2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1531
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
2PQAA 2AWOA 3GD7A 4R4TA 1XTDA 1N33L 1X6OA 3J80c 2WP8J 2AWNA 1I50H 2IT1A 4HJAA 1SR3A 1YJNA 5IP9G 2NVQH 2F3IA 4A3KH 1M1KC 2UUCL 3HFZB 1K3RA 5GADC 3S17H 4A3MH 3KFUA 3T1HL 2CWPA 1C7YA 1OXVA 2WFWA 1Q1BA 4BA1I 1QVGA 4LNQA 1XMQL 1HR0L 3CD6A 2UXDQ 2R93H 1Q8KA 3T1YQ 2AKWB 2WB1G 2LSSA 5HY6A 4DR3Q 4LF5L 4NB3A 4P74A 1KRSA 4B3ML 4K0KL 2JA5G 4AQYL 1UEBA 2E5LQ 3HOUG 1DGSA 2XTIA 2LXJA 3I4NH 1U5KA 4XIGS 3HOXG 2JA7H 1X65A 4RMFA 4YY3Q 1QZGA 2A8VA 3PIPA 1XNRQ 1D7QA 1G291 3UE1A 1IBML 1S40A 3RNUA 1Z47A 4KLKA 3U4ZA 2JEBI 5ELNA 4A3FH 3A0JA 3CCUA 4A3CH 1C9OA 1MIUA 2NVXH 2N49A 2NZOA 5IYCG 5IWAQ 2D0PA 1YJ9A 1VQHA 1JJCB 2C35B 4GNXA 1WFQA 2HIXA 3CCEA 4IFDI 5LMNW 4NXNQ 4WJ3M 1KRTA 1JE5A 4BY1G 2R7ZG 4JG2A 1TWGH 2XGTA 3FKIG 4IFDJ 3G6EA 1O7IA 1V9PA 1VQ4A 3I55A 1PH9A 1YZ6A 4JBWA 1CKMA 1E1TA 2FXQA 3FHWA 4P72A 4DR5L 2L15A 4A3EG 3PO2G 3OTOL 2MO1A 2A19A 4GKKQ 4JYAQ 1GO3E 1YHBA 4RG1A 3S15H 1E3PA 4C3IH 1VQ9A 4X6AH 2UU9Q 1A8VA 4QY7A 3DLLA 2GN5A 2GVBA 4JI1Q 4DPGA 4JI2Q 1KIXA 4DV4L 1L1OB 2MFIA 4KHPQ 1I5FA 3GTOH 1I3QH 5C44H 3K7AH 1C0AA 3PGZA 4PG3A 1E22A 2KCTA 3CAMA 4PMWA 3PUVA 3BZKA 4IJLA 4GOPA 4DV3Q 4NXMQ 2B63G 3I4MG 1MKHA 4MZ9A 1K8AC 3L2PA 2HHHQ 2JA6H 4JBKA 1AH9A 3TRZA 2B3GA 4FDBA 1Q81C 3F2DA 1EFWA 1IZ6A 4LF7Q 1CUKA 1OXSC 4GLXA 3J81i 4JI7Q 1WYDA 3I7FA 1EIYB 3GTPH 1J5EL 2UUCQ 1VQOA 1JT8A 1CSPA 5C0XI 3T1HQ 3E0EA 2OTLA 1VQAA 2IX0A 2IY5B 4DV2L 2WAQG 1Q86C 1HNXL 4IPHA 5C0XJ 4A3DH 3EBEA 1V43A 1HR0Q 3HOZG 4BBRH 4GLAC 4WJ4A 3CC7A 4JI3L 4OWWB 4X62L 3W1GA 4HJ5A 4QGUA 1UE7A 4IPDA 2UXCL 4L5SA 4JBMA 1LUZA 1VQEA 2Z0SA 3NBHB 4LFAL 1GKHA 2ALYB 3E9HA 5IP7H 1KAWA 4YCWA 4TVAB 1IBMQ 4EQ5A 1Q7YC 5FLMG 5GAHC 1GVPA 4AYBE 1GM5A 2K4KA 1XPRA 2BH8A 1QUQA 5FLXc 2E2HH 2VUMG 2EIFA 3I2ZA 1NBWA 1VCIA 2OQ0A 4DR4Q 1TXYA 2RHQB 4KHZA 3ICEA 1Y1WH 5IE8A 1OXTA 1VQFA 1I94Q 1PH4A 2E2IH 1X3EA 4UP9A 4LUOA 4A3MG 3ER0A 4A3IH 4OONA 1A0IA 2VS1A 5IYDG 1XPOA 1VQLA 3GTLH 3H0GG 3RN5A 1HNWL 5K36G 4LF6L 1TWAH 1FGUA 2KHJA 1H95A 4IPCA 5IYBH 2CCZA 4JV5L 2R93G 3BJUA 2OWOA 4LF8L 4DR5Q 4L5RC 2H5XA 3OTOQ 4LF4L 2N78A 1A62A 5AJ3L 2NN6G 1CKNA 1VQBA 4POGA 3S16H 2R92G 3TS2A 3AEVA 1KL9A 3I56A 1SFOH 4TQUS 1FVIA 2MQHA 2PNHA 4DV4Q 4B3RL 2EQSA 1IBLL 1RIPA 2ID0A 2RCNA 1CKOA 3VDYA 4X64L 1IXRA 4XTCS 4IO9A 4A3CG 2GVAA 3MXNB 4DV6L 3AFQA 4QIWE 1ASZA 1EUJA 4ALPA 4QQBX 5JEAG 3JAMc 1XPUA 2K5NA 2VW9A 2I0QA 4A3GH 4GS3A 4GNXB 3Q8DA 1X55A 3IRBA 4ME3A 5M3MH 4YWLA 1HNZL 4JI8L 4JI6L 4DKAC 1KQSA 5J3BA 2ZM6L 1PVOA 1OXXK 4HIDA 4UY8C 1J5EQ 3HOYG 1IBKL 3CC2A 3S2DH 4A93H 1IL2A 4DR6L 1TWCH 1VQCA 2BA0A 3J80i 1VQ7A 4DV2Q 3PUWA 2R6GA 1R9TH 4X65L 4OWXB 4A75A 1PV4A 4Y52H 3HOWG 4PZ7A 4B3SQ 3STBC 4OX9L 3PSIA 1G51A 4JI3Q 2YYZA 4X62Q 4R1JA 4IJHA 4JI4L 2ASBA 1PH8A 2UUAL 1PH3A 2VNUD 4HIOA 2UXCQ 3FP9A 5C44G 1EOVA 3W5OA 1BBUA 3G48A 5C4XH 1L2FA 4LFAQ 1XMOL 1E1OA 3RZDH 2I5HA 3CCJA 1VQ6A 2AMCB 4GOPB 1SROA 3M85A 3ZJYC 1JJ2A 1BBWA 3TQYA 1B7YB 1W2BA 4JCVE 1V1QA 4C3JH 2B29A 2EDUA 4YWMA 2KBNA 5C3EG 4DV5L 4BBSH 4GN5A 4Y7NH 3KOJA 2EXDA 2E8GA 3AQQA 4DV1Q 3D0FA 3PO3G 3B6YA 5IT9c 3J7ZC 3KLWA 3PUZA 5M5YH 5IP9H 4LFBL 1N32Q 4P71A 3DM3A 5GROA 1HZCA 2BA1A 4BY7H 1HZ9A 3HOVH 5BR8Q 2UXBL 1LTLA 3OYYA 4IPGA 4YHHQ 4LUVA 4DV7L 1HJPA 1AE2A 1NY4A 4LF6Q 5ELOA 1HZAA 1M90C 1XNQQ 2ATWA 1OTCA 3PCOB 1LM0A 1OXUA 1QVCA 2K14A 4L5QA 1Q12A 4LF4Q 1EQRA 4DR7Q 3D31A 5E7NA 3RR5A 2JA5H 2JQOA 1A63A 4PZ6A 5AJ3Q 2ZJRA 3HOUH 3S1RH 1PH2A 1K8GA 5IP7G 3A5UA 3HOXH 3CMAA 2IHFA 1PFSA 3UDGA 1Q82C 2KENA 2YTXA 1IBLQ 1N33Q 2ZTDA 4A76A 3M7NA 2HQLA 3J81c 1YEZA 1BKBA 4X64Q 1KXLA 2VZAA 3ULLA 1QUQB 4A4IA 4AYBG 4NPSA 2ZJPA 4DV6Q 4C2MH 3PF4A 3M4QA 5IYCH 4UPAA 4GLVB 1UE6A 5GAGC 1XJVA 1W3SA 3KF6B 3EIVA 2JE6I 2Z6KC 2NVTH 1XMQQ 1JB7A 1K0RA 3ERSX 4A3IG 1HNZQ 3J7A5 3A74A 3PUYA 4JI6Q 2VY3A 4LF5Q 1PYSB 4BY1H 2R7ZH 4A3LH 5JJLA 4HIMA 1VQ8A 1SE8A 3FKIH 4K0KQ 4B3MQ 2ZM6Q 1YHQA 1E24A 1VQDA 4AQYQ 1YNXA 3M9BA 1TWHH 1FL0A 3S1MH 1KD1C 4A3JG 1AE3A 2UXDL 3T1YL 3RLFA 4R4OA 3PO2H 4A3EH 4DR6Q 2JA8G 3PV0A 1B8AA 1Y1VG 2ZTCA 1EWIA 1YBYA 2YV5A 1HH2P 1Y14B 1J6QA 5IY0A 4X65Q 3K0XA 1CKNB 3KYHC 1HR0W 2HT1A 5GAEC 2K5VA 1WCMG 2QEXA 5LMNL 4OX9Q 4OO1I 4JI4Q 2Y0SE 2UUAQ 3F2CA 2R7FA 3E9IA 1L0WA 3KF6A 4EX5A 4HJ8A 1XMOQ 4A3KG 5H1SE 3L7ZC 1N36L 1L1OC 2I5MX 4DV0L 3M3YH 4JI5L 2B63H 3I4MH 4NXNL 4POFA 4LFCL 3NELA 1VQNA 1Q1EA 3CCLA 4YWKA 1S72A 1N9WA 3U58A 3S1NH 3G71A 4BXXH 2RHSB 4LWCA 4LFBQ 1P16A 1QZHA 2R7DA 4YCVA 2E2JH 4A93G 2JA7G 5JJIA 3TREA 2UUBL 4DV7Q 4GKJL 3GTQH 2KHIA 1EQQA 3S2HH 1PH5A 2K5HA 4A3FG 2F4VL 3SGIA 1JJGA 3HOZH 5JJKA 3KDFA 2N8NA 5FJ8H 2K50A 5M3FH 4DUZL 1P8LA 4JI1L 4LW1A 4JI2L 2VL6A 4KHPL 3RN2A 3H3VI 4OXPA 2ZJQA 4A3BH 2N3SA 2NZHA 1N34L 2ZTEA 5C4XG 2I5LX 2OQKA 3UE0A 1PH6A 2CFMA 2DUDA 1E7ZA 2NN6I 4NXML 4DV3L 1UWVA 4JC0A 2JA9A 1UE1A 1VQGA 4JOIC 2VUMH 1NE3A 1S3OA 3HKZE 4LF7L 4DR1L 3KF8B 5M5WH 4JI7L 2Q2IA 1YITA 1HNXQ 4DR2L 2YU9H 1X56A 4BY7G 2VQFL 3HOVG 3JAMi 2OCEA 2CQOA 4X66L 5IYDH 2AHOB 3H0GH 2VQEL 1NTGA 1KC8C 3CC4A 4J15A 5JEAJ 4AH6A 1ASYA 3H3VH 3F8TA 1UE5A 4PZ8A 2IHEA 4UP8A 1YVCA 4HJ7A 4IFDG 3CPFA 2KCMA 3M4OH 4B3TL 2F52A 4DK6C 1PH1A 3NEMA 1YI2A 1VQ5A 3I4NG 5HGQA 3GTMH 3BZCA 4P73A 2R92H 1PHJA 1LYLA 5LMNQ 1D8LA 4HJ9A 2ES2A 4GN3B 4H02A 2JA6G 3PUXA 2D62A 1PA6A 4JBJA 2YTVA 1YHAA 2MO0A 4DR4L 4DAYB 3CPWA 1N36Q 3ULPA 2V1CC 1X3FA 1HNWQ 1I94L 4DV0Q 3S14H 4JI5Q 3F1ZA 1MJCA 3UDFA 4A3DG 4LFCQ 2WB1E 4BBRG 2NVYH 4JV5Q 1K9MC 3GTGH 4LF8Q 4A3LG 1Z9FA 1K73C 3CF5A 3RZOH 4GNXC 1VQKA 1HZBA 1N8RC 4IOCA 2K52A 2Q2UA 4LF9L 3NENA 2K75A 3HOYH 4O2DA 1SN8A 4DUYL 1SMXA 5M5XH 3GTKH 3PIOA 2HIVA 2LXKA 3HKSA 2UUBQ 4GKJQ 1PH7A 3KJOA 1FJGL 1T9HA 4B3RQ 4JI0L 2CKZB 2F4VQ 2RF4A 2QA4A 3G4SA 2Z6KA 3K80C 5LMUL 1Q46A 3L0OA 3EN2A 4DUZQ 3HOWH 4IOAA 5C0XG 5C4JH 1NMFA 2PI2A 2Y0SG 3CP0A 1Y1WG 4YCUA 1EYGA 3CMEA 3W1BA 3CQZH 2CWAA 3TS0A 1N34Q 3TEHB 1RL2A 1GD7A 3F2BA 3CW2C 4JI8Q 1IYJB 1SRUA 4LUZA 1WJJA 4QJFA 1MJEA 3S24A 2BH2A 4MTNA 4R4QA 1TWFH 2OTJA 2DGYA 5IYBG 5DLQE 1JMCA 1WI5A 3GO5A 3ULJA 4DR3L 1IBKQ 5C3EH 4BXXG 2JEAI 4DR1Q 4GOPC 1VQPA 2E5LL 3UDIA 4MNOA 3PO3H 3MEFA 4DR2Q 1EIFA 4DK3C 4GN4B 3STBD 1VQIA 4O0AA 3PF5A 2VQFQ 1VQMA 4YY3L 4X66Q 3CCRA 1XNRL 2QGQA 3AYHB 3RLNA 4OO1G 3I4OA 1SLJA 4L5TA 5GQOA 2VQEQ 1L1OA 3CCQA 2Q2HA 1X9NA 4R4IA 3KDFB 2JJQA 5FJ8G 5M3FG 4B3SL 2MNAA 1X3GA 3K81C 3S1QH 4B3TQ 2PI2E 5IWAL 4A3BG 1BVSA 4A3GG 5M3MG 3BU2A 4OWTB 4UP7A 4AIMA 4DV5Q 3GDEA 1VQJA 4APVA 4BBSG 1G6PA 5EAYA 1PYBA 3CCSA 2PQAB 3JC66 1NJIC 2D0OA 2WAQE 4JYAL 1X54A 4GKKL 2UXBQ 1KHIA 4DV1L 1K83H 3HKZG 4R4CA 1VS0A 1YJWA 1N32L 4BA2I 3A5ZB 2UU9L 4KI0A 1B70B 1U0LA 3K7UC 4C3HH 4DNIA 5BR8L 1CSQA 3KJPA 3OW2A 4YHHL 3K8AA 4P75A 3CCMA 1XNQL 3WWVA 3LGJA 3U50C 2Q2TA 3RLOA 3AFPA 4A3JH 4LF9Q 2JK8A 4DUYQ 2YTYA 4HIKA 4JOIA 3CCVA 1QVFA 2JA8H 1Y1VH 4DAMA 4QL5A 4DR7L 3GTJH 1WOCA 2A1AA 2PMZE 1FJGQ 3H15A 3M4PA 4JI0Q 3UDXA 5FLMH 3J81j 3U4VA 1YIJA 1I6HH 1NMGA 1WCMH 5LMUQ 3CXCA 2HHHL 2IX1A
chains in the Genus database with same CATH superfamily
3HKZC 9ICXA 4BGDA 4R4TA 4R65A 2HCFA 3MZ5A 3DMUA 3KHGA 1I50H 3NTHA 1DONA 2UUCL 4HAIA 2H3FA 1A6XA 1EY7A 2CWPA 2WINB 2AQ4A 5M9OA 5KL8B 5CP2A 5IIJA 3PW2A 1QWYA 1HR0L 4OJ6A 2UXDQ 1Q8KA 5ELCA 4DR3Q 5KRUA 5KFNA 7ICIA 2KA7A 4NDXA 1TS2A 4P74A 3GIJA 1PVQA 2JA5G 4MHVA 1U47A 3HOUG 2YN4A 4F2RA 2XTIA 2LXJA 2ZXRA 4O3SA 1DOQA 3QEAZ 1S97A 5KFYA 4IC9A 4ED7A 1X65A 2A8VA 2EJMA 4P0PB 4FNFA 1G291 3TP8A 1IBML 2K04A 1ZQHA 3TAQA 4KLKA 1HA5A 3TMEA 2JEBI 5JJZA 4A3FH 1Z1BA 3MXNA 1K3BC 1V1OA 4M47A 4UASA 4KJOA 2D0PA 2WF9A 1VQHA 4KKSA 5KYIA 5IWAQ 2B63B 2W9BB 3M3YB 2C35B 5IIFA 4C8LA 3RBDA 2XVTA 3CCEA 1X6JA 4IFDI 4WJ3M 1PTOC 4NLNA 1JE5A 2JEJA 2R7ZG 1XU4A 3FKIG 9ICLA 2C28A 1ZD2P 2SDFA 1JRPA 2NRWA 2IHMA 5IT9L 3V05A 4EENA 2HBLA 3P1HA 2B6GA 3PO2G 1KLGD 1JROA 8ICNA 2A68D 5JVG3 4LJZC 3OTOL 2NTSA 2A19A 3SYZA 5AM2A 2NBFA 1LV9A 5CV5A 2BKEA 4QCLA 5EGTA 1ENFA 1H9SA 4C3IH 7ICKA 4C3HB 1VQ9A 3BS5B 3DLLA 2GVBA 4DPGA 4DV4L 2MFIA 3GTOH 2W04A 3LWLA 1I4XA 3G6VA 1RPLA 3C29A 4IFDH 3PGZA 5LL6S 2VB2X 1C48A 1GHKA 1S5BD 4PZOA 3CAMA 2XY5A 5L1KA 4PMWA 1SSOA 2KQ3A 4M9HA 1PFMA 2O4XA 1N5WA 2WHEA 2JA6H 1I50B 3F2DA 2PMZF 1IZ6A 1CUKA 5D4BA 4GLXA 1RZTA 3RR8A 2AQ0A 4K2KA 2YU9B 4JI7Q 4RPZA 4TUPA 2Q8IB 5AKXA 3PW5A 2W3SA 1CSPA 2JH1A 3E0EA 3SR6A 3OOCA 3T1HQ 2VJ4A 4P4PA 4IS7A 4TUQA 2WAQG 5T1GA 3QZ7A 5HR6A 1GUWA 2DFLA 7ICMA 2JN4A 5CV7A 1CTMA 3HOZG 4GLAC 2KMDA 3Q8RB 1K28A 4WJ4A 8ICZA 4JI3L 4OWWB 3ALRA 2RRDA 1UT5A 5KFIA 1DJRD 5EE3A 5AICA 1JWMD 1BCPB 2XICA 1VQEA 2Z0SA 3P7JA 2PZWA 4JBMA 1KAWA 2G06A 2PKEA 1IV8A 1Q3UA 1STAA 4TVAB 2YY6A 1TS4A 4A3FB 8ICKA 5KFMA 4XT1B 5DLQE 4GXJA 5KFAA 1N5XA 4DL3A 4IZ8A 1HEKA 4QF4A 2VUMG 3E5SA 1BPXA 5DBBA 2OQ0A 2ISOA 1TXYA 2RHQB 3NUCA 2BCRA 3ICEA 2JRZA 5KT3A 1Y1WH 5K4LA 5L9XA 5JU5A 4RQMA 4UP9A 4F5RA 4A3MG 3ER0A 4A3IH 3PO5A 2YMQA 4MFCA 1G2SA 5IYDG 3H0GG 3RN5A 2P6RA 2WACA 4IPCA 3TKAA 3GTKB 4J9RA 2NRVA 4LF8L 3NBHA 5A2QE 2KN7A 2EAMA 4C3IB 3D3RA 3SAGA 3KBXA 1CKNA 2Y1IA 1NR2A 2R92G 5CYUA 1A77A 1KKXA 2A68C 1FVIA 4QZDA 3Q6SA 3GTOB 1BPDA 9ICTA 1IBLL 1COKA 1WCLA 3VDYA 4X64L 1T94A 4DFPA 5KFUA 1NJZA 1EUJA 4JK1C 2HD3A 5G5GA 4IRKA 5JEAG 4F7XA 2I0QA 1ZQCA 4GNXB 4DSJA 2L55A 4WJWA 4NLGA 4KLHA 1E0BA 2CVRA 4YWLA 5J39A 2YX8A 5C3EB 1HNZL 1A76A 4ED2A 3FAHA 2WF5A 5J29A 1L0YB 2ZM6L 4QUFA 5BN4A 2EVBA 3CC2A 2NRZA 1CHPD 1TWCH 4FVMA 7ICTA 5KAIU 4X65L 2KOLA 1ZQGA 1T5EA 4YIJA 3J81E 1ZQ1C 2O6KA 4Y52H 1MQ3A 5KFWA 2ESEA 2A6ED 4PZ7A 3STBC 3I28A 3K1ZA 1KQQA 1S0OA 1M6YA 1ZQFA 4UAWA 1PK1B 4ZAIA 4R8IA 2VIXA 2UXCQ 3RH5A 2B2UC 5C4XH 1L2FA 4LFAQ 2KP7A 4UBCA 4ZUJA 3OWEB 1AZQA 2L12A 4KX5A 4F4KA 3ZJYC 3HILA 1KAAA 2EYFA 1NUCA 1TVAA 3R3OA 4C3JH 3EROA 5I9OA 1WTPA 3QWNA 4K4IA 1Y1WB 2EZYA 1YZ7A 9ICIA 2E8GA 4P4MA 3AQQA 4DV1Q 2EPBA 3B6YA 3PUZA 2F1JA 2KCCA 1Z00B 5EE1A 3IN5A 9ICAA 2D5DA 4PHAA 3DM3A 2BA1A 4P71A 5DB9A 5BR8Q 4C1NI 4IPGA 1M8AA 5F9NA 1AE2A 1QNUA 5ELOA 4LF6Q 2O5JC 4RA8A 4PHDA 4G3IA 1OTCA 1LM0A 1ZXIA 1LTTD 2JA8B 3QXGA 2MUTB 4L5QA 5FOBB 4LF4Q 2WFAA 1PTOH 3QX7A 3D31A 5E7NA 3EZ5A 3RR5A 4RNMA 4UATA 4DGZA 5DBCA 5AI6A 1LV5A 2CQAA 5AJ3Q 3S1RH 5J2KA 5IGDA 5J8YC 3CMAA 5EKIA 4A3IB 2AUJD 4KTQA 1XX8A 2FMMA 3WU2U 2KENA 1N33Q 3RAQA 3PMLA 3FRPB 4M2YA 3N6RA 5COYA 3J81c 2W7OA 4I27A 1BKBA 1KLUD 2ZXIA 1YEZA 5J0XA 1QUQB 2VZAA 3H4DA 3E0JA 1JUDA 1VMCA 4QIWB 2BDUA 1XNSA 5IYCH 1UNSA 3EW9A 4DCCA 1XJVA 2JMGA 1W3SA 5L1LA 3KF6B 5J2HA 2EJFC 2Z6KC 4GFJA 4FBUA 1JXLA 5BOLA 3PUYA 4RH6A 4JI6Q 4BY1H 4M9NA 4NLBA 3C2KA 3M9NB 1YNXA 3TBIB 3S1MH 3QZ8A 1XWEA 3T1YL 1TWCB 3RD4A 4R4OA 4DR6Q 4QZHA 4I2JA 3PMNA 1B8AA 3HKZB 1EWIA 4N8FA 5A35A 1HH2P 4C4SA 3KYHC 5EJWA 5C3XA 5GAEC 2KVSA 1SJHD 5LMNL 4OX9Q 2Q0ZX 1O03A 2Y0SE 3SD7A 2LM4A 3QJYA 3E9IA 3H09A 5C4XB 3M6ZA 3PMFA 4RQ8A 3LWMA 4KK7A 5F2DA 4A3KG 4HYKA 2PPBC 2A6EC 3L7ZC 4FE3A 3CYMA 4KKUA 1L1OC 4B9SA 1QG7A 1WCNA 3PSFA 3AMZA 3OIPA 3I4MH 4U673 2MSNA 1ZQXA 4Y2YA 3TQ1A 4LFCL 2KSOB 2MRLA 3ZDBA 4O3RA 1RJTA 1VQNA 3OHXC 3A56A 2RHSB 4DL7A 3IFTA 3NHHA 3HRZC 3ND8A 3SQIA 4YCVA 2ES6A 1X40A 2KK0A 1RXVA 2KIWA 5ALDA 2LMCB 5JJIA 3D6CA 2DNCA 2UUBL 4GKJL 2D8CA 1N56A 1I3QB 2LMRA 1BPEA 3S2HH 2YB4A 1PH5A 2EY2A 4CKBA 2F4VL 5DB7A 3QU9A 3KDFA 4JI7L 5JJKA 1PTOB 1RQLA 5FJ8H 5M3FH 4LW1A 5ALRA 1NI3A 5ELBA 3A0HU 2VL6A 3S1RB 3I4NB 4KHPL 3RJIA 3PW7A 4OXPA 1O80A 2B0CA 3TP5A 1SB3C 3GIIA 2B2VA 2I5LX 2QDLA 2DUYA 5KFHA 3RB0A 2QILA 3UE0A 2CFMA 3OHAA 4RGNA 2EZXA 4WORA 3VC8A 3LYSA 1KFTA 2RA4A 4QWDA 1A15A 2QB0B 2JA9A 1S77D 3OTQA 3EJIA 5AM5A 5ALKA 5KFGA 3X3NA 2ZXOA 4XDXA 1JXEA 1S3OA 5DM73 4CDGA 3IG8A 5B66U 3H4BA 1PYWD 4O1NA 1W6KA 4L6TB 4DR2L 1PRTC 1X56A 5KG4A 2I6XA 4RT3A 3D4DA 4BY1B 1EYAA 1WTQA 3HOVG 5E4XA 2V4DA 4UB8U 1A0PA 1NKBA 4ELTA 1NTGA 3MEHA 3Q24A 3S1MB 4J15A 1SYGA 5DG8A 7ICNA 1L5UA 4O42A 4DXFA 2KCMA 3N97B 3WKCA 1PVPA 2BQUA 3N7RC 4DK6C 1PH1A 3AN1A 2XRSD 1VQ5A 1NK9A 5DKWA 4KLJA 3GTMH 2FPKA 3BZCA 5J2IA 4LJXA 1EFID 1HCZA 1L3TA 3BVMA 4H02A 1TAQA 1EWCA 1PA6A 1BPBA 4JMUA 4I2IA 4IUNA 2ODGA 4JBJA 3PIP3 4ECTA 4FS1A 3FDTA 5JPMC 1Z19A 2MO0A 2ICIA 4RQ6A 2Y0SF 3RB6A 2V1CC 1X3FA 1HNWQ 1LVHA 4PHPA 4I7ZC 4CHTB 3MAQA 4DV0Q 4P0QB 3S14H 3I55A 2IPKD 5ALFA 4BBRG 2NVYH 4ILWA 8ICVA 2P66A 5EQ0A 4U7CA 4RPYA 4F4XA 1Z9FA 4A3LG 2ZT9C 2GLEA 3ICXA 5KNBA 1HZBA 1Z4OA 4J6HA 2OXOA 2Q2UA 1PFNA 2K75A 4DUYL 3H0LB 2KIVA 4IR1A 1SMXA 3L3OC 5M5XH 4B9WA 4Q8FA 1FJGL 1LKYA 3S2HB 5EKLA 2I1QA 3PIO3 3MGVA 4JI0L 5IGFA 5AKEA 2AQ3B 3BZDB 2RF4A 5M3FB 3G4SA 3MR6A 5LMUL 1Q46A 2KKPA 1L3VA 3BDCA 3EN2A 4H7BA 2PI2A 3SVMA 2HOQA 3ORYA 1GUGA 1AQ6A 2CWAA 5M3MB 2XNAC 4QW9A 3H0RB 2BPFA 1HFGA 4NM2A 2W54A 3F2BA 3QUCA 1RTOA 3M1YA 1WJJA 2D2CC 2BHNA 2ZIVB 5KNIA 2GA4B 2BH2A 4R4QA 1X6IA 9ICKA 1JMCA 3H8MA 3R9KA 4ABNA 3GO5A 3MHBA 2DJFC 3CKIB 3ULJA 1IBKQ 2OEOA 4HCEA 3SE0A 2ZIUA 4OJLA 5AHXA 4BXXG 1PZID 3A0BU 3UDIA 4AYBC 3PO3H 3MEFA 3BJYA 1EIFA 1Z3EB 3E0FA 4R8UA 3BYTB 4QMGA 4DFJA 3PF5A 4RU9A 4KITB 5F9LA 1TVXA 4X66Q 1XNRL 2IX3A 3AYHB 1ZQOA 4OO1G 4DF8A 4L5TA 4NKLA 2LBOA 3J80E 1AN8A 2Q2HA 2OT2A 4DLEA 2IL8A 2G5HB 4B3SL 3H6MA 2MNAA 3NRWA 3BDLA 4Y2RA 3K81C 2FFKB 1RF2D 4XQNA 2PI2E 5I4DA 1ZD5A 4UB5A 1IM4A 2EOTA 3GTMB 4A3GG 1L7OA 5IODA 3M9OB 5DQHA 5CWRA 2B8GA 4UP7A 4DFDA 4RQ3A 9ICUA 4Z6EA 1LT4D 5KFKA 1RG6A 4DNRB 4DFKA 3GP7A 2B2YA 3VR2A 2K60A 2L5YA 1PYBA 4JYAL 3NUQA 1QSLA 5KAFU 4NJ8A 1PFBA 2WAQE 3S14B 4ID6A 3URYA 4IQZA 3M8RA 2DF4B 1HTPA 2J4XA 2NVYB 3WK6A 2Z1CA 3OSOA 1B53A 3A5ZB 4UW9A 2IHNA 1U0LA 2WB1B 4KI0A 3OW2A 4RGMA 4I7AA 1NNXA 2RHFA 4RCOA 3I76A 5T1IA 2XWJB 3U50C 1RODA 1SYEA 4R63A 4KLMA 2L4NA 3OW7A 5M5XB 1P7DA 2JK8A 7ICHA 4JOIA 1X32A 2HQEA 3SEBA 1Y1VH 1QVFA 2A1AA 2B8FA 3M4PA 3UDXA 3RJKA 4EZ6A 5AKGA 4DL6A 1QSSA 1WCMH 3CXCA 2HHHL 4KLGA 3NVZA 4O0IA 2PQAA 3BQTA 1JICA 3JAML 3J80c 5AKHA 5GTIU 2WP8J 2FJ2A 2IT1A 1SR3A 4B08A 4HJAA 2LI6A 5IIKA 3C46A 1ZQDA 3NBIA 4DAPA 4DOAA 2QCPX 4RGTA 1C7YA 5K36H 8ICRA 2NUCA 1Q1BA 5BOMA 3T3FA 4BA1I 1QVGA 1XMQL 2UXBQ 2FLPA 5HHIA 2TMPA 1SNCA 4ED3A 1ZYRD 3QIAA 4M04A 2AKWB 4A3EB 1LTAD 2LSSA 5HY6A 5C5MA 3Q23A 1HUZA 4LF5L 1KRSA 3KKAC 3PO3B 3ZD9A 1Q3VA 4AQYL 1UEBA 1C8CA 2B2VC 4K5XA 1STGA 1CK1A 1KW4A 3C5GA 4Y2QA 3HOXG 2JA7H 2TSSA 1BUVT 2K4PA 3GZFA 3KD3A 2HUGA 4YY3Q 4X3UA 1OUQA 3RNUA 1Z47A 2ISPA 3PW0A 3U4ZA 3C1EA 2FPMA 5JTIA 5ELNA 1STBA 1SNMA 3WK8A 4XQQA 3ZD8A 1MIUA 2NVXH 2N49A 1WUDA 4G7OC 1YJ9A 1VJ5A 2EYOA 3BDOA 2HIXA 4PL1A 2EZVA 4TSSA 2BR0A 4UB1A 4IUTA 4EGVA 3B0XA 4JG2A 4UAVA 4QJFB 4KX3A 1V9PA 3KBGA 9ICWA 1RD9D 4Y2XA 3SV4A 3FHWA 5AI8A 2UVRA 4B9VA 3OMGA 4ELUA 4P72A 4ZYSA 4DOBA 2MO1A 5J22A 3GTQB 2B2TA 1SAPA 2YMMA 1PXUA 1YHBA 4IUUA 4RG1A 1FYCA 4X6AH 2A1JA 1A8VA 1D5XC 2ATLA 4QY7A 2X69A 5FLXE 3DWAA 1N32Q 4JI1Q 2WAQF 4JI2Q 2RLTA 1ZYQA 2F3NA 2IOHA 1L1OB 4CDEC 5DB8A 1XSLA 3UXOA 5ALJA 1Y1VB 1C0AA 2BZFA 5KFCA 2F0HA 4JW0A 3DWPA 3JPPA 4PG3A 2QARB 1E22A 1I4HA 1GUOA 1B2TA 3BZKA 5CJ7A 2KCNA 4DV3Q 1WCMB 4GOPA 4NXMQ 2B63G 5DLGA 4MZ9A 5CHGA 4RT2A 1UQVA 1F2LA 1OXJA 1MSHA 4H44C 2KHQA 1A6SA 4LF7Q 4NLCA 1A2TA 1A3UA 3FDSA 1EIYB 1G8ZD 3NTKA 1J5EL 4UHVA 2UUCQ 1VQOA 5C0XI 4KLTA 3SV3A 1IW7D 3PX4A 2OTLA 4DV2L 2F76X 4V190 4UAYA 2WF7A 1ESFA 2ZIXA 2R3ZA 4IPHA 3L3FX 4NL9A 2W11A 1N48A 1V43A 3I72A 1HR0Q 1I4RA 2LHTA 4TKOB 4MEYA 5DQIA 1OO9B 1SYBA 4DS4A 1SNOA 4Q45A 3R8BA 3SHLA 3GDXA 4YP3A 4X62L 4HJ5A 4QGUA 1Q3LA 2JEFA 1UE7A 1Z7TA 4CGZA 4L5SA 2BCOA 3NQTA 2NO5A 3QUTA 2KEDA 3NBHB 2FE9A 2A73B 1GKHA 4BWJA 3ZDEA 3U26A 1Z6HA 2ALYB 5IP7H 3K5MA 2YB1A 1G2TA 3NWSA 1IBMQ 1EEID 2KNJA 4K5VA 1SZPA 1XPRA 1PRTB 5I6WA 5FLXc 1HTLD 4U68A 2EIFA 1EY0A 1NBWA 4DR4Q 1N62A 5AKKA 1O08A 4KHZA 1MBYA 5C0XH 2E2IH 1OXTA 5CBEE 1PH4A 4ME5A 1X3EA 1WD0A 5J0UA 3F2UA 5EBCA 1O7ZA 2ASJA 3R2TA 1VQLA 2NYZD 3GV6A 4BWMA 3PNCA 4KLEA 2W7PA 5G3LD 5J1ZA 2CCZA 4JV5L 1ZQBA 2PI4A 5KT2A 2AUKA 4F4YA 1TT2A 4DR5Q 4L5RC 5I2YA 3OTOQ 4KD4A 2O5IC 5ALYA 4MIUA 2NN6G 3AQEA 4DL2A 2I9GA 1ILQA 1VQBA 3A7AB 1FR3A 1WTRA 4POGA 3TS2A 4PMCA 2HBKA 5AFWA 5C4JB 4TQUS 2MQHA 2MUYA 4DV4Q 4B3RL 4RQNA 3C5FA 2B2YC 4R9WA 4J1MA 1SGGA 4RKBA 1IXRA 2GWSA 5IT9E 2ZJ5A 2GVAA 3RH6A 4CF4A 2M9NA 7ICGA 3Q22A 4DV6L 4ALPA 2LYBA 2X6GA 4QQBX 1XPUA 1WWVA 4U6PA 1HHVA 1QLNA 5KG5A 5HMMA 3Q8DA 4CGYB 3MC0B 2DPIA 3PO4A 2OEHA 8ICUA 2JYOA 3OPOA 4J9LA 1J8IA 3MR3A 4DKAC 4IQUA 1KQSA 1D5MC 4DSIA 3NSWA 2XY7A 3IFDA 4HSPA 1HQRD 5G3LF 3HOYG 3S2DH 4A93H 3VYTA 1IL2A 2F0LA 3N52A 5D46A 1VQCA 5KFTA 1VQ7A 1X3QA 2EZZA 2KD1A 4MN3A 4RQ1A 2R6GA 1R9TH 4M8AA 3DDHA 4A75A 8ICIA 1PV4A 2F0TA 4OIKA 3HOWG 3QUBA 4R64A 3SK8A 1S8OA 1G51A 4JI3Q 1IW7C 4IJHA 4BS9A 3TDQA 3WDNA 4GC7A 3BVGA 3ZDDA 4H0LC 2F0KA 2KEYA 4HIOA 5KIXA 2VNUD 5L1MA 1XMOL 2VA8A 3MABA 3VYSA 2HSZA 2I5HA 1EY8A 2W55A 3PSTA 5FKAC 5HR7A 1B3QA 4AYBB 2GOLA 1BBWA 1W2BA 1V1PA 3MWYW 1V1QA 2B29A 1V97A 4YWMA 4OEMB 5C3EG 4OX9L 1HPCA 2E2IB 1YJWA 2EXDA 3KF8A 1TY0A 2HHTA 1MGSA 4RHRA 2PI5A 5IT9c 3V7LA 2E1EA 3KLWA 5M5YH 2YMPA 1SYFA 4LFBL 1WTHA 1EEFD 1SMYD 1HZCA 3SAFA 5GROA 4P2CB 4BY7H 1K1SA 2M0NA 1HZ9A 3HS0C 4QZ9A 1LTLA 4YHHQ 4LUVA 1HJPA 1NY4A 2VB3X 2R8GA 1LO5D 5IOCA 4A3JB 3TFRA 2ATWA 2ASLA 8ICFA 1RCVD 4F5NA 1NK8A 1TV9A 1QVCA 2K14A 8ICPA 1MC8A 3KZXA 2P35A 4O3PA 2JA5H 4PZ6A 3RJJA 1QQ6A 4GXIA 1Q8IA 2BE5D 3HOUH 4A8EA 2E1FA 2IHFA 3OSNA 3FVQA 3UDGA 1G91A 1IBLQ 1EL0A 2YMLA 2HQLA 5FO7B 4X64Q 1KXLA 3ULLA 3PF4A 4M6WB 1BNOA 4PH5A 4RQ2A 2G0AA 1RM6C 1TAUA 2B2TC 3QU7A 4KN4C 4C1NK 4CJ2C 4DAYA 4YG2A 4EBDA 3A8JE 8ICWA 4X5VA 2HDMA 3NPPA 2JE6I 1L3UA 2NVTH 1K0RA 4A3IG 3LK9A 4ECXA 3ISBA 1LT3D 1NAPA 1S5ED 2VY3A 3PQIA 1HNZQ 2R7ZH 5G5HA 1U9RA 4K6DA 1SE8A 4MFAA 3FKIH 3T5KA 4HSVA 3GQBA 2F0MA 1E24A 4K14A 2ZM6Q 4B3MQ 4K0KQ 3M9BA 4F2SA 3ZI4A 4A93B 4X3KA 3S2DB 2UXDL 3RLFA 1EYDA 2V4QA 3C2PA 3PO2H 2JA8G 1BGXT 2ZTCA 5KFPA 1R9TB 1NCVA 4RKLA 4ECSA 3T5HA 1X9MA 1SV0A 2BDPA 1I6VC 5IY0A 4QUCA 4KLFA 4X65Q 2QEXA 1JMSA 1E2VA 4QZFA 2K01A 3BYYB 1N61A 5FK9C 3L4PA 3VR4A 3F2CA 4IUQA 2FHTA 1DK3A 4OO1J 1M4VA 4DQSA 4EX5A 1Y88A 1I4QA 4O3MA 5H1SE 4FFDA 1N36L 3M6KA 3MTSA 3RJEA 2SNSA 5ALMA 5IINA 3ONAB 3FPUB 2HBMA 2MA1A 5HURA 1Q1EA 4IQWA 5IIMA 2RDFA 2SOBA 2G5DA 1S72A 3U58A 1F0MA 2K8AA 2OM6A 2PMZC 2KJ8A 1L7PA 2K4HA 1XS9D 5J2EA 1KDHA 1QZHA 2R7DA 1S4ZA 2E2JH 3MR2A 4RCNA 4BY7B 2WF8A 1D6EC 2Q8TA 3KLSX 3VA7A 3TADC 2HHXA 2DQNB 5HGTA 2JZBA 3MGIA 2J6TA 3SGIA 3HOZH 2G08A 5ALTA 4I2CA 2XY6A 1P8LA 1SNPA 1SMYC 5FO9B 5J0PA 5E79U 4L8JA 3HOUB 4P2HA 1XC9A 2NZHA 5KG7A 2ZTEA 1NK4A 1V85A 1N34L 5C4XG 4QW8A 5KG0A 2JA6B 5KFZA 3EPGA 2DUDA 1TE2A 5DQGA 3H40A 5EPKA 2XSCA 4ED0A 4I29A 9ICFA 1ZQTA 4JC0A 3MDAA 4NP5A 4J9SA 3WOFA 2PFPA 3NXWA 2VUMH 3OPXA 4O5KA 1QCBD 4H13C 2E8PA 5M5WH 2K03A 4C7YA 3GV5B 2BCQA 4E0DA 4KLLA 4G7ZC 1HNXQ 2NVTB 2W9CB 3LDAA 1FFUA 5C3WA 1U48A 4BDPA 5E4WC 5DDMA 3FKIB 2OCEA 2CQOA 5IYDH 7ICFA 3RJGA 1IL8A 1UT8A 1NNLA 2B21A 4EELA 3OJSA 3EA6A 3H0GH 1EYCA 2CHBD 2J7ZA 4ED8A 4AH6A 1KC8C 3H91A 4OIJA 3F8TA 3DM1A 3PO2B 2W9MA 2IHEA 3RH4A 4PZ8A 5D3DA 5EPLA 4ZCKA 2FJ6A 4BUGA 4NLZA 4DN4M 2J6SA 2F52A 3BS1A 3ND9A 2X6LA 4MFFA 3MFHA 2XI9A 4EBEA 1CQFA 5CMDA 3I4NG 5HGQA 1XTCD 3PR4A 2XIDA 2R92H 5JRTA 5LMNQ 1D8LA 4GN3B 3V96A 5GTHU 2F3WA 3IP4B 2YTVA 2J0TD 1ZQMA 1DM0B 1FNVA 1TQOA 3KK7A 3X3MA 1ZQQA 5A2QL 2F44A 2YTUA 2VKQA 5JEAH 4XQJA 4I2BA 2KVMA 3CRLC 4C4TA 3F1ZA 2H3ZA 4JWNA 3RUZA 4LFCQ 4F4ZA 4UB2A 3VR6A 2N88A 3Q8LA 1K73C 3RZOH 1WTVA 2E2JB 1VQKA 9ICRA 1N8RC 1JR0D 1ET9A 1ECWA 1EQVA 1EWHA 4O2DA 1SN8A 4DSFA 5DB6A 4C8KA 4IR9A 2HIVA 2LXKA 3PIOA 2UUBQ 4GKJQ 1L3SA 1T9HA 2PCFB 1ZQZA 4G9BA 1RDFA 5CV4A 2F4VQ 2A3VA 1QOHA 4TQRA 3C1YA 3L0OA 4C0ZA 4UAUA 2XC9A 2QLTA 1NMFA 2C2RA 3FPPA 3NVWA 4PV1C 4ED1A 3CMEA 5KG2A 7ICLA 3TS0A 1UHUA 4OD0A 3CU7A 3LVWA 4JI8Q 3T53B 1IYJB 1SRUA 4LUZA 4DR5L 1WG8A 4ECUA 1QH9A 1J9OA 2RKSA 2EE1A 1TWFH 2KJ5A 8ICBA 5KEEA 2OTJA 5IYBG 2Y9UA 2HDOA 3OHBA 2HDLA 5ALOA 3WKDA 3S6JA 5M5WB 1MSWD 4F87A 4F8RA 2MPMA 2JEAI 2E5LL 3HG9A 4DR2Q 1L7MA 1L7NA 2AU0A 1LT6D 4GN4B 5ISRA 1AFPA 1VQIA 4FYDA 4I2EA 3BS5A 1SXEA 2KJ9A 3H0GB 4EEYA 3I4OA 1RQNA 2V9WA 4DQIA 3HP3A 4JPBW 1TAMA 1ET6A 3UMCA 1X9NA 2RBMA 2FMQA 4PZNA 5FJ8G 5AI0A 5CR3A 5M3FG 2Z7JA 3S1QH 4NLKA 3I3CA 4Y2PA 1NR4A 2K4EA 1NJWA 2KZZA 1XSPA 2CH4A 9ICSA 2DBYA 2EY6A 2R92B 2MGSA 3EFXD 4C3JB 5M3MG 3BU2A 4OWTB 4AIMA 5CV8A 2HMXA 2L11A 4DV5Q 3E2EA 3DEOA 3GDEA 2E76C 5BN5A 4GC6A 4YXJA 2DL0A 3F5EA 5ALUA 3C23A 4APVA 3C2LA 3KLRA 2B2WA 3UMGA 2F4IA 2PQAB 3CCSA 2YQEA 4CBVA 1X54A 4B9LA 1S5FD 2W8KA 2D9UA 2M9VA 4BX9C 1NK6A 4B6JA 4M9JA 1K83H 1VS0A 3G6JB 4DV1L 1JALA 5AKLA 1EIGA 2VXWA 4BXOA 3L9AX 1YT3A 4US8A 5K5PA 2UU9L 1F9PA 4DNIA 4PL2A 5BR8L 3GU3A 3RZOB 4KN7A 3WKAA 1T8EA 1EY6A 2DJGC 3QEBZ 4MTKA 1KABA 1R4PB 4P75A 3WWVA 1A3TA 4DK1A 5DEHA 4RUCA 8ICXA 3RLOA 1VF5C 3AFPA 2PNRC 4ZKBB 1BO0A 4DUYQ 3A54A 1G6ZA 1SKWA 4DAMA 4FO6A 4QL5A 2F1IA 1WOCA 3WK4A 1FJGQ 4QWEA 4ECRA 3H15A 3ISDA 1WWUA 4JI0Q 4YQWA 5FLMH 3U4VA 1YIJA 3D2NA 4Y2SA 3RJHA 5LMUQ 1DOKA 3TARA 3C1FA 2IX1A 4BBSG 3UXNA 1XTDA 1N33L 2ENBA 1QSYA 2N55A 5AKIA 4AP9A 2AWNA 5ALGA 2NVQH 5KT5A 4A3KH 1M1KC 1K3RA 5GADC 3S17H 4FP5D 5IGGA 2WFWA 4NW2A 3JPSA 4EYHB 3IV6A 2FLLA 1MD2D 3ETLA 3HGBA 3CD6A 2R93H 2SNMA 1ICFB 2WB1G 1U45A 4ZK9B 4NB3A 4JV2A 2BGWA 1Q90A 1KN5A 1T3QA 3NVVA 4LVSA 9ICMA 1ZXTA 1DGSA 4FS2A 3SAHA 4HMJA 5CV9A 4YXMA 2F0JA 1BR9A 2EYHA 3Q8PB 1DXMA 4Z9CB 1QZGA 3D4WA 1XNRQ 3A8KE 3AM9A 4UQGA 4I2DA 2G09A 5ALHA 4RZRA 2QF7A 4YMNA 5J2GA 1PUZA 5DGBA 4JB3A 2XVSA 4FZNA 3A0JA 3S1QB 4A3CH 1C9OA 1KRPA 2NZOA 9ICVA 4DO9A 3UQ2A 2ICEC 5DM63 5DG9A 1KNAA 3I4MB 4GNXA 3PR5B 1WFQA 2J6UA 4NXNQ 2FPLA 5I6YA 3IHQB 1X9SA 1ESRA 8ICMA 1TWGH 5EKKA 4V0BA 4GZYC 2RDJA 4LAAA 4IFDJ 1K5OA 2BOSA 1VQ4A 2K8BB 2ZJAA 1B44D 2NTTA 2FXQA 4A3EG 1J97A 2ZUCA 2L15A 4JYAQ 1K83B 4B9NA 9ICPA 2LPEA 4IQVA 4DQPA 3I8ZA 1SXTA 3S15H 2HOFA 1HQMC 1SBBB 5KL1B 3MXPA 4PMBA 4UB6U 4CKCA 5BN3A 2R61A 2XWBB 3BQ2A 4A76A 2E75C 1N2XA 5AM4A 1TK0A 3BVZA 4DLGA 1XO0A 1PK1A 4J9OA 5C44H 2EQYA 4WFN3 1E2WA 3K7AH 4Y2VA 1AZPA 4ODGA 2PMZB 1KLNA 4RPXA 1ZD4A 1MKHA 4KLIA 2BQRA 4M9LA 4EEKA 1SYCA 3L2PA 2HOIA 1B4FA 3ETRA 4F93B 2QEJC 2HHHQ 1S0MA 4IURA 4JBKA 1EFWA 4FDBA 3MGHA 4OCZA 2H1EA 4R8NA 1JX4A 4A3KB 3PZPA 3I7FA 1L6NA 3GTPH 1BNPA 1Z00A 3C3LA 3AQFA 1RKNA 3SR1A 4QZBA 3QR8A 1I4GA 2Y0SC 4NV0A 2IX0A 2G9HD 3UI2A 1Q86C 4RFBA 2R93B 2LS01 3EBEA 4ECQA 4BBRH 3U9OA 4PQXA 4LMQD 2MUTA 4OJPA 1ZQUA 9ICCA 4CDCC 3JAME 3ITPA 1CZWA 1QNKA 1ZQNA 2QDBA 4B9XA 1SNQA 5J2AA 5J2FA 4RQ0A 2DNEA 2JH7A 2ZIWB 3RAXA 3T51B 4TRDA 8ICLA 4Q5VA 1SJED 1EZ8A 4XT3B 4EQ5A 1Q7YC 2BPCA 4I28A 1QJOA 3O13A 4F92B 8ICTA 1TY2A 2BH8A 1QUQA 4FF1A 1ENCA 2E2HH 3TZDA 4K4HA 2BDOA 5KFEA 1JQYD 3VR3A 4DL4A 4N9PA 2F8LA 3D8GA 1CI4A 4IRCA 1I94Q 3LNNA 2EANA 2E74C 4LUOA 4KLQA 2Q4TA 1TWGB 3E3XA 4G7HC 2VS1A 1XPOA 1ZJMA 1HNWL 5K36G 5KFRA 4OJ5A 5TSSA 3KBBA 1W6JA 2KHJA 1IYVA 1H95A 4I65A 2OWOA 4DWIA 4ZRZA 2L5TA 8ICJA 2HHVA 3S15B 3CRXA 2E5SA 3RBEA 1A62A 4MHEA 4YN4A 1NOMA 2XCAA 4O9MA 2UVUA 1Y8OB 3S16H 3R93A 3M7DA 1ILPA 4RUAA 1KL9A 5E1FA 1SFOH 4DF7A 3DHQA 1S0NA 2EQSA 1RIPA 2ID0A 5CORA 2RCNA 9ICHA 1CKOA 5C44B 1XYIA 2K05A 3K7AB 4XTCS 3QU2A 3Q8QB 1F9RA 3MXNB 3AFQA 2KECA 4QIWE 2F0IA 1ASZA 3MA2B 3JAMc 3H3VC 3KOOA 5CA7A 5J0TA 4QWAA 4A3GH 2RP5A 4GS3A 2AXTU 2A5HA 4Q8EA 1X55A 5CC4A 5C0YA 4C56C 2KSOA 3LWUA 3Q8KA 2IJ0A 5ELEA 3RB3A 4HMIA 5J3BA 1ZQIA 2F0QA 2HHUA 4EVOA 3J80L 2QW7A 4UY8C 4KY6A 2F0SA 3I70A 1LTBD 1U9LA 1J5EQ 1IBKL 5AKJA 2EXZA 3G6YA 4UAZA 4UDUC 3UMBA 3J80i 4DV2Q 3PUWA 4YMMA 2AGPA 1WTOA 1H9SB 5ELFA 4OWXB 3L5KA 2Z9HA 1N60A 4IL6U 1KDAA 1XXGA 1SE4A 4JI4L 3NK9A 4X62Q 4N8X1 4QB4A 2UUAL 1PH3A 1KTKA 5ALNA 4I2FA 1WVLA 4S3SA 1BBUA 3G48A 1SZHA 5ALZA 2KZMA 1E1OA 2PW7A 4F88A 2HHQA 3RZDH 3FYHA 4O3OA 3RR7A 5CEHA 3WKEA 3CCJA 1VQ6A 4DL5A 1SROA 2E2HB 2QB0A 4K4GA 4JCVE 2EDUA 1JC7A 2KBNA 4KLOA 4KMUA 4F71A 4CCHA 2DY7A 1U4LA 1UA1A 1FD7D 3J7ZC 3TANA 1QB5D 2G07A 3EWAA 3GFKB 3KUPA 4RAUC 3V72A 4CDFC 4QWCA 2EY1A 5C4ZA 1GUNA 4DV7L 4QZIA 2EH9A 1HZAA 1ZQSA 1XNQQ 2XCPA 2WKDA 5LL6X 3KHHA 4ACOA 2E8NA 5KFFA 3PCOB 3DV9A 3E58A 5DBAA 1OXUA 4XYOA 7ICPA 5FP0A 1N63A 3AMUA 1GJXA 1UPHA 4DR7Q 2R8HA 2A74C 2BDNA 5J0SA 2JQOA 2HI0A 2FMPA 3SK4A 2MHVA 1JI7A 3VYRA 3S16B 5KG3A 1K8GA 5IP7G 3HOXH 4KHVA 1PFSA 4HN7A 3MXUA 2GO7A 1Q82C 4Q0FA 2JEIA 2YTXA 4Z6DA 2ZTDA 2ZUDA 3NVYA 1F2ZA 4AYBG 4DSEA 3TFSA 4NPSA 4DV6Q 4MF2A 4C2MH 1RYUA 3M4QA 3RF9A 4A3GB 2ZXHA 3SK5A 4UPAA 1Y8PB 4LZGA 4O3NA 4P0QA 1ZKOA 1Z4NA 2K33A 1JB7A 3ERSX 4C3HG 2QKQA 4QIWF 1TK8A 1JE4A 3A74A 4OL7A 3J7YW 5J2CA 3UM9A 2HHSA 5JJLA 5TZVA 4HIMA 1A2UA 1VQ8A 2EYJA 8ICQA 3J7AF 1YHQA 1VQDA 1CFMA 1KEJA 1KD1C 4A3JG 1FGBD 2MP1A 2JA7B 3WK5A 3MR5A 4RQ7A 2DKZA 1FEZA 1ZYRC 3PV0A 3BDPA 1D1KA 2F3VA 3BQ1A 3HX0A 1Y14B 2C22A 1B3AA 1J6QA 3K0XA 1CKNB 1HR0W 4OHJA 2NVXB 3D4RA 5AK4A 2LKVA 2WAQC 3HKZF 1L0XB 5KG1A 3ISCA 4OGQC 5C6AA 3HW8A 3GILA 2R7FA 4GKKQ 1X42A 3T79A 1C4QA 1XMOQ 1CT1D 3RZDB 2IW3A 2KOBA 3K1RB 3JPNA 1ZJNA 3TSSA 4FF3A 2I5MX 4EX7A 3OWFA 2ZIVA 1V38A 3VCBA 3M3YH 3KHRA 1JWSD 4HR7B 4JI5L 2B63H 4POFA 4CJ1B 3B0YA 1KBUA 3C28A 3NELA 3NP8A 3D2QA 4QWBA 9ICEA 2C9OA 3G71A 4DAVA 4LFBQ 5AK3A 1GHJA 4A93G 4KTAA 1EY9A 3C21A 2JR5A 2EJGC 4DEZA 4JK1A 4ECYA 3Q8MA 4F3OA 4BJQA 2MJ8A 3TREA 1ZQKA 2KHIA 1EQQA 2K5HA 4A3FG 4QIWC 4LZDA 2W3RA 3GIKA 4O5EA 2K5QA 2N8NA 4JI1L 3JPOA 4DUZL 4C7ZA 4JI2L 3N7PD 5AK6A 1MHWC 4XRHA 3H3VI 1ZQYA 5HNKA 2N3SA 4RWSC 3HOXB 4A3BH 4F5QA 3NRZA 5ALIA 3CNHA 2OQKA 1CZGA 2KV2A 1PTOF 2JHDA 1U4RA 3MFGA 1AROP 4K8IA 4F8MA 1CM9A 1PH6A 3G6XA 3Q8SB 5DNFA 2NN6I 1FFVA 1PK3A 4NXML 4DV3L 4K8JA 3HP6A 4C2MB 1VQGA 2PW5A 4JOIC 5D3IB 3TN2A 1NE3A 1OW5A 4J9PA 2ZXPA 4DF4A 5T14A 3QNMA 3GV3A 4WRDA 4DR1L 4Y2TA 4LF7L 4A3DB 4Y2UA 3OIQA 4C3IG 4ZLTF 2YU9H 4ICAA 4YR2A 1PVRA 4BY7G 5AKYA 1DYQA 2B2UA 2VQFL 1KTQA 4QZ8A 4A3DH 3R2IA 1NK5A 2AHOB 1O7YA 1PMRA 5HP4A 2F0PA 3IDWA 3CC4A 1XO1A 1ASYA 3H94A 3H3VH 1UE5A 2KG5A 4FO2A 1GOZA 3HRDD 4UP8A 4HJ7A 4IFDG 3CPFA 2F1HA 1SL1A 4B3TL 1NK7A 1BDOA 3NEMA 4K5WA 2F8KA 5KNCA 2XGPA 2NN6H 3DWQA 4P73A 3BQ0A 1RDPD 5ALEA 9ICQA 4DSLA 1IIPA 1LYLA 2K32A 4HJ9A 2ES2A 2JA6G 5ALVA 2FI1A 2D62A 1SKSA 2Y0SB 3N7SC 3W3AA 2NYVA 4F5PA 4C4RA 5KNDA 4UBBA 2IMWP 4C8OA 4DR4L 1T5XD 3CPWA 5AM0A 1N36Q 1NSNS 1QQ7A 3ULPA 3JPRA 3OJUA 3C1ZA 4HAEA 5CR0A 1MJCA 3UDFA 2WB1E 2F0NA 4KMOB 5J8YA 2EAPA 3MVVA 4RNNA 3V6HA 4LF8Q 3FEWX 1XSNA 4UARA 3K59A 1NKEA 2PXIA 3AL0B 1L8LA 3K57A 4Z6FA 1H38A 4K6LA 4IOCA 2QB1A 4TUSA 2DPJA 4LF9L 3HOYH 3GTKH 3V2TA 3TI0A 2DY8A 2W03A 1TK5A 2EYPA 5KFQA 2IWHA 5CB1A 2O2LD 5BPCA 2QA4A 4KMUC 2Z6KA 3K80C 3H0MB 3HOWH 3RFAA 3VA5A 1MSGA 4A3BB 2VA2A 3SK6A 3MXGA 5CBAE 5KYLA 1Y1WG 2EYLA 4YCUA 3CQZH 1FNUA 1DRGA 1N34Q 3K4GA 5AI4A 1STYA 3CRKC 3QOJA 5IILA 3TEHB 4CNQA 5KFBA 7ICOA 3CW2C 4USAA 3GV7B 1FNWA 4F91B 5ALQA 4QJFA 1MJEA 3S24A 4CE6A 5KFVA 2UVWA 4MTNA 4NMZA 1X9XA 1LTGD 2DGYA 3V6JA 1JN3A 1H9KA 4EYIB 5L1JA 1WI5A 2PO4A 2Z6BA 1QQ5A 1STNA 3OSPA 2VA3A 4DR3L 5C3EH 1KNEA 2ASDA 4GOPC 2L9HA 4NWIA 1T4GA 2LM1A 3QYPA 1LB2B 2IBKA 4DK3C 3STBD 4O0AA 2IOFK 2JXJA 3CHBD 5H2FU 1VQMA 3CCRA 3S9WA 3RLNA 2K89A 4ZOHC 1SLJA 5GQOA 4ELVA 2VQEQ 1L1OA 4YCXA 4RNOA 2R8JA 4BXOB 8ICSA 2F0WA 3KDFB 9ICJA 3NE5B 3QU4A 3THVA 4FBTA 5IWAL 2QARA 1BVSA 4JV1A 2LFNA 2ZG6A 4NL9C 1C20A 2F0FA 2F77X 3SI8A 7ICEA 2OF1A 2Z8LA 3FC4A 3M4YA 4G4KA 4IRDA 5EAYA 3I91A 5EOZA 1UEAB 1K1QA 5DAUA 5M5YB 4YR0A 3JC66 2F0UA 3SMVA 1Z1VA 1KHIA 1LT5D 1JIHA 4KD3A 1F5SA 3HKZG 2D6FC 3T13A 3K5NA 1N32L 1HUMA 4I2GA 5E3FA 2M2LA 3KJPA 2HBJA 1IYUA 4YHHL 5L1IA 2JA5B 3T5LA 5B5EU 4ECZA 5AI9A 3LGJA 3HOYB 3A7LA 2WB1F 3JPQA 4KLSA 4DSKA 3KHLA 2LY7A 1FIQA 2OH2A 2YTYA 1UUPA 2EYMA 4HIKA 8ICOA 2JA8H 1NJXA 1EIHA 2KHSA 5JAVA 3GTJH 3DEPA 2XRQD 1B0XA 1CA6A 2DGZA 3HOWB 2KVCA 1I6HH 1NMGA 4F72A 2BE5C 4C3JG 1HA6A 2RVLA 2HCCA 1SV4A 2AWOA 3GD7A 4M0AA 4XA5A 1X66A 1X6OA 2PFQA 3CQZB 1TS5A 2AQ2B 1YJNA 2PZUA 3SXHA 5IP9G 4MF8A 3RB4A 2F3IA 3ZYYX 1S5DD 5EWEA 3HFZB 2R7ZB 4A3MH 3KFUA 3T1HL 4JV0A 5CGKA 1IKMA 4FZLA 1OXVA 1PH9A 1U4PA 4LNQA 3T1YQ 1IHZA 3RTVA 1I4PA 2XIWA 4K0KL 3Q0AA 4B3ML 3WKBA 1BF4A 2E5LQ 4QZGA 1EY4A 5ELDA 2LKYA 3M8SA 2R8KA 4TQSA 1U5KA 5A0LA 1RHPA 4XIGS 4DXGA 4RMFA 1D7QA 3MFYA 3PIPA 2D3DA 4QNLA 5AM1A 1DOMA 3AU6A 1LKYB 3UE1A 4RQ5A 5L37A 2KFNA 1S40A 4J9NA 5AIAA 4EQPA 3CCUA 1ENAA 1F2MA 2RDHA 5IYCG 2Y9TA 5KT7A 1JORA 1X2IA 2LYHA 5IIIA 9ICOA 3I73A 4HTHA 4CF3A 4EZ9A 1JJCB 1YNJD 2A69D 2WB1C 5LMNW 2E2DC 1KRTA 4BY1G 3WOEA 2XGTA 1UCVA 3RRGA 3G6EA 1CI3M 1O7IA 5C4HA 3TP7A 3AU7A 3V6KA 3G7LA 2W43A 1YZ6A 7ICSA 1CKMA 4JBWA 2KZ3A 4I2AA 5J2BA 1GUSA 1E1TA 1SE2A 1SL0A 2ZIUB 3GQCA 4M9GA 1DOLA 3I90A 4PJ0U 3JPTA 4P0PA 1B22A 1SEBD 2WAQB 1ZRNA 2H3IA 1GO3E 3T16A 4DK0A 2BCSA 1CQVA 1E3PA 3HOZB 4R8UB 5CV6A 2UU9Q 2XGQA 5J0RA 2GN5A 3DUZA 9ICNA 3D6JA 2DKXA 2HCIA 2N1RA 4I2HA 1KIXA 3V7JA 1LLRD 2XN9C 4KHPQ 1I5FA 5KT4A 1I3QH 1EQTA 2RCFA 2W9BA 4J8QA 4DS5A 5NUCA 3AU2A 5LHY1 4DQQA 2E3TA 1YNND 3DXJC 3OMCA 3GTJB 1LTRD 2Z4IA 4GKKL 3PX0A 3QE9Y 5KGUA 1JB3A 2KCTA 1I6HB 1MQ2A 3PUVA 4IJLA 3I4NH 3I4MG 2ZJ8A 3J81L 1U4BA 1K8AC 2FLNA 1HXYD 3O0FA 2VUMB 2Z4HA 3QO2A 2C2DA 3M7GA 1AH9A 3TRZA 2K4IA 4PPXA 2B3GA 1Q81C 5EE9A 1PRTD 1ICWA 3NTUA 1OXSC 3J81i 1WYDA 2ALZA 4A3MB 1DGJA 4G57A 1JT8A 3F5AA 1ZRMA 1D9DA 5J2DA 1V8QA 1VQAA 4CRXA 4KLDA 2KEEA 2NWGA 1Y69U 2IY5B 1LABA 5JOBA 3ONNA 8ICCA 3TZUA 1HNXL 5C0XJ 1TKWB 1EXNA 2LYAA 4KKTA 5DGAA 3C2MA 3B9JA 3CC7A 5CRXA 3W1GA 3SZ2A 1X9WA 4IPDA 1F9QA 3TP6A 1AP0A 2UXCL 1LUZA 2I46A 5C5JA 4PGQA 3E9HA 4LFAL 5KG6A 1KDBA 2JSOA 4YCWA 2VQEL 1HFNA 4DOCA 1LTID 4EQNA 5FLMG 5GAHC 1GVPA 4AYBE 1GM5A 2K4KA 3K0YA 5C5LA 5EWFA 2FMCA 4M6WA 3I2ZA 1VCIA 3EUB2 1S9FA 1WTWA 4YD2A 2JXMB 2F2AB 2RQXA 3PVXA 1VQFA 1SV0C 2K5WA 5IE8A 1PRTF 1HRJA 2HW3A 4GIBA 4XXEA 7ICJA 1SWWA 1A0IA 3N28A 3EQLC 4WJ3B 4KY5A 4OONA 3GTLH 3PX6A 4LF6L 1TWAH 4IALA 2F0DA 1YNJC 1FGUA 5AIBA 2K28A 2A69C 5IYBH 2R93G 2Y1JA 3BJUA 4XYQA 3KFUF 2FINB 3H8WA 4XQ8A 1STHA 2H5XA 4LF4L 3IM1A 2N78A 2CH4W 1MN8A 2E8OA 5AJ3L 2NO4A 3J7AV 1B1ZA 3AEVA 2CRXA 1S5CD 3D6WA 2OYYA 2P6UA 2KE7A 7ICUA 3HZXA 2PNHA 3SDZA 3I56A 1ZD3A 1S0VA 1GO3F 4QZCA 4NXZA 2W8LA 4IO9A 4A3CG 4E6IA 4IQTA 4OJOA 2BQ3A 1TIID 2QKIC 4QZEA 4NY8A 2K5NA 2VW9A 1TWFB 2NRXA 3KKAA 1ZQEA 1ZQPA 4J9KA 5HMLA 1BQQT 1R4QB 3NQIA 3IRBA 2HHWA 1DZ1A 4ME3A 5M3MH 1PDQA 4ZQ3A 1YNNC 4JI8L 4JI6L 1K8OA 4O3QA 1ZQWA 1RYRA 1U49A 1VF7A 5EWGA 1PVOA 1OXXK 4HIDA 5IP9H 1WTXA 5JVH3 3MBYA 5IGBA 1CEZA 4DR6L 1DK2A 2BA0A 4DFMA 3NTIA 3SENA 2H4OA 1PLFA 3P20A 4Z6CA 3FMCA 3K5OA 4ULLA 2A1JB 3MFIA 4ED6A 4DQRA 4KLUA 1SE3A 1EY5A 2RSNA 3NWTA 3QG1A 4B3SQ 3P75A 3PSIA 1PZNA 3FM9A 2VANA 1TFRA 4F4WA 1NK0A 2F0GA 2YYZA 4R1JA 2ASBA 1PH8A 4PGYA 3FP9A 4EQOA 5C44G 2AQ1B 1EOVA 5ALSA 2K1BA 3W5OA 2C2EA 2KFZA 1D9FA 5JPNC 3LVVA 4KY7A 1K0SA 2H3QA 1B4OA 4YD1A 2AMCB 3N4MB 3M85A 4GOPB 1JJ2A 1LTSD 2I07B 1B7YB 3TQYA 3TAPA 1COOA 1RYSA 4DV5L 3PSPA 4BBSH 4J9MA 1ZEQX 4RGOS 2L0CA 4GN5A 4Y7NH 3KOJA 4PHEA 1D8YA 2RQ5A 5JUMA 4O5CA 4AYBF 3KTQA 3D0FA 3PO3G 2W9CA 1NJYA 4JWMA 5KFSA 3GTLB 3RMHA 3HOVH 2UXBL 1TWAB 2Q8RE 3OYYA 5I2XA 4OELB 1AEXA 1M90C 2ZIXB 2BCUA 2WF6A 3KZIU 4UB3A 4J9QA 5J2JA 2FDRA 5EBDA 1Q12A 1EQRA 1KDCA 4UB4A 5HHHA 1A63A 1BCPD 2ZJRA 2K8CB 1PH2A 2HVHA 4CJ0B 2R8IA 3A5UA 3HWTA 1ZQLA 2B39A 2K5DA 5D65A 1SWVA 3M7NA 3NS1A 2NVQB 1JOKA 4A4IA 2ZJPA 4XUSA 3S17B 3WK7A 4C8NA 1TS3A 1IG6A 1D8BA 1ZOLA 4GLVB 1UE6A 5GAGC 5AK5A 1X3PA 5KT6A 5D49A 3EIVA 2NZ1D 5D14A 2G9DA 2IA6A 1XMQQ 1EU3A 8ICEA 3J7A5 4LF5Q 1PYSB 3AUOA 4A3LH 2F0OA 4AQYQ 2CPRA 1D2BA 3F53A 1FL0A 1TWHH 1AE3A 2VJ5A 3PV8A 1S10A 3QB3A 5F3XB 4A3EH 3H8JA 1Y1VG 4JVZA 4ZUIA 1YBYA 2YV5A 1HIWA 3LX0A 4C8MA 2HT1A 4Q43A 2PZTA 1BCPF 1RTNA 3QOLA 1B50A 2K5VA 1WCMG 3H7IA 3K5LA 5TISU 3ZDCA 5KFJA 1EZ6A 4OO1I 4JI4Q 3MDCA 1JWUD 2UUAQ 3BG3A 1BOSA 1L0WA 3KF6A 3HPOA 2V4RA 2K7VA 5AKZA 2KUMA 4HJ8A 2AH5A 2CW0D 1DXSA 3NASA 5KFDA 4DV0L 2JV3A 4NXNL 5J0OA 5KTQA 4BBSB 3HT3A 2OXPA 1ZQRA 1KSPA 4Y7NB 1J2MA 4YWKA 3CCLA 1SXDA 1N9WA 3S1NH 4BXXH 1SDFA 2JP1A 4NM1A 4LWCA 2KJXA 1P16A 3HOVB 2JA7G 1L8OA 1BPYA 4YFKA 2W9AA 1H9RA 1O7LA 3HEJA 4DV7Q 4OO1H 3GTQH 1GXDC 2DWQA 1KFSA 3AB9A 2B2WC 1JJGA 4FZMA 7ICVA 2AGQA 2K50A 3W2DA 4KJNA 4LK1C 4CDDC 5DDYA 1URJA 8ICGA 2WTFA 1SNDA 1II3A 3RN2A 1XWLA 5J0YA 3T56B 2ZJQA 9ICBA 4R66A 1MI2A 4IUVA 1B9NA 5DG7A 1F77A 4KN7C 1F2YA 2BCVA 1E7ZA 5FO8B 1SIJA 3BS7A 2WV6D 1ZQJA 1ED1A 2NRTA 1EOTA 5DLFA 1BCPC 3GTPB 1UWVA 1V1PB 1UE1A 1D1IA 1HUOA 2P5ZX 1F44A 1TR5A 1RXWA 3HKZE 3VR5A 3KF8B 4DA2A 3K75D 3BQ7A 2Q2IA 3K58A 1YITA 2DN8A 1WD1A 1KFDA 2FMSA 4BBRB 1ONLA 5KFXA 4ZH4A 1AW7A 5KFOA 1TU2B 3JAMi 4X66L 3A55A 1B43A 2KICA 3SEIA 1SYDA 1TWHB 2F03A 3IL8A 5JEAJ 1F9SA 4J03A 1ML0D 5AI5A 2MAXA 1BPZA 1YVCA 3QUQA 5ALPA 1UA0A 3M4OH 4CKEA 2CXYA 1CRXA 4BWGB 4F5OA 1YI2A 4HEDA 5EPJA 2PFNA 1VDVA 4FF2A 1BBXC 4DU9A 1WYGA 3PY8A 4RQ4A 4JUZA 3IKJA 1PHJA 3E6ZX 3IRUA 1D5ZC 4MEXA 3PUXA 3T5JA 2F0VA 4M1UB 2C5CA 2EAOA 2JGAA 1STEA 1YHAA 4HCSA 3GIMA 5ALWA 1QILA 2RDIA 3V7KA 4EBCA 1ZETA 4B9MA 5EE0A 1LACA 2XO7A 3M9MB 4DAYB 3UQ0A 2M00A 2SEBD 2KHVA 1Y8NB 4QZAA 3EPIA 2KKVA 2MU2A 1I94L 3ERQA 1GUTA 4GXKA 2UVVA 5IGCA 4JI5Q 4A3DG 2JEGA 1JCKB 2A6HD 4FXDA 3IG5A 4JV5Q 1K9MC 2CW0C 3GTGH 1SKRA 3S1NB 2PFOA 1A3VA 1IKLA 4KV6A 3EYZA 3CF5A 4CF5A 4FXGC 3T4AC 1QE6A 4YMOA 1SL2A 1T7PA 4GNXC 1BNZA 1K8MA 2CN1A 2K52A 3NENA 3LWEA 2F1MA 3VYUA 2IOFA 1SFOB 4ECWA 3U9SA 3HKSA 4KN4A 1QTMA 4PGXA 1JOOA 2NV3A 3KJOA 1PH7A 4B3RQ 2CKZB 2HVIA 1TKDA 2R18A 4DUZQ 2EY5A 4US9A 1MA7A 4IOAA 4IN3A 5C0XG 5C4JH 3CP0A 2Y0SG 1EYGA 2PQEA 3IAYA 3CP8A 5IGEA 3W1BA 4P4OA 1UAPA 3WK9A 1NKCA 4YR3A 4FF4A 3A8IE 7ICQA 1RL2A 2EDGA 4F50A 1NZBA 1GD7A 1E2ZA 2L1BA 1U4MA 1VDZA 4C80A 3RJFA 5AM3A 4Y2JA 4DFAA 3UPQA 2ZUBA 4IUPA 2F0EA 2PYKA 1DCZA 1S76D 1ZQAA 4DR1Q 1VQPA 3GV8B 4Q44A 4MNOA 3H8SA 1T3NA 1PZJD 1CA5A 4L63B 3K6OA 3ED5A 2VQFQ 1S5LU 1HUNA 3I4LA 4YY3L 3DEEA 2QGQA 1NZPA 3HJEA 4TURA 1EU4A 2JZBB 3CCQA 3QU5A 2RSOA 2WIIB 3UXPA 8ICAA 9ICGA 1PTOD 4R4IA 2E8MA 2JJQA 3M4OB 7ICRA 4ZKCB 1B9MA 1X3GA 4B3TQ 2H3VA 1DD2A 3KLSA 4A3BG 2WKCA 1VLBA 4YVZA 3I1YA 4FXKC 2OHFA 4UAIA 1JOQA 1VMPA 5FLXL 1CHQD 1VQJA 1H9MA 3TADA 2BPGA 1G6PA 1BXTA 4B9UA 4N9TA 1H9JA 1PZKD 4EX6A 1NJIC 2D0OA 1ZQVA 3PW4A 2RDGA 4X3TA 1J2NA 2AGOA 3D2SA 2G5IB 1FO4A 2KTQA 2GH1A 2K6AA 4R4CA 4DNTB 4BA2I 3ZDAA 3GTGB 5ALLA 5KFLA 5J0QA 1B70B 1QCKA 3K7UC 1CSQA 4K2LA 3EVQA 4C3HH 3OGUA 3K8AA 3CCMA 1XNQL 3TACB 3RRHA 5IIOA 5I9PA 2Q2TA 4X3SA 2AJQA 4A3JH 4LF9Q 2ZIWA 5ALXA 3MC1A 2A6HC 3NGDA 4B9TA 3CCVA 4DR7L 2PMZE 1O78A 3J81j 8ICYA 5J0WA 4ECVA 8ICHA 4RHSA 2NB0A 4PNYA
chains in the Genus database with same CATH topology
2PQAA 2AWOA 3GD7A 4R4TA 1XTDA 1N33L 1X6OA 3J80c 2WP8J 2AWNA 1I50H 2IT1A 4HJAA 1SR3A 1YJNA 5IP9G 2NVQH 2F3IA 4A3KH 1M1KC 2UUCL 3HFZB 1K3RA 5GADC 3S17H 4A3MH 3KFUA 3T1HL 2CWPA 1C7YA 1OXVA 2WFWA 1Q1BA 4BA1I 1QVGA 4LNQA 1XMQL 1HR0L 3CD6A 2UXDQ 2R93H 1Q8KA 3T1YQ 2AKWB 2WB1G 2LSSA 5HY6A 4DR3Q 4LF5L 4NB3A 4P74A 1KRSA 4B3ML 4K0KL 2JA5G 4AQYL 1UEBA 2E5LQ 3HOUG 1DGSA 2XTIA 2LXJA 3I4NH 1U5KA 4XIGS 3HOXG 2JA7H 1X65A 4RMFA 4YY3Q 1QZGA 2A8VA 3PIPA 1XNRQ 1D7QA 1G291 3UE1A 1IBML 1S40A 3RNUA 1Z47A 4KLKA 3U4ZA 2JEBI 5ELNA 4A3FH 3A0JA 3CCUA 4A3CH 1C9OA 1MIUA 2NVXH 2N49A 2NZOA 5IYCG 5IWAQ 2D0PA 1YJ9A 1VQHA 1JJCB 2C35B 4GNXA 1WFQA 2HIXA 3CCEA 4IFDI 5LMNW 4NXNQ 4WJ3M 1KRTA 1JE5A 4BY1G 2R7ZG 4JG2A 1TWGH 2XGTA 3FKIG 4IFDJ 3G6EA 1O7IA 1V9PA 1VQ4A 3I55A 1PH9A 1YZ6A 4JBWA 1CKMA 1E1TA 2FXQA 3FHWA 4P72A 4DR5L 2L15A 4A3EG 3PO2G 3OTOL 2MO1A 2A19A 4GKKQ 4JYAQ 1GO3E 1YHBA 4RG1A 3S15H 1E3PA 4C3IH 1VQ9A 4X6AH 2UU9Q 1A8VA 4QY7A 3DLLA 2GN5A 2GVBA 4JI1Q 4DPGA 4JI2Q 1KIXA 4DV4L 1L1OB 2MFIA 4KHPQ 1I5FA 3GTOH 1I3QH 5C44H 3K7AH 1C0AA 3PGZA 4PG3A 1E22A 2KCTA 3CAMA 4PMWA 3PUVA 3BZKA 4IJLA 4GOPA 4DV3Q 4NXMQ 2B63G 3I4MG 1MKHA 4MZ9A 1K8AC 3L2PA 2HHHQ 2JA6H 4JBKA 1AH9A 3TRZA 2B3GA 4FDBA 1Q81C 3F2DA 1EFWA 1IZ6A 4LF7Q 1CUKA 1OXSC 4GLXA 3J81i 4JI7Q 1WYDA 3I7FA 1EIYB 3GTPH 1J5EL 2UUCQ 1VQOA 1JT8A 1CSPA 5C0XI 3T1HQ 3E0EA 2OTLA 1VQAA 2IX0A 2IY5B 4DV2L 2WAQG 1Q86C 1HNXL 4IPHA 5C0XJ 4A3DH 3EBEA 1V43A 1HR0Q 3HOZG 4BBRH 4GLAC 4WJ4A 3CC7A 4JI3L 4OWWB 4X62L 3W1GA 4HJ5A 4QGUA 1UE7A 4IPDA 2UXCL 4L5SA 4JBMA 1LUZA 1VQEA 2Z0SA 3NBHB 4LFAL 1GKHA 2ALYB 3E9HA 5IP7H 1KAWA 4YCWA 4TVAB 1IBMQ 4EQ5A 1Q7YC 5FLMG 5GAHC 1GVPA 4AYBE 1GM5A 2K4KA 1XPRA 2BH8A 1QUQA 5FLXc 2E2HH 2VUMG 2EIFA 3I2ZA 1NBWA 1VCIA 2OQ0A 4DR4Q 1TXYA 2RHQB 4KHZA 3ICEA 1Y1WH 5IE8A 1OXTA 1VQFA 1I94Q 1PH4A 2E2IH 1X3EA 4UP9A 4LUOA 4A3MG 3ER0A 4A3IH 4OONA 1A0IA 2VS1A 5IYDG 1XPOA 1VQLA 3GTLH 3H0GG 3RN5A 1HNWL 5K36G 4LF6L 1TWAH 1FGUA 2KHJA 1H95A 4IPCA 5IYBH 2CCZA 4JV5L 2R93G 3BJUA 2OWOA 4LF8L 4DR5Q 4L5RC 2H5XA 3OTOQ 4LF4L 2N78A 1A62A 5AJ3L 2NN6G 1CKNA 1VQBA 4POGA 3S16H 2R92G 3TS2A 3AEVA 1KL9A 3I56A 1SFOH 4TQUS 1FVIA 2MQHA 2PNHA 4DV4Q 4B3RL 2EQSA 1IBLL 1RIPA 2ID0A 2RCNA 1CKOA 3VDYA 4X64L 1IXRA 4XTCS 4IO9A 4A3CG 2GVAA 3MXNB 4DV6L 3AFQA 4QIWE 1ASZA 1EUJA 4ALPA 4QQBX 5JEAG 3JAMc 1XPUA 2K5NA 2VW9A 2I0QA 4A3GH 4GS3A 4GNXB 3Q8DA 1X55A 3IRBA 4ME3A 5M3MH 4YWLA 1HNZL 4JI8L 4JI6L 4DKAC 1KQSA 5J3BA 2ZM6L 1PVOA 1OXXK 4HIDA 4UY8C 1J5EQ 3HOYG 1IBKL 3CC2A 3S2DH 4A93H 1IL2A 4DR6L 1TWCH 1VQCA 2BA0A 3J80i 1VQ7A 4DV2Q 3PUWA 2R6GA 1R9TH 4X65L 4OWXB 4A75A 1PV4A 4Y52H 3HOWG 4PZ7A 4B3SQ 3STBC 4OX9L 3PSIA 1G51A 4JI3Q 2YYZA 4X62Q 4R1JA 4IJHA 4JI4L 2ASBA 1PH8A 2UUAL 1PH3A 2VNUD 4HIOA 2UXCQ 3FP9A 5C44G 1EOVA 3W5OA 1BBUA 3G48A 5C4XH 1L2FA 4LFAQ 1XMOL 1E1OA 3RZDH 2I5HA 3CCJA 1VQ6A 2AMCB 4GOPB 1SROA 3M85A 3ZJYC 1JJ2A 1BBWA 3TQYA 1B7YB 1W2BA 4JCVE 1V1QA 4C3JH 2B29A 2EDUA 4YWMA 2KBNA 5C3EG 4DV5L 4BBSH 4GN5A 4Y7NH 3KOJA 2EXDA 2E8GA 3AQQA 4DV1Q 3D0FA 3PO3G 3B6YA 5IT9c 3J7ZC 3KLWA 3PUZA 5M5YH 5IP9H 4LFBL 1N32Q 4P71A 3DM3A 5GROA 1HZCA 2BA1A 4BY7H 1HZ9A 3HOVH 5BR8Q 2UXBL 1LTLA 3OYYA 4IPGA 4YHHQ 4LUVA 4DV7L 1HJPA 1AE2A 1NY4A 4LF6Q 5ELOA 1HZAA 1M90C 1XNQQ 2ATWA 1OTCA 3PCOB 1LM0A 1OXUA 1QVCA 2K14A 4L5QA 1Q12A 4LF4Q 1EQRA 4DR7Q 3D31A 5E7NA 3RR5A 2JA5H 2JQOA 1A63A 4PZ6A 5AJ3Q 2ZJRA 3HOUH 3S1RH 1PH2A 1K8GA 5IP7G 3A5UA 3HOXH 3CMAA 2IHFA 1PFSA 3UDGA 1Q82C 2KENA 2YTXA 1IBLQ 1N33Q 2ZTDA 4A76A 3M7NA 2HQLA 3J81c 1YEZA 1BKBA 4X64Q 1KXLA 2VZAA 3ULLA 1QUQB 4A4IA 4AYBG 4NPSA 2ZJPA 4DV6Q 4C2MH 3PF4A 3M4QA 5IYCH 4UPAA 4GLVB 1UE6A 5GAGC 1XJVA 1W3SA 3KF6B 3EIVA 2JE6I 2Z6KC 2NVTH 1XMQQ 1JB7A 1K0RA 3ERSX 4A3IG 1HNZQ 3J7A5 3A74A 3PUYA 4JI6Q 2VY3A 4LF5Q 1PYSB 4BY1H 2R7ZH 4A3LH 5JJLA 4HIMA 1VQ8A 1SE8A 3FKIH 4K0KQ 4B3MQ 2ZM6Q 1YHQA 1E24A 1VQDA 4AQYQ 1YNXA 3M9BA 1TWHH 1FL0A 3S1MH 1KD1C 4A3JG 1AE3A 2UXDL 3T1YL 3RLFA 4R4OA 3PO2H 4A3EH 4DR6Q 2JA8G 3PV0A 1B8AA 1Y1VG 2ZTCA 1EWIA 1YBYA 2YV5A 1HH2P 1Y14B 1J6QA 5IY0A 4X65Q 3K0XA 1CKNB 3KYHC 1HR0W 2HT1A 5GAEC 2K5VA 1WCMG 2QEXA 5LMNL 4OX9Q 4OO1I 4JI4Q 2Y0SE 2UUAQ 3F2CA 2R7FA 3E9IA 1L0WA 3KF6A 4EX5A 4HJ8A 1XMOQ 4A3KG 5H1SE 3L7ZC 1N36L 1L1OC 2I5MX 4DV0L 3M3YH 4JI5L 2B63H 3I4MH 4NXNL 4POFA 4LFCL 3NELA 1VQNA 1Q1EA 3CCLA 4YWKA 1S72A 1N9WA 3U58A 3S1NH 3G71A 4BXXH 2RHSB 4LWCA 4LFBQ 1P16A 1QZHA 2R7DA 4YCVA 2E2JH 4A93G 2JA7G 5JJIA 3TREA 2UUBL 4DV7Q 4GKJL 3GTQH 2KHIA 1EQQA 3S2HH 1PH5A 2K5HA 4A3FG 2F4VL 3SGIA 1JJGA 3HOZH 5JJKA 3KDFA 2N8NA 5FJ8H 2K50A 5M3FH 4DUZL 1P8LA 4JI1L 4LW1A 4JI2L 2VL6A 4KHPL 3RN2A 3H3VI 4OXPA 2ZJQA 4A3BH 2N3SA 2NZHA 1N34L 2ZTEA 5C4XG 2I5LX 2OQKA 3UE0A 1PH6A 2CFMA 2DUDA 1E7ZA 2NN6I 4NXML 4DV3L 1UWVA 4JC0A 2JA9A 1UE1A 1VQGA 4JOIC 2VUMH 1NE3A 1S3OA 3HKZE 4LF7L 4DR1L 3KF8B 5M5WH 4JI7L 2Q2IA 1YITA 1HNXQ 4DR2L 2YU9H 1X56A 4BY7G 2VQFL 3HOVG 3JAMi 2OCEA 2CQOA 4X66L 5IYDH 2AHOB 3H0GH 2VQEL 1NTGA 1KC8C 3CC4A 4J15A 5JEAJ 4AH6A 1ASYA 3H3VH 3F8TA 1UE5A 4PZ8A 2IHEA 4UP8A 1YVCA 4HJ7A 4IFDG 3CPFA 2KCMA 3M4OH 4B3TL 2F52A 4DK6C 1PH1A 3NEMA 1YI2A 1VQ5A 3I4NG 5HGQA 3GTMH 3BZCA 4P73A 2R92H 1PHJA 1LYLA 5LMNQ 1D8LA 4HJ9A 2ES2A 4GN3B 4H02A 2JA6G 3PUXA 2D62A 1PA6A 4JBJA 2YTVA 1YHAA 2MO0A 4DR4L 4DAYB 3CPWA 1N36Q 3ULPA 2V1CC 1X3FA 1HNWQ 1I94L 4DV0Q 3S14H 4JI5Q 3F1ZA 1MJCA 3UDFA 4A3DG 4LFCQ 2WB1E 4BBRG 2NVYH 4JV5Q 1K9MC 3GTGH 4LF8Q 4A3LG 1Z9FA 1K73C 3CF5A 3RZOH 4GNXC 1VQKA 1HZBA 1N8RC 4IOCA 2K52A 2Q2UA 4LF9L 3NENA 2K75A 3HOYH 4O2DA 1SN8A 4DUYL 1SMXA 5M5XH 3GTKH 3PIOA 2HIVA 2LXKA 3HKSA 2UUBQ 4GKJQ 1PH7A 3KJOA 1FJGL 1T9HA 4B3RQ 4JI0L 2CKZB 2F4VQ 2RF4A 2QA4A 3G4SA 2Z6KA 3K80C 5LMUL 1Q46A 3L0OA 3EN2A 4DUZQ 3HOWH 4IOAA 5C0XG 5C4JH 1NMFA 2PI2A 2Y0SG 3CP0A 1Y1WG 4YCUA 1EYGA 3CMEA 3W1BA 3CQZH 2CWAA 3TS0A 1N34Q 3TEHB 1RL2A 1GD7A 3F2BA 3CW2C 4JI8Q 1IYJB 1SRUA 4LUZA 1WJJA 4QJFA 1MJEA 3S24A 2BH2A 4MTNA 4R4QA 1TWFH 2OTJA 2DGYA 5IYBG 5DLQE 1JMCA 1WI5A 3GO5A 3ULJA 4DR3L 1IBKQ 5C3EH 4BXXG 2JEAI 4DR1Q 4GOPC 1VQPA 2E5LL 3UDIA 4MNOA 3PO3H 3MEFA 4DR2Q 1EIFA 4DK3C 4GN4B 3STBD 1VQIA 4O0AA 3PF5A 2VQFQ 1VQMA 4YY3L 4X66Q 3CCRA 1XNRL 2QGQA 3AYHB 3RLNA 4OO1G 3I4OA 1SLJA 4L5TA 5GQOA 2VQEQ 1L1OA 3CCQA 2Q2HA 1X9NA 4R4IA 3KDFB 2JJQA 5FJ8G 5M3FG 4B3SL 2MNAA 1X3GA <