3NVZA

Crystal structure of bovine xanthine oxidase in complex with indole-3-aldehyde
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvzA01
2MJEA 2W3RA 3AECB 3B9JA 1FXIA 3AMZA 2EKIA 1YJIA 2PVGC 2WQYB 3AEGB 3AEAB 5MPOA 5EE9A 1DOYA 2G1EA 3AE6B 4WWMA 3AE3B 1N5WA 1E0ZA 3SR6A 2PKOA 1RYJA 4N6EB 3NVZA 3VR9B 1TKYA 1EWYC 3NVYA 1WWTA 3KWLA 4A9AA 4HRSA 1L6VA 3RPFC 1AYFA 4N58A 1TKGA 1J7BA 2MJDA 3AE5B 3AE1B 3CIRB 3P4QB 1E9MA 3W5VB 1FFVA 1N60A 1ZUD2 2BS2B 2CU3A 2K9XA 4JWSC 1WRIA 2CJNA 1FRDA 1E7PB 1YQ3B 2MJ3A 3AE7B 1NVID 1V8CA 1FO4A 1PFDA 1NYQA 1TYGB 4HROA 1QF6A 1NENB 5AUKA 1DOXA 3AEBB 3VRBB 2W55A 1FFUA 1JALA 2L83A 5EE1A 1CZPA 4YXDB 3AH7A 2DBYA 4ZOHC 2B76B 2JX5A 4C7YA 1WYGA 1N63A 2WU2B 1QOAA 5H8YE 2BS3B 2K5PA 2WDQB 2WDVB 5EE0A 1XLNA 1TJEA 1R7SA 1SF0A 2KMMA 1VLBA 3AEDB 1E10A 4USAA 4US8A 1OQRA 1NYRA 2M19A 4YT0B 1SB3C 4WQMA 1FRRA 2LEKA 3W9CB 4P6VF 1CJEA 1XLQA 3AE2B 2MH7A 2Y5CA 1ZOYB 1QLBB 2BT6A 1KF6B 1OFFA 1PDXA 1UWMA 2WLBA 4ZHOA 3AN1A 1E6EB 1OQQA 2K22A 3W5UB 2QIEB 2BS4B 1FMAD 1XLOA 1SIJA 3P4SB 2H89B 1IUEA 2JQRB 1WGKA 1FM0D 1JW9D 5AUIA 1VDVA 2DWQA 1RWSA 3P1MA 4YSXB 2WP9B 3DWGC 3HUIA 3NVWA 1I7HA 1FIQA 1JWAD 2PIAA 3EUB2 5EE3A 1RFKA 1J7CA 1XLPA 5C2TB 3PO0A 1JRPA 4YSZB 1V97A 5G5HA 1NEKB 3L4PA 1FXAA 1T3QA 4C7ZA 3P63A 1L5PA 2PVOD 2W3SA 1JQ4A 1DOIA 1L0VB 1N62A 1WXQA 1AWDA 4ITKA 3NS1A 1QT9A 3VRAB 3AE4B 4ZHPA 1YQ4B 2ACZB 1ZP0B 2FBWB 3AEEB 4YTPB 3LXFA 1ROEA 1N61A 4C80A 1YJJA 1PUTA 2L52A 2Q5WD 3B2FA 3P4RB 3VR8B 3WCQA 2W54A 2KAJA 1L6UA 2M56B 3NRZA 1QOFA 2OHFA 3ABVB 4YSYB 4US9A 3AV8A 1A70A 2HTME 2WU5B 2WDRB 3SFDB 2QJLA 1QOGA 3NVVA 3AE8B 3SFEB 1KRHA 1F0ZA 2CJOA 3BIID 5H92C 1QOBA 2N0SB 1TKEA 4JX1C 4N59A 3DWMA 5C3JB 3P4PB 4YTNB 4JWUC 3FC4A 3AB5A 3LB8C 3HVZA 1GAQB 2E3TA 3HRDD 1B9RA 3ETRA 3AEFB 1VJKA 4LTUA 1RM6C 3FAHA 3CWIA 4IDIA 1JROA 2WS3B 3ZYYX 1KFYB 4KX6B 5GXGB 1J7AA 3AE9B 4FXCA 1NI3A 1N5XA 1DGJA 2AX5A 1ZXIA 3AM9A 3B2GA 2H88B 1JWBD 4YTMB 1GPXA 5G5GA 1XO3A
chains in the Genus database with same CATH superfamily
4M2YA 2ZTCA 1MQ2A 4ANUA 7ICMA 4DHZE 2FE9A 2RMMA 3ENEA 2C5LC 2LJ5A 3OJ3A 4FZMA 4Z6EA 1COKA 4J9PA 3ZKJC 5LXHA 3DVGY 3QAQA 2WX1A 2MA9B 3RI7C 3M1YA 1JCKB 3ISCA 2NRVA 3V60A 2ZJAA 5J2RA 1N60A 4RPYA 3FYHA 3KHRA 1C76A 2LMCA 2A19A 1YQ3B 3AE7B 2OXOA 4F5QA 1QF6A 2IGDA 3QU5A 1ZYQA 2WHIA 2NBWB 2H3ZA 5T14A 4KDIC 3HVDA 3A0HU 4QJFB 3SENA 3NOBA 2KNBA 2YMMA 1X42A 3PW0A 7ICTA 2WXGA 5KT7A 2BYVE 1L0YB 2WDQB 1L8OA 3TEYA 1R7SA 2ZW1A 4KLEA 1VLBA 3DHGC 4B95A 3TEZA 2KHWB 5KFLA 4EEKA 5KFFA 2KG5A 1NKCA 3T3NA 1UPHA 3E0FA 8ICUA 1AW7A 1MG8A 5B66U 1YJ1A 2AQ1B 1JRUA 1XEEA 1ZW7A 4RQMA 5J0OA 1L3VA 4KKIA 2PIAA 3PX6A 3V6CB 4W9EA 3QEAZ 4UB8U 1TKDA 3QUTA 2NS5A 1MA7A 3LJ3A 1HJPA 3QX1A 4II2B 3RZWC 3ZTCA 5IA7A 2HHWA 1KDHA 2M8SA 4NM2A 5ALLA 3C1YA 1S77D 1KTQA 4K4GA 2FCSA 5AKHA 3I28A 5DBBA 4YR2A 5J17A 3LXFA 3H8WA 1G6JA 2KSOB 4BGDA 9ICWA 2BCSA 2QB1A 4KLJA 1A70A 2FLNA 1R4MB 2G4DB 2WXIA 4EFOA 2K4EA 4AWJA 4ECXA 1U4BA 5FP0A 4JX1C 1WX9A 1GB4A 3MHSD 5KT6A 3O13A 1UH6A 3QYPA 2KVRA 1SE2A 2LVQA 2DZKA 3OSPA 1WJNA 4IC7B 1Z5SB 2W9AA 5DLFA 3KHLA 2WAQC 2K4PA 2EAMA 3JPRA 3Q8EA 3MJWA 5DLGA 3AE9B 1M6YA 2JPHA 4ICVA 5D94A 3PMNA 1TBEA 1RRBA 2XN9C 2ZIVB 2EH9A 1ZQRA 2WF5A 3JPQA 4EE2A 5CTRC 5FR3A 1ZPSA 1OQYA 3RNFC 4F4YA 1Q10A 2HOFA 2CHXA 3OAWA 4XRHA 2PKOA 3KQ4A 2W82A 3L08A 4KLLA 1L6VA 5AI4A 7ICKA 3DCGA 4RFBA 2OYYA 4QZEA 3TBLD 3BQ1A 1ZQAA 4A3OA 3U52E 4JK1A 2CKHB 5BYRA 4FO6A 4DQSA 3VQIA 1ED1A 4LVSA 3MHZA 2R8HA 4XZ4A 3UINB 2BDUA 3RTVA 3RB6A 2BB6A 4CRXA 1RPLA 1IBXB 5HHIA 2KKVA 1UZXB 4ZYNA 1L2NA 5F3XB 1Z2MA 5KFRA 2Q4TA 4GLXA 3RULA 5IIKA 2E1FA 2LHEA 3AL0B 3M9NB 4I28A 2LBOA 5J0PA 2F1IA 2FDRA 4ECQA 3UXNA 4OD0A 3ZDAA 3SDLC 1JWSD 2EAOA 2LYBA 3KZIU 1HZ6A 4DSEA 3NY5A 4IKGA 2FPLA 4EX6A 3LDAA 1RQNA 3MBYA 1X9MA 2IMWP 4NY8A 1ZOYB 2LVPA 2KOXA 4ZHOA 2J52A 2I6XA 1E6EB 1P7FA 4P16A 4TURA 4L1BA 3T9LA 3TARA 1TE2A 1TK0A 2ZVNA 5J8YA 2NYVA 5KFBA 3C2KA 5AUIA 3QQ8B 1ZJMA 3BVZA 2DLBA 5KFVA 3AQFA 4UB2A 3QIJA 3V61A 2KJRA 2ALZA 2K8AA 3KBBA 4RQNA 5IIIA 2WYQA 1L7MA 4RPXA 3URYA 2W3SA 1GC6A 2AL3A 3R2TA 4KGSA 2W9CB 1N62A 2C9WB 2XY5A 4O5KA 1TY2A 4I2EA 2FBWB 2FIFA 4A90A 3ZRFA 2UU7A 3UXPA 2JH7A 7ICGA 1V2YA 2KICA 2JZBB 2W11A 5K4LA 4C8NA 4TQRA 4J3OD 5HI1A 2IY0B 4WH4A 4YSYB 4ARCA 3H0LB 1L6NA 1C7YA 1B22A 1WX7A 4FJZA 5KAFU 1ZQOA 5KFCA 2GO7A 5H92C 8ICMA 1F2RI 5BO4B 1WXMA 3KUCB 4LZGA 2ZPNA 4Y2JA 3KKAA 2JGAA 1V9PA 3KZXA 5EWGA 1SKWA 5HFYA 4QWAA 2WXLA 3IG3A 3RNBC 1E7UA 2G4SA 2ZIXB 4WJOA 1DOQA 1DGJA 5D49A 2V3NA 9ICUA 8ICOA 1YT3A 3Q8CA 4L2YA 2HBJA 1JWBD 5KFDA 4BXOB 2HHUA 2W9CA 3QA8A 2FPMA 2KK0A 3L0WB 4JLCA 2L0TA 4CCHA 4BKTA 2G5IB 3MC1A 4ECSA 4M01A 1UT8A 2UVUA 2XC9A 2K0PA 3VH3B 5J0XA 4M9LA 2KWUB 1D5ZC 2JZBA 2R18A 3PW4A 2KDEB 1V86A 2KDBA 4UB5A 1OEYA 3JYUA 2KKPA 2K9XA 1P3QU 2WXOA 4F71A 4O3PA 1MPEA 1JIHA 1ZQXA 3HPOA 3WK6A 2YMLA 4MSMB 4F1SA 4DSIA 1NBFC 4EELA 4FULA 2GBMA 2Y0SC 4WWNA 2H3QA 4M9GA 2OH2A 3A4SC 5CHWA 2Y9TA 3LWLA 4HCNB 4FADA 1ZGUB 2DUYA 4NLNA 2JUOA 1WYGA 3DDHA 3IVFA 2KDMA 4EZ9A 1C4CA 5AKKA 3IDWA 5KG0A 8ICVA 5KHQA 1XSLA 1S10A 4G3XB 3Q3OC 2NPTB 4MGIE 4YN4A 3PSFA 4PS8A 4USAA 4GGQA 1OQRA 2MBHA 3DHHC 2M19A 5CHVC 5KG7A 4YT0B 2KNJA 4KLTA 1D8BA 1NK6A 4KIKB 4Y2RA 2Z7JA 3ZRCA 2LUEA 2J0KA 2NTTA 1TAMA 4DQRA 4DSLA 2V4RA 4OJ5A 5BOLA 1S9FA 2D5GA 2JY6A 2YMQA 3H0RB 5JUMA 2LI5A 4YSXB 4NAWA 5JHBA 2G09A 2AQ4A 2WP9B 1K50A 3BVGA 5IAAC 3PV1A 5DG7A 1COOA 1X40A 1SKRA 3NZ3A 1VZ8A 2M1MA 4W9GA 3R7QA 3L3FX 2D3AA 2FPKA 1L0VB 5J0WA 4RNMA 4PH5A 4M04A 1QT9A 2K6QA 2RSUA 4KLIA 1OGWA 5HHDG 1IM4A 3IV6A 1V5TA 4QZDA 2JRIB 2L52A 4J9SA 4QAYA 2W54A 2IPKD 2KAJA 3PX4A 1VZ7A 2M56B 2R2OA 1C3TA 1C4PA 2PMZF 3AV8A 5E6PA 1IG6A 4MJSB 4AS1A 8ICKA 4FBTA 1LB2B 4J9NA 1KRHA 1F0ZA 3K9PB 3PY8A 3N3KB 1VCBA 8ICWA 3W1SA 3CMMB 3JPSA 1V81A 3U2SC 3LDZE 2M9NA 2AQ3B 1CRXA 3G6XA 2LGIA 2BHNA 2I1QA 1XC9A 1U47A 2FUHB 4YL8A 2XVTA 5TISU 4ED2A 1WR6E 2LJIA 3V6EB 1JROA 4QZGA 1X9WA 3Q8KA 2QC8A 3C2LA 1J7AA 4G50A 1N5XA 1Q0WB 4F7ZA 2DKZA 2KJHB 4IRDA 4PT5A 3R2IA 1GPXA 4DL6A 1C20A 2RPQA 2L32A 1GJZA 5TR5A 4PGXA 4ELTA 4J9QA 3KVFB 1BPZA 4MGYE 3K75D 1NNLA 1YNTE 2ZTDA 1Y56A 4FHJA 2BBCA 4N6EB 3NVZA 4BKSD 4BOZB 3VR9B 1FEHA 1EWYC 3VUXA 2KV2A 4J9OA 4MJSA 5IN7A 2B0CA 4DFPA 2JVCA 1QLNA 1MI0A 5AKZA 1BNOA 4B9LA 9ICEA 1ZD2P 4NLBA 4JGHB 2DFLA 3J9CA 4HROA 3UMGA 2L83A 2BDPA 2LXAA 5DGBA 1EU4A 5HKHA 4R8UB 5T8IA 3IHPC 4W9IA 2JMGA 3B0AA 3D6JA 4M8NA 2BPCA 4PYUA 4KLQA 3H0MB 1ZQHA 3MTNB 4UAUA 1KL9A 3TJPA 2HOQA 1AROP 2INPE 7ICJA 2F77X 1NK9A 2A1JB 4UAZA 5AZGA 3EWAA 3NUHB 4DOAA 1WYWB 1XF5L 2YVCA 2KO3A 5AKGA 3PS6A 5D3DA 4UQGA 4AJWA 3RF9A 2XIDA 4O3OA 4AP4C 2Z0DB 4EENA 2QLTA 1WCNA 3M62B 1K1SA 1Z1VA 5HMLA 1XLOA 3M9MB 2H89B 4FBUA 4C8MA 1XSNA 1F9JA 3HW8A 5AK6A 1PK1B 2ZNVC 3EUB2 4UASA 2BTEA 2QARA 2JEGA 1SL0A 3SD7A 2Q0ZX 4PGYA 5KAIU 2HJ8A 2HBKA 4R8UA 8ICPA 3QHTA 5DG9A 4GLSC 1ZQDA 1TS4A 2ZPYA 3BY4B 1YQ4B 4IWOA 4KZCA 1BVSA 4BBNF 1T7PA 1F5SA 4MGZE 2G08A 3TAQA 3V6HA 3Q69A 3NZUA 2KD0A 4DFKA 3ZGZA 4LK0M 1YZ6A 2R61A 2WDRB 5J0TA 2CJOA 3PLUA 1I35A 1YN5A 4NJ7A 5IOIA 1M94A 3RJEA 1I4QA 3M7DA 2NO4A 4NL9A 5AKIA 5A0LA 1HUOA 3V6JA 2RGFA 2WXKA 3QU9A 3T5JA 2IGHA 3Q3MC 2E3TA 3A33B 4OVVA 3VXWA 4QZAA 3JVZX 2K8BB 1PK1A 2KLCA 4XX5A 1U48A 4NWIA 3WAMA 5CR0A 5J29A 1MFWA 1NI3A 3RJJA 1N48A 2KKCA 2K1FA 4XDDA 4EZKA 1U4AA 3H6NA 3UQ2A 2YB1A 2KN5A 2VANA 3RJGA 3N1XC 2R8GA 3AMZA 1F2RC 9ICAA 2EKIA 4AP9A 2BQQA 2N1RA 4WAFA 3HX0A 1WR1A 3RNAC 5AI5A 4RGNA 5J18A 1ET9A 2KACA 3WK7A 4RGMA 5KG3A 3NS8A 3QK0A 1S0MA 3QUCA 2KMCA 3MP9A 5L9XA 2JEIA 3AE5B 4UDUC 1SZHA 9ICLA 2J0JA 2BPFA 4XDCA 4JB3A 3U7ZA 1D3ZA 3DBRB 2NV3A 1ZE3D 3FKYA 3Q14C 1Z4OA 4WJ3B 3IT4B 2FE8A 2W55A 3H9DA 2MX2A 4FFDA 1CZPA 5CHGA 3ZNZB 4DFDA 5C0YA 2BCQA 3IAS1 2ES6A 4HPLB 1L8LA 1YIWA 2KC2A 1SXEA 2C22A 3NUQA 5AM0A 4CQNA 2IHMA 1UQVA 3UGBB 2V4QA 4XE0A 4G9BA 1QSSA 3T3OA 1E10A 1QQRA 1MSWD 5LXIB 2XCPA 4OJLA 4US8A 3V7LA 3ETLA 3U30A 5ALIA 3IXSA 3BQTA 3BZKA 7ICLA 1JWMD 1HA5A 2FCMA 3PGEA 1OFFA 4KLMA 3AN1A 3BZDB 2RP5A 1E90A 4PHAA 2HDEA 1RYSA 3HJEA 2LVOA 3V72A 2V9WA 3ORYA 4HCPB 1FM0D 4RQ3A 3SAGA 4GXKA 1NDDA 2XY7A 1ZQTA 4PL2A 3DWGC 4BVUC 2HVIA 2DF4B 3GZNI 2WDTB 3BS5B 3BYYB 3PW5A 4CF3A 1S0NA 3WAPA 4E74A 2ESEA 2FMPA 1N6ZA 1L7NA 2HW3A 1J97A 4OCZA 4NJ6A 2KIWA 1Z4NA 4ITKA 2WB1C 3ONNA 2EANA 4RGOS 5DKWA 4J9LA 3QE9Y 4QZ8A 2G9HD 3C5FA 2O6VB 5F9NA 1E8XA 1Y88A 2F1JA 2Q5WD 4LNFA 3MGHA 1L6UA 1RZTA 4W9KA 2BYTA 4QWBA 4DFMA 3AU6A 3AUOA 3BK2A 2PFOA 2WU5B 3MC8A 4E71A 3SFDB 4DCCA 3RAXA 9ICCA 3K1ZA 2JYEA 4EBEA 2ASLA 3M95A 2ZTEA 4NLKA 2ZXHA 2RDIA 3T5LA 1CUKA 3N7PD 5AI8A 3M8RA 3ISBA 4IRCA 1X1MA 3I9V1 4P4PA 3ZNID 3OTQA 3ETRA 3CNHA 4TMAB 5AHXA 4F4XA 5J2FA 4RQ1A 3H4DA 5KFMA 2EZXA 2DAJA 2GBRA 1ZQSA 3Q8FA 3RRHA 3LWMA 2ISPA 1F0MA 5D4BA 1MQ3A 1XO3A 2LYAA 3QJZA 4F2SA 2YY6A 1CMXB 3W2DA 2W7OA 1SWVA 2L00B 1S5LU 4M9HA 1H38A 4HDOA 4EEWA 1RAXA 2G1EA 2LPEA 2NVUI 2VZKB 4P1CC 4W9FA 2IY1B 2KX3A 2O6VA 2VJ4A 2G45B 3H8SA 5AM2A 1DYQA 3LVVA 3JPNA 3RR7A 1JXEA 3A4RA 1D8LA 4I2DA 2JHDA 3WKEA 4DQQA 3A1QB 3RNGC 3TCAA 4C8LA 3W5VB 1DK3A 3CIRB 1T6BX 1I4RA 2PE9A 2MBBB 8ICTA 2CU3A 2MBEA 3TL5A 3RD2A 2F2AB 4CE6A 3MABA 2HE7A 3UMCA 5IO9A 2IO0B 4M0WA 1BUIC 3ZUNA 1AQ6A 3BK1A 4ZOHC 2JZZA 4MEXA 3KUDB 4Q2JA 1F77A 2JX5A 3AXCA 4C4SA 3VC8A 2NO5A 4QZCA 9ICJA 3S2AA 2BW2A 2ZCCA 5H8YE 1RDFA 4Q43A 3H8JA 4Y2PA 7ICPA 1SF0A 4ZYSA 1SWWA 3VDZA 4RNAA 2V4LA 5HNKA 1UF0A 3W9CB 2LEKA 4P6VF 2SEBD 3NJTA 1QLBB 2BT6A 4LZDA 4XWWA 2D3DA 3A1QA 4Y2UA 3RJKA 1F52A 5KFHA 1NK0A 3ZDEA 2C2DA 1IUEA 4EYHB 2WXNA 2HJ1A 3U4EG 1LGRA 1J2MA 2DZIA 2C7HA 3PREA 1L7PA 4ELVA 5ALXA 1J7CA 3L54A 2N7JA 2LGXA 1ZQVA 3L4PA 4RQ5A 4PGQA 1SJHD 3E56A 2FMQA 3P63A 4MHVA 1HXYD 5J2KA 4IS7A 2PFNA 5I4DA 1S3SG 5DGAA 3ED5A 2K60A 4ZHPA 4I2HA 3DQVA 3AE4B 1MVKA 1GOZA 1P7DA 3WKDA 3MR2A 2PXIA 4CHKA 3DV9A 4XA5A 1SL2A 2BGFA 2MWSB 1N61A 5AI6A 3B2FA 3UI3A 2Y1JA 1KFTA 3WCQA 4US9A 2RDHA 1ZQGA 1ENFA 1MN8A 1ZQUA 1B4FA 3FDSA 1QOBA 5G55A 1X6JA 4HJGE 2A4ZA 3P4PB 1HQRD 3SEBA 5KFOA 2IZVB 4EZLA 2ATLA 3UIPB 1RM6C 1YMHE 2WF8A 4ICAA 3PV8A 5AI9A 4QZBA 2KYWA 2WS3B 1KOTA 2HBMA 2HHVA 4DL2A 4QWDA 1OXJA 1IYFA 1JI7A 4M02A 1V9JA 4DSJA 5ALRA 2HCFA 2IO2B 4BKGA 3TANA 3E58A 1YJIA 2KIVA 2ZUCA 2BQ3A 3PO5A 1M4VA 2V3SA 3AQEA 2CXYA 1CI4A 3WU2U 5AZFA 1SV0C 3AE6B 2M0NA 3V7JA 2KJ8A 3SR6A 2E8MA 1CQVA 1RYJA 2D11A 4NXZA 1XCQL 2P6UA 4QZHA 4QZIA 5ALZA 2YQEA 1ZD5A 5HHHA 4F5OA 7ICVA 4M6WA 2IYDB 1T0RC 4K1RB 1XSPA 4JWSC 1ZD4A 1ZKHA 2YLMA 3HKZC 2KMDA 4Z6CA 4YP3A 2MJ3A 2PPHA 1NVID 4NAMA 2MHJA 1ZD3A 4RH6A 1DOXA 3CP8A 1ZQWA 4F4KA 4F8CB 3RRGA 2BVCA 1AARA 4B9SA 2B76B 9ICVA 3EZ5A 5KL1B 3C28A 1JWUD 4ECYA 1UT5A 2IOFA 3AI5A 4MF8A 3CSTA 3KYDD 2WTFA 2CHWA 1XLNA 4WURA 3TEXA 4A20A 2B21A 3THVA 4HPPA 2GOLA 1SB3C 4HPMB 3SAFA 2N9KA 5AZHA 3VH4B 2BZFA 4TSSA 2ASDA 4MM3B 1R4NI 3ISDA 5KFZA 4DL7A 2YX8A 1Q3VA 2K25A 3UPQA 2L76A 4W9JA 4LCDE 4DF4A 2CS4A 4GSWA 1TY0A 2J0MA 1Z00A 4MT5A 4IW0A 4DWFA 5DQHA 2V4IB 5G5HA 2W04A 1T3QA 5ALOA 4C7ZA 5D7GA 2PVOD 4BZAA 2H3FA 3UIOB 1AWDA 1PVPA 3NS1A 1XS9D 1SEBD 3U26A 4HJKA 2ACZB 3E2EA 2WAQF 3L10B 4F93B 4F50A 4WJPA 2XI9A 2L3ZA 4MELA 1C79A 2XCAA 4FJVB 4LJPB 3P2BA 4DS4A 5JHAA 2E8PA 5J0RA 7ICQA 4KN4A 3DVNV 3VUYA 2MSED 3EECA 2G07A 3H1UA 5GMVA 1A6SA 2D10A 4NNJB 3KOOA 4MM3A 4W9HA 1B0XA 4NJ8A 1FNUA 5CA7A 4BWMA 1V6EA 1WE7A 3NGDA 4MH0E 1V49A 3APFA 4Y2TA 4IR1A 3OHBA 3P42A 3EPGA 2AU0A 1XNSA 3MDAA 1F1HA 4O5EA 2JZPA 1YX6B 2BWFA 5HR6A 2WX0A 1XCTL 3B08A 3MJ5A 4W9LA 5AM4A 4O3SA 4HDQA 3VTVA 4OW0A 1GB1A 3RB0A 1YOVB 1Z19A 4JQWC 3F5EA 4IUMB 4MFCA 2PVGC 2WQYB 1ISNA 2Y5PA 4O3RA 1VJ5A 3HM6X 4KLUA 4KX5A 2DAFA 3AE3B 4C4TA 1UHUA 2LGDA 4HAIA 4UAVA 1KKXA 3Q8SB 3KUZA 4DXFA 2GI9A 3KWLA 5KHOA 4P4MA 2QILA 3NRWA 1ZETA 1PGBA 2F8LA 2WGSA 3MC9A 1H4RA 5ALJA 1TS5A 3H4BA 7ICHA 1C78A 1E7PB 4LDTB 1YZ7A 3PRPB 4NQKE 2FMSA 1DXSA 4HWIB 2KN7A 3UMBA 2L0FA 2IOFK 1TAUA 2QDFA 1RLFA 1IXRA 2JYTA 2LMRA 3RH4A 2MP2B 4B0EA 4IQWA 5JH5C 1N63A 2WU2B 3TFSA 4GC7A 1S76D 3UQBA 5CJ7A 4I29A 5FK9C 4UB3A 3RR8A 4UBBA 3C0RB 5KT4A 1WF9A 2D3BA 4JV1A 1OEYJ 4NAWB 4GDKA 1PDXA 2WLBA 2C2EA 4M9JA 3LYSA 1OQQA 4ZDVA 3MR6A 8ICHA 2XK5B 2JEJA 1WMHB 3Q8RB 5LNK1 2C7NB 2GWSA 1WGKA 1SKSA 2ZNVB 1KH0A 3ZTDA 4PPXA 4K3BA 3RCZA 1VDVA 2DWQA 4RQ2A 4IG7B 5JRTA 4TQSA 1Y8RC 1WM3A 3HP6A 2FIDA 4KN7A 2LGSA 3GIJA 3PO0A 4DL4A 2IBKA 1P98A 2F44A 5E6NA 3RYTA 1QTMA 2DHZA 3WK8A 3BWUD 2MP2A 4RZRA 4EUTA 2G06A 5DB8A 4RQ8A 4AQ7A 3VFKA 1NOMA 3RNCC 4UARA 5BMGA 2J6TA 4MSQB 4F72A 1EU3A 1FNWA 4UW9A 1YJJA 3Q6BA 2MCNB 1XQQA 2VRRB 4M00A 1X66A 9ICHA 1ZQJA 4CNQA 1PGAA 3RFAA 2KJ5A 4UBCA 4CYEA 4IC9A 2Y1IA 3ZDBA 4M9NA 1ZQ1C 2KVCA 3DWMA 4A3PA 2XK5A 4XC2A 4PHEA 1WMHA 2PLPA 3C2MA 3FC4A 3ZD9A 2LRWA 3AB5A 2J53A 1ZQIA 2E8OA 4WWOA 5AEKB 5J2IA 2AQ2B 3QNMA 2I1KA 2B6GA 4UB6U 4BX9C 4ICUA 2RR9A 4QZFA 1Q1OA 4WQOB 4ECTA 2B3AA 3PZ7A 1UELA 1NJXA 2CN1A 4DL3A 3IG8A 2ZXIA 3AECB 3ZNHB 5F9LA 4OVUA 1FXIA 3N4MB 1SGHA 2MW5A 3GV7B 1RFAA 4ANXA 5MPOA 2ZG6A 4REZA 4LJXA 4KMUA 5LLIA 1GUAB 4WAAA 1LVHA 3DBSA 1LFDA 2WF7A 2W8KA 1SXTA 2YEPB 4M8MA 1WWTA 3VAWA 5BYSA 4NV0A 2O6KA 3H8HA 3GIIA 4BJQA 2JXXA 2I5HA 3N7RC 2RRDA 1L4ZB 4DOCA 3IG5A 3QZ8A 4G0NB 4P1BC 1EM7A 1L3UA 2R8JA 1FFUA 4RUAA 1L3SA 3X0WA 2P6RA 1BXTA 3ZLZA 1FNVA 5DBAA 3PO4A 1QQ6A 2REXA 4IM2A 4PHDA 2WXHA 2OWOA 2UVWA 1SZPA 2IO1B 2VJ5A 3RFZB 2D07B 4ANVA 1HEZE 3T79A 3F53A 4NLGA 1QSYA 3M6ZA 3F2CA 2J7QB 4EBDA 2CU1A 4WWPA 3TI0A 4C8KA 1LXDA 1SGGA 2K8CB 4YMNA 4IWPA 3L16A 4Y2QA 2HVHA 1EUVB 7ICUA 1CJEA 8ICQA 3A0BU 4GXIA 3ZW3A 4MGKE 2W7PA 1TK5A 4RNNA 2QIEB 5DCNA 2QARB 4QIWF 1KTKA 2GMIC 4K7UA 1SIJA 1ECWA 4RF1A 2JH1A 1GG3A 1TZOA 2BWES 4GXBA 2WXRA 1C9FA 5EE3A 2KQ7A 3R66C 9ICNA 3QXGA 8ICJA 3ZDCA 4FN2A 5DQGA 1ZQNA 3K4GA 5B5EU 1L5PA 4FJYA 2E1EA 4DSKA 4KX3A 5AM1A 2WWZA 3C21A 2FI1A 2C60A 2I2YA 4MDKE 3HK0A 3JW0X 3AEEB 2DPIA 2YB4A 1NK4A 1WJ4A 1V80A 4DHJB 3MC0B 3EFCA 2H3IA 5DB9A 4K81A 3HT3A 5AICA 5ALKA 4FS1A 1FXTB 2K8CA 4F92B 2KDFB 4LNIA 1N56A 4ANWA 4R65A 5AKJA 2V9HA 3SFEB 4ED6A 2K4HA 3SV4A 4OJ6A 5IILA 4YTNB 4JWUC 4QW9A 4EOYA 2KTRB 5ALQA 5IINA 3ZDTA 9ICRA 3PHXB 1B9RA 1VJKA 3UXOA 4Y2YA 4G3IA 2VA2A 1KFYB 4KX6B 4UATA 4X5VA 2JZ3B 9ICOA 2AX5A 5DB6A 3C8YA 4RPZA 1N2XA 5JZEB 2M17A 2FLPA 2MLBA 4TUQA 4ED3A 3WK9A 4MFAA 1UUPA 1A0PA 1XT9B 2KHQA 2KFZA 4PL1A 2N7EA 4FZNA 1PQSA 1CEZA 4HXDA 4WWMA 3DBHI 1DRGA 2CR5A 3I76A 2UVRA 4O3MA 4BKSA 2KZZA 3VTUA 8ICEA 1ZRNA 4GDLB 3RPFC 3AU4A 3PMLA 1BPXA 5D2MB 3ML8A 5KFEA 1ZUD2 4DXAB 1ZQZA 5IIJA 2K6DB 4B6WA 2P66A 1DK2A 1JMLA 2KTRA 3B0XA 2EZYA 3JSVA 1PFDA 4P0PA 2WFAA 4KDLB 2YTUA 2V0GA 5J0UA 1K52A 2LGYA 2CHZA 1E8YA 3PW2A 2F8KA 2JWZA 2M4NA 3QU7A 2XY6A 3BS7A 1YN4A 5E6JA 4C7YA 3MFIA 3OGUA 2BCUA 1ZDXA 3IP4B 4LLGM 3BQ0A 4ECZA 4JIOU 4K4IA 1PZNA 4PJ0U 1QOAA 1JUDA 3KD3A 1RYUA 3PSEB 5GTIU 3QUBA 4U6PA 4PS7A 1FCLA 5EE0A 4J9KA 2K39A 4A8EA 9ICTA 4OHJA 3Q8BA 3OG5A 2KD1A 9ICKA 3GZFA 3AE2B 3DDCB 3IBEA 1QSLA 2ZIUA 3ICXA 5AKXA 2UYZB 3Q8AA 2NRZA 3DBLI 4GDLA 3F5AA 3TFRA 2INCC 2KK8A 2BF8B 3QWZB 3W1YA 3RJIA 3TEWA 5KT3A 8ICCA 1NZPA 3HUIA 3WKAA 1UA0A 1RFKA 1XLPA 5EWFA 3MR3A 3H7PA 3D2NA 4FLHA 4IOIE 4RT2A 4ECWA 1FXAA 4ZRPA 1OUQA 3MDCA 3PZPA 4MF2A 2VH1A 4GC6A 4KGRA 3GV5B 1ET6A 2HTHA 2Z59B 2ISOA 1UGJA 5J2AA 2PI5A 3GV8B 4W9DA 3V3XA 5KFAA 5ALGA 2BKRB 3ZQ4A 5DPWA 4RUCA 5HP4A 3Q8QB 1WGYA 4E0DA 1ROEA 4C80A 1I4PA 2JWUA 3P4RB 3SI8A 1RXWA 1P9DU 2OM6A 1QOFA 3PSIA 1NKBA 3C5GA 2HTME 4FBJB 4ZRIA 1NZBA 3PSPA 4WIPA 4Y2SA 4NM1A 3O65B 5E6OA 4ECUA 1B1ZA 4N59A 1GNUA 4ACOA 3ZIMA 1S1QB 1WGRA 3MFGA 4GXJA 2RDBC 3HRDD 2AGQA 4II3B 4IM3A 1JN3A 2DGZA 1WM2A 3FAHA 2YEPF 2IBIB 2W9BA 2GB1A 3TMPB 1K51A 2LI6A 4DQOC 4F3OA 2X38A 4I27A 3ZDDA 2RQ5A 3QCAA 1HTQA 3TADC 4Y2XA 5DDMA 2KZMA 3UQAA 2MJEA 3B9JA 2KVZA 4B9MA 2ZJ8A 4QWEA 3L5KA 4Q8FA 3ZI4A 2INDC 2ON8A 5HG2A 4I2JA 5KFYA 4RQ4A 3C1ZA 2ZVOA 3C29A 4ED7A 1K53A 3RBDA 2I38A 4IM0A 5J2HA 4DHZB 1YX5B 3TAPA 4B9NA 4S0RA 5ALYA 5J2BA 2HDOA 3ZJTA 2VZKD 2J6UA 4YG2A 2WF6A 5BPCA 4DOBA 1WE6A 1E9MA 1TTNA 4ECRA 3T8MA 4J9RA 1V1OA 5AI0A 2VA3A 4M0WB 1I4GA 1X9SA 2N9PC 3APCA 1L0XB 1FRDA 8ICXA 3A9KB 1KN5A 4RF0A 4YVZA 2PFPA 3VUWA 3KHHA 2HBLA 4XQ8A 1NJWA 1KSPA 1UBIA 5KFQA 2Z8LA 3ZVVA 1Q3UA 4IR9A 2RDGA 1XU4A 5CB1A 3RB3A 3SD5A 1MG4A 4EZ6A 4HKQA 2M0XA 2W9MA 2AHOB 1EO6A 2EZZA 2Y3AA 3BINA 5DQIA 2MRLA 1S8OA 3BQ2A 2WDVB 4XGAB 2V1YA 1SV0A 1YD8U 7ICOA 3AU2A 3TIXA 1OTRB 4IQTA 4DS5A 4J9MA 2BGWA 5JXVA 1WFYA 2WB1F 4OJOA 5HMMA 4AYBF 3GILA 3Q2AC 2H5XA 1XLQA 5KT2A 2P35A 4KMOB 2LHDA 5IIOA 4DL5A 2MUTA 1TIFA 2K22A 3QX7A 2KP7A 1KM7A 4ED8A 3GB1A 3FILB 2J42A 2O2VA 4DK5A 4R64A 2DENB 4LNNA 2MEKA 1ZQYA 1FIQA 1ZQFA 3A9KA 3N1YC 8ICLA 1TGZB 4DDID 2BCRA 2MQJA 3EGRA 4ZRJA 4QWCA 2HHTA 4QZ9A 1V97A 3OJ4B 4XWTA 2ZUBA 1V1PB 4KITB 3QU4A 4YQWA 1I4XA 1SSNA 1R4MI 8ICFA 1V85A 4KKJA 2I9GA 2KWCA 4FZLA 1A5RA 3GZNB 2EAPA 2HD5B 2EMTA 4GOCA 1IIPA 3T5KA 3E9SA 1LKYA 4RMAA 3VR8B 4TQ0A 4FS2A 2KVSA 3NRZA 3ABVB 2JU6X 2N9XA 4RNOA 4RQ6A 2R8KA 1D5XC 1QOGA 2PKEA 4GFJA 5J2JA 4DQPA 3R8BA 5KFIA 1X2IA 4DO9A 1NKEA 1PK3A 1BPEA 8ICIA 2YMPA 4PHPA 3HIZA 4I2IA 1NI2A 3FILA 5KG5A 3HVZA 3QARA 1XO1A 3PZ8A 4O5CA 1ZQEA 2L05A 2YN4A 2Y9UA 3SEIA 2HMXA 4OO1J 2LWPA 2GBKA 3HWTA 2N1WA 3OLMD 4ZRQA 1V1PA 5L1MA 2GBJA 4PK1A 4YTMB 3FM9A 5G5GA 3EYZA 3ONSA 3DVNU 1WWVA 5E79U 1IGCA 2BB5A 1UA1A 3AEGB 3IHQB 4XUSA 3H7IA 4M0AA 2LRUA 4HYKA 9ICGA 4M6WB 4J03A 2BR0A 3IFWB 3WIMA 3ZDMC 2CRXA 1O08A 4HEA1 4HRSA 2OEDA 4N58A 8ICSA 4O3QA 1ZQPA 2EQYA 1SIFA 3GIMA 5ALTA 1SE3A 1T0YA 1PVQA 4YMOA 4DF8A 2D3CA 3EHVA 4AUQC 2JRZA 1S0VA 1MHXA 3AEBB 1JALA 5EE1A 4YXDB 4Y2VA 3AH7A 1BGXT 2DKXA 2ONQA 1E8WA 5C1ZA 2AEHA 2J6SA 4CO7A 4KTQA 2DYMA 2KTQA 3N32A 2OOBB 2MU2A 4JV2A 3ZJVA 5KFKA 2MA1A 3CW2C 3T3FA 5KFWA 2M0AA 4DQIA 2F3NA 2A3VA 4C00A 5TSSA 2MAXA 3PNCA 5GTHU 3H40A 1Z00B 5AKEA 2IGGA 9ICBA 5AIAA 4TQ1A 2BKFA 2QCZA 1WIAA 2LASA 3P4SB 2L5YA 3Q3NC 3NVWA 5AK4A 2G3QB 2KWDA 2KFKB 4F4WA 3S6JA 3JPOA 3BVMA 3GE3C 1JRPA 4JE3B 1X6IA 3EW9A 4MEYA 7ICEA 2IDYA 2AH5A 1SBBB 3PT2B 2NRXA 5JTIA 5FKAC 3OPXA 5DB7A 1WXQA 1BPDA 1WCLA 4A6QA 4DLGA 3U8ZA 4Z6FA 4F5RA 4OVZA 2R2QA 4CDGA 2AJQA 2WNMA 4IWQA 4ASWC 4YXJA 5KG2A 3AEVA 4KLOA 2PE6B 4KLDA 1WWUA 4YR0A 3JPTA 1J19A 2X8XX 2LXCA 3GE8C 3TSSA 4CF5A 3AE8B 9ICFA 1EF5A 3PR5B 4EBCA 2ZW0A 2KSOA 3BIID 2N0SB 4YXMA 2PJHA 4YMMA 1UWXA 1ZQCA 3OJSA 1TK8A 2FJ6A 5TZVA 3PVXA 5DG8A 3ALRA 2KFKA 4DFJA 2JV3A 2RPVA 1QZEA 1KFSA 3ZD8A 2KFJA 2L8JA 2INNE 7ICFA 2JRHA 3HKZF 2KANA 3I5JC 3BJYA 4IL6U 5J2EA 4R63A 3SMVA 9ICXA 3SQIA 2D3GA 2KWVB 3UQ0A 4YD1A 2L1AA 3SAHA 1WXAA 1WZ0A 5BYQA 4AOFA 3F2DA 1N5WA 3UF8A 1E0ZA 2C2RA 3F2BA 2GLSA 1L7YA 5J0QA 2D6FC 2ZIVA 5J2DA 2PW9A 2UWQA 2AXTU 4K4HA 1BMLC 4RM8A 4A9AA 1AYFA 3AE1B 4F8RA 1OW5A 4RCOA 3RT3B 5FR6A 2JR5A 2IJ0A 3PR4A 2VA8A 2ODGA 3A9JB 5AKYA 2LFIA 1V8CA 3I57A 1QQ5A 2KN4A 3DVGX 4F91B 2A1AA 1UGMA 2DZMA 5J0SA 3BZCA 3GFKB 4LDTD 2KEYA 4JPSA 3OJUA 4NY0A 4C4RA 1Q5WB 1IBXA 4Z6DA 2W9NA 3DPDA 1TV9A 2IOHA 2HHQA 1WRDB 5AM3A 2OJRA 3ZJUA 1V38A 4JV0A 8ICRA 4HK2A 3M8SA 3J81j 2WXQA 3PVLA 4GDKB 1F44A 1TJEA 2FAZA 2KMMA 4NZLB 2KDIA 3KH0A 4JWNA 1NYRA 3BQ7A 5KG1A 3K9OB 5KFNA 1RXVA 3OWEB 2KZRA 1T4GA 2MSNA 9ICIA 2BPSA 4HKZE 4RGTA 3W5UB 3DHIC 2OJWA 4D2KA 3V05A 2GRIA 2JQRB 1NK8A 4ED1A 1L4DB 2KJ9A 1ZOLA 4EYIB 4P4OA 3RJHA 1JWAD 3D32A 3A9JA 2N7DA 1E5WA 4KZ0A 1SV4A 1J2NA 4M47A 2KE7A 5ALEA 1NEKB 1WH3A 3Q8PB 2DPJA 2A5UA 1D4BA 1R4NB 1GC7A 2AYOB 2KQ4X 5EOZA 4ACFA 5AK5A 4KGTA 1WGHA 1A77A 5KG4A 1DOIA 5L83A 2E5SA 4DXGA 4O3NA 4IRKA 1S97A 2LD9A 2NRTA 3MGIA 1XXGA 4DBGA 5AK3A 1L5UA 1B43A 1ZQBA 2W03A 3QU2A 4F4ZA 1WI0A 4EKUA 4YFKA 3EPIA 1LQBA 2LM1A 3HM3A 3KLSX 3MGVA 4BOSC 1MC8A 3NASA 4K7SA 4I2AA 3JPPA 3MFHA 8ICYA 2HI0A 3D2QA 1ZDVA 2ZZPB 4KSKC 4UAWA 1ZXHA 3RMKC 3LYYA 3ALBA 2N9LA 4TUUA 1CK1A 1TKEA 3PTFC 3VTWA 2VH2A 1LV5A 2DYBA 1J8CA 1PVRA 3D2SA 5ALVA 4S17A 3GDXA 5EWEA 4N9F4 2XO7A 1SE9A 5KFPA 3AEFB 4G11A 4YR3A 4K3CA 5KFUA 2PFQA 3U7DA 2UVVA 3BDPA 4RU9A 2EDUA 5KTQA 4KLGA 1HTOA 2H88B 4I2CA 2DL0A 1ZJNA 2QHOA 2W3RA 2PMZC 3KTQA 2KOBA 4OZCA 1KLGD 2ZIXA 3R3MA 3RH5A 1DOYA 1U45A 2KLGA 4P0QB 4BXOA 3Q3JA 1KQQA 3RJFA 2HOIA 1L7OA 1IPGA 2G0AA 1TKYA 3NVYA 2NRWA 3X23A 1TKGA 1J7BA 4GN1A 3P4QB 1RYRA 5ALNA 3IM1A 3N97B 1ZQQA 1T8EA 4OJPA 5J8YC 3Q8LA 5DPSA 2KHVA 1FO4A 5L95C 1TYGB 2KQSA 5KL8B 2BQUA 3GS2A 5AUKA 1T3NA 3V7KA 1PUZA 4F5NA 4NQLB 4X57B 5ALSA 3QZ7A 1UD7A 2NCNA 2Y0SF 3PW7A 4JWMA 8ICAA 1P7EA 4F5PA 2KTFA 4EZJA 4ZRKA 2VIXA 4GIBA 1SJED 4HLEA 3C23A 2BS3B 2GBNA 3OHAA 3RAQA 2K5PA 2XGPA 5IKCM 4DEZA 4CF4A 1S0OA 3VVWB 4B0MA 4ED0A 2RD0A 1IGDA 3NZSA 3O0FA 4P0QA 2K3UA 1FCCC 3PSTA 4P2HA 4WQMA 4LNKA 3GQCA 3DEEA 2MH7A 2NPTA 7ICRA 4QIWC 2KZ3A 5J0YA 4E3CA 3G6VA 2NR2A 3UM9A 1C1YB 1FMAD 2BS4B 1C4AA 2V3PA 3H7SA 3G6YA 2KC1A 1MJDA 1WY8A 2QMTA 4B9KA 4RT3A 1SL1A 4KIKA 4KLSA 1I7HA 1EXNA 3NTUA 3ZO5B 2WXJA 5D6JB 3KKAC 2AL6A 1WX8A 1Q8KA 3H8MA 2JT4B 3CSFA 2XGQA 4AJYB 1BPBA 5ALUA 4Q8EA 1JXLA 1D6EC 1BPYA 4C0ZA 3I3TB 3VRAB 2XBBC 2C28A 3SV3A 3WKBA 4YTPB 5ALWA 1XD3B 5ALDA 4Q45A 1PUTA 5L1IA 1BNPA 1T5XD 1UBQA 3RBEA 2WXMA 2VKQA 2WHEA 2DNFA 4KLHA 1SXDA 3AU5A 4DHJD 3L13A 2QJLA 3NVVA 2XNAC 4W9CA 3V6KA 1QILA 5AIBA 2SAKA 4NPNA 1EWCA 5IP4D 2EELA 2JSVX 3VCBA 2R8IA 5KFSA 4XYCA 3K1RB 3IT6B 3I1YA 4QNLA 2IA6A 3T5HA 2HHSA 3PRMB 1TT5B 4ZH4A 2WXFA 4ARIA 1J0GA 4BBNC 4LTUA 4A8XC 2PTLA 9ICMA 1ESFA 3CWIA 2K4IA 4DWIA 1NJZA 4ELUA 1QKZA 4R3DA 4RQ7A 4L23A 1A76A 4URKA 1YN3A 4KV2A 3N1ZC 4WJNA 3TKAA 5CX3A 2KFNA 5ALPA 1ZRMA 1KBUA 9ICPA 3KHGA 5DBCA 4YCXA 1H8CA 2KXJA 4FA6A 1X9XA 5KNIA 1I42A 4O9MA 2F1HA 3AEAB 4I6LB 2HSZA 4GMVA 3DBRI 5ALFA 2C7MB 2Z0EB 4JL9A 3RB4A 4UAYA 4B9TA 4FHKA 1NJYA 3WK4A 2LKYA 5JU5A 1VR9A 1E7VA 2DX5B 3JSVB 1FPYA 1NK5A 3EC8A 2MJDA 2BCVA 1TS2A 4YWGG 2E8NA 4P0PB 5D3IB 3WKCA 5L1KA 1FFVA 2BS2B 2MBQA 1WRIA 4BAXA 2CJNA 5AKLA 4KLFA 1ACCA 2QSDA 1K5OA 3SYZA 2BYFA 3RUIB 3VRBB 3M3JA 3OSNA 1T0QC 3M63B 4DSFA 4BWJA 4EEYA 2DBYA 1WJ6A 1Q46A 4TV3A 3ML9A 1P0RA 3TADA 2I1JA 4KSLC 3ZXVA 2CPRA 1WUDA 2AGPA 1D9DA 7ICIA 2DZJA 2BYEA 1VD2A 2ZIUB 2LHTA 4CGZA 1U49A 4KVGB 3AEDB 3M6KA 2BKEA 5DPTA 2XEWA 4NLCA 1QCKA 4BDPA 4EX7A 4B9VA 1TS3A 5BMIA 1HZ5A 1FRRA 3N9YC 3QC8B 1WGGA 1TAQA 7ICNA 1E8ZA 3RH6A 1LM8B 2Y5CA 1TFRA 2A1JA 3RN9C 2D8CA 4B6JA 2N9EB 4HVBA 3H7PB 4PYZA 3R9KA 1Z1BA 1URJA 3B1LX 3W1SC 1HIWA 1FEZA 3B0YA 2L7RA 4JMUA 2NBVB 2MRPA 4IQUA 3TACB 1AN8A 5H2FU 1MHHE 2LZ6A 3PZDA 1LO5D 5C2TB 3SHQA 9ICSA 4LNOA 3ECIA 1WZ3A 4P7IA 1KW4A 1GO3F 1HEKA 3PLVA 4YSZB 2PMVA 7ICSA 4B9UA 1JQ4A 2LYHA 5CP2A 2XICA 5L1JA 1ZQKA 3AULA 1O03A 2OCEA 1K8RB 1KLUD 2RDJA 2KX0A 4TUSA 3ZNGC 1ZP0B 3SZ2A 8ICGA 3LK9A 8ICBA 2N1VA 4RM9A 3GU3A 3N28A 3ZXRA 2RHFA 1WXVA 3N7SC 4U7CA 2RLTA 1EF1A 1YQBA 2ICIA 1L3TA 2LM4A 2BPGA 3DOWA 5CRXA 3KYCD 5G2NA 4PS3A 5C3JB 4I6NB 2W9BB 2N4FA 4BFRA 2EMSA 1GAQB 2QKQA 4GB9A 2ZJDA 1IP9A 2IHNA 1C77A 3TUOA 2G5HB 3L17A 1PYWD 2ASQA 3MR5A 1XO0A 2LUMA 2WF9A 1WG8A 3AM9A 1U9LA 5KT5A 2E6XA 2K8BA 4JUZA 2AGOA 4UB1A 4O0IA 4MEMA 2AQ0A 1KRPA 2NBUA 2TSSA 3WA0A 2FCNA 3HILA 2HHXA 3WANA 2W43A 2PEAA 5EE9A 5CEHA 2FNJB 1STEA 2O6VD 3V62A 3NG0A 4I2GA 3GOEA 5J2GA 4A55A 3KW5B 2D2QA 3PX0A 1FD6A 3IRUA 1WJUA 2FLLA 3CYMA 4UB4A 1ZQLA 1RQLA 5ALHA 3N30A 1QH9A 5ALMA 4MACA 3RNEC 3GIKA 2DYOA 4GIVA 2JEFA 4LJOB 5KFJA 4R66A 5L1LA 5C5JA 5BOMA 2WXPA 4MH8A 2ZJ5A 5J2CA 3APDA 2ASJA 3DBHB 3PPAA 2NMQA 1NYQA 1UNSA 1KLVA 1UCVA 1NENB 4TKNA 2H3VA 2PI4A 3KWVA 4QW8A 4MFFA 3M9OB 2FUG1 5BMHA 5KFTA 3QUQA 1HE8A 4IQVA 3CF6E 2F76X 3IN5A 3VHTC 2JXJA 2BQRA 1KLNA 2ZIWB 1K1QA 1VRAB 1VZ6A 1WXSA 3TQ1A 3WK5A 3WALA 1P1AA 4Q44A 3Q8MA 2AWTA 3PHWB 1D5MC 1KFDA 5CWRA 2MUTB 1WGDA 2ZUDA 2DQNB 4AYBC 3WAOA 1V5OA 2KJ6A 4DDGD 2J4XA 2O2VB 1KEJA 1HUZA 3QEBZ 1TVAA 4C4VB 2QB0B 1KF6B 5AM5A 2KT7A 1UWMA 1ZQMA 4PZNA 1KJTA 1T0SC 4K7WA 2W8LA 3CRXA 3HHMA 1D9FA 5D46A 1JW9D 3N20C 4NL9C 3P1MA 1RWSA 4GU2A 1Z3EB 5DDYA 1RG6A 2ZEQA 4FE3A 4F2RA 1IV8A 3NHEB 4NLZA 5HR7A 3SU8X 2GOWA 2FCQA 4YD2A 3DBLB 1XWLA 4OZAA 2QEJC 3EFUA 1I4HA 2JF5A 1LKYB 1QQ7A 2GLEA 2IO3B 3BS5A 4ECVA 2ZIWA 2JXTA 4TUPA 4O1NA 1DGSA 3I63C 4WJQA 4DLEA 5EDSA 3R7RA 4H2AA 5KFXA 2K8HA 2OHFA 4BUGA 1WSPA 4C8OA 3PRZA 5KFGA 2MBOA 1JX4A 1T94A 5IIMA 1BT0A 3C19A 4RQ0A 4OZBA 5DPRA 3RZFA 2QB0A 4C4VA 2OEHA 5KG6A 2EKEC 3IAM1 4C56C 2K89A 3EA6A 2NTSA 4PZOA 8ICZA 3LB8C 4I2FA 3Q3FA 8ICNA 2Y5BB 4I6PA 1NK7A 3BYTB 4J6IA 5C23A 4NJCA 1TZ1A 3KFUF 3LVWA 4IDIA 2KMAA 3ZYYX 5GXGB 1JMSA 4FXCA 4I2BA 5CHFA 2ZCBA 1ZXIA 3B2GA 9ICQA 1PGXA 2GH1A 1SE4A 3GP7A 1D8YA
chains in the Genus database with same CATH topology
3AECB 1FXIA 3AMZA 1F2RC 2EKIA 2RMMA 4WAFA 2L1AA 5MPOA 4REZA 5BYQA 4RGNA 1ET9A 1N5WA 2KACA 1E0ZA 4RGMA 2PW9A 1JCKB 1SXTA 1BMLC 2YEPB 1WWTA 4A9AA 1AYFA 3MP9A 5BYSA 3AE1B 3AE5B 3H8HA 4UDUC 4RCOA 1N60A 4XDCA 2IJ0A 3U7ZA 1C76A 2LMCA 1L4ZB 1YQ3B 1ZE3D 3AE7B 2LFIA 1V8CA 1QF6A 2IGDA 3I57A 1EM7A 2KN4A 3IT4B 2FE8A 2W55A 1FFUA 1CZPA 1BXTA 1FNVA 3IAS1 3HVDA 2WXHA 4JPSA 3RFZB 1IBXA 4CQNA 1HEZE 2WXGA 3ZJUA 4XE0A 3T3OA 1L0YB 2WDQB 2WXQA 4GDKB 3TEYA 1QQRA 1R7SA 1TJEA 2KMMA 1VLBA 2ZW1A 4NZLB 1E10A 4US8A 1NYRA 3IXSA 3TEZA 1CJEA 1JWMD 1HA5A 3OWEB 1OFFA 3T3NA 3AN1A 1AW7A 4HKZE 3BZDB 4RGTA 2QIEB 3W5UB 2HDEA 4D2KA 1KTKA 4RF1A 1SIJA 2AQ1B 2GRIA 3V05A 2JQRB 1XEEA 1FM0D 1L4DB 1TZOA 2WXRA 3DWGC 4KKIA 1JWAD 2PIAA 1C9FA 5EE3A 3BYYB 1NEKB 1D4BA 2KQ4X 1L5PA 4KGTA 1DOIA 4ITKA 4DXGA 2I2YA 4RGOS 1XXGA 3AEEB 3LXFA 2G9HD 3MC0B 2Q5WD 3KLSX 1L6UA 2BYTA 1ZDVA 3BK2A 1A70A 1ZXHA 2WU5B 3SFDB 2WXIA 3LYYA 3SFEB 2JYEA 2N9LA 1CK1A 1TKEA 4JX1C 3I9V1 1GB4A 4YTNB 3O13A 4JWUC 1SE2A 1B9RA 3ETRA 3AEFB 1VJKA 4TMAB 3Q8EA 1KFYB 4KX6B 3AE9B 2AX5A 3Q8FA 3C8YA 2H88B 1XO3A 2W3RA 2XN9C 1UUPA 4OZCA 1KLGD 3W2DA 4EE2A 5FR3A 1ZPSA 1DOYA 2G1EA 2VZKB 1Q10A 4WWMA 2PKOA 1DYQA 3KQ4A 2W82A 1TKYA 3NVYA 4GDLB 1L6VA 4RFBA 3RPFC 1TKGA 1J7BA 3W5VB 3CIRB 3P4QB 1T6BX 1I4RA 3U52E 5BYRA 1ZUD2 2CU3A 3VQIA 3MHZA 1JMLA 1FO4A 1PFDA 1TYGB 2BB6A 3GS2A 5AUKA 1IBXB 2V0GA 1K52A 4M0WA 1BUIC 3BK1A 4ZOHC 4Q2JA 1YN4A 5E6JA 1F77A 4C7YA 2JX5A 1ZDXA 1P7EA 2LHEA 4LLGM 1SJED 2BW2A 1QOAA 5H8YE 2BS3B 2K5PA 1FCLA 5EE0A 1SF0A 4B0MA 4ZYSA 1JWSD 1HZ6A 1IGDA 4IKGA 4OHJA 4RNAA 3Q8BA 2K3UA 1FCCC 4WQMA 2LEKA 3W9CB 4P6VF 3AE2B 2MH7A 2SEBD 1ZOYB 1QLBB 2BT6A 2J52A 3Q8AA 4ZHOA 4XWWA 1E6EB 1P7FA 4P16A 4L1BA 2V3PA 2BS4B 1FMAD 1C4AA 1IUEA 2QMTA 5AUIA 2WXNA 3TEWA 3BVZA 3U4EG 3HUIA 1I7HA 2DLBA 1RFKA 1J7CA 1XLPA 2WXJA 4IOIE 2N7JA 3E56A 3L4PA 1FXAA 1SJHD 3P63A 4ZRPA 1HXYD 4KGRA 3URYA 2W3SA 1ET6A 3R2TA 1D6EC 4KGSA 5I4DA 1N62A 4ZHPA 1UGJA 3AE4B 3VRAB 1MVKA 3V3XA 1GOZA 1TY2A 2FBWB 3ZQ4A 4A90A 4YTPB 1ROEA 1N61A 4C80A 3B2FA 1I4PA 1PUTA 2JWUA 1T5XD 3P4RB 3UI3A 3WCQA 2WXMA 4J3OD 1QOFA 5HI1A 4WH4A 4YSYB 4ARCA 4US9A 2RDHA 1ENFA 2HTME 2QJLA 3NVVA 2XNAC 4WIPA 1QILA 5H92C 2SAKA 1EWCA 1QOBA 2EELA 1B1ZA 2JSVX 4HJGE 4N59A 1F2RI 3P4PB 3IT6B 1HQRD 3MFGA 3SEBA 3HRDD 2WXFA 4ARIA 5HFYA 4LTUA 1RM6C 1YMHE 2PTLA 3FAHA 4A8XC 1ESFA 3CWIA 1QKZA 2WXLA 2YEPF 2WS3B 4R3DA 4L23A 2GB1A 1YN3A 1K51A 4DQOC 1DGJA 2V3NA 2X38A 4L2YA 3Q8CA 1JWBD 2MJEA 3B9JA 1YJIA 2ON8A 5HG2A 1M4VA 3AEAB 2K0PA 1K53A 3AE6B 2I38A 3SR6A 1D5ZC 1CQVA 1RYJA 1XCQL 1VR9A 3ZJTA 2VZKD 2MJDA 1TS2A 4YWGG 5D3IB 1E9MA 1V1OA 1FFVA 2BS2B 2K9XA 1I4GA 2WXOA 4JWSC 1WRIA 2CJNA 1MPEA 1L0XB 1FRDA 1ACCA 4NAMA 2MJ3A 2QSDA 4RF0A 1NVID 1DOXA 4RH6A 3VRBB 2DBYA 2Z8LA 2B76B 1WYGA 2RDGA 2KDMA 1JWUD 4HKQA 1C4CA 2Y3AA 2WDVB 1XLNA 4WURA 3TEXA 3AEDB 4USAA 1OQRA 2M19A 1TS3A 4YT0B 5BMIA 5JXVA 1SB3C 1HZ5A 1FRRA 3N9YC 1XLQA 2N9KA 2Y5CA 2LHDA 4TSSA 4MM3B 2NTTA 2K22A 3GB1A 3FILB 2J42A 2D5GA 4YSXB 1TY0A 2MEKA 2WP9B 1K50A 3BVGA 1FIQA 4MT5A 1AN8A 1MHHE 3EGRA 1LO5D 5C2TB 2V4IB 4YSZB 1V97A 5G5HA 1T3QA 4C7ZA 1VZ8A 2PMVA 3NZ3A 4XWTA 5D7GA 1V1PB 2PVOD 1JQ4A 1I4XA 1L0VB 1SSNA 1AWDA 1SEBD 3NS1A 1QT9A 1KLUD 4KKJA 2ACZB 1ZP0B 5HHDG 1C79A 2L52A 3E9SA 3VR8B 4TQ0A 2W54A 2IPKD 2KAJA 2M56B 1VZ7A 3NRZA 1C4PA 3ABVB 3AV8A 2JU6X 2ICIA 4AS1A 1D5XC 1QOGA 1KRHA 1F0ZA 3R8BA 1FNUA 5C3JB 3W1SA 3FILA 3U2SC 3HVZA 1GAQB 2AQ3B 3PZ8A 2LGIA 3P42A 1C77A 2LJIA 3TUOA 1JROA 1PYWD 2JZPA 2LUMA 1J7AA 1N5XA 3AM9A 1XCTL 3MJ5A 1V1PA 4ZRQA 4YTMB 4PT5A 2E6XA 5G5GA 3R2IA 1GPXA 4OW0A 2L32A 1GB1A 1IGCA 2BB5A 2TSSA 2PVGC 2WQYB 3AEGB 2Y5PA 5EE9A 1STEA 1YNTE 3AE3B 1Y56A 2BBCA 4N6EB 3NVZA 4DXFA 4A55A 2GI9A 3VR9B 1FD6A 1FEHA 1EWYC 3KWLA 4HEA1 4HRSA 4MACA 2OEDA 4N58A 2QILA 1MI0A 1PGBA 2DYOA 1SE3A 2WXPA 1TS5A 4MH8A 1C78A 1E7PB 3J9CA 4HROA 1MHXA 2NMQA 1NYQA 1UNSA 1NENB 3AEBB 3KWVA 1JALA 2L83A 5EE1A 1EU4A 4YXDB 5T8IA 2FUG1 3AH7A 5BMHA 2JYTA 2ONQA 4B0EA 1N63A 1VRAB 2WU2B 1VZ6A 2DYMA 2INPE 1D5MC 5FK9C 3ZJVA 3NUHB 2M0AA 1XF5L 5TSSA 2J4XA 5D3DA 4NAWB 1KF6B 1PDXA 1UWMA 2WLBA 1OQQA 2IGGA 4TQ1A 1XLOA 5LNK1 3P4SB 2H89B 1WGKA 1JW9D 1KH0A 1VDVA 2DWQA 1RWSA 3P1MA 3NVWA 3EUB2 2KWDA 2BTEA 3BVMA 3PO0A 1JRPA 4JE3B 2IDYA 4OZAA 2QEJC 1SBBB 3BWUD 1I4HA 4GLSC 5FKAC 1WXQA 1TS4A 2JXTA 1YQ4B 4A6QA 4O1NA 4AQ7A 4OVZA 5BMGA 2WNMA 1EU3A 1FNWA 1YJJA 4H2AA 3Q69A 3ZGZA 2OHFA 4LK0M 2R61A 3TSSA 1WSPA 1PGAA 2WDRB 3AE8B 4OZBA 2ZW0A 2CJOA 3BIID 2N0SB 3IAM1 1YN5A 3EA6A 2NTSA 3DWMA 1UWXA 1I4QA 4C56C 2PLPA 2WXKA 3FC4A 3AB5A 2J53A 3LB8C 2IGHA 2E3TA 3BYTB 2AQ2B 4NJCA 4IDIA 3ZYYX 2RPVA 5GXGB 4FXCA 1NI3A 3B2GA 1ZXIA 4XDDA 2INNE 1PGXA 1SE4A 3PZ7A 3GP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJE A;  2W3R A;  3AEC B;  3B9J A;  1FXI A;  3AMZ A;  2EKI A;  1YJI A;  2PVG C;  2WQY B;  3AEG B;  3AEA B;  5MPO A;  5EE9 A;  1DOY A;  2G1E A;  3AE6 B;  4WWM A;  3AE3 B;  1N5W A;  1E0Z A;  3SR6 A;  2PKO A;  1RYJ A;  4N6E B;  3NVZ A;  3VR9 B;  1TKY A;  1EWY C;  3NVY A;  1WWT A;  3KWL A;  4A9A A;  4HRS A;  1L6V A;  3RPF C;  1AYF A;  4N58 A;  1TKG A;  1J7B A;  2MJD A;  3AE5 B;  3AE1 B;  3CIR B;  3P4Q B;  1E9M A;  3W5V B;  1FFV A;  1N60 A;  1ZUD 2;  2BS2 B;  2CU3 A;  2K9X A;  4JWS C;  1WRI A;  2CJN A;  1FRD A;  1E7P B;  1YQ3 B;  2MJ3 A;  3AE7 B;  1NVI D;  1V8C A;  1FO4 A;  1PFD A;  1NYQ A;  1TYG B;  4HRO A;  1QF6 A;  1NEN B;  5AUK A;  1DOX A;  3AEB B;  3VRB B;  2W55 A;  1FFU A;  1JAL A;  2L83 A;  5EE1 A;  1CZP A;  4YXD B;  3AH7 A;  2DBY A;  4ZOH C;  2B76 B;  2JX5 A;  4C7Y A;  1WYG A;  1N63 A;  2WU2 B;  1QOA A;  5H8Y E;  2BS3 B;  2K5P A;  2WDQ B;  2WDV B;  5EE0 A;  1XLN A;  1TJE A;  1R7S A;  1SF0 A;  2KMM A;  1VLB A;  3AED B;  1E10 A;  4USA A;  4US8 A;  1OQR A;  1NYR A;  2M19 A;  4YT0 B;  1SB3 C;  4WQM A;  1FRR A;  2LEK A;  3W9C B;  4P6V F;  1CJE A;  1XLQ A;  3AE2 B;  2MH7 A;  2Y5C A;  1ZOY B;  1QLB B;  2BT6 A;  1KF6 B;  1OFF A;  1PDX A;  1UWM A;  2WLB A;  4ZHO A;  3AN1 A;  1E6E B;  1OQQ A;  2K22 A;  3W5U B;  2QIE B;  2BS4 B;  1FMA D;  1XLO A;  1SIJ A;  3P4S B;  2H89 B;  1IUE A;  2JQR B;  1WGK A;  1FM0 D;  1JW9 D;  5AUI A;  1VDV A;  2DWQ A;  1RWS A;  3P1M A;  4YSX B;  2WP9 B;  3DWG C;  3HUI A;  3NVW A;  1I7H A;  1FIQ A;  1JWA D;  2PIA A;  3EUB 2;  5EE3 A;  1RFK A;  1J7C A;  1XLP A;  5C2T B;  3PO0 A;  1JRP A;  4YSZ B;  1V97 A;  5G5H A;  1NEK B;  3L4P A;  1FXA A;  1T3Q A;  4C7Z A;  3P63 A;  1L5P A;  2PVO D;  2W3S A;  1JQ4 A;  1DOI A;  1L0V B;  1N62 A;  1WXQ A;  1AWD A;  4ITK A;  3NS1 A;  1QT9 A;  3VRA B;  3AE4 B;  4ZHP A;  1YQ4 B;  2ACZ B;  1ZP0 B;  2FBW B;  3AEE B;  4YTP B;  3LXF A;  1ROE A;  1N61 A;  4C80 A;  1YJJ A;  1PUT A;  2L52 A;  2Q5W D;  3B2F A;  3P4R B;  3VR8 B;  3WCQ A;  2W54 A;  2KAJ A;  1L6U A;  2M56 B;  3NRZ A;  1QOF A;  2OHF A;  3ABV B;  4YSY B;  4US9 A;  3AV8 A;  1A70 A;  2HTM E;  2WU5 B;  2WDR B;  3SFD B;  2QJL A;  1QOG A;  3NVV A;  3AE8 B;  3SFE B;  1KRH A;  1F0Z A;  2CJO A;  3BII D;  5H92 C;  1QOB A;  2N0S B;  1TKE A;  4JX1 C;  4N59 A;  3DWM A;  5C3J B;  3P4P B;  4YTN B;  4JWU C;  3FC4 A;  3AB5 A;  3LB8 C;  3HVZ A;  1GAQ B;  2E3T A;  3HRD D;  1B9R A;  3ETR A;  3AEF B;  1VJK A;  4LTU A;  1RM6 C;  3FAH A;  3CWI A;  4IDI A;  1JRO A;  2WS3 B;  3ZYY X;  1KFY B;  4KX6 B;  5GXG B;  1J7A A;  3AE9 B;  4FXC A;  1NI3 A;  1N5X A;  1DGJ A;  2AX5 A;  1ZXI A;  3AM9 A;  3B2G A;  2H88 B;  1JWB D;  4YTM B;  1GPX A;  5G5G A;  1XO3 A; 
#chains in the Genus database with same CATH topology
 4M2Y A;  2ZTC A;  1MQ2 A;  4ANU A;  7ICM A;  4DHZ E;  2FE9 A;  2RMM A;  3ENE A;  2C5L C;  2LJ5 A;  3OJ3 A;  4FZM A;  4Z6E A;  1COK A;  4J9P A;  3ZKJ C;  5LXH A;  3DVG Y;  3QAQ A;  2WX1 A;  2MA9 B;  3RI7 C;  3M1Y A;  1JCK B;  3ISC A;  2NRV A;  3V60 A;  2ZJA A;  5J2R A;  1N60 A;  4RPY A;  3FYH A;  3KHR A;  1C76 A;  2LMC A;  2A19 A;  1YQ3 B;  3AE7 B;  2OXO A;  4F5Q A;  1QF6 A;  2IGD A;  3QU5 A;  1ZYQ A;  2WHI A;  2NBW B;  2H3Z A;  5T14 A;  4KDI C;  3HVD A;  3A0H U;  4QJF B;  3SEN A;  3NOB A;  2KNB A;  2YMM A;  1X42 A;  3PW0 A;  7ICT A;  2WXG A;  5KT7 A;  2BYV E;  1L0Y B;  2WDQ B;  1L8O A;  3TEY A;  1R7S A;  2ZW1 A;  4KLE A;  1VLB A;  3DHG C;  4B95 A;  3TEZ A;  2KHW B;  5KFL A;  4EEK A;  5KFF A;  2KG5 A;  1NKC A;  3T3N A;  1UPH A;  3E0F A;  8ICU A;  1AW7 A;  1MG8 A;  5B66 U;  1YJ1 A;  2AQ1 B;  1JRU A;  1XEE A;  1ZW7 A;  4RQM A;  5J0O A;  1L3V A;  4KKI A;  2PIA A;  3PX6 A;  3V6C B;  4W9E A;  3QEA Z;  4UB8 U;  1TKD A;  3QUT A;  2NS5 A;  1MA7 A;  3LJ3 A;  1HJP A;  3QX1 A;  4II2 B;  3RZW C;  3ZTC A;  5IA7 A;  2HHW A;  1KDH A;  2M8S A;  4NM2 A;  5ALL A;  3C1Y A;  1S77 D;  1KTQ A;  4K4G A;  2FCS A;  5AKH A;  3I28 A;  5DBB A;  4YR2 A;  5J17 A;  3LXF A;  3H8W A;  1G6J A;  2KSO B;  4BGD A;  9ICW A;  2BCS A;  2QB1 A;  4KLJ A;  1A70 A;  2FLN A;  1R4M B;  2G4D B;  2WXI A;  4EFO A;  2K4E A;  4AWJ A;  4ECX A;  1U4B A;  5FP0 A;  4JX1 C;  1WX9 A;  1GB4 A;  3MHS D;  5KT6 A;  3O13 A;  1UH6 A;  3QYP A;  2KVR A;  1SE2 A;  2LVQ A;  2DZK A;  3OSP A;  1WJN A;  4IC7 B;  1Z5S B;  2W9A A;  5DLF A;  3KHL A;  2WAQ C;  2K4P A;  2EAM A;  3JPR A;  3Q8E A;  3MJW A;  5DLG A;  3AE9 B;  1M6Y A;  2JPH A;  4ICV A;  5D94 A;  3PMN A;  1TBE A;  1RRB A;  2XN9 C;  2ZIV B;  2EH9 A;  1ZQR A;  2WF5 A;  3JPQ A;  4EE2 A;  5CTR C;  5FR3 A;  1ZPS A;  1OQY A;  3RNF C;  4F4Y A;  1Q10 A;  2HOF A;  2CHX A;  3OAW A;  4XRH A;  2PKO A;  3KQ4 A;  2W82 A;  3L08 A;  4KLL A;  1L6V A;  5AI4 A;  7ICK A;  3DCG A;  4RFB A;  2OYY A;  4QZE A;  3TBL D;  3BQ1 A;  1ZQA A;  4A3O A;  3U52 E;  4JK1 A;  2CKH B;  5BYR A;  4FO6 A;  4DQS A;  3VQI A;  1ED1 A;  4LVS A;  3MHZ A;  2R8H A;  4XZ4 A;  3UIN B;  2BDU A;  3RTV A;  3RB6 A;  2BB6 A;  4CRX A;  1RPL A;  1IBX B;  5HHI A;  2KKV A;  1UZX B;  4ZYN A;  1L2N A;  5F3X B;  1Z2M A;  5KFR A;  2Q4T A;  4GLX A;  3RUL A;  5IIK A;  2E1F A;  2LHE A;  3AL0 B;  3M9N B;  4I28 A;  2LBO A;  5J0P A;  2F1I A;  2FDR A;  4ECQ A;  3UXN A;  4OD0 A;  3ZDA A;  3SDL C;  1JWS D;  2EAO A;  2LYB A;  3KZI U;  1HZ6 A;  4DSE A;  3NY5 A;  4IKG A;  2FPL A;  4EX6 A;  3LDA A;  1RQN A;  3MBY A;  1X9M A;  2IMW P;  4NY8 A;  1ZOY B;  2LVP A;  2KOX A;  4ZHO A;  2J52 A;  2I6X A;  1E6E B;  1P7F A;  4P16 A;  4TUR A;  4L1B A;  3T9L A;  3TAR A;  1TE2 A;  1TK0 A;  2ZVN A;  5J8Y A;  2NYV A;  5KFB A;  3C2K A;  5AUI A;  3QQ8 B;  1ZJM A;  3BVZ A;  2DLB A;  5KFV A;  3AQF A;  4UB2 A;  3QIJ A;  3V61 A;  2KJR A;  2ALZ A;  2K8A A;  3KBB A;  4RQN A;  5III A;  2WYQ A;  1L7M A;  4RPX A;  3URY A;  2W3S A;  1GC6 A;  2AL3 A;  3R2T A;  4KGS A;  2W9C B;  1N62 A;  2C9W B;  2XY5 A;  4O5K A;  1TY2 A;  4I2E A;  2FBW B;  2FIF A;  4A90 A;  3ZRF A;  2UU7 A;  3UXP A;  2JH7 A;  7ICG A;  1V2Y A;  2KIC A;  2JZB B;  2W11 A;  5K4L A;  4C8N A;  4TQR A;  4J3O D;  5HI1 A;  2IY0 B;  4WH4 A;  4YSY B;  4ARC A;  3H0L B;  1L6N A;  1C7Y A;  1B22 A;  1WX7 A;  4FJZ A;  5KAF U;  1ZQO A;  5KFC A;  2GO7 A;  5H92 C;  8ICM A;  1F2R I;  5BO4 B;  1WXM A;  3KUC B;  4LZG A;  2ZPN A;  4Y2J A;  3KKA A;  2JGA A;  1V9P A;  3KZX A;  5EWG A;  1SKW A;  5HFY A;  4QWA A;  2WXL A;  3IG3 A;  3RNB C;  1E7U A;  2G4S A;  2ZIX B;  4WJO A;  1DOQ A;  1DGJ A;  5D49 A;  2V3N A;  9ICU A;  8ICO A;  1YT3 A;  3Q8C A;  4L2Y A;  2HBJ A;  1JWB D;  5KFD A;  4BXO B;  2HHU A;  2W9C A;  3QA8 A;  2FPM A;  2KK0 A;  3L0W B;  4JLC A;  2L0T A;  4CCH A;  4BKT A;  2G5I B;  3MC1 A;  4ECS A;  4M01 A;  1UT8 A;  2UVU A;  2XC9 A;  2K0P A;  3VH3 B;  5J0X A;  4M9L A;  2KWU B;  1D5Z C;  2JZB A;  2R18 A;  3PW4 A;  2KDE B;  1V86 A;  2KDB A;  4UB5 A;  1OEY A;  3JYU A;  2KKP A;  2K9X A;  1P3Q U;  2WXO A;  4F71 A;  4O3P A;  1MPE A;  1JIH A;  1ZQX A;  3HPO A;  3WK6 A;  2YML A;  4MSM B;  4F1S A;  4DSI A;  1NBF C;  4EEL A;  4FUL A;  2GBM A;  2Y0S C;  4WWN A;  2H3Q A;  4M9G A;  2OH2 A;  3A4S C;  5CHW A;  2Y9T A;  3LWL A;  4HCN B;  4FAD A;  1ZGU B;  2DUY A;  4NLN A;  2JUO A;  1WYG A;  3DDH A;  3IVF A;  2KDM A;  4EZ9 A;  1C4C A;  5AKK A;  3IDW A;  5KG0 A;  8ICV A;  5KHQ A;  1XSL A;  1S10 A;  4G3X B;  3Q3O C;  2NPT B;  4MGI E;  4YN4 A;  3PSF A;  4PS8 A;  4USA A;  4GGQ A;  1OQR A;  2MBH A;  3DHH C;  2M19 A;  5CHV C;  5KG7 A;  4YT0 B;  2KNJ A;  4KLT A;  1D8B A;  1NK6 A;  4KIK B;  4Y2R A;  2Z7J A;  3ZRC A;  2LUE A;  2J0K A;  2NTT A;  1TAM A;  4DQR A;  4DSL A;  2V4R A;  4OJ5 A;  5BOL A;  1S9F A;  2D5G A;  2JY6 A;  2YMQ A;  3H0R B;  5JUM A;  2LI5 A;  4YSX B;  4NAW A;  5JHB A;  2G09 A;  2AQ4 A;  2WP9 B;  1K50 A;  3BVG A;  5IAA C;  3PV1 A;  5DG7 A;  1COO A;  1X40 A;  1SKR A;  3NZ3 A;  1VZ8 A;  2M1M A;  4W9G A;  3R7Q A;  3L3F X;  2D3A A;  2FPK A;  1L0V B;  5J0W A;  4RNM A;  4PH5 A;  4M04 A;  1QT9 A;  2K6Q A;  2RSU A;  4KLI A;  1OGW A;  5HHD G;  1IM4 A;  3IV6 A;  1V5T A;  4QZD A;  2JRI B;  2L52 A;  4J9S A;  4QAY A;  2W54 A;  2IPK D;  2KAJ A;  3PX4 A;  1VZ7 A;  2M56 B;  2R2O A;  1C3T A;  1C4P A;  2PMZ F;  3AV8 A;  5E6P A;  1IG6 A;  4MJS B;  4AS1 A;  8ICK A;  4FBT A;  1LB2 B;  4J9N A;  1KRH A;  1F0Z A;  3K9P B;  3PY8 A;  3N3K B;  1VCB A;  8ICW A;  3W1S A;  3CMM B;  3JPS A;  1V81 A;  3U2S C;  3LDZ E;  2M9N A;  2AQ3 B;  1CRX A;  3G6X A;  2LGI A;  2BHN A;  2I1Q A;  1XC9 A;  1U47 A;  2FUH B;  4YL8 A;  2XVT A;  5TIS U;  4ED2 A;  1WR6 E;  2LJI A;  3V6E B;  1JRO A;  4QZG A;  1X9W A;  3Q8K A;  2QC8 A;  3C2L A;  1J7A A;  4G50 A;  1N5X A;  1Q0W B;  4F7Z A;  2DKZ A;  2KJH B;  4IRD A;  4PT5 A;  3R2I A;  1GPX A;  4DL6 A;  1C20 A;  2RPQ A;  2L32 A;  1GJZ A;  5TR5 A;  4PGX A;  4ELT A;  4J9Q A;  3KVF B;  1BPZ A;  4MGY E;  3K75 D;  1NNL A;  1YNT E;  2ZTD A;  1Y56 A;  4FHJ A;  2BBC A;  4N6E B;  3NVZ A;  4BKS D;  4BOZ B;  3VR9 B;  1FEH A;  1EWY C;  3VUX A;  2KV2 A;  4J9O A;  4MJS A;  5IN7 A;  2B0C A;  4DFP A;  2JVC A;  1QLN A;  1MI0 A;  5AKZ A;  1BNO A;  4B9L A;  9ICE A;  1ZD2 P;  4NLB A;  4JGH B;  2DFL A;  3J9C A;  4HRO A;  3UMG A;  2L83 A;  2BDP A;  2LXA A;  5DGB A;  1EU4 A;  5HKH A;  4R8U B;  5T8I A;  3IHP C;  4W9I A;  2JMG A;  3B0A A;  3D6J A;  4M8N A;  2BPC A;  4PYU A;  4KLQ A;  3H0M B;  1ZQH A;  3MTN B;  4UAU A;  1KL9 A;  3TJP A;  2HOQ A;  1ARO P;  2INP E;  7ICJ A;  2F77 X;  1NK9 A;  2A1J B;  4UAZ A;  5AZG A;  3EWA A;  3NUH B;  4DOA A;  1WYW B;  1XF5 L;  2YVC A;  2KO3 A;  5AKG A;  3PS6 A;  5D3D A;  4UQG A;  4AJW A;  3RF9 A;  2XID A;  4O3O A;  4AP4 C;  2Z0D B;  4EEN A;  2QLT A;  1WCN A;  3M62 B;  1K1S A;  1Z1V A;  5HML A;  1XLO A;  3M9M B;  2H89 B;  4FBU A;  4C8M A;  1XSN A;  1F9J A;  3HW8 A;  5AK6 A;  1PK1 B;  2ZNV C;  3EUB 2;  4UAS A;  2BTE A;  2QAR A;  2JEG A;  1SL0 A;  3SD7 A;  2Q0Z X;  4PGY A;  5KAI U;  2HJ8 A;  2HBK A;  4R8U A;  8ICP A;  3QHT A;  5DG9 A;  4GLS C;  1ZQD A;  1TS4 A;  2ZPY A;  3BY4 B;  1YQ4 B;  4IWO A;  4KZC A;  1BVS A;  4BBN F;  1T7P A;  1F5S A;  4MGZ E;  2G08 A;  3TAQ A;  3V6H A;  3Q69 A;  3NZU A;  2KD0 A;  4DFK A;  3ZGZ A;  4LK0 M;  1YZ6 A;  2R61 A;  2WDR B;  5J0T A;  2CJO A;  3PLU A;  1I35 A;  1YN5 A;  4NJ7 A;  5IOI A;  1M94 A;  3RJE A;  1I4Q A;  3M7D A;  2NO4 A;  4NL9 A;  5AKI A;  5A0L A;  1HUO A;  3V6J A;  2RGF A;  2WXK A;  3QU9 A;  3T5J A;  2IGH A;  3Q3M C;  2E3T A;  3A33 B;  4OVV A;  3VXW A;  4QZA A;  3JVZ X;  2K8B B;  1PK1 A;  2KLC A;  4XX5 A;  1U48 A;  4NWI A;  3WAM A;  5CR0 A;  5J29 A;  1MFW A;  1NI3 A;  3RJJ A;  1N48 A;  2KKC A;  2K1F A;  4XDD A;  4EZK A;  1U4A A;  3H6N A;  3UQ2 A;  2YB1 A;  2KN5 A;  2VAN A;  3RJG A;  3N1X C;  2R8G A;  3AMZ A;  1F2R C;  9ICA A;  2EKI A;  4AP9 A;  2BQQ A;  2N1R A;  4WAF A;  3HX0 A;  1WR1 A;  3RNA C;  5AI5 A;  4RGN A;  5J18 A;  1ET9 A;  2KAC A;  3WK7 A;  4RGM A;  5KG3 A;  3NS8 A;  3QK0 A;  1S0M A;  3QUC A;  2KMC A;  3MP9 A;  5L9X A;  2JEI A;  3AE5 B;  4UDU C;  1SZH A;  9ICL A;  2J0J A;  2BPF A;  4XDC A;  4JB3 A;  3U7Z A;  1D3Z A;  3DBR B;  2NV3 A;  1ZE3 D;  3FKY A;  3Q14 C;  1Z4O A;  4WJ3 B;  3IT4 B;  2FE8 A;  2W55 A;  3H9D A;  2MX2 A;  4FFD A;  1CZP A;  5CHG A;  3ZNZ B;  4DFD A;  5C0Y A;  2BCQ A;  3IAS 1;  2ES6 A;  4HPL B;  1L8L A;  1YIW A;  2KC2 A;  1SXE A;  2C22 A;  3NUQ A;  5AM0 A;  4CQN A;  2IHM A;  1UQV A;  3UGB B;  2V4Q A;  4XE0 A;  4G9B A;  1QSS A;  3T3O A;  1E10 A;  1QQR A;  1MSW D;  5LXI B;  2XCP A;  4OJL A;  4US8 A;  3V7L A;  3ETL A;  3U30 A;  5ALI A;  3IXS A;  3BQT A;  3BZK A;  7ICL A;  1JWM D;  1HA5 A;  2FCM A;  3PGE A;  1OFF A;  4KLM A;  3AN1 A;  3BZD B;  2RP5 A;  1E90 A;  4PHA A;  2HDE A;  1RYS A;  3HJE A;  2LVO A;  3V72 A;  2V9W A;  3ORY A;  4HCP B;  1FM0 D;  4RQ3 A;  3SAG A;  4GXK A;  1NDD A;  2XY7 A;  1ZQT A;  4PL2 A;  3DWG C;  4BVU C;  2HVI A;  2DF4 B;  3GZN I;  2WDT B;  3BS5 B;  3BYY B;  3PW5 A;  4CF3 A;  1S0N A;  3WAP A;  4E74 A;  2ESE A;  2FMP A;  1N6Z A;  1L7N A;  2HW3 A;  1J97 A;  4OCZ A;  4NJ6 A;  2KIW A;  1Z4N A;  4ITK A;  2WB1 C;  3ONN A;  2EAN A;  4RGO S;  5DKW A;  4J9L A;  3QE9 Y;  4QZ8 A;  2G9H D;  3C5F A;  2O6V B;  5F9N A;  1E8X A;  1Y88 A;  2F1J A;  2Q5W D;  4LNF A;  3MGH A;  1L6U A;  1RZT A;  4W9K A;  2BYT A;  4QWB A;  4DFM A;  3AU6 A;  3AUO A;  3BK2 A;  2PFO A;  2WU5 B;  3MC8 A;  4E71 A;  3SFD B;  4DCC A;  3RAX A;  9ICC A;  3K1Z A;  2JYE A;  4EBE A;  2ASL A;  3M95 A;  2ZTE A;  4NLK A;  2ZXH A;  2RDI A;  3T5L A;  1CUK A;  3N7P D;  5AI8 A;  3M8R A;  3ISB A;  4IRC A;  1X1M A;  3I9V 1;  4P4P A;  3ZNI D;  3OTQ A;  3ETR A;  3CNH A;  4TMA B;  5AHX A;  4F4X A;  5J2F A;  4RQ1 A;  3H4D A;  5KFM A;  2EZX A;  2DAJ A;  2GBR A;  1ZQS A;  3Q8F A;  3RRH A;  3LWM A;  2ISP A;  1F0M A;  5D4B A;  1MQ3 A;  1XO3 A;  2LYA A;  3QJZ A;  4F2S A;  2YY6 A;  1CMX B;  3W2D A;  2W7O A;  1SWV A;  2L00 B;  1S5L U;  4M9H A;  1H38 A;  4HDO A;  4EEW A;  1RAX A;  2G1E A;  2LPE A;  2NVU I;  2VZK B;  4P1C C;  4W9F A;  2IY1 B;  2KX3 A;  2O6V A;  2VJ4 A;  2G45 B;  3H8S A;  5AM2 A;  1DYQ A;  3LVV A;  3JPN A;  3RR7 A;  1JXE A;  3A4R A;  1D8L A;  4I2D A;  2JHD A;  3WKE A;  4DQQ A;  3A1Q B;  3RNG C;  3TCA A;  4C8L A;  3W5V B;  1DK3 A;  3CIR B;  1T6B X;  1I4R A;  2PE9 A;  2MBB B;  8ICT A;  2CU3 A;  2MBE A;  3TL5 A;  3RD2 A;  2F2A B;  4CE6 A;  3MAB A;  2HE7 A;  3UMC A;  5IO9 A;  2IO0 B;  4M0W A;  1BUI C;  3ZUN A;  1AQ6 A;  3BK1 A;  4ZOH C;  2JZZ A;  4MEX A;  3KUD B;  4Q2J A;  1F77 A;  2JX5 A;  3AXC A;  4C4S A;  3VC8 A;  2NO5 A;  4QZC A;  9ICJ A;  3S2A A;  2BW2 A;  2ZCC A;  5H8Y E;  1RDF A;  4Q43 A;  3H8J A;  4Y2P A;  7ICP A;  1SF0 A;  4ZYS A;  1SWW A;  3VDZ A;  4RNA A;  2V4L A;  5HNK A;  1UF0 A;  3W9C B;  2LEK A;  4P6V F;  2SEB D;  3NJT A;  1QLB B;  2BT6 A;  4LZD A;  4XWW A;  2D3D A;  3A1Q A;  4Y2U A;  3RJK A;  1F52 A;  5KFH A;  1NK0 A;  3ZDE A;  2C2D A;  1IUE A;  4EYH B;  2WXN A;  2HJ1 A;  3U4E G;  1LGR A;  1J2M A;  2DZI A;  2C7H A;  3PRE A;  1L7P A;  4ELV A;  5ALX A;  1J7C A;  3L54 A;  2N7J A;  2LGX A;  1ZQV A;  3L4P A;  4RQ5 A;  4PGQ A;  1SJH D;  3E56 A;  2FMQ A;  3P63 A;  4MHV A;  1HXY D;  5J2K A;  4IS7 A;  2PFN A;  5I4D A;  1S3S G;  5DGA A;  3ED5 A;  2K60 A;  4ZHP A;  4I2H A;  3DQV A;  3AE4 B;  1MVK A;  1GOZ A;  1P7D A;  3WKD A;  3MR2 A;  2PXI A;  4CHK A;  3DV9 A;  4XA5 A;  1SL2 A;  2BGF A;  2MWS B;  1N61 A;  5AI6 A;  3B2F A;  3UI3 A;  2Y1J A;  1KFT A;  3WCQ A;  4US9 A;  2RDH A;  1ZQG A;  1ENF A;  1MN8 A;  1ZQU A;  1B4F A;  3FDS A;  1QOB A;  5G55 A;  1X6J A;  4HJG E;  2A4Z A;  3P4P B;  1HQR D;  3SEB A;  5KFO A;  2IZV B;  4EZL A;  2ATL A;  3UIP B;  1RM6 C;  1YMH E;  2WF8 A;  4ICA A;  3PV8 A;  5AI9 A;  4QZB A;  2KYW A;  2WS3 B;  1KOT A;  2HBM A;  2HHV A;  4DL2 A;  4QWD A;  1OXJ A;  1IYF A;  1JI7 A;  4M02 A;  1V9J A;  4DSJ A;  5ALR A;  2HCF A;  2IO2 B;  4BKG A;  3TAN A;  3E58 A;  1YJI A;  2KIV A;  2ZUC A;  2BQ3 A;  3PO5 A;  1M4V A;  2V3S A;  3AQE A;  2CXY A;  1CI4 A;  3WU2 U;  5AZF A;  1SV0 C;  3AE6 B;  2M0N A;  3V7J A;  2KJ8 A;  3SR6 A;  2E8M A;  1CQV A;  1RYJ A;  2D11 A;  4NXZ A;  1XCQ L;  2P6U A;  4QZH A;  4QZI A;  5ALZ A;  2YQE A;  1ZD5 A;  5HHH A;  4F5O A;  7ICV A;  4M6W A;  2IYD B;  1T0R C;  4K1R B;  1XSP A;  4JWS C;  1ZD4 A;  1ZKH A;  2YLM A;  3HKZ C;  2KMD A;  4Z6C A;  4YP3 A;  2MJ3 A;  2PPH A;  1NVI D;  4NAM A;  2MHJ A;  1ZD3 A;  4RH6 A;  1DOX A;  3CP8 A;  1ZQW A;  4F4K A;  4F8C B;  3RRG A;  2BVC A;  1AAR A;  4B9S A;  2B76 B;  9ICV A;  3EZ5 A;  5KL1 B;  3C28 A;  1JWU D;  4ECY A;  1UT5 A;  2IOF A;  3AI5 A;  4MF8 A;  3CST A;  3KYD D;  2WTF A;  2CHW A;  1XLN A;  4WUR A;  3TEX A;  4A20 A;  2B21 A;  3THV A;  4HPP A;  2GOL A;  1SB3 C;  4HPM B;  3SAF A;  2N9K A;  5AZH A;  3VH4 B;  2BZF A;  4TSS A;  2ASD A;  4MM3 B;  1R4N I;  3ISD A;  5KFZ A;  4DL7 A;  2YX8 A;  1Q3V A;  2K25 A;  3UPQ A;  2L76 A;  4W9J A;  4LCD E;  4DF4 A;  2CS4 A;  4GSW A;  1TY0 A;  2J0M A;  1Z00 A;  4MT5 A;  4IW0 A;  4DWF A;  5DQH A;  2V4I B;  5G5H A;  2W04 A;  1T3Q A;  5ALO A;  4C7Z A;  5D7G A;  2PVO D;  4BZA A;  2H3F A;  3UIO B;  1AWD A;  1PVP A;  3NS1 A;  1XS9 D;  1SEB D;  3U26 A;  4HJK A;  2ACZ B;  3E2E A;  2WAQ F;  3L10 B;  4F93 B;  4F50 A;  4WJP A;  2XI9 A;  2L3Z A;  4MEL A;  1C79 A;  2XCA A;  4FJV B;  4LJP B;  3P2B A;  4DS4 A;  5JHA A;  2E8P A;  5J0R A;  7ICQ A;  4KN4 A;  3DVN V;  3VUY A;  2MSE D;  3EEC A;  2G07 A;  3H1U A;  5GMV A;  1A6S A;  2D10 A;  4NNJ B;  3KOO A;  4MM3 A;  4W9H A;  1B0X A;  4NJ8 A;  1FNU A;  5CA7 A;  4BWM A;  1V6E A;  1WE7 A;  3NGD A;  4MH0 E;  1V49 A;  3APF A;  4Y2T A;  4IR1 A;  3OHB A;  3P42 A;  3EPG A;  2AU0 A;  1XNS A;  3MDA A;  1F1H A;  4O5E A;  2JZP A;  1YX6 B;  2BWF A;  5HR6 A;  2WX0 A;  1XCT L;  3B08 A;  3MJ5 A;  4W9L A;  5AM4 A;  4O3S A;  4HDQ A;  3VTV A;  4OW0 A;  1GB1 A;  3RB0 A;  1YOV B;  1Z19 A;  4JQW C;  3F5E A;  4IUM B;  4MFC A;  2PVG C;  2WQY B;  1ISN A;  2Y5P A;  4O3R A;  1VJ5 A;  3HM6 X;  4KLU A;  4KX5 A;  2DAF A;  3AE3 B;  4C4T A;  1UHU A;  2LGD A;  4HAI A;  4UAV A;  1KKX A;  3Q8S B;  3KUZ A;  4DXF A;  2GI9 A;  3KWL A;  5KHO A;  4P4M A;  2QIL A;  3NRW A;  1ZET A;  1PGB A;  2F8L A;  2WGS A;  3MC9 A;  1H4R A;  5ALJ A;  1TS5 A;  3H4B A;  7ICH A;  1C78 A;  1E7P B;  4LDT B;  1YZ7 A;  3PRP B;  4NQK E;  2FMS A;  1DXS A;  4HWI B;  2KN7 A;  3UMB A;  2L0F A;  2IOF K;  1TAU A;  2QDF A;  1RLF A;  1IXR A;  2JYT A;  2LMR A;  3RH4 A;  2MP2 B;  4B0E A;  4IQW A;  5JH5 C;  1N63 A;  2WU2 B;  3TFS A;  4GC7 A;  1S76 D;  3UQB A;  5CJ7 A;  4I29 A;  5FK9 C;  4UB3 A;  3RR8 A;  4UBB A;  3C0R B;  5KT4 A;  1WF9 A;  2D3B A;  4JV1 A;  1OEY J;  4NAW B;  4GDK A;  1PDX A;  2WLB A;  2C2E A;  4M9J A;  3LYS A;  1OQQ A;  4ZDV A;  3MR6 A;  8ICH A;  2XK5 B;  2JEJ A;  1WMH B;  3Q8R B;  5LNK 1;  2C7N B;  2GWS A;  1WGK A;  1SKS A;  2ZNV B;  1KH0 A;  3ZTD A;  4PPX A;  4K3B A;  3RCZ A;  1VDV A;  2DWQ A;  4RQ2 A;  4IG7 B;  5JRT A;  4TQS A;  1Y8R C;  1WM3 A;  3HP6 A;  2FID A;  4KN7 A;  2LGS A;  3GIJ A;  3PO0 A;  4DL4 A;  2IBK A;  1P98 A;  2F44 A;  5E6N A;  3RYT A;  1QTM A;  2DHZ A;  3WK8 A;  3BWU D;  2MP2 A;  4RZR A;  4EUT A;  2G06 A;  5DB8 A;  4RQ8 A;  4AQ7 A;  3VFK A;  1NOM A;  3RNC C;  4UAR A;  5BMG A;  2J6T A;  4MSQ B;  4F72 A;  1EU3 A;  1FNW A;  4UW9 A;  1YJJ A;  3Q6B A;  2MCN B;  1XQQ A;  2VRR B;  4M00 A;  1X66 A;  9ICH A;  1ZQJ A;  4CNQ A;  1PGA A;  3RFA A;  2KJ5 A;  4UBC A;  4CYE A;  4IC9 A;  2Y1I A;  3ZDB A;  4M9N A;  1ZQ1 C;  2KVC A;  3DWM A;  4A3P A;  2XK5 A;  4XC2 A;  4PHE A;  1WMH A;  2PLP A;  3C2M A;  3FC4 A;  3ZD9 A;  2LRW A;  3AB5 A;  2J53 A;  1ZQI A;  2E8O A;  4WWO A;  5AEK B;  5J2I A;  2AQ2 B;  3QNM A;  2I1K A;  2B6G A;  4UB6 U;  4BX9 C;  4ICU A;  2RR9 A;  4QZF A;  1Q1O A;  4WQO B;  4ECT A;  2B3A A;  3PZ7 A;  1UEL A;  1NJX A;  2CN1 A;  4DL3 A;  3IG8 A;  2ZXI A;  3AEC B;  3ZNH B;  5F9L A;  4OVU A;  1FXI A;  3N4M B;  1SGH A;  2MW5 A;  3GV7 B;  1RFA A;  4ANX A;  5MPO A;  2ZG6 A;  4REZ A;  4LJX A;  4KMU A;  5LLI A;  1GUA B;  4WAA A;  1LVH A;  3DBS A;  1LFD A;  2WF7 A;  2W8K A;  1SXT A;  2YEP B;  4M8M A;  1WWT A;  3VAW A;  5BYS A;  4NV0 A;  2O6K A;  3H8H A;  3GII A;  4BJQ A;  2JXX A;  2I5H A;  3N7R C;  2RRD A;  1L4Z B;  4DOC A;  3IG5 A;  3QZ8 A;  4G0N B;  4P1B C;  1EM7 A;  1L3U A;  2R8J A;  1FFU A;  4RUA A;  1L3S A;  3X0W A;  2P6R A;  1BXT A;  3ZLZ A;  1FNV A;  5DBA A;  3PO4 A;  1QQ6 A;  2REX A;  4IM2 A;  4PHD A;  2WXH A;  2OWO A;  2UVW A;  1SZP A;  2IO1 B;  2VJ5 A;  3RFZ B;  2D07 B;  4ANV A;  1HEZ E;  3T79 A;  3F53 A;  4NLG A;  1QSY A;  3M6Z A;  3F2C A;  2J7Q B;  4EBD A;  2CU1 A;  4WWP A;  3TI0 A;  4C8K A;  1LXD A;  1SGG A;  2K8C B;  4YMN A;  4IWP A;  3L16 A;  4Y2Q A;  2HVH A;  1EUV B;  7ICU A;  1CJE A;  8ICQ A;  3A0B U;  4GXI A;  3ZW3 A;  4MGK E;  2W7P A;  1TK5 A;  4RNN A;  2QIE B;  5DCN A;  2QAR B;  4QIW F;  1KTK A;  2GMI C;  4K7U A;  1SIJ A;  1ECW A;  4RF1 A;  2JH1 A;  1GG3 A;  1TZO A;  2BWE S;  4GXB A;  2WXR A;  1C9F A;  5EE3 A;  2KQ7 A;  3R66 C;  9ICN A;  3QXG A;  8ICJ A;  3ZDC A;  4FN2 A;  5DQG A;  1ZQN A;  3K4G A;  5B5E U;  1L5P A;  4FJY A;  2E1E A;  4DSK A;  4KX3 A;  5AM1 A;  2WWZ A;  3C21 A;  2FI1 A;  2C60 A;  2I2Y A;  4MDK E;  3HK0 A;  3JW0 X;  3AEE B;  2DPI A;  2YB4 A;  1NK4 A;  1WJ4 A;  1V80 A;  4DHJ B;  3MC0 B;  3EFC A;  2H3I A;  5DB9 A;  4K81 A;  3HT3 A;  5AIC A;  5ALK A;  4FS1 A;  1FXT B;  2K8C A;  4F92 B;  2KDF B;  4LNI A;  1N56 A;  4ANW A;  4R65 A;  5AKJ A;  2V9H A;  3SFE B;  4ED6 A;  2K4H A;  3SV4 A;  4OJ6 A;  5IIL A;  4YTN B;  4JWU C;  4QW9 A;  4EOY A;  2KTR B;  5ALQ A;  5IIN A;  3ZDT A;  9ICR A;  3PHX B;  1B9R A;  1VJK A;  3UXO A;  4Y2Y A;  4G3I A;  2VA2 A;  1KFY B;  4KX6 B;  4UAT A;  4X5V A;  2JZ3 B;  9ICO A;  2AX5 A;  5DB6 A;  3C8Y A;  4RPZ A;  1N2X A;  5JZE B;  2M17 A;  2FLP A;  2MLB A;  4TUQ A;  4ED3 A;  3WK9 A;  4MFA A;  1UUP A;  1A0P A;  1XT9 B;  2KHQ A;  2KFZ A;  4PL1 A;  2N7E A;  4FZN A;  1PQS A;  1CEZ A;  4HXD A;  4WWM A;  3DBH I;  1DRG A;  2CR5 A;  3I76 A;  2UVR A;  4O3M A;  4BKS A;  2KZZ A;  3VTU A;  8ICE A;  1ZRN A;  4GDL B;  3RPF C;  3AU4 A;  3PML A;  1BPX A;  5D2M B;  3ML8 A;  5KFE A;  1ZUD 2;  4DXA B;  1ZQZ A;  5IIJ A;  2K6D B;  4B6W A;  2P66 A;  1DK2 A;  1JML A;  2KTR A;  3B0X A;  2EZY A;  3JSV A;  1PFD A;  4P0P A;  2WFA A;  4KDL B;  2YTU A;  2V0G A;  5J0U A;  1K52 A;  2LGY A;  2CHZ A;  1E8Y A;  3PW2 A;  2F8K A;  2JWZ A;  2M4N A;  3QU7 A;  2XY6 A;  3BS7 A;  1YN4 A;  5E6J A;  4C7Y A;  3MFI A;  3OGU A;  2BCU A;  1ZDX A;  3IP4 B;  4LLG M;  3BQ0 A;  4ECZ A;  4JIO U;  4K4I A;  1PZN A;  4PJ0 U;  1QOA A;  1JUD A;  3KD3 A;  1RYU A;  3PSE B;  5GTI U;  3QUB A;  4U6P A;  4PS7 A;  1FCL A;  5EE0 A;  4J9K A;  2K39 A;  4A8E A;  9ICT A;  4OHJ A;  3Q8B A;  3OG5 A;  2KD1 A;  9ICK A;  3GZF A;  3AE2 B;  3DDC B;  3IBE A;  1QSL A;  2ZIU A;  3ICX A;  5AKX A;  2UYZ B;  3Q8A A;  2NRZ A;  3DBL I;  4GDL A;  3F5A A;  3TFR A;  2INC C;  2KK8 A;  2BF8 B;  3QWZ B;  3W1Y A;  3RJI A;  3TEW A;  5KT3 A;  8ICC A;  1NZP A;  3HUI A;  3WKA A;  1UA0 A;  1RFK A;  1XLP A;  5EWF A;  3MR3 A;  3H7P A;  3D2N A;  4FLH A;  4IOI E;  4RT2 A;  4ECW A;  1FXA A;  4ZRP A;  1OUQ A;  3MDC A;  3PZP A;  4MF2 A;  2VH1 A;  4GC6 A;  4KGR A;  3GV5 B;  1ET6 A;  2HTH A;  2Z59 B;  2ISO A;  1UGJ A;  5J2A A;  2PI5 A;  3GV8 B;  4W9D A;  3V3X A;  5KFA A;  5ALG A;  2BKR B;  3ZQ4 A;  5DPW A;  4RUC A;  5HP4 A;  3Q8Q B;  1WGY A;  4E0D A;  1ROE A;  4C80 A;  1I4P A;  2JWU A;  3P4R B;  3SI8 A;  1RXW A;  1P9D U;  2OM6 A;  1QOF A;  3PSI A;  1NKB A;  3C5G A;  2HTM E;  4FBJ B;  4ZRI A;  1NZB A;  3PSP A;  4WIP A;  4Y2S A;  4NM1 A;  3O65 B;  5E6O A;  4ECU A;  1B1Z A;  4N59 A;  1GNU A;  4ACO A;  3ZIM A;  1S1Q B;  1WGR A;  3MFG A;  4GXJ A;  2RDB C;  3HRD D;  2AGQ A;  4II3 B;  4IM3 A;  1JN3 A;  2DGZ A;  1WM2 A;  3FAH A;  2YEP F;  2IBI B;  2W9B A;  2GB1 A;  3TMP B;  1K51 A;  2LI6 A;  4DQO C;  4F3O A;  2X38 A;  4I27 A;  3ZDD A;  2RQ5 A;  3QCA A;  1HTQ A;  3TAD C;  4Y2X A;  5DDM A;  2KZM A;  3UQA A;  2MJE A;  3B9J A;  2KVZ A;  4B9M A;  2ZJ8 A;  4QWE A;  3L5K A;  4Q8F A;  3ZI4 A;  2IND C;  2ON8 A;  5HG2 A;  4I2J A;  5KFY A;  4RQ4 A;  3C1Z A;  2ZVO A;  3C29 A;  4ED7 A;  1K53 A;  3RBD A;  2I38 A;  4IM0 A;  5J2H A;  4DHZ B;  1YX5 B;  3TAP A;  4B9N A;  4S0R A;  5ALY A;  5J2B A;  2HDO A;  3ZJT A;  2VZK D;  2J6U A;  4YG2 A;  2WF6 A;  5BPC A;  4DOB A;  1WE6 A;  1E9M A;  1TTN A;  4ECR A;  3T8M A;  4J9R A;  1V1O A;  5AI0 A;  2VA3 A;  4M0W B;  1I4G A;  1X9S A;  2N9P C;  3APC A;  1L0X B;  1FRD A;  8ICX A;  3A9K B;  1KN5 A;  4RF0 A;  4YVZ A;  2PFP A;  3VUW A;  3KHH A;  2HBL A;  4XQ8 A;  1NJW A;  1KSP A;  1UBI A;  5KFQ A;  2Z8L A;  3ZVV A;  1Q3U A;  4IR9 A;  2RDG A;  1XU4 A;  5CB1 A;  3RB3 A;  3SD5 A;  1MG4 A;  4EZ6 A;  4HKQ A;  2M0X A;  2W9M A;  2AHO B;  1EO6 A;  2EZZ A;  2Y3A A;  3BIN A;  5DQI A;  2MRL A;  1S8O A;  3BQ2 A;  2WDV B;  4XGA B;  2V1Y A;  1SV0 A;  1YD8 U;  7ICO A;  3AU2 A;  3TIX A;  1OTR B;  4IQT A;  4DS5 A;  4J9M A;  2BGW A;  5JXV A;  1WFY A;  2WB1 F;  4OJO A;  5HMM A;  4AYB F;  3GIL A;  3Q2A C;  2H5X A;  1XLQ A;  5KT2 A;  2P35 A;  4KMO B;  2LHD A;  5IIO A;  4DL5 A;  2MUT A;  1TIF A;  2K22 A;  3QX7 A;  2KP7 A;  1KM7 A;  4ED8 A;  3GB1 A;  3FIL B;  2J42 A;  2O2V A;  4DK5 A;  4R64 A;  2DEN B;  4LNN A;  2MEK A;  1ZQY A;  1FIQ A;  1ZQF A;  3A9K A;  3N1Y C;  8ICL A;  1TGZ B;  4DDI D;  2BCR A;  2MQJ A;  3EGR A;  4ZRJ A;  4QWC A;  2HHT A;  4QZ9 A;  1V97 A;  3OJ4 B;  4XWT A;  2ZUB A;  1V1P B;  4KIT B;  3QU4 A;  4YQW A;  1I4X A;  1SSN A;  1R4M I;  8ICF A;  1V85 A;  4KKJ A;  2I9G A;  2KWC A;  4FZL A;  1A5R A;  3GZN B;  2EAP A;  2HD5 B;  2EMT A;  4GOC A;  1IIP A;  3T5K A;  3E9S A;  1LKY A;  4RMA A;  3VR8 B;  4TQ0 A;  4FS2 A;  2KVS A;  3NRZ A;  3ABV B;  2JU6 X;  2N9X A;  4RNO A;  4RQ6 A;  2R8K A;  1D5X C;  1QOG A;  2PKE A;  4GFJ A;  5J2J A;  4DQP A;  3R8B A;  5KFI A;  1X2I A;  4DO9 A;  1NKE A;  1PK3 A;  1BPE A;  8ICI A;  2YMP A;  4PHP A;  3HIZ A;  4I2I A;  1NI2 A;  3FIL A;  5KG5 A;  3HVZ A;  3QAR A;  1XO1 A;  3PZ8 A;  4O5C A;  1ZQE A;  2L05 A;  2YN4 A;  2Y9U A;  3SEI A;  2HMX A;  4OO1 J;  2LWP A;  2GBK A;  3HWT A;  2N1W A;  3OLM D;  4ZRQ A;  1V1P A;  5L1M A;  2GBJ A;  4PK1 A;  4YTM B;  3FM9 A;  5G5G A;  3EYZ A;  3ONS A;  3DVN U;  1WWV A;  5E79 U;  1IGC A;  2BB5 A;  1UA1 A;  3AEG B;  3IHQ B;  4XUS A;  3H7I A;  4M0A A;  2LRU A;  4HYK A;  9ICG A;  4M6W B;  4J03 A;  2BR0 A;  3IFW B;  3WIM A;  3ZDM C;  2CRX A;  1O08 A;  4HEA 1;  4HRS A;  2OED A;  4N58 A;  8ICS A;  4O3Q A;  1ZQP A;  2EQY A;  1SIF A;  3GIM A;  5ALT A;  1SE3 A;  1T0Y A;  1PVQ A;  4YMO A;  4DF8 A;  2D3C A;  3EHV A;  4AUQ C;  2JRZ A;  1S0V A;  1MHX A;  3AEB B;  1JAL A;  5EE1 A;  4YXD B;  4Y2V A;  3AH7 A;  1BGX T;  2DKX A;  2ONQ A;  1E8W A;  5C1Z A;  2AEH A;  2J6S A;  4CO7 A;  4KTQ A;  2DYM A;  2KTQ A;  3N32 A;  2OOB B;  2MU2 A;  4JV2 A;  3ZJV A;  5KFK A;  2MA1 A;  3CW2 C;  3T3F A;  5KFW A;  2M0A A;  4DQI A;  2F3N A;  2A3V A;  4C00 A;  5TSS A;  2MAX A;  3PNC A;  5GTH U;  3H40 A;  1Z00 B;  5AKE A;  2IGG A;  9ICB A;  5AIA A;  4TQ1 A;  2BKF A;  2QCZ A;  1WIA A;  2LAS A;  3P4S B;  2L5Y A;  3Q3N C;  3NVW A;  5AK4 A;  2G3Q B;  2KWD A;  2KFK B;  4F4W A;  3S6J A;  3JPO A;  3BVM A;  3GE3 C;  1JRP A;  4JE3 B;  1X6I A;  3EW9 A;  4MEY A;  7ICE A;  2IDY A;  2AH5 A;  1SBB B;  3PT2 B;  2NRX A;  5JTI A;  5FKA C;  3OPX A;  5DB7 A;  1WXQ A;  1BPD A;  1WCL A;  4A6Q A;  4DLG A;  3U8Z A;  4Z6F A;  4F5R A;  4OVZ A;  2R2Q A;  4CDG A;  2AJQ A;  2WNM A;  4IWQ A;  4ASW C;  4YXJ A;  5KG2 A;  3AEV A;  4KLO A;  2PE6 B;  4KLD A;  1WWU A;  4YR0 A;  3JPT A;  1J19 A;  2X8X X;  2LXC A;  3GE8 C;  3TSS A;  4CF5 A;  3AE8 B;  9ICF A;  1EF5 A;  3PR5 B;  4EBC A;  2ZW0 A;  2KSO A;  3BII D;  2N0S B;  4YXM A;  2PJH A;  4YMM A;  1UWX A;  1ZQC A;  3OJS A;  1TK8 A;  2FJ6 A;  5TZV A;  3PVX A;  5DG8 A;  3ALR A;  2KFK A;  4DFJ A;  2JV3 A;  2RPV A;  1QZE A;  1KFS A;  3ZD8 A;  2KFJ A;  2L8J A;  2INN E;  7ICF A;  2JRH A;  3HKZ F;  2KAN A;  3I5J C;  3BJY A;  4IL6 U;  5J2E A;  4R63 A;  3SMV A;  9ICX A;  3SQI A;  2D3G A;  2KWV B;  3UQ0 A;  4YD1 A;  2L1A A;  3SAH A;  1WXA A;  1WZ0 A;  5BYQ A;  4AOF A;  3F2D A;  1N5W A;  3UF8 A;  1E0Z A;  2C2R A;  3F2B A;  2GLS A;  1L7Y A;  5J0Q A;  2D6F C;  2ZIV A;  5J2D A;  2PW9 A;  2UWQ A;  2AXT U;  4K4H A;  1BML C;  4RM8 A;  4A9A A;  1AYF A;  3AE1 B;  4F8R A;  1OW5 A;  4RCO A;  3RT3 B;  5FR6 A;  2JR5 A;  2IJ0 A;  3PR4 A;  2VA8 A;  2ODG A;  3A9J B;  5AKY A;  2LFI A;  1V8C A;  3I57 A;  1QQ5 A;  2KN4 A;  3DVG X;  4F91 B;  2A1A A;  1UGM A;  2DZM A;  5J0S A;  3BZC A;  3GFK B;  4LDT D;  2KEY A;  4JPS A;  3OJU A;  4NY0 A;  4C4R A;  1Q5W B;  1IBX A;  4Z6D A;  2W9N A;  3DPD A;  1TV9 A;  2IOH A;  2HHQ A;  1WRD B;  5AM3 A;  2OJR A;  3ZJU A;  1V38 A;  4JV0 A;  8ICR A;  4HK2 A;  3M8S A;  3J81 j;  2WXQ A;  3PVL A;  4GDK B;  1F44 A;  1TJE A;  2FAZ A;  2KMM A;  4NZL B;  2KDI A;  3KH0 A;  4JWN A;  1NYR A;  3BQ7 A;  5KG1 A;  3K9O B;  5KFN A;  1RXV A;  3OWE B;  2KZR A;  1T4G A;  2MSN A;  9ICI A;  2BPS A;  4HKZ E;  4RGT A;  3W5U B;  3DHI C;  2OJW A;  4D2K A;  3V05 A;  2GRI A;  2JQR B;  1NK8 A;  4ED1 A;  1L4D B;  2KJ9 A;  1ZOL A;  4EYI B;  4P4O A;  3RJH A;  1JWA D;  3D32 A;  3A9J A;  2N7D A;  1E5W A;  4KZ0 A;  1SV4 A;  1J2N A;  4M47 A;  2KE7 A;  5ALE A;  1NEK B;  1WH3 A;  3Q8P B;  2DPJ A;  2A5U A;  1D4B A;  1R4N B;  1GC7 A;  2AYO B;  2KQ4 X;  5EOZ A;  4ACF A;  5AK5 A;  4KGT A;  1WGH A;  1A77 A;  5KG4 A;  1DOI A;  5L83 A;  2E5S A;  4DXG A;  4O3N A;  4IRK A;  1S97 A;  2LD9 A;  2NRT A;  3MGI A;  1XXG A;  4DBG A;  5AK3 A;  1L5U A;  1B43 A;  1ZQB A;  2W03 A;  3QU2 A;  4F4Z A;  1WI0 A;  4EKU A;  4YFK A;  3EPI A;  1LQB A;  2LM1 A;  3HM3 A;  3KLS X;  3MGV A;  4BOS C;  1MC8 A;  3NAS A;  4K7S A;  4I2A A;  3JPP A;  3MFH A;  8ICY A;  2HI0 A;  3D2Q A;  1ZDV A;  2ZZP B;  4KSK C;  4UAW A;  1ZXH A;  3RMK C;  3LYY A;  3ALB A;  2N9L A;  4TUU A;  1CK1 A;  1TKE A;  3PTF C;  3VTW A;  2VH2 A;  1LV5 A;  2DYB A;  1J8C A;  1PVR A;  3D2S A;  5ALV A;  4S17 A;  3GDX A;  5EWE A;  4N9F 4;  2XO7 A;  1SE9 A;  5KFP A;  3AEF B;  4G11 A;  4YR3 A;  4K3C A;  5KFU A;  2PFQ A;  3U7D A;  2UVV A;  3BDP A;  4RU9 A;  2EDU A;  5KTQ A;  4KLG A;  1HTO A;  2H88 B;  4I2C A;  2DL0 A;  1ZJN A;  2QHO A;  2W3R A;  2PMZ C;  3KTQ A;  2KOB A;  4OZC A;  1KLG D;  2ZIX A;  3R3M A;  3RH5 A;  1DOY A;  1U45 A;  2KLG A;  4P0Q B;  4BXO A;  3Q3J A;  1KQQ A;  3RJF A;  2HOI A;  1L7O A;  1IPG A;  2G0A A;  1TKY A;  3NVY A;  2NRW A;  3X23 A;  1TKG A;  1J7B A;  4GN1 A;  3P4Q B;  1RYR A;  5ALN A;  3IM1 A;  3N97 B;  1ZQQ A;  1T8E A;  4OJP A;  5J8Y C;  3Q8L A;  5DPS A;  2KHV A;  1FO4 A;  5L95 C;  1TYG B;  2KQS A;  5KL8 B;  2BQU A;  3GS2 A;  5AUK A;  1T3N A;  3V7K A;  1PUZ A;  4F5N A;  4NQL B;  4X57 B;  5ALS A;  3QZ7 A;  1UD7 A;  2NCN A;  2Y0S F;  3PW7 A;  4JWM A;  8ICA A;  1P7E A;  4F5P A;  2KTF A;  4EZJ A;  4ZRK A;  2VIX A;  4GIB A;  1SJE D;  4HLE A;  3C23 A;  2BS3 B;  2GBN A;  3OHA A;  3RAQ A;  2K5P A;  2XGP A;  5IKC M;  4DEZ A;  4CF4 A;  1S0O A;  3VVW B;  4B0M A;  4ED0 A;  2RD0 A;  1IGD A;  3NZS A;  3O0F A;  4P0Q A;  2K3U A;  1FCC C;  3PST A;  4P2H A;  4WQM A;  4LNK A;  3GQC A;  3DEE A;  2MH7 A;  2NPT A;  7ICR A;  4QIW C;  2KZ3 A;  5J0Y A;  4E3C A;  3G6V A;  2NR2 A;  3UM9 A;  1C1Y B;  1FMA D;  2BS4 B;  1C4A A;  2V3P A;  3H7S A;  3G6Y A;  2KC1 A;  1MJD A;  1WY8 A;  2QMT A;  4B9K A;  4RT3 A;  1SL1 A;  4KIK A;  4KLS A;  1I7H A;  1EXN A;  3NTU A;  3ZO5 B;  2WXJ A;  5D6J B;  3KKA C;  2AL6 A;  1WX8 A;  1Q8K A;  3H8M A;  2JT4 B;  3CSF A;  2XGQ A;  4AJY B;  1BPB A;  5ALU A;  4Q8E A;  1JXL A;  1D6E C;  1BPY A;  4C0Z A;  3I3T B;  3VRA B;  2XBB C;  2C28 A;  3SV3 A;  3WKB A;  4YTP B;  5ALW A;  1XD3 B;  5ALD A;  4Q45 A;  1PUT A;  5L1I A;  1BNP A;  1T5X D;  1UBQ A;  3RBE A;  2WXM A;  2VKQ A;  2WHE A;  2DNF A;  4KLH A;  1SXD A;  3AU5 A;  4DHJ D;  3L13 A;  2QJL A;  3NVV A;  2XNA C;  4W9C A;  3V6K A;  1QIL A;  5AIB A;  2SAK A;  4NPN A;  1EWC A;  5IP4 D;  2EEL A;  2JSV X;  3VCB A;  2R8I A;  5KFS A;  4XYC A;  3K1R B;  3IT6 B;  3I1Y A;  4QNL A;  2IA6 A;  3T5H A;  2HHS A;  3PRM B;  1TT5 B;  4ZH4 A;  2WXF A;  4ARI A;  1J0G A;  4BBN C;  4LTU A;  4A8X C;  2PTL A;  9ICM A;  1ESF A;  3CWI A;  2K4I A;  4DWI A;  1NJZ A;  4ELU A;  1QKZ A;  4R3D A;  4RQ7 A;  4L23 A;  1A76 A;  4URK A;  1YN3 A;  4KV2 A;  3N1Z C;  4WJN A;  3TKA A;  5CX3 A;  2KFN A;  5ALP A;  1ZRM A;  1KBU A;  9ICP A;  3KHG A;  5DBC A;  4YCX A;  1H8C A;  2KXJ A;  4FA6 A;  1X9X A;  5KNI A;  1I42 A;  4O9M A;  2F1H A;  3AEA B;  4I6L B;  2HSZ A;  4GMV A;  3DBR I;  5ALF A;  2C7M B;  2Z0E B;  4JL9 A;  3RB4 A;  4UAY A;  4B9T A;  4FHK A;  1NJY A;  3WK4 A;  2LKY A;  5JU5 A;  1VR9 A;  1E7V A;  2DX5 B;  3JSV B;  1FPY A;  1NK5 A;  3EC8 A;  2MJD A;  2BCV A;  1TS2 A;  4YWG G;  2E8N A;  4P0P B;  5D3I B;  3WKC A;  5L1K A;  1FFV A;  2BS2 B;  2MBQ A;  1WRI A;  4BAX A;  2CJN A;  5AKL A;  4KLF A;  1ACC A;  2QSD A;  1K5O A;  3SYZ A;  2BYF A;  3RUI B;  3VRB B;  3M3J A;  3OSN A;  1T0Q C;  3M63 B;  4DSF A;  4BWJ A;  4EEY A;  2DBY A;  1WJ6 A;  1Q46 A;  4TV3 A;  3ML9 A;  1P0R A;  3TAD A;  2I1J A;  4KSL C;  3ZXV A;  2CPR A;  1WUD A;  2AGP A;  1D9D A;  7ICI A;  2DZJ A;  2BYE A;  1VD2 A;  2ZIU B;  2LHT A;  4CGZ A;  1U49 A;  4KVG B;  3AED B;  3M6K A;  2BKE A;  5DPT A;  2XEW A;  4NLC A;  1QCK A;  4BDP A;  4EX7 A;  4B9V A;  1TS3 A;  5BMI A;  1HZ5 A;  1FRR A;  3N9Y C;  3QC8 B;  1WGG A;  1TAQ A;  7ICN A;  1E8Z A;  3RH6 A;  1LM8 B;  2Y5C A;  1TFR A;  2A1J A;  3RN9 C;  2D8C A;  4B6J A;  2N9E B;  4HVB A;  3H7P B;  4PYZ A;  3R9K A;  1Z1B A;  1URJ A;  3B1L X;  3W1S C;  1HIW A;  1FEZ A;  3B0Y A;  2L7R A;  4JMU A;  2NBV B;  2MRP A;  4IQU A;  3TAC B;  1AN8 A;  5H2F U;  1MHH E;  2LZ6 A;  3PZD A;  1LO5 D;  5C2T B;  3SHQ A;  9ICS A;  4LNO A;  3ECI A;  1WZ3 A;  4P7I A;  1KW4 A;  1GO3 F;  1HEK A;  3PLV A;  4YSZ B;  2PMV A;  7ICS A;  4B9U A;  1JQ4 A;  2LYH A;  5CP2 A;  2XIC A;  5L1J A;  1ZQK A;  3AUL A;  1O03 A;  2OCE A;  1K8R B;  1KLU D;  2RDJ A;  2KX0 A;  4TUS A;  3ZNG C;  1ZP0 B;  3SZ2 A;  8ICG A;  3LK9 A;  8ICB A;  2N1V A;  4RM9 A;  3GU3 A;  3N28 A;  3ZXR A;  2RHF A;  1WXV A;  3N7S C;  4U7C A;  2RLT A;  1EF1 A;  1YQB A;  2ICI A;  1L3T A;  2LM4 A;  2BPG A;  3DOW A;  5CRX A;  3KYC D;  5G2N A;  4PS3 A;  5C3J B;  4I6N B;  2W9B B;  2N4F A;  4BFR A;  2EMS A;  1GAQ B;  2QKQ A;  4GB9 A;  2ZJD A;  1IP9 A;  2IHN A;  1C77 A;  3TUO A;  2G5H B;  3L17 A;  1PYW D;  2ASQ A;  3MR5 A;  1XO0 A;  2LUM A;  2WF9 A;  1WG8 A;  3AM9 A;  1U9L A;  5KT5 A;  2E6X A;  2K8B A;  4JUZ A;  2AGO A;  4UB1 A;  4O0I A;  4MEM A;  2AQ0 A;  1KRP A;  2NBU A;  2TSS A;  3WA0 A;  2FCN A;  3HIL A;  2HHX A;  3WAN A;  2W43 A;  2PEA A;  5EE9 A;  5CEH A;  2FNJ B;  1STE A;  2O6V D;  3V62 A;  3NG0 A;  4I2G A;  3GOE A;  5J2G A;  4A55 A;  3KW5 B;  2D2Q A;  3PX0 A;  1FD6 A;  3IRU A;  1WJU A;  2FLL A;  3CYM A;  4UB4 A;  1ZQL A;  1RQL A;  5ALH A;  3N30 A;  1QH9 A;  5ALM A;  4MAC A;  3RNE C;  3GIK A;  2DYO A;  4GIV A;  2JEF A;  4LJO B;  5KFJ A;  4R66 A;  5L1L A;  5C5J A;  5BOM A;  2WXP A;  4MH8 A;  2ZJ5 A;  5J2C A;  3APD A;  2ASJ A;  3DBH B;  3PPA A;  2NMQ A;  1NYQ A;  1UNS A;  1KLV A;  1UCV A;  1NEN B;  4TKN A;  2H3V A;  2PI4 A;  3KWV A;  4QW8 A;  4MFF A;  3M9O B;  2FUG 1;  5BMH A;  5KFT A;  3QUQ A;  1HE8 A;  4IQV A;  3CF6 E;  2F76 X;  3IN5 A;  3VHT C;  2JXJ A;  2BQR A;  1KLN A;  2ZIW B;  1K1Q A;  1VRA B;  1VZ6 A;  1WXS A;  3TQ1 A;  3WK5 A;  3WAL A;  1P1A A;  4Q44 A;  3Q8M A;  2AWT A;  3PHW B;  1D5M C;  1KFD A;  5CWR A;  2MUT B;  1WGD A;  2ZUD A;  2DQN B;  4AYB C;  3WAO A;  1V5O A;  2KJ6 A;  4DDG D;  2J4X A;  2O2V B;  1KEJ A;  1HUZ A;  3QEB Z;  1TVA A;  4C4V B;  2QB0 B;  1KF6 B;  5AM5 A;  2KT7 A;  1UWM A;  1ZQM A;  4PZN A;  1KJT A;  1T0S C;  4K7W A;  2W8L A;  3CRX A;  3HHM A;  1D9F A;  5D46 A;  1JW9 D;  3N20 C;  4NL9 C;  3P1M A;  1RWS A;  4GU2 A;  1Z3E B;  5DDY A;  1RG6 A;  2ZEQ A;  4FE3 A;  4F2R A;  1IV8 A;  3NHE B;  4NLZ A;  5HR7 A;  3SU8 X;  2GOW A;  2FCQ A;  4YD2 A;  3DBL B;  1XWL A;  4OZA A;  2QEJ C;  3EFU A;  1I4H A;  2JF5 A;  1LKY B;  1QQ7 A;  2GLE A;  2IO3 B;  3BS5 A;  4ECV A;  2ZIW A;  2JXT A;  4TUP A;  4O1N A;  1DGS A;  3I63 C;  4WJQ A;  4DLE A;  5EDS A;  3R7R A;  4H2A A;  5KFX A;  2K8H A;  2OHF A;  4BUG A;  1WSP A;  4C8O A;  3PRZ A;  5KFG A;  2MBO A;  1JX4 A;  1T94 A;  5IIM A;  1BT0 A;  3C19 A;  4RQ0 A;  4OZB A;  5DPR A;  3RZF A;  2QB0 A;  4C4V A;  2OEH A;  5KG6 A;  2EKE C;  3IAM 1;  4C56 C;  2K89 A;  3EA6 A;  2NTS A;  4PZO A;  8ICZ A;  3LB8 C;  4I2F A;  3Q3F A;  8ICN A;  2Y5B B;  4I6P A;  1NK7 A;  3BYT B;  4J6I A;  5C23 A;  4NJC A;  1TZ1 A;  3KFU F;  3LVW A;  4IDI A;  2KMA A;  3ZYY X;  5GXG B;  1JMS A;  4FXC A;  4I2B A;  5CHF A;  2ZCB A;  1ZXI A;  3B2G A;  9ICQ A;  1PGX A;  2GH1 A;  1SE4 A;  3GP7 A;  1D8Y A; 
#chains in the Genus database with same CATH homology
 3AEC B;  1FXI A;  3AMZ A;  1F2R C;  2EKI A;  2RMM A;  4WAF A;  2L1A A;  5MPO A;  4REZ A;  5BYQ A;  4RGN A;  1ET9 A;  1N5W A;  2KAC A;  1E0Z A;  4RGM A;  2PW9 A;  1JCK B;  1SXT A;  1BML C;  2YEP B;  1WWT A;  4A9A A;  1AYF A;  3MP9 A;  5BYS A;  3AE1 B;  3AE5 B;  3H8H A;  4UDU C;  4RCO A;  1N60 A;  4XDC A;  2IJ0 A;  3U7Z A;  1C76 A;  2LMC A;  1L4Z B;  1YQ3 B;  1ZE3 D;  3AE7 B;  2LFI A;  1V8C A;  1QF6 A;  2IGD A;  3I57 A;  1EM7 A;  2KN4 A;  3IT4 B;  2FE8 A;  2W55 A;  1FFU A;  1CZP A;  1BXT A;  1FNV A;  3IAS 1;  3HVD A;  2WXH A;  4JPS A;  3RFZ B;  1IBX A;  4CQN A;  1HEZ E;  2WXG A;  3ZJU A;  4XE0 A;  3T3O A;  1L0Y B;  2WDQ B;  2WXQ A;  4GDK B;  3TEY A;  1QQR A;  1R7S A;  1TJE A;  2KMM A;  1VLB A;  2ZW1 A;  4NZL B;  1E10 A;  4US8 A;  1NYR A;  3IXS A;  3TEZ A;  1CJE A;  1JWM D;  1HA5 A;  3OWE B;  1OFF A;  3T3N A;  3AN1 A;  1AW7 A;  4HKZ E;  3BZD B;  4RGT A;  2QIE B;  3W5U B;  2HDE A;  4D2K A;  1KTK A;  4RF1 A;  1SIJ A;  2AQ1 B;  2GRI A;  3V05 A;  2JQR B;  1XEE A;  1FM0 D;  1L4D B;  1TZO A;  2WXR A;  3DWG C;  4KKI A;  1JWA D;  2PIA A;  1C9F A;  5EE3 A;  3BYY B;  1NEK B;  1D4B A;  2KQ4 X;  1L5P A;  4KGT A;  1DOI A;  4ITK A;  4DXG A;  2I2Y A;  4RGO S;  1XXG A;  3AEE B;  3LXF A;  2G9H D;  3MC0 B;  2Q5W D;  3KLS X;  1L6U A;  2BYT A;  1ZDV A;  3BK2 A;  1A70 A;  1ZXH A;  2WU5 B;  3SFD B;  2WXI A;  3LYY A;  3SFE B;  2JYE A;  2N9L A;  1CK1 A;  1TKE A;  4JX1 C;  3I9V 1;  1GB4 A;  4YTN B;  3O13 A;  4JWU C;  1SE2 A;  1B9R A;  3ETR A;  3AEF B;  1VJK A;  4TMA B;  3Q8E A;  1KFY B;  4KX6 B;  3AE9 B;  2AX5 A;  3Q8F A;  3C8Y A;  2H88 B;  1XO3 A;  2W3R A;  2XN9 C;  1UUP A;  4OZC A;  1KLG D;  3W2D A;  4EE2 A;  5FR3 A;  1ZPS A;  1DOY A;  2G1E A;  2VZK B;  1Q10 A;  4WWM A;  2PKO A;  1DYQ A;  3KQ4 A;  2W82 A;  1TKY A;  3NVY A;  4GDL B;  1L6V A;  4RFB A;  3RPF C;  1TKG A;  1J7B A;  3W5V B;  3CIR B;  3P4Q B;  1T6B X;  1I4R A;  3U52 E;  5BYR A;  1ZUD 2;  2CU3 A;  3VQI A;  3MHZ A;  1JML A;  1FO4 A;  1PFD A;  1TYG B;  2BB6 A;  3GS2 A;  5AUK A;  1IBX B;  2V0G A;  1K52 A;  4M0W A;  1BUI C;  3BK1 A;  4ZOH C;  4Q2J A;  1YN4 A;  5E6J A;  1F77 A;  4C7Y A;  2JX5 A;  1ZDX A;  1P7E A;  2LHE A;  4LLG M;  1SJE D;  2BW2 A;  1QOA A;  5H8Y E;  2BS3 B;  2K5P A;  1FCL A;  5EE0 A;  1SF0 A;  4B0M A;  4ZYS A;  1JWS D;  1HZ6 A;  1IGD A;  4IKG A;  4OHJ A;  4RNA A;  3Q8B A;  2K3U A;  1FCC C;  4WQM A;  2LEK A;  3W9C B;  4P6V F;  3AE2 B;  2MH7 A;  2SEB D;  1ZOY B;  1QLB B;  2BT6 A;  2J52 A;  3Q8A A;  4ZHO A;  4XWW A;  1E6E B;  1P7F A;  4P16 A;  4L1B A;  2V3P A;  2BS4 B;  1FMA D;  1C4A A;  1IUE A;  2QMT A;  5AUI A;  2WXN A;  3TEW A;  3BVZ A;  3U4E G;  3HUI A;  1I7H A;  2DLB A;  1RFK A;  1J7C A;  1XLP A;  2WXJ A;  4IOI E;  2N7J A;  3E56 A;  3L4P A;  1FXA A;  1SJH D;  3P63 A;  4ZRP A;  1HXY D;  4KGR A;  3URY A;  2W3S A;  1ET6 A;  3R2T A;  1D6E C;  4KGS A;  5I4D A;  1N62 A;  4ZHP A;  1UGJ A;  3AE4 B;  3VRA B;  1MVK A;  3V3X A;  1GOZ A;  1TY2 A;  2FBW B;  3ZQ4 A;  4A90 A;  4YTP B;  1ROE A;  1N61 A;  4C80 A;  3B2F A;  1I4P A;  1PUT A;  2JWU A;  1T5X D;  3P4R B;  3UI3 A;  3WCQ A;  2WXM A;  4J3O D;  1QOF A;  5HI1 A;  4WH4 A;  4YSY B;  4ARC A;  4US9 A;  2RDH A;  1ENF A;  2HTM E;  2QJL A;  3NVV A;  2XNA C;  4WIP A;  1QIL A;  5H92 C;  2SAK A;  1EWC A;  1QOB A;  2EEL A;  1B1Z A;  2JSV X;  4HJG E;  4N59 A;  1F2R I;  3P4P B;  3IT6 B;  1HQR D;  3MFG A;  3SEB A;  3HRD D;  2WXF A;  4ARI A;  5HFY A;  4LTU A;  1RM6 C;  1YMH E;  2PTL A;  3FAH A;  4A8X C;  1ESF A;  3CWI A;  1QKZ A;  2WXL A;  2YEP F;  2WS3 B;  4R3D A;  4L23 A;  2GB1 A;  1YN3 A;  1K51 A;  4DQO C;  1DGJ A;  2V3N A;  2X38 A;  4L2Y A;  3Q8C A;  1JWB D;  2MJE A;  3B9J A;  1YJI A;  2ON8 A;  5HG2 A;  1M4V A;  3AEA B;  2K0P A;  1K53 A;  3AE6 B;  2I38 A;  3SR6 A;  1D5Z C;  1CQV A;  1RYJ A;  1XCQ L;  1VR9 A;  3ZJT A;  2VZK D;  2MJD A;  1TS2 A;  4YWG G;  5D3I B;  1E9M A;  1V1O A;  1FFV A;  2BS2 B;  2K9X A;  1I4G A;  2WXO A;  4JWS C;  1WRI A;  2CJN A;  1MPE A;  1L0X B;  1FRD A;  1ACC A;  4NAM A;  2MJ3 A;  2QSD A;  4RF0 A;  1NVI D;  1DOX A;  4RH6 A;  3VRB B;  2DBY A;  2Z8L A;  2B76 B;  1WYG A;  2RDG A;  2KDM A;  1JWU D;  4HKQ A;  1C4C A;  2Y3A A;  2WDV B;  1XLN A;  4WUR A;  3TEX A;  3AED B;  4USA A;  1OQR A;  2M19 A;  1TS3 A;  4YT0 B;  5BMI A;  5JXV A;  1SB3 C;  1HZ5 A;  1FRR A;  3N9Y C;  1XLQ A;  2N9K A;  2Y5C A;  2LHD A;  4TSS A;  4MM3 B;  2NTT A;  2K22 A;  3GB1 A;  3FIL B;  2J42 A;  2D5G A;  4YSX B;  1TY0 A;  2MEK A;  2WP9 B;  1K50 A;  3BVG A;  1FIQ A;  4MT5 A;  1AN8 A;  1MHH E;  3EGR A;  1LO5 D;  5C2T B;  2V4I B;  4YSZ B;  1V97 A;  5G5H A;  1T3Q A;  4C7Z A;  1VZ8 A;  2PMV A;  3NZ3 A;  4XWT A;  5D7G A;  1V1P B;  2PVO D;  1JQ4 A;  1I4X A;  1L0V B;  1SSN A;  1AWD A;  1SEB D;  3NS1 A;  1QT9 A;  1KLU D;  4KKJ A;  2ACZ B;  1ZP0 B;  5HHD G;  1C79 A;  2L52 A;  3E9S A;  3VR8 B;  4TQ0 A;  2W54 A;  2IPK D;  2KAJ A;  2M56 B;  1VZ7 A;  3NRZ A;  1C4P A;  3ABV B;  3AV8 A;  2JU6 X;  2ICI A;  4AS1 A;  1D5X C;  1QOG A;  1KRH A;  1F0Z A;  3R8B A;  1FNU A;  5C3J B;  3W1S A;  3FIL A;  3U2S C;  3HVZ A;  1GAQ B;  2AQ3 B;  3PZ8 A;  2LGI A;  3P42 A;  1C77 A;  2LJI A;  3TUO A;  1JRO A;  1PYW D;  2JZP A;  2LUM A;  1J7A A;  1N5X A;  3AM9 A;  1XCT L;  3MJ5 A;  1V1P A;  4ZRQ A;  4YTM B;  4PT5 A;  2E6X A;  5G5G A;  3R2I A;  1GPX A;  4OW0 A;  2L32 A;  1GB1 A;  1IGC A;  2BB5 A;  2TSS A;  2PVG C;  2WQY B;  3AEG B;  2Y5P A;  5EE9 A;  1STE A;  1YNT E;  3AE3 B;  1Y56 A;  2BBC A;  4N6E B;  3NVZ A;  4DXF A;  4A55 A;  2GI9 A;  3VR9 B;  1FD6 A;  1FEH A;  1EWY C;  3KWL A;  4HEA 1;  4HRS A;  4MAC A;  2OED A;  4N58 A;  2QIL A;  1MI0 A;  1PGB A;  2DYO A;  1SE3 A;  2WXP A;  1TS5 A;  4MH8 A;  1C78 A;  1E7P B;  3J9C A;  4HRO A;  1MHX A;  2NMQ A;  1NYQ A;  1UNS A;  1NEN B;  3AEB B;  3KWV A;  1JAL A;  2L83 A;  5EE1 A;  1EU4 A;  4YXD B;  5T8I A;  2FUG 1;  3AH7 A;  5BMH A;  2JYT A;  2ONQ A;  4B0E A;  1N63 A;  1VRA B;  2WU2 B;  1VZ6 A;  2DYM A;  2INP E;  1D5M C;  5FK9 C;  3ZJV A;  3NUH B;  2M0A A;  1XF5 L;  5TSS A;  2J4X A;  5D3D A;  4NAW B;  1KF6 B;  1PDX A;  1UWM A;  2WLB A;  1OQQ A;  2IGG A;  4TQ1 A;  1XLO A;  5LNK 1;  3P4S B;  2H89 B;  1WGK A;  1JW9 D;  1KH0 A;  1VDV A;  2DWQ A;  1RWS A;  3P1M A;  3NVW A;  3EUB 2;  2KWD A;  2BTE A;  3BVM A;  3PO0 A;  1JRP A;  4JE3 B;  2IDY A;  4OZA A;  2QEJ C;  1SBB B;  3BWU D;  1I4H A;  4GLS C;  5FKA C;  1WXQ A;  1TS4 A;  2JXT A;  1YQ4 B;  4A6Q A;  4O1N A;  4AQ7 A;  4OVZ A;  5BMG A;  2WNM A;  1EU3 A;  1FNW A;  1YJJ A;  4H2A A;  3Q69 A;  3ZGZ A;  2OHF A;  4LK0 M;  2R61 A;  3TSS A;  1WSP A;  1PGA A;  2WDR B;  3AE8 B;  4OZB A;  2ZW0 A;  2CJO A;  3BII D;  2N0S B;  3IAM 1;  1YN5 A;  3EA6 A;  2NTS A;  3DWM A;  1UWX A;  1I4Q A;  4C56 C;  2PLP A;  2WXK A;  3FC4 A;  3AB5 A;  2J53 A;  3LB8 C;  2IGH A;  2E3T A;  3BYT B;  2AQ2 B;  4NJC A;  4IDI A;  3ZYY X;  2RPV A;  5GXG B;  4FXC A;  1NI3 A;  3B2G A;  1ZXI A;  4XDD A;  2INN E;  1PGX A;  1SE4 A;  3PZ7 A;  3GP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...