2I5HA

Crystal structure of af1531 from archaeoglobus fulgidus, pfam duf655
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
178
Chain Sequence
EDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1531
total genus 41
structure length 178
sequence length 180
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04919 DUF655 Protein of unknown function (DUF655)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.280 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 AF1531-like domain 2i5hA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5hA01
3W5OA 1WCMG 1XJVA 4JBWA 3W1GA 4PZ7A 1PH9A 5BR8Q 4R4TA 4UY8C 4LFBL 4K0KQ 3PO2H 1OXUA 3NEMA 5IWAL 3PO3G 2DGYA 4A3DH 5IP9G 4OO1G 3K0XA 4GLXA 3S1NH 3FKIG 4JI0Q 5M5XH 3HOZH 1N32Q 1Z9FA 3J81j 1X3FA 4DAYB 1IXRA 4R4IA 2YTXA 3S2HH 4DR3L 1E22A 3I4OA 4DR5L 3PV0A 1E1OA 4JOIA 4YCUA 2I0QA 5AJ3L 3F8TA 5C0XJ 4LF9L 3TQYA 4JBKA 4X66L 2UUBL 1S40A 5C44H 3J7A5 1IBKQ 2WB1G 5JEAG 4A3CH 1RIPA 4HIOA 1FJGQ 5C3EH 4EX5A 4X62Q 1PH2A 1K8AC 2CKZB 1PH5A 1XMQQ 4LF7Q 4DV4L 3S1QH 4BXXG 1Q81C 1VQDA 3UDXA 2WAQE 2QEXA 4DR5Q 1J6QA 4LF8Q 1KXLA 1SMXA 2UXCQ 4NB3A 1OXSC 2AMCB 5EAYA 2OWOA 4GS3A 1GO3E 4KLKA 4J15A 4B3MQ 2ZTDA 1HNXQ 2IT1A 1HNWQ 4IOCA 5ELNA 3GDEA 4DUZL 1Q82C 3HOVG 2MQHA 1IZ6A 2D0PA 1SFOH 4LF7L 3ER0A 1JJ2A 2E8GA 2Z6KC 3M9BA 3F2BA 3I4NG 2UXDQ 4LF8L 3PIPA 1IL2A 3GTQH 1K8GA 4BBSG 4MZ9A 4A75A 2Q2IA 4JI4L 3OTOQ 4JI8Q 4C3HH 1E24A 5M3FH 4A3FH 1WYDA 3HKSA 2YU9H 4BY1H 3KDFB 4RG1A 4DPGA 1PH4A 3GTOH 4QY7A 4PZ8A 1L2FA 3M4OH 2JA5H 1UWVA 4LF6L 4BA2I 1ASYA 3OW2A 2JA7G 3D31A 2UXBQ 1NY4A 4DV1Q 4LF5L 4IPHA 4JI0L 2NVQH 1YNXA 2GVAA 2VY3A 3PUXA 1QVGA 4JI5Q 1N32L 2ZM6L 1X54A 1A63A 3U50C 4PMWA 3J80c 1PH7A 1PYSB 4A3CG 4DV0Q 2N49A 1IBLL 5C44G 3CCMA 3CC7A 1AE2A 1K83H 4OX9Q 4A3LH 4OO1I 5GAHC 1VQ9A 4X66Q 2ALYB 4DR1L 1N34Q 3AQQA 4L5QA 5ELOA 4DV5Q 2XTIA 1LUZA 1TWCH 5FLMH 4C3IH 1YHAA 1HR0W 1K0RA 1Y1VG 4A3LG 3ULPA 4BBRH 4QJFA 2ATWA 3HFZB 3RR5A 3HOZG 1QZGA 4DR6L 2NVYH 4A3EH 4B3RL 2NN6I 1TWFH 2RHSB 1SN8A 1E3PA 2CWAA 2E2HH 2ZJRA 2UUCL 2MO1A 4GOPA 1W3SA 3PO2G 1MJEA 1HNXL 1HR0L 3AFQA 1HNWL 2VUMG 1LM0A 5J3BA 1OXTA 4DK3C 4GN4B 3S24A 1QZHA 4A3EG 1O7IA 2RF4A 4QL5A 3U4ZA 1XPOA 3CC2A 2PQAA 1KD1C 5IYBH 1CKMA 4BBRG 1EUJA 4AQYL 4MNOA 3K7UC 3U58A 3K8AA 1HJPA 5IYDG 3F1ZA 3S17H 1WFQA 2VZAA 1VQIA 2KCTA 3EBEA 5IP7H 1CUKA 1LTLA 2IHFA 3UE1A 1SRUA 4WJ3M 2JQOA 3M4QA 3I2ZA 4DR2Q 3G48A 2VUMH 1VQFA 3STBC 4EQ5A 1VQKA 1HZ9A 4LFAL 3CCEA 3H3VI 2R93G 1IBML 2VL6A 1HZBA 3AYHB 3TRZA 3NBHB 2BH2A 3CD6A 2JA6H 4HJAA 3T1HL 1A0IA 1GD7A 5JJKA 1YHBA 1GKHA 2UU9Q 4JI3Q 4JV5L 4JI2Q 2UXBL 2OQ0A 2HHHQ 4A3IH 4DV1L 3S1MH 1CKOA 3A0JA 2B63H 4DR7L 4O0AA 2R7ZH 5M3FG 3D0FA 2JK8A 4L5TA 5IWAQ 4IO9A 1YHQA 1ASZA 2QGQA 4UPAA 1YEZA 3CCSA 1UE7A 4OX9L 4NPSA 4DR1Q 2ES2A 1XPRA 4DUYQ 1CKNA 4DR3Q 2EIFA 3I4NH 1VQAA 1S3OA 3HOVH 1K3RA 1C9OA 1EQRA 1SROA 1X65A 1YJWA 1N36Q 2CWPA 4NXNL 4GKKQ 2A19A 4GKJQ 4LFCQ 1KAWA 4GN5A 4HJ8A 1PA6A 2NZOA 1XTDA 2K75A 1WI5A 2YTYA 2KBNA 1OTCA 2UUCQ 4LF5Q 4O2DA 4X64Q 1JMCA 4B3ML 1OXVA 2KHJA 3E9IA 2KCMA 1Q86C 4B3TQ 4DV4Q 4WJ4A 4OWTB 3PUYA 5C3EG 3AFPA 1JB7A 3GTGH 1BKBA 3RLNA 5M3MG 3CF5A 4GOPB 4IFDI 2LXJA 1QUQB 4GOPC 1EIYB 4YY3L 2EDUA 2IX1A 4A3KH 1KIXA 1YZ6A 1G291 5IP7G 1VQLA 1X55A 3PF5A 3M3YH 1RL2A 2VQEL 1X6OA 3CMAA 4DUZQ 1XNRL 4JYAQ 4JBMA 3CP0A 2VQFQ 4POGA 3KJOA 1PH8A 3STBD 4L5RC 3HOWG 3PGZA 3PUWA 2F3IA 4GNXB 3M85A 3TREA 4DV3L 1YBYA 4A3DG 1L1OA 2K5NA 4MTNA 5GADC 2VS1A 3CAMA 4A3JH 1UE5A 2UU9L 4NXMQ 1VQ7A 1WCMH 1G51A 1U5KA 1U0LA 2I5LX 3PO3H 4LF4L 3CXCA 4P75A 1P8LA 2KHIA 1TWAH 2N8NA 4XTCS 1LYLA 4TQUS 4GN3B 3E0EA 2K5VA 1IBLQ 2AWOA 3EN2A 4AIMA 4A3GH 3H15A 4DV7L 2MNAA 4DR4L 5GAEC 4A3IG 1CKNB 1E1TA 1KRSA 4LUVA 3PUVA 2A1AA 4BY7G 1NE3A 1BBWA 2NVXH 3I4MG 3KJPA 3VDYA 3JAMc 1PV4A 2JJQA 2R92H 1EWIA 4UP7A 1FL0A 3NENA 3J80i 1SR3A 4JI2L 2K52A 4DKAC 3CPWA 4B3SQ 1TWHH 3JAMi 1CSQA 3H0GG 3HOXG 1VQPA 2JA7H 1VQGA 2YYZA 2Z6KA 3UDGA 3CW2C 4X62L 3I7FA 3HOUH 1JE5A 3FP9A 1B8AA 4JI8L 4B3RQ 3GTLH 2WFWA 5FLMG 2JE6I 3PSIA 3UDFA 1N33Q 2IX0A 2E2IH 1Y14B 2Q2TA 2K4KA 4OXPA 2MO0A 3LGJA 4YCVA 1L0WA 3G4SA 4QIWE 5LMUL 4A3KG 1YIJA 5FJ8G 1KQSA 4QGUA 3G71A 1D7QA 4JBJA 4LUZA 1T9HA 2RCNA 2ZJQA 1PFSA 2GN5A 2ZM6Q 2R92G 4DV2Q 4R1JA 2F52A 2UUAL 3S1RH 2R7DA 2NVTH 1I94L 4R4QA 1HZAA 4YWKA 3CC4A 2JEBI 1CSPA 3T1HQ 4JOIC 4LNQA 2CQOA 2NN6G 1XMOL 1VQ6A 4YCWA 5JJIA 3GTPH 1PYBA 1XPUA 2K14A 4KHPQ 5IYCH 2OCEA 1I5FA 4POFA 3CCJA 2UUBQ 3SGIA 1X9NA 3BJUA 4P73A 4XIGS 5LMNL 2B3GA 4DR7Q 3GTKH 3B6YA 4A3JG 1BVSA 5E7NA 1FGUA 1I6HH 3GD7A 3CMEA 2LXKA 4A3MH 3RLFA 2ASBA 2B29A 1VQJA 1VQOA 4QQBX 4IJLA 3KLWA 3PCOB 4ALPA 1KC8C 3RZOH 1KHIA 4R4OA 4DV3Q 1M1KC 2AHOB 3KOJA 1VQBA 1X56A 3FKIH 2JA6G 4A3MG 3RNUA 4H02A 3I56A 4Y7NH 2HT1A 4PG3A 4HIKA 1DGSA 1Q46A 1K73C 3OTOL 3HKZE 1EYGA 1Y1WH 1V1QA 2E5LQ 1I50H 1IYJB 3MEFA 2BA1A 5FJ8H 1GVPA 3KF6A 4IOAA 4HIDA 2K50A 5C4XG 4JG2A 1J5EQ 3AEVA 5HY6A 5HGQA 4A3BG 5IYDH 5M5WH 3S16H 3M7NA 3KDFA 1NMGA 1PVOA 4IPCA 2EQSA 3KF6B 2R7FA 3H0GH 5IY0A 3HOXH 2D62A 3J81c 2UUAQ 1A8VA 3IRBA 4A93H 1FVIA 4HIMA 3TS0A 2OTJA 1W2BA 3JC66 1E7ZA 2VW9A 1EIFA 2GVBA 4ME3A 5IP9H 2EXDA 1TWGH 3KYHC 2WAQG 4P71A 3F2CA 4HJ9A 4JI1L 1R9TH 1XNRQ 5JEAJ 4DR2L 1XNQL 2ZJPA 1SE8A 1Z47A 2H5XA 1PH6A 3BU2A 4DAMA 2Y0SG 3KF8B 4GNXA 3A74A 1NMFA 5IYBG 4YWLA 3RN5A 1OXXK 2UXDL 3CCVA 4DV6L 3J7ZC 3GTMH 2IY5B 2HHHL 5JJLA 1V9PA 1UEBA 3I55A 3RN2A 1VQEA 2Q2UA 2JA8H 4LF4Q 1KRTA 3F2DA 1N8RC 4IPGA 4TVAB 4DV2L 2MFIA 3HOYH 3K7AH 3M4PA 1Q1BA 1PH1A 4A93G 4BA1I 4X6AH 3TEHB 1WOCA 2Q2HA 4IFDG 3MXNB 5BR8L 2CCZA 3Q8DA 4LF6Q 2F4VL 2N3SA 3J81i 2HQLA 4P74A 3ULJA 4DUYL 2QA4A 4DV6Q 1JT8A 2RHQB 1M90C 2VQEQ 1MKHA 2AWNA 4FDBA 1K9MC 4JYAL 4JI7Q 3CQZH 1A62A 4LUOA 4BY1G 4A3FG 2YTVA 4KHPL 3L0OA 2E5LL 4LWCA 3CCLA 3CCRA 3HOUG 4AH6A 4AYBG 3S14H 1C0AA 3HKZG 4DV0L 3A5ZB 1N33L 2D0OA 1HZCA 2VNUD 2KENA 3ULLA 5AJ3Q 1JJGA 1PH3A 3ERSX 5M3MH 4X64L 4LF9Q 2LSSA 1B70B 2F4VQ 1N9WA 4JI3L 3A5UA 3CCQA 3HOYG 1Q1EA 4JV5Q 4B3TL 4JI6Q 3CCUA 3I4MH 3KFUA 1NBWA 1S72A 5LMNW 3RLOA 4BY7H 2R6GA 3G6EA 4GNXC 2HIXA 4DR6Q 2BA0A 1BBUA 1L1OC 3HOWH 2JA5G 2I5MX 3EIVA 3PIOA 2HIVA 3S2DH 4KHZA 2ZTEA 2UXCL 1KL9A 5FLXc 1FJGL 1EOVA 5C4XH 4C2MH 4DR4Q 1Q8KA 1B7YB 2WB1E 4JC0A 1V43A 4LW1A 1XMQL 3FHWA 1GM5A 1VQ8A 4UP9A 2AKWB 4PZ6A 1YITA 1Y1WG 1I3QH 4AQYQ 3TS2A 5IYCG 1XMOQ 1H95A 1VQ5A 1D8LA 3ICEA 2XGTA 3DM3A 4UP8A 3L7ZC 5IE8A 5GAGC 1Q7YC 4L5SA 3U4VA 5K36G 1AE3A 4YWMA 4A76A 4NXNQ 1NTGA 4GKJL 2YV5A 1VCIA 1UE1A 2JA9A 3K80C 4LFAQ 5C4JH 1YJNA 2JEAI 1C7YA 2IHEA 1EQQA 5M5YH 1HNZL 3S15H 2E2JH 3WWVA 5LMUQ 4DK6C 4JI4Q 4BXXH 4BBSH 3PUZA 2Z0SA 4YHHL 2NZHA 1IBKL 2V1CC 2K5HA 4JI7L 2PI2A 3UDIA 3BZKA 3L2PA 5DLQE 4YY3Q 1MJCA 4IPDA 2R7ZG 1UE6A 2BH8A 5IT9c 4IFDJ 1HNZQ 1AH9A 1I94Q 3PF4A 3NELA 2PQAB 3E9HA 3BZCA 4RMFA 3K81C 4OWXB 2CFMA 1YJ9A 4JI5L 2B63G 5C0XI 4NXML 4HJ7A 4JI6L 3UE0A 1VQNA 5GQOA 1VS0A 2OQKA 1HH2P 2ZTCA 3W1BA 1G6PA 4JCVE 5C0XG 4GKKL 3DLLA 1J5EL 2PNHA 4DV5L 5LMNQ 4OONA 3GTJH 3CPFA 1VQCA 4AYBE 4DV7Q 2N78A 1JJCB 4KI0A 1VQ4A 1YVCA 1VQMA 1XNQQ 1TXYA 3T1YL 1L1OB 2DUDA 4GLAC 4R4CA 4X65L 4LFBQ 4GLVB 4P72A 2FXQA 4JI1Q 1HR0Q 1X3EA 4APVA 2OTLA 2ID0A 1VQHA 2I5HA 4B3SL 4A4IA 2A8VA 1EFWA 1YI2A 2PMZE 2R93H 2L15A 3RZDH 4Y52H 2JA8G 1MIUA 1NJIC 1N36L 2VQFL 5H1SE 4K0KL 4LFCL 1WJJA 4IJHA 2WP8J 3T1YQ 4C3JH 1PHJA 1IBMQ 1P16A 4X65Q 1QUQA 2C35B 1Y1VH 4A3GG 1X3GA 4DNIA 1QVFA 4A3BH 3OYYA 1SLJA 1N34L 1QVCA 5GROA 3GO5A 1Q12A 2Y0SE 4YHHQ 3ZJYC 4HJ5A 2PI2E 4OWWB 3H3VH
chains in the Genus database with same CATH superfamily
3W1GA 2B2VC 5BR8Q 2L11A 4KLEA 1OXUA 4PGQA 2R8HA 2EDGA 2DGYA 1LT6D 2CXYA 5IP9G 2GA4B 5IWAL 4BS9A 3H4DA 3RJEA 5E4WC 1FO4A 5J8YC 3NRZA 3EQLC 3M4YA 5D65A 4MFFA 4G7HC 1NNLA 1N62A 4HYKA 3EZ5A 3AM9A 1IXRA 4DAYB 4R4IA 1ICFB 1KFSA 2YTXA 3OPOA 3S2HH 1RCVD 1MA7A 4YCUA 2I0QA 4USAA 4LF9L 2UVRA 4LFCQ 1Z4NA 1I94L 2K4IA 4EX5A 5KG0A 2WB1C 3QUBA 3UMGA 5G3LF 2K28A 1PH5A 4CCHA 3N52A 1STGA 1VQDA 4DR5Q 2WAQE 1Q81C 1QLNA 4LF8Q 1KXLA 5I6WA 4DQQA 2SDFA 1SIJA 2NO4A 5D14A 5KRUA 2JR5A 2OWOA 1FNWA 3PSTA 1GO3E 2K03A 4GS3A 9ICMA 4AYBF 1HNXQ 2A1JA 1GO3F 4OJLA 2VA8A 3AUOA 1F77A 4IUPA 3QNMA 1KFDA 4G7ZC 1HNWQ 5CJ7A 3QUTA 1EWHA 2HBJA 5A2QL 4B9LA 1TY2A 1XSNA 2MQHA 1JB3A 2D0PA 2ATLA 1PTOB 4KK7A 2CW0D 4PQXA 3ER0A 4DSJA 1EEFD 1SNOA 1Z7TA 2E8GA 3M9BA 3I4NG 3HG9A 3D4WA 7ICSA 5EBDA 4CJ2C 1F2LA 4IRDA 3H6MA 4FBTA 1J9OA 1GUTA 1T5EA 4XDXA 1K8GA 1PFMA 4MHVA 2Q2IA 1JCKB 1SV4A 3CHBD 1NUCA 4C3HH 1E24A 2BCUA 2F0OA 1I4PA 2K32A 2EJGC 1B44D 2L0CA 4DPGA 1SZHA 5C4ZA 2ZXPA 3D31A 1ICWA 3OWFA 2JA7G 4ZOHC 3C2KA 3G6JB 4LF5L 1RDPD 2ODGA 5EWFA 1HXYD 1YNXA 4I28A 1KQQA 1QVGA 1A63A 8ICYA 1X54A 1DXSA 2ZIUB 3J80c 3RH6A 1II3A 1A3UA 1PYSB 1TVXA 1SNQA 1QJOA 2XSCA 4A3DB 4B9VA 1QSSA 1DCZA 5KG2A 4A3LH 4RQ2A 1NKCA 4C2MB 3M6ZA 3PR4A 2ZIUA 1F9PA 2DJGC 3TZDA 4U7CA 1LUZA 1TWCH 2XTIA 2F1IA 1STAA 4C3IH 4A3LG 2FPKA 4F5RA 3H94A 3TFSA 3RR5A 4Y2UA 1QZGA 5IIOA 3KZXA 3NVYA 1LACA 3PQIA 1SN8A 1E3PA 3WOEA 2G09A 2ZJRA 2MPMA 2F0FA 4GOPA 3M6KA 1HR0L 3AFQA 1ZQVA 1HNWL 2YMMA 5J3BA 3HKZF 1QZHA 4G57A 3B9JA 4RT2A 1O7IA 2W7OA 1ZQCA 1HFGA 4XRHA 3NGDA 4AQYL 1PVPA 2I9GA 3VYUA 3HGBA 3U58A 1A77A 3S17H 3L9AX 1H9SA 1VQIA 1FNVA 2KCTA 2KEEA 3SK8A 4WJ3M 4HMIA 3D8GA 4C3IB 1LABA 4KLFA 2Y0SB 1E2ZA 3G48A 2K1BA 3SD7A 2DWQA 4N8FA 4DOCA 3LNNA 4F71A 4YG2A 1T8EA 4FBUA 1HZBA 3AYHB 4JUZA 4CDEC 5M5WB 1ZQDA 4F5NA 4YN4A 1DOQA 3MC1A 1TIID 1A0IA 1U45A 1GD7A 4Q45A 2RDGA 1GKHA 3MDAA 2UU9Q 4JV5L 3M7DA 1LLRD 4C56C 3S1MH 4DV1L 3A0JA 5IILA 1RTNA 3CRLC 4HTHA 2B63H 3QB3A 3KFUF 3EA6A 2F0NA 4O0AA 5A0LA 5J0OA 1N48A 4A93B 2Q0ZX 4R63A 3BS5B 1HTPA 4KY5A 2NVTB 3K1ZA 4A3KB 5BOMA 4UPAA 3NBHA 3JPNA 2M0NA 4MFAA 3MXPA 5JPMC 1CQVA 4DR1Q 5JRTA 1X6IA 2HSZA 4KLGA 4PZOA 1NK8A 2EE1A 3D6WA 3H09A 3SV3A 5ALKA 1BBXC 4BBSB 1C20A 1K3RA 2EY5A 4N8X1 3T56B 2EY1A 5D46A 4GKJQ 4GKKQ 2J4XA 3OMCA 5E79U 2FLLA 1K83B 4RUAA 4M2YA 5HR7A 2NN6H 4GC6A 3NS1A 1BPXA 5C5JA 1WI5A 5JUMA 1YNJD 2KBNA 2KJ5A 2B2UC 4U68A 3S1NB 2O5JC 4QZIA 1JMCA 4B3ML 4Y2PA 3MVVA 3SDZA 4ECXA 3CP8A 5KFAA 3PUYA 4B3TQ 2NWGA 4K6LA 5C3EG 1S5ED 4RQ1A 3MGVA 4QCLA 4PNYA 4YY3L 2A5HA 3RZDB 1KIXA 1MHWC 1ZQTA 1S8OA 1BCPC 5EOZA 1JQYD 1X55A 3I8ZA 4RWSC 2HDMA 5KT2A 4DUZQ 1XNRL 4JYAQ 1D8BA 9ICIA 5JAVA 4KLLA 4FZNA 5DB6A 4UAUA 2KNJA 3K5OA 3KJOA 1WCLA 3EFXD 4P2CB 1WTHA 3PGZA 1A2TA 3A54A 4V190 3TREA 1FR3A 1YBYA 3KK7A 3J7YW 4A3DG 4A3JH 5GADC 2UU9L 4ZQ3A 1VQ7A 2C5CA 1KSPA 2ENBA 2I5LX 1U0LA 3PO3H 1UA0A 3CXCA 1ZJMA 1GOZA 1KDCA 1ZQUA 4BX9C 3KKAC 1KDHA 1TAUA 1FEZA 4RKBA 2EAOA 4GN3B 4DSFA 4AIMA 4F72A 3ITPA 2FMQA 3H15A 4IN3A 1NZBA 2MNAA 3QYPA 3AU6A 5IGCA 5HP4A 1CKNB 1E1TA 4A3IG 4IQVA 4ZKCB 2A1AA 2E74C 5F9LA 3PW4A 4XQ8A 5K4LA 4OO1J 3I4MG 3E2EA 2JJQA 1EY5A 1FL0A 4KY6A 3J80i 1SR3A 4I2FA 4FF1A 2K52A 4B3SQ 5JTIA 4B9TA 2FFKB 1N5WA 3UDGA 2YYZA 4MEYA 1P7DA 2FMCA 2ZUCA 1JE5A 4CKEA 5FLMG 4DFJA 2WB1F 3EPGA 2Q2TA 4KMUC 3WU2U 2RVLA 4R8UB 3K6OA 1DRGA 4UBBA 5FJ8G 4R8UA 4QGUA 4YR3A 5J0WA 1WVLA 3PSFA 4EEYA 3ND9A 3S1MB 3T5JA 2ZJQA 4Y2XA 3OWEB 4RCOA 4DOBA 3A8JE 2Z8LA 4DV2Q 1NK7A 2VB2X 1STNA 1PK3A 2NVQB 2F8LA 3QEBZ 1SL2A 1HTLD 1Q3VA 4QZCA 2NVTH 4R4QA 1WG8A 7ICRA 1C48A 3SAGA 2ZXRA 3QO2A 3V7KA 4DK0A 3MAQA 3T1HQ 4LNQA 4A3FB 4FZMA 5KT7A 1HEKA 1PZJD 2KD1A 4YCWA 1CZGA 1IHZA 2OXPA 4Y2JA 2BPCA 4OL7A 2HBKA 2F3WA 5KG7A 3GFKB 4HSPA 2B39A 5IYCH 4ECWA 5L37A 5IIMA 4GXIA 2FI1A 1KLGD 2PZTA 1I5FA 3PMLA 2DPJA 1KNEA 3MFYA 4P73A 4XIGS 3T16A 4XQQA 2OM6A 3K58A 3JAME 4A3JG 3GTKH 1I6HH 2HOFA 4BXOA 3AU2A 2LXKA 3HOUB 3J81E 3PMFA 1F9QA 2R7ZB 4IJLA 5HR6A 3KLWA 3EROA 3PCOB 5DB8A 1X40A 1JMSA 2XC9A 1JXLA 4ALPA 3D4RA 3K1RB 5ALOA 1L0YB 4K4IA 5ELCA 3RZOH 5DB7A 1L3VA 1FFUA 1VQBA 1X56A 2R18A 4KX3A 5IIJA 3RNUA 4DL6A 4H02A 3I56A 2YQEA 4F93B 2XIWA 5KFGA 4PG3A 1DGSA 1Q46A 2KTQA 1NSNS 2M9NA 3IFTA 3VC8A 4ED0A 1RF2D 2OF1A 3RB3A 5EKIA 1CEZA 2XCPA 5KFUA 3R8BA 1ZQRA 5FJ8H 3F5EA 1N63A 1KBUA 5IGGA 2K5QA 2K50A 5KFDA 1Y69U 1QE6A 4PGXA 5HY6A 5IYDH 4ECRA 4M9HA 1G2TA 5M5WH 3PY8A 5KT3A 4ME5A 1HUNA 1FYCA 1JALA 9ICJA 3FDTA 1MBYA 3QOJA 4RQMA 4YVZA 2DY7A 1EQVA 2W9BA 2LPEA 3DWPA 2HHWA 1A8VA 2W9BB 4FO6A 1PVRA 1PRTF 4DXGA 2K8BB 3SAHA 3JC66 1E7ZA 3OTQA 1EIFA 4J9PA 2RSNA 2VW9A 2EXDA 4TUPA 3KYHC 2WAQG 3MBYA 3TAPA 4JI1L 3JPOA 2IL8A 3HRZC 7ICQA 2H3VA 3CRXA 3QWNA 1XO1A 1Y8NB 4GNXA 1IW7D 1LKYA 2VJ4A 4ABNA 5IYBG 4B9UA 5JVG3 1S77D 4P4PA 1UNSA 4QJFB 5TISU 3J7ZC 3R9KA 2HHHL 5EKKA 1OXJA 2IY5B 5KEEA 2Q2UA 2JA8H 5CB1A 4G4KA 1KRTA 1ILQA 9ICKA 4EQOA 1SWVA 3ED5A 3HOYH 4F5PA 3K7AH 2PFOA 4B9SA 1PH1A 2YB1A 3C2LA 2G5DA 4BA1I 5ALVA 3I4LA 5L1KA 2XI9A 2CCZA 3Q8DA 2F4VL 1LTSD 2KVMA 4P74A 4O42A 8ICKA 2NZ1D 4DV6Q 1PFBA 2UXBL 1M90C 1SFOB 2AWNA 1ZOLA 5ALDA 2ZG6A 3ZI4A 1SYDA 2F0SA 1QILA 1FGBD 1ZQKA 3CQZH 4BY1G 3S14B 1CA6A 4A3GB 4AH6A 2L55A 2RHFA 3SZ2A 3HKZG 3A5ZB 5EQ0A 3IFDA 2FJ6A 2VNUD 1PH3A 3ERSX 3ZDCA 2KFNA 2I07B 8ICMA 1XX8A 1LTGD 1J97A 3ISDA 2E75C 1Q1EA 4B9XA 1SYCA 4UB4A 2ISOA 2SNSA 1ZRMA 5LMNW 2CHBD 1COOA 4HEDA 4ILWA 2HIXA 4ECYA 1ZQSA 3EIVA 1AQ6A 4KLJA 1VLBA 4KHZA 3TP7A 3RBEA 1Z1BA 4NXZA 2UXCL 1DM0B 3T5HA 5FLXc 1DONA 1PZNA 2A73B 5DQHA 1XMQL 3M1YA 4F92B 3BVZA 4KITB 5C3XA 5I9OA 2XICA 5DLFA 2AKWB 3C2MA 2N88A 2O2LD 1ZQYA 2NTTA 5ALNA 3TS2A 4DNTB 3GTGB 4UB6U 4MHEA 5J0YA 4QB4A 3BS5A 2MRLA 5M5YB 4KV6A 4RNNA 8ICEA 2DY8A 3U4VA 4Q5VA 1AE3A 5K36G 1SV0A 4C4SA 4C8LA 2XGQA 2KCCA 3K80C 5J2KA 1L8OA 4N9TA 4KN7C 1SNPA 4C4TA 1ZQMA 4RQ5A 9ICRA 2D6FC 2PO4A 5T14A 3CU7A 1ZETA 4M1UB 1IG6A 3T13A 2ZT9C 3GIMA 2H3IA 1TY0A 5CMDA 4BXXH 1J2NA 2NZHA 4ED7A 1BCPF 1BGXT 3GTLB 2PI2A 5F3XB 1CHPD 2GO7A 4EVOA 3BDLA 1MJCA 9ICEA 2BH8A 3IAYA 1JI7A 2O6KA 1S10A 1L3SA 4CHTB 5IT9c 1I94Q 1HNZQ 3PF4A 3HOWB 4M0AA 1IV8A 1J8IA 3GTOB 2O5IC 2CFMA 3KD3A 4L63B 4FVMA 4NXML 2R61A 4ULLA 5J8YA 4ZLTF 1VS0A 3MEHA 3VA7A 3SK6A 5C6AA 4GKKL 1XSLA 3DLLA 1B4FA 4OJPA 4EBDA 2PNHA 2JN4A 8ICVA 2Q8RE 4NMZA 5LMNQ 5ALRA 1D5MC 2VA2A 5LL6X 2X69A 4IUNA 2M9VA 4YMOA 4WRDA 2IHNA 1O7LA 5NUCA 4C3IG 3J80E 1VQ4A 3DDHA 3T1YL 1L1OB 1U4LA 5B66U 4C8KA 5FK9C 1BPEA 3J80L 1XSPA 2XRQD 3W2DA 4K8JA 2OT2A 2BPGA 2FXQA 4CKBA 5KFIA 2E2IB 1I6HB 4TKOB 4QZAA 2ID0A 1EFWA 2Z1CA 2R93H 2L15A 3PX4A 1ZXTA 3BG3A 1WJJA 1B9NA 1XO0A 4M9LA 1T4GA 4DAVA 1PHJA 1NZPA 5DDMA 4Y2VA 1GUGA 2KSOA 4XQJA 3E0FA 4NLCA 1V1PA 5JVH3 1PTOD 3ISCA 4B9MA 3PIP3 2NVXB 2Y0SE 3GO5A 2KIWA 1PTOF 1IYUA 4OWWB 3A56A 4PZ7A 4UY8C 4F2RA 4FO2A 1PMRA 1R4QB 3NEMA 3VR6A 3QU2A 7ICMA 2QEJC 4YR0A 4GLXA 1IL8A 4OJ5A 1DK3A 1EEID 1VF5C 3S1NH 3UXOA 2G06A 3OIQA 1BNZA 1QCKA 1N32Q 2B2WA 5KFOA 2D8CA 5KFPA 1X3FA 2VB3X 3HOZB 2EZXA 5D49A 2R8IA 5KFVA 3WK7A 4KLUA 1B3QA 1E22A 3HS0C 3I4OA 3PV0A 3RB0A 2BQ3A 2KHSA 3F8TA 1KLNA 4OIJA 5J22A 5C0XJ 3TQYA 4JBKA 5ALQA 2NV3A 2UUBL 1PRTC 3Q0AA 4LZGA 2DBYA 3HP6A 2KV2A 3TACB 3UPQA 2V9WA 1PH2A 5L1IA 1ZQOA 3WDNA 5EJWA 2PFPA 1Z3EB 2QB0B 4BXXG 4ECVA 1J6QA 4DQSA 5KFFA 2AMCB 3E6ZX 4KLTA 3MR6A 1DJRD 4DGZA 1T3NA 4NP5A 1LKYB 4RCNA 3HW8A 4HN7A 4M47A 1K5OA 5BPCA 3I4MB 2ZJ5A 4DUZL 3KBGA 5AKJA 3M9MB 1IZ6A 4LF7L 5ALMA 1JJ2A 3F2BA 2Z6KC 1BNOA 3NP8A 3KHGA 3DEPA 3QE9Y 4QWDA 1IL2A 3GTQH 5KFZA 4PHPA 3C29A 4MZ9A 4A75A 1NCVA 4LZDA 3D2NA 2D2CC 4OEMB 1EU3A 2RDIA 2I6XA 1WYDA 3HKSA 5A35A 2YU9H 3KDFB 2PMZB 4BY1H 4C1NK 1K28A 1PH4A 4CJ0B 5IOCA 3GTOH 1HRJA 4PZ8A 1L2FA 5AHXA 3MR3A 5DGAA 2B21A 4A3BB 5KFEA 3NE5B 2KE7A 2UXBQ 1PXUA 2Y0SF 2KECA 4Y2TA 1N32L 2GVAA 3PUXA 4JI5Q 2HI0A 4RGMA 1S5LU 4G9BA 1BQQT 1PH7A 1HA6A 1NK6A 4A3CG 4R64A 2JXJA 1BOSA 1IBLL 2L9HA 5C44G 1NJXA 4IL6U 2C2RA 4O3RA 1B53A 1K83H 2A6HD 2WAQB 4OO1I 2DL0A 4N9PA 3GILA 1ZQIA 1L0XB 4DV5Q 1UEAB 1TVAA 5HMLA 2LM4A 3C1ZA 2A6ED 4J6HA 1UA1A 1URJA 1TKWB 4C3JG 1X9SA 1EOTA 2NVYH 3V6HA 2NN6I 1TWFH 2HHUA 3I1YA 3L4PA 1MSGA 1M8AA 4X3TA 2E2HH 2UUCL 1ED1A 1JOOA 3QX7A 2HHXA 3M4OB 1ML0D 4R8NA 2VUMG 1QQ6A 4FXGC 3OHAA 3S1QB 4DK3C 1ESFA 2Z7JA 3T79A 1K1QA 4QL5A 4A3EG 1XPOA 3CC2A 4RGOS 2PQAA 1KD1C 5IYBH 1TS2A 1COKA 4BBRG 1NK0A 1CFMA 5ALTA 2VUMB 1KTKA 1SV0C 1HJPA 1BCPD 3F1ZA 5IYDG 1QQ5A 1ZYRD 2VZAA 5IP7H 3BS1A 5DM73 1LTLA 1AROP 3QXGA 5J2IA 3T3FA 1SRUA 4NLBA 1ONLA 2IHMA 1Y8OB 1VQFA 2KK0A 1Q8IA 5J2DA 4K6DA 1HZ9A 4K4HA 2WKDA 4IUVA 3QU5A 2IOFK 4XT1B 4IUQA 2RCFA 3TRZA 3NBHB 2BH2A 4NLKA 2H3QA 2F0GA 5ELFA 3NWSA 2EYPA 3RAQA 3PNCA 3E0JA 4JI3Q 2P6UA 4A3IH 1L7NA 3IN5A 1Z00A 3NRWA 2EZZA 3M8RA 4M9GA 5K5PA 1JUDA 5M3FG 2ASDA 3Q8KA 5G3LD 3T53B 4NLGA 2LMRA 2N1RA 3MFHA 1B22A 2DJFC 2JK8A 5IWAQ 3I91A 1TT2A 1YEZA 1N56A 4ELVA 4O0IA 3CCSA 1Y1VB 1ZD5A 2A6EC 2VANA 4WORA 2QARB 4B9WA 3T51B 1XPRA 4IS7A 1BPBA 2EIFA 3HOVH 4AYBB 1C9OA 1SROA 4QW9A 1WWUA 3HT3A 8ICTA 1E2VA 2UVWA 4NXNL 3PR5B 1WTRA 2LY7A 1N36Q 3I3CA 1KAWA 1W6JA 2VIXA 4RPZA 1BDOA 3DXJC 4HCEA 4HJ8A 2NB0A 1AZQA 2KQ3A 5T1GA 3JPQA 2K75A 1X9XA 2KJ9A 7ICGA 2A69D 2UUCQ 4RNMA 4RUCA 3TI0A 4O2DA 4DCCA 1SYGA 2CQAA 2LS01 2KHJA 3E9IA 2KCMA 3F2UA 4DV4Q 2MJ8A 3Q22A 3CF5A 4GOPB 7ICTA 3X3MA 4GOPC 1EIYB 2HMXA 3ETRA 5I9PA 2EDUA 1SE4A 4PV1C 5JJKA 4RT3A 4RGNA 3DMUA 5D3IB 1VQLA 1G291 2IJ0A 3PF5A 2BZFA 1RL2A 1BCPB 1IIPA 3CMAA 3A7AB 1CRXA 4JBMA 4K8IA 4LMQD 1RDFA 3CP0A 1UPHA 5J0PA 1QG7A 1PH8A 2E8PA 4CDDC 4L5RC 3HOWG 3P75A 2ZIWB 1TR5A 5AI6A 1YT3A 4PPXA 5ALSA 4V0BA 1SKRA 2V4DA 1SKSA 1L1OA 3CAMA 5AK5A 3DHQA 4NLZA 4EYHB 3Q8SB 3G6YA 1G51A 3RFAA 1WCMH 2WACA 1ENCA 1P8LA 5AKYA 4YXMA 2KHIA 3CQZB 2G9HD 4XTCS 2B2WC 2HHSA 1TFRA 1RXWA 1LYLA 2ASJA 3PSPA 2OHFA 4JV1A 4K5WA 3CNHA 2MSNA 1EYCA 1JWUD 2E3TA 4DV7L 1IW7C 4I2BA 1UHUA 5KTQA 3LVWA 1T94A 2F0TA 2XCAA 1BBWA 2Q8IB 1UAPA 2ZXOA 3VDYA 3PV8A 2NYVA 3UQ2A 1EWIA 4EX7A 2VA3A 4RQ3A 2K33A 2X6LA 1RHPA 2OYYA 2FJ2A 4PHDA 2K01A 4JI2L 3CPWA 3S15B 1U4PA 3DWQA 3LK9A 3CW2C 9ICLA 3I7FA 4X62L 4DFDA 2PZWA 1I4HA 1B8AA 1AP0A 1I4RA 3UDFA 4K4GA 3VYSA 4XXEA 1RXVA 1Y14B 2C9OA 2K4KA 2MO0A 3LGJA 2L12A 3H0RB 5LMUL 3DEOA 3MFIA 2YU9B 4KN4A 2JZBA 3OMGA 4JMUA 3RH4A 8ICWA 2G9DA 1D7QA 1JN3A 3IRUA 5AKIA 3F5AA 2ISPA 1T9HA 4YQWA 2GN5A 2ZM6Q 3GTQB 2K8AA 1IKLA 2UUAL 2F52A 1LTBD 3TKAA 3QG1A 1NK4A 4Y7NB 1HUOA 3PZPA 1MQ2A 4YWKA 4DSLA 3U9OA 5M3MB 4DWIA 1CSPA 3DV9A 1JXEA 8ICPA 2NN6G 4JOIC 1TE2A 3LVVA 4BY1B 1VQ6A 1S0OA 1JOQA 2RQ5A 5IIFA 1EY6A 1PYBA 3GTPH 5J39A 2K14A 2DNCA 1TKDA 2EYHA 4DSKA 4C8MA 3CCJA 2UUBQ 3V6KA 1F2YA 8ICZA 1ENAA 1H9JA 1V38A 1X9NA 2J0TD 3WK5A 3B6YA 4H44C 4J8QA 5E7NA 1FGUA 3GD7A 3LWMA 1ZQNA 3TN2A 2ASBA 1IKMA 2KEDA 1U4RA 1H9KA 1VQJA 2B2YA 3RLFA 2DF4B 1S0MA 3ZDAA 4P0PA 4FYDA 2JA6B 1SL0A 4UB8U 5J0TA 4KKUA 4X3UA 1KC8C 1PLFA 4R4OA 1X6JA 3QU7A 4DV3Q 1C8CA 1M1KC 1MGSA 1M4VA 4O5CA 3QJYA 5CGKA 2CRXA 3FKIH 2JA6G 4A3MG 3H4BA 1S9FA 4JW0A 2ZXHA 1QSLA 5GTIU 5I2XA 5IT9E 4OO1H 5FP0A 5BN4A 1Y1WH 2DUYA 3NUCA 4MF2A 2KHVA 3RB4A 1GVPA 2NRZA 3MXNA 4ED6A 2A68D 4QWCA 3N7RC 5KIXA 4IOAA 4ICAA 4EQPA 5C4XG 2BGWA 5HGQA 8ICFA 1CM9A 1VDZA 2EZVA 4UATA 5AM1A 4U673 2W9CB 1NMGA 2AGPA 1PVOA 4IPCA 2EQSA 3MWYW 1U47A 2R7FA 3V2TA 5IY0A 4O5KA 2A74C 7ICLA 3U26A 3TS0A 3M7GA 1KW4A 4KMOB 4FS2A 4HJ9A 1XNRQ 1TWGH 3F2CA 1PYWD 4NKLA 3C46A 1U4MA 5CV7A 1XNQL 4J9KA 3I70A 5FOBB 2ZJPA 1X66A 2F77X 3ISBA 4DAMA 4DL2A 2FINB 2WKCA 5ALXA 3A74A 4DL4A 4YIJA 3OHXC 3RN5A 2UXDL 9ICFA 5AK6A 3CCVA 2EYJA 3KLRA 4E6IA 4Y2RA 1V9PA 3RN2A 3RR7A 3I55A 2F3VA 4RGTA 1MD2D 1BNPA 3S17B 1LTAD 5EGTA 2BCVA 4DSEA 5EBCA 1Q1BA 4A93G 5KYLA 4J9LA 4BY7B 2RA4A 1WOCA 1FIQA 4IFDG 4EX6A 2D5DA 4UASA 3J81i 1LTID 3ZD8A 2HQLA 3HP3A 1JT8A 2RHQB 3RJKA 5KFXA 2VQEQ 3EWAA 4FDBA 1K9MC 4JYAL 4UAZA 4NDXA 1ZD2P 4LWCA 1QOHA 3HOUG 3N7SC 3ZDDA 1WD0A 4QIWB 4DV0L 1NKEA 9ICXA 5EE9A 1GUWA 2KENA 5AJ3Q 3KOOA 4KLIA 5C0YA 5DEHA 5M3MH 1B70B 3ICXA 1N9WA 8ICCA 4X64L 4B3TL 4RNOA 9ICWA 5AI8A 3MXGA 3KFUA 1S72A 2LYBA 5ALZA 1TS5A 4F91B 3GTPB 3RLOA 3B0YA 4BY7H 2R6GA 2K4EA 1ZKOA 3NPPA 3G6EA 4GNXC 8ICHA 4DR6Q 2I5MX 1N61A 2HIVA 3S2DH 2ZTEA 1FJGL 1EOVA 4F7XA 5C4XH 2V4QA 4FE3A 1Q8KA 1B7YB 4RA8A 2WB1E 2EH9A 5DGBA 3NXWA 4UP9A 4YP3A 3IDWA 3N7PD 1Y1WG 1V97A 2LYAA 2PFNA 1TWCB 1EL0A 1B2TA 4DEZA 2WIIB 1JRPA 2XGTA 4UP8A 5FLXL 4PGYA 1EIHA 2F2AB 1Q7YC 4AP9A 1OUQA 4ID6A 4YWMA 3SK4A 1DOKA 4A76A 4NXNQ 2YV5A 4EZ6A 1ZQFA 1BUVT 4EELA 2PI4A 3OSPA 4EEKA 4PJ0U 4I2GA 3MTSA 5M5YH 2E1EA 1EQQA 1HNZL 3S15H 2E2JH 3WWVA 1G6ZA 4ZUJA 4O1NA 4JI4Q 3GV7B 1EY7A 3HJEA 3KHHA 3QUCA 2A6HC 3HOVB 4F3OA 4YHHL 2W3SA 5EE1A 2XWJB 4RQ0A 3GQCA 2K5HA 1ZRNA 4QZHA 3UDIA 3L2PA 3G7LA 3ZDEA 3PO3B 5KFCA 3QR8A 7ICIA 2R7ZG 2W55A 1UE6A 5CHGA 5CV8A 2ALZA 4YD2A 1KN5A 4RMFA 1YJ9A 5J0UA 2NTSA 3QU4A 5COYA 3BYYB 4IFDH 3SAFA 4GZYC 4UARA 1TK8A 3UE0A 4A3MB 3PMNA 4FF3A 2BCRA 1HH2P 3KZIU 1EYDA 1SXTA 1T3QA 5KG1A 2KUMA 3UXPA 9ICVA 4OIKA 1SJHD 3Q6SA 5CORA 2BDUA 5T1IA 3NASA 1J5EL 4DN4M 1RYSA 1CI3M 1WWVA 2WF6A 3V7LA 1DXMA 2JGAA 1SNCA 2F0WA 7ICNA 4DFAA 4FNFA 4F5OA 2RRDA 4PHAA 3OOCA 4KI0A 2ZJ8A 2PNRC 5ALYA 3MC0B 3RJJA 1SEBD 3U9SA 4BWJA 3RH5A 1I50B 1PUZA 2DUDA 3Q8PB 1SB3C 4CF3A 3VR2A 4GLVB 5ELBA 4LFBQ 1L6NA 5IGFA 3UMCA 1NK9A 1PZKD 1D9FA 2JH1A 7ICHA 2AH5A 4QNLA 4WJ3B 4BDPA 2NBFA 1VQHA 2RDHA 3S2HB 4A4IA 2G0AA 1S5DD 1YI2A 4F50A 3LYSA 1FNUA 3NVWA 2B2UA 3D4DA 4K14A 3RZDH 1NJIC 5ALEA 2JA8G 1L7MA 5H1SE 4K0KL 4LFCL 3T4AC 2WP8J 3T1YQ 5KFQA 5HNKA 4QZBA 1P16A 1LT4D 2FPMA 1Y1VH 5KNBA 1ZQZA 2XIDA 1QVFA 2LHTA 1O7ZA 1XWEA 5E3FA 1JROA 4YHHQ 5IGDA 4JWNA 1KNAA 5DQGA 3VR3A 3F53A 1M6YA 3SYZA 3H3VH 4C8NA 3W5OA 1WCMG 1XJVA 1RQLA 4JBWA 3PO2H 4OO1G 3KLSX 3A0HU 1OW5A 3K0XA 3W3AA 3FKIG 1AEXA 2JEFA 2F1HA 5M5XH 3HOZH 1N60A 3WKBA 2RLTA 3TFRA 1Z9FA 4FS1A 1D5ZC 4DR3L 1VMPA 1E1OA 4JOIA 4QF4A 1PFNA 2DKZA 1JE4A 3TMEA 4NWIA 5H2FU 4DLGA 3IHQB 1S5FD 4QUCA 2BHNA 4X66L 5M3FB 1MSHA 1S40A 2EZYA 2WB1G 2JV3A 4HIOA 1FJGQ 4X62Q 2CKZB 4LF7Q 2AQ0A 4DV4L 3S1QH 1D8YA 5J2EA 2HHVA 1SAPA 8ICOA 3UDXA 1B9MA 4U6PA 1SMXA 2UXCQ 5AK3A 2XNAC 5EE0A 1EU4A 4NB3A 1OXSC 2NO5A 5EAYA 3QOLA 2W03A 2W7PA 4J15A 4OJOA 4B3MQ 2ZTDA 1EWCA 1TS3A 3C3LA 1UT5A 5KG6A 4X3SA 4IOCA 4TQSA 3KF8A 4J9OA 2FPLA 3HOVG 2K89A 4NV0A 4JV2A 1TWAB 5I2YA 4JB3A 2UVVA 1SYBA 3IG8A 2ZIVB 5ALIA 3C5FA 1T5XD 5CV4A 4QIWF 3LDAA 1U9LA 2DKXA 4J9MA 3BQTA 4O9MA 2PMZF 4EBCA 3BQ7A 4Z6EA 1TU2B 3P20A 5DLGA 2XO7A 4BBSG 4H0LC 5KFSA 3UQ0A 8ICUA 1RJTA 4JI4L 3OTOQ 2YX8A 3RB6A 2BDOA 4Z6CA 5AKLA 5M3FH 3H40A 5IODA 4A3FH 2IOHA 2DN8A 2BCQA 4RG1A 1G2SA 2JA5H 3BVGA 1U4BA 4F4WA 3OW2A 4EZ9A 2KJXA 1NY4A 1A3TA 4DV1Q 1XWLA 1SYEA 2B0CA 2NVQH 1Z1VA 4F4YA 2VY3A 1F9SA 5C5LA 1HCZA 2ZM6L 3RBDA 3U50C 1GHKA 4F5QA 4I29A 1LTTD 2R8JA 1SMYD 1ZQXA 1RTOA 1R4PB 2CPRA 1KRPA 8ICJA 3TANA 3CC7A 1AE2A 4OX9Q 5C5MA 4J9RA 3Q8QB 1VQ9A 4X66Q 2ALYB 4DR1L 4RQNA 2J6SA 3AQQA 4L5QA 5ELOA 4US8A 1AW7A 2Z9HA 1SWWA 4O3OA 5FLMH 3H0MB 1ZYRC 1ZD3A 1YHAA 7ICOA 1K0RA 1RM6C 1A0PA 1Y1VG 4BBRH 4RPYA 2J6UA 2BDPA 1KKXA 3ULPA 2BDNA 3HOZG 3FPUB 4A3EH 3NVZA 3G6XA 4JK1C 1VMCA 2ZUBA 2MO1A 3N28A 4M9NA 4QWAA 1A15A 1SE3A 3PO2G 2XVTA 1MJEA 1NOMA 1HNXL 2JH7A 1LM0A 3BYTB 2H4OA 4BWGB 1OXTA 1PK1B 4GN4B 3U4ZA 2KZMA 4DAPA 2WAQF 1CKMA 1H9RA 1TK5A 1EUJA 1BF4A 9ICBA 3K7UC 1HFNA 3K8AA 2IPKD 5L1MA 4OJ6A 4DU9A 1LV9A 1WFQA 5LHY1 2E8MA 2WV6D 3EBEA 3UE1A 4KHVA 4UAYA 3JPPA 2YY6A 3PW7A 1UUPA 3I2ZA 3TP6A 4EQ5A 2E8NA 4DR2Q 1SKWA 8ICNA 4LFAL 2VUMH 3H3VI 1IBML 5ALPA 5CR3A 1ECWA 3CYMA 3Q8LA 4A8EA 2K60A 3UXNA 2FLNA 2HOIA 1SYFA 2AUJD 3TADC 1JICA 5J2HA 5J1ZA 4HJAA 3T1HL 1YHBA 1S0NA 4A3EB 2KIVA 5AKZA 1YZ7A 1CKOA 3M9NB 4DR7L 4DA2A 1Z00B 2A69C 4IUUA 5AFWA 8ICRA 4QWBA 5CV5A 2YN4A 3PX0A 1A76A 3D0FA 5IINA 4L5TA 4IO9A 2HDOA 2PQEA 1EY9A 2QDBA 1ASZA 4ECQA 1HHVA 4OX9L 5E4XA 4NPSA 1NK5A 4DUYQ 4DAYA 4CF5A 4X5VA 3PO4A 2K05A 4L6TB 1EQRA 4AYBC 1X65A 1YJWA 2CWPA 2A19A 2K6AA 1PTOC 4Q0FA 1PA6A 1XTDA 1ET9A 5AKKA 3A0BU 5E1FA 4FF4A 2YTYA 1OTCA 2OEHA 2JEGA 4LF5Q 1KTQA 4X64Q 3MDCA 2DPIA 1OXVA 1TQOA 4OWTB 1CI4A 5CA7A 5EE3A 3ONNA 1JB7A 2B6GA 2LXJA 1S76D 1QUQB 4RKLA 5JOBA 5HMMA 2R8KA 1BO0A 4P2HA 1I4GA 3FMCA 3NTKA 3NWTA 4A3KH 1YZ6A 1NJWA 5IP7G 1ZQHA 1EFID 2VQEL 3M3YH 1X6OA 3NQIA 1SXEA 1VDVA 2B63B 2KKVA 4ECSA 2VQFQ 4POGA 4C0ZA 3STBD 1JWSD 2F0JA 1ILPA 3JPSA 3PUWA 2YB4A 3BQ0A 3FRPB 4HAIA 2W9CA 8ICAA 3GQBA 3M85A 4DF8A 3KBBA 5AK4A 2C2DA 4WJWA 4MTNA 4EYIB 1L5UA 3A8KE 1KAAA 2R8GA 1U5KA 2HCCA 5G5HA 4K5XA 4LF4L 1IYVA 4P75A 1U9RA 1FFVA 1Q3LA 5KFBA 3EJIA 2W54A 2N8NA 2E76C 2KEYA 2AXTU 3E0EA 4EBEA 1KEJA 2K5VA 2K7VA 2EY6A 3SR6A 2LKYA 3O0FA 4O3PA 2QKIC 1NI3A 5GAEC 4DR4L 2J7ZA 3HZXA 2FE9A 1WCNA 1H9MA 4F88A 3SHLA 2NRXA 3CKIB 3PUVA 4BY7G 2P5ZX 1HUMA 3BVMA 2NVXH 4FF2A 3GIJA 2F8KA 1ZEQX 2R92H 2KVSA 2G5HB 3NENA 4KN7A 2W9AA 1LTRD 4DKAC 2AQ2B 3NTHA 3MHBA 3JAMi 2JA7B 1CSQA 4XT3B 3H0GG 3HOXG 3OSNA 3M3YB 3HOUH 4JI8L 4B3RQ 2E5SA 1Z19A 4S3SA 2HBMA 2Y0SC 3K59A 2WFWA 3BJYA 3GTLH 2JE6I 3P7JA 5KGUA 3WK8A 2IX0A 5TSSA 1WTPA 2SEBD 1MC8A 4Z6FA 3PW0A 4OXPA 3TDQA 2ZIWA 3G4SA 3SENA 1AN8A 1KQSA 4YMMA 5ALFA 4KD3A 3PW5A 2QKQA 3WKDA 2EQYA 4GXKA 5C3WA 1NJZA 1EZ8A 3AB9A 2M2LA 3MFGA 3R3OA 4JBJA 2FDRA 4LUZA 3V7JA 1TK0A 1FD7D 2OEOA 3KTQA 1L7PA 2RCNA 5LL6S 4ED3A 2R92G 4YD1A 4R1JA 2C22A 3URYA 5TZVA 3S1RH 2KP7A 9ICOA 4F87A 2EJMA 3FPPA 4TUQA 1TV9A 3CC4A 2R92B 1CTMA 3NQTA 1DZ1A 2CQOA 4ZUIA 4M6WA 2RQXA 2QLTA 3L3FX 2F0KA 5KT4A 3RJGA 2W8LA 5JJIA 2F0LA 4H7BA 4TQRA 1CA5A 3R2IA 5DG7A 3C1YA 2HUGA 3I72A 2OCEA 4DSIA 4RHSA 5AI9A 2EANA 4GIBA 5I6YA 4C4RA 1C4QA 2B3GA 1T7PA 3E5SA 1BVSA 1LO5D 4OD0A 4M8AA 1SE2A 2A68C 2FHTA 3FAHA 1EQTA 2XVSA 4FXKC 2MA1A 4A3MH 1VQOA 4QQBX 1DK2A 4DL3A 3IP4B 2FLPA 1GUSA 4X3KA 2TSSA 1AZPA 4Y2YA 4ZYSA 4J9SA 2AHOB 3AU7A 3KOJA 3AQEA 3HILA 4NJ8A 2XY5A 2MHVA 3D3RA 5IT9L 2HT1A 3H0LB 4XYOA 1ZYQA 1QNKA 4TRDA 2JA6H 5AIBA 5IGEA 2NRTA 1K73C 3HKZE 4Y2QA 1V1QA 2E5LQ 2K8CB 1X9WA 1IYJB 1GUNA 1I50H 2LFNA 3MEFA 3NTIA 3SVMA 2CN1A 2XY6A 3KF6A 4F8MA 4DS4A 4F8RA 3HWTA 1O03A 1SL1A 1NKBA 3AEVA 1J5EQ 4C80A 3JPTA 3V72A 3S16H 3M7NA 3HKZB 5KFHA 2PPBC 5J2CA 3KDFA 1X3PA 3KF6B 5C4XB 3H0GH 2L4NA 3HOXH 2D62A 1HIWA 3R2TA 3J81c 3N97B 4MTKA 3NTUA 1Q90A 3IRBA 3RRHA 4A93H 1FVIA 3UM9A 2VJ5A 4YFKA 5M9OA 1W2BA 8ICBA 4LFBL 2GVBA 4ME3A 5IP9H 4P71A 2HQEA 5AKXA 5EWGA 1GJXA 1S5CD 4H13C 5BN3A 4KKSA 4RAUC 5JEAJ 2F0DA 1R9TB 1SE8A 1U48A 1I4XA 1PH6A 4CGZA 2YMQA 2Y0SG 4I2DA 3ETLA 9ICAA 4IZ8A 4F4KA 5AKEA 4I2JA 1KDBA 4BXOB 2EXZA 2KCNA 2WF7A 5BOLA 3GTMH 2KFZA 1UEBA 4JWMA 1VQEA 2GH1A 1XYIA 5KAFU 2ESEA 3F2DA 3PW2A 1N8RC 3K57A 5KG4A 5J2GA 4DS5A 2IBKA 4BJQA 4IPGA 4TVAB 4DV2L 3GV6A 5KNCA 4DLEA 3WK4A 2MU2A 5G5GA 1ZQJA 3M4PA 1D2BA 5J2FA 3FEWX 1I4QA 3MXNB 3N6RA 3Q8MA 1LT3D 5BR8L 3FC4A 4DF4A 3A7LA 5I4DA 1ESRA 4O5EA 2KOLA 4PMBA 1MKHA 3SEBA 4DO9A 4JI7Q 4LUOA 1A62A 5ALJA 2B2TA 3L0OA 2E5LL 3V6JA 4GXJA 3CCLA 1C0AA 9ICQA 2WFAA 2RP5A 2LM1A 5EWEA 3QIAA 4QIWC 3FKIB 2D0OA 4DFMA 2ZXIA 1HZCA 3ULLA 1N2XA 1F2ZA 3Q8RB 4LF9Q 2LSSA 2KN7A 1JR0D 3OIPA 4JI3L 3A5UA 3CCQA 3HOYG 3J7AF 2JSOA 4C8OA 1SSOA 3CCUA 3WKCA 4JI6Q 3MR2A 4A3JB 4KLDA 1SXDA 3CD6A 3HOYB 3AN1A 3RAXA 4NY8A 1BBUA 2F0UA 3HOWH 4DQRA 3PIOA 4BWMA 5CP2A 4KTAA 1KL9A 4KLOA 2L5YA 4IQUA 1MI2A 3TARA 5F2DA 4LW1A 1GM5A 1VQ8A 2H3FA 3EYZA 1YITA 3QZ7A 1JX4A 1I3QH 7ICKA 2AUKA 4AQYQ 4DL5A 1XMOQ 4DNRB 2QB0A 1DOMA 1D8LA 3ICEA 4HSVA 4LJZC 3L7ZC 2L1BA 4IQZA 5J2JA 2F0VA 1QQ7A 4L5SA 5DBCA 1JOKA 2IA6A 5C4JB 3GZFA 2NUCA 4GKJL 2PYKA 2OXOA 5C4HA 1YJNA 4LFAQ 2G5IB 2JEAI 1C7YA 2IHEA 3MGIA 4HMJA 4RPXA 1STHA 4DK1A 5AKGA 5LMUQ 3E58A 3PO2B 1UQVA 1QSYA 4BBSH 2Z0SA 5ALUA 4I2IA 2H3ZA 4HR7B 2QW7A 1IBKL 2F0IA 4JI7L 5KFNA 2B2TC 4FXDA 4Q44A 4Q8FA 3SI8A 4C7ZA 1XU4A 5AM5A 1H9SB 5KG3A 4YY3Q 5DAUA 4IPDA 2WF8A 4IFDJ 3NELA 3MZ5A 3OJUA 3E9HA 3BZCA 3K81C 4JI5L 4IR1A 2HHQA 5JPNC 3D2QA 2PW5A 2KJ8A 4HJ7A 3SE0A 1LVHA 1L3UA 4A3IB 4JI6L 2R93B 9ICHA 1X3QA 1YNJC 2EPBA 4ZCKA 5L9XA 3W1BA 5JJZA 4JCVE 2HVIA 2PZUA 2HCIA 3VA5A 1EXNA 4E0DA 4NLNA 3IV6A 4US9A 4TUSA 3BZDB 2CVRA 2P35A 4CGYB 5ISRA 4DV5L 3HX0A 4K5VA 1ZJNA 3CPFA 1VQCA 5EPLA 4DV7Q 1CT1D 1TWHB 2W11A 1YVCA 2O4XA 4CF4A 2P66A 1TXYA 4PHEA 5J2BA 2NRWA 5AIAA 9ICUA 4B08A 5J0XA 4GLAC 4R4CA 2Z6BA 1XS9D 4X65L 2JEIA 2F0EA 1F9RA 1L8LA 2FMSA 4QMGA 1SNDA 5KFKA 3GV3A 5A2QE 1X3EA 3K7AB 4KJNA 1PVQA 3TZUA 1QWYA 2A8VA 2PMZE 1WTOA 4CJ1B 3H8JA 3UMBA 5CEHA 8ICSA 3Q24A 2JMGA 4Y52H 1MSWD 1MIUA 2VQFL 3AQFA 2GOLA 1A6SA 1JORA 2JRZA 4IRKA 4HCSA 4PMCA 1ZD4A 3MR5A 4TSSA 2HHTA 4C3JH 1IBMQ 2C35B 4JK1A 3K5MA 1X3GA 4DNIA 2M00A 2XY7A 1DD2A 2J6TA 2JA5B 1SLJA 4L8JA 1N34L 1A3VA 4F2SA 7ICUA 1G8ZD 4ECTA 2KMDA 1K0SA 2PI2E 1B0XA 2RBMA 5IIKA 1PH9A 4QZGA 4K0KQ 4R4TA 1ZQ1C 3X3NA 3P1HA 3AMUA 1U49A 3PO3G 4A3DH 4ED1A 1K8OA 3KBXA 2W8KA 4TURA 3C28A 3ND8A 3RTVA 3PO5A 2F1JA 1SBBB 4JI0Q 9ICGA 3OW7A 2H1EA 3WOFA 2ZUDA 3J81j 5KNIA 3I73A 2BE5C 3K5NA 2YMLA 4DR5L 7ICEA 4I27A 5DM63 4K2LA 5AJ3L 1J2MA 3BDOA 2GWSA 3SQIA 3TSSA 3D6JA 2Z4HA 2HDLA 5C44H 1IBKQ 3J7A5 5EPKA 5JEAG 1L3TA 4UHVA 1VJ5A 1RIPA 4A3CH 3H7IA 3H3VC 5C3EH 1K8AC 4IURA 5IIIA 5FO9B 1XMQQ 2QF7A 1DYQA 4MEXA 5FO8B 2QEXA 3GP7A 4QZEA 2EVBA 1EY4A 4JPBW 4DF7A 5CRXA 3RJFA 1ET6A 1STEA 4KLKA 5CC4A 2W04A 1HA5A 2IT1A 5ELNA 2MUYA 1NAPA 4I2HA 1TAQA 1ZQEA 3GDEA 1Q82C 3SEIA 5KL8B 1PDQA 1HPCA 2PXIA 2R3ZA 4RHRA 4RH6A 3ORYA 5D3DA 1D6EC 1TAMA 1SFOH 4XQNA 1EYAA 4DQIA 2UXDQ 4LF8L 4B6JA 3PIPA 4IALA 5KT6A 1K8MA 3TP8A 8ICIA 4MF8A 5FO7B 3QUQA 3QZ8A 3G6VA 4JI8Q 2AQ4A 2EAMA 1TWGB 2WF9A 4ZRZA 4O3NA 2MAXA 1YNNC 4QY7A 5KT5A 3V96A 2I1QA 3M4OH 2E2JB 2C2EA 2MGSA 2P6RA 1UWVA 4LF6L 1PRTD 4BA2I 1ASYA 3VR4A 5ALGA 4BGDA 3TADA 2PI5A 4IPHA 4JI0L 4UBCA 5JU5A 4PMWA 5CBAE 5KFMA 1RG6A 1SGGA 4Y2SA 4DV0Q 2N49A 1F0MA 1NJYA 3VYRA 4ZH4A 3CCMA 1NNXA 2E2DC 3JAML 5L1LA 3HEJA 3K4GA 5GAHC 1O78A 5DB9A 2JXMB 2LI6A 1N34Q 3VR5A 2G07A 2PKEA 1B3AA 1GXDC 4CE6A 2CH4A 1HR0W 3SK5A 2E1FA 4KLHA 1HQMC 4QJFA 2ATWA 1O7YA 3HFZB 4DR6L 4B3RL 1LB2B 3IKJA 2RHSB 5J0SA 1Y1WB 3JPRA 2CWAA 3OJSA 5DQIA 1UCVA 5AI0A 5DDYA 1W3SA 3ONAB 3GU3A 4GFJA 1SDFA 3SMVA 7ICPA 3RUZA 3S24A 1Q3UA 3C1EA 2FMMA 2RF4A 4QZ9A 3A55A 4LK1C 1PK1A 3AMZA 1I6VC 4LJXA 1ZQPA 4B9NA 4MNOA 2CW0C 5GTHU 5KL1B 1RQNA 4KMUA 3WKEA 3C1FA 1CUKA 2Y9UA 2IHFA 4WFN3 2ICIA 4PH5A 2JQOA 1TS4A 2AJQA 3M4QA 4ED8A 2C28A 3I28A 3STBC 1VQKA 3CCEA 2R93G 4Z6DA 4F4ZA 2VL6A 2TMPA 3QEAZ 4R65A 4O3QA 4NM1A 2E2HB 1IM4A 9ICNA 1KLUD 1F2MA 3O13A 1B43A 2NVYB 3ERQA 1XNSA 4RFBA 4JI2Q 4UAWA 2Y1JA 2OQ0A 4CDCC 2W3RA 5ELEA 4CKCA 1A2UA 2HHHQ 5C44B 1L7OA 2G08A 5FKAC 2R7ZH 1S5BD 3OGUA 1WTXA 1YHQA 2QGQA 2LBOA 3SV4A 1Y88A 3S6JA 5B5EU 4KTQA 1UE7A 1XTCD 5C3EB 1XXGA 5HURA 3S16B 5ALWA 4Q43A 1S0VA 1CQFA 2B8FA 2HD3A 2ES2A 4M04A 1CKNA 1BPZA 2D9UA 4DR3Q 3I4NH 1VQAA 1S3OA 1CK1A 2QILA 4BUGA 5AKHA 2AGQA 1KDAA 4GN5A 2SOBA 2NZOA 4K2KA 3DM1A 5AM2A 3EPIA 1QNUA 2WINB 4NL9C 2KOBA 3B0XA 2JP1A 4JV0A 4UB3A 4C3HG 4WJ4A 1Q86C 4J03A 3K0YA 1RZTA 2LYHA 3NHHA 4JVZA 3ZD9A 5DKWA 1V1PB 1F5SA 1D9DA 3AFPA 4QZFA 1BKBA 3H91A 3MXUA 4YCXA 3RLNA 5M3MG 3GTGH 4IFDI 1VF7A 2KHQA 9ICPA 2VXWA 4XUSA 4O3SA 4OELB 2OH2A 1PTOH 5K36H 3EW9A 1Z4OA 4I2EA 4RQ6A 2JEJA 2XGPA 4RU9A 2F3IA 4MN3A 4GNXB 4DV3L 1PZID 2K5NA 1LT5D 2WAQC 2VS1A 1UE5A 4NXMQ 4Z9CB 4DQPA 3K75D 1RPLA 4KD4A 4FZLA 1CHQD 4YMNA 3IG5A 2V4RA 3ZYYX 1AFPA 3I76A 1RYUA 2F3NA 4CNQA 4GC7A 1TWAH 3GIKA 2BCSA 2IW3A 2BOSA 3PX6A 5HGTA 4TQUS 2SNMA 4IQTA 5AICA 3J81L 1IBLQ 2AWOA 3EN2A 4A3GH 3FM9A 1HUZA 3CRKC 1F44A 4LUVA 3HRDD 1KRSA 4J9NA 2WB1B 3H8SA 4EENA 1NE3A 3MGHA 2F4IA 1HQRD 2KG5A 3KJPA 3JAMc 1PV4A 9ICCA 3EVQA 3H8MA 3D6CA 2VKQA 1X32A 4EQNA 2D3DA 4UP7A 1DGJA 1STYA 2RDFA 1TWHH 5CV9A 1RD9D 4P0QB 2IX3A 2Z4IA 1VQPA 2JA7H 3WK6A 1VQGA 2EAPA 2Z6KA 3FP9A 4DFKA 3D2SA 3LWEA 4J9QA 2K4PA 1K1SA 1V85A 2DQNB 3PSIA 3PVXA 4IQWA 3S9WA 4HJ5A 2E2IH 1N33Q 3BQ2A 4YCVA 1L0WA 4QIWE 4KN4C 4A3KG 1X42A 1YIJA 1WTQA 3NSWA 1I3QB 2IMWP 4ED2A 5KAIU 3V05A 4HAEA 3G71A 4IC9A 2LMCB 5KFLA 1XC9A 1SZPA 3RF9A 1SJED 1SNMA 1PFSA 4UB2A 3T5KA 4UB5A 2I46A 5C0XH 4RZRA 3GTJB 4OCZA 1ZQAA 2AQ3B 2R7DA 3VCBA 3S1RB 1HZAA 5HHHA 2JEBI 3RRGA 5ALHA 5AM4A 1XMOL 3DWAA 2AGOA 3BQ1A 1RYRA 4FFDA 5DG8A 1QH9A 1ZQQA 4LAAA 3J7AV 4KX5A 2Y9TA 2X6GA 1XPUA 5ALLA 4KHPQ 4KLMA 3IM1A 2WF5A 4POFA 4R8IA 3NUQA 3SGIA 2F03A 3GTKB 2LKVA 3BJUA 5IGBA 5LMNL 4DR7Q 4QWEA 5J29A 5D4BA 5F9NA 2BE5D 3CMEA 3OPXA 2B29A 1BXTA 1QTMA 2KVCA 2AQ1B 2W9MA 1TWFB 2JYOA 1JC7A 4C3HB 3RJIA 1KHIA 3L3OC 4NM2A 1S4ZA 1V1OA 1G91A 4OHJA 1B1ZA 4NW2A 4Y7NH 2RDJA 3TAQA 9ICTA 1YNND 4HIKA 3LX0A 3R93A 4R9WA 5J0RA 2K04A 5JEAH 5KFTA 1Z6HA 2MUTA 3OTOL 1EYGA 2BPFA 3KHLA 2EYOA 1EY0A 4YXJA 1ENFA 2BA1A 1Y8PB 1ZQWA 2KA7A 3Q23A 4MFCA 5BN5A 1X9MA 4G3IA 4HIDA 2K5WA 3RD4A 4JG2A 1N5XA 5CYUA 2BCOA 4MIUA 4A3BG 1E2WA 2Q4TA 4DXFA 1ZQGA 4CBVA 4P4MA 3ALRA 3OSOA 1WYGA 1QCBD 5L1JA 3H0GB 3HOXB 4UAIA 2ZJAA 1STBA 4QUFA 2QCPX 2UUAQ 4PL2A 3GV8B 2BR0A 5M5XB 2HOQA 4HIMA 4BBRB 2QB1A 1WTVA 3T5LA 3THVA 2OTJA 1WD1A 1R9TH 4QZ8A 4O3MA 2FMPA 2F0QA 4DR2L 4RQ7A 3TP5A 1Z47A 2H5XA 3BU2A 3KF8B 5KFRA 2PW7A 5FLXE 3TBIB 2Y1IA 3KLSA 2QDLA 1NMFA 4DL7A 4M6WB 2JHDA 3I4NB 4YWLA 4XA5A 3WK9A 4C3JB 4ELTA 1OXXK 4ZKBB 3S2DB 1EY8A 4DV6L 2UVUA 5JJLA 1UT8A 5EKLA 2F76X 1QB5D 4LF4Q 4PZNA 4CRXA 2HCFA 2EY2A 2OQKA 1EZ6A 3GV5B 2MFIA 5J0QA 8ICXA 4UW9A 4G7OC 4IUTA 2KZZA 2ZIXA 4X6AH 3TEHB 4CDGA 5DNFA 5DBBA 2Q2HA 2N55A 4CDFC 2K4HA 3OHBA 4DFPA 4LF6Q 2N3SA 3RMHA 2HBLA 5DG9A 3LWLA 2XRSD 3ULJA 4RQ8A 2QA4A 3TQ1A 3RR8A 4DUYL 2KICA 4OGQC 2PFQA 4KHPL 4A3FG 2IOFA 2YTVA 2AU0A 4C1NI 3CCRA 1D1IA 4AYBG 3S14H 1O80A 5HHIA 1N33L 4IR9A 2EYMA 3VYTA 3FVQA 1JJGA 2JZBB 2B2VA 2F4VQ 4XYQA 2ES6A 3PIO3 4JV5Q 3I90A 3I4MH 2PCFB 4I65A 1NBWA 1RODA 4QZDA 2DGZA 3GDXA 5CV6A 3MABA 2W43A 2F0PA 3E3XA 5KFWA 2YMPA 1L1OC 1W6KA 2BA0A 2DNEA 2WTFA 5DBAA 5KG5A 5ELDA 2IWHA 2JA5G 4UB1A 2GLEA 1NR4A 2BQRA 1ZXIA 4PL1A 3RJHA 4ECUA 2F0HA 4DR4Q 5J2AA 3C23A 4C2MH 4R66A 1H38A 1JIHA 4JC0A 3NVVA 1V43A 3FHWA 2QARA 3C2PA 4EGVA 4PZ6A 1KFTA 4KLSA 3KHRA 4I7AA 5IYCG 1H95A 2EOTA 1VQ5A 9ICSA 5CBEE 3DM3A 4F4XA 3UI2A 5IE8A 5GAGC 7ICVA 2E8OA 3M8SA 8ICLA 2KSOB 3DUZA 1KABA 1B50A 2ASLA 4Q8EA 5EPJA 4UQGA 2KZ3A 3FYHA 8ICQA 1NTGA 2MUTB 2F0MA 1VCIA 1E0BA 1UE1A 2JA9A 3LWUA 5C4JH 4P4OA 4NL9A 1D1KA 4LVSA 3SXHA 4I2AA 1D5XC 1GHJA 1B4OA 2DFLA 2F44A 5KFYA 2BQUA 2F1MA 3ZDBA 4DK6C 2JA8B 3PUZA 5KYIA 1SMYC 4FP5D 2NYZD 4ZAIA 4C7YA 1RKNA 2V1CC 2ZIXB 3HKZC 4I2CA 7ICFA 1DOLA 3K5LA 3BZKA 4DOAA 1ZQBA 3BS7A 3QU9A 1GUOA 1V8QA 1BPDA 5AI4A 2L5TA 2XWBB 5DLQE 2XN9C 4UAVA 3MA2B 1AH9A 5KFJA 2WHEA 3DEEA 5CWRA 2PQAB 2HW3A 3FDSA 4M9JA 3N4MB 4OWXB 3SR1A 5C0XI 2CH4W 2B63G 1PRTB 4KKTA 2A3VA 2NRVA 4ELUA 3RZOB 3BDPA 1VQNA 5GQOA 2PMZC 1MN8A 3WKAA 3C21A 2ZTCA 2HVHA 1G6PA 8ICGA 3H8WA 1MQ3A 2K5DA 4I7ZC 5C0XG 3A8IE 5CR0A 3HPOA 2EYFA 1A6XA 5AI5A 3KKAA 1OO9B 5AM3A 1K3BC 4OONA 3GTJH 1BR9A 4AYBE 1EIGA 4KJOA 3L5KA 4QW8A 1JWMD 2N78A 1O08A 1JJCB 3NBIA 4UDUC 1VQMA 1XNQQ 3NK9A 2Q8TA 2EJFC 7ICJA 4KY7A 1LV5A 1ZQLA 2RSOA 1BPYA 1WTWA 2KKPA 3IL8A 4P72A 2B2YC 3AL0B 4JI1Q 1WCMB 2B8GA 1WUDA 2A1JB 3M9OB 1S97A 4KLQA 4APVA 1HR0Q 4RQ4A 2OTLA 3EUB2 4B3SL 2I5HA 4ODGA 3KUPA 2BKEA 3BDCA 1N36L 1CZWA 4IJHA 2ZIVA 2ICEC 4J1MA 4P0QA 4X65Q 1QUQA 4ZK9B 3GTMB 4A3GG 2MP1A 2EYLA 5KNDA 1NR2A 4A3BH 5AM0A 3OYYA 1X2IA 4ECZA 4P0PB 3GIIA 4ACOA 1QVCA 1Q12A 5GROA 4IRCA 3ZJYC 2RKSA 3C5GA 4YR2A 2IX1A 2YTUA
chains in the Genus database with same CATH topology
3W5OA 1WCMG 1XJVA 4JBWA 3W1GA 4PZ7A 1PH9A 5BR8Q 4R4TA 4UY8C 4LFBL 4K0KQ 3PO2H 1OXUA 3NEMA 5IWAL 3PO3G 2DGYA 4A3DH 5IP9G 4OO1G 3K0XA 4GLXA 3S1NH 3FKIG 4JI0Q 5M5XH 3HOZH 1N32Q 1Z9FA 3J81j 1X3FA 4DAYB 1IXRA 4R4IA 2YTXA 3S2HH 4DR3L 1E22A 3I4OA 4DR5L 3PV0A 1E1OA 4JOIA 4YCUA 2I0QA 5AJ3L 3F8TA 5C0XJ 4LF9L 3TQYA 4JBKA 4X66L 2UUBL 1S40A 5C44H 3J7A5 1IBKQ 2WB1G 5JEAG 4A3CH 1RIPA 4HIOA 1FJGQ 5C3EH 4EX5A 4X62Q 1PH2A 1K8AC 2CKZB 1PH5A 1XMQQ 4LF7Q 4DV4L 3S1QH 4BXXG 1Q81C 1VQDA 3UDXA 2WAQE 2QEXA 4DR5Q 1J6QA 4LF8Q 1KXLA 1SMXA 2UXCQ 4NB3A 1OXSC 2AMCB 5EAYA 2OWOA 4GS3A 1GO3E 4KLKA 4J15A 4B3MQ 2ZTDA 1HNXQ 2IT1A 1HNWQ 4IOCA 5ELNA 3GDEA 4DUZL 1Q82C 3HOVG 2MQHA 1IZ6A 2D0PA 1SFOH 4LF7L 3ER0A 1JJ2A 2E8GA 2Z6KC 3M9BA 3F2BA 3I4NG 2UXDQ 4LF8L 3PIPA 1IL2A 3GTQH 1K8GA 4BBSG 4MZ9A 4A75A 2Q2IA 4JI4L 3OTOQ 4JI8Q 4C3HH 1E24A 5M3FH 4A3FH 1WYDA 3HKSA 2YU9H 4BY1H 3KDFB 4RG1A 4DPGA 1PH4A 3GTOH 4QY7A 4PZ8A 1L2FA 3M4OH 2JA5H 1UWVA 4LF6L 4BA2I 1ASYA 3OW2A 2JA7G 3D31A 2UXBQ 1NY4A 4DV1Q 4LF5L 4IPHA 4JI0L 2NVQH 1YNXA 2GVAA 2VY3A 3PUXA 1QVGA 4JI5Q 1N32L 2ZM6L 1X54A 1A63A 3U50C 4PMWA 3J80c 1PH7A 1PYSB 4A3CG 4DV0Q 2N49A 1IBLL 5C44G 3CCMA 3CC7A 1AE2A 1K83H 4OX9Q 4A3LH 4OO1I 5GAHC 1VQ9A 4X66Q 2ALYB 4DR1L 1N34Q 3AQQA 4L5QA 5ELOA 4DV5Q 2XTIA 1LUZA 1TWCH 5FLMH 4C3IH 1YHAA 1HR0W 1K0RA 1Y1VG 4A3LG 3ULPA 4BBRH 4QJFA 2ATWA 3HFZB 3RR5A 3HOZG 1QZGA 4DR6L 2NVYH 4A3EH 4B3RL 2NN6I 1TWFH 2RHSB 1SN8A 1E3PA 2CWAA 2E2HH 2ZJRA 2UUCL 2MO1A 4GOPA 1W3SA 3PO2G 1MJEA 1HNXL 1HR0L 3AFQA 1HNWL 2VUMG 1LM0A 5J3BA 1OXTA 4DK3C 4GN4B 3S24A 1QZHA 4A3EG 1O7IA 2RF4A 4QL5A 3U4ZA 1XPOA 3CC2A 2PQAA 1KD1C 5IYBH 1CKMA 4BBRG 1EUJA 4AQYL 4MNOA 3K7UC 3U58A 3K8AA 1HJPA 5IYDG 3F1ZA 3S17H 1WFQA 2VZAA 1VQIA 2KCTA 3EBEA 5IP7H 1CUKA 1LTLA 2IHFA 3UE1A 1SRUA 4WJ3M 2JQOA 3M4QA 3I2ZA 4DR2Q 3G48A 2VUMH 1VQFA 3STBC 4EQ5A 1VQKA 1HZ9A 4LFAL 3CCEA 3H3VI 2R93G 1IBML 2VL6A 1HZBA 3AYHB 3TRZA 3NBHB 2BH2A 3CD6A 2JA6H 4HJAA 3T1HL 1A0IA 1GD7A 5JJKA 1YHBA 1GKHA 2UU9Q 4JI3Q 4JV5L 4JI2Q 2UXBL 2OQ0A 2HHHQ 4A3IH 4DV1L 3S1MH 1CKOA 3A0JA 2B63H 4DR7L 4O0AA 2R7ZH 5M3FG 3D0FA 2JK8A 4L5TA 5IWAQ 4IO9A 1YHQA 1ASZA 2QGQA 4UPAA 1YEZA 3CCSA 1UE7A 4OX9L 4NPSA 4DR1Q 2ES2A 1XPRA 4DUYQ 1CKNA 4DR3Q 2EIFA 3I4NH 1VQAA 1S3OA 3HOVH 1K3RA 1C9OA 1EQRA 1SROA 1X65A 1YJWA 1N36Q 2CWPA 4NXNL 4GKKQ 2A19A 4GKJQ 4LFCQ 1KAWA 4GN5A 4HJ8A 1PA6A 2NZOA 1XTDA 2K75A 1WI5A 2YTYA 2KBNA 1OTCA 2UUCQ 4LF5Q 4O2DA 4X64Q 1JMCA 4B3ML 1OXVA 2KHJA 3E9IA 2KCMA 1Q86C 4B3TQ 4DV4Q 4WJ4A 4OWTB 3PUYA 5C3EG 3AFPA 1JB7A 3GTGH 1BKBA 3RLNA 5M3MG 3CF5A 4GOPB 4IFDI 2LXJA 1QUQB 4GOPC 1EIYB 4YY3L 2EDUA 2IX1A 4A3KH 1KIXA 1YZ6A 1G291 5IP7G 1VQLA 1X55A 3PF5A 3M3YH 1RL2A 2VQEL 1X6OA 3CMAA 4DUZQ 1XNRL 4JYAQ 4JBMA 3CP0A 2VQFQ 4POGA 3KJOA 1PH8A 3STBD 4L5RC 3HOWG 3PGZA 3PUWA 2F3IA 4GNXB 3M85A 3TREA 4DV3L 1YBYA 4A3DG 1L1OA 2K5NA 4MTNA 5GADC 2VS1A 3CAMA 4A3JH 1UE5A 2UU9L 4NXMQ 1VQ7A 1WCMH 1G51A 1U5KA 1U0LA 2I5LX 3PO3H 4LF4L 3CXCA 4P75A 1P8LA 2KHIA 1TWAH 2N8NA 4XTCS 1LYLA 4TQUS 4GN3B 3E0EA 2K5VA 1IBLQ 2AWOA 3EN2A 4AIMA 4A3GH 3H15A 4DV7L 2MNAA 4DR4L 5GAEC 4A3IG 1CKNB 1E1TA 1KRSA 4LUVA 3PUVA 2A1AA 4BY7G 1NE3A 1BBWA 2NVXH 3I4MG 3KJPA 3VDYA 3JAMc 1PV4A 2JJQA 2R92H 1EWIA 4UP7A 1FL0A 3NENA 3J80i 1SR3A 4JI2L 2K52A 4DKAC 3CPWA 4B3SQ 1TWHH 3JAMi 1CSQA 3H0GG 3HOXG 1VQPA 2JA7H 1VQGA 2YYZA 2Z6KA 3UDGA 3CW2C 4X62L 3I7FA 3HOUH 1JE5A 3FP9A 1B8AA 4JI8L 4B3RQ 3GTLH 2WFWA 5FLMG 2JE6I 3PSIA 3UDFA 1N33Q 2IX0A 2E2IH 1Y14B 2Q2TA 2K4KA 4OXPA 2MO0A 3LGJA 4YCVA 1L0WA 3G4SA 4QIWE 5LMUL 4A3KG 1YIJA 5FJ8G 1KQSA 4QGUA 3G71A 1D7QA 4JBJA 4LUZA 1T9HA 2RCNA 2ZJQA 1PFSA 2GN5A 2ZM6Q 2R92G 4DV2Q 4R1JA 2F52A 2UUAL 3S1RH 2R7DA 2NVTH 1I94L 4R4QA 1HZAA 4YWKA 3CC4A 2JEBI 1CSPA 3T1HQ 4JOIC 4LNQA 2CQOA 2NN6G 1XMOL 1VQ6A 4YCWA 5JJIA 3GTPH 1PYBA 1XPUA 2K14A 4KHPQ 5IYCH 2OCEA 1I5FA 4POFA 3CCJA 2UUBQ 3SGIA 1X9NA 3BJUA 4P73A 4XIGS 5LMNL 2B3GA 4DR7Q 3GTKH 3B6YA 4A3JG 1BVSA 5E7NA 1FGUA 1I6HH 3GD7A 3CMEA 2LXKA 4A3MH 3RLFA 2ASBA 2B29A 1VQJA 1VQOA 4QQBX 4IJLA 3KLWA 3PCOB 4ALPA 1KC8C 3RZOH 1KHIA 4R4OA 4DV3Q 1M1KC 2AHOB 3KOJA 1VQBA 1X56A 3FKIH 2JA6G 4A3MG 3RNUA 4H02A 3I56A 4Y7NH 2HT1A 4PG3A 4HIKA 1DGSA 1Q46A 1K73C 3OTOL 3HKZE 1EYGA 1Y1WH 1V1QA 2E5LQ 1I50H 1IYJB 3MEFA 2BA1A 5FJ8H 1GVPA 3KF6A 4IOAA 4HIDA 2K50A 5C4XG 4JG2A 1J5EQ 3AEVA 5HY6A 5HGQA 4A3BG 5IYDH 5M5WH 3S16H 3M7NA 3KDFA 1NMGA 1PVOA 4IPCA 2EQSA 3KF6B 2R7FA 3H0GH 5IY0A 3HOXH 2D62A 3J81c 2UUAQ 1A8VA 3IRBA 4A93H 1FVIA 4HIMA 3TS0A 2OTJA 1W2BA 3JC66 1E7ZA 2VW9A 1EIFA 2GVBA 4ME3A 5IP9H 2EXDA 1TWGH 3KYHC 2WAQG 4P71A 3F2CA 4HJ9A 4JI1L 1R9TH 1XNRQ 5JEAJ 4DR2L 1XNQL 2ZJPA 1SE8A 1Z47A 2H5XA 1PH6A 3BU2A 4DAMA 2Y0SG 3KF8B 4GNXA 3A74A 1NMFA 5IYBG 4YWLA 3RN5A 1OXXK 2UXDL 3CCVA 4DV6L 3J7ZC 3GTMH 2IY5B 2HHHL 5JJLA 1V9PA 1UEBA 3I55A 3RN2A 1VQEA 2Q2UA 2JA8H 4LF4Q 1KRTA 3F2DA 1N8RC 4IPGA 4TVAB 4DV2L 2MFIA 3HOYH 3K7AH 3M4PA 1Q1BA 1PH1A 4A93G 4BA1I 4X6AH 3TEHB 1WOCA 2Q2HA 4IFDG 3MXNB 5BR8L 2CCZA 3Q8DA 4LF6Q 2F4VL 2N3SA 3J81i 2HQLA 4P74A 3ULJA 4DUYL 2QA4A 4DV6Q 1JT8A 2RHQB 1M90C 2VQEQ 1MKHA 2AWNA 4FDBA 1K9MC 4JYAL 4JI7Q 3CQZH 1A62A 4LUOA 4BY1G 4A3FG 2YTVA 4KHPL 3L0OA 2E5LL 4LWCA 3CCLA 3CCRA 3HOUG 4AH6A 4AYBG 3S14H 1C0AA 3HKZG 4DV0L 3A5ZB 1N33L 2D0OA 1HZCA 2VNUD 2KENA 3ULLA 5AJ3Q 1JJGA 1PH3A 3ERSX 5M3MH 4X64L 4LF9Q 2LSSA 1B70B 2F4VQ 1N9WA 4JI3L 3A5UA 3CCQA 3HOYG 1Q1EA 4JV5Q 4B3TL 4JI6Q 3CCUA 3I4MH 3KFUA 1NBWA 1S72A 5LMNW 3RLOA 4BY7H 2R6GA 3G6EA 4GNXC 2HIXA 4DR6Q 2BA0A 1BBUA 1L1OC 3HOWH 2JA5G 2I5MX 3EIVA 3PIOA 2HIVA 3S2DH 4KHZA 2ZTEA 2UXCL 1KL9A 5FLXc 1FJGL 1EOVA 5C4XH 4C2MH 4DR4Q 1Q8KA 1B7YB 2WB1E 4JC0A 1V43A 4LW1A 1XMQL 3FHWA 1GM5A 1VQ8A 4UP9A 2AKWB 4PZ6A 1YITA 1Y1WG 1I3QH 4AQYQ 3TS2A 5IYCG 1XMOQ 1H95A 1VQ5A 1D8LA 3ICEA 2XGTA 3DM3A 4UP8A 3L7ZC 5IE8A 5GAGC 1Q7YC 4L5SA 3U4VA 5K36G 1AE3A 4YWMA 4A76A 4NXNQ 1NTGA 4GKJL 2YV5A 1VCIA 1UE1A 2JA9A 3K80C 4LFAQ 5C4JH 1YJNA 2JEAI 1C7YA 2IHEA 1EQQA 5M5YH 1HNZL 3S15H 2E2JH 3WWVA 5LMUQ 4DK6C 4JI4Q 4BXXH 4BBSH 3PUZA 2Z0SA 4YHHL 2NZHA 1IBKL 2V1CC 2K5HA 4JI7L 2PI2A 3UDIA 3BZKA 3L2PA 5DLQE 4YY3Q 1MJCA 4IPDA 2R7ZG 1UE6A 2BH8A 5IT9c 4IFDJ 1HNZQ 1AH9A 1I94Q 3PF4A 3NELA 2PQAB 3E9HA 3BZCA 4RMFA 3K81C 4OWXB 2CFMA 1YJ9A 4JI5L 2B63G 5C0XI 4NXML 4HJ7A 4JI6L 3UE0A