4F4KA

Dna polymerase i large fragment complex 6
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 198
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4kA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f4kA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4kA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f4kA01
4DEZA 1KLMA 1TL1A 4UB1A 1D8YA 2J6TA 4GVMA 4E19A 7ICKA 2ATLA 4M2YA 2HHSA 4QW9A 4ELTA 3CM6A 2MUTB 1NK9A 3VQEA 1RT3A 4FJHA 3RTVA 2Z1GA 4GC7A 4DFMA 3AA4A 4NLKA 2BPFA 1IKWA 4I28A 1TVAA 1NOMA 3V9ZA 1UT5A 2P5GA 3AA2A 4DO9A 3KHRA 3CQ8A 3NBPA 4EBCA 1UAXA 2KW4A 1XSNA 4R8UB 9ICNA 4BE0A 3K75D 2P1JA 4RNNA 3E01A 9ICAA 4LD0A 3LDAA 4DFPA 3SPYA 2AU0A 4DTXA 5DK5A 2C2DA 3OYEA 1U49A 2R8GA 1WCLA 4B3OA 4F4XA 5J2CA 1JKHA 2QKKA 4ECXA 3P83D 2BQRA 8ICWA 2BQUA 1GOBA 4DQQA 4G3IA 4EP5A 4CHYA 3L2QA 9ICUA 4ECSA 9ICVA 4DL7A 1JN3A 3PVXA 3ZT2A 4KREA 4Y1DA 3TABA 3ZT4A 4DTJA 4Z6CA 4KB0A 4Z4IA 1K1QA 1G15A 3HJFA 3IM1A 8ICNA 3OYNA 3N4MB 9ICTA 4LVSA 4FCYA 1QE1A 5HMLA 1SZPA 4GXKA 1NJYA 1EP4A 1U9LA 4B8AB 4KLJA 3IRXA 3RJHA 3OS2A 4HCBA 4KLEA 3EY1A 4ZTFA 3ISCA 5HP4A 4E7LA 4CIFA 1MQ3A 3ZCMA 3V81A 5J0YA 3KKSA 3O4QA 2P51A 4DOAA 2BCVA 1BCMA 1S77D 4B9LA 5CJ7A 3RJEA 2BCSA 5KFLA 4QZIA 1N56A 3OJSA 1JLQA 2XY6A 4FW1A 3EPGA 4YMMA 1WLJA 8ICSA 4NM1A 4KI6A 2Q0ZX 5TZVA 5CB1A 2VG6A 4CFAA 1ZQDA 9ICQA 5E41A 2RDIA 1T03A 4FZXC 4RUCA 3THVA 1KSPA 4FBTA 1UWBA 4RQ5A 1Z26A 4KO0A 2OPPA 4IQUA 1QSYA 4M3RA 3BDPA 3AVAA 2V4RA 4KLIA 5IIMA 4NYNA 4QZEA 1JLGA 5J2FA 2BGWA 4CJ4A 3U3GA 4DSEA 2D0AA 3TWHA 5KFMA 1LWCA 1L3VA 4IG0A 3OYCA 3QZ8A 1WAFA 5J2QA 2Q3SA 5IIIA 4DF4A 4QWDA 4FJMA 4O5KA 4CEDA 7ICIA 4CJ5A 3VQQA 4G1QA 3LZIA 1CLQA 1TK0A 4DL2A 4F5RA 4KLTA 1KCFA 4TUQA 3LK9A 1LW0A 3H8SA 4KLLA 2E6MA 2GUIA 5C42A 4PPXA 3QZ7A 5CYQA 4F3TA 2DFHA 5KFBA 2O4GA 5I42A 2W8LA 3AV9A 3P1GA 4HCCA 3JPRA 3SUPA 1T7PA 1LW2A 4W5NA 3C21A 4FJ7A 4FLTA 8ICIA 1LB2B 1A5VA 4M3YA 1WSGA 1ZBFA 1BPEA 4IG3A 4DL4A 1NKEA 4J9KA 3AVMA 2IOCA 5KFGA 1TKDA 1VK0A 3MR2A 2EX3A 4O3RA 3RRHA 3O3GA 3RBEA 1K6YA 4O55A 4FLWA 4J9NA 1XS9D 1EXQA 1ZJMA 1VSEA 9ICFA 4QW8A 1KDHA 1UT8A 2LSNA 4CCHA 4C8MA 2R8KA 3RH4A 5SZTA 3UIQA 8ICOA 3GIMA 5J2EA 3NF8A 3SQ2A 2FBVA 1KEJA 3T5JA 5J0WA 4P4OA 1HQEA 3QETA 3RMAA 2JGUA 3MXIA 4CERA 4EZ6A 2XY5A 2QK9A 1ZQTA 1HYZA 3RR7A 4BE1A 3KKRA 5K14A 2AQ0A 4CJUA 4BDPA 4DTMA 4GXJA 2DTUA 3LWLA 4QZCA 1I39A 4DTNA 4RPXA 3M9NB 5FRMA 1N6QA 4FYDA 2MUTA 3V9WA 2PFOA 1TFRA 2EHGA 5IIJA 3V1OA 5HMMA 4J2AA 3GV7B 1HNVA 4YNQA 4MF8A 2NRXA 4W5OA 3VA3A 2KZ3A 1S5JA 8ICQA 3RMCA 5CHGA 3K57A 1WSEA 3C2KA 4H4OA 4EP4A 4DFKA 1VSLA 3C2MA 5J2AA 1ITGA 4ED0A 4IBNA 8ICFA 3RB0A 4TSXA 1QHTA 4RG8A 4Q8FA 4OKJA 4Q43A 1JX4A 3OYDA 1V9PA 4PGXA 4BWJA 3C5GA 5DGBA 4YR3A 2W9CA 4O9MA 4O5CA 4IRCA 3NF9A 4RT3A 1N5YA 3GFKB 5KGWA 4W5QA 4M6WB 3QERA 4FJNA 5HRNA 5KFDA 2Y1JA 4F2SA 2R7YA 2ASLA 4IFVA 3HM9A 1IKVA 4CEAA 1TAUA 2HNDA 3G6XA 3MGIA 1YVUA 3ZSOA 5HRPA 1WSHA 1F21A 3SPZA 1S10A 1WSJA 4NY8A 2ZUDA 4ID5A 3NH1A 3KJVA 1T8EA 3S3OA 3GV5B 4YXMA 1C0MA 4M9LA 1QTMA 3K59A 3ZSXA 4P4PA 2VA3A 1RBVA 1RTIA 4N5SA 3N97B 1KFSA 1SKRA 4NM2A 2HNYA 2HNZA 1D5AA 3DLBA 4RUAA 4RNOA 4MEXA 1Q8IA 4E7HA 4KHSA 2IMWP 3MEDA 3K5OA 3KLIA 3T1AA 3PNCA 3CFPA 1XC9A 3AU2A 4YD1A 1S1VA 3V72A 4UB4A 4CHQA 2W9AA 3BGRA 3MECA 4ED2A 7ICFA 2ASDA 3Q8KA 3C95A 4M3WA 1Y88A 2A1JA 4R8UA 2HHWA 4N56A 2FMPA 3MEGA 4GMJB 4Q0BA 2PI5A 4I7FA 4UBBA 3OYKA 2IGIA 5KG4A 3V1RA 5EWFA 5J0RA 4J2BA 4DG1A 9ICMA 4RQ0A 8ICUA 4I2QA 5KFYA 4FK4A 4I2FA 4DQIA 1C0TA 4J9PA 1ASWA 2FBTA 2F1IA 1B9FA 3ZDCA 4ICLA 4CGDA 1JIHA 4PGYA 1TGOA 4Z6FA 3TAMA 3QEPA 2KZZA 4M9NA 3PR4A 5JS2A 1HYSA 2GV9A 3VQDA 5EWEA 1ZQYA 8ICTA 2BCUA 2FPLA 3WNGA 1ZQQA 3DRPA 4TQSA 2BGGA 1Q9XA 4I27A 3S3MA 1ASUA 1CZ9A 2BQ3A 4UQGA 2ITGA 1S1XA 5J29A 3OYHA 4PWDA 2PYJA 4DTPA 3SQ0A 1ZQAA 3NGZA 5IINA 4LZDA 2LYHA 2VWKA 2D0BA 1RILA 1HJRA 1L3UA 3T5KA 4NCAA 4K8ZA 2PY5A 5CYMA 5J2BA 4YVZA 2VA2A 2HHVA 4MFCA 2FBXA 4J9OA 2GWSA 4O44A 2YNHA 4FJIA 5KFSA 3DMJA 3BQ2A 2YNGA 1XSLA 3L2UA 3RWUA 8ICJA 4FJ5A 4F91B 4OVLA 1ZQZA 4M45A 4CJLA 4EZ9A 4ED3A 4ECTA 4F92B 3DM2A 2IHNA 3NE6A 2F1JA 4RQ8A 8ICPA 3VQAA 1ZQUA 4KTWA 4O5BA 4CHOA 4B9UA 4RQ2A 3M8PA 4C8LA 4DU4A 5DKWA 4DSIA 4RW6A 3PW0A 1ZQKA 1IG9A 1XO1A 3V6HA 9ICBA 2VWJA 2M9NA 4DF8A 3JPOA 3AVCA 8ICMA 2X74A 1D9FA 4KV8A 3DYAA 2ZJ8A 3NF6A 2HHTA 3OGUA 3HYFA 1ZQHA 2OPSA 3NGYA 3RB4A 8ICZA 1T05A 5KFTA 3RH5A 4FLYA 3AO3A 5KFKA 3PX6A 3GILA 3LAMA 3ZSZA 3QEWA 4N76A 4M9HA 4QZDA 1ZQNA 7ICLA 2ZTCA 2F8TA 5DB7A 3QEXA 4PH5A 3PUFA 1MQ2A 3UQ2A 5KFZA 3SUQA 4E7IA 4GLXA 2XHBA 1S0VA 1BL3A 1QSLA 3AVFA 3T3FA 5C25A 5DLFA 4B9NA 4MQ3A 3RJIA 1GOAA 1S0MA 5KG5A 3MFHA 2PYLA 4KB1A 3Q8MA 1EX4A 4QWBA 3VQ9A 1JLBA 1BISA 5KGXA 2HB5A 5DG7A 4DU3A 1RTJA 3H8JA 4I2IA 2XCPA 8ICCA 8ICYA 1NJXA 3HW8A 1ZQMA 3VQ4A 4K4GA 3E2EA 2XRIA 5KFCA 3CG7A 1ZBIA 2YHAA 5J2GA 4RQ7A 4CIEA 4B9TA 1FXXA 2VANA 2UVRA 2DFLA 3PW5A 1BCOA 3OY9A 2I1QA 5CA7A 1RCHA 4Z4GA 5L1JA 3M8SA 3G0ZA 4LH4A 3EZ5A 5KFJA 4DL6A 4DQSA 1VSIA 5J0XA 5DG9A 4FK2A 1BI4A 3K5LA 4ECUA 2PI4A 4K8XA 3ZDAA 9ICCA 1Z3EB 2A1JB 3WNEA 3RMDA 4KI4A 3PV8A 2ETJA 3VQPA 4M42A 4CGJA 3HVRA 5DB9A 3DOKA 2PFPA 1DTTA 1S1UA 2VG7A 4WE1A 1NOZA 4CFCA 4F4WA 3SV4A 3D45A 1WSFA 4M04A 1QLNA 3V4IA 1S97A 1WAJA 2JEGA 2IS3A 5JUMA 3MR5A 2YNFA 2B4JA 5KFAA 4E1NA 4FZYA 1JLCA 4P4MA 3UPQA 4CECA 3V6KA 2YNIA 4UB2A 3M9MB 3MR6A 4HVJA 1O1WA 1RT7A 8ICBA 3TFRA 1KRPA 4I2AA 1BI4B 4Z4CA 4R63A 3AVJA 4JV1A 3JSMA 2BHNA 4YD2A 3KD5E 1HUOA 2BDPA 1A5XA 5KFNA 2BR0A 3LALA 5CZ2A 4PGQA 2UVVA 3AVKA 4PA1A 5J1EA 3KHGA 1SL2A 4DWIA 4PUOA 4IQWA 2R8JA 8ICHA 3V6DA 5CR0A 3AVNA 4E7KA 2NRTA 4B9SA 4O3PA 1VSJA 5DQGA 3Q8RB 1HPZA 4O5EA 4BXOA 2P6RA 4KTZA 1J5OA 4F4KA 4DTSA 4DOCA 5IILA 4H4MA 5KTQA 3QEIA 3SI8A 2BKEA 3JPSA 5J2PA 3LPTA 4O4GA 2X6NA 4J9LA 1D8LA 2Y1IA 2AQ4A 4CGIA 2RPIA 4CK3A 3M9OB 3TARA 1S9GA 1ZETA 1U4BA 3PW7A 4FJ9A 3C1ZA 3LZJA 3MGHA 2PFNA 3MDAA 3MAQA 3UXNA 1TK8A 3K5NA 4Q45A 3MDCA 4CGFA 1BIZA 1SL1A 3B6OA 2W8KA 1VSKA 4KHWA 4QCLA 4LSNA 3HP6A 1LAVA 1C7YA 5KRSA 4ED1A 1GOCA 1QS4A 1TKZA 3C23A 3V9UA 3RRGA 5BOMA 4N41A 1MC8A 4IRKA 1JLAA 3SQ4A 1RYSA 3LAKA 4R65A 2X6SA 1VRUA 4DS4A 4JV0A 4UBCA 3CFOA 1A76A 3DLGA 3RAQA 1CZBA 3QIOA 4Z0UA 4F5PA 4MFFA 4I2CA 5D3GA 1B9DA 3HSTB 2AJQA 2DFFA 4F4ZA 3PX4A 2B6AA 4O3QA 3QIPA 1RBSA 5KFOA 1ZQEA 4QWAA 1W0HA 7ICUA 4HUGA 4YP3A 2IAJA 3EYZA 3GQCA 1ASVA 4BACA 4XUSA 3WNFA 1VSHA 5D4BA 1XU4A 1KFTA 1VRTA 3V6JA 4OGCA 5KT2A 3L3VA 4HTUA 3AVBA 2BPCA 3K5MA 1SKSA 8ICEA 1U04A 4NXZA 4I2HA 4IKFA 2V9WA 3O3FA 2ZJ5A 4B08A 4ZTJA 2I9GA 1RT4A 3NAEA 2HHXA 3GDXA 3ULDA 4KLGA 9ICEA 3C2LA 4J9RA 3SCXA 1W9HA 1RYRA 1BIUA 3AA3A 5HNKA 4KHNA 4DL5A 1BPYA 7ICQA 4IQTA 1TV9A 3VQ7A 2FPKA 4P2HA 4FJXA 1DOQA 4F5QA 1WNSA 2I5JA 1COOA 4F2RA 1ZYQA 3ZT3A 1VSFA 5KI6A 5SWMA 2UVWA 4J9QA 1EXNA 4ED7A 2FPMA 1HJPA 3LANA 1S0OA 1YTAA 4ID1A 4ECVA 1PZNA 3GV8B 2BE2A 4CJPA 4QWEA 4CFBA 4YQWA 1J9AA 4I2BA 4F8RA 3NTUA 3MXMA 1TK5A 1L5UA 2ZQBA 5CZ1A 2DY4A 5KFWA 2OPRA 1XHZA 1RXWA 1NK5A 4C8OA 4CJVA 3Q8QB 1HRHA 7ICEA 4MF2A 3TAQA 4TUPA 4PY5A 1Z00B 4NCBA 3C6TA 2G8FA 2X78A 9ICWA 1IO2A 2PXIA 1NK8A 3H4DA 4FLXA 2XCAA 4DSKA 2W9BB 2RF2A 3QESA 4CHZA 4BGDA 3AA5X 3S3NA 3DI6A 8ICKA 4ED8A 3RAXA 4QOZB 3HPGA 3G10A 4GC6A 1VSDA 1REVA 3PO5A 4Y1CA 3NHGA 3HL8A 4OKKA 2RN2A 4UB3A 2ISPA 5J2KA 4HUFA 3ETLA 3GIIA 1TL3A 2ZTDA 1BQMA 1ZQBA 4KITB 4EYHB 1RBTA 5HBMA 5HROA 2PFQA 1RDDA 2OPQA 3HWTA 4CF1A 4CJSA 5J0SA 1HUZA 4AHSA 5J2NA 3FFIA 4NCGA 4FLVA 4F5NA 3QEAZ 4CK1A 3JPNA 3QLHA 3MXJA 3TQ1A 4O3OA 4ELUA 3HXMA 5KG7A 5D49A 3G6VA 2G8HA 2ZD1A 5DBAA 4CEBA 1BPDA 3JPPA 1FKPA 3PW2A 1C0UA 1HQUA 3JPTA 4DQRA 4CIGA 4JWNA 2NRZA 3ZD9A 4DOBA 2KZMA 4J9SA 4CHPA 1FK9A 3ZT1A 3RMBA 5DDYA 5DBBA 1TVRA 2NRVA 4Q5VA 2XGQA 7ICGA 4EYIB 1X9MA 1B43A 4RU9A 5KT5A 1U47A 1X9SA 3RB3A 1SV5A 2HHQA 1J53A 2ATQA 4FJGA 2AGQA 3OSNA 3T5HA 4QZ8A 3ZSQA 1I3AA 1JMSA 3SUNA 9ICLA 4E3SA 4QZBA 2ZE2A 1NK0A 3M8RA 4F93B 1L3SA 3O4NA 1RDCA 4ECWA 1WN7A 3ZT0A 4C8NA 3S9HA 4XIUA 5HRRA 4E7JA 3ORYA 2ZUCA 5HRSA 1ZQLA 1BGXT 3EWAA 4I2DA 5C5JA 1NK6A 1RXVA 3ISBA 1B22A 3KK2A 4FO6A 4DL3A 9ICGA 4M3XA 1BPBA 4XRHA 9ICOA 3GIJA 4CK2A 4YR2A 4CEFA 4FJLA 4RQ3A 1A5WA 4RNMA 4TUSA 5KG6A 1SUQA 1TKTA 4DU1A 1NK4A 4I2JA 1ZBHA 3LPUA 4AHCA 1RNHA 3OYJA 1RTHA 3I0SA 4DLGA 3DRSA 4M47A 1H38A 3DLKA 3OYBA 2G8IA 3KHLA 3T19A 4YR0A 4TQRA 3A2FA 1VSMA 4KLSA 1XSPA 5KT7A 7ICSA 2JLEA 5HHHA 1SL0A 3RJGA 1ZQIA 1DLOA 3MEEA 4M0AA 4RW7A 1AROP 4LH5A 4I29A 3O3HA 2BANA 3HP9A 4QWCA 4CF0A 2FMSA 2H5XA 1RTDA 2XC9A 4I2PA 5J2HA 2ALZA 2IA6A 4JWMA 5J0TA 1EKEA 4KLQA 2OYQA 4MFAA 2MAXA 1LWFA 4JRQA 3TAGA 2HW3A 4H8KA 4QZHA 3C5FA 1RDAA 2F8SA 4RZRA 5J0PA 1KTQA 3VQ5A 3VQ8A 4BE2A 4YMOA 8ICRA 2Z1HA 5KFEA 7ICJA 4FW2A 3BQ0A 4KLUA 3OSPA 2KQ2A 1ZQGA 3NGDA 3U3YA 1JL2A 2ZUBA 4KHQA 4CJEA 4EEYA 5J2MA 3ZSRA 4CJQA 1X2IA 2JZBA 4CJFA 4FM2A 4YXJA 7ICHA 1BPZA 1IKXA 7ICMA 2NUBA 4JS4A 2UVUA 3OYFA 2YKNA 8ICVA 4FJKA 4UAZA 2RKIA 4L8RB 5KFPA 3MBYA 9ICRA 1S9FA 1CUKA 3DLEA 4CEQA 4NLZA 3Q8PB 4HUEA 3QEBZ 3ZDDA 4AILC 3SI6A 4FLUA 2B21A 4E0DA 2XY7A 4RPYA 3L3UA 5EWGA 5FROA 2HVIA 4B9VA 1JLFA 2VG5A 4UAWA 2PZSA 3QO9A 4LZGA 4KLFA 3H7IA 3ASMA 2FC0A 2QXFA 4AHTA 5CP2A 3H8WA 7ICPA 1ZBLA 5DB6A 4ECRA 4RPZA 1RT2A 3HVTA 5D46A 1HYVA 3OHBA 3SYZA 1S76D 1IM4A 3TAPA 1IXRA 4JK1A 2OZMA 3QEVA 3IAYA 2O4IA 3AO1A 4PQUA 4NLGA 3OS0A 1UA0A 1Q9YA 4KFBA 4R64A 1NJZA 3AO4A 4Z4FA 3B6PA 1RT1A 4KLOA 1KFDA 1X9WA 2DPIA 3OYMA 2FLPA 4FS1A 2YKMA 3F73A 4BDYA 3OYGA 4CF2A 3HX0A 1L3TA 2R8IA 1CEZA 4EBEA 4QZFA 1Z25A 3B0YA 2V4QA 4TURA 2C28A 1ZQPA 4KHUA 1ZQSA 2J6UA 1JXEA 4JUZA 2GBZA 1JXLA 3V1QA 1RT6A 4M41A 3SZ2A 3VQBA 1U48A 4JS5A 3LP1A 1LV5A 3Q8SB 4LSLA 5I3UA 5KG2A 5J2JA 4FVMA 3RJJA 4Q8EA 5L9XA 2G8WA 1CXQA 1ZQOA 4QZAA 4OKEA 1JXBA 2JEJA 3ZD8A 5DGAA 1NKCA 1KLNA 1T4GA 1ZQVA 4KHYA 4MEYA 3HT3A 5C24A 7ICVA 3KD1E 4RW9A 2BPGA 9ICSA 4CEZA 4KAZA 1ZQRA 1Y97A 3AO5A 3ZDBA 2HVHA 4FJJA 5DBCA 1ZQFA 1RBRA 1LWEA 3AO2A 2BCQA 5L1IA 4DS5A 2XY8A 3M8QA 3HPOA 4ECZA 4M9JA 2KFZA 4I2EA 1DTQA 4KLHA 1R0AA 3LP0A 5KFXA 3K4GA 4IQVA 3ISDA 4CJTA 3LWMA 8ICXA 5J0OA 3QNOA 4PHEA 2KTQA 3MABA 4ELVA 2G8VA 1C6VA 3U6FA 3PR5B 2XO7A 1XI1A 4DQPA 1RBUA 7ICTA 2OZSA 5DG8A 3VA0A 3GIKA 4O0JA 4DSFA 4K4HA 4UAYA 3H40A 1ZQJA 5DQIA 4MFBA 5KFQA 2YV0X 3PW4A 3T5LA 4F4YA 4K4IA 4IFYA 4CEEA 2KFNA 4JRPA 1J54A 4OLBA 3H08A 4AHVA 5FRNA 2ISOA 2JEFA 1BVSA 4O3NA 3V7LA 2BCRA 4QAGA 3QINA 4AH9A 5IIOA 5CY4A 4M3TA 4Z6DA 4J2DA 3JPQA 1YT3A 1ZJNA 1U45A 2JEIA 5EOZA 3ZDEA 1BPXA 3RJKA 4KN7A 4KTQA 4I2GA 3ITHA 3KK1A 3BQTA 3TAEA 1TAQA 4Q44A 4LY7A 1CXUA 4FS2A 1NK7A 1RZTA 4FM1A 3OYIA 1S6QA 4CJKA 5J0UA 4ED6A 4IR1A 4GXIA 4KLMA 1JL1A 1LAWA 1ZQCA 4YN4A 3RR8A 3OVNA 4QZ9A 1K1SA 2JZBB 2E6LA 3K2PA 4FZZA 5J2DA 1KVBA 2NRWA 5KG1A 4CFDA 4XQ8A 3TAFA 1Z00A 5T7BA 4Z4EA 3AUOA 2F1HA 4ZH4A 5KFUA 4KLDA 2D5RA 4KRFA 4FJ8A 4BWMA 3P5JA 1KVAA 1BQNA 4F5OA 3PMLA 4OPKA 3KIOA 4O0IA 4W5TA 3V7KA 9ICXA 3VQCA 4CJRA 3OS1A 4JV2A 9ICHA 1C1CA 3D0PA 5FDLA 4J2EA 3UXPA 3V9XA 1RPLA 5KG0A 4GW6A 2VA8A 4RQ1A 4FK0A 5BPCA 3I0RA 4IR9A 4IRDA 2B5JA 4ECQA 4CGHA 3NF7A 1WSIA 5EU7A 4KN4A 1ZQWA 4PHDA 3PO4A 5IIKA 3EW9A 4CF8A 4OLAA 3PX0A 3AVGA 3TFSA 3SUOA 1A77A 5KT6A 4CJ3A 1YTUA 3NH2A 3ZSYA 3KTQA 4I9LA 4RQ4A 1FKOA 2G8UA 3C1YA 5KFVA 1S9EA 1DGSA 2DPJA 3AVHA 1QSSA 4DTUA 1ZBUA 3L2VA 4AHRA 3IHQB 4J9MA 4R5PA 5KRTA 4OPJA 3VQ6A 3RBDA 2W9BA 5DQHA 1XHXA 1JLEA 3LP3A 3MFIA 4IDKA 3TANA 3AU6A 4HYKA 2AGPA 3DLHA 4FLZA 4YFUA 4KPYA 2F96A 4DSLA 5L1KA 5BOLA 2D0CA 3F9KA 4Z6EA 8ICAA 4OGEA 5J2IA 4RW8A 3PMNA 4O3SA 4E89A 4DTOA 3L2RA 3OYLA 3HK2A 1MSWD 2IC3A 2W9CB 5F9LA 4W5RA 3HPHA 4FXDA 2OA8A 4YCXA 3BQ1A 3CFRA 3KLFA 4QZGA 2IHMA 1RDBA 4CESA 2RDJA 4UB5A 4PHAA 2FLNA 3CYMA 1HMVA 4EBDA 1S0NA 7ICNA 4M3ZA 2FBYA 4KMUA 2XGPA 3IG1A 3V9SA 3LP2A 2YHBA 4CGGA 3RJFA 1NJWA 3HO1A 1XWLA 3TR8A 2Z1JA 3KLHA 3KK3A 4F50A 3NFAA 4B8CA 3KLGA 1BHLA 3ZSWA 1S1TA 5JS1A 4E1MA 3AVLA 1IKYA 3ISNC 3I8DA 2R8HA 5HHIA 2E4LA 2HHUA 3OHAA 1EETA 7ICRA 1C1AA 1C1BA 3NH0A 4DFJA 2AGOA 5DLGA 2P6UA 4M9GA 4DMNA 4NYFA 3C6UA 4YMNA 1D9DA 3QNNA 3DOLA 3CM5A 3SQ1A 1MU2A 5DB8A 3RH6A 4DLEA 3KHHA 4HHTA 5KT3A 5KFIA 5DMRA 5DDMA 4RW4A 3C94A 1UA1A 2Z1IA 3L2WA 4YFKA 4CEOA 2C22A 3MR3A 3OJUA 2G8KA 3SV3A 4ECYA 4BXOB 1S1WA 4DSJA 1KVCA 3JYTA 4JLHA 2QKBA 1RT5A 3Q8LA 3L8BA 4DTRA 4KKOA 4M3UA 8ICLA 2ZTEA 2A1SA 1IH7A 2J6SA 1NKBA 3AVIA 5KFHA 4RQ6A 3NCIA 1UOCA 3H4BA 2W9MA 9ICIA 4PHPA 3NDKA 3DRRA 9ICKA 2C2RA 1HNIA 4N47A 5HLFA 4X5VA 2ZJAA 1NOYA 1ZQXA 2DFEA 3B0XA 2W42A 5HP1A 3EPIA 4RT2A 2A1RA 1X1PA 8ICGA 4CHNA 4AHUA 4XA5A 3SJJA 1B92A 2KN7A 3UXOA 2P66A 3DLRA 4OJRA 2IBKA 4BDZA 3WNHA 2C2EA 1QQCA 3VN5A 2FLLA 3PY8A 9ICPA 4CJWA 3OYAA 5F9NA 5J0QA 3RB6A 4NLNA 3K58A 1N48A 4I9QA 3QE9Y 4M6WA 2WTFA 3LDSA 4YG2A 2IDOA 3ALYA 3SNNA 3G6YA 4FM0A 4CE9A 4ZHRA 3TI0A 5KFRA 1TV6A 1WCNA 1SKWA 4FBUA 3ZSVA 2P5OA 5KG3A 2FMQA 3BJYA 4R66A 2HMIA 2OWOA 5CWRA 4C8KA 3KLEA 3FYHA 5KT4A 1S6PA 3UQ0A 2WOMA 2WONA 4Z4HA 3IS9A 4F3OA 5KFFA 4B9MA 9ICJA 3V7JA 2ASJA 1T3NA 3FDSA 7ICOA 3NGIA 4CF9A 5L1LA 1TKXA
chains in the Genus database with same CATH superfamily
3Q89A 4YY3J 1X6JA 1KLMA 1D8YA 4GVMA 4E19A 4ANDA 1MA9B 4ELTA 4ZCKA 4URGA 3TZXA 1NK9A 4JI6K 2NXUA 4FJHA 4DFMA 3MCSA 3QAEA 3BSAA 2BPFA 1PVQA 1UW9A 4I28A 3E1YA 2QN6B 1K8KA 1JCEA 4DO9A 5AK5A 1OSCA 1UAXA 2R7OA 3CDUA 3K75D 3A13A 4LF9F 3E01A 9ICAA 2ZC4A 2CJQA 4TLQA 4DFPA 2NXJA 4W4MA 4DTXA 4V1Ak 2EH9A 1PYTA 1S6UA 4L73A 4A8YA 4TY8A 1U49A 2R8GA 4WU2A 1WCLA 1N62A 2ZKUA 3BH7B 3P83D 1R8AA 4B3SK 4NB4A 2BQRA 8ICWA 4PYDA 1NSAA 4G3IA 2KYZA 9ICUA 3W60A 4CTAA 5EUHA 2W04A 1T05B 2AH5A 1N4LA 3ZT4A 1CRXA 2QA2A 3AB4B 1J5EF 1RTIB 2XHCA 3P3DA 4Z4IA 3QIDA 4AD6A 1IBLF 3HJFA 2E3TA 2WF8A 3OTDA 3HCXA 2CN1A 9ICTA 2MZ1A 4FCYA 5HMLA 1ZXOA 1NJYA 4CZGA 4ZPDA 3E0FA 2FTRA 5AK3A 3RJHA 3HFZB 1LFPA 4HCBA 5F8NA 4KLEA 2N7YA 2Q31A 4US8A 4ZTFA 4JI1K 5LJVA 3V81A 3DNCA 1RDRA 2QC3A 4RNHA 4DOAA 3VQSA 3Q7CA 5GTHU 3NOCA 1U2VB 3VEOA 2YNFB 1IVZA 1UHUA 1BCMA 3PZPA 2DHAA 5E3QA 1S77D 5CJ7A 1F44A 3RJEA 5JICA 3OD2A 1JLQA 1WLJA 8ICSA 3IO1A 1WF2A 1N6QB 4BY9C 4OJ6A 1S8OA 3QICA 2JVOA 2KXNB 1RP5A 4AQYK 3A3OB 2VZ9A 1PC5A 2DGWA 1U6ZA 4RUCA 1AA1B 1VJWA 3NOGA 2Z4PA 1NWKA 1QUVA 5KPTA 1KSPA 3WX8A 3ZO7A 3H5YA 2E1RA 1FRIA 4M5LA 4KH5A 1Z4OA 3BDPA 3KOAA 3GE9A 5HVFA 1UEUA 1K0TA 2VB6A 1UZHA 5ALLA 1N5QA 3CCWA 4Z37A 5J2FA 3LH2S 4XO0A 4CJ4A 4U6PA 3OBYA 1KVIA 2XI9A 2YX1A 4YOTA 5KFMA 1QAYA 3OYCA 1L3VA 5HO4A 3QZ8A 3G8SA 1XNQJ 1WAFA 2EBEA 3UFCX 3O5BA 3M1VB 5ADXH 1V5IB 3F2KA 4QYRA 4CJ5A 1I94J 4LBHA 2FHJA 4NLOA 5JVGQ 3ZX3A 3FCWA 1CLQA 2R2SA 1TK0A 3MAAA 4TKTA 1DGKN 3J80Y 4I7FB 3WIVA 2CGJA 3FGUA 3H8SA 5C15A 4KLLA 3C29A 4WCEL 2HOQA 2E6MA 3CE8A 5CYQA 5D77A 4F3TA 4Y2CA 5FJ4A 5I42A 1S3XA 4LVNP 1KDNA 1B64A 2IVPA 3DV9A 5I9EB 2AEMA 3LF0A 4FLTA 1LB2B 4WF9L 3LL3A 4UZCA 4NXMJ 2NZTA 1BPEA 1YI2N 3TZZA 4J9KA 3GP9A 5KFGA 1SIWB 2KL8A 3NS1A 2EX3A 4WP9A 3TUZC 3O3GA 3RBEA 5IM0A 4J9NA 1ZJMA 2PFFB 1YJ9S 1SZ2A 4CCHA 3BYPA 4LF7K 3RW7A 1V4TA 2BKOA 4G1PA 3TADC 2A3ZA 3UIQA 2F65A 3AJDA 5BPMA 1HQEA 5AI6A 2OLWA 1RT4B 3AD8C 1UJ4A 1HYZA 3CCLN 3U1LA 3RR7A 3A8JA 3KZIU 4EWTA 1VQ4S 1VQMS 1WWVA 3ENWA 4BDPA 2BRKA 2BDUA 3DRXA 1CJVB 4QZCA 4DTNA 3MDFA 4CLYA 3M9NB 5IS2A 3C7NB 1N6QA 2K60A 3VGTA 5KPZA 4DZ6A 1HNZF 3LGMA 4AL5A 4W5OA 3WKDA 3P96A 4NYOA 2E5SA 5EE9A 8ICQA 1NUEA 4M5DB 5M2UA 4U67Q 2W3SA 2VD3A 1JALA 2E5GA 1YAGA 4O8KA 5J2AA 1ITGA 3HI9A 4ZVEA 4TSXA 5E2QA 5HATA 1WOPA 2HIYA 4YUDA 2ZUAA 4Q8FA 1GH8A 4Q43A 1TKZB 1JX4A 3NMRA 3OYDA 2JC0A 2Q2RA 1I1GA 4NMXA 4H5VA 4KIAA 4O5CA 2DWQA 2PN6A 3W3DA 2ZOFA 4LMZA 4RT3A 1N5YA 2YQ3A 3MZIA 3Q86A 3U27A 5KFDA 2Y1JA 5AZJA 1XR5A 2ZIXB 2FC8A 4A8FA 4P2MA 1TAUA 4B9QA 4TVAB 4K5RA 1WBDA 2XBPA 2VJ5A 1V4SA 3MGIA 4DR7K 3QFHA 4UF4A 3ZSOA 3C66A 4NXNK 2UUCJ 1WSHA 1F21A 3ETMA 2GIQA 3SPZA 5CYQB 1K8AO 3VMFB 3T1YJ 5J8YA 5JLHA 1X60A 1T8EA 3EE9A 3GV5B 2V9KA 1SXDA 3K59A 4WYLA 4LFCK 4P4PA 1D09B 2VA3A 1RBVA 1L8OA 4MDAA 3CCZA 4GFJA 3KUHA 2HYIB 2PFDA 5EGYA 4JI8J 2GS8A 3W62A 3VEXA 1UVJA 3PNCA 3CFPA 4R25A 4YD1A 1B0TA 2BANB 4QOTA 2XMVA 4UB4A 4CHQA 1M90O 2HMPA 1FJEB 1G1XA 3G71S 3H0LB 4A48A 1PK1B 3C95A 2O8CA 2DK2A 1SQGA 4PEOA 5HL7Q 2E5LF 2CUYA 2MKCA 4GMJB 4MN4C 1Q4RA 4C0OC 6FD1A 4Q0BA 4I7FA 2OTJS 3OYKA 3HJEA 2PA3A 4J2BA 4O3MA 2F9DA 4LF7F 2EKYA 3FSIA 4DV6K 4F04B 3VPZA 2Q97A 3D54A 4DQIA 4DV5K 1ASWA 2D41A 3P49B 2KJWA 3HOTA 4ICLA 2LYBA 4RTFD 1XMBA 3R7SB 4HHHA 2AYGA 1Z2LA 2HK2A 4Z6FA 3TAMA 1NZBA 4M9NA 5A2QY 1I3OB 4DHVA 1P9YA 3VEZA 2KK0A 8ICTA 2AWZA 2FPLA 4DR5J 4K7QA 2XWXA 4TQSA 1SC3B 3QX7A 4I27A 3S3MA 2PMWA 2BQ3A 2ITGA 3OV7A 1SVDA 5J29A 2EZXA 2PYJA 2I1RA 1R59O 5IINA 2WW8A 4FF2A 4LZDA 3PRDA 2ZH9A 4K25A 1L3UA 4NCAA 2ATCB 5CYMA 1M1GA 4MFCA 2MLZA 2FBXA 5EN1A 2CDQA 2E7WA 1VLYA 4IG3B 3HX9A 4USKA 5KFSA 5H9FK 3MCPA 3X1LB 2VOPA 2YNGA 4FVCA 3RWUA 8ICJA 4OVLA 5KOXA 3IS9B 2AX1A 4EZ9A 2FJBB 4B3MK 5I42B 5C24B 3THPA 5DM6Q 2D9PA 2FHJD 4Q2LA 1OSDA 3B9JA 8ICPA 4PL7A 3CQYA 3LW5C 3VQAA 4FOIA 3GSIA 4DV1J 1ZQUA 1OVYA 2Z56B 4HACA 1V3SA 5E3CA 4B9UA 2MKKA 4US9A 2VPZB 3SQOP 2Y1LB 1GLBG 4RQ2A 3TWZA 1JK9B 3SBGA 5E0OA 3O6WA 1XTZA 4DR3F 2YKMB 2LQJA 2VWJA 1RDWX 3JPOA 2WSFC 2VFUA 4OX9K 4KV8A 5ALGA 1NDPA 1HNIB 2DY9A 1HBUA 2ZJ8A 3NF6A 3OGUA 4HHJA 1FIQA 2ZF5O 3HYFA 1ZQHA 3NGYA 2QFJA 1T05A 3K7RA 1U1LA 4QIFA 2MTLA 1ATNA 4USWA 2KT5A 4BC2A 3RH5A 2DGXA 3Q8YA 1T02A 3ZETA 3LDLA 2L9WA 4JK8A 1U2RA 1ZQNA 3VGUA 3QXGA 3UR3C 3PUFA 3UQ2A 5KFZA 3CJBA 2XHBA 3TVZA 2VQFF 1BL3A 1MU2B 5HMZA 4B9NA 3NVMA 3BO2A 2GOLA 1GOAA 3U1NA 5KG5A 3MFHA 2PYLA 3AGRA 3MD1A 1HHSA 3DLEB 3KUEA 3KG4A 3L3CA 3PJWA 2XNRA 3VQ4A 2D9OA 5EX3A 3E2EA 1HWJA 5KFCA 4CF5A 3SMPA 1ZBIA 3D6MB 2LA6A 2YHAA 4RQ7A 4B9TA 1DKGD 3ZZTA 3OY9A 4OJLA 9RUBA 5DDQC 5CA7A 4Z4GA 3G0ZA 2KKVA 5HMWA 3QT7A 3TVKA 3PDNA 4NA1A 2JRZA 1UEKA 3R9PA 2MA1A 4WXWA 3ZDAA 4A8QA 2A42A 4UUWA 1PO6A 4P9SA 3VZIA 3WNEA 3PV8A 3VQPA 4M42A 5DB9A 2G0AA 1S72S 2VG7A 2LQ5A 1IKWB 1TTHB 1RHQB 3M2RB 4NJ8A 4F4WA 4OHZA 3ELHA 2VDHA 3SV4A 4ETZA 3D45A 4KPCA 2ILYA 3U8XA 2FHMA 1S97A 5EXWA 3KMQA 5A2QU 2W4DA 1SS6A 3GG0A 2IS3A 1KVJA 1YWXA 5JUMA 4M7YA 2QIFA 3BKFA 2B4JA 1M5KC 4E1NA 5J2MB 4XDCA 1XNRF 2NV3A 3DXMA 3TJ8A 1S22A 2V8GA 3CCUN 2YX8A 3WQTA 3C6TB 4DX8H 3JSMA 1CG2A 2QLXA 3TJAA 3KD5E 2BDPA 3SMZA 2UVVA 4DUYJ 1AUDA 2AP1A 3KHGA 3IA0A 2M2BA 2R8JA 3KNGA 8ICHA 2RE1A 2DGVA 1RHKB 4E7KA 2NRTA 2M4MA 2GH1A 4B9SA 2ASPA 4H0YB 1FF2A 3KDOA 4OI4A 1VQ6S 2E88A 3QRPA 3SQIA 3KJQB 4YB7A 4IOBA 3Q8RB 2D3UA 1NPPA 4O5EA 2P6RA 1XMOK 3J81Y 1QQ5A 1HBMB 2ZH1A 5IILA 2LPEA 3GU0A 3ZZYA 5KTQA 5IV4A 3QEIA 2E8AA 3SI8A 2KHDA 4ZLNA 2YBVA 1UKUA 1D8LA 2JX2A 2Y1IA 2OI2A 1XJWB 2P2CB 3IR6B 1XQSC 4LSZB 5AFUA 1O8BA 1UW4A 4AYBF 2H5IB 3HD2A 1ZETA 2FVPA 3LZJA 2PFNA 4Q45A 2DRAA 3B6OA 2W8KA 3WKAA 1VSKA 4LSNA 3HP6A 3CNHA 4BBYA 5KRSA 3WUHA 1LXJA 2C2MB 1QVFR 1QS4A 1JLGB 1TKZA 3C23A 2WVCA 3IWXA 1NHVA 3QYPA 3KOOA 2A3VA 1JLAA 1JCGA 2V67A 3WK7A 1LWEB 3IXQA 1Y7PA 2F40A 3LAKA 4DS4A 2QLJB 1R7IA 3F2CA 1V5VA 4IO8A 3VERA 4OYOA 4WIQA 1QHAA 2IJRA 5AQXA 4DG1B 3S01A 1ZPWX 2B4VA 2B7BB 3HHLB 4Z0UA 5ALHA 4MFFA 4I2CA 2BEFA 2UU9K 3CDWA 1B9DA 4JKEA 4RX6A 4F4ZA 5AKXA 1RDUA 5D4LA 4X4NA 2B6AA 4DR2J 5AI0A 4I2PB 1AB8A 4PJ0U 3FBCA 5KFOA 1ZQEA 2Z2LA 4DV7J 4CZEA 1MG7A 4MFBB 7ICUA 1YBAA 1W0HA 4XUSA 5D4BA 2NYHA 3VOVA 4BRPA 1VRTA 4DX6A 2IYIA 3EGVA 2H5JB 4OGCA 2EAOA 5JJBA 5KT2A 3L3VA 3BZCA 3AVBA 2BPCA 2DHGA 1SKSA 4OYPA 8ICEA 2BJEA 2IVYA 1U04A 4NXZA 1GLDG 4MHVA 2V9WA 2V50A 3NCQA 3UVJB 5KL8B 4GKKK 2HHXA 1RTHB 3ULDA 4KLGA 9ICEA 4J9RA 3TW0A 1RCOB 1W9HA 2DNKA 2DH9A 5IM0B 4KHNA 4J03A 1N60A 1BPYA 1Z1VA 4GO5X 2A2DA 3PYGA 2J5AA 2W24A 2FPKA 4P2HA 1HQ2A 1DOQA 4F5QA 5EHHA 3I32A 3CJ8A 5SWMA 5L8RC 4J9QA 1EHWA 1P8ZA 3T7ZA 1EXNA 4YDDB 2FPMA 3WBZA 1S0OA 2WB1C 1FTRA 4CFBA 2A6AA 1IBKJ 4I2BA 3MXMA 4DR3J 2ZH2A 3BF1A 2ZQBA 4DV3K 2MYFA 2DY4A 1UPHA 2UU9F 2OPRA 1JLQB 1PILA 2XLJA 4MF2A 3TAQA 4BR0A 2X1FA 3C6TA 2DIVA 3P6YC 3RUBL 2E5LJ 2OPRB 2KG0A 1SUQB 3MMBA 4AM7A 1MWKA 2HFOA 4DSKA 2W9BB 1T03B 4HWIA 2RF2A 2MMYA 4CHZA 4X66K 3VGVA 2UUBF 1ZBSA 3HPGA 1ZS6A 1REVA 4Y1CA 1SV5B 3MM5A 3MURP 4OX8A 2ISPA 4C3LA 2ZNZA 4CH1A 3CJRA 4DFDA 1X4DA 1X3MA 3AGKA 2WF6A 1RBTA 4E8UA 2IM3A 5F3TA 4PG8A 5HROA 3MGVA 1SB6A 1H2VZ 3CD0A 1TL3B 5J2NA 4NCGA 2JHDA 1BOTO 1P6TA 1TMMA 2HWTA 3F56A 2F44A 3ADAC 3MXJA 4R79A 2B0GA 3TQ1A 4WQ4C 3HXMA 1N8RT 3CTRA 3D2SA 1E4FT 4NCGB 4CEBA 3JPPA 3H0RB 3PW2A 2ZIVA 4CZJA 5AQSA 1HNVB 1CVJA 3H98A 2DR8A 3LA0A 1J5OB 4J9SA 4B1WB 4OJ5A 3DDNA 3RMBA 5DDYA 5DBBA 1M6YA 5F8IA 2D1CA 3PTWA 4Q5VA 2XGQA 4LF5F 5GVQA 2ZH5A 1U47A 4ZN3A 4EMDA 3C3LA 4EO6A 4KHPK 4CW7B 1OKJA 4DU8A 2M0GB 2YWEA 2XEXA 4F93B 1ZM3A 3O4NA 3C6HA 2G0IA 1LNQA 4ECWA 1HPMA 4JI1J 5BRHA 2L41A 3PLAA 1W2BM 3FC9A 2XVTA 4LSNB 5GADP 4KX3A 1PGZA 4LF6K 1Y5LB 4ZHRB 1SC1B 3PIOL 3CCLS 4E7JA 2ZUCA 5JMVA 1EJ7L 1BGXT 3EWAA 2M52A 3RJMB 1B22A 1Y3KA 2FXUA 1BXNA 1CLFA 1Y4ZB 2ZVIA 1BPBA 1CJVA 3FR0A 1K47A 3GIJA 4CK2A 4BREA 2EANA 4YR2A 3KLEB 4RQ3A 3DOLB 4UOFA 4NO7A 3GOIA 4TUSA 2QJ3A 4AHCA 1RTHA 3ILJA 2YNHB 3O9RA 3DRSA 2EFNA 4KGKA 3KFUF 3DLKA 3OYBA 2G8IA 4PKIA 3T19A 3VF4A 2LVWA 4YR0A 4IO1A 5CAAA 2ZC3A 3A2FA 3W65A 5KT7A 3BYRA 4I68A 2JLEA 1VRTB 1OW5A 1AROP 3LGNA 2AIRB 1CBKA 2QSFA 2FJAB 4NEZA 1Z1BA 2CXEA 3LM2A 1Q16B 2B6AB 4JI5K 4LF4F 2ALZA 2IA6A 2J9DE 2CQHA 2B8QA 5HQ8A 1F9FA 2JZ5A 1ZD3A 3SIPB 1TL4A 4K4SA 1EX8A 1RBLA 4DPWA 2OYQA 4BRQA 1AFJA 1LWFA 5G0RB 1ZAXA 1UEVA 4WQ5C 2DH8A 2HW3A 3VEVA 2O3DA 5E79U 1T3VA 2QXLA 1GX5A 4F0MA 1VJQA 3VQ8A 4BE2A 8ICRA 2IYGA 5KFEA 4FW2A 2YB1A 2JLGA 3A8IA 2DNMA 5H9FJ 3U3YA 3BS7A 1U0SA 2ZUBA 4RUBA 4CJEA 1KP6A 5J2MA 1X2IA 3K0SA 4CJFA 4FM2A 4LF4K 4YXJA 1WF1A 2E44A 3C14B 1IKXA 4ZPAA 1Z19A 2NUBA 4DCPB 4JS4A 3SMSA 1H2UX 3OYFA 3J8AA 2RKIA 2FUG9 1FJGF 1UVIA 9ICRA 2FD2A 4PCQA 3ED5A 2DGQA 4DV4F 3CJKB 1EQ0A 2IIRA 3QEBZ 4AILC 3SI6A 3WIUA 2H3GX 4E0DA 2XHWA 4TYAA 2XY7A 4WTYA 5E26A 8AT1B 1HKCA 2JMGA 3FJ2A 2OHFA 4BRKA 2HBQB 1PK1A 4B9VA 5HI7A 2VG5A 2PZSA 3H7IA 1B70B 3I5AA 2W43A 2FC0A 2QXFA 4AHTA 1W2BR 2V51B 1ZBLA 5DB6A 4ECRA 4RCHA 1PC4A 2DO4A 4F3QA 3MN5A 2OEHA 2AXTU 3SYZA 2GW8A 5AQFA 1IM4A 1IKYB 1IXRA 1SH2A 1FE4A 3JXOA 3IAYA 4JHDA 4M5JA 2QA4S 4NLGA 1F6TA 3U02A 1IIPA 2QLBB 3SAHA 1JROA 2W2PP 1X4GA 1X5OA 3AB2B 2CKWA 1I5OB 4Z4FA 1ZTTA 2F8LA 4X2BA 2FLPA 4YOWA 4FS1A 1UAWA 3OYGA 1UWAA 2MQMA 4WYBA 1L3TA 3M2VB 2E5IA 2UXBF 1U26A 1WBBA 1CEZA 3N4QA 5IT9O 1ZRMA 5K8NA 5DDPC 3FQLA 4TU9A 2DQNB 4L74A 3W66A 5LY3A 4TURA 5AKKA 5AQLA 4A8XA 1ATSA 1JXLA 5HROB 1S1TB 5LMNK 3V1QA 2IM0A 3BN7A 3CXCM 4X64K 3BGRB 5GMEA 4RQNA 3PEHA 4I69A 4LSLA 5I3UA 2RAQA 4MKAA 1WC0A 3M2RA 3MCAB 2FDNA 3LP2B 4I6MA 2G8WA 2QLTA 1N88A 3B6BA 4CH7A 1LK7A 4OKEA 5ALIA 1JXBA 2JEJA 5DGAA 4WJ3B 4J9VA 3TNVA 1K73T 2BW2A 3HM8A 3CC7S 3CF5L 3KD1E 3KLFB 3QWPA 3VESA 4KAZA 3AO5A 1AT1B 2HVHA 1KQFB 4IOCQ 1TR0A 3QQCD 1NGIA 5L1IA 2R7WA 2XY8A 3KWIA 5MAOA 5IV3A 4NLBA 4KLHA 3TRGA 3LP0A 5KFXA 2DHSA 4IQVA 3IR7B 4YB1P 5ALYA 1UL3A 2O8DB 2G8VA 3MOZA 2RKIB 3QLHB 4OZ2A 2QKQA 2HRTA 4CO5A 2FPHX 5BPNA 4BRMA 4K4XA 2YKPA 3VA0A 4DSFA 1HIYA 4K4HA 4DV0J 4AFFA 4BQLA 5DQIA 1Q5VA 3ISND 5KFQA 2YV0X 1Q82T 3T5LA 4F4YA 4IFYA 4CEEA 3N28A 1J54A 4AHVA 4F26A 5AQIA 2MZSA 1WKLA 3WK4A 3W9IA 2DGOA 1MNEA 3QO9B 5K14B 4L6V3 1OY6A 4NLUA 1S5LU 1LK5A 2WCXA 3L6QA 3JPQA 4PQAA 1ZJNA 1D3WA 4JEPA 5B08A 4QPTA 4DR3K 4QIGA 4WFNL 3A5OC 2VG6B 1BPXA 2FGCA 1FX2A 5IWAJ 4FL9A 2FDRA 1FRHA 4HI1A 4DV6J 1SXLA 1ZOTA 3DXKB 3BQTA 3B8AX 4LF5K 2JNJA 2CYYA 2R7UA 3THTA 1RQLA 4DX5A 1RT3B 4PZOA 4IR1A 2GV1A 1VJ5A 1H6KX 1HLWA 2O66A 2CQPA 5EX0A 1SC6A 2E6LA 1NI3A 4BX9C 1D8BA 5AQTA 3I76A 3TAFA 4OCZA 5T7BA 3AUOA 3UD3P 2FJ6A 2D5RA 4ILLA 1HX1A 1L6NA 4KRFA 1SGGA 2W2QP 1WC3A 4V19S 3KG0A 3PMLA 1VQ9N 2H5EA 3QJLA 3OLBA 1F5AA 4HDHA 3GZ7A 4CJRA 2F4FA 5ETTA 4OJ1A 2KT3A 2VH7A 4GRSA 1EP4B 3NL0A 2WFBA 1VQ7N 5AQZA 2ZIUA 1VC5A 3UXPA 5KG0A 4KHPJ 3C14A 5BPCA 2G4BA 5ALKA 4FO0A 1PBAA 1VIOA 1X4CA 1L8LA 4DHYA 2QWRA 4P75A 4ECQA 3NF7A 4KN4A 4W92B 2Q3PA 1TV6B 4X66F 3WXIA 2OEJA 4P6QA 4UOCA 1WDDA 1VHIA 3OW2R 3MMVA 4CF8A 1X7VA 4DV1K 1REVB 2VV5A 4J5OA 4K2JA 2PDAA 1YDLA 3VVUA 4JKFA 2XWYA 4QU6A 1DJ0A 3NMUA 2Y8WA 3U9DA 4CJ3A 3FC4A 1YTUA 3JAMY 3NH2A 3R5BA 4H5TA 3DC2A 4HH1A 4ILRA 2CADA 1MN9A 3R3TA 3CCVS 1S9EA 4DV3F 3UI3A 3AXMA 3ENQA 1GLCG 2CJBA 2PT0A 1SH0A 3L2VA 4R5PA 2D4WA 2KLAA 3VQ6A 3CCMN 4TY9A 3ZZOA 4NXNJ 3LUYA 3LP3A 1BA1A 1C4CA 4N8NA 4BJQA 2AGPA 4FLZA 2F96A 4UY8O 4DSLA 4CZLA 5ETVA 1NNEA 1S7IA 4Z6EA 4DR5K 2B9YA 5J2IA 5M2RA 3TEHB 1FJ7A 4OI6A 2I7PA 2E1MC 3AY0A 1B4FA 3HK2A 2ROGA 4LFCF 2IC3A 2W9CB 4FXDA 4W5RA 4JI7F 2OA8A 3KLFA 4LF1A 4QZGA 2O01C 2UXBK 4NMLA 2OEMA 2LXIA 5AZIA 2M70A 2FLNA 4EBDA 1S0NA 2FBYA 3S8SA 4KMUA 5L46A 4JKGA 3HRDD 2P9CA 3IG1A 3LP2A 4QR1A 3RJFA 1NJWA 2GHWA 2CRLA 1KL9A 5J1EB 4B3TJ 4B8CA 3FKBA 1BHLA 4CH0S 1S1TA 4E1MA 3BP8A 3AVLA 3UDCA 3ISNC 3ISZA 5HHIA 5BR8J 2ZUGA 4M5KA 2E4LA 3F53A 3OHAA 7ICRA 1X5SA 2NSCA 4H0PA 1Q7YT 1NBWA 1W7AA 2CPFA 5M2PA 4DMNA 4CVNE 4NYFA 1YUWA 3DOLA 2YQEA 1HJOA 3RH6A 4DV4K 2AD9A 3DM2B 3NGTA 2ACMA 4IKAA 3DXBA 4NA3A 4M8LA 5M1PA 2C22A 3MR3A 2F3JA 2X1GA 2ASOA 1RT5A 2YWHA 3L8BA 3D1QA 8ICLA 1FDAA 3D66A 2IJNA 2D1KA 3DKDA 4HT7A 3U9ZA 3OUYA 4N47A 3BZQA 1ZQXA 3ATUA 2I7NA 3EPIA 1X42A 4RT2A 3BQ7A 5AQQA 2A1RA 2F7VA 1X1PA 4OD0A 1P1LA 1H74A 2BV3A 3EZUA 2IBKA 3WNHA 2C2EA 1QQCA 4GO7X 3W8GA 2L48A 4LFBK 5GTIU 2FLLA 3OYAA 3I9ZA 5CCMA 3K58A 4H4OB 4UZBA 4IO9Q 4YOEA 1N48A 4I9QA 4K2XA 4DCJB 4M6WA 2WTFA 2JRSA 3V4IB 5CD4A 4YG2A 2BXJA 4JOUA 5ALEA 4J7CA 3ZXWA 4M5MA 4LF8K 3TI0A 5AKHA 1TV6A 2KVIA 1SKWA 1OPZA 4FBUA 2P5OA 3HSCA 2CQCA 4JKDA 3NEKA 5D4PA 3THXA 3BJYA 4WFYA 4R66A 4PKGA 2HMIA 2Y0SD 5CWRA 3K89A 3KLEA 3H1VX 2QI2A 5KT4A 5F2RA 2WONA 3M4XA 4PQUB 1IKVB 1FRXA 2KI2A 2ASJA 2RH3A 3O0FA 4OI0A 3M32B 3I87A 5L1LA 2PY5A 4LRDA 1TL1A 1ZM2A 2I0XA 3G25A 3SQGB 5HL7L 3MWTA 2RD5C 4YOYA 1VQ8N 4M2YA 2HHSA 3M2VA 4QW9A 3PYEA 2B51A 4LRCA 3VTHA 3VQEA 1RT3A 3RTVA 2Z1GA 1YQHA 5KOWA 3CCJS 4PXBA 3CCRS 1N32K 2ZE2B 2KHCA 2RT3A 3CCTA 1NOMA 4KH0B 4OZJA 2Y9HA 2HNYB 3UNYA 2KW4A 1XSNA 4KHPF 4ZITA 2I5HA 4RNNA 3VV2B 1N5TA 3VAJA 3LDOA 4FWKA 5J2PB 4MT1A 1TP7A 4OIXA 3VALA 3SPYA 1LEOA 3IDWA 2W25A 1YRXA 3R2DJ 2FGOA 4MKVA 6AT1B 3R97A 4B3OA 1JKHA 4BR7A 3QU4A 4LFAF 4JKGB 4NXMK 1GOBA 3AA8A 3L2QA 2JC1A 9ICVA 3K1RB 4Y1DA 3N9UC 4EHUA 3ENAA 2AT1B 1SV0C 3RAMA 3E58A 2CNKB 4PL2A 3IM1A 8ICNA 1UMJA 2SXLA 1FWLA 4LVSA 4QR0A 1SZPA 1Q3VA 5DS7A 1U9LA 3WX4A 4KH4A 2ZM6K 4B8AB 4KLJA 3RW6A 1J2VA 1OH7A 3EY1A 2E8MA 4WFBL 2VDIA 3TTDA 1FFSB 1MQ3A 1BLUA 3ZCMA 2ZWOA 1CC7A 3KKSA 2P51A 4NV0A 2AJ0A 4C7ZA 1HW8A 2CVEA 1EQYA 1RHRB 2Q36A 2IHR1 2O8DA 3BEGB 5KFLA 3R5DA 2GELA 4FW1A 4YMMA 4NM1A 1WTBA 4BRNA 4KI6A 2EW9A 4X62F 2GWJA 2DXEA 3QT6A 3V5RA 2ZIWA 2WONB 1X0PA 2UV8A 1Y5IB 2NYVA 1S9EB 2HFNA 2RDIA 4L72B 4RWWA 4FZXC 1UZDA 5D4OA 4MK8A 4BR5A 4HEA9 1XK8A 4RW6B 2E5LK 3THWB 1G7CB 3O8MA 2QLFB 5IIMA 2AA4A 1FERA 1YHQS 3MGJA 5FLXO 1KEKA 3GJTB 3D6HB 3M6KA 2BGWA 4OO1J 1X31C 2LEPA 2QMWA 1JNRB 4ZCMA 1B7FA 2D0AA 4QNLA 1O5JA 1RWPB 2MKIA 4P73A 5IIIA 2YHXA 5ALUA 4FJMA 4F9OA 2EKNA 1RQNA 1YGYA 5H1SQ 2CPHA 3TEGA 2MU2A 1S7HA 1RABB 5C42B 4DL2A 5AXMA 1VQKS 1KCFA 3MDQA 3LK9A 1LW0A 4Y2QA 3LDNA 1RAFB 5AJ3F 1TU0B 3EVWA 5C42A 3WKBA 2WB1D 1LWFB 1TL5A 5KFBA 3WXMB 2FSNA 3HSZA 1HD0A 1WHYA 4OZ5A 3SUPA 1UPMB 4USIA 3KK2B 3D1OA 1MMNA 3I4PA 3IDHA 2CG4A 4JV5K 8ICIA 2GHPA 1A5VA 4GKJJ 2FJDB 4FP9A 3EKSA 4DR6K 3CCEN 1VK0A 3PHEA 4O55A 1OO0B 2HSZA 1EXQA 1QZ5A 5BREA 3RH4A 5SZTA 2IRYA 3JXUA 3NF8A 2GVDB 4QS7A 2BJ3A 3FBBA 3SQ2A 2FBVA 4YY3K 4YN3B 1CJKB 1KEJA 1M5SA 4P4OA 2QT7A 2CNNB 4CERA 2JV3A 2DVIA 2E8NA 3KKRA 2XMKA 2JH1A 5K14A 3OBIA 4GKJK 3MEGB 5JXSA 2ZWPA 3GWCA 3DOMA 4GMKA 4ZCLA 4U7BA 3LWLA 1QQOA 3MMAB 4DV5J 1I39A 1RK8A 2DY1A 1VQ5S 2XYPB 2O8EB 3UW1A 1WD6A 1HNZK 2MGZB 1VQNS 4BRLA 5IIJA 5HMMA 1HQUB 4J2AA 3GV7B 1YVNA 4WCEQ 1HR0K 2NRXA 1OH5A 1YBTA 3VA3A 2KZ3A 1NGCA 3BGFA 3KWGA 3RMCA 2CGLA 3K57A 4PG5A 1WYGA 4M63A 4H4OA 4UQTA 3M5RA 4EP4A 1DGJA 4DFKA 4A8KA 1RU1A 3QT8A 1IN0A 2PFUA 1VQ8S 4ED0A 5E33A 1U8WA 8ICFA 1GMWA 2LMRA 3NGUA 2VUGA 5M1OA 4TXSA 1V9PA 3C15B 4BWJA 3C5GA 3J7AP 2X3DA 5DGBA 4YR3A 2GJFA 2NZCA 2HDOA 5AR0A 4K4UA 4IRCA 3GSDA 1X5PA 2DIUA 1KXPA 3GFKB 2NREA 3QAUA 2EK6A 2VGNA 3QERA 4FJNA 5AXLA 1N33K 2K3IA 2NXNA 2VBWA 1IKVA 3O08A 4NXMF 1R31A 3CJ5A 2ZXHA 2KHOA 1IXKA 3G6XA 2A1AA 1PVRA 3LPYA 2NRHA 2V8PA 3FZLA 1ZD5A 3M7DA 2KKZA 4IOAL 4FZNA 1DQ9A 1WSJA 3ULHA 5LT5A 4NY8A 4FWMA 3J81j 2GGPA 3BS9A 2WSCC 1VQPN 1BWVA 3DHXA 3KJVA 2JOQA 2DYAA 4YXMA 1C0MA 1ROFA 1QTMA 3KK1B 3DDKA 3ZSXA 1S48A 4DV2J 2RU9A 3C16B 4N5SA 4FZLA 2ZH6A 3WK8A 5L9NA 1UTAA 1S1VB 2K06A 4MEXA 3IMQJ 1BDGA 3SQGA 3EL2A 2IMWP 3K17A 3MEDA 3K5OA 4YOXA 1BA0A 4LR8A 4NX9A 3CCSS 1C4AA 3WEEB 3V72A 3J80O 4NLDA 1HKGA 1JMTA 2B3TB 4DMZA 2UU9J 2RB7A 4QYZJ 4BVOA 3RZAA 1U7LA 2M88A 3D3BJ 1N34J 1NGDA 4M3WA 5AHXA 2VIXA 4UAUA 2VFSA 2A1JA 2HHWA 4N56A 3MEGA 1UFLA 3HFKA 3M6ZA 2UUAK 2EZZA 3J7Z5 2NR0A 2RDDA 5KG4A 3UCUP 3MMJA 1T44A 3TADA 4A2BA 4I2QA 8ICUA 3CWJA 1O08A 4O5FA 2K7KA 3BGOP 1HBOA 2COLA 1WG8A 2FF6A 4LF8F 2FBTA 3J7ZO 4CYUB 1T11A 2F1IA 1B9FA 4I2QB 1TVRB 3BB5A 4P7TA 3QEPA 4QYZK 5JS2A 3GE1A 2GV9A 3VQDA 5EWEA 3J7A1 2ZNYA 1RGIA 4Z2XA 3THYB 1OXJA 1ZQQA 1NU4A 4F3MA 5LMUF 4H5NA 5JVHL 2RILA 3EEQA 2HQFA 4UQGA 5CR4A 3TA0A 1S1XA 4PWDA 2Z2MA 1FJCA 1SCJB 4DTPA 3SQ0A 3NGZA 1GNKA 4C3KA 5EE1A 2D0BA 3MTJA 2YWGA 1HJRA 4WFAQ 3T5KA 3CIMA 4D3GA 5J2BA 3Q24A 4YDUC 2VA2A 3UD4P 2R3VA 3ETOA 4J9OA 3K1ZA 2W4CA 3D2FB 4OZ3A 4C0HA 5LOQA 4YMEA 1SQKA 4IEEA 5LL6Z 4C4RA 4FJIA 1AYEA 3CPWR 1LW0B 1ZAVA 3L2UA 2OANA 4M45A 4CJLA 2P9PB 1MDUB 2QM1A 1V9OA 2DGSA 4ECTA 2B4UA 2YWKA 4F92B 3DM2A 2IHNA 3CMQA 2MQ8A 4TYBA 3NE6A 1CULA 3CB4A 4JP8A 3BUZB 4L76A 3L4IA 4DJBA 4A2AA 4KTWA 3T6BA 1RM6C 4AXJA 4ZVSB 4JD2B 4DSIA 3FE1A 3PW0A 3HHDA 1ZQKA 3HI0A 4YOUA 4KH6A 3EWGA 1XO1A 5D4NA 3SMVA 4DF8A 4DUZJ 4AQYF 1E4GT 3DYAA 2E1ZA 1FJGK 2Z0GA 1X4BA 1SIJA 1VQSA 4NLXA 3RVCA 1X66A 4FLYA 1FEZA 2EK1A 5FPDA 3TX8A 3GILA 1VS3A 3FZMA 2HS4A 3ZSZA 3QEWA 1Y9OA 4A8MP 4DCOB 1NM2A 1XIQA 4B1VA 5B0BA 2F8TA 5DB7A 2A2CA 1MQ2A 5BXIA 2VKZG 3SUQA 4ZKAA 3A5NC 4GLXA 3IBPA 3IAS9 3AVFA 3T3FA 4UAVA 3GDQA 4MQ3A 1HBOB 3N5BA 2VC0A 2QL9B 3OFFA 4JK9A 3UKRA 4MLEA 4HT5A 4KB1A 3Q8MA 2HQCA 3I4HX 3VQ9A 3AD9C 5DG7A 1FCAA 4KAIA 3N7RC 4K4GA 3BBCA 5C2DA 4A8WA 4Y34A 2GMHA 4UT4A 5I4MA 2W4PA 2XZWA 4KKOB 1FXXA 2GTDA 1H2TZ 3VVTA 2DFLA 3D7EO 1Q82O 2LLZA 3HOSA 2G09A 2KRRA 4AQYJ 3HHNB 2KVQE 3VC8A 2RNEA 3IBFB 1C0FA 4XEIA 4BRAA 3EZ5A 1AZSB 3K5PA 5J0XA 2EG1A 1WEXA 3T1HJ 3D1HA 3JSMB 3K5LA 1B0VA 2YY6A 2Y0SC 9ICCA 2Q79A 4JNEA 5KAFU 3ENOA 2ETJA 2QW9A 3IC1A 1WNEA 4RR5A 1S1UA 1Q5YA 2HQIA 4KHMA 1NOZA 3P45B 5A8RA 4RPFA 2HEKA 2LFVA 4CFCA 2RE2A 4JI6F 2MGZA 4M04A 3OTOF 2XTJP 6FDRA 4BC5A 4G1QB 1FKAF 4OPAA 3JTOA 2QX0A 4DXLA 3EM1A 1BMQB 3BSOA 1FTCA 1KONA 4FYWB 4GV6A 1Q3UA 2VICA 2XICA 2UXDJ 1JLCA 1G3OA 4EU0A 1H3DA 4I4BA 3D9BA 4UB2A 3M9MB 3MR6A 1RT5B 3MOJB 4FXVA 2VGMA 5IZHA 2AJ2A 1D8ZA 5AKEA 3TO8A 3PIOQ 4Z4CA 4R63A 4G65A 3J7YU 3DWLA 1NGFA 2BHNA 1NB2A 4M5IA 4YD2A 2W03A 3FMBA 4ILGB 1HUOA 2DNGA 1UWBB 3NVYA 2MHNA 3QU2A 2BR0A 4ZMMA 2GVZB 5CZ2A 1EB0A 2A6MA 3Q83A 4ATNA 3UO0A 3KK3B 4PA1A 2JSXA 3SAFA 3R6MA 2GO7A 1N5XA 1LVHA 3CNQP 5DM7Q 3I55S 2BKNA 3G6ES 2YMMA 1TL7A 2VWBA 1SJQA 2OP5A 4Y2TA 1HPZA 4BXOA 4DTSA 2CQDA 5FIIA 4H4MA 5B0EA 1KQSM 3NBPB 5HR6A 3E01B 3DOMB 3GYXB 3SFGA 4O4GA 4J9LA 4NLSA 2GMLA 3V2UC 2FVQA 2HGMA 5HSPA 2WK4A 3M9OB 3JTPA 3TARA 3T79A 2MQNA 2VC1A 1U4BA 2OMLA 5IC6B 5D8HB 4ALZA 2HQDA 4FJ9A 1NH8A 3H46O 3MGHA 3R3LA 2EFPA 2MKJA 1Y0HA 1WUAA 2K4PA 5AQPA 1RHJB 2C1EB 1SL1A 5C2CA 4KHWA 3PACA 4QCLA 3O1BA 3ULEA 1YI2S 1E6VB 1PUZA 4KMOB 4ED1A 1GOCA 5E84A 2ZHBA 1RACB 5IOLA 4N41A 1MC8A 3SQ4A 3LP1B 3C15A 1T6CA 1Q46A 3TUPA 1RYSA 1ZRNA 3L95X 4JV0A 1HBMA 3F44A 1QAJA 2EFOA 1A76A 4NWBA 5JLFA 5LMNJ 3RAQA 2WHOA 4DV2K 3B54A 4F5PA 2MJNA 5A6PA 1S49A 2R7XA 3HSTB 4F0KA 2DFFA 1E3MA 5IT0A 3MI7X 3IG5A 1HL6A 1XMQF 4O3QA 1WJ9A 3DDIA 2HBZB 4QWAA 4YB5A 3OL9A 4YP3A 3CGIA 1ASVA 2E9ZA 1XU4A 1KFTA 1DLOB 2GGPB 1IBCB 1B0XA 3DYAB 2V2QA 4HTUA 3EUNA 2PAVA 2DD8S 3ENVA 2ZJ5A 4B08A 4EK2A 2I9GA 1RT4A 4AF1A 1DBDA 3AFGA 3BF3A 3M30B 1RT1B 3OTEA 2RQMA 3DHWC 3VWSA 1D4XA 2WSEC 2IM2A 2YHWA 5HNKA 3NXZA 4ID8A 3LGHA 1VCTA 3JQJA 4USUA 4O8UA 7ICQA 1R43A 1TMJA 9ATCB 4UW2A 3DGPB 1P90A 1AXQA 4UW9A 2AHOB 1NM1A 4GV9A 2I5JA 1WNSA 3BGLA 4F2RA 1A6SA 4NXNF 1V3ZA 2F5GA 4TN2A 3NLCA 4ED7A 4ID1A 5K8OA 4ECVA 2Q4TA 3GV8B 2LYAA 4IOXA 2BE2A 4QWEA 4MIBA 4YQWA 2GWKA 2XS5A 3WZ0A 5J2NB 3MK6A 1O0PA 4A8SA 3R5JB 4C0BA 4H5RA 3KD3A 1XHZA 1NGAA 1RXWA 2VOOA 4CJVA 5DJBA 3Q8QB 1HBNA 4K4TA 3G2XA 4PY5A 4HVZA 2GX9A 1RI7A 3E9PA 1ILYA 2J9DA 2Z7JA 2ZJPQ 3VF0B 1TKTB 2QWNA 2I8EA 3I6PA 2XCAA 4JI3F 1C20A 3GONA 3NNAA 5GADI 1YLXA 5F8LA 3AA5X 1F3VA 4Y0FA 4ED8A 2HHHK 2QA4N 1BQMB 4GC6A 2WFAA 4EI2A 5BYQA 1DQAA 3HL8A 2VQEJ 3KLIB 4ICAA 5J2KA 4BRHA 1URNA 2O8FA 4WIIA 4HUFA 1WKKA 2J9CA 1IUJA 3M8ZA 2JH7A 2NQPA 4KITB 2QG9B 3FEZA 5HBMA 3SEOA 4OQJA 2JWKA 3MC1A 1BQXA 1RJJA 1W2IA 4P2XA 2KKHA 2YJEA 2R7QA 2J0XA 2OPQA 2ZM6F 1W7WA 1HUZA 3QEAZ 2H48B 4ANEA 2W2NP 5HQLA 4CI6A 2ASMA 1IBLK 3DU5A 1J5EK 1Q79A 5G4DA 5D49A 3FFIB 5CABA 1BPDA 2XMMA 2MZRA 4DQRA 5BR9A 2KH9A 4DV3J 3HKZC 3CMEN 3ZD9A 2KZMA 3OXFA 3C16A 3TVYA 5GINA 4LFAK 1FK9A 3O1LA 3ZT1A 1DHMA 4JKCA 4QPXA 4OHYA 2NRVA 5BRDA 4DPUA 4EYIB 1X9MA 1B43A 3B82A 1SV5A 3RB3A 4QS8A 3KNAA 3I55N 1J53A 2ATQA 2HFZA 4FJGA 3T5HA 4DDFA 3BS5B 3CPEA 1YJNN 2WMMA 2IM1A 1YJRA 4RQMA 3SUNA 4E3SA 3KHYA 1HMVB 1NGHA 4EFAC 1NK0A 4CIOA 4LIRA 1JRPA 3Q8VA 1L3SA 2MY8A 1RDCA 4NOHA 1N32F 1ZD4A 1WN7A 3ZT0A 1BD6A 1P27B 4JI7J 1ECWA 4C3MA 4DN0A 5HRRA 2ES6A 3ENHA 3ZNJ1 5F8GA 1U1OA 3O9SA 4CD3A 5TISU 1A7GE 2F9WA 3MPYA 4QIEA 1A0OB 1NK6A 1F0MA 2RRDA 4FO6A 3W2VA 2NRRA 2YJFA 4M3XA 2EC0A 9ICOA 1A5WA 4DU1A 1TKTA 4EUVA 4I2JA 1ZBHA 2IFXA 1FFUA 1ZPVA 2KB2A 3FMWA 1EAYC 2OTLS 3D6RA 4OYWA 3M30A 3I0SA 4DLGA 3ID8A 3EXYA 2CJAA 2V7YA 3GIRA 3EVOA 3G8QA 2DTJA 1VSMA 2H4WB 1ICEB 4KH1B 7ICSA 3RJGA 5DZ6A 1U1PA 4PHTX 3MEEA 5A2QO 1QD1A 4LH5A 1SQEA 2MLYA 1K8AT 1ED1A 4QWCA 1DFDA 2HLUA 2DGZA 4JB3A 4E1JA 2WAQF 2L08A 2FMSA 4UASA 4X4PA 2F8HA 4LFBF 3CD6N 5J2HA 3MEKA 3UN5A 5J0TA 2BJ8A 4KLQA 4MFAA 3VAIA 5GAGU 4JRQA 1FFVA 3TAGA 3ICLA 3THXB 1FWPA 4GVEA 3VR1A 1V85A 5ALNA 4QZHA 4V19J 2B9WA 4NWIA 4RZRA 1KS2A 5H1SV 2ZOGA 1X4AA 2W41A 2DRDA 5HAOA 2EBGA 1DXSA 4YMOA 3SFUA 4A4JA 4Y65A 3NGSA 1JI7A 4KLUA 3OSPA 2ACYA 1WI6A 2E1PA 3NVKA 4DL0C 4LR9A 4KHQA 1NZAA 4EEYA 3HZEA 3I31A 2JZBA 2Z30B 4QQBA 3HBTA 7ICHA 2ZJQL 3DI6B 2AMCB 4RW7B 2FY8A 3D2NA 1M5PC 1XMOJ 8ICVA 4AYBD 3QRRA 2O6KA 2C3UA 3IRWP 5B0FA 3MBYA 4IZ9A 5JVHQ 4LF6J 3EKUA 1RWUA 4NLZA 1KD1T 1P9QC 3MR7A 4P71A 1JCFA 1SJRA 3Q8PB 1Y3JA 4HUEA 4LREA 3FGVA 5EVZA 1GEHA 2KG1A 5T14A 2CIMA 5FROA 2UUAF 3KZXA 4JI6J 4Y6IA 3L4PA 3HKWA 2O8BA 1JQGA 3J7AN 1YG0A 2IOHA 4BC9A 2U2FA 3N5FA 4KRWA 1VQNN 1X8DA 3C0BA 2GVZA 2CH6A 3GYNA 2DBBA 2HOFA 3QEVA 2OZMA 1KAYA 2RVJA 2O8BB 3R5GA 3M2UB 3TQEA 3OS0A 1Q9YA 4KFBA 4R64A 5D15A 1FNOA 1FJGJ 3CC2N 1FK9B 2DXDA 2DPIA 3OYMA 1CJTA 4NASA 3F73A 4BDYA 5DM6L 4CF2A 3HX0A 3A0HU 1QH9A 2CZVC 4NZ7A 2XIDA 1ACMB 3S1TA 1ZD2P 1WWUA 4EBEA 4ZVOB 4QZFA 3BS5A 4JI7K 1CJTB 2GQ2A 2Q6CA 3S6EA 3QSYB 3MM7A 3QB0A 2GBZA 3ENBA 3M1VA 2HZAA 3EDRB 2YHYA 4CLZA 1KHVA 4AUKA 3ET6B 1U48A 1UP1A 2B9EA 2QRRA 4JS5A 4IXCA 3LP1A 4AL6A 5AQJA 1VLOA 3DRRB 5KG2A 4FVMA 2JGAA 1CXQA 5AI8A 4EFHA 1M90T 3ZD8A 4WP8A 4KHYA 4RW4B 4RW9A 3WT0A 1PSDA 4CP5A 2EXUA 5ETOA 4LRBA 5DBCA 3RYLA 1RBRA 1VI7A 1J6ZA 2E5JA 3V81B 4ECZA 2MEWA 2C42A 4I2EA 1NCLA 4MYTA 3M8PB 4CJTA 3LWMA 3MN6A 3R8YA 3QNOA 4PHEA 2HBKA 4KX5A 1TUUA 2UXBJ 4DR1J 3U6FA 1NEEA 2XO7A 4CT8A 3DLJA 2XG8A 2CPZA 5DDRC 2O8CB 3POTB 1RYUA 4O0JA 1H72C 1ZQJA 5ITHA 2IAJB 4C1NK 4PZVA 4NI2A 3TU5A 4JRPA 5FRNA 1Z05A 3GB0A 3AMZA 3V7LA 1M0SA 1S6OA 3QINA 5IIOA 1NLKL 3OPXA 5G5HA 4LIWA 2QB0B 1C1CB 2JEIA 3UCZP 4ZLLA 2C2KB 4A62A 5EOZA 4U96A 3G82B 4FPBA 4U7UD 4OMFG 4YY3F 3F5EA 4I2GA 3KK1A 4M94A 1TAQA 2XMWA 3FZKA 1NK7A 1RZTA 4GKKJ 4ACOA 4FM1A 1S6QA 5GMKa 3Q0AA 1N54B 4KLMA 4MKYA 2VQEK 1JL1A 1ZQCA 4YN4A 1Q7LB 3P31A 4PWWA 1R0BG 3RR8A 2JZBB 4FWNA 2VKQA 3D2EB 5ALXA 5KG1A 1ITPA 4XQ8A 4CFDA 1OH6A 1Z00A 5B0GA 4Z4EA 4EIAA 2F1HA 4EENA 4DPYA 2HZCA 4Y2SA 1U1KA 2QO3A 5AI9A 3F0NA 1H1VA 1KR4A 1KVAA 1B99A 2RSQA 5GAGI 1MA7A 2NUHA 2LM4A 9ICXA 4KY3A 3MAAB 2HNDB 9ICHA 3D0PA 4M5HA 2AV5A 2X7IA 1CS4A 3V9XA 4J8FA 4GW6A 2ALYB 2VA8A 1NHKL 3KKAC 4RQ1A 2FHKA 4JI4F 4RWTA 4FK0A 1N36F 1DTTB 4W90B 4E98A 4IRDA 3H25A 4WK1A 4A46A 1NG9A 1ZQWA 4WFXA 3PO4A 5BR8K 5SUHA 3N7PD 4USVA 1NZPA 3PX0A 5IT9Y 3AVGA 4C4WA 2DEIA 3AODA 5RUBA 3Q7BA 2V68A 1BWEA 3OXLA 2F7TA 4ZLJA 2NXEA 3SK3A 3QJJA 2VL1A 1SZHA 2K4EA 2F63A 3ZSYA 3KTQA 4I9LA 5DRKA 1FKOA 2G8UA 5KFVA 1MLAA 1L7NA 1VK8A 1DGSA 5E7OB 1LOUA 5KQ8A 2MSNA 3MCNA 5L39A 3I56N 4DTUA 4AHRA 4NLTA 3LPEA 2W7PA 3RBDA 4AM6A 3OTCA 1JLEA 5ALJA 4IDKA 4LFBJ 4DBQA 5BN9A 3TANA 3EVMA 2XMAA 2ZHAA 2HFSA 3DFEA 3DLHA 2IA0A 5L1KA 1EZZB 3MM9A 2L3MA 1LXNA 4G9ZA 8ICAA 4OGEA 1Q53A 4E89A 4CNYA 1WC5A 2LEAA 4DTOA 4JI0F 1N36J 2FZGB 3FRYA 2BJ1A 1RWOB 2J7WA 5F9LA 4WXOA 4YCXA 3MM7B 5JMNA 3QFPA 1KQQA 3QGPA 1PAEX 3KFWX 4NA2A 4C1NI 3ZZ0A 3MUMP 3CCQN 2VQFK 4R0EA 4PHAA 1EWRA 1HMVA 2ZJPL 4A5AA 2OELA 2VJUA 4K50A 2BVZA 2WVDA 3QRQA 4CGGA 2OFGX 7AT1B 3TR8A 2YQ0A 3A8KA 3KLGA 3OR1A 4IOAQ 4CYUA 5E5NA 3RGIA 4GVBB 2VJ4A 2XLKA 2QEXN 3I8DA 3P4UB 1BUXA 1ZA1B 2BE7D 1EETA 5A0YB 3US5A 4KB7A 2KT2A 5DLGA 2P6UA 3VEYA 1YITS 1SPBP 4ZPBA 4YMNA 2DCUB 3KJFB 2AF6A 5K20B 2K1RB 4HHTA 5KFIA 2DHHA 4IYQA 4C7YA 3ILLA 2YI1A 4NLRA 5FPMA 5DDMA 5ALMA 3L9ZA 4BROA 3C94A 4IH5A 1M5VC 4YFKA 3R5CA 4MIWA 3OJUA 5ETMA 3SV3A 1S1WA 1OH8A 4CGZA 2ZFHA 3D2FA 2DNLA 2QKBA 1ZTWA 3ZTQA 4DTRA 4M5NA 3AM9A 4KKOA 2H9ZA 1IH7A 1GO3F 5FP0A 3MMCB 3WKCA 4RQ6A 3AVIA 4LC9B 3NCIA 2ZITA 1UOCA 1B3TA 2W9MA 4KV8B 3UMGA 9ICKA 4EAHD 2C2RA 1HNIA 3VZHA 4X5VA 1NOYA 1Q8BA 2DFEA 3PFOA 3UNGC 5HP1A 5H9EK 3RBXA 1NRKA 2CPEA 3W2WB 4LF9J 8ICGA 4AHUA 4J9UE 3SJJA 1B92A 5ALTA 1JUDA 2OIHA 4USHA 3A3NB 2R7RA 4DUYK 3DLRA 4OJRA 4KGXB 3MXHP 3HHLA 1U2CA 5HJYA 2HSEB 3R5AA 3VN5A 1PIEA 2J76E 3QU5A 5J0QA 2P9UB 3OBWA 2W3RA 3OR2A 1H7XA 1FI4A 4ZVTB 4B3SF 2BTFA 3OVAA 1XN9A 2DNHA 3FBEA 3BEXA 2IDOA 3CJ7A 1S6QB 1WCNA 3H8MA 3AJ2A 3IP4B 3QGIA 3AAQA 1GMVA 2CGKA 2WOMB 5BRFA 2XULA 1MWYA 3OQ2A 2WAQD 3QBWA 3P4IA 5FPNA 1ZZFA 1K44A 3NASA 4A5BA 2OWOA 2CJ9A 3QUQA 4C8KA 3BY5A 5GMDA 1TKXB 2CPXA 2WOMA 3D28A 3UMBA 2P6SA 2B8PA 3M2UA 4RUHA 1T3NA 1UPPA 3J7YI 3FDSA 4JI2F 2VCPA 3NVWA 4CF9A 1TKXA 4DEZA 5KPRA 4FF4A 2ZXIA 2J6TA 1F9HA 1QVFM 3OL7A 1EIYB 5CE3A 2F9TA 1UVLA 3CM6A 4ZPTR 1WEYA 4X62J 3N4PA 4GC7A 5AQYA 2RUSA 3AA4A 3I96A 4IQXA 2WF5A 1N61A 1IKWA 3UCGA 4PXEA 2VHGA 2L9NA 3EUB2 1UT5A 4P0PB 2P5GA 4OX9F 3KHRA 3CQ8A 3NBPA 2PMZD 1N34F 3KLVA 4BE0A 9ICNA 2PEHA 1DRGA 2KO1A 3R7BB 4LD0A 2UXCK 4ZVUB 4F0HA 2PKEA 4FVUA 1NMNA 4MTPA 4DR1K 2YKOA 3SSQA 3C7NA 2FVSA 3BF4A 2GO8A 5DETA 4CLFA 3QSIA 2VIHA 4F4XA 5J2CA 4CO0A 2FF3B 4ECXA 5AQWA 2QKKA 5AKJA 2BQUA 4DQQA 4B17A 4CHYA 1N5YB 3O9TA 4A47A 4ECSA 1JN3A 3PVXA 2C3MA 5HP1B 4KREA 4NRUA 3TABA 2MQLA 4DTJA 3NNHA 2H3FA 4Z6CA 3GYGA 2XSFA 1K1QA 4CDGA 1G15A 4LF7J 1UVMA 4Q7AA 3OYNA 3ILIA 3N4MB 3BR9A 1QE1A 1WKJA 1XC3A 4FE3A 1JLCB 3TSUA 3OS2A 2YPYA 4QIWD 3DDHA 3AH6A 2PA8D 2G13A 5LM7E 3QGHA 5HP4A 1F2GA 4E7LA 4CIFA 4K0KK 2UUCF 5J0YA 1T9WA 4NLCA 3O4QA 3MD3A 4DR5F 4TLRA 3PM9A 5AQGA 3IG8A 3EJMA 2D74B 1RTJB 1RHUB 4MH8A 2FHOB 3FM9A 4UARA 1VQYA 2BCSA 4QZIA 3IUCA 1N56A 5G0RA 3EGNA 3DN9A 2ITMA 1YJWN 2Q0ZX 4BUGA 5CB1A 3CDAA 5IWAK 4URSA 2BA9A 3TACB 2BMBA 4DR4F 2A5XA 4CFAA 2VBXA 2MPUA 3H3OB 1APSA 3OR1B 4M95A 1T03A 1X6IA 2FSKA 4FBTA 1UWBA 4PPZA 4R0JA 4RQ5A 1Z26A 1V6HA 2OPPA 1QSYA 4M3RA 4BG9A 1TFYA 3AVAA 3R6LB 2WC9A 2V4RA 4KLIA 3NVZA 2GIRA 2H65B 4XAKA 2V4JA 1JLGA 5ALDA 5F8HA 3IMXA 4Y28C 3UPFA 1U2FA 3MCOA 2Y9UA 3U3GA 1DK3A 1GLEG 3ITHB 1BNOA 4DSEA 4OHWA 3UD5A 3TWHA 4IG0A 4ZLPA 5J2QA 2HRYA 2Q3SA 2DBYA 2RQKA 4DF4A 4QWDA 3SCJE 2P9UA 3VCDA 4CEDA 3MAHA 4JI0J 3NGRA 2G2OA 2DHXA 1CI4A 3W2WA 4FPIA 3JYTB 2NPIA 4ZIWA 2FJXA 5AJ3K 2WF9A 4QJFB 2GUIA 2OCEA 1VQLS 3QZ7A 4NYPA 2DFHA 2JH3A 3H90A 3EICA 3AV9A 4ILJA 3JPRA 1T7PA 4KO0B 4W5NA 1NNLA 4FJ7A 4M3YA 4CNQA 3KLGB 2EDUA 3W0LA 1ZBFA 3VENA 4K42A 2WVBA 2GAGC 4IG3A 1HI8A 2HQ3A 4DL4A 2F4VJ 1NKEA 3PG9A 2IOCA 5EOYA 4WKYA 4BVPA 1K6YA 1HKBA 4NLVA 1WOQA 4FLWA 1FNMA 9ICFA 4QW8A 1WC1A 4KR0B 5BPLA 1UT8A 1NDLA 2LSNA 2D0OA 4IO9L 3WHIA 1RISA 3GIMA 3CT9A 4WKRA 1HA1A 4CI0B 3TUJC 5J0WA 2OUGA 4EZ6A 3WXLA 3PSPA 2AEFA 1X4HA 4BE1A 3E9OA 2POKA 5ADZA 3CPWM 1HW9A 5D0RA 1E6YA 4HLBA 3P5BP 4Y0WA 3MUTP 4CJUA 2HS3A 3W1YC 1X4EA 2DTUA 4ITSA 4RPXA 4EEKA 4G9BA 2ZDPA 2R9LA 2DGUA 4TY8B 2XI2A 4FYDA 3HJVA 2PFOA 2Q0UA 4RWXA 1E6YB 3V1OA 3NWGA 5AK4A 2C3OA 1PAUB 4CNZA 2V2VA 4OJGA 3HVTB 4X65K 2OSRA 5CHGA 1X4FA 3DRSB 2Y8YA 3GFZA 3NS7B 3SEIA 1VSLA 3C2MA 2K8AA 3D6FB 1WUDA 4IC9A 2W6LA 1JB0C 4MKBA 1VBZA 3RB0A 1F5BA 1URRA 2MLXA 2OTLN 2ZIUB 3H8YA 2W2MP 2HVDA 3M6WA