2H3ZA

Structure of the hiv-1 matrix protein bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
b'GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 38
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3zA01
2H3IA 1A6SA 2K4HA 2K4IA 2H3ZA 2LYAA 1ECWA 2NV3A 2H3QA 4ICAA 2HMXA 1TAMA 1ED1A 2JMGA 2H3FA 4JMUA 2H3VA 2GOLA 2N1RA 1UPHA 1L6NA 2K4EA 1HEKA 4IC9A 2LYBA 1HIWA
chains in the Genus database with same CATH superfamily
4IL6U 2OYYA 4RQ8A 2HBMA 1S77D 3OHBA 1FO4A 1PVRA 4NLGA 1JRPA 2JMGA 5KG5A 2JRZA 2LM4A 2RDJA 3F5EA 3T5LA 3HP6A 4M9LA 4KMUA 4OCZA 2ES6A 3JPOA 3EW9A 3IG5A 2WF5A 2G09A 4KLHA 5KFUA 4LVSA 3C2KA 1N5XA 4NY8A 5J0OA 5HMMA 4OO1J 2XO7A 3UM9A 1MC8A 5GTIU 2CN1A 3N4MB 2PFQA 4GC6A 3ED5A 1ZQUA 4DLGA 2DPIA 3C2LA 5J0TA 4F4YA 1NI3A 3QX7A 2FI1A 4ECTA 3TACB 2OWOA 1HJPA 2RRDA 1ZQ1C 2HOFA 1T3QA 4QZFA 4BDPA 5AI6A 5ALMA 5A0LA 3RAXA 2UVRA 5AIAA 2W11A 2EANA 4UASA 2RQ5A 2YMPA 4MF2A 5ALKA 3GZFA 8ICXA 3MBYA 2KEYA 2KSOA 2HBKA 3M7DA 1A0PA 2QKQA 4UARA 3V6HA 4C8LA 1UT5A 2JH7A 4MHVA 4RQNA 8ICVA 4RQ4A 5J2AA 2RDIA 1RM6C 1N56A 4GC7A 4BWMA 3ICXA 5DBCA 2J6UA 5ALGA 3C23A 1MSWD 3OJSA 2YMMA 4DFMA 2I6XA 2FLLA 2DPJA 3RB3A 4O0IA 2QARA 4HAIA 1Q46A 4I2IA 2UVUA 1UPHA 4RQ1A 1ZQZA 1H38A 2K4EA 1X9MA 1M6YA 2DL0A 2E1FA 3KKAA 2XGPA 4J9KA 4M0AA 1X6IA 4Y2TA 4C7ZA 3QU4A 5J8YC 8ICYA 1S0NA 2C2EA 2GWSA 1ZD4A 1B0XA 2YTUA 8ICJA 3NTUA 5KG7A 4O9MA 5ALZA 1DGSA 1NJXA 4ECXA 5J0PA 1ZQYA 3RRGA 4PGXA 4YR2A 1V97A 3AQEA 1TAUA 1WUDA 2NRXA 1HIWA 1XC9A 3GILA 2L5YA 8ICNA 9ICQA 5EE3A 3Q8RB 2WB1C 3SZ2A 1ZQEA 4QZEA 3OGUA 2I1QA 1TE2A 2LM1A 2FPKA 2W7PA 1U9LA 1L6NA 4BWJA 3F5AA 1UT8A 2KV2A 2XY5A 4X5VA 4F5QA 1ZETA 5AHXA 4F92B 4MFCA 1JXEA 5J2DA 3KHHA 4O3OA 1NK4A 2FJ6A 4B9TA 5AI9A 3JPRA 3N28A 5DB8A 5KNIA 4YN4A 4R8UB 9ICFA 4F2RA 3MDAA 1PK1B 3M6ZA 1LKYA 4MEYA 4R65A 3ZD9A 3PSTA 1O08A 3AUOA 3WK6A 1URJA 8ICEA 8ICMA 3N97B 1ZQRA 2XVTA 3MR2A 3KHGA 4UB3A 1X6JA 5J2EA 9ICRA 1QQ5A 3RJKA 4YD2A 4UAYA 4PGQA 2BDUA 3WK9A 4J9LA 1GO3F 4F5PA 1TFRA 1KW4A 5ALPA 3PMLA 1XU4A 3TI0A 4C8KA 2Y9UA 4ED2A 4B9SA 2W7OA 5KFJA 4DSEA 3IN5A 4UW9A 3LVVA 5DB9A 3AU6A 4QZDA 3H4DA 2PMZF 4TURA 3ISDA 4PJ0U 3Q8KA 1S76D 2NO4A 5J0XA 2NRVA 5J0RA 2IOFA 3TQ1A 3HJEA 4NJ8A 2KICA 2YMLA 5HNKA 3TANA 4TUPA 4M9GA 1XSPA 1D8LA 3N7RC 3RR8A 3A0HU 3LWMA 4F93B 1NK5A 3RAQA 3MR6A 1TAMA 4IQUA 4P2HA 1XWLA 2K8AA 3L5KA 1RDFA 2UVWA 4M47A 1Z3EB 1F5SA 1OW5A 5J2JA 3TKAA 5AICA 3QU2A 4F4ZA 4DQSA 2WHEA 4ELVA 3FYHA 4J9SA 2QLTA 4PPXA 4RQ7A 5KFCA 3T5JA 1ZQOA 4LJXA 1ZQMA 1S0MA 2OCEA 3B0YA 2VA3A 1Z4OA 2N1RA 1C7YA 1X66A 5EWGA 3WKAA 5KAFU 4KN4A 1ZQIA 8ICKA 1XNSA 2BQ3A 3OPXA 5KFTA 2K60A 4FZLA 3RH4A 2KTQA 4NV0A 1SL0A 2BDPA 2AH5A 1ED1A 2NYVA 4FO6A 5HP4A 1ZQVA 1IG6A 4YP3A 4RNNA 9ICVA 4QWCA 3PW2A 2WB1F 2KE7A 2W8LA 4EZ6A 4F5NA 1HEKA 3RTVA 1NK7A 5AM5A 1CI4A 3PY8A 4DSLA 8ICLA 1A76A 9ICEA 3H8JA 3WK4A 4J9MA 3WK8A 1ZQAA 1TK0A 1DGJA 3T3FA 3QZ8A 1QSLA 4AYBC 2DWQA 2BPFA 3SAGA 2KK0A 2E8NA 2AGOA 4KLGA 2Q0ZX 4UAZA 3M9NB 1N2XA 2O6KA 4YR0A 2B6GA 5KFEA 3IP4B 2AGPA 3QUTA 7ICSA 2WTFA 2NRTA 2XI9A 5KFZA 2NV3A 2ESEA 1U4BA 3FDSA 9ICTA 4UBBA 4J9PA 1UA0A 1J97A 4WJ3B 3LK9A 4ECVA 3PW5A 1Z4NA 3GFKB 9ICCA 1NJYA 4PHPA 4FZMA 3FM9A 3N7PD 3MR3A 2PFNA 4I2EA 3OSNA 2I9GA 2YMQA 1IIPA 3IM1A 4EEKA 1S5LU 1U49A 8ICSA 1O03A 5ALXA 4US8A 3KOOA 1LKYB 5BOMA 3GV7B 3EPIA 4EX7A 2KN7A 2W54A 2A1AA 5AM1A 1B4FA 1SKWA 4ECRA 2F1JA 2R8JA 5EE0A 4BJQA 3T5HA 4DL5A 3Q8SB 1RG6A 5KG2A 5GTHU 1V85A 5AKYA 3PX0A 1NK9A 1SWWA 1KKXA 2KJ9A 3TFRA 1PZNA 1ZYQA 3TAPA 5KFIA 4US9A 4KLDA 8ICTA 2ASDA 1UHUA 4K4GA 5ALNA 5ALLA 4PL2A 7ICUA 1BGXT 1KEJA 2QB0A 7ICTA 3LYSA 4GXKA 2M9NA 3C5FA 3B0XA 2JH1A 5AKZA 2KFNA 1N48A 2JZBA 2AHOB 5J8YA 1KFSA 3ZDBA 3RH5A 3M9OB 1AROP 3K75D 5ALHA 2W04A 2W55A 3C2MA 3ZDEA 2KOBA 3IHQB 1F44A 1L8OA 1KRPA 5AKGA 1Q8KA 1J2MA 3MC1A 4CNQA 2ZIXB 4JMUA 2Y0SC 3UMCA 5H2FU 3AEVA 5C0YA 3K4GA 2BCVA 2KKVA 4F50A 5CRXA 2P35A 2R18A 1QSYA 4O3RA 4C8NA 2HOQA 3JPSA 4IQWA 3HILA 4MFFA 2CXYA 3KBBA 5AIBA 2NO5A 1FIQA 1Z1BA 2R8IA 2EQYA 3RFAA 3QEAZ 4ZOHC 5HMLA 2BPGA 4DL6A 3EZ5A 4CRXA 4IRCA 4IQTA 3CP8A 5IIKA 4BUGA 4F4XA 4M6WB 4O3MA 4EYHB 4O3PA 3UMGA 4F4WA 4QZGA 2LYAA 2KKPA 1L3UA 2BCSA 3PR5B 1YT3A 3QE9Y 4KLFA 1ZQDA 4C4TA 4M2YA 3Q8LA 3Q8MA 4NLNA 1FFUA 1K1QA 5ALVA 2ZTEA 3D2SA 2HHQA 3SAFA 2BCRA 2ISOA 4FS1A 1SV0C 3QU9A 5KFYA 5JUMA 3MGVA 3SI8A 2E8MA 2DF4B 4AYBF 2JEIA 4KLJA 1ZQQA 3GV5B 5JTIA 2ASLA 1V9PA 3V7LA 3ZDCA 4BX9C 3GIKA 1U48A 2WFAA 4GXIA 4FBUA 3ETRA 4Y2UA 8ICGA 4YD1A 3AMZA 1DOQA 5B5EU 4ED6A 2EAMA 3PR4A 2LPEA 7ICNA 4TUSA 3C29A 4BXOB 4YMNA 1ZRMA 2HVHA 4P0PB 2H3ZA 2ZUCA 1KQQA 4JWMA 3B9JA 4JV2A 4Q8EA 2BQUA 4YR3A 5L1IA 2KFZA 4RPXA 3EYZA 4PZNA 4G3IA 2GOLA 2ZIUB 5ALUA 2PMZC 1N63A 1LB2B 3JPPA 2F77X 3M9MB 2ATLA 1BPXA 4OJ5A 2DQNB 1RQNA 5AI0A 2W43A 3BS5B 5KL1B 5K4LA 4CF3A 1QSSA 2KVCA 4B9VA 1RZTA 2OM6A 3MFIA 1JI7A 4TQSA 4OJPA 1ZD3A 4ED8A 4QWDA 4ACOA 5KFHA 1SKRA 3FC4A 2KIWA 2RLTA 1IXRA 2FLPA 1L5UA 1SWVA 3EPGA 2YY6A 3I1YA 5TISU 3PSIA 3QXGA 2H3FA 2WF6A 4EZ9A 1RYRA 5HR7A 2EH9A 4QZ9A 2HBJA 3RF9A 2HVIA 5KT3A 1T4GA 3NVWA 3BZKA 3M8RA 4RQ0A 4Y2YA 2A1JA 2KIVA 4DFDA 3JPQA 1S8OA 4C80A 4KLQA 2EZZA 4PHDA 2YX8A 3RJEA 5AI8A 1SL1A 2PXIA 3ZDAA 5BPCA 4K4IA 3ZD8A 2IA6A 3H0MB 7ICLA 8ICPA 1CEZA 1DK3A 2W3RA 2ZXHA 4JK1A 2DFLA 2Y0SF 3BQ2A 2ODGA 3BJYA 3MGHA 3NRZA 3DV9A 5ALEA 1X42A 2KVSA 4GLXA 1KSPA 2HHWA 3HRDD 3H40A 4YCXA 5EE1A 2MUTA 3WKDA 2F1IA 1ZQNA 4NLBA 4DS5A 4Z6EA 4DSJA 3SR6A 3C21A 2KNJA 5F9LA 2HOIA 3E0FA 3PVXA 1SZPA 5L1LA 4O5KA 4LZDA 4Q43A 3WKEA 4JB3A 3AN1A 2G07A 5J2CA 5ALWA 4UB8U 4RNOA 4IQVA 1ZQHA 2AQ4A 1ZQFA 5KT5A 4RPZA 3GIIA 5IILA 1NNLA 5KFQA 5HHIA 2CRXA 1KL9A 4DO9A 4DL2A 1Q3VA 2PFPA 2VANA 2FE9A 4UB2A 5AK4A 4EBCA 2ZJAA 4RQ5A 2AQ0A 1C20A 4PH5A 1IM4A 2VJ4A 1D8BA 2JXJA 3CRXA 1WG8A 5DB7A 1OUQA 2W9BA 3GDXA 2ISPA 2A3VA 3J81j 4J9NA 4ECQA 4GXJA 2BCQA 4M9JA 1UCVA 3RJIA 3C28A 1X9WA 1JN3A 2HSZA 4R66A 5CHGA 3WKCA 4B9NA 3PSFA 1QQ6A 4RQ6A 3PZPA 4JWNA 1WWVA 3E2EA 2H5XA 3R9KA 4F4KA 1LV5A 2E5SA 3QNMA 4ELTA 4DLEA 2XY7A 8ICZA 4UB5A 3GV8B 3GU3A 2ZIVA 5J0UA 1FFVA 2VJ5A 1CUKA 2IHNA 3PSPA 3MABA 4Z6DA 5ALQA 4UAVA 3GIJA 5CEHA 5DKWA 5BOLA 4HYKA 1MN8A 3SV4A 3VCBA 5CJ7A 4KLUA 4PHAA 1NZBA 4JUZA 2K4HA 4Y2RA 4Y2PA 5C5JA 3OJUA 1WCLA 5KFBA 2LMRA 2Y9TA 4RZRA 2VKQA 2K89A 2BR0A 5D4BA 3QUCA 4UATA 5KFXA 2YN4A 4Y2XA 5KG3A 2G5IB 4AP9A 2KSOB 1BPDA 1S0OA 2RHFA 1BPZA 2LYBA 5IIJA 1RXWA 3ZI4A 1IV8A 1S10A 3S6JA 2EAPA 2W9CA 4KTQA 2AXTU 4DF4A 1PUZA 1N5WA 1JUDA 2DKXA 4F72A 3WKBA 1KTQA 2KP7A 4I2FA 2AJQA 3ETLA 4RQ3A 2WF9A 2XY6A 3NGDA 4YG2A 2QARB 2CPRA 4C0ZA 4BGDA 3RB6A 2JR5A 3BQ7A 4YMMA 3I76A 4DCCA 4RQMA 2ZUDA 2P6RA 5IIMA 5AI5A 3T5KA 5ALFA 1S0VA 2A1JB 1XSLA 5J0WA 4I2BA 1L3TA 4UBCA 2FPLA 1COKA 4TQRA 4ELUA 1U47A 4GIBA 4F91B 5ALYA 2Y1JA 2HHSA 3JPTA 1PVQA 4Y2JA 3FAHA 4QWEA 4UB1A 4I2AA 1SV0A 4Y2QA 9ICOA 2KHQA 5ALSA 5B66U 1SKSA 2JGAA 4OJLA 5ALDA 2FMQA 4MEXA 3M8SA 3V7KA 2DBYA 2W03A 5CP2A 4P4MA 1Z1VA 4XUSA 4ECZA 2DUYA 5KFKA 4EYIB 4ECSA 4R64A 3QU5A 4UQGA 3TAQA 2PI4A 2MUTB 4PGYA 5KT2A 2G06A 3NRWA 1ZXIA 1JXLA 4QWBA 2IOFK 3RR7A 4I2HA 3RBDA 4O5CA 2KD1A 3GIMA 1WWUA 2FDRA 5AM2A 2YQEA 2F3NA 2FMSA 4P0QA 1UA1A 7ICIA 4ECYA 1KLNA 9ICJA 2ALZA 1KFDA 2V4QA 3C1YA 3D2QA 2W8KA 3IG8A 4DFKA 4IRKA 8ICBA 4DL3A 4R63A 1RXVA 2J6SA 4NLZA 3AQFA 3EWAA 1A6SA 4J9RA 4DSFA 1ZQXA 4NM1A 3G6XA 2HHTA 3F2CA 1X9XA 4EBEA 1NZPA 2HHUA 5JRTA 1COOA 5KFFA 4DSIA 2IMWP 2YB1A 3LWLA 2ZIWA 4GFJA 3H8MA 1K1SA 3OTQA 1ZQLA 2VA8A 2W3SA 3NVYA 2WAQC 2J6TA 5KFRA 5HHHA 4C8MA 4ZH4A 3QYPA 4Y2VA 1P7DA 1V38A 4PL1A 3RJFA 2E8OA 1SIJA 1T3NA 3HKZC 1ZOLA 4RT3A 3BQTA 4IC9A 4KX3A 4ECUA 5KFVA 1ZRNA 1QQ7A 4E0DA 3MR5A 2JHDA 1QTMA 1NK6A 5EOZA 4KLIA 9ICUA 3IDWA 5DGAA 1D9FA 7ICHA 5HR6A 7ICMA 1ZQBA 3F53A 1NK8A 4DS4A 3EUB2 3QEBZ 5F9NA 4RUAA 3BS7A 3CW2C 4JV0A 2ZJ8A 4QW9A 8ICIA 3TFSA 5EWEA 9ICBA 2H3QA 3WK5A 4DOAA 1NOMA 8ICRA 9ICAA 4NL9C 2OH2A 4KN7A 3SMVA 5J2GA 3RBEA 4OD0A 1B22A 3KZIU 4B9UA 2F44A 4DEZA 4R8UA 4B9MA 1DRGA 4Y2SA 2HHVA 1PK1A 4DOBA 4B9LA 3CYMA 4YQWA 4UB4A 1RPLA 4DQRA 4J9QA 1PK3A 1D9DA 1SGGA 1T8EA 4FS2A 1TK8A 4MFAA 1L7PA 4DOCA 2G0AA 4KLLA 2XICA 1ZQTA 1B43A 4P4PA 5L1MA 4I2GA 2I5HA 3ONNA 2XCPA 1ZQWA 4UAUA 3BQ0A 1Q3UA 2MAXA 1JALA 2FMPA 1SXDA 3RH6A 4KLEA 4F5OA 4CDGA 2B0CA 2M0NA 3HW8A 1A77A 4RUCA 4Q8FA 5AK6A 4LZGA 3UMBA 7ICPA 4NLKA 4CF5A 4OJ6A 2PKEA 4KX5A 4J03A 4U7CA 1VDVA 4IRDA 5KFAA 4RU9A 3UQ2A 1VLBA 1D8YA 2P66A 3WK7A 2MRLA 2GO7A 3HPOA 3AU2A 2K8BB 4RT2A 5J2BA 1N62A 3ISCA 5T14A 2JEGA 4NWIA 1BNPA 4IS7A 5AKJA 1WYGA 5L1JA 4ICAA 2XIDA 3BZCA 3QZ7A 2R8KA 2MU2A 9ICPA 7ICEA 5AKHA 2C22A 4F2SA 2R8GA 1FEZA 3KTQA 5IIOA 9ICHA 4UB6U 4P0QB 5KFWA 3PW7A 4QIWC 1TAQA 5DGBA 2F8KA 3H0RB 5AI4A 9ICMA 3TADC 2XCAA 2OHFA 4I29A 1DK2A 5KG1A 4QWAA 2WAQF 3PX6A 4QZBA 3CNHA 4KLTA 1KFTA 8ICFA 4ED3A 5J2HA 4QJFB 2D8CA 4F5RA 4CF4A 4KITB 4I27A 1Z19A 4ED1A 3SEIA 3QUBA 2KG5A 4DQQA 4Q45A 2BZFA 3HKZF 3BDPA 2ZIWB 4B6JA 3HWTA 3KZXA 1OXJA 4XA5A 4TUQA 2H3VA 2IHMA 2FLNA 5ALOA 4C7YA 3PV8A 4DQIA 1ZQGA 4NM2A 2QB0B 4ED0A 1ZD2P 1Y88A 4DFPA 3RJHA 3GQCA 3U26A 3THVA 1SL2A 2HHXA 5DG8A 4M9NA 1LVHA 3HT3A 5KG4A 2JZBB 2ZJ5A 4QZAA 4U6PA 9ICWA 5AKEA 2V4RA 5AK3A 1X2IA 2FPMA 3HX0A 4ECWA 3MGIA 2NRWA 4Z6FA 8ICQA 1JROA 4M9HA 5KG0A 4YXJA 1BPBA 4QZHA 1TVAA 2HCFA 2WF7A 3KFUF 3UXNA 4EEYA 3C5GA 4YVZA 2BPCA 1HUOA 3KD3A 4OJOA 4XQ8A 1DXSA 3WU2U 2DKZA 1T94A 4USAA 4C4SA 9ICLA 5CWRA 3ALRA 3V72A 4O5EA 2QB1A 5IIIA 3UXPA 1VJ5A 1XO1A 1NJWA 4EELA 2MSNA 3Q8PB 1ZJMA 4FE3A 1SZHA 3G6YA 9ICSA 1ZD5A 5KFDA 5AKIA 5AM3A 1KN5A 1XS9D 8ICCA 1YZ7A 5D46A 2HDOA 1X40A 1RYUA 2LYHA 3PNCA 4KMOB 5DBBA 3PW0A 4IR1A 5AKXA 8ICUA 1SB3C 4KLOA 3I28A 1N61A 2D3DA 3D2NA 8ICAA 3V7JA 1YZ6A 5DDYA 1QLNA 4F3OA 4FFDA 1KBUA 2KZMA 3H0LB 3F2BA 3PO5A 5JU5A 5AM4A 1L3SA 3DEEA 3V6KA 3SD7A 3MFHA 1NJZA 1ZQJA 2PI5A 3Q8QB 4EENA 5CB1A 2RP5A 1JIHA 1NKEA 2G08A 3DDHA 2XC9A 1Z00A 4DFJA 3IRUA 5J0SA 1U45A 4YMOA 2NRZA 3E58A 2ZTCA 4C4RA 1TK5A 5FP0A 4QIWF 2BKEA 3G6VA 5J0QA 2HMXA 5DQGA 5J2FA 2Z7JA 2LBOA 1T7PA 2HBLA 1BVSA 5E79U 4J9OA 3NUQA 3T79A 4I2DA 5AKLA 3D6JA 5J0YA 4NXZA 3PX4A 5AKKA 3PO4A 2ZIXA 1K5OA 5ALRA 1ECWA 1JMSA 2V9WA 2LKYA 4F71A 3PW4A 7ICFA 9ICKA 5CA7A 4I28A 4KLSA 1ZQCA 2AGQA 2K8CB 5KTQA 4RNMA 2F76X 3F2DA 1N60A 1BPYA 4I2CA 5KFPA 4CE6A 1MQ3A 3KHLA 4CGZA 2IBKA 4NL9A 5J2KA 3MDCA 3KKAC 4O3NA 5KFNA 4M6WA 5DDMA 1TKDA 4YFKA 3H4BA 4O3QA 4NLCA 3LVWA 1ZQSA 4XRHA 4C8OA 2VIXA 2LI6A 3ZDDA 7ICRA 3SAHA 7ICOA 4PZOA 5DLFA 1L7MA 1NK0A 2BCUA 1QH9A 2KHVA 3QUQA 5F3XB 3A0BU 4FBTA 3SENA 1UQVA 5J2IA 5DG7A 2BGWA 1RYSA 4O3SA 1BNOA 5KFSA 3V6JA 3SV3A 5DB6A 2KJ8A 4EX6A 2E3TA 3M1YA 3RB0A 4QZ8A 4K4HA 2KZZA 1SXEA 5KFLA 2EDUA 3BQ1A 2F2AB 4RQ2A 2C28A 2EZXA 5G5HA 4DL7A 5TZVA 1JX4A 2JEFA 4QZCA 3TARA 9ICGA 3QU7A 2K4IA 5KL8B 4DQPA 4A8EA 7ICQA 4BXOA 3N7SC 4G9BA 1SV4A 1WCNA 4P0PA 2AU0A 2D6FC 2E8PA 3K1ZA 7ICJA 8ICHA 3M6KA 2W9MA 2UVVA 7ICKA 2EZYA 3AL0B 4I2JA 4DL4A 7ICGA 5CR0A 1S9FA 1NKBA 2KJ5A 2H3IA 4F8RA 2ZIUA 5KAIU 2WF8A 4MF8A 4JV1A 3OHAA 1L8LA 1MA7A 2C2DA 2Y1IA 2G5HB 5KFOA 2LHTA 3BS5A 3RJJA 5EE9A 4ED7A 3UQ0A 5KT4A 3LDAA 3SQIA 3NASA 2OEHA 1RQLA 2F8LA 2DGZA 1PVPA 4YXMA 2BHNA 5KT6A 9ICIA 5AK5A 2VA2A 1EXNA 3NVVA 1NKCA 2ZUBA 2ZXIA 1QCKA 2KZ3A 2YB4A 5AM0A 5ALIA 2W9BB 3TADA 4UAWA 1XSNA 5L1KA 2JV3A 9ICNA 4DF8A 3O0FA 3NS1A 1ZQPA 2MA1A 2OXOA 3RJGA 3OSPA 4KLMA 2R8HA 5ALTA 5DLGA 5IINA 1J2NA 1X9SA 3H8SA 9ICXA 2Q4TA 5DBAA 5ALJA 2GLEA 2P6UA 1F0MA 4QW8A 3K1RB 3SYZA 4DSKA 8ICOA 2ZIVB 3RB4A 1ZQKA 1KDHA 1Z00B 2A19A 5KFMA 5DG9A 3VC8A 3ISBA 3AM9A 3PMNA 4FZNA 2EAOA 4P4OA 1HUZA 2BQRA 3UPQA 2HI0A 5KG6A 1BPEA 4Q44A 1L7OA 4EBDA 1MQ2A 2C2RA 5DQHA 2GH1A 1ZJNA 4DWIA 2ZTDA 2KMDA 3NVZA 5L9XA 2F1HA 3JPNA 3H8WA 2K4PA 2B21A 2E1EA 5KFGA 2JEJA 3KHRA 3H7IA 4PHEA 4CCHA 4RPYA 3L3FX 1S97A 5DQIA 3L4PA 2IOHA 5J29A 2W9CB 8ICWA 2XGQA 1L3VA 3IV6A 2W9AA 1XO0A 2ASJA 2HW3A 2ZG6A 5D49A 4QNLA 2PFOA 4QZIA 1AQ6A 3UXOA 3C1ZA 4IR9A 3ORYA 4Z6CA 5EWFA 5G5GA 5KT7A 3RRHA 4M04A 1TV9A 1L7NA 7ICVA 1CRXA
chains in the Genus database with same CATH topology
3O0FA 3ICXA 2R18A 2F77X 3N7PD 4NLBA 1NZBA 2KHVA 4CDGA 2K4HA 2M0NA 2MA1A 2HOQA 2OXOA 3DEEA 4KX3A 4OJ5A 2W03A 2DQNB 2OYYA 1IIPA 2HBMA 2JHDA 3PSTA 5KL1B 2KNJA 2HOIA 2KJ8A 2VKQA 2RP5A 1URJA 2K89A 3E0FA 1PVRA 4U6PA 1Z1BA 4OJ6A 5CRXA 2JMGA 2G08A 4KX5A 2Q4TA 4U7CA 2G06A 3NRWA 2XVTA 2KVCA 3F5EA 3RFAA 5HR6A 2N1RA 2OM6A 1UPHA 2G5IB 3F53A 4OJPA 2F2AB 2KD1A 3IG5A 4CRXA 2G09A 2K4EA 2MRLA 2RHFA 2G07A 3CP8A 2LYBA 2E1FA 4BJQA 4ACOA 2K8BB 4BUGA 2ZIVB 2BDUA 1XNSA 4O3MA 3OPXA 2K4IA 4FZLA 5T14A 4OO1J 4P0QA 2KIWA 4NWIA 2LYAA 1GO3F 4NV0A 4QIWF 2H3QA 5KL8B 2KKPA 3VC8A 4A8EA 1YT3A 2CN1A 3N7SC 2XIDA 4FZNA 4ICAA 2HMXA 3KFUF 3PSIA 2Z7JA 2LBOA 3F2BA 1ED1A 4P0PA 2H3FA 2HBLA 3D2QA 2D6FC 2CRXA 3NUQA 3K1ZA 5HR7A 3M6KA 2OH2A 3T79A 1Q3VA 2KJ9A 3IG8A 4OJOA 2HBJA 4P0QB 3RF9A 3AL0B 3D2SA 2WB1F 2W7OA 4QIWC 3SAFA 3SMVA 3AQEA 1T94A 1WUDA 3MGVA 2KJ5A 1HEKA 2ZIXA 2GH1A 1HIWA 3IN5A 3ALRA 2DF4B 3AQFA 3LVVA 2H3IA 2CPRA 4AYBF 4C0ZA 1A6SA 2PMZF 2ZIUA 2RRDA 2VJ4A 3H0RB 1D8BA 1ZQ1C 2HOFA 3CRXA 1OUQA 1ECWA 1DRGA 4PL2A 2E1EA 3F2CA 2A3VA 5A0LA 4BX9C 2LKYA 2WB1C 1MA7A 3LYSA 2WAQF 2YX8A 3CYMA 4FE3A 1SZHA 2G5HB 2LHTA 3C28A 4AYBC 2JH1A 2W7PA 2YB1A 4QJFB 3L3FX 2KICA 2ZIWA 4GFJA 3SAGA 1L6NA 3F5AA 3GZFA 3PSFA 2KV2A 3PZPA 3SQIA 3C29A 3H0MB 3N7RC 2F8LA 2K8CB 1Z19A 2F76X 2WAQC 2ZXHA 3F2DA 2DGZA 2Y0SF 4P0PB 2E5SA 3IP4B 1PVPA 2H3ZA 2KEYA 2XI9A 3HKZF 4CGZA 2NV3A 2W04A 4KMOB 2G0AA 2HBKA 3M7DA 1A0PA 2ZIWB 1XO0A 2XICA 2KOBA 2JH7A 1PVQA 3GU3A 1F44A 2ZG6A 1TAMA 2ZIVA 1P7DA 3KZXA 2K8AA 2VJ5A 4QNLA 3PSPA 3LVWA 3ONNA 2ZIXB 4JMUA 4NLCA 4PL1A 2ZXIA 2H3VA 3D2NA 2GOLA 2Y0SC 2YB4A 1Q3UA 2VIXA 2ZIUB 4WJ3B 2PMZC 5C0YA 3HKZC 2KHQA 1KBUA 3SAHA 2KKVA 2JGAA 4FZMA 3VCBA 4OJLA 3H0LB 3M6ZA 4IC9A 1CRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3I A;  1A6S A;  2K4H A;  2K4I A;  2H3Z A;  2LYA A;  1ECW A;  2NV3 A;  2H3Q A;  4ICA A;  2HMX A;  1TAM A;  1ED1 A;  2JMG A;  2H3F A;  4JMU A;  2H3V A;  2GOL A;  2N1R A;  1UPH A;  1L6N A;  2K4E A;  1HEK A;  4IC9 A;  2LYB A;  1HIW A; 
#chains in the Genus database with same CATH topology
 4IL6 U;  2OYY A;  4RQ8 A;  2HBM A;  1S77 D;  3OHB A;  1FO4 A;  1PVR A;  4NLG A;  1JRP A;  2JMG A;  5KG5 A;  2JRZ A;  2LM4 A;  2RDJ A;  3F5E A;  3T5L A;  3HP6 A;  4M9L A;  4KMU A;  4OCZ A;  2ES6 A;  3JPO A;  3EW9 A;  3IG5 A;  2WF5 A;  2G09 A;  4KLH A;  5KFU A;  4LVS A;  3C2K A;  1N5X A;  4NY8 A;  5J0O A;  5HMM A;  4OO1 J;  2XO7 A;  3UM9 A;  1MC8 A;  5GTI U;  2CN1 A;  3N4M B;  2PFQ A;  4GC6 A;  3ED5 A;  1ZQU A;  4DLG A;  2DPI A;  3C2L A;  5J0T A;  4F4Y A;  1NI3 A;  3QX7 A;  2FI1 A;  4ECT A;  3TAC B;  2OWO A;  1HJP A;  2RRD A;  1ZQ1 C;  2HOF A;  1T3Q A;  4QZF A;  4BDP A;  5AI6 A;  5ALM A;  5A0L A;  3RAX A;  2UVR A;  5AIA A;  2W11 A;  2EAN A;  4UAS A;  2RQ5 A;  2YMP A;  4MF2 A;  5ALK A;  3GZF A;  8ICX A;  3MBY A;  2KEY A;  2KSO A;  2HBK A;  3M7D A;  1A0P A;  2QKQ A;  4UAR A;  3V6H A;  4C8L A;  1UT5 A;  2JH7 A;  4MHV A;  4RQN A;  8ICV A;  4RQ4 A;  5J2A A;  2RDI A;  1RM6 C;  1N56 A;  4GC7 A;  4BWM A;  3ICX A;  5DBC A;  2J6U A;  5ALG A;  3C23 A;  1MSW D;  3OJS A;  2YMM A;  4DFM A;  2I6X A;  2FLL A;  2DPJ A;  3RB3 A;  4O0I A;  2QAR A;  4HAI A;  1Q46 A;  4I2I A;  2UVU A;  1UPH A;  4RQ1 A;  1ZQZ A;  1H38 A;  2K4E A;  1X9M A;  1M6Y A;  2DL0 A;  2E1F A;  3KKA A;  2XGP A;  4J9K A;  4M0A A;  1X6I A;  4Y2T A;  4C7Z A;  3QU4 A;  5J8Y C;  8ICY A;  1S0N A;  2C2E A;  2GWS A;  1ZD4 A;  1B0X A;  2YTU A;  8ICJ A;  3NTU A;  5KG7 A;  4O9M A;  5ALZ A;  1DGS A;  1NJX A;  4ECX A;  5J0P A;  1ZQY A;  3RRG A;  4PGX A;  4YR2 A;  1V97 A;  3AQE A;  1TAU A;  1WUD A;  2NRX A;  1HIW A;  1XC9 A;  3GIL A;  2L5Y A;  8ICN A;  9ICQ A;  5EE3 A;  3Q8R B;  2WB1 C;  3SZ2 A;  1ZQE A;  4QZE A;  3OGU A;  2I1Q A;  1TE2 A;  2LM1 A;  2FPK A;  2W7P A;  1U9L A;  1L6N A;  4BWJ A;  3F5A A;  1UT8 A;  2KV2 A;  2XY5 A;  4X5V A;  4F5Q A;  1ZET A;  5AHX A;  4F92 B;  4MFC A;  1JXE A;  5J2D A;  3KHH A;  4O3O A;  1NK4 A;  2FJ6 A;  4B9T A;  5AI9 A;  3JPR A;  3N28 A;  5DB8 A;  5KNI A;  4YN4 A;  4R8U B;  9ICF A;  4F2R A;  3MDA A;  1PK1 B;  3M6Z A;  1LKY A;  4MEY A;  4R65 A;  3ZD9 A;  3PST A;  1O08 A;  3AUO A;  3WK6 A;  1URJ A;  8ICE A;  8ICM A;  3N97 B;  1ZQR A;  2XVT A;  3MR2 A;  3KHG A;  4UB3 A;  1X6J A;  5J2E A;  9ICR A;  1QQ5 A;  3RJK A;  4YD2 A;  4UAY A;  4PGQ A;  2BDU A;  3WK9 A;  4J9L A;  1GO3 F;  4F5P A;  1TFR A;  1KW4 A;  5ALP A;  3PML A;  1XU4 A;  3TI0 A;  4C8K A;  2Y9U A;  4ED2 A;  4B9S A;  2W7O A;  5KFJ A;  4DSE A;  3IN5 A;  4UW9 A;  3LVV A;  5DB9 A;  3AU6 A;  4QZD A;  3H4D A;  2PMZ F;  4TUR A;  3ISD A;  4PJ0 U;  3Q8K A;  1S76 D;  2NO4 A;  5J0X A;  2NRV A;  5J0R A;  2IOF A;  3TQ1 A;  3HJE A;  4NJ8 A;  2KIC A;  2YML A;  5HNK A;  3TAN A;  4TUP A;  4M9G A;  1XSP A;  1D8L A;  3N7R C;  3RR8 A;  3A0H U;  3LWM A;  4F93 B;  1NK5 A;  3RAQ A;  3MR6 A;  1TAM A;  4IQU A;  4P2H A;  1XWL A;  2K8A A;  3L5K A;  1RDF A;  2UVW A;  4M47 A;  1Z3E B;  1F5S A;  1OW5 A;  5J2J A;  3TKA A;  5AIC A;  3QU2 A;  4F4Z A;  4DQS A;  2WHE A;  4ELV A;  3FYH A;  4J9S A;  2QLT A;  4PPX A;  4RQ7 A;  5KFC A;  3T5J A;  1ZQO A;  4LJX A;  1ZQM A;  1S0M A;  2OCE A;  3B0Y A;  2VA3 A;  1Z4O A;  2N1R A;  1C7Y A;  1X66 A;  5EWG A;  3WKA A;  5KAF U;  4KN4 A;  1ZQI A;  8ICK A;  1XNS A;  2BQ3 A;  3OPX A;  5KFT A;  2K60 A;  4FZL A;  3RH4 A;  2KTQ A;  4NV0 A;  1SL0 A;  2BDP A;  2AH5 A;  1ED1 A;  2NYV A;  4FO6 A;  5HP4 A;  1ZQV A;  1IG6 A;  4YP3 A;  4RNN A;  9ICV A;  4QWC A;  3PW2 A;  2WB1 F;  2KE7 A;  2W8L A;  4EZ6 A;  4F5N A;  1HEK A;  3RTV A;  1NK7 A;  5AM5 A;  1CI4 A;  3PY8 A;  4DSL A;  8ICL A;  1A76 A;  9ICE A;  3H8J A;  3WK4 A;  4J9M A;  3WK8 A;  1ZQA A;  1TK0 A;  1DGJ A;  3T3F A;  3QZ8 A;  1QSL A;  4AYB C;  2DWQ A;  2BPF A;  3SAG A;  2KK0 A;  2E8N A;  2AGO A;  4KLG A;  2Q0Z X;  4UAZ A;  3M9N B;  1N2X A;  2O6K A;  4YR0 A;  2B6G A;  5KFE A;  3IP4 B;  2AGP A;  3QUT A;  7ICS A;  2WTF A;  2NRT A;  2XI9 A;  5KFZ A;  2NV3 A;  2ESE A;  1U4B A;  3FDS A;  9ICT A;  4UBB A;  4J9P A;  1UA0 A;  1J97 A;  4WJ3 B;  3LK9 A;  4ECV A;  3PW5 A;  1Z4N A;  3GFK B;  9ICC A;  1NJY A;  4PHP A;  4FZM A;  3FM9 A;  3N7P D;  3MR3 A;  2PFN A;  4I2E A;  3OSN A;  2I9G A;  2YMQ A;  1IIP A;  3IM1 A;  4EEK A;  1S5L U;  1U49 A;  8ICS A;  1O03 A;  5ALX A;  4US8 A;  3KOO A;  1LKY B;  5BOM A;  3GV7 B;  3EPI A;  4EX7 A;  2KN7 A;  2W54 A;  2A1A A;  5AM1 A;  1B4F A;  1SKW A;  4ECR A;  2F1J A;  2R8J A;  5EE0 A;  4BJQ A;  3T5H A;  4DL5 A;  3Q8S B;  1RG6 A;  5KG2 A;  5GTH U;  1V85 A;  5AKY A;  3PX0 A;  1NK9 A;  1SWW A;  1KKX A;  2KJ9 A;  3TFR A;  1PZN A;  1ZYQ A;  3TAP A;  5KFI A;  4US9 A;  4KLD A;  8ICT A;  2ASD A;  1UHU A;  4K4G A;  5ALN A;  5ALL A;  4PL2 A;  7ICU A;  1BGX T;  1KEJ A;  2QB0 A;  7ICT A;  3LYS A;  4GXK A;  2M9N A;  3C5F A;  3B0X A;  2JH1 A;  5AKZ A;  2KFN A;  1N48 A;  2JZB A;  2AHO B;  5J8Y A;  1KFS A;  3ZDB A;  3RH5 A;  3M9O B;  1ARO P;  3K75 D;  5ALH A;  2W04 A;  2W55 A;  3C2M A;  3ZDE A;  2KOB A;  3IHQ B;  1F44 A;  1L8O A;  1KRP A;  5AKG A;  1Q8K A;  1J2M A;  3MC1 A;  4CNQ A;  2ZIX B;  4JMU A;  2Y0S C;  3UMC A;  5H2F U;  3AEV A;  5C0Y A;  3K4G A;  2BCV A;  2KKV A;  4F50 A;  5CRX A;  2P35 A;  2R18 A;  1QSY A;  4O3R A;  4C8N A;  2HOQ A;  3JPS A;  4IQW A;  3HIL A;  4MFF A;  2CXY A;  3KBB A;  5AIB A;  2NO5 A;  1FIQ A;  1Z1B A;  2R8I A;  2EQY A;  3RFA A;  3QEA Z;  4ZOH C;  5HML A;  2BPG A;  4DL6 A;  3EZ5 A;  4CRX A;  4IRC A;  4IQT A;  3CP8 A;  5IIK A;  4BUG A;  4F4X A;  4M6W B;  4O3M A;  4EYH B;  4O3P A;  3UMG A;  4F4W A;  4QZG A;  2LYA A;  2KKP A;  1L3U A;  2BCS A;  3PR5 B;  1YT3 A;  3QE9 Y;  4KLF A;  1ZQD A;  4C4T A;  4M2Y A;  3Q8L A;  3Q8M A;  4NLN A;  1FFU A;  1K1Q A;  5ALV A;  2ZTE A;  3D2S A;  2HHQ A;  3SAF A;  2BCR A;  2ISO A;  4FS1 A;  1SV0 C;  3QU9 A;  5KFY A;  5JUM A;  3MGV A;  3SI8 A;  2E8M A;  2DF4 B;  4AYB F;  2JEI A;  4KLJ A;  1ZQQ A;  3GV5 B;  5JTI A;  2ASL A;  1V9P A;  3V7L A;  3ZDC A;  4BX9 C;  3GIK A;  1U48 A;  2WFA A;  4GXI A;  4FBU A;  3ETR A;  4Y2U A;  8ICG A;  4YD1 A;  3AMZ A;  1DOQ A;  5B5E U;  4ED6 A;  2EAM A;  3PR4 A;  2LPE A;  7ICN A;  4TUS A;  3C29 A;  4BXO B;  4YMN A;  1ZRM A;  2HVH A;  4P0P B;  2H3Z A;  2ZUC A;  1KQQ A;  4JWM A;  3B9J A;  4JV2 A;  4Q8E A;  2BQU A;  4YR3 A;  5L1I A;  2KFZ A;  4RPX A;  3EYZ A;  4PZN A;  4G3I A;  2GOL A;  2ZIU B;  5ALU A;  2PMZ C;  1N63 A;  1LB2 B;  3JPP A;  2F77 X;  3M9M B;  2ATL A;  1BPX A;  4OJ5 A;  2DQN B;  1RQN A;  5AI0 A;  2W43 A;  3BS5 B;  5KL1 B;  5K4L A;  4CF3 A;  1QSS A;  2KVC A;  4B9V A;  1RZT A;  2OM6 A;  3MFI A;  1JI7 A;  4TQS A;  4OJP A;  1ZD3 A;  4ED8 A;  4QWD A;  4ACO A;  5KFH A;  1SKR A;  3FC4 A;  2KIW A;  2RLT A;  1IXR A;  2FLP A;  1L5U A;  1SWV A;  3EPG A;  2YY6 A;  3I1Y A;  5TIS U;  3PSI A;  3QXG A;  2H3F A;  2WF6 A;  4EZ9 A;  1RYR A;  5HR7 A;  2EH9 A;  4QZ9 A;  2HBJ A;  3RF9 A;  2HVI A;  5KT3 A;  1T4G A;  3NVW A;  3BZK A;  3M8R A;  4RQ0 A;  4Y2Y A;  2A1J A;  2KIV A;  4DFD A;  3JPQ A;  1S8O A;  4C80 A;  4KLQ A;  2EZZ A;  4PHD A;  2YX8 A;  3RJE A;  5AI8 A;  1SL1 A;  2PXI A;  3ZDA A;  5BPC A;  4K4I A;  3ZD8 A;  2IA6 A;  3H0M B;  7ICL A;  8ICP A;  1CEZ A;  1DK3 A;  2W3R A;  2ZXH A;  4JK1 A;  2DFL A;  2Y0S F;  3BQ2 A;  2ODG A;  3BJY A;  3MGH A;  3NRZ A;  3DV9 A;  5ALE A;  1X42 A;  2KVS A;  4GLX A;  1KSP A;  2HHW A;  3HRD D;  3H40 A;  4YCX A;  5EE1 A;  2MUT A;  3WKD A;  2F1I A;  1ZQN A;  4NLB A;  4DS5 A;  4Z6E A;  4DSJ A;  3SR6 A;  3C21 A;  2KNJ A;  5F9L A;  2HOI A;  3E0F A;  3PVX A;  1SZP A;  5L1L A;  4O5K A;  4LZD A;  4Q43 A;  3WKE A;  4JB3 A;  3AN1 A;  2G07 A;  5J2C A;  5ALW A;  4UB8 U;  4RNO A;  4IQV A;  1ZQH A;  2AQ4 A;  1ZQF A;  5KT5 A;  4RPZ A;  3GII A;  5IIL A;  1NNL A;  5KFQ A;  5HHI A;  2CRX A;  1KL9 A;  4DO9 A;  4DL2 A;  1Q3V A;  2PFP A;  2VAN A;  2FE9 A;  4UB2 A;  5AK4 A;  4EBC A;  2ZJA A;  4RQ5 A;  2AQ0 A;  1C20 A;  4PH5 A;  1IM4 A;  2VJ4 A;  1D8B A;  2JXJ A;  3CRX A;  1WG8 A;  5DB7 A;  1OUQ A;  2W9B A;  3GDX A;  2ISP A;  2A3V A;  3J81 j;  4J9N A;  4ECQ A;  4GXJ A;  2BCQ A;  4M9J A;  1UCV A;  3RJI A;  3C28 A;  1X9W A;  1JN3 A;  2HSZ A;  4R66 A;  5CHG A;  3WKC A;  4B9N A;  3PSF A;  1QQ6 A;  4RQ6 A;  3PZP A;  4JWN A;  1WWV A;  3E2E A;  2H5X A;  3R9K A;  4F4K A;  1LV5 A;  2E5S A;  3QNM A;  4ELT A;  4DLE A;  2XY7 A;  8ICZ A;  4UB5 A;  3GV8 B;  3GU3 A;  2ZIV A;  5J0U A;  1FFV A;  2VJ5 A;  1CUK A;  2IHN A;  3PSP A;  3MAB A;  4Z6D A;  5ALQ A;  4UAV A;  3GIJ A;  5CEH A;  5DKW A;  5BOL A;  4HYK A;  1MN8 A;  3SV4 A;  3VCB A;  5CJ7 A;  4KLU A;  4PHA A;  1NZB A;  4JUZ A;  2K4H A;  4Y2R A;  4Y2P A;  5C5J A;  3OJU A;  1WCL A;  5KFB A;  2LMR A;  2Y9T A;  4RZR A;  2VKQ A;  2K89 A;  2BR0 A;  5D4B A;  3QUC A;  4UAT A;  5KFX A;  2YN4 A;  4Y2X A;  5KG3 A;  2G5I B;  4AP9 A;  2KSO B;  1BPD A;  1S0O A;  2RHF A;  1BPZ A;  2LYB A;  5IIJ A;  1RXW A;  3ZI4 A;  1IV8 A;  1S10 A;  3S6J A;  2EAP A;  2W9C A;  4KTQ A;  2AXT U;  4DF4 A;  1PUZ A;  1N5W A;  1JUD A;  2DKX A;  4F72 A;  3WKB A;  1KTQ A;  2KP7 A;  4I2F A;  2AJQ A;  3ETL A;  4RQ3 A;  2WF9 A;  2XY6 A;  3NGD A;  4YG2 A;  2QAR B;  2CPR A;  4C0Z A;  4BGD A;  3RB6 A;  2JR5 A;  3BQ7 A;  4YMM A;  3I76 A;  4DCC A;  4RQM A;  2ZUD A;  2P6R A;  5IIM A;  5AI5 A;  3T5K A;  5ALF A;  1S0V A;  2A1J B;  1XSL A;  5J0W A;  4I2B A;  1L3T A;  4UBC A;  2FPL A;  1COK A;  4TQR A;  4ELU A;  1U47 A;  4GIB A;  4F91 B;  5ALY A;  2Y1J A;  2HHS A;  3JPT A;  1PVQ A;  4Y2J A;  3FAH A;  4QWE A;  4UB1 A;  4I2A A;  1SV0 A;  4Y2Q A;  9ICO A;  2KHQ A;  5ALS A;  5B66 U;  1SKS A;  2JGA A;  4OJL A;  5ALD A;  2FMQ A;  4MEX A;  3M8S A;  3V7K A;  2DBY A;  2W03 A;  5CP2 A;  4P4M A;  1Z1V A;  4XUS A;  4ECZ A;  2DUY A;  5KFK A;  4EYI B;  4ECS A;  4R64 A;  3QU5 A;  4UQG A;  3TAQ A;  2PI4 A;  2MUT B;  4PGY A;  5KT2 A;  2G06 A;  3NRW A;  1ZXI A;  1JXL A;  4QWB A;  2IOF K;  3RR7 A;  4I2H A;  3RBD A;  4O5C A;  2KD1 A;  3GIM A;  1WWU A;  2FDR A;  5AM2 A;  2YQE A;  2F3N A;  2FMS A;  4P0Q A;  1UA1 A;  7ICI A;  4ECY A;  1KLN A;  9ICJ A;  2ALZ A;  1KFD A;  2V4Q A;  3C1Y A;  3D2Q A;  2W8K A;  3IG8 A;  4DFK A;  4IRK A;  8ICB A;  4DL3 A;  4R63 A;  1RXV A;  2J6S A;  4NLZ A;  3AQF A;  3EWA A;  1A6S A;  4J9R A;  4DSF A;  1ZQX A;  4NM1 A;  3G6X A;  2HHT A;  3F2C A;  1X9X A;  4EBE A;  1NZP A;  2HHU A;  5JRT A;  1COO A;  5KFF A;  4DSI A;  2IMW P;  2YB1 A;  3LWL A;  2ZIW A;  4GFJ A;  3H8M A;  1K1S A;  3OTQ A;  1ZQL A;  2VA8 A;  2W3S A;  3NVY A;  2WAQ C;  2J6T A;  5KFR A;  5HHH A;  4C8M A;  4ZH4 A;  3QYP A;  4Y2V A;  1P7D A;  1V38 A;  4PL1 A;  3RJF A;  2E8O A;  1SIJ A;  1T3N A;  3HKZ C;  1ZOL A;  4RT3 A;  3BQT A;  4IC9 A;  4KX3 A;  4ECU A;  5KFV A;  1ZRN A;  1QQ7 A;  4E0D A;  3MR5 A;  2JHD A;  1QTM A;  1NK6 A;  5EOZ A;  4KLI A;  9ICU A;  3IDW A;  5DGA A;  1D9F A;  7ICH A;  5HR6 A;  7ICM A;  1ZQB A;  3F53 A;  1NK8 A;  4DS4 A;  3EUB 2;  3QEB Z;  5F9N A;  4RUA A;  3BS7 A;  3CW2 C;  4JV0 A;  2ZJ8 A;  4QW9 A;  8ICI A;  3TFS A;  5EWE A;  9ICB A;  2H3Q A;  3WK5 A;  4DOA A;  1NOM A;  8ICR A;  9ICA A;  4NL9 C;  2OH2 A;  4KN7 A;  3SMV A;  5J2G A;  3RBE A;  4OD0 A;  1B22 A;  3KZI U;  4B9U A;  2F44 A;  4DEZ A;  4R8U A;  4B9M A;  1DRG A;  4Y2S A;  2HHV A;  1PK1 A;  4DOB A;  4B9L A;  3CYM A;  4YQW A;  4UB4 A;  1RPL A;  4DQR A;  4J9Q A;  1PK3 A;  1D9D A;  1SGG A;  1T8E A;  4FS2 A;  1TK8 A;  4MFA A;  1L7P A;  4DOC A;  2G0A A;  4KLL A;  2XIC A;  1ZQT A;  1B43 A;  4P4P A;  5L1M A;  4I2G A;  2I5H A;  3ONN A;  2XCP A;  1ZQW A;  4UAU A;  3BQ0 A;  1Q3U A;  2MAX A;  1JAL A;  2FMP A;  1SXD A;  3RH6 A;  4KLE A;  4F5O A;  4CDG A;  2B0C A;  2M0N A;  3HW8 A;  1A77 A;  4RUC A;  4Q8F A;  5AK6 A;  4LZG A;  3UMB A;  7ICP A;  4NLK A;  4CF5 A;  4OJ6 A;  2PKE A;  4KX5 A;  4J03 A;  4U7C A;  1VDV A;  4IRD A;  5KFA A;  4RU9 A;  3UQ2 A;  1VLB A;  1D8Y A;  2P66 A;  3WK7 A;  2MRL A;  2GO7 A;  3HPO A;  3AU2 A;  2K8B B;  4RT2 A;  5J2B A;  1N62 A;  3ISC A;  5T14 A;  2JEG A;  4NWI A;  1BNP A;  4IS7 A;  5AKJ A;  1WYG A;  5L1J A;  4ICA A;  2XID A;  3BZC A;  3QZ7 A;  2R8K A;  2MU2 A;  9ICP A;  7ICE A;  5AKH A;  2C22 A;  4F2S A;  2R8G A;  1FEZ A;  3KTQ A;  5IIO A;  9ICH A;  4UB6 U;  4P0Q B;  5KFW A;  3PW7 A;  4QIW C;  1TAQ A;  5DGB A;  2F8K A;  3H0R B;  5AI4 A;  9ICM A;  3TAD C;  2XCA A;  2OHF A;  4I29 A;  1DK2 A;  5KG1 A;  4QWA A;  2WAQ F;  3PX6 A;  4QZB A;  3CNH A;  4KLT A;  1KFT A;  8ICF A;  4ED3 A;  5J2H A;  4QJF B;  2D8C A;  4F5R A;  4CF4 A;  4KIT B;  4I27 A;  1Z19 A;  4ED1 A;  3SEI A;  3QUB A;  2KG5 A;  4DQQ A;  4Q45 A;  2BZF A;  3HKZ F;  3BDP A;  2ZIW B;  4B6J A;  3HWT A;  3KZX A;  1OXJ A;  4XA5 A;  4TUQ A;  2H3V A;  2IHM A;  2FLN A;  5ALO A;  4C7Y A;  3PV8 A;  4DQI A;  1ZQG A;  4NM2 A;  2QB0 B;  4ED0 A;  1ZD2 P;  1Y88 A;  4DFP A;  3RJH A;  3GQC A;  3U26 A;  3THV A;  1SL2 A;  2HHX A;  5DG8 A;  4M9N A;  1LVH A;  3HT3 A;  5KG4 A;  2JZB B;  2ZJ5 A;  4QZA A;  4U6P A;  9ICW A;  5AKE A;  2V4R A;  5AK3 A;  1X2I A;  2FPM A;  3HX0 A;  4ECW A;  3MGI A;  2NRW A;  4Z6F A;  8ICQ A;  1JRO A;  4M9H A;  5KG0 A;  4YXJ A;  1BPB A;  4QZH A;  1TVA A;  2HCF A;  2WF7 A;  3KFU F;  3UXN A;  4EEY A;  3C5G A;  4YVZ A;  2BPC A;  1HUO A;  3KD3 A;  4OJO A;  4XQ8 A;  1DXS A;  3WU2 U;  2DKZ A;  1T94 A;  4USA A;  4C4S A;  9ICL A;  5CWR A;  3ALR A;  3V72 A;  4O5E A;  2QB1 A;  5III A;  3UXP A;  1VJ5 A;  1XO1 A;  1NJW A;  4EEL A;  2MSN A;  3Q8P B;  1ZJM A;  4FE3 A;  1SZH A;  3G6Y A;  9ICS A;  1ZD5 A;  5KFD A;  5AKI A;  5AM3 A;  1KN5 A;  1XS9 D;  8ICC A;  1YZ7 A;  5D46 A;  2HDO A;  1X40 A;  1RYU A;  2LYH A;  3PNC A;  4KMO B;  5DBB A;  3PW0 A;  4IR1 A;  5AKX A;  8ICU A;  1SB3 C;  4KLO A;  3I28 A;  1N61 A;  2D3D A;  3D2N A;  8ICA A;  3V7J A;  1YZ6 A;  5DDY A;  1QLN A;  4F3O A;  4FFD A;  1KBU A;  2KZM A;  3H0L B;  3F2B A;  3PO5 A;  5JU5 A;  5AM4 A;  1L3S A;  3DEE A;  3V6K A;  3SD7 A;  3MFH A;  1NJZ A;  1ZQJ A;  2PI5 A;  3Q8Q B;  4EEN A;  5CB1 A;  2RP5 A;  1JIH A;  1NKE A;  2G08 A;  3DDH A;  2XC9 A;  1Z00 A;  4DFJ A;  3IRU A;  5J0S A;  1U45 A;  4YMO A;  2NRZ A;  3E58 A;  2ZTC A;  4C4R A;  1TK5 A;  5FP0 A;  4QIW F;  2BKE A;  3G6V A;  5J0Q A;  2HMX A;  5DQG A;  5J2F A;  2Z7J A;  2LBO A;  1T7P A;  2HBL A;  1BVS A;  5E79 U;  4J9O A;  3NUQ A;  3T79 A;  4I2D A;  5AKL A;  3D6J A;  5J0Y A;  4NXZ A;  3PX4 A;  5AKK A;  3PO4 A;  2ZIX A;  1K5O A;  5ALR A;  1ECW A;  1JMS A;  2V9W A;  2LKY A;  4F71 A;  3PW4 A;  7ICF A;  9ICK A;  5CA7 A;  4I28 A;  4KLS A;  1ZQC A;  2AGQ A;  2K8C B;  5KTQ A;  4RNM A;  2F76 X;  3F2D A;  1N60 A;  1BPY A;  4I2C A;  5KFP A;  4CE6 A;  1MQ3 A;  3KHL A;  4CGZ A;  2IBK A;  4NL9 A;  5J2K A;  3MDC A;  3KKA C;  4O3N A;  5KFN A;  4M6W A;  5DDM A;  1TKD A;  4YFK A;  3H4B A;  4O3Q A;  4NLC A;  3LVW A;  1ZQS A;  4XRH A;  4C8O A;  2VIX A;  2LI6 A;  3ZDD A;  7ICR A;  3SAH A;  7ICO A;  4PZO A;  5DLF A;  1L7M A;  1NK0 A;  2BCU A;  1QH9 A;  2KHV A;  3QUQ A;  5F3X B;  3A0B U;  4FBT A;  3SEN A;  1UQV A;  5J2I A;  5DG7 A;  2BGW A;  1RYS A;  4O3S A;  1BNO A;  5KFS A;  3V6J A;  3SV3 A;  5DB6 A;  2KJ8 A;  4EX6 A;  2E3T A;  3M1Y A;  3RB0 A;  4QZ8 A;  4K4H A;  2KZZ A;  1SXE A;  5KFL A;  2EDU A;  3BQ1 A;  2F2A B;  4RQ2 A;  2C28 A;  2EZX A;  5G5H A;  4DL7 A;  5TZV A;  1JX4 A;  2JEF A;  4QZC A;  3TAR A;  9ICG A;  3QU7 A;  2K4I A;  5KL8 B;  4DQP A;  4A8E A;  7ICQ A;  4BXO A;  3N7S C;  4G9B A;  1SV4 A;  1WCN A;  4P0P A;  2AU0 A;  2D6F C;  2E8P A;  3K1Z A;  7ICJ A;  8ICH A;  3M6K A;  2W9M A;  2UVV A;  7ICK A;  2EZY A;  3AL0 B;  4I2J A;  4DL4 A;  7ICG A;  5CR0 A;  1S9F A;  1NKB A;  2KJ5 A;  2H3I A;  4F8R A;  2ZIU A;  5KAI U;  2WF8 A;  4MF8 A;  4JV1 A;  3OHA A;  1L8L A;  1MA7 A;  2C2D A;  2Y1I A;  2G5H B;  5KFO A;  2LHT A;  3BS5 A;  3RJJ A;  5EE9 A;  4ED7 A;  3UQ0 A;  5KT4 A;  3LDA A;  3SQI A;  3NAS A;  2OEH A;  1RQL A;  2F8L A;  2DGZ A;  1PVP A;  4YXM A;  2BHN A;  5KT6 A;  9ICI A;  5AK5 A;  2VA2 A;  1EXN A;  3NVV A;  1NKC A;  2ZUB A;  2ZXI A;  1QCK A;  2KZ3 A;  2YB4 A;  5AM0 A;  5ALI A;  2W9B B;  3TAD A;  4UAW A;  1XSN A;  5L1K A;  2JV3 A;  9ICN A;  4DF8 A;  3O0F A;  3NS1 A;  1ZQP A;  2MA1 A;  2OXO A;  3RJG A;  3OSP A;  4KLM A;  2R8H A;  5ALT A;  5DLG A;  5IIN A;  1J2N A;  1X9S A;  3H8S A;  9ICX A;  2Q4T A;  5DBA A;  5ALJ A;  2GLE A;  2P6U A;  1F0M A;  4QW8 A;  3K1R B;  3SYZ A;  4DSK A;  8ICO A;  2ZIV B;  3RB4 A;  1ZQK A;  1KDH A;  1Z00 B;  2A19 A;  5KFM A;  5DG9 A;  3VC8 A;  3ISB A;  3AM9 A;  3PMN A;  4FZN A;  2EAO A;  4P4O A;  1HUZ A;  2BQR A;  3UPQ A;  2HI0 A;  5KG6 A;  1BPE A;  4Q44 A;  1L7O A;  4EBD A;  1MQ2 A;  2C2R A;  5DQH A;  2GH1 A;  1ZJN A;  4DWI A;  2ZTD A;  2KMD A;  3NVZ A;  5L9X A;  2F1H A;  3JPN A;  3H8W A;  2K4P A;  2B21 A;  2E1E A;  5KFG A;  2JEJ A;  3KHR A;  3H7I A;  4PHE A;  4CCH A;  4RPY A;  3L3F X;  1S97 A;  5DQI A;  3L4P A;  2IOH A;  5J29 A;  2W9C B;  8ICW A;  2XGQ A;  1L3V A;  3IV6 A;  2W9A A;  1XO0 A;  2ASJ A;  2HW3 A;  2ZG6 A;  5D49 A;  4QNL A;  2PFO A;  4QZI A;  1AQ6 A;  3UXO A;  3C1Z A;  4IR9 A;  3ORY A;  4Z6C A;  5EWF A;  5G5G A;  5KT7 A;  3RRH A;  4M04 A;  1TV9 A;  1L7N A;  7ICV A;  1CRX A; 
#chains in the Genus database with same CATH homology
 3O0F A;  3ICX A;  2R18 A;  2F77 X;  3N7P D;  4NLB A;  1NZB A;  2KHV A;  4CDG A;  2K4H A;  2M0N A;  2MA1 A;  2HOQ A;  2OXO A;  3DEE A;  4KX3 A;  4OJ5 A;  2W03 A;  2DQN B;  2OYY A;  1IIP A;  2HBM A;  2JHD A;  3PST A;  5KL1 B;  2KNJ A;  2HOI A;  2KJ8 A;  2VKQ A;  2RP5 A;  1URJ A;  2K89 A;  3E0F A;  1PVR A;  4U6P A;  1Z1B A;  4OJ6 A;  5CRX A;  2JMG A;  2G08 A;  4KX5 A;  2Q4T A;  4U7C A;  2G06 A;  3NRW A;  2XVT A;  2KVC A;  3F5E A;  3RFA A;  5HR6 A;  2N1R A;  2OM6 A;  1UPH A;  2G5I B;  3F53 A;  4OJP A;  2F2A B;  2KD1 A;  3IG5 A;  4CRX A;  2G09 A;  2K4E A;  2MRL A;  2RHF A;  2G07 A;  3CP8 A;  2LYB A;  2E1F A;  4BJQ A;  4ACO A;  2K8B B;  4BUG A;  2ZIV B;  2BDU A;  1XNS A;  4O3M A;  3OPX A;  2K4I A;  4FZL A;  5T14 A;  4OO1 J;  4P0Q A;  2KIW A;  4NWI A;  2LYA A;  1GO3 F;  4NV0 A;  4QIW F;  2H3Q A;  5KL8 B;  2KKP A;  3VC8 A;  4A8E A;  1YT3 A;  2CN1 A;  3N7S C;  2XID A;  4FZN A;  4ICA A;  2HMX A;  3KFU F;  3PSI A;  2Z7J A;  2LBO A;  3F2B A;  1ED1 A;  4P0P A;  2H3F A;  2HBL A;  3D2Q A;  2D6F C;  2CRX A;  3NUQ A;  3K1Z A;  5HR7 A;  3M6K A;  2OH2 A;  3T79 A;  1Q3V A;  2KJ9 A;  3IG8 A;  4OJO A;  2HBJ A;  4P0Q B;  3RF9 A;  3AL0 B;  3D2S A;  2WB1 F;  2W7O A;  4QIW C;  3SAF A;  3SMV A;  3AQE A;  1T94 A;  1WUD A;  3MGV A;  2KJ5 A;  1HEK A;  2ZIX A;  2GH1 A;  1HIW A;  3IN5 A;  3ALR A;  2DF4 B;  3AQF A;  3LVV A;  2H3I A;  2CPR A;  4AYB F;  4C0Z A;  1A6S A;  2PMZ F;  2ZIU A;  2RRD A;  2VJ4 A;  3H0R B;  1D8B A;  1ZQ1 C;  2HOF A;  3CRX A;  1OUQ A;  1ECW A;  1DRG A;  4PL2 A;  2E1E A;  3F2C A;  2A3V A;  5A0L A;  4BX9 C;  2LKY A;  2WB1 C;  1MA7 A;  3LYS A;  2WAQ F;  2YX8 A;  3CYM A;  4FE3 A;  1SZH A;  2G5H B;  2LHT A;  3C28 A;  4AYB C;  2JH1 A;  2W7P A;  2YB1 A;  4QJF B;  3L3F X;  2KIC A;  2ZIW A;  4GFJ A;  3SAG A;  1L6N A;  3F5A A;  3GZF A;  3PSF A;  2KV2 A;  3PZP A;  3SQI A;  3C29 A;  3H0M B;  3N7R C;  2F8L A;  2K8C B;  1Z19 A;  2F76 X;  2WAQ C;  2ZXH A;  3F2D A;  2DGZ A;  2Y0S F;  4P0P B;  2E5S A;  3IP4 B;  1PVP A;  2H3Z A;  2KEY A;  2XI9 A;  3HKZ F;  4CGZ A;  2NV3 A;  2W04 A;  4KMO B;  2G0A A;  2HBK A;  3M7D A;  1A0P A;  2ZIW B;  1XO0 A;  2XIC A;  2KOB A;  2JH7 A;  1PVQ A;  3GU3 A;  1F44 A;  2ZG6 A;  1TAM A;  2ZIV A;  1P7D A;  3KZX A;  2K8A A;  2VJ5 A;  4QNL A;  3PSP A;  3LVW A;  3ONN A;  2ZIX B;  4JMU A;  4NLC A;  4PL1 A;  2ZXI A;  2H3V A;  3D2N A;  2GOL A;  2Y0S C;  2YB4 A;  1Q3U A;  2VIX A;  2ZIU B;  4WJ3 B;  2PMZ C;  5C0Y A;  3HKZ C;  2KHQ A;  1KBU A;  3SAH A;  2KKV A;  2JGA A;  4FZM A;  3VCB A;  4OJL A;  3H0L B;  3M6Z A;  4IC9 A;  1CRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...