2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
b'EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1531
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
2BA1A 4XIGS 1X56A 4HIOA 2KCTA 3U4ZA 3W5OA 1EYGA 1H95A 5C4JH 5JJKA 2BH2A 1N36Q 4DK3C 4BY7H 1NTGA 1J6QA 4DR5Q 4YCVA 2N3SA 1Z47A 2D0OA 4JBKA 4LF7L 4JI6L 5AJ3L 4JI3Q 4A3MH 2ES2A 5ELOA 1Q7YC 1M90C 3PO2G 1U0LA 1B70B 3CCEA 1XPRA 4OWTB 4DV2L 4B3ML 3HOWH 4BXXH 1L2FA 2IHEA 4DR4L 4FDBA 5FLMG 4A3BH 1IL2A 1MJEA 1KHIA 4X66L 3EN2A 3RZDH 1Y1VG 3RLFA 4JI4Q 2KHJA 1OXVA 3EBEA 4L5QA 3PIOA 3UDGA 3PF5A 4C2MH 4BBSH 1PH6A 3GTJH 5H1SE 4JYAQ 1P16A 4LF9L 3FKIH 1I3QH 2VQEL 1X55A 4A93G 4Y52H 5JJIA 1UEBA 1Q12A 1K8GA 1FJGQ 2I5HA 1DGSA 4WJ4A 2PNHA 4ALPA 3G48A 1Y1WH 1V1QA 4AQYL 1XPUA 2R7FA 5M3FG 2HT1A 4MZ9A 3L7ZC 3CCMA 1PH1A 5M5XH 3S16H 5C4XH 4KLKA 1S72A 2MQHA 3CC7A 4YY3Q 3I55A 4RG1A 2Q2TA 2WFWA 4A3GG 4LUVA 3ULLA 1I94Q 3BZKA 4EQ5A 3U50C 3CC4A 4JBMA 4P71A 1Y14B 2NZHA 1KL9A 4P72A 4X64Q 1TWCH 4BY1G 2UU9Q 2V1CC 1XJVA 1N36L 4OO1I 1TXYA 4UY8C 1YIJA 1A0IA 1SE8A 3RN2A 2IX1A 4DR5L 4A4IA 1P8LA 1CUKA 1TWGH 3I2ZA 4GS3A 3S14H 4Y7NH 3KYHC 2JJQA 3KF6A 5E7NA 4DAMA 1PH4A 4JI3L 4NB3A 1WYDA 2JA9A 5C3EG 2C35B 2CWPA 4JG2A 3M4PA 1KRTA 3K81C 3OYYA 1YITA 3NBHB 3IRBA 3UDFA 1OTCA 4A3IH 4JI4L 4IOCA 4A3FG 2JA8G 3PGZA 2ZTDA 3K80C 2YTVA 3H3VH 4DR7L 3FP9A 1L0WA 3CXCA 1VCIA 4DAYB 4B3RQ 1NJIC 1YBYA 4LF4L 3M7NA 4L5RC 4JYAL 2GVBA 2A1AA 3DM3A 3PCOB 4LUOA 3G6EA 3CCJA 4DR2Q 1FJGL 1N9WA 4IO9A 4JI7Q 4RMFA 3SGIA 3HOUG 1PV4A 4LFBQ 4YCUA 1C9OA 1CKMA 1KIXA 1HZCA 2UXDQ 1JE5A 1K0RA 1TWHH 3F2CA 1LYLA 1S3OA 3PO2H 2VZAA 1HZAA 1LTLA 1B8AA 3I4OA 4R4TA 3A74A 2K4KA 4YY3L 5FLXc 1MKHA 4DV0Q 1AE2A 3HOVG 5IP9H 1XMQL 4IFDI 4B3MQ 5IYDG 1I94L 1AH9A 5FLMH 1VQLA 2OQKA 1VQFA 1VQ4A 4IJLA 3M9BA 4LFCQ 4P74A 1K8AC 4R4IA 4X64L 1XPOA 4A3CH 2QEXA 2UUCQ 2UU9L 1VQ5A 5M3MG 3PF4A 2ZJRA 4DK6C 3PO3G 4JC0A 2K50A 3PUWA 4IPHA 3CF5A 2LXKA 2JE6I 1LUZA 4GN5A 1IBKQ 1ASZA 1KXLA 3PIPA 1HNZQ 4A93H 1NMGA 4PZ6A 3HOYH 3NEMA 1GM5A 2E5LQ 1KC8C 5EAYA 3HFZB 3CCRA 3VDYA 1D7QA 4JI0Q 1FL0A 4R1JA 3KDFA 1HZ9A 1NMFA 4A3DH 2IHFA 5M3FH 3UE1A 1JMCA 1VQHA 1QUQA 3GTGH 3JC66 1JT8A 1UE1A 2NVYH 1VQNA 1PH9A 2ZJQA 3M85A 1K83H 5IYCG 4IFDJ 3J7A5 2EIFA 3T1YQ 4A3LG 4L5SA 1X3FA 4B3RL 2ASBA 3HOZG 2VUMG 1C0AA 3J80i 4O0AA 5ELNA 1M1KC 2LSSA 1L1OB 4DR2L 2JEAI 5LMNW 2ZM6Q 4JI7L 1WCMG 3ER0A 4LFBL 1X54A 2UXBQ 1O7IA 4GNXC 2UXDL 4TQUS 1BBWA 4AYBE 1TWAH 1YJ9A 1YHQA 3RLNA 3GTPH 4AYBG 2A19A 5GROA 4X6AH 2PQAA 5C3EH 3KF6B 4DV0L 1OXXK 2EXDA 1BVSA 4JI1Q 4IOAA 3CMEA 3RLOA 4DKAC 1GO3E 2CKZB 3I7FA 1A62A 1SLJA 1YHAA 4LFCL 5LMNQ 5HGQA 2CQOA 1HH2P 2HIXA 1Q1EA 2UUCL 3W1BA 1GD7A 5C0XI 1I6HH 4DR7Q 2JQOA 4C3JH 2AKWB 3S2HH 2ZTCA 4JI8Q 1SFOH 1IBKL 1EFWA 4LF4Q 2NZOA 1SRUA 2QA4A 1HNZL 5GADC 4DPGA 3HOXH 4OXPA 4TVAB 2CCZA 1GVPA 4JCVE 4BA1I 4C3IH 2E5LL 1VQ8A 5C44H 1EIFA 1IBMQ 4JI0L 3TS2A 4OWXB 2HHHQ 3AQQA 2VQFQ 4A3EH 3GTMH 2XGTA 1X3GA 3KJPA 1G6PA 5C0XG 2I5MX 4X65Q 2JA6H 1UWVA 5JEAG 4A3KG 2F52A 3HOVH 1WI5A 4GOPB 3ULPA 1N8RC 1VQAA 5IYDH 1CKNB 1EUJA 3HKSA 2KENA 3PUZA 1HZBA 4KHZA 4QJFA 3ULJA 3CCUA 3Q8DA 1XMQQ 1VQ6A 3T1YL 5IY0A 2PMZE 3GTQH 3GTLH 3S1NH 2AWOA 2E2IH 1Q1BA 3TEHB 3I56A 2VW9A 3CCSA 2JEBI 5GAEC 1PH5A 2R92G 4OONA 3J80c 1D8LA 5JEAJ 3STBC 4BBRG 2ZM6L 3CD6A 1QZHA 1XTDA 1UE6A 4HJAA 1W2BA 2E2JH 3T1HL 5LMUQ 2UXBL 2UUAQ 3I4NH 1KAWA 5IT9c 2ZJPA 2VY3A 3KOJA 2MO1A 2WP8J 2B63G 1XNRQ 1VQCA 3S1MH 1EQQA 2AHOB 4JI1L 4QGUA 3L0OA 2CWAA 2JA5H 1A63A 4A75A 2YV5A 2KHIA 1E1OA 4POFA 3J81j 2N49A 5IYCH 1QVGA 5LMNL 4LF8L 4A76A 3A0JA 4LFAQ 4POGA 1VQBA 4IJHA 1QVFA 2AMCB 2EQSA 3E9HA 1B7YB 1KQSA 4GN4B 5GAGC 3H15A 4YWLA 4QL5A 4JI8L 3HOZH 2IY5B 2R93G 1VQMA 2VUMH 4BY7G 1YNXA 3PUYA 2A8VA 2ATWA 1PVOA 4R4CA 2MO0A 5K36G 1VQ9A 3I4MG 1JJGA 2GVAA 1IBML 2HHHL 4KHPQ 2VQFL 1NE3A 1V9PA 4GKKQ 2UXCL 1A8VA 4YHHQ 2CFMA 1N34Q 4DR1Q 4X65L 4PMWA 1K3RA 4A3JG 1T9HA 1WJJA 4DV5Q 4MNOA 3B6YA 3KLWA 1IXRA 4GLVB 4DR3Q 1EOVA 1HJPA 3E9IA 1YEZA 1NBWA 3ZJYC 4C3HH 2F4VQ 2K5NA 5FJ8G 2FXQA 1PHJA 3K7AH 1YVCA 2JA7G 1Y1VH 3CPFA 1X65A 4DR6L 1IZ6A 3TRZA 2D62A 5JJLA 1RL2A 1E22A 3A5ZB 2RHQB 3AFPA 5LMUL 4GNXA 2OCEA 1OXTA 2WB1E 3CCQA 2UUAL 2WB1G 3JAMi 2K5VA 3CQZH 3LGJA 5HY6A 1EIYB 4HJ8A 1XNRL 2YTXA 3GDEA 3U58A 4K0KQ 4LUZA 2I5LX 1VS0A 2NVQH 2UUBQ 1X9NA 2E2HH 3L2PA 3CPWA 2Q2HA 4DUYQ 4HIMA 3RN5A 1TWFH 4GN3B 1U5KA 1VQEA 4PG3A 4A3GH 4LFAL 2LXJA 5BR8Q 2NVTH 1VQIA 3PV0A 4QIWE 4GLAC 2QGQA 3G71A 5DLQE 3KJOA 1PYSB 2KCMA 2R92H 2JK8A 4BY1H 4H02A 4BBRH 1SN8A 2R6GA 1IBLQ 4OX9Q 5M5WH 1G51A 5M5YH 3H3VI 3NELA 4KHPL 5IYBG 3T1HQ 4GKKL 4YHHL 1N34L 4DR1L 2B3GA 3HKZE 1X3EA 4L5TA 3OTOQ 2Y0SE 4AH6A 2R7ZG 3HKZG 1W3SA 4DV5L 4B3TQ 2Y0SG 1RIPA 1SMXA 4NXMQ 4DR3L 3UE0A 1KD1C 1V43A 1JB7A 3F8TA 1WOCA 1QZGA 4LF6Q 4LF5Q 1UE5A 3MXNB 3OW2A 4A3IG 4LNQA 2F4VL 1N33Q 1BBUA 1GKHA 2YTYA 2R7DA 4UP9A 3W1GA 2JA8H 2PI2A 3PSIA 4A3FH 4P73A 4LF8Q 1PH8A 2XTIA 2H5XA 3U4VA 4LW1A 1EQRA 3M4OH 2YYZA 2R93H 3GO5A 3M4QA 1PA6A 4DV4Q 1YHBA 4IPGA 3TREA 2VNUD 2DGYA 2F3IA 3GTKH 3I4MH 3HOUH 3JAMc 3S24A 3GTOH 1IYJB 3EIVA 4DV1L 1VQPA 4K0KL 2UXCQ 4LWCA 2HIVA 4MTNA 2VS1A 4R4OA 4AIMA 4A3JH 2ALYB 1ASYA 2UUBL 5IP9G 1KRSA 3CCVA 1J5EQ 4ME3A 2K52A 2Z6KA 3DLLA 2ID0A 4DUYL 4DV3L 1HNXQ 3ICEA 3S17H 1UE7A 3KFUA 4GKJQ 1G291 5IWAQ 5BR8L 5FJ8H 4A3CG 2MFIA 2K14A 1SR3A 2ZTEA 2JA7H 3S2DH 3K7UC 3BZCA 3KF8B 2K75A 2BH8A 1PH2A 1E7ZA 2N8NA 5C0XJ 2OTLA 4QY7A 4DR6Q 1I5FA 5M3MH 1IBLL 4OX9L 3PO3H 1LM0A 3HOYG 4JV5Q 4NXNQ 3AYHB 2L15A 2B29A 3H0GG 4A3DG 2RCNA 3OTOL 4GNXB 4B3TL 3GD7A 1N32Q 4HJ9A 4NXML 3PUVA 2AWNA 5IP7G 1HR0W 2N78A 1BKBA 4JI5Q 4LF6L 1WFQA 3G4SA 4LF5L 3KDFB 2WAQE 1Q86C 1N33L 2OQ0A 2WAQG 4WJ3M 1S40A 1QUQB 2Z6KC 3CW2C 3ERSX 1L1OA 1VQDA 2Q2IA 3D0FA 1MIUA 1E3PA 2D0PA 1AE3A 1PFSA 4A3LH 2NN6I 2I0QA 4YWKA 1JJCB 1FVIA 3CAMA 4DV4L 4JOIA 1K9MC 4UP8A 3CC2A 1HR0Q 1VQGA 2RHSB 4DUZQ 4JI2Q 2KBNA 4GLXA 1Q81C 3S1QH 1WCMH 4JBWA 1YZ6A 4O2DA 5GQOA 2OWOA 5IYBH 3F1ZA 1OXSC 3TS0A 1CKOA 1XNQQ 1CSQA 4A3MG 4HJ5A 2EDUA 1E24A 1VQ7A 2R7ZH 4OO1G 1J5EL 4DV7Q 4DV6Q 1NY4A 2NN6G 1Q82C 3HOWG 4BXXG 3RR5A 1XMOQ 1HNXL 4B3SQ 4GKJL 4A3BG 3E0EA 4HJ7A 4X62Q 5IWAL 3F2BA 3J81i 3J7ZC 1JJ2A 2PQAB 1HNWQ 1Q8KA 2E8GA 1YJWA 2BA0A 4APVA 4BBSG 1FGUA 3M3YH 3AFQA 1OXUA 1L1OC 3BJUA 5J3BA 1PH3A 2MNAA 3FKIG 3HOXG 1PH7A 1PYBA 4IPDA 4NXNL 4IPCA 4DNIA 3A5UA 5C44G 4JV5L 3CP0A 4J15A 1QVCA 4A3EG 4JOIC 2Z0SA 3WWVA 1Y1WG 4LF7Q 4JI6Q 4KI0A 4GOPA 5AJ3Q 4UPAA 1N32L 1CKNA 2JA6G 4YWMA 3PUXA 4QQBX 4DV1Q 4JI5L 4P75A 1Q46A 4PZ7A 2VL6A 3RZOH 3S15H 1K73C 5C4XG 4YCWA 4DV2Q 1SROA 3MEFA 4DR4Q 4A3KH 2NVXH 5IE8A 4DV3Q 4X66Q 4NPSA 3CMAA 2IX0A 2K5HA 2HQLA 3S1RH 5GAHC 3D31A 4PZ8A 2RF4A 3BU2A 2IT1A 1X6OA 2OTJA 4IFDG 4R4QA 2Q2UA 4UP7A 1C7YA 4LF9Q 1R9TH 2VQEQ 1HR0L 4DUZL 4JI2L 1E1TA 3K0XA 3FHWA 4XTCS 3STBD 3I4NG 3TQYA 3UDIA 1YI2A 4BA2I 2YU9H 2DUDA 1XNQL 3F2DA 3H0GH 1Z9FA 4EX5A 2GN5A 3AEVA 1CSPA 4HIDA 4AQYQ 1VQKA 2B63H 4DV7L 4DV6L 1VQOA 1YJNA 2JA5G 5IP7H 1VQJA 4GOPC 3NENA 2PI2E 1XMOL 3CCLA 3K8AA 4B3SL 3UDXA 4HIKA 4OWWB 4X62L 3RNUA 1MJCA 1HNWL 4JBJA 1I50H 3J81c 1EWIA
chains in the Genus database with same CATH superfamily
5KFRA 1P7DA 2EANA 4RQ5A 4XIGS 3X3NA 1L7MA 4BXOA 3U4ZA 3W5OA 3GTGB 3EPIA 3H0RB 5JUMA 3SAGA 2BH2A 4DNTB 2IOFA 5G5GA 2NRXA 3PSTA 5AM3A 1LTSD 3TP5A 4J9MA 1B50A 2K6AA 5KFEA 3SR1A 3RB6A 4F72A 5CB1A 3E3XA 4LF7L 2F3NA 4FFDA 3TFSA 4NLGA 2HHQA 4BY1B 3SMVA 2P5ZX 4A3MH 2BKEA 1ML0D 4I2AA 2XVSA 3PO2G 3VYSA 2KE7A 8ICSA 3UM9A 1EYCA 5M5YB 1KN5A 4LJXA 3PIO3 3ONNA 5J0SA 4GC7A 2WB1C 3PX4A 2IHEA 4NDXA 1KLGD 4RT3A 4HAIA 2Q0ZX 3VR2A 5ALHA 1Y69U 4DOCA 1KHIA 3EN2A 4X66L 3RZDH 4FZMA 5A2QE 3D4DA 4G4KA 1TR5A 3EBEA 2F77X 2WAQF 2XCAA 4M9JA 1H9SA 4BBSH 1ZOLA 2VJ4A 3QUTA 3G6XA 2CVRA 4QWDA 5KAIU 5KNCA 1PH6A 5H1SE 3AMUA 5I6YA 1P16A 4LF9L 4NJ8A 3FKIH 2W11A 1X55A 4O3MA 3ERQA 3O0FA 1TS5A 4NMZA 1L0YB 1UEBA 2JA8B 8ICHA 1HTLD 3GV3A 1L8LA 2EVBA 2ALZA 2PNHA 3S2HB 1EL0A 1V1QA 1XPUA 4I7AA 4U7CA 1ZQFA 1X9SA 3L7ZC 1UA0A 1ET9A 4CKBA 3CCMA 1PH1A 2BPGA 1T5EA 5C4XH 2RSNA 1LT5D 3NVVA 1STGA 4YY3Q 2WFWA 1NK0A 3MXPA 3I55A 5KFCA 1ENCA 3BZKA 1S5BD 3U50C 3MAQA 4JBMA 1Y14B 4YQWA 2KSOB 2Y9TA 4FE3A 5J0QA 1HA5A 1KL9A 1UNSA 4P72A 2EPBA 2ZUDA 4X64Q 3N7RC 1TWCH 5DB9A 2AU0A 1BCPD 1PFNA 1TXYA 2ASDA 1SE8A 3VYRA 3RN2A 1P8LA 4DOBA 1S0OA 5CHGA 3E5SA 1J97A 2KEYA 5AI4A 1MI2A 4Y7NH 3D2QA 2GOLA 3S1NB 5KG6A 2JJQA 2LYHA 1JCKB 3ITPA 4ELUA 4JI3L 4UAUA 2JA9A 5GTIU 3K5NA 1DD2A 2CWPA 2A5HA 4ECUA 3M4PA 3KD3A 2NYZD 1E2ZA 2DY8A 4UAZA 2X6GA 3UDFA 2XN9C 1X6IA 4A3FG 4JI4L 2KG5A 1GXDC 1SJHD 3H3VH 1JWMD 2KNJA 4MF8A 4DAYB 4U673 4B3RQ 4RKBA 1YBYA 2RLTA 1CA5A 1QE6A 3GQCA 2YB1A 2P6UA 3DM3A 4LUOA 3CCJA 4DR2Q 4CF4A 2MUTB 1BXTA 3WKBA 3SGIA 3HOUG 1SYEA 1C9OA 3FDSA 1KIXA 1HZCA 2UXDQ 3RBDA 2NB0A 4BGDA 1BPEA 2ZXOA 5D3DA 2VUMB 2YMLA 1RTNA 2H3VA 1PZKD 3IV6A 4QZHA 1HZAA 1LTLA 5FLXc 2IOHA 2BCQA 2K4KA 1H38A 3C28A 3SYZA 5KG3A 5IYDG 1I94L 4G9BA 1RZTA 1TVAA 5HURA 3D6CA 4Y2UA 3ISDA 3AB9A 1K8AC 3MGHA 3A8KE 1PXUA 2PFPA 4DL7A 2UU9L 4YG2A 4PGXA 3MDAA 3PO3G 3PUWA 3A7AB 3Q8MA 2FHTA 2AGPA 4M2YA 3NQIA 3OWFA 2KIWA 4C3HB 1ASZA 4CJ2C 4PZ6A 4CNQA 4RH6A 5EAYA 3VDYA 5KG7A 3KDFA 4FVMA 5JOBA 2ZUCA 1LV5A 5KFYA 5DAUA 4WFN3 4DL2A 3GTGH 1BPXA 4OD0A 1PH9A 2ZJQA 3WK4A 5ALYA 5J0RA 4OHJA 1ZQWA 1JXEA 4Z6DA 8ICWA 1MHWC 1U45A 5IIOA 2KCNA 2NO4A 1X3FA 4JVZA 5FK9C 3UMCA 3TBIB 2ASBA 2E2HB 5ALGA 3OGUA 1C0AA 1QSYA 5ALUA 2LFNA 1TWFB 2LSSA 2X6LA 5I2XA 5LMNW 1XWLA 5A0LA 1WCMG 5L1MA 2NVTB 5ALFA 3H8MA 4LFBL 4BUGA 1Y8OB 1SXDA 1X54A 3TAQA 4GNXC 4DFPA 5AKIA 4DSFA 1YHQA 4IC9A 3RLNA 2A19A 3PW4A 4BBRB 2PQAA 1WTXA 4DV0L 2DGZA 1BVSA 2E8PA 5EPLA 1UT5A 2NRVA 3C1ZA 4DKAC 2OF1A 4HMJA 5J0PA 4LFCL 5BOLA 4P4OA 1HH2P 3M6KA 1SE4A 1SIJA 3M6ZA 5C0XI 3S2HH 2ZIXB 1EFID 4GXJA 2NZOA 2QA4A 1HNZL 4DPGA 4TURA 2W9BB 1NKBA 2B8FA 4JB3A 1L7OA 4RGOS 4RQ1A 4EQPA 2I1QA 2KVMA 5EE1A 2HSZA 4L63B 4CHTB 1TKWB 4PHAA 4PGQA 1QILA 3RAXA 4OWXB 3M4OB 4KTAA 1G6PA 2R93B 4DL5A 5J8YC 5EQ0A 1MSWD 1ZD4A 3UXNA 1UWVA 4DFKA 5KFSA 4J9KA 3QO2A 1K0SA 5IIMA 2F03A 2F52A 3FM9A 2AH5A 2JH7A 1BCPF 1CKNB 3HKSA 2KENA 4QW8A 3WK7A 1HZBA 4QJFA 3G6YA 1B4OA 4I2FA 3T1YL 1VQ6A 4DFJA 2EAPA 4PQXA 3UMBA 3C5GA 2PMZE 1KNAA 1L3UA 4MF2A 2AWOA 2WV6D 4RGTA 3KKAC 4EBCA 4A3JB 3S1NH 4ECTA 4C7ZA 1PH5A 2R92G 8ICCA 2VJ5A 3C1FA 5BN3A 4TSSA 3H6MA 1D8LA 3STBC 3CD6A 1QZHA 4RKLA 4J8QA 2F0KA 2YX8A 7ICVA 4M9LA 1ZQUA 2WKDA 1KAWA 2ZJPA 2VY3A 2WP8J 3FMCA 5AI0A 1XNRQ 3JPSA 3NWSA 1QCBD 2WF5A 4RWSC 1EQQA 4QGUA 4JI1L 1IKMA 3L0OA 2CWAA 4CJ0B 1T3QA 2WB1B 1EY7A 4NW2A 3MA2B 4CRXA 4K2LA 5I9PA 4LF8L 4A76A 4OJ6A 3KHHA 4LFAQ 4IJHA 5DDMA 5CYUA 2AMCB 1KQSA 4JI8L 2HCIA 4Q8EA 3TZUA 1VQMA 3OIQA 2VUMH 1YNXA 4P4MA 1G6ZA 2D2CC 1A2UA 5DEHA 4DGZA 4QW9A 5K36G 4ZCKA 1JJGA 1IBML 5AKLA 2HHHL 1V9PA 2R61A 1IV8A 4V0BA 4YHHQ 2CFMA 1N34Q 2UXCL 3RRHA 4X65L 4PMWA 1TWGB 3FAHA 1F9PA 3P7JA 4R8IA 4XQ8A 4MNOA 1WTHA 2E1FA 1IXRA 4NL9A 1EOVA 1ENAA 4IUPA 1NBWA 3T5KA 3OPOA 4K8IA 4C3HH 4C4SA 3A8IE 5AICA 4MIUA 3ED5A 1V97A 4LZDA 4O5CA 1LTRD 1YVCA 1QLNA 1WTPA 3OMGA 4C80A 3BYTB 1XWEA 3V7KA 3BQ1A 1PRTF 5KFXA 5DM63 1Q90A 2D62A 4BWGB 2D8CA 4DS5A 1K3BC 4CDDC 3WOFA 1XX8A 5LMUL 3D2SA 1HUNA 4YMNA 1OXTA 4P0QB 2IJ0A 5IGBA 3KHGA 4KKSA 4X3UA 2UUAL 3JAMi 3NUQA 1DCZA 5AI5A 4F4XA 1HQRD 1X40A 1T3NA 1ZJMA 2B21A 5BPCA 3PSPA 1D9FA 4LUZA 2WHEA 3RTVA 2E2HH 2F76X 5JVH3 4ED2A 5L1JA 2Q2HA 1TAUA 3RN5A 3KFUF 1TWFH 4GN3B 1U5KA 2FI1A 3T56B 4USAA 4A3GH 9ICTA 3VR6A 3PO4A 2NVTH 3PV0A 1JALA 4I2BA 2FLNA 3GV8B 1JOOA 1DGJA 2HBMA 1PYSB 4YD1A 8ICFA 5DBAA 1A2TA 3H09A 4B9NA 2A6HC 4H02A 4XT3B 1L3SA 1KNEA 1SN8A 4BBRH 1IBLQ 4OX9Q 1KABA 8ICTA 2JYOA 5JPMC 3NELA 1AQ6A 2J7ZA 3CP8A 4ED3A 2A6EC 9ICPA 4GKKL 2DKXA 2EAOA 3TARA 4L5TA 2HVHA 2Y0SE 1LTGD 2DUYA 1XSPA 2KZZA 1W3SA 3HKZG 1RIPA 5B66U 4C8KA 3KHRA 4B9MA 2ZUBA 1KD1C 3F8TA 4XQNA 4LF6Q 2LKVA 1S5LU 1YZ7A 8ICRA 2BDUA 3MXNB 4A3IG 2F4VL 3CHBD 5IGEA 2LPEA 2BQ3A 1BBUA 2B2UA 2KEEA 3W1GA 2ZIWB 4F4WA 1H9MA 4LF8Q 1EZ8A 2H5XA 3G7LA 3IG8A 4PV1C 1IM4A 1EQRA 3M4OH 2R93H 3GO5A 5COYA 4PPXA 1H9KA 3OJUA 1EU3A 3VR4A 9ICCA 4R9WA 4RGMA 2VNUD 4ZQ3A 3ND8A 2BDOA 1C8CA 2B2VC 3S24A 1S0VA 1LTAD 2UXCQ 5ELCA 2HIVA 4R4OA 4A3JH 4BY7B 1SV0C 5IP9G 2Z6KA 1IG6A 2PCFB 2OYYA 1HNXQ 5I9OA 3KFUA 1QSLA 5BR8L 2DKZA 2F0MA 4A3CG 3DWAA 5T1IA 1FGBD 1AROP 3K7UC 5DG9A 1PH2A 2ATLA 1E7ZA 9ICEA 1ZQIA 1WWVA 5L1IA 2WACA 1KTKA 2OTLA 2RBMA 3A0HU 3QU5A 2AUJD 4A3BB 3BQTA 5AKJA 2H4OA 4RHRA 4JV5Q 5H2FU 5FLXL 4HSPA 5IINA 2B29A 1PTOC 1JIHA 4KY6A 3OTOL 3GTJB 1STEA 4GNXB 2W8KA 3T3FA 3J7AF 4HJ9A 4NXML 3N6RA 5IP7G 2VA8A 1AEXA 5C3XA 2A68C 1A77A 4YR0A 1BNZA 5C44B 1WFQA 5ALNA 8ICLA 4F7XA 2WAQE 1Q86C 2WF6A 1N33L 1Y1WB 2OQ0A 2HW3A 1QH9A 2ASLA 2Q2IA 1JXLA 1E3PA 2D0PA 3S16B 2JZBA 1AE3A 3NVYA 3MR3A 4UB2A 4WORA 2I0QA 3BDLA 1AFPA 3L5KA 4NLBA 2QB0A 5AK5A 5KFIA 1XTCD 4JOIA 4QB4A 3LWLA 1VQGA 1SNOA 4DUZQ 4JI2Q 2R8JA 2OWOA 4O2DA 5GQOA 5IYBH 1XNQQ 2KFNA 3RRGA 1CKOA 2A6ED 3TS0A 1KKXA 3RFAA 1JOQA 4HJ5A 1E24A 4A8EA 1BF4A 3U26A 1J5EL 4DV7Q 3MEHA 2Q8IB 3LWUA 3SEBA 3TFRA 4B3SQ 4GKJL 4H7BA 8ICMA 3SAHA 5IWAL 1KEJA 3DWQA 3F2BA 4X62Q 4YCXA 3J81i 1HNWQ 1Q8KA 8ICNA 2KEDA 4UB1A 2ZXPA 2XWJB 4CKCA 4CDGA 2O6KA 2N88A 1K1SA 2C22A 1OXUA 4KD4A 5J3BA 4HTHA 4QIWF 5NUCA 5AM1A 1YNND 2MNAA 3H4DA 1MC8A 1PH7A 5KG2A 3A5UA 4IPCA 4F3OA 3CP0A 5EE3A 3WK5A 4RT2A 1QVCA 3N52A 4A3EG 4F5NA 2G5HB 4GXIA 4K2KA 4GOPA 4JI6Q 1R4PB 3TMEA 3PUXA 5C5LA 4JI5L 2AQ0A 4P75A 1TU2B 3R2IA 4YCWA 3J80E 4F4YA 4K5VA 3MEFA 3QOJA 4F2RA 3GZFA 2DL0A 2UVRA 4DF4A 1TWHB 2IX3A 8ICOA 1JQYD 3CMAA 1TE2A 3PO2B 4KITB 1G91A 4PZ8A 2O5JC 2F8LA 2JEGA 3BU2A 1F0MA 5HGTA 4M6WB 1J9OA 1N56A 1SE2A 1F2ZA 5D46A 3N97B 1HR0L 3IAYA 3TI0A 1SSOA 3GIMA 4E6IA 3RJJA 3CKIB 3C1EA 2Y1JA 1SMYC 1HA6A 3AEVA 4I2JA 1CSPA 1CQVA 3HRZC 1ZQDA 1VQKA 7ICHA 4JK1C 1COOA 1ZQVA 3ORYA 2BR0A 3K8AA 2A68D 3PV8A 4OWWB 3RNUA 2Z7JA 2FPMA 4JBJA 1ZXTA 4F5QA 3Q0AA 2HVIA 2GLEA 3GIKA 4I2IA 2BA1A 3OMCA 1X56A 1ZQBA 2HD3A 2H3IA 2OH2A 1DOKA 4NM1A 3GV5B 2SEBD 5L1KA 1N36Q 1K83B 5DNFA 4TUQA 4BY7H 2PMZF 1J6QA 4DR5Q 4YCVA 1LTID 2KJXA 2N3SA 4F93B 5HP4A 4F8MA 1TT2A 1Z00A 4JBKA 1ZEQX 4BWMA 1C48A 3MDCA 1A76A 1UPHA 5M5WB 1M90C 2ZIUB 2W3RA 1NK7A 2KQ3A 4GXKA 1XPRA 4DV2L 4B3ML 1YNJD 5K5PA 1L2FA 2A3VA 4DR4L 4A3BH 1IL2A 2L5TA 1SZPA 4GFJA 1MJEA 2PI5A 2O5IC 1TWAB 5EWEA 3H94A 1UCVA 1SDFA 1Y1VG 3RLFA 3VC8A 1ZQJA 2KHJA 3GTPB 2Y1IA 3AM9A 4QZCA 4B9VA 1OXVA 4L5QA 4DK0A 3UDGA 3P1HA 4YN4A 4KJNA 3GTJH 9ICXA 2HHSA 9ICVA 4JYAQ 2VQEL 4Y52H 2XIWA 4IQWA 5HHHA 5DQGA 1ASYA 3ALRA 2I5HA 3HWTA 1I6HB 1ZQCA 5KEEA 4WJ4A 3K59A 9ICSA 3G48A 1FD7D 3N7SC 2BQUA 5IGDA 4AQYL 2R7FA 3PY8A 1SFOB 3QUQA 3Q8SB 1Z7TA 4LMQD 5CR0A 4RQ7A 4I27A 3S16H 5ALWA 3ZDAA 1K5OA 2KZ3A 4RNNA 3Q8RB 3PW0A 2F0VA 2MQHA 3MVVA 4KLKA 4RG1A 5AKEA 3ULLA 4TUSA 3K5MA 2D3DA 1F9SA 4P71A 3GTMB 3HKZC 4B9SA 4YR2A 4QNLA 1F9QA 4Y2YA 3T5LA 2C2EA 2W7OA 2JA6B 1QB5D 1D8YA 2V1CC 2XICA 4OO1I 1RYUA 4PNYA 5IOCA 9ICWA 5DB8A 4YFKA 2BCVA 4OIJA 1O08A 3I91A 2E2IB 3KF6A 1PFBA 5E7NA 5DQHA 3RJHA 4FYDA 1TIID 7ICPA 1VJ5A 3QU7A 5C3EG 2PXIA 1CQFA 1DK2A 8ICXA 3MFIA 1JE4A 2Z4HA 4KV6A 8ICQA 2EYOA 5M9OA 1T5XD 4U6PA 3FPPA 2GA4B 4M9GA 2PYKA 3IRBA 3NBHB 1YITA 1OTCA 4OCZA 1A0PA 4O3PA 2KIVA 9ICRA 2ISPA 2ZTDA 2F0WA 4DR7L 3FP9A 3IFTA 5ALKA 4QZFA 2L0CA 5JVG3 3CXCA 1NJIC 4LF4L 2JA5B 2K04A 1NZBA 2A74C 4ZKBB 2ZG6A 2GVBA 5ALLA 1Y8NB 3PCOB 5CV7A 1N9WA 3QYPA 1QNKA 4JI7Q 2DF4B 5DDYA 2XRQD 4RMFA 2PZTA 1G8ZD 3EPGA 1B3QA 1JE5A 1K0RA 1H9RA 3RH4A 1TWHH 4C8OA 1PTOB 2LY7A 4ZUJA 3NTIA 3PO2H 3I1YA 4J9PA 4BXXG 3UPQA 1B8AA 3I4OA 2R3ZA 3PMFA 2Z1CA 3M8RA 1KDAA 4YY3L 3MR5A 2JEIA 4IFDI 4B3MQ 4EBDA 1AH9A 3A7LA 4EENA 3FYHA 4UAVA 3SI8A 1Y88A 1JWSD 2MSNA 1QNUA 2QARA 2EE1A 4I2HA 1LB2B 4X64L 2QEXA 2UUCQ 2EY6A 1KFTA 5M3MG 3PF4A 2ZJRA 4L6TB 1YT3A 4ODGA 2JN4A 4FF4A 4IPHA 3D4WA 5JJZA 1LUZA 1S5DD 1IBKQ 3HEJA 1S0NA 1H9SB 3PVXA 1BR9A 1GM5A 2E5LQ 2NTSA 1KC8C 1D7QA 1U4MA 1FL0A 3DMUA 4O3OA 3C1YA 1HZ9A 1V85A 3TN2A 4A3DH 4DSKA 1KDCA 2IHFA 2EY5A 1TY0A 5KFZA 1QUQA 1F5SA 4DFMA 1KDHA 2ZXHA 5J2GA 2R8IA 3JC66 1JT8A 5J2JA 1HEKA 3M85A 1K83H 5IYCG 1ENFA 1CFMA 3J7A5 2HBJA 2EIFA 2MAXA 3J80L 3S15B 3SK8A 4IALA 2XIDA 1Z3EB 3OHAA 2JEJA 1WWUA 4B3RL 2NVQB 4OL7A 4RQ3A 4KLDA 5J2HA 5J39A 1SYBA 4YXMA 4DR2L 1LVHA 1VDVA 1UUPA 2ZJ5A 1S97A 2HHVA 3ER0A 2UXDL 4JPBW 1TWAH 2R92B 3GTPH 5GROA 1K1QA 4LAAA 4OO1H 4UW9A 5DGAA 3GU3A 3K0YA 4Q5VA 3CMEA 1SKSA 3PW7A 1A62A 4O0IA 3QXGA 2BCOA 2R8KA 5LMNQ 5HGQA 2WIIB 3C5FA 1B2TA 2VB3X 1PK3A 4F5PA 3W1BA 1I6HH 1CT1D 1VMPA 5AFWA 9ICJA 2CQAA 3SK5A 2AKWB 5I2YA 3L4PA 3EW9A 2P66A 4DR7Q 1SFOH 1EFWA 4LF4Q 1SRUA 2SNMA 3L9AX 3RAQA 2B2YC 4TVAB 2F0QA 4BA1I 3OPXA 3KTQA 1PUZA 1SZHA 1EIFA 1NAPA 3TS2A 1F2LA 3AQQA 2VQFQ 3NHHA 4YP3A 3PR5B 4FF2A 3GTMH 2JA6H 1BPYA 4UB6U 3QEBZ 1TK8A 4BX9C 2OM6A 4A3KG 1WI5A 2Y9UA 3ULPA 5DG8A 5IYDH 4OJPA 3R93A 3NXWA 2UVUA 2OEHA 1Q3UA 2UVVA 1I4QA 4EYHB 3Q8DA 1WYGA 3ULJA 2LBOA 1G2SA 4U68A 3N7PD 2E2IH 2O2LD 3TEHB 5G3LD 2VW9A 1SXTA 2JEBI 5GAEC 3CCSA 2VKQA 5JEAJ 1UAPA 3W2DA 4K14A 3S17B 3DXJC 4NLNA 1PRTC 4IFDH 2J0TD 4HJAA 2NV3A 3T1HL 8ICYA 3OW7A 3S2DB 1SEBD 1RPLA 5CMDA 5IT9c 4I29A 2EOTA 1XU4A 3KOJA 1CZGA 4QMGA 1D1IA 1VQCA 5IIKA 4RGNA 3TP8A 2JA5H 4A75A 1JRPA 2F0DA 2F1IA 1ED1A 3J81j 2EQYA 5DLFA 7ICSA 1IL8A 1Q8IA 2SDFA 2BQRA 4DQSA 2CHBD 4POGA 5M5XB 1KAAA 4UBBA 3C21A 1TAMA 2OT2A 1BBXC 4GN4B 3MC1A 5GAGC 2C5CA 3H15A 3BS5B 1PTOH 1PK1B 1RQNA 4C1NI 2GWSA 3DV9A 1NNXA 2R18A 3C29A 4DO9A 4JWMA 2FMSA 3MZ5A 3I4MG 3THVA 4KHPQ 4EEYA 2E1EA 3V6HA 1Q3LA 4ILWA 5ALMA 2OXPA 1EY9A 1WJJA 4P2HA 1KFDA 2F3VA 4DV5Q 4KLFA 4DR3Q 1O78A 2JXMB 2RCFA 5D3IB 3MABA 1Z6HA 1J8IA 1PHJA 2F1HA 5FJ8G 3WK9A 3K5LA 3HKZB 3MHBA 4AYBB 2ZXRA 3DDHA 4QZAA 4KKUA 4ECYA 3S9WA 2ZIVB 3PIP3 1JN3A 3D6JA 1L3VA 1LV9A 2DJGC 2KKVA 2HQEA 1NUCA 2K33A 1D8BA 3TRZA 2LHTA 1E22A 3A5ZB 3I72A 3NQTA 5ALIA 2RDHA 3LX0A 1F2YA 2QCPX 4ECSA 3UXOA 3M3YB 4US8A 4J9SA 4PMBA 1XNRL 3NRWA 2YTXA 3GDEA 3EJIA 1TKDA 2W9AA 2XO7A 1VS0A 4R63A 4R66A 5KFBA 2NVQH 5KFPA 3L2PA 2KSOA 4Q0FA 1OUQA 2E76C 4NY8A 3VA7A 4DUYQ 2G06A 4QF4A 4HIMA 3AUOA 1EY5A 4LFAL 3EYZA 4ECXA 4KN4C 3B9JA 2L1BA 4QIWE 4GLAC 3G71A 3K6OA 4CGYB 3DEPA 3A56A 4HEDA 3QZ7A 1NI3A 2DY7A 2W9CB 2A1JB 2BOSA 2E2DC 2KCMA 2G07A 4MEXA 4BY1H 2R92H 1ZQHA 7ICTA 1J2MA 1DK3A 1STHA 1G51A 2PFOA 4PZOA 1JB3A 2KFZA 3NK9A 5M5YH 1BNPA 1SKWA 9ICOA 4RQ0A 5ALDA 5HMMA 1PZID 3JPPA 4FXGC 3T1HQ 3BDPA 4IR1A 4YHHL 4YVZA 4CDCC 1N34L 8ICZA 3FDTA 4AH6A 2MHVA 4DQQA 2Y0SG 4DL4A 2C2DA 2K03A 3B0XA 3Q8KA 1WOCA 1SNQA 5KG4A 4DAYA 3OW2A 4LF5Q 1HTPA 1KSPA 4EX7A 3NTHA 1JICA 1NZPA 2XSCA 2YTYA 5ALXA 2JA8H 2B63B 1NJWA 3PSIA 2XTIA 3MGVA 2MUTA 3LVVA 4EX6A 4RUCA 1O7YA 2FPLA 4DQPA 5FLXE 1WTRA 2F0PA 3M4QA 3GIJA 3R2TA 5KT2A 3CRXA 4GC6A 1M6YA 3ZDEA 1FFVA 1I4PA 1X32A 4FBTA 3TREA 2DGYA 2F3IA 1XXGA 3JPOA 2E5SA 3QUCA 2W7PA 4CGZA 4J6HA 3JAMc 4EZ6A 4UB3A 4ZAIA 1DM0B 5ELFA 1UHUA 5LHY1 4CF3A 2WTFA 4Q44A 2V4QA 4IR9A 2ALYB 3SZ2A 3OSPA 1V38A 4I65A 4ME3A 2DBYA 4FF3A 3A0BU 3S17H 3Q8QB 4G7ZC 1G291 4KMUA 4YMOA 2BCUA 3KOOA 4C7YA 1JROA 2M9VA 1EQTA 2K14A 2MFIA 3S2DH 4IS7A 3KF8B 4I28A 1ZQAA 4KN7C 4PL2A 5CC4A 1WD1A 1Y1WH 3RBEA 1X42A 3KBBA 1I5FA 1IBLL 2LI6A 2PFNA 4Y2PA 5AKKA 4OX9L 4QWAA 2K4PA 1JI7A 2FE9A 4F91B 3TAPA 1HCZA 2EJMA 2BCRA 2RKSA 4KK7A 4P4PA 4RFBA 5EKIA 4NXNQ 2L15A 4IUVA 1ESRA 4Z9CB 5JPNC 3Q8PB 5J0OA 5EWFA 2CH4A 1PYWD 4KJOA 4ME5A 2WFAA 5KNIA 1I3QB 1X6JA 5FO8B 4BDPA 1LACA 3NBIA 1BKBA 5J2DA 3MXUA 3BG3A 4DAVA 4LF6L 3G4SA 2YQEA 1NK9A 1KQQA 5EJWA 4ED1A 2KICA 4A3EB 3OHBA 1B9NA 2WAQG 4HN7A 2PW7A 5HHIA 5EPKA 1NK5A 5J0YA 4J9LA 2VA2A 1PFSA 4A3LH 5KFTA 5D65A 3J7AV 1RQLA 1HHVA 3CAMA 5BOMA 2ICEC 3SQIA 1K9MC 1RHPA 3OSNA 3V7LA 2KBNA 4GLXA 1YZ6A 3H0LB 2IWHA 3PMNA 3RJIA 5CR3A 2E74C 1CSQA 4LJZC 4DL6A 5TSSA 4ZUIA 2WB1F 4O3RA 3T51B 2QKQA 1WD0A 5IIIA 1LABA 4DV6Q 2NN6G 4IURA 1ZQRA 5ALZA 3FPUB 4EGVA 3TADC 4UAWA 4KLOA 3RR5A 1XMOQ 1GOZA 4CJ1B 1HNXL 2RQXA 2Z4IA 2ZIXA 3H91A 1TK0A 1WUDA 2E8GA 5AI9A 5KNDA 1YJWA 2MJ8A 3H8WA 1XC9A 2W9BA 2O4XA 4APVA 1RG6A 3NVZA 3LYSA 1FGUA 3M3YH 1L1OC 1PH3A 3BVMA 1A3VA 3KZIU 3EROA 4ECWA 5KT5A 2YY6A 1SXEA 1PYBA 4IPDA 4JV5L 4DNIA 4OELB 1RM6C 3UMGA 1PRTB 4XXEA 4DLGA 1L5UA 2PMZC 4PJ0U 3WWVA 3C46A 4I2CA 5E4XA 3OTQA 5ELBA 1FO4A 3OWEB 5AJ3Q 2XVTA 1CKNA 2K89A 4YWMA 1NSNS 5AI8A 4DN4M 4QQBX 5C0XH 1Q46A 4PZ7A 2E3TA 1K73C 5DG7A 4PL1A 2B2WC 2F0EA 2EY1A 2CPRA 4KLIA 7ICOA 3ICXA 3K5OA 1V1PB 5KRUA 2HUGA 2IX0A 2K5HA 2HQLA 2OXOA 3AU6A 3D31A 3MWYW 3E0JA 3D8GA 5KFNA 3WKAA 9ICLA 1U48A 2RF4A 5JRTA 4ULLA 2GH1A 2KK0A 1X6OA 2B8GA 2OTJA 4UP7A 4PMCA 2FDRA 1LT4D 1RTOA 1ILPA 4DUZL 4JI2L 3K0XA 1Y1VB 1E0BA 3RD4A 3STBD 1YI2A 4BA2I 1V8QA 1XNQL 4LZGA 2HCFA 1SL2A 2PI4A 2GO7A 1Z9FA 2XNAC 4EX5A 1ZYRC 2N1RA 4O3NA 3RJFA 2B63H 3SD7A 4JV0A 5A35A 4DV7L 1VQOA 1YJNA 5IP7H 1VQJA 2BZFA 3TSSA 3CCLA 4B3SL 4FF1A 7ICIA 3HOYB 3PX0A 4X62L 2CH4W 3RJGA 4Y2QA 1HNWL 1BGXT 4DQRA 4PHEA 2MRLA 1ZQEA 2D9UA 3J81c 4C8LA 2VB2X 5CBEE 2Q8TA 5J0WA 2KCTA 1H95A 2JEFA 3JPTA 2NVYB 5C4HA 4Z6FA 2KP7A 1ONLA 2AQ3B 1NTGA 1STYA 2PO4A 2XY6A 2BE5C 2G5IB 1S8OA 1Z47A 2D0OA 1UT8A 1HXYD 4JI6L 5KG5A 3NASA 1TY2A 3P20A 9ICBA 3SE0A 4XT1B 3DEEA 3K1ZA 3RJEA 5J1ZA 2Z6BA 1Z1VA 3V2TA 1TS2A 1B70B 1SE3A 3CCEA 4OWTB 5FOBB 4Q8FA 4I2DA 4FDBA 5KFMA 4ZH4A 2F8KA 5FLMG 1JORA 2B2TC 1FR3A 2G0AA 3HGBA 2BDPA 1ZQGA 4B9LA 3KLSX 7ICLA 5C3EB 3ND9A 4YD2A 1W6KA 3PF5A 4P0QA 3WKDA 4YR3A 1E2VA 4Y2TA 1I3QH 1NR4A 2JMGA 1LTBD 3WOEA 4DXFA 3RF9A 4A93G 1F2MA 3GP7A 1K8GA 4C4TA 1FJGQ 2K5WA 4NM2A 2VXWA 2YMPA 2CRXA 2KZMA 1RXVA 4C3JB 4XRHA 4ALPA 4BS9A 2E75C 5M3FG 4CDFC 3PQIA 4MZ9A 4KY5A 2HT1A 4FO6A 2AUKA 3FEWX 3HOXB 1B1ZA 3CC7A 1LTTD 3DWPA 4A3GG 3PSFA 3QX7A 3BQ2A 4QWCA 3CC4A 3KLSA 4EQ5A 1L8OA 4UAYA 2NRTA 4CDEC 3N4MB 3QJYA 2Y0SC 3F53A 4FP5D 4UHVA 4LVSA 4ED0A 5CGKA 1S10A 1XJVA 4OJOA 3KHLA 5ELEA 5C0YA 1N36L 4UY8C 1YIJA 3RB4A 3LWEA 3H3VC 4DR5L 1T94A 1QG7A 3LVWA 4K5WA 1CUKA 4IQVA 4HYKA 2K60A 3CNHA 1TWGH 2A6HD 3BJYA 2L11A 2F44A 4GS3A 4WRDA 5KYLA 2HOQA 3H8SA 1ZQKA 3KYHC 1F44A 4TUPA 2YMMA 2EH9A 3T16A 4DAMA 1PH4A 3O13A 4BJQA 1ZETA 3MXNA 4RQ8A 3SAFA 1ZYRD 3BVZA 3LWMA 1U49A 2ZIWA 4DQIA 1C4QA 4FZLA 3K81C 5KTQA 2EDGA 3D3RA 3I4NB 3OYYA 2AGQA 1OXJA 1X66A 1X9WA 4RPZA 1CM9A 1DXMA 2YTVA 3S1MB 4KX5A 1U47A 5EOZA 3M7NA 4L5RC 4JYAL 3H40A 1RXWA 1LKYB 3OOCA 3G6EA 1WTQA 3DEOA 4C3IG 4GZYC 1XSLA 2BE5D 1CKMA 2RRDA 1SNDA 5F9LA 1VF5C 1A3TA 2OHFA 4HCEA 3MFYA 4PGYA 2ENBA 4R4TA 3A74A 1MKHA 3HOVG 2KTQA 5KFQA 2KKPA 1CRXA 1KDBA 4F87A 3M9BA 3K57A 1NJZA 5D4BA 4R4IA 4OEMB 3MR2A 3WKEA 3QZ8A 2K50A 1XO1A 2DQNB 2WAQC 2LXKA 3MR6A 4GN5A 2ZJAA 2B0CA 4HR7B 3SV4A 3HOYH 2L12A 5KFHA 3A55A 1BNOA 4JI0Q 2L55A 3CU7A 3JPRA 1NMFA 5TZVA 1JMCA 3UE1A 1PTOD 1D5ZC 4KLUA 1B9MA 1VQHA 4IUQA 4CKEA 4P2CB 3PW5A 2NVYH 3M4YA 2PKEA 1VQNA 4Y2XA 2BPCA 5TISU 2PZUA 2LMRA 1AN8A 1AP0A 4F5OA 2NBFA 2FJ2A 3HOZG 1EU4A 1G2TA 3J80i 4O0AA 5ELNA 4FS1A 1M1KC 1L1OB 2JEAI 2ZM6Q 3NPPA 4JI7L 3TP7A 2F0UA 4X3TA 1B44D 3LDAA 3T13A 3RMHA 4R8UB 2XCPA 2QDBA 2UXBQ 1S0MA 5J8YA 2ICIA 1O7IA 2PMZB 4TQUS 4AYBE 1YJ9A 1JMSA 1N2XA 1GJXA 3VYTA 4RQNA 4QZIA 1X9MA 4G57A 5HR6A 5C3EH 1ZQYA 4K6DA 3KF6B 4NV0A 1MD2D 2HOIA 2EXDA 2V4RA 3RLOA 1D6EC 3I7FA 4DS4A 2A69C 3TACB 3KKAA 4KLLA 1SLJA 1BUVT 4DXGA 1ZQTA 2NTTA 5EE9A 2UUCL 2IL8A 3KZXA 2JQOA 4C3JH 4QZGA 4QUCA 1IBKL 3EWAA 4UAIA 5GADC 3HOXH 3R3OA 4OXPA 2QW7A 2E5LL 4A3FB 4C56C 4C4RA 4EEKA 1KTQA 5AKHA 3RJKA 2G9DA 3IL8A 5C44H 2KHQA 4J03A 4TRDA 5FKAC 2DPJA 1MN8A 1X3GA 3KJPA 2AQ2B 2I5MX 4ACOA 5D49A 5JEAG 3JPNA 3I4MB 3GTKB 4B9UA 2K8BB 5ALVA 2W04A 1VQ7A 3H8JA 1MA7A 3PUZA 3HOUB 4KX3A 2HOFA 4IRCA 8ICEA 5KNBA 3GTOB 5J29A 4M6WA 3NS1A 1O7LA 3HP3A 3V6JA 1Q1BA 2EXZA 3I56A 4UARA 5DKWA 1CEZA 4PHPA 2LYBA 3RZDB 2QARB 3KBGA 1ESFA 4QZ9A 1UE6A 4EQOA 1L6NA 1QTMA 1K28A 1ZRNA 3QE9Y 8ICBA 3I4NH 3ZDCA 4M0AA 2MO1A 4XDXA 4F88A 3ZI4A 4FZNA 3IN5A 1SMYD 3M7GA 3PO3B 3S1MH 3HOWG 4B08A 5KL8B 4F71A 5T14A 2YV5A 2KHIA 2QF7A 1E1OA 2HDOA 2PFQA 2ZT9C 5E4WC 5IYCH 3AQFA 4JV2A 5CORA 5LMNL 2PW5A 4P0PB 2JP1A 2RDFA 3RH6A 1VQBA 2F0HA 3A0JA 1ZYQA 4H44C 4DF7A 2EQSA 4E0DA 3E9HA 1B7YB 3URYA 2Z8LA 4QL5A 4YWLA 3M7DA 1NK8A 1Z4OA 4BY7G 2A8VA 2ATWA 1PVOA 3W3AA 1S76D 5KFGA 4J1MA 2HBLA 5CJ7A 2IBKA 4BXOB 2MO0A 3HZXA 5AKXA 2IA6A 2ZIUA 5IIJA 7ICRA 2NUCA 1VQ9A 1TWCB 1EWHA 4H13C 4XYOA 2VQFL 4CF5A 2FLLA 4KHVA 1RJTA 1CI3M 3WDNA 5F2DA 4DR1Q 2QB1A 2NRZA 1O7ZA 3J81L 3C23A 1IYUA 2WINB 3EVQA 4FNFA 4Y2RA 3B6YA 1ZD3A 1EEID 2HBKA 1HJPA 1WCMB 3E9IA 2F0JA 3A8JE 2JH1A 5J0XA 4IN3A 3F2UA 2K5NA 3HRDD 4ECRA 3E58A 2FXQA 2EYLA 2JA7G 3I3CA 2Y0SB 4O5EA 1B22A 4DR6L 2DWQA 4ELTA 1IZ6A 4QZEA 4ED7A 1S5ED 4ECZA 1EXNA 4GIBA 4C0ZA 1K8MA 1N5WA 3I4LA 1PTOF 5JAVA 2H3QA 2OCEA 2J6SA 2WB1E 3X3MA 3LGJA 3KK7A 3T4AC 4HJ8A 4I2GA 3QB3A 3U58A 2NO5A 4TQRA 1NJYA 1DYQA 4K0KQ 7ICGA 4MN3A 2UUBQ 4O1NA 4HCSA 2W54A 3K4GA 1N48A 4FBUA 4DOAA 4NL9C 2KJ8A 2KCCA 3F5EA 2WF8A 3GDXA 1S9FA 4RA8A 1VQIA 1X3QA 1EIHA 2QGQA 1BCPC 2KMDA 2M2LA 5DLQE 4OJ5A 3RZOB 1ZQOA 3IHQB 3OSOA 1FNWA 4DFDA 2RP5A 4KLSA 1OW5A 2JK8A 4K4HA 4R65A 3QG1A 3QEAZ 4DLEA 4KLGA 5HR7A 5M5WH 3BDOA 1SB3C 4ABNA 3C2MA 2B2VA 2W3SA 4HAEA 4C1NK 9ICFA 3H3VI 4KLEA 4B9WA 4DFAA 4DU9A 4KHPL 1UA1A 1SV0A 1NOMA 3MC0B 5KT6A 2R7ZG 4B3TQ 3NBHA 4DV5L 3C2PA 9ICQA 3RB0A 1T7PA 1SMXA 1R9TB 4DR3L 4X3KA 1WTOA 1GHKA 1V43A 1JB7A 5C6AA 1QZGA 5IGGA 2YU9B 1STAA 4LNQA 1TAQA 4O42A 3M9OB 4RNOA 1GKHA 4YIJA 1TS4A 2QLTA 4A3FH 1PH8A 5KGUA 3EUB2 2KVSA 2W55A 1Y8PB 2NZ1D 4KKTA 3CRLC 2FMQA 3WK6A 3IKJA 2FPKA 3SR6A 4Q43A 4DV4Q 3V72A 2TSSA 4K5XA 1B4FA 8ICJA 1YHBA 2M9NA 2WAQB 1SYDA 2QDLA 7ICUA 3GTKH 3I4MH 1BO0A 4QZBA 2EAMA 3HOUH 5C4JB 2V4DA 1QJOA 2HCCA 1IYJB 4DV1L 8ICUA 1VQPA 3GTOH 1OO9B 4LWCA 1HFNA 4ED8A 4RNMA 3CCVA 2K52A 4DUYL 4MFFA 2ID0A 4K6LA 4DV3L 3ICEA 1UE7A 2LMCB 2FJ6A 2F4IA 5FJ8H 4JUZA 3AMZA 2BPFA 2ZTEA 5ALPA 2QEJC 1M4VA 2K75A 2BH8A 1S5FD 1V1OA 3HOWB 2B2UC 1QQ7A 5J2KA 1ICFB 4DR6Q 3FRPB 5AKYA 3PO3H 3QU2A 5FP0A 2BGWA 1I6VC 1SYCA 3SDZA 3HX0A 2RQ5A 4RZRA 2QKIC 3H0GG 4C2MB 2RCNA 5G5HA 5BN5A 1B3AA 4A3DG 2HI0A 1BDOA 3GD7A 2JV3A 4RPXA 3T79A 3DHQA 3PUVA 1HR0W 1N32Q 4QWBA 2N78A 3F5AA 2IPKD 4LF5L 3KDFB 2HMXA 4F92B 1S40A 4TQSA 2Z6KC 3IDWA 2E8MA 4MFAA 1MIUA 1ZQLA 3VA5A 3GFKB 3ISBA 3JPQA 4HMIA 3DUZA 2NN6I 3I90A 4M1UB 4PZNA 1FVIA 3AQEA 1EYDA 4UP8A 3CC2A 5AI6A 1ILQA 4KLJA 1Q81C 1WCMH 4JBWA 3F1ZA 4DK1A 3SHLA 5ELDA 4A3MG 3PX6A 1PLFA 2FFKB 4OO1G 4J9RA 4JV1A 3IRUA 5KT4A 1ZQZA 4RCNA 4RQMA 5AKZA 9ICNA 1Q82C 1AW7A 7ICKA 3S14B 3IM1A 3E0EA 2K5QA 5CBAE 4HJ7A 1JJ2A 2PQAB 1QOHA 4I2EA 1SL1A 2A73B 4Q45A 3PMLA 4EBEA 1NKEA 3V7JA 1MBYA 4ID6A 5CV4A 3TDQA 1A6XA 4BBSG 3R8BA 2BCSA 8ICVA 2L9HA 4NLZA 3U9OA 4RPYA 3PR4A 2WF9A 3FKIG 1TFRA 1H9JA 3I28A 4PHDA 5KFKA 1FNVA 4NXNL 4A3IB 3T5HA 1B53A 3AN1A 1X3PA 4JK1A 4JOIC 5J2FA 4LF7Q 4QUFA 1QQ5A 4UPAA 5LL6S 2JA6G 5CP2A 1EY8A 9ICUA 1MSHA 4DV1Q 1N63A 3FC4A 3S15H 5C4XG 2VL6A 3RZOH 1K8OA 5KFWA 1FFUA 3HKZF 5ALTA 4AYBF 1GUNA 1Z4NA 1SROA 3AL0B 3Q24A 4DF8A 5IE8A 4DV3Q 1DONA 4X66Q 4NPSA 4XUSA 1XO0A 1AZPA 5IT9E 4RUAA 2F1MA 3ZDBA 1W6JA 3QOLA 4QJFB 1CK1A 4CBVA 3C3LA 4R64A 4IFDG 2Q4TA 4R4QA 2Q2UA 1C7YA 4LF9Q 2C9OA 1R9TH 1A6SA 1JR0D 3I76A 5IGFA 1TV9A 1E1TA 4G7OC 4IQUA 1NKCA 3FHWA 4XTCS 3UDIA 3N28A 5KFJA 3NTKA 4KMOB 2YU9H 1PRTD 2F0FA 2DUDA 3F2DA 3AU7A 3ZD8A 2NRWA 2GN5A 3MGIA 4HIDA 3M8SA 3HJEA 4YMMA 2LS01 4DSJA 1T4GA 4DV6L 2JA5G 4A93B 4GOPC 3NENA 2PI2E 5IODA 1XMOL 3UDXA 2K05A 1EIGA 1D2BA 4C8MA 2EZYA 3BS5A 2K1BA 3SV3A 9ICAA 1EWIA 1PK1A 1GUGA 5M3FB 1DRGA 4NLKA 2IW3A 2PQEA 4M8AA 3Q23A 4HIOA 1EYGA 5C4JH 1MQ3A 2DN8A 3D6WA 5JJKA 2XY5A 1RKNA 3QUBA 2OEOA 4DK3C 4A3GB 3A54A 1JUDA 3SXHA 1U9RA 4F5RA 5K36H 1EEFD 3QIAA 4ICAA 5J2IA 1GUTA 2VANA 3KLRA 5AJ3L 4DNRB 1S5CD 5FO9B 1ZQXA 4KY7A 2ES2A 5KFLA 2JSOA 5ELOA 1Q7YC 3B0YA 1NJXA 3R9KA 1U0LA 2NN6H 3I2ZA 3HOWH 2D5DA 3DM1A 1SAPA 4BXXH 3UI2A 2ZIVA 4N9TA 3QU4A 5G3LF 3H7IA 2H1EA 3UXPA 1CI4A 5DQIA 2NYVA 5KAFU 4JI4Q 2HHWA 5DBBA 1ZQQA 5F9NA 1FYCA 2HDLA 1SWVA 4IZ8A 4XYQA 3PIOA 4C2MH 1BCPB 3UQ0A 1A15A 4ZOHC 5ALSA 5AK4A 5JJIA 4PH5A 4UQGA 1Q12A 5CA7A 4QIWC 4ELVA 2YN4A 8ICGA 1DGSA 3C2LA 1HPCA 1X2IA 3NSWA 4DA2A 1DXSA 5M5XH 2F0OA 3U9SA 2I9GA 1S72A 2Q2TA 5KL1B 5AHXA 1JC7A 4C3IB 2J4XA 1TQOA 3NE5B 5EE0A 3MTSA 1SV4A 1ECWA 4LUVA 1I94Q 2SOBA 2A1JA 2EZXA 4Y2VA 2W9CA 2NZHA 4I7ZC 2IHMA 2EZVA 5JU5A 2F0SA 4US9A 3BZDB 2EYFA 3TKAA 4BY1G 5A2QL 2UU9Q 4B9TA 4F50A 3BVGA 3HOVB 2IX1A 1A0IA 1EZ6A 5HMLA 4A4IA 1D9DA 1U9LA 3J7YW 3S14H 3GTQB 3VR3A 3GTLB 2FINB 2F1JA 1EYAA 1VF7A 4NB3A 1WYDA 3E2EA 2C35B 4JG2A 1RF2D 2E2JB 3TANA 1KRTA 2I07B 5EBDA 2KD1A 4MHVA 1KW4A 4BWJA 3WKCA 4A3IH 2ODGA 3ISCA 4IOCA 2JA8G 3NUCA 3PGZA 3K80C 4X3SA 1HUOA 1L0WA 1PVRA 1FNUA 3JAME 3BS1A 1VCIA 4JWNA 2K28A 5J2EA 1STBA 1S4ZA 4DCCA 4OO1J 4M9HA 2HHUA 2CW0C 5DB7A 2A1AA 2W03A 3BDCA 1FJGL 4J9NA 4IO9A 4DSIA 1RODA 1ZQMA 4K4GA 1PV4A 4LFBQ 4YCUA 3I73A 4DL3A 3ETRA 1IIPA 4UBCA 3HOZB 4O9MA 5EKLA 4UB5A 1ZD5A 3F2CA 2YB4A 1LYLA 1S3OA 3CRKC 2VZAA 2C2RA 5J2BA 4L8JA 1I4XA 4DV0Q 1AE2A 5IP9H 1XMQL 1STNA 3KF8A 4V190 2EYHA 2FMMA 5FLMH 3T5JA 5LL6X 2JHDA 2OQKA 1VQLA 1VQFA 1VQ4A 3BYYB 4IJLA 2F0TA 4LFCQ 5AIBA 4P74A 3WU2U 1XPOA 4A3CH 2XI9A 5AKGA 2WF7A 4N9PA 3GV7B 2K7VA 1VQ5A 9ICIA 4DK6C 3H0MB 4JC0A 4Z6CA 3CF5A 4YXJA 2JE6I 3QR8A 4N8FA 4G7HC 1ZQ1C 3ZD9A 1ET6A 3PIPA 1HNZQ 4A93H 4C8NA 1ZRMA 1VLBA 2CN1A 1NMGA 3K7AB 3NEMA 1PMRA 2G5DA 4OIKA 8ICPA 4F8RA 1CZWA 3HFZB 3OIPA 9ICMA 4Y2SA 3CCRA 3E0FA 4R8NA 4R1JA 2ES6A 4JI3Q 5F3XB 4QWEA 1ZQNA 5M3FH 3IG5A 4IRKA 2R8HA 2WKCA 4IRDA 4G3IA 3T53B 1C20A 1UE1A 2RA4A 4IFDJ 3EQLC 2R8GA 4M04A 1HUZA 5AM4A 4MEYA 4EELA 3CQZB 1S77D 3I70A 1EY0A 1RYRA 3T1YQ 4A3LG 4L5SA 5GTHU 4AP9A 1XNSA 7ICEA 2B2YA 2ZJ8A 2RDJA 2VUMG 3TQ1A 3TP6A 1WCNA 5IT9L 4WJWA 5C5MA 1WCLA 1T8EA 2JZBB 4O3SA 1E2WA 1O80A 5L9XA 2EYJA 3HS0C 1BBWA 3Q6SA 3SVMA 2QB0B 1F77A 1PZJD 3K75D 3SEIA 1A3UA 1ZXIA 4AYBG 1GUSA 1DOMA 4X6AH 1ZKOA 4F4ZA 5KFAA 1EWCA 1TVXA 3EZ5A 2RDIA 1OXXK 1QWYA 4JI1Q 2KVCA 2K4HA 2K8CB 2AGOA 4IOAA 3GILA 1GO3E 2CKZB 4JMUA 3S6JA 4X5VA 3G6JB 4C3HG 1YHAA 4DEZA 2CQOA 2G9HD 2HIXA 7ICFA 1Q1EA 1CA6A 4OJLA 1I4RA 1GD7A 1YNNC 1WTWA 4DAPA 4RQ6A 2ZTCA 2E8OA 5KFVA 4IUNA 4JI8Q 1D5XC 5ISRA 5J0TA 4HSVA 2KHVA 1QQ6A 2CW0D 4RHSA 2LYAA 2CCZA 2DPIA 1VMCA 4NXZA 1GVPA 5AM0A 4JCVE 4C3IH 1VQ8A 5DLGA 1BPZA 2XRSD 1NK6A 4IUTA 5IGCA 1IBMQ 4JI0L 3AU2A 4A3EH 2HHHQ 1VDZA 2XGTA 5C0XG 4X65Q 2W43A 3PZPA 4KLQA 1V1PA 2DFLA 1LT6D 1JX4A 2EZZA 2AQ1B 1IKLA 3HOVH 9ICKA 4GOPB 4EZ9A 1N8RC 1I4HA 1EY4A 1VQAA 1EUJA 1SYGA 5CV9A 5I6WA 4UATA 5DGBA 1U4RA 4KHZA 3CCUA 1XMQQ 5J2AA 1GHJA 1GUWA 5JTIA 4M9NA 1NK4A 2PNRC 5AM5A 5IY0A 3GTQH 3GTLH 2K4IA 4XQQA 1RCVD 4KD3A 4OONA 3J80c 4DWIA 4BBRG 1DOQA 5KG1A 4N8X1 2ZM6L 5KYIA 2G09A 1XTDA 1W2BA 2E2JH 1ICWA 5CV6A 5CV8A 5LMUQ 2UXBL 2JA7B 1HQMC 2UUAQ 2LKYA 2VA3A 3J81E 3HP6A 2ASJA 2B63G 4QZ8A 2F0NA 2KJ9A 5M3MB 4XA5A 2I46A 3RR8A 1RDFA 5E79U 2AHOB 4KLTA 5C4ZA 1NR2A 7ICNA 1SBBB 1A63A 1N62A 5ALRA 2HDMA 3FVQA 4POFA 2E8NA 1MGSA 3WK8A 2N49A 1QVGA 1HRJA 1BQQT 3SK6A 1B43A 3V6KA 4ECVA 3GQBA 2LM1A 1RDPD 1QVFA 4ECQA 1PVQA 1D1KA 7ICMA 1ZJNA 3EFXD 4IUUA 4UDUC 3HOZH 2IY5B 2AQ4A 2R93G 2K5DA 4KLHA 3PUYA 1XSNA 1LT3D 4KLMA 2EYPA 4R4CA 3I8ZA 1TK5A 3BS7A 2GVAA 1URJA 4EYIB 4FXKC 4QIWB 5E1FA 1KXLA 1NE3A 5KFOA 3SK4A 2XWBB 5K4LA 1A8VA 2PZWA 2JXJA 4GKKQ 1R4QB 1YNJC 1K3RA 4A3JG 1T9HA 3HPOA 4K8JA 2SNSA 3KLWA 4GLVB 4EVOA 1Z00B 3NVWA 1QSSA 3S1QB 4KN4A 2RHFA 4RQ4A 1YEZA 1ZD2P 3ZJYC 2B6GA 2F4VQ 9ICGA 1L0XB 2KECA 3OHXC 4LK1C 3K7AH 3HILA 2R7ZB 1CHQD 1Y1VH 3CPFA 3NP8A 4ZYSA 1X65A 3NWTA 1AZQA 2KV2A 1SKRA 3V96A 5JJLA 1RL2A 2RDGA 5ALEA 5DBCA 3JAML 2RHQB 3AFPA 1ZQPA 3TZDA 1MSGA 4GNXA 2HHTA 1IW7C 2K01A 3CCQA 3D2NA 2G08A 8ICAA 2RSOA 1N5XA 2WB1G 5KT3A 2K5VA 1L7NA 3CQZH 5HY6A 1EIYB 4IL6U 1DZ1A 5ALQA 3QU9A 1II3A 2KJ5A 1SJED 1Q3VA 2EJFC 2ZXIA 2I5LX 5DM73 3NTUA 5JEAH 1X9NA 3IP4B 3CPWA 4J9OA 3M9NB 2F2AB 3PO5A 4KTQA 1IHZA 3IFDA 4NP5A 1HFGA 5EKKA 4ZK9B 1VQEA 5CV5A 4PG3A 2JGAA 3MBYA 2LXJA 5BR8Q 4IQZA 3M9MB 3KJOA 2JRZA 2XC9A 3RB3A 5C3WA 2CXYA 5AM2A 1HIWA 1EQVA 4A3KB 8ICKA 2R6GA 4FO2A 1ZQSA 2NVXB 2L5YA 5KIXA 5CEHA 5KFUA 4NLCA 3S1RB 5KFDA 3M1YA 2PPBC 3V05A 5IYBG 1NCVA 2KN7A 3CYMA 2BHNA 2UVWA 4F2SA 1COKA 2QILA 3VYUA 1J2NA 2B3GA 3HKZE 1X3EA 5FO7B 3OTOQ 1FIQA 2TMPA 4DR1L 2IHNA 3KBXA 3PNCA 1X9XA 4NXMQ 4ZRZA 4Y2JA 3UE0A 2J6UA 5ALJA 1BPDA 3BQ0A 1DOLA 1UE5A 2F0IA 3H0GB 4A3DB 1N33Q 5EPJA 4KN7A 1LO5D 2EJGC 2R7DA 4UP9A 1LKYA 2PI2A 3ONAB 4P73A 1O03A 3U4VA 4LW1A 5D14A 2YYZA 2JR5A 3MFHA 4RAUC 2KOLA 1PA6A 1BPBA 1I50B 3C2KA 3VR5A 4IPGA 2P6RA 1I4GA 2BDNA 1F9RA 1CTMA 2FMCA 2V9WA 1GUOA 1SGGA 3GIIA 3EA6A 7ICQA 1SL0A 3VCBA 5L37A 4EQNA 3NGDA 3EIVA 4K0KL 5KFFA 1KBUA 3K1RB 4MTNA 2VS1A 4AIMA 2UUBL 2IOFK 2MP1A 4WJ3B 1U4BA 1KRSA 1J5EQ 1KLNA 3K58A 3DLLA 4MFCA 3LNNA 2N55A 1PFMA 4GKJQ 5AK6A 1D5MC 2M00A 4JW0A 9ICHA 5IWAQ 4F4KA 2MUYA 1BOSA 4A3MB 1SR3A 2JA7H 1KRPA 2VIXA 3D4RA 2MU2A 3QNMA 3BZCA 4H0LC 2MPMA 5E3FA 2J6TA 5J22A 1IYVA 2W8LA 7ICJA 2P35A 2DNCA 2N8NA 5C0XJ 4QY7A 2C28A 5M3MH 4Z6EA 2Q8RE 1LM0A 3H4BA 3L3OC 3HOYG 2ISOA 2I6XA 3AYHB 2XY7A 1SYFA 5KG0A 1DJRD 1IW7D 4BBSB 1FEZA 3Q8LA 3TADA 1Z1BA 5DB6A 4B3TL 3FKIB 1TS3A 2RVLA 2AWNA 1M8AA 3NRZA 5EGTA 4S3SA 4JI5Q 4RU9A 1N61A 2X69A 1XYIA 5T1GA 4K4IA 1KLUD 1SNPA 4XQJA 4FS2A 4ED6A 1HUMA 1NNLA 4AYBC 4MHEA 4WJ3M 3CW2C 1QUQB 3ERSX 1L1OA 3LK9A 1VQDA 3D0FA 3MFGA 1L3TA 4IQTA 5HNKA 1JOKA 1LLRD 2KA7A 2KHSA 4KMUC 5C4XB 5L1LA 4R8UA 3KUPA 3Q22A 2Z9HA 4YWKA 1JJCB 3G6VA 2K32A 4MTKA 4OGQC 4TKOB 4B9XA 4DV4L 1SWWA 2MGSA 3SENA 1HR0Q 2RHSB 2L4NA 4UB8U 3S1QH 3RUZA 5ALOA 2K8AA 3L3FX 1OXSC 2EYMA 2FMPA 2YTUA 5J2CA 2XGPA 1WTVA 2B2WA 2EDUA 2LM4A 4UB4A 2DNEA 2R7ZH 2M0NA 4UASA 5CRXA 2NWGA 1NY4A 2W9MA 1PDQA 4CE6A 4Y7NB 4ZLTF 4A3BG 1PVPA 4FXDA 4J9QA 1Z19A 8ICIA 3J7ZC 1CHPD 2F0LA 3HW8A 2K4EA 1RD9D 3RR7A 2A69D 2BA0A 4C3JG 3ZDDA 4DSEA 1UEAB 2ESEA 5AK3A 2MA1A 3AFQA 4ZKCB 1SNMA 3BJUA 5CWRA 5EWGA 2AJQA 3HOXG 1B0XA 2YMQA 3UQ2A 5C44G 2XGQA 1EOTA 1WVLA 4J15A 2EY2A 3OJSA 4O3QA 1EY6A 3HG9A 2KOBA 5KT7A 2Z0SA 1Y1WG 5IILA 4B6JA 4KI0A 1N32L 1N60A 3P75A 1RYSA 4QCLA 5J0UA 1KFSA 1U4LA 4DV2Q 1QCKA 2Y0SF 5EBCA 2H3ZA 3PW2A 4NKLA 5BN4A 5I4DA 2HHXA 4A3KH 4DR4Q 2NVXH 1UQVA 1SNCA 3BQ7A 4NWIA 2B39A 4DSLA 3S1RH 1L7PA 2KUMA 3MXGA 2DJFC 5GAHC 1XS9D 1GO3F 1JWUD 2IT1A 4M47A 2F3WA 4O5KA 2AXTU 4RQ2A 3HT3A 2F0GA 2VQEQ 5B5EU 3I4NG 5C5JA 4CCHA 3TQYA 3ZYYX 2IMWP 3H0GH 2H3FA 5AIAA 4QZDA 1MQ2A 4AQYQ 3GV6A 1PZNA 5IIFA 3QWNA 2FLPA 2B2TA 4P0PA 1U4PA 4RCOA 4HIKA 1MJCA 3RH5A 3E6ZX 1I50H 3ETLA 2D6FC 1WG8A
chains in the Genus database with same CATH topology
2BA1A 4XIGS 1X56A 4HIOA 2KCTA 3U4ZA 3W5OA 1EYGA 1H95A 5C4JH 5JJKA 2BH2A 1N36Q 4DK3C 4BY7H 1NTGA 1J6QA 4DR5Q 4YCVA 2N3SA 1Z47A 2D0OA 4JBKA 4LF7L 4JI6L 5AJ3L 4JI3Q 4A3MH 2ES2A 5ELOA 1Q7YC 1M90C 3PO2G 1U0LA 1B70B 3CCEA 1XPRA 4OWTB 4DV2L 4B3ML 3HOWH 4BXXH 1L2FA 2IHEA 4DR4L 4FDBA 5FLMG 4A3BH 1IL2A 1MJEA 1KHIA 4X66L 3EN2A 3RZDH 1Y1VG 3RLFA 4JI4Q 2KHJA 1OXVA 3EBEA 4L5QA 3PIOA 3UDGA 3PF5A 4C2MH 4BBSH 1PH6A 3GTJH 5H1SE 4JYAQ 1P16A 4LF9L 3FKIH 1I3QH 2VQEL 1X55A 4A93G 4Y52H 5JJIA 1UEBA 1Q12A 1K8GA 1FJGQ 2I5HA 1DGSA 4WJ4A 2PNHA 4ALPA 3G48A 1Y1WH 1V1QA 4AQYL 1XPUA 2R7FA 5M3FG 2HT1A 4MZ9A 3L7ZC 3CCMA 1PH1A 5M5XH 3S16H 5C4XH 4KLKA 1S72A 2MQHA 3CC7A 4YY3Q 3I55A 4RG1A 2Q2TA 2WFWA 4A3GG 4LUVA 3ULLA 1I94Q 3BZKA 4EQ5A 3U50C 3CC4A 4JBMA 4P71A 1Y14B 2NZHA 1KL9A 4P72A 4X64Q 1TWCH 4BY1G 2UU9Q 2V1CC 1XJVA 1N36L 4OO1I 1TXYA 4UY8C 1YIJA 1A0IA 1SE8A 3RN2A 2IX1A 4DR5L 4A4IA 1P8LA 1CUKA 1TWGH 3I2ZA 4GS3A 3S14H 4Y7NH 3KYHC 2JJQA 3KF6A 5E7NA 4DAMA 1PH4A 4JI3L 4NB3A 1WYDA 2JA9A 5C3EG 2C35B 2CWPA 4JG2A 3M4PA 1KRTA 3K81C 3OYYA 1YITA 3NBHB 3IRBA 3UDFA 1OTCA 4A3IH 4JI4L 4IOCA 4A3FG 2JA8G 3PGZA 2ZTDA 3K80C 2YTVA 3H3VH 4DR7L 3FP9A 1L0WA 3CXCA 1VCIA 4DAYB 4B3RQ 1NJIC 1YBYA 4LF4L 3M7NA 4L5RC 4JYAL 2GVBA 2A1AA 3DM3A 3PCOB 4LUOA 3G6EA 3CCJA 4DR2Q 1FJGL 1N9WA 4IO9A 4JI7Q 4RMFA 3SGIA 3HOUG 1PV4A 4LFBQ 4YCUA 1C9OA 1CKMA 1KIXA 1HZCA 2UXDQ 1JE5A 1K0RA 1TWHH 3F2CA 1LYLA 1S3OA 3PO2H 2VZAA 1HZAA 1LTLA 1B8AA 3I4OA 4R4TA 3A74A 2K4KA 4YY3L 5FLXc 1MKHA 4DV0Q 1AE2A 3HOVG 5IP9H 1XMQL 4IFDI 4B3MQ 5IYDG 1I94L 1AH9A 5FLMH 1VQLA 2OQKA 1VQFA 1VQ4A 4IJLA 3M9BA 4LFCQ 4P74A 1K8AC 4R4IA 4X64L 1XPOA 4A3CH 2QEXA 2UUCQ 2UU9L 1VQ5A 5M3MG 3PF4A 2ZJRA 4DK6C 3PO3G 4JC0A 2K50A 3PUWA 4IPHA 3CF5A 2LXKA 2JE6I 1LUZA 4GN5A 1IBKQ 1ASZA 1KXLA 3PIPA 1HNZQ 4A93H 1NMGA 4PZ6A 3HOYH 3NEMA 1GM5A 2E5LQ 1KC8C 5EAYA 3HFZB 3CCRA 3VDYA 1D7QA 4JI0Q 1FL0A 4R1JA 3KDFA 1HZ9A 1NMFA 4A3DH 2IHFA 5M3FH 3UE1A 1JMCA 1VQHA 1QUQA 3GTGH 3JC66 1JT8A 1UE1A 2NVYH 1VQNA 1PH9A 2ZJQA 3M85A 1K83H 5IYCG 4IFDJ 3J7A5 2EIFA 3T1YQ 4A3LG 4L5SA 1X3FA 4B3RL 2ASBA 3HOZG 2VUMG 1C0AA 3J80i 4O0AA 5ELNA 1M1KC 2LSSA 1L1OB 4DR2L 2JEAI 5LMNW 2ZM6Q 4JI7L 1WCMG 3ER0A 4LFBL 1X54A 2UXBQ 1O7IA 4GNXC 2UXDL 4TQUS 1BBWA 4AYBE 1TWAH 1YJ9A 1YHQA 3RLNA 3GTPH 4AYBG 2A19A 5GROA 4X6AH 2PQAA 5C3EH 3KF6B 4DV0L 1OXXK 2EXDA 1BVSA 4JI1Q 4IOAA 3CMEA 3RLOA 4DKAC 1GO3E 2CKZB 3I7FA 1A62A 1SLJA 1YHAA 4LFCL 5LMNQ 5HGQA 2CQOA 1HH2P 2HIXA 1Q1EA 2UUCL 3W1BA 1GD7A 5C0XI 1I6HH 4DR7Q 2JQOA 4C3JH 2AKWB 3S2HH 2ZTCA 4JI8Q 1SFOH 1IBKL 1EFWA 4LF4Q 2NZOA 1SRUA 2QA4A 1HNZL 5GADC 4DPGA 3HOXH 4OXPA 4TVAB 2CCZA 1GVPA 4JCVE 4BA1I 4C3IH 2E5LL 1VQ8A 5C44H 1EIFA 1IBMQ 4JI0L 3TS2A 4OWXB 2HHHQ 3AQQA 2VQFQ 4A3EH 3GTMH 2XGTA 1X3GA 3KJPA 1G6PA 5C0XG 2I5MX 4X65Q 2JA6H 1UWVA 5JEAG 4A3KG 2F52A 3HOVH 1WI5A 4GOPB 3ULPA 1N8RC 1VQAA 5IYDH 1CKNB 1EUJA 3HKSA 2KENA 3PUZA 1HZBA 4KHZA 4QJFA 3ULJA 3CCUA 3Q8DA 1XMQQ 1VQ6A 3T1YL 5IY0A 2PMZE 3GTQH 3GTLH 3S1NH 2AWOA 2E2IH 1Q1BA 3TEHB 3I56A 2VW9A 3CCSA 2JEBI 5GAEC 1PH5A 2R92G 4OONA 3J80c 1D8LA 5JEAJ 3STBC 4BBRG 2ZM6L 3CD6A 1QZHA 1XTDA 1UE6A 4HJAA 1W2BA 2E2JH 3T1HL 5LMUQ 2UXBL 2UUAQ 3I4NH 1KAWA 5IT9c 2ZJPA 2VY3A 3KOJA 2MO1A 2WP8J 2B63G 1XNRQ 1VQCA 3S1MH 1EQQA 2AHOB 4JI1L 4QGUA 3L0OA 2CWAA 2JA5H 1A63A 4A75A 2YV5A 2KHIA 1E1OA 4POFA 3J81j 2N49A 5IYCH 1QVGA 5LMNL 4LF8L 4A76A 3A0JA 4LFAQ 4POGA 1VQBA 4IJHA 1QVFA 2AMCB 2EQSA 3E9HA 1B7YB 1KQSA 4GN4B 5GAGC 3H15A 4YWLA 4QL5A 4JI8L 3HOZH 2IY5B 2R93G 1VQMA 2VUMH 4BY7G 1YNXA 3PUYA 2A8VA 2ATWA 1PVOA 4R4CA 2MO0A 5K36G 1VQ9A 3I4MG 1JJGA 2GVAA 1IBML 2HHHL 4KHPQ 2VQFL 1NE3A 1V9PA 4GKKQ 2UXCL 1A8VA 4YHHQ 2CFMA 1N34Q 4DR1Q 4X65L 4PMWA 1K3RA 4A3JG 1T9HA 1WJJA 4DV5Q 4MNOA 3B6YA 3KLWA 1IXRA 4GLVB 4DR3Q 1EOVA 1HJPA 3E9IA 1YEZA 1NBWA 3ZJYC 4C3HH 2F4VQ 2K5NA 5FJ8G 2FXQA 1PHJA 3K7AH 1YVCA 2JA7G 1Y1VH 3CPFA 1X65A 4DR6L 1IZ6A 3TRZA 2D62A 5JJLA 1RL2A 1E22A 3A5ZB 2RHQB 3AFPA 5LMUL 4GNXA 2OCEA 1OXTA 2WB1E 3CCQA 2UUAL 2WB1G 3JAMi 2K5VA 3CQZH 3LGJA 5HY6A 1EIYB 4HJ8A 1XNRL 2YTXA 3GDEA 3U58A 4K0KQ 4LUZA 2I5LX 1VS0A 2NVQH 2UUBQ 1X9NA 2E2HH 3L2PA 3CPWA 2Q2HA 4DUYQ 4HIMA 3RN5A 1TWFH 4GN3B 1U5KA 1VQEA 4PG3A 4A3GH 4LFAL 2LXJA 5BR8Q 2NVTH 1VQIA 3PV0A 4QIWE 4GLAC 2QGQA 3G71A 5DLQE 3KJOA 1PYSB 2KCMA 2R92H 2JK8A 4BY1H 4H02A 4BBRH 1SN8A 2R6GA 1IBLQ 4OX9Q 5M5WH 1G51A 5M5YH 3H3VI 3NELA 4KHPL 5IYBG 3T1HQ 4GKKL 4YHHL 1N34L 4DR1L 2B3GA 3HKZE 1X3EA 4L5TA 3OTOQ 2Y0SE 4AH6A 2R7ZG 3HKZG 1W3SA 4DV5L 4B3TQ 2Y0SG 1RIPA 1SMXA 4NXMQ 4DR3L 3UE0A 1KD1C 1V43A 1JB7A 3F8TA 1WOCA 1QZGA 4LF6Q 4LF5Q 1UE5A 3MXNB 3OW2A 4A3IG 4LNQA 2F4VL 1N33Q 1BBUA 1GKHA 2YTYA 2R7DA 4UP9A 3W1GA 2JA8H 2PI2A 3PSIA 4A3FH 4P73A 4LF8Q 1PH8A 2XTIA 2H5XA 3U4VA 4LW1A 1EQRA 3M4OH 2YYZA 2R93H 3GO5A 3M4QA 1PA6A 4DV4Q 1YHBA 4IPGA 3TREA 2VNUD 2DGYA 2F3IA 3GTKH 3I4MH 3HOUH 3JAMc 3S24A 3GTOH 1IYJB 3EIVA 4DV1L 1VQPA 4K0KL 2UXCQ 4LWCA 2HIVA 4MTNA 2VS1A 4R4OA 4AIMA 4A3JH 2ALYB 1ASYA 2UUBL 5IP9G 1KRSA 3CCVA 1J5EQ 4ME3A 2K52A 2Z6KA 3DLLA 2ID0A 4DUYL 4DV3L 1HNXQ 3ICEA 3S17H 1UE7A 3KFUA 4GKJQ 1G291 5IWAQ 5BR8L 5FJ8H 4A3CG 2MFIA 2K14A 1SR3A 2ZTEA 2JA7H 3S2DH 3K7UC 3BZCA 3KF8B 2K75A 2BH8A 1PH2A 1E7ZA 2N8NA 5C0XJ 2OTLA 4QY7A 4DR6Q 1I5FA 5M3MH 1IBLL 4OX9L 3PO3H 1LM0A 3HOYG 4JV5Q 4NXNQ 3AYHB 2L15A 2B29A 3H0GG 4A3DG 2RCNA 3OTOL 4GNXB 4B3TL 3GD7A 1N32Q 4HJ9A 4NXML 3PUVA 2AWNA 5IP7G 1HR0W 2N78A 1BKBA 4JI5Q 4LF6L 1WFQA 3G4SA 4LF5L 3KDFB 2WAQE 1Q86C 1N33L 2OQ0A 2WAQG 4WJ3M 1S40A 1QUQB 2Z6KC 3CW2C 3ERSX 1L1OA 1VQDA 2Q2IA 3D0FA 1MIUA 1E3PA 2D0PA 1AE3A 1PFSA 4A3LH 2NN6I 2I0QA 4YWKA 1JJCB 1FVIA 3CAMA 4DV4L 4JOIA 1K9MC 4UP8A 3CC2A 1HR0Q 1VQGA 2RHSB 4DUZQ 4JI2Q 2KBNA 4GLXA 1Q81C 3S1QH 1WCMH 4JBWA 1YZ6A 4O2DA 5GQOA 2OWOA 5IYBH 3F1ZA 1OXSC 3TS0A 1CKOA 1XNQQ 1CSQA 4A3MG 4HJ5A 2EDUA 1E24A 1VQ7A 2R7ZH 4OO1G 1J5EL 4DV7Q 4DV6Q 1NY4A 2NN6G 1Q82C 3HOWG 4BXXG 3RR5A 1XMOQ 1HNXL 4B3SQ 4GKJL 4A3BG 3E0EA 4HJ7A 4X62Q 5IWAL 3F2BA 3J81i 3J7ZC 1JJ2A 2PQAB 1HNWQ 1Q8KA 2E8GA 1YJWA 2BA0A 4APVA 4BBSG 1FGUA 3M3YH 3AFQA 1OXUA 1L1OC 3BJUA 5J3BA 1PH3A 2MNAA 3FKIG 3HOXG 1PH7A 1PYBA 4IPDA 4NXNL 4IPCA 4DNIA 3A5UA 5C44G 4JV5L 3CP0A 4J15A 1QVCA 4A3EG 4JOIC 2Z0SA 3WWVA 1Y1WG 4LF7Q 4JI6Q 4KI0A 4GOPA 5AJ3Q 4UPAA 1N32L 1CKNA 2JA6G