3NVZA

Crystal structure of bovine xanthine oxidase in complex with indole-3-aldehyde
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvzA01
2M56B 2MJDA 1L5PA 1AWDA 1J7AA 1ZXIA 3BIID 1ZOYB 1FXIA 1NEKB 2LEKA 2MJEA 2WDVB 2WU2B 2CU3A 3LB8C 4KX6B 2BS2B 4N59A 5MPOA 1RYJA 1DGJA 3NVWA 1FRRA 1SIJA 1FM0D 3P63A 4JWUC 1QF6A 4C7YA 1N5XA 3AB5A 1AYFA 3AEGB 2ACZB 2L52A 1QLBB 1PFDA 2OHFA 4WWMA 1NENB 4YSXB 1WYGA 2FBWB 1XLQA 2WQYB 1NYRA 1TKGA 1QT9A 1JW9D 5AUKA 1YQ4B 5EE0A 5H8YE 2H88B 2BT6A 1QOFA 1FXAA 1L6UA 3FC4A 2N0SB 3AEFB 4YSZB 1FRDA 3W9CB 2PKOA 2EKIA 1PUTA 2PIAA 4N58A 1N5WA 1QOAA 3AE4B 1N63A 1JWBD 3P4SB 5C3JB 2DBYA 2K22A 3AE6B 1CZPA 5H92C 3W5VB 2DWQA 2M19A 1KRHA 4US8A 5GXGB 1F0ZA 3ETRA 4WQMA 2W54A 3CWIA 2PVGC 3HVZA 2W3RA 3ABVB 4YT0B 2WP9B 1E9MA 1UWMA 1WGKA 2QJLA 2KAJA 1FFUA 3AE8B 4YTMB 1E6EB 3P4RB 4HRSA 1DOYA 1OFFA 3CIRB 5AUIA 4YTPB 3SFEB 2CJNA 1QOBA 1B9RA 2Y5CA 1JROA 2G1EA 3P4PB 2BS3B 1NI3A 5G5GA 1V8CA 3AEAB 3NVZA 1A70A 1VJKA 3EUB2 2K5PA 2L83A 1N62A 3AEDB 3HUIA 2MJ3A 2WLBA 1E0ZA 1TKYA 1KF6B 5C2TB 3B9JA 1IUEA 3L4PA 1XLOA 1FO4A 1WXQA 3AE7B 3B2GA 3KWLA 4P6VF 3AEBB 2WDRB 1ZP0B 3AECB 1DOIA 2K9XA 1TJEA 1RFKA 1VLBA 1ZUD2 3B2FA 4JWSC 3VR9B 1E7PB 3ZYYX 3P4QB 3DWMA 2W3SA 2H89B 4ZHOA 2BS4B 3NVVA 3AMZA 4N6EB 3RPFC 1JRPA 3WCQA 2CJOA 4YSYB 2QIEB 3DWGC 1QOGA 1R7SA 1YJIA 1E10A 4C7ZA 3SR6A 3P1MA 4ITKA 4ZHPA 1ROEA 2MH7A 5EE3A 3FAHA 1WRIA 1DOXA 1CJEA 2JX5A 4C80A 1RM6C 3AE5B 4ZOHC 1XLPA 5EE9A 1NVID 1JALA 1JWAD 1L6VA 3NRZA 3VR8B 1N61A 1GAQB 2B76B 3NS1A 1TYGB 1YJJA 1V97A 4YTNB 1FIQA 4US9A 3AEEB 5EE1A 2E3TA 1GPXA 3AE1B 1T3QA 5G5HA 1N60A 1EWYC 1YQ3B 3VRBB 2W55A 1L0VB 2HTME 4USAA 1FMAD 2KMMA 1SF0A 2PVOD 3VRAB 4HROA 3AM9A 4YXDB 3HRDD 1OQRA 3AE2B 3AN1A 4A9AA 2WU5B 3NVYA 2Q5WD 1FFVA 2WS3B 1J7CA 2JQRB 1VDVA 1JQ4A 3AV8A 1J7BA 1WWTA 3AE3B 4FXCA 1SB3C 1OQQA 2WDQB 1PDXA 4JX1C 3W5UB 4IDIA 1NYQA 3AE9B 3AH7A 3LXFA 1RWSA 1TKEA 1I7HA 3SFDB 2AX5A 4LTUA 1KFYB 1XLNA 1XO3A 3PO0A
chains in the Genus database with same CATH superfamily
1VJ5A 3O0FA 4KLEA 2WDVB 3TBLD 4EEWA 5IN7A 1IPGA 2ZG6A 2WHEA 3I28A 1RYJA 1ZGUB 1S8OA 1FRRA 3ZNHB 3UQ0A 1EU3A 3L3FX 4BDPA 3H7PB 4K3BA 4ZRIA 2JSVX 1WJ4A 2ACZB 4QIWF 3PMLA 4K7WA 1OEYA 4I2GA 7ICRA 1RXVA 3ZXVA 4GDKA 3K4GA 1ZQBA 3S6JA 1QT9A 2KMDA 2F2AB 5BMHA 3BVZA 2EELA 3FC4A 4PJ0U 5HR6A 3AEFB 4YSZB 3BQ7A 5ALVA 3EECA 2K6QA 5HMLA 2F76X 2MRPA 2EKIA 3RB4A 1ZQRA 2NRZA 3QE9Y 1SL0A 2PIAA 2OJWA 1ZE3D 4JE3B 4HWIB 4G11A 2Z7JA 1P7EA 5H2FU 1XCQL 4UBCA 4Z6EA 2MBOA 2J53A 2W54A 3Q8RB 1PQSA 3JPQA 3MDAA 3HVZA 2XVTA 2BQRA 4YXMA 1WWVA 1OFFA 1B9RA 3QU5A 4FO6A 1GUAB 2ODGA 2JZ3B 2SEBD 2LVQA 1RLFA 2AQ2B 1Z4OA 3AEDB 2Y9TA 4NZLB 4OVVA 1P3QU 1KF6B 3L0WB 3M8RA 8ICUA 1SGGA 1JN3A 4KLQA 4F1SA 3EA6A 4CYEA 2WDRB 4RUCA 1S0NA 3KBBA 4OJ6A 1SZPA 5AK3A 2W3SA 2H89B 2F44A 4KSLC 2VANA 2K0PA 3FILB 1UZXB 1SSNA 4R8UA 2DKXA 1X9XA 2CXYA 2KANA 8ICCA 2LUMA 3NZUA 4EZLA 1E10A 3SR6A 1ZD4A 3QUQA 2ZUDA 2KFKB 1RXWA 1SXDA 2WGSA 2ZJ8A 2HHQA 2IOFA 4XC2A 4BBNF 1FD6A 3RFZB 1ECWA 1CMXB 1PGBA 1GNUA 4DL7A 5AZFA 3N20C 2RP5A 3C1YA 2RMMA 9ICLA 2BQQA 2XK5B 1ZQHA 2YTUA 2WXPA 4RGNA 4DSIA 4ZRPA 1ZQDA 1VD2A 1S76D 2UWQA 4DQIA 4ECTA 2KVCA 9ICGA 2W9NA 3VRAB 2NCNA 2R2OA 3AE2B 1KFDA 4PK1A 1S77D 2N1VA 3PW7A 3RH4A 3T9LA 4XWWA 5KG0A 1YQBA 2Y5PA 1KEJA 4DF4A 5B66U 3GILA 2WXFA 3QNMA 3SEIA 4C4TA 3AE3B 2HJ8A 4RF1A 3AU2A 2KJ8A 4EEKA 2IZVB 5KT6A 4BWJA 1UA0A 1KFYB 3L13A 2CR5A 2KFKA 1L3TA 1ZOYB 2Q0ZX 2BCSA 3HM6X 2CU3A 1Z4NA 9ICOA 1ISNA 3EHVA 2G4DB 3I9V1 5CX3A 3BS5A 5L1MA 4BOZB 2MWSB 4ZDVA 3SHQA 1B0XA 2NTTA 1DYQA 2LJ5A 3BK1A 1PFDA 1ZQLA 2OHFA 1KDHA 1VZ7A 2KVRA 3ML8A 4YSXB 1MN8A 3DEEA 1S9FA 1TAUA 4IUMB 3F53A 3MC9A 3R66C 1H38A 3RZWC 4QZ9A 3GE3C 4LNNA 2F3NA 2XEWA 3NTUA 5F3XB 2JT4B 3C0RB 1Z1VA 1V9PA 3HK0A 4Y2QA 1TS4A 4G50A 2Y9UA 4HYKA 3NS8A 3UI3A 4EYIB 4KGTA 2GBKA 3UXNA 4PGQA 1LKYB 2YX8A 1J0GA 3EC8A 4CGZA 3DHGC 2KVZA 2XN9C 3B1LX 2CU1A 3F2BA 2G0AA 4RF0A 5ALSA 4NL9A 1B22A 5KT2A 3QXGA 1P7FA 1NK9A 3BY4B 2L0TA 4CQNA 5C5JA 1S0VA 1FPYA 2BHNA 4R3DA 2RHFA 2INCC 1ZDVA 2WP9B 3TARA 2ZTDA 8ICLA 1FFUA 4PHEA 1WRDB 4OZCA 2EMSA 1E8XA 3CIRB 3KQ4A 1WYWB 5DPTA 1KN5A 3M9NB 2IO2B 2C2EA 2HOIA 3T3FA 8ICBA 3UIOB 2BS3B 4UW9A 5KFZA 4MM3A 1C9FA 1ZD3A 5KG4A 2CRXA 1EWCA 2K6DB 2MP2A 4B9NA 4ELUA 4KDLB 4HKQA 9ICWA 2KZMA 5C2TB 4J9RA 4IM3A 3TEWA 4XE0A 3B2GA 4W9KA 5HKHA 1L3UA 4Z6FA 4WJ3B 3MDCA 4LZDA 3SU8X 4YR0A 2YB1A 1DK2A 4DOAA 1SKWA 3BYTB 2GH1A 3DWGC 2Z0DB 3Q8PB 4K1RB 3BWUD 4OW0A 5EE3A 2XO7A 3RR8A 3FAHA 4CRXA 2EQYA 4TQRA 1X9WA 1XLPA 1IYFA 4FADA 1UHUA 4ECQA 4CF3A 1V86A 3NS1A 1X9MA 3V6KA 1S1QB 2L05A 5AK4A 1ET6A 2QCZA 4YCXA 2KACA 4KN4A 4EX7A 1K50A 3P42A 3QJZA 4F4YA 3RB6A 1YQ3B 4C8OA 9ICSA 2PJHA 2FI1A 3KHGA 3WK9A 2O6VB 4EBCA 4MF2A 2IHMA 2IO0B 2HVHA 3IV6A 4QJFB 4IC7B 4JV0A 3A9KB 2WU5B 1IGDA 2L32A 5HHDG 1J2NA 1EO6A 3G6YA 1S3SG 2WX0A 2LKYA 4HJGE 4FXCA 3ZNZB 5C1ZA 1OQQA 5ALMA 4J9NA 1FEHA 8ICRA 4JB3A 4Q8EA 5KFAA 4NY8A 3N7SC 2QC8A 3PV1A 1I4GA 3WK5A 2LEKA 5DKWA 1ZJMA 3AL0B 1YZ7A 4BAXA 5L1IA 3D2QA 2DYBA 2L52A 5KL8B 2UVUA 2DYMA 5J8YC 2NMQA 1TV9A 3RYTA 2YVCA 4QAYA 1LB2B 2HCFA 4OZBA 4WJQA 2E8OA 3EW9A 1WY8A 4NM1A 2Z59B 4UDUC 2LM4A 2N9XA 5J2FA 2K89A 2D3GA 1WH3A 2ZJDA 3H4DA 2L7RA 4QWBA 2FMPA 3D2NA 3C2KA 1YIWA 4U7CA 1ZQMA 4HCPB 4M0WB 4ECYA 2HD5B 2XGPA 5GXGB 2XCPA 4KX5A 1L2NA 3M1YA 7ICGA 2QSDA 2JYEA 3CWIA 2W82A 1D8YA 2HOQA 1H4RA 2QMTA 1A0PA 4KIKB 1MFWA 3RUIB 3PX0A 5HR7A 2KOXA 4PGYA 3H8MA 1ZD5A 2E8NA 3H8SA 3MR3A 4U6PA 1T3NA 4HXDA 5IIIA 2Y5CA 1JROA 1ZOLA 3PR5B 4EENA 1JMLA 2LASA 1L7NA 4ELVA 1TVAA 3D2SA 3V72A 3Q14C 4PS7A 1LKYA 3UF8A 3ZQ4A 5AIAA 3TANA 2PPHA 1E0ZA 3SQIA 1D3ZA 4DHZB 2BKEA 1JXEA 1FCLA 4ED6A 4DSEA 4J6IA 4AJWA 1QSYA 2J6UA 3PREA 1QSLA 5D3DA 1I35A 2L00B 3V7JA 2HVIA 1TS3A 2C7NB 3KZXA 3CRXA 1X9SA 2KK0A 5AKXA 4O5EA 4LJPB 3BS5B 3UXPA 2DLBA 1ZKHA 2MH7A 3TSSA 3V6CB 1ZQQA 2K4PA 1NJZA 1XT9B 2JX5A 2LPEA 1F9JA 2DX5B 2JWUA 2K25A 3I1YA 2N7JA 4NJCA 1WGGA 3C8YA 4IR1A 1DGSA 3ZXRA 3NRZA 4AWJA 2F1HA 1MG8A 3KLSX 3C19A 2I38A 4MGYE 4A8EA 3PW2A 5EWGA 4IWPA 3WK4A 1BPZA 5L95C 3A9JA 1U4BA 1YMHE 2KD1A 3KOOA 4QNLA 1OQRA 4QZBA 4IOIE 2INPE 3QZ7A 3ZUNA 1PK1A 4RGMA 5KG6A 3NVYA 1NK5A 5CHWA 2JR5A 2KNBA 3RJJA 4QZFA 2NO4A 3N28A 1PDXA 2WF6A 2DPIA 2Z8LA 2B0CA 4GC7A 2AX5A 1KTQA 1TTNA 3RNGC 2AYOB 1FNWA 2HSZA 3SAFA 1COKA 1F52A 2ESEA 4DQOC 1DGJA 4YD2A 3NGDA 3N1ZC 8ICHA 5J0PA 4KGSA 2FUHB 4RQNA 4OO1J 5L1KA 3JW0X 1BGXT 3QU2A 3N97B 1L4ZB 1EXNA 5J0YA 1WGYA 3MJ5A 5AI9A 3PGEA 3WU2U 2WXLA 3U26A 1XSLA 3DBLB 1P7DA 2D2QA 5AM3A 1KJTA 4TUSA 4C00A 3GIIA 2H3QA 1N5WA 2SAKA 4K7UA 1HTQA 5DDYA 5AM4A 4BXOA 3IAM1 1U4AA 2LVOA 5AICA 2MRLA 5KFOA 1GC6A 4DL2A 2QB1A 1RFAA 1OGWA 3H4BA 2AGPA 4KMOB 3ABVB 5TR5A 7ICNA 2O6VA 1E6EB 4ZH4A 1V6EA 2LHTA 3LVWA 1LV5A 2A4ZA 4DOBA 4MF8A 2KX3A 2BQUA 4RU9A 1XO0A 2J6SA 4RFBA 2FUG1 5G2NA 2KDMA 2WLBA 4E3CA 3UMBA 4LCDE 4K3CA 3GV7B 4ED1A 2KJHB 3L4PA 2YQEA 1RAXA 1XLOA 4W9GA 3KWLA 2R8IA 4TURA 2W7PA 1PVRA 3W1SC 1WE6A 1VLBA 5J2JA 2N9EB 3SV4A 2MX2A 1UCVA 5BMIA 1XEEA 4PGXA 2MSED 3NASA 3C23A 4GU2A 2KV2A 4O3SA 2CJOA 4KZCA 3NUQA 2KNJA 1JWMD 3FYHA 1WJNA 4J3OD 4OJPA 1T0SC 2BYEA 2NS5A 3OWEB 1DOXA 2GB1A 2NRTA 4ZOHC 1XO1A 5ALFA 2D5GA 5EE9A 2AXTU 1NVID 2HBMA 4DL5A 2HE7A 4KLJA 2BYVE 3APDA 2N7DA 1T3QA 1SV0C 5TISU 3VC8A 3PRPB 1AARA 2CHWA 3GU3A 1SF0A 5FP0A 3R7RA 3WAOA 1WSPA 5KFJA 4X57B 3SENA 4KLFA 2G3QB 2N4FA 9ICKA 3V7KA 2W9AA 4GFJA 5BPCA 1C7YA 2OOBB 5G55A 4JLCA 2JQRB 1WXVA 2B21A 2CPRA 2JH1A 2KHQA 1HUZA 4RQ5A 2KC2A 4EKUA 2M0NA 1SB3C 4HAIA 2JEGA 1RZTA 2NPTA 4XYCA 3PHXB 4I2IA 1TAMA 3I63C 5AKIA 1ZDXA 5IIKA 1TJEA 1AN8A 1BNOA 3KHHA 3UQ2A 1RG6A 3BIID 8ICZA 4IQUA 2ASDA 1CEZA 4Y2XA 3N3KB 4YXJA 1SIJA 3P63A 4DHJB 4ECSA 2ZPNA 5D7GA 5KFWA 3RN9C 4F5PA 2LYAA 3CSTA 4FN2A 2JF5A 5KFVA 2KMCA 1S10A 1KFTA 1SWVA 2WQYB 1D6EC 2FCNA 2WF8A 5EE0A 2NO5A 2H88B 1WE7A 9ICIA 2N0SB 3LDZE 2WF7A 2YMMA 2FCQA 4RNOA 1CQVA 3KKAC 2GBMA 2JY6A 4Q45A 1ACCA 5IIOA 1JWBD 2ZJ5A 3TL5A 9ICNA 1WG8A 2HBKA 2WXIA 3ZLZA 3Q8AA 1U47A 1ED1A 3QU4A 5K4LA 4KLSA 2ZTCA 2WXHA 3AU5A 2R2QA 2PKEA 4K4IA 2LM1A 3MP9A 4ZRJA 1SXEA 2Y0SF 2R8HA 1UWMA 2KAJA 3E9SA 4FJYA 4F2RA 2PMZF 5KFRA 4DLGA 2QB0A 2BCQA 1SIFA 4QW9A 5E6PA 1KLVA 3R9KA 1NI3A 4QIWC 2FMSA 2N9LA 3A1QB 3KKAA 1Y56A 3X0WA 1KOTA 2LD9A 4ICUA 2H3IA 3TUOA 5HP4A 4LVSA 2VA2A 1LVHA 2KKVA 4GC6A 3QK0A 4O3QA 3VH4B 4FFDA 3AEBB 4MH0E 3CSFA 2IGDA 1ZQ1C 2D10A 3DWMA 1J2MA 3GIKA 3QYPA 2ZNVB 4OJ5A 2UVRA 3RPFC 1JRPA 2W9MA 3H1UA 3EWAA 2FIDA 2AQ4A 3H7IA 3P1MA 3K1RB 8ICWA 3QEAZ 2MP2B 4EZ6A 1BXTA 2ON8A 3AQEA 5HNKA 4A6QA 1BUIC 2FLLA 1L5UA 1T5XD 5KFBA 4FS2A 1TYGB 5IILA 4DL6A 3BVMA 4F7ZA 8ICAA 3IRUA 2NRXA 2W55A 4DHJD 4UQGA 5B5EU 3T8MA 5L83A 4P0PB 4NAWB 2JRIB 2IA6A 3ZD8A 1F2RI 1WWUA 3PO5A 1QILA 3X23A 4K4GA 4OZAA 1SZHA 5DPRA 5AI8A 7ICSA 1XD3B 2WAQC 1U45A 1ZQWA 2IDYA 4HPPA 3AUOA 1SV0A 2VZKD 4PL1A 1YJ1A 1IBXA 3PMNA 1NYQA 3CP8A 2E1EA 1GG3A 1PK3A 1OQYA 3ZO5B 5EWFA 2M56B 2RPVA 5ALWA 1J7AA 2KJ6A 4NPNA 5JRTA 5ALTA 2LBOA 1LM8B 4BKGA 2IGGA 4URKA 4KLHA 2FE8A 3IFWB 2QEJC 5IIMA 5J2EA 1BPXA 4KX3A 2AQ1B 4OJLA 2E1FA 1Z19A 4E0DA 2KFZA 1WYGA 2G07A 2LRWA 3H7SA 3WIMA 5JHBA 5D6JB 3KH0A 5L1LA 2DZJA 4M0WA 2DUYA 2H3ZA 2WAQF 2WX1A 1HUOA 3U52E 1P0RA 4AQ7A 3T3OA 4IRKA 4I27A 5D94A 4M8NA 2YB4A 5KFLA 5J2HA 5AM1A 1QOAA 3RJHA 4I29A 4QZ8A 3MR5A 1T0QC 3F2CA 1STEA 4KLLA 4DFPA 2RDGA 2W03A 7ICIA 2OYYA 2G45B 3WAPA 4XUSA 3PRZA 2JHDA 2KYWA 4RNNA 2AHOB 4PS3A 5KTQA 4O3RA 2KDEB 3EZ5A 5AK5A 4B95A 2W3RA 3V6JA 3DBRB 2KJ5A 4DQQA 2BPFA 4LLGM 5AUIA 1IGCA 2M17A 1JRUA 5ALRA 3ONSA 5G5GA 1V8CA 4WH4A 3RJKA 2LXAA 2KWUB 3SMVA 1VJKA 3RAXA 4F4XA 1M4VA 3I3TB 3EUB2 2K5PA 2L83A 4GSWA 5CEHA 2EMTA 4R65A 2BPGA 1F5SA 4F93B 4JPSA 4ICVA 2KLCA 5ALGA 5ALIA 2X8XX 1RFKA 4RGTA 2GBJA 3IHQB 3ZDTA 3Q69A 4XZ4A 4ZYSA 3TKAA 1HXYD 4JWMA 3OJ3A 2GLSA 3GQCA 4P16A 1TS5A 5AM0A 5ALNA 3SEBA 3WANA 4EOYA 3V7LA 5J0OA 2JRZA 1WGRA 2OCEA 1IV8A 2WHIA 2GLEA 2HW3A 4TQ0A 2VKQA 4Z6DA 1ZQPA 4B0MA 1CJEA 4X5VA 4DFJA 3ENEA 4B6WA 4QZAA 3BZDB 2UVVA 1KRPA 2RSUA 3NY5A 4KGRA 2KICA 1B1ZA 1L3SA 2B3AA 1JWAD 2C7HA 2KKCA 3SV3A 2NV3A 3AU6A 1HJPA 1N6ZA 2BBCA 5HHHA 4YTNB 3R2TA 3RRGA 1LQBA 3BQ2A 2K39A 1UT5A 3KUCB 4A20A 3LJ3A 2KMMA 1NKBA 3GZNI 1ZQGA 3HM3A 3O65B 3HRDD 3WK6A 1CRXA 3RJGA 1ZQEA 4LK0M 1IIPA 2M0XA 4BKTA 1UQVA 2D11A 1JMSA 2WXRA 5FR6A 4EZ9A 2LWPA 3FKYA 4DL3A 7ICJA 4E74A 4PYUA 4YG2A 4YR3A 1MQ3A 1ZQIA 2VJ4A 2DHZA 1T4GA 3W5UB 5J2IA 1ZRNA 4MH8A 1WCNA 2FBWB 4WAFA 1L7OA 2JRHA 1WM3A 1AWDA 4P1BC 1WX9A 4KV2A 5GMVA 3ZNGC 1SBBB 2MQJA 2JEFA 4WWNA 2RQ5A 4GDKB 8ICGA 3JPRA 5CJ7A 4DO9A 3AU4A 4F5RA 2KJ9A 2BDUA 3L5KA 4OCZA 4KLMA 1XLQA 2BB6A 1TKGA 3R3MA 2BPSA 5HG2A 1JW9D 4JV1A 2BT6A 3IG8A 4HDOA 2LHEA 4B0EA 3GOEA 1D8LA 3HJEA 1BPEA 4XWTA 5CA7A 4MM3B 4ECXA 4M8MA 3SZ2A 1C4PA 1EU4A 1PUTA 1Q3UA 2BYFA 2DZKA 4DFMA 2FNJB 4N58A 2JVCA 3M8SA 4II2B 3N7PD 1H8CA 4QZCA 2JZBB 2HHVA 4O5CA 2G9HD 4F72A 5J29A 4ECRA 1QZEA 2W9BA 2IO1B 2OM6A 4RPZA 1F2RC 4GN1A 3U7ZA 2KG5A 2G08A 3WALA 2C5LC 2AU0A 3ETRA 2B6GA 2I5HA 4MEYA 4UAUA 3OG5A 4GB9A 3OTQA 1SE9A 3ZJUA 1WUDA 2ZIVA 4IRCA 1WXMA 1FNVA 4CO7A 4BX9C 3B0XA 4RZRA 2KTRA 2KOBA 5BOLA 1ZD2P 1SKRA 4GDLA 4F5NA 4NJ6A 3PW5A 3MHZA 3DVNU 3OPXA 2JMGA 1X6JA 1BPDA 4JWNA 1V5OA 2C7MB 2LGDA 4NJ7A 3IM1A 4WWOA 4TSSA 2JH7A 1Q5WB 2VIXA 4HKZE 3QWZB 8ICPA 1JI7A 4LNOA 3KVFB 4WIPA 4UB3A 1J19A 4MJSB 4C4SA 2KJRA 1K1QA 4FA6A 2BR0A 4P1CC 2W9CB 3ZYYX 3N9YC 2XY5A 3BINA 2RDBC 2I1QA 4O1NA 4J9PA 3QU9A 2DQNB 3KHLA 4B9VA 2XNAC 3IVFA 5FR3A 2AGOA 4Y2YA 2ZEQA 4IM0A 1YN5A 1KLNA 1WRIA 3OHBA 2P66A 3H9DA 4II3B 2ASJA 1NOMA 4XQ8A 5BOMA 3U7DA 1RRBA 4ED2A 2GO7A 4UAZA 1XNSA 3AEVA 4HPLB 5DBAA 2KZZA 2YEPF 8ICVA 5KAIU 1V1PA 3VUWA 3PSIA 2M8SA 5HI1A 4M47A 4YWGG 2LUEA 1NK0A 5AKYA 4DOCA 4TV3A 1UD7A 2HTHA 4C8NA 3RR7A 4F3OA 1EUVB 1LXDA 1UT8A 2EAPA 4F4KA 1V85A 2KE7A 2HMXA 3OJ4B 1SGHA 2IPKD 4KLTA 4FZLA 2IBKA 1JX4A 3ZDMC 4YP3A 2KX0A 4JX1C 4EZJA 4KN7A 3JSVB 2QARB 3SD5A 4MGIE 3GIJA 4UB6U 4LNFA 2KP7A 1WZ3A 1WIAA 2MCNB 5D46A 3M6ZA 1M6YA 5L1JA 3QCAA 1CI4A 3KHRA 5IO9A 2WU2B 4YR2A 5KFFA 4R8UB 4ECZA 3ALRA 5JUMA 3UINB 2K8BB 4IG7B 5LXHA 5MPOA 5ALZA 4JWUC 1FM0D 1Q1OA 5D4BA 1Z5SB 4LDTD 7ICUA 3ZVVA 2XY7A 1NKEA 3TADC 2BWFA 4A90A 3ZDEA 4JV2A 4C4VA 1TE2A 2DKZA 3RAQA 2JEJA 4G3IA 5C23A 3AI5A 4ZYNA 2W9CA 4E71A 2ZNVC 2X38A 4PHAA 4ECUA 1T6BX 5HMMA 3BJYA 4QWEA 2PFQA 3IDWA 1FCCC 4G0NB 1FRDA 1JWUD 4PPXA 3W9CB 3DBHB 3C21A 2PTLA 2KKPA 2HOFA 2DENB 3GE8C 3Q3JA 4F8CB 4PZOA 2IGHA 3BDPA 4QZEA 2ZZPB 4PZNA 3GV5B 3W5VB 3JVZX 3N1YC 1CK1A 1NKCA 5TSSA 4FULA 3TAQA 3E0FA 3Q3MC 1E9MA 1WGKA 4Q44A 2G5HB 2G5IB 4MT5A 4YTPB 5DLGA 3HPOA 4P0QA 2VH1A 2EANA 2MHJA 2JEIA 2Y3AA 4ACOA 1A70A 3Q2AC 4BBNC 3C5FA 3IHPC 1ET9A 4FHJA 2ZTEA 2BGFA 4UB5A 2HBLA 4ASWC 3UMCA 3AE7B 2ZCBA 1E8YA 4M9HA 8ICQA 3VUYA 1DOIA 1D5XC 3ZNID 4TKNA 1SJED 1YD8U 3RNAC 1UBIA 2E8MA 2PE9A 2ZIWA 2NRVA 3CF6E 4ECVA 1U9LA 3MGVA 5CRXA 8ICSA 3NUHB 1C3TA 1ZRMA 1DRGA 2UU7A 2D3CA 1KM7A 5J0SA 5DLFA 4FBUA 2BTEA 4AP4C 4Y2PA 3MHSD 4D2KA 1ZQSA 2IOHA 1ZQYA 3F2DA 4MELA 5EE1A 2JZZA 3RBDA 1MJDA 1JWSD 3VRBB 3MGIA 3OGUA 5T14A 1L0VB 3VTWA 1NZBA 5CTRC 3BZCA 4DDGD 4B9LA 3ZDCA 4JK1A 4ED7A 4O3MA 2K4HA 2GMIC 3R8BA 3ZTDA 3UPQA 4ED8A 9ICJA 2K8HA 3NZ3A 1G6JA 2AGQA 2K4EA 9ICQA 4F92B 2HHXA 1NK6A 1IG6A 1TZOA 4PHDA 3TEXA 4DHZE 3AH7A 2K1FA 4AJYB 5BMGA 2DPJA 2O2VA 1ZQZA 2JWZA 2N9PC 4B9UA 4NLZA 4ANXA 1FXIA 1NEKB 3RNFC 1K52A 5DBBA 2BS2B 4XA5A 3NVWA 4QWCA 4F5OA 1XU4A 9ICAA 3ETLA 3QZ8A 3JPTA 1UGMA 2W7OA 4C4VB 3PS6A 4TUQA 2V3PA 1V2YA 2NRWA 2PMZC 2G09A 1DXSA 2YMLA 2F1JA 4M00A 2NYVA 3D6JA 2N1RA 5DDMA 5LLIA 1PGAA 1RYUA 4QWDA 8ICOA 4RT3A 2OEHA 4M01A 3A4RA 4C8KA 1ENFA 1E7UA 2M0AA 4DS4A 5F9LA 4ECWA 2DWQA 3OAWA 3DBRI 4HCNB 1YN3A 4XDDA 2KHWB 4JIOU 3RNCC 3W2DA 2GWSA 4F5QA 4RM8A 4YT0B 4O3OA 2J7QB 5AI5A 1F1HA 4KLIA 1MI0A 3V60A 5DQHA 2HHWA 8ICJA 4REZA 2A3VA 1S97A 1A5RA 3LYSA 3QU7A 3K9OB 2H3VA 5KL1B 3BQ1A 4NNJB 1PZNA 4F50A 3UM9A 3DBLI 4YMMA 3C29A 4EBEA 3WKDA 3PO4A 2E6XA 3IT4B 4P6VF 2V4LA 3T5JA 3DOWA 3IXSA 2KZRA 3VH3B 3AECB 2MUTB 1X40A 2I1JA 4WWPA 1WGHA 3Q3NC 5JXVA 3DQVA 5GTIU 4ZHOA 2LVPA 4N6EB 4Y2RA 3TFRA 3Q8MA 3UGBB 1LFDA 4J9MA 1YJIA 5JU5A 5ALQA 1PVPA 1R7SA 4TQ1A 2RR9A 2KSOB 7ICTA 4XDCA 3PY8A 3V3XA 1MC8A 1RM6C 5E6OA 5KT4A 2CKHB 1C4CA 1T8EA 4LJXA 1ZETA 4IWOA 1JUDA 5AK6A 3OJSA 1N61A 1C76A 2PW9A 1FIQA 4US9A 3KD3A 2Z0EB 3GDXA 3TQ1A 4R63A 1NJWA 2ZIXB 5JZEB 2LGIA 1BT0A 4USAA 2KN5A 2BF8B 2EKEC 1S0OA 3RI7C 2KN4A 1O03A 5E79U 3NJTA 5LNK1 3BK2A 5D49A 3SDLC 4KLGA 3QAQA 4KLOA 1HZ5A 1F44A 1EF1A 1B4FA 1N56A 2Q5WD 4UB1A 3MC0B 1VDVA 4J9SA 1JQ4A 2W9BB 1SKSA 1R4NI 2J0KA 4FBTA 2LGYA 2JZBA 4R66A 1GOZA 4JQWC 2FPLA 2RDHA 1TKEA 5J2GA 3PZPA 3SFDB 3WK7A 2MU2A 3N4MB 3PNCA 1XLNA 2KSOA 1E90A 3WKAA 3F5EA 2P6UA 1L0XB 4MFCA 5ALUA 5J8YA 1XC9A 2YMQA 3HIZA 3QC8B 3LVVA 4FJVB 5DB6A 3OSPA 3ICXA 3HW8A 1Z00B 2A1AA 5AZGA 1QLBB 2LYBA 5BYQA 1L7MA 4O3PA 3U2SC 4TQSA 7ICFA 3A0HU 5DG7A 1YX6B 2P35A 2PE6B 4LNIA 3SAHA 2BQ3A 4I2FA 3LK9A 3T79A 1GB1A 2A1JA 1I4RA 4ANUA 5CP2A 1IXRA 5DGBA 1WMHA 4DXAB 1XWLA 4C8MA 4DK5A 2K22A 3AE6B 5H92C 4YQWA 5KG7A 3LWMA 2M19A 3JPPA 2D3BA 2I2YA 4YL8A 4WQMA 7ICMA 2CS4A 3ECIA 2V4QA 2HDEA 3M62B 2FPMA 1URJA 2D8CA 2D07B 2D3AA 4NWIA 5AI0A 2OH2A 1V1PB 4FHKA 4GXJA 4ANWA 3DVNV 4RQ3A 4M0AA 5F9NA 1C20A 1UA1A 1KKXA 1WR1A 3H8WA 1XS9D 3NG0A 2L76A 3J9CA 2DAJA 2V1YA 2A19A 4BJQA 4TMAB 4RUAA 4G9BA 1P98A 3DVGY 2PLPA 4KKJA 5CHFA 1WZ0A 3URYA 4P4OA 2QKQA 3JPSA 1ZQJA 2KHVA 1HEKA 1TY0A 3PSEB 4IR9A 4JWSC 1QQ6A 9ICPA 4C0ZA 1J97A 4CDGA 2V4RA 2XBBC 4A3PA 5KFMA 3FM9A 3DDHA 1R4MB 2ZCCA 3MFHA 2WXNA 3M3JA 4BUGA 1TFRA 4FE3A 2R8GA 4I6NB 3KZIU 4DWFA 1UPHA 4LZGA 4QW8A 4ITKA 2NBWB 3B08A 2R18A 2PFPA 5C0YA 1ZQNA 2BCUA 3ONNA 3GS2A 1Q3VA 4AS1A 4UB4A 3IT6B 1MSWD 5ALOA 3VHTC 3MFIA 3G6VA 1L7PA 3KUZA 3E58A 4DL4A 5IOIA 2ONQA 4DEZA 3CMMB 4CF4A 2JXXA 1D8BA 3AE1B 2ZIUA 4B9KA 4I2DA 1K51A 2JU6X 3MBYA 2DNFA 4B9TA 4OHJA 3ZGZA 4JMUA 2IY1B 3GZNB 3DHHC 2H3FA 2ZXHA 1QKZA 2GRIA 5CHVC 2M4NA 8ICMA 3I5JC 1N48A 1TS2A 4YD1A 2KWDA 3WK8A 3VTVA 5J0UA 4MFAA 2KWVB 1OW5A 2L1AA 8ICTA 4NLCA 1XSPA 2Q4TA 3RNBC 4NV0A 1RYSA 2KXJA 4N59A 3LB8C 4QZGA 3B0YA 3HHMA 3KFUF 2E8PA 4J9QA 3W1SA 5ALHA 1O08A 3VXWA 4EZKA 4QZHA 4UBBA 4I28A 2JV3A 3PR4A 5KFCA 3Q8FA 1TAQA 2XIDA 2IBIB 3PW4A 3HILA 4IQVA 2G06A 4YMOA 2WDTB 3NOBA 3Q8EA 3DVGX 1L6UA 4HDQA 1NBFC 3IBEA 2C22A 3SI8A 2DGZA 2PKOA 5FK9C 7ICOA 3ZJVA 4DSKA 5TZVA 4P0QB 1ZQVA 3OLMD 3P4SB 2ICIA 4N9F4 3LDAA 1IM4A 2XGQA 2IY0B 2BWES 4ZRQA 3PX4A 2Y1IA 1Q8KA 5AKJA 4YMNA 2QILA 1F0ZA 3BS7A 4M9JA 1RYRA 2KDBA 2NVUI 3EGRA 3A0BU 8ICEA 3AE8B 2XI9A 3P4RB 2I1KA 4RQ8A 2AL6A 3T5HA 3PZ8A 4Y2JA 3IG3A 3P4PB 4F71A 5IKCM 5KFNA 5AHXA 3GV8B 4CCHA 2MBQA 1ZQXA 3AEAB 2K8CB 4TUUA 3I57A 4M9NA 2LYHA 5J0QA 4PS8A 4QWAA 2LFIA 3N7RC 2IMWP 4ED0A 3GFKB 1V38A 1ZP0B 4NQKE 3WKBA 3EYZA 2Y0SC 1ZQKA 4BVUC 2RGFA 4DXFA 4WAAA 2AJQA 1V81A 1X42A 2IOFK 3TFSA 1NZPA 5KFQA 2V4IB 1BPBA 1CUKA 4UARA 2MBHA 1Z00A 2OWOA 1KSPA 2EH9A 1QOGA 4KLDA 4DCCA 4WJPA 2I9GA 3RNEC 3IP4B 4ICAA 3AE5B 4OVZA 2KDFB 2QARA 3ZI4A 2NBVB 1WXSA 1JALA 4BWMA 4M04A 5J17A 3VQIA 3VR8B 4GMVA 1KBUA 1X2IA 7ICLA 1PUZA 2VZKB 3JYUA 2QB0B 1N60A 2RRDA 3TAPA 3WA0A 2KFJA 1Z3EB 4HROA 3KUDB 4B6JA 4EELA 1EM7A 5IIJA 5J0WA 8ICXA 2KT7A 4AP9A 1KLUD 3RJFA 2MBBB 1SWWA 3H0LB 2OXOA 1WR6E 2DZMA 1L0YB 3AV8A 3A4SC 4M6WB 3QA8A 1TZ1A 3WAMA 3RB0A 2AL3A 4O3NA 2INNE 3IN5A 2LZ6A 2W8LA 4JGHB 2DF4B 4UATA 1JXLA 3PZDA 1RWSA 5J2KA 3Q8SB 4BFRA 4C8LA 1E8ZA 1ZQOA 4K7SA 1QLNA 1DK3A 3HWTA 5DQIA 1XO3A 2GI9A 1WX8A 3ALBA 4DFDA 2PMVA 2RDIA 8ICYA 3PLVA 1J8CA 1HE8A 5ALKA 3C2LA 1N5XA 4OD0A 1TK5A 4UAWA 3RCZA 2BB5A 9ICTA 2REXA 3PZ7A 1Q10A 2OEDA 4RT2A 2L3ZA 1YX5B 2MUTA 1WI0A 1L3VA 2C28A 2MEKA 1SEBD 1S5LU 4BZAA 1XSNA 2NR2A 1I4QA 1HTOA 1OUQA 1KTKA 4OVUA 2C9WB 3CW2C 4DLEA 2YEPB 2KQ7A 2KLGA 4M6WA 3MR2A 5DGAA 4WQOB 2PFOA 4GXIA 2L0FA 4P2HA 4NLBA 4BKSD 1CZPA 4H2AA 2NBUA 2VRRB 2LI6A 2WWZA 4PH5A 4P0PA 2PVGC 4NAWA 1D4BA 4IM2A 4NQLB 1Y8RC 2KTFA 4NL9C 3RD2A 4GIBA 2QJLA 4RPXA 3PTFC 1DOYA 3V05A 2ZIUB 1QOBA 1V5TA 3RB3A 1SE4A 5E6NA 2KIVA 3VTUA 3MJWA 1L4DB 3M9MB 2JYTA 4W9HA 3M9OB 1NK4A 4DWIA 4EX6A 2KIWA 2LMCA 1B43A 4GIVA 1WXQA 3DPDA 4DQRA 1U48A 5JHAA 4KLUA 3P4QB 2FCSA 2YN4A 5ALJA 2FE9A 4CE6A 4PHPA 1LGRA 1GB4A 2BCRA 5JTIA 2RLTA 5KFKA 1EF5A 1WXAA 2UYZB 3V6HA 4UAYA 5EOZA 1KQQA 2BDPA 1A77A 4NJ8A 3PW0A 5L9XA 2ASQA 3HT3A 2J42A 4C80A 3H8HA 3VDZA 5KT7A 2A5UA 2YLMA 4RQ6A 3H6NA 4ELTA 2K8CA 4QZDA 2LGXA 2ZUCA 1VR9A 3QUTA 4RQMA 2AQ3B 5KFTA 3DHIC 1I4HA 1Y88A 3N30A 3QEBZ 4ANVA 2VJ5A 1AROP 3UMGA 2V0GA 3P2BA 3L54A 2EAMA 5J2BA 2LGSA 4A55A 3BQ0A 3T5LA 5J0TA 1FMAD 3RZFA 4P7IA 1FXTB 3VAWA 3BZKA 3ED5A 4C56C 1QQ7A 2LMRA 2XY6A 1V80A 3MTNB 1J7CA 1Q0WB 3UIPB 4IQWA 2BPCA 3L10B 1TBEA 4DSFA 3H8JA 1D9DA 4Q8FA 1WMHB 5ALEA 3PSTA 4IDIA 8ICIA 2DFLA 3AE9B 4KMUA 5AKEA 3J81j 2K4IA 4C4RA 2KK8A 4LTUA 2BKRB 1MG4A 4A9AA 4Q43A 2FIFA 1ZXIA 2JZPA 3VFKA 2ASLA 2AEHA 4W9FA 8ICFA 4Z6CA 2D3DA 1XXGA 1ESFA 4IW0A 1A6SA 1RQNA 1K53A 4UAVA 1AYFA 3O13A 4G3XB 5LXIB 5DBCA 1R4MI 2Y1JA 2WNMA 2KFNA 2FDRA 4KVGB 1X1MA 2BCVA 2K3UA 4W9DA 4M9GA 5H8YE 2E5SA 1A76A 2MAXA 9ICVA 5J2RA 3QUBA 4O9MA 3E2EA 7ICPA 1FXAA 4PL2A 4J9LA 4Y2VA 1KLGD 4DDID 3VVWB 1U49A 2FPKA 4DQPA 2N7EA 3KYDD 4W9JA 4W9IA 1WFYA 3Q8BA 1WX7A 1KL9A 2ISPA 5D3IB 2Y5BB 3NZSA 4FBJB 2I6XA 1SL1A 4KDIC 2CHZA 2FJ6A 2F1IA 1N2XA 3HVDA 9ICXA 4MEMA 2HJ1A 4RH6A 2R8KA 1XCTL 4NXZA 1UH6A 2V9WA 2ZIXA 1Q46A 1SL2A 1HZ6A 2CJNA 3A9JB 2G1EA 3KWVA 3PLUA 3K9PB 2GOWA 1QQ5A 3DBHI 4DSJA 1M94A 3TEYA 3EPGA 2FMQA 5AKKA 4CHKA 2VA8A 3Q8LA 1IUEA 4J9OA 2V3NA 5AUKA 4UB8U 1SJHD 3B2FA 4RQ7A 2EZXA 2WB1F 3NRWA 3AMZA 4HEA1 1GO3F 3WCQA 4JL9A 4RM9A 4YSYB 4EE2A 4Y2TA 4IC9A 2M9NA 1WGDA 4ZHPA 1ROEA 2K8BA 3DV9A 4GLSC 2JXJA 1JIHA 2ZUBA 3ZJTA 2HHSA 1YT3A 2L5YA 5AM2A 2KZ3A 3Q8QB 5IA7A 1BPYA 3H40A 1KW4A 1FEZA 3JSVA 1C78A 3DDCB 3AEEB 2EAOA 2E3TA 2ISOA 1RPLA 4BOSC 2YMPA 3SYZA 3AM9A 1MA7A 1BVSA 3JPNA 2IJ0A 3GP7A 2W11A 1L6NA 3LYYA 5ALDA 4I2BA 1L7YA 1MHHE 3PHWB 3L08A 5BYRA 3M95A 1MVKA 2EZZA 4BXOB 4NM2A 5KAFU 7ICQA 3DBSA 1MHXA 2W04A 4FJZA 1XQQA 3HX0A 1ZPSA 2XK5A 1NK7A 2R8JA 2WXOA 3DCGA 1MPEA 2WXGA 3LXFA 5J2CA 3GIMA 2W8KA 3U4EG 5BYSA 4RQ0A 3RH5A 2IHNA 1L5PA 2MJDA 3PSFA 4KX6B 2FLPA 4EBDA 2C60A 1QF6A 1C4AA 2XCAA 1TIFA 4IKGA 1ZXHA 5ALYA 4ACFA 5KT5A 3FILA 2CHXA 2GBRA 3L17A 3E56A 2ZXIA 2F8KA 1K5OA 3THVA 3TEZA 3VUXA 5KHQA 1T0YA 4PT5A 3U30A 1Z1BA 4MSQB 4CF5A 2HHUA 1BNPA 3A1QA 5AI6A 2F8LA 4MJSA 3B0AA 3UXOA 4AYBF 1UWXA 1WJ6A 8ICNA 5KFSA 5T8IA 1N63A 3I76A 3BVGA 1V49A 3BYYB 3V62A 3HP6A 1UGJA 1ZQFA 4DF8A 2RD0A 5GTHU 4L1BA 4NLKA 1C1YB 1VZ8A 2KTRB 2NTSA 4OJOA 1KRHA 5AEKB 9ICRA 2UVWA 5AKGA 3Q8CA 2JGAA 2WF9A 5DG9A 3QUCA 7ICEA 1D5ZC 2QDFA 2V9HA 5KFHA 3LWLA 4JUZA 1WJUA 1I42A 4F8RA 3H0RB 2KVSA 7ICHA 4RQ1A 5J0XA 2M1MA 3TMPB 5KFDA 3NVZA 5CB1A 1N62A 4W9CA 2F77X 4B9SA 2H5XA 1S0MA 4FLHA 2BKFA 1WCLA 3QX7A 5KFIA 4GOCA 1FO4A 4Y2UA 3TIXA 5J2AA 2O6KA 1RQLA 3W1YA 1ZUD2 3RT3B 4UASA 4P4PA 3QARA 5DG8A 1WF9A 3AQFA 2ZIWB 3JPOA 4I2CA 2N1WA 4A8XC 1PGXA 8ICKA 3RMKC 2QIEB 3U8ZA 4C7ZA 1V9JA 1ZQUA 3PVLA 3PRMB 3TACB 1WM2A 4TUPA 5FKAC 2PFNA 2ES6A 1IP9A 4RCOA 2NPTB 1AQ6A 5IINA 1LO5D 3C5GA 2CN1A 1GAQB 2B76B 9ICEA 1YJJA 2J0MA 2QHOA 1T7PA 4XGAB 4EYHB 4PYZA 5G5HA 3T5KA 2KC1A 3TCAA 2ALZA 5DPSA 2GOLA 2HBJA 1BMLC 2FCMA 4LDTB 3OJUA 3ISBA 3L16A 4YXDB 1X6IA 4IL6U 2WXJA 7ICVA 4BKSA 2BYTA 5JH5C 4MSMB 5DCNA 1HA5A 2HHTA 3PT2B 3H0MB 4BGDA 3RJIA 2QLTA 2BZFA 1WWTA 1GJZA 4I2HA 2WXMA 2XC9A 5DQGA 4MGZE 3RJEA 4S17A 2C2DA 4M9LA 1OEYJ 1TT5B 2JXTA 2DL0A 5KFXA 1UELA 1NJXA 2MJEA 1UNSA 4S0RA 1X66A 5J0RA 2GBNA 2LI5A 9ICMA 1YNTE 5A0LA 5ALLA 4MFFA 1T0RC 3TI0A 2C2RA 5KG5A 1XF5L 4HLEA 4J9KA 4WWMA 1NENB 2KQSA 2L8JA 4K4HA 1NYRA 3NHEB 4YVZA 1I4PA 3QIJA 1YQ4B 4I2JA 1HIWA 4F4ZA 1NJYA 2INDC 1KH0A 2KQ4X 4MACA 1QOFA 2LRUA 5KT3A 2BVCA 2ZW0A 2W43A 4P4MA 3CNHA 5DB7A 5CR0A 9ICHA 9ICCA 5KFUA 4ARIA 3HKZC 1SXTA 5AZHA 1TGZB 3MR6A 4HJKA 2WXQA 4IS7A 3OSNA 4DBGA 3AE4B 1QQRA 1I4XA 4L23A 1GC7A 3K1ZA 2DBYA 1ZYQA 3A9KA 5C3JB 3RH6A 5KG2A 4DQSA 3QX1A 5D2MB 1VZ6A 4EFOA 7ICKA 4EEYA 1UBQA 3CYMA 4AYBC 2MA9B 3AULA 3D32A 3MFGA 2KDIA 2FLNA 2EZYA 4F4WA 3S2AA 1T94A 2PEAA 4HRSA 4I6LB 1OXJA 4HPMB 2G4SA 4GXKA 4NLGA 3RULA 3A33B 3SD7A 2MLBA 3APCA 3FDSA 3ZRCA 4WJOA 2AQ0A 2A1JB 1C79A 4DSLA 2WF5A 1NK8A 5KFGA 1QCKA 2MJ3A 3QQ8B 3GB1A 2HDOA 4LNKA 3KYCD 3K75D 2RPQA 2DYOA 2KD0A 4ED3A 1UF0A 4AOFA 5IP4D 2K9XA 2AH5A 3UQBA 3M6KA 5EWEA 1E7PB 2KO3A 4AUQC 3ZW3A 1MQ2A 4F2SA 2BS4B 2PI4A 2IYDB 3EFCA 4YFKA 5AKLA 5DB8A 1P1AA 4KKIA 9ICUA 2MW5A 5AKHA 5ALPA 1JCKB 2ZVOA 3MC1A 4MGKE 4Y2SA 3UQAA 2RDJA 2TSSA 4KSKC 2ATLA 1E7VA 2XICA 5KNIA 1L6VA 3F5AA 5CWRA 2WTFA 3APFA 2R61A 1R4NB 5CHGA 3ML9A 5J18A 1IBXB 3M63B 4NAMA 5DB9A 1PK1B 4KITB 3R2IA 3RTVA 1QSSA 5KHOA 2KN7A 1YZ6A 2PVOD 2HI0A 2VH2A 4XRHA 2ZIVB 2N9KA 3ZD9A 2DZIA 3IG5A 4ZRKA 4W9LA 3ZDBA 3N1XC 1TKDA 3RBEA 3Q8KA 2PI5A 4A3OA 2J4XA 3SAGA 1J7BA 5E6JA 1COOA 3ZDDA 2WFAA 2O6VD 2WYQA 2WB1C 4NLNA 5KFEA 2K8AA 1I7HA 3ZIMA 1TK0A 4F91B 5DPWA 3PO0A 4ARCA 1GPXA 2JUOA 1NDDA 1PVQA 1F77A 2FAZA 1K1SA 1E8WA 1YN4A 3IAS1 1ZJNA 1E5WA 4C7YA 1FNUA 3AB5A 4L2YA 4NY0A 3AEGB 3ORYA 4GXBA 1QTMA 5AM5A 1ZQAA 3EPIA 1YOVB 3H7PA 3C28A 2LJIA 3TADA 4RQ4A 2KWCA 3ZKJC 2ZJAA 1UUPA 2AWTA 4DS5A 1D5MC 4CNQA 4UB2A 4RGOS 3HKZF 3RF9A 3ZTCA 3GZFA 4KZ0A 3N32A 4GGQA 1ZQTA 2LHDA 2BGWA 3AXCA 5KFYA 1AW7A 2DAFA 4I2AA 3Q3FA 2J6TA 4KIKA 4FZMA 4FZNA 3KTQA 4M2YA 9ICFA 3V61A 4US8A 2IO3B 3TJPA 2MA1A 3PV8A 4YTMB 2MSNA 4RNAA 2V3SA 1HEZE 1NNLA 1L8LA 2OJRA 3SFEB 3ISDA 5AKZA 2PXIA 5HHIA 2KEYA 4QZIA 4B9MA 5KG1A 1NI2A 5EDSA 3MABA 4DFKA 2ZW1A 2P6RA 4M02A 3ZDAA 2K60A 3VCBA 2EDUA 2BW2A 3HUIA 5BO4B 4FS1A 1TKYA 1VCBA 5ALXA 3QHTA 3RFAA 3B9JA 3OHAA 1F0MA 3PX6A 1KFSA 4O5KA 2KMAA 3BQTA 5HFYA 4I6PA 3R7QA 3WKCA 1DOQA 4J03A 3G6XA 4KTQA 5AI4A 4HK2A 3VR9B 4HVBA 3WKEA 4DXGA 4Q2JA 3PSPA 5KG3A 4RNMA 3Q3OC 2KTQA 3NVVA 3C2MA 2YY6A 9ICBA 1SE3A 4RMAA 4XX5A 1V1OA 1TY2A 3RRHA 4MDKE 2O2VB 5J2DA 2JPHA 2LXCA 4RPYA 1PYWD 3MGHA 1L8OA 3PVXA 4W9EA 2ZPYA 4LJOB 2MBEA 4GLXA 3V6EB 3EFUA 4EUTA 4GDLB 1V97A 2J0JA 3PPAA 1SV4A 4IRDA 5KFPA 5I4DA 1EWYC 2ZVNA 1RDFA 2HTME 4IWQA 1SE2A 1ZW7A 3MC8A 4K81A 4MEXA 3Q6BA 4O0IA 5IAAC 3AN1A 1VRAB 4MHVA 2D6FC 1K8RB 4RQ2A 2WXKA 4WURA 1FFVA 2WS3B 3KW5B 2J52A 1Z2MA 3T3NA 3C1ZA 4WJNA 1ZQCA 1C77A 1HQRD 5AIBA 2VA3A 4IQTA 1P9DU 3M7DA 2WDQB 3ZRFA 4R64A 4I2EA 1D9FA 1OTRB 1TK8A 1QH9A 3ISCA 4YN4A
chains in the Genus database with same CATH topology
4A9AA 3BIID 1ZXIA 2JZPA 2WDVB 1FXIA 1NEKB 1K52A 2BS2B 1XXGA 1RYJA 3NVWA 1ESFA 1SIJA 1FRRA 3P63A 1EU3A 1K53A 5D7GA 1AYFA 3O13A 2JSVX 2ACZB 2WNMA 2V3PA 2WQYB 1QT9A 2K3UA 1D6EC 5EE0A 5H8YE 2H88B 5BMHA 3BVZA 2EELA 1FXAA 1PGAA 3FC4A 1KLGD 2N0SB 3AEFB 4YSZB 1CQVA 2EKIA 2PIAA 1ACCA 3Q8BA 1JWBD 1ZE3D 1ENFA 2M0AA 5D3IB 2WXIA 4JE3B 2DWQA 3Q8AA 2WXHA 1P7EA 1XCQL 1YN3A 3HVDA 2J53A 2W54A 4XDDA 3W2DA 3MP9A 3HVZA 4YT0B 4RH6A 1UWMA 1XCTL 2KAJA 3E9SA 1MI0A 1OFFA 4REZA 1HZ6A 2CJNA 1B9RA 2G1EA 3KWVA 1NI3A 2SEBD 2N9LA 2AQ2B 3TEYA 3AEDB 4NZLB 1Y56A 3TUOA 1KF6B 2E6XA 1IUEA 3IT4B 4P6VF 2V3NA 3EA6A 3IXSA 3AEBB 2WDRB 3AECB 5AUKA 1SJHD 3B2FA 2IGDA 5JXVA 3DWMA 2W3SA 2H89B 4ZHOA 3AMZA 4HEA1 4N6EB 3RPFC 1JRPA 2K0PA 3FILB 3WCQA 1SSNA 4YSYB 2LUMA 1YJIA 1R7SA 4EE2A 4TQ1A 1E10A 3P1MA 3SR6A 4ZHPA 1ROEA 4GLSC 4XDCA 3V3XA 1RM6C 3ZJTA 1C4CA 1FD6A 3RFZB 1BXTA 2ON8A 1PGBA 1N61A 1C76A 4A6QA 1BUIC 1C78A 1T5XD 1TYGB 2PW9A 2RMMA 1FIQA 4US9A 3AEEB 2E3TA 2WXPA 3BVMA 4RGNA 4ZRPA 2W55A 2LGIA 4USAA 4NAWB 3VRAB 3AM9A 2KN4A 1F2RI 3AE2B 2IJ0A 3GP7A 5LNK1 1QILA 3LYYA 3BK2A 1MHHE 4OZAA 5BYRA 4XWWA 1HZ5A 1MVKA 2IDYA 2Q5WD 2Y5PA 3MC0B 1VDVA 2VZKD 2WXFA 1MHXA 1JQ4A 3AE3B 1IBXA 4RF1A 1GOZA 1ZPSA 2WXOA 1MPEA 1NYQA 3LXFA 2RDHA 1TKEA 3SFDB 3U4EG 5BYSA 1KFYB 1XLNA 2M56B 2MJDA 1L5PA 2RPVA 1J7AA 1ZOYB 4KX6B 1L0XB 2CU3A 1QF6A 1C4AA 3I9V1 2IGGA 4IKGA 1ZXHA 2FE8A 2QEJC 2NTTA 1DYQA 1QLBB 3BK1A 1PFDA 3FILA 2OHFA 1VZ7A 2AQ1B 3E56A 5BYQA 4YSXB 1WYGA 3U2SC 3TEZA 4PT5A 4M0WA 3U52E 1TS4A 4AQ7A 1GB1A 3T3OA 3UI3A 1I4RA 4KGTA 1UWXA 5T8IA 1QOAA 2XN9C 1N63A 3BVGA 4RF0A 3BYYB 1STEA 2K22A 2RDGA 1UGJA 3AE6B 1P7FA 4L1BA 5H92C 4CQNA 1VZ8A 2M19A 2NTSA 1KRHA 4R3DA 2I2YA 4WQMA 3Q8CA 2HDEA 2W3RA 1ZDVA 1D5ZC 2WP9B 1V1PB 1FFUA 4OZCA 4LLGM 3CIRB 3KQ4A 5AUIA 1IGCA 2BS3B 1C9FA 5G5GA 1V8CA 4WH4A 3J9CA 3NVZA 1VJKA 1M4VA 1EWCA 3EUB2 2K5PA 2L83A 4HKQA 1N62A 4TMAB 2PLPA 4KKJA 3URYA 5C2TB 3TEWA 4JPSA 4XE0A 1FO4A 3B2GA 1TY0A 1RFKA 1ZUD2 4JWSC 4RGTA 3Q69A 2WXNA 4ZYSA 1HXYD 4A8XC 4P16A 1PGXA 1TS5A 3BYTB 3SEBA 2QIEB 3DWGC 3BWUD 4C7ZA 4TQ0A 4ITKA 4OW0A 5EE3A 3FAHA 4B0MA 1CJEA 5FKAC 3GS2A 1XLPA 4AS1A 4RCOA 3BZDB 3IT6B 4KGRA 1B1ZA 1LO5D 1JWAD 2ONQA 1GAQB 2B76B 3NS1A 1YJJA 2BBCA 1ET6A 4YTNB 3P42A 2KACA 1K50A 3R2TA 3AE1B 5G5HA 1YQ3B 1K51A 2KMMA 2JU6X 1BMLC 4YXDB 3HRDD 4OHJA 2WXJA 3ZGZA 4LK0M 2BYTA 1QKZA 2GRIA 2WU5B 1IGDA 2L32A 1HA5A 2WXRA 5HHDG 1TS2A 1WWTA 4HJGE 2WXMA 2KWDA 4FXCA 1OQQA 1FEHA 3W5UB 2L1AA 4MH8A 2FBWB 4WAFA 2JXTA 1AWDA 1I4GA 2MJEA 1UNSA 2LEKA 1SBBB 3LB8C 4N59A 4GDKB 1YNTE 3W1SA 2L52A 1XF5L 3Q8FA 4WWMA 2DYMA 1NENB 5HG2A 2BB6A 1XLQA 1NYRA 1TKGA 2NMQA 1JW9D 1I4PA 1YQ4B 3Q8EA 2BT6A 4OZBA 1KH0A 2KQ4X 2LHEA 4MACA 1QOFA 4B0EA 2ZW0A 1L6UA 4UDUC 4XWTA 4ARIA 4MM3B 1SXTA 5FK9C 2PKOA 1C4PA 1PUTA 1EU4A 2WXQA 3ZJVA 4N58A 3AE4B 1QQRA 1I4XA 4L23A 2G9HD 3P4SB 5C3JB 2DBYA 2ICIA 1F2RC 3U7ZA 1VZ6A 4ZRQA 5GXGB 2QILA 3MFGA 3ETRA 1F0ZA 2QSDA 2JYEA 3CWIA 2W82A 3EGRA 2QMTA 3ZJUA 1FNVA 3AE8B 3P4RB 4HRSA 3PZ8A 3MHZA 2Y5CA 1JROA 3P4PB 3AEAB 1JMLA 1C79A 4TSSA 3I57A 4HKZE 3ZQ4A 2MJ3A 4WIPA 3GB1A 1E0ZA 1FCLA 2DYOA 2LFIA 1ZP0B 2K9XA 3ZYYX 3N9YC 5D3DA 4DXFA 1E7PB 1TS3A 2BS4B 2V4IB 4O1NA 2XNAC 5FR3A 1QOGA 4KKIA 2DLBA 2MH7A 1YN5A 3TSSA 1WRIA 1JCKB 2JX5A 2JWUA 3AE5B 4OVZA 2N7JA 4NJCA 2TSSA 3C8YA 1JALA 1L6VA 3NRZA 3VQIA 3VR8B 3KLSX 2I38A 2R61A 2YEPF 1IBXB 2VZKB 1V1PA 4NAMA 5HI1A 1N60A 4YWGG 3R2IA 1YMHE 2PVOD 4HROA 1OQRA 1EM7A 2N9KA 4IOIE 2INPE 4RGMA 1KLUD 3NVYA 2J4XA 1L0YB 3AV8A 1J7BA 5E6JA 2IPKD 2INNE 1PDXA 4JX1C 2Z8LA 1RWSA 1I7HA 2AX5A 1XO3A 3PO0A 2GI9A 4ARCA 2PMVA 1GPXA 1FNWA 2WU2B 1F77A 5MPOA 1YN4A 3IAS1 4DQOC 1DGJA 4JWUC 1FM0D 4C7YA 1N5XA 1FNUA 3AB5A 4L2YA 3AEGB 2BB5A 3PZ7A 4KGSA 4A90A 1Q10A 2OEDA 1L4ZB 2LJIA 3MJ5A 2MEKA 2X38A 1T6BX 1SEBD 2WXLA 1UUPA 1FCCC 1D5MC 1I4QA 1KTKA 1FRDA 1JWUD 4RGOS 3W9CB 2YEPB 2PTLA 1N5WA 2SAKA 2LHDA 1AW7A 3IAM1 2IGHA 1CZPA 3W5VB 4H2AA 5TSSA 1CK1A 4US8A 2PVGC 1D4BA 3ABVB 1E9MA 2QJLA 1WGKA 4YTMB 4RNAA 1E6EB 1DOYA 4MT5A 1HEZE 4YTPB 3SFEB 3V05A 1QOBA 1SE4A 2Y3AA 1A70A 2ZW1A 4RFBA 2FUG1 1ET9A 2BW2A 3HUIA 1L4DB 2JYTA 2KDMA 2WLBA 1TKYA 3B9JA 2LMCA 3L4PA 1XLOA 3AE7B 1WXQA 3KWLA 5HFYA 1DOIA 1VLBA 1D5XC 3VR9B 1SJED 3P4QB 5BMIA 4DXGA 4Q2JA 1XEEA 3NVVA 1GB4A 2CJOA 1SE3A 1JWMD 3NUHB 1V1OA 1TY2A 4J3OD 3OWEB 1DOXA 2J42A 4C80A 2GB1A 3H8HA 1PYWD 4ZOHC 2D5GA 2BTEA 5EE9A 1NVID 1VR9A 2AQ3B 1I4HA 4D2KA 4GDLB 1V97A 5EE1A 2V0GA 1JWSD 5I4DA 3VRBB 1T3QA 1EWYC 1L0VB 2HTME 4A55A 1FMAD 1SE2A 1SF0A 4C56C 1WSPA 3AN1A 1VRAB 2WXKA 4WURA 3R8BA 1FFVA 2WS3B 3T3NA 2J52A 1J7CA 2JQRB 3NZ3A 1C77A 1HQRD 1SB3C 1TZOA 2WDQB 3TEXA 4IDIA 3AE9B 3AH7A 1ZDXA 5BMGA 4LTUA 1TJEA 2WXGA 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M56 B;  2MJD A;  1L5P A;  1AWD A;  1J7A A;  1ZXI A;  3BII D;  1ZOY B;  1FXI A;  1NEK B;  2LEK A;  2MJE A;  2WDV B;  2WU2 B;  2CU3 A;  3LB8 C;  4KX6 B;  2BS2 B;  4N59 A;  5MPO A;  1RYJ A;  1DGJ A;  3NVW A;  1FRR A;  1SIJ A;  1FM0 D;  3P63 A;  4JWU C;  1QF6 A;  4C7Y A;  1N5X A;  3AB5 A;  1AYF A;  3AEG B;  2ACZ B;  2L52 A;  1QLB B;  1PFD A;  2OHF A;  4WWM A;  1NEN B;  4YSX B;  1WYG A;  2FBW B;  1XLQ A;  2WQY B;  1NYR A;  1TKG A;  1QT9 A;  1JW9 D;  5AUK A;  1YQ4 B;  5EE0 A;  5H8Y E;  2H88 B;  2BT6 A;  1QOF A;  1FXA A;  1L6U A;  3FC4 A;  2N0S B;  3AEF B;  4YSZ B;  1FRD A;  3W9C B;  2PKO A;  2EKI A;  1PUT A;  2PIA A;  4N58 A;  1N5W A;  1QOA A;  3AE4 B;  1N63 A;  1JWB D;  3P4S B;  5C3J B;  2DBY A;  2K22 A;  3AE6 B;  1CZP A;  5H92 C;  3W5V B;  2DWQ A;  2M19 A;  1KRH A;  4US8 A;  5GXG B;  1F0Z A;  3ETR A;  4WQM A;  2W54 A;  3CWI A;  2PVG C;  3HVZ A;  2W3R A;  3ABV B;  4YT0 B;  2WP9 B;  1E9M A;  1UWM A;  1WGK A;  2QJL A;  2KAJ A;  1FFU A;  3AE8 B;  4YTM B;  1E6E B;  3P4R B;  4HRS A;  1DOY A;  1OFF A;  3CIR B;  5AUI A;  4YTP B;  3SFE B;  2CJN A;  1QOB A;  1B9R A;  2Y5C A;  1JRO A;  2G1E A;  3P4P B;  2BS3 B;  1NI3 A;  5G5G A;  1V8C A;  3AEA B;  3NVZ A;  1A70 A;  1VJK A;  3EUB 2;  2K5P A;  2L83 A;  1N62 A;  3AED B;  3HUI A;  2MJ3 A;  2WLB A;  1E0Z A;  1TKY A;  1KF6 B;  5C2T B;  3B9J A;  1IUE A;  3L4P A;  1XLO A;  1FO4 A;  1WXQ A;  3AE7 B;  3B2G A;  3KWL A;  4P6V F;  3AEB B;  2WDR B;  1ZP0 B;  3AEC B;  1DOI A;  2K9X A;  1TJE A;  1RFK A;  1VLB A;  1ZUD 2;  3B2F A;  4JWS C;  3VR9 B;  1E7P B;  3ZYY X;  3P4Q B;  3DWM A;  2W3S A;  2H89 B;  4ZHO A;  2BS4 B;  3NVV A;  3AMZ A;  4N6E B;  3RPF C;  1JRP A;  3WCQ A;  2CJO A;  4YSY B;  2QIE B;  3DWG C;  1QOG A;  1R7S A;  1YJI A;  1E10 A;  4C7Z A;  3SR6 A;  3P1M A;  4ITK A;  4ZHP A;  1ROE A;  2MH7 A;  5EE3 A;  3FAH A;  1WRI A;  1DOX A;  1CJE A;  2JX5 A;  4C80 A;  1RM6 C;  3AE5 B;  4ZOH C;  1XLP A;  5EE9 A;  1NVI D;  1JAL A;  1JWA D;  1L6V A;  3NRZ A;  3VR8 B;  1N61 A;  1GAQ B;  2B76 B;  3NS1 A;  1TYG B;  1YJJ A;  1V97 A;  4YTN B;  1FIQ A;  4US9 A;  3AEE B;  5EE1 A;  2E3T A;  1GPX A;  3AE1 B;  1T3Q A;  5G5H A;  1N60 A;  1EWY C;  1YQ3 B;  3VRB B;  2W55 A;  1L0V B;  2HTM E;  4USA A;  1FMA D;  2KMM A;  1SF0 A;  2PVO D;  3VRA B;  4HRO A;  3AM9 A;  4YXD B;  3HRD D;  1OQR A;  3AE2 B;  3AN1 A;  4A9A A;  2WU5 B;  3NVY A;  2Q5W D;  1FFV A;  2WS3 B;  1J7C A;  2JQR B;  1VDV A;  1JQ4 A;  3AV8 A;  1J7B A;  1WWT A;  3AE3 B;  4FXC A;  1SB3 C;  1OQQ A;  2WDQ B;  1PDX A;  4JX1 C;  3W5U B;  4IDI A;  1NYQ A;  3AE9 B;  3AH7 A;  3LXF A;  1RWS A;  1TKE A;  1I7H A;  3SFD B;  2AX5 A;  4LTU A;  1KFY B;  1XLN A;  1XO3 A;  3PO0 A; 
#chains in the Genus database with same CATH topology
 1VJ5 A;  3O0F A;  4KLE A;  2WDV B;  3TBL D;  4EEW A;  5IN7 A;  1IPG A;  2ZG6 A;  2WHE A;  3I28 A;  1RYJ A;  1ZGU B;  1S8O A;  1FRR A;  3ZNH B;  3UQ0 A;  1EU3 A;  3L3F X;  4BDP A;  3H7P B;  4K3B A;  4ZRI A;  2JSV X;  1WJ4 A;  2ACZ B;  4QIW F;  3PML A;  4K7W A;  1OEY A;  4I2G A;  7ICR A;  1RXV A;  3ZXV A;  4GDK A;  3K4G A;  1ZQB A;  3S6J A;  1QT9 A;  2KMD A;  2F2A B;  5BMH A;  3BVZ A;  2EEL A;  3FC4 A;  4PJ0 U;  5HR6 A;  3AEF B;  4YSZ B;  3BQ7 A;  5ALV A;  3EEC A;  2K6Q A;  5HML A;  2F76 X;  2MRP A;  2EKI A;  3RB4 A;  1ZQR A;  2NRZ A;  3QE9 Y;  1SL0 A;  2PIA A;  2OJW A;  1ZE3 D;  4JE3 B;  4HWI B;  4G11 A;  2Z7J A;  1P7E A;  5H2F U;  1XCQ L;  4UBC A;  4Z6E A;  2MBO A;  2J53 A;  2W54 A;  3Q8R B;  1PQS A;  3JPQ A;  3MDA A;  3HVZ A;  2XVT A;  2BQR A;  4YXM A;  1WWV A;  1OFF A;  1B9R A;  3QU5 A;  4FO6 A;  1GUA B;  2ODG A;  2JZ3 B;  2SEB D;  2LVQ A;  1RLF A;  2AQ2 B;  1Z4O A;  3AED B;  2Y9T A;  4NZL B;  4OVV A;  1P3Q U;  1KF6 B;  3L0W B;  3M8R A;  8ICU A;  1SGG A;  1JN3 A;  4KLQ A;  4F1S A;  3EA6 A;  4CYE A;  2WDR B;  4RUC A;  1S0N A;  3KBB A;  4OJ6 A;  1SZP A;  5AK3 A;  2W3S A;  2H89 B;  2F44 A;  4KSL C;  2VAN A;  2K0P A;  3FIL B;  1UZX B;  1SSN A;  4R8U A;  2DKX A;  1X9X A;  2CXY A;  2KAN A;  8ICC A;  2LUM A;  3NZU A;  4EZL A;  1E10 A;  3SR6 A;  1ZD4 A;  3QUQ A;  2ZUD A;  2KFK B;  1RXW A;  1SXD A;  2WGS A;  2ZJ8 A;  2HHQ A;  2IOF A;  4XC2 A;  4BBN F;  1FD6 A;  3RFZ B;  1ECW A;  1CMX B;  1PGB A;  1GNU A;  4DL7 A;  5AZF A;  3N20 C;  2RP5 A;  3C1Y A;  2RMM A;  9ICL A;  2BQQ A;  2XK5 B;  1ZQH A;  2YTU A;  2WXP A;  4RGN A;  4DSI A;  4ZRP A;  1ZQD A;  1VD2 A;  1S76 D;  2UWQ A;  4DQI A;  4ECT A;  2KVC A;  9ICG A;  2W9N A;  3VRA B;  2NCN A;  2R2O A;  3AE2 B;  1KFD A;  4PK1 A;  1S77 D;  2N1V A;  3PW7 A;  3RH4 A;  3T9L A;  4XWW A;  5KG0 A;  1YQB A;  2Y5P A;  1KEJ A;  4DF4 A;  5B66 U;  3GIL A;  2WXF A;  3QNM A;  3SEI A;  4C4T A;  3AE3 B;  2HJ8 A;  4RF1 A;  3AU2 A;  2KJ8 A;  4EEK A;  2IZV B;  5KT6 A;  4BWJ A;  1UA0 A;  1KFY B;  3L13 A;  2CR5 A;  2KFK A;  1L3T A;  1ZOY B;  2Q0Z X;  2BCS A;  3HM6 X;  2CU3 A;  1Z4N A;  9ICO A;  1ISN A;  3EHV A;  2G4D B;  3I9V 1;  5CX3 A;  3BS5 A;  5L1M A;  4BOZ B;  2MWS B;  4ZDV A;  3SHQ A;  1B0X A;  2NTT A;  1DYQ A;  2LJ5 A;  3BK1 A;  1PFD A;  1ZQL A;  2OHF A;  1KDH A;  1VZ7 A;  2KVR A;  3ML8 A;  4YSX B;  1MN8 A;  3DEE A;  1S9F A;  1TAU A;  4IUM B;  3F53 A;  3MC9 A;  3R66 C;  1H38 A;  3RZW C;  4QZ9 A;  3GE3 C;  4LNN A;  2F3N A;  2XEW A;  3NTU A;  5F3X B;  2JT4 B;  3C0R B;  1Z1V A;  1V9P A;  3HK0 A;  4Y2Q A;  1TS4 A;  4G50 A;  2Y9U A;  4HYK A;  3NS8 A;  3UI3 A;  4EYI B;  4KGT A;  2GBK A;  3UXN A;  4PGQ A;  1LKY B;  2YX8 A;  1J0G A;  3EC8 A;  4CGZ A;  3DHG C;  2KVZ A;  2XN9 C;  3B1L X;  2CU1 A;  3F2B A;  2G0A A;  4RF0 A;  5ALS A;  4NL9 A;  1B22 A;  5KT2 A;  3QXG A;  1P7F A;  1NK9 A;  3BY4 B;  2L0T A;  4CQN A;  5C5J A;  1S0V A;  1FPY A;  2BHN A;  4R3D A;  2RHF A;  2INC C;  1ZDV A;  2WP9 B;  3TAR A;  2ZTD A;  8ICL A;  1FFU A;  4PHE A;  1WRD B;  4OZC A;  2EMS A;  1E8X A;  3CIR B;  3KQ4 A;  1WYW B;  5DPT A;  1KN5 A;  3M9N B;  2IO2 B;  2C2E A;  2HOI A;  3T3F A;  8ICB A;  3UIO B;  2BS3 B;  4UW9 A;  5KFZ A;  4MM3 A;  1C9F A;  1ZD3 A;  5KG4 A;  2CRX A;  1EWC A;  2K6D B;  2MP2 A;  4B9N A;  4ELU A;  4KDL B;  4HKQ A;  9ICW A;  2KZM A;  5C2T B;  4J9R A;  4IM3 A;  3TEW A;  4XE0 A;  3B2G A;  4W9K A;  5HKH A;  1L3U A;  4Z6F A;  4WJ3 B;  3MDC A;  4LZD A;  3SU8 X;  4YR0 A;  2YB1 A;  1DK2 A;  4DOA A;  1SKW A;  3BYT B;  2GH1 A;  3DWG C;  2Z0D B;  3Q8P B;  4K1R B;  3BWU D;  4OW0 A;  5EE3 A;  2XO7 A;  3RR8 A;  3FAH A;  4CRX A;  2EQY A;  4TQR A;  1X9W A;  1XLP A;  1IYF A;  4FAD A;  1UHU A;  4ECQ A;  4CF3 A;  1V86 A;  3NS1 A;  1X9M A;  3V6K A;  1S1Q B;  2L05 A;  5AK4 A;  1ET6 A;  2QCZ A;  4YCX A;  2KAC A;  4KN4 A;  4EX7 A;  1K50 A;  3P42 A;  3QJZ A;  4F4Y A;  3RB6 A;  1YQ3 B;  4C8O A;  9ICS A;  2PJH A;  2FI1 A;  3KHG A;  3WK9 A;  2O6V B;  4EBC A;  4MF2 A;  2IHM A;  2IO0 B;  2HVH A;  3IV6 A;  4QJF B;  4IC7 B;  4JV0 A;  3A9K B;  2WU5 B;  1IGD A;  2L32 A;  5HHD G;  1J2N A;  1EO6 A;  3G6Y A;  1S3S G;  2WX0 A;  2LKY A;  4HJG E;  4FXC A;  3ZNZ B;  5C1Z A;  1OQQ A;  5ALM A;  4J9N A;  1FEH A;  8ICR A;  4JB3 A;  4Q8E A;  5KFA A;  4NY8 A;  3N7S C;  2QC8 A;  3PV1 A;  1I4G A;  3WK5 A;  2LEK A;  5DKW A;  1ZJM A;  3AL0 B;  1YZ7 A;  4BAX A;  5L1I A;  3D2Q A;  2DYB A;  2L52 A;  5KL8 B;  2UVU A;  2DYM A;  5J8Y C;  2NMQ A;  1TV9 A;  3RYT A;  2YVC A;  4QAY A;  1LB2 B;  2HCF A;  4OZB A;  4WJQ A;  2E8O A;  3EW9 A;  1WY8 A;  4NM1 A;  2Z59 B;  4UDU C;  2LM4 A;  2N9X A;  5J2F A;  2K89 A;  2D3G A;  1WH3 A;  2ZJD A;  3H4D A;  2L7R A;  4QWB A;  2FMP A;  3D2N A;  3C2K A;  1YIW A;  4U7C A;  1ZQM A;  4HCP B;  4M0W B;  4ECY A;  2HD5 B;  2XGP A;  5GXG B;  2XCP A;  4KX5 A;  1L2N A;  3M1Y A;  7ICG A;  2QSD A;  2JYE A;  3CWI A;  2W82 A;  1D8Y A;  2HOQ A;  1H4R A;  2QMT A;  1A0P A;  4KIK B;  1MFW A;  3RUI B;  3PX0 A;  5HR7 A;  2KOX A;  4PGY A;  3H8M A;  1ZD5 A;  2E8N A;  3H8S A;  3MR3 A;  4U6P A;  1T3N A;  4HXD A;  5III A;  2Y5C A;  1JRO A;  1ZOL A;  3PR5 B;  4EEN A;  1JML A;  2LAS A;  1L7N A;  4ELV A;  1TVA A;  3D2S A;  3V72 A;  3Q14 C;  4PS7 A;  1LKY A;  3UF8 A;  3ZQ4 A;  5AIA A;  3TAN A;  2PPH A;  1E0Z A;  3SQI A;  1D3Z A;  4DHZ B;  2BKE A;  1JXE A;  1FCL A;  4ED6 A;  4DSE A;  4J6I A;  4AJW A;  1QSY A;  2J6U A;  3PRE A;  1QSL A;  5D3D A;  1I35 A;  2L00 B;  3V7J A;  2HVI A;  1TS3 A;  2C7N B;  3KZX A;  3CRX A;  1X9S A;  2KK0 A;  5AKX A;  4O5E A;  4LJP B;  3BS5 B;  3UXP A;  2DLB A;  1ZKH A;  2MH7 A;  3TSS A;  3V6C B;  1ZQQ A;  2K4P A;  1NJZ A;  1XT9 B;  2JX5 A;  2LPE A;  1F9J A;  2DX5 B;  2JWU A;  2K25 A;  3I1Y A;  2N7J A;  4NJC A;  1WGG A;  3C8Y A;  4IR1 A;  1DGS A;  3ZXR A;  3NRZ A;  4AWJ A;  2F1H A;  1MG8 A;  3KLS X;  3C19 A;  2I38 A;  4MGY E;  4A8E A;  3PW2 A;  5EWG A;  4IWP A;  3WK4 A;  1BPZ A;  5L95 C;  3A9J A;  1U4B A;  1YMH E;  2KD1 A;  3KOO A;  4QNL A;  1OQR A;  4QZB A;  4IOI E;  2INP E;  3QZ7 A;  3ZUN A;  1PK1 A;  4RGM A;  5KG6 A;  3NVY A;  1NK5 A;  5CHW A;  2JR5 A;  2KNB A;  3RJJ A;  4QZF A;  2NO4 A;  3N28 A;  1PDX A;  2WF6 A;  2DPI A;  2Z8L A;  2B0C A;  4GC7 A;  2AX5 A;  1KTQ A;  1TTN A;  3RNG C;  2AYO B;  1FNW A;  2HSZ A;  3SAF A;  1COK A;  1F52 A;  2ESE A;  4DQO C;  1DGJ A;  4YD2 A;  3NGD A;  3N1Z C;  8ICH A;  5J0P A;  4KGS A;  2FUH B;  4RQN A;  4OO1 J;  5L1K A;  3JW0 X;  1BGX T;  3QU2 A;  3N97 B;  1L4Z B;  1EXN A;  5J0Y A;  1WGY A;  3MJ5 A;  5AI9 A;  3PGE A;  3WU2 U;  2WXL A;  3U26 A;  1XSL A;  3DBL B;  1P7D A;  2D2Q A;  5AM3 A;  1KJT A;  4TUS A;  4C00 A;  3GII A;  2H3Q A;  1N5W A;  2SAK A;  4K7U A;  1HTQ A;  5DDY A;  5AM4 A;  4BXO A;  3IAM 1;  1U4A A;  2LVO A;  5AIC A;  2MRL A;  5KFO A;  1GC6 A;  4DL2 A;  2QB1 A;  1RFA A;  1OGW A;  3H4B A;  2AGP A;  4KMO B;  3ABV B;  5TR5 A;  7ICN A;  2O6V A;  1E6E B;  4ZH4 A;  1V6E A;  2LHT A;  3LVW A;  1LV5 A;  2A4Z A;  4DOB A;  4MF8 A;  2KX3 A;  2BQU A;  4RU9 A;  1XO0 A;  2J6S A;  4RFB A;  2FUG 1;  5G2N A;  2KDM A;  2WLB A;  4E3C A;  3UMB A;  4LCD E;  4K3C A;  3GV7 B;  4ED1 A;  2KJH B;  3L4P A;  2YQE A;  1RAX A;  1XLO A;  4W9G A;  3KWL A;  2R8I A;  4TUR A;  2W7P A;  1PVR A;  3W1S C;  1WE6 A;  1VLB A;  5J2J A;  2N9E B;  3SV4 A;  2MX2 A;  1UCV A;  5BMI A;  1XEE A;  4PGX A;  2MSE D;  3NAS A;  3C23 A;  4GU2 A;  2KV2 A;  4O3S A;  2CJO A;  4KZC A;  3NUQ A;  2KNJ A;  1JWM D;  3FYH A;  1WJN A;  4J3O D;  4OJP A;  1T0S C;  2BYE A;  2NS5 A;  3OWE B;  1DOX A;  2GB1 A;  2NRT A;  4ZOH C;  1XO1 A;  5ALF A;  2D5G A;  5EE9 A;  2AXT U;  1NVI D;  2HBM A;  4DL5 A;  2HE7 A;  4KLJ A;  2BYV E;  3APD A;  2N7D A;  1T3Q A;  1SV0 C;  5TIS U;  3VC8 A;  3PRP B;  1AAR A;  2CHW A;  3GU3 A;  1SF0 A;  5FP0 A;  3R7R A;  3WAO A;  1WSP A;  5KFJ A;  4X57 B;  3SEN A;  4KLF A;  2G3Q B;  2N4F A;  9ICK A;  3V7K A;  2W9A A;  4GFJ A;  5BPC A;  1C7Y A;  2OOB B;  5G55 A;  4JLC A;  2JQR B;  1WXV A;  2B21 A;  2CPR A;  2JH1 A;  2KHQ A;  1HUZ A;  4RQ5 A;  2KC2 A;  4EKU A;  2M0N A;  1SB3 C;  4HAI A;  2JEG A;  1RZT A;  2NPT A;  4XYC A;  3PHX B;  4I2I A;  1TAM A;  3I63 C;  5AKI A;  1ZDX A;  5IIK A;  1TJE A;  1AN8 A;  1BNO A;  3KHH A;  3UQ2 A;  1RG6 A;  3BII D;  8ICZ A;  4IQU A;  2ASD A;  1CEZ A;  4Y2X A;  3N3K B;  4YXJ A;  1SIJ A;  3P63 A;  4DHJ B;  4ECS A;  2ZPN A;  5D7G A;  5KFW A;  3RN9 C;  4F5P A;  2LYA A;  3CST A;  4FN2 A;  2JF5 A;  5KFV A;  2KMC A;  1S10 A;  1KFT A;  1SWV A;  2WQY B;  1D6E C;  2FCN A;  2WF8 A;  5EE0 A;  2NO5 A;  2H88 B;  1WE7 A;  9ICI A;  2N0S B;  3LDZ E;  2WF7 A;  2YMM A;  2FCQ A;  4RNO A;  1CQV A;  3KKA C;  2GBM A;  2JY6 A;  4Q45 A;  1ACC A;  5IIO A;  1JWB D;  2ZJ5 A;  3TL5 A;  9ICN A;  1WG8 A;  2HBK A;  2WXI A;  3ZLZ A;  3Q8A A;  1U47 A;  1ED1 A;  3QU4 A;  5K4L A;  4KLS A;  2ZTC A;  2WXH A;  3AU5 A;  2R2Q A;  2PKE A;  4K4I A;  2LM1 A;  3MP9 A;  4ZRJ A;  1SXE A;  2Y0S F;  2R8H A;  1UWM A;  2KAJ A;  3E9S A;  4FJY A;  4F2R A;  2PMZ F;  5KFR A;  4DLG A;  2QB0 A;  2BCQ A;  1SIF A;  4QW9 A;  5E6P A;  1KLV A;  3R9K A;  1NI3 A;  4QIW C;  2FMS A;  2N9L A;  3A1Q B;  3KKA A;  1Y56 A;  3X0W A;  1KOT A;  2LD9 A;  4ICU A;  2H3I A;  3TUO A;  5HP4 A;  4LVS A;  2VA2 A;  1LVH A;  2KKV A;  4GC6 A;  3QK0 A;  4O3Q A;  3VH4 B;  4FFD A;  3AEB B;  4MH0 E;  3CSF A;  2IGD A;  1ZQ1 C;  2D10 A;  3DWM A;  1J2M A;  3GIK A;  3QYP A;  2ZNV B;  4OJ5 A;  2UVR A;  3RPF C;  1JRP A;  2W9M A;  3H1U A;  3EWA A;  2FID A;  2AQ4 A;  3H7I A;  3P1M A;  3K1R B;  8ICW A;  3QEA Z;  2MP2 B;  4EZ6 A;  1BXT A;  2ON8 A;  3AQE A;  5HNK A;  4A6Q A;  1BUI C;  2FLL A;  1L5U A;  1T5X D;  5KFB A;  4FS2 A;  1TYG B;  5IIL A;  4DL6 A;  3BVM A;  4F7Z A;  8ICA A;  3IRU A;  2NRX A;  2W55 A;  4DHJ D;  4UQG A;  5B5E U;  3T8M A;  5L83 A;  4P0P B;  4NAW B;  2JRI B;  2IA6 A;  3ZD8 A;  1F2R I;  1WWU A;  3PO5 A;  1QIL A;  3X23 A;  4K4G A;  4OZA A;  1SZH A;  5DPR A;  5AI8 A;  7ICS A;  1XD3 B;  2WAQ C;  1U45 A;  1ZQW A;  2IDY A;  4HPP A;  3AUO A;  1SV0 A;  2VZK D;  4PL1 A;  1YJ1 A;  1IBX A;  3PMN A;  1NYQ A;  3CP8 A;  2E1E A;  1GG3 A;  1PK3 A;  1OQY A;  3ZO5 B;  5EWF A;  2M56 B;  2RPV A;  5ALW A;  1J7A A;  2KJ6 A;  4NPN A;  5JRT A;  5ALT A;  2LBO A;  1LM8 B;  4BKG A;  2IGG A;  4URK A;  4KLH A;  2FE8 A;  3IFW B;  2QEJ C;  5IIM A;  5J2E A;  1BPX A;  4KX3 A;  2AQ1 B;  4OJL A;  2E1F A;  1Z19 A;  4E0D A;  2KFZ A;  1WYG A;  2G07 A;  2LRW A;  3H7S A;  3WIM A;  5JHB A;  5D6J B;  3KH0 A;  5L1L A;  2DZJ A;  4M0W A;  2DUY A;  2H3Z A;  2WAQ F;  2WX1 A;  1HUO A;  3U52 E;  1P0R A;  4AQ7 A;  3T3O A;  4IRK A;  4I27 A;  5D94 A;  4M8N A;  2YB4 A;  5KFL A;  5J2H A;  5AM1 A;  1QOA A;  3RJH A;  4I29 A;  4QZ8 A;  3MR5 A;  1T0Q C;  3F2C A;  1STE A;  4KLL A;  4DFP A;  2RDG A;  2W03 A;  7ICI A;  2OYY A;  2G45 B;  3WAP A;  4XUS A;  3PRZ A;  2JHD A;  2KYW A;  4RNN A;  2AHO B;  4PS3 A;  5KTQ A;  4O3R A;  2KDE B;  3EZ5 A;  5AK5 A;  4B95 A;  2W3R A;  3V6J A;  3DBR B;  2KJ5 A;  4DQQ A;  2BPF A;  4LLG M;  5AUI A;  1IGC A;  2M17 A;  1JRU A;  5ALR A;  3ONS A;  5G5G A;  1V8C A;  4WH4 A;  3RJK A;  2LXA A;  2KWU B;  3SMV A;  1VJK A;  3RAX A;  4F4X A;  1M4V A;  3I3T B;  3EUB 2;  2K5P A;  2L83 A;  4GSW A;  5CEH A;  2EMT A;  4R65 A;  2BPG A;  1F5S A;  4F93 B;  4JPS A;  4ICV A;  2KLC A;  5ALG A;  5ALI A;  2X8X X;  1RFK A;  4RGT A;  2GBJ A;  3IHQ B;  3ZDT A;  3Q69 A;  4XZ4 A;  4ZYS A;  3TKA A;  1HXY D;  4JWM A;  3OJ3 A;  2GLS A;  3GQC A;  4P16 A;  1TS5 A;  5AM0 A;  5ALN A;  3SEB A;  3WAN A;  4EOY A;  3V7L A;  5J0O A;  2JRZ A;  1WGR A;  2OCE A;  1IV8 A;  2WHI A;  2GLE A;  2HW3 A;  4TQ0 A;  2VKQ A;  4Z6D A;  1ZQP A;  4B0M A;  1CJE A;  4X5V A;  4DFJ A;  3ENE A;  4B6W A;  4QZA A;  3BZD B;  2UVV A;  1KRP A;  2RSU A;  3NY5 A;  4KGR A;  2KIC A;  1B1Z A;  1L3S A;  2B3A A;  1JWA D;  2C7H A;  2KKC A;  3SV3 A;  2NV3 A;  3AU6 A;  1HJP A;  1N6Z A;  2BBC A;  5HHH A;  4YTN B;  3R2T A;  3RRG A;  1LQB A;  3BQ2 A;  2K39 A;  1UT5 A;  3KUC B;  4A20 A;  3LJ3 A;  2KMM A;  1NKB A;  3GZN I;  1ZQG A;  3HM3 A;  3O65 B;  3HRD D;  3WK6 A;  1CRX A;  3RJG A;  1ZQE A;  4LK0 M;  1IIP A;  2M0X A;  4BKT A;  1UQV A;  2D11 A;  1JMS A;  2WXR A;  5FR6 A;  4EZ9 A;  2LWP A;  3FKY A;  4DL3 A;  7ICJ A;  4E74 A;  4PYU A;  4YG2 A;  4YR3 A;  1MQ3 A;  1ZQI A;  2VJ4 A;  2DHZ A;  1T4G A;  3W5U B;  5J2I A;  1ZRN A;  4MH8 A;  1WCN A;  2FBW B;  4WAF A;  1L7O A;  2JRH A;  1WM3 A;  1AWD A;  4P1B C;  1WX9 A;  4KV2 A;  5GMV A;  3ZNG C;  1SBB B;  2MQJ A;  2JEF A;  4WWN A;  2RQ5 A;  4GDK B;  8ICG A;  3JPR A;  5CJ7 A;  4DO9 A;  3AU4 A;  4F5R A;  2KJ9 A;  2BDU A;  3L5K A;  4OCZ A;  4KLM A;  1XLQ A;  2BB6 A;  1TKG A;  3R3M A;  2BPS A;  5HG2 A;  1JW9 D;  4JV1 A;  2BT6 A;  3IG8 A;  4HDO A;  2LHE A;  4B0E A;  3GOE A;  1D8L A;  3HJE A;  1BPE A;  4XWT A;  5CA7 A;  4MM3 B;  4ECX A;  4M8M A;  3SZ2 A;  1C4P A;  1EU4 A;  1PUT A;  1Q3U A;  2BYF A;  2DZK A;  4DFM A;  2FNJ B;  4N58 A;  2JVC A;  3M8S A;  4II2 B;  3N7P D;  1H8C A;  4QZC A;  2JZB B;  2HHV A;  4O5C A;  2G9H D;  4F72 A;  5J29 A;  4ECR A;  1QZE A;  2W9B A;  2IO1 B;  2OM6 A;  4RPZ A;  1F2R C;  4GN1 A;  3U7Z A;  2KG5 A;  2G08 A;  3WAL A;  2C5L C;  2AU0 A;  3ETR A;  2B6G A;  2I5H A;  4MEY A;  4UAU A;  3OG5 A;  4GB9 A;  3OTQ A;  1SE9 A;  3ZJU A;  1WUD A;  2ZIV A;  4IRC A;  1WXM A;  1FNV A;  4CO7 A;  4BX9 C;  3B0X A;  4RZR A;  2KTR A;  2KOB A;  5BOL A;  1ZD2 P;  1SKR A;  4GDL A;  4F5N A;  4NJ6 A;  3PW5 A;  3MHZ A;  3DVN U;  3OPX A;  2JMG A;  1X6J A;  1BPD A;  4JWN A;  1V5O A;  2C7M B;  2LGD A;  4NJ7 A;  3IM1 A;  4WWO A;  4TSS A;  2JH7 A;  1Q5W B;  2VIX A;  4HKZ E;  3QWZ B;  8ICP A;  1JI7 A;  4LNO A;  3KVF B;  4WIP A;  4UB3 A;  1J19 A;  4MJS B;  4C4S A;  2KJR A;  1K1Q A;  4FA6 A;  2BR0 A;  4P1C C;  2W9C B;  3ZYY X;  3N9Y C;  2XY5 A;  3BIN A;  2RDB C;  2I1Q A;  4O1N A;  4J9P A;  3QU9 A;  2DQN B;  3KHL A;  4B9V A;  2XNA C;  3IVF A;  5FR3 A;  2AGO A;  4Y2Y A;  2ZEQ A;  4IM0 A;  1YN5 A;  1KLN A;  1WRI A;  3OHB A;  2P66 A;  3H9D A;  4II3 B;  2ASJ A;  1NOM A;  4XQ8 A;  5BOM A;  3U7D A;  1RRB A;  4ED2 A;  2GO7 A;  4UAZ A;  1XNS A;  3AEV A;  4HPL B;  5DBA A;  2KZZ A;  2YEP F;  8ICV A;  5KAI U;  1V1P A;  3VUW A;  3PSI A;  2M8S A;  5HI1 A;  4M47 A;  4YWG G;  2LUE A;  1NK0 A;  5AKY A;  4DOC A;  4TV3 A;  1UD7 A;  2HTH A;  4C8N A;  3RR7 A;  4F3O A;  1EUV B;  1LXD A;  1UT8 A;  2EAP A;  4F4K A;  1V85 A;  2KE7 A;  2HMX A;  3OJ4 B;  1SGH A;  2IPK D;  4KLT A;  4FZL A;  2IBK A;  1JX4 A;  3ZDM C;  4YP3 A;  2KX0 A;  4JX1 C;  4EZJ A;  4KN7 A;  3JSV B;  2QAR B;  3SD5 A;  4MGI E;  3GIJ A;  4UB6 U;  4LNF A;  2KP7 A;  1WZ3 A;  1WIA A;  2MCN B;  5D46 A;  3M6Z A;  1M6Y A;  5L1J A;  3QCA A;  1CI4 A;  3KHR A;  5IO9 A;  2WU2 B;  4YR2 A;  5KFF A;  4R8U B;  4ECZ A;  3ALR A;  5JUM A;  3UIN B;  2K8B B;  4IG7 B;  5LXH A;  5MPO A;  5ALZ A;  4JWU C;  1FM0 D;  1Q1O A;  5D4B A;  1Z5S B;  4LDT D;  7ICU A;  3ZVV A;  2XY7 A;  1NKE A;  3TAD C;  2BWF A;  4A90 A;  3ZDE A;  4JV2 A;  4C4V A;  1TE2 A;  2DKZ A;  3RAQ A;  2JEJ A;  4G3I A;  5C23 A;  3AI5 A;  4ZYN A;  2W9C A;  4E71 A;  2ZNV C;  2X38 A;  4PHA A;  4ECU A;  1T6B X;  5HMM A;  3BJY A;  4QWE A;  2PFQ A;  3IDW A;  1FCC C;  4G0N B;  1FRD A;  1JWU D;  4PPX A;  3W9C B;  3DBH B;  3C21 A;  2PTL A;  2KKP A;  2HOF A;  2DEN B;  3GE8 C;  3Q3J A;  4F8C B;  4PZO A;  2IGH A;  3BDP A;  4QZE A;  2ZZP B;  4PZN A;  3GV5 B;  3W5V B;  3JVZ X;  3N1Y C;  1CK1 A;  1NKC A;  5TSS A;  4FUL A;  3TAQ A;  3E0F A;  3Q3M C;  1E9M A;  1WGK A;  4Q44 A;  2G5H B;  2G5I B;  4MT5 A;  4YTP B;  5DLG A;  3HPO A;  4P0Q A;  2VH1 A;  2EAN A;  2MHJ A;  2JEI A;  2Y3A A;  4ACO A;  1A70 A;  3Q2A C;  4BBN C;  3C5F A;  3IHP C;  1ET9 A;  4FHJ A;  2ZTE A;  2BGF A;  4UB5 A;  2HBL A;  4ASW C;  3UMC A;  3AE7 B;  2ZCB A;  1E8Y A;  4M9H A;  8ICQ A;  3VUY A;  1DOI A;  1D5X C;  3ZNI D;  4TKN A;  1SJE D;  1YD8 U;  3RNA C;  1UBI A;  2E8M A;  2PE9 A;  2ZIW A;  2NRV A;  3CF6 E;  4ECV A;  1U9L A;  3MGV A;  5CRX A;  8ICS A;  3NUH B;  1C3T A;  1ZRM A;  1DRG A;  2UU7 A;  2D3C A;  1KM7 A;  5J0S A;  5DLF A;  4FBU A;  2BTE A;  4AP4 C;  4Y2P A;  3MHS D;  4D2K A;  1ZQS A;  2IOH A;  1ZQY A;  3F2D A;  4MEL A;  5EE1 A;  2JZZ A;  3RBD A;  1MJD A;  1JWS D;  3VRB B;  3MGI A;  3OGU A;  5T14 A;  1L0V B;  3VTW A;  1NZB A;  5CTR C;  3BZC A;  4DDG D;  4B9L A;  3ZDC A;  4JK1 A;  4ED7 A;  4O3M A;  2K4H A;  2GMI C;  3R8B A;  3ZTD A;  3UPQ A;  4ED8 A;  9ICJ A;  2K8H A;  3NZ3 A;  1G6J A;  2AGQ A;  2K4E A;  9ICQ A;  4F92 B;  2HHX A;  1NK6 A;  1IG6 A;  1TZO A;  4PHD A;  3TEX A;  4DHZ E;  3AH7 A;  2K1F A;  4AJY B;  5BMG A;  2DPJ A;  2O2V A;  1ZQZ A;  2JWZ A;  2N9P C;  4B9U A;  4NLZ A;  4ANX A;  1FXI A;  1NEK B;  3RNF C;  1K52 A;  5DBB A;  2BS2 B;  4XA5 A;  3NVW A;  4QWC A;  4F5O A;  1XU4 A;  9ICA A;  3ETL A;  3QZ8 A;  3JPT A;  1UGM A;  2W7O A;  4C4V B;  3PS6 A;  4TUQ A;  2V3P A;  1V2Y A;  2NRW A;  2PMZ C;  2G09 A;  1DXS A;  2YML A;  2F1J A;  4M00 A;  2NYV A;  3D6J A;  2N1R A;  5DDM A;  5LLI A;  1PGA A;  1RYU A;  4QWD A;  8ICO A;  4RT3 A;  2OEH A;  4M01 A;  3A4R A;  4C8K A;  1ENF A;  1E7U A;  2M0A A;  4DS4 A;  5F9L A;  4ECW A;  2DWQ A;  3OAW A;  3DBR I;  4HCN B;  1YN3 A;  4XDD A;  2KHW B;  4JIO U;  3RNC C;  3W2D A;  2GWS A;  4F5Q A;  4RM8 A;  4YT0 B;  4O3O A;  2J7Q B;  5AI5 A;  1F1H A;  4KLI A;  1MI0 A;  3V60 A;  5DQH A;  2HHW A;  8ICJ A;  4REZ A;  2A3V A;  1S97 A;  1A5R A;  3LYS A;  3QU7 A;  3K9O B;  2H3V A;  5KL1 B;  3BQ1 A;  4NNJ B;  1PZN A;  4F50 A;  3UM9 A;  3DBL I;  4YMM A;  3C29 A;  4EBE A;  3WKD A;  3PO4 A;  2E6X A;  3IT4 B;  4P6V F;  2V4L A;  3T5J A;  3DOW A;  3IXS A;  2KZR A;  3VH3 B;  3AEC B;  2MUT B;  1X40 A;  2I1J A;  4WWP A;  1WGH A;  3Q3N C;  5JXV A;  3DQV A;  5GTI U;  4ZHO A;  2LVP A;  4N6E B;  4Y2R A;  3TFR A;  3Q8M A;  3UGB B;  1LFD A;  4J9M A;  1YJI A;  5JU5 A;  5ALQ A;  1PVP A;  1R7S A;  4TQ1 A;  2RR9 A;  2KSO B;  7ICT A;  4XDC A;  3PY8 A;  3V3X A;  1MC8 A;  1RM6 C;  5E6O A;  5KT4 A;  2CKH B;  1C4C A;  1T8E A;  4LJX A;  1ZET A;  4IWO A;  1JUD A;  5AK6 A;  3OJS A;  1N61 A;  1C76 A;  2PW9 A;  1FIQ A;  4US9 A;  3KD3 A;  2Z0E B;  3GDX A;  3TQ1 A;  4R63 A;  1NJW A;  2ZIX B;  5JZE B;  2LGI A;  1BT0 A;  4USA A;  2KN5 A;  2BF8 B;  2EKE C;  1S0O A;  3RI7 C;  2KN4 A;  1O03 A;  5E79 U;  3NJT A;  5LNK 1;  3BK2 A;  5D49 A;  3SDL C;  4KLG A;  3QAQ A;  4KLO A;  1HZ5 A;  1F44 A;  1EF1 A;  1B4F A;  1N56 A;  2Q5W D;  4UB1 A;  3MC0 B;  1VDV A;  4J9S A;  1JQ4 A;  2W9B B;  1SKS A;  1R4N I;  2J0K A;  4FBT A;  2LGY A;  2JZB A;  4R66 A;  1GOZ A;  4JQW C;  2FPL A;  2RDH A;  1TKE A;  5J2G A;  3PZP A;  3SFD B;  3WK7 A;  2MU2 A;  3N4M B;  3PNC A;  1XLN A;  2KSO A;  1E90 A;  3WKA A;  3F5E A;  2P6U A;  1L0X B;  4MFC A;  5ALU A;  5J8Y A;  1XC9 A;  2YMQ A;  3HIZ A;  3QC8 B;  3LVV A;  4FJV B;  5DB6 A;  3OSP A;  3ICX A;  3HW8 A;  1Z00 B;  2A1A A;  5AZG A;  1QLB B;  2LYB A;  5BYQ A;  1L7M A;  4O3P A;  3U2S C;  4TQS A;  7ICF A;  3A0H U;  5DG7 A;  1YX6 B;  2P35 A;  2PE6 B;  4LNI A;  3SAH A;  2BQ3 A;  4I2F A;  3LK9 A;  3T79 A;  1GB1 A;  2A1J A;  1I4R A;  4ANU A;  5CP2 A;  1IXR A;  5DGB A;  1WMH A;  4DXA B;  1XWL A;  4C8M A;  4DK5 A;  2K22 A;  3AE6 B;  5H92 C;  4YQW A;  5KG7 A;  3LWM A;  2M19 A;  3JPP A;  2D3B A;  2I2Y A;  4YL8 A;  4WQM A;  7ICM A;  2CS4 A;  3ECI A;  2V4Q A;  2HDE A;  3M62 B;  2FPM A;  1URJ A;  2D8C A;  2D07 B;  2D3A A;  4NWI A;  5AI0 A;  2OH2 A;  1V1P B;  4FHK A;  4GXJ A;  4ANW A;  3DVN V;  4RQ3 A;  4M0A A;  5F9N A;  1C20 A;  1UA1 A;  1KKX A;  1WR1 A;  3H8W A;  1XS9 D;  3NG0 A;  2L76 A;  3J9C A;  2DAJ A;  2V1Y A;  2A19 A;  4BJQ A;  4TMA B;  4RUA A;  4G9B A;  1P98 A;  3DVG Y;  2PLP A;  4KKJ A;  5CHF A;  1WZ0 A;  3URY A;  4P4O A;  2QKQ A;  3JPS A;  1ZQJ A;  2KHV A;  1HEK A;  1TY0 A;  3PSE B;  4IR9 A;  4JWS C;  1QQ6 A;  9ICP A;  4C0Z A;  1J97 A;  4CDG A;  2V4R A;  2XBB C;  4A3P A;  5KFM A;  3FM9 A;  3DDH A;  1R4M B;  2ZCC A;  3MFH A;  2WXN A;  3M3J A;  4BUG A;  1TFR A;  4FE3 A;  2R8G A;  4I6N B;  3KZI U;  4DWF A;  1UPH A;  4LZG A;  4QW8 A;  4ITK A;  2NBW B;  3B08 A;  2R18 A;  2PFP A;  5C0Y A;  1ZQN A;  2BCU A;  3ONN A;  3GS2 A;  1Q3V A;  4AS1 A;  4UB4 A;  3IT6 B;  1MSW D;  5ALO A;  3VHT C;  3MFI A;  3G6V A;  1L7P A;  3KUZ A;  3E58 A;  4DL4 A;  5IOI A;  2ONQ A;  4DEZ A;  3CMM B;  4CF4 A;  2JXX A;  1D8B A;  3AE1 B;  2ZIU A;  4B9K A;  4I2D A;  1K51 A;  2JU6 X;  3MBY A;  2DNF A;  4B9T A;  4OHJ A;  3ZGZ A;  4JMU A;  2IY1 B;  3GZN B;  3DHH C;  2H3F A;  2ZXH A;  1QKZ A;  2GRI A;  5CHV C;  2M4N A;  8ICM A;  3I5J C;  1N48 A;  1TS2 A;  4YD1 A;  2KWD A;  3WK8 A;  3VTV A;  5J0U A;  4MFA A;  2KWV B;  1OW5 A;  2L1A A;  8ICT A;  4NLC A;  1XSP A;  2Q4T A;  3RNB C;  4NV0 A;  1RYS A;  2KXJ A;  4N59 A;  3LB8 C;  4QZG A;  3B0Y A;  3HHM A;  3KFU F;  2E8P A;  4J9Q A;  3W1S A;  5ALH A;  1O08 A;  3VXW A;  4EZK A;  4QZH A;  4UBB A;  4I28 A;  2JV3 A;  3PR4 A;  5KFC A;  3Q8F A;  1TAQ A;  2XID A;  2IBI B;  3PW4 A;  3HIL A;  4IQV A;  2G06 A;  4YMO A;  2WDT B;  3NOB A;  3Q8E A;  3DVG X;  1L6U A;  4HDQ A;  1NBF C;  3IBE A;  2C22 A;  3SI8 A;  2DGZ A;  2PKO A;  5FK9 C;  7ICO A;  3ZJV A;  4DSK A;  5TZV A;  4P0Q B;  1ZQV A;  3OLM D;  3P4S B;  2ICI A;  4N9F 4;  3LDA A;  1IM4 A;  2XGQ A;  2IY0 B;  2BWE S;  4ZRQ A;  3PX4 A;  2Y1I A;  1Q8K A;  5AKJ A;  4YMN A;  2QIL A;  1F0Z A;  3BS7 A;  4M9J A;  1RYR A;  2KDB A;  2NVU I;  3EGR A;  3A0B U;  8ICE A;  3AE8 B;  2XI9 A;  3P4R B;  2I1K A;  4RQ8 A;  2AL6 A;  3T5H A;  3PZ8 A;  4Y2J A;  3IG3 A;  3P4P B;  4F71 A;  5IKC M;  5KFN A;  5AHX A;  3GV8 B;  4CCH A;  2MBQ A;  1ZQX A;  3AEA B;  2K8C B;  4TUU A;  3I57 A;  4M9N A;  2LYH A;  5J0Q A;  4PS8 A;  4QWA A;  2LFI A;  3N7R C;  2IMW P;  4ED0 A;  3GFK B;  1V38 A;  1ZP0 B;  4NQK E;  3WKB A;  3EYZ A;  2Y0S C;  1ZQK A;  4BVU C;  2RGF A;  4DXF A;  4WAA A;  2AJQ A;  1V81 A;  1X42 A;  2IOF K;  3TFS A;  1NZP A;  5KFQ A;  2V4I B;  1BPB A;  1CUK A;  4UAR A;  2MBH A;  1Z00 A;  2OWO A;  1KSP A;  2EH9 A;  1QOG A;  4KLD A;  4DCC A;  4WJP A;  2I9G A;  3RNE C;  3IP4 B;  4ICA A;  3AE5 B;  4OVZ A;  2KDF B;  2QAR A;  3ZI4 A;  2NBV B;  1WXS A;  1JAL A;  4BWM A;  4M04 A;  5J17 A;  3VQI A;  3VR8 B;  4GMV A;  1KBU A;  1X2I A;  7ICL A;  1PUZ A;  2VZK B;  3JYU A;  2QB0 B;  1N60 A;  2RRD A;  3TAP A;  3WA0 A;  2KFJ A;  1Z3E B;  4HRO A;  3KUD B;  4B6J A;  4EEL A;  1EM7 A;  5IIJ A;  5J0W A;  8ICX A;  2KT7 A;  4AP9 A;  1KLU D;  3RJF A;  2MBB B;  1SWW A;  3H0L B;  2OXO A;  1WR6 E;  2DZM A;  1L0Y B;  3AV8 A;  3A4S C;  4M6W B;  3QA8 A;  1TZ1 A;  3WAM A;  3RB0 A;  2AL3 A;  4O3N A;  2INN E;  3IN5 A;  2LZ6 A;  2W8L A;  4JGH B;  2DF4 B;  4UAT A;  1JXL A;  3PZD A;  1RWS A;  5J2K A;  3Q8S B;  4BFR A;  4C8L A;  1E8Z A;  1ZQO A;  4K7S A;  1QLN A;  1DK3 A;  3HWT A;  5DQI A;  1XO3 A;  2GI9 A;  1WX8 A;  3ALB A;  4DFD A;  2PMV A;  2RDI A;  8ICY A;  3PLV A;  1J8C A;  1HE8 A;  5ALK A;  3C2L A;  1N5X A;  4OD0 A;  1TK5 A;  4UAW A;  3RCZ A;  2BB5 A;  9ICT A;  2REX A;  3PZ7 A;  1Q10 A;  2OED A;  4RT2 A;  2L3Z A;  1YX5 B;  2MUT A;  1WI0 A;  1L3V A;  2C28 A;  2MEK A;  1SEB D;  1S5L U;  4BZA A;  1XSN A;  2NR2 A;  1I4Q A;  1HTO A;  1OUQ A;  1KTK A;  4OVU A;  2C9W B;  3CW2 C;  4DLE A;  2YEP B;  2KQ7 A;  2KLG A;  4M6W A;  3MR2 A;  5DGA A;  4WQO B;  2PFO A;  4GXI A;  2L0F A;  4P2H A;  4NLB A;  4BKS D;  1CZP A;  4H2A A;  2NBU A;  2VRR B;  2LI6 A;  2WWZ A;  4PH5 A;  4P0P A;  2PVG C;  4NAW A;  1D4B A;  4IM2 A;  4NQL B;  1Y8R C;  2KTF A;  4NL9 C;  3RD2 A;  4GIB A;  2QJL A;  4RPX A;  3PTF C;  1DOY A;  3V05 A;  2ZIU B;  1QOB A;  1V5T A;  3RB3 A;  1SE4 A;  5E6N A;  2KIV A;  3VTU A;  3MJW A;  1L4D B;  3M9M B;  2JYT A;  4W9H A;  3M9O B;  1NK4 A;  4DWI A;  4EX6 A;  2KIW A;  2LMC A;  1B43 A;  4GIV A;  1WXQ A;  3DPD A;  4DQR A;  1U48 A;  5JHA A;  4KLU A;  3P4Q B;  2FCS A;  2YN4 A;  5ALJ A;  2FE9 A;  4CE6 A;  4PHP A;  1LGR A;  1GB4 A;  2BCR A;  5JTI A;  2RLT A;  5KFK A;  1EF5 A;  1WXA A;  2UYZ B;  3V6H A;  4UAY A;  5EOZ A;  1KQQ A;  2BDP A;  1A77 A;  4NJ8 A;  3PW0 A;  5L9X A;  2ASQ A;  3HT3 A;  2J42 A;  4C80 A;  3H8H A;  3VDZ A;  5KT7 A;  2A5U A;  2YLM A;  4RQ6 A;  3H6N A;  4ELT A;  2K8C A;  4QZD A;  2LGX A;  2ZUC A;  1VR9 A;  3QUT A;  4RQM A;  2AQ3 B;  5KFT A;  3DHI C;  1I4H A;  1Y88 A;  3N30 A;  3QEB Z;  4ANV A;  2VJ5 A;  1ARO P;  3UMG A;  2V0G A;  3P2B A;  3L54 A;  2EAM A;  5J2B A;  2LGS A;  4A55 A;  3BQ0 A;  3T5L A;  5J0T A;  1FMA D;  3RZF A;  4P7I A;  1FXT B;  3VAW A;  3BZK A;  3ED5 A;  4C56 C;  1QQ7 A;  2LMR A;  2XY6 A;  1V80 A;  3MTN B;  1J7C A;  1Q0W B;  3UIP B;  4IQW A;  2BPC A;  3L10 B;  1TBE A;  4DSF A;  3H8J A;  1D9D A;  4Q8F A;  1WMH B;  5ALE A;  3PST A;  4IDI A;  8ICI A;  2DFL A;  3AE9 B;  4KMU A;  5AKE A;  3J81 j;  2K4I A;  4C4R A;  2KK8 A;  4LTU A;  2BKR B;  1MG4 A;  4A9A A;  4Q43 A;  2FIF A;  1ZXI A;  2JZP A;  3VFK A;  2ASL A;  2AEH A;  4W9F A;  8ICF A;  4Z6C A;  2D3D A;  1XXG A;  1ESF A;  4IW0 A;  1A6S A;  1RQN A;  1K53 A;  4UAV A;  1AYF A;  3O13 A;  4G3X B;  5LXI B;  5DBC A;  1R4M I;  2Y1J A;  2WNM A;  2KFN A;  2FDR A;  4KVG B;  1X1M A;  2BCV A;  2K3U A;  4W9D A;  4M9G A;  5H8Y E;  2E5S A;  1A76 A;  2MAX A;  9ICV A;  5J2R A;  3QUB A;  4O9M A;  3E2E A;  7ICP A;  1FXA A;  4PL2 A;  4J9L A;  4Y2V A;  1KLG D;  4DDI D;  3VVW B;  1U49 A;  2FPK A;  4DQP A;  2N7E A;  3KYD D;  4W9J A;  4W9I A;  1WFY A;  3Q8B A;  1WX7 A;  1KL9 A;  2ISP A;  5D3I B;  2Y5B B;  3NZS A;  4FBJ B;  2I6X A;  1SL1 A;  4KDI C;  2CHZ A;  2FJ6 A;  2F1I A;  1N2X A;  3HVD A;  9ICX A;  4MEM A;  2HJ1 A;  4RH6 A;  2R8K A;  1XCT L;  4NXZ A;  1UH6 A;  2V9W A;  2ZIX A;  1Q46 A;  1SL2 A;  1HZ6 A;  2CJN A;  3A9J B;  2G1E A;  3KWV A;  3PLU A;  3K9P B;  2GOW A;  1QQ5 A;  3DBH I;  4DSJ A;  1M94 A;  3TEY A;  3EPG A;  2FMQ A;  5AKK A;  4CHK A;  2VA8 A;  3Q8L A;  1IUE A;  4J9O A;  2V3N A;  5AUK A;  4UB8 U;  1SJH D;  3B2F A;  4RQ7 A;  2EZX A;  2WB1 F;  3NRW A;  3AMZ A;  4HEA 1;  1GO3 F;  3WCQ A;  4JL9 A;  4RM9 A;  4YSY B;  4EE2 A;  4Y2T A;  4IC9 A;  2M9N A;  1WGD A;  4ZHP A;  1ROE A;  2K8B A;  3DV9 A;  4GLS C;  2JXJ A;  1JIH A;  2ZUB A;  3ZJT A;  2HHS A;  1YT3 A;  2L5Y A;  5AM2 A;  2KZ3 A;  3Q8Q B;  5IA7 A;  1BPY A;  3H40 A;  1KW4 A;  1FEZ A;  3JSV A;  1C78 A;  3DDC B;  3AEE B;  2EAO A;  2E3T A;  2ISO A;  1RPL A;  4BOS C;  2YMP A;  3SYZ A;  3AM9 A;  1MA7 A;  1BVS A;  3JPN A;  2IJ0 A;  3GP7 A;  2W11 A;  1L6N A;  3LYY A;  5ALD A;  4I2B A;  1L7Y A;  1MHH E;  3PHW B;  3L08 A;  5BYR A;  3M95 A;  1MVK A;  2EZZ A;  4BXO B;  4NM2 A;  5KAF U;  7ICQ A;  3DBS A;  1MHX A;  2W04 A;  4FJZ A;  1XQQ A;  3HX0 A;  1ZPS A;  2XK5 A;  1NK7 A;  2R8J A;  2WXO A;  3DCG A;  1MPE A;  2WXG A;  3LXF A;  5J2C A;  3GIM A;  2W8K A;  3U4E G;  5BYS A;  4RQ0 A;  3RH5 A;  2IHN A;  1L5P A;  2MJD A;  3PSF A;  4KX6 B;  2FLP A;  4EBD A;  2C60 A;  1QF6 A;  1C4A A;  2XCA A;  1TIF A;  4IKG A;  1ZXH A;  5ALY A;  4ACF A;  5KT5 A;  3FIL A;  2CHX A;  2GBR A;  3L17 A;  3E56 A;  2ZXI A;  2F8K A;  1K5O A;  3THV A;  3TEZ A;  3VUX A;  5KHQ A;  1T0Y A;  4PT5 A;  3U30 A;  1Z1B A;  4MSQ B;  4CF5 A;  2HHU A;  1BNP A;  3A1Q A;  5AI6 A;  2F8L A;  4MJS A;  3B0A A;  3UXO A;  4AYB F;  1UWX A;  1WJ6 A;  8ICN A;  5KFS A;  5T8I A;  1N63 A;  3I76 A;  3BVG A;  1V49 A;  3BYY B;  3V62 A;  3HP6 A;  1UGJ A;  1ZQF A;  4DF8 A;  2RD0 A;  5GTH U;  4L1B A;  4NLK A;  1C1Y B;  1VZ8 A;  2KTR B;  2NTS A;  4OJO A;  1KRH A;  5AEK B;  9ICR A;  2UVW A;  5AKG A;  3Q8C A;  2JGA A;  2WF9 A;  5DG9 A;  3QUC A;  7ICE A;  1D5Z C;  2QDF A;  2V9H A;  5KFH A;  3LWL A;  4JUZ A;  1WJU A;  1I42 A;  4F8R A;  3H0R B;  2KVS A;  7ICH A;  4RQ1 A;  5J0X A;  2M1M A;  3TMP B;  5KFD A;  3NVZ A;  5CB1 A;  1N62 A;  4W9C A;  2F77 X;  4B9S A;  2H5X A;  1S0M A;  4FLH A;  2BKF A;  1WCL A;  3QX7 A;  5KFI A;  4GOC A;  1FO4 A;  4Y2U A;  3TIX A;  5J2A A;  2O6K A;  1RQL A;  3W1Y A;  1ZUD 2;  3RT3 B;  4UAS A;  4P4P A;  3QAR A;  5DG8 A;  1WF9 A;  3AQF A;  2ZIW B;  3JPO A;  4I2C A;  2N1W A;  4A8X C;  1PGX A;  8ICK A;  3RMK C;  2QIE B;  3U8Z A;  4C7Z A;  1V9J A;  1ZQU A;  3PVL A;  3PRM B;  3TAC B;  1WM2 A;  4TUP A;  5FKA C;  2PFN A;  2ES6 A;  1IP9 A;  4RCO A;  2NPT B;  1AQ6 A;  5IIN A;  1LO5 D;  3C5G A;  2CN1 A;  1GAQ B;  2B76 B;  9ICE A;  1YJJ A;  2J0M A;  2QHO A;  1T7P A;  4XGA B;  4EYH B;  4PYZ A;  5G5H A;  3T5K A;  2KC1 A;  3TCA A;  2ALZ A;  5DPS A;  2GOL A;  2HBJ A;  1BML C;  2FCM A;  4LDT B;  3OJU A;  3ISB A;  3L16 A;  4YXD B;  1X6I A;  4IL6 U;  2WXJ A;  7ICV A;  4BKS A;  2BYT A;  5JH5 C;  4MSM B;  5DCN A;  1HA5 A;  2HHT A;  3PT2 B;  3H0M B;  4BGD A;  3RJI A;  2QLT A;  2BZF A;  1WWT A;  1GJZ A;  4I2H A;  2WXM A;  2XC9 A;  5DQG A;  4MGZ E;  3RJE A;  4S17 A;  2C2D A;  4M9L A;  1OEY J;  1TT5 B;  2JXT A;  2DL0 A;  5KFX A;  1UEL A;  1NJX A;  2MJE A;  1UNS A;  4S0R A;  1X66 A;  5J0R A;  2GBN A;  2LI5 A;  9ICM A;  1YNT E;  5A0L A;  5ALL A;  4MFF A;  1T0R C;  3TI0 A;  2C2R A;  5KG5 A;  1XF5 L;  4HLE A;  4J9K A;  4WWM A;  1NEN B;  2KQS A;  2L8J A;  4K4H A;  1NYR A;  3NHE B;  4YVZ A;  1I4P A;  3QIJ A;  1YQ4 B;  4I2J A;  1HIW A;  4F4Z A;  1NJY A;  2IND C;  1KH0 A;  2KQ4 X;  4MAC A;  1QOF A;  2LRU A;  5KT3 A;  2BVC A;  2ZW0 A;  2W43 A;  4P4M A;  3CNH A;  5DB7 A;  5CR0 A;  9ICH A;  9ICC A;  5KFU A;  4ARI A;  3HKZ C;  1SXT A;  5AZH A;  1TGZ B;  3MR6 A;  4HJK A;  2WXQ A;  4IS7 A;  3OSN A;  4DBG A;  3AE4 B;  1QQR A;  1I4X A;  4L23 A;  1GC7 A;  3K1Z A;  2DBY A;  1ZYQ A;  3A9K A;  5C3J B;  3RH6 A;  5KG2 A;  4DQS A;  3QX1 A;  5D2M B;  1VZ6 A;  4EFO A;  7ICK A;  4EEY A;  1UBQ A;  3CYM A;  4AYB C;  2MA9 B;  3AUL A;  3D32 A;  3MFG A;  2KDI A;  2FLN A;  2EZY A;  4F4W A;  3S2A A;  1T94 A;  2PEA A;  4HRS A;  4I6L B;  1OXJ A;  4HPM B;  2G4S A;  4GXK A;  4NLG A;  3RUL A;  3A33 B;  3SD7 A;  2MLB A;  3APC A;  3FDS A;  3ZRC A;  4WJO A;  2AQ0 A;  2A1J B;  1C79 A;  4DSL A;  2WF5 A;  1NK8 A;  5KFG A;  1QCK A;  2MJ3 A;  3QQ8 B;  3GB1 A;  2HDO A;  4LNK A;  3KYC D;  3K75 D;  2RPQ A;  2DYO A;  2KD0 A;  4ED3 A;  1UF0 A;  4AOF A;  5IP4 D;  2K9X A;  2AH5 A;  3UQB A;  3M6K A;  5EWE A;  1E7P B;  2KO3 A;  4AUQ C;  3ZW3 A;  1MQ2 A;  4F2S A;  2BS4 B;  2PI4 A;  2IYD B;  3EFC A;  4YFK A;  5AKL A;  5DB8 A;  1P1A A;  4KKI A;  9ICU A;  2MW5 A;  5AKH A;  5ALP A;  1JCK B;  2ZVO A;  3MC1 A;  4MGK E;  4Y2S A;  3UQA A;  2RDJ A;  2TSS A;  4KSK C;  2ATL A;  1E7V A;  2XIC A;  5KNI A;  1L6V A;  3F5A A;  5CWR A;  2WTF A;  3APF A;  2R61 A;  1R4N B;  5CHG A;  3ML9 A;  5J18 A;  1IBX B;  3M63 B;  4NAM A;  5DB9 A;  1PK1 B;  4KIT B;  3R2I A;  3RTV A;  1QSS A;  5KHO A;  2KN7 A;  1YZ6 A;  2PVO D;  2HI0 A;  2VH2 A;  4XRH A;  2ZIV B;  2N9K A;  3ZD9 A;  2DZI A;  3IG5 A;  4ZRK A;  4W9L A;  3ZDB A;  3N1X C;  1TKD A;  3RBE A;  3Q8K A;  2PI5 A;  4A3O A;  2J4X A;  3SAG A;  1J7B A;  5E6J A;  1COO A;  3ZDD A;  2WFA A;  2O6V D;  2WYQ A;  2WB1 C;  4NLN A;  5KFE A;  2K8A A;  1I7H A;  3ZIM A;  1TK0 A;  4F91 B;  5DPW A;  3PO0 A;  4ARC A;  1GPX A;  2JUO A;  1NDD A;  1PVQ A;  1F77 A;  2FAZ A;  1K1S A;  1E8W A;  1YN4 A;  3IAS 1;  1ZJN A;  1E5W A;  4C7Y A;  1FNU A;  3AB5 A;  4L2Y A;  4NY0 A;  3AEG B;  3ORY A;  4GXB A;  1QTM A;  5AM5 A;  1ZQA A;  3EPI A;  1YOV B;  3H7P A;  3C28 A;  2LJI A;  3TAD A;  4RQ4 A;  2KWC A;  3ZKJ C;  2ZJA A;  1UUP A;  2AWT A;  4DS5 A;  1D5M C;  4CNQ A;  4UB2 A;  4RGO S;  3HKZ F;  3RF9 A;  3ZTC A;  3GZF A;  4KZ0 A;  3N32 A;  4GGQ A;  1ZQT A;  2LHD A;  2BGW A;  3AXC A;  5KFY A;  1AW7 A;  2DAF A;  4I2A A;  3Q3F A;  2J6T A;  4KIK A;  4FZM A;  4FZN A;  3KTQ A;  4M2Y A;  9ICF A;  3V61 A;  4US8 A;  2IO3 B;  3TJP A;  2MA1 A;  3PV8 A;  4YTM B;  2MSN A;  4RNA A;  2V3S A;  1HEZ E;  1NNL A;  1L8L A;  2OJR A;  3SFE B;  3ISD A;  5AKZ A;  2PXI A;  5HHI A;  2KEY A;  4QZI A;  4B9M A;  5KG1 A;  1NI2 A;  5EDS A;  3MAB A;  4DFK A;  2ZW1 A;  2P6R A;  4M02 A;  3ZDA A;  2K60 A;  3VCB A;  2EDU A;  2BW2 A;  3HUI A;  5BO4 B;  4FS1 A;  1TKY A;  1VCB A;  5ALX A;  3QHT A;  3RFA A;  3B9J A;  3OHA A;  1F0M A;  3PX6 A;  1KFS A;  4O5K A;  2KMA A;  3BQT A;  5HFY A;  4I6P A;  3R7Q A;  3WKC A;  1DOQ A;  4J03 A;  3G6X A;  4KTQ A;  5AI4 A;  4HK2 A;  3VR9 B;  4HVB A;  3WKE A;  4DXG A;  4Q2J A;  3PSP A;  5KG3 A;  4RNM A;  3Q3O C;  2KTQ A;  3NVV A;  3C2M A;  2YY6 A;  9ICB A;  1SE3 A;  4RMA A;  4XX5 A;  1V1O A;  1TY2 A;  3RRH A;  4MDK E;  2O2V B;  5J2D A;  2JPH A;  2LXC A;  4RPY A;  1PYW D;  3MGH A;  1L8O A;  3PVX A;  4W9E A;  2ZPY A;  4LJO B;  2MBE A;  4GLX A;  3V6E B;  3EFU A;  4EUT A;  4GDL B;  1V97 A;  2J0J A;  3PPA A;  1SV4 A;  4IRD A;  5KFP A;  5I4D A;  1EWY C;  2ZVN A;  1RDF A;  2HTM E;  4IWQ A;  1SE2 A;  1ZW7 A;  3MC8 A;  4K81 A;  4MEX A;  3Q6B A;  4O0I A;  5IAA C;  3AN1 A;  1VRA B;  4MHV A;  2D6F C;  1K8R B;  4RQ2 A;  2WXK A;  4WUR A;  1FFV A;  2WS3 B;  3KW5 B;  2J52 A;  1Z2M A;  3T3N A;  3C1Z A;  4WJN A;  1ZQC A;  1C77 A;  1HQR D;  5AIB A;  2VA3 A;  4IQT A;  1P9D U;  3M7D A;  2WDQ B;  3ZRF A;  4R64 A;  4I2E A;  1D9F A;  1OTR B;  1TK8 A;  1QH9 A;  3ISC A;  4YN4 A; 
#chains in the Genus database with same CATH homology
 4A9A A;  3BII D;  1ZXI A;  2JZP A;  2WDV B;  1FXI A;  1NEK B;  1K52 A;  2BS2 B;  1XXG A;  1RYJ A;  3NVW A;  1ESF A;  1SIJ A;  1FRR A;  3P63 A;  1EU3 A;  1K53 A;  5D7G A;  1AYF A;  3O13 A;  2JSV X;  2ACZ B;  2WNM A;  2V3P A;  2WQY B;  1QT9 A;  2K3U A;  1D6E C;  5EE0 A;  5H8Y E;  2H88 B;  5BMH A;  3BVZ A;  2EEL A;  1FXA A;  1PGA A;  3FC4 A;  1KLG D;  2N0S B;  3AEF B;  4YSZ B;  1CQV A;  2EKI A;  2PIA A;  1ACC A;  3Q8B A;  1JWB D;  1ZE3 D;  1ENF A;  2M0A A;  5D3I B;  2WXI A;  4JE3 B;  2DWQ A;  3Q8A A;  2WXH A;  1P7E A;  1XCQ L;  1YN3 A;  3HVD A;  2J53 A;  2W54 A;  4XDD A;  3W2D A;  3MP9 A;  3HVZ A;  4YT0 B;  4RH6 A;  1UWM A;  1XCT L;  2KAJ A;  3E9S A;  1MI0 A;  1OFF A;  4REZ A;  1HZ6 A;  2CJN A;  1B9R A;  2G1E A;  3KWV A;  1NI3 A;  2SEB D;  2N9L A;  2AQ2 B;  3TEY A;  3AED B;  4NZL B;  1Y56 A;  3TUO A;  1KF6 B;  2E6X A;  1IUE A;  3IT4 B;  4P6V F;  2V3N A;  3EA6 A;  3IXS A;  3AEB B;  2WDR B;  3AEC B;  5AUK A;  1SJH D;  3B2F A;  2IGD A;  5JXV A;  3DWM A;  2W3S A;  2H89 B;  4ZHO A;  3AMZ A;  4HEA 1;  4N6E B;  3RPF C;  1JRP A;  2K0P A;  3FIL B;  3WCQ A;  1SSN A;  4YSY B;  2LUM A;  1YJI A;  1R7S A;  4EE2 A;  4TQ1 A;  1E10 A;  3P1M A;  3SR6 A;  4ZHP A;  1ROE A;  4GLS C;  4XDC A;  3V3X A;  1RM6 C;  3ZJT A;  1C4C A;  1FD6 A;  3RFZ B;  1BXT A;  2ON8 A;  1PGB A;  1N61 A;  1C76 A;  4A6Q A;  1BUI C;  1C78 A;  1T5X D;  1TYG B;  2PW9 A;  2RMM A;  1FIQ A;  4US9 A;  3AEE B;  2E3T A;  2WXP A;  3BVM A;  4RGN A;  4ZRP A;  2W55 A;  2LGI A;  4USA A;  4NAW B;  3VRA B;  3AM9 A;  2KN4 A;  1F2R I;  3AE2 B;  2IJ0 A;  3GP7 A;  5LNK 1;  1QIL A;  3LYY A;  3BK2 A;  1MHH E;  4OZA A;  5BYR A;  4XWW A;  1HZ5 A;  1MVK A;  2IDY A;  2Q5W D;  2Y5P A;  3MC0 B;  1VDV A;  2VZK D;  2WXF A;  1MHX A;  1JQ4 A;  3AE3 B;  1IBX A;  4RF1 A;  1GOZ A;  1ZPS A;  2WXO A;  1MPE A;  1NYQ A;  3LXF A;  2RDH A;  1TKE A;  3SFD B;  3U4E G;  5BYS A;  1KFY B;  1XLN A;  2M56 B;  2MJD A;  1L5P A;  2RPV A;  1J7A A;  1ZOY B;  4KX6 B;  1L0X B;  2CU3 A;  1QF6 A;  1C4A A;  3I9V 1;  2IGG A;  4IKG A;  1ZXH A;  2FE8 A;  2QEJ C;  2NTT A;  1DYQ A;  1QLB B;  3BK1 A;  1PFD A;  3FIL A;  2OHF A;  1VZ7 A;  2AQ1 B;  3E56 A;  5BYQ A;  4YSX B;  1WYG A;  3U2S C;  3TEZ A;  4PT5 A;  4M0W A;  3U52 E;  1TS4 A;  4AQ7 A;  1GB1 A;  3T3O A;  3UI3 A;  1I4R A;  4KGT A;  1UWX A;  5T8I A;  1QOA A;  2XN9 C;  1N63 A;  3BVG A;  4RF0 A;  3BYY B;  1STE A;  2K22 A;  2RDG A;  1UGJ A;  3AE6 B;  1P7F A;  4L1B A;  5H92 C;  4CQN A;  1VZ8 A;  2M19 A;  2NTS A;  1KRH A;  4R3D A;  2I2Y A;  4WQM A;  3Q8C A;  2HDE A;  2W3R A;  1ZDV A;  1D5Z C;  2WP9 B;  1V1P B;  1FFU A;  4OZC A;  4LLG M;  3CIR B;  3KQ4 A;  5AUI A;  1IGC A;  2BS3 B;  1C9F A;  5G5G A;  1V8C A;  4WH4 A;  3J9C A;  3NVZ A;  1VJK A;  1M4V A;  1EWC A;  3EUB 2;  2K5P A;  2L83 A;  4HKQ A;  1N62 A;  4TMA B;  2PLP A;  4KKJ A;  3URY A;  5C2T B;  3TEW A;  4JPS A;  4XE0 A;  1FO4 A;  3B2G A;  1TY0 A;  1RFK A;  1ZUD 2;  4JWS C;  4RGT A;  3Q69 A;  2WXN A;  4ZYS A;  1HXY D;  4A8X C;  4P16 A;  1PGX A;  1TS5 A;  3BYT B;  3SEB A;  2QIE B;  3DWG C;  3BWU D;  4C7Z A;  4TQ0 A;  4ITK A;  4OW0 A;  5EE3 A;  3FAH A;  4B0M A;  1CJE A;  5FKA C;  3GS2 A;  1XLP A;  4AS1 A;  4RCO A;  3BZD B;  3IT6 B;  4KGR A;  1B1Z A;  1LO5 D;  1JWA D;  2ONQ A;  1GAQ B;  2B76 B;  3NS1 A;  1YJJ A;  2BBC A;  1ET6 A;  4YTN B;  3P42 A;  2KAC A;  1K50 A;  3R2T A;  3AE1 B;  5G5H A;  1YQ3 B;  1K51 A;  2KMM A;  2JU6 X;  1BML C;  4YXD B;  3HRD D;  4OHJ A;  2WXJ A;  3ZGZ A;  4LK0 M;  2BYT A;  1QKZ A;  2GRI A;  2WU5 B;  1IGD A;  2L32 A;  1HA5 A;  2WXR A;  5HHD G;  1TS2 A;  1WWT A;  4HJG E;  2WXM A;  2KWD A;  4FXC A;  1OQQ A;  1FEH A;  3W5U B;  2L1A A;  4MH8 A;  2FBW B;  4WAF A;  2JXT A;  1AWD A;  1I4G A;  2MJE A;  1UNS A;  2LEK A;  1SBB B;  3LB8 C;  4N59 A;  4GDK B;  1YNT E;  3W1S A;  2L52 A;  1XF5 L;  3Q8F A;  4WWM A;  2DYM A;  1NEN B;  5HG2 A;  2BB6 A;  1XLQ A;  1NYR A;  1TKG A;  2NMQ A;  1JW9 D;  1I4P A;  1YQ4 B;  3Q8E A;  2BT6 A;  4OZB A;  1KH0 A;  2KQ4 X;  2LHE A;  4MAC A;  1QOF A;  4B0E A;  2ZW0 A;  1L6U A;  4UDU C;  4XWT A;  4ARI A;  4MM3 B;  1SXT A;  5FK9 C;  2PKO A;  1C4P A;  1PUT A;  1EU4 A;  2WXQ A;  3ZJV A;  4N58 A;  3AE4 B;  1QQR A;  1I4X A;  4L23 A;  2G9H D;  3P4S B;  5C3J B;  2DBY A;  2ICI A;  1F2R C;  3U7Z A;  1VZ6 A;  4ZRQ A;  5GXG B;  2QIL A;  3MFG A;  3ETR A;  1F0Z A;  2QSD A;  2JYE A;  3CWI A;  2W82 A;  3EGR A;  2QMT A;  3ZJU A;  1FNV A;  3AE8 B;  3P4R B;  4HRS A;  3PZ8 A;  3MHZ A;  2Y5C A;  1JRO A;  3P4P B;  3AEA B;  1JML A;  1C79 A;  4TSS A;  3I57 A;  4HKZ E;  3ZQ4 A;  2MJ3 A;  4WIP A;  3GB1 A;  1E0Z A;  1FCL A;  2DYO A;  2LFI A;  1ZP0 B;  2K9X A;  3ZYY X;  3N9Y C;  5D3D A;  4DXF A;  1E7P B;  1TS3 A;  2BS4 B;  2V4I B;  4O1N A;  2XNA C;  5FR3 A;  1QOG A;  4KKI A;  2DLB A;  2MH7 A;  1YN5 A;  3TSS A;  1WRI A;  1JCK B;  2JX5 A;  2JWU A;  3AE5 B;  4OVZ A;  2N7J A;  4NJC A;  2TSS A;  3C8Y A;  1JAL A;  1L6V A;  3NRZ A;  3VQI A;  3VR8 B;  3KLS X;  2I38 A;  2R61 A;  2YEP F;  1IBX B;  2VZK B;  1V1P A;  4NAM A;  5HI1 A;  1N60 A;  4YWG G;  3R2I A;  1YMH E;  2PVO D;  4HRO A;  1OQR A;  1EM7 A;  2N9K A;  4IOI E;  2INP E;  4RGM A;  1KLU D;  3NVY A;  2J4X A;  1L0Y B;  3AV8 A;  1J7B A;  5E6J A;  2IPK D;  2INN E;  1PDX A;  4JX1 C;  2Z8L A;  1RWS A;  1I7H A;  2AX5 A;  1XO3 A;  3PO0 A;  2GI9 A;  4ARC A;  2PMV A;  1GPX A;  1FNW A;  2WU2 B;  1F77 A;  5MPO A;  1YN4 A;  3IAS 1;  4DQO C;  1DGJ A;  4JWU C;  1FM0 D;  4C7Y A;  1N5X A;  1FNU A;  3AB5 A;  4L2Y A;  3AEG B;  2BB5 A;  3PZ7 A;  4KGS A;  4A90 A;  1Q10 A;  2OED A;  1L4Z B;  2LJI A;  3MJ5 A;  2MEK A;  2X38 A;  1T6B X;  1SEB D;  2WXL A;  1UUP A;  1FCC C;  1D5M C;  1I4Q A;  1KTK A;  1FRD A;  1JWU D;  4RGO S;  3W9C B;  2YEP B;  2PTL A;  1N5W A;  2SAK A;  2LHD A;  1AW7 A;  3IAM 1;  2IGH A;  1CZP A;  3W5V B;  4H2A A;  5TSS A;  1CK1 A;  4US8 A;  2PVG C;  1D4B A;  3ABV B;  1E9M A;  2QJL A;  1WGK A;  4YTM B;  4RNA A;  1E6E B;  1DOY A;  4MT5 A;  1HEZ E;  4YTP B;  3SFE B;  3V05 A;  1QOB A;  1SE4 A;  2Y3A A;  1A70 A;  2ZW1 A;  4RFB A;  2FUG 1;  1ET9 A;  2BW2 A;  3HUI A;  1L4D B;  2JYT A;  2KDM A;  2WLB A;  1TKY A;  3B9J A;  2LMC A;  3L4P A;  1XLO A;  3AE7 B;  1WXQ A;  3KWL A;  5HFY A;  1DOI A;  1VLB A;  1D5X C;  3VR9 B;  1SJE D;  3P4Q B;  5BMI A;  4DXG A;  4Q2J A;  1XEE A;  3NVV A;  1GB4 A;  2CJO A;  1SE3 A;  1JWM D;  3NUH B;  1V1O A;  1TY2 A;  4J3O D;  3OWE B;  1DOX A;  2J42 A;  4C80 A;  2GB1 A;  3H8H A;  1PYW D;  4ZOH C;  2D5G A;  2BTE A;  5EE9 A;  1NVI D;  1VR9 A;  2AQ3 B;  1I4H A;  4D2K A;  4GDL B;  1V97 A;  5EE1 A;  2V0G A;  1JWS D;  5I4D A;  3VRB B;  1T3Q A;  1EWY C;  1L0V B;  2HTM E;  4A55 A;  1FMA D;  1SE2 A;  1SF0 A;  4C56 C;  1WSP A;  3AN1 A;  1VRA B;  2WXK A;  4WUR A;  3R8B A;  1FFV A;  2WS3 B;  3T3N A;  2J52 A;  1J7C A;  2JQR B;  3NZ3 A;  1C77 A;  1HQR D;  1SB3 C;  1TZO A;  2WDQ B;  3TEX A;  4IDI A;  3AE9 B;  3AH7 A;  1ZDX A;  5BMG A;  4LTU A;  1TJE A;  2WXG A;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...