4F4KA

Dna polymerase i large fragment complex 6
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 198
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4kA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f4kA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4kA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f4kA01
5CY4A 5KG2A 3SQ0A 4BE0A 1X2IA 1TK0A 3AVKA 1HYVA 4J9PA 2YNHA 3U3GA 3RJFA 4CEDA 1UAXA 3NDKA 5J0TA 1SZPA 1MSWD 4IR9A 3MR5A 1JLEA 4PQUA 2FBXA 3H8SA 5J2DA 4CF1A 1JN3A 3ZDDA 4CHZA 4CHNA 1RXVA 5KFRA 2VG5A 2GV9A 3EWAA 3QE9Y 5KT3A 2DY4A 1S76D 3AVMA 3VQEA 3M9NB 3K5OA 3KLFA 4I2FA 3Q8RB 9ICVA 4QWCA 8ICMA 4Z6FA 2DFLA 3NF9A 5CYMA 5EOZA 3DLKA 3KHHA 3ZSXA 4FM2A 3HJFA 2IHMA 4YMMA 4DTPA 4UAWA 4F92B 4ICLA 4OKKA 4RPZA 2D0BA 3ZT1A 3RH5A 1U47A 3H08A 2W42A 3AA2A 3KIOA 3RJEA 4DTSA 4JK1A 4LSNA 1JXBA 1S0VA 3O4NA 1S0MA 3EW9A 4I2QA 4DTXA 2YKNA 1TL3A 1HUOA 4C8MA 4RQ8A 4DLEA 2JEFA 4I9LA 4YFKA 1WCNA 5J2KA 2JEJA 4KTZA 5KFMA 4F3TA 2BCSA 2XY7A 4I2GA 3C2KA 4W5QA 4Z4HA 4FJNA 8ICJA 5DQHA 4XQ8A 4F4ZA 3RJJA 1HPZA 3JYTA 5HMLA 2XGPA 1HUZA 1ZQHA 2HHWA 3OYEA 1QSYA 2ITGA 2KN7A 4PWDA 3LZJA 1WSGA 1EXQA 4NYNA 3RBEA 1TV6A 3VN5A 4KHYA 1Y97A 1S9EA 5J2AA 3O3FA 3V9WA 4DQQA 2W9AA 4NLZA 2BR0A 3U3YA 3V6HA 1KFDA 3QERA 4FJLA 1W9HA 3NBPA 4HCBA 4N56A 4RW8A 3QIPA 3HPGA 4FJ7A 4O4GA 3V7KA 1S0NA 1LWFA 1ASWA 2PFQA 1ZQDA 1GOBA 1S9GA 5L9XA 5CA7A 4DU1A 2D0AA 3LALA 4I2EA 2BE2A 1IH7A 2FLLA 4FW1A 4QAGA 3GIIA 1RT3A 2X78A 4CJ4A 1JL2A 5KFAA 5EWEA 4Q5VA 7ICHA 4DSJA 4M3TA 4CJVA 3L2UA 5FRNA 4DQPA 1WAFA 3SUQA 4FJ8A 4FW2A 4P4PA 3H40A 4MFFA 4DSKA 1LV5A 3K4GA 1DOQA 4OPJA 1DTQA 4FJXA 2ZQBA 3ZSWA 3MEDA 5DBBA 3JPRA 4GMJB 1S77D 5JS1A 1SKRA 1VRUA 3RR8A 3K75D 2ZTEA 3BQ0A 3KHLA 4IRKA 4DO9A 4PHDA 4CJTA 4FJGA 4Q0BA 4DTMA 3K5LA 3S3NA 2FLPA 3NF6A 2ZUDA 4RNMA 2ATQA 2HHSA 2W9BA 3ZSVA 3K59A 4F2SA 3VQCA 4KI6A 2VA2A 4CJQA 4H4OA 8ICIA 4F4YA 4YN4A 1IXRA 3S9HA 4J9MA 4DTOA 4QOZB 4RQ6A 1XS9D 4HUFA 4PUOA 4M9JA 2W9MA 3H4DA 1A5XA 2A1JA 5KFVA 9ICJA 4CHQA 5L1LA 5KG3A 3AA5X 1HNVA 2P5GA 5IIOA 2JZBA 1RZTA 1A77A 1RT2A 2HHVA 3L3UA 4FLXA 2DFFA 3HYFA 4J9KA 4J9NA 8ICEA 4DOCA 2QXFA 4FJJA 3K5MA 3KD1E 1BPXA 2JEIA 3RJGA 1NOYA 1RT1A 3L2VA 5BOLA 5J2NA 1KVAA 3MR2A 5CB1A 1ZQVA 2RF2A 5DQIA 2XGQA 2R8GA 5KG1A 1KLNA 4CJLA 1BCMA 4NCBA 9ICWA 4LZGA 3Q8SB 1VRTA 2FBVA 4KB1A 4E0DA 3ITHA 2J6SA 4KLGA 2BCRA 1CXQA 2G8FA 4O5KA 3EZ5A 7ICTA 2R8KA 3MFIA 3OYMA 4FLTA 3QIOA 5KT2A 4DG1A 2AQ0A 3HP9A 5CP2A 4Q43A 4YXMA 4DTUA 3SQ2A 1SL2A 1B9DA 2MUTB 4DEZA 3OYAA 4B9MA 3OSPA 3T19A 5J2EA 4IR1A 4JS5A 4KLEA 3HSTB 1BPZA 4I2JA 5J0OA 4GLXA 4Z4IA 2HB5A 2G8VA 1RT5A 3QNNA 2RKIA 3AVNA 3NE6A 3GQCA 3RB3A 4UAZA 4RQ0A 4CFAA 1ZQXA 5L1KA 3AV9A 4IG0A 5IIIA 4FJ5A 4F93B 2FMQA 1NKEA 4M42A 4F5OA 2OZSA 5DG8A 3EY1A 3RWUA 2PXIA 4JS4A 2DTUA 3AVFA 7ICEA 4DQRA 3TAPA 4M45A 3QEBZ 2YNGA 5KFPA 3OJUA 1Z25A 4RQ2A 3JPOA 1KFSA 4BWMA 3UXNA 3CM5A 4H4MA 1FK9A 5KFHA 4F4XA 2DFHA 4F50A 4E19A 2UVRA 1WSFA 3GFKB 5HLFA 4IKFA 9ICEA 2JEGA 1JLCA 4UB5A 2Y1JA 3SI8A 2EX3A 1WCLA 2LSNA 1MQ3A 4Z6EA 4I29A 2G8WA 5C5JA 3KK1A 1YVUA 1ZQPA 1LAVA 2BGWA 1BPEA 4CJUA 1KDHA 9ICTA 1RDDA 1R0AA 3MR6A 1ZQOA 1JL1A 2IDOA 4NLGA 3AO1A 3QETA 5FROA 4O9MA 3T3FA 4EYIB 2I9GA 4JLHA 3HVRA 1X1PA 3Q8PB 1QSLA 2XC9A 4K4GA 4EYHB 3ASMA 4RG8A 5I3UA 5KTQA 1SKSA 2X6SA 4ECUA 1TGOA 4KLQA 3C95A 5J2HA 2KZMA 8ICOA 3QEAZ 4IRCA 2ZTDA 2O4GA 3SCXA 8ICRA 3MXMA 4DFKA 1VK0A 1AROP 2P6UA 2O4IA 2R8JA 3OS2A 1QS4A 2PYLA 1JMSA 1PZNA 3GIKA 9ICXA 1RT4A 4CJSA 1X9SA 1BPBA 4R65A 5CJ7A 3RTVA 1S1XA 1TVRA 3T5HA 3AVHA 3L3VA 5IILA 3OVNA 2VA3A 2F1IA 3H8JA 3UXOA 2IOCA 3N97B 7ICKA 4CEFA 4OVLA 5CWRA 4CF9A 1ASVA 3BGRA 1S6PA 4F4KA 4F5QA 5HBMA 4RT2A 4FLZA 2PZSA 3PNCA 2UVUA 4F91B 5DDYA 2XRIA 4ED7A 4C8NA 1ITGA 1ZQMA 4B8CA 4KTQA 4RNOA 2NUBA 3IS9A 4CFCA 4O0JA 4CGFA 3VQ8A 4KLIA 1XHZA 4I2AA 1X9MA 4IQWA 2ZJAA 4AHRA 3PO4A 1TKXA 2QKKA 3JPNA 1KEJA 4YMOA 4O3OA 2OPRA 2NRZA 5KG4A 5KFKA 5HHHA 3TQ1A 3KK2A 4TUSA 1UOCA 5KT4A 3QEIA 4DFJA 3QNOA 3AVLA 4DTJA 9ICQA 3QO9A 3RBDA 4KHWA 1H38A 1T8EA 4HHTA 3OS0A 5J2FA 4TSXA 4TUPA 5IIJA 1ZETA 4CESA 1FKPA 4M2YA 4JWNA 1A5WA 3WNEA 3LP1A 3G6XA 5KFXA 1NK9A 4QCLA 4DSFA 1TKTA 4FCYA 3WNFA 3HP6A 2ASJA 1FXXA 7ICUA 1DGSA 9ICMA 4YR0A 2YNIA 1XO1A 1RDCA 2HMIA 4GC7A 4B8AB 3TAMA 4LH4A 1I39A 2M9NA 4CGIA 1DTTA 4OLAA 4OKJA 3B6OA 1IKYA 2HHQA 4FZZA 4FM0A 3AO3A 5J0UA 3JPTA 2W9CB 1U48A 3RRGA 2EHGA 3QZ7A 3V1RA 3NH2A 2IS3A 4LD0A 4MFAA 4YG2A 4OGEA 4HTUA 4R66A 3BQ2A 4J9RA 1ZBIA 9ICLA 2OPQA 1ZQYA 3LP2A 3ZDCA 3AVIA 5CYQA 4ZTJA 3TAFA 1HNIA 4DL7A 1NJWA 1I3AA 1TL1A 2WTFA 4EBEA 2I1QA 4M0AA 2C2RA 2BHNA 4M3ZA 2Z1IA 3K58A 4C8KA 1XWLA 4GC6A 1ZBLA 1JLQA 3T5JA 4HYKA 3JSMA 1NKBA 3Q8MA 4KKOA 4R8UB 1L5UA 3PO5A 4M3XA 8ICSA 4EZ6A 1LWEA 3OYFA 3V6KA 4I28A 1CZBA 1EX4A 5J2JA 1C7YA 1D5AA 1HJRA 3AVGA 4ZH4A 3NHGA 2X6NA 4B9SA 2PFNA 1L3VA 1QQCA 3KD5E 3C23A 3AU2A 5KGXA 2BPGA 5KG5A 3G6VA 4N41A 3THVA 3OSNA 4IQTA 1D8LA 2ZTCA 2HVIA 5D3GA 1VSFA 3K57A 4RQ1A 4G3IA 3V6JA 3V9SA 8ICBA 3K5NA 3TABA 1L3TA 1NK0A 4CK2A 4E7HA 1RCHA 4Q44A 1IKWA 1KVCA 1N48A 5KFYA 3SI6A 1WSIA 1JXEA 3C6TA 1NOMA 5CZ1A 5J2BA 4NLKA 1RTHA 5EWFA 4Z4GA 4R64A 1VSJA 3UQ0A 3KLIA 1NJYA 3ZSRA 4DU4A 2XO7A 2ZJ5A 1SL0A 4NY8A 4MF8A 4IG3A 4CJWA 4KHSA 1NJXA 3SUNA 4E7IA 3NF7A 2KQ2A 1NK5A 4XUSA 5D4BA 5HRRA 7ICQA 4E89A 4EBDA 3RMAA 5HP1A 8ICQA 4CHYA 1S1UA 3ISCA 3PW5A 2PYJA 1Q8IA 4WE1A 4KLDA 2QK9A 1KVBA 1KSPA 3GV5B 4O55A 2IC3A 2VWKA 5BPCA 3V9UA 4J9OA 4NLNA 4Q8FA 4GVMA 4W5TA 4FM1A 4RW4A 1ZQGA 4BGDA 4M9LA 5SZTA 1COOA 9ICAA 2Z1HA 2NRTA 4I9QA 3L2RA 5DB8A 3P83D 5KFUA 4AHSA 4O5EA 3OYBA 4BDYA 2F8TA 2A1SA 5FRMA 2AQ4A 2UVVA 1QE1A 4AHTA 1O1WA 3V7JA 5DG9A 4ED2A 9ICGA 4DF4A 2F1JA 4DF8A 3AO2A 1UA0A 1RYRA 3WNHA 4QW8A 2GWSA 3SJJA 3HVTA 7ICLA 5I42A 4O3RA 3IG1A 4ZTFA 3ZDBA 3IAYA 4KO0A 4FK4A 1JXLA 1BPYA 1RBSA 3AA3A 5D49A 3NFAA 3TANA 4RQ7A 1BPDA 1C1BA 1N56A 3RAXA 2JGUA 1QLNA 4CGGA 3QZ8A 3P5JA 3HPHA 3F73A 4KLMA 3S3OA 4QWEA 1K1SA 3B6PA 4QZ9A 2HNZA 2VG6A 3LWMA 3SV4A 1VSIA 4FLYA 2WOMA 1HYSA 4JV0A 4EEYA 5KG6A 3QINA 4GXIA 1YTAA 2B5JA 4B9UA 5KFOA 3CFRA 5J2PA 2P5OA 4YXJA 4K4IA 5HNKA 1SV5A 8ICHA 3ALYA 4YCXA 3HL8A 7ICGA 1S97A 4EP5A 3SZ2A 2MUTA 1ZQIA 1TK5A 1TVAA 5J2QA 3MECA 8ICVA 3ZD8A 3O4QA 3OY9A 1RT6A 3V1QA 4ECZA 2D0CA 4PHEA 7ICMA 3MDAA 2OA8A 4B9LA 4KLFA 3TR8A 3OYJA 4ECVA 3ZSYA 4QZHA 1EKEA 1BQNA 3I0SA 3HX0A 1T4GA 3OHAA 3V6DA 5IIMA 1RILA 2ASDA 2V9WA 2G8UA 4K8XA 4FJHA 9ICKA 2IBKA 4PGXA 4W5RA 3SPYA 3AUOA 4M3UA 3PX4A 4KLLA 3PW4A 3KLEA 2C2DA 1VSHA 1REVA 2HNYA 5KFFA 1K6YA 4BWJA 4KLSA 3ZCMA 3T1AA 2XCPA 1S5JA 2FPKA 2R7YA 1C0TA 4CCHA 5KFBA 3H7IA 5KFZA 4DQIA 4J2AA 5L1JA 4FS1A 4RU9A 2R8HA 4RUCA 9ICUA 4XA5A 1S10A 4IRDA 3E01A 3ISNC 4TQRA 4JV2A 3ZSOA 4YD2A 5IINA 2C28A 4I27A 3OYHA 4UB2A 4YVZA 4ECQA 3VQAA 4KFBA 3ZD9A 4E7JA 2OYQA 4FXDA 2ATLA 5KG7A 3TAQA 3NAEA 4ELUA 3MGHA 4AH9A 3A2FA 4KPYA 8ICGA 3ZT0A 3NGIA 9ICBA 3QESA 2RPIA 2Y1IA 4JUZA 1WNSA 4KLTA 2W8LA 4LVSA 2XHBA 4BACA 2QKBA 3RB6A 4FK0A 4F5RA 3HT3A 2AJQA 4NM1A 3DYAA 4ED3A 1TAQA 2BQRA 3SQ4A 4M3YA 3LDAA 3ETLA 1CEZA 3HO1A 4P4OA 5KFEA 1ZQLA 4B3OA 4TQSA 1HMVA 5HROA 1WN7A 4FO6A 1ZBUA 4AILC 4YMNA 9ICHA 3SNNA 3TFRA 3LDSA 1VSLA 4ECTA 3C2MA 3HPOA 3B0YA 2G8IA 4BXOB 4K4HA 5J0QA 4YNQA 2FBYA 3KLGA 3LAMA 5DGBA 4BDPA 3WNGA 3RB4A 3NGZA 7ICSA 1HRHA 1K1QA 2ISPA 3RJKA 5J0PA 2C2EA 4RQ3A 4O3SA 2DFEA 3DLGA 5J0WA 2BCQA 2IGIA 5KT6A 1KFTA 4ZHRA 1ASUA 2ZJ8A 4UBCA 5D46A 3M8PA 4CF2A 2IMWP 4JV1A 1MQ2A 3NGYA 5C24A 1LB2B 5KFDA 4CJ5A 3H8WA 3ISBA 1RBRA 3DRPA 4ID1A 3AU6A 1RTJA 2R8IA 1BVSA 3RMBA 1RNHA 1UT8A 1YT3A 2BANA 1QSSA 4F5PA 5DB6A 4KMUA 1XSPA 1ZQRA 1L3SA 1XSNA 3BQTA 4GW6A 3M9MB 2HHTA 7ICJA 1SL1A 3QEXA 4ED8A 3C21A 1G15A 3VQ7A 3TAEA 4O44A 2G8KA 4QZ8A 1EP4A 4QZFA 4RPXA 1TFRA 5KFWA 3DLBA 4O3QA 3DOLA 3RH6A 4QWAA 2FPMA 3G10A 4DOAA 3F9KA 5KG0A 1A76A 3CG7A 1LAWA 2ALZA 4C8OA 2V4RA 2KFZA 4CIEA 4E7LA 1NOZA 1BGXT 3MGIA 4DLGA 4DTNA 5J2CA 4MF2A 2OWOA 4MEYA 2DPJA 4AHCA 4PA1A 2W9CA 3TARA 2BKEA 5KFJA 3RRHA 4CIGA 1WSJA 5DQGA 5J0SA 4KLHA 5KFNA 2E6MA 4H8KA 1ZJMA 3PX0A 4FJIA 4HCCA 3ZSZA 8ICPA 3SPZA 1RBTA 3MAQA 3KLHA 2IAJA 3L2WA 2G8HA 2HW3A 2B21A 2AGOA 2YV0X 4PHPA 1RBUA 2BPCA 3PY8A 1BIZA 9ICOA 4NCAA 3C5GA 1ZQEA 4I2IA 2Q3SA 4JRPA 1WSHA 1TK8A 3ZSQA 4M3WA 3MXIA 5DG7A 3PW2A 5EU7A 1Z00B 5HMMA 4Z4FA 4ELTA 4R8UA 3VA0A 3SV3A 1NKCA 4B08A 2YHBA 1LWCA 4QZDA 5J2IA 1VSKA 4O3PA 1VSMA 3LPUA 3LANA 1TKZA 4LH5A 3C2LA 5J0YA 4CECA 1V9PA 3KJVA 5K14A 3IM1A 1QHTA 8ICZA 4M6WB 1RDAA 4F8RA 5KFGA 3JPSA 3UPQA 3Q8KA 4R63A 3QEPA 1JLBA 3NH1A 1RYSA 5J29A 4W5OA 1CUKA 2PI4A 3VQDA 5HRSA 4DSIA 1NK7A 4PGQA 3PR4A 3TAGA 3SQ1A 4CE9A 2OZMA 4N76A 1ZQUA 4FBUA 3VQ4A 4K8ZA 4DL4A 1NJZA 4KB0A 3MFHA 1IO2A 1B9FA 2D5RA 4UQGA 3AVJA 1Z3EB 2Z1GA 4AHVA 2H5XA 5FDLA 4F3OA 4CJKA 4GXKA 1T05A 3D0PA 1IKXA 2RDJA 4ECYA 4XRHA 4F2RA 2ZD1A 4PPXA 7ICRA 4PY5A 5J0RA 3DOKA 3BJYA 4QZBA 4JRQA 2BCUA 8ICAA 2OPSA 1C6VA 3LPTA 4Z4CA 1ZQTA 2HNDA 4M3RA 1IG9A 3DRSA 4IFYA 3V1OA 3JPQA 9ICPA 5J2MA 2HVHA 5DBCA 3KK3A 1U49A 4CEQA 4TUQA 4Q8EA 1ZBFA 4HVJA 1ZQSA 4DL2A 4RZRA 1XC9A 3TI0A 4J9SA 3PMNA 1BIUA 5L1IA 7ICIA 3GIMA 4UB1A 3MDCA 4FYDA 4KITB 3OYDA 4ED1A 4FZXC 3V72A 4ECXA 5HP4A 1B22A 4N5SA 5HRPA 3OYGA 4B9NA 4MFCA 1EETA 3D45A 5IIKA 2ZUBA 3LP3A 1UA1A 8ICTA 2MAXA 3LK9A 8ICLA 4ELVA 1Y88A 3T5LA 2PFOA 4XIUA 3ORYA 4RNNA 2AU0A 3M9OB 3OYLA 4CGHA 2V4QA 3ZDAA 3MBYA 4J9LA 3C1ZA 2C22A 3ZT3A 3C6UA 4Z0UA 4KHQA 4F5NA 5KFTA 3G6YA 4Q45A 4CEEA 4CHPA 1U9LA 5DB7A 4DOBA 3M8SA 1T3NA 3OJSA 4HUEA 1ZQQA 4KHNA 3DI6A 5KI6A 8ICCA 3BDPA 5KT5A 3G0ZA 2LYHA 3LAKA 5KFCA 3DLEA 3SYZA 3NGDA 4Z4EA 5J2GA 2DPIA 3ZDEA 2F8SA 4GXJA 3OGUA 4KLJA 4CK3A 1J9AA 4CEAA 1A5VA 1S9FA 4IFVA 4O0IA 5DDMA 4NYFA 2HHUA 3GIJA 1WLJA 1XI1A 4MEXA 4UB4A 4UBBA 1Z26A 4CHOA 5DK5A 3MEEA 4PH5A 1ZQAA 4E1MA 4IBNA 5KFSA 4CF0A 5KFLA 9ICSA 5CZ2A 4YD1A 3VQ6A 4X5VA 1HQUA 3ZT2A 3RMCA 4CIFA 1XHXA 2BQUA 2J6TA 1S0OA 4Y1CA 2NRWA 4M04A 1BHLA 2NRVA 3MABA 3V81A 4DFMA 3NTUA 3VQ9A 3HK2A 1HJPA 5DKWA 4N47A 1KRPA 3C94A 1SUQA 2ETJA 4P2HA 4IDKA 4ID5A 4DSLA 2GBZA 2XCAA 4RUAA 2VWJA 4KTWA 1J53A 3EPIA 1T7PA 4DU3A 2J6UA 2P1JA 2KZ3A 4W5NA 5SWMA 3PVXA 3V7LA 4FVMA 3HXMA 3ZT4A 2X74A 4P4MA 8ICWA 1BL3A 2Z1JA 3L8BA 1HQEA 3QLHA 5JS2A 3AVAA 7ICOA 1ZQKA 4I2BA 4R5PA 3NF8A 3I8DA 3VA3A 3CYMA 3HM9A 1N5YA 3NH0A 4KLOA 2ZUCA 7ICVA 3OYIA 3AA4A 3RJIA 4FLWA 4CEBA 3ISDA 1QTMA 4HUGA 5F9NA 4RQ4A 2XY5A 5JUMA 3RJHA 3DM2A 3TWHA 2OPPA 4LZDA 3O3GA 4TURA 4YQWA 3EYZA 4UB3A 4E1NA 1RBVA 2P51A 4Z6CA 4CF8A 2FMSA 4RPYA 4I2CA 5EWGA 4RQ5A 4J2DA 1BISA 5KRSA 1BI4A 3HW8A 1SKWA 4ED0A 4KREA 2VG7A 3PR5B 4FS2A 4MFBA 4DWIA 4EBCA 3M8RA 3ULDA 1B92A 1ZQBA 4M47A 3PUFA 1CZ9A 4IQVA 2WONA 4BE1A 2BGGA 4KLUA 2PFPA 1RXWA 2W9BB 3TFSA 1MU2A 2KW4A 3AVBA 4OPKA 4I2PA 4I2HA 1VSEA 3IRXA 4OKEA 1DLOA 9ICFA 4E3SA 4RW7A 2YKMA 4FBTA 3MEGA 1RTDA 8ICUA 4KHUA 4KN4A 3OYNA 1KLMA 2JLEA 3UIQA 5KRTA 3NCIA 1ZYQA 2GUIA 5CHGA 4OJRA 1X9WA 4EP4A 2BQ3A 1NK4A 2A1JB 3IHQB 3LZIA 4NCGA 4YR2A 4BXOA 4FJKA 4MQ3A 1J5OA 1C0MA 4CJRA 1JX4A 1VSDA 2JZBB 1RT7A 4CJFA 1MC8A 3RR7A 5DLGA 1BI4B 4CJEA 3CQ8A 4DL5A 4DMNA 1LW0A 4EZ9A 3KKRA 5KFIA 1C0UA 4O5BA 4DS4A 4BE2A 5DMRA 4QZIA 2FLNA 1BQMA 1UWBA 3N4MB 3OS1A 3EPGA 2B4JA 1JKHA 1C1AA 2UVWA 4AHUA 4L8RB 1ZQZA 4RT3A 8ICFA 1N6QA 4QW9A 3GV7B 4I7FA 3QEWA 1FKOA 4QZAA 2BDPA 3P1GA 3RAQA 4M41A 3H4BA 4YR3A 2KZZA 4FZYA 1WSEA 2VA8A 4CFBA 4NXZA 1KTQA 3KHGA 2Q0ZX 4YP3A 4DSEA 5C42A 3I0RA 4ED6A 4YFUA 3L2QA 1U45A 4CJPA 4DFPA 5KT7A 2ZE2A 1IM4A 8ICYA 1ZQFA 2VANA 4O5CA 2E6LA 3AVCA 3LP0A 4OGCA 4DL6A 4CERA 4J2EA 3OYKA 4UAYA 4B9VA 4KV8A 1UT5A 3C5FA 2A1RA 2PY5A 4FLVA 1C1CA 1D8YA 3OHBA 2P66A 3FDSA 3VQ5A 3CM6A 2FBTA 3Q8QB 4CK1A 3CFOA 7ICPA 3U6FA 3T5KA 2AGPA 4LSLA 4KRFA 2RDIA 3DLRA 4ECSA 3GILA 1ZBHA 2HHXA 5C25A 1JLFA 3BQ1A 1GOCA 1JLGA 5HHIA 3E2EA 3MXJA 4B9TA 4LY7A 4DTRA 2I5JA 8ICKA 1ZQNA 4CEOA 4RW6A 3KHRA 1NK6A 4E7KA 2B6AA 2FPLA 3VQQA 1TAUA 1IKVA 2F1HA 2KTQA 1EXNA 3JPPA 7ICNA 3SUPA 3V9XA 3KTQA 1XSLA 4QWDA 4OLBA 3PV8A 4CGDA 1S1WA 4JWMA 2KFNA 3PMLA 4ECWA 3M8QA 1F21A 3DLHA 3PW0A 4O3NA 8ICNA 4J2BA 5HRNA 5J1EA 9ICIA 4CEZA 5DB9A 5DGAA 3S3MA 3VQPA 3UQ2A 1Z00A 3FYHA 3PW7A 3AO5A 1RDBA 5T7BA 7ICFA 3B0XA 2W8KA 3UXPA 4CGJA 3RMDA 2FMPA 3RB0A 1U4BA 4M6WA 2BPFA 5KFQA 4NM2A 3V9ZA 2IHNA 1LW2A 3VQBA 4QWBA 1T03A 4CFDA 1RPLA 2AGQA 2RN2A 3AO4A 3HWTA 1Q9XA 1D9FA 2IA6A 4QZCA 2ISOA 3GV8B 1WAJA 5DBAA 3O3HA 1ZQJA 3FFIA 4J9QA 4C8LA 4KN7A 4M9HA 1CXUA 5KGWA 1B43A 1GOAA 5E41A 1TKDA 4KAZA 1Q9YA 3K2PA 1S6QA 4FJMA 1NK8A 4DQSA 2XY8A 1S1VA 1KCFA 3OYCA 4IQUA 5DLFA 4BDZA 3GDXA 9ICNA 3DMJA 4CJ3A 4DS5A 1ZQWA 1ZQCA 2BCVA 1RTIA 3CFPA 4F4WA 1HYZA 3MR3A 4RW9A 4PGYA 4M9GA 1TV9A 4M9NA 4G1QA 2FC0A 5BOMA 2ASLA 4QZGA 1BCOA 1YTUA 3SUOA 1L3UA 1D9DA 2E4LA 3KKSA 4Y1DA 5TZVA 1ZJNA 1J54A 2PI5A 2XY6A 4FJ9A 4DL3A 9ICRA 4KI4A 4FLUA 4Z6DA 3RH4A 1JLAA 3PX6A 4QZEA 4PHAA 9ICCA 8ICXA 5J0XA 1JIHA 1W0HA 3C1YA 5F9LA 5CR0A 4I2DA 3DRRA 1XU4A 3QEVA 3LWLA 2YNFA 2P6RA 1S1TA 4FK2A 1CLQA 2NRXA 2YHAA 3V4IA 1U04A 3Q8LA 2F96A 4ECRA
chains in the Genus database with same CATH superfamily
1FIQA 1FWKA 2V8GA 1IBLF 3SQ0A 4BE0A 2DJWA 1TK0A 2XYPB 3AVKA 3CB4A 1UVMA 1AUSL 2L9DA 2Q66A 3C16A 2LQBA 4HHJA 1UAXA 3NDKA 3ZZRA 1SZPA 1MSWD 5LJVA 4C3LA 2KRRA 4CYUA 2FBXA 3ZDDA 1GK8A 4CHZA 5KFRA 3GCXP 4K50A 3N4QA 2KL8A 1UJ4A 5KT3A 2DY4A 1KKHA 4EHTA 2ZG6A 3Q89A 4I2FA 3GBTA 3B9JA 3MCPA 9ICVA 4WFBQ 4QWCA 4Y65A 1JLAB 5CYMA 5EOZA 3DLKA 3ZTRA 4HACA 1P1LA 2HBYB 4DTPA 1N54B 1WF2A 4ICLA 2YY6A 4DR5J 3RH5A 1U47A 2VYPA 1NI3A 1YJTA 4X4PA 2MPUA 3ENWA 4DUZK 1S0MA 4I2QA 2HFUA 1NSKL 3CPWR 2YKNA 5CYQB 3GOIA 1YITS 5TKYA 4DLEA 1TL1B 3T9ZA 1N60A 1WCNA 4R25A 5J2KA 2JEJA 4ZIVA 2ACMA 1T02A 3C7NA 2XY7A 4I2GA 1YJ9S 3C2KA 1R8BA 4DR5F 4FJNA 4F3MA 3JSMB 1SJQA 2QA1A 4DV5J 2PEBA 4NA2A 2QMXA 2VPZB 2XGPA 3RU0A 3QJLA 3HJVA 3ZTOA 1QSYA 2ITGA 3LZJA 1WSGA 3TJAA 3E9PA 2ZIUB 4NLDA 1Y97A 1VRQC 1RWUA 4XK8C 3O3FA 3FJ2A 5F3TA 4PABA 3M2RA 3U3YA 2Q0RA 2DKXA 4HCBA 4RW8A 3US5A 3QIPA 3HPGA 2IJNA 5DM7Q 2ZOFA 4ZVOB 3V7KA 2EKNA 1RUSA 1ASWA 5CA5A 4DV5F 5A0LA 4MK7A 1QVGR 2W03A 2W25A 2P9IA 4CBXA 1VI7A 4QS9A 2CPZA 2VGMA 5D3GB 2I6XA 3GIIA 1B64A 3P3DA 2W4PA 3R3LA 5I4MA 3IBCB 4DSJA 4M3TA 4CJVA 3L2UA 5FRNA 2FJBB 3QT5A 2FY1A 5A8RA 1KBUA 1MROB 2J7KA 2K7KA 2E29A 1S99A 2VPYB 2CRXA 2NNWA 4DR3K 1SS6A 2ASMA 2E7XA 4GMJB 4KQZA 4CO3A 1SKRA 2KVIA 3K75D 4BG9A 3Q2SC 4DO9A 4PHDA 2BMBA 4Q0BA 2OM6A 3MMCA 3WK4A 3QWPA 1UMJA 3M6KA 4YOVA 4B3TK 4WE1B 3GDQA 3OBIA 2F65A 3ZSVA 4D3HA 3VQCA 4ATNA 4KI6A 4BG8A 3HCXA 4LIRA 4ILJA 1WUAA 8ICIA 3DXSX 3D1QA 3NP5A 3JXOA 1Z1ZA 4TVAB 2IYGA 4Y2SA 3ZNJ1 3MHYA 3PXGa 4BREA 2EZZA 4DU7A 2ZIXA 1U0SA 1UZHA 3B82A 1DURA 4DTOA 4RQ6A 2RH3A 4M9JA 3H4DA 4DCJB 2I2YA 3R6LB 2LI6A 3CCUN 1XR5A 5L1LA 3K89A 2KV2A 2DF4B 2YXLA 5IIOA 3GTYX 1RT2A 2HHVA 3BZCA 4K4VA 3DLLQ 4OJHA 2AMCB 3G8SA 3HYFA 4DOCA 3CCMN 5I42B 2KH9A 5AQMA 6FDRA 3IG1B 3H25A 4IUFA 4N8NA 2YKOA 2ZJRQ 2B9YA 2GZOA 2JEIA 4MK8A 4OHWA 3TVYA 1NOYA 1RGIA 2GEMA 4DHVA 5B0GA 3MR2A 4JI4K 2EH9A 1C1BB 2QB1A 4OJ6A 1ZQVA 3EGVA 4USJC 1L8LA 2XGQA 2UUBJ 1VK8A 2R8GA 2VFSA 4JI3J 4ILHA 5KG1A 1YXQA 2HNZB 2QG9B 9ICWA 4KB1A 4E0DA 2YH1A 2J6SA 5DZ6A 3CMAS 2VCPA 1C0GA 1CXQA 5ALLA 3FMBA 3TX8A 4TU7A 2MA1A 2R8KA 4FLTA 5KT2A 2AQ0A 4BRCA 4HHHA 4QBUA 3F2CA 1F9HA 3SQ2A 1SL2A 2UUBF 1B9DA 1TTHB 4EFAC 2KSOA 1SJRA 3LQVA 1BOTO 4BR9A 1FW6A 3OYAA 5D4LA 5BPNA 4QOTA 1Y5LB 2HVDA 3EE9A 2CFXA 1M5SA 1RT6B 3HZEA 2HB5A 1RT5A 1HHQA 3RB3A 5A8KB 4CF5A 2HSZA 1HHTP 4IO1A 1YDLA 3I0SB 2FDRA 5IIIA 1DQAA 1WD6A 3LDQA 4F5OA 7FDRA 2BM1A 2A1AA 4K2XA 5DG8A 4LSZB 4H5NA 4LMZA 3LPYA 4CF3A 2MGZB 2YNGA 1BE4A 4YB1P 3KLEB 4B1XB 2A2DA 1NNEA 1NPPA 4LF6J 3GSIA 4BWMA 3UXNA 4UW9A 3CM5A 4A2BA 3I31A 1U1LA 1SH0A 2M0NA 4DN0A 4EX7A 1RDRA 2UVRA 4KB7A 1JLCA 1OH8A 4UB5A 2Y1JA 4PKGA 2QN6B 3E01B 1O13A 2G8WA 3MZIA 5ETLA 2BH1A 4D3GA 1ZQPA 5D4OA 2O8EB 1URRA 9ICTA 2BJ7A 3WK7A 4LF6F 4NLGA 3QETA 5M1OA 3A8KA 3S7RA 2E8PA 4KHMA 1APSA 1CPZA 2R2RA 1T0TV 4CLYA 3HVRA 1X1PA 1QSLA 1PILA 3HSZA 3I96A 5I3UA 5EGYA 2X6SA 2GTDA 5K8MA 1KC8O 2CPRA 3GLJA 2CAJA 1TGOA 2J8SA 3AMZA 2KZMA 2UXDK 3HHEA 4JKGB 2O4GA 3MXMA 3G8QA 2QRRA 1H73A 2XQCA 1M6YA 3Q86A 3OS2A 1RWVB 1BU6O 1GTEA 1ILYA 2MLZA 2HF4A 2IOFA 4CM0A 2RHFA 4Z7CA 2UUCK 2OHFA 3UCZP 1JXVA 5CJ7A 4LRAA 1IR2A 4B3MJ 2PBDA 3J80Y 3OL9A 3FAHA 1SC3B 4KC5A 5CH7B 4H0PA 3I5CA 4OZ1A 2HEKA 4FF2A 3F5EA 3KG0A 3CC4S 2KJ9A 2B51A 4F5QA 4CLWA 5HBMA 2VJ4A 3EEQA 3DEEA 2FPHX 5KPRA 4FLZA 1ZS6A 4ZHRB 3CC2N 3QNMA 4B3MF 4ER8A 5KL8B 4CO0A 3C6AA 4C8NA 1H3DA 2RHQB 3AGKA 3M5RA 4KTQA 4B3RF 3IKMA 4ISGA 5HSPA 2IVFB 2DKZA 1DY3A 4L75A 4KT0C 5AJ3J 1RQNA 3HILA 2G06A 2HIQA 3PRVA 5AQPA 4KLIA 1XHZA 4OMFG 4I2AA 4IQWA 3DKDA 1L8OA 1KBRA 2BANB 4AHRA 1YG0A 3CJ9A 2CH6A 3TW0A 1LFPA 4O3OA 1CJTB 4A2AA 4K8RA 4PL7A 5KG4A 5HHHA 3KK2A 5GIOA 5KT4A 3H5UA 2P9PA 1N32F 2P9KB 2V4JB 5KOWA 3D6FB 4Y0FA 2DCUB 3QO9A 4BRKA 4KHWA 5AJ3F 5JMVA 2BVZA 5AKXA 1T8EA 2AJ4A 4TUPA 1FKPA 4RX6A 4JWNA 1HKCA 3WNEA 2GV1A 2M7SA 3MC1A 4WP3A 1NK9A 3GJRB 2LYBA 1TKTA 2QJ3A 5AM2A 2MZQA 1SCJB 1U6FA 2KG5A 1DGSA 5JMNA 2YNIA 2Q6BA 1FJEB 5GADI 4HTLA 4IOCQ 4FPAA 3Q23A 3UNYA 2M9NA 1YIJS 1I39A 1XNSA 1V5VA 3R7BB 4ILMA 4OKJA 2EANA 4CNZA 3EN9A 1IKYA 4FZZA 3FGUA 4OYOA 4HTJA 2MSNA 1KONA 5AI5A 4DPOA 3SCKE 3KJFB 3FSIA 4HHUA 1KDNA 3BGFA 3CWJA 3V1RA 1KOOA 4MFAA 3J8AA 3IN5A 4OGEA 1UQVA 1VGYA 3VEZA 4HTUA 3DV9A 1AZSB 2W7PA 4PPDA 3VGUA 2OPQA 2WFBA 2ILZA 2QEXN 3ZDCA 3AVIA 3PSIA 2IY5B 4ZTJA 3TAFA 2GS8A 4M0AA 3SQGA 1SZHA 3LP1B 5HMZA 3QYYA 4AQYJ 3QRPA 4C6AA 3ZYYX 4CO4A 1XWLA 4MO4A 4RJVA 5ALVA 1DK2A 2HFOA 2ZJQL 2FZCB 4KKOA 3QIDA 5ETSA 4M3XA 4WQ4A 8ICSA 3VETA 4K4TA 3CMQA 3OYFA 2QFIA 2HMIB 1VQLS 1U6ZA 4X62J 3MN7A 4OZNA 1M0SA 1NZBA 5B0BA 4DV7J 3CJ4A 4I28A 3KJVB 1C7YA 1D5AA 3AVGA 1WI8A 1NJIT 4AQYF 3AHPA 3HHLA 5IT0A 2YKPA 1QQCA 4USWA 2VF3A 3KD5E 1RHUB 2RILA 3AU2A 3SSQA 1JLBB 4DV6K 2BPGA 4N41A 1XMQK 1FXRA 2ZTCA 3NKYA 1QZ5A 3AJ2A 1JMTA 2HVIA 3H8YA 3UB5A 3DU6A 4G3IA 3GG1A 4X62F 2UXCJ 2Q43A 4KJIA 4DV7F 2O6KA 3V9SA 1RWPB 5AIBA 2O8FB 3UDCA 1RCHA 3DJCA 3EGNA 3TO8A 5KFYA 2EWHA 3CJAA 1MLAA 2BJDA 4LRCA 2F4VK 3HTVA 3AD7C 4NWBA 3A3NB 3C6TA 5FDLB 5HMYA 4FKXA 1A9NB 4NLKA 3CJ2A 2UXCF 1NO8A 3W0LA 2DHAA 2IIHA 3KLIA 2J76E 4DU4A 1EWRA 4A61A 2VQFF 4NY8A 4IG3A 1NJXA 1FRLA 4J9VA 2CNKB 3B8AX 4IFYB 1NK5A 2Z4PA 5ALPA 4E89A 4TU8A 3NOGA 4JI5K 1OY8A 5AKZA 2JRSA 1RABB 4XPEA 4DUYJ 4O55A 2W2MP 1KQKA 2EFNA 3RUBL 1L6NA 1F0XA 5BPCA 3M6VA 2DL0A 4P0PB 1KEKA 4Q8FA 4RW4A 9ATCB 4FF3A 4K43A 5A0YB 4BGDA 5SZTA 4ZJQA 5HAOA 3LOUA 5DB8A 2U2FA 2NS1B 4K42A 5KFUA 5IQ6A 4O5EA 1D9AA 3A0HU 2VHGA 1FESA 4UB8U 4DUYF 4QS7A 1O1WA 4AHTA 5L39A 2QLXA 9ICGA 1V97A 4X4NA 4L72B 2F1JA 1SH3A 4M5HA 2LVWA 4N8OA 3OLBA 4USAA 4CLKA 4QJVA 1X60A 5AT1B 1RYRA 3WNHA 1TR0A 2GWSA 1SQFA 3O44A 4A8YA 7ICLA 3A3PB 2LQ8A 2V6AA 3FZLA 4USIA 3ZDBA 4KO0A 3LGHA 5AQTA 4CGGA 3RAXA 3MGJA 2JGUA 3F73A 4QWEA 2RQKA 4QZ9A 3LWMA 3SV4A 4WYLA 4BCAA 2PEHA 1HYSA 4JV0A 3BSCA 3MTJA 2F4FA 4NOHA 2E9RX 2QV6A 1H6KX 3SCJE 3MUVP 5KFOA 5J2PA 3ALYA 8ICHA 3SMVA 3MPVA 5AXMA 2QYGA 1AA1B 1OYDA 3K0JA 1XO0A 1XN9A 4Y0WA 4FZLA 5C15A 4FYXB 3MMBA 3EL2A 1F5SA 4XH4A 3K8WA 4C48A 1G99A 1XR7A 2RLTA 8ICVA 1YZ7A 3HHDA 3OY9A 3V1QA 4BC3A 1ESVA 1X40A 1SUQB 4IDKB 2OA8A 4B9LA 2BA9A 4ID5B 4ED5A 3TR8A 2A18A 2FVQA 2CJ9A 4QZHA 1EKEA 1BQNA 4OHZA 3OHAA 3V6DA 1RILA 5AM3A 2CVIA 3OTCA 5AIAA 4YB6A 3MOJB 2YHYA 3DLJA 2KHOA 5JVGL 1NG9A 5F1XA 3PX4A 2R18A 3CO0P 4KLLA 3S01A 2WF6A 3A12A 1EHWA 1WWVA 1REVA 3H3OB 5KFFA 2KXHA 4KLSA 3ZCMA 3LYSA 1SV5B 3VAMA 4OI3A 3MM5B 1V38A 2YJEA 2NYHA 4OCZA 2R7YA 2HSEB 1C0TA 4CCHA 3AGRA 4UUXA 5KFBA 5KFZA 4WFNQ 4RU9A 4J90A 2RHKA 4IRDA 2ZBPA 4RNFA 3PLAA 3DM2B 2XHWA 3D6HB 2C28A 3OYHA 3CCSS 4UB2A 1X4HA 1FNXH 2CPIA 2ATLA 1S49A 3TAQA 1O0PA 3CCJN 4DCOB 1OO0B 1NMNA 3MGHA 4OD0A 1HJOA 1W25A 3A2FA 5D6GA 4KPYA 5T7LA 4ZVEA 1F5CA 2P9CA 4FL9A 1CULA 1Y9OA 4C7ZA 4WFXA 2RPIA 2A42A 2XI9A 3PIPQ 5HN0A 3L7OA 3OR1B 1FA0A 3TP2A 4MFBB 2AJ0A 4LVSA 3NNCA 1U1KA 5F0WA 3A13A 2JH3A 4DL0C 3PJWA 2EWSA 3JAMY 4DHYA 1HBNB 4NM1A 4PYAA 1X0PA 3VTHA 3SBMA 3HO1A 4RW7B 1ZQLA 4TQSA 2FTRA 5G5HA 2HS4A 1WN7A 1RTDB 4USKA 5L8RC 1KLMB 1HNXJ 1R27B 3MMAB 1HD0A 4JI7J 5GADU 1X9JA 3C2MA 3HPOA 1QAYA 1RSCA 5E3RA 2G8IA 5J0QA 2FBYA 4BDPA 2KYZA 3NGZA 1LOTB 7ICSA 5J0PA 4KH4A 5J0WA 3KVGA 5KT6A 1KFTA 2IM0A 3FMWA 5BYRA 3J7YI 3VAFA 4YUDA 2G1HA 3ILJA 2MKJA 4JI7F 3NGYA 4I56A 4HLBA 1NSAA 3ISBA 3DRPA 1RTJA 3QMLA 3RMBA 1VQ6N 5H1SV 3I55S 2DR7A 2V2ZA 4L73A 1YT3A 1NDKA 1R8AA 3DGPA 5ETRA 3NGSA 1Y7PA 4F5PA 2ZWHA 3NAHA 3B78A 3H8MA 2GVZA 2YWHA 4B3OB 1QVFM 1LOUA 1LK5A 2ZH1A 3NG8A 2E7VA 3QEXA 3C21A 3TVKA 3VQ7A 5M1KA 4KYZA 4O44A 1VQPS 2B4PA 1ECWA 4BR2A 5ALKA 4QZFA 2LKYA 2ZE2B 3WKCA 4LC9B 3ULEB 3RH6A 3NLCA 2FPMA 2Y0BB 3F9KA 5JVHL 1A76A 3LP0B 3ILIA 4NL9A 4O0NA 5LMNK 3QU2A 1BGXT 3D2FB 1LQ9A 3WC2A 5J2CA 2HF3A 2MZSA 2DGSA 1T95A 3BF3A 4F04B 1JLFB 3TARA 3M2UB 5BXIA 3THWB 3RRHA 1L7OA 3CMES 1NDLA 3MPYA 2MMYA 5DQGA 5J0SA 2E6MA 2I5JB 3BB5A 2CPEA 2QL7B 4FJIA 2B0GA 3MM9A 4JKDA 1IKVB 3TKAA 3N6LA 4IDHA 3TOQA 2GH1A 2IAJA 2P9UB 2G8HA 1YRTA 1HBUB 5ADXA 2AGOA 2YV0X 3QSIA 1LKYB 2ZKTA 4I2IA 4JRPA 4KGXB 4WF9L 4ZKAA 1YAGA 5DG7A 1NU4A 5EU7A 2B4VA 4CJ7A 1Z00B 2YWKA 4KY3A 5HMMA 3CPEA 1FD8A 4R8UA 4IOAQ 3AJ1A 2G1DA 3SV3A 3CP8A 4QZDA 3EXYA 1QQ6A 1VSKA 4X65K 3PYEA 4P71A 2G07A 3IM1A 1RDAA 2ZC3A 5C2CA 1HWJA 1LW2B 2VPWB 4M94A 1VMBA 5CZVA 1AW0A 2AZ3A 5J29A 2BUNA 3B6BA 3D1HA 8RUCA 3AQFA 4WIQA 1EJ7L 4WWSA 4PGQA 1KAXA 3DXMB 3VCBA 4WJBA 3TAGA 1FDBA 3S8SA 1LCUA 4NL9C 5FPNA 5ALUA 4BC2A 5M1PA 2WSEC 1IO2A 1B9FA 2IPOB 3CD6N 2E1RA 3MD1A 3OQ2A 4CJKA 2YX8A 1WG1A 1T05A 3M30A 1ZD4A 4C1NK 4XH5A 2RRAA 5KAIU 2E2PA 1LWCB 4PY5A 5J0RA 3AT1B 3DOKA 4BY9C 3ZEUB 2OPSA 3AAPA 2HBRB 3CD5A 2BV3A 1IG9A 4K4WA 3JPQA 1DEJA 3HF5A 3MPDA 1U49A 1BC6A 4TUQA 4QYZJ 1ZQSA 3RG6A 2ZH6A 1F5AA 2DR9A 4DL2A 3PMNA 2FHJA 4NPOA 2NSBA 4MYUA 5BPLA 3MDCA 1C4CA 2EK1A 1FDDA 2R3VA 3V72A 1REGX 1JCGA 5HP4A 4JK8A 1YSJA 1B22A 4N5SA 3G96A 1S1TB 1F3FA 1RDFA 1R0BG 3JTOA 4M63C 3FCHA 1WG5A 5IIKA 3LP3A 1HI8A 3BV8A 1WI6A 5M1NA 1MN8A 3T5LA 1Z1VA 4XIUA 3ENBA 3C16B 2FYXA 3MBYA 3C1ZA 3CRXA 3U1NA 1ED1A 3P49B 4CIOA 3OL6A 2M52A 4CYUB 2DGVA 2PC6A 4Y2JA 3QGGA 4A8SA 4CHPA 3A3OB 3SAFA 4B1ZA 3SCLE 4HUEA 5B09A 5KI6A 2LYHA 3KWGA 2GC8A 4Q2LA 3A0IX 3AOBA 4GXJA 5JJBA 3OGUA 4KLJA 4HR2A 4CEAA 5CYMB 1NMEB 1A5VA 2OD4A 3N5FA 3IFEA 2PFUA 4B3RK 2N3OA 4HACB 2CZVC 1XI1A 3O5TB 4TY9A 1SXLA 2QLFB 5DK5A 3EX7B 2N7YA 3MEEA 4ICLB 2X51A 1ZQAA 2VD3A 3OV7A 1KHWA 2J9DE 3W2VA 4CF0A 1K9MO 3J7AP 5LT5A 1HQUA 4UAUA 3RMCA 4CIFA 2AYEA 2IVMA 4I2QB 3WXJA 2AW0A 2IMOA 1QQNA 2NRWA 2YKNB 2NO5A 3V81A 2KB2A 2WBRA 4OFZA 2W2PP 4PG5A 3J7AN 4YHHK 3C7NB 5H2FU 1V3ZA 3ID8A 3C94A 2D74B 3PJ9A 5ETVA 4LF7K 3TPQA 1VQ8N 4DSLA 2ZDPA 8ATCB 5EX5A 2AIRB 3EDQB 4KTWA 4NE9C 2A5XA 1T7PA 2J4RA 1BDGA 2P1JA 2KZ3A 1WEZA 3M2RB 2G13A 3V7LA 4FVMA 3IRWP 4RW8B 2MY7A 3QU4A 1EARA 2JFKA 2HHHJ 1HQEA 3QLHA 2V94A 2V51B 4R5PA 2P9IB 3VA3A 2AP6A 1ZOLA 2B56A 2XI3A 1N5YA 2LQ5A 2ZUCA 3O9RA 5F9NA 4RQ4A 2XY5A 5LM7E 5JUMA 4LZDA 2HHHF 2A3ZA 5A8RB 3J7YU 1RHJB 1YHQN 2ZF5O 3M8WA 2YX7A 2P51A 4MTPA 2I8EA 2AXTU 1IWGA 3AY0A 4RQ5A 2H48B 2FE9A 3AB4B 1KVIA 1SGGA 1RKIA 2RRDA 2QTWA 1TL5A 4ED0A 1VCTA 1VQYA 1TU0B 5LOQA 5JU5A 5AFUH 4Q0BB 4FS2A 3H1VX 1IBMJ 1GLCG 1K9MT 4DWIA 4EBCA 3PYGA 5BYSA 1F9EB 3MMCB 2KKHA 4OJPA 3LDLA 1B92A 1PG5B 2IFXA 4IQVA 3O8MA 2ES6A 3U26A 2PFPA 4IH6A 1QD1A 3VAIA 1XMOJ 3PKYA 3DOMA 4I2HA 2Y0SD 3IRXA 1DLOA 4X64K 9ICFA 3R5JB 4E3SA 2YKMA 1F3VA 4JBCA 5EE9A 2QC3A 8ICUA 2ZIXB 3GU0A 1IBMF 3NCIA 3NVZA 4Y6IA 5E84A 2PA3A 4OJRA 3V4MA 1X9WA 1NNLA 1PVPA 1QQ7A 2W55A 3LZIA 4NCGA 4DFDA 1XMOF 4FJKA 4K0KK 1FTCA 4MQ3A 1J5OA 3ZX2A 1X5SA 2BM0A 1RT7A 1MC8A 3OA9A 1RT2B 3RBZA 1IBKK 4USUA 3FKBA 1G1XA 1RAFB 3GYXB 1TMMA 2VQFK 3CDBA 1Z1BA 4B1VA 3VGKA 1BQMA 4AE5A 3QRQA 3OS1A 3EPGA 3IAS9 4FPIA 4UW2A 4DV4J 3D6RA 5DDRC 4CT9A 3OLAA 1C0FA 3QX7A 1N6QA 4QW9A 3QEWA 1NGHA 4JYAK 3U7JA 4M41A 4JKBA 5AM0A 1RISA 3MCNA 2DYAA 4YR3A 2RU9A 4CLFA 1KTQA 3N4WA 4R79A 1T9XA 2Q0ZX 3PACA 5HANA 2HBQB 2W3SA 2UP1A 2V68A 4DFPA 4DV4F 1N52B 1MMDA 2VL1A 4UARA 1ZQFA 4NLQA 4HAIA 4O5CA 2EAOA 3AVCA 2KSOB 2VIHA 5B0CA 4F9OA 3I8BA 4GV3A 2HYIB 3VEVA 1RM6C 2COLA 1LW0B 1X5TA 4CDIA 4ZOHC 5BRFA 1UL3A 4USTA 3RRKA 1RT5B 2O8CA 3OBYA 3CM6A 3Q8QB 4CK1A 3U6FA 4W92B 3T5KA 2AGPA 4WCEL 4QIVA 2EG1A 2RDIA 5D78A 3UD5A 1WG4A 1RLDA 5C25A 2YTCA 2LEPA 2GJFA 3D2NA 1JLGA 2DVIA 5AQQA 4LVNP 4JKHA 2GGPA 2K7JA 2R7OA 3A8IA 3TYTA 4DTRA 8ICKA 3LO3A 1ZQNA 2CQ1A 1M90T 4CEOA 5FPDA 1SC4B 5LXYA 1EIYB 2DWQA 1OMSA 4LF1A 2YNGB 4GKJJ 4Y3CA 5C42B 4P75A 3SUPA 3CJ8A 1FI4A 4OYZA 1XSLA 4FWNA 1S1WA 4JWMA 2YB1A 4ECWA 2Z8QA 5HRNA 4JI1J 5DB9A 5DGAA 1JLCB 3S3MA 4LF5K 2GQCA 1SIJA 3SQOP 1RGVA 1OY6A 3QGIA 2H5JB 4RWWA 5LSRA 4WU3A 1RDBA 4GKJF 4MKBA 7ICFA 3G8TA 4O5FA 3UXPA 4OX9J 1Q81O 2KG1A 2KT3A 2MLYA 3MN5A 3NVYA 2FJWA 5KFQA 5ALWA 4PJ0U 3VQBA 2KJ8A 1T03A 2E2QA 3NNAA 5DJBA 1RPLA 1RU2A 5I3UB 1FJGJ 2AT1B 1OQ6A 3HWTA 1D9FA 2IA6A 1F60B 2ZVSA 2V7ZA 4AXIA 2ISOA 2M70A 7FD1A 3CCQS 1BY9A 4OX9F 1T9UA 2CQ4A 3CJCA 4BRIA 3CEDA 1NZAA 4F02A 4M9HA 1B43A 5E41A 1TKDA 1Q9YA 2C3MA 3GCWP 4I4BA 2AEMA 1XIQA 1MNEA 2ZHAA 2HZAA 1FJGF 1S1VA 2QWRA 5D0HA 2DITA 4P2XA 1X5PA 2E5HA 3HULA 3H5XA 4DS5A 3HKZD 2CQ0A 2CNNB 2APOA 4A8KA 2Y0SC 1IBCB 1ZQWA 1KQGB 3KJNB 1RTIA 1FRJA 3CFPA 4JV5J 2FQQB 1Q0NA 3NL0A 4ZVFA 4HH0A 2QM1A 2K3IA 4BVOA 4M9GA 5IWAK 1UVNA 1R8CA 3BREA 4C0BA 5ALYA 1BO5O 3SUOA 1L3UA 1D9DA 3TEGA 3KKSA 3RSEA 2CA9A 5D0RA 5TZVA 2G08A 1ZJNA 1BMQB 3G87A 2PI5A 1XTZA 3PNIA 4B6JA 4OJLA 4JV5F 4Z6DA 1JLAA 3PX6A 3NOCA 3RZAA 3M6XA 2FC9A 3C1YA 3E9LA 4LF4J 2KU7A 3OT9A 4I2DA 2E1EA 2UZAA 4WXWA 3A8JA 3QEVA 2P6RA 4DPTA 4Z37A 2YHAA 3SXLA 4FO0A 1RWXB 4RCHA 1NCLA 3EE3A 3WXIA 1NZ8A 2P35A 3WX4A 3KK2B 3NWGA 2P9PB 3IDHA 2E5SA 1X2IA 1Q81T 4WZQA 2NXJA 1Z19A 2YNHA 3QO9B 3UCGA 2MEWA 1TQLA 4MJKA 4KHRA 3MR5A 4Y2YA 1FKPB 2KXFA 4LF4F 2KVSA 4IKAA 3H8SA 5J2DA 2OI2A 5H9FK 5FPEA 1JN3A 3EKUA 2RIJA 1TKTB 3I5BA 3OPXA 3MDQA 2YNIB 1AFJA 3WIUA 3M9NB 2NR0A 3ADAC 3NVKA 4BRFA 1U1QA 2BTFA 3BM7A 4Z6FA 1PK1A 2HWHA 2MZRA 1VQ9S 3NEKA 3NF9A 3CJ0A 2Z57B 1IJEB 3KHHA 1IKYB 3ZSXA 4FM2A 4K41A 2I7PA 5CYJA 4YMMA 3F0NA 4UAWA 3H0LB 3AOAA 2FGCA 3HHNB 4F92B 3F44A 4L6V3 2D0BA 1RP5A 2F9DA 5HR6A 2CPFA 2D9PA 3T9NA 3AXKA 1UHUA 2GHVC 3D3BJ 3RJEA 4DTSA 4JK1A 4LBIA 1JXBA 2C2NA 1KR4A 1S0VA 1E3MA 2OPQB 4PXCA 4PWUA 4DR7J 1TL3A 2QI2A 3JSRA 4PXDA 2QT7A 3D3CJ 3SQGB 2VICA 3CCRS 2EK6A 1FDNA 3RGIA 4HVZA 2HMXA 2M8HA 4Z4HA 1RHQB 4CO2A 8ICJA 3QAEA 3F2BA 4F4ZA 1JWWA 3RJJA 1HPZA 4DR4K 5HMLA 1ZQHA 5BN8A 2RHSB 4PWDA 4UOHA 5E5NA 2OTJS 3TUJC 2HOFA 2HBZB 4JI6J 1TV6A 1Y3JA 5J2AA 3SMZA 4DR7F 4DQQA 1K0TA 3NVMA 4NLZA 2IVNA 1Q79A 2V50A 3GYGA 1KFDA 2GAHC 4OYXA 3NBPA 4C7QA 4N56A 2ZOMA 4DV3K 2R9LA 2HWTA 4FJ7A 2VWBA 1LWFA 5GAEI 2R2SA 2PFQA 2DNOA 2D69A 1S9GA 3TRGA 4I2EA 3T1HK 1XNQK 2BE2A 2Z0GA 2FLLA 4JI6F 3K1RB 3LUYA 4WK1A 4Q5VA 3LA0A 4JKAA 1N5SA 2V5HG 1DGJA 3WKAA 3UWTA 2NYIA 4FJ8A 4MFFA 2HGNA 1JI7A 2IRXA 2Z2YB 3MWBA 3ETOA 3HD2A 4WU2A 1DOQA 3C6TB 3NRWA 4CO5A 5HVGA 4OPJA 4FJXA 2KO1A 5EE0A 1P8GA 1HNWJ 1JNZB 1RE1B 3MEDA 2F76X 3K1ZA 2GJ2A 3J7A1 3JPRA 3KLIB 2P9SB 1SJ3P 4GVBA 3HKZC 2HVEA 2PFFB 4XH1A 2ZTEA 3OVBA 3KHLA 2ROPA 4AFFA 4CJTA 4DTMA 3K5LA 4H5RA 2ZUDA 3QFUA 2HFVA 3FZ2A 2E20A 2HHSA 2D6FC 1HNWF 2YMQA 4X4UA 3ZTQA 2VZ9A 3PYDA 3O8WA 3P38A 3VZIA 2LYVA 2GHPA 1UCVA 4F4YA 4RW4B 3BP8A 4YN4A 1IXRA 1BWVA 2FHMA 3S9HA 3M4XA 1WNEA 4X4TA 3HVAA 4J9MA 2CPXA 4C0HA 4Y2IA 1I5OB 1XS9D 1Z6RA 1A5XA 2LHTA 3OFEA 3DCAA 2XB2D 3C15B 5KFVA 4PG6A 5F8IA 4CHQA 5KG3A 4JI8J 1HBOA 4LF8J 2P5GA 3UO0A 4OL8A 1RZTA 1UCNA 2VONA 1BG3A 4M1KA 2DXDA 1OUQA 2KG0A 2DFFA 3UDEA 4J9KA 1N5WA 4J9NA 4CZFA 1NM2A 1L7NA 1Z4OA 4GO5X 5JXSA 4I68A 4KO0B 3IGNA 1N36K 4QZVB 4BR5A 5AQGA 2YKAA 1RT1A 3L2VA 1Q82O 1SV4A 4R0JA 4JI8F 4TKTA 1KVAA 5KAFU 4LF8F 4V19S 4ZP8A 1VQMS 4XEIA 2OJ3A 1TE2A 4AYBD 5IT9O 4DPUA 1K47A 3F5TA 3O1WA 1EZZB 4LZGA 1HYSB 3I76A 2AWZA 3CJBA 3Q2TC 3CCVN 2Z2LA 1SXDA 3BGUA 2G8FA 5J2PB 4O5KA 1JALA 7ICTA 1HI1A 2AKWB 4B1UB 3MFIA 3QIOA 4U67L 5F8LA 3L5KA 4DTUA 4C4WA 1FXDA 4DEZA 5HOOA 3MMBB 1U09A 2KM8B 4UUWA 4B9MA 4PG8A 2CZ9A 4FPBA 5KL1B 5J2EA 4A62A 4KLEA 3HSTB 1BPZA 3VEOA 1N5VA 4J8FA 1M5OC 3AVNA 3NE6A 2R7RA 1OY9A 5K8OA 4OHYA 1HQ2A 4UAZA 1ZQXA 5L1KA 3GJQB 2RRBA 1BQNB 1U1NA 3V6DB 1NKEA 2HURA 4MN4C 2F8HA 3VGSA 2CDRB 2RF2B 2OSQA 5CCMA 2PT0A 4FN5A 4JS4A 2DTUA 3AVFA 4DQRA 5ALEA 4GVEA 2PMZF 1REVB 4JN4A 4X66K 2BJEA 4KH5A 5EOYA 2E2OA 2GO9A 1C0TB 1CS4A 4F4XA 2DFHA 3BO3A 3CE8A 2HDOA 3GFKB 5B7WA 9ICEA 3B8HA 4IKFA 2ROEA 2OLWA 2OH2A 1MQ3A 3C46A 2Y9HA 5IV4A 4IO9Q 1FWPA 2VBYA 4CJUA 5F41A 1RDDA 3VEXA 3HRDD 4TYBA 1F6TA 6FD1A 5EHHA 3N79A 4O9MA 3KUGA 4MH8A 2I9GA 1KAYA 1F0MA 1VC5A 3Q8PB 1JJ4A 5T7LB 1MWYA 4K4GA 4EYHB 3ASMA 4RG8A 5JVGQ 4FWPA 1CULB 1SKSA 1HD1A 3IR6B 1JROA 3C8YA 3R1HA 5J2HA 2ATCB 3SCXA 4KGKA 3HSJA 3OTEA 2HK3A 2CJAA 3E8OA 3TA1A 4WTOB 2PYLA 3GIKA 1MG7A 2HGLA 3I87A 4CJSA 4P2FA 3ALRA 3N6NA 1BPBA 4R65A 3VZHA 2ZZTA 4ZVQB 3RTVA 4EWTA 1GMWD 3M7VA 2I7NA 4FNIA 3W7BA 2F1IA 2O67A 5M2UA 5ALJA 3UXOA 3BN7A 4CEFA 2W54A 1B4FA 5CWRA 4OVLA 4H4KA 4OHVA 1Y5IB 4ZCIA 2ZXIA 1R0AB 4OZ3A 3JS9A 1CVJA 5AICA 2MYFA 2AYMA 1S6PA 4YEAA 2UUAF 4F4KA 1VOMA 4I69A 2LEBA 4K59A 2PZSA 1WTFA 1I94F 1Q8KA 3PNCA 3TZYA 4TLRA 5DDYA 3HZ6A 4ZLNA 1VLBA 1WOSA 3B4DA 3MUMP 4Q7AA 3W62A 1ITGA 4B8CA 4HH1A 3DRPB 2NUBA 5LMUK 3NVWA 2A41A 1RTJB 2H5IB 2D0OA 1ZD3A 4O0JA 3KZBA 3HLUA 3VQ8A 2DNGA 2GFFA 4L3KA 3ULHA 3QBCA 5DZ7A 1HA1A 4YN3B 3PO4A 1WOOA 1YTYA 2QKKA 3JPNA 1BA0A 2GVZB 2Q36A 3MXHP 1HLWA 1UOCA 4A47A 2Y9UA 3CJ5A 1AZSA 2ZM6J 2WFAA 2KJWA 4ILGB 4KX5A 3KKAC 4AYBC 3TR5A 3E0FA 1XNRK 4O44B 1N34J 2RP5A 3OS0A 4X4SA 2D3UA 5IIJA 2XMAA 2JWNA 1ITPA 4CESA 1VYAA 3LP1A 5KFXA 1QTNB 4QIGA 1QAIA 2FJEB 4QCLA 3KZIU 2WAQD 3W60A 4FCYA 2ASJA 1PAEX 7ICUA 3FE1A 1UW4A 3NS7B 4PG7A 2ZM6F 3UMCA 5GAEU 1CC8A 2HMIA 4GC7A 3W9JA 5AQXA 3BBFA 1N34F 4NLPA 2ALYB 4URSA 1JJ2M 3B6OA 1K73O 4J5OA 3SBTA 2HHQA 4JOUA 3TTFA 4UT4A 1IQZA 3AQEA 2WK4A 3SLCA 1GMWA 3QZ7A 4H4KC 2DT9A 3NH2A 3QSYB 4LD0A 4EELA 4YG2A 4NV0A 3L09A 2JXJA 3MM9B 2LXIA 4MKVA 2O8FA 3IA0A 2IAJB 1ZRNA 1HNIA 1I3AA 4WFAL 4YY3J 4DCPB 3CC4N 1FNOA 2C2RA 3L4PA 3J80U 2DR5A 1YBAA 1VQ7S 3K58A 3M2VA 1RAAB 4LVOP 1QY7A 1JLQA 2LCWA 3HT0A 4ZCKA 3IG5A 3LM2A 2V2QA 1J5EJ 1VDHA 4R8UB 1L5UA 3PO5A 2CWXA 2E1ZA 4BC4A 4EZ6A 1LWEA 3V6KA 2EPIA 4CNQA 5DS7A 1SZ2A 1EX4A 3QFWA 4YY3F 3BKUA 4PKDB 2PFNA 3C23A 3O80A 5KGXA 1OYEA 5KG5A 3G6VA 2SXLA 3VERA 5AK5A 1J5EF 4IQTA 2DRBA 1NGAA 3ISND 3W3SA 2HFSA 4RQ1A 4PYDA 4Y2KA 4EI2A 3VMFB 8ICBA 3K5NA 4ZLLA 5A0YA 1FERA 1NK0A 3D5MA 4CK2A 4BRAA 3N7SC 4A8OA 4Q44A 2CH5A 4WF9Q 2CXYA 1D8ZA 1Q95G 2VBXA 2ZH3A 4DR2K 5AM4A 3CDUA 1T05B 2P2CB 3QU9A 1NOMA 1RTHA 3CCUS 1K73T 2KNJA 3IR5B 4R64A 1YIJN 3HOSA 3DOKB 1GXLA 2XO7A 2ZJ5A 4DV0K 2OPSB 5AE3A 1H7WA 5B66U 3CCLN 1B0XA 4WQ5A 3FCVA 5D4BA 3CCMS 1OH6A 2VKZG 3KXDA 4EBDA 1GEHA 5F0UA 1NB7A 3RMAA 5ALGA 1S1UA 3PW5A 2PYJA 3LVVA 3O9SA 5G0RB 4KLDA 1OH7A 1UP1A 1U26A 1QM9A 1Q1KA 1UTAA 3MM7A 1K8AO 1RFQA 4GVMA 3FRZA 4FM1A 3M3ZA 4M9LA 4QJFB 7AT1B 2VOPA 2Z1HA 1W26A 1N0VC 4I9QA 2XEXA 2WB4A 3IO1A 4AHSA 2JHEA 3NXZA 2E1CA 3NGRA 4BDYA 4F72A 2YQ0A 2UVVA 5HJYA 2IIRA 5DG9A 4HI1A 2YH0A 4ED2A 2KN4A 2WVBA 1VQLN 4QU7A 1UA0A 3UQSA 4QW8A 4ZPVR 4FXVA 4B3SK 4O3RA 5F2RA 4ZTFA 2OFHX 2KIVA 4FK4A 1LFWA 2DNNA 3D0HE 1R6YA 2QKQA 1RBSA 2WAQC 5AQKA 5D49A 3NFAA 4NRTA 2FI1A 3TANA 1SPBP 5CHIA 4TYAA 3UI3A 2K4PA 2W40A 1T44A 3QBXA 4ZPDA 2DHXA 2VG6A 4FLYA 1W2IA 1WC4A 2A40A 3WBZA 3QINA 4DUTA 5IT9Y 4B9UA 3MEEB 1Q5VA 1H0HB 1Q7YO 4K4IA 5HNKA 1SV5A 4YCXA 1H2TZ 2L08A 1P9YA 1FRXA 2FD2A 3W2VB 4G9ZA 7ICGA 4EFHA 2G0IA 3OBWA 4WQ5C 4QIEA 3VEYA 3T69A 2MUTA 2VJUA 5HATA 1TK5A 1N33K 3OTQA 3B54A 5J2QA 3MECA 4UZBA 3TTCA 3R3TA 4QS8A 3PFOA 4B17A 1VISA 5BPMA 4PHEA 3MDAA 3VAJA 3M8ZA 4NYZA 2R2UA 3ZSYA 3AFGA 2QLBB 3HX0A 3QUTA 1P9QC 3T6JA 3JXUA 1T4GA 5BR8J 1X0FA 2R7UA 2ASDA 2W24A 2GWKA 2V9WA 1J2NA 3AA9A 2G8UA 4K8XA 1FX4A 9ICKA 4W5RA 4DX7A 4FWOA 3PW4A 1FDAA 2HNYA 1K6YA 1S5JA 2XM3A 3NMUA 1OPZA 4R5PB 2FPKA 4QPXA 5AR0A 4EO8A 3SJHA 5EN1A 3SK3A 5BR8F 1N5YB 3I9V9 4J2AA 1S72S 2D1CA 3FK4A 2PGCA 9ICUA 1PBUA 4XA5A 3M32A 1RA6A 3ISNC 3FGVA 1JJ2R 1X9XA 2DNQA 2BRLA 2QL5B 3CULA 2ERRA 2GHWA 4YVZA 4CLLA 1AT1B 3AEVA 4KFBA 3VQAA 3ZD9A 3QNWB 2Z7JA 4OV1A 1VQ5S 5BREA 3BY5A 2OYQA 4BC5A 1YJWS 3NAEA 2KKPA 4ELUA 3TSUA 2YN4A 3CJ3A 3ZT0A 1RWOB 2HWIA 2Y8WA 2D7SA 1T9TA 1Q7YT 1Q78A 1N5TA 4N77A 2Y1IA 4ZVSB 1WNSA 3OTOK 4KLTA 2W8LA 5HVFA 2Q1NA 2KHCA 3JSYA 4P9SA 3KD3A 2YJFA 4F5RA 2AJQA 2DO4A 3DYAA 4ED3A 1CC7A 2O5DA 4XPCA 3ZZ0A 4JEPA 3IRXB 1DLOB 2X1FA 4MLEA 4B3OA 2KIWA 2YKMB 3PFEA 1HMVA 5HROA 4FO6A 5F3XB 3AXMA 3SNNA 4AILC 4P2SA 1YUWA 1UETA 3PSFA 4X4OA 1UZDA 1VSLA 1SQGA 5THWA 3FC4A 1Q7LB 2BDUA 4NCGB 3HBTA 4K4HA 4YNQA 1J5OB 2K8CB 1RCXB 3LAMA 2W11A 2M5YA 3RB4A 1DQ9A 4C98A 1HRHA 1K1QA 2ISPA 2C2EA 1RT7B 5ETMA 4RWXA 1F2GA 3PHTA 3MK6A 1CI4A 2ZJ8A 3F2KA 5ELZA 4UBCA 3DDIA 3BEGB 2FJ6A 3M8PA 2DEJA 4XO0A 1MQ2A 3I82A 1EB0A 2XNQA 3CC7S 1M1KO 4CH7A 5LJ3Y 1C4AA 2F9WA 4ID1A 1BQMB 4LFAK 4DV2J 1RI7A 3BO4A 2R8IA 1GLAG 3J81O 1WOPA 3MD3A 2MTLA 5ALZA 2BZ2A 1RNHA 1UT8A 1NHVA 2YQ3A 4DV1J 1N6QB 3QT7A 3GU3A 1SWVA 2CPYA 1L3SA 3IXQA 1XSNA 2C2ZB 3TUZC 4AP9A 4UOFA 2GLEA 3CCSN 4DV2F 3TAEA 4QZ8A 1R8PA 2BKPA 3W1YC 3R6MA 5C2DA 5KFWA 1LKYA 2VQEJ 2MHNA 4O3QA 1RBAA 4DV1F 3ZNUA 3CG7A 2ALZA 1URNA 1T9VA 1WDDA 4K25A 2V4RA 3BR8A 4X4QA 3MGVA 3T1YK 3TX0A 5ETQA 1YJ7A 1FEZA 1D09B 3P6YC 1IXKA 2O8CB 1NZPA 3CCZA 4ZVRB 3PM9A 1UFWA 2OWOA 2FSNA 3O9QA 4PA1A 2Q1LA 3OFHA 2VQEF 2BKNA 2QMWA 4LFBK 5C25B 3OR2A 3AL0B 5KFJA 1JLGB 4JD2A 2GO7A 1WSJA 2GGPB 4KLHA 3GR0A 1GMUA 3CDEA 3JAMU 2YB4A 4CRXA 2RT3A 3CW2C 1NH7A 1KKXA 4LBPA 2NQPA 1IQTA 3FZFA 4A8XA 5BRHA 3SPZA 1RTZA 2QWMA 1RBTA 2OAUA 5ADZA 4XAKA 2A6OA 3GYNA 4CZJA 2C2KB 3BZQA 4GNIA 2BW2A 5AI9A 2HW3A 2B21A 4PHPA 5F8NA 3H1QA 2VGNA 1BIZA 4ZPBA 9ICOA 3D4JA 1ZQEA 4NASA 5D0GA 3QJPA 2VUGA 4M3WA 3PW2A 1M1KT 2CQ3A 1WKJA 2KMDA 1U1MA 4Z4FA 4ELTA 4URQU 1TFWA 4FOEA 3H45C 4B08A 2YHBA 1LWCA 3M05A 4WCEQ 1S59A 3EJMA 1BQXA 4LH5A 3C2LA 3FCWA 1LEOA 2U1AA 2WF9A 4FZMA 1N33J 3EWGA 1CLFA 3I55N 3CSKA 4F8RA 2WHOA 2WZ1A 2PIIA 5KFGA 4K4SA 4U7UD 2CPDA 1T03B 1HBMB 1VQKN 1R31A 3NH1A 1RYSA 5AXLA 4M5DA 2OANA 3PEHA 5DM7L 3BGOP 4M5NA 2XICA 2F9TA 1CUKA 2PI4A 1N8RO 3NNHA 3D0GE 4WYWA 1GH8A 2BYCA 2IM2A 2ZNYA 4NWIA 1VQPN 1O5JA 3MFHA 2D5RA 4UQGA 3HOTA 4AHVA 1S1VB 1WDTA 4F3OA 3DU5A 5HQ8A 3Q24A 4XRHA 2B8QA 3R5BA 3TADA 2ZH8A 1OPIA 2DXEA 2PO4A 4PPXA 1RTIB 1WEYA 7ICRA 2YPZA 2ITMA 4JRQA 4M8LA 2XULA 3TTDA 8ICAA 4C11A 1WF1A 4Z4CA 1ZQTA 2HNDA 3DRSA 2DR8A 3KWIA 3V1OA 3UR3C 2XLKA 1ZXIA 2K4IA 4CE6A 4WFYA 3RSEB 4OX7A 3OXLA 1UPMB 4NA1A 4Q8EA 1ZBFA 1WHXA 5G4DA 2E44A 2UV8A 5M2PA 2W3RA 4RZRA 2ZOGA 4JI0K 7ICIA 3QYPA 2KEYA 3SAGA 3OYDA 3J7ZO 5A8WA 3U9DA 2DIVA 1ZRMA 4ECXA 3EKSA 1UWAA 3D67A 1PIEA 3OYGA 2LXUA 3LM9A 3IFRA 3VGTA 1Q5YA 3D45A 2GVDA 4CQ1A 4X4RA 1DXSA 4KHPK 4ELVA 1Y88A 4P6QA 4OJOA 2AU0A 4EAHD 1I6JA 2YNHB 3EXCX 1MMNA 3WK8A 2ZD1B 2J9EA 3ZT3A 3UKRA 3C6UA 5IQQA 4KBOA 5KFTA 4Q45A 2A1BA 3C66A 1U9LA 4U7UK 2G5HB 1NEEA 3DLLL 1ZQQA 4KHNA 3DI6A 2JVOA 2UUAK 3DLEA 4Z4EA 4BLGA 1BUPA 5J2GA 2DPIA 4LR8A 3H46O 2WB1F 4DXLA 1U2RA 4CI0B 1PK1B 4PZVA 3PSTA 1S9FA 3FFKB 4O0IA 5DDMA 2HHUA 3GIJA 1WLJA 4KR0B 1HR0J 1FCAA 2QWNA 4UBBA 2LBOA 3TADC 2CPHA 4HTIA 2WBMA 3P4UB 4NMLA 2UU9K 2PDAA 4PH5A 2V34A 2V63A 4C23A 1GXUA 5I3PA 4E1MA 4IBNA 5GTIU 4QIWF 2GQ2A 4K4XA 5CZ2A 4YD1A 4X5VA 3ZT2A 2J6TA 1ZH5A 4Y1CA 3PTWA 5IV3A 2NRVA 1TL3B 1F5BA 2EBGA 4DFMA 2O66A 3K2YA 1HR0F 3VQ9A 4GKKJ 1HJPA 1TL7A 4N47A 1VR6A 2E5LK 2ETJA 2MQPA 4P2HA 2E8AA 2DGTA 5ETOA 1HPZB 2XCAA 3J7ZT 4GRSA 1KQFB 4PWDB 5E2QA 3HD1A 2QFJA 1FXLA 1TUYA 3EPIA 1TV6B 2V2KA 4BX9C 3CF5L 2AP1A 4W5NA 5SWMA 1S5LU 3HXMA 4GKKF 3NBPB 3ZO7A 1O6XA 3ZT4A 4P4MA 5K20B 4GFJA 4M5LA 1LWFB 2K2PA 5JS2A 1S9GB 2F9JA 2P9EA 4PQAA 3D0IE 2W4CA 1SQKA 2BE2B 3CYMA 3HM9A 4LFCK 1WKLA 4JB8B 3J7Z5 3R9LA 2BZFA 3NH0A 7ICVA 3AA4A 4FLWA 4CEBA 1Z2ZA 4HUGA 1QTMA 1XK8A 1XQIA 2LU2A 3P5BP 2OPPA 3B4MA 2F8LA 1ATNA 3O3GA 3WEEA 1RWWB 1M5VC 3KBBA 1VQSA 3LW5C 2L5YA 2KI2A 1RBVA 4Z6CA 4AL5A 3F56A 2ZZNA 3WK9A 4I2CA 3FQLA 5EWGA 1SVDA 1JJHA 3MEDB 4P0QA 4DR1J 1NGBA 2WSCC 5KRSA 2H3ZA 4MKYA 1YX2A 4GVBB 1EAYC 5H9EJ 2JNJA 3HHKA 3M8RA 3ULDA 2IRUA 3H98A 1Z2LA 3PIOQ 4DR6J 1CZ9A 2WONA 4LF9K 1RXWA 1VQ6S 5F8HA 4CP5A 4E8UA 2KW4A 3AVBA 2LECA 4OPKA 3QUBA 2MKSA 3P96A 1Q86O 4CWBA 5AQOA 2CG4A 3SR6A 3FZKA 1S8OA 1ZM4A 4U7BA 3V5RA 2YMPA 4KN4A 1A0OB 5EX3A 1V3SA 2CUYA 2WBNA 1ZYQA 2RD5C 3CCES 2GUIA 2JZ5A 3R5AA 4DR6F 2N4DA 2XYGB 3IHQB 1I3OB 4YOXA 2O8DA 4JI2J 1JX4A 2DB1A 1HBOB 4JI3F 3VV2B 1VSDA 5AZIA 3AM9A 2UXBJ 1XJWB 1HUXA 3N28A 1QJHA 3U1LA 2DGUA 1H2VZ 1LW0A 1WSRA 2VG7B 1FJ7A 3KKRA 1VJQA 5KFIA 2NRHA 5FD1A 1C0UA 1MDUB 4DS4A 3P5TL 5DO2A 5DMRA 2W7AA 4JMUA 2ESEA 4UOGA 4A48A 2CQGA 4ZVGA 3ENOA 1RT1B 2WVEA 1JK9B 1N88A 4NZ0A 4JI2F 1YQHA 1X4GA 3WT0A 1JKHA 4ZVUB 2ZUGA 1C1AA 2UVWA 1LXNA 3AD9C 4IC9A 4L8RB 1SWWA 3UN3A 3J81Y 4M5KA 2JHDA 4QZAA 3IBFB 1VC6A 2NUHA 4PWWA 4AL6A 2RMLA 3EO3A 3A4TA 3QXGA 3KHGA 2XWXA 2L9WA 5C42A 3I0RA 1BD6A 1LVHA 3L2QA 4US8A 1U45A 3L7PA 4W98A 1IM4A 8ICYA 4Z2XA 2VANA 1NLKL 1YVFA 3BEXA 2ODGA 5C2FA 2JSXA 2RUSA 4DL6A 1F1BB 2QWLA 2ZIWA 3OYKA 4B9VA 1U7LA 4KV8A 2BXJA 2GNKA 1UT5A 1HPMA 2A1RA 4FLVA 3VAGA 1Q8LA 2RVJA 1C1CA 4DUZJ 4US9A 1NM1A 3FDSA 1BHNA 1Q86T 2FBTA 7ICPA 1N5XA 4KRFA 2A19A 4IOCL 3BBCA 1WC1A 5E0OA 2HHXA 2JL9A 1HWIA 1GOCA 4ID8A 3GFYA 3D2EA 1CSJA 1B99A 4YDUC 2D8CA 3MXJA 4B9TA 2V52B 3GSDA 4DB3A 4DPWA 5LL6Z 1NK6A 3JAMO 4DUZF 1E6YA 3FRYA 4KH0B 2FPLA 4ZP9A 4U67Q 2JWKA 4K4YA 1X4CA 2CIMA 4LF2A 4OZJA 4CZMA 4F36A 7ICNA 3QWUA 1WELA 3ISZA 1JCFA 4QWDA 4U9RA 1CS4B 3KDOA 3DLHA 3PYFA 3CD6S 1HIYA 4J9UE 3C65A 2Q4TA 4WXOA 1U2VB 1B3TA 9ICIA 1GQEA 4PAAA 3MOZA 3HMJG 1BWEA 3AO5A 4V19J 4JHDA 5HR7A 2AJ2A 2H9ZA 2VPXB 5GVQA 1HNZK 4UASA 3RB0A 1U2CA 4NM2A 3V9ZA 2CQHA 4BJQA 4QWBA 5DRKA 1OIAA 4CFDA 4V1Ak 1CBKA 4DR3J 3ED5A 3MM8A 5JICA 2K4HA 3WZ0A 3NMRA 3FFIA 1P1TA 4OI6A 1GOAA 3EUNA 5GAGP 3SQIA 3QT8A 4FJMA 1HKAA 5A6WA 2HZVA 4DQSA 4B3TJ 2CJBA 2F3NA 1HARA 4DR3F 2J0XA 4BDZA 5AQIA 5J1EB 3GDXA 5ALFA 3CNQP 4NXMK 4E1JA 3L3CA 1ZQCA 3ENVA 2BCVA 3GG4A 2YHWA 1FJCA 2I0XA 4F4WA 3PJXA 1HYZA 3MR3A 2LP4A 2MKHA 4G1QA 2FC0A 4QPTA 1S6PB 1KC8T 4RWTA 4Y2UA 2AZ1A 3QFHA 2J8AA 4B3TF 4OV6A 1YTUA 4Y1DA 4LQ3A 1J27A 1J54A 2V8HA 3FM9A 2LM4A 4W90B 4JKFA 2Z56B 4NO7A 3SCIE 3ETRA 4KI4A 2YKQA 3RH4A 2MKCA 2HRUA 3O6QA 3N7PD 9ICCA 4RO0A 1JIHA 1W0HA 5F9LA 2CWKA 4ZLPA 3PCOB 3N7RC 2YNFA 4FK2A 4CZIA 1CLQA 3V4IA 1B0TA 1U04A 5DM6L 3Q8LA 4ECRA 5K8NA 4G9BA 2FDNA 5CY4A 3QDKA 1M5KC 2XIDA 4P10A 1HYVA 5J1PA 4JI4J 4IJAA 1YWXA 1UKUA 3MM6A 3R2DJ 4WFZA 5AQRA 3H7HB 3U3GA 1IWAA 4CEDA 3A5NC 1P8ZA 3SEOA 4CBWA 3DHXA 1JLEA 4PQUA 3AD8C 2VFTA 2X3DA 2OFGX 4K5RA 1VQOS 4CHNA 1RXVA 3EWAA 2DGXA 2ZWPA 4NXNK 3AVMA 4JI4F 3K5OA 3W65A 1KVKA 2D1KA 5AM5A 3KLFA 3Q8RB 8ICMA 3GP9A 2DFLA 1OXJA 1EQYA 4PPZA 4C0OC 1RYUA 4DX8H 3HJFA 2IHMA 4H0VB 2V2VA 4A5AA 4JKCA 4OKKA 4M5GA 4RPZA 4ETXA 4UZCA 2JVRA 2FVCA 3H42A 2W42A 3AA2A 3VHQA 3KIOA 4LSNA 3UD3P 3UDLA 3O4NA 2P9LA 2HKEA 4IS7A 2EAPA 1WKKA 3ET6A 1HNIB 5TISU 2OEMA 1RAHB 2JJ4D 4F3TA 2MSSA 3M2VB 2WRMA 2XVTA 4W5QA 1JLQB 2YHXA 3BKFA 1O8BA 2L48A 1U25A 5DQHA 4V19X 4KPCA 3WU2U 3QU7A 2J0WA 1LWEB 2HHWA 5AE2A 3OYEA 2KN7A 2P9SA 4NYNA 3RBEA 3VN5A 3GR1A 5JRTA 1KP6A 1I51B 5LJWA 1WC5A 3QERA 4ZP7A 4FJLA 3K7RA 1W9HA 1FFUA 1TUWA 3EGZA 4ISFA 2RAQA 1TUVA 1C20A 4NYOA 2NXNA 4W4MA 4FFDA 2LYAA 1GOBA 2F7VA 5EVZA 5L9XA 2D0AA 3LALA 5HQMA 4FW1A 4F71A 2I38A 1TL4A 2IVPA 4F7VA 4WFAQ 1RT3A 4I67A 5KFAA 1DAXA 2N4CA 5EWEA 7ICHA 2POKA 5KNIA 2EKYA 2W01A 2ZUAA 2UXDJ 4P4PA 3H40A 3K4GA 1CRXA 4CRJA 3C15A 4LJMA 4CZLA 1RDUA 1PVRA 1DTQA 4KAIA 1RTHB 2ZQBA 1WUUA 1N62A 3ZSWA 2DHHA 3JYTB 2LMRA 3NGKA 2UUCJ 4ILLA 3H2LA 3K0SA 1S12A 1VQ9N 1VRUA 5JS1A 1PGZA 3R97A 3RR8A 1S9EB 1MA7A 1FRHA 3BQ0A 2UXDF 1U6BA 3S3NA 2FLPA 4RNMA 2ATQA 2G2ZA 4AF1A 4O4GB 1S1UB 3CD7A 2KD1A 5GTHU 1HKGA 2AJFE 2MSTA 3W9HA 4YOUA 2W9BA 3FEZA 4OJ1A 3FC9A 1MWZA 1VBKA 4IEIA 2UUCF 4F2SA 2HOQA 3QRRA 2E8MA 2VA2A 2DNYA 4CJQA 1XBWA 4H4OA 3MM7B 2KDOA 1WWUA 5ALMA 3CHWA 5ALOA 4XDCA 4OO1J 3AN1A 4BR0A 1NPRA 3NWRA 3CCRN 2KE7A 2QA4G 2E1AA 5U47A 1DGKN 1SJ1A 2HRTA 3R8YA 5ALNA 1HHSA 2W9MA 4ENOA 1XQSC 2YQEA 9ICJA 1IBLK 2N7CA 5AKJA 4ACOA 2OTJN 1A77A 2DNHA 2HBJA 3VF6A 3ELHA 5RUBA 3L3UA 5HL7L 4FLXA 1TELA 2A2CA 4RU2A 4NXMJ 2AEJA 2NRRA 4FJJA 4I6AA 3VC8A 2BACA 4PXEA 3K5MA 3KD1E 3H0MB 3THXB 5AKYA 2C2OB 2B8PA 3RJGA 2CNOB 1IR0A 2A0FB 2NO4A 3AB2B 5ETKA 4ERDA 5BOLA 5J2NA 2MZTA 3U9ZA 2HI0A 4ETZA 2MQQA 2RF2A 1FVSA 2MKIA 2VG6B 4NCBA 5GMDA 2FBVA 1VRTA 3UMGA 2FC8A 2BCRA 2WMMA 4NRUA 1L7MA 3FUYA 1HWUA 4DZDA 2X1GA 4NYPA 2RS8A 3HP9A 5CP2A 2DISA 1VBYA 4YXMA 2XZWA 4F67A 2BUPA 3AQPA 2VC1A 4YB7A 2M8DB 1HNVB 2YY3A 5BJRA 2W43A