2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1531
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
4HJAA 1N34L 1OXTA 4JI3L 5K36G 2IY5B 2K50A 2N3SA 1H95A 4JYAQ 2WP8J 4DAYB 4POFA 1ASZA 4LF6Q 3F2BA 2BH2A 4JI0L 3CCSA 2JA6H 4LF6L 4A3KH 3S1QH 4GS3A 3S24A 1VQ5A 3SGIA 1XNRQ 2PNHA 3J7A5 1A0IA 4LFBQ 3CC7A 1PH2A 1N33L 4DR7Q 3D0FA 4LFAQ 2ASBA 1QZHA 2R93H 2JJQA 4DV4Q 1V43A 2BA0A 3CW2C 4L5QA 4R4TA 4DR2Q 4ALPA 4JI6Q 1I6HH 1X65A 1LM0A 4OX9Q 2JK8A 1TXYA 5IE8A 3DLLA 3S15H 1CKOA 1K3RA 2GVAA 3CPFA 4DR3L 4AQYQ 1K8GA 2UXCL 1IBLL 4HIKA 4C3IH 1JJ2A 2Z6KC 4HJ9A 4OXPA 4DV6Q 4PZ6A 2MFIA 4JBWA 4JI0Q 3MEFA 1S72A 3STBD 1DGSA 1SE8A 1JMCA 2E5LQ 3I7FA 4QQBX 4JI5Q 3G48A 1QVGA 4DR7L 5IP7G 1WCMG 1VQIA 3GO5A 1B70B 1TWFH 1Y1VG 2LXJA 2NVYH 3BZCA 2WAQE 1XNQQ 3M85A 5M5WH 2QEXA 4JV5L 4PMWA 2E2JH 2KCMA 1VQGA 1EQQA 2UUAL 4GN4B 4JYAL 4GKJL 2I5HA 1QVCA 4DV3L 2A19A 1O7IA 4JI1L 2I0QA 3M9BA 1T9HA 2VUMG 5C3EG 4TQUS 5EAYA 2UUCQ 2JEAI 4DV1L 2VL6A 1GVPA 1TWCH 3HOWH 4JOIA 2ZM6L 1Z47A 1HNZQ 4LF9L 4BBSG 3UDXA 4DV5Q 5C44G 3HOZG 3I4MG 1VQPA 2Q2IA 1L2FA 1E3PA 3GTOH 5JJIA 3CCJA 1U5KA 1FVIA 2QA4A 1X56A 1PV4A 3KDFB 3CQZH 4A3DH 2E8GA 4B3TL 1GKHA 4P72A 1MKHA 2CWAA 4R4IA 2K4KA 2HQLA 1KRTA 3F1ZA 2D0PA 4WJ4A 4Y52H 1TWHH 1CKMA 4DUZQ 3GDEA 5M3FG 1KXLA 4DV7L 3ICEA 4DR6Q 1IBKL 3W5OA 2MO0A 2AHOB 3PCOB 5IYDG 1HNZL 1XPUA 4X65L 3EIVA 1VQ7A 3PUWA 3T1YQ 4DPGA 4X64Q 3H3VI 3KLWA 1SFOH 2UUAQ 3GTGH 1HNWL 2Q2TA 4GOPB 1SRUA 3AQQA 4DKAC 1VQCA 3S14H 1QUQA 4A3FH 1WJJA 3I2ZA 1IBMQ 3K7UC 4DV3Q 1FJGL 4XTCS 1YZ6A 3CCVA 2B63G 2HHHQ 4BY1G 3Q8DA 5ELNA 1K8AC 2B63H 1WOCA 2F52A 3WWVA 2HIVA 5FLMH 1YHBA 1ASYA 4POGA 3HOYH 3TRZA 4YCWA 4C2MH 4JBMA 4R1JA 2I5MX 4O0AA 2RCNA 2MQHA 3I4OA 1M1KC 4A3DG 3AYHB 3BU2A 3UE0A 1G51A 1TWGH 4UP8A 4Y7NH 3HOXG 4FDBA 2VQEQ 3M3YH 2EQSA 1YHQA 2UUBL 2I5LX 1PH4A 4NXNQ 4IOAA 4NB3A 4L5SA 2JA8G 1CKNB 2GN5A 3HOVG 4A3LH 4GLAC 1VQFA 3HFZB 3A0JA 3CMEA 2UXBL 4JI1Q 1GD7A 2IHFA 1HR0W 5AJ3L 2R6GA 1HZCA 3ZJYC 3OTOL 1N8RC 1PH1A 1HNXQ 2VUMH 1JT8A 2ID0A 1HJPA 3HKSA 1N34Q 3KOJA 2B29A 1Q8KA 4DR5L 4UY8C 4B3SL 4PG3A 3L0OA 3PIOA 1C0AA 4JCVE 3MXNB 5H1SE 2L15A 2FXQA 1OXSC 1YEZA 3S2DH 4KI0A 4DR1Q 1PH6A 2EDUA 1IBLQ 2Y0SE 2CKZB 5GAHC 4TVAB 3M4OH 2CQOA 4BY7G 1E22A 2EXDA 3S1NH 1YJ9A 2ZTEA 3UE1A 1MIUA 1SN8A 2B3GA 4AH6A 1VQ8A 1SMXA 2DGYA 1XMQQ 1OXXK 4L5TA 2OTLA 1E1OA 1KHIA 3BZKA 4JC0A 4H02A 5IP9G 4BA1I 3T1HQ 3M4QA 4NXNL 5JEAJ 1XJVA 4A3GH 4KHPL 4A3IG 5C4XH 2UU9L 2UUBQ 3DM3A 3CD6A 1HZBA 1VQBA 2ES2A 2BH8A 4UP7A 3STBC 3HKZE 4YWKA 1EUJA 1P8LA 4APVA 3KYHC 5BR8Q 3K7AH 1AE3A 2K52A 2R93G 4GLVB 4MZ9A 4YCUA 2NVTH 1S40A 3RZDH 4JI4L 3HOWG 1PH5A 2YTYA 4LFCQ 4JOIC 1VQ6A 1MJCA 3FKIH 5JEAG 1N36L 1J5EQ 1QVFA 2PI2E 4GKKQ 4DV2L 4GNXB 4B3RQ 1N36Q 1L1OC 2WB1E 2N78A 4P74A 5LMUL 4WJ3M 5JJKA 2CFMA 5LMUQ 2IX0A 2VZAA 5GADC 4MTNA 4PZ7A 2PI2A 3EBEA 4R4OA 2OWOA 2KBNA 1PA6A 2UUCL 1BBUA 1PYBA 1M90C 3J81i 1VQEA 4NPSA 1MJEA 3NEMA 3PF4A 4DV5L 4X66Q 2UXDL 1C7YA 4X66L 2PQAA 1W2BA 4K0KQ 1E7ZA 4IJLA 3A74A 4DV7Q 3UDFA 4HJ5A 3PGZA 4R4CA 3G6EA 3PV0A 4DV2Q 1XPOA 4J15A 4GOPC 4X6AH 3GD7A 4DR3Q 3W1GA 3RN2A 3GTPH 2JQOA 3S16H 2YV5A 4JV5Q 2HIXA 4JBKA 3FP9A 4IOCA 2VNUD 4GLXA 1V1QA 3KDFA 5C44H 1LTLA 5LMNQ 1TWAH 1YNXA 3J81c 4DV0Q 1UE5A 1HH2P 1I94L 4O2DA 3E0EA 1UE6A 4LFCL 4A3JH 3GTKH 3HOXH 2VQFL 5M3MG 1Y14B 4BXXH 2ZTCA 4DK6C 2IT1A 3UDGA 1U0LA 2E5LL 2R7ZG 2ATWA 3HOUG 4BY7H 1AH9A 2KENA 4DUYQ 4HJ8A 5M5XH 1V9PA 1X3EA 3I56A 2JE6I 1VQ9A 1Y1VH 4IPGA 4JI3Q 3HOVH 2QGQA 5IYDH 2VY3A 1XNRL 5C0XI 1KIXA 3L7ZC 1Q1BA 3CMAA 3RZOH 4QY7A 1FL0A 2YU9H 4LF8L 3PF5A 4JG2A 1P16A 4A76A 3PUYA 1EOVA 2F3IA 4GN3B 4GNXC 3CAMA 3CCRA 1X3FA 1Q46A 3E9HA 3KF6B 4OO1G 5E7NA 3GTJH 1S3OA 4KLKA 3I4NH 3CF5A 3J7ZC 4JI8L 5IWAQ 3NELA 1VCIA 3FKIG 4HIDA 4DR5Q 3TEHB 3JAMi 3CPWA 1IL2A 3ULPA 2OTJA 1SLJA 1E1TA 5GQOA 1VQHA 1VQLA 1PYSB 1JJCB 5IYCG 2C35B 4X62L 1WCMH 1XTDA 4PZ8A 5AJ3Q 3RN5A 2VQFQ 4LF4L 3RLNA 3RLFA 2NZHA 2KHJA 3OTOQ 4YWLA 4JI2Q 4A3IH 1PH9A 2JA6G 2JA7H 1N32Q 1GM5A 2CCZA 3F2DA 2Q2HA 3G71A 2JEBI 1J6QA 4OWTB 3GTQH 1B7YB 2JA5H 2EIFA 4DUYL 1I5FA 1NMFA 2Q2UA 2PMZE 2NN6I 1Q1EA 5FLXc 5C0XJ 4A3FG 1PH3A 1EIFA 1KL9A 4HIOA 1R9TH 4AYBG 1WFQA 2WB1G 2YYZA 3S1RH 1JE5A 1SR3A 4B3TQ 1N33Q 1VQMA 4BBSH 3EN2A 1I3QH 4LFBL 1GO3E 3CCMA 3H3VH 5LMNL 4EQ5A 4C3HH 4IFDJ 3I4MH 2K5VA 3HOZH 3I4NG 3D31A 1E24A 1CSPA 1IBKQ 2Z6KA 1UE1A 4GN5A 4A3EH 5M3MH 4A3CG 1VQAA 1VQDA 3LGJA 3GTMH 4DR6L 3TQYA 3T1YL 2NZOA 4OO1I 4QL5A 2R92G 5IYCH 4JI7Q 2JA7G 1CKNA 5FJ8H 4B3MQ 4DR4Q 1W3SA 3S17H 3J80i 1D8LA 2RHSB 3CXCA 4A3GG 1UWVA 2N8NA 1OXVA 4A75A 1OTCA 3RR5A 5IP9H 4BBRG 2YTXA 2CWPA 5IT9c 2BA1A 3NBHB 2ZJRA 5C4XG 4YWMA 3L2PA 2XGTA 4YY3Q 2Y0SG 4LF7L 4K0KL 1A62A 1YVCA 3JC66 5IY0A 1Y1WG 4LF7Q 5IYBG 3AFPA 4L5RC 1N9WA 1RIPA 2XTIA 2YTVA 3OYYA 4LF5L 1BKBA 2LSSA 4NXMQ 3TREA 1HNWQ 1X6OA 3HOYG 1Q86C 1QUQB 1VQOA 5FLMG 3ERSX 4DV1Q 4BY1H 3PSIA 5HGQA 5ELOA 4JI7L 1L1OA 1A63A 2UXDQ 2AMCB 4LW1A 4DR1L 4YCVA 2ALYB 3PIPA 4A93G 3IRBA 2OQKA 1VQ4A 1XMQL 4X62Q 2ZM6Q 4DUZL 2K75A 4DV6L 3ER0A 3PO3G 4A3BH 1KC8C 2R7ZH 3RLOA 3AEVA 2GVBA 4P71A 3UDIA 4A3KG 4JI5L 1EWIA 4LUOA 4YHHL 2RHQB 2HT1A 1PHJA 5BR8L 2LXKA 2R7FA 3E9IA 4C3JH 1EQRA 1X55A 3K8AA 2UXCQ 1JJGA 2KHIA 4BBRH 1RL2A 4BA2I 1YJWA 5DLQE 4IPHA 2UXBQ 3M4PA 2ZJPA 2DUDA 2K5HA 4LF4Q 2A8VA 1HZAA 4JI2L 2F4VQ 3VDYA 1VQKA 3U50C 3AFQA 4LWCA 4DV4L 2H5XA 4JBJA 4IFDG 1WI5A 1KQSA 1Z9FA 1BVSA 1XMOQ 2IX1A 4IFDI 3I55A 3KF6A 3TS2A 4QGUA 3H15A 3OW2A 1I50H 3RNUA 1X54A 4DR2L 4JI6L 3PO3H 3HKZG 4YHHQ 3S1MH 4A3JG 5C0XG 4A3EG 1SROA 3CCLA 1EIYB 2D0OA 4AQYL 4IPDA 1PFSA 2JA8H 1VS0A 2OQ0A 4UP9A 1I94Q 4LFAL 2ZTDA 4LUZA 1Q82C 1IZ6A 1G291 1YBYA 1AE2A 4A4IA 4X65Q 2IHEA 1NJIC 2JA5G 1X9NA 3BJUA 4AIMA 2Z0SA 1KAWA 1PH8A 1NE3A 2MNAA 4IO9A 4GNXA 2A1AA 2V1CC 4P73A 2AKWB 1L0WA 5IYBH 3U58A 1CUKA 3M7NA 3KJOA 2RF4A 2HHHL 1NBWA 1YHAA 2F4VL 1G6PA 1FJGQ 1PH7A 3S2HH 1UEBA 2K14A 4LF8Q 4QJFA 1PVOA 1X3GA 2VQEL 4DNIA 5GAEC 1KD1C 2R92H 1D7QA 1YIJA 4LF5Q 4NXML 1C9OA 3PUXA 3KJPA 4A3CH 3GTLH 4P75A 5FJ8G 1NY4A 1K0RA 1KRSA 4DK3C 3J81j 1XMOL 2NN6G 5GROA 3G4SA 1NMGA 2WAQG 5LMNW 1EFWA 4LUVA 4R4QA 3FHWA 3W1BA 4A3LG 2VW9A 1A8VA 1QZGA 1EYGA 1WYDA 2JA9A 2VS1A 5J3BA 3U4ZA 3CC4A 4JI4Q 1HR0L 1BBWA 4LF9Q 2AWNA 3H0GH 2K5NA 1Q12A 3J80c 2OCEA 3H0GG 3PUVA 4OWWB 2KCTA 2WFWA 4ME3A 2ZJQA 3PO2G 2MO1A 4X64L 1Q7YC 4AYBE 4DAMA 3K81C 1YI2A 1B8AA 4IPCA 3U4VA 3F2CA 3TS0A 4QIWE 5GAGC 1IBML 3KFUA 4DV0L 3ULLA 1OXUA 3CCEA 4HJ7A 4B3ML 3CP0A 3F8TA 4OWXB 4EX5A 1Q81C 4A3BG 1YITA 3ULJA 4BXXG 4B3RL 3NENA 1VQNA 1HZ9A 3K0XA 1XPRA 1LYLA 1JB7A 4UPAA 1N32L 1FGUA 2AWOA 1CSQA 4OONA 5IP7H 5M5YH 4HIMA 3A5ZB 4YY3L 4GKKL 2NVXH 3CCUA 2E2HH 2E2IH 5M3FH 4B3SQ 4RG1A 4MNOA 1K83H 1UE7A 4IJHA 4RMFA 4GKJQ 3B6YA 3A5UA 3T1HL 1VQJA 5C4JH 1IXRA 1K9MC 2R7DA 4KHPQ 2D62A 2PQAB 5C3EH 1K73C 2UU9Q 4XIGS 4OX9L 4DR4L 1NTGA 4JI8Q 5IWAL 1Y1WH 3JAMc 1YJNA 4GOPA 5HY6A 3PO2H 3K80C 4LNQA 2NVQH 1HR0Q 1LUZA 4A3MH 4A3MG 1HNXL 4KHZA 3CC2A 3KF8B 1XNQL 3CCQA 3PUZA 1J5EL 1IYJB 3HOUH 2N49A 4A93H 5JJLA 1L1OB
chains in the Genus database with same CATH superfamily
1OXTA 2PFNA 2KOLA 2LHTA 2F0WA 2HDMA 2YN4A 5KG5A 4JI3L 5K36G 1RD9D 3P75A 4JYAQ 1ZQPA 3NP8A 3DEEA 4POFA 2PFPA 1S5DD 4B08A 4JI0L 4A3KH 2AGPA 3J7A5 2CQAA 1A0IA 3CC7A 5A2QL 1DXSA 2LM4A 4NL9C 4NJ8A 4R8UA 4LFAQ 3I70A 1UT5A 1ZYQA 3SI8A 2Y9TA 2R93H 1DXMA 3CW2C 4R4TA 2HBJA 3D2SA 2EH9A 4JI6Q 8ICSA 1HNWQ 1LM0A 2JEFA 1GHJA 3WK6A 4OX9Q 2JK8A 3QU4A 1NNLA 1RF2D 4XT1B 2E1FA 1R4QB 4DR3L 3EPGA 4AQYQ 1K8GA 1SJED 4HJ9A 4DV6Q 3PIP3 5DBAA 3VYSA 2L4NA 2PW7A 3MEFA 1S72A 3L3FX 2D5DA 2QDBA 1HQRD 3H7IA 2C2DA 2CH4A 3UXNA 1JMCA 4Y2YA 3HPOA 1G2SA 3G48A 3QNMA 1MQ3A 1X3PA 2GOLA 1E2WA 3GIIA 3KD3A 2WKDA 4RGMA 3V2TA 1RHPA 1VF5C 1VQIA 2O5JC 1TWFH 2NVYH 2MA1A 1MA7A 2EZXA 8ICNA 5NUCA 2KG5A 1S5CD 2F0QA 4KLDA 2KCMA 2Z1CA 4CDEC 4JYAL 2I5HA 2K03A 1FIQA 2ZXOA 4F8RA 4JI1L 4J9NA 1PRTF 3TN2A 3M9BA 4DK0A 2K01A 3SAFA 3QZ8A 4BWJA 2OHFA 1F44A 4IZ8A 5FO7B 1IYUA 4DV1L 2XY6A 1JX4A 1UCVA 4EBEA 1D8BA 5KFPA 1Z47A 2NRWA 4BBSG 3UDXA 1VQPA 1UAPA 1X66A 1MSWD 1L2FA 3V96A 3WK4A 2OH2A 5TISU 4DL4A 3D4WA 1FVIA 5ALNA 3SAHA 1X56A 2A6EC 2F3WA 3WDNA 2UVVA 1K5OA 3KDFB 2NB0A 2IWHA 4H13C 4UB4A 4F4YA 2F0JA 2E8GA 1PFNA 1PFMA 2RLTA 1GKHA 4YD1A 2KCCA 9ICLA 1ZQZA 1MKHA 1T5XD 2W9CB 3D6JA 1J2MA 5DAUA 1TWHH 2EOTA 3VA5A 1JOQA 4DV7L 5JUMA 2NRTA 1T8EA 1IBKL 4K5XA 5J2CA 5K5PA 4P4PA 5KFZA 1XPUA 2BCUA 3M4OB 1JR0D 3P7JA 5KAFU 5E3FA 1SNMA 3I3CA 1A15A 4X64Q 3H3VI 3T5HA 1A3UA 2RDFA 4PL1A 1SRUA 4PH5A 1QILA 4DKAC 3S14H 1QUQA 1WJJA 2ISPA 4XTCS 4BY7B 1YZ6A 2JRZA 1LTSD 5IP7H 4JVZA 3K5LA 4NLCA 4BY1G 2XY5A 1OW5A 2HHHQ 1K8AC 2B63H 2JEIA 1WOCA 3WWVA 3TRZA 4C80A 4C3IG 1PZJD 4C2MH 1TY0A 2I5MX 1SNQA 1DGJA 3PR5B 2FMCA 3C2LA 4A3DG 3AYHB 3HOXG 1ZD3A 2KCNA 5HNKA 2R8IA 4RT3A 3N7PD 3K5OA 1PH4A 5KT7A 4L5SA 4OGQC 2JA8G 2RP5A 3HOVG 4UBCA 4R8UB 4DF8A 3WOEA 5KFUA 1TWCB 4GLAC 1PVQA 3CMEA 1DOLA 1GD7A 1JOOA 2FLNA 1EZ8A 5HP4A 1HR0W 5DQHA 2BQ3A 2P6UA 1N8RC 1PH1A 1LVHA 2QKIC 1HNXQ 3FYHA 3DV9A 4J03A 1ZRMA 4J8QA 5FP0A 4C7YA 2GO7A 2ID0A 3T53B 3KOJA 2B29A 5I4DA 5CR3A 4ECXA 2W3RA 4DSFA 4UY8C 2PZUA 4B3SL 3JPQA 5F9NA 5CV8A 2PKEA 4X3KA 4JCVE 5H1SE 3PIOA 5M5YB 2R61A 4JB3A 2PYKA 3UM9A 2E8NA 5AI0A 1LKYB 1KDCA 4EENA 3DEOA 4YMMA 3S2DH 2RDHA 4DR1Q 3B9JA 1PLFA 2CKZB 1HHVA 2CQOA 4FBUA 2FLPA 1YJ9A 3UE1A 1MIUA 1VQ8A 3GU3A 1OXXK 3Q8PB 7ICHA 4JC0A 4H02A 4PNYA 3JAML 3M4QA 3HOZB 5C4XH 2E74C 5T14A 4FS1A 1HZBA 2O2LD 5J0TA 2E8PA 1XWLA 2ODGA 2BH8A 5G5GA 1T94A 4A3GB 5DGAA 5ALTA 1T5EA 1ZJMA 1V1OA 4MZ9A 3LWLA 1CZWA 3RZDH 3HOWG 1PH5A 2YTYA 1MJCA 4XQJA 4UB8U 4CRXA 3VR2A 1S97A 5KNBA 2F1IA 2EZZA 4GKKQ 1T3QA 1H9JA 3NWTA 2VA8A 2F0SA 4GNXB 1N36Q 2N1RA 1ZQKA 4P74A 3QYPA 5LMUQ 1NZBA 1F9RA 8ICFA 1AZQA 3K59A 5AKJA 3EBEA 2G07A 2KFNA 1I4PA 2Z4HA 1M90C 1BPZA 4GC6A 1ICFB 2O5IC 5AICA 2QB0A 1N56A 2L5YA 3PF4A 1JN3A 2M00A 2XIWA 4EYHB 1J97A 5KFSA 1W2BA 3ZI4A 4JK1C 4DL7A 1KDAA 4C3IB 1E7ZA 4OD0A 2IPKD 4ZLTF 4X3UA 3MDAA 4Y2QA 1UA1A 2B8GA 1TWAB 2BQRA 5G3LD 4RNNA 2W9BB 1XPOA 3W1GA 3O0FA 4UARA 4R63A 3QEBZ 2JQOA 2CHBD 4QIWB 1RYUA 5HHHA 2RSNA 3FP9A 4GLXA 1MI2A 1ZQXA 5J0OA 5AI9A 5J0QA 3GFKB 4ECRA 5LMNQ 4M9JA 4DV0Q 1UE5A 2M0NA 4XXEA 3AM9A 3ZDEA 4P4MA 4MFCA 2FINB 4O2DA 3E0EA 4FZLA 4A3JH 3QEAZ 3HKZC 2K89A 1MGSA 4USAA 4BXXH 3G6YA 2W54A 2J7ZA 4KLOA 1AH9A 1STNA 1BPBA 3C1ZA 3U26A 1LTID 2KENA 1CTMA 3C1FA 5M5XH 3K0YA 1IW7D 3V7JA 5ALWA 2R7ZB 5COYA 1V1PB 4K6DA 3T56B 4U673 4KITB 4M0AA 1ZQDA 5IYDH 5KFDA 1NR4A 4BY7H 5J2DA 3T13A 4DAPA 1STGA 4K14A 4I2AA 4J6HA 3K57A 3SK6A 1S8OA 4FYDA 3WK8A 2EYPA 1EQTA 4CJ2C 4LF8L 1ZD2P 2FMSA 3PUYA 4CJ1B 5DM63 4V0BA 2A6HD 2F3IA 4GN3B 1KAAA 4X3TA 2R18A 1D9FA 8ICCA 3CAMA 2JXJA 3PV8A 3WOFA 3HOXB 3J81E 4K2LA 1NK9A 4QW9A 3CF5A 4JI8L 3OTQA 2KP7A 4I2HA 4HIDA 4G7HC 2VKQA 3TEHB 1IL2A 4O1NA 3CPWA 4DEZA 3D4RA 1QQ7A 1SLJA 5CBEE 2NVXB 5GQOA 1Z4OA 2WF8A 3TMEA 1JJCB 2WB1C 4M9NA 2EAMA 4X62L 4KLEA 1XTDA 5AJ3Q 2QARA 1L0XB 4DXGA 3OTOQ 2NZ1D 1TU2B 4JI2Q 1WVLA 5F3XB 1PZKD 2CCZA 1F2YA 2KTQA 1CHQD 3NTHA 2C9OA 3SMVA 1O7YA 1PTOB 3TI0A 5EWFA 3OIPA 1XSNA 2D9UA 5FLXc 1PH3A 2KN7A 1EIFA 5DNFA 4B9TA 2ZXPA 4XT3B 5ALFA 4AYBG 4HIOA 2G9HD 1L8LA 4B3TQ 3RAQA 2KJ9A 4DS5A 3NQIA 2R3ZA 1I3QH 4ID6A 2XRQD 1PK1A 4C1NK 2FLLA 4C3HH 4EQ5A 3S1RB 3N97B 2K5VA 3C46A 2JA5B 3D31A 1E24A 1MD2D 2Z9HA 3HRDD 3SR6A 1UE1A 2IHMA 5EKKA 5J39A 2SDFA 4RQ5A 5M3MH 4EEKA 4F2SA 1RKNA 3Q8QB 3F5AA 5L1MA 2QLTA 3TACB 1VQAA 2EJGC 1NSNS 3LGJA 3T1YL 4OJOA 4QL5A 4NLGA 5FJ8H 2LM1A 5L9XA 1W3SA 1QWYA 4Q5VA 2G06A 1BBXC 5ALEA 4A3GG 4A75A 5IP9H 5DEHA 5GTHU 1ZYRD 2YTXA 2CWPA 2W9BA 3EROA 4C3JB 4Q45A 1ZD5A 1IG6A 4FF1A 4K4HA 3KHGA 1YVCA 5CV9A 5IY0A 2WF9A 2F0IA 4ECSA 2E2DC 2EJFC 1DJRD 4C8KA 2KICA 2YTVA 3OYYA 3BQ1A 4EBCA 8ICQA 1BKBA 4OELB 2E8OA 2XO7A 2ASLA 3SV3A 2OF1A 4Q0FA 3K1ZA 3C2PA 4I29A 1B4FA 4F2RA 2OQKA 1G91A 1B44D 4DN4M 4X62Q 1TFRA 4DV6L 2FMMA 4RKBA 4CDCC 4F93B 1ZQFA 5HURA 3AEVA 3RBEA 2GVBA 4P71A 2DWQA 2W8LA 2L12A 3TP8A 4ELUA 4JI5L 2EYLA 4C2MB 2Y1JA 1CM9A 2HHUA 2HT1A 5BR8L 4EGVA 2R7FA 3E9IA 1EQRA 1I4RA 2UXCQ 1ZQGA 4DFKA 4IQWA 4BA2I 2F0EA 2DUDA 2ZIWB 4HTHA 3S9WA 4L63B 8ICOA 2F4VQ 4I2BA 3BYTB 3VDYA 2HQEA 4RQ6A 3AFQA 4IUQA 1U47A 1FFVA 4DV4L 3GTPB 1A2UA 1X9SA 1NJZA 2XWJB 1D5ZC 1WI5A 2FFKB 1BVSA 2IX1A 3UMCA 3OGUA 1QB5D 2MSNA 1EQVA 4QGUA 1WWUA 2HOIA 1I50H 5EBDA 3PO3H 2RVLA 3M9OB 1QCBD 9ICOA 2XY7A 1HQMC 1WTVA 3MFYA 1SE4A 4GC7A 1EIYB 3CCLA 3K1RB 1RQNA 4I2IA 1B3AA 2E2IB 2WB1B 4DU9A 4IPDA 1VLBA 1KFSA 7ICMA 7ICNA 4UP9A 1KKXA 3BDOA 4LFAL 4LUZA 2PPBC 1F9QA 4QZBA 7ICIA 1QLNA 1IZ6A 2HSZA 1STHA 1X9MA 3UQ0A 1AE2A 3DWAA 4Z6FA 4X65Q 2EY1A 2JA5G 3MBYA 2B6GA 5EPKA 7ICGA 5CHGA 3H8JA 1NE3A 2MJ8A 1M6YA 4CE6A 2V1CC 4P73A 3J7AF 3NRWA 4DQIA 5JVG3 2ZJ5A 3NWSA 1TT2A 3TAPA 9ICBA 3NPPA 1EYAA 1UQVA 2F4VL 3BQ2A 4CBVA 1G6PA 1FJGQ 1QSSA 4OO1J 1WTPA 1PH7A 3BVZA 2NVYB 1UEBA 4LF8Q 3SXHA 2FE9A 3TANA 1X3GA 2FJ2A 3AB9A 4CDFC 2CRXA 2VQEL 2R92H 2HW3A 4LF5Q 4NXML 8ICJA 8ICAA 2HHXA 3D6CA 1S9FA 4M9LA 4Y2TA 4A3CH 1O03A 2W03A 4FBTA 3J81j 2Y0SF 1ET9A 1SAPA 2NV3A 5I2YA 4EVOA 4FZNA 3DXJC 2EZVA 5AM2A 3I73A 3RF9A 1JWMD 4R4QA 4G7OC 4WJ3B 2ZIVB 1L0YB 4Q44A 3TZUA 1RM6C 2FHTA 2V9WA 3S2DB 4QB4A 3BQTA 2XN9C 3CKIB 4BUGA 1EY0A 2DFLA 2EANA 3NVYA 4KLSA 3H0GH 1Q12A 3PUVA 2WFWA 4ME3A 9ICNA 1KFDA 4KLJA 5CBAE 4X64L 5AKYA 3NE5B 1L3TA 4DAMA 4I28A 1HUNA 5KT4A 2W9AA 1B8AA 3U4VA 3F2CA 4KN7C 2Q8IB 1IBML 4YXJA 9ICWA 1BQQT 2XIDA 4DSKA 4NM1A 2IJ0A 4RCNA 4RPXA 3JPNA 3K58A 3ULJA 4A3BG 3C23A 1HZ9A 3K0XA 1N32L 3KLRA 2AWOA 3C5FA 3JPPA 4OONA 4RCOA 2KNJA 3ISBA 1GUOA 5CWRA 3A5ZB 1F2LA 3NQTA 3AL0B 4EZ9A 3BDLA 4HIMA 2KHQA 4HSPA 4C3JG 2L0CA 1T4GA 4ED6A 1ICWA 2NVQB 4IJHA 2NYZD 1R4PB 1ZQJA 1ZQQA 5AK5A 5EGTA 5CRXA 1PRTC 2KJ5A 4XIGS 5AK6A 4JI8Q 3BVGA 1NCVA 1MN8A 5CB1A 4GOPA 3SV4A 1RYSA 3RH5A 7ICEA 3SK4A 3K80C 3JPRA 3AQFA 1SFOB 4A93B 3D2QA 1U48A 4FZMA 3L5KA 1LUZA 1I4GA 4QZCA 2N55A 4RU9A 5KG7A 2HOFA 3HP6A 4TRDA 1XYIA 2KK0A 3TFRA 3JPSA 4FVMA 2V4DA 2ASBA 2ZT9C 4MF2A 4HJAA 1XNSA 1YNJD 2DF4B 2D6FC 2KA7A 4LF6Q 4FS2A 5KFCA 4YIJA 3NBIA 3CCSA 2QCPX 2PNHA 2AXTU 3BQ7A 3Q22A 5M5WB 2A1JA 1MQ2A 3S14B 1LABA 9ICGA 4DR7Q 4I2GA 5CR0A 5AFWA 2F0MA 4LJXA 1QZHA 2JJQA 3PZPA 3HW8A 4Q8FA 2Z8LA 5KFKA 2EY6A 2K33A 3S15H 2DL0A 5IE8A 2O4XA 5KYLA 3DLLA 5DB6A 2K5QA 1K3RA 4J9OA 1A77A 3CPFA 4Y2VA 4BWMA 3KBGA 4K5WA 5KFEA 1IBLL 4HIKA 2Z6KC 4OXPA 4NWIA 2ZIXB 4F92B 5D14A 1DOQA 2MFIA 4UB6U 4JBWA 4JI0Q 3PX0A 1SNPA 1QNKA 2XICA 1DGSA 1SE8A 1TR5A 2W04A 2DNCA 3STBD 3OJUA 2ENBA 2K5DA 4K4IA 2F76X 5ALLA 1WCMG 2YB4A 4DQPA 3BZCA 2HHVA 1B70B 1Y1VG 3H0GB 3AMUA 1PVOA 2WAQE 3KBBA 4XQNA 1R9TB 3VYTA 3H40A 4PMWA 4JK1A 4GKJL 2ZIVA 4DV3L 2RSOA 2A19A 1OO9B 4LVSA 1IHZA 1COOA 2VUMG 5C3EG 5EAYA 1Z3EB 4R66A 3PW0A 5JOBA 2JEAI 3D4DA 3EZ5A 4MHVA 3Q8SB 1ENFA 1TWCH 1OXJA 2ZM6L 1LT5D 5FLXL 1D2BA 4Z6EA 4LF9L 1G2TA 2KZ3A 2BDUA 4YVZA 3U9SA 4NKLA 1KQQA 3J7ZC 3EWAA 4AYBC 5JVH3 2YX8A 2B2WA 4KLFA 3TSSA 3EYZA 2DKXA 4ED3A 5AI8A 2L9HA 5HR6A 5ALQA 1H9MA 1KRTA 4PL2A 2D0PA 2XGQA 4O9MA 4DUZQ 3GDEA 5M3FG 1KXLA 3OSPA 3AQEA 2G9DA 3IFTA 3ICEA 5AKZA 2AHOB 3T3FA 3PCOB 4CHTB 5IYDG 1HNZL 4E6IA 4X65L 3EIVA 1VQ7A 1BF4A 3IHQB 3ALRA 3T1YQ 5J0PA 1SYBA 2HHTA 1SFOH 2L5TA 1HNWL 2Q2TA 3LNNA 1II3A 1VQCA 1BNOA 4O3OA 2E3TA 4DV3Q 2F77X 3QB3A 3PSTA 1CZGA 1ZD4A 1HA5A 3A54A 1U49A 2B63G 3PNCA 5FLMH 1N2XA 1YHBA 4POGA 3QU2A 4NY8A 3NXWA 8ICPA 4YCWA 4DFMA 2IX3A 3I4OA 1G51A 3BG3A 3HGBA 4Y7NH 3EFXD 3P20A 3RZOB 2EQSA 3BVMA 2F3VA 5D49A 4HYKA 5ALOA 4NB3A 2RQXA 5ELDA 3H09A 1IV8A 5DBBA 4DO9A 1BPXA 4A3LH 4QZGA 3A0JA 2LS01 5AKGA 1SBBB 4O42A 5AJ3L 2KIVA 2R6GA 3TP7A 5C5LA 2SOBA 3ZJYC 3OTOL 2WKCA 5JU5A 5AKLA 1C48A 2JSOA 4ZRZA 5CMDA 3ZDBA 2XSCA 4J9MA 2F0NA 1JT8A 3FEWX 3HKSA 4DFDA 1Q8KA 2JGAA 5DG8A 3I1YA 1PMRA 1WCLA 4PG3A 2FPLA 4AYBB 1C0AA 1DK3A 1GO3F 4TUQA 1MSGA 1NK0A 2JN4A 5ALUA 1YEZA 3NTUA 3H0MB 5IOCA 5ALZA 2EDUA 4KMUC 3K4GA 1U4RA 2Y0SE 1FNWA 3QE9Y 4TVAB 4BY7G 2EXDA 2JHDA 4N9PA 2ZTEA 3PW7A 1TKWB 1SN8A 2QW7A 4AH6A 1XMQQ 4NLBA 1DOKA 5KFYA 1TAQA 1KHIA 5KIXA 4BA1I 4KHPL 1PRTB 2ZIUA 3ZD9A 5M5YH 4ECUA 3BS7A 1YNNC 2WV6D 4EZ6A 4YCXA 4UP7A 3STBC 4APVA 2W11A 3KYHC 4C0ZA 1DD2A 4RT2A 8ICTA 3SE0A 1Y8OB 4GLVB 5IT9L 3PW4A 4YCUA 1V85A 1WCNA 4UAUA 1S40A 2ZIWA 2NUCA 2JH1A 2W9MA 4JOIC 1RJTA 3SDZA 1BNZA 1J5EQ 1QVFA 2PI2E 4B3RQ 4DV2L 1GJXA 3EUB2 1XU4A 4KX3A 5KFFA 5J2GA 1RTNA 2P5ZX 3KF8A 5LL6X 5LMUL 3MABA 1WCMB 3PMFA 3H4BA 2ESEA 5EKIA 1TS5A 4PZ7A 2PI2A 2C2RA 5ALRA 2GA4B 2KBNA 1N63A 1PYBA 3HRZC 4IUUA 3TFSA 4ECTA 3E2EA 1MJEA 3I4NB 5I9PA 2W7PA 2J6SA 4DV5L 3L4PA 1EOTA 2OM6A 4KLLA 2LPEA 4Y2UA 1C7YA 4M2YA 2PQAA 3I91A 4PHPA 1SV0A 1JMSA 4HAEA 1I4QA 4K0KQ 3J80E 3TKAA 4HJ5A 3OOCA 1EEFD 4EQOA 3PGZA 4F5NA 4O3QA 3GQCA 4ECZA 4J15A 1K8MA 4DR3Q 1NK7A 2IOHA 5AM3A 3B0XA 2YV5A 1AROP 1NZPA 4NXZA 3JPOA 2HIXA 4JV5Q 4TUPA 2L11A 2Z6BA 1IW7C 3CRXA 4DF4A 1V1QA 3OWFA 5C44H 4DWIA 3M3YB 3HOVB 4M6WB 5KFNA 1HUOA 2KE7A 1YNXA 5KNDA 1L7OA 1UE6A 2DJGC 4LFCL 3HOXH 2ZUDA 2ZTCA 1LV9A 3ITPA 4DK6C 2E5LL 1TY2A 1U4PA 2F0GA 3ND9A 3HOUG 2R7ZG 1KFTA 1F0MA 1NK6A 2KEYA 4Y2JA 5H2FU 4XA5A 1ENCA 1AFPA 1V9PA 1GUSA 4A8EA 1X3EA 4F4KA 1STBA 2V4QA 3GDXA 4FF4A 1QG7A 4HCSA 4QZIA 4JI3Q 1WYGA 1ZQSA 3HOVH 5KFRA 4B9MA 2QGQA 5J0YA 3GTOB 1Z4NA 4EQPA 1G8ZD 2YMPA 3K75D 4FXGC 1IM4A 4QY7A 4RQ2A 4IL6U 2G5HB 4QNLA 1P16A 4G57A 3K5NA 1NJYA 2MRLA 1LT4D 4EQNA 4IUNA 5KFVA 3M6ZA 3PO5A 3QU5A 3ERQA 3CCRA 1X3FA 4J9QA 3KF6B 4IR1A 9ICPA 5E7NA 3I4NH 4OO1G 3UPQA 3RJEA 5DB9A 3LWEA 3H4DA 4RQNA 4O3NA 4KN4A 1VCIA 2DY8A 2IA6A 3NELA 2YB1A 4FE3A 3IFDA 4X5VA 1E1TA 1IYVA 1PYSB 3OSOA 3HILA 4F72A 2MAXA 1S5FD 4RFBA 1WCMH 3RN5A 4F7XA 2VQFQ 1FNVA 2MU2A 4M9GA 1HXYD 3HP3A 4NW2A 4YWLA 4A3IH 1PH9A 1ZQWA 5CEHA 3F2DA 1EYDA 3QX7A 3T5LA 2WB1F 2C22A 2JEBI 3FPPA 3I8ZA 4RGNA 3G71A 1B7YB 3DWPA 2EIFA 5L1JA 4I2CA 1HFNA 1Q1EA 2Q8TA 5C0XJ 4I7AA 2KECA 3NASA 5AKXA 4PQXA 1QOHA 3RJFA 4A3FG 3M9MB 1WFQA 4G4KA 1Q3UA 3C1YA 1VQMA 4QF4A 3EN2A 2FJ6A 1GO3E 2BOSA 5KEEA 3H3VH 3J81L 3I4MH 8ICYA 3QOJA 3I4NG 1D8YA 4MEYA 2AQ4A 1S5ED 1X6JA 1RPLA 5IIMA 1CSPA 2EYMA 2K8BB 1ZEQX 9ICFA 4FNFA 3OHAA 4A3EH 2X6LA 2JA7B 1VQDA 2H3VA 2ZIXA 3MZ5A 3C21A 3QUTA 3KHHA 5EE1A 3RRGA 4MFFA 4J9RA 4DR4Q 3VCBA 4Q8EA 1COKA 1RDFA 2R92B 1SXDA 1W6JA 2B2TC 4RQ0A 3RAXA 5EQ0A 1UWVA 2N8NA 1OXVA 3RR5A 2VIXA 2R8HA 5AKIA 1ZQLA 8ICRA 1E2ZA 4BBRG 2R93B 8ICIA 1JC7A 2RA4A 4Y7NB 3JAME 1U4BA 4YY3Q 2Y0SG 4MTKA 3VR4A 4ZYSA 3LX0A 2M9NA 1N5WA 2L1BA 4N8FA 1Y1WG 5IYBG 3HOYB 3WKAA 2CPRA 1QNUA 1N9WA 1RIPA 3V05A 4LF5L 4NXMQ 2JA6B 1EIHA 4CF4A 4RNOA 5J8YA 1ESFA 1QUQB 4KN7A 1Q86C 4ACOA 4TSSA 2AGOA 3PSIA 4IQTA 7ICLA 5KT2A 5KG6A 3C2MA 4A93G 2F2AB 4Q43A 1JXLA 3IRBA 1VQ4A 3S16B 1SIJA 2AQ0A 5KFTA 2K75A 2PZTA 9ICAA 3ER0A 4ED8A 5D4BA 2E76C 5AK3A 1XX8A 3UDIA 2QDLA 3PO3B 4CGZA 1SYGA 2BDNA 5L1KA 5IT9E 4DSIA 3I72A 2BCSA 3GILA 2D3DA 2NO5A 1EWCA 3GTKB 1BNPA 5KG2A 3K8AA 2ICEC 2KHIA 4P0QA 4BBRH 1RL2A 4IRCA 4IPHA 2ZJPA 1VF7A 3BZDB 5I2XA 4FF2A 4F88A 2VB3X 1VQKA 5C6AA 1MSHA 1LT3D 4LWCA 4US8A 3UQ2A 4ELTA 2BDOA 1TE2A 2ASDA 5G3LF 4DOBA 2LI6A 1KQSA 3I55A 3H15A 4HN7A 4JMUA 3RNUA 1X54A 4JI6L 3RB4A 3EVQA 3RZDB 5GTIU 4YHHQ 1S0VA 3S1MH 1LKYA 5DDMA 4QUFA 4A3FB 2ZXRA 1ZQOA 2NRXA 2M9VA 4AQYL 2QB0B 4DXFA 1VS0A 2OQ0A 5IGFA 4C4SA 1I94Q 3QG1A 2EAPA 3R9KA 5DG7A 2H3IA 4KLIA 2F0VA 2Z7JA 1G291 1YZ7A 2PCFB 4A4IA 1WD1A 3IL8A 1FFUA 4Z6CA 3KLSA 3SK5A 4R8IA 1TWHB 3CU7A 4F5QA 1WG8A 1LTAD 5KFJA 1SE2A 4GNXA 4IO9A 3OJSA 4C4RA 3KJOA 2P35A 2HHHL 1NBWA 2F3NA 5J0WA 4ZUIA 5IGBA 3PY8A 4L8JA 3S2HH 2J6UA 4DL2A 4QJFA 1WTWA 4B9VA 1RXVA 5GAEC 1D7QA 5J0XA 1YIJA 3V7LA 3PUXA 5ELCA 3GTLH 4DCCA 4ED0A 5B5EU 2LFNA 1K0RA 9ICUA 4XDXA 2GH1A 4DK3C 9ICCA 4WFN3 2EZYA 3IG8A 2PMZC 3M7GA 5BN3A 2KQ3A 7ICTA 2HCCA 2RKSA 1CA6A 1EFWA 4LUVA 3S1NB 3W1BA 1SL1A 1IKLA 4A3LG 2BQUA 1A8VA 3NTIA 4DGZA 1WYDA 4PHDA 2KJ8A 2DY7A 5J3BA 4CNQA 3ND8A 2EXZA 4EEYA 1HR0L 1BBWA 2VA3A 4BXOA 3H8WA 4Y2XA 4ZKBB 4KJOA 7ICKA 3A7AB 4RZRA 4ZQ3A 2YTUA 2MO1A 2K6AA 1NKCA 1EL0A 1EY8A 1WWVA 2HHSA 3TP6A 1Q7YC 2C5CA 4UAWA 4R65A 1SWVA 1TAMA 9ICRA 1K28A 3M4YA 9ICVA 3J7YW 2A68D 3MWYW 2Q4TA 4CF5A 4QIWE 5GAGC 2BGWA 2B63B 1OXUA 5TSSA 4HJ7A 4B3ML 2YQEA 4F71A 5IGDA 1V97A 1YITA 3DEPA 2HOQA 2A3VA 3T51B 4F91B 1JB7A 5C44B 2JEJA 4CCHA 1H9SA 1KDBA 1S0OA 2K8AA 5J22A 2PFQA 4H0LC 2NVXH 7ICOA 4DSJA 2E2IH 3TDQA 4B3SQ 4RG1A 1JICA 4MNOA 1K83H 2BHNA 1KBUA 3A5UA 5C4JH 1B50A 1NI3A 4HMJA 2D62A 2PQAB 3QUQA 5KFAA 4DR4L 5IWAL 1DYQA 3RJHA 5CV5A 5LHY1 2LMCB 4KMOB 3MEHA 1PK1B 2CVRA 3VR3A 2NVQH 3N7SC 4IFDH 5AKKA 1HR0Q 1A63A 5IIIA 4F5RA 4H7BA 4AP9A 3F2UA 3RJJA 1LACA 1KNEA 1B22A 2UXDQ 4LZDA 1X6IA 4F8MA 5C3WA 4O5CA 1DCZA 4R8NA 1S0MA 3PUZA 3CCQA 1IYJB 1J5EL 4OWXB 4HCEA 1Y69U 1FGBD 2IHNA 3HOUH 3PO2B 5ISRA 2F0FA 5ELEA 2QEJC 2IY5B 2XCAA 3E5SA 2LBOA 1HTPA 1EY5A 4NP5A 2WP8J 1CHPD 1H95A 4YR2A 4KLUA 3UMGA 4DAYB 3KHRA 1VDZA 2PNRC 2JA6H 1DZ1A 3MHBA 4LF6L 4J9SA 3KBXA 3S1QH 1HA6A 4LFBQ 1BXTA 2QARB 5ALIA 3S24A 1D1IA 3QZ7A 1L7PA 2XCPA 3VA7A 1PH2A 1N33L 1NK8A 3L3OC 3H8SA 4KLTA 1GXDC 3D0FA 1KNAA 3ETRA 2HD3A 4DV4Q 2BA0A 4Y2PA 4L5QA 5FO9B 3RTVA 1X65A 1QSLA 2XWBB 7ICSA 1SJHD 2KKPA 2RHFA 4BWGB 1TXYA 3ICXA 1CKOA 2EVBA 1UEAB 2HBMA 4ZKCB 5CV4A 4IQUA 3F5EA 3Q8MA 2QF7A 2YMQA 5KFQA 4C3IH 1JJ2A 2BCQA 4PZ6A 2B8FA 5IIOA 1CQVA 5IGCA 4A3EB 4JV0A 1DONA 1SNCA 5AKEA 1X40A 4M9HA 4JI5Q 4DR7L 4P4OA 2C2EA 5AI5A 2NTSA 4MN3A 3GO5A 2LXJA 5FO8B 4RQMA 3IG5A 1XNQQ 4UW9A 2K28A 2RBMA 1WTRA 2QEXA 2AH5A 1HUZA 1VMCA 2A68C 1VQGA 4F5OA 3V6KA 3QR8A 1EQQA 5KT3A 1LO5D 7ICFA 1QVCA 2UUAL 2H3QA 1PDQA 5EPLA 2W8KA 2I0QA 2DN8A 4TQUS 3KHLA 3M8RA 5I6YA 2KJXA 4F5PA 2JZBB 4OHJA 4RQ8A 4JOIA 5L1LA 3R2TA 4IR9A 1HNZQ 4FFDA 4OJPA 3I4MG 2PW5A 3TQ1A 1TS3A 1ZXIA 1YNND 2Q2IA 1I4XA 1JOKA 1E3PA 2WFAA 3NHHA 1O08A 5KTQA 5JJIA 3CCJA 1U5KA 3AU6A 4BBSB 2QA4A 1JORA 4M6WA 5KG1A 3UI2A 3EPIA 1CQFA 3S1QB 1N62A 3WKBA 5EWGA 2Q8RE 4C8NA 1EU3A 1WTOA 4QZ9A 4IUVA 5ALSA 2F0HA 2CWAA 4RQ4A 2D2CC 1NK4A 4R4IA 3ZYYX 2JR5A 1I50B 2HQLA 4UBBA 1SV4A 1CKMA 4DAYA 1STYA 3HOUB 1SXEA 1PTOC 5KFLA 3W5OA 2MO0A 1E2VA 2HBKA 3PUWA 3HJEA 3KLWA 2UUAQ 1ZQEA 1JQYD 1RZTA 1S5BD 3AQQA 1T7PA 4A3FH 1Z1BA 1IBMQ 3K7UC 1FJGL 3CCVA 1TK8A 3KKAA 1EFID 5ELNA 1KLGD 2HIVA 1ASYA 2EY5A 4R1JA 5C3EB 4O0AA 3ISCA 5KT6A 2MQHA 2RCNA 4K6LA 1M1KC 3IP4B 1NOMA 5KT5A 3BU2A 3UE0A 4UP8A 3M3YH 4FDBA 5ALMA 3LK9A 4L6TB 1V8QA 3T79A 4JWNA 2NBFA 1XO0A 3VYUA 4B9WA 2I5LX 4IOAA 3D6WA 4M1UB 1PTOD 1CKNB 4UATA 1PFBA 2XVTA 1GOZA 1Z00B 3N28A 3HOWB 1VQFA 3HFZB 1ZKOA 4B9LA 4H44C 3SAGA 3PMLA 4JI1Q 1DRGA 2IHFA 2KVSA 2KHSA 3GTMB 4QZFA 3BQ0A 4QWEA 4ED2A 1HZCA 3PR4A 2B2UC 3FMCA 4ODGA 4MHEA 3RMHA 5M3MB 1V38A 2KUMA 2F4IA 3FVQA 5KG4A 2AUKA 2PQEA 2VUMH 4R9WA 3T16A 2OXOA 1ML0D 1ZQHA 4DQQA 1PK3A 3MFHA 1Y88A 3SHLA 4MEXA 2DKZA 3WKCA 1I4HA 5KFBA 2B39A 3PX6A 5EWEA 2K05A 4HMIA 4KI0A 1PH6A 1IBLQ 2DUYA 2HUGA 2KV2A 2EYFA 2B3GA 3C1EA 1SMXA 4MFAA 4E0DA 2NN6H 1E1OA 5IP9G 1RDPD 1UPHA 3PW2A 5E4XA 3VC8A 3T1HQ 1CA5A 3WK9A 1I3QB 1XJVA 5ALGA 4RPYA 1GUGA 2UU9L 4ZUJA 2B21A 3CD6A 2ES2A 2ZIUB 5DBCA 5ALHA 3NRZA 4M8AA 2NO4A 3HKZE 5FOBB 1EUJA 3C3LA 4NDXA 1Q8IA 8ICWA 2F0PA 4RUCA 4KLHA 4DOAA 3KTQA 2R93G 2NVTH 4JI4L 7ICQA 1LT6D 3MXPA 1VQ6A 4NV0A 9ICJA 3FKIH 3GTQB 5FKAC 9ICKA 2LMRA 3RR7A 1B2TA 1IL8A 3R93A 4KJNA 5EJWA 1MC8A 2CFMA 1KDHA 3GV6A 4UAIA 4DQRA 2OWOA 1PA6A 1A3VA 1B1ZA 1BBUA 3J81i 3FAHA 1VQEA 4NPSA 3OHXC 4ED7A 4G3IA 3AU2A 2UXDL 5DM73 1ZQUA 2E5SA 3MDCA 9ICQA 4X66L 3GTJB 3BJYA 2XGPA 2WIIB 1WTHA 4IJLA 3A74A 3UDFA 1A76A 8ICGA 2PFOA 9ICEA 2PZWA 4R4CA 5F9LA 2WF6A 3GZFA 3WKDA 2JXMB 4Z6DA 1LTRD 2CXYA 4IURA 2ATLA 1ZQYA 3GD7A 4DV2Q 3RB0A 1Q3VA 4X6AH 4RHSA 1STEA 3GTPH 4JPBW 3S16H 4JBKA 2F1MA 3MAQA 4B9NA 1S5LU 2ICIA 4IOCA 2VNUD 2BR0A 4RPZA 3ZDCA 1RODA 2BPCA 5ALDA 4BGDA 3KDFA 1LTLA 1ZQCA 1TWAH 3J81c 3M9NB 1HH2P 4FF3A 3KFUF 5KFGA 5M3MG 1Y14B 3OHBA 1NJXA 3UDGA 1U0LA 4CKBA 3CNHA 3URYA 5J2IA 2SNMA 3I28A 2Y0SC 4HJ8A 1FYCA 2XNAC 1ZQMA 3CRLC 4ECYA 3HKZB 1K8OA 4IQZA 3NUQA 4I2JA 4CDGA 4O3RA 1TS4A 2JE6I 2I07B 1PVRA 4IPGA 3I56A 2ZG6A 3GIJA 1SDFA 1HUMA 4RQ1A 2TMPA 5C0XI 2N88A 1KIXA 8ICXA 1H9KA 3NS1A 1SSOA 1Z6HA 1Q1BA 3L7ZC 2F0TA 3QU9A 5KG3A 4MIUA 3MC1A 3BDCA 4P2CB 3FC4A 3CMAA 3PF5A 3RFAA 2F44A 4A76A 3HWTA 2K5WA 4RHRA 4IRDA 2WACA 4FXKC 3R8BA 2GLEA 4K2KA 1JE4A 3L9AX 1Q46A 2BPGA 3E9HA 3N7RC 5JJZA 2WINB 3GTJH 1S3OA 4KLKA 2NVTB 4DR5Q 4F4WA 1G6ZA 3ULPA 2ZJ8A 4JUZA 3I90A 5JPMC 3J7AV 2NRZA 1F9PA 5EPJA 2OEOA 1AQ6A 1VQHA 5AIAA 1U45A 5CYUA 1QSYA 5IINA 1Z7TA 1H9SB 1P7DA 5IYCG 2C35B 1UA0A 2WF7A 5FK9C 3SD7A 2ISOA 3RLNA 3Q23A 3MR6A 2KHJA 2FDRA 2ZUBA 2JA7H 3FDSA 1L3UA 1UNSA 4RGTA 1GM5A 4BDPA 2LYBA 5AM0A 3UXPA 4OWTB 3GTQH 5AKHA 2WAQB 1I5FA 1PTOF 2NN6I 2PMZE 3HZXA 3OW7A 3TADA 3GQBA 2F0UA 1KL9A 2X6GA 5I6WA 4C3HB 3S1RH 1R9TH 1HPCA 1JE5A 4KKUA 4BBSH 3E6ZX 1ESRA 1UHUA 4LFBL 3CCMA 2HVHA 3C28A 5LMNL 4IFDJ 2LKYA 3HS0C 3HOZH 4F4ZA 3PO4A 3PSFA 2Z6KA 4OJ6A 3W2DA 3DWQA 1BGXT 5C0XH 3G7LA 1D5XC 3GTMH 2EQYA 5CJ7A 1L3VA 3TQYA 2PMZB 2NZOA 2R92G 5KG0A 4I65A 2O6KA 2KZZA 3WK5A 5IYCH 1CRXA 1QQ6A 4B3MQ 5EBCA 4YMOA 5HHIA 3S17H 1M8AA 3E3XA 2HBLA 3LDAA 4HAIA 3QIAA 3J80i 4GXIA 2RHSB 3CXCA 4CKCA 3LYSA 1JALA 1Y8PB 4XYOA 5IT9c 3NBHB 5C4XG 1KEJA 5C0YA 4LF7L 2G5IB 5C4ZA 4K0KL 3JC66 1DM0B 5ELFA 1N5XA 1SNDA 1XWEA 1KSPA 3NVZA 4IUTA 4I2EA 3TAQA 2LSSA 2KOBA 1QQ5A 4ILWA 2TSSA 2EYOA 1X6OA 3I4LA 3TREA 2YU9B 4UASA 1A2TA 1VQOA 2DQNB 3MTSA 3A8KE 3ERSX 2VJ4A 4GZYC 3SQIA 1J8IA 3H8MA 5EKLA 5HGQA 1RYRA 5ELOA 4JI7L 1RXWA 5IILA 1DK2A 1TKDA 4IC9A 1L1OA 1D1KA 4LW1A 3BS5A 4YCVA 3MXNA 4DR1L 1RCVD 1EWHA 4ECQA 1J9OA 4WRDA 5CV7A 1XMQL 4JV1A 4IUPA 1QCKA 2HMXA 4DL5A 4NLKA 3W3AA 4LAAA 2F0LA 3D2NA 3C2KA 4A3BH 4X3SA 3AUOA 3EJIA 1KC8C 2R7ZH 4PMBA 3RLOA 1URJA 1V1PA 2LKVA 2EDGA 5KFXA 1BDOA 4A3KG 2WAQC 4FP5D 5EE0A 1PXUA 4F50A 2F0KA 4YHHL 2RHQB 1XXGA 1PHJA 2KVMA 2LXKA 3T5JA 1JWUD 4RKLA 4C3JH 1F9SA 1X55A 4YP3A 1JJGA 4O0IA 1EEID 1HEKA 4PGXA 4DLGA 2HCIA 5DLQE 5ALPA 2RQ5A 2UXBQ 4KY7A 4LF4Q 2A8VA 1SGGA 1HZAA 3RR8A 2UVUA 4WJWA 1TQOA 3MXUA 3AN1A 4YR3A 5AIBA 3U50C 4UDUC 5DB8A 2F8KA 4UB3A 3KUPA 4I2DA 2H5XA 1AW7A 1XTCD 4U7CA 4BBRB 4KK7A 3KKAC 3F53A 3G6VA 4XYQA 2IBKA 3X3MA 3H3VC 3SR1A 4TUSA 1YT3A 1B9NA 1XMOQ 2I1QA 4IFDI 2VA2A 3TS2A 3FPUB 3OW2A 4DR2L 1ZQBA 4YFKA 3HKZG 1L7NA 9ICIA 1KW4A 1XC9A 4A3JG 1S77D 4LMQD 4A3EG 1SROA 3UMBA 4PV1C 5BPCA 2D0OA 1BCPB 1JUDA 3ZDDA 4XRHA 4BX9C 3B0YA 4WORA 3HKZF 1C20A 1A0PA 1NNXA 1Q82C 1BPYA 1YBYA 1LB2B 1SL2A 4PHEA 1NJIC 2E2JH 1NKBA 1X9NA 4AIMA 2DPIA 5ALXA 1KAWA 1PZID 1PH8A 4MF8A 2ES6A 1SXTA 5J29A 2BE5D 2A1AA 1ZQVA 3FKIB 5T1IA 5IYBH 4RA8A 1VJ5A 3U58A 1CUKA 3QWNA 3M7NA 1SB3C 2DGZA 1YHAA 4KX5A 2ZXIA 2PI5A 3E58A 4OJ5A 4UB2A 1DOMA 1CEZA 1BUVT 3A55A 1KTKA 5IGGA 2F1HA 2B2WC 4YN4A 2H4OA 2AJQA 5D65A 4QJFB 1JXEA 3GIMA 1C9OA 2EPBA 4R64A 5C4XB 2Y0SB 4P75A 5FJ8G 1KRSA 1XMOL 2I46A 1ZETA 1D5MC 1XS9D 2A5HA 3G4SA 4CDDC 2WAQG 4EYIB 3MFGA 3DDHA 4EBDA 3FHWA 5J2JA 4PJ0U 2G09A 2VW9A 2HHQA 4J9KA 1EYGA 5L1IA 3GTLB 1CT1D 3U4ZA 4C7ZA 2ZUCA 4JI4Q 5BN5A 1CK1A 3GV7B 5K4LA 2CW0C 3K5MA 2AWNA 4M47A 4RGOS 3J80c 3G6XA 4B9SA 3BYYB 2KCTA 4OWWB 2AGQA 2ZJQA 4DOCA 1NJWA 4RUAA 3RH6A 4QWBA 4EX7A 3VR5A 3BS5B 1YI2A 3TS0A 1AEXA 4A3KB 4IQVA 5TZVA 2J4XA 4DV0L 3KFUA 1JI7A 3ULLA 3CCEA 1PUZA 4KLGA 3F8TA 1Q81C 1F5SA 4BS9A 1TVAA 1W6KA 5C3XA 4BXXG 2IL8A 4B3RL 1LLRD 4UB5A 1XPRA 1LYLA 2K32A 2PMZF 2W43A 1JB3A 3OMCA 1CSQA 2PXIA 1I6HB 3RUZA 4OEMB 4GKKL 4YY3L 5I9OA 3ONNA 3OPXA 4DK1A 4ABNA 4TKOB 1QTMA 5M3FH 2A1JB 3LWMA 2VANA 3SYZA 1UE7A 2RDIA 2CW0D 4RMFA 3B6YA 3T1HL 4PGYA 4GKJQ 1K9MC 4DFJA 5C3EH 2UU9Q 1HIWA 1X2IA 2R8GA 2NYVA 2HDOA 1Y1WH 3JAMc 1ZXTA 3A0BU 1SYFA 5C4JB 5HY6A 2B2VA 1K83B 4LNQA 1BOSA 4RH6A 5KFOA 1ZQIA 4KD3A 2D8CA 2R8JA 3N52A 1B3QA 2BCOA 3GV3A 3WU2U 4ZOHC 4A3MG 3CC2A 4YG2A 4A93H 4QUCA 2N49A 1L1OB 1N34L 3MXGA 1PRTD 2I6XA 2K50A 2J0TD 4ED1A 2N3SA 5HMLA 4P2HA 1ASZA 5CP2A 2K1BA 2BH2A 3F2BA 5HR7A 3V6JA 3H91A 4DL6A 1F2MA 4GS3A 1VQ5A 1XNRQ 3SGIA 4A3DB 4J9PA 1GUWA 4UAVA 1BO0A 2FPKA 4ELVA 1Q90A 2BCVA 1O7ZA 1SMYD 1V43A 1EZ6A 2NWGA 3D8GA 4DR2Q 2V4RA 1TV9A 4ALPA 1I6HH 3IAYA 5JTIA 4DS4A 3NSWA 2H3FA 3IM1A 5B66U 2VJ5A 4P0QB 8ICLA 2GVAA 4P0PB 4PMCA 4F4XA 3J80L 2UXCL 2FI1A 4GXKA 1GHKA 2JEGA 3NVVA 2AQ1B 3GV5B 2F0DA 1TIID 4DFAA 2QKQA 3IV6A 4RWSC 2CN1A 2YMLA 2EJMA 1U9RA 5E1FA 3S15B 1FO4A 2IMWP 3EW9A 4QQBX 1RG6A 3PQIA 3I7FA 2E5LQ 3IN5A 1SE3A 2RDGA 4KHVA 5CORA 1QVGA 4F87A 5IP7G 3C5GA 3MGVA 4TQRA 2KMDA 3MFIA 1AN8A 3M85A 5M5WH 4JV5L 2VUMB 4ECWA 1HRJA 2H1EA 4GN4B 3DMUA 1KN5A 1O7IA 2FMQA 3R3OA 1SV0C 1T9HA 5J0RA 5AI6A 3U9OA 2UUCQ 4N8X1 4RQ3A 4YXMA 3BDPA 2VL6A 1GVPA 1CI4A 4QWAA 3HOWH 3A56A 3VYRA 1TS2A 4ULLA 4DV5Q 2PI4A 3G6JB 5J2AA 4LZGA 1H9RA 5C44G 3HOZG 3H6MA 2JA8B 3GTOH 4NM2A 1B0XA 1X9XA 5KFWA 3HX0A 1ZQRA 2VXWA 1PV4A 4UQGA 3CQZH 4A3DH 1JIHA 3I76A 4B3TL 4G7ZC 5KNIA 4P72A 3OIQA 5KL1B 3V72A 2K4KA 1D6EC 3F1ZA 4Y52H 2ASJA 1ZOLA 4DR6Q 1L6NA 5KGUA 1IKMA 4GIBA 4BXOB 3V6HA 1SYDA 4JW0A 3OPOA 4DPGA 4A3MB 3GTGH 1TAUA 4GOPB 5DLGA 5DLFA 2P66A 1F77A 4KY6A 2YY6A 3P1HA 4QIWC 3I2ZA 4P0PA 1ZRNA 4YR0A 4QZHA 1ZQNA 1LTBD 5JEAH 3Q8DA 3RJGA 2F52A 4ZCKA 4QIWF 1N61A 3HOYH 1ET6A 2L55A 4JBMA 4Y2RA 2F1JA 4RNMA 4IALA 2W55A 1CI3M 3M7DA 1L3SA 1TWGH 4YMNA 4UHVA 2VQEQ 1Z00A 3X3NA 3GTGB 4QW8A 3M8SA 5C5MA 8ICEA 1YHQA 2UUBL 3MC0B 4NXNQ 1AP0A 2OEHA 1BPEA 1JRPA 3SK8A 2GN5A 1EY9A 2MUYA 4O3PA 3ORYA 2F0OA 3MGIA 4QZAA 2UXBL 2KIWA 1SKRA 2KEDA 5JPNC 1MBYA 3KOOA 4J1MA 5BN4A 4EX6A 3MGHA 9ICHA 4O3SA 1UT8A 1FD7D 2VB2X 3UXOA 3EQLC 2E1EA 1HJPA 1N34Q 4XUSA 2EYJA 1O80A 3OWEB 4DR5L 5AM5A 1NUCA 3L0OA 1OUQA 1A3TA 3ONAB 3QUBA 4C3HG 3MXNB 2BCRA 5A2QE 1WTQA 2L15A 4DSEA 2K4EA 2GWSA 2FXQA 1OXSC 7ICJA 1VMPA 1E0BA 1L7MA 5GAHC 1N48A 3M4OH 1E22A 3KK7A 3S1NH 3KZXA 3JPTA 1NAPA 2AQ3B 2DGYA 1GUNA 4Z9CB 1Q3LA 4ZK9B 4L5TA 2OTLA 3A0HU 2A6ED 3BZKA 2KD1A 3RBDA 2B2TA 3T4AC 4IRKA 5JEAJ 4NXNL 4A3GH 4OJLA 3I4MB 4A3IG 2UUBQ 2FMPA 3DM3A 3WK7A 3HEJA 1KRPA 1TVXA 1VQBA 3ED5A 5ALVA 3NGDA 3KZIU 3D3RA 3CP8A 1EU4A 3TADC 4YWKA 4OIJA 2Y1IA 1P8LA 3ISDA 1ILQA 5BR8Q 3K7AH 1AE3A 2K52A 5CC4A 2J6TA 3Q6SA 5FLXE 4HR7B 3R2IA 1KTQA 2B0CA 1CFMA 4LFCQ 2RRDA 4V190 5J2FA 1FNUA 1ZQAA 5JEAG 2XC9A 1N36L 3T5KA 4DQSA 2KZMA 7ICPA 3DM1A 5KL8B 4OO1H 1L1OC 1X32A 3IDWA 3C29A 2WB1E 4PHAA 2N78A 9ICSA 4WJ3M 1BR9A 2K04A 4ZAIA 5JJKA 1S0NA 1JCKB 1SMYC 2IX0A 4YQWA 2VZAA 5GADC 1STAA 3EA6A 4MTNA 2KVCA 3QJYA 2W3SA 2B2YA 4R4OA 3S2HB 2SEBD 3M6KA 3RB3A 2UUCL 3N4MB 3BS1A 3NEMA 1PYWD 2DBYA 4X66Q 1JROA 4F3OA 1EYCA 1Z1VA 3GV8B 5E79U 1ZQTA 4HSVA 5BOLA 4DV7Q 4RQ7A 2UVRA 1VDVA 2JMGA 3LVWA 2B2UA 3FRPB 1BCPD 3G6EA 2MP1A 5J2BA 3PV0A 4DFPA 4QZDA 4KLQA 4GOPC 3PW5A 3RN2A 2OT2A 5J8YC 3TBIB 2IOFA 1ZJNA 1SZHA 4XQ8A 1C4QA 1ZQ1C 1O7LA 1I94L 1TK5A 2G0AA 3M1YA 4PZOA 4QCLA 1BPDA 1L8OA 2NRVA 2CH4W 1M4VA 2YMMA 1HCZA 4DL3A 3RB6A 4KMUA 4JV2A 2BKEA 2VQFL 3GTKH 3PMNA 2IT1A 4CF3A 5J0SA 2M2LA 5C4HA 2ATWA 5IIFA 4PZNA 4B6JA 4PPXA 4DUYQ 1QH9A 2K4PA 1RTOA 5K36H 3H0RB 2OYYA 1Z19A 1VQ9A 1Y1VH 1A6XA 1QE6A 1EXNA 4NL9A 4Y2SA 1WUDA 2VY3A 1XNRL 5LL6S 2WF5A 5KAIU 1N60A 4KV6A 3HT3A 3RZOH 5ALKA 1FL0A 2YU9H 4BY1B 4JG2A 2MUTA 3Q8RB 2HI0A 3TARA 2H3ZA 3MA2B 2I9GA 1EOVA 1ENAA 4QZEA 2EY2A 4GNXC 2HCFA 2ALZA 4KKSA 3Q0AA 5D3IB 5ELBA 3TZDA 8ICBA 7ICVA 5IWAQ 3FKIG 3K7AB 1ILPA 3JAMi 1X3QA 1J2NA 2OTJA 2JP1A 3IRUA 5AI4A 1VQLA 2C28A 2JYOA 9ICTA 3A8IE 4NMZA 2KSOA 4DNRB 3PIO3 4U6PA 2K4IA 4PZ8A 1ECWA 1L5UA 3RLFA 4LF4L 5DKWA 1KLNA 2NZHA 1PZNA 2JA6G 5L37A 4QWDA 1MHWC 1U4LA 5J1ZA 5BOMA 1N32Q 1LTGD 2Q2HA 9ICMA 2OXPA 3CRKC 4OIKA 1J6QA 2JZBA 4O3MA 2JA5H 1B43A 4GFJA 2BE5C 1NMFA 1S10A 5IGEA 1A6SA 1S4ZA 4DSLA 5KRUA 4DUYL 4K8JA 2RCFA 5KYIA 5M9OA 3Q8KA 3IKJA 4C8MA 1HFGA 1JWSD 2WB1G 2YYZA 5J2EA 1SR3A 1N33Q 2FPMA 1TWFB 1FEZA 1EY6A 4N9TA 2X69A 4XQQA 2K8CB 8ICUA 4NLZA 3RH4A 2AUJD 4AYBF 1F2ZA 2G08A 2K4HA 3S1MB 4QMGA 4KY5A 1IBKQ 2HVIA 4GN5A 5IIKA 5EE9A 2W7OA 2W9CA 2XRSD 4CKEA 2XI9A 3QOLA 4DR6L 4A3CG 4OO1I 1SYEA 5AM4A 4A3IB 4JI7Q 2JA7G 1CKNA 1XSPA 8ICHA 9ICXA 7ICRA 1WD0A 2Z4IA 2BZFA 1D8LA 3OSNA 1BCPC 1K0SA 3FM9A 3MR3A 1OTCA 5A35A 1FR3A 2ZJRA 2BA1A 2A69D 5D46A 4YWMA 3L2PA 2XGTA 5KNCA 1ED1A 1A62A 4JWMA 2WAQF 1AZPA 4LF7Q 4DA2A 2WHEA 3AFPA 4ME5A 2MUTB 3OMGA 4IN3A 5IODA 4L5RC 2XTIA 5AHXA 2B2VC 4DAVA 2RDJA 3ZDAA 4I2FA 8ICVA 5HGTA 3HOYG 1SKSA 3CYMA 1NR2A 5FLMG 4DV1Q 3AMZA 4TQSA 3O13A 4BY1H 4IS7A 4ECVA 3PSPA 3MR5A 2AMCB 1WTXA 2ALYB 3PIPA 2EAOA 4OCZA 4UAYA 2LY7A 1BCPF 2ZM6Q 4DUZL 5AM1A 1EIGA 5M5XB 3PO3G 4LJZC 2R8KA 3GIKA 3SZ2A 1GUTA 3Q24A 3E0FA 2P6RA 2NTTA 2HDLA 4TURA 3QUCA 5C5JA 4C8OA 1SWWA 1EWIA 2AQ2B 4HEDA 2KSOB 4LUOA 2A74C 5ALJA 1X9WA 1D9DA 4A3BB 2ZXHA 4DNTB 4QZ8A 3CQZB 1YJWA 4C1NI 2BDPA 1NK5A 3M4PA 5EE3A 2K5HA 4O5KA 2UVWA 2EYHA 2E2HB 3RD4A 2QILA 4JI2L 2IOFK 2K60A 2E75C 3MVVA 4S3SA 3N6RA 5KFMA 2KFZA 2IW3A 3RRHA 4JBJA 2MGSA 4IFDG 4BJQA 1SYCA 5DG9A 2JH7A 1Z9FA 1EY7A 3KF6A 3TP5A 1Y1WB 5CA7A 1Y8NB 2XVSA 2JV3A 4B9XA 4I7ZC 1PVPA 2Y9UA 5E4WC 4K4GA 3FDTA 5JRTA 5T1GA 4K5VA 5C0XG 5J2KA 2ZJAA 2F03A 1T3NA 1UUPA 2B2YC 4G9BA 4B9UA 1K3BC 8ICMA 1HTLD 1PFSA 1YNJC 2JA8H 2LYAA 3NUCA 2ZTDA 8ICZA 5KFHA 2F8LA 2K7VA 2BPFA 1IIPA 3CHBD 2WTFA 2IHEA 3BJUA 2Z0SA 1RQLA 4PGQA 2MNAA 3ZD8A 8ICKA 3K6OA 1U9LA 1XSLA 1S76D 2AKWB 5D3DA 3S6JA 3RJKA 3KLSX 1NKEA 3DUZA 3NK9A 4FO6A 4M04A 1ZYRC 2MPMA 3Q8LA 1L0WA 2RF4A 4FO2A 2A6HC 1TK0A 1U4MA 4C56C 2KEEA 3LWUA 4KN4C 4LK1C 2K14A 5F2DA 3THVA 3PVXA 4KTQA 4DNIA 1KD1C 4QWCA 3SEIA 4CJ0B 2SNSA 3KJPA 1NY4A 4ICAA 1LTTD 3AU7A 2DNEA 4DF7A 5CGKA 4C4TA 3PX4A 2NN6G 5DQGA 5GROA 1NMGA 1PTOH 4NLNA 5LMNW 5J0UA 3QU7A 5G5HA 5EOZA 3A7LA 4O5EA 4ZH4A 5JAVA 1QZGA 4KTAA 2E2JB 5J2HA 2AU0A 2JA9A 2VS1A 3SVMA 3CC4A 4U68A 4OL7A 4LF9Q 5IIJA 2HHWA 1EY4A 2K5NA 2OCEA 5DDYA 3H0GG 3SENA 4K8IA 4I27A 1Y1VB 3ETLA 1X42A 1SKWA 3PO2G 5KFIA 2MHVA 7ICUA 4KKTA 4FXDA 4UAZA 2G5DA 1B9MA 1LV5A 3GP7A 4AYBE 4UB1A 3K81C 2A69C 4IPCA 5A0LA 1B4OA 4KD4A 3QO2A 1I6VC 1XO1A 1SZPA 3QXGA 3E0JA 3CP0A 5AK4A 3NTKA 4EX5A 5CV6A 4KLMA 3VR6A 1SEBD 2EE1A 3NENA 1VQNA 1K1QA 4UPAA 1FGUA 2DPJA 1K1SA 1O78A 3MR2A 4DLEA 2KKVA 5DGBA 3NBHA 2QB1A 3CCUA 2E2HH 5DB7A 3NVWA 3WKEA 3HG9A 1SL0A 1TWGB 3SEBA 3LVVA 2Q2UA 1VQJA 5HMMA 1IXRA 4KHPQ 4J9LA 2R7DA 4OX9L 1K73C 4WJ4A 2LYHA 1H38A 1NTGA 4YD2A 1B53A 3RJIA 1C8CA 1YJNA 3V7KA 2A73B 3DHQA 1KABA 5M3FB 4A3JB 3H94A 3PO2H 2DJFC 5DQIA 2E8MA 4US9A 3H0LB 4C8LA 5ALYA 4A3MH 4RAUC 2KHVA 1KLUD 2PO4A 4KHZA 1QJOA 1HNXL 3S17B 3KF8B 1ONLA 1XNQL 5JJLA 4CGYB 2Q0ZX 4GXJA 1SNOA 3A8JE 4EELA
chains in the Genus database with same CATH topology
4HJAA 1N34L 1OXTA 4JI3L 5K36G 2IY5B 2K50A 2N3SA 1H95A 4JYAQ 2WP8J 4DAYB 4POFA 1ASZA 4LF6Q 3F2BA 2BH2A 4JI0L 3CCSA 2JA6H 4LF6L 4A3KH 3S1QH 4GS3A 3S24A 1VQ5A 3SGIA 1XNRQ 2PNHA 3J7A5 1A0IA 4LFBQ 3CC7A 1PH2A 1N33L 4DR7Q 3D0FA 4LFAQ 2ASBA 1QZHA 2R93H 2JJQA 4DV4Q 1V43A 2BA0A 3CW2C 4L5QA 4R4TA 4DR2Q 4ALPA 4JI6Q 1I6HH 1X65A 1LM0A 4OX9Q 2JK8A 1TXYA 5IE8A 3DLLA 3S15H 1CKOA 1K3RA 2GVAA 3CPFA 4DR3L 4AQYQ 1K8GA 2UXCL 1IBLL 4HIKA 4C3IH 1JJ2A 2Z6KC 4HJ9A 4OXPA 4DV6Q 4PZ6A 2MFIA 4JBWA 4JI0Q 3MEFA 1S72A 3STBD 1DGSA 1SE8A 1JMCA 2E5LQ 3I7FA 4QQBX 4JI5Q 3G48A 1QVGA 4DR7L 5IP7G 1WCMG 1VQIA 3GO5A 1B70B 1TWFH 1Y1VG 2LXJA 2NVYH 3BZCA 2WAQE 1XNQQ 3M85A 5M5WH 2QEXA 4JV5L 4PMWA 2E2JH 2KCMA 1VQGA 1EQQA 2UUAL 4GN4B 4JYAL 4GKJL 2I5HA 1QVCA 4DV3L 2A19A 1O7IA 4JI1L 2I0QA 3M9BA 1T9HA 2VUMG 5C3EG 4TQUS 5EAYA 2UUCQ 2JEAI 4DV1L 2VL6A 1GVPA 1TWCH 3HOWH 4JOIA 2ZM6L 1Z47A 1HNZQ 4LF9L 4BBSG 3UDXA 4DV5Q 5C44G 3HOZG 3I4MG 1VQPA 2Q2IA 1L2FA 1E3PA 3GTOH 5JJIA 3CCJA 1U5KA 1FVIA 2QA4A 1X56A 1PV4A 3KDFB 3CQZH 4A3DH 2E8GA 4B3TL 1GKHA 4P72A 1MKHA 2CWAA 4R4IA 2K4KA 2HQLA 1KRTA 3F1ZA 2D0PA 4WJ4A 4Y52H 1TWHH 1CKMA 4DUZQ 3GDEA 5M3FG 1KXLA 4DV7L 3ICEA 4DR6Q 1IBKL 3W5OA 2MO0A 2AHOB 3PCOB 5IYDG 1HNZL 1XPUA 4X65L 3EIVA 1VQ7A 3PUWA 3T1YQ 4DPGA 4X64Q 3H3VI 3KLWA 1SFOH 2UUAQ 3GTGH 1HNWL 2Q2TA 4GOPB 1SRUA 3AQQA 4DKAC 1VQCA 3S14H 1QUQA 4A3FH 1WJJA 3I2ZA 1IBMQ 3K7UC 4DV3Q 1FJGL 4XTCS 1YZ6A 3CCVA 2B63G 2HHHQ 4BY1G 3Q8DA 5ELNA 1K8AC 2B63H 1WOCA 2F52A 3WWVA 2HIVA 5FLMH 1YHBA 1ASYA 4POGA 3HOYH 3TRZA 4YCWA 4C2MH 4JBMA 4R1JA 2I5MX 4O0AA 2RCNA 2MQHA 3I4OA 1M1KC 4A3DG 3AYHB 3BU2A 3UE0A 1G51A 1TWGH 4UP8A 4Y7NH 3HOXG 4FDBA 2VQEQ 3M3YH 2EQSA 1YHQA 2UUBL 2I5LX 1PH4A 4NXNQ 4IOAA 4NB3A 4L5SA 2JA8G 1CKNB 2GN5A 3HOVG 4A3LH 4GLAC 1VQFA 3HFZB 3A0JA 3CMEA 2UXBL 4JI1Q 1GD7A 2IHFA 1HR0W 5AJ3L 2R6GA 1HZCA 3ZJYC 3OTOL 1N8RC 1PH1A 1HNXQ 2VUMH 1JT8A 2ID0A 1HJPA 3HKSA 1N34Q 3KOJA 2B29A 1Q8KA 4DR5L 4UY8C 4B3SL 4PG3A 3L0OA 3PIOA 1C0AA 4JCVE 3MXNB 5H1SE 2L15A 2FXQA 1OXSC 1YEZA 3S2DH 4KI0A 4DR1Q 1PH6A 2EDUA 1IBLQ 2Y0SE 2CKZB 5GAHC 4TVAB 3M4OH 2CQOA 4BY7G 1E22A 2EXDA 3S1NH 1YJ9A 2ZTEA 3UE1A 1MIUA 1SN8A 2B3GA 4AH6A 1VQ8A 1SMXA 2DGYA 1XMQQ 1OXXK 4L5TA 2OTLA 1E1OA 1KHIA 3BZKA 4JC0A 4H02A 5IP9G 4BA1I 3T1HQ 3M4QA 4NXNL 5JEAJ 1XJVA 4A3GH 4KHPL 4A3IG 5C4XH 2UU9L 2UUBQ 3DM3A 3CD6A 1HZBA 1VQBA 2ES2A 2BH8A 4UP7A 3STBC 3HKZE 4YWKA 1EUJA 1P8LA 4APVA 3KYHC 5BR8Q 3K7AH 1AE3A 2K52A 2R93G 4GLVB 4MZ9A 4YCUA 2NVTH 1S40A 3RZDH 4JI4L 3HOWG 1PH5A 2YTYA 4LFCQ 4JOIC 1VQ6A 1MJCA 3FKIH 5JEAG 1N36L 1J5EQ 1QVFA 2PI2E 4GKKQ 4DV2L 4GNXB 4B3RQ 1N36Q 1L1OC 2WB1E 2N78A 4P74A 5LMUL 4WJ3M 5JJKA 2CFMA 5LMUQ 2IX0A 2VZAA 5GADC 4MTNA 4PZ7A 2PI2A 3EBEA 4R4OA 2OWOA 2KBNA 1PA6A 2UUCL 1BBUA 1PYBA 1M90C 3J81i 1VQEA 4NPSA 1MJEA 3NEMA 3PF4A 4DV5L 4X66Q 2UXDL 1C7YA 4X66L 2PQAA 1W2BA 4K0KQ 1E7ZA 4IJLA 3A74A 4DV7Q 3UDFA 4HJ5A 3PGZA 4R4CA 3G6EA 3PV0A 4DV2Q 1XPOA 4J15A 4GOPC 4X6AH 3GD7A 4DR3Q 3W1GA 3RN2A 3GTPH 2JQOA 3S16H 2YV5A 4JV5Q 2HIXA 4JBKA 3FP9A 4IOCA 2VNUD 4GLXA 1V1QA 3KDFA 5C44H 1LTLA 5LMNQ 1TWAH 1YNXA 3J81c 4DV0Q 1UE5A 1HH2P 1I94L 4O2DA 3E0EA 1UE6A 4LFCL 4A3JH 3GTKH 3HOXH 2VQFL 5M3MG 1Y14B 4BXXH 2ZTCA 4DK6C 2IT1A 3UDGA 1U0LA 2E5LL 2R7ZG 2ATWA 3HOUG 4BY7H 1AH9A 2KENA 4DUYQ 4HJ8A 5M5XH 1V9PA 1X3EA 3I56A 2JE6I 1VQ9A 1Y1VH 4IPGA 4JI3Q 3HOVH 2QGQA 5IYDH 2VY3A 1XNRL 5C0XI 1KIXA 3L7ZC 1Q1BA 3CMAA 3RZOH 4QY7A 1FL0A 2YU9H 4LF8L 3PF5A 4JG2A 1P16A 4A76A 3PUYA 1EOVA 2F3IA 4GN3B 4GNXC 3CAMA 3CCRA 1X3FA 1Q46A 3E9HA 3KF6B 4OO1G 5E7NA 3GTJH 1S3OA 4KLKA 3I4NH 3CF5A 3J7ZC 4JI8L 5IWAQ 3NELA 1VCIA 3FKIG 4HIDA 4DR5Q 3TEHB 3JAMi 3CPWA 1IL2A 3ULPA 2OTJA 1SLJA 1E1TA 5GQOA 1VQHA 1VQLA 1PYSB 1JJCB 5IYCG 2C35B 4X62L 1WCMH 1XTDA 4PZ8A 5AJ3Q 3RN5A 2VQFQ 4LF4L 3RLNA 3RLFA 2NZHA 2KHJA 3OTOQ 4YWLA 4JI2Q 4A3IH 1PH9A 2JA6G 2JA7H 1N32Q 1GM5A 2CCZA 3F2DA 2Q2HA 3G71A 2JEBI 1J6QA 4OWTB 3GTQH 1B7YB 2JA5H 2EIFA 4DUYL 1I5FA 1NMFA 2Q2UA 2PMZE 2NN6I 1Q1EA 5FLXc 5C0XJ 4A3FG 1PH3A 1EIFA 1KL9A 4HIOA 1R9TH 4AYBG 1WFQA 2WB1G 2YYZA 3S1RH 1JE5A 1SR3A 4B3TQ 1N33Q 1VQMA 4BBSH 3EN2A 1I3QH 4LFBL 1GO3E 3CCMA 3H3VH 5LMNL 4EQ5A 4C3HH 4IFDJ 3I4MH 2K5VA 3HOZH 3I4NG 3D31A 1E24A 1CSPA 1IBKQ 2Z6KA 1UE1A 4GN5A 4A3EH 5M3MH 4A3CG 1VQAA 1VQDA 3LGJA 3GTMH 4DR6L 3TQYA 3T1YL 2NZOA 4OO1I 4QL5A 2R92G 5IYCH 4JI7Q 2JA7G 1CKNA 5FJ8H 4B3MQ 4DR4Q 1W3SA 3S17H 3J80i 1D8LA 2RHSB 3CXCA 4A3GG 1UWVA 2N8NA 1OXVA 4A75A 1OTCA 3RR5A 5IP9H 4BBRG 2YTXA 2CWPA 5IT9c 2BA1A 3NBHB 2ZJRA 5C4XG 4YWMA 3L2PA 2XGTA 4YY3Q 2Y0SG 4LF7L 4K0KL 1A62A 1YVCA 3JC66 5IY0A 1Y1WG 4LF7Q 5IYBG 3AFPA 4L5RC 1N9WA 1RIPA 2XTIA 2YTVA 3OYYA 4LF5L 1BKBA 2LSSA 4NXMQ 3TREA 1HNWQ 1X6OA 3HOYG 1Q86C 1QUQB 1VQOA 5FLMG 3ERSX 4DV1Q 4BY1H 3PSIA 5HGQA 5ELOA 4JI7L 1L1OA 1A63A 2UXDQ 2AMCB 4LW1A 4DR1L 4YCVA 2ALYB 3PIPA 4A93G 3IRBA 2OQKA 1VQ4A 1XMQL 4X62Q 2ZM6Q 4DUZL 2K75A 4DV6L 3ER0A 3PO3G 4A3BH 1KC8C 2R7ZH 3RLOA 3AEVA 2GVBA 4P71A 3UDIA 4A3KG 4JI5L 1EWIA 4LUOA 4YHHL 2RHQB 2HT1A 1PHJA 5BR8L 2LXKA 2R7FA 3E9IA 4C3JH 1EQRA 1X55A 3K8AA 2UXCQ 1JJGA 2KHIA 4BBRH 1RL2A 4BA2I 1YJWA 5DLQE 4IPHA 2UXBQ 3M4PA 2ZJPA 2DUDA 2K5HA 4LF4Q 2A8VA 1HZAA 4JI2L 2F4VQ 3VDYA 1VQKA 3U50C 3AFQA 4LWCA 4DV4L 2H5XA 4JBJA 4IFDG 1WI5A 1KQSA 1Z9FA 1BVSA 1XMOQ 2IX1A 4IFDI 3I55A 3KF6A 3TS2A 4QGUA 3H15A 3OW2A 1I50H 3RNUA 1X54A 4DR2L 4JI6L 3PO3H 3HKZG 4YHHQ 3S1MH 4A3JG 5C0XG 4A3EG 1SROA 3CCLA 1EIYB 2D0OA 4AQYL 4IPDA 1PFSA 2JA8H 1VS0A 2OQ0A 4UP9A 1I94Q 4LFAL 2ZTDA 4LUZA 1Q82C 1IZ6A 1G291 1YBYA 1AE2A 4A4IA 4X65Q 2IHEA 1NJIC 2JA5G 1X9NA 3BJUA 4AIMA 2Z0SA 1KAWA 1PH8A 1NE3A 2MNAA 4IO9A 4GNXA 2A1AA 2V1CC 4P73A 2AKWB 1L0WA 5IYBH 3U58A 1CUKA 3M7NA 3KJOA 2RF4A 2HHHL 1NBWA 1YHAA 2F4VL 1G6PA 1FJGQ 1PH7A 3S2HH 1UEBA 2K14A 4LF8Q 4QJFA 1PVOA 1X3GA 2VQEL 4DNIA 5GAEC 1KD1C 2R92H 1D7QA 1YIJA 4LF5Q 4NXML 1C9OA 3PUXA 3KJPA 4A3CH 3GTLH 4P75A 5FJ8G 1NY4A 1K0RA 1KRSA 4DK3C 3J81j 1XMOL 2NN6G 5GROA 3G4SA 1NMGA 2WAQG 5LMNW 1EFWA 4LUVA 4R4QA 3FHWA 3W1BA 4A3LG 2VW9A 1A8VA 1QZGA 1EYGA 1WYDA 2JA9A 2VS1A 5J3BA 3U4ZA 3CC4A 4JI4Q 1HR0L 1BBWA 4LF9Q 2AWNA 3H0GH 2K5NA 1Q12A 3J80c 2OCEA 3H0GG 3PUVA 4OWWB 2KCTA 2WFWA 4ME3A 2ZJQA 3PO2G 2MO1A 4X64L 1Q7YC 4AYBE 4DAMA 3K81C 1YI2A 1B8AA 4IPCA 3U4VA 3F2CA 3TS0A 4QIWE 5GAGC