4F4KA

Dna polymerase i large fragment complex 6
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 198
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4kA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f4kA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4kA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f4kA01
4FLYA 4MF2A 1BPXA 1J53A 3ZSWA 4CJEA 1S6PA 4TQRA 3HP6A 3IRXA 4QWCA 1S9EA 3RBEA 2XO7A 1BI4A 4PWDA 3ZDAA 4BDYA 1LWCA 2HNYA 4CK1A 3OSPA 1ZBUA 3DOLA 5DDYA 4QCLA 4CF0A 1CUKA 7ICGA 4KFBA 4XRHA 3RAXA 1JL2A 1D8LA 4M3TA 4RQ4A 5J0UA 2G8KA 4YFUA 4DSJA 1X2IA 2C2DA 3T5KA 5JS2A 3DM2A 4FJGA 1VSLA 4BWJA 4FJHA 3IM1A 4LSNA 5KG0A 3MDCA 4QZIA 5DLFA 4C8LA 4QZCA 3OS0A 2WOMA 3KTQA 1RT5A 3MBYA 4CECA 3UQ0A 2FC0A 1K1SA 4CJRA 4CJSA 1JKHA 3RMCA 4FVMA 2X78A 4QZ8A 5C5JA 5E41A 3AVIA 3JPQA 4HCCA 3NF6A 3TFSA 5KFJA 4M9LA 1ZQAA 4J2EA 3L2RA 1WCLA 2BPGA 2IC3A 4KPYA 3WNHA 2OYQA 2DFLA 3DYAA 3AVAA 3Q8MA 2FMPA 4CJKA 3EYZA 4DQQA 3RJHA 3DRRA 2YHBA 4KO0A 5KG4A 3QEVA 4FJ5A 4LH5A 1KFSA 5HHHA 1KVCA 5DB9A 4CJWA 3KLEA 1SL2A 1BCOA 4HCBA 2VA2A 4Z4IA 3I0RA 1WNSA 4I9LA 1QSLA 4KTZA 2BPCA 3Q8KA 3NFAA 3RH6A 3L8BA 3DLBA 3V9UA 1NJXA 4PGYA 4Q5VA 5J2AA 4M3WA 8ICWA 5KG7A 3B6OA 3NAEA 4QZ9A 4O5EA 1L5UA 2W8KA 3ORYA 1L3TA 4O3NA 1VSJA 3C2MA 4IFVA 3TWHA 4J9LA 3MEGA 4C8OA 1ASUA 2AGQA 4FM1A 4HTUA 8ICRA 5HP4A 4F92B 3OGUA 3GQCA 1ZETA 2BCRA 4RNNA 5IIOA 4KREA 3KIOA 4QWAA 1IM4A 4YCXA 3KHGA 2AGOA 3RR7A 4CGFA 4MEYA 1Z26A 3U6FA 2W9AA 1VK0A 9ICRA 4GMJB 2BCQA 2BGWA 2FMQA 2DFEA 5DKWA 4KHSA 1ZQUA 1LW0A 4BDPA 1U47A 1BQNA 5KG2A 4B9VA 2V4QA 4IRDA 3VQQA 3MDAA 4NY8A 5DB7A 4OLBA 5J0OA 3WNEA 2PFQA 4I2FA 4I2JA 4PH5A 1D9FA 4CE9A 4O5KA 8ICKA 2WTFA 3DRSA 5F9NA 1S76D 3V81A 2F96A 5HP1A 2NUBA 1XI1A 4CF9A 3KHRA 1Z00A 3RR8A 1JLEA 4R66A 4H8KA 5L1JA 4DS5A 4KB1A 4P2HA 5KFXA 1RBRA 2O4GA 1LAVA 4I29A 4ECUA 1BIZA 2Z1GA 2RKIA 4CK2A 3SV3A 4EBDA 4YP3A 2P5OA 4I2EA 5KFHA 2BQ3A 4Z6EA 7ICTA 4JS4A 3UQ2A 4B9MA 1LAWA 3BJYA 4GXJA 5BOMA 3ULDA 3THVA 3SPYA 3QIPA 4CJLA 4M45A 5J2DA 4E1NA 5J2GA 2ZJAA 3LWLA 4UB4A 5J2FA 3TI0A 3KD5E 3UXOA 4ECYA 4RUCA 3ZCMA 1FXXA 1UWBA 7ICRA 2PFNA 1NK0A 4Y1CA 4PGXA 2QXFA 3LAMA 3V1OA 4KLTA 1A76A 1FKOA 3O3GA 5FDLA 4B8CA 3AVMA 3DI6A 4FM2A 4DQPA 9ICMA 1RT7A 3QO9A 1S1XA 3V6HA 3Q8QB 4AILC 8ICNA 3QZ7A 3PO4A 4RQ3A 1TVAA 4DFJA 3BGRA 3HXMA 3MXJA 1XHXA 4NCAA 4CF2A 4IQTA 4DSKA 5J2KA 2UVWA 1ZQJA 2JEGA 4Q0BA 3TAPA 1RDDA 4RUAA 2G8FA 2ATLA 1CLQA 2ZUDA 5J0WA 3ASMA 1J5OA 4KLMA 4JWMA 4IQUA 1Y97A 1NK8A 5DG8A 1XS9D 3KK1A 4IG3A 3KLGA 4NXZA 5J1EA 1CEZA 3UXNA 1ZBHA 1L3VA 2YNHA 1RXVA 4TQSA 4ECZA 9ICIA 3C2KA 2XRIA 3GV5B 1ZBIA 4PPXA 1D5AA 1C1BA 5IIKA 5IINA 4FJ7A 2MUTA 1IKYA 4XQ8A 3PR4A 3M9NB 2VWJA 4RT3A 4QWBA 4FJNA 2DFFA 3OYJA 3HVRA 1TL1A 4BGDA 4KTWA 2BQUA 3AA5X 4J2BA 4DOBA 2VA3A 4DFKA 2B6AA 3OYLA 4NLZA 4QWEA 4CJ3A 2FLLA 4N76A 2BR0A 3PX6A 4M3UA 3KKSA 4I28A 5KFPA 3HWTA 4I2QA 4F8RA 1IO2A 1JLAA 9ICSA 4BDZA 3AO5A 1U49A 1IKXA 3NBPA 5CB1A 3AVKA 4ZH4A 4LVSA 3VQDA 4IKFA 4RQ0A 5DB8A 2LSNA 3C95A 5FRNA 3V6DA 4UBCA 8ICMA 2PFOA 4DWIA 4LZDA 4YXMA 9ICTA 2D5RA 2QKBA 3KK3A 1HMVA 2HHSA 2XCPA 1KVAA 5D3GA 9ICHA 3QEPA 1ZQFA 3V7LA 2ALZA 4F4KA 3SI8A 3ZT0A 1QHTA 4O0IA 1Y88A 2Z1IA 3Q8RB 3PV8A 3AVFA 2HHWA 3KHHA 4CFCA 7ICEA 5L1KA 4DFMA 4F5NA 3PVXA 4UAYA 4UB1A 3M8QA 4NM1A 2DTUA 3RJGA 5EU7A 8ICGA 2C28A 1HUOA 2G8VA 2G8UA 4KN4A 5I42A 5J0PA 1WSGA 3B6PA 4ED2A 2ISOA 4QWDA 4CESA 4JV0A 3MAQA 3ZSYA 3V4IA 4BE0A 1ZQPA 3NE6A 4E7LA 3MGIA 4G3IA 1SL1A 5KT6A 9ICXA 4CHYA 1ASWA 4F5QA 3OYMA 1SL0A 5DGBA 1BPBA 5KFEA 4EBCA 2P66A 4J9QA 1HNVA 3TQ1A 1B43A 5IIIA 4KLQA 4DFPA 2XY7A 2FBVA 1NJWA 2KFNA 1YVUA 5KFWA 1O1WA 5JS1A 4QZBA 5EWFA 4GLXA 5L1LA 5BOLA 2DPJA 3KD1E 3LP0A 4M47A 7ICOA 3ZT3A 2VANA 1X9MA 3HO1A 4PA1A 3V9SA 3DMJA 2LYHA 4MFFA 4WE1A 4QZHA 3T19A 1ZQOA 3OYGA 2Q3SA 2R7YA 2JEFA 4K4HA 2UVRA 4DEZA 4DQSA 3C2LA 4RNMA 5C25A 5EWEA 3OYIA 2B4JA 1T8EA 3C5GA 3SPZA 2OPRA 4IFYA 1L3SA 4YFKA 4YR0A 2HW3A 4CJUA 4HUFA 1ZQEA 1VSDA 4O5CA 4L8RB 4M9NA 2W9BB 3ZSZA 4BE1A 2R8KA 3KJVA 1HQUA 3PW2A 3SI6A 4P4PA 3JPOA 2G8HA 1WSIA 1V9PA 1TKZA 5J2PA 2C22A 3JPTA 1RCHA 3NCIA 3GIJA 9ICBA 5KFUA 1ZQMA 5D4BA 1ZQSA 4CERA 4CIEA 8ICQA 2A1RA 3T5JA 3IHQB 5CHGA 2D0BA 2JZBB 4J9NA 1HQEA 5KGWA 1ZYQA 4KLOA 4KTQA 1KFTA 8ICTA 4E0DA 1TGOA 3H4DA 1Z3EB 3HPOA 3MR2A 3I0SA 1ZQZA 4IRCA 1H38A 4CJTA 1YTAA 4JK1A 4ECVA 4CEOA 4CEQA 3MFHA 4NM2A 4YNQA 5KFIA 2KZMA 1JMSA 2DY4A 2PY5A 1N48A 4DQRA 4FJ9A 4B08A 2R8JA 3NTUA 1XU4A 4DL4A 9ICVA 3C23A 3NF8A 4FJMA 3RB3A 3OYAA 1S97A 4IQVA 1UA1A 5DMRA 1ZQXA 3VQAA 5HRSA 2QKKA 4M41A 2HVIA 4R5PA 3QEIA 4KLEA 2XCAA 4AHRA 1WSEA 1NOZA 5KI6A 4HHTA 7ICUA 1D8YA 5J2NA 4DG1A 1NK7A 1LW2A 8ICIA 2UVVA 5J0XA 3QEXA 1KCFA 4O3OA 4FK4A 2VG7A 2IHMA 1A5VA 3VQ9A 4GVMA 3N4MB 2J6TA 3H08A 4M2YA 2VG5A 1S1WA 3K5LA 5J2CA 2PZSA 3SQ2A 2PYLA 1NK5A 5J2JA 4ECXA 3C6UA 1COOA 1XWLA 4DTSA 4YXJA 3TANA 1VSMA 2BGGA 4PHAA 4AHTA 4ED0A 4B3OA 1WLJA 2AGPA 1TFRA 4FK2A 1RPLA 1EX4A 3ALYA 1S0VA 3RJEA 4M42A 3OYCA 3HYFA 3K5OA 4TUQA 3AVHA 1XSPA 3HK2A 3VA0A 5CR0A 4K4GA 4M0AA 1SZPA 2JEJA 1ZBFA 3HP9A 3TAEA 4R64A 4ID1A 1XHZA 1IKVA 1CXUA 3VQBA 3SQ1A 4JWNA 3GFKB 4YMNA 3TAMA 5FROA 5HRPA 3OSNA 2YHAA 1TVRA 2XHBA 4Q8EA 8ICOA 2F8TA 4FLTA 4BE2A 4F2SA 5JUMA 2RDIA 4FS1A 3PW0A 5HHIA 3BQ0A 4BXOB 4CCHA 5DG9A 4RZRA 1B9DA 4FJKA 1IKWA 4OKKA 3OYDA 1VSFA 5DBCA 3S9HA 2G8IA 4OPJA 1I39A 4CGJA 4FK0A 4R63A 2FPMA 2KQ2A 1C0UA 3ZSQA 4RQ8A 2BE2A 4E89A 2PI5A 3RMBA 4YG2A 3LAKA 5KFNA 1JN3A 4QZGA 3TAGA 4CHNA 4MEXA 2Z1JA 5C42A 3QLHA 4DTOA 1RZTA 3DLEA 3SYZA 1S77D 1JLCA 1WSFA 4RW6A 4PHPA 3K5NA 1HYSA 4DOCA 1MC8A 1HUZA 3AU6A 4DOAA 2B21A 3JPRA 1K1QA 4F5OA 1YTUA 4CEEA 3PW5A 2FPLA 4CJ5A 4ECTA 4XA5A 4JS5A 4W5NA 2I1QA 2YNFA 4KAZA 3PMNA 5CP2A 3ZDEA 3HJFA 4F93B 2BANA 1R0AA 5BPCA 4JRPA 3RTVA 2OPPA 3V1QA 3AVBA 4E7HA 4EZ6A 5KT7A 8ICFA 2XGPA 3OYFA 3RB6A 1RTHA 3AVJA 4OKEA 3F9KA 3ISNC 3GIMA 3NDKA 1FK9A 4MQ3A 5C24A 4QZFA 5HBMA 4FBUA 5J2QA 4F3TA 3OYHA 2IA6A 3RJIA 1VSHA 3VQPA 3RWUA 3LALA 3NF7A 3SUNA 3NH2A 3H7IA 4CJ4A 2XY5A 1TAQA 4OGEA 3ETLA 4J2AA 4AHCA 2Y1JA 4Z4FA 1EXNA 3M8RA 4XUSA 4F4ZA 4CIGA 4CJPA 5KFVA 7ICJA 3CFPA 2FBXA 3H8WA 3PX4A 1MU2A 4C8KA 4KB0A 4CGIA 3UPQA 4M04A 2FMSA 2W8LA 1RDAA 3RMDA 4ICLA 1ZQNA 9ICCA 4K4IA 1NJZA 2VWKA 3RRGA 2YKMA 2DFHA 4KHYA 1NKEA 1W0HA 4ECSA 4KITB 3H40A 7ICNA 2P5GA 4I2PA 1WSJA 1A77A 3SJJA 2IGIA 1TKXA 1N56A 1KVBA 3DOKA 5DQGA 1RTDA 4CJVA 3QNOA 1RBSA 1XSLA 4J2DA 2ZQBA 2E6LA 2ZTDA 4OLAA 1RTIA 3I8DA 2W9MA 3AA2A 2VG6A 3RB0A 3ZSOA 2JGUA 4YR3A 4DTRA 1C0TA 4QAGA 5KFBA 4UB2A 3S3OA 3SV4A 1S0MA 1EETA 4IBNA 4AHSA 3RMAA 2ETJA 4KLDA 5KFOA 3HPGA 1ZQVA 4MF8A 5DG7A 7ICVA 4DL5A 1TV9A 4GXKA 1WN7A 4TUPA 3TAQA 3LK9A 1T3NA 4FLVA 4DF4A 1QSSA 5DBAA 1JXEA 4DU1A 2RPIA 4OPKA 1SKRA 3P5JA 4E3SA 3HVTA 2FBYA 1RT4A 4CJQA 9ICEA 4TUSA 2BQRA 1VSKA 2JLEA 5HROA 3OYKA 2H5XA 3V9XA 4N41A 4E7IA 3V9WA 3CM6A 5KFSA 2ZUCA 5SWMA 1HRHA 4CHZA 1J54A 4CFDA 1ZBLA 4KLUA 3OHBA 1LV5A 1J9AA 4FLUA 1JL1A 4Z4CA 7ICFA 1MQ3A 3B0YA 2P6UA 5K14A 7ICLA 3Q8PB 3MXIA 4ID5A 3Q8SB 1TK8A 5KTQA 4KN7A 4PQUA 4NLKA 4O9MA 3EZ5A 3G10A 4O4GA 7ICKA 3AV9A 3L3UA 2FLPA 1B92A 3MGHA 5J2IA 5J29A 1XO1A 3OVNA 1VRTA 4F5RA 4FS2A 3K2PA 3TAFA 5CZ2A 4FJXA 1ZQBA 1T05A 4QOZB 9ICLA 3ZT2A 5KFQA 4O3SA 4RW8A 2I5JA 2P6RA 5CY4A 2YV0X 4QW8A 3EPIA 5SZTA 3BQTA 2GUIA 3K4GA 4GC6A 1SV5A 4MFBA 2P51A 2R8IA 3NF9A 1X1PA 2Z1HA 2W9CA 3HPHA 3K57A 4J9KA 1LB2B 9ICAA 1IH7A 3AVCA 1XC9A 4G1QA 4MFCA 4X5VA 4F4WA 4ED6A 2BKEA 4CIFA 4BXOA 2D0CA 5F9LA 2ASDA 1GOAA 2IDOA 2ZD1A 3CQ8A 3AO1A 2W9CB 4KV8A 4RU9A 3JPPA 3AO3A 4I2BA 4RW7A 3RB4A 2D0AA 4DL6A 1RILA 4N47A 4E7KA 4DS4A 5KG1A 9ICOA 5DB6A 1REVA 4HUEA 2KTQA 3ISBA 3JPSA 3M8SA 5KT5A 3IS9A 3KLFA 3EPGA 4ELTA 3T5HA 1JLGA 4CJFA 4IQWA 4R8UA 1NJYA 4KHQA 1NK4A 4EYIB 4UAWA 3KLHA 3SQ0A 4ELVA 5DQIA 1WSHA 3FFIA 4KKOA 5HMLA 1ZQWA 5FRMA 2I9GA 3PUFA 2HNZA 3HT3A 1ZQGA 1KSPA 4KLSA 3TR8A 8ICLA 3SNNA 2FBTA 3Q8LA 3AVNA 3ZT1A 3SUQA 5KFKA 4EP4A 2PYJA 1SKWA 3E2EA 5EOZA 1GOCA 1JLFA 3IAYA 3PX0A 1JX4A 4M9HA 1TV6A 5KFRA 4KHUA 8ICCA 4DF8A 4RQ1A 9ICFA 1U48A 4C8NA 3NGDA 1Q9YA 2E4LA 1RBUA 3O4QA 3C1YA 3TFRA 4IRKA 3PW7A 5KT2A 4DQIA 1BISA 3HSTB 3L3VA 1QE1A 2ISPA 5J2HA 4DU4A 4KRFA 4F91B 1WAFA 2IAJA 1BPEA 2AQ0A 3N97B 5TZVA 2KW4A 3B0XA 4CHOA 8ICPA 4W5OA 1KFDA 1RXWA 2J6SA 4FM0A 4CFAA 1ZJMA 1S5JA 3LPTA 5D49A 3VQ6A 3V7KA 3MR3A 2F1HA 1S0NA 3GV7B 1NOMA 8ICAA 4M6WB 3LZIA 1VSIA 4DL2A 5CZ1A 3VA3A 4DL7A 4FO6A 4I2CA 3O4NA 4FJ8A 2YNGA 3MEDA 4FJJA 1RYSA 3C94A 2OWOA 5KFFA 4RQ6A 3S3MA 1S10A 3JSMA 4J9RA 4ZHRA 2FPKA 1DTTA 2NRXA 2HHXA 5T7BA 4ED1A 4AHUA 3VQ5A 4R8UB 1C1AA 4C8MA 4Z4EA 3U3YA 3OYEA 4CF8A 2X6NA 1PZNA 2A1SA 4RQ7A 4O44A 3G6XA 1Q9XA 3GIIA 3QETA 4Q44A 3ZDCA 5KG5A 3EWAA 4B9NA 4OGCA 3U3GA 4W5TA 4FBTA 2IBKA 1GOBA 5KFGA 4OVLA 4LD0A 4GW6A 3D45A 5KFYA 4F4YA 3LDSA 3LP3A 3PR5B 2F8SA 2ZTCA 2OZSA 4KLHA 4XIUA 3OHAA 4YD1A 3O3FA 4RPXA 4ZTFA 4ECRA 1NKCA 3HL8A 1DTQA 3ITHA 9ICKA 4I2HA 4ED8A 3GV8B 3MABA 1ITGA 1U45A 2V4RA 4DSLA 4JLHA 5L9XA 1IG9A 2XY6A 1C7YA 1IXRA 3TABA 1S0OA 4RG8A 4O3QA 4GC7A 5KRSA 3SQ4A 4LSLA 3RJKA 4ED7A 3P83D 5CJ7A 3VQ8A 1NOYA 5KGXA 4RNOA 1JXLA 2BCVA 2P1JA 5J0RA 3CFOA 4YQWA 3HM9A 2C2RA 4K8XA 2HHQA 3JYTA 4KLJA 1BPDA 3K58A 1X9SA 5J0QA 1CZ9A 4BWMA 5KFAA 1UA0A 3UIQA 2HVHA 1WCNA 2BCSA 4UAZA 1N6QA 5CYQA 1ASVA 1L3UA 4AH9A 5J0YA 4KLGA 3VQ7A 3C21A 3HX0A 4NLNA 1MSWD 3V1RA 2AQ4A 1Q8IA 3RH4A 4EEYA 4IG0A 2G8WA 5HLFA 4O55A 3BDPA 3ISDA 4DO9A 4UB3A 4NCBA 4NLGA 1ZQDA 4M9GA 3V6JA 1BHLA 5KFZA 1HYZA 4NYNA 4FZYA 3DLHA 8ICVA 2OPSA 3P1GA 1ZQLA 3EY1A 1T7PA 7ICQA 1TKTA 4TURA 3QIOA 1BVSA 3LANA 3LP1A 4RT2A 3VQ4A 3WNFA 1A5WA 3GIKA 4YN4A 4DSIA 4YVZA 3K5MA 1EP4A 1HYVA 1HJRA 4O3RA 3ZT4A 4F5PA 4I2IA 2W42A 4NCGA 4HVJA 4YMMA 2IS3A 3RRHA 3AO4A 1UOCA 4N56A 4ECWA 4KI6A 1ZQHA 4E19A 4DL3A 9ICJA 2EX3A 1G15A 4ED3A 4IDKA 1MQ2A 4Z4GA 2HHVA 5DBBA 4Z6FA 1ZQRA 3NHGA 4KHNA 2ZTEA 3C6TA 4O5BA 4FYDA 2NRVA 4B9SA 5KG3A 4MFAA 8ICEA 4IR1A 3A2FA 4RQ2A 5KT4A 4M6WA 2ASLA 3C1ZA 3NGYA 4FJLA 2R8HA 4F3OA 4B9TA 4J9PA 3L2WA 1ZQTA 4PGQA 5IILA 1TK5A 4GXIA 5J0SA 1KEJA 3C5FA 3QNNA 4CEFA 5HMMA 7ICMA 4DLEA 3DRPA 3VN5A 1NKBA 1BIUA 1BI4B 4CEBA 1EXQA 1X9WA 3ZD8A 3T1AA 2YNIA 3RJJA 3KLIA 4DLGA 8ICBA 4M3RA 3OJSA 3F73A 2GV9A 4JUZA 3QEAZ 2XGQA 1KDHA 7ICHA 4NYFA 2Q0ZX 1I3AA 1S6QA 4DSFA 2HHUA 3ZDBA 3BQ2A 1F21A 4UB5A 4UQGA 8ICSA 3LPUA 4CGHA 3AA4A 4TSXA 2YKNA 2HNDA 4Z0UA 4RQ5A 2JZBA 4FLZA 4RPZA 1RTJA 1RT1A 1BGXT 2Y1IA 5D46A 4H4MA 2HB5A 3PNCA 1ZQKA 4F50A 3AUOA 1DGSA 2NRZA 2F1JA 3VQEA 3D0PA 2GBZA 5I3UA 3CYMA 1TL3A 5IIMA 1VRUA 4DTUA 1WAJA 2KZZA 1TKDA 5DQHA 1XSNA 4QZEA 4UBBA 2DPIA 4CF1A 4J9OA 3V6KA 4P4OA 1A5XA 4J9MA 1ZQQA 2X74A 2OPQA 4KLLA 4DTMA 1QTMA 1C1CA 4Z4HA 5KFDA 3LZJA 1HJPA 2ZJ5A 2B5JA 4M3YA 3H8SA 4B9LA 5KFLA 8ICHA 1SUQA 1UAXA 4EYHB 3AVLA 2FLNA 3GILA 1S1VA 3OJUA 4W5QA 1Z00B 1KLMA 5HRRA 9ICWA 1KRPA 1BL3A 1DOQA 4FZZA 3UXPA 4E1MA 1RDBA 1QS4A 2IHNA 2XC9A 4YR2A 3S3NA 2HMIA 2RN2A 4I27A 2ZJ8A 3LP2A 8ICUA 1N5YA 3V72A 4N5SA 4CK3A 3G6VA 3PW4A 5EWGA 3L2UA 1TAUA 3DLKA 2ZE2A 1CXQA 4IR9A 4QZAA 1C6VA 5DDMA 1S1UA 3G6YA 4DTPA 4ZTJA 1B22A 4LH4A 3KHLA 3JPNA 2BPFA 3SUPA 1BPYA 4DU3A 2RDJA 5L1IA 1ZJNA 3E01A 4RPYA 1KTQA 1RYRA 3BQ1A 3M9MB 4JV2A 4F2RA 3DLRA 4KLFA 4M9JA 1C0MA 2RF2A 2VA8A 3AVGA 3H8JA 4EP5A 2PFPA 3ZSVA 3EW9A 5DK5A 2AU0A 4FZXC 1RT6A 3HW8A 1U4BA 5DLGA 5HRNA 1YT3A 4AHVA 2PXIA 2BDPA 3MXMA 8ICYA 4CHPA 3H4BA 9ICPA 2X6SA 4I2DA 4EBEA 4FXDA 1B9FA 9ICQA 2OZMA 2HHTA 2PI4A 3MECA 5J2MA 4DTXA 2KFZA 8ICXA 4Q43A 3T3FA 1HNIA 5CYMA 3OY9A 4PUOA 3AU2A 3QINA 4I2AA 3L2QA 7ICSA 3KKRA 5CA7A 4B9UA 1D9DA 3ZDDA 4H4OA 3MR6A 4CEDA 1EKEA 1K6YA 2J6UA 2AJQA 4RW4A 3FDSA 2IMWP 4RW9A 4KI4A 4PHDA 1S1TA 2QK9A 9ICUA 2NRWA 4FCYA 4DTNA 4KMUA 1RBTA 4PY5A 1U9LA 2BHNA 1ZQIA 4Q8FA 1CZBA 4CHQA 2F1IA 2OA8A 4OJRA 3V7JA 3ZD9A 3T5LA 4O0JA 4E7JA 1JLQA 1RT3A 1ZQYA 5IIJA 2MAXA 2BCUA 2ASJA 2MUTB 1HPZA 4CEAA 4I9QA 9ICGA 1DLOA 1S9GA 9ICNA 2A1JA 2JEIA 3MR5A 7ICIA 4M3ZA 4JV1A 3M9OB 3NH1A 4HUGA 2E6MA 1T4GA 3V9ZA 4W5RA 2A1JB 5KT3A 2C2EA 3ZSXA 1JLBA 3RAQA 4FLWA 5J2EA 3MFIA 5KFTA 4CGGA 3NGZA 3CFRA 5DGAA 2V9WA 4FW2A 3OS2A 1LWFA 4QZDA 2UVUA 2ATQA 4Z6DA 3QE9Y 2W9BA 4LY7A 3IG1A 3PMLA 1T03A 5J2BA 3M8PA 3QEWA 4M3XA 2XY8A 1QSYA 1FKPA 2EHGA 3CM5A 4I7FA 5HNKA 3WNGA 3KK2A 3SUOA 4Q45A 4CEZA 3RJFA 3VQCA 5KFMA 8ICZA 1NK9A 1AROP 1UT8A 3K59A 3RBDA 1W9HA 1TK0A 3O3HA 5KFCA 5KRTA 4J9SA 3TARA 3QEBZ 1BPZA 3AA3A 4R65A 4F4XA 1QLNA 4JRQA 3LDAA 1LWEA 2ITGA 1Z25A 4HYKA 4KLIA 4LZGA 1BCMA 2NRTA 1QQCA 4BACA 4ELUA 3GDXA 1SKSA 3K75D 4CGDA 3RH5A 4PHEA 4K8ZA 3QESA 2WONA 5J0TA 2ZUBA 1U04A 1BQMA 4EZ9A 5KG6A 1S9FA 4CFBA 4DTJA 2IOCA 3PO5A 1RNHA 4I2GA 4P4MA 4DSEA 4YMOA 3DLGA 2M9NA 3LWMA 3PY8A 1VSEA 1JXBA 1RBVA 2O4IA 3ISCA 1UT5A 7ICPA 4ECQA 4B8AB 1JIHA 4FJIA 3MEEA 3FYHA 1ZQCA 3G0ZA 3AO2A 4Y1DA 3ZSRA 3NGIA 8ICJA 3OYBA 1RT2A 3CG7A 4FW1A 4O3PA 5CWRA 4FLXA 2KZ3A 3QZ8A 1NK6A 1KLNA 4OKJA 3OS1A 4YD2A 4Z6CA 3QERA 4KHWA 3SZ2A 2GWSA 3L2VA 2R8GA 3NH0A 4DMNA 2KN7A 3OYNA 3SCXA 4QW9A 1RDCA
chains in the Genus database with same CATH superfamily
2YKAA 4B3RK 2PFUA 5I9EB 2OD4A 1J53A 4CJEA 3O08A 3HP6A 3IRXA 1IJJA 4N8OA 1QD1A 5AM1A 4IOAQ 2XO7A 4WXOA 2CQ0A 3BBBA 4BDYA 2HNYA 4DV6F 3ZX0A 4USAA 4ZVQB 5ALVA 1ZBUA 2DHGA 4NEZA 1FE0A 4XRHA 3RAXA 3QRRA 1JL2A 1D8LA 4BC7A 2P9PA 4M3TA 5ALSA 1RKJA 3J7ZO 4YFUA 4DSJA 1Y11A 1X2IA 5A8RB 4OZ1A 4C1NI 4LRFA 4X4UA 3MMBA 4RBVA 3W2WB 4IUFA 4FJHA 4LSNA 1BNPA 1S22A 1UETA 4M5GA 4QZIA 4M5LA 1RWMB 5BJRA 2WOMA 3KTQA 3UQ0A 1OY6A 4ZA1A 4CJRA 4CJSA 1Q1KA 2C3PA 3WXMB 4R25A 2E3TA 3KFWX 5E41A 3JPQA 4HCCA 1CJTA 4PQUB 1ATNA 1WCLA 4KPYA 4DX6A 2OYQA 3J80O 3DYAA 3AVAA 5K14B 3TEHB 2WVBA 3KNAA 3L3FX 4CJKA 3EYZA 4ZCLA 4EI2A 4BC5A 2WAQD 3DRRA 4BLGA 4PG8A 3QEVA 2HVDA 2PIIA 2V52B 2V7ZA 3KLEA 5HHHA 1KVCA 4HCBA 1BCOA 5J1EB 1OW5A 4UAVA 3OTQA 3I0RA 3FBBA 4JI2K 3HX9A 4ICAA 3Q8KA 3RH6A 1HFEL 4DCHA 1ZM3A 3QJJA 4N7TA 2O8FA 4KHPJ 5J2AA 1R0AB 3TYTA 8ICWA 5KG7A 3B6OA 3OUYA 1EJ7L 1U26A 5HMWA 4O5EA 5AFUA 4KE5A 4GKKF 3LA0A 2KHQA 5D0HA 2E5JA 1X4EA 1YJWN 2R18A 2HPUA 2A2CA 2CKWA 2E5SA 4LSNB 4NYZA 3PIPQ 1ZOLA 3KBBA 1S1XB 3TJAA 4FM1A 1RT7B 4ZP9A 3V4MA 8ICRA 1HR0J 3KMQA 4F92B 3GQCA 4H4KA 1O51A 5HMZA 2IYIA 3H59A 2G13A 2HRUA 1S1UB 3CQXA 1NSKL 1IM4A 4EEKA 2W43A 3PRBA 1Z26A 1PCAA 1IXKA 4B3RF 4KT0C 9ICRA 3QBCA 1FFWB 2Z2MA 3ZXWA 1ZD3A 2VQFK 3ID6A 4QQBA 2DFEA 5ALKA 5DKWA 1ZQUA 1WG8A 3T1HJ 5HO4A 1BQNA 2VGNA 3VQQA 1E6VB 5DB7A 3QPIA 3UN2A 1Q18A 4E1JA 2AX0A 3J7A1 4I2FA 4PH5A 5HQ8A 4CE9A 8ICKA 1TVRB 3M2RA 2J8AA 2M9KA 3V81A 2F96A 3Q83A 2E2OA 2JXJA 2I7PA 3OTDA 5A6PA 4QR1A 2KT3A 2XG8A 5LL6Z 2HLUA 1TYQB 1XNSA 3M8ZA 5JRTA 1ZTWA 2DH8A 3CIZA 2XQCA 2DRAA 1JK9B 1BIZA 3B4DA 1I94J 2QTWA 1YVNA 3SV3A 5ELZA 4EBDA 2AJFE 2MGZB 2V9KA 4Z6EA 3UQ2A 2R7XA 4B9MA 2EZXA 1LAWA 2N82B 3BJYA 3ULDA 4HI2A 1WNEA 3SPYA 1ZA1B 1CC8A 4M45A 5J2GA 2BKPA 2KXHA 1NU0A 4LIWA 2WONB 5J2FA 2PMZD 1NGHA 3IAM9 1KHVA 2W6KA 4A5AA 3UXOA 4ECYA 4YB6A 3ZCMA 1UWBA 3SSRA 5F8NA 4Y3CA 1FXXA 5I4MA 1PBAA 2PFNA 2D9PA 3H8YA 3UWTA 3ET6A 3LAMA 4FKXA 1X4HA 3GMGA 4B1ZA 3I9V9 2Z2LA 5FDLA 3VGMA 3AVMA 1KN5A 3QT7A 1FIQA 3OBWA 3L3CA 4IOAL 1Q7YO 4DFJA 3C66A 4IFVB 2CQHA 2JC1A 1NGBA 4E98A 1MN7A 4FWPA 4NXMJ 2WSFC 3TAPA 1VBYA 4MKYA 4KHPF 4RUAA 2G8FA 2BXJA 2ZUDA 1WOSA 1FX4A 1VFJA 2C3YA 2DNOA 2VPXB 2XMMA 2DVIA 3D6TB 3LDNA 3CNHA 3WXKA 1Y97A 2E66A 5DG8A 4YY3J 4IG3A 2HWHA 3HT0A 1IR2A 4NXZA 4DCPB 3ENBA 2JRSA 1ZBHA 4NYPA 1RXVA 5AZJA 4CP5A 2Q1LA 1WKKA 9ICIA 2NR0A 4I0WA 5DZ6A 3R5GA 4H5NA 1ZBIA 4PPXA 1T9VA 1C1BA 2G07A 4PG7A 3B8HA 1XMOF 1IKYA 2IC3B 3L09A 4QWBA 4ZP8A 4FJNA 2KXNB 3HVRA 3DU6A 2HDOA 3WZ0A 4DR6K 3BYPA 2GOLA 5DDPC 2BQUA 2F3NA 1M6YA 4AXIA 4LFCF 4M95A 2B6AA 3NNAA 2OMLA 3OYLA 3J7YI 2EXUA 3JS9A 4K4XA 3PX6A 3PYFA 4F04B 3F2DA 3VAHA 4I2QA 2QARA 1WKJA 3FBCA 4CJ7A 3FSYA 1HNXJ 3AO5A 2F77X 1IKXA 3VF6A 1D3WA 5CB1A 3AVKA 2NXCA 1VQYA 3FMBA 4IS7A 1BG3A 1M90T 2A41A 4FXVA 1QZ6A 3V6DA 2YJFA 3QQCD 2ZC4A 3UNYA 1EIYB 2OAUA 1VQ8S 4LZDA 3QUBA 2BV3A 3IWLA 3QFHA 4IG3B 2D5RA 4OJOA 3BO4A 1YITS 3CJ0A 1ZQFA 3CD5A 1FEHA 1QHTA 2CG4A 2HIYA 4Y0WA 1RCOB 1Q7LB 3U1MA 1AQ6A 1OJ4A 3RW7A 1QQ6A 1JNZB 5HK4A 3M8QA 3CJAA 3RJGA 2O5DA 3BBCA 2LKYA 2D3O1 5F1XA 4C11B 2P8IA 1HUOA 2PMWA 2EANA 2C42A 4PZNA 4ILGB 5J0PA 4CF5A 1RT2B 2YPZA 4JV0A 3D2SA 2EI5A 2ZH4A 1WTFA 4BE0A 3N7RC 1KD1O 2XZTB 3LPYA 5KT6A 3MWPA 1VQ8N 1ASWA 1DQ8A 1SL0A 5KFEA 2P66A 5C0YA 2F9WA 4JK7A 4J9QA 1HBOB 1T9UA 4B3TJ 1KKHA 4CI0B 3NAIA 3TRGA 5CCMA 1YVUA 2E7VA 2E8MA 4NWIA 3AAQA 2OPRB 2HGNA 5THWA 5K8OA 3NWRA 5MAOA 2F8KA 4GLXA 3AOAA 3KLFB 4CE6A 1XNQK 4ZVPB 2DPJA 3LP0A 4M47A 1HR0F 2GGPB 1YF5L 3BEXA 1U0HB 4UW2A 3V9SA 1BMQB 4WE1A 3T19A 5GIOA 3GOIA 4LR9A 4JKFA 4FFDA 1TU0B 5T7LB 3C2LA 1DAXA 2ZEJA 1NGGA 4I2QB 2FVCA 1FRJA 5EWEA 1Q0NA 2ZD1B 2YBVA 1NLVA 1C1CB 2QL5B 1UPHA 4IFYA 3J81O 1ZQEA 1KVKA 3HILA 1VSDA 3N28A 4YUDA 3EEQA 2W9BB 1ZH5A 3ZSZA 1TE2A 3FK4A 2R8KA 4PQAA 4JYAJ 2ZXIA 1V9PA 3QU5A 5J2PA 1RUSA 5IT4A 2C22A 3EO3A 3AD9C 1MA9B 2DD8S 3MTJA 5D4BA 1ZQSA 4CIEA 2CPZA 3FSXA 3MAAB 5TKWA 3M1YA 5CHGA 3CJSA 4J9NA 3O9UA 3CXCR 1PJ7A 5KGWA 3E9LA 3X3UA 3CD6N 2LU1A 1KFTA 4I4BA 3CJKA 3MMCA 1HPZB 3IN5A 3I0SA 3KHYA 2YTUA 4HH0A 1QAIA 4JK1A 2MA1A 2GW8A 2VPYB 4NM2A 2A1BA 5EHHA 5KFIA 2XNRA 1JMSA 1N48A 3AXMA 1VQ4S 3OBYA 3KNGA 3TZYA 3NTUA 1SJ1A 5G0RA 9ICVA 5U47A 4JAXA 3KLIB 4A2BA 3TZXA 2HBMA 2NNWA 4OLOA 4FJMA 3R3LA 2CPJA 1NXIA 1LFWA 2XB2D 2CQBA 2ZIXA 9RUBA 5HRSA 3W9JA 3NWGA 2R4FA 4ED4A 3VTHA 1K8KA 5AXKA 3FVYA 2MRLA 1WSEA 4OD0A 5KI6A 4HHTA 1WHXA 3A4TA 1D8YA 2CNLB 4M1KA 2UVVA 1I51B 4H0YB 4WP8A 4FK4A 3CD6S 3VQ9A 4GVMA 1N33K 1BUPA 3K5LA 5J2CA 2PZSA 3SQ2A 3D3CJ 4ECXA 2ZIUA 3C6UA 3TTFA 4JBCA 3NY0A 4PL2A 4YXJA 4LFAJ 2ZWHA 3W0LA 4USUA 5D15A 4AM6A 4PHAA 5CD4H 4B1WB 5AQIA 1TFYA 2AGPA 1C4CA 4FK2A 2BYCA 2WRMA 1S0VA 4BRQA 3KUEA 3OYCA 1E6YB 2MSSA 5D4LA 3AVHA 4X62J 2GZOA 5KAIU 1Q16B 2YI1A 1KVJA 4H0TB 1ZBFA 2AKWB 4BJQA 4ID1A 1IKVA 4KFBB 1X6IA 4F71A 4YMNA 3TAMA 3CCSN 3MI7X 3IDWA 5HRPA 3OSNA 2BE2B 1TVRA 1VJWA 4K4SA 4BE2A 2DBBA 4FS1A 1F1BB 3PW0A 3ZFVA 3UE2A 1IVZA 1NNEA 4OJHA 1FJGF 4ICLB 3R8YA 1FJGK 1WG1A 1IKWA 4OKKA 4OIXA 1U2VA 3OYDA 3MPDA 4W92B 5CRXA 3R3TA 4BG8A 4OPJA 1I39A 2DXDA 4BC2A 2CPRA 3ONQA 1AUDA 4JYAF 4WJ3B 3M8YA 2KDOA 2B6GA 2BE2A 2G0JA 3E0FA 4YG2A 3LAKA 5KFNA 2DEIA 5C42A 3QLHA 2HFVA 4JI2J 3SD7A 1S77D 5KPRA 5AM0A 4PR6A 3VAIA 4PHPA 3QGHA 3K5NA 2HVEA 2NPFA 3DI6B 4DOAA 2VKRA 2P5VA 2B21A 4QOTA 1K1QA 3PTWA 2FVRA 1BA0A 1YTUA 3LVVA 4CZKA 2DF4B 4CJ5A 4ECTA 7FD1A 1OSCA 4JS5A 4MMOA 2WB1D 4AM7A 1YDLA 7AT1B 3CCSS 4JI0J 3PYDA 4HR2A 4BHQA 4YDDB 3IMQJ 2M70A 3OUYB 4AXJA 4JI5J 4MKAA 3M30A 1R0AA 5BPCA 4JRPA 2OPPA 5KT7A 2ZBCA 5L39A 3L4BC 3LGMA 1NZAA 4AP9A 2BOAA 3D1OA 1FK9A 5DS7A 4PKGA 2RKIB 4WFNL 3O3LA 1P7DA 4CGZA 1COKA 3OYHA 2GNKA 4EIAA 1HW9A 3H5YA 3LALA 2YX7A 1WB9A 4DL0C 2BUPA 3LGNA 5HROB 1QVGR 4AHCA 3H1VX 3MD3A 2DNMA 4Z4FA 1EXNA 2Q6CA 3M8RA 1NUEA 4PKDB 3P96A 5GADI 5GADP 1P9QC 5G0RB 7ICJA 3CEDA 3CFPA 4B3TF 4CDIA 2RQ4A 4LF7J 1MU2A 4URGA 4FOIA 2DL0A 4DR3F 4PXCA 4BRIA 1RDAA 3QFPA 2YHYA 2ITMA 1LWFB 2NRHA 4UUWA 1NJZA 2VWKA 5H9FJ 5KNIA 4KPCA 3H40A 4DR1F 4I2PA 1TKXA 3O9TA 3VALA 2R7UA 4CJVA 4C6AA 1ED1A 2FDNA 1RBSA 3LM9A 1TFWA 4FWSA 2E6LA 2VOOA 2P9PB 3UDLA 2KYXA 3G6EN 3AA2A 2VC0A 1RP5A 3VENA 4CO4A 3DOMB 3L9ZA 4US9A 4YR3A 4UB2A 2LLZA 3WK4A 2OYYA 3SV4A 4QS9A 3UD3P 3CCMN 2RT3A 4KLDA 3FCWA 2IAJB 1WEXA 1VQOS 2OP5A 1TV9A 4GXKA 3LK9A 4IFYB 4OZ0A 4M5DB 2ZH6A 5DBAA 3P45B 1M1KT 4DU1A 4W4MA 5E5NA 3NS6A 4RW4B 1WI6A 5M1OA 4E3SA 2FBYA 5T7LA 4CJQA 4TUSA 2CGKA 3V9XA 4JB8B 1BHNA 3M32A 2H51B 2MKIA 3EE8A 1SXLA 5SWMA 3SDEA 5J2MB 4CFDA 2CDRB 2J0SD 1LV5A 2HQDA 3CCZA 3UDVA 2JL9A 2HZAA 3L7PA 7ICFA 3MCSA 3B0YA 2P6UA 3DGPA 3CJ7A 4KN7A 1S57A 4NLKA 2WZ1A 2QXLA 3WX4A 1TAMA 2HBJA 3EZ5A 5KQ8A 5AK4A 5AKZA 2RUGA 2VASA 4O4GA 3L3UA 3MM6A 3MM8B 1CRXA 2N3LA 4B3SJ 1CBKA 3MGHA 4DV3F 1B3TA 3OVNA 1UFLA 4OI2A 1H7WA 1VRTA 1BXNA 2CJXB 3MDFA 1ZQBA 4QOZB 9ICLA 3ZT2A 4RW8A 4DPWA 4DR6J 5CY4A 5FJ4A 3FZ2A 4QW8A 3C16A 4N77A 4OI3A 3VV2B 5GAEI 2X1AA 2Z1HA 1KXPA 1A7GE 2QO3A 4CZEA 3HPHA 3K57A 3DXKA 3KJVB 2JRZA 3TPQA 1U2RA 2Q0UA 1VQ5N 5IC4B 1WD6A 1H72C 4G1QA 1SC6A 4ED6A 1ZM2A 2HHPA 3C15B 4MO4A 5A76A 4CIFA 2F63A 2P9LB 5K5MA 2MZ1A 3AO1A 2W9CB 4DUTA 1X4AA 3D5MA 3P4UB 1RU2A 5LMUF 3AO3A 4RW7A 4IJAA 3D2NA 4A8WA 3DHXA 1LWXA 4N47A 1Q8LA 5KG1A 1IR1A 3TA0A 1OUQA 1DARA 1REVA 4J9VA 1Y9OA 2KTQA 1DK2A 2LU2A 2QARB 3JPSA 4IOBA 1NDLA 3IBFB 4TU8A 3TJ8A 1WUDA 2V8HA 3EPGA 2MKYA 1VRTB 3CJ1A 4ELTA 2ZC3A 1HHQA 2XSFA 1IBLF 3PJWA 4EHTA 4Y28C 2UUCK 1HI1A 2B9WA 2UXCF 3I1YA 3U9DA 3SQ0A 4UASA 3ATUA 1N5VA 2W40A 3CMQA 3FFIA 3HOSA 2KKPA 2I9GA 2HNZA 1ZQGA 1KSPA 3TR8A 5C2FA 3SNNA 2FBTA 3AVNA 3SUQA 2LI6A 1BWVA 4AYBC 5KFKA 4EP4A 2I38A 5CAAA 1SKWA 2LPEA 2GQ2A 1IWAA 1HNIB 2QMXA 4K4YA 4P7TA 5AZJB 3UMBA 2E2NA 1TV6A 1UEKA 4KHUA 2PSZA 1FNXH 3IWXA 9ICFA 4DV4F 1GMVA 3NGDA 4GVBA 2F7TA 3C1YA 3PW7A 5F3ZA 4JI5F 2FJWA 1UL3A 3KK2B 5M2RA 3HSTB 4LF8K 5LJ3Y 4JOUA 5B0CA 4B17A 3WKEA 3MX5A 4TKTA 2V2VA 4CLUA 4KRFA 4F91B 2F4VF 4DHYA 5TZVA 2KW4A 4U7UK 4NLPA 3AY9A 4W5OA 3LQVA 3WIVA 2J6SA 4FM0A 4UOCA 3H46O 2B7CB 2LDYA 4C2MA 1WEZA 1ZJMA 3LPTA 1ZS6A 3KUHA 1X4FA 2EK1A 1Z4NA 5HI7A 3V7KA 2EWSA 1RYUA 1R31A 3ED5A 3C19A 1FERA 1KQGB 4DR6F 3GG0A 8ICAA 3LZIA 4MH8A 3MX2A 4I2CA 4FJ8A 2FY1A 1Z1VA 4J8FA 1FFSB 3J81U 1J5EJ 2DGSA 2HRYA 3I87A 4OHYA 3CETA 2QT7A 3VVUA 3S3MA 3EE3A 1Y3JA 1PYTA 4P75A 2RS2A 2IOFA 4AHUA 1TL1B 2MGZA 2Y8WA 2LM4A 1C1AA 4URSA 4C97A 3BH6B 4LQ3A 1NGIA 4Z4EA 2W04A 4JKGA 4JI1K 4OHWA 4CF8A 3CERA 2X6NA 4O44A 3G6XA 1Q9XA 1NB2A 1S1VB 2ZF5O 1BC6A 4B9NA 5AE1A 1E3MA 1BOTO 1NWKA 2IBKA 4F7VA 3KMSA 3N5FA 4OVLA 3SSSA 3CJCA 3R5CA 3IR7B 4GW6A 4F4YA 5ADZA 4MYTA 2N4DA 5B0DA 1N0VC 4B9QA 1O03A 3QYYA 4KLHA 1UPMB 3OHAA 4ZTFA 2V69A 4TU7A 4Y2CA 2YPYA 4DR4F 3OR2B 4O0NA 2RP5A 4XDCA 1KD1T 4WFBQ 1U45A 3E9OA 1OY9A 1IXRA 4C4RA 1VS3A 3M6UA 3Q8YA 4LSLA 1RU1A 3W65A 4ZPWR 3SEIA 2BJ3A 4RNOA 4B3MF 1JXLA 2BCVA 2P1JA 3IGVA 1GFWB 3FGVA 3HM9A 4LSLB 2OHFA 1RSCA 3ZTQA 5F8GA 5EVZA 4QJVA 2MKJA 2HHQA 2DB1A 4LF5K 2QC3A 2G06A 3TX8A 4ISFA 3CMAS 2HFNA 2XMAA 2E1MC 1X9SA 1ZC6A 3UIQA 2VQEK 3O9RA 4PHTX 2ILYA 3FQKA 4B3SF 2LHTA 5CYQA 3CD7A 4MO5A 1ASVA 2E5HA 2FJEB 3LF0A 4X66F 2MKSA 2PEHA 3JXOA 4AH9A 3KK3B 3BBFA 1MSWD 3DDKA 3V1RA 3HVWA 2HYIB 4EEYA 4CIOA 1WBDA 3ISDA 2MMYA 4MT1A 1U2CA 2Z57B 4MN4C 4NYNA 5KFZA 1HYZA 8ICVA 3T1HK 1JLEB 1T7PA 1JJ2M 2J4RA 2VD3A 1BVSA 1ACMB 2OKQA 2GAGC 1HNZK 3DDHA 1A5WA 1ZPWX 4O3RA 3UN3A 1VQPN 4F5PA 3TTDA 3R7SB 1X31C 3H7HB 1PC5A 4NCGA 3QGIA 1VQ9S 2GO7A 1HIWA 4YMMA 2D69A 4ACOA 4KH6A 1KONA 3EUNA 3WC0A 4KI6A 3GDQA 3J81j 3Q86A 3P31A 2WSEC 2R7QA 3R5AA 5BRFA 2KV2A 4ES3A 3D1HA 4AYBF 2Y0SC 5DBBA 3SQOP 3C6TA 4O5BA 4FYDA 4JI6K 2O66A 4MFAA 4IR1A 4NI2B 4CTAA 4P73A 3C1ZA 4CT8A 4FJLA 3OXLA 1VBZA 5F0UA 3CC4N 4FYYB 1ILYA 1ZQTA 2RAQA 1TK5A 3MUVP 4GXIA 5J0SA 1KEJA 3M2UA 1PVRA 1AB8A 2VF3A 2HNYB 5ALZA 4X84A 1NKBA 1PYOB 2GVZB 1BI4B 3OR1B 1X9WA 3A8EA 3RJJA 2JGAA 3IRXB 4WWSA 1VBKA 1GXTA 2J0WA 3GLJA 2WAQF 4BRPA 2I6XA 3UVJB 4D3GA 3QGGA 5JVHL 1L8LA 5K8MA 1I3AA 4RL1A 3BM7A 2HHUA 3ZDBA 2MKKA 4FYXB 4M5JA 4UB5A 4UQGA 1DRZA 1B7FA 3LM2A 4CGHA 1RACB 4U7CA 4YN3B 3CF5L 2QWNA 3NS1A 3OTBA 1N2XA 3T41A 3QO9B 3ADAC 3OT9A 2UU9J 3O1WA 3VEWA 3K1RB 1ZXIA 5D46A 4PZVA 1UMJA 1FKOB 3HBTA 1C4AA 4PZOA 3PNCA 1ZQKA 1FWPA 2DIUA 2GJIA 2F1JA 3VQEA 3D0PA 1RLCL 1G3OA 5H9FK 2UYTA 4JK9A 2CQ1A 2HQCA 5DQHA 4TY9A 2KT2A 1SQFA 3HFVA 4J9OA 4CLYA 2AHOB 4P4OA 3NS7B 1A5XA 4J9MA 1ZQQA 2ERRA 2X7IA 2X74A 1C1CA 1RHJB 1SQGA 3FGUA 2HFSA 1WWUA 2FHMA 3HFZB 2NLWA 1XQSC 4QIGA 2HQGA 4PL7A 2ZJ5A 2B5JA 3DM2B 3NVYA 4B9LA 8ICHA 1XMQF 1QZ5A 4QIWC 1HYSB 2I1RA 1GAOA 5AQTA 4QPXA 3MZIA 5HRRA 4BS2A 3Q8VA 1G6BA 5E3RA 2E1YA 1OVYA 4E1MA 5H2FU 1QS4A 2IHNA 2CQGA 1Z19A 4JV5K 2GIRA 2FSKA 2HMIA 3IG1B 4I6AA 1X4GA 1VQLS 5HVFA 3V72A 2HF4A 2LXUA 1LQ9A 3KJFB 3MEDB 2B9XA 4A62A 1UFKA 2YNGB 3SXLA 3C6HA 1IJEB 4OHZA 4ZVFA 1GLBG 3IM9A 3KHLA 2Q3PA 5AM2A 1YVFA 1QQ7A 3I5CA 1TUYA 2ZOFA 2E88A 1KVIA 3E01A 3BQ1A 1B70B 3F5AA 4NMLA 4KLFA 2RF2A 2N7CA 3M4XA 1HI0P 4ZLNA 2VA8A 3AVGA 3H8JA 3FZBA 2F7VA 4B6JA 3TP2A 2R2RA 3ZI4A 4RUHA 1WC6A 1Q82T 1D8ZA 4G9ZA 3G87A 5CEHA 1RT6A 3AAWB 4OYAA 4NXMK 3HW8A 4JI8F 5F2RA 5DLGA 4QBUA 2XZDB 2EAPA 3K0SA 1M5HA 3MOZA 1NAQA 4GKKJ 5GAGU 8ICYA 3THTA 5M1QA 2DCLA 2X6SA 4I2DA 4AE5A 3UCUP 5AKHA 1LWEB 2OZMA 2HHTA 4JI3K 3VPZA 5J2MA 2DR8A 3FCVA 2GX9A 8ICXA 4Q43A 1YJVA 4PUOA 3OV7A 3QINA 3L2QA 7ICSA 4OYIA 5CA7A 4CEDA 2BA9A 1VQSA 1K6YA 4NZ6A 5JJBA 3H2LA 3BQ7A 3S6JA 3FDSA 2IMWP 1XNQJ 2QK9A 4HTLA 4CVNE 4ILMA 2BHNA 5JTIA 3VGTA 2JZ5A 2B6AB 1KOOA 1CZBA 2ZNYA 2OA8A 3QRPA 3TJ9A 3JSMB 2ODGA 2ZDOA 1RWWB 1JLGB 1JLQA 4CLFA 1ZQYA 2A10A 2XICA 4ZVEA 2MAXA 2WB1F 3F5EA 3C7NA 3D9BA 3IMXA 2DRBA 1DJ0A 1S9GA 3CXCM 2DNYA 1VQ6N 2MZRA 2KB2A 5L46A 4K42A 2AYMA 4JMUA 4LF5F 2A1JB 2C2EA 2AT1B 3C65A 1DLOB 2YNHB 1QJHA 1HD0A 2CVIA 5J2EA 1CS4A 3CDUA 5KFTA 3NGZA 1RI7A 1TKZB 1GLEG 3OS2A 4WCEQ 2HCFA 2UVUA 4Z6DA 3HFKA 4X4NA 4K25A 1O13A 2W11A 1T03A 1WF0A 4M3XA 3QB0A 1N60A 2ZH8A 1QSYA 1FKPA 2EHGA 1FDDA 2BEFA 5HNKA 5AK6A 3MURP 2R7WA 3NMRA 4UY8O 3S01A 1UW4A 1VDHA 1JROA 1UT8A 1L7NA 1U1PA 1D09B 1HBMB 3TA1A 3O3HA 5KFCA 5KRTA 1IBCB 3HLUA 2AP6A 3QEBZ 3HZ6A 3FBFA 1QVFR 4NLSA 4DR3K 2I5JB 3PYEA 3C6AA 3L0QA 4DFDA 1DHMA 1HWIA 1FK9B 3VOVA 4NLCA 2A0FB 2E1ZA 1ZD5A 1UWBB 2IMOA 4ZVHA 1JI7A 3GDXA 1X0PA 1YRUA 4K8ZA 2WONA 4ID8A 1HBUA 5HVGA 2MHNA 5E3CA 3QJPA 2O8CB 2V51B 1NSQA 3L7OA 3H3NO 4DSEA 4PWUA 3LWMA 3DLGA 3JQMA 2CPDA 2YQ1A 3KLHB 5AE2A 2QX0A 2OJ3A 2X3DA 2LMIA 1F9HA 5L1MA 1UT5A 5ALDA 3NS5A 4ECQA 2A6OA 4B8AB 4FJIA 2LQ5A 4PAAA 2QL7B 3G0ZA 4LRAA 4H5RA 3LYSA 2CDQA 1U1KA 3CG7A 3TVYA 3G9CA 4GV9A 3TNVA 1WKLA 2FJVA 3QZ8A 4BBYA 3VESA 4NXNK 4OKJA 3SBGA 1AFJA 2E1FA 1X4CA 2FYXA 1B0PA 3SZ2A 1S6QB 1N88A 3L2VA 4KX3A 1SV0A 3NH0A 3O80A 2E8PA 3QYPA 1OH8A 2G5HB 4X62K 3UKRA 4QW9A 1E6VA 1M5OC 1RDCA 3SMZA 1BQNB 3ZSWA 1GTHA 3WKDA 1N32K 4QWCA 2LQ9A 2KJWA 3HHLD 3VAKA 3VQSA 4PWDA 2JR5A 2VV5A 4MIAA 2EBGA 1L3KA 2DH9A 2KHOA 3JSYA 4NL9A 3BKFA 3GBTA 5DDYA 4CF0A 1CUKA 3GPAA 4KFBA 4K43A 3OA9A 1SH2A 2CQIA 2G8KA 3LL3A 3PEJA 1OIAA 2A3JA 2CZ9A 4DX7A 3M05A 5CZXA 1TMMA 1VSLA 4I56A 3IM1A 5FLXO 4W98A 1RA7A 3ZEUB 5DLFA 3M7DA 3JTNA 1CQNA 3DXMA 2XMJA 4LRCA 4OJ6A 4JI8K 1WBBA 2E9TA 4FN5A 4JP8A 4K0KJ 3MXHP 2NXEA 3D6FB 3KWIA 4XH1A 1V38A 1JKHA 3GYNA 3NF6A 1GX6A 4M9LA 1ZQAA 4J2EA 3VMFB 3JB9k 4G6VB 2RE1A 4A8FA 2IRXA 4F36A 3Q8MA 4UF4A 3SENA 1KOHA 2DRDA 4KBIA 3EZWA 2IVFB 3KKAC 4Z2XA 5IM0B 3E1YA 4QS8A 2XSJA 1FRIA 3H45C 2VJ4A 1LVHA 3QIDA 1L6NA 1N5XA 2DKXA 2GC8A 2L41A 4FJ5A 3B4MA 1KFSA 4CJWA 5GMDA 4WF9Q 2VA2A 1WNSA 4I9LA 1YIJN 2EK6A 3H42A 4JKAA 5L9NA 2KE7A 2HS4A 3ULEA 4XEIA 2W1BA 4LF4J 2DIVA 1NJXA 1F9EB 4PGYA 3G8SA 3BO3A 3FM9A 1CJUB 1L5UA 1L3TA 4DUZK 2HFUA 1SAZA 3C2MA 3GONA 4FF1A 2DNLA 2KO1A 1ZZFA 3UO0A 2JLGA 4C8OA 1ASUA 2MQOA 3BO2A 3CC7S 3E01B 2A2DA 3HOTA 4WK3A 4UOGA 1L8OA 1T9YA 1BD6A 1XJWB 3R1XA 3OGUA 1ZETA 3FAHA 2KSOB 1YI2S 2IJFA 3M6XA 4KREA 3T6BA 3GSIA 2P9SB 3KIOA 5ALLA 2JFKA 2A5XA 2G08A 3TVZA 4MEYA 2IVPA 3FBEA 3O2IA 3NAHA 1FHTA 2RHFA 4A8QA 3WKCA 1KR4A 1DTQB 4UQTA 2GHWA 1CQMA 1RBAA 3KWGA 3WXJA 1X9XA 3GL1A 3GE1A 4KHSA 1IWGA 4BDPA 1VMBA 5KG2A 2V4QA 3MDAA 3QBXA 2V2KA 4OLBA 2HSZA 5J0OA 3WNEA 2PFQA 4I2JA 1D9FA 2KRRA 1K44A 3WK5A 1MDUB 3DRSA 1WELA 3CCEN 2PBDA 3HD2A 5HP1A 5K8PA 2NUBA 3KHRA 4R66A 2AV5A 4H8KA 4KB1A 3U1LA 2OSQA 2BJDA 2XO6A 5EE0A 2GGPA 3VVTA 4ZPAA 4ANCA 5DM6L 4I29A 2RRNA 5FPNA 4FPAA 2FY8A 4PPDA 3LPEA 1Q5YA 4FOEA 4I2EA 1V3ZA 5KFHA 5M2PA 2BQ3A 5E0OA 1NCLA 1GK8A 5B0BA 2MKHA 4RX6A 3DFEA 4OZNA 1C0FA 4QU7A 4GXJA 4B3OB 2E7WA 1U0SA 3THVA 2NZ4A 1JCFA 4CJLA 5SUHA 5J2DA 4E1NA 3LWLA 2PE8A 3KD5E 2BJEA 4GFJA 5AQLA 4Y2SA 2FE9A 3BN7A 2HVZA 5LMNF 2FPHX 7ICRA 1PK3A 2MLZA 1NK0A 2QXFA 4C7YA 3RUBL 4USHA 3V1OA 1FKOA 1MROA 5J2NB 3O3GA 1A0PA 1XERA 4B8CA 5TISU 2KRBA 2LXFA 4WZQA 4FM2A 3QO9A 1U7LA 4DUYJ 1U2FA 3PEHA 1KQKA 3Q8QB 2HNDB 4F72A 1PKUA 2MZSA 3MEGB 2Z7JA 1QAYA 2XI9A 1MMDA 4AT1B 5EX0A 3S41A 3ONNA 2HF3A 2ZKTA 3PSIA 4LF4F 2BE9B 1PJ6A 5FLXU 2G1HA 3ZC4A 2B4OA 5KOWA 1NHUA 2MLYA 5J0WA 2OEJA 3ASMA 3GZFA 1NK8A 3WHIA 2BTFA 1PC4A 3L6QA 3UXNA 2EDUA 4X65J 3V6DB 2AX1A 4TQSA 1SZHA 4DR1J 4H4KC 4WYLA 2KYZA 5EGYA 4KJIA 1D5AA 2OXOA 4LF9J 5IIKA 3NGSA 4GKJJ 4CW7B 4NI2A 2KK0A 5D0RA 2Y9UA 4RR5A 5LXYA 2W3RA 2J0XA 4BGDA 3D0HE 4KTWA 1Q8BA 2JFDA 5IT9Y 3ILLA 2VA3A 5BR9A 1RT5B 4NLZA 1NDCA 4B3MK 2FLLA 4P2XA 3DXMB 3PHEA 1W2BR 4M3UA 5A8WA 5FPEA 1YJ9S 2HBKA 3DN9A 3KKSA 4I28A 5KFPA 3HWTA 3CCJS 5EN1A 1VC0A 1TTHB 1IO2A 9ICSA 3PJ9A 4BDZA 2ZVIA 1N0UA 1VC6A 5GINA 1VQMN 4DV3K 2Z56B 5CYMB 5AKIA 3NBPA 3QFUA 4LVSA 4YDXA 3VQDA 5F0WA 4IKFA 4RQ0A 2GS8A 2Q66A 3CCRS 3C95A 4UBCA 5AKJA 4DMZA 5GAHI 2HGLA 4KH4A 5HLFB 5AKGA 4YXMA 9ICTA 2QKBA 1HMVA 3MHYA 3MR7A 2WB4A 2XCPA 1KVAA 1Q3VA 4K4VA 3D4JA 2OSRA 9ICHA 1VLBA 3V7LA 4F4KA 2IIHA 3CUNA 1U1QA 1Z4UA 2MDAA 5B0AA 5HVHA 1HKGA 5BR8K 4LFCK 3D2EB 4A8SA 2HHWA 4CFCA 1VQ7S 3HKZD 3A8YA 5L1KA 2HFOA 1DURA 2NZTA 4UB1A 3H5SA 1AW0A 4DV5F 5LMNJ 2G8VA 3TUIC 2G8UA 4KN4A 4ZVRB 3PKMA 5B08A 2RSQA 3R2DJ 3ENWA 4UOHA 2DISA 1FEZA 1KL9A 3B6PA 1IG6A 4ED2A 1NMDA 4QWDA 4CESA 4CDGA 5T14A 2WHEA 3ICLA 3ZSYA 3V4IA 2IDEA 3GCXP 5I42B 1ZQPA 4F4AA 5L8RC 4MLEA 3CCRN 1M5PC 4AYBD 4G3IA 1S12A 3I6PA 1ZZNA 2MQLA 2W24A 3M1FA 3N4PA 2ES6A 2E2PA 1ATSA 4KKOB 1S5LU 3OVBA 4IH6A 3TQ1A 4DFPA 2XY7A 1NJWA 1CULB 4OHXA 3A3NB 5FLXY 4YMEA 4ID5B 4B3TK 5JU5A 5AQVA 3TO8A 4BR4A 4QZBA 2L5YA 1M5VC 3AARA 2QJ3A 4NLVA 1RHUB 2JH7A 1ZD4A 1D9AA 3DWLA 1ITPA 1AZSB 4Z37A 3CCLN 2XMWA 4IWVA 4MIWA 2LYHA 3WEEA 3U26A 3VGUA 2O8DA 2QB0B 1S6UA 4UTGA 4LF9F 2R7YA 3CIPA 2UVRA 3MM5B 4DEZA 3M2RB 4RNMA 5C25A 2DKOB 3CCTA 3M2VB 3OYIA 2DNGA 4DX8H 2CYYA 1T8EA 1MN9A 4NA2A 3QRQA 3SPZA 4HHUA 2WW8A 1L3SA 2C3UA 1LW0B 3EVWA 5A8KB 1RQNA 4O5CA 2FHJD 2IYGA 2QMWA 1U6BA 5M1KA 2UUCJ 1WTBA 1HQUA 4CBUA 3TW0A 1NHKL 1SI9A 1C0TB 1TKZA 2H4YB 3JPTA 1F3FA 3NCIA 3GIJA 1YJNS 1ZQMA 4MFBB 1HNXF 2BDUA 3MC1A 8ICQA 1O0PA 2A1RA 3SCKE 1H1VA 2H3GX 3HKZF 1T02A 1NGJA 2JZBB 2FUG9 3U02A 1HQEA 2X3GA 4KLOA 2VBYA 2HHHJ 4Z94A 3KKAA 2QWPA 1TGOA 3H4DA 1Z3EB 1VJ5A 1ZQZA 1F5CA 1U8WA 2B4PA 2AYBA 4IRCA 4FZVA 2EFQA 1YTAA 4I67A 2Z30B 1YXQA 3SMVA 4O23A 3MFHA 4OI1A 1DBDA 4YNQA 2KZMA 2WBRA 1YKWA 2YH1A 4B08A 1VBXA 3BB5A 3WDOA 3CCQN 3TSPA 5F8MA 2PD1A 5D77A 1HMVB 3B54A 5H9EK 2CPHA 3CD0A 1YJWS 1S7HA 1TV6B 5BPNA 1NOZA 3K7RA 7ICUA 1RE1B 2ZH1A 6FDRA 3J7AN 2CRLA 3TWZA 5J0XA 5LJ5Y 2UUAF 3DGVA 1A5VA 2V4JB 1WC0A 3KKFA 3H08A 1EQMA 1HARA 3GCWP 4UARA 4IDKB 2V50A 3CRXA 1J5EF 2V8DA 1XWLA 1OSDA 2H3EB 4CLPA 1VSMA 4ED0A 4IFEA 1YZ6A 4BR2A 1WLJA 1SS6A 2KNJA 4TYAA 1RPLA 3ALYA 1X6JA 2FDRA 4M42A 3HYFA 3K5OA 4TUQA 5AM4A 1XSPA 2SXLA 3H1QA 5EE3A 4M0AA 4KY3A 2JEJA 4WU3A 2DNRA 4DR7J 1F0XA 5AE3A 4JI1J 4GKJF 3VQBA 1Y0HA 1S48A 3IBCB 1QTNB 1MG7A 1FRHA 2LQBA 2XHBA 2DH7A 4IJNA 3CTRA 1TMJA 2GAHC 4JNEA 4UT4A 2F8TA 3ZZUA 2DHHA 3KLGB 2B8QA 5KOXA 4B02A 3OW2R 3VAGA 2HS3A 1IUJA 5DG9A 1VSFA 3S9HA 4P2SA 2P9KB 3BY5A 5DDQC 4CGJA 3OPXA 2KQ2A 2O8BB 1C0UA 2ZHAA 2J9DA 1ZRMA 2PI5A 3HKWA 5AJ3J 1QM9A 1VHXA 2F9JA 3WK8A 4CHNA 4MEXA 1RK8A 1PG5B 4F0HA 3DLEA 1JLCA 2L9NA 1HYSA 4DOCA 4Y2UA 1S4FA 2DGTA 2OTLN 3KLVA 3JXUA 3R2CJ 3MEEB 1JMTA 4W5NA 4OYPA 3O9SA 1R0BG 4CBXA 2AJ1A 2COLA 4MDAA 1T9XA 2YNFA 3T1YJ 1HIYA 2FHJA 2R42A 3PMNA 5CP2A 2CXEA 2LA6A 3ZDEA 2EH9A 3HJFA 1ZM4A 1UVMA 1YLXA 2BANB 3P5BP 1EX8A 3BZCA 1WG4A 3HZGA 3AVBA 1ZM9A 1EZZB 1HNWJ 4JI5K 2DPNA 2F4VJ 3ALRA 2GTDA 4NX9A 1UVLA 3NDKA 4MQ3A 4PXDA 2QLBB 5J2QA 4A59A 2BX6A 1VSHA 2YWWA 4BY9C 3NF7A 4OI6A 2APOA 3NH2A 2V8PA 1TAQA 3ETLA 2ABYA 3U7JA 3K0JA 3QMLA 3DHWC 2UV8G 2HIQA 2Y1JA 5HR7A 2C2OB 3LDOA 2FJBB 4CIGA 4LFBK 2KIVA 2OEKA 2V2QA 5IFMA 2PEBA 2MQQA 1HQ2A 1NBEB 1UVNA 3JTOA 2OD6A 1UWAA 4C8KA 4KB0A 2P9KA 2ZH7A 3UPQA 2FMSA 3THPA 4A46A 3MTKA 1RJJA 1SJ4P 4DR2K 5C12A 4K4IA 3RRGA 2YKMA 5F8LA 5EE9A 2BRKA 4X4QA 4E2FB 4KRWA 3SJJA 3DOKA 3A12A 3S7RA 5DQGA 1R6YA 3FKBA 3S1TA 2ZM6F 3OL9A 2KKVA 4J2DA 2WF9A 2YWHA 4HTIA 2CPYA 2ZQBA 2DNPA 2KSOA 3M1VA 1FRLA 4K5SA 4ZCMA 4C8YA 3GJQB 4OYZA 3RB0A 2WSCC 2JGUA 2YWKA 3KWMA 4UW9A 1NNLA 3G8TA 2A18A 4RCHA 1F2HA 5DETA 4AHSA 3W5ZA 3RMAA 3H0MB 1S9EB 3HPGA 3GZ7A 4MF8A 3AEVA 2MPUA 2XYPB 3EN9A 4FP9A 1YITN 3FEXB 5J1PA 2QL9B 4TUPA 3TAQA 4DF4A 1P90A 1JXEA 1IV0A 1X8DA 3ULEB 3QXGA 4J03A 2A19A 1RT4A 9ICEA 3FR0A 1SB3C 1X5OA 2H5XA 4N41A 4E7IA 1PIEA 3V9WA 5KFSA 1TL4A 4W90B 3DMJB 5CHCB 2B3TB 1BO5O 3CJ8A 1FX2A 2PO4A 4FLUA 1JL1A 2DNZA 1R0CB 1R8BA 4CO5A 3MM9B 2UU9K 4PKIA 7ICLA 4IOCQ 2KEYA 3MXIA 4GKKK 1F5BA 1TK8A 5KTQA 2NUHA 4O9MA 2W2MP 2E5LK 2DT9A 1VQ4N 2IM3A 2QLJB 2E1RA 5A2QY 3DJCA 1UTAA 1JKHB 1GLDG 2OPPB 2DJWA 2E1CA 4JD2A 2VJVA 3UD5A 1OH7A 2B0CA 3BP8A 5J2IA 5J29A 5AKKA 4FS2A 4IL6U 4DDFA 5HL7L 4PABA 2G5IB 4DZ6A 4FJXA 1T05A 1PO6A 3CJQA 4O3SA 1X5TA 2D6FC 3VR1A 5SZTA 1T44A 1SV5A 1YJ7A 2P51A 2R8IA 3OFEA 4IOXA 2P9IA 1X1PA 2WHOA 2RHSB 5ETMA 4OQJA 4J9KA 2EQYA 2UUBF 5EX3A 4U8YA 1LWCB 1IH7A 3QNMA 2L48A 3CJTA 4MFCA 5GAGP 4X5VA 4G65A 2D0CA 4Y0FA 2ASDA 1GOAA 2KJVA 3H2UB 3CQ8A 3MCMA 4WKRA 3JPPA 5AKLA 2YMQA 3RB4A 1KLMB 2P6SA 3B6BA 2D0AA 4DL6A 3R6LB 1RILA 2XTJP 3PXGa 4BRGA 4DS4A 4M8LA 8AT1B 4QIWF 1KAYA 1R8AA 9ICOA 3AJ2A 3L7UA 5DB6A 2XBPA 2NO4A 1Y3KA 3POTB 2NYIA 4KGMA 3M8SA 1W25A 4URQU 2AZ3A 1E6YA 3QAEA 4IQWA 1U6FA 2ZH5A 4BGAA 4UAWA 4M63C 1JJHA 3DLGB 3R9KA 1WACA 4KKOA 4QZVB 5HMLA 1ZBSA 1ZQWA 5FRMA 3PUFA 5I3UB 4OZ2A 4KLSA 8ICLA 1SC1B 3KZIU 2FXUA 1IN0A 1HBNA 1Q5VA 2VPWB 2PYJA 1NPRA 2FVQA 2W01A 3EL2A 4Q2LA 5EOZA 4OFZA 2WFAA 1JLFA 1JX4A 2HSEB 3QATA 1NGFA 4BG9A 4M9HA 3M6GA 3QSIA 2UU9F 2HK2A 4KC5A 4AL5A 3FZLA 2M8DB 5JMVA 4C8NA 2FVPA 2A3ZA 1Q9YA 3D0IE 3VAJA 1BWFO 1U1MA 5MLCV 2E4LA 3ICXA 2KD1A 2KN4A 4X4VA 3TFRA 5KT2A 5GTHU 3I28A 4ER8A 4FWRA 1BISA 1K73O 5ALXA 3L3VA 1QE1A 1XNQF 5J2HA 4DPTA 4DU4A 4O3MA 2JV3A 2DQNB 1ESVA 2AQ0A 2YVSA 2Z8QA 4LF8J 3N97B 3B0XA 3DRPB 1H0HB 2B51A 1XNRJ 4M63A 2NRRA 1RXWA 4WFNQ 3BGRB 1QH9A 4CFAA 4YORA 1NDKA 1RFQA 5D49A 3GSDA 3CJKB 4CZJA 3HSZA 4F0MA 1RTIB 2H1YA 2F1HA 3EKUA 1S0NA 2VL1A 3GV7B 4M6WB 1S7IA 3TSQA 4JKCA 4CYUB 4JKHA 1VSIA 3VA3A 5CZ1A 1C20A 4FO6A 2ZE2B 3DLKB 3O4NA 1LOUA 2P9GA 1SGGA 4FJJA 2BOPA 4E8UA 3LW5C 4FWQA 3C7NB 2N1RA 4LSZB 4JI4F 1XMBA 1RQLA 3AD8C 1FRXA 1FCAA 3SCLE 3JSMA 5AQGA 1X3MA 2RLTA 3PIOL 2FPKA 3HDSA 3IA0A 4NZ0A 3MCAB 4P7VA 1PGZA 3AAPA 2ZOGA 2EFOA 1LKYB 3VGVA 1Q81T 3C2PA 1HWKA 3OYEA 1WOPA 1PZNA 2ZHOA 3KJNB 4RQ7A 4OX9J 5KL8B 2A1SA 4IOCL 3Q22A 1Q4RA 4Q44A 3ZDCA 3WK9A 1Y4ZB 2M88A 4WE1B 3EWAA 4ISGA 1Y5IB 2P6TA 1GOBA 5KFGA 1XN9A 3OTOF 1SZ2A 3QU2A 1RTHB 3UMGA 2H3QA 4NXNF 3D45A 3JS6A 3PR5B 2OZSA 2VDIA 3TTCA 2A40A 2W54A 4IC9A 5ALUA 3D54A 3HL8A 1NH8A 5KAFU 4TLRA 2JX2A 4C7ZA 2LECA 3GV8B 3DXKB 1ITGA 2V4RA 2XY6A 3R1LA 2YY3A 1S0OA 2IDLA 4RG8A 3CJ9A 4O3QA 1F5AA 5KRSA 3NP5A 4LVNP 2FSJA 3VQ8A 1NOYA 1X3NA 5FP0A 4BR9A 1MROB 3AMZA 2Y1RI 2ZIWB 2XYGB 3AGRA 4YOVA 3ZTPA 3VETA 4DV4J 3JYTA 4UY8T 4DCJB 4KLJA 3ZNUA 4R0EA 1BLUA 2GMHA 4G9BA 3K58A 2ZWPA 5J0QA 3MM6B 3LTOA 1UA0A 2BCSA 3I4HX 1IBMJ 3N4WA 2QG9B 2Y9HA 5F0XA 4IDHA 1S72S 1N6QA 2VBZA 2X51A 3GJTB 4U67Q 3ZZRA 2B0GA 4KLGA 2VHGA 1GLCG 3VQ7A 2K1RB 3RYLA 4NLNA 1UZDA 4IG0A 5HLFA 5D4NA 5E26A 4UB3A 4USIA 4NCBA 2Q0RA 3NRWA 3DLHA 2HWIA 3THWA 2OPSA 5BR8F 1ZQLA 4ILLA 4ZPCA 4HLBA 5C2GA 5F8HA 3EWGA 4NLTA 3QIOA 2D8CA 3O1BA 2DGWA 2H3VA 3OLAA 4BC3A 3WNFA 5B5EU 3RGIA 3FLCO 3GIKA 2UUBJ 1IQTA 2DR7A 1EP4A 2K89A 3CC2S 1SWVA 2RD5C 4DV5K 4I2IA 2WUSA 3SAGA 4DV0J 2W42A 2ADCA 3UI3A 2IS3A 1Q53A 3IKMA 4L74A 3CCMS 3PM9A 1ZQHA 4E19A 9ICJA 2E8OA 1UJ4A 2OI2A 2EX3A 4ED3A 1S1WB 4FSVA 2VONA 1SIZA 5HJYA 1S72N 1FDNA 3TVKA 3VAFA 3DOMA 4L3KA 5FPDA 1N54B 3CCUN 4OX9F 1LW2B 4EGLA 3NGYA 4DG1B 3Q89A 2GIQA 5ITHA 4B9TA 4FNIA 3NVMA 2IM1A 4BREA 4J9PA 3L2WA 4L72B 2W41A 5HL7Q 5IILA 1RKIA 5AQJA 1GEHA 3BKTA 3MPVA 1WC5A 3OTOJ 4JI4K 5HMMA 1GX5A 1K47A 3FE1A 4JKEA 4CEBA 1EXQA 3V2UC 2KMDA 5JLFA 4BROA 3GWCA 4DLGA 4M3RA 3OJSA 1XC3A 3F73A 4JUZA 2VCPA 1GT8A 5KAKA 5JVGQ 1RGIA 7ICHA 4NYFA 2Q0ZX 2P9NB 4OX8A 1FA0A 1N32F 2GVZA 8ICSA 3LPUA 2HGMA 4WKYA 1RAAB 2B43A 4AF1A 2DY1A 2YKNA 3VEYA 2HNDA 1JXVA 3FEZA 4RQ5A 3A3OB 2HBQB 3PCOB 3J80U 5B0FA 5AQKA 4FLZA 2LEPA 1EO1A 2M2BA 2GCFA 4QS7A 4WFAL 4JI3F 5HJXA 4H4MA 3P39A 4CTAB 4F50A 4AQYJ 1URJA 3OFFA 4LR8A 4LF2A 4LBHA 2XNQA 3CYMA 4DTUA 1WAJA 4KB7A 2R7TA 4JKBA 4UBBA 1WUUA 3BH7B 3BN4A 1Q95G 2RHKA 2PKEA 4Y2XA 2LQJA 5ETNA 1RQ0A 2UUAK 4LF9K 2O01C 1ZAXA 2E8AA 1PBUA 2VOPA 4Z4HA 4ZLJA 3PIOQ 2YMPA 4NWBA 2DGOA 3J7Z5 3LZJA 3BF1A 1ZD2P 1HJPA 4ETZA 5KFLA 1SUQA 3H20A 3A5OC 3A5NC 3I55N 4X4RA 4EYHB 1LXNA 4OCZA 3FCHA 3GILA 4DJBA 3OL7A 3OJUA 1I5OB 2AJ0A 4IZ9A 1KRPA 3KK7A 2NUUG 2MLXA 3D0GE 2YH0A 2HFZA 4ZCIA 3S6EA 2CNOB 1RDBA 1SXDA 2RJZA 1WDDA 1NG9A 2FHOB 4I27A 4A8YA 2IM2A 1N5YA 4NLUA 4N5SA 3TA2A 2HZVA 2GWKA 4B1UB 2UZAA 4KHPK 2DGUA 4RUBA 2ASOA 2FJAB 2OO4A 1RWUA 1HWLA 4DBQA 2P9EA 4ZTJA 3IWNC 1B22A 3SEOA 4MLHA 4CZFA 4Z7YA 4HWIA 3BV8A 4NLRA 4NB4A 4DU3A 2Y3YA 2LYVA 4FKYA 2FJDB 1ZJNA 2E1EA 2YB4A 4QYRA 5ETOA 4U67L 4P0PA 2YTCA 1C0MA 3IP4B 1RT3B 2D3UA 2VKZG 5IS2A 3ZSVA 3G82A 3EW9A 5DK5A 1H6KX 2OUGA 3D68A 3I8BA 1F44A 1CJUA 3EDRB 1ZOTA 4ZJOA 2LYBA 1RHRB 4ZVSB 3MPWA 2O8FB 4EELA 2ZIUB 3C6UB 1U4BA 4K8RA 1XTZA 5HRNA 4CT9A 4M7XA 1HUXA 1YT3A 3G2XA 2RUSA 1Q86O 3MXMA 3CO0P 2KJ9A 3H4BA 4CHPA 4FXDA 1B9FA 3HSCA 1CG2A 2PI4A 4ZLLA 4X65F 2ZJQQ 1Q78A 4EENA 3AU2A 1FDBA 4I2AA 4JI3J 2WVEA 3UKUA 2EW9A 3P8BB 2MY7A 1TZ0A 4B9UA 2ZIXB 3PDNA 2DK2A 1LOTB 1EKEA 4AQYF 4CLLA 3OHRA 4DPYA 1S1TA 2HAIA 2HOIA 4KMUA 2DR5A 3QT5A 2F76X 1ZQIA 2K4PA 2JJ4D 4Q8FA 3BSNA 2BH1A 3CJBA 5LJVA 1MNEA 1X40A 4CHQA 2F1IA 2FIUA 1X9JA 5KPZA 3ZD9A 3T5LA 4DV1K 2WOMB 1ZRNA 2K4IA 2CN1A 3RZAA 4E7JA 3ZX2A 1QQOA 2L9WA 1GO3F 1RT3A 1S5ZA 4ZMMA 5IIJA 1GLFO 4Y2YA 1QAXA 2ASJA 2MUTB 1HPZA 1VR6A 2FHKA 3BR9A 3THYB 4CEAA 3SMPA 9ICGA 2E5IA 1DLOA 2JEIA 3VAMA 4M3ZA 3M9OB 3NH1A 4AUKA 3PACA 3TZWA 3V9ZA 3W62A 4P72A 1JJ4A 1O08A 4W5RA 3ZSXA 1JLBA 3RAQA 5LSOA 4FLWA 2MQ8A 4ZN3A 3MFIA 1VQPS 4CGGA 4KSEB 3T9NA 1VQ9N 1N5YB 1F3VA 4QZDA 1KQSM 1DXSA 2ZM6K 3QE9Y 3PLAA 5M1FA 3Q23A 4DV7F 4B1VA 4LY7A 3M8PA 2VQFJ 2KP7A 2VJ5A 2R2TA 3CI5A 3I5BA 3HSDA 4Y2QA 2J9DE 3AGKA 4MK8A 3KK2A 2GH1A 3WNGA 4DCOB 4CEZA 3VQCA 5KFMA 5C25B 3WUHA 1NK9A 4FF4A 2HOFA 2RRAA 4HVZA 5A2QU 4RNFA 1XMQK 1TK0A 5KQDA 4LFBF 2F8MA 3TARA 1BPZA 3VF0B 5HBMB 3LDAA 3BREA 3VEXA 4HYKA 4KLIA 5LT5A 4LZGA 3KOOA 2NRTA 1T95A 3W9HA 4ELUA 4FF2A 4USVA 1WI8A 3K75D 4CGDA 4PHEA 3OQ2A 1ZA2B 3QESA 3AFGA 1BQMA 1S9FA 2A3VA 3C28A 3PO5A 4BRAA 4I2GA 2WVFA 2YWGA 3PY8A 2JLFA 4UZCA 3M5RA 2CH5A 2JHEA 2MU2A 4M5IA 7ICPA 2WB1C 1JIHA 1Q79A 1M90O 3DLJA 2PA8D 3JSBA 4ATNA 1RT1B 4L3QA 8ICJA 1T3QA 5ALMA 3SFUA 4OJGA 2JNJA 2DNNA 4FW1A 4O3PA 1LFPA 1REVB 1VK3A 3BKUA 2M0GB 3D6RA 1KLNA 4CH7A 3M8WA 3IBPA 4Z6CA 2AP1A 4O4RA 2GWSA 5ALFA 2GO9A 2R8GA 1KQQA 1VOMA 3D3BJ 3GYGA 3F2CA 3IUCA 3M6ZA 1RAEB 2MJUA 1RG6A 2CWKA 4H0XB 1FW6A 2H3FA 2GQQA 3D2EA 4CO3A 1BPXA 1S6PA 4TQRA 5CR4A 2W4CA 4DR7K 1XK8A 2R7RA 4CH0S 1N33F 4C1NK 1LWCA 4CM2A 4US8A 4KIAA 4ALZA 3OSPA 3VF2A 2M8HA 1S4EA 5J0UA 4YOYA 1E4FT 2UXBK 2C2DA 5LOQA 3R5BA 1GMUA 4C4WA 3DM2A 4FJGA 1M1GA 2DY9A 4P71A 4BWJA 5AQSA 2AJ2A 3D28A 2V68A 4KBOA 3UR3C 3J7YU 3KG1A 3CT9A 4H0PA 5C2DA 5AICA 5G4DA 4C8LA 1JRPA 5JLHA 4CQ1A 1RT5A 4CZHA 4JI6F 2IBOA 1K1SA 2FB0A 2BRLA 3RMCA 4FVMA 2X78A 3ILIA 1S99A 3AVIA 3TACB 2I2YA 1HL6A 5KFJA 5IOLA 3R9LA 2IC3A 4FYWB 4NOHA 4ITSA 3WNHA 2DFLA 2YMMA 2CNKB 2FMPA 3VCBA 5A6WA 2B4VA 1RISA 3ENHA 4KO0A 2WK4A 1IBMK 4R5PB 4LH5A 5HQMA 1B64A 2K1RA 4WQ4C 2R7SA 1SL2A 4WQ5C 2K2PA 1TQLA 2AWZA 1OQ3A 5TKYA 3CW2C 1FKAF 5D78A 2QWRA 3JAMO 4KTZA 1RT4B 1D1UA 3IR5B 5F3TA 1HWUA 3NFAA 2RVJA 1UKUA 2OFGX 3SAHA 3R5DA 3ENQA 3L8BA 3DLBA 3V9UA 1VQKN 1O5JA 2IFXA 3KG4A 2NCKL 4PEOA 4M3WA 1P1LA 1VQON 4BVOA 1T3VA 3A5MC 2DNKA 2CPXA 2W8KA 3B78A 4LFAF 3OR1A 2XLJA 4A2AA 4PJ0U 1VSJA 3HI9A 4IFVA 3M6VA 4J9LA 3MEGA 3I5AA 3M2UB 2XMUA 1L7PA 1UZHA 2UUBK 1X60A 2AGQA 2FJXA 5AZIA 4ISEA 5HP4A 2UXCK 3EKSA 2IY5B 2AMCB 4RNNA 3DLEB 2B9YA 3W61A 3KG0A 4EX6A 3KHGA 4YCXA 2AGOA 4KGZB 1BWEA 4JB3A 3DOKB 4DR4K 4U6PA 2ZWOA 2W9AA 1VK0A 5GAGI 4YB7A 4GMJB 8ATCB 2E1AA 2BGWA 2HOEA 3GFHA 3ILJA 1V85A 2FMQA 1MW7A 1VYAA 3QICA 1U47A 4ERDA 2VFTA 3KJQB 4NCGB 4IRDA 1XIQA 3T1HF 4NY8A 2KU7A 5GAEP 3E58A 1XEZA 5F9NA 1S76D 2ROEA 1FT8A 4F3QA 1J2NA 1XR5A 4JKDA 1TUGB 1FWKA 3RR8A 5ETQA 5L1JA 4DS5A 2OPSB 4P2HA 4MK9A 1RBRA 2O4GA 3C8YA 2CNNB 1LAVA 5HP1B 2M5YA 2PN6A 2RKIA 2B5JB 1LKYA 3I56N 4YP3A 2P5OA 2YX6A 2QA2A 4OJPA 2Y0BB 2KKHA 7ICTA 4X66K 3F0NA 1XBWA 5BOMA 3T1YF 2HBLA 2DBYA 1BQMB 2ZJAA 2MJNA 3K5PA 4RKUC 5AKEA 2M3DA 4RUCA 2XI2A 4HL9A 2A6AA 1HNWK 4Y1CA 2ZH2A 4YDUA 1JALA 2ZIWA 5FPMA 1OH5A 4KLTA 1A76A 3G4SN 1UFWA 4I1TA 2V2ZA 1IQZA 3DI6A 4DQPA 2QZ8A 2ZJRQ 1MWKA 1S1XA 4H5VA 4AILC 3QZ7A 1V3RA 2C3MA 1YK9A 4RQ3A 1TVAA 3ZZTA 5LL6d 1R3NA 1OXJA 3MXJA 4NCAA 3UE5A 4QPTA 1UVJA