2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1531
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
2OWOA 4OO1I 4LWCA 3D0FA 4LFAL 4BY7G 4LFAQ 3STBD 1MKHA 4A3JG 1PA6A 2JA5H 1Q46A 1Z47A 3KJOA 3UDFA 3EIVA 2UXCL 4PZ8A 1KQSA 4HJ5A 4DR7Q 1E24A 2R7FA 2MO0A 2RCNA 3A5ZB 2KHJA 4KHZA 4R4IA 1XMQL 4B3SL 3TRZA 4JI2Q 2HQLA 2CFMA 4A3LH 3L2PA 3PV0A 3DLLA 4HIDA 5AJ3Q 1BVSA 4A3BH 1GM5A 3S2DH 1SRUA 3PUYA 5M5WH 1D8LA 5C4JH 3UDXA 2ZM6Q 1K8GA 4B3TQ 3MXNB 3RLNA 1WYDA 4DR5L 4L5RC 2VUMH 4A3DH 1XPUA 2AKWB 1U5KA 2DGYA 5FLMG 4PG3A 4JBWA 4JI3L 2NN6I 1YHBA 3HKSA 4JV5L 3GTKH 1QVFA 1PH6A 1HNXL 3PUVA 1V1QA 1IBLL 3I7FA 3UDIA 4DR2Q 2E2IH 4LFCQ 2I5LX 5AJ3L 4LNQA 2A8VA 1K0RA 4DV0Q 3E9HA 3ZJYC 3GTJH 4DV1L 1DGSA 3W5OA 1VQNA 1JT8A 1QVGA 3AQQA 1SR3A 1YJNA 3J81c 5ELOA 3HOUG 3D31A 5IY0A 4A76A 2XGTA 3G48A 4MZ9A 5C44H 3BZKA 1Y1VG 2IY5B 2JJQA 1PH5A 3TREA 2PNHA 4H02A 1J5EL 3F2BA 2E5LL 4A3JH 1NE3A 1IBKL 4IJLA 2Y0SG 3KJPA 2Q2TA 1VQ8A 3HKZG 4DV2Q 1Y14B 1PH2A 4R4TA 4YY3Q 4LFBQ 4LFBL 1KD1C 1Q1BA 5IT9c 4QJFA 3K8AA 3RNUA 1KXLA 3ICEA 2E5LQ 1Q82C 4WJ4A 3EN2A 4LF7Q 1Z9FA 1N33Q 1X56A 2K5VA 5M3MG 2EQSA 4LUVA 4NB3A 1RL2A 3KDFB 4DK6C 2UXDQ 1KL9A 4O2DA 2VW9A 4DR3L 2I5MX 1WCMG 1YEZA 2JK8A 2ASBA 3I4MH 1VQFA 1QZGA 1PV4A 3CC4A 4LF5L 1AE3A 4A3EH 4JI8Q 4LF4Q 2PMZE 3FKIG 3PUWA 1HNXQ 4NPSA 4A3KH 1CSQA 1GVPA 4DV3L 1L0WA 4AQYQ 4NXMQ 1PH9A 2YU9H 2CCZA 2IHFA 4DV0L 3JAMc 2RHQB 2Q2UA 3GTMH 3HOUH 3KOJA 3PF4A 2JA5G 4JYAQ 1MJEA 4HJAA 3OW2A 4B3RL 1Q7YC 1TWAH 3CAMA 2CWPA 2QEXA 4DR1L 3GO5A 4C3IH 3S1MH 3DM3A 2C35B 2UUCQ 4GNXC 4JI4L 5JJIA 1Y1WG 5JJLA 3WWVA 4A3MH 3JC66 2ZM6L 2UUAQ 3OTOL 2MO1A 3J80i 3GTOH 1I50H 1C9OA 1YZ6A 3NELA 4A93H 5M5XH 1NJIC 2ATWA 2K50A 2UXDL 4GS3A 3M85A 1I5FA 3CC2A 3HOVH 3HOWH 1YHAA 2WAQE 2VUMG 4BBSH 1H95A 2WB1G 3AFPA 4B3ML 4A3CG 4B3MQ 1KIXA 1TWHH 1HR0W 1FJGL 1SFOH 4P75A 1XNQL 1WOCA 2ES2A 1Q81C 5C4XG 1VQ6A 2Q2IA 4B3RQ 4JBKA 4IPDA 1VQ4A 4GLXA 1L2FA 3TS0A 3HOXH 5LMNL 1HZ9A 2ZJRA 4A93G 1EUJA 1VQIA 4A75A 4X66Q 2LXJA 4GLAC 4X62L 1IBML 1ASYA 2F4VQ 3HOVG 4JBMA 2BH2A 4DR6Q 1FVIA 1TXYA 1SE8A 2AHOB 1Y1VH 2UUBL 3S1QH 2N3SA 2EXDA 1XMQQ 5IE8A 4PZ6A 2ZTCA 3ERSX 1QZHA 1Q12A 1UWVA 2Z0SA 3K7UC 4DR3Q 2I0QA 2K4KA 2F3IA 3HOXG 4OWWB 1V9PA 3KF8B 5HGQA 4HJ9A 2KENA 2YTXA 3W1GA 1LTLA 1XNRQ 4HIOA 2AMCB 3M4PA 2QA4A 4JOIC 5JEAJ 3MEFA 3J7ZC 1X6OA 2CWAA 5IWAL 2MNAA 4LF6Q 5M3FG 1PYBA 1GD7A 4RMFA 2D0OA 4AYBG 5GAGC 2AWOA 4P74A 3BU2A 4DNIA 1NTGA 2GVAA 4DR4L 1HR0Q 4A3CH 2ALYB 2JA6G 4GN4B 4DR5Q 5LMUQ 2OQ0A 1I6HH 5LMUL 4LW1A 3CF5A 3S2HH 1VQJA 1CKNB 4P71A 4DAMA 1UE5A 5C3EG 4BY7H 1D7QA 1VQHA 2JEAI 4X6AH 1I3QH 1C7YA 2K14A 4A3IG 4YWKA 1YVCA 2OCEA 4AYBE 2VQFL 1EOVA 1O7IA 3B6YA 1G51A 3FKIH 3J81i 1LYLA 4PMWA 1P8LA 3U4VA 1YHQA 4DV6Q 1YI2A 1M90C 2BA0A 3NENA 2JEBI 2JA7G 1FL0A 1VQOA 3KF6B 5ELNA 3S14H 5IP9G 3NEMA 2GN5A 1VQCA 1KAWA 3GTLH 1IBLQ 4IOAA 1CUKA 1Q8KA 2NVYH 4GNXA 1KC8C 3J81j 4GOPB 3M4OH 1TWGH 3U58A 1VQGA 4DV1Q 1HNZL 2JQOA 5C3EH 3T1YQ 1RIPA 3NBHB 3J80c 2YTVA 3I4MG 2N8NA 3TEHB 1EIYB 4HJ7A 2JA7H 1YNXA 1ASZA 1SROA 4JI0Q 4BY1G 2UU9Q 2I5HA 4R4OA 2Z6KA 3ER0A 4LF9Q 2PI2A 3S1NH 4JYAL 4XIGS 2QGQA 5IP9H 4DV7L 4HJ8A 3CCEA 1YIJA 1X3FA 1XMOL 1PH4A 1N9WA 4R1JA 4JI6Q 4GOPC 2IX0A 3T1YL 3S15H 4X64Q 3FP9A 3K0XA 2B3GA 2JE6I 2VY3A 1EQRA 1UE1A 2VL6A 4DV3Q 4JBJA 4YHHL 1UE7A 4AQYL 4A3FH 4MNOA 4OWTB 3CCMA 2N49A 4A3LG 4K0KQ 4IPHA 3KDFA 4K0KL 4APVA 2R92H 3ULLA 4DUYL 2WB1E 1WJJA 2WP8J 2JA8G 2GVBA 1NY4A 3CPFA 3E0EA 4QIWE 4R4CA 4NXNQ 3CD6A 4A3GG 5IYBH 4LF7L 2UUCL 3RLFA 3HKZE 4LF9L 1JJGA 2UU9L 4Y52H 1IXRA 3RR5A 1EIFA 3TQYA 2E2JH 2UXBQ 1NMGA 3KYHC 4YWLA 4C2MH 2NVQH 1WI5A 4DPGA 1A8VA 1VCIA 2RF4A 3F1ZA 5M5YH 1CKNA 2IHEA 2R92G 4NXML 2K5NA 1PH7A 1EFWA 1UEBA 5C44G 1NMFA 3F8TA 1KHIA 3CCSA 1YBYA 1HH2P 4GKJQ 3M4QA 3AYHB 2A19A 3F2DA 1TWCH 1J6QA 2MQHA 1SLJA 4P73A 1VQDA 4IFDG 5HY6A 2VNUD 4X65L 4DUZQ 4LF8Q 4Y7NH 3S24A 1N33L 4HIMA 1X3EA 4X62Q 2WFWA 2PQAB 2VQFQ 2ZJPA 3CCJA 1N32Q 1G6PA 4LUZA 1OXTA 1VQKA 2E8GA 1X54A 5C0XG 1EWIA 1VQLA 3CC7A 4JCVE 1JJCB 4NXNL 1M1KC 3I4OA 1PFSA 2HIXA 2Y0SE 3G71A 2CQOA 3PUZA 4IPGA 1XJVA 2R7ZG 1IBKQ 1JE5A 3UE1A 5FLXc 5M3FH 4BBSG 1XNQQ 4QQBX 4OO1G 1X55A 2H5XA 3TS2A 1NBWA 3H0GH 5GAEC 1W3SA 3A74A 4DV5Q 1WCMH 3F2CA 1U0LA 3I4NH 1JJ2A 4QL5A 1S3OA 1KRTA 1X3GA 1HZCA 3I2ZA 5C4XH 3I55A 2HHHQ 2ID0A 3PUXA 4A3GH 1FJGQ 2Q2HA 2VS1A 4IFDJ 4MTNA 5H1SE 5IP7G 5BR8L 1UE6A 1N34Q 3GTQH 4YCVA 2MFIA 5LMNW 1E1OA 4YCWA 2R6GA 4X64L 3PIOA 3UDGA 1PH1A 2HHHL 1L1OB 2RHSB 1EYGA 4UY8C 3H3VH 1VQ5A 4IO9A 3T1HQ 2ZTEA 1G291 1IL2A 4BXXH 2R93G 3AEVA 2R7DA 3G6EA 4JG2A 4ME3A 3CCVA 3RZDH 4JI4Q 4X66L 4DV7Q 4GKKL 2A1AA 1HR0L 2EDUA 2JA9A 2OTJA 4A3FG 4AIMA 5GROA 3G4SA 1XPRA 1PH3A 2F52A 2VQEL 4POFA 2OTLA 1OXVA 4GN3B 4LUOA 1GO3E 5JEAG 4UP9A 4DK3C 3GTPH 2V1CC 4QGUA 3A5UA 2CKZB 5IP7H 2KBNA 1VS0A 2NZOA 3UE0A 3J7A5 4A3KG 1V43A 4A4IA 3PF5A 4DV4Q 2KHIA 3L0OA 4JI2L 4BY1H 1SMXA 1N32L 5IYBG 3RN5A 3KF6A 3L7ZC 2VZAA 4GKJL 4JI1L 2BH8A 1W2BA 4JI1Q 3CCLA 1Q86C 1I94Q 1HJPA 4BA1I 4DUZL 3IRBA 4DKAC 1X9NA 4LF8L 4TVAB 4GNXB 3S1RH 1Y1WH 2NZHA 5M3MH 3CMEA 4YY3L 3I4NG 1K8AC 3CCQA 2PQAA 1QUQB 4JI7L 4IJHA 4JI5Q 1HNWQ 2EIFA 1S40A 1A63A 1HZAA 5FJ8H 3S17H 4UP7A 1OXUA 5GQOA 1EQQA 3HOYG 3H3VI 4KHPQ 5K36G 3EBEA 3ULJA 5C0XJ 2KCTA 1N36Q 1TWFH 2K52A 3CCUA 1XPOA 3W1BA 3PO3H 4JV5Q 1JMCA 4DUYQ 3VDYA 1OTCA 1HNWL 3HFZB 4BBRH 2B63G 2PI2E 1FGUA 3K81C 4LF5Q 1XNRL 3GTGH 3PO2H 3BJUA 1WFQA 4BA2I 1OXSC 1XTDA 2XTIA 1E22A 3SGIA 2WAQG 3M7NA 2R7ZH 4C3JH 3RN2A 1B70B 3FHWA 4DAYB 4GLVB 3RLOA 4OXPA 1SN8A 4JC0A 4EX5A 2NVTH 4A3DG 2JA6H 5IYCG 4IPCA 1X65A 2K5HA 3S16H 3PSIA 3PGZA 1PHJA 4DR1Q 2DUDA 2UUBQ 3HOZG 1GKHA 3K7AH 1L1OA 3CP0A 2ZJQA 4J15A 3Q8DA 4DR2L 4OX9L 3CXCA 2NVXH 1AE2A 2UXBL 3PIPA 2VQEQ 1K3RA 1VQAA 3PCOB 1S72A 1YJ9A 1BBWA 3I56A 2YTYA 3GD7A 1E7ZA 1HZBA 4B3SQ 1Q1EA 2IT1A 3CW2C 4L5TA 5IYDH 4A3BG 4OX9Q 1CSPA 1PVOA 1KRSA 3E9IA 3KFUA 2NN6G 3CMAA 5GAHC 1HNZQ 3CQZH 4QY7A 3U4ZA 3H15A 1VQ7A 2JA8H 3HOYH 4BXXG 5BR8Q 3HOZH 4DV5L 4DV6L 1OXXK 1CKMA 2UXCQ 3H0GG 2AWNA 5FLMH 3KLWA 4UPAA 4L5SA 5C0XI 4C3HH 2LXKA 4HIKA 4A3IH 2BA1A 3BZCA 3CPWA 2KCMA 3RZOH 2IX1A 2D62A 3K80C 3LGJA 3M3YH 2B29A 4LFCL 1K83H 4R4QA 3GDEA 2Z6KC 3OTOQ 1VQMA 2UUAL 4KLKA 2D0PA 2FXQA 3HOWG 4JI6L 3PO2G 5JJKA 1JB7A 1XMOQ 2LSSA 1A62A 3AFQA 1IYJB 4GOPA 1YITA 4IOCA 1QUQA 4FDBA 5EAYA 4JI3Q 4YCUA 3JAMi 2YV5A 4IFDI 4JOIA 1PH8A 1R9TH 4YWMA 4KHPL 1YJWA 1BKBA 2R93H 3CCRA 4EQ5A 1B8AA 1E3PA 1N8RC 2HT1A 4WJ3M 2L15A 1VQEA 4DR4Q 1A0IA 2K75A 5DLQE 1I94L 4JI7Q 2ZTDA 5FJ8G 1VQ9A 4JI8L 4LF4L 4RG1A 1B7YB 1VQPA 1BBUA 4L5QA 4YHHQ 4X65Q 5E7NA 4DV4L 1N36L 1MIUA 1CKOA 4XTCS 4GN5A 1P16A 2N78A 5IYDG 4OWXB 4UP8A 1K73C 4POGA 4DR6L 4ALPA 3STBC 1IZ6A 1LUZA 2HIVA 4BBRG 2F4VL 4O0AA 4TQUS 3U50C 3PO3G 1MJCA 4PZ7A 1K9MC 2B63H 4KI0A 4JI0L 1J5EQ 3M9BA 5LMNQ 4AH6A 4GKKQ 4A3MG 2E2HH 4B3TL 1IBMQ 4DV2L 2YYZA 1PYSB 1N34L 1AH9A 4A3EG 3ULPA 1VQBA 4OONA 3OYYA 1T9HA 5IYCH 1QVCA 4JI5L 1E1TA 5GADC 5IWAQ 4LF6L 2OQKA 3A0JA 4DR7L 1L1OC 5J3BA 1C0AA 3T1HL 4P72A 1LM0A
chains in the Genus database with same CATH superfamily
3MGVA 3I72A 3D2SA 3J80L 2B21A 2TSSA 4LFAL 3QO2A 2KQ3A 1CK1A 1MKHA 3AMZA 4KY5A 5EE9A 1PDQA 2UVWA 1Q46A 3H0GB 3KJOA 1PA6A 1LTRD 2MRLA 3KD3A 4OHJA 1G8ZD 1KQSA 2SEBD 2R7FA 2FLNA 3A5ZB 2AUJD 4R4IA 1GUWA 1WUDA 4UB4A 3V6JA 2ASLA 4JI2Q 2P5ZX 1PFMA 2V4QA 4X5VA 4DQIA 3DLLA 5AJ3Q 3GTMB 1NNXA 4JYAL 3NVVA 1K8GA 5M5XB 4B3TQ 1G6PA 1IKMA 2YMQA 5DQGA 1CRXA 1ET9A 1WCMB 4A3DH 5KFQA 4KLSA 4IUUA 4YIJA 2DNEA 5FLMG 1XPUA 2QB0A 2NN6I 3H8MA 4TUSA 3F53A 1RG6A 1QVFA 4RQMA 3FAHA 3UDIA 5HURA 2NZ1D 3Q8QB 5L1MA 1CFMA 3L9AX 4KJOA 1K0RA 1TVAA 5M5WB 3HRZC 3ZJYC 3GU3A 2JEGA 1ONLA 1R4QB 2XICA 3RB4A 1S8OA 1QVGA 4Y2TA 1BGXT 4C7ZA 1DXMA 1SR3A 1YNND 5FK9C 3CNHA 4CKCA 2KCCA 1ZQYA 2H3VA 4C7YA 4QZHA 2NVYB 2XGTA 2FDRA 2RDJA 3J81E 5C44H 3MR3A 2RQXA 9ICEA 5JPNC 1Y1VG 1ZQRA 1WWVA 2JJQA 1WYGA 2IY5B 3RMHA 1PH5A 2XY6A 2KKVA 2VB2X 4DXGA 4RQ7A 1NK6A 2QARA 3PO2B 1QCBD 3F2BA 3BS1A 8ICPA 3M8SA 1HTPA 5TZVA 1SNCA 4IJLA 1IBKL 4CDEC 4FF1A 1PVRA 3KJPA 3KUPA 3BVGA 1AP0A 4MF8A 2C2DA 1MD2D 4B9WA 4DV2Q 4YXJA 2KOLA 4B9UA 3I3CA 1U9RA 4UB6U 1PUZA 4RGMA 1CT1D 5H2FU 4EYHB 2N1RA 3RAQA 2L12A 2HBJA 2B63B 5A2QL 3QG1A 5AI9A 5M3MG 3RR8A 3SQIA 4KLIA 3GILA 2KZ3A 3WKDA 5KT7A 8ICAA 2OF1A 4DR3L 3FMCA 4DAPA 2O6KA 2KSOB 4JV1A 4CF4A 4ECVA 2KVMA 2I6XA 4FXKC 2VJ5A 2KIVA 1JN3A 1BPZA 4MIUA 1S5ED 3L3FX 1GOZA 1N48A 8ICMA 1L0WA 5I4DA 4AQYQ 3J7AF 3MXGA 2UVVA 2CCZA 4DQSA 2GLEA 1UUPA 2JMGA 1JROA 3GTMH 3FDTA 5DDMA 4UAUA 3QZ7A 4WFN3 2RRDA 4I2AA 2JA5G 1TK0A 4HJAA 4B3RL 4Y2VA 4DU9A 2PW5A 1FD7D 2CWPA 2K89A 3GO5A 3I76A 2M00A 5DQIA 5J0WA 4F5NA 4C3IB 1VDVA 4IS7A 5JJLA 3C2PA 2EZVA 1STGA 1J2NA 3OTOL 3NELA 2VUMB 1EL0A 1I5FA 4C8NA 5J2KA 4KX3A 5G5GA 1MC8A 2HW3A 5EWFA 3T5KA 2ZIWA 4C3HB 2H3FA 2EJGC 4B3MQ 4A3KB 1KIXA 1HR0W 4HAIA 3QU9A 4R8IA 2ZJ5A 1SYCA 4MN3A 1LT6D 3HOUB 2Q2IA 3A56A 4OIJA 2O5IC 1ZQHA 4B3RQ 1KFTA 4ICAA 4BGDA 1ILQA 4CJ1B 3WK5A 1L2FA 2W3SA 5J0RA 3W2DA 2DPJA 3TS0A 2F8LA 4O1NA 4KHPL 4J9MA 3ND9A 1EUJA 2ZIUB 4A75A 3RR7A 4X66Q 2PFNA 2NTTA 3HS0C 4ZKCB 1IBML 2BH2A 4QZBA 3H8WA 3K5LA 3DEOA 2EJMA 3S2HB 1NK0A 1PTOC 2UUBL 4KD4A 2Y9UA 1HA6A 4UAYA 2L4NA 5BN5A 4PZ6A 4O0IA 2ASJA 4YCXA 1NK4A 1QZHA 5KG1A 3GQCA 5CBAE 4RPZA 4F4XA 4X3UA 5J1ZA 3BDOA 3A0HU 4M47A 1SB3C 5ALSA 1N60A 4M9HA 3HOXG 5BOMA 2NBFA 3EJIA 1XNRQ 3S14B 2KMDA 3M4PA 2YB1A 1Y8NB 2A6ED 1L7OA 2CWAA 2QCPX 3J7YW 5M3FG 2GA4B 3JAML 1PYBA 1GD7A 1SJED 4RMFA 4AYBG 4USAA 4DR4L 4DNIA 5KEEA 3IAYA 2AQ2B 1HR0Q 2DFLA 4DF4A 1B1ZA 4A3CH 3JPSA 3D2NA 3HILA 2OQ0A 2Y0SF 3QWNA 3ZDBA 1STBA 3OMCA 4DAMA 2MU2A 5C3EG 4BY7H 4MEXA 1Z1VA 1ZJMA 1C7YA 2HOFA 5KFAA 2K4IA 3PX4A 2K14A 1YVCA 1BNOA 2OCEA 5I9OA 5FO7B 1YHQA 2L5YA 1EY9A 3KOOA 5ELDA 2DJGC 4PMWA 3MFIA 1S77D 4DV6Q 3HOYB 3S2DH 2JEBI 3TSSA 1FL0A 3KF6B 4AYBC 5C0XH 4M8AA 4ED8A 1M8AA 1U49A 5AK4A 7ICOA 3NEMA 1WTQA 2J7ZA 2NRTA 4I2IA 3D4DA 1KAWA 1IBLQ 3AL0B 3M6ZA 2NVYH 2WF6A 4O3OA 2F0GA 5JVH3 1AN8A 1TWGH 2NUCA 1VQGA 4G7OC 1HNZL 2JQOA 4YN4A 4R8UA 3I8ZA 4DFMA 5J2CA 1G91A 1O08A 4Y2JA 2N8NA 3TEHB 1KW4A 2BCRA 2EYFA 1YNXA 1ASZA 1S5LU 3LYSA 4LF9Q 4PMCA 1N34L 2QGQA 4HJ8A 5AKYA 3WKBA 3OSNA 4OO1G 1ILPA 5DB8A 4YD1A 1DXSA 2EVBA 4JB3A 1HUOA 2A73B 1DCZA 8ICZA 1T5XD 3FP9A 4DLEA 4DV3Q 4A3FH 3KLSX 4YHHL 2N49A 2E8OA 4ELVA 7ICFA 5IIFA 2B2VA 1E0BA 1SMYC 1SDFA 2XI9A 5KG6A 2WB1E 3URYA 3EPGA 3M9NB 4JWNA 1WTXA 3V6HA 1NY4A 3CPFA 4QIWE 4R4CA 4CJ0B 1BF4A 4NXNQ 1KFSA 3CD6A 4QF4A 4A3GB 4KLDA 2G5DA 4LF9L 4CF5A 4J9KA 2E8NA 2L9HA 1JRPA 2HDOA 1VF7A 5IGEA 2E2JH 4JK1A 4OGQC 2KJ8A 1SNDA 4C2MH 1SWWA 1YNNC 1BQQT 1A0PA 1N5XA 4AYBF 3ISBA 3F1ZA 8ICBA 1X2IA 1L0XB 3ZD9A 4MF2A 1B22A 1DGJA 4DSEA 5C44G 2KHVA 2KKPA 1NMFA 1S5BD 2EY2A 1VMPA 3FYHA 1YBYA 4DCCA 4GKJQ 1KFDA 3LWMA 4EBDA 4CBVA 1TWCH 2VKQA 1SV4A 2F0PA 1DZ1A 4F3OA 4DUZQ 1U47A 4DSJA 3S24A 2WF8A 4ED3A 2KD1A 3KF8A 4X62Q 1BCPF 5AI5A 1H9JA 1Z6HA 2GOLA 2K1BA 2ZJPA 3R2IA 3HT3A 1J97A 1OXTA 1X54A 5G5HA 4O42A 8ICYA 1A2UA 1Y1VB 1YNJC 1C20A 2F77X 3S1QB 4NLCA 4HAEA 3I4OA 4BWMA 5GAGC 4ACOA 4IQWA 1PFSA 2CW0C 5HMLA 1JE4A 4M1UB 3MGHA 1S0NA 2HHVA 8ICJA 1EY5A 3H09A 2R93B 4QQBX 3CHBD 2E2JB 1X55A 3H91A 3TS2A 5GAEC 4I2DA 3A74A 3AMUA 3QOLA 4H13C 3F2CA 5A2QE 4QZ8A 5AM0A 3S15B 8ICTA 9ICSA 1X3GA 3QEAZ 1NSNS 5KG5A 5DBAA 3NVWA 3C29A 2ZXRA 4ELUA 2VS1A 2Z4IA 4Q5VA 1SFOB 1CQFA 1UE6A 3C5FA 4TRDA 1I4GA 4YCVA 1D8YA 3RH4A 3G7LA 2XIDA 4FO2A 4J9NA 1K28A 2WFAA 3TN2A 4U673 3PIOA 3UDGA 1L1OB 1PH1A 1EYGA 1WVLA 2HHHL 3H3VH 5CV4A 3MA2B 3T1HQ 2R93G 1IL2A 3MTSA 3AEVA 1YNJD 3G6EA 4ME3A 5ELFA 1SL2A 4X66L 4DV7Q 3BYTB 4GKKL 2PZTA 1HR0L 5I2XA 2E2IB 2KFNA 4R8NA 2OTJA 4PMBA 1XO0A 1TS5A 3VR5A 1XPRA 3NGDA 5AK5A 2FHTA 1NK8A 2EYJA 2JA5B 3OTQA 4I2HA 1OXVA 2RA4A 4P0QB 2V9WA 3GTPH 1B0XA 2PW7A 2EYMA 2AXTU 1ZRNA 1VS0A 2NZOA 3PF5A 4BY1H 2G5HB 1N56A 1SMXA 5IYBG 4JI3Q 3BDCA 2Z1CA 4JI1L 1HXYD 1O7LA 1WWUA 2HQEA 4JI1Q 1W2BA 4KN4C 3QB3A 1SZHA 1WG8A 1CTMA 4CRXA 4DKAC 2WV6D 2UVUA 4HSVA 1ZRMA 3H8JA 4DSLA 1NNLA 2NZHA 2JZBA 5M3MH 3CMEA 2EZYA 5J2DA 2PPBC 1K8AC 4OJPA 3CCQA 1HNWQ 1QUQB 5CR3A 4JI5Q 3VA7A 1A63A 4IUVA 5FJ8H 1BO0A 1QH9A 4UP7A 5D3IB 2WHEA 5GQOA 3F2UA 1EQQA 2IW3A 4F4YA 3RB0A 4P4MA 1SL1A 1DJRD 4WRDA 1Z00B 8ICFA 5C0XJ 2KCTA 2F3NA 1N36Q 7ICGA 1XPOA 1SWVA 4FVMA 2ZXOA 4DUYQ 1OTCA 3HFZB 1C48A 3X3NA 2R61A 3FPPA 5EJWA 4JW0A 4XUSA 1FFUA 5ALYA 1OXSC 1XTDA 2F0FA 9ICIA 2JSOA 4LAAA 3S6JA 5CGKA 1FNVA 4YP3A 2P6UA 2KSOA 3KZIU 4R9WA 4GLVB 1L6NA 2F0SA 5KFTA 2NVTH 2MUTB 1D5ZC 5IIIA 5KFCA 4IPCA 4DFPA 1BPEA 5IYCG 2KN7A 1NJYA 2K5HA 3PSIA 5DEHA 1F9QA 1Z4NA 1SYDA 3CP0A 2CH4W 4X3KA 4QUFA 4DR2L 2Y1IA 3K7AB 2ZJQA 4O3SA 2IBKA 3CXCA 1I50B 1RF2D 4NV0A 1PRTB 2EAPA 5KG7A 1NK7A 1K3RA 2BQUA 2XCPA 4ZK9B 2NO4A 4I2GA 1YJ9A 4QCLA 5C3WA 3GD7A 1E7ZA 1SE4A 4DL2A 3DDHA 2IT1A 3CW2C 4L5TA 4MEYA 4P2CB 4UHVA 2R18A 5AKEA 4TUQA 1FYCA 4OX9Q 1XNSA 4DSKA 4KN7C 2IOFK 3E9IA 3K5OA 5BN4A 3T16A 1RYRA 2LYHA 1HNZQ 3CQZH 4A3BB 3V6KA 3TARA 5BR8Q 1JB3A 4DV5L 3HOZH 1CKMA 3H0GG 8ICSA 3QNMA 3PIP3 3GV6A 4YMNA 7ICTA 4C3HH 3NQTA 3R93A 4HMJA 2LYAA 2FLLA 3NHHA 3GTLB 4RGOS 1HPCA 2LI6A 2R7ZB 4QWAA 1RQNA 4KLKA 5EKLA 5JJZA 4JI6L 1I4PA 3ZDEA 3QR8A 1JB7A 1XMOQ 3PO4A 3M7GA 2QDLA 2E1FA 4RQ1A 1YITA 1T94A 3TMEA 4IOCA 2YN4A 1VJ5A 2YV5A 4J9QA 5T1GA 4RNNA 1SKRA 8ICHA 9ICXA 3D6JA 2A6EC 2XY7A 9ICRA 2PI4A 1YJWA 3CCRA 2HT1A 5CR0A 4DSFA 1N8RC 2EAOA 2F0IA 2B2VC 1TVXA 4QUCA 1Q3VA 4S3SA 4KLTA 1H9RA 3SVMA 4C3HG 1A15A 1A0IA 2WAQC 1KNEA 3MZ5A 5KG3A 3Q8LA 4BBRB 2LMRA 4PGQA 5KFXA 4LF4L 4RG1A 3NRWA 2ALZA 4F4KA 3HPOA 1LTBD 4L5QA 2F1IA 2MSNA 4UAZA 2KE7A 2XWBB 3LK9A 3EUB2 1K8MA 3E3XA 1OUQA 1N36L 1LT3D 2OXOA 4OJOA 1MIUA 4XRHA 1P16A 2VANA 3IG5A 4FS1A 4RT3A 2BGWA 3LWUA 2DUYA 4POGA 5CHGA 2V4DA 1IZ6A 1LUZA 3OWFA 1MSWD 5CMDA 2F3VA 4PZ7A 2A3VA 5AFWA 5E1FA 2B63H 2LFNA 4KI0A 3DUZA 3GIMA 4RQ2A 3OOCA 2BCOA 3M9BA 4GKKQ 3LX0A 1D9DA 2E2HH 3V7LA 3RJKA 3QXGA 2ZIUA 4JWMA 1NK9A 2DKZA 3PMLA 3C28A 1F9PA 3E0FA 1JQYD 3DXJC 3OYYA 4XTCS 4RPYA 2BCVA 1E1TA 1K0SA 2IOHA 2E2DC 1A2TA 2FMPA 4EZ9A 1EYCA 3HOWB 1L1OC 1JR0D 2B2YC 8ICUA 1LTGD 5J3BA 4FBTA 3SAHA 4P72A 5J39A 2OWOA 2KJ9A 3NBIA 4OO1I 1UAPA 1B9MA 4LWCA 5EGTA 5M3MB 2P6RA 7ICRA 4BY7G 3Q6SA 3GTOB 4A3JG 3S9WA 1V38A 2BE5D 1LKYB 4QWEA 4H44C 3EIVA 2UXCL 5F3XB 4EBCA 3QUCA 2W43A 2KFZA 4HCSA 2G09A 2BCSA 4PHDA 4KHZA 3SEBA 3TRZA 3RZDB 1GXDC 1O78A 4F8RA 1N2XA 1SMYD 4A3LH 4BY1B 3I4LA 1II3A 3LDAA 1GM5A 5M5WH 1D8LA 2HHXA 1O7ZA 3S16B 4JMUA 5J2BA 3HP6A 4PG3A 4JBWA 4JI3L 1CZWA 3I1YA 3Q8PB 1YHBA 3C5GA 5I9PA 1KN5A 4US8A 1HNXL 1ESFA 4G7ZC 1V1QA 3I7FA 4DR2Q 3WK4A 1LT4D 4IQUA 4IQVA 4DQRA 5NUCA 3GIKA 2E2IH 2A8VA 3PNCA 4DV0Q 4IC9A 4P0PA 3M9OB 2VIXA 1ENFA 3GTJH 1VQNA 2MP1A 1RDPD 4F2SA 3AQQA 1YJNA 4M6WB 3J81c 3FVQA 3C21A 1OW5A 3HOUG 3M1YA 3K5MA 4A76A 4GZYC 4X3SA 3SENA 3PX6A 3DWPA 4CHTB 1RTNA 1D5MC 1VMCA 1EIGA 5KFHA 1EY7A 2F1HA 3IP4B 1BNZA 5EBCA 3A8KE 1ZQCA 2M2LA 1PRTC 1RHPA 2XVTA 5KG4A 4ED2A 2F76X 4PHEA 2F0OA 2MHVA 7ICUA 2A68D 2Y0SG 5AM2A 4B9MA 1Y1WB 1Y14B 5IGFA 4YY3Q 4LFBQ 1IYVA 3LVWA 1LV9A 4UATA 1FNWA 1Q1BA 4ODGA 3H94A 4QJFA 5K5PA 1MHWC 1F77A 1AFPA 5IT9E 4DK1A 4KN4A 3PSFA 5J0XA 4RNOA 5D3DA 4A3JB 4O3QA 5KFKA 2K5VA 2Q4TA 2HBKA 1RL2A 3UXPA 9ICCA 2W9CA 1BDOA 3N52A 8ICRA 4FF4A 2CVRA 4RHSA 4O2DA 3SK5A 5KAIU 2PZUA 1D5XC 4IURA 1EY4A 4LF4Q 2PI5A 1F2YA 4DS5A 3FKIG 1HNXQ 1ZQQA 1B3AA 3TKAA 3NTHA 4A3KH 2NV3A 2K60A 4ULLA 4NXMQ 1ZETA 1M6YA 1KEJA 3T5LA 2YU9H 2DNCA 4HR7B 3C2LA 5AKZA 3JPQA 1PLFA 3HOUH 4GC6A 4M9GA 3KOJA 3TFSA 2Z6BA 3MEHA 4KMUC 1H9SB 3MR2A 4FNFA 3CAMA 1J8IA 1COOA 1ZD5A 2F0WA 2QEXA 4ZCKA 4DR1L 2F1MA 8ICOA 4C3IH 2OHFA 5HHIA 3DM3A 2UUCQ 4I2BA 5CB1A 1PFNA 2ZT9C 4A3MH 4U7CA 3JC66 5J0UA 2MO1A 1F2ZA 1I50H 5EBDA 4A93H 4EBEA 2D5DA 1NJIC 2K50A 3GFKB 2KUMA 5JPMC 1HUNA 3HOVH 5EQ0A 2N55A 4UARA 1YHAA 3MHBA 2VUMG 2KVSA 1H95A 4QZAA 1L3SA 1ZQNA 3AFPA 3VC8A 1F2LA 1MQ2A 9ICWA 2PKEA 1TWHH 5IINA 1B43A 5KG2A 1XNQL 5C6AA 1VQ6A 4QIWF 1GJXA 1S9FA 2X69A 3TP8A 4O5EA 2XC9A 3KLSA 4GLXA 7ICNA 2KZMA 5KG0A 5KTQA 2ZJRA 2OEOA 2RKSA 4KN7A 4QW8A 2OYYA 4Y2SA 4TURA 5IT9L 2ICEC 1EIHA 2CPRA 3HOVG 3QIAA 2F4VQ 4DR6Q 3SAFA 1CHQD 1SE8A 4B9SA 2AHOB 2KNJA 1LVHA 2PFPA 4PL1A 2N3SA 2RSOA 1XMQQ 5IE8A 1SV0A 1ECWA 4ED7A 5K36H 2EXZA 3Q8SB 1Q12A 3VR6A 5J8YA 2C2RA 1BNPA 5JEAH 5AKLA 3K7UC 4DR3Q 2I0QA 4O5CA 3A7AB 4H7BA 3RJGA 2K4KA 1EZ8A 4OWWB 2F0NA 4K4IA 4B6JA 4P4OA 4RQ6A 5CV9A 3W1GA 2NVQB 1LTLA 9ICFA 2LY7A 2AMCB 4BWGB 4HIOA 1G2TA 5JEAJ 1PYWD 1X6OA 5IWAL 1O7YA 4KLHA 4RQ4A 3BQ0A 1B4OA 2J6UA 1J2MA 2D2CC 2Y0SC 4QJFB 4QZIA 2AWOA 2GVAA 1K8OA 2H3QA 4BUGA 1LB2B 1ZQMA 1CI4A 4GN4B 5LMUQ 1STAA 4DR5Q 5LMUL 4LW1A 5J29A 1DD2A 1VQJA 8ICGA 4C0ZA 1KLNA 1NZBA 1UE5A 1Y8PB 3ZDAA 2IOFA 1X9MA 3KK7A 4X6AH 5BOLA 4A3IG 2VQFL 4Q8EA 1LYLA 1M90C 5EPLA 1CI3M 2BA0A 3ERQA 4PV1C 1AEXA 3VCBA 1I4XA 1HQMC 3S14H 3JPRA 1GUGA 1L0YB 4EGVA 3IFTA 2KVCA 4IRKA 2UVRA 3TADA 3MFHA 2WKCA 4IOAA 1Q8KA 1QTMA 4ZYSA 3J81j 1S0MA 3N6RA 3PQIA 1Q3UA 1DYQA 1TK5A 5C3EH 3NBHB 1L5UA 1OXJA 1EIYB 4HJ7A 3HX0A 1JMSA 2AU0A 3H0RB 2BDUA 1SROA 5JOBA 2I5HA 5AM4A 4Y2YA 1QLNA 5CC4A 1ZYRC 2UU9Q 4XIGS 4DV7L 5L1LA 4FF3A 3CCEA 1N9WA 4R1JA 3VR2A 3C1YA 1WCNA 1U4RA 2IX0A 4DLGA 3S15H 2BDNA 3K0XA 1S97A 2B3GA 2BHNA 3U26A 2VL6A 4K14A 5LL6X 4A3LG 4MNOA 1TV9A 2JRZA 1ZQWA 4EYIB 4ED6A 3KDFA 4K0KL 3TANA 2YTUA 1BBXC 2IHNA 3PO3B 2K4HA 5ALKA 2JZBB 3EROA 3OWEB 4DUYL 3ZDDA 1TT2A 4Z9CB 2ISOA 2WP8J 1WTOA 4LF7L 1X42A 4IL6U 1JJGA 5KL1B 1L8OA 1IXRA 1FO4A 3N4MB 3QUBA 3TQYA 2D6FC 3KYHC 1HUZA 2GH1A 5AKJA 1GUTA 1WI5A 2F0UA 3T79A 2DF4B 1F9RA 5DM73 2K5WA 4IUQA 1ZQUA 2E8MA 1KTKA 2H1EA 3CU7A 4CNQA 3A0BU 3PW5A 1SYEA 2VXWA 4NXML 1NUCA 1QILA 1P7DA 1ZQBA 2B2UC 2A6HC 2HI0A 4QMGA 1KHIA 3QZ8A 1BCPB 3M4QA 1ZQIA 3F2DA 4DGZA 1B44D 5E3FA 2BKEA 5CORA 4LF8Q 1L7MA 3QYPA 5J2HA 1N33L 4ECSA 1X3EA 1ZQTA 4ZH4A 3CCJA 3IRUA 2CHBD 4I2EA 1SKSA 4DAYA 4F88A 1HHVA 5ALWA 2Q0ZX 5IIKA 2J6SA 2E8GA 1VQKA 1IL8A 4KMOB 4RQ8A 2PQEA 3IKJA 4KLOA 4F71A 5IODA 1H38A 2VA2A 5DNFA 4B9VA 2CQOA 1XJVA 1NKEA 2DY8A 2R7ZG 2KP7A 1JE5A 3UE1A 5FLXc 5M3FH 9ICHA 5CV7A 1XNQQ 1PZKD 3RTVA 3ED5A 3M8RA 2E1EA 4N9PA 1W3SA 2K8AA 1ICWA 3GTJB 1STNA 3T3FA 3OSOA 4HSPA 1S3OA 3I2ZA 5C4XH 1QNUA 3I55A 1QQ5A 5I2YA 1K83B 1JIHA 1JALA 1SE2A 3GV7B 4ED1A 2JXJA 4IFDJ 5C44B 4MTNA 2EH9A 5J2FA 1CZGA 5H1SE 2W55A 5BR8L 3NK9A 4ZRZA 2FFKB 5KIXA 5IGDA 5EWGA 4O5KA 5LMNW 4V190 3GTQH 1E1OA 5DM63 3OJUA 1H9KA 4UY8C 2RHSB 4KITB 4IO9A 4DA2A 3FDSA 4QIWB 5C4XB 2KEDA 2EYOA 2R7DA 2AQ3B 4JG2A 3RF9A 3CCVA 3RZDH 1WTRA 2A5HA 3TDQA 2EDUA 3FC4A 3HEJA 2JA9A 1XX8A 2JHDA 4NMZA 3NVZA 5GROA 3PR4A 3G4SA 3PVXA 2W8LA 2F52A 4POFA 1PH3A 4NWIA 1D6EC 3BQ1A 4ECTA 2N88A 2MA1A 1SNPA 4LUOA 3A7LA 2YQEA 4BY7B 4DK3C 2EANA 5L1IA 1U45A 3A5UA 2BZFA 5IP7H 1SGGA 4DL5A 4TQRA 4A3KG 2HDMA 1EEFD 5KFYA 1TKWB 1N32L 1TS2A 3L7ZC 4GKJL 2RSNA 2JEIA 5AHXA 3MABA 4K8IA 3IRBA 1X9NA 4XQ8A 2F0QA 5ALHA 5KFIA 1TY2A 1KDAA 1IIPA 2E2HB 4RQ0A 2XIWA 4EZ6A 4YY3L 4CE6A 3I4NG 4UB3A 5FOBB 5JRTA 2PQAA 4JI7L 4F4WA 8ICCA 1EWCA 1HZAA 2PO4A 4QWBA 3S17H 3QU4A 1I4HA 2F0KA 3HOYG 4F91B 3I28A 1SV0C 2QB0B 4XA5A 3H3VI 1EFID 3RZOB 1A3TA 3EBEA 4OL7A 1ZYRD 1E2ZA 2PYKA 2I1QA 1HNWL 4BBRH 1PXUA 3K81C 1I4QA 4FS2A 1XNRL 3GTGH 4BA2I 1WFQA 4ZUJA 3SAGA 2R7ZH 2QKQA 1A3VA 2F2AB 1B70B 3FHWA 4EENA 3RLOA 4OXPA 1SN8A 4EX5A 1TAUA 2IX3A 4A3DG 2EOTA 4KK7A 4XYQA 4ZUIA 4HEDA 1PK1A 1X65A 2HD3A 5BPCA 1XYIA 1PHJA 2DUDA 2PCFB 3IFDA 4J8QA 5CYUA 4RCNA 4C8MA 9ICNA 1L1OA 2B2YA 3NBHA 2ATLA 3PV8A 2MUYA 3TQ1A 1H9SA 1PRTD 5KT6A 1PRTF 3PIPA 4CGZA 4OELB 2KIWA 2FPKA 2C28A 2KZZA 2PNRC 3PCOB 4KKTA 1BBWA 3I56A 2YTYA 2B2TC 1S72A 3GV8B 5FO8B 1ZOLA 5DB7A 3I90A 4RGTA 5HMMA 2Q8IB 3D2QA 4NL9A 3RJEA 1PVOA 4ILWA 3IN5A 2DPIA 5LHY1 2ZUDA 2ZIXA 2JXMB 4EQOA 3CMAA 5GAHC 2JA8H 1VQ7A 4FFDA 3P7JA 3U4ZA 3NTKA 1SJHD 5JVG3 1K1QA 1KQQA 5C3EB 2LKYA 4BS9A 5HGTA 3H0MB 5KFPA 4KLEA 2AWNA 5FLMH 4K6DA 4JVZA 4L5SA 5C0XI 2F0DA 4M9LA 2LXKA 4L6TB 5ALPA 3RBEA 3RZOH 5AKHA 2KCMA 4F92B 3SMVA 2BOSA 3K80C 2RVLA 3LGJA 1VQMA 4R4QA 1V1OA 3GTKH 1G6ZA 8ICWA 3BG3A 4DO9A 1T4GA 4OIKA 4KKUA 1MSHA 3T53B 4DF8A 2LSSA 2M9VA 1E2VA 4GOPA 1ZQXA 8ICKA 3TZUA 4NY8A 1QUQA 4FDBA 4DAVA 5KYIA 4IFDI 4JOIA 1PH8A 5AKKA 2SOBA 4K5XA 1B8AA 5EPJA 1BCPD 1NKBA 1IV8A 2F0MA 4O9MA 5DDYA 2BE5C 3MBYA 2ZTDA 3KHGA 4WJWA 2FE9A 4MHVA 1XSPA 2A68C 2XNAC 4A3EB 5E7NA 2IMWP 4R65A 4M6WA 3C2MA 4C4RA 1Q8IA 1VF5C 2H3IA 4OJ5A 2N78A 4QIWC 4UP8A 1QQ7A 4DR6L 4ALPA 3STBC 2HIVA 1X32A 2F4VL 1QCKA 4O0AA 5G3LF 4MTKA 3PO3G 4FF2A 2W03A 1ZQKA 4C80A 1IHZA 4KY6A 2D3DA 5IGCA 4JI0L 1J5EQ 3B0XA 3TAQA 4A3MG 1T7PA 2K5DA 3QU2A 2F0VA 2BDOA 3B0YA 4B3TL 2FINB 3Q8MA 5KL8B 3V7JA 2AJQA 2FLPA 1UA1A 4OONA 3W3AA 3G6XA 1RD9D 5ALDA 3SHLA 3DWQA 1PTOD 1IW7D 2KHSA 5IWAQ 2OQKA 2RCFA 1ZQSA 2RLTA 3MVVA 4FYDA 3ORYA 1X3QA 2I9GA 4UB1A 1X9SA 1RJTA 4LZDA 5GTIU 2MUTA 4YMOA 2WF5A 5JTIA 3HW8A 9ICJA 1EU3A 2EJFC 3D0FA 5ELBA 4LFAQ 3STBD 2O5JC 2HCFA 3RD4A 1Z47A 3RB3A 2JA5H 2WAQF 1TIID 2F4IA 4DR7Q 4HJ5A 3Q23A 4UBCA 1E24A 2ZXIA 4KTQA 2MO0A 4RNMA 3PY8A 2RCNA 1XMQL 3C46A 2JA7B 2HQLA 2CFMA 2ZIWB 5EKIA 3PV0A 4HIDA 3BQ7A 5DLGA 1BVSA 1ZQPA 5COYA 1SRUA 2ZM6Q 3UDXA 3DEEA 3RLNA 3WK8A 1WYDA 4N8FA 4L5RC 4ZKBB 4IZ8A 1XS9D 2AKWB 2DGYA 4DNRB 1SXDA 4KY7A 1U4MA 3HKSA 1TFRA 4F5QA 4U6PA 2E75C 3RB6A 2BQ3A 4IQTA 2F0HA 4LFCQ 1KBUA 4LNQA 5T14A 4YR0A 2XO7A 3E9HA 4JK1C 4DV1L 1IM4A 1DGSA 3E58A 1JT8A 5C5JA 1HFGA 5ALOA 2Z9HA 3I91A 1B9NA 7ICKA 5ELOA 4CKBA 5IY0A 3ALRA 3G48A 2OXPA 3BZKA 4LZGA 1D8BA 4Z6EA 4YG2A 4CDGA 2E76C 4GXKA 3TP7A 4BXOB 2B8GA 2YB4A 4F93B 3TREA 3K6OA 1J9OA 4H02A 3GTGB 1S4ZA 3HKZB 4B9XA 2VA3A 4ME5A 2Z7JA 4A3JH 3EZ5A 2KA7A 2BR0A 2RQ5A 1A6XA 3T5JA 1I3QB 3FRPB 4C1NK 1VQ8A 5J0SA 3UMCA 5IT9c 2IWHA 1TWCB 3K8AA 2CH4A 3NASA 3ICEA 3AU7A 2WKDA 4PHAA 1GHJA 1TY0A 5I6WA 1R9TB 2E5LQ 1Q82C 4WJ4A 4UAWA 4R66A 3UPQA 2XRSD 4C8OA 4CCHA 1Z9FA 3DHQA 1IKLA 4IQZA 1N33Q 1GUSA 1X56A 4NB3A 1Z1BA 2B39A 3ETLA 2IA6A 3KDFB 4DK6C 2EDGA 2DL0A 2UXDQ 4RAUC 2G08A 4RKBA 2I5MX 1YEZA 2JK8A 1N62A 1QZGA 1PV4A 3CC4A 5HR7A 4LF5L 7ICPA 5E79U 2KTQA 5D14A 2ZUCA 3PUWA 1TAQA 2E74C 3M9MB 3EFXD 1CSQA 5KT3A 3HJEA 5KFRA 4PZNA 1PH9A 2L11A 2W9BA 2KICA 3I73A 1K5OA 2RHQB 3JAMc 3UXOA 2K01A 3G6VA 3OW2A 3MFYA 1Q7YC 1TWAH 1EYDA 4IR1A 3BDLA 1CA6A 1HRJA 3S1MH 4I2JA 1RDFA 4F87A 2C35B 4JI4L 1PFBA 1AQ6A 5JJIA 4E0DA 1Y1WG 3WWVA 4DL3A 1XWLA 2ZM6L 2UUAQ 1QSSA 2XY5A 1RZTA 3J80i 1C9OA 4C4TA 4ZLTF 4YFKA 1CEZA 2ATWA 2UXDL 3M85A 4A8EA 4BBSH 3TZDA 1QG7A 4B3ML 3V7KA 4IN3A 4KLJA 2ZUBA 4A3CG 4JUZA 2AGPA 1FJGL 4P75A 1EY8A 2B2WC 2ES2A 2K4EA 1Q81C 4DL7A 1BPDA 4C8KA 4JBKA 1YT3A 4IPDA 4RQNA 2VB3X 1ZQZA 5A35A 5J2GA 3HOXH 1IG6A 1HZ9A 2IJ0A 4K5VA 4J03A 3VA5A 4A93G 1SXEA 1VQIA 4EVOA 4BWJA 4XYOA 3NS1A 1WCLA 2LXJA 2Q8TA 3WOFA 1ASYA 1TWFB 2PFQA 3GV5B 5DBBA 4OJLA 3ZDCA 4XQJA 2IPKD 4C8LA 1C8CA 2VJ4A 2EXDA 4J9RA 1HEKA 2ZTCA 3ERSX 1KRPA 2F0EA 3E2EA 3CRXA 3P75A 1UWVA 4ID6A 4XT3B 5M3FB 1L3VA 3NXWA 2L55A 1KD1C 1EZ6A 5DGAA 1S76D 1ET6A 1QJOA 4J9SA 1SSOA 5HR6A 2KENA 5C3XA 3MXUA 4JOIC 1HTLD 2G5IB 3MEFA 3J7ZC 4ECWA 1KDBA 3RH5A 3EA6A 2JV3A 1UEAB 2PMZB 2L5TA 1BUVT 2NWGA 2ICIA 2JH7A 1A76A 4JV5L 5AIBA 8ICEA 1UHUA 5AI8A 1O80A 3MXNA 1HIWA 1UA0A 5EPKA 1I6HH 1XWEA 4NW2A 3S2HH 4IFDH 3ND8A 2LHTA 5DGBA 1D7QA 4LJZC 5CWRA 4ECYA 1I3QH 1M4VA 3QE9Y 2NO5A 1QOHA 3O13A 4YWKA 4CJ2C 1TAMA 5ALUA 2M0NA 1O7IA 3B6YA 4OCZA 3FKIH 3KBBA 3J81i 1P8LA 2JA8B 3VR3A 3RRHA 5EE1A 3NENA 3QX7A 1ZEQX 4KMUA 4B9NA 4IRCA 1ENCA 1EQVA 5ALLA 5IP9G 2JH1A 3IG8A 1KSPA 1NR4A 1PZID 1XO1A 3JPTA 2GN5A 5F2DA 4NLBA 4IALA 3GTLH 4RHRA 4GNXA 1Y69U 1AW7A 1KC8C 4GOPB 1T5EA 1XSLA 3R2TA 3PSPA 1TS4A 5K4LA 2R8GA 2P35A 3NUQA 2WB1B 3PIO3 3HOZB 2JGAA 4KHVA 5KNDA 2I46A 1FNUA 1RIPA 3J80c 1JC7A 1SYGA 3M6KA 1HCZA 2W3RA 3SV4A 4RCOA 4TUPA 4JI0Q 4BY1G 5KYLA 3MGIA 3S1NH 4IRDA 5ALVA 1YIJA 2W9AA 4DWIA 5KAFU 1QNKA 1X3FA 1WTVA 1PH4A 4JI6Q 3AU2A 3C1ZA 1K1SA 2JR5A 3N28A 2AQ0A 3T1YL 1PMRA 1SIJA 3RUZA 2E5SA 4FZLA 3TACB 2FJ6A 4BX9C 4QZGA 1U4LA 2JE6I 4CGYB 1EQRA 4RU9A 4P0QA 4KTAA 3TP6A 4OWTB 3BQ2A 3CCMA 5ALRA 3EYZA 2R92H 3T51B 4LVSA 3GZFA 2CN1A 4K6LA 4RUAA 5EKKA 2JA8G 2GVBA 1EXNA 2K8CB 3KKAA 2JEFA 2JP1A 3E0EA 3U9OA 1D1IA 4XQQA 4A3GG 2EYPA 5IYBH 5C0YA 2UUCL 3BQTA 1Q86C 2ZXPA 2W7OA 2YMMA 5DB6A 3HKZE 4Y2UA 1KDHA 4Y52H 1ZQFA 4F2RA 1EIFA 2NVTB 1NMGA 3EW9A 4Z6FA 2R8KA 3HGBA 3HKZC 1B2TA 4RT2A 1A8VA 3BS5B 1VCIA 1FFVA 5M5YH 3N97B 9ICUA 2IHEA 4NDXA 4DS4A 2R92G 2F1JA 2WF7A 2K5NA 1G2SA 4LJXA 1EFWA 3VYSA 4YR2A 5IOCA 4XXEA 2BPCA 3NE5B 5M9OA 3CCSA 1HH2P 5CV8A 2G06A 5C5MA 3RJHA 1I6VC 4UASA 3AYHB 4KLQA 1J6QA 1VQDA 4K2LA 4WJ3B 2ZXHA 8ICLA 4Y7NH 1PTOH 2WFWA 3RH6A 4NLZA 2PQAB 1EQTA 2VQFQ 4FXDA 3PMNA 3M4YA 1MSGA 4LUZA 7ICIA 3JAME 1GO3F 1KKXA 5ALIA 4GC7A 3CC7A 4QNLA 5F9LA 2ZG6A 2HVIA 1M1KC 5J0TA 5AM5A 2H3ZA 1RXWA 5M5YB 3G71A 2JEJA 1SYFA 1XU4A 1LTTD 4IPGA 4YQWA 5FLXE 1IBKQ 1U9LA 1L8LA 5KFZA 4N9TA 3J7AV 1ZD4A 2W7PA 2J6TA 1QWYA 3ITPA 5AM3A 4DV5Q 1WCMH 2K04A 2PZWA 5AK3A 3I4NH 3ICXA 2B8FA 4QL5A 3WKAA 5FKAC 4KLLA 5DBCA 3GTKB 2ID0A 1S5CD 1RTOA 1QQ6A 1FJGQ 1BPXA 2KEEA 3F5EA 2CXYA 2R92B 2HSZA 1PK1B 3JPOA 2JA6B 2MFIA 4A3DB 1CM9A 1A3UA 1B53A 1EU4A 1DOQA 2B2TA 2R6GA 4O3RA 1S0VA 2WINB 3HOVB 2SNSA 1VQ5A 3WK9A 1NOMA 2OM6A 4M9NA 1BR9A 1G291 3NWTA 3LVVA 3UMGA 2A1AA 3WKEA 2B0CA 3M4OB 4A3FG 5KT2A 5KFVA 2HHTA 3EQLC 1PVQA 2BPGA 3E6ZX 3SK6A 2OTLA 4G57A 5AICA 4GN3B 1GO3E 4DOBA 4UP9A 3KTQA 1V97A 2V1CC 4QGUA 2CKZB 3UE0A 2F0TA 4Q0FA 4A3MB 1V43A 3IL8A 4JI2L 4DV4Q 2KHIA 3L0OA 4CKEA 2ZJAA 4IUPA 5I6YA 3IV6A 1Z7TA 2VZAA 1V1PA 2BH8A 4OD0A 3CCLA 1K3BC 2LKVA 9ICVA 4UB8U 4BA1I 4LF8L 4I65A 4UQGA 4C1NI 4P2HA 4RQ5A 3KHHA 1SNMA 4GNXB 4QB4A 2W9BB 2DN8A 1F0MA 3MXPA 5AIAA 3BVMA 4K4HA 1STEA 1L3TA 2B2UA 3QU5A 3NTUA 1NK5A 3AM9A 2G9HD 4RA8A 3AQFA 4DQPA 3SZ2A 1TU2B 4F5OA 3TP5A 4JV2A 3X3MA 3J81L 1DK3A 3JPNA 9ICKA 1OXUA 4RKLA 1ICFB 2Y0SB 1U4PA 1UT8A 3B9JA 2K52A 4RPXA 4DL6A 2QF7A 3PO3H 2B63G 5GTHU 1BPYA 2PI2E 1FGUA 4UAVA 4LF5Q 4Y2PA 2DGZA 5DG7A 1SZPA 4MFAA 2FJ2A 4JPBW 3SXHA 1LLRD 2PXIA 2XTIA 3MDAA 4PNYA 1NZPA 2W9MA 3RJIA 1F44A 2WAQG 5ELCA 3SGIA 3M7NA 8ICNA 4C3JH 3VYRA 3M3YB 1ZYQA 4I7AA 4DAYB 2HUGA 4FXGC 4JC0A 5ALJA 1D9FA 1FEZA 2KECA 5KFFA 2JA6H 1ZQLA 1ML0D 3OIPA 2UUBQ 4ZQ3A 2HVHA 1GHKA 1TQOA 3GP7A 1GKHA 4A3FB 3K7AH 4CDDC 5L37A 2RHFA 3Q8DA 5ALZA 4QW9A 3H4DA 1ZQEA 2V4RA 3BYYB 2NVXH 4EX6A 5DB9A 2HOIA 1DK2A 2EY5A 3K5NA 4PH5A 2VQEQ 5L1JA 4IUTA 1VQAA 1KNAA 1JOQA 3UXNA 2AH5A 5KFJA 5LL6S 2QDBA 4R64A 5AI4A 4C3JG 3HOXB 1CSPA 5L1KA 5IILA 1KRSA 3OJSA 2W8KA 3UQ2A 1UCVA 5CV5A 3ONAB 4CDCC 3H15A 3Q22A 1X9XA 1BOSA 5AK6A 2A69D 4DV6L 2XN9C 1OXXK 2KV2A 5ALNA 3MR5A 3NP8A 4KD3A 5KFSA 3KHLA 1DOLA 1SNOA 1D2BA 4HIKA 2BA1A 3BZCA 1X6JA 2IX1A 2D62A 4F4ZA 2B29A 2RDIA 1K83H 1LTID 4LFCL 3OTOQ 5J8YC 1T3NA 5JJKA 2DWQA 5HHHA 2DY7A 5CJ7A 1A62A 3V05A 2K7VA 3OGUA 1S10A 2BCUA 9ICMA 3V72A 1PTOB 4Y7NB 2EY6A 4QZFA 1BKBA 3PW7A 3TI0A 4XDXA 3H3VC 4EQ5A 1GUOA 1B3QA 3DM1A 2WB1C 1WTHA 5DLFA 2L15A 3LNNA 5EE3A 3K4GA 4F5RA 3S2DB 2F8KA 3D6WA 4HN7A 1PZJD 4C56C 5DLQE 1I94L 4JI7Q 4Q44A 2X6LA 4G7HC 2W9CB 3C2KA 4JI8L 4LMQD 4UB2A 1B7YB 3D4WA 2YY6A 1VQPA 1BBUA 2I07B 4UW9A 4ECUA 4X65Q 4OEMB 2XGQA 4DV4L 3GTPB 2ISPA 3V96A 1CKOA 4GN5A 4BXOA 3MAQA 3Q8KA 3WK6A 4OWXB 1K73C 3K0YA 3GDXA 1O03A 1A77A 3PR5B 4KV6A 4BBRG 4TQUS 1D1KA 1AZQA 3GV3A 3ISDA 3UI2A 5A0LA 1MJCA 2BCQA 3MDCA 1U48A 5LMNQ 1TE2A 4EELA 1RPLA 1V8QA 3PW2A 1DRGA 4NP5A 1CQVA 4DV2L 1PYSB 2G9DA 3AU6A 4A3EG 1VQBA 4N8X1 3SK4A 3VYTA 5IYCH 1ZQGA 4JI5L 1YZ7A 1EEID 3HZXA 3OW7A 3D4RA 2ZIXB 1RKNA 4DR7L 1Z3EB 3H4BA 2MJ8A 3Q24A 1MBYA 1C0AA 4X3TA 3H8SA 7ICEA 1PZNA 5C4JB 1V1PB 2C22A 2EYLA 2EZZA 4L63B 2FMSA 2K8BB 3UDFA 2Y9TA 2ZIVB 4PZ8A 3K58A 5J2EA 1IYUA 2HDLA 4B3SL 4BJQA 3EPIA 2KHJA 3CP8A 2OT2A 4NL9C 2XSCA 4MHEA 1FGBD 3G6JB 4Z6CA 4F72A 3L2PA 1AROP 4A3BH 3NSWA 4AP9A 4QZ9A 1EOTA 3PUYA 5C4JH 1SNQA 2NRXA 1X66A 2VUMH 3MXNB 4JV0A 4Q43A 4DR5L 5B5EU 2QARB 4XT1B 3PZPA 2QW7A 1U5KA 3RJJA 4DK0A 3WK7A 1XC9A 2K28A 2NYZD 3NVYA 1PH6A 1QSYA 1SAPA 3PUVA 2K4PA 2C5CA 2NB0A 2HHWA 3CQZB 1IBLL 4UBBA 2I5LX 5AJ3L 1NI3A 2YMLA 1I6HB 4L8JA 5AKGA 1RCVD 3FPUB 4NKLA 3W5OA 1NJZA 1TS3A 3NQIA 3AB9A 1T8EA 1ZQAA 2RDGA 4J1MA 3D31A 4G9BA 4YVZA 2F44A 5D46A 5DG8A 1Z4OA 4Y2RA 1MQ3A 1UQVA 3GQBA 5DKWA 2LS01 3M7DA 5KFLA 4MZ9A 2ENBA 3QUTA 3AUOA 5FO9B 4DFKA 1JXLA 3R8BA 3S17B 2IHMA 1KLUD 3MR6A 3FEWX 2PNHA 2KK0A 1J5EL 5C4ZA 2E5LL 1F5SA 1NE3A 5E4WC 1JUDA 1JOKA 3SEIA 4J9PA 2Q2TA 3HKZG 3CYMA 1PH2A 4R4TA 3OHAA 4B08A 2W54A 4LFBL 4RWSC 1RXVA 3BZDB 5J2AA 3L5KA 1I4RA 3RNUA 1KXLA 2RBMA 4RH6A 1B50A 3EN2A 4LF7Q 1LTSD 1S5FD 3RBDA 3SV3A 1NJXA 2EQSA 3KLRA 3L3OC 4LUVA 1MI2A 5IIJA 2NRZA 4B9TA 5CEHA 3RAXA 2K05A 3QJYA 5KNCA 4CF3A 4F50A 1KL9A 2VW9A 4YR3A 2WIIB 1WCMG 2ASBA 3I4MH 1VQFA 4FE3A 4FBUA 5FLXL 1AE3A 3UMBA 4A3EH 4JI8Q 1E2WA 2ZIVA 5AM1A 2HCIA 2HHSA 2PMZE 4NPSA 5KRUA 1UT5A 4Y2QA 4YXMA 1GVPA 4DV3L 5DQHA 3N7SC 2IHFA 4DV0L 4PHPA 2X6GA 2Q2UA 5KFNA 4DN4M 1SYBA 5ALQA 3PF4A 4NJ8A 1MJEA 4JYAQ 5HP4A 4FO6A 2K32A 1MN8A 4PPXA 3OSPA 3N7RC 4ED0A 4KLGA 4P4PA 3PW4A 3S1MB 4GNXC 5C5LA 3MC0B 3RJFA 3GTOH 4O3MA 4ZOHC 1SXTA 2WB1F 1YZ6A 2NVXB 1NKCA 1HQRD 3U9SA 5M5XH 3BJYA 2EE1A 4WORA 4K5WA 4GIBA 4GS3A 2HOQA 3CC2A 2VA8A 4DOAA 3HOWH 2WAQE 2WB1G 4KLMA 3CRKC 3A8IE 3CRLC 1Q3LA 1TWHB 2CW0D 5ALMA 1WTWA 5KNIA 3BS7A 1VLBA 4ECRA 4BXXH 1SFOH 2KEYA 4KJNA 1EWHA 3OHBA 1WOCA 9ICBA 5ALGA 1HUMA 5J0YA 5C4XG 1CA5A 2KHQA 2BQRA 5D65A 1VQ4A 1I94Q 4QWDA 3ZYYX 5LMNL 1JX4A 2AGOA 4I2FA 5KFDA 1S5DD 5KFEA 2C2EA 3SE0A 5AI0A 1TKDA 2KJXA 4GLAC 8ICIA 4X62L 1JOOA 4C3JB 3CKIB 4DF7A 4JBMA 2J4XA 2Y1JA 2NRWA 3K1ZA 1FVIA 1TXYA 1SBBB 1L7PA 4QWCA 1Y1VH 1SL0A 3S1QH 2YX8A 3KKAC 5DG9A 2G0AA 4UB5A 1HA5A 1T3QA 4R63A 3TBIB 5KFOA 1NJWA 1H9MA 3KBGA 4P0PB 1KLGD 5J2JA 1JXEA 4V0BA 4OO1J 2Z0SA 3OPXA 2E3TA 2F0LA 5ALTA 2F3IA 1V9PA 2K33A 4C4SA 2GO7A 3PSTA 3KF8B 1OO9B 2YTXA 4LK1C 5C4HA 5HGQA 4HJ9A 3O0FA 1ZQVA 2QA4A 4OO1H 1PTOF 3C1FA 2HCCA 4LF6Q 2MNAA 2NN6H 3HG9A 3V2TA 2MGSA 3ISCA 9ICOA 1JWMD 5EOZA 4M2YA 2D0OA 2RDHA 2EQYA 1N61A 4EEKA 3K75D 1NTGA 3BU2A 4P74A 2ALYB 2JA6G 2LM1A 3OHXC 3L4PA 3CF5A 5AKIA 4KKSA 2OEHA 1UNSA 1CKNB 5KFUA 2HHQA 4P71A 1X6IA 1VQHA 2JEAI 9ICGA 7ICHA 1JWSD 2FPLA 2C9OA 4AYBE 1EOVA 1B4FA 1G51A 3U4VA 2FMQA 2JA7G 1YI2A 5ALFA 2LBOA 1VQOA 1BPBA 1TR5A 1KAAA 5CP2A 5ELNA 4O3NA 2G07A 2YMPA 2SDFA 3D8GA 2M9NA 1X3PA 1VQCA 1CUKA 5KFMA 4DQQA 2DKXA 4ECQA 2HBLA 5J22A 3M4OH 3U58A 1LT5D 1V85A 2O4XA 3HRDD 4DV1Q 3NRZA 1S0OA 4DFJA 1DM0B 1KABA 2XRQD 3J80E 3T1YQ 2EAMA 1KDCA 4HCEA 2YTVA 3I4MG 4PGXA 3AQEA 7ICJA 3F5AA 2EZXA 7ICSA 5FP0A 5EE0A 2JA7H 2A69C 3DMUA 4R4OA 2Z6KA 3ER0A 2DJFC 2PI2A 2GWSA 2CRXA 2H4OA 5IP9H 1XMOL 3K59A 1FR3A 2SNMA 4GOPC 2F03A 2F0JA 3RFAA 2AQ4A 3WDNA 3ZD8A 4PQXA 3I4NB 1XTCD 3IDWA 1DOMA 4X64Q 1EY0A 2VY3A 2R8JA 1UE1A 4AQYL 4JBJA 1UE7A 3VR4A 2RP5A 4K0KQ 1JICA 4IPHA 4APVA 5BN3A 3ULLA 3D3RA 4DOCA 1WJJA 3I4MB 2OH2A 4RZRA 5CA7A 1LKYA 2XVSA 2ES6A 4M0AA 3SDZA 3WOEA 2Q8RE 2Z4HA 3RLFA 1TWGB 3BDPA 5EWEA 2UU9L 1JCKB 3RR5A 3H6MA 2J0TD 2DBYA 5F9NA 5KNBA 2NYVA 2UXBQ 3UQ0A 4MFFA 4YWLA 2NVQH 4DPGA 2RF4A 3C3LA 1CKNA 8ICQA 1ZQDA 4Q8FA 1PH7A 1UEBA 9ICLA 2EYHA 3WU2U 5KFBA 7ICQA 3F8TA 4BDPA 1HFNA 2FMMA 9ICAA 4I2CA 3VYUA 3OIQA 2L0CA 2A19A 3K1RB 1JORA 2MQHA 1SLJA 4OJ6A 4P73A 3ETRA 4IFDG 1GUNA 5HY6A 2VNUD 4X65L 2LM4A 5B66U 2JYOA 3C23A 4HIMA 1AZPA 2F3WA 1N32Q 5TISU 2K6AA 4YMMA 2PMZF 1N5WA 2L1BA 4M04A 1UPHA 5E4XA 1LTAD 5C0XG 1EWIA 5JU5A 1VQLA 4JCVE 1JJCB 1VDZA 1Y8OB 2W04A 4FP5D 4NXNL 1R4PB 1SEBD 1STYA 2Y0SE 2HIXA 3PUZA 1BCPC 5KGUA 5CRXA 2FPMA 1ZD3A 4BBSG 2K5QA 1LACA 1LABA 5J0PA 1JWUD 2H5XA 4ECXA 8ICVA 2AQ1B 1NBWA 2AGQA 3H0GH 1QB5D 2ODGA 2R8HA 2A1JA 3PO5A 7ICVA 1U0LA 1Z19A 1JJ2A 1KRTA 1HZCA 2HHHQ 3SR6A 4TQSA 1DOKA 3PUXA 4A3GH 1QSLA 2LYBA 2Q2HA 2E8PA 2WAQB 3RRGA 2JN4A 3S1NB 4K2KA 3E5SA 3QOJA 2D8CA 2PMZC 5IP7G 2ESEA 3SK8A 1N34Q 4HMIA 1F2MA 2XWJB 4GXJA 1W6JA 4YCWA 2B6GA 4KLUA 4X64L 9ICPA 1ZQ1C 4FZMA 1MGSA 5L9XA 2ZTEA 1FIQA 5HNKA 3PX0A 1RYSA 3C1EA 4J6HA 5CV6A 5KT4A 3E0JA 5DAUA 2YU9B 4JI4Q 2HHUA 1IW7C 1LO5D 1W6KA 1ZXTA 1NAPA 2XGPA 3NWSA 4AIMA 5IIMA 2VQEL 1DONA 4QZDA 1ZQJA 4K4GA 1ZD2P 2PFOA 4UAIA 3TAPA 4NLGA 5JEAG 3LWEA 3BS5A 4FZNA 3GIJA 3K57A 4DSIA 4PGYA 3QUQA 2KBNA 4RGNA 3J7A5 4A4IA 3TFRA 3FKIB 2K03A 4CDFC 1ZXIA 3QU7A 4ABNA 3ZI4A 3RN5A 3KF6A 2KOBA 4I28A 3BVZA 4DL4A 4O3PA 2P66A 7ICLA 4J9LA 5J2IA 4I29A 4RQ3A 4MFCA 1BXTA 3D6CA 3DV9A 4PJ0U 1HJPA 2HBMA 3FM9A 3R9KA 1TK8A 2EY1A 3KBXA 4DUZL 5T1IA 4XQNA 4TVAB 3MC1A 2QLTA 3R3OA 2KG5A 1WD1A 3S1RH 3T4AC 1Y1WH 4C3IG 3H40A 3LWLA 4GFJA 3A8JE 4G3IA 4G4KA 5TSSA 3ONNA 4Z6DA 1JI7A 4QZEA 4IJHA 1RYUA 2A1JB 2EIFA 5J0OA 1S40A 2O2LD 3NUCA 1PVPA 4UDUC 2AUKA 3KZXA 3I70A 2W11A 1WTPA 3P1HA 3OMGA 2RDFA 4A3IB 2NRVA 4KHPQ 5K36G 3ULJA 4EQNA 1TWFH 4JV5Q 3CCUA 4Q45A 4KLFA 2WACA 3W1BA 4EQPA 3VDYA 1JMCA 3IM1A 4KX5A 3EWAA 3OPOA 4IUNA 3T5HA 2LMCB 3A55A 3HWTA 3JPPA 4NLNA 3PO2H 3BJUA 3SD7A 4ECZA 3MFGA 1E22A 2MPMA 3N7PD 2TMPA 4HTHA 4I7ZC 5AI6A 2NTSA 3RN2A 5KT5A 3THVA 5CBEE 3KHRA 4TSSA 3GIIA 3DWAA 3Q8RB 3S16H 3PGZA 3PMFA 1ED1A 4DR1Q 3EVQA 4R8UB 3HOZG 1EY6A 1XSNA 5ALXA 2KCNA 3Q0AA 4J15A 4I27A 4OX9L 4F8MA 2IL8A 1STHA 4DFAA 2B2WA 1AE2A 4DXFA 2UXBL 5KFGA 3GTQB 1PK3A 4DEZA 2FI1A 2WF9A 2MAXA 1HZBA 4ZAIA 1Q1EA 4B3SQ 2BDPA 4BBSB 2FMCA 2BPFA 5IYDH 4A3BG 3TADC 1WD0A 1QE6A 3KFUA 2NN6G 1LV5A 2R3ZA 2ZJ8A 4QY7A 3HOYH 2A6HD 4BXXG 1U4BA 1L3UA 4IR9A 1COKA 1RODA 5ELEA 4HYKA 2UXCQ 1L7NA 4J9OA 3KLWA 4UPAA 4YD2A 4NLKA 1TWAB 2QEJC 1NR2A 4A3IH 3CPWA 5D4BA 3AN1A 1XXGA 3M3YH 3H0LB 1Q90A 3GDEA 2Z6KC 1ZKOA 3A54A 3KFUF 1MA7A 2D0PA 2FXQA 3NTIA 4E6IA 4PZOA 5D49A 2UUAL 3HOWG 3PO2G 4A93B 5J0QA 4Y2XA 2A74C 4M9JA 2QILA 1ZJNA 1ESRA 1KTQA 3UM9A 5IIOA 1IYJB 1SE3A 1Y88A 4QZCA 3AFQA 3QEBZ 3HKZF 5EAYA 4RUCA 1Z00A 4YCUA 4AYBB 3JAMi 1ZQOA 2HMXA 1R9TH 4YWMA 1SKWA 3IHQB 3S1RB 4ELTA 2XCAA 5IGGA 2R93H 3NPPA 1E3PA 1RM6C 2EPBA 9ICQA 4U68A 4WJ3M 3H7IA 5AKXA 4B9LA 4TKOB 1VQEA 4DR4Q 2ASDA 2K75A 2Z8LA 1URJA 5G3LD 5FJ8G 8ICXA 1VQ9A 3T13A 1N63A 3P20A 4RFBA 5ISRA 4F7XA 4F5PA 5JAVA 3WKCA 7ICMA 9ICTA 4YHHQ 4GXIA 1C4QA 2CQAA 4H0LC 4K8JA 3SR1A 3G6YA 4NM1A 5IYDG 4DFDA 1EYAA 2QB1A 2DQNB 5ALEA 2KJ5A 4US9A 3SYZA 4EX7A 3DEPA 2R8IA 1RQLA 4NXZA 3U50C 2LPEA 1K9MC 4PL2A 3HP3A 1X9WA 4AH6A 1NCVA 4EEYA 3SI8A 2QKIC 1IBMQ 1F9SA 2YYZA 5JUMA 3MWYW 1AH9A 3T56B 3ULPA 4C2MB 1T9HA 1QVCA 4NM2A 2D9UA 4DNTB 5GADC 4LF6L 1CHPD 3A0JA 1A6SA 1ENAA 5IGBA 1X40A 5KFWA 2WTFA 3T1HL 3PW0A 1LM0A
chains in the Genus database with same CATH topology
2OWOA 4OO1I 4LWCA 3D0FA 4LFAL 4BY7G 4LFAQ 3STBD 1MKHA 4A3JG 1PA6A 2JA5H 1Q46A 1Z47A 3KJOA 3UDFA 3EIVA 2UXCL 4PZ8A 1KQSA 4HJ5A 4DR7Q 1E24A 2R7FA 2MO0A 2RCNA 3A5ZB 2KHJA 4KHZA 4R4IA 1XMQL 4B3SL 3TRZA 4JI2Q 2HQLA 2CFMA 4A3LH 3L2PA 3PV0A 3DLLA 4HIDA 5AJ3Q 1BVSA 4A3BH 1GM5A 3S2DH 1SRUA 3PUYA 5M5WH 1D8LA 5C4JH 3UDXA 2ZM6Q 1K8GA 4B3TQ 3MXNB 3RLNA 1WYDA 4DR5L 4L5RC 2VUMH 4A3DH 1XPUA 2AKWB 1U5KA 2DGYA 5FLMG 4PG3A 4JBWA 4JI3L 2NN6I 1YHBA 3HKSA 4JV5L 3GTKH 1QVFA 1PH6A 1HNXL 3PUVA 1V1QA 1IBLL 3I7FA 3UDIA 4DR2Q 2E2IH 4LFCQ 2I5LX 5AJ3L 4LNQA 2A8VA 1K0RA 4DV0Q 3E9HA 3ZJYC 3GTJH 4DV1L 1DGSA 3W5OA 1VQNA 1JT8A 1QVGA 3AQQA 1SR3A 1YJNA 3J81c 5ELOA 3HOUG 3D31A 5IY0A 4A76A 2XGTA 3G48A 4MZ9A 5C44H 3BZKA 1Y1VG 2IY5B 2JJQA 1PH5A 3TREA 2PNHA 4H02A 1J5EL 3F2BA 2E5LL 4A3JH 1NE3A 1IBKL 4IJLA 2Y0SG 3KJPA 2Q2TA 1VQ8A 3HKZG 4DV2Q 1Y14B 1PH2A 4R4TA 4YY3Q 4LFBQ 4LFBL 1KD1C 1Q1BA 5IT9c 4QJFA 3K8AA 3RNUA 1KXLA 3ICEA 2E5LQ 1Q82C 4WJ4A 3EN2A 4LF7Q 1Z9FA 1N33Q 1X56A 2K5VA 5M3MG 2EQSA 4LUVA 4NB3A 1RL2A 3KDFB 4DK6C 2UXDQ 1KL9A 4O2DA 2VW9A 4DR3L 2I5MX 1WCMG 1YEZA 2JK8A 2ASBA 3I4MH 1VQFA 1QZGA 1PV4A 3CC4A 4LF5L 1AE3A 4A3EH 4JI8Q 4LF4Q 2PMZE 3FKIG 3PUWA 1HNXQ 4NPSA 4A3KH 1CSQA 1GVPA 4DV3L 1L0WA 4AQYQ 4NXMQ 1PH9A 2YU9H 2CCZA 2IHFA 4DV0L 3JAMc 2RHQB 2Q2UA 3GTMH 3HOUH 3KOJA 3PF4A 2JA5G 4JYAQ 1MJEA 4HJAA 3OW2A 4B3RL 1Q7YC 1TWAH 3CAMA 2CWPA 2QEXA 4DR1L 3GO5A 4C3IH 3S1MH 3DM3A 2C35B 2UUCQ 4GNXC 4JI4L 5JJIA 1Y1WG 5JJLA 3WWVA 4A3MH 3JC66 2ZM6L 2UUAQ 3OTOL 2MO1A 3J80i 3GTOH 1I50H 1C9OA 1YZ6A 3NELA 4A93H 5M5XH 1NJIC 2ATWA 2K50A 2UXDL 4GS3A 3M85A 1I5FA 3CC2A 3HOVH 3HOWH 1YHAA 2WAQE 2VUMG 4BBSH 1H95A 2WB1G 3AFPA 4B3ML 4A3CG 4B3MQ 1KIXA 1TWHH 1HR0W 1FJGL 1SFOH 4P75A 1XNQL 1WOCA 2ES2A 1Q81C 5C4XG 1VQ6A 2Q2IA 4B3RQ 4JBKA 4IPDA 1VQ4A 4GLXA 1L2FA 3TS0A 3HOXH 5LMNL 1HZ9A 2ZJRA 4A93G 1EUJA 1VQIA 4A75A 4X66Q 2LXJA 4GLAC 4X62L 1IBML 1ASYA 2F4VQ 3HOVG 4JBMA 2BH2A 4DR6Q 1FVIA 1TXYA 1SE8A 2AHOB 1Y1VH 2UUBL 3S1QH 2N3SA 2EXDA 1XMQQ 5IE8A 4PZ6A 2ZTCA 3ERSX 1QZHA 1Q12A 1UWVA 2Z0SA 3K7UC 4DR3Q 2I0QA 2K4KA 2F3IA 3HOXG 4OWWB 1V9PA 3KF8B 5HGQA 4HJ9A 2KENA 2YTXA 3W1GA 1LTLA 1XNRQ 4HIOA 2AMCB 3M4PA 2QA4A 4JOIC 5JEAJ 3MEFA 3J7ZC 1X6OA 2CWAA 5IWAL 2MNAA 4LF6Q 5M3FG 1PYBA 1GD7A 4RMFA 2D0OA 4AYBG 5GAGC 2AWOA 4P74A 3BU2A 4DNIA 1NTGA 2GVAA 4DR4L 1HR0Q 4A3CH 2ALYB 2JA6G 4GN4B 4DR5Q 5LMUQ 2OQ0A 1I6HH 5LMUL 4LW1A 3CF5A 3S2HH 1VQJA 1CKNB 4P71A 4DAMA 1UE5A 5C3EG 4BY7H 1D7QA 1VQHA 2JEAI 4X6AH 1I3QH 1C7YA 2K14A 4A3IG 4YWKA 1YVCA 2OCEA 4AYBE 2VQFL 1EOVA 1O7IA 3B6YA 1G51A 3FKIH 3J81i 1LYLA 4PMWA 1P8LA 3U4VA 1YHQA 4DV6Q 1YI2A 1M90C 2BA0A 3NENA 2JEBI 2JA7G 1FL0A 1VQOA 3KF6B 5ELNA 3S14H 5IP9G 3NEMA 2GN5A 1VQCA 1KAWA 3GTLH 1IBLQ 4IOAA 1CUKA 1Q8KA 2NVYH 4GNXA 1KC8C 3J81j 4GOPB 3M4OH 1TWGH 3U58A 1VQGA 4DV1Q 1HNZL 2JQOA 5C3EH 3T1YQ 1RIPA 3NBHB 3J80c 2YTVA 3I4MG 2N8NA 3TEHB 1EIYB 4HJ7A 2JA7H 1YNXA 1ASZA 1SROA 4JI0Q 4BY1G 2UU9Q 2I5HA 4R4OA 2Z6KA 3ER0A 4LF9Q 2PI2A 3S1NH 4JYAL 4XIGS 2QGQA 5IP9H 4DV7L 4HJ8A 3CCEA 1YIJA 1X3FA 1XMOL 1PH4A 1N9WA 4R1JA 4JI6Q 4GOPC 2IX0A 3T1YL 3S15H 4X64Q 3FP9A 3K0XA 2B3GA 2JE6I 2VY3A 1EQRA 1UE1A 2VL6A 4DV3Q 4JBJA 4YHHL 1UE7A 4AQYL 4A3FH 4MNOA 4OWTB 3CCMA 2N49A 4A3LG 4K0KQ 4IPHA 3KDFA 4K0KL 4APVA 2R92H 3ULLA 4DUYL 2WB1E 1WJJA 2WP8J 2JA8G 2GVBA 1NY4A 3CPFA 3E0EA 4QIWE 4R4CA 4NXNQ 3CD6A 4A3GG 5IYBH 4LF7L 2UUCL 3RLFA 3HKZE 4LF9L 1JJGA 2UU9L 4Y52H 1IXRA 3RR5A 1EIFA 3TQYA 2E2JH 2UXBQ 1NMGA 3KYHC 4YWLA 4C2MH 2NVQH 1WI5A 4DPGA 1A8VA 1VCIA 2RF4A 3F1ZA 5M5YH 1CKNA 2IHEA 2R92G 4NXML 2K5NA 1PH7A 1EFWA 1UEBA 5C44G 1NMFA 3F8TA 1KHIA 3CCSA 1YBYA 1HH2P 4GKJQ 3M4QA 3AYHB 2A19A 3F2DA 1TWCH 1J6QA 2MQHA 1SLJA 4P73A 1VQDA 4IFDG 5HY6A 2VNUD 4X65L 4DUZQ 4LF8Q 4Y7NH 3S24A 1N33L 4HIMA 1X3EA 4X62Q 2WFWA 2PQAB 2VQFQ 2ZJPA 3CCJA 1N32Q 1G6PA 4LUZA 1OXTA 1VQKA 2E8GA 1X54A 5C0XG 1EWIA 1VQLA 3CC7A 4JCVE 1JJCB 4NXNL 1M1KC 3I4OA 1PFSA 2HIXA 2Y0SE 3G71A 2CQOA 3PUZA 4IPGA 1XJVA 2R7ZG 1IBKQ 1JE5A 3UE1A 5FLXc 5M3FH 4BBSG 1XNQQ 4QQBX 4OO1G 1X55A 2H5XA 3TS2A 1NBWA 3H0GH 5GAEC 1W3SA 3A74A 4DV5Q 1WCMH 3F2CA 1U0LA 3I4NH 1JJ2A 4QL5A 1S3OA 1KRTA 1X3GA 1HZCA 3I2ZA 5C4XH 3I55A 2HHHQ 2ID0A 3PUXA 4A3GH 1FJGQ 2Q2HA 2VS1A 4IFDJ 4MTNA 5H1SE 5IP7G 5BR8L 1UE6A 1N34Q 3GTQH 4YCVA 2MFIA 5LMNW 1E1OA 4YCWA 2R6GA 4X64L 3PIOA 3UDGA 1PH1A 2HHHL 1L1OB 2RHSB 1EYGA 4UY8C 3H3VH 1VQ5A 4IO9A 3T1HQ 2ZTEA 1G291 1IL2A 4BXXH 2R93G 3AEVA 2R7DA 3G6EA 4JG2A 4ME3A 3CCVA 3RZDH 4JI4Q 4X66L 4DV7Q 4GKKL 2A1AA 1HR0L 2EDUA 2JA9A 2OTJA 4A3FG 4AIMA 5GROA 3G4SA 1XPRA 1PH3A 2F52A 2VQEL 4POFA 2OTLA 1OXVA 4GN3B 4LUOA 1GO3E 5JEAG 4UP9A 4DK3C 3GTPH 2V1CC 4QGUA 3A5UA 2CKZB 5IP7H 2KBNA 1VS0A 2NZOA 3UE0A 3J7A5 4A3KG 1V43A 4A4IA 3PF5A 4DV4Q 2KHIA 3L0OA 4JI2L 4BY1H 1SMXA 1N32L 5IYBG 3RN5A 3KF6A 3L7ZC 2VZAA 4GKJL 4JI1L 2BH8A 1W2BA 4JI1Q 3CCLA 1Q86C 1I94Q 1HJPA 4BA1I 4DUZL 3IRBA 4DKAC 1X9NA 4LF8L 4TVAB 4GNXB 3S1RH 1Y1WH 2NZHA 5M3MH 3CMEA 4YY3L 3I4NG 1K8AC 3CCQA 2PQAA 1QUQB 4JI7L 4IJHA 4JI5Q 1HNWQ 2EIFA 1S40A 1A63A 1HZAA 5FJ8H 3S17H 4UP7A 1OXUA 5GQOA 1EQQA 3HOYG 3H3VI 4KHPQ 5K36G 3EBEA 3ULJA 5C0XJ 2KCTA 1N36Q 1TWFH 2K52A 3CCUA 1XPOA 3W1BA 3PO3H 4JV5Q 1JMCA 4DUYQ 3VDYA 1OTCA 1HNWL 3HFZB 4BBRH 2B63G 2PI2E 1FGUA 3K81C 4LF5Q 1XNRL 3GTGH 3PO2H 3BJUA 1WFQA 4BA2I 1OXSC 1XTDA 2XTIA 1E22A 3SGIA 2WAQG 3M7NA 2R7ZH 4C3JH 3RN2A 1B70B 3FHWA 4DAYB 4GLVB 3RLOA 4OXPA 1SN8A 4JC0A 4EX5A 2NVTH 4A3DG 2JA6H 5IYCG 4IPCA 1X65A 2K5HA 3S16H 3PSIA 3PGZA 1PHJA 4DR1Q 2DUDA 2UUBQ 3HOZG 1GKHA 3K7AH 1L1OA 3CP0A 2ZJQA 4J15A 3Q8DA 4DR2L 4OX9L 3CXCA 2NVXH 1AE2A 2UXBL 3PIPA 2VQEQ 1K3RA 1VQAA 3PCOB 1S72A 1YJ9A 1BBWA 3I56A 2YTYA 3GD7A 1E7ZA 1HZBA 4B3SQ 1Q1EA 2IT1A 3CW2C 4L5TA 5IYDH 4A3BG 4OX9Q 1CSPA 1PVOA 1KRSA 3E9IA 3KFUA 2NN6G 3CMAA 5GAHC 1HNZQ 3CQZH 4QY7A 3U4ZA 3H15A 1VQ7A 2JA8H 3HOYH 4BXXG 5BR8Q 3HOZH 4DV5L 4DV6L 1OXXK 1CKMA 2UXCQ 3H0GG 2AWNA 5FLMH 3KLWA 4UPAA 4L5SA 5C0XI 4C3HH 2LXKA 4HIKA 4A3IH 2BA1A 3BZCA 3CPWA 2KCMA 3RZOH 2IX1A 2D62A 3K80C 3LGJA 3M3YH 2B29A 4LFCL 1K83H 4R4QA 3GDEA 2Z6KC 3OTOQ 1VQMA 2UUAL 4KLKA 2D0PA 2FXQA 3HOWG 4JI6L 3PO2G 5JJKA 1JB7A 1XMOQ 2LSSA 1A62A 3AFQA 1IYJB 4GOPA 1YITA 4IOCA 1QUQA 4FDBA 5EAYA 4JI3Q 4YCUA 3JAMi 2YV5A 4IFDI 4JOIA 1PH8A 1R9TH 4YWMA 4KHPL 1YJWA