2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1531
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
5C44G 1K83H 1MIUA 1OXTA 2K14A 3E9HA 4DPGA 1N34Q 1KD1C 1JE5A 1T9HA 1IBMQ 4OWXB 1PH8A 1BBWA 1UE5A 1L1OC 2ZJQA 2IHEA 3S1QH 4IFDJ 1Q12A 3CCUA 4LF6L 2C35B 3JAMc 2Q2HA 1VQ6A 4YWLA 3BJUA 3T1HQ 1A0IA 2F4VQ 4A3KH 4L5RC 1I94L 1G6PA 1WJJA 3K7AH 3GTOH 4LUVA 4B3RL 1M90C 1KIXA 4LFBQ 4DKAC 2KHIA 4GN4B 4DUZL 5FLXc 2UUBQ 4LF9Q 2XGTA 3M3YH 3KDFA 3GDEA 4GKKL 4OWTB 5GAEC 1N9WA 4BY7G 4DV7L 2QA4A 4GOPB 1XMQQ 3CMEA 2ZTEA 3F8TA 3PIOA 4C2MH 1YBYA 1TWAH 2CWPA 2K50A 4NXNL 3FKIG 4R4OA 2K52A 4BA1I 1N36L 1HR0W 1HZBA 2AHOB 5C3EH 4DV5Q 4JI2L 2VNUD 2OCEA 3CMAA 3CCMA 4DV0Q 4R4IA 2UXDL 1Y1WH 4X62L 2VQFQ 3PIPA 4A3BH 2E8GA 1X54A 1HR0Q 4DR4Q 1IBKQ 4IPHA 1NMGA 3T1YQ 3A74A 1GD7A 1LYLA 1OXUA 1V43A 3CCQA 1PH5A 3OW2A 1H95A 4DV1Q 1XPRA 3VDYA 1NY4A 3HOXH 1V1QA 1NMFA 2WB1G 2DUDA 4DUYL 2JA5G 2ASBA 5IYBH 1VQKA 2NZOA 3HOWH 3U50C 3PUWA 4R4TA 4JBKA 1IL2A 3GTGH 4C3IH 1PV4A 1J6QA 4JI3L 2IX0A 4A75A 3S1MH 1WYDA 4DK6C 5IWAQ 1HZAA 3JC66 1XNRQ 1HNXQ 4WJ3M 3CCRA 1JT8A 1Y1VG 3I4NG 4K0KL 3U58A 4A93H 2E2JH 1J5EQ 1IXRA 2KENA 5IP9H 3CXCA 4P73A 3H3VH 3S16H 4PG3A 4X64L 1KXLA 1PH7A 2ID0A 2JA6G 4L5QA 2IX1A 3BZCA 5C0XG 1PH4A 2AKWB 4YY3L 4Y52H 1RIPA 3RN5A 2AWNA 2NVXH 4BBRG 4C3JH 3KOJA 4X66Q 5C0XI 4IJLA 4A3JH 4LW1A 1QUQB 4DV3L 2WFWA 1NBWA 4JOIA 1KQSA 4FDBA 1VQAA 4IOCA 1Q1EA 2HT1A 4APVA 4R4CA 4KI0A 4YCUA 5GQOA 3AQQA 5BR8L 2VQEL 4A3EH 4DAYB 1HNWQ 4A3CG 2UUCL 1VQ4A 4JI7Q 2PI2A 2IY5B 2PQAB 1Y14B 1JMCA 2HHHL 4JI4Q 4NPSA 3UE0A 2RHSB 4POFA 3JAMi 3ICEA 4DR7L 1YJWA 2IT1A 4JI8L 2F52A 2N78A 1WCMH 5IYCH 2R92H 1KRSA 2E2HH 1S3OA 1B7YB 4NB3A 4DV6L 4DR5Q 1IYJB 4GNXC 3HOVH 3PUYA 1EQQA 4OONA 1YHAA 4RG1A 4B3TL 4DV4L 2VZAA 4A3KG 1L2FA 1EOVA 2OQ0A 4LF8L 1R9TH 3GTLH 4QGUA 1KAWA 2ZJPA 1QZHA 1L1OB 1PYBA 1I5FA 1YIJA 3I4NH 3NBHB 3CC7A 3OYYA 1MJEA 4HJ9A 1PH3A 1X3FA 1GO3E 2D0OA 3K7UC 4DR3L 3J81c 3KFUA 2KHJA 2YTVA 3AFQA 2B63H 1Z9FA 5C3EG 4HJ8A 2EDUA 1I3QH 1TWFH 1YZ6A 4P74A 4GOPA 2B3GA 1Y1WG 4LFAQ 4DNIA 4XTCS 1S72A 3M7NA 4A3BG 1W3SA 2GN5A 1PH1A 1PVOA 2OTLA 3Q8DA 4L5SA 4O0AA 2UU9Q 5M5WH 2KCMA 3G48A 2QEXA 2NVQH 4JCVE 4DV2L 3S17H 4LF4L 1WOCA 4P71A 5JEAJ 1GM5A 3S2DH 1E22A 2QGQA 5IYBG 4QY7A 3PCOB 3HOWG 4BBSH 1OXXK 1VQBA 4X6AH 5AJ3L 1N8RC 1LUZA 4A76A 1U0LA 3M85A 2UUAL 1AH9A 4LF6Q 3U4VA 3K81C 2Y0SG 1OXVA 3S2HH 2R93G 1E7ZA 1Q8KA 2Z6KA 4O2DA 2I5HA 3ULPA 4A93G 4ALPA 2D0PA 4Y7NH 4IFDG 2K5NA 3TQYA 1N32L 4UP7A 1I94Q 4A3GH 5IP9G 3KLWA 4B3RQ 1MKHA 4JI0L 3PO3H 1XNQL 4JI5L 4YHHL 4DUZQ 3I2ZA 3H3VI 1C9OA 1JJCB 3PGZA 4DR2L 4IO9A 4DV7Q 2Y0SE 5M3FH 4IPCA 2E5LL 4HJAA 5FLMH 3G6EA 4A3JG 2ZTCA 3K0XA 3GTQH 3CW2C 4NXNQ 1YJ9A 1N36Q 1Q46A 4JI2Q 5FJ8H 5HGQA 1A8VA 2UXDQ 2CQOA 4TQUS 1VQHA 4X62Q 4A3EG 4QIWE 4DR1L 2HQLA 4IPGA 1QUQA 2N8NA 1YI2A 3EBEA 1QVGA 3DLLA 2I0QA 4JBMA 3HKZG 4P72A 3B6YA 4DUYQ 1YJNA 5IYCG 3I4OA 1WCMG 3HFZB 1SE8A 3KF8B 5LMUL 2D62A 2HIXA 2R92G 4MNOA 3W1GA 1HNZL 1ASYA 3HOVG 2PQAA 4JI3Q 3ER0A 1C7YA 3LGJA 4POGA 1SROA 3M4PA 5ELNA 4BXXH 3RLNA 3M4QA 4A3MH 4K0KQ 2UUBL 2JA7H 2YTXA 4B3SL 4LF5L 3MEFA 3STBD 1VQNA 4JI1L 5C4XH 5JJIA 2V1CC 3A5ZB 3G71A 3S1RH 4KHPL 2BA0A 3EIVA 5M3MG 2R93H 1HJPA 1K9MC 4X64Q 3H15A 4EQ5A 4PMWA 2UXBL 4QQBX 2WAQG 3GO5A 4BY1H 4LUZA 1A62A 2WB1E 1PYSB 4YY3Q 5LMNW 1QVCA 2MQHA 5IE8A 1B8AA 1FL0A 1L1OA 2Q2IA 2Q2TA 3E0EA 4A3LH 1LM0A 2B63G 2VW9A 4DV3Q 3J80c 3FHWA 3T1YL 1D7QA 2LSSA 3KF6B 2LXKA 1N33L 1XTDA 1G51A 4AQYQ 3I4MH 2WAQE 3L7ZC 2BH8A 5BR8Q 2VQEQ 5LMNL 1IZ6A 4HJ5A 1GKHA 2H5XA 1ASZA 1UE7A 4A3FH 1YHQA 2CFMA 4R1JA 4AIMA 4HIKA 1VQ8A 1K8AC 1X9NA 4DK3C 2HHHQ 1XPUA 3PO2H 5GROA 4IPDA 4BBSG 2VY3A 4JI8Q 4DR7Q 1A63A 2R7ZH 4AH6A 1AE2A 1KHIA 5IWAL 3RZOH 4PZ7A 4LUOA 4XIGS 4DV6Q 1VQFA 1VQCA 4RMFA 4AYBG 2MO0A 3D31A 1CKNA 3KYHC 2NVTH 4GLAC 2OWOA 4B3TQ 4DV4Q 4JV5Q 2JE6I 4IOAA 4A3GG 3SGIA 1VQMA 3ZJYC 3PF5A 3OTOL 1BVSA 4C3HH 4LF8Q 1EYGA 4A3IH 3PO3G 1SFOH 1OTCA 2UXCL 5IYDH 1OXSC 1D8LA 1WI5A 2A1AA 3H0GH 3NELA 1IBLL 2E2IH 2RCNA 1E1OA 1FJGQ 5M3FG 1CUKA 1M1KC 5M5XH 4X65L 5FLMG 1W2BA 1X56A 5M3MH 4OX9L 2MO1A 2EXDA 2Z0SA 3NEMA 4DR3Q 1EFWA 1G291 1YITA 3S24A 1EQRA 5FJ8G 1QZGA 1VQPA 2LXJA 2JEBI 2NZHA 3UDFA 2WP8J 3FP9A 4A4IA 2DGYA 3F2DA 3CP0A 1VQLA 1SN8A 5M5YH 3KJOA 3TREA 4J15A 4LF7L 2BA1A 4LFCL 4DV2Q 4LF4Q 2NVYH 3ULLA 1VQ5A 3WWVA 1UE6A 5IP7H 2HIVA 1UWVA 3J81j 5JEAG 4YWKA 5AJ3Q 1NE3A 3F2CA 1KC8C 4UY8C 4JYAL 5K36G 3PUZA 2UUAQ 1XPOA 4BXXG 1CKNB 1WFQA 4A3MG 4TVAB 2JA7G 4JC0A 4QL5A 3S14H 4YCWA 2L15A 5C4XG 1Z47A 2PNHA 4H02A 4JI0Q 1X6OA 4GKJL 5ELOA 3W1BA 1XNQQ 3M4OH 2YYZA 3RN2A 3CQZH 4YHHQ 1VQ9A 4JI5Q 3PUVA 4ME3A 1XMOL 4BY1G 1I6HH 1X55A 4IJHA 2OTJA 3J80i 3A5UA 4JBWA 4DR2Q 4IFDI 1K0RA 3CC2A 3EN2A 1SRUA 2E5LQ 1RL2A 4A3LG 2MNAA 5GAGC 4GKKQ 1O7IA 3CPFA 1UEBA 5J3BA 2ZM6L 4GLXA 4PZ8A 1HZ9A 3NENA 1VQGA 2K4KA 3I4MG 4B3ML 1B70B 4HIOA 3W5OA 3GTJH 3UE1A 4DR1Q 4DR6L 1YVCA 3I7FA 1MJCA 2CKZB 2A19A 2I5MX 3CAMA 1VQJA 1TWHH 1LTLA 1YEZA 1YNXA 2ALYB 3KF6A 4A3FG 2K75A 4NXML 1AE3A 4OXPA 3PO2G 4JI6L 2AMCB 3UDXA 4OWWB 2VUMH 3CC4A 2R7ZG 5LMUQ 1Q7YC 3M9BA 1PA6A 3TS0A 1N34L 3S15H 1IBML 3HOYH 1PFSA 2NN6G 4DAMA 1HNZQ 5JJLA 4HJ7A 1PH9A 1TWGH 1VQEA 2ES2A 1SMXA 2NN6I 3HOZH 4JOIC 4A3DG 2XTIA 4UPAA 2GVAA 4KLKA 4B3SQ 4LF5Q 3T1HL 4A3IG 2K5HA 4JI1Q 2PMZE 3AFPA 2F4VL 1CSQA 1L0WA 4KHPQ 1VQ7A 5IYDG 4LFBL 2UXBQ 1VCIA 3H0GG 4R4QA 3AYHB 4LF9L 1P8LA 1DGSA 2R7FA 2JA9A 3HKZE 3RZDH 3CD6A 1E1TA 1PH2A 1TXYA 1XMQL 4LNQA 1PHJA 4GN5A 2KBNA 2R6GA 3PF4A 3J81i 2N3SA 4GNXB 2EIFA 1JB7A 1Q82C 3DM3A 1BKBA 3HOUH 3F2BA 4MZ9A 4DV5L 3TRZA 1N33Q 4DV0L 3ERSX 2CWAA 2VQFL 3GTMH 5LMNQ 1FVIA 1S40A 1HR0L 4DR4L 1IBKL 3L0OA 1Q1BA 4HIMA 2JA8G 2VS1A 2YU9H 3L2PA 3CCSA 1K8GA 4DV1L 1SR3A 1UE1A 5IP7G 1K73C 5EAYA 1V9PA 2BH2A 5C44H 2UUCQ 3S1NH 4KHZA 1EWIA 3K80C 5IT9c 3U4ZA 5DLQE 3IRBA 4EX5A 4HIDA 1C0AA 3BZKA 1XNRL 4GOPC 1HNXL 1U5KA 3KDFB 2YTYA 2RHQB 3OTOQ 1J5EL 2VL6A 3AEVA 2R7DA 5C0XJ 3RR5A 3D0FA 2UXCQ 1IBLQ 2K5VA 4A3DH 3CCVA 2ZJRA 3KJPA 3RNUA 2EQSA 4X65Q 4BY7H 4OX9Q 4X66L 1CKMA 4AQYL 3BU2A 1YHBA 1GVPA 4JG2A 4AYBE 3UDGA 4MTNA 2MFIA 2JK8A 4UP9A 3FKIH 3UDIA 1QVFA 5HY6A 1Q81C 2Z6KC 2I5LX 4PZ6A 1EUJA 3E9IA 4GN3B 1VS0A 1TWCH 4LF7Q 1NJIC 3J7ZC 4LFCQ 1HNWL 2F3IA 3HKSA 4P75A 1BBUA 3CCEA 2IHFA 3CCJA 2Q2UA 4JI7L 3RLFA 2VUMG 4JI4L 3CF5A 3PV0A 1X65A 1CKOA 1P16A 2PI2E 1E24A 4GLVB 2JA5H 3HOYG 2JA8H 1K3RA 4JYAQ 1KRTA 3I55A 4JV5L 2FXQA 3PSIA 4YWMA 2RF4A 4DR5L 1JJGA 4UP8A 1VQOA 3HOZG 3J7A5 4BA2I 4LWCA 1XJVA 3GTKH 4GS3A 3A0JA 1Y1VH 2OQKA 3MXNB 1I50H 4GKJQ 1CSPA 1FJGL 1Q86C 1VQDA 1XMOQ 1N32Q 2JEAI 2GVBA 5GADC 2ZTDA 5H1SE 1VQIA 4QJFA 2JA6H 3K8AA 4WJ4A 3STBC 2JJQA 1JJ2A 1E3PA 3TS2A 5JJKA 5IY0A 1HH2P 3I56A 3F1ZA 4BBRH 4L5TA 2B29A 1KL9A 1FGUA 1X3EA 2KCTA 3PUXA 2A8VA 3HOUG 3RLOA 4YCVA 1HZCA 2ATWA 2YV5A 3ULJA 2ZM6Q 3CPWA 2N49A 2AWOA 5C4JH 1X3GA 4JBJA 3HOXG 2JQOA 4B3MQ 4LFAL 2CCZA 1SLJA 4GNXA 4DR6Q 5E7NA 4OO1G 3GTPH 5GAHC 2UU9L 1EIYB 1NTGA 4OO1I 4A3CH 4NXMQ 3G4SA 3GD7A 1EIFA 1PH6A 3CCLA 3TEHB 4JI6Q
chains in the Genus database with same CATH superfamily
2YMPA 3ZDEA 4XYQA 2R8KA 1K83H 4F92B 1N34Q 1A3TA 3MXPA 1IBMQ 4KN7C 1L1OC 2IHEA 3SK6A 2UVVA 5KFMA 3GQBA 3PVXA 1ZQYA 1SXEA 3N7PD 4MF8A 3MFGA 2F0FA 2EYJA 4KLEA 1A0IA 5AK3A 3AQFA 4A3KH 1FIQA 2F4VQ 1M90C 3H7IA 4PZNA 4DKAC 4DUZL 1HA6A 3MGIA 4LF9Q 1GUNA 3KDFA 5KFGA 4A3MB 8ICTA 1NJWA 5CV8A 1N9WA 4BY7G 2NBFA 2EXZA 3GQCA 3HILA 2ESEA 2HOIA 1JIHA 4J1MA 4RQMA 2R93B 2BGWA 1JOKA 1FNWA 1TWAH 2CWPA 5ALXA 3FKIG 4BA1I 2EAOA 4J9LA 3WK4A 4KX3A 1HZBA 4CKBA 4DV5Q 4JI2L 4DV0Q 2HHWA 4NLGA 3EQLC 1X32A 4FBTA 4X62L 4HCEA 3PIPA 2VQFQ 4ODGA 1HR0Q 2XICA 1DOMA 4RZRA 3TAPA 1IBKQ 4H7BA 3SQIA 1LYLA 1CT1D 1PH5A 2JH7A 2F0WA 1MA7A 1ZD2P 2WIIB 4PMBA 3OW2A 1B43A 1STYA 4YR3A 2D9UA 1V1QA 5CV9A 2DUDA 2JA5G 3QO2A 2NZOA 5DQHA 2K5QA 3U50C 3J81E 9ICBA 2EAMA 3A8KE 3GTGH 2NWGA 5ALLA 2KECA 9ICAA 1J6QA 4OJLA 2KKVA 2VJ4A 1H38A 1HCZA 1S5FD 3S1MH 1WYGA 1NUCA 1WYDA 4C8LA 3H8WA 3JC66 1WTPA 3WKCA 5L1MA 4EBDA 5AKIA 4M47A 1ZQDA 3U58A 2R7ZB 4KLHA 2F76X 4CRXA 2OEHA 1SMYD 2E2JH 2PW7A 1J5EQ 2K6AA 1MC8A 5KFIA 1BNPA 2KENA 3TKAA 2BCRA 2WACA 5J0TA 4F7XA 1TY0A 4EELA 2EYHA 2W03A 4QW8A 3HPOA 2IX1A 3RR7A 5C0XG 1ZQEA 2C22A 3RN5A 2NVXH 2FMMA 3HP3A 3KOJA 2F0HA 3X3NA 4C3JH 1SYDA 5KG3A 3JAML 2AQ0A 2ZXRA 1RPLA 1Y8PB 2XI9A 3TFRA 4DV3L 5EE1A 1KQSA 4FDBA 4C8NA 4DSFA 1D1IA 4IOCA 3TMEA 2IMWP 1BF4A 3V72A 2D5DA 4L6TB 3C3LA 4F2RA 2MUTA 4R4CA 4KI0A 2IW3A 5KNBA 1HRJA 4Z6EA 5GQOA 5BR8L 4ECWA 2VQEL 4U7CA 2HBMA 4A3EH 3TADA 3BZDB 3V05A 9ICOA 1KQQA 2FMPA 1ZQMA 4JI4Q 3UE0A 5KFYA 1YJWA 2XGPA 2PCFB 2HBLA 3WKAA 2BZFA 1KRSA 5I6WA 4PV1C 1PUZA 1B7YB 1G8ZD 4NB3A 5IOCA 1N48A 3D2SA 2NVYB 2LY7A 5D3DA 3HOVH 5ALUA 4Y2YA 4RG1A 5AM4A 2VZAA 3QOJA 2H1EA 9ICTA 1EOVA 5ALHA 1TK0A 1JQYD 2LMCB 4RGOS 4XQJA 1X6JA 2RDJA 4G7ZC 5ALWA 2NZ1D 1XU4A 2E8NA 2EY5A 4KJNA 2AQ2B 3S14B 4FF3A 1U45A 4ECSA 3PQIA 1B50A 1B22A 1X3FA 5KT2A 3FM9A 3SAGA 2HVIA 1GO3E 2D0OA 2EDGA 5BN5A 2RQ5A 4YCXA 3C2MA 2FLNA 2YTVA 3J81c 2DPJA 3HZXA 4HJ8A 2B63H 1I3QH 3R2TA 5J0RA 1STBA 2B3GA 1Y1WG 1VF5C 4DNIA 1C48A 2XIDA 4EEYA 4ELTA 1PRTD 2WHEA 4A3BG 3PY8A 3NUCA 1SWVA 1SBBB 1QH9A 1Z7TA 3Q8DA 2OTLA 4O0AA 2HW3A 2QEXA 3OSNA 4F5NA 1CHPD 3S17H 2LFNA 1AROP 4P71A 3GZFA 3V96A 2A68C 5GTIU 5BN4A 1GM5A 2QGQA 4R9WA 2C2EA 3PCOB 4KKSA 2YMQA 3Q22A 5IODA 1OXXK 3RD4A 2CW0C 5J0UA 3OHAA 2J0TD 4K4HA 3M85A 4IQUA 2G07A 4UB6U 2RBMA 4LF6Q 1AH9A 2W43A 1KN5A 2Y0SG 3K81C 2R93G 1NJXA 1E7ZA 1Q8KA 1SV4A 4IFDG 4MHVA 4Y7NH 4XQ8A 4DOBA 1DOLA 4DS5A 4A3GH 5IP9G 2HBKA 1U47A 1LTTD 3ZDAA 3KLWA 4FXGC 4JI0L 4JPBW 4JI5L 4LVSA 1V8QA 3I2ZA 4NL9A 3H3VI 1EEID 1KTKA 5J0XA 1P7DA 5ALGA 3E0JA 2ASDA 4DO9A 5IGFA 1CM9A 3GV3A 1RJTA 2KOLA 3K0XA 1GJXA 3CW2C 3GIKA 3RFAA 3K0YA 3BYYB 1L3VA 1Q46A 1L3SA 2FE9A 2QKQA 2KZ3A 4F93B 1EWHA 5FJ8H 2Q4TA 3L3FX 4Q5VA 3AB9A 2MPMA 1QUQA 1F9QA 2DQNB 2W04A 3ED5A 1F0MA 5ALOA 4C4TA 4P72A 4HAIA 4J9PA 2KA7A 4DUYQ 2H4OA 3FC4A 4QF4A 1TS5A 2R92G 3GTMB 2DWQA 2HIXA 2BHNA 4QZAA 1X3PA 2N55A 5HMLA 1ASYA 2ZJ5A 4M6WB 5EBCA 4JI3Q 3U26A 1C7YA 4POGA 3M4PA 2YQEA 2X69A 2NO5A 3RLNA 4BXXH 1NKEA 4DGZA 2PI5A 4KJOA 4KK7A 4R63A 3STBD 4LF5L 4JI1L 3MR5A 4PL2A 5C4XH 3HT3A 1QQ5A 1D5ZC 3FAHA 2BA0A 1IYVA 1HJPA 3RRGA 4EQ5A 2HHQA 4QQBX 4QWAA 1A62A 5AKJA 2DPIA 2WB1E 2B0CA 1PYSB 2LM1A 3H91A 4YY3Q 5LMNW 5J2IA 4UAUA 4UBBA 1T5XD 3E0EA 1LM0A 5CBAE 4A3DB 3G6VA 2A6ED 1KSPA 2OHFA 2LXKA 3KF6B 1EWCA 1N33L 1RYRA 4AQYQ 1E0BA 4ED8A 3I4MH 2BH8A 3KBBA 1KFDA 3QX7A 1SJHD 3N6RA 4P4OA 2W7OA 3NSWA 2H5XA 1ASZA 5EPJA 5CC4A 3QZ7A 4UBCA 4KLLA 2CFMA 1X3QA 4R1JA 5AFWA 1CEZA 4HIKA 1YHQA 3PO2H 4BBSG 4IPDA 1TWCB 3TI0A 5C3XA 4DV6Q 4XIGS 4RQ8A 1VQFA 3HRZC 5ELDA 4RMFA 4E0DA 3LDAA 4F71A 2B2VA 3D31A 4OIKA 2B2WA 4GLAC 4E6IA 2OWOA 2KKPA 2DKXA 3RJFA 2KVMA 2JE6I 3QU9A 1VQMA 2VIXA 5KFEA 4LF8Q 3OTOL 1FFVA 2K33A 2RA4A 3RUZA 1J9OA 4C3HH 4I28A 1L6NA 4KLGA 3ETRA 4A3IH 4FXDA 3OJUA 4LZDA 4F4WA 3PW2A 5IYDH 4B08A 1ZOLA 4ECVA 1ICWA 2RCNA 5EE9A 7ICQA 3EFXD 4G7HC 3K5OA 1MD2D 4X65L 2J6TA 1V1PB 1X56A 5BOLA 4UAWA 5JTIA 2L12A 3MWYW 5G5HA 2EXDA 3NEMA 4J6HA 3NVZA 1EFWA 4OX9L 1YITA 1SIJA 3UXOA 4C8MA 3S24A 2PMZC 4KY7A 1VQPA 2LXJA 5KFFA 1Z1VA 2NZHA 1HHVA 1B9NA 2DGYA 1ET9A 4XQNA 4LF7L 2ZJAA 2BA1A 4LFCL 3HKZC 3FYHA 3A8IE 4YVZA 2RDGA 2F0NA 4LAAA 4QB4A 4F4YA 2JRZA 4F87A 2LPEA 3L4PA 3VR6A 2QB0B 1PK3A 2BPFA 3K6OA 5AKZA 3MHBA 3T51B 2ZIXA 5DDYA 4GXIA 1RHPA 1UWVA 5TZVA 5EGTA 5AJ3Q 4UY8C 1XO1A 4JYAL 3J80L 2B2YA 2UUAQ 4RA8A 3NPPA 1CKNB 4GC7A 3AN1A 1K83B 4M0AA 1EQTA 1L3TA 3ERQA 4QL5A 2JA7G 1X9MA 1TWHB 5HMMA 4O3MA 5L1JA 3R2IA 3VYUA 4H02A 3DHQA 5IIIA 5ELOA 5HHHA 2YTUA 4Y2XA 2YYZA 2WAQC 4NMZA 4YHHQ 3PUVA 4PJ0U 1XMOL 4J9KA 2PO4A 3BDPA 4Y2SA 4C8KA 4IFDI 2K32A 4A3KB 3CC2A 4OJ6A 1SDFA 1PVPA 2MNAA 3NVWA 2O5IC 4GKKQ 1O7IA 5COYA 1SZHA 4QZ9A 4RQ2A 4GLXA 1KRPA 1STGA 4R65A 3NENA 2LHTA 3IKJA 1B70B 3KHHA 4BGDA 3T5JA 1HTPA 3GTJH 5J2HA 3I7FA 1MJCA 1TWAB 3CAMA 2HBJA 3RBDA 1YEZA 2ALYB 2F0DA 4IUTA 1BPZA 1AE3A 2YX8A 4OXPA 1BR9A 4DL5A 2AMCB 3UDXA 3TP6A 2VUMH 3NWSA 3I90A 4F4XA 2QARA 1PTOF 3T5KA 1PA6A 1ILQA 1LT3D 3S15H 2G5IB 4F88A 4RQ7A 2B2TA 4RQ3A 1G6ZA 4ECTA 4M8AA 8ICUA 4KLUA 3J81L 2VB3X 4A3DG 3CHBD 4RKLA 2GVAA 3GTGB 4PMCA 5EPLA 3T1HL 2K5HA 1KABA 3RH5A 5KFZA 1F2MA 1I4PA 2EOTA 4KHPQ 1VQ7A 3TADC 4LFBL 3S1MB 1DD2A 1XXGA 5IIKA 2EQYA 1E2ZA 4DFAA 3HWTA 1PH2A 2KJ9A 1SYBA 3U9SA 2E2JB 5T14A 1OW5A 5J2DA 4DL6A 4LNQA 4NLNA 1NKBA 4CDDC 1B3AA 4UAZA 3PMNA 2N3SA 4GNXB 1SL1A 2KEDA 2AGOA 4BDPA 4MF2A 3HOUH 1B4FA 3F2BA 4MZ9A 5EWFA 4KN7A 3HP6A 4H0LC 3F5EA 4US8A 1TT2A 4C4SA 4C3JB 2NVXB 1TAQA 5LMNQ 1MBYA 1A6XA 3AU2A 2ZIUB 2CW0D 2F1JA 2VS1A 3CU7A 4RGMA 2EZXA 4AYBF 1HIWA 2KP7A 3J7AF 1A15A 1A3VA 3GFKB 1NK0A 5C44H 2UUCQ 4A3EB 2PKEA 3IV6A 2XY7A 3K80C 3NQIA 2KSOB 3H6MA 1K8MA 3U4ZA 5KNIA 5KT3A 3ZDBA 3IRBA 4DQIA 2YB4A 5ALQA 3BZKA 4X3UA 3SK4A 1U5KA 1D2BA 2CVRA 2V4QA 3HGBA 2JZBB 2PYKA 3HOVB 4OIJA 8ICEA 1PZKD 3A0HU 2K5VA 9ICVA 1IBLQ 4P2HA 5KNDA 2C2RA 3RNUA 2JMGA 1F2YA 4QZ8A 1VLBA 5KG2A 3KOOA 2HDLA 1I4QA 3JAME 1CKMA 2JR5A 4AQYL 3BU2A 4RHSA 4JG2A 3UDGA 2I46A 4MTNA 3DV9A 2JK8A 1QVFA 1A2TA 1QLNA 4IUUA 5HY6A 3NTKA 1Q81C 4PGYA 7ICUA 3OHBA 2A69C 1ZETA 2XY5A 1K3BC 1VS0A 1NJIC 2B63B 2ZXIA 3HKSA 5CB1A 1I3QB 5EBDA 1PFNA 4NL9C 4PHEA 1CTMA 3CF5A 1X42A 4HSPA 4IQWA 9ICUA 4GLVB 1N2XA 1KRTA 3S17B 1D5MC 5J2JA 2XGQA 3PSIA 1D9FA 2H3IA 2FXQA 2OEOA 2XSCA 2HD3A 4YWMA 1JI7A 4CGYB 3HOZG 4BA2I 2K4PA 1XJVA 3JPPA 1C8CA 2D6FC 8ICFA 1Y1VH 2VANA 2N88A 2ZXOA 2E3TA 1ZQAA 4GKJQ 1EL0A 4QZCA 5AI6A 1Q86C 1U4BA 3QUBA 3BYTB 3KTQA 3MR3A 2HHVA 3FRPB 1VQIA 4QJFA 2XVSA 3HS0C 3A0BU 2IBKA 3PR5B 1T3QA 4GXKA 2O4XA 5J1ZA 1JJ2A 3MA2B 4A3GB 5JJKA 4DF4A 4CDEC 2B29A 2A8VA 3NQTA 1SYFA 1LABA 2AWOA 1EQVA 1XSLA 1KDHA 5CP2A 1X3GA 1SLJA 3EUB2 4OO1G 3RAQA 5DLGA 3GTPH 4J03A 1NTGA 5T1IA 4A3CH 1N5XA 3G4SA 3GD7A 5AKXA 3M6ZA 4BX9C 9ICPA 3L5KA 5ALSA 1SE2A 4L63B 2K14A 4US9A 1JE5A 2K5DA 1NJYA 4OWXB 1BBWA 4WJWA 3C2LA 1CA6A 3HW8A 1Q12A 3NWTA 3I72A 2C35B 5C3WA 1TVAA 3JAMc 3JPOA 3PZPA 1JE4A 2ICEC 1M4VA 3NTHA 1EY9A 4IRDA 1WD1A 4DQRA 2WF8A 1I94L 5KFRA 1XNSA 2ODGA 3I76A 5J2EA 2KQ3A 4LUVA 5A2QL 1NK9A 2KHIA 4GN4B 3M3YH 1CZGA 2BPGA 1FNVA 3BS1A 1F2ZA 4GKKL 3OHXC 5KG5A 5KRUA 5C4XB 5DG9A 4UB4A 3ITPA 2QA4A 4RU9A 4GOPB 2OXOA 2HDMA 5CMDA 4K4IA 1GXDC 2QILA 2CH4W 1YBYA 3KBGA 4NXNL 1N36L 1HR0W 1PYWD 4RQ4A 1EY0A 2PZUA 4ICAA 3ZDCA 2B2VC 2B2WC 5C3EH 2OCEA 1NI3A 1Q90A 2I6XA 4R4IA 3CMAA 2CH4A 1WD0A 2UXDL 1N62A 4K5VA 2ZUBA 3KK7A 4IPHA 3T1YQ 3BVMA 1V43A 5L9XA 1ZQCA 1QSYA 1OXUA 5M9OA 4I2CA 2Z1CA 4DV1Q 1B3QA 1XPRA 2K4IA 5DG7A 4XRHA 4ZCKA 5BOMA 1C4QA 3HOXH 5ALZA 3KZIU 3RJKA 4BXOB 2WB1G 3I4MB 4ED3A 5IGEA 4R4TA 3W3AA 2H3ZA 4M2YA 2WF9A 3I8ZA 2JXMB 4C3IH 1TVXA 4TQRA 3C2KA 4KKUA 4ZAIA 4B9WA 3TN2A 3PO2B 1LT6D 4ZUIA 1XNRQ 1HQRD 1HZAA 4GFJA 5ALFA 3I28A 3CCRA 1HNXQ 2FI1A 4B9XA 4K0KL 4WJ3M 2Y1IA 1E2VA 5FK9C 3MEHA 3S16H 5DBCA 1NAPA 4J9QA 4OHJA 4X64L 1KXLA 1BUVT 4JVZA 5ALKA 2CRXA 4CJ1B 1EYCA 3OIPA 1EFID 1ECWA 1RIPA 2AWNA 4C3HB 4A3IB 4BBRG 1X9SA 1NNXA 1J8IA 1T4GA 2B2YC 4EX6A 3QWNA 2L5TA 1NBWA 3QIAA 5J0PA 1VQAA 1Q1EA 2F0PA 1JORA 3DWPA 3M1YA 4BWMA 4APVA 1K0SA 4YCUA 4K6LA 4DAYB 1QSSA 5FLXL 5AIBA 3VA5A 2UUCL 1VQ4A 5ELCA 5DB8A 2PI2A 3PW4A 5IIFA 3SAHA 2PQAB 1Y14B 5JVH3 4JI7Q 4POFA 2K04A 2KVCA 4J8QA 4JI8L 2F52A 3JPNA 1JWUD 1WCMH 1JALA 2N78A 5ELBA 5IYCH 4DAVA 2SOBA 5ALPA 2F0SA 5C0YA 3Q8MA 3H3VC 1S5ED 9ICFA 1HUOA 1ESFA 7ICGA 4ED0A 1JR0D 4BS9A 2XVTA 3A54A 2WF6A 4RNMA 4QIWC 2HOFA 4GC6A 1E2WA 1AFPA 2F3NA 3VA7A 1L2FA 3BVZA 2G5HB 1FGBD 3V6JA 4IQVA 1KAWA 3D2QA 1U48A 4ECUA 1U4LA 9ICCA 1L1OB 2L0CA 1TY2A 5DB6A 2IPKD 3I4NH 2FLLA 1MHWC 3NBHB 3CNHA 4CJ0B 4CF3A 2BCSA 1LLRD 3CC7A 1MJEA 1ZQTA 3BQTA 2WV6D 4HJ9A 3J7YW 1PH3A 3K75D 1GUTA 1PVRA 1PZJD 4PNYA 2B2TC 4DR3L 2K8AA 4NV0A 2KHJA 3AMZA 1SYGA 3RJHA 1TWFH 3RH4A 2E76C 4P74A 4QW9A 5DB9A 1JUDA 4I2GA 1S72A 4XTCS 1O08A 3M7NA 2GN5A 4FZLA 5T1GA 2Y0SF 3UMGA 1EU4A 1I6VC 4L5SA 2KCMA 3NHHA 2NVQH 4CF4A 4KHVA 4DV2L 4OD0A 1E22A 1B2TA 5CWRA 4P2CB 3ICXA 1SYCA 1S0OA 1H9SB 4QY7A 5IYBG 2FMCA 3GTJB 3HOWG 3TDQA 1VQBA 3BDOA 3J80E 3RBEA 4JUZA 1UCVA 3IFTA 4M6WA 3PX0A 5KG7A 1VMCA 3CRXA 3NRZA 3C5GA 1ESRA 2PFPA 2L5YA 1H9KA 3WK8A 2Z6KA 3ULPA 4A93G 3S15B 2IX3A 4UP7A 4DSJA 2E8MA 4UB2A 2G09A 5KFKA 1MKHA 3CRKC 3PO3H 4B3RQ 5EQ0A 5AIAA 2A74C 2FLPA 4F72A 3LNNA 4Y2UA 4O5CA 4DR2L 1LV9A 3TFSA 4OL7A 4DV7Q 2E5LL 2A69D 2Z8LA 5M3FH 5AK4A 5FLMH 9ICKA 4A3JG 1AW7A 2RDHA 1YJ9A 4UB5A 2AGPA 9ICWA 1ZQ1C 1KAAA 2JHDA 5JPNC 1ZKOA 5DBAA 2A73B 4C1NI 1ZYRD 5HGQA 4CJ2C 1VQHA 1L0YB 1V97A 4KMUA 4DR1L 4UDUC 1PFBA 1UQVA 4KLFA 9ICNA 3DLLA 1PFMA 2I0QA 4ED6A 3DUZA 3HOUB 1NCVA 2PPBC 2R8GA 3WU2U 1LACA 4DSKA 3I4OA 3HFZB 1BQQT 4ME5A 5KFNA 2QDBA 1PTOD 5JEAH 2D3DA 1L8LA 4UAYA 4KLIA 1HNZL 5K36H 2QKIC 3LWLA 3R3OA 3ER0A 1YZ7A 4KLJA 2F0MA 4BWGB 3GV6A 5BN3A 8ICKA 3HX0A 1EY4A 4I2IA 2OT2A 3M4QA 5C44B 3C1ZA 4FE3A 2DJGC 8ICNA 3K58A 4B3SL 3Q24A 3SK5A 4KD3A 1VQNA 5JJIA 3S1RH 3G71A 2R8IA 1AZQA 1KLGD 2H3QA 1NZBA 1A0PA 2OXPA 3P1HA 1K9MC 1L7MA 4PMWA 2UXBL 2XIWA 1K5OA 4BY1H 4H13C 4LUZA 5CA7A 5CV4A 1URJA 5IE8A 1B8AA 1FL0A 2LS01 2Q2IA 4A3LH 4EQOA 2VW9A 7ICJA 2PZTA 4QWEA 4OELB 2KV2A 5ELFA 3D3RA 3O0FA 4XYOA 4TUQA 3J80c 3T1YL 1KLUD 1WTRA 2PFNA 2KHQA 3RB0A 2LSSA 3MFIA 1UEAB 3M7GA 3SR1A 1IM4A 1AQ6A 3DEOA 5C4ZA 2WAQE 3L7ZC 2EZZA 1IZ6A 5HR6A 1BPYA 1S8OA 4K4GA 1UE7A 5AM5A 2EVBA 4A3FH 2HHHQ 1K8AC 4DK3C 4DR7Q 5GROA 1PZID 2VY3A 3WK6A 1A63A 4FS1A 8ICOA 1LTSD 4PZ7A 5I2XA 2Y0SC 2NN6H 3N4MB 2DBYA 5ALYA 4K2KA 4FFDA 1CKNA 2K4HA 1DCZA 2IWHA 3VR3A 4B3TQ 1UA1A 4DV4Q 3PX6A 2WFAA 3SGIA 4Q44A 3IRUA 4YN4A 3ZJYC 1BVSA 1O7LA 1TFRA 3E0FA 9ICSA 1AEXA 3OMGA 1ET6A 2QEJC 3BQ0A 2UXCL 1HUZA 1PTOH 1NK6A 3H0GH 3PV8A 2HCIA 2E2IH 3I3CA 1E1OA 1Y1VB 3PSTA 1DOQA 1W2BA 4O42A 3TZUA 2Z0SA 4CCHA 4QZDA 1G291 4CHTB 3QU4A 1ONLA 1JN3A 4MFFA 9ICQA 1BCPF 1EQRA 2JA6B 3EA6A 3A7AB 4R8UB 4PL1A 5IIJA 4P0PA 3FP9A 4A4IA 3PSFA 3PNCA 2G08A 3FVQA 5IGGA 2ALZA 1WVLA 3AMUA 4RGTA 7ICLA 1JC7A 1L7OA 2MU2A 1S10A 3N7RC 4LF4Q 1YNNC 3EVQA 5C5LA 5IIOA 1VQ5A 1HFGA 1STNA 1RG6A 4ED7A 4J9SA 4Y2TA 5D4BA 2UVWA 4XA5A 3C1YA 2BR0A 1SJED 1UE6A 1EU3A 5IP7H 4GIBA 2EANA 4Z6CA 3LWEA 1KC8C 4QCLA 4BJQA 4TUPA 3PUZA 2NRZA 4HTHA 1XPOA 2YB1A 1NNLA 2QCPX 4A3MG 4YMOA 2WKDA 1F9SA 3L3OC 3Q8RB 4FO6A 2FPLA 4IR9A 1X6OA 3W1BA 1XNQQ 3WK5A 1I4HA 2OTJA 1YNJD 1K1QA 5AM3A 5KG4A 3AU6A 2V9WA 2R8JA 2O5JC 5ISRA 4G57A 1ZXTA 5KNCA 1NK7A 1ZD5A 2ATLA 2JP1A 2PMZF 1RQLA 5BPCA 4UARA 3RJIA 2E1EA 3PO5A 5GAGC 3M3YB 2Z6BA 5EKIA 2VXWA 3I1YA 1VJ5A 3WKBA 2ZM6L 2KHVA 2JA6H 4YG2A 3HKZF 1IW7C 1HZ9A 1PDQA 3MFHA 1VQGA 2D2CC 2K4KA 4HIOA 1I4XA 4B3ML 2F0IA 3GV8B 3W5OA 1EEFD 4DR6L 4F5OA 1Z00A 4O9MA 1ZQPA 1YVCA 2W8KA 2ZIUA 1JB3A 1PK1A 2DL0A 1LTLA 5C3EB 4KMOB 2XWBB 4JI6L 4O3PA 2JH1A 1GHJA 3CC4A 2R7ZG 5LMUQ 1Q7YC 3M9BA 1N34L 3V7JA 1MN8A 4RKBA 1IBML 3HOYH 5CJ7A 3PW7A 4HJ7A 1TWGH 1VQEA 2ES2A 3HOXB 1KFTA 1T94A 3AUOA 2WAQF 5KYLA 3C1EA 2C2DA 2NV3A 2F4VL 5A2QE 4C3IB 4RWSC 4DN4M 1CSQA 2F0OA 2P6UA 5KFLA 1SL2A 2RQXA 4LF9L 2JGAA 2KTQA 2JA9A 2R7FA 3RZDH 5AKYA 2E8OA 3GILA 1OUQA 1E1TA 1NSNS 2DJFC 2W9CB 1D5XC 1II3A 3LX0A 1L8OA 2ZIWA 4RCOA 3S16B 9ICJA 1HTLD 1A3UA 1SZPA 3DWQA 2KICA 9ICEA 5KT6A 1O78A 2EIFA 4Z9CB 3SV3A 4GZYC 1BKBA 5JPMC 1JWMD 2HHXA 3PW0A 4DV5L 4PH5A 3TRZA 3MXUA 4DV0L 3G6JB 1L7PA 2BCUA 1X66A 2VQFL 4PQXA 4ZUJA 1HR0L 1R4PB 4IUVA 1IBKL 3L0OA 2OF1A 2FPMA 1QWYA 2YU9H 2WF5A 3BQ2A 3L2PA 1B0XA 4BWJA 1SR3A 3NVVA 1ZEQX 4C0ZA 4HSVA 4DNTB 1SL0A 1GUOA 1BCPC 4JWNA 1V9PA 5IILA 3S1NH 2PMZB 2PI4A 1PXUA 2PFOA 1EWIA 1PMRA 4RAUC 3EPIA 1C20A 2O2LD 5DLQE 3MC0B 4WJ3B 4DFJA 3HKZB 3WKEA 2ZJ8A 2JYOA 3HG9A 1WCMB 3PSPA 3KDFB 2RHQB 4KD4A 3VYSA 5G3LF 1J5EL 2MAXA 3AEVA 4ZRZA 1CFMA 3GIMA 3D0FA 4KLMA 5FKAC 2W9BA 4P4MA 3A56A 3CCVA 2ZJRA 1DGJA 3KJPA 2RP5A 2W8LA 2EQSA 7ICMA 1V85A 2LYAA 1VF7A 4BY7H 1HFNA 3H0LB 4DFPA 1TKDA 2ZUDA 2VJ5A 3I4NB 1GVPA 1MSWD 4AYBE 5I2YA 2OM6A 1XSNA 2WAQB 3UDIA 3FKIH 1SE4A 2XRQD 2XWJB 2A6HC 2TSSA 2Z6KC 3E6ZX 2HMXA 4F8MA 2BPCA 3SR6A 3E9IA 4GN3B 3BS5A 1F2LA 5FLXE 3RMHA 2EZVA 1N61A 4N9PA 5AKLA 4U673 1TWFB 3CCEA 2XCPA 5D14A 4JI4L 1RXWA 5J0QA 3QZ8A 3PV0A 4HEDA 2CN1A 3KFUF 1CKOA 4MEXA 2JA5H 1K3RA 2JEFA 3I55A 1AZPA 4IURA 3KZXA 2NVQB 1LT4D 2F2AB 3NXWA 2R8HA 4UP8A 1VQOA 1H9JA 5FO8B 4NM2A 4X5VA 3J7A5 5KFCA 3IHQB 2JXJA 4LWCA 2F3WA 5CRXA 3GTKH 3A0JA 2HUGA 2JEJA 3ONAB 4OEMB 1LKYB 4KMUC 1I50H 4EZ9A 5C5MA 1N32Q 2JEAI 5GADC 3QU7A 4DWIA 5H1SE 2J4XA 4WJ4A 1HEKA 4QZHA 5IT9L 3TS2A 5C0XH 3PO3B 5IY0A 5AKHA 4I2AA 2MUTB 4L5TA 1LTRD 7ICSA 1FGUA 1X3EA 2JN4A 4WORA 3S1QH 5ALVA 3GDXA 1SAPA 1EIHA 4UASA 2N49A 3SV4A 4Y2PA 1CRXA 1QNUA 2A1JA 4NJ8A 2F0LA 3SEIA 4XQQA 3ALRA 3HOXG 5M3FB 4K14A 2CCZA 1EIYB 5KFHA 3M9MB 3PW5A 4NXMQ 2DNEA 1PH6A 1RM6C 4RQNA 4PHDA 4PGXA 2RKSA 8ICZA 4BXOA 4K0KQ 2KUMA 5AI5A 1WUDA 1LTID 4FO2A 1PH8A 4YMMA 1UE5A 2F03A 4DL4A 4YR2A 5CV7A 2ZJQA 1XC9A 5C4HA 3CCUA 4LF6L 2HI0A 8ICSA 3D6JA 2Q2HA 1VQ6A 4O3RA 2QB1A 1G6PA 3MTSA 4NY8A 2AGQA 1WJJA 3K7AH 3GTOH 1U4RA 4UW9A 5FLXc 4EEKA 8ICQA 1O03A 5DB7A 2DN8A 2UVRA 2XGTA 3GDEA 5DAUA 4YFKA 2NYZD 3G6YA 4KN4A 4UB1A 4KLQA 1IKMA 3OPXA 4Y2VA 3S1RB 1XMQQ 2VB2X 4B9SA 3N52A 2F3VA 3NUQA 3CP8A 3CMEA 2ZTEA 2N1RA 1ZQSA 9ICIA 4I7ZC 4C2MH 4DU9A 1ZQNA 4B9TA 2K50A 4DEZA 2K52A 2NYVA 3UM9A 5KFTA 4BY1B 2AHOB 4CKCA 2VNUD 1Y1WH 4FF1A 4RQ0A 4A3BH 4DR4Q 3TANA 3QEBZ 5DNFA 1M8AA 2A68D 1GD7A 7ICHA 3CCQA 1J2MA 5KG6A 4DQSA 1LVHA 4YXMA 2KZZA 2KHSA 4DUYL 3JPRA 1VQKA 4NW2A 4NM1A 2EYOA 3PUWA 1X6IA 3LK9A 1SXTA 4JBKA 4M9LA 1IL2A 2AH5A 3S6JA 3P75A 2ZIVA 1PV4A 3IFDA 4JI3L 3V2TA 4A3FB 2C9OA 2IX0A 2F8LA 4DLEA 1TQOA 4X3KA 4A75A 4DK6C 2EYPA 5IWAQ 5DM63 5IIMA 4YR0A 2Q8RE 3I4NG 3DXJC 2BDUA 1SE3A 2BQUA 4DFKA 4J9OA 4C56C 2Y9TA 5IP9H 1UHUA 5KG0A 5F2DA 3FMCA 2UVUA 4IZ8A 3OGUA 2ID0A 2TMPA 3MXNA 4L5QA 4DOCA 4CGZA 1IW7D 1PH4A 4CNQA 4YY3L 1LV5A 1KTQA 4X66Q 2M00A 2Y1JA 5J8YA 4IJLA 1PTOB 3H0GB 5DKWA 4RT2A 1QUQB 1OTCA 2FMSA 2E2IB 4JOIA 2FFKB 1B44D 2FINB 1A2UA 5J2CA 4P4PA 2P6RA 1VDZA 4P0QA 3AQQA 1SNDA 1TAUA 5D3IB 1HNWQ 2LYBA 1IL8A 2ZUCA 2R61A 3NBIA 8ICBA 1XTCD 7ICIA 1JMCA 5ALDA 2RHSB 2SNMA 5J2FA 5KFAA 1ICFB 2R92H 5KFQA 3GTPB 2E2HH 1S3OA 1ZQFA 2BCVA 2M9VA 4DV6L 1Q3VA 4DR5Q 5K4LA 4XT1B 3PMFA 3EWAA 1U9LA 4ABNA 1ZQOA 3I70A 3KLRA 3PUYA 4GNXC 4OONA 2NRVA 4LK1C 1YHAA 4A3KG 3GTLH 4LF8L 1R9TH 3SHLA 2MP1A 4QGUA 2FMQA 2L55A 3HEJA 2EJFC 3R93A 4ECQA 5CV5A 3SXHA 4Q8FA 5FO9B 7ICVA 5AM1A 2J6SA 5JJZA 2K4EA 2ISPA 1A76A 2FJ2A 3OYYA 1V1OA 4AYBB 4QZEA 4DK1A 4DOAA 3K7UC 4Y7NB 2WTFA 3KKAC 1RKNA 3URYA 2GOLA 2EAPA 1GUGA 3D4WA 1QB5D 2YY6A 4IQTA 1QNKA 5EWGA 1BCPD 3B0YA 4LFAQ 2KJ5A 5J0YA 1QCBD 1W3SA 4XUSA 2W9AA 1UNSA 2ZT9C 1PH1A 2UU9Q 3G48A 4I2DA 5A0LA 4JCVE 2Z7JA 2PW5A 1WOCA 2WB1C 5JEAJ 3S2DH 3N28A 3GU3A 3K59A 4BBSH 5AK6A 5NUCA 3E2EA 8ICAA 4RPYA 4UAVA 1STEA 5AJ3L 4QIWF 2SDFA 4A76A 3NK9A 2UUAL 4YMNA 4DL2A 1MI2A 1JICA 3U4VA 3VR5A 4EYHB 3UMBA 4NLZA 2B6GA 4RUCA 4ALPA 3KHLA 3SI8A 2K5NA 3HOYB 4MFAA 2GWSA 1QTMA 2CQAA 2M2LA 1N32L 1WCNA 1TWGB 3QOLA 1JMSA 1SMYC 2F0JA 1S97A 1Q3LA 4YHHL 4DUZQ 4DQQA 1C9OA 5JAVA 5GTHU 1CI3M 2A3VA 1WWUA 3PGZA 2A6HD 3EW9A 4IUNA 1HUNA 4IO9A 4C3JG 2Y0SE 1JCKB 2QLTA 3G6EA 2PZWA 2ZTCA 4FF4A 1RYSA 3GTQH 4IRKA 4QZBA 5ALJA 4JV0A 3MR2A 4JWMA 1K28A 7ICEA 5JU5A 4JI2Q 3RZDB 4C1NK 1WTWA 5EKKA 2CQOA 4OJOA 4TQUS 1ZD4A 4X62Q 3U9OA 4A3EG 2BQRA 1UA0A 5B66U 3A8JE 2M9NA 4FXKC 4O3QA 3M9OB 9ICLA 4JBMA 3D4DA 1FEZA 3T3FA 1SKWA 3B6YA 1YJNA 1IV8A 3EZ5A 8ICLA 4O5EA 1SE8A 3KF8B 1G91A 2D62A 4HMJA 4HMIA 3W1GA 3OJSA 2KNJA 3CYMA 2YU9B 3HOVG 4J9RA 1SROA 5KT5A 1ZQZA 4F5QA 3IG8A 3EPGA 3S1NB 2KCNA 2K5WA 3H4BA 2JA7H 1S77D 1ZQIA 3MEFA 3OWFA 5KFUA 1I4GA 2V1CC 1UPHA 3NGDA 3MZ5A 1L5UA 4KHPL 4N8X1 2PQEA 3EIVA 5KT7A 5ALEA 4NP5A 3H15A 3V7LA 2G06A 4NLBA 3GO5A 4OCZA 1R4QB 3P20A 4RCNA 2KOBA 4QIWB 2MQHA 3ONNA 3ZI4A 3QG1A 2AQ1B 3A7LA 3QUQA 3IM1A 2MRLA 2Q2TA 4QZFA 3Q8PB 2B63G 3UMCA 4DV3Q 4RPXA 3FHWA 1ZQXA 2CXYA 3NP8A 1F44A 3M9NB 3ND9A 5A35A 4BY7B 4X3TA 2F0VA 2D8CA 3MGVA 4ED2A 2VQEQ 5BR8Q 5LMNL 4HJ5A 1PRTC 2E75C 4RQ5A 2QARB 3TBIB 4G9BA 1KW4A 3FKIB 3RJEA 1KDCA 1VQ8A 4RPZA 4O3SA 4K8IA 1XPUA 1IIPA 1X9NA 4O0IA 4ILWA 4M1UB 4Y2JA 1AE2A 5DQGA 1KHIA 1O7YA 3NTIA 5IWAL 3RZOH 2YMMA 1TIID 3VC8A 3FDTA 4AYBG 3OOCA 2MO0A 4ZYSA 3ZDDA 1WG8A 5L1IA 4F4KA 2NVTH 3KYHC 1N63A 1KFSA 4JV5Q 3CRLC 2JA5B 4O3NA 4IOAA 4A3GG 1SNMA 2E8PA 3PF5A 5CV6A 1EYGA 8ICCA 2B2UA 5G3LD 2I1QA 2IJ0A 1SFOH 3C2PA 2J6UA 1IBLL 1D8LA 1ZD3A 1YT3A 1WI5A 3NELA 3GTKB 3PX4A 1RDFA 3T79A 1FJGQ 2V4DA 3LWUA 2YN4A 5LL6X 1I50B 2W54A 5ALRA 1NK8A 2E74C 3WOEA 5M3MH 1QCKA 5M5XH 3JPQA 1D8YA 3IP4B 2MO1A 2F0QA 2PXIA 3C5FA 4DSLA 1NOMA 1BO0A 5AICA 3MDAA 3WKDA 5FJ8G 3KBXA 1QZGA 3J7AV 1WWVA 1X40A 2EE1A 2JEBI 2WP8J 1VQLA 1BXTA 3CP0A 1SN8A 2HQEA 5M5YH 3S1QB 5JUMA 3V6HA 3JPTA 5EPKA 4IC9A 1N60A 4DXGA 4I2FA 3ULLA 2K8BB 3Q8SB 1ZRNA 4PHPA 4S3SA 3QXGA 1RF2D 3VYTA 3SZ2A 4ZKCB 1CQVA 2J7ZA 4CDGA 2KG5A 4ED1A 2FJ6A 1TS2A 3OIQA 4KN4C 1WTVA 2FDRA 1FO4A 3IDWA 4RT3A 4QWBA 1AP0A 1B1ZA 1NJZA 4DXFA 2GO7A 4BXXG 3A55A 4ACOA 4JC0A 5IINA 3WK9A 1KEJA 1TK8A 5C4XG 1T7PA 2PNHA 3MAQA 4JI0Q 4GKJL 2K60A 1D1KA 3M4OH 2VUMB 4JI5Q 3CQZH 1XWEA 3T16A 1EXNA 1OO9B 1I6HH 1X55A 2IOHA 4ECYA 3A5UA 4PHAA 8ICWA 2WINB 4JBWA 1K0RA 1Y8NB 1FFUA 2AU0A 1SRUA 5IT9E 3F53A 3K7AB 3IAYA 5AHXA 4JW0A 3C46A 3GTOB 3DDHA 2KJ8A 2MJ8A 3ZD9A 1QILA 5K5PA 3CPFA 3SMVA 3O13A 4EX7A 2LKYA 4F5RA 1LT5D 4PZ8A 8ICRA 1Y88A 5KL8B 3I4MG 2DFLA 4OJPA 3FPUB 3DEPA 1ZQUA 4C2MB 5DM73 2B8GA 4Q45A 3C23A 5FP0A 1QOHA 2F0EA 1K1SA 1VQJA 2HHTA 1TWHH 2K01A 3BDCA 3KF6A 3MBYA 9ICMA 3OW7A 2VA8A 2K75A 5J39A 3PO2G 5EJWA 1Y1WB 2KZMA 4A3BB 3NRWA 5J2KA 3M6KA 4TUSA 7ICRA 5D49A 2F4IA 4GXJA 9ICXA 2L4NA 4YIJA 2JV3A 4M04A 5LL6S 8ICMA 1EZ8A 4DAMA 5J8YC 4R66A 2VA3A 1XSPA 1VMPA 3F2UA 1PH9A 4I27A 1ED1A 2NN6I 1BNOA 4ZH4A 5J2AA 1ZQRA 1RD9D 4JOIC 3HOZH 1TU2B 2XTIA 4LF5Q 2AQ3B 4C3HG 4KV6A 4A3IG 4JI1Q 2PMZE 3AFPA 3KHRA 5G5GA 4QJFB 4X3SA 2RHFA 2KN7A 1CZWA 5IYDG 1LO5D 1NZPA 4R4QA 2Y0SB 2RLTA 1P8LA 9ICRA 4FF2A 3HKZE 3CD6A 4C7ZA 1TXYA 2MGSA 5L1LA 4HR7B 3TSSA 2HHUA 1BOSA 2IA6A 1PHJA 3D4RA 2R6GA 3PF4A 1EYDA 3W2DA 3OSOA 3ISCA 1SKRA 4JV2A 4NKLA 3KD3A 4B9VA 4R64A 3H8MA 1Q82C 3ZYYX 8ICVA 5KEEA 4ELUA 1B9MA 5AM0A 3RB3A 3RB4A 1V1PA 2KJXA 1N33Q 2CWAA 4Y2RA 1FVIA 1IHZA 1S40A 4OO1H 1Q1BA 4HIMA 2HOQA 4ECRA 1K8GA 3CCSA 5F3XB 4DV1L 1DM0B 1UE1A 1KBUA 3LVVA 3Q8QB 3KLSA 1JX4A 3M7DA 3BVGA 4RUAA 1RYUA 1L0XB 5IT9c 4I7AA 1HUMA 5FO7B 3GIIA 3Q8LA 5CR0A 4UB3A 2QB0A 4HIDA 3LVWA 1XNRL 4IUQA 1WTXA 1HNXL 1M6YA 4MIUA 2R92B 1X9XA 5I6YA 2E2HB 3OTOQ 2KFNA 1EY5A 1LKYA 2L1BA 1TAMA 2LKVA 3VYRA 5C0XJ 2G9DA 4FBUA 4QWDA 1FD7D 3RR5A 5KYIA 4NWIA 4MTKA 3D8GA 4NXZA 5FOBB 1NKCA 1IKLA 4B9MA 1EY8A 3LYSA 3GTLB 1R9TB 4X65Q 4OX9Q 4YD2A 3AQEA 4YQWA 3C29A 2JSOA 2VKQA 2KCCA 2MFIA 2KD1A 4UP9A 4NLKA 4RQ1A 4FP5D 1B53A 5ALTA 2FHTA 1EUJA 1ZQWA 3QNMA 4LF7Q 4LFCQ 3H8JA 2F3IA 2HSZA 4P75A 1COOA 2KIWA 1BBUA 3EYZA 1G2SA 3SE0A 2Q2UA 4JI7L 2VUMG 5KFXA 1DXSA 1CI4A 4DCCA 4RNNA 1IG6A 1EQQA 1X65A 1Z4NA 1PLFA 1D9DA 8ICXA 1E24A 1TR5A 4R8NA 5CORA 2JA8H 4JYAQ 4JV5L 4XXEA 3K57A 2RF4A 2W7PA 3PIP3 1JOOA 3KJOA 3S2DB 5E4XA 3V6KA 1PZNA 1NR2A 4BBSB 4GS3A 4ID6A 1KDBA 1CSPA 1FJGL 3BQ7A 1LTBD 1VQDA 1XMOQ 5KTQA 5D65A 5HGTA 1EZ6A 1F9PA 4KLDA 2ZTDA 5I4DA 3K8AA 1SGGA 4EQPA 3AM9A 2AXTU 3E5SA 4BBRH 1JXEA 2B8FA 3ORYA 3HOUG 1HZCA 3CPWA 2ZXHA 3ND8A 4V190 5C4JH 4J9MA 5E3FA 2F1IA 5DGBA 5ELEA 4EENA 2B21A 1BPEA 1LB2B 4GNXA 3E58A 2EYMA 3GTQB 4DL3A 3NASA 5AKEA 1J2NA 3N7SC 3CCLA 3TEHB 5CGKA 7ICOA 5C44G 2MA1A 1H9MA 1MIUA 4JMUA 1OXTA 2LM4A 3E9HA 4DPGA 1KD1C 1DXMA 1T9HA 1H9RA 3R9KA 4IFDJ 2G0AA 2L9HA 3RF9A 4YWLA 2KSOA 2WF7A 2RRDA 3BJUA 3T1HQ 4BBRB 3KKAA 1BCPB 2XN9C 4L5RC 3C1FA 4B3RL 4MFCA 2Z9HA 3B9JA 4YXJA 5E4WC 4PZOA 1KIXA 1ZQBA 2IHMA 4LFBQ 1ZXIA 2AJQA 2UUBQ 1HA5A 1EOTA 1DJRD 3L9AX 2JA7B 2JZBA 4OWTB 1ZQVA 1O80A 3QB3A 5GAEC 2DY8A 4DLGA 4CKEA 1BBXC 4DV7L 1ZJNA 3B0XA 4G7OC 3MXGA 3F8TA 3PIOA 4IRCA 3EJIA 2GA4B 2NRWA 4R4OA 5KFOA 1AN8A 1G2TA 3H09A 1F5SA 3ZD8A 1COKA 1U9RA 2F1MA 1SNCA 3CCMA 5JVG3 3BDLA 1LTGD 2Z4IA 2E8GA 1X54A 2W3SA 3QU2A 3MR6A 1NMGA 3MFYA 3A74A 3T13A 1H95A 2B2UC 2M0NA 2AUKA 2L11A 4B6JA 5DBBA 3VDYA 1ML0D 1NY4A 4K2LA 5J22A 1ZQKA 3NTUA 3QE9Y 5AI4A 3TZDA 3UXNA 5CEHA 1KNEA 1NMFA 2ASBA 5IYBH 3HOWH 3I73A 4M9NA 2BE5C 3WDNA 9ICGA 4UB8U 2RSOA 2OH2A 2IHNA 4JK1A 3OMCA 1JT8A 3MC1A 3M8RA 2HVHA 1Y1VG 3SVMA 3RZOB 4A93H 1ILPA 3SYZA 1IXRA 2IL8A 2NTTA 3CXCA 2LBOA 4P73A 3H3VH 5ALIA 1SV0A 1ZQQA 2NVTB 5HHIA 4PG3A 4QZGA 4ECZA 1PH7A 3KUPA 1RTOA 2JA6G 4H44C 3BZCA 5EOZA 1N56A 1SNQA 2AKWB 4Y52H 3DMUA 1GUWA 1MSGA 4DFDA 4RNOA 3FEWX 2Q8TA 5C0XI 1SFOB 4ZQ3A 4I2EA 2ENBA 3QUCA 3V7KA 4A3JH 3UXPA 4LW1A 2WFWA 2RDIA 3QJYA 5AM2A 4N9TA 2HT1A 2OYYA 5M5XB 4O5KA 3H40A 4DQPA 5M3MB 9ICHA 3RTVA 2MHVA 1Q3UA 2NRTA 4A3CG 8ICHA 1XWLA 1GO3F 4UAIA 4K5XA 4NDXA 1BNZA 4QUCA 2IY5B 2EY1A 4PGQA 4KLSA 4FNFA 4NPSA 5F9NA 3JAMi 2HHHL 4C4RA 4DSEA 3ICEA 4DR7L 2H3VA 2IT1A 1SYEA 4TURA 5M5YB 3UPQA 3QYPA 5I9OA 3PIO3 4OJ5A 4EGVA 1IYJB 3K5MA 1TK5A 4LMQD 4F50A 2BOSA 2QDLA 3NE5B 1DRGA 2KK0A 5KL1B 4G4KA 4DV4L 4B3TL 3K4GA 1WTHA 5KFBA 2OQ0A 2RSNA 4U68A 3MABA 3SD7A 2ZJPA 1QZHA 1ZYQA 5EKLA 1PYBA 5EWEA 1I5FA 1Z3EB 1RXVA 4JV1A 1YIJA 4FS2A 1NR4A 4QNLA 1T3NA 2GH1A 8ICIA 3EROA 4CF5A 3M4OB 3K1ZA 3GP7A 1Z4OA 5CHGA 5J0OA 8ICYA 3CQZB 3TP8A 1JOQA 1ZQLA 2ASJA 1EY6A 3AFQA 1I6HB 5H2FU 1S5DD 1Z9FA 5C3EG 2EDUA 4TRDA 1YZ6A 4C8OA 4EZ6A 5KIXA 4GOPA 3I4LA 5KFVA 1ENFA 1UUPA 2ICIA 3IN5A 4I2HA 1L7NA 2F44A 1PVOA 4OGQC 2BKEA 4KTAA 2BCQA 4ULLA 3QU5A 3GV7B 1NK5A 4B9LA 1EYAA 5M5WH 3IL8A 4F4ZA 3T4AC 4LF4L 1X2IA 4PPXA 3ISBA 2K1BA 4RH6A 1SSOA 2F0TA 4TKOB 2KEYA 4F3OA 3KF8A 2Y9UA 4X6AH 1N8RC 2IOFK 2XRSD 4C3IG 1LUZA 1U0LA 3BJYA 5HP4A 1T8EA 2HCCA 1QSLA 1OXVA 2CPRA 3S2HH 2MUYA 1RTNA 3RB6A 4O2DA 2I5HA 2A5HA 1FR3A 2X6GA 2D0PA 4CBVA 3TQ1A 3SENA 5DGAA 3TQYA 3MGHA 1I94Q 4ECXA 2HHSA 2K28A 1K8OA 2NRXA 2XNAC 2CHBD 1KDAA 4RGNA 5KGUA 1XNQL 3HOZB 1JJCB 2WKCA 2ATWA 2QW7A 4KY5A 4IALA 2HCFA 4IL6U 4QMGA 4M9JA 4N8FA 4IPCA 1ZQGA 1CK1A 4HJAA 8ICPA 4RFBA 5CR3A 5AK5A 4P0PB 1Z6HA 1S5LU 4NXNQ 1N36Q 4TQSA 3SEBA 1S0VA 2FPKA 5KFJA 4M9HA 4HAEA 5J0SA 4DL7A 1A8VA 2UXDQ 1SEBD 2WB1F 2MSNA 2P66A 4QIWE 2HQLA 4IPGA 4DF8A 1YNND 2N8NA 3EBEA 3UI2A 1S9FA 7ICPA 4K8JA 1YI2A 1QVGA 4EQNA 1BPDA 4CDCC 3HKZG 4DAPA 1A77A 3VCBA 2KIVA 5IYCG 1QJOA 1WCMG 1CA5A 4DAYA 5LMUL 1IYUA 4MNOA 2I9GA 1ENCA 2K03A 1S5CD 2GLEA 5EE0A 2PQAA 4USAA 3Q23A 4Z6DA 5HNKA 3TACB 3LGJA 3OSPA 5ELNA 2EZYA 1Z1BA 3TP5A 3Q6SA 1GHKA 1U49A 4A3MH 2EH9A 2UUBL 1RZTA 2YTXA 2DF4B 3E3XA 5B5EU 4I29A 3WOFA 3RR8A 2C5CA 3A5ZB 2DUYA 5DEHA 8ICGA 5M3MG 2R93H 2VA2A 4X64Q 1BPXA 3H8SA 3N97B 4I2BA 2WAQG 1RQNA 4IFDH 3BQ1A 2Q0ZX 3ETLA 2DKZA 3M4YA 1QVCA 2F0GA 3KLSX 3JPSA 4Q0FA 1WTOA 1L1OA 7ICNA 2K89A 2EY2A 4FZMA 3NBHA 2NB0A 2K8CB 1HQMC 1MGSA 1Z00B 5I9PA 3KFUA 7ICKA 4JB3A 4IUPA 3T56B 1PK1B 1D7QA 2JEIA 1ZRMA 3QR8A 1XTDA 1G51A 1DYQA 4KITB 1F9RA 3K1RB 1SWWA 1GKHA 1BPBA 3I91A 2SNSA 4FZNA 2LYHA 3R8BA 5DQIA 5TISU 4AIMA 1ZQHA 4WRDA 4JI8Q 2AQ4A 2R7ZH 4AH6A 5AI9A 2KVSA 4LUOA 3Q0AA 1RDPD 1VQCA 2R3ZA 4EVOA 2AUJD 2DNCA 1HXYD 1H9SA 4EYIB 4UATA 2ASLA 1GUSA 2EYLA 2WB1B 1MQ3A 7ICFA 2JA8B 2XC9A 2Z4HA 4Q43A 3RJJA 1QG7A 3PO3G 2G9HD 1SNPA 3THVA 2XY6A 2ZIWB 3PMLA 1HPCA 4IN3A 4ZK9B 1OXSC 2A1AA 4UQGA 3D6WA 3QEAZ 4K6DA 5M3FG 1CUKA 4RHRA 1EY7A 1M1KC 5FLMG 1U4MA 1JWSD 1TKWB 4DR3Q 4CDFC 1BDOA 3SK8A 3QUTA 4TSSA 3S9WA 4WFN3 1PRTF 3PR4A 3DWAA 3GV5B 3UDFA 3F2DA 2K7VA 1N5WA 1Z19A 1S0NA 1DK2A 1ZJMA 1EIGA 1LTAD 1ZYRC 2BE5D 2KEEA 4J15A 3TREA 5IGBA 4DV2Q 1JROA 1SXDA 2NVYH 3FPPA 1DONA 5C4JB 3DEEA 3WWVA 5DLFA 2DGZA 3J81j 2HIVA 5TSSA 5KT4A 4YWKA 3F2CA 4YD1A 1NE3A 4L8JA 3X3MA 4DK0A 3NVYA 5JEAG 5KFDA 5K36G 2BDOA 1PTOC 4ELVA 4IS7A 1S4ZA 1WFQA 4TVAB 1UT8A 1S76D 3NS1A 3S14H 4YCWA 5LHY1 2L15A 1Z47A 2W9BB 3RN2A 1VQ9A 3TP7A 4IQZA 4NLCA 4ME3A 1STHA 5CYUA 4BY1G 4IJHA 1SKSA 3J80i 5J2GA 4DR2Q 1PVQA 1W6KA 3EN2A 2E5LQ 1RL2A 2Q8IB 2BCOA 4A3LG 3IG5A 2KFZA 3BS5B 4AP9A 1UEBA 5D46A 4OO1J 5J3BA 3OPOA 3KHGA 4JK1C 1TE2A 2KMDA 3GIJA 3T5HA 2E2DC 5AKKA 4HYKA 4DR1Q 3UE1A 2E5SA 3AU7A 5ALMA 4CE6A 2CKZB 1DOKA 2KE7A 2A19A 3OTQA 3WK7A 3RH6A 2I5MX 4XDXA 1MSHA 1SNOA 4A3FG 1SV0C 1YNXA 4NXML 1O7ZA 2LMRA 4I2JA 4ZLTF 4KY6A 4OWWB 1A6SA 2ZIXB 1X9WA 3MVVA 2QF7A 3SDZA 4HCSA 3TS0A 5JJLA 4AYBC 1PFSA 3FDSA 2NN6G 1HNZQ 1KNAA 1QE6A 5HURA 1QQ7A 5JRTA 1PRTB 1RCVD 2PFQA 3TAQA 1SMXA 4M9GA 1T5EA 5C6AA 2HDOA 5AKGA 2EJGC 3RJGA 1I4RA 5J29A 4UHVA 1OXJA 3HOWB 4ZKBB 4KLKA 3D2NA 4B3SQ 1TS4A 4O1NA 4XT3B 2EYFA 3ISDA 1S0MA 1L0WA 4DA2A 2NO4A 1XS9D 1KLNA 2BDNA 2ES6A 1VCIA 3H0GG 2UXBQ 3AYHB 2RVLA 1DGSA 1S5BD 1KKXA 4HN7A 4A93B 4KLTA 4MN3A 4R8IA 3BS7A 5EE3A 4DS4A 1XMQL 4GN5A 2KBNA 2P5ZX 2A1JB 3D6CA 4DF7A 3J81i 3C28A 2B39A 2ISOA 3H94A 3LWMA 3VR4A 1DK3A 1JB7A 2XCAA 3DM3A 1XX8A 2EJMA 2JEGA 3OWEB 4DNRB 1V38A 4IR1A 4F2SA 5KFPA 4KKTA 3C21A 3ERSX 1STAA 3T53B 3GTMH 1VDVA 4DR4L 5KAFU 4LJZC 4A3JB 4EBEA 1XYIA 2JA8G 3CKIB 4YP3A 4J9NA 2RCFA 4ZOHC 3HJEA 3H0MB 3TARA 4R8UA 3DM1A 3PO4A 3VR2A 4QUFA 5IP7G 1K73C 5EAYA 2BH2A 3H4DA 1BGXT 1RODA 4KHZA 4EBCA 2E1FA 3P7JA 4U6PA 2W3RA 4EX5A 5DDMA 1C0AA 1JRPA 3G6XA 3UQ2A 4GOPC 2W55A 5L1KA 1TV9A 2YTYA 2G5DA 2LI6A 2F77X 2VL6A 2R7DA 5C5JA 2UXCQ 4QWCA 1TS3A 2F1HA 5HR7A 4A3DH 3H0RB 4Z6FA 1UAPA 5IGDA 4F8RA 4BUGA 2BDPA 1UT5A 1YNJC 1WTQA 4B9UA 4X66L 3BG3A 5ALNA 3G7LA 4B9NA 4Q8EA 1YHBA 3T5LA 5J0WA 2NTSA 2W9MA 2P35A 3RAXA 4DFMA 1WCLA 1Q8IA 2NUCA 2O6KA 2I5LX 5KFSA 4PZ6A 1ZQJA 2I07B 4QZIA 1TWCH 4RQ6A 3M8SA 3J7ZC 4KX5A 4FVMA 1HNWL 2ZG6A 3RRHA 2C28A 4LZGA 1W6JA 2RDFA 5IGCA 2YMLA 1B4OA 3CCJA 2IHFA 4KTQA 5JOBA 3Q8KA 3RLFA 2ZIVB 4Y2QA 1CHQD 4MHEA 3F5AA 4FYDA 2PI2E 1P16A 1J97A 5F9LA 3HOYG 5M5WB 2V4RA 2EY6A 5AI8A 2ZXPA 1GOZA 1JJGA 4DR5L 5KFWA 2XO7A 3UQ0A 1Y8OB 4DSIA 1FNUA 1D6EC 5CBEE 5L37A 2OQKA 3MXNB 3SAFA 5E79U 1QQ6A 3K5NA 1CQFA 1DZ1A 4O3OA 1U4PA 2F0UA 2PNRC 2F0KA 3S2HB 2IOFA 4A8EA 4V0BA 3K5LA 1ENAA 4C80A 3HRDD 2GVBA 4KLOA 1F77A 2EPBA 3STBC 2JJQA 1E3PA 1NK4A 4C7YA 1HH2P 2BQ3A 1MQ2A 3F1ZA 3I56A 1KL9A 2W11A 4LJXA 3MDCA 1JXLA 4P0QB 2KCTA 3PUXA 4F5PA 7ICTA 4YCVA 2W9CA 2YV5A 3RLOA 3ULJA 2ZM6Q 2H3FA 4I65A 1Y69U 5AI0A 4K5WA 5KAIU 4JBJA 4B3MQ 2JQOA 4LFAL 2DY7A 1L3UA 2K05A 1XO0A 5E7NA 4DR6Q 2F8KA 1SB3C 1D8BA 5DG8A 2SEBD 8ICJA 2X6LA 5GAHC 5J2BA 2UU9L 4MEYA 4F91B 4G3IA 5E1FA 4OO1I 2A6EC 4UPAA 1EIFA 2R18A 5KG1A 3AL0B 1FYCA 4JI6Q
chains in the Genus database with same CATH topology
5C44G 1K83H 1MIUA 1OXTA 2K14A 3E9HA 4DPGA 1N34Q 1KD1C 1JE5A 1T9HA 1IBMQ 4OWXB 1PH8A 1BBWA 1UE5A 1L1OC 2ZJQA 2IHEA 3S1QH 4IFDJ 1Q12A 3CCUA 4LF6L 2C35B 3JAMc 2Q2HA 1VQ6A 4YWLA 3BJUA 3T1HQ 1A0IA 2F4VQ 4A3KH 4L5RC 1I94L 1G6PA 1WJJA 3K7AH 3GTOH 4LUVA 4B3RL 1M90C 1KIXA 4LFBQ 4DKAC 2KHIA 4GN4B 4DUZL 5FLXc 2UUBQ 4LF9Q 2XGTA 3M3YH 3KDFA 3GDEA 4GKKL 4OWTB 5GAEC 1N9WA 4BY7G 4DV7L 2QA4A 4GOPB 1XMQQ 3CMEA 2ZTEA 3F8TA 3PIOA 4C2MH 1YBYA 1TWAH 2CWPA 2K50A 4NXNL 3FKIG 4R4OA 2K52A 4BA1I 1N36L 1HR0W 1HZBA 2AHOB 5C3EH 4DV5Q 4JI2L 2VNUD 2OCEA 3CMAA 3CCMA 4DV0Q 4R4IA 2UXDL 1Y1WH 4X62L 2VQFQ 3PIPA 4A3BH 2E8GA 1X54A 1HR0Q 4DR4Q 1IBKQ 4IPHA 1NMGA 3T1YQ 3A74A 1GD7A 1LYLA 1OXUA 1V43A 3CCQA 1PH5A 3OW2A 1H95A 4DV1Q 1XPRA 3VDYA 1NY4A 3HOXH 1V1QA 1NMFA 2WB1G 2DUDA 4DUYL 2JA5G 2ASBA 5IYBH 1VQKA 2NZOA 3HOWH 3U50C 3PUWA 4R4TA 4JBKA 1IL2A 3GTGH 4C3IH 1PV4A 1J6QA 4JI3L 2IX0A 4A75A 3S1MH 1WYDA 4DK6C 5IWAQ 1HZAA 3JC66 1XNRQ 1HNXQ 4WJ3M 3CCRA 1JT8A 1Y1VG 3I4NG 4K0KL 3U58A 4A93H 2E2JH 1J5EQ 1IXRA 2KENA 5IP9H 3CXCA 4P73A 3H3VH 3S16H 4PG3A 4X64L 1KXLA 1PH7A 2ID0A 2JA6G 4L5QA 2IX1A 3BZCA 5C0XG 1PH4A 2AKWB 4YY3L 4Y52H 1RIPA 3RN5A 2AWNA 2NVXH 4BBRG 4C3JH 3KOJA 4X66Q 5C0XI 4IJLA 4A3JH 4LW1A 1QUQB 4DV3L 2WFWA 1NBWA 4JOIA 1KQSA 4FDBA 1VQAA 4IOCA 1Q1EA 2HT1A 4APVA 4R4CA 4KI0A 4YCUA 5GQOA 3AQQA 5BR8L 2VQEL 4A3EH 4DAYB 1HNWQ 4A3CG 2UUCL 1VQ4A 4JI7Q 2PI2A 2IY5B 2PQAB 1Y14B 1JMCA 2HHHL 4JI4Q 4NPSA 3UE0A 2RHSB 4POFA 3JAMi 3ICEA 4DR7L 1YJWA 2IT1A 4JI8L 2F52A 2N78A 1WCMH 5IYCH 2R92H 1KRSA 2E2HH 1S3OA 1B7YB 4NB3A 4DV6L 4DR5Q 1IYJB 4GNXC 3HOVH 3PUYA 1EQQA 4OONA 1YHAA 4RG1A 4B3TL 4DV4L 2VZAA 4A3KG 1L2FA 1EOVA 2OQ0A 4LF8L 1R9TH 3GTLH 4QGUA 1KAWA 2ZJPA 1QZHA 1L1OB 1PYBA 1I5FA 1YIJA 3I4NH 3NBHB 3CC7A 3OYYA 1MJEA 4HJ9A 1PH3A 1X3FA 1GO3E 2D0OA 3K7UC 4DR3L 3J81c 3KFUA 2KHJA 2YTVA 3AFQA 2B63H 1Z9FA 5C3EG 4HJ8A 2EDUA 1I3QH 1TWFH 1YZ6A 4P74A 4GOPA 2B3GA 1Y1WG 4LFAQ 4DNIA 4XTCS 1S72A 3M7NA 4A3BG 1W3SA 2GN5A 1PH1A 1PVOA 2OTLA 3Q8DA 4L5SA 4O0AA 2UU9Q 5M5WH 2KCMA 3G48A 2QEXA 2NVQH 4JCVE 4DV2L 3S17H 4LF4L 1WOCA 4P71A 5JEAJ 1GM5A 3S2DH 1E22A 2QGQA 5IYBG 4QY7A 3PCOB 3HOWG 4BBSH 1OXXK 1VQBA 4X6AH 5AJ3L 1N8RC 1LUZA 4A76A 1U0LA 3M85A 2UUAL 1AH9A 4LF6Q 3U4VA 3K81C 2Y0SG 1OXVA 3S2HH 2R93G 1E7ZA 1Q8KA 2Z6KA 4O2DA 2I5HA 3ULPA 4A93G 4ALPA 2D0PA 4Y7NH 4IFDG 2K5NA 3TQYA 1N32L 4UP7A 1I94Q 4A3GH 5IP9G 3KLWA 4B3RQ 1MKHA 4JI0L 3PO3H 1XNQL 4JI5L 4YHHL 4DUZQ 3I2ZA 3H3VI 1C9OA 1JJCB 3PGZA 4DR2L 4IO9A 4DV7Q 2Y0SE 5M3FH 4IPCA 2E5LL 4HJAA 5FLMH 3G6EA 4A3JG 2ZTCA 3K0XA 3GTQH 3CW2C 4NXNQ 1YJ9A 1N36Q 1Q46A 4JI2Q 5FJ8H 5HGQA 1A8VA 2UXDQ 2CQOA 4TQUS 1VQHA 4X62Q 4A3EG 4QIWE 4DR1L 2HQLA 4IPGA 1QUQA 2N8NA 1YI2A 3EBEA 1QVGA 3DLLA 2I0QA 4JBMA 3HKZG 4P72A 3B6YA 4DUYQ 1YJNA 5IYCG 3I4OA 1WCMG 3HFZB 1SE8A 3KF8B 5LMUL 2D62A 2HIXA 2R92G 4MNOA 3W1GA 1HNZL 1ASYA 3HOVG 2PQAA 4JI3Q 3ER0A 1C7YA 3LGJA 4POGA 1SROA 3M4PA 5ELNA 4BXXH 3RLNA 3M4QA 4A3MH 4K0KQ 2UUBL 2JA7H 2YTXA 4B3SL 4LF5L 3MEFA 3STBD 1VQNA 4JI1L 5C4XH 5JJIA 2V1CC 3A5ZB 3G71A 3S1RH 4KHPL 2BA0A 3EIVA 5M3MG 2R93H 1HJPA 1K9MC 4X64Q 3H15A 4EQ5A 4PMWA 2UXBL 4QQBX 2WAQG 3GO5A 4BY1H 4LUZA 1A62A 2WB1E 1PYSB 4YY3Q 5LMNW 1QVCA 2MQHA 5IE8A 1B8AA 1FL0A 1L1OA 2Q2IA 2Q2TA 3E0EA 4A3LH 1LM0A 2B63G 2VW9A 4DV3Q 3J80c 3FHWA 3T1YL 1D7QA 2LSSA 3KF6B 2LXKA 1N33L 1XTDA 1G51A 4AQYQ 3I4MH 2WAQE 3L7ZC 2BH8A 5BR8Q 2VQEQ 5LMNL 1IZ6A 4HJ5A 1GKHA 2H5XA 1ASZA 1UE7A 4A3FH 1YHQA 2CFMA 4R1JA 4AIMA 4HIKA 1VQ8A 1K8AC 1X9NA 4DK3C 2HHHQ 1XPUA 3PO2H 5GROA 4IPDA 4BBSG 2VY3A 4JI8Q 4DR7Q 1A63A 2R7ZH 4AH6A 1AE2A 1KHIA 5IWAL 3RZOH 4PZ7A 4LUOA 4XIGS 4DV6Q 1VQFA 1VQCA 4RMFA 4AYBG 2MO0A 3D31A 1CKNA 3KYHC 2NVTH 4GLAC 2OWOA 4B3TQ 4DV4Q 4JV5Q 2JE6I 4IOAA 4A3GG 3SGIA 1VQMA 3ZJYC 3PF5A 3OTOL 1BVSA 4C3HH 4LF8Q 1EYGA 4A3IH 3PO3G 1SFOH 1OTCA 2UXCL 5IYDH 1OXSC 1D8LA 1WI5A 2A1AA 3H0GH 3NELA 1IBLL 2E2IH 2RCNA 1E1OA 1FJGQ 5M3FG 1CUKA 1M1KC 5M5XH 4X65L 5FLMG 1W2BA 1X56A 5M3MH 4OX9L 2MO1A 2EXDA 2Z0SA 3NEMA 4DR3Q 1EFWA 1G291 1YITA 3S24A 1EQRA 5FJ8G 1QZGA 1VQPA 2LXJA 2JEBI 2NZHA 3UDFA 2WP8J 3FP9A 4A4IA 2DGYA 3F2DA 3CP0A 1VQLA 1SN8A 5M5YH 3KJOA 3TREA 4J15A 4LF7L 2BA1A 4LFCL 4DV2Q 4LF4Q 2NVYH 3ULLA 1VQ5A 3WWVA 1UE6A 5IP7H 2HIVA 1UWVA 3J81j 5JEAG 4YWKA 5AJ3Q 1NE3A 3F2CA 1KC8C 4UY8C 4JYAL 5K36G 3PUZA 2UUAQ 1XPOA 4BXXG 1CKNB 1WFQA 4A3MG 4TVAB 2JA7G 4JC0A 4QL5A 3S14H 4YCWA 2L15A 5C4XG 1Z47A 2PNHA 4H02A 4JI0Q 1X6OA 4GKJL 5ELOA 3W1BA 1XNQQ 3M4OH 2YYZA 3RN2A 3CQZH 4YHHQ 1VQ9A 4JI5Q 3PUVA 4ME3A 1XMOL 4BY1G 1I6HH 1X55A 4IJHA 2OTJA 3J80i 3A5UA 4JBWA 4DR2Q 4IFDI 1K0RA 3CC2A 3EN2A 1SRUA 2E5LQ 1RL2A 4A3LG 2MNAA 5GAGC 4GKKQ 1O7IA 3CPFA 1UEBA 5J3BA 2ZM6L 4GLXA 4PZ8A 1HZ9A 3NENA 1VQGA 2K4KA 3I4MG 4B3ML 1B70B 4HIOA 3W5OA 3GTJH 3UE1A 4DR1Q 4DR6L 1YVCA 3I7FA 1MJCA 2CKZB 2A19A 2I5MX 3CAMA 1VQJA 1TWHH 1LTLA 1YEZA 1YNXA 2ALYB 3KF6A 4A3FG 2K75A 4NXML 1AE3A 4OXPA 3PO2G 4JI6L 2AMCB 3UDXA 4OWWB 2VUMH 3CC4A 2R7ZG 5LMUQ 1Q7YC 3M9BA 1PA6A 3TS0A 1N34L 3S15H 1IBML 3HOYH 1PFSA 2NN6G 4DAMA 1HNZQ 5JJLA 4HJ7A 1PH9A 1TWGH 1VQEA 2ES2A 1SMXA 2NN6I 3HOZH 4JOIC 4A3DG 2XTIA 4UPAA 2GVAA 4KLKA 4B3SQ 4LF5Q 3T1HL 4A3IG 2K5HA 4JI1Q 2PMZE 3AFPA 2F4VL 1CSQA 1L0WA 4KHPQ 1VQ7A 5IYDG 4LFBL 2UXBQ 1VCIA 3H0GG 4R4QA 3AYHB 4LF9L 1P8LA 1DGSA 2R7FA 2JA9A 3HKZE 3RZDH 3CD6A 1E1TA 1PH2A 1TXYA 1XMQL 4LNQA 1PHJA 4GN5A 2KBNA 2R6GA 3PF4A 3J81i 2N3SA 4GNXB 2EIFA 1JB7A 1Q82C 3DM3A 1BKBA 3HOUH 3F2BA 4MZ9A 4DV5L 3TRZA 1N33Q 4DV0L 3ERSX 2CWAA 2VQFL 3GTMH 5LMNQ 1FVIA 1S40A 1HR0L 4DR4L 1IBKL 3L0OA 1Q1BA 4HIMA 2JA8G 2VS1A 2YU9H 3L2PA 3CCSA 1K8GA 4DV1L 1SR3A 1UE1A 5IP7G 1K73C 5EAYA 1V9PA 2BH2A 5C44H 2UUCQ 3S1NH 4KHZA 1EWIA 3K80C 5IT9c 3U4ZA 5DLQE 3IRBA 4EX5A 4HIDA 1C0AA 3BZKA 1XNRL 4GOPC 1HNXL 1U5KA 3KDFB 2YTYA 2RHQB 3OTOQ 1J5EL 2VL6A 3AEVA 2R7DA 5C0XJ 3RR5A 3D0FA 2UXCQ 1IBLQ 2K5VA 4A3DH 3CCVA 2ZJRA 3KJPA 3RNUA 2EQSA 4X65Q 4BY7H 4OX9Q 4X66L 1CKMA 4AQYL 3BU2A 1YHBA 1GVPA 4JG2A 4AYBE 3UDGA 4MTNA 2MFIA 2JK8A 4UP9A 3FKIH 3UDIA 1QVFA 5HY6A 1Q81C 2Z6KC 2I5LX 4PZ6A 1EUJA 3E9IA 4GN3B 1VS0A 1TWCH 4LF7Q 1NJIC 3J7ZC 4LFCQ 1HNWL 2F3IA 3HKSA 4P75A 1BBUA 3CCEA 2IHFA 3CCJA 2Q2UA 4JI7L 3RLFA 2VUMG 4JI4L 3CF5A 3PV0A 1X65A 1CKOA 1P16A 2PI2E 1E24A 4GLVB 2JA5H 3HOYG 2JA8H 1K3RA 4JYAQ 1KRTA