2H3ZA

Structure of the hiv-1 matrix protein bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 38
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3zA01
4JMUA 2H3ZA 4IC9A 1ED1A 2H3IA 2N1RA 1HEKA 2K4IA 1HIWA 2NV3A 2JMGA 2H3FA 2H3VA 1A6SA 2LYAA 1L6NA 2K4HA 1ECWA 1TAMA 4ICAA 2HMXA 2H3QA 2GOLA 2LYBA 1UPHA 2K4EA
chains in the Genus database with same CATH superfamily
3IHQB 4KLJA 2ZIUA 2C2DA 4KN4A 4J9PA 4DEZA 2I6XA 5J2FA 2EZYA 1QTMA 2W9CA 2IOFA 2A3VA 1X2IA 3UXPA 1QH9A 1X42A 3SENA 3OJSA 3ZDCA 1BPXA 4QWBA 4NV0A 4DOBA 5ALWA 4ECWA 5AKEA 5KL8B 3PO4A 2E8PA 7ICHA 4P0QA 1JX4A 5DDYA 4NL9C 5KFOA 3F5EA 1KLNA 2MUTB 1HJPA 3I76A 2KEYA 1QLNA 4UB5A 4F5OA 2WF5A 5AI8A 3N4MB 2KIVA 1RYRA 9ICXA 2XI9A 3HJEA 3Q8RB 4BXOB 2FJ6A 8ICIA 3NVYA 5J0QA 2HOIA 1Y88A 4Y2VA 9ICPA 3R9KA 3MR6A 5L1LA 1JXEA 2E8OA 5J2CA 1C20A 1KEJA 1A0PA 4DFKA 2KP7A 2FE9A 1J2NA 2H3FA 4C8NA 3PX0A 3JPPA 5KFFA 2AGOA 4OO1J 4NLKA 3MC1A 5BPCA 3EPGA 2AHOB 2F8KA 4IRDA 2ZXIA 4G9BA 1D8BA 4DS5A 5AKGA 1KQQA 1ED1A 3PSPA 3LVVA 2H3IA 4QNLA 3HT3A 1WUDA 5IIJA 2DQNB 3ISCA 1J2MA 4RQ8A 1SL0A 2F3NA 3TADA 5IILA 4WJ3B 1WWVA 5J0WA 8ICJA 4DCCA 1ZRMA 4DQQA 3LVWA 2ZIUB 3UMGA 4M9LA 3BQ2A 1NKCA 2ZIVB 3RBDA 2F44A 5J0SA 2CRXA 2HHQA 3T79A 3KTQA 5KFGA 7ICEA 5DDMA 3MFHA 2W55A 1V97A 4LJXA 2BCVA 2XICA 3IG5A 2MSNA 4EYHB 4YMOA 4DFJA 4KLTA 2IOFK 5KFRA 2PFNA 4QZEA 3GDXA 1UPHA 4I2EA 1N60A 1ZQHA 4ECTA 5FP0A 3BJYA 3ZD8A 5KNIA 2G0AA 2W7OA 3RH5A 2HBLA 5KFAA 3OTQA 4QZDA 3EWAA 4I2AA 4O3RA 4Z6CA 1D9DA 1A76A 3WK9A 4PGXA 3FC4A 2LYHA 4ELVA 3QU9A 4GLXA 3N28A 3GIKA 4I29A 1YT3A 2W8LA 1ZQOA 1F44A 4RQ0A 4ELUA 4IQTA 5ALNA 4J9MA 5CA7A 3M7DA 5KFPA 5EE0A 2BCRA 4R8UB 9ICGA 2RDJA 5ALEA 3D2QA 2KZ3A 3V7JA 4FO6A 1NK4A 4Q43A 2ZIWA 2IA6A 2JEGA 1JI7A 2H3ZA 3TADC 1S0OA 3FM9A 2NRVA 2KZMA 5GTIU 3PW5A 5H2FU 3UQ2A 5KFZA 2GLEA 5D4BA 5AKJA 7ICIA 5KT6A 4EEKA 1DK2A 2RRDA 1XNSA 3PW4A 5DBAA 1S0MA 1XC9A 1L3UA 2W43A 5AK3A 3OPXA 4YQWA 4KMUA 4RT3A 4J9OA 3G6VA 2EZZA 4QZCA 3JPOA 2WF9A 1X9XA 2A1JB 1BNOA 3QXGA 2IHMA 1MN8A 3T5LA 2Y0SF 1A77A 5ALHA 4CF5A 3QUTA 1ZQUA 1ZQNA 3L5KA 2WF7A 2G07A 4M9JA 3M8RA 3HX0A 3MGIA 1IXRA 3RAQA 8ICMA 2LM1A 2B0CA 2EZXA 3Q8SB 1NK5A 4F4YA 2BCUA 4F5QA 1O03A 3GILA 4GIBA 2F2AB 3QU2A 2D8CA 1M6YA 2A1JA 5AICA 5ALPA 5KFCA 3SMVA 2QLTA 2HHTA 2I9GA 4EBDA 4DL2A 1N63A 2ZIXB 1BPBA 3IP4B 2PMZC 2VJ5A 5AI9A 1DOQA 1FFUA 2MUTA 2KV2A 4YXMA 3ZD9A 5J2BA 2A1AA 3N7PD 3QZ7A 4ECSA 3SQIA 4KLLA 8ICGA 5ALFA 3BQTA 1QSYA 2ISPA 2JZBA 8ICQA 4U6PA 3WK8A 1XU4A 4O9MA 4RUAA 3M6ZA 2IMWP 1ECWA 2AQ0A 4Y2YA 1NK7A 3ETRA 5ALJA 3M9MB 4KTQA 5HHIA 4RQ6A 1YZ7A 4X5VA 4O3OA 5AHXA 1TVAA 1ZD2P 1NJWA 1L3VA 7ICOA 3OHBA 5ALKA 3O0FA 2AJQA 5AKZA 3C28A 4DSJA 3H40A 1U48A 1L7OA 2JEFA 3QEBZ 3D2NA 1KSPA 5J2IA 5F9NA 3B0YA 4Y2JA 2VIXA 4EYIB 5KL1B 1LV5A 4O3PA 8ICRA 2XY6A 4MEYA 4JV1A 4J9KA 5HR6A 4Q44A 2GOLA 1O08A 2HBKA 1NJXA 4QW9A 1KDHA 1X66A 3GU3A 1VLBA 5IINA 2M0NA 1H38A 3MR2A 2HOFA 1S76D 1S10A 4DQRA 4FZMA 1PVRA 1NK8A 2JXJA 1NK9A 3BS5B 4QIWC 2LBOA 5AM1A 3AMZA 1U45A 1K1SA 4UAUA 1LVHA 1N2XA 3QU4A 2XCAA 4FBUA 8ICZA 1PVPA 1FEZA 1L8OA 3AU2A 2MU2A 2BDUA 1X6JA 5AM0A 2G5HB 4LZGA 3Q8QB 3AU6A 1X40A 4C8OA 3PW0A 5A0LA 2F76X 5AKLA 4F4KA 2ZTCA 4B9TA 3VCBA 1D8LA 1F5SA 1VDVA 3RJGA 2JEJA 9ICJA 3RRGA 1BPYA 2FPLA 3CP8A 1XSLA 2W04A 5J2DA 2EAOA 3IDWA 3C29A 3SI8A 7ICSA 4IQVA 3LYSA 4BWJA 4YP3A 1ZQZA 5JTIA 2OXOA 2Y0SC 2BPFA 9ICFA 3Q8KA 5DQGA 3NVZA 4TQRA 1SB3C 5ALMA 4OJ6A 4JB3A 2KJ8A 3TFSA 1UT8A 1XWLA 1IIPA 2R18A 3ONNA 1D8YA 2V4RA 1TFRA 2LMRA 4BJQA 1N48A 2Y9TA 5KG6A 3PR4A 3MBYA 3RFAA 3QU7A 1JUDA 1UHUA 3ISBA 3N7RC 3C5GA 1MSWD 1SKSA 1L5UA 2HHXA 3JPNA 2KFZA 3TI0A 3GV8B 4IS7A 8ICKA 2DF4B 1V38A 3TKAA 3BS7A 3AN1A 1SV4A 3E2EA 3A0BU 5JU5A 1SWWA 5ALOA 1X9SA 4Y2RA 1IV8A 4OJ5A 2BZFA 2C2EA 2E1FA 4YVZA 5KFSA 1CEZA 2P66A 4YMNA 4FE3A 3RJJA 4C80A 4I2HA 1B43A 1U9LA 2KNJA 3MFIA 2FLLA 2KOBA 2KG5A 4JWMA 2F1IA 4YD2A 1ZD5A 2W54A 2D3DA 1KTQA 1JROA 4PHDA 3CNHA 3ICXA 3E58A 4ELTA 3RJKA 1MQ3A 1SXEA 3M6KA 2KSOA 5KFYA 2XCPA 3V7KA 5DG9A 3RJIA 2HDOA 2FI1A 1NKEA 1T7PA 4XA5A 2G5IB 2M9NA 2XGPA 2K4EA 5ALDA 4MEXA 3FYHA 5KT4A 5D46A 4Y2TA 8ICFA 2W9CB 4DSFA 5ALUA 1NKBA 5ALSA 2E5SA 1ZOLA 4GC6A 1T8EA 3QEAZ 4Q8EA 2CXYA 5KG4A 2AGPA 4RPYA 4QWEA 3IV6A 5KTQA 3MGHA 1RYUA 4RQ3A 2ASLA 4IQUA 1ZQSA 3MABA 1Z4NA 3PX6A 1SXDA 4UARA 2LPEA 2IHNA 3Q8LA 3SAGA 2AU0A 4NM1A 4DOAA 5KFXA 4B9LA 2KMDA 1N5XA 2UVWA 4M6WB 3RH6A 4YXJA 4F72A 2ESEA 5L1IA 2ZXHA 3SYZA 5J2HA 5HR7A 2BQ3A 2KIWA 1K1QA 4UBCA 1WWUA 3KHRA 4UAZA 5AM5A 4ZOHC 1UA0A 4IC9A 4OJPA 4PZOA 3AEVA 2IOHA 1FFVA 3PSTA 3GV5B 4BXOA 5J2JA 4BUGA 3RTVA 4IL6U 2HBJA 1KBUA 8ICBA 4DF4A 4LZDA 2DKZA 2W9AA 4DL3A 5KFUA 1KL9A 1WG8A 1X9WA 3OSPA 3C2LA 5J0XA 3LWMA 2NRZA 5DG7A 2C28A 4P0PB 4DLGA 3UXOA 5IIIA 4ECVA 2BGWA 2PMZF 5F3XB 4DL5A 4R63A 7ICNA 4ECYA 4PH5A 4DQPA 2R8IA 2QKQA 7ICQA 4NL9A 3UQ0A 2OH2A 2QB0B 2EANA 3SAFA 3FAHA 3HRDD 1SV0A 5HMMA 4O5KA 1B4FA 1LKYB 5KFNA 1ZQQA 1T94A 4DSEA 2RP5A 1TAUA 7ICVA 3EUB2 1FO4A 3H7IA 4PZNA 1ZQKA 2DBYA 1TK8A 3M1YA 9ICHA 3SEIA 5G5HA 4DO9A 3H4BA 4CDGA 3SV4A 3OHAA 3OJUA 4RQ2A 3K4GA 2XC9A 1UA1A 1V85A 3WKDA 2XO7A 1BPEA 1JXLA 4TURA 1LB2B 4M04A 8ICOA 5KFBA 2JH1A 3TARA 4UQGA 5EWEA 2FMSA 1HIWA 3L4PA 2H3VA 2KFNA 4KLHA 1AROP 4NY8A 2YB4A 3T5JA 3C5FA 3RAXA 2HOQA 3LK9A 2ZTDA 4ICAA 4I27A 8ICPA 5T14A 2YTUA 9ICBA 2AXTU 3DEEA 4TQSA 4J03A 1V9PA 5KT2A 1UQVA 2NV3A 2DPIA 3MGVA 2FPMA 3MR3A 4QZHA 3H0MB 1ZETA 2NO4A 2LYBA 5AK6A 2YB1A 1BGXT 2HCFA 2NRTA 4RPZA 8ICNA 3C21A 3ORYA 9ICSA 4DFMA 2OM6A 1QCKA 3AUOA 1Q8KA 2DWQA 2QARA 2YMLA 4F50A 2WAQC 1RXVA 1S97A 1XO1A 2G06A 4UB2A 4FZNA 3RR8A 4QIWF 3V6KA 1XSPA 4AP9A 4RQ1A 5KG2A 2ISOA 5KFLA 4UB4A 2KVSA 3IG8A 3M9OB 2XY7A 4EEYA 1SV0C 4I2IA 3PMNA 8ICVA 4QZAA 4F5PA 1CUKA 3MR5A 2KKVA 3PSFA 2PFPA 5G5GA 2LM4A 3HW8A 4YFKA 3NUQA 1D9FA 4KLGA 3PY8A 3EPIA 3M9NB 4IR1A 4JV2A 2B6GA 1ZQXA 3WKEA 4UW9A 4KLFA 2JV3A 5KAFU 4J9SA 2ASDA 4KLDA 1AQ6A 4UAVA 1T3NA 4YCXA 1WYGA 2ZJ8A 3C2MA 3PV8A 2F77X 2BKEA 2BQRA 3BZCA 4GC7A 2FPKA 3B9JA 4R66A 4QZIA 2V4QA 4PL2A 5EE9A 5CR0A 1C7YA 5HMLA 4KLEA 8ICXA 1JRPA 4NLNA 3GIIA 4XRHA 4QZFA 8ICLA 3UMBA 4DFPA 2HHVA 1XS9D 3QNMA 1ZQGA 2JMGA 1CI4A 5DB9A 3ZDAA 1TKDA 5KFEA 1OUQA 5DB7A 1S9FA 1SKWA 3TAQA 2NO5A 3CW2C 5C0YA 4C7YA 1L7NA 7ICKA 5AI0A 4O5EA 2B21A 1RQLA 3ALRA 3NS1A 8ICTA 5J2EA 1COOA 2ZIVA 2E8MA 3G6XA 3LDAA 4K4GA 3K1RB 5J8YA 2A19A 7ICLA 4RQNA 5KFIA 1XSNA 3CRXA 3M8SA 1BVSA 4M6WA 3CYMA 2OCEA 2HHWA 1L7MA 1CRXA 4ECRA 1JIHA 2DKXA 4UBBA 4DQSA 3Q8PB 3RB0A 7ICPA 2F8LA 1QSLA 2BCSA 1L8LA 2J6UA 5KFHA 2GWSA 4KLIA 2FDRA 5DBCA 3GQCA 4ACOA 5CEHA 1PVQA 2YQEA 5ALQA 3WU2U 3F2DA 1EXNA 4OJLA 1KN5A 3LWLA 5KT5A 5KT3A 9ICRA 4ECXA 2ASJA 2JEIA 3WKAA 4FZLA 4DWIA 2EAPA 1QQ6A 4QZ8A 3H8JA 3L3FX 4UAYA 5ALGA 2G09A 5J8YC 2KTQA 5J0TA 3WK6A 1OW5A 4GXKA 4O5CA 2HHUA 2MAXA 1ZQMA 5K4LA 1X9MA 4C7ZA 4I2DA 2BPGA 5KG5A 2F1HA 4ED2A 1ZYQA 5GTHU 2OWOA 2DGZA 3EZ5A 1P7DA 5B5EU 4IR9A 9ICVA 5AKHA 5EOZA 1RQNA 1NNLA 3V72A 1ZQYA 3NGDA 2QB0A 4PL1A 4TUQA 3PNCA 3QZ8A 4JMUA 1ZJMA 1LKYA 4TUSA 2HVIA 3KHHA 2RQ5A 4EZ9A 4Y2QA 1NOMA 3RJHA 3DDHA 4ED3A 4O0IA 3THVA 7ICUA 5KFWA 4I2GA 2KHQA 1HUOA 3IN5A 4DSLA 5L1MA 1VJ5A 4QZGA 3D2SA 4F91B 2PI4A 2PKEA 4O3QA 4U7CA 4IRCA 3BQ7A 1U4BA 3ZDEA 1Z00A 2BR0A 4J9QA 1RZTA 4I2CA 1KFSA 4Y2PA 5DQIA 4KX5A 4MFFA 2KHVA 4DSKA 4K4HA 4OJOA 3F2BA 1RPLA 5J0PA 2PI5A 2YMPA 3H8MA 2YX8A 4GXJA 4EX7A 5JUMA 2WTFA 4RNMA 3H4DA 3E0FA 3FDSA 4JV0A 3PO5A 9ICOA 1X6IA 4AYBF 2W8KA 4FS2A 4DQIA 4BDPA 4PJ0U 5IIMA 4C0ZA 1K5OA 4J9LA 3MDCA 4UB1A 5AM2A 4PPXA 1FIQA 4UAWA 1QQ7A 2JHDA 4F2SA 4UASA 5KFDA 5KG1A 2KSOB 2DL0A 2UVUA 4MHVA 1UCVA 3PX4A 5KFJA 4F5NA 4QZ9A 1L7PA 3QUBA 5CJ7A 3UMCA 3RB6A 4KITB 2JH7A 2ZIWB 5DKWA 4YD1A 2VJ4A 1NJZA 4YG2A 4YMMA 2HMXA 2J6SA 2VA2A 3H8SA 2JZBB 2E3TA 2RDIA 3RRHA 3RR7A 1BNPA 1KRPA 8ICWA 2K4IA 5DQHA 4C4SA 4M0AA 3OSNA 4QWDA 5ALTA 3PW7A 4CCHA 2ZJAA 2ZUBA 2XIDA 2W3RA 2IBKA 2O6KA 7ICGA 4ED0A 1ZQEA 4HYKA 3Q8MA 2K8AA 3NRWA 4DF8A 4E0DA 1ZQWA 4CGZA 2UVRA 3KHGA 4B6JA 2W9BB 4KLQA 3RB4A 4P4OA 4CF3A 4IQWA 4F71A 4UB3A 4FBTA 2HI0A 5KG0A 3TQ1A 5ALXA 2EH9A 1RM6C 3C1ZA 2KN7A 3T5HA 8ICEA 3SR6A 2AGQA 5L1KA 3HKZF 3B0XA 3H8WA 4C4RA 1MQ2A 4DSIA 4EBEA 3QX7A 8ICSA 1WCNA 2VANA 2HW3A 1NJYA 5AI4A 3MDAA 5ALIA 3T3FA 4DL6A 2W9BA 2R8JA 1PK3A 1ZQBA 2WHEA 1PK1B 4DOCA 2WB1C 1ZD3A 1HEKA 1ZXIA 2I1QA 1SGGA 4P2HA 2FLPA 3WKBA 9ICKA 1N62A 4Z6FA 4GFJA 3GIJA 4EENA 4F4XA 3G6YA 2D6FC 2ZIXA 5ALRA 1COKA 5KFTA 3WK5A 2UVVA 2OEHA 1DGJA 9ICUA 5AIBA 9ICLA 3KZIU 3U26A 4YR2A 2ATLA 2G08A 5J2GA 4NXZA 4KN7A 8ICYA 1Q46A 4EX6A 2AQ4A 4P0PA 4CF4A 1JN3A 1JALA 2KE7A 2E8NA 2WAQF 3IRUA 4ECZA 2AH5A 4FFDA 2FLNA 4KMOB 2W3SA 5CP2A 2ZG6A 1WCLA 4NJ8A 4JUZA 4DLEA 2CN1A 1N61A 4NM2A 9ICMA 2DPJA 4KLSA 2E1EA 1PK1A 5EWGA 1BPDA 1Z1BA 4RQ7A 3SV3A 5J0RA 3K75D 3UM9A 1N5WA 2HSZA 4EZ6A 5DGBA 2R8HA 4OD0A 1SL2A 3UPQA 1ZQPA 1ZQDA 3BQ1A 4F3OA 5BOLA 2PXIA 4B9NA 2N1RA 4YN4A 5AI6A 4QW8A 4RZRA 3F53A 4Z6EA 1L6NA 3QU5A 4F92B 2P6UA 1ZQLA 1ZQFA 1PUZA 5BOMA 2OYYA 5E79U 4RNOA 1S77D 2H3QA 5DG8A 2W03A 2KJ9A 2NYVA 5IIOA 4MFAA 5AM3A 4R8UA 3J81j 4G3IA 2QARB 1NK0A 1TK0A 4I28A 7ICMA 9ICTA 2WF6A 3SAHA 4UB8U 1TAQA 1A6SA 2LYAA 3QE9Y 3F5AA 4RNNA 5F9LA 1Z3EB 2WF8A 2BPCA 5AKKA 5C5JA 4M2YA 2F1JA 2P35A 3HKZC 2ZTEA 4KLOA 3H0RB 4P4PA 5KFVA 3TFRA 2L5YA 1TK5A 3WKCA 2HVHA 3WK7A 4Y2UA 4ZH4A 1UT5A 1OXJA 4F4ZA 5IIKA 1SIJA 1TV9A 5CWRA 4I2JA 4O3NA 5KAIU 2K60A 4RUCA 3KHLA 3HPOA 5CB1A 3I1YA 4CE6A 5AM4A 2V9WA 2BCQA 2KICA 2KK0A 4XQ8A 3SD7A 4GXIA 8ICHA 3ZDDA 4MF2A 5KFKA 3NTUA 5AI5A 4USAA 2C2RA 3BDPA 5L1JA 1B22A 4BGDA 5D49A 2CPRA 5DB8A 2KJ5A 3ISDA 1SWVA 1S5LU 2VA3A 3JPTA 2EDUA 2VKQA 3HILA 2LHTA 3C1YA 5J0UA 4P4MA 3KFUF 5EE1A 5DBBA 5ALZA 4M9GA 4M9HA 4LVSA 5AK5A 2PFQA 2HHSA 4CRXA 3QUQA 2KZZA 5AKYA 4F8RA 4B9VA 1KW4A 2H5XA 4UB6U 7ICTA 4YR0A 3HP6A 3I28A 4M9NA 3K1ZA 4AYBC 1U47A 4C8KA 3JPRA 4RT2A 4ECUA 4B9MA 1MA7A 4I2FA 9ICWA 9ICEA 5KFQA 4F4WA 2MRLA 4QWCA 9ICCA 7ICFA 8ICCA 3PR5B 4DL7A 7ICJA 3SZ2A 1TE2A 4RQMA 2XVTA 1IM4A 1N56A 1QQ5A 9ICIA 5KT7A 4JWNA 3WK4A 1DRGA 2YY6A 3RJEA 2ZUCA 3AL0B 4UATA 4QJFB 5AKIA 2ZUDA 1NK6A 3KD3A 4ED7A 4PHPA 1J97A 4R65A 2K8BB 1ZQ1C 5KFMA 3V6HA 2K4HA 1F0MA 4P0QB 4TUPA 3PW2A 1ZQRA 2R8KA 2JGAA 4J9NA 9ICNA 1U49A 1KFDA 3NVVA 4PGQA 3RBEA 3BZKA 2PFOA 8ICUA 3ED5A 4FS1A 1RDFA 4Q45A 2OHFA 3KZXA 3AQEA 1GO3F 5TISU 1BPZA 4ED8A 4OCZA 4RPXA 4O3SA 2LI6A 3BS5A 1RXWA 1ZQIA 2XGQA 5J0OA 1S0NA 4C4TA 2W7PA 4DS4A 2DUYA 4RU9A 3D6JA 4XUSA 5L9XA 4C8LA 5EE3A 5KG3A 1RYSA 1ZQAA 4M47A 3C23A 2WFAA 1QSSA 4BWMA 1ZQVA 2NRWA 2ALZA 4NLBA 1RG6A 1ZQTA 4CNQA 1DK3A 1S0VA 1ZRNA 8ICAA 2K89A 2KVCA 3PVXA 2HBMA 5B66U 5DLFA 1Z19A 2K4PA 2Y9UA 1T4GA 3KKAC 3GIMA 5DGAA 1ZJNA 1SZHA 2RLTA 4Y2SA 4ED1A 2K8CB 2W9MA 1NZBA 3KOOA 5JRTA 5DB6A 3RH4A 1Z00B 2QB1A 4O3MA 4B9UA 2BHNA 5ALVA 2ZJ5A 3BQ0A 2DFLA 4K4IA 1KKXA 4Z6DA 3F2CA 3T5KA 4C8MA 4IRKA 1YZ6A 4NWIA 1NI3A 1Z4OA 5KG7A 4J9RA 3ETLA 1Z1VA 1T3QA 5CHGA 4RQ5A 5TZVA 1S8OA 4US9A 3QUCA 1B0XA 2Z7JA 4YR3A 3A0HU 2GH1A 3JPSA 2MA1A 2GO7A 5AKXA 1DGSA 5ALYA 4PHEA 2JRZA 3C2KA 5EWFA 5J2AA 3N7SC 3HWTA 1IG6A 3QYPA 3JPQA 4PGYA 1Q3VA 1L3SA 3KBBA 4NLGA 3ZDBA 4ED6A 4US8A 5J29A 4R64A 2JR5A 1SL1A 5AK4A 4Q8FA 5AIAA 1ZQCA 3GV7B 4NLZA 2BDPA 3NVWA 3PZPA 1JMSA 2RHFA 4F2RA 4HAIA 3GZFA 2EQYA 2VA8A 1HUZA 5ALLA 4DL4A 5CRXA 1KFTA 9ICAA 4KLUA 3OGUA 5J0YA 3EYZA 1L3TA 7ICRA 2NRXA 1XO0A 4QWAA 4F5RA 4EBCA 3AQFA 3NRZA 2KD1A 4Y2XA 4JK1A 1Q3UA 1SKRA 2YN4A 4KX3A 2YMQA 3PMLA 2EAMA 2I5HA 4F93B 2C22A 3H0LB 4EELA 4MF8A 1URJA 4QZBA 2Y1IA 4B9SA 3ZI4A 4DFDA 9ICQA 1PZNA 5DLGA 4PHAA 2FMPA 2Q4TA 3VC8A 3TANA 2BQUA 3GFKB 3N97B 3S6JA 2WB1F 4KLMA 3TACB 3V7LA 1ZQJA 3NASA 3UXNA 2LKYA 1MC8A 4MFCA 3PSIA 1ZD4A 3IM1A 2ES6A 3RJFA 5J2KA 4A8EA 2KKPA 3DV9A 4BX9C 2ODGA 3KKAA 2J6TA 2R8GA 5HP4A 2P6RA 4I2BA 2W11A 4ECQA 4RQ4A 5HNKA 2YMMA 1NZPA 1SZPA 3RB3A 3RF9A 2Y1JA 1DXSA 3AM9A 1TAMA 2XY5A 5HHHA 3TAPA 3EW9A 3V6JA 4NLCA 2FMQA 2Q0ZX
chains in the Genus database with same CATH topology
2ZIUA 2KJ5A 3LVWA 1XNSA 2JHDA 2ZIUB 3ALRA 4JMUA 3O0FA 1T94A 2OXOA 2Y0SC 2RP5A 2ZIVA 3C28A 2ZIVB 2WB1C 2VKQA 3D2NA 3PZPA 2CRXA 2RHFA 3T79A 1HEKA 2LHTA 2E5SA 3IG8A 3SAHA 3GZFA 3KZXA 3OPXA 2A3VA 3AQEA 2VIXA 1GO3F 5KL1B 2JH7A 4OJ6A 2ZIWB 2LYAA 1A6SA 2XICA 3KFUF 2KJ8A 3CRXA 5CRXA 3IG5A 2VJ4A 2KKVA 3F5AA 3PSFA 1IIPA 4GFJA 4CDGA 2R18A 3CYMA 2KHQA 2HMXA 3IN5A 5HR6A 3ONNA 4NV0A 2GOLA 2HBKA 1UPHA 3NUQA 2W7PA 1CRXA 2D6FC 2ZIXA 5KL8B 4BJQA 3GU3A 2Y0SF 1XO0A 4P0QA 2F8LA 4CRXA 2M0NA 2HOFA 3AQFA 3SAGA 2KD1A 3RFAA 3F5EA 3HKZC 2JH1A 1Q3UA 3D2SA 3N7RC 4FZMA 4NLBA 2G0AA 2K4IA 4KX3A 1HIWA 2HBLA 2G07A 2W7OA 3H0RB 4U7CA 1PVRA 2G08A 2KEYA 4QIWC 2H3VA 2K89A 2KVCA 3H0LB 2HBMA 4ACOA 2LBOA 3K1ZA 4AYBC 1Z19A 4P0PA 1PVQA 2XI9A 2YB4A 1URJA 3F2DA 2ZXHA 4OJLA 2HOQA 2WAQF 2DF4B 4ICAA 2XIDA 5HR7A 2KIWA 5T14A 2F77X 1PVPA 1SZHA 1MA7A 2HOIA 2K8CB 4KMOB 4KX5A 2K8AA 2KHVA 2Q4TA 2ZG6A 3DEEA 1NZBA 4FZLA 3NRWA 4OJOA 4IC9A 2CN1A 4OJPA 4PL2A 3VC8A 2F2AB 1YT3A 2MRLA 3F2BA 4O3MA 1A0PA 3L3FX 4OJ5A 2NV3A 2WB1F 3PSTA 2E1FA 1F44A 2H3FA 4CGZA 2E1EA 2BDUA 2YX8A 4BUGA 3MGVA 1Z1BA 2HBJA 2G09A 3SMVA 3M7DA 4FE3A 2XVTA 3H0MB 3F2CA 2KNJA 1KBUA 2LKYA 2G5HB 2KOBA 2ZIXB 4NWIA 3D2QA 3IP4B 4OO1J 2PMZC 2VJ5A 3PSIA 3E0FA 2KV2A 2LYBA 2YB1A 1DRGA 3N7PD 4A8EA 5A0LA 2F76X 2KKPA 2ZIWA 3SQIA 3AL0B 4AYBF 2ZXIA 4BX9C 4P0PB 3ICXA 1D8BA 2H3ZA 2Z7JA 2GH1A 2KICA 3VCBA 4QJFB 1ED1A 3PSPA 3LVVA 2H3IA 2MA1A 2N1RA 4QNLA 4U6PA 2OM6A 3M6KA 2PMZF 3HKZF 2JMGA 3F53A 1WUDA 2K8BB 3N7SC 3CP8A 2DQNB 3M6ZA 1ZQ1C 3RF9A 4C0ZA 2W04A 2DGZA 1L6NA 2K4HA 1ECWA 1P7DA 2WAQC 4P0QB 2OYYA 1Q3VA 3C29A 1TAMA 2G06A 1OUQA 2OH2A 4WJ3B 2JGAA 3SAFA 2CPRA 3LYSA 4PL1A 2H3QA 4FZNA 4NLCA 5C0YA 2G5IB 2RRDA 2W03A 4QIWF 2KJ9A 2K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2H3Z A;  4IC9 A;  1ED1 A;  2H3I A;  2N1R A;  1HEK A;  2K4I A;  1HIW A;  2NV3 A;  2JMG A;  2H3F A;  2H3V A;  1A6S A;  2LYA A;  1L6N A;  2K4H A;  1ECW A;  1TAM A;  4ICA A;  2HMX A;  2H3Q A;  2GOL A;  2LYB A;  1UPH A;  2K4E A; 
#chains in the Genus database with same CATH topology
 3IHQ B;  4KLJ A;  2ZIU A;  2C2D A;  4KN4 A;  4J9P A;  4DEZ A;  2I6X A;  5J2F A;  2EZY A;  1QTM A;  2W9C A;  2IOF A;  2A3V A;  1X2I A;  3UXP A;  1QH9 A;  1X42 A;  3SEN A;  3OJS A;  3ZDC A;  1BPX A;  4QWB A;  4NV0 A;  4DOB A;  5ALW A;  4ECW A;  5AKE A;  5KL8 B;  3PO4 A;  2E8P A;  7ICH A;  4P0Q A;  1JX4 A;  5DDY A;  4NL9 C;  5KFO A;  3F5E A;  1KLN A;  2MUT B;  1HJP A;  3I76 A;  2KEY A;  1QLN A;  4UB5 A;  4F5O A;  2WF5 A;  5AI8 A;  3N4M B;  2KIV A;  1RYR A;  9ICX A;  2XI9 A;  3HJE A;  3Q8R B;  4BXO B;  2FJ6 A;  8ICI A;  3NVY A;  5J0Q A;  2HOI A;  1Y88 A;  4Y2V A;  9ICP A;  3R9K A;  3MR6 A;  5L1L A;  1JXE A;  2E8O A;  5J2C A;  1C20 A;  1KEJ A;  1A0P A;  4DFK A;  2KP7 A;  2FE9 A;  1J2N A;  2H3F A;  4C8N A;  3PX0 A;  3JPP A;  5KFF A;  2AGO A;  4OO1 J;  4NLK A;  3MC1 A;  5BPC A;  3EPG A;  2AHO B;  2F8K A;  4IRD A;  2ZXI A;  4G9B A;  1D8B A;  4DS5 A;  5AKG A;  1KQQ A;  1ED1 A;  3PSP A;  3LVV A;  2H3I A;  4QNL A;  3HT3 A;  1WUD A;  5IIJ A;  2DQN B;  3ISC A;  1J2M A;  4RQ8 A;  1SL0 A;  2F3N A;  3TAD A;  5IIL A;  4WJ3 B;  1WWV A;  5J0W A;  8ICJ A;  4DCC A;  1ZRM A;  4DQQ A;  3LVW A;  2ZIU B;  3UMG A;  4M9L A;  3BQ2 A;  1NKC A;  2ZIV B;  3RBD A;  2F44 A;  5J0S A;  2CRX A;  2HHQ A;  3T79 A;  3KTQ A;  5KFG A;  7ICE A;  5DDM A;  3MFH A;  2W55 A;  1V97 A;  4LJX A;  2BCV A;  2XIC A;  3IG5 A;  2MSN A;  4EYH B;  4YMO A;  4DFJ A;  4KLT A;  2IOF K;  5KFR A;  2PFN A;  4QZE A;  3GDX A;  1UPH A;  4I2E A;  1N60 A;  1ZQH A;  4ECT A;  5FP0 A;  3BJY A;  3ZD8 A;  5KNI A;  2G0A A;  2W7O A;  3RH5 A;  2HBL A;  5KFA A;  3OTQ A;  4QZD A;  3EWA A;  4I2A A;  4O3R A;  4Z6C A;  1D9D A;  1A76 A;  3WK9 A;  4PGX A;  3FC4 A;  2LYH A;  4ELV A;  3QU9 A;  4GLX A;  3N28 A;  3GIK A;  4I29 A;  1YT3 A;  2W8L A;  1ZQO A;  1F44 A;  4RQ0 A;  4ELU A;  4IQT A;  5ALN A;  4J9M A;  5CA7 A;  3M7D A;  5KFP A;  5EE0 A;  2BCR A;  4R8U B;  9ICG A;  2RDJ A;  5ALE A;  3D2Q A;  2KZ3 A;  3V7J A;  4FO6 A;  1NK4 A;  4Q43 A;  2ZIW A;  2IA6 A;  2JEG A;  1JI7 A;  2H3Z A;  3TAD C;  1S0O A;  3FM9 A;  2NRV A;  2KZM A;  5GTI U;  3PW5 A;  5H2F U;  3UQ2 A;  5KFZ A;  2GLE A;  5D4B A;  5AKJ A;  7ICI A;  5KT6 A;  4EEK A;  1DK2 A;  2RRD A;  1XNS A;  3PW4 A;  5DBA A;  1S0M A;  1XC9 A;  1L3U A;  2W43 A;  5AK3 A;  3OPX A;  4YQW A;  4KMU A;  4RT3 A;  4J9O A;  3G6V A;  2EZZ A;  4QZC A;  3JPO A;  2WF9 A;  1X9X A;  2A1J B;  1BNO A;  3QXG A;  2IHM A;  1MN8 A;  3T5L A;  2Y0S F;  1A77 A;  5ALH A;  4CF5 A;  3QUT A;  1ZQU A;  1ZQN A;  3L5K A;  2WF7 A;  2G07 A;  4M9J A;  3M8R A;  3HX0 A;  3MGI A;  1IXR A;  3RAQ A;  8ICM A;  2LM1 A;  2B0C A;  2EZX A;  3Q8S B;  1NK5 A;  4F4Y A;  2BCU A;  4F5Q A;  1O03 A;  3GIL A;  4GIB A;  2F2A B;  3QU2 A;  2D8C A;  1M6Y A;  2A1J A;  5AIC A;  5ALP A;  5KFC A;  3SMV A;  2QLT A;  2HHT A;  2I9G A;  4EBD A;  4DL2 A;  1N63 A;  2ZIX B;  1BPB A;  3IP4 B;  2PMZ C;  2VJ5 A;  5AI9 A;  1DOQ A;  1FFU A;  2MUT A;  2KV2 A;  4YXM A;  3ZD9 A;  5J2B A;  2A1A A;  3N7P D;  3QZ7 A;  4ECS A;  3SQI A;  4KLL A;  8ICG A;  5ALF A;  3BQT A;  1QSY A;  2ISP A;  2JZB A;  8ICQ A;  4U6P A;  3WK8 A;  1XU4 A;  4O9M A;  4RUA A;  3M6Z A;  2IMW P;  1ECW A;  2AQ0 A;  4Y2Y A;  1NK7 A;  3ETR A;  5ALJ A;  3M9M B;  4KTQ A;  5HHI A;  4RQ6 A;  1YZ7 A;  4X5V A;  4O3O A;  5AHX A;  1TVA A;  1ZD2 P;  1NJW A;  1L3V A;  7ICO A;  3OHB A;  5ALK A;  3O0F A;  2AJQ A;  5AKZ A;  3C28 A;  4DSJ A;  3H40 A;  1U48 A;  1L7O A;  2JEF A;  3QEB Z;  3D2N A;  1KSP A;  5J2I A;  5F9N A;  3B0Y A;  4Y2J A;  2VIX A;  4EYI B;  5KL1 B;  1LV5 A;  4O3P A;  8ICR A;  2XY6 A;  4MEY A;  4JV1 A;  4J9K A;  5HR6 A;  4Q44 A;  2GOL A;  1O08 A;  2HBK A;  1NJX A;  4QW9 A;  1KDH A;  1X66 A;  3GU3 A;  1VLB A;  5IIN A;  2M0N A;  1H38 A;  3MR2 A;  2HOF A;  1S76 D;  1S10 A;  4DQR A;  4FZM A;  1PVR A;  1NK8 A;  2JXJ A;  1NK9 A;  3BS5 B;  4QIW C;  2LBO A;  5AM1 A;  3AMZ A;  1U45 A;  1K1S A;  4UAU A;  1LVH A;  1N2X A;  3QU4 A;  2XCA A;  4FBU A;  8ICZ A;  1PVP A;  1FEZ A;  1L8O A;  3AU2 A;  2MU2 A;  2BDU A;  1X6J A;  5AM0 A;  2G5H B;  4LZG A;  3Q8Q B;  3AU6 A;  1X40 A;  4C8O A;  3PW0 A;  5A0L A;  2F76 X;  5AKL A;  4F4K A;  2ZTC A;  4B9T A;  3VCB A;  1D8L A;  1F5S A;  1VDV A;  3RJG A;  2JEJ A;  9ICJ A;  3RRG A;  1BPY A;  2FPL A;  3CP8 A;  1XSL A;  2W04 A;  5J2D A;  2EAO A;  3IDW A;  3C29 A;  3SI8 A;  7ICS A;  4IQV A;  3LYS A;  4BWJ A;  4YP3 A;  1ZQZ A;  5JTI A;  2OXO A;  2Y0S C;  2BPF A;  9ICF A;  3Q8K A;  5DQG A;  3NVZ A;  4TQR A;  1SB3 C;  5ALM A;  4OJ6 A;  4JB3 A;  2KJ8 A;  3TFS A;  1UT8 A;  1XWL A;  1IIP A;  2R18 A;  3ONN A;  1D8Y A;  2V4R A;  1TFR A;  2LMR A;  4BJQ A;  1N48 A;  2Y9T A;  5KG6 A;  3PR4 A;  3MBY A;  3RFA A;  3QU7 A;  1JUD A;  1UHU A;  3ISB A;  3N7R C;  3C5G A;  1MSW D;  1SKS A;  1L5U A;  2HHX A;  3JPN A;  2KFZ A;  3TI0 A;  3GV8 B;  4IS7 A;  8ICK A;  2DF4 B;  1V38 A;  3TKA A;  3BS7 A;  3AN1 A;  1SV4 A;  3E2E A;  3A0B U;  5JU5 A;  1SWW A;  5ALO A;  1X9S A;  4Y2R A;  1IV8 A;  4OJ5 A;  2BZF A;  2C2E A;  2E1F A;  4YVZ A;  5KFS A;  1CEZ A;  2P66 A;  4YMN A;  4FE3 A;  3RJJ A;  4C80 A;  4I2H A;  1B43 A;  1U9L A;  2KNJ A;  3MFI A;  2FLL A;  2KOB A;  2KG5 A;  4JWM A;  2F1I A;  4YD2 A;  1ZD5 A;  2W54 A;  2D3D A;  1KTQ A;  1JRO A;  4PHD A;  3CNH A;  3ICX A;  3E58 A;  4ELT A;  3RJK A;  1MQ3 A;  1SXE A;  3M6K A;  2KSO A;  5KFY A;  2XCP A;  3V7K A;  5DG9 A;  3RJI A;  2HDO A;  2FI1 A;  1NKE A;  1T7P A;  4XA5 A;  2G5I B;  2M9N A;  2XGP A;  2K4E A;  5ALD A;  4MEX A;  3FYH A;  5KT4 A;  5D46 A;  4Y2T A;  8ICF A;  2W9C B;  4DSF A;  5ALU A;  1NKB A;  5ALS A;  2E5S A;  1ZOL A;  4GC6 A;  1T8E A;  3QEA Z;  4Q8E A;  2CXY A;  5KG4 A;  2AGP A;  4RPY A;  4QWE A;  3IV6 A;  5KTQ A;  3MGH A;  1RYU A;  4RQ3 A;  2ASL A;  4IQU A;  1ZQS A;  3MAB A;  1Z4N A;  3PX6 A;  1SXD A;  4UAR A;  2LPE A;  2IHN A;  3Q8L A;  3SAG A;  2AU0 A;  4NM1 A;  4DOA A;  5KFX A;  4B9L A;  2KMD A;  1N5X A;  2UVW A;  4M6W B;  3RH6 A;  4YXJ A;  4F72 A;  2ESE A;  5L1I A;  2ZXH A;  3SYZ A;  5J2H A;  5HR7 A;  2BQ3 A;  2KIW A;  1K1Q A;  4UBC A;  1WWU A;  3KHR A;  4UAZ A;  5AM5 A;  4ZOH C;  1UA0 A;  4IC9 A;  4OJP A;  4PZO A;  3AEV A;  2IOH A;  1FFV A;  3PST A;  3GV5 B;  4BXO A;  5J2J A;  4BUG A;  3RTV A;  4IL6 U;  2HBJ A;  1KBU A;  8ICB A;  4DF4 A;  4LZD A;  2DKZ A;  2W9A A;  4DL3 A;  5KFU A;  1KL9 A;  1WG8 A;  1X9W A;  3OSP A;  3C2L A;  5J0X A;  3LWM A;  2NRZ A;  5DG7 A;  2C28 A;  4P0P B;  4DLG A;  3UXO A;  5III A;  4ECV A;  2BGW A;  2PMZ F;  5F3X B;  4DL5 A;  4R63 A;  7ICN A;  4ECY A;  4PH5 A;  4DQP A;  2R8I A;  2QKQ A;  7ICQ A;  4NL9 A;  3UQ0 A;  2OH2 A;  2QB0 B;  2EAN A;  3SAF A;  3FAH A;  3HRD D;  1SV0 A;  5HMM A;  4O5K A;  1B4F A;  1LKY B;  5KFN A;  1ZQQ A;  1T94 A;  4DSE A;  2RP5 A;  1TAU A;  7ICV A;  3EUB 2;  1FO4 A;  3H7I A;  4PZN A;  1ZQK A;  2DBY A;  1TK8 A;  3M1Y A;  9ICH A;  3SEI A;  5G5H A;  4DO9 A;  3H4B A;  4CDG A;  3SV4 A;  3OHA A;  3OJU A;  4RQ2 A;  3K4G A;  2XC9 A;  1UA1 A;  1V85 A;  3WKD A;  2XO7 A;  1BPE A;  1JXL A;  4TUR A;  1LB2 B;  4M04 A;  8ICO A;  5KFB A;  2JH1 A;  3TAR A;  4UQG A;  5EWE A;  2FMS A;  1HIW A;  3L4P A;  2H3V A;  2KFN A;  4KLH A;  1ARO P;  4NY8 A;  2YB4 A;  3T5J A;  3C5F A;  3RAX A;  2HOQ A;  3LK9 A;  2ZTD A;  4ICA A;  4I27 A;  8ICP A;  5T14 A;  2YTU A;  9ICB A;  2AXT U;  3DEE A;  4TQS A;  4J03 A;  1V9P A;  5KT2 A;  1UQV A;  2NV3 A;  2DPI A;  3MGV A;  2FPM A;  3MR3 A;  4QZH A;  3H0M B;  1ZET A;  2NO4 A;  2LYB A;  5AK6 A;  2YB1 A;  1BGX T;  2HCF A;  2NRT A;  4RPZ A;  8ICN A;  3C21 A;  3ORY A;  9ICS A;  4DFM A;  2OM6 A;  1QCK A;  3AUO A;  1Q8K A;  2DWQ A;  2QAR A;  2YML A;  4F50 A;  2WAQ C;  1RXV A;  1S97 A;  1XO1 A;  2G06 A;  4UB2 A;  4FZN A;  3RR8 A;  4QIW F;  3V6K A;  1XSP A;  4AP9 A;  4RQ1 A;  5KG2 A;  2ISO A;  5KFL A;  4UB4 A;  2KVS A;  3IG8 A;  3M9O B;  2XY7 A;  4EEY A;  1SV0 C;  4I2I A;  3PMN A;  8ICV A;  4QZA A;  4F5P A;  1CUK A;  3MR5 A;  2KKV A;  3PSF A;  2PFP A;  5G5G A;  2LM4 A;  3HW8 A;  4YFK A;  3NUQ A;  1D9F A;  4KLG A;  3PY8 A;  3EPI A;  3M9N B;  4IR1 A;  4JV2 A;  2B6G A;  1ZQX A;  3WKE A;  4UW9 A;  4KLF A;  2JV3 A;  5KAF U;  4J9S A;  2ASD A;  4KLD A;  1AQ6 A;  4UAV A;  1T3N A;  4YCX A;  1WYG A;  2ZJ8 A;  3C2M A;  3PV8 A;  2F77 X;  2BKE A;  2BQR A;  3BZC A;  4GC7 A;  2FPK A;  3B9J A;  4R66 A;  4QZI A;  2V4Q A;  4PL2 A;  5EE9 A;  5CR0 A;  1C7Y A;  5HML A;  4KLE A;  8ICX A;  1JRP A;  4NLN A;  3GII A;  4XRH A;  4QZF A;  8ICL A;  3UMB A;  4DFP A;  2HHV A;  1XS9 D;  3QNM A;  1ZQG A;  2JMG A;  1CI4 A;  5DB9 A;  3ZDA A;  1TKD A;  5KFE A;  1OUQ A;  5DB7 A;  1S9F A;  1SKW A;  3TAQ A;  2NO5 A;  3CW2 C;  5C0Y A;  4C7Y A;  1L7N A;  7ICK A;  5AI0 A;  4O5E A;  2B21 A;  1RQL A;  3ALR A;  3NS1 A;  8ICT A;  5J2E A;  1COO A;  2ZIV A;  2E8M A;  3G6X A;  3LDA A;  4K4G A;  3K1R B;  5J8Y A;  2A19 A;  7ICL A;  4RQN A;  5KFI A;  1XSN A;  3CRX A;  3M8S A;  1BVS A;  4M6W A;  3CYM A;  2OCE A;  2HHW A;  1L7M A;  1CRX A;  4ECR A;  1JIH A;  2DKX A;  4UBB A;  4DQS A;  3Q8P B;  3RB0 A;  7ICP A;  2F8L A;  1QSL A;  2BCS A;  1L8L A;  2J6U A;  5KFH A;  2GWS A;  4KLI A;  2FDR A;  5DBC A;  3GQC A;  4ACO A;  5CEH A;  1PVQ A;  2YQE A;  5ALQ A;  3WU2 U;  3F2D A;  1EXN A;  4OJL A;  1KN5 A;  3LWL A;  5KT5 A;  5KT3 A;  9ICR A;  4ECX A;  2ASJ A;  2JEI A;  3WKA A;  4FZL A;  4DWI A;  2EAP A;  1QQ6 A;  4QZ8 A;  3H8J A;  3L3F X;  4UAY A;  5ALG A;  2G09 A;  5J8Y C;  2KTQ A;  5J0T A;  3WK6 A;  1OW5 A;  4GXK A;  4O5C A;  2HHU A;  2MAX A;  1ZQM A;  5K4L A;  1X9M A;  4C7Z A;  4I2D A;  2BPG A;  5KG5 A;  2F1H A;  4ED2 A;  1ZYQ A;  5GTH U;  2OWO A;  2DGZ A;  3EZ5 A;  1P7D A;  5B5E U;  4IR9 A;  9ICV A;  5AKH A;  5EOZ A;  1RQN A;  1NNL A;  3V72 A;  1ZQY A;  3NGD A;  2QB0 A;  4PL1 A;  4TUQ A;  3PNC A;  3QZ8 A;  4JMU A;  1ZJM A;  1LKY A;  4TUS A;  2HVI A;  3KHH A;  2RQ5 A;  4EZ9 A;  4Y2Q A;  1NOM A;  3RJH A;  3DDH A;  4ED3 A;  4O0I A;  3THV A;  7ICU A;  5KFW A;  4I2G A;  2KHQ A;  1HUO A;  3IN5 A;  4DSL A;  5L1M A;  1VJ5 A;  4QZG A;  3D2S A;  4F91 B;  2PI4 A;  2PKE A;  4O3Q A;  4U7C A;  4IRC A;  3BQ7 A;  1U4B A;  3ZDE A;  1Z00 A;  2BR0 A;  4J9Q A;  1RZT A;  4I2C A;  1KFS A;  4Y2P A;  5DQI A;  4KX5 A;  4MFF A;  2KHV A;  4DSK A;  4K4H A;  4OJO A;  3F2B A;  1RPL A;  5J0P A;  2PI5 A;  2YMP A;  3H8M A;  2YX8 A;  4GXJ A;  4EX7 A;  5JUM A;  2WTF A;  4RNM A;  3H4D A;  3E0F A;  3FDS A;  4JV0 A;  3PO5 A;  9ICO A;  1X6I A;  4AYB F;  2W8K A;  4FS2 A;  4DQI A;  4BDP A;  4PJ0 U;  5IIM A;  4C0Z A;  1K5O A;  4J9L A;  3MDC A;  4UB1 A;  5AM2 A;  4PPX A;  1FIQ A;  4UAW A;  1QQ7 A;  2JHD A;  4F2S A;  4UAS A;  5KFD A;  5KG1 A;  2KSO B;  2DL0 A;  2UVU A;  4MHV A;  1UCV A;  3PX4 A;  5KFJ A;  4F5N A;  4QZ9 A;  1L7P A;  3QUB A;  5CJ7 A;  3UMC A;  3RB6 A;  4KIT B;  2JH7 A;  2ZIW B;  5DKW A;  4YD1 A;  2VJ4 A;  1NJZ A;  4YG2 A;  4YMM A;  2HMX A;  2J6S A;  2VA2 A;  3H8S A;  2JZB B;  2E3T A;  2RDI A;  3RRH A;  3RR7 A;  1BNP A;  1KRP A;  8ICW A;  2K4I A;  5DQH A;  4C4S A;  4M0A A;  3OSN A;  4QWD A;  5ALT A;  3PW7 A;  4CCH A;  2ZJA A;  2ZUB A;  2XID A;  2W3R A;  2IBK A;  2O6K A;  7ICG A;  4ED0 A;  1ZQE A;  4HYK A;  3Q8M A;  2K8A A;  3NRW A;  4DF8 A;  4E0D A;  1ZQW A;  4CGZ A;  2UVR A;  3KHG A;  4B6J A;  2W9B B;  4KLQ A;  3RB4 A;  4P4O A;  4CF3 A;  4IQW A;  4F71 A;  4UB3 A;  4FBT A;  2HI0 A;  5KG0 A;  3TQ1 A;  5ALX A;  2EH9 A;  1RM6 C;  3C1Z A;  2KN7 A;  3T5H A;  8ICE A;  3SR6 A;  2AGQ A;  5L1K A;  3HKZ F;  3B0X A;  3H8W A;  4C4R A;  1MQ2 A;  4DSI A;  4EBE A;  3QX7 A;  8ICS A;  1WCN A;  2VAN A;  2HW3 A;  1NJY A;  5AI4 A;  3MDA A;  5ALI A;  3T3F A;  4DL6 A;  2W9B A;  2R8J A;  1PK3 A;  1ZQB A;  2WHE A;  1PK1 B;  4DOC A;  2WB1 C;  1ZD3 A;  1HEK A;  1ZXI A;  2I1Q A;  1SGG A;  4P2H A;  2FLP A;  3WKB A;  9ICK A;  1N62 A;  4Z6F A;  4GFJ A;  3GIJ A;  4EEN A;  4F4X A;  3G6Y A;  2D6F C;  2ZIX A;  5ALR A;  1COK A;  5KFT A;  3WK5 A;  2UVV A;  2OEH A;  1DGJ A;  9ICU A;  5AIB A;  9ICL A;  3KZI U;  3U26 A;  4YR2 A;  2ATL A;  2G08 A;  5J2G A;  4NXZ A;  4KN7 A;  8ICY A;  1Q46 A;  4EX6 A;  2AQ4 A;  4P0P A;  4CF4 A;  1JN3 A;  1JAL A;  2KE7 A;  2E8N A;  2WAQ F;  3IRU A;  4ECZ A;  2AH5 A;  4FFD A;  2FLN A;  4KMO B;  2W3S A;  5CP2 A;  2ZG6 A;  1WCL A;  4NJ8 A;  4JUZ A;  4DLE A;  2CN1 A;  1N61 A;  4NM2 A;  9ICM A;  2DPJ A;  4KLS A;  2E1E A;  1PK1 A;  5EWG A;  1BPD A;  1Z1B A;  4RQ7 A;  3SV3 A;  5J0R A;  3K75 D;  3UM9 A;  1N5W A;  2HSZ A;  4EZ6 A;  5DGB A;  2R8H A;  4OD0 A;  1SL2 A;  3UPQ A;  1ZQP A;  1ZQD A;  3BQ1 A;  4F3O A;  5BOL A;  2PXI A;  4B9N A;  2N1R A;  4YN4 A;  5AI6 A;  4QW8 A;  4RZR A;  3F53 A;  4Z6E A;  1L6N A;  3QU5 A;  4F92 B;  2P6U A;  1ZQL A;  1ZQF A;  1PUZ A;  5BOM A;  2OYY A;  5E79 U;  4RNO A;  1S77 D;  2H3Q A;  5DG8 A;  2W03 A;  2KJ9 A;  2NYV A;  5IIO A;  4MFA A;  5AM3 A;  4R8U A;  3J81 j;  4G3I A;  2QAR B;  1NK0 A;  1TK0 A;  4I28 A;  7ICM A;  9ICT A;  2WF6 A;  3SAH A;  4UB8 U;  1TAQ A;  1A6S A;  2LYA A;  3QE9 Y;  3F5A A;  4RNN A;  5F9L A;  1Z3E B;  2WF8 A;  2BPC A;  5AKK A;  5C5J A;  4M2Y A;  2F1J A;  2P35 A;  3HKZ C;  2ZTE A;  4KLO A;  3H0R B;  4P4P A;  5KFV A;  3TFR A;  2L5Y A;  1TK5 A;  3WKC A;  2HVH A;  3WK7 A;  4Y2U A;  4ZH4 A;  1UT5 A;  1OXJ A;  4F4Z A;  5IIK A;  1SIJ A;  1TV9 A;  5CWR A;  4I2J A;  4O3N A;  5KAI U;  2K60 A;  4RUC A;  3KHL A;  3HPO A;  5CB1 A;  3I1Y A;  4CE6 A;  5AM4 A;  2V9W A;  2BCQ A;  2KIC A;  2KK0 A;  4XQ8 A;  3SD7 A;  4GXI A;  8ICH A;  3ZDD A;  4MF2 A;  5KFK A;  3NTU A;  5AI5 A;  4USA A;  2C2R A;  3BDP A;  5L1J A;  1B22 A;  4BGD A;  5D49 A;  2CPR A;  5DB8 A;  2KJ5 A;  3ISD A;  1SWV A;  1S5L U;  2VA3 A;  3JPT A;  2EDU A;  2VKQ A;  3HIL A;  2LHT A;  3C1Y A;  5J0U A;  4P4M A;  3KFU F;  5EE1 A;  5DBB A;  5ALZ A;  4M9G A;  4M9H A;  4LVS A;  5AK5 A;  2PFQ A;  2HHS A;  4CRX A;  3QUQ A;  2KZZ A;  5AKY A;  4F8R A;  4B9V A;  1KW4 A;  2H5X A;  4UB6 U;  7ICT A;  4YR0 A;  3HP6 A;  3I28 A;  4M9N A;  3K1Z A;  4AYB C;  1U47 A;  4C8K A;  3JPR A;  4RT2 A;  4ECU A;  4B9M A;  1MA7 A;  4I2F A;  9ICW A;  9ICE A;  5KFQ A;  4F4W A;  2MRL A;  4QWC A;  9ICC A;  7ICF A;  8ICC A;  3PR5 B;  4DL7 A;  7ICJ A;  3SZ2 A;  1TE2 A;  4RQM A;  2XVT A;  1IM4 A;  1N56 A;  1QQ5 A;  9ICI A;  5KT7 A;  4JWN A;  3WK4 A;  1DRG A;  2YY6 A;  3RJE A;  2ZUC A;  3AL0 B;  4UAT A;  4QJF B;  5AKI A;  2ZUD A;  1NK6 A;  3KD3 A;  4ED7 A;  4PHP A;  1J97 A;  4R65 A;  2K8B B;  1ZQ1 C;  5KFM A;  3V6H A;  2K4H A;  1F0M A;  4P0Q B;  4TUP A;  3PW2 A;  1ZQR A;  2R8K A;  2JGA A;  4J9N A;  9ICN A;  1U49 A;  1KFD A;  3NVV A;  4PGQ A;  3RBE A;  3BZK A;  2PFO A;  8ICU A;  3ED5 A;  4FS1 A;  1RDF A;  4Q45 A;  2OHF A;  3KZX A;  3AQE A;  1GO3 F;  5TIS U;  1BPZ A;  4ED8 A;  4OCZ A;  4RPX A;  4O3S A;  2LI6 A;  3BS5 A;  1RXW A;  1ZQI A;  2XGQ A;  5J0O A;  1S0N A;  4C4T A;  2W7P A;  4DS4 A;  2DUY A;  4RU9 A;  3D6J A;  4XUS A;  5L9X A;  4C8L A;  5EE3 A;  5KG3 A;  1RYS A;  1ZQA A;  4M47 A;  3C23 A;  2WFA A;  1QSS A;  4BWM A;  1ZQV A;  2NRW A;  2ALZ A;  4NLB A;  1RG6 A;  1ZQT A;  4CNQ A;  1DK3 A;  1S0V A;  1ZRN A;  8ICA A;  2K89 A;  2KVC A;  3PVX A;  2HBM A;  5B66 U;  5DLF A;  1Z19 A;  2K4P A;  2Y9U A;  1T4G A;  3KKA C;  3GIM A;  5DGA A;  1ZJN A;  1SZH A;  2RLT A;  4Y2S A;  4ED1 A;  2K8C B;  2W9M A;  1NZB A;  3KOO A;  5JRT A;  5DB6 A;  3RH4 A;  1Z00 B;  2QB1 A;  4O3M A;  4B9U A;  2BHN A;  5ALV A;  2ZJ5 A;  3BQ0 A;  2DFL A;  4K4I A;  1KKX A;  4Z6D A;  3F2C A;  3T5K A;  4C8M A;  4IRK A;  1YZ6 A;  4NWI A;  1NI3 A;  1Z4O A;  5KG7 A;  4J9R A;  3ETL A;  1Z1V A;  1T3Q A;  5CHG A;  4RQ5 A;  5TZV A;  1S8O A;  4US9 A;  3QUC A;  1B0X A;  2Z7J A;  4YR3 A;  3A0H U;  2GH1 A;  3JPS A;  2MA1 A;  2GO7 A;  5AKX A;  1DGS A;  5ALY A;  4PHE A;  2JRZ A;  3C2K A;  5EWF A;  5J2A A;  3N7S C;  3HWT A;  1IG6 A;  3QYP A;  3JPQ A;  4PGY A;  1Q3V A;  1L3S A;  3KBB A;  4NLG A;  3ZDB A;  4ED6 A;  4US8 A;  5J29 A;  4R64 A;  2JR5 A;  1SL1 A;  5AK4 A;  4Q8F A;  5AIA A;  1ZQC A;  3GV7 B;  4NLZ A;  2BDP A;  3NVW A;  3PZP A;  1JMS A;  2RHF A;  4F2R A;  4HAI A;  3GZF A;  2EQY A;  2VA8 A;  1HUZ A;  5ALL A;  4DL4 A;  5CRX A;  1KFT A;  9ICA A;  4KLU A;  3OGU A;  5J0Y A;  3EYZ A;  1L3T A;  7ICR A;  2NRX A;  1XO0 A;  4QWA A;  4F5R A;  4EBC A;  3AQF A;  3NRZ A;  2KD1 A;  4Y2X A;  4JK1 A;  1Q3U A;  1SKR A;  2YN4 A;  4KX3 A;  2YMQ A;  3PML A;  2EAM A;  2I5H A;  4F93 B;  2C22 A;  3H0L B;  4EEL A;  4MF8 A;  1URJ A;  4QZB A;  2Y1I A;  4B9S A;  3ZI4 A;  4DFD A;  9ICQ A;  1PZN A;  5DLG A;  4PHA A;  2FMP A;  2Q4T A;  3VC8 A;  3TAN A;  2BQU A;  3GFK B;  3N97 B;  3S6J A;  2WB1 F;  4KLM A;  3TAC B;  3V7L A;  1ZQJ A;  3NAS A;  3UXN A;  2LKY A;  1MC8 A;  4MFC A;  3PSI A;  1ZD4 A;  3IM1 A;  2ES6 A;  3RJF A;  5J2K A;  4A8E A;  2KKP A;  3DV9 A;  4BX9 C;  2ODG A;  3KKA A;  2J6T A;  2R8G A;  5HP4 A;  2P6R A;  4I2B A;  2W11 A;  4ECQ A;  4RQ4 A;  5HNK A;  2YMM A;  1NZP A;  1SZP A;  3RB3 A;  3RF9 A;  2Y1J A;  1DXS A;  3AM9 A;  1TAM A;  2XY5 A;  5HHH A;  3TAP A;  3EW9 A;  3V6J A;  4NLC A;  2FMQ A;  2Q0Z X; 
#chains in the Genus database with same CATH homology
 2ZIU A;  2KJ5 A;  3LVW A;  1XNS A;  2JHD A;  2ZIU B;  3ALR A;  4JMU A;  3O0F A;  1T94 A;  2OXO A;  2Y0S C;  2RP5 A;  2ZIV A;  3C28 A;  2ZIV B;  2WB1 C;  2VKQ A;  3D2N A;  3PZP A;  2CRX A;  2RHF A;  3T79 A;  1HEK A;  2LHT A;  2E5S A;  3IG8 A;  3SAH A;  3GZF A;  3KZX A;  3OPX A;  2A3V A;  3AQE A;  2VIX A;  1GO3 F;  5KL1 B;  2JH7 A;  4OJ6 A;  2ZIW B;  2LYA A;  1A6S A;  2XIC A;  3KFU F;  2KJ8 A;  3CRX A;  5CRX A;  3IG5 A;  2VJ4 A;  2KKV A;  3F5A A;  3PSF A;  1IIP A;  4GFJ A;  4CDG A;  2R18 A;  3CYM A;  2KHQ A;  2HMX A;  3IN5 A;  5HR6 A;  3ONN A;  4NV0 A;  2GOL A;  2HBK A;  1UPH A;  3NUQ A;  2W7P A;  1CRX A;  2D6F C;  2ZIX A;  5KL8 B;  4BJQ A;  3GU3 A;  2Y0S F;  1XO0 A;  4P0Q A;  2F8L A;  4CRX A;  2M0N A;  2HOF A;  3AQF A;  3SAG A;  2KD1 A;  3RFA A;  3F5E A;  3HKZ C;  2JH1 A;  1Q3U A;  3D2S A;  3N7R C;  4FZM A;  4NLB A;  2G0A A;  2K4I A;  4KX3 A;  1HIW A;  2HBL A;  2G07 A;  2W7O A;  3H0R B;  4U7C A;  1PVR A;  2G08 A;  2KEY A;  4QIW C;  2H3V A;  2K89 A;  2KVC A;  3H0L B;  2HBM A;  4ACO A;  2LBO A;  3K1Z A;  4AYB C;  1Z19 A;  4P0P A;  1PVQ A;  2XI9 A;  2YB4 A;  1URJ A;  3F2D A;  2ZXH A;  4OJL A;  2HOQ A;  2WAQ F;  2DF4 B;  4ICA A;  2XID A;  5HR7 A;  2KIW A;  5T14 A;  2F77 X;  1PVP A;  1SZH A;  1MA7 A;  2HOI A;  2K8C B;  4KMO B;  4KX5 A;  2K8A A;  2KHV A;  2Q4T A;  2ZG6 A;  3DEE A;  1NZB A;  4FZL A;  3NRW A;  4OJO A;  4IC9 A;  2CN1 A;  4OJP A;  4PL2 A;  3VC8 A;  2F2A B;  1YT3 A;  2MRL A;  3F2B A;  4O3M A;  1A0P A;  3L3F X;  4OJ5 A;  2NV3 A;  2WB1 F;  3PST A;  2E1F A;  1F44 A;  2H3F A;  4CGZ A;  2E1E A;  2BDU A;  2YX8 A;  4BUG A;  3MGV A;  1Z1B A;  2HBJ A;  2G09 A;  3SMV A;  3M7D A;  4FE3 A;  2XVT A;  3H0M B;  3F2C A;  2KNJ A;  1KBU A;  2LKY A;  2G5H B;  2KOB A;  2ZIX B;  4NWI A;  3D2Q A;  3IP4 B;  4OO1 J;  2PMZ C;  2VJ5 A;  3PSI A;  3E0F A;  2KV2 A;  2LYB A;  2YB1 A;  1DRG A;  3N7P D;  4A8E A;  5A0L A;  2F76 X;  2KKP A;  2ZIW A;  3SQI A;  3AL0 B;  4AYB F;  2ZXI A;  4BX9 C;  4P0P B;  3ICX A;  1D8B A;  2H3Z A;  2Z7J A;  2GH1 A;  2KIC A;  3VCB A;  4QJF B;  1ED1 A;  3PSP A;  3LVV A;  2H3I A;  2MA1 A;  2N1R A;  4QNL A;  4U6P A;  2OM6 A;  3M6K A;  2PMZ F;  3HKZ F;  2JMG A;  3F53 A;  1WUD A;  2K8B B;  3N7S C;  3CP8 A;  2DQN B;  3M6Z A;  1ZQ1 C;  3RF9 A;  4C0Z A;  2W04 A;  2DGZ A;  1L6N A;  2K4H A;  1ECW A;  1P7D A;  2WAQ C;  4P0Q B;  2OYY A;  1Q3V A;  3C29 A;  1TAM A;  2G06 A;  1OUQ A;  2OH2 A;  4WJ3 B;  2JGA A;  3SAF A;  2CPR A;  3LYS A;  4PL1 A;  2H3Q A;  4FZN A;  4NLC A;  5C0Y A;  2G5I B;  2RRD A;  2W03 A;  4QIW F;  2KJ9 A;  2K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...