2BZFA

Structural basis for dna bridging by barrier-to-autointegration factor (baf)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2bzfA00
2EZXA 2ODGA 2BZFA 2EZZA 1QCKA 1CI4A 2EZYA
chains in the Genus database with same CATH superfamily
4JV0A 2F8LA 3CP8A 3TKAA 3C28A 1WCNA 3ZDDA 2A1JA 1QQ5A 1RYRA 3A0HU 4Y2SA 3HILA 4C8NA 2HVIA 4UW9A 4UAYA 1HEKA 2VA8A 5AM4A 5DB9A 4LZGA 2AXTU 4P2HA 1NKCA 2JHDA 2YN4A 3HKZC 5DG9A 5DBCA 1ZRNA 4RPXA 1PVPA 2BGWA 2P6RA 5HP4A 5KG7A 4R63A 8ICVA 2G09A 2ODGA 2CPRA 1ZD4A 2RHFA 2A1AA 5J8YC 4CF5A 3SAHA 1RXWA 2E1EA 4DCCA 5KFQA 2HCFA 1Z00A 2E8MA 2AGPA 2FMQA 4EENA 2E8PA 5J8YA 2BPGA 5J2HA 1KN5A 2FPLA 4OJPA 2XY5A 4QZGA 1SV4A 3QE9Y 4F4XA 4RQ2A 2KVCA 4RU9A 5KFXA 2DKXA 2AGOA 1M6YA 2MRLA 5EE9A 2J6TA 3ISCA 2W9AA 7ICNA 4CF3A 4EZ6A 3RAQA 3MGVA 4UB6U 4R8UA 3IV6A 4B9SA 1T3NA 2W03A 2K8CB 4ECXA 1TFRA 2EZXA 4ED0A 4Y2TA 3MGIA 1TK8A 2ZIVA 1L3SA 4YXJA 2R8GA 1ZJMA 1Z4NA 2YTUA 3T3FA 4RUAA 4F5PA 3NASA 1JMSA 4LZDA 1RDFA 3L3FX 3PW0A 5CR0A 5AM1A 5KT7A 1KRPA 2BCRA 3H8WA 4X5VA 2NRZA 4MFCA 2W7PA 2NRVA 1XS9D 1NK7A 4MEYA 2H3QA 4O9MA 5AKYA 4NLKA 3WKEA 2AHOB 2JGAA 2DFLA 1SXDA 4BXOA 2HHVA 5D46A 3VCBA 4GC7A 9ICQA 3C5GA 2WF5A 3F5AA 2Y9UA 4DL4A 2HHWA 4NLGA 2DPIA 3SENA 5ALJA 2GLEA 4DFDA 2FLPA 1QQ7A 4O3OA 1F0MA 5HHIA 3UMCA 4F4WA 1MQ2A 3RJHA 4NLCA 3AQFA 2YMQA 2AGQA 3GQCA 2XICA 5KFNA 5JUMA 1SXEA 4M2YA 2ATLA 3FAHA 3J81j 1Z3EB 4CNQA 1WWVA 4Y2RA 1UPHA 3RF9A 2KTQA 4YR3A 4PL1A 2JRZA 2YMPA 4DSIA 9ICCA 2XVTA 1L7PA 4NWIA 3PVXA 1QTMA 2JZBA 3ZDEA 3ETLA 4UAZA 2BZFA 4R64A 5KG6A 2WTFA 3QEAZ 4JV2A 1TE2A 4QWBA 5KT3A 3TANA 7ICEA 1D8LA 2LI6A 2V4QA 1ZQQA 5J0QA 3E0FA 3HJEA 2LPEA 5KFAA 1YZ6A 3BQTA 1NNLA 1SL2A 7ICKA 2YY6A 4M9HA 2R8KA 5ALYA 2KNJA 3EUB2 3KBBA 3CRXA 3H40A 2C2EA 4I2DA 1QSSA 2BQUA 4YMOA 3G6VA 2ZJ8A 1X6JA 4I2IA 5J2IA 2F77X 2IBKA 1K1SA 2G08A 5ALWA 3GV8B 1NK5A 2PXIA 1COOA 1FIQA 1LVHA 4B6JA 4P0QB 1ZQGA 1XU4A 2H3VA 1WG8A 2JEIA 1V38A 4DL6A 5EE0A 4NL9A 3H4DA 2F1JA 5EOZA 4QZDA 4RPYA 4YXMA 1Q8KA 4DO9A 4F5NA 5AM2A 3JPQA 3PO5A 3KHLA 4Z6FA 4Q45A 2BDPA 4OJ6A 1KEJA 3QZ8A 3RB3A 4EEKA 1N5XA 5J2JA 9ICXA 4DOCA 4F8RA 3GILA 2DF4B 3AM9A 3PMLA 2I1QA 1Z1VA 2WB1F 1PK1B 4UB5A 3ZD9A 4M9LA 2IA6A 1UA1A 4BWMA 2VJ4A 4QZHA 2FPMA 1WCLA 1QQ6A 2ZUCA 5KFPA 5IIKA 2I6XA 5DB7A 4P0PB 2DUYA 2J6UA 1DK2A 5GTHU 3LWLA 4UB3A 2IMWP 2IHNA 4F4KA 8ICRA 4R8UB 4GXIA 3K75D 3M1YA 5KL8B 2JEGA 1NZPA 5J2GA 2HBLA 4E0DA 3L4PA 1C20A 1RQNA 1ZQUA 5AI6A 4KLGA 4RQ1A 5ALOA 3QUQA 2KKVA 3RFAA 2VIXA 3KOOA 5B66U 4Z6CA 5KNIA 7ICJA 3EYZA 1VLBA 3NVZA 4R66A 8ICFA 2HSZA 7ICOA 2L5YA 4EEYA 5AKZA 3H8SA 2WAQF 5KAFU 4EZ9A 1ED1A 2NRXA 3H0LB 1KL9A 4QZ9A 5KT5A 4O3QA 5HHHA 1T4GA 3D2QA 1J2NA 4AYBF 1NI3A 5ALPA 5L1MA 3PSTA 1U4BA 5KFZA 5J2FA 1UCVA 9ICJA 4M9GA 2LBOA 4C7YA 4YR2A 7ICQA 4UAVA 2H3IA 1SWWA 1O08A 4TUPA 5ALTA 3ETRA 5ALEA 4O3MA 3OSNA 2WFAA 3HWTA 1DK3A 1N62A 1UQVA 3I28A 1RYSA 3AL0B 3KKAA 4O5KA 2F1IA 3C5FA 2KZMA 1YZ7A 3ONNA 3SMVA 2EZYA 2VJ5A 1X6IA 2YB4A 2H3FA 2K60A 5DBBA 2XY6A 5J2AA 1QSLA 3ALRA 1IXRA 2MU2A 4QIWF 5KG3A 4NV0A 2VANA 3F2BA 3IDWA 3K1ZA 1PK3A 1WWUA 2YMMA 3IRUA 4DWIA 3RBDA 3ED5A 2OXOA 4J9SA 5KFLA 2QARA 2VKQA 3F2CA 2FDRA 3LYSA 3B0YA 3GV5B 3SYZA 2Y0SF 2W9BB 3N7PD 2A3VA 5D49A 4GIBA 2R18A 3BDPA 3QX7A 3T5HA 5DBAA 5DLGA 3TADA 4QWEA 5HR6A 1X9SA 1B43A 2W43A 3QUTA 2Z7JA 4J03A 5AIAA 1SZHA 3H8JA 1U9LA 1KFTA 4YD2A 2HDOA 3KFUF 2FLNA 2FI1A 2WF8A 1ZOLA 3T5LA 1ZQOA 5KFHA 5AM0A 2B0CA 2F2AB 4DF4A 5ALVA 2YMLA 2OYYA 2W8KA 2HOQA 9ICVA 1X66A 3Q8QB 3C29A 4TQSA 1IV8A 4F5RA 4XRHA 4NY8A 3KD3A 5AK6A 3N4MB 1MC8A 4NJ8A 8ICLA 4HYKA 2ZIUA 4DSLA 4DQQA 2JMGA 3H4BA 1S10A 2Y0SC 5ALFA 4IRDA 3KKAC 1PUZA 4FZNA 1PVRA 8ICUA 3Q8LA 3OSPA 5AKLA 5DB8A 2W11A 8ICTA 4KLTA 5L1IA 1YT3A 2W55A 3D6JA 4M9JA 4US9A 3NVWA 2HMXA 1NKEA 4CDGA 4KLSA 4UBBA 2ES6A 3S6JA 5KFRA 1LKYA 1SV0A 3LK9A 3SD7A 1ZQZA 1LV5A 4ED7A 1N56A 3WU2U 1KBUA 4ED8A 5HR7A 1RXVA 4ECTA 1ZQAA 4NM1A 2ZTEA 2DWQA 4F91B 2CN1A 3V6JA 3OGUA 5IIOA 1KKXA 4ECRA 3LVWA 5BPCA 1NK9A 4DQPA 1CRXA 3NTUA 5K4LA 3H0MB 1SIJA 1T8EA 4KLEA 3C23A 4DQSA 3ORYA 3UQ0A 4Y2PA 2K8BB 4IQWA 4WJ3B 2NO5A 1N63A 1S8OA 7ICPA 3AN1A 2D8CA 8ICXA 2W9BA 3MFIA 4K4GA 3TARA 4YMNA 2UVVA 1PK1A 2QARB 1ZQVA 4YCXA 4UBCA 2XCAA 4QIWC 5KFTA 2KJ5A 4YVZA 3TAQA 4ECYA 5HMMA 7ICMA 5AK5A 2D6FC 5AK4A 2KV2A 1TAMA 3OHBA 3RJEA 1V97A 5IIMA 5J2BA 5H2FU 5L1JA 1ZQPA 1S97A 1CUKA 5ALLA 4O0IA 1Q3VA 4ELVA 4C4SA 4XQ8A 2LM4A 2C2RA 4Y2YA 4RNOA 9ICUA 4YFKA 8ICWA 5KTQA 2NO4A 3B0XA 4P0QA 2KFNA 5KG2A 1Z00B 5DGBA 8ICAA 2KKPA 5KFUA 3RR8A 2K8AA 4BX9C 2JEJA 3PX0A 1MA7A 4Z6DA 9ICGA 3PSPA 3M8RA 2M9NA 4XUSA 5IINA 2R8JA 1ZQYA 1ZQMA 5AKHA 4ECWA 4B9NA 4OJOA 5AI0A 4EBCA 4A8EA 4QWDA 9ICSA 5JTIA 1U45A 4Y2UA 3RH6A 2LMRA 3V7JA 4ED3A 1X2IA 3HX0A 3BJYA 3V6KA 4TURA 1JROA 3OTQA 3QUBA 5FP0A 2HHXA 2A1JB 2WB1C 1ZQSA 3ZDAA 4C0ZA 4ED1A 4B9UA 1XSPA 3BQ0A 3SQIA 1Z1BA 3RRHA 2ZIWA 3T79A 3RH4A 8ICCA 3BS5A 2KEYA 2KN7A 1JI7A 2MA1A 5EE1A 4F71A 1Y88A 3PV8A 4YMMA 4MF2A 4NLNA 1SKSA 2RRDA 1C7YA 4PHEA 3RRGA 5F9NA 2EAMA 1ZD3A 4CGZA 1JRPA 1T3QA 4DQRA 1Z4OA 1ZQFA 1ZQIA 4O3SA 2Y9TA 4BWJA 4P0PA 2Q4TA 3LVVA 2DBYA 7ICUA 2ASJA 2RLTA 1MN8A 2ZIUB 3OPXA 2BCUA 4Q8FA 4ECQA 3PW2A 8ICEA 4F93B 9ICFA 2DKZA 3UXOA 3NVVA 8ICMA 1B22A 4FBTA 2BCSA 1NKBA 7ICHA 2Q0ZX 2QLTA 3B9JA 2V4RA 5L1LA 4R65A 4P4OA 5J0XA 3DV9A 2BCVA 5KFBA 4CRXA 1DGJA 1HUZA 2DGZA 5EWFA 4ECSA 4DL5A 4DQIA 4BGDA 3O0FA 1P7DA 1BPDA 1BVSA 3L5KA 2OWOA 2D3DA 5DG8A 2PFPA 3C2KA 3M9MB 2LYHA 1L3VA 3GIMA 4UB1A 1K1QA 1IIPA 1ZD5A 4Q43A 1JN3A 1N2XA 4QW8A 2HBKA 4IR1A 5T14A 3PMNA 3ICXA 3KTQA 5BOLA 3WKBA 3LWMA 5AKIA 2QB0B 3R9KA 4O5EA 4QW9A 4RQ8A 3M7DA 1TV9A 4ECVA 3SR6A 4C80A 4P4PA 3PR4A 2WHEA 5ALDA 4BJQA 1Z19A 2BHNA 3WK6A 5AI5A 1X9XA 2K4EA 1ZQ1C 3N7RC 1BPXA 2I9GA 2Y1IA 3QU7A 5KFFA 4QNLA 3HT3A 3MGHA 4KLUA 2AQ0A 5KT4A 1ZQLA 1D8BA 3C1ZA 5KFVA 3TAPA 1WYGA 5KFEA 4F4ZA 5AKEA 4YQWA 1KTQA 4UAUA 3WKDA 4O3NA 1OUQA 2DPJA 3QU2A 1BPEA 5ALNA 1ZQWA 3M8SA 1XNSA 2EAPA 4ACOA 3MABA 1SV0C 2UVRA 4KLIA 3JPPA 5AI8A 2XI9A 9ICBA 4FS2A 9ICTA 2KSOA 1EXNA 3IN5A 3T5KA 2LM1A 4KLMA 3SI8A 1JALA 4NLBA 2G06A 8ICQA 5C0YA 5KFMA 2F1HA 3C2LA 5F9LA 4XA5A 2EANA 2ZXHA 2MAXA 8ICHA 4FZMA 2KZ3A 1KSPA 1LKYB 1SB3C 2NRWA 3K1RB 4DSEA 1F5SA 3NS1A 4PHAA 3QEBZ 4CCHA 1XSNA 1FO4A 1S77D 1NZBA 2W8LA 3EPIA 4YN4A 1GO3F 5AICA 4NXZA 1KQQA 3C21A 5CEHA 5EWGA 1D8YA 1ZQCA 4I28A 3I76A 9ICWA 2VA2A 4TUSA 9ICIA 2HOFA 4YR0A 1QCKA 2WF7A 2KMDA 1Q46A 1BNPA 2ASDA 2PFNA 2EAOA 3UMBA 2NV3A 3IP4B 1UHUA 3D2SA 2R8HA 4RT2A 1ZQRA 4QZFA 1AROP 3V7LA 2WAQC 3PW5A 2W3RA 5J2EA 2H3ZA 4IRCA 5KG5A 1UA0A 2OCEA 2ZIVB 3HPOA 1MSWD 4OCZA 5DGAA 2GOLA 3KZIU 4US8A 4DFKA 4M47A 2O6KA 2YX8A 1IG6A 2W7OA 2HI0A 4DOAA 2XY7A 3U26A 3PNCA 3OJSA 4J9NA 1TVAA 1JUDA 7ICVA 2MSNA 4UATA 3UXNA 3EPGA 3GV7B 4GC6A 5KT2A 4RQ6A 3KHGA 2LYBA 3I1YA 3BQ7A 2HHTA 1T7PA 9ICNA 5JRTA 5GTIU 1QH9A 2ZJAA 3TACB 1NK4A 2HHQA 1ZRMA 4ICAA 5EE3A 4RUCA 5KFWA 8ICZA 4F72A 1DRGA 4RQ7A 2KIWA 5DQIA 5CRXA 2AJQA 4IS7A 5ALSA 1KLNA 4JWMA 1UT5A 2LKYA 3WKAA 4LVSA 1S76D 2XIDA 4IQVA 5AI9A 3PR5B 2OHFA 3WK5A 3MR5A 5JU5A 3CW2C 3IG5A 5KFOA 3RAXA 4EYHB 4JWNA 4I2EA 4EBEA 3E58A 4Y2XA 4DEZA 2BPCA 4O3PA 5J0TA 3WK9A 2GO7A 9ICKA 4GXKA 4OD0A 4C4RA 4MFFA 1TAUA 4EYIB 4KX5A 5KT6A 2E3TA 8ICYA 4Q44A 3IM1A 4ELTA 3C1YA 2E1FA 1TAQA 2JH7A 2ZUBA 4DOBA 4RQ3A 3G6YA 3QU5A 4JMUA 4PHPA 2ISPA 5ALMA 2G07A 4I2JA 2HBJA 3BQ1A 5KFJA 4F5QA 1F44A 2HHUA 3JPNA 1A0PA 5J0YA 8ICBA 2EH9A 4F3OA 5ALHA 3Q8PB 4FE3A 1DGSA 2ZIWB 1MQ3A 1XWLA 2RP5A 4OJLA 4CF4A 5BOMA 4DFPA 4F2SA 2C22A 2GH1A 1NJZA 3FDSA 3FM9A 2KICA 2ZG6A 4M6WA 5KL1B 1NK8A 1L5UA 3BS7A 2E5SA 2MUTA 5AM3A 2RDJA 1COKA 4KN7A 3Q8MA 4I2CA 3SV4A 4PGQA 1VDVA 3MR2A 1NJXA 4UAWA 5AKXA 2FLLA 4M9NA 4I2FA 2B21A 2HVHA 2WF9A 1TKDA 3OJUA 4J9MA 1S0VA 1XO1A 4KX3A 1N5WA 4FS1A 2K89A 4RZRA 3V7KA 3RJIA 4MHVA 1U48A 3RJGA 2G5IB 4IQTA 4ZH4A 4BDPA 7ICLA 3RJKA 5ALXA 2ZXIA 2K4PA 4DLGA 2N1RA 2ZIXB 5CP2A 1JIHA 2Y1JA 4DL2A 4QZIA 5KAIU 1U49A 1L8OA 3M6ZA 4DSKA 1NK6A 4AYBC 4IRKA 2NRTA 1L3TA 3HRDD 2FMSA 5J29A 4UB2A 4DSJA 3SEIA 3FYHA 3RTVA 1RYUA 3GU3A 4ECZA 5CWRA 3ZI4A 1RM6C 1HIWA 3NVYA 1SL0A 4K4IA 3ZD8A 5E79U 4RPZA 3Q8SB 3RJFA 4J9QA 9ICRA 1ECWA 2OM6A 8ICJA 3AQEA 4OJ5A 3RJJA 5DQHA 3ISBA 1SZPA 2FJ6A 2P6UA 2KZZA 1QSYA 2F76X 1A76A 4GLXA 5ALGA 4J9OA 4KLHA 3CYMA 4RQ4A 3KZXA 1O03A 3KHHA 1OXJA 1J2MA 1NJWA 4KLFA 1KW4A 2HOIA 3VC8A 3KHRA 3EWAA 1NK0A 4YG2A 3RB4A 1FFUA 3PX4A 1X9MA 2QB0A 4C7ZA 4KTQA 3M9OB 2BCQA 3E2EA 5J0RA 1SGGA 7ICSA 3Q8RB 1L6NA 1T94A 2CRXA 2CXYA 3AUOA 2G0AA 2KG5A 4C8LA 3H7IA 4Y2JA 5AM5A 4KITB 4IC9A 4QWAA 4I2GA 2QKQA 2M0NA 3BZCA 2PMZF 3C2MA 2KJ8A 3NUQA 1X9WA 1HUOA 2BQ3A 2IOFA 4ELUA 9ICPA 5TZVA 4PPXA 2AH5A 4B9VA 3GFKB 1SWVA 2F44A 1ZJNA 4GXJA 3RR7A 3RB0A 3AU2A 4QZAA 4Z6EA 1Q3UA 4C8KA 1ZQJA 4HAIA 4QZ8A 1L7NA 1L8LA 2KSOB 4TQRA 3JPRA 4B9LA 1B4FA 4YD1A 2PI5A 1K5OA 2HHSA 4KLOA 3A0BU 2IOHA 3GZFA 3UM9A 1CEZA 5IILA 9ICLA 1ZETA 3WK4A 1XO0A 9ICEA 4M04A 5KG4A 5G5GA 2JH1A 3PX6A 1ZQBA 2ZUDA 3MR3A 2V9WA 4NM2A 4MFAA 2KP7A 4C4TA 3G6XA 1XC9A 2K4IA 2NYVA 2I5HA 3H0RB 3LDAA 4RQ0A 4QZCA 1JXLA 2UVUA 2E8NA 9ICMA 2FMPA 2KIVA 3QXGA 3RBEA 3H8MA 1H38A 5KFGA 4F92B 4AP9A 2EDUA 3UXPA 3TADC 7ICGA 3QZ7A 3D2NA 1UT8A 2KD1A 4DLEA 2FPKA 9ICAA 2B6GA 1KFDA 3MDAA 3HKZF 4RQNA 3OHAA 1S0OA 4IL6U 5L9XA 4Q8EA 7ICTA 2KJ9A 2PI4A 2JR5A 2RDIA 2AU0A 1KDHA 3V72A 4DS5A 4IQUA 2WF6A 5J0WA 4RNMA 2OEHA 4KLQA 3AMZA 1N61A 1TK0A 2R8IA 1SL1A 1RQLA 2KFZA 5AI4A 2G5HB 1BPBA 4K4HA 4FZLA 5AHXA 2HW3A 3ZDCA 4U7CA 3THVA 2EQYA 1ZQEA 4P4MA 2BKEA 5HMLA 5KFDA 2LHTA 3PZPA 1B0XA 4KMUA 2ASLA 1D9FA 4RQ5A 2DL0A 1ZQDA 2GWSA 1NJYA 2LYAA 2BQRA 3RB6A 2DQNB 5KFYA 2RQ5A 2K4HA 4KN4A 3TQ1A 8ICKA 5DDYA 2BPFA 2H5XA 1HJPA 4QZEA 2XC9A 3MFHA 3N97B 5ALIA 2P35A 2ALZA 3DEEA 3NRZA 4I2HA 2W9CA 3WK7A 1J97A 8ICGA 4DL3A 3QU4A 2J6SA 8ICOA 1N48A 4LJXA 5AKGA 4QWCA 3V6HA 4DS4A 4BUGA 3NGDA 2KHVA 3MR6A 2AQ4A 7ICIA 2IOFK 4J9LA 4KLLA 3F53A 3MDCA 1DXSA 5DKWA 5B5EU 2JEFA 4PH5A 4PGYA 4C8MA 5D4BA 3GIKA 1RZTA 4EX6A 2ISOA 1RPLA 4OO1J 5J2CA 4F5OA 3IHQB 4PZNA 4UB8U 4KMOB 4PJ0U 2XGQA 4NL9C 2UVWA 1QLNA 4EX7A 2W9MA 1ZYQA 3GIJA 2ZTCA 3TFRA 4G9BA 3N28A 1L7MA 5IIIA 3EZ5A 1XSLA 2XCPA 1TK5A 4B9MA 1AQ6A 2JV3A 2W9CB 2OH2A 3Q8KA 1X42A 4JV1A 3UMGA 3DDHA 4UARA 1BPZA 2W3SA 5KFSA 3PSIA 5DQGA 5KFKA 2C2DA 3T5JA 4USAA 4ED6A 3AU6A 1U47A 1PVQA 4JK1A 1ZXIA 4BXOB 5AKKA 2P66A 4PZOA 3HP6A 2VA3A 2BR0A 1VJ5A 4UASA 4ECUA 5CB1A 9ICOA 4J9RA 5J0UA 2FE9A 4PHDA 4G3IA 3SAGA 1JXEA 1X40A 4Y2QA 2HBMA 4QZBA 4KLDA 5CHGA 3BQ2A 2QB1A 2KK0A 3MBYA 3GIIA 1ZQNA 1BNOA 4RT3A 3PW7A 8ICNA 3TFSA 1SKRA 2XO7A 3MC1A 1IM4A 1OW5A 4C8OA 4B9TA 2C28A 4DFJA 5DG7A 3IG8A 2JZBB 5J0OA 2W04A 1FEZA 5IIJA 3EW9A 4YP3A 3NRWA 1BGXT 4MF8A 4UB4A 3RH5A 3F5EA 3SZ2A 3PY8A 3PO4A 5J0PA 5F3XB 5ALKA 4I29A 5KFIA 1L7OA 5ALUA 4ZOHC 5TISU 4J9PA 4ED2A 4MEXA 4KLJA 2KE7A 4PGXA 5CJ7A 1ZQXA 2KVSA 2ZJ5A 2KHQA 1KFSA 1V9PA 4RNNA 4DFMA 4NLZA 4EBDA 2PMZC 2PFOA 1V85A 4PL2A 8ICSA 2MUTB 3HW8A 3QU9A 4F50A 4F2RA 4JB3A 3BS5B 8ICIA 3M9NB 3JPOA 5KFCA 4DL7A 1L3UA 4RQMA 3JPSA 4JUZA 5J2KA 5G5HA 4DF8A 4O5CA 7ICRA 3SV3A 5DDMA 5DLFA 3QNMA 8ICPA 1S5LU 1A77A 5J2DA 1JX4A 1S9FA 2A19A 3WK8A 5HNKA 4U6PA 4FFDA 4EELA 1WUDA 3N7SC 5CA7A 2BDUA 1DOQA 3K4GA 4FO6A 1ZQKA 4TUQA 1CI4A 2E8OA 3FC4A 4Y2VA 5KG0A 3JPTA 4IR9A 1RG6A 5ALQA 5AK3A 4GFJA 1ZQHA 1PZNA 3SAFA 3F2DA 3QUCA 2PKEA 2YQEA 4O3RA 3ZDBA 1A6SA 5ALZA 1N60A 4UQGA 2ZTDA 3WKCA 4CE6A 4FBUA 4DSFA 4I2AA 4M6WB 5A0LA 3QYPA 1NOMA 4J9KA 3PW4A 2YB1A 3M6KA 3TI0A 1URJA 2ESEA 2F8KA 2W54A 2ZIXA 3UQ2A 1S0NA 3GDXA 4QJFB 4I27A 2F3NA 5L1KA 4I2BA 3UPQA 5J0SA 5AIBA 1BPYA 1D9DA 3PSFA 9ICHA 1S0MA 5KG1A 7ICFA 4F4YA 1FFVA 3CNHA 1SKWA 2EZZA 1LB2B 4M0AA 5ALRA 5DB6A 5C5JA 1ZQTA 3ISDA 2KOBA 3BZKA 2PFQA 3AEVA 1ZD2P 2JXJA 5AKJA 2XGPA 5EWEA 2IHMA
chains in the Genus database with same CATH topology
2EZXA 2ODGA 2BZFA 2EZZA 1QCKA 1CI4A 2EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZX A;  2ODG A;  2BZF A;  2EZZ A;  1QCK A;  1CI4 A;  2EZY A; 
#chains in the Genus database with same CATH topology
 4JV0 A;  2F8L A;  3CP8 A;  3TKA A;  3C28 A;  1WCN A;  3ZDD A;  2A1J A;  1QQ5 A;  1RYR A;  3A0H U;  4Y2S A;  3HIL A;  4C8N A;  2HVI A;  4UW9 A;  4UAY A;  1HEK A;  2VA8 A;  5AM4 A;  5DB9 A;  4LZG A;  2AXT U;  4P2H A;  1NKC A;  2JHD A;  2YN4 A;  3HKZ C;  5DG9 A;  5DBC A;  1ZRN A;  4RPX A;  1PVP A;  2BGW A;  2P6R A;  5HP4 A;  5KG7 A;  4R63 A;  8ICV A;  2G09 A;  2ODG A;  2CPR A;  1ZD4 A;  2RHF A;  2A1A A;  5J8Y C;  4CF5 A;  3SAH A;  1RXW A;  2E1E A;  4DCC A;  5KFQ A;  2HCF A;  1Z00 A;  2E8M A;  2AGP A;  2FMQ A;  4EEN A;  2E8P A;  5J8Y A;  2BPG A;  5J2H A;  1KN5 A;  2FPL A;  4OJP A;  2XY5 A;  4QZG A;  1SV4 A;  3QE9 Y;  4F4X A;  4RQ2 A;  2KVC A;  4RU9 A;  5KFX A;  2DKX A;  2AGO A;  1M6Y A;  2MRL A;  5EE9 A;  2J6T A;  3ISC A;  2W9A A;  7ICN A;  4CF3 A;  4EZ6 A;  3RAQ A;  3MGV A;  4UB6 U;  4R8U A;  3IV6 A;  4B9S A;  1T3N A;  2W03 A;  2K8C B;  4ECX A;  1TFR A;  2EZX A;  4ED0 A;  4Y2T A;  3MGI A;  1TK8 A;  2ZIV A;  1L3S A;  4YXJ A;  2R8G A;  1ZJM A;  1Z4N A;  2YTU A;  3T3F A;  4RUA A;  4F5P A;  3NAS A;  1JMS A;  4LZD A;  1RDF A;  3L3F X;  3PW0 A;  5CR0 A;  5AM1 A;  5KT7 A;  1KRP A;  2BCR A;  3H8W A;  4X5V A;  2NRZ A;  4MFC A;  2W7P A;  2NRV A;  1XS9 D;  1NK7 A;  4MEY A;  2H3Q A;  4O9M A;  5AKY A;  4NLK A;  3WKE A;  2AHO B;  2JGA A;  2DFL A;  1SXD A;  4BXO A;  2HHV A;  5D46 A;  3VCB A;  4GC7 A;  9ICQ A;  3C5G A;  2WF5 A;  3F5A A;  2Y9U A;  4DL4 A;  2HHW A;  4NLG A;  2DPI A;  3SEN A;  5ALJ A;  2GLE A;  4DFD A;  2FLP A;  1QQ7 A;  4O3O A;  1F0M A;  5HHI A;  3UMC A;  4F4W A;  1MQ2 A;  3RJH A;  4NLC A;  3AQF A;  2YMQ A;  2AGQ A;  3GQC A;  2XIC A;  5KFN A;  5JUM A;  1SXE A;  4M2Y A;  2ATL A;  3FAH A;  3J81 j;  1Z3E B;  4CNQ A;  1WWV A;  4Y2R A;  1UPH A;  3RF9 A;  2KTQ A;  4YR3 A;  4PL1 A;  2JRZ A;  2YMP A;  4DSI A;  9ICC A;  2XVT A;  1L7P A;  4NWI A;  3PVX A;  1QTM A;  2JZB A;  3ZDE A;  3ETL A;  4UAZ A;  2BZF A;  4R64 A;  5KG6 A;  2WTF A;  3QEA Z;  4JV2 A;  1TE2 A;  4QWB A;  5KT3 A;  3TAN A;  7ICE A;  1D8L A;  2LI6 A;  2V4Q A;  1ZQQ A;  5J0Q A;  3E0F A;  3HJE A;  2LPE A;  5KFA A;  1YZ6 A;  3BQT A;  1NNL A;  1SL2 A;  7ICK A;  2YY6 A;  4M9H A;  2R8K A;  5ALY A;  2KNJ A;  3EUB 2;  3KBB A;  3CRX A;  3H40 A;  2C2E A;  4I2D A;  1QSS A;  2BQU A;  4YMO A;  3G6V A;  2ZJ8 A;  1X6J A;  4I2I A;  5J2I A;  2F77 X;  2IBK A;  1K1S A;  2G08 A;  5ALW A;  3GV8 B;  1NK5 A;  2PXI A;  1COO A;  1FIQ A;  1LVH A;  4B6J A;  4P0Q B;  1ZQG A;  1XU4 A;  2H3V A;  1WG8 A;  2JEI A;  1V38 A;  4DL6 A;  5EE0 A;  4NL9 A;  3H4D A;  2F1J A;  5EOZ A;  4QZD A;  4RPY A;  4YXM A;  1Q8K A;  4DO9 A;  4F5N A;  5AM2 A;  3JPQ A;  3PO5 A;  3KHL A;  4Z6F A;  4Q45 A;  2BDP A;  4OJ6 A;  1KEJ A;  3QZ8 A;  3RB3 A;  4EEK A;  1N5X A;  5J2J A;  9ICX A;  4DOC A;  4F8R A;  3GIL A;  2DF4 B;  3AM9 A;  3PML A;  2I1Q A;  1Z1V A;  2WB1 F;  1PK1 B;  4UB5 A;  3ZD9 A;  4M9L A;  2IA6 A;  1UA1 A;  4BWM A;  2VJ4 A;  4QZH A;  2FPM A;  1WCL A;  1QQ6 A;  2ZUC A;  5KFP A;  5IIK A;  2I6X A;  5DB7 A;  4P0P B;  2DUY A;  2J6U A;  1DK2 A;  5GTH U;  3LWL A;  4UB3 A;  2IMW P;  2IHN A;  4F4K A;  8ICR A;  4R8U B;  4GXI A;  3K75 D;  3M1Y A;  5KL8 B;  2JEG A;  1NZP A;  5J2G A;  2HBL A;  4E0D A;  3L4P A;  1C20 A;  1RQN A;  1ZQU A;  5AI6 A;  4KLG A;  4RQ1 A;  5ALO A;  3QUQ A;  2KKV A;  3RFA A;  2VIX A;  3KOO A;  5B66 U;  4Z6C A;  5KNI A;  7ICJ A;  3EYZ A;  1VLB A;  3NVZ A;  4R66 A;  8ICF A;  2HSZ A;  7ICO A;  2L5Y A;  4EEY A;  5AKZ A;  3H8S A;  2WAQ F;  5KAF U;  4EZ9 A;  1ED1 A;  2NRX A;  3H0L B;  1KL9 A;  4QZ9 A;  5KT5 A;  4O3Q A;  5HHH A;  1T4G A;  3D2Q A;  1J2N A;  4AYB F;  1NI3 A;  5ALP A;  5L1M A;  3PST A;  1U4B A;  5KFZ A;  5J2F A;  1UCV A;  9ICJ A;  4M9G A;  2LBO A;  4C7Y A;  4YR2 A;  7ICQ A;  4UAV A;  2H3I A;  1SWW A;  1O08 A;  4TUP A;  5ALT A;  3ETR A;  5ALE A;  4O3M A;  3OSN A;  2WFA A;  3HWT A;  1DK3 A;  1N62 A;  1UQV A;  3I28 A;  1RYS A;  3AL0 B;  3KKA A;  4O5K A;  2F1I A;  3C5F A;  2KZM A;  1YZ7 A;  3ONN A;  3SMV A;  2EZY A;  2VJ5 A;  1X6I A;  2YB4 A;  2H3F A;  2K60 A;  5DBB A;  2XY6 A;  5J2A A;  1QSL A;  3ALR A;  1IXR A;  2MU2 A;  4QIW F;  5KG3 A;  4NV0 A;  2VAN A;  3F2B A;  3IDW A;  3K1Z A;  1PK3 A;  1WWU A;  2YMM A;  3IRU A;  4DWI A;  3RBD A;  3ED5 A;  2OXO A;  4J9S A;  5KFL A;  2QAR A;  2VKQ A;  3F2C A;  2FDR A;  3LYS A;  3B0Y A;  3GV5 B;  3SYZ A;  2Y0S F;  2W9B B;  3N7P D;  2A3V A;  5D49 A;  4GIB A;  2R18 A;  3BDP A;  3QX7 A;  3T5H A;  5DBA A;  5DLG A;  3TAD A;  4QWE A;  5HR6 A;  1X9S A;  1B43 A;  2W43 A;  3QUT A;  2Z7J A;  4J03 A;  5AIA A;  1SZH A;  3H8J A;  1U9L A;  1KFT A;  4YD2 A;  2HDO A;  3KFU F;  2FLN A;  2FI1 A;  2WF8 A;  1ZOL A;  3T5L A;  1ZQO A;  5KFH A;  5AM0 A;  2B0C A;  2F2A B;  4DF4 A;  5ALV A;  2YML A;  2OYY A;  2W8K A;  2HOQ A;  9ICV A;  1X66 A;  3Q8Q B;  3C29 A;  4TQS A;  1IV8 A;  4F5R A;  4XRH A;  4NY8 A;  3KD3 A;  5AK6 A;  3N4M B;  1MC8 A;  4NJ8 A;  8ICL A;  4HYK A;  2ZIU A;  4DSL A;  4DQQ A;  2JMG A;  3H4B A;  1S10 A;  2Y0S C;  5ALF A;  4IRD A;  3KKA C;  1PUZ A;  4FZN A;  1PVR A;  8ICU A;  3Q8L A;  3OSP A;  5AKL A;  5DB8 A;  2W11 A;  8ICT A;  4KLT A;  5L1I A;  1YT3 A;  2W55 A;  3D6J A;  4M9J A;  4US9 A;  3NVW A;  2HMX A;  1NKE A;  4CDG A;  4KLS A;  4UBB A;  2ES6 A;  3S6J A;  5KFR A;  1LKY A;  1SV0 A;  3LK9 A;  3SD7 A;  1ZQZ A;  1LV5 A;  4ED7 A;  1N56 A;  3WU2 U;  1KBU A;  4ED8 A;  5HR7 A;  1RXV A;  4ECT A;  1ZQA A;  4NM1 A;  2ZTE A;  2DWQ A;  4F91 B;  2CN1 A;  3V6J A;  3OGU A;  5IIO A;  1KKX A;  4ECR A;  3LVW A;  5BPC A;  1NK9 A;  4DQP A;  1CRX A;  3NTU A;  5K4L A;  3H0M B;  1SIJ A;  1T8E A;  4KLE A;  3C23 A;  4DQS A;  3ORY A;  3UQ0 A;  4Y2P A;  2K8B B;  4IQW A;  4WJ3 B;  2NO5 A;  1N63 A;  1S8O A;  7ICP A;  3AN1 A;  2D8C A;  8ICX A;  2W9B A;  3MFI A;  4K4G A;  3TAR A;  4YMN A;  2UVV A;  1PK1 A;  2QAR B;  1ZQV A;  4YCX A;  4UBC A;  2XCA A;  4QIW C;  5KFT A;  2KJ5 A;  4YVZ A;  3TAQ A;  4ECY A;  5HMM A;  7ICM A;  5AK5 A;  2D6F C;  5AK4 A;  2KV2 A;  1TAM A;  3OHB A;  3RJE A;  1V97 A;  5IIM A;  5J2B A;  5H2F U;  5L1J A;  1ZQP A;  1S97 A;  1CUK A;  5ALL A;  4O0I A;  1Q3V A;  4ELV A;  4C4S A;  4XQ8 A;  2LM4 A;  2C2R A;  4Y2Y A;  4RNO A;  9ICU A;  4YFK A;  8ICW A;  5KTQ A;  2NO4 A;  3B0X A;  4P0Q A;  2KFN A;  5KG2 A;  1Z00 B;  5DGB A;  8ICA A;  2KKP A;  5KFU A;  3RR8 A;  2K8A A;  4BX9 C;  2JEJ A;  3PX0 A;  1MA7 A;  4Z6D A;  9ICG A;  3PSP A;  3M8R A;  2M9N A;  4XUS A;  5IIN A;  2R8J A;  1ZQY A;  1ZQM A;  5AKH A;  4ECW A;  4B9N A;  4OJO A;  5AI0 A;  4EBC A;  4A8E A;  4QWD A;  9ICS A;  5JTI A;  1U45 A;  4Y2U A;  3RH6 A;  2LMR A;  3V7J A;  4ED3 A;  1X2I A;  3HX0 A;  3BJY A;  3V6K A;  4TUR A;  1JRO A;  3OTQ A;  3QUB A;  5FP0 A;  2HHX A;  2A1J B;  2WB1 C;  1ZQS A;  3ZDA A;  4C0Z A;  4ED1 A;  4B9U A;  1XSP A;  3BQ0 A;  3SQI A;  1Z1B A;  3RRH A;  2ZIW A;  3T79 A;  3RH4 A;  8ICC A;  3BS5 A;  2KEY A;  2KN7 A;  1JI7 A;  2MA1 A;  5EE1 A;  4F71 A;  1Y88 A;  3PV8 A;  4YMM A;  4MF2 A;  4NLN A;  1SKS A;  2RRD A;  1C7Y A;  4PHE A;  3RRG A;  5F9N A;  2EAM A;  1ZD3 A;  4CGZ A;  1JRP A;  1T3Q A;  4DQR A;  1Z4O A;  1ZQF A;  1ZQI A;  4O3S A;  2Y9T A;  4BWJ A;  4P0P A;  2Q4T A;  3LVV A;  2DBY A;  7ICU A;  2ASJ A;  2RLT A;  1MN8 A;  2ZIU B;  3OPX A;  2BCU A;  4Q8F A;  4ECQ A;  3PW2 A;  8ICE A;  4F93 B;  9ICF A;  2DKZ A;  3UXO A;  3NVV A;  8ICM A;  1B22 A;  4FBT A;  2BCS A;  1NKB A;  7ICH A;  2Q0Z X;  2QLT A;  3B9J A;  2V4R A;  5L1L A;  4R65 A;  4P4O A;  5J0X A;  3DV9 A;  2BCV A;  5KFB A;  4CRX A;  1DGJ A;  1HUZ A;  2DGZ A;  5EWF A;  4ECS A;  4DL5 A;  4DQI A;  4BGD A;  3O0F A;  1P7D A;  1BPD A;  1BVS A;  3L5K A;  2OWO A;  2D3D A;  5DG8 A;  2PFP A;  3C2K A;  3M9M B;  2LYH A;  1L3V A;  3GIM A;  4UB1 A;  1K1Q A;  1IIP A;  1ZD5 A;  4Q43 A;  1JN3 A;  1N2X A;  4QW8 A;  2HBK A;  4IR1 A;  5T14 A;  3PMN A;  3ICX A;  3KTQ A;  5BOL A;  3WKB A;  3LWM A;  5AKI A;  2QB0 B;  3R9K A;  4O5E A;  4QW9 A;  4RQ8 A;  3M7D A;  1TV9 A;  4ECV A;  3SR6 A;  4C80 A;  4P4P A;  3PR4 A;  2WHE A;  5ALD A;  4BJQ A;  1Z19 A;  2BHN A;  3WK6 A;  5AI5 A;  1X9X A;  2K4E A;  1ZQ1 C;  3N7R C;  1BPX A;  2I9G A;  2Y1I A;  3QU7 A;  5KFF A;  4QNL A;  3HT3 A;  3MGH A;  4KLU A;  2AQ0 A;  5KT4 A;  1ZQL A;  1D8B A;  3C1Z A;  5KFV A;  3TAP A;  1WYG A;  5KFE A;  4F4Z A;  5AKE A;  4YQW A;  1KTQ A;  4UAU A;  3WKD A;  4O3N A;  1OUQ A;  2DPJ A;  3QU2 A;  1BPE A;  5ALN A;  1ZQW A;  3M8S A;  1XNS A;  2EAP A;  4ACO A;  3MAB A;  1SV0 C;  2UVR A;  4KLI A;  3JPP A;  5AI8 A;  2XI9 A;  9ICB A;  4FS2 A;  9ICT A;  2KSO A;  1EXN A;  3IN5 A;  3T5K A;  2LM1 A;  4KLM A;  3SI8 A;  1JAL A;  4NLB A;  2G06 A;  8ICQ A;  5C0Y A;  5KFM A;  2F1H A;  3C2L A;  5F9L A;  4XA5 A;  2EAN A;  2ZXH A;  2MAX A;  8ICH A;  4FZM A;  2KZ3 A;  1KSP A;  1LKY B;  1SB3 C;  2NRW A;  3K1R B;  4DSE A;  1F5S A;  3NS1 A;  4PHA A;  3QEB Z;  4CCH A;  1XSN A;  1FO4 A;  1S77 D;  1NZB A;  2W8L A;  3EPI A;  4YN4 A;  1GO3 F;  5AIC A;  4NXZ A;  1KQQ A;  3C21 A;  5CEH A;  5EWG A;  1D8Y A;  1ZQC A;  4I28 A;  3I76 A;  9ICW A;  2VA2 A;  4TUS A;  9ICI A;  2HOF A;  4YR0 A;  1QCK A;  2WF7 A;  2KMD A;  1Q46 A;  1BNP A;  2ASD A;  2PFN A;  2EAO A;  3UMB A;  2NV3 A;  3IP4 B;  1UHU A;  3D2S A;  2R8H A;  4RT2 A;  1ZQR A;  4QZF A;  1ARO P;  3V7L A;  2WAQ C;  3PW5 A;  2W3R A;  5J2E A;  2H3Z A;  4IRC A;  5KG5 A;  1UA0 A;  2OCE A;  2ZIV B;  3HPO A;  1MSW D;  4OCZ A;  5DGA A;  2GOL A;  3KZI U;  4US8 A;  4DFK A;  4M47 A;  2O6K A;  2YX8 A;  1IG6 A;  2W7O A;  2HI0 A;  4DOA A;  2XY7 A;  3U26 A;  3PNC A;  3OJS A;  4J9N A;  1TVA A;  1JUD A;  7ICV A;  2MSN A;  4UAT A;  3UXN A;  3EPG A;  3GV7 B;  4GC6 A;  5KT2 A;  4RQ6 A;  3KHG A;  2LYB A;  3I1Y A;  3BQ7 A;  2HHT A;  1T7P A;  9ICN A;  5JRT A;  5GTI U;  1QH9 A;  2ZJA A;  3TAC B;  1NK4 A;  2HHQ A;  1ZRM A;  4ICA A;  5EE3 A;  4RUC A;  5KFW A;  8ICZ A;  4F72 A;  1DRG A;  4RQ7 A;  2KIW A;  5DQI A;  5CRX A;  2AJQ A;  4IS7 A;  5ALS A;  1KLN A;  4JWM A;  1UT5 A;  2LKY A;  3WKA A;  4LVS A;  1S76 D;  2XID A;  4IQV A;  5AI9 A;  3PR5 B;  2OHF A;  3WK5 A;  3MR5 A;  5JU5 A;  3CW2 C;  3IG5 A;  5KFO A;  3RAX A;  4EYH B;  4JWN A;  4I2E A;  4EBE A;  3E58 A;  4Y2X A;  4DEZ A;  2BPC A;  4O3P A;  5J0T A;  3WK9 A;  2GO7 A;  9ICK A;  4GXK A;  4OD0 A;  4C4R A;  4MFF A;  1TAU A;  4EYI B;  4KX5 A;  5KT6 A;  2E3T A;  8ICY A;  4Q44 A;  3IM1 A;  4ELT A;  3C1Y A;  2E1F A;  1TAQ A;  2JH7 A;  2ZUB A;  4DOB A;  4RQ3 A;  3G6Y A;  3QU5 A;  4JMU A;  4PHP A;  2ISP A;  5ALM A;  2G07 A;  4I2J A;  2HBJ A;  3BQ1 A;  5KFJ A;  4F5Q A;  1F44 A;  2HHU A;  3JPN A;  1A0P A;  5J0Y A;  8ICB A;  2EH9 A;  4F3O A;  5ALH A;  3Q8P B;  4FE3 A;  1DGS A;  2ZIW B;  1MQ3 A;  1XWL A;  2RP5 A;  4OJL A;  4CF4 A;  5BOM A;  4DFP A;  4F2S A;  2C22 A;  2GH1 A;  1NJZ A;  3FDS A;  3FM9 A;  2KIC A;  2ZG6 A;  4M6W A;  5KL1 B;  1NK8 A;  1L5U A;  3BS7 A;  2E5S A;  2MUT A;  5AM3 A;  2RDJ A;  1COK A;  4KN7 A;  3Q8M A;  4I2C A;  3SV4 A;  4PGQ A;  1VDV A;  3MR2 A;  1NJX A;  4UAW A;  5AKX A;  2FLL A;  4M9N A;  4I2F A;  2B21 A;  2HVH A;  2WF9 A;  1TKD A;  3OJU A;  4J9M A;  1S0V A;  1XO1 A;  4KX3 A;  1N5W A;  4FS1 A;  2K89 A;  4RZR A;  3V7K A;  3RJI A;  4MHV A;  1U48 A;  3RJG A;  2G5I B;  4IQT A;  4ZH4 A;  4BDP A;  7ICL A;  3RJK A;  5ALX A;  2ZXI A;  2K4P A;  4DLG A;  2N1R A;  2ZIX B;  5CP2 A;  1JIH A;  2Y1J A;  4DL2 A;  4QZI A;  5KAI U;  1U49 A;  1L8O A;  3M6Z A;  4DSK A;  1NK6 A;  4AYB C;  4IRK A;  2NRT A;  1L3T A;  3HRD D;  2FMS A;  5J29 A;  4UB2 A;  4DSJ A;  3SEI A;  3FYH A;  3RTV A;  1RYU A;  3GU3 A;  4ECZ A;  5CWR A;  3ZI4 A;  1RM6 C;  1HIW A;  3NVY A;  1SL0 A;  4K4I A;  3ZD8 A;  5E79 U;  4RPZ A;  3Q8S B;  3RJF A;  4J9Q A;  9ICR A;  1ECW A;  2OM6 A;  8ICJ A;  3AQE A;  4OJ5 A;  3RJJ A;  5DQH A;  3ISB A;  1SZP A;  2FJ6 A;  2P6U A;  2KZZ A;  1QSY A;  2F76 X;  1A76 A;  4GLX A;  5ALG A;  4J9O A;  4KLH A;  3CYM A;  4RQ4 A;  3KZX A;  1O03 A;  3KHH A;  1OXJ A;  1J2M A;  1NJW A;  4KLF A;  1KW4 A;  2HOI A;  3VC8 A;  3KHR A;  3EWA A;  1NK0 A;  4YG2 A;  3RB4 A;  1FFU A;  3PX4 A;  1X9M A;  2QB0 A;  4C7Z A;  4KTQ A;  3M9O B;  2BCQ A;  3E2E A;  5J0R A;  1SGG A;  7ICS A;  3Q8R B;  1L6N A;  1T94 A;  2CRX A;  2CXY A;  3AUO A;  2G0A A;  2KG5 A;  4C8L A;  3H7I A;  4Y2J A;  5AM5 A;  4KIT B;  4IC9 A;  4QWA A;  4I2G A;  2QKQ A;  2M0N A;  3BZC A;  2PMZ F;  3C2M A;  2KJ8 A;  3NUQ A;  1X9W A;  1HUO A;  2BQ3 A;  2IOF A;  4ELU A;  9ICP A;  5TZV A;  4PPX A;  2AH5 A;  4B9V A;  3GFK B;  1SWV A;  2F44 A;  1ZJN A;  4GXJ A;  3RR7 A;  3RB0 A;  3AU2 A;  4QZA A;  4Z6E A;  1Q3U A;  4C8K A;  1ZQJ A;  4HAI A;  4QZ8 A;  1L7N A;  1L8L A;  2KSO B;  4TQR A;  3JPR A;  4B9L A;  1B4F A;  4YD1 A;  2PI5 A;  1K5O A;  2HHS A;  4KLO A;  3A0B U;  2IOH A;  3GZF A;  3UM9 A;  1CEZ A;  5IIL A;  9ICL A;  1ZET A;  3WK4 A;  1XO0 A;  9ICE A;  4M04 A;  5KG4 A;  5G5G A;  2JH1 A;  3PX6 A;  1ZQB A;  2ZUD A;  3MR3 A;  2V9W A;  4NM2 A;  4MFA A;  2KP7 A;  4C4T A;  3G6X A;  1XC9 A;  2K4I A;  2NYV A;  2I5H A;  3H0R B;  3LDA A;  4RQ0 A;  4QZC A;  1JXL A;  2UVU A;  2E8N A;  9ICM A;  2FMP A;  2KIV A;  3QXG A;  3RBE A;  3H8M A;  1H38 A;  5KFG A;  4F92 B;  4AP9 A;  2EDU A;  3UXP A;  3TAD C;  7ICG A;  3QZ7 A;  3D2N A;  1UT8 A;  2KD1 A;  4DLE A;  2FPK A;  9ICA A;  2B6G A;  1KFD A;  3MDA A;  3HKZ F;  4RQN A;  3OHA A;  1S0O A;  4IL6 U;  5L9X A;  4Q8E A;  7ICT A;  2KJ9 A;  2PI4 A;  2JR5 A;  2RDI A;  2AU0 A;  1KDH A;  3V72 A;  4DS5 A;  4IQU A;  2WF6 A;  5J0W A;  4RNM A;  2OEH A;  4KLQ A;  3AMZ A;  1N61 A;  1TK0 A;  2R8I A;  1SL1 A;  1RQL A;  2KFZ A;  5AI4 A;  2G5H B;  1BPB A;  4K4H A;  4FZL A;  5AHX A;  2HW3 A;  3ZDC A;  4U7C A;  3THV A;  2EQY A;  1ZQE A;  4P4M A;  2BKE A;  5HML A;  5KFD A;  2LHT A;  3PZP A;  1B0X A;  4KMU A;  2ASL A;  1D9F A;  4RQ5 A;  2DL0 A;  1ZQD A;  2GWS A;  1NJY A;  2LYA A;  2BQR A;  3RB6 A;  2DQN B;  5KFY A;  2RQ5 A;  2K4H A;  4KN4 A;  3TQ1 A;  8ICK A;  5DDY A;  2BPF A;  2H5X A;  1HJP A;  4QZE A;  2XC9 A;  3MFH A;  3N97 B;  5ALI A;  2P35 A;  2ALZ A;  3DEE A;  3NRZ A;  4I2H A;  2W9C A;  3WK7 A;  1J97 A;  8ICG A;  4DL3 A;  3QU4 A;  2J6S A;  8ICO A;  1N48 A;  4LJX A;  5AKG A;  4QWC A;  3V6H A;  4DS4 A;  4BUG A;  3NGD A;  2KHV A;  3MR6 A;  2AQ4 A;  7ICI A;  2IOF K;  4J9L A;  4KLL A;  3F53 A;  3MDC A;  1DXS A;  5DKW A;  5B5E U;  2JEF A;  4PH5 A;  4PGY A;  4C8M A;  5D4B A;  3GIK A;  1RZT A;  4EX6 A;  2ISO A;  1RPL A;  4OO1 J;  5J2C A;  4F5O A;  3IHQ B;  4PZN A;  4UB8 U;  4KMO B;  4PJ0 U;  2XGQ A;  4NL9 C;  2UVW A;  1QLN A;  4EX7 A;  2W9M A;  1ZYQ A;  3GIJ A;  2ZTC A;  3TFR A;  4G9B A;  3N28 A;  1L7M A;  5III A;  3EZ5 A;  1XSL A;  2XCP A;  1TK5 A;  4B9M A;  1AQ6 A;  2JV3 A;  2W9C B;  2OH2 A;  3Q8K A;  1X42 A;  4JV1 A;  3UMG A;  3DDH A;  4UAR A;  1BPZ A;  2W3S A;  5KFS A;  3PSI A;  5DQG A;  5KFK A;  2C2D A;  3T5J A;  4USA A;  4ED6 A;  3AU6 A;  1U47 A;  1PVQ A;  4JK1 A;  1ZXI A;  4BXO B;  5AKK A;  2P66 A;  4PZO A;  3HP6 A;  2VA3 A;  2BR0 A;  1VJ5 A;  4UAS A;  4ECU A;  5CB1 A;  9ICO A;  4J9R A;  5J0U A;  2FE9 A;  4PHD A;  4G3I A;  3SAG A;  1JXE A;  1X40 A;  4Y2Q A;  2HBM A;  4QZB A;  4KLD A;  5CHG A;  3BQ2 A;  2QB1 A;  2KK0 A;  3MBY A;  3GII A;  1ZQN A;  1BNO A;  4RT3 A;  3PW7 A;  8ICN A;  3TFS A;  1SKR A;  2XO7 A;  3MC1 A;  1IM4 A;  1OW5 A;  4C8O A;  4B9T A;  2C28 A;  4DFJ A;  5DG7 A;  3IG8 A;  2JZB B;  5J0O A;  2W04 A;  1FEZ A;  5IIJ A;  3EW9 A;  4YP3 A;  3NRW A;  1BGX T;  4MF8 A;  4UB4 A;  3RH5 A;  3F5E A;  3SZ2 A;  3PY8 A;  3PO4 A;  5J0P A;  5F3X B;  5ALK A;  4I29 A;  5KFI A;  1L7O A;  5ALU A;  4ZOH C;  5TIS U;  4J9P A;  4ED2 A;  4MEX A;  4KLJ A;  2KE7 A;  4PGX A;  5CJ7 A;  1ZQX A;  2KVS A;  2ZJ5 A;  2KHQ A;  1KFS A;  1V9P A;  4RNN A;  4DFM A;  4NLZ A;  4EBD A;  2PMZ C;  2PFO A;  1V85 A;  4PL2 A;  8ICS A;  2MUT B;  3HW8 A;  3QU9 A;  4F50 A;  4F2R A;  4JB3 A;  3BS5 B;  8ICI A;  3M9N B;  3JPO A;  5KFC A;  4DL7 A;  1L3U A;  4RQM A;  3JPS A;  4JUZ A;  5J2K A;  5G5H A;  4DF8 A;  4O5C A;  7ICR A;  3SV3 A;  5DDM A;  5DLF A;  3QNM A;  8ICP A;  1S5L U;  1A77 A;  5J2D A;  1JX4 A;  1S9F A;  2A19 A;  3WK8 A;  5HNK A;  4U6P A;  4FFD A;  4EEL A;  1WUD A;  3N7S C;  5CA7 A;  2BDU A;  1DOQ A;  3K4G A;  4FO6 A;  1ZQK A;  4TUQ A;  1CI4 A;  2E8O A;  3FC4 A;  4Y2V A;  5KG0 A;  3JPT A;  4IR9 A;  1RG6 A;  5ALQ A;  5AK3 A;  4GFJ A;  1ZQH A;  1PZN A;  3SAF A;  3F2D A;  3QUC A;  2PKE A;  2YQE A;  4O3R A;  3ZDB A;  1A6S A;  5ALZ A;  1N60 A;  4UQG A;  2ZTD A;  3WKC A;  4CE6 A;  4FBU A;  4DSF A;  4I2A A;  4M6W B;  5A0L A;  3QYP A;  1NOM A;  4J9K A;  3PW4 A;  2YB1 A;  3M6K A;  3TI0 A;  1URJ A;  2ESE A;  2F8K A;  2W54 A;  2ZIX A;  3UQ2 A;  1S0N A;  3GDX A;  4QJF B;  4I27 A;  2F3N A;  5L1K A;  4I2B A;  3UPQ A;  5J0S A;  5AIB A;  1BPY A;  1D9D A;  3PSF A;  9ICH A;  1S0M A;  5KG1 A;  7ICF A;  4F4Y A;  1FFV A;  3CNH A;  1SKW A;  2EZZ A;  1LB2 B;  4M0A A;  5ALR A;  5DB6 A;  5C5J A;  1ZQT A;  3ISD A;  2KOB A;  3BZK A;  2PFQ A;  3AEV A;  1ZD2 P;  2JXJ A;  5AKJ A;  2XGP A;  5EWE A;  2IHM A; 
#chains in the Genus database with same CATH homology
 2EZX A;  2ODG A;  2BZF A;  2EZZ A;  1QCK A;  1CI4 A;  2EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...