2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1531
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
3KF6B 1N33Q 3AEVA 1MJEA 3CCMA 4POFA 4L5TA 1G291 3CCJA 3D0FA 4X64Q 5GQOA 1UE1A 3NENA 3G71A 1XPRA 3GTOH 4LF6L 4LUOA 2UUBQ 3BU2A 2ZJQA 3HFZB 5FJ8H 5IYCG 1OXVA 4DR3Q 1QZHA 1SLJA 1PV4A 3Q8DA 4L5RC 2ZJRA 1PH2A 1C0AA 4GKKL 4JV5L 4DUYQ 1M1KC 3ER0A 1YHQA 1AE3A 4DR2L 1VQDA 2RHQB 4DR5L 1N32L 3GDEA 2I0QA 1U0LA 1XTDA 1KHIA 3A0JA 1IYJB 2OCEA 3I4NH 4BBRH 4IPCA 4LFAL 4P73A 3I56A 1XJVA 5IYDH 2XGTA 1GVPA 2UXCQ 2IHEA 1SN8A 3KFUA 5IP9H 5GAGC 4JI4Q 3A5ZB 5FJ8G 1J5EQ 5C4JH 1Q86C 4X6AH 1OXSC 1JJGA 4DV4Q 1Z9FA 4JI5Q 4LF8L 5M3FH 5IWAL 1TXYA 4AIMA 2ATWA 3G48A 3I7FA 3CD6A 3TRZA 4GLVB 2ALYB 4DKAC 1MJCA 4BBSH 4A3CH 3I4NG 4BBRG 2AHOB 1VQGA 3PGZA 1XMOL 2HHHQ 4LFBL 4GN3B 3FHWA 5IYDG 4ALPA 2BA0A 3J81j 1VQ6A 2VQFQ 5IP7H 4K0KL 1E24A 3E9HA 5GADC 1HZ9A 3OTOQ 5IP9G 4YY3L 4LFCL 1FVIA 1V1QA 2K5HA 4HJ7A 4NXNQ 2JA7H 1EWIA 2R92G 2GVBA 4DV6Q 1RIPA 5H1SE 2K14A 2UUCQ 1WFQA 3HKSA 1X6OA 4UP9A 4DR6L 2B3GA 1YZ6A 2DGYA 4YHHQ 4C3JH 1YHAA 5M3FG 4DNIA 4Y52H 4C2MH 4A3EH 1SRUA 4BBSG 3I55A 4IOCA 1JJ2A 4A3CG 4RMFA 1W3SA 4LF4L 2N8NA 5LMUQ 5IY0A 4GKJQ 2IHFA 5IP7G 4JI1Q 2WP8J 1YIJA 3K7AH 4X65Q 1MIUA 4QGUA 1X3FA 1L0WA 3G6EA 4DV5Q 5GROA 3UE0A 2JA7G 2ES2A 1BBWA 1CUKA 3JAMc 4LF9L 3MXNB 2K4KA 3STBC 2I5LX 2KHJA 4LUVA 2KCMA 4O2DA 2YYZA 4PZ6A 4OWXB 3U4VA 4DV2L 5IT9c 2VW9A 1X56A 1GM5A 2CKZB 1B7YB 1LUZA 2VZAA 4A3EG 3G4SA 5FLMH 4A3MH 1M90C 2I5MX 2RHSB 1N36Q 3WWVA 3S2HH 1S3OA 1EIFA 4R4QA 1UE6A 2E2JH 1A8VA 3I4OA 4R1JA 1S72A 4UPAA 2N78A 4B3SQ 1VQNA 3HOWH 5JEAG 3W5OA 1EYGA 1H95A 1UE5A 2JA5H 4GLAC 3J81c 3CCLA 2D0OA 1BKBA 1K0RA 1C7YA 4JBKA 5FLXc 4R4OA 4HIOA 2MFIA 4R4CA 3S1QH 4B3RL 1E1OA 5AJ3L 1VQCA 1HNZL 2JA8H 4DR4L 1XMQQ 4DPGA 5FLMG 4A3MG 4PMWA 3STBD 2IX1A 3L2PA 4IFDI 3ZJYC 1FGUA 2IT1A 1VQKA 3CMEA 4OO1I 4B3ML 2MNAA 2Z0SA 4R4TA 3GTJH 1W2BA 2EQSA 4LF6Q 4L5QA 1L2FA 3M9BA 2BH2A 3HOWG 3PF4A 2CFMA 1Q82C 2JA5G 1X65A 2OQ0A 2ZJPA 4HJ9A 1A62A 4BY7H 4NXML 2R6GA 4GKKQ 1NE3A 4R4IA 4JV5Q 1OTCA 4DR5Q 1OXTA 4DR2Q 1JB7A 2N49A 4LW1A 1EQQA 1VQ7A 3GTQH 4OX9L 3NBHB 4BY1H 2JA8G 1PH3A 1I50H 4UP7A 5ELNA 4JBWA 4LFAQ 4A76A 2OTJA 1YVCA 3RLNA 2F52A 1KXLA 3U4ZA 2NN6I 3GD7A 3BZKA 4DK3C 3UDIA 2C35B 1YJWA 4IFDJ 1HZCA 4BY7G 2OWOA 4JC0A 4JI7L 4GOPB 4LF8Q 3H3VI 4MNOA 2JA6H 5IWAQ 1TWFH 2B63H 3S16H 1TWHH 1PYSB 4JI2L 4BY1G 1TWAH 2NZOA 4IPHA 1WCMH 1XMOQ 5C0XI 3HOVH 4LFBQ 4GLXA 3H0GH 4YWKA 4JI3L 1ASZA 1FJGL 1IL2A 4A3LH 4K0KQ 3CAMA 4JBJA 3PV0A 4YY3Q 2AKWB 1YJNA 2UU9L 1CSPA 4NPSA 4DAYB 4L5SA 4LFCQ 4IOAA 3DLLA 2PI2E 2R7ZH 3FP9A 4JOIA 4DR6Q 3TS2A 4LF7L 3M4PA 1AH9A 4JG2A 2JA6G 4JI8L 2B63G 3TREA 1EUJA 3CXCA 4ME3A 1PFSA 3J80c 1QVGA 5M3MH 3UE1A 3CCEA 1IXRA 1WCMG 4OO1G 3HOVG 1VQMA 3I2ZA 3S24A 4LF4Q 3H0GG 1JJCB 4A3LG 2R92H 4GS3A 3PO2H 3CCUA 3T1HL 2DUDA 2MQHA 1Y1WH 3A5UA 4P74A 1G51A 4DK6C 5LMNW 3F8TA 5C0XJ 3T1YL 4LNQA 3H3VH 2R7ZG 2QA4A 3GTMH 4LF9Q 1VQAA 3PUXA 1GD7A 1VQJA 3A74A 4DV3L 4JI0Q 4J15A 3ULJA 2JEBI 4DV2Q 1YEZA 1AE2A 1N9WA 1KAWA 4A3IH 3KOJA 1NJIC 1EIYB 3J80i 1DGSA 5M3MG 3F1ZA 1IBML 4QY7A 2KBNA 3IRBA 1HNWL 4IPDA 4XIGS 3DM3A 3PO2G 1PH9A 3M4QA 4DR7L 1Y1WG 3HOXH 3J7A5 2WFWA 2ASBA 4GOPA 4A75A 4JOIC 1N34L 2UXDL 1XNQL 1C9OA 4NB3A 2F4VL 4QIWE 3W1BA 5C3EH 5GAEC 2JQOA 1L1OA 2WAQG 3TQYA 1VQOA 4B3RQ 4OWTB 3HOYH 3CPWA 5AJ3Q 4A3IG 1HNZQ 4DR4Q 4YWMA 1VQFA 2VQEL 2KENA 2D0PA 1PYBA 1N8RC 1YNXA 1CKNB 1CSQA 3D31A 2AWNA 3JC66 4KI0A 3CF5A 3RNUA 1X3EA 1PH8A 1QZGA 5ELOA 1CKOA 3TEHB 1YHBA 3HOXG 1PH6A 1Q1EA 1I94L 4NXMQ 4JI0L 1QVCA 4DV1L 2EIFA 1QUQB 3KJPA 2D62A 4DUZL 3HOZH 5C3EG 2PQAB 1NTGA 3AFPA 1WJJA 3CC7A 1YITA 2E8GA 3EIVA 1X3GA 3MEFA 4JCVE 5JEAJ 4OX9Q 3HOYG 1Q12A 1VQIA 2Q2UA 2KCTA 1Q7YC 1UWVA 1EOVA 2UUAL 1WOCA 4DR1L 1XNRL 3K80C 2K52A 3CCVA 1HZBA 3KF8B 3UDXA 1Q81C 4AH6A 1EFWA 4YCVA 1OXUA 4A3FH 3JAMi 4H02A 1V43A 2AMCB 4GOPC 3K81C 2PNHA 4GNXB 2XTIA 1TWCH 4LUZA 4X66L 4JI7Q 1VQ8A 3F2DA 3U58A 2L15A 3HOZG 4A4IA 3BZCA 2VY3A 2HIXA 2ZTDA 4AQYL 1VQ5A 4BA1I 2Q2HA 3KJOA 4A3BH 5JJKA 4QL5A 4JI2Q 3UDGA 2PMZE 2BH8A 4RG1A 4P71A 4JI3Q 1FJGQ 2A8VA 3RN5A 1IZ6A 3S1MH 1SROA 4QJFA 2CQOA 2YTVA 2JJQA 2UU9Q 3J81i 5JJIA 5BR8L 3HKZG 4LWCA 4YCUA 4A3FG 1KIXA 3S15H 2NZHA 4AYBG 1IBLL 2YTXA 2JE6I 4LF7Q 2K5NA 1NBWA 3PO3G 3OYYA 2Y0SG 4PZ7A 4JI8Q 4EX5A 4HIMA 2HIVA 3PUYA 2VNUD 2IX0A 3E9IA 1VQ4A 4A3BG 1VQLA 1VCIA 3RLOA 4DAMA 4LF5L 2VUMH 1CKNA 1OXXK 1KRTA 1NMGA 2UXBL 1J6QA 3S17H 3K8AA 3CC2A 1JMCA 3T1HQ 1BVSA 1HR0L 2N3SA 4B3TL 4YCWA 1Q46A 4APVA 3T1YQ 4X62L 2JK8A 3GTLH 3KLWA 4WJ4A 1QUQA 1QVFA 2HQLA 4OONA 2NVQH 1D8LA 2PQAA 2E5LL 1A0IA 4OWWB 1K73C 4A93H 4DV3Q 1I3QH 4GN4B 1L1OB 4PG3A 5C44H 4HIDA 1B8AA 1X9NA 3PUWA 1HNXL 3S2DH 4BXXH 2YV5A 2VUMG 1IBMQ 1LM0A 4BA2I 1HNWQ 1K8AC 4XTCS 3VDYA 2OTLA 2KHIA 1Y14B 3ULLA 1GKHA 4DR7Q 3GO5A 2FXQA 1IBKL 4GNXA 4IO9A 2NVXH 2JEAI 2UXDQ 1N34Q 1XNQQ 2GN5A 1HZAA 3KYHC 2F4VQ 1KQSA 3J7ZC 4A93G 1PH7A 2VS1A 4IFDG 4MTNA 3RZOH 1LTLA 4C3IH 5C44G 2QEXA 4O0AA 2VQEQ 4TQUS 4DV7L 4BXXG 3GTPH 3K7UC 5LMNL 5JJLA 1VQPA 3PUVA 5E7NA 1HH2P 1UEBA 2QGQA 5HY6A 2ZM6L 4DV0L 1PH4A 1V9PA 3ERSX 1VS0A 4A3DH 1E1TA 2Z6KA 1WI5A 3PUZA 3S1NH 1I94Q 2CWPA 3L7ZC 2IY5B 4DV1Q 1PVOA 3PIPA 4JI6L 1U5KA 3PCOB 3U50C 4DUZQ 1NMFA 1SR3A 3UDFA 1YJ9A 4JYAL 1R9TH 1BBUA 3M4OH 1JT8A 2NN6G 3CC4A 4TVAB 4KHPL 3PIOA 4IPGA 1XNRQ 2UUAQ 2YU9H 4KHZA 4DR1Q 2R93H 3RLFA 3TS0A 4GNXC 4A3DG 1SE8A 2LXKA 1FL0A 3AYHB 3CMAA 3F2CA 2JA9A 4X66Q 2R7DA 1N33L 5C0XG 2V1CC 3EBEA 3CCRA 4AQYQ 1GO3E 4X64L 2LSSA 2WB1G 4GN5A 2E2IH 3AFQA 1WYDA 3B6YA 3CP0A 3EN2A 4A3JH 2UUBL 3SGIA 1K3RA 5M5YH 4HJAA 4OXPA 3NELA 4DR3L 2R93G 1VQEA 3CQZH 1JE5A 4PZ8A 4IJLA 4UY8C 2ID0A 4DUYL 1E22A 1SMXA 2Z6KC 5BR8Q 3CCSA 2WAQE 3CPFA 3ULPA 1S40A 1XPUA 2GVAA 2ZTCA 3M85A 3H15A 1IBLQ 2ZTEA 3GTKH 4C3HH 1T9HA 2WB1E 3KF6A 1B70B 1KD1C 2EXDA 2RCNA 2UXCL 1D7QA 3W1GA 2K75A 4MZ9A 1VQHA 2VL6A 1SFOH 4JI4L 4LF5Q 3E0EA 4A3JG 1J5EL 3M7NA 1I6HH 3KDFB 2K5VA 2UXBQ 5IYBH 5GAHC 4HIKA 1HR0Q 1K83H 4HJ5A 4YWLA 4JI5L 1KRSA 4DV4L 2EDUA 4B3TQ 2HT1A 4X62Q 1Y1VH 2R7FA 3I4MH 2YTYA 1E7ZA 3RN2A 3RZDH 3PO3H 1L1OC 1K8GA 2E5LQ 1Q8KA 5J3BA 1P8LA 3F2BA 3M3YH 2HHHL 3HOUH 5C4XH 1UE7A 5DLQE 2VQFL 2B29A 3OTOL 1HNXQ 4NXNL 4DV6L 3S14H 1G6PA 3BJUA 3NEMA 5IYBG 2OQKA 3CCQA 2UUCL 2H5XA 4YHHL 1K9MC 1CKMA 2Q2IA 1IBKQ 3CW2C 1Y1VG 1TWGH 2K50A 3I4MG 1Z47A 2MO0A 5M5WH 4B3MQ 4UP8A 2Q2TA 4POGA 5HGQA 1RL2A 3HOUG 2I5HA 1HR0W 1X54A 5LMUL 1XPOA 2E2HH 4P75A 2NVTH 4GKJL 5C4XG 1MKHA 4JI1L 1A63A 2BA1A 3FKIH 1LYLA 4KLKA 3HKZE 4X65L 4DV7Q 4A3GH 4DV5L 5LMNQ 3AQQA 2RF4A 3GTGH 4AYBE 1X55A 2LXJA 2ZM6Q 4DV0Q 3OW2A 1ASYA 2A19A 2CCZA 1O7IA 2Y0SE 3K0XA 4A3KH 4EQ5A 1N32Q 3S1RH 4JBMA 1NY4A 1PHJA 3LGJA 4WJ3M 1P16A 4JI6Q 1YI2A 5K36G 4JYAQ 1N36L 2CWAA 1PA6A 4Y7NH 4KHPQ 3KDFA 1Q1BA 4B3SL 5EAYA 1KC8C 3FKIG 1HJPA 5IYCH 4A3GG 2MO1A 1VQBA 4IJHA 4HJ8A 1I5FA 3ICEA 4P72A 3RR5A 3PF5A 1EQRA 2A1AA 2F3IA 1PH1A 1KL9A 2AWOA 4FDBA 1VQ9A 4A3KG 2PI2A 1E3PA 4QQBX 5IE8A 2NVYH 5M5XH 1YBYA 1PH5A 3L0OA 1XMQL 3PSIA
chains in the Genus database with same CATH superfamily
1N33Q 1KLGD 4NMZA 3CCMA 1XPOA 4POFA 3CCJA 3DUZA 2EJGC 2FPLA 4O0IA 2I46A 2ZJQA 3KZXA 2EANA 4ED7A 1NK8A 2JEJA 4IQTA 4ECSA 1BXTA 3NHHA 5TSSA 4KLOA 4DR3Q 1QZHA 1ECWA 2IW3A 5FLXE 3Q8DA 1TK0A 4ZKBB 1C0AA 4DSEA 1YHQA 2NO5A 4DR2L 3KBXA 1N32L 4C8KA 3GDEA 4O3QA 1BF4A 2F0TA 1KFDA 1RCVD 1XTDA 2I1QA 2XSCA 2I0QA 4YR0A 2OEHA 3IM1A 2ZXPA 5D14A 1JI7A 2L4NA 4A3EB 2J4XA 4UAWA 7ICLA 4DK1A 2MUTA 1PTOB 1BPXA 3KFUA 4C7ZA 3KUPA 3K1ZA 4KKTA 5IP9H 5T1IA 3ITPA 5FJ8G 3M9MB 1WTVA 2JH7A 1I6HB 4H44C 1Q86C 3D6CA 1STAA 2M9NA 3QZ7A 3QR8A 2JGAA 1OXSC 5IODA 1Z9FA 1G6ZA 5ALNA 2CVRA 5M3FH 3RR7A 4AIMA 3QO2A 4BJQA 1VF7A 3HILA 2P6UA 5ELCA 5C5LA 4GN3B 1ZEQX 5IYDG 4O5CA 1DXMA 4EQOA 4K0KL 1E24A 3E9HA 1HZ9A 4M0AA 3FRPB 2MGSA 3S2HB 4LFCL 2G06A 5TISU 2ALZA 2K5HA 2F03A 5DDMA 2JA7H 4KLSA 2BCVA 3U9OA 5H1SE 2F0QA 2K14A 9ICTA 1KDAA 1FNUA 3HOWB 1J2NA 1X6OA 2LKVA 7ICJA 1YZ6A 4DQPA 2C5CA 2OEOA 1LTGD 1IV8A 5KG2A 4DNIA 5EGTA 4ZK9B 1SRUA 4ODGA 1SSOA 1ZD5A 2ZXRA 5EE9A 4FXDA 2A1JB 3PNCA 3PSFA 2N8NA 4GKJQ 1S5FD 4BDPA 2ZXHA 2X69A 1B50A 1E2VA 1YIJA 5JJZA 5JEAH 2EY1A 2NB0A 1MIUA 2QF7A 2A3VA 1L0WA 3G6EA 3N52A 4XYQA 1XO1A 3OPXA 1PMRA 4BXOB 2HD3A 3A8JE 3HGBA 4X5VA 3STBC 4KITB 1IIPA 5DQGA 1JB3A 2F0HA 4DLGA 4O2DA 3U4VA 4K2KA 1LUZA 2K5DA 5DBAA 4J1MA 4A3EG 1IKMA 5FP0A 3R3OA 5F2DA 4O9MA 3Q23A 1RKNA 1NK4A 5C3WA 4R4QA 1SJED 5ALPA 1UE6A 2NYZD 2X6LA 1ENFA 2WHEA 7ICPA 4DO9A 1TS2A 4B9VA 1BQQT 1EY7A 1UAPA 4HCSA 4R1JA 3W5OA 4FYDA 3RJHA 3K1RB 2HHQA 2RBMA 3KLSA 3UQ0A 4RPZA 4B9XA 2H3VA 4MTKA 3JPRA 4Z6CA 3L9AX 5FLXc 4R4OA 4HIOA 3AQEA 2MFIA 3QJYA 3E6ZX 1E1OA 3UXNA 5KFJA 4O42A 3MHBA 4FZLA 1HNZL 2W9BB 2HVHA 4PMWA 1TWHB 3T13A 3AQFA 3ZJYC 2RSOA 2ASJA 3L2PA 4IFDI 8ICZA 1S4ZA 3NTUA 1EY6A 5J2FA 3CMEA 1ENCA 4OO1I 2Z0SA 1IYVA 3P1HA 2PCFB 5EQ0A 3HOWG 4TUSA 3URYA 2ZG6A 1Q82C 1X65A 4HJ9A 3TADA 2W9AA 4DU9A 1RQNA 1P7DA 4DA2A 2P6RA 4JV5Q 3GU3A 3D4DA 1OTCA 5KFBA 4LW1A 1EQQA 1S0NA 2DUYA 5DQIA 3NBHB 4OJOA 1Q3UA 4RQ2A 1I50H 4LFAQ 5ELNA 3FYHA 7ICSA 4JBWA 1GO3F 3OSNA 4QIWB 1YVCA 3I4NB 2F52A 2EYOA 3BVMA 1KXLA 2NN6I 3LWUA 2H3QA 3D3RA 4PHAA 3O13A 5J2IA 3MXNA 1S9FA 1EY8A 3M8SA 4DOBA 5IT9E 1FNWA 5H2FU 4K4IA 2O6KA 2OWOA 1BPZA 1A15A 3TFRA 3H3VI 4EELA 2W7OA 1ZQHA 2JA6H 2EYHA 1QNUA 2KKPA 1EYAA 2F0MA 4BY1G 4ECQA 5AIAA 3OSOA 3GIIA 4IPHA 4OO1H 4BBSB 4CF5A 2XGQA 5C0XI 4DOCA 4GLXA 2F2AB 3H0GH 4YWKA 1IL2A 2JYOA 4JBJA 4YY3Q 5AFWA 1CSPA 4NPSA 4DAYB 3R2IA 3MABA 3DLLA 3TADC 1ZQYA 3N7RC 4PHEA 3T5HA 2PI5A 3SK4A 4JOIA 2K4HA 4DR6Q 3QUBA 2Z4HA 3TN2A 4GFJA 1H9JA 4IURA 2FLPA 5CV9A 1ZQ1C 5C6AA 1LT3D 5EPLA 5KFKA 1SZHA 2Z4IA 5M3MH 1JORA 3CCEA 1ZQDA 3Q22A 4LF4Q 1KDHA 4K8IA 4BGDA 5J2DA 1FGBD 1SE3A 1QB5D 4A3LG 3T51B 3GQBA 4GS3A 5AKHA 3PO2H 4I28A 3SENA 3PY8A 2PMZB 1Y1WH 4HMJA 3LK9A 4I2DA 3NSWA 3H3VH 2R7ZG 2QA4A 1XNSA 3GTMH 4LF9Q 5CEHA 4YR2A 1ZQJA 2SEBD 2V4DA 1GD7A 5AM3A 1VQJA 5L9XA 1KSPA 3PV8A 1DK3A 2GA4B 3LVWA 1NK6A 9ICOA 2XO7A 1KAWA 1N9WA 2ASLA 2F0SA 4IUNA 1TR5A 4ED6A 4LVSA 1L8LA 3D2SA 3F1ZA 5HHHA 2LPEA 1S5LU 1N5XA 3M8RA 4F4ZA 5I9PA 4P0PA 4F5OA 3DM3A 2EH9A 3M4QA 1VLBA 1Z00A 1E2WA 3RMHA 2WFWA 3K5MA 4B08A 4IQWA 4JOIC 1XNQL 2XGPA 3DXJC 3W1BA 5C3EH 5BN4A 4OWTB 5KT6A 5AJ3Q 4LK1C 4YWMA 3UMCA 3NTIA 1TIID 4XDXA 4QUFA 4QWCA 1TKDA 3H40A 1CKNB 4KI0A 3CF5A 1PH6A 4UAYA 1WTXA 1I94L 1ZQKA 1SMYD 4JI0L 1VDVA 2FJ6A 5EE0A 3HOZH 1YNJC 4I29A 1ZYRC 3AFPA 2F0WA 1YITA 3EIVA 2B63G 3MEFA 2XNAC 3RAQA 3M4YA 3DDHA 5JOBA 3K58A 1Q12A 1VQIA 3N6RA 2Q2UA 2F0IA 2KCTA 3B0YA 2TMPA 1EOVA 2UUAL 1XNRL 3K80C 1AZPA 3D8GA 1HZBA 2FMSA 4G7ZC 1ZQVA 4YCVA 4F50A 1D5MC 4PH5A 4L63B 2B0CA 5HR7A 4DS5A 5DM73 5J0UA 5EOZA 3N7SC 5KAFU 3CNHA 4AQYL 3M1YA 2IMWP 1H9SB 5AM5A 3SEIA 2Q2HA 5JJKA 4QL5A 3UDGA 1I4XA 2BH8A 1EY0A 5IGDA 1XYIA 5C44B 1H9KA 1WCMB 1KDBA 4KLQA 1FJGQ 3HJEA 3S1MH 3S2DB 1W6JA 1X6JA 4QJFA 1FO4A 1I4RA 2CQOA 5JJIA 2A6HD 3J81i 2KOLA 1B0XA 1SDFA 4J9MA 3PW7A 1VMPA 3R8BA 1KIXA 3S15H 4X3SA 4M6WB 3NK9A 2HDOA 4U6PA 1VJ5A 4CGZA 2JE6I 2K5NA 3ERQA 3PO3G 2NVXB 1LT6D 1YZ7A 2EYMA 1HCZA 2Y0SG 5EKKA 2R8JA 4PZ7A 4EX5A 3QNMA 5DQHA 1PK3A 2IX0A 3E9IA 4C1NI 4DNRB 4HTHA 2VUMH 2HHVA 3T53B 5DG9A 1RG6A 1PRTF 2K32A 1J6QA 4Q0FA 2P35A 3K8AA 3CC2A 1NNXA 1BVSA 2TSSA 3NPPA 5J39A 3FVQA 3GTPB 3T1YQ 4X62L 1F5SA 2FHTA 1QUQA 1QVFA 5J1ZA 5ALJA 1ET6A 2E5LL 3MXPA 2BQ3A 3DMUA 4DK0A 2ZUDA 3WKEA 3ONNA 3IV6A 5KFVA 3H8SA 3ZD8A 2B2UC 4HIDA 4A3IB 1X9NA 4XRHA 4CJ1B 3OW7A 3M4OB 2IBKA 4C7YA 3KF8A 4KX3A 1J9OA 2EAMA 2PW5A 1ET9A 3K5OA 3TDQA 1HTLD 4P4MA 3ULLA 1TFRA 3IRUA 1GKHA 4WORA 2FXQA 1L7NA 4GNXA 3KZIU 2UXDQ 1N34Q 1HZAA 1SGGA 2IJ0A 2M0NA 2WF7A 4IS7A 1GOZA 2VS1A 1UHUA 4C3IH 5C44G 4KLTA 1NZBA 1HA6A 1T5XD 2AQ1B 3OMCA 4IUVA 8ICVA 5DBCA 2O4XA 4O0AA 4TQUS 2QEXA 2VQEQ 4DV7L 2E2IB 1VQPA 2PI4A 1DOKA 5ALKA 2JEGA 4P2CB 4PGQA 1LB2B 2QGQA 4CDEC 1ENAA 4A3JB 1RJTA 1V9PA 2E8MA 3I1YA 3TQ1A 3RB3A 9ICSA 3M7DA 1CHQD 4IUTA 3RUZA 3TI0A 2LHTA 3BQ2A 1PFNA 4FF1A 3ORYA 3AMUA 4DV1Q 2XY5A 3KTQA 2KNJA 4I2HA 1U5KA 3PCOB 4DUZQ 2KFNA 1SYBA 1YJ9A 3F2UA 3GTKB 5C5JA 4IN3A 5KRUA 2WIIB 4TVAB 1EY5A 1CT1D 3CP8A 3GQCA 2F3VA 1DJRD 4KHZA 4ECYA 4DR1Q 1N34L 2YU9H 8ICKA 3CRKC 2W3SA 1WVLA 2R93H 1D2BA 1WUDA 2AUKA 3TS0A 3MR3A 3OIQA 1Z3EB 3EROA 3QOJA 3QWNA 4GNXC 3HKZB 4A3FB 1NOMA 1SL1A 3OMGA 3AYHB 2G07A 1RYSA 3WK4A 1Z7TA 4F5NA 4ULLA 1Y1VB 2HHXA 4X66Q 1TWCB 1N33L 4MF8A 8ICYA 2V9WA 3J81L 4FS2A 3AFQA 3IG8A 1WCNA 1LT4D 2E75C 3QE9Y 2E8PA 5M5YH 4HJAA 8ICHA 3F5AA 1JX4A 3NELA 4OXPA 4DR3L 1LKYA 4PL1A 4UARA 4Y2XA 4X3TA 3UMBA 5LL6X 4IJLA 5DB8A 5D46A 2ID0A 2QDBA 2HBJA 2DL0A 2Q0ZX 1STNA 2WAQE 4RQ8A 5J0RA 1S5BD 1S40A 3ALRA 2AQ4A 1IBLQ 5KFPA 3HOVB 5KFTA 2W9CB 5IIJA 1MBYA 2EAOA 1G8ZD 2MSNA 5AKGA 4O5EA 3Q8LA 2A68D 3BQTA 1TK5A 1RHPA 3EJIA 3W1GA 4MZ9A 3BDOA 4A3JG 3PMFA 3KDFB 1UCVA 2CW0D 4DXFA 4G7OC 1HXYD 5IYBH 5ELEA 1PRTC 3S17B 1FIQA 1HR0Q 4JB3A 2RDFA 4DL2A 9ICVA 4HJ5A 5DB6A 3H3VC 2NWGA 4RZRA 4M9NA 5AICA 2YTYA 3PO3H 4TKOB 2JHDA 4Z6EA 1SYFA 2FMPA 2WAQC 4ECXA 2SNSA 5AKIA 2F1IA 3I8ZA 3M3YH 3S1RB 4RH6A 9ICLA 1UPHA 3G6JB 2B29A 2UVUA 2MUYA 3E5SA 3LNNA 4C8LA 2Q4TA 5DM63 4DEZA 1NR2A 3VR3A 4Y7NB 1PYWD 1GJXA 1EFID 1G6PA 2VB3X 1XWEA 2JEIA 4B9MA 2NO4A 1YNNC 3NP8A 2DF4B 4HEDA 1K9MC 5ALZA 1NK5A 2JZBB 7ICIA 1FYCA 2H3IA 1TWGH 1Y1VG 2K50A 2P5ZX 4PQXA 4RPYA 5M5WH 3NVZA 4FZNA 2LMCB 2E2DC 3GV3A 2R8KA 5KT7A 1TE2A 5HGQA 2I5HA 1NKBA 2YQEA 2NVTH 3RZOB 2E2HH 4GKJL 2CH4W 1A63A 3FKIH 1LYLA 5EBDA 4H7BA 4A3GH 2DY7A 3AQQA 1SE2A 3GFKB 4AYBE 1I4HA 2LXJA 1ASYA 4CF3A 2CCZA 2GLEA 2KP7A 5AK6A 5EWGA 1O7IA 2G9DA 5K5PA 1OO9B 4JBMA 3QYPA 5AK4A 2K28A 1B22A 4DFKA 1PHJA 3LGJA 4GXIA 2V4RA 2F0LA 1YI2A 3IAYA 4JI6Q 4RGOS 4ILWA 5L1KA 4US9A 2XIDA 4RCOA 5EAYA 2PZTA 3J7AF 2J6TA 1HUNA 5IYCH 8ICSA 5BOLA 3A7AB 2HHWA 2B2YA 3A8KE 1ZQWA 2X6GA 4BXOA 3NQIA 4IJHA 1I5FA 3I76A 2Q8TA 4EX7A 3PW4A 4F92B 1PH1A 2A1AA 3Q8MA 4OO1J 1KL9A 3H4BA 2K03A 5I6YA 4XUSA 4QMGA 2PI2A 4ECUA 4QZEA 1XC9A 1RQLA 2DBYA 1K8MA 2NVYH 5LMNW 3L0OA 1NK9A 3PSIA 3V6KA 3KF6B 5G5GA 1L0XB 4DL4A 2IPKD 1G291 4L5TA 4BS9A 1WTWA 8ICOA 4XT3B 3BU2A 3HFZB 2FI1A 2KZ3A 1TT2A 2ZIWA 3VYUA 1PV4A 1MN8A 3SVMA 4DLEA 4KD4A 2JA7B 2EY6A 3CRLC 1N56A 3NE5B 1SYDA 4DUYQ 1VF5C 1M1KC 5KTQA 8ICBA 3ER0A 4JV5L 1VQDA 2W8LA 3RRGA 4I2FA 2Q8IB 1U0LA 3TP5A 3A0JA 2FPMA 4UW9A 4KLGA 8ICWA 4M9GA 4IPCA 3C2KA 4P73A 4LFAL 2W9BA 1TY2A 3I56A 1XJVA 1HA5A 4ZUIA 1B4OA 2PMZF 3KKAC 4Y2RA 2Z8LA 3IFDA 5GAGC 3QG1A 1J5EQ 4DFMA 1BPDA 1B4FA 2B2YC 3PMNA 3EA6A 1XSLA 1UA0A 2FE9A 5J2AA 1C8CA 2VA3A 1JJGA 5KFIA 1K83B 2L5YA 2ODGA 1ZXIA 5DG8A 5FK9C 1TXYA 5HP4A 3I7FA 3I4MB 3TRZA 4RT2A 4DKAC 3VA7A 9ICPA 3RZDB 2FFKB 2VA2A 4I2BA 4F8RA 2RDHA 2AGOA 4C4RA 3J81j 1VQ6A 3HOUB 3QX7A 5IP7H 3RF9A 5IP9G 4YY3L 1X9MA 3MFYA 5IOCA 4HJ7A 2R92G 2FMCA 2E2JB 1ZQMA 1WFQA 4DR6L 4DAPA 2B3GA 3BQ1A 4YHHQ 9ICXA 4X3KA 4UB5A 2B39A 1KAAA 1XTCD 5M3FG 1LLRD 1STHA 1S5CD 3Q24A 3BQ0A 1ILPA 8ICAA 9ICQA 5HGTA 2NRZA 4IOCA 1JJ2A 3NRZA 2AQ3B 1LTSD 1TU2B 4LF4L 1W3SA 4ED2A 5LMUQ 2JXJA 3DHQA 1T7PA 4J9OA 1J2MA 1PZID 4CF4A 3EWAA 3K7AH 4X65Q 4CDFC 4DV5Q 2JA7G 3QEAZ 4F2RA 3DEOA 3PX6A 1SE4A 1ZXTA 1CUKA 2ES2A 4LF9L 1U9LA 3BDPA 2KJXA 4YMOA 4A8EA 4I7AA 1V38A 1V97A 2I5LX 3G7LA 4F87A 4LUVA 2KCMA 4PZ6A 1T3QA 2PFQA 2P66A 1GM5A 2FJ2A 1B7YB 3RTVA 2IOFK 5FLMH 4A3MH 4PHPA 2I5MX 2RHSB 3WWVA 2YY6A 1AZQA 1S3OA 3M7GA 2K5WA 2R3ZA 5J0YA 1BUVT 3I4OA 1S72A 1TS5A 1EZ6A 4KLLA 5KT4A 3PZPA 5CV4A 5JEAG 1UE5A 2JA5H 2N55A 4RHSA 3J81c 4KKSA 3BS5A 4IR1A 3M9OB 3WK7A 4DQRA 1ESRA 4JBKA 1X9WA 3W2DA 4M47A 1I6VC 4R4CA 4M9HA 3S1QH 2KICA 3HZXA 1ZQAA 4ZRZA 5AJ3L 1VQCA 2JA8H 2W9MA 2JEFA 4QZDA 1ZQEA 1HUMA 5CWRA 2IT1A 1VQKA 2MNAA 3ONAB 1UA1A 7ICEA 1L2FA 4MEXA 3H0GB 1GUWA 1H38A 3I3CA 2ZJPA 1NNLA 1ZQOA 1N48A 4BY7H 3TP8A 2E8OA 5ALYA 1A0PA 2KIWA 1OXTA 3KBGA 2DNEA 1YNND 3D4WA 1QSYA 2DWQA 3MR5A 4UP7A 1AW7A 4A76A 3I72A 1XO0A 2CRXA 3VR2A 4QUCA 4PNYA 4L6TB 3EVQA 4USAA 3C46A 2PMZC 2Z1CA 2C35B 1T8EA 1S0VA 2YN4A 2DQNB 3QEBZ 1NAPA 3D6WA 3PO2B 5C4JB 1Y1WB 2C28A 1QWYA 2YMPA 4IRCA 2F0FA 3NQTA 4LF8Q 2NBFA 3H94A 3NUCA 2B63H 1ZQSA 4F72A 1TWAH 1L7OA 5ALHA 1TVAA 2RCFA 4LFBQ 3GV7B 3WKBA 1FJGL 3L3OC 1RM6C 1YJNA 5EPJA 4L5SA 3KHGA 2F76X 4EBEA 3IHQB 1PTOD 8ICRA 2EE1A 3C2PA 4IOAA 4RQ7A 4YN4A 3SEBA 4I2IA 4P0QA 3RJEA 1D1KA 2DKZA 1FNVA 2KSOB 5JTIA 2JA6G 2ZJ5A 2KMDA 1KFTA 2L12A 3IP4B 2LS01 3V96A 3MC1A 4DSIA 9ICEA 1L6NA 1PFSA 2C2EA 2C2DA 4RKBA 4WFN3 1IXRA 4XT1B 4C4SA 5T14A 4OO1G 3IL8A 3I2ZA 3S9WA 5IIOA 3LYSA 1CI3M 1JWSD 1IYUA 2BPGA 3H0GG 4J9RA 3NTKA 4I7ZC 2R92H 3CCUA 5HMMA 2QB1A 2OT2A 3A5UA 3UMGA 3T1YL 4LNQA 2HDMA 2ZIXB 5AHXA 2XVTA 2EPBA 1OXJA 5CP2A 1VQAA 3BQ7A 1CA5A 3A74A 2KV2A 1WTOA 3MFHA 4J15A 2JEBI 5C5MA 3QIAA 3FEWX 3WK5A 3HPOA 1NK0A 2EZXA 2WFAA 3DWQA 1NJIC 3HOZB 3J80i 2YX8A 5M3MG 7ICHA 1ICFB 3MWYW 4QY7A 2K89A 1LABA 1SMYC 3A0BU 3LWLA 3D2NA 5CR0A 2RHFA 3HKZF 4NXZA 3OGUA 1PH9A 3PO2G 1Y1WG 2H1EA 3J7A5 4F88A 4DQQA 2I9GA 4A75A 4JVZA 1KFSA 2HBMA 5KG0A 2L9HA 4GOPA 1C9OA 1SB3C 2L0CA 1PZKD 3KK7A 4TSSA 4JK1A 1O7YA 3KLRA 4AYBB 2JQOA 5J0OA 2WAQG 2VIXA 3RH6A 1CEZA 1BCPB 4NDXA 4M04A 2O5IC 4DR4Q 2BDUA 2ES6A 4R63A 1U9RA 1VQFA 1Q90A 3QU7A 4ZUJA 2VQEL 5L1IA 5DG7A 4DSFA 2D0PA 1KQQA 1L3UA 2XWBB 3ND8A 1EYDA 3M9NB 4N8X1 2AWNA 3JC66 2KTQA 3BYYB 1KBUA 1X3EA 5E4WC 4B3MQ 1CKOA 1CK1A 3TEHB 3T79A 5HR6A 1D6EC 3S1MB 3PX0A 1Q1EA 2HOFA 9ICMA 4NXMQ 1QVCA 4DV1L 1B9NA 3TZDA 1BOSA 3VR6A 4QZAA 2WKCA 4DUZL 5C3EG 1EYCA 1WWUA 4FF3A 4G9BA 1NTGA 1KKXA 3C28A 2KUMA 9ICUA 4DCCA 1R4QB 4JCVE 2R8GA 2CH4A 4XYOA 3GTQB 1UEAB 4NLNA 2A6HC 2UVWA 1EIGA 4BY1B 1Q7YC 4KLFA 4DR1L 5I9OA 4MHEA 1PUZA 5L1MA 3V2TA 3F53A 4CE6A 1WWVA 4HYKA 2M2LA 4AH6A 2QLTA 1Z1VA 1T3NA 1BGXT 4PPXA 3O0FA 3AU7A 4OGQC 4ZYSA 4EQPA 3JAMi 1URJA 2H3FA 4BUGA 2B6GA 4GOPC 4F93B 4X66L 4LUZA 4JK1C 4JI7Q 3F2DA 3U58A 1T4GA 1RTOA 2L15A 4A4IA 5J22A 3Q0AA 3HOZG 1F9RA 4J8QA 1TWFB 1CFMA 4EEKA 2QARB 1ICWA 3KJOA 4RG1A 1PXUA 1EU3A 3HRDD 3ZD9A 1EQVA 2JP1A 2KVMA 1DOLA 2YTVA 5F9LA 2ZIUB 5J2KA 2JJQA 4DGZA 2UU9Q 4YCUA 1TAQA 4LWCA 3H8MA 3NVYA 2NZHA 2QCPX 4AYBG 8ICJA 1IBLL 2R7ZB 2YTXA 3GV5B 1NBWA 1AEXA 3AB9A 4RNOA 1ZQUA 1G2TA 1HFNA 3KBBA 5ISRA 3H0RB 3RJIA 5AM2A 1VQ4A 4JUZA 4ED8A 4DAMA 4C3IB 3RB4A 4IZ8A 1AROP 4YFKA 1OXXK 3QZ8A 1NMGA 4RAUC 3PO5A 1X66A 4BWGB 1JMCA 4Y2VA 3T1HQ 1HR0L 4NLGA 2FLNA 2W54A 4DL3A 3WOFA 1SEBD 4APVA 1U45A 3GTLH 4WJ4A 3TANA 2Z9HA 2XCPA 2B8FA 4OONA 4UHVA 4ECTA 2NVQH 1D8LA 2PQAA 1A0IA 1TAMA 1F9QA 2G08A 3C1EA 1GHJA 2PO4A 4JV1A 4DV3Q 4A93H 4IFDH 2WB1F 1L1OB 2C22A 4CKBA 1ZQFA 5DAUA 3PUWA 4BXXH 1II3A 1X6IA 2VUMG 5I2YA 2LM4A 2JSOA 2SOBA 2CQAA 2V4QA 3VCBA 5I6WA 4BA2I 4R8UB 9ICFA 4XTCS 1ZQGA 3OWEB 3VDYA 2YU9B 3GO5A 1BPYA 2R93B 4ELUA 2KECA 4IO9A 1HIWA 3E58A 4WRDA 2GN5A 1JUDA 2F4VQ 4IALA 5AKJA 1KTQA 4MTNA 1LTLA 2NN6H 4KTQA 2CHBD 4KN4A 2XRSD 5COYA 5KYIA 2XCAA 3L4PA 1LACA 4R8NA 4R66A 1LTRD 1ED1A 4DS4A 4NLZA 1ZRMA 1TV9A 4UDUC 3HP3A 1HH2P 2F0PA 1BDOA 1MSWD 1E1TA 1SNDA 4NV0A 4HSVA 1NJZA 1JE4A 3PIO3 2IY5B 3L7ZC 3GV6A 4CCHA 3Q8QB 2AQ0A 3PIPA 5M9OA 3TBIB 4JI6L 1SR3A 5C0XH 4C8MA 1R9TH 3DEPA 5IGEA 2Y1IA 4RQ5A 1JT8A 4C3IG 3CC4A 1HQRD 1STBA 3JAML 5AKEA 4PZNA 3ZDBA 5F3XB 2BCQA 2RDIA 5GTHU 3BVGA 2ICEC 4NL9A 1SKWA 2WF6A 1SL2A 1FL0A 2A68C 4ME5A 2F8LA 4Q45A 3H8WA 4CNQA 1SNOA 4KV6A 3PSTA 4F5PA 2R7DA 4XQNA 2CW0C 1W6KA 4DF7A 3PO3B 2Y0SB 1QG7A 1NK7A 1ZQNA 1GO3E 3BVZA 1N5WA 4KN4C 9ICBA 1M8AA 3M3YB 1D1IA 3B6YA 2K05A 1K3RA 3TAPA 1ZQTA 1Q3LA 1DGJA 4EGVA 2R93G 1VQEA 2RVLA 4PV1C 1WYGA 4BX9C 4C0ZA 1JE5A 2WF5A 4UBCA 1L3VA 4DUYL 1E22A 5BR8Q 4J9LA 5CV6A 2ZTCA 1K28A 1PK1A 3M85A 2ZTEA 5G5HA 1CQVA 3VR5A 2B8GA 4ED1A 2F44A 3SAGA 1TWGB 2WB1E 3VA5A 3KF6A 2ATLA 1B70B 1KD1C 4EX6A 2HHUA 2XC9A 2RRDA 1CM9A 2DY8A 2RCNA 4CGYB 2VL6A 4WJ3M 4LF5Q 2NVTB 5JRTA 1J5EL 3RRHA 1I6HH 1QCKA 3JPOA 2K5VA 4Z6FA 3K75D 4DF4A 2K8BB 2ASDA 1NR4A 4NL9C 2KJ9A 1S8OA 5GAHC 4YWLA 1KRSA 4WJWA 2EDUA 4B3TQ 3EYZA 3CKIB 4O3RA 4UB8U 5D49A 1CI4A 3B0XA 3CU7A 1Q8KA 5J3BA 5ALTA 2KZZA 1P8LA 2L1BA 3FDTA 4Y2TA 5C4XH 2EY5A 2HCFA 2AU0A 1UE7A 2WB1C 4UB3A 5DLQE 3ISCA 3NBIA 1QE6A 1EIHA 2K7VA 3X3MA 1HNXQ 2E1FA 2BPFA 1RYUA 1I4PA 3NVWA 2IL8A 2SDFA 4HAEA 1B3QA 4ICAA 5J2HA 2Z7JA 3BJUA 5IYBG 2OQKA 1RD9D 4OHJA 8ICUA 3RJKA 2H5XA 1IW7D 4YHHL 5DDYA 1CKMA 2MA1A 2Q2IA 3NWSA 3CW2C 4JV2A 1G91A 1D9DA 2EJMA 5ALEA 3SMVA 3L5KA 5K36H 1QQ6A 4EEYA 4POGA 4ZQ3A 1CRXA 2EOTA 5KFDA 2NVYB 5FOBB 5LMUL 2XIWA 4FO6A 1SAPA 5TZVA 1JWMD 4KMOB 1JCKB 2BE5C 3C1FA 3GP7A 2MUTB 5L1JA 3T5JA 4PMCA 4X65L 4BWJA 4DV5L 5LMNQ 3A8IE 2RF4A 2QW7A 3GTGH 2ZM6Q 2A19A 1SL0A 2W55A 4UATA 4ELVA 2WV6D 1SBBB 5AK3A 4A3KH 1U48A 3S1NB 1WTPA 1XS9D 1N32Q 1BNOA 2K4IA 3N7PD 5KG3A 1P16A 2R61A 3QUCA 7ICVA 1AFPA 3TAQA 1QQ7A 2CWAA 4PJ0U 3OHBA 1PA6A 3MTSA 1ZJMA 4DSLA 4GC7A 1KC8C 3FKIG 9ICWA 4A3GG 2RA4A 4G3IA 4YXMA 3EZ5A 4KLHA 4QZ8A 2F3WA 2AH5A 4P72A 2A69C 5CB1A 5DGBA 4KLDA 1C4QA 2F3IA 2AWOA 4FDBA 7ICKA 2CPRA 4GXJA 2KHVA 5IE8A 2DKXA 5M5XH 2Y9TA 2FMQA 2K04A 2ASBA 1DD2A 3QXGA 1MJEA 1K0SA 3QUTA 1SKSA 3BDCA 4GC6A 3D0FA 5GQOA 1UE1A 3V72A 3NENA 1XPRA 3T16A 2C2RA 2GWSA 4F7XA 4LUOA 2UUBQ 2YMQA 4K5WA 4TUQA 5IYCG 2KG5A 3ZDEA 1I4QA 4Y2PA 5IIFA 1XWLA 3OHXC 1KN5A 3CQZB 1PH2A 4OJLA 1EOTA 1X40A 5KL1B 2RHQB 5ALLA 3MA2B 3VYRA 4NKLA 1KHIA 1IYJB 1PTOF 2B2VA 4BBRH 1U4PA 2L11A 4I2CA 2PW7A 3DWPA 3I4NH 1Y88A 3SAFA 2F77X 2XGTA 4JW0A 1GVPA 2NRWA 4U7CA 2UXCQ 1E0BA 2HQEA 4O3PA 1CZGA 2MJ8A 3E2EA 5CBAE 4OCZA 4ZH4A 3ICXA 2K60A 3FPUB 5IILA 4F4KA 2DPJA 4QB4A 5D65A 3WDNA 4DFDA 3K7AB 1PZJD 5EBCA 4X6AH 1H9RA 4LF8L 2MU2A 2ATWA 4XA5A 3Q8RB 4J03A 3CD6A 3C1ZA 3QOLA 4RQNA 2ALYB 4GLVB 4RGMA 4BBSH 4A3CH 2GO7A 2ZIVA 1SV0A 1QQ5A 2KHQA 1EY9A 3SHLA 2B2TA 4V0BA 4LFBL 1WTHA 3FHWA 5DBBA 2BA0A 4KX5A 5AKZA 3NUQA 2VQFQ 4A3MB 5GADC 5AKLA 4TQSA 2DJFC 2KJ8A 3QU4A 1FVIA 1V1QA 1ZKOA 1EWIA 2PFNA 2EYFA 4KLJA 2PXIA 1JOKA 4UP9A 4N8FA 2ZJAA 2DGYA 2E5SA 1BCPF 4C3JH 1TY0A 3AUOA 1YHAA 1MSHA 4MHVA 4CDDC 1UT8A 2HVIA 4Y52H 4C2MH 2B2VC 3D2QA 1PLFA 5L1LA 4ECRA 3NS1A 1WTQA 5KT5A 4OL7A 4RMFA 2LKYA 1PFBA 3C3LA 5IY0A 2JA8B 1OUQA 1LVHA 2IHFA 5IP7G 2FDRA 2FLLA 4UB4A 4QGUA 8ICMA 5GROA 3UE0A 1BBWA 1NZPA 3C23A 3JAMc 1MGSA 1EWHA 4QWBA 3MXNB 3N4MB 2HOQA 4NY8A 2EQYA 1SKRA 5CA7A 4BY7B 2KSOA 2J6SA 4RQMA 1FFUA 8ICCA 2RQXA 4EYIB 4DQIA 2CKZB 2VZAA 1SV0C 1SNMA 3RR8A 3I91A 3Q8SB 2B2TC 3G4SA 1M90C 4HSPA 5A0LA 1TAUA 5I4DA 4RA8A 4UPAA 1B43A 1VQNA 3GILA 1EYGA 2LM1A 2KA7A 4MFFA 1LO5D 5KFOA 5KAIU 1ZD4A 1X3QA 4PGXA 3CCLA 1BKBA 1JR0D 1C7YA 2W3RA 3H4DA 4CJ2C 5FO8B 3EFXD 5K4LA 3JPTA 1KLUD 1DZ1A 1UQVA 4DR4L 2QEJC 3P20A 2BCOA 5FLMG 4A3MG 1SZPA 3VR4A 4ACOA 1XMQQ 2IX1A 2LYBA 4FE3A 3C21A 1BPBA 3BG3A 4RUAA 4B3ML 4LF6Q 3GTJH 4KJNA 1W2BA 1D8BA 5J29A 7ICFA 4QZBA 3PF4A 2YB4A 8ICXA 2OQ0A 2JA5G 1GHKA 5ALRA 4NXML 5KFHA 4CHTB 4KLMA 4GKKQ 1NE3A 4R4IA 2AQ2B 3SV4A 1Z6HA 5J0WA 4QIWF 1LTBD 3L3FX 4DR5Q 1JB7A 1VQ7A 4QWAA 3K57A 4YMMA 1RZTA 1HFGA 3HG9A 2A1JA 2AGPA 2JA8G 4F4WA 1EL0A 4YG2A 1PTOC 3M6KA 2XN9C 2OTJA 3RLNA 9ICNA 4L8JA 4EBDA 3GD7A 2KQ3A 7ICRA 2F0VA 1GXDC 2WF8A 4JPBW 2RP5A 3OWFA 3UDIA 1YJWA 1BPEA 4O3OA 2BE5D 4IFDJ 1HZCA 2R92B 5AM1A 1Z00B 4G57A 4BY7G 4DL7A 2UVVA 4I2EA 4JI7L 2BCRA 4RCNA 4MNOA 1RDFA 5IWAQ 2YB1A 3AMZA 5M3FB 1PYSB 5EPKA 4DN4M 2IA6A 3TMEA 1WCMH 3RBEA 2QB0B 2HHSA 3MEHA 1XMOQ 3N97B 3HOVH 1UNSA 3J81E 2EYPA 4RQ6A 2KKVA 3PV0A 1ZQIA 1SNPA 4ED0A 2D5DA 4LAAA 2UU9L 5DB9A 2E8NA 3TARA 1V1PB 2I07B 2J0TD 2PI2E 3FP9A 2XRQD 3TS2A 3WOEA 2VB2X 1AH9A 4RUCA 2D8CA 4QZGA 1IG6A 3DM1A 4JG2A 5AK5A 2WKDA 2W04A 1EUJA 3TREA 3GIJA 3BS7A 3GV8B 2A69D 1Z4OA 5KFXA 2WTFA 3MZ5A 4ME3A 1QVGA 3UE1A 3OJSA 2MP1A 4Y2QA 4M1UB 2QDLA 5J0QA 3OPOA 3S24A 2G5IB 4DOAA 1JJCB 1L8OA 3DV9A 5ALFA 1HRJA 2Z6BA 4HN7A 5D3IB 5CBEE 3T1HL 4O3MA 2DUDA 2ZIUA 1F2LA 2MQHA 1Y8NB 5KGUA 3PIP3 4J9PA 3F8TA 4EBCA 1NKCA 5C0XJ 1X32A 5KL8B 1S10A 3PUXA 5EKLA 1O78A 8ICNA 4DV3L 4JI0Q 3NBHA 4JV0A 1A2UA 2EY2A 4FFDA 4DV2Q 1YEZA 1X9XA 3M6ZA 1BR9A 3KOJA 4A3IH 1NJWA 1EIYB 5L37A 2OXOA 4KLEA 1ZJNA 2ENBA 3IRBA 2VA8A 5J0TA 4IPDA 1SV4A 2WINB 4YVZA 2MAXA 3HOXH 2PZUA 4XXEA 1JICA 4LJZC 4R9WA 1EQTA 2Y0SF 2F4VL 4X3UA 4QIWE 5GAEC 3V7LA 1L1OA 1PVQA 3TQYA 1VQOA 3FMCA 5KT3A 4F4XA 4K4GA 3QB3A 1D5XC 3CPWA 3HOYH 4O3SA 5KFZA 1I4GA 4DAVA 3WK8A 2M00A 3ETRA 3Q8KA 4I27A 1PYBA 4NM2A 1YNXA 2MHVA 3D31A 3MXGA 4N9TA 4DAYA 3RNUA 1PH8A 2KVSA 2ZT9C 4S3SA 4DSKA 2QILA 5DLFA 1YHBA 2W7PA 1PVRA 2K4PA 3RBDA 4FO2A 3K0YA 4LJXA 1F77A 1QUQB 1F2YA 2KHSA 4KHVA 2G0AA 4RQ1A 4OJPA 2EDGA 3KJPA 3MDCA 1GUNA 3CC7A 2HW3A 4RGNA 2LY7A 4K2LA 2IHMA 2F1HA 4QIWC 4OX9Q 1ML0D 1KTKA 3CXCA 4IQZA 1UWVA 1I50B 1EWCA 2JN4A 2NZ1D 3KF8B 4QCLA 3PX4A 1EFWA 3MGVA 4A3FH 2F0DA 4B9SA 4H02A 4K8JA 3V6HA 4IRKA 1K1SA 3E0FA 3NVVA 4GNXB 1CTMA 3SK5A 1TWCH 2O5JC 5CMDA 3OHAA 5BN3A 4YP3A 1U4RA 3E0JA 5JPMC 3GTLB 2NVQB 3BZCA 1UT5A 2HIXA 2XY7A 2JA6B 4BA1I 1NI3A 1XSPA 4A3BH 3MVVA 3IDWA 1N60A 4JI2Q 2PMZE 4KKUA 1IL8A 5KG1A 1D5ZC 5CHGA 4JI3Q 3ETLA 2A8VA 1IZ6A 1K1QA 3PO4A 2EYJA 1STEA 3KLSX 4KLUA 8ICIA 5BR8L 4RQ4A 2JH1A 1BBXC 1X9SA 4LF7Q 1B2TA 9ICKA 1YT3A 5NUCA 2FMMA 4JI8Q 4ZCKA 2HIVA 3PUYA 1VQLA 5LL6S 4PHDA 3RLOA 1JMSA 3NXWA 4LF5L 1JXEA 1CKNA 5M3MB 1EZ8A 1KRTA 5KNBA 1SYGA 3S17H 1MHWC 5J2JA 3BYTB 2FINB 2N3SA 4B3TL 1Q46A 4B9TA 2JK8A 3JPNA 1PRTB 3KLWA 1BNZA 3GTMB 4OWWB 1K73C 5G3LD 1I3QH 4KD3A 1ZRNA 4NM1A 4GN4B 2K8AA 1G2SA 4PG3A 5KNIA 2WAQB 1JWUD 4IUPA 5DLGA 5CC4A 1HPCA 1HNXL 1R9TB 2OXPA 3C5GA 1IBMQ 1KDCA 4OIKA 2F0NA 4MEYA 1TS4A 1HNWQ 1JRPA 1KNEA 1MQ2A 4Q8EA 1K8AC 3UXPA 4UB6U 4PL2A 1MQ3A 3TP7A 2RLTA 2OTLA 2KHIA 3SR6A 1LKYB 2GH1A 1HUOA 5KNCA 4DR7Q 1RTNA 1A77A 3H8JA 3G6VA 2BDPA 5EE3A 2E74C 3KYHC 1KQSA 1H9SA 3J7ZC 4A93G 1PH7A 5C3EB 4IFDG 3UPQA 1Q8IA 3RZOH 1AN8A 2F4IA 2OHFA 4CDGA 3HT3A 1DOQA 2K8CB 4Y2UA 2KVCA 5BOMA 5EKIA 3D6JA 2IHNA 5AIBA 1JXLA 4EZ9A 4M9JA 4BXXG 3K7UC 5LMNL 3PUVA 5E7NA 1UEBA 4JMUA 2RDJA 4KMUA 4UASA 1BO0A 3DWAA 1LTAD 5HY6A 2ZM6L 3ERSX 3V7KA 1PH4A 4M6WA 4A3DH 5J0PA 1TVXA 4EYHB 3WK6A 4NLBA 3TACB 2EXZA 5KFNA 2CWPA 1QSSA 4YIJA 1M6YA 4O3NA 4NLKA 3H6MA 1B9MA 2Q8RE 4B9NA 2N88A 1PVOA 3U50C 1ZETA 3H0MB 5KT2A 1NMFA 1BBUA 4DXGA 2NN6G 4GXKA 2BPCA 2L55A 2RQ5A 3NRWA 5KFRA 1BCPD 1SJHD 3OIPA 4FNFA 5AM0A 2NTSA 2F1JA 3U26A 3V6JA 3BZDB 1SWVA 2KOBA 2AXTU 3RLFA 1ZQQA 5IT9L 3C2LA 1U4MA 2LXKA 3NWTA 2PQEA 4Q43A 2JV3A 2NRXA 1CA6A 2JA9A 5IGCA 1QJOA 4XQJA 4F5RA 2IOFA 4J6HA 1WD1A 5C0XG 1QNKA 4Q8FA 2LSSA 1ZD2P 5JU5A 1V8QA 1WYDA 3CP0A 2R8HA 1WG8A 2B21A 3LWEA 2UUBL 5C4XB 1DXSA 2HCIA 3R9KA 4RT3A 4FF4A 4KY5A 4KMUC 3PW2A 4PZ8A 1ILQA 2KJ5A 4YR3A 3EPGA 2J7ZA 4UY8C 4YMNA 2B2WA 3CCSA 3CPFA 1M4VA 3H15A 2F0UA 3S15B 4J9NA 2DPIA 1L7PA 2BKEA 4YQWA 1U47A 2ZUBA 9ICHA 1DM0B 2M9VA 3PQIA 1T9HA 4C3HH 3F5EA 2E3TA 1RF2D 5A35A 2EXDA 3C29A 2UXCL 2Y1JA 1FD7D 1IW7C 4U673 2FPKA 4OEMB 1SFOH 1VQHA 3SQIA 5AKKA 3LVVA 3E0EA 4MN3A 2VUMB 1S5ED 4MF2A 2UXBQ 2IOHA 5ALWA 2QKIC 2HT1A 1K83H 2HI0A 1A3UA 3GTGB 3I4MH 4YXJA 1E7ZA 3D4RA 3RN2A 5ELFA 3RZDH 2BQRA 1MD2D 3RAXA 4FBUA 3TZUA 1A6XA 2I6XA 1ZQRA 1ZQPA 4KTAA 4A3KB 2UXDL 4E0DA 3HOUH 2VQFL 2HBKA 1TK8A 1L7MA 1VDZA 1ZQZA 1ZD3A 4UB2A 3ZYYX 3S14H 2Y9UA 4IR9A 4C80A 4K14A 2ZIWB 3CCQA 3MR6A 4N9PA 5KG6A 2F0GA 4XQ8A 4ECZA 1F44A 2B2WC 2A6ED 2ZXOA 1IBKQ 2OYYA 4FS1A 1ZQXA 4TRDA 2MO0A 1HUZA 2KCCA 2PFOA 3MAQA 1RYRA 4UP8A 2Q2TA 3IG5A 4HMIA 5JVG3 5CV5A 2HBLA 2F0EA 3KOOA 3EPIA 4WJ3B 1O7ZA 4K6DA 5M5XB 5C4XG 3DEEA 1L3SA 1OW5A 1MKHA 1NSNS 1U4BA 2BA1A 1S5DD 5EJWA 3HP6A 3HKZE 4CRXA 5HNKA 3H0LB 2LBOA 1CQFA 2DN8A 2BDOA 3I70A 4B9WA 1NCVA 1X55A 4DV0Q 1B3AA 2W43A 1TKWB 4IQUA 4ZAIA 3J80L 2XICA 5KG7A 3ZI4A 3GZFA 3RB0A 2CN1A 4EQ5A 2W9CA 2L5TA 4HR7B 3OSPA 3CRXA 2LYAA 5CV7A 5K36G 5KEEA 1IM4A 4JYAQ 5CGKA 4B9LA 2K5QA 5JAVA 5E3FA 4BBRB 3SXHA 4KHPQ 2EZZA 3KDFA 3J7YW 2VANA 3PR4A 1V85A 2K33A 1HJPA 5HHIA 4FVMA 2MO1A 1VQBA 3HKZC 4US8A 3UXOA 4HJ8A 1QCBD 1ESFA 3PF5A 4RPXA 4ELTA 1EQRA 5BPCA 4MFAA 4GZYC 1JIHA 5AI4A 4EENA 4HCEA 4A3KG 1DCZA 3Q8PB 4QQBX 1X3PA 1YBYA 1VMCA 4DQSA 1KABA 3MC0B 4FP5D 5IGGA 1XMQL 3AEVA 4C8NA 3SDZA 5LHY1 4X64Q 3G71A 3H91A 3GTOH 3OOCA 4LF6L 4F5QA 5B5EU 4DFJA 5FJ8H 3AU2A 3KD3A 5ALMA 1OXVA 5M5YB 1SLJA 4L5RC 1J97A 2JZBA 4TURA 1FR3A 4QZIA 2HHTA 2ZJRA 4MFCA 5IIIA 2EZVA 4GKKL 1KNAA 1C20A 1KW4A 1IKLA 1AE3A 4RWSC 4DR5L 5KYLA 3FC4A 2AGQA 1KLNA 4C3JB 3ND9A 2OCEA 4O5KA 3MGIA 1QLNA 4Y2SA 5IYDH 4C2MB 4ECWA 1LV9A 2IHEA 1SN8A 4JI4Q 1STYA 5KFCA 3A5ZB 4RQ3A 4H0LC 5C4JH 4Z6DA 1NJXA 3WK9A 4AP9A 1ZOLA 1XX8A 4DV4Q 4JI5Q 2IX3A 2KEYA 3BS5B 1MSGA 5KFLA 5IWAL 3G48A 7ICMA 1MJCA 2OF1A 7ICQA 1NUCA 3I4NG 3UQ2A 4BBRG 2AHOB 4P4OA 3JPPA 1L5UA 2ZXIA 1T5EA 1VQGA 3PGZA 1XMOL 2HHHQ 3WKCA 2PPBC 4ALPA 3AM9A 5KFEA 5DGAA 3R2TA 3OTOQ 1DYQA 4KK7A 4M9LA 4NXNQ 2JR5A 2KE7A 2GVBA 4DV6Q 8ICQA 1RIPA 2JXMB 2CXYA 2GOLA 2UUCQ 3VC8A 1Q3VA 3HKSA 1CHPD 3QU2A 2VJ5A 2PYKA 3RJGA 4P4PA 2PNRC 4K5VA 2DFLA 2NYVA 3UM9A 5M5WB 5IINA 4TQRA 2KN7A 4A3EH 3CHBD 1T94A 4F4YA 3I55A 1PTOH 3FPPA 4BBSG 4A3CG 2QB0A 1HHVA 9ICCA 1XSNA 4YD2A 2KEDA 4KN7A 5AM4A 2E2HB 4JI1Q 2K4EA 2WP8J 5JVH3 1K3BC 3FKIB 1X3FA 1F9PA 1V1PA 4A3GB 3EW9A 5J8YA 3GTJB 3SK8A 1A6SA 3G6XA 1DK2A 4QZCA 1Y8OB 3U9SA 2K4KA 5CORA 5EWFA 5CR3A 4C3JG 1N2XA 2KHJA 3J80E 2YYZA 4OWXB 3N28A 4H13C 5IGBA 4DV2L 5IT9c 4O1NA 3ZDCA 1X56A 2VW9A 5AKXA 1N36Q 3S2HH 4OD0A 1JC7A 1JQYD 2AUJD 1EIFA 5GTIU 4DL5A 3RB6A 1SIJA 1A8VA 2K6AA 4OIJA 4B3SQ 2N78A 1H95A 3HOWH 9ICGA 2W11A 3SAHA 5D4BA 4GLAC 1PZNA 2O2LD 2D0OA 4B3RQ 4Q44A 4UAZA 1K0RA 3P7JA 3H7IA 2BZFA 4QNLA 5IIMA 4M8AA 4P0QB 4B3RL 1D9FA 1LTID 1PDQA 1JROA 1FEZA 4KLIA 4ID6A 4DPGA 3STBD 2B2UA 1FGUA 4KN7C 3K59A 2LFNA 2E76C 1GUTA 2MPMA 3AN1A 5J2BA 4R4TA 1WTRA 1NKEA 2EQSA 2E1EA 1HTPA 4L5QA 1Y8PB 3M9BA 2BH2A 1KRPA 3SD7A 5J8YC 2CFMA 5AKYA 2XI9A 3NASA 4DF8A 2OH2A 1A62A 2R6GA 4NP5A 5JUMA 4ED3A 1SNCA 4DR2Q 1GUSA 2G5DA 2N49A 3GTQH 4OX9L 4YD1A 2VXWA 4BY1H 1SXTA 8ICPA 2WACA 1PH3A 3PW0A 1EEFD 3U4ZA 3JAME 3BZKA 4IUQA 4G7HC 5B66U 4DK3C 1WD0A 2HSZA 2EVBA 2XVSA 4OELB 1A3TA 3I4LA 4JC0A 2WAQF 3MFIA 8ICFA 1EEID 4GOPB 4DSJA 1TWFH 2F0JA 3S16H 1TWHH 3HW8A 3SK6A 1N62A 4JI2L 3ISDA 4IRDA 5C4ZA 3IFTA 4ECVA 2NZOA 3AL0B 4JI3L 1ASZA 1B53A 3FDSA 5G3LF 4A3LH 4K0KQ 2HMXA 4EZ6A 3CAMA 1EXNA 3AU6A 3TSSA 2AKWB 3V7JA 4CKCA 4LFCQ 5T1GA 4RGTA 2R7ZH 2H3ZA 1S0OA 1SXDA 5KFUA 3HOXB 1X42A 4LF7L 3M4PA 4J9SA 1ZQBA 4ZLTF 5KIXA 3WKDA 1IHZA 4JI8L 5E4XA 1MC8A 3J80c 2A5HA 4J9KA 2F0KA 3X3NA 1WCMG 3HOYB 3HOVG 1VQMA 9ICIA 2LYHA 1EY4A 3G6YA 4K6LA 3WU2U 5FO7B 4UAVA 4QZFA 5IGFA 3EUB2 3CYMA 5KFAA 5C0YA 1G51A 4P74A 4DK6C 8ICTA 2WF9A 4IQVA 3K4GA 3T5KA 1L0YB 1F2MA 4R8IA 3ULJA 3Q6SA 3RJFA 4M2YA 2N1RA 1AE2A 5CV8A 1K8OA 1DGSA 1HEKA 1IBML 2VKQA 2KBNA 1RDPD 1F0MA 2KCNA 2R8IA 1HNWL 4F3OA 1SNQA 5CJ7A 4XIGS 2D9UA 4ABNA 2IWHA 2G09A 4DR7L 2UVRA 4AYBF 3JPSA 2R18A 1A2TA 3A7LA 4FF2A 1XU4A 4ZOHC 1F9SA 2ICIA 2JA5B 2D6FC 4NB3A 3KHLA 4K5XA 1O08A 2F1MA 5ALGA 3BJYA 1EU4A 1STGA 3A54A 5ALXA 4QWDA 3MBYA 3S1QB 4C1NK 4DNTB 4A3IG 1HNZQ 3QU5A 2HDLA 4V190 4RQ0A 1AQ6A 2KK0A 4NWIA 3MDAA 1E2ZA 2KENA 4A3BB 1N8RC 1CSQA 3RH4A 5C4HA 1ZQCA 2K1BA 1QZGA 5ELOA 4PMBA 5CYUA 3I73A 1B1ZA 3RD4A 3HOXG 3J7AV 2K01A 1O7LA 4Q5VA 2EJFC 4KY6A 2EIFA 2NV3A 2BDNA 2DGZA 8ICGA 2D62A 3P75A 3RFAA 1A76A 1QOHA 1QH9A 4Y2JA 1WJJA 2PQAB 2BOSA 1DRGA 2AJQA 7ICOA 1X3GA 4GIBA 2E8GA 3MFGA 5JEAJ 1Y69U 3HOYG 3TFSA 5ELBA 2KFZA 5A2QL 1CZWA 1S77D 2BCUA 5KG5A 1WOCA 2RKSA 2K52A 5J2GA 3CCVA 3R93A 4PGYA 3UDXA 2ZIXA 4ZKCB 1Q81C 1FFVA 2HUGA 1OXUA 1TS3A 5ALIA 1V43A 2AMCB 3K81C 1RODA 2PNHA 4RKLA 2LMRA 5AI6A 2XTIA 8ICEA 1SYEA 5E1FA 2W03A 9ICRA 3KHRA 1VQ8A 4I65A 4QZHA 2VY3A 2ZTDA 3A55A 1VQ5A 2OM6A 2B63B 1I3QB 4CBVA 4P71A 1TWAB 5E79U 3GIKA 1RPLA 5FO9B 1JOQA 1YNJD 5KFYA 1ZYRD 3RN5A 4XQQA 1SROA 5ALQA 5DKWA 3MGHA 2EAPA 5CRXA 1HQMC 3HKZG 4A3FG 5EWEA 4NW2A 3E3XA 1GUOA 3THVA 3OYYA 2QKQA 5J0XA 1LV5A 2NRVA 4B9UA 4HIMA 1TQOA 3ZDAA 2KIVA 2F8KA 2XWJB 3I90A 4A3BG 2VNUD 2EZYA 3NGDA 1VCIA 4F8MA 1SXEA 5KG4A 2RSNA 4QF4A 2UXBL 4P0PB 5DEHA 7ICNA 5J0SA 1JN3A 5KNDA 4YCWA 7ICUA 5KFGA 2A74C 2G9HD 2HQLA 1S97A 4FXGC 3GDXA 2W8KA 4A3DB 4RNNA 3T5LA 3A56A 4TUPA 4QWEA 4R65A 1N61A 5C44H 1B8AA 1QTMA 4QW8A 2SNMA 3S2DH 1ZYQA 2YV5A 2WB1B 1LM0A 3KKAA 5ALVA 4RU9A 2KZMA 5F9NA 2C9OA 4KJOA 1Y14B 1LTTD 2F3NA 1QILA 3S16B 3HRZC 1RXWA 3H09A 1IBKL 2NVXH 5J2CA 3QU9A 4AYBC 2JEAI 1XNQQ 5DB7A 2KEEA 3S6JA 1Z1BA 1BCPC 1PK1B 2NRTA 5ALSA 2QARA 2ISPA 8ICLA 5AI9A 5IIKA 3OTQA 4R64A 4I2GA 1MA7A 2ZJ8A 1JALA 1COKA 3GTPH 1R4PB 3T56B 1X2IA 3ED5A 4F71A 2BQUA 2D2CC 5JJLA 1J8IA 3HX0A 3B9JA 3SV3A 4DV0L 4U68A 1H9MA 1VS0A 3S1NH 2Z6KA 1WI5A 3PUZA 1I94Q 4DL6A 3GIMA 2XY6A 1WCLA 1O03A 4LMQD 2H4OA 1BNPA 4NLCA 4JYAL 3UDFA 1S0MA 3HS0C 4C3HB 2ISOA 3M4OH 5ALDA 4C8OA 3MXUA 4KHPL 4NJ8A 3PIOA 4QZ9A 4IPGA 1LT5D 1XNRQ 5A2QE 2UUAQ 4CJ0B 5HMLA 2RDGA 3OJUA 1SFOB 4QJFB 1B44D 3T4AC 5C3XA 4IUUA 4KY7A 1RXVA 4A3DG 4F2SA 2YTUA 1SE8A 2DNCA 3CMAA 3LX0A 3F2CA 3T3FA 3SI8A 1U4LA 2V1CC 3EBEA 4CKEA 3CCRA 4AQYQ 4X64L 1K5OA 1JOOA 2WB1G 4GN5A 4C56C 2E2IH 3PMLA 4I2JA 5JPNC 3EN2A 4A3JH 5FKAC 3FAHA 4R8UA 3C5FA 4YCXA 3JPQA 3SGIA 5FLXL 1S76D 1N63A 4PZOA 4DFAA 4RHRA 2F0OA 3CQZH 5HURA 4OJ6A 4G4KA 1KEJA 3S14B 7ICGA 1SMXA 2Z6KC 2EYLA 3ULPA 3LDAA 5AI8A 1XPUA 2GVAA 2HCCA 3I28A 3C2MA 1ONLA 3GTKH 2G5HB 2LI6A 4EQNA 3A0HU 3KHHA 4MIUA 3K5NA 5KFSA 1PFMA 3FM9A 4UB1A 4EVOA 4IL6U 1D7QA 1SWWA 4LZGA 9ICAA 1Z4NA 2A6EC 2K75A 4JI4L 1Z19A 3M7NA 3MR2A 3SYZA 4C4TA 3LWMA 5J2EA 3QUQA 2DJGC 2JMGA 4B6JA 3ZDDA 4HIKA 4JI5L 4DV4L 3RJJA 4E6IA 4X62Q 1Y1VH 2R7FA 3UI2A 5AI0A 1L1OC 4QW9A 1O80A 4JWMA 1L3TA 1K8GA 4C3HG 1NJYA 2E5LQ 4BWMA 2ESEA 3NTHA 3F2BA 4A93B 5KFFA 5ALUA 2PFPA 2HHHL 1UUPA 4CDCC 5EE1A 2BGWA 1D8YA 3OTOL 5KFMA 3W3AA 3VYTA 4OJ5A 2YMMA 4NXNL 4P2HA 4UQGA 4DV6L 3K5LA 9ICJA 3BDLA 3NEMA 2UUCL 4UAIA 3EQLC 5I2XA 2J6UA 4UAUA 7ICTA 3HWTA 1SYCA 3HEJA 3I4MG 1Z47A 1PVPA 4RNMA 3PR5B 4FZMA 3IKJA 4LZDA 1PRTD 1RL2A 3KFUF 1HR0W 2PKEA 1X54A 3HOUG 4P75A 1DOMA 3TP6A 4JI1L 4Y2YA 4KLKA 4DV7Q 3C1YA 4IC9A 2NTTA 4FXKC 2ZUCA 3GTOB 5ELDA 2YMLA 3TKAA 4HAIA 3BS1A 3OW2A 3VYSA 2Y0SE 2D3DA 5BN5A 3ISBA 4K4HA 1U49A 3K0XA 1MI2A 1V1OA 3S1RH 2KD1A 1NY4A 4Z9CB 2BCSA 1XXGA 3WKAA 3PVXA 4RFBA 2VJ4A 1N36L 3IN5A 3SZ2A 4FBTA 1C48A 2BHNA 2ZIVB 2NUCA 4UBBA 1F2ZA 2A73B 3V05A 4Y7NH 1AP0A 1A3VA 3PSPA 1Q1BA 2HOIA 5D3DA 4B3SL 5KFWA 1ZQLA 4I2AA 3SR1A 5DNFA 3SE0A 4DWIA 5ALOA 2BR0A 3ICEA 3RH5A 5KFQA 2E2JH 4J9QA 3RR5A 1COOA 2JRZA 1GUGA 4DFPA 5AI5A 1VQ9A 3PW5A 1DONA 4F91B 1E3PA 4JWNA 2Y0SC 2PZWA 1PH5A 3K6OA 2MRLA 1QSLA
chains in the Genus database with same CATH topology
3KF6B 1N33Q 3AEVA 1MJEA 3CCMA 4POFA 4L5TA 1G291 3CCJA 3D0FA 4X64Q 5GQOA 1UE1A 3NENA 3G71A 1XPRA 3GTOH 4LF6L 4LUOA 2UUBQ 3BU2A 2ZJQA 3HFZB 5FJ8H 5IYCG 1OXVA 4DR3Q 1QZHA 1SLJA 1PV4A 3Q8DA 4L5RC 2ZJRA 1PH2A 1C0AA 4GKKL 4JV5L 4DUYQ 1M1KC 3ER0A 1YHQA 1AE3A 4DR2L 1VQDA 2RHQB 4DR5L 1N32L 3GDEA 2I0QA 1U0LA 1XTDA 1KHIA 3A0JA 1IYJB 2OCEA 3I4NH 4BBRH 4IPCA 4LFAL 4P73A 3I56A 1XJVA 5IYDH 2XGTA 1GVPA 2UXCQ 2IHEA 1SN8A 3KFUA 5IP9H 5GAGC 4JI4Q 3A5ZB 5FJ8G 1J5EQ 5C4JH 1Q86C 4X6AH 1OXSC 1JJGA 4DV4Q 1Z9FA 4JI5Q 4LF8L 5M3FH 5IWAL 1TXYA 4AIMA 2ATWA 3G48A 3I7FA 3CD6A 3TRZA 4GLVB 2ALYB 4DKAC 1MJCA 4BBSH 4A3CH 3I4NG 4BBRG 2AHOB 1VQGA 3PGZA 1XMOL 2HHHQ 4LFBL 4GN3B 3FHWA 5IYDG 4ALPA 2BA0A 3J81j 1VQ6A 2VQFQ 5IP7H 4K0KL 1E24A 3E9HA 5GADC 1HZ9A 3OTOQ 5IP9G 4YY3L 4LFCL 1FVIA 1V1QA 2K5HA 4HJ7A 4NXNQ 2JA7H 1EWIA 2R92G 2GVBA 4DV6Q 1RIPA 5H1SE 2K14A 2UUCQ 1WFQA 3HKSA 1X6OA 4UP9A 4DR6L 2B3GA 1YZ6A 2DGYA 4YHHQ 4C3JH 1YHAA 5M3FG 4DNIA 4Y52H 4C2MH 4A3EH 1SRUA 4BBSG 3I55A 4IOCA 1JJ2A 4A3CG 4RMFA 1W3SA 4LF4L 2N8NA 5LMUQ 5IY0A 4GKJQ 2IHFA 5IP7G 4JI1Q 2WP8J 1YIJA 3K7AH 4X65Q 1MIUA 4QGUA 1X3FA 1L0WA 3G6EA 4DV5Q 5GROA 3UE0A 2JA7G 2ES2A 1BBWA 1CUKA 3JAMc 4LF9L 3MXNB 2K4KA 3STBC 2I5LX 2KHJA 4LUVA 2KCMA 4O2DA 2YYZA 4PZ6A 4OWXB 3U4VA 4DV2L 5IT9c 2VW9A 1X56A 1GM5A 2CKZB 1B7YB 1LUZA 2VZAA 4A3EG 3G4SA 5FLMH 4A3MH 1M90C 2I5MX 2RHSB 1N36Q 3WWVA 3S2HH 1S3OA 1EIFA 4R4QA 1UE6A 2E2JH 1A8VA 3I4OA 4R1JA 1S72A 4UPAA 2N78A 4B3SQ 1VQNA 3HOWH 5JEAG 3W5OA 1EYGA 1H95A 1UE5A 2JA5H 4GLAC 3J81c 3CCLA 2D0OA 1BKBA 1K0RA 1C7YA 4JBKA 5FLXc 4R4OA 4HIOA 2MFIA 4R4CA 3S1QH 4B3RL 1E1OA 5AJ3L 1VQCA 1HNZL 2JA8H 4DR4L 1XMQQ 4DPGA 5FLMG 4A3MG 4PMWA 3STBD 2IX1A 3L2PA 4IFDI 3ZJYC 1FGUA 2IT1A 1VQKA 3CMEA 4OO1I 4B3ML 2MNAA 2Z0SA 4R4TA 3GTJH 1W2BA 2EQSA 4LF6Q 4L5QA 1L2FA 3M9BA 2BH2A 3HOWG 3PF4A 2CFMA 1Q82C 2JA5G 1X65A 2OQ0A 2ZJPA 4HJ9A 1A62A 4BY7H 4NXML 2R6GA 4GKKQ 1NE3A 4R4IA 4JV5Q 1OTCA 4DR5Q 1OXTA 4DR2Q 1JB7A 2N49A 4LW1A 1EQQA 1VQ7A 3GTQH 4OX9L 3NBHB 4BY1H 2JA8G 1PH3A 1I50H 4UP7A 5ELNA 4JBWA 4LFAQ 4A76A 2OTJA 1YVCA 3RLNA 2F52A 1KXLA 3U4ZA 2NN6I 3GD7A 3BZKA 4DK3C 3UDIA 2C35B 1YJWA 4IFDJ 1HZCA 4BY7G 2OWOA 4JC0A 4JI7L 4GOPB 4LF8Q 3H3VI 4MNOA 2JA6H 5IWAQ 1TWFH 2B63H 3S16H 1TWHH 1PYSB 4JI2L 4BY1G 1TWAH 2NZOA 4IPHA 1WCMH 1XMOQ 5C0XI 3HOVH 4LFBQ 4GLXA 3H0GH 4YWKA 4JI3L 1ASZA 1FJGL 1IL2A 4A3LH 4K0KQ 3CAMA 4JBJA 3PV0A 4YY3Q 2AKWB 1YJNA 2UU9L 1CSPA 4NPSA 4DAYB 4L5SA 4LFCQ 4IOAA 3DLLA 2PI2E 2R7ZH 3FP9A 4JOIA 4DR6Q 3TS2A 4LF7L 3M4PA 1AH9A 4JG2A 2JA6G 4JI8L 2B63G 3TREA 1EUJA 3CXCA 4ME3A 1PFSA 3J80c 1QVGA 5M3MH 3UE1A 3CCEA 1IXRA 1WCMG 4OO1G 3HOVG 1VQMA 3I2ZA 3S24A 4LF4Q 3H0GG 1JJCB 4A3LG 2R92H 4GS3A 3PO2H 3CCUA 3T1HL 2DUDA 2MQHA 1Y1WH 3A5UA 4P74A 1G51A 4DK6C 5LMNW 3F8TA 5C0XJ 3T1YL 4LNQA 3H3VH 2R7ZG 2QA4A 3GTMH 4LF9Q 1VQAA 3PUXA 1GD7A 1VQJA 3A74A 4DV3L 4JI0Q 4J15A 3ULJA 2JEBI 4DV2Q 1YEZA 1AE2A 1N9WA 1KAWA 4A3IH 3KOJA 1NJIC 1EIYB 3J80i 1DGSA 5M3MG 3F1ZA 1IBML 4QY7A 2KBNA 3IRBA 1HNWL 4IPDA 4XIGS 3DM3A 3PO2G 1PH9A 3M4QA 4DR7L 1Y1WG 3HOXH 3J7A5 2WFWA 2ASBA 4GOPA 4A75A 4JOIC 1N34L 2UXDL 1XNQL 1C9OA 4NB3A 2F4VL 4QIWE 3W1BA 5C3EH 5GAEC 2JQOA 1L1OA 2WAQG 3TQYA 1VQOA 4B3RQ 4OWTB 3HOYH 3CPWA 5AJ3Q 4A3IG 1HNZQ 4DR4Q 4YWMA 1VQFA 2VQEL 2KENA 2D0PA 1PYBA 1N8RC 1YNXA 1CKNB 1CSQA 3D31A 2AWNA 3JC66 4KI0A 3CF5A 3RNUA 1X3EA 1PH8A 1QZGA 5ELOA 1CKOA 3TEHB 1YHBA 3HOXG 1PH6A 1Q1EA 1I94L 4NXMQ 4JI0L 1QVCA 4DV1L 2EIFA 1QUQB 3KJPA 2D62A 4DUZL 3HOZH 5C3EG 2PQAB 1NTGA 3AFPA 1WJJA 3CC7A 1YITA 2E8GA 3EIVA 1X3GA 3MEFA 4JCVE 5JEAJ 4OX9Q 3HOYG 1Q12A 1VQIA 2Q2UA 2KCTA 1Q7YC 1UWVA 1EOVA 2UUAL 1WOCA 4DR1L 1XNRL 3K80C 2K52A 3CCVA 1HZBA 3KF8B 3UDXA 1Q81C 4AH6A 1EFWA 4YCVA 1OXUA 4A3FH 3JAMi 4H02A 1V43A 2AMCB 4GOPC 3K81C 2PNHA 4GNXB 2XTIA 1TWCH 4LUZA 4X66L 4JI7Q 1VQ8A 3F2DA 3U58A 2L15A 3HOZG 4A4IA 3BZCA 2VY3A 2HIXA 2ZTDA 4AQYL 1VQ5A 4BA1I 2Q2HA 3KJOA 4A3BH 5JJKA 4QL5A 4JI2Q 3UDGA 2PMZE 2BH8A 4RG1A 4P71A 4JI3Q 1FJGQ 2A8VA 3RN5A 1IZ6A 3S1MH 1SROA 4QJFA 2CQOA 2YTVA 2JJQA 2UU9Q 3J81i 5JJIA 5BR8L 3HKZG 4LWCA 4YCUA 4A3FG 1KIXA 3S15H 2NZHA 4AYBG 1IBLL 2YTXA 2JE6I 4LF7Q 2K5NA 1NBWA 3PO3G 3OYYA 2Y0SG 4PZ7A 4JI8Q 4EX5A 4HIMA 2HIVA 3PUYA 2VNUD 2IX0A 3E9IA 1VQ4A 4A3BG 1VQLA 1VCIA 3RLOA 4DAMA 4LF5L 2VUMH 1CKNA 1OXXK 1KRTA 1NMGA 2UXBL 1J6QA 3S17H 3K8AA 3CC2A 1JMCA 3T1HQ 1BVSA 1HR0L 2N3SA 4B3TL 4YCWA 1Q46A 4APVA 3T1YQ 4X62L 2JK8A 3GTLH 3KLWA 4WJ4A 1QUQA 1QVFA 2HQLA 4OONA 2NVQH 1D8LA 2PQAA 2E5LL 1A0IA 4OWWB 1K73C 4A93H 4DV3Q 1I3QH 4GN4B 1L1OB 4PG3A 5C44H 4HIDA 1B8AA 1X9NA 3PUWA 1HNXL 3S2DH 4BXXH 2YV5A 2VUMG 1IBMQ 1LM0A 4BA2I 1HNWQ 1K8AC 4XTCS 3VDYA 2OTLA 2KHIA 1Y14B 3ULLA 1GKHA 4DR7Q 3GO5A 2FXQA 1IBKL 4GNXA 4IO9A 2NVXH 2JEAI 2UXDQ 1N34Q 1XNQQ 2GN5A 1HZAA 3KYHC 2F4VQ 1KQSA 3J7ZC 4A93G 1PH7A 2VS1A 4IFDG 4MTNA 3RZOH 1LTLA 4C3IH 5C44G 2QEXA 4O0AA 2VQEQ 4TQUS 4DV7L 4BXXG 3GTPH 3K7UC 5LMNL 5JJLA 1VQPA 3PUVA 5E7NA 1HH2P 1UEBA 2QGQA 5HY6A 2ZM6L 4DV0L 1PH4A 1V9PA 3ERSX 1VS0A 4A3DH 1E1TA 2Z6KA 1WI5A 3PUZA 3S1NH 1I94Q 2CWPA 3L7ZC 2IY5B 4DV1Q 1PVOA 3PIPA 4JI6L 1U5KA 3PCOB 3U50C 4DUZQ 1NMFA 1SR3A 3UDFA 1YJ9A 4JYAL 1R9TH 1BBUA 3M4OH 1JT8A 2NN6G 3CC4A 4TVAB 4KHPL 3PIOA 4IPGA 1XNRQ 2UUAQ 2YU9H 4KHZA 4DR1Q 2R93H 3RLFA 3TS0A 4GNXC 4A3DG 1SE8A 2LXKA 1FL0A 3AYHB 3CMAA 3F2CA 2JA9A 4X66Q 2R7DA 1N33L 5C0XG 2V1CC 3EBEA 3CCRA 4AQYQ 1GO3E 4X64L 2LSSA 2WB1G 4GN5A 2E2IH 3AFQA 1WYDA 3B6YA 3CP0A 3EN2A 4A3JH 2UUBL 3SGIA 1K3RA 5M5YH 4HJAA 4OXPA 3NELA 4DR3L 2R93G 1VQEA 3CQZH 1JE5A 4PZ8A 4IJLA 4UY8C 2ID0A 4DUYL 1E22A 1SMXA 2Z6KC 5BR8Q 3CCSA 2WAQE 3CPFA 3ULPA 1S40A 1XPUA 2GVAA 2ZTCA 3M85A 3H15A 1IBLQ 2ZTEA 3GTKH 4C3HH 1T9HA 2WB1E 3KF6A 1B70B 1KD1C 2EXDA 2RCNA 2UXCL 1D7QA 3W1GA 2K75A 4MZ9A 1VQHA 2VL6A 1SFOH 4JI4L 4LF5Q 3E0EA 4A3JG 1J5EL 3M7NA 1I6HH 3KDFB 2K5VA 2UXBQ 5IYBH 5GAHC 4HIKA 1HR0Q 1K83H 4HJ5A 4YWLA 4JI5L 1KRSA 4DV4L 2EDUA 4B3TQ 2HT1A 4X62Q 1Y1VH 2R7FA 3I4MH 2YTYA 1E7ZA 3RN2A 3RZDH 3PO3H 1L1OC 1K8GA 2E5LQ 1Q8KA 5J3BA 1P8LA 3F2BA 3M3YH 2HHHL 3HOUH 5C4XH 1UE7A 5DLQE 2VQFL 2B29A 3OTOL 1HNXQ 4NXNL 4DV6L 3S14H 1G6PA 3BJUA 3NEMA 5IYBG 2OQKA 3CCQA 2UUCL 2H5XA 4YHHL 1K9MC 1CKMA 2Q2IA 1IBKQ 3CW2C 1Y1VG 1TWGH 2K50A 3I4MG 1Z47A 2MO0A 5M5WH 4B3MQ 4UP8A 2Q2TA 4POGA 5HGQA <