2H3ZA

Structure of the hiv-1 matrix protein bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 38
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3zA01
1ED1A 4JMUA 2HMXA 1A6SA 2LYBA 2K4HA 1L6NA 1TAMA 1UPHA 1HEKA 2LYAA 4IC9A 4ICAA 1HIWA 1ECWA 2N1RA 2JMGA 2K4EA 2K4IA 2GOLA 2H3VA 2H3FA 2H3ZA 2H3QA 2H3IA 2NV3A
chains in the Genus database with same CATH superfamily
2UVRA 2EZZA 4IS7A 5HP4A 4ED2A 4KMOB 3QXGA 3V6JA 1F0MA 3EZ5A 5ALPA 1SKRA 5ALEA 4LVSA 2LMRA 3GV5B 2W3RA 2ZIUA 5HHHA 5CR0A 1X9MA 4YG2A 4O3OA 4EEKA 3ONNA 2ZUDA 4M9GA 2R8HA 2DKXA 2IOFA 2ES6A 5AKIA 5J0YA 1QTMA 2Z7JA 4ECZA 3L4PA 4I2BA 2MUTB 2Y1IA 8ICVA 2RDJA 2FMQA 2WF8A 3BS5B 1XU4A 1Y88A 1C7YA 1SXDA 3RAQA 2F1JA 2QB1A 4EENA 5J2FA 3BS5A 2RRDA 5KFPA 4I2DA 4ED8A 2AGOA 4BX9C 4I27A 5KFOA 4YR0A 2G5HB 5AI5A 3TADA 5AI0A 3RB4A 4UB8U 4Y2XA 3UXOA 5AKKA 3RR8A 4UAUA 4GC7A 4QZCA 1NK9A 3AN1A 1Z4OA 4TUQA 4B9SA 1SV0C 1UQVA 3QNMA 2QARB 3UMCA 4RQ1A 3SENA 1LKYA 2E1EA 2OHFA 3EWAA 2E3TA 1U4BA 1N61A 3QE9Y 4CF3A 4M9HA 4PGXA 2HI0A 3QU9A 4UB3A 1L3UA 2F2AB 2F76X 3TAQA 1S76D 1YT3A 1GO3F 4F4WA 1X40A 2PFNA 3ED5A 3ZDCA 4K4GA 1N48A 3OTQA 2XY6A 1NI3A 3D2SA 4G3IA 4DFKA 4Y2PA 1DGSA 3SQIA 4O3RA 1KEJA 1X42A 4O3SA 4PHEA 8ICSA 5KT4A 2LYHA 2C28A 2JXJA 5G5GA 5AKEA 1YZ7A 1QQ5A 5IIOA 2FI1A 4KITB 3NGDA 3EUB2 1Q3VA 3V6HA 1QH9A 3C2LA 5CRXA 4I2JA 5KT6A 4LZGA 8ICIA 2W9MA 4ZH4A 1S0OA 1WWVA 3SEIA 4RQ5A 4ED7A 2ASLA 3ZDAA 2GO7A 2OH2A 2A19A 4US9A 5J0WA 4UQGA 4I2GA 4CGZA 2ZTEA 3M6KA 5B5EU 1JROA 2QB0A 5DB6A 3CW2C 4QWDA 2KN7A 3TADC 4C7ZA 8ICXA 3JPTA 5KG6A 4DL5A 2C2RA 3NVZA 2R8GA 4NJ8A 2FLNA 4KLJA 4C8MA 4NM1A 1ZRMA 4C4TA 1NJZA 8ICTA 2R8KA 4M9LA 1TV9A 3RJKA 2LHTA 2EDUA 2VJ5A 5GTHU 4F4XA 4CF4A 2MSNA 4DFPA 2PI4A 2XGQA 2YMLA 5C5JA 3QEBZ 2LI6A 1ZQIA 5KFNA 2FJ6A 5KFAA 5J2JA 1BPZA 1J97A 4NY8A 2R18A 1NJWA 2BPGA 2DWQA 5ALDA 5J29A 2JEJA 2RP5A 3H8JA 4UASA 5ALLA 4DL4A 1A0PA 8ICPA 2KG5A 5DGAA 1OXJA 5IIIA 1NKCA 3MGVA 2PKEA 3WK4A 2KSOB 4QJFB 1CRXA 2D6FC 3OJSA 2MA1A 3H0MB 4IRKA 1S0NA 3K1ZA 1SKWA 5J0SA 5J0XA 1SKSA 4ELUA 5ALWA 5AM3A 3MDCA 3F5EA 3T5LA 3AEVA 3PW5A 4IR9A 5IIJA 9ICKA 2BKEA 1T3NA 1XS9D 2W43A 5EWEA 1KFDA 1UT8A 5AM0A 4RPZA 1JXEA 1KKXA 3SI8A 3UQ0A 3GFKB 1BVSA 3ETLA 2XGPA 5C0YA 1IIPA 4US8A 2IHMA 1U9LA 4EEYA 7ICIA 5J0QA 2AGQA 5KT7A 2FDRA 2KVSA 3NASA 4RNMA 4DFDA 2GH1A 4NLBA 5KFDA 5KFLA 5BOLA 1SGGA 4QZGA 4KLLA 1ZQQA 1PK1B 1Z3EB 2PFOA 4J9QA 2C2DA 3B0YA 2W55A 4O5EA 3PW4A 9ICFA 5B66U 1N2XA 5K4LA 3G6VA 2DL0A 3RJIA 2DGZA 3QZ7A 5AI8A 3N4MB 3ZI4A 2OCEA 2EH9A 3Q8QB 4PL1A 1NKBA 1X9WA 1ZD4A 4X5VA 2KJ8A 3T5JA 4MEYA 3QUQA 4GC6A 1ZQPA 5F3XB 9ICUA 4B9LA 4CF5A 1IV8A 3WU2U 2HHUA 4IRDA 5J2IA 4RT3A 1TK0A 5KG1A 1T3QA 3RBEA 4RZRA 4YXJA 1FO4A 2PFQA 2D8CA 2BCUA 4O3NA 1COKA 5BOMA 5AI4A 2VKQA 3PW7A 1PZNA 2DQNB 1TAMA 2W9BA 4YD2A 1X66A 5JUMA 1SV4A 5J2BA 2WF6A 4M9NA 3Q8SB 2I1QA 2ZTDA 4RUAA 4F5PA 5AHXA 2HOQA 5ALJA 4DEZA 5KG0A 1AQ6A 3CNHA 5CB1A 2P66A 3PY8A 2K8CB 3ISDA 2B21A 4F50A 9ICSA 1J2MA 4QW8A 1BPBA 5DB8A 5J2DA 4ECSA 5EE1A 5ALYA 2J6TA 2W9AA 1S0MA 4GIBA 3BZCA 1U47A 1RXVA 5EE9A 2KK0A 7ICRA 3TANA 2JMGA 5DG8A 4F5NA 5DQHA 4I2FA 1BNOA 3AU2A 3ZD9A 4Y2SA 1ZQSA 2BDPA 3M9OB 2AU0A 3H0RB 4F4YA 2NRWA 5IINA 3RJGA 5ALHA 4QZHA 4R8UA 1ZQGA 4F8RA 2BR0A 3M6ZA 4JUZA 3Q8KA 1XSLA 1JRPA 1L7PA 5BPCA 5AM4A 4MF2A 3QU5A 2KE7A 2WFAA 9ICXA 3T5HA 4C8OA 4F93B 1HEKA 1NK0A 3F2CA 4KX3A 2K8BB 1ZOLA 3H0LB 4OJPA 1KLNA 5AIAA 3IDWA 2ISOA 3E2EA 9ICWA 2JHDA 2BHNA 3SV3A 4QIWC 4RPXA 4BWMA 4P0QA 1NJYA 2VIXA 4NLCA 3PW0A 2XVTA 3M8SA 2WHEA 4UW9A 5AIBA 5JRTA 4DQRA 1X2IA 2XICA 3MR3A 3PX6A 4B9MA 1RYUA 2JZBB 5KT5A 3LWMA 5KG5A 5EWGA 4CNQA 4RT2A 5DB7A 8ICQA 4ED1A 4NLZA 4DQSA 1UA0A 3E58A 8ICUA 3M7DA 2KHVA 4QW9A 4KLUA 3TFSA 2HOIA 4Y2RA 5AK5A 4GXKA 4M6WA 2N1RA 4JV1A 3PR5B 2FPMA 4Q44A 4FS1A 1KFTA 3J81j 5ALFA 5J2HA 4EZ9A 1S97A 1VLBA 3JPOA 2LBOA 2O6KA 4DSJA 3WKBA 2F1HA 2PFPA 1ZD3A 3MR6A 2CN1A 4JWMA 2B6GA 3LVWA 4TURA 4F5QA 2KV2A 4IQTA 8ICJA 2K4IA 5AKJA 2WF5A 4Y2VA 5D4BA 3V7LA 4RPYA 3LWLA 2W8LA 4EYIB 4ECRA 2ESEA 3HPOA 9ICQA 9ICIA 9ICTA 2KEYA 3JPRA 2KIWA 4C4SA 3HILA 3UQ2A 5ALGA 1Q46A 2PMZC 3HWTA 3QUTA 3QU4A 4TQRA 4M2YA 2IBKA 2EZYA 3PNCA 3QEAZ 2JR5A 2AHOB 3RTVA 4DLEA 4FZNA 3F2BA 2BQRA 2ZIUB 4DSKA 4J9OA 3B0XA 2ZIXA 5L1JA 2HDOA 1F44A 4QNLA 2BPFA 5AM5A 4RQ7A 3NVWA 4YQWA 2IA6A 4R65A 2NRTA 3BS7A 3C23A 5F9NA 2P35A 5KFHA 1N5WA 1L5UA 3GIMA 5AKHA 4DOCA 1V85A 2FMSA 1ZQFA 4DL6A 2VA8A 4TUPA 3QU2A 5EE3A 2D3DA 1K1SA 5J0UA 5HMMA 5J2GA 3HRDD 4YMMA 3IG8A 3PVXA 2RHFA 8ICEA 4UB2A 1KSPA 5J8YA 4OJLA 3TQ1A 4F2RA 2G09A 3HP6A 4GLXA 3AL0B 5HR7A 2ATLA 5DBAA 3F2DA 1NK7A 1LKYB 2JEGA 1A76A 1KTQA 3TACB 3V72A 2MU2A 2RDIA 2ZXIA 2KFZA 3B9JA 5CA7A 1DK2A 1WYGA 1NK8A 8ICMA 4Y2JA 2W04A 3MFIA 4F4ZA 1ZYQA 1IG6A 1B22A 4YCXA 3F53A 4UAYA 5J2KA 3G6XA 8ICRA 3C28A 4YXMA 4NLKA 4C80A 3LDAA 9ICCA 2GLEA 5HHIA 1MQ3A 4J9NA 4KTQA 4P0PA 5ALMA 1O08A 3RB3A 2XC9A 1KW4A 3SV4A 3N7PD 1ZQBA 2KFNA 2FPKA 3HKZC 4Z6EA 2E8MA 3NUQA 2OWOA 4I29A 3Q8RB 1MQ2A 2HHTA 5CJ7A 5DQGA 4EZ6A 2NO4A 4QIWF 3PX0A 4FFDA 3SMVA 2Y9UA 2ZIVA 1B0XA 4AYBF 4O5CA 1JALA 2CRXA 2K60A 3C21A 2E8NA 3TAPA 3WKAA 3A0HU 3C5GA 1PVQA 3RJEA 2HW3A 4MFCA 5GTIU 1SB3C 1QSLA 2QB0B 1V97A 2FLLA 1RXWA 4KLGA 4C7YA 4F2SA 1ZQUA 3M9MB 9ICPA 2WAQC 5AKZA 3PR4A 5J8YC 4Z6DA 9ICGA 4RU9A 3LVVA 5KFCA 5DB9A 3NRWA 5KFQA 4UB5A 4B9NA 1ZQCA 1L6NA 1JI7A 1QSSA 1ZQJA 4QZIA 4RQ0A 3QUBA 7ICLA 4AP9A 1MSWD 2Y1JA 2HVHA 4I28A 1KFSA 1ZQWA 3MGIA 3FAHA 1ZD2P 5KAFU 3VCBA 2BPCA 3KZIU 5ALUA 3SAGA 2BDUA 4Y2TA 3EYZA 3ORYA 1KBUA 8ICWA 5ALQA 3IV6A 3BQ2A 2ISPA 2H3QA 2PMZF 1NOMA 4DQIA 2G08A 8ICNA 1N62A 5DBBA 1RDFA 1DK3A 4DFMA 4PH5A 1PK3A 1BPXA 4CRXA 4I2AA 4RNNA 3D2QA 3RF9A 2RLTA 4LZDA 3FDSA 5D46A 3MR5A 5F9LA 4UARA 3UXNA 3A0BU 1PVRA 4B6JA 1ZQAA 3L3FX 1MC8A 4B9VA 3ZDBA 8ICYA 4NXZA 1MN8A 1WG8A 4LJXA 2AGPA 3OPXA 3GIJA 4J9RA 5AM2A 2F3NA 1B4FA 4JB3A 3OHAA 1ZQTA 4ECWA 4R64A 3ZDDA 5AKGA 3NVYA 3DDHA 3PSPA 4OD0A 4QZBA 4WJ3B 2Q4TA 5ALNA 3Q8PB 2HSZA 1RZTA 3WKCA 4BXOA 4UB4A 3KD3A 4MFFA 1BPYA 1RYSA 7ICJA 5DKWA 2HBKA 3JPQA 2FE9A 5AI9A 3PSIA 3WKDA 2WF7A 1NKEA 2W03A 4EBDA 3UPQA 4MEXA 4QZAA 5D49A 3GILA 2XCAA 3UMBA 2BGWA 2OYYA 4NLNA 1ZQRA 1XSPA 2ZTCA 2W3SA 3BZKA 2V4QA 2LYAA 1F5SA 3GU3A 2HHXA 2IOFK 3C29A 2HCFA 3FM9A 2K4PA 4RQMA 9ICNA 4P4MA 5AM1A 4K4HA 3BQTA 1ZQYA 2W9BB 3AM9A 4ECUA 3OGUA 4QWBA 2KOBA 5CWRA 2VJ4A 1XSNA 2IHNA 1BNPA 1JIHA 2YY6A 2W7PA 9ICBA 1JMSA 1Z4NA 4IL6U 4Q43A 1ZD5A 1RPLA 2AH5A 3BQ7A 2YMPA 4FBTA 2EANA 2P6RA 3M1YA 4EELA 3UMGA 2AJQA 3KHGA 3HT3A 1XC9A 3L5KA 1FEZA 1QQ7A 2WAQF 3V7JA 7ICSA 1S9FA 3EW9A 2XCPA 2WB1C 2YMQA 4EBEA 3RJHA 4YMOA 2FMPA 3BDPA 4XUSA 4P4PA 4ECXA 1KRPA 3IG5A 5EE0A 1TAQA 5KFSA 5AI6A 4XRHA 4KMUA 2W9CA 4DWIA 4Q8EA 4U6PA 7ICTA 3V7KA 1SIJA 3ZDEA 1KL9A 4JWNA 1ZQZA 3DV9A 2P6UA 2ZIWA 5KFWA 5A0LA 4R8UB 4KLFA 5ALKA 1NZPA 3H8WA 5TISU 5KG2A 4EX7A 2A3VA 3KHHA 3PW2A 4DSLA 1ZQXA 5HR6A 3RB0A 3MDAA 4NV0A 1IM4A 4Y2UA 1L8OA 9ICAA 1KN5A 2GOLA 3MC1A 4KLIA 1WWUA 2UVUA 2ZUCA 1SL0A 2NRXA 1N5XA 4TUSA 4PHAA 2YQEA 3H4BA 1BPDA 3QUCA 4J9KA 2ZJ8A 4RQ3A 4P0QB 4JV2A 1ZQEA 2HBJA 4UATA 1D9DA 2H3VA 1T94A 2NV3A 3K4GA 4I2EA 1X9XA 2EAOA 4DF8A 1T8EA 2XI9A 1RG6A 3QYPA 4F71A 4U7CA 4ACOA 4DCCA 2PI5A 4QZEA 2E5SA 2W11A 4DOBA 2EAPA 1RQLA 2KICA 5AK4A 2K4EA 2L5YA 4C8KA 4F92B 2C22A 4UAVA 1A6SA 4HYKA 1S8OA 4M6WB 5AK6A 2CPRA 2G06A 4R66A 1JX4A 9ICVA 2NRVA 1U48A 3OJUA 4OJ6A 1CI4A 1T7PA 1SL2A 2BCQA 9ICOA 2H3FA 3PSTA 4YR2A 1JN3A 1UA1A 4CCHA 2DFLA 7ICFA 3WK7A 2CXYA 5IIMA 4KLQA 3PMNA 4KX5A 4PL2A 3ETRA 2UVVA 3D6JA 2W7OA 1L7NA 3AQFA 3RJJA 3RB6A 3WKEA 2XY7A 1XNSA 9ICHA 1D8BA 2KMDA 2BCRA 3OSPA 1SZPA 1X6IA 4O3QA 5KG4A 2Q0ZX 4KLTA 4P2HA 3HX0A 5KFGA 2KVCA 4DO9A 4NL9A 1HUZA 2YN4A 4CE6A 4F5RA 4XQ8A 3GZFA 4J9LA 2ZUBA 2K8AA 4Z6FA 5KAIU 2DUYA 3BJYA 3Q8MA 3EPIA 1VJ5A 2ALZA 1TFRA 2I6XA 8ICZA 3K75D 3U26A 5AKXA 3GIIA 2F44A 7ICUA 3KHRA 5EOZA 1BGXT 3HJEA 2HHSA 3M8RA 2ZIXB 2HOFA 4BGDA 1ZQMA 5KFZA 2DPJA 3C5FA 7ICVA 2W8KA 3I76A 4ELVA 9ICRA 5KFMA 5ALVA 2DPIA 1PUZA 1C20A 2HBMA 3ZD8A 3WK8A 4YVZA 4B9TA 3S6JA 5ALSA 4F4KA 4KLOA 2KP7A 1Z00A 5ALTA 4GFJA 2M0NA 4O3MA 3NVVA 4DFJA 4A8EA 4ED0A 1M6YA 3PSFA 1A77A 2YB4A 2E8PA 4EX6A 1TKDA 4UAZA 4ED3A 5KFYA 2WF9A 1ZQHA 4C4RA 3ICXA 5L1MA 3IRUA 1ZQOA 5EWFA 2V9WA 2V4RA 4E0DA 2XIDA 1Z1VA 2YB1A 2WB1F 1S0VA 3OHBA 3GV7B 5DLFA 8ICOA 2YMMA 1QCKA 2HHWA 5KNIA 7ICQA 1J2NA 7ICGA 2MUTA 2FPLA 4B9UA 5ALRA 4NL9C 4BJQA 4YD1A 3CRXA 4UBCA 4DOAA 1DOQA 3SD7A 4DS5A 8ICCA 3TARA 2NYVA 4FO6A 1L8LA 1UPHA 4GXJA 4P0PB 1CEZA 4QWEA 3IN5A 2DBYA 4QZ8A 4J9MA 3QU7A 5DLGA 2KZ3A 2LM1A 5J0RA 4QZDA 3OSNA 4ED6A 2YX8A 5J0PA 3KZXA 2NRZA 3CP8A 1TVAA 3LK9A 5G5HA 2K4HA 2QARA 4RQ6A 2J6SA 1B43A 2IMWP 2ZIVB 1XO1A 8ICGA 2BQ3A 4DSEA 2JGAA 4C8LA 3IHQB 4FZLA 4KN7A 4YP3A 1TK8A 4JK1A 1L3SA 1UT5A 2KKVA 4RUCA 7ICOA 2ASJA 4OJ5A 4Q8FA 5KG7A 4NM2A 1CUKA 4YN4A 3MR2A 1LV5A 2I5HA 2QKQA 4IC9A 2I9GA 4USAA 4PHDA 3JPSA 8ICAA 3JPNA 5KT3A 3TI0A 2KJ9A 2KZZA 3C1YA 5H2FU 4MFAA 1RQNA 2BCVA 3RH4A 3I28A 5HMLA 2NO5A 4QWAA 1O03A 5HNKA 1L3VA 4QZFA 2DKZA 1HUOA 4FZMA 1OUQA 5J2EA 5KL8B 2BCSA 4O0IA 3G6YA 4O9MA 4DSFA 4F72A 3MABA 3V6KA 5IIKA 1DGJA 1JUDA 4Z6CA 4RQ2A 3F5AA 5KG3A 1RYRA 1ED1A 4I2IA 3TFRA 1WUDA 5CEHA 4M04A 1XWLA 1OW5A 4PGYA 1TE2A 4R63A 3WK6A 4JV0A 1N56A 4IQWA 4OCZA 2IOHA 2VANA 4P4OA 2H3IA 4QZ9A 3MBYA 1Q8KA 3NS1A 4JMUA 2KZMA 4BUGA 4Y2YA 5KL1B 4DF4A 1K1QA 4PJ0U 4YMNA 3O0FA 4NWIA 2KJ5A 3WK5A 3T79A 4DLGA 3FC4A 3KKAA 8ICBA 3AMZA 4K4IA 2WTFA 3KBBA 5KFIA 1YZ6A 5IILA 1T4GA 5ALOA 3AQEA 3RBDA 1U45A 2C2EA 4OJOA 4RQ4A 3Q8LA 1ZQKA 3RJFA 1LB2B 4DQPA 2KSOA 1HIWA 3R9KA 1COOA 3RAXA 5TZVA 4ECTA 4ECVA 2PXIA 2KIVA 1P7DA 2ZXHA 4I2HA 3BQ0A 4PGQA 2K89A 2JH7A 4KLDA 1S77D 4J9SA 4C8NA 1UHUA 4NLGA 3C2KA 2JRZA 5AICA 5DQIA 5J0TA 1TK5A 4BXOB 2A1JB 5DGBA 4O5KA 1X9SA 1NJXA 5FP0A 5KFUA 5KFFA 3EPGA 3H40A 2E8OA 2A1JA 3T5KA 7ICPA 2BQUA 2DF4B 2Y0SC 3PMLA 3C1ZA 5L9XA 8ICKA 2F77X 7ICMA 3IP4B 1LVHA 4IQUA 1VDVA 3MFHA 1FIQA 1ZQVA 4PPXA 5L1LA 3SAHA 2J6UA 2F1IA 2ZJAA 1L7OA 5DG7A 1NK6A 5J2AA 4BWJA 3WK9A 4FE3A 3JPPA 4TQSA 3MGHA 1SWVA 3PX4A 1PK1A 3PO4A 1S10A 3KKAC 1ZXIA 4DL3A 2LYBA 2EAMA 4PHPA 3HW8A 2H5XA 8ICFA 2AQ4A 1JXLA 1H38A 3HKZF 4Q45A 1XO0A 2XY5A 3N7SC 1NZBA 1NNLA 3BQ1A 1X6JA 5DG9A 3E0FA 1BPEA 5T14A 1ZQ1C 3ISBA 4ICAA 2JH1A 5KT2A 2XO7A 1L3TA 4M9JA 3ISCA 1D9FA 3UXPA 5KTQA 2KHQA 2ZJ5A 5KFTA 5ALZA 5AKYA 3SYZA 3RR7A 1FFVA 1NK4A 4ELTA 4F5OA 3KTQA 2OM6A 3GDXA 3PO5A 3SAFA 2KKPA 9ICEA 7ICKA 5J2CA 5DDMA 2F8LA 1L7MA 2W9CB 4YR3A 4F3OA 7ICHA 3PV8A 5KFRA 3K1RB 2UVWA 4XA5A 1ZJNA 2ZIWB 1V9PA 3IM1A 4O3PA 4G9BA 2EQYA 3RRHA 4I2CA 2HHVA 4DL2A 2QLTA 4DL7A 9ICMA 4UB6U 3N97B 1WCNA 1MA7A 1ZRNA 2OXOA 3LYSA 1ZQLA 4HAIA 2VA3A 2KD1A 3RH6A 8ICLA 3KOOA 3KFUF 5DBCA 3I1YA 4QWCA 7ICEA 3CYMA 4ZOHC 4MF8A 2JEFA 4DSIA 5J0OA 3FYHA 4Y2QA 5KFJA 5AKLA 2G5IB 2LKYA 3GV8B 2E1FA 4UAWA 2G07A 3AUOA 3N28A 4OO1J 4FBUA 4GXIA 4MHVA 1DRGA 4KLMA 5ALIA 4PZOA 2BZFA 7ICNA 5E79U 1K5OA 4RQ8A 4RNOA 4M47A 1Q3UA 3NTUA 3SR6A 5KFBA 2GWSA 1UCVA 1URJA 2JEIA 4EYHB 4KLEA 2G0AA 5KFEA 1SWWA 3NRZA 1SXEA 1NK5A 3ALRA 1QSYA 2LM4A 4ECQA 2MRLA 5L1IA 2B0CA 3RRGA 3THVA 1ZETA 5AK3A 2HBLA 4DS4A 5L1KA 2JV3A 1IXRA 3RH5A 2AQ0A 3H4DA 2HMXA 2OEHA 1Z1BA 3N7RC 4J9PA 4AYBC 4FS2A 5CP2A 1TAUA 4EBCA 4IQVA 5JU5A 3RFAA 4BDPA 1ECWA 5JTIA 3C2MA 3QZ8A 4YFKA 4KN4A 1WCLA 3M9NB 2R8IA 2JZBA 2H3ZA 3DEEA 3PZPA 5CHGA 4KLSA 1KDHA 3H7IA 2F8KA 1S5LU 4J03A 2Y9TA 2KTQA 2HHQA 3TKAA 5KFKA 1V38A 4RQNA 2Y0SF 1KQQA 4UB1A 4CDGA 3QX7A 2MAXA 4DQQA 2RQ5A 3T3FA 3SZ2A 2W54A 4C0ZA 2ASDA 1ZQNA 4IRCA 9ICLA 3UM9A 1PVPA 1U49A 1N60A 5DDYA 2HVIA 9ICJA 1N63A 1FFUA 1QLNA 2LPEA 3AU6A 1Z19A 1RM6C 2R8JA 1D8LA 8ICHA 1DXSA 4KLHA 2A1AA 2ZG6A 3GQCA 5KFXA 3KHLA 1SL1A 3GIKA 1AROP 4M0AA 2EZXA 3H8SA 5ALXA 1SV0A 3D2NA 1ZQDA 4IR1A 2FLPA 1QQ6A 1D8YA 3H8MA 1ZJMA 4PZNA 5KFVA 2KNJA 1EXNA 4UBBA 2VA2A 1Z00B 2YTUA 2M9NA 4ECYA 1SZHA 2ODGA 3VC8A 4F91B 2AXTU 1HJPA
chains in the Genus database with same CATH topology
2WB1F 2W04A 2HBKA 2ZXHA 3MGVA 2K89A 2HMXA 2JH7A 4QJFB 2OM6A 1Z1BA 3N7RC 3SQIA 4AYBC 3F53A 2KEYA 2KKPA 2ZIWA 3PSIA 3SAFA 4KX5A 2D6FC 2KIWA 1HEKA 4KMOB 2W03A 5A0LA 2MA1A 3H0MB 4PL2A 3RFAA 2F8LA 4FZMA 3C28A 3SAGA 1OUQA 2W7OA 2PMZC 5KL8B 1ECWA 3F2CA 3K1ZA 3AQFA 2A3VA 4KX3A 2BDUA 2K8BB 3H0LB 5HR6A 4OJPA 2ZIUA 1KBUA 4NV0A 4P0PA 1XNSA 4BJQA 3CRXA 1D8BA 3F5EA 2GOLA 1Q3VA 2JHDA 3ONNA 2H3ZA 2DF4B 2H3QA 2Y0SC 2PMZF 2ZIWB 3DEEA 4QIWC 3N7PD 3PZPA 2OYYA 3F5AA 4P0QA 1ED1A 2Z7JA 2VIXA 3HKZC 4NLCA 2F77X 5CRXA 1WUDA 2G08A 2VKQA 2KVCA 2XVTA 3NUQA 3IP4B 2DQNB 1TAMA 1UPHA 4FZNA 3F2BA 4P0PB 2LYAA 2ZIUB 3GZFA 2OH2A 2XICA 2Y0SF 2K8AA 3GU3A 4QIWF 3IN5A 3C29A 4CDGA 4CGZA 1MA7A 3SAHA 5C0YA 1IIPA 2OXOA 3LYSA 3SMVA 1P7DA 3M6KA 4CRXA 2ZIXA 2ZIVA 4P0QB 2KD1A 2HOQA 2HBJA 4AYBF 3D2QA 3KFUF 2K8CB 1F44A 2H3VA 4C0ZA 1T94A 3RF9A 2CRXA 2YX8A 4FE3A 4QNLA 2H3IA 2NV3A 3KZXA 3CP8A 2RRDA 4JMUA 2KOBA 3CYMA 2VJ4A 2XI9A 4BUGA 2W7PA 4BX9C 1PVPA 1PVQA 2LYBA 3M7DA 2K4HA 1PVRA 2GH1A 5KL1B 4U7CA 4NLBA 2G5HB 2G5IB 2KHVA 2ZIXB 2LKYA 2ZIVB 2HOFA 2HOIA 4ACOA 2E1FA 2JGAA 3L3FX 2G07A 2LHTA 2VJ5A 3O0FA 2E5SA 4NWIA 2KJ5A 2N1RA 3HKZF 3T79A 1XO0A 4OO1J 2JMGA 4FZLA 1Z19A 3N7SC 1DRGA 1NZBA 2WAQC 2KICA 2K4EA 2HBMA 3OPXA 3LVVA 1Q3UA 2KKVA 3NRWA 2ZG6A 3E0FA 2E1EA 1CRXA 4OJ5A 1URJA 1A6SA 3AQEA 4GFJA 2M0NA 4O3MA 3IG8A 4OJOA 4A8EA 2G0AA 2WAQF 1L6NA 3H0RB 2CPRA 2G06A 2LBOA 2RHFA 3PSFA 5T14A 2R18A 1ZQ1C 2YB4A 3PSPA 4IC9A 4ICAA 2DGZA 1HIWA 2JH1A 4OJLA 3D2NA 2CN1A 4WJ3B 2G09A 2Q4TA 2RP5A 2WB1C 3LVWA 3ALRA 3AL0B 2F2AB 5HR7A 2F76X 3ICXA 2KJ9A 2KV2A 1YT3A 1GO3F 3M6ZA 2MRLA 2KHQA 1A0PA 2KNJA 4OJ6A 3F2DA 3IG5A 2K4IA 2XIDA 2ZXIA 2HBLA 2H3FA 4PL1A 3VCBA 3PSTA 1SZHA 3VC8A 4U6PA 2KJ8A 3D2SA 2YB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED1 A;  4JMU A;  2HMX A;  1A6S A;  2LYB A;  2K4H A;  1L6N A;  1TAM A;  1UPH A;  1HEK A;  2LYA A;  4IC9 A;  4ICA A;  1HIW A;  1ECW A;  2N1R A;  2JMG A;  2K4E A;  2K4I A;  2GOL A;  2H3V A;  2H3F A;  2H3Z A;  2H3Q A;  2H3I A;  2NV3 A; 
#chains in the Genus database with same CATH topology
 2UVR A;  2EZZ A;  4IS7 A;  5HP4 A;  4ED2 A;  4KMO B;  3QXG A;  3V6J A;  1F0M A;  3EZ5 A;  5ALP A;  1SKR A;  5ALE A;  4LVS A;  2LMR A;  3GV5 B;  2W3R A;  2ZIU A;  5HHH A;  5CR0 A;  1X9M A;  4YG2 A;  4O3O A;  4EEK A;  3ONN A;  2ZUD A;  4M9G A;  2R8H A;  2DKX A;  2IOF A;  2ES6 A;  5AKI A;  5J0Y A;  1QTM A;  2Z7J A;  4ECZ A;  3L4P A;  4I2B A;  2MUT B;  2Y1I A;  8ICV A;  2RDJ A;  2FMQ A;  2WF8 A;  3BS5 B;  1XU4 A;  1Y88 A;  1C7Y A;  1SXD A;  3RAQ A;  2F1J A;  2QB1 A;  4EEN A;  5J2F A;  3BS5 A;  2RRD A;  5KFP A;  4I2D A;  4ED8 A;  2AGO A;  4BX9 C;  4I27 A;  5KFO A;  4YR0 A;  2G5H B;  5AI5 A;  3TAD A;  5AI0 A;  3RB4 A;  4UB8 U;  4Y2X A;  3UXO A;  5AKK A;  3RR8 A;  4UAU A;  4GC7 A;  4QZC A;  1NK9 A;  3AN1 A;  1Z4O A;  4TUQ A;  4B9S A;  1SV0 C;  1UQV A;  3QNM A;  2QAR B;  3UMC A;  4RQ1 A;  3SEN A;  1LKY A;  2E1E A;  2OHF A;  3EWA A;  2E3T A;  1U4B A;  1N61 A;  3QE9 Y;  4CF3 A;  4M9H A;  4PGX A;  2HI0 A;  3QU9 A;  4UB3 A;  1L3U A;  2F2A B;  2F76 X;  3TAQ A;  1S76 D;  1YT3 A;  1GO3 F;  4F4W A;  1X40 A;  2PFN A;  3ED5 A;  3ZDC A;  4K4G A;  1N48 A;  3OTQ A;  2XY6 A;  1NI3 A;  3D2S A;  4G3I A;  4DFK A;  4Y2P A;  1DGS A;  3SQI A;  4O3R A;  1KEJ A;  1X42 A;  4O3S A;  4PHE A;  8ICS A;  5KT4 A;  2LYH A;  2C28 A;  2JXJ A;  5G5G A;  5AKE A;  1YZ7 A;  1QQ5 A;  5IIO A;  2FI1 A;  4KIT B;  3NGD A;  3EUB 2;  1Q3V A;  3V6H A;  1QH9 A;  3C2L A;  5CRX A;  4I2J A;  5KT6 A;  4LZG A;  8ICI A;  2W9M A;  4ZH4 A;  1S0O A;  1WWV A;  3SEI A;  4RQ5 A;  4ED7 A;  2ASL A;  3ZDA A;  2GO7 A;  2OH2 A;  2A19 A;  4US9 A;  5J0W A;  4UQG A;  4I2G A;  4CGZ A;  2ZTE A;  3M6K A;  5B5E U;  1JRO A;  2QB0 A;  5DB6 A;  3CW2 C;  4QWD A;  2KN7 A;  3TAD C;  4C7Z A;  8ICX A;  3JPT A;  5KG6 A;  4DL5 A;  2C2R A;  3NVZ A;  2R8G A;  4NJ8 A;  2FLN A;  4KLJ A;  4C8M A;  4NM1 A;  1ZRM A;  4C4T A;  1NJZ A;  8ICT A;  2R8K A;  4M9L A;  1TV9 A;  3RJK A;  2LHT A;  2EDU A;  2VJ5 A;  5GTH U;  4F4X A;  4CF4 A;  2MSN A;  4DFP A;  2PI4 A;  2XGQ A;  2YML A;  5C5J A;  3QEB Z;  2LI6 A;  1ZQI A;  5KFN A;  2FJ6 A;  5KFA A;  5J2J A;  1BPZ A;  1J97 A;  4NY8 A;  2R18 A;  1NJW A;  2BPG A;  2DWQ A;  5ALD A;  5J29 A;  2JEJ A;  2RP5 A;  3H8J A;  4UAS A;  5ALL A;  4DL4 A;  1A0P A;  8ICP A;  2KG5 A;  5DGA A;  1OXJ A;  5III A;  1NKC A;  3MGV A;  2PKE A;  3WK4 A;  2KSO B;  4QJF B;  1CRX A;  2D6F C;  3OJS A;  2MA1 A;  3H0M B;  4IRK A;  1S0N A;  3K1Z A;  1SKW A;  5J0S A;  5J0X A;  1SKS A;  4ELU A;  5ALW A;  5AM3 A;  3MDC A;  3F5E A;  3T5L A;  3AEV A;  3PW5 A;  4IR9 A;  5IIJ A;  9ICK A;  2BKE A;  1T3N A;  1XS9 D;  2W43 A;  5EWE A;  1KFD A;  1UT8 A;  5AM0 A;  4RPZ A;  1JXE A;  1KKX A;  3SI8 A;  3UQ0 A;  3GFK B;  1BVS A;  3ETL A;  2XGP A;  5C0Y A;  1IIP A;  4US8 A;  2IHM A;  1U9L A;  4EEY A;  7ICI A;  5J0Q A;  2AGQ A;  5KT7 A;  2FDR A;  2KVS A;  3NAS A;  4RNM A;  4DFD A;  2GH1 A;  4NLB A;  5KFD A;  5KFL A;  5BOL A;  1SGG A;  4QZG A;  4KLL A;  1ZQQ A;  1PK1 B;  1Z3E B;  2PFO A;  4J9Q A;  2C2D A;  3B0Y A;  2W55 A;  4O5E A;  3PW4 A;  9ICF A;  5B66 U;  1N2X A;  5K4L A;  3G6V A;  2DL0 A;  3RJI A;  2DGZ A;  3QZ7 A;  5AI8 A;  3N4M B;  3ZI4 A;  2OCE A;  2EH9 A;  3Q8Q B;  4PL1 A;  1NKB A;  1X9W A;  1ZD4 A;  4X5V A;  2KJ8 A;  3T5J A;  4MEY A;  3QUQ A;  4GC6 A;  1ZQP A;  5F3X B;  9ICU A;  4B9L A;  4CF5 A;  1IV8 A;  3WU2 U;  2HHU A;  4IRD A;  5J2I A;  4RT3 A;  1TK0 A;  5KG1 A;  1T3Q A;  3RBE A;  4RZR A;  4YXJ A;  1FO4 A;  2PFQ A;  2D8C A;  2BCU A;  4O3N A;  1COK A;  5BOM A;  5AI4 A;  2VKQ A;  3PW7 A;  1PZN A;  2DQN B;  1TAM A;  2W9B A;  4YD2 A;  1X66 A;  5JUM A;  1SV4 A;  5J2B A;  2WF6 A;  4M9N A;  3Q8S B;  2I1Q A;  2ZTD A;  4RUA A;  4F5P A;  5AHX A;  2HOQ A;  5ALJ A;  4DEZ A;  5KG0 A;  1AQ6 A;  3CNH A;  5CB1 A;  2P66 A;  3PY8 A;  2K8C B;  3ISD A;  2B21 A;  4F50 A;  9ICS A;  1J2M A;  4QW8 A;  1BPB A;  5DB8 A;  5J2D A;  4ECS A;  5EE1 A;  5ALY A;  2J6T A;  2W9A A;  1S0M A;  4GIB A;  3BZC A;  1U47 A;  1RXV A;  5EE9 A;  2KK0 A;  7ICR A;  3TAN A;  2JMG A;  5DG8 A;  4F5N A;  5DQH A;  4I2F A;  1BNO A;  3AU2 A;  3ZD9 A;  4Y2S A;  1ZQS A;  2BDP A;  3M9O B;  2AU0 A;  3H0R B;  4F4Y A;  2NRW A;  5IIN A;  3RJG A;  5ALH A;  4QZH A;  4R8U A;  1ZQG A;  4F8R A;  2BR0 A;  3M6Z A;  4JUZ A;  3Q8K A;  1XSL A;  1JRP A;  1L7P A;  5BPC A;  5AM4 A;  4MF2 A;  3QU5 A;  2KE7 A;  2WFA A;  9ICX A;  3T5H A;  4C8O A;  4F93 B;  1HEK A;  1NK0 A;  3F2C A;  4KX3 A;  2K8B B;  1ZOL A;  3H0L B;  4OJP A;  1KLN A;  5AIA A;  3IDW A;  2ISO A;  3E2E A;  9ICW A;  2JHD A;  2BHN A;  3SV3 A;  4QIW C;  4RPX A;  4BWM A;  4P0Q A;  1NJY A;  2VIX A;  4NLC A;  3PW0 A;  2XVT A;  3M8S A;  2WHE A;  4UW9 A;  5AIB A;  5JRT A;  4DQR A;  1X2I A;  2XIC A;  3MR3 A;  3PX6 A;  4B9M A;  1RYU A;  2JZB B;  5KT5 A;  3LWM A;  5KG5 A;  5EWG A;  4CNQ A;  4RT2 A;  5DB7 A;  8ICQ A;  4ED1 A;  4NLZ A;  4DQS A;  1UA0 A;  3E58 A;  8ICU A;  3M7D A;  2KHV A;  4QW9 A;  4KLU A;  3TFS A;  2HOI A;  4Y2R A;  5AK5 A;  4GXK A;  4M6W A;  2N1R A;  4JV1 A;  3PR5 B;  2FPM A;  4Q44 A;  4FS1 A;  1KFT A;  3J81 j;  5ALF A;  5J2H A;  4EZ9 A;  1S97 A;  1VLB A;  3JPO A;  2LBO A;  2O6K A;  4DSJ A;  3WKB A;  2F1H A;  2PFP A;  1ZD3 A;  3MR6 A;  2CN1 A;  4JWM A;  2B6G A;  3LVW A;  4TUR A;  4F5Q A;  2KV2 A;  4IQT A;  8ICJ A;  2K4I A;  5AKJ A;  2WF5 A;  4Y2V A;  5D4B A;  3V7L A;  4RPY A;  3LWL A;  2W8L A;  4EYI B;  4ECR A;  2ESE A;  3HPO A;  9ICQ A;  9ICI A;  9ICT A;  2KEY A;  3JPR A;  2KIW A;  4C4S A;  3HIL A;  3UQ2 A;  5ALG A;  1Q46 A;  2PMZ C;  3HWT A;  3QUT A;  3QU4 A;  4TQR A;  4M2Y A;  2IBK A;  2EZY A;  3PNC A;  3QEA Z;  2JR5 A;  2AHO B;  3RTV A;  4DLE A;  4FZN A;  3F2B A;  2BQR A;  2ZIU B;  4DSK A;  4J9O A;  3B0X A;  2ZIX A;  5L1J A;  2HDO A;  1F44 A;  4QNL A;  2BPF A;  5AM5 A;  4RQ7 A;  3NVW A;  4YQW A;  2IA6 A;  4R65 A;  2NRT A;  3BS7 A;  3C23 A;  5F9N A;  2P35 A;  5KFH A;  1N5W A;  1L5U A;  3GIM A;  5AKH A;  4DOC A;  1V85 A;  2FMS A;  1ZQF A;  4DL6 A;  2VA8 A;  4TUP A;  3QU2 A;  5EE3 A;  2D3D A;  1K1S A;  5J0U A;  5HMM A;  5J2G A;  3HRD D;  4YMM A;  3IG8 A;  3PVX A;  2RHF A;  8ICE A;  4UB2 A;  1KSP A;  5J8Y A;  4OJL A;  3TQ1 A;  4F2R A;  2G09 A;  3HP6 A;  4GLX A;  3AL0 B;  5HR7 A;  2ATL A;  5DBA A;  3F2D A;  1NK7 A;  1LKY B;  2JEG A;  1A76 A;  1KTQ A;  3TAC B;  3V72 A;  2MU2 A;  2RDI A;  2ZXI A;  2KFZ A;  3B9J A;  5CA7 A;  1DK2 A;  1WYG A;  1NK8 A;  8ICM A;  4Y2J A;  2W04 A;  3MFI A;  4F4Z A;  1ZYQ A;  1IG6 A;  1B22 A;  4YCX A;  3F53 A;  4UAY A;  5J2K A;  3G6X A;  8ICR A;  3C28 A;  4YXM A;  4NLK A;  4C80 A;  3LDA A;  9ICC A;  2GLE A;  5HHI A;  1MQ3 A;  4J9N A;  4KTQ A;  4P0P A;  5ALM A;  1O08 A;  3RB3 A;  2XC9 A;  1KW4 A;  3SV4 A;  3N7P D;  1ZQB A;  2KFN A;  2FPK A;  3HKZ C;  4Z6E A;  2E8M A;  3NUQ A;  2OWO A;  4I29 A;  3Q8R B;  1MQ2 A;  2HHT A;  5CJ7 A;  5DQG A;  4EZ6 A;  2NO4 A;  4QIW F;  3PX0 A;  4FFD A;  3SMV A;  2Y9U A;  2ZIV A;  1B0X A;  4AYB F;  4O5C A;  1JAL A;  2CRX A;  2K60 A;  3C21 A;  2E8N A;  3TAP A;  3WKA A;  3A0H U;  3C5G A;  1PVQ A;  3RJE A;  2HW3 A;  4MFC A;  5GTI U;  1SB3 C;  1QSL A;  2QB0 B;  1V97 A;  2FLL A;  1RXW A;  4KLG A;  4C7Y A;  4F2S A;  1ZQU A;  3M9M B;  9ICP A;  2WAQ C;  5AKZ A;  3PR4 A;  5J8Y C;  4Z6D A;  9ICG A;  4RU9 A;  3LVV A;  5KFC A;  5DB9 A;  3NRW A;  5KFQ A;  4UB5 A;  4B9N A;  1ZQC A;  1L6N A;  1JI7 A;  1QSS A;  1ZQJ A;  4QZI A;  4RQ0 A;  3QUB A;  7ICL A;  4AP9 A;  1MSW D;  2Y1J A;  2HVH A;  4I28 A;  1KFS A;  1ZQW A;  3MGI A;  3FAH A;  1ZD2 P;  5KAF U;  3VCB A;  2BPC A;  3KZI U;  5ALU A;  3SAG A;  2BDU A;  4Y2T A;  3EYZ A;  3ORY A;  1KBU A;  8ICW A;  5ALQ A;  3IV6 A;  3BQ2 A;  2ISP A;  2H3Q A;  2PMZ F;  1NOM A;  4DQI A;  2G08 A;  8ICN A;  1N62 A;  5DBB A;  1RDF A;  1DK3 A;  4DFM A;  4PH5 A;  1PK3 A;  1BPX A;  4CRX A;  4I2A A;  4RNN A;  3D2Q A;  3RF9 A;  2RLT A;  4LZD A;  3FDS A;  5D46 A;  3MR5 A;  5F9L A;  4UAR A;  3UXN A;  3A0B U;  1PVR A;  4B6J A;  1ZQA A;  3L3F X;  1MC8 A;  4B9V A;  3ZDB A;  8ICY A;  4NXZ A;  1MN8 A;  1WG8 A;  4LJX A;  2AGP A;  3OPX A;  3GIJ A;  4J9R A;  5AM2 A;  2F3N A;  1B4F A;  4JB3 A;  3OHA A;  1ZQT A;  4ECW A;  4R64 A;  3ZDD A;  5AKG A;  3NVY A;  3DDH A;  3PSP A;  4OD0 A;  4QZB A;  4WJ3 B;  2Q4T A;  5ALN A;  3Q8P B;  2HSZ A;  1RZT A;  3WKC A;  4BXO A;  4UB4 A;  3KD3 A;  4MFF A;  1BPY A;  1RYS A;  7ICJ A;  5DKW A;  2HBK A;  3JPQ A;  2FE9 A;  5AI9 A;  3PSI A;  3WKD A;  2WF7 A;  1NKE A;  2W03 A;  4EBD A;  3UPQ A;  4MEX A;  4QZA A;  5D49 A;  3GIL A;  2XCA A;  3UMB A;  2BGW A;  2OYY A;  4NLN A;  1ZQR A;  1XSP A;  2ZTC A;  2W3S A;  3BZK A;  2V4Q A;  2LYA A;  1F5S A;  3GU3 A;  2HHX A;  2IOF K;  3C29 A;  2HCF A;  3FM9 A;  2K4P A;  4RQM A;  9ICN A;  4P4M A;  5AM1 A;  4K4H A;  3BQT A;  1ZQY A;  2W9B B;  3AM9 A;  4ECU A;  3OGU A;  4QWB A;  2KOB A;  5CWR A;  2VJ4 A;  1XSN A;  2IHN A;  1BNP A;  1JIH A;  2YY6 A;  2W7P A;  9ICB A;  1JMS A;  1Z4N A;  4IL6 U;  4Q43 A;  1ZD5 A;  1RPL A;  2AH5 A;  3BQ7 A;  2YMP A;  4FBT A;  2EAN A;  2P6R A;  3M1Y A;  4EEL A;  3UMG A;  2AJQ A;  3KHG A;  3HT3 A;  1XC9 A;  3L5K A;  1FEZ A;  1QQ7 A;  2WAQ F;  3V7J A;  7ICS A;  1S9F A;  3EW9 A;  2XCP A;  2WB1 C;  2YMQ A;  4EBE A;  3RJH A;  4YMO A;  2FMP A;  3BDP A;  4XUS A;  4P4P A;  4ECX A;  1KRP A;  3IG5 A;  5EE0 A;  1TAQ A;  5KFS A;  5AI6 A;  4XRH A;  4KMU A;  2W9C A;  4DWI A;  4Q8E A;  4U6P A;  7ICT A;  3V7K A;  1SIJ A;  3ZDE A;  1KL9 A;  4JWN A;  1ZQZ A;  3DV9 A;  2P6U A;  2ZIW A;  5KFW A;  5A0L A;  4R8U B;  4KLF A;  5ALK A;  1NZP A;  3H8W A;  5TIS U;  5KG2 A;  4EX7 A;  2A3V A;  3KHH A;  3PW2 A;  4DSL A;  1ZQX A;  5HR6 A;  3RB0 A;  3MDA A;  4NV0 A;  1IM4 A;  4Y2U A;  1L8O A;  9ICA A;  1KN5 A;  2GOL A;  3MC1 A;  4KLI A;  1WWU A;  2UVU A;  2ZUC A;  1SL0 A;  2NRX A;  1N5X A;  4TUS A;  4PHA A;  2YQE A;  3H4B A;  1BPD A;  3QUC A;  4J9K A;  2ZJ8 A;  4RQ3 A;  4P0Q B;  4JV2 A;  1ZQE A;  2HBJ A;  4UAT A;  1D9D A;  2H3V A;  1T94 A;  2NV3 A;  3K4G A;  4I2E A;  1X9X A;  2EAO A;  4DF8 A;  1T8E A;  2XI9 A;  1RG6 A;  3QYP A;  4F71 A;  4U7C A;  4ACO A;  4DCC A;  2PI5 A;  4QZE A;  2E5S A;  2W11 A;  4DOB A;  2EAP A;  1RQL A;  2KIC A;  5AK4 A;  2K4E A;  2L5Y A;  4C8K A;  4F92 B;  2C22 A;  4UAV A;  1A6S A;  4HYK A;  1S8O A;  4M6W B;  5AK6 A;  2CPR A;  2G06 A;  4R66 A;  1JX4 A;  9ICV A;  2NRV A;  1U48 A;  3OJU A;  4OJ6 A;  1CI4 A;  1T7P A;  1SL2 A;  2BCQ A;  9ICO A;  2H3F A;  3PST A;  4YR2 A;  1JN3 A;  1UA1 A;  4CCH A;  2DFL A;  7ICF A;  3WK7 A;  2CXY A;  5IIM A;  4KLQ A;  3PMN A;  4KX5 A;  4PL2 A;  3ETR A;  2UVV A;  3D6J A;  2W7O A;  1L7N A;  3AQF A;  3RJJ A;  3RB6 A;  3WKE A;  2XY7 A;  1XNS A;  9ICH A;  1D8B A;  2KMD A;  2BCR A;  3OSP A;  1SZP A;  1X6I A;  4O3Q A;  5KG4 A;  2Q0Z X;  4KLT A;  4P2H A;  3HX0 A;  5KFG A;  2KVC A;  4DO9 A;  4NL9 A;  1HUZ A;  2YN4 A;  4CE6 A;  4F5R A;  4XQ8 A;  3GZF A;  4J9L A;  2ZUB A;  2K8A A;  4Z6F A;  5KAI U;  2DUY A;  3BJY A;  3Q8M A;  3EPI A;  1VJ5 A;  2ALZ A;  1TFR A;  2I6X A;  8ICZ A;  3K75 D;  3U26 A;  5AKX A;  3GII A;  2F44 A;  7ICU A;  3KHR A;  5EOZ A;  1BGX T;  3HJE A;  2HHS A;  3M8R A;  2ZIX B;  2HOF A;  4BGD A;  1ZQM A;  5KFZ A;  2DPJ A;  3C5F A;  7ICV A;  2W8K A;  3I76 A;  4ELV A;  9ICR A;  5KFM A;  5ALV A;  2DPI A;  1PUZ A;  1C20 A;  2HBM A;  3ZD8 A;  3WK8 A;  4YVZ A;  4B9T A;  3S6J A;  5ALS A;  4F4K A;  4KLO A;  2KP7 A;  1Z00 A;  5ALT A;  4GFJ A;  2M0N A;  4O3M A;  3NVV A;  4DFJ A;  4A8E A;  4ED0 A;  1M6Y A;  3PSF A;  1A77 A;  2YB4 A;  2E8P A;  4EX6 A;  1TKD A;  4UAZ A;  4ED3 A;  5KFY A;  2WF9 A;  1ZQH A;  4C4R A;  3ICX A;  5L1M A;  3IRU A;  1ZQO A;  5EWF A;  2V9W A;  2V4R A;  4E0D A;  2XID A;  1Z1V A;  2YB1 A;  2WB1 F;  1S0V A;  3OHB A;  3GV7 B;  5DLF A;  8ICO A;  2YMM A;  1QCK A;  2HHW A;  5KNI A;  7ICQ A;  1J2N A;  7ICG A;  2MUT A;  2FPL A;  4B9U A;  5ALR A;  4NL9 C;  4BJQ A;  4YD1 A;  3CRX A;  4UBC A;  4DOA A;  1DOQ A;  3SD7 A;  4DS5 A;  8ICC A;  3TAR A;  2NYV A;  4FO6 A;  1L8L A;  1UPH A;  4GXJ A;  4P0P B;  1CEZ A;  4QWE A;  3IN5 A;  2DBY A;  4QZ8 A;  4J9M A;  3QU7 A;  5DLG A;  2KZ3 A;  2LM1 A;  5J0R A;  4QZD A;  3OSN A;  4ED6 A;  2YX8 A;  5J0P A;  3KZX A;  2NRZ A;  3CP8 A;  1TVA A;  3LK9 A;  5G5H A;  2K4H A;  2QAR A;  4RQ6 A;  2J6S A;  1B43 A;  2IMW P;  2ZIV B;  1XO1 A;  8ICG A;  2BQ3 A;  4DSE A;  2JGA A;  4C8L A;  3IHQ B;  4FZL A;  4KN7 A;  4YP3 A;  1TK8 A;  4JK1 A;  1L3S A;  1UT5 A;  2KKV A;  4RUC A;  7ICO A;  2ASJ A;  4OJ5 A;  4Q8F A;  5KG7 A;  4NM2 A;  1CUK A;  4YN4 A;  3MR2 A;  1LV5 A;  2I5H A;  2QKQ A;  4IC9 A;  2I9G A;  4USA A;  4PHD A;  3JPS A;  8ICA A;  3JPN A;  5KT3 A;  3TI0 A;  2KJ9 A;  2KZZ A;  3C1Y A;  5H2F U;  4MFA A;  1RQN A;  2BCV A;  3RH4 A;  3I28 A;  5HML A;  2NO5 A;  4QWA A;  1O03 A;  5HNK A;  1L3V A;  4QZF A;  2DKZ A;  1HUO A;  4FZM A;  1OUQ A;  5J2E A;  5KL8 B;  2BCS A;  4O0I A;  3G6Y A;  4O9M A;  4DSF A;  4F72 A;  3MAB A;  3V6K A;  5IIK A;  1DGJ A;  1JUD A;  4Z6C A;  4RQ2 A;  3F5A A;  5KG3 A;  1RYR A;  1ED1 A;  4I2I A;  3TFR A;  1WUD A;  5CEH A;  4M04 A;  1XWL A;  1OW5 A;  4PGY A;  1TE2 A;  4R63 A;  3WK6 A;  4JV0 A;  1N56 A;  4IQW A;  4OCZ A;  2IOH A;  2VAN A;  4P4O A;  2H3I A;  4QZ9 A;  3MBY A;  1Q8K A;  3NS1 A;  4JMU A;  2KZM A;  4BUG A;  4Y2Y A;  5KL1 B;  4DF4 A;  1K1Q A;  4PJ0 U;  4YMN A;  3O0F A;  4NWI A;  2KJ5 A;  3WK5 A;  3T79 A;  4DLG A;  3FC4 A;  3KKA A;  8ICB A;  3AMZ A;  4K4I A;  2WTF A;  3KBB A;  5KFI A;  1YZ6 A;  5IIL A;  1T4G A;  5ALO A;  3AQE A;  3RBD A;  1U45 A;  2C2E A;  4OJO A;  4RQ4 A;  3Q8L A;  1ZQK A;  3RJF A;  1LB2 B;  4DQP A;  2KSO A;  1HIW A;  3R9K A;  1COO A;  3RAX A;  5TZV A;  4ECT A;  4ECV A;  2PXI A;  2KIV A;  1P7D A;  2ZXH A;  4I2H A;  3BQ0 A;  4PGQ A;  2K89 A;  2JH7 A;  4KLD A;  1S77 D;  4J9S A;  4C8N A;  1UHU A;  4NLG A;  3C2K A;  2JRZ A;  5AIC A;  5DQI A;  5J0T A;  1TK5 A;  4BXO B;  2A1J B;  5DGB A;  4O5K A;  1X9S A;  1NJX A;  5FP0 A;  5KFU A;  5KFF A;  3EPG A;  3H40 A;  2E8O A;  2A1J A;  3T5K A;  7ICP A;  2BQU A;  2DF4 B;  2Y0S C;  3PML A;  3C1Z A;  5L9X A;  8ICK A;  2F77 X;  7ICM A;  3IP4 B;  1LVH A;  4IQU A;  1VDV A;  3MFH A;  1FIQ A;  1ZQV A;  4PPX A;  5L1L A;  3SAH A;  2J6U A;  2F1I A;  2ZJA A;  1L7O A;  5DG7 A;  1NK6 A;  5J2A A;  4BWJ A;  3WK9 A;  4FE3 A;  3JPP A;  4TQS A;  3MGH A;  1SWV A;  3PX4 A;  1PK1 A;  3PO4 A;  1S10 A;  3KKA C;  1ZXI A;  4DL3 A;  2LYB A;  2EAM A;  4PHP A;  3HW8 A;  2H5X A;  8ICF A;  2AQ4 A;  1JXL A;  1H38 A;  3HKZ F;  4Q45 A;  1XO0 A;  2XY5 A;  3N7S C;  1NZB A;  1NNL A;  3BQ1 A;  1X6J A;  5DG9 A;  3E0F A;  1BPE A;  5T14 A;  1ZQ1 C;  3ISB A;  4ICA A;  2JH1 A;  5KT2 A;  2XO7 A;  1L3T A;  4M9J A;  3ISC A;  1D9F A;  3UXP A;  5KTQ A;  2KHQ A;  2ZJ5 A;  5KFT A;  5ALZ A;  5AKY A;  3SYZ A;  3RR7 A;  1FFV A;  1NK4 A;  4ELT A;  4F5O A;  3KTQ A;  2OM6 A;  3GDX A;  3PO5 A;  3SAF A;  2KKP A;  9ICE A;  7ICK A;  5J2C A;  5DDM A;  2F8L A;  1L7M A;  2W9C B;  4YR3 A;  4F3O A;  7ICH A;  3PV8 A;  5KFR A;  3K1R B;  2UVW A;  4XA5 A;  1ZJN A;  2ZIW B;  1V9P A;  3IM1 A;  4O3P A;  4G9B A;  2EQY A;  3RRH A;  4I2C A;  2HHV A;  4DL2 A;  2QLT A;  4DL7 A;  9ICM A;  4UB6 U;  3N97 B;  1WCN A;  1MA7 A;  1ZRN A;  2OXO A;  3LYS A;  1ZQL A;  4HAI A;  2VA3 A;  2KD1 A;  3RH6 A;  8ICL A;  3KOO A;  3KFU F;  5DBC A;  3I1Y A;  4QWC A;  7ICE A;  3CYM A;  4ZOH C;  4MF8 A;  2JEF A;  4DSI A;  5J0O A;  3FYH A;  4Y2Q A;  5KFJ A;  5AKL A;  2G5I B;  2LKY A;  3GV8 B;  2E1F A;  4UAW A;  2G07 A;  3AUO A;  3N28 A;  4OO1 J;  4FBU A;  4GXI A;  4MHV A;  1DRG A;  4KLM A;  5ALI A;  4PZO A;  2BZF A;  7ICN A;  5E79 U;  1K5O A;  4RQ8 A;  4RNO A;  4M47 A;  1Q3U A;  3NTU A;  3SR6 A;  5KFB A;  2GWS A;  1UCV A;  1URJ A;  2JEI A;  4EYH B;  4KLE A;  2G0A A;  5KFE A;  1SWW A;  3NRZ A;  1SXE A;  1NK5 A;  3ALR A;  1QSY A;  2LM4 A;  4ECQ A;  2MRL A;  5L1I A;  2B0C A;  3RRG A;  3THV A;  1ZET A;  5AK3 A;  2HBL A;  4DS4 A;  5L1K A;  2JV3 A;  1IXR A;  3RH5 A;  2AQ0 A;  3H4D A;  2HMX A;  2OEH A;  1Z1B A;  3N7R C;  4J9P A;  4AYB C;  4FS2 A;  5CP2 A;  1TAU A;  4EBC A;  4IQV A;  5JU5 A;  3RFA A;  4BDP A;  1ECW A;  5JTI A;  3C2M A;  3QZ8 A;  4YFK A;  4KN4 A;  1WCL A;  3M9N B;  2R8I A;  2JZB A;  2H3Z A;  3DEE A;  3PZP A;  5CHG A;  4KLS A;  1KDH A;  3H7I A;  2F8K A;  1S5L U;  4J03 A;  2Y9T A;  2KTQ A;  2HHQ A;  3TKA A;  5KFK A;  1V38 A;  4RQN A;  2Y0S F;  1KQQ A;  4UB1 A;  4CDG A;  3QX7 A;  2MAX A;  4DQQ A;  2RQ5 A;  3T3F A;  3SZ2 A;  2W54 A;  4C0Z A;  2ASD A;  1ZQN A;  4IRC A;  9ICL A;  3UM9 A;  1PVP A;  1U49 A;  1N60 A;  5DDY A;  2HVI A;  9ICJ A;  1N63 A;  1FFU A;  1QLN A;  2LPE A;  3AU6 A;  1Z19 A;  1RM6 C;  2R8J A;  1D8L A;  8ICH A;  1DXS A;  4KLH A;  2A1A A;  2ZG6 A;  3GQC A;  5KFX A;  3KHL A;  1SL1 A;  3GIK A;  1ARO P;  4M0A A;  2EZX A;  3H8S A;  5ALX A;  1SV0 A;  3D2N A;  1ZQD A;  4IR1 A;  2FLP A;  1QQ6 A;  1D8Y A;  3H8M A;  1ZJM A;  4PZN A;  5KFV A;  2KNJ A;  1EXN A;  4UBB A;  2VA2 A;  1Z00 B;  2YTU A;  2M9N A;  4ECY A;  1SZH A;  2ODG A;  3VC8 A;  4F91 B;  2AXT U;  1HJP A; 
#chains in the Genus database with same CATH homology
 2WB1 F;  2W04 A;  2HBK A;  2ZXH A;  3MGV A;  2K89 A;  2HMX A;  2JH7 A;  4QJF B;  2OM6 A;  1Z1B A;  3N7R C;  3SQI A;  4AYB C;  3F53 A;  2KEY A;  2KKP A;  2ZIW A;  3PSI A;  3SAF A;  4KX5 A;  2D6F C;  2KIW A;  1HEK A;  4KMO B;  2W03 A;  5A0L A;  2MA1 A;  3H0M B;  4PL2 A;  3RFA A;  2F8L A;  4FZM A;  3C28 A;  3SAG A;  1OUQ A;  2W7O A;  2PMZ C;  5KL8 B;  1ECW A;  3F2C A;  3K1Z A;  3AQF A;  2A3V A;  4KX3 A;  2BDU A;  2K8B B;  3H0L B;  5HR6 A;  4OJP A;  2ZIU A;  1KBU A;  4NV0 A;  4P0P A;  1XNS A;  4BJQ A;  3CRX A;  1D8B A;  3F5E A;  2GOL A;  1Q3V A;  2JHD A;  3ONN A;  2H3Z A;  2DF4 B;  2H3Q A;  2Y0S C;  2PMZ F;  2ZIW B;  3DEE A;  4QIW C;  3N7P D;  3PZP A;  2OYY A;  3F5A A;  4P0Q A;  1ED1 A;  2Z7J A;  2VIX A;  3HKZ C;  4NLC A;  2F77 X;  5CRX A;  1WUD A;  2G08 A;  2VKQ A;  2KVC A;  2XVT A;  3NUQ A;  3IP4 B;  2DQN B;  1TAM A;  1UPH A;  4FZN A;  3F2B A;  4P0P B;  2LYA A;  2ZIU B;  3GZF A;  2OH2 A;  2XIC A;  2Y0S F;  2K8A A;  3GU3 A;  4QIW F;  3IN5 A;  3C29 A;  4CDG A;  4CGZ A;  1MA7 A;  3SAH A;  5C0Y A;  1IIP A;  2OXO A;  3LYS A;  3SMV A;  1P7D A;  3M6K A;  4CRX A;  2ZIX A;  2ZIV A;  4P0Q B;  2KD1 A;  2HOQ A;  2HBJ A;  4AYB F;  3D2Q A;  3KFU F;  2K8C B;  1F44 A;  2H3V A;  4C0Z A;  1T94 A;  3RF9 A;  2CRX A;  2YX8 A;  4FE3 A;  4QNL A;  2H3I A;  2NV3 A;  3KZX A;  3CP8 A;  2RRD A;  4JMU A;  2KOB A;  3CYM A;  2VJ4 A;  2XI9 A;  4BUG A;  2W7P A;  4BX9 C;  1PVP A;  1PVQ A;  2LYB A;  3M7D A;  2K4H A;  1PVR A;  2GH1 A;  5KL1 B;  4U7C A;  4NLB A;  2G5H B;  2G5I B;  2KHV A;  2ZIX B;  2LKY A;  2ZIV B;  2HOF A;  2HOI A;  4ACO A;  2E1F A;  2JGA A;  3L3F X;  2G07 A;  2LHT A;  2VJ5 A;  3O0F A;  2E5S A;  4NWI A;  2KJ5 A;  2N1R A;  3HKZ F;  3T79 A;  1XO0 A;  4OO1 J;  2JMG A;  4FZL A;  1Z19 A;  3N7S C;  1DRG A;  1NZB A;  2WAQ C;  2KIC A;  2K4E A;  2HBM A;  3OPX A;  3LVV A;  1Q3U A;  2KKV A;  3NRW A;  2ZG6 A;  3E0F A;  2E1E A;  1CRX A;  4OJ5 A;  1URJ A;  1A6S A;  3AQE A;  4GFJ A;  2M0N A;  4O3M A;  3IG8 A;  4OJO A;  4A8E A;  2G0A A;  2WAQ F;  1L6N A;  3H0R B;  2CPR A;  2G06 A;  2LBO A;  2RHF A;  3PSF A;  5T14 A;  2R18 A;  1ZQ1 C;  2YB4 A;  3PSP A;  4IC9 A;  4ICA A;  2DGZ A;  1HIW A;  2JH1 A;  4OJL A;  3D2N A;  2CN1 A;  4WJ3 B;  2G09 A;  2Q4T A;  2RP5 A;  2WB1 C;  3LVW A;  3ALR A;  3AL0 B;  2F2A B;  5HR7 A;  2F76 X;  3ICX A;  2KJ9 A;  2KV2 A;  1YT3 A;  1GO3 F;  3M6Z A;  2MRL A;  2KHQ A;  1A0P A;  2KNJ A;  4OJ6 A;  3F2D A;  3IG5 A;  2K4I A;  2XID A;  2ZXI A;  2HBL A;  2H3F A;  4PL1 A;  3VCB A;  3PST A;  1SZH A;  3VC8 A;  4U6P A;  2KJ8 A;  3D2S A;  2YB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...