3NVZA

Crystal structure of bovine xanthine oxidase in complex with indole-3-aldehyde
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvzA01
4JWSC 3AECB 2PVOD 1QOAA 3AE5B 4N59A 1GPXA 3AMZA 1SF0A 3DWMA 4FXCA 1WXQA 2ACZB 3CIRB 1NEKB 3AE7B 2WDQB 3AEGB 2W54A 1N62A 4USAA 3ZYYX 4YXDB 2WLBA 3AE3B 3VRBB 2BT6A 4KX6B 5G5GA 1FFUA 3EUB2 1FRRA 2BS4B 4WWMA 2W3RA 1PUTA 3NVZA 1OFFA 3AE9B 1F0ZA 1CJEA 5H8YE 1RFKA 1XLPA 2B76B 1KFYB 1TYGB 1TKYA 3NVYA 1XO3A 4YT0B 2PIAA 2H88B 1I7HA 1EWYC 2OHFA 4WQMA 1CZPA 1NYQA 2JQRB 1WGKA 4N58A 3HUIA 2AX5A 1XLNA 3AV8A 3VR8B 2K22A 1L6VA 1NI3A 4C7ZA 3L4PA 1J7CA 3SFEB 1DOIA 2CJOA 4ITKA 2W55A 1QT9A 4P6VF 4US8A 2WU2B 1N63A 1XLQA 1XLOA 2PVGC 1RYJA 1YJJA 3AB5A 5EE9A 1JALA 3KWLA 3P4SB 1RM6C 1J7BA 1JWAD 4YTMB 1KF6B 1N5XA 2MH7A 1JROA 4JWUC 5AUKA 1ZUD2 2QIEB 2M19A 1FFVA 3NS1A 2CJNA 2MJEA 1DOYA 1QF6A 3ABVB 1WWTA 1VDVA 2M56B 3AE8B 2FBWB 2EKIA 2BS3B 2QJLA 4US9A 3AEBB 1V97A 5MPOA 5EE1A 3AM9A 1GAQB 2KMMA 1QOFA 3W5VB 3ETRA 1KRHA 1J7AA 1V8CA 1YJIA 1A70A 1OQRA 3SFDB 1R7SA 3AEDB 1L0VB 1TKEA 1E0ZA 3WCQA 4YSYB 3SR6A 1L6UA 1NVID 1JRPA 4IDIA 1E10A 1DOXA 1IUEA 3HRDD 1FMAD 3AN1A 2KAJA 3AH7A 1FM0D 1E7PB 2Y5CA 5C2TB 2WP9B 2L83A 1YQ3B 3AEEB 3P4QB 4HRSA 1ROEA 2CU3A 1B9RA 3LXFA 3RPFC 1L5PA 4ZHOA 2LEKA 1N60A 1OQQA 3BIID 3CWIA 2E3TA 1WYGA 2PKOA 4JX1C 2Q5WD 4C80A 2JX5A 1ZP0B 1FO4A 3AEFB 2W3SA 3B2FA 1PFDA 3NRZA 1FXAA 2WU5B 3AE2B 1AYFA 1FRDA 3AE1B 3B2GA 1UWMA 2L52A 4LTUA 1N5WA 5C3JB 1FIQA 3DWGC 4N6EB 3AEAB 5H92C 1WRIA 1NENB 2MJDA 2G1EA 3AE6B 3VRAB 4YTNB 2K5PA 1YQ4B 3HVZA 5EE3A 1N61A 2K9XA 1VLBA 5EE0A 2H89B 1E9MA 5G5HA 3B9JA 4HROA 3NVVA 3VR9B 1RWSA 4ZOHC 1QLBB 1JW9D 1DGJA 2WDRB 1T3QA 1E6EB 2BS2B 2DBYA 1TJEA 1SB3C 2WQYB 3AE4B 5AUIA 3NVWA 4YTPB 2WS3B 4YSZB 2WDVB 3P4PB 1FXIA 1SIJA 1TKGA 1QOBA 3P1MA 2DWQA 4C7YA 4A9AA 2MJ3A 1JQ4A 2N0SB 3W9CB 1PDXA 3P63A 1QOGA 3P4RB 3W5UB 1NYRA 5GXGB 4YSXB 3LB8C 1JWBD 2HTME 4ZHPA 1VJKA 1ZXIA 1AWDA 1ZOYB 3PO0A 3FC4A 3FAHA
chains in the Genus database with same CATH superfamily
5AIAA 4REZA 2JZBB 5EWGA 3ZIMA 4R66A 2WF7A 3AMZA 3MFIA 1I4PA 1WSPA 3EECA 1JMLA 1TZOA 4YXDB 4DLEA 1ISNA 2L05A 2WXHA 4KX6B 3RT3B 2BS4B 2KZ3A 4K1RB 4TURA 4R63A 3SZ2A 2DAJA 3WAOA 1RAXA 4LJOB 5TSSA 3TEWA 3LWMA 2KLGA 1T3NA 4PHAA 2PIAA 4O3PA 3WIMA 8ICUA 1ZXHA 4C56C 3PW4A 4KSKC 4UAUA 4DHZB 5CA7A 2NRVA 2L32A 2OEHA 1V6EA 3MFGA 4C8KA 4KLGA 4QWDA 1TY0A 4ITKA 1XF5L 4DCCA 4O0IA 3LWLA 4K4HA 5ALHA 3KHRA 3OAWA 1FXTB 2EAOA 2L0TA 3IV6A 3HT3A 4YTMB 4XDCA 4K3BA 1EM7A 1GG3A 2NBWB 4KLOA 4A55A 3C29A 3WKEA 1DOYA 4XYCA 3KUDB 1SE2A 4CHKA 4JWMA 5ALUA 4C4VA 2BYTA 2QJLA 2HOQA 5ALYA 4AYBF 5DQHA 1V38A 4U6PA 3UQ2A 4RQ4A 3UQAA 3N7PD 5AKJA 2FPKA 3H8MA 5AKXA 1J7AA 1C3TA 1ZQNA 4Q8FA 2EAPA 3AU2A 1TKEA 3ALRA 4UB8U 2Y0SF 1MPEA 1LM8B 2XCAA 2BBCA 4O5CA 2ZTCA 5C2TB 4DQIA 2KHVA 3QX7A 2WF9A 1DK2A 2IO3B 4PH5A 1TT5B 3E9SA 2WXLA 2M0XA 4XUSA 2G08A 2OXOA 2DKXA 1KEJA 1U45A 1D8BA 5E6PA 2VRRB 3HM6X 2INCC 4IM3A 2KX3A 3AEFB 4ZRIA 1DGSA 1PFDA 2G45B 5JTIA 3R2IA 4PS8A 4ZYNA 3AE1B 4O5EA 2IOFK 1TTNA 4P4OA 1I4GA 4Y2QA 1I4RA 3RBDA 3QK0A 3RFZB 1X6JA 2DX5B 2L8JA 1N61A 1KLVA 1M94A 1YN5A 4F91B 1TIFA 3ZRCA 4HCNB 3OTQA 5L95C 5J2KA 3B9JA 1RYSA 4HROA 3NVVA 1HTOA 4YXMA 1HIWA 1BPBA 3PT2B 3K75D 3PRPB 2D5GA 2AQ1B 3UIPB 4JV1A 3AEVA 1NJZA 5IOIA 1SIJA 1TKGA 5ALPA 4DFKA 3W9CB 3CYMA 4F4WA 3JPQA 3SV3A 2KD1A 2R8KA 1NYRA 2DFLA 4ECSA 2RQ5A 3AXCA 2VH1A 3GP7A 2KTQA 2FLPA 4IM0A 3FAHA 2GMIC 4N59A 2FUG1 4DHJB 4WJQA 1NK7A 3MR2A 4RF1A 5IIMA 2MBHA 3IHPC 2AWTA 2BCUA 4GDKA 1T0SC 2YEPF 3R2TA 1PK3A 5IAAC 3RNGC 3S2AA 4BZAA 4ZDVA 3WKBA 4W9CA 5KFGA 4HKZE 2OOBB 5HHDG 2ZW0A 5AM2A 1F0ZA 3KFUF 1CJEA 2MU2A 3Q8EA 3BK1A 4XE0A 3Q8PB 4DL6A 2FUHB 2H88B 1WJ4A 2REXA 4C8MA 5KFDA 3OJ4B 5JXVA 2HSZA 2C2RA 1K8RB 4BAXA 1WM3A 7ICPA 3UI3A 1KTKA 2F3NA 1UA0A 1HE8A 3QU9A 2ES6A 2BCRA 2PVGC 4K7WA 1C4AA 3N1ZC 1EXNA 2KC1A 1JALA 2XO7A 1ZQVA 1TS5A 2FMPA 3J9CA 1KF6B 4FN2A 2ASDA 4P2HA 3TCAA 4FHKA 1LKYA 2H3IA 4Q8EA 2KWVB 2PTLA 5J0PA 3ICXA 2LJ5A 1L7OA 3PNCA 3BYYB 4A8EA 4YCXA 2D3GA 5CTRC 4JL9A 2AGOA 3BQ2A 2VA2A 4FFDA 3DQVA 4F4XA 3DVGX 4JQWC 2JGAA 2INDC 3WCQA 3FDSA 4DQOC 4J9NA 1UF0A 4ZYSA 2ESEA 2GOLA 3AN1A 5AKGA 3RNBC 4YD1A 1OQYA 1IPGA 1IIPA 1OEYJ 4YL8A 2A4ZA 1O03A 2B0CA 2HHVA 3RZWC 4KLHA 1X9WA 2G5HB 1L8OA 4RUCA 2LWPA 2N7JA 1ET6A 5JH5C 3TEZA 1WYGA 4OVVA 4EUTA 2LVQA 3RAXA 2LGYA 1GB4A 8ICPA 5IA7A 1FXAA 4O3SA 3Q8LA 1FRDA 4RNMA 1S8OA 1N5WA 3GIMA 1Q1OA 1CQVA 1S1QB 3R7RA 2XIDA 5J2GA 4J6IA 1HUZA 1A5RA 4CO7A 5J2IA 2YQEA 5BPCA 4J9MA 2DYBA 2WXRA 1RWSA 3NY5A 2W7PA 1JW9D 4WWNA 3N7RC 4MEXA 2KVCA 1F9JA 1SGGA 3A1QA 5AUIA 4KMOB 2MRLA 8ICAA 2C5LC 2D6FC 2H3QA 2J53A 2BDPA 3RH6A 3KHLA 2DQNB 2WGSA 2YB1A 4FS1A 1Y88A 2IGDA 4BKGA 2F1HA 2QMTA 3DEEA 3KUCB 2ZJAA 3M62B 3T3FA 3DBHB 2PI5A 3P42A 3RNAC 2HTME 1JUDA 1VJKA 2G4SA 3PO0A 4FULA 3VH3B 2PVOD 5A0LA 2G06A 1S0OA 4L2YA 4OZBA 3PSEB 2JZPA 2YB4A 2I38A 4GU2A 1WE7A 7ICHA 5AKZA 4ED1A 1WZ3A 1YJ1A 4RGOS 2L1AA 2J42A 3VXWA 2LD9A 4OJ6A 2EQYA 5F9LA 5KFAA 4AOFA 3ORYA 4QZ8A 4HDOA 1WGKA 5CHFA 1XLNA 3QARA 1L6VA 2O2VA 1XSNA 2WYQA 3APFA 1WYWB 3NASA 4BGDA 4OO1J 4QWBA 1FNVA 4RNAA 4RFBA 1XLOA 4CDGA 4ECTA 4BVUC 2AU0A 2JEGA 4JV0A 3TADA 2YN4A 3A9KB 5FK9C 1ZDXA 3UIOB 4YMNA 5DPSA 2G0AA 2MW5A 3ML9A 3I76A 3L08A 1WF9A 4ASWC 5EE1A 3UMBA 4RGNA 1D4BA 3PSFA 2AQ0A 4YWGG 4RQ7A 3N32A 3B0YA 3DPDA 4IS7A 1UZXB 4DK5A 2V4IB 2W82A 4UAVA 3RI7C 4GDLA 5KT4A 1E10A 5HNKA 1NK9A 2NO5A 1U48A 4P1CC 4B9UA 1SE4A 3EC8A 1ED1A 2E1EA 4NQKE 1EWCA 5D3IB 4C4SA 2W8KA 2C2DA 7ICQA 1PGAA 5L1KA 1J19A 2BPGA 1NJYA 2PKOA 4WJPA 1KJTA 3ZLZA 2N7DA 3QWZB 3C1ZA 2W8LA 3NRZA 2Z59B 4B9MA 2JH1A 4KGSA 5FR6A 4U7CA 8ICXA 4KX3A 2BPFA 3NHEB 5BMGA 2I5HA 3O65B 1MHXA 4RM9A 3PR4A 2K9XA 4KLUA 1KLNA 4LNIA 2E8OA 5ALQA 5GTHU 1VR9A 2JMGA 1FEZA 3BVMA 3MC9A 3VR9B 1TVAA 1K5OA 4RQ2A 2K3UA 5L1IA 3Q8FA 2KT7A 3L3FX 1JWMD 3IVFA 2DYMA 9ICBA 1T0YA 5J0QA 3C5GA 1ZPSA 2E6XA 4ECYA 2DWQA 3J81j 2LKYA 1WJ6A 1ZQAA 3IT6B 4QZIA 5DBBA 2K4HA 3L5KA 3H6NA 4O3RA 1JXLA 1PQSA 3LB8C 4UDUC 1UUPA 1LXDA 5J0YA 2JZBA 2KDFB 5HI1A 3AECB 2W43A 4GIVA 2L0FA 1F2RI 1WY8A 2WDQB 2JSVX 3GOEA 3BS5B 3VRBB 2OM6A 4I2HA 3GIKA 4M01A 3E58A 3PSPA 4O1NA 1QLNA 1D3ZA 3KTQA 2FCQA 4AWJA 1COKA 3TACB 1SKWA 1KFYB 5GTIU 2X38A 3DHHC 5DCNA 1DK3A 1XO3A 2FPLA 1NKBA 1PGXA 3K4GA 4KZ0A 2OHFA 4O3QA 3JYUA 4XX5A 4EEWA 2V3SA 4KSLC 2V9HA 4LDTD 2RDBC 3SV4A 1OXJA 1DOIA 1Y8RC 1QT9A 4AP9A 1WCNA 1UHUA 4OVZA 1E8ZA 9ICQA 2E8NA 4XWWA 4K3CA 2RDGA 1Z1VA 3KWLA 3ZXVA 1N5XA 3SQIA 2KNBA 2BQQA 5KG4A 4NAMA 1FFVA 3NS1A 2KKVA 1WX8A 4W9HA 3MJ5A 3W1SC 4KVGB 1K50A 1MHHE 1WWTA 4BXOB 4OCZA 3TARA 1MG4A 2CS4A 1BUIC 3BS7A 2N1VA 3M3JA 3SHQA 2LMRA 4X5VA 5D6JB 3TUOA 3FKYA 4IQWA 4RGMA 3U26A 4DL3A 2IGGA 4WURA 4IDIA 3WKAA 4Z6FA 4IG7B 2ASJA 4FZNA 2BYEA 3RYTA 1YOVB 4G11A 4KLMA 3KQ4A 4EZJA 5D46A 4AYBC 2HBMA 4YR3A 4EELA 2CN1A 3KWVA 2WF8A 2E3TA 4Y2UA 4MFAA 5F3XB 2JX5A 9ICCA 1FD6A 5D49A 3I57A 2GO7A 1CK1A 2JYEA 2KN7A 1TK0A 2RGFA 2Y0SC 4DSKA 2LYAA 3V6KA 5CB1A 2QB0B 2EMSA 5G2NA 4NQLB 2ZVOA 3MR6A 1ZQLA 5J0SA 2J0MA 5J2HA 3RAQA 5D3DA 2JR5A 1XSPA 4I6NB 3RTVA 4FJZA 3Q8RB 4E71A 5KAFU 4KN7A 2I1QA 5KTQA 4KLQA 2N4FA 4L1BA 2FMSA 9ICAA 1Z1BA 2H3ZA 2AJQA 3AE4B 3V7KA 1J0GA 4C4TA 4R64A 4DSFA 1GUAB 3N3KB 1KSPA 2LPEA 1QOBA 4OZCA 4A9AA 1ZQRA 5KT7A 4KDLB 1T4GA 2W04A 3QEBZ 3Q8QB 2FIDA 2BYVE 1HZ5A 4MEYA 2NRWA 4JWSC 5CP2A 2K0PA 3TQ1A 2AXTU 3T5HA 1TK8A 4IRKA 1WXQA 3LK9A 5IP4D 1SBBB 3CMMB 2HOIA 4NJ7A 1GB1A 3W2DA 4KV2A 4HYKA 4UQGA 3JVZX 5KFSA 2KMDA 3RJHA 4J9QA 1UGJA 1A77A 4DOCA 3JSVB 5TISU 3UF8A 3NUQA 1WFYA 1TE2A 2V0GA 3GE8C 4K4IA 3LYSA 5ALDA 5G55A 4OHJA 3MDAA 1QILA 3RRGA 3H9DA 2BTEA 5AHXA 2K1FA 2VJ4A 3Q6BA 2FI1A 4C7ZA 3TEYA 1K1SA 3VUWA 4CRXA 5BOMA 1WWVA 2K6DB 4MGKE 3V6HA 1P7DA 3PZ7A 4GB9A 2LXCA 3W1YA 3QUQA 3AU6A 5BYQA 2KFKB 4CF4A 2CU1A 2DZJA 1KFTA 4RQ8A 4N9F4 1QTMA 5B66U 2HW3A 2M19A 3PZ8A 4Q45A 4DL4A 1KH0A 4RPZA 3BWUD 1ZQQA 3ABVB 2M56B 2M9NA 3KW5B 5AKYA 3RCZA 2N9PC 2PPHA 5DPRA 5J0TA 3RULA 9ICIA 4NNJB 3MC0B 2KJ8A 4A6QA 1KFDA 1F5SA 1ZOLA 2IBIB 1NK5A 3GZNB 2OWOA 3B08A 1TAUA 2RR9A 3H1UA 8ICHA 2KNJA 1TAMA 2YX8A 3MP9A 4F2SA 3TIXA 2ISOA 3IHQB 5J8YA 4R3DA 4BOSC 3SR6A 2BPCA 3JPRA 1T94A 1L3SA 9ICKA 5J0RA 3K9PB 1SKRA 4FJVB 3NGDA 1OEYA 2LVPA 1NI2A 3FYHA 3PSIA 5AM0A 1B9RA 9ICWA 1E90A 3NTUA 4F7ZA 4FA6A 2WF6A 4KGRA 2AGPA 4C80A 1U49A 4WAAA 1HQRD 5E6JA 2CHXA 1ZQJA 4QWAA 3A4RA 4KDIC 3MR3A 4I2BA 2D10A 3ZNHB 4YTNB 5CJ7A 3HK0A 3PVXA 3PLUA 3VAWA 1BNOA 4P16A 4WIPA 5BYRA 8ICOA 4F1SA 4RQ0A 1BPZA 1ZQFA 2V4QA 3TL5A 3SAFA 5HR7A 2DKZA 4GC7A 1D5XC 2EH9A 3R8BA 8ICFA 4DHZE 3ZKJC 3V7LA 4F71A 4GXIA 1TJEA 1L2NA 1ZQDA 2WQYB 3FILB 4CGZA 4P0PB 9ICHA 4YSZB 5HKHA 1ZQKA 3I63C 2W9MA 4G0NB 2YMPA 3SAHA 3P1MA 4QJFB 4C7YA 3PV1A 2N1RA 5KFXA 1PDXA 2MP2B 5LXHA 3PZPA 4F92B 2FE9A 3AU4A 1JWBD 1MQ2A 4NPNA 3TI0A 4YSXB 4DBGA 2N9LA 4P0QB 4I2EA 1CRXA 4I2AA 3T8MA 3CP8A 3QUCA 4PGXA 1KW4A 4J9KA 2KQ7A 2RPQA 2IJ0A 3C8YA 4HLEA 4J03A 4B9LA 3QNMA 2LRWA 1Q0WB 4Q2JA 3EUB2 1SGHA 1UBQA 2MA9B 4HXDA 3NVZA 1JN3A 1ZD5A 3BVGA 3ZDDA 1MN8A 3MR5A 3T79A 9ICPA 5AZGA 5KFLA 3D2QA 2FCSA 5ALJA 2ZZPB 1SXDA 4ACOA 2R8JA 4LDTB 1N48A 4NV0A 3PW7A 5FKAC 3HUIA 3VUYA 3VR8B 2O6VD 2ASLA 1H4RA 4W9DA 2V4RA 1IG6A 2W55A 4LK0M 1SWVA 4DSIA 2F77X 1Z4NA 3AUOA 4JB3A 5DLGA 3OPXA 4ECXA 2C28A 2KO3A 5JRTA 2BQUA 4EZ9A 1YJJA 3AB5A 4F5PA 2RSUA 2CXYA 1YIWA 4QNLA 4C8OA 3A9KA 3ZDBA 1E5WA 5KFWA 3B0XA 4KKIA 1XNSA 1XO1A 2PMZF 1ZE3D 2NBUA 4XWTA 4OJOA 2BCSA 4EEKA 2DGZA 1FEHA 2E1FA 3IAM1 5LLIA 4RPXA 2FLLA 2RRDA 3ZDAA 1WUDA 2JYTA 1ZQUA 3GIIA 2C7NB 3LDZE 4K7SA 3B1LX 2OH2A 4EZ6A 3QUTA 2CRXA 1Z00B 1URJA 4MH8A 2DPJA 4DQSA 4BDPA 3C28A 2KAJA 4O3MA 4GXBA 2MAXA 1T7PA 3RZFA 4YN4A 5EWFA 4DQRA 3WK7A 2IO1B 4EZKA 1HA5A 2WXKA 4DOAA 2KX0A 2ON8A 1ZQTA 4CQNA 2ZW1A 4UBBA 3PPAA 3N1YC 3E56A 4KGTA 1WX9A 2Q5WD 3ZRFA 2HHSA 2WHEA 3UMCA 2K39A 3APDA 3TAPA 1ACCA 2R2OA 1KTQA 1AN8A 5AI8A 2M1MA 3QC8B 2K4IA 4HDQA 2QCZA 4PYZA 2WXOA 4WAFA 5DB8A 2KDBA 4HWIB 3M9OB 4DFPA 4IOIE 4DS4A 3Q8MA 2K5PA 3TSSA 2VKQA 1XXGA 1RDFA 2KDEB 4UB1A 2H89B 2R61A 4HPLB 4A20A 1ZQWA 2FPMA 1I4HA 1NJXA 3EYZA 3OLMD 1NK8A 5LXIB 4EENA 4Y2RA 4ZRJA 4DXFA 2C22A 1S0MA 3L13A 5L1LA 1BGXT 2PE9A 7ICRA 2YMLA 1IXRA 2K25A 4B6JA 2KIVA 2JZZA 3BY4B 3P63A 3I1YA 9ICLA 1X9MA 3RFAA 1ZOYB 1IBXB 5J0UA 3GV7B 3F5AA 4E0DA 3N30A 1QOAA 1NK0A 2LGIA 1NOMA 2HVHA 3DWMA 3IBEA 2CPRA 3ZYYX 3BS5A 4O3NA 5DG7A 3BZCA 5IN7A 3M9MB 2N7EA 3EPIA 4NL9C 3RJJA 3HP6A 2W9NA 1ZDVA 4FADA 1BNPA 1PUTA 1XC9A 4KLLA 3AE9B 4B0MA 1ZJNA 4IQUA 2Q4TA 3KUZA 4ICVA 4PZOA 4KITB 2I2YA 4J9RA 4ZRKA 1XSLA 2R8IA 4DQQA 2BHNA 1Z19A 1JXEA 3HKZF 1P1AA 2BPSA 1N63A 1WR1A 3GV5B 5ALEA 2LASA 2PKEA 2LBOA 2ASQA 4JK1A 3WA0A 4PGQA 2KZMA 5KFVA 4GC6A 2GBJA 2M4NA 2M17A 5AI6A 2NCNA 2WX1A 3THVA 4Q43A 4BXOA 3DBHI 1TS2A 3AE8B 3ISDA 4QZFA 2DPIA 2KQ4X 3QU5A 2KFNA 2KMMA 1QOFA 3QXGA 4F93B 4GLXA 1Q10A 3SFDB 5EDSA 1B4FA 4BUGA 3C2MA 1L0VB 2GRIA 5IO9A 3HIZA 3VH4B 3UXPA 1NVID 2L76A 2MWSB 3GE3C 5DGAA 5C23A 3HRDD 2BZFA 2BF8B 3FM9A 3DVNU 4DFDA 4IWOA 1F0MA 3NRWA 3OGUA 1WJNA 5DQIA 4CCHA 3WK9A 3C0RB 4HRSA 2A1JB 4UB4A 2BGWA 1OGWA 1QZEA 2CU3A 4HEA1 2PEAA 2D8CA 1F44A 3BQ1A 4ZHOA 3ZJTA 1SE3A 2JWZA 4W9LA 1NDDA 3KYDD 3NG0A 1F52A 1TS4A 2JUOA 4TKNA 4XC2A 1CMXB 2R2QA 4K81A 1PVPA 2D2QA 3QCAA 3SYZA 4DF8A 3ISCA 3HM3A 3ZDTA 4LTUA 1P98A 1UWMA 5C3JB 2QB0A 3NUHB 2DZIA 1WCLA 2Q0ZX 1A76A 5BOLA 4MSQB 4JGHB 2O6KA 1STEA 2P6UA 5D2MB 4YD2A 3KOOA 5G5HA 2BCQA 2QEJC 3VTVA 8ICRA 2GBMA 4DXAB 1E6EB 3U7DA 5BYSA 5J2FA 4QZDA 5AKKA 4PHPA 1ET9A 3VTWA 4KLTA 2A19A 3K1ZA 3M9NB 4B9TA 4OJ5A 5T14A 2WDVB 3P4PB 2INNE 1V85A 1WXAA 4EYIB 3RN9C 1YX6B 3PVLA 4AJWA 4QW9A 3RNCC 4NY0A 4WJNA 4O9MA 1QOGA 3ETLA 1NKCA 2YLMA 2I1KA 2G3QB 2IGHA 2PE6B 1ZXIA 2IA6A 4E3CA 2QB1A 4TUSA 3BJYA 1MSWD 4MSMB 1U47A 1FNUA 2HBKA 2J6SA 1TV9A 4DSJA 1NEKB 3AE7B 1U4BA 2ZPNA 4LZDA 2WLBA 4MELA 4JE3B 2XK5B 3JSVA 1PK1B 2KEYA 4RNNA 4RQMA 3SEBA 4NAWB 4LNKA 2LM4A 5ALZA 3D32A 1SZHA 5AKHA 7ICIA 3TANA 3JPSA 1TYGB 2JEJA 4NZLB 4GXKA 3PLVA 4WQMA 2AQ3B 2O6VB 2Z7JA 1JRUA 2MBOA 2EKEC 2W9CB 2ATLA 1NNLA 5ALSA 1Z4OA 5KT2A 3PX4A 2BKFA 1TZ1A 1PYWD 2KVZA 3L54A 2JWUA 1JWSD 1RQNA 3H0RB 4M02A 3T3NA 2KFKA 3AI5A 3H7IA 5DG8A 4RGTA 4JIOU 1MQ3A 1WH3A 3ECIA 1WE6A 4M6WB 9ICVA 3V6CB 4ED8A 4DXGA 3PW0A 4GXJA 4Z6DA 1D5ZC 1TKDA 1TY2A 5KL8B 5L1MA 2BW2A 4CE6A 2EKIA 3APCA 2BS3B 2K8HA 2LHDA 9ICXA 3HW8A 5HG2A 2K4PA 2WXIA 1UWXA 5AICA 2ALZA 2F1IA 4R8UB 2P35A 4DOBA 1UCVA 3WK5A 5J0WA 5JZEB 4O3OA 3GV8B 3DBRB 2TSSA 2JF5A 4RPYA 3MDCA 3PV8A 1E0ZA 2K60A 2F8KA 4I29A 1B22A 1DOXA 2K8BB 2IBKA 4QW8A 3PMNA 2WAQF 2XEWA 3C23A 1P7EA 1OTRB 4MACA 3HVDA 1GO3F 5KFUA 2IO2B 2RP5A 4PL1A 2ZIWB 4IRDA 4RU9A 4F3OA 3RPFC 1V2YA 4EBDA 2GH1A 4YG2A 1NJWA 4M9HA 1OQQA 4XA5A 2WDTB 4QAYA 4BFRA 2WXQA 1WGYA 1ZP0B 3AULA 2DHZA 1MFWA 2INPE 1D9FA 4FLHA 1SV0A 4KLSA 1SWWA 2QHOA 2OJRA 5FP0A 2LFIA 3IP4B 1PVQA 3Q69A 2J6TA 4KMUA 3HVZA 2ZJ5A 2WB1F 4FZLA 1KL9A 5BMHA 5I4DA 1ZRMA 2WXFA 5KG2A 2ZNVC 1C4CA 4LJPB 1VZ7A 2F2AB 2RLTA 2WDRB 2FNJB 4LNOA 3VC8A 1L4ZB 4YR0A 3FILA 4CF5A 4F50A 4P0PA 1TFRA 3NVWA 4YTPB 2J7QB 1RZTA 1C78A 3EZ5A 4OJPA 3BZKA 2MJ3A 2MP2A 4P1BC 1ZD3A 2MCNB 2HHXA 4A8XC 4EFOA 3IG8A 4F2RA 1WJUA 4I28A 2UYZB 4P0QA 2KHWB 1AWDA 3V6EB 1N6ZA 4M04A 3PGEA 1CI4A 4YP3A 5CHVC 1I42A 9ICMA 3HHMA 1JX4A 2C7HA 4MM3B 3WAPA 2D3BA 1P3QU 4I27A 2DUYA 4B9NA 1RYUA 1IV8A 2GWSA 1OFFA 2QLTA 2C2EA 3ZGZA 2B76B 5ALIA 1HJPA 3PZDA 3QQ8B 3VDZA 3I5JC 1WI0A 4YT0B 5KFHA 4QWEA 1EWYC 2EELA 2ZPYA 4BKSD 2J0JA 2VIXA 2Z0DB 1YN3A 1D9DA 4N58A 2NBVB 1V86A 5J2EA 4ECQA 2NPTB 4EX7A 2VJ5A 4IM2A 5DBAA 3NS8A 5ALLA 1ZQPA 3C2KA 1QCKA 2NRTA 2XY6A 1UA1A 2E8PA 2V9WA 4C8LA 5AM4A 2AYOB 2NVUI 2G5IB 3A33B 3EA6A 4JWUC 8ICGA 2MH7A 1NBFC 2HBLA 4A3PA 1VDVA 3V3XA 2ZUDA 3GU3A 9ICEA 3DBLB 4BBNF 4JPSA 4D2KA 4PHEA 4S17A 4R65A 5DDYA 5DB9A 1WG8A 2F8LA 7ICGA 3VFKA 2LI6A 1L3UA 1BPDA 3KHHA 3PO5A 3H40A 4HVBA 3M8RA 3BYTB 5KT6A 3KYCD 4NLZA 3WANA 3VVWB 3KBBA 2EDUA 1Z00A 1YT3A 3ZNZB 2V3NA 1F2RC 1KFSA 2XBBC 2MBEA 2PMZC 2KANA 5AKEA 4DSLA 2QC8A 3AEEB 3KHGA 1ZKHA 3GFKB 5AM3A 3H4BA 4MF8A 2PXIA 2Y5PA 5KFZA 1N2XA 4EYHB 3TMPB 2Y1IA 5AI9A 2ZCCA 5D7GA 2NRXA 2GB1A 5AKIA 4PS7A 2YMQA 1S9FA 3RR7A 4TQ0A 5KFOA 1VD2A 3RBEA 1NENB 8ICBA 4QZEA 2YVCA 3SMVA 2DENB 3OJ3A 3OJSA 1L6NA 3OWEB 2CKHB 3GILA 1QLBB 3DDCB 4A3OA 2LUEA 5HMMA 4QZCA 1EU4A 1R4NB 4HJKA 3QUBA 1E8XA 2KZZA 2I6XA 3GZNI 4DSEA 2HDEA 3DV9A 2XY7A 3DBSA 3NJTA 4C8NA 3H7SA 2EZZA 1MVKA 4TSSA 1AQ6A 3VHTC 2KV2A 3P4RB 4ZHPA 4EKUA 1HEZE 1IBXA 3R7QA 3UMGA 4UB5A 4GGQA 5L1JA 1X9SA 3LVWA 5KFTA 3RR8A 4JV2A 3N9YC 4WWPA 3ZVVA 2D11A 4MEMA 1PZNA 1EU3A 4J9SA 2HMXA 3AE3B 5E79U 4KLFA 4FZMA 2NS5A 4NJ6A 5L83A 2W3RA 4W9JA 4F8CB 2BQ3A 2K89A 1EF1A 2IO0B 2L00B 2AHOB 4OVUA 2KVRA 4I2GA 2OCEA 3A9JB 1TKYA 3VQIA 5L9XA 1HEKA 3RJFA 5J2DA 2NRZA 4M9JA 2K22A 2PFQA 1S97A 3T3OA 2JY6A 1J2MA 2WF5A 3GS2A 4DWIA 2R18A 3TADC 1ZQEA 1YNTE 2WTFA 1ZYQA 5HP4A 3V6JA 4DDID 3PTFC 5GMVA 3CSFA 1FPYA 1ZUD2 3K9OB 5KFBA 1WIAA 2CJNA 2MJEA 1IYFA 4B9SA 2PLPA 4QZAA 4QZBA 5IILA 3MJWA 4MHVA 4OZAA 3HKZC 3ZNGC 3ZI4A 3UXOA 2ZXIA 1SL2A 4FHJA 4LLGM 5AI5A 3TBLD 3I28A 5DB7A 4DLGA 1A70A 2ZEQA 3SAGA 3K1RB 3EFUA 2DLBA 3QAQA 4ELVA 1ENFA 3AQFA 2HHQA 4P4PA 2D3AA 4M8NA 4MFCA 2IY1B 3DVGY 4GLSC 3ZO5B 3RH5A 1XWLA 3AH7A 3VCBA 1XO0A 3D6JA 2MQJA 2V1YA 2WX0A 4JLCA 2A1JA 2Y9TA 3GZFA 3P4QB 1ROEA 2FJ6A 1UELA 2BCVA 3LXFA 2LUMA 2E8MA 1KKXA 4HCPB 3V05A 2HHTA 2W7OA 1EO6A 3OG5A 3CWIA 4TQ1A 1QQ5A 3MC1A 4F4YA 3DDHA 4HPPA 2W3SA 5E6NA 3HILA 5DLFA 2P6RA 2XCPA 1Z3EB 9ICGA 4IQVA 2L52A 3IDWA 4PPXA 5J17A 1FIQA 2MJDA 3AE6B 2G1EA 1WMHB 5EE3A 8ICJA 4P7IA 3BZDB 3N28A 1XCTL 5TZVA 2KIWA 3C1YA 4XZ4A 2QILA 1SEBD 4NM2A 1DGJA 1B0XA 7ICMA 2WFAA 2DBYA 3DHGC 1SB3C 2KC2A 3PRZA 2ZCBA 3PHXB 3NZUA 1K1QA 2AQ2B 4BOZB 3RD2A 5ALNA 1FCCC 2DZMA 4X57B 2KHQA 3N20C 3PMLA 2H3VA 2WHIA 1GOZA 2ONQA 3ML8A 1IM4A 2GLEA 3RF9A 2XGQA 4II2B 5E6OA 4W9GA 3UQBA 1V1PB 3ZD9A 3UPQA 1GPXA 2KN5A 4MJSB 1Q5WB 2FDRA 4RUAA 3CIRB 2RD0A 1Y56A 1ZQCA 3AEGB 2W54A 2KD0A 4ARIA 5DB6A 2XK5A 3UXNA 1T0RC 1PK1A 3DOWA 4Z6CA 4NAWA 1YQBA 4B0EA 4MT5A 3H7PB 5ALFA 1MI0A 4AQ7A 4NJ8A 4C0ZA 4F4ZA 2ZIVB 4EEYA 5H8YE 5KG1A 1NZBA 4IWPA 4YMOA 2XI9A 1BVSA 4HAIA 2L5YA 3OHAA 2O6VA 4GSWA 4DL5A 2W9CA 2KKPA 5J18A 3CRXA 2KTRB 2BKRB 4DF4A 1Q46A 3MABA 1EF5A 2CJOA 4CF3A 4IUMB 5KG0A 4US8A 3GDXA 2MUTB 1XLQA 2ZJ8A 4PJ0U 3M7DA 1PUZA 2LHTA 3S6JA 4M6WA 3WU2U 2GI9A 2HTHA 1WGDA 5KFYA 5HR6A 2YEPB 2AEHA 5ALOA 8ICTA 1KDHA 4HPMB 4ZRQA 2L3ZA 3IM1A 1QSYA 2RDHA 2JHDA 3QU7A 1JWUD 1V97A 4M9GA 3AM9A 1GAQB 4R8UA 2HHUA 2Z0EB 5KFEA 3MTNB 3RJIA 1MC8A 5J2BA 4URKA 4NLNA 3AEDB 4KLIA 8ICZA 4NWIA 4J3OD 4YSYB 8ICEA 2K8BA 2YMMA 4KLEA 5AM1A 1QSSA 2ZIXB 1T6BX 2M8SA 2JU6X 3O0FA 2HI0A 4YR2A 2KXJA 2Y5CA 2ZIWA 2UU7A 3X0WA 8ICMA 3T5KA 1YD8U 1C77A 3BK2A 4FS2A 2JRZA 4NM1A 2KSOB 1UH6A 3QIJA 2KJ5A 2PFPA 7ICTA 1L5PA 3GQCA 2JT4B 1X9XA 3VTUA 2ZVNA 1ZQBA 4OW0A 3PW2A 3O13A 3QA8A 1GC6A 4ECZA 1J2NA 2GBNA 2LZ6A 1ZQMA 4DO9A 3AE2B 3M95A 2D3CA 3ZD8A 5EWEA 2VA3A 2AGQA 2VZKD 3DWGC 2WAQC 4F4KA 3U7ZA 3EGRA 5H92C 1BPYA 4KLJA 2BYFA 2UVUA 1AARA 1HZ6A 1P7FA 2ZUBA 5IINA 2J52A 2KK0A 3A0HU 1Q8KA 1K52A 1ZD2P 1V1OA 2B3AA 3ZTDA 9ICJA 1PVRA 1KBUA 4DL2A 1RG6A 1U9LA 1I4XA 2FE8A 5IIOA 1GJZA 2K4EA 3IN5A 4FE3A 2W9BB 4DS5A 2B6GA 4FBUA 3MC8A 3UINB 2KMAA 4AJYB 1JMSA 2WB1C 1KRPA 3M8SA 5KT3A 3LVVA 1ZQ1C 1KLUD 1YZ6A 3Q3MC 1SF0A 3PX6A 3Q2AC 2ACZB 2IZVB 1MJDA 4MM3A 4HKQA 1N62A 1V9JA 4RT3A 4EZLA 4PL2A 4UB3A 2EAMA 4QZ9A 2M0NA 1E7UA 2JRIB 2WXPA 2KJ9A 3M6KA 5KNIA 1E7VA 4TUUA 3JPTA 2BDUA 3F53A 4J9PA 9ICNA 1TGZB 3QYPA 1T0QC 4S0RA 3RJEA 2KACA 3C19A 3ZUNA 4FBJB 4YFKA 4YQWA 1L4DB 1RFAA 2BR0A 3ONSA 1LO5D 2NPTA 2PMVA 2AX5A 1V80A 1QQ7A 2H5XA 3TFRA 2MBBB 4M8MA 3M6ZA 2H3FA 1L0YB 2EANA 3MHSD 4KN4A 3U30A 5JHBA 3HJEA 3KLSX 2R8HA 2HOFA 4ED0A 5AK3A 1L0XB 2QARB 1VRAB 4G9BA 5AUKA 7ICOA 1R4MB 4TQRA 4ECRA 5AI4A 1NKEA 4G3IA 4DEZA 4MDKE 3PSTA 1QF6A 2KP7A 1L8LA 4EX6A 1PGBA 1JCKB 4MFFA 4PZNA 2JPHA 3ZW3A 2J6UA 8ICKA 4NXZA 2XN9C 1SL0A 2IOFA 1XU4A 4IQTA 5J8YC 8ICNA 2FIFA 4Z6EA 5ALGA 4EBEA 1P9DU 1N56A 2IYDB 1H8CA 4BWJA 4PGYA 3F2BA 2ZIUB 3WK8A 4KLDA 5J0XA 5AK6A 1X66A 2KKCA 5ALMA 5D4BA 2UWQA 2NTTA 3U8ZA 2IMWP 2GLSA 4ANXA 2JVCA 4BBNC 2DL0A 2DAFA 1K53A 2JXJA 5DPWA 4ICAA 5JUMA 3ISBA 2G09A 3L17A 4I2JA 3M63B 2LJIA 2D3DA 4RF0A 3H8WA 1AROP 3ZDMC 3CF6E 4B95A 4IR1A 2HVIA 5CEHA 5DKWA 3V72A 3RH4A 4YMMA 1YZ7A 3HWTA 4MF2A 1T8EA 5D94A 3H4DA 3VRAB 9ICFA 4M9LA 4LZGA 4K4GA 1CEZA 1VLBA 3WKCA 4DQPA 1BT0A 1E9MA 3A4SC 5KFNA 2BB6A 2RDJA 4EOYA 2A1AA 4ZOHC 1WGGA 2V4LA 2J0KA 1QH9A 1T3QA 1I35A 4UARA 5HMLA 3ZJVA 3PREA 5DGBA 1FXIA 4Y2JA 2J4XA 2Y9UA 3DBRI 1JQ4A 5T8IA 5DPTA 4GOCA 2LYHA 4Y2XA 2EMTA 4LVSA 3AE5B 3KKAA 4LCDE 3NZSA 5CHWA 3LYYA 3CSTA 4RCOA 5AZFA 1D6EC 4PT5A 5KFFA 2BT6A 2G07A 1FFUA 3AQEA 4WWMA 2MSED 5CHGA 2UVWA 5CRXA 2BB5A 2C60A 1J97A 1LFDA 3A9JA 3EHVA 2W9AA 1J8CA 3L0WB 3U4EG 3NVYA 3JPPA 3Q8BA 1OW5A 2JZ3B 5KHOA 4ANWA 2KDMA 2BKEA 1NYQA 1Z2MA 1ECWA 1ZQOA 1NK4A 2KJ6A 3AV8A 1NI3A 4KZCA 2WXNA 5TR5A 2KICA 2FAZA 2W03A 5KFQA 2WNMA 3EWAA 2WU2B 1UT8A 2F1JA 1BXTA 2CHWA 2JXXA 1UQVA 2DF4B 3V61A 3G6XA 1ZQIA 2LVOA 2XGPA 2KOXA 3QZ7A 3JPNA 3DHIC 3NOBA 1RM6C 3OJUA 3EW9A 2QIEB 4FO6A 2IHMA 5FR3A 1S0NA 4UAYA 1F77A 5AI0A 3AEBB 2LI5A 2W11A 3W1SA 1OUQA 2KJRA 4RQ3A 4H2AA 4NLBA 1XQQA 4HK2A 4M0AA 1HXYD 4RQ6A 4ED3A 1P0RA 2XICA 3ETRA 3H0MB 1S10A 1DOQA 4DWFA 3Q3OC 1ESFA 2VA8A 3E2EA 5IIKA 1BPEA 2ODGA 2BWES 4ZH4A 1S76D 3CNHA 2MSNA 3IFWB 2KFJA 2QSDA 4BJQA 1S77D 4IR9A 4PYUA 4ANVA 2E5SA 4UW9A 3GIJA 2UVVA 4WJOA 4TQSA 1XEEA 1ZRNA 1A6SA 4KIKB 1ZD4A 2ISPA 1SXEA 1SIFA 2SAKA 4BWMA 4F5QA 1WXVA 4EE2A 1WM2A 2VANA 2K8CB 3RB4A 1B43A 7ICVA 1ZGUB 1JI7A 2NTSA 4Y2SA 3D2SA 1K51A 4J9LA 2EZYA 1E8WA 3B2FA 2AL3A 3IT4B 1AYFA 4MGZE 4DFJA 3RB0A 3B2GA 2VZKB 4B9VA 1WXSA 5AZHA 1ZQYA 4QIWF 3MGIA 8ICIA 1UBIA 1WMHA 3DVNV 3BQTA 4BX9C 5EOZA 1FNWA 4GN1A 4LJXA 1V81A 5EE0A 1WXMA 1IGDA 1QQRA 2C7MB 2K6QA 2PI4A 1AW7A 1XT9B 3DBLI 1KN5A 3RNEC 3RUIB 5AIBA 3IXSA 2NR2A 5AEKB 4UB6U 1O08A 4ED6A 1SL1A 5JHAA 4AS1A 1ZQGA 4Q44A 4MGYE 3NZ3A 7ICLA 1B1ZA 4Y2YA 4ELTA 2JH7A 2M0AA 3ZQ4A 3W5UB 5B5EU 4UATA 5BMIA 4IC9A 4I2CA 1A0PA 1WGRA 1V1PA 2N9XA 3OSNA 1XCQL 1KLGD 4MJSA 3BINA 3RMKC 4W9EA 3N1XC 4OD0A 5HHIA 1DYQA 4M2YA 2XVTA 9ICSA 9ICOA 4NJCA 5DQGA 1HTQA 1I4QA 2MRPA 3QHTA 2X8XX 3H7PA 1LVHA 1FRRA 3GB1A 3RNFC 3QZ8A 4P4MA 1RLFA 3Q8CA 2ZIVA 5J2RA 4TUQA 3KD3A 2IDYA 2KYWA 1RFKA 3RB6A 4RNOA 4BKSA 4QWCA 4TMAB 4E74A 3BQ7A 1I7HA 1CZPA 2YTUA 2JQRB 5KAIU 4LNFA 2KTRA 1WWUA 4I2DA 8ICSA 2KZRA 2GBKA 4I2FA 3F5EA 1WRDB 2KLCA 3U2SC 5F9NA 3Q8AA 2MUTA 2XNAC 4M47A 1X2IA 1R4NI 4DFMA 1M4VA 1V9PA 1RYJA 2A5UA 3CW2C 4QZHA 4ZRPA 2V3PA 1J7BA 1JWAD 2DZKA 3SDLC 4XRHA 3AL0B 3RRHA 2F76X 3ENEA 2PFOA 3MFHA 1L3VA 4PS3A 5ALRA 4US9A 4C4VB 1SZPA 4IW0A 8ICCA 3MHZA 3TFSA 2JEFA 3QX1A 4DL7A 3W5VB 1KRHA 3HPOA 3PHWB 1V8CA 5DG9A 1JIHA 1YJIA 3WAMA 2MBQA 4ECWA 5IIIA 4I6LB 2D07B 4W9IA 2ZIXA 1L6UA 1JRPA 4UASA 1S5LU 3ZDEA 1IUEA 3ALBA 4NLGA 1FMAD 2GOWA 2LXAA 1TS3A 1BPXA 3SEIA 2ICIA 3R66C 2WP9B 5AM5A 2HBJA 1VZ8A 2ZJDA 2KSOA 5KL1B 3MGVA 2GBRA 3LJ3A 3KH0A 1M6YA 2VH2A 3BIID 2KG5A 2BWFA 2KQSA 3QU4A 4RZRA 7ICEA 1SE9A 1GNUA 1KM7A 1SV4A 3KKAC 4AUQC 5HHHA 2FCMA 4M0WA 4NLCA 4C4RA 1BMLC 7ICJA 1QKZA 1YQ4B 2LYBA 4I6PA 2NO4A 1H38A 2L7RA 1ZQZA 1SSNA 2LHEA 3OHBA 2CHZA 2Z8LA 2MA1A 5JU5A 3R3MA 4MGIE 4YXJA 2NMQA 3F2DA 2ZNVB 2ZTDA 4FJYA 2N9KA 5LNK1 3SD5A 5C1ZA 2CR5A 2W9BA 3UQ0A 4ICUA 2KWDA 2C9WB 4Y2VA 1LB2B 4UBCA 1IP9A 1YMHE 4YVZA 1QQ6A 7ICUA 4LNNA 3V7JA 2Y1JA 3JPOA 4NLKA 5J2JA 2N9EB 1TBEA 3H8JA 1DXSA 1C7YA 5ALXA 1DRGA 1WZ0A 4B9KA 2LGXA 2WWZA 4PK1A 1XD3B 4ECVA 4XDDA 3PO4A 3A0BU 1X6IA 2XY5A 4GDKB 4GMVA 4F5RA 4ED7A 1SJED 3MBYA 1L7YA 1IGCA 4JMUA 5KG7A 3LDAA 3T5JA 2HHWA 2ZXHA 1XLPA 4WJ3B 1L7PA 7ICSA 3L16A 5CWRA 4CYEA 2ZG6A 3T5LA 4TV3A 3IG5A 5KG3A 3URYA 2SEBD 3R9KA 2BGFA 1WX7A 2QDFA 3EFCA 3N97B 1S0VA 2OYYA 3U52E 2HE7A 3SFEB 4MH0E 1TAQA 4BKTA 3I3TB 1WGHA 3SD7A 3Q8KA 4P6VF 2G4DB 8ICLA 3V62A 2LMCA 2NV3A 4UAZA 1RXVA 2KTFA 5KG5A 3H8HA 5EE9A 2QARA 2RPVA 5J2CA 4KX5A 1JROA 2F44A 3PX0A 3PS6A 2KWCA 1UNSA 2DYOA 1MG8A 4A90A 2PJHA 2JXTA 1LKYB 3UM9A 3Q8SB 2FMQA 2MLBA 1ZETA 5MPOA 5KFPA 1U4AA 2IY0B 4RT2A 4TUPA 3EPGA 3X23A 2IHNA 1OQRA 4DDGD 2ZIUA 3IRUA 2I9GA 1L7NA 3WK6A 9ICUA 2LGDA 1C79A 2FCNA 3ZDCA 2RDIA 1FM0D 1E7PB 2AQ4A 4W9KA 1YQ3B 3H8SA 3C5FA 3QE9Y 3I9V1 2KFZA 4NY8A 8ICVA 3Q14C 2OJWA 3QEAZ 1E8YA 1Z5SB 3DCGA 5BO4B 1N60A 3UGBB 3KVFB 3VUXA 1NK6A 4RH6A 5KFRA 4JX1C 1SV0C 2JV3A 1ZQHA 3BVZA 4GFJA 1FO4A 3HX0A 2KOBA 5J29A 2HJ8A 3WK4A 3C2LA 3BDPA 2LRUA 2WU5B 3M1YA 2LGSA 2AH5A 3PY8A 1HUOA 5AK5A 5IIJA 4Y2TA 1WRIA 2K8AA 4QZGA 4PHDA 4B6WA 4RM8A 5J0OA 2Y3AA 4J9OA 4Y2PA 4EBCA 4OJLA 1SXTA 3QJZA 4IKGA 4K7UA 4F5NA 3PW5A 2UVRA 2MX2A 1LV5A 2WXMA 1D8LA 3KZIU 3A1QB 2WS3B 5ALWA 3RJGA 3ZTCA 3BQ0A 3D2NA 2A3VA 4G50A 3N4MB 4ANUA 2MHJA 2N0SB 4IC7B 1RPLA 1YN4A 3N7SC 1UT5A 3RB3A 9ICTA 5KFMA 4L23A 3FC4A 1RQLA 4ECUA 5HFYA 1SJHD 4IWQA 3TEXA 3Q3NC 1ZJMA 4FXCA 2KDIA 4JWNA 4DHJD 3IAS1 5AK4A 4USAA 7ICFA 2BVCA 5IKCM 5G5GA 2IPKD 5CR0A 5KT5A 4I2IA 4AP4C 4ARCA 2KVSA 2BQRA 4O5KA 4NL9A 1V5TA 3WALA 2FLNA 2XC9A 1C9FA 2IOHA 4XGAB 2MEKA 4UB2A 4WQOB 3ZXRA 2KK8A 3ZNID 1RXWA 5DBCA 3AU5A 2RMMA 8ICWA 3ED5A 4ED2A 1D5MC 1UD7A 1J7CA 3L4PA 2G9HD 1YX5B 4IRCA 3C21A 7ICNA 1C76A 2O2VB 5ALKA 1WR6E 3MGHA 4ELUA 1Q3VA 2R8GA 1TK5A 1C4PA 3L10B 5DDMA 4FBTA 5C0YA 3P4SB 3ZJUA 1GC7A 3WKDA 1UPHA 1UGMA 4CNQA 5H2FU 1RRBA 2WXGA 2Y5BB 3SU8X 2N1WA 2B21A 1X42A 2FBWB 2RHFA 2KJHB 2AL6A 2PFNA 5KG6A 2EZXA 8ICYA 4KKJA 1ZQSA 2HDOA 1FCLA 3Q3FA 2PW9A 3SI8A 1C20A 5KFJA 1R7SA 1V5OA 4II3B 1T5XD 4GIBA 2KWUB 5J2AA 4ACFA 2WXJA 4RMAA 4GDLB 1F1HA 1VCBA 7ICKA 4M00A 3KZXA 5ALVA 4XQ8A 1C1YB 1LQBA 5AKLA 5KFCA 3B0AA 1LGRA 3P2BA 4WWOA 2JRHA 1G6JA 4KIKA 2L83A 4G3XB 3G6VA 2KE7A 2DNFA 3RJKA 3IG3A 2LEKA 4RQ1A 2YY6A 3E0FA 2K8CA 3Q3JA 5K4LA 3JW0X 3G6YA 1SKSA 3SENA 4WH4A 2P66A 1MA7A 4KTQA 3PRMB 3V60A 2QKQA 2I1JA 1S3SG 1Q3UA 3TKAA 3QU2A 4N6EB 5C5JA 8ICQA 2ZTEA 1L3TA 1L5UA 3TAQA 3AEAB 4W9FA 3OSPA 5ALTA 1CUKA 1XS9D 3H0LB 4F8RA 1R4MI 1VZ6A 4F72A 1KOTA 2OEDA 5KFIA 4M9NA 3TJPA 5CX3A 4UAWA 1ZW7A 2BS2B 3PR5B 1V49A 4F5OA 2KMCA 1L7MA 1X40A 1NZPA 2JEIA 2HJ1A 1X1MA 9ICRA 1KQQA 1D8YA 1VJ5A 2HCFA 1EUVB 4JUZA 2LM1A 3ONNA 4QIWC 4RQNA 4RQ5A 1QSLA 5KHQA 4C00A 1ZQXA 5GXGB 4HJGE 3T9LA 2NYVA 5KFKA 3F2CA 1COOA 2ZUCA 1RYRA 2HD5B 2KN4A 4M0WB 4IL6U
chains in the Genus database with same CATH topology
4JWSC 4REZA 2K0PA 3AE5B 3AMZA 1I4PA 1WSPA 1JMLA 1WXQA 1TZOA 1SBBB 3LYYA 4MM3B 4YXDB 1GB1A 4RCOA 3W2DA 2WXHA 1D6EC 4PT5A 2BT6A 4KX6B 1FFUA 1UGJA 2BS4B 4WWMA 1OFFA 2BB5A 3ZGZA 5TSSA 2B76B 3TEWA 3U4EG 2V0GA 3NVYA 3Q8BA 4YT0B 2PIAA 1EWYC 2KDMA 2EELA 1NYQA 1ZXHA 1QILA 4OHJA 4C56C 4N58A 2BTEA 1YN3A 3AV8A 2L32A 1NI3A 2WXNA 4C7ZA 3MFGA 3TEYA 1TY0A 4ITKA 1XF5L 2WNMA 2WU2B 1BXTA 3PZ7A 5BYQA 4YTMB 1RM6C 3EA6A 4JWUC 4XDCA 2MH7A 1EM7A 2QIEB 2M19A 3PZ8A 3BWUD 1KH0A 4A55A 5FR3A 1DOYA 3ABVB 2M56B 1VDVA 1SE2A 3V3XA 2BYTA 2QJLA 1F77A 4JPSA 3AEBB 4D2KA 3MC0B 3W1SA 4H2AA 4A6QA 1HXYD 3ETRA 1J7AA 1ESFA 3MP9A 3BYTB 1TKEA 4R3DA 3SR6A 1MPEA 2V3NA 2QSDA 1F2RC 2BBCA 5C2TB 3AEEB 1XEEA 1B9RA 2Y5PA 3E9SA 2WXLA 2SAKA 4EE2A 4KGRA 4C80A 2NTSA 1K51A 1HQRD 3AEFB 5D7GA 2GB1A 3B2FA 1PFDA 3IT4B 3R2IA 5E6JA 1AYFA 3AE1B 3B2GA 2VZKB 4TQ0A 1I4GA 1NENB 1I4RA 4YTNB 3RFZB 1FNWA 1N61A 4P16A 4WIPA 1YN5A 5BYRA 5EE0A 1IGDA 1QQRA 3B9JA 3OWEB 4HROA 3NVVA 1AW7A 1QLBB 1D5XC 1EU4A 3R8BA 2D5GA 1TJEA 2AQ1B 3IXSA 2WQYB 3FILB 4YSZB 2HDEA 1SIJA 1TKGA 4AS1A 3P1MA 4C7YA 1MVKA 4TSSA 3NZ3A 1B1ZA 3W9CB 1PDXA 2M0AA 3ZQ4A 3P4RB 3W5UB 1NYRA 4YSXB 4ZHPA 1JWBD 5BMIA 1HEZE 1IBXA 3GP7A 1V1PA 2N9LA 3FAHA 1XCQL 1KLGD 3N9YC 2FUG1 4N59A 2IJ0A 1DYQA 4RF1A 3C8YA 1EU3A 4NJCA 1I4QA 3AE3B 4Q2JA 2YEPF 3EUB2 1FRRA 3GB1A 3R2TA 2W3RA 4HKZE 5HHDG 3Q8CA 3NVZA 2ZW0A 1F0ZA 1CJEA 2IDYA 3Q8EA 1RFKA 3BK1A 3BVGA 4XE0A 1TKYA 4TMAB 2H88B 3VQIA 1I7HA 1CZPA 2JQRB 5FKAC 3HUIA 3VR8B 5JXVA 2K22A 3U2SC 2W55A 3Q8AA 4LK0M 3T3OA 2XNAC 3UI3A 1KTKA 3GS2A 1M4VA 2PVGC 1RYJA 1YJJA 1YNTE 1C4AA 3AB5A 1JALA 2V3PA 1TS5A 3J9CA 1J7BA 1JWAD 4ZRPA 1KF6B 1ZUD2 4KKIA 2CJNA 1ZE3D 2MJEA 4XWTA 2PLPA 2PTLA 4US9A 1FEHA 3IAM1 4OZAA 3BYYB 3MHZA 2JYTA 3W5VB 1KRHA 4LLGM 1V8CA 1YJIA 1A70A 2DLBA 1ENFA 3WCQA 1L6UA 4DQOC 1JRPA 1IUEA 4ZYSA 1FMAD 4GLSC 3AN1A 1TS3A 4MH8A 2KAJA 3AH7A 2ICIA 2WP9B 3P4QB 1ROEA 1VZ8A 3LXFA 1HA5A 2LUMA 3V05A 2WXKA 2N7JA 2ON8A 4CQNA 3BIID 1ET6A 4TQ1A 2ZW1A 3CWIA 3TEZA 1WYGA 4KGTA 3E56A 2Q5WD 1GB4A 2W3SA 1FXAA 1ACCA 1FRDA 4M0WA 1AN8A 2L52A 1N5WA 1FIQA 2WXOA 4WAFA 4IOIE 1CQVA 2MJDA 3AE6B 2G1EA 1BMLC 2K5PA 1QKZA 1YQ4B 5EE3A 3TSSA 1XXGA 3BZDB 1XCTL 2H89B 2R61A 1SSNA 2LHEA 2WXRA 1RWSA 2QILA 1I4HA 2Z8LA 1SEBD 1JW9D 1DGJA 2NMQA 2DBYA 4DXFA 1SB3C 5AUIA 2AQ2B 2N9KA 5LNK1 2J53A 2KWDA 1FCCC 2IGDA 2QMTA 3P63A 1GOZA 2ONQA 3P42A 1YMHE 2HTME 1VJKA 1ZOYB 3PO0A 1IBXB 1V1PB 2PVOD 1QOAA 1GPXA 2LGIA 3DWMA 4L2YA 4OZBA 2JZPA 3CIRB 3ZYYX 1Y56A 3AEGB 2W54A 2I38A 4ARIA 4XDDA 4B0EA 4MT5A 1ZDVA 4GDKB 1PUTA 4RGOS 1MI0A 2J42A 2L1AA 3AE9B 1SJED 4B0MA 4AQ7A 1IGCA 5H8YE 1XLPA 2I2YA 3URYA 2SEBD 1WGKA 1XLNA 1L6VA 3U52E 3SFEB 2CJOA 4P6VF 4US8A 1N63A 1XLQA 1FNVA 2LMCA 4RNAA 4RFBA 1XLOA 3H8HA 5EE9A 2RPVA 2GI9A 2YEPB 1JROA 5FK9C 1UNSA 1ZDXA 2DYOA 4ZRQA 4A90A 2JXTA 1TS2A 3AE8B 2RDHA 2KQ4X 1JWUD 1V97A 5MPOA 5EE1A 4RGNA 3AM9A 1GAQB 1D4BA 2KMMA 1QOFA 4YWGG 1Q10A 1OQRA 3SFDB 3AEDB 1L0VB 2GRIA 2V4IB 2W82A 4J3OD 4YSYB 1NVID 1E10A 1T6BX 3HRDD 1C79A 2JU6X 1SE4A 1FM0D 1E7PB 2Y5CA 1YQ3B 4HRSA 2CU3A 3BK2A 1C77A 3I9V1 4HEA1 1EWCA 1L5PA 4ZHOA 3ZJTA 5D3IB 1N60A 4OW0A 1SE3A 1PGAA 4RH6A 2PKOA 4JX1C 3O13A 1TS4A 3BVZA 1FO4A 3NRZA 3AE2B 2WU5B 4KGSA 1UWMA 4LTUA 5C3JB 3NUHB 2VZKD 3DWGC 3U7ZA 5BMGA 3EGRA 5H92C 1WRIA 1HZ6A 1P7FA 1MHXA 2Y3AA 2K9XA 2J52A 1STEA 1SXTA 5G5HA 1VR9A 1K52A 4IKGA 3BVMA 2QEJC 1V1OA 3VR9B 2WXMA 1E6EB 2K3UA 5BYSA 1ET9A 3Q8FA 1JWMD 2DYMA 1I4XA 2FE8A 2WS3B 2WDVB 3P4PB 2INNE 1ZPSA 2E6XA 2DWQA 2N0SB 3IT6B 1YN4A 1QOGA 2IGHA 3LB8C 4UDUC 1ZXIA 1UUPA 1KLUD 4L23A 3FC4A 5HFYA 5HI1A 3AECB 1SJHD 3TEXA 1FNUA 1SF0A 4FXCA 1F2RI 2ACZB 1NEKB 3AE7B 2WDQB 3IAS1 4USAA 1N62A 2JSVX 4HKQA 2WLBA 3VRBB 4JE3B 2WXPA 5G5GA 2IPKD 3SEBA 4NAWB 4ARCA 4O1NA 1C9FA 2KACA 1KFYB 1TYGB 2X38A 2MEKA 1XO3A 4NZLB 1PGXA 1L4DB 2OHFA 4WQMA 2AQ3B 1LO5D 2RMMA 2PMVA 2AX5A 1D5MC 1J7CA 3L4PA 2G9HD 1DOIA 1C76A 1QT9A 1L0YB 1PYWD 4OVZA 2JWUA 1JWSD 4XWWA 3T3NA 2RDGA 3KLSX 1C4PA 4RGTA 3KWLA 3P4SB 3ZJUA 1L0XB 1N5XA 1VRAB 5AUKA 4DXGA 4NAMA 1FFVA 3NS1A 2WXGA 1D5ZC 3MJ5A 1TY2A 1QF6A 1K50A 1MHHE 1WWTA 2BW2A 2FBWB 2EKIA 2BS3B 1PGBA 1JCKB 2LHDA 4KKJA 2XN9C 1BUIC 2WXIA 5HG2A 1UWXA 1FCLA 2PW9A 1R7SA 3TUOA 2TSSA 4RGMA 1E0ZA 1T5XD 2IGGA 4WURA 4IDIA 2WXJA 1DOXA 4GDLB 2NTTA 1P7EA 4MACA 3HVDA 2L83A 3KQ4A 1K53A 3RPFC 2LEKA 1OQQA 3KWVA 2E3TA 2WXQA 2JX5A 1FD6A 1ZP0B 2LJIA 3I57A 1CK1A 4WH4A 2JYEA 4RF0A 2INPE 4N6EB 2LFIA 3AEAB 3Q69A 3VRAB 3HVZA 5BMHA 1VLBA 2WXFA 5D3DA 5I4DA 1VZ6A 1E9MA 2BB6A 1C4CA 2OEDA 4ZOHC 1VZ7A 2WDRB 4L1BA 1T3QA 1L4ZB 2BS2B 3FILA 3AE4B 3NVWA 4YTPB 3ZJVA 1C78A 1FXIA 1QOBA 4OZCA 4A9AA 2J4XA 2MJ3A 1JQ4A 5T8IA 4A8XC 5GXGB 4HJGE 1AWDA 1HZ5A 2KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWS C;  3AEC B;  2PVO D;  1QOA A;  3AE5 B;  4N59 A;  1GPX A;  3AMZ A;  1SF0 A;  3DWM A;  4FXC A;  1WXQ A;  2ACZ B;  3CIR B;  1NEK B;  3AE7 B;  2WDQ B;  3AEG B;  2W54 A;  1N62 A;  4USA A;  3ZYY X;  4YXD B;  2WLB A;  3AE3 B;  3VRB B;  2BT6 A;  4KX6 B;  5G5G A;  1FFU A;  3EUB 2;  1FRR A;  2BS4 B;  4WWM A;  2W3R A;  1PUT A;  3NVZ A;  1OFF A;  3AE9 B;  1F0Z A;  1CJE A;  5H8Y E;  1RFK A;  1XLP A;  2B76 B;  1KFY B;  1TYG B;  1TKY A;  3NVY A;  1XO3 A;  4YT0 B;  2PIA A;  2H88 B;  1I7H A;  1EWY C;  2OHF A;  4WQM A;  1CZP A;  1NYQ A;  2JQR B;  1WGK A;  4N58 A;  3HUI A;  2AX5 A;  1XLN A;  3AV8 A;  3VR8 B;  2K22 A;  1L6V A;  1NI3 A;  4C7Z A;  3L4P A;  1J7C A;  3SFE B;  1DOI A;  2CJO A;  4ITK A;  2W55 A;  1QT9 A;  4P6V F;  4US8 A;  2WU2 B;  1N63 A;  1XLQ A;  1XLO A;  2PVG C;  1RYJ A;  1YJJ A;  3AB5 A;  5EE9 A;  1JAL A;  3KWL A;  3P4S B;  1RM6 C;  1J7B A;  1JWA D;  4YTM B;  1KF6 B;  1N5X A;  2MH7 A;  1JRO A;  4JWU C;  5AUK A;  1ZUD 2;  2QIE B;  2M19 A;  1FFV A;  3NS1 A;  2CJN A;  2MJE A;  1DOY A;  1QF6 A;  3ABV B;  1WWT A;  1VDV A;  2M56 B;  3AE8 B;  2FBW B;  2EKI A;  2BS3 B;  2QJL A;  4US9 A;  3AEB B;  1V97 A;  5MPO A;  5EE1 A;  3AM9 A;  1GAQ B;  2KMM A;  1QOF A;  3W5V B;  3ETR A;  1KRH A;  1J7A A;  1V8C A;  1YJI A;  1A70 A;  1OQR A;  3SFD B;  1R7S A;  3AED B;  1L0V B;  1TKE A;  1E0Z A;  3WCQ A;  4YSY B;  3SR6 A;  1L6U A;  1NVI D;  1JRP A;  4IDI A;  1E10 A;  1DOX A;  1IUE A;  3HRD D;  1FMA D;  3AN1 A;  2KAJ A;  3AH7 A;  1FM0 D;  1E7P B;  2Y5C A;  5C2T B;  2WP9 B;  2L83 A;  1YQ3 B;  3AEE B;  3P4Q B;  4HRS A;  1ROE A;  2CU3 A;  1B9R A;  3LXF A;  3RPF C;  1L5P A;  4ZHO A;  2LEK A;  1N60 A;  1OQQ A;  3BII D;  3CWI A;  2E3T A;  1WYG A;  2PKO A;  4JX1 C;  2Q5W D;  4C80 A;  2JX5 A;  1ZP0 B;  1FO4 A;  3AEF B;  2W3S A;  3B2F A;  1PFD A;  3NRZ A;  1FXA A;  2WU5 B;  3AE2 B;  1AYF A;  1FRD A;  3AE1 B;  3B2G A;  1UWM A;  2L52 A;  4LTU A;  1N5W A;  5C3J B;  1FIQ A;  3DWG C;  4N6E B;  3AEA B;  5H92 C;  1WRI A;  1NEN B;  2MJD A;  2G1E A;  3AE6 B;  3VRA B;  4YTN B;  2K5P A;  1YQ4 B;  3HVZ A;  5EE3 A;  1N61 A;  2K9X A;  1VLB A;  5EE0 A;  2H89 B;  1E9M A;  5G5H A;  3B9J A;  4HRO A;  3NVV A;  3VR9 B;  1RWS A;  4ZOH C;  1QLB B;  1JW9 D;  1DGJ A;  2WDR B;  1T3Q A;  1E6E B;  2BS2 B;  2DBY A;  1TJE A;  1SB3 C;  2WQY B;  3AE4 B;  5AUI A;  3NVW A;  4YTP B;  2WS3 B;  4YSZ B;  2WDV B;  3P4P B;  1FXI A;  1SIJ A;  1TKG A;  1QOB A;  3P1M A;  2DWQ A;  4C7Y A;  4A9A A;  2MJ3 A;  1JQ4 A;  2N0S B;  3W9C B;  1PDX A;  3P63 A;  1QOG A;  3P4R B;  3W5U B;  1NYR A;  5GXG B;  4YSX B;  3LB8 C;  1JWB D;  2HTM E;  4ZHP A;  1VJK A;  1ZXI A;  1AWD A;  1ZOY B;  3PO0 A;  3FC4 A;  3FAH A; 
#chains in the Genus database with same CATH topology
 5AIA A;  4REZ A;  2JZB B;  5EWG A;  3ZIM A;  4R66 A;  2WF7 A;  3AMZ A;  3MFI A;  1I4P A;  1WSP A;  3EEC A;  1JML A;  1TZO A;  4YXD B;  4DLE A;  1ISN A;  2L05 A;  2WXH A;  4KX6 B;  3RT3 B;  2BS4 B;  2KZ3 A;  4K1R B;  4TUR A;  4R63 A;  3SZ2 A;  2DAJ A;  3WAO A;  1RAX A;  4LJO B;  5TSS A;  3TEW A;  3LWM A;  2KLG A;  1T3N A;  4PHA A;  2PIA A;  4O3P A;  3WIM A;  8ICU A;  1ZXH A;  4C56 C;  3PW4 A;  4KSK C;  4UAU A;  4DHZ B;  5CA7 A;  2NRV A;  2L32 A;  2OEH A;  1V6E A;  3MFG A;  4C8K A;  4KLG A;  4QWD A;  1TY0 A;  4ITK A;  1XF5 L;  4DCC A;  4O0I A;  3LWL A;  4K4H A;  5ALH A;  3KHR A;  3OAW A;  1FXT B;  2EAO A;  2L0T A;  3IV6 A;  3HT3 A;  4YTM B;  4XDC A;  4K3B A;  1EM7 A;  1GG3 A;  2NBW B;  4KLO A;  4A55 A;  3C29 A;  3WKE A;  1DOY A;  4XYC A;  3KUD B;  1SE2 A;  4CHK A;  4JWM A;  5ALU A;  4C4V A;  2BYT A;  2QJL A;  2HOQ A;  5ALY A;  4AYB F;  5DQH A;  1V38 A;  4U6P A;  3UQ2 A;  4RQ4 A;  3UQA A;  3N7P D;  5AKJ A;  2FPK A;  3H8M A;  5AKX A;  1J7A A;  1C3T A;  1ZQN A;  4Q8F A;  2EAP A;  3AU2 A;  1TKE A;  3ALR A;  4UB8 U;  2Y0S F;  1MPE A;  1LM8 B;  2XCA A;  2BBC A;  4O5C A;  2ZTC A;  5C2T B;  4DQI A;  2KHV A;  3QX7 A;  2WF9 A;  1DK2 A;  2IO3 B;  4PH5 A;  1TT5 B;  3E9S A;  2WXL A;  2M0X A;  4XUS A;  2G08 A;  2OXO A;  2DKX A;  1KEJ A;  1U45 A;  1D8B A;  5E6P A;  2VRR B;  3HM6 X;  2INC C;  4IM3 A;  2KX3 A;  3AEF B;  4ZRI A;  1DGS A;  1PFD A;  2G45 B;  5JTI A;  3R2I A;  4PS8 A;  4ZYN A;  3AE1 B;  4O5E A;  2IOF K;  1TTN A;  4P4O A;  1I4G A;  4Y2Q A;  1I4R A;  3RBD A;  3QK0 A;  3RFZ B;  1X6J A;  2DX5 B;  2L8J A;  1N61 A;  1KLV A;  1M94 A;  1YN5 A;  4F91 B;  1TIF A;  3ZRC A;  4HCN B;  3OTQ A;  5L95 C;  5J2K A;  3B9J A;  1RYS A;  4HRO A;  3NVV A;  1HTO A;  4YXM A;  1HIW A;  1BPB A;  3PT2 B;  3K75 D;  3PRP B;  2D5G A;  2AQ1 B;  3UIP B;  4JV1 A;  3AEV A;  1NJZ A;  5IOI A;  1SIJ A;  1TKG A;  5ALP A;  4DFK A;  3W9C B;  3CYM A;  4F4W A;  3JPQ A;  3SV3 A;  2KD1 A;  2R8K A;  1NYR A;  2DFL A;  4ECS A;  2RQ5 A;  3AXC A;  2VH1 A;  3GP7 A;  2KTQ A;  2FLP A;  4IM0 A;  3FAH A;  2GMI C;  4N59 A;  2FUG 1;  4DHJ B;  4WJQ A;  1NK7 A;  3MR2 A;  4RF1 A;  5IIM A;  2MBH A;  3IHP C;  2AWT A;  2BCU A;  4GDK A;  1T0S C;  2YEP F;  3R2T A;  1PK3 A;  5IAA C;  3RNG C;  3S2A A;  4BZA A;  4ZDV A;  3WKB A;  4W9C A;  5KFG A;  4HKZ E;  2OOB B;  5HHD G;  2ZW0 A;  5AM2 A;  1F0Z A;  3KFU F;  1CJE A;  2MU2 A;  3Q8E A;  3BK1 A;  4XE0 A;  3Q8P B;  4DL6 A;  2FUH B;  2H88 B;  1WJ4 A;  2REX A;  4C8M A;  5KFD A;  3OJ4 B;  5JXV A;  2HSZ A;  2C2R A;  1K8R B;  4BAX A;  1WM3 A;  7ICP A;  3UI3 A;  1KTK A;  2F3N A;  1UA0 A;  1HE8 A;  3QU9 A;  2ES6 A;  2BCR A;  2PVG C;  4K7W A;  1C4A A;  3N1Z C;  1EXN A;  2KC1 A;  1JAL A;  2XO7 A;  1ZQV A;  1TS5 A;  2FMP A;  3J9C A;  1KF6 B;  4FN2 A;  2ASD A;  4P2H A;  3TCA A;  4FHK A;  1LKY A;  2H3I A;  4Q8E A;  2KWV B;  2PTL A;  5J0P A;  3ICX A;  2LJ5 A;  1L7O A;  3PNC A;  3BYY B;  4A8E A;  4YCX A;  2D3G A;  5CTR C;  4JL9 A;  2AGO A;  3BQ2 A;  2VA2 A;  4FFD A;  3DQV A;  4F4X A;  3DVG X;  4JQW C;  2JGA A;  2IND C;  3WCQ A;  3FDS A;  4DQO C;  4J9N A;  1UF0 A;  4ZYS A;  2ESE A;  2GOL A;  3AN1 A;  5AKG A;  3RNB C;  4YD1 A;  1OQY A;  1IPG A;  1IIP A;  1OEY J;  4YL8 A;  2A4Z A;  1O03 A;  2B0C A;  2HHV A;  3RZW C;  4KLH A;  1X9W A;  2G5H B;  1L8O A;  4RUC A;  2LWP A;  2N7J A;  1ET6 A;  5JH5 C;  3TEZ A;  1WYG A;  4OVV A;  4EUT A;  2LVQ A;  3RAX A;  2LGY A;  1GB4 A;  8ICP A;  5IA7 A;  1FXA A;  4O3S A;  3Q8L A;  1FRD A;  4RNM A;  1S8O A;  1N5W A;  3GIM A;  1Q1O A;  1CQV A;  1S1Q B;  3R7R A;  2XID A;  5J2G A;  4J6I A;  1HUZ A;  1A5R A;  4CO7 A;  5J2I A;  2YQE A;  5BPC A;  4J9M A;  2DYB A;  2WXR A;  1RWS A;  3NY5 A;  2W7P A;  1JW9 D;  4WWN A;  3N7R C;  4MEX A;  2KVC A;  1F9J A;  1SGG A;  3A1Q A;  5AUI A;  4KMO B;  2MRL A;  8ICA A;  2C5L C;  2D6F C;  2H3Q A;  2J53 A;  2BDP A;  3RH6 A;  3KHL A;  2DQN B;  2WGS A;  2YB1 A;  4FS1 A;  1Y88 A;  2IGD A;  4BKG A;  2F1H A;  2QMT A;  3DEE A;  3KUC B;  2ZJA A;  3M62 B;  3T3F A;  3DBH B;  2PI5 A;  3P42 A;  3RNA C;  2HTM E;  1JUD A;  1VJK A;  2G4S A;  3PO0 A;  4FUL A;  3VH3 B;  2PVO D;  5A0L A;  2G06 A;  1S0O A;  4L2Y A;  4OZB A;  3PSE B;  2JZP A;  2YB4 A;  2I38 A;  4GU2 A;  1WE7 A;  7ICH A;  5AKZ A;  4ED1 A;  1WZ3 A;  1YJ1 A;  4RGO S;  2L1A A;  2J42 A;  3VXW A;  2LD9 A;  4OJ6 A;  2EQY A;  5F9L A;  5KFA A;  4AOF A;  3ORY A;  4QZ8 A;  4HDO A;  1WGK A;  5CHF A;  1XLN A;  3QAR A;  1L6V A;  2O2V A;  1XSN A;  2WYQ A;  3APF A;  1WYW B;  3NAS A;  4BGD A;  4OO1 J;  4QWB A;  1FNV A;  4RNA A;  4RFB A;  1XLO A;  4CDG A;  4ECT A;  4BVU C;  2AU0 A;  2JEG A;  4JV0 A;  3TAD A;  2YN4 A;  3A9K B;  5FK9 C;  1ZDX A;  3UIO B;  4YMN A;  5DPS A;  2G0A A;  2MW5 A;  3ML9 A;  3I76 A;  3L08 A;  1WF9 A;  4ASW C;  5EE1 A;  3UMB A;  4RGN A;  1D4B A;  3PSF A;  2AQ0 A;  4YWG G;  4RQ7 A;  3N32 A;  3B0Y A;  3DPD A;  4IS7 A;  1UZX B;  4DK5 A;  2V4I B;  2W82 A;  4UAV A;  3RI7 C;  4GDL A;  5KT4 A;  1E10 A;  5HNK A;  1NK9 A;  2NO5 A;  1U48 A;  4P1C C;  4B9U A;  1SE4 A;  3EC8 A;  1ED1 A;  2E1E A;  4NQK E;  1EWC A;  5D3I B;  4C4S A;  2W8K A;  2C2D A;  7ICQ A;  1PGA A;  5L1K A;  1J19 A;  2BPG A;  1NJY A;  2PKO A;  4WJP A;  1KJT A;  3ZLZ A;  2N7D A;  3QWZ B;  3C1Z A;  2W8L A;  3NRZ A;  2Z59 B;  4B9M A;  2JH1 A;  4KGS A;  5FR6 A;  4U7C A;  8ICX A;  4KX3 A;  2BPF A;  3NHE B;  5BMG A;  2I5H A;  3O65 B;  1MHX A;  4RM9 A;  3PR4 A;  2K9X A;  4KLU A;  1KLN A;  4LNI A;  2E8O A;  5ALQ A;  5GTH U;  1VR9 A;  2JMG A;  1FEZ A;  3BVM A;  3MC9 A;  3VR9 B;  1TVA A;  1K5O A;  4RQ2 A;  2K3U A;  5L1I A;  3Q8F A;  2KT7 A;  3L3F X;  1JWM D;  3IVF A;  2DYM A;  9ICB A;  1T0Y A;  5J0Q A;  3C5G A;  1ZPS A;  2E6X A;  4ECY A;  2DWQ A;  3J81 j;  2LKY A;  1WJ6 A;  1ZQA A;  3IT6 B;  4QZI A;  5DBB A;  2K4H A;  3L5K A;  3H6N A;  4O3R A;  1JXL A;  1PQS A;  3LB8 C;  4UDU C;  1UUP A;  1LXD A;  5J0Y A;  2JZB A;  2KDF B;  5HI1 A;  3AEC B;  2W43 A;  4GIV A;  2L0F A;  1F2R I;  1WY8 A;  2WDQ B;  2JSV X;  3GOE A;  3BS5 B;  3VRB B;  2OM6 A;  4I2H A;  3GIK A;  4M01 A;  3E58 A;  3PSP A;  4O1N A;  1QLN A;  1D3Z A;  3KTQ A;  2FCQ A;  4AWJ A;  1COK A;  3TAC B;  1SKW A;  1KFY B;  5GTI U;  2X38 A;  3DHH C;  5DCN A;  1DK3 A;  1XO3 A;  2FPL A;  1NKB A;  1PGX A;  3K4G A;  4KZ0 A;  2OHF A;  4O3Q A;  3JYU A;  4XX5 A;  4EEW A;  2V3S A;  4KSL C;  2V9H A;  4LDT D;  2RDB C;  3SV4 A;  1OXJ A;  1DOI A;  1Y8R C;  1QT9 A;  4AP9 A;  1WCN A;  1UHU A;  4OVZ A;  1E8Z A;  9ICQ A;  2E8N A;  4XWW A;  4K3C A;  2RDG A;  1Z1V A;  3KWL A;  3ZXV A;  1N5X A;  3SQI A;  2KNB A;  2BQQ A;  5KG4 A;  4NAM A;  1FFV A;  3NS1 A;  2KKV A;  1WX8 A;  4W9H A;  3MJ5 A;  3W1S C;  4KVG B;  1K50 A;  1MHH E;  1WWT A;  4BXO B;  4OCZ A;  3TAR A;  1MG4 A;  2CS4 A;  1BUI C;  3BS7 A;  2N1V A;  3M3J A;  3SHQ A;  2LMR A;  4X5V A;  5D6J B;  3TUO A;  3FKY A;  4IQW A;  4RGM A;  3U26 A;  4DL3 A;  2IGG A;  4WUR A;  4IDI A;  3WKA A;  4Z6F A;  4IG7 B;  2ASJ A;  4FZN A;  2BYE A;  3RYT A;  1YOV B;  4G11 A;  4KLM A;  3KQ4 A;  4EZJ A;  5D46 A;  4AYB C;  2HBM A;  4YR3 A;  4EEL A;  2CN1 A;  3KWV A;  2WF8 A;  2E3T A;  4Y2U A;  4MFA A;  5F3X B;  2JX5 A;  9ICC A;  1FD6 A;  5D49 A;  3I57 A;  2GO7 A;  1CK1 A;  2JYE A;  2KN7 A;  1TK0 A;  2RGF A;  2Y0S C;  4DSK A;  2LYA A;  3V6K A;  5CB1 A;  2QB0 B;  2EMS A;  5G2N A;  4NQL B;  2ZVO A;  3MR6 A;  1ZQL A;  5J0S A;  2J0M A;  5J2H A;  3RAQ A;  5D3D A;  2JR5 A;  1XSP A;  4I6N B;  3RTV A;  4FJZ A;  3Q8R B;  4E71 A;  5KAF U;  4KN7 A;  2I1Q A;  5KTQ A;  4KLQ A;  2N4F A;  4L1B A;  2FMS A;  9ICA A;  1Z1B A;  2H3Z A;  2AJQ A;  3AE4 B;  3V7K A;  1J0G A;  4C4T A;  4R64 A;  4DSF A;  1GUA B;  3N3K B;  1KSP A;  2LPE A;  1QOB A;  4OZC A;  4A9A A;  1ZQR A;  5KT7 A;  4KDL B;  1T4G A;  2W04 A;  3QEB Z;  3Q8Q B;  2FID A;  2BYV E;  1HZ5 A;  4MEY A;  2NRW A;  4JWS C;  5CP2 A;  2K0P A;  3TQ1 A;  2AXT U;  3T5H A;  1TK8 A;  4IRK A;  1WXQ A;  3LK9 A;  5IP4 D;  1SBB B;  3CMM B;  2HOI A;  4NJ7 A;  1GB1 A;  3W2D A;  4KV2 A;  4HYK A;  4UQG A;  3JVZ X;  5KFS A;  2KMD A;  3RJH A;  4J9Q A;  1UGJ A;  1A77 A;  4DOC A;  3JSV B;  5TIS U;  3UF8 A;  3NUQ A;  1WFY A;  1TE2 A;  2V0G A;  3GE8 C;  4K4I A;  3LYS A;  5ALD A;  5G55 A;  4OHJ A;  3MDA A;  1QIL A;  3RRG A;  3H9D A;  2BTE A;  5AHX A;  2K1F A;  2VJ4 A;  3Q6B A;  2FI1 A;  4C7Z A;  3TEY A;  1K1S A;  3VUW A;  4CRX A;  5BOM A;  1WWV A;  2K6D B;  4MGK E;  3V6H A;  1P7D A;  3PZ7 A;  4GB9 A;  2LXC A;  3W1Y A;  3QUQ A;  3AU6 A;  5BYQ A;  2KFK B;  4CF4 A;  2CU1 A;  2DZJ A;  1KFT A;  4RQ8 A;  4N9F 4;  1QTM A;  5B66 U;  2HW3 A;  2M19 A;  3PZ8 A;  4Q45 A;  4DL4 A;  1KH0 A;  4RPZ A;  3BWU D;  1ZQQ A;  3ABV B;  2M56 B;  2M9N A;  3KW5 B;  5AKY A;  3RCZ A;  2N9P C;  2PPH A;  5DPR A;  5J0T A;  3RUL A;  9ICI A;  4NNJ B;  3MC0 B;  2KJ8 A;  4A6Q A;  1KFD A;  1F5S A;  1ZOL A;  2IBI B;  1NK5 A;  3GZN B;  2OWO A;  3B08 A;  1TAU A;  2RR9 A;  3H1U A;  8ICH A;  2KNJ A;  1TAM A;  2YX8 A;  3MP9 A;  4F2S A;  3TIX A;  2ISO A;  3IHQ B;  5J8Y A;  4R3D A;  4BOS C;  3SR6 A;  2BPC A;  3JPR A;  1T94 A;  1L3S A;  9ICK A;  5J0R A;  3K9P B;  1SKR A;  4FJV B;  3NGD A;  1OEY A;  2LVP A;  1NI2 A;  3FYH A;  3PSI A;  5AM0 A;  1B9R A;  9ICW A;  1E90 A;  3NTU A;  4F7Z A;  4FA6 A;  2WF6 A;  4KGR A;  2AGP A;  4C80 A;  1U49 A;  4WAA A;  1HQR D;  5E6J A;  2CHX A;  1ZQJ A;  4QWA A;  3A4R A;  4KDI C;  3MR3 A;  4I2B A;  2D10 A;  3ZNH B;  4YTN B;  5CJ7 A;  3HK0 A;  3PVX A;  3PLU A;  3VAW A;  1BNO A;  4P16 A;  4WIP A;  5BYR A;  8ICO A;  4F1S A;  4RQ0 A;  1BPZ A;  1ZQF A;  2V4Q A;  3TL5 A;  3SAF A;  5HR7 A;  2DKZ A;  4GC7 A;  1D5X C;  2EH9 A;  3R8B A;  8ICF A;  4DHZ E;  3ZKJ C;  3V7L A;  4F71 A;  4GXI A;  1TJE A;  1L2N A;  1ZQD A;  2WQY B;  3FIL B;  4CGZ A;  4P0P B;  9ICH A;  4YSZ B;  5HKH A;  1ZQK A;  3I63 C;  2W9M A;  4G0N B;  2YMP A;  3SAH A;  3P1M A;  4QJF B;  4C7Y A;  3PV1 A;  2N1R A;  5KFX A;  1PDX A;  2MP2 B;  5LXH A;  3PZP A;  4F92 B;  2FE9 A;  3AU4 A;  1JWB D;  1MQ2 A;  4NPN A;  3TI0 A;  4YSX B;  4DBG A;  2N9L A;  4P0Q B;  4I2E A;  1CRX A;  4I2A A;  3T8M A;  3CP8 A;  3QUC A;  4PGX A;  1KW4 A;  4J9K A;  2KQ7 A;  2RPQ A;  2IJ0 A;  3C8Y A;  4HLE A;  4J03 A;  4B9L A;  3QNM A;  2LRW A;  1Q0W B;  4Q2J A;  3EUB 2;  1SGH A;  1UBQ A;  2MA9 B;  4HXD A;  3NVZ A;  1JN3 A;  1ZD5 A;  3BVG A;  3ZDD A;  1MN8 A;  3MR5 A;  3T79 A;  9ICP A;  5AZG A;  5KFL A;  3D2Q A;  2FCS A;  5ALJ A;  2ZZP B;  1SXD A;  4ACO A;  2R8J A;  4LDT B;  1N48 A;  4NV0 A;  3PW7 A;  5FKA C;  3HUI A;  3VUY A;  3VR8 B;  2O6V D;  2ASL A;  1H4R A;  4W9D A;  2V4R A;  1IG6 A;  2W55 A;  4LK0 M;  1SWV A;  4DSI A;  2F77 X;  1Z4N A;  3AUO A;  4JB3 A;  5DLG A;  3OPX A;  4ECX A;  2C28 A;  2KO3 A;  5JRT A;  2BQU A;  4EZ9 A;  1YJJ A;  3AB5 A;  4F5P A;  2RSU A;  2CXY A;  1YIW A;  4QNL A;  4C8O A;  3A9K A;  3ZDB A;  1E5W A;  5KFW A;  3B0X A;  4KKI A;  1XNS A;  1XO1 A;  2PMZ F;  1ZE3 D;  2NBU A;  4XWT A;  4OJO A;  2BCS A;  4EEK A;  2DGZ A;  1FEH A;  2E1F A;  3IAM 1;  5LLI A;  4RPX A;  2FLL A;  2RRD A;  3ZDA A;  1WUD A;  2JYT A;  1ZQU A;  3GII A;  2C7N B;  3LDZ E;  4K7S A;  3B1L X;  2OH2 A;  4EZ6 A;  3QUT A;  2CRX A;  1Z00 B;  1URJ A;  4MH8 A;  2DPJ A;  4DQS A;  4BDP A;  3C28 A;  2KAJ A;  4O3M A;  4GXB A;  2MAX A;  1T7P A;  3RZF A;  4YN4 A;  5EWF A;  4DQR A;  3WK7 A;  2IO1 B;  4EZK A;  1HA5 A;  2WXK A;  4DOA A;  2KX0 A;  2ON8 A;  1ZQT A;  4CQN A;  2ZW1 A;  4UBB A;  3PPA A;  3N1Y C;  3E56 A;  4KGT A;  1WX9 A;  2Q5W D;  3ZRF A;  2HHS A;  2WHE A;  3UMC A;  2K39 A;  3APD A;  3TAP A;  1ACC A;  2R2O A;  1KTQ A;  1AN8 A;  5AI8 A;  2M1M A;  3QC8 B;  2K4I A;  4HDQ A;  2QCZ A;  4PYZ A;  2WXO A;  4WAF A;  5DB8 A;  2KDB A;  4HWI B;  3M9O B;  4DFP A;  4IOI E;  4DS4 A;  3Q8M A;  2K5P A;  3TSS A;  2VKQ A;  1XXG A;  1RDF A;  2KDE B;  4UB1 A;  2H89 B;  2R61 A;  4HPL B;  4A20 A;  1ZQW A;  2FPM A;  1I4H A;  1NJX A;  3EYZ A;  3OLM D;  1NK8 A;  5LXI B;  4EEN A;  4Y2R A;  4ZRJ A;  4DXF A;  2C22 A;  1S0M A;  3L13 A;  5L1L A;  1BGX T;  2PE9 A;  7ICR A;  2YML A;  1IXR A;  2K25 A;  4B6J A;  2KIV A;  2JZZ A;  3BY4 B;  3P63 A;  3I1Y A;  9ICL A;  1X9M A;  3RFA A;  1ZOY B;  1IBX B;  5J0U A;  3GV7 B;  3F5A A;  4E0D A;  3N30 A;  1QOA A;  1NK0 A;  2LGI A;  1NOM A;  2HVH A;  3DWM A;  3IBE A;  2CPR A;  3ZYY X;  3BS5 A;  4O3N A;  5DG7 A;  3BZC A;  5IN7 A;  3M9M B;  2N7E A;  3EPI A;  4NL9 C;  3RJJ A;  3HP6 A;  2W9N A;  1ZDV A;  4FAD A;  1BNP A;  1PUT A;  1XC9 A;  4KLL A;  3AE9 B;  4B0M A;  1ZJN A;  4IQU A;  2Q4T A;  3KUZ A;  4ICV A;  4PZO A;  4KIT B;  2I2Y A;  4J9R A;  4ZRK A;  1XSL A;  2R8I A;  4DQQ A;  2BHN A;  1Z19 A;  1JXE A;  3HKZ F;  1P1A A;  2BPS A;  1N63 A;  1WR1 A;  3GV5 B;  5ALE A;  2LAS A;  2PKE A;  2LBO A;  2ASQ A;  4JK1 A;  3WA0 A;  4PGQ A;  2KZM A;  5KFV A;  4GC6 A;  2GBJ A;  2M4N A;  2M17 A;  5AI6 A;  2NCN A;  2WX1 A;  3THV A;  4Q43 A;  4BXO A;  3DBH I;  1TS2 A;  3AE8 B;  3ISD A;  4QZF A;  2DPI A;  2KQ4 X;  3QU5 A;  2KFN A;  2KMM A;  1QOF A;  3QXG A;  4F93 B;  4GLX A;  1Q10 A;  3SFD B;  5EDS A;  1B4F A;  4BUG A;  3C2M A;  1L0V B;  2GRI A;  5IO9 A;  3HIZ A;  3VH4 B;  3UXP A;  1NVI D;  2L76 A;  2MWS B;  3GE3 C;  5DGA A;  5C23 A;  3HRD D;  2BZF A;  2BF8 B;  3FM9 A;  3DVN U;  4DFD A;  4IWO A;  1F0M A;  3NRW A;  3OGU A;  1WJN A;  5DQI A;  4CCH A;  3WK9 A;  3C0R B;  4HRS A;  2A1J B;  4UB4 A;  2BGW A;  1OGW A;  1QZE A;  2CU3 A;  4HEA 1;  2PEA A;  2D8C A;  1F44 A;  3BQ1 A;  4ZHO A;  3ZJT A;  1SE3 A;  2JWZ A;  4W9L A;  1NDD A;  3KYD D;  3NG0 A;  1F52 A;  1TS4 A;  2JUO A;  4TKN A;  4XC2 A;  1CMX B;  2R2Q A;  4K81 A;  1PVP A;  2D2Q A;  3QCA A;  3SYZ A;  4DF8 A;  3ISC A;  3HM3 A;  3ZDT A;  4LTU A;  1P98 A;  1UWM A;  5C3J B;  2QB0 A;  3NUH B;  2DZI A;  1WCL A;  2Q0Z X;  1A76 A;  5BOL A;  4MSQ B;  4JGH B;  2O6K A;  1STE A;  2P6U A;  5D2M B;  4YD2 A;  3KOO A;  5G5H A;  2BCQ A;  2QEJ C;  3VTV A;  8ICR A;  2GBM A;  4DXA B;  1E6E B;  3U7D A;  5BYS A;  5J2F A;  4QZD A;  5AKK A;  4PHP A;  1ET9 A;  3VTW A;  4KLT A;  2A19 A;  3K1Z A;  3M9N B;  4B9T A;  4OJ5 A;  5T14 A;  2WDV B;  3P4P B;  2INN E;  1V85 A;  1WXA A;  4EYI B;  3RN9 C;  1YX6 B;  3PVL A;  4AJW A;  4QW9 A;  3RNC C;  4NY0 A;  4WJN A;  4O9M A;  1QOG A;  3ETL A;  1NKC A;  2YLM A;  2I1K A;  2G3Q B;  2IGH A;  2PE6 B;  1ZXI A;  2IA6 A;  4E3C A;  2QB1 A;  4TUS A;  3BJY A;  1MSW D;  4MSM B;  1U47 A;  1FNU A;  2HBK A;  2J6S A;  1TV9 A;  4DSJ A;  1NEK B;  3AE7 B;  1U4B A;  2ZPN A;  4LZD A;  2WLB A;  4MEL A;  4JE3 B;  2XK5 B;  3JSV A;  1PK1 B;  2KEY A;  4RNN A;  4RQM A;  3SEB A;  4NAW B;  4LNK A;  2LM4 A;  5ALZ A;  3D32 A;  1SZH A;  5AKH A;  7ICI A;  3TAN A;  3JPS A;  1TYG B;  2JEJ A;  4NZL B;  4GXK A;  3PLV A;  4WQM A;  2AQ3 B;  2O6V B;  2Z7J A;  1JRU A;  2MBO A;  2EKE C;  2W9C B;  2ATL A;  1NNL A;  5ALS A;  1Z4O A;  5KT2 A;  3PX4 A;  2BKF A;  1TZ1 A;  1PYW D;  2KVZ A;  3L54 A;  2JWU A;  1JWS D;  1RQN A;  3H0R B;  4M02 A;  3T3N A;  2KFK A;  3AI5 A;  3H7I A;  5DG8 A;  4RGT A;  4JIO U;  1MQ3 A;  1WH3 A;  3ECI A;  1WE6 A;  4M6W B;  9ICV A;  3V6C B;  4ED8 A;  4DXG A;  3PW0 A;  4GXJ A;  4Z6D A;  1D5Z C;  1TKD A;  1TY2 A;  5KL8 B;  5L1M A;  2BW2 A;  4CE6 A;  2EKI A;  3APC A;  2BS3 B;  2K8H A;  2LHD A;  9ICX A;  3HW8 A;  5HG2 A;  2K4P A;  2WXI A;  1UWX A;  5AIC A;  2ALZ A;  2F1I A;  4R8U B;  2P35 A;  4DOB A;  1UCV A;  3WK5 A;  5J0W A;  5JZE B;  4O3O A;  3GV8 B;  3DBR B;  2TSS A;  2JF5 A;  4RPY A;  3MDC A;  3PV8 A;  1E0Z A;  2K60 A;  2F8K A;  4I29 A;  1B22 A;  1DOX A;  2K8B B;  2IBK A;  4QW8 A;  3PMN A;  2WAQ F;  2XEW A;  3C23 A;  1P7E A;  1OTR B;  4MAC A;  3HVD A;  1GO3 F;  5KFU A;  2IO2 B;  2RP5 A;  4PL1 A;  2ZIW B;  4IRD A;  4RU9 A;  4F3O A;  3RPF C;  1V2Y A;  4EBD A;  2GH1 A;  4YG2 A;  1NJW A;  4M9H A;  1OQQ A;  4XA5 A;  2WDT B;  4QAY A;  4BFR A;  2WXQ A;  1WGY A;  1ZP0 B;  3AUL A;  2DHZ A;  1MFW A;  2INP E;  1D9F A;  4FLH A;  1SV0 A;  4KLS A;  1SWW A;  2QHO A;  2OJR A;  5FP0 A;  2LFI A;  3IP4 B;  1PVQ A;  3Q69 A;  2J6T A;  4KMU A;  3HVZ A;  2ZJ5 A;  2WB1 F;  4FZL A;  1KL9 A;  5BMH A;  5I4D A;  1ZRM A;  2WXF A;  5KG2 A;  2ZNV C;  1C4C A;  4LJP B;  1VZ7 A;  2F2A B;  2RLT A;  2WDR B;  2FNJ B;  4LNO A;  3VC8 A;  1L4Z B;  4YR0 A;  3FIL A;  4CF5 A;  4F50 A;  4P0P A;  1TFR A;  3NVW A;  4YTP B;  2J7Q B;  1RZT A;  1C78 A;  3EZ5 A;  4OJP A;  3BZK A;  2MJ3 A;  2MP2 A;  4P1B C;  1ZD3 A;  2MCN B;  2HHX A;  4A8X C;  4EFO A;  3IG8 A;  4F2R A;  1WJU A;  4I28 A;  2UYZ B;  4P0Q A;  2KHW B;  1AWD A;  3V6E B;  1N6Z A;  4M04 A;  3PGE A;  1CI4 A;  4YP3 A;  5CHV C;  1I42 A;  9ICM A;  3HHM A;  1JX4 A;  2C7H A;  4MM3 B;  3WAP A;  2D3B A;  1P3Q U;  4I27 A;  2DUY A;  4B9N A;  1RYU A;  1IV8 A;  2GWS A;  1OFF A;  2QLT A;  2C2E A;  3ZGZ A;  2B76 B;  5ALI A;  1HJP A;  3PZD A;  3QQ8 B;  3VDZ A;  3I5J C;  1WI0 A;  4YT0 B;  5KFH A;  4QWE A;  1EWY C;  2EEL A;  2ZPY A;  4BKS D;  2J0J A;  2VIX A;  2Z0D B;  1YN3 A;  1D9D A;  4N58 A;  2NBV B;  1V86 A;  5J2E A;  4ECQ A;  2NPT B;  4EX7 A;  2VJ5 A;  4IM2 A;  5DBA A;  3NS8 A;  5ALL A;  1ZQP A;  3C2K A;  1QCK A;  2NRT A;  2XY6 A;  1UA1 A;  2E8P A;  2V9W A;  4C8L A;  5AM4 A;  2AYO B;  2NVU I;  2G5I B;  3A33 B;  3EA6 A;  4JWU C;  8ICG A;  2MH7 A;  1NBF C;  2HBL A;  4A3P A;  1VDV A;  3V3X A;  2ZUD A;  3GU3 A;  9ICE A;  3DBL B;  4BBN F;  4JPS A;  4D2K A;  4PHE A;  4S17 A;  4R65 A;  5DDY A;  5DB9 A;  1WG8 A;  2F8L A;  7ICG A;  3VFK A;  2LI6 A;  1L3U A;  1BPD A;  3KHH A;  3PO5 A;  3H40 A;  4HVB A;  3M8R A;  3BYT B;  5KT6 A;  3KYC D;  4NLZ A;  3WAN A;  3VVW B;  3KBB A;  2EDU A;  1Z00 A;  1YT3 A;  3ZNZ B;  2V3N A;  1F2R C;  1KFS A;  2XBB C;  2MBE A;  2PMZ C;  2KAN A;  5AKE A;  4DSL A;  2QC8 A;  3AEE B;  3KHG A;  1ZKH A;  3GFK B;  5AM3 A;  3H4B A;  4MF8 A;  2PXI A;  2Y5P A;  5KFZ A;  1N2X A;  4EYH B;  3TMP B;  2Y1I A;  5AI9 A;  2ZCC A;  5D7G A;  2NRX A;  2GB1 A;  5AKI A;  4PS7 A;  2YMQ A;  1S9F A;  3RR7 A;  4TQ0 A;  5KFO A;  1VD2 A;  3RBE A;  1NEN B;  8ICB A;  4QZE A;  2YVC A;  3SMV A;  2DEN B;  3OJ3 A;  3OJS A;  1L6N A;  3OWE B;  2CKH B;  3GIL A;  1QLB B;  3DDC B;  4A3O A;  2LUE A;  5HMM A;  4QZC A;  1EU4 A;  1R4N B;  4HJK A;  3QUB A;  1E8X A;  2KZZ A;  2I6X A;  3GZN I;  4DSE A;  2HDE A;  3DV9 A;  2XY7 A;  3DBS A;  3NJT A;  4C8N A;  3H7S A;  2EZZ A;  1MVK A;  4TSS A;  1AQ6 A;  3VHT C;  2KV2 A;  3P4R B;  4ZHP A;  4EKU A;  1HEZ E;  1IBX A;  3R7Q A;  3UMG A;  4UB5 A;  4GGQ A;  5L1J A;  1X9S A;  3LVW A;  5KFT A;  3RR8 A;  4JV2 A;  3N9Y C;  4WWP A;  3ZVV A;  2D11 A;  4MEM A;  1PZN A;  1EU3 A;  4J9S A;  2HMX A;  3AE3 B;  5E79 U;  4KLF A;  4FZM A;  2NS5 A;  4NJ6 A;  5L83 A;  2W3R A;  4W9J A;  4F8C B;  2BQ3 A;  2K89 A;  1EF1 A;  2IO0 B;  2L00 B;  2AHO B;  4OVU A;  2KVR A;  4I2G A;  2OCE A;  3A9J B;  1TKY A;  3VQI A;  5L9X A;  1HEK A;  3RJF A;  5J2D A;  2NRZ A;  4M9J A;  2K22 A;  2PFQ A;  1S97 A;  3T3O A;  2JY6 A;  1J2M A;  2WF5 A;  3GS2 A;  4DWI A;  2R18 A;  3TAD C;  1ZQE A;  1YNT E;  2WTF A;  1ZYQ A;  5HP4 A;  3V6J A;  4DDI D;  3PTF C;  5GMV A;  3CSF A;  1FPY A;  1ZUD 2;  3K9O B;  5KFB A;  1WIA A;  2CJN A;  2MJE A;  1IYF A;  4B9S A;  2PLP A;  4QZA A;  4QZB A;  5IIL A;  3MJW A;  4MHV A;  4OZA A;  3HKZ C;  3ZNG C;  3ZI4 A;  3UXO A;  2ZXI A;  1SL2 A;  4FHJ A;  4LLG M;  5AI5 A;  3TBL D;  3I28 A;  5DB7 A;  4DLG A;  1A70 A;  2ZEQ A;  3SAG A;  3K1R B;  3EFU A;  2DLB A;  3QAQ A;  4ELV A;  1ENF A;  3AQF A;  2HHQ A;  4P4P A;  2D3A A;  4M8N A;  4MFC A;  2IY1 B;  3DVG Y;  4GLS C;  3ZO5 B;  3RH5 A;  1XWL A;  3AH7 A;  3VCB A;  1XO0 A;  3D6J A;  2MQJ A;  2V1Y A;  2WX0 A;  4JLC A;  2A1J A;  2Y9T A;  3GZF A;  3P4Q B;  1ROE A;  2FJ6 A;  1UEL A;  2BCV A;  3LXF A;  2LUM A;  2E8M A;  1KKX A;  4HCP B;  3V05 A;  2HHT A;  2W7O A;  1EO6 A;  3OG5 A;  3CWI A;  4TQ1 A;  1QQ5 A;  3MC1 A;  4F4Y A;  3DDH A;  4HPP A;  2W3S A;  5E6N A;  3HIL A;  5DLF A;  2P6R A;  2XCP A;  1Z3E B;  9ICG A;  4IQV A;  2L52 A;  3IDW A;  4PPX A;  5J17 A;  1FIQ A;  2MJD A;  3AE6 B;  2G1E A;  1WMH B;  5EE3 A;  8ICJ A;  4P7I A;  3BZD B;  3N28 A;  1XCT L;  5TZV A;  2KIW A;  3C1Y A;  4XZ4 A;  2QIL A;  1SEB D;  4NM2 A;  1DGJ A;  1B0X A;  7ICM A;  2WFA A;  2DBY A;  3DHG C;  1SB3 C;  2KC2 A;  3PRZ A;  2ZCB A;  3PHX B;  3NZU A;  1K1Q A;  2AQ2 B;  4BOZ B;  3RD2 A;  5ALN A;  1FCC C;  2DZM A;  4X57 B;  2KHQ A;  3N20 C;  3PML A;  2H3V A;  2WHI A;  1GOZ A;  2ONQ A;  3ML8 A;  1IM4 A;  2GLE A;  3RF9 A;  2XGQ A;  4II2 B;  5E6O A;  4W9G A;  3UQB A;  1V1P B;  3ZD9 A;  3UPQ A;  1GPX A;  2KN5 A;  4MJS B;  1Q5W B;  2FDR A;  4RUA A;  3CIR B;  2RD0 A;  1Y56 A;  1ZQC A;  3AEG B;  2W54 A;  2KD0 A;  4ARI A;  5DB6 A;  2XK5 A;  3UXN A;  1T0R C;  1PK1 A;  3DOW A;  4Z6C A;  4NAW A;  1YQB A;  4B0E A;  4MT5 A;  3H7P B;  5ALF A;  1MI0 A;  4AQ7 A;  4NJ8 A;  4C0Z A;  4F4Z A;  2ZIV B;  4EEY A;  5H8Y E;  5KG1 A;  1NZB A;  4IWP A;  4YMO A;  2XI9 A;  1BVS A;  4HAI A;  2L5Y A;  3OHA A;  2O6V A;  4GSW A;  4DL5 A;  2W9C A;  2KKP A;  5J18 A;  3CRX A;  2KTR B;  2BKR B;  4DF4 A;  1Q46 A;  3MAB A;  1EF5 A;  2CJO A;  4CF3 A;  4IUM B;  5KG0 A;  4US8 A;  3GDX A;  2MUT B;  1XLQ A;  2ZJ8 A;  4PJ0 U;  3M7D A;  1PUZ A;  2LHT A;  3S6J A;  4M6W A;  3WU2 U;  2GI9 A;  2HTH A;  1WGD A;  5KFY A;  5HR6 A;  2YEP B;  2AEH A;  5ALO A;  8ICT A;  1KDH A;  4HPM B;  4ZRQ A;  2L3Z A;  3IM1 A;  1QSY A;  2RDH A;  2JHD A;  3QU7 A;  1JWU D;  1V97 A;  4M9G A;  3AM9 A;  1GAQ B;  4R8U A;  2HHU A;  2Z0E B;  5KFE A;  3MTN B;  3RJI A;  1MC8 A;  5J2B A;  4URK A;  4NLN A;  3AED B;  4KLI A;  8ICZ A;  4NWI A;  4J3O D;  4YSY B;  8ICE A;  2K8B A;  2YMM A;  4KLE A;  5AM1 A;  1QSS A;  2ZIX B;  1T6B X;  2M8S A;  2JU6 X;  3O0F A;  2HI0 A;  4YR2 A;  2KXJ A;  2Y5C A;  2ZIW A;  2UU7 A;  3X0W A;  8ICM A;  3T5K A;  1YD8 U;  1C77 A;  3BK2 A;  4FS2 A;  2JRZ A;  4NM1 A;  2KSO B;  1UH6 A;  3QIJ A;  2KJ5 A;  2PFP A;  7ICT A;  1L5P A;  3GQC A;  2JT4 B;  1X9X A;  3VTU A;  2ZVN A;  1ZQB A;  4OW0 A;  3PW2 A;  3O13 A;  3QA8 A;  1GC6 A;  4ECZ A;  1J2N A;  2GBN A;  2LZ6 A;  1ZQM A;  4DO9 A;  3AE2 B;  3M95 A;  2D3C A;  3ZD8 A;  5EWE A;  2VA3 A;  2AGQ A;  2VZK D;  3DWG C;  2WAQ C;  4F4K A;  3U7Z A;  3EGR A;  5H92 C;  1BPY A;  4KLJ A;  2BYF A;  2UVU A;  1AAR A;  1HZ6 A;  1P7F A;  2ZUB A;  5IIN A;  2J52 A;  2KK0 A;  3A0H U;  1Q8K A;  1K52 A;  1ZD2 P;  1V1O A;  2B3A A;  3ZTD A;  9ICJ A;  1PVR A;  1KBU A;  4DL2 A;  1RG6 A;  1U9L A;  1I4X A;  2FE8 A;  5IIO A;  1GJZ A;  2K4E A;  3IN5 A;  4FE3 A;  2W9B B;  4DS5 A;  2B6G A;  4FBU A;  3MC8 A;  3UIN B;  2KMA A;  4AJY B;  1JMS A;  2WB1 C;  1KRP A;  3M8S A;  5KT3 A;  3LVV A;  1ZQ1 C;  1KLU D;  1YZ6 A;  3Q3M C;  1SF0 A;  3PX6 A;  3Q2A C;  2ACZ B;  2IZV B;  1MJD A;  4MM3 A;  4HKQ A;  1N62 A;  1V9J A;  4RT3 A;  4EZL A;  4PL2 A;  4UB3 A;  2EAM A;  4QZ9 A;  2M0N A;  1E7U A;  2JRI B;  2WXP A;  2KJ9 A;  3M6K A;  5KNI A;  1E7V A;  4TUU A;  3JPT A;  2BDU A;  3F53 A;  4J9P A;  9ICN A;  1TGZ B;  3QYP A;  1T0Q C;  4S0R A;  3RJE A;  2KAC A;  3C19 A;  3ZUN A;  4FBJ B;  4YFK A;  4YQW A;  1L4D B;  1RFA A;  2BR0 A;  3ONS A;  1LO5 D;  2NPT A;  2PMV A;  2AX5 A;  1V80 A;  1QQ7 A;  2H5X A;  3TFR A;  2MBB B;  4M8M A;  3M6Z A;  2H3F A;  1L0Y B;  2EAN A;  3MHS D;  4KN4 A;  3U30 A;  5JHB A;  3HJE A;  3KLS X;  2R8H A;  2HOF A;  4ED0 A;  5AK3 A;  1L0X B;  2QAR B;  1VRA B;  4G9B A;  5AUK A;  7ICO A;  1R4M B;  4TQR A;  4ECR A;  5AI4 A;  1NKE A;  4G3I A;  4DEZ A;  4MDK E;  3PST A;  1QF6 A;  2KP7 A;  1L8L A;  4EX6 A;  1PGB A;  1JCK B;  4MFF A;  4PZN A;  2JPH A;  3ZW3 A;  2J6U A;  8ICK A;  4NXZ A;  2XN9 C;  1SL0 A;  2IOF A;  1XU4 A;  4IQT A;  5J8Y C;  8ICN A;  2FIF A;  4Z6E A;  5ALG A;  4EBE A;  1P9D U;  1N56 A;  2IYD B;  1H8C A;  4BWJ A;  4PGY A;  3F2B A;  2ZIU B;  3WK8 A;  4KLD A;  5J0X A;  5AK6 A;  1X66 A;  2KKC A;  5ALM A;  5D4B A;  2UWQ A;  2NTT A;  3U8Z A;  2IMW P;  2GLS A;  4ANX A;  2JVC A;  4BBN C;  2DL0 A;  2DAF A;  1K53 A;  2JXJ A;  5DPW A;  4ICA A;  5JUM A;  3ISB A;  2G09 A;  3L17 A;  4I2J A;  3M63 B;  2LJI A;  2D3D A;  4RF0 A;  3H8W A;  1ARO P;  3ZDM C;  3CF6 E;  4B95 A;  4IR1 A;  2HVI A;  5CEH A;  5DKW A;  3V72 A;  3RH4 A;  4YMM A;  1YZ7 A;  3HWT A;  4MF2 A;  1T8E A;  5D94 A;  3H4D A;  3VRA B;  9ICF A;  4M9L A;  4LZG A;  4K4G A;  1CEZ A;  1VLB A;  3WKC A;  4DQP A;  1BT0 A;  1E9M A;  3A4S C;  5KFN A;  2BB6 A;  2RDJ A;  4EOY A;  2A1A A;  4ZOH C;  1WGG A;  2V4L A;  2J0K A;  1QH9 A;  1T3Q A;  1I35 A;  4UAR A;  5HML A;  3ZJV A;  3PRE A;  5DGB A;  1FXI A;  4Y2J A;  2J4X A;  2Y9U A;  3DBR I;  1JQ4 A;  5T8I A;  5DPT A;  4GOC A;  2LYH A;  4Y2X A;  2EMT A;  4LVS A;  3AE5 B;  3KKA A;  4LCD E;  3NZS A;  5CHW A;  3LYY A;  3CST A;  4RCO A;  5AZF A;  1D6E C;  4PT5 A;  5KFF A;  2BT6 A;  2G07 A;  1FFU A;  3AQE A;  4WWM A;  2MSE D;  5CHG A;  2UVW A;  5CRX A;  2BB5 A;  2C60 A;  1J97 A;  1LFD A;  3A9J A;  3EHV A;  2W9A A;  1J8C A;  3L0W B;  3U4E G;  3NVY A;  3JPP A;  3Q8B A;  1OW5 A;  2JZ3 B;  5KHO A;  4ANW A;  2KDM A;  2BKE A;  1NYQ A;  1Z2M A;  1ECW A;  1ZQO A;  1NK4 A;  2KJ6 A;  3AV8 A;  1NI3 A;  4KZC A;  2WXN A;  5TR5 A;  2KIC A;  2FAZ A;  2W03 A;  5KFQ A;  2WNM A;  3EWA A;  2WU2 B;  1UT8 A;  2F1J A;  1BXT A;  2CHW A;  2JXX A;  1UQV A;  2DF4 B;  3V61 A;  3G6X A;  1ZQI A;  2LVO A;  2XGP A;  2KOX A;  3QZ7 A;  3JPN A;  3DHI C;  3NOB A;  1RM6 C;  3OJU A;  3EW9 A;  2QIE B;  4FO6 A;  2IHM A;  5FR3 A;  1S0N A;  4UAY A;  1F77 A;  5AI0 A;  3AEB B;  2LI5 A;  2W11 A;  3W1S A;  1OUQ A;  2KJR A;  4RQ3 A;  4H2A A;  4NLB A;  1XQQ A;  4HK2 A;  4M0A A;  1HXY D;  4RQ6 A;  4ED3 A;  1P0R A;  2XIC A;  3ETR A;  3H0M B;  1S10 A;  1DOQ A;  4DWF A;  3Q3O C;  1ESF A;  2VA8 A;  3E2E A;  5IIK A;  1BPE A;  2ODG A;  2BWE S;  4ZH4 A;  1S76 D;  3CNH A;  2MSN A;  3IFW B;  2KFJ A;  2QSD A;  4BJQ A;  1S77 D;  4IR9 A;  4PYU A;  4ANV A;  2E5S A;  4UW9 A;  3GIJ A;  2UVV A;  4WJO A;  4TQS A;  1XEE A;  1ZRN A;  1A6S A;  4KIK B;  1ZD4 A;  2ISP A;  1SXE A;  1SIF A;  2SAK A;  4BWM A;  4F5Q A;  1WXV A;  4EE2 A;  1WM2 A;  2VAN A;  2K8C B;  3RB4 A;  1B43 A;  7ICV A;  1ZGU B;  1JI7 A;  2NTS A;  4Y2S A;  3D2S A;  1K51 A;  4J9L A;  2EZY A;  1E8W A;  3B2F A;  2AL3 A;  3IT4 B;  1AYF A;  4MGZ E;  4DFJ A;  3RB0 A;  3B2G A;  2VZK B;  4B9V A;  1WXS A;  5AZH A;  1ZQY A;  4QIW F;  3MGI A;  8ICI A;  1UBI A;  1WMH A;  3DVN V;  3BQT A;  4BX9 C;  5EOZ A;  1FNW A;  4GN1 A;  4LJX A;  1V81 A;  5EE0 A;  1WXM A;  1IGD A;  1QQR A;  2C7M B;  2K6Q A;  2PI4 A;  1AW7 A;  1XT9 B;  3DBL I;  1KN5 A;  3RNE C;  3RUI B;  5AIB A;  3IXS A;  2NR2 A;  5AEK B;  4UB6 U;  1O08 A;  4ED6 A;  1SL1 A;  5JHA A;  4AS1 A;  1ZQG A;  4Q44 A;  4MGY E;  3NZ3 A;  7ICL A;  1B1Z A;  4Y2Y A;  4ELT A;  2JH7 A;  2M0A A;  3ZQ4 A;  3W5U B;  5B5E U;  4UAT A;  5BMI A;  4IC9 A;  4I2C A;  1A0P A;  1WGR A;  1V1P A;  2N9X A;  3OSN A;  1XCQ L;  1KLG D;  4MJS A;  3BIN A;  3RMK C;  4W9E A;  3N1X C;  4OD0 A;  5HHI A;  1DYQ A;  4M2Y A;  2XVT A;  9ICS A;  9ICO A;  4NJC A;  5DQG A;  1HTQ A;  1I4Q A;  2MRP A;  3QHT A;  2X8X X;  3H7P A;  1LVH A;  1FRR A;  3GB1 A;  3RNF C;  3QZ8 A;  4P4M A;  1RLF A;  3Q8C A;  2ZIV A;  5J2R A;  4TUQ A;  3KD3 A;  2IDY A;  2KYW A;  1RFK A;  3RB6 A;  4RNO A;  4BKS A;  4QWC A;  4TMA B;  4E74 A;  3BQ7 A;  1I7H A;  1CZP A;  2YTU A;  2JQR B;  5KAI U;  4LNF A;  2KTR A;  1WWU A;  4I2D A;  8ICS A;  2KZR A;  2GBK A;  4I2F A;  3F5E A;  1WRD B;  2KLC A;  3U2S C;  5F9N A;  3Q8A A;  2MUT A;  2XNA C;  4M47 A;  1X2I A;  1R4N I;  4DFM A;  1M4V A;  1V9P A;  1RYJ A;  2A5U A;  3CW2 C;  4QZH A;  4ZRP A;  2V3P A;  1J7B A;  1JWA D;  2DZK A;  3SDL C;  4XRH A;  3AL0 B;  3RRH A;  2F76 X;  3ENE A;  2PFO A;  3MFH A;  1L3V A;  4PS3 A;  5ALR A;  4US9 A;  4C4V B;  1SZP A;  4IW0 A;  8ICC A;  3MHZ A;  3TFS A;  2JEF A;  3QX1 A;  4DL7 A;  3W5V B;  1KRH A;  3HPO A;  3PHW B;  1V8C A;  5DG9 A;  1JIH A;  1YJI A;  3WAM A;  2MBQ A;  4ECW A;  5III A;  4I6L B;  2D07 B;  4W9I A;  2ZIX A;  1L6U A;  1JRP A;  4UAS A;  1S5L U;  3ZDE A;  1IUE A;  3ALB A;  4NLG A;  1FMA D;  2GOW A;  2LXA A;  1TS3 A;  1BPX A;  3SEI A;  2ICI A;  3R66 C;  2WP9 B;  5AM5 A;  2HBJ A;  1VZ8 A;  2ZJD A;  2KSO A;  5KL1 B;  3MGV A;  2GBR A;  3LJ3 A;  3KH0 A;  1M6Y A;  2VH2 A;  3BII D;  2KG5 A;  2BWF A;  2KQS A;  3QU4 A;  4RZR A;  7ICE A;  1SE9 A;  1GNU A;  1KM7 A;  1SV4 A;  3KKA C;  4AUQ C;  5HHH A;  2FCM A;  4M0W A;  4NLC A;  4C4R A;  1BML C;  7ICJ A;  1QKZ A;  1YQ4 B;  2LYB A;  4I6P A;  2NO4 A;  1H38 A;  2L7R A;  1ZQZ A;  1SSN A;  2LHE A;  3OHB A;  2CHZ A;  2Z8L A;  2MA1 A;  5JU5 A;  3R3M A;  4MGI E;  4YXJ A;  2NMQ A;  3F2D A;  2ZNV B;  2ZTD A;  4FJY A;  2N9K A;  5LNK 1;  3SD5 A;  5C1Z A;  2CR5 A;  2W9B A;  3UQ0 A;  4ICU A;  2KWD A;  2C9W B;  4Y2V A;  1LB2 B;  4UBC A;  1IP9 A;  1YMH E;  4YVZ A;  1QQ6 A;  7ICU A;  4LNN A;  3V7J A;  2Y1J A;  3JPO A;  4NLK A;  5J2J A;  2N9E B;  1TBE A;  3H8J A;  1DXS A;  1C7Y A;  5ALX A;  1DRG A;  1WZ0 A;  4B9K A;  2LGX A;  2WWZ A;  4PK1 A;  1XD3 B;  4ECV A;  4XDD A;  3PO4 A;  3A0B U;  1X6I A;  2XY5 A;  4GDK B;  4GMV A;  4F5R A;  4ED7 A;  1SJE D;  3MBY A;  1L7Y A;  1IGC A;  4JMU A;  5KG7 A;  3LDA A;  3T5J A;  2HHW A;  2ZXH A;  1XLP A;  4WJ3 B;  1L7P A;  7ICS A;  3L16 A;  5CWR A;  4CYE A;  2ZG6 A;  3T5L A;  4TV3 A;  3IG5 A;  5KG3 A;  3URY A;  2SEB D;  3R9K A;  2BGF A;  1WX7 A;  2QDF A;  3EFC A;  3N97 B;  1S0V A;  2OYY A;  3U52 E;  2HE7 A;  3SFE B;  4MH0 E;  1TAQ A;  4BKT A;  3I3T B;  1WGH A;  3SD7 A;  3Q8K A;  4P6V F;  2G4D B;  8ICL A;  3V62 A;  2LMC A;  2NV3 A;  4UAZ A;  1RXV A;  2KTF A;  5KG5 A;  3H8H A;  5EE9 A;  2QAR A;  2RPV A;  5J2C A;  4KX5 A;  1JRO A;  2F44 A;  3PX0 A;  3PS6 A;  2KWC A;  1UNS A;  2DYO A;  1MG8 A;  4A90 A;  2PJH A;  2JXT A;  1LKY B;  3UM9 A;  3Q8S B;  2FMQ A;  2MLB A;  1ZET A;  5MPO A;  5KFP A;  1U4A A;  2IY0 B;  4RT2 A;  4TUP A;  3EPG A;  3X23 A;  2IHN A;  1OQR A;  4DDG D;  2ZIU A;  3IRU A;  2I9G A;  1L7N A;  3WK6 A;  9ICU A;  2LGD A;  1C79 A;  2FCN A;  3ZDC A;  2RDI A;  1FM0 D;  1E7P B;  2AQ4 A;  4W9K A;  1YQ3 B;  3H8S A;  3C5F A;  3QE9 Y;  3I9V 1;  2KFZ A;  4NY8 A;  8ICV A;  3Q14 C;  2OJW A;  3QEA Z;  1E8Y A;  1Z5S B;  3DCG A;  5BO4 B;  1N60 A;  3UGB B;  3KVF B;  3VUX A;  1NK6 A;  4RH6 A;  5KFR A;  4JX1 C;  1SV0 C;  2JV3 A;  1ZQH A;  3BVZ A;  4GFJ A;  1FO4 A;  3HX0 A;  2KOB A;  5J29 A;  2HJ8 A;  3WK4 A;  3C2L A;  3BDP A;  2LRU A;  2WU5 B;  3M1Y A;  2LGS A;  2AH5 A;  3PY8 A;  1HUO A;  5AK5 A;  5IIJ A;  4Y2T A;  1WRI A;  2K8A A;  4QZG A;  4PHD A;  4B6W A;  4RM8 A;  5J0O A;  2Y3A A;  4J9O A;  4Y2P A;  4EBC A;  4OJL A;  1SXT A;  3QJZ A;  4IKG A;  4K7U A;  4F5N A;  3PW5 A;  2UVR A;  2MX2 A;  1LV5 A;  2WXM A;  1D8L A;  3KZI U;  3A1Q B;  2WS3 B;  5ALW A;  3RJG A;  3ZTC A;  3BQ0 A;  3D2N A;  2A3V A;  4G50 A;  3N4M B;  4ANU A;  2MHJ A;  2N0S B;  4IC7 B;  1RPL A;  1YN4 A;  3N7S C;  1UT5 A;  3RB3 A;  9ICT A;  5KFM A;  4L23 A;  3FC4 A;  1RQL A;  4ECU A;  5HFY A;  1SJH D;  4IWQ A;  3TEX A;  3Q3N C;  1ZJM A;  4FXC A;  2KDI A;  4JWN A;  4DHJ D;  3IAS 1;  5AK4 A;  4USA A;  7ICF A;  2BVC A;  5IKC M;  5G5G A;  2IPK D;  5CR0 A;  5KT5 A;  4I2I A;  4AP4 C;  4ARC A;  2KVS A;  2BQR A;  4O5K A;  4NL9 A;  1V5T A;  3WAL A;  2FLN A;  2XC9 A;  1C9F A;  2IOH A;  4XGA B;  2MEK A;  4UB2 A;  4WQO B;  3ZXR A;  2KK8 A;  3ZNI D;  1RXW A;  5DBC A;  3AU5 A;  2RMM A;  8ICW A;  3ED5 A;  4ED2 A;  1D5M C;  1UD7 A;  1J7C A;  3L4P A;  2G9H D;  1YX5 B;  4IRC A;  3C21 A;  7ICN A;  1C76 A;  2O2V B;  5ALK A;  1WR6 E;  3MGH A;  4ELU A;  1Q3V A;  2R8G A;  1TK5 A;  1C4P A;  3L10 B;  5DDM A;  4FBT A;  5C0Y A;  3P4S B;  3ZJU A;  1GC7 A;  3WKD A;  1UPH A;  1UGM A;  4CNQ A;  5H2F U;  1RRB A;  2WXG A;  2Y5B B;  3SU8 X;  2N1W A;  2B21 A;  1X42 A;  2FBW B;  2RHF A;  2KJH B;  2AL6 A;  2PFN A;  5KG6 A;  2EZX A;  8ICY A;  4KKJ A;  1ZQS A;  2HDO A;  1FCL A;  3Q3F A;  2PW9 A;  3SI8 A;  1C20 A;  5KFJ A;  1R7S A;  1V5O A;  4II3 B;  1T5X D;  4GIB A;  2KWU B;  5J2A A;  4ACF A;  2WXJ A;  4RMA A;  4GDL B;  1F1H A;  1VCB A;  7ICK A;  4M00 A;  3KZX A;  5ALV A;  4XQ8 A;  1C1Y B;  1LQB A;  5AKL A;  5KFC A;  3B0A A;  1LGR A;  3P2B A;  4WWO A;  2JRH A;  1G6J A;  4KIK A;  2L83 A;  4G3X B;  3G6V A;  2KE7 A;  2DNF A;  3RJK A;  3IG3 A;  2LEK A;  4RQ1 A;  2YY6 A;  3E0F A;  2K8C A;  3Q3J A;  5K4L A;  3JW0 X;  3G6Y A;  1SKS A;  3SEN A;  4WH4 A;  2P66 A;  1MA7 A;  4KTQ A;  3PRM B;  3V60 A;  2QKQ A;  2I1J A;  1S3S G;  1Q3U A;  3TKA A;  3QU2 A;  4N6E B;  5C5J A;  8ICQ A;  2ZTE A;  1L3T A;  1L5U A;  3TAQ A;  3AEA B;  4W9F A;  3OSP A;  5ALT A;  1CUK A;  1XS9 D;  3H0L B;  4F8R A;  1R4M I;  1VZ6 A;  4F72 A;  1KOT A;  2OED A;  5KFI A;  4M9N A;  3TJP A;  5CX3 A;  4UAW A;  1ZW7 A;  2BS2 B;  3PR5 B;  1V49 A;  4F5O A;  2KMC A;  1L7M A;  1X40 A;  1NZP A;  2JEI A;  2HJ1 A;  1X1M A;  9ICR A;  1KQQ A;  1D8Y A;  1VJ5 A;  2HCF A;  1EUV B;  4JUZ A;  2LM1 A;  3ONN A;  4QIW C;  4RQN A;  4RQ5 A;  1QSL A;  5KHQ A;  4C00 A;  1ZQX A;  5GXG B;  4HJG E;  3T9L A;  2NYV A;  5KFK A;  3F2C A;  1COO A;  2ZUC A;  1RYR A;  2HD5 B;  2KN4 A;  4M0W B;  4IL6 U; 
#chains in the Genus database with same CATH homology
 4JWS C;  4REZ A;  2K0P A;  3AE5 B;  3AMZ A;  1I4P A;  1WSP A;  1JML A;  1WXQ A;  1TZO A;  1SBB B;  3LYY A;  4MM3 B;  4YXD B;  1GB1 A;  4RCO A;  3W2D A;  2WXH A;  1D6E C;  4PT5 A;  2BT6 A;  4KX6 B;  1FFU A;  1UGJ A;  2BS4 B;  4WWM A;  1OFF A;  2BB5 A;  3ZGZ A;  5TSS A;  2B76 B;  3TEW A;  3U4E G;  2V0G A;  3NVY A;  3Q8B A;  4YT0 B;  2PIA A;  1EWY C;  2KDM A;  2EEL A;  1NYQ A;  1ZXH A;  1QIL A;  4OHJ A;  4C56 C;  4N58 A;  2BTE A;  1YN3 A;  3AV8 A;  2L32 A;  1NI3 A;  2WXN A;  4C7Z A;  3MFG A;  3TEY A;  1TY0 A;  4ITK A;  1XF5 L;  2WNM A;  2WU2 B;  1BXT A;  3PZ7 A;  5BYQ A;  4YTM B;  1RM6 C;  3EA6 A;  4JWU C;  4XDC A;  2MH7 A;  1EM7 A;  2QIE B;  2M19 A;  3PZ8 A;  3BWU D;  1KH0 A;  4A55 A;  5FR3 A;  1DOY A;  3ABV B;  2M56 B;  1VDV A;  1SE2 A;  3V3X A;  2BYT A;  2QJL A;  1F77 A;  4JPS A;  3AEB B;  4D2K A;  3MC0 B;  3W1S A;  4H2A A;  4A6Q A;  1HXY D;  3ETR A;  1J7A A;  1ESF A;  3MP9 A;  3BYT B;  1TKE A;  4R3D A;  3SR6 A;  1MPE A;  2V3N A;  2QSD A;  1F2R C;  2BBC A;  5C2T B;  3AEE B;  1XEE A;  1B9R A;  2Y5P A;  3E9S A;  2WXL A;  2SAK A;  4EE2 A;  4KGR A;  4C80 A;  2NTS A;  1K51 A;  1HQR D;  3AEF B;  5D7G A;  2GB1 A;  3B2F A;  1PFD A;  3IT4 B;  3R2I A;  5E6J A;  1AYF A;  3AE1 B;  3B2G A;  2VZK B;  4TQ0 A;  1I4G A;  1NEN B;  1I4R A;  4YTN B;  3RFZ B;  1FNW A;  1N61 A;  4P16 A;  4WIP A;  1YN5 A;  5BYR A;  5EE0 A;  1IGD A;  1QQR A;  3B9J A;  3OWE B;  4HRO A;  3NVV A;  1AW7 A;  1QLB B;  1D5X C;  1EU4 A;  3R8B A;  2D5G A;  1TJE A;  2AQ1 B;  3IXS A;  2WQY B;  3FIL B;  4YSZ B;  2HDE A;  1SIJ A;  1TKG A;  4AS1 A;  3P1M A;  4C7Y A;  1MVK A;  4TSS A;  3NZ3 A;  1B1Z A;  3W9C B;  1PDX A;  2M0A A;  3ZQ4 A;  3P4R B;  3W5U B;  1NYR A;  4YSX B;  4ZHP A;  1JWB D;  5BMI A;  1HEZ E;  1IBX A;  3GP7 A;  1V1P A;  2N9L A;  3FAH A;  1XCQ L;  1KLG D;  3N9Y C;  2FUG 1;  4N59 A;  2IJ0 A;  1DYQ A;  4RF1 A;  3C8Y A;  1EU3 A;  4NJC A;  1I4Q A;  3AE3 B;  4Q2J A;  2YEP F;  3EUB 2;  1FRR A;  3GB1 A;  3R2T A;  2W3R A;  4HKZ E;  5HHD G;  3Q8C A;  3NVZ A;  2ZW0 A;  1F0Z A;  1CJE A;  2IDY A;  3Q8E A;  1RFK A;  3BK1 A;  3BVG A;  4XE0 A;  1TKY A;  4TMA B;  2H88 B;  3VQI A;  1I7H A;  1CZP A;  2JQR B;  5FKA C;  3HUI A;  3VR8 B;  5JXV A;  2K22 A;  3U2S C;  2W55 A;  3Q8A A;  4LK0 M;  3T3O A;  2XNA C;  3UI3 A;  1KTK A;  3GS2 A;  1M4V A;  2PVG C;  1RYJ A;  1YJJ A;  1YNT E;  1C4A A;  3AB5 A;  1JAL A;  2V3P A;  1TS5 A;  3J9C A;  1J7B A;  1JWA D;  4ZRP A;  1KF6 B;  1ZUD 2;  4KKI A;  2CJN A;  1ZE3 D;  2MJE A;  4XWT A;  2PLP A;  2PTL A;  4US9 A;  1FEH A;  3IAM 1;  4OZA A;  3BYY B;  3MHZ A;  2JYT A;  3W5V B;  1KRH A;  4LLG M;  1V8C A;  1YJI A;  1A70 A;  2DLB A;  1ENF A;  3WCQ A;  1L6U A;  4DQO C;  1JRP A;  1IUE A;  4ZYS A;  1FMA D;  4GLS C;  3AN1 A;  1TS3 A;  4MH8 A;  2KAJ A;  3AH7 A;  2ICI A;  2WP9 B;  3P4Q B;  1ROE A;  1VZ8 A;  3LXF A;  1HA5 A;  2LUM A;  3V05 A;  2WXK A;  2N7J A;  2ON8 A;  4CQN A;  3BII D;  1ET6 A;  4TQ1 A;  2ZW1 A;  3CWI A;  3TEZ A;  1WYG A;  4KGT A;  3E56 A;  2Q5W D;  1GB4 A;  2W3S A;  1FXA A;  1ACC A;  1FRD A;  4M0W A;  1AN8 A;  2L52 A;  1N5W A;  1FIQ A;  2WXO A;  4WAF A;  4IOI E;  1CQV A;  2MJD A;  3AE6 B;  2G1E A;  1BML C;  2K5P A;  1QKZ A;  1YQ4 B;  5EE3 A;  3TSS A;  1XXG A;  3BZD B;  1XCT L;  2H89 B;  2R61 A;  1SSN A;  2LHE A;  2WXR A;  1RWS A;  2QIL A;  1I4H A;  2Z8L A;  1SEB D;  1JW9 D;  1DGJ A;  2NMQ A;  2DBY A;  4DXF A;  1SB3 C;  5AUI A;  2AQ2 B;  2N9K A;  5LNK 1;  2J53 A;  2KWD A;  1FCC C;  2IGD A;  2QMT A;  3P63 A;  1GOZ A;  2ONQ A;  3P42 A;  1YMH E;  2HTM E;  1VJK A;  1ZOY B;  3PO0 A;  1IBX B;  1V1P B;  2PVO D;  1QOA A;  1GPX A;  2LGI A;  3DWM A;  4L2Y A;  4OZB A;  2JZP A;  3CIR B;  3ZYY X;  1Y56 A;  3AEG B;  2W54 A;  2I38 A;  4ARI A;  4XDD A;  4B0E A;  4MT5 A;  1ZDV A;  4GDK B;  1PUT A;  4RGO S;  1MI0 A;  2J42 A;  2L1A A;  3AE9 B;  1SJE D;  4B0M A;  4AQ7 A;  1IGC A;  5H8Y E;  1XLP A;  2I2Y A;  3URY A;  2SEB D;  1WGK A;  1XLN A;  1L6V A;  3U52 E;  3SFE B;  2CJO A;  4P6V F;  4US8 A;  1N63 A;  1XLQ A;  1FNV A;  2LMC A;  4RNA A;  4RFB A;  1XLO A;  3H8H A;  5EE9 A;  2RPV A;  2GI9 A;  2YEP B;  1JRO A;  5FK9 C;  1UNS A;  1ZDX A;  2DYO A;  4ZRQ A;  4A90 A;  2JXT A;  1TS2 A;  3AE8 B;  2RDH A;  2KQ4 X;  1JWU D;  1V97 A;  5MPO A;  5EE1 A;  4RGN A;  3AM9 A;  1GAQ B;  1D4B A;  2KMM A;  1QOF A;  4YWG G;  1Q10 A;  1OQR A;  3SFD B;  3AED B;  1L0V B;  2GRI A;  2V4I B;  2W82 A;  4J3O D;  4YSY B;  1NVI D;  1E10 A;  1T6B X;  3HRD D;  1C79 A;  2JU6 X;  1SE4 A;  1FM0 D;  1E7P B;  2Y5C A;  1YQ3 B;  4HRS A;  2CU3 A;  3BK2 A;  1C77 A;  3I9V 1;  4HEA 1;  1EWC A;  1L5P A;  4ZHO A;  3ZJT A;  5D3I B;  1N60 A;  4OW0 A;  1SE3 A;  1PGA A;  4RH6 A;  2PKO A;  4JX1 C;  3O13 A;  1TS4 A;  3BVZ A;  1FO4 A;  3NRZ A;  3AE2 B;  2WU5 B;  4KGS A;  1UWM A;  4LTU A;  5C3J B;  3NUH B;  2VZK D;  3DWG C;  3U7Z A;  5BMG A;  3EGR A;  5H92 C;  1WRI A;  1HZ6 A;  1P7F A;  1MHX A;  2Y3A A;  2K9X A;  2J52 A;  1STE A;  1SXT A;  5G5H A;  1VR9 A;  1K52 A;  4IKG A;  3BVM A;  2QEJ C;  1V1O A;  3VR9 B;  2WXM A;  1E6E B;  2K3U A;  5BYS A;  1ET9 A;  3Q8F A;  1JWM D;  2DYM A;  1I4X A;  2FE8 A;  2WS3 B;  2WDV B;  3P4P B;  2INN E;  1ZPS A;  2E6X A;  2DWQ A;  2N0S B;  3IT6 B;  1YN4 A;  1QOG A;  2IGH A;  3LB8 C;  4UDU C;  1ZXI A;  1UUP A;  1KLU D;  4L23 A;  3FC4 A;  5HFY A;  5HI1 A;  3AEC B;  1SJH D;  3TEX A;  1FNU A;  1SF0 A;  4FXC A;  1F2R I;  2ACZ B;  1NEK B;  3AE7 B;  2WDQ B;  3IAS 1;  4USA A;  1N62 A;  2JSV X;  4HKQ A;  2WLB A;  3VRB B;  4JE3 B;  2WXP A;  5G5G A;  2IPK D;  3SEB A;  4NAW B;  4ARC A;  4O1N A;  1C9F A;  2KAC A;  1KFY B;  1TYG B;  2X38 A;  2MEK A;  1XO3 A;  4NZL B;  1PGX A;  1L4D B;  2OHF A;  4WQM A;  2AQ3 B;  1LO5 D;  2RMM A;  2PMV A;  2AX5 A;  1D5M C;  1J7C A;  3L4P A;  2G9H D;  1DOI A;  1C76 A;  1QT9 A;  1L0Y B;  1PYW D;  4OVZ A;  2JWU A;  1JWS D;  4XWW A;  3T3N A;  2RDG A;  3KLS X;  1C4P A;  4RGT A;  3KWL A;  3P4S B;  3ZJU A;  1L0X B;  1N5X A;  1VRA B;  5AUK A;  4DXG A;  4NAM A;  1FFV A;  3NS1 A;  2WXG A;  1D5Z C;  3MJ5 A;  1TY2 A;  1QF6 A;  1K50 A;  1MHH E;  1WWT A;  2BW2 A;  2FBW B;  2EKI A;  2BS3 B;  1PGB A;  1JCK B;  2LHD A;  4KKJ A;  2XN9 C;  1BUI C;  2WXI A;  5HG2 A;  1UWX A;  1FCL A;  2PW9 A;  1R7S A;  3TUO A;  2TSS A;  4RGM A;  1E0Z A;  1T5X D;  2IGG A;  4WUR A;  4IDI A;  2WXJ A;  1DOX A;  4GDL B;  2NTT A;  1P7E A;  4MAC A;  3HVD A;  2L83 A;  3KQ4 A;  1K53 A;  3RPF C;  2LEK A;  1OQQ A;  3KWV A;  2E3T A;  2WXQ A;  2JX5 A;  1FD6 A;  1ZP0 B;  2LJI A;  3I57 A;  1CK1 A;  4WH4 A;  2JYE A;  4RF0 A;  2INP E;  4N6E B;  2LFI A;  3AEA B;  3Q69 A;  3VRA B;  3HVZ A;  5BMH A;  1VLB A;  2WXF A;  5D3D A;  5I4D A;  1VZ6 A;  1E9M A;  2BB6 A;  1C4C A;  2OED A;  4ZOH C;  1VZ7 A;  2WDR B;  4L1B A;  1T3Q A;  1L4Z B;  2BS2 B;  3FIL A;  3AE4 B;  3NVW A;  4YTP B;  3ZJV A;  1C78 A;  1FXI A;  1QOB A;  4OZC A;  4A9A A;  2J4X A;  2MJ3 A;  1JQ4 A;  5T8I A;  4A8X C;  5GXG B;  4HJG E;  1AWD A;  1HZ5 A;  2KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...