2H3ZA

Structure of the hiv-1 matrix protein bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 38
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3zA01
1HEKA 2K4HA 2N1RA 2LYAA 2GOLA 1L6NA 2K4EA 2LYBA 4IC9A 2K4IA 2NV3A 4JMUA 1HIWA 2H3IA 2JMGA 2HMXA 1TAMA 1ECWA 2H3VA 1UPHA 4ICAA 1ED1A 2H3FA 2H3QA 2H3ZA 1A6SA
chains in the Genus database with same CATH superfamily
3CW2C 4UASA 3H8MA 1ZQAA 2CN1A 2C2DA 3IRUA 3OPXA 3ZDAA 2KFNA 1L3TA 1ZJMA 1F5SA 4KMOB 5AKIA 2K4EA 2FE9A 4BX9C 3WKBA 1D8LA 5CWRA 5A0LA 3RJIA 1MSWD 3EPGA 5L1JA 2W04A 5KFFA 4QZ8A 1A6SA 5J2FA 2B6GA 3GU3A 4UW9A 3OSNA 3D2QA 3PW7A 2BHNA 9ICEA 1NK5A 1JUDA 2KFZA 3B0XA 2W7PA 3JPNA 5CEHA 4JK1A 2AQ0A 1K1QA 3JPOA 2VJ5A 4CF3A 1AQ6A 3TADC 5DLGA 3H8WA 3PVXA 1ZQLA 2ATLA 5ALXA 5CA7A 2ZG6A 1ZQKA 1CEZA 2NO4A 2DUYA 4PHPA 3Q8PB 2J6SA 2YMPA 4JUZA 2V4RA 2ZXHA 1TE2A 3FC4A 3UXPA 1QCKA 2O6KA 3KHHA 2K8BB 1NJWA 3IG8A 4NLKA 2LMRA 5KFMA 2F77X 4EELA 1TAQA 4BDPA 1MC8A 5CP2A 3G6VA 8ICEA 1PVQA 3T5LA 2AXTU 5KFDA 4NXZA 3PW0A 5KFJA 1QSLA 1DGSA 5DLFA 3WK7A 1ZQBA 2MAXA 1KLNA 4UAUA 5HHIA 5BOMA 1N62A 2RLTA 3D2NA 2I5HA 3VC8A 5AKYA 5DB8A 1D9DA 4I29A 4GLXA 4P4OA 3T79A 2H3QA 1C20A 4R8UB 5AICA 4UB2A 4RNOA 4M47A 1SB3C 3G6XA 3N4MB 2IMWP 5ALIA 1YT3A 1GO3F 2PFNA 1U48A 2JEGA 3ISCA 7ICIA 4C80A 2Q4TA 4A8EA 1VDVA 4QWBA 4BJQA 3TAQA 1ZD3A 5AM0A 3BQ0A 1KQQA 3BJYA 1FFUA 2R8KA 5DB9A 4DL6A 2ALZA 1J2NA 5B5EU 4RQ6A 2IA6A 4WJ3B 4M6WA 1KFDA 3I28A 4B9MA 2DWQA 4ECYA 1XS9D 1COOA 3MR2A 1X42A 3PSIA 5J2IA 5IIJA 1S10A 4KLOA 5DKWA 3PV8A 3RH5A 1TV9A 8ICZA 4OJLA 4P2HA 4M6WB 3Q8MA 1L5UA 4O3QA 2A19A 4J9NA 3DDHA 3LVVA 5J2CA 2EQYA 5KFCA 2HOIA 5IIMA 2IHNA 4IRKA 1LB2B 2W8KA 1L8LA 4B9VA 3NUQA 1ZQJA 4DQRA 3AUOA 4UBBA 4MF8A 2C28A 1LKYB 3RBDA 4ED3A 3QEAZ 3PSFA 4MFCA 4JMUA 5D49A 3GV7B 3WK5A 1KEJA 4I28A 2EDUA 3N97B 3C2KA 3BZCA 5AM3A 3LWLA 4O5KA 2ZUBA 5HHHA 3WU2U 2KJ5A 5IIIA 4K4GA 4ZOHC 2GH1A 1KRPA 3C21A 5JU5A 3S6JA 4ICAA 3BS5A 3B9JA 1UT5A 4EENA 4DL5A 4F3OA 2MU2A 2FJ6A 1D8BA 5J2EA 8ICMA 2XY7A 4Y2TA 1ZQNA 1ZOLA 1B22A 3CNHA 3M6KA 3V7KA 3KHLA 5HR7A 3DEEA 8ICKA 5ALVA 4RUCA 3EUB2 2YMQA 3AL0B 2K4HA 1ZQGA 1DXSA 4F5PA 7ICOA 1NNLA 3SI8A 3CP8A 3GDXA 5KT5A 2ZTCA 5KFTA 1ZQRA 2KSOA 2XIDA 1SKRA 1SV0A 2G09A 4IRDA 1TK5A 5EE3A 2KKVA 3EYZA 4CGZA 2YMMA 5AK5A 5BPCA 5JUMA 3ZDDA 2CPRA 5HP4A 3H0RB 4K4IA 1T7PA 3L3FX 8ICJA 4F93B 3UQ2A 2W9MA 4F50A 2DQNB 5KG1A 1ZQIA 1ZQMA 5L1KA 2W3RA 1D8YA 2DFLA 3EZ5A 4QZAA 4M9HA 2MRLA 2BCUA 3NS1A 3BZKA 2JZBB 4EBCA 2F3NA 4TQRA 9ICNA 4I2IA 5BOLA 2UVWA 4MHVA 5T14A 4Y2QA 3V7LA 2Y1JA 1N61A 3UMBA 4RPXA 3KFUF 2A1JA 1QQ5A 1S5LU 3SZ2A 4RQ8A 4C0ZA 1WCLA 4J9QA 3IP4B 4FZNA 1NOMA 4TURA 4NY8A 2BKEA 2HVHA 3ZD8A 1B43A 4CRXA 5KL1B 4F5NA 3FDSA 4OJPA 4YR3A 1YZ6A 4GC7A 3PSTA 4EBEA 4DFKA 3SYZA 5J0RA 5ALRA 5G5GA 2R8HA 4UB5A 1S97A 5KG7A 4QZHA 2YB1A 4IRCA 2AGPA 1ZQEA 5AI9A 3HKZC 4PGQA 3T5HA 5ALWA 5KFXA 4JWMA 1NI3A 8ICAA 4QJFB 2LYHA 3PZPA 4ED8A 2K8CB 1ZJNA 4Q8EA 2HSZA 7ICJA 3FM9A 4QZGA 3M9OB 1SL2A 1QSYA 1ECWA 4CF5A 3ZDBA 4DSKA 4AYBC 5L9XA 4TUSA 4EZ6A 3RJEA 3UMCA 3QUTA 4ECTA 5J2DA 3K75D 4CCHA 1A76A 1PK1B 1KW4A 2W54A 1ZQDA 8ICTA 4PZOA 2QARB 2LHTA 2P35A 2XC9A 3WKEA 1JMSA 4QWDA 2K89A 4LZGA 9ICAA 8ICBA 2W03A 1V97A 4I2GA 2E8NA 7ICVA 3DV9A 1PUZA 4K4HA 2KZMA 3AN1A 1XO1A 9ICIA 4YXJA 1J2MA 5ALEA 2FLLA 5KT7A 1RQLA 2W9AA 3AQFA 7ICNA 9ICQA 5DQHA 1ZQUA 3QU9A 3BS7A 5ALPA 3CYMA 1X9WA 5KG6A 2KNJA 3N28A 3GV8B 1RPLA 2XCAA 5AIBA 4NLCA 5ALMA 4RPZA 9ICGA 4FO6A 1CUKA 2MUTA 3RAQA 4DSEA 5EWFA 4I2EA 3NVYA 5J0PA 8ICLA 8ICGA 2F1IA 3Q8RB 3HPOA 2EANA 1SGGA 4MFFA 4F2RA 1VLBA 5HR6A 1JXEA 4ED0A 2HHUA 3RRGA 2EAPA 5IIKA 2AJQA 5DGAA 3UM9A 1XSPA 2KJ9A 5CJ7A 1NK9A 1MQ2A 8ICRA 1PVPA 1TFRA 4LJXA 5GTIU 5K4LA 1BNPA 1XO0A 2WB1F 2JEIA 2D8CA 1Q8KA 2VA2A 4ECQA 4US8A 3EPIA 2JV3A 3ISDA 4ELTA 4F4WA 1TK8A 4UATA 3K1RB 2Y0SC 1N2XA 3IG5A 2W11A 4O3NA 1PK3A 3AEVA 2WF8A 2JHDA 2BQRA 3BQ7A 4LVSA 8ICPA 5L1MA 3QXGA 3LDAA 2PFPA 4QZDA 4PPXA 1QLNA 2PMZC 4KLGA 2ZJAA 8ICIA 2HBLA 2ESEA 1U47A 1X2IA 3SAFA 1XSLA 4EYIB 3UMGA 9ICBA 1COKA 4KLHA 9ICCA 8ICWA 4MFAA 2WF7A 2JEJA 3UXOA 3RH4A 1BPYA 4FE3A 2AGQA 4BGDA 8ICFA 4DFPA 4PHEA 4O5CA 2KOBA 2ZUDA 4UARA 2NRXA 3FAHA 2H3VA 4KN4A 4PZNA 4YMMA 3LYSA 3SR6A 1X6JA 1L3VA 2RDJA 2ZJ8A 3PX6A 4DS5A 3Q8QB 5ALSA 5KFPA 2E8MA 4DL7A 4C4TA 5AI0A 3Q8SB 2NYVA 3T5JA 3PY8A 1SXEA 1RYUA 1AROP 4DFJA 4I2HA 2FDRA 2P6RA 4I2FA 3WK4A 2LM1A 4KLFA 1SV0C 3IV6A 1L7PA 1XU4A 1U45A 1U4BA 4DQSA 3NRWA 4C7ZA 3ZDEA 2N1RA 5IILA 2R18A 2UVRA 4IC9A 8ICYA 3TACB 5J2BA 3Q8LA 5JRTA 5J0QA 2KMDA 3RBEA 4QW9A 3ALRA 3B0YA 2AU0A 1NJZA 4F5OA 1ZQPA 4ED2A 4R8UA 4RNMA 3CRXA 2OXOA 1MA7A 3H8JA 2ISPA 2YY6A 1EXNA 4J9RA 1BVSA 5EWGA 2FMPA 1Q46A 4DS4A 2HHTA 5AM2A 1OXJA 1TAUA 1ZRNA 8ICUA 2EAMA 4E0DA 4DLGA 5KL8B 3KKAA 1M6YA 5AM4A 1QH9A 2ZIWB 4GIBA 5KG0A 2Y1IA 7ICMA 3AU2A 2FLPA 3GILA 3MDCA 1T3QA 4DL3A 2XGPA 1Z00B 4AP9A 2H5XA 4C8MA 3WKCA 4F5QA 3QU7A 4P4MA 5CB1A 5EOZA 5J0YA 3NGDA 2BDPA 3MC1A 3WK9A 3R9KA 4UAVA 1OW5A 5J2HA 5KFOA 4RU9A 3IHQB 1FFVA 4J9KA 4P0PB 2E5SA 1Q3VA 4QNLA 1UA1A 1Z19A 2KZ3A 5DQIA 3MGVA 1RM6C 4YXMA 5ALYA 4KLSA 4G3IA 5AIAA 3SENA 1LKYA 1BPDA 4NM1A 4O9MA 5DBCA 4MF2A 4IL6U 5J0SA 2ZXIA 4Z6EA 3PW5A 4DSLA 4Y2UA 3ISBA 3RJKA 4RZRA 4KTQA 4C4RA 3PR4A 5AHXA 2LYAA 3EW9A 4GXJA 2PI5A 1RXVA 4DSIA 2F1JA 2IOHA 3H0MB 1NK7A 4O0IA 2EH9A 4ZH4A 2M9NA 2XGQA 2NRWA 1WWVA 3QUQA 2HHQA 2EAOA 2ZJ5A 3RB6A 4B9NA 3C23A 2VA8A 4DOBA 3RFAA 1L7NA 1DOQA 2ZIUB 1SL1A 3V6HA 2JH1A 4J03A 5KTQA 1XWLA 5J0XA 3T5KA 2PKEA 2HHVA 2YB4A 1B4FA 4KLMA 3SQIA 1N63A 4M2YA 4NLZA 4YP3A 5KT6A 3F2BA 4BXOB 4IR1A 5ALFA 5AKHA 7ICFA 4J9MA 4FS1A 2XY6A 3QE9Y 3TQ1A 5AKKA 4KLQA 1S76D 1ZQ1C 2GOLA 5KFQA 3OTQA 2KV2A 3IN5A 2WF6A 2BZFA 4EBDA 4Z6FA 1DRGA 3HT3A 1KFTA 2BCSA 3GV5B 8ICHA 3HILA 1NJYA 5J2AA 4RQ5A 4DQPA 4RUAA 5AI6A 3ZI4A 5DQGA 4KLIA 4F4YA 3N7SC 1JIHA 3ETLA 4RQ1A 2J6TA 4DSJA 2CXYA 5KG2A 3J81j 2YTUA 2HBMA 1SWVA 2BPFA 3KD3A 3TANA 4QW8A 2JZBA 1S77D 5CRXA 2WHEA 4NL9A 3H4DA 4GXIA 4KLUA 3G6YA 4M0AA 3PW4A 3AU6A 4DSFA 4OD0A 2HOQA 2G07A 2I6XA 4R66A 1BPZA 1SKWA 4CF4A 9ICRA 3OHBA 2Q0ZX 1NK0A 4PHAA 5IINA 2BCQA 5EWEA 2ZIXB 3HRDD 4QZFA 4Y2XA 1QTMA 8ICNA 2AGOA 3RJFA 4OJ6A 4YCXA 1URJA 3HP6A 4PGYA 4YVZA 4DOAA 5D4BA 4JB3A 5KFEA 5DG9A 4PJ0U 2KD1A 4FBTA 9ICJA 4F4KA 3SAGA 2E1EA 3HKZF 4B9LA 4QZEA 4XRHA 3WK6A 2WFAA 3ZD9A 1ZQOA 1S8OA 5AM5A 4DFMA 3GFKB 1T8EA 1RDFA 4YR0A 5J2JA 3UPQA 1IV8A 4AYBF 4Q44A 4IQUA 1PK1A 2AH5A 5KFAA 5KG4A 2QARA 2FI1A 1A0PA 4RNNA 3QUBA 7ICUA 5ALZA 2H3IA 7ICHA 1F0MA 2BQUA 3LVWA 2HBJA 3PO4A 2YQEA 7ICPA 5J8YA 4NV0A 3C5GA 3PNCA 5ALHA 2E8OA 2FPLA 3LWMA 9ICUA 1L6NA 5DDYA 4Y2RA 4PH5A 1XC9A 2RHFA 4DWIA 2QKQA 1FIQA 1X9XA 2KZZA 3HJEA 4I2JA 4B9SA 5KFSA 2F2AB 9ICOA 3JPQA 1KDHA 5AKZA 1NKCA 3ORYA 3JPSA 2WAQF 3KKAC 4RQ2A 4UQGA 1U49A 7ICSA 2ASLA 2BDUA 2BCVA 1Q3UA 4QIWC 2MSNA 4UB1A 3N7RC 3NASA 4P4PA 4I2DA 4P0QB 1K5OA 5ALDA 5D46A 3GIMA 2WAQC 4ELVA 5CHGA 3BDPA 3E58A 2FPMA 3AM9A 1NK4A 4I2CA 8ICVA 2G5IB 1BNOA 2QLTA 1ZXIA 1N5WA 4JWNA 2W9BB 3M9MB 4QWCA 3RR8A 2E3TA 1ZD4A 5B66U 2KHQA 4MEXA 9ICSA 3KHRA 4C7YA 3K1ZA 1UPHA 2A3VA 2IHMA 3NVWA 2KHVA 1Z3EB 2C22A 3M8RA 3NVVA 4C8LA 4ECVA 3BQ1A 4FBUA 1RXWA 3OJSA 3BQTA 4JV1A 3C1ZA 2P6UA 5ALGA 4RQ0A 1ZQSA 3C5FA 4UB3A 7ICKA 4RT3A 2W3SA 3H4BA 3N7PD 2KP7A 5H2FU 1T94A 2Y0SF 1UQVA 2ZIVB 3ED5A 2Y9UA 1DGJA 1WYGA 1Z4NA 4GFJA 1D9FA 8ICOA 2B0CA 2BQ3A 4Y2YA 1KL9A 4EYHB 3NRZA 3L5KA 4YR2A 3C2LA 1BGXT 2QB1A 4QZCA 2J6UA 7ICEA 2PMZF 4PL1A 3O0FA 3PX4A 2ES6A 2W9CB 2OHFA 2QB0B 3TFSA 3MFIA 1C7YA 3GZFA 1ZQFA 2PFOA 2LBOA 2Z7JA 5L1LA 5DG7A 2XI9A 3GIKA 3RB3A 2HW3A 1Z1BA 4F5RA 2JH7A 1TAMA 3NTUA 1JXLA 3U26A 4I27A 1V38A 4U6PA 5J2KA 2DPIA 5ALUA 2VKQA 5AK4A 4F72A 5FP0A 1QSSA 7ICLA 4Z6CA 1RYSA 3RB0A 1ZQHA 1WG8A 4NLGA 1O08A 3MGHA 4DCCA 1Z1VA 1VJ5A 4KLTA 2ZTEA 2XICA 2MA1A 1NKEA 4KLEA 4NLNA 4O3MA 5ALOA 4CE6A 1XNSA 4DLEA 5AKLA 3UQ0A 4Y2SA 3RB4A 4EX7A 4I2AA 2PXIA 4FZLA 5C5JA 3HX0A 2IOFA 2ZTDA 3C29A 5HNKA 3K4GA 4UB8U 8ICCA 3GIJA 4DQIA 4M9GA 4NL9C 2KIWA 1KBUA 1KN5A 3H40A 2DKXA 1WWUA 2K60A 5L1IA 4R64A 5EE9A 2VANA 2XVTA 5J2GA 3NVZA 1NK6A 4IQVA 3QX7A 2EZZA 4B6JA 2DL0A 2FLNA 4BWJA 2OCEA 2ZIWA 5KFKA 1P7DA 1CRXA 2BCRA 4YD1A 2R8JA 2LPEA 3QU5A 4UB4A 2BGWA 4EX6A 5CR0A 1N60A 1HUZA 4M04A 1X6IA 2UVUA 1SIJA 3TAPA 1Z00A 2K4PA 2ISOA 2GWSA 5HMLA 3KBBA 9ICWA 1V85A 4ECWA 1UHUA 3PW2A 5KFGA 3SV3A 1ZQCA 3V72A 2DBYA 8ICSA 9ICPA 1LV5A 2I9GA 2BPCA 2WTFA 1L3SA 1JX4A 1ZETA 4P0PA 5KFVA 2HMXA 2BR0A 1FEZA 1X66A 2P66A 4EEKA 1NJXA 3PR5B 5F9LA 3C28A 1ZQWA 2FPKA 5DB7A 1WCNA 1RQNA 4F91B 7ICGA 4EEYA 3E2EA 2YX8A 4KLJA 4YG2A 2KE7A 3KHGA 2KIVA 2HHSA 3EWAA 4KLDA 1JN3A 3QU4A 4IQTA 5TZVA 1ZD5A 5KFWA 3MABA 4QZBA 1K1SA 2PFQA 2RDIA 4Y2VA 1S0MA 4JV0A 2NRVA 1UT8A 4O5EA 4Q43A 4R65A 5ALKA 1S0OA 3MR3A 1N56A 2L5YA 4KN7A 5ALJA 3AQEA 5J8YC 2HHWA 3MDAA 2ASDA 1HUOA 4FFDA 2HCFA 2KEYA 4NWIA 5DBAA 4TUQA 2H3FA 9ICHA 2ZIUA 2JEFA 1QQ6A 8ICXA 3TARA 2OH2A 1ZQQA 1CI4A 3M8SA 3M1YA 3A0BU 3PX0A 1LVHA 3ETRA 4GC6A 5J0UA 2KK0A 2GO7A 3QU2A 1MN8A 4MEYA 4ECUA 1TVAA 3Q8KA 4QWEA 1SZPA 2RP5A 5KT2A 1HIWA 1T4GA 2KKPA 4KLLA 2JMGA 4DF8A 3SAHA 2KICA 4BXOA 1KSPA 1JI7A 5DGBA 5KT4A 1RZTA 4QWAA 1PZNA 2VIXA 2LI6A 2W55A 5F9NA 2ODGA 3RJHA 2WF5A 1ZQTA 4DEZA 1B0XA 5IIOA 3UXNA 4HAIA 2C2RA 2HDOA 3M6ZA 2CRXA 1IXRA 2KJ8A 3SEIA 1UCVA 4F4ZA 1ZQYA 4YD2A 2Y9TA 3JPRA 4Y2JA 3JPPA 5AKEA 4F8RA 3RF9A 3OJUA 4DOCA 4XQ8A 1X9SA 2D6FC 3FYHA 1NZBA 4B9TA 2KTQA 2NV3A 3SD7A 3RAXA 1PVRA 3SMVA 5KG5A 2F76X 7ICQA 1T3NA 4J9PA 1ED1A 3H7IA 1L3UA 4O3OA 3MR6A 2RQ5A 2FMSA 4JV2A 2OM6A 5J0TA 4IS7A 4DO9A 4C8KA 2W43A 3RJGA 9ICKA 2ZIXA 3I76A 5KNIA 4UB6U 3TKAA 2R8IA 5DG8A 4ACOA 5AKXA 3BS5B 3WKDA 4DL4A 4RPYA 4OJ5A 4O3PA 2E8PA 3C1YA 3TI0A 1ZYQA 3OHAA 1ZQVA 2YMLA 2I1QA 3ICXA 4B9UA 3LK9A 2R8GA 3TADA 9ICLA 4RQ7A 5EE0A 8ICQA 2W7OA 1JRPA 1KFSA 1ZQXA 2W8LA 4US9A 1A77A 4I2BA 5TISU 4RQ3A 3WK8A 2LKYA 2K8AA 1YZ7A 1L7OA 3F2CA 2F8KA 2JRZA 9ICXA 5KAIU 4X5VA 1BPXA 2KSOB 4UBCA 4EZ9A 4ECRA 4IQWA 1RYRA 3JPTA 3F53A 3RRHA 2UVVA 2BPGA 1V9PA 5KFUA 4GXKA 5AI8A 4O3RA 3THVA 4O3SA 3I1YA 3TFRA 2DPJA 4BUGA 4YQWA 5C0YA 1F44A 2V4QA 3OGUA 3QEBZ 3PO5A 3AMZA 4UAYA 4J9SA 4CNQA 4C8NA 1ZD2P 4XA5A 5G5HA 1BPEA 2VJ4A 3A0HU 1N5XA 2KN7A 2GLEA 4OO1J 3F5EA 5KG3A 3H8SA 3GQCA 1QQ7A 3ONNA 5J0OA 4PL2A 2F44A 5HMMA 3F2DA 2EZYA 3PSPA 4PHDA 2VA3A 1SL0A 4NJ8A 1SV4A 5DDMA 3RH6A 3MFHA 4M9JA 2A1AA 3KOOA 4YFKA 2JR5A 2LM4A 2C2EA 2G5HB 2AHOB 5JTIA 4F4XA 4HYKA 5KAFU 2HHXA 3MBYA 2A1JB 3WKAA 3IDWA 4QZIA 1RG6A 4NM2A 1IM4A 2JGAA 2DF4B 4M9NA 4UAZA 1O03A 2WF9A 1Y88A 3BQ2A 5KFHA 3OSPA 4P0QA 4ELUA 3KZIU 1N48A 2FMQA 4QIWF 1FO4A 9ICMA 4ED7A 3RJJA 4ECZA 4F92B 4F2SA 4KX3A 2IOFK 4RQNA 5AKGA 5KFZA 1L7MA 2YN4A 3M9NB 1MQ3A 2W9BA 3VCBA 4Q8FA 2NO5A 4Z6DA 5KFIA 1OUQA 3RR7A 2F1HA 3T3FA 1SWWA 4LZDA 3QYPA 5KT3A 3QUCA 4NLBA 1KKXA 2HVIA 3F5AA 1S0VA 5ALTA 4Q45A 3D2SA 4Y2PA 1SKSA 3D6JA 4U7CA 5J29A 4C4SA 4QZ9A 3V7JA 4DQQA 4DFDA 4ECSA 2RRDA 5ALNA 2HBKA 5KFNA 4RT2A 3C2MA 1HEKA 1H38A 4BWMA 3QNMA 1SZHA 3GIIA 4KITB 5AK6A 3RTVA 1DK3A 1ZQZA 1IIPA 2V9WA 4YN4A 2E1FA 1J97A 2F8LA 2KG5A 4OJOA 2ZIVA 1X40A 4J9LA 4USAA 3KZXA 2HI0A 2JXJA 2DGZA 2EZXA 4TQSA 1S0NA 3HWTA 2KVCA 5F3XB 2PI4A 5AI5A 4J9OA 3L4PA 4XUSA 2XY5A 4IR9A 4DF4A 2D3DA 4F71A 5ALLA 4M9LA 1JALA 3SV4A 1JROA 4UAWA 1NK8A 2W9CA 4ED1A 1ZRMA 2NRZA 4KMUA 7ICTA 5KFBA 4R63A 3MGIA 2ASJA 2QB0A 3PMNA 5KFLA 3HW8A 3H0LB 9ICVA 3V6KA 5DBBA 1IG6A 2IBKA 1Z4OA 2B21A 2G08A 4TUPA 5KFRA 3PMLA 2OWOA 1X9MA 4RQ4A 2LYBA 2K4IA 1XSNA 4ECXA 2NRTA 5EE1A 3ZDCA 4FS2A 1TKDA 4DL2A 4KX5A 3M7DA 2G0AA 1BPBA 2MUTB 2M0NA 4FZMA 4YMOA 2OYYA 7ICRA 1U9LA 3E0FA 5AKJA 1HJPA 4PGXA 2ZUCA 9ICFA 5ALQA 4YMNA 4C8OA 5DB6A 1UA0A 1WUDA 1KTQA 4CDGA 3V6JA 2AQ4A 3KTQA 4RQMA 1SXDA 2WB1C 1DK2A 3MR5A 1TK0A 5KFYA 2OEHA 1L8OA 1NZPA 1NKBA 1S9FA 5GTHU 5AK3A 2HOFA 5J0WA 2G06A 2XCPA 4OCZA 5AI4A 4ED6A 5AM1A 4G9BA 2KVSA 3QZ8A 3IM1A 2DKZA 9ICTA 2XO7A 3QZ7A 2H3ZA 5E79U
chains in the Genus database with same CATH topology
2OM6A 2KIWA 1KBUA 2HOQA 4NV0A 2W03A 2G07A 2CN1A 1YT3A 3OPXA 2PMZC 2KJ5A 2LYAA 1L6NA 3AQEA 4KMOB 2K4EA 4BX9C 2XVTA 3H0MB 5T14A 2GH1A 1GO3F 5A0LA 2HBLA 2PMZF 2G5HB 4PL1A 3O0FA 2RHFA 2W04A 2ZIXA 3SAFA 2KEYA 3KFUF 3AQFA 4NWIA 4ICAA 2ZIXB 2H3FA 2ZIUA 4ACOA 2ZIWA 3H0LB 3RFAA 1P7DA 1CRXA 2OH2A 2F2AB 5KL8B 3GZFA 1A6SA 3CYMA 1D8BA 4C0ZA 2ZIUB 2Q4TA 2ZIWB 3IP4B 4FZNA 4A8EA 4BJQA 2G08A 4OJ5A 4OJ6A 2WAQF 2KNJA 2JH1A 2LBOA 2Z7JA 3GU3A 2JGAA 4FE3A 1PVRA 3D2QA 2DF4B 3ICXA 2LYBA 2K4IA 2XI9A 2BDUA 2YB4A 4WJ3B 4CRXA 5KL1B 1URJA 2KOBA 3M6KA 3SQIA 2RP5A 4NLCA 4OJPA 2W7PA 1Q3UA 1HIWA 2KKPA 2JMGA 4QIWC 1Z1BA 2JH7A 4P0QA 3N7RC 2KICA 2VJ5A 1TAMA 3PSTA 2H3VA 3DEEA 3SAHA 4KX5A 3M7DA 2W7OA 3LYSA 2G0AA 2M0NA 4FZMA 2KD1A 3F2BA 2OYYA 4QIWF 4P0QB 2YB1A 3E0FA 2H3QA 2ZG6A 2WAQC 3SAGA 3HKZC 4KX3A 5HR6A 2LKYA 4U6PA 3AL0B 3PSIA 2VIXA 2E1EA 2K4HA 2K8AA 2G5IB 4QJFB 3PZPA 2VKQA 3HKZF 3CP8A 3VCBA 1ZQ1C 2GOLA 2K8CB 1OUQA 2ZXHA 2XIDA 3F2CA 5HR7A 4NLBA 2KV2A 1WUDA 2K8BB 3F5AA 4P0PA 2KHQA 3IN5A 2G09A 4CDGA 3D2SA 3M6ZA 4OJLA 2CRXA 3K1ZA 2HMXA 2KJ9A 4U7CA 1ECWA 2KKVA 2KJ8A 1UPHA 3IG8A 2A3VA 4CGZA 2E5SA 4P0PB 2F77X 2KHVA 3F53A 1DRGA 1Q3VA 3LVVA 4QNLA 2WB1C 4AYBC 1PVPA 3C28A 3NRWA 2RRDA 2XICA 1Z19A 2MA1A 3MGVA 2HOIA 2HBKA 2CPRA 1PVQA 4O3MA 3RF9A 1XO0A 2WB1F 1HEKA 3H0RB 4AYBF 4BUGA 3NUQA 1F44A 5C0YA 1XNSA 3L3FX 2D6FC 1SZHA 2YX8A 2N1RA 1NZBA 2HOFA 2R18A 1IIPA 4IC9A 2G06A 3N7SC 2NV3A 3PSFA 2VJ4A 2E1FA 4OJOA 1A0PA 2F8LA 2Y0SC 4JMUA 4OO1J 3N7PD 2DQNB 3F5EA 2H3IA 4FZLA 2ZIVA 3SMVA 2F76X 2HBMA 2ZXIA 3IG5A 3D2NA 2LHTA 1T94A 2Y0SF 3ALRA 3KZXA 1ED1A 2ZIVB 3ONNA 3VC8A 3C29A 4PL2A 2DGZA 4GFJA 3CRXA 5CRXA 3LVWA 3F2DA 2HBJA 2JHDA 2MRLA 2K89A 2KVCA 2OXOA 1MA7A 3PSPA 3T79A 2H3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  2K4H A;  2N1R A;  2LYA A;  2GOL A;  1L6N A;  2K4E A;  2LYB A;  4IC9 A;  2K4I A;  2NV3 A;  4JMU A;  1HIW A;  2H3I A;  2JMG A;  2HMX A;  1TAM A;  1ECW A;  2H3V A;  1UPH A;  4ICA A;  1ED1 A;  2H3F A;  2H3Q A;  2H3Z A;  1A6S A; 
#chains in the Genus database with same CATH topology
 3CW2 C;  4UAS A;  3H8M A;  1ZQA A;  2CN1 A;  2C2D A;  3IRU A;  3OPX A;  3ZDA A;  2KFN A;  1L3T A;  1ZJM A;  1F5S A;  4KMO B;  5AKI A;  2K4E A;  2FE9 A;  4BX9 C;  3WKB A;  1D8L A;  5CWR A;  5A0L A;  3RJI A;  1MSW D;  3EPG A;  5L1J A;  2W04 A;  5KFF A;  4QZ8 A;  1A6S A;  5J2F A;  2B6G A;  3GU3 A;  4UW9 A;  3OSN A;  3D2Q A;  3PW7 A;  2BHN A;  9ICE A;  1NK5 A;  1JUD A;  2KFZ A;  3B0X A;  2W7P A;  3JPN A;  5CEH A;  4JK1 A;  2AQ0 A;  1K1Q A;  3JPO A;  2VJ5 A;  4CF3 A;  1AQ6 A;  3TAD C;  5DLG A;  3H8W A;  3PVX A;  1ZQL A;  2ATL A;  5ALX A;  5CA7 A;  2ZG6 A;  1ZQK A;  1CEZ A;  2NO4 A;  2DUY A;  4PHP A;  3Q8P B;  2J6S A;  2YMP A;  4JUZ A;  2V4R A;  2ZXH A;  1TE2 A;  3FC4 A;  3UXP A;  1QCK A;  2O6K A;  3KHH A;  2K8B B;  1NJW A;  3IG8 A;  4NLK A;  2LMR A;  5KFM A;  2F77 X;  4EEL A;  1TAQ A;  4BDP A;  1MC8 A;  5CP2 A;  3G6V A;  8ICE A;  1PVQ A;  3T5L A;  2AXT U;  5KFD A;  4NXZ A;  3PW0 A;  5KFJ A;  1QSL A;  1DGS A;  5DLF A;  3WK7 A;  1ZQB A;  2MAX A;  1KLN A;  4UAU A;  5HHI A;  5BOM A;  1N62 A;  2RLT A;  3D2N A;  2I5H A;  3VC8 A;  5AKY A;  5DB8 A;  1D9D A;  4I29 A;  4GLX A;  4P4O A;  3T79 A;  2H3Q A;  1C20 A;  4R8U B;  5AIC A;  4UB2 A;  4RNO A;  4M47 A;  1SB3 C;  3G6X A;  3N4M B;  2IMW P;  5ALI A;  1YT3 A;  1GO3 F;  2PFN A;  1U48 A;  2JEG A;  3ISC A;  7ICI A;  4C80 A;  2Q4T A;  4A8E A;  1VDV A;  4QWB A;  4BJQ A;  3TAQ A;  1ZD3 A;  5AM0 A;  3BQ0 A;  1KQQ A;  3BJY A;  1FFU A;  2R8K A;  5DB9 A;  4DL6 A;  2ALZ A;  1J2N A;  5B5E U;  4RQ6 A;  2IA6 A;  4WJ3 B;  4M6W A;  1KFD A;  3I28 A;  4B9M A;  2DWQ A;  4ECY A;  1XS9 D;  1COO A;  3MR2 A;  1X42 A;  3PSI A;  5J2I A;  5IIJ A;  1S10 A;  4KLO A;  5DKW A;  3PV8 A;  3RH5 A;  1TV9 A;  8ICZ A;  4OJL A;  4P2H A;  4M6W B;  3Q8M A;  1L5U A;  4O3Q A;  2A19 A;  4J9N A;  3DDH A;  3LVV A;  5J2C A;  2EQY A;  5KFC A;  2HOI A;  5IIM A;  2IHN A;  4IRK A;  1LB2 B;  2W8K A;  1L8L A;  4B9V A;  3NUQ A;  1ZQJ A;  4DQR A;  3AUO A;  4UBB A;  4MF8 A;  2C28 A;  1LKY B;  3RBD A;  4ED3 A;  3QEA Z;  3PSF A;  4MFC A;  4JMU A;  5D49 A;  3GV7 B;  3WK5 A;  1KEJ A;  4I28 A;  2EDU A;  3N97 B;  3C2K A;  3BZC A;  5AM3 A;  3LWL A;  4O5K A;  2ZUB A;  5HHH A;  3WU2 U;  2KJ5 A;  5III A;  4K4G A;  4ZOH C;  2GH1 A;  1KRP A;  3C21 A;  5JU5 A;  3S6J A;  4ICA A;  3BS5 A;  3B9J A;  1UT5 A;  4EEN A;  4DL5 A;  4F3O A;  2MU2 A;  2FJ6 A;  1D8B A;  5J2E A;  8ICM A;  2XY7 A;  4Y2T A;  1ZQN A;  1ZOL A;  1B22 A;  3CNH A;  3M6K A;  3V7K A;  3KHL A;  5HR7 A;  3DEE A;  8ICK A;  5ALV A;  4RUC A;  3EUB 2;  2YMQ A;  3AL0 B;  2K4H A;  1ZQG A;  1DXS A;  4F5P A;  7ICO A;  1NNL A;  3SI8 A;  3CP8 A;  3GDX A;  5KT5 A;  2ZTC A;  5KFT A;  1ZQR A;  2KSO A;  2XID A;  1SKR A;  1SV0 A;  2G09 A;  4IRD A;  1TK5 A;  5EE3 A;  2KKV A;  3EYZ A;  4CGZ A;  2YMM A;  5AK5 A;  5BPC A;  5JUM A;  3ZDD A;  2CPR A;  5HP4 A;  3H0R B;  4K4I A;  1T7P A;  3L3F X;  8ICJ A;  4F93 B;  3UQ2 A;  2W9M A;  4F50 A;  2DQN B;  5KG1 A;  1ZQI A;  1ZQM A;  5L1K A;  2W3R A;  1D8Y A;  2DFL A;  3EZ5 A;  4QZA A;  4M9H A;  2MRL A;  2BCU A;  3NS1 A;  3BZK A;  2JZB B;  4EBC A;  2F3N A;  4TQR A;  9ICN A;  4I2I A;  5BOL A;  2UVW A;  4MHV A;  5T14 A;  4Y2Q A;  3V7L A;  2Y1J A;  1N61 A;  3UMB A;  4RPX A;  3KFU F;  2A1J A;  1QQ5 A;  1S5L U;  3SZ2 A;  4RQ8 A;  4C0Z A;  1WCL A;  4J9Q A;  3IP4 B;  4FZN A;  1NOM A;  4TUR A;  4NY8 A;  2BKE A;  2HVH A;  3ZD8 A;  1B43 A;  4CRX A;  5KL1 B;  4F5N A;  3FDS A;  4OJP A;  4YR3 A;  1YZ6 A;  4GC7 A;  3PST A;  4EBE A;  4DFK A;  3SYZ A;  5J0R A;  5ALR A;  5G5G A;  2R8H A;  4UB5 A;  1S97 A;  5KG7 A;  4QZH A;  2YB1 A;  4IRC A;  2AGP A;  1ZQE A;  5AI9 A;  3HKZ C;  4PGQ A;  3T5H A;  5ALW A;  5KFX A;  4JWM A;  1NI3 A;  8ICA A;  4QJF B;  2LYH A;  3PZP A;  4ED8 A;  2K8C B;  1ZJN A;  4Q8E A;  2HSZ A;  7ICJ A;  3FM9 A;  4QZG A;  3M9O B;  1SL2 A;  1QSY A;  1ECW A;  4CF5 A;  3ZDB A;  4DSK A;  4AYB C;  5L9X A;  4TUS A;  4EZ6 A;  3RJE A;  3UMC A;  3QUT A;  4ECT A;  5J2D A;  3K75 D;  4CCH A;  1A76 A;  1PK1 B;  1KW4 A;  2W54 A;  1ZQD A;  8ICT A;  4PZO A;  2QAR B;  2LHT A;  2P35 A;  2XC9 A;  3WKE A;  1JMS A;  4QWD A;  2K89 A;  4LZG A;  9ICA A;  8ICB A;  2W03 A;  1V97 A;  4I2G A;  2E8N A;  7ICV A;  3DV9 A;  1PUZ A;  4K4H A;  2KZM A;  3AN1 A;  1XO1 A;  9ICI A;  4YXJ A;  1J2M A;  5ALE A;  2FLL A;  5KT7 A;  1RQL A;  2W9A A;  3AQF A;  7ICN A;  9ICQ A;  5DQH A;  1ZQU A;  3QU9 A;  3BS7 A;  5ALP A;  3CYM A;  1X9W A;  5KG6 A;  2KNJ A;  3N28 A;  3GV8 B;  1RPL A;  2XCA A;  5AIB A;  4NLC A;  5ALM A;  4RPZ A;  9ICG A;  4FO6 A;  1CUK A;  2MUT A;  3RAQ A;  4DSE A;  5EWF A;  4I2E A;  3NVY A;  5J0P A;  8ICL A;  8ICG A;  2F1I A;  3Q8R B;  3HPO A;  2EAN A;  1SGG A;  4MFF A;  4F2R A;  1VLB A;  5HR6 A;  1JXE A;  4ED0 A;  2HHU A;  3RRG A;  2EAP A;  5IIK A;  2AJQ A;  5DGA A;  3UM9 A;  1XSP A;  2KJ9 A;  5CJ7 A;  1NK9 A;  1MQ2 A;  8ICR A;  1PVP A;  1TFR A;  4LJX A;  5GTI U;  5K4L A;  1BNP A;  1XO0 A;  2WB1 F;  2JEI A;  2D8C A;  1Q8K A;  2VA2 A;  4ECQ A;  4US8 A;  3EPI A;  2JV3 A;  3ISD A;  4ELT A;  4F4W A;  1TK8 A;  4UAT A;  3K1R B;  2Y0S C;  1N2X A;  3IG5 A;  2W11 A;  4O3N A;  1PK3 A;  3AEV A;  2WF8 A;  2JHD A;  2BQR A;  3BQ7 A;  4LVS A;  8ICP A;  5L1M A;  3QXG A;  3LDA A;  2PFP A;  4QZD A;  4PPX A;  1QLN A;  2PMZ C;  4KLG A;  2ZJA A;  8ICI A;  2HBL A;  2ESE A;  1U47 A;  1X2I A;  3SAF A;  1XSL A;  4EYI B;  3UMG A;  9ICB A;  1COK A;  4KLH A;  9ICC A;  8ICW A;  4MFA A;  2WF7 A;  2JEJ A;  3UXO A;  3RH4 A;  1BPY A;  4FE3 A;  2AGQ A;  4BGD A;  8ICF A;  4DFP A;  4PHE A;  4O5C A;  2KOB A;  2ZUD A;  4UAR A;  2NRX A;  3FAH A;  2H3V A;  4KN4 A;  4PZN A;  4YMM A;  3LYS A;  3SR6 A;  1X6J A;  1L3V A;  2RDJ A;  2ZJ8 A;  3PX6 A;  4DS5 A;  3Q8Q B;  5ALS A;  5KFP A;  2E8M A;  4DL7 A;  4C4T A;  5AI0 A;  3Q8S B;  2NYV A;  3T5J A;  3PY8 A;  1SXE A;  1RYU A;  1ARO P;  4DFJ A;  4I2H A;  2FDR A;  2P6R A;  4I2F A;  3WK4 A;  2LM1 A;  4KLF A;  1SV0 C;  3IV6 A;  1L7P A;  1XU4 A;  1U45 A;  1U4B A;  4DQS A;  3NRW A;  4C7Z A;  3ZDE A;  2N1R A;  5IIL A;  2R18 A;  2UVR A;  4IC9 A;  8ICY A;  3TAC B;  5J2B A;  3Q8L A;  5JRT A;  5J0Q A;  2KMD A;  3RBE A;  4QW9 A;  3ALR A;  3B0Y A;  2AU0 A;  1NJZ A;  4F5O A;  1ZQP A;  4ED2 A;  4R8U A;  4RNM A;  3CRX A;  2OXO A;  1MA7 A;  3H8J A;  2ISP A;  2YY6 A;  1EXN A;  4J9R A;  1BVS A;  5EWG A;  2FMP A;  1Q46 A;  4DS4 A;  2HHT A;  5AM2 A;  1OXJ A;  1TAU A;  1ZRN A;  8ICU A;  2EAM A;  4E0D A;  4DLG A;  5KL8 B;  3KKA A;  1M6Y A;  5AM4 A;  1QH9 A;  2ZIW B;  4GIB A;  5KG0 A;  2Y1I A;  7ICM A;  3AU2 A;  2FLP A;  3GIL A;  3MDC A;  1T3Q A;  4DL3 A;  2XGP A;  1Z00 B;  4AP9 A;  2H5X A;  4C8M A;  3WKC A;  4F5Q A;  3QU7 A;  4P4M A;  5CB1 A;  5EOZ A;  5J0Y A;  3NGD A;  2BDP A;  3MC1 A;  3WK9 A;  3R9K A;  4UAV A;  1OW5 A;  5J2H A;  5KFO A;  4RU9 A;  3IHQ B;  1FFV A;  4J9K A;  4P0P B;  2E5S A;  1Q3V A;  4QNL A;  1UA1 A;  1Z19 A;  2KZ3 A;  5DQI A;  3MGV A;  1RM6 C;  4YXM A;  5ALY A;  4KLS A;  4G3I A;  5AIA A;  3SEN A;  1LKY A;  1BPD A;  4NM1 A;  4O9M A;  5DBC A;  4MF2 A;  4IL6 U;  5J0S A;  2ZXI A;  4Z6E A;  3PW5 A;  4DSL A;  4Y2U A;  3ISB A;  3RJK A;  4RZR A;  4KTQ A;  4C4R A;  3PR4 A;  5AHX A;  2LYA A;  3EW9 A;  4GXJ A;  2PI5 A;  1RXV A;  4DSI A;  2F1J A;  2IOH A;  3H0M B;  1NK7 A;  4O0I A;  2EH9 A;  4ZH4 A;  2M9N A;  2XGQ A;  2NRW A;  1WWV A;  3QUQ A;  2HHQ A;  2EAO A;  2ZJ5 A;  3RB6 A;  4B9N A;  3C23 A;  2VA8 A;  4DOB A;  3RFA A;  1L7N A;  1DOQ A;  2ZIU B;  1SL1 A;  3V6H A;  2JH1 A;  4J03 A;  5KTQ A;  1XWL A;  5J0X A;  3T5K A;  2PKE A;  2HHV A;  2YB4 A;  1B4F A;  4KLM A;  3SQI A;  1N63 A;  4M2Y A;  4NLZ A;  4YP3 A;  5KT6 A;  3F2B A;  4BXO B;  4IR1 A;  5ALF A;  5AKH A;  7ICF A;  4J9M A;  4FS1 A;  2XY6 A;  3QE9 Y;  3TQ1 A;  5AKK A;  4KLQ A;  1S76 D;  1ZQ1 C;  2GOL A;  5KFQ A;  3OTQ A;  2KV2 A;  3IN5 A;  2WF6 A;  2BZF A;  4EBD A;  4Z6F A;  1DRG A;  3HT3 A;  1KFT A;  2BCS A;  3GV5 B;  8ICH A;  3HIL A;  1NJY A;  5J2A A;  4RQ5 A;  4DQP A;  4RUA A;  5AI6 A;  3ZI4 A;  5DQG A;  4KLI A;  4F4Y A;  3N7S C;  1JIH A;  3ETL A;  4RQ1 A;  2J6T A;  4DSJ A;  2CXY A;  5KG2 A;  3J81 j;  2YTU A;  2HBM A;  1SWV A;  2BPF A;  3KD3 A;  3TAN A;  4QW8 A;  2JZB A;  1S77 D;  5CRX A;  2WHE A;  4NL9 A;  3H4D A;  4GXI A;  4KLU A;  3G6Y A;  4M0A A;  3PW4 A;  3AU6 A;  4DSF A;  4OD0 A;  2HOQ A;  2G07 A;  2I6X A;  4R66 A;  1BPZ A;  1SKW A;  4CF4 A;  9ICR A;  3OHB A;  2Q0Z X;  1NK0 A;  4PHA A;  5IIN A;  2BCQ A;  5EWE A;  2ZIX B;  3HRD D;  4QZF A;  4Y2X A;  1QTM A;  8ICN A;  2AGO A;  3RJF A;  4OJ6 A;  4YCX A;  1URJ A;  3HP6 A;  4PGY A;  4YVZ A;  4DOA A;  5D4B A;  4JB3 A;  5KFE A;  5DG9 A;  4PJ0 U;  2KD1 A;  4FBT A;  9ICJ A;  4F4K A;  3SAG A;  2E1E A;  3HKZ F;  4B9L A;  4QZE A;  4XRH A;  3WK6 A;  2WFA A;  3ZD9 A;  1ZQO A;  1S8O A;  5AM5 A;  4DFM A;  3GFK B;  1T8E A;  1RDF A;  4YR0 A;  5J2J A;  3UPQ A;  1IV8 A;  4AYB F;  4Q44 A;  4IQU A;  1PK1 A;  2AH5 A;  5KFA A;  5KG4 A;  2QAR A;  2FI1 A;  1A0P A;  4RNN A;  3QUB A;  7ICU A;  5ALZ A;  2H3I A;  7ICH A;  1F0M A;  2BQU A;  3LVW A;  2HBJ A;  3PO4 A;  2YQE A;  7ICP A;  5J8Y A;  4NV0 A;  3C5G A;  3PNC A;  5ALH A;  2E8O A;  2FPL A;  3LWM A;  9ICU A;  1L6N A;  5DDY A;  4Y2R A;  4PH5 A;  1XC9 A;  2RHF A;  4DWI A;  2QKQ A;  1FIQ A;  1X9X A;  2KZZ A;  3HJE A;  4I2J A;  4B9S A;  5KFS A;  2F2A B;  9ICO A;  3JPQ A;  1KDH A;  5AKZ A;  1NKC A;  3ORY A;  3JPS A;  2WAQ F;  3KKA C;  4RQ2 A;  4UQG A;  1U49 A;  7ICS A;  2ASL A;  2BDU A;  2BCV A;  1Q3U A;  4QIW C;  2MSN A;  4UB1 A;  3N7R C;  3NAS A;  4P4P A;  4I2D A;  4P0Q B;  1K5O A;  5ALD A;  5D46 A;  3GIM A;  2WAQ C;  4ELV A;  5CHG A;  3BDP A;  3E58 A;  2FPM A;  3AM9 A;  1NK4 A;  4I2C A;  8ICV A;  2G5I B;  1BNO A;  2QLT A;  1ZXI A;  1N5W A;  4JWN A;  2W9B B;  3M9M B;  4QWC A;  3RR8 A;  2E3T A;  1ZD4 A;  5B66 U;  2KHQ A;  4MEX A;  9ICS A;  3KHR A;  4C7Y A;  3K1Z A;  1UPH A;  2A3V A;  2IHM A;  3NVW A;  2KHV A;  1Z3E B;  2C22 A;  3M8R A;  3NVV A;  4C8L A;  4ECV A;  3BQ1 A;  4FBU A;  1RXW A;  3OJS A;  3BQT A;  4JV1 A;  3C1Z A;  2P6U A;  5ALG A;  4RQ0 A;  1ZQS A;  3C5F A;  4UB3 A;  7ICK A;  4RT3 A;  2W3S A;  3H4B A;  3N7P D;  2KP7 A;  5H2F U;  1T94 A;  2Y0S F;  1UQV A;  2ZIV B;  3ED5 A;  2Y9U A;  1DGJ A;  1WYG A;  1Z4N A;  4GFJ A;  1D9F A;  8ICO A;  2B0C A;  2BQ3 A;  4Y2Y A;  1KL9 A;  4EYH B;  3NRZ A;  3L5K A;  4YR2 A;  3C2L A;  1BGX T;  2QB1 A;  4QZC A;  2J6U A;  7ICE A;  2PMZ F;  4PL1 A;  3O0F A;  3PX4 A;  2ES6 A;  2W9C B;  2OHF A;  2QB0 B;  3TFS A;  3MFI A;  1C7Y A;  3GZF A;  1ZQF A;  2PFO A;  2LBO A;  2Z7J A;  5L1L A;  5DG7 A;  2XI9 A;  3GIK A;  3RB3 A;  2HW3 A;  1Z1B A;  4F5R A;  2JH7 A;  1TAM A;  3NTU A;  1JXL A;  3U26 A;  4I27 A;  1V38 A;  4U6P A;  5J2K A;  2DPI A;  5ALU A;  2VKQ A;  5AK4 A;  4F72 A;  5FP0 A;  1QSS A;  7ICL A;  4Z6C A;  1RYS A;  3RB0 A;  1ZQH A;  1WG8 A;  4NLG A;  1O08 A;  3MGH A;  4DCC A;  1Z1V A;  1VJ5 A;  4KLT A;  2ZTE A;  2XIC A;  2MA1 A;  1NKE A;  4KLE A;  4NLN A;  4O3M A;  5ALO A;  4CE6 A;  1XNS A;  4DLE A;  5AKL A;  3UQ0 A;  4Y2S A;  3RB4 A;  4EX7 A;  4I2A A;  2PXI A;  4FZL A;  5C5J A;  3HX0 A;  2IOF A;  2ZTD A;  3C29 A;  5HNK A;  3K4G A;  4UB8 U;  8ICC A;  3GIJ A;  4DQI A;  4M9G A;  4NL9 C;  2KIW A;  1KBU A;  1KN5 A;  3H40 A;  2DKX A;  1WWU A;  2K60 A;  5L1I A;  4R64 A;  5EE9 A;  2VAN A;  2XVT A;  5J2G A;  3NVZ A;  1NK6 A;  4IQV A;  3QX7 A;  2EZZ A;  4B6J A;  2DL0 A;  2FLN A;  4BWJ A;  2OCE A;  2ZIW A;  5KFK A;  1P7D A;  1CRX A;  2BCR A;  4YD1 A;  2R8J A;  2LPE A;  3QU5 A;  4UB4 A;  2BGW A;  4EX6 A;  5CR0 A;  1N60 A;  1HUZ A;  4M04 A;  1X6I A;  2UVU A;  1SIJ A;  3TAP A;  1Z00 A;  2K4P A;  2ISO A;  2GWS A;  5HML A;  3KBB A;  9ICW A;  1V85 A;  4ECW A;  1UHU A;  3PW2 A;  5KFG A;  3SV3 A;  1ZQC A;  3V72 A;  2DBY A;  8ICS A;  9ICP A;  1LV5 A;  2I9G A;  2BPC A;  2WTF A;  1L3S A;  1JX4 A;  1ZET A;  4P0P A;  5KFV A;  2HMX A;  2BR0 A;  1FEZ A;  1X66 A;  2P66 A;  4EEK A;  1NJX A;  3PR5 B;  5F9L A;  3C28 A;  1ZQW A;  2FPK A;  5DB7 A;  1WCN A;  1RQN A;  4F91 B;  7ICG A;  4EEY A;  3E2E A;  2YX8 A;  4KLJ A;  4YG2 A;  2KE7 A;  3KHG A;  2KIV A;  2HHS A;  3EWA A;  4KLD A;  1JN3 A;  3QU4 A;  4IQT A;  5TZV A;  1ZD5 A;  5KFW A;  3MAB A;  4QZB A;  1K1S A;  2PFQ A;  2RDI A;  4Y2V A;  1S0M A;  4JV0 A;  2NRV A;  1UT8 A;  4O5E A;  4Q43 A;  4R65 A;  5ALK A;  1S0O A;  3MR3 A;  1N56 A;  2L5Y A;  4KN7 A;  5ALJ A;  3AQE A;  5J8Y C;  2HHW A;  3MDA A;  2ASD A;  1HUO A;  4FFD A;  2HCF A;  2KEY A;  4NWI A;  5DBA A;  4TUQ A;  2H3F A;  9ICH A;  2ZIU A;  2JEF A;  1QQ6 A;  8ICX A;  3TAR A;  2OH2 A;  1ZQQ A;  1CI4 A;  3M8S A;  3M1Y A;  3A0B U;  3PX0 A;  1LVH A;  3ETR A;  4GC6 A;  5J0U A;  2KK0 A;  2GO7 A;  3QU2 A;  1MN8 A;  4MEY A;  4ECU A;  1TVA A;  3Q8K A;  4QWE A;  1SZP A;  2RP5 A;  5KT2 A;  1HIW A;  1T4G A;  2KKP A;  4KLL A;  2JMG A;  4DF8 A;  3SAH A;  2KIC A;  4BXO A;  1KSP A;  1JI7 A;  5DGB A;  5KT4 A;  1RZT A;  4QWA A;  1PZN A;  2VIX A;  2LI6 A;  2W55 A;  5F9N A;  2ODG A;  3RJH A;  2WF5 A;  1ZQT A;  4DEZ A;  1B0X A;  5IIO A;  3UXN A;  4HAI A;  2C2R A;  2HDO A;  3M6Z A;  2CRX A;  1IXR A;  2KJ8 A;  3SEI A;  1UCV A;  4F4Z A;  1ZQY A;  4YD2 A;  2Y9T A;  3JPR A;  4Y2J A;  3JPP A;  5AKE A;  4F8R A;  3RF9 A;  3OJU A;  4DOC A;  4XQ8 A;  1X9S A;  2D6F C;  3FYH A;  1NZB A;  4B9T A;  2KTQ A;  2NV3 A;  3SD7 A;  3RAX A;  1PVR A;  3SMV A;  5KG5 A;  2F76 X;  7ICQ A;  1T3N A;  4J9P A;  1ED1 A;  3H7I A;  1L3U A;  4O3O A;  3MR6 A;  2RQ5 A;  2FMS A;  4JV2 A;  2OM6 A;  5J0T A;  4IS7 A;  4DO9 A;  4C8K A;  2W43 A;  3RJG A;  9ICK A;  2ZIX A;  3I76 A;  5KNI A;  4UB6 U;  3TKA A;  2R8I A;  5DG8 A;  4ACO A;  5AKX A;  3BS5 B;  3WKD A;  4DL4 A;  4RPY A;  4OJ5 A;  4O3P A;  2E8P A;  3C1Y A;  3TI0 A;  1ZYQ A;  3OHA A;  1ZQV A;  2YML A;  2I1Q A;  3ICX A;  4B9U A;  3LK9 A;  2R8G A;  3TAD A;  9ICL A;  4RQ7 A;  5EE0 A;  8ICQ A;  2W7O A;  1JRP A;  1KFS A;  1ZQX A;  2W8L A;  4US9 A;  1A77 A;  4I2B A;  5TIS U;  4RQ3 A;  3WK8 A;  2LKY A;  2K8A A;  1YZ7 A;  1L7O A;  3F2C A;  2F8K A;  2JRZ A;  9ICX A;  5KAI U;  4X5V A;  1BPX A;  2KSO B;  4UBC A;  4EZ9 A;  4ECR A;  4IQW A;  1RYR A;  3JPT A;  3F53 A;  3RRH A;  2UVV A;  2BPG A;  1V9P A;  5KFU A;  4GXK A;  5AI8 A;  4O3R A;  3THV A;  4O3S A;  3I1Y A;  3TFR A;  2DPJ A;  4BUG A;  4YQW A;  5C0Y A;  1F44 A;  2V4Q A;  3OGU A;  3QEB Z;  3PO5 A;  3AMZ A;  4UAY A;  4J9S A;  4CNQ A;  4C8N A;  1ZD2 P;  4XA5 A;  5G5H A;  1BPE A;  2VJ4 A;  3A0H U;  1N5X A;  2KN7 A;  2GLE A;  4OO1 J;  3F5E A;  5KG3 A;  3H8S A;  3GQC A;  1QQ7 A;  3ONN A;  5J0O A;  4PL2 A;  2F44 A;  5HMM A;  3F2D A;  2EZY A;  3PSP A;  4PHD A;  2VA3 A;  1SL0 A;  4NJ8 A;  1SV4 A;  5DDM A;  3RH6 A;  3MFH A;  4M9J A;  2A1A A;  3KOO A;  4YFK A;  2JR5 A;  2LM4 A;  2C2E A;  2G5H B;  2AHO B;  5JTI A;  4F4X A;  4HYK A;  5KAF U;  2HHX A;  3MBY A;  2A1J B;  3WKA A;  3IDW A;  4QZI A;  1RG6 A;  4NM2 A;  1IM4 A;  2JGA A;  2DF4 B;  4M9N A;  4UAZ A;  1O03 A;  2WF9 A;  1Y88 A;  3BQ2 A;  5KFH A;  3OSP A;  4P0Q A;  4ELU A;  3KZI U;  1N48 A;  2FMQ A;  4QIW F;  1FO4 A;  9ICM A;  4ED7 A;  3RJJ A;  4ECZ A;  4F92 B;  4F2S A;  4KX3 A;  2IOF K;  4RQN A;  5AKG A;  5KFZ A;  1L7M A;  2YN4 A;  3M9N B;  1MQ3 A;  2W9B A;  3VCB A;  4Q8F A;  2NO5 A;  4Z6D A;  5KFI A;  1OUQ A;  3RR7 A;  2F1H A;  3T3F A;  1SWW A;  4LZD A;  3QYP A;  5KT3 A;  3QUC A;  4NLB A;  1KKX A;  2HVI A;  3F5A A;  1S0V A;  5ALT A;  4Q45 A;  3D2S A;  4Y2P A;  1SKS A;  3D6J A;  4U7C A;  5J29 A;  4C4S A;  4QZ9 A;  3V7J A;  4DQQ A;  4DFD A;  4ECS A;  2RRD A;  5ALN A;  2HBK A;  5KFN A;  4RT2 A;  3C2M A;  1HEK A;  1H38 A;  4BWM A;  3QNM A;  1SZH A;  3GII A;  4KIT B;  5AK6 A;  3RTV A;  1DK3 A;  1ZQZ A;  1IIP A;  2V9W A;  4YN4 A;  2E1F A;  1J97 A;  2F8L A;  2KG5 A;  4OJO A;  2ZIV A;  1X40 A;  4J9L A;  4USA A;  3KZX A;  2HI0 A;  2JXJ A;  2DGZ A;  2EZX A;  4TQS A;  1S0N A;  3HWT A;  2KVC A;  5F3X B;  2PI4 A;  5AI5 A;  4J9O A;  3L4P A;  4XUS A;  2XY5 A;  4IR9 A;  4DF4 A;  2D3D A;  4F71 A;  5ALL A;  4M9L A;  1JAL A;  3SV4 A;  1JRO A;  4UAW A;  1NK8 A;  2W9C A;  4ED1 A;  1ZRM A;  2NRZ A;  4KMU A;  7ICT A;  5KFB A;  4R63 A;  3MGI A;  2ASJ A;  2QB0 A;  3PMN A;  5KFL A;  3HW8 A;  3H0L B;  9ICV A;  3V6K A;  5DBB A;  1IG6 A;  2IBK A;  1Z4O A;  2B21 A;  2G08 A;  4TUP A;  5KFR A;  3PML A;  2OWO A;  1X9M A;  4RQ4 A;  2LYB A;  2K4I A;  1XSN A;  4ECX A;  2NRT A;  5EE1 A;  3ZDC A;  4FS2 A;  1TKD A;  4DL2 A;  4KX5 A;  3M7D A;  2G0A A;  1BPB A;  2MUT B;  2M0N A;  4FZM A;  4YMO A;  2OYY A;  7ICR A;  1U9L A;  3E0F A;  5AKJ A;  1HJP A;  4PGX A;  2ZUC A;  9ICF A;  5ALQ A;  4YMN A;  4C8O A;  5DB6 A;  1UA0 A;  1WUD A;  1KTQ A;  4CDG A;  3V6J A;  2AQ4 A;  3KTQ A;  4RQM A;  1SXD A;  2WB1 C;  1DK2 A;  3MR5 A;  1TK0 A;  5KFY A;  2OEH A;  1L8O A;  1NZP A;  1NKB A;  1S9F A;  5GTH U;  5AK3 A;  2HOF A;  5J0W A;  2G06 A;  2XCP A;  4OCZ A;  5AI4 A;  4ED6 A;  5AM1 A;  4G9B A;  2KVS A;  3QZ8 A;  3IM1 A;  2DKZ A;  9ICT A;  2XO7 A;  3QZ7 A;  2H3Z A;  5E79 U; 
#chains in the Genus database with same CATH homology
 2OM6 A;  2KIW A;  1KBU A;  2HOQ A;  4NV0 A;  2W03 A;  2G07 A;  2CN1 A;  1YT3 A;  3OPX A;  2PMZ C;  2KJ5 A;  2LYA A;  1L6N A;  3AQE A;  4KMO B;  2K4E A;  4BX9 C;  2XVT A;  3H0M B;  5T14 A;  2GH1 A;  1GO3 F;  5A0L A;  2HBL A;  2PMZ F;  2G5H B;  4PL1 A;  3O0F A;  2RHF A;  2W04 A;  2ZIX A;  3SAF A;  2KEY A;  3KFU F;  3AQF A;  4NWI A;  4ICA A;  2ZIX B;  2H3F A;  2ZIU A;  4ACO A;  2ZIW A;  3H0L B;  3RFA A;  1P7D A;  1CRX A;  2OH2 A;  2F2A B;  5KL8 B;  3GZF A;  1A6S A;  3CYM A;  1D8B A;  4C0Z A;  2ZIU B;  2Q4T A;  2ZIW B;  3IP4 B;  4FZN A;  4A8E A;  4BJQ A;  2G08 A;  4OJ5 A;  4OJ6 A;  2WAQ F;  2KNJ A;  2JH1 A;  2LBO A;  2Z7J A;  3GU3 A;  2JGA A;  4FE3 A;  1PVR A;  3D2Q A;  2DF4 B;  3ICX A;  2LYB A;  2K4I A;  2XI9 A;  2BDU A;  2YB4 A;  4WJ3 B;  4CRX A;  5KL1 B;  1URJ A;  2KOB A;  3M6K A;  3SQI A;  2RP5 A;  4NLC A;  4OJP A;  2W7P A;  1Q3U A;  1HIW A;  2KKP A;  2JMG A;  4QIW C;  1Z1B A;  2JH7 A;  4P0Q A;  3N7R C;  2KIC A;  2VJ5 A;  1TAM A;  3PST A;  2H3V A;  3DEE A;  3SAH A;  4KX5 A;  3M7D A;  2W7O A;  3LYS A;  2G0A A;  2M0N A;  4FZM A;  2KD1 A;  3F2B A;  2OYY A;  4QIW F;  4P0Q B;  2YB1 A;  3E0F A;  2H3Q A;  2ZG6 A;  2WAQ C;  3SAG A;  3HKZ C;  4KX3 A;  5HR6 A;  2LKY A;  4U6P A;  3AL0 B;  3PSI A;  2VIX A;  2E1E A;  2K4H A;  2K8A A;  2G5I B;  4QJF B;  3PZP A;  2VKQ A;  3HKZ F;  3CP8 A;  3VCB A;  1ZQ1 C;  2GOL A;  2K8C B;  1OUQ A;  2ZXH A;  2XID A;  3F2C A;  5HR7 A;  4NLB A;  2KV2 A;  1WUD A;  2K8B B;  3F5A A;  4P0P A;  2KHQ A;  3IN5 A;  2G09 A;  4CDG A;  3D2S A;  3M6Z A;  4OJL A;  2CRX A;  3K1Z A;  2HMX A;  2KJ9 A;  4U7C A;  1ECW A;  2KKV A;  2KJ8 A;  1UPH A;  3IG8 A;  2A3V A;  4CGZ A;  2E5S A;  4P0P B;  2F77 X;  2KHV A;  3F53 A;  1DRG A;  1Q3V A;  3LVV A;  4QNL A;  2WB1 C;  4AYB C;  1PVP A;  3C28 A;  3NRW A;  2RRD A;  2XIC A;  1Z19 A;  2MA1 A;  3MGV A;  2HOI A;  2HBK A;  2CPR A;  1PVQ A;  4O3M A;  3RF9 A;  1XO0 A;  2WB1 F;  1HEK A;  3H0R B;  4AYB F;  4BUG A;  3NUQ A;  1F44 A;  5C0Y A;  1XNS A;  3L3F X;  2D6F C;  1SZH A;  2YX8 A;  2N1R A;  1NZB A;  2HOF A;  2R18 A;  1IIP A;  4IC9 A;  2G06 A;  3N7S C;  2NV3 A;  3PSF A;  2VJ4 A;  2E1F A;  4OJO A;  1A0P A;  2F8L A;  2Y0S C;  4JMU A;  4OO1 J;  3N7P D;  2DQN B;  3F5E A;  2H3I A;  4FZL A;  2ZIV A;  3SMV A;  2F76 X;  2HBM A;  2ZXI A;  3IG5 A;  3D2N A;  2LHT A;  1T94 A;  2Y0S F;  3ALR A;  3KZX A;  1ED1 A;  2ZIV B;  3ONN A;  3VC8 A;  3C29 A;  4PL2 A;  2DGZ A;  4GFJ A;  3CRX A;  5CRX A;  3LVW A;  3F2D A;  2HBJ A;  2JHD A;  2MRL A;  2K89 A;  2KVC A;  2OXO A;  1MA7 A;  3PSP A;  3T79 A;  2H3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...