2H3ZA

Structure of the hiv-1 matrix protein bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 38
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3zA01
2N1RA 2K4HA 1ED1A 2H3FA 2NV3A 2LYAA 2H3ZA 2K4EA 1ECWA 1L6NA 2K4IA 2LYBA 1UPHA 4IC9A 1HIWA 2GOLA 2H3IA 1HEKA 4JMUA 1A6SA 1TAMA 2HMXA 2H3VA 2H3QA 2JMGA 4ICAA
chains in the Genus database with same CATH superfamily
1RXWA 3CP8A 5L9XA 1CEZA 2BPGA 5AIBA 1HUZA 4O3SA 3KBBA 5CJ7A 2C2EA 3UM9A 2Y0SC 3KHHA 4B9UA 1TAQA 2PMZF 2K8BB 1HEKA 5J8YC 2E8NA 3VC8A 4RQNA 1NK6A 3FAHA 3RJGA 1DXSA 4O0IA 2MA1A 4TURA 2IOFK 5CB1A 3WKEA 2KICA 1U4BA 1ZQZA 1SZPA 3ISBA 1A77A 3BS5A 2JEFA 8ICYA 3NRZA 1N56A 3HT3A 2J6UA 2FE9A 3MGVA 3PNCA 4FE3A 2IBKA 3KKAA 2I6XA 5JTIA 3C1YA 3OSPA 1IG6A 4I2JA 9ICMA 4QWDA 1KQQA 2YN4A 1KTQA 1BPYA 5DQGA 3C21A 2Q0ZX 2NO4A 1QQ5A 3OGUA 1NK7A 2KK0A 1FFUA 2RLTA 4ELTA 3QU9A 2BR0A 3WK6A 4JWMA 5TZVA 3TKAA 5CR0A 2IMWP 2HBKA 3RH5A 5KFWA 4RQ0A 4I2FA 1U45A 3SAFA 3E58A 2HOFA 4QZEA 3L4PA 4QZGA 1SV0C 5KL8B 5ALXA 2V4RA 7ICRA 4EELA 3M6KA 4M9HA 2GO7A 1IXRA 1ZQ1C 5HP4A 2OWOA 2ISPA 5KFHA 4ICAA 1K5OA 1DK2A 1ZJMA 4KX5A 3WK7A 1L8LA 1KSPA 2AHOB 3GIIA 3QZ7A 2ESEA 5KG5A 3V6KA 5KG0A 4UAUA 1MSWD 1JXLA 2EDUA 9ICJA 4Y2QA 3EUB2 3UXNA 5AK6A 3ZD9A 4I2DA 5IIKA 1XWLA 4F71A 4KLOA 4C7YA 2LMRA 4KX3A 3SAHA 3JPRA 1QCKA 2H3FA 4CRXA 3GQCA 3EYZA 5L1MA 3UMCA 1QTMA 3RBEA 1SWVA 4EBDA 3SQIA 3NASA 3AM9A 8ICSA 1NK4A 8ICEA 5ALQA 3HJEA 3M8RA 1U49A 4QWAA 2ES6A 3C2LA 3RJEA 1L6NA 4I2HA 1LKYA 1DRGA 2KSOA 4EBEA 1QSSA 3EW9A 9ICEA 5KFUA 1S97A 2YQEA 1Z4NA 1JIHA 3M6ZA 2J6SA 4M9LA 4NLKA 1T3QA 4RQ3A 3BQ1A 3RBDA 5CP2A 5AHXA 2GWSA 4BX9C 2EZZA 3F5EA 5IIMA 2E3TA 2W9AA 1BVSA 2ZJ5A 1ZXIA 2Y1IA 4LZDA 5J29A 5DDMA 2WF8A 4ELVA 2ZG6A 1Z19A 2J6TA 4KLHA 3Q8RB 9ICIA 1ZD3A 3NVVA 1ZQFA 4NM1A 8ICPA 8ICVA 3FYHA 3K4GA 1KW4A 4TQSA 3IG8A 1LVHA 2W55A 3ETRA 1RYRA 3PW2A 1DGJA 1WG8A 4FZMA 5J0XA 4Y2UA 4AYBC 3H4BA 1WWVA 2JMGA 3UQ2A 1Z4OA 4F5QA 2AGOA 1RYUA 2C2RA 2ZTCA 4GC7A 2HOIA 1BGXT 3PV8A 5K4LA 3TFRA 2B21A 3NVYA 5AI6A 4JV0A 4PHPA 3IN5A 5L1KA 4C4TA 2OH2A 4P4PA 4PHDA 2BCRA 4RQ4A 5ALSA 1SKRA 3JPOA 4QZ9A 3N7SC 3RJFA 5JUMA 4KLQA 1TFRA 4B9LA 4KN7A 4EZ6A 4GXJA 2KJ8A 2AGPA 2LBOA 2D3DA 2W8LA 3N28A 5J0OA 4AP9A 3Q8SB 4DF8A 4M0AA 1Y88A 1L3VA 4KLFA 3QNMA 5KFJA 4QZFA 4XRHA 4DL6A 5AI0A 2RP5A 4UB2A 4YMMA 2NRTA 2LYBA 4DQSA 5KTQA 4BXOB 2G5IB 7ICTA 4PJ0U 3PO5A 1ZQIA 4B9TA 2DWQA 4UARA 2KVSA 7ICFA 2HBLA 1B43A 2W11A 4MEXA 2EZXA 3D6JA 1Q46A 2HBMA 5ALNA 2NRXA 3AU6A 1VLBA 1ZRNA 1XC9A 4BXOA 5AK4A 1PVQA 1C20A 3KTQA 2BPCA 4TQRA 3MFIA 2FI1A 2KFNA 1ZQCA 3QUTA 2FMPA 3SV3A 3KOOA 3LDAA 2VA3A 5AI4A 4QW8A 4OJPA 1AQ6A 4UAYA 1NKEA 5KG6A 4O3MA 3PW5A 5AKEA 1KN5A 4KLEA 4I2GA 7ICEA 3KZXA 1B0XA 3H4DA 4EEKA 2G0AA 5ALEA 4Y2PA 3ZDBA 2HVHA 2LHTA 2VANA 2F8LA 4DS4A 4F91B 1U48A 4MEYA 9ICCA 1KBUA 2WF9A 5E79U 4PGQA 3MGHA 1WUDA 4C7ZA 1Z00A 5JRTA 1TV9A 4YR0A 5ALHA 3JPPA 5BOMA 4ECRA 5DG8A 2JEGA 2XGPA 3RF9A 1ZQMA 1JXEA 3SAGA 2BQ3A 2KZMA 3IDWA 3FM9A 4P4OA 4FZLA 2JHDA 4MFAA 2LPEA 3IM1A 5ALDA 2JXJA 1F5SA 3SV4A 4DSEA 1ZD4A 3GU3A 3SEIA 3GIJA 2LKYA 3VCBA 8ICOA 3ICXA 3RJKA 4IQTA 1ZQEA 9ICUA 5F9NA 3C5FA 3N4MB 7ICJA 4ED7A 4UB1A 1QLNA 3HX0A 5AM3A 2WFAA 2FLNA 5KFDA 3DV9A 1VJ5A 2EH9A 4DL7A 2DFLA 4I27A 1X6IA 2DQNB 2PFNA 3H7IA 4PPXA 2JGAA 2ZIUB 1L7MA 1K1QA 2FLLA 1RQLA 5DKWA 2YY6A 2F44A 2F3NA 4ECUA 4IRKA 4PGXA 1B22A 2YMLA 5KFKA 4J9NA 3NRWA 5IIJA 2R8JA 1HJPA 1T3NA 2WF5A 2BDUA 8ICMA 2DL0A 2HOQA 2ZIUA 4B9VA 4NXZA 3BDPA 5KG1A 2HCFA 3PMNA 4QZBA 8ICLA 2DGZA 2V9WA 3WKBA 4QZ8A 1U9LA 2H3VA 5KFNA 4KITB 3PSPA 3CRXA 3K1RB 4RT3A 2KE7A 1L7PA 5J0TA 2PMZC 4EYIB 1ZQGA 3TADA 3B0YA 1B4FA 1P7DA 5J2GA 5J2DA 4JUZA 2IHNA 4KLUA 3M9MB 4KN4A 4Q45A 3MABA 1ZQKA 5F3XB 4EYHB 4DO9A 4BUGA 4F4KA 1ZQRA 1SB3C 3UMBA 5ALJA 5KFTA 1TVAA 2WF6A 4PHAA 4P0QB 8ICIA 3G6XA 2LYHA 4Y2SA 4M04A 4I2EA 7ICSA 3GILA 2UVUA 2F76X 4P0PB 1X9WA 3FC4A 4J03A 2WAQC 2E8MA 5KG2A 4QJFB 4JV2A 1J2NA 8ICCA 1NKCA 4J9SA 3H0RB 4DF4A 3Q8LA 3C29A 3NUQA 1S9FA 2KV2A 5ALWA 2ZIXA 4P0QA 5ALOA 3H0MB 5KL1B 4P0PA 2VJ5A 2LM4A 3ISCA 4QIWC 1X9MA 3WK5A 2KVCA 2KZ3A 2OM6A 1NZPA 3U26A 3HILA 1H38A 2E1FA 2XY6A 5HMMA 5GTHU 4I2CA 2RDIA 3B9JA 1KFTA 5DLGA 2JZBB 3Q8QB 2YB4A 5DGBA 1O03A 2KHVA 4RQ6A 5DBAA 1XSLA 5J8YA 4LJXA 1PUZA 2W9BB 3EZ5A 2LI6A 3RFAA 4GC6A 2ZIWB 5J2BA 1JMSA 5J2JA 2P35A 1RM6C 5DG7A 4UBCA 1ZQNA 2KKVA 5ALIA 3QE9Y 2JZBA 3D2QA 4QZAA 4F4YA 2AQ4A 5FP0A 2XGQA 2W9CB 3LK9A 1PK3A 1N48A 2P6UA 4ED3A 2KJ5A 3RJJA 1V85A 2G06A 1QQ7A 4JK1A 4NL9C 4Y2JA 4CGZA 4YP3A 5DBBA 4F4XA 4YXMA 4YMOA 1BNPA 4B9SA 4KTQA 9ICFA 2W9CA 3BQ7A 2ASJA 2AQ0A 1X66A 3QUBA 1SL0A 4KLDA 4EX7A 1MQ3A 1C7YA 1V97A 4MHVA 5L1IA 2UVRA 2YX8A 1JUDA 3UXPA 3MFHA 3D2NA 2PFQA 2HHXA 2I9GA 1L8OA 4YR3A 4NJ8A 3S6JA 5AM4A 2H5XA 2F2AB 7ICUA 2KP7A 4YG2A 4DL2A 4CNQA 2F8KA 2R8KA 3LWLA 5AI5A 5ALRA 8ICKA 4I2BA 4J9OA 9ICTA 3OPXA 5KG4A 4DS5A 4UASA 4RU9A 3LWMA 4F2RA 4QNLA 8ICBA 4IRCA 4C0ZA 5ALYA 1UA1A 3MGIA 5D46A 1FFVA 4ECQA 2Y0SF 4PL1A 2AGQA 4I2AA 4QW9A 9ICBA 1X42A 2A3VA 3MR6A 1A76A 3C2KA 4GLXA 1L7NA 4R65A 5KFIA 4F5OA 2ZXHA 1N63A 4NLZA 3OHAA 2YMPA 3T3FA 1DK3A 3QU4A 2GH1A 2ZXIA 1Z1BA 2E1EA 3SI8A 5AKKA 4UB3A 2AJQA 4US8A 1T4GA 2HHTA 4MF8A 3MC1A 4ECVA 1NJYA 2FDRA 4UB6U 3SYZA 5KFGA 5AM0A 2BPFA 2DKZA 1MA7A 2VIXA 4YXJA 8ICNA 3TARA 7ICGA 3L5KA 3WK8A 4J9LA 2KJ9A 3I28A 4ED6A 2ASLA 1IIPA 4DOCA 1ZQDA 3PVXA 3GDXA 1NI3A 5J0WA 3OJSA 4M47A 3QXGA 1KRPA 1ZJNA 3G6YA 3SMVA 3LVVA 4P4MA 2JH7A 2HHWA 4YCXA 4RZRA 9ICQA 2XIDA 5KFFA 1KLNA 2NRVA 5J2CA 2HW3A 1NOMA 4RNMA 5J2KA 4B6JA 4TUPA 4X5VA 1S8OA 3RAXA 1UQVA 2ATLA 3ISDA 2KN7A 4O5CA 3M9OB 1SGGA 5EOZA 1KFSA 1TK8A 4U6PA 4CCHA 3NVWA 1QSYA 3QEBZ 4FS1A 1ZRMA 5JU5A 9ICPA 3UMGA 2WB1C 2GOLA 2EZYA 2FMSA 5CRXA 5KFMA 1MN8A 5J2HA 2XCPA 2PXIA 1SZHA 3C1ZA 1ZQWA 4RQ2A 2NYVA 3H8SA 3LVWA 2HHSA 5TISU 2BKEA 2YMQA 1Q3UA 2K4IA 5DB8A 4KLGA 1UPHA 3BQ0A 4QZHA 3E0FA 4RUCA 4NLGA 1NK5A 5KG3A 2C2DA 1PK1B 3HRDD 2HHVA 4KMUA 5ALMA 3RB6A 4DOAA 1NNLA 3J81j 3OHBA 1N2XA 7ICQA 3ED5A 1TK5A 3O0FA 3KFUF 1Z1VA 2K89A 1ZD2P 4FBUA 4CF3A 1PK1A 1A6SA 2OYYA 3K75D 1MQ2A 2QLTA 4NLCA 2ZUDA 8ICWA 4YQWA 3HKZC 4C8MA 3JPQA 3AQEA 4RQMA 2F1IA 4UAVA 5KT3A 4KLLA 4YFKA 2A19A 2ODGA 4O5EA 4KLIA 4O9MA 3C23A 1XSNA 4F2SA 4BDPA 3H8JA 2CXYA 1ZQPA 3RR7A 2ZIVB 3WK9A 2C22A 5CWRA 3IRUA 2HDOA 2V4QA 1S0OA 4UB5A 3MR2A 1AROP 2GLEA 2I1QA 4AYBF 5KFBA 5AIAA 2M9NA 2K60A 3E2EA 2MSNA 2CN1A 5AKLA 3OSNA 3QU7A 2MU2A 4ED2A 3RRHA 3SENA 5AKJA 5ALLA 3JPSA 4OD0A 3GV7B 5IIIA 5J2EA 5DQHA 1CRXA 2VA8A 2DUYA 4FFDA 2BDPA 5J2IA 2Y9UA 9ICKA 5KFAA 4FS2A 4NM2A 2JEIA 2EAOA 4ECZA 2XVTA 2BGWA 3PX0A 1L3SA 2ZUBA 3F2DA 2KEYA 4YD2A 3V6JA 3IV6A 4RQ8A 5HHHA 1NJWA 4Y2TA 5HHIA 3TAPA 1RPLA 2QB0B 5C0YA 4KLJA 4J9KA 4UW9A 5EWEA 2P6RA 1X9SA 4IL6U 4C8OA 3OJUA 4MFFA 4RQ7A 4DLGA 1U47A 3Q8PB 3M8SA 1KDHA 4NLBA 5KAIU 2QB0A 2I5HA 5AM5A 1URJA 5AI9A 4DLEA 1ZQOA 8ICRA 4FZNA 4K4GA 1ZQVA 5KFLA 3KHRA 1V38A 4JMUA 3IHQB 3TFSA 2HMXA 5HMLA 5J0UA 4UAWA 1T94A 2PFOA 2KIWA 1J97A 4J9QA 3PX6A 2OXOA 1BPXA 3MDCA 1NKBA 1X2IA 4YD1A 2XI9A 4M9GA 2PKEA 1TK0A 3EPGA 4IQWA 3BZCA 1RYSA 5KAFU 4IC9A 5DDYA 2HVIA 5B5EU 4F8RA 2F1HA 1COOA 5ALKA 5ALVA 4DEZA 2OHFA 3A0HU 1YT3A 2G08A 3NVZA 3UQ0A 3RH6A 2R8GA 1ZQBA 1ZOLA 5KFCA 3A0BU 4ECXA 2Y9TA 2ASDA 4M6WB 2BHNA 4M9JA 2W43A 2B6GA 5D4BA 4O3QA 1KEJA 8ICQA 1FIQA 2IA6A 1Q3VA 1S0VA 1D9DA 1D8BA 3CW2C 5C5JA 1FEZA 3H8MA 5BPCA 3RJIA 2F1JA 2G09A 2JH1A 1TKDA 5HNKA 5J0RA 5AM1A 3TANA 4DSJA 2JRZA 2R8HA 1JALA 1NJXA 4J9PA 4F5RA 3UXOA 5J0SA 1CUKA 4Y2YA 4R64A 4HAIA 5DG9A 3HWTA 1UA0A 3SD7A 1BPBA 3PX4A 4DOBA 3M1YA 2HHUA 2ZJ8A 2YMMA 4Q8EA 1OXJA 2HBJA 1X6JA 2OEHA 1RG6A 4IQUA 4K4HA 4DL4A 4Z6FA 5EWGA 5L1LA 1RXVA 3GIMA 3TQ1A 2EAMA 2QKQA 5AI8A 2AU0A 2CPRA 3RJHA 1ED1A 4RUAA 2A1JB 3BQTA 1S76D 4M9NA 3PR5B 3SR6A 2Y1JA 4U7CA 4E0DA 2UVVA 1RQNA 5H2FU 4PZNA 1TAUA 4UBBA 1UHUA 1ZQLA 3PW0A 4IQVA 4C4SA 2KFZA 5AKGA 4R63A 2A1AA 4Z6EA 4NL9A 2A1JA 3AQFA 1S0NA 3TACB 3V6HA 8ICJA 2W9BA 5KNIA 3BS5B 3ORYA 1BPZA 1ZETA 2ZIWA 3ZI4A 3PZPA 2VJ4A 1TE2A 2VA2A 3NS1A 2E8OA 4IS7A 4ED0A 5J2AA 2W54A 5KG7A 4I28A 5KFEA 1RZTA 3H40A 1N5WA 4DFKA 3Q8MA 2PI4A 2RHFA 3MBYA 3RTVA 1XSPA 2Q4TA 5KFZA 8ICGA 4MF2A 3FDSA 3ALRA 3HW8A 2KKPA 1S77D 2WAQF 4F50A 4Q8FA 4IR1A 2RQ5A 2ZUCA 4JB3A 1L3TA 3PY8A 3T5HA 4DSIA 4CE6A 1EXNA 4RNOA 1SV0A 3JPNA 1JI7A 5KT4A 3KD3A 5AM2A 4ELUA 3KKAC 7ICHA 3I76A 5KFSA 1DOQA 4O3PA 3QU2A 2WHEA 4QIWF 5KFRA 9ICLA 4LZGA 5AK5A 4Y2RA 4PZOA 2RRDA 4Z6DA 3Q8KA 4ZOHC 3WKCA 2YB1A 5AICA 4C4RA 3IG5A 4PH5A 3N7PD 4YVZA 1KKXA 1YZ7A 2H3ZA 1XNSA 2JEJA 1ECWA 3RRGA 2C28A 4P2HA 2WF7A 5J0PA 5KT5A 5ALPA 4QZCA 3QUCA 9ICNA 1ZQHA 2HI0A 1NZBA 1S5LU 5KFXA 2NRZA 1D8YA 4DQIA 1ZQJA 1HUOA 1LV5A 4ZH4A 2G07A 3RR8A 4KLTA 4F3OA 4DQRA 2KTQA 1NK8A 2BCVA 9ICAA 3ETLA 3PR4A 2H3IA 2UVWA 5DB9A 2ZTDA 3TI0A 5GTIU 4Y2XA 3AEVA 3CNHA 3AMZA 2H3QA 2BZFA 1UT8A 2AXTU 4F92B 4GIBA 2G5HB 5EE9A 3R9KA 3KHLA 9ICGA 1N62A 3ZDDA 2CRXA 1PZNA 4I2IA 4G9BA 5AK3A 4C8KA 2O6KA 5DLFA 1F44A 4QWEA 2ISOA 2VKQA 1L3UA 4G3IA 1LKYB 2KSOB 3V7JA 1SIJA 2WTFA 1LB2B 2DF4B 5D49A 4BGDA 4DSKA 3TAQA 3V7KA 1XS9D 7ICIA 4DCCA 1JRPA 4TUQA 3I1YA 7ICMA 5J2FA 3H0LB 4YN4A 4Y2VA 1XU4A 3NGDA 5IILA 1ZD5A 4RNNA 3V72A 1QQ6A 3ZDCA 5EWFA 4KLMA 9ICXA 4J9RA 3MR5A 4QZDA 4RQ5A 2W8KA 9ICSA 4HYKA 5DBCA 4ED1A 3WKDA 2QARB 5B66U 1ZQQA 4ECYA 2FLPA 4RPXA 3OTQA 8ICXA 5ALTA 1RDFA 4Q44A 1WCLA 4GXIA 5EE0A 4EBCA 4DFDA 1UT5A 4USAA 4LVSA 5IIOA 4XUSA 4GXKA 2FPLA 1IM4A 2K8AA 4R8UB 1NK0A 2KOBA 4XQ8A 3F2BA 3F5AA 3D2SA 2QARA 1PVPA 4NWIA 2L5YA 1SWWA 5AKIA 4I29A 1SKSA 4US9A 4EX6A 2W7PA 1FO4A 3AL0B 4C8NA 1OUQA 1COKA 1CI4A 7ICLA 5CHGA 1OW5A 3N7RC 3T79A 5HR6A 4R8UA 2N1RA 4MFCA 4OO1J 2XY5A 4RPZA 1WYGA 2JR5A 3SZ2A 2F77X 3THVA 3RB3A 3QEAZ 4QWCA 5IINA 1ZQAA 4DQPA 4OJ5A 4ECWA 1X40A 5KT6A 2AH5A 4YMNA 4TUSA 1HIWA 1D9FA 4UB4A 1XO1A 5KFQA 4OJOA 4ECTA 3ZDEA 5CA7A 3BJYA 2W9MA 4DL3A 2W7OA 1ZYQA 2HHQA 2BCSA 2BQRA 3AN1A 5HR7A 1BPEA 3GV5B 1M6YA 1JN3A 5KFYA 5L1JA 4O3RA 1N61A 7ICNA 1S10A 3PW4A 3C28A 2YTUA 5DQIA 4NLNA 4ACOA 2R18A 2IHMA 3WK4A 5DB6A 3L3FX 4DQQA 5A0LA 3C2MA 2W04A 3AU2A 4DFMA 3GZFA 1DGSA 3DDHA 3NTUA 3G6VA 3GV8B 1QSLA 3WKAA 8ICFA 2D8CA 3C5GA 4B9MA 1YZ6A 4RPYA 3BZKA 4FBTA 2MUTB 3RB4A 2ZIVA 3KZIU 4DFJA 2D6FC 3T5JA 4F4WA 1T7PA 3B0XA 8ICZA 4XA5A 5KFVA 9ICWA 5T14A 1TAMA 2WB1F 2RDJA 4O3NA 5ALGA 4GFJA 4CDGA 1F0MA 4CF5A 4ECSA 3T5KA 4EEYA 2W3RA 3WU2U 3PSTA 3BS7A 2XY7A 4DSFA 2IOFA 2DPJA 1ZQSA 5AKHA 4RQ1A 1Z00B 2MUTA 3K1ZA 2LM1A 8ICTA 3KHGA 2MRLA 2XCAA 1L5UA 3RB0A 9ICOA 4C80A 2NO5A 4CF4A 1KL9A 3N97B 4M2YA 1A0PA 2K4PA 2K8CB 1N5XA 2KMDA 4J9MA 3HP6A 1SXEA 2ZJAA 5F9LA 1L7OA 2PI5A 4WJ3B 4A8EA 4BWMA 5DB7A 4UAZA 3QU5A 5ALFA 4F5PA 4NV0A 3RAQA 3UPQA 2P66A 1QH9A 1Q8KA 2KHQA 5ALUA 1V9PA 5G5HA 3V7LA 3PW7A 3CYMA 4UATA 7ICOA 4ED8A 2HSZA 2M0NA 2DBYA 3HKZF 2LYAA 1KFDA 4R66A 3M7DA 5DGAA 4PL2A 3M9NB 4JWNA 3EPIA 2FJ6A 4DL5A 4QWBA 5EE1A 3F2CA 1WCNA 7ICPA 2MAXA 2B0CA 1VDVA 2R8IA 1PVRA 4PHEA 5CEHA 2FPMA 4DSLA 1J2MA 1K1SA 4KLSA 2NV3A 4PGYA 5ALZA 3QX7A 9ICRA 2KIVA 4OCZA 3GIKA 5KFPA 4K4IA 3AUOA 3MDAA 1SKWA 1SV4A 3BQ2A 3LYSA 1JROA 2W03A 2KNJA 2DKXA 8ICHA 3GFKB 5KFOA 2NRWA 3QUQA 2BCQA 4RT2A 4IR9A 1NK9A 5KT2A 2EQYA 4F72A 4DFPA 2Z7JA 3H8WA 2KG5A 4YR2A 1ZQUA 2IOHA 2XC9A 4DWIA 4OJ6A 1IV8A 2XICA 2KZZA 1ZQXA 4EENA 1X9XA 4UB8U 5EE3A 2K4EA 7ICVA 4F4ZA 2ALZA 2ZTEA 4QZIA 5KT7A 4C8LA 1T8EA 1MC8A 3PSIA 3JPTA 2EANA 1JX4A 2DPIA 1SXDA 2E8PA 3F53A 4B9NA 9ICVA 1UCVA 2KD1A 1GO3F 3EWAA 1O08A 5AKYA 3T5LA 1NJZA 2EAPA 4M6WA 4BWJA 3IP4B 2FPKA 3RH4A 4EZ9A 3PSFA 1BPDA 3TADC 1S0MA 3ZDAA 3ONNA 4OJLA 5J0YA 1ZQTA 3PMLA 5AKXA 1SL2A 2ZIXB 1D8LA 9ICHA 2W3SA 1Z3EB 7ICKA 4UQGA 4Q43A 2JV3A 1N60A 4O5KA 2E5SA 4IRDA 3HPOA 4FO6A 3ZD8A 2QB1A 5BOLA 2OCEA 4F5NA 2FMQA 4KMOB 5J0QA 2K4HA 4BJQA 8ICAA 1SL1A 2PFPA 2XO7A 1ZQYA 4NY8A 3MR3A 3QYPA 4JV1A 4O3OA 1XO0A 2BQUA 1WWUA 3QZ8A 1BNOA 5G5GA 4F93B 5AKZA 2BCUA 3PO4A 3DEEA 4Z6CA 8ICUA
chains in the Genus database with same CATH topology
2ZG6A 2KV2A 2N1RA 1Z19A 4OO1J 1IIPA 2ZIXA 4P0QA 2Z7JA 4KX5A 1D8BA 2G5HB 2HBLA 3CP8A 3H0MB 5KL1B 3PSTA 2F77X 2G09A 4P0PA 2CRXA 2RHFA 2VJ5A 4OJ6A 5C0YA 2XICA 4QIWC 2JH1A 2HBMA 2KVCA 3K1ZA 2Y0SC 2Q4TA 2K4EA 4OJ5A 2DQNB 2OM6A 3IG8A 1F44A 2JGAA 2ZIUB 3O0FA 2VKQA 3ALRA 1HIWA 2MRLA 2K8BB 2KKPA 2PMZF 2E1FA 1HEKA 2K89A 3OPXA 3SMVA 1PVQA 3KFUF 2WAQF 3LVVA 2DF4B 2JH7A 4FZMA 1A6SA 2OYYA 4OJOA 3PSIA 3VC8A 4AYBC 2JMGA 4NLCA 4QNLA 2XIDA 3F53A 2MA1A 4KX3A 2YB4A 3HKZC 3SAHA 1A0PA 2K8CB 3NRWA 4NLBA 2HOIA 2W7OA 2KD1A 2KHVA 3H0LB 3AQEA 2H3FA 2KICA 1GO3F 4CRXA 4OJPA 1URJA 2BDUA 4C0ZA 3IN5A 4O3MA 5HR7A 4WJ3B 3T79A 2OH2A 2HOQA 2ZIUA 4A8EA 3RFAA 4FZNA 2ZIWB 2ZIVB 2HBJA 3IP4B 4QIWF 3KZXA 2Y0SF 4NV0A 2DGZA 4PL1A 3MGVA 2KHQA 4JMUA 3PSFA 2G0AA 2KKVA 3C28A 2HMXA 2RRDA 4FE3A 2H3VA 3ONNA 4OJLA 2LHTA 1T94A 3D2QA 2F8LA 3PSPA 2KIWA 3CYMA 4ICAA 4ACOA 2R18A 2A3VA 3CRXA 2OXOA 3SQIA 3N7SC 2CPRA 2YB1A 2ZIXB 4AYBF 1KBUA 2M0NA 4U6PA 1ED1A 3IG5A 3L3FX 2XI9A 3N7PD 1WUDA 2KJ5A 2ZXHA 2PMZC 3HKZF 2LYAA 2CN1A 5A0LA 2KJ8A 2H3ZA 4U7CA 2LBOA 2G06A 1XNSA 1P7DA 1ECWA 2E5SA 2W04A 3M7DA 1L6NA 4PL2A 4IC9A 3GZFA 2WB1C 3RF9A 3SAGA 2GOLA 2GH1A 1DRGA 4CGZA 2ZXIA 1Z1BA 2E1EA 3F2CA 5CRXA 4FZLA 1NZBA 1PVRA 4BUGA 2JHDA 1CRXA 1YT3A 2G08A 2K8AA 4KMOB 2K4HA 4BJQA 1SZHA 2KOBA 4P0QB 1Q3VA 3M6ZA 3F2BA 3F5AA 3D2SA 3AQFA 1PVPA 2G07A 2NV3A 3LVWA 4NWIA 2RP5A 2HBKA 3GU3A 2F76X 4P0PB 3SAFA 2LKYA 2XVTA 2YX8A 3VCBA 4BX9C 1XO0A 2HOFA 2WAQC 3F5EA 2K4IA 3D2NA 1Q3UA 2LYBA 2ZIWA 2ZIVA 1UPHA 3ICXA 2D6FC 5HR6A 1MA7A 5KL8B 2VIXA 3F2DA 3E0FA 2H3IA 4QJFB 2KEYA 3LYSA 3M6KA 2VJ4A 2G5IB 2W7PA 3PZPA 2W03A 3AL0B 2KNJA 3H0RB 5T14A 1ZQ1C 1OUQA 1TAMA 2F2AB 2KJ9A 2WB1F 3C29A 3DEEA 3NUQA 2H3QA 3N7RC 4GFJA 4CDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1R A;  2K4H A;  1ED1 A;  2H3F A;  2NV3 A;  2LYA A;  2H3Z A;  2K4E A;  1ECW A;  1L6N A;  2K4I A;  2LYB A;  1UPH A;  4IC9 A;  1HIW A;  2GOL A;  2H3I A;  1HEK A;  4JMU A;  1A6S A;  1TAM A;  2HMX A;  2H3V A;  2H3Q A;  2JMG A;  4ICA A; 
#chains in the Genus database with same CATH topology
 1RXW A;  3CP8 A;  5L9X A;  1CEZ A;  2BPG A;  5AIB A;  1HUZ A;  4O3S A;  3KBB A;  5CJ7 A;  2C2E A;  3UM9 A;  2Y0S C;  3KHH A;  4B9U A;  1TAQ A;  2PMZ F;  2K8B B;  1HEK A;  5J8Y C;  2E8N A;  3VC8 A;  4RQN A;  1NK6 A;  3FAH A;  3RJG A;  1DXS A;  4O0I A;  2MA1 A;  4TUR A;  2IOF K;  5CB1 A;  3WKE A;  2KIC A;  1U4B A;  1ZQZ A;  1SZP A;  3ISB A;  1A77 A;  3BS5 A;  2JEF A;  8ICY A;  3NRZ A;  1N56 A;  3HT3 A;  2J6U A;  2FE9 A;  3MGV A;  3PNC A;  4FE3 A;  2IBK A;  3KKA A;  2I6X A;  5JTI A;  3C1Y A;  3OSP A;  1IG6 A;  4I2J A;  9ICM A;  4QWD A;  1KQQ A;  2YN4 A;  1KTQ A;  1BPY A;  5DQG A;  3C21 A;  2Q0Z X;  2NO4 A;  1QQ5 A;  3OGU A;  1NK7 A;  2KK0 A;  1FFU A;  2RLT A;  4ELT A;  3QU9 A;  2BR0 A;  3WK6 A;  4JWM A;  5TZV A;  3TKA A;  5CR0 A;  2IMW P;  2HBK A;  3RH5 A;  5KFW A;  4RQ0 A;  4I2F A;  1U45 A;  3SAF A;  3E58 A;  2HOF A;  4QZE A;  3L4P A;  4QZG A;  1SV0 C;  5KL8 B;  5ALX A;  2V4R A;  7ICR A;  4EEL A;  3M6K A;  4M9H A;  2GO7 A;  1IXR A;  1ZQ1 C;  5HP4 A;  2OWO A;  2ISP A;  5KFH A;  4ICA A;  1K5O A;  1DK2 A;  1ZJM A;  4KX5 A;  3WK7 A;  1L8L A;  1KSP A;  2AHO B;  3GII A;  3QZ7 A;  2ESE A;  5KG5 A;  3V6K A;  5KG0 A;  4UAU A;  1MSW D;  1JXL A;  2EDU A;  9ICJ A;  4Y2Q A;  3EUB 2;  3UXN A;  5AK6 A;  3ZD9 A;  4I2D A;  5IIK A;  1XWL A;  4F71 A;  4KLO A;  4C7Y A;  2LMR A;  4KX3 A;  3SAH A;  3JPR A;  1QCK A;  2H3F A;  4CRX A;  3GQC A;  3EYZ A;  5L1M A;  3UMC A;  1QTM A;  3RBE A;  1SWV A;  4EBD A;  3SQI A;  3NAS A;  3AM9 A;  8ICS A;  1NK4 A;  8ICE A;  5ALQ A;  3HJE A;  3M8R A;  1U49 A;  4QWA A;  2ES6 A;  3C2L A;  3RJE A;  1L6N A;  4I2H A;  1LKY A;  1DRG A;  2KSO A;  4EBE A;  1QSS A;  3EW9 A;  9ICE A;  5KFU A;  1S97 A;  2YQE A;  1Z4N A;  1JIH A;  3M6Z A;  2J6S A;  4M9L A;  4NLK A;  1T3Q A;  4RQ3 A;  3BQ1 A;  3RBD A;  5CP2 A;  5AHX A;  2GWS A;  4BX9 C;  2EZZ A;  3F5E A;  5IIM A;  2E3T A;  2W9A A;  1BVS A;  2ZJ5 A;  1ZXI A;  2Y1I A;  4LZD A;  5J29 A;  5DDM A;  2WF8 A;  4ELV A;  2ZG6 A;  1Z19 A;  2J6T A;  4KLH A;  3Q8R B;  9ICI A;  1ZD3 A;  3NVV A;  1ZQF A;  4NM1 A;  8ICP A;  8ICV A;  3FYH A;  3K4G A;  1KW4 A;  4TQS A;  3IG8 A;  1LVH A;  2W55 A;  3ETR A;  1RYR A;  3PW2 A;  1DGJ A;  1WG8 A;  4FZM A;  5J0X A;  4Y2U A;  4AYB C;  3H4B A;  1WWV A;  2JMG A;  3UQ2 A;  1Z4O A;  4F5Q A;  2AGO A;  1RYU A;  2C2R A;  2ZTC A;  4GC7 A;  2HOI A;  1BGX T;  3PV8 A;  5K4L A;  3TFR A;  2B21 A;  3NVY A;  5AI6 A;  4JV0 A;  4PHP A;  3IN5 A;  5L1K A;  4C4T A;  2OH2 A;  4P4P A;  4PHD A;  2BCR A;  4RQ4 A;  5ALS A;  1SKR A;  3JPO A;  4QZ9 A;  3N7S C;  3RJF A;  5JUM A;  4KLQ A;  1TFR A;  4B9L A;  4KN7 A;  4EZ6 A;  4GXJ A;  2KJ8 A;  2AGP A;  2LBO A;  2D3D A;  2W8L A;  3N28 A;  5J0O A;  4AP9 A;  3Q8S B;  4DF8 A;  4M0A A;  1Y88 A;  1L3V A;  4KLF A;  3QNM A;  5KFJ A;  4QZF A;  4XRH A;  4DL6 A;  5AI0 A;  2RP5 A;  4UB2 A;  4YMM A;  2NRT A;  2LYB A;  4DQS A;  5KTQ A;  4BXO B;  2G5I B;  7ICT A;  4PJ0 U;  3PO5 A;  1ZQI A;  4B9T A;  2DWQ A;  4UAR A;  2KVS A;  7ICF A;  2HBL A;  1B43 A;  2W11 A;  4MEX A;  2EZX A;  3D6J A;  1Q46 A;  2HBM A;  5ALN A;  2NRX A;  3AU6 A;  1VLB A;  1ZRN A;  1XC9 A;  4BXO A;  5AK4 A;  1PVQ A;  1C20 A;  3KTQ A;  2BPC A;  4TQR A;  3MFI A;  2FI1 A;  2KFN A;  1ZQC A;  3QUT A;  2FMP A;  3SV3 A;  3KOO A;  3LDA A;  2VA3 A;  5AI4 A;  4QW8 A;  4OJP A;  1AQ6 A;  4UAY A;  1NKE A;  5KG6 A;  4O3M A;  3PW5 A;  5AKE A;  1KN5 A;  4KLE A;  4I2G A;  7ICE A;  3KZX A;  1B0X A;  3H4D A;  4EEK A;  2G0A A;  5ALE A;  4Y2P A;  3ZDB A;  2HVH A;  2LHT A;  2VAN A;  2F8L A;  4DS4 A;  4F91 B;  1U48 A;  4MEY A;  9ICC A;  1KBU A;  2WF9 A;  5E79 U;  4PGQ A;  3MGH A;  1WUD A;  4C7Z A;  1Z00 A;  5JRT A;  1TV9 A;  4YR0 A;  5ALH A;  3JPP A;  5BOM A;  4ECR A;  5DG8 A;  2JEG A;  2XGP A;  3RF9 A;  1ZQM A;  1JXE A;  3SAG A;  2BQ3 A;  2KZM A;  3IDW A;  3FM9 A;  4P4O A;  4FZL A;  2JHD A;  4MFA A;  2LPE A;  3IM1 A;  5ALD A;  2JXJ A;  1F5S A;  3SV4 A;  4DSE A;  1ZD4 A;  3GU3 A;  3SEI A;  3GIJ A;  2LKY A;  3VCB A;  8ICO A;  3ICX A;  3RJK A;  4IQT A;  1ZQE A;  9ICU A;  5F9N A;  3C5F A;  3N4M B;  7ICJ A;  4ED7 A;  4UB1 A;  1QLN A;  3HX0 A;  5AM3 A;  2WFA A;  2FLN A;  5KFD A;  3DV9 A;  1VJ5 A;  2EH9 A;  4DL7 A;  2DFL A;  4I27 A;  1X6I A;  2DQN B;  2PFN A;  3H7I A;  4PPX A;  2JGA A;  2ZIU B;  1L7M A;  1K1Q A;  2FLL A;  1RQL A;  5DKW A;  2YY6 A;  2F44 A;  2F3N A;  4ECU A;  4IRK A;  4PGX A;  1B22 A;  2YML A;  5KFK A;  4J9N A;  3NRW A;  5IIJ A;  2R8J A;  1HJP A;  1T3N A;  2WF5 A;  2BDU A;  8ICM A;  2DL0 A;  2HOQ A;  2ZIU A;  4B9V A;  4NXZ A;  3BDP A;  5KG1 A;  2HCF A;  3PMN A;  4QZB A;  8ICL A;  2DGZ A;  2V9W A;  3WKB A;  4QZ8 A;  1U9L A;  2H3V A;  5KFN A;  4KIT B;  3PSP A;  3CRX A;  3K1R B;  4RT3 A;  2KE7 A;  1L7P A;  5J0T A;  2PMZ C;  4EYI B;  1ZQG A;  3TAD A;  3B0Y A;  1B4F A;  1P7D A;  5J2G A;  5J2D A;  4JUZ A;  2IHN A;  4KLU A;  3M9M B;  4KN4 A;  4Q45 A;  3MAB A;  1ZQK A;  5F3X B;  4EYH B;  4DO9 A;  4BUG A;  4F4K A;  1ZQR A;  1SB3 C;  3UMB A;  5ALJ A;  5KFT A;  1TVA A;  2WF6 A;  4PHA A;  4P0Q B;  8ICI A;  3G6X A;  2LYH A;  4Y2S A;  4M04 A;  4I2E A;  7ICS A;  3GIL A;  2UVU A;  2F76 X;  4P0P B;  1X9W A;  3FC4 A;  4J03 A;  2WAQ C;  2E8M A;  5KG2 A;  4QJF B;  4JV2 A;  1J2N A;  8ICC A;  1NKC A;  4J9S A;  3H0R B;  4DF4 A;  3Q8L A;  3C29 A;  3NUQ A;  1S9F A;  2KV2 A;  5ALW A;  2ZIX A;  4P0Q A;  5ALO A;  3H0M B;  5KL1 B;  4P0P A;  2VJ5 A;  2LM4 A;  3ISC A;  4QIW C;  1X9M A;  3WK5 A;  2KVC A;  2KZ3 A;  2OM6 A;  1NZP A;  3U26 A;  3HIL A;  1H38 A;  2E1F A;  2XY6 A;  5HMM A;  5GTH U;  4I2C A;  2RDI A;  3B9J A;  1KFT A;  5DLG A;  2JZB B;  3Q8Q B;  2YB4 A;  5DGB A;  1O03 A;  2KHV A;  4RQ6 A;  5DBA A;  1XSL A;  5J8Y A;  4LJX A;  1PUZ A;  2W9B B;  3EZ5 A;  2LI6 A;  3RFA A;  4GC6 A;  2ZIW B;  5J2B A;  1JMS A;  5J2J A;  2P35 A;  1RM6 C;  5DG7 A;  4UBC A;  1ZQN A;  2KKV A;  5ALI A;  3QE9 Y;  2JZB A;  3D2Q A;  4QZA A;  4F4Y A;  2AQ4 A;  5FP0 A;  2XGQ A;  2W9C B;  3LK9 A;  1PK3 A;  1N48 A;  2P6U A;  4ED3 A;  2KJ5 A;  3RJJ A;  1V85 A;  2G06 A;  1QQ7 A;  4JK1 A;  4NL9 C;  4Y2J A;  4CGZ A;  4YP3 A;  5DBB A;  4F4X A;  4YXM A;  4YMO A;  1BNP A;  4B9S A;  4KTQ A;  9ICF A;  2W9C A;  3BQ7 A;  2ASJ A;  2AQ0 A;  1X66 A;  3QUB A;  1SL0 A;  4KLD A;  4EX7 A;  1MQ3 A;  1C7Y A;  1V97 A;  4MHV A;  5L1I A;  2UVR A;  2YX8 A;  1JUD A;  3UXP A;  3MFH A;  3D2N A;  2PFQ A;  2HHX A;  2I9G A;  1L8O A;  4YR3 A;  4NJ8 A;  3S6J A;  5AM4 A;  2H5X A;  2F2A B;  7ICU A;  2KP7 A;  4YG2 A;  4DL2 A;  4CNQ A;  2F8K A;  2R8K A;  3LWL A;  5AI5 A;  5ALR A;  8ICK A;  4I2B A;  4J9O A;  9ICT A;  3OPX A;  5KG4 A;  4DS5 A;  4UAS A;  4RU9 A;  3LWM A;  4F2R A;  4QNL A;  8ICB A;  4IRC A;  4C0Z A;  5ALY A;  1UA1 A;  3MGI A;  5D46 A;  1FFV A;  4ECQ A;  2Y0S F;  4PL1 A;  2AGQ A;  4I2A A;  4QW9 A;  9ICB A;  1X42 A;  2A3V A;  3MR6 A;  1A76 A;  3C2K A;  4GLX A;  1L7N A;  4R65 A;  5KFI A;  4F5O A;  2ZXH A;  1N63 A;  4NLZ A;  3OHA A;  2YMP A;  3T3F A;  1DK3 A;  3QU4 A;  2GH1 A;  2ZXI A;  1Z1B A;  2E1E A;  3SI8 A;  5AKK A;  4UB3 A;  2AJQ A;  4US8 A;  1T4G A;  2HHT A;  4MF8 A;  3MC1 A;  4ECV A;  1NJY A;  2FDR A;  4UB6 U;  3SYZ A;  5KFG A;  5AM0 A;  2BPF A;  2DKZ A;  1MA7 A;  2VIX A;  4YXJ A;  8ICN A;  3TAR A;  7ICG A;  3L5K A;  3WK8 A;  4J9L A;  2KJ9 A;  3I28 A;  4ED6 A;  2ASL A;  1IIP A;  4DOC A;  1ZQD A;  3PVX A;  3GDX A;  1NI3 A;  5J0W A;  3OJS A;  4M47 A;  3QXG A;  1KRP A;  1ZJN A;  3G6Y A;  3SMV A;  3LVV A;  4P4M A;  2JH7 A;  2HHW A;  4YCX A;  4RZR A;  9ICQ A;  2XID A;  5KFF A;  1KLN A;  2NRV A;  5J2C A;  2HW3 A;  1NOM A;  4RNM A;  5J2K A;  4B6J A;  4TUP A;  4X5V A;  1S8O A;  3RAX A;  1UQV A;  2ATL A;  3ISD A;  2KN7 A;  4O5C A;  3M9O B;  1SGG A;  5EOZ A;  1KFS A;  1TK8 A;  4U6P A;  4CCH A;  3NVW A;  1QSY A;  3QEB Z;  4FS1 A;  1ZRM A;  5JU5 A;  9ICP A;  3UMG A;  2WB1 C;  2GOL A;  2EZY A;  2FMS A;  5CRX A;  5KFM A;  1MN8 A;  5J2H A;  2XCP A;  2PXI A;  1SZH A;  3C1Z A;  1ZQW A;  4RQ2 A;  2NYV A;  3H8S A;  3LVW A;  2HHS A;  5TIS U;  2BKE A;  2YMQ A;  1Q3U A;  2K4I A;  5DB8 A;  4KLG A;  1UPH A;  3BQ0 A;  4QZH A;  3E0F A;  4RUC A;  4NLG A;  1NK5 A;  5KG3 A;  2C2D A;  1PK1 B;  3HRD D;  2HHV A;  4KMU A;  5ALM A;  3RB6 A;  4DOA A;  1NNL A;  3J81 j;  3OHB A;  1N2X A;  7ICQ A;  3ED5 A;  1TK5 A;  3O0F A;  3KFU F;  1Z1V A;  2K89 A;  1ZD2 P;  4FBU A;  4CF3 A;  1PK1 A;  1A6S A;  2OYY A;  3K75 D;  1MQ2 A;  2QLT A;  4NLC A;  2ZUD A;  8ICW A;  4YQW A;  3HKZ C;  4C8M A;  3JPQ A;  3AQE A;  4RQM A;  2F1I A;  4UAV A;  5KT3 A;  4KLL A;  4YFK A;  2A19 A;  2ODG A;  4O5E A;  4KLI A;  4O9M A;  3C23 A;  1XSN A;  4F2S A;  4BDP A;  3H8J A;  2CXY A;  1ZQP A;  3RR7 A;  2ZIV B;  3WK9 A;  2C22 A;  5CWR A;  3IRU A;  2HDO A;  2V4Q A;  1S0O A;  4UB5 A;  3MR2 A;  1ARO P;  2GLE A;  2I1Q A;  4AYB F;  5KFB A;  5AIA A;  2M9N A;  2K60 A;  3E2E A;  2MSN A;  2CN1 A;  5AKL A;  3OSN A;  3QU7 A;  2MU2 A;  4ED2 A;  3RRH A;  3SEN A;  5AKJ A;  5ALL A;  3JPS A;  4OD0 A;  3GV7 B;  5III A;  5J2E A;  5DQH A;  1CRX A;  2VA8 A;  2DUY A;  4FFD A;  2BDP A;  5J2I A;  2Y9U A;  9ICK A;  5KFA A;  4FS2 A;  4NM2 A;  2JEI A;  2EAO A;  4ECZ A;  2XVT A;  2BGW A;  3PX0 A;  1L3S A;  2ZUB A;  3F2D A;  2KEY A;  4YD2 A;  3V6J A;  3IV6 A;  4RQ8 A;  5HHH A;  1NJW A;  4Y2T A;  5HHI A;  3TAP A;  1RPL A;  2QB0 B;  5C0Y A;  4KLJ A;  4J9K A;  4UW9 A;  5EWE A;  2P6R A;  1X9S A;  4IL6 U;  4C8O A;  3OJU A;  4MFF A;  4RQ7 A;  4DLG A;  1U47 A;  3Q8P B;  3M8S A;  1KDH A;  4NLB A;  5KAI U;  2QB0 A;  2I5H A;  5AM5 A;  1URJ A;  5AI9 A;  4DLE A;  1ZQO A;  8ICR A;  4FZN A;  4K4G A;  1ZQV A;  5KFL A;  3KHR A;  1V38 A;  4JMU A;  3IHQ B;  3TFS A;  2HMX A;  5HML A;  5J0U A;  4UAW A;  1T94 A;  2PFO A;  2KIW A;  1J97 A;  4J9Q A;  3PX6 A;  2OXO A;  1BPX A;  3MDC A;  1NKB A;  1X2I A;  4YD1 A;  2XI9 A;  4M9G A;  2PKE A;  1TK0 A;  3EPG A;  4IQW A;  3BZC A;  1RYS A;  5KAF U;  4IC9 A;  5DDY A;  2HVI A;  5B5E U;  4F8R A;  2F1H A;  1COO A;  5ALK A;  5ALV A;  4DEZ A;  2OHF A;  3A0H U;  1YT3 A;  2G08 A;  3NVZ A;  3UQ0 A;  3RH6 A;  2R8G A;  1ZQB A;  1ZOL A;  5KFC A;  3A0B U;  4ECX A;  2Y9T A;  2ASD A;  4M6W B;  2BHN A;  4M9J A;  2W43 A;  2B6G A;  5D4B A;  4O3Q A;  1KEJ A;  8ICQ A;  1FIQ A;  2IA6 A;  1Q3V A;  1S0V A;  1D9D A;  1D8B A;  3CW2 C;  5C5J A;  1FEZ A;  3H8M A;  5BPC A;  3RJI A;  2F1J A;  2G09 A;  2JH1 A;  1TKD A;  5HNK A;  5J0R A;  5AM1 A;  3TAN A;  4DSJ A;  2JRZ A;  2R8H A;  1JAL A;  1NJX A;  4J9P A;  4F5R A;  3UXO A;  5J0S A;  1CUK A;  4Y2Y A;  4R64 A;  4HAI A;  5DG9 A;  3HWT A;  1UA0 A;  3SD7 A;  1BPB A;  3PX4 A;  4DOB A;  3M1Y A;  2HHU A;  2ZJ8 A;  2YMM A;  4Q8E A;  1OXJ A;  2HBJ A;  1X6J A;  2OEH A;  1RG6 A;  4IQU A;  4K4H A;  4DL4 A;  4Z6F A;  5EWG A;  5L1L A;  1RXV A;  3GIM A;  3TQ1 A;  2EAM A;  2QKQ A;  5AI8 A;  2AU0 A;  2CPR A;  3RJH A;  1ED1 A;  4RUA A;  2A1J B;  3BQT A;  1S76 D;  4M9N A;  3PR5 B;  3SR6 A;  2Y1J A;  4U7C A;  4E0D A;  2UVV A;  1RQN A;  5H2F U;  4PZN A;  1TAU A;  4UBB A;  1UHU A;  1ZQL A;  3PW0 A;  4IQV A;  4C4S A;  2KFZ A;  5AKG A;  4R63 A;  2A1A A;  4Z6E A;  4NL9 A;  2A1J A;  3AQF A;  1S0N A;  3TAC B;  3V6H A;  8ICJ A;  2W9B A;  5KNI A;  3BS5 B;  3ORY A;  1BPZ A;  1ZET A;  2ZIW A;  3ZI4 A;  3PZP A;  2VJ4 A;  1TE2 A;  2VA2 A;  3NS1 A;  2E8O A;  4IS7 A;  4ED0 A;  5J2A A;  2W54 A;  5KG7 A;  4I28 A;  5KFE A;  1RZT A;  3H40 A;  1N5W A;  4DFK A;  3Q8M A;  2PI4 A;  2RHF A;  3MBY A;  3RTV A;  1XSP A;  2Q4T A;  5KFZ A;  8ICG A;  4MF2 A;  3FDS A;  3ALR A;  3HW8 A;  2KKP A;  1S77 D;  2WAQ F;  4F50 A;  4Q8F A;  4IR1 A;  2RQ5 A;  2ZUC A;  4JB3 A;  1L3T A;  3PY8 A;  3T5H A;  4DSI A;  4CE6 A;  1EXN A;  4RNO A;  1SV0 A;  3JPN A;  1JI7 A;  5KT4 A;  3KD3 A;  5AM2 A;  4ELU A;  3KKA C;  7ICH A;  3I76 A;  5KFS A;  1DOQ A;  4O3P A;  3QU2 A;  2WHE A;  4QIW F;  5KFR A;  9ICL A;  4LZG A;  5AK5 A;  4Y2R A;  4PZO A;  2RRD A;  4Z6D A;  3Q8K A;  4ZOH C;  3WKC A;  2YB1 A;  5AIC A;  4C4R A;  3IG5 A;  4PH5 A;  3N7P D;  4YVZ A;  1KKX A;  1YZ7 A;  2H3Z A;  1XNS A;  2JEJ A;  1ECW A;  3RRG A;  2C28 A;  4P2H A;  2WF7 A;  5J0P A;  5KT5 A;  5ALP A;  4QZC A;  3QUC A;  9ICN A;  1ZQH A;  2HI0 A;  1NZB A;  1S5L U;  5KFX A;  2NRZ A;  1D8Y A;  4DQI A;  1ZQJ A;  1HUO A;  1LV5 A;  4ZH4 A;  2G07 A;  3RR8 A;  4KLT A;  4F3O A;  4DQR A;  2KTQ A;  1NK8 A;  2BCV A;  9ICA A;  3ETL A;  3PR4 A;  2H3I A;  2UVW A;  5DB9 A;  2ZTD A;  3TI0 A;  5GTI U;  4Y2X A;  3AEV A;  3CNH A;  3AMZ A;  2H3Q A;  2BZF A;  1UT8 A;  2AXT U;  4F92 B;  4GIB A;  2G5H B;  5EE9 A;  3R9K A;  3KHL A;  9ICG A;  1N62 A;  3ZDD A;  2CRX A;  1PZN A;  4I2I A;  4G9B A;  5AK3 A;  4C8K A;  2O6K A;  5DLF A;  1F44 A;  4QWE A;  2ISO A;  2VKQ A;  1L3U A;  4G3I A;  1LKY B;  2KSO B;  3V7J A;  1SIJ A;  2WTF A;  1LB2 B;  2DF4 B;  5D49 A;  4BGD A;  4DSK A;  3TAQ A;  3V7K A;  1XS9 D;  7ICI A;  4DCC A;  1JRP A;  4TUQ A;  3I1Y A;  7ICM A;  5J2F A;  3H0L B;  4YN4 A;  4Y2V A;  1XU4 A;  3NGD A;  5IIL A;  1ZD5 A;  4RNN A;  3V72 A;  1QQ6 A;  3ZDC A;  5EWF A;  4KLM A;  9ICX A;  4J9R A;  3MR5 A;  4QZD A;  4RQ5 A;  2W8K A;  9ICS A;  4HYK A;  5DBC A;  4ED1 A;  3WKD A;  2QAR B;  5B66 U;  1ZQQ A;  4ECY A;  2FLP A;  4RPX A;  3OTQ A;  8ICX A;  5ALT A;  1RDF A;  4Q44 A;  1WCL A;  4GXI A;  5EE0 A;  4EBC A;  4DFD A;  1UT5 A;  4USA A;  4LVS A;  5IIO A;  4XUS A;  4GXK A;  2FPL A;  1IM4 A;  2K8A A;  4R8U B;  1NK0 A;  2KOB A;  4XQ8 A;  3F2B A;  3F5A A;  3D2S A;  2QAR A;  1PVP A;  4NWI A;  2L5Y A;  1SWW A;  5AKI A;  4I29 A;  1SKS A;  4US9 A;  4EX6 A;  2W7P A;  1FO4 A;  3AL0 B;  4C8N A;  1OUQ A;  1COK A;  1CI4 A;  7ICL A;  5CHG A;  1OW5 A;  3N7R C;  3T79 A;  5HR6 A;  4R8U A;  2N1R A;  4MFC A;  4OO1 J;  2XY5 A;  4RPZ A;  1WYG A;  2JR5 A;  3SZ2 A;  2F77 X;  3THV A;  3RB3 A;  3QEA Z;  4QWC A;  5IIN A;  1ZQA A;  4DQP A;  4OJ5 A;  4ECW A;  1X40 A;  5KT6 A;  2AH5 A;  4YMN A;  4TUS A;  1HIW A;  1D9F A;  4UB4 A;  1XO1 A;  5KFQ A;  4OJO A;  4ECT A;  3ZDE A;  5CA7 A;  3BJY A;  2W9M A;  4DL3 A;  2W7O A;  1ZYQ A;  2HHQ A;  2BCS A;  2BQR A;  3AN1 A;  5HR7 A;  1BPE A;  3GV5 B;  1M6Y A;  1JN3 A;  5KFY A;  5L1J A;  4O3R A;  1N61 A;  7ICN A;  1S10 A;  3PW4 A;  3C28 A;  2YTU A;  5DQI A;  4NLN A;  4ACO A;  2R18 A;  2IHM A;  3WK4 A;  5DB6 A;  3L3F X;  4DQQ A;  5A0L A;  3C2M A;  2W04 A;  3AU2 A;  4DFM A;  3GZF A;  1DGS A;  3DDH A;  3NTU A;  3G6V A;  3GV8 B;  1QSL A;  3WKA A;  8ICF A;  2D8C A;  3C5G A;  4B9M A;  1YZ6 A;  4RPY A;  3BZK A;  4FBT A;  2MUT B;  3RB4 A;  2ZIV A;  3KZI U;  4DFJ A;  2D6F C;  3T5J A;  4F4W A;  1T7P A;  3B0X A;  8ICZ A;  4XA5 A;  5KFV A;  9ICW A;  5T14 A;  1TAM A;  2WB1 F;  2RDJ A;  4O3N A;  5ALG A;  4GFJ A;  4CDG A;  1F0M A;  4CF5 A;  4ECS A;  3T5K A;  4EEY A;  2W3R A;  3WU2 U;  3PST A;  3BS7 A;  2XY7 A;  4DSF A;  2IOF A;  2DPJ A;  1ZQS A;  5AKH A;  4RQ1 A;  1Z00 B;  2MUT A;  3K1Z A;  2LM1 A;  8ICT A;  3KHG A;  2MRL A;  2XCA A;  1L5U A;  3RB0 A;  9ICO A;  4C80 A;  2NO5 A;  4CF4 A;  1KL9 A;  3N97 B;  4M2Y A;  1A0P A;  2K4P A;  2K8C B;  1N5X A;  2KMD A;  4J9M A;  3HP6 A;  1SXE A;  2ZJA A;  5F9L A;  1L7O A;  2PI5 A;  4WJ3 B;  4A8E A;  4BWM A;  5DB7 A;  4UAZ A;  3QU5 A;  5ALF A;  4F5P A;  4NV0 A;  3RAQ A;  3UPQ A;  2P66 A;  1QH9 A;  1Q8K A;  2KHQ A;  5ALU A;  1V9P A;  5G5H A;  3V7L A;  3PW7 A;  3CYM A;  4UAT A;  7ICO A;  4ED8 A;  2HSZ A;  2M0N A;  2DBY A;  3HKZ F;  2LYA A;  1KFD A;  4R66 A;  3M7D A;  5DGA A;  4PL2 A;  3M9N B;  4JWN A;  3EPI A;  2FJ6 A;  4DL5 A;  4QWB A;  5EE1 A;  3F2C A;  1WCN A;  7ICP A;  2MAX A;  2B0C A;  1VDV A;  2R8I A;  1PVR A;  4PHE A;  5CEH A;  2FPM A;  4DSL A;  1J2M A;  1K1S A;  4KLS A;  2NV3 A;  4PGY A;  5ALZ A;  3QX7 A;  9ICR A;  2KIV A;  4OCZ A;  3GIK A;  5KFP A;  4K4I A;  3AUO A;  3MDA A;  1SKW A;  1SV4 A;  3BQ2 A;  3LYS A;  1JRO A;  2W03 A;  2KNJ A;  2DKX A;  8ICH A;  3GFK B;  5KFO A;  2NRW A;  3QUQ A;  2BCQ A;  4RT2 A;  4IR9 A;  1NK9 A;  5KT2 A;  2EQY A;  4F72 A;  4DFP A;  2Z7J A;  3H8W A;  2KG5 A;  4YR2 A;  1ZQU A;  2IOH A;  2XC9 A;  4DWI A;  4OJ6 A;  1IV8 A;  2XIC A;  2KZZ A;  1ZQX A;  4EEN A;  1X9X A;  4UB8 U;  5EE3 A;  2K4E A;  7ICV A;  4F4Z A;  2ALZ A;  2ZTE A;  4QZI A;  5KT7 A;  4C8L A;  1T8E A;  1MC8 A;  3PSI A;  3JPT A;  2EAN A;  1JX4 A;  2DPI A;  1SXD A;  2E8P A;  3F53 A;  4B9N A;  9ICV A;  1UCV A;  2KD1 A;  1GO3 F;  3EWA A;  1O08 A;  5AKY A;  3T5L A;  1NJZ A;  2EAP A;  4M6W A;  4BWJ A;  3IP4 B;  2FPK A;  3RH4 A;  4EZ9 A;  3PSF A;  1BPD A;  3TAD C;  1S0M A;  3ZDA A;  3ONN A;  4OJL A;  5J0Y A;  1ZQT A;  3PML A;  5AKX A;  1SL2 A;  2ZIX B;  1D8L A;  9ICH A;  2W3S A;  1Z3E B;  7ICK A;  4UQG A;  4Q43 A;  2JV3 A;  1N60 A;  4O5K A;  2E5S A;  4IRD A;  3HPO A;  4FO6 A;  3ZD8 A;  2QB1 A;  5BOL A;  2OCE A;  4F5N A;  2FMQ A;  4KMO B;  5J0Q A;  2K4H A;  4BJQ A;  8ICA A;  1SL1 A;  2PFP A;  2XO7 A;  1ZQY A;  4NY8 A;  3MR3 A;  3QYP A;  4JV1 A;  4O3O A;  1XO0 A;  2BQU A;  1WWU A;  3QZ8 A;  1BNO A;  5G5G A;  4F93 B;  5AKZ A;  2BCU A;  3PO4 A;  3DEE A;  4Z6C A;  8ICU A; 
#chains in the Genus database with same CATH homology
 2ZG6 A;  2KV2 A;  2N1R A;  1Z19 A;  4OO1 J;  1IIP A;  2ZIX A;  4P0Q A;  2Z7J A;  4KX5 A;  1D8B A;  2G5H B;  2HBL A;  3CP8 A;  3H0M B;  5KL1 B;  3PST A;  2F77 X;  2G09 A;  4P0P A;  2CRX A;  2RHF A;  2VJ5 A;  4OJ6 A;  5C0Y A;  2XIC A;  4QIW C;  2JH1 A;  2HBM A;  2KVC A;  3K1Z A;  2Y0S C;  2Q4T A;  2K4E A;  4OJ5 A;  2DQN B;  2OM6 A;  3IG8 A;  1F44 A;  2JGA A;  2ZIU B;  3O0F A;  2VKQ A;  3ALR A;  1HIW A;  2MRL A;  2K8B B;  2KKP A;  2PMZ F;  2E1F A;  1HEK A;  2K89 A;  3OPX A;  3SMV A;  1PVQ A;  3KFU F;  2WAQ F;  3LVV A;  2DF4 B;  2JH7 A;  4FZM A;  1A6S A;  2OYY A;  4OJO A;  3PSI A;  3VC8 A;  4AYB C;  2JMG A;  4NLC A;  4QNL A;  2XID A;  3F53 A;  2MA1 A;  4KX3 A;  2YB4 A;  3HKZ C;  3SAH A;  1A0P A;  2K8C B;  3NRW A;  4NLB A;  2HOI A;  2W7O A;  2KD1 A;  2KHV A;  3H0L B;  3AQE A;  2H3F A;  2KIC A;  1GO3 F;  4CRX A;  4OJP A;  1URJ A;  2BDU A;  4C0Z A;  3IN5 A;  4O3M A;  5HR7 A;  4WJ3 B;  3T79 A;  2OH2 A;  2HOQ A;  2ZIU A;  4A8E A;  3RFA A;  4FZN A;  2ZIW B;  2ZIV B;  2HBJ A;  3IP4 B;  4QIW F;  3KZX A;  2Y0S F;  4NV0 A;  2DGZ A;  4PL1 A;  3MGV A;  2KHQ A;  4JMU A;  3PSF A;  2G0A A;  2KKV A;  3C28 A;  2HMX A;  2RRD A;  4FE3 A;  2H3V A;  3ONN A;  4OJL A;  2LHT A;  1T94 A;  3D2Q A;  2F8L A;  3PSP A;  2KIW A;  3CYM A;  4ICA A;  4ACO A;  2R18 A;  2A3V A;  3CRX A;  2OXO A;  3SQI A;  3N7S C;  2CPR A;  2YB1 A;  2ZIX B;  4AYB F;  1KBU A;  2M0N A;  4U6P A;  1ED1 A;  3IG5 A;  3L3F X;  2XI9 A;  3N7P D;  1WUD A;  2KJ5 A;  2ZXH A;  2PMZ C;  3HKZ F;  2LYA A;  2CN1 A;  5A0L A;  2KJ8 A;  2H3Z A;  4U7C A;  2LBO A;  2G06 A;  1XNS A;  1P7D A;  1ECW A;  2E5S A;  2W04 A;  3M7D A;  1L6N A;  4PL2 A;  4IC9 A;  3GZF A;  2WB1 C;  3RF9 A;  3SAG A;  2GOL A;  2GH1 A;  1DRG A;  4CGZ A;  2ZXI A;  1Z1B A;  2E1E A;  3F2C A;  5CRX A;  4FZL A;  1NZB A;  1PVR A;  4BUG A;  2JHD A;  1CRX A;  1YT3 A;  2G08 A;  2K8A A;  4KMO B;  2K4H A;  4BJQ A;  1SZH A;  2KOB A;  4P0Q B;  1Q3V A;  3M6Z A;  3F2B A;  3F5A A;  3D2S A;  3AQF A;  1PVP A;  2G07 A;  2NV3 A;  3LVW A;  4NWI A;  2RP5 A;  2HBK A;  3GU3 A;  2F76 X;  4P0P B;  3SAF A;  2LKY A;  2XVT A;  2YX8 A;  3VCB A;  4BX9 C;  1XO0 A;  2HOF A;  2WAQ C;  3F5E A;  2K4I A;  3D2N A;  1Q3U A;  2LYB A;  2ZIW A;  2ZIV A;  1UPH A;  3ICX A;  2D6F C;  5HR6 A;  1MA7 A;  5KL8 B;  2VIX A;  3F2D A;  3E0F A;  2H3I A;  4QJF B;  2KEY A;  3LYS A;  3M6K A;  2VJ4 A;  2G5I B;  2W7P A;  3PZP A;  2W03 A;  3AL0 B;  2KNJ A;  3H0R B;  5T14 A;  1ZQ1 C;  1OUQ A;  1TAM A;  2F2A B;  2KJ9 A;  2WB1 F;  3C29 A;  3DEE A;  3NUQ A;  2H3Q A;  3N7R C;  4GFJ A;  4CDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...