3NVZA

Crystal structure of bovine xanthine oxidase in complex with indole-3-aldehyde
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvzA01
3VR9B 4ZHPA 2EKIA 1CZPA 1XLOA 1NYRA 1WXQA 1R7SA 3ABVB 2K5PA 1VJKA 3W5UB 4ZHOA 2WDRB 4WWMA 3W9CB 2Q5WD 1QOAA 1JWBD 1E6EB 1PFDA 3W5VB 1OQRA 2PVGC 1XLPA 2Y5CA 1KF6B 1DGJA 1NEKB 1DOYA 1QT9A 1XLQA 1ZP0B 3NVVA 2CJOA 2FBWB 3AEEB 4KX6B 4USAA 5C3JB 2W3RA 4IDIA 2MJEA 2W54A 5GXGB 1KRHA 3AE3B 1I7HA 1OQQA 4JWSC 2DBYA 3NVYA 3AEFB 1WWTA 3KWLA 1YQ4B 1B9RA 1XLNA 3NS1A 4YSXB 5AUKA 3AV8A 2BS3B 1E10A 1N5WA 3ZYYX 3RPFC 1GAQB 4N59A 3P4RB 1L6VA 3LXFA 3L4PA 1FFUA 3NVWA 1WYGA 1QLBB 1TKGA 2G1EA 2WLBA 2MH7A 4HRSA 1FRDA 1JRPA 5EE9A 3SFEB 1JQ4A 2BT6A 3AE9B 2W55A 1V8CA 5G5HA 3AEDB 5EE0A 3VRBB 2M19A 4YT0B 1F0ZA 4C7YA 3P4QB 2W3SA 1PDXA 2ACZB 2PKOA 4YTMB 3AE1B 2MJ3A 1L5PA 1TYGB 1XO3A 4C7ZA 1WGKA 1VDVA 3EUB2 3HRDD 1QOGA 2WDQB 3CIRB 2H88B 1RM6C 3AM9A 1CJEA 1PUTA 1RFKA 3VR8B 1J7CA 1FM0D 1J7AA 3NVZA 2LEKA 2MJDA 2QJLA 3VRAB 1JWAD 1FIQA 1N62A 1QOFA 1UWMA 2HTME 2N0SB 3DWMA 4YTPB 1AWDA 3NRZA 1JALA 1JW9D 1FXAA 1YJIA 3AEGB 3LB8C 4P6VF 5H92C 1QF6A 1NVID 1SB3C 1J7BA 1T3QA 1EWYC 3P1MA 3B2FA 1E0ZA 5MPOA 5H8YE 3AN1A 3AE4B 1RYJA 3AE7B 1VLBA 1ROEA 3PO0A 2M56B 2QIEB 3AEBB 3P4PB 4N58A 4ITKA 5G5GA 3BIID 3ETRA 3FAHA 3CWIA 5EE3A 2WDVB 5EE1A 2JX5A 4A9AA 3FC4A 2L52A 2BS2B 1N63A 1N5XA 1NYQA 2AX5A 1OFFA 1SF0A 2KAJA 3WCQA 2BS4B 4JWUC 2JQRB 2WU5B 4N6EB 1N60A 2H89B 1ZXIA 1FXIA 1NENB 1GPXA 3P4SB 3B9JA 1JROA 4US9A 1YJJA 2PIAA 3AH7A 4FXCA 1TKYA 4YSYB 1A70A 1L0VB 1NI3A 5C2TB 1QOBA 3AB5A 4YXDB 2E3TA 3AE8B 1DOIA 3SR6A 2CU3A 4JX1C 2B76B 1IUEA 1ZOYB 4ZOHC 1KFYB 4YTNB 4LTUA 4US8A 4YSZB 1AYFA 1L6UA 3DWGC 2DWQA 3AMZA 3AECB 3AE5B 3HVZA 1SIJA 2K9XA 3HUIA 1WRIA 1FMAD 1TJEA 3AE2B 2WQYB 1FO4A 1FFVA 2CJNA 1N61A 3AE6B 1E7PB 1TKEA 2K22A 2OHFA 1FRRA 2PVOD 1E9MA 2WP9B 2WS3B 3AEAB 3B2GA 4HROA 3SFDB 2KMMA 2WU2B 1V97A 1YQ3B 4C80A 1RWSA 5AUIA 2L83A 4WQMA 3P63A 1ZUD2 1DOXA
chains in the Genus database with same CATH superfamily
4KN4A 4LJXA 4E3CA 2HCFA 1NYRA 2EH9A 3P2BA 4PS8A 4U7CA 4QWAA 3QE9Y 1U9LA 4ASWC 3RNBC 2KG5A 3MABA 2J52A 3C1ZA 4MH8A 5KFHA 4IQVA 2BVCA 2LI5A 4HLEA 1J8CA 2BQUA 4MT5A 4G3XB 2LGDA 5DDYA 4QWBA 5AI5A 3RAQA 2MW5A 2I1QA 1JWMD 3ZYYX 4BVUC 5D49A 1L6VA 5I4DA 2E8OA 1SGHA 3RJJA 4HRSA 3DBLB 4Y2TA 2DPJA 1SSNA 3SFEB 3H0RB 2INDC 5IOIA 5J2FA 1D4BA 3FKYA 1JQ4A 2WXKA 1Q8KA 4YCXA 4QW8A 7ICHA 4Q45A 5AM4A 3JVZX 3UIOB 2DZJA 3R7QA 2WXIA 3EYZA 3QHTA 5ALQA 3H7IA 3AE1B 4LNOA 1AROP 4I2AA 1I4XA 9ICPA 4C56C 4DBGA 3PSTA 7ICTA 2DUYA 3ECIA 3F5AA 3GDXA 2DLBA 4WWPA 5ALLA 3N28A 3VUXA 2WDTB 2CHWA 3K9OB 4C4RA 4HVBA 2ZTEA 1L3VA 9ICWA 1IGDA 5A0LA 1ZE3D 1HZ5A 3MHSD 2CN1A 2MP2B 1ISNA 2JZBA 4ECQA 4OVUA 2N4FA 3PV1A 2LHDA 4GC7A 1I35A 5ALFA 5EWGA 4K1RB 1S9FA 8ICQA 3UQAA 3ZRCA 1SE2A 3AN1A 1J2NA 2CHXA 2QIEB 2LVPA 3N30A 3ETRA 2ZIVB 2WB1F 4F92B 3I1YA 1KJTA 1PGBA 4UB3A 2FIDA 3V62A 4BBNF 3PR5B 4DQIA 4ELUA 2C60A 4G50A 2PMZC 1N6ZA 3BK1A 3WKAA 2JYTA 2KK8A 4LJOB 1TZ1A 4RQ0A 3J81j 1S77D 1WGRA 2FIFA 4W9EA 2P6UA 4W9IA 3DVGX 2WFAA 1HXYD 2PIAA 3WALA 4RQ3A 1L8OA 3AB5A 4Q44A 3C29A 1C4CA 1WXSA 3Q8CA 4DXAB 4DF8A 1XO1A 4O5CA 1P3QU 2DENB 1XSPA 2IHMA 1WGGA 1ZOYB 4YTNB 1Q46A 4US8A 3RJFA 1RRBA 4OO1J 1S0VA 2BB6A 4CE6A 5DBCA 4CCHA 5IIKA 4YMNA 3HVZA 4ECXA 2YMLA 4O3QA 4J9KA 4GDLB 2JZPA 3AE2B 2KVSA 1XD3B 3BY4B 4Y2YA 1P7DA 2DKXA 1E7PB 2K22A 2WS3B 3AEAB 9ICAA 2FUG1 2WU2B 4ECSA 5FR3A 1HUZA 3PX4A 1SL1A 1U49A 1Q3UA 1B22A 2I2YA 3VR9B 5HKHA 4BKSD 3PR4A 2C9WB 5KFSA 5DQGA 4KSLC 4I2GA 4ARIA 2K39A 2NVUI 1D9DA 1KF6B 2RDJA 3QXGA 1Z5SB 4UDUC 4XDCA 3NVVA 3D2QA 5AM1A 4NXZA 3GV5B 4ACOA 3KFUF 2FNJB 3JYUA 2BYTA 2R61A 2WYQA 2DBYA 4MDKE 4XGAB 2YTUA 1R4MB 5J2KA 8ICNA 3HT3A 4J9OA 1F52A 2EAMA 4N59A 2NPTB 1IIPA 1MI0A 3H8WA 2K89A 4XUSA 3ZXRA 4QWCA 4OCZA 4YG2A 3BQ0A 1ZRNA 9ICCA 2W55A 2K8AA 3GS2A 1HEZE 4DFKA 1IP9A 2JPHA 4NY8A 1E7VA 3THVA 3ZUNA 5KG6A 4HKZE 3GILA 4C7ZA 1X66A 3PT2B 1ZW7A 4Q8FA 2JZ3B 1J7CA 3HK0A 4G9BA 4KVGB 4P4MA 2XY7A 3ISCA 3MFGA 5IINA 4AYBC 2IGHA 1GO3F 4NJCA 2N0SB 5L1MA 2WAQF 3IT6B 1VZ6A 3ZIMA 2E8NA 4PS7A 1NZPA 2B21A 2PFOA 3CSFA 2KVRA 1NKBA 4FHKA 4DL2A 3PO0A 1ROEA 4PZOA 3PX0A 1V1PB 2JY6A 4MELA 3BIID 2WWZA 3FAHA 4ECZA 1TKDA 3DCGA 4C4SA 4II2B 4A9AA 1L2NA 3FC4A 2O6VD 4LZDA 4EZKA 1KLNA 1KLGD 1NK9A 3URYA 4F5NA 2G08A 5KL1B 4PHAA 1ZQWA 1KM7A 4GN1A 3C1YA 3QX7A 1Z4OA 1FXIA 3ZNZB 4WJQA 5KG2A 4B0EA 2QLTA 1Z00B 4US9A 4M04A 4HJKA 3O0FA 3HHMA 2YY6A 5DG8A 3FILA 3FDSA 3SR6A 1ZGUB 4RPZA 1V49A 2B76B 5H2FU 4B0MA 2NO4A 4HPMB 1ZDVA 4IKGA 1CUKA 2XCPA 5ALJA 4EEYA 3ONNA 2LM1A 2BPFA 4MFCA 4QWEA 2V3PA 3SAGA 3E2EA 3SQIA 4II3B 3PRZA 4TUUA 5J2IA 2V4IB 2NRWA 1YX6B 4C8NA 5CHFA 3B08A 2ZJ8A 4PHDA 4EZJA 2LYAA 3EFUA 4O5KA 4ZHPA 8ICJA 4UB6U 2V4QA 2Q4TA 2VA2A 2GBMA 3IG5A 3BQTA 2G0AA 1CZPA 3X23A 2OEDA 1VJ5A 2N9PC 3W5UB 1VJKA 2EAOA 4DSJA 2PI5A 3W9CB 1PFDA 2JMGA 4DOBA 1OQRA 5C1ZA 4BWJA 1KL9A 3PW2A 2ZCBA 1NEKB 1WH3A 4TQRA 3MR5A 4MF2A 4KZ0A 3ZDDA 1NK4A 1KKXA 2LYHA 4LNKA 1KN5A 4DSFA 5KFWA 5J2BA 4P0QA 4DFDA 5TZVA 2E5SA 3G6XA 2IBKA 4K4GA 1WRDB 4GIVA 3KD3A 2FCMA 4ELTA 3PSPA 2L32A 4AP4C 1WR1A 2YMQA 3PRMB 5D3DA 3U7ZA 1FFUA 5KG1A 3U2SC 3PSEB 4B9NA 1WZ0A 4Z6EA 5L1JA 4RFBA 4FA6A 2XIDA 2WTFA 3TSSA 4Y2SA 3RFZB 5J8YA 3ML9A 1NNLA 2I6XA 3K4GA 2FI1A 2KZ3A 1NDDA 3DQVA 8ICKA 4DL4A 1YX5B 3DVNU 3H7PA 2LUMA 4QAYA 1WGHA 1WGKA 2Z0EB 2JXJA 3Q8FA 2QB0A 2RMMA 1TAMA 4MF8A 3PW0A 2XO7A 3L17A 4KIKB 2VZKB 5AIBA 2BF8B 2GBJA 2OJRA 1DYQA 5HI1A 4O3SA 2W9BA 4JV2A 3C5FA 1DK2A 3A33B 5L1LA 2KJ9A 2QC8A 2GLSA 3T5HA 4O3OA 4J03A 8ICBA 4GFJA 3ZJUA 4P2HA 2IMWP 3SU8X 1LKYA 3C21A 4PYUA 4LDTD 3C23A 1IG6A 4FZNA 4XDDA 4KLMA 4JWMA 3EECA 7ICNA 3ZI4A 3U52E 1WIAA 3KKAC 1WZ3A 3WK9A 2FJ6A 1OFFA 4TUPA 4YR2A 3V6KA 4KV2A 1F1HA 1P1AA 4FE3A 1X9SA 5F9NA 1T5XD 4M6WB 7ICQA 1U4BA 1SJED 4ZYNA 1C79A 3BYYB 3OSNA 4DQOC 8ICZA 2KOBA 4YMMA 3L13A 2O2VA 1ZJMA 1L0VB 1LFDA 1P7EA 1RQNA 4HDOA 2Y1JA 4I6NB 2J42A 4C8MA 1ZQFA 5KT7A 2FLLA 1MA7A 1RQLA 2I5HA 2I38A 4ED2A 2JT4B 8ICEA 4QZDA 1S5LU 3AMZA 2RDGA 2FMPA 2D5GA 2K9XA 3HUIA 4F8CB 1HQRD 2X8XX 8ICFA 4F91B 1QH9A 1FFVA 2A3VA 4IDIA 3ICXA 1TKEA 2JH7A 1T0SC 3DOWA 4RCOA 5TSSA 1BGXT 4BKGA 4HYKA 2G06A 2ZUCA 3JPQA 1RZTA 1MHXA 1RWSA 2KTQA 4WQMA 1ZQTA 3UINB 3PS6A 5K4LA 2W8LA 3AU5A 1DOXA 3E0FA 3PO4A 1WJ4A 1HTQA 2NMQA 4YL8A 3QZ8A 5AKYA 2E1FA 1JRUA 4C4VB 1MG4A 8ICPA 1MQ2A 2NBVB 5JHBA 4AS1A 2CRXA 3H8MA 4JE3B 3QU2A 5KT6A 1QLNA 1DGJA 1DOYA 3V3XA 2V3SA 2M4NA 1A5RA 2AEHA 5L9XA 1UUPA 2C7NB 2K8CB 4UARA 5IIMA 5IIIA 4HWIB 3RJIA 2HBKA 4YSXB 4DQSA 5CX3A 2EKEC 4NL9C 4FBUA 2YVCA 4CF4A 2JRHA 4RQ8A 4A55A 2PMZF 3D2NA 5J18A 2WGSA 4ZRQA 4RMAA 5HHHA 5G5HA 3Q8KA 1U45A 3IHQB 2PKEA 2XGPA 2HOIA 1ZPSA 1IXRA 4FS1A 3RH5A 4I2CA 2L3ZA 1F0ZA 4DQPA 1JWUD 2R8KA 2NO5A 5J2GA 2ZTDA 4BDPA 4WAAA 4B6WA 3B0AA 1ED1A 4IWOA 3VH3B 3IP4B 4XZ4A 4NPNA 3O13A 5CP2A 3WKCA 1J0GA 4QZIA 1UT5A 2XC9A 4QZ9A 3OLMD 3GB1A 1FCLA 1WR6E 1WSPA 2FLNA 2HBMA 3MHZA 1YJIA 1IBXB 4TUSA 1SV0C 4UAYA 1L5UA 2BCUA 2KZRA 1KFDA 3A1QB 1QF6A 1EWYC 4KKIA 5JUMA 5JU5A 5GTHU 2WX0A 5D46A 9ICRA 2UVVA 1V86A 4EYIB 3NZ3A 1J97A 2ZXIA 3ENEA 1Z3EB 2M0NA 5HMLA 3N20C 3CSTA 4F5PA 2M56B 4ECVA 4M0AA 4MGZE 4ANVA 1D8YA 3H7SA 3IFWB 2ZPNA 1PVQA 4M0WA 5EE1A 2KQ4X 2LGIA 4EZ9A 3Q69A 4B9TA 4NNJB 1F2RI 3WAMA 1NZBA 5AI6A 2AX5A 4PGYA 2BW2A 1C4AA 1XC9A 2G09A 2YB4A 1VD2A 2IOFA 3QAQA 3WCQA 5IP4D 5AKKA 2DFLA 1ACCA 2L00B 1I4HA 2KDIA 3GQCA 4KLHA 1N60A 3IDWA 4EEKA 1ZQ1C 3B9JA 3RMKC 5DKWA 4OZAA 3QU4A 5KT2A 3M95A 1Z4NA 1DOIA 2WHIA 2MBOA 9ICTA 2HW3A 3A9JA 5HR7A 4RQ4A 2W9NA 2FE8A 4EFOA 3BZKA 5DPWA 5CRXA 4A90A 2MRPA 3AECB 2NRTA 1TS3A 4RQ7A 4ACFA 2R8GA 2F3NA 1WRIA 3MJWA 4EZ6A 4NWIA 4BZAA 2UYZB 1HZ6A 1N61A 4QIWC 4KLJA 3C2MA 1S0OA 2OH2A 2WP9B 2L0FA 2AQ2B 4AOFA 4NLNA 4KZCA 4C80A 4YD2A 1WJNA 2HHQA 2A4ZA 4PYZA 3QJZA 3UGBB 1SE3A 4I6PA 1SWVA 3U7DA 2F77X 4PGXA 4AYBF 4OJ5A 4KLTA 4J9LA 2F44A 3V05A 1DXSA 2XBBC 8ICSA 2IGGA 1NK0A 2Y0SC 4YN4A 1QQ5A 3RB4A 4BKSA 2WXHA 3SV4A 2W3RA 5AM3A 4DK5A 4JMUA 4NLCA 2HHWA 3L10B 2I9GA 1YZ7A 4DL6A 3MTNB 5KFPA 3NS1A 4F2RA 2Z0DB 5AUKA 4A3PA 2GBRA 3RPFC 2KACA 1WE6A 3LXFA 4UAVA 4O9MA 1WYGA 3PV8A 2L8JA 2DAFA 1QSSA 5FR6A 1TS4A 2WXQA 1IM4A 1F2RC 4C8LA 2G9HD 2J6UA 3IG3A 3BS5A 2ZW0A 4GXJA 3P4QB 2JZBB 4O3MA 2V9HA 1KOTA 3BQ2A 1TYGB 4AQ7A 1ZKHA 1KRPA 2LGXA 3ZJVA 4G0NB 2KVZA 2ZIXA 5AZHA 2MU2A 5G2NA 4R63A 1SXEA 4UATA 1T3NA 2HHUA 3TEWA 2E8PA 2I1JA 3CRXA 4JIOU 3L54A 5AZGA 3KWVA 1ZRMA 3DHGC 3MR6A 4NM2A 3VUWA 3OGUA 4DO9A 5H8YE 4F7ZA 1A0PA 2PXIA 4WJNA 3UM9A 2CPRA 9ICMA 3RJGA 1CQVA 1UA1A 1TS2A 4N58A 1U4AA 5KL8B 1WI0A 1QSYA 5G5GA 3QK0A 3NUHB 3TJPA 2LM4A 4GC6A 3I5JC 5T8IA 2OWOA 4C00A 1MC8A 1NYQA 2PW9A 2YMPA 4HCNB 1O03A 8ICLA 3CP8A 4B9UA 5J2RA 3I28A 4KN7A 3ZDAA 5BO4B 3ZRFA 2GO7A 1BPBA 3UQ0A 2O6VA 2ZVNA 3ZXVA 1GPXA 1TY0A 3KUDB 4ZRIA 1NI3A 3C19A 2CHZA 2HHVA 2LRUA 4UB1A 4I2DA 3MFHA 1FPYA 2KQ7A 1RYUA 5AEKB 1LO5D 1WM2A 3EA6A 5KFFA 1R4NI 1ZD2P 5ALSA 1ZQPA 3T79A 1COKA 2H3VA 4IC7B 1NK7A 1FXTB 3BVMA 1EU4A 2VA3A 1JXEA 5HR6A 4ICVA 3ZTDA 1FRRA 3VTVA 3PRPB 4CYEA 1XXGA 2OYYA 3VXWA 3Q14C 4CNQA 1ZDXA 1XCQL 4K7SA 2EZXA 2KZZA 1KFTA 1ECWA 2J53A 4ITKA 2PLPA 1RYRA 2WXOA 3ABVB 4XX5A 4MGYE 4W9GA 3JPRA 3LDAA 3W5VB 1E6EB 2P35A 4RT3A 2HJ8A 1XLQA 3RJEA 3AEEB 2CJOA 4USAA 2LUEA 2R8HA 2W54A 3DDCB 2N9XA 1I7HA 2INPE 1WWTA 4N9F4 2JUOA 2WX1A 1I4GA 4K7WA 3H8JA 1D5ZC 5J29A 1D5MC 2KWDA 3UIPB 2PTLA 5DLGA 3RBDA 5C0YA 1GC6A 4OD0A 1FRDA 1Y56A 5E6NA 4A20A 2LRWA 2WF5A 1UGJA 5FKAC 2D3DA 2JGAA 5DB9A 2ACZB 1F0MA 1TY2A 5E6JA 1SWWA 1GJZA 2A5UA 1PK1A 1ZQOA 4B9LA 3NUQA 8ICUA 4U6PA 1SKSA 2G07A 3RAXA 1V9JA 4IQWA 4R66A 4MM3A 1Z2MA 2MBHA 4OVZA 2V4LA 4DL7A 2PJHA 3RB3A 2LHEA 1ZQUA 2GLEA 4RQ1A 1OXJA 1SB3C 4EOYA 1T3QA 4KX3A 4ECRA 4KLOA 4CDGA 5KFLA 4ED0A 1GUAB 2WHEA 2GMIC 3DV9A 2V4RA 4IRDA 1QQRA 4RZRA 2AWTA 3CF6E 4UAWA 3TUOA 1MFWA 3DBHI 1C4PA 3QUBA 3R7RA 2ZNVB 2FAZA 3TQ1A 2C7MB 2KWUB 4WURA 4DWFA 4ECUA 1KLUD 2JRIB 3FILB 1I4PA 4LNIA 2KHWB 3RRGA 2BS4B 2F8KA 1Q10A 2F1HA 2J6TA 1OQYA 4S17A 4CF3A 2GH1A 1D9FA 1EO6A 2K8BA 3BYTB 2B6GA 2RP5A 2YN4A 4O3PA 3APDA 2ASLA 2N7DA 3GE3C 3ZNID 2M0AA 3TI0A 2MBEA 1UGMA 5J2JA 2VJ4A 3RNGC 3GIIA 3LYYA 9ICLA 4PL1A 1TK0A 1NI2A 2J7QB 3JSVA 3MGIA 7ICVA 3KHRA 2QDFA 3K1RB 2AL3A 7ICGA 3WK5A 1SKWA 3NG0A 5LLIA 2JEGA 1PYWD 4MHVA 2G3QB 5ALDA 3HM6X 1BUIC 5ALXA 1AQ6A 4BJQA 1ZQJA 2JF5A 3AE6B 3KH0A 4EZLA 2Y3AA 4F5QA 3B2GA 3QEBZ 5ALUA 2GBKA 2KMMA 3QU5A 4TMAB 3ZDTA 2F1IA 2MA1A 2BCSA 4DXGA 2D10A 2RSUA 2XVTA 4Q8EA 3F2BA 3PO5A 4KGSA 4I6LB 3OAWA 3SD7A 3M8SA 5DG7A 4P0QB 1YOVB 2ASDA 2WDRB 4MFFA 4FJZA 3BQ7A 1FNWA 3VH4B 2IO1B 5E79U 3BVZA 1JWBD 1NKEA 3G6VA 9ICXA 5B5EU 4NJ6A 4UB4A 1CK1A 2KICA 3PW7A 3PPAA 3H9DA 2ODGA 3M6KA 2INNE 1JMLA 2KKCA 3NVYA 2RGFA 3AEFB 5E6OA 1D3ZA 2IY0B 5KFVA 1V38A 2MEKA 2W11A 1L4DB 3QWZB 3H7PB 5IA7A 4DL5A 2IOFK 2WLBA 3H1UA 5AKLA 3NZSA 2QB0B 2AU0A 4DFMA 3RR8A 3QA8A 1GC7A 3N7PD 3X0WA 1P0RA 5DGBA 4GOCA 4RUAA 4YVZA 5CR0A 1NJWA 2KJHB 9ICFA 4GLXA 4C7YA 3OG5A 2W9MA 2KLGA 3JPSA 2MJ3A 3PMLA 1L4ZB 3M8RA 1RYSA 2BKEA 3ONSA 1IV8A 3DBLI 1LKYB 2XK5A 2LEKA 1QOFA 2MHJA 7ICFA 3JPPA 4YXMA 1SV4A 2DKZA 1JALA 2EAPA 2AGPA 2AQ4A 4LNFA 2EMTA 5EWEA 4QIWF 4J9SA 4A3OA 1C3TA 1BPEA 2F1JA 3KHHA 3I76A 8ICIA 3FM9A 4LK0M 9ICEA 2EZYA 4NLBA 2K25A 3AXCA 4UAUA 1NBFC 2KDFB 3EHVA 5L1IA 2MBBB 2D3GA 1SL0A 4KDIC 2QARA 5D4BA 1OW5A 3E9SA 4WAFA 5DG9A 2L52A 2O2VB 2ZJAA 1J19A 2BBCA 2UVRA 1YN5A 4NLZA 2MQJA 2WXFA 4M9GA 2KAJA 2Y0SF 1T7PA 4PS3A 3PZ8A 3IXSA 4JWUC 4EBCA 5DGAA 3IV6A 1K1SA 3EW9A 3QIJA 3D6JA 3U4EG 1QKZA 4KDLB 4BGDA 4KLUA 1E8YA 3SYZA 3RZWC 4YQWA 4I2HA 3T3FA 3Q8EA 8ICOA 2LMCA 2KV2A 1BVSA 1QOBA 4PJ0U 4I2FA 1XO0A 2BCVA 2J4XA 3SAFA 2H3FA 5HHDG 3UMBA 4M9LA 4KMUA 1PGXA 1A77A 3BQ1A 1WUDA 3F2CA 2WNMA 2RDBC 1HIWA 1YD8U 3VAWA 4KLFA 3OWEB 4JB3A 3SFDB 1FEZA 4P4OA 5DQHA 2DHZA 4M8NA 1VR9A 2LBOA 3DBRB 2K60A 2L83A 4P1CC 1PVPA 1ZQMA 3ORYA 1L0XB 4J3OD 1X9MA 3VUYA 4B95A 3T9LA 9ICUA 4BKTA 4BAXA 1LB2B 4ICAA 5AIAA 1NKCA 1ZQYA 2KKVA 5KT5A 2HI0A 4UASA 1P7FA 5AKGA 1NJXA 1ZP0B 5CHGA 3UMGA 4DFPA 1NK5A 2FBWB 3CW2C 1AARA 4M2YA 2BR0A 1L7NA 3M9NB 4NQKE 1GNUA 2YLMA 4ZRKA 1S3SG 2AL6A 5J0WA 3ZLZA 2WXPA 3EFCA 5J0XA 2FPKA 1ZQVA 1K52A 3T5LA 2MBQA 4C8KA 2KDBA 3P4RB 4ELVA 1ZQGA 4TKNA 3AE9B 2LFIA 4RPYA 1SXDA 3B0YA 3WK7A 3ZO5B 1L0YB 1FNUA 4K3CA 4P1BC 2JWUA 2PKOA 1R4MI 3V61A 2KANA 2RQ5A 2ZIWA 3SMVA 1ZD5A 5KG4A 2D07B 5KT3A 4F8RA 4MH0E 1D5XC 4RNMA 3V7JA 4I28A 8ICGA 4IWPA 4OHJA 4D2KA 2FMQA 5KFIA 1C76A 3L5KA 5JTIA 3DWMA 2XGQA 3MR2A 4IM3A 3RNEC 9ICGA 4M0WB 3TMPB 4MEYA 3CNHA 4A6QA 1QSLA 4IWQA 2QILA 2VH2A 3M7DA 3T3NA 3Q8AA 5KFNA 1OEYJ 3KHLA 4I2EA 4KLEA 1PGAA 1KTKA 3RH4A 1V5OA 1VLBA 3SZ2A 4O0IA 3P4PB 3NS8A 3ISBA 2KFZA 4JWNA 2AXTU 2WDVB 4DWIA 5KFBA 3RTVA 4GXIA 2FMSA 2XI9A 1Z1VA 3G6YA 3A9JB 4YD1A 4RQ5A 3HKZC 1TGZB 3UF8A 5L83A 2K6DB 1V85A 1SL2A 2P6RA 3HX0A 2IBIB 2JEIA 2L5YA 2JQRB 3P42A 3R2IA 4MSQB 3B0XA 3LWLA 3NTUA 1WF9A 1NENB 4HDQA 1YJJA 1TAQA 2BKRB 3QX1A 3R8BA 1A70A 1C20A 1HA5A 4DF4A 2CU3A 4TQ0A 2ZZPB 4B9MA 3ZDCA 1ZQBA 4LTUA 2N9KA 4REZA 2HBLA 3VC8A 2IO0B 3H0MB 2J0KA 4FS2A 5J0UA 4RM9A 3ZKJC 4YSZB 3A0HU 3N4MB 2OCEA 3KKAA 2LWPA 5D94A 1LVHA 1IGCA 1UF0A 2ZTCA 3RJKA 1B43A 2K4IA 1ET6A 2NTTA 3EC8A 3UQ2A 3ZNHB 4IRCA 3UPQA 2ON8A 5C5JA 2KD0A 2KMDA 1PK3A 2BDUA 3MR3A 1GOZA 2L05A 3Q8RB 5ALTA 3M3JA 3M63B 2JVCA 3LDZE 4EE2A 4K7UA 2K6QA 4LVSA 3H4BA 3OJ3A 4BFRA 2LASA 2MX2A 2WXNA 2CR5A 2RDIA 2W7OA 2BYEA 4G3IA 4FULA 2VIXA 2CXYA 1Q5WB 2XCAA 1M4VA 1N56A 2YMMA 5JRTA 1TIFA 2A1JA 2NRXA 2NTSA 2IJ0A 1TKGA 2FDRA 1ZD3A 3ZDMC 2ZIXB 5GTIU 5HHIA 1V8CA 1XF5L 2IO2B 4TQ1A 5E6PA 3GOEA 4YR0A 2N9LA 1ZJNA 2MAXA 1WG8A 1EU3A 2ZXHA 2EANA 3PHWB 4E71A 3LWMA 2JSVX 1PDXA 1L8LA 3PVLA 2ZPYA 2ZCCA 1XWLA 2AJQA 3H0LB 4R8UA 1UELA 2B0CA 2CS4A 2WF9A 1K1QA 2WF8A 3CIRB 2KIWA 4PK1A 1X2IA 1RFKA 5AKJA 2MWSB 4RQNA 3WK8A 3NRWA 5AI0A 2ZJDA 2YEPF 2HD5B 2X38A 5BYRA 4I27A 4XYCA 5KFYA 1AWDA 4UAZA 4IM2A 4P6VF 1ZQDA 3RD2A 3L08A 4NL9A 3E58A 1ZQZA 2NYVA 3C28A 1BT0A 4MGKE 1RDFA 3JPNA 2YB1A 1DRGA 5DB8A 2HHTA 4ED3A 4QW9A 2NRVA 4QZCA 2O6VB 2PFNA 2O6KA 1JN3A 2QHOA 2W82A 4MACA 5KFCA 2KNJA 3TEYA 4PPXA 1JUDA 3FYHA 4XWWA 2OEHA 2KXJA 3SV3A 4HPLB 9ICNA 3N1XC 4Y2JA 2G4DB 3DVGY 4RT2A 3TADC 1BPZA 3N97B 2JXXA 4MGIE 2VKQA 5BOLA 3Q3JA 3VHTC 2OXOA 2DL0A 4M47A 2FUHB 4MJSA 2VANA 1XT9B 4RH6A 2UVUA 3V6EB 1SV0A 2W7PA 2OOBB 2K8HA 4DHZE 3RF9A 2DQNB 2BZFA 2KLCA 2MLBA 2FPMA 2WXJA 4O5EA 2D6FC 3PSFA 2DWQA 4P0PA 2BWES 4A8EA 3N1ZC 1UBIA 2D2QA 1B4FA 5ALRA 5AHXA 3C8YA 1FMAD 4DS4A 1WFYA 2JV3A 1TBEA 2CJNA 4QZAA 5BMHA 2OHFA 5ALVA 5GMVA 3IM1A 3QYPA 2C5LC 2KFJA 3WU2U 3NOBA 2ZUDA 5J0OA 2IGDA 4LCDE 2PI4A 2DZMA 4Y2QA 4FBTA 4DSIA 2R2OA 4E74A 1ZUD2 1MN8A 1F5SA 2JRZA 2V3NA 3BINA 3D2SA 2NS5A 1ZQRA 3LJ3A 3SAHA 4WWMA 3U26A 3RB6A 4ZDVA 3VDZA 2FPLA 5F3XB 1QOAA 4FADA 3RUIB 2PVGC 2PPHA 5IIOA 3KHGA 2L76A 5DB7A 4KX6B 3ZD8A 2GBNA 3MC8A 2K3UA 3ALRA 5J2DA 4H2AA 1XNSA 1KRHA 5KAFU 1IYFA 1SKRA 3GIJA 2LZ6A 2PFPA 4HPPA 1B9RA 2NBUA 2RD0A 5KFKA 4QWDA 3M62B 2RPVA 3TFRA 2D3AA 3AV8A 2Z7JA 5BMIA 1COOA 3QCAA 1PK1B 1BNOA 5TISU 2Z59B 5KT4A 3PLVA 4GIBA 4JQWC 2ICIA 4S0RA 1NOMA 2KMAA 1ET9A 2ZIUA 4CF5A 3KYDD 4MM3B 1HEKA 5AKEA 2HOFA 4NLGA 1ZD4A 4QZHA 3MC1A 4WIPA 5AZFA 2IZVB 4EX7A 2KN4A 4R65A 4B9SA 3VFKA 3KYCD 3V6CB 3E56A 5CTRC 2XNAC 1XQQA 1RM6C 4M8MA 4L2YA 1PUTA 3VR8B 1FM0D 2HTHA 3QZ7A 2C2RA 1B1ZA 1FEHA 3L0WB 2MJDA 5CEHA 4PHPA 4FJVB 3MC9A 1N62A 1MG8A 2KJ6A 1ZYQA 3PZPA 5AKXA 2NBWB 2ISOA 3IAS1 5H92C 3HM3A 2LVOA 1C1YB 3RFAA 1FXAA 1RFAA 3UXOA 1SIFA 2BGFA 4LDTB 1YZ6A 4Y2PA 4FO6A 4BOSC 1G6JA 2QCZA 4UB5A 1UH6A 1YJ1A 5KFQA 4ECWA 2K8BB 2W03A 1RAXA 3V6JA 4WH4A 2KT7A 3Q8PB 1ZQEA 5AK4A 7ICPA 2UU7A 1SE9A 2ASJA 3I9V1 5KFJA 1N63A 4IL6U 2BS2B 5DPRA 5KAIU 1V6EA 1EWCA 1YIWA 2JEJA 5J2CA 2PEAA 3APFA 2AYOB 1I4QA 3JSVB 5IAAC 2N7EA 4NJ8A 5AI4A 1Q0WB 2NR2A 2YQEA 3UXPA 4J9QA 5ALPA 3Q8QB 2DYBA 2C28A 3N9YC 4DDGD 3GZNB 3V60A 3MDAA 3IRUA 3W1SC 1K51A 4Z6FA 1ZETA 3TKAA 1Z19A 2EQYA 1VCBA 4HCPB 5DPTA 4F4KA 4JLCA 2LPEA 1KH0A 4RNOA 3N1YC 3TCAA 1ZQIA 5LNK1 4ZOHC 2C22A 2G5HB 3DDHA 1AYFA 2GRIA 1QTMA 2MSNA 7ICJA 1P98A 2AH5A 2LGYA 1SIJA 3O65B 4TV3A 4IR1A 2IA6A 1WGDA 4BXOA 2BQ3A 4KGTA 1QQ6A 5EWFA 4NAWA 1T94A 1AW7A 3MDCA 2KJ5A 1L7PA 4L1BA 3PZ7A 4AJWA 4BOZB 4NJ7A 3LK9A 3GZFA 2NV3A 1Q3VA 2JWZA 2W9CA 3IG8A 5LXIB 1XLOA 3IN5A 4WJOA 4PGQA 5AK6A 4GU2A 4CQNA 3AQEA 3T3OA 4W9CA 4KGRA 3NZUA 3MC0B 1V2YA 1FD6A 4WQOB 2ESEA 3ZD9A 1OTRB 2V1YA 2N1WA 3K9PB 4ZRJA 4PL2A 3Q6BA 1SZHA 3OSPA 4F2SA 4KTQA 2LVQA 1KTQA 2B3AA 4WWOA 4LLGM 1DOQA 2Y5PA 2W9AA 3Q3OC 1PZNA 2V0GA 1WX7A 2BS3B 1E10A 8ICWA 4Y2VA 4MFAA 1AN8A 1E8ZA 5EOZA 1RXVA 4F5OA 4RGOS 4ANUA 3Q8BA 4C0ZA 2MH7A 3HKZF 4CGZA 2XK5B 1X42A 5AKHA 4YT0B 3AQFA 2JXTA 5AM5A 5D7GA 4JPSA 5KG5A 1SZPA 2KKPA 2N1RA 1L3SA 4I29A 3RNFC 1JWSD 3PTFC 3J9CA 1XO3A 3SEBA 5ALOA 4OJOA 3WAOA 4F4ZA 1VDVA 3EUB2 2AQ0A 1SGGA 3EPGA 1TS5A 3EZ5A 3AM9A 1CJEA 3PX6A 3M1YA 9ICKA 2LMRA 3UI3A 3N3KB 2QJLA 3ZJTA 3VRAB 1KDHA 2BYFA 2LHTA 2J0JA 2HBJA 3PGEA 3NJTA 2KD1A 5ALHA 2CKHB 1ZQAA 2ZVOA 4KMOB 5ALMA 1UD7A 4FFDA 4QZGA 4JUZA 4KLIA 2ASQA 3JPOA 1GB1A 3RB0A 5AK3A 3AEBB 2BQRA 3DPDA 4W9KA 3RN9C 3K75D 4MEMA 3QUQA 5DB6A 3LVVA 5J0QA 1K8RB 2KWCA 3ISDA 1E5WA 1SF0A 2KTRA 2IO3B 1CI4A 1L7MA 5KFXA 3PMNA 4DXFA 1XSLA 1WE7A 4RGTA 2F8LA 2G5IB 5AK5A 2E3TA 4I2BA 4K4HA 4JX1C 1X6IA 2KVCA 2XY6A 5J17A 1K5OA 3BWUD 3KZIU 3APCA 4AJYB 1KBUA 4URKA 4IOIE 1A6SA 4LZGA 4YFKA 4HAIA 5CWRA 5IO9A 1BPYA 3A9KA 3OJSA 1WXMA 1E9MA 4TURA 5AI9A 1KW4A 4B6JA 4NAMA 2K4EA 4FHJA 1V9PA 2LXAA 2WXMA 2PE6B 2RPQA 3OTQA 3DBSA 2XY5A 1RPLA 5DBBA 5LXHA 5DLFA 1S0NA 4W9HA 4DHJD 3H8HA 4X57B 3ML8A 2IHNA 3H6NA 3ETLA 7ICEA 4CRXA 4NV0A 2KFKA 2PE9A 5J0TA 4J6IA 3JPTA 2C2EA 4RQMA 1MSWD 4AP9A 5J0RA 2XICA 2KHVA 1F9JA 4DQQA 3F53A 3R9KA 2KNBA 1N5WA 1ZXHA 1UQVA 2ZIWB 3EWAA 4ED8A 1SEBD 4J9NA 4HK2A 3L4PA 2L1AA 3IAM1 4FLHA 3Q3MC 5CB1A 5DPSA 2N1VA 2EDUA 1T4GA 2GI9A 3GP7A 4PHEA 2BPCA 1TE2A 3N7RC 2DZIA 2BCRA 4IQTA 1N48A 2DZKA 1ZQHA 5KFUA 2IDYA 5HFYA 3S2AA 5CHWA 4IW0A 5ALKA 4IM0A 1NJZA 2KFNA 1WMHA 2LXCA 2H88B 3IVFA 4UB2A 1V1OA 1ZQKA 4W9LA 3VTUA 5KG0A 3NVZA 3UQBA 2KX0A 3GV7B 2RLTA 2I1KA 3OJ4B 2VZKD 2MUTA 3N7SC 1TT5B 4UB8U 1TZOA 2OJWA 3T8MA 1TTNA 4UBCA 2KSOA 5ALNA 3AULA 4E0DA 4F4YA 4J9PA 1H4RA 1LGRA 2K1FA 4RQ2A 5KNIA 5D6JB 1KEJA 1WYWB 3B2FA 4C4TA 2RDHA 4AWJA 2KOXA 1PQSA 2ONQA 2J0MA 3VVWB 4O3NA 2W9BB 4GDKA 2M1MA 3RT3B 4OW0A 2MA9B 2VH1A 3HIZA 4RF1A 2JX5A 3L3FX 2BQQA 3SI8A 1TV9A 8ICAA 1HUOA 2N9EB 1L3TA 5KFDA 1UA0A 4RU9A 3HP6A 2WXLA 1S1QB 2D3BA 2WXRA 4XQ8A 4EELA 5F9LA 3F2DA 2H89B 1OUQA 4W9JA 2HDEA 4Y2UA 1XU4A 3PVXA 2M17A 3W2DA 2IOHA 2KP7A 3R66C 5KFZA 1EUVB 3AE8B 4DOAA 5BOMA 2DGZA 4DHZB 3TAQA 4QNLA 2R2QA 1IUEA 3MGHA 1YQBA 8ICXA 3QUCA 4O1NA 1L6NA 2Y9TA 2EELA 4HEA1 2R8JA 1DK3A 2H3ZA 2W04A 4RGNA 3T5JA 2KN7A 2HJ1A 4HROA 2Y1IA 4Z6DA 1C78A 1MQ3A 5HNKA 4R3DA 5CHVC 3C2LA 4WJ3B 1XEEA 1HJPA 3N32A 1Q1OA 5AUIA 2JHDA 3WKBA 3LYSA 2FE9A 3HW8A 5JHAA 2ISPA 1NK8A 2KMCA 3OHAA 3GIKA 2HVHA 5J2EA 2A1JB 2K0PA 5J0PA 4EENA 2GOWA 4M9HA 4EYHB 3VTWA 9ICJA 3T5KA 2WF6A 8ICHA 8ICMA 2ZW1A 3SD5A 1WX8A 1TAUA 2MJEA 4DSKA 3KWLA 1F77A 1BMLC 2IY1B 5AKIA 2QEJC 8ICYA 1MHHE 1GAQB 1V81A 1T0YA 4TSSA 2JEFA 1HE8A 4B9KA 5DDMA 4R8UB 1QLBB 4J9RA 5EDSA 1QZEA 5IILA 5EE9A 4PZNA 2QSDA 1ZOLA 3GFKB 4KLLA 4KLSA 3C0RB 5EE0A 5BYQA 1YN4A 2M19A 4K81A 4JV1A 4PT5A 2NRZA 2FCNA 3MP9A 3WKDA 3QEAZ 4B9VA 3MBYA 3UXNA 4O3RA 2ZNVC 9ICVA 1UPHA 2L0TA 5CA7A 2LGSA 3RH6A 1MJDA 1HTOA 1T8EA 4OJ6A 3H40A 4K3BA 4BWMA 3V7KA 2Q0ZX 3NRZA 4OJLA 2BGWA 3TARA 1NVID 4GMVA 1S76D 2GB1A 1WJUA 2EZZA 2BPGA 3P1MA 5HP4A 4I2IA 2K4PA 1JXLA 2E8MA 5JH5C 1UCVA 1RYJA 3IHPC 1EM7A 3TFSA 3ZDBA 3ZW3A 2MP2A 3TL5A 4RNNA 5FP0A 3PREA 4MJSB 2M9NA 2DNFA 3BJYA 2JZZA 1N5XA 1ZQQA 3PLUA 3QC8B 1K53A 2QB1A 3NASA 1RG6A 4XA5A 1QQ7A 4DSLA 4FN2A 4DHJB 4P0PB 4ECTA 1UT8A 1YN3A 2KTFA 2ZIVA 4KX5A 1KFSA 4DFJA 1CRXA 2KJRA 1A76A 3ZGZA 4F72A 4M9NA 4GLSC 2VRRB 2CU1A 3AUOA 1MPEA 2N7JA 4KLQA 4DEZA 3QQ8B 4XC2A 5G55A 8ICRA 3LVWA 4PH5A 3H4DA 4GXKA 4JGHB 2BTEA 3GE8C 3U30A 1KSPA 2KC2A 5AKZA 2D3CA 5KFOA 1KLVA 5AM0A 5DCNA 3ZDEA 5DBAA 1YQ3B 1C77A 3A4RA 1BNPA 3BZCA 3IBEA 5J8YC 1D6EC 3KUCB 1ESFA 4Y2RA 4ZH4A 4GDLA 4K4IA 1VZ8A 2ATLA 2M0XA 2K5PA 1WJ6A 4ZHOA 2D11A 4Y2XA 3EGRA 2HHXA 2ES6A 2KO3A 4GB9A 3TAPA 1XLPA 1UBQA 4IR9A 3WIMA 5AM2A 1WX9A 5GXGB 4HXDA 3AE3B 4I2JA 5KTQA 4KLDA 2INCC 3DBRI 2ZIUB 4QJFB 1LXDA 2A19A 2SAKA 3MJ5A 4F93B 4LJPB 4OVVA 4ANWA 1RLFA 4F1SA 1CMXB 1OEYA 4IS7A 3RYTA 4JK1A 3QUTA 3AU4A 3RR7A 2W43A 3NVWA 5KHQA 4RQ6A 5KFAA 1IPGA 4WJPA 4QZFA 4UBBA 3VRBB 1E90A 1JIHA 1O08A 2W3SA 5KHOA 4YTMB 1GB4A 1C9FA 4TUQA 2J6SA 2NPTA 5L95C 1LQBA 4YXJA 3DHHC 2WDQB 1QOGA 1OGWA 4WWNA 4CHKA 2FCSA 1WCLA 2MSED 2SEBD 1WWUA 9ICQA 4M02A 2LI6A 1J7AA 1MVKA 8ICCA 3BS5B 5KFEA 2OM6A 1JWAD 1UWMA 2LJ5A 5ALYA 3QU9A 9ICBA 2JH1A 4RGMA 4P16A 3Q8MA 3OJUA 3PY8A 4Q2JA 1T0RC 4CO7A 2HMXA 9ICOA 5MPOA 1KQQA 3AE4B 2KJ8A 3AL0B 4ICUA 3F5EA 1UZXB 2TSSA 5D3IB 3H8SA 1CEZA 3EPIA 3HWTA 5EE3A 3CWIA 5JZEB 2RR9A 2BKFA 4OZCA 4L23A 3Q3NC 3KQ4A 1WWVA 3RZFA 3Q3FA 2ZEQA 1TVAA 1WXAA 4GGQA 4QZ8A 2PMVA 3OPXA 3NGDA 3VQIA 2BCQA 1P9DU 1X9XA 1M6YA 4N6EB 5J2HA 4FZMA 4J9MA 2RRDA 4NY0A 1V1PA 3GU3A 3KBBA 3PZDA 1WXVA 4OJPA 2C7HA 3AH7A 3M6ZA 1TKYA 4P4PA 4YSYB 3M9OB 4YXDB 3Q2AC 4BXOB 3RRHA 1SXTA 3TEXA 5HMMA 7ICMA 4G11A 2BHNA 4NAWB 2KX3A 3ZNGC 5L1KA 4ANXA 2DX5B 1YMHE 1YNTE 4HKQA 5J0SA 2LJIA 3WKEA 2W9CB 7ICKA 7ICRA 3S6JA 4GXBA 2DAJA 3CMMB 9ICSA 1Z00A 2UVWA 1EF5A 2KDMA 1TJEA 4F3OA 2DPIA 3A0BU 1SE4A 1STEA 4M00A 3RI7C 1FO4A 4ZYSA 5ALZA 4NQLB 3KLSX 2C2DA 3TANA 2IYDB 1S8OA 4DDID 3PNCA 3ZVVA 4R64A 3AEVA 1UHUA 1V97A 1PVRA 4FJYA 4NM1A 1VRAB 5IIJA 3TADA 1ZQXA 3SENA 4HJGE 3WA0A 1K50A 8ICTA 2MCNB 1WXQA 2WB1C 1R7SA 1C7YA 2KEYA 1BPXA 2L7RA 1YT3A 3CYMA 4FBJB 9ICIA 4BBNC 4X5VA 2VA8A 2KZMA 2K4HA 1F44A 4AUQC 3SEIA 2F2AB 4DCCA 1TFRA 3IT4B 4JL9A 4RUCA 2H5XA 4OZBA 1Y8RC 3NHEB 4JWSC 2BWFA 2LKYA 2W8KA 1WM3A 2E1EA 3D32A 4XWTA 3TACB 3M9MB 2MRLA 2G1EA 4LNNA 3HJEA 1JRPA 2NCNA 1V5TA 2BT6A 5J2AA 3RJHA 2IPKD 2KWVB 3HILA 5KFGA 3QARA 2KDEB 2UWQA 3BK2A 3WANA 5IKCM 3DEEA 4MSMB 4MEXA 4EBEA 3R2TA 5KG3A 5ALEA 4F4WA 5B66U 2AGQA 5AICA 1EXNA 4DL3A 4KLGA 2Y5BB 3I3TB 2KN5A 3HRDD 2GOLA 3V72A 2RHFA 2EMSA 3C2KA 4W9DA 2PFQA 1JX4A 5ALIA 4M9JA 1T0QC 1L3UA 2HTME 4KSKC 2DYOA 4F5RA 3W1YA 1VZ7A 2HDOA 4F50A 1JW9D 3V6HA 2VJ5A 2FCQA 4GSWA 2Z8LA 4EKUA 5KG7A 3HPOA 3KZXA 2KTRB 1B0XA 1E0ZA 3PW4A 1X6JA 5DQIA 4KIKA 1ZQNA 1I42A 1D8LA 5TR5A 1H8CA 2BB5A 1S10A 1ZQLA 2BYVE 1LV5A 4EEWA 2F76X 5HG2A 3NY5A 5ALWA 2ZG6A 4NLKA 1T6BX 1XS9D 2FLPA 2JR5A 2Y9UA 1R4NB 3I63C 4IC9A 5KFTA 2H3QA 1L7YA 3KTQA 2WU5B 1ZXIA 3GIMA 3SDLC 1JROA 5BMGA 1Z1BA 5C2TB 3RBEA 4ARCA 4DLEA 2BDPA 3A9KB 5AI8A 3L16A 4F71A 4JV0A 1ENFA 3R3MA 3Q8LA 2LD9A 1KFYB 4M6WA 3Q8SB 4DOCA 3TIXA 1L6UA 3DWGC 3RNAC 1X40A 3GV8B 7ICSA 2HSZA 3BS7A 1D8BA 3AE5B 4ED7A 4BX9C 3MGVA 2WAQC 2R8IA 1U47A 2DF4B 2G4SA 2QMTA 3BZDB 3RULA 3ZTCA 2PVOD 2AGOA 1S0MA 1S97A 2A1AA 1I4RA 4ED6A 2JYEA 2KFKB 3C5GA 1EF1A 3KUZA 1XCTL 3KW5B 1X9WA 1ZQCA 2EKIA 1NK6A 1NJYA 1H38A 1E8WA 4EX6A 4YMOA 2YEPB 3KVFB 1TK8A 5KFRA 2Q5WD 2H3IA 1WGYA 3W1SA 2Y5CA 5IN7A 1FNVA 4W9FA 1QT9A 5C3JB 2KC1A 1RXWA 4IUMB 2M8SA 5C23A 1OQQA 4P7IA 9ICHA 3WK6A 5T14A 2E6XA 4EUTA 2AQ3B 4ED1A 1UWXA 1YQ4B 1XLNA 4C4VA 4DS5A 2WXGA 3BVGA 3MFIA 5ALGA 4Q43A 3DVNV 7ICLA 3TEZA 3U8ZA 5CJ7A 1WMHB 3JW0X 2GWSA 3SHQA 2K8CA 3AEDB 5BPCA 4KITB 4F4XA 7ICUA 2MUTB 3BDPA 4EBDA 4DSEA 4IRKA 1WCNA 4M01A 2KSOB 2KE7A 4FZLA 4RPXA 4UQGA 1L5PA 2HVIA 3QU7A 7ICIA 2ZJ5A 2R18A 3PSIA 4IQUA 1M94A 3DBHB 4C8OA 4YWGG 1UNSA 2KQSA 2BPSA 4GDKB 2DYMA 1FIQA 4RF0A 1ZQSA 3RCZA 4ECYA 2WF7A 1TK5A 2HOQA 4YTPB 3AEGB 2ZUBA 4Z6CA 1DGSA 3LB8C 2LYBA 1V80A 1J7BA 4QZBA 2G45B 3AE7B 4QZEA 7ICOA 2AQ1B 1Y88A 3PHXB 1U48A 2YX8A 3ZQ4A 4RM8A 1L7OA 3ED5A 1XSNA 1JCKB 2V9WA 1IBXA 3A1QA 4DQRA 2KHQA 1SBBB 1X1MA 4IG7B 3A4SC 3DHIC 4KKJA 4A8XC 2XN9C 2AHOB 5FK9C 4YR3A 3AU6A 3UMCA 3VCBA 3I57A 4TQSA 2QARB 3RNCC 1J2MA 1E7UA 3P4SB 2REXA 4FXCA 5BYSA 5JXVA 1QCKA 3V7LA 5KFMA 3QNMA 2ALZA 2D8CA 1N2XA 1URJA 4BUGA 1FCCC 2KK0A 4XRHA 2QKQA 3WK4A 1E8XA 8ICVA 2KIVA 4UW9A 3OHBA 3ALBA 2XEWA 1WY8A 1JI7A 1PUZA 5D2MB 1BPDA 2JU6X 5J0YA 3KOOA 2WQYB 1SJHD 1GG3A 2P66A 2KYWA 3GZNI 4DLGA 3HVDA 1QILA 3K1ZA 4ZRPA 3TBLD 1JMSA 4YP3A 3PW5A 3AU2A 1BXTA 2HE7A 3WAPA 4NZLB 4RNAA 1LM8B 2HHSA 4XE0A 3AI5A 3P63A 3B1LX
chains in the Genus database with same CATH topology
1SE3A 4EE2A 1NYRA 3V05A 2K0PA 2IGGA 2WXNA 2J52A 2WXHA 2ZW1A 2W3RA 2MJEA 4MH8A 1M4VA 3KWLA 4MT5A 1F77A 1BMLC 3NS1A 2QEJC 5AUKA 1MHHE 1JWMD 3ZYYX 3RPFC 1GAQB 2KACA 2NTSA 1L6VA 3LXFA 4TSSA 2IJ0A 5I4DA 4HRSA 1QLBB 1WYGA 1SSNA 1TKGA 3SFEB 5EE9A 2QSDA 1D4BA 1JQ4A 1TS4A 2WXQA 2WXKA 1V8CA 1XF5L 5EE0A 5BYQA 1F2RC 4TQ1A 2N9LA 1YN4A 2M19A 2G9HD 1EU3A 2ZW0A 3P4QB 2JSVX 1PDXA 2WXIA 4PT5A 3AE1B 3MP9A 1I4XA 4AQ7A 1TYGB 4C56C 3ZJVA 3CIRB 2DLBA 1RFKA 3TEWA 1IGDA 1ZE3D 1HZ5A 2YEPF 2X38A 5BYRA 3KWVA 1AWDA 3NRZA 4P6VF 1NVID 2LHDA 2GB1A 3P1MA 5H8YE 1SE2A 3AN1A 1RYJA 2W82A 1EM7A 4XDCA 4MACA 1CQVA 1TS2A 2QIEB 4N58A 3TEYA 5G5GA 3ETRA 3NUHB 1PGBA 4XWWA 5T8IA 1N5XA 1NYQA 2PW9A 3BK1A 1K53A 2JYTA 1GPXA 1YN3A 1HXYD 1TY0A 2PIAA 4RH6A 1NI3A 3AB5A 1C4CA 3Q8CA 3ZGZA 4GLSC 1MPEA 2N7JA 1ZOYB 1LO5D 4YTNB 3EA6A 4US8A 2BB6A 2DWQA 2BTEA 3HVZA 3C8YA 4GDLB 1FMAD 2JZPA 3BVMA 3AE2B 1EU4A 2CJNA 1E7PB 2K22A 5BMHA 2OHFA 1FRRA 2WS3B 1XXGA 3AEAB 2FUG1 2WU2B 2IGDA 1YQ3B 5FR3A 1C77A 1ZDXA 1XCQL 1ZUD2 1D6EC 1ESFA 2J53A 4ITKA 2I2YA 3VR9B 2V3NA 2PLPA 2WXOA 1VZ8A 3ABVB 2K5PA 4ZHOA 4WWMA 3EGRA 1QOAA 3W5VB 1E6EB 4ARIA 2PVGC 1XLPA 1KF6B 4UDUC 1XLQA 3AEEB 3NVVA 2CJOA 4KX6B 2BYTA 4USAA 2K3UA 4H2AA 2R61A 5GXGB 2W54A 1KRHA 3AE3B 1I7HA 2INPE 2DBYA 3MJ5A 2SAKA 1WWTA 1B9RA 2RPVA 3AV8A 5BMIA 1I4GA 1D5ZC 4N59A 1D5MC 1MI0A 2KWDA 2PTLA 3NVWA 1Y56A 1FRDA 2ICIA 2W55A 1ET9A 1UGJA 3GS2A 1HEZE 5FKAC 4MM3B 3VRBB 2W3SA 2ACZB 4WIPA 4YTMB 1GB4A 1TY2A 5E6JA 1C9FA 2KN4A 4HKZE 4C7ZA 2WDQB 1QOGA 3E56A 2XNAC 1RM6C 2SEBD 4L2YA 1PUTA 3VR8B 1J7CA 1FM0D 1J7AA 1MVKA 1B1ZA 1FEHA 2MJDA 3MFGA 2IGHA 4OVZA 1JWAD 1N62A 1UWMA 4NJCA 2N0SB 3IAS1 2LHEA 5H92C 3IT6B 1FXAA 1VZ6A 1SB3C 4RGMA 1T3QA 4P16A 4Q2JA 5MPOA 1QQRA 3AE4B 3TUOA 1C4PA 2TSSA 1ROEA 3PO0A 4WH4A 1V1PB 5D3IB 3BIID 4WURA 3FAHA 3CWIA 5EE3A 4A9AA 4OZCA 3FC4A 3I9V1 2BS2B 1N63A 1KLUD 4L23A 3FILB 3KQ4A 1I4PA 1KLGD 1EWCA 2BS4B 2PMVA 3URYA 3VQIA 1Q10A 1I4QA 3BYTB 4N6EB 3N9YC 1V1PA 1FXIA 4B0EA 2M0AA 4US9A 3AH7A 4YSYB 1TKYA 4YXDB 1K51A 3FILA 1SXTA 3TEXA 3SR6A 3LYYA 4NAWB 1KH0A 2B76B 4B0MA 5LNK1 4ZOHC 1ZDVA 4IKGA 1YMHE 1YNTE 1AYFA 2GRIA 4HKQA 2LJIA 2V3PA 1PYWD 1SIJA 2WXJA 2KDMA 1TJEA 1STEA 1SE4A 1BUIC 1FO4A 4KGTA 2V4IB 3AE6B 4ZYSA 2Y3AA 3KLSX 1AW7A 3B2GA 4TMAB 2KMMA 1V97A 4L1BA 3PZ7A 4DXGA 1VRAB 4ZHPA 4KGSA 4HJGE 1K50A 1CZPA 1XLOA 2OEDA 1WXQA 1R7SA 3W5UB 1VJKA 4CQNA 2WDRB 3T3OA 4KGRA 1FNWA 3BVZA 3MC0B 3W9CB 1JWBD 1PFDA 1FD6A 1OQRA 1NEKB 1CK1A 3IT4B 4OZBA 2INNE 1JMLA 4JWSC 3NVYA 3AEFB 4LLGM 2Y5PA 2V0GA 2MEKA 2BS3B 1E10A 1L4DB 2L32A 4XWTA 5D3DA 1AN8A 3U7ZA 2WLBA 1FFUA 4RGOS 3Q8BA 2G1EA 3U2SC 2MH7A 1JRPA 2BT6A 2IPKD 4RFBA 3TSSA 3RFZB 4YT0B 3BK2A 2JXTA 4C7YA 5D7GA 4JPSA 3R2TA 2MJ3A 1JWSD 2LUMA 3J9CA 1XO3A 3SEBA 1L4ZB 1WGKA 3Q8FA 1VDVA 3EUB2 3HRDD 2RMMA 1TS5A 3AM9A 1CJEA 2VZKB 3UI3A 2LEKA 5HI1A 1DYQA 2QJLA 3ZJTA 3VRAB 1QOFA 2HTME 2DYOA 1VZ7A 1JALA 1JW9D 2Z8LA 3ZJUA 1E0ZA 4LK0M 1GB1A 2BB5A 3AEBB 4XDDA 3E9SA 4WAFA 5HG2A 3U52E 2L52A 2BBCA 1OFFA 1T6BX 1YN5A 2WXFA 1SF0A 2KAJA 3PZ8A 3IXSA 4JWUC 4DXFA 1T5XD 2WU5B 3U4EG 1QKZA 1SJED 1ZXIA 1C79A 3BYYB 4RGTA 4DQOC 1JROA 5BMGA 3Q8EA 2LMCA 5C2TB 4ARCA 1L0VB 1P7EA 1QOBA 2E3TA 2J42A 1ENFA 4JX1C 2J4XA 5HHDG 2I38A 1KFYB 1PGXA 1L6UA 3DWGC 3BWUD 3AMZA 2RDGA 3AE5B 2WNMA 2D5GA 2K9XA 3HUIA 4IOIE 1HQRD 3BZDB 2QMTA 4IDIA 1FFVA 4RCOA 1TKEA 2PVOD 1E9MA 3OWEB 3SFDB 5TSSA 1I4RA 2JYEA 1VR9A 4NAMA 1MHXA 1RWSA 2L83A 4WQMA 1XCTL 2WXMA 1DOXA 1L0XB 4J3OD 2EKIA 2NMQA 3H8HA 2YEPB 2Q5WD 3W1SA 4AS1A 4JE3B 2Y5CA 1P7FA 1FNVA 1DGJA 1DOYA 1QT9A 1ZP0B 3V3XA 5C3JB 2FBWB 1UUPA 1OQQA 2E6XA 2AQ3B 1UWXA 1YQ4B 1XLNA 2WXPA 4YSXB 2WXGA 3BVGA 1N5WA 1ZXHA 1K52A 3P4RB 1SEBD 4A55A 3TEZA 3L4PA 2L1AA 3IAM1 4ZRQA 3AE9B 2LFIA 2GI9A 5G5HA 3AEDB 3GP7A 1L0YB 1FNUA 1ZPSA 2JWUA 1F0ZA 1JWUD 2IDYA 2PKOA 5HFYA 1L5PA 1D5XC 2H88B 3O13A 4YWGG 1V1OA 1UNSA 4OHJA 3NVZA 4D2KA 4GDKB 1C76A 2DYMA 1FIQA 4RF0A 2VZKD 3DWMA 1TZOA 3GB1A 1FCLA 1WSPA 4YTPB 3AEGB 3MHZA 1YJIA 1IBXB 3LB8C 4A6QA 1QF6A 1J7BA 2QILA 1EWYC 4KKIA 3T3NA 3Q8AA 3B2FA 2RDHA 3NZ3A 2ONQA 1PGAA 1KTKA 3AE7B 2AQ1B 1VLBA 2M56B 3P4PB 4OW0A 3ZQ4A 1JCKB 4RF1A 2WDVB 2KQ4X 2JX5A 2LGIA 3Q69A 4M0WA 5EE1A 1IBXA 1F2RI 2AX5A 2BW2A 1C4AA 1SBBB 3WCQA 4A8XC 4KKJA 2WXLA 1ACCA 2XN9C 1I4HA 2WXRA 5FK9C 2JQRB 3P42A 1N60A 3I57A 3R2IA 2H89B 1NENB 2HDEA 3W2DA 3P4SB 3B9JA 1YJJA 4FXCA 5BYSA 5JXVA 3R8BA 4OZAA 1A70A 1HA5A 3AE8B 1DOIA 2CU3A 4TQ0A 1FCCC 1IUEA 2FE8A 4LTUA 4O1NA 4A90A 2N9KA 4HEA1 2EELA 3AECB 4REZA 1TS3A 1WRIA 2JU6X 4RGNA 2WQYB 1SJHD 1HZ6A 1N61A 4YSZB 3HVDA 4HROA 1QILA 2WP9B 4ZRPA 2AQ2B 1C78A 1IGCA 2NTTA 1BXTA 1ET6A 4R3DA 4NZLB 4RNAA 2ON8A 4C80A 1XEEA 5AUIA 4XE0A 3P63A 1GOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR9 B;  4ZHP A;  2EKI A;  1CZP A;  1XLO A;  1NYR A;  1WXQ A;  1R7S A;  3ABV B;  2K5P A;  1VJK A;  3W5U B;  4ZHO A;  2WDR B;  4WWM A;  3W9C B;  2Q5W D;  1QOA A;  1JWB D;  1E6E B;  1PFD A;  3W5V B;  1OQR A;  2PVG C;  1XLP A;  2Y5C A;  1KF6 B;  1DGJ A;  1NEK B;  1DOY A;  1QT9 A;  1XLQ A;  1ZP0 B;  3NVV A;  2CJO A;  2FBW B;  3AEE B;  4KX6 B;  4USA A;  5C3J B;  2W3R A;  4IDI A;  2MJE A;  2W54 A;  5GXG B;  1KRH A;  3AE3 B;  1I7H A;  1OQQ A;  4JWS C;  2DBY A;  3NVY A;  3AEF B;  1WWT A;  3KWL A;  1YQ4 B;  1B9R A;  1XLN A;  3NS1 A;  4YSX B;  5AUK A;  3AV8 A;  2BS3 B;  1E10 A;  1N5W A;  3ZYY X;  3RPF C;  1GAQ B;  4N59 A;  3P4R B;  1L6V A;  3LXF A;  3L4P A;  1FFU A;  3NVW A;  1WYG A;  1QLB B;  1TKG A;  2G1E A;  2WLB A;  2MH7 A;  4HRS A;  1FRD A;  1JRP A;  5EE9 A;  3SFE B;  1JQ4 A;  2BT6 A;  3AE9 B;  2W55 A;  1V8C A;  5G5H A;  3AED B;  5EE0 A;  3VRB B;  2M19 A;  4YT0 B;  1F0Z A;  4C7Y A;  3P4Q B;  2W3S A;  1PDX A;  2ACZ B;  2PKO A;  4YTM B;  3AE1 B;  2MJ3 A;  1L5P A;  1TYG B;  1XO3 A;  4C7Z A;  1WGK A;  1VDV A;  3EUB 2;  3HRD D;  1QOG A;  2WDQ B;  3CIR B;  2H88 B;  1RM6 C;  3AM9 A;  1CJE A;  1PUT A;  1RFK A;  3VR8 B;  1J7C A;  1FM0 D;  1J7A A;  3NVZ A;  2LEK A;  2MJD A;  2QJL A;  3VRA B;  1JWA D;  1FIQ A;  1N62 A;  1QOF A;  1UWM A;  2HTM E;  2N0S B;  3DWM A;  4YTP B;  1AWD A;  3NRZ A;  1JAL A;  1JW9 D;  1FXA A;  1YJI A;  3AEG B;  3LB8 C;  4P6V F;  5H92 C;  1QF6 A;  1NVI D;  1SB3 C;  1J7B A;  1T3Q A;  1EWY C;  3P1M A;  3B2F A;  1E0Z A;  5MPO A;  5H8Y E;  3AN1 A;  3AE4 B;  1RYJ A;  3AE7 B;  1VLB A;  1ROE A;  3PO0 A;  2M56 B;  2QIE B;  3AEB B;  3P4P B;  4N58 A;  4ITK A;  5G5G A;  3BII D;  3ETR A;  3FAH A;  3CWI A;  5EE3 A;  2WDV B;  5EE1 A;  2JX5 A;  4A9A A;  3FC4 A;  2L52 A;  2BS2 B;  1N63 A;  1N5X A;  1NYQ A;  2AX5 A;  1OFF A;  1SF0 A;  2KAJ A;  3WCQ A;  2BS4 B;  4JWU C;  2JQR B;  2WU5 B;  4N6E B;  1N60 A;  2H89 B;  1ZXI A;  1FXI A;  1NEN B;  1GPX A;  3P4S B;  3B9J A;  1JRO A;  4US9 A;  1YJJ A;  2PIA A;  3AH7 A;  4FXC A;  1TKY A;  4YSY B;  1A70 A;  1L0V B;  1NI3 A;  5C2T B;  1QOB A;  3AB5 A;  4YXD B;  2E3T A;  3AE8 B;  1DOI A;  3SR6 A;  2CU3 A;  4JX1 C;  2B76 B;  1IUE A;  1ZOY B;  4ZOH C;  1KFY B;  4YTN B;  4LTU A;  4US8 A;  4YSZ B;  1AYF A;  1L6U A;  3DWG C;  2DWQ A;  3AMZ A;  3AEC B;  3AE5 B;  3HVZ A;  1SIJ A;  2K9X A;  3HUI A;  1WRI A;  1FMA D;  1TJE A;  3AE2 B;  2WQY B;  1FO4 A;  1FFV A;  2CJN A;  1N61 A;  3AE6 B;  1E7P B;  1TKE A;  2K22 A;  2OHF A;  1FRR A;  2PVO D;  1E9M A;  2WP9 B;  2WS3 B;  3AEA B;  3B2G A;  4HRO A;  3SFD B;  2KMM A;  2WU2 B;  1V97 A;  1YQ3 B;  4C80 A;  1RWS A;  5AUI A;  2L83 A;  4WQM A;  3P63 A;  1ZUD 2;  1DOX A; 
#chains in the Genus database with same CATH topology
 4KN4 A;  4LJX A;  4E3C A;  2HCF A;  1NYR A;  2EH9 A;  3P2B A;  4PS8 A;  4U7C A;  4QWA A;  3QE9 Y;  1U9L A;  4ASW C;  3RNB C;  2KG5 A;  3MAB A;  2J52 A;  3C1Z A;  4MH8 A;  5KFH A;  4IQV A;  2BVC A;  2LI5 A;  4HLE A;  1J8C A;  2BQU A;  4MT5 A;  4G3X B;  2LGD A;  5DDY A;  4QWB A;  5AI5 A;  3RAQ A;  2MW5 A;  2I1Q A;  1JWM D;  3ZYY X;  4BVU C;  5D49 A;  1L6V A;  5I4D A;  2E8O A;  1SGH A;  3RJJ A;  4HRS A;  3DBL B;  4Y2T A;  2DPJ A;  1SSN A;  3SFE B;  3H0R B;  2IND C;  5IOI A;  5J2F A;  1D4B A;  3FKY A;  1JQ4 A;  2WXK A;  1Q8K A;  4YCX A;  4QW8 A;  7ICH A;  4Q45 A;  5AM4 A;  3JVZ X;  3UIO B;  2DZJ A;  3R7Q A;  2WXI A;  3EYZ A;  3QHT A;  5ALQ A;  3H7I A;  3AE1 B;  4LNO A;  1ARO P;  4I2A A;  1I4X A;  9ICP A;  4C56 C;  4DBG A;  3PST A;  7ICT A;  2DUY A;  3ECI A;  3F5A A;  3GDX A;  2DLB A;  4WWP A;  5ALL A;  3N28 A;  3VUX A;  2WDT B;  2CHW A;  3K9O B;  4C4R A;  4HVB A;  2ZTE A;  1L3V A;  9ICW A;  1IGD A;  5A0L A;  1ZE3 D;  1HZ5 A;  3MHS D;  2CN1 A;  2MP2 B;  1ISN A;  2JZB A;  4ECQ A;  4OVU A;  2N4F A;  3PV1 A;  2LHD A;  4GC7 A;  1I35 A;  5ALF A;  5EWG A;  4K1R B;  1S9F A;  8ICQ A;  3UQA A;  3ZRC A;  1SE2 A;  3AN1 A;  1J2N A;  2CHX A;  2QIE B;  2LVP A;  3N30 A;  3ETR A;  2ZIV B;  2WB1 F;  4F92 B;  3I1Y A;  1KJT A;  1PGB A;  4UB3 A;  2FID A;  3V62 A;  4BBN F;  3PR5 B;  4DQI A;  4ELU A;  2C60 A;  4G50 A;  2PMZ C;  1N6Z A;  3BK1 A;  3WKA A;  2JYT A;  2KK8 A;  4LJO B;  1TZ1 A;  4RQ0 A;  3J81 j;  1S77 D;  1WGR A;  2FIF A;  4W9E A;  2P6U A;  4W9I A;  3DVG X;  2WFA A;  1HXY D;  2PIA A;  3WAL A;  4RQ3 A;  1L8O A;  3AB5 A;  4Q44 A;  3C29 A;  1C4C A;  1WXS A;  3Q8C A;  4DXA B;  4DF8 A;  1XO1 A;  4O5C A;  1P3Q U;  2DEN B;  1XSP A;  2IHM A;  1WGG A;  1ZOY B;  4YTN B;  1Q46 A;  4US8 A;  3RJF A;  1RRB A;  4OO1 J;  1S0V A;  2BB6 A;  4CE6 A;  5DBC A;  4CCH A;  5IIK A;  4YMN A;  3HVZ A;  4ECX A;  2YML A;  4O3Q A;  4J9K A;  4GDL B;  2JZP A;  3AE2 B;  2KVS A;  1XD3 B;  3BY4 B;  4Y2Y A;  1P7D A;  2DKX A;  1E7P B;  2K22 A;  2WS3 B;  3AEA B;  9ICA A;  2FUG 1;  2WU2 B;  4ECS A;  5FR3 A;  1HUZ A;  3PX4 A;  1SL1 A;  1U49 A;  1Q3U A;  1B22 A;  2I2Y A;  3VR9 B;  5HKH A;  4BKS D;  3PR4 A;  2C9W B;  5KFS A;  5DQG A;  4KSL C;  4I2G A;  4ARI A;  2K39 A;  2NVU I;  1D9D A;  1KF6 B;  2RDJ A;  3QXG A;  1Z5S B;  4UDU C;  4XDC A;  3NVV A;  3D2Q A;  5AM1 A;  4NXZ A;  3GV5 B;  4ACO A;  3KFU F;  2FNJ B;  3JYU A;  2BYT A;  2R61 A;  2WYQ A;  2DBY A;  4MDK E;  4XGA B;  2YTU A;  1R4M B;  5J2K A;  8ICN A;  3HT3 A;  4J9O A;  1F52 A;  2EAM A;  4N59 A;  2NPT B;  1IIP A;  1MI0 A;  3H8W A;  2K89 A;  4XUS A;  3ZXR A;  4QWC A;  4OCZ A;  4YG2 A;  3BQ0 A;  1ZRN A;  9ICC A;  2W55 A;  2K8A A;  3GS2 A;  1HEZ E;  4DFK A;  1IP9 A;  2JPH A;  4NY8 A;  1E7V A;  3THV A;  3ZUN A;  5KG6 A;  4HKZ E;  3GIL A;  4C7Z A;  1X66 A;  3PT2 B;  1ZW7 A;  4Q8F A;  2JZ3 B;  1J7C A;  3HK0 A;  4G9B A;  4KVG B;  4P4M A;  2XY7 A;  3ISC A;  3MFG A;  5IIN A;  4AYB C;  2IGH A;  1GO3 F;  4NJC A;  2N0S B;  5L1M A;  2WAQ F;  3IT6 B;  1VZ6 A;  3ZIM A;  2E8N A;  4PS7 A;  1NZP A;  2B21 A;  2PFO A;  3CSF A;  2KVR A;  1NKB A;  4FHK A;  4DL2 A;  3PO0 A;  1ROE A;  4PZO A;  3PX0 A;  1V1P B;  2JY6 A;  4MEL A;  3BII D;  2WWZ A;  3FAH A;  4ECZ A;  1TKD A;  3DCG A;  4C4S A;  4II2 B;  4A9A A;  1L2N A;  3FC4 A;  2O6V D;  4LZD A;  4EZK A;  1KLN A;  1KLG D;  1NK9 A;  3URY A;  4F5N A;  2G08 A;  5KL1 B;  4PHA A;  1ZQW A;  1KM7 A;  4GN1 A;  3C1Y A;  3QX7 A;  1Z4O A;  1FXI A;  3ZNZ B;  4WJQ A;  5KG2 A;  4B0E A;  2QLT A;  1Z00 B;  4US9 A;  4M04 A;  4HJK A;  3O0F A;  3HHM A;  2YY6 A;  5DG8 A;  3FIL A;  3FDS A;  3SR6 A;  1ZGU B;  4RPZ A;  1V49 A;  2B76 B;  5H2F U;  4B0M A;  2NO4 A;  4HPM B;  1ZDV A;  4IKG A;  1CUK A;  2XCP A;  5ALJ A;  4EEY A;  3ONN A;  2LM1 A;  2BPF A;  4MFC A;  4QWE A;  2V3P A;  3SAG A;  3E2E A;  3SQI A;  4II3 B;  3PRZ A;  4TUU A;  5J2I A;  2V4I B;  2NRW A;  1YX6 B;  4C8N A;  5CHF A;  3B08 A;  2ZJ8 A;  4PHD A;  4EZJ A;  2LYA A;  3EFU A;  4O5K A;  4ZHP A;  8ICJ A;  4UB6 U;  2V4Q A;  2Q4T A;  2VA2 A;  2GBM A;  3IG5 A;  3BQT A;  2G0A A;  1CZP A;  3X23 A;  2OED A;  1VJ5 A;  2N9P C;  3W5U B;  1VJK A;  2EAO A;  4DSJ A;  2PI5 A;  3W9C B;  1PFD A;  2JMG A;  4DOB A;  1OQR A;  5C1Z A;  4BWJ A;  1KL9 A;  3PW2 A;  2ZCB A;  1NEK B;  1WH3 A;  4TQR A;  3MR5 A;  4MF2 A;  4KZ0 A;  3ZDD A;  1NK4 A;  1KKX A;  2LYH A;  4LNK A;  1KN5 A;  4DSF A;  5KFW A;  5J2B A;  4P0Q A;  4DFD A;  5TZV A;  2E5S A;  3G6X A;  2IBK A;  4K4G A;  1WRD B;  4GIV A;  3KD3 A;  2FCM A;  4ELT A;  3PSP A;  2L32 A;  4AP4 C;  1WR1 A;  2YMQ A;  3PRM B;  5D3D A;  3U7Z A;  1FFU A;  5KG1 A;  3U2S C;  3PSE B;  4B9N A;  1WZ0 A;  4Z6E A;  5L1J A;  4RFB A;  4FA6 A;  2XID A;  2WTF A;  3TSS A;  4Y2S A;  3RFZ B;  5J8Y A;  3ML9 A;  1NNL A;  2I6X A;  3K4G A;  2FI1 A;  2KZ3 A;  1NDD A;  3DQV A;  8ICK A;  4DL4 A;  1YX5 B;  3DVN U;  3H7P A;  2LUM A;  4QAY A;  1WGH A;  1WGK A;  2Z0E B;  2JXJ A;  3Q8F A;  2QB0 A;  2RMM A;  1TAM A;  4MF8 A;  3PW0 A;  2XO7 A;  3L17 A;  4KIK B;  2VZK B;  5AIB A;  2BF8 B;  2GBJ A;  2OJR A;  1DYQ A;  5HI1 A;  4O3S A;  2W9B A;  4JV2 A;  3C5F A;  1DK2 A;  3A33 B;  5L1L A;  2KJ9 A;  2QC8 A;  2GLS A;  3T5H A;  4O3O A;  4J03 A;  8ICB A;  4GFJ A;  3ZJU A;  4P2H A;  2IMW P;  3SU8 X;  1LKY A;  3C21 A;  4PYU A;  4LDT D;  3C23 A;  1IG6 A;  4FZN A;  4XDD A;  4KLM A;  4JWM A;  3EEC A;  7ICN A;  3ZI4 A;  3U52 E;  1WIA A;  3KKA C;  1WZ3 A;  3WK9 A;  2FJ6 A;  1OFF A;  4TUP A;  4YR2 A;  3V6K A;  4KV2 A;  1F1H A;  1P1A A;  4FE3 A;  1X9S A;  5F9N A;  1T5X D;  4M6W B;  7ICQ A;  1U4B A;  1SJE D;  4ZYN A;  1C79 A;  3BYY B;  3OSN A;  4DQO C;  8ICZ A;  2KOB A;  4YMM A;  3L13 A;  2O2V A;  1ZJM A;  1L0V B;  1LFD A;  1P7E A;  1RQN A;  4HDO A;  2Y1J A;  4I6N B;  2J42 A;  4C8M A;  1ZQF A;  5KT7 A;  2FLL A;  1MA7 A;  1RQL A;  2I5H A;  2I38 A;  4ED2 A;  2JT4 B;  8ICE A;  4QZD A;  1S5L U;  3AMZ A;  2RDG A;  2FMP A;  2D5G A;  2K9X A;  3HUI A;  4F8C B;  1HQR D;  2X8X X;  8ICF A;  4F91 B;  1QH9 A;  1FFV A;  2A3V A;  4IDI A;  3ICX A;  1TKE A;  2JH7 A;  1T0S C;  3DOW A;  4RCO A;  5TSS A;  1BGX T;  4BKG A;  4HYK A;  2G06 A;  2ZUC A;  3JPQ A;  1RZT A;  1MHX A;  1RWS A;  2KTQ A;  4WQM A;  1ZQT A;  3UIN B;  3PS6 A;  5K4L A;  2W8L A;  3AU5 A;  1DOX A;  3E0F A;  3PO4 A;  1WJ4 A;  1HTQ A;  2NMQ A;  4YL8 A;  3QZ8 A;  5AKY A;  2E1F A;  1JRU A;  4C4V B;  1MG4 A;  8ICP A;  1MQ2 A;  2NBV B;  5JHB A;  4AS1 A;  2CRX A;  3H8M A;  4JE3 B;  3QU2 A;  5KT6 A;  1QLN A;  1DGJ A;  1DOY A;  3V3X A;  2V3S A;  2M4N A;  1A5R A;  2AEH A;  5L9X A;  1UUP A;  2C7N B;  2K8C B;  4UAR A;  5IIM A;  5III A;  4HWI B;  3RJI A;  2HBK A;  4YSX B;  4DQS A;  5CX3 A;  2EKE C;  4NL9 C;  4FBU A;  2YVC A;  4CF4 A;  2JRH A;  4RQ8 A;  4A55 A;  2PMZ F;  3D2N A;  5J18 A;  2WGS A;  4ZRQ A;  4RMA A;  5HHH A;  5G5H A;  3Q8K A;  1U45 A;  3IHQ B;  2PKE A;  2XGP A;  2HOI A;  1ZPS A;  1IXR A;  4FS1 A;  3RH5 A;  4I2C A;  2L3Z A;  1F0Z A;  4DQP A;  1JWU D;  2R8K A;  2NO5 A;  5J2G A;  2ZTD A;  4BDP A;  4WAA A;  4B6W A;  3B0A A;  1ED1 A;  4IWO A;  3VH3 B;  3IP4 B;  4XZ4 A;  4NPN A;  3O13 A;  5CP2 A;  3WKC A;  1J0G A;  4QZI A;  1UT5 A;  2XC9 A;  4QZ9 A;  3OLM D;  3GB1 A;  1FCL A;  1WR6 E;  1WSP A;  2FLN A;  2HBM A;  3MHZ A;  1YJI A;  1IBX B;  4TUS A;  1SV0 C;  4UAY A;  1L5U A;  2BCU A;  2KZR A;  1KFD A;  3A1Q B;  1QF6 A;  1EWY C;  4KKI A;  5JUM A;  5JU5 A;  5GTH U;  2WX0 A;  5D46 A;  9ICR A;  2UVV A;  1V86 A;  4EYI B;  3NZ3 A;  1J97 A;  2ZXI A;  3ENE A;  1Z3E B;  2M0N A;  5HML A;  3N20 C;  3CST A;  4F5P A;  2M56 B;  4ECV A;  4M0A A;  4MGZ E;  4ANV A;  1D8Y A;  3H7S A;  3IFW B;  2ZPN A;  1PVQ A;  4M0W A;  5EE1 A;  2KQ4 X;  2LGI A;  4EZ9 A;  3Q69 A;  4B9T A;  4NNJ B;  1F2R I;  3WAM A;  1NZB A;  5AI6 A;  2AX5 A;  4PGY A;  2BW2 A;  1C4A A;  1XC9 A;  2G09 A;  2YB4 A;  1VD2 A;  2IOF A;  3QAQ A;  3WCQ A;  5IP4 D;  5AKK A;  2DFL A;  1ACC A;  2L00 B;  1I4H A;  2KDI A;  3GQC A;  4KLH A;  1N60 A;  3IDW A;  4EEK A;  1ZQ1 C;  3B9J A;  3RMK C;  5DKW A;  4OZA A;  3QU4 A;  5KT2 A;  3M95 A;  1Z4N A;  1DOI A;  2WHI A;  2MBO A;  9ICT A;  2HW3 A;  3A9J A;  5HR7 A;  4RQ4 A;  2W9N A;  2FE8 A;  4EFO A;  3BZK A;  5DPW A;  5CRX A;  4A90 A;  2MRP A;  3AEC B;  2NRT A;  1TS3 A;  4RQ7 A;  4ACF A;  2R8G A;  2F3N A;  1WRI A;  3MJW A;  4EZ6 A;  4NWI A;  4BZA A;  2UYZ B;  1HZ6 A;  1N61 A;  4QIW C;  4KLJ A;  3C2M A;  1S0O A;  2OH2 A;  2WP9 B;  2L0F A;  2AQ2 B;  4AOF A;  4NLN A;  4KZC A;  4C80 A;  4YD2 A;  1WJN A;  2HHQ A;  2A4Z A;  4PYZ A;  3QJZ A;  3UGB B;  1SE3 A;  4I6P A;  1SWV A;  3U7D A;  2F77 X;  4PGX A;  4AYB F;  4OJ5 A;  4KLT A;  4J9L A;  2F44 A;  3V05 A;  1DXS A;  2XBB C;  8ICS A;  2IGG A;  1NK0 A;  2Y0S C;  4YN4 A;  1QQ5 A;  3RB4 A;  4BKS A;  2WXH A;  3SV4 A;  2W3R A;  5AM3 A;  4DK5 A;  4JMU A;  4NLC A;  2HHW A;  3L10 B;  2I9G A;  1YZ7 A;  4DL6 A;  3MTN B;  5KFP A;  3NS1 A;  4F2R A;  2Z0D B;  5AUK A;  4A3P A;  2GBR A;  3RPF C;  2KAC A;  1WE6 A;  3LXF A;  4UAV A;  4O9M A;  1WYG A;  3PV8 A;  2L8J A;  2DAF A;  1QSS A;  5FR6 A;  1TS4 A;  2WXQ A;  1IM4 A;  1F2R C;  4C8L A;  2G9H D;  2J6U A;  3IG3 A;  3BS5 A;  2ZW0 A;  4GXJ A;  3P4Q B;  2JZB B;  4O3M A;  2V9H A;  1KOT A;  3BQ2 A;  1TYG B;  4AQ7 A;  1ZKH A;  1KRP A;  2LGX A;  3ZJV A;  4G0N B;  2KVZ A;  2ZIX A;  5AZH A;  2MU2 A;  5G2N A;  4R63 A;  1SXE A;  4UAT A;  1T3N A;  2HHU A;  3TEW A;  2E8P A;  2I1J A;  3CRX A;  4JIO U;  3L54 A;  5AZG A;  3KWV A;  1ZRM A;  3DHG C;  3MR6 A;  4NM2 A;  3VUW A;  3OGU A;  4DO9 A;  5H8Y E;  4F7Z A;  1A0P A;  2PXI A;  4WJN A;  3UM9 A;  2CPR A;  9ICM A;  3RJG A;  1CQV A;  1UA1 A;  1TS2 A;  4N58 A;  1U4A A;  5KL8 B;  1WI0 A;  1QSY A;  5G5G A;  3QK0 A;  3NUH B;  3TJP A;  2LM4 A;  4GC6 A;  3I5J C;  5T8I A;  2OWO A;  4C00 A;  1MC8 A;  1NYQ A;  2PW9 A;  2YMP A;  4HCN B;  1O03 A;  8ICL A;  3CP8 A;  4B9U A;  5J2R A;  3I28 A;  4KN7 A;  3ZDA A;  5BO4 B;  3ZRF A;  2GO7 A;  1BPB A;  3UQ0 A;  2O6V A;  2ZVN A;  3ZXV A;  1GPX A;  1TY0 A;  3KUD B;  4ZRI A;  1NI3 A;  3C19 A;  2CHZ A;  2HHV A;  2LRU A;  4UB1 A;  4I2D A;  3MFH A;  1FPY A;  2KQ7 A;  1RYU A;  5AEK B;  1LO5 D;  1WM2 A;  3EA6 A;  5KFF A;  1R4N I;  1ZD2 P;  5ALS A;  1ZQP A;  3T79 A;  1COK A;  2H3V A;  4IC7 B;  1NK7 A;  1FXT B;  3BVM A;  1EU4 A;  2VA3 A;  1JXE A;  5HR6 A;  4ICV A;  3ZTD A;  1FRR A;  3VTV A;  3PRP B;  4CYE A;  1XXG A;  2OYY A;  3VXW A;  3Q14 C;  4CNQ A;  1ZDX A;  1XCQ L;  4K7S A;  2EZX A;  2KZZ A;  1KFT A;  1ECW A;  2J53 A;  4ITK A;  2PLP A;  1RYR A;  2WXO A;  3ABV B;  4XX5 A;  4MGY E;  4W9G A;  3JPR A;  3LDA A;  3W5V B;  1E6E B;  2P35 A;  4RT3 A;  2HJ8 A;  1XLQ A;  3RJE A;  3AEE B;  2CJO A;  4USA A;  2LUE A;  2R8H A;  2W54 A;  3DDC B;  2N9X A;  1I7H A;  2INP E;  1WWT A;  4N9F 4;  2JUO A;  2WX1 A;  1I4G A;  4K7W A;  3H8J A;  1D5Z C;  5J29 A;  1D5M C;  2KWD A;  3UIP B;  2PTL A;  5DLG A;  3RBD A;  5C0Y A;  1GC6 A;  4OD0 A;  1FRD A;  1Y56 A;  5E6N A;  4A20 A;  2LRW A;  2WF5 A;  1UGJ A;  5FKA C;  2D3D A;  2JGA A;  5DB9 A;  2ACZ B;  1F0M A;  1TY2 A;  5E6J A;  1SWW A;  1GJZ A;  2A5U A;  1PK1 A;  1ZQO A;  4B9L A;  3NUQ A;  8ICU A;  4U6P A;  1SKS A;  2G07 A;  3RAX A;  1V9J A;  4IQW A;  4R66 A;  4MM3 A;  1Z2M A;  2MBH A;  4OVZ A;  2V4L A;  4DL7 A;  2PJH A;  3RB3 A;  2LHE A;  1ZQU A;  2GLE A;  4RQ1 A;  1OXJ A;  1SB3 C;  4EOY A;  1T3Q A;  4KX3 A;  4ECR A;  4KLO A;  4CDG A;  5KFL A;  4ED0 A;  1GUA B;  2WHE A;  2GMI C;  3DV9 A;  2V4R A;  4IRD A;  1QQR A;  4RZR A;  2AWT A;  3CF6 E;  4UAW A;  3TUO A;  1MFW A;  3DBH I;  1C4P A;  3QUB A;  3R7R A;  2ZNV B;  2FAZ A;  3TQ1 A;  2C7M B;  2KWU B;  4WUR A;  4DWF A;  4ECU A;  1KLU D;  2JRI B;  3FIL B;  1I4P A;  4LNI A;  2KHW B;  3RRG A;  2BS4 B;  2F8K A;  1Q10 A;  2F1H A;  2J6T A;  1OQY A;  4S17 A;  4CF3 A;  2GH1 A;  1D9F A;  1EO6 A;  2K8B A;  3BYT B;  2B6G A;  2RP5 A;  2YN4 A;  4O3P A;  3APD A;  2ASL A;  2N7D A;  3GE3 C;  3ZNI D;  2M0A A;  3TI0 A;  2MBE A;  1UGM A;  5J2J A;  2VJ4 A;  3RNG C;  3GII A;  3LYY A;  9ICL A;  4PL1 A;  1TK0 A;  1NI2 A;  2J7Q B;  3JSV A;  3MGI A;  7ICV A;  3KHR A;  2QDF A;  3K1R B;  2AL3 A;  7ICG A;  3WK5 A;  1SKW A;  3NG0 A;  5LLI A;  2JEG A;  1PYW D;  4MHV A;  2G3Q B;  5ALD A;  3HM6 X;  1BUI C;  5ALX A;  1AQ6 A;  4BJQ A;  1ZQJ A;  2JF5 A;  3AE6 B;  3KH0 A;  4EZL A;  2Y3A A;  4F5Q A;  3B2G A;  3QEB Z;  5ALU A;  2GBK A;  2KMM A;  3QU5 A;  4TMA B;  3ZDT A;  2F1I A;  2MA1 A;  2BCS A;  4DXG A;  2D10 A;  2RSU A;  2XVT A;  4Q8E A;  3F2B A;  3PO5 A;  4KGS A;  4I6L B;  3OAW A;  3SD7 A;  3M8S A;  5DG7 A;  4P0Q B;  1YOV B;  2ASD A;  2WDR B;  4MFF A;  4FJZ A;  3BQ7 A;  1FNW A;  3VH4 B;  2IO1 B;  5E79 U;  3BVZ A;  1JWB D;  1NKE A;  3G6V A;  9ICX A;  5B5E U;  4NJ6 A;  4UB4 A;  1CK1 A;  2KIC A;  3PW7 A;  3PPA A;  3H9D A;  2ODG A;  3M6K A;  2INN E;  1JML A;  2KKC A;  3NVY A;  2RGF A;  3AEF B;  5E6O A;  1D3Z A;  2IY0 B;  5KFV A;  1V38 A;  2MEK A;  2W11 A;  1L4D B;  3QWZ B;  3H7P B;  5IA7 A;  4DL5 A;  2IOF K;  2WLB A;  3H1U A;  5AKL A;  3NZS A;  2QB0 B;  2AU0 A;  4DFM A;  3RR8 A;  3QA8 A;  1GC7 A;  3N7P D;  3X0W A;  1P0R A;  5DGB A;  4GOC A;  4RUA A;  4YVZ A;  5CR0 A;  1NJW A;  2KJH B;  9ICF A;  4GLX A;  4C7Y A;  3OG5 A;  2W9M A;  2KLG A;  3JPS A;  2MJ3 A;  3PML A;  1L4Z B;  3M8R A;  1RYS A;  2BKE A;  3ONS A;  1IV8 A;  3DBL I;  1LKY B;  2XK5 A;  2LEK A;  1QOF A;  2MHJ A;  7ICF A;  3JPP A;  4YXM A;  1SV4 A;  2DKZ A;  1JAL A;  2EAP A;  2AGP A;  2AQ4 A;  4LNF A;  2EMT A;  5EWE A;  4QIW F;  4J9S A;  4A3O A;  1C3T A;  1BPE A;  2F1J A;  3KHH A;  3I76 A;  8ICI A;  3FM9 A;  4LK0 M;  9ICE A;  2EZY A;  4NLB A;  2K25 A;  3AXC A;  4UAU A;  1NBF C;  2KDF B;  3EHV A;  5L1I A;  2MBB B;  2D3G A;  1SL0 A;  4KDI C;  2QAR A;  5D4B A;  1OW5 A;  3E9S A;  4WAF A;  5DG9 A;  2L52 A;  2O2V B;  2ZJA A;  1J19 A;  2BBC A;  2UVR A;  1YN5 A;  4NLZ A;  2MQJ A;  2WXF A;  4M9G A;  2KAJ A;  2Y0S F;  1T7P A;  4PS3 A;  3PZ8 A;  3IXS A;  4JWU C;  4EBC A;  5DGA A;  3IV6 A;  1K1S A;  3EW9 A;  3QIJ A;  3D6J A;  3U4E G;  1QKZ A;  4KDL B;  4BGD A;  4KLU A;  1E8Y A;  3SYZ A;  3RZW C;  4YQW A;  4I2H A;  3T3F A;  3Q8E A;  8ICO A;  2LMC A;  2KV2 A;  1BVS A;  1QOB A;  4PJ0 U;  4I2F A;  1XO0 A;  2BCV A;  2J4X A;  3SAF A;  2H3F A;  5HHD G;  3UMB A;  4M9L A;  4KMU A;  1PGX A;  1A77 A;  3BQ1 A;  1WUD A;  3F2C A;  2WNM A;  2RDB C;  1HIW A;  1YD8 U;  3VAW A;  4KLF A;  3OWE B;  4JB3 A;  3SFD B;  1FEZ A;  4P4O A;  5DQH A;  2DHZ A;  4M8N A;  1VR9 A;  2LBO A;  3DBR B;  2K60 A;  2L83 A;  4P1C C;  1PVP A;  1ZQM A;  3ORY A;  1L0X B;  4J3O D;  1X9M A;  3VUY A;  4B95 A;  3T9L A;  9ICU A;  4BKT A;  4BAX A;  1LB2 B;  4ICA A;  5AIA A;  1NKC A;  1ZQY A;  2KKV A;  5KT5 A;  2HI0 A;  4UAS A;  1P7F A;  5AKG A;  1NJX A;  1ZP0 B;  5CHG A;  3UMG A;  4DFP A;  1NK5 A;  2FBW B;  3CW2 C;  1AAR A;  4M2Y A;  2BR0 A;  1L7N A;  3M9N B;  4NQK E;  1GNU A;  2YLM A;  4ZRK A;  1S3S G;  2AL6 A;  5J0W A;  3ZLZ A;  2WXP A;  3EFC A;  5J0X A;  2FPK A;  1ZQV A;  1K52 A;  3T5L A;  2MBQ A;  4C8K A;  2KDB A;  3P4R B;  4ELV A;  1ZQG A;  4TKN A;  3AE9 B;  2LFI A;  4RPY A;  1SXD A;  3B0Y A;  3WK7 A;  3ZO5 B;  1L0Y B;  1FNU A;  4K3C A;  4P1B C;  2JWU A;  2PKO A;  1R4M I;  3V61 A;  2KAN A;  2RQ5 A;  2ZIW A;  3SMV A;  1ZD5 A;  5KG4 A;  2D07 B;  5KT3 A;  4F8R A;  4MH0 E;  1D5X C;  4RNM A;  3V7J A;  4I28 A;  8ICG A;  4IWP A;  4OHJ A;  4D2K A;  2FMQ A;  5KFI A;  1C76 A;  3L5K A;  5JTI A;  3DWM A;  2XGQ A;  3MR2 A;  4IM3 A;  3RNE C;  9ICG A;  4M0W B;  3TMP B;  4MEY A;  3CNH A;  4A6Q A;  1QSL A;  4IWQ A;  2QIL A;  2VH2 A;  3M7D A;  3T3N A;  3Q8A A;  5KFN A;  1OEY J;  3KHL A;  4I2E A;  4KLE A;  1PGA A;  1KTK A;  3RH4 A;  1V5O A;  1VLB A;  3SZ2 A;  4O0I A;  3P4P B;  3NS8 A;  3ISB A;  2KFZ A;  4JWN A;  2AXT U;  2WDV B;  4DWI A;  5KFB A;  3RTV A;  4GXI A;  2FMS A;  2XI9 A;  1Z1V A;  3G6Y A;  3A9J B;  4YD1 A;  4RQ5 A;  3HKZ C;  1TGZ B;  3UF8 A;  5L83 A;  2K6D B;  1V85 A;  1SL2 A;  2P6R A;  3HX0 A;  2IBI B;  2JEI A;  2L5Y A;  2JQR B;  3P42 A;  3R2I A;  4MSQ B;  3B0X A;  3LWL A;  3NTU A;  1WF9 A;  1NEN B;  4HDQ A;  1YJJ A;  1TAQ A;  2BKR B;  3QX1 A;  3R8B A;  1A70 A;  1C20 A;  1HA5 A;  4DF4 A;  2CU3 A;  4TQ0 A;  2ZZP B;  4B9M A;  3ZDC A;  1ZQB A;  4LTU A;  2N9K A;  4REZ A;  2HBL A;  3VC8 A;  2IO0 B;  3H0M B;  2J0K A;  4FS2 A;  5J0U A;  4RM9 A;  3ZKJ C;  4YSZ B;  3A0H U;  3N4M B;  2OCE A;  3KKA A;  2LWP A;  5D94 A;  1LVH A;  1IGC A;  1UF0 A;  2ZTC A;  3RJK A;  1B43 A;  2K4I A;  1ET6 A;  2NTT A;  3EC8 A;  3UQ2 A;  3ZNH B;  4IRC A;  3UPQ A;  2ON8 A;  5C5J A;  2KD0 A;  2KMD A;  1PK3 A;  2BDU A;  3MR3 A;  1GOZ A;  2L05 A;  3Q8R B;  5ALT A;  3M3J A;  3M63 B;  2JVC A;  3LDZ E;  4EE2 A;  4K7U A;  2K6Q A;  4LVS A;  3H4B A;  3OJ3 A;  4BFR A;  2LAS A;  2MX2 A;  2WXN A;  2CR5 A;  2RDI A;  2W7O A;  2BYE A;  4G3I A;  4FUL A;  2VIX A;  2CXY A;  1Q5W B;  2XCA A;  1M4V A;  1N56 A;  2YMM A;  5JRT A;  1TIF A;  2A1J A;  2NRX A;  2NTS A;  2IJ0 A;  1TKG A;  2FDR A;  1ZD3 A;  3ZDM C;  2ZIX B;  5GTI U;  5HHI A;  1V8C A;  1XF5 L;  2IO2 B;  4TQ1 A;  5E6P A;  3GOE A;  4YR0 A;  2N9L A;  1ZJN A;  2MAX A;  1WG8 A;  1EU3 A;  2ZXH A;  2EAN A;  3PHW B;  4E71 A;  3LWM A;  2JSV X;  1PDX A;  1L8L A;  3PVL A;  2ZPY A;  2ZCC A;  1XWL A;  2AJQ A;  3H0L B;  4R8U A;  1UEL A;  2B0C A;  2CS4 A;  2WF9 A;  1K1Q A;  2WF8 A;  3CIR B;  2KIW A;  4PK1 A;  1X2I A;  1RFK A;  5AKJ A;  2MWS B;  4RQN A;  3WK8 A;  3NRW A;  5AI0 A;  2ZJD A;  2YEP F;  2HD5 B;  2X38 A;  5BYR A;  4I27 A;  4XYC A;  5KFY A;  1AWD A;  4UAZ A;  4IM2 A;  4P6V F;  1ZQD A;  3RD2 A;  3L08 A;  4NL9 A;  3E58 A;  1ZQZ A;  2NYV A;  3C28 A;  1BT0 A;  4MGK E;  1RDF A;  3JPN A;  2YB1 A;  1DRG A;  5DB8 A;  2HHT A;  4ED3 A;  4QW9 A;  2NRV A;  4QZC A;  2O6V B;  2PFN A;  2O6K A;  1JN3 A;  2QHO A;  2W82 A;  4MAC A;  5KFC A;  2KNJ A;  3TEY A;  4PPX A;  1JUD A;  3FYH A;  4XWW A;  2OEH A;  2KXJ A;  3SV3 A;  4HPL B;  9ICN A;  3N1X C;  4Y2J A;  2G4D B;  3DVG Y;  4RT2 A;  3TAD C;  1BPZ A;  3N97 B;  2JXX A;  4MGI E;  2VKQ A;  5BOL A;  3Q3J A;  3VHT C;  2OXO A;  2DL0 A;  4M47 A;  2FUH B;  4MJS A;  2VAN A;  1XT9 B;  4RH6 A;  2UVU A;  3V6E B;  1SV0 A;  2W7P A;  2OOB B;  2K8H A;  4DHZ E;  3RF9 A;  2DQN B;  2BZF A;  2KLC A;  2MLB A;  2FPM A;  2WXJ A;  4O5E A;  2D6F C;  3PSF A;  2DWQ A;  4P0P A;  2BWE S;  4A8E A;  3N1Z C;  1UBI A;  2D2Q A;  1B4F A;  5ALR A;  5AHX A;  3C8Y A;  1FMA D;  4DS4 A;  1WFY A;  2JV3 A;  1TBE A;  2CJN A;  4QZA A;  5BMH A;  2OHF A;  5ALV A;  5GMV A;  3IM1 A;  3QYP A;  2C5L C;  2KFJ A;  3WU2 U;  3NOB A;  2ZUD A;  5J0O A;  2IGD A;  4LCD E;  2PI4 A;  2DZM A;  4Y2Q A;  4FBT A;  4DSI A;  2R2O A;  4E74 A;  1ZUD 2;  1MN8 A;  1F5S A;  2JRZ A;  2V3N A;  3BIN A;  3D2S A;  2NS5 A;  1ZQR A;  3LJ3 A;  3SAH A;  4WWM A;  3U26 A;  3RB6 A;  4ZDV A;  3VDZ A;  2FPL A;  5F3X B;  1QOA A;  4FAD A;  3RUI B;  2PVG C;  2PPH A;  5IIO A;  3KHG A;  2L76 A;  5DB7 A;  4KX6 B;  3ZD8 A;  2GBN A;  3MC8 A;  2K3U A;  3ALR A;  5J2D A;  4H2A A;  1XNS A;  1KRH A;  5KAF U;  1IYF A;  1SKR A;  3GIJ A;  2LZ6 A;  2PFP A;  4HPP A;  1B9R A;  2NBU A;  2RD0 A;  5KFK A;  4QWD A;  3M62 B;  2RPV A;  3TFR A;  2D3A A;  3AV8 A;  2Z7J A;  5BMI A;  1COO A;  3QCA A;  1PK1 B;  1BNO A;  5TIS U;  2Z59 B;  5KT4 A;  3PLV A;  4GIB A;  4JQW C;  2ICI A;  4S0R A;  1NOM A;  2KMA A;  1ET9 A;  2ZIU A;  4CF5 A;  3KYD D;  4MM3 B;  1HEK A;  5AKE A;  2HOF A;  4NLG A;  1ZD4 A;  4QZH A;  3MC1 A;  4WIP A;  5AZF A;  2IZV B;  4EX7 A;  2KN4 A;  4R65 A;  4B9S A;  3VFK A;  3KYC D;  3V6C B;  3E56 A;  5CTR C;  2XNA C;  1XQQ A;  1RM6 C;  4M8M A;  4L2Y A;  1PUT A;  3VR8 B;  1FM0 D;  2HTH A;  3QZ7 A;  2C2R A;  1B1Z A;  1FEH A;  3L0W B;  2MJD A;  5CEH A;  4PHP A;  4FJV B;  3MC9 A;  1N62 A;  1MG8 A;  2KJ6 A;  1ZYQ A;  3PZP A;  5AKX A;  2NBW B;  2ISO A;  3IAS 1;  5H92 C;  3HM3 A;  2LVO A;  1C1Y B;  3RFA A;  1FXA A;  1RFA A;  3UXO A;  1SIF A;  2BGF A;  4LDT B;  1YZ6 A;  4Y2P A;  4FO6 A;  4BOS C;  1G6J A;  2QCZ A;  4UB5 A;  1UH6 A;  1YJ1 A;  5KFQ A;  4ECW A;  2K8B B;  2W03 A;  1RAX A;  3V6J A;  4WH4 A;  2KT7 A;  3Q8P B;  1ZQE A;  5AK4 A;  7ICP A;  2UU7 A;  1SE9 A;  2ASJ A;  3I9V 1;  5KFJ A;  1N63 A;  4IL6 U;  2BS2 B;  5DPR A;  5KAI U;  1V6E A;  1EWC A;  1YIW A;  2JEJ A;  5J2C A;  2PEA A;  3APF A;  2AYO B;  1I4Q A;  3JSV B;  5IAA C;  2N7E A;  4NJ8 A;  5AI4 A;  1Q0W B;  2NR2 A;  2YQE A;  3UXP A;  4J9Q A;  5ALP A;  3Q8Q B;  2DYB A;  2C28 A;  3N9Y C;  4DDG D;  3GZN B;  3V60 A;  3MDA A;  3IRU A;  3W1S C;  1K51 A;  4Z6F A;  1ZET A;  3TKA A;  1Z19 A;  2EQY A;  1VCB A;  4HCP B;  5DPT A;  4F4K A;  4JLC A;  2LPE A;  1KH0 A;  4RNO A;  3N1Y C;  3TCA A;  1ZQI A;  5LNK 1;  4ZOH C;  2C22 A;  2G5H B;  3DDH A;  1AYF A;  2GRI A;  1QTM A;  2MSN A;  7ICJ A;  1P98 A;  2AH5 A;  2LGY A;  1SIJ A;  3O65 B;  4TV3 A;  4IR1 A;  2IA6 A;  1WGD A;  4BXO A;  2BQ3 A;  4KGT A;  1QQ6 A;  5EWF A;  4NAW A;  1T94 A;  1AW7 A;  3MDC A;  2KJ5 A;  1L7P A;  4L1B A;  3PZ7 A;  4AJW A;  4BOZ B;  4NJ7 A;  3LK9 A;  3GZF A;  2NV3 A;  1Q3V A;  2JWZ A;  2W9C A;  3IG8 A;  5LXI B;  1XLO A;  3IN5 A;  4WJO A;  4PGQ A;  5AK6 A;  4GU2 A;  4CQN A;  3AQE A;  3T3O A;  4W9C A;  4KGR A;  3NZU A;  3MC0 B;  1V2Y A;  1FD6 A;  4WQO B;  2ESE A;  3ZD9 A;  1OTR B;  2V1Y A;  2N1W A;  3K9P B;  4ZRJ A;  4PL2 A;  3Q6B A;  1SZH A;  3OSP A;  4F2S A;  4KTQ A;  2LVQ A;  1KTQ A;  2B3A A;  4WWO A;  4LLG M;  1DOQ A;  2Y5P A;  2W9A A;  3Q3O C;  1PZN A;  2V0G A;  1WX7 A;  2BS3 B;  1E10 A;  8ICW A;  4Y2V A;  4MFA A;  1AN8 A;  1E8Z A;  5EOZ A;  1RXV A;  4F5O A;  4RGO S;  4ANU A;  3Q8B A;  4C0Z A;  2MH7 A;  3HKZ F;  4CGZ A;  2XK5 B;  1X42 A;  5AKH A;  4YT0 B;  3AQF A;  2JXT A;  5AM5 A;  5D7G A;  4JPS A;  5KG5 A;  1SZP A;  2KKP A;  2N1R A;  1L3S A;  4I29 A;  3RNF C;  1JWS D;  3PTF C;  3J9C A;  1XO3 A;  3SEB A;  5ALO A;  4OJO A;  3WAO A;  4F4Z A;  1VDV A;  3EUB 2;  2AQ0 A;  1SGG A;  3EPG A;  1TS5 A;  3EZ5 A;  3AM9 A;  1CJE A;  3PX6 A;  3M1Y A;  9ICK A;  2LMR A;  3UI3 A;  3N3K B;  2QJL A;  3ZJT A;  3VRA B;  1KDH A;  2BYF A;  2LHT A;  2J0J A;  2HBJ A;  3PGE A;  3NJT A;  2KD1 A;  5ALH A;  2CKH B;  1ZQA A;  2ZVO A;  4KMO B;  5ALM A;  1UD7 A;  4FFD A;  4QZG A;  4JUZ A;  4KLI A;  2ASQ A;  3JPO A;  1GB1 A;  3RB0 A;  5AK3 A;  3AEB B;  2BQR A;  3DPD A;  4W9K A;  3RN9 C;  3K75 D;  4MEM A;  3QUQ A;  5DB6 A;  3LVV A;  5J0Q A;  1K8R B;  2KWC A;  3ISD A;  1E5W A;  1SF0 A;  2KTR A;  2IO3 B;  1CI4 A;  1L7M A;  5KFX A;  3PMN A;  4DXF A;  1XSL A;  1WE7 A;  4RGT A;  2F8L A;  2G5I B;  5AK5 A;  2E3T A;  4I2B A;  4K4H A;  4JX1 C;  1X6I A;  2KVC A;  2XY6 A;  5J17 A;  1K5O A;  3BWU D;  3KZI U;  3APC A;  4AJY B;  1KBU A;  4URK A;  4IOI E;  1A6S A;  4LZG A;  4YFK A;  4HAI A;  5CWR A;  5IO9 A;  1BPY A;  3A9K A;  3OJS A;  1WXM A;  1E9M A;  4TUR A;  5AI9 A;  1KW4 A;  4B6J A;  4NAM A;  2K4E A;  4FHJ A;  1V9P A;  2LXA A;  2WXM A;  2PE6 B;  2RPQ A;  3OTQ A;  3DBS A;  2XY5 A;  1RPL A;  5DBB A;  5LXH A;  5DLF A;  1S0N A;  4W9H A;  4DHJ D;  3H8H A;  4X57 B;  3ML8 A;  2IHN A;  3H6N A;  3ETL A;  7ICE A;  4CRX A;  4NV0 A;  2KFK A;  2PE9 A;  5J0T A;  4J6I A;  3JPT A;  2C2E A;  4RQM A;  1MSW D;  4AP9 A;  5J0R A;  2XIC A;  2KHV A;  1F9J A;  4DQQ A;  3F53 A;  3R9K A;  2KNB A;  1N5W A;  1ZXH A;  1UQV A;  2ZIW B;  3EWA A;  4ED8 A;  1SEB D;  4J9N A;  4HK2 A;  3L4P A;  2L1A A;  3IAM 1;  4FLH A;  3Q3M C;  5CB1 A;  5DPS A;  2N1V A;  2EDU A;  1T4G A;  2GI9 A;  3GP7 A;  4PHE A;  2BPC A;  1TE2 A;  3N7R C;  2DZI A;  2BCR A;  4IQT A;  1N48 A;  2DZK A;  1ZQH A;  5KFU A;  2IDY A;  5HFY A;  3S2A A;  5CHW A;  4IW0 A;  5ALK A;  4IM0 A;  1NJZ A;  2KFN A;  1WMH A;  2LXC A;  2H88 B;  3IVF A;  4UB2 A;  1V1O A;  1ZQK A;  4W9L A;  3VTU A;  5KG0 A;  3NVZ A;  3UQB A;  2KX0 A;  3GV7 B;  2RLT A;  2I1K A;  3OJ4 B;  2VZK D;  2MUT A;  3N7S C;  1TT5 B;  4UB8 U;  1TZO A;  2OJW A;  3T8M A;  1TTN A;  4UBC A;  2KSO A;  5ALN A;  3AUL A;  4E0D A;  4F4Y A;  4J9P A;  1H4R A;  1LGR A;  2K1F A;  4RQ2 A;  5KNI A;  5D6J B;  1KEJ A;  1WYW B;  3B2F A;  4C4T A;  2RDH A;  4AWJ A;  2KOX A;  1PQS A;  2ONQ A;  2J0M A;  3VVW B;  4O3N A;  2W9B B;  4GDK A;  2M1M A;  3RT3 B;  4OW0 A;  2MA9 B;  2VH1 A;  3HIZ A;  4RF1 A;  2JX5 A;  3L3F X;  2BQQ A;  3SI8 A;  1TV9 A;  8ICA A;  1HUO A;  2N9E B;  1L3T A;  5KFD A;  1UA0 A;  4RU9 A;  3HP6 A;  2WXL A;  1S1Q B;  2D3B A;  2WXR A;  4XQ8 A;  4EEL A;  5F9L A;  3F2D A;  2H89 B;  1OUQ A;  4W9J A;  2HDE A;  4Y2U A;  1XU4 A;  3PVX A;  2M17 A;  3W2D A;  2IOH A;  2KP7 A;  3R66 C;  5KFZ A;  1EUV B;  3AE8 B;  4DOA A;  5BOM A;  2DGZ A;  4DHZ B;  3TAQ A;  4QNL A;  2R2Q A;  1IUE A;  3MGH A;  1YQB A;  8ICX A;  3QUC A;  4O1N A;  1L6N A;  2Y9T A;  2EEL A;  4HEA 1;  2R8J A;  1DK3 A;  2H3Z A;  2W04 A;  4RGN A;  3T5J A;  2KN7 A;  2HJ1 A;  4HRO A;  2Y1I A;  4Z6D A;  1C78 A;  1MQ3 A;  5HNK A;  4R3D A;  5CHV C;  3C2L A;  4WJ3 B;  1XEE A;  1HJP A;  3N32 A;  1Q1O A;  5AUI A;  2JHD A;  3WKB A;  3LYS A;  2FE9 A;  3HW8 A;  5JHA A;  2ISP A;  1NK8 A;  2KMC A;  3OHA A;  3GIK A;  2HVH A;  5J2E A;  2A1J B;  2K0P A;  5J0P A;  4EEN A;  2GOW A;  4M9H A;  4EYH B;  3VTW A;  9ICJ A;  3T5K A;  2WF6 A;  8ICH A;  8ICM A;  2ZW1 A;  3SD5 A;  1WX8 A;  1TAU A;  2MJE A;  4DSK A;  3KWL A;  1F77 A;  1BML C;  2IY1 B;  5AKI A;  2QEJ C;  8ICY A;  1MHH E;  1GAQ B;  1V81 A;  1T0Y A;  4TSS A;  2JEF A;  1HE8 A;  4B9K A;  5DDM A;  4R8U B;  1QLB B;  4J9R A;  5EDS A;  1QZE A;  5IIL A;  5EE9 A;  4PZN A;  2QSD A;  1ZOL A;  3GFK B;  4KLL A;  4KLS A;  3C0R B;  5EE0 A;  5BYQ A;  1YN4 A;  2M19 A;  4K81 A;  4JV1 A;  4PT5 A;  2NRZ A;  2FCN A;  3MP9 A;  3WKD A;  3QEA Z;  4B9V A;  3MBY A;  3UXN A;  4O3R A;  2ZNV C;  9ICV A;  1UPH A;  2L0T A;  5CA7 A;  2LGS A;  3RH6 A;  1MJD A;  1HTO A;  1T8E A;  4OJ6 A;  3H40 A;  4K3B A;  4BWM A;  3V7K A;  2Q0Z X;  3NRZ A;  4OJL A;  2BGW A;  3TAR A;  1NVI D;  4GMV A;  1S76 D;  2GB1 A;  1WJU A;  2EZZ A;  2BPG A;  3P1M A;  5HP4 A;  4I2I A;  2K4P A;  1JXL A;  2E8M A;  5JH5 C;  1UCV A;  1RYJ A;  3IHP C;  1EM7 A;  3TFS A;  3ZDB A;  3ZW3 A;  2MP2 A;  3TL5 A;  4RNN A;  5FP0 A;  3PRE A;  4MJS B;  2M9N A;  2DNF A;  3BJY A;  2JZZ A;  1N5X A;  1ZQQ A;  3PLU A;  3QC8 B;  1K53 A;  2QB1 A;  3NAS A;  1RG6 A;  4XA5 A;  1QQ7 A;  4DSL A;  4FN2 A;  4DHJ B;  4P0P B;  4ECT A;  1UT8 A;  1YN3 A;  2KTF A;  2ZIV A;  4KX5 A;  1KFS A;  4DFJ A;  1CRX A;  2KJR A;  1A76 A;  3ZGZ A;  4F72 A;  4M9N A;  4GLS C;  2VRR B;  2CU1 A;  3AUO A;  1MPE A;  2N7J A;  4KLQ A;  4DEZ A;  3QQ8 B;  4XC2 A;  5G55 A;  8ICR A;  3LVW A;  4PH5 A;  3H4D A;  4GXK A;  4JGH B;  2BTE A;  3GE8 C;  3U30 A;  1KSP A;  2KC2 A;  5AKZ A;  2D3C A;  5KFO A;  1KLV A;  5AM0 A;  5DCN A;  3ZDE A;  5DBA A;  1YQ3 B;  1C77 A;  3A4R A;  1BNP A;  3BZC A;  3IBE A;  5J8Y C;  1D6E C;  3KUC B;  1ESF A;  4Y2R A;  4ZH4 A;  4GDL A;  4K4I A;  1VZ8 A;  2ATL A;  2M0X A;  2K5P A;  1WJ6 A;  4ZHO A;  2D11 A;  4Y2X A;  3EGR A;  2HHX A;  2ES6 A;  2KO3 A;  4GB9 A;  3TAP A;  1XLP A;  1UBQ A;  4IR9 A;  3WIM A;  5AM2 A;  1WX9 A;  5GXG B;  4HXD A;  3AE3 B;  4I2J A;  5KTQ A;  4KLD A;  2INC C;  3DBR I;  2ZIU B;  4QJF B;  1LXD A;  2A19 A;  2SAK A;  3MJ5 A;  4F93 B;  4LJP B;  4OVV A;  4ANW A;  1RLF A;  4F1S A;  1CMX B;  1OEY A;  4IS7 A;  3RYT A;  4JK1 A;  3QUT A;  3AU4 A;  3RR7 A;  2W43 A;  3NVW A;  5KHQ A;  4RQ6 A;  5KFA A;  1IPG A;  4WJP A;  4QZF A;  4UBB A;  3VRB B;  1E90 A;  1JIH A;  1O08 A;  2W3S A;  5KHO A;  4YTM B;  1GB4 A;  1C9F A;  4TUQ A;  2J6S A;  2NPT A;  5L95 C;  1LQB A;  4YXJ A;  3DHH C;  2WDQ B;  1QOG A;  1OGW A;  4WWN A;  4CHK A;  2FCS A;  1WCL A;  2MSE D;  2SEB D;  1WWU A;  9ICQ A;  4M02 A;  2LI6 A;  1J7A A;  1MVK A;  8ICC A;  3BS5 B;  5KFE A;  2OM6 A;  1JWA D;  1UWM A;  2LJ5 A;  5ALY A;  3QU9 A;  9ICB A;  2JH1 A;  4RGM A;  4P16 A;  3Q8M A;  3OJU A;  3PY8 A;  4Q2J A;  1T0R C;  4CO7 A;  2HMX A;  9ICO A;  5MPO A;  1KQQ A;  3AE4 B;  2KJ8 A;  3AL0 B;  4ICU A;  3F5E A;  1UZX B;  2TSS A;  5D3I B;  3H8S A;  1CEZ A;  3EPI A;  3HWT A;  5EE3 A;  3CWI A;  5JZE B;  2RR9 A;  2BKF A;  4OZC A;  4L23 A;  3Q3N C;  3KQ4 A;  1WWV A;  3RZF A;  3Q3F A;  2ZEQ A;  1TVA A;  1WXA A;  4GGQ A;  4QZ8 A;  2PMV A;  3OPX A;  3NGD A;  3VQI A;  2BCQ A;  1P9D U;  1X9X A;  1M6Y A;  4N6E B;  5J2H A;  4FZM A;  4J9M A;  2RRD A;  4NY0 A;  1V1P A;  3GU3 A;  3KBB A;  3PZD A;  1WXV A;  4OJP A;  2C7H A;  3AH7 A;  3M6Z A;  1TKY A;  4P4P A;  4YSY B;  3M9O B;  4YXD B;  3Q2A C;  4BXO B;  3RRH A;  1SXT A;  3TEX A;  5HMM A;  7ICM A;  4G11 A;  2BHN A;  4NAW B;  2KX3 A;  3ZNG C;  5L1K A;  4ANX A;  2DX5 B;  1YMH E;  1YNT E;  4HKQ A;  5J0S A;  2LJI A;  3WKE A;  2W9C B;  7ICK A;  7ICR A;  3S6J A;  4GXB A;  2DAJ A;  3CMM B;  9ICS A;  1Z00 A;  2UVW A;  1EF5 A;  2KDM A;  1TJE A;  4F3O A;  2DPI A;  3A0B U;  1SE4 A;  1STE A;  4M00 A;  3RI7 C;  1FO4 A;  4ZYS A;  5ALZ A;  4NQL B;  3KLS X;  2C2D A;  3TAN A;  2IYD B;  1S8O A;  4DDI D;  3PNC A;  3ZVV A;  4R64 A;  3AEV A;  1UHU A;  1V97 A;  1PVR A;  4FJY A;  4NM1 A;  1VRA B;  5IIJ A;  3TAD A;  1ZQX A;  3SEN A;  4HJG E;  3WA0 A;  1K50 A;  8ICT A;  2MCN B;  1WXQ A;  2WB1 C;  1R7S A;  1C7Y A;  2KEY A;  1BPX A;  2L7R A;  1YT3 A;  3CYM A;  4FBJ B;  9ICI A;  4BBN C;  4X5V A;  2VA8 A;  2KZM A;  2K4H A;  1F44 A;  4AUQ C;  3SEI A;  2F2A B;  4DCC A;  1TFR A;  3IT4 B;  4JL9 A;  4RUC A;  2H5X A;  4OZB A;  1Y8R C;  3NHE B;  4JWS C;  2BWF A;  2LKY A;  2W8K A;  1WM3 A;  2E1E A;  3D32 A;  4XWT A;  3TAC B;  3M9M B;  2MRL A;  2G1E A;  4LNN A;  3HJE A;  1JRP A;  2NCN A;  1V5T A;  2BT6 A;  5J2A A;  3RJH A;  2IPK D;  2KWV B;  3HIL A;  5KFG A;  3QAR A;  2KDE B;  2UWQ A;  3BK2 A;  3WAN A;  5IKC M;  3DEE A;  4MSM B;  4MEX A;  4EBE A;  3R2T A;  5KG3 A;  5ALE A;  4F4W A;  5B66 U;  2AGQ A;  5AIC A;  1EXN A;  4DL3 A;  4KLG A;  2Y5B B;  3I3T B;  2KN5 A;  3HRD D;  2GOL A;  3V72 A;  2RHF A;  2EMS A;  3C2K A;  4W9D A;  2PFQ A;  1JX4 A;  5ALI A;  4M9J A;  1T0Q C;  1L3U A;  2HTM E;  4KSK C;  2DYO A;  4F5R A;  3W1Y A;  1VZ7 A;  2HDO A;  4F50 A;  1JW9 D;  3V6H A;  2VJ5 A;  2FCQ A;  4GSW A;  2Z8L A;  4EKU A;  5KG7 A;  3HPO A;  3KZX A;  2KTR B;  1B0X A;  1E0Z A;  3PW4 A;  1X6J A;  5DQI A;  4KIK A;  1ZQN A;  1I42 A;  1D8L A;  5TR5 A;  1H8C A;  2BB5 A;  1S10 A;  1ZQL A;  2BYV E;  1LV5 A;  4EEW A;  2F76 X;  5HG2 A;  3NY5 A;  5ALW A;  2ZG6 A;  4NLK A;  1T6B X;  1XS9 D;  2FLP A;  2JR5 A;  2Y9U A;  1R4N B;  3I63 C;  4IC9 A;  5KFT A;  2H3Q A;  1L7Y A;  3KTQ A;  2WU5 B;  1ZXI A;  3GIM A;  3SDL C;  1JRO A;  5BMG A;  1Z1B A;  5C2T B;  3RBE A;  4ARC A;  4DLE A;  2BDP A;  3A9K B;  5AI8 A;  3L16 A;  4F71 A;  4JV0 A;  1ENF A;  3R3M A;  3Q8L A;  2LD9 A;  1KFY B;  4M6W A;  3Q8S B;  4DOC A;  3TIX A;  1L6U A;  3DWG C;  3RNA C;  1X40 A;  3GV8 B;  7ICS A;  2HSZ A;  3BS7 A;  1D8B A;  3AE5 B;  4ED7 A;  4BX9 C;  3MGV A;  2WAQ C;  2R8I A;  1U47 A;  2DF4 B;  2G4S A;  2QMT A;  3BZD B;  3RUL A;  3ZTC A;  2PVO D;  2AGO A;  1S0M A;  1S97 A;  2A1A A;  1I4R A;  4ED6 A;  2JYE A;  2KFK B;  3C5G A;  1EF1 A;  3KUZ A;  1XCT L;  3KW5 B;  1X9W A;  1ZQC A;  2EKI A;  1NK6 A;  1NJY A;  1H38 A;  1E8W A;  4EX6 A;  4YMO A;  2YEP B;  3KVF B;  1TK8 A;  5KFR A;  2Q5W D;  2H3I A;  1WGY A;  3W1S A;  2Y5C A;  5IN7 A;  1FNV A;  4W9F A;  1QT9 A;  5C3J B;  2KC1 A;  1RXW A;  4IUM B;  2M8S A;  5C23 A;  1OQQ A;  4P7I A;  9ICH A;  3WK6 A;  5T14 A;  2E6X A;  4EUT A;  2AQ3 B;  4ED1 A;  1UWX A;  1YQ4 B;  1XLN A;  4C4V A;  4DS5 A;  2WXG A;  3BVG A;  3MFI A;  5ALG A;  4Q43 A;  3DVN V;  7ICL A;  3TEZ A;  3U8Z A;  5CJ7 A;  1WMH B;  3JW0 X;  2GWS A;  3SHQ A;  2K8C A;  3AED B;  5BPC A;  4KIT B;  4F4X A;  7ICU A;  2MUT B;  3BDP A;  4EBD A;  4DSE A;  4IRK A;  1WCN A;  4M01 A;  2KSO B;  2KE7 A;  4FZL A;  4RPX A;  4UQG A;  1L5P A;  2HVI A;  3QU7 A;  7ICI A;  2ZJ5 A;  2R18 A;  3PSI A;  4IQU A;  1M94 A;  3DBH B;  4C8O A;  4YWG G;  1UNS A;  2KQS A;  2BPS A;  4GDK B;  2DYM A;  1FIQ A;  4RF0 A;  1ZQS A;  3RCZ A;  4ECY A;  2WF7 A;  1TK5 A;  2HOQ A;  4YTP B;  3AEG B;  2ZUB A;  4Z6C A;  1DGS A;  3LB8 C;  2LYB A;  1V80 A;  1J7B A;  4QZB A;  2G45 B;  3AE7 B;  4QZE A;  7ICO A;  2AQ1 B;  1Y88 A;  3PHX B;  1U48 A;  2YX8 A;  3ZQ4 A;  4RM8 A;  1L7O A;  3ED5 A;  1XSN A;  1JCK B;  2V9W A;  1IBX A;  3A1Q A;  4DQR A;  2KHQ A;  1SBB B;  1X1M A;  4IG7 B;  3A4S C;  3DHI C;  4KKJ A;  4A8X C;  2XN9 C;  2AHO B;  5FK9 C;  4YR3 A;  3AU6 A;  3UMC A;  3VCB A;  3I57 A;  4TQS A;  2QAR B;  3RNC C;  1J2M A;  1E7U A;  3P4S B;  2REX A;  4FXC A;  5BYS A;  5JXV A;  1QCK A;  3V7L A;  5KFM A;  3QNM A;  2ALZ A;  2D8C A;  1N2X A;  1URJ A;  4BUG A;  1FCC C;  2KK0 A;  4XRH A;  2QKQ A;  3WK4 A;  1E8X A;  8ICV A;  2KIV A;  4UW9 A;  3OHB A;  3ALB A;  2XEW A;  1WY8 A;  1JI7 A;  1PUZ A;  5D2M B;  1BPD A;  2JU6 X;  5J0Y A;  3KOO A;  2WQY B;  1SJH D;  1GG3 A;  2P66 A;  2KYW A;  3GZN I;  4DLG A;  3HVD A;  1QIL A;  3K1Z A;  4ZRP A;  3TBL D;  1JMS A;  4YP3 A;  3PW5 A;  3AU2 A;  1BXT A;  2HE7 A;  3WAP A;  4NZL B;  4RNA A;  1LM8 B;  2HHS A;  4XE0 A;  3AI5 A;  3P63 A;  3B1L X; 
#chains in the Genus database with same CATH homology
 1SE3 A;  4EE2 A;  1NYR A;  3V05 A;  2K0P A;  2IGG A;  2WXN A;  2J52 A;  2WXH A;  2ZW1 A;  2W3R A;  2MJE A;  4MH8 A;  1M4V A;  3KWL A;  4MT5 A;  1F77 A;  1BML C;  3NS1 A;  2QEJ C;  5AUK A;  1MHH E;  1JWM D;  3ZYY X;  3RPF C;  1GAQ B;  2KAC A;  2NTS A;  1L6V A;  3LXF A;  4TSS A;  2IJ0 A;  5I4D A;  4HRS A;  1QLB B;  1WYG A;  1SSN A;  1TKG A;  3SFE B;  5EE9 A;  2QSD A;  1D4B A;  1JQ4 A;  1TS4 A;  2WXQ A;  2WXK A;  1V8C A;  1XF5 L;  5EE0 A;  5BYQ A;  1F2R C;  4TQ1 A;  2N9L A;  1YN4 A;  2M19 A;  2G9H D;  1EU3 A;  2ZW0 A;  3P4Q B;  2JSV X;  1PDX A;  2WXI A;  4PT5 A;  3AE1 B;  3MP9 A;  1I4X A;  4AQ7 A;  1TYG B;  4C56 C;  3ZJV A;  3CIR B;  2DLB A;  1RFK A;  3TEW A;  1IGD A;  1ZE3 D;  1HZ5 A;  2YEP F;  2X38 A;  5BYR A;  3KWV A;  1AWD A;  3NRZ A;  4P6V F;  1NVI D;  2LHD A;  2GB1 A;  3P1M A;  5H8Y E;  1SE2 A;  3AN1 A;  1RYJ A;  2W82 A;  1EM7 A;  4XDC A;  4MAC A;  1CQV A;  1TS2 A;  2QIE B;  4N58 A;  3TEY A;  5G5G A;  3ETR A;  3NUH B;  1PGB A;  4XWW A;  5T8I A;  1N5X A;  1NYQ A;  2PW9 A;  3BK1 A;  1K53 A;  2JYT A;  1GPX A;  1YN3 A;  1HXY D;  1TY0 A;  2PIA A;  4RH6 A;  1NI3 A;  3AB5 A;  1C4C A;  3Q8C A;  3ZGZ A;  4GLS C;  1MPE A;  2N7J A;  1ZOY B;  1LO5 D;  4YTN B;  3EA6 A;  4US8 A;  2BB6 A;  2DWQ A;  2BTE A;  3HVZ A;  3C8Y A;  4GDL B;  1FMA D;  2JZP A;  3BVM A;  3AE2 B;  1EU4 A;  2CJN A;  1E7P B;  2K22 A;  5BMH A;  2OHF A;  1FRR A;  2WS3 B;  1XXG A;  3AEA B;  2FUG 1;  2WU2 B;  2IGD A;  1YQ3 B;  5FR3 A;  1C77 A;  1ZDX A;  1XCQ L;  1ZUD 2;  1D6E C;  1ESF A;  2J53 A;  4ITK A;  2I2Y A;  3VR9 B;  2V3N A;  2PLP A;  2WXO A;  1VZ8 A;  3ABV B;  2K5P A;  4ZHO A;  4WWM A;  3EGR A;  1QOA A;  3W5V B;  1E6E B;  4ARI A;  2PVG C;  1XLP A;  1KF6 B;  4UDU C;  1XLQ A;  3AEE B;  3NVV A;  2CJO A;  4KX6 B;  2BYT A;  4USA A;  2K3U A;  4H2A A;  2R61 A;  5GXG B;  2W54 A;  1KRH A;  3AE3 B;  1I7H A;  2INP E;  2DBY A;  3MJ5 A;  2SAK A;  1WWT A;  1B9R A;  2RPV A;  3AV8 A;  5BMI A;  1I4G A;  1D5Z C;  4N59 A;  1D5M C;  1MI0 A;  2KWD A;  2PTL A;  3NVW A;  1Y56 A;  1FRD A;  2ICI A;  2W55 A;  1ET9 A;  1UGJ A;  3GS2 A;  1HEZ E;  5FKA C;  4MM3 B;  3VRB B;  2W3S A;  2ACZ B;  4WIP A;  4YTM B;  1GB4 A;  1TY2 A;  5E6J A;  1C9F A;  2KN4 A;  4HKZ E;  4C7Z A;  2WDQ B;  1QOG A;  3E56 A;  2XNA C;  1RM6 C;  2SEB D;  4L2Y A;  1PUT A;  3VR8 B;  1J7C A;  1FM0 D;  1J7A A;  1MVK A;  1B1Z A;  1FEH A;  2MJD A;  3MFG A;  2IGH A;  4OVZ A;  1JWA D;  1N62 A;  1UWM A;  4NJC A;  2N0S B;  3IAS 1;  2LHE A;  5H92 C;  3IT6 B;  1FXA A;  1VZ6 A;  1SB3 C;  4RGM A;  1T3Q A;  4P16 A;  4Q2J A;  5MPO A;  1QQR A;  3AE4 B;  3TUO A;  1C4P A;  2TSS A;  1ROE A;  3PO0 A;  4WH4 A;  1V1P B;  5D3I B;  3BII D;  4WUR A;  3FAH A;  3CWI A;  5EE3 A;  4A9A A;  4OZC A;  3FC4 A;  3I9V 1;  2BS2 B;  1N63 A;  1KLU D;  4L23 A;  3FIL B;  3KQ4 A;  1I4P A;  1KLG D;  1EWC A;  2BS4 B;  2PMV A;  3URY A;  3VQI A;  1Q10 A;  1I4Q A;  3BYT B;  4N6E B;  3N9Y C;  1V1P A;  1FXI A;  4B0E A;  2M0A A;  4US9 A;  3AH7 A;  4YSY B;  1TKY A;  4YXD B;  1K51 A;  3FIL A;  1SXT A;  3TEX A;  3SR6 A;  3LYY A;  4NAW B;  1KH0 A;  2B76 B;  4B0M A;  5LNK 1;  4ZOH C;  1ZDV A;  4IKG A;  1YMH E;  1YNT E;  1AYF A;  2GRI A;  4HKQ A;  2LJI A;  2V3P A;  1PYW D;  1SIJ A;  2WXJ A;  2KDM A;  1TJE A;  1STE A;  1SE4 A;  1BUI C;  1FO4 A;  4KGT A;  2V4I B;  3AE6 B;  4ZYS A;  2Y3A A;  3KLS X;  1AW7 A;  3B2G A;  4TMA B;  2KMM A;  1V97 A;  4L1B A;  3PZ7 A;  4DXG A;  1VRA B;  4ZHP A;  4KGS A;  4HJG E;  1K50 A;  1CZP A;  1XLO A;  2OED A;  1WXQ A;  1R7S A;  3W5U B;  1VJK A;  4CQN A;  2WDR B;  3T3O A;  4KGR A;  1FNW A;  3BVZ A;  3MC0 B;  3W9C B;  1JWB D;  1PFD A;  1FD6 A;  1OQR A;  1NEK B;  1CK1 A;  3IT4 B;  4OZB A;  2INN E;  1JML A;  4JWS C;  3NVY A;  3AEF B;  4LLG M;  2Y5P A;  2V0G A;  2MEK A;  2BS3 B;  1E10 A;  1L4D B;  2L32 A;  4XWT A;  5D3D A;  1AN8 A;  3U7Z A;  2WLB A;  1FFU A;  4RGO S;  3Q8B A;  2G1E A;  3U2S C;  2MH7 A;  1JRP A;  2BT6 A;  2IPK D;  4RFB A;  3TSS A;  3RFZ B;  4YT0 B;  3BK2 A;  2JXT A;  4C7Y A;  5D7G A;  4JPS A;  3R2T A;  2MJ3 A;  1JWS D;  2LUM A;  3J9C A;  1XO3 A;  3SEB A;  1L4Z B;  1WGK A;  3Q8F A;  1VDV A;  3EUB 2;  3HRD D;  2RMM A;  1TS5 A;  3AM9 A;  1CJE A;  2VZK B;  3UI3 A;  2LEK A;  5HI1 A;  1DYQ A;  2QJL A;  3ZJT A;  3VRA B;  1QOF A;  2HTM E;  2DYO A;  1VZ7 A;  1JAL A;  1JW9 D;  2Z8L A;  3ZJU A;  1E0Z A;  4LK0 M;  1GB1 A;  2BB5 A;  3AEB B;  4XDD A;  3E9S A;  4WAF A;  5HG2 A;  3U52 E;  2L52 A;  2BBC A;  1OFF A;  1T6B X;  1YN5 A;  2WXF A;  1SF0 A;  2KAJ A;  3PZ8 A;  3IXS A;  4JWU C;  4DXF A;  1T5X D;  2WU5 B;  3U4E G;  1QKZ A;  1SJE D;  1ZXI A;  1C79 A;  3BYY B;  4RGT A;  4DQO C;  1JRO A;  5BMG A;  3Q8E A;  2LMC A;  5C2T B;  4ARC A;  1L0V B;  1P7E A;  1QOB A;  2E3T A;  2J42 A;  1ENF A;  4JX1 C;  2J4X A;  5HHD G;  2I38 A;  1KFY B;  1PGX A;  1L6U A;  3DWG C;  3BWU D;  3AMZ A;  2RDG A;  3AE5 B;  2WNM A;  2D5G A;  2K9X A;  3HUI A;  4IOI E;  1HQR D;  3BZD B;  2QMT A;  4IDI A;  1FFV A;  4RCO A;  1TKE A;  2PVO D;  1E9M A;  3OWE B;  3SFD B;  5TSS A;  1I4R A;  2JYE A;  1VR9 A;  4NAM A;  1MHX A;  1RWS A;  2L83 A;  4WQM A;  1XCT L;  2WXM A;  1DOX A;  1L0X B;  4J3O D;  2EKI A;  2NMQ A;  3H8H A;  2YEP B;  2Q5W D;  3W1S A;  4AS1 A;  4JE3 B;  2Y5C A;  1P7F A;  1FNV A;  1DGJ A;  1DOY A;  1QT9 A;  1ZP0 B;  3V3X A;  5C3J B;  2FBW B;  1UUP A;  1OQQ A;  2E6X A;  2AQ3 B;  1UWX A;  1YQ4 B;  1XLN A;  2WXP A;  4YSX B;  2WXG A;  3BVG A;  1N5W A;  1ZXH A;  1K52 A;  3P4R B;  1SEB D;  4A55 A;  3TEZ A;  3L4P A;  2L1A A;  3IAM 1;  4ZRQ A;  3AE9 B;  2LFI A;  2GI9 A;  5G5H A;  3AED B;  3GP7 A;  1L0Y B;  1FNU A;  1ZPS A;  2JWU A;  1F0Z A;  1JWU D;  2IDY A;  2PKO A;  5HFY A;  1L5P A;  1D5X C;  2H88 B;  3O13 A;  4YWG G;  1V1O A;  1UNS A;  4OHJ A;  3NVZ A;  4D2K A;  4GDK B;  1C76 A;  2DYM A;  1FIQ A;  4RF0 A;  2VZK D;  3DWM A;  1TZO A;  3GB1 A;  1FCL A;  1WSP A;  4YTP B;  3AEG B;  3MHZ A;  1YJI A;  1IBX B;  3LB8 C;  4A6Q A;  1QF6 A;  1J7B A;  2QIL A;  1EWY C;  4KKI A;  3T3N A;  3Q8A A;  3B2F A;  2RDH A;  3NZ3 A;  2ONQ A;  1PGA A;  1KTK A;  3AE7 B;  2AQ1 B;  1VLB A;  2M56 B;  3P4P B;  4OW0 A;  3ZQ4 A;  1JCK B;  4RF1 A;  2WDV B;  2KQ4 X;  2JX5 A;  2LGI A;  3Q69 A;  4M0W A;  5EE1 A;  1IBX A;  1F2R I;  2AX5 A;  2BW2 A;  1C4A A;  1SBB B;  3WCQ A;  4A8X C;  4KKJ A;  2WXL A;  1ACC A;  2XN9 C;  1I4H A;  2WXR A;  5FK9 C;  2JQR B;  3P42 A;  1N60 A;  3I57 A;  3R2I A;  2H89 B;  1NEN B;  2HDE A;  3W2D A;  3P4S B;  3B9J A;  1YJJ A;  4FXC A;  5BYS A;  5JXV A;  3R8B A;  4OZA A;  1A70 A;  1HA5 A;  3AE8 B;  1DOI A;  2CU3 A;  4TQ0 A;  1FCC C;  1IUE A;  2FE8 A;  4LTU A;  4O1N A;  4A90 A;  2N9K A;  4HEA 1;  2EEL A;  3AEC B;  4REZ A;  1TS3 A;  1WRI A;  2JU6 X;  4RGN A;  2WQY B;  1SJH D;  1HZ6 A;  1N61 A;  4YSZ B;  3HVD A;  4HRO A;  1QIL A;  2WP9 B;  4ZRP A;  2AQ2 B;  1C78 A;  1IGC A;  2NTT A;  1BXT A;  1ET6 A;  4R3D A;  4NZL B;  4RNA A;  2ON8 A;  4C80 A;  1XEE A;  5AUI A;  4XE0 A;  3P63 A;  1GOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...