4F4KA

Dna polymerase i large fragment complex 6
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 198
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4kA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f4kA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4kA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f4kA01
4KHQA 1S0OA 3DMJA 4UB4A 1S77D 1BPBA 3TAQA 1VSIA 3L2RA 5KTQA 1PZNA 3G6VA 3OSNA 1C0TA 4QWAA 3KLFA 5DBBA 2V9WA 3JPQA 1JIHA 3L2VA 1QS4A 3QIPA 4NM1A 4CEAA 5IIMA 5CZ2A 4RUCA 3QNOA 4JS5A 3MGHA 5J0UA 4FJ5A 4FZXC 1GOAA 5DLFA 3BQ2A 3PW2A 5JUMA 4Z0UA 3C94A 4F5OA 3OSPA 1D8LA 3LAMA 4DL5A 2DTUA 9ICGA 2ASJA 4M42A 4RQ3A 2PZSA 2ZTCA 4R66A 2F8TA 2DFLA 1SL0A 3OS1A 4K4GA 4QZ8A 4DQRA 3V81A 1ZETA 2ETJA 4NYFA 2RKIA 2D5RA 1IKYA 3MDCA 3S3NA 2D0CA 4CEEA 4O4GA 3MAQA 4H4OA 1TVAA 4Y1CA 3KD1E 3UXOA 2WONA 5DKWA 3GIJA 3F9KA 1W0HA 4ED8A 5KFCA 4ELVA 4CF2A 4EBEA 2UVWA 4NM2A 4O44A 1B22A 4TUPA 1U4BA 3AVJA 1S1TA 3NE6A 8ICAA 4GC6A 4CFDA 1U04A 4J9NA 2KZMA 2HNDA 1RZTA 1KVBA 3IAYA 4W5QA 1RBRA 3ISBA 2XY7A 1BPXA 5KFVA 4I2GA 1S97A 4QZIA 3SPZA 3MEGA 4HUFA 4DOCA 4XUSA 4QAGA 5FRMA 4KPYA 5DLGA 4UAZA 3OYMA 1JX4A 4C8MA 2HHXA 1LAVA 4DQIA 1BI4B 4G3IA 3LZJA 4F8RA 4DOBA 5KFFA 2J6TA 2XY8A 4AHCA 4Z6CA 3NF8A 4AHTA 4F93B 2XHBA 4KLUA 1BCMA 1JL1A 4CJEA 4M6WB 4UQGA 3GIIA 2RPIA 4QZ9A 3C2KA 1H38A 3HJFA 3ZSWA 4CE9A 1VSLA 3SJJA 3TR8A 3O4QA 3EPGA 3H7IA 5HLFA 4TUSA 3WNFA 5KFSA 8ICMA 5KG0A 2X78A 4GVMA 4E19A 5KFYA 3HX0A 3ISDA 2PFQA 3LZIA 5KFDA 1DLOA 4GXJA 2Z1JA 2BQUA 3NH2A 5J2KA 3I0RA 4GXIA 4W5RA 4GMJB 1L5UA 4DS4A 1WSGA 1BQNA 2P66A 2YV0X 1HQEA 2DFEA 2ATQA 3CYMA 4CHNA 4IKFA 5DGAA 3SQ2A 5KFHA 4IG0A 3SUOA 4DSEA 4HCBA 1NKBA 4KLJA 4DSKA 4CF0A 4KN7A 1XHXA 4FK4A 1N48A 2XRIA 5EWEA 5IIKA 4YN4A 1S1VA 3VQAA 2ISPA 4IDKA 4Z6DA 2MAXA 3ZD8A 5KFKA 1VSMA 2F96A 1A77A 2HB5A 3ITHA 2IA6A 4EEYA 4KMUA 3SV4A 3RWUA 3V6DA 3MR2A 2LSNA 7ICNA 2HHVA 3TWHA 5KFZA 1RBVA 4KLEA 2OZSA 4CEOA 5KFTA 3EWAA 3KHLA 2HW3A 2B6AA 3UXNA 4DTNA 1SV5A 3BQTA 4O3PA 4FJLA 3DLHA 3V6JA 9ICAA 1RT6A 3AV9A 3C5GA 3PO5A 1ZQZA 4DL4A 2JLEA 4M3YA 3PR4A 4M45A 4HVJA 4DG1A 1A5XA 2IAJA 1ASVA 9ICFA 1S6QA 4EZ6A 4DO9A 2GBZA 3C23A 3WNHA 3PW7A 4E7KA 3AVCA 2RDJA 7ICKA 4PH5A 3ZT4A 3SUPA 4QW8A 3T5HA 1C0MA 5I42A 1S1WA 3SV3A 1WSJA 1FXXA 4F3TA 8ICYA 2F1IA 4LSNA 4DOAA 9ICBA 3V6KA 3JYTA 5CYMA 7ICTA 4M3UA 4I2HA 4DSFA 4PGYA 5KFXA 5C5JA 3V9XA 4RPYA 4JLHA 2DFFA 3M8RA 3AVNA 4KI6A 2HVHA 4CGFA 1RT4A 1ZQLA 4FLYA 9ICWA 4I28A 2E4LA 1VRUA 4CJ4A 3OJUA 3KK3A 4N41A 3S3OA 9ICXA 3PMNA 4FJGA 1UT8A 4B08A 1DTQA 4M9HA 2VWJA 5KFJA 3Q8MA 2DY4A 2ZTEA 2BDPA 8ICJA 1BVSA 3MR5A 3JPSA 7ICVA 5J0WA 3OHAA 1QLNA 2KZZA 1BQMA 1HJPA 4YR3A 1L3SA 3AVAA 4FZZA 3K5OA 2W9CB 4PPXA 4CK2A 1S0MA 4O3SA 1RCHA 1Z26A 3NGYA 4AHRA 2AQ0A 1UAXA 2F8SA 4B9LA 3RBDA 3ZSRA 5E41A 3Q8PB 4M3ZA 3DLEA 3NGIA 4F2SA 2A1JB 4KLTA 1X9SA 4IRCA 3LP2A 4CEFA 3ZDCA 1S9EA 3GV7B 4ECWA 4DQPA 4F5RA 4ELTA 4R8UA 4J9OA 2V4RA 3AA2A 3GILA 9ICVA 1ZQJA 4FLXA 4DTRA 4RW8A 4NLKA 2C28A 4DL6A 3RJJA 1I39A 2G8UA 3OYDA 9ICUA 3OYKA 4YD2A 2VA8A 8ICXA 2ASLA 4KLLA 4N56A 2IS3A 1XSPA 5D3GA 3Q8RB 2XO7A 4HHTA 4IRKA 4Z6EA 4CECA 1RXWA 1BIUA 5KRSA 3PX4A 1ZYQA 4CIFA 5CZ1A 4ECSA 2W8KA 4I27A 1ZQWA 4RW7A 5KFGA 3P5JA 2KFNA 4BDPA 3V72A 1Z00B 5DDYA 1A5WA 2W9MA 2ZD1A 1WCLA 3LPTA 4KRFA 3VQBA 2FLNA 1IKXA 4LSLA 1B9DA 3HWTA 4F4ZA 1YTUA 5HHIA 2O4GA 4BXOA 1JXLA 4OVLA 4P2HA 2W42A 1NK6A 3VQEA 1ZQAA 3SCXA 3QEAZ 3KIOA 3F73A 5CWRA 4O3QA 2ZJ5A 4IRDA 2YNIA 1IG9A 7ICUA 3MR6A 2OZMA 3VQPA 1WAFA 1VSJA 3DOKA 3DRPA 3DLRA 4H8KA 4CJSA 4M41A 3V1QA 3P1GA 3L3UA 5J0YA 2W9BB 3P83D 4EZ9A 4YR2A 3E2EA 3KHHA 1S9GA 4ECVA 4JV0A 5J2QA 5KT7A 4NYNA 5KT3A 3MECA 3RMAA 5KFMA 1WSIA 4IFYA 1ZQHA 1A76A 4CERA 2B5JA 8ICWA 4FLWA 4M3XA 9ICSA 4P4PA 1BISA 1KSPA 1D9FA 4QZDA 4IBNA 4NCBA 4JV2A 2NRZA 5FROA 5L9XA 2FC0A 2NUBA 2EX3A 4YXJA 3ORYA 4ZH4A 2F1HA 3KHRA 2HVIA 4OGCA 2FPKA 4RZRA 1HYSA 5F9NA 8ICSA 4DLEA 3BDPA 4XIUA 2AGPA 4B9VA 4OPKA 3RJGA 4FLUA 4B3OA 4FCYA 1ZQYA 1BHLA 3AVKA 1XWLA 4M0AA 3RMBA 2G8IA 8ICZA 2XY6A 4CGHA 1YTAA 5CY4A 4DLGA 3U3YA 4TQRA 5C42A 3L2WA 4F4YA 4UB3A 5C24A 5EWGA 3AO5A 1Y97A 1SKWA 1NK8A 4CEZA 3QO9A 3ZT1A 4YMNA 4OGEA 4BGDA 2BCSA 1RT7A 3AU2A 1JXBA 1TAUA 3SUNA 1R0AA 4RQ4A 3GV5B 1HQUA 4ZTFA 1JN3A 3C1YA 3L2QA 3IRXA 2R8KA 1GOCA 3MBYA 4M3WA 3IS9A 3NGDA 4AHVA 3QZ8A 5CP2A 5KFNA 3B6PA 4O55A 5KT4A 1N56A 7ICJA 1CXQA 4KHNA 1TV6A 4KTQA 3FFIA 3V4IA 1HNVA 3VQCA 4J9PA 3THVA 1C1CA 1JLCA 3SYZA 1VSKA 1REVA 3LANA 3VQDA 4I2IA 2IHNA 4FJKA 3HM9A 5KG4A 1QE1A 3V7KA 1TKTA 2WOMA 3T5LA 4E1MA 2R7YA 1MQ3A 4R65A 3MDAA 3SI8A 3HSTB 3LDAA 1NKCA 3ULDA 4MEYA 1WN7A 1J9AA 3ZSXA 3O3HA 4UBCA 3I0SA 4N76A 4DTJA 5HHHA 3LK9A 4DQQA 1RT5A 3HPOA 2RN2A 4JRQA 4OLBA 1L3VA 3PY8A 1VSDA 1S1UA 1RBTA 2RF2A 3LPUA 2BHNA 3C6TA 4CF8A 3GV8B 4Y1DA 3U3GA 1ZQBA 3LAKA 3ASMA 2KQ2A 3LP1A 4KKOA 3VQ6A 1MQ2A 4FO6A 1UT5A 3MR3A 3RB4A 4YMMA 3C2LA 5L1IA 4KLIA 2PI5A 1ZQIA 5KFWA 3NTUA 3LP0A 4CEQA 4CFAA 1TV9A 1RBSA 4KITB 4I2FA 1MSWD 3NDKA 3TAGA 1SUQA 3VQQA 4BWJA 3K5NA 2FMQA 1ZQNA 2MUTA 3DRRA 3TANA 4DF8A 1ZQCA 3PMLA 4UB2A 1Z3EB 4JUZA 4RQ2A 3KLEA 2B21A 1RXVA 3QIOA 2QKKA 3RJFA 3EYZA 2ALZA 4AHUA 4B8AB 4HUEA 3VQ9A 4MFBA 3FYHA 2F1JA 1HYZA 8ICEA 4NLZA 1LWEA 3AU6A 5IINA 7ICQA 4CGGA 4M9GA 1S0VA 5HMLA 3SQ4A 4FK0A 4HTUA 5HRPA 5J2IA 1T4GA 1CUKA 4QZCA 2JZBB 4RT3A 4DFKA 1B92A 4FJJA 2GUIA 4DTXA 1RPLA 4CFBA 4PHAA 1W9HA 3QINA 4BWMA 3G0ZA 4KHUA 3HT3A 5DBAA 2FPMA 4RQ1A 4FBTA 5DB9A 3KKRA 4KTZA 4CEBA 5HP1A 7ICEA 3OYFA 7ICOA 4ELUA 2HHUA 5D4BA 1N5YA 1WCNA 1C6VA 3KD5E 5DK5A 4FLTA 5KFLA 5KG5A 3CFRA 4DSLA 3QEXA 3ISNC 5JS2A 7ICHA 4RPZA 4I2QA 3ZT0A 3FDSA 4PHDA 3D0PA 2HHSA 4CFCA 3DI6A 4E3SA 2BCVA 4RU9A 1IXRA 5DG8A 1QSLA 4YFUA 5HNKA 2B4JA 2XGPA 2G8KA 3AO4A 1JLGA 1U45A 3ZCMA 1KVCA 3NF6A 1K6YA 3B0XA 5BPCA 2NRWA 4F5PA 5J2HA 1RDCA 3NF9A 4YMOA 3LWLA 8ICFA 3H4DA 4Z4HA 4ED3A 4MEXA 1BGXT 1D8YA 1TVRA 4O5KA 3TABA 4W5NA 4ZHRA 2Z1HA 4FJMA 5CJ7A 5KFPA 4M9JA 4C8KA 4QW9A 2PI4A 4KB0A 3GDXA 2OA8A 1XSLA 3RH5A 1XS9D 1UOCA 1RT3A 5D46A 3IHQB 7ICRA 4LD0A 3DYAA 4HUGA 4F3OA 3QE9Y 4CEDA 4CJUA 2YKMA 3K57A 4ZTJA 3ZDEA 4XRHA 2UVUA 3T19A 4TURA 4CJ3A 1BPYA 5J0QA 3QEWA 4M6WA 4OJRA 3OYLA 4DTSA 8ICGA 4N47A 3QEVA 2AU0A 4DS5A 4NCGA 3RRHA 3O4NA 3GQCA 4QZAA 2BCUA 1HMVA 3SI6A 3PX6A 4OLAA 3S9HA 1S1XA 5KG7A 4KTWA 3OHBA 4DFJA 1ZQQA 2BGWA 7ICPA 5TZVA 3L8BA 2QKBA 2Z1GA 1ZQKA 1NK7A 3V9UA 4CGDA 2XC9A 4EP4A 1RYRA 2OYQA 4J9RA 5IIOA 2PFOA 4F4XA 1K1QA 5KI6A 2QXFA 5KFOA 5J2FA 4QZFA 4KFBA 4FS1A 4EP5A 1SKRA 2W9AA 3RRGA 1ZBUA 3HPHA 2BR0A 3QLHA 4F92B 1EX4A 4LH5A 1D5AA 1U47A 4NLNA 1HRHA 1HYVA 4ED7A 9ICMA 3OYHA 1ZBIA 1QSSA 4W5TA 4PA1A 1X9MA 4RNNA 1LW2A 3V7LA 3B6OA 3GIKA 3V6HA 4B9NA 3AVFA 4N5SA 5EOZA 4O0IA 1BPZA 3G6YA 1QSYA 5J0XA 1ZQRA 5FRNA 2C22A 2BQ3A 4CIEA 3PW4A 5SZTA 1XSNA 4I2EA 2HHQA 1B43A 4DU4A 1TKZA 2G8FA 2FBVA 2HNZA 4AHSA 5KFRA 2VG5A 3O3FA 3NH0A 2RDIA 3MFIA 1WNSA 3HO1A 1CEZA 1KLNA 4FJ7A 2IBKA 3PV8A 5KFEA 3AO2A 4C8LA 2G8VA 4LZGA 4YCXA 1EKEA 2ASDA 4QZHA 5DB7A 5KRTA 7ICLA 1NK0A 5DB8A 5KT2A 3JPPA 2PFNA 3M9MB 9ICLA 4LY7A 1Q9YA 1MU2A 4CIGA 5HRSA 4KLSA 2HNYA 4IQTA 2FBYA 1TK0A 5FDLA 1ZBLA 5HRNA 2P5GA 4CGIA 8ICTA 4BE2A 3TFRA 1HUOA 1ZQGA 5KG2A 7ICIA 1LWCA 3QEBZ 1IH7A 3S3MA 4QWDA 1EXNA 3K59A 1JLBA 4HYKA 4YD1A 1ZQDA 1ZQPA 1U49A 4DFPA 3UXPA 4DF4A 3SQ1A 1LAWA 5DDMA 1VK0A 4YNQA 3T1AA 3VN5A 4KN4A 1SKSA 4EBCA 4RQ7A 3VQ4A 3AA4A 4PY5A 4I9QA 3NH1A 3OY9A 1LW0A 3ZSOA 3AO1A 1ZQXA 4B9UA 4ECTA 2BPGA 2BQRA 1WAJA 4GXKA 5J2PA 3RR7A 5KFUA 3ZD9A 1EP4A 3HVRA 8ICUA 4FZYA 2FLLA 2DPIA 4O3RA 1Q9XA 1CZ9A 5L1JA 2FBTA 1Z25A 1KEJA 1B9FA 4RG8A 2BCQA 2G8HA 2C2RA 3T5JA 4M47A 4QZEA 5DMRA 3ZSVA 1J5OA 3MGIA 4KO0A 2W9CA 4RW9A 1ZQVA 2FLPA 4RW6A 4RNOA 4PGXA 3V1OA 4LVSA 5HROA 5BOMA 2BE2A 4O5EA 4KLQA 2BANA 4E0DA 2A1JA 1NOMA 2M9NA 3N97B 2I9GA 3O3GA 4ED2A 4QZBA 5KGWA 4KHYA 2KTQA 3HK2A 4GC7A 3OYGA 3RAXA 5CHGA 3RJIA 4O3OA 3HL8A 3KLIA 3M8PA 1VSEA 3CFPA 5J2JA 3RB6A 4F4KA 4BACA 3RB0A 4DL3A 5J0PA 1UA1A 2BPFA 5KT5A 1HUZA 2PXIA 2YNGA 3HP9A 3C21A 3CM5A 3VQ5A 1NK5A 2OWOA 1C1BA 3H8WA 3RH6A 3OYCA 3IG1A 1ZJNA 2VWKA 3CG7A 2HHWA 2R8IA 5DQHA 3M9NB 4CJVA 1U9LA 1G15A 1RBUA 4P4MA 4AH9A 2ZUBA 4Q43A 3H4BA 1ZJMA 1EXQA 2GV9A 4ECQA 1NK9A 4CHOA 3SUQA 1Z00A 4ECZA 4OKKA 4CHQA 3NHGA 4FS2A 2XY5A 4DL2A 3KK2A 4I2AA 4M04A 1WSEA 3TFSA 5DB6A 4R63A 4Q44A 1J54A 3QETA 1ZBFA 4E89A 2WTFA 2XCPA 1DTTA 4YG2A 2Z1IA 7ICFA 3Q8SB 1RTIA 4IQUA 4KV8A 5J0OA 1YT3A 2LYHA 8ICCA 2P6UA 1T7PA 5DBCA 4YVZA 2A1SA 1TFRA 5J2MA 1JXEA 4DSJA 4EBDA 2YHAA 5DGBA 5CYQA 3V9SA 4M2YA 1ITGA 4Q0BA 4PUOA 3EY1A 2KN7A 4Z4GA 3M9OB 4DQSA 3C6UA 3TAFA 2ZJAA 4JS4A 1TK8A 1BPEA 3HYFA 2Q0ZX 8ICOA 1JLQA 1L3TA 1ZQOA 5EU7A 3CM6A 2D0AA 3TAPA 3OYJA 4BDYA 1A5VA 3ETLA 2W8LA 4RNMA 5J0SA 4UAYA 4CHYA 8ICIA 3BJYA 1UA0A 4I7FA 1U48A 4Z6FA 4RQ6A 4E7LA 4MFCA 5J29A 3G6XA 3NGZA 1BIZA 2Y1IA 1RNHA 3L3VA 5J2DA 4B9TA 1C0UA 1NK4A 4K8ZA 1YVUA 1RDBA 3A2FA 2I1QA 3PW5A 3RAQA 1D9DA 4J2DA 3WNGA 2Y1JA 1FKPA 1NOZA 2D0BA 4F4WA 2ISOA 3DRSA 4M3RA 3RMCA 1MC8A 1IKWA 1RTHA 5HBMA 4BE0A 1HJRA 4QWCA 4CJFA 3NFAA 1KFDA 3K4GA 4CCHA 1TK5A 2BKEA 4CJLA 3HW8A 2DFHA 5IIJA 3RMDA 1X1PA 3SPYA 3ISCA 1WSFA 4WE1A 4KLOA 5KGXA 3KKSA 4CJTA 1JMSA 4F5QA 4QWBA 2P6RA 1TAQA 1TL1A 3RB3A 3OYEA 1RT1A 1JKHA 4CJQA 4KREA 3SQ0A 4ED1A 4R64A 2BPCA 3JPRA 8ICBA 1S0NA 5DQIA 2R8GA 4IQWA 1KRPA 2YNHA 1XC9A 1KDHA 3AVBA 4CJWA 1C1AA 1JL2A 4ED0A 3NF7A 4M3TA 4KLDA 2FBXA 1J53A 3MXIA 3AVIA 8ICLA 5L1KA 1QQCA 4MFAA 2IGIA 5DG9A 3K58A 3BQ1A 2NRVA 3U6FA 4QCLA 9ICRA 1HNIA 8ICNA 2EHGA 1SZPA 1NJYA 4DU1A 4JV1A 3MFHA 4YFKA 1WLJA 2PYJA 3K5MA 3EZ5A 4ICLA 4PWDA 2HMIA 3GIMA 3VQ8A 5J2BA 1XO1A 5DQGA 3KK1A 3DLBA 4F5NA 3H8JA 1CXUA 4Q5VA 1HPZA 2BGGA 4LZDA 4J2EA 3TQ1A 2NRTA 3BGRA 4DL7A 1XU4A 4KLFA 4AILC 4UB5A 4YXMA 2A1RA 3M8QA 9ICOA 3LDSA 3QEIA 3B0YA 1DOQA 5K14A 4B8CA 4Z4EA 4JK1A 3ZSYA 3TAMA 4CHZA 3OS2A 4J9MA 3ZT2A 4FM1A 4CJKA 2Q3SA 2JEIA 3I8DA 3LALA 4KLMA 4O5BA 4K4IA 7ICMA 5CR0A 5L1LA 4KI4A 4QOZB 4F2RA 3PO4A 4YQWA 2I5JA 1FK9A 4FLZA 1I3AA 4XA5A 3H40A 3DOLA 4ED6A 4O3NA 3AUOA 3EPIA 3K75D 8ICPA 4E7IA 3UQ2A 2V4QA 3AVLA 3DLGA 4J2BA 3ZSZA 4JRPA 5T7BA 3ZDBA 4RUAA 4H4MA 4CF1A 3RJHA 1VSFA 4J9QA 4FBUA 4ECXA 5J1EA 3E01A 4Z4CA 8ICRA 3C2MA 2ZE2A 4RQ5A 4IG3A 3PNCA 3UPQA 2JEJA 8ICHA 3K5LA 9ICHA 4K4HA 4JWNA 4J2AA 3MEDA 1ZQUA 2JZBA 1BI4A 3MABA 1O1WA 2BCRA 4ECRA 2J6SA 2YKNA 2FMSA 3ZDAA 3QZ7A 4P4OA 4X5VA 1X2IA 2PFPA 1KCFA 2AGOA 1JLEA 4KAZA 1KFTA 4YP3A 3QESA 3PX0A 4CESA 2KFZA 4ID1A 1QHTA 4TSXA 4YR0A 3OGUA 3TARA 3AO3A 2X6NA 4QWEA 4IFVA 4RQ0A 4RQ8A 4F50A 3NBPA 4RT2A 1NJXA 3N4MB 2QK9A 5KG6A 4UAWA 2XCAA 3OYNA 1T03A 4MFFA 2ITGA 2P1JA 5DG7A 5CA7A 1F21A 2AGQA 5IILA 3RBEA 4R8UB 2OPPA 4CJPA 3OYAA 4J9SA 3L2UA 4FM2A 2OPQA 3OYBA 4M9LA 2KW4A 5CB1A 2ZUCA 1CZBA 1QTMA 4IR1A 3TI0A 4CK1A 1EETA 2XGQA 3CQ8A 4DSIA 3LP3A 4DMNA 4UB1A 4FK2A 5J2EA 4HCCA 4I2DA 4E1NA 4PHPA 1NOYA 4I2CA 4FXDA 2IHMA 4E7JA 4I2BA 3BQ0A 3DM2A 5KG3A 4FJ8A 4FM0A 5KFBA 3JPNA 5SWMA 2ATLA 2O4IA 3KTQA 1T3NA 4Q45A 1K1SA 4KLHA 3OS0A 4TQSA 4B9SA 3D45A 4FJIA 3SNNA 2NRXA 4CJRA 3KHGA 2FMPA 4BXOB 2UVRA 3PVXA 2UVVA 1NJWA 3V9WA 3JPTA 4J9KA 1ZQMA 5JS1A 4F91B 2AQ4A 4DTOA 4KLGA 4C8NA 1RDDA 3V1RA 4Z4IA 4FYDA 4GLXA 5KFQA 1ASUA 3NAEA 3VA3A 2YNFA 2E6LA 4R5PA 1LB2B 1IO2A 1KVAA 3AA5X 4CF9A 4FW1A 4PHEA 4C8OA 4DU3A 3CFOA 1IM4A 5J0TA 4QZGA 4UBBA 2P5OA 4FJ9A 8ICVA 4W5OA 2IC3A 5KFAA 4GW6A 2X74A 3T3FA 2C2EA 1ASWA 3M8SA 4OKEA 3JSMA 3VQ7A 3HPGA 3ZDDA 9ICKA 2ZQBA 4KHWA 5HP4A 4NXZA 3OYIA 2JEFA 4DTPA 5BOLA 2VA2A 1BL3A 5J2NA 2R8HA 1S76D 2VA3A 3NCIA 3HP6A 2JGUA 4Q8FA 2YHBA 1CLQA 4CGJA 2G8WA 1LWFA 3QERA 1L3UA 2PY5A 4KB1A 5J2AA 2OPSA 1N6QA 1T05A 4G1QA 1BCOA 1C7YA 4I2JA 1TKDA 1VRTA 2E6MA 1XI1A 1FKOA 4RW4A 1ZQSA 2VG6A 4MF2A 1ZBHA 2AJQA 3HVTA 2JEGA 3AVMA 3RJKA 4FW2A 1TL3A 4I9LA 4FJHA 4Q8EA 9ICIA 2ZJ8A 4DWIA 1RT2A 9ICQA 3Q8QB 2HHTA 4FJNA 3PR5B 3MEEA 1RDAA 3V9ZA 4O9MA 4NLGA 3IM1A 2VANA 9ICNA 4EYHB 5J0RA 4CK3A 3G10A 7ICSA 4LH4A 4B9MA 1S6PA 3RH4A 3C95A 2FPLA 3T5KA 5KT6A 9ICPA 4OPJA 3PW0A 3KLHA 4L8RB 5J2CA 4I2PA 3OVNA 4BE1A 2J6UA 3AA3A 3WNEA 1Y88A 3RJEA 3OJSA 5D49A 9ICTA 4RPXA 4Z4FA 3H08A 4TUQA 1NKEA 3Q8KA 1IKVA 3UQ0A 4IR9A 1S9FA 2IOCA 3LWMA 9ICEA 7ICGA 5EWFA 3ZSQA 4ECYA 1JLAA 4OKJA 3DLKA 1RTJA 4BDZA 4NY8A 3TAEA 4CHPA 4ECUA 3ZT3A 1AROP 2H5XA 3EW9A 5IIIA 3MXMA 4K8XA 3RTVA 3C5FA 4XQ8A 4DEZA 1RTDA 2GWSA 1VSHA 1XHZA 2IDOA 5F9LA 1TGOA 4KHSA 4MF8A 2ZUDA 2DPJA 3AVHA 4DTUA 1DGSA 4O5CA 5C25A 4I29A 3Q8LA 1KTQA 4FLVA 5I3UA 1X9WA 3QEPA 3C1ZA 4J9LA 4FVMA 3JPOA 3GFKB 2OPRA 3HXMA 3MXJA 2P51A 5KFIA 3QNNA 5KG1A 9ICCA 2R8JA 1WSHA 9ICJA 5HRRA 1UWBA 3SZ2A 5HMMA 2ZTDA 3UIQA 1KLMA 1SL1A 1ZQFA 1Q8IA 4O0JA 4DFMA 4ID5A 4DTMA 4CJ5A 4IQVA 1ZQEA 1KFSA 1S10A 4JWMA 3PUFA 5J2GA 4PQUA 1COOA 2C2DA 4EYIB 2W9BA 4E7HA 8ICKA 1RILA 3ALYA 3KLGA 3AVGA 1TKXA 4PGQA 8ICQA 3VA0A 1GOBA 1RYSA 1V9PA 2KZ3A 3V7JA 2MUTB 2IMWP 3RR8A 4MQ3A 3H8SA 1JLFA 1LV5A 1NJZA 2VG7A 3K2PA 4FJXA 3KJVA 1SL2A 4M9NA 2PYLA 2X6SA 1S5JA 1T8EA 1ZQTA 1BPDA 4NCAA
chains in the Genus database with same CATH superfamily
1WC4A 4UB4A 1S77D 3HRGA 4CZHA 3EGZA 1VSIA 1OY6A 4UZCA 4QWAA 5F8MA 3SFUA 1RAAB 2Z30B 5DZ6A 4X64J 4GKJK 3JPQA 2GA7A 1IG8A 3TZYA 4MK9A 3JAMO 1QS4A 2BOAA 4DU7A 1PC5A 4PWDB 3BF4A 2HBRB 1JI7A 3QNOA 4JS5A 2YWKA 4FZXC 2KXHA 2XBPA 2HPUA 5HP1B 2IPOB 5CQGA 1D8LA 2M8HA 3AAWB 4DUZF 3CIMA 4L6V3 5C12A 3D2EB 1NZ8A 1FXDA 3QU9A 3OS1A 3M30A 4K4GA 4PZVA 1ZETA 2A2DA 4WQ5C 3HSJA 1IKYA 3MDCA 4NLYA 1X66A 4LUBA 3UE2A 4CEEA 3BGFA 3AD8C 4O4GA 5M2PA 2PMZD 2BJ3A 2C42A 3THYA 4H4OA 1TVAA 3VMFB 2WONA 3DI6B 4JK9A 3M6KA 3UVJB 3PJXA 2NSCA 1ZM9A 3JB9k 4I67A 4NI2A 3Q86A 5KFCA 1RACB 1O8BA 3O1LA 1XNQK 1X6JA 2UVWA 4HI1A 3TJ9A 1DY3A 2XS2A 2EK6A 2PKEA 3H5YA 5EE3A 2DWQA 3D66A 1U4BA 3NGSA 3L4PA 5J8YC 2JHDA 5JTIA 3QGIA 8ICAA 1YJ9S 4GC6A 2ZH3A 1T02A 1U04A 3G4SN 1UHUA 3EMTA 3MDQA 4J9NA 2FZKB 3PIOQ 3MM5A 1XIQA 3TKAA 4URQU 3ISBA 3WUHA 3T1YF 5KFVA 1S97A 4QZIA 3MEGA 5L46A 3HM8A 5LL6Z 4PRFA 3R7NB 4ANCA 4YB1P 3PYFA 4KPYA 1WG5A 4UAZA 3OYMA 3KUHA 4C8MA 2HHXA 2GO8A 2P9KB 1LAVA 1RAIB 2DHAA 3DYAB 4DQIA 2CNOB 1YSJA 4CLZA 1RU2A 5KFFA 4JI6K 4AHCA 1YJNS 1VQ4S 1VLBA 1AT1B 4F93B 3VZIA 1IQTA 4CM0A 5G5HA 4ZOHC 2UYTA 4LF4J 3C2KA 1H38A 4DN0A 2WF6A 3T69A 3H0RB 2WAQF 1X42A 2XEXA 2V94A 4I64A 3W8PA 5KAFU 4JI3K 3A12A 1YBAA 4OJHA 3CCTA 1HHTP 2ZZNA 4E19A 1U1KA 5KFYA 3P38A 1GX6A 2Q6BA 2HWIA 2ASMA 3I8BA 3QSYB 4GXJA 2Z1JA 2VDIA 3WIUA 1SZHA 4Y2UA 3AOAA 2J4RA 1RDUA 3I0RA 2IVPA 1L5UA 5HL7Q 2FY8A 3N79A 1BQNA 1E6YB 2I5HA 3VCDA 2F4VF 4KQZA 3EL2A 3D2SA 3SUOA 2XMJA 5B0FA 4CF0A 2OTJN 2K4IA 4LBIA 3G8SA 3O1BA 3A8EA 4WYLA 2LU2A 2PEBA 1RAOA 3CD5A 1WC5A 1XK8A 2XRIA 4X4SA 3IG8A 4FOEA 1U7LA 2F96A 2CYYA 1MWMA 4YY3J 4PR6A 4LVOP 1ESVA 4UT4A 1WWVA 2MZJA 3SV4A 1FFGB 1TZ0A 3Q7CA 3MR2A 1ZOTA 3MCOA 1RBVA 1Q86O 2FGOA 4I6AA 2W25A 1XR6A 1OMSA 2HNZB 5A8KB 5KFTA 3EWAA 1FEZA 2VG5B 3GU3A 3UXNA 2IMOA 4K2JA 4DTNA 3BQTA 4O3PA 3D3BJ 4FJLA 2GJ2A 3V6JA 1GLAG 2FVSA 1ZQZA 4GV3A 5CA5A 2JLEA 1X6IA 3MTJA 2O8BA 2GIFA 4HVJA 3TSUA 1A5XA 2IAJA 3D6JA 1SC6A 2KRRA 2GBZA 2HDOA 2YY3A 4CZCA 1MU2B 3AVCA 2RDJA 2HNYB 5GMDA 7ICKA 1XMBA 4FPBA 1UKUA 3ZT4A 4UTGA 3QIDA 2ZZMA 1C0MA 3MM8A 1PSDA 3IMXA 1L7OA 5AQJA 9ICBA 3V6KA 1MMDA 3VGTA 5CYMA 1KVKA 2MZRA 2J7WA 1N61A 3H3OB 3I32A 2FXUA 5C5JA 3IDWA 1N33K 1NNLA 2HFZA 2OPSB 3O2IA 4OJ1A 2GH1A 3PSFA 4HKQA 1F0MA 4DR2K 2YKAA 3E9LA 4I28A 3ULEB 4YDDB 4CJ4A 3OJUA 3KK3A 3DLLQ 4FJGA 3QU5A 1V3ZA 3SBGA 4A5BA 1DTQA 3IBFB 3M8ZA 5B5EU 1VIOA 2F5GA 4KGXB 1WBBA 2DY4A 1RT2B 2EFGA 1BVSA 1Q53A 2J0QD 1FRXA 2KSOA 2CQ0A 3AVAA 4FZZA 3SAFA 3K5OA 4PPXA 4CK2A 4Y6IA 3VAGA 4ED4A 1R8BA 3NGYA 1UP1A 2YXLA 2F8SA 3RBDA 3ZSRA 1GO3F 5BREA 1HEKA 3Q8PB 5E41A 2BW7A 2F63A 1K8AO 3BH6B 2DGUA 1FX4A 4HT7A 4KLTA 3GFXA 2BE9B 3NRBA 5H1SQ 1MA9B 3KXDA 2F8EX 3GV7B 4LT6A 4ECWA 2K8AA 4LF6J 2V4RA 1ZQJA 3BSNA 2E5LK 1HNXF 4NLKA 4KHMA 1I39A 1RAFB 1HWIA 1RTJB 1SJ1A 5HQLA 9ICUA 4KH5A 2OYYA 2ASLA 1CC8A 4ZP6A 5JVHQ 5D3GA 4IZ9A 3Q8RB 4Z6EA 3AAPA 3PX4A 4CIFA 2W8KA 5CRXA 3PFEA 2FVQA 3H25A 4JI5K 1YZ6A 2UUWA 2CXYA 5D4LA 2QJ3A 5DDYA 2EI5A 2MXYA 2F8MA 4LRBA 2ZD1A 2WHOA 2WF9A 3NNAA 1YAGA 2HS3A 3GZ7A 1S4EA 3TVZA 2D0OA 5HHIA 2KJ5A 2CVIA 3TACB 2BYCA 4OVLA 1F0XA 4P2HA 3U26A 1OSDA 1NK6A 2GHPA 3VQEA 4BGBA 1RTIB 1KVIA 3KIOA 3WK7A 4DR4F 4O3QA 1RZMA 1FXLA 2RDDA 1PJ7A 2DY9A 2OZMA 2WB1D 3DOKA 2BKPA 5KPRA 4CJSA 4M41A 3P1GA 3L3UA 5J0YA 1X4FA 4EZ9A 1MG7A 4F26A 4X62J 1M90T 4PUOB 1O08A 3KHHA 2IFXA 3VGSA 4Y2TA 4ECVA 3D6FB 3O5TB 5ETLA 2HRUA 2Y1LB 3Q2SC 4NYNA 1KONA 2H3VA 3LDQA 4B1XB 1JLQB 8ICWA 1XMQK 5AM2A 2DIUA 9ICSA 4AL6A 4YUDA 2LYAA 4IBNA 1HD1A 4TYBA 4YB5A 1W2BR 2VG7B 2MJNA 4A62A 4BQZA 4X66F 5IQ6A 2Y0BB 2RU9A 3IGNA 1YJTA 4I7FB 2ZHAA 1OYEA 2KT5A 3TUIC 4OX9K 5K5MA 3DMJB 2Y0SC 4RZRA 5M1OA 8ICSA 4DLEA 3QRRA 3O0FA 2D1CA 2VBYA 4J8FA 4C0OC 3BDPA 2LMRA 3KLFB 1DZ5A 1X5TA 1UVKA 4DR6F 4B3OA 3I82A 5M2RA 1BHLA 1ZBTA 3ONQA 5F1XA 4PWWA 3L7PA 2XY6A 1ZH5A 5HBMB 5C42A 1NH7A 2V52B 4PQAA 3QO9A 2LQBA 4OGEA 2GMHA 1RT7A 4CM2A 3AU2A 1JXBA 2CPDA 1MNEA 2MHNA 3TJ8A 2HGLA 3L2QA 5JICA 2R8KA 1KKXA 3QT5A 1VLOA 5KFNA 3RRKA 2VQEF 2E88A 1N56A 3EZOA 3DDIA 4C3MA 1SVDA 3V4IA 2AHOB 1APSA 2GX9A 3THVA 1VSKA 3SYZA 3VQDA 3CJKB 3SQOP 2W41A 3RGIA 2CPXA 2VDHA 2ZGZA 1RQNA 1MQ3A 4TY8B 4LF2A 2D3UA 5AI5A 3SI8A 3V5RA 1PGZA 3G82B 5GMKa 1C0GA 5I9EB 3MMAB 1HARA 3ULDA 1QQ6A 4MEYA 2JR5A 4PHTX 5TKWA 2B43A 1JROA 2KEYA 3KK1B 2I6XA 3HPOA 5EGYA 2RN2A 3CPWR 1RA6A 1SQFA 1UW9A 1L3VA 1VSDA 4CF3A 1X40A 2V34A 4NLBA 5KOWA 3J7Z5 3L7OA 3UW1A 2CQCA 2NXNA 1R27B 2WC9A 2GAHC 1K8KA 2W54A 3DXKA 5B08A 3A3PB 1IR1A 4KKOA 5K14B 3CCWA 4UW2A 4I0WA 4G6VB 4WYWA 3MR3A 3RB4A 5L1IA 2PI5A 3H3NO 2QEXS 3FQKA 3BP8A 4BRDA 2J0SD 1Z4UA 2FHJD 4JI6F 5AK5A 1TV9A 4DR7K 4KITB 4Y34A 3MURP 4CZEA 2I5JB 1FK9B 4FWMA 2FZGB 2JMGA 2J5AA 1KW4A 3ZLJA 2R4FA 2HYIB 2H51B 4YMEA 4JNEA 3I1YA 4BR7A 3PMLA 4ZP9A 2DIVA 1LKYA 2BM0A 4M5DA 4OYMA 5M1NA 3MOJB 2IRXA 4AHUA 1RQ0A 3BS5B 4B8AB 3AGKA 2RVJA 4P0QA 5J1EB 1X4AA 4JI0J 3FYHA 2F1JA 4FF4A 4NLZA 2W40A 1SXDA 3DXSX 4IWVA 3K1RB 4FWKA 2DNGA 1Q95G 2PIIA 5GADU 1S4FA 5HRPA 5J2IA 4QZCA 1KR4A 2VF3A 3ISZA 1FF2A 4FF2A 1KHWA 4CFBA 2EFOA 1W9HA 4BWMA 1Q86T 3G0ZA 1N36K 4PG5A 3D6RA 5HP1A 7ICEA 5LT5A 7ICOA 5L38A 2HMXA 2A6AA 2AJ1A 2B6AB 5BR8K 2E8MA 3QT7A 1VQPN 3OQ2A 1VBXA 5I3PA 3D2EA 4FLTA 3SIPB 4P7VA 3CFRA 3MGJA 5AFUA 2XMKA 4DSLA 3P4IA 4B17A 3DOMB 1UEVA 1T03B 5JS2A 3LVVA 3ZT0A 5A2QO 1DQ8A 1DQ9A 3M1FA 1WTBA 2D8CA 4ILGB 3DI6A 4WP9A 5B0DA 2BCVA 3OTOK 3UVJA 3Q23A 3VOVA 1YITN 3H90A 3DXMA 2FVCA 2E5SA 1TFYA 2G8KA 1U45A 2DB1A 3RVCA 3B0XA 2NRWA 8RUCA 1AUDA 5J2HA 4LF5J 1Q3VA 2ABYA 1RDCA 3NF9A 2MA1A 3J7AP 3KBBA 8ICFA 1Z2ZA 2CWXA 4ED3A 2IRUA 4UASA 3D1QA 3H20A 2A1AA 2L41A 4K0KF 5GINA 2ZIXA 2MZQA 5AR0A 4IC9A 3CJSA 2Z1HA 2G1DA 1BMQB 2ROGA 2ACMA 3M6WA 1WI6A 1XSLA 3RH5A 4WPAA 4EMDA 4RQNA 1XS9D 1NB7A 1UOCA 4WXOA 2A10A 1N33F 3DYAA 4HUGA 1ZM4A 3QE9Y 1OH7A 1NJIT 4QPTA 3LF0A 4CO4A 4B1YB 4CJ3A 1P27B 3RBXA 3A1YG 2RQ5A 2EANA 5K8PA 2G0IA 3OYLA 3TZXA 5AKHA 4F3MA 8ICGA 4N47A 2HIQA 1S59A 2BCUA 4F3QA 1SQKA 3SI6A 4OLAA 3MUMP 1UPPA 1RHQB 3HBTA 3LP2B 1D8BA 1OO0B 3WDOA 5TZVA 1R0CB 2QKBA 2IC3B 4C80A 2V6AA 3J80Y 1HHQA 2Y9TA 4O5FA 2XC9A 2ZH2A 2QB1A 4HTLA 1OS5A 1O51A 3EE8A 4JI8F 1E6YA 2W11A 4EX7A 5KI6A 4IOCQ 4P73A 5KFOA 4L75A 5M1FA 2W9AA 3CQXA 3A0HU 1ZBUA 2ZIWB 1GK8A 4KIAA 3CCLN 1N0VC 1U47A 2YX7A 1HRHA 5AQPA 1QVFR 1HYVA 1ZBIA 2E20A 1Q79A 2LBOA 2R9LA 1RWPB 1X9MA 3WKCA 3B6OA 3V6HA 4B9NA 4ZKAA 4O0IA 1OYDA 1TL3B 2PMHA 1QSYA 1ZQRA 1VHXA 1FRLA 4PXDA 2ZJPL 1XSNA 1XR5A 1B43A 4ANEA 1RWNB 2Y9HA 2G2ZA 2HNZA 2X1AA 2XM3A 2VG5A 1KDNA 1NG9A 3NH0A 4QIVA 5HAOA 1T9VA 2D7SA 5ALOA 4JI5F 4KYZA 4A5AA 1RWXB 4EI2A 2VBXA 4ZVFA 4A48A 2VGMA 3THXA 3AO2A 1VHFA 1U0HB 3Q24A 2L9NA 3I56N 2DF4B 2BZ2A 3PM9A 2ASDA 3OPKA 4QZHA 4DV6J 2LFVA 5KT2A 3MX2A 3FFKB 3E8OA 5KAKA 1MU2A 4CIGA 4KLSA 2D1KA 2HNYA 2FBYA 5FDLA 1ZBLA 2B9EA 1H74A 1JLAB 1RWOB 2D41A 3M05A 3QEBZ 4F25A 1RWWB 2ILZA 4MLEA 1EXNA 2Q97A 1JLBA 4ES1A 3PEHA 4FZVA 4RUBA 1ZQPA 1U49A 4K50A 5DDMA 1VK0A 1IWAA 5GAGU 4YNQA 3VN5A 4KN4A 2GHVC 1SKSA 4EBCA 4PY5A 3NH1A 1GXUA 1HNZK 5AQIA 5AQUA 3ZSOA 1M1KO 5G5GA 1F5AA 5D0GA 1K73O 3ULEA 2R7UA 3DDKA 4I6MB 3ATUA 4FDFA 4B02A 2MQQA 4MH8A 2A40A 2IYGA 5BJRA 4WFAL 4FZYA 3P3DA 4O3RA 1CZ9A 1WC3A 5LJWA 2FBTA 4OYIA 3CC2S 4ATNA 9RUBA 5AHXA 5KL8B 1RAJA 4M47A 1V9OA 2JWLA 2B3TB 3I5BA 4QZEA 2KHQA 3MGIA 4ID5B 4JYAF 4DV1K 1ZQVA 1CJTB 4PQUB 2ZUGA 4LC9B 1F2GA 2BE2A 3O9SA 2K1RB 3Q7BA 3GYGA 3ZX3A 4BRPA 4E0DA 4JV5F 2NSBA 4BHQA 1HWKA 3CP8A 3KLGB 5LMNK 3N97B 1TKXB 3BPSP 3D2WA 4IH5A 4K4YA 5AI8A 2ZG6A 4QZBA 3TSQA 3CETA 1JQGA 3TOQA 4CZGA 5ALZA 1A6SA 3D1HA 3UMBA 1V5IB 1W2IA 3DXBA 2XHWA 3T1HK 1JLCB 1GLBG 4BX9C 4ZCKA 4DL3A 2HWTA 2BPFA 4AYBC 4CGZA 3HP9A 1JNZB 2V50A 4DR3F 2RIJA 4CZLA 3IDHA 1M5VC 4LIRA 2VWKA 1T9TA 3CG7A 2HHWA 1CJKB 2R8IA 3M9NB 3KFWX 1G15A 1N5QA 5DM6L 5K4LA 1EXQA 3UCUP 3NOCA 3ID6A 3U4LA 2R7TA 1D0EA 3N01A 1KS2A 5CHIA 4FS2A 2FHKA 4PG6A 4DL2A 1S72N 4I2AA 2YKOA 1N32K 3TFSA 1QAYA 4LBPA 5DB6A 3QETA 2QZ8A 1ZBFA 4E89A 3DU6A 2WTFA 1T3VA 4ZPDA 1W2BM 3UKUB 2KM8B 1RTIA 5LY3A 1Z1ZA 5J0OA 5LM7E 2UU9K 2RKIB 1YT3A 2LYHA 5FPMA 2P6UA 1T7PA 4PYAA 4YVZA 2DNZA 2A1SA 3ZX0A 4PPZA 3KDOA 1RUSA 2QI2A 4DSJA 4EBDA 4DR5K 2QWMA 4G65A 1ITGA 4LFCF 4W92B 4PUOA 4C8YA 2UXDF 4A8YA 4Z4GA 4JKHA 1Q4RA 1KWMA 2ZJAA 2V2KA 3HHEA 5IM0A 2KE7A 4UY8T 4ZCLA 3TTFA 8ICOA 1JLQA 2FHJA 3QJJA 1KVJA 1ZQOA 3KYLA 2YBVA 2PGCA 1PG5B 3TAPA 1D09B 1S1TB 1NGFA 2BBEA 3KLEB 4LRFA 2NV3A 3KKAC 1ZM2A 4FXVA 4I7FA 1FD2A 4GVBB 1GTEA 2RNEA 4MFBB 3CCSN 3AJ2A 2HK3A 2W04A 4IS7A 4PG8A 2Y1IA 1Q7YT 2F8LA 3L3VA 3AGRA 3QBXA 2BV3A 4R0EA 4FZMA 2I1QA 3UDLA 4PXBA 3FSYA 3VETA 1R8HA 1WEZA 2CG4A 1FE0A 1U02A 3AJDA 1VIXA 5B09A 2D0BA 4X4UA 4X4VA 3RMCA 3K89A 4NZ6A 1MC8A 4IL6U 1WELA 1TYQB 2CNKB 1NGCA 5HBMA 5KAIU 4CJFA 5LSLA 2IVYA 2AX0A 3K4GA 1F9EB 2D0PA 2MQOA 2YB1A 4HI2A 3FE1A 4IKAA 4QIWD 4AQYF 4DV2K 4WQ4A 3EJMA 1M6YA 3GJQB 4JN4A 2WBNA 3CDAA 1QDUB 3ISND 4CJQA 1JKHA 3SQ0A 1BUPA 1EJ7L 2MKIA 5D4OA 1CVJA 4ILMA 2BPCA 4KBIA 3S1TA 1S0NA 2R8GA 3B78A 4ZCIA 3L4IA 1VJ5A 3HFKA 1Q81O 2D3ZA 2D69A 3QBWA 1HQEB 5F0WA 1C1AA 3I4HX 2GFFA 4KLDA 4X4NA 3MXIA 1X0FA 5L1KA 2ATCB 3CJKA 1UJ5A 1WOQA 1EQYA 2B4UA 5AFUH 3U6FA 4X65K 4TY8A 2RE2A 2M8DB 2WVDA 2KVQE 2NUHA 1SZPA 2R7SA 2VJ4A 4FKXA 1URRA 1TVRB 2AJ4A 4YFKA 2GS8A 4U7BA 2Z0GA 4KC5A 2JH7A 2DHGA 6FD1A 3KK1A 3GB0A 4F5NA 1XMOK 2QLWA 4IEEA 5B66U 2ZZTA 4CO1A 3S6EA 3K0JA 1RGVA 1N8RT 2KNJA 4WFZA 2H3EB 3C19A 2LQJA 5ETKA 5D0RA 4J2EA 3IG5A 1BU6O 3MAAA 3ZI4A 2DNLA 4AILC 3J80U 3M8QA 9ICOA 3R5GA 3M2VB 4DG1B 4GKKK 2OIHA 5K14A 1HPMA 2XVTA 4B8CA 3IA0A 3ZTPA 4L3NA 1HW8A 3ZSYA 1HMVB 4NYZA 4Y2QA 2Q3SA 1DAXA 3LALA 4O5BA 5CR0A 5I42B 4ZITA 4IJAA 1NGDA 2I5JA 1FK9A 4FLZA 2J76E 1JXVA 4XA5A 3NVMA 1IBMJ 4BRNA 3VGMA 4LSNB 5T7LB 3JYTB 1D1UA 3CC7S 3UQ2A 3AVLA 3BKUA 1LXNA 3VPZA 3VENA 4H4MA 1VSFA 1YX2A 3BS5A 4J9QA 3OL8A 5J1EA 2BE7D 5HMXA 4LF7J 1RT4B 2CQBA 2ZE2A 1JCEA 1F5CA 4EELA 3E3XA 4OI4A 1UZHA 4LFAF 3UPQA 2CZVC 3HHLB 2ZWHA 2I2YA 2P9NB 2FZCB 2BXJA 1UJ6A 4J2AA 1DK3A 1O1WA 3MABA 2BCRA 3IR5B 3VF6A 3ZDAA 1BQMB 2EH9A 2GGPB 3CCES 4M1KA 2HAIA 2P35A 1JLEA 3ADAC 3WT0A 1NHVA 3PX0A 3ZEUA 5A6PA 4XK8C 4UY85 4CESA 2KFZA 4TSXA 3DLEB 4KT0C 2HFVA 4RQ0A 4F50A 3TRGA 1DGJA 1IVZA 4WP3A 3UN2A 2H48B 3O5BA 3DOMA 4F71A 1YLXA 3OYNA 4HDHA 1T03A 2P1JA 7FDRA 2RMLA 4K5RA 3OYAA 2P6SA 2MLXA 5ETPA 4P9SA 2JZ5A 3MCMA 4IR1A 1X3MA 4CK1A 2NS1B 3Q22A 1ZM3A 3H46O 5AIBA 1NGJA 4DSIA 1N54B 2RUSA 2FVPA 1Y9OA 4AXIA 2DNMA 2DYAA 4DV4J 1V6HA 4AUKA 2GUPA 4FK2A 2H5IB 4I2DA 1WWHA 2W03A 4UOHA 4PHPA 4JI2J 1NOYA 4I2CA 4OJ5A 3CCVN 1Z1VA 4ZVTB 2IHMA 2YY6A 4H0OA 2Q2RA 4FP9A 4I2BA 3BO3A 4JI1J 5KG3A 1ZA1B 4OHYA 2J0XA 2R2SA 2ATLA 2FJAB 1K73T 1FDBA 1T3NA 3OS0A 5A6WA 1YBUA 2E1CA 4FJIA 4LF9J 2X1FA 3D6MB 2NRXA 2CUYA 4UB6U 2O67A 4LSLB 1OXJA 4KX3A 1LEOA 3JPTA 5FP0A 1WOPA 1K0VA 2AQ4A 2YNIB 1RDDA 1SC1B 5KFQA 1P8GA 3NAEA 3DRPB 1VQKN 2E6LA 2JXJA 1I94F 3AA5X 4BCAA 3BYPA 4DUYJ 3CUNA 1N63A 3LDPA 5J0TA 4A8XA 1S9GB 1U0SA 5J2QB 4FJ9A 3FC4A 8ICVA 3G25A 4BR9A 4DV1F 1ZD3A 2IC3A 4C1NK 3MMCB 3M2RB 3M8SA 4OKEA 1CULB 1FWLA 3H59A 3JSMA 1ZZNA 4RBUA 1YBTA 9ICKA 3VZHA 2EBGA 5HP4A 1X5OA 2JVRA 4FZLA 3MR7A 1EB0A 5LMNF 3R3LA 3W8GA 1S76D 2VA3A 3EDQB 4IQXA 2YNGB 1CLQA 4CGJA 2ZVSA 2ZIWA 2AEMA 2FJDB 2I8EA 3TP2A 4DUZJ 3R6MA 4WU3A 4FWNA 4CLSA 1BY9A 1VQLS 1NLVA 3T1HF 1ZBHA 4UOFA 1TL3A 3FJ2A 4TLQA 2U1AA 3AQFA 3G87A 5I3QA 1UQVA 3TWZA 2HHTA 2P9LA 3ONNA 4NLGA 4ISGA 2VANA 1VFJA 4OHZA 5J0RA 5AXNA 2NRHA 2U2FA 2VCPA 4OPJA 1DTTB 4DDFA 4LQ9A 4X4PA 1NPRA 3OVNA 3BGLA 3L9ZA 3AA3A 2O6KA 1W25A 3OXLA 2WB4A 4DHVA 2CPFA 2ZGYA 4U7UD 2VIXA 4IOCL 2FGCA 3SJHA 4IO1A 3P8BB 3H08A 4TUQA 4JKCA 2G06A 2QYCA 3LWMA 2VV5A 4BS2A 1C1CB 3C6UB 3QICA 5EWFA 3PHTA 3T1YJ 1JLAA 3DLKA 1NCLA 1U1LA 3KFUF 1VDHA 1TU0B 5F3TA 4F04B 2YHXA 2OEMA 2BW2A 2ESEA 2C2MB 5IV3A 1W7AA 2IOHA 1PYOB 1GMUA 2E5HA 3MXMA 3RTVA 2CDQA 4O0NA 4DEZA 4KGMA 1NMDA 3HKZD 2KOBA 3ILJA 1HHSA 2DCLA 5F9LA 5ALKA 4CZIA 4MF8A 2ZUDA 3ETMA 3I0SB 4GVEA 1RT5B 4I29A 2F9TA 4I6MA 3QEPA 1GXLA 2AV5A 3U9DA 1S1UB 4Y0FA 1UEKA 2MKKA 1HI1A 2YHWA 4X2BA 1Y10A 5A8WB 3QNNA 4IFEA 3CJ9A 2LPEA 2FHOB 5JMVA 3U1LA 1PBAA 2E5GA 3ZZ0A 2ZTDA 4OHWA 2XLJA 3PNIA 4USAA 5DDRC 1B3TA 2QL9B 3B9JA 2YX6A 4ID5A 4DQ8A 4CJ5A 5J2GA 2ZH9A 1CJTA 4PQUA 2F4VJ 1COOA 2C2DA 2G07A 2K1RA 8ICKA 2O8DA 3JS9A 4KHRA 3KLGA 3FBBA 2DVIA 1TKXA 1RYSA 1V9PA 1JCGA 2A3VA 3V7JA 3BKFA 4TLRA 2EC0A 3MXHP 1HKAA 5AM4A 3RR8A 3PHEA 4MQ3A 3H8SA 4FYYB 3KG4A 3WK4A 1FWKA 5LMUK 1SPBP 1ZPWX 1N5VA 3PCOB 3OBYA 2X6SA 1OKJA 1T8EA 4NCAA 4BQLA 3CJRA 3PXGa 2QV6A 2DR9A 1LWEB 3ZTRA 2WAQC 1HNIB 4Y2CA 4RR5A 1GLFO 3MPYA 2LDYA 1CJKA 4NWBA 3W64A 4C3LA 2CQ4A 4ZP7A 3R6GB 1JIHA 5GAHI 1M1GA 3NNHA 3EUNA 1HNWJ 4ICLB 1IBLK 1DURA 3M8YA 4NLRA 4UOCA 5FLXY 5IIMA 3MCNA 5CZ2A 1NU4A 3QU2A 1R8PA 3DWLA 2KU7A 3J81Y 2GCFA 3VTHA 1SZ2A 2MSTA 3MM9A 4X65F 3LVWA 2IM0A 1HPZB 2VPXB 4F5OA 2XYPB 5ETMA 1B7FA 5HMWA 1N5YB 5AJ3F 3KVGA 3A5NC 2DTUA 3NGRA 4M42A 2ZTCA 1PO6A 3UKUA 2F8TA 1SL0A 4J90A 1U2VB 4A8FA 1NDKA 2RKIA 2D5RA 3S3NA 5CE3A 1QAJA 1NNEA 3NVVA 2MZTA 2FVRA 4HTJA 2FC9A 1CSJA 1U2RA 1JALA 1W0HA 2BZFA 4NL9C 3BZQA 5BXIA 3EKSA 2KP7A 2JDJA 4NXNK 1TUWA 4EBEA 3BN7A 1B22A 2OD4A 2ZJQL 2KIVA 2R7WA 2YMLA 1Y3JA 3AVJA 1S1TA 3NE6A 3KMSA 4CFDA 2OTLN 2GVZA 2W01A 4GVBA 3LDLA 4W5QA 2ZH4A 3D7EO 4JAXA 4MMOA 4DOCA 5FRMA 3VEZA 2FIUA 4FNHA 5KQDA 5DLGA 3EWGA 1RT3B 2F9DA 3MM7B 3MCPA 1NM2A 1Z6RA 3MEDB 3MUVP 1BI4B 4B1WB 2EC2A 3LZJA 4F8RA 5BN9A 4X84A 4D3HA 2BX6A 4B3RK 1TYQA 2VKZG 3NF8A 4AHTA 2FQQB 4KLUA 1BCMA 4CJEA 5AI4A 3GP9A 1HNXJ 4M6WB 1AXQA 4QZ9A 3UMCA 2W3SA 3CCUS 1J2VA 4NCGB 4OYZA 1VSLA 1X4HA 4XH5A 3H2VE 4BBYA 1GT8A 2DHSA 4IO8A 5HVGA 4TY9A 1NMEB 4TUSA 3L0QA 4DV7K 4B6JA 5KFSA 8ICMA 5KG0A 3I9V9 2X78A 4GVMA 2PFQA 2BKNA 3LZIA 1WG8A 3W5YA 4LFBK 5J2KA 3KUEA 3F2DA 4GXIA 1QZ5A 3SMSA 2BJEA 1HQEA 1PYTA 3CYMA 2HQGA 5DGAA 1MMNA 4KLJA 4DSKA 1TMJA 3UD5A 5AI9A 2R2UA 3HZEA 3F5TA 1XEZA 5F8JA 5KFKA 3JXOA 4N7TA 4WCEQ 2A5XA 4DR4J 2IA6A 2GTDA 4EEYA 1VJQA 2JOQA 3RWUA 4A8QA 1AYEA 3G96A 1GH8A 1REGX 4NO7A 2W2OP 5KFZA 1TKZB 2ZXHA 3PFOA 2IJNA 2ZHOA 2ERRA 4CEOA 3KHLA 4C0HA 4ID8A 3U27A 3S7RA 2HW3A 1BD6A 3F2CA 4UUXA 2KB2A 1KBRA 4YHHK 3LGNA 1XJWB 4C1NI 3IN5A 2IYIA 3PO5A 1FXRA 4MYTA 5ETVA 1LOUA 4DL4A 3R5BA 1O5JA 3ETOA 4M45A 5JU5A 1H7WA 2YKPA 3M2VA 4DG1A 1TL5A 2FPHX 1ASVA 5C2DA 2E66A 9ICFA 1U8SA 2DEIA 4X66J 4DO9A 3C23A 5AXKA 3ZETB 3UDVA 4EHUA 4PH5A 5K8NA 3NCQA 3QRQA 5I42A 5C10A 3FZLA 1I1GA 2RB7A 1WSJA 1NZAA 2MRLA 2YQ0A 4DR6J 1JRPA 5IT0A 2F76X 4LSNA 5T7LA 5HOOA 3JYTA 5HVHA 5ADZA 3KHYA 2JJ4D 2HBYB 4M3UA 2ILYA 1UVMA 4ZPTR 4RPYA 2N4DA 1LW0B 2O8CB 2DFFA 4PXEA 1GLJO 1RT4A 1ZQLA 4X64K 9ICWA 1L3KA 1RG6A 4OZ5A 2MGZB 3S3OA 9ICXA 3PMNA 3HHLA 1A6LA 4B3SK 1PBUA 2LEBA 2P9NA 4GV9A 2FB0A 4J7CA 2EZYA 1VCTA 1G7CB 4IUFA 4FNIA 2WF5A 3RW7A 8ICJA 5MAOA 3S01A 3MEEB 1KD1O 5J0WA 2VHGA 2VQEJ 1KQSM 1RI7A 1BQMA 3NS6A 1L3SA 3PKYA 3VQTA 3VF2A 5AKKA 1UAWA 1Z26A 2HBMA 5C7PA 1SXLA 3R9LA 1UAXA 1RKJA 4B9LA 3X3UA 2NXJA 4AXJA 4DZ6A 4FWLA 1KOHA 4M3ZA 3DLEA 2A1JB 2MJUA 4IRCA 2KT2A 1EWRA 1ZRNA 5EE0A 3R3TA 4NLUA 3ZDCA 1S9EA 3CCZA 2E1FA 4CDGA 4BC9A 2CADA 3NLCA 4X4TA 4J9OA 2XNQA 3GILA 4FLXA 2C28A 2RS8A 3JXUA 2JVOA 1SCJB 1CJVB 1U1NA 1A7GE 2K8BB 3Q8VA 3RSEA 8ICXA 2G09A 2IS3A 3H0PA 1S5ZA 1HBOB 2Y8WA 3FZKA 2XQCA 2UV8A 1BIUA 1ZYQA 3SQIA 4I27A 3K7RA 1P7DA 4C4TA 1VJWA 2WVCA 3OFGA 1VQON 3E0FA 2E1YA 2E8NA 3V72A 5T14A 3L95X 3OXFA 2W9MA 1WCLA 1HI8A 2DNYA 4JI6J 4KRFA 3ZZYA 4JOUA 2OPRB 4LSLA 1YTUA 1UWBB 2O4GA 4HEA9 1YJUA 3G4SS 4LF4K 5D8HB 1ZQAA 3SCXA 2KYZA 4USTA 3QEAZ 3CO0P 3CPEA 1L7PA 5CWRA 5GMEA 2YNIA 4KV8B 3FBCA 1V85A 7ICUA 3UE5A 2ZWPA 1T0TV 2DQNB 3JQKA 3DRPA 2RLTA 2ZH8A 3DLRA 4KAIA 3WIVA 5CYQB 4W98A 1RISA 3SDEB 4Q0BB 4IH6A 3IM9A 1S9GA 2IM1A 3FLCO 5J2QA 5KT7A 1X4CA 1PAUB 4US9A 2EZXA 1WSIA 1M0SA 4CERA 4FLWA 3S6JA 3MMCA 3M2RA 1D9FA 1CULA 3FAHA 1RWMB 2QWOA 2QA4N 2NRZA 1E6VB 1NI3A 2P9IB 1M1HA 1H7XA 1U6BA 4RKUC 2FC0A 3NASA 3J81U 3BBFA 4DX8H 5FPEA 2B4PA 3X1LB 2QXLA 2Z8QA 3C2PA 2HVIA 4L3KA 3MWPA 2CRLA 5B7WA 3QFHA 4E98A 5F9NA 2W7OA 3I28A 1I51B 4B9VA 1C0UB 4OPKA 4FLUA 3EGWB 4FCYA 2W7AA 2HVEA 4M0AA 3RMBA 2HBJA 2YWWA 1N5WA 1SAZA 4MKAA 4TU9A 2WW4A 2XYGB 5AI6A 4FKYA 3SSSA 2BTFA 2XMWA 3L2WA 2OTJS 2GHWA 1EKSA 1YZ7A 1CJUA 1Y97A 1SKWA 5DZ7A 3OW2M 3KG0A 4P72A 4BGDA 4ILJA 2GV1A 5BYSA 3QFWA 1UFKA 2V63A 3GV5B 2KO1A 3MI7X 4DKWA 1S22A 1IKYB 1TL1B 2BOPA 1SBRA 5M2UA 3WK6A 4O4GB 3IP4B 3THYB 5KT4A 4K0KJ 1CXQA 3CERA 5GIOA 3VQCA 2FDRA 3M6ZA 2PA8D 3E9OA 1C1CA 4J9VA 3LANA 2P9CA 4I2IA 3AY0A 3HM9A 4K4SA 4H5TA 5HMYA 4Z37A 1TKTA 2WOMA 2R7YA 3BB5A 4YB7A 1N33J 4OYWA 5MLCQ 4ZLNA 4NE9C 1Y0HA 2CPIA 1NKCA 2Q79A 4JI7K 2ZFHA 3CD6N 1R8CA 2R2RA 2ODGA 3ZSXA 2ZBQA 3I0SA 2HMIB 4N76A 3L6QA 4DTJA 5HHHA 1RT5A 3MEGB 1SV0A 2XWYA 1Q8BA 4PPDA 3SXLA 2EAPA 3PY8A 1S1UA 5ALJA 1RAHB 4H0PA 3LPUA 5CR4A 2GZOA 2CJAA 3VGUA 2L9WA 2BHNA 3Q2TC 3W66A 5AQZA 4FPAA 1CC7A 3KJNB 2KG0A 4ZLLA 4CF8A 1UPMB 4FWRA 1OQ6A 4YOXA 3OTQA 2MY7A 4UW9A 2EWSA 3ASMA 2KDOA 5ALWA 4JI8J 4WFYA 2YWEA 4YMMA 4LF8F 3CJ7A 3C2LA 2EG1A 3TAMB 2YWHA 3HULA 2WTUA 5KFWA 4A2BA 1FEHA 5L8RC 4H0TB 4RLEA 4C11B 4CFAA 4B3RF 2EKYA 2OFHX 3NDKA 2KK0A 2HLTA 3TAGA 3CMAN 3K5NA 2W6KA 1L6NA 2HHHK 3DOLB 1FJCA 5AXLA 2CN1A 3ZTQA 4AL7A 1F44A 4UB2A 1Z3EB 4JUZA 2I7NA 4BUGA 1BA1A 2FI1A 4UATA 1RXVA 2QKKA 1U2FA 4GVLA 5AKZA 3W61A 2ALZA 5L1MA 1PJ5A 3E01B 3ZX2A 1V4SA 1HYZA 2MSSA 1LWEA 2XSFA 4LFBF 3VV2B 2JRZA 7ICQA 3G8QA 2XMVA 5GAEI 4CGGA 4JI5J 1BG3A 2Y3YA 1O03A 3BN4A 1NSPA 3BEXA 1CUKA 4DFKA 2JZBB 4RT3A 1B92A 2GUIA 1QM9A 2PO4A 3AM9A 4DTXA 3KZIU 2YKNB 5HO4A 4PHAA 2ZKUA 4K4ZA 1FRIA 3HT3A 4YOTA 5DBAA 2FPMA 4RPFA 2H5JB 4KTZA 4ELUA 2K89A 2E44A 4A46A 5L9NA 1CRXA 3FRYA 2RHQB 3L4BC 1N5YA 1WCNA 5L39A 4CTAB 2VU5A 2QN6B 1U2VA 4XEIA 4C3KA 2KVIA 2IAJB 1YRUA 2R7OA 4Y3CA 4X62K 4BC5A 4QIFA 6AT1B 4OL8A 2HHSA 2OPQB 4CFCA 1N60A 5DG8A 1H0HB 1EETB 2V7ZA 2VYPA 2IDEA 1HR0F 3AO4A 3LL3A 2WVFA 1EARA 4USHA 1JJ2M 5IZHA 1R59O 4KY3A 4I56A 1FFVA 1DFDA 3AEVA 4Y2MA 3CMEN 2DXDA 4MEXA 4OYXA 3DM2B 3CF5L 2H3IA 1MWZA 4OV6A 2HQIA 4JYAJ 4W5NA 5ALHA 2AWZA 2MMYA 4P10A 5KFPA 3PSIA 4M9JA 3QT6A 2LEAA 2HBKA 2PI4A 4O4RA 2CJBA 3CCMN 4JV5J 1RT3A 1NXIA 3MM7A 1S3XA 5D46A 3ZZPA 3IHQB 1R43A 7ICRA 4URSA 1CLFA 3NRWA 4K8RA 3M5RA 2BRLA 4XRHA 3QPIA 2DO0A 3WK8A 1LWXA 1B4FA 4M6WA 4OJRA 4E1JA 5ETNA 1FFSB 4B3SF 3QEVA 4NCGA 3O4NA 2OI2A 5IOLA 3ILIA 3GSIA 5JRTA 5AKLA 5KG7A 4DR3J 2G0JA 5CH7B 1ZQQA 2EFNA 2EVZA 4ZMMA 2Z1GA 2IJRA 2VFTA 1NK7A 2WSCC 3V9UA 5IQQA 3QYPA 1RYRA 5E2QA 3HX9A 2OYQA 2CJXB 5D78A 3GL1A 1OWXA 1J5EK 5J2NB 3SMPA 1OUQA 5J2FA 4KFBA 4EP5A 1XQIA 1SKRA 4UUWA 2BR0A 2YX4A 4LH5A 1D5AA 1FJGK 4ED7A 2XS5A 4W5TA 3UDCA 1O13A 4BROA 3OXGA 2E1EA 1VQNN 5EOZA 4F72A 1IWGA 3B82A 3G6YA 2UUCF 5J0XA 5FRNA 2BQ3A 3B6BA 3NS5A 4CIEA 1HA1A 1OW5A 4WFBL 3GU0A 4P7TA 4BRKA 1TKZA 2ZD1B 5LJ3Y 4H5RA 2FBVA 2QE5A 4AHSA 1S57A 4ISEA 4DCPB 4LFCJ 3TADC 1S6PB 1S12A 2UXDJ 1C4CA 3O3FA 2BJ9A 2OELA 1EHWA 3MFIA 3RYLA 1ZRMA 3RUBL 4BRGA 3W9IA 1KLNA 2ZKTA 4FJ7A 3PV8A 1RE1B 3AQOA 3SCJE 4M63C 3K8VA 4LZGA 1KN6A 1EKEA 2XHCA 4B1UB 7ICLA 3EVOA 9ICLA 2DNOA 1VQ6N 3R5CA 3ZETA 5HRSA 4RJVA 2M70A 1BA0A 5F0XA 2HGNA 1E4FT 2P5GA 2VL1A 5ITHA 8ICTA 2FJXA 5KG2A 1OH5A 1IH7A 2CWKA 4QWDA 5IT9O 2HFSA 4AFFA 2QC3A 4WCEL 4HYKA 1WOSA 4YD1A 3M2UB 1ZQDA 5HN0A 2L5YA 4NOHA 3GBTA 3T1AA 1G4CA 2CH5A 3AA4A 2EKNA 4I9QA 1Q8KA 4WFNQ 2LP4A 3TQEA 2Q0RA 1ZTTA 3OY9A 1LW0A 2WVBA 2Y0SD 3JAMU 3AO1A 2F8KA 1FI4A 2KJVA 1WAJA 2GW8A 1GMVA 2D3OR 2MGZA 4MDBA 4AQYJ 4B3OB 1CG2A 4M5KA 8ICUA 3EDRB 1E4GT 4FO0A 2H4YB 1Q9XA 2E2PA 1CBKA 3VALA 1Z25A 1KEJA 1VC0A 3DRXA 2PFFB 1WUDA 4ZP8A 3OHRA 5H9EJ 1Q46A 2ADBA 4FYWB 4ZS6A 5CD4A 4ZPBA 3BYRA 4RNOA 4PGXA 3HI0A 3V1OA 4LVSA 5BOMA 4N77A 4U95A 5AQHA 4I6WA 3LYSA 4OFZA 1D4XA 3IO1A 3AJ1A 1RT7B 3W62A 2QARB 4K4UA 2A1JA 2XULA 2RJZA 2F8HA 4DCJB 1IJFB 2A42A 1KEKA 3C6HA 2QMWA 4CP5A 3HK2A 5E3PA 3GG1A 1J27A 3I87A 1IBKF 4DZDA 4C4RA 3RJIA 4WQ5A 1VBKA 3K5PA 4KE5A 2DGVA 3CFPA 3T7ZA 4A2AA 3HHNB 4BACA 3RB0A 5IC4B 1CJVA 1VQPS 5KT5A 1HUZA 3QFPA 4DMZA 1YUWA 4LF5K 1SB6A 4HL9A 4H4KA 3C21A 1PVQA 4B3TF 3C15B 3OYCA 3LPYA 4BRMA 3TVYA 1AFIA 3UNYA 2DHXA 2HLUA 1FNMA 4ZPWR 3QUTA 4ZN3A 4G1IA 1QUVA 1OH6A 4CJVA 1U9LA 2WZ1A 4AH9A 3H4BA 1ZJMA 3AD7C 3PG9A 2VASA 2GV9A 5J8YA 4ECQA 1NK9A 5DM7L 1RHMB 1SIJA 4OKKA 2NZTA 3MAHA 2BA9A 3TYTA 1T94A 4M04A 2KXFA 2ZOMA 1WNEA 4JI7F 3LOUA 2MDAA 1YJVA 3WXLA 1K8KB 1T11A 4ZPVR 4A8SA 4IQUA 4KKOB 3P96A 4KV8A 8ICCA 5GAHP 2O8EB 1DT9A 2P9SA 1AZSB 2YHAA 5DGBA 4OX7A 5CYQA 2P9GA 5JVGL 3SDEA 4Q0BA 2DNPA 1EO1A 3OBIA 2KN7A 3LW5C 3M9OB 1U25A 3NKYA 4QYZJ 3WZ0A 4KH6A 1G6BA 2R42A 4LFAJ 1PILA 1L3TA 1UEUA 4LMZA 5EU7A 3SEIA 2K4HA 2AJFE 2NYHA 2D0AA 4O3MA 3OYJA 3R7BB 1E6VA 2P9IA 3ILLA 4PKHA 3MUTP 2KKHA 8ICIA 3BJYA 1UA0A 1MDUB 2HNDB 1U48A 2RILA 1HW9A 3O6WA 4Z6FA 1XUPO 1WEYA 2HHHF 4MKYA 4E7LA 4MFCA 2DGSA 3G71N 3G6XA 2LQ8A 3NGZA 1BIZA 1N88A 2V9KA 4B9TA 1C0UA 4RWTA 1RDBA 3PW5A 1H73A 2CJQA 4J2DA 2Y1JA 3LM9A 3C7NA 2OO4A 2PDAA 4DPXA 3ZO7A 4BRQA 1J6ZA 1T95A 1IKWA 1RTHA 4XO0A 3FMBA 1GTHA 4WFXA 3BBCA 3CCLS 3NFAA 2B9WA 4DV0F 1RWKB 3CO9A 3FCVA 1EIYB 2BKEA 2FUG9 3MMVA 5IIJA 5HLFB 3RMDA 4ZJOA 3ISCA 3RJMB 1WSFA 4KLOA 3KKSA 4ZA1A 5ALPA 3GR1A 3VGVA 1HD0A 1NGIA 1TL1A 3OYEA 1DLOB 4JBCA 4R64A 2DRDA 1XNRF 1NM1A 5DQIA 1XC9A 1KDHA 3AVBA 2DGWA 2CPRA 2OM6A 3VAJA 3FGVA 1JL2A 4ED0A 2R7VA 3AD9C 3AVIA 3DXMB 8ICLA 4IG0B 4PKGA 5A2QY 1JCFA 1S5LU 4DR1F 2HOFA 2R7XA 3I56S 3W60A 4B3MK 4AP9A 1JNRB 4OZLA 2YQ3A 2VWBA 4JV1A 4RU2A 3DCAA 2ZIXB 3BM7A 3ITHB 1MWQA 1RBAA 2WF8A 3K2YA 2PYJA 2LA4A 3K5MA 3EZ5A 3HVAA 5AK3A 2HMIA 4DPTA 1EWQA 4WBFA 1I94J 3H8JA 2B51A 2HRTA 2HBQB 4WIQA 1SJQA 4LZDA 3CXCM 2UXBK 2BM1A 3A13A 2UXCF 3I76A 4KLFA 1RT6B 4DV1J 4UB5A 3SAHA 2GOLA 2Z58B 3QEIA 3B0YA 3FM9A 1DOQA 1B0VA 2DXEA 5EX5A 2O3DA 1AW0A 2YH0A 1UJ4A 3FZMA 2DPNA 1S6QB 4Z4EA 5LMNJ 3EZWA 2ZJPQ 1RK8A 3MD1A 3TAMA 4ZLJA 3OS2A 2XI2A 2CJ9A 2KRBA 2VB6A 3ICXA 4HHUA 2AKWB 4C11A 2JEIA 3I8DA 3NMUA 3KWGA 4K4IA 4ZVRB 4C0BA 5L1LA 3GIRA 4QOZB 4C4SA 1O0PA 3UD4P 3RAMA 5HR6A 5EN1A 4BC2A 4BREA 3WHIA 3T1HJ 1TTHB 3DOLA 1SGGA 4Y2KA 3BDEA 4O3NA 3AB4B 4CI0B 1R3NA 2C3YA 3M6UA 3N7RC 4NLDA 4PL2A 2GIQA 3DLGA 4J2BA 2JC1A 3ZSZA 4JRPA 4RUAA 4CF1A 2KVCA 3RJHA 3HF5A 4ECXA 5KOXA 3E01A 1FTCA 3C2MA 4OYAA 2GX8A 1FX2A 1FRKA 1HLUA 2X1GA 4BGAA 2VIHA 2E9TA 4K4VA 1J5EF 2KM8C 9ICHA 2CQ2A 4JWNA 5EUHA 4DPWA 3AN1A 2JZBA 2LM1A 1PAEX 1ZPVA 5TKYA 2YKNA 3HSDA 2CNLB 4X5VA 1FJGF 1LOTB 4BC3A 3OD2A 4ZVUB 4L74A 4YP3A 3QESA 5I4MA 1QHTA 3OGUA 3M1VB 3AO3A 2F1FA 4CTAA 2ASYA 4QWEA 3IMQJ 3THXB 3UKRB 4I4BA 4RT2A 2MHEA 4WFAQ 3N4MB 2V8HA 2CQGA 2YX1A 4IOAL 3FC9A 4I1TA 1TL7B 2DL0A 3KWIA 4FPIA 2JWKA 5DG7A 3LTOA 3NNCA 4R8UB 2M4MA 4RQMA 1S72S 4CJPA 2WHEA 3L2UA 4J9SA 4FM2A 2AYMA 5G0RA 2OPQA 3OYBA 2KKZA 5FDLB 1CZBA 2IIRA 1QTMA 1S6OA 3HOTA 5M1KA 1EETA 3AA9A 2XMUA 4PKDB 3CQ8A 3LP3A 4DMNA 1JLBB 3CSKA 3ENQA 1Q0NA 5AQQA 4ILRA 2BUPA 4PEOA 2OHFA 3PYGA 4JI4F 4E1NA 1FRHA 3G2XA 4F0MA 1M5PC 2E2QA 2IM2A 2F2AB 3BO4A 2PMZF 4MJKA 3DM2A 4FXWA 4YDUA 3NOGA 3JPNA 3OA9A 1M5OC 3ULHA 3UCGA 3ALRA 1P1LA 3ZC4A 1QAIA 4KLHA 4TQSA 2XZWA 3VEOA 1XNSA 3A3NB 3MN5A 3J8AA 2A41A 1IKXB 2HFOA 3HKWA 2MQNA 3PVXA 4ETZA 2UVVA 3E9PA 4YORA 5GIPA 1JK9B 2I0XA 4TNOA 3CCSS 5DM6Q 4DTOA 3SD7A 4FYDA 4A47A 3VGLA 2P9EA 5F8IA 1RDWX 2YNFA 4YEAA 2BJ8A 1LB2B 1IO2A 2BE2B 1VC5A 3M4XA 4FW1A 4C8OA 2P9PB 1NGEA 1CQNA 3TUPA 2P5OA 3J7ZT 2HZAA 2YN4A 2ZBPA 1UZDA 5KFAA 2B8QA 2WK4A 2B5JB 2X74A 5ADXA 3FNNA 3L4QA 1JJCB 2HVZA 3B4MA 4CLFA 4U67L 1B7YB 3HPGA 5CD4H 2YKQA 2C2NA 4DTPA 2VA2A 2LMIA 3W5XA 5E33A 1BL3A 3BH7B 5J2NA 1T3QA 3NCIA 4AYBD 4X65J 2YHBA 5E7OB 4OV1A 2G8WA 2HF4A 1RWUA 1L3UA 3QERA 5J2AA 5AQKA 2JX2A 1T05A 2OEKA 1BCOA 1VRTA 2E6MA 4IO9Q 1ZS6A 2DNNA 5AJ3J 4AT1B 5LJVA 4UB8U 4FWPA 2AJQA 4HWIA 4ISFA 3VAKA 4DWIA 3AA8A 4WTYA 3F5EA 3V9ZA 4O9MA 3JS6A 2XNRA 1FERA 1R6YA 9ICNA 2G4BA 4EYHB 1QQOA 4CK3A 3G10A 3FSIA 4B9MA 1S6PA 1ZA2B 2FPLA 9ICPA 3KNAA 2N3OA 3HSCA 3PW0A 4L8RB 5EX3A 4LBHA 3HOSA 2LA6A 3FEXB 5LSRA 5T41A 4Z2XA 2KHOA 2DXFA 3SCLE 1Y88A 3RJEA 3NMRA 1PKUA 3PTWA 3MK6A 1SIWB 9ICTA 2NXUA 4RPXA 4Z4FA 1GXTA 1WTFA 2D3DA 1X0PA 3TA1A 1NKEA 3Q8KA 2DUYA 3FFIB 3UQ0A 1HNVB 1HWLA 3UFCX 2IOCA 2HS4A 9ICEA 5E0OA 4GNIA 1QY7A 2CAJA 2AX1A 5IM0B 4BDZA 1KQFB 4CLPA 3TTDA 3HHLC 1GLEG 2ZH6A 1YI2N 3M2UA 5IIIA 1TUGB 2YTUA 5BYRA 3C5FA 4XQ8A 1VR6A 4NZ0A 1XHZA 2EG2A 3QQCD 1TGOA 2WCXA 3QGHA 4CE6A 2F77X 1WDDA 3ENBA 3AVHA 4USUA 2HI0A 1SXEA 2YX8A 3Q8LA 5ALGA 3HHKA 4ETXA 2V67A 1KTQA 2OGUA 3FQLA 3J7A1 2K8GA 3CJQA 1X9WA 2RF2B 3C1ZA 4KX5A 3K1ZA 3JPOA 5B0GA 9ICCA 5GADI 5HRRA 2FSKA 3SZ2A 2DGZA 4P2FA 2AYGA 2AF6A 3UIQA 4WXWA 2KHCA 1BHNA 3D1OA 1Q8IA 2BVZA 4DTMA 4JWMA 3TSPA 4GKJF 3WC2A 3CRXA 3MM6A 4EYIB 3KJQB 2W9BA 5A2QU 4NL5A 3T6JA 5AE3A 1X4GA 4H5VA 4USIA 4AM6A 2QARA 3ALYA 4PL7A 3O80A 4PGQA 5G4DA 8ICQA 1VQSA 4MKBA 2A6OA 1JKHB 2AP1A 2KZ3A 3R9KA 2P2CB 4DV5K 4WFNL 2MUTB 3DRRB 4RUHA 2VJ5A 1Y5IB 2ACYA 2YHYA 4DV4K 5E3QA 1JJ4A 1NJZA 2G08A 3O1WA 4XH4A 1SL2A 1G3OA 2PMWA 2PYLA 5HQMA 1S5JA 1VI7A 3P31A 1SH2A 2CNNB 4KHQA 1S8OA 2MZ1A 1BPBA 3C15A 3DHWC 1HKCA 3L2RA 5KTQA 3SENA 3G6VA 1ACMB 1SQGA 1DBDA 2RAQA 5DBBA 5AK4A 2V9WA 4BR0A 3U9ZA 4NM1A 3PDNA 4CEAA 3CJCA 1XNQF 1RTZA 4RUCA 1N4LA 2K7KA 3MGHA 4FJ5A 4B3MF 3VWSA 3KG1A 5DLFA 3TVKA 4A61A 3QX7A 2AMCB 1BO5O 3C94A 3CCRS 2YVSA 4YOEA 3OSPA 3O08A 2AJ0A 4FPRA 1WG1A 3OFEA 3MAAB 2HZCA 3LAMA 4DL5A 3CCVS 1HQ2A 3RG6A 4H03B 1DRGA 2PZSA 2LKZA 4NA2A 5AQXA 4CNYA 3M8QB 2NZCA 2QIFA 1MN9A 3V81A 4QZ8A 4DUYK 2G2OA 2OJ3A 4NYFA 2O8EA 2IVFB 1RDFA 2ZVIA 2UXBF 4KH1B 4DPUA 1FEEA 1AZSA 4I2QB 4ZCMA 1SWWA 1ZOLA 4Y1CA 2V4JA 2W6LA 2WFAA 2LM4A 5DKWA 3GIJA 3I5CA 4ED8A 3DAWA 4HT5A 1HLWA 1KQQA 4ELVA 1JLGB 4CF2A 1NGAA 3HCXA 1U8WA 2JC0A 4LR7A 4PL8A 4NM2A 3AXKA 3PKMA 1VQKS 4TUPA 5FLXO 1VS3A 2IVNA 2WB1F 4JI3F 2BMBA 3MMBB 4C97A 4H4MB 4DUZK 2HNDA 4Y00A 4ZHRB 1RBRA 1BPXA 2XY7A 4OI3A 2H4WB 2ZE2B 2DGTA 2OHDA 2JWNA 3BQ7A 1NHKL 4HUFA 4XUSA 4QAGA 2RT3A 1YJWN 1X7VA 4NJ8A 2M9KA 2P8IA 5CYJA 2V8PA 3V4MA 2QL5B 2YKMB 2DGXA 2LU1A 5AQTA 2J6TA 2XY8A 4F0HA 1TP7A 1ULRA 3KJFB 2HBLA 2GIRA 2CZ4A 2XHBA 2ZH5A 1JLEB 3WQTA 2Z57B 3VC8A 3ZEUB 4Y28C 3ZSWA 4CE9A 4KH0B 3SJJA 5H9FK 4IJNA 3O4QA 5HJXA 3H98A 3EPGA 1H1VA 3H7IA 5HLFA 4EAHD 3WQPA 2XLIA 4BRLA 5ALLA 3IC1A 3HX0A 3ISDA 3CJAA 3KK7A 1DLOA 2BQUA 1DGKN 3NH2A 1QQNA 2ZOFA 2PSZA 4GMJB 4DS4A 3U02A 2YH1A 1YIJN 4K7QA 2P66A 2NCKL 2YV0X 3BF3A 2DFEA 2L9DA 2ATQA 4CHNA 3GE9A 1SV0C 2JGAA 2MKCA 5KFHA 4IG0A 4DSEA 3D2NA 4HCBA 1NKBA 1X4BA 3ENHA 2G13A 1XHXA 4FK4A 5EWEA 2FJEB 5IIKA 1VK8A 3VQAA 4DB3A 1BUXA 4IDKA 4ER8A 3JQJA 5GAGI 4PCQA 3TX0A 3M8WA 2N7YA 3ITHA 3SEOA 3JSYA 5ALFA 4KMUA 3MC1A 1JUDA 7ICNA 2CQIA 2W2NP 5AZJA 4KLEA 2OZSA 5ALEA 1HI0P 3KOAA 2Q1NA 5HR7A 3NCPA 2YB4A 2N7CA 2KG1A 3ID8A 1X31C 1D8ZA 1RT6A 3AV9A 3C5GA 4CBXA 4DR2F 2DR8A 2F4VK 3P5TL 2CPJA 1DXSA 3MGVA 3NY0A 2VFRA 1S6QA 4G1PA 4EZ6A 1BNPA 1QJHA 3WNHA 4HR2A 1K8AT 3HVWA 5BPMA 4H0VB 4AM7A 1ZAWA 3BY5A 1RADB 3IUCA 3FZBA 1I5OB 4K25A 2VZ9A 2QSWA 1FXXA 1ICEB 4F3TA 1WOOA 3N4QA 3GR0A 3IBPA 3JSMB 1RLDA 8ICYA 1H3DA 5LSOA 4DOAA 2YJEA 3F0NA 3T9NA 3EX7B 3OTBA 7ICTA 3MCAB 5DRKA 4Y2AA 5KFXA 4ZVQB 4JLHA 2AH5A 5F2RA 3M8RA 1NBEB 4KI6A 1K9MO 2E5LF 5J2PB 1IJEB 1SWVA 5F8NA 3J7YP 1HNWK 1EP4B 1UT8A 4JKBA 5ADXH 4M9HA 1NPKA 2W4PA 5KFJA 1FVQA 3TUJC 4ZPAA 2P9LB 2WUSA 3E58A 3JPSA 3MR5A 4UAVA 2V8DA 2KZZA 2O1PA 1J5OB 1HJPA 1GNKA 2W9CB 4RW9B 5K9FA 5JJBA 3HTVA 1RCHA 4ZDNA 5HROB 1DRZA 2VICA 2GVDB 1N34K 3M1VA 2DH9A 1X9SA 2UUBK 3QB0A 3UKRA 3G9CA 4OPHA 5IWAK 2HVDA 2LDIA 1ZXIA 2NREA 1TL7A 2Z2LA 2N4CA 4DQPA 2OKQA 4TVAB 4DL0C 4ELTA 1VQ5S 4R8UA 2M3DA 2AW0A 4CBUA 4KGKA 1WF0A 1IV0A 3B54A 4DL6A 3RJJA 2YMMA 4CJ7A 3DLKB 1WC1A 2RRBA 3FBFA 2J9DA 2JL9A 3QNWB 1C1BB 4US8A 3IXQA 4KLLA 2XO7A 3IG1B 4CECA 2B8PA 4B1VA