3NVZA

Crystal structure of bovine xanthine oxidase in complex with indole-3-aldehyde
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 39
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvzA01
3SR6A 4US9A 1NI3A 2JQRB 3DWMA 3AEAB 3CIRB 4ZOHC 4FXCA 1WXQA 2W54A 4WQMA 4JWUC 2H89B 1WGKA 1XLOA 4A9AA 2PIAA 2MJDA 1WRIA 5EE0A 3B2FA 3AEFB 1E7PB 3AEBB 2MJ3A 2PVGC 2WU2B 2HTME 2CJNA 4ITKA 1YJIA 4HROA 3W5UB 1JQ4A 3KWLA 1KF6B 1L6UA 1FO4A 1CJEA 3HUIA 3NRZA 4ZHPA 1NYQA 1XO3A 4C7YA 2BS4B 5EE1A 2Y5CA 1EWYC 2WDVB 2E3TA 1J7CA 3NVVA 1YJJA 1VDVA 1KRHA 1TYGB 3BIID 3P63A 3AEEB 5MPOA 1JROA 4YTNB 5H8YE 3NVZA 2WDRB 3AE8B 1VLBA 3NVWA 1YQ3B 3SFEB 3AH7A 1TJEA 1UWMA 1DOXA 1TKGA 1XLPA 4C7ZA 1ZOYB 2W3RA 1SF0A 2MH7A 3P4QB 1QOFA 4YTMB 4ZHOA 4YT0B 1ZXIA 1DOYA 1FM0D 1DGJA 1R7SA 1RFKA 1SB3C 1RM6C 1AWDA 3W5VB 1L6VA 1FXIA 1IUEA 1NYRA 1JWAD 2EKIA 2M56B 2B76B 2WP9B 1N60A 1E9MA 1QOAA 4KX6B 1E10A 3B2GA 3EUB2 1E6EB 3AV8A 1GPXA 2CJOA 1XLNA 1N5WA 3AE5B 3HRDD 2W55A 4C80A 4IDIA 1JALA 1V8CA 1QT9A 1FFVA 4HRSA 2FBWB 2JX5A 1F0ZA 3W9CB 3VRBB 4YSZB 1QOBA 1L0VB 1QLBB 3PO0A 1J7AA 1RWSA 1N61A 4N6EB 2KMMA 3AE7B 2DWQA 1PUTA 3AEDB 3AE3B 1NVID 1PFDA 3AE4B 2BS2B 1ZP0B 1XLQA 1L5PA 1PDXA 1FXAA 2LEKA 5C2TB 2WDQB 2BS3B 1JWBD 3AB5A 3DWGC 5EE9A 1OQQA 1V97A 2W3SA 1J7BA 1GAQB 1WWTA 5GXGB 3AE1B 4LTUA 3AEGB 2AX5A 3ZYYX 1ZUD2 3B9JA 2N0SB 4YSYB 1N62A 2QIEB 3P4SB 3AE9B 1OFFA 2WU5B 3P1MA 4N59A 2M19A 1TKEA 2ACZB 3WCQA 1A70A 1SIJA 1I7HA 4N58A 4YSXB 2Q5WD 1AYFA 1RYJA 5AUKA 1FIQA 1N63A 1ROEA 2L52A 3RPFC 1QOGA 2OHFA 3ABVB 1E0ZA 1FRDA 1JRPA 2G1EA 1FFUA 3FAHA 2KAJA 3LB8C 3P4PB 5AUIA 3AM9A 3FC4A 5C3JB 2K5PA 1N5XA 3AE6B 5G5GA 2K9XA 3L4PA 3VR8B 3ETRA 1B9RA 3SFDB 3VRAB 1FMAD 1WYGA 2L83A 2BT6A 1FRRA 3AE2B 3P4RB 2K22A 4YTPB 3NVYA 4YXDB 1VJKA 5H92C 2CU3A 2WS3B 1QF6A 4P6VF 5G5HA 3AECB 3VR9B 1T3QA 3HVZA 4US8A 2H88B 3AN1A 1DOIA 2QJLA 2WLBA 2WQYB 1NEKB 1JW9D 1KFYB 2PKOA 3LXFA 5EE3A 1NENB 2MJEA 1CZPA 1OQRA 3CWIA 4JX1C 4WWMA 4USAA 1TKYA 3AMZA 4JWSC 2PVOD 3NS1A 1YQ4B 2DBYA
chains in the Genus database with same CATH superfamily
3CSFA 1MC8A 4MHVA 2KHQA 3M62B 2J0JA 3N1XC 2KIWA 3O65B 4DSIA 2NVUI 5IIOA 2WXFA 3IVFA 2KX0A 2D3GA 5BOMA 4KLJA 2GBRA 3EYZA 4DOCA 2WFAA 4R65A 3QZ7A 2BKFA 2HTME 1UQVA 4ITKA 2N4FA 4HROA 1NKBA 4GC7A 2DZMA 4O9MA 3Q8BA 4CQNA 2GOLA 2PMZF 4K3BA 2FUG1 4YQWA 3BWUD 1XSNA 4E3CA 3ZNZB 2G4DB 1GG3A 3TEWA 2L8JA 1TYGB 3R2IA 4EELA 4LNFA 4P2HA 3H0RB 2KN5A 4K4IA 2IHMA 1E5WA 2K3UA 1KLUD 4M6WB 2KTRA 1C77A 2DAFA 3RNBC 1F52A 2B0CA 4DO9A 4HPLB 1OW5A 4RM9A 1EF5A 3R7RA 5CR0A 2BQRA 4IC7B 1WXVA 1SZHA 3SDLC 2TSSA 2XICA 2FE8A 2QC8A 2AEHA 2HD5B 2L7RA 5AK5A 2ASQA 1E9MA 5BMHA 3B2GA 2BYEA 8ICLA 5J2EA 9ICUA 3DVNV 2K6QA 4KLOA 3Q8RB 2BHNA 1L3SA 4ED6A 4M47A 1L3TA 4OVZA 4KLQA 2KDEB 2Y0SC 2YB1A 2KIVA 2L3ZA 2J4XA 5KT2A 1PUTA 3AEDB 2G07A 3GV7B 5J2KA 3EW9A 1MQ2A 3UXOA 3F5EA 1Q3UA 1F2RC 1ZQNA 1WGYA 2F1IA 5B5EU 2V4QA 2EQYA 1LKYB 2W3SA 1XCTL 1KLGD 7ICPA 3DBHB 1JRUA 4PHDA 3HP6A 4RF1A 3HILA 2KZMA 4DXFA 1HUOA 4NJ6A 3IG5A 4QZCA 4HAIA 2BCRA 8ICJA 1IM4A 3V7LA 2HJ8A 1SE3A 2J0KA 5KHQA 2KD1A 3QU9A 5KFAA 3LWLA 1N63A 4KDIC 1SV4A 4KIKA 4RQNA 1QOGA 1KLNA 4QAYA 4W9IA 3OG5A 2N7EA 2HOQA 5KFXA 1ZD4A 3AM9A 1U49A 5T14A 3R66C 3KZIU 3L4PA 2IDYA 2MP2A 1F44A 3G6VA 3ZRCA 2MAXA 4PYUA 4DXAB 2HVIA 3B0YA 4MH8A 2UVVA 1FEZA 3M8SA 2HBLA 4OJLA 3M9OB 2WXNA 4IWOA 4A20A 2JHDA 2J0MA 2WS3B 4NLBA 1RQNA 4P0PA 1WZ3A 4RT3A 3RF9A 2PEAA 3UPQA 8ICIA 3ED5A 1MG4A 4GDKB 3VTUA 4WWPA 1Z3EB 3WK5A 4HK2A 3RUIB 2VJ4A 1SXDA 2F2AB 3AEAB 5CTRC 1O03A 3M6ZA 3MR6A 2KFNA 1DK3A 9ICIA 2QARB 5L83A 3KYCD 4IR9A 2LXCA 5J0YA 3AEBB 2GMIC 4P7IA 4F4KA 3ZI4A 1SJED 2CJNA 1U48A 5AKGA 4O3SA 5KTQA 3E2EA 1SBBB 3APFA 3IFWB 4K81A 1HTQA 4O5EA 3OTQA 4K4GA 2HHXA 2QLTA 4ICVA 4QJFB 4AJWA 3TCAA 3BIID 5B66U 3N7PD 2E6XA 5JHAA 5H8YE 4YG2A 3BQ0A 2C9WB 4ZRKA 5IAAC 2WF9A 3N28A 5KFCA 4O0IA 3F2CA 2FCSA 4KKIA 4F92B 4KDLB 2CPRA 2ALZA 4MJSA 1TZOA 1D6EC 3MHSD 4HJGE 4XC2A 1TJEA 1TS4A 3AL0B 3PX4A 3RBEA 4WJOA 4IKGA 1NK7A 2W3RA 4UAUA 2JZ3B 4FBTA 1J0GA 2RMMA 2JEGA 3SEIA 1TGZB 8ICTA 4GXKA 1Z00B 1FNVA 4F2SA 2V4LA 2FPMA 2HJ1A 4IW0A 5AKZA 4MT5A 4C0ZA 4EZ6A 3EUB2 1MSWD 2GBNA 2QB0B 2IO3B 3AU2A 1H38A 1F1HA 4Y2UA 4Y2VA 4J9PA 5AM2A 4M04A 4NLCA 5JU5A 2D3AA 2KACA 3PW2A 4K3CA 3Q8SB 1ZQPA 1IP9A 1D4BA 4YXMA 4F5RA 5J2CA 4S17A 4UBBA 3Q6BA 2MUTB 4EFOA 4YR0A 4XRHA 5J2AA 1MPEA 2E1FA 3NRWA 4P0PB 3WK7A 4QZ8A 2KHVA 2K8HA 2VA8A 1WWTA 4GXBA 1ZUD2 5J8YC 5IIIA 3KHLA 2HCFA 3ONSA 2H5XA 3IAS1 5DPTA 2WU5B 3BS5A 4EYIB 3NHEB 1T7PA 2GB1A 4HJKA 8ICPA 4RQ7A 1GB4A 1RG6A 4G3XB 1ZD2P 2MRPA 2LBOA 4KIKB 1YN5A 2L52A 4B0MA 4TV3A 5KFUA 4PT5A 3ZDDA 1S97A 1ZQYA 4MEXA 4TUUA 2MBEA 4LVSA 4NL9A 5DPWA 2JUOA 2KMDA 4RQMA 3RAQA 4OZAA 1J8CA 1XCQL 2BF8B 5FR6A 1QF6A 2JH1A 8ICYA 2WAQF 4WWOA 1WGGA 4I2AA 1VRAB 1NEKB 2AH5A 3JPSA 2R18A 1A6SA 3TIXA 5DG8A 3Q8EA 4I2HA 1NI3A 3GDXA 4ED8A 1ZQDA 2KFKB 2MP2B 1PZNA 4FXCA 4KSLC 3CNHA 2BPFA 1IIPA 1UF0A 2IZVB 1X66A 4U6PA 5EOZA 2HE7A 1TIFA 1OUQA 1NK5A 2NTSA 7ICQA 1V49A 3C29A 3PLVA 2FLLA 1ZKHA 3N97B 3H0LB 3RFZB 2NMQA 4XDDA 2ZTDA 1XO3A 2KT7A 2JYTA 2KKVA 4A55A 1Q8KA 2FPKA 2WDVB 1D9FA 2AWTA 1TT5B 1AARA 5C1ZA 4YL8A 1BPZA 3RJJA 2QDFA 4Q8FA 4XWTA 1UZXB 4M6WA 2HI0A 4ED3A 2EELA 1B0XA 4I2IA 1X42A 5KFOA 5DBAA 1R4NB 2V3SA 1RM6C 1FEHA 9ICAA 4LJPB 3RT3B 1SE4A 5FP0A 3GV5B 4EUTA 4TUPA 1V9PA 1U9LA 2HBMA 2W55A 3MABA 4N9F4 4MGKE 3EECA 4UB3A 4M2YA 1QT9A 2IO2B 3Q3JA 3BZCA 2RQ5A 1L0VB 1QOBA 3PREA 2G06A 1RWSA 4Y2JA 3KUZA 1L7OA 2ZJAA 4IL6U 1XNSA 3UQ0A 4NAWB 3I63C 1L8OA 1WSPA 2KTRB 3GB1A 2ES6A 3N1YC 4O3QA 2LEKA 3PX6A 3LVWA 4TUQA 3DBRB 3H1UA 2BYFA 2L05A 1HZ6A 4OVUA 3AE1B 2QCZA 4LTUA 4P0QB 3N32A 1H8CA 4UARA 3ISCA 3T5JA 2JH7A 2O6VB 2XO7A 1HE8A 2KOXA 4RGMA 1XF5L 4N59A 4C4VB 1TKEA 1A70A 5BYRA 4B6JA 3HHMA 2EAOA 5KL8B 9ICQA 4BBNF 1JCKB 1UGMA 5BPCA 3TBLD 4UB5A 2YVCA 4MACA 5CWRA 4DL2A 1WJ6A 3SV4A 2KZRA 1K8RB 3LK9A 4DQPA 3JPNA 1L5UA 1XXGA 3PLUA 3BY4B 4YMNA 1V86A 2LGYA 2WXOA 1GB1A 4BFRA 5IO9A 2YTUA 2ONQA 4ECRA 5J0RA 3NZSA 1ZW7A 2L00B 4DLGA 2BYTA 5DQHA 2MRLA 3H8JA 4B9VA 2VANA 3QX1A 4IRDA 2AU0A 2NRVA 5KFZA 5KG6A 1V5OA 4TQ0A 4LDTB 4JWSC 3V3XA 1P1AA 3PMLA 4PZNA 1V38A 1LO5D 3DWMA 3AXCA 2BW2A 1KEJA 5KFWA 1WXQA 4ECWA 2MA1A 5J2GA 1H4RA 4IM0A 1WRIA 5EE0A 2OJRA 2M0XA 3AEFB 4AWJA 1MA7A 4QWDA 2R2QA 1Z1BA 3QXGA 4UQGA 4RPZA 1NKCA 2W9CA 3KWLA 3QUTA 1UWXA 2FCQA 2C22A 3N4MB 3JPRA 2PXIA 4EENA 4C7YA 3G6YA 4BWMA 2IGGA 4RNAA 5HFYA 1ZQMA 1MQ3A 5L1IA 1GJZA 2BQ3A 1NJWA 3DBLB 2IMWP 3LWMA 5CHWA 2NS5A 4ARCA 5TR5A 8ICXA 2H3QA 3NVZA 2N1WA 2EZYA 4LZGA 5ALGA 2KQ4X 3UQ2A 2AL3A 3L5KA 2NRZA 2KDBA 3KFUF 4O3RA 2P6UA 1L7PA 3C28A 3MFGA 4KGSA 4KMUA 2WX1A 3L08A 1WUDA 4YTMB 3GIIA 2I1KA 2JEIA 1B4FA 2AQ2B 4YD1A 2QMTA 2KHWB 1GUAB 1IGCA 4ANWA 4BXOA 1PGAA 4J9KA 3BS7A 1PK1B 5L1MA 2SAKA 4G0NB 5D3IB 1K51A 4KX6B 2H3FA 5AKLA 1WR6E 1ZD3A 3TEXA 1B43A 4M0AA 9ICRA 3DDHA 1L3VA 2L1AA 4DWFA 5KT3A 2W03A 1Z2MA 4KLTA 1WR1A 4ELVA 1PGXA 2LGDA 2GBKA 3SZ2A 4RQ8A 2PE6B 3JPQA 1N61A 3RB4A 2DENB 4ECUA 3AULA 4GIBA 3I28A 2DWQA 4WURA 5E6OA 4EKUA 2RDIA 4K4HA 5J8YA 5AK6A 2WDQB 1K52A 5D7GA 4UAZA 4DL6A 1YX6B 3Q3FA 4Z6EA 1Z1VA 2W7OA 4M9JA 5AM1A 3MC0B 1OTRB 4BKSD 4TUSA 2WGSA 3WKBA 3OPXA 3W2DA 4Y2PA 1YZ7A 1OQYA 2ZPNA 4NQLB 1P9DU 4HPMB 4KN4A 1ZQKA 1KDHA 2XY7A 3JPTA 2MHJA 4F50A 4JV0A 2PE9A 2HOIA 4EZ9A 2D11A 3NVYA 3ZD8A 4DDID 3GE3C 1HUZA 2REXA 2EMSA 4P6VF 3MC8A 1BNPA 4KLLA 4RU9A 3G6XA 2K25A 4DL5A 1UHUA 5EE3A 2B21A 3KH0A 8ICFA 4RQ3A 2JZBB 4B9SA 2F77X 2KYWA 5F9LA 5CB1A 1NK6A 2KQSA 1STEA 5HNKA 2BKEA 4EZKA 5HHHA 3VTWA 4PL1A 4UASA 3B08A 5ALPA 4A9AA 1PVQA 4LJOB 2KFJA 4DF4A 1TK8A 1DGSA 5GTIU 5DLGA 2BPCA 5KAIU 4CYEA 1VCBA 2QHOA 2ZUDA 2ASJA 3D2QA 2DPJA 2HDEA 2FAZA 3NVVA 2QILA 5L95C 3HKZC 1HQRD 2BYVE 2NO4A 1P98A 4C4TA 3KVFB 2NBUA 4O3PA 3MBYA 1OGWA 5J18A 2ZTEA 3RAXA 3L54A 3ORYA 2KVRA 2G9HD 5JXVA 1KTQA 1TKGA 1XLPA 4QWAA 1YT3A 4ED0A 3GU3A 7ICHA 1RFKA 2BVCA 3CW2C 2CRXA 3Q8MA 1NNLA 1A0PA 1KW4A 4MF8A 1LVHA 2JEFA 2JF5A 2M56B 4II2B 2WYQA 1N60A 3KKAA 5ALYA 4MM3B 4YXJA 2BB6A 4ZRIA 4XQ8A 2OEDA 1TK5A 3WKCA 4E71A 4HPPA 4B9TA 1U45A 3MFIA 1LQBA 4C80A 5J17A 5KFDA 1FFVA 3C5FA 3HVDA 1I35A 3QCAA 4BZAA 2KTQA 1KH0A 5KFMA 3C21A 1ZDVA 3N1ZC 4RQ0A 2IO0B 3QU5A 2W9MA 4RT2A 2ICIA 4JMUA 5ALQA 2LGXA 1D8LA 1EF1A 2K4IA 4RNMA 3RH5A 4Y2YA 2GLSA 4Z6FA 4K1RB 4P1CC 4ANUA 1HIWA 3OHAA 1T8EA 2PI5A 3NZUA 3PV1A 3BQTA 5BMGA 5IOIA 1VJ5A 1V1PA 5GXGB 4IRKA 2VZKD 2Z7JA 4ELUA 4CO7A 4DK5A 4YSYB 2HTHA 3QAQA 4HDOA 3C8YA 4KTQA 2K8BB 4B9UA 4IRCA 2KLGA 4P1BC 3BZDB 1COOA 3HK0A 1ZQJA 2XNAC 1Z4NA 3MR3A 4C4SA 2JY6A 3DCGA 2NYVA 3SYZA 2ZIUB 3Q8CA 8ICCA 1E0ZA 4QZGA 3A9KA 2LYBA 1UGJA 2ZZPB 3AU4A 1L2NA 5FKAC 3OJ4B 3FC4A 3BDPA 3CSTA 2G4SA 2KFKA 5AK3A 3SENA 3VRAB 5IP4D 2YY6A 5J2HA 3ALRA 3URYA 3GE8C 4BDPA 2OEHA 3M9NB 3NUHB 5D46A 2G45B 1A77A 2KN7A 3C0RB 1T3QA 4AYBF 3HVZA 4US8A 5HP4A 3J9CA 2QJLA 1XO1A 3R7QA 4M9NA 4C8LA 2O6VD 4RMAA 2A5UA 2J6UA 1PQSA 2PVOD 1V1PB 1QQ7A 1Y56A 1E7UA 2KWCA 3RJFA 3BYYB 9ICJA 4DXGA 5C23A 4DF8A 1WXMA 1NZPA 4NLKA 2KJ9A 2DHZA 1PUZA 2MJDA 3DBSA 2YEPB 2HSZA 5ALUA 4PS3A 2ZUBA 1L3UA 2PVGC 2WU2B 3Q14C 4CHKA 2UVWA 2KP7A 3MFHA 2BCUA 4TQRA 1EUVB 3BS5B 1ZRMA 3UM9A 4WWNA 2V3NA 2K4EA 2LUEA 2CHXA 1V6EA 3DHHC 3MJWA 1NK8A 1NJXA 3AEEB 5CJ7A 1ACCA 4YTNB 2KMAA 4DS4A 2GWSA 4FZMA 2V3PA 2Y5BB 3OSPA 7ICLA 1HZ5A 1JN3A 5EDSA 1EM7A 1VLBA 3A33B 2HW3A 2KDIA 4JUZA 3HX0A 1WFYA 3WKDA 2KZZA 2D2QA 4G11A 4IWPA 9ICCA 3JVZX 2XK5B 3GOEA 4HDQA 2J7QB 3BVZA 4R3DA 3MDAA 4J9LA 2ODGA 5HMMA 4O5KA 3BQ7A 4NXZA 1JWAD 1NYRA 2DX5B 5DDMA 1GOZA 5AICA 9ICEA 1VZ6A 2WXGA 2H3VA 1T4GA 2UYZB 3PHWB 2R8GA 2NPTA 3RR8A 2Y9UA 1LXDA 1WXSA 1UH6A 4BVUC 4F5PA 2JX5A 1Z00A 4B0EA 4LZDA 5KFFA 4RGNA 3K9PB 3PO0A 2EANA 4JIOU 2KE7A 3BQ2A 3NUQA 4FA6A 1NJZA 4MJSB 4FFDA 5KL1B 2C7NB 2LYAA 4PZOA 5AKKA 3EPGA 3ZRFA 4QNLA 3AB5A 3H6NA 4C8MA 3V61A 4P4MA 1ZQLA 1XU4A 4F8CB 1EO6A 1JWUD 3PHXB 3KHHA 5KFIA 4YMMA 3C2LA 2P66A 2N0SB 5HKHA 2O2VA 3MGVA 2UVRA 2ACZB 1WXAA 1TY0A 3Q3MC 5KG5A 2PKEA 2K8CA 5KFYA 2HOFA 5K4LA 5KT6A 5KFRA 2LHTA 2K1FA 2MBOA 2OHFA 2LYHA 2IY1B 4W9DA 2G1EA 3QNMA 1D3ZA 2QARA 5DBBA 2XC9A 1K5OA 5CHFA 1ZQZA 1N5XA 4DSEA 1S76D 2Z59B 3PRMB 1YQBA 5DG7A 1SV0C 1QZEA 2PLPA 5DLFA 2C2EA 9ICHA 4LNKA 1ESFA 5DB9A 1L6NA 2CU3A 2FCMA 1A5RA 1J2MA 5D4BA 2N1RA 2Q4TA 2LGIA 2UWQA 3UINB 4RNOA 1KFYB 5G2NA 2DYBA 4O1NA 2KXJA 1IXRA 2YLMA 5DB7A 7ICJA 3CMMB 1TK0A 4JQWC 4M0WB 3ISDA 2WDTB 2FPLA 3DVNU 4US9A 3E58A 5DPSA 2VJ5A 5AM5A 2LI6A 1IBXA 1WRDB 1EU3A 1F0MA 1E7PB 5ALNA 3KBBA 9ICOA 4QZ9A 1QCKA 2BCQA 5JTIA 2XGPA 3NTUA 3UIPB 3M3JA 4M9HA 2F44A 3RJEA 2RGFA 3M6KA 3NOBA 1TVAA 2LJIA 1WGHA 2D3BA 3ZLZA 2CR5A 4ECXA 2Z0DB 4AYBC 4KLHA 1F2RI 3SAGA 2AHOB 5KG7A 2RSUA 4OZCA 4JV2A 2OCEA 4KLDA 4WIPA 2NBVB 4XDCA 4QW8A 3VAWA 4JPSA 4HYKA 2Z8LA 5L1LA 1ZYQA 3L0WB 4WH4A 3S2AA 3E56A 2KX3A 2DL0A 4DQQA 1YOVB 2MQJA 3AH7A 4XA5A 2J6TA 3K9OB 2MX2A 4DSJA 3M7DA 1X40A 2WHIA 2K4PA 3DVGY 4F5QA 1ZXIA 2KKPA 5CHGA 5J0QA 1XQQA 2PPHA 5FK9C 4YN4A 3PS6A 2IY0B 2EKIA 4WJNA 2YMQA 4CNQA 2KC1A 4OJOA 1BPYA 2L0FA 3APCA 2XGQA 1V8CA 5JRTA 2AGOA 4I6PA 7ICUA 4IQWA 4MFFA 4ED2A 1SGGA 2G3QB 1BXTA 4YR3A 3HW8A 1E8ZA 2NR2A 2E1EA 3OHBA 3MGIA 2YMPA 3Q2AC 9ICMA 3ZDAA 5ALXA 5C5JA 1RXVA 2R8JA 1ZP0B 5EWGA 3WAMA 4XWWA 2HHUA 8ICGA 3UF8A 1IGDA 2KSOB 3QX7A 2EAPA 9ICGA 1ZQWA 3T3OA 2LRUA 2ISPA 4B9NA 3RB3A 9ICLA 5EWFA 1OFFA 3U7DA 4ECVA 2Q0ZX 1WMHB 2F76X 4UDUC 4YSXB 1D8YA 1L4DB 4KLGA 4MH0E 3KTQA 1AW7A 1I4QA 1MG8A 2RP5A 8ICQA 2WF6A 3TQ1A 3GFKB 2DUYA 3NS8A 1WX7A 1B9RA 3A0HU 3SFDB 1L7YA 1ISNA 2INNE 2NRWA 2R8KA 5HMLA 2I5HA 3AE2B 2HHWA 4LK0M 1VJKA 3WK8A 3HKZF 3VR9B 4DFPA 1Y8RC 2VZKB 2H88B 1ZRNA 2CHZA 5DB6A 1UBQA 2CU1A 2LZ6A 4I2CA 1XWLA 4EBDA 2INPE 3A9KB 4XGAB 3MC9A 3ML9A 3KYDD 2KSOA 4F5NA 3SHQA 3D32A 4PPXA 3LYSA 2VA2A 1RPLA 1ZQGA 2MEKA 3KKAC 3EZ5A 3AI5A 4O3NA 1WCNA 4K7UA 8ICMA 2JMGA 4PS7A 3PTFC 4HEA1 3T3FA 1Q3VA 3DBRI 4AQ7A 4R8UA 3HUIA 4ZHPA 3MC1A 1NYQA 2INCC 3CF6E 2BS4B 3UIOB 1FCLA 1HEKA 1WJ4A 1HEZE 1EWYC 2E3TA 2H3ZA 1YJJA 1VDVA 4K7SA 4JWNA 2DYOA 1S0OA 1S10A 5KG3A 8ICOA 2KJRA 4GN1A 4NM1A 2R61A 4UB4A 3H8WA 1URJA 3K4GA 2MA9B 4II3B 3QUCA 1IG6A 2KG5A 3GS2A 1SF0A 3IT4B 3JSVA 2IHNA 5AI4A 1I4PA 4Q45A 4YT0B 1D5MC 1FM0D 1R7SA 3A4SC 4MFCA 2M8SA 4MM3A 1WE6A 2HHTA 1L0XB 2DFLA 2VA3A 5LXHA 2RPQA 2KICA 5ALLA 2B76B 2F1HA 1QOAA 1X9SA 1FPYA 1TS3A 2YMLA 3AV8A 3VTVA 1GPXA 1S1QB 4B95A 2OJWA 3A1QA 4YVZA 4WQOB 1QQRA 4UATA 3A9JB 1I4XA 3HIZA 5KFSA 2XVTA 4D2KA 3K1ZA 2JYEA 1J7AA 5AM3A 4HCNB 3SEBA 2I1JA 5D3DA 1X9XA 2M4NA 1ET9A 3B1LX 3VCBA 4RPXA 1TKDA 2ESEA 3R8BA 2LGSA 2WB1C 1WY8A 3N9YC 1AN8A 5L1JA 3BVMA 1X1MA 3ZUNA 3GP7A 3L10B 2OYYA 4RUCA 3QE9Y 4NJ7A 3ZYYX 3QEAZ 3PZPA 1N62A 4F4YA 4NWIA 8ICUA 2DPIA 2ZEQA 4OO1J 1TV9A 2W9NA 2VH2A 3JPOA 5HHDG 3TJPA 5HHIA 4KX3A 1S9FA 4I28A 3WK9A 4M9LA 4W9GA 4NM2A 1RYRA 4J9NA 4DL4A 5AUIA 3QZ8A 2DKXA 3MJ5A 2K5PA 2LVQA 4JK1A 3VR8B 4KLEA 2C7MB 4KLMA 3P2BA 4K7WA 3W1SA 2N9KA 1ZJMA 4G3IA 1E90A 2YMMA 4M00A 4IR1A 2VRRB 3P4RB 4YTPB 4PHAA 3SU8X 3WU2U 4BJQA 3C19A 2J52A 3ZDMC 2JU6X 4MF2A 4Y2SA 2ZNVC 2D3DA 3R2TA 3SD5A 2O2VB 5D6JB 2N9PC 4FHKA 3RULA 4KX5A 3T5HA 2F1JA 4FADA 3HM6X 1ZQVA 3SR6A 1F9JA 2WF8A 2JWZA 4ICUA 3VHTC 2W54A 4WQMA 4JWUC 4FZNA 3KLSX 4AOFA 2W9AA 4EZJA 3RNAC 1YJIA 1F77A 1P3QU 4FS2A 3KHRA 1NJYA 4GOCA 5ALJA 2GOWA 4BKSA 4GU2A 2ZVNA 2QB0A 4EBEA 3VVWB 3ZDBA 1SL0A 2BZFA 1WGDA 2NV3A 4J03A 4ZRJA 3OJSA 4Q2JA 2BPGA 3ALBA 1SGHA 5D2MB 3PNCA 4C7ZA 1YN3A 1UBIA 1TAUA 1T0YA 4X5VA 4JLCA 4KZCA 4IG7B 1N6ZA 4IQUA 2QEJC 3OAWA 3AEVA 2IBIB 1FXIA 3F5AA 2WP9B 3ZQ4A 1XO0A 3H8HA 4RCOA 1WWVA 2KEYA 3OSNA 2CJOA 2MSED 3PSEB 2ZG6A 5KFBA 3IHPC 4PS8A 1WCLA 4Y2XA 3PW5A 2JV3A 3MTNB 2RLTA 4ICAA 2PFOA 3VRBB 1UPHA 5TSSA 3QC8B 4GFJA 3BQ1A 2JXJA 4Z6DA 3T5LA 3QIJA 2IOFK 1QH9A 3DQVA 4N6EB 4HCPB 4M0WA 4EEYA 3ZTCA 2HDOA 4Z6CA 3AE7B 7ICMA 3KUCB 4KVGB 1BGXT 3N7SC 1KFDA 1YD8U 2GH1A 1XLQA 3ZGZA 1PDXA 4DQIA 2ZIWB 4A3PA 4FS1A 1JXEA 3K1RB 2BS3B 4FLHA 2E5SA 1SKRA 7ICKA 4FULA 4KSKC 4F1SA 2W9CB 2A1AA 5LNK1 1DXSA 3AEGB 3H9DA 1X6JA 1ZQTA 5BMIA 4I2JA 1PVRA 1GO3F 1TY2A 4ZH4A 1U4AA 1ZQXA 4RUAA 4FO6A 4ACOA 1UA1A 5J2RA 3DHIC 3WIMA 1FNWA 4RFBA 4QZEA 4KLIA 3IBEA 4WJQA 2E8OA 2ZJ8A 2G0AA 4DDGD 5TZVA 1FRDA 2KAJA 4GDLA 2GBMA 2KLCA 3ZNHB 1E8YA 2D3CA 1EXNA 1KRPA 4P16A 3RNEC 4QWBA 3PO5A 3VXWA 3ZO5B 5J0TA 2BT6A 1UT8A 2FMQA 5KHOA 1L7NA 1RZTA 3Q8AA 1ZQ1C 4IUMB 5T8IA 2LHDA 1RQLA 1X9MA 1ENFA 3IG3A 4ZYNA 5LLIA 3LXFA 2KWUB 4EYHB 4UAWA 2G09A 1NK0A 4JGHB 2EDUA 3TMPB 1LKYA 3PT2B 2LJ5A 2WXHA 1YQ4B 2ASDA 7ICRA 2A4ZA 3RZFA 2ZPYA 2D5GA 5ALSA 3ZVVA 2FLNA 1RRBA 2AL6A 5J2FA 2PTLA 1NI2A 3FDSA 1XT9B 4DL3A 4G50A 3PR5B 2FIDA 2WXQA 3F2DA 4CRXA 1SZPA 1DOQA 4PGQA 1JQ4A 2P35A 1NK9A 3PSPA 2MBQA 4NQKE 3Q3NC 3NASA 4MFAA 3DPDA 3WALA 2I9GA 2HHSA 4QZAA 2E8PA 1NK4A 3AUOA 2JR5A 2FLPA 2CHWA 5IA7A 4RPYA 4Y2RA 2HVHA 1CMXB 3U4EG 4RGOS 2ZNVB 3AQFA 3T9LA 1WJNA 2N7DA 3TAQA 4DBGA 2C28A 2AYOB 1UWMA 1R4NI 1GC6A 4RF0A 4KITB 5KFEA 1MFWA 9ICWA 2W04A 5IN7A 5KFLA 4YD2A 1SB3C 3R3MA 4KZ0A 4W9KA 1WM2A 1D9DA 1VZ8A 4FJVB 2AQ4A 1QSSA 2KTFA 3V72A 4OW0A 4FJYA 1N5WA 2WXRA 1WH3A 2BWFA 3E9SA 5KAFU 4F5OA 2HBJA 2KJ5A 4DCCA 1Q46A 3RBDA 1BVSA 1RXWA 3Q8LA 5AEKB 1Q10A 4QIWC 2IPKD 2ATLA 1WZ0A 1YIWA 3LJ3A 2JWUA 2JZZA 1S0NA 1GC7A 1PFDA 1LB2B 1KKXA 4FN2A 4Y2TA 5J0WA 2DKZA 1SSNA 3PO4A 3V6EB 4BOSC 2MBHA 4RQ6A 1CI4A 2JZBA 3TAPA 3HM3A 4DQOC 3B9JA 2EKEC 2MBBB 3DDCB 3ZKJC 4ANXA 2JGAA 2IOFA 5E79U 1S8OA 2ZW1A 4LLGM 3IRUA 3TI0A 1SKSA 5F9NA 2DLBA 2JEJA 1SE2A 3GILA 1V5TA 5AUKA 5CA7A 3D2SA 4NAMA 2ZIUA 4LNIA 1ROEA 3RPFC 2Z0EB 4QZIA 5BYSA 2GI9A 4A3OA 4UB6U 2WXKA 5AZGA 2MLBA 5ALZA 3LB8C 1JI7A 1C4AA 4FE3A 4NJCA 5G5GA 1J97A 3TEYA 1TE2A 4IS7A 2W11A 1SEBD 4LDTD 1SWVA 2FUHB 5CX3A 2W8LA 4RQ4A 3CRXA 4RQ2A 3OJUA 4JL9A 2ZIWA 3OLMD 2DQNB 3ICXA 3GIKA 1JW9D 2LMRA 3ETLA 4DL7A 2KK0A 4USAA 3AMZA 1JMSA 1ZQFA 4J9OA 3J81j 4EEWA 1V9JA 1N2XA 3H8MA 3V6CB 1JMLA 2LKYA 1KBUA 2J6SA 2ISOA 4GDLB 2M1MA 4KLFA 2MU2A 1WGKA 3RZWC 1X6IA 1Z4OA 5IIKA 1OXJA 1XLOA 4NLZA 4BKGA 9ICTA 5KFVA 5AZHA 2R2OA 3UXPA 4PJ0U 5KG2A 1Q1OA 3F2BA 2ZXIA 1KF6B 1L6UA 5ALDA 1FO4A 2JT4B 5IILA 2RDHA 4Q43A 2KMCA 1TFRA 1LGRA 3RN9C 2X38A 4DSFA 4B6WA 1N48A 3RJGA 2C5LC 2E8NA 2D6FC 4F93B 4ECTA 3Q8QB 5AKEA 3RCZA 4BXOB 1C3TA 3AU5A 1MVKA 3JW0X 1CEZA 2BCSA 4M02A 1T94A 2BKRB 4WJ3B 1KLVA 3UQAA 2D10A 4CGZA 3H4BA 1ZOYB 3T8MA 1QILA 2IOHA 3EPIA 3P4QB 2JXXA 2M9NA 5E6NA 1ZGUB 2KWVB 3V7KA 5JZEB 3RD2A 1L6VA 2FIFA 9ICNA 3V60A 4WJPA 4RGTA 1UNSA 3THVA 4B9KA 4ZYSA 2PFNA 3H7PA 7ICVA 5AZFA 5AHXA 3RNFC 1E6EB 5HG2A 2J53A 3HRDD 4O3MA 4F8RA 2PFPA 3MHZA 1JALA 2BGFA 3MP9A 3F53A 2A1JB 2OOBB 3EHVA 4MGYE 3VUXA 5KFGA 4DHJD 5D49A 2IGHA 1FD6A 3AU6A 2BDPA 1KM7A 5FR3A 2A3VA 2C2RA 2LWPA 3AE4B 2RDJA 3N30A 3BVGA 7ICGA 2Y0SF 4OJ5A 2BR0A 1ZJNA 2G08A 5AM0A 2B3AA 4EX6A 5AM4A 4CE6A 2I2YA 3UMCA 4P4PA 4C8KA 2W82A 2M0NA 4O5CA 5ALMA 2LASA 1XD3B 1S0MA 1XSLA 5GMVA 2QIEB 3QUBA 3VH4B 1I4HA 1KN5A 1SXTA 1P7DA 5KT7A 1BPXA 2JXTA 2KANA 2JRZA 1C20A 2ON8A 3BZKA 2WB1F 1XEEA 2F3NA 1HJPA 4UW9A 2BQUA 3P4PB 2K89A 2EMTA 3RNGC 4LCDE 3IP4B 5D94A 3FILA 1COKA 2D8CA 5AI8A 1LV5A 4F4ZA 4I27A 1KSPA 2QSDA 1XSPA 2CN1A 3SAFA 1TBEA 3ISBA 2ZIVA 3C1ZA 3TACB 4E74A 4YXDB 2GLEA 3MDCA 1T0RC 5E6PA 5G5HA 3B0AA 5DG9A 3LVVA 2O6VA 2WLBA 2WQYB 4CDGA 4P0QA 1WX8A 2FDRA 4I6LB 1QSLA 3NS1A 2KFZA 3T5KA 3I3TB 4KN7A 1M4VA 4KLUA 1E8XA 3I1YA 4DS5A 3A9JA 3BINA 1TS5A 2JPHA 4XX5A 2AQ0A 3IM1A 5E6JA 2LMCA 5KFNA 2MJ3A 1ZQSA 3N3KB 3H7IA 3Q69A 4IM3A 4IC9A 3UQBA 3OGUA 3V6HA 4QWEA 2PI4A 3ML8A 1S77D 3T3NA 1TAMA 3RFAA 1C7YA 1CJEA 3TADA 2ZCBA 2XI9A 3GZNI 9ICXA 3IXSA 1MN8A 3TANA 3FKYA 3MR2A 3WK4A 3AQEA 3PZDA 1J19A 5MPOA 2YN4A 5J2IA 1U4BA 2H3IA 2WXIA 8ICWA 1QKZA 1WG8A 4YMOA 5ALIA 2ZTCA 2IA6A 2AJQA 2KJHB 2XY6A 7ICOA 2OH2A 4J9SA 3WKAA 5L9XA 1NKEA 3WANA 4URKA 2BB5A 4XE0A 4ZHOA 3GQCA 1SV0A 3M63B 2BTEA 2IBKA 2KC2A 3PW7A 3W1YA 2JRIB 4R8UB 2N9LA 4H2AA 2PFQA 3I5JC 4UAVA 3TFRA 3JPPA 5HI1A 8ICAA 2W43A 1IV8A 2YEPF 3SMVA 4DLEA 2YQEA 5DGAA 3EGRA 3ZDCA 8ICKA 1KTKA 1E7VA 1F0ZA 3W9CB 1XC9A 4QW9A 4EX7A 4I2FA 9ICKA 4ZRQA 5KFTA 2N9EB 3E0FA 9ICPA 3JSVB 4W9EA 2R8HA 2KMMA 4F4WA 2EH9A 4RQ1A 1B22A 5ALTA 4C56C 3ZXVA 3DWGC 3UMBA 3RTVA 3RNCC 1N56A 1CUKA 3MGHA 1UELA 5AI5A 3PPAA 3OWEB 1ZETA 4GIVA 3WAOA 4ZDVA 2LRWA 2UVUA 3ZXRA 2LM1A 2WNMA 4NLNA 4JE3B 3PZ8A 4YWGG 2WTFA 1D5XC 1RYJA 1FNUA 1KFSA 1SXEA 3T79A 4Q44A 1Q0WB 2G5IB 3I76A 1JRPA 1FFUA 3V05A 3PY8A 4QIWF 4O3OA 1L7MA 1D5ZC 2Y5PA 4C4VA 1WYWB 5JUMA 1WYGA 1P0RA 2L83A 4A8XC 1MI0A 2PMVA 1ZD5A 5KFJA 3C2KA 5H92C 7ICTA 2KQ7A 3ZW3A 4JB3A 1QQ5A 1T5XD 3GIJA 3MR5A 3D6JA 1BMLC 5JHBA 1RFAA 2RRDA 1NENB 1O08A 4WWMA 4W9FA 5IKCM 5KT5A 2K8AA 2FI1A 2WXMA 1OEYA 4NAWA 2BWES 2W9BA 2XY5A 4ECQA 3O13A 4MSQB 2ASLA 5AKYA 2KK8A 3ZTDA 4IQTA 2DZIA 2IYDB 3HJEA 7ICIA 4DQSA 2MUTA 1IPGA 2V1YA 3PRZA 2K39A 4HKZE 4EZLA 1ZQQA 1ZQAA 3TKAA 2CS4A 2MWSB 3QWZB 3EFCA 4BWJA 3WAPA 3PSIA 3DOWA 5DKWA 3L3FX 1V1OA 2JVCA 5KNIA 1WMHA 3BJYA 4HLEA 3HWTA 3L13A 8ICZA 1UA0A 4S0RA 3L16A 3P63A 3ZD9A 1QLNA 4MEMA 1JROA 2NTTA 2WF7A 5GTHU 4GMVA 3RYTA 1MHXA 5AKIA 1R4MB 1EU4A 2WDRB 5BYQA 2FNJB 1FXTB 2DYMA 3CYMA 1K53A 2P6RA 3Q3OC 3KOOA 4I6NB 4M8MA 5DGBA 3I9V1 4DSLA 4ZRPA 2DAJA 3C2MA 5KT4A 2RDBC 2DGZA 1QOFA 4B9MA 2CXYA 1DOYA 2A1JA 2QB1A 4A6QA 5ALWA 2WX0A 5A0LA 4GXIA 4KKJA 4W9LA 2OWOA 3IHQB 4NV0A 1T0SC 5ALRA 3L17A 4KGTA 3TL5A 3BK1A 1NZBA 4X57B 2OM6A 7ICSA 2BGWA 1DRGA 3GZNB 3P42A 1AROP 1M6YA 2R8IA 2FBWB 1OEYJ 5IINA 3FYHA 3PSTA 2KNBA 1YNTE 1IBXB 1QLBB 2NRTA 3Q8FA 2RPVA 4I2DA 3KUDB 1NVID 1P7EA 1SKWA 2C60A 2AQ3B 5ALHA 2OXOA 3FM9A 5C2TB 1A76A 3PV8A 3QA8A 4F3OA 2XEWA 5EE9A 4RH6A 2FJ6A 5DQGA 4HVBA 3DEEA 4GDKA 4UB2A 4EOYA 3N20C 2X8XX 3RMKC 5ALEA 1YMHE 4GC6A 3SV3A 5AI9A 1JUDA 4EBCA 1SIJA 2HHQA 1I7HA 2L76A 2PJHA 2Q5WD 3DBHI 3BYTB 1AYFA 4OJ6A 3KW5B 1FIQA 4DWIA 1XS9D 4TURA 4KMOB 2K8CB 2B6GA 1VR9A 2ZVOA 2I38A 5J0UA 4J9QA 4PL2A 4DFDA 3AE6B 3N7RC 1V81A 2RDGA 3VH3B 3QEBZ 2J42A 3IAM1 2IGDA 1FRRA 2ZIVB 1V2YA 4FZLA 2BPSA 2RHFA 4DFJA 1YZ6A 4KV2A 1U47A 1WF9A 3TARA 3ZJTA 2Y3AA 1C1YB 1JWSD 3FILB 1C78A 1KQQA 4C00A 2WF5A 3D2NA 3DV9A 3PVXA 4OHJA 3U8ZA 4IWQA 2I1QA 1BT0A 2N9XA 4Y2QA 4PGYA 3IT6B 4BAXA 2JQRB 5AIBA 1SJHD 3RRHA 1C79A 1ZDXA 1DK2A 5DBCA 1UD7A 4DEZA 1ZQOA 1GNUA 2VKQA 5KFHA 2H89B 3WK6A 5J0XA 4KGRA 4REZA 3RJIA 2ZJ5A 5CRXA 4GLXA 1Z19A 4LNNA 2KVCA 3TADC 4LJXA 4PHEA 2LVPA 3W5UB 7ICNA 4AP4C 2LVOA 4ECSA 4R63A 3SAHA 2KDFB 5HR7A 1WWUA 2Y5CA 3IG8A 2XK5A 4HXDA 3W1SC 5DB8A 1K50A 3NY5A 1KRHA 3RJKA 4L2YA 2RR9A 3IV6A 3I57A 4PYZA 2PW9A 1S5LU 4BBNC 1NDDA 3NVWA 3SQIA 2Y1JA 1WJUA 2LUMA 5KFQA 1ZQRA 1RAXA 4OCZA 5TISU 3JYUA 4TSSA 3LDZE 4BX9C 7ICEA 3WKEA 2EZXA 4E0DA 3H7PB 5J0PA 2INDC 3QHTA 4HKQA 4DFMA 2BQQA 4UB8U 5AIAA 2M17A 3NJTA 3PZ7A 4L1BA 1ZQHA 4NPNA 2NPTB 1ZQUA 2HHVA 4XYCA 3A4RA 3QK0A 1JIHA 8ICEA 5AKJA 2D07B 5ALVA 1BPDA 5J2BA 3AE5B 3U30A 8ICBA 5ALOA 3V7JA 4HRSA 4IDIA 2L0TA 3WA0A 4QZHA 1ZXHA 2IJ0A 3QARA 2K6DB 4DQRA 1K1QA 4TQSA 1R4MI 2EZZA 4C8NA 4R64A 2KWDA 4RNNA 4ED1A 4C4RA 5HR6A 3H8SA 1E8WA 8ICVA 1ZQEA 3DVGX 3UMGA 4L23A 4QZDA 4G9BA 3EFUA 1L5PA 5DPRA 4MGZE 4NY8A 2QKQA 1OQQA 5AK4A 1V97A 1JX4A 2Y1IA 1J7BA 4CF3A 4JV1A 4RM8A 2BDUA 2AX5A 3PVLA 1ZPSA 2LD9A 1BNOA 3P1MA 5AKXA 5KG4A 4BOZB 1CK1A 5DDYA 3C5GA 2ZIXB 4I29A 1P7FA 2MW5A 3S6JA 1PYWD 1ZQCA 4A8EA 1Y88A 4MELA 3PSFA 3ONNA 4I2BA 4MEYA 1YX5B 4RQ5A 1ZE3D 3QQ8B 3FAHA 1K1SA 3SI8A 4IM2A 1KOTA 4DHJB 5CEHA 2XCPA 4DFKA 2BBCA 2K9XA 2K8BA 1TTNA 2V4RA 4GSWA 2LXAA 1ED1A 4ACFA 2AXTU 2W7PA 4PGXA 2DZKA 2UU7A 2K22A 2WWZA 2C2DA 5L1KA 1SL2A 2NCNA 2Y9TA 3LDAA 3QYPA 1I4GA 4LNOA 4QWCA 4WAFA 3X0WA 5CHVC 4W9CA 5AI6A 5G55A 2LI5A 5ALFA 2PKOA 2NO5A 1JXLA 2PMZC 2AGQA 1I42A 2G5HB 4ARIA 3ZJUA 2FMSA 2DBYA 3ZIMA 5ALKA 1QTMA 1FCCC 4ZOHC 3HPOA 3V6KA 3U26A 1PGBA 1Z5SB 2AQ1B 2GBJA 3UI3A 2L5YA 1YJ1A 1KFTA 3HT3A 4AS1A 4QZBA 4C8OA 2WAQC 4J9RA 2XCAA 2IO1B 1EWCA 4F7ZA 3NRZA 5JH5C 3VFKA 4Q8EA 1F5SA 3R9KA 1S0VA 3DBLI 4F2RA 1S3SG 4OZBA 2F8KA 3O0FA 3B0XA 3ENEA 3RJHA 1BUIC 1M94A 3ZNID 3ZNGC 1X2IA 4UAYA 4MGIE 1WIAA 4A90A 2V0GA 3AE8B 2LHEA 1I4RA 4TQ1A 3BK2A 3SFEB 4ED7A 4F4XA 1TAQA 1V85A 3H0MB 3K75D 3V62A 4M8NA 1BPEA 3RR7A 5LXIB 2FCNA 4OD0A 2ZJDA 3H7SA 4UBCA 2DF4B 4CCHA 4QZFA 2C7HA 4R66A 3TUOA 4F91B 4I2GA 1AWDA 1X9WA 3NG0A 2V4IB 1TS2A 4AJYB 2GRIA 1C4PA 4RZRA 1C4CA 1WX9A 2SEBD 5C0YA 3NZ3A 3H40A 1V80A 7ICFA 4CF4A 4ANVA 2VIXA 3SD7A 3PMNA 1SIFA 1XLNA 2VH1A 3PGEA 2GO7A 4J6IA 4EEKA 2NBWB 1LM8B 3U2SC 2YX8A 1DYQA 1ZQBA 2V9HA 9ICBA 3KD3A 4YSZB 3M1YA 2LFIA 3KQ4A 3TEZA 4M9GA 2V9WA 2EAMA 5J0SA 3ECIA 3AE3B 2JSVX 2BS2B 1HA5A 4YP3A 2ZCCA 4I2EA 4MDKE 4UB1A 1RYSA 2HBKA 1PVPA 4W9HA 8ICSA 4ECYA 4PK1A 2KVZA 2ZUCA 3ZDEA 8ICHA 5AI0A 3P4SB 1L4ZB 5IIJA 2KVSA 3KHGA 3RRGA 2E8MA 2MSNA 4J3OD 3LYYA 1YN4A 1IYFA 4TMAB 1T6BX 3IDWA 3M8RA 2KD0A 4FBUA 2XBBC 2FE9A 1PK3A 3C23A 1KJTA 3VQIA 2W8KA 1HTOA 4GGQA 5I4DA 4HWIB 2O6KA 4BUGA 2DZJA 3U7ZA 5C3JB 1TZ1A 5F3XB 9ICSA 3ETRA 3KZXA 1ET6A 2N1VA 4OJPA 2WXPA 3QU7A 4F71A 1C76A 5BO4B 4YR2A 8ICNA 1L0YB 4YCXA 3KWVA 2LM4A 2JZPA 4WAAA 3X23A 5KG0A 1ZQIA 3QUQA 3AN1A 1D8BA 1CRXA 3V6JA 3PR4A 1HXYD 2MJEA 3CWIA 1T3NA 4CF5A 4NLGA 1WM3A 3QJZA 3ZDTA 3NGDA 3CIRB 4W9JA 1QQ6A 1LFDA 1T0QC 2XN9C 2PIAA 4ECZA 4MSMB 3B2FA 3QU4A 2KNJA 5J29A 2K60A 3Q8PB 1JWMD 2K0PA 5EE1A 3A0BU 3TFSA 4IQVA 5AKHA 4NL9C 2FMPA 4OVVA 1J7CA 1UT5A 3PW4A 2ZW0A 5KG1A 4F72A 5J2JA 3RI7C 5IIMA 3TSSA 2WXLA 2L32A 2KJ6A 1RDFA 4ELTA 1YQ3B 2KOBA 4GB9A 4KLSA 5BOLA 3OJ3A 1DOXA 3UGBB 2KO3A 3UXNA 1G6JA 2MH7A 2WHEA 2LPEA 1B1ZA 3EC8A 9ICFA 4PH5A 2ZXHA 2YB4A 2RD0A 1DGJA 1ECWA 2WXJA 1WE7A 2NRXA 1QSYA 1WGRA 5KFPA 4IOIE 2HMXA 5KFKA 3W5VB 4FBJB 4FHJA 1IUEA 4YFKA 2MCNB 1CQVA 5EWEA 3A1QB 2KN4A 2KV2A 4DHZB 1E10A 2XIDA 3VUYA 1BPBA 4DOBA 2KKCA 5J0OA 1VD2A 1J2NA 3CP8A 1PK1A 2KZ3A 3RB0A 3RB6A 1SL1A 5DQIA 4P4OA 3GIMA 4TKNA 4NY0A 4DHZE 3ZJVA 2N7JA 1WI0A 4M01A 2AGPA 3VC8A 9ICVA 4GLSC 3RH6A 3C1YA 1Q5WB 1FXAA 1NOMA 1ZOLA 3EWAA 4BGDA 1JWBD 5H2FU 4AUQC 3H4DA 4NNJB 1GAQB 1RLFA 1SWWA 8ICRA 3GV8B 2JRHA 4EE2A 1AQ6A 3AE9B 3GZFA 3M9MB 2M19A 3VDZA 1SE9A 3WCQA 4AP9A 3PRPB 4NZLB 4N58A 5CP2A 2I6XA 4J9MA 4DOAA 4FJZA 3VUWA 2W9BB 3U52E 2BCVA 3ABVB 5J2DA 1MHHE 1NBFC 2DNFA 4BKTA 1RYUA 1UUPA 1KL9A 2KJ8A 3M95A 3EA6A 4JWMA 3DHGC 4XZ4A 1FMAD 2A19A 4NJ8A 4PHPA 3PW0A 4U7CA 3IN5A 4B9LA 1C9FA 4DSKA 1VZ7A 2ZIXA 3Q8KA 3AECB 1MJDA 1UCVA 4ASWC 3RH4A 3QU2A 1DOIA 5DCNA 1CZPA 1L8LA 2F8LA 2K4HA 4GXJA 1OQRA 4JX1C 1TKYA 2KDMA 2M0AA 3PX0A 3APDA 2CKHB 4XUSA
chains in the Genus database with same CATH topology
3SR6A 1STEA 2WXFA 2W54A 4WQMA 4JWUC 4A9AA 3KLSX 4HKZE 2HTME 4ITKA 1YJIA 1V1OA 4HROA 4CQNA 3Q8BA 1F77A 2FUG1 3BWUD 2HDEA 3TEWA 3NVVA 2QILA 1TYGB 3P63A 3R2IA 1JROA 1HQRD 2NTTA 1MHXA 2K3UA 1EU4A 2WDRB 5BYQA 1KLUD 4Q2JA 2DYMA 1C77A 1K53A 2G9HD 5JXVA 1TKGA 1XLPA 3I9V1 4C7ZA 1YN3A 4ZRPA 1QOFA 1DOYA 1RFKA 2TSSA 2QEJC 2FE8A 4A6QA 1FXIA 2M56B 2WP9B 3ZQ4A 3H8HA 1N60A 1E9MA 4MM3B 4RCOA 4KKJA 3B2GA 5BMHA 2BB6A 2CJOA 4KGTA 2OEDA 3BK1A 4C80A 3P42A 1FFVA 2FBWB 3HVDA 1IBXB 1YNTE 4OVZA 1KH0A 5TSSA 3VRBB 1ZDVA 1QLBB 2ICIA 4N6EB 4M0WA 2J4XA 3Q8FA 2RPVA 3AE7B 1PUTA 3AEDB 1NVID 1P7EA 3ZJVA 2AQ3B 3ZGZA 1XLQA 1PDXA 1F2RC 5C2TB 2BS3B 5BMGA 5EE9A 4RH6A 1XCTL 1V1PA 2W3SA 1KLGD 5GXGB 5LNK1 2VZKD 4DXFA 3AEGB 4RF1A 4YSYB 5BMIA 1TY2A 3C8YA 1YMHE 1SIJA 1I7HA 1FNWA 2Q5WD 1SE3A 3BZDB 3BYTB 4RFBA 1AYFA 2XNAC 1FIQA 1N63A 1QOGA 3Q8CA 1E0ZA 1FRDA 1UGJA 2KAJA 1VR9A 5FKAC 2I38A 3AM9A 3FC4A 3AE6B 3L4PA 2IDYA 4P16A 3VRAB 2RDGA 2J42A 3IAM1 2BT6A 1FRRA 2IGDA 4MH8A 3URYA 3NUHB 3Q8AA 5T8IA 2WXNA 2WS3B 3ZJTA 1T3QA 3HVZA 2LHDA 4US8A 1ENFA 1JWSD 2Y3AA 3J9CA 3FILB 2QJLA 1C78A 3LXFA 4GDKB 4OHJA 2PVOD 1V1PB 3IT6B 2WXHA 1YQ4B 1Y56A 2JQRB 1SJHD 3AEAB 1C79A 1ZDXA 3BYYB 4DXGA 2D5GA 2H89B 2PTLA 4KGRA 2MJDA 4REZA 2YEPB 2WXQA 3AEBB 2PVGC 2WU2B 1SJED 2CJNA 1JQ4A 3W5UB 1SBBB 2V3NA 2Y5CA 1K50A 3BIID 1KRHA 4L2YA 2E6XA 3AEEB 1ACCA 4YTNB 5H8YE 2V3PA 3U4EG 3I57A 1HZ5A 2PW9A 4KKIA 4RGOS 1EM7A 1VLBA 3NVWA 1D6EC 1TZOA 2LUMA 4HJGE 1TJEA 1TS4A 1UWMA 4IKGA 4RF0A 2W3RA 4TSSA 2RMMA 1FNVA 1SB3C 4HKQA 4R3DA 3BVZA 3PZ7A 4L1BA 1NYRA 4MT5A 1JWAD 1VZ8A 1GOZA 3EUB2 4OW0A 1VZ6A 2WXGA 1N5WA 2WXRA 3AE5B 3E9SA 4IDIA 4HRSA 1ZXHA 2IJ0A 2JX5A 4B0EA 2KACA 4RGNA 2KWDA 1D4BA 3PO0A 1Q10A 2IPKD 2JWUA 1PFDA 4L23A 1L5PA 1MPEA 1SSNA 3AB5A 1OQQA 1V97A 1J7BA 1WWTA 1JWUD 2AX5A 1ZUD2 4DQOC 3B9JA 2N0SB 1ZPSA 3IAS1 2ZW1A 4LLGM 2WU5B 3P1MA 2ACZB 1CK1A 1P7FA 1TY0A 2DLBA 2GB1A 1PYWD 1SE2A 5AUKA 1GB4A 4NAMA 1ROEA 1YN5A 2L52A 2OHFA 3RPFC 4B0MA 2GI9A 5BYSA 1ZE3D 2G1EA 4PT5A 3FAHA 2WXKA 3LB8C 1C4AA 1N5XA 4NJCA 2BBCA 5G5GA 2K9XA 3TEYA 2PLPA 1SEBD 4OZAA 2K22A 1ESFA 1XCQL 2CU3A 1QF6A 1I4GA 4WAFA 2LGIA 1VRAB 1NEKB 1JW9D 1KFYB 2PKOA 4O1NA 4USAA 3AMZA 3Q8EA 4ARIA 3ZJUA 2DBYA 1NI3A 4US9A 1JMLA 1FCCC 4ZOHC 1PGBA 4FXCA 3UI3A 2AQ1B 1IBXA 4GDLB 1WGKA 1XLOA 4AS1A 1EU3A 1E7PB 2NTSA 1EWCA 1KF6B 1L6UA 3RFZB 1FO4A 2NMQA 3NRZA 4XDDA 2LJIA 1XO3A 2RDHA 2JYTA 4A55A 2WDVB 2X38A 1F2RI 4OZCA 4OZBA 4WIPA 1BUIC 4XDCA 4JPSA 2Z8LA 2V0GA 4A90A 3AE8B 2LHEA 1I4RA 4TQ1A 4WH4A 4XWTA 1MVKA 2EELA 3BK2A 3E56A 3SFEB 3AH7A 1ZOYB 1QILA 3P4QB 1ZXIA 3TUOA 1RM6C 1AWDA 1FEHA 1L6VA 1TS2A 2V4IB 5FK9C 2GRIA 1C4PA 1C4CA 2EKIA 2SEBD 3NZ3A 1UNSA 4RGTA 1SE4A 4ZYSA 1E6EB 5HG2A 2J53A 1XLNA 3HRDD 2W55A 3MHZA 1JALA 1V8CA 1QT9A 3MP9A 3U2SC 1DYQA 4YSZB 1BXTA 1QOBA 1L0VB 2LFIA 3KQ4A 3TEZA 1RWSA 2IGHA 4NAWB 1FD6A 3AE3B 1WSPA 2JSVX 3AE4B 2BS2B 1HA5A 1ZP0B 3BVGA 3GB1A 4XWWA 2LEKA 1IGDA 2I2YA 1HZ6A 2W82A 3AE1B 4LTUA 3T3OA 2QIEB 1L4ZB 3P4SB 1I4HA 1OFFA 1SXTA 2JXTA 4RGMA 1XF5L 4N59A 1TKEA 4UDUC 4J3OD 1A70A 2ON8A 3LYYA 1YN4A 5BYRA 4YSXB 1L4DB 4TMAB 1T6BX 1JCKB 1XEEA 1AW7A 1I4QA 3VQIA 5I4DA 3P4PB 4MACA 3U7ZA 5C3JB 3FILA 1B9RA 3ETRA 3SFDB 1ET6A 2INNE 2WXPA 2QSDA 1XXGA 1C76A 3AE2B 1L0YB 4LK0M 2WXOA 3KWVA 4YXDB 1GB1A 1VJKA 2JZPA 2ONQA 3VR9B 5G5HA 2VZKB 2H88B 3AN1A 2WLBA 2WQYB 2BYTA 1HXYD 2MJEA 3CWIA 2INPE 4TQ0A 4JWSC 3V3XA 3NS1A 1LO5D 1M4VA 3DWMA 3CIRB 2BW2A 1WXQA 2MEKA 1TS5A 2XN9C 2PIAA 1WRIA 5EE0A 5E6JA 3B2FA 3AEFB 2LMCA 2MJ3A 3Q69A 4HEA1 3KWLA 3T3NA 1UWXA 4AQ7A 3HUIA 1CJEA 1JWMD 4ZHPA 2K0PA 1NYQA 1FCLA 5HFYA 4C7YA 2BS4B 2IGGA 4RNAA 5EE1A 3IXSA 1HEZE 1EWYC 2E3TA 1J7CA 1YJJA 1VDVA 2ZW0A 5MPOA 2DYOA 4ARCA 3TSSA 2WXLA 2WXIA 2L32A 1QKZA 3NVZA 2R61A 2KQ4X 1YQ3B 1DOXA 3GS2A 1SF0A 3IT4B 2MH7A 3MFGA 4KGSA 1B1ZA 2BB5A 1I4PA 4XE0A 4YT0B 4YTMB 4ZHOA 1D5MC 1DGJA 1FM0D 1R7SA 2AQ2B 2QMTA 2WXJA 2BTEA 4IOIE 1IGCA 3W5VB 1L0XB 1PGAA 5D3IB 2SAKA 1IUEA 4H2AA 1CQVA 2N9LA 2B76B 1K51A 2KN4A 1QOAA 4KX6B 1E10A 1TS3A 3TEXA 3AV8A 1GPXA 5HI1A 2L1AA 2YEPF 3EGRA 1KTKA 1QQRA 1I4XA 1F0ZA 3W9CB 1PGXA 2N7JA 4D2KA 4ZRQA 2JYEA 3SEBA 1J7AA 1N61A 2KMMA 4GLSC 5D3DA 2DWQA 4WURA 1ET9A 4C56C 3R8BA 1FXAA 2WDQB 1JWBD 1K52A 3DWGC 5D7GA 3N9YC 1AN8A 1GAQB 3BVMA 3GP7A 3ZYYX 3OWEB 1N62A 4EE2A 3AE9B 3MC0B 2M19A 3WCQA 2WNMA 4JE3B 3PZ8A 4N58A 4NZLB 4YWGG 1D5XC 1RYJA 1FNUA 5HHDG 3W2DA 3U52E 3ABVB 1JRPA 1MHHE 1FFUA 5AUIA 3V05A 3MJ5A 1UUPA 2K5PA 3EA6A 3VR8B 1D5ZC 2Y5PA 3W1SA 1FMAD 2N9KA 1WYGA 2L83A 4A8XC 5FR3A 1MI0A 3P4RB 4YTPB 3NVYA 2PMVA 1C9FA 2J52A 2JU6X 5H92C 1VZ7A 4P6VF 3AECB 1T5XD 3R2TA 1BMLC 1DOIA 5EE3A 1NENB 1CZPA 1OQRA 4JX1C 4WWMA 1TKYA 2WXMA 2KDMA 2M0AA 3O13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR6 A;  4US9 A;  1NI3 A;  2JQR B;  3DWM A;  3AEA B;  3CIR B;  4ZOH C;  4FXC A;  1WXQ A;  2W54 A;  4WQM A;  4JWU C;  2H89 B;  1WGK A;  1XLO A;  4A9A A;  2PIA A;  2MJD A;  1WRI A;  5EE0 A;  3B2F A;  3AEF B;  1E7P B;  3AEB B;  2MJ3 A;  2PVG C;  2WU2 B;  2HTM E;  2CJN A;  4ITK A;  1YJI A;  4HRO A;  3W5U B;  1JQ4 A;  3KWL A;  1KF6 B;  1L6U A;  1FO4 A;  1CJE A;  3HUI A;  3NRZ A;  4ZHP A;  1NYQ A;  1XO3 A;  4C7Y A;  2BS4 B;  5EE1 A;  2Y5C A;  1EWY C;  2WDV B;  2E3T A;  1J7C A;  3NVV A;  1YJJ A;  1VDV A;  1KRH A;  1TYG B;  3BII D;  3P63 A;  3AEE B;  5MPO A;  1JRO A;  4YTN B;  5H8Y E;  3NVZ A;  2WDR B;  3AE8 B;  1VLB A;  3NVW A;  1YQ3 B;  3SFE B;  3AH7 A;  1TJE A;  1UWM A;  1DOX A;  1TKG A;  1XLP A;  4C7Z A;  1ZOY B;  2W3R A;  1SF0 A;  2MH7 A;  3P4Q B;  1QOF A;  4YTM B;  4ZHO A;  4YT0 B;  1ZXI A;  1DOY A;  1FM0 D;  1DGJ A;  1R7S A;  1RFK A;  1SB3 C;  1RM6 C;  1AWD A;  3W5V B;  1L6V A;  1FXI A;  1IUE A;  1NYR A;  1JWA D;  2EKI A;  2M56 B;  2B76 B;  2WP9 B;  1N60 A;  1E9M A;  1QOA A;  4KX6 B;  1E10 A;  3B2G A;  3EUB 2;  1E6E B;  3AV8 A;  1GPX A;  2CJO A;  1XLN A;  1N5W A;  3AE5 B;  3HRD D;  2W55 A;  4C80 A;  4IDI A;  1JAL A;  1V8C A;  1QT9 A;  1FFV A;  4HRS A;  2FBW B;  2JX5 A;  1F0Z A;  3W9C B;  3VRB B;  4YSZ B;  1QOB A;  1L0V B;  1QLB B;  3PO0 A;  1J7A A;  1RWS A;  1N61 A;  4N6E B;  2KMM A;  3AE7 B;  2DWQ A;  1PUT A;  3AED B;  3AE3 B;  1NVI D;  1PFD A;  3AE4 B;  2BS2 B;  1ZP0 B;  1XLQ A;  1L5P A;  1PDX A;  1FXA A;  2LEK A;  5C2T B;  2WDQ B;  2BS3 B;  1JWB D;  3AB5 A;  3DWG C;  5EE9 A;  1OQQ A;  1V97 A;  2W3S A;  1J7B A;  1GAQ B;  1WWT A;  5GXG B;  3AE1 B;  4LTU A;  3AEG B;  2AX5 A;  3ZYY X;  1ZUD 2;  3B9J A;  2N0S B;  4YSY B;  1N62 A;  2QIE B;  3P4S B;  3AE9 B;  1OFF A;  2WU5 B;  3P1M A;  4N59 A;  2M19 A;  1TKE A;  2ACZ B;  3WCQ A;  1A70 A;  1SIJ A;  1I7H A;  4N58 A;  4YSX B;  2Q5W D;  1AYF A;  1RYJ A;  5AUK A;  1FIQ A;  1N63 A;  1ROE A;  2L52 A;  3RPF C;  1QOG A;  2OHF A;  3ABV B;  1E0Z A;  1FRD A;  1JRP A;  2G1E A;  1FFU A;  3FAH A;  2KAJ A;  3LB8 C;  3P4P B;  5AUI A;  3AM9 A;  3FC4 A;  5C3J B;  2K5P A;  1N5X A;  3AE6 B;  5G5G A;  2K9X A;  3L4P A;  3VR8 B;  3ETR A;  1B9R A;  3SFD B;  3VRA B;  1FMA D;  1WYG A;  2L83 A;  2BT6 A;  1FRR A;  3AE2 B;  3P4R B;  2K22 A;  4YTP B;  3NVY A;  4YXD B;  1VJK A;  5H92 C;  2CU3 A;  2WS3 B;  1QF6 A;  4P6V F;  5G5H A;  3AEC B;  3VR9 B;  1T3Q A;  3HVZ A;  4US8 A;  2H88 B;  3AN1 A;  1DOI A;  2QJL A;  2WLB A;  2WQY B;  1NEK B;  1JW9 D;  1KFY B;  2PKO A;  3LXF A;  5EE3 A;  1NEN B;  2MJE A;  1CZP A;  1OQR A;  3CWI A;  4JX1 C;  4WWM A;  4USA A;  1TKY A;  3AMZ A;  4JWS C;  2PVO D;  3NS1 A;  1YQ4 B;  2DBY A; 
#chains in the Genus database with same CATH topology
 3CSF A;  1MC8 A;  4MHV A;  2KHQ A;  3M62 B;  2J0J A;  3N1X C;  2KIW A;  3O65 B;  4DSI A;  2NVU I;  5IIO A;  2WXF A;  3IVF A;  2KX0 A;  2D3G A;  5BOM A;  4KLJ A;  2GBR A;  3EYZ A;  4DOC A;  2WFA A;  4R65 A;  3QZ7 A;  2BKF A;  2HTM E;  1UQV A;  4ITK A;  2N4F A;  4HRO A;  1NKB A;  4GC7 A;  2DZM A;  4O9M A;  3Q8B A;  4CQN A;  2GOL A;  2PMZ F;  4K3B A;  2FUG 1;  4YQW A;  3BWU D;  1XSN A;  4E3C A;  3ZNZ B;  2G4D B;  1GG3 A;  3TEW A;  2L8J A;  1TYG B;  3R2I A;  4EEL A;  4LNF A;  4P2H A;  3H0R B;  2KN5 A;  4K4I A;  2IHM A;  1E5W A;  2K3U A;  1KLU D;  4M6W B;  2KTR A;  1C77 A;  2DAF A;  3RNB C;  1F52 A;  2B0C A;  4DO9 A;  4HPL B;  1OW5 A;  4RM9 A;  1EF5 A;  3R7R A;  5CR0 A;  2BQR A;  4IC7 B;  1WXV A;  1SZH A;  3SDL C;  2TSS A;  2XIC A;  2FE8 A;  2QC8 A;  2AEH A;  2HD5 B;  2L7R A;  5AK5 A;  2ASQ A;  1E9M A;  5BMH A;  3B2G A;  2BYE A;  8ICL A;  5J2E A;  9ICU A;  3DVN V;  2K6Q A;  4KLO A;  3Q8R B;  2BHN A;  1L3S A;  4ED6 A;  4M47 A;  1L3T A;  4OVZ A;  4KLQ A;  2KDE B;  2Y0S C;  2YB1 A;  2KIV A;  2L3Z A;  2J4X A;  5KT2 A;  1PUT A;  3AED B;  2G07 A;  3GV7 B;  5J2K A;  3EW9 A;  1MQ2 A;  3UXO A;  3F5E A;  1Q3U A;  1F2R C;  1ZQN A;  1WGY A;  2F1I A;  5B5E U;  2V4Q A;  2EQY A;  1LKY B;  2W3S A;  1XCT L;  1KLG D;  7ICP A;  3DBH B;  1JRU A;  4PHD A;  3HP6 A;  4RF1 A;  3HIL A;  2KZM A;  4DXF A;  1HUO A;  4NJ6 A;  3IG5 A;  4QZC A;  4HAI A;  2BCR A;  8ICJ A;  1IM4 A;  3V7L A;  2HJ8 A;  1SE3 A;  2J0K A;  5KHQ A;  2KD1 A;  3QU9 A;  5KFA A;  3LWL A;  1N63 A;  4KDI C;  1SV4 A;  4KIK A;  4RQN A;  1QOG A;  1KLN A;  4QAY A;  4W9I A;  3OG5 A;  2N7E A;  2HOQ A;  5KFX A;  1ZD4 A;  3AM9 A;  1U49 A;  5T14 A;  3R66 C;  3KZI U;  3L4P A;  2IDY A;  2MP2 A;  1F44 A;  3G6V A;  3ZRC A;  2MAX A;  4PYU A;  4DXA B;  2HVI A;  3B0Y A;  4MH8 A;  2UVV A;  1FEZ A;  3M8S A;  2HBL A;  4OJL A;  3M9O B;  2WXN A;  4IWO A;  4A20 A;  2JHD A;  2J0M A;  2WS3 B;  4NLB A;  1RQN A;  4P0P A;  1WZ3 A;  4RT3 A;  3RF9 A;  2PEA A;  3UPQ A;  8ICI A;  3ED5 A;  1MG4 A;  4GDK B;  3VTU A;  4WWP A;  1Z3E B;  3WK5 A;  4HK2 A;  3RUI B;  2VJ4 A;  1SXD A;  2F2A B;  3AEA B;  5CTR C;  1O03 A;  3M6Z A;  3MR6 A;  2KFN A;  1DK3 A;  9ICI A;  2QAR B;  5L83 A;  3KYC D;  4IR9 A;  2LXC A;  5J0Y A;  3AEB B;  2GMI C;  4P7I A;  4F4K A;  3ZI4 A;  1SJE D;  2CJN A;  1U48 A;  5AKG A;  4O3S A;  5KTQ A;  3E2E A;  1SBB B;  3APF A;  3IFW B;  4K81 A;  1HTQ A;  4O5E A;  3OTQ A;  4K4G A;  2HHX A;  2QLT A;  4ICV A;  4QJF B;  4AJW A;  3TCA A;  3BII D;  5B66 U;  3N7P D;  2E6X A;  5JHA A;  5H8Y E;  4YG2 A;  3BQ0 A;  2C9W B;  4ZRK A;  5IAA C;  2WF9 A;  3N28 A;  5KFC A;  4O0I A;  3F2C A;  2FCS A;  4KKI A;  4F92 B;  4KDL B;  2CPR A;  2ALZ A;  4MJS A;  1TZO A;  1D6E C;  3MHS D;  4HJG E;  4XC2 A;  1TJE A;  1TS4 A;  3AL0 B;  3PX4 A;  3RBE A;  4WJO A;  4IKG A;  1NK7 A;  2W3R A;  4UAU A;  2JZ3 B;  4FBT A;  1J0G A;  2RMM A;  2JEG A;  3SEI A;  1TGZ B;  8ICT A;  4GXK A;  1Z00 B;  1FNV A;  4F2S A;  2V4L A;  2FPM A;  2HJ1 A;  4IW0 A;  5AKZ A;  4MT5 A;  4C0Z A;  4EZ6 A;  3EUB 2;  1MSW D;  2GBN A;  2QB0 B;  2IO3 B;  3AU2 A;  1H38 A;  1F1H A;  4Y2U A;  4Y2V A;  4J9P A;  5AM2 A;  4M04 A;  4NLC A;  5JU5 A;  2D3A A;  2KAC A;  3PW2 A;  4K3C A;  3Q8S B;  1ZQP A;  1IP9 A;  1D4B A;  4YXM A;  4F5R A;  5J2C A;  4S17 A;  4UBB A;  3Q6B A;  2MUT B;  4EFO A;  4YR0 A;  4XRH A;  5J2A A;  1MPE A;  2E1F A;  3NRW A;  4P0P B;  3WK7 A;  4QZ8 A;  2KHV A;  2K8H A;  2VA8 A;  1WWT A;  4GXB A;  1ZUD 2;  5J8Y C;  5III A;  3KHL A;  2HCF A;  3ONS A;  2H5X A;  3IAS 1;  5DPT A;  2WU5 B;  3BS5 A;  4EYI B;  3NHE B;  1T7P A;  2GB1 A;  4HJK A;  8ICP A;  4RQ7 A;  1GB4 A;  1RG6 A;  4G3X B;  1ZD2 P;  2MRP A;  2LBO A;  4KIK B;  1YN5 A;  2L52 A;  4B0M A;  4TV3 A;  5KFU A;  4PT5 A;  3ZDD A;  1S97 A;  1ZQY A;  4MEX A;  4TUU A;  2MBE A;  4LVS A;  4NL9 A;  5DPW A;  2JUO A;  2KMD A;  4RQM A;  3RAQ A;  4OZA A;  1J8C A;  1XCQ L;  2BF8 B;  5FR6 A;  1QF6 A;  2JH1 A;  8ICY A;  2WAQ F;  4WWO A;  1WGG A;  4I2A A;  1VRA B;  1NEK B;  2AH5 A;  3JPS A;  2R18 A;  1A6S A;  3TIX A;  5DG8 A;  3Q8E A;  4I2H A;  1NI3 A;  3GDX A;  4ED8 A;  1ZQD A;  2KFK B;  2MP2 B;  1PZN A;  4FXC A;  4KSL C;  3CNH A;  2BPF A;  1IIP A;  1UF0 A;  2IZV B;  1X66 A;  4U6P A;  5EOZ A;  2HE7 A;  1TIF A;  1OUQ A;  1NK5 A;  2NTS A;  7ICQ A;  1V49 A;  3C29 A;  3PLV A;  2FLL A;  1ZKH A;  3N97 B;  3H0L B;  3RFZ B;  2NMQ A;  4XDD A;  2ZTD A;  1XO3 A;  2KT7 A;  2JYT A;  2KKV A;  4A55 A;  1Q8K A;  2FPK A;  2WDV B;  1D9F A;  2AWT A;  1TT5 B;  1AAR A;  5C1Z A;  4YL8 A;  1BPZ A;  3RJJ A;  2QDF A;  4Q8F A;  4XWT A;  1UZX B;  4M6W A;  2HI0 A;  4ED3 A;  2EEL A;  1B0X A;  4I2I A;  1X42 A;  5KFO A;  5DBA A;  1R4N B;  2V3S A;  1RM6 C;  1FEH A;  9ICA A;  4LJP B;  3RT3 B;  1SE4 A;  5FP0 A;  3GV5 B;  4EUT A;  4TUP A;  1V9P A;  1U9L A;  2HBM A;  2W55 A;  3MAB A;  4N9F 4;  4MGK E;  3EEC A;  4UB3 A;  4M2Y A;  1QT9 A;  2IO2 B;  3Q3J A;  3BZC A;  2RQ5 A;  1L0V B;  1QOB A;  3PRE A;  2G06 A;  1RWS A;  4Y2J A;  3KUZ A;  1L7O A;  2ZJA A;  4IL6 U;  1XNS A;  3UQ0 A;  4NAW B;  3I63 C;  1L8O A;  1WSP A;  2KTR B;  3GB1 A;  2ES6 A;  3N1Y C;  4O3Q A;  2LEK A;  3PX6 A;  3LVW A;  4TUQ A;  3DBR B;  3H1U A;  2BYF A;  2L05 A;  1HZ6 A;  4OVU A;  3AE1 B;  2QCZ A;  4LTU A;  4P0Q B;  3N32 A;  1H8C A;  4UAR A;  3ISC A;  3T5J A;  2JH7 A;  2O6V B;  2XO7 A;  1HE8 A;  2KOX A;  4RGM A;  1XF5 L;  4N59 A;  4C4V B;  1TKE A;  1A70 A;  5BYR A;  4B6J A;  3HHM A;  2EAO A;  5KL8 B;  9ICQ A;  4BBN F;  1JCK B;  1UGM A;  5BPC A;  3TBL D;  4UB5 A;  2YVC A;  4MAC A;  5CWR A;  4DL2 A;  1WJ6 A;  3SV4 A;  2KZR A;  1K8R B;  3LK9 A;  4DQP A;  3JPN A;  1L5U A;  1XXG A;  3PLU A;  3BY4 B;  4YMN A;  1V86 A;  2LGY A;  2WXO A;  1GB1 A;  4BFR A;  5IO9 A;  2YTU A;  2ONQ A;  4ECR A;  5J0R A;  3NZS A;  1ZW7 A;  2L00 B;  4DLG A;  2BYT A;  5DQH A;  2MRL A;  3H8J A;  4B9V A;  2VAN A;  3QX1 A;  4IRD A;  2AU0 A;  2NRV A;  5KFZ A;  5KG6 A;  1V5O A;  4TQ0 A;  4LDT B;  4JWS C;  3V3X A;  1P1A A;  3PML A;  4PZN A;  1V38 A;  1LO5 D;  3DWM A;  3AXC A;  2BW2 A;  1KEJ A;  5KFW A;  1WXQ A;  4ECW A;  2MA1 A;  5J2G A;  1H4R A;  4IM0 A;  1WRI A;  5EE0 A;  2OJR A;  2M0X A;  3AEF B;  4AWJ A;  1MA7 A;  4QWD A;  2R2Q A;  1Z1B A;  3QXG A;  4UQG A;  4RPZ A;  1NKC A;  2W9C A;  3KWL A;  3QUT A;  1UWX A;  2FCQ A;  2C22 A;  3N4M B;  3JPR A;  2PXI A;  4EEN A;  4C7Y A;  3G6Y A;  4BWM A;  2IGG A;  4RNA A;  5HFY A;  1ZQM A;  1MQ3 A;  5L1I A;  1GJZ A;  2BQ3 A;  1NJW A;  3DBL B;  2IMW P;  3LWM A;  5CHW A;  2NS5 A;  4ARC A;  5TR5 A;  8ICX A;  2H3Q A;  3NVZ A;  2N1W A;  2EZY A;  4LZG A;  5ALG A;  2KQ4 X;  3UQ2 A;  2AL3 A;  3L5K A;  2NRZ A;  2KDB A;  3KFU F;  4O3R A;  2P6U A;  1L7P A;  3C28 A;  3MFG A;  4KGS A;  4KMU A;  2WX1 A;  3L08 A;  1WUD A;  4YTM B;  3GII A;  2I1K A;  2JEI A;  1B4F A;  2AQ2 B;  4YD1 A;  2QMT A;  2KHW B;  1GUA B;  1IGC A;  4ANW A;  4BXO A;  1PGA A;  4J9K A;  3BS7 A;  1PK1 B;  5L1M A;  2SAK A;  4G0N B;  5D3I B;  1K51 A;  4KX6 B;  2H3F A;  5AKL A;  1WR6 E;  1ZD3 A;  3TEX A;  1B43 A;  4M0A A;  9ICR A;  3DDH A;  1L3V A;  2L1A A;  4DWF A;  5KT3 A;  2W03 A;  1Z2M A;  4KLT A;  1WR1 A;  4ELV A;  1PGX A;  2LGD A;  2GBK A;  3SZ2 A;  4RQ8 A;  2PE6 B;  3JPQ A;  1N61 A;  3RB4 A;  2DEN B;  4ECU A;  3AUL A;  4GIB A;  3I28 A;  2DWQ A;  4WUR A;  5E6O A;  4EKU A;  2RDI A;  4K4H A;  5J8Y A;  5AK6 A;  2WDQ B;  1K52 A;  5D7G A;  4UAZ A;  4DL6 A;  1YX6 B;  3Q3F A;  4Z6E A;  1Z1V A;  2W7O A;  4M9J A;  5AM1 A;  3MC0 B;  1OTR B;  4BKS D;  4TUS A;  2WGS A;  3WKB A;  3OPX A;  3W2D A;  4Y2P A;  1YZ7 A;  1OQY A;  2ZPN A;  4NQL B;  1P9D U;  4HPM B;  4KN4 A;  1ZQK A;  1KDH A;  2XY7 A;  3JPT A;  2MHJ A;  4F50 A;  4JV0 A;  2PE9 A;  2HOI A;  4EZ9 A;  2D11 A;  3NVY A;  3ZD8 A;  4DDI D;  3GE3 C;  1HUZ A;  2REX A;  2EMS A;  4P6V F;  3MC8 A;  1BNP A;  4KLL A;  4RU9 A;  3G6X A;  2K25 A;  4DL5 A;  1UHU A;  5EE3 A;  2B21 A;  3KH0 A;  8ICF A;  4RQ3 A;  2JZB B;  4B9S A;  2F77 X;  2KYW A;  5F9L A;  5CB1 A;  1NK6 A;  2KQS A;  1STE A;  5HNK A;  2BKE A;  4EZK A;  5HHH A;  3VTW A;  4PL1 A;  4UAS A;  3B08 A;  5ALP A;  4A9A A;  1PVQ A;  4LJO B;  2KFJ A;  4DF4 A;  1TK8 A;  1DGS A;  5GTI U;  5DLG A;  2BPC A;  5KAI U;  4CYE A;  1VCB A;  2QHO A;  2ZUD A;  2ASJ A;  3D2Q A;  2DPJ A;  2HDE A;  2FAZ A;  3NVV A;  2QIL A;  5L95 C;  3HKZ C;  1HQR D;  2BYV E;  2NO4 A;  1P98 A;  4C4T A;  3KVF B;  2NBU A;  4O3P A;  3MBY A;  1OGW A;  5J18 A;  2ZTE A;  3RAX A;  3L54 A;  3ORY A;  2KVR A;  2G9H D;  5JXV A;  1KTQ A;  1TKG A;  1XLP A;  4QWA A;  1YT3 A;  4ED0 A;  3GU3 A;  7ICH A;  1RFK A;  2BVC A;  3CW2 C;  2CRX A;  3Q8M A;  1NNL A;  1A0P A;  1KW4 A;  4MF8 A;  1LVH A;  2JEF A;  2JF5 A;  2M56 B;  4II2 B;  2WYQ A;  1N60 A;  3KKA A;  5ALY A;  4MM3 B;  4YXJ A;  2BB6 A;  4ZRI A;  4XQ8 A;  2OED A;  1TK5 A;  3WKC A;  4E71 A;  4HPP A;  4B9T A;  1U45 A;  3MFI A;  1LQB A;  4C80 A;  5J17 A;  5KFD A;  1FFV A;  3C5F A;  3HVD A;  1I35 A;  3QCA A;  4BZA A;  2KTQ A;  1KH0 A;  5KFM A;  3C21 A;  1ZDV A;  3N1Z C;  4RQ0 A;  2IO0 B;  3QU5 A;  2W9M A;  4RT2 A;  2ICI A;  4JMU A;  5ALQ A;  2LGX A;  1D8L A;  1EF1 A;  2K4I A;  4RNM A;  3RH5 A;  4Y2Y A;  2GLS A;  4Z6F A;  4K1R B;  4P1C C;  4ANU A;  1HIW A;  3OHA A;  1T8E A;  2PI5 A;  3NZU A;  3PV1 A;  3BQT A;  5BMG A;  5IOI A;  1VJ5 A;  1V1P A;  5GXG B;  4IRK A;  2VZK D;  2Z7J A;  4ELU A;  4CO7 A;  4DK5 A;  4YSY B;  2HTH A;  3QAQ A;  4HDO A;  3C8Y A;  4KTQ A;  2K8B B;  4B9U A;  4IRC A;  2KLG A;  4P1B C;  3BZD B;  1COO A;  3HK0 A;  1ZQJ A;  2XNA C;  1Z4N A;  3MR3 A;  4C4S A;  2JY6 A;  3DCG A;  2NYV A;  3SYZ A;  2ZIU B;  3Q8C A;  8ICC A;  1E0Z A;  4QZG A;  3A9K A;  2LYB A;  1UGJ A;  2ZZP B;  3AU4 A;  1L2N A;  5FKA C;  3OJ4 B;  3FC4 A;  3BDP A;  3CST A;  2G4S A;  2KFK A;  5AK3 A;  3SEN A;  3VRA B;  5IP4 D;  2YY6 A;  5J2H A;  3ALR A;  3URY A;  3GE8 C;  4BDP A;  2OEH A;  3M9N B;  3NUH B;  5D46 A;  2G45 B;  1A77 A;  2KN7 A;  3C0R B;  1T3Q A;  4AYB F;  3HVZ A;  4US8 A;  5HP4 A;  3J9C A;  2QJL A;  1XO1 A;  3R7Q A;  4M9N A;  4C8L A;  2O6V D;  4RMA A;  2A5U A;  2J6U A;  1PQS A;  2PVO D;  1V1P B;  1QQ7 A;  1Y56 A;  1E7U A;  2KWC A;  3RJF A;  3BYY B;  9ICJ A;  4DXG A;  5C23 A;  4DF8 A;  1WXM A;  1NZP A;  4NLK A;  2KJ9 A;  2DHZ A;  1PUZ A;  2MJD A;  3DBS A;  2YEP B;  2HSZ A;  5ALU A;  4PS3 A;  2ZUB A;  1L3U A;  2PVG C;  2WU2 B;  3Q14 C;  4CHK A;  2UVW A;  2KP7 A;  3MFH A;  2BCU A;  4TQR A;  1EUV B;  3BS5 B;  1ZRM A;  3UM9 A;  4WWN A;  2V3N A;  2K4E A;  2LUE A;  2CHX A;  1V6E A;  3DHH C;  3MJW A;  1NK8 A;  1NJX A;  3AEE B;  5CJ7 A;  1ACC A;  4YTN B;  2KMA A;  4DS4 A;  2GWS A;  4FZM A;  2V3P A;  2Y5B B;  3OSP A;  7ICL A;  1HZ5 A;  1JN3 A;  5EDS A;  1EM7 A;  1VLB A;  3A33 B;  2HW3 A;  2KDI A;  4JUZ A;  3HX0 A;  1WFY A;  3WKD A;  2KZZ A;  2D2Q A;  4G11 A;  4IWP A;  9ICC A;  3JVZ X;  2XK5 B;  3GOE A;  4HDQ A;  2J7Q B;  3BVZ A;  4R3D A;  3MDA A;  4J9L A;  2ODG A;  5HMM A;  4O5K A;  3BQ7 A;  4NXZ A;  1JWA D;  1NYR A;  2DX5 B;  5DDM A;  1GOZ A;  5AIC A;  9ICE A;  1VZ6 A;  2WXG A;  2H3V A;  1T4G A;  2UYZ B;  3PHW B;  2R8G A;  2NPT A;  3RR8 A;  2Y9U A;  1LXD A;  1WXS A;  1UH6 A;  4BVU C;  4F5P A;  2JX5 A;  1Z00 A;  4B0E A;  4LZD A;  5KFF A;  4RGN A;  3K9P B;  3PO0 A;  2EAN A;  4JIO U;  2KE7 A;  3BQ2 A;  3NUQ A;  4FA6 A;  1NJZ A;  4MJS B;  4FFD A;  5KL1 B;  2C7N B;  2LYA A;  4PZO A;  5AKK A;  3EPG A;  3ZRF A;  4QNL A;  3AB5 A;  3H6N A;  4C8M A;  3V61 A;  4P4M A;  1ZQL A;  1XU4 A;  4F8C B;  1EO6 A;  1JWU D;  3PHX B;  3KHH A;  5KFI A;  4YMM A;  3C2L A;  2P66 A;  2N0S B;  5HKH A;  2O2V A;  3MGV A;  2UVR A;  2ACZ B;  1WXA A;  1TY0 A;  3Q3M C;  5KG5 A;  2PKE A;  2K8C A;  5KFY A;  2HOF A;  5K4L A;  5KT6 A;  5KFR A;  2LHT A;  2K1F A;  2MBO A;  2OHF A;  2LYH A;  2IY1 B;  4W9D A;  2G1E A;  3QNM A;  1D3Z A;  2QAR A;  5DBB A;  2XC9 A;  1K5O A;  5CHF A;  1ZQZ A;  1N5X A;  4DSE A;  1S76 D;  2Z59 B;  3PRM B;  1YQB A;  5DG7 A;  1SV0 C;  1QZE A;  2PLP A;  5DLF A;  2C2E A;  9ICH A;  4LNK A;  1ESF A;  5DB9 A;  1L6N A;  2CU3 A;  2FCM A;  1A5R A;  1J2M A;  5D4B A;  2N1R A;  2Q4T A;  2LGI A;  2UWQ A;  3UIN B;  4RNO A;  1KFY B;  5G2N A;  2DYB A;  4O1N A;  2KXJ A;  1IXR A;  2YLM A;  5DB7 A;  7ICJ A;  3CMM B;  1TK0 A;  4JQW C;  4M0W B;  3ISD A;  2WDT B;  2FPL A;  3DVN U;  4US9 A;  3E58 A;  5DPS A;  2VJ5 A;  5AM5 A;  2LI6 A;  1IBX A;  1WRD B;  1EU3 A;  1F0M A;  1E7P B;  5ALN A;  3KBB A;  9ICO A;  4QZ9 A;  1QCK A;  2BCQ A;  5JTI A;  2XGP A;  3NTU A;  3UIP B;  3M3J A;  4M9H A;  2F44 A;  3RJE A;  2RGF A;  3M6K A;  3NOB A;  1TVA A;  2LJI A;  1WGH A;  2D3B A;  3ZLZ A;  2CR5 A;  4ECX A;  2Z0D B;  4AYB C;  4KLH A;  1F2R I;  3SAG A;  2AHO B;  5KG7 A;  2RSU A;  4OZC A;  4JV2 A;  2OCE A;  4KLD A;  4WIP A;  2NBV B;  4XDC A;  4QW8 A;  3VAW A;  4JPS A;  4HYK A;  2Z8L A;  5L1L A;  1ZYQ A;  3L0W B;  4WH4 A;  3S2A A;  3E56 A;  2KX3 A;  2DL0 A;  4DQQ A;  1YOV B;  2MQJ A;  3AH7 A;  4XA5 A;  2J6T A;  3K9O B;  2MX2 A;  4DSJ A;  3M7D A;  1X40 A;  2WHI A;  2K4P A;  3DVG Y;  4F5Q A;  1ZXI A;  2KKP A;  5CHG A;  5J0Q A;  1XQQ A;  2PPH A;  5FK9 C;  4YN4 A;  3PS6 A;  2IY0 B;  2EKI A;  4WJN A;  2YMQ A;  4CNQ A;  2KC1 A;  4OJO A;  1BPY A;  2L0F A;  3APC A;  2XGQ A;  1V8C A;  5JRT A;  2AGO A;  4I6P A;  7ICU A;  4IQW A;  4MFF A;  4ED2 A;  1SGG A;  2G3Q B;  1BXT A;  4YR3 A;  3HW8 A;  1E8Z A;  2NR2 A;  2E1E A;  3OHB A;  3MGI A;  2YMP A;  3Q2A C;  9ICM A;  3ZDA A;  5ALX A;  5C5J A;  1RXV A;  2R8J A;  1ZP0 B;  5EWG A;  3WAM A;  4XWW A;  2HHU A;  8ICG A;  3UF8 A;  1IGD A;  2KSO B;  3QX7 A;  2EAP A;  9ICG A;  1ZQW A;  3T3O A;  2LRU A;  2ISP A;  4B9N A;  3RB3 A;  9ICL A;  5EWF A;  1OFF A;  3U7D A;  4ECV A;  2Q0Z X;  1WMH B;  2F76 X;  4UDU C;  4YSX B;  1D8Y A;  1L4D B;  4KLG A;  4MH0 E;  3KTQ A;  1AW7 A;  1I4Q A;  1MG8 A;  2RP5 A;  8ICQ A;  2WF6 A;  3TQ1 A;  3GFK B;  2DUY A;  3NS8 A;  1WX7 A;  1B9R A;  3A0H U;  3SFD B;  1L7Y A;  1ISN A;  2INN E;  2NRW A;  2R8K A;  5HML A;  2I5H A;  3AE2 B;  2HHW A;  4LK0 M;  1VJK A;  3WK8 A;  3HKZ F;  3VR9 B;  4DFP A;  1Y8R C;  2VZK B;  2H88 B;  1ZRN A;  2CHZ A;  5DB6 A;  1UBQ A;  2CU1 A;  2LZ6 A;  4I2C A;  1XWL A;  4EBD A;  2INP E;  3A9K B;  4XGA B;  3MC9 A;  3ML9 A;  3KYD D;  2KSO A;  4F5N A;  3SHQ A;  3D32 A;  4PPX A;  3LYS A;  2VA2 A;  1RPL A;  1ZQG A;  2MEK A;  3KKA C;  3EZ5 A;  3AI5 A;  4O3N A;  1WCN A;  4K7U A;  8ICM A;  2JMG A;  4PS7 A;  3PTF C;  4HEA 1;  3T3F A;  1Q3V A;  3DBR I;  4AQ7 A;  4R8U A;  3HUI A;  4ZHP A;  3MC1 A;  1NYQ A;  2INC C;  3CF6 E;  2BS4 B;  3UIO B;  1FCL A;  1HEK A;  1WJ4 A;  1HEZ E;  1EWY C;  2E3T A;  2H3Z A;  1YJJ A;  1VDV A;  4K7S A;  4JWN A;  2DYO A;  1S0O A;  1S10 A;  5KG3 A;  8ICO A;  2KJR A;  4GN1 A;  4NM1 A;  2R61 A;  4UB4 A;  3H8W A;  1URJ A;  3K4G A;  2MA9 B;  4II3 B;  3QUC A;  1IG6 A;  2KG5 A;  3GS2 A;  1SF0 A;  3IT4 B;  3JSV A;  2IHN A;  5AI4 A;  1I4P A;  4Q45 A;  4YT0 B;  1D5M C;  1FM0 D;  1R7S A;  3A4S C;  4MFC A;  2M8S A;  4MM3 A;  1WE6 A;  2HHT A;  1L0X B;  2DFL A;  2VA3 A;  5LXH A;  2RPQ A;  2KIC A;  5ALL A;  2B76 B;  2F1H A;  1QOA A;  1X9S A;  1FPY A;  1TS3 A;  2YML A;  3AV8 A;  3VTV A;  1GPX A;  1S1Q B;  4B95 A;  2OJW A;  3A1Q A;  4YVZ A;  4WQO B;  1QQR A;  4UAT A;  3A9J B;  1I4X A;  3HIZ A;  5KFS A;  2XVT A;  4D2K A;  3K1Z A;  2JYE A;  1J7A A;  5AM3 A;  4HCN B;  3SEB A;  2I1J A;  5D3D A;  1X9X A;  2M4N A;  1ET9 A;  3B1L X;  3VCB A;  4RPX A;  1TKD A;  2ESE A;  3R8B A;  2LGS A;  2WB1 C;  1WY8 A;  3N9Y C;  1AN8 A;  5L1J A;  3BVM A;  1X1M A;  3ZUN A;  3GP7 A;  3L10 B;  2OYY A;  4RUC A;  3QE9 Y;  4NJ7 A;  3ZYY X;  3QEA Z;  3PZP A;  1N62 A;  4F4Y A;  4NWI A;  8ICU A;  2DPI A;  2ZEQ A;  4OO1 J;  1TV9 A;  2W9N A;  2VH2 A;  3JPO A;  5HHD G;  3TJP A;  5HHI A;  4KX3 A;  1S9F A;  4I28 A;  3WK9 A;  4M9L A;  4W9G A;  4NM2 A;  1RYR A;  4J9N A;  4DL4 A;  5AUI A;  3QZ8 A;  2DKX A;  3MJ5 A;  2K5P A;  2LVQ A;  4JK1 A;  3VR8 B;  4KLE A;  2C7M B;  4KLM A;  3P2B A;  4K7W A;  3W1S A;  2N9K A;  1ZJM A;  4G3I A;  1E90 A;  2YMM A;  4M00 A;  4IR1 A;  2VRR B;  3P4R B;  4YTP B;  4PHA A;  3SU8 X;  3WU2 U;  4BJQ A;  3C19 A;  2J52 A;  3ZDM C;  2JU6 X;  4MF2 A;  4Y2S A;  2ZNV C;  2D3D A;  3R2T A;  3SD5 A;  2O2V B;  5D6J B;  2N9P C;  4FHK A;  3RUL A;  4KX5 A;  3T5H A;  2F1J A;  4FAD A;  3HM6 X;  1ZQV A;  3SR6 A;  1F9J A;  2WF8 A;  2JWZ A;  4ICU A;  3VHT C;  2W54 A;  4WQM A;  4JWU C;  4FZN A;  3KLS X;  4AOF A;  2W9A A;  4EZJ A;  3RNA C;  1YJI A;  1F77 A;  1P3Q U;  4FS2 A;  3KHR A;  1NJY A;  4GOC A;  5ALJ A;  2GOW A;  4BKS A;  4GU2 A;  2ZVN A;  2QB0 A;  4EBE A;  3VVW B;  3ZDB A;  1SL0 A;  2BZF A;  1WGD A;  2NV3 A;  4J03 A;  4ZRJ A;  3OJS A;  4Q2J A;  2BPG A;  3ALB A;  1SGH A;  5D2M B;  3PNC A;  4C7Z A;  1YN3 A;  1UBI A;  1TAU A;  1T0Y A;  4X5V A;  4JLC A;  4KZC A;  4IG7 B;  1N6Z A;  4IQU A;  2QEJ C;  3OAW A;  3AEV A;  2IBI B;  1FXI A;  3F5A A;  2WP9 B;  3ZQ4 A;  1XO0 A;  3H8H A;  4RCO A;  1WWV A;  2KEY A;  3OSN A;  2CJO A;  2MSE D;  3PSE B;  2ZG6 A;  5KFB A;  3IHP C;  4PS8 A;  1WCL A;  4Y2X A;  3PW5 A;  2JV3 A;  3MTN B;  2RLT A;  4ICA A;  2PFO A;  3VRB B;  1UPH A;  5TSS A;  3QC8 B;  4GFJ A;  3BQ1 A;  2JXJ A;  4Z6D A;  3T5L A;  3QIJ A;  2IOF K;  1QH9 A;  3DQV A;  4N6E B;  4HCP B;  4M0W A;  4EEY A;  3ZTC A;  2HDO A;  4Z6C A;  3AE7 B;  7ICM A;  3KUC B;  4KVG B;  1BGX T;  3N7S C;  1KFD A;  1YD8 U;  2GH1 A;  1XLQ A;  3ZGZ A;  1PDX A;  4DQI A;  2ZIW B;  4A3P A;  4FS1 A;  1JXE A;  3K1R B;  2BS3 B;  4FLH A;  2E5S A;  1SKR A;  7ICK A;  4FUL A;  4KSK C;  4F1S A;  2W9C B;  2A1A A;  5LNK 1;  1DXS A;  3AEG B;  3H9D A;  1X6J A;  1ZQT A;  5BMI A;  4I2J A;  1PVR A;  1GO3 F;  1TY2 A;  4ZH4 A;  1U4A A;  1ZQX A;  4RUA A;  4FO6 A;  4ACO A;  1UA1 A;  5J2R A;  3DHI C;  3WIM A;  1FNW A;  4RFB A;  4QZE A;  4KLI A;  3IBE A;  4WJQ A;  2E8O A;  2ZJ8 A;  2G0A A;  4DDG D;  5TZV A;  1FRD A;  2KAJ A;  4GDL A;  2GBM A;  2KLC A;  3ZNH B;  1E8Y A;  2D3C A;  1EXN A;  1KRP A;  4P16 A;  3RNE C;  4QWB A;  3PO5 A;  3VXW A;  3ZO5 B;  5J0T A;  2BT6 A;  1UT8 A;  2FMQ A;  5KHO A;  1L7N A;  1RZT A;  3Q8A A;  1ZQ1 C;  4IUM B;  5T8I A;  2LHD A;  1RQL A;  1X9M A;  1ENF A;  3IG3 A;  4ZYN A;  5LLI A;  3LXF A;  2KWU B;  4EYH B;  4UAW A;  2G09 A;  1NK0 A;  4JGH B;  2EDU A;  3TMP B;  1LKY A;  3PT2 B;  2LJ5 A;  2WXH A;  1YQ4 B;  2ASD A;  7ICR A;  2A4Z A;  3RZF A;  2ZPY A;  2D5G A;  5ALS A;  3ZVV A;  2FLN A;  1RRB A;  2AL6 A;  5J2F A;  2PTL A;  1NI2 A;  3FDS A;  1XT9 B;  4DL3 A;  4G50 A;  3PR5 B;  2FID A;  2WXQ A;  3F2D A;  4CRX A;  1SZP A;  1DOQ A;  4PGQ A;  1JQ4 A;  2P35 A;  1NK9 A;  3PSP A;  2MBQ A;  4NQK E;  3Q3N C;  3NAS A;  4MFA A;  3DPD A;  3WAL A;  2I9G A;  2HHS A;  4QZA A;  2E8P A;  1NK4 A;  3AUO A;  2JR5 A;  2FLP A;  2CHW A;  5IA7 A;  4RPY A;  4Y2R A;  2HVH A;  1CMX B;  3U4E G;  4RGO S;  2ZNV B;  3AQF A;  3T9L A;  1WJN A;  2N7D A;  3TAQ A;  4DBG A;  2C28 A;  2AYO B;  1UWM A;  1R4N I;  1GC6 A;  4RF0 A;  4KIT B;  5KFE A;  1MFW A;  9ICW A;  2W04 A;  5IN7 A;  5KFL A;  4YD2 A;  1SB3 C;  3R3M A;  4KZ0 A;  4W9K A;  1WM2 A;  1D9D A;  1VZ8 A;  4FJV B;  2AQ4 A;  1QSS A;  2KTF A;  3V72 A;  4OW0 A;  4FJY A;  1N5W A;  2WXR A;  1WH3 A;  2BWF A;  3E9S A;  5KAF U;  4F5O A;  2HBJ A;  2KJ5 A;  4DCC A;  1Q46 A;  3RBD A;  1BVS A;  1RXW A;  3Q8L A;  5AEK B;  1Q10 A;  4QIW C;  2IPK D;  2ATL A;  1WZ0 A;  1YIW A;  3LJ3 A;  2JWU A;  2JZZ A;  1S0N A;  1GC7 A;  1PFD A;  1LB2 B;  1KKX A;  4FN2 A;  4Y2T A;  5J0W A;  2DKZ A;  1SSN A;  3PO4 A;  3V6E B;  4BOS C;  2MBH A;  4RQ6 A;  1CI4 A;  2JZB A;  3TAP A;  3HM3 A;  4DQO C;  3B9J A;  2EKE C;  2MBB B;  3DDC B;  3ZKJ C;  4ANX A;  2JGA A;  2IOF A;  5E79 U;  1S8O A;  2ZW1 A;  4LLG M;  3IRU A;  3TI0 A;  1SKS A;  5F9N A;  2DLB A;  2JEJ A;  1SE2 A;  3GIL A;  1V5T A;  5AUK A;  5CA7 A;  3D2S A;  4NAM A;  2ZIU A;  4LNI A;  1ROE A;  3RPF C;  2Z0E B;  4QZI A;  5BYS A;  2GI9 A;  4A3O A;  4UB6 U;  2WXK A;  5AZG A;  2MLB A;  5ALZ A;  3LB8 C;  1JI7 A;  1C4A A;  4FE3 A;  4NJC A;  5G5G A;  1J97 A;  3TEY A;  1TE2 A;  4IS7 A;  2W11 A;  1SEB D;  4LDT D;  1SWV A;  2FUH B;  5CX3 A;  2W8L A;  4RQ4 A;  3CRX A;  4RQ2 A;  3OJU A;  4JL9 A;  2ZIW A;  3OLM D;  2DQN B;  3ICX A;  3GIK A;  1JW9 D;  2LMR A;  3ETL A;  4DL7 A;  2KK0 A;  4USA A;  3AMZ A;  1JMS A;  1ZQF A;  4J9O A;  3J81 j;  4EEW A;  1V9J A;  1N2X A;  3H8M A;  3V6C B;  1JML A;  2LKY A;  1KBU A;  2J6S A;  2ISO A;  4GDL B;  2M1M A;  4KLF A;  2MU2 A;  1WGK A;  3RZW C;  1X6I A;  1Z4O A;  5IIK A;  1OXJ A;  1XLO A;  4NLZ A;  4BKG A;  9ICT A;  5KFV A;  5AZH A;  2R2O A;  3UXP A;  4PJ0 U;  5KG2 A;  1Q1O A;  3F2B A;  2ZXI A;  1KF6 B;  1L6U A;  5ALD A;  1FO4 A;  2JT4 B;  5IIL A;  2RDH A;  4Q43 A;  2KMC A;  1TFR A;  1LGR A;  3RN9 C;  2X38 A;  4DSF A;  4B6W A;  1N48 A;  3RJG A;  2C5L C;  2E8N A;  2D6F C;  4F93 B;  4ECT A;  3Q8Q B;  5AKE A;  3RCZ A;  4BXO B;  1C3T A;  3AU5 A;  1MVK A;  3JW0 X;  1CEZ A;  2BCS A;  4M02 A;  1T94 A;  2BKR B;  4WJ3 B;  1KLV A;  3UQA A;  2D10 A;  4CGZ A;  3H4B A;  1ZOY B;  3T8M A;  1QIL A;  2IOH A;  3EPI A;  3P4Q B;  2JXX A;  2M9N A;  5E6N A;  1ZGU B;  2KWV B;  3V7K A;  5JZE B;  3RD2 A;  1L6V A;  2FIF A;  9ICN A;  3V60 A;  4WJP A;  4RGT A;  1UNS A;  3THV A;  4B9K A;  4ZYS A;  2PFN A;  3H7P A;  7ICV A;  5AZF A;  5AHX A;  3RNF C;  1E6E B;  5HG2 A;  2J53 A;  3HRD D;  4O3M A;  4F8R A;  2PFP A;  3MHZ A;  1JAL A;  2BGF A;  3MP9 A;  3F53 A;  2A1J B;  2OOB B;  3EHV A;  4MGY E;  3VUX A;  5KFG A;  4DHJ D;  5D49 A;  2IGH A;  1FD6 A;  3AU6 A;  2BDP A;  1KM7 A;  5FR3 A;  2A3V A;  2C2R A;  2LWP A;  3AE4 B;  2RDJ A;  3N30 A;  3BVG A;  7ICG A;  2Y0S F;  4OJ5 A;  2BR0 A;  1ZJN A;  2G08 A;  5AM0 A;  2B3A A;  4EX6 A;  5AM4 A;  4CE6 A;  2I2Y A;  3UMC A;  4P4P A;  4C8K A;  2W82 A;  2M0N A;  4O5C A;  5ALM A;  2LAS A;  1XD3 B;  1S0M A;  1XSL A;  5GMV A;  2QIE B;  3QUB A;  3VH4 B;  1I4H A;  1KN5 A;  1SXT A;  1P7D A;  5KT7 A;  1BPX A;  2JXT A;  2KAN A;  2JRZ A;  1C20 A;  2ON8 A;  3BZK A;  2WB1 F;  1XEE A;  2F3N A;  1HJP A;  4UW9 A;  2BQU A;  3P4P B;  2K89 A;  2EMT A;  3RNG C;  4LCD E;  3IP4 B;  5D94 A;  3FIL A;  1COK A;  2D8C A;  5AI8 A;  1LV5 A;  4F4Z A;  4I27 A;  1KSP A;  2QSD A;  1XSP A;  2CN1 A;  3SAF A;  1TBE A;  3ISB A;  2ZIV A;  3C1Z A;  3TAC B;  4E74 A;  4YXD B;  2GLE A;  3MDC A;  1T0R C;  5E6P A;  5G5H A;  3B0A A;  5DG9 A;  3LVV A;  2O6V A;  2WLB A;  2WQY B;  4CDG A;  4P0Q A;  1WX8 A;  2FDR A;  4I6L B;  1QSL A;  3NS1 A;  2KFZ A;  3T5K A;  3I3T B;  4KN7 A;  1M4V A;  4KLU A;  1E8X A;  3I1Y A;  4DS5 A;  3A9J A;  3BIN A;  1TS5 A;  2JPH A;  4XX5 A;  2AQ0 A;  3IM1 A;  5E6J A;  2LMC A;  5KFN A;  2MJ3 A;  1ZQS A;  3N3K B;  3H7I A;  3Q69 A;  4IM3 A;  4IC9 A;  3UQB A;  3OGU A;  3V6H A;  4QWE A;  2PI4 A;  3ML8 A;  1S77 D;  3T3N A;  1TAM A;  3RFA A;  1C7Y A;  1CJE A;  3TAD A;  2ZCB A;  2XI9 A;  3GZN I;  9ICX A;  3IXS A;  1MN8 A;  3TAN A;  3FKY A;  3MR2 A;  3WK4 A;  3AQE A;  3PZD A;  1J19 A;  5MPO A;  2YN4 A;  5J2I A;  1U4B A;  2H3I A;  2WXI A;  8ICW A;  1QKZ A;  1WG8 A;  4YMO A;  5ALI A;  2ZTC A;  2IA6 A;  2AJQ A;  2KJH B;  2XY6 A;  7ICO A;  2OH2 A;  4J9S A;  3WKA A;  5L9X A;  1NKE A;  3WAN A;  4URK A;  2BB5 A;  4XE0 A;  4ZHO A;  3GQC A;  1SV0 A;  3M63 B;  2BTE A;  2IBK A;  2KC2 A;  3PW7 A;  3W1Y A;  2JRI B;  4R8U B;  2N9L A;  4H2A A;  2PFQ A;  3I5J C;  4UAV A;  3TFR A;  3JPP A;  5HI1 A;  8ICA A;  2W43 A;  1IV8 A;  2YEP F;  3SMV A;  4DLE A;  2YQE A;  5DGA A;  3EGR A;  3ZDC A;  8ICK A;  1KTK A;  1E7V A;  1F0Z A;  3W9C B;  1XC9 A;  4QW9 A;  4EX7 A;  4I2F A;  9ICK A;  4ZRQ A;  5KFT A;  2N9E B;  3E0F A;  9ICP A;  3JSV B;  4W9E A;  2R8H A;  2KMM A;  4F4W A;  2EH9 A;  4RQ1 A;  1B22 A;  5ALT A;  4C56 C;  3ZXV A;  3DWG C;  3UMB A;  3RTV A;  3RNC C;  1N56 A;  1CUK A;  3MGH A;  1UEL A;  5AI5 A;  3PPA A;  3OWE B;  1ZET A;  4GIV A;  3WAO A;  4ZDV A;  2LRW A;  2UVU A;  3ZXR A;  2LM1 A;  2WNM A;  4NLN A;  4JE3 B;  3PZ8 A;  4YWG G;  2WTF A;  1D5X C;  1RYJ A;  1FNU A;  1KFS A;  1SXE A;  3T79 A;  4Q44 A;  1Q0W B;  2G5I B;  3I76 A;  1JRP A;  1FFU A;  3V05 A;  3PY8 A;  4QIW F;  4O3O A;  1L7M A;  1D5Z C;  2Y5P A;  4C4V A;  1WYW B;  5JUM A;  1WYG A;  1P0R A;  2L83 A;  4A8X C;  1MI0 A;  2PMV A;  1ZD5 A;  5KFJ A;  3C2K A;  5H92 C;  7ICT A;  2KQ7 A;  3ZW3 A;  4JB3 A;  1QQ5 A;  1T5X D;  3GIJ A;  3MR5 A;  3D6J A;  1BML C;  5JHB A;  1RFA A;  2RRD A;  1NEN B;  1O08 A;  4WWM A;  4W9F A;  5IKC M;  5KT5 A;  2K8A A;  2FI1 A;  2WXM A;  1OEY A;  4NAW A;  2BWE S;  2W9B A;  2XY5 A;  4ECQ A;  3O13 A;  4MSQ B;  2ASL A;  5AKY A;  2KK8 A;  3ZTD A;  4IQT A;  2DZI A;  2IYD B;  3HJE A;  7ICI A;  4DQS A;  2MUT A;  1IPG A;  2V1Y A;  3PRZ A;  2K39 A;  4HKZ E;  4EZL A;  1ZQQ A;  1ZQA A;  3TKA A;  2CS4 A;  2MWS B;  3QWZ B;  3EFC A;  4BWJ A;  3WAP A;  3PSI A;  3DOW A;  5DKW A;  3L3F X;  1V1O A;  2JVC A;  5KNI A;  1WMH A;  3BJY A;  4HLE A;  3HWT A;  3L13 A;  8ICZ A;  1UA0 A;  4S0R A;  3L16 A;  3P63 A;  3ZD9 A;  1QLN A;  4MEM A;  1JRO A;  2NTT A;  2WF7 A;  5GTH U;  4GMV A;  3RYT A;  1MHX A;  5AKI A;  1R4M B;  1EU4 A;  2WDR B;  5BYQ A;  2FNJ B;  1FXT B;  2DYM A;  3CYM A;  1K53 A;  2P6R A;  3Q3O C;  3KOO A;  4I6N B;  4M8M A;  5DGB A;  3I9V 1;  4DSL A;  4ZRP A;  2DAJ A;  3C2M A;  5KT4 A;  2RDB C;  2DGZ A;  1QOF A;  4B9M A;  2CXY A;  1DOY A;  2A1J A;  2QB1 A;  4A6Q A;  5ALW A;  2WX0 A;  5A0L A;  4GXI A;  4KKJ A;  4W9L A;  2OWO A;  3IHQ B;  4NV0 A;  1T0S C;  5ALR A;  3L17 A;  4KGT A;  3TL5 A;  3BK1 A;  1NZB A;  4X57 B;  2OM6 A;  7ICS A;  2BGW A;  1DRG A;  3GZN B;  3P42 A;  1ARO P;  1M6Y A;  2R8I A;  2FBW B;  1OEY J;  5IIN A;  3FYH A;  3PST A;  2KNB A;  1YNT E;  1IBX B;  1QLB B;  2NRT A;  3Q8F A;  2RPV A;  4I2D A;  3KUD B;  1NVI D;  1P7E A;  1SKW A;  2C60 A;  2AQ3 B;  5ALH A;  2OXO A;  3FM9 A;  5C2T B;  1A76 A;  3PV8 A;  3QA8 A;  4F3O A;  2XEW A;  5EE9 A;  4RH6 A;  2FJ6 A;  5DQG A;  4HVB A;  3DEE A;  4GDK A;  4UB2 A;  4EOY A;  3N20 C;  2X8X X;  3RMK C;  5ALE A;  1YMH E;  4GC6 A;  3SV3 A;  5AI9 A;  1JUD A;  4EBC A;  1SIJ A;  2HHQ A;  1I7H A;  2L76 A;  2PJH A;  2Q5W D;  3DBH I;  3BYT B;  1AYF A;  4OJ6 A;  3KW5 B;  1FIQ A;  4DWI A;  1XS9 D;  4TUR A;  4KMO B;  2K8C B;  2B6G A;  1VR9 A;  2ZVO A;  2I38 A;  5J0U A;  4J9Q A;  4PL2 A;  4DFD A;  3AE6 B;  3N7R C;  1V81 A;  2RDG A;  3VH3 B;  3QEB Z;  2J42 A;  3IAM 1;  2IGD A;  1FRR A;  2ZIV B;  1V2Y A;  4FZL A;  2BPS A;  2RHF A;  4DFJ A;  1YZ6 A;  4KV2 A;  1U47 A;  1WF9 A;  3TAR A;  3ZJT A;  2Y3A A;  1C1Y B;  1JWS D;  3FIL B;  1C78 A;  1KQQ A;  4C00 A;  2WF5 A;  3D2N A;  3DV9 A;  3PVX A;  4OHJ A;  3U8Z A;  4IWQ A;  2I1Q A;  1BT0 A;  2N9X A;  4Y2Q A;  4PGY A;  3IT6 B;  4BAX A;  2JQR B;  5AIB A;  1SJH D;  3RRH A;  1C79 A;  1ZDX A;  1DK2 A;  5DBC A;  1UD7 A;  4DEZ A;  1ZQO A;  1GNU A;  2VKQ A;  5KFH A;  2H89 B;  3WK6 A;  5J0X A;  4KGR A;  4REZ A;  3RJI A;  2ZJ5 A;  5CRX A;  4GLX A;  1Z19 A;  4LNN A;  2KVC A;  3TAD C;  4LJX A;  4PHE A;  2LVP A;  3W5U B;  7ICN A;  4AP4 C;  2LVO A;  4ECS A;  4R63 A;  3SAH A;  2KDF B;  5HR7 A;  1WWU A;  2Y5C A;  3IG8 A;  2XK5 A;  4HXD A;  3W1S C;  5DB8 A;  1K50 A;  3NY5 A;  1KRH A;  3RJK A;  4L2Y A;  2RR9 A;  3IV6 A;  3I57 A;  4PYZ A;  2PW9 A;  1S5L U;  4BBN C;  1NDD A;  3NVW A;  3SQI A;  2Y1J A;  1WJU A;  2LUM A;  5KFQ A;  1ZQR A;  1RAX A;  4OCZ A;  5TIS U;  3JYU A;  4TSS A;  3LDZ E;  4BX9 C;  7ICE A;  3WKE A;  2EZX A;  4E0D A;  3H7P B;  5J0P A;  2IND C;  3QHT A;  4HKQ A;  4DFM A;  2BQQ A;  4UB8 U;  5AIA A;  2M17 A;  3NJT A;  3PZ7 A;  4L1B A;  1ZQH A;  4NPN A;  2NPT B;  1ZQU A;  2HHV A;  4XYC A;  3A4R A;  3QK0 A;  1JIH A;  8ICE A;  5AKJ A;  2D07 B;  5ALV A;  1BPD A;  5J2B A;  3AE5 B;  3U30 A;  8ICB A;  5ALO A;  3V7J A;  4HRS A;  4IDI A;  2L0T A;  3WA0 A;  4QZH A;  1ZXH A;  2IJ0 A;  3QAR A;  2K6D B;  4DQR A;  1K1Q A;  4TQS A;  1R4M I;  2EZZ A;  4C8N A;  4R64 A;  2KWD A;  4RNN A;  4ED1 A;  4C4R A;  5HR6 A;  3H8S A;  1E8W A;  8ICV A;  1ZQE A;  3DVG X;  3UMG A;  4L23 A;  4QZD A;  4G9B A;  3EFU A;  1L5P A;  5DPR A;  4MGZ E;  4NY8 A;  2QKQ A;  1OQQ A;  5AK4 A;  1V97 A;  1JX4 A;  2Y1I A;  1J7B A;  4CF3 A;  4JV1 A;  4RM8 A;  2BDU A;  2AX5 A;  3PVL A;  1ZPS A;  2LD9 A;  1BNO A;  3P1M A;  5AKX A;  5KG4 A;  4BOZ B;  1CK1 A;  5DDY A;  3C5G A;  2ZIX B;  4I29 A;  1P7F A;  2MW5 A;  3S6J A;  1PYW D;  1ZQC A;  4A8E A;  1Y88 A;  4MEL A;  3PSF A;  3ONN A;  4I2B A;  4MEY A;  1YX5 B;  4RQ5 A;  1ZE3 D;  3QQ8 B;  3FAH A;  1K1S A;  3SI8 A;  4IM2 A;  1KOT A;  4DHJ B;  5CEH A;  2XCP A;  4DFK A;  2BBC A;  2K9X A;  2K8B A;  1TTN A;  2V4R A;  4GSW A;  2LXA A;  1ED1 A;  4ACF A;  2AXT U;  2W7P A;  4PGX A;  2DZK A;  2UU7 A;  2K22 A;  2WWZ A;  2C2D A;  5L1K A;  1SL2 A;  2NCN A;  2Y9T A;  3LDA A;  3QYP A;  1I4G A;  4LNO A;  4QWC A;  4WAF A;  3X0W A;  5CHV C;  4W9C A;  5AI6 A;  5G55 A;  2LI5 A;  5ALF A;  2PKO A;  2NO5 A;  1JXL A;  2PMZ C;  2AGQ A;  1I42 A;  2G5H B;  4ARI A;  3ZJU A;  2FMS A;  2DBY A;  3ZIM A;  5ALK A;  1QTM A;  1FCC C;  4ZOH C;  3HPO A;  3V6K A;  3U26 A;  1PGB A;  1Z5S B;  2AQ1 B;  2GBJ A;  3UI3 A;  2L5Y A;  1YJ1 A;  1KFT A;  3HT3 A;  4AS1 A;  4QZB A;  4C8O A;  2WAQ C;  4J9R A;  2XCA A;  2IO1 B;  1EWC A;  4F7Z A;  3NRZ A;  5JH5 C;  3VFK A;  4Q8E A;  1F5S A;  3R9K A;  1S0V A;  3DBL I;  4F2R A;  1S3S G;  4OZB A;  2F8K A;  3O0F A;  3B0X A;  3ENE A;  3RJH A;  1BUI C;  1M94 A;  3ZNI D;  3ZNG C;  1X2I A;  4UAY A;  4MGI E;  1WIA A;  4A90 A;  2V0G A;  3AE8 B;  2LHE A;  1I4R A;  4TQ1 A;  3BK2 A;  3SFE B;  4ED7 A;  4F4X A;  1TAQ A;  1V85 A;  3H0M B;  3K75 D;  3V62 A;  4M8N A;  1BPE A;  3RR7 A;  5LXI B;  2FCN A;  4OD0 A;  2ZJD A;  3H7S A;  4UBC A;  2DF4 B;  4CCH A;  4QZF A;  2C7H A;  4R66 A;  3TUO A;  4F91 B;  4I2G A;  1AWD A;  1X9W A;  3NG0 A;  2V4I B;  1TS2 A;  4AJY B;  2GRI A;  1C4P A;  4RZR A;  1C4C A;  1WX9 A;  2SEB D;  5C0Y A;  3NZ3 A;  3H40 A;  1V80 A;  7ICF A;  4CF4 A;  4ANV A;  2VIX A;  3SD7 A;  3PMN A;  1SIF A;  1XLN A;  2VH1 A;  3PGE A;  2GO7 A;  4J6I A;  4EEK A;  2NBW B;  1LM8 B;  3U2S C;  2YX8 A;  1DYQ A;  1ZQB A;  2V9H A;  9ICB A;  3KD3 A;  4YSZ B;  3M1Y A;  2LFI A;  3KQ4 A;  3TEZ A;  4M9G A;  2V9W A;  2EAM A;  5J0S A;  3ECI A;  3AE3 B;  2JSV X;  2BS2 B;  1HA5 A;  4YP3 A;  2ZCC A;  4I2E A;  4MDK E;  4UB1 A;  1RYS A;  2HBK A;  1PVP A;  4W9H A;  8ICS A;  4ECY A;  4PK1 A;  2KVZ A;  2ZUC A;  3ZDE A;  8ICH A;  5AI0 A;  3P4S B;  1L4Z B;  5IIJ A;  2KVS A;  3KHG A;  3RRG A;  2E8M A;  2MSN A;  4J3O D;  3LYY A;  1YN4 A;  1IYF A;  4TMA B;  1T6B X;  3IDW A;  3M8R A;  2KD0 A;  4FBU A;  2XBB C;  2FE9 A;  1PK3 A;  3C23 A;  1KJT A;  3VQI A;  2W8K A;  1HTO A;  4GGQ A;  5I4D A;  4HWI B;  2O6K A;  4BUG A;  2DZJ A;  3U7Z A;  5C3J B;  1TZ1 A;  5F3X B;  9ICS A;  3ETR A;  3KZX A;  1ET6 A;  2N1V A;  4OJP A;  2WXP A;  3QU7 A;  4F71 A;  1C76 A;  5BO4 B;  4YR2 A;  8ICN A;  1L0Y B;  4YCX A;  3KWV A;  2LM4 A;  2JZP A;  4WAA A;  3X23 A;  5KG0 A;  1ZQI A;  3QUQ A;  3AN1 A;  1D8B A;  1CRX A;  3V6J A;  3PR4 A;  1HXY D;  2MJE A;  3CWI A;  1T3N A;  4CF5 A;  4NLG A;  1WM3 A;  3QJZ A;  3ZDT A;  3NGD A;  3CIR B;  4W9J A;  1QQ6 A;  1LFD A;  1T0Q C;  2XN9 C;  2PIA A;  4ECZ A;  4MSM B;  3B2F A;  3QU4 A;  2KNJ A;  5J29 A;  2K60 A;  3Q8P B;  1JWM D;  2K0P A;  5EE1 A;  3A0B U;  3TFS A;  4IQV A;  5AKH A;  4NL9 C;  2FMP A;  4OVV A;  1J7C A;  1UT5 A;  3PW4 A;  2ZW0 A;  5KG1 A;  4F72 A;  5J2J A;  3RI7 C;  5IIM A;  3TSS A;  2WXL A;  2L32 A;  2KJ6 A;  1RDF A;  4ELT A;  1YQ3 B;  2KOB A;  4GB9 A;  4KLS A;  5BOL A;  3OJ3 A;  1DOX A;  3UGB B;  2KO3 A;  3UXN A;  1G6J A;  2MH7 A;  2WHE A;  2LPE A;  1B1Z A;  3EC8 A;  9ICF A;  4PH5 A;  2ZXH A;  2YB4 A;  2RD0 A;  1DGJ A;  1ECW A;  2WXJ A;  1WE7 A;  2NRX A;  1QSY A;  1WGR A;  5KFP A;  4IOI E;  2HMX A;  5KFK A;  3W5V B;  4FBJ B;  4FHJ A;  1IUE A;  4YFK A;  2MCN B;  1CQV A;  5EWE A;  3A1Q B;  2KN4 A;  2KV2 A;  4DHZ B;  1E10 A;  2XID A;  3VUY A;  1BPB A;  4DOB A;  2KKC A;  5J0O A;  1VD2 A;  1J2N A;  3CP8 A;  1PK1 A;  2KZ3 A;  3RB0 A;  3RB6 A;  1SL1 A;  5DQI A;  4P4O A;  3GIM A;  4TKN A;  4NY0 A;  4DHZ E;  3ZJV A;  2N7J A;  1WI0 A;  4M01 A;  2AGP A;  3VC8 A;  9ICV A;  4GLS C;  3RH6 A;  3C1Y A;  1Q5W B;  1FXA A;  1NOM A;  1ZOL A;  3EWA A;  4BGD A;  1JWB D;  5H2F U;  4AUQ C;  3H4D A;  4NNJ B;  1GAQ B;  1RLF A;  1SWW A;  8ICR A;  3GV8 B;  2JRH A;  4EE2 A;  1AQ6 A;  3AE9 B;  3GZF A;  3M9M B;  2M19 A;  3VDZ A;  1SE9 A;  3WCQ A;  4AP9 A;  3PRP B;  4NZL B;  4N58 A;  5CP2 A;  2I6X A;  4J9M A;  4DOA A;  4FJZ A;  3VUW A;  2W9B B;  3U52 E;  2BCV A;  3ABV B;  5J2D A;  1MHH E;  1NBF C;  2DNF A;  4BKT A;  1RYU A;  1UUP A;  1KL9 A;  2KJ8 A;  3M95 A;  3EA6 A;  4JWM A;  3DHG C;  4XZ4 A;  1FMA D;  2A19 A;  4NJ8 A;  4PHP A;  3PW0 A;  4U7C A;  3IN5 A;  4B9L A;  1C9F A;  4DSK A;  1VZ7 A;  2ZIX A;  3Q8K A;  3AEC B;  1MJD A;  1UCV A;  4ASW C;  3RH4 A;  3QU2 A;  1DOI A;  5DCN A;  1CZP A;  1L8L A;  2F8L A;  2K4H A;  4GXJ A;  1OQR A;  4JX1 C;  1TKY A;  2KDM A;  2M0A A;  3PX0 A;  3APD A;  2CKH B;  4XUS A; 
#chains in the Genus database with same CATH homology
 3SR6 A;  1STE A;  2WXF A;  2W54 A;  4WQM A;  4JWU C;  4A9A A;  3KLS X;  4HKZ E;  2HTM E;  4ITK A;  1YJI A;  1V1O A;  4HRO A;  4CQN A;  3Q8B A;  1F77 A;  2FUG 1;  3BWU D;  2HDE A;  3TEW A;  3NVV A;  2QIL A;  1TYG B;  3P63 A;  3R2I A;  1JRO A;  1HQR D;  2NTT A;  1MHX A;  2K3U A;  1EU4 A;  2WDR B;  5BYQ A;  1KLU D;  4Q2J A;  2DYM A;  1C77 A;  1K53 A;  2G9H D;  5JXV A;  1TKG A;  1XLP A;  3I9V 1;  4C7Z A;  1YN3 A;  4ZRP A;  1QOF A;  1DOY A;  1RFK A;  2TSS A;  2QEJ C;  2FE8 A;  4A6Q A;  1FXI A;  2M56 B;  2WP9 B;  3ZQ4 A;  3H8H A;  1N60 A;  1E9M A;  4MM3 B;  4RCO A;  4KKJ A;  3B2G A;  5BMH A;  2BB6 A;  2CJO A;  4KGT A;  2OED A;  3BK1 A;  4C80 A;  3P42 A;  1FFV A;  2FBW B;  3HVD A;  1IBX B;  1YNT E;  4OVZ A;  1KH0 A;  5TSS A;  3VRB B;  1ZDV A;  1QLB B;  2ICI A;  4N6E B;  4M0W A;  2J4X A;  3Q8F A;  2RPV A;  3AE7 B;  1PUT A;  3AED B;  1NVI D;  1P7E A;  3ZJV A;  2AQ3 B;  3ZGZ A;  1XLQ A;  1PDX A;  1F2R C;  5C2T B;  2BS3 B;  5BMG A;  5EE9 A;  4RH6 A;  1XCT L;  1V1P A;  2W3S A;  1KLG D;  5GXG B;  5LNK 1;  2VZK D;  4DXF A;  3AEG B;  4RF1 A;  4YSY B;  5BMI A;  1TY2 A;  3C8Y A;  1YMH E;  1SIJ A;  1I7H A;  1FNW A;  2Q5W D;  1SE3 A;  3BZD B;  3BYT B;  4RFB A;  1AYF A;  2XNA C;  1FIQ A;  1N63 A;  1QOG A;  3Q8C A;  1E0Z A;  1FRD A;  1UGJ A;  2KAJ A;  1VR9 A;  5FKA C;  2I38 A;  3AM9 A;  3FC4 A;  3AE6 B;  3L4P A;  2IDY A;  4P16 A;  3VRA B;  2RDG A;  2J42 A;  3IAM 1;  2BT6 A;  1FRR A;  2IGD A;  4MH8 A;  3URY A;  3NUH B;  3Q8A A;  5T8I A;  2WXN A;  2WS3 B;  3ZJT A;  1T3Q A;  3HVZ A;  2LHD A;  4US8 A;  1ENF A;  1JWS D;  2Y3A A;  3J9C A;  3FIL B;  2QJL A;  1C78 A;  3LXF A;  4GDK B;  4OHJ A;  2PVO D;  1V1P B;  3IT6 B;  2WXH A;  1YQ4 B;  1Y56 A;  2JQR B;  1SJH D;  3AEA B;  1C79 A;  1ZDX A;  3BYY B;  4DXG A;  2D5G A;  2H89 B;  2PTL A;  4KGR A;  2MJD A;  4REZ A;  2YEP B;  2WXQ A;  3AEB B;  2PVG C;  2WU2 B;  1SJE D;  2CJN A;  1JQ4 A;  3W5U B;  1SBB B;  2V3N A;  2Y5C A;  1K50 A;  3BII D;  1KRH A;  4L2Y A;  2E6X A;  3AEE B;  1ACC A;  4YTN B;  5H8Y E;  2V3P A;  3U4E G;  3I57 A;  1HZ5 A;  2PW9 A;  4KKI A;  4RGO S;  1EM7 A;  1VLB A;  3NVW A;  1D6E C;  1TZO A;  2LUM A;  4HJG E;  1TJE A;  1TS4 A;  1UWM A;  4IKG A;  4RF0 A;  2W3R A;  4TSS A;  2RMM A;  1FNV A;  1SB3 C;  4HKQ A;  4R3D A;  3BVZ A;  3PZ7 A;  4L1B A;  1NYR A;  4MT5 A;  1JWA D;  1VZ8 A;  1GOZ A;  3EUB 2;  4OW0 A;  1VZ6 A;  2WXG A;  1N5W A;  2WXR A;  3AE5 B;  3E9S A;  4IDI A;  4HRS A;  1ZXH A;  2IJ0 A;  2JX5 A;  4B0E A;  2KAC A;  4RGN A;  2KWD A;  1D4B A;  3PO0 A;  1Q10 A;  2IPK D;  2JWU A;  1PFD A;  4L23 A;  1L5P A;  1MPE A;  1SSN A;  3AB5 A;  1OQQ A;  1V97 A;  1J7B A;  1WWT A;  1JWU D;  2AX5 A;  1ZUD 2;  4DQO C;  3B9J A;  2N0S B;  1ZPS A;  3IAS 1;  2ZW1 A;  4LLG M;  2WU5 B;  3P1M A;  2ACZ B;  1CK1 A;  1P7F A;  1TY0 A;  2DLB A;  2GB1 A;  1PYW D;  1SE2 A;  5AUK A;  1GB4 A;  4NAM A;  1ROE A;  1YN5 A;  2L52 A;  2OHF A;  3RPF C;  4B0M A;  2GI9 A;  5BYS A;  1ZE3 D;  2G1E A;  4PT5 A;  3FAH A;  2WXK A;  3LB8 C;  1C4A A;  1N5X A;  4NJC A;  2BBC A;  5G5G A;  2K9X A;  3TEY A;  2PLP A;  1SEB D;  4OZA A;  2K22 A;  1ESF A;  1XCQ L;  2CU3 A;  1QF6 A;  1I4G A;  4WAF A;  2LGI A;  1VRA B;  1NEK B;  1JW9 D;  1KFY B;  2PKO A;  4O1N A;  4USA A;  3AMZ A;  3Q8E A;  4ARI A;  3ZJU A;  2DBY A;  1NI3 A;  4US9 A;  1JML A;  1FCC C;  4ZOH C;  1PGB A;  4FXC A;  3UI3 A;  2AQ1 B;  1IBX A;  4GDL B;  1WGK A;  1XLO A;  4AS1 A;  1EU3 A;  1E7P B;  2NTS A;  1EWC A;  1KF6 B;  1L6U A;  3RFZ B;  1FO4 A;  2NMQ A;  3NRZ A;  4XDD A;  2LJI A;  1XO3 A;  2RDH A;  2JYT A;  4A55 A;  2WDV B;  2X38 A;  1F2R I;  4OZC A;  4OZB A;  4WIP A;  1BUI C;  4XDC A;  4JPS A;  2Z8L A;  2V0G A;  4A90 A;  3AE8 B;  2LHE A;  1I4R A;  4TQ1 A;  4WH4 A;  4XWT A;  1MVK A;  2EEL A;  3BK2 A;  3E56 A;  3SFE B;  3AH7 A;  1ZOY B;  1QIL A;  3P4Q B;  1ZXI A;  3TUO A;  1RM6 C;  1AWD A;  1FEH A;  1L6V A;  1TS2 A;  2V4I B;  5FK9 C;  2GRI A;  1C4P A;  1C4C A;  2EKI A;  2SEB D;  3NZ3 A;  1UNS A;  4RGT A;  1SE4 A;  4ZYS A;  1E6E B;  5HG2 A;  2J53 A;  1XLN A;  3HRD D;  2W55 A;  3MHZ A;  1JAL A;  1V8C A;  1QT9 A;  3MP9 A;  3U2S C;  1DYQ A;  4YSZ B;  1BXT A;  1QOB A;  1L0V B;  2LFI A;  3KQ4 A;  3TEZ A;  1RWS A;  2IGH A;  4NAW B;  1FD6 A;  3AE3 B;  1WSP A;  2JSV X;  3AE4 B;  2BS2 B;  1HA5 A;  1ZP0 B;  3BVG A;  3GB1 A;  4XWW A;  2LEK A;  1IGD A;  2I2Y A;  1HZ6 A;  2W82 A;  3AE1 B;  4LTU A;  3T3O A;  2QIE B;  1L4Z B;  3P4S B;  1I4H A;  1OFF A;  1SXT A;  2JXT A;  4RGM A;  1XF5 L;  4N59 A;  1TKE A;  4UDU C;  4J3O D;  1A70 A;  2ON8 A;  3LYY A;  1YN4 A;  5BYR A;  4YSX B;  1L4D B;  4TMA B;  1T6B X;  1JCK B;  1XEE A;  1AW7 A;  1I4Q A;  3VQI A;  5I4D A;  3P4P B;  4MAC A;  3U7Z A;  5C3J B;  3FIL A;  1B9R A;  3ETR A;  3SFD B;  1ET6 A;  2INN E;  2WXP A;  2QSD A;  1XXG A;  1C76 A;  3AE2 B;  1L0Y B;  4LK0 M;  2WXO A;  3KWV A;  4YXD B;  1GB1 A;  1VJK A;  2JZP A;  2ONQ A;  3VR9 B;  5G5H A;  2VZK B;  2H88 B;  3AN1 A;  2WLB A;  2WQY B;  2BYT A;  1HXY D;  2MJE A;  3CWI A;  2INP E;  4TQ0 A;  4JWS C;  3V3X A;  3NS1 A;  1LO5 D;  1M4V A;  3DWM A;  3CIR B;  2BW2 A;  1WXQ A;  2MEK A;  1TS5 A;  2XN9 C;  2PIA A;  1WRI A;  5EE0 A;  5E6J A;  3B2F A;  3AEF B;  2LMC A;  2MJ3 A;  3Q69 A;  4HEA 1;  3KWL A;  3T3N A;  1UWX A;  4AQ7 A;  3HUI A;  1CJE A;  1JWM D;  4ZHP A;  2K0P A;  1NYQ A;  1FCL A;  5HFY A;  4C7Y A;  2BS4 B;  2IGG A;  4RNA A;  5EE1 A;  3IXS A;  1HEZ E;  1EWY C;  2E3T A;  1J7C A;  1YJJ A;  1VDV A;  2ZW0 A;  5MPO A;  2DYO A;  4ARC A;  3TSS A;  2WXL A;  2WXI A;  2L32 A;  1QKZ A;  3NVZ A;  2R61 A;  2KQ4 X;  1YQ3 B;  1DOX A;  3GS2 A;  1SF0 A;  3IT4 B;  2MH7 A;  3MFG A;  4KGS A;  1B1Z A;  2BB5 A;  1I4P A;  4XE0 A;  4YT0 B;  4YTM B;  4ZHO A;  1D5M C;  1DGJ A;  1FM0 D;  1R7S A;  2AQ2 B;  2QMT A;  2WXJ A;  2BTE A;  4IOI E;  1IGC A;  3W5V B;  1L0X B;  1PGA A;  5D3I B;  2SAK A;  1IUE A;  4H2A A;  1CQV A;  2N9L A;  2B76 B;  1K51 A;  2KN4 A;  1QOA A;  4KX6 B;  1E10 A;  1TS3 A;  3TEX A;  3AV8 A;  1GPX A;  5HI1 A;  2L1A A;  2YEP F;  3EGR A;  1KTK A;  1QQR A;  1I4X A;  1F0Z A;  3W9C B;  1PGX A;  2N7J A;  4D2K A;  4ZRQ A;  2JYE A;  3SEB A;  1J7A A;  1N61 A;  2KMM A;  4GLS C;  5D3D A;  2DWQ A;  4WUR A;  1ET9 A;  4C56 C;  3R8B A;  1FXA A;  2WDQ B;  1JWB D;  1K52 A;  3DWG C;  5D7G A;  3N9Y C;  1AN8 A;  1GAQ B;  3BVM A;  3GP7 A;  3ZYY X;  3OWE B;  1N62 A;  4EE2 A;  3AE9 B;  3MC0 B;  2M19 A;  3WCQ A;  2WNM A;  4JE3 B;  3PZ8 A;  4N58 A;  4NZL B;  4YWG G;  1D5X C;  1RYJ A;  1FNU A;  5HHD G;  3W2D A;  3U52 E;  3ABV B;  1JRP A;  1MHH E;  1FFU A;  5AUI A;  3V05 A;  3MJ5 A;  1UUP A;  2K5P A;  3EA6 A;  3VR8 B;  1D5Z C;  2Y5P A;  3W1S A;  1FMA D;  2N9K A;  1WYG A;  2L83 A;  4A8X C;  5FR3 A;  1MI0 A;  3P4R B;  4YTP B;  3NVY A;  2PMV A;  1C9F A;  2J52 A;  2JU6 X;  5H92 C;  1VZ7 A;  4P6V F;  3AEC B;  1T5X D;  3R2T A;  1BML C;  1DOI A;  5EE3 A;  1NEN B;  1CZP A;  1OQR A;  4JX1 C;  4WWM A;  1TKY A;  2WXM A;  2KDM A;  2M0A A;  3O13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...