2BZFA

Structural basis for dna bridging by barrier-to-autointegration factor (baf)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2bzfA00
2BZFA 2EZZA 1CI4A 2EZYA 2ODGA 1QCKA 2EZXA
chains in the Genus database with same CATH superfamily
5J2BA 3PR5B 8ICXA 4JMUA 3RRHA 1BPXA 5AIBA 4Y2SA 5KFNA 2KHVA 2RLTA 1QQ6A 1UCVA 4KITB 4P4PA 2WTFA 1K1SA 4KN4A 1X6IA 5KG6A 4QIWC 3PSPA 1Z1BA 4M9HA 5DLFA 2KFNA 1AQ6A 5ALDA 4R65A 3RR8A 5L1KA 1HUZA 1KSPA 3F5EA 1AROP 3QU5A 3RFAA 2W9AA 1X9WA 1ZQJA 3D2QA 5IILA 3HT3A 4PHPA 3RBDA 4F71A 3SEIA 5AK6A 3RJKA 2XY6A 4ECRA 4B9TA 1FO4A 3SYZA 3RH6A 2ESEA 2PMZF 2PFOA 2CRXA 3BQ7A 5KFGA 3QX7A 8ICUA 1L3UA 2V4QA 2Q0ZX 4NJ8A 9ICKA 3RB6A 7ICLA 1K5OA 1ZQGA 4DQPA 4UARA 5KFAA 4IQWA 8ICNA 8ICIA 1VJ5A 4Y2QA 2DQNB 4DCCA 1Q3VA 7ICTA 5ALGA 4YFKA 3AQFA 2GO7A 5AKJA 4PPXA 4KLJA 4KLHA 2ZUDA 5DBBA 4J9LA 3QUTA 4QWEA 4QWCA 2XO7A 2JH1A 4PL2A 4PGYA 5KFWA 1TK5A 3UQ2A 3MR3A 3RJHA 4MEXA 2KZZA 3M9OB 4YR3A 4KX3A 1XSPA 4KN7A 5KFXA 3MDAA 1SKSA 4JV2A 5J2JA 5ALHA 3TADC 3RJGA 3TARA 1ZQKA 4NL9A 3AU6A 2FE9A 1N62A 3UM9A 2F8LA 5ALUA 3ZI4A 2ZIXB 2HOIA 4PJ0U 4QZ9A 1KL9A 5HHIA 4XRHA 2F76X 1DRGA 2XVTA 5KFVA 1Z4NA 3L5KA 4FZNA 5AK3A 2PFPA 1B22A 2ZTEA 2R8GA 2UVUA 1PK3A 3VCBA 4PHDA 2AH5A 2AXTU 4OCZA 4O3SA 8ICPA 4BDPA 1N56A 1T4GA 2NO4A 4RUCA 4F4KA 5KAIU 3BZKA 2HHVA 1RG6A 2RDIA 3QUBA 4ED3A 3TACB 4BXOA 4F5PA 4UAWA 1ZQYA 2F3NA 4CF5A 4A8EA 3JPSA 1ZD2P 5J0XA 5J2KA 2BQUA 2G09A 1ZQOA 5KG2A 2QB0A 5ALTA 2W9BB 2E8OA 1ZQXA 4TUPA 3UXOA 2BGWA 5ALKA 1F0MA 5JUMA 3AQEA 1QQ7A 3UXPA 4C4SA 5KFRA 5L9XA 3KZIU 4NLNA 2I1QA 3GQCA 1U49A 1RDFA 2Q4TA 4F5OA 2KP7A 1RQLA 2YMQA 2PFQA 4FBUA 5ALPA 4O3MA 2VKQA 4O3PA 2K89A 1QSLA 2RHFA 2W7OA 3F53A 2WAQF 1Z3EB 4DQIA 9ICOA 1SV4A 5C0YA 3E0FA 4PL1A 4NWIA 4M6WB 1KFSA 2ASLA 1T3NA 1PVPA 2V9WA 2M9NA 4F5RA 2K8CB 3HWTA 4NLZA 2NO5A 1NK6A 1L8LA 1EXNA 5ALLA 5GTHU 5KT4A 3L3FX 2WF6A 3M6KA 5KG0A 3HPOA 1NK0A 5J2GA 5A0LA 3WU2U 2ISPA 2A1JB 2FLPA 2P6RA 4KLGA 2KFZA 2FDRA 8ICWA 1FFVA 2I5HA 2DKZA 5KFTA 1JUDA 2YX8A 4B9SA 9ICNA 1QSYA 4YCXA 9ICJA 3NVWA 1LVHA 1QH9A 2E5SA 5DLGA 4B9VA 5L1JA 9ICMA 4JWMA 9ICCA 2L5YA 1Z00A 1NI3A 1TKDA 4QW8A 4Y2UA 3Q8SB 2LI6A 1RXVA 4IQTA 5KFQA 4M0AA 2BDUA 2HHTA 3G6YA 8ICAA 2KD1A 2JZBA 3WK7A 4AP9A 2FMSA 2UVRA 3MGHA 4RU9A 2AQ0A 2ATLA 1XNSA 1QSSA 2HMXA 1COOA 1UQVA 9ICPA 2YMLA 5ALMA 4Y2RA 3RRGA 2OH2A 3KHLA 4RQ0A 2AGPA 4ECSA 3F2DA 1X66A 3BDPA 2LMRA 1NJZA 2K4IA 1TVAA 2BHNA 2Y1JA 4KLMA 1NJWA 5CB1A 3MR5A 3PMLA 1XU4A 4YG2A 2Y9TA 4QZFA 3LWMA 3OSPA 4TQSA 4MF8A 3H7IA 4EX6A 1X6JA 3V6KA 3EWAA 4PH5A 2DFLA 2G5HB 4ZOHC 3ETLA 3WKAA 2JEGA 2MSNA 4CRXA 5K4LA 5F9NA 4ED1A 1MSWD 2LYHA 4NLKA 2KSOA 3I1YA 4UBCA 1XS9D 7ICUA 3TFSA 1Q8KA 3WK5A 4UB4A 1N48A 3SV3A 4F4XA 8ICQA 5JRTA 5EWEA 1PK1A 3ISBA 9ICHA 1CUKA 5BOMA 2BCSA 3QZ7A 3WK6A 1X40A 1Z19A 5KFFA 2MA1A 2W54A 1TK8A 4Z6DA 3OGUA 2VA2A 4O3OA 1NJYA 2NYVA 5J0YA 4O5EA 3ONNA 2ZJAA 2V4RA 1NK5A 7ICGA 3IDWA 2ES6A 5AM2A 1NK8A 4X5VA 4C4RA 1GO3F 4UAZA 1XSNA 2ZIWB 2IA6A 2Y9UA 1D8YA 4KLOA 2VA8A 7ICQA 2E8MA 4ECUA 4DEZA 3UPQA 1S0VA 4P4OA 2XGPA 3EPIA 3UMGA 4DF4A 4UB2A 1ED1A 4YVZA 1YZ7A 4PGXA 1LKYA 1D8BA 2IOFK 8ICSA 4RQ5A 4F5QA 4DSLA 1MQ2A 3JPRA 4P0QB 4F72A 4ECWA 1NZBA 5CRXA 4I2HA 1ZQVA 4PGQA 1URJA 2ZIVB 4J9PA 5IIJA 4B6JA 5TZVA 1ECWA 2W43A 1NNLA 5L1IA 3N97B 3F2BA 4C8KA 2KNJA 4IQVA 5AKLA 4E0DA 2IOFA 2HBKA 2XY5A 3RTVA 2EANA 3ORYA 5AM0A 8ICEA 1SZHA 3SMVA 3QU7A 5KFPA 3BZCA 2EQYA 1QQ5A 4YD1A 4GXIA 4C8OA 3IG5A 3ZD9A 1SL2A 1ZRNA 1ZQRA 5J2EA 5ALIA 7ICJA 2KMDA 1NZPA 4M47A 1B4FA 1N5WA 1JMSA 3OHAA 5KTQA 1S76D 4BWJA 3C2LA 2C2DA 1KQQA 3VC8A 4ACOA 4I2JA 4ZH4A 4RPYA 4EBCA 1IG6A 4CDGA 5L1MA 2BPCA 2W9MA 1JRPA 1O03A 2HSZA 1S0OA 3SAHA 4DSJA 2ZUBA 1ZQ1C 1JROA 4ED8A 4RNMA 3QU9A 3RB4A 1ZQQA 2KIVA 8ICCA 1X9MA 4RQ4A 1V38A 1Q3UA 4C80A 4I2FA 2AJQA 1UHUA 2BKEA 1PVRA 1XC9A 2M0NA 3AEVA 5ALYA 3TFRA 2FMPA 3TADA 3UMBA 1N2XA 5J0TA 2F8KA 4ELTA 2E1FA 1CI4A 1U45A 1Q46A 4Q44A 5KT2A 5DKWA 3E2EA 3F5AA 4KX5A 3GDXA 5HR6A 3GZFA 3NUQA 2WF8A 7ICOA 3HKZC 3ZDDA 4QIWF 1ZYQA 1PVQA 1SGGA 7ICFA 4OJLA 4RNNA 5CR0A 4MFAA 4F4ZA 3QE9Y 4DFJA 2CXYA 4K4IA 2J6TA 2OM6A 3MFIA 1SXEA 3PSTA 2VIXA 4OJ5A 3C5GA 3SV4A 4I2CA 1JXLA 8ICLA 1ZQZA 3KFUF 1XSLA 4DFMA 2DGZA 3NRZA 1T7PA 4R66A 4I27A 4UB6U 2ZIWA 4M9JA 2D3DA 2H5XA 4P4MA 2ISOA 5KT7A 4I2AA 1JN3A 4P0PA 3SENA 1F44A 4NLBA 2AQ4A 1RYUA 4J9OA 2BCQA 1DOQA 3SQIA 4FFDA 2KKVA 4IC9A 2DPIA 4J9MA 5AKKA 5HMLA 4HAIA 3GIJA 2WAQC 4KLIA 9ICVA 2G07A 3BQ2A 5DDYA 1ZD4A 4C0ZA 1FIQA 3B9JA 2W3RA 3OHBA 4JV1A 4KLDA 3TI0A 3FYHA 1OUQA 2KEYA 2FI1A 1BPYA 2PI4A 2KTQA 2KICA 5ALJA 4UB3A 4QZCA 2BPGA 5IIKA 3GIIA 2K4EA 3Q8MA 5CWRA 3LVWA 2GOLA 3FC4A 2BCVA 2HOQA 1ZQNA 1L7OA 3CW2C 4ED6A 4M9LA 5KFYA 4EENA 1P7DA 1L6NA 4DSFA 3L4PA 4F50A 2KIWA 4UAUA 5ALNA 4KLEA 5EE9A 9ICWA 1SXDA 3RR7A 4DQQA 3J81j 3D2SA 4MEYA 1UA0A 8ICYA 4YXJA 2W55A 1V97A 3ICXA 2MUTB 4UAYA 3DDHA 2FPKA 5ALXA 1MA7A 4EEKA 1U9LA 5AI9A 5AKIA 3MGIA 3Q8KA 2EAMA 3EPGA 1IM4A 1S0MA 2ZTCA 2F2AB 4YXMA 3A0BU 2W8KA 3IRUA 5AM3A 1HEKA 5ALFA 3OSNA 3ETRA 3BS5B 7ICSA 4Y2TA 3PSFA 5DB9A 1ZXIA 4Q45A 3H4DA 3Q8PB 3Q8RB 4NLGA 2NRXA 4ECZA 1L8OA 3PW5A 4QZEA 4RQ6A 1NKBA 3DV9A 2RDJA 2FMQA 8ICKA 3KTQA 2XCAA 2R8HA 3HKZF 5DB8A 3B0XA 1A0PA 5AKYA 2YMMA 2HCFA 4F2SA 2JXJA 4TURA 5KFKA 3C1YA 3NGDA 3H8JA 4B9UA 2PI5A 8ICTA 2ZJ8A 7ICPA 5TISU 3RAXA 5ALSA 5CJ7A 2K60A 4GXJA 4M6WA 3KD3A 2BCUA 4YN4A 1J2NA 3I28A 3R9KA 5ALWA 5KFCA 1NKCA 4USAA 4ELUA 1NJXA 4PHAA 3WK8A 3RB0A 4OJOA 3H8WA 4Y2XA 4NLCA 9ICGA 2VANA 2IHNA 4JK1A 2W8LA 4RQMA 1RM6C 3T5HA 4UB1A 8ICJA 5J8YA 4J9RA 2HDOA 3JPOA 3BJYA 4BWMA 2P35A 4YMOA 2W9CA 4DS5A 3ZDEA 4DOBA 3PW0A 2A1JA 3RH5A 2E8PA 3TQ1A 4DOAA 3BQ0A 1WYGA 3WK9A 1DXSA 4RUAA 1ZQDA 4IQUA 4C8LA 4K4HA 2MU2A 4Z6CA 2ASJA 2YMPA 3OPXA 4UBBA 4O9MA 3WKEA 5AIAA 4Y2JA 1BPEA 4Q8EA 1Z00B 3UXNA 1A6SA 2OXOA 2AU0A 5J2FA 9ICUA 2KE7A 3QEAZ 1BNOA 3N28A 1SV0C 3GU3A 3K4GA 1M6YA 4U7CA 8ICRA 3CRXA 3M8SA 2R18A 4TUQA 1BVSA 3I76A 5EWGA 2PXIA 2E1EA 1ZD5A 2ZXIA 1S10A 2BZFA 2BQRA 2HHWA 1ZQUA 1KBUA 4NL9C 3V7LA 1JI7A 1D9FA 5DQHA 2HOFA 3KHRA 3MBYA 9ICQA 5AK5A 3M7DA 2KZMA 9ICEA 1B43A 5DBCA 4BGDA 1TAQA 1ZQIA 3O0FA 3WKDA 3AM9A 2VJ5A 1MC8A 4QW9A 3HRDD 4O5KA 4KLSA 3G6VA 4Z6EA 5KT5A 2BR0A 2BCRA 5J0UA 4OO1J 3AU2A 4ED0A 5IIMA 1V85A 3H0LB 3KOOA 1KDHA 4O0IA 5BPCA 7ICNA 3PX6A 4Z6FA 5DBAA 2EDUA 2G06A 4US9A 5H2FU 1J97A 2XGQA 3SI8A 4F5NA 2KN7A 1UPHA 4FZLA 2H3FA 3IG8A 2K8AA 1LKYB 1S0NA 4QZ8A 3IP4B 8ICBA 3NRWA 2NRZA 3F2CA 3BQTA 3H40A 1L7NA 4JUZA 2ZIUB 2BPFA 5KFSA 4RQ2A 5DQIA 4J03A 3JPNA 4LJXA 4F91B 2JMGA 2KVSA 3KBBA 8ICOA 2QB1A 5AICA 4R8UA 4QJFB 4RQNA 4FBTA 2EZYA 2PKEA 2NV3A 2YTUA 2ZIXA 4J9KA 1KEJA 4DFKA 1SIJA 3WKCA 5KT6A 1QCKA 3QEBZ 1WWUA 4JB3A 4PHEA 3K1RB 3C5FA 2W9CB 5J2IA 1L3VA 3LDAA 2WF7A 2KV2A 3SZ2A 1S5LU 1UT5A 4M04A 2E8NA 2JEIA 3KHHA 5J8YC 1WG8A 4DLGA 4MFFA 4ECTA 2B0CA 4DO9A 2JGAA 5HMMA 3N7RC 3PSIA 1FEZA 1ZQWA 2H3IA 1ZQMA 4BXOB 1SZPA 5C5JA 3A0HU 4P0QA 4Y2VA 4I2BA 7ICMA 2F44A 4J9QA 2ZIVA 4Y2PA 4ICAA 1UT8A 5J2CA 3KZXA 1SKRA 2ZG6A 5J2HA 2NRTA 3QZ8A 2IBKA 3RJIA 4UATA 1JXEA 4DFPA 3RJJA 3PR4A 5JU5A 5DG8A 3Q8QB 1IXRA 4CNQA 4R63A 3RJFA 2HVIA 4M9NA 5HHHA 4LZGA 3HP6A 2F1IA 5EE3A 2XIDA 5AM1A 2CPRA 3GILA 1KLNA 1NKEA 4NM2A 5AI8A 4Q8FA 3V7KA 4GXKA 5ALQA 4YR2A 4WJ3B 4FS2A 1JALA 1T8EA 2HHQA 5J29A 5KG7A 4FS1A 3SAGA 2C22A 1U48A 4FE3A 5AM4A 4HYKA 4O3RA 3IN5A 2HI0A 1DGSA 2J6UA 5AKZA 4DL5A 3AUOA 2RQ5A 1KN5A 2QKQA 1C7YA 1SWWA 3HW8A 1JX4A 4QZAA 2FLLA 2R8IA 2LM4A 3V6HA 5KL8B 1ZD3A 4DL3A 2FPMA 1T3QA 4B9MA 2HBLA 4DSKA 1SKWA 3DEEA 2PMZC 3PW4A 2WB1C 3HJEA 2JH7A 3CP8A 1XO0A 9ICBA 1QLNA 3RAQA 4EBDA 1SWVA 1Z1VA 3OJUA 2W11A 3T5LA 3N4MB 3TKAA 5KNIA 5F3XB 3GFKB 1YT3A 4DWIA 5ALZA 4DF8A 4DQSA 4JV0A 4DSIA 4UAVA 3SR6A 2K4PA 2LYBA 3NVVA 8ICGA 4CE6A 3RB3A 4I2IA 2E3TA 4F8RA 4C8NA 2DL0A 2FJ6A 2K8BB 3V72A 4KLLA 2NRVA 3TANA 4US8A 3LK9A 3NVZA 1OW5A 3UQ0A 1ZQAA 2QARA 4I28A 1ZJMA 3N7PD 5JTIA 3PW2A 5KFOA 5CA7A 4P0PB 1C20A 3PV8A 1RYSA 2OCEA 9ICIA 2LKYA 5EE1A 4RNOA 4KMOB 3NVYA 2IMWP 1NK9A 2A1AA 4CF3A 2XC9A 4OJPA 3V6JA 4K4GA 4F3OA 4F4WA 2MUTA 1BNPA 4F93B 1MN8A 3MC1A 5HR7A 1OXJA 1K1QA 1RZTA 2EZZA 1Z4OA 3ZDBA 3QYPA 3CYMA 4DLEA 2OWOA 2H3ZA 2W04A 3Q8LA 2KZ3A 1TV9A 7ICKA 4C7YA 1XWLA 4EYIB 5D4BA 4ECVA 2I6XA 3QUCA 3QNMA 2HBJA 2C2RA 1PK1B 3RJEA 2KG5A 1RYRA 5AKEA 9ICAA 5EWFA 3PO4A 4YD2A 3M1YA 2LYAA 4IR1A 1QTMA 2KJ9A 1RPLA 5KFEA 8ICZA 3C2MA 7ICVA 2ASDA 2VJ4A 3PW7A 2H3QA 1SL0A 3C21A 1BGXT 5ALEA 3PZPA 4Q43A 2FLNA 4DL6A 1ZQFA 3LVVA 4UASA 5IINA 5AI4A 4P2HA 4MF2A 3LWLA 5AHXA 4IRDA 4KMUA 4F4YA 1S97A 4EZ6A 4KTQA 1HJPA 1PUZA 3D2NA 1VDVA 4M2YA 2YB4A 4BX9C 4CF4A 1TE2A 1YZ6A 2KKPA 4UW9A 3BS7A 4AYBF 7ICHA 1PZNA 1ZRMA 1N5XA 3IHQB 3S6JA 4ECYA 4ED7A 5F9LA 4ELVA 3H4BA 1ZJNA 2ZUCA 1SL1A 5KFDA 8ICVA 4M9GA 4MFCA 5CP2A 5G5GA 5J0SA 5KFHA 4G9BA 2MRLA 3JPQA 5AKHA 2ODGA 4UQGA 3M6ZA 4CGZA 3RF9A 5D46A 1D8LA 4YMNA 3T3FA 1D9DA 1ZQEA 1L7MA 2DF4B 2CN1A 2WFAA 4ECXA 2KHQA 3QU2A 2W7PA 4ECQA 1IV8A 3C28A 2Y0SC 4FO6A 4LVSA 5HNKA 4QZBA 4Y2YA 2JRZA 4EBEA 4KLTA 3SD7A 2ALZA 5T14A 4QWAA 1L7PA 3MR2A 4TUSA 3C2KA 4UB8U 1ZQSA 1WCLA 4RQ8A 8ICMA 3PO5A 4DFDA 3C29A 7ICIA 5J0QA 2XI9A 5IIOA 1L3TA 4QZIA 5B5EU 3FM9A 3PY8A 1N63A 4F92B 3QU4A 2XICA 5AM5A 3MR6A 1X2IA 3THVA 5KG4A 4QWBA 4KLUA 2HBMA 1LV5A 3KKAC 4YQWA 3GIMA 1ZQTA 4EZ9A 4QWDA 7ICRA 4DL7A 3KHGA 4OJ6A 1CEZA 3TAPA 2Y0SF 2XY7A 1DK2A 2ZTDA 2KK0A 2G08A 4RPZA 5ALVA 5J0RA 4C8MA 4EEYA 2B21A 2G5IB 5ALRA 1S9FA 4I29A 4DOCA 3MFHA 4B9NA 4EYHB 2O6KA 2F1JA 2JEJA 2MAXA 1N61A 4QZGA 2QB0B 2W9BA 4NY8A 4YP3A 3M9NB 2AHOB 1TAMA 2JV3A 4C7ZA 2YQEA 5AKGA 1FFUA 4CCHA 1VLBA 2HHUA 3GV8B 1ZQHA 3NASA 9ICRA 2WF5A 3ISCA 1WUDA 2FPLA 1X9XA 4AYBC 3SAFA 1B0XA 3H0MB 2Y1IA 5DGBA 4J9NA 2KOBA 2ZIUA 3IV6A 1UA1A 3AMZA 1NK7A 3E58A 2LHTA 4NXZA 4DL4A 1ZETA 5KAFU 4C4TA 2XCPA 1T94A 5KFBA 5KFMA 1HIWA 2A3VA 1O08A 3G6XA 5J2DA 2PFNA 1CRXA 1J2MA 1SV0A 3ZD8A 2JZBB 4RT2A 5FP0A 4I2DA 9ICXA 1H38A 4QZDA 1S77D 7ICEA 4XUSA 4NV0A 2DWQA 4F2RA 4YR0A 2RP5A 3QXGA 1N60A 3MDCA 8ICFA 2YB1A 3TAQA 1NK4A 3EW9A 2GLEA 3U26A 2ZJ5A 4IL6U 2EAOA 4DQRA 5E79U 4GC6A 3HILA 1U47A 2UVWA 3GV5B 2Z7JA 2HHXA 3IM1A 3EUB2 4GIBA 5J0OA 4QZHA 5AI6A 4DSEA 3WK4A 3NS1A 4RQ7A 4RT3A 1DGJA 3PVXA 9ICSA 3T5JA 2W3SA 3NTUA 4KLFA 3KKAA 3GIKA 4QNLA 1A77A 5L1LA 5DB7A 2NRWA 1KW4A 2ZXHA 4EX7A 2BQ3A 4R8UB 1JIHA 2EAPA 3N7SC 3JPTA 5KT3A 3ZDAA 2EZXA 4LZDA 1U4BA 5KG3A 1LB2B 1DK3A 3UMCA 2WF9A 3H8MA 2B6GA 3V7JA 4PZOA 4DS4A 1KRPA 2F1HA 2RRDA 1S8OA 1L3SA 5EE0A 1BPBA 4XA5A 3WKBA 5J0WA 5CEHA 2JR5A 5GTIU 3D6JA 5KFZA 3EZ5A 2JHDA 4J9SA 2N1RA 3FAHA 1ZQPA 4IS7A 3K1ZA 2UVVA 2C28A 4RQ1A 5DB6A 1BPDA 2HVHA 2DPJA 4U6PA 4O3QA 2J6SA 2H3VA 5KFIA 4I2GA 5KL1B 3PX4A 1MQ3A 2R8JA 2DBYA 4KLQA 1A76A 4MHVA 2A19A 4YMMA 5KFJA 5J2AA 2KJ8A 1KTQA 2AGOA 2BDPA 2DKXA 2G0AA 2KVCA 4RQ3A 4PZNA 2D8CA 4IRCA 2KSOB 3PX0A 1WCNA 1L5UA 2I9GA 4R64A 3OTQA 3T5KA 2K4HA 1ZQLA 2F77X 5KFUA 4XQ8A 5AK4A 4FZMA 5KG1A 3ZDCA 2W03A 3BS5A 5ALOA 1XO1A 2LPEA 1SB3C 5D49A 2D6FC 1TK0A 1ZQBA 3ISDA 5IIIA 9ICFA 4B9LA 4GLXA 2OEHA 3K75D 4G3IA 3M9MB 3JPPA 2OHFA 3PMNA 3GV7B 3ALRA 2LM1A 3C1ZA 3H8SA 3AN1A 4O3NA 4I2EA 5G5HA 2P66A 4IR9A 4O5CA 9ICLA 5AKXA 1V9PA 4IRKA 1KKXA 5DQGA 2WHEA 2YY6A 1HUOA 3MGVA 1ZOLA 2EH9A 9ICTA 5BOLA 3C23A 5DG7A 2P6UA 5AI5A 3RBEA 1RXWA 3CNHA 3MABA 1BPZA 3EYZA 4TQRA 1KFTA 5CHGA 4BJQA 5B66U 2IHMA 5EOZA 3T79A 1F5SA 5KFLA 2R8KA 3FDSA 4RPXA 2GWSA 3LYSA 2AGQA 4RZRA 2YN4A 4UB5A 2OYYA 3H0RB 3BQ1A 1TFRA 4DL2A 2LBOA 3M8RA 4OD0A 3HX0A 1RQNA 2WB1F 2GH1A 8ICHA 4JWNA 3AL0B 4GFJA 2QLTA 1WWVA 2HHSA 3ED5A 5HP4A 4ED2A 4NM1A 1TAUA 4GC7A 2HW3A 5DDMA 1COKA 3B0YA 4EELA 4BUGA 5KG5A 5AI0A 2KJ5A 1IIPA 3PNCA 2C2EA 1X42A 5DG9A 2DUYA 2JEFA 1Y88A 1KFDA 2QARB 5J0PA 3RH4A 2VA3A 2IOHA 5DGAA 1NOMA 3QUQA 3OJSA 1X9SA 1ZQCA
chains in the Genus database with same CATH topology
2BZFA 2EZZA 1CI4A 2EZYA 2ODGA 1QCKA 2EZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZF A;  2EZZ A;  1CI4 A;  2EZY A;  2ODG A;  1QCK A;  2EZX A; 
#chains in the Genus database with same CATH topology
 5J2B A;  3PR5 B;  8ICX A;  4JMU A;  3RRH A;  1BPX A;  5AIB A;  4Y2S A;  5KFN A;  2KHV A;  2RLT A;  1QQ6 A;  1UCV A;  4KIT B;  4P4P A;  2WTF A;  1K1S A;  4KN4 A;  1X6I A;  5KG6 A;  4QIW C;  3PSP A;  1Z1B A;  4M9H A;  5DLF A;  2KFN A;  1AQ6 A;  5ALD A;  4R65 A;  3RR8 A;  5L1K A;  1HUZ A;  1KSP A;  3F5E A;  1ARO P;  3QU5 A;  3RFA A;  2W9A A;  1X9W A;  1ZQJ A;  3D2Q A;  5IIL A;  3HT3 A;  4PHP A;  3RBD A;  4F71 A;  3SEI A;  5AK6 A;  3RJK A;  2XY6 A;  4ECR A;  4B9T A;  1FO4 A;  3SYZ A;  3RH6 A;  2ESE A;  2PMZ F;  2PFO A;  2CRX A;  3BQ7 A;  5KFG A;  3QX7 A;  8ICU A;  1L3U A;  2V4Q A;  2Q0Z X;  4NJ8 A;  9ICK A;  3RB6 A;  7ICL A;  1K5O A;  1ZQG A;  4DQP A;  4UAR A;  5KFA A;  4IQW A;  8ICN A;  8ICI A;  1VJ5 A;  4Y2Q A;  2DQN B;  4DCC A;  1Q3V A;  7ICT A;  5ALG A;  4YFK A;  3AQF A;  2GO7 A;  5AKJ A;  4PPX A;  4KLJ A;  4KLH A;  2ZUD A;  5DBB A;  4J9L A;  3QUT A;  4QWE A;  4QWC A;  2XO7 A;  2JH1 A;  4PL2 A;  4PGY A;  5KFW A;  1TK5 A;  3UQ2 A;  3MR3 A;  3RJH A;  4MEX A;  2KZZ A;  3M9O B;  4YR3 A;  4KX3 A;  1XSP A;  4KN7 A;  5KFX A;  3MDA A;  1SKS A;  4JV2 A;  5J2J A;  5ALH A;  3TAD C;  3RJG A;  3TAR A;  1ZQK A;  4NL9 A;  3AU6 A;  2FE9 A;  1N62 A;  3UM9 A;  2F8L A;  5ALU A;  3ZI4 A;  2ZIX B;  2HOI A;  4PJ0 U;  4QZ9 A;  1KL9 A;  5HHI A;  4XRH A;  2F76 X;  1DRG A;  2XVT A;  5KFV A;  1Z4N A;  3L5K A;  4FZN A;  5AK3 A;  2PFP A;  1B22 A;  2ZTE A;  2R8G A;  2UVU A;  1PK3 A;  3VCB A;  4PHD A;  2AH5 A;  2AXT U;  4OCZ A;  4O3S A;  8ICP A;  4BDP A;  1N56 A;  1T4G A;  2NO4 A;  4RUC A;  4F4K A;  5KAI U;  3BZK A;  2HHV A;  1RG6 A;  2RDI A;  3QUB A;  4ED3 A;  3TAC B;  4BXO A;  4F5P A;  4UAW A;  1ZQY A;  2F3N A;  4CF5 A;  4A8E A;  3JPS A;  1ZD2 P;  5J0X A;  5J2K A;  2BQU A;  2G09 A;  1ZQO A;  5KG2 A;  2QB0 A;  5ALT A;  2W9B B;  2E8O A;  1ZQX A;  4TUP A;  3UXO A;  2BGW A;  5ALK A;  1F0M A;  5JUM A;  3AQE A;  1QQ7 A;  3UXP A;  4C4S A;  5KFR A;  5L9X A;  3KZI U;  4NLN A;  2I1Q A;  3GQC A;  1U49 A;  1RDF A;  2Q4T A;  4F5O A;  2KP7 A;  1RQL A;  2YMQ A;  2PFQ A;  4FBU A;  5ALP A;  4O3M A;  2VKQ A;  4O3P A;  2K89 A;  1QSL A;  2RHF A;  2W7O A;  3F53 A;  2WAQ F;  1Z3E B;  4DQI A;  9ICO A;  1SV4 A;  5C0Y A;  3E0F A;  4PL1 A;  4NWI A;  4M6W B;  1KFS A;  2ASL A;  1T3N A;  1PVP A;  2V9W A;  2M9N A;  4F5R A;  2K8C B;  3HWT A;  4NLZ A;  2NO5 A;  1NK6 A;  1L8L A;  1EXN A;  5ALL A;  5GTH U;  5KT4 A;  3L3F X;  2WF6 A;  3M6K A;  5KG0 A;  3HPO A;  1NK0 A;  5J2G A;  5A0L A;  3WU2 U;  2ISP A;  2A1J B;  2FLP A;  2P6R A;  4KLG A;  2KFZ A;  2FDR A;  8ICW A;  1FFV A;  2I5H A;  2DKZ A;  5KFT A;  1JUD A;  2YX8 A;  4B9S A;  9ICN A;  1QSY A;  4YCX A;  9ICJ A;  3NVW A;  1LVH A;  1QH9 A;  2E5S A;  5DLG A;  4B9V A;  5L1J A;  9ICM A;  4JWM A;  9ICC A;  2L5Y A;  1Z00 A;  1NI3 A;  1TKD A;  4QW8 A;  4Y2U A;  3Q8S B;  2LI6 A;  1RXV A;  4IQT A;  5KFQ A;  4M0A A;  2BDU A;  2HHT A;  3G6Y A;  8ICA A;  2KD1 A;  2JZB A;  3WK7 A;  4AP9 A;  2FMS A;  2UVR A;  3MGH A;  4RU9 A;  2AQ0 A;  2ATL A;  1XNS A;  1QSS A;  2HMX A;  1COO A;  1UQV A;  9ICP A;  2YML A;  5ALM A;  4Y2R A;  3RRG A;  2OH2 A;  3KHL A;  4RQ0 A;  2AGP A;  4ECS A;  3F2D A;  1X66 A;  3BDP A;  2LMR A;  1NJZ A;  2K4I A;  1TVA A;  2BHN A;  2Y1J A;  4KLM A;  1NJW A;  5CB1 A;  3MR5 A;  3PML A;  1XU4 A;  4YG2 A;  2Y9T A;  4QZF A;  3LWM A;  3OSP A;  4TQS A;  4MF8 A;  3H7I A;  4EX6 A;  1X6J A;  3V6K A;  3EWA A;  4PH5 A;  2DFL A;  2G5H B;  4ZOH C;  3ETL A;  3WKA A;  2JEG A;  2MSN A;  4CRX A;  5K4L A;  5F9N A;  4ED1 A;  1MSW D;  2LYH A;  4NLK A;  2KSO A;  3I1Y A;  4UBC A;  1XS9 D;  7ICU A;  3TFS A;  1Q8K A;  3WK5 A;  4UB4 A;  1N48 A;  3SV3 A;  4F4X A;  8ICQ A;  5JRT A;  5EWE A;  1PK1 A;  3ISB A;  9ICH A;  1CUK A;  5BOM A;  2BCS A;  3QZ7 A;  3WK6 A;  1X40 A;  1Z19 A;  5KFF A;  2MA1 A;  2W54 A;  1TK8 A;  4Z6D A;  3OGU A;  2VA2 A;  4O3O A;  1NJY A;  2NYV A;  5J0Y A;  4O5E A;  3ONN A;  2ZJA A;  2V4R A;  1NK5 A;  7ICG A;  3IDW A;  2ES6 A;  5AM2 A;  1NK8 A;  4X5V A;  4C4R A;  1GO3 F;  4UAZ A;  1XSN A;  2ZIW B;  2IA6 A;  2Y9U A;  1D8Y A;  4KLO A;  2VA8 A;  7ICQ A;  2E8M A;  4ECU A;  4DEZ A;  3UPQ A;  1S0V A;  4P4O A;  2XGP A;  3EPI A;  3UMG A;  4DF4 A;  4UB2 A;  1ED1 A;  4YVZ A;  1YZ7 A;  4PGX A;  1LKY A;  1D8B A;  2IOF K;  8ICS A;  4RQ5 A;  4F5Q A;  4DSL A;  1MQ2 A;  3JPR A;  4P0Q B;  4F72 A;  4ECW A;  1NZB A;  5CRX A;  4I2H A;  1ZQV A;  4PGQ A;  1URJ A;  2ZIV B;  4J9P A;  5IIJ A;  4B6J A;  5TZV A;  1ECW A;  2W43 A;  1NNL A;  5L1I A;  3N97 B;  3F2B A;  4C8K A;  2KNJ A;  4IQV A;  5AKL A;  4E0D A;  2IOF A;  2HBK A;  2XY5 A;  3RTV A;  2EAN A;  3ORY A;  5AM0 A;  8ICE A;  1SZH A;  3SMV A;  3QU7 A;  5KFP A;  3BZC A;  2EQY A;  1QQ5 A;  4YD1 A;  4GXI A;  4C8O A;  3IG5 A;  3ZD9 A;  1SL2 A;  1ZRN A;  1ZQR A;  5J2E A;  5ALI A;  7ICJ A;  2KMD A;  1NZP A;  4M47 A;  1B4F A;  1N5W A;  1JMS A;  3OHA A;  5KTQ A;  1S76 D;  4BWJ A;  3C2L A;  2C2D A;  1KQQ A;  3VC8 A;  4ACO A;  4I2J A;  4ZH4 A;  4RPY A;  4EBC A;  1IG6 A;  4CDG A;  5L1M A;  2BPC A;  2W9M A;  1JRP A;  1O03 A;  2HSZ A;  1S0O A;  3SAH A;  4DSJ A;  2ZUB A;  1ZQ1 C;  1JRO A;  4ED8 A;  4RNM A;  3QU9 A;  3RB4 A;  1ZQQ A;  2KIV A;  8ICC A;  1X9M A;  4RQ4 A;  1V38 A;  1Q3U A;  4C80 A;  4I2F A;  2AJQ A;  1UHU A;  2BKE A;  1PVR A;  1XC9 A;  2M0N A;  3AEV A;  5ALY A;  3TFR A;  2FMP A;  3TAD A;  3UMB A;  1N2X A;  5J0T A;  2F8K A;  4ELT A;  2E1F A;  1CI4 A;  1U45 A;  1Q46 A;  4Q44 A;  5KT2 A;  5DKW A;  3E2E A;  3F5A A;  4KX5 A;  3GDX A;  5HR6 A;  3GZF A;  3NUQ A;  2WF8 A;  7ICO A;  3HKZ C;  3ZDD A;  4QIW F;  1ZYQ A;  1PVQ A;  1SGG A;  7ICF A;  4OJL A;  4RNN A;  5CR0 A;  4MFA A;  4F4Z A;  3QE9 Y;  4DFJ A;  2CXY A;  4K4I A;  2J6T A;  2OM6 A;  3MFI A;  1SXE A;  3PST A;  2VIX A;  4OJ5 A;  3C5G A;  3SV4 A;  4I2C A;  1JXL A;  8ICL A;  1ZQZ A;  3KFU F;  1XSL A;  4DFM A;  2DGZ A;  3NRZ A;  1T7P A;  4R66 A;  4I27 A;  4UB6 U;  2ZIW A;  4M9J A;  2D3D A;  2H5X A;  4P4M A;  2ISO A;  5KT7 A;  4I2A A;  1JN3 A;  4P0P A;  3SEN A;  1F44 A;  4NLB A;  2AQ4 A;  1RYU A;  4J9O A;  2BCQ A;  1DOQ A;  3SQI A;  4FFD A;  2KKV A;  4IC9 A;  2DPI A;  4J9M A;  5AKK A;  5HML A;  4HAI A;  3GIJ A;  2WAQ C;  4KLI A;  9ICV A;  2G07 A;  3BQ2 A;  5DDY A;  1ZD4 A;  4C0Z A;  1FIQ A;  3B9J A;  2W3R A;  3OHB A;  4JV1 A;  4KLD A;  3TI0 A;  3FYH A;  1OUQ A;  2KEY A;  2FI1 A;  1BPY A;  2PI4 A;  2KTQ A;  2KIC A;  5ALJ A;  4UB3 A;  4QZC A;  2BPG A;  5IIK A;  3GII A;  2K4E A;  3Q8M A;  5CWR A;  3LVW A;  2GOL A;  3FC4 A;  2BCV A;  2HOQ A;  1ZQN A;  1L7O A;  3CW2 C;  4ED6 A;  4M9L A;  5KFY A;  4EEN A;  1P7D A;  1L6N A;  4DSF A;  3L4P A;  4F50 A;  2KIW A;  4UAU A;  5ALN A;  4KLE A;  5EE9 A;  9ICW A;  1SXD A;  3RR7 A;  4DQQ A;  3J81 j;  3D2S A;  4MEY A;  1UA0 A;  8ICY A;  4YXJ A;  2W55 A;  1V97 A;  3ICX A;  2MUT B;  4UAY A;  3DDH A;  2FPK A;  5ALX A;  1MA7 A;  4EEK A;  1U9L A;  5AI9 A;  5AKI A;  3MGI A;  3Q8K A;  2EAM A;  3EPG A;  1IM4 A;  1S0M A;  2ZTC A;  2F2A B;  4YXM A;  3A0B U;  2W8K A;  3IRU A;  5AM3 A;  1HEK A;  5ALF A;  3OSN A;  3ETR A;  3BS5 B;  7ICS A;  4Y2T A;  3PSF A;  5DB9 A;  1ZXI A;  4Q45 A;  3H4D A;  3Q8P B;  3Q8R B;  4NLG A;  2NRX A;  4ECZ A;  1L8O A;  3PW5 A;  4QZE A;  4RQ6 A;  1NKB A;  3DV9 A;  2RDJ A;  2FMQ A;  8ICK A;  3KTQ A;  2XCA A;  2R8H A;  3HKZ F;  5DB8 A;  3B0X A;  1A0P A;  5AKY A;  2YMM A;  2HCF A;  4F2S A;  2JXJ A;  4TUR A;  5KFK A;  3C1Y A;  3NGD A;  3H8J A;  4B9U A;  2PI5 A;  8ICT A;  2ZJ8 A;  7ICP A;  5TIS U;  3RAX A;  5ALS A;  5CJ7 A;  2K60 A;  4GXJ A;  4M6W A;  3KD3 A;  2BCU A;  4YN4 A;  1J2N A;  3I28 A;  3R9K A;  5ALW A;  5KFC A;  1NKC A;  4USA A;  4ELU A;  1NJX A;  4PHA A;  3WK8 A;  3RB0 A;  4OJO A;  3H8W A;  4Y2X A;  4NLC A;  9ICG A;  2VAN A;  2IHN A;  4JK1 A;  2W8L A;  4RQM A;  1RM6 C;  3T5H A;  4UB1 A;  8ICJ A;  5J8Y A;  4J9R A;  2HDO A;  3JPO A;  3BJY A;  4BWM A;  2P35 A;  4YMO A;  2W9C A;  4DS5 A;  3ZDE A;  4DOB A;  3PW0 A;  2A1J A;  3RH5 A;  2E8P A;  3TQ1 A;  4DOA A;  3BQ0 A;  1WYG A;  3WK9 A;  1DXS A;  4RUA A;  1ZQD A;  4IQU A;  4C8L A;  4K4H A;  2MU2 A;  4Z6C A;  2ASJ A;  2YMP A;  3OPX A;  4UBB A;  4O9M A;  3WKE A;  5AIA A;  4Y2J A;  1BPE A;  4Q8E A;  1Z00 B;  3UXN A;  1A6S A;  2OXO A;  2AU0 A;  5J2F A;  9ICU A;  2KE7 A;  3QEA Z;  1BNO A;  3N28 A;  1SV0 C;  3GU3 A;  3K4G A;  1M6Y A;  4U7C A;  8ICR A;  3CRX A;  3M8S A;  2R18 A;  4TUQ A;  1BVS A;  3I76 A;  5EWG A;  2PXI A;  2E1E A;  1ZD5 A;  2ZXI A;  1S10 A;  2BZF A;  2BQR A;  2HHW A;  1ZQU A;  1KBU A;  4NL9 C;  3V7L A;  1JI7 A;  1D9F A;  5DQH A;  2HOF A;  3KHR A;  3MBY A;  9ICQ A;  5AK5 A;  3M7D A;  2KZM A;  9ICE A;  1B43 A;  5DBC A;  4BGD A;  1TAQ A;  1ZQI A;  3O0F A;  3WKD A;  3AM9 A;  2VJ5 A;  1MC8 A;  4QW9 A;  3HRD D;  4O5K A;  4KLS A;  3G6V A;  4Z6E A;  5KT5 A;  2BR0 A;  2BCR A;  5J0U A;  4OO1 J;  3AU2 A;  4ED0 A;  5IIM A;  1V85 A;  3H0L B;  3KOO A;  1KDH A;  4O0I A;  5BPC A;  7ICN A;  3PX6 A;  4Z6F A;  5DBA A;  2EDU A;  2G06 A;  4US9 A;  5H2F U;  1J97 A;  2XGQ A;  3SI8 A;  4F5N A;  2KN7 A;  1UPH A;  4FZL A;  2H3F A;  3IG8 A;  2K8A A;  1LKY B;  1S0N A;  4QZ8 A;  3IP4 B;  8ICB A;  3NRW A;  2NRZ A;  3F2C A;  3BQT A;  3H40 A;  1L7N A;  4JUZ A;  2ZIU B;  2BPF A;  5KFS A;  4RQ2 A;  5DQI A;  4J03 A;  3JPN A;  4LJX A;  4F91 B;  2JMG A;  2KVS A;  3KBB A;  8ICO A;  2QB1 A;  5AIC A;  4R8U A;  4QJF B;  4RQN A;  4FBT A;  2EZY A;  2PKE A;  2NV3 A;  2YTU A;  2ZIX A;  4J9K A;  1KEJ A;  4DFK A;  1SIJ A;  3WKC A;  5KT6 A;  1QCK A;  3QEB Z;  1WWU A;  4JB3 A;  4PHE A;  3K1R B;  3C5F A;  2W9C B;  5J2I A;  1L3V A;  3LDA A;  2WF7 A;  2KV2 A;  3SZ2 A;  1S5L U;  1UT5 A;  4M04 A;  2E8N A;  2JEI A;  3KHH A;  5J8Y C;  1WG8 A;  4DLG A;  4MFF A;  4ECT A;  2B0C A;  4DO9 A;  2JGA A;  5HMM A;  3N7R C;  3PSI A;  1FEZ A;  1ZQW A;  2H3I A;  1ZQM A;  4BXO B;  1SZP A;  5C5J A;  3A0H U;  4P0Q A;  4Y2V A;  4I2B A;  7ICM A;  2F44 A;  4J9Q A;  2ZIV A;  4Y2P A;  4ICA A;  1UT8 A;  5J2C A;  3KZX A;  1SKR A;  2ZG6 A;  5J2H A;  2NRT A;  3QZ8 A;  2IBK A;  3RJI A;  4UAT A;  1JXE A;  4DFP A;  3RJJ A;  3PR4 A;  5JU5 A;  5DG8 A;  3Q8Q B;  1IXR A;  4CNQ A;  4R63 A;  3RJF A;  2HVI A;  4M9N A;  5HHH A;  4LZG A;  3HP6 A;  2F1I A;  5EE3 A;  2XID A;  5AM1 A;  2CPR A;  3GIL A;  1KLN A;  1NKE A;  4NM2 A;  5AI8 A;  4Q8F A;  3V7K A;  4GXK A;  5ALQ A;  4YR2 A;  4WJ3 B;  4FS2 A;  1JAL A;  1T8E A;  2HHQ A;  5J29 A;  5KG7 A;  4FS1 A;  3SAG A;  2C22 A;  1U48 A;  4FE3 A;  5AM4 A;  4HYK A;  4O3R A;  3IN5 A;  2HI0 A;  1DGS A;  2J6U A;  5AKZ A;  4DL5 A;  3AUO A;  2RQ5 A;  1KN5 A;  2QKQ A;  1C7Y A;  1SWW A;  3HW8 A;  1JX4 A;  4QZA A;  2FLL A;  2R8I A;  2LM4 A;  3V6H A;  5KL8 B;  1ZD3 A;  4DL3 A;  2FPM A;  1T3Q A;  4B9M A;  2HBL A;  4DSK A;  1SKW A;  3DEE A;  2PMZ C;  3PW4 A;  2WB1 C;  3HJE A;  2JH7 A;  3CP8 A;  1XO0 A;  9ICB A;  1QLN A;  3RAQ A;  4EBD A;  1SWV A;  1Z1V A;  3OJU A;  2W11 A;  3T5L A;  3N4M B;  3TKA A;  5KNI A;  5F3X B;  3GFK B;  1YT3 A;  4DWI A;  5ALZ A;  4DF8 A;  4DQS A;  4JV0 A;  4DSI A;  4UAV A;  3SR6 A;  2K4P A;  2LYB A;  3NVV A;  8ICG A;  4CE6 A;  3RB3 A;  4I2I A;  2E3T A;  4F8R A;  4C8N A;  2DL0 A;  2FJ6 A;  2K8B B;  3V72 A;  4KLL A;  2NRV A;  3TAN A;  4US8 A;  3LK9 A;  3NVZ A;  1OW5 A;  3UQ0 A;  1ZQA A;  2QAR A;  4I28 A;  1ZJM A;  3N7P D;  5JTI A;  3PW2 A;  5KFO A;  5CA7 A;  4P0P B;  1C20 A;  3PV8 A;  1RYS A;  2OCE A;  9ICI A;  2LKY A;  5EE1 A;  4RNO A;  4KMO B;  3NVY A;  2IMW P;  1NK9 A;  2A1A A;  4CF3 A;  2XC9 A;  4OJP A;  3V6J A;  4K4G A;  4F3O A;  4F4W A;  2MUT A;  1BNP A;  4F93 B;  1MN8 A;  3MC1 A;  5HR7 A;  1OXJ A;  1K1Q A;  1RZT A;  2EZZ A;  1Z4O A;  3ZDB A;  3QYP A;  3CYM A;  4DLE A;  2OWO A;  2H3Z A;  2W04 A;  3Q8L A;  2KZ3 A;  1TV9 A;  7ICK A;  4C7Y A;  1XWL A;  4EYI B;  5D4B A;  4ECV A;  2I6X A;  3QUC A;  3QNM A;  2HBJ A;  2C2R A;  1PK1 B;  3RJE A;  2KG5 A;  1RYR A;  5AKE A;  9ICA A;  5EWF A;  3PO4 A;  4YD2 A;  3M1Y A;  2LYA A;  4IR1 A;  1QTM A;  2KJ9 A;  1RPL A;  5KFE A;  8ICZ A;  3C2M A;  7ICV A;  2ASD A;  2VJ4 A;  3PW7 A;  2H3Q A;  1SL0 A;  3C21 A;  1BGX T;  5ALE A;  3PZP A;  4Q43 A;  2FLN A;  4DL6 A;  1ZQF A;  3LVV A;  4UAS A;  5IIN A;  5AI4 A;  4P2H A;  4MF2 A;  3LWL A;  5AHX A;  4IRD A;  4KMU A;  4F4Y A;  1S97 A;  4EZ6 A;  4KTQ A;  1HJP A;  1PUZ A;  3D2N A;  1VDV A;  4M2Y A;  2YB4 A;  4BX9 C;  4CF4 A;  1TE2 A;  1YZ6 A;  2KKP A;  4UW9 A;  3BS7 A;  4AYB F;  7ICH A;  1PZN A;  1ZRM A;  1N5X A;  3IHQ B;  3S6J A;  4ECY A;  4ED7 A;  5F9L A;  4ELV A;  3H4B A;  1ZJN A;  2ZUC A;  1SL1 A;  5KFD A;  8ICV A;  4M9G A;  4MFC A;  5CP2 A;  5G5G A;  5J0S A;  5KFH A;  4G9B A;  2MRL A;  3JPQ A;  5AKH A;  2ODG A;  4UQG A;  3M6Z A;  4CGZ A;  3RF9 A;  5D46 A;  1D8L A;  4YMN A;  3T3F A;  1D9D A;  1ZQE A;  1L7M A;  2DF4 B;  2CN1 A;  2WFA A;  4ECX A;  2KHQ A;  3QU2 A;  2W7P A;  4ECQ A;  1IV8 A;  3C28 A;  2Y0S C;  4FO6 A;  4LVS A;  5HNK A;  4QZB A;  4Y2Y A;  2JRZ A;  4EBE A;  4KLT A;  3SD7 A;  2ALZ A;  5T14 A;  4QWA A;  1L7P A;  3MR2 A;  4TUS A;  3C2K A;  4UB8 U;  1ZQS A;  1WCL A;  4RQ8 A;  8ICM A;  3PO5 A;  4DFD A;  3C29 A;  7ICI A;  5J0Q A;  2XI9 A;  5IIO A;  1L3T A;  4QZI A;  5B5E U;  3FM9 A;  3PY8 A;  1N63 A;  4F92 B;  3QU4 A;  2XIC A;  5AM5 A;  3MR6 A;  1X2I A;  3THV A;  5KG4 A;  4QWB A;  4KLU A;  2HBM A;  1LV5 A;  3KKA C;  4YQW A;  3GIM A;  1ZQT A;  4EZ9 A;  4QWD A;  7ICR A;  4DL7 A;  3KHG A;  4OJ6 A;  1CEZ A;  3TAP A;  2Y0S F;  2XY7 A;  1DK2 A;  2ZTD A;  2KK0 A;  2G08 A;  4RPZ A;  5ALV A;  5J0R A;  4C8M A;  4EEY A;  2B21 A;  2G5I B;  5ALR A;  1S9F A;  4I29 A;  4DOC A;  3MFH A;  4B9N A;  4EYH B;  2O6K A;  2F1J A;  2JEJ A;  2MAX A;  1N61 A;  4QZG A;  2QB0 B;  2W9B A;  4NY8 A;  4YP3 A;  3M9N B;  2AHO B;  1TAM A;  2JV3 A;  4C7Z A;  2YQE A;  5AKG A;  1FFU A;  4CCH A;  1VLB A;  2HHU A;  3GV8 B;  1ZQH A;  3NAS A;  9ICR A;  2WF5 A;  3ISC A;  1WUD A;  2FPL A;  1X9X A;  4AYB C;  3SAF A;  1B0X A;  3H0M B;  2Y1I A;  5DGB A;  4J9N A;  2KOB A;  2ZIU A;  3IV6 A;  1UA1 A;  3AMZ A;  1NK7 A;  3E58 A;  2LHT A;  4NXZ A;  4DL4 A;  1ZET A;  5KAF U;  4C4T A;  2XCP A;  1T94 A;  5KFB A;  5KFM A;  1HIW A;  2A3V A;  1O08 A;  3G6X A;  5J2D A;  2PFN A;  1CRX A;  1J2M A;  1SV0 A;  3ZD8 A;  2JZB B;  4RT2 A;  5FP0 A;  4I2D A;  9ICX A;  1H38 A;  4QZD A;  1S77 D;  7ICE A;  4XUS A;  4NV0 A;  2DWQ A;  4F2R A;  4YR0 A;  2RP5 A;  3QXG A;  1N60 A;  3MDC A;  8ICF A;  2YB1 A;  3TAQ A;  1NK4 A;  3EW9 A;  2GLE A;  3U26 A;  2ZJ5 A;  4IL6 U;  2EAO A;  4DQR A;  5E79 U;  4GC6 A;  3HIL A;  1U47 A;  2UVW A;  3GV5 B;  2Z7J A;  2HHX A;  3IM1 A;  3EUB 2;  4GIB A;  5J0O A;  4QZH A;  5AI6 A;  4DSE A;  3WK4 A;  3NS1 A;  4RQ7 A;  4RT3 A;  1DGJ A;  3PVX A;  9ICS A;  3T5J A;  2W3S A;  3NTU A;  4KLF A;  3KKA A;  3GIK A;  4QNL A;  1A77 A;  5L1L A;  5DB7 A;  2NRW A;  1KW4 A;  2ZXH A;  4EX7 A;  2BQ3 A;  4R8U B;  1JIH A;  2EAP A;  3N7S C;  3JPT A;  5KT3 A;  3ZDA A;  2EZX A;  4LZD A;  1U4B A;  5KG3 A;  1LB2 B;  1DK3 A;  3UMC A;  2WF9 A;  3H8M A;  2B6G A;  3V7J A;  4PZO A;  4DS4 A;  1KRP A;  2F1H A;  2RRD A;  1S8O A;  1L3S A;  5EE0 A;  1BPB A;  4XA5 A;  3WKB A;  5J0W A;  5CEH A;  2JR5 A;  5GTI U;  3D6J A;  5KFZ A;  3EZ5 A;  2JHD A;  4J9S A;  2N1R A;  3FAH A;  1ZQP A;  4IS7 A;  3K1Z A;  2UVV A;  2C28 A;  4RQ1 A;  5DB6 A;  1BPD A;  2HVH A;  2DPJ A;  4U6P A;  4O3Q A;  2J6S A;  2H3V A;  5KFI A;  4I2G A;  5KL1 B;  3PX4 A;  1MQ3 A;  2R8J A;  2DBY A;  4KLQ A;  1A76 A;  4MHV A;  2A19 A;  4YMM A;  5KFJ A;  5J2A A;  2KJ8 A;  1KTQ A;  2AGO A;  2BDP A;  2DKX A;  2G0A A;  2KVC A;  4RQ3 A;  4PZN A;  2D8C A;  4IRC A;  2KSO B;  3PX0 A;  1WCN A;  1L5U A;  2I9G A;  4R64 A;  3OTQ A;  3T5K A;  2K4H A;  1ZQL A;  2F77 X;  5KFU A;  4XQ8 A;  5AK4 A;  4FZM A;  5KG1 A;  3ZDC A;  2W03 A;  3BS5 A;  5ALO A;  1XO1 A;  2LPE A;  1SB3 C;  5D49 A;  2D6F C;  1TK0 A;  1ZQB A;  3ISD A;  5III A;  9ICF A;  4B9L A;  4GLX A;  2OEH A;  3K75 D;  4G3I A;  3M9M B;  3JPP A;  2OHF A;  3PMN A;  3GV7 B;  3ALR A;  2LM1 A;  3C1Z A;  3H8S A;  3AN1 A;  4O3N A;  4I2E A;  5G5H A;  2P66 A;  4IR9 A;  4O5C A;  9ICL A;  5AKX A;  1V9P A;  4IRK A;  1KKX A;  5DQG A;  2WHE A;  2YY6 A;  1HUO A;  3MGV A;  1ZOL A;  2EH9 A;  9ICT A;  5BOL A;  3C23 A;  5DG7 A;  2P6U A;  5AI5 A;  3RBE A;  1RXW A;  3CNH A;  3MAB A;  1BPZ A;  3EYZ A;  4TQR A;  1KFT A;  5CHG A;  4BJQ A;  5B66 U;  2IHM A;  5EOZ A;  3T79 A;  1F5S A;  5KFL A;  2R8K A;  3FDS A;  4RPX A;  2GWS A;  3LYS A;  2AGQ A;  4RZR A;  2YN4 A;  4UB5 A;  2OYY A;  3H0R B;  3BQ1 A;  1TFR A;  4DL2 A;  2LBO A;  3M8R A;  4OD0 A;  3HX0 A;  1RQN A;  2WB1 F;  2GH1 A;  8ICH A;  4JWN A;  3AL0 B;  4GFJ A;  2QLT A;  1WWV A;  2HHS A;  3ED5 A;  5HP4 A;  4ED2 A;  4NM1 A;  1TAU A;  4GC7 A;  2HW3 A;  5DDM A;  1COK A;  3B0Y A;  4EEL A;  4BUG A;  5KG5 A;  5AI0 A;  2KJ5 A;  1IIP A;  3PNC A;  2C2E A;  1X42 A;  5DG9 A;  2DUY A;  2JEF A;  1Y88 A;  1KFD A;  2QAR B;  5J0P A;  3RH4 A;  2VA3 A;  2IOH A;  5DGA A;  1NOM A;  3QUQ A;  3OJS A;  1X9S A;  1ZQC A; 
#chains in the Genus database with same CATH homology
 2BZF A;  2EZZ A;  1CI4 A;  2EZY A;  2ODG A;  1QCK A;  2EZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...