3NVZA

Crystal structure of bovine xanthine oxidase in complex with indole-3-aldehyde
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvzA01
1ZOYB 2CU3A 1XLQA 3KWLA 1RM6C 2W3SA 2AX5A 1XLOA 2WDRB 3AE7B 2PIAA 3AN1A 2QJLA 3NVZA 3L4PA 1WYGA 4HROA 1E0ZA 5G5HA 3AE2B 1FM0D 1FRDA 3AE6B 1DGJA 2DBYA 1IUEA 1JW9D 2MJEA 2WU5B 3AB5A 1KF6B 5H8YE 4YSZB 1J7BA 2K5PA 3NS1A 2WU2B 1SF0A 2KMMA 3B9JA 1WWTA 2Q5WD 2WLBA 2WQYB 4IDIA 5AUIA 2QIEB 3NVWA 3AEFB 3VR8B 3HRDD 2FBWB 2H89B 2JQRB 1NENB 3VRAB 1YQ3B 3SFDB 5EE9A 1KFYB 3AE5B 1YJIA 1DOXA 3RPFC 1WGKA 1DOIA 4N6EB 3DWMA 3P63A 4YXDB 4P6VF 2B76B 4WWMA 3AECB 3SFEB 5C2TB 1E6EB 1JROA 2OHFA 3LB8C 1JWAD 1QOAA 1E7PB 3AEEB 1R7SA 3DWGC 2L52A 2WP9B 3ABVB 3AE8B 1PFDA 4A9AA 1XO3A 1N62A 4YT0B 1L5PA 1ZXIA 3W5VB 1NI3A 4US9A 3SR6A 2N0SB 4JWSC 2BS3B 3AEGB 1GAQB 1JWBD 2G1EA 1QOGA 1WXQA 1PUTA 1ZP0B 2PVGC 3AE1B 1FXAA 3P4PB 4YTMB 2E3TA 1E10A 1GPXA 1QOBA 3AE4B 3AE3B 4ZOHC 1VDVA 1TYGB 4US8A 3NVVA 1L0VB 1YJJA 1XLNA 1RYJA 4C7ZA 1QF6A 2PVOD 1A70A 1SIJA 1KRHA 3P4QB 1TKEA 5MPOA 1N63A 1CZPA 3AEAB 1RFKA 2M56B 2MH7A 3P4SB 4YSYB 1N61A 2W55A 5AUKA 4YTNB 1VJKA 3AV8A 2W54A 1EWYC 5EE0A 1UWMA 3B2FA 1JALA 1RWSA 2MJ3A 3P4RB 3LXFA 2JX5A 1FFUA 1PDXA 4JWUC 3NRZA 1L6UA 3AE9B 1DOYA 4YTPB 1F0ZA 1SB3C 1VLBA 1FMAD 1J7CA 1E9MA 1AWDA 1QT9A 3B2GA 2WDQB 3CWIA 2LEKA 2M19A 1B9RA 3PO0A 5H92C 1NYRA 1I7HA 1WRIA 2WS3B 2KAJA 3FC4A 1TKGA 1NVID 4FXCA 1FFVA 3ETRA 1OQRA 5GXGB 2L83A 2K22A 1L6VA 4C7YA 1ROEA 2BS2B 1FXIA 2WDVB 1TJEA 4HRSA 4N59A 1FIQA 3W9CB 5C3JB 2ACZB 2Y5CA 2HTME 4JX1C 5EE1A 3AMZA 1T3QA 3AEDB 3VR9B 2CJNA 1N5WA 1XLPA 2CJOA 4N58A 1NYQA 3VRBB 4YSXB 1N5XA 2MJDA 5G5GA 1NEKB 1OFFA 1FO4A 1QOFA 3W5UB 2W3RA 4USAA 1TKYA 1OQQA 1JRPA 3BIID 2DWQA 1AYFA 1QLBB 1N60A 3P1MA 4KX6B 4WQMA 2BS4B 2K9XA 3AM9A 5EE3A 4LTUA 1V8CA 3HVZA 4ZHPA 1J7AA 1CJEA 3WCQA 1JQ4A 3HUIA 1YQ4B 3NVYA 3AH7A 3EUB2 1FRRA 2PKOA 4ZHOA 2H88B 3FAHA 3ZYYX 1ZUD2 3CIRB 4ITKA 3AEBB 2BT6A 2EKIA 1V97A 4C80A
chains in the Genus database with same CATH superfamily
3OWEB 1Z19A 3EHVA 5AKXA 4AP4C 3AN1A 4RNMA 2R8HA 5HKHA 4GC7A 3AE2B 3K1ZA 4BBNF 3GB1A 3RRGA 2KJRA 3QU9A 2ASQA 5JZEB 5E6JA 4ZDVA 1AN8A 4ED2A 1RLFA 4LNKA 4C0ZA 2B21A 2UVWA 3N3KB 1ZE3D 2Q5WD 1OXJA 5DQHA 2BWES 3WANA 2D11A 1RAXA 2LJIA 2KZ3A 4W9EA 2UVRA 1YQ3B 8ICGA 5KG4A 3TADA 3RH5A 3QEBZ 2OEHA 4JGHB 3RPFC 3RNEC 4RH6A 1AARA 2PMZC 2RPVA 3CRXA 1MN8A 3PPAA 4GLSC 4M8MA 2AEHA 4AJWA 4DEZA 1XCQL 2LI5A 2LZ6A 4A9AA 1JMLA 1FEZA 1FNVA 3NZ3A 5D49A 5IA7A 1Y56A 5ALNA 3ZDBA 1IM4A 1ZXIA 4Z6FA 3MJWA 2KC1A 3P4PB 2LM4A 3C2KA 3T5LA 1WRDB 7ICEA 3VDZA 2KOBA 3RAXA 1BMLC 5DB6A 3UQAA 3RJHA 2HVHA 3QU2A 2PVOD 3Q3OC 5MPOA 4LDTB 4NL9A 4WJ3B 4M6WA 5FP0A 1N61A 4DBGA 1Q3UA 5BMHA 2BR0A 4UW9A 4WJQA 1L7NA 3EFUA 2KOXA 5FR3A 4PHDA 4QZGA 4YG2A 3V6JA 5D46A 2KWVB 2ZJ8A 2YB1A 3M9NB 2F1HA 3E0FA 2OXOA 5C5JA 2UVVA 2HHVA 4AQ7A 8ICYA 5IIKA 5AZFA 3MR3A 1TVAA 4R63A 3BK2A 1DOYA 4RGTA 5IILA 3JPSA 4YTPB 1F0ZA 4EEKA 2DZKA 2JGAA 3MGVA 3VVWB 1J7CA 2D3CA 3WK5A 1AWDA 1KW4A 4YR3A 4R66A 3G6YA 2A3VA 4M9HA 2R8IA 1LXDA 2J0MA 2ZIWB 1BPDA 4XUSA 1I7HA 5JRTA 1LO5D 3X0WA 1QTMA 1QSLA 4FXCA 2KNBA 1OQRA 3ETRA 2ZJAA 2C2DA 1NZPA 4KLIA 2I1QA 3BYYB 1H8CA 1GO3F 3Q14C 2P6UA 4K4IA 3KTQA 1MG8A 2WXGA 5E6NA 3M8RA 4Y2VA 5HMMA 1PVRA 1B4FA 2XCPA 5J0TA 3MFIA 4DL5A 4DF8A 1GB4A 1A0PA 4Y2XA 5ALMA 2ZEQA 4W9IA 3L54A 1F9JA 2G4SA 3ZRFA 3SZ2A 4EYHB 3EECA 4NQKE 5CTRC 3JSVB 1BPBA 3C0RB 4F50A 2MHJA 4MF8A 3FDSA 4GFJA 7ICFA 1K1QA 4MFFA 2LGDA 3SAGA 3V6CB 5AM4A 1KSPA 2W3SA 1QILA 3AU6A 4YN4A 3TBLD 1OW5A 1RRBA 4FBJB 3VTUA 3RNAC 4F5RA 4FJZA 1BNOA 1SKRA 4QAYA 3BQ7A 4YL8A 2WXLA 2KKPA 4KLEA 2JF5A 2INDC 2ZVNA 1L4ZB 3X23A 1NENB 7ICIA 5DGBA 9ICPA 2BCQA 2C28A 9ICCA 2FUHB 1WYWB 4YP3A 1EO6A 2KHVA 4P16A 4J9PA 2W7PA 2L5YA 4A8XC 2GLSA 2R61A 5CJ7A 3NY5A 1GOZA 4HDOA 4ANVA 2VZKB 2V9WA 2G45B 9ICVA 4BAXA 1WY8A 4IKGA 1L5PA 5KFAA 4GGQA 4O3PA 4L1BA 1C4PA 3T9LA 2BHNA 5KG7A 4HWIB 2CN1A 3GZNI 1XNSA 4HXDA 4XWTA 1WWVA 1ZD2P 2PFOA 3RI7C 4EEWA 2LMCA 1UD7A 2K8AA 4C56C 4NY0A 4GXJA 2KXJA 3TSSA 1RYJA 1PGBA 2VJ4A 2Z59B 2VH2A 8ICIA 2UYZB 3AEAB 4EUTA 4KVGB 4DFDA 4M9GA 1HUOA 3RD2A 3U8ZA 1EWYC 1S97A 3RFZB 2BBCA 3AQFA 2GI9A 1EXNA 2RRDA 2J0JA 5ALYA 3IAM1 1YD8U 5KFOA 9ICUA 5ALHA 4KGRA 2RDJA 2A5UA 1FFUA 3KHRA 3NRZA 5AKLA 3VHTC 3QU5A 3F2BA 2D2QA 5J2JA 4IRDA 5AM1A 2K8BA 2H3ZA 4O3NA 5AKJA 1E9MA 5KFRA 2V4RA 1QT9A 1ZQJA 4J6IA 4S0RA 3WKDA 1NYRA 3WU2U 4HPPA 3M6KA 2KX3A 2AGPA 1FFVA 2K22A 2M9NA 3Q8RB 1EWCA 4MGZE 3V62A 4DHJD 1TJEA 3HKZC 2KSOA 4KMOB 2HHQA 2KJ6A 4K7UA 3F2CA 4UQGA 2N1VA 3A9JA 2E1EA 3N4MB 2MU2A 4RGOS 1TKYA 3RH6A 1ZQCA 4XE0A 4IR1A 3MR5A 2K9XA 3ZD9A 3AM9A 3DVNU 1DK3A 3E58A 4EZ6A 3KZIU 4HEA1 3WKBA 1YT3A 3UMBA 5AKHA 3MDCA 1S3SG 1JQ4A 4CF4A 5LXIB 2FI1A 4RT3A 3AL0B 4O3OA 2O2VB 4DLGA 5IIMA 1EU3A 2NMQA 1WG8A 4C4RA 2P66A 5AEKB 4G50A 2F2AB 2IOFK 5KFFA 1VD2A 3QUTA 1QCKA 3I1YA 2INCC 1LKYB 4MH0E 4HROA 2I2YA 4BOSC 3KZXA 2BTEA 2G3QB 4WH4A 1YOVB 3AEVA 4KSLC 3AQEA 2JZBA 1VCBA 4CHKA 2WF7A 3HRDD 4FHKA 5IO9A 3OHAA 4MJSB 1ZQWA 2DL0A 2LVOA 2EZZA 1WJ4A 5AKZA 1UA0A 4DL6A 2JR5A 2ZIVB 2Z7JA 5KG5A 4RQ7A 3IDWA 4MM3B 4EKUA 4DSKA 1QOAA 1N56A 1ZQDA 3PZ8A 2Y1JA 2ASLA 1CMXB 2DYOA 1MVKA 2J4XA 5IKCM 4ZYNA 5L83A 3UGBB 4M47A 4DOBA 4Z6DA 4JWSC 3AE1B 4EX6A 4LNIA 4UB1A 2YLMA 4KGSA 2NVUI 2MCNB 5JH5C 4IQVA 3OGUA 3PHWB 5DCNA 1HIWA 4EX7A 2WXIA 3VTWA 1WZ3A 2A1AA 4ZH4A 1RFKA 2M56B 5G55A 2D07B 4YTNB 2PE6B 4DOCA 1ZDXA 5KFJA 1P9DU 4GDKA 5CX3A 4P4PA 1I42A 4IR9A 1ZD4A 4I2HA 4JWNA 3DVGY 2C5LC 3KUCB 3AU4A 2RD0A 3H7SA 2MBQA 4KLOA 2MX2A 3RJGA 4DL2A 4LK0M 2KZZA 3EWAA 3RYTA 2NRZA 1STEA 1KTQA 2VH1A 4F4KA 4LDTD 5KG6A 4QZBA 1NK5A 2WDTB 2LYAA 7ICQA 5GMVA 1TKGA 1TAQA 3IBEA 2J6UA 3H0LB 5TR5A 2L83A 3T3NA 2CKHB 5J17A 1QQ5A 4BUGA 5EE1A 5IINA 3SEBA 9ICIA 1C77A 2ZZPB 2XY6A 2CJNA 4WIPA 1NYQA 2AQ1B 2DYBA 1WUDA 2C60A 3W5UB 4EZJA 2KVSA 2NV3A 2GRIA 4MELA 1ZQHA 4Y2PA 3RJIA 2D5GA 3K9PB 2JRZA 4MEMA 3R8BA 2ZXIA 1DRGA 3D32A 3PY8A 2K4EA 5KFCA 1Z4OA 2BZFA 4O3SA 2KKVA 3HWTA 2N7JA 4YMNA 2LD9A 3GE8C 4BKTA 2HTHA 3H7PB 4QW8A 1ECWA 4TV3A 4I2GA 1SKSA 4YMMA 5F9LA 3JPQA 3ZJVA 2KZRA 1UHUA 2EAOA 4I6PA 3IP4B 7ICSA 1N48A 4W9JA 2DBYA 2ZUCA 1C4AA 1TS3A 3BQ0A 1NK6A 1KF6B 4ACFA 3MGIA 4KN4A 2JXTA 2W9MA 1D8YA 4DFJA 5E6PA 3NVWA 1R4NB 1QQ6A 1ZETA 1S0OA 1TS4A 4C8NA 1Q8KA 4HAIA 3K4GA 5EE9A 1UH6A 4J9OA 1KFTA 4M9LA 1PGAA 5CA7A 3TACB 3H8JA 1C78A 3OPXA 1KL9A 4P6VF 1JI7A 3UF8A 4J9MA 5J29A 1O03A 4ED6A 3GZFA 1VZ7A 5LNK1 5IP4D 4HLEA 1JWAD 2JVCA 3BQTA 1SBBB 3QYPA 3ABVB 2V4LA 4P0PB 3ISBA 4M9JA 2KFKA 3RBEA 1JWSD 4ANXA 4KV2A 4TQRA 4PYZA 4K4HA 4RGMA 4Y2TA 4EELA 3QX7A 4Y2UA 2K4IA 1ENFA 5HR7A 2L0FA 4NNJB 3TANA 1NBFC 5BOLA 1NOMA 5BMGA 2K60A 1CRXA 2Q0ZX 3AU5A 4XRHA 3APFA 1L3SA 2SAKA 8ICHA 1GUAB 2VZKD 2D8CA 1P7FA 9ICSA 1UWMA 3HIZA 4RM8A 2BQ3A 3D2SA 4YQWA 2IY1B 4DSIA 4K3BA 4GXIA 4NL9C 3Q8BA 4FULA 5J2RA 1ZJMA 4PGQA 2WXQA 3B1LX 2H3FA 5J0WA 1L6UA 3AE9B 4DSLA 2JXXA 3P42A 1V1PB 3LDZE 2OM6A 1SE4A 3IG8A 3EPIA 1FMAD 5TSSA 3BYTB 4MDKE 3UI3A 2NRTA 1ZQZA 1RYUA 1S1QB 1ZOLA 3DBRI 4F2SA 2Y3AA 2JXJA 2K89A 1WXAA 1ZQAA 2WS3B 2KFKB 3CP8A 3DHGC 2ISPA 3RULA 4QWAA 3HHMA 1D4BA 1T0SC 3BINA 4BJQA 4URKA 1XO1A 1L4DB 3AMZA 3VH4B 2JRIB 2KK0A 3PSFA 4JL9A 3CF6E 1N6ZA 5IIJA 3KYDD 3ZO5B 1Z2MA 1F1HA 2REXA 2YTUA 3JPRA 2LI6A 4OVZA 3NS8A 2IHMA 2P35A 2C7NB 4L23A 5EE3A 3PREA 2CHWA 3DBHB 1MPEA 3SYZA 7ICLA 1T6BX 5AI5A 1F0MA 3BDPA 1SEBD 3Q3JA 2HOIA 2FLNA 4B9MA 4P2HA 4FZMA 2BQUA 4TQ0A 4EYIB 2CU3A 5I4DA 1XLOA 2IYDB 8ICMA 2MBOA 1AW7A 2HDEA 5J8YA 5G5HA 1M94A 2W03A 4UATA 2G4DB 2K1FA 3QK0A 4BKGA 1UGJA 4ASWC 2D3DA 1IUEA 4A3PA 5H8YE 3EPGA 5L9XA 5G2NA 1DOXA 3ZNHB 3GQCA 5C23A 3QU4A 1ZQYA 1VR9A 4AWJA 1D9DA 4YD2A 3CSTA 1XSPA 3VRAB 1MJDA 2GBJA 3U30A 3EYZA 1SKWA 4TUPA 4Y2QA 3MR6A 4JIOU 3N7RC 3J9CA 3Q8AA 3ZNZB 4CRXA 2KZMA 4L2YA 5DGAA 4J9RA 1C4CA 5AK6A 8ICEA 1C1YB 1PUZA 1YJ1A 2N9LA 3R66C 4NPNA 3UXOA 2OEDA 3GU3A 1WXQA 4TUSA 2IGDA 4GIVA 2ZIUA 4R8UA 4K1RB 5KFDA 2JHDA 1IIPA 3APCA 3A1QA 1P3QU 3MABA 1TYGB 2RQ5A 4F4YA 2NRWA 2ZCCA 2CHZA 3ZGZA 1D9FA 2PLPA 3TL5A 2AGQA 4DF4A 4OJOA 1V9PA 2HCFA 2L3ZA 5HI1A 1TK0A 1P0RA 2IBKA 3RN9C 2ISOA 3ZKJC 4LNOA 2WAQF 4JV0A 2ES6A 1K50A 4QZ8A 4G3IA 2IY0B 2J53A 2KMCA 5AZGA 4DHZB 3TEYA 1M4VA 4GU2A 2FJ6A 4ICVA 1J2NA 4EBDA 2W9AA 3A4RA 4E0DA 3H0RB 2KX0A 5J0XA 3N7PD 4W9DA 5D6JB 4Q43A 1S77D 3MC8A 3SU8X 2XK5A 2OH2A 5D3DA 3LWMA 5ALDA 1ZQLA 2INNE 2L8JA 1ZRMA 4ZRPA 8ICOA 4CF5A 2CS4A 4I2JA 1FXIA 2WDVB 1MA7A 4JX1C 3CMMB 4PJ0U 2FUG1 2CJOA 4C4VA 3Q8PB 3W1YA 3QAQA 2AQ0A 4IQTA 5EWFA 4W9GA 1NEKB 3PSTA 2E1FA 1OQYA 1KLUD 5DG8A 4F4XA 1TAUA 8ICVA 3KQ4A 2NBVB 3P1MA 3H6NA 4O0IA 5FR6A 3HVZA 4DS5A 2ZPNA 3BWUD 4B9LA 4JMUA 2L05A 2K39A 4JE3B 1B43A 2R18A 4B9VA 3UMCA 2BDUA 3CIRB 5JXVA 2ATLA 4M9NA 5KFTA 2ZJ5A 5ALJA 2YVCA 2GWSA 4OZAA 2HOQA 3W1SA 3TAPA 1B22A 2NYVA 3L4PA 1WYGA 1IPGA 9ICHA 2AYOB 4ANUA 1SE2A 4DK5A 1PZNA 2XO7A 3SD7A 1J7BA 5GTIU 1YN5A 3ZDMC 2KD1A 1SF0A 2KMMA 3B9JA 1NJXA 2WQYB 3GIKA 1U48A 2RGFA 2IPKD 1O08A 2H89B 1IG6A 1KM7A 3V6EB 2Y5BB 2UU7A 1IYFA 1YJIA 1XSLA 3HT3A 1S10A 1T0RC 4R65A 2V3SA 5KFIA 1WX9A 3MC0B 1ZQKA 3Q8EA 2OJRA 4RNOA 4IC7B 4G9BA 2YEPF 5T8IA 2DPIA 1D3ZA 3EGRA 3PSEB 1BVSA 2FCQA 3PRPB 5FKAC 3WK4A 5L1IA 4GSWA 2DHZA 4RF1A 3ALBA 3IAS1 4Q8FA 1QOBA 2JWZA 1VDVA 2Y5PA 1L0YB 4RNAA 5HHIA 5JUMA 2KVCA 4DQRA 3RB3A 5FK9C 1HUZA 5J2IA 3WKAA 2MH7A 4M0WA 2XEWA 4YSYB 4AYBF 1SV0A 3PNCA 1VJKA 2O6KA 4B6JA 4J9QA 9ICLA 2O6VA 1IV8A 1XSNA 4IOIE 3RJFA 5AM5A 2D6FC 4DL7A 2XY7A 4NAWA 1L7OA 1WXVA 4PZNA 3OJUA 2KN4A 3IRUA 4MHVA 4RF0A 3WA0A 3BZKA 2KJ8A 2WDQB 1ZQGA 2N9PC 4KKIA 2IZVB 2KVRA 5IN7A 1ACCA 3MJ5A 5HHDG 3DHIC 2C7HA 3TI0A 5E79U 2DKZA 4FS2A 4KLMA 1XF5L 1L6VA 4HRSA 4TQ1A 3W9CB 1GC6A 4B9SA 1EU4A 3THVA 2WB1C 1KH0A 4RQ2A 5HP4A 4O3MA 2PMVA 8ICWA 3QX1A 2LUMA 1BT0A 3RF9A 4Q8EA 8ICNA 2RHFA 3DHHC 3H9DA 4B6WA 4I2EA 1L8LA 3VR9B 3WK7A 4UAWA 1JWMD 3WK8A 1UWXA 1J7AA 1HQRD 4GXBA 3WCQA 5CEHA 1DOQA 1ED1A 3RJJA 2HVIA 1F2RI 3GS2A 5DLFA 4X5VA 1Z3EB 3ZYYX 3M6ZA 3PZPA 1RPLA 3V72A 2JYTA 4I6NB 1BGXT 3PSPA 3F5EA 4FO6A 3GP7A 4WJOA 2KIWA 3MGHA 2EMTA 5B66U 1SGHA 3TJPA 4WJPA 1U49A 9ICGA 1D5MC 3TEWA 1JW9D 1ZQMA 2EAPA 3BQ1A 2WX1A 4M02A 3D2QA 1J8CA 5J0YA 4M6WB 4C8MA 9ICNA 4IDIA 9ICMA 2AU0A 4IRKA 3IN5A 1UBIA 3DBLI 4DDID 3S6JA 3U7DA 4ECXA 2ZW0A 4PZOA 1Z5SB 3IFWB 3SHQA 1KFYB 3QXGA 1T94A 2KV2A 3BVGA 4MACA 1V80A 2A4ZA 2NO4A 2N9KA 4N6EB 5KNIA 2EELA 2JEIA 5AK5A 3AECB 1X9WA 1WFYA 1D5ZC 2IGHA 5J2EA 4BX9C 3ZDTA 1E7PB 1F77A 4Q45A 4ECWA 3DWGC 2B3AA 4OVVA 1VRAB 2JY6A 3M63B 3D2NA 4AP9A 5ALOA 3HPOA 5TISU 1NJWA 3ZDAA 3CSFA 3ZJUA 4ARCA 1JWBD 5DPRA 1QOGA 1ZP0B 5AKIA 3PSIA 2E3TA 4HYKA 4EENA 4II2B 4KLSA 5C0YA 2FAZA 4ZOHC 2G9HD 3AE3B 1V2YA 2V9HA 5AM2A 5KFHA 2CRXA 1T4GA 2Z0EB 3NUQA 1GNUA 4QJFB 4NY8A 4YR0A 3O65B 2ZPYA 2R2OA 2BGFA 5BYQA 3AV8A 4I29A 4GDLA 1QH9A 3M3JA 1RWSA 2V1YA 3B0XA 1CQVA 5ALIA 3P4RB 4RQ1A 4UB2A 4UASA 3NRWA 1HE8A 3HP6A 2AJQA 4F1SA 2KC2A 3QUCA 4NLGA 3N1ZC 1ZQFA 4YCXA 3QZ8A 7ICKA 5BMIA 3Q8MA 1KKXA 1B9RA 3LWLA 2GBRA 4HPLB 1HZ6A 1OGWA 1HTQA 2MAXA 3M9OB 5ALGA 1NVID 1X1MA 3KKAC 3VTVA 1HEZE 3JPTA 3BJYA 3ISCA 4C7YA 2ALZA 4N59A 3N1YC 2ACZB 5CHVC 3VAWA 2H3VA 4J9LA 1G6JA 1T3QA 1ZPSA 1ISNA 2J6SA 1N5WA 2G07A 3VUXA 4F92B 5ALLA 2MJDA 2HW3A 4DDGD 4LNFA 1ZD3A 5AKGA 3GDXA 2QLTA 4AS1A 1JRPA 3BIID 4QZDA 1AYFA 4GDLB 2W8LA 2JU6X 4YVZA 4IWPA 1UGMA 1UCVA 3VFKA 3RJKA 1UZXB 5AI4A 3ML9A 4I2BA 4RGNA 4XYCA 1J2MA 3Q8QB 5J0SA 4OCZA 3GV8B 2FDRA 5KFLA 4RQ4A 2HOFA 4DXGA 4E71A 3IT4B 4RT2A 3Q8LA 4A8EA 2BT6A 2PMZF 5J2BA 1TS5A 2QARA 2EDUA 4PPXA 3Q8CA 3WKCA 4F4ZA 2QKQA 5CRXA 4F7ZA 2Y9UA 3SMVA 4M04A 2BKFA 1CEZA 4NLNA 4PYUA 4PL2A 3AB5A 5HR6A 2DZJA 4DCCA 1Z4NA 3LVVA 2XICA 4HCPB 3EA6A 2EANA 1JUDA 2ZTCA 2WNMA 7ICPA 3IT6B 4ZRJA 1GJZA 1MSWD 4F5QA 2PFQA 1QQRA 2IDYA 5KHOA 4ECUA 3ECIA 5AM0A 3MC1A 5CP2A 2AL3A 2W8KA 2HBMA 3NOBA 2PW9A 4DHZE 3VUWA 3J81j 2BVCA 2KACA 2ZNVC 2K8BB 3IXSA 4ARIA 5ALZA 2H3IA 4P0QA 4K81A 2YMMA 4I2FA 4PS3A 2AQ4A 4MGKE 5ALFA 2NTSA 2JMGA 1E6EB 5L1KA 2HBLA 5AIBA 5EWGA 4FA6A 2Y0SC 2K4PA 2E5SA 1UNSA 3VC8A 3C23A 1N62A 1NK9A 4H2AA 3SENA 8ICPA 4B9NA 3WAOA 4HKQA 4CCHA 4F5OA 2BS3B 3L3FX 3HK0A 4LVSA 2KSOB 4IG7B 3ZD8A 1KEJA 1ZXHA 5ALRA 2WXKA 3A9JB 2FNJB 3VCBA 2KN7A 2XBBC 2LUEA 4WWPA 1QF6A 5AIAA 3WAMA 5KFVA 3NJTA 4U6PA 2PI5A 5J2CA 5ALXA 4HPMB 1WMHA 5DG9A 3OSPA 3Q2AC 5DB7A 4RZRA 2VRRB 3ED5A 3RUIB 1NJZA 2W04A 2INPE 1I35A 1L0XB 5H2FU 2NPTA 3KH0A 4R3DA 1A5RA 2VA8A 3ZQ4A 1A6SA 2FLPA 4KKJA 4FBUA 5KFBA 5ALUA 4NAMA 4HK2A 1SXDA 2B0CA 2I38A 2ONQA 4KLTA 3JYUA 1WXMA 1SJHD 2E8PA 3QUQA 3C2LA 3B2GA 2J52A 3OSNA 9ICJA 3A33B 1FPYA 1PK1A 5KAFU 2GBMA 2IO0B 4AJYB 3L17A 1E7VA 3R7RA 4BVUC 4RUAA 2JZBB 3GZNB 3PMNA 2IO3B 2KO3A 1BPEA 3ORYA 4MEXA 7ICGA 2JWUA 1N5XA 3TQ1A 1WZ0A 5G5GA 2IOFA 1KLGD 3MHZA 2MLBA 4M01A 2ZCBA 1C7YA 4KDLB 5J2GA 2MBHA 1JXEA 2HSZA 3M9MB 1LM8B 4J3OD 3T5HA 2WXMA 1K52A 4BZAA 4ZHPA 2BYTA 3MR2A 5IIIA 2BYEA 1WJNA 3ICXA 1NDDA 2QILA 2I1KA 7ICUA 7ICNA 4ELUA 5KAIU 3V7JA 1PK3A 4PH5A 4J03A 3UM9A 2N7EA 4J9SA 3ZXRA 2LKYA 4DXFA 2W9BA 1FD6A 3GIJA 2EAMA 1BPYA 1YX5B 2FIFA 2FIDA 1PK1B 3NVZA 1WGGA 3OJ4B 3C28A 3A0HU 4RQ8A 1FRDA 1K53A 3AE6B 4O9MA 2KD0A 4EE2A 2NBUA 8ICCA 4TQSA 3W1SC 4BOZB 2JPHA 5KFQA 4F5NA 2YX8A 2FCNA 4ED3A 4KITB 4PS8A 1URJA 8ICQA 3VR8B 1RXVA 2MP2A 4GDKB 4UB8U 3U4EG 1MC8A 2G0AA 3QNMA 1SZHA 4DQOC 1YZ6A 3KUDB 4DFKA 1I4RA 4A55A 2DAFA 3H40A 5ALTA 1TK5A 5DBBA 4Y2YA 4UAZA 1EF1A 1QSYA 2MBBB 1QSSA 3T3OA 2WP9B 1PFDA 1SZPA 3WK9A 1ZRNA 1L8OA 3W5VB 4C00A 1JMSA 4FZLA 2WXRA 2CU1A 1TZ1A 2PVGC 8ICLA 5KT7A 4O5KA 2KVZA 4XX5A 3PX4A 1CUKA 2IOHA 2KTQA 1Q10A 2QB0A 4OJ5A 4CNQA 3B08A 2KP7A 2KDMA 1RQNA 3HM3A 1WX8A 5KHQA 4C7ZA 3I5JC 3P4QB 1SIJA 2J6TA 3T8MA 7ICJA 2F8LA 3N9YC 4B9TA 2BYFA 1Z00A 2ON8A 3HKZF 3ZLZA 5EWEA 4WWNA 2N1WA 2W54A 3ZIMA 2LBOA 1ZQRA 3B2FA 3TADC 4X57B 5AI6A 3BS7A 4I27A 5AM3A 5KG0A 4QZFA 3I28A 3NASA 4JWUC 1I4GA 1J0GA 3GIIA 4ECZA 2NBWB 2HDOA 1UELA 1NK8A 2XN9C 2W11A 4NLBA 3L08A 4IWOA 2BGWA 4MGIE 5KT6A 4IM2A 2KLCA 1V9JA 1T0YA 2KWCA 3MFGA 2ZG6A 2NCNA 2V4QA 2BPGA 2IO1B 5HFYA 3ZDDA 2Y0SF 2MRLA 4YR2A 2FCMA 4BGDA 5DLGA 5L1JA 4MSMB 4UB5A 2W9NA 2NTTA 3KLSX 2LYHA 7ICTA 3UQ2A 1IP9A 2SEBD 1BPXA 5KT5A 4ECQA 2KE7A 3C21A 3LVWA 4JUZA 4MFAA 2PXIA 3PX0A 3RB4A 1B1ZA 2HJ1A 4NJ8A 2YY6A 4ZRKA 4MEYA 2C2EA 3N97B 3NUHB 5LLIA 2BPSA 1DYQA 2B6GA 1R4MI 1D5XC 5CB1A 1UT8A 4KLHA 3NZUA 1ZQVA 3ONNA 2ESEA 4BXOA 4ZHOA 4OZCA 3DBSA 2E8NA 1ZUD2 3ISDA 2JUOA 3DOWA 5D2MB 5T14A 3KHLA 1V97A 3RR8A 4UAUA 4C80A 4KLLA 4KX3A 2BW2A 1XLQA 2LGXA 3QWZB 4GMVA 2WDRB 4Q44A 1NKBA 3C1YA 2NRXA 8ICAA 3GOEA 1GB1A 2PI4A 1L6NA 1IXRA 5KFXA 2HE7A 1KFSA 5KFNA 2KHQA 3ZDEA 5AI8A 2ODGA 4LLGM 3SD5A 1KJTA 3ZTDA 5KFZA 1RDFA 2LGSA 4MT5A 4EZKA 2JQRB 2WYQA 2XC9A 5E6OA 1ZQSA 4XZ4A 8ICBA 3TIXA 5IAAC 4O3RA 3MTNB 4EZ9A 3PR4A 2EZXA 1WGRA 1NI2A 2C9WB 4RQMA 3DWMA 4B9KA 3A0BU 4BWMA 4F8RA 5DPSA 4NM2A 1NKEA 4YWGG 4I2IA 2FPKA 3ZW3A 4R64A 4BBNC 3U26A 3C29A 5AI0A 5DG7A 2TSSA 3OG5A 1X6IA 2G08A 2D3AA 4M00A 4GXKA 2PFNA 1NI3A 2RR9A 2VA3A 2V3NA 4YTMB 3UQ0A 1V85A 9ICWA 5J0RA 4OJLA 4UARA 1ZQEA 4DQSA 1TE2A 4C8KA 5KT4A 3RJEA 4NV0A 1PVQA 1N63A 3UQBA 1ZQIA 4NWIA 3P4SB 3EC8A 3L0WB 2MEKA 4MH8A 1SL2A 2JH7A 2BKEA 4GB9A 1U9LA 3TMPB 2C2RA 3LJ3A 1ZQPA 2WXFA 1KN5A 4F4WA 4PK1A 5HG2A 4A6QA 4DWFA 2ZUBA 2MWSB 3DPDA 3L10B 2K8HA 1SE9A 4AOFA 9ICTA 3UXPA 4KTQA 1VLBA 3LDAA 5KFSA 1T5XD 1K51A 3V6KA 5J2KA 4F5PA 1X9MA 2BF8B 2M19A 2HJ8A 3PO0A 4ECRA 2XNAC 1JIHA 2WF5A 3RR7A 9ICBA 5GXGB 4EOYA 4RQ3A 2ZNVB 4ECYA 3IG5A 2HTME 3ZVVA 2C22A 1KDHA 2E8MA 9ICQA 3PGEA 4XC2A 2FMQA 2CR5A 2MUTA 5KL8B 4JLCA 2DZIA 4NJCA 5TZVA 8ICRA 4G0NB 3ZXVA 2LHEA 1T8EA 3U2SC 1FXTB 3ENEA 7ICHA 3ZRCA 5AKYA 4HJKA 4HKZE 3KD3A 1XCTL 1S8OA 2KK8A 3IV6A 3UMGA 1TZOA 2H88B 2F76X 5JHBA 4DSJA 4P4MA 2YB4A 1ZOYB 2LFIA 2ZIUB 4R8UB 1V5OA 3BVZA 5LXHA 1DK2A 1YN4A 3AE7B 3I3TB 3A1QB 5J2AA 1T7PA 4F91B 2HBKA 3DEEA 2K4HA 1JCKB 2J42A 3DBRB 2K6QA 3VH3B 1K8RB 4FJVB 5J18A 4TUUA 1WSPA 1SJED 4NQLB 2BPCA 1Z1VA 3BQ2A 2LM1A 4GLXA 1WI0A 2DX5B 2WU2B 2LRWA 5BYSA 4IUMB 4K7SA 1WIAA 3PS6A 3RB6A 3H0MB 5IOIA 2L00B 3PRMB 3CYMA 4CGZA 3AE5B 3R3MA 1FCLA 4RQ5A 4NLKA 1XD3B 5ALSA 2WXJA 3N7SC 1SXEA 2DPJA 5J2DA 1GC7A 3PV8A 3GE3C 1WE6A 2XK5B 2OHFA 2ZIXA 8ICUA 5KL1B 3RAQA 4DL3A 3T5JA 2QMTA 2L52A 4HVBA 2GLEA 2MA9B 1KBUA 2HMXA 3C5GA 2HHUA 2DAJA 4US9A 1C76A 4J9KA 1Y88A 4F3OA 3M8SA 1LFDA 2JRHA 1TY2A 3AE4B 4C4VB 1UBQA 2KTRA 4IQWA 1UQVA 2DF4B 4P4OA 3PW0A 1YJJA 4KZCA 2F1IA 2HHTA 1ZQUA 5KFYA 4LJPB 1PYWD 1TKDA 7ICRA 1C9FA 3ZI4A 3UPQA 3RMKC 2K8CA 5ALQA 1RYRA 4DQQA 4QZCA 4GC6A 3V61A 2L1AA 2QHOA 1MFWA 1TS2A 2IO2B 1FEHA 2QSDA 2V3PA 1WJUA 2JX5A 5AZHA 1ZQOA 3VQIA 4PHEA 3KW5B 2EMSA 3TFRA 3OAWA 1WCLA 4C4TA 3HW8A 2YQEA 1EUVB 2K0PA 1YX6B 3NG0A 2PKEA 2Y1IA 2LJ5A 4UBBA 1ET6A 3MHSD 4M8NA 2LYBA 5KTQA 1BNPA 1WR6E 4WURA 3U7ZA 2DENB 2J7QB 1OTRB 4B95A 2AH5A 4MFCA 4ZRIA 3FC4A 1X9XA 1QLNA 1V86A 1YNTE 3QHTA 2H3QA 2ZTDA 4QIWC 4JPSA 3PR5B 1N2XA 3PHXB 3KVFB 5C3JB 4IQUA 2Y5CA 2KJ9A 2KTRB 4LZDA 3QE9Y 2WF6A 1X66A 4TUQA 2FCSA 2QC8A 4YSXB 3SAHA 4O3QA 2I9GA 2WXNA 1UA1A 1TAMA 4CDGA 8ICZA 2K8CB 1N60A 1SWWA 5L1LA 2MA1A 3TAQA 4O5CA 5J0UA 1ZGUB 4ELVA 2KIVA 4O5EA 1XO0A 2V4IB 3QEAZ 5DKWA 1NNLA 2M17A 2CXYA 2VIXA 1CJEA 5KFKA 4ED1A 4K7WA 4JV2A 4QWDA 2VJ5A 3WK6A 4YXJA 1HEKA 3ZJTA 5CWRA 1ZQTA 3RCZA 1P7DA 1U47A 1NK0A 3BY4B 4BDPA 4ZYSA 1RM6C 4A20A 3Q8SB 4MGYE 2VKQA 5ALWA 1MG4A 1SL1A 4GOCA 3UIOB 3WKEA 2ZIWA 3OJ3A 1NJYA 4NZLB 3PLVA 4YSZB 4M0WB 3NS1A 3Q3FA 4DXAB 1Q0WB 3HJEA 2N4FA 4KLJA 3AEFB 2AQ3B 2N9XA 3DDHA 9ICEA 1S0MA 3T79A 2O6VB 3SFDB 4PHPA 1SE3A 5DB8A 4NAWB 4RQNA 5CR0A 4QNLA 4PGXA 4W9CA 4CQNA 4FS1A 2EKEC 4XA5A 2AXTU 5CHFA 2DQNB 2QCZA 4YFKA 4RFBA 2KWDA 3C5FA 3AEEB 5K4LA 3AE8B 4Q2JA 2KICA 4YT0B 2Y9TA 1UF0A 2KQ7A 2MQJA 3RT3B 2D3GA 2N0SB 8ICXA 1E8YA 4UB4A 3JSVA 3IHQB 2G1EA 4WAFA 3ZDCA 3H1UA 5ALPA 3EZ5A 3BVMA 8ICSA 1JXLA 1X9SA 5HNKA 2KFJA 2AL6A 1KOTA 4DFPA 1YMHE 4IC9A 2JZ3B 2W55A 4BKSA 2RP5A 4XQ8A 1SL0A 3B0YA 2GBKA 3SV4A 1JALA 2A1JA 4KZ0A 5DPTA 4Y2SA 5ALKA 3UIPB 4RUCA 1Z1BA 3APDA 1LVHA 4RPYA 4ICUA 3H8HA 3R2TA 2KN5A 1DXSA 2L76A 1V49A 1VZ6A 2QDFA 4GN1A 3CWIA 4LJXA 1MHHE 5IIOA 1ZYQA 1WWUA 2HHXA 5J0PA 2KAJA 3BS5A 1F52A 5KFEA 2JZPA 1ROEA 1F44A 2BS2B 9ICRA 1FIQA 3H8MA 3HVDA 1WE7A 1WM2A 4B9UA 2KLGA 5EOZA 2DFLA 2OWOA 5KFPA 2YEPB 5KG1A 3M1YA 1XLPA 1TT5B 3AEDB 4N58A 4P1BC 4I6LB 2KJ5A 1WJ6A 2ZVOA 1OFFA 2RSUA 3AXCA 1FO4A 2L7RA 5DBCA 2RMMA 4USAA 4PS7A 5BOMA 1Q5WB 2LHDA 1ZDVA 3RZFA 1MI0A 4UAVA 8ICFA 2F3NA 3KHHA 4KX6B 4KMUA 3TKAA 5KG3A 3UXNA 9ICFA 2A1JB 4LTUA 4LJOB 1E5WA 2ZW1A 1YQ4B 4XWWA 3LK9A 2PKOA 4PT5A 1NZBA 1FNWA 2YMLA 4MSQB 3I63C 2XI9A 3JPPA 2KQ4X 1U4AA 4IRCA 2EKIA 2OCEA 2GMIC 4KLGA 2BCRA 1MHXA 2Z8LA 3QUBA 1FCCC 4TURA 3QZ7A 4J9NA 4G3XB 5J2HA 2KT7A 4UBCA 3BS5B 3V7LA 4XDDA 3I76A 2FPMA 2MRPA 5KFUA 1K1SA 3OLMD 4ACOA 4O1NA 1GG3A 3R2IA 3VUYA 5AUIA 3H8SA 3N32A 1WWTA 4P7IA 2WLBA 4QZHA 7ICMA 1S5LU 3H7IA 3SI8A 3WIMA 3NTUA 2FBWB 2JYEA 1X42A 4FFDA 2KNJA 4ZRQA 3PV1A 4QIWF 4D2KA 1KLNA 5D3IB 2AWTA 4U7CA 1WGKA 1DOIA 3FKYA 1SGGA 1LQBA 3PO5A 2NRVA 3E9SA 2M0NA 5C2TB 3KBBA 2AGOA 5AHXA 3RRHA 2PFPA 3I57A 2EQYA 1P98A 4FHJA 2IBIB 4FN2A 4I2AA 4C8OA 1XO3A 4PHAA 1Y8RC 2O2VA 4NJ6A 2M0AA 3O0FA 2BB5A 4OJPA 5DDYA 1MQ3A 2LGIA 3D6JA 1C79A 4DS4A 8ICTA 1LV5A 2J0KA 5J8YC 2FPLA 1GPXA 1LKYA 2P6RA 1JN3A 3M62B 1A70A 1KRHA 2PTLA 2A19A 4YXMA 4UB3A 3PVXA 2VANA 3IHPC 1VJ5A 5AUKA 1U4BA 1UUPA 1WH3A 3DBLB 2FE8A 5EE0A 3Q3NC 4KIKA 1V81A 3Q8KA 2BQQA 2WB1F 3RBDA 1XWLA 2PE9A 2IA6A 1B0XA 4MJSA 3LXFA 1M6YA 2RDBC 4CYEA 1JRUA 4ELTA 1L7YA 3H4DA 4F8CB 2KWUB 4DSEA 5JTIA 2XVTA 3JPNA 2QARB 2ZIVA 2W82A 3RNBC 1E8WA 4FZNA 1SB3C 2MSNA 1C3TA 1SV4A 2KEYA 5DQGA 2LGYA 1ZQXA 4MM3A 3N1XC 4C4SA 5A0LA 4KLDA 1BXTA 1PGXA 3R7QA 1WX7A 1E7UA 1ZD5A 5EDSA 4DQPA 5J0OA 4Y2JA 2UWQA 2XGPA 5DDMA 4RNNA 1R4NI 3CW2C 4QWCA 5F9NA 2I1JA 1COKA 2CPRA 3V6HA 2GOLA 1X40A 4C8LA 3ML8A 2DKXA 3QQ8B 4W9KA 1L2NA 4QZEA 3I9V1 3RB0A 1T3NA 1QKZA 3VXWA 3W2DA 3DQVA 5KFGA 4P0QB 2NS5A 3TUOA 1QLBB 3E2EA 4KIKB 4WQMA 2BS4B 2WTFA 2KFNA 3N30A 4OW0A 3TARA 1RXWA 1Q3VA 4JV1A 2K25A 2L32A 3DVNV 4KLFA 5HHHA 2IJ0A 3NVYA 3JW0X 3RH4A 1L3VA 1YQBA 2BB6A 1HXYD 2BCVA 2DGZA 2F8KA 1E8ZA 5KT2A 2ZUDA 2KTFA 4DSFA 2DYMA 3KFUF 3PW2A 2W9CA 1WGHA 2AX5A 2QJLA 4FADA 4II3B 4KX5A 5KT3A 4QZAA 2D10A 1DGJA 4DWIA 1WGDA 4KN7A 4CO7A 1SSNA 4EFOA 4W9LA 3RNCC 1RYSA 3U52E 2K5PA 2Z0DB 3B0AA 2HHWA 1WMHB 2LVQA 3KYCD 2NO5A 3MFHA 2QIEB 1A76A 2NPTB 2JV3A 5D4BA 4KLQA 2LVPA 2M0XA 3TCAA 1ESFA 2G09A 4DQIA 3V3XA 2KHWB 1TTNA 4YXDB 2EZYA 3TEZA 2KMDA 3UINB 3MBYA 3H4BA 5KG2A 1V5TA 2WXHA 3PT2B 3M95A 2MSED 1JROA 3ZNID 5DBAA 3AUOA 2KG5A 3LB8C 3ALRA 4WQOB 4ANWA 4K3CA 2IGGA 2ASJA 2E8OA 2BKRB 4B0EA 4YMOA 3H7PA 2BQRA 2KANA 4RPZA 2W9CB 1X2IA 3SR6A 1C20A 4WWMA 2O6VD 1CI4A 3PVLA 3C19A 3A4SC 1WCNA 2ASDA 2WXPA 4NJ7A 4P1CC 2YMPA 1ZW7A 1LGRA 4US8A 3NVVA 1L0VB 5BYRA 1A77A 1ZQQA 1WGYA 2AHOB 3EW9A 4A3OA 4GIBA 1WXSA 1ZKHA 3K75D 2N9EB 3RFAA 5DB9A 2LXAA 3H8WA 2WHIA 3LYYA 1Q46A 3DBHI 2G5HB 2BCUA 3BK1A 3R9KA 1X6JA 1S0NA 1YZ7A 5D94A 1TFRA 3OTQA 3KOOA 1PDXA 3WALA 4WJNA 1RFAA 2HBJA 4Y2RA 2AQ2B 2WFAA 2W9BB 1XXGA 1YN3A 2HD5B 4DFMA 5JU5A 2BWFA 4N9F4 3RNFC 3GV7B 3OJSA 2WGSA 4JWMA 4NLCA 1EF5A 5J0QA 3JPOA 5H92C 3AULA 3L5KA 3GIMA 3F2DA 2X8XX 2BYVE 4TMAB 4EZLA 4P0PA 5D7GA 3IVFA 4QZIA 4MF2A 5L1MA 2LMRA 2MP2B 5BO4B 3HILA 3V7KA 4ICAA 4EBCA 2WAQC 3SAFA 2RLTA 2JSVX 4RPXA 4IL6U 5ALEA 4FE3A 9ICAA 2GB1A 3PLUA 4HDQA 3GILA 1SV0C 2DWQA 3F5AA 4ED0A 1H4RA 4LZGA 1RQLA 4UAYA 5ALVA 4M0AA 3F53A 2V0GA 2IHNA 2D3BA 1FRRA 7ICVA 2ZJDA 1HJPA 3RTVA 3PW7A 2RDIA 3DV9A 4DL4A 4ITKA 1RG6A 2FMPA 1LB2B 4IM3A 4REZA 3DDCB 4B0MA 1AROP 4ECSA 8ICJA 1FNUA 2GOWA 1ZQNA 1V1PA 2QB0B 3KUZA 3ZTCA 2PIAA 1K5OA 2R8GA 1QZEA 1P7EA 1S76D 4BKSD 2C7MB 2ZXHA 2MJEA 2IMWP 4AUQC 1Z00B 2RPQA 2HI0A 1KQQA 4F71A 2K3UA 3QCAA 2BPFA 1ZJNA 1J19A 1SXTA 4NLZA 3ZUNA 3PMLA 4LNNA 1P1AA 3O13A 2RDHA 3DCGA 3NHEB 2EH9A 4W9FA 3MC9A 1L7MA 3S2AA 3SEIA 1D8BA 1OEYJ 2KKCA 2KDEB 2LASA 3PW5A 3SFEB 3G6VA 5AKEA 4KGTA 3C2MA 1R7SA 1NK4A 2Q4TA 1AQ6A 1JX4A 5GTHU 2WF9A 1IGDA 3RNGC 3GFKB 2F1JA 1PVPA 1TIFA 5F3XB 1BPZA 1XU4A 2KYWA 2LHTA 1COOA 2YN4A 3FILA 5CHGA 1GAQB 3KKAA 1PQSA 2NR2A 2W7OA 2QB1A 1J97A 5J2FA 1VZ8A 2XCAA 2G06A 3BZDB 4A90A 2YMQA 1H38A 4K4GA 3KHGA 1TBEA 2L0TA 5AI9A 4JB3A 2M1MA 3PZDA 4IWQA 2JZZA 3KWVA 2I5HA 1XC9A 2ICIA 1ZQBA 3K9OB 3P2BA 4RCOA 2WX0A 3RZWC 4BXOB 2MJ3A 1EM7A 2DUYA 4OVUA 3MP9A 3V60A 4PL1A 4NXZA 2N1RA 3QU7A 2KQSA 3N20C 1ZQ1C 1I4PA 2KJHB 2LXCA 2GO7A 3T5KA 2FE9A 1U45A 1I4QA 5BPCA 2JEFA 3QJZA 3M7DA 3C8YA 2WF8A 2JEGA 4OD0A 1XEEA 2DLBA 3TEXA 1I4HA 4E3CA 1WRIA 2XGQA 2R8JA 1KRPA 4Z6CA 2KDFB 3FILB 3V05A 3SDLC 4KLUA 2XIDA 1WR1A 3PZ7A 2OOBB 1S0VA 2OJWA 2VA2A 1OEYA 2DZMA 4AYBC 4JK1A 3Q6BA 2M8SA 4E74A 2CHXA 2X38A 2F44A 2I6XA 5KFMA 4DOAA 1RZTA 2R8KA 2WHEA 4F72A 3VRBB 1L7PA 3FYHA 1ET9A 4EBEA 3OHBA 1QOFA 1QQ7A 4IW0A 2JEJA 1OQQA 3Q3MC 1JWUD 4XGAB 3DVGX 3ONSA 2WXOA 4ECTA 1V38A 3PW4A 3URYA 4KSKC 4FJYA 3C1ZA 3BZCA 2FMSA 4DLEA 1L3TA 4I28A 3AH7A 2OYYA 3FAHA 2PPHA 3AU2A 2GBNA 4RQ0A 1TK8A 3AEBB 3GV5B 1T0QC 1E10A 2R2QA 1HZ5A 2PJHA 1L5UA 3L13A 4YD1A 2K6DB 3KWLA 1E0ZA 2LWPA 1F2RC 1FM0D 4IM0A 2G5IB 1V1OA 2JH1A 2WU5B 1DGSA 2MW5A 3IM1A 3WAPA 4F93B 1TY0A 5AKKA 2FLLA 5B5EU 4PGYA 4HJGE 2KMAA 4EEYA 5L95C 1NK7A 4S17A 1F5SA 3PRZA 4QWEA 2XY5A 3QA8A 5KFWA 5AICA 1IBXA 1XT9B 4G11A 2DNFA 3PO4A 4W9HA 3FM9A 3P63A 4UB6U 4I2DA 2B76B 5DQIA 2HHSA 4OJ6A 1R4MB 1UT5A 1E8XA 4TKNA 3HX0A 4ED7A 3QARA 1BUIC 2BCSA 4HCNB 4KDIC 1D8LA 2N7DA 4CF3A 1WF9A 5AK3A 2GH1A 3AEGB 1PUTA 4RMAA 1FXAA 1WM3A 1TGZB 1E90A 2KDIA 4WWOA 3JVZX 3PX6A 2MUTB 1XLNA 5DPWA 3T3FA 4F2RA 2KFZA 1XQQA 4BFRA 4FBTA 1CZPA 2LRUA 1CK1A 2LPEA 4I2CA 1I4XA 3HM6X 4OZBA 3ZNGC 4QW9A 3SV3A 3G6XA 1XS9D 4NM1A 4M2YA 3EFCA 3SQIA 3Q69A 8ICKA 4QZ9A 4DHJB 3A9KA 1SIFA 5C1ZA 1IBXB 3CNHA 3LYSA 1HTOA 3AI5A 3Q8FA 2H5XA 3E56A 1IGCA 4OHJA 1SWVA 9ICKA 4RQ6A 2W43A 4UDUC 1UPHA 1TV9A 1KLVA 2JT4B 5JHAA 3PTFC 2LEKA 2F77X 4OO1J 3QC8B 3MDAA 2QEJC 2UVUA 9ICOA 4DO9A 1KFDA 1L3UA 3QIJA 2ZTEA 2MBEA 4WAAA 1Q1OA 4Z6EA 3IG3A 2M4NA 4ECVA 4FLHA 2WWZA 1OUQA 2W3RA 4CE6A 1MQ2A 3TFSA 4LCDE 4ED8A 4TSSA 4QWBA 1NKCA 5HMLA 1V8CA 3L16A 2ZIXB 3A9KB 3NZSA 1D6EC 4RM9A 4RU9A 1HA5A 3ETLA 3HUIA 2KDBA 3EUB2 2PEAA 3NGDA 2E6XA 5CHWA 4JQWC 2BDPA 4BWJA 1S9FA 7ICOA 9ICXA 4IS7A 1V6EA 4XDCA 3N28A 1YIWA 3K1RB 2RDGA 5AK4A 1TKEA 1KTKA
chains in the Genus database with same CATH topology
4DXFA 1MHXA 2CU3A 3OWEB 5I4DA 2Z8LA 1FD6A 1FCCC 1XLOA 3AN1A 3NVZA 1AW7A 2HDEA 5G5HA 3AE2B 1K53A 3AE6B 1FRDA 3GB1A 4EE2A 1UGJA 4XDDA 1IUEA 5E6JA 1AN8A 5H8YE 4O1NA 3R2IA 5AUIA 1DOXA 1WWTA 1ZE3D 2Q5WD 2WLBA 3VR8B 2FBWB 1VR9A 2LJIA 2JYEA 4GDKB 3U4EG 3VRAB 1YQ3B 4ZRQA 4DQOC 4D2KA 5D3IB 3RPFC 1WGKA 1DOIA 1I4RA 4RH6A 4A55A 2RPVA 3E9SA 3J9CA 5C2TB 4GLSC 3Q8AA 3I57A 4L2YA 1XCQL 1C4CA 3T3OA 2WP9B 4A9AA 1JMLA 1PFDA 1XO3A 1FNVA 3NZ3A 2N9LA 1Y56A 2M0AA 1ZXIA 3W5VB 2BB5A 2LGIA 2WXRA 2OEDA 1C79A 1WXQA 2PVGC 3P4PB 2IGDA 1Q10A 1GPXA 1TYGB 2KDMA 1BMLC 4C7ZA 2PVOD 1A70A 1SIJA 1KRHA 2PTLA 3P4QB 5MPOA 3ZGZA 3N9YC 2PLPA 2ON8A 5HI1A 1N61A 5AUKA 5BMHA 1UUPA 2W54A 2FE8A 5EE0A 3B2FA 5FR3A 1K50A 3LXFA 4AQ7A 2J53A 3TEYA 1M4VA 4JWUC 1I4GA 2W82A 3BK2A 1DOYA 4RGTA 4YTPB 1F0ZA 1SB3C 1J7CA 1AWDA 2XN9C 5D3DA 1I7HA 1LO5D 2INNE 1BXTA 4FXCA 1OQRA 3ETRA 3MFGA 1PGXA 4ZRPA 1FXIA 2WDVB 5HFYA 3BYYB 4JX1C 2WXGA 2FUG1 2CJOA 2NTTA 3KLSX 2SEBD 1NEKB 1B1ZA 3I9V1 1QKZA 3W2DA 1GB4A 3TUOA 1KLUD 1QLBB 3P1MA 4WQMA 3KQ4A 2BS4B 3NUHB 4OW0A 2L32A 1DYQA 3HVZA 1D5XC 3BWUD 2IJ0A 3NVYA 2BB6A 4ZHOA 4JE3B 4OZCA 1HXYD 1ZUD2 3CIRB 5JXVA 1V97A 4C80A 2DYMA 2BW2A 4OZAA 1XLQA 3W1SA 1QILA 2W3SA 2AX5A 2WDRB 2QJLA 3L4PA 1WYGA 1SE2A 1DGJA 1GB1A 1SSNA 3U52E 1J7BA 2K5PA 2WXLA 1YN5A 1SF0A 2KMMA 3B9JA 4LLGM 2WQYB 2QIEB 1L4ZB 4MT5A 2IPKD 2JQRB 2H89B 1NENB 1YJIA 1ESFA 3V3XA 3DWMA 4YXDB 3TEZA 3MC0B 4P16A 3Q8EA 4A8XC 2WXHA 2R61A 2YEPF 1GOZA 5T8IA 1JROA 3LB8C 4YWGG 2VZKB 3EGRA 2IGGA 2TSSA 4B0EA 4IKGA 1L5PA 4L1BA 1C4PA 1NI3A 5FKAC 3SR6A 4WWMA 2V3NA 4YTMB 4XWTA 4RF1A 2WXPA 3IAS1 2LMCA 4C56C 1QOBA 1VDVA 4US8A 3NVVA 1L0VB 3TSSA 2Y5PA 1L0YB 1RYJA 5BYRA 4RNAA 1PGBA 1N63A 3AEAB 5FK9C 2MH7A 3P4SB 4M0WA 4YSYB 2MEKA 4MH8A 1VJKA 1EWYC 3LYYA 2BBCA 2GI9A 3BK1A 2WXFA 5HG2A 4A6QA 3IAM1 4KGRA 4IOIE 1FFUA 1PDXA 3NRZA 2AQ2B 1XXGA 1YN3A 1VLBA 2KN4A 1T5XD 4RF0A 1E9MA 1K51A 1QT9A 4KKIA 2WDQB 2M19A 3PO0A 2XNAC 5H92C 1NYRA 1ACCA 3MJ5A 5HHDG 1FFVA 4TMAB 5GXGB 1XF5L 2K22A 1L6VA 5D7GA 1EWCA 4HRSA 1TJEA 4TQ1A 3W9CB 2HTME 1EU4A 1KH0A 2PMVA 2LUMA 4RGOS 2JSVX 2GB1A 1TKYA 4NJCA 2DWQA 4XE0A 2LHEA 1JWMD 3U2SC 2K9XA 3AM9A 1UWXA 4HEA1 4HKZE 1J7AA 1HQRD 1XCTL 3WCQA 1JQ4A 2V0GA 1FRRA 1F2RI 1TZOA 3GS2A 2H88B 1EU3A 3ZYYX 4ITKA 2NMQA 2JYTA 4REZA 1ZOYB 4B0MA 2LFIA 1FNUA 3BVZA 3GP7A 1V1PA 1YN4A 3AE7B 2PIAA 4HROA 2I2YA 1P7EA 1JCKB 1D5MC 2J42A 3TEWA 2BTEA 1JW9D 2MJEA 4WH4A 1WSPA 1SJED 2WU2B 4IDIA 2K3UA 5BYSA 1SXTA 3HRDD 2ZW0A 3O13A 2RDHA 1KFYB 3AE5B 3BVGA 4MACA 1FCLA 2N9KA 4N6EB 2WXJA 2EELA 3AECB 3SFEB 1D5ZC 2IGHA 4KGTA 2OHFA 4MM3B 1QOAA 1E7PB 1F77A 1R7SA 3DWGC 3PZ8A 2J4XA 2QMTA 2DYOA 1MVKA 2L52A 1VRAB 1IGDA 4US9A 4JWSC 3ZJUA 1C76A 3FILA 1GAQB 1JWBD 3AE1B 1QOGA 1ZP0B 4ARCA 2E3TA 4KGSA 1VZ8A 1TY2A 3BZDB 3AE4B 3AE3B 4ZOHC 2G9HD 4A90A 1YJJA 2WXIA 1RFKA 2M56B 1PYWD 1C9FA 4YTNB 3KWVA 3AV8A 2ICIA 5BYQA 4RCOA 1ZDXA 2L1AA 1RWSA 2MJ3A 1EM7A 1TS2A 2QSDA 1CQVA 1FEHA 3MP9A 3P4RB 2V3PA 2JX5A 3VQIA 1I4PA 1I4QA 2K0PA 3C8YA 4LK0M 1STEA 1ET6A 5BMIA 1XEEA 2DLBA 3TEXA 4WURA 3U7ZA 1B9RA 1I4HA 1HZ6A 1WRIA 3FC4A 1YNTE 1TKGA 3FILB 1NVID 3T3NA 3V05A 1HEZE 2L83A 4JPSA 4C7YA 3PZ7A 4N59A 5C3JB 2ACZB 2Y5CA 2X38A 5EE1A 3SEBA 1C77A 1T3QA 1ZPSA 2CJNA 1N5WA 4WIPA 1NYQA 2AQ1B 3VRBB 1ET9A 4YSXB 2MJDA 1QOFA 2WXNA 3W5UB 4AS1A 2GRIA 1OQQA 1JRPA 1JWUD 3BIID 1AYFA 4GDLB 1N60A 2WXOA 2V4IB 2JU6X 2D5GA 3R8BA 3URYA 1CJEA 4RGNA 3AH7A 2N7JA 3ZJTA 3FAHA 4DXGA 3IT4B 3AEBB 2BT6A 1E10A 1TS5A 1HZ5A 3Q8CA 3KWLA 4ZYSA 1RM6C 3ZJVA 1E0ZA 1F2RC 1FM0D 2DBYA 1C4AA 1TS3A 1V1OA 2WU5B 3AB5A 1KF6B 4NZLB 4YSZB 3NS1A 1TY0A 2JXTA 3EA6A 3AEFB 3NVWA 2AQ3B 1TS4A 2WNMA 4HJGE 3IT6B 2IDYA 1QQRA 3SFDB 5EE9A 1SE3A 4NAWB 1IBXA 1PGAA 2PW9A 2KACA 1C78A 3IXSA 3P63A 4ARIA 4P6VF 4CQNA 2B76B 1VZ7A 2NTSA 1E6EB 4RFBA 5LNK1 2KWDA 1JWAD 3AEEB 1SBBB 1BUIC 3ABVB 1UNSA 3AE8B 4Q2JA 1N62A 4YT0B 4H2AA 4HKQA 2N0SB 2BS3B 3AEGB 2G1EA 1JWSD 1PUTA 1FXAA 4WAFA 4RGMA 1ZXHA 2WXKA 1ENFA 3BVMA 5BMGA 1XLNA 1QF6A 1YMHE 1CZPA 2SAKA 1CK1A 1I4XA 2VZKD 2W55A 4OZBA 1P7FA 1UWMA 2INPE 1JALA 1L0XB 3Q69A 4R3DA 3ZQ4A 1IBXB 4KKJA 3Q8BA 3Q8FA 4NAMA 2WXQA 3E56A 1L6UA 3AE9B 2I38A 2ONQA 1IGCA 3H8HA 1SJHD 3P42A 1V1PB 3R2TA 4OHJA 1SE4A 4UDUC 1VZ6A 1FMAD 5TSSA 3B2GA 3BYTB 2J52A 3UI3A 3CWIA 2LEKA 1MHHE 2Y3AA 2WS3B 2KAJA 2QEJC 2JZPA 1ROEA 2BS2B 1D4BA 1FIQA 3HVDA 1L4DB 3AMZA 3VR9B 2YEPB 3AEDB 1XLPA 4N58A 2JWUA 1N5XA 3RFZB 5G5GA 1OFFA 1FO4A 2RMMA 2W3RA 4USAA 2LHDA 1KLGD 1ZDVA 4OVZA 4TSSA 1MI0A 3MHZA 4L23A 4KX6B 5EE3A 4LTUA 1V8CA 1MPEA 1D6EC 4ZHPA 4J3OD 1HA5A 2WXMA 1K52A 1YQ4B 1T6BX 2ZW1A 3HUIA 4XWWA 1SEBD 3EUB2 2PKOA 2BYTA 2E6XA 4PT5A 1FNWA 2QILA 4XDCA 2KQ4X 2RDGA 4TQ0A 2EKIA 1TKEA 1KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY B;  2CU3 A;  1XLQ A;  3KWL A;  1RM6 C;  2W3S A;  2AX5 A;  1XLO A;  2WDR B;  3AE7 B;  2PIA A;  3AN1 A;  2QJL A;  3NVZ A;  3L4P A;  1WYG A;  4HRO A;  1E0Z A;  5G5H A;  3AE2 B;  1FM0 D;  1FRD A;  3AE6 B;  1DGJ A;  2DBY A;  1IUE A;  1JW9 D;  2MJE A;  2WU5 B;  3AB5 A;  1KF6 B;  5H8Y E;  4YSZ B;  1J7B A;  2K5P A;  3NS1 A;  2WU2 B;  1SF0 A;  2KMM A;  3B9J A;  1WWT A;  2Q5W D;  2WLB A;  2WQY B;  4IDI A;  5AUI A;  2QIE B;  3NVW A;  3AEF B;  3VR8 B;  3HRD D;  2FBW B;  2H89 B;  2JQR B;  1NEN B;  3VRA B;  1YQ3 B;  3SFD B;  5EE9 A;  1KFY B;  3AE5 B;  1YJI A;  1DOX A;  3RPF C;  1WGK A;  1DOI A;  4N6E B;  3DWM A;  3P63 A;  4YXD B;  4P6V F;  2B76 B;  4WWM A;  3AEC B;  3SFE B;  5C2T B;  1E6E B;  1JRO A;  2OHF A;  3LB8 C;  1JWA D;  1QOA A;  1E7P B;  3AEE B;  1R7S A;  3DWG C;  2L52 A;  2WP9 B;  3ABV B;  3AE8 B;  1PFD A;  4A9A A;  1XO3 A;  1N62 A;  4YT0 B;  1L5P A;  1ZXI A;  3W5V B;  1NI3 A;  4US9 A;  3SR6 A;  2N0S B;  4JWS C;  2BS3 B;  3AEG B;  1GAQ B;  1JWB D;  2G1E A;  1QOG A;  1WXQ A;  1PUT A;  1ZP0 B;  2PVG C;  3AE1 B;  1FXA A;  3P4P B;  4YTM B;  2E3T A;  1E10 A;  1GPX A;  1QOB A;  3AE4 B;  3AE3 B;  4ZOH C;  1VDV A;  1TYG B;  4US8 A;  3NVV A;  1L0V B;  1YJJ A;  1XLN A;  1RYJ A;  4C7Z A;  1QF6 A;  2PVO D;  1A70 A;  1SIJ A;  1KRH A;  3P4Q B;  1TKE A;  5MPO A;  1N63 A;  1CZP A;  3AEA B;  1RFK A;  2M56 B;  2MH7 A;  3P4S B;  4YSY B;  1N61 A;  2W55 A;  5AUK A;  4YTN B;  1VJK A;  3AV8 A;  2W54 A;  1EWY C;  5EE0 A;  1UWM A;  3B2F A;  1JAL A;  1RWS A;  2MJ3 A;  3P4R B;  3LXF A;  2JX5 A;  1FFU A;  1PDX A;  4JWU C;  3NRZ A;  1L6U A;  3AE9 B;  1DOY A;  4YTP B;  1F0Z A;  1SB3 C;  1VLB A;  1FMA D;  1J7C A;  1E9M A;  1AWD A;  1QT9 A;  3B2G A;  2WDQ B;  3CWI A;  2LEK A;  2M19 A;  1B9R A;  3PO0 A;  5H92 C;  1NYR A;  1I7H A;  1WRI A;  2WS3 B;  2KAJ A;  3FC4 A;  1TKG A;  1NVI D;  4FXC A;  1FFV A;  3ETR A;  1OQR A;  5GXG B;  2L83 A;  2K22 A;  1L6V A;  4C7Y A;  1ROE A;  2BS2 B;  1FXI A;  2WDV B;  1TJE A;  4HRS A;  4N59 A;  1FIQ A;  3W9C B;  5C3J B;  2ACZ B;  2Y5C A;  2HTM E;  4JX1 C;  5EE1 A;  3AMZ A;  1T3Q A;  3AED B;  3VR9 B;  2CJN A;  1N5W A;  1XLP A;  2CJO A;  4N58 A;  1NYQ A;  3VRB B;  4YSX B;  1N5X A;  2MJD A;  5G5G A;  1NEK B;  1OFF A;  1FO4 A;  1QOF A;  3W5U B;  2W3R A;  4USA A;  1TKY A;  1OQQ A;  1JRP A;  3BII D;  2DWQ A;  1AYF A;  1QLB B;  1N60 A;  3P1M A;  4KX6 B;  4WQM A;  2BS4 B;  2K9X A;  3AM9 A;  5EE3 A;  4LTU A;  1V8C A;  3HVZ A;  4ZHP A;  1J7A A;  1CJE A;  3WCQ A;  1JQ4 A;  3HUI A;  1YQ4 B;  3NVY A;  3AH7 A;  3EUB 2;  1FRR A;  2PKO A;  4ZHO A;  2H88 B;  3FAH A;  3ZYY X;  1ZUD 2;  3CIR B;  4ITK A;  3AEB B;  2BT6 A;  2EKI A;  1V97 A;  4C80 A; 
#chains in the Genus database with same CATH topology
 3OWE B;  1Z19 A;  3EHV A;  5AKX A;  4AP4 C;  3AN1 A;  4RNM A;  2R8H A;  5HKH A;  4GC7 A;  3AE2 B;  3K1Z A;  4BBN F;  3GB1 A;  3RRG A;  2KJR A;  3QU9 A;  2ASQ A;  5JZE B;  5E6J A;  4ZDV A;  1AN8 A;  4ED2 A;  1RLF A;  4LNK A;  4C0Z A;  2B21 A;  2UVW A;  3N3K B;  1ZE3 D;  2Q5W D;  1OXJ A;  5DQH A;  2BWE S;  3WAN A;  2D11 A;  1RAX A;  2LJI A;  2KZ3 A;  4W9E A;  2UVR A;  1YQ3 B;  8ICG A;  5KG4 A;  3TAD A;  3RH5 A;  3QEB Z;  2OEH A;  4JGH B;  3RPF C;  3RNE C;  4RH6 A;  1AAR A;  2PMZ C;  2RPV A;  3CRX A;  1MN8 A;  3PPA A;  4GLS C;  4M8M A;  2AEH A;  4AJW A;  4DEZ A;  1XCQ L;  2LI5 A;  2LZ6 A;  4A9A A;  1JML A;  1FEZ A;  1FNV A;  3NZ3 A;  5D49 A;  5IA7 A;  1Y56 A;  5ALN A;  3ZDB A;  1IM4 A;  1ZXI A;  4Z6F A;  3MJW A;  2KC1 A;  3P4P B;  2LM4 A;  3C2K A;  3T5L A;  1WRD B;  7ICE A;  3VDZ A;  2KOB A;  3RAX A;  1BML C;  5DB6 A;  3UQA A;  3RJH A;  2HVH A;  3QU2 A;  2PVO D;  3Q3O C;  5MPO A;  4LDT B;  4NL9 A;  4WJ3 B;  4M6W A;  5FP0 A;  1N61 A;  4DBG A;  1Q3U A;  5BMH A;  2BR0 A;  4UW9 A;  4WJQ A;  1L7N A;  3EFU A;  2KOX A;  5FR3 A;  4PHD A;  4QZG A;  4YG2 A;  3V6J A;  5D46 A;  2KWV B;  2ZJ8 A;  2YB1 A;  3M9N B;  2F1H A;  3E0F A;  2OXO A;  5C5J A;  2UVV A;  2HHV A;  4AQ7 A;  8ICY A;  5IIK A;  5AZF A;  3MR3 A;  1TVA A;  4R63 A;  3BK2 A;  1DOY A;  4RGT A;  5IIL A;  3JPS A;  4YTP B;  1F0Z A;  4EEK A;  2DZK A;  2JGA A;  3MGV A;  3VVW B;  1J7C A;  2D3C A;  3WK5 A;  1AWD A;  1KW4 A;  4YR3 A;  4R66 A;  3G6Y A;  2A3V A;  4M9H A;  2R8I A;  1LXD A;  2J0M A;  2ZIW B;  1BPD A;  4XUS A;  1I7H A;  5JRT A;  1LO5 D;  3X0W A;  1QTM A;  1QSL A;  4FXC A;  2KNB A;  1OQR A;  3ETR A;  2ZJA A;  2C2D A;  1NZP A;  4KLI A;  2I1Q A;  3BYY B;  1H8C A;  1GO3 F;  3Q14 C;  2P6U A;  4K4I A;  3KTQ A;  1MG8 A;  2WXG A;  5E6N A;  3M8R A;  4Y2V A;  5HMM A;  1PVR A;  1B4F A;  2XCP A;  5J0T A;  3MFI A;  4DL5 A;  4DF8 A;  1GB4 A;  1A0P A;  4Y2X A;  5ALM A;  2ZEQ A;  4W9I A;  3L54 A;  1F9J A;  2G4S A;  3ZRF A;  3SZ2 A;  4EYH B;  3EEC A;  4NQK E;  5CTR C;  3JSV B;  1BPB A;  3C0R B;  4F50 A;  2MHJ A;  4MF8 A;  3FDS A;  4GFJ A;  7ICF A;  1K1Q A;  4MFF A;  2LGD A;  3SAG A;  3V6C B;  5AM4 A;  1KSP A;  2W3S A;  1QIL A;  3AU6 A;  4YN4 A;  3TBL D;  1OW5 A;  1RRB A;  4FBJ B;  3VTU A;  3RNA C;  4F5R A;  4FJZ A;  1BNO A;  1SKR A;  4QAY A;  3BQ7 A;  4YL8 A;  2WXL A;  2KKP A;  4KLE A;  2JF5 A;  2IND C;  2ZVN A;  1L4Z B;  3X23 A;  1NEN B;  7ICI A;  5DGB A;  9ICP A;  2BCQ A;  2C28 A;  9ICC A;  2FUH B;  1WYW B;  4YP3 A;  1EO6 A;  2KHV A;  4P16 A;  4J9P A;  2W7P A;  2L5Y A;  4A8X C;  2GLS A;  2R61 A;  5CJ7 A;  3NY5 A;  1GOZ A;  4HDO A;  4ANV A;  2VZK B;  2V9W A;  2G45 B;  9ICV A;  4BAX A;  1WY8 A;  4IKG A;  1L5P A;  5KFA A;  4GGQ A;  4O3P A;  4L1B A;  1C4P A;  3T9L A;  2BHN A;  5KG7 A;  4HWI B;  2CN1 A;  3GZN I;  1XNS A;  4HXD A;  4XWT A;  1WWV A;  1ZD2 P;  2PFO A;  3RI7 C;  4EEW A;  2LMC A;  1UD7 A;  2K8A A;  4C56 C;  4NY0 A;  4GXJ A;  2KXJ A;  3TSS A;  1RYJ A;  1PGB A;  2VJ4 A;  2Z59 B;  2VH2 A;  8ICI A;  2UYZ B;  3AEA B;  4EUT A;  4KVG B;  4DFD A;  4M9G A;  1HUO A;  3RD2 A;  3U8Z A;  1EWY C;  1S97 A;  3RFZ B;  2BBC A;  3AQF A;  2GI9 A;  1EXN A;  2RRD A;  2J0J A;  5ALY A;  3IAM 1;  1YD8 U;  5KFO A;  9ICU A;  5ALH A;  4KGR A;  2RDJ A;  2A5U A;  1FFU A;  3KHR A;  3NRZ A;  5AKL A;  3VHT C;  3QU5 A;  3F2B A;  2D2Q A;  5J2J A;  4IRD A;  5AM1 A;  2K8B A;  2H3Z A;  4O3N A;  5AKJ A;  1E9M A;  5KFR A;  2V4R A;  1QT9 A;  1ZQJ A;  4J6I A;  4S0R A;  3WKD A;  1NYR A;  3WU2 U;  4HPP A;  3M6K A;  2KX3 A;  2AGP A;  1FFV A;  2K22 A;  2M9N A;  3Q8R B;  1EWC A;  4MGZ E;  3V62 A;  4DHJ D;  1TJE A;  3HKZ C;  2KSO A;  4KMO B;  2HHQ A;  2KJ6 A;  4K7U A;  3F2C A;  4UQG A;  2N1V A;  3A9J A;  2E1E A;  3N4M B;  2MU2 A;  4RGO S;  1TKY A;  3RH6 A;  1ZQC A;  4XE0 A;  4IR1 A;  3MR5 A;  2K9X A;  3ZD9 A;  3AM9 A;  3DVN U;  1DK3 A;  3E58 A;  4EZ6 A;  3KZI U;  4HEA 1;  3WKB A;  1YT3 A;  3UMB A;  5AKH A;  3MDC A;  1S3S G;  1JQ4 A;  4CF4 A;  5LXI B;  2FI1 A;  4RT3 A;  3AL0 B;  4O3O A;  2O2V B;  4DLG A;  5IIM A;  1EU3 A;  2NMQ A;  1WG8 A;  4C4R A;  2P66 A;  5AEK B;  4G50 A;  2F2A B;  2IOF K;  5KFF A;  1VD2 A;  3QUT A;  1QCK A;  3I1Y A;  2INC C;  1LKY B;  4MH0 E;  4HRO A;  2I2Y A;  4BOS C;  3KZX A;  2BTE A;  2G3Q B;  4WH4 A;  1YOV B;  3AEV A;  4KSL C;  3AQE A;  2JZB A;  1VCB A;  4CHK A;  2WF7 A;  3HRD D;  4FHK A;  5IO9 A;  3OHA A;  4MJS B;  1ZQW A;  2DL0 A;  2LVO A;  2EZZ A;  1WJ4 A;  5AKZ A;  1UA0 A;  4DL6 A;  2JR5 A;  2ZIV B;  2Z7J A;  5KG5 A;  4RQ7 A;  3IDW A;  4MM3 B;  4EKU A;  4DSK A;  1QOA A;  1N56 A;  1ZQD A;  3PZ8 A;  2Y1J A;  2ASL A;  1CMX B;  2DYO A;  1MVK A;  2J4X A;  5IKC M;  4ZYN A;  5L83 A;  3UGB B;  4M47 A;  4DOB A;  4Z6D A;  4JWS C;  3AE1 B;  4EX6 A;  4LNI A;  4UB1 A;  2YLM A;  4KGS A;  2NVU I;  2MCN B;  5JH5 C;  4IQV A;  3OGU A;  3PHW B;  5DCN A;  1HIW A;  4EX7 A;  2WXI A;  3VTW A;  1WZ3 A;  2A1A A;  4ZH4 A;  1RFK A;  2M56 B;  5G55 A;  2D07 B;  4YTN B;  2PE6 B;  4DOC A;  1ZDX A;  5KFJ A;  1P9D U;  4GDK A;  5CX3 A;  4P4P A;  1I42 A;  4IR9 A;  1ZD4 A;  4I2H A;  4JWN A;  3DVG Y;  2C5L C;  3KUC B;  3AU4 A;  2RD0 A;  3H7S A;  2MBQ A;  4KLO A;  2MX2 A;  3RJG A;  4DL2 A;  4LK0 M;  2KZZ A;  3EWA A;  3RYT A;  2NRZ A;  1STE A;  1KTQ A;  2VH1 A;  4F4K A;  4LDT D;  5KG6 A;  4QZB A;  1NK5 A;  2WDT B;  2LYA A;  7ICQ A;  5GMV A;  1TKG A;  1TAQ A;  3IBE A;  2J6U A;  3H0L B;  5TR5 A;  2L83 A;  3T3N A;  2CKH B;  5J17 A;  1QQ5 A;  4BUG A;  5EE1 A;  5IIN A;  3SEB A;  9ICI A;  1C77 A;  2ZZP B;  2XY6 A;  2CJN A;  4WIP A;  1NYQ A;  2AQ1 B;  2DYB A;  1WUD A;  2C60 A;  3W5U B;  4EZJ A;  2KVS A;  2NV3 A;  2GRI A;  4MEL A;  1ZQH A;  4Y2P A;  3RJI A;  2D5G A;  3K9P B;  2JRZ A;  4MEM A;  3R8B A;  2ZXI A;  1DRG A;  3D32 A;  3PY8 A;  2K4E A;  5KFC A;  1Z4O A;  2BZF A;  4O3S A;  2KKV A;  3HWT A;  2N7J A;  4YMN A;  2LD9 A;  3GE8 C;  4BKT A;  2HTH A;  3H7P B;  4QW8 A;  1ECW A;  4TV3 A;  4I2G A;  1SKS A;  4YMM A;  5F9L A;  3JPQ A;  3ZJV A;  2KZR A;  1UHU A;  2EAO A;  4I6P A;  3IP4 B;  7ICS A;  1N48 A;  4W9J A;  2DBY A;  2ZUC A;  1C4A A;  1TS3 A;  3BQ0 A;  1NK6 A;  1KF6 B;  4ACF A;  3MGI A;  4KN4 A;  2JXT A;  2W9M A;  1D8Y A;  4DFJ A;  5E6P A;  3NVW A;  1R4N B;  1QQ6 A;  1ZET A;  1S0O A;  1TS4 A;  4C8N A;  1Q8K A;  4HAI A;  3K4G A;  5EE9 A;  1UH6 A;  4J9O A;  1KFT A;  4M9L A;  1PGA A;  5CA7 A;  3TAC B;  3H8J A;  1C78 A;  3OPX A;  1KL9 A;  4P6V F;  1JI7 A;  3UF8 A;  4J9M A;  5J29 A;  1O03 A;  4ED6 A;  3GZF A;  1VZ7 A;  5LNK 1;  5IP4 D;  4HLE A;  1JWA D;  2JVC A;  3BQT A;  1SBB B;  3QYP A;  3ABV B;  2V4L A;  4P0P B;  3ISB A;  4M9J A;  2KFK A;  3RBE A;  1JWS D;  4ANX A;  4KV2 A;  4TQR A;  4PYZ A;  4K4H A;  4RGM A;  4Y2T A;  4EEL A;  3QX7 A;  4Y2U A;  2K4I A;  1ENF A;  5HR7 A;  2L0F A;  4NNJ B;  3TAN A;  1NBF C;  5BOL A;  1NOM A;  5BMG A;  2K60 A;  1CRX A;  2Q0Z X;  3AU5 A;  4XRH A;  3APF A;  1L3S A;  2SAK A;  8ICH A;  1GUA B;  2VZK D;  2D8C A;  1P7F A;  9ICS A;  1UWM A;  3HIZ A;  4RM8 A;  2BQ3 A;  3D2S A;  4YQW A;  2IY1 B;  4DSI A;  4K3B A;  4GXI A;  4NL9 C;  3Q8B A;  4FUL A;  5J2R A;  1ZJM A;  4PGQ A;  2WXQ A;  3B1L X;  2H3F A;  5J0W A;  1L6U A;  3AE9 B;  4DSL A;  2JXX A;  3P42 A;  1V1P B;  3LDZ E;  2OM6 A;  1SE4 A;  3IG8 A;  3EPI A;  1FMA D;  5TSS A;  3BYT B;  4MDK E;  3UI3 A;  2NRT A;  1ZQZ A;  1RYU A;  1S1Q B;  1ZOL A;  3DBR I;  4F2S A;  2Y3A A;  2JXJ A;  2K89 A;  1WXA A;  1ZQA A;  2WS3 B;  2KFK B;  3CP8 A;  3DHG C;  2ISP A;  3RUL A;  4QWA A;  3HHM A;  1D4B A;  1T0S C;  3BIN A;  4BJQ A;  4URK A;  1XO1 A;  1L4D B;  3AMZ A;  3VH4 B;  2JRI B;  2KK0 A;  3PSF A;  4JL9 A;  3CF6 E;  1N6Z A;  5IIJ A;  3KYD D;  3ZO5 B;  1Z2M A;  1F1H A;  2REX A;  2YTU A;  3JPR A;  2LI6 A;  4OVZ A;  3NS8 A;  2IHM A;  2P35 A;  2C7N B;  4L23 A;  5EE3 A;  3PRE A;  2CHW A;  3DBH B;  1MPE A;  3SYZ A;  7ICL A;  1T6B X;  5AI5 A;  1F0M A;  3BDP A;  1SEB D;  3Q3J A;  2HOI A;  2FLN A;  4B9M A;  4P2H A;  4FZM A;  2BQU A;  4TQ0 A;  4EYI B;  2CU3 A;  5I4D A;  1XLO A;  2IYD B;  8ICM A;  2MBO A;  1AW7 A;  2HDE A;  5J8Y A;  5G5H A;  1M94 A;  2W03 A;  4UAT A;  2G4D B;  2K1F A;  3QK0 A;  4BKG A;  1UGJ A;  4ASW C;  2D3D A;  1IUE A;  4A3P A;  5H8Y E;  3EPG A;  5L9X A;  5G2N A;  1DOX A;  3ZNH B;  3GQC A;  5C23 A;  3QU4 A;  1ZQY A;  1VR9 A;  4AWJ A;  1D9D A;  4YD2 A;  3CST A;  1XSP A;  3VRA B;  1MJD A;  2GBJ A;  3U30 A;  3EYZ A;  1SKW A;  4TUP A;  4Y2Q A;  3MR6 A;  4JIO U;  3N7R C;  3J9C A;  3Q8A A;  3ZNZ B;  4CRX A;  2KZM A;  4L2Y A;  5DGA A;  4J9R A;  1C4C A;  5AK6 A;  8ICE A;  1C1Y B;  1PUZ A;  1YJ1 A;  2N9L A;  3R66 C;  4NPN A;  3UXO A;  2OED A;  3GU3 A;  1WXQ A;  4TUS A;  2IGD A;  4GIV A;  2ZIU A;  4R8U A;  4K1R B;  5KFD A;  2JHD A;  1IIP A;  3APC A;  3A1Q A;  1P3Q U;  3MAB A;  1TYG B;  2RQ5 A;  4F4Y A;  2NRW A;  2ZCC A;  2CHZ A;  3ZGZ A;  1D9F A;  2PLP A;  3TL5 A;  2AGQ A;  4DF4 A;  4OJO A;  1V9P A;  2HCF A;  2L3Z A;  5HI1 A;  1TK0 A;  1P0R A;  2IBK A;  3RN9 C;  2ISO A;  3ZKJ C;  4LNO A;  2WAQ F;  4JV0 A;  2ES6 A;  1K50 A;  4QZ8 A;  4G3I A;  2IY0 B;  2J53 A;  2KMC A;  5AZG A;  4DHZ B;  3TEY A;  1M4V A;  4GU2 A;  2FJ6 A;  4ICV A;  1J2N A;  4EBD A;  2W9A A;  3A4R A;  4E0D A;  3H0R B;  2KX0 A;  5J0X A;  3N7P D;  4W9D A;  5D6J B;  4Q43 A;  1S77 D;  3MC8 A;  3SU8 X;  2XK5 A;  2OH2 A;  5D3D A;  3LWM A;  5ALD A;  1ZQL A;  2INN E;  2L8J A;  1ZRM A;  4ZRP A;  8ICO A;  4CF5 A;  2CS4 A;  4I2J A;  1FXI A;  2WDV B;  1MA7 A;  4JX1 C;  3CMM B;  4PJ0 U;  2FUG 1;  2CJO A;  4C4V A;  3Q8P B;  3W1Y A;  3QAQ A;  2AQ0 A;  4IQT A;  5EWF A;  4W9G A;  1NEK B;  3PST A;  2E1F A;  1OQY A;  1KLU D;  5DG8 A;  4F4X A;  1TAU A;  8ICV A;  3KQ4 A;  2NBV B;  3P1M A;  3H6N A;  4O0I A;  5FR6 A;  3HVZ A;  4DS5 A;  2ZPN A;  3BWU D;  4B9L A;  4JMU A;  2L05 A;  2K39 A;  4JE3 B;  1B43 A;  2R18 A;  4B9V A;  3UMC A;  2BDU A;  3CIR B;  5JXV A;  2ATL A;  4M9N A;  5KFT A;  2ZJ5 A;  5ALJ A;  2YVC A;  2GWS A;  4OZA A;  2HOQ A;  3W1S A;  3TAP A;  1B22 A;  2NYV A;  3L4P A;  1WYG A;  1IPG A;  9ICH A;  2AYO B;  4ANU A;  1SE2 A;  4DK5 A;  1PZN A;  2XO7 A;  3SD7 A;  1J7B A;  5GTI U;  1YN5 A;  3ZDM C;  2KD1 A;  1SF0 A;  2KMM A;  3B9J A;  1NJX A;  2WQY B;  3GIK A;  1U48 A;  2RGF A;  2IPK D;  1O08 A;  2H89 B;  1IG6 A;  1KM7 A;  3V6E B;  2Y5B B;  2UU7 A;  1IYF A;  1YJI A;  1XSL A;  3HT3 A;  1S10 A;  1T0R C;  4R65 A;  2V3S A;  5KFI A;  1WX9 A;  3MC0 B;  1ZQK A;  3Q8E A;  2OJR A;  4RNO A;  4IC7 B;  4G9B A;  2YEP F;  5T8I A;  2DPI A;  1D3Z A;  3EGR A;  3PSE B;  1BVS A;  2FCQ A;  3PRP B;  5FKA C;  3WK4 A;  5L1I A;  4GSW A;  2DHZ A;  4RF1 A;  3ALB A;  3IAS 1;  4Q8F A;  1QOB A;  2JWZ A;  1VDV A;  2Y5P A;  1L0Y B;  4RNA A;  5HHI A;  5JUM A;  2KVC A;  4DQR A;  3RB3 A;  5FK9 C;  1HUZ A;  5J2I A;  3WKA A;  2MH7 A;  4M0W A;  2XEW A;  4YSY B;  4AYB F;  1SV0 A;  3PNC A;  1VJK A;  2O6K A;  4B6J A;  4J9Q A;  9ICL A;  2O6V A;  1IV8 A;  1XSN A;  4IOI E;  3RJF A;  5AM5 A;  2D6F C;  4DL7 A;  2XY7 A;  4NAW A;  1L7O A;  1WXV A;  4PZN A;  3OJU A;  2KN4 A;  3IRU A;  4MHV A;  4RF0 A;  3WA0 A;  3BZK A;  2KJ8 A;  2WDQ B;  1ZQG A;  2N9P C;  4KKI A;  2IZV B;  2KVR A;  5IN7 A;  1ACC A;  3MJ5 A;  5HHD G;  3DHI C;  2C7H A;  3TI0 A;  5E79 U;  2DKZ A;  4FS2 A;  4KLM A;  1XF5 L;  1L6V A;  4HRS A;  4TQ1 A;  3W9C B;  1GC6 A;  4B9S A;  1EU4 A;  3THV A;  2WB1 C;  1KH0 A;  4RQ2 A;  5HP4 A;  4O3M A;  2PMV A;  8ICW A;  3QX1 A;  2LUM A;  1BT0 A;  3RF9 A;  4Q8E A;  8ICN A;  2RHF A;  3DHH C;  3H9D A;  4B6W A;  4I2E A;  1L8L A;  3VR9 B;  3WK7 A;  4UAW A;  1JWM D;  3WK8 A;  1UWX A;  1J7A A;  1HQR D;  4GXB A;  3WCQ A;  5CEH A;  1DOQ A;  1ED1 A;  3RJJ A;  2HVI A;  1F2R I;  3GS2 A;  5DLF A;  4X5V A;  1Z3E B;  3ZYY X;  3M6Z A;  3PZP A;  1RPL A;  3V72 A;  2JYT A;  4I6N B;  1BGX T;  3PSP A;  3F5E A;  4FO6 A;  3GP7 A;  4WJO A;  2KIW A;  3MGH A;  2EMT A;  5B66 U;  1SGH A;  3TJP A;  4WJP A;  1U49 A;  9ICG A;  1D5M C;  3TEW A;  1JW9 D;  1ZQM A;  2EAP A;  3BQ1 A;  2WX1 A;  4M02 A;  3D2Q A;  1J8C A;  5J0Y A;  4M6W B;  4C8M A;  9ICN A;  4IDI A;  9ICM A;  2AU0 A;  4IRK A;  3IN5 A;  1UBI A;  3DBL I;  4DDI D;  3S6J A;  3U7D A;  4ECX A;  2ZW0 A;  4PZO A;  1Z5S B;  3IFW B;  3SHQ A;  1KFY B;  3QXG A;  1T94 A;  2KV2 A;  3BVG A;  4MAC A;  1V80 A;  2A4Z A;  2NO4 A;  2N9K A;  4N6E B;  5KNI A;  2EEL A;  2JEI A;  5AK5 A;  3AEC B;  1X9W A;  1WFY A;  1D5Z C;  2IGH A;  5J2E A;  4BX9 C;  3ZDT A;  1E7P B;  1F77 A;  4Q45 A;  4ECW A;  3DWG C;  2B3A A;  4OVV A;  1VRA B;  2JY6 A;  3M63 B;  3D2N A;  4AP9 A;  5ALO A;  3HPO A;  5TIS U;  1NJW A;  3ZDA A;  3CSF A;  3ZJU A;  4ARC A;  1JWB D;  5DPR A;  1QOG A;  1ZP0 B;  5AKI A;  3PSI A;  2E3T A;  4HYK A;  4EEN A;  4II2 B;  4KLS A;  5C0Y A;  2FAZ A;  4ZOH C;  2G9H D;  3AE3 B;  1V2Y A;  2V9H A;  5AM2 A;  5KFH A;  2CRX A;  1T4G A;  2Z0E B;  3NUQ A;  1GNU A;  4QJF B;  4NY8 A;  4YR0 A;  3O65 B;  2ZPY A;  2R2O A;  2BGF A;  5BYQ A;  3AV8 A;  4I29 A;  4GDL A;  1QH9 A;  3M3J A;  1RWS A;  2V1Y A;  3B0X A;  1CQV A;  5ALI A;  3P4R B;  4RQ1 A;  4UB2 A;  4UAS A;  3NRW A;  1HE8 A;  3HP6 A;  2AJQ A;  4F1S A;  2KC2 A;  3QUC A;  4NLG A;  3N1Z C;  1ZQF A;  4YCX A;  3QZ8 A;  7ICK A;  5BMI A;  3Q8M A;  1KKX A;  1B9R A;  3LWL A;  2GBR A;  4HPL B;  1HZ6 A;  1OGW A;  1HTQ A;  2MAX A;  3M9O B;  5ALG A;  1NVI D;  1X1M A;  3KKA C;  3VTV A;  1HEZ E;  3JPT A;  3BJY A;  3ISC A;  4C7Y A;  2ALZ A;  4N59 A;  3N1Y C;  2ACZ B;  5CHV C;  3VAW A;  2H3V A;  4J9L A;  1G6J A;  1T3Q A;  1ZPS A;  1ISN A;  2J6S A;  1N5W A;  2G07 A;  3VUX A;  4F92 B;  5ALL A;  2MJD A;  2HW3 A;  4DDG D;  4LNF A;  1ZD3 A;  5AKG A;  3GDX A;  2QLT A;  4AS1 A;  1JRP A;  3BII D;  4QZD A;  1AYF A;  4GDL B;  2W8L A;  2JU6 X;  4YVZ A;  4IWP A;  1UGM A;  1UCV A;  3VFK A;  3RJK A;  1UZX B;  5AI4 A;  3ML9 A;  4I2B A;  4RGN A;  4XYC A;  1J2M A;  3Q8Q B;  5J0S A;  4OCZ A;  3GV8 B;  2FDR A;  5KFL A;  4RQ4 A;  2HOF A;  4DXG A;  4E71 A;  3IT4 B;  4RT2 A;  3Q8L A;  4A8E A;  2BT6 A;  2PMZ F;  5J2B A;  1TS5 A;  2QAR A;  2EDU A;  4PPX A;  3Q8C A;  3WKC A;  4F4Z A;  2QKQ A;  5CRX A;  4F7Z A;  2Y9U A;  3SMV A;  4M04 A;  2BKF A;  1CEZ A;  4NLN A;  4PYU A;  4PL2 A;  3AB5 A;  5HR6 A;  2DZJ A;  4DCC A;  1Z4N A;  3LVV A;  2XIC A;  4HCP B;  3EA6 A;  2EAN A;  1JUD A;  2ZTC A;  2WNM A;  7ICP A;  3IT6 B;  4ZRJ A;  1GJZ A;  1MSW D;  4F5Q A;  2PFQ A;  1QQR A;  2IDY A;  5KHO A;  4ECU A;  3ECI A;  5AM0 A;  3MC1 A;  5CP2 A;  2AL3 A;  2W8K A;  2HBM A;  3NOB A;  2PW9 A;  4DHZ E;  3VUW A;  3J81 j;  2BVC A;  2KAC A;  2ZNV C;  2K8B B;  3IXS A;  4ARI A;  5ALZ A;  2H3I A;  4P0Q A;  4K81 A;  2YMM A;  4I2F A;  4PS3 A;  2AQ4 A;  4MGK E;  5ALF A;  2NTS A;  2JMG A;  1E6E B;  5L1K A;  2HBL A;  5AIB A;  5EWG A;  4FA6 A;  2Y0S C;  2K4P A;  2E5S A;  1UNS A;  3VC8 A;  3C23 A;  1N62 A;  1NK9 A;  4H2A A;  3SEN A;  8ICP A;  4B9N A;  3WAO A;  4HKQ A;  4CCH A;  4F5O A;  2BS3 B;  3L3F X;  3HK0 A;  4LVS A;  2KSO B;  4IG7 B;  3ZD8 A;  1KEJ A;  1ZXH A;  5ALR A;  2WXK A;  3A9J B;  2FNJ B;  3VCB A;  2KN7 A;  2XBB C;  2LUE A;  4WWP A;  1QF6 A;  5AIA A;  3WAM A;  5KFV A;  3NJT A;  4U6P A;  2PI5 A;  5J2C A;  5ALX A;  4HPM B;  1WMH A;  5DG9 A;  3OSP A;  3Q2A C;  5DB7 A;  4RZR A;  2VRR B;  3ED5 A;  3RUI B;  1NJZ A;  2W04 A;  2INP E;  1I35 A;  1L0X B;  5H2F U;  2NPT A;  3KH0 A;  4R3D A;  1A5R A;  2VA8 A;  3ZQ4 A;  1A6S A;  2FLP A;  4KKJ A;  4FBU A;  5KFB A;  5ALU A;  4NAM A;  4HK2 A;  1SXD A;  2B0C A;  2I38 A;  2ONQ A;  4KLT A;  3JYU A;  1WXM A;  1SJH D;  2E8P A;  3QUQ A;  3C2L A;  3B2G A;  2J52 A;  3OSN A;  9ICJ A;  3A33 B;  1FPY A;  1PK1 A;  5KAF U;  2GBM A;  2IO0 B;  4AJY B;  3L17 A;  1E7V A;  3R7R A;  4BVU C;  4RUA A;  2JZB B;  3GZN B;  3PMN A;  2IO3 B;  2KO3 A;  1BPE A;  3ORY A;  4MEX A;  7ICG A;  2JWU A;  1N5X A;  3TQ1 A;  1WZ0 A;  5G5G A;  2IOF A;  1KLG D;  3MHZ A;  2MLB A;  4M01 A;  2ZCB A;  1C7Y A;  4KDL B;  5J2G A;  2MBH A;  1JXE A;  2HSZ A;  3M9M B;  1LM8 B;  4J3O D;  3T5H A;  2WXM A;  1K52 A;  4BZA A;  4ZHP A;  2BYT A;  3MR2 A;  5III A;  2BYE A;  1WJN A;  3ICX A;  1NDD A;  2QIL A;  2I1K A;  7ICU A;  7ICN A;  4ELU A;  5KAI U;  3V7J A;  1PK3 A;  4PH5 A;  4J03 A;  3UM9 A;  2N7E A;  4J9S A;  3ZXR A;  2LKY A;  4DXF A;  2W9B A;  1FD6 A;  3GIJ A;  2EAM A;  1BPY A;  1YX5 B;  2FIF A;  2FID A;  1PK1 B;  3NVZ A;  1WGG A;  3OJ4 B;  3C28 A;  3A0H U;  4RQ8 A;  1FRD A;  1K53 A;  3AE6 B;  4O9M A;  2KD0 A;  4EE2 A;  2NBU A;  8ICC A;  4TQS A;  3W1S C;  4BOZ B;  2JPH A;  5KFQ A;  4F5N A;  2YX8 A;  2FCN A;  4ED3 A;  4KIT B;  4PS8 A;  1URJ A;  8ICQ A;  3VR8 B;  1RXV A;  2MP2 A;  4GDK B;  4UB8 U;  3U4E G;  1MC8 A;  2G0A A;  3QNM A;  1SZH A;  4DQO C;  1YZ6 A;  3KUD B;  4DFK A;  1I4R A;  4A55 A;  2DAF A;  3H40 A;  5ALT A;  1TK5 A;  5DBB A;  4Y2Y A;  4UAZ A;  1EF1 A;  1QSY A;  2MBB B;  1QSS A;  3T3O A;  2WP9 B;  1PFD A;  1SZP A;  3WK9 A;  1ZRN A;  1L8O A;  3W5V B;  4C00 A;  1JMS A;  4FZL A;  2WXR A;  2CU1 A;  1TZ1 A;  2PVG C;  8ICL A;  5KT7 A;  4O5K A;  2KVZ A;  4XX5 A;  3PX4 A;  1CUK A;  2IOH A;  2KTQ A;  1Q10 A;  2QB0 A;  4OJ5 A;  4CNQ A;  3B08 A;  2KP7 A;  2KDM A;  1RQN A;  3HM3 A;  1WX8 A;  5KHQ A;  4C7Z A;  3I5J C;  3P4Q B;  1SIJ A;  2J6T A;  3T8M A;  7ICJ A;  2F8L A;  3N9Y C;  4B9T A;  2BYF A;  1Z00 A;  2ON8 A;  3HKZ F;  3ZLZ A;  5EWE A;  4WWN A;  2N1W A;  2W54 A;  3ZIM A;  2LBO A;  1ZQR A;  3B2F A;  3TAD C;  4X57 B;  5AI6 A;  3BS7 A;  4I27 A;  5AM3 A;  5KG0 A;  4QZF A;  3I28 A;  3NAS A;  4JWU C;  1I4G A;  1J0G A;  3GII A;  4ECZ A;  2NBW B;  2HDO A;  1UEL A;  1NK8 A;  2XN9 C;  2W11 A;  4NLB A;  3L08 A;  4IWO A;  2BGW A;  4MGI E;  5KT6 A;  4IM2 A;  2KLC A;  1V9J A;  1T0Y A;  2KWC A;  3MFG A;  2ZG6 A;  2NCN A;  2V4Q A;  2BPG A;  2IO1 B;  5HFY A;  3ZDD A;  2Y0S F;  2MRL A;  4YR2 A;  2FCM A;  4BGD A;  5DLG A;  5L1J A;  4MSM B;  4UB5 A;  2W9N A;  2NTT A;  3KLS X;  2LYH A;  7ICT A;  3UQ2 A;  1IP9 A;  2SEB D;  1BPX A;  5KT5 A;  4ECQ A;  2KE7 A;  3C21 A;  3LVW A;  4JUZ A;  4MFA A;  2PXI A;  3PX0 A;  3RB4 A;  1B1Z A;  2HJ1 A;  4NJ8 A;  2YY6 A;  4ZRK A;  4MEY A;  2C2E A;  3N97 B;  3NUH B;  5LLI A;  2BPS A;  1DYQ A;  2B6G A;  1R4M I;  1D5X C;  5CB1 A;  1UT8 A;  4KLH A;  3NZU A;  1ZQV A;  3ONN A;  2ESE A;  4BXO A;  4ZHO A;  4OZC A;  3DBS A;  2E8N A;  1ZUD 2;  3ISD A;  2JUO A;  3DOW A;  5D2M B;  5T14 A;  3KHL A;  1V97 A;  3RR8 A;  4UAU A;  4C80 A;  4KLL A;  4KX3 A;  2BW2 A;  1XLQ A;  2LGX A;  3QWZ B;  4GMV A;  2WDR B;  4Q44 A;  1NKB A;  3C1Y A;  2NRX A;  8ICA A;  3GOE A;  1GB1 A;  2PI4 A;  1L6N A;  1IXR A;  5KFX A;  2HE7 A;  1KFS A;  5KFN A;  2KHQ A;  3ZDE A;  5AI8 A;  2ODG A;  4LLG M;  3SD5 A;  1KJT A;  3ZTD A;  5KFZ A;  1RDF A;  2LGS A;  4MT5 A;  4EZK A;  2JQR B;  2WYQ A;  2XC9 A;  5E6O A;  1ZQS A;  4XZ4 A;  8ICB A;  3TIX A;  5IAA C;  4O3R A;  3MTN B;  4EZ9 A;  3PR4 A;  2EZX A;  1WGR A;  1NI2 A;  2C9W B;  4RQM A;  3DWM A;  4B9K A;  3A0B U;  4BWM A;  4F8R A;  5DPS A;  4NM2 A;  1NKE A;  4YWG G;  4I2I A;  2FPK A;  3ZW3 A;  4R64 A;  4BBN C;  3U26 A;  3C29 A;  5AI0 A;  5DG7 A;  2TSS A;  3OG5 A;  1X6I A;  2G08 A;  2D3A A;  4M00 A;  4GXK A;  2PFN A;  1NI3 A;  2RR9 A;  2VA3 A;  2V3N A;  4YTM B;  3UQ0 A;  1V85 A;  9ICW A;  5J0R A;  4OJL A;  4UAR A;  1ZQE A;  4DQS A;  1TE2 A;  4C8K A;  5KT4 A;  3RJE A;  4NV0 A;  1PVQ A;  1N63 A;  3UQB A;  1ZQI A;  4NWI A;  3P4S B;  3EC8 A;  3L0W B;  2MEK A;  4MH8 A;  1SL2 A;  2JH7 A;  2BKE A;  4GB9 A;  1U9L A;  3TMP B;  2C2R A;  3LJ3 A;  1ZQP A;  2WXF A;  1KN5 A;  4F4W A;  4PK1 A;  5HG2 A;  4A6Q A;  4DWF A;  2ZUB A;  2MWS B;  3DPD A;  3L10 B;  2K8H A;  1SE9 A;  4AOF A;  9ICT A;  3UXP A;  4KTQ A;  1VLB A;  3LDA A;  5KFS A;  1T5X D;  1K51 A;  3V6K A;  5J2K A;  4F5P A;  1X9M A;  2BF8 B;  2M19 A;  2HJ8 A;  3PO0 A;  4ECR A;  2XNA C;  1JIH A;  2WF5 A;  3RR7 A;  9ICB A;  5GXG B;  4EOY A;  4RQ3 A;  2ZNV B;  4ECY A;  3IG5 A;  2HTM E;  3ZVV A;  2C22 A;  1KDH A;  2E8M A;  9ICQ A;  3PGE A;  4XC2 A;  2FMQ A;  2CR5 A;  2MUT A;  5KL8 B;  4JLC A;  2DZI A;  4NJC A;  5TZV A;  8ICR A;  4G0N B;  3ZXV A;  2LHE A;  1T8E A;  3U2S C;  1FXT B;  3ENE A;  7ICH A;  3ZRC A;  5AKY A;  4HJK A;  4HKZ E;  3KD3 A;  1XCT L;  1S8O A;  2KK8 A;  3IV6 A;  3UMG A;  1TZO A;  2H88 B;  2F76 X;  5JHB A;  4DSJ A;  4P4M A;  2YB4 A;  1ZOY B;  2LFI A;  2ZIU B;  4R8U B;  1V5O A;  3BVZ A;  5LXH A;  1DK2 A;  1YN4 A;  3AE7 B;  3I3T B;  3A1Q B;  5J2A A;  1T7P A;  4F91 B;  2HBK A;  3DEE A;  2K4H A;  1JCK B;  2J42 A;  3DBR B;  2K6Q A;  3VH3 B;  1K8R B;  4FJV B;  5J18 A;  4TUU A;  1WSP A;  1SJE D;  4NQL B;  2BPC A;  1Z1V A;  3BQ2 A;  2LM1 A;  4GLX A;  1WI0 A;  2DX5 B;  2WU2 B;  2LRW A;  5BYS A;  4IUM B;  4K7S A;  1WIA A;  3PS6 A;  3RB6 A;  3H0M B;  5IOI A;  2L00 B;  3PRM B;  3CYM A;  4CGZ A;  3AE5 B;  3R3M A;  1FCL A;  4RQ5 A;  4NLK A;  1XD3 B;  5ALS A;  2WXJ A;  3N7S C;  1SXE A;  2DPJ A;  5J2D A;  1GC7 A;  3PV8 A;  3GE3 C;  1WE6 A;  2XK5 B;  2OHF A;  2ZIX A;  8ICU A;  5KL1 B;  3RAQ A;  4DL3 A;  3T5J A;  2QMT A;  2L52 A;  4HVB A;  2GLE A;  2MA9 B;  1KBU A;  2HMX A;  3C5G A;  2HHU A;  2DAJ A;  4US9 A;  1C76 A;  4J9K A;  1Y88 A;  4F3O A;  3M8S A;  1LFD A;  2JRH A;  1TY2 A;  3AE4 B;  4C4V B;  1UBQ A;  2KTR A;  4IQW A;  1UQV A;  2DF4 B;  4P4O A;  3PW0 A;  1YJJ A;  4KZC A;  2F1I A;  2HHT A;  1ZQU A;  5KFY A;  4LJP B;  1PYW D;  1TKD A;  7ICR A;  1C9F A;  3ZI4 A;  3UPQ A;  3RMK C;  2K8C A;  5ALQ A;  1RYR A;  4DQQ A;  4QZC A;  4GC6 A;  3V61 A;  2L1A A;  2QHO A;  1MFW A;  1TS2 A;  2IO2 B;  1FEH A;  2QSD A;  2V3P A;  1WJU A;  2JX5 A;  5AZH A;  1ZQO A;  3VQI A;  4PHE A;  3KW5 B;  2EMS A;  3TFR A;  3OAW A;  1WCL A;  4C4T A;  3HW8 A;  2YQE A;  1EUV B;  2K0P A;  1YX6 B;  3NG0 A;  2PKE A;  2Y1I A;  2LJ5 A;  4UBB A;  1ET6 A;  3MHS D;  4M8N A;  2LYB A;  5KTQ A;  1BNP A;  1WR6 E;  4WUR A;  3U7Z A;  2DEN B;  2J7Q B;  1OTR B;  4B95 A;  2AH5 A;  4MFC A;  4ZRI A;  3FC4 A;  1X9X A;  1QLN A;  1V86 A;  1YNT E;  3QHT A;  2H3Q A;  2ZTD A;  4QIW C;  4JPS A;  3PR5 B;  1N2X A;  3PHX B;  3KVF B;  5C3J B;  4IQU A;  2Y5C A;  2KJ9 A;  2KTR B;  4LZD A;  3QE9 Y;  2WF6 A;  1X66 A;  4TUQ A;  2FCS A;  2QC8 A;  4YSX B;  3SAH A;  4O3Q A;  2I9G A;  2WXN A;  1UA1 A;  1TAM A;  4CDG A;  8ICZ A;  2K8C B;  1N60 A;  1SWW A;  5L1L A;  2MA1 A;  3TAQ A;  4O5C A;  5J0U A;  1ZGU B;  4ELV A;  2KIV A;  4O5E A;  1XO0 A;  2V4I B;  3QEA Z;  5DKW A;  1NNL A;  2M17 A;  2CXY A;  2VIX A;  1CJE A;  5KFK A;  4ED1 A;  4K7W A;  4JV2 A;  4QWD A;  2VJ5 A;  3WK6 A;  4YXJ A;  1HEK A;  3ZJT A;  5CWR A;  1ZQT A;  3RCZ A;  1P7D A;  1U47 A;  1NK0 A;  3BY4 B;  4BDP A;  4ZYS A;  1RM6 C;  4A20 A;  3Q8S B;  4MGY E;  2VKQ A;  5ALW A;  1MG4 A;  1SL1 A;  4GOC A;  3UIO B;  3WKE A;  2ZIW A;  3OJ3 A;  1NJY A;  4NZL B;  3PLV A;  4YSZ B;  4M0W B;  3NS1 A;  3Q3F A;  4DXA B;  1Q0W B;  3HJE A;  2N4F A;  4KLJ A;  3AEF B;  2AQ3 B;  2N9X A;  3DDH A;  9ICE A;  1S0M A;  3T79 A;  2O6V B;  3SFD B;  4PHP A;  1SE3 A;  5DB8 A;  4NAW B;  4RQN A;  5CR0 A;  4QNL A;  4PGX A;  4W9C A;  4CQN A;  4FS1 A;  2EKE C;  4XA5 A;  2AXT U;  5CHF A;  2DQN B;  2QCZ A;  4YFK A;  4RFB A;  2KWD A;  3C5F A;  3AEE B;  5K4L A;  3AE8 B;  4Q2J A;  2KIC A;  4YT0 B;  2Y9T A;  1UF0 A;  2KQ7 A;  2MQJ A;  3RT3 B;  2D3G A;  2N0S B;  8ICX A;  1E8Y A;  4UB4 A;  3JSV A;  3IHQ B;  2G1E A;  4WAF A;  3ZDC A;  3H1U A;  5ALP A;  3EZ5 A;  3BVM A;  8ICS A;  1JXL A;  1X9S A;  5HNK A;  2KFJ A;  2AL6 A;  1KOT A;  4DFP A;  1YMH E;  4IC9 A;  2JZ3 B;  2W55 A;  4BKS A;  2RP5 A;  4XQ8 A;  1SL0 A;  3B0Y A;  2GBK A;  3SV4 A;  1JAL A;  2A1J A;  4KZ0 A;  5DPT A;  4Y2S A;  5ALK A;  3UIP B;  4RUC A;  1Z1B A;  3APD A;  1LVH A;  4RPY A;  4ICU A;  3H8H A;  3R2T A;  2KN5 A;  1DXS A;  2L76 A;  1V49 A;  1VZ6 A;  2QDF A;  4GN1 A;  3CWI A;  4LJX A;  1MHH E;  5IIO A;  1ZYQ A;  1WWU A;  2HHX A;  5J0P A;  2KAJ A;  3BS5 A;  1F52 A;  5KFE A;  2JZP A;  1ROE A;  1F44 A;  2BS2 B;  9ICR A;  1FIQ A;  3H8M A;  3HVD A;  1WE7 A;  1WM2 A;  4B9U A;  2KLG A;  5EOZ A;  2DFL A;  2OWO A;  5KFP A;  2YEP B;  5KG1 A;  3M1Y A;  1XLP A;  1TT5 B;  3AED B;  4N58 A;  4P1B C;  4I6L B;  2KJ5 A;  1WJ6 A;  2ZVO A;  1OFF A;  2RSU A;  3AXC A;  1FO4 A;  2L7R A;  5DBC A;  2RMM A;  4USA A;  4PS7 A;  5BOM A;  1Q5W B;  2LHD A;  1ZDV A;  3RZF A;  1MI0 A;  4UAV A;  8ICF A;  2F3N A;  3KHH A;  4KX6 B;  4KMU A;  3TKA A;  5KG3 A;  3UXN A;  9ICF A;  2A1J B;  4LTU A;  4LJO B;  1E5W A;  2ZW1 A;  1YQ4 B;  4XWW A;  3LK9 A;  2PKO A;  4PT5 A;  1NZB A;  1FNW A;  2YML A;  4MSQ B;  3I63 C;  2XI9 A;  3JPP A;  2KQ4 X;  1U4A A;  4IRC A;  2EKI A;  2OCE A;  2GMI C;  4KLG A;  2BCR A;  1MHX A;  2Z8L A;  3QUB A;  1FCC C;  4TUR A;  3QZ7 A;  4J9N A;  4G3X B;  5J2H A;  2KT7 A;  4UBC A;  3BS5 B;  3V7L A;  4XDD A;  3I76 A;  2FPM A;  2MRP A;  5KFU A;  1K1S A;  3OLM D;  4ACO A;  4O1N A;  1GG3 A;  3R2I A;  3VUY A;  5AUI A;  3H8S A;  3N32 A;  1WWT A;  4P7I A;  2WLB A;  4QZH A;  7ICM A;  1S5L U;  3H7I A;  3SI8 A;  3WIM A;  3NTU A;  2FBW B;  2JYE A;  1X42 A;  4FFD A;  2KNJ A;  4ZRQ A;  3PV1 A;  4QIW F;  4D2K A;  1KLN A;  5D3I B;  2AWT A;  4U7C A;  1WGK A;  1DOI A;  3FKY A;  1SGG A;  1LQB A;  3PO5 A;  2NRV A;  3E9S A;  2M0N A;  5C2T B;  3KBB A;  2AGO A;  5AHX A;  3RRH A;  2PFP A;  3I57 A;  2EQY A;  1P98 A;  4FHJ A;  2IBI B;  4FN2 A;  4I2A A;  4C8O A;  1XO3 A;  4PHA A;  1Y8R C;  2O2V A;  4NJ6 A;  2M0A A;  3O0F A;  2BB5 A;  4OJP A;  5DDY A;  1MQ3 A;  2LGI A;  3D6J A;  1C79 A;  4DS4 A;  8ICT A;  1LV5 A;  2J0K A;  5J8Y C;  2FPL A;  1GPX A;  1LKY A;  2P6R A;  1JN3 A;  3M62 B;  1A70 A;  1KRH A;  2PTL A;  2A19 A;  4YXM A;  4UB3 A;  3PVX A;  2VAN A;  3IHP C;  1VJ5 A;  5AUK A;  1U4B A;  1UUP A;  1WH3 A;  3DBL B;  2FE8 A;  5EE0 A;  3Q3N C;  4KIK A;  1V81 A;  3Q8K A;  2BQQ A;  2WB1 F;  3RBD A;  1XWL A;  2PE9 A;  2IA6 A;  1B0X A;  4MJS A;  3LXF A;  1M6Y A;  2RDB C;  4CYE A;  1JRU A;  4ELT A;  1L7Y A;  3H4D A;  4F8C B;  2KWU B;  4DSE A;  5JTI A;  2XVT A;  3JPN A;  2QAR B;  2ZIV A;  2W82 A;  3RNB C;  1E8W A;  4FZN A;  1SB3 C;  2MSN A;  1C3T A;  1SV4 A;  2KEY A;  5DQG A;  2LGY A;  1ZQX A;  4MM3 A;  3N1X C;  4C4S A;  5A0L A;  4KLD A;  1BXT A;  1PGX A;  3R7Q A;  1WX7 A;  1E7U A;  1ZD5 A;  5EDS A;  4DQP A;  5J0O A;  4Y2J A;  2UWQ A;  2XGP A;  5DDM A;  4RNN A;  1R4N I;  3CW2 C;  4QWC A;  5F9N A;  2I1J A;  1COK A;  2CPR A;  3V6H A;  2GOL A;  1X40 A;  4C8L A;  3ML8 A;  2DKX A;  3QQ8 B;  4W9K A;  1L2N A;  4QZE A;  3I9V 1;  3RB0 A;  1T3N A;  1QKZ A;  3VXW A;  3W2D A;  3DQV A;  5KFG A;  4P0Q B;  2NS5 A;  3TUO A;  1QLB B;  3E2E A;  4KIK B;  4WQM A;  2BS4 B;  2WTF A;  2KFN A;  3N30 A;  4OW0 A;  3TAR A;  1RXW A;  1Q3V A;  4JV1 A;  2K25 A;  2L32 A;  3DVN V;  4KLF A;  5HHH A;  2IJ0 A;  3NVY A;  3JW0 X;  3RH4 A;  1L3V A;  1YQB A;  2BB6 A;  1HXY D;  2BCV A;  2DGZ A;  2F8K A;  1E8Z A;  5KT2 A;  2ZUD A;  2KTF A;  4DSF A;  2DYM A;  3KFU F;  3PW2 A;  2W9C A;  1WGH A;  2AX5 A;  2QJL A;  4FAD A;  4II3 B;  4KX5 A;  5KT3 A;  4QZA A;  2D10 A;  1DGJ A;  4DWI A;  1WGD A;  4KN7 A;  4CO7 A;  1SSN A;  4EFO A;  4W9L A;  3RNC C;  1RYS A;  3U52 E;  2K5P A;  2Z0D B;  3B0A A;  2HHW A;  1WMH B;  2LVQ A;  3KYC D;  2NO5 A;  3MFH A;  2QIE B;  1A76 A;  2NPT B;  2JV3 A;  5D4B A;  4KLQ A;  2LVP A;  2M0X A;  3TCA A;  1ESF A;  2G09 A;  4DQI A;  3V3X A;  2KHW B;  1TTN A;  4YXD B;  2EZY A;  3TEZ A;  2KMD A;  3UIN B;  3MBY A;  3H4B A;  5KG2 A;  1V5T A;  2WXH A;  3PT2 B;  3M95 A;  2MSE D;  1JRO A;  3ZNI D;  5DBA A;  3AUO A;  2KG5 A;  3LB8 C;  3ALR A;  4WQO B;  4ANW A;  4K3C A;  2IGG A;  2ASJ A;  2E8O A;  2BKR B;  4B0E A;  4YMO A;  3H7P A;  2BQR A;  2KAN A;  4RPZ A;  2W9C B;  1X2I A;  3SR6 A;  1C20 A;  4WWM A;  2O6V D;  1CI4 A;  3PVL A;  3C19 A;  3A4S C;  1WCN A;  2ASD A;  2WXP A;  4NJ7 A;  4P1C C;  2YMP A;  1ZW7 A;  1LGR A;  4US8 A;  3NVV A;  1L0V B;  5BYR A;  1A77 A;  1ZQQ A;  1WGY A;  2AHO B;  3EW9 A;  4A3O A;  4GIB A;  1WXS A;  1ZKH A;  3K75 D;  2N9E B;  3RFA A;  5DB9 A;  2LXA A;  3H8W A;  2WHI A;  3LYY A;  1Q46 A;  3DBH I;  2G5H B;  2BCU A;  3BK1 A;  3R9K A;  1X6J A;  1S0N A;  1YZ7 A;  5D94 A;  1TFR A;  3OTQ A;  3KOO A;  1PDX A;  3WAL A;  4WJN A;  1RFA A;  2HBJ A;  4Y2R A;  2AQ2 B;  2WFA A;  2W9B B;  1XXG A;  1YN3 A;  2HD5 B;  4DFM A;  5JU5 A;  2BWF A;  4N9F 4;  3RNF C;  3GV7 B;  3OJS A;  2WGS A;  4JWM A;  4NLC A;  1EF5 A;  5J0Q A;  3JPO A;  5H92 C;  3AUL A;  3L5K A;  3GIM A;  3F2D A;  2X8X X;  2BYV E;  4TMA B;  4EZL A;  4P0P A;  5D7G A;  3IVF A;  4QZI A;  4MF2 A;  5L1M A;  2LMR A;  2MP2 B;  5BO4 B;  3HIL A;  3V7K A;  4ICA A;  4EBC A;  2WAQ C;  3SAF A;  2RLT A;  2JSV X;  4RPX A;  4IL6 U;  5ALE A;  4FE3 A;  9ICA A;  2GB1 A;  3PLU A;  4HDQ A;  3GIL A;  1SV0 C;  2DWQ A;  3F5A A;  4ED0 A;  1H4R A;  4LZG A;  1RQL A;  4UAY A;  5ALV A;  4M0A A;  3F53 A;  2V0G A;  2IHN A;  2D3B A;  1FRR A;  7ICV A;  2ZJD A;  1HJP A;  3RTV A;  3PW7 A;  2RDI A;  3DV9 A;  4DL4 A;  4ITK A;  1RG6 A;  2FMP A;  1LB2 B;  4IM3 A;  4REZ A;  3DDC B;  4B0M A;  1ARO P;  4ECS A;  8ICJ A;  1FNU A;  2GOW A;  1ZQN A;  1V1P A;  2QB0 B;  3KUZ A;  3ZTC A;  2PIA A;  1K5O A;  2R8G A;  1QZE A;  1P7E A;  1S76 D;  4BKS D;  2C7M B;  2ZXH A;  2MJE A;  2IMW P;  4AUQ C;  1Z00 B;  2RPQ A;  2HI0 A;  1KQQ A;  4F71 A;  2K3U A;  3QCA A;  2BPF A;  1ZJN A;  1J19 A;  1SXT A;  4NLZ A;  3ZUN A;  3PML A;  4LNN A;  1P1A A;  3O13 A;  2RDH A;  3DCG A;  3NHE B;  2EH9 A;  4W9F A;  3MC9 A;  1L7M A;  3S2A A;  3SEI A;  1D8B A;  1OEY J;  2KKC A;  2KDE B;  2LAS A;  3PW5 A;  3SFE B;  3G6V A;  5AKE A;  4KGT A;  3C2M A;  1R7S A;  1NK4 A;  2Q4T A;  1AQ6 A;  1JX4 A;  5GTH U;  2WF9 A;  1IGD A;  3RNG C;  3GFK B;  2F1J A;  1PVP A;  1TIF A;  5F3X B;  1BPZ A;  1XU4 A;  2KYW A;  2LHT A;  1COO A;  2YN4 A;  3FIL A;  5CHG A;  1GAQ B;  3KKA A;  1PQS A;  2NR2 A;  2W7O A;  2QB1 A;  1J97 A;  5J2F A;  1VZ8 A;  2XCA A;  2G06 A;  3BZD B;  4A90 A;  2YMQ A;  1H38 A;  4K4G A;  3KHG A;  1TBE A;  2L0T A;  5AI9 A;  4JB3 A;  2M1M A;  3PZD A;  4IWQ A;  2JZZ A;  3KWV A;  2I5H A;  1XC9 A;  2ICI A;  1ZQB A;  3K9O B;  3P2B A;  4RCO A;  2WX0 A;  3RZW C;  4BXO B;  2MJ3 A;  1EM7 A;  2DUY A;  4OVU A;  3MP9 A;  3V60 A;  4PL1 A;  4NXZ A;  2N1R A;  3QU7 A;  2KQS A;  3N20 C;  1ZQ1 C;  1I4P A;  2KJH B;  2LXC A;  2GO7 A;  3T5K A;  2FE9 A;  1U45 A;  1I4Q A;  5BPC A;  2JEF A;  3QJZ A;  3M7D A;  3C8Y A;  2WF8 A;  2JEG A;  4OD0 A;  1XEE A;  2DLB A;  3TEX A;  1I4H A;  4E3C A;  1WRI A;  2XGQ A;  2R8J A;  1KRP A;  4Z6C A;  2KDF B;  3FIL B;  3V05 A;  3SDL C;  4KLU A;  2XID A;  1WR1 A;  3PZ7 A;  2OOB B;  1S0V A;  2OJW A;  2VA2 A;  1OEY A;  2DZM A;  4AYB C;  4JK1 A;  3Q6B A;  2M8S A;  4E74 A;  2CHX A;  2X38 A;  2F44 A;  2I6X A;  5KFM A;  4DOA A;  1RZT A;  2R8K A;  2WHE A;  4F72 A;  3VRB B;  1L7P A;  3FYH A;  1ET9 A;  4EBE A;  3OHB A;  1QOF A;  1QQ7 A;  4IW0 A;  2JEJ A;  1OQQ A;  3Q3M C;  1JWU D;  4XGA B;  3DVG X;  3ONS A;  2WXO A;  4ECT A;  1V38 A;  3PW4 A;  3URY A;  4KSK C;  4FJY A;  3C1Z A;  3BZC A;  2FMS A;  4DLE A;  1L3T A;  4I28 A;  3AH7 A;  2OYY A;  3FAH A;  2PPH A;  3AU2 A;  2GBN A;  4RQ0 A;  1TK8 A;  3AEB B;  3GV5 B;  1T0Q C;  1E10 A;  2R2Q A;  1HZ5 A;  2PJH A;  1L5U A;  3L13 A;  4YD1 A;  2K6D B;  3KWL A;  1E0Z A;  2LWP A;  1F2R C;  1FM0 D;  4IM0 A;  2G5I B;  1V1O A;  2JH1 A;  2WU5 B;  1DGS A;  2MW5 A;  3IM1 A;  3WAP A;  4F93 B;  1TY0 A;  5AKK A;  2FLL A;  5B5E U;  4PGY A;  4HJG E;  2KMA A;  4EEY A;  5L95 C;  1NK7 A;  4S17 A;  1F5S A;  3PRZ A;  4QWE A;  2XY5 A;  3QA8 A;  5KFW A;  5AIC A;  1IBX A;  1XT9 B;  4G11 A;  2DNF A;  3PO4 A;  4W9H A;  3FM9 A;  3P63 A;  4UB6 U;  4I2D A;  2B76 B;  5DQI A;  2HHS A;  4OJ6 A;  1R4M B;  1UT5 A;  1E8X A;  4TKN A;  3HX0 A;  4ED7 A;  3QAR A;  1BUI C;  2BCS A;  4HCN B;  4KDI C;  1D8L A;  2N7D A;  4CF3 A;  1WF9 A;  5AK3 A;  2GH1 A;  3AEG B;  1PUT A;  4RMA A;  1FXA A;  1WM3 A;  1TGZ B;  1E90 A;  2KDI A;  4WWO A;  3JVZ X;  3PX6 A;  2MUT B;  1XLN A;  5DPW A;  3T3F A;  4F2R A;  2KFZ A;  1XQQ A;  4BFR A;  4FBT A;  1CZP A;  2LRU A;  1CK1 A;  2LPE A;  4I2C A;  1I4X A;  3HM6 X;  4OZB A;  3ZNG C;  4QW9 A;  3SV3 A;  3G6X A;  1XS9 D;  4NM1 A;  4M2Y A;  3EFC A;  3SQI A;  3Q69 A;  8ICK A;  4QZ9 A;  4DHJ B;  3A9K A;  1SIF A;  5C1Z A;  1IBX B;  3CNH A;  3LYS A;  1HTO A;  3AI5 A;  3Q8F A;  2H5X A;  3E56 A;  1IGC A;  4OHJ A;  1SWV A;  9ICK A;  4RQ6 A;  2W43 A;  4UDU C;  1UPH A;  1TV9 A;  1KLV A;  2JT4 B;  5JHA A;  3PTF C;  2LEK A;  2F77 X;  4OO1 J;  3QC8 B;  3MDA A;  2QEJ C;  2UVU A;  9ICO A;  4DO9 A;  1KFD A;  1L3U A;  3QIJ A;  2ZTE A;  2MBE A;  4WAA A;  1Q1O A;  4Z6E A;  3IG3 A;  2M4N A;  4ECV A;  4FLH A;  2WWZ A;  1OUQ A;  2W3R A;  4CE6 A;  1MQ2 A;  3TFS A;  4LCD E;  4ED8 A;  4TSS A;  4QWB A;  1NKC A;  5HML A;  1V8C A;  3L16 A;  2ZIX B;  3A9K B;  3NZS A;  1D6E C;  4RM9 A;  4RU9 A;  1HA5 A;  3ETL A;  3HUI A;  2KDB A;  3EUB 2;  2PEA A;  3NGD A;  2E6X A;  5CHW A;  4JQW C;  2BDP A;  4BWJ A;  1S9F A;  7ICO A;  9ICX A;  4IS7 A;  1V6E A;  4XDC A;  3N28 A;  1YIW A;  3K1R B;  2RDG A;  5AK4 A;  1TKE A;  1KTK A; 
#chains in the Genus database with same CATH homology
 4DXF A;  1MHX A;  2CU3 A;  3OWE B;  5I4D A;  2Z8L A;  1FD6 A;  1FCC C;  1XLO A;  3AN1 A;  3NVZ A;  1AW7 A;  2HDE A;  5G5H A;  3AE2 B;  1K53 A;  3AE6 B;  1FRD A;  3GB1 A;  4EE2 A;  1UGJ A;  4XDD A;  1IUE A;  5E6J A;  1AN8 A;  5H8Y E;  4O1N A;  3R2I A;  5AUI A;  1DOX A;  1WWT A;  1ZE3 D;  2Q5W D;  2WLB A;  3VR8 B;  2FBW B;  1VR9 A;  2LJI A;  2JYE A;  4GDK B;  3U4E G;  3VRA B;  1YQ3 B;  4ZRQ A;  4DQO C;  4D2K A;  5D3I B;  3RPF C;  1WGK A;  1DOI A;  1I4R A;  4RH6 A;  4A55 A;  2RPV A;  3E9S A;  3J9C A;  5C2T B;  4GLS C;  3Q8A A;  3I57 A;  4L2Y A;  1XCQ L;  1C4C A;  3T3O A;  2WP9 B;  4A9A A;  1JML A;  1PFD A;  1XO3 A;  1FNV A;  3NZ3 A;  2N9L A;  1Y56 A;  2M0A A;  1ZXI A;  3W5V B;  2BB5 A;  2LGI A;  2WXR A;  2OED A;  1C79 A;  1WXQ A;  2PVG C;  3P4P B;  2IGD A;  1Q10 A;  1GPX A;  1TYG B;  2KDM A;  1BML C;  4C7Z A;  2PVO D;  1A70 A;  1SIJ A;  1KRH A;  2PTL A;  3P4Q B;  5MPO A;  3ZGZ A;  3N9Y C;  2PLP A;  2ON8 A;  5HI1 A;  1N61 A;  5AUK A;  5BMH A;  1UUP A;  2W54 A;  2FE8 A;  5EE0 A;  3B2F A;  5FR3 A;  1K50 A;  3LXF A;  4AQ7 A;  2J53 A;  3TEY A;  1M4V A;  4JWU C;  1I4G A;  2W82 A;  3BK2 A;  1DOY A;  4RGT A;  4YTP B;  1F0Z A;  1SB3 C;  1J7C A;  1AWD A;  2XN9 C;  5D3D A;  1I7H A;  1LO5 D;  2INN E;  1BXT A;  4FXC A;  1OQR A;  3ETR A;  3MFG A;  1PGX A;  4ZRP A;  1FXI A;  2WDV B;  5HFY A;  3BYY B;  4JX1 C;  2WXG A;  2FUG 1;  2CJO A;  2NTT A;  3KLS X;  2SEB D;  1NEK B;  1B1Z A;  3I9V 1;  1QKZ A;  3W2D A;  1GB4 A;  3TUO A;  1KLU D;  1QLB B;  3P1M A;  4WQM A;  3KQ4 A;  2BS4 B;  3NUH B;  4OW0 A;  2L32 A;  1DYQ A;  3HVZ A;  1D5X C;  3BWU D;  2IJ0 A;  3NVY A;  2BB6 A;  4ZHO A;  4JE3 B;  4OZC A;  1HXY D;  1ZUD 2;  3CIR B;  5JXV A;  1V97 A;  4C80 A;  2DYM A;  2BW2 A;  4OZA A;  1XLQ A;  3W1S A;  1QIL A;  2W3S A;  2AX5 A;  2WDR B;  2QJL A;  3L4P A;  1WYG A;  1SE2 A;  1DGJ A;  1GB1 A;  1SSN A;  3U52 E;  1J7B A;  2K5P A;  2WXL A;  1YN5 A;  1SF0 A;  2KMM A;  3B9J A;  4LLG M;  2WQY B;  2QIE B;  1L4Z B;  4MT5 A;  2IPK D;  2JQR B;  2H89 B;  1NEN B;  1YJI A;  1ESF A;  3V3X A;  3DWM A;  4YXD B;  3TEZ A;  3MC0 B;  4P16 A;  3Q8E A;  4A8X C;  2WXH A;  2R61 A;  2YEP F;  1GOZ A;  5T8I A;  1JRO A;  3LB8 C;  4YWG G;  2VZK B;  3EGR A;  2IGG A;  2TSS A;  4B0E A;  4IKG A;  1L5P A;  4L1B A;  1C4P A;  1NI3 A;  5FKA C;  3SR6 A;  4WWM A;  2V3N A;  4YTM B;  4XWT A;  4RF1 A;  2WXP A;  3IAS 1;  2LMC A;  4C56 C;  1QOB A;  1VDV A;  4US8 A;  3NVV A;  1L0V B;  3TSS A;  2Y5P A;  1L0Y B;  1RYJ A;  5BYR A;  4RNA A;  1PGB A;  1N63 A;  3AEA B;  5FK9 C;  2MH7 A;  3P4S B;  4M0W A;  4YSY B;  2MEK A;  4MH8 A;  1VJK A;  1EWY C;  3LYY A;  2BBC A;  2GI9 A;  3BK1 A;  2WXF A;  5HG2 A;  4A6Q A;  3IAM 1;  4KGR A;  4IOI E;  1FFU A;  1PDX A;  3NRZ A;  2AQ2 B;  1XXG A;  1YN3 A;  1VLB A;  2KN4 A;  1T5X D;  4RF0 A;  1E9M A;  1K51 A;  1QT9 A;  4KKI A;  2WDQ B;  2M19 A;  3PO0 A;  2XNA C;  5H92 C;  1NYR A;  1ACC A;  3MJ5 A;  5HHD G;  1FFV A;  4TMA B;  5GXG B;  1XF5 L;  2K22 A;  1L6V A;  5D7G A;  1EWC A;  4HRS A;  1TJE A;  4TQ1 A;  3W9C B;  2HTM E;  1EU4 A;  1KH0 A;  2PMV A;  2LUM A;  4RGO S;  2JSV X;  2GB1 A;  1TKY A;  4NJC A;  2DWQ A;  4XE0 A;  2LHE A;  1JWM D;  3U2S C;  2K9X A;  3AM9 A;  1UWX A;  4HEA 1;  4HKZ E;  1J7A A;  1HQR D;  1XCT L;  3WCQ A;  1JQ4 A;  2V0G A;  1FRR A;  1F2R I;  1TZO A;  3GS2 A;  2H88 B;  1EU3 A;  3ZYY X;  4ITK A;  2NMQ A;  2JYT A;  4REZ A;  1ZOY B;  4B0M A;  2LFI A;  1FNU A;  3BVZ A;  3GP7 A;  1V1P A;  1YN4 A;  3AE7 B;  2PIA A;  4HRO A;  2I2Y A;  1P7E A;  1JCK B;  1D5M C;  2J42 A;  3TEW A;  2BTE A;  1JW9 D;  2MJE A;  4WH4 A;  1WSP A;  1SJE D;  2WU2 B;  4IDI A;  2K3U A;  5BYS A;  1SXT A;  3HRD D;  2ZW0 A;  3O13 A;  2RDH A;  1KFY B;  3AE5 B;  3BVG A;  4MAC A;  1FCL A;  2N9K A;  4N6E B;  2WXJ A;  2EEL A;  3AEC B;  3SFE B;  1D5Z C;  2IGH A;  4KGT A;  2OHF A;  4MM3 B;  1QOA A;  1E7P B;  1F77 A;  1R7S A;  3DWG C;  3PZ8 A;  2J4X A;  2QMT A;  2DYO A;  1MVK A;  2L52 A;  1VRA B;  1IGD A;  4US9 A;  4JWS C;  3ZJU A;  1C76 A;  3FIL A;  1GAQ B;  1JWB D;  3AE1 B;  1QOG A;  1ZP0 B;  4ARC A;  2E3T A;  4KGS A;  1VZ8 A;  1TY2 A;  3BZD B;  3AE4 B;  3AE3 B;  4ZOH C;  2G9H D;  4A90 A;  1YJJ A;  2WXI A;  1RFK A;  2M56 B;  1PYW D;  1C9F A;  4YTN B;  3KWV A;  3AV8 A;  2ICI A;  5BYQ A;  4RCO A;  1ZDX A;  2L1A A;  1RWS A;  2MJ3 A;  1EM7 A;  1TS2 A;  2QSD A;  1CQV A;  1FEH A;  3MP9 A;  3P4R B;  2V3P A;  2JX5 A;  3VQI A;  1I4P A;  1I4Q A;  2K0P A;  3C8Y A;  4LK0 M;  1STE A;  1ET6 A;  5BMI A;  1XEE A;  2DLB A;  3TEX A;  4WUR A;  3U7Z A;  1B9R A;  1I4H A;  1HZ6 A;  1WRI A;  3FC4 A;  1YNT E;  1TKG A;  3FIL B;  1NVI D;  3T3N A;  3V05 A;  1HEZ E;  2L83 A;  4JPS A;  4C7Y A;  3PZ7 A;  4N59 A;  5C3J B;  2ACZ B;  2Y5C A;  2X38 A;  5EE1 A;  3SEB A;  1C77 A;  1T3Q A;  1ZPS A;  2CJN A;  1N5W A;  4WIP A;  1NYQ A;  2AQ1 B;  3VRB B;  1ET9 A;  4YSX B;  2MJD A;  1QOF A;  2WXN A;  3W5U B;  4AS1 A;  2GRI A;  1OQQ A;  1JRP A;  1JWU D;  3BII D;  1AYF A;  4GDL B;  1N60 A;  2WXO A;  2V4I B;  2JU6 X;  2D5G A;  3R8B A;  3URY A;  1CJE A;  4RGN A;  3AH7 A;  2N7J A;  3ZJT A;  3FAH A;  4DXG A;  3IT4 B;  3AEB B;  2BT6 A;  1E10 A;  1TS5 A;  1HZ5 A;  3Q8C A;  3KWL A;  4ZYS A;  1RM6 C;  3ZJV A;  1E0Z A;  1F2R C;  1FM0 D;  2DBY A;  1C4A A;  1TS3 A;  1V1O A;  2WU5 B;  3AB5 A;  1KF6 B;  4NZL B;  4YSZ B;  3NS1 A;  1TY0 A;  2JXT A;  3EA6 A;  3AEF B;  3NVW A;  2AQ3 B;  1TS4 A;  2WNM A;  4HJG E;  3IT6 B;  2IDY A;  1QQR A;  3SFD B;  5EE9 A;  1SE3 A;  4NAW B;  1IBX A;  1PGA A;  2PW9 A;  2KAC A;  1C78 A;  3IXS A;  3P63 A;  4ARI A;  4P6V F;  4CQN A;  2B76 B;  1VZ7 A;  2NTS A;  1E6E B;  4RFB A;  5LNK 1;  2KWD A;  1JWA D;  3AEE B;  1SBB B;  1BUI C;  3ABV B;  1UNS A;  3AE8 B;  4Q2J A;  1N62 A;  4YT0 B;  4H2A A;  4HKQ A;  2N0S B;  2BS3 B;  3AEG B;  2G1E A;  1JWS D;  1PUT A;  1FXA A;  4WAF A;  4RGM A;  1ZXH A;  2WXK A;  1ENF A;  3BVM A;  5BMG A;  1XLN A;  1QF6 A;  1YMH E;  1CZP A;  2SAK A;  1CK1 A;  1I4X A;  2VZK D;  2W55 A;  4OZB A;  1P7F A;  1UWM A;  2INP E;  1JAL A;  1L0X B;  3Q69 A;  4R3D A;  3ZQ4 A;  1IBX B;  4KKJ A;  3Q8B A;  3Q8F A;  4NAM A;  2WXQ A;  3E56 A;  1L6U A;  3AE9 B;  2I38 A;  2ONQ A;  1IGC A;  3H8H A;  1SJH D;  3P42 A;  1V1P B;  3R2T A;  4OHJ A;  1SE4 A;  4UDU C;  1VZ6 A;  1FMA D;  5TSS A;  3B2G A;  3BYT B;  2J52 A;  3UI3 A;  3CWI A;  2LEK A;  1MHH E;  2Y3A A;  2WS3 B;  2KAJ A;  2QEJ C;  2JZP A;  1ROE A;  2BS2 B;  1D4B A;  1FIQ A;  3HVD A;  1L4D B;  3AMZ A;  3VR9 B;  2YEP B;  3AED B;  1XLP A;  4N58 A;  2JWU A;  1N5X A;  3RFZ B;  5G5G A;  1OFF A;  1FO4 A;  2RMM A;  2W3R A;  4USA A;  2LHD A;  1KLG D;  1ZDV A;  4OVZ A;  4TSS A;  1MI0 A;  3MHZ A;  4L23 A;  4KX6 B;  5EE3 A;  4LTU A;  1V8C A;  1MPE A;  1D6E C;  4ZHP A;  4J3O D;  1HA5 A;  2WXM A;  1K52 A;  1YQ4 B;  1T6B X;  2ZW1 A;  3HUI A;  4XWW A;  1SEB D;  3EUB 2;  2PKO A;  2BYT A;  2E6X A;  4PT5 A;  1FNW A;  2QIL A;  4XDC A;  2KQ4 X;  2RDG A;  4TQ0 A;  2EKI A;  1TKE A;  1KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...