2H3ZA

Structure of the hiv-1 matrix protein bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 38
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3zA01
4IC9A 2K4EA 2H3IA 2H3QA 2H3FA 1ECWA 2NV3A 2H3VA 2H3ZA 4ICAA 2LYAA 4JMUA 1HIWA 2N1RA 2K4IA 1UPHA 1TAMA 1HEKA 1L6NA 2GOLA 1A6SA 2K4HA 2HMXA 2JMGA 2LYBA 1ED1A
chains in the Genus database with same CATH superfamily
2VKQA 3LDAA 4M2YA 1RG6A 5TZVA 4B9NA 1TAQA 2KNJA 2PXIA 9ICHA 3KD3A 4P2HA 4JWMA 3BQ2A 5J0WA 4Z6CA 3ZD8A 2ALZA 3H8WA 4F4ZA 1K1SA 5AM2A 3C2MA 3AQFA 3I1YA 3Q8MA 3AN1A 5AKIA 5KG0A 4OO1J 4O3RA 4BXOB 5AKYA 4DF4A 3CW2C 2EZYA 5IINA 3NVZA 2G06A 4LZDA 2BCSA 1QQ5A 1VJ5A 3C2KA 3F2CA 4MHVA 2XCAA 5C5JA 4ECTA 4ED3A 4QZFA 4HAIA 4KLQA 1COKA 2AHOB 3M6KA 4UAVA 2XI9A 1PK1B 1ZOLA 4DFJA 4F72A 3PVXA 4M9NA 1XNSA 1XO1A 4U6PA 1L7PA 3GV7B 3M9OB 1TE2A 1XSPA 4J9OA 1ZXIA 4GC7A 5KT4A 1V9PA 4C4TA 2NO5A 5KFBA 4NLKA 3Q8SB 4KN4A 5J0RA 2ZUDA 2K8BB 8ICIA 3RJHA 4IS7A 5ALVA 1FO4A 1A0PA 1ZQIA 3L5KA 1PK1A 1FIQA 5DDYA 4QWEA 2NRTA 4RUCA 4C8LA 2KD1A 3MGIA 3B9JA 9ICMA 5KFLA 4F4WA 1Z4NA 2XCPA 2BCRA 4NM1A 8ICWA 3ZDAA 2ASDA 3SR6A 4EENA 2JR5A 4KX5A 1UT5A 1YZ7A 4RUAA 2DPIA 4C0ZA 2DF4B 3AL0B 2KZMA 1MC8A 5KFVA 4EZ9A 2Q4TA 1QLNA 3NASA 5J0UA 1EXNA 2F76X 2XICA 1LVHA 1U49A 2KIWA 1NZPA 1LV5A 1CEZA 4Y2XA 1NK0A 1XC9A 3OHBA 4DQQA 2ZIVB 4ECQA 3PO4A 4I2CA 5GTIU 4F71A 2EANA 2RLTA 3NRWA 1V85A 9ICVA 5KG2A 4IC9A 3WK4A 4MFFA 5KFTA 4FZMA 1B22A 5EE3A 1N56A 2DPJA 7ICRA 2Y0SF 3RH5A 3PW2A 2BGWA 1BPEA 2VIXA 3QZ7A 2W54A 2QB1A 2NO4A 5KFDA 2LM1A 3BQ1A 3PY8A 3BS5A 5ALSA 5HR6A 3M7DA 1RXWA 5KFKA 5B66U 4DFMA 1J2NA 4R8UA 8ICYA 1N2XA 2R18A 3H8JA 3WKCA 1ZQUA 2Y1IA 3SV4A 2JGAA 8ICRA 3H4BA 5IIOA 4P0QB 1XU4A 3CNHA 1IV8A 4RQ5A 1X9SA 4YXJA 4IRCA 4B6JA 1SKWA 2WF6A 2F1JA 4EEYA 3HP6A 2NYVA 3PSTA 4J9KA 1PZNA 2B21A 1S76D 2FLPA 8ICVA 2KFZA 2C22A 4BWMA 5GTHU 5HP4A 3RJKA 3RB6A 2DQNB 4PL2A 2ZJ8A 4JV2A 4JB3A 4RQ1A 4O3MA 1UT8A 2HOIA 5AKGA 3MFIA 3C29A 1D8YA 2WB1C 4YD2A 2WHEA 2KVSA 5ALEA 4O5CA 4F8RA 1UCVA 4QWAA 3ISDA 5ALGA 2JXJA 3SAFA 3IRUA 3ZDEA 1SKSA 8ICAA 2GOLA 4NV0A 1Z1BA 4FBTA 2W9BA 2ZIVA 1ZQVA 4QZDA 2R8GA 3K4GA 4QZIA 3JPRA 1ZQBA 1LKYA 2FJ6A 5H2FU 1PVPA 1ZQXA 9ICPA 2BQ3A 2A19A 4QW8A 2J6TA 2PFNA 4US8A 2E5SA 4OJPA 3PMLA 1ZYQA 3M8RA 3ED5A 4ED6A 2HW3A 4JV0A 5DKWA 4UQGA 4PZNA 4Y2PA 4RPZA 3G6XA 7ICHA 2BQUA 1U48A 8ICKA 5KG7A 2W8KA 1MQ2A 3SAHA 1V97A 1NZBA 1ZQQA 4ZOHC 3BS5B 2KVCA 4JV1A 3SV3A 1PUZA 3BQTA 4DL4A 5J0TA 4FZNA 4ECRA 3THVA 1ZJMA 4TUPA 1JXLA 3QE9Y 4DOBA 4KLJA 4RQMA 3BZKA 4EBCA 3RB4A 3ORYA 3ETLA 1KKXA 1TAUA 1SV0C 4DS5A 4F91B 2K8AA 3C1ZA 1MSWD 2UVVA 3EWAA 3QU9A 4C8NA 2IHNA 1HEKA 9ICBA 4O9MA 4TURA 3ZDDA 1XWLA 2FPMA 5KFXA 2R8JA 1AQ6A 3A0BU 4MF2A 1SGGA 5JRTA 4NL9A 1JI7A 3M9MB 2VA8A 3ZD9A 2KICA 3HKZC 2C28A 4ECYA 2OXOA 5DG8A 1UHUA 9ICSA 4IR1A 4DS4A 3OPXA 5AK6A 8ICCA 2HMXA 4OJ6A 1ZQLA 3UPQA 1NJWA 2JEIA 2DKZA 4O0IA 5HHIA 2YB4A 2W9AA 4J9PA 2KIVA 3GIIA 3OSPA 4O3SA 8ICTA 3GQCA 4FS1A 4YR3A 1ZQTA 4P4OA 4KLUA 1U4BA 2JV3A 2HOFA 4DOCA 2ZUCA 5J0SA 3F5AA 5AKXA 3OSNA 4DFKA 4CGZA 1X2IA 1L7MA 2PKEA 2WAQC 5EE9A 9ICOA 1RM6C 3M8SA 1NKCA 3B0XA 4R66A 4FS2A 4ELVA 1ZD2P 2F2AB 9ICQA 3LVVA 5J0OA 7ICVA 3FM9A 1DK3A 1MQ3A 1F0MA 4EBEA 4NLBA 5DBAA 5KT3A 4M47A 1S0VA 3RH6A 5DDMA 4UASA 8ICBA 1NNLA 3TAPA 1YT3A 3HPOA 2KP7A 3MFHA 3G6VA 2OWOA 1BGXT 3TI0A 2BZFA 1RZTA 5K4LA 3IHQB 1ZJNA 2A1AA 4YCXA 4RQ6A 5AKEA 1FFVA 3I28A 3RF9A 5KFEA 2DUYA 1BNOA 8ICMA 2AQ4A 2KN7A 4YG2A 4RT3A 5CP2A 3GIMA 4PPXA 4F2SA 2GH1A 2JZBB 3DDHA 2H3QA 1SV0A 1OXJA 2JRZA 2W43A 1ZRMA 8ICEA 5DB6A 2RDIA 3UM9A 2ZTEA 5ALDA 1N61A 4EX7A 1DXSA 1U9LA 1QCKA 2W8LA 2KKVA 3KTQA 1ZETA 4J9RA 5J2JA 1QQ7A 4F50A 2KZZA 1RYRA 3WKDA 4QW9A 2ATLA 3V7LA 2C2EA 5D46A 5KFQA 1KSPA 3Q8PB 1L3VA 3PR4A 3RAQA 1S9FA 4QWBA 1BPYA 2N1RA 2K4IA 5ALIA 3H7IA 3C2LA 2FPKA 1FEZA 4R64A 3MR2A 2IHMA 4M6WB 4BUGA 2UVWA 4C4RA 1NKBA 4CCHA 4RU9A 3HWTA 1AROP 1KFDA 1BVSA 2ZIWB 4P0PB 2G08A 1ZQHA 3KZXA 5B5EU 3MGVA 2BKEA 1RYSA 4RQNA 4IQTA 3GDXA 1X9MA 3TADA 2K60A 4QZCA 4RQ3A 1Z1VA 3QZ8A 5KFGA 4I2DA 1KN5A 2HCFA 3DV9A 1DGSA 5DG7A 3BZCA 1X42A 4JWNA 2PI5A 1JIHA 3ZDCA 4QZGA 1B43A 4Y2UA 4MF8A 1L7NA 2WF5A 5KFJA 1NJZA 3IDWA 9ICXA 4DWIA 2RQ5A 3WU2U 4KLMA 2BQRA 3PW0A 5J2EA 1L5UA 1KTQA 3TQ1A 4Y2VA 4DQIA 4B9UA 7ICNA 3MBYA 1A77A 2PFPA 2WAQF 2B0CA 3HILA 4UB3A 2KV2A 1OW5A 5J2HA 5AI6A 4DL3A 4O3NA 3KHRA 2EZZA 5AKJA 4KLTA 2E1EA 9ICNA 3S6JA 4UAZA 4Z6DA 1PVRA 2QB0A 3D2SA 9ICUA 1T3NA 5J0QA 4U7CA 3H4DA 4YD1A 8ICGA 1S97A 1NJXA 2BPFA 1ZQWA 4M6WA 2YMLA 3M6ZA 5CWRA 4M9JA 4ECZA 3M1YA 4C8KA 1ZQYA 4Y2QA 4EYIB 3JPOA 5AI8A 2WFAA 1Q3VA 3RR8A 1N62A 4I2FA 3T5LA 3PO5A 5DGBA 2P6UA 3UMGA 1JX4A 2Z7JA 1KW4A 2E1FA 3GV8B 2VJ5A 3PNCA 2BPGA 4FO6A 5KG6A 5DBBA 4DQRA 4EX6A 2W7PA 5IIMA 5J2AA 3IN5A 5EE1A 5D49A 3FAHA 2JEJA 2WF9A 2W55A 5BOLA 3WK9A 5KFMA 2P6RA 1XSLA 4RT2A 3NGDA 3V72A 4GIBA 4US9A 4J9MA 5KTQA 4I2HA 2ZG6A 2LBOA 3TFSA 5ALYA 5J2IA 4YR0A 4C4SA 2KG5A 1ZQNA 1Q8KA 5IILA 2CXYA 3QUCA 2MUTB 1KBUA 5ALPA 2Y9TA 5KFHA 4CDGA 9ICGA 5KT7A 5HR7A 8ICUA 4KLFA 1ZQCA 4XQ8A 4MFCA 4O3QA 3QNMA 5ALMA 2RDJA 3J81j 1PK3A 9ICLA 3I76A 2LYAA 2HI0A 5DG9A 3CRXA 4B9LA 4ELUA 5DB7A 2KTQA 3R9KA 8ICHA 2JMGA 2XVTA 3V7KA 2G0AA 2AGOA 4CNQA 5ALKA 1L8LA 2UVUA 1N63A 3T79A 3QX7A 5KT5A 2FPLA 1JMSA 4KITB 2BPCA 4RPYA 3RH4A 4EYHB 3C1YA 1UA1A 1ZQSA 1GO3F 5AM1A 4OD0A 1SL2A 4UBCA 3QU5A 1KLNA 3HT3A 4TUQA 5ALNA 4J9NA 3ICXA 1WYGA 5HNKA 4FBUA 3GFKB 1L3UA 4DEZA 3QU7A 2HVHA 2HSZA 5JTIA 3D2NA 2KE7A 4C8MA 4RQ8A 3AU6A 4ECSA 2I1QA 1ZQJA 2W04A 4FZLA 5ALWA 4DSFA 2ES6A 2RP5A 4C8OA 3EYZA 2OEHA 1YZ6A 2HHUA 1ZQ1C 5CB1A 2ZXIA 3QUQA 5G5HA 2ODGA 1C20A 4QZ8A 1SL0A 2ASJA 4RZRA 3MR6A 2YMMA 5KNIA 4O3OA 2AXTU 4M9HA 3QUBA 2K4PA 4DQSA 5KFCA 2MUTA 4YR2A 5AM0A 1SL1A 4EELA 5KFNA 4P4MA 2F1IA 1MA7A 3T5HA 4BDPA 1ED1A 2W9MA 5KFPA 5L1KA 1ZQAA 3BQ7A 2V4RA 4YMMA 2XO7A 2NRVA 1X9XA 1ZQPA 3HW8A 1URJA 3LWMA 2HBLA 4I2BA 5IIKA 3DEEA 3U26A 3SAGA 2HHVA 3WKEA 1O08A 5L1JA 1ZD3A 1D9DA 2ISPA 3NUQA 3V6KA 2W11A 4PHDA 3MGHA 2G5IB 4LZGA 2PFOA 2LKYA 5J2GA 1KFTA 3RR7A 4I2EA 5ALLA 3NVVA 3RRGA 3PX4A 2FLNA 3IG5A 4PHEA 2OM6A 3B0YA 8ICLA 2CN1A 1RXVA 7ICLA 3BJYA 4R65A 5L1MA 2HHQA 2YMQA 4E0DA 2PMZC 2KHVA 4A8EA 7ICSA 2WF8A 5L1LA 3RJGA 2R8IA 4Z6FA 3WK7A 1ZQMA 3E2EA 4DFDA 2I5HA 1S5LU 4DL7A 1NKEA 2IOHA 2F8KA 4YQWA 2MRLA 2QARB 2EAMA 5EWFA 3GILA 1TK0A 5G5GA 3KHHA 1ZQFA 1WG8A 2WF7A 4FE3A 4I2JA 1QSSA 4PJ0U 1J97A 5ALOA 4PGXA 9ICAA 5J0PA 2E8MA 2I6XA 2H3VA 5ALHA 5AI0A 2KJ5A 7ICQA 3SEIA 3MDCA 1DGJA 2GWSA 4PHPA 3C5GA 5JU5A 1L7OA 2G07A 4ZH4A 2JH1A 4F4YA 4DSJA 2EQYA 3BQ0A 5EOZA 4CRXA 4YN4A 4HYKA 4GLXA 2QARA 5KFIA 3NVWA 2KOBA 1S10A 1SKRA 4YMNA 5AM4A 7ICIA 1BNPA 1TFRA 3ISBA 5AHXA 5F9LA 1U45A 3JPQA 5T14A 1N5XA 2OHFA 2KSOB 5DBCA 5KFOA 1S0OA 5KAIU 4PGQA 4PL1A 4WJ3B 3ALRA 3PSPA 3KHLA 1NK6A 1WCLA 4F5PA 3MC1A 2ESEA 3L3FX 1COOA 2VA2A 4CF5A 2W9CB 1SXEA 2FMQA 3UQ2A 4UB6U 2PFQA 1L3TA 2BCVA 4UB4A 4G3IA 1JRPA 3V6HA 3N7PD 3EPIA 5KG5A 4DL5A 3TAQA 4IQWA 2O6KA 1LB2B 1ZQDA 4Q8EA 3JPPA 3EZ5A 4DSIA 3K1ZA 4AP9A 5KL1B 4CF3A 3N7RC 3KZIU 2ZTDA 3N97B 1S8OA 2MA1A 9ICCA 4ED7A 4PH5A 3OJUA 3RFAA 2F44A 4J9SA 3VC8A 4YXMA 2EDUA 3TACB 4ICAA 1B0XA 4NLNA 7ICOA 2W9CA 4AYBC 2XGQA 2DKXA 2YX8A 4NY8A 5J2BA 4DFPA 1FFUA 2BDPA 1Q3UA 1Y88A 3E58A 2IOFK 1SXDA 2E3TA 2W9BB 5J2FA 1IIPA 3RRHA 4FFDA 3UMBA 4J03A 2HBKA 4F5NA 5AK3A 4ED0A 4QIWC 5A0LA 5CRXA 2D6FC 1ZQEA 1Z00A 5HMMA 5ALRA 2ZIXA 1XO0A 4QWCA 9ICIA 3CP8A 3IP4B 1DOQA 2EH9A 4Q44A 3LK9A 2W03A 4DF8A 3Q8KA 4DSEA 5DLGA 4BGDA 4UB2A 4IQVA 3AM9A 1BPBA 3SQIA 2JEFA 1X6JA 2KSOA 3F5EA 1JUDA 3D6JA 4UW9A 3H0LB 3PR5B 3A0HU 4I29A 2HHWA 7ICPA 3MABA 3PV8A 1HUZA 3RJFA 4PHAA 3OHAA 2M9NA 4NLZA 4DSKA 2ZIUB 3JPSA 4RNOA 2W3SA 4EZ6A 1RPLA 5AKHA 2XY5A 2KJ9A 4C7YA 3H8SA 2J6SA 1BPDA 5KL8B 4RQ2A 5KT2A 2H3FA 7ICUA 5AKKA 2BDUA 5ALTA 3WK6A 4NXZA 1NK9A 4QZBA 1A6SA 4G9BA 1Z19A 5J8YC 2DFLA 2ZIUA 3KOOA 2CPRA 4ECVA 7ICTA 4ACOA 4ED8A 4KTQA 2HDOA 3RJIA 2DGZA 3KKAA 4QZAA 1QTMA 2LYHA 2M0NA 1KDHA 1B4FA 3QEAZ 1ZQRA 5J2KA 4R8UB 5D4BA 1SWWA 2NRXA 4BXOA 4P0QA 1A76A 1N60A 4EBDA 1JALA 4XA5A 3QUTA 4ECXA 5ALQA 5DLFA 4QZEA 1RDFA 5AKLA 1ECWA 4J9QA 3SENA 1Z00B 4F5RA 2G5HB 4IRDA 4IQUA 3WK8A 2P66A 3PW5A 4OJLA 5IIJA 4DLEA 3SD7A 2HBMA 1TKDA 3RB0A 5EWEA 3HRDD 5AM5A 3SYZA 3O0FA 2XC9A 1QSLA 5C0YA 4O3PA 2F1HA 2OYYA 1M6YA 2MU2A 2VJ4A 2GO7A 4KMUA 4C80A 1RQNA 2HHTA 2YY6A 4RNMA 4ED1A 3T5KA 3SI8A 5HMLA 2RRDA 2VANA 2XY6A 2QKQA 4GC6A 2H5XA 2ZXHA 2C2DA 1OUQA 4I2AA 3HJEA 3VCBA 4O5KA 1SIJA 4M9GA 4PZOA 5KAFU 3QU2A 2K89A 3KBBA 2DBYA 1IM4A 2FLLA 2OH2A 1Z4OA 2AGPA 5J29A 2HHSA 2W7OA 2LMRA 1O03A 4F2RA 4K4IA 2ZUBA 1LKYB 4M9LA 7ICGA 4OJ5A 4Q8FA 2ZJAA 3Q8RB 4F5QA 5ALFA 3RJJA 3UQ0A 4XRHA 3PW7A 1ZD5A 3RB3A 1SB3C 2G09A 3FDSA 3D2QA 4M04A 4MEXA 1KFSA 9ICEA 3BS7A 1X40A 2E8OA 8ICSA 3K1RB 2CRXA 3GIKA 5DQGA 2I9GA 4Y2YA 3AMZA 2IBKA 2LHTA 2UVRA 9ICFA 2F3NA 2C2RA 1C7YA 4RQ0A 4OJOA 2ZJ5A 4ED2A 3V6JA 3PX0A 3QEBZ 2AU0A 2Y0SC 3C5FA 2LPEA 4I28A 4DQPA 5DB8A 3UMCA 2YN4A 4Q45A 4YMOA 3V7JA 2NRZA 4NL9C 4KN7A 4DL6A 4CE6A 3JPTA 3QU4A 4KLHA 5AICA 3NVYA 5AI5A 5J0YA 2FMPA 3T5JA 2YQEA 4Y2SA 1F5SA 2RHFA 4R63A 2NRWA 2MSNA 2EZXA 1ZD4A 2B6GA 4M0AA 4ELTA 7ICFA 2FI1A 1PVQA 1DRGA 4NM2A 3IM1A 3IV6A 1NJYA 4GFJA 4UBBA 1P7DA 5JUMA 2ISOA 8ICNA 3PSFA 1D8LA 1WUDA 4UAYA 5ALUA 1WCNA 1TVAA 1Z3EB 3UXOA 3EPGA 4OCZA 4KLDA 5KFFA 1IXRA 2FDRA 4Q43A 1QSYA 3PZPA 2KJ8A 3JPNA 3H8MA 2Q0ZX 1XS9D 3GZFA 1BPZA 3TFRA 4KLOA 3RAXA 1XSNA 5DGAA 3AU2A 5F3XB 2HOQA 4RNNA 4IR9A 2AQ0A 2QLTA 2KK0A 4QZHA 5L1IA 1T4GA 3LVWA 5KFRA 3LYSA 3F53A 2BCUA 4I27A 5KFYA 1NOMA 5AK5A 1CUKA 4UB1A 5KFZA 4RQ7A 5DQIA 7ICMA 1ZQGA 9ICJA 4GXKA 2LM4A 3NTUA 2A3VA 4F93B 2JH7A 4GXIA 4UATA 1UA0A 2R8KA 1JN3A 2W3RA 2HBJA 3TARA 5BOMA 1CRXA 3WK5A 4UB8U 4PGYA 2A1JA 4UB5A 4O5EA 5EE0A 3H0MB 2F77X 1SWVA 1X9WA 4UARA 2XY7A 3GU3A 4ECWA 4EEKA 5ALZA 1JXEA 4IRKA 4NLGA 2H3IA 4C7ZA 3SZ2A 2BCQA 2HHXA 5BPCA 4TQSA 1T94A 4F4XA 3PX6A 1NI3A 4QIWF 2V4QA 2KZ3A 2JZBA 2Y9UA 2AJQA 2GLEA 4YP3A 3IG8A 5L9XA 1ZQZA 1SZPA 2K4EA 7ICEA 4F92B 4NWIA 8ICJA 1KEJA 3H0RB 3PW4A 3MR3A 8ICQA 2H3ZA 3KFUF 1SZHA 3NS1A 4DO9A 1HIWA 5KT6A 4MEYA 1S0MA 3GV5B 1JROA 1T7PA 1KL9A 3QXGA 4QWDA 3WKAA 2BR0A 2YMPA 4P4PA 1L3SA 3EW9A 4JUZA 2Y1JA 4TUSA 4KLEA 1RYUA 1H38A 4ECUA 1S77D 3SMVA 4DOAA 2D8CA 2XIDA 1L8OA 1UPHA 3RTVA 2ZIWA 4P0PA 3RBDA 1CI4A 4LVSA 2D3DA 2YB1A 3E0FA 1K1QA 3F2DA 9ICTA 1ZQKA 4BJQA 5CR0A 2IA6A 5F9NA 3MR5A 1RQLA 4Y2JA 4KLSA 3EUB2 5KG4A 1V38A 3F2BA 3C28A 3ZI4A 4UAWA 3KKAC 1NK8A 4IL6U 3ETRA 4QJFB 4DSLA 2KHQA 2LYBA 2ZTCA 2P35A 2KMDA 2MAXA 2R8HA 5J2DA 2A1JB 3AQEA 8ICOA 2ASLA 1KRPA 2KEYA 1N48A 5CEHA 3ZDBA 3C23A 3QYPA 1D8BA 2DL0A 3FYHA 4QNLA 5AI4A 3WKBA 4BX9C 1F44A 2FMSA 2V9WA 3UXNA 2NV3A 2EAPA 1K5OA 1NK5A 4KLIA 2K8CB 2LI6A 1S0NA 4JMUA 3PSIA 4LJXA 4DL2A 1X66A 4MFAA 4NJ8A 3C21A 3N28A 4NLCA 5J0XA 4TQRA 4CF4A 3UXPA 4Y2TA 3Q8LA 4GXJA 2QB0B 3OGUA 3L4PA 2PMZF 3Q8QB 2YTUA 5AK4A 1N5WA 1WWUA 3K75D 1T3QA 3FC4A 5KFWA 5KG1A 1IG6A 3HKZF 4KLGA 4I2GA 2VA3A 4B9MA 3KHGA 1D9FA 3LWLA 4KMOB 1VDVA 2WB1F 4JK1A 3ISCA 1J2MA 4B9TA 2XGPA 1NK7A 5EWGA 5E79U 2KKPA 5FP0A 4F4KA 2IOFA 5KFAA 3TKAA 1TV9A 2BHNA 9ICKA 2JHDA 2E8NA 1X6IA 5KFSA 4F5OA 1BPXA 2K4HA 1Q46A 5ALXA 3NRZA 1NK4A 1ZQOA 1QQ6A 5HHHA 8ICZA 2FE9A 3GIJA 3RJEA 5J2CA 3T3FA 2DWQA 3ONNA 1VLBA 5TISU 2HVIA 5J8YA 1T8EA 5AIBA 1ZRNA 3N4MB 1UQVA 4Y2RA 3AUOA 3HX0A 7ICJA 3OTQA 3MDAA 5AIAA 5AKZA 1KQQA 4B9SA 1DK2A 1MN8A 5CHGA 4QZ9A 5ALJA 5IIIA 5DB9A 4UAUA 4DCCA 5AM3A 5KG3A 1HJPA 5CJ7A 2E8PA 2EAOA 3AEVA 3G6YA 3H40A 2ZIXB 4YFKA 3TANA 2PI4A 4F3OA 1TAMA 4J9LA 1L6NA 9ICWA 1U47A 3PMNA 3M9NB 3RBEA 1SV4A 5CA7A 4X5VA 4DLGA 2JEGA 9ICRA 3TADC 7ICKA 8ICFA 2OCEA 2IMWP 2J6UA 2AH5A 8ICPA 3OJSA 4USAA 4Z6EA 3BDPA 1HUOA 5KFUA 3CYMA 2KFNA 5AI9A 5DQHA 4I2IA 4KX3A 4KLLA 4K4GA 4B9VA 1QH9A 2AGQA 4K4HA 8ICXA 2WTFA 2L5YA 4RQ4A 4YVZA 4XUSA 1TK5A 4BWJA 1WWVA 1TK8A 2F8LA 4AYBF 3N7SC 4RPXA
chains in the Genus database with same CATH topology
3L3FX 3F5EA 2VKQA 3PSTA 2OYYA 1Q3VA 4NLBA 2VJ4A 3H0LB 1GO3F 2G5IB 2H3IA 2LKYA 2KNJA 3ONNA 1T94A 1YT3A 3AQEA 2RHFA 3ICXA 3IG5A 2K8AA 4KX5A 4QIWF 2OM6A 2Z7JA 2E1FA 2ZIUB 2VJ5A 4C0ZA 2DF4B 2CN1A 2DQNB 4PL2A 3AL0B 1NZBA 1HEKA 3N7PD 2RRDA 2KEYA 2KJ9A 4O3MA 2W7PA 2ZXHA 3IG8A 1OUQA 3D2NA 2HOIA 3IN5A 3RF9A 3VCBA 2PMZC 3K1ZA 2KHVA 2Q4TA 3AQFA 2WB1C 2K4EA 3C29A 1PVQA 2F76X 5KL8B 4NWIA 2XICA 5KL1B 4A8EA 4QNLA 3N7RC 2KIWA 4BX9C 1DRGA 1F44A 2GH1A 3H0RB 4OO1J 2H3QA 2MA1A 2K89A 2H3FA 2ZIVB 2NV3A 3RFAA 2KICA 2OH2A 3HKZC 2W04A 4FZLA 2G06A 2H3ZA 3VC8A 2W7OA 2RP5A 2K8CB 2OXOA 4GFJA 4ICAA 1SZHA 2ZG6A 1P7DA 2LBOA 4JMUA 3KFUF 3PSIA 2MRLA 2BDUA 1HIWA 2ZIXB 3NRWA 3F2CA 3SAFA 1TAMA 3PSFA 1WUDA 1L6NA 2GOLA 4NV0A 1ZQ1C 4OJ5A 4AYBC 1A6SA 3OPXA 1Z1BA 2YX8A 2ZIVA 2ZXIA 2WAQF 1Z19A 4NLCA 2KKVA 2HMXA 4FE3A 1KBUA 2ZIUA 4IC9A 2KV2A 2CPRA 4OJ6A 3M6KA 4ACOA 4CDGA 4FZMA 3PZPA 2G09A 2KJ8A 2YB4A 3D2QA 2XI9A 3GZFA 1Q3UA 1PVPA 5HR7A 2PMZF 2Y0SF 2DGZA 2H3VA 1XNSA 2VIXA 2HOQA 2CRXA 2KJ5A 1IIPA 2M0NA 4U6PA 3SMVA 2E1EA 2E5SA 2LYAA 4OJPA 2XIDA 3LVWA 2N1RA 2HBKA 2K4IA 2LHTA 1UPHA 3F53A 3LYSA 3CRXA 3HKZF 2ZIWA 4P0PA 1PVRA 4QIWC 5A0LA 2G07A 4P0QA 5CRXA 1MA7A 2JH1A 2D6FC 3D2SA 2HOFA 4BUGA 4CRXA 2JMGA 1ED1A 1D8BA 2XVTA 5HR6A 3F5AA 3M7DA 2YB1A 2ZIXA 3E0FA 2WB1F 4KMOB 4OJOA 2KOBA 3CYMA 4U7CA 1XO0A 4CGZA 3CP8A 3IP4B 2R18A 3SAHA 2WAQC 3F2DA 2A3VA 2JGAA 4KX3A 2ZIWB 2JH7A 4BJQA 1ECWA 2G0AA 2G08A 2Y0SC 2K8BB 4P0PB 4P0QB 2W03A 2KKPA 3KZXA 2KVCA 5T14A 3M6ZA 1A0PA 1URJA 2G5HB 2F2AB 2HBLA 3MGVA 2HBJA 2JHDA 3C28A 3F2BA 3T79A 1CRXA 3DEEA 3LVVA 3SAGA 4OJLA 4PL1A 4FZNA 2HBMA 4WJ3B 2K4HA 3ALRA 3SQIA 3H0MB 2F8LA 3PSPA 2F77X 3O0FA 4AYBF 2KD1A 3N7SC 3NUQA 4QJFB 5C0YA 2KHQA 2LYBA 3GU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC9 A;  2K4E A;  2H3I A;  2H3Q A;  2H3F A;  1ECW A;  2NV3 A;  2H3V A;  2H3Z A;  4ICA A;  2LYA A;  4JMU A;  1HIW A;  2N1R A;  2K4I A;  1UPH A;  1TAM A;  1HEK A;  1L6N A;  2GOL A;  1A6S A;  2K4H A;  2HMX A;  2JMG A;  2LYB A;  1ED1 A; 
#chains in the Genus database with same CATH topology
 2VKQ A;  3LDA A;  4M2Y A;  1RG6 A;  5TZV A;  4B9N A;  1TAQ A;  2KNJ A;  2PXI A;  9ICH A;  3KD3 A;  4P2H A;  4JWM A;  3BQ2 A;  5J0W A;  4Z6C A;  3ZD8 A;  2ALZ A;  3H8W A;  4F4Z A;  1K1S A;  5AM2 A;  3C2M A;  3AQF A;  3I1Y A;  3Q8M A;  3AN1 A;  5AKI A;  5KG0 A;  4OO1 J;  4O3R A;  4BXO B;  5AKY A;  4DF4 A;  3CW2 C;  2EZY A;  5IIN A;  3NVZ A;  2G06 A;  4LZD A;  2BCS A;  1QQ5 A;  1VJ5 A;  3C2K A;  3F2C A;  4MHV A;  2XCA A;  5C5J A;  4ECT A;  4ED3 A;  4QZF A;  4HAI A;  4KLQ A;  1COK A;  2AHO B;  3M6K A;  4UAV A;  2XI9 A;  1PK1 B;  1ZOL A;  4DFJ A;  4F72 A;  3PVX A;  4M9N A;  1XNS A;  1XO1 A;  4U6P A;  1L7P A;  3GV7 B;  3M9O B;  1TE2 A;  1XSP A;  4J9O A;  1ZXI A;  4GC7 A;  5KT4 A;  1V9P A;  4C4T A;  2NO5 A;  5KFB A;  4NLK A;  3Q8S B;  4KN4 A;  5J0R A;  2ZUD A;  2K8B B;  8ICI A;  3RJH A;  4IS7 A;  5ALV A;  1FO4 A;  1A0P A;  1ZQI A;  3L5K A;  1PK1 A;  1FIQ A;  5DDY A;  4QWE A;  2NRT A;  4RUC A;  4C8L A;  2KD1 A;  3MGI A;  3B9J A;  9ICM A;  5KFL A;  4F4W A;  1Z4N A;  2XCP A;  2BCR A;  4NM1 A;  8ICW A;  3ZDA A;  2ASD A;  3SR6 A;  4EEN A;  2JR5 A;  4KX5 A;  1UT5 A;  1YZ7 A;  4RUA A;  2DPI A;  4C0Z A;  2DF4 B;  3AL0 B;  2KZM A;  1MC8 A;  5KFV A;  4EZ9 A;  2Q4T A;  1QLN A;  3NAS A;  5J0U A;  1EXN A;  2F76 X;  2XIC A;  1LVH A;  1U49 A;  2KIW A;  1NZP A;  1LV5 A;  1CEZ A;  4Y2X A;  1NK0 A;  1XC9 A;  3OHB A;  4DQQ A;  2ZIV B;  4ECQ A;  3PO4 A;  4I2C A;  5GTI U;  4F71 A;  2EAN A;  2RLT A;  3NRW A;  1V85 A;  9ICV A;  5KG2 A;  4IC9 A;  3WK4 A;  4MFF A;  5KFT A;  4FZM A;  1B22 A;  5EE3 A;  1N56 A;  2DPJ A;  7ICR A;  2Y0S F;  3RH5 A;  3PW2 A;  2BGW A;  1BPE A;  2VIX A;  3QZ7 A;  2W54 A;  2QB1 A;  2NO4 A;  5KFD A;  2LM1 A;  3BQ1 A;  3PY8 A;  3BS5 A;  5ALS A;  5HR6 A;  3M7D A;  1RXW A;  5KFK A;  5B66 U;  4DFM A;  1J2N A;  4R8U A;  8ICY A;  1N2X A;  2R18 A;  3H8J A;  3WKC A;  1ZQU A;  2Y1I A;  3SV4 A;  2JGA A;  8ICR A;  3H4B A;  5IIO A;  4P0Q B;  1XU4 A;  3CNH A;  1IV8 A;  4RQ5 A;  1X9S A;  4YXJ A;  4IRC A;  4B6J A;  1SKW A;  2WF6 A;  2F1J A;  4EEY A;  3HP6 A;  2NYV A;  3PST A;  4J9K A;  1PZN A;  2B21 A;  1S76 D;  2FLP A;  8ICV A;  2KFZ A;  2C22 A;  4BWM A;  5GTH U;  5HP4 A;  3RJK A;  3RB6 A;  2DQN B;  4PL2 A;  2ZJ8 A;  4JV2 A;  4JB3 A;  4RQ1 A;  4O3M A;  1UT8 A;  2HOI A;  5AKG A;  3MFI A;  3C29 A;  1D8Y A;  2WB1 C;  4YD2 A;  2WHE A;  2KVS A;  5ALE A;  4O5C A;  4F8R A;  1UCV A;  4QWA A;  3ISD A;  5ALG A;  2JXJ A;  3SAF A;  3IRU A;  3ZDE A;  1SKS A;  8ICA A;  2GOL A;  4NV0 A;  1Z1B A;  4FBT A;  2W9B A;  2ZIV A;  1ZQV A;  4QZD A;  2R8G A;  3K4G A;  4QZI A;  3JPR A;  1ZQB A;  1LKY A;  2FJ6 A;  5H2F U;  1PVP A;  1ZQX A;  9ICP A;  2BQ3 A;  2A19 A;  4QW8 A;  2J6T A;  2PFN A;  4US8 A;  2E5S A;  4OJP A;  3PML A;  1ZYQ A;  3M8R A;  3ED5 A;  4ED6 A;  2HW3 A;  4JV0 A;  5DKW A;  4UQG A;  4PZN A;  4Y2P A;  4RPZ A;  3G6X A;  7ICH A;  2BQU A;  1U48 A;  8ICK A;  5KG7 A;  2W8K A;  1MQ2 A;  3SAH A;  1V97 A;  1NZB A;  1ZQQ A;  4ZOH C;  3BS5 B;  2KVC A;  4JV1 A;  3SV3 A;  1PUZ A;  3BQT A;  4DL4 A;  5J0T A;  4FZN A;  4ECR A;  3THV A;  1ZJM A;  4TUP A;  1JXL A;  3QE9 Y;  4DOB A;  4KLJ A;  4RQM A;  3BZK A;  4EBC A;  3RB4 A;  3ORY A;  3ETL A;  1KKX A;  1TAU A;  1SV0 C;  4DS5 A;  4F91 B;  2K8A A;  3C1Z A;  1MSW D;  2UVV A;  3EWA A;  3QU9 A;  4C8N A;  2IHN A;  1HEK A;  9ICB A;  4O9M A;  4TUR A;  3ZDD A;  1XWL A;  2FPM A;  5KFX A;  2R8J A;  1AQ6 A;  3A0B U;  4MF2 A;  1SGG A;  5JRT A;  4NL9 A;  1JI7 A;  3M9M B;  2VA8 A;  3ZD9 A;  2KIC A;  3HKZ C;  2C28 A;  4ECY A;  2OXO A;  5DG8 A;  1UHU A;  9ICS A;  4IR1 A;  4DS4 A;  3OPX A;  5AK6 A;  8ICC A;  2HMX A;  4OJ6 A;  1ZQL A;  3UPQ A;  1NJW A;  2JEI A;  2DKZ A;  4O0I A;  5HHI A;  2YB4 A;  2W9A A;  4J9P A;  2KIV A;  3GII A;  3OSP A;  4O3S A;  8ICT A;  3GQC A;  4FS1 A;  4YR3 A;  1ZQT A;  4P4O A;  4KLU A;  1U4B A;  2JV3 A;  2HOF A;  4DOC A;  2ZUC A;  5J0S A;  3F5A A;  5AKX A;  3OSN A;  4DFK A;  4CGZ A;  1X2I A;  1L7M A;  2PKE A;  2WAQ C;  5EE9 A;  9ICO A;  1RM6 C;  3M8S A;  1NKC A;  3B0X A;  4R66 A;  4FS2 A;  4ELV A;  1ZD2 P;  2F2A B;  9ICQ A;  3LVV A;  5J0O A;  7ICV A;  3FM9 A;  1DK3 A;  1MQ3 A;  1F0M A;  4EBE A;  4NLB A;  5DBA A;  5KT3 A;  4M47 A;  1S0V A;  3RH6 A;  5DDM A;  4UAS A;  8ICB A;  1NNL A;  3TAP A;  1YT3 A;  3HPO A;  2KP7 A;  3MFH A;  3G6V A;  2OWO A;  1BGX T;  3TI0 A;  2BZF A;  1RZT A;  5K4L A;  3IHQ B;  1ZJN A;  2A1A A;  4YCX A;  4RQ6 A;  5AKE A;  1FFV A;  3I28 A;  3RF9 A;  5KFE A;  2DUY A;  1BNO A;  8ICM A;  2AQ4 A;  2KN7 A;  4YG2 A;  4RT3 A;  5CP2 A;  3GIM A;  4PPX A;  4F2S A;  2GH1 A;  2JZB B;  3DDH A;  2H3Q A;  1SV0 A;  1OXJ A;  2JRZ A;  2W43 A;  1ZRM A;  8ICE A;  5DB6 A;  2RDI A;  3UM9 A;  2ZTE A;  5ALD A;  1N61 A;  4EX7 A;  1DXS A;  1U9L A;  1QCK A;  2W8L A;  2KKV A;  3KTQ A;  1ZET A;  4J9R A;  5J2J A;  1QQ7 A;  4F50 A;  2KZZ A;  1RYR A;  3WKD A;  4QW9 A;  2ATL A;  3V7L A;  2C2E A;  5D46 A;  5KFQ A;  1KSP A;  3Q8P B;  1L3V A;  3PR4 A;  3RAQ A;  1S9F A;  4QWB A;  1BPY A;  2N1R A;  2K4I A;  5ALI A;  3H7I A;  3C2L A;  2FPK A;  1FEZ A;  4R64 A;  3MR2 A;  2IHM A;  4M6W B;  4BUG A;  2UVW A;  4C4R A;  1NKB A;  4CCH A;  4RU9 A;  3HWT A;  1ARO P;  1KFD A;  1BVS A;  2ZIW B;  4P0P B;  2G08 A;  1ZQH A;  3KZX A;  5B5E U;  3MGV A;  2BKE A;  1RYS A;  4RQN A;  4IQT A;  3GDX A;  1X9M A;  3TAD A;  2K60 A;  4QZC A;  4RQ3 A;  1Z1V A;  3QZ8 A;  5KFG A;  4I2D A;  1KN5 A;  2HCF A;  3DV9 A;  1DGS A;  5DG7 A;  3BZC A;  1X42 A;  4JWN A;  2PI5 A;  1JIH A;  3ZDC A;  4QZG A;  1B43 A;  4Y2U A;  4MF8 A;  1L7N A;  2WF5 A;  5KFJ A;  1NJZ A;  3IDW A;  9ICX A;  4DWI A;  2RQ5 A;  3WU2 U;  4KLM A;  2BQR A;  3PW0 A;  5J2E A;  1L5U A;  1KTQ A;  3TQ1 A;  4Y2V A;  4DQI A;  4B9U A;  7ICN A;  3MBY A;  1A77 A;  2PFP A;  2WAQ F;  2B0C A;  3HIL A;  4UB3 A;  2KV2 A;  1OW5 A;  5J2H A;  5AI6 A;  4DL3 A;  4O3N A;  3KHR A;  2EZZ A;  5AKJ A;  4KLT A;  2E1E A;  9ICN A;  3S6J A;  4UAZ A;  4Z6D A;  1PVR A;  2QB0 A;  3D2S A;  9ICU A;  1T3N A;  5J0Q A;  4U7C A;  3H4D A;  4YD1 A;  8ICG A;  1S97 A;  1NJX A;  2BPF A;  1ZQW A;  4M6W A;  2YML A;  3M6Z A;  5CWR A;  4M9J A;  4ECZ A;  3M1Y A;  4C8K A;  1ZQY A;  4Y2Q A;  4EYI B;  3JPO A;  5AI8 A;  2WFA A;  1Q3V A;  3RR8 A;  1N62 A;  4I2F A;  3T5L A;  3PO5 A;  5DGB A;  2P6U A;  3UMG A;  1JX4 A;  2Z7J A;  1KW4 A;  2E1F A;  3GV8 B;  2VJ5 A;  3PNC A;  2BPG A;  4FO6 A;  5KG6 A;  5DBB A;  4DQR A;  4EX6 A;  2W7P A;  5IIM A;  5J2A A;  3IN5 A;  5EE1 A;  5D49 A;  3FAH A;  2JEJ A;  2WF9 A;  2W55 A;  5BOL A;  3WK9 A;  5KFM A;  2P6R A;  1XSL A;  4RT2 A;  3NGD A;  3V72 A;  4GIB A;  4US9 A;  4J9M A;  5KTQ A;  4I2H A;  2ZG6 A;  2LBO A;  3TFS A;  5ALY A;  5J2I A;  4YR0 A;  4C4S A;  2KG5 A;  1ZQN A;  1Q8K A;  5IIL A;  2CXY A;  3QUC A;  2MUT B;  1KBU A;  5ALP A;  2Y9T A;  5KFH A;  4CDG A;  9ICG A;  5KT7 A;  5HR7 A;  8ICU A;  4KLF A;  1ZQC A;  4XQ8 A;  4MFC A;  4O3Q A;  3QNM A;  5ALM A;  2RDJ A;  3J81 j;  1PK3 A;  9ICL A;  3I76 A;  2LYA A;  2HI0 A;  5DG9 A;  3CRX A;  4B9L A;  4ELU A;  5DB7 A;  2KTQ A;  3R9K A;  8ICH A;  2JMG A;  2XVT A;  3V7K A;  2G0A A;  2AGO A;  4CNQ A;  5ALK A;  1L8L A;  2UVU A;  1N63 A;  3T79 A;  3QX7 A;  5KT5 A;  2FPL A;  1JMS A;  4KIT B;  2BPC A;  4RPY A;  3RH4 A;  4EYH B;  3C1Y A;  1UA1 A;  1ZQS A;  1GO3 F;  5AM1 A;  4OD0 A;  1SL2 A;  4UBC A;  3QU5 A;  1KLN A;  3HT3 A;  4TUQ A;  5ALN A;  4J9N A;  3ICX A;  1WYG A;  5HNK A;  4FBU A;  3GFK B;  1L3U A;  4DEZ A;  3QU7 A;  2HVH A;  2HSZ A;  5JTI A;  3D2N A;  2KE7 A;  4C8M A;  4RQ8 A;  3AU6 A;  4ECS A;  2I1Q A;  1ZQJ A;  2W04 A;  4FZL A;  5ALW A;  4DSF A;  2ES6 A;  2RP5 A;  4C8O A;  3EYZ A;  2OEH A;  1YZ6 A;  2HHU A;  1ZQ1 C;  5CB1 A;  2ZXI A;  3QUQ A;  5G5H A;  2ODG A;  1C20 A;  4QZ8 A;  1SL0 A;  2ASJ A;  4RZR A;  3MR6 A;  2YMM A;  5KNI A;  4O3O A;  2AXT U;  4M9H A;  3QUB A;  2K4P A;  4DQS A;  5KFC A;  2MUT A;  4YR2 A;  5AM0 A;  1SL1 A;  4EEL A;  5KFN A;  4P4M A;  2F1I A;  1MA7 A;  3T5H A;  4BDP A;  1ED1 A;  2W9M A;  5KFP A;  5L1K A;  1ZQA A;  3BQ7 A;  2V4R A;  4YMM A;  2XO7 A;  2NRV A;  1X9X A;  1ZQP A;  3HW8 A;  1URJ A;  3LWM A;  2HBL A;  4I2B A;  5IIK A;  3DEE A;  3U26 A;  3SAG A;  2HHV A;  3WKE A;  1O08 A;  5L1J A;  1ZD3 A;  1D9D A;  2ISP A;  3NUQ A;  3V6K A;  2W11 A;  4PHD A;  3MGH A;  2G5I B;  4LZG A;  2PFO A;  2LKY A;  5J2G A;  1KFT A;  3RR7 A;  4I2E A;  5ALL A;  3NVV A;  3RRG A;  3PX4 A;  2FLN A;  3IG5 A;  4PHE A;  2OM6 A;  3B0Y A;  8ICL A;  2CN1 A;  1RXV A;  7ICL A;  3BJY A;  4R65 A;  5L1M A;  2HHQ A;  2YMQ A;  4E0D A;  2PMZ C;  2KHV A;  4A8E A;  7ICS A;  2WF8 A;  5L1L A;  3RJG A;  2R8I A;  4Z6F A;  3WK7 A;  1ZQM A;  3E2E A;  4DFD A;  2I5H A;  1S5L U;  4DL7 A;  1NKE A;  2IOH A;  2F8K A;  4YQW A;  2MRL A;  2QAR B;  2EAM A;  5EWF A;  3GIL A;  1TK0 A;  5G5G A;  3KHH A;  1ZQF A;  1WG8 A;  2WF7 A;  4FE3 A;  4I2J A;  1QSS A;  4PJ0 U;  1J97 A;  5ALO A;  4PGX A;  9ICA A;  5J0P A;  2E8M A;  2I6X A;  2H3V A;  5ALH A;  5AI0 A;  2KJ5 A;  7ICQ A;  3SEI A;  3MDC A;  1DGJ A;  2GWS A;  4PHP A;  3C5G A;  5JU5 A;  1L7O A;  2G07 A;  4ZH4 A;  2JH1 A;  4F4Y A;  4DSJ A;  2EQY A;  3BQ0 A;  5EOZ A;  4CRX A;  4YN4 A;  4HYK A;  4GLX A;  2QAR A;  5KFI A;  3NVW A;  2KOB A;  1S10 A;  1SKR A;  4YMN A;  5AM4 A;  7ICI A;  1BNP A;  1TFR A;  3ISB A;  5AHX A;  5F9L A;  1U45 A;  3JPQ A;  5T14 A;  1N5X A;  2OHF A;  2KSO B;  5DBC A;  5KFO A;  1S0O A;  5KAI U;  4PGQ A;  4PL1 A;  4WJ3 B;  3ALR A;  3PSP A;  3KHL A;  1NK6 A;  1WCL A;  4F5P A;  3MC1 A;  2ESE A;  3L3F X;  1COO A;  2VA2 A;  4CF5 A;  2W9C B;  1SXE A;  2FMQ A;  3UQ2 A;  4UB6 U;  2PFQ A;  1L3T A;  2BCV A;  4UB4 A;  4G3I A;  1JRP A;  3V6H A;  3N7P D;  3EPI A;  5KG5 A;  4DL5 A;  3TAQ A;  4IQW A;  2O6K A;  1LB2 B;  1ZQD A;  4Q8E A;  3JPP A;  3EZ5 A;  4DSI A;  3K1Z A;  4AP9 A;  5KL1 B;  4CF3 A;  3N7R C;  3KZI U;  2ZTD A;  3N97 B;  1S8O A;  2MA1 A;  9ICC A;  4ED7 A;  4PH5 A;  3OJU A;  3RFA A;  2F44 A;  4J9S A;  3VC8 A;  4YXM A;  2EDU A;  3TAC B;  4ICA A;  1B0X A;  4NLN A;  7ICO A;  2W9C A;  4AYB C;  2XGQ A;  2DKX A;  2YX8 A;  4NY8 A;  5J2B A;  4DFP A;  1FFU A;  2BDP A;  1Q3U A;  1Y88 A;  3E58 A;  2IOF K;  1SXD A;  2E3T A;  2W9B B;  5J2F A;  1IIP A;  3RRH A;  4FFD A;  3UMB A;  4J03 A;  2HBK A;  4F5N A;  5AK3 A;  4ED0 A;  4QIW C;  5A0L A;  5CRX A;  2D6F C;  1ZQE A;  1Z00 A;  5HMM A;  5ALR A;  2ZIX A;  1XO0 A;  4QWC A;  9ICI A;  3CP8 A;  3IP4 B;  1DOQ A;  2EH9 A;  4Q44 A;  3LK9 A;  2W03 A;  4DF8 A;  3Q8K A;  4DSE A;  5DLG A;  4BGD A;  4UB2 A;  4IQV A;  3AM9 A;  1BPB A;  3SQI A;  2JEF A;  1X6J A;  2KSO A;  3F5E A;  1JUD A;  3D6J A;  4UW9 A;  3H0L B;  3PR5 B;  3A0H U;  4I29 A;  2HHW A;  7ICP A;  3MAB A;  3PV8 A;  1HUZ A;  3RJF A;  4PHA A;  3OHA A;  2M9N A;  4NLZ A;  4DSK A;  2ZIU B;  3JPS A;  4RNO A;  2W3S A;  4EZ6 A;  1RPL A;  5AKH A;  2XY5 A;  2KJ9 A;  4C7Y A;  3H8S A;  2J6S A;  1BPD A;  5KL8 B;  4RQ2 A;  5KT2 A;  2H3F A;  7ICU A;  5AKK A;  2BDU A;  5ALT A;  3WK6 A;  4NXZ A;  1NK9 A;  4QZB A;  1A6S A;  4G9B A;  1Z19 A;  5J8Y C;  2DFL A;  2ZIU A;  3KOO A;  2CPR A;  4ECV A;  7ICT A;  4ACO A;  4ED8 A;  4KTQ A;  2HDO A;  3RJI A;  2DGZ A;  3KKA A;  4QZA A;  1QTM A;  2LYH A;  2M0N A;  1KDH A;  1B4F A;  3QEA Z;  1ZQR A;  5J2K A;  4R8U B;  5D4B A;  1SWW A;  2NRX A;  4BXO A;  4P0Q A;  1A76 A;  1N60 A;  4EBD A;  1JAL A;  4XA5 A;  3QUT A;  4ECX A;  5ALQ A;  5DLF A;  4QZE A;  1RDF A;  5AKL A;  1ECW A;  4J9Q A;  3SEN A;  1Z00 B;  4F5R A;  2G5H B;  4IRD A;  4IQU A;  3WK8 A;  2P66 A;  3PW5 A;  4OJL A;  5IIJ A;  4DLE A;  3SD7 A;  2HBM A;  1TKD A;  3RB0 A;  5EWE A;  3HRD D;  5AM5 A;  3SYZ A;  3O0F A;  2XC9 A;  1QSL A;  5C0Y A;  4O3P A;  2F1H A;  2OYY A;  1M6Y A;  2MU2 A;  2VJ4 A;  2GO7 A;  4KMU A;  4C80 A;  1RQN A;  2HHT A;  2YY6 A;  4RNM A;  4ED1 A;  3T5K A;  3SI8 A;  5HML A;  2RRD A;  2VAN A;  2XY6 A;  2QKQ A;  4GC6 A;  2H5X A;  2ZXH A;  2C2D A;  1OUQ A;  4I2A A;  3HJE A;  3VCB A;  4O5K A;  1SIJ A;  4M9G A;  4PZO A;  5KAF U;  3QU2 A;  2K89 A;  3KBB A;  2DBY A;  1IM4 A;  2FLL A;  2OH2 A;  1Z4O A;  2AGP A;  5J29 A;  2HHS A;  2W7O A;  2LMR A;  1O03 A;  4F2R A;  4K4I A;  2ZUB A;  1LKY B;  4M9L A;  7ICG A;  4OJ5 A;  4Q8F A;  2ZJA A;  3Q8R B;  4F5Q A;  5ALF A;  3RJJ A;  3UQ0 A;  4XRH A;  3PW7 A;  1ZD5 A;  3RB3 A;  1SB3 C;  2G09 A;  3FDS A;  3D2Q A;  4M04 A;  4MEX A;  1KFS A;  9ICE A;  3BS7 A;  1X40 A;  2E8O A;  8ICS A;  3K1R B;  2CRX A;  3GIK A;  5DQG A;  2I9G A;  4Y2Y A;  3AMZ A;  2IBK A;  2LHT A;  2UVR A;  9ICF A;  2F3N A;  2C2R A;  1C7Y A;  4RQ0 A;  4OJO A;  2ZJ5 A;  4ED2 A;  3V6J A;  3PX0 A;  3QEB Z;  2AU0 A;  2Y0S C;  3C5F A;  2LPE A;  4I28 A;  4DQP A;  5DB8 A;  3UMC A;  2YN4 A;  4Q45 A;  4YMO A;  3V7J A;  2NRZ A;  4NL9 C;  4KN7 A;  4DL6 A;  4CE6 A;  3JPT A;  3QU4 A;  4KLH A;  5AIC A;  3NVY A;  5AI5 A;  5J0Y A;  2FMP A;  3T5J A;  2YQE A;  4Y2S A;  1F5S A;  2RHF A;  4R63 A;  2NRW A;  2MSN A;  2EZX A;  1ZD4 A;  2B6G A;  4M0A A;  4ELT A;  7ICF A;  2FI1 A;  1PVQ A;  1DRG A;  4NM2 A;  3IM1 A;  3IV6 A;  1NJY A;  4GFJ A;  4UBB A;  1P7D A;  5JUM A;  2ISO A;  8ICN A;  3PSF A;  1D8L A;  1WUD A;  4UAY A;  5ALU A;  1WCN A;  1TVA A;  1Z3E B;  3UXO A;  3EPG A;  4OCZ A;  4KLD A;  5KFF A;  1IXR A;  2FDR A;  4Q43 A;  1QSY A;  3PZP A;  2KJ8 A;  3JPN A;  3H8M A;  2Q0Z X;  1XS9 D;  3GZF A;  1BPZ A;  3TFR A;  4KLO A;  3RAX A;  1XSN A;  5DGA A;  3AU2 A;  5F3X B;  2HOQ A;  4RNN A;  4IR9 A;  2AQ0 A;  2QLT A;  2KK0 A;  4QZH A;  5L1I A;  1T4G A;  3LVW A;  5KFR A;  3LYS A;  3F53 A;  2BCU A;  4I27 A;  5KFY A;  1NOM A;  5AK5 A;  1CUK A;  4UB1 A;  5KFZ A;  4RQ7 A;  5DQI A;  7ICM A;  1ZQG A;  9ICJ A;  4GXK A;  2LM4 A;  3NTU A;  2A3V A;  4F93 B;  2JH7 A;  4GXI A;  4UAT A;  1UA0 A;  2R8K A;  1JN3 A;  2W3R A;  2HBJ A;  3TAR A;  5BOM A;  1CRX A;  3WK5 A;  4UB8 U;  4PGY A;  2A1J A;  4UB5 A;  4O5E A;  5EE0 A;  3H0M B;  2F77 X;  1SWV A;  1X9W A;  4UAR A;  2XY7 A;  3GU3 A;  4ECW A;  4EEK A;  5ALZ A;  1JXE A;  4IRK A;  4NLG A;  2H3I A;  4C7Z A;  3SZ2 A;  2BCQ A;  2HHX A;  5BPC A;  4TQS A;  1T94 A;  4F4X A;  3PX6 A;  1NI3 A;  4QIW F;  2V4Q A;  2KZ3 A;  2JZB A;  2Y9U A;  2AJQ A;  2GLE A;  4YP3 A;  3IG8 A;  5L9X A;  1ZQZ A;  1SZP A;  2K4E A;  7ICE A;  4F92 B;  4NWI A;  8ICJ A;  1KEJ A;  3H0R B;  3PW4 A;  3MR3 A;  8ICQ A;  2H3Z A;  3KFU F;  1SZH A;  3NS1 A;  4DO9 A;  1HIW A;  5KT6 A;  4MEY A;  1S0M A;  3GV5 B;  1JRO A;  1T7P A;  1KL9 A;  3QXG A;  4QWD A;  3WKA A;  2BR0 A;  2YMP A;  4P4P A;  1L3S A;  3EW9 A;  4JUZ A;  2Y1J A;  4TUS A;  4KLE A;  1RYU A;  1H38 A;  4ECU A;  1S77 D;  3SMV A;  4DOA A;  2D8C A;  2XID A;  1L8O A;  1UPH A;  3RTV A;  2ZIW A;  4P0P A;  3RBD A;  1CI4 A;  4LVS A;  2D3D A;  2YB1 A;  3E0F A;  1K1Q A;  3F2D A;  9ICT A;  1ZQK A;  4BJQ A;  5CR0 A;  2IA6 A;  5F9N A;  3MR5 A;  1RQL A;  4Y2J A;  4KLS A;  3EUB 2;  5KG4 A;  1V38 A;  3F2B A;  3C28 A;  3ZI4 A;  4UAW A;  3KKA C;  1NK8 A;  4IL6 U;  3ETR A;  4QJF B;  4DSL A;  2KHQ A;  2LYB A;  2ZTC A;  2P35 A;  2KMD A;  2MAX A;  2R8H A;  5J2D A;  2A1J B;  3AQE A;  8ICO A;  2ASL A;  1KRP A;  2KEY A;  1N48 A;  5CEH A;  3ZDB A;  3C23 A;  3QYP A;  1D8B A;  2DL0 A;  3FYH A;  4QNL A;  5AI4 A;  3WKB A;  4BX9 C;  1F44 A;  2FMS A;  2V9W A;  3UXN A;  2NV3 A;  2EAP A;  1K5O A;  1NK5 A;  4KLI A;  2K8C B;  2LI6 A;  1S0N A;  4JMU A;  3PSI A;  4LJX A;  4DL2 A;  1X66 A;  4MFA A;  4NJ8 A;  3C21 A;  3N28 A;  4NLC A;  5J0X A;  4TQR A;  4CF4 A;  3UXP A;  4Y2T A;  3Q8L A;  4GXJ A;  2QB0 B;  3OGU A;  3L4P A;  2PMZ F;  3Q8Q B;  2YTU A;  5AK4 A;  1N5W A;  1WWU A;  3K75 D;  1T3Q A;  3FC4 A;  5KFW A;  5KG1 A;  1IG6 A;  3HKZ F;  4KLG A;  4I2G A;  2VA3 A;  4B9M A;  3KHG A;  1D9F A;  3LWL A;  4KMO B;  1VDV A;  2WB1 F;  4JK1 A;  3ISC A;  1J2M A;  4B9T A;  2XGP A;  1NK7 A;  5EWG A;  5E79 U;  2KKP A;  5FP0 A;  4F4K A;  2IOF A;  5KFA A;  3TKA A;  1TV9 A;  2BHN A;  9ICK A;  2JHD A;  2E8N A;  1X6I A;  5KFS A;  4F5O A;  1BPX A;  2K4H A;  1Q46 A;  5ALX A;  3NRZ A;  1NK4 A;  1ZQO A;  1QQ6 A;  5HHH A;  8ICZ A;  2FE9 A;  3GIJ A;  3RJE A;  5J2C A;  3T3F A;  2DWQ A;  3ONN A;  1VLB A;  5TIS U;  2HVI A;  5J8Y A;  1T8E A;  5AIB A;  1ZRN A;  3N4M B;  1UQV A;  4Y2R A;  3AUO A;  3HX0 A;  7ICJ A;  3OTQ A;  3MDA A;  5AIA A;  5AKZ A;  1KQQ A;  4B9S A;  1DK2 A;  1MN8 A;  5CHG A;  4QZ9 A;  5ALJ A;  5III A;  5DB9 A;  4UAU A;  4DCC A;  5AM3 A;  5KG3 A;  1HJP A;  5CJ7 A;  2E8P A;  2EAO A;  3AEV A;  3G6Y A;  3H40 A;  2ZIX B;  4YFK A;  3TAN A;  2PI4 A;  4F3O A;  1TAM A;  4J9L A;  1L6N A;  9ICW A;  1U47 A;  3PMN A;  3M9N B;  3RBE A;  1SV4 A;  5CA7 A;  4X5V A;  4DLG A;  2JEG A;  9ICR A;  3TAD C;  7ICK A;  8ICF A;  2OCE A;  2IMW P;  2J6U A;  2AH5 A;  8ICP A;  3OJS A;  4USA A;  4Z6E A;  3BDP A;  1HUO A;  5KFU A;  3CYM A;  2KFN A;  5AI9 A;  5DQH A;  4I2I A;  4KX3 A;  4KLL A;  4K4G A;  4B9V A;  1QH9 A;  2AGQ A;  4K4H A;  8ICX A;  2WTF A;  2L5Y A;  4RQ4 A;  4YVZ A;  4XUS A;  1TK5 A;  4BWJ A;  1WWV A;  1TK8 A;  2F8L A;  4AYB F;  3N7S C;  4RPX A; 
#chains in the Genus database with same CATH homology
 3L3F X;  3F5E A;  2VKQ A;  3PST A;  2OYY A;  1Q3V A;  4NLB A;  2VJ4 A;  3H0L B;  1GO3 F;  2G5I B;  2H3I A;  2LKY A;  2KNJ A;  3ONN A;  1T94 A;  1YT3 A;  3AQE A;  2RHF A;  3ICX A;  3IG5 A;  2K8A A;  4KX5 A;  4QIW F;  2OM6 A;  2Z7J A;  2E1F A;  2ZIU B;  2VJ5 A;  4C0Z A;  2DF4 B;  2CN1 A;  2DQN B;  4PL2 A;  3AL0 B;  1NZB A;  1HEK A;  3N7P D;  2RRD A;  2KEY A;  2KJ9 A;  4O3M A;  2W7P A;  2ZXH A;  3IG8 A;  1OUQ A;  3D2N A;  2HOI A;  3IN5 A;  3RF9 A;  3VCB A;  2PMZ C;  3K1Z A;  2KHV A;  2Q4T A;  3AQF A;  2WB1 C;  2K4E A;  3C29 A;  1PVQ A;  2F76 X;  5KL8 B;  4NWI A;  2XIC A;  5KL1 B;  4A8E A;  4QNL A;  3N7R C;  2KIW A;  4BX9 C;  1DRG A;  1F44 A;  2GH1 A;  3H0R B;  4OO1 J;  2H3Q A;  2MA1 A;  2K89 A;  2H3F A;  2ZIV B;  2NV3 A;  3RFA A;  2KIC A;  2OH2 A;  3HKZ C;  2W04 A;  4FZL A;  2G06 A;  2H3Z A;  3VC8 A;  2W7O A;  2RP5 A;  2K8C B;  2OXO A;  4GFJ A;  4ICA A;  1SZH A;  2ZG6 A;  1P7D A;  2LBO A;  4JMU A;  3KFU F;  3PSI A;  2MRL A;  2BDU A;  1HIW A;  2ZIX B;  3NRW A;  3F2C A;  3SAF A;  1TAM A;  3PSF A;  1WUD A;  1L6N A;  2GOL A;  4NV0 A;  1ZQ1 C;  4OJ5 A;  4AYB C;  1A6S A;  3OPX A;  1Z1B A;  2YX8 A;  2ZIV A;  2ZXI A;  2WAQ F;  1Z19 A;  4NLC A;  2KKV A;  2HMX A;  4FE3 A;  1KBU A;  2ZIU A;  4IC9 A;  2KV2 A;  2CPR A;  4OJ6 A;  3M6K A;  4ACO A;  4CDG A;  4FZM A;  3PZP A;  2G09 A;  2KJ8 A;  2YB4 A;  3D2Q A;  2XI9 A;  3GZF A;  1Q3U A;  1PVP A;  5HR7 A;  2PMZ F;  2Y0S F;  2DGZ A;  2H3V A;  1XNS A;  2VIX A;  2HOQ A;  2CRX A;  2KJ5 A;  1IIP A;  2M0N A;  4U6P A;  3SMV A;  2E1E A;  2E5S A;  2LYA A;  4OJP A;  2XID A;  3LVW A;  2N1R A;  2HBK A;  2K4I A;  2LHT A;  1UPH A;  3F53 A;  3LYS A;  3CRX A;  3HKZ F;  2ZIW A;  4P0P A;  1PVR A;  4QIW C;  5A0L A;  2G07 A;  4P0Q A;  5CRX A;  1MA7 A;  2JH1 A;  2D6F C;  3D2S A;  2HOF A;  4BUG A;  4CRX A;  2JMG A;  1ED1 A;  1D8B A;  2XVT A;  5HR6 A;  3F5A A;  3M7D A;  2YB1 A;  2ZIX A;  3E0F A;  2WB1 F;  4KMO B;  4OJO A;  2KOB A;  3CYM A;  4U7C A;  1XO0 A;  4CGZ A;  3CP8 A;  3IP4 B;  2R18 A;  3SAH A;  2WAQ C;  3F2D A;  2A3V A;  2JGA A;  4KX3 A;  2ZIW B;  2JH7 A;  4BJQ A;  1ECW A;  2G0A A;  2G08 A;  2Y0S C;  2K8B B;  4P0P B;  4P0Q B;  2W03 A;  2KKP A;  3KZX A;  2KVC A;  5T14 A;  3M6Z A;  1A0P A;  1URJ A;  2G5H B;  2F2A B;  2HBL A;  3MGV A;  2HBJ A;  2JHD A;  3C28 A;  3F2B A;  3T79 A;  1CRX A;  3DEE A;  3LVV A;  3SAG A;  4OJL A;  4PL1 A;  4FZN A;  2HBM A;  4WJ3 B;  2K4H A;  3ALR A;  3SQI A;  3H0M B;  2F8L A;  3PSP A;  2F77 X;  3O0F A;  4AYB F;  2KD1 A;  3N7S C;  3NUQ A;  4QJF B;  5C0Y A;  2KHQ A;  2LYB A;  3GU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...