2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1531
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
1EUJA 2XGTA 3T1YQ 4C3IH 2RCNA 4DV7L 4P72A 4OO1G 1HZ9A 2D62A 1EQQA 1CKOA 3BU2A 4NB3A 4NXNL 5GAGC 4DR3L 2JA6G 1JJCB 4R4QA 2VQEQ 3PO2G 4LFAL 4BA1I 1JJGA 3J81c 3W1GA 3K81C 2V1CC 1XNRQ 1IBLL 2ZTDA 4YWLA 1WOCA 1G51A 2R7ZG 4A76A 1SRUA 3HFZB 1X55A 3CCJA 5M3MG 2QA4A 4GNXC 4P71A 1KC8C 4GS3A 1HZAA 5H1SE 3H15A 4NXMQ 4DUZL 4YY3L 3BZCA 3KF6B 1N33L 3NENA 4A3EH 3PV0A 4MTNA 4A3IG 4B3TL 4POGA 1PH7A 2WP8J 2B3GA 4LFCQ 1VQ6A 3CW2C 1NMFA 3OTOQ 4LFBL 3KJOA 1N34L 1CSQA 2Q2TA 2EQSA 2L15A 4LWCA 3ULJA 1KRTA 2RHSB 3I56A 1JB7A 1TWAH 3H0GG 4TQUS 3F2BA 4GLVB 1AE2A 1GKHA 5IYCH 4LF5L 4GLXA 1SLJA 1QUQA 3U58A 4UP9A 4HJAA 2NZOA 1B8AA 5J3BA 1C9OA 2K14A 4B3ML 4A3IH 1M1KC 5GQOA 3M4OH 3TS2A 2QEXA 1UE6A 2JA6H 3PO2H 2UXBL 1Q86C 1Q1BA 3TQYA 1VQ7A 2ATWA 5M5XH 3WWVA 5IP7H 2AKWB 1TWGH 4LNQA 3HOWG 2NVTH 2ASBA 2JK8A 1MJEA 4DR6Q 1EOVA 4QGUA 1FL0A 3CPWA 4GN4B 1E1TA 5FLMG 1JE5A 1WJJA 3AFQA 4OONA 4QIWE 3SGIA 3ICEA 1PH8A 4DR5L 4A93H 5C44G 2E2HH 4BXXG 1N32L 1EYGA 3GTQH 3CC7A 1HR0Q 2CQOA 3S2DH 4HIMA 4IPCA 3JAMc 2UUBQ 3NEMA 3RN5A 1W2BA 4JBJA 1BBWA 1CSPA 4YWKA 1EFWA 4BY1G 1VQNA 2WAQG 4LW1A 2OCEA 2BH2A 4LF9L 5JEAJ 1NBWA 2YTYA 3DM3A 5FLMH 2OQKA 3HOZH 3TRZA 1XPOA 3HKZE 3AEVA 2UU9L 4X65Q 2VL6A 4IFDJ 4DV5L 4DV2L 2UXCQ 1L1OA 1KD1C 3STBC 1N36Q 1PV4A 3J81j 3L2PA 3CCSA 1HNZQ 4IPHA 4HIDA 3UE1A 1SN8A 4PG3A 4BBRG 3UDGA 5C0XI 4UP7A 2Z6KC 3T1HQ 4BY7H 2N3SA 1HNXL 5IWAQ 4BY1H 1E22A 4DR1L 1VQJA 4PZ7A 2B29A 1I94Q 4L5SA 1TXYA 4DR7Q 2UXDL 3ZJYC 2ZM6Q 1XMQQ 5C44H 1P16A 2BH8A 4BXXH 4JG2A 3G71A 4X64L 4KHPL 4IFDG 3K7AH 3E0EA 4X62L 3H0GH 3UE0A 5M3FH 4GOPA 4BY7G 5C4JH 1IBML 1E24A 1QVFA 3B6YA 1RIPA 4QQBX 2K75A 4WJ4A 4DV3Q 4J15A 1XMOQ 2R93G 2N49A 4YWMA 5C0XG 2ZTEA 3KOJA 2EDUA 1LYLA 2VY3A 1PFSA 3M9BA 3F2DA 3J7ZC 1WCMH 5FJ8H 2YU9H 2EIFA 3CXCA 5AJ3Q 1OXUA 4P73A 1QZHA 4LF6Q 4IJLA 4YHHQ 3G48A 1YVCA 1L1OC 3PUVA 1Y1VG 2ALYB 4JI6L 2E2IH 1XNQL 4UP8A 3KDFB 4IOAA 3EBEA 3LGJA 5ELNA 4JI5L 3J81i 2I5HA 1WI5A 4OX9Q 1YI2A 5IYDG 2UUCQ 4DR4L 5IP7G 1NTGA 2PMZE 3KJPA 1Q82C 4JI0Q 4B3SQ 3HOYG 4NPSA 1YHBA 4ME3A 3CP0A 1S72A 3K80C 1D8LA 1UE7A 1VQMA 1YEZA 1Y1WG 5LMNW 2UUAQ 3PIOA 3HOUH 1G6PA 4LF8Q 2WFWA 2GVAA 5BR8Q 1I6HH 3E9HA 1X54A 3MEFA 1YHAA 1A63A 1I5FA 3L7ZC 1TWCH 1Z9FA 2R7DA 3A0JA 2YTXA 3BZKA 4IPDA 4A75A 3K8AA 1YJWA 1TWFH 2HHHL 1IZ6A 2VS1A 4A3MG 1LM0A 3CMEA 1N8RC 3PUXA 5JJLA 4DV6Q 1MJCA 2E5LQ 1MKHA 1UE5A 2NZHA 1VQAA 2GN5A 5GAHC 4IPGA 4DR2L 1Q7YC 1FJGQ 3CQZH 3S14H 4A3BG 4DUYQ 1SFOH 5M5WH 4EX5A 2VNUD 1PH9A 2VQFQ 3RN2A 2R92G 4H02A 2N8NA 5C3EG 2Y0SE 1WYDA 5JEAG 4JYAL 1DGSA 5M3MH 2NN6G 4IO9A 3K7UC 1GD7A 1NMGA 3M4QA 1IBKL 4GKJL 3HOUG 5IY0A 4JI4Q 1J5EL 1LTLA 3F1ZA 1VQPA 4BBSG 3UDXA 3T1YL 1VQCA 4GOPC 4A3EG 5IT9c 1OXVA 4DV7Q 1EIFA 1KL9A 2PQAA 2HQLA 2IX0A 4NXNQ 1U0LA 3JAMi 2I0QA 2VQEL 1OTCA 4GKKQ 2VZAA 2KCMA 4LFAQ 2MFIA 3TREA 3HOXH 4DK3C 4A3FG 1Z47A 1ASYA 4KI0A 4YCWA 5GADC 4A3KH 1XNRL 4GN5A 3KFUA 4GNXB 1VQIA 2K50A 1S40A 2Z6KA 2A19A 3RNUA 1VS0A 4A3FH 1SROA 2GVBA 1TWHH 3PSIA 1YITA 1PA6A 5M5YH 1C0AA 3J7A5 4DUZQ 1MIUA 4YY3Q 4LUOA 4A3CH 4B3RL 1XPRA 3PO3H 4AQYL 1OXSC 1PHJA 4JI8L 2ES2A 2IHFA 2KHJA 4LFBQ 4HIOA 1KIXA 4JV5L 4A3JG 1HJPA 1PH2A 1VQGA 1N34Q 2PQAB 3Q8DA 1X3FA 4OXPA 1VCIA 4A3GG 3I4OA 1YIJA 3TEHB 2VUMH 2ZJPA 1HNWQ 2NVYH 1G291 3KF8B 1VQ5A 3GDEA 1YZ6A 1L1OB 1YJNA 1XPUA 4IFDI 2NN6I 4APVA 5IP9H 1EQRA 2H5XA 3CMAA 2JA5H 4QY7A 1S3OA 3I55A 2B63H 3D0FA 1X56A 2DUDA 5IYBG 4A3DG 2OQ0A 2LXJA 3F8TA 4DV0L 4DK6C 3GTOH 2MO0A 3M4PA 1K9MC 3I2ZA 2LSSA 2RHQB 4JI3L 4JI7L 2DGYA 2R7FA 5DLQE 2JA7G 4X66Q 3S15H 4JCVE 4A3BH 1V1QA 2F4VQ 4DV4L 3CCUA 3G6EA 2HIVA 2CCZA 4JI2L 1IL2A 4K0KL 1NY4A 1K8AC 1K83H 1Q12A 4A3JH 1PH5A 4LF7L 4LF4Q 2IY5B 4DV1Q 1EIYB 2PI2E 1Q8KA 2A1AA 1VQ8A 1KHIA 5E7NA 4JI1L 1CKMA 1YBYA 1L0WA 3HOVG 1C7YA 1VQ4A 5LMUL 2ZTCA 4KLKA 5C4XH 1V9PA 3NBHB 5LMNL 4X6AH 3UDFA 2ZJRA 1E7ZA 2UU9Q 2CWPA 4DV2Q 1D7QA 4OO1I 1QUQB 2OTLA 3FKIH 1T9HA 4A3LG 3AQQA 3E9IA 1IXRA 1Q1EA 3KF6A 2QGQA 3FHWA 1L2FA 1A8VA 2F52A 4MZ9A 1BVSA 4OWTB 4L5QA 4DR3Q 3ULPA 4PZ6A 1HNXQ 4HJ8A 2ID0A 4PMWA 3HOVH 3S16H 3A74A 3RZDH 4DR7L 2MO1A 3RLOA 2ZM6L 1CKNB 3FKIG 1IBLQ 2IHEA 3PGZA 4R1JA 3I4NH 1SE8A 4QJFA 2R6GA 5IE8A 2HIXA 2JJQA 4IOCA 4KHPQ 4AYBE 4X62Q 1GM5A 1X3GA 2IX1A 4NXML 2E8GA 3ULLA 2JE6I 3NELA 1CUKA 3GO5A 5C3EH 1IBMQ 2XTIA 5IYBH 4A3DH 1Y14B 4DV3L 1N33Q 4B3TQ 3J80i 4P74A 1W3SA 2RF4A 1QVGA 1UEBA 3OYYA 2VW9A 4LFCL 1VQLA 1I50H 4C2MH 1I3QH 3OTOL 1X9NA 2I5LX 4GN3B 3CAMA 3GD7A 5HY6A 3I7FA 4AH6A 1E1OA 2N78A 3JC66 5GAEC 3PO3G 1KAWA 4LUVA 4JBWA 1NJIC 1X65A 2HT1A 4A4IA 3FP9A 2OWOA 5M3FG 3CCVA 1VQ9A 1FGUA 1UE1A 2KCTA 1QVCA 4GNXA 3CC4A 4LF5Q 3STBD 3PF4A 1YHQA 3I4NG 1A62A 1XNQQ 2K52A 1AH9A 4JC0A 3F2CA 4B3MQ 4DPGA 2BA0A 2C35B 3OW2A 4JI5Q 4JBKA 3H3VI 1VQBA 4LUZA 2JA5G 2UXBQ 2UUCL 2KBNA 2ZJQA 3CCQA 3CC2A 3GTPH 4A3MH 3PIPA 3AFPA 1A0IA 1SR3A 2FXQA 1VQDA 4DNIA 1PYSB 4FDBA 1JT8A 4A3KG 5IYDH 4DR6L 2OTJA 3ER0A 2WB1G 2F3IA 4YCVA 5BR8L 4EQ5A 3PF5A 1KQSA 3KYHC 4PZ8A 3PUZA 3S1NH 1YNXA 3RLNA 5K36G 4DR5Q 2CKZB 1Y1WH 3S2HH 3GTKH 3A5ZB 4Y52H 3M7NA 1N32Q 2PNHA 1HR0L 1PVOA 4UY8C 1FVIA 1K73C 3RZOH 2UUBL 2E5LL 2JEAI 4RG1A 3GTGH 3H3VH 1EWIA 3S1MH 3HKZG 4WJ3M 3BJUA 4TVAB 1B7YB 4LF9Q 4L5TA 3S24A 2I5MX 4QL5A 2MNAA 2B63G 1OXXK 3GTJH 1N9WA 4DR2Q 1XTDA 4MNOA 4A3LH 1UWVA 4X65L 4DV5Q 3U4VA 2UXCL 1HH2P 4DUYL 1N36L 5C0XJ 3I4MG 2KENA 2R93H 1PH1A 1HNZL 1VQFA 5GROA 1JJ2A 1KXLA 4IJHA 5C4XG 4A3GH 2K5NA 4R4IA 3T1HL 3PUWA 2E2JH 5ELOA 5IWAL 4JBMA 4DR1Q 1WCMG 3CCMA 4GKJQ 3EIVA 1RL2A 1I94L 2UXDQ 2BA1A 3G4SA 1PH4A 1J5EQ 2A8VA 1XMQL 3W1BA 1O7IA 4O0AA 3KLWA 4X64Q 4JOIC 2VUMG 3CD6A 1CKNA 2WB1E 4GLAC 2NVQH 3AYHB 3U4ZA 4A3CG 4AIMA 2AWNA 4Y7NH 1NE3A 4DKAC 1PYBA 1WFQA 4GKKL 2PI2A 2R92H 2EXDA 1XMOL 1R9TH 3M3YH 1K0RA 2KHIA 3CCRA 2R7ZH 4L5RC 1IYJB 1HZBA 1B70B 1JMCA 3HOXG 2CWAA 2Q2HA 3W5OA 3HOZG 1H95A 3CF5A 4KHZA 4ALPA 3VDYA 2Q2IA 2YTVA 4RMFA 3ERSX 3D31A 1VQKA 4B3RQ 3UDIA 1J6QA 1SMXA 5AJ3L 3DLLA 1Q81C 1BBUA 4AQYQ 4LF6L 1Y1VH 4YHHL 4JI8Q 3HOYH 1P8LA 3TS0A 1E3PA 4DAYB 5HGQA 1OXTA 1LUZA 1KRSA 3S17H 4JV5Q 5IYCG 4P75A 4JI6Q 3RLFA 2NVXH 2K4KA 4XTCS 1X6OA 4DAMA 4OX9L 4HJ5A 2JEBI 2K5VA 4DR4Q 4HJ9A 4JI0L 4B3SL 2D0PA 3KDFA 1VQOA 1HNWL 4JOIA 3IRBA 3GTMH 1X3EA 3GTLH 1M90C 1V43A 1K3RA 2UUAL 4GOPB 2YYZA 1Q46A 1HZCA 4C3HH 4LF8L 2AWOA 3M85A 4HIKA 5EAYA 4AYBG 5FLXc 4DV0Q 4YCUA 3CCLA 4C3JH 1YJ9A 2JA8H 5IP9G 2YV5A 3K0XA 4XIGS 1XJVA 4BA2I 4O2DA 2Z0SA 4JI3Q 3J80c 4JI7Q 3U50C 3S1RH 2JA7H 3HOWH 2D0OA 2HHHQ 4X66L 1QZGA 5JJKA 2Y0SG 2MQHA 1HR0W 3CPFA 4HJ7A 3EN2A 3I4MH 4DV6L 2F4VL 4JI2Q 3RR5A 4DV4Q 1PH3A 4K0KQ 2K5HA 4OWWB 4R4TA 4OWXB 2JA8G 5FJ8G 4R4CA 1VQHA 1PH6A 4BBSH 4LF7Q 2JQOA 4LF4L 1FJGL 4DV1L 2Q2UA 2JA9A 4JI1Q 3L0OA 3S1QH 2CFMA 4A93G 2VQFL 4POFA 4UPAA 3PUYA 1K8GA 2AHOB 1U5KA 1VQEA 2LXKA 3CCEA 1BKBA 1GO3E 4R4OA 4BBRH 5LMUQ 2AMCB 3MXNB 3HKSA 1IBKQ 4JYAQ 5JJIA 5LMNQ 1ASZA 1AE3A 4JI4L 3PCOB 1GVPA 3A5UA 2IT1A 2WAQE
chains in the Genus database with same CATH superfamily
3RB6A 1TWCB 1R9TB 1V85A 4M8AA 1SV4A 2BGWA 2KHSA 4HMIA 1X42A 1CKOA 3BU2A 4NB3A 2IX3A 4ED8A 2PZWA 2PKEA 1U49A 3J81c 4K5WA 3K81C 1B3AA 4QZCA 3ISBA 2W04A 1XNRQ 3J7AV 1SNOA 2R7ZG 3L4PA 2BE5D 2QB0A 2QA4A 3EWAA 1A3TA 5AICA 4NXMQ 4N9TA 3FC4A 3KKAC 3UM9A 4DEZA 4YY3L 1WTQA 3S1MB 2E1EA 5CV7A 3IN5A 4MIUA 1N33L 3HEJA 4B3TL 3PV0A 4MTNA 2H3FA 2XVSA 3N6RA 2HHXA 1ZQHA 1PTOC 4LFCQ 2VJ4A 2DBYA 3PW4A 2X69A 4HR7B 4KY6A 1HPCA 3OWFA 2Q2TA 4CKCA 3EQLC 1TWAH 2VXWA 1A3UA 4TQUS 3J7YW 5IYCH 3H3VC 2QILA 3BS5B 1VLBA 2LBOA 3P1HA 4I28A 2NZOA 2KSOB 5J3BA 4MTKA 2HOIA 1PLFA 4Q44A 4IQUA 5GQOA 2PW5A 4A3IH 8ICVA 2I07B 3VYTA 2HSZA 1UE6A 2W3RA 4IRDA 4MFFA 3WK9A 3D6WA 4UBBA 9ICQA 1S4ZA 4FF1A 1ZQIA 2M2LA 2XCPA 3TQYA 2BR0A 5IIJA 5AKLA 1A6SA 1HFGA 3NRWA 2F1HA 4CDFC 5J2FA 2NVTH 2ICIA 1WTXA 2EYHA 4P4MA 2K1BA 4WFN3 4QGUA 4F3OA 1PDQA 2EJFC 1DRGA 4A8EA 1GO3F 4OONA 3CYMA 1TKWB 4QIWC 3SGIA 4RKBA 4K6DA 1PH8A 4FXGC 2NRXA 1J9OA 5C44G 2LMRA 1S9FA 5J2AA 2W7OA 4DL7A 4CGYB 3RAXA 1EYGA 1E2ZA 1N32L 1JORA 4HIMA 3HOUB 2ASDA 4YR2A 4IPCA 2UVUA 5T1IA 3NEMA 3RN5A 1EFWA 2E8PA 3HOYB 5COYA 1TE2A 3QYPA 2AGQA 4LF9L 5JEAJ 2YTYA 1LLRD 2JA5B 3HOZH 5F9NA 1VF5C 2BCVA 1LABA 4IFDJ 1C20A 4DV2L 1ZQOA 3STBC 5IIIA 1SKSA 3L2PA 3AB9A 1KN5A 2CN1A 4PG3A 1MQ3A 4BBRG 3UDGA 2W7PA 5C0XI 1PZJD 4Q8FA 4RQ3A 4RQ8A 4BY1H 4DFJA 1E22A 1VQJA 2B29A 4J9NA 4ZKCB 3V6HA 1MN8A 3MEHA 2B2UC 1XMQQ 3S17B 4C3IB 2F0HA 2NUCA 3G71A 3IG5A 4X64L 3K7AH 1UT5A 3D4WA 1QSSA 3IM1A 5EPJA 3UE0A 5M3FH 3IFDA 4BY7G 5KYLA 1E24A 5J0TA 1RIPA 1C8CA 1Z1BA 4DV3Q 4RU9A 4PHDA 2H3IA 2N49A 3T79A 2ZTEA 3E2EA 2CH4W 3KOJA 1DD2A 5C0YA 3OSPA 3A0HU 1GUNA 2PPBC 1PFSA 4PPXA 3BZDB 4KLFA 5FJ8H 3GZFA 7ICPA 2YU9H 1RKNA 1B22A 4Z6FA 2B2VA 2PFPA 3RFAA 3ZDEA 4P73A 1L3VA 1ZQLA 3A8JE 3BS5A 5KFMA 2XRSD 1YVCA 5M5XB 4A3FB 3PUVA 5FLXL 5AK3A 3C3LA 1XNQL 4UP8A 1TFRA 2O5IC 1S0VA 3TACB 5ELNA 1CA6A 4J9RA 1ZXIA 4OX9Q 2FDRA 3VYRA 2VB3X 2BCRA 1SXTA 2KKPA 1JWSD 5DNFA 4CKBA 4GIBA 1H9MA 3KJPA 4B3SQ 4NPSA 3LWMA 2EE1A 3A55A 1ZQCA 4ME3A 1UE7A 4BXOA 1HCZA 1YEZA 2IOHA 1ZYRC 1Y1WG 3M4OB 2UUAQ 2DF4B 1BO0A 3M4YA 5KFEA 3BJYA 2KEDA 1O03A 5DM63 1I6HH 2KK0A 3E9HA 1I4XA 1FFUA 3WKAA 1YHAA 1Z9FA 3A0JA 3BZKA 2YTXA 2HHHL 4DWIA 4LZDA 3G6YA 4NDXA 4I2DA 4LVSA 2DY7A 1JX4A 1F9RA 3CRKC 1N8RC 4UW9A 2K05A 2E5LQ 2ENBA 1MKHA 2NZHA 2KTQA 3MAQA 3SMVA 2GN5A 5J8YC 4B9NA 1BUVT 3AQEA 2XC9A 1TKDA 1IKLA 1TWAB 3CQZH 4DUYQ 3S14H 1KBUA 4A3BG 4J03A 3MABA 1ZQMA 2G09A 3LWEA 4X3KA 5M5WH 3M9OB 3T5JA 1SNPA 3AU2A 4H02A 3C2KA 4RPZA 3NTHA 1B50A 4HN7A 5ALYA 3I76A 4IO9A 5M3MH 2NN6G 2F8LA 3M4QA 2KFNA 5KG5A 1F2YA 2ZXPA 1RQNA 2ZIUA 5IY0A 3JAME 4MFAA 1ZQBA 2BPFA 4DSLA 4QUFA 4GOPC 4DV7Q 1SB3C 1EIFA 2IX0A 1TAUA 8ICGA 2TMPA 2XCAA 2VZAA 4IUQA 4KV6A 1BPYA 3TREA 4DK3C 3NS1A 1Z47A 4DFPA 1ASYA 4YCWA 3X3NA 5KFKA 3KFUA 1YNJD 4F5QA 2KKVA 4B6JA 1VQIA 3R3OA 4KY5A 1Z00A 4DLGA 1GUWA 4C3JG 1OUQA 3K58A 3Q0AA 1X6JA 3HJEA 3PSIA 3RB4A 2AUJD 4F7XA 4EBDA 3TZUA 1LV5A 3DEEA 1MIUA 5J2CA 3UXOA 1XX8A 4FXKC 4B9WA 4YY3Q 4LJXA 2E2IB 1Z4OA 4WJ3B 1F9SA 2IOFK 4OCZA 1K5OA 2NB0A 1ZXTA 1QE6A 4KJOA 4LFBQ 2PYKA 3IKJA 4I65A 4O9MA 2QARB 8ICBA 1S0NA 1NZPA 4UB2A 1G2SA 2I9GA 3DEOA 3M6KA 4UB8U 1VQGA 1KTKA 3Q8DA 3NHHA 3FDSA 1I4RA 4A3GG 4CKEA 4UAZA 1ZQ1C 5J2HA 3TEHB 1HNWQ 3Q6SA 3V7JA 1O78A 5EBCA 1ZJMA 2AGPA 1YZ6A 1ENCA 3MFYA 1XPUA 3GTPB 2RLTA 2EZYA 5IP9H 2H5XA 3RAQA 3RR8A 4QY7A 3I55A 5BN5A 2B63H 4RZRA 2JEFA 2DUDA 5IYBG 2EYPA 3NQIA 4JPBW 1JE4A 5KYIA 4DK6C 5AM5A 1SYBA 4O42A 4JI3L 3PR5B 2DGYA 1SNCA 8ICQA 4X66Q 2D5DA 3N7SC 2F4VQ 3GIMA 1U9LA 1X9MA 2HIVA 3OIQA 2EANA 3CCUA 2B2TA 1K83H 2Q8RE 5J2JA 2IOFA 5J0XA 2NVXB 9ICBA 3H6MA 4DAPA 4LF7L 9ICRA 3Q8KA 3I4LA 4DV1Q 1BNOA 2KHVA 2QDLA 3MA2B 1VQ8A 2WTFA 5E7NA 1CKMA 3R2TA 1MI2A 4I2EA 1EY5A 4BX9C 1L0WA 1HTLD 3HOVG 1C7YA 4ZQ3A 2OEHA 3NVVA 4BDPA 2ZTCA 4K4HA 4ACOA 5C4XH 3NBHB 2ZXOA 2RVLA 1JICA 3UDFA 4DAVA 5AM0A 5J0WA 1A6XA 1D7QA 1QUQB 5AKEA 1T9HA 2F1MA 5KL1B 4A3LG 4R65A 1ZQRA 3S9WA 1Q1EA 4IQZA 4ODGA 2GH1A 1L2FA 3UI2A 1A8VA 2DUYA 2F52A 4MZ9A 2EYOA 3K1RB 4PZ6A 2C2EA 4M0AA 3VR4A 2ZJAA 1X3PA 1K8MA 1O08A 8ICJA 2IJ0A 1XSNA 1EU3A 3PMFA 3RLOA 3QZ8A 1IBLQ 3N7PD 1ILQA 3PGZA 3AU6A 4FE3A 3GV8B 3HGBA 4TUSA 4R9WA 4IOCA 2JJQA 3DWPA 2A69D 5DLFA 1BPZA 3BYYB 2IX1A 1C48A 4KLUA 3ULLA 2IPKD 4OEMB 1CUKA 3GO5A 5C3EH 1IBMQ 1B44D 2PZTA 3AMZA 4IQTA 5T14A 4EQPA 4RQ5A 5IYBH 5AM1A 8ICCA 4KY7A 4B3TQ 1W3SA 3C2LA 4L63B 4UB6U 5DB6A 4EELA 1PUZA 1ILPA 4YR0A 3OTOL 1X9NA 1N56A 2MUTB 3MVVA 2A68D 3I7FA 2IWHA 3QIAA 3JC66 5CWRA 1CQVA 1KAWA 1J97A 1RYUA 2ZXHA 5F3XB 4AYBC 2KVMA 3NUCA 4JBWA 3NTUA 3QXGA 1RQLA 4A4IA 4FZNA 1VQ9A 3E5SA 1FGUA 1UE1A 3AQFA 1KSPA 2KCTA 7ICQA 3F5EA 2LM4A 1KTQA 2G5IB 4RCOA 1GUTA 3STBD 4GNXA 3I4NG 3PF4A 4QZEA 1L5UA 3C1FA 4KN4C 1DK3A 4J9KA 1F9QA 9ICTA 2G9HD 3FVQA 3U26A 4K8JA 2L11A 1ZD2P 2RP5A 4PV1C 4X3UA 3PSFA 2W43A 2Q4TA 1P7DA 4PL2A 4Z6EA 4Q45A 4LUZA 4C3HB 2JA5G 3CC2A 2A68C 1LKYA 2F0MA 5KT6A 2EZZA 2BQRA 1F2ZA 2K60A 1A0IA 9ICWA 3B0YA 2D2CC 4OIKA 3PX6A 3NE5B 4DS4A 4US9A 5ALDA 4BJQA 4KN7C 2R8KA 4F93B 3SV3A 1KQSA 1JWUD 5ELCA 4CDCC 3PF5A 2OHFA 4OD0A 4NKLA 4PZ8A 4ZLTF 4K5XA 1WTPA 2NYVA 2CKZB 1T5EA 3S2HH 3RUZA 3A5ZB 3GTMB 3M7NA 4A3BB 2KD1A 5EJWA 1HR0L 1PVOA 1SL2A 2UUBL 2E8NA 4NJ8A 4DK1A 2EY6A 2NN6H 2KG5A 4L5TA 3S24A 2I5MX 1SZPA 1BDOA 1OXXK 1QSYA 2F1IA 4OO1J 5KFGA 4F4XA 2OH2A 1UWVA 4DV5Q 3I4MG 5BOLA 3QB3A 2KUMA 4G7HC 2A1JB 4KMUA 1ZQGA 2KHQA 1KXLA 5C4XG 1BPXA 4UQGA 2BCUA 1D8YA 5ALMA 2WAQB 4R4IA 3MC1A 1ECWA 3PUWA 2PW7A 2A5HA 1RL2A 7ICUA 3WOFA 2K4HA 1J5EQ 2A8VA 3H94A 2K4PA 4P0PA 2HHQA 1IM4A 1BNPA 3KLWA 4O0AA 4PZOA 1CKNA 4HMJA 3HWTA 1ZQXA 1NZBA 2NVQH 5BPCA 2EY1A 2HI0A 1HUZA 4DKAC 5IIFA 1LTSD 2P6UA 1PRTB 3WKCA 1CRXA 3CHBD 1XMOL 1F5SA 4QZFA 5HR7A 1N60A 3M3YH 3E6ZX 2QEJC 5I6WA 1IHZA 7ICLA 1B70B 2OYYA 3QNMA 2WF5A 5IIOA 2IMWP 2ICEC 4KLOA 2Q2HA 3SXHA 5AKYA 4KHZA 5LHY1 4ALPA 3VDYA 1H95A 4OIJA 5J2GA 1SMXA 4I7AA 4KMOB 3DLLA 5EE1A 2HCFA 2F0TA 4M9HA 4LF6L 1P8LA 1X66A 1E3PA 5HGQA 5EWGA 3S17H 4JV5Q 3TADA 3SAHA 4P75A 3K5LA 4ED6A 3BG3A 4XTCS 4LZGA 3MFHA 1JCKB 1DXMA 4F5OA 4I2FA 4ZUJA 2XO7A 4JI0L 2WFAA 2E2DC 3KDFA 1SE4A 4DOAA 4NLKA 3SD7A 3TSSA 1QLNA 4K5VA 1K3RA 1QG7A 3Q24A 4Y2QA 1STYA 2YYZA 2UUAL 4LF8L 3RZOB 1NSNS 2KFZA 3IP4B 2AWOA 4I7ZC 1I6VC 3M85A 4AYBG 4C3JH 4K2LA 1YJ9A 4UBCA 3K0XA 1XJVA 4DL2A 1TVXA 3HOWH 2H3ZA 4NM1A 3HRDD 3GTJB 8ICPA 2HHHQ 3H0GB 3ZI4A 1NK0A 4EYHB 3CPFA 3EN2A 4K2KA 2F4VL 4JI2Q 3RR5A 4DV4Q 2K5HA 4X3TA 5FJ8G 2JEGA 3MDCA 4ED3A 4X5VA 1V1PB 1DZ1A 2JQOA 5TISU 3MHBA 4LF4L 5G5HA 3T4AC 2Q2UA 1XSPA 3L0OA 3S1QH 2CFMA 2F0JA 2VQFL 5DQIA 2FLNA 4YG2A 3K5MA 7ICHA 3M6ZA 4UAUA 1U5KA 3VYUA 4BGDA 2XWBB 3O13A 3RJEA 3HZXA 3MXNB 3WOEA 1IBKQ 1AE3A 1ENAA 1I3QB 1E0BA 2QW7A 1N5WA 2KEYA 9ICIA 3AU7A 3A5UA 5AI9A 2KMDA 4F5PA 1EUJA 2A73B 9ICLA 2RCNA 4FO6A 4CDDC 1HZ9A 2V9WA 4YMMA 4RGTA 4R8IA 3VA7A 2F4IA 4BA1I 1JJGA 3RBDA 3H09A 3FPUB 2V1CC 1ZQZA 4JV2A 1L6NA 5E4WC 4ED1A 4YCXA 1X55A 5J0OA 3S14B 4E6IA 4I2BA 1BR9A 1HZAA 4F88A 1QNUA 3C23A 1S5ED 2MJ8A 4TURA 1SMYC 4A3EH 1ZYRD 2BHNA 4OO1H 2JR5A 4UARA 1UAPA 1PH7A 4I29A 3EJIA 1Z6HA 5I2XA 4QZIA 1VQ6A 4LFBL 5AM4A 5KG3A 5DB7A 4M04A 3KJOA 2CH4A 2LI6A 1RG6A 4FZMA 3MXUA 1N34L 1UA0A 1TK8A 1CSQA 1EZ8A 1CTMA 3IFTA 3ULJA 5D14A 2I46A 1TV9A 2G0AA 1S5DD 1JB7A 2FLPA 2K6AA 3F2BA 1AE2A 4QUCA 5KFYA 1FO4A 4EEYA 1SKRA 4GLXA 4E0DA 1GHJA 2A74C 3N52A 1B0XA 4QF4A 3KLSA 4TKOB 1C9OA 2X6LA 3SEBA 3TARA 4CJ2C 2F44A 1SGGA 5ALKA 1UPHA 5KT7A 3G6VA 8ICSA 1EFID 2NVQB 2JZBB 1Q86C 1Q1BA 5E4XA 1KW4A 3J80L 4NV0A 2PMZC 1BCPD 5ALTA 5J2DA 3C1ZA 5KG0A 5IP7H 4BUGA 2AKWB 4KLIA 2ZIXA 1NK8A 4RHSA 1WCNA 2B8FA 3J7AF 1EOVA 2XVTA 2KVSA 5G5GA 1H9SB 3CPWA 3TFSA 1XTCD 1Q3VA 2F0DA 4HYKA 3ICEA 1VDZA 2WKCA 1F44A 3BS7A 7ICNA 3QUCA 1SNMA 3UMGA 3I4MB 2F0WA 4IUPA 1BQQT 4UDUC 3S2DH 5KFZA 1NNLA 1AP0A 3RRHA 2CW0C 1VQNA 2FMSA 2J6UA 4BY1G 2WAQG 4YXJA 2MPMA 4BBSB 4PMCA 1NBWA 3DM3A 5CV9A 3AMUA 3I91A 2WIIB 5EQ0A 1SV0C 3BYTB 2R7ZB 3KZXA 1EQTA 8ICOA 2A6ED 1N36Q 2PO4A 3E58A 3J81j 1OO9B 1NK4A 5CRXA 3UE1A 1WTWA 5D4BA 2Z4HA 4YXMA 4BS9A 3AM9A 1K3BC 3X3MA 3T1HQ 2N3SA 4DR1L 4L5SA 1TXYA 3ZJYC 2WB1F 4IRKA 2ZM6Q 3VR6A 1NJYA 3TP6A 4FYDA 5C44H 4I2GA 2ZUCA 4JG2A 4N8FA 2PQEA 1N2XA 4IUUA 2LYAA 3NASA 3H0GH 5JEAH 3QZ7A 3EW9A 1IBML 1QVFA 2ALZA 7ICMA 4QQBX 3G6JB 4QMGA 4WJ4A 1S0OA 4KHVA 5NUCA 2R93G 3G7LA 2MRLA 5KNCA 5C0XG 4TQRA 5CC4A 4DLEA 3MGVA 2B6GA 1LYLA 1PYWD 4ELUA 3N7RC 1A3VA 1PRTF 2VANA 2YMPA 3EPIA 4CJ0B 2AXTU 4IR9A 1ZQUA 3AN1A 2HBLA 2B2WC 1ZQFA 2FMCA 4ZCKA 5KG6A 1K1QA 2LMCB 5AJ3Q 1WTVA 4KTQA 4KKTA 2Y9UA 1ZQEA 7ICOA 2ZJ5A 3RD4A 3H0LB 3G48A 4DQRA 1TWHB 2VUMB 4WJWA 5JOBA 5JRTA 2KJ5A 4C8MA 3GV7B 3I28A 1EYAA 1ZOLA 4N8X1 4DL5A 3KDFB 2B0CA 5J0YA 3C5FA 4JV0A 1SV0A 3UXPA 1D5ZC 2I5HA 5CJ7A 3LGJA 4FVMA 1XO0A 2KIVA 5JPNC 1YI2A 1SZHA 4DQPA 5IYDG 2UUCQ 4DR4L 5IODA 1NTGA 2PMZE 4XQQA 1YHBA 3OPXA 2MU2A 1X2IA 5K5PA 1Z4NA 3IV6A 1G6PA 3OOCA 4O5KA 4LF8Q 3M7GA 5AM3A 2WFWA 2GVAA 4DXGA 2W11A 3V2TA 3ETLA 2DKZA 2FI1A 5KFFA 3C2MA 1A63A 4P4PA 3L7ZC 4NM2A 4EX6A 2RRDA 4XQ8A 4KLSA 5FO7B 3W2DA 1YJWA 2VS1A 5HHHA 2BQUA 3PUXA 4GXJA 4DV6Q 5JJLA 2QB1A 5TZVA 4HAEA 2AQ1B 2E2HB 1AQ6A 4DR2L 1Q7YC 2F0IA 4RNNA 3KBGA 1BXTA 5C4HA 4LJZC 1KKXA 3TADC 3MGIA 3C29A 3TP7A 1K28A 3FKIB 1YNND 4P2HA 4GC7A 2SDFA 3TFRA 5C3EG 3OMGA 4EQNA 3K59A 4CBVA 5KFXA 3IG8A 1L7NA 4DSKA 1GD7A 1NMGA 4TRDA 5L1LA 1RYSA 7ICGA 1II3A 2K5QA 2K4EA 4RQ4A 1A76A 1HA6A 2E3TA 3MFIA 3F1ZA 5DM73 2YMMA 9ICCA 2M00A 3S2HB 4WRDA 4XA5A 4CDGA 5JUMA 5ALJA 1NR2A 1OXVA 2JH7A 1EWHA 1KAAA 1ZQYA 2PQAA 2V4DA 2I0QA 2VQEL 3BDLA 3QEBZ 2KCMA 1WCMB 4LFAQ 3BDPA 2B2WA 4ME5A 1XNRL 4P0QB 8ICLA 1ET6A 4GNXB 3PY8A 3QE9Y 1EY4A 3ND8A 2A19A 1FIQA 4NLCA 1NK7A 1VS0A 5C3XA 1PA6A 5AK5A 2HQEA 1RJTA 3FPPA 1FFVA 2FLLA 3PO3H 3QU4A 3PNCA 4Y2VA 1T4GA 4HSPA 4V0BA 4AQYL 1OXSC 1PHJA 1X3QA 3I70A 3URYA 4V190 2IHFA 5KFLA 5L1IA 4IRCA 1KIXA 5ALUA 9ICGA 5DG7A 1RCVD 1HJPA 2PQAB 1X3FA 2B2UA 4RKLA 1YT3A 3HPOA 3P20A 5E3FA 5EE0A 4AP9A 2TSSA 4C2MB 1YIJA 1SE3A 2G08A 2ZJPA 3QOJA 4PNYA 2NVYH 1L1OB 5BN4A 4IFDI 1YJNA 1ED1A 4BXOB 2NN6I 1EQRA 2HCCA 5IILA 5AI0A 2ZUBA 5J0RA 1ZKOA 2K28A 4QWAA 5AK4A 2EYJA 2GA4B 3J81E 5GTHU 4A3DG 2OQ0A 2LXJA 5KRUA 3ISCA 2L5TA 8ICAA 1AN8A 1CQFA 2MO0A 3FRPB 3HKZB 3M4PA 4B08A 3SR6A 1K9MC 1NJXA 4KMUC 1B9MA 3C2PA 1JWMD 5EKIA 2JA7G 1JOQA 3BVGA 1V1QA 2PFQA 2ZIVA 1DOLA 2DJGC 2F0KA 1NCVA 4I2IA 4OJOA 4QZGA 3P7JA 4RA8A 5AFWA 1PH5A 3JPQA 4LF4Q 4QIWB 4OGQC 2RSOA 4HTHA 5DQGA 1EIYB 1Q8KA 3DMUA 4FF4A 3ZDDA 1KLGD 4JI1L 1YBYA 4KLLA 1IYVA 1JROA 4NY8A 1HEKA 4RGOS 3E3XA 5LMUL 2VB2X 5JVG3 9ICSA 4NL9C 1OXJA 1ICWA 3HG9A 2ZJRA 1V1OA 2UU9Q 1KDCA 4C3JB 1XXGA 4DV2Q 2G06A 5HHIA 3EUB2 3PW7A 2OTLA 5DQHA 2BCQA 2SEBD 5KFBA 3NPPA 3OWEB 3HOWB 1IXRA 4A76A 1L0XB 2EQYA 4UB3A 1HIWA 4OWTB 1Y88A 4DR3Q 1HNXQ 2ID0A 3S16H 4CDEC 5J0UA 5FOBB 3RZDH 4DR7L 1CKNB 2VIXA 3FKIG 4C1NI 3RRGA 3D6CA 1NNXA 1VDVA 3I4NH 3Q8PB 1SE8A 4QJFA 2R6GA 5ELBA 1HTPA 1GM5A 1A2UA 3HKZF 3UXNA 1X3GA 4EEKA 4NXML 1O7YA 4I2CA 2E8GA 4KJNA 4DGZA 1E2VA 2DY8A 1N33Q 2F3NA 4PJ0U 3ISDA 3J80i 1AEXA 1ZQNA 1STBA 3JPTA 1QVGA 1NKBA 4PGQA 3RB0A 1RYRA 1I3QH 4MEYA 1JOKA 2I5LX 3J81L 9ICNA 2NO5A 4PQXA 5JTIA 1E1OA 2N78A 3Q22A 1LTRD 1S77D 4LUVA 1NJIC 1X65A 3PW0A 5CYUA 4WORA 3JPSA 5FLXE 2G07A 4DFDA 2A6EC 3TI0A 5AKIA 1HUOA 1HQMC 4RGNA 3F2CA 1H9KA 9ICUA 8ICKA 3H0RB 2BA0A 2C35B 3OW2A 3A56A 4JI5Q 2BDOA 2F0FA 4QWDA 4O0IA 5FKAC 2MUTA 2UUCL 4CF5A 4NMZA 2JA8B 1T94A 4A3JB 2PFOA 2FXQA 1VQDA 1UUPA 4G7OC 1D9FA 1PYSB 2R3ZA 3E0JA 5F2DA 2LKYA 4GFJA 5J1ZA 4DR6L 5IYDH 4O3NA 3EFXD 2AQ3B 1SIJA 2Q0ZX 5HMMA 2GOLA 5BR8L 1XYIA 4EQ5A 3SDZA 5J2BA 2R8IA 2BPGA 3PUZA 2XGQA 3S1NH 5ALVA 1S5LU 1D8BA 5AI4A 1N32Q 1SWVA 2E8MA 1JIHA 2HD3A 1K73C 2ISOA 4KLQA 1BCPC 3BVZA 3ED5A 2IL8A 1D1IA 4RG1A 5AHXA 3C21A 2JEAI 1RD9D 1XC9A 1BOSA 2L55A 4QL5A 2B63G 4DR2Q 2HMXA 3F53A 3OSOA 4A3LH 3RH6A 2WAQF 1HH2P 1LT6D 5C0XJ 2EVBA 2KENA 3GQBA 8ICHA 2W8LA 1PH1A 5ALGA 2R93H 2NVYB 3NWTA 1TS3A 3ETRA 5DGBA 2AGOA 4A3GH 1K8OA 3IDWA 2RCFA 3CCMA 4UB1A 3TN2A 4ELVA 1SYFA 2BA1A 3H91A 1IV8A 4C80A 1J8IA 2KZ3A 3BQ0A 1O7IA 2J6TA 2EZXA 4ED2A 7ICKA 1EIGA 2F03A 3Q8MA 2XY5A 3S2DB 4BBRB 3AYHB 4B9SA 3U4ZA 4A3CG 4AIMA 1JXLA 2AWNA 5CV8A 3C5GA 3H8JA 1PYBA 2QDBA 4GKKL 2PI2A 1Q3LA 2R92H 4DSIA 1G6ZA 2EXDA 1H38A 1R9TH 1K0RA 2R7ZH 1FD7D 1IYJB 2X6GA 4F87A 2R8GA 2CWAA 3HOZG 1SBBB 2RHFA 3CF5A 1WUDA 4OJPA 2K8CB 3KFUF 4JW0A 3GTOB 4RMFA 4DF4A 3ERSX 1VQKA 4RUAA 4YR3A 2UVRA 4IR1A 3S15B 1CM9A 4L6TB 1Y1VH 2KECA 4YHHL 4YN4A 3KLRA 3TKAA 1TQOA 1SWWA 2M9NA 1OXTA 1KRSA 4ECTA 4KD3A 5KAFU 4A3MB 4JI6Q 1GHKA 1HUNA 2YB4A 1N5XA 2RDFA 3RLFA 4U6PA 3PW2A 4M9NA 1N62A 1AZPA 1DCZA 1UCVA 3NK9A 4DSJA 3C46A 2JEBI 2K8AA 5L1MA 4HJ9A 4FBUA 5KT5A 3RZDB 4YMNA 1ZJNA 4JOIA 2YN4A 2LM1A 4DL3A 1RTNA 3GTLH 2G9DA 2NRTA 3LX0A 5KFRA 1V43A 2AQ2B 1Q46A 3ZYYX 5ELFA 4M9GA 2XNAC 5KFIA 3GTGB 1S8OA 3K1ZA 2CPRA 3RTVA 1X32A 2B8GA 2K01A 1G91A 2RQ5A 4KK7A 2DFLA 3S1RH 2JA7H 2KJXA 4X66L 1QZGA 1RODA 2H1EA 2Y0SG 1JALA 1B4OA 4DV6L 1PVQA 1D6EC 1ZYQA 2KP7A 1L3UA 3NQTA 2OXPA 3BS1A 2JA8G 4R4CA 4DQIA 1VQHA 1PVRA 2ATLA 3KKAA 3KHRA 2JP1A 4DS5A 2GWSA 4BWJA 4JI1Q 5KAIU 1VF7A 5J22A 2ISPA 4YFKA 4POFA 3MFGA 1K8GA 1RPLA 3V72A 5FK9C 1BKBA 4CGZA 3QU9A 5JJIA 4DOBA 5LMNQ 1BCPF 1I50B 3LVVA 2E75C 1CZWA 2QCPX 5C6AA 3PCOB 1GVPA 4JK1C 2BCSA 2N88A 1CFMA 2WAQE 4IZ8A 3HOZB 4CRXA 4KX5A 1X9WA 2XGTA 5DBCA 1MHWC 4C3IH 5BN3A 4RQ7A 4P72A 2Z7JA 3LYSA 4FZLA 3VCBA 3WK5A 3PMLA 4J9LA 2D62A 2KJ8A 2F0LA 5GAGC 3P75A 5CORA 4DR3L 2VQEQ 2ZIXB 3CP8A 4PGYA 2NBFA 4ZRZA 2K33A 1SKWA 4XQNA 3W1GA 2P6RA 1I6HB 4UASA 4KLEA 4P4OA 1IBLL 2ZTDA 1DK2A 2BOSA 1WOCA 1G51A 2QB0B 3KHLA 5ALXA 1SRUA 5AKKA 1A15A 1YNJC 3HFZB 1S5CD 3QWNA 1PVPA 3GIIA 3CCJA 3MZ5A 4ECRA 5ALEA 4RQ0A 1L7PA 4KN7A 4QZAA 4UB4A 1EQVA 4RNMA 2JGAA 1Z7TA 4LK1C 4A3IG 5CGKA 3DHQA 3A8IE 2B3GA 5KFNA 1GUOA 5IGEA 2N55A 1Z3EB 3QX7A 2P66A 4F5NA 1AW7A 2EQSA 1HHVA 2FPLA 2GLEA 1KRTA 5D3DA 3I56A 1Y1WB 3H0GG 5KFSA 4IURA 4JWMA 2KVCA 5HMLA 5EOZA 5LL6X 1GKHA 4LF5L 4FS2A 3EROA 3LNNA 3F5AA 4F4YA 4UP9A 4C8NA 3I73A 4ED0A 2RDIA 2CQAA 1B8AA 4CF3A 2K14A 1BPDA 4HJAA 4ECVA 4K4GA 1M1KC 3KOOA 4IN3A 3M4OH 3CRLC 4M9JA 1MSGA 2JA6H 3PO2H 2UXBL 4NLZA 1IYUA 5KT2A 7ICVA 1VQ7A 2F1JA 5M5XH 3WWVA 1RM6C 1TU2B 5AI6A 4XYOA 4M9LA 7ICTA 2LPEA 1TWGH 2L12A 3HOWG 2KE7A 3DEPA 1DONA 3TBIB 2QKIC 7ICJA 1MJEA 4DR6Q 1FL0A 4C7ZA 1JI7A 4GN4B 1E1TA 1FNWA 2JV3A 3M9MB 1WJJA 1WTHA 2EJMA 4QIWE 3ONNA 5AIBA 1SJHD 1NJWA 1G8ZD 1F77A 4A93H 4BXXG 4M6WB 2DJFC 3GTQH 3D4DA 3H4BA 1HR0Q 4CF4A 1DOQA 3L9AX 1W2BA 4YVZA 4YWKA 2MUYA 4LW1A 2OCEA 2NRVA 5DDYA 3NVYA 5ALQA 3UMCA 2ZUDA 5KFPA 3NUQA 1SSOA 1SYCA 3J80E 2K89A 2A6HD 2E5SA 2K8BB 4ECXA 2IHMA 2G5DA 3HKZE 4ZK9B 1XPOA 5D49A 1O80A 5M3MB 1TY2A 1DYQA 1L1OA 5IOCA 1PV4A 4OJ5A 4DAYA 1HNZQ 1WYGA 4HIDA 2P35A 3GV5B 1DJRD 1F9PA 1H9RA 3BQ7A 4R63A 1COKA 2EY5A 2KNJA 3K6OA 3QUBA 4PHAA 3WK7A 4FNFA 5IGFA 4ECZA 1PXUA 4ECYA 1STEA 2CVRA 2D9UA 4BY7H 2BDNA 2WF7A 3CQZB 7ICIA 5KT4A 5KNIA 9ICHA 2PCFB 4J8QA 1P16A 4DCCA 3HRZC 1XWLA 2F0GA 4FFDA 1N48A 5ELDA 3LWUA 1IIPA 1A77A 2H3VA 3E0EA 4X62L 4KHPL 2EXZA 2PZUA 3JPPA 4C4RA 1BPBA 1I4GA 1IW7C 3ALRA 5J0PA 2W9BA 4PL1A 3WK4A 1XMOQ 3KF8A 4YWMA 1L0YB 4QZBA 4RUCA 2EDUA 1RHPA 3WU2U 2VY3A 1S10A 3NP8A 3UMBA 5L1JA 2R8JA 4NLGA 1D2BA 3M9BA 3RBEA 3SAGA 5KG2A 3CXCA 5CMDA 5J39A 3PSTA 4JUZA 1OXUA 4U673 1ZD5A 4DQSA 4LF6Q 3K0YA 4EVOA 4EQOA 4EBEA 3BDOA 5JU5A 1EYCA 1WD1A 1L1OC 3MXNA 2ALYB 5E1FA 2E2IH 3LVWA 4JI6L 4MEXA 1QH9A 4IOAA 3EBEA 4DO9A 2NVTB 3I90A 4JI5L 1T5XD 1WI5A 2B63B 1CT1D 4UATA 4O3QA 3M8SA 5IP7G 4KLMA 3V6KA 4J6HA 4ULLA 5KGUA 3K80C 4ID6A 4KITB 1VQMA 2RDGA 2O2LD 4RT2A 2B2TC 2FHTA 3PIOA 3IRUA 1WD0A 8ICIA 3O0FA 3HOUH 1L8LA 1COOA 5BR8Q 2CRXA 3PW5A 5CBAE 3MEFA 1AFPA 4QWCA 1I5FA 3PVXA 1CI3M 2R7DA 2D3DA 4IPDA 5I9PA 4A75A 1U4RA 3K8AA 1QILA 3HW8A 2K32A 1LM0A 3QJYA 2WF9A 3CMEA 2I6XA 3RR7A 3EA6A 3NTKA 1UE5A 4F72A 2W9CA 1SJED 2XY7A 1DM0B 2KQ3A 2G5HB 4PZNA 2KN7A 5GAHC 2HBMA 2EOTA 1QQ6A 1JMSA 4QZDA 9ICXA 2EZVA 4Q43A 1U48A 3DUZA 1PH9A 2VNUD 4FBTA 3OW7A 2EAMA 5T1GA 3RN2A 1EXNA 1H9SA 5H2FU 4QZHA 3QUQA 1T8EA 1N61A 5KFWA 1EU4A 1NAPA 2KCNA 1WYDA 1IL8A 3SAFA 2PMZB 1DGSA 4YD1A 4GKJL 4M1UB 3HOUG 5IIKA 3GILA 2B2YC 2DKXA 4RNOA 5AK6A 1LTLA 2KOLA 1TT2A 1PTOD 3RH4A 1NKCA 2F0QA 3RMHA 3KTQA 1VQCA 3FEWX 5D3IB 3T1YL 4A3EG 4F2SA 2F0VA 5C4XB 4I2AA 8ICZA 2HQLA 3CKIB 4DNTB 1U0LA 3DV9A 3D4RA 1OTCA 1NK9A 3T5KA 1F0MA 1D5XC 4GKKQ 5B5EU 5B66U 4CCHA 2MFIA 3HOXH 2YU9B 3G6XA 3UPQA 1TK0A 8ICTA 1PTOH 2FMMA 3D3RA 5GADC 3K7AB 4A3KH 9ICAA 2EAOA 3OHAA 2WV6D 5I4DA 2F2AB 3A0BU 5M3FB 2YMQA 2Z6KA 1S40A 4A93B 1SYDA 3RNUA 4KD4A 3GTQB 1V97A 4BWMA 2GVBA 4A3FH 3Q8LA 5M5YH 1Y8NB 3K5NA 4DUZQ 3J7A5 2M9VA 4LUOA 5EBDA 4RQNA 1XPRA 5DG8A 1ZQTA 1LTGD 1AZQA 4FO2A 1Q3UA 3SHLA 2D6FC 2W9MA 3OIPA 2ES2A 3TAPA 2KHJA 4G9BA 5F9LA 1PMRA 4H13C 4TSSA 4XDXA 3QG1A 2V4RA 4Y2RA 4ZOHC 4F4ZA 1PH2A 5D65A 3SK4A 1HUMA 4JWNA 1FNUA 3HKZC 4OXPA 2CXYA 4C1NK 2ZXIA 2NV3A 1XU4A 4IC9A 3I4OA 1CZGA 1WCLA 3C1YA 9ICKA 1G291 1DOMA 3GDEA 5KL8B 4CJ1B 4F4WA 1VQ5A 4APVA 4M47A 2WINB 3QU2A 3OPOA 4YIJA 1S3OA 2Z4IA 3D0FA 1X56A 5D46A 2XSCA 1JUDA 1TS5A 4DV0L 2DNCA 1Q90A 3GTOH 2DQNB 5EPLA 3I2ZA 4HCSA 2LSSA 2JN4A 5KFDA 1B53A 4Y2SA 3WKBA 1NK6A 5DLQE 5C5LA 3S15H 2YB1A 4JCVE 4A3BH 1LT5D 4Y7NB 3QOLA 3I3CA 4K6LA 3VR5A 4DV4L 3G6EA 5M5WB 4JI2L 1ZRMA 3IL8A 1IL2A 2Y1IA 1UNSA 4DA2A 1K8AC 2B2YA 3S6JA 2IY5B 2PI2E 1KHIA 3MR5A 4J9PA 4RCNA 4NWIA 2WF6A 3PQIA 5IIMA 2UVWA 3OJSA 5IINA 1E2WA 2FMPA 1W6KA 1V9PA 3NRZA 5LMNL 4X6AH 1E7ZA 1G2TA 2CWPA 1SEBD 3MDAA 2NWGA 3ERQA 1UHUA 4F50A 1I4QA 5G3LF 2HCIA 3E9IA 1JR0D 1KNAA 3DXJC 3KF6A 5DBBA 1BVSA 4L5QA 4OL7A 3ULPA 5EE3A 4L8JA 4HJ8A 4ABNA 2EY2A 4KKUA 1M8AA 4KKSA 5ALSA 2PI5A 4R1JA 4FF3A 3H8WA 5IE8A 4KHPQ 2HIXA 1TR5A 1ZETA 5DB9A 2L1BA 5C5MA 1EEID 3NELA 1NK5A 2H4OA 2XTIA 1CEZA 1Y14B 4Y2PA 4Z6DA 4ZKBB 4P74A 2Z6BA 3OYYA 5JJZA 1VQLA 1I50H 3HS0C 2JHDA 4MFCA 2E74C 4GN3B 3PZPA 3DDHA 4AH6A 4EZ9A 3V96A 1NUCA 1T7PA 1R4PB 3V7KA 1T3QA 2EYFA 3M3YB 1NOMA 1SXDA 1GXDC 5M3FG 1Z1VA 5KFTA 3CCVA 2AH5A 5KG1A 1BPEA 4R8UB 5KNBA 3CC4A 1STNA 1LT4D 5A0LA 4RPYA 1ZQPA 2K52A 1XNQQ 3K5OA 1AH9A 4JC0A 2J6SA 5ELEA 4B3MQ 3L3FX 4JBKA 3KHHA 1QQ7A 1PFMA 1KRPA 5CEHA 3GTPH 2VKQA 4PHEA 3OJUA 3PIPA 3AFPA 1SNQA 4DNIA 5L37A 4RPXA 1PTOB 5KFUA 1PZID 1SXEA 3RJGA 4KLHA 2W8KA 4A3KG 2ZIWB 4ED7A 2WB1G 3ER0A 2F3IA 2A1JA 1KLUD 4EGVA 5M5YB 1EIHA 2C5CA 2A69C 5K36G 4DR5Q 1Y1WH 1Y8OB 3GTKH 4JV1A 1FVIA 4UY8C 3RZOH 2E5LL 1K83B 3H3VH 1ZQSA 3FYHA 3NBIA 4UAVA 4OHJA 4DFAA 4TVAB 4QWEA 1B7YB 2RKSA 3FDTA 2MNAA 1R4QB 4F5RA 4Y2TA 4QW9A 3GTJH 1AROP 2MA1A 1XTDA 4MNOA 2JA6B 4X65L 3PO2B 5GTIU 4I2HA 4KN4A 4KLGA 4PHPA 4RWSC 2XICA 5DBAA 2XRQD 1EOTA 1VQFA 3SK5A 3H8MA 1JJ2A 2C9OA 4RAUC 3VR2A 2O4XA 2ZG6A 3M1YA 5ELOA 3R8BA 4ECSA 3M8RA 4JBMA 3FAHA 2ASLA 4GKJQ 3EIVA 2F0UA 4LAAA 2CW0D 2Z9HA 1PRTC 3W1BA 2PI4A 4X64Q 3RB3A 3R9KA 4K14A 3CD6A 4GLAC 5ALIA 2YQEA 4Y7NH 3MWYW 4NP5A 3HX0A 1WFQA 3KLSX 3PX0A 4DF8A 3BQTA 4IUVA 3GIKA 1T3NA 1O7LA 1OW5A 2FE9A 4ZAIA 2BE5C 4Z9CB 2JYOA 5KEEA 3PV8A 2KHIA 3CCRA 5KIXA 4L5RC 2BDUA 4G7ZC 2E1FA 3VC8A 1S76D 2XN9C 4HCEA 3VR3A 3K4GA 2J4XA 3HOXG 5C3EB 3E0FA 3W5OA 1L7MA 2W3SA 2WB1C 5KNDA 3TZDA 1XSLA 2YTVA 3SE0A 1MD2D 3D31A 3UDIA 1J6QA 1EY7A 5AJ3L 4N9PA 5HP4A 5ALZA 1Q81C 3R93A 5CR0A 2J0TD 3ZD8A 3MR2A 2BKEA 3LWLA 4JI8Q 4QJFB 5AKHA 1RDPD 1SAPA 2E76C 3SR1A 4J9MA 4RQ2A 2MGSA 5KFAA 2W03A 2OT2A 2OM6A 3TANA 3QEAZ 4DAMA 2LFNA 4JYAQ 2K5VA 1KQQA 4DR4Q 4UAWA 4XYQA 2XWJB 4JMUA 1JN3A 1VQOA 4B3SL 1V38A 3IRBA 2IW3A 4F2RA 3GTMH 1M90C 1B4FA 2DN8A 4EENA 1SMYD 2VA2A 1HZCA 2YTUA 4C3HH 1CHPD 1GOZA 2K03A 2KCCA 4HIKA 5EAYA 3F2UA 5FLXc 5IT9E 3AL0B 2HBKA 5IP9G 4XIGS 3ZDCA 4JI3Q 2Z0SA 3I1YA 4H44C 5AKZA 3KBBA 4P0QA 4MF8A 4YMOA 4MHEA 2MQHA 5EE9A 1S5FD 4HJ7A 1PK3A 3I4MH 1KFDA 3HOVB 1ZQJA 4K0KQ 5AIAA 4OWXB 1EY9A 2YY6A 1URJA 2BPCA 1PH6A 1S5BD 3WKEA 4LF7Q 1X9XA 5DB8A 4BBSH 3ICXA 1FJGL 3OHBA 4ECWA 4DV1L 2PNRC 3THVA 4PH5A 2WB1B 1F2MA 4XUSA 4A93G 2RQXA 5J8YA 3HP6A 2AHOB 4A3DB 2ESEA 1VQEA 2F0PA 4IS7A 5LMUQ 4R4OA 5DAUA 1UA1A 5HGTA 2D8CA 2WKDA 4MN3A 2KOBA 5IGGA 1CA5A 1ASZA 7ICSA 4XXEA 1KFTA 2CHBD 5ALFA 2IT1A 1FEZA 3ND9A 4QB4A 5CP2A 2C28A 3T1YQ 5C44B 4OO1G 3C28A 4KLDA 1TS4A 3T53B 4DV7L 2K04A 1EQQA 3GP7A 1SE2A 4NXNL 2JA6G 3PO2G 1JJCB 4R4QA 4MF2A 3GFKB 4ECQA 4AYBF 4LFAL 5G3LD 2K4IA 3D2SA 1KNEA 3GIJA 2EYMA 2L4NA 5DEHA 3GTKB 1WWVA 2EH9A 3D2QA 4RFBA 5M3MG 2W9BB 2WAQC 4P71A 4GNXC 1KC8C 4QW8A 4GS3A 2F0NA 2IBKA 5H1SE 3H15A 1PFNA 1SYGA 1U4LA 4DUZL 2HVIA 3BZCA 3KF6B 3NENA 2KICA 1TWFB 4POGA 1ESRA 4IL6U 3KD3A 5BOMA 1Z19A 2WP8J 2BQ3A 2Z1CA 3CW2C 2EDGA 1NMFA 2AQ0A 5KT3A 4IALA 3OTOQ 4QZ9A 7ICRA 1MSHA 3RH5A 4R8NA 5CR3A 4FXDA 4GZYC 2HOQA 4UB5A 2JMGA 3EZ5A 4GXKA 5J0SA 2L15A 4LWCA 1S0MA 2RHSB 1SNDA 3Q23A 4IQVA 1YNNC 2KA7A 3D8GA 3U9SA 1SFOB 3SK8A 4GLVB 1D5MC 3HOXB 3RJHA 1SLJA 1Y8PB 2WACA 1QUQA 4XT3B 3U58A 1V1PA 1QSLA 1PK1A 5AI5A 4A3KB 1EZ6A 3LDAA 4B3ML 4B9XA 3DWQA 3H8SA 3A7LA 2QEXA 2EYLA 1ET9A 2HDOA 3WKDA 1EY0A 2F0SA 2PXIA 8ICNA 4QNLA 3M9NB 4KX3A 4XT1B 2ATWA 8ICWA 4C56C 1LTID 4DOCA 1ZRNA 4O3MA 3K57A 1QCBD 4LNQA 3A54A 4QCLA 4X3SA 2ASBA 1KEJA 2JK8A 5L9XA 5JVH3 5FLMG 3NWSA 1JE5A 1LTBD 9ICPA 3AFQA 3SVMA 5HNKA 1CK1A 4CE6A 4IUNA 2W9AA 4IFDH 4DR5L 1SDFA 1ZD3A 3U9OA 5JAVA 2E2HH 8ICUA 1LT3D 5ALLA 3CC7A 3M7DA 2CQOA 1PRTD 4U68A 4XQJA 3MR3A 3JAMc 5EPKA 3PO4A 4AYBB 4JBJA 1BBWA 1CSPA 2UUBQ 2BH2A 5K36H 4RGMA 5FLMH 4P2CB 2OQKA 3TRZA 1L3TA 3AEVA 3K75D 1EWCA 1LO5D 2VL6A 4X65Q 2UU9L 3S1QB 4DV5L 1A2TA 2UXCQ 2NRWA 1QB5D 1XWEA 5EWEA 1KD1C 5M9OA 1Y69U 3CCSA 4IPHA 2BDPA 2VA3A 1U4MA 1SN8A 1EYDA 1NR4A 4I27A 5J29A 3ITPA 4UP7A 2P5ZX 4RQMA 2Z6KC 4DSFA 2HDLA 4RQ1A 5J0QA 5IWAQ 1HNXL 5DDMA 1WWUA 2WF8A 2HHSA 1M4VA 4PZ7A 1I94Q 4DR7Q 1PTOF 2UXDL 2N1RA 1W6JA 2BH8A 1VMPA 4BXXH 3CNHA 2F3VA 2KV2A 3JPOA 5CBEE 1LACA 5KFCA 3V05A 1B43A 4IFDG 1IKMA 3NTIA 4GOPA 5C4JH 5DG9A 1ZEQX 4ICAA 4DL6A 1SL1A 3B6YA 2K75A 1JXEA 4C3HG 1TAQA 3KHGA 1JC7A 1TY0A 2MHVA 4J15A 2OXOA 5KFHA 1RXVA 1WTRA 5CHGA 2L9HA 2LYBA 3D6JA 1QTMA 1BCPB 1HXYD 3F2DA 3J7ZC 1WCMH 1MSWD 2EIFA 4DL4A 3VA5A 4A3EB 3PSPA 5CB1A 4TQSA 1B9NA 3T5LA 4G3IA 1EY6A 1L8OA 1LTTD 4EZ6A 5EWFA 7ICEA 1QZHA 4IJLA 4YHHQ 4NW2A 2ODGA 3SV4A 3SQIA 1TAMA 3RJJA 2ZIUB 1Y1VG 2DPIA 1I4PA 5CV6A 4F92B 1BNZA 3PO3B 3J81i 2DPJA 2H3QA 3Q8SB 3H40A 4I2JA 5AKJA 1YZ7A 1Q82C 4JI0Q 1ZQQA 1WG8A 2XIDA 3HOYG 5CV4A 3GDXA 4O3PA 3CP0A 2R8HA 1S72A 1D8LA 2L0CA 5A35A 5LMNW 3JPNA 3TMEA 1LTAD 9ICJA 4ILWA 2C2RA 5AKGA 3QR8A 1X54A 4QZ8A 2MP1A 4O3RA 2FFKB 3I72A 1GUSA 3OTQA 2ZIWA 1TWCH 1TIID 1K1SA 4J9SA 1TWFH 1PK1B 3JAML 1IZ6A 2W54A 1LV9A 4A3MG 3PR4A 2XY6A 3ZDAA 1MJCA 2ZXRA 3R2IA 1BBXC 2O6KA 1VQAA 1QCKA 1JRPA 3ZD9A 3CRXA 4Q0FA 7ICFA 4Y2YA 4OJ6A 4C3IG 4IPGA 2V4QA 2LHTA 1FJGQ 4DXFA 2WHEA 3H0MB 1SFOH 2PMZF 4OJLA 3NSWA 4EX5A 2DGZA 2VQFQ 4J9QA 2EJGC 3B9JA 8ICFA 2LS01 3BDCA 3AUOA 2R92G 3A8KE 2N8NA 3RF9A 1SL0A 2Y0SE 5JEAG 4BWGB 4JYAL 4DU9A 1IBKL 4JK1A 3K7UC 4IUTA 4JI4Q 1J5EL 1KDBA 3S16B 3WK6A 2Y0SB 3QO2A 3IHQB 1VQPA 1KDAA 3UDXA 4BBSG 1M6YA 5IT9c 2Z8LA 3IAYA 1B3QA 1KL9A 4NXNQ 2AJQA 3JAMi 2ES6A 5J2IA 4DN4M 2DL0A 2GO7A 1NKEA 2HHVA 3UQ2A 3NVWA 4A3FG 1QOHA 1STAA 3GV3A 4H7BA 4KLJA 1EY8A 4KI0A 4ZYSA 2XI9A 4GN5A 2C22A 2L5YA 2K50A 3N97B 5EGTA 3A7AB 2RBMA 3UQ0A 3HT3A 1SROA 1C0AA 1TWHH 1D9DA 3KK7A 2LY7A 5EKLA 1YITA 1CI4A 2F77X 2JXJA 5C3WA 5KTQA 2K7VA 3BQ1A 4YP3A 2Y0SF 3NXWA 4A3CH 4B3RL 4UAIA 2W9CB 4JI8L 2NTSA 3DM1A 3NBHA 3SEIA 4HIOA 1TK5A 4B9UA 3SZ2A 4JV5L 3ONAB 4A3JG 2MAXA 2XIWA 2SNMA 4KTAA 1N34Q 3MTSA 3T5HA 4B9LA 1VCIA 3PMNA 2HW3A 2FPMA 4M2YA 1EEFD 2VUMH 4O3OA 3T56B 1QQ5A 3KF8B 2HVHA 3BQ2A 4Z6CA 2E2JB 3CMAA 2JA5H 2B2VC 2JRZA 9ICMA 1C4QA 1DXSA 9ICVA 5K4LA 3F8TA 2B39A 2QLTA 4B9TA 4YQWA 5C4JB 3Q8QB 4JI7L 2RHQB 1PZKD 3ORYA 1U4PA 1ZQAA 3S1NB 2R7FA 2Y9TA 1MBYA 2NRZA 3OHXC 1ZD4A 4C8OA 2JEIA 2NYZD 4BY1B 2CCZA 4K0KL 3HP3A 3GU3A 1NY4A 4ZH4A 5IGCA 4DK0A 2LKVA 1FYCA 3TDQA 1Q12A 3KBXA 3ZDBA 4A3JH 4FP5D 5TSSA 1ICFB 3T13A 5IGBA 5KFJA 2A1AA 5L1KA 1X6IA 3SYZA 4P0PB 4Q5VA 4B9VA 4DFMA 5ALNA 2RDJA 5JPMC 1VQ4A 2VA8A 2C2DA 1STGA 5ISRA 2KZZA 4KLKA 1J2NA 3MR6A 4Y2XA 2QARA 1I4HA 2R18A 2Y1JA 1RTOA 3D2NA 4G57A 1O7ZA 2JSOA 4OO1I 3FKIH 4F91B 3AQQA 2NO4A 2PFNA 2LYHA 4QIWF 2HHUA 2QGQA 2JXMB 3FHWA 3NGDA 1RF2D 4R64A 1PFBA 1UQVA 2BZFA 9ICOA 4RQ6A 3HOVH 1FNVA 1VMCA 5CA7A 3A74A 5KFQA 4YD2A 5DGAA 2MO1A 1S97A 5AM2A 2ZM6L 2R93B 2R92B 4H0LC 2IHEA 1NI3A 4RT3A 2HHTA 4F71A 1JOOA 4F8MA 4ELTA 4AYBE 2KJ9A 4ZUIA 4X62Q 3NVZA 1RXWA 5ALRA 4K8IA 5AI8A 8ICYA 3MC0B 4C8KA 2K5WA 5HURA 4EX7A 2JE6I 2W55A 3OMCA 4A3DH 5ALHA 4DV3L 2F0OA 2HDMA 3N28A 2FPKA 2F76X 2YX8A 3FM9A 4JB3A 4C8LA 1UEBA 2RF4A 4LFCL 2VW9A 3OSNA 1XS9D 4J9OA 1ONLA 4C2MH 1Y1VB 1MGSA 3CAMA 3GD7A 5HY6A 1MQ2A 1QJOA 2AQ4A 1HQRD 5DLGA 3PX4A 3WK8A 5GAEC 3PO3G 3C1EA 4RHRA 1HFNA 2F8KA 2HT1A 2ZIVB 4HAIA 2OWOA 3FP9A 1UEAB 1QVCA 1B1ZA 4R8UA 1D1KA 4LF5Q 1YHQA 4B9MA 1A62A 8ICRA 1A0PA 4K4IA 4Q8EA 2OF1A 2O5JC 2YMLA 4F8RA 2DNEA 3L3OC 3RJKA 1V8QA 4DPGA 3TAQA 1ZQKA 3BVMA 4GXIA 1JB3A 3H3VI 1LB2B 5KG4A 1VQBA 2UXBQ 3GQCA 2EPBA 2KBNA 2ZJQA 3CCQA 4YWLA 2RDHA 1LKYB 5IGDA 1TS2A 4A3MH 2FINB 3HILA 1SR3A 2BCOA 5CV5A 1J2MA 2HOFA 2VJ5A 2JEJA 4C4TA 5KFVA 4FDBA 4TUPA 4FF2A 1JT8A 1U47A 4Y2JA 5HR6A 1BF4A 1IW7D 2JH1A 4F4KA 2OTJA 4JVZA 3SENA 4YCVA 4NXZA 3KYHC 3SK6A 3KZIU 9ICFA 4R66A 1YNXA 2KEEA 3RLNA 1ESFA 4Y52H 3GTLB 1N63A 5ALPA 5I2YA 2UVVA 4DNRB 2PNHA 3FMCA 4PMBA 3GTGH 3S1MH 2DWQA 3EYZA 1EWIA 3HKZG 3V6JA 3RJFA 3BJUA 4LF9Q 4WJ3M 5ALWA 4OELB 3VYSA 1K0SA 4C4SA 3Q8RB 2Q8TA 3S1RB 2JA7B 1N9WA 5C4ZA 1MC8A 5A2QE 3TS2A 1X9SA 3U4VA 2UXCL 3H4DA 1L3SA 4DUYL 1N36L 1L7OA 2KIWA 1HNZL 5GROA 3W3AA 4LMQD 4IJHA 2QKQA 2A6HC 1VJ5A 1ZQVA 4EYIB 2K5NA 2OEOA 1GUGA 4J1MA 3T1HL 3KUPA 3SI8A 5IWAL 2E2JH 2B21A 2JZBA 2M0NA 1ZQDA 1U9RA 1WCMG 4DR1Q 1I94L 2UXDQ 5C5JA 4NLBA 3N4MB 3JPRA 3G4SA 1PH4A 1BGXT 3TQ1A 4NL9A 1ML0D 1XMQL 4CHTB 4O5EA 1KDHA 4RH6A 3MBYA 4A3IB 1U4BA 2AUKA 4JOIC 2FJ2A 4DQQA 2VUMG 2ZT9C 2WB1E 5FP0A 2A3VA 3MGHA 2Q8IB 4O5CA 1NE3A 3B0XA 4DSEA 1QNKA 2F3WA 4NLNA 2SNSA 3I4NB 2KZMA 3EVQA 4HSVA 3EPGA 4M6WA 4ECUA 9ICEA 4C7YA 3PIO3 1HZBA 8ICEA 1JMCA 3MXPA 4DF7A 3PIP3 3L5KA 4S3SA 1EL0A 3H7IA 4C0ZA 4XRHA 2Q2IA 1CHQD 1XO1A 1WTOA 4B3RQ 1QWYA 1DGJA 2EAPA 2FMQA 5E79U 8ICMA 5I9OA 3PO5A 2FJ6A 1BBUA 1JQYD 2K5DA 3QUTA 5IT9L 4AQYQ 1SYEA 3HOYH 1B2TA 3TS0A 1DOKA 3T51B 5KG7A 5EKKA 1X40A 4DAYB 2IA6A 4USAA 1LUZA 5IYCG 4DFKA 5J2KA 2HHWA 5LL6S 2NVXH 2K4KA 3QU7A 4MHVA 1X6OA 1HRJA 1LVHA 4OX9L 4HJ5A 5ALOA 2XGPA 4O1NA 1KABA 4HEDA 4TUQA 1IG6A 4GC6A 3MXGA 1H9JA 2I1QA 2D0PA 1HNWL 1ENFA 2MSNA 2SOBA 4UHVA 1STHA 1X3EA 5C0XH 4EBCA 3GV6A 4UAYA 2Y0SC 4GOPB 5J2EA 1MA7A 3DWAA 2HUGA 4U7CA 4G4KA 2F0EA 2JA8H 5A2QL 4DV0Q 3CCLA 1FGBD 1FR3A 4YCUA 4CNQA 3LK9A 2YV5A 3WDNA 2AU0A 3TP5A 4BA2I 4O2DA 5DKWA 1KFSA 3J80c 4JI7Q 3U50C 4KLTA 1GJXA 2ASJA 2D0OA 3TP8A 1XNSA 3T16A 4IQWA 4US8A 5JJKA 3CU7A 1U45A 1HR0W 2RSNA 2NTTA 1KLNA 1PH3A 4O3SA 1F2LA 4OWWB 2IHNA 4QWBA 3RJIA 4R4TA 1UT8A 1PZNA 3QU5A 4A3GB 4PGXA 2QF7A 2KSOA 1NJZA 2J7ZA 5I6YA 1TWGB 2ZJ8A 4Y2UA 2JA9A 5FO8B 5FO9B 3V7LA 2E8OA 3T3FA 4UPAA 3OGUA 3PUYA 1ZQWA 2HBJA 1HA5A 5KFOA 2LXKA 3CCEA 5AKXA 1GO3E 4BBRH 2RA4A 2AMCB 1Z00B 3HKSA 1WVLA 1TVAA 3I8ZA 4FS1A 4BY7B 1Q8IA 4JI4L 1RDFA 1RZTA 2R61A 4PMWA 8ICXA 2NZ1D
chains in the Genus database with same CATH topology
1EUJA 2XGTA 3T1YQ 4C3IH 2RCNA 4DV7L 4P72A 4OO1G 1HZ9A 2D62A 1EQQA 1CKOA 3BU2A 4NB3A 4NXNL 5GAGC 4DR3L 2JA6G 1JJCB 4R4QA 2VQEQ 3PO2G 4LFAL 4BA1I 1JJGA 3J81c 3W1GA 3K81C 2V1CC 1XNRQ 1IBLL 2ZTDA 4YWLA 1WOCA 1G51A 2R7ZG 4A76A 1SRUA 3HFZB 1X55A 3CCJA 5M3MG 2QA4A 4GNXC 4P71A 1KC8C 4GS3A 1HZAA 5H1SE 3H15A 4NXMQ 4DUZL 4YY3L 3BZCA 3KF6B 1N33L 3NENA 4A3EH 3PV0A 4MTNA 4A3IG 4B3TL 4POGA 1PH7A 2WP8J 2B3GA 4LFCQ 1VQ6A 3CW2C 1NMFA 3OTOQ 4LFBL 3KJOA 1N34L 1CSQA 2Q2TA 2EQSA 2L15A 4LWCA 3ULJA 1KRTA 2RHSB 3I56A 1JB7A 1TWAH 3H0GG 4TQUS 3F2BA 4GLVB 1AE2A 1GKHA 5IYCH 4LF5L 4GLXA 1SLJA 1QUQA 3U58A 4UP9A 4HJAA 2NZOA 1B8AA 5J3BA 1C9OA 2K14A 4B3ML 4A3IH 1M1KC 5GQOA 3M4OH 3TS2A 2QEXA 1UE6A 2JA6H 3PO2H 2UXBL 1Q86C 1Q1BA 3TQYA 1VQ7A 2ATWA 5M5XH 3WWVA 5IP7H 2AKWB 1TWGH 4LNQA 3HOWG 2NVTH 2ASBA 2JK8A 1MJEA 4DR6Q 1EOVA 4QGUA 1FL0A 3CPWA 4GN4B 1E1TA 5FLMG 1JE5A 1WJJA 3AFQA 4OONA 4QIWE 3SGIA 3ICEA 1PH8A 4DR5L 4A93H 5C44G 2E2HH 4BXXG 1N32L 1EYGA 3GTQH 3CC7A 1HR0Q 2CQOA 3S2DH 4HIMA 4IPCA 3JAMc 2UUBQ 3NEMA 3RN5A 1W2BA 4JBJA 1BBWA 1CSPA 4YWKA 1EFWA 4BY1G 1VQNA 2WAQG 4LW1A 2OCEA 2BH2A 4LF9L 5JEAJ 1NBWA 2YTYA 3DM3A 5FLMH 2OQKA 3HOZH 3TRZA 1XPOA 3HKZE 3AEVA 2UU9L 4X65Q 2VL6A 4IFDJ 4DV5L 4DV2L 2UXCQ 1L1OA 1KD1C 3STBC 1N36Q 1PV4A 3J81j 3L2PA 3CCSA 1HNZQ 4IPHA 4HIDA 3UE1A 1SN8A 4PG3A 4BBRG 3UDGA 5C0XI 4UP7A 2Z6KC 3T1HQ 4BY7H 2N3SA 1HNXL 5IWAQ 4BY1H 1E22A 4DR1L 1VQJA 4PZ7A 2B29A 1I94Q 4L5SA 1TXYA 4DR7Q 2UXDL 3ZJYC 2ZM6Q 1XMQQ 5C44H 1P16A 2BH8A 4BXXH 4JG2A 3G71A 4X64L 4KHPL 4IFDG 3K7AH 3E0EA 4X62L 3H0GH 3UE0A 5M3FH 4GOPA 4BY7G 5C4JH 1IBML 1E24A 1QVFA 3B6YA 1RIPA 4QQBX 2K75A 4WJ4A 4DV3Q 4J15A 1XMOQ 2R93G 2N49A 4YWMA 5C0XG 2ZTEA 3KOJA 2EDUA 1LYLA 2VY3A 1PFSA 3M9BA 3F2DA 3J7ZC 1WCMH 5FJ8H 2YU9H 2EIFA 3CXCA 5AJ3Q 1OXUA 4P73A 1QZHA 4LF6Q 4IJLA 4YHHQ 3G48A 1YVCA 1L1OC 3PUVA 1Y1VG 2ALYB 4JI6L 2E2IH 1XNQL 4UP8A 3KDFB 4IOAA 3EBEA 3LGJA 5ELNA 4JI5L 3J81i 2I5HA 1WI5A 4OX9Q 1YI2A 5IYDG 2UUCQ 4DR4L 5IP7G 1NTGA 2PMZE 3KJPA 1Q82C 4JI0Q 4B3SQ 3HOYG 4NPSA 1YHBA 4ME3A 3CP0A 1S72A 3K80C 1D8LA 1UE7A 1VQMA 1YEZA 1Y1WG 5LMNW 2UUAQ 3PIOA 3HOUH 1G6PA 4LF8Q 2WFWA 2GVAA 5BR8Q 1I6HH 3E9HA 1X54A 3MEFA 1YHAA 1A63A 1I5FA 3L7ZC 1TWCH 1Z9FA 2R7DA 3A0JA 2YTXA 3BZKA 4IPDA 4A75A 3K8AA 1YJWA 1TWFH 2HHHL 1IZ6A 2VS1A 4A3MG 1LM0A 3CMEA 1N8RC 3PUXA 5JJLA 4DV6Q 1MJCA 2E5LQ 1MKHA 1UE5A 2NZHA 1VQAA 2GN5A 5GAHC 4IPGA 4DR2L 1Q7YC 1FJGQ 3CQZH 3S14H 4A3BG 4DUYQ 1SFOH 5M5WH 4EX5A 2VNUD 1PH9A 2VQFQ 3RN2A 2R92G 4H02A 2N8NA 5C3EG 2Y0SE 1WYDA 5JEAG 4JYAL 1DGSA 5M3MH 2NN6G 4IO9A 3K7UC 1GD7A 1NMGA 3M4QA 1IBKL 4GKJL 3HOUG 5IY0A 4JI4Q 1J5EL 1LTLA 3F1ZA 1VQPA 4BBSG 3UDXA 3T1YL 1VQCA 4GOPC 4A3EG 5IT9c 1OXVA 4DV7Q 1EIFA 1KL9A 2PQAA 2HQLA 2IX0A 4NXNQ 1U0LA 3JAMi 2I0QA 2VQEL 1OTCA 4GKKQ 2VZAA 2KCMA 4LFAQ 2MFIA 3TREA 3HOXH 4DK3C 4A3FG 1Z47A 1ASYA 4KI0A 4YCWA 5GADC 4A3KH 1XNRL 4GN5A 3KFUA 4GNXB 1VQIA 2K50A 1S40A 2Z6KA 2A19A 3RNUA 1VS0A 4A3FH 1SROA 2GVBA 1TWHH 3PSIA 1YITA 1PA6A 5M5YH 1C0AA 3J7A5 4DUZQ 1MIUA 4YY3Q 4LUOA 4A3CH 4B3RL 1XPRA 3PO3H 4AQYL 1OXSC 1PHJA 4JI8L 2ES2A 2IHFA 2KHJA 4LFBQ 4HIOA 1KIXA 4JV5L 4A3JG 1HJPA 1PH2A 1VQGA 1N34Q 2PQAB 3Q8DA 1X3FA 4OXPA 1VCIA 4A3GG 3I4OA 1YIJA 3TEHB 2VUMH 2ZJPA 1HNWQ 2NVYH 1G291 3KF8B 1VQ5A 3GDEA 1YZ6A 1L1OB 1YJNA 1XPUA 4IFDI 2NN6I 4APVA 5IP9H 1EQRA 2H5XA 3CMAA 2JA5H 4QY7A 1S3OA 3I55A 2B63H 3D0FA 1X56A 2DUDA 5IYBG 4A3DG 2OQ0A 2LXJA 3F8TA 4DV0L 4DK6C 3GTOH 2MO0A 3M4PA 1K9MC 3I2ZA 2LSSA 2RHQB 4JI3L 4JI7L 2DGYA 2R7FA 5DLQE 2JA7G 4X66Q 3S15H 4JCVE 4A3BH 1V1QA 2F4VQ 4DV4L 3CCUA 3G6EA 2HIVA 2CCZA 4JI2L 1IL2A 4K0KL 1NY4A 1K8AC 1K83H 1Q12A 4A3JH 1PH5A 4LF7L 4LF4Q 2IY5B 4DV1Q 1EIYB 2PI2E 1Q8KA 2A1AA 1VQ8A 1KHIA 5E7NA 4JI1L 1CKMA 1YBYA 1L0WA 3HOVG 1C7YA 1VQ4A 5LMUL 2ZTCA 4KLKA 5C4XH 1V9PA 3NBHB 5LMNL 4X6AH 3UDFA 2ZJRA 1E7ZA 2UU9Q 2CWPA 4DV2Q 1D7QA 4OO1I 1QUQB 2OTLA 3FKIH 1T9HA 4A3LG 3AQQA 3E9IA 1IXRA 1Q1EA 3KF6A 2QGQA 3FHWA 1L2FA 1A8VA 2F52A 4MZ9A 1BVSA 4OWTB 4L5QA 4DR3Q 3ULPA 4PZ6A 1HNXQ 4HJ8A 2ID0A 4PMWA 3HOVH 3S16H 3A74A 3RZDH 4DR7L 2MO1A 3RLOA 2ZM6L 1CKNB 3FKIG 1IBLQ 2IHEA 3PGZA 4R1JA 3I4NH 1SE8A 4QJFA 2R6GA 5IE8A 2HIXA 2JJQA 4IOCA 4KHPQ 4AYBE 4X62Q 1GM5A 1X3GA 2IX1A 4NXML 2E8GA 3ULLA 2JE6I 3NELA 1CUKA 3GO5A 5C3EH 1IBMQ 2XTIA 5IYBH 4A3DH 1Y14B 4DV3L 1N33Q 4B3TQ 3J80i 4P74A 1W3SA 2RF4A 1QVGA 1UEBA 3OYYA 2VW9A 4LFCL 1VQLA 1I50H 4C2MH 1I3QH 3OTOL 1X9NA 2I5LX 4GN3B 3CAMA 3GD7A 5HY6A 3I7FA 4AH6A 1E1OA 2N78A 3JC66 5GAEC 3PO3G 1KAWA 4LUVA 4JBWA 1NJIC 1X65A 2HT1A 4A4IA 3FP9A 2OWOA 5M3FG 3CCVA 1VQ9A 1FGUA 1UE1A 2KCTA 1QVCA 4GNXA 3CC4A 4LF5Q 3STBD 3PF4A 1YHQA 3I4NG 1A62A 1XNQQ 2K52A 1AH9A 4JC0A 3F2CA 4B3MQ 4DPGA 2BA0A 2C35B 3OW2A 4JI5Q 4JBKA 3H3VI 1VQBA 4LUZA 2JA5G 2UXBQ 2UUCL 2KBNA 2ZJQA 3CCQA 3CC2A 3GTPH 4A3MH 3PIPA 3AFPA 1A0IA 1SR3A 2FXQA 1VQDA 4DNIA 1PYSB 4FDBA 1JT8A 4A3KG 5IYDH 4DR6L 2OTJA 3ER0A 2WB1G 2F3IA 4YCVA 5BR8L 4EQ5A 3PF5A 1KQSA 3KYHC 4PZ8A 3PUZA 3S1NH 1YNXA 3RLNA 5K36G 4DR5Q 2CKZB 1Y1WH 3S2HH 3GTKH 3A5ZB 4Y52H 3M7NA 1N32Q 2PNHA 1HR0L 1PVOA 4UY8C 1FVIA 1K73C 3RZOH 2UUBL 2E5LL 2JEAI 4RG1A 3GTGH 3H3VH 1EWIA 3S1MH 3HKZG 4WJ3M 3BJUA 4TVAB 1B7YB 4LF9Q 4L5TA 3S24A 2I5MX 4QL5A 2MNAA 2B63G 1OXXK 3GTJH 1N9WA 4DR2Q 1XTDA 4MNOA 4A3LH 1UWVA 4X65L 4DV5Q 3U4VA 2UXCL 1HH2P 4DUYL 1N36L 5C0XJ 3I4MG 2KENA 2R93H 1PH1A 1HNZL 1VQFA 5GROA 1JJ2A 1KXLA 4IJHA 5C4XG 4A3GH 2K5NA 4R4IA 3T1HL 3PUWA 2E2JH 5ELOA 5IWAL 4JBMA 4DR1Q 1WCMG 3CCMA 4GKJQ 3EIVA 1RL2A 1I94L 2UXDQ 2BA1A 3G4SA 1PH4A 1J5EQ 2A8VA 1XMQL 3W1BA 1O7IA 4O0AA 3KLWA 4X64Q 4JOIC 2VUMG 3CD6A 1CKNA 2WB1E 4GLAC 2NVQH 3AYHB 3U4ZA 4A3CG 4AIMA 2AWNA 4Y7NH 1NE3A 4DKAC 1PYBA 1WFQA 4GKKL 2PI2A 2R92H 2EXDA 1XMOL 1R9TH 3M3YH 1K0RA 2KHIA 3CCRA 2R7ZH 4L5RC 1IYJB 1HZBA 1B70B 1JMCA 3HOXG 2CWAA 2Q2HA 3W5OA 3HOZG 1H95A 3CF5A 4KHZA 4ALPA 3VDYA 2Q2IA 2YTVA 4RMFA 3ERSX 3D31A 1VQKA 4B3RQ 3UDIA 1J6QA 1SMXA 5AJ3L 3DLLA 1Q81C 1BBUA 4AQYQ 4LF6L 1Y1VH 4YHHL 4JI8Q 3HOYH 1P8LA 3TS0A 1E3PA 4DAYB 5HGQA 1OXTA 1LUZA 1KRSA 3S17H 4JV5Q 5IYCG 4P75A 4JI6Q 3RLFA 2NVXH 2K4KA 4XTCS 1X6OA 4DAMA 4OX9L 4HJ5A 2JEBI 2K5VA 4DR4Q 4HJ9A 4JI0L 4B3SL 2D0PA 3KDFA 1VQOA 1HNWL 4JOIA 3IRBA 3GTMH 1X3EA 3GTLH 1M90C 1V43A 1K3RA 2UUAL 4GOPB 2YYZA 1Q46A 1HZCA 4C3HH 4LF8L 2AWOA