2BZFA

Structural basis for dna bridging by barrier-to-autointegration factor (baf)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2bzfA00
2ODGA 2EZXA 2BZFA 2EZYA 2EZZA 1QCKA 1CI4A
chains in the Genus database with same CATH superfamily
2KNJA 3PSPA 3SQIA 4DF8A 4DL7A 4O3OA 4CGZA 4R8UA 2W3RA 3ED5A 8ICCA 5ALZA 4PH5A 1S0VA 7ICPA 2K4HA 2LKYA 5DDYA 3SR6A 2QKQA 4RT3A 5DG7A 2VA8A 1P7DA 2EDUA 3FAHA 5DB7A 2UVRA 4Y2RA 3H8WA 2PXIA 2ODGA 2AJQA 1Z1VA 3ICXA 5EWFA 2DFLA 1J97A 2W9CB 2D3DA 4C80A 4YMMA 1PK1B 3RAXA 1JMSA 7ICVA 1L3SA 3CRXA 1XS9D 5AKZA 5IIKA 4P0QA 2RLTA 3QU4A 4F91B 1U49A 3BJYA 2HMXA 4JV0A 4I2GA 5KG4A 3SV4A 4C0ZA 2KD1A 3SENA 2EQYA 5F9LA 9ICUA 3RFAA 2CXYA 3NS1A 4DQSA 5J8YC 3SMVA 5CR0A 3BZCA 2E8MA 5J0QA 3KHHA 4O5CA 3SAHA 2PFQA 2D6FC 3C28A 2PFOA 3UMBA 3ZD9A 4M9NA 1ZQSA 4P2HA 1SKSA 4GC6A 4K4IA 1D8LA 2BPGA 2KE7A 4C8NA 5ALNA 5L1JA 4AYBF 1YZ7A 3V6JA 3F2BA 1BNOA 9ICRA 3QU7A 3NRWA 3UXNA 2FMQA 1X2IA 3WK8A 5J0PA 2W9AA 4MFFA 8ICJA 1RQLA 4RU9A 1HUZA 1VLBA 1QQ7A 2OCEA 5DB6A 4NLZA 3JPPA 3AM9A 4DFMA 2ISOA 1BPYA 2C2DA 2HHUA 1A0PA 4UB1A 2W11A 3OJSA 4M9HA 3GIKA 4IS7A 4QNLA 3QX7A 3E58A 1SXEA 1U47A 1KRPA 4PHAA 4G3IA 3AN1A 3U26A 5E79U 2V9WA 3RJEA 3AUOA 3MBYA 2LI6A 4YD2A 2B21A 3QU9A 3LK9A 3RBDA 2F1JA 4RQMA 4F4KA 2G0AA 1ZJMA 2NV3A 3IG8A 8ICNA 8ICYA 1BNPA 2OYYA 5HNKA 2EH9A 3PX6A 3H8SA 4OJPA 1TAQA 3KHGA 2YQEA 5EE0A 2LM4A 2I5HA 1IM4A 1ZD5A 1XSPA 2JEIA 3T5LA 4Q45A 1KDHA 1F5SA 2ZIUA 2FLLA 3ZDDA 3FM9A 3TI0A 2OHFA 2W55A 2QARB 3ZDBA 4P0PA 4ZH4A 4F5RA 3TARA 4ECXA 2JEJA 3VC8A 1HJPA 1S0OA 2W8LA 4M2YA 5J0UA 4B9VA 1ZYQA 4R63A 5JU5A 2YX8A 1XC9A 4NLBA 1SL0A 5HMLA 2ISPA 2ZJAA 3IRUA 1J2NA 2BDUA 4ED6A 2NRWA 3C23A 4OO1J 2XIDA 2IHNA 3NRZA 2YTUA 4BWMA 3I76A 1TVAA 2F1HA 4ED8A 3L5KA 2DPIA 2IOHA 4RQ0A 4C8KA 3ETLA 3N4MB 4Y2JA 1YT3A 2F76X 3MDCA 4EELA 4DL4A 2H3VA 4K4GA 1HUOA 1F44A 1JI7A 1ZQWA 5KT3A 5AI0A 4RZRA 4IL6U 4QZHA 5KFDA 1B43A 2ZIVA 8ICBA 4F5QA 1T8EA 8ICUA 2KSOA 4UASA 4NLKA 2W8KA 5ALVA 4R65A 8ICIA 4J9PA 4F5OA 5KFQA 4BXOB 2H3FA 3KFUF 2WF5A 4F5NA 3HRDD 4ACOA 4FS1A 2KHVA 2Y1JA 2IMWP 1ZQOA 1KFSA 4ED0A 4UAZA 4E0DA 4RQ7A 3BZKA 5J2EA 4RPZA 2MUTA 3RJGA 4I2BA 2AQ4A 4UB6U 2RRDA 8ICZA 4JK1A 3HX0A 8ICHA 2K4IA 2KKPA 2CN1A 9ICGA 4MFAA 4FBUA 4M04A 1KQQA 1SB3C 3UXPA 1N63A 1DK2A 2HBMA 5KFCA 3GIJA 4MF8A 1S77D 3ZDCA 1V9PA 1TFRA 4UARA 5KFWA 2NRZA 3B0YA 4DCCA 2ASLA 4J9LA 3C5FA 4LVSA 5G5GA 1X6JA 2E1FA 2EZZA 3HILA 5TISU 4ECZA 3SAFA 2F77X 4DSEA 4NWIA 3HWTA 1SV0C 4F2RA 3LVVA 3H0RB 4NV0A 1U45A 1UHUA 5KFFA 5DQHA 3PV8A 3Q8MA 5KT4A 7ICLA 4TURA 2CPRA 1O03A 4QWBA 2KJ9A 3TKAA 2ZTCA 5EWGA 4IRKA 1ZQBA 1Q46A 8ICEA 1VDVA 4Y2XA 2BQRA 9ICLA 4C8LA 1IG6A 3B9JA 2AGQA 2GOLA 4DL5A 4MFCA 3DV9A 4KLIA 3NVWA 1Z00B 2QB0B 3KD3A 4I2FA 5DGAA 2EANA 4DL6A 3PVXA 2F8LA 4MEXA 3WKBA 2DUYA 5J2AA 1NK7A 3AEVA 2GLEA 1QH9A 2FPMA 1UQVA 5KT5A 3HKZF 9ICQA 3GV5B 3PR5B 3KZIU 1C7YA 4UAVA 2LYAA 2VJ5A 2WAQC 3LYSA 1X9WA 2JXJA 5CA7A 5AM3A 1WG8A 1TKDA 2WF8A 4I27A 1T94A 1JUDA 2FE9A 4PGXA 4DOCA 2JEFA 5BOMA 4DL3A 4BDPA 5J2HA 3J81j 4TQRA 4DO9A 4RQ5A 5KL1B 3F2DA 4UAWA 4PPXA 3N7RC 2L5YA 2A1JB 3MC1A 3C21A 2XCAA 4NL9C 1L7OA 1QCKA 2KMDA 2NRVA 1WWVA 3QUTA 2JRZA 3I28A 2E8OA 2DBYA 3N7SC 4JWMA 3L4PA 3IN5A 2V4RA 3IV6A 4O3NA 4QWEA 2QLTA 3WKCA 2G06A 3TAPA 3NVVA 4C7ZA 3VCBA 4DFDA 9ICXA 4F2SA 3RB3A 1Q8KA 3QEBZ 3M9OB 3KKAA 3BS5B 2R8GA 1NK4A 4KLFA 3SD7A 2XGQA 4KLQA 4GXKA 3AU6A 4CRXA 1PZNA 1TAUA 3IG5A 2KTQA 1X40A 2JZBA 1Y88A 3A0BU 1COOA 3D2QA 5FP0A 3WU2U 5B5EU 2EAMA 1PUZA 1ZQGA 4Y2YA 3SEIA 4EEYA 1NOMA 3ISDA 1WWUA 2HOFA 3OJUA 5C0YA 2KP7A 2W7OA 2R18A 5KG7A 3QU5A 3UQ2A 2DKXA 2AXTU 4RQ4A 3PMLA 5ALPA 3MGHA 2HHWA 2EZYA 3NVYA 3TQ1A 1LKYA 5D46A 4Q44A 5KG3A 2W7PA 1X66A 5ALUA 3C5GA 3LWMA 2KV2A 1ZXIA 5KL8B 1ZQUA 3QYPA 8ICTA 1UT5A 4UBBA 5IIIA 1ZQ1C 5DGBA 1U4BA 4QJFB 2IOFK 2OM6A 4B9LA 2EAPA 1NKEA 3NUQA 5KFYA 2AGPA 1NK5A 4UW9A 3L3FX 5J0RA 1NKBA 1QSLA 4O3RA 4DOAA 9ICHA 7ICEA 3RR7A 7ICRA 1UCVA 4NM1A 3RF9A 4B9TA 3JPOA 2M9NA 2ZJ8A 3AU2A 1URJA 2J6TA 2O6KA 4M9LA 7ICJA 3CP8A 2AGOA 2HCFA 5DQIA 5KFNA 1UA1A 3WK9A 1L7PA 3NASA 5AKEA 2KHQA 4OJOA 1JXLA 4QIWC 4ECWA 4DS5A 2HHXA 4ZOHC 3K1RB 7ICHA 1IV8A 2ASDA 4EYHB 4PHPA 5KAFU 4UQGA 2EZXA 2AQ0A 5J2FA 3C29A 3ZDAA 4QZ8A 3RH5A 5AKIA 1S9FA 3SZ2A 1NKCA 4F93B 3IP4B 1K1QA 2VA3A 1X9SA 4GXJA 4KLLA 3JPTA 2LM1A 4FFDA 2MAXA 2V4QA 2E3TA 2XO7A 2K60A 4RQ3A 4CE6A 2A19A 3WKAA 3H8JA 3AQEA 4UB4A 5DBBA 4F50A 1RXVA 5ALYA 4EX6A 5BOLA 2DGZA 5ALEA 4UBCA 4RQNA 3PSFA 4Z6DA 4YVZA 4JV2A 5HR7A 5AM5A 3H4DA 3WKEA 2IHMA 2R8HA 3Q8SB 3Q8QB 2C22A 2F1IA 5AICA 2HSZA 1EXNA 5F9NA 1X42A 3DDHA 1X9XA 2P35A 3TANA 1L7NA 5AKLA 1MQ2A 4Q43A 3R9KA 1BPZA 4Y2PA 2W9BB 3THVA 1RYRA 2KZ3A 3BQTA 2VIXA 4US8A 2BPFA 5KFTA 5G5HA 1RQNA 4M6WB 3T5HA 1S8OA 2ASJA 1T7PA 9ICJA 4R64A 2C28A 3PMNA 5IILA 1DRGA 5AKHA 1F0MA 1N5WA 4EBCA 2KKVA 3D2NA 3LWLA 1Z3EB 5AKYA 1ZD4A 2ZIXB 2F2AB 3G6VA 4J9NA 4TUQA 4DLGA 5AKGA 4OJ5A 3RH6A 1X6IA 4QZGA 2FMPA 4K4HA 2VJ4A 5HMMA 5DG9A 1JXEA 4DWIA 2KICA 4FBTA 4GFJA 3RB4A 3BQ7A 5KFVA 4IR9A 5L1IA 4UAYA 1LB2B 1C20A 1XNSA 5KTQA 5AM4A 3MR2A 3JPQA 2ZXIA 5KFZA 5CEHA 5J8YA 5IIJA 1KEJA 2YMPA 2K4PA 1N56A 5AIBA 5CWRA 1LV5A 1N62A 3Q8PB 1V85A 3ORYA 1XO0A 2FMSA 2NRXA 3H4BA 3RJFA 3EUB2 4QZAA 4I29A 4NLGA 2W04A 5KG1A 1NZPA 2GH1A 4Q8FA 4WJ3B 2CRXA 4P4MA 2DL0A 4RPXA 1V38A 3V6HA 1SL1A 4O5KA 1ZQLA 4F72A 4LJXA 1L7MA 2JH7A 1COKA 4QZDA 4DSJA 4ELVA 2HI0A 4IR1A 5DDMA 2XC9A 5ALMA 2DQNB 5L1KA 3ZI4A 1IXRA 2D8CA 5BPCA 3SYZA 8ICAA 3H0MB 2FPLA 5AM1A 2IOFA 5AHXA 2UVUA 4UAUA 2BCVA 4QWCA 2NRTA 3GFKB 1ZQMA 4DSKA 5DLGA 4TUPA 4DSLA 5KFAA 3TACB 2LMRA 2KZZA 4Y2VA 4GLXA 3N97B 1BPDA 5KT6A 1FO4A 3G6YA 1A77A 3LDAA 4PZNA 4YR3A 9ICFA 2OXOA 4NLNA 5ALOA 4R66A 4EBEA 4UB2A 5AK6A 1LVHA 1H38A 5AI9A 3FDSA 1RYUA 2YY6A 5ALDA 4F4XA 4IQWA 3GZFA 4OD0A 5KFLA 2HHSA 3KZXA 4HAIA 2XI9A 1SIJA 2PMZC 5KFGA 2PI4A 2HBKA 5J0TA 3A0HU 1ZQKA 1GO3F 1Z4NA 3RJKA 3PSIA 5B66U 9ICPA 1CRXA 1CI4A 2KVSA 3NVZA 3ETRA 4C4RA 4A8EA 1KFTA 3O0FA 3QEAZ 3MR5A 1FIQA 5ALKA 3QUCA 1SV4A 2OWOA 8ICMA 4DQPA 5KFBA 4BUGA 2MRLA 2ZTEA 5J2JA 3HJEA 3OSPA 2WF7A 3BQ0A 4TUSA 3E2EA 2W9CA 4RPYA 1PK1A 2WFAA 4QZEA 3UM9A 2W54A 2F3NA 4YN4A 1QLNA 3QUQA 4KLDA 3M7DA 4EZ9A 1PVQA 4KX5A 5J0SA 3HW8A 1WYGA 1T3NA 2KZMA 4RNOA 1ECWA 7ICTA 4YFKA 1BPEA 4DEZA 3UXOA 3V7KA 2ZIWB 3WKDA 4UATA 5AK4A 2HHVA 3PO5A 3LVWA 4RUAA 4Y2SA 1TK5A 1SWWA 2ATLA 2IBKA 4C4SA 5AKJA 1L8LA 4O3PA 2PFPA 4I28A 3HPOA 3ZDEA 3ISCA 4F71A 2YB4A 1DGJA 1XWLA 2J6SA 2Y0SC 2IA6A 4F3OA 4Z6CA 3K4GA 3KHRA 2HVHA 1N2XA 2WAQF 1SL2A 4I2CA 2ZJ5A 4J9KA 4ECYA 3GU3A 4I2DA 5AIAA 4CF3A 1JX4A 1KBUA 4RUCA 1MA7A 2Q0ZX 4B6JA 2DWQA 2G09A 4FE3A 3RB0A 5HHHA 3JPSA 4ICAA 3WK5A 4P0QB 3G6XA 2UVVA 1PVRA 3GIMA 5KT2A 2QB1A 2W43A 4EYIB 2JMGA 2K89A 3AL0B 4PL2A 4B9SA 5AK3A 2KK0A 3IM1A 4J9SA 3MGIA 1SV0A 7ICSA 3AMZA 1RPLA 1CUKA 1ED1A 1S5LU 3WK6A 3HP6A 3M9MB 5AI5A 3OSNA 5KFRA 1VJ5A 3RJJA 5EOZA 3GILA 4KLJA 5L9XA 2ZUDA 4NJ8A 2K4EA 2QARA 4RQ1A 1B22A 1D9FA 3HT3A 3MABA 1KSPA 7ICIA 4ECVA 3V7JA 4DF4A 5AKKA 2G07A 4YD1A 5KFSA 4Y2UA 4NY8A 4OCZA 4KMOB 4F5PA 1FEZA 1L3UA 4XQ8A 2E8PA 2XY5A 2E1EA 4EZ6A 3BS7A 1UT8A 2GO7A 3IHQB 3E0FA 2Y9UA 4C8MA 1XU4A 8ICKA 1ZQTA 2E5SA 1OUQA 4KN4A 1D8BA 4C8OA 3N7PD 4U7CA 1ZQHA 1Z19A 1WCNA 2DF4B 3DEEA 4ECQA 3RJIA 2JR5A 3MDAA 4CF5A 4PJ0U 3TADC 5L1LA 3UMGA 4JMUA 3EZ5A 3RTVA 5K4LA 2N1RA 1S0MA 4FO6A 1Q3UA 5KNIA 3PW5A 5GTIU 1DGSA 3ONNA 5JTIA 3F2CA 2ZIUB 7ICKA 2XICA 4RNMA 7ICFA 3SI8A 4FS2A 3OHBA 4P0PB 3IDWA 1NZBA 1B0XA 4O3QA 2VKQA 9ICKA 1K1SA 4BXOA 1ZQVA 2RQ5A 2KIVA 4QIWF 2MU2A 4ECRA 2FLNA 2G5HB 2ZG6A 5KG0A 5DBAA 1ZQIA 4YQWA 1ZQRA 2HOQA 3GQCA 5ALSA 2JEGA 3GV8B 4ED7A 3PW7A 2P66A 1JN3A 4IQUA 4J9OA 1S0NA 3T3FA 2M0NA 2H3QA 2BHNA 4MF2A 5IINA 2BQ3A 2KFZA 3QE9Y 4JUZA 4Z6EA 4O3MA 5EE1A 5C5JA 5KFMA 4M9JA 1T4GA 9ICTA 2JH1A 3FC4A 5JUMA 3K1ZA 4DLEA 2BPCA 3MFIA 3V72A 3CYMA 3M8RA 3QZ7A 2VANA 3S6JA 4I2AA 8ICRA 1L3VA 2HBJA 1ZRNA 4QZ9A 1TK8A 5ALGA 4YXJA 4I2IA 4BJQA 1AQ6A 4ED3A 2ZIVB 5DB8A 2KSOB 2KEYA 3RB6A 3NGDA 5HR6A 2K8BB 2XVTA 4BX9C 4UB8U 4DQQA 4YR2A 4KLMA 4DFPA 5KAIU 1Z00A 2QB0A 2XY6A 4X5VA 4UB3A 4BGDA 4USAA 2A1AA 3RH4A 3RBEA 1NK9A 2MUTB 2WB1C 5DBCA 2OH2A 5KT7A 5HP4A 4O5EA 4YMNA 4Y2QA 3D2SA 1UA0A 4DOBA 1Z4OA 4DS4A 2RDJA 4YP3A 3C2MA 4J9MA 3TFRA 1N48A 3BDPA 3KTQA 3H40A 4ELTA 1J2MA 5H2FU 7ICQA 5EE3A 1ZD2P 2FJ6A 4RQ6A 5KFIA 8ICSA 3GV7B 1WUDA 4J9RA 4M9GA 2ALZA 1A6SA 2K8AA 2J6UA 4XA5A 2BCQA 4F4ZA 4M47A 2KJ8A 1FFUA 3TAQA 2Y9TA 5DQGA 4PHDA 4RQ8A 2OEHA 1A76A 4DFKA 5J2CA 5J0OA 1QQ6A 2A1JA 1L5UA 1KTQA 8ICFA 3JPRA 1NK0A 3F5AA 4KLOA 5KG5A 1RG6A 2JHDA 4YG2A 4Y2TA 5ALTA 1RM6C 4QW8A 2KVCA 4NXZA 4JB3A 5ALIA 4DFJA 1MQ3A 4KX3A 3MGVA 2GWSA 2DPJA 9ICEA 3QXGA 1RXWA 4DQRA 4KTQA 3M8SA 1S76D 1D9DA 1RZTA 4LZDA 3BS5A 5TZVA 1SXDA 1ZQJA 4AYBC 5AK5A 4I2HA 3Q8RB 1ZOLA 5KFKA 4ECSA 4DQIA 1L8OA 1XO1A 5J0XA 1B4FA 1DK3A 1OW5A 3N28A 4KLEA 2AHOB 3KBBA 2ZUCA 1AROP 2E8NA 8ICGA 4CNQA 4EENA 2JGAA 5J2IA 3MR3A 4G9BA 4GXIA 2P6UA 5ALXA 1L3TA 4KLHA 1KFDA 1ZQCA 5J2BA 4F4YA 5DLFA 3M6KA 3SAGA 1ZQXA 1YZ6A 8ICOA 4LZGA 3TFSA 1PK3A 2YMQA 4Q8EA 1NNLA 1DOQA 4PHEA 1PVPA 4B9NA 2KFNA 2FPKA 2YMMA 4XRHA 1RDFA 4ELUA 4ECTA 1UPHA 1D8YA 1NJXA 4NLCA 2RP5A 4US9A 5AI6A 4MHVA 5CP2A 4EBDA 5JRTA 1XSLA 1U48A 1KL9A 1KLNA 2ZXHA 2PMZF 4EEKA 9ICVA 3PX0A 1BPXA 5EE9A 3PW4A 1ZD3A 1NK6A 3QUBA 2YN4A 2W03A 3ALRA 4CDGA 2JV3A 2JZBB 1Z1BA 1QTMA 5KFHA 1NJZA 5CRXA 4QZFA 2R8KA 8ICLA 1MC8A 2PFNA 1FFVA 2H3ZA 5T14A 2ESEA 2R8IA 1ZJNA 5ALLA 5DG8A 3QZ8A 2HHTA 2BZFA 4YXMA 2FLPA 8ICVA 4NM2A 7ICUA 4TQSA 1JROA 2C2EA 1NI3A 3CNHA 4PZOA 2YMLA 3PW0A 2W9MA 2AU0A 9ICNA 5ALJA 1LKYB 4QWDA 3UPQA 1QSYA 1SGGA 4AP9A 4KITB 2MA1A 3C1ZA 1HIWA 2I6XA 1ZQPA 3C2LA 4GC7A 4C7YA 2WF6A 1SWVA 2XY7A 4IRDA 4YCXA 4YMOA 1JALA 1U9LA 1ZQAA 4DSFA 2B6GA 5AM2A 1BVSA 3V7LA 1JIHA 1SZPA 2KN7A 2NO4A 1SKWA 4F8RA 9ICMA 3PX4A 2XCPA 5CB1A 1Q3VA 2H5XA 1QSSA 2EAOA 2R8JA 4I2EA 1T3QA 9ICCA 4F92B 3JPNA 4HYKA 1ZRMA 2Y0SF 4QZBA 5CHGA 3PW2A 3KOOA 4DSIA 4DL2A 2BR0A 3Q8LA 4FZMA 3MFHA 2FDRA 2BKEA 4Z6FA 4U6PA 2LYHA 3NTUA 2ES6A 4I2JA 4JV1A 3T5JA 5L1MA 2W9BA 1JRPA 1TAMA 4OJ6A 1L6NA 2BGWA 5DB9A 4J9QA 2YB1A 1TV9A 4M6WA 3ISBA 1QQ5A 1KN5A 4R8UB 1X9MA 3V6KA 4J03A 2ZIXA 2KG5A 3KHLA 2LBOA 2WF9A 2BCSA 4C4TA 3MR6A 9ICSA 4CCHA 5CJ7A 2NYVA 7ICNA 2G08A 1NJWA 2RHFA 4O9MA 4F4WA 4IQVA 1SKRA 5KFPA 3M1YA 5KFUA 3OGUA 2W3SA 4P4OA 3RJHA 1NK8A 1N60A 2LHTA 1TK0A 2HDOA 3EW9A 3FYHA 9ICAA 2BCUA 4JWNA 2KOBA 1V97A 2C2RA 5AKXA 4KLTA 3H8MA 3UQ0A 2F8KA 4QWAA 3AQFA 3SV3A 2HW3A 7ICOA 5AM0A 4KMUA 1ZQYA 2B0CA 5AI4A 1IIPA 3KKAC 5J0WA 1ZQNA 2HOIA 3WK4A 4FZLA 3D6JA 4PGYA 4B9UA 3C1YA 1ZQQA 2MSNA 2P6RA 3QU2A 3F53A 2G5IB 3F5EA 3I1YA 3OTQA 1S10A 2VA2A 3RAQA 1MN8A 1O08A 5J2KA 3PZPA 3PSTA 5D49A 3BQ2A 8ICWA 5A0LA 3ZD8A 4FZNA 3UMCA 2WHEA 4IC9A 4O3SA 2I9GA 2DKZA 3H7IA 1N61A 3PO4A 3OPXA 5J0YA 1XSNA 4MEYA 3PY8A 3RR8A 4CF4A 3HKZC 5KG6A 4OJLA 1ZETA 2PI5A 4UB5A 3EYZA 5GTHU 8ICQA 4RNNA 1NJYA 4KN7A 1OXJA 1DXSA 5J2DA 8ICPA 1S97A 5DKWA 3B0XA 2AH5A 1TE2A 5KFXA 4ED1A 1ZQZA 4EX7A 5J2GA 3T79A 1K5OA 3BQ1A 1BPBA 5D4BA 9ICOA 2ZUBA 1ZQEA 2KJ5A 4QW9A 4GIBA 2XGPA 1M6YA 4QZIA 1KW4A 5ALFA 8ICXA 4ECUA 9ICWA 3T5KA 1KKXA 4BWJA 2Q4TA 5ALQA 3GDXA 1N5XA 2Z7JA 2WTFA 4NL9A 2RDIA 3K75D 1ZQFA 9ICIA 5ALWA 9ICBA 2BQUA 4XUSA 2HBLA 2F44A 7ICGA 7ICMA 2HHQA 5ALRA 5AI8A 3M6ZA 2NO5A 4KLUA 1SZHA 2K8CB 5F3XB 3EWAA 1BGXT 1CEZA 4M0AA 3QNMA 2A3VA 2UVWA 4YR0A 1RYSA 3GIIA 2I1QA 2PKEA 1WCLA 5IIOA 5ALHA 2Y1IA 3CW2C 3TADA 4QZCA 4RQ2A 4PGQA 3M9NB 3EPIA 3PR4A 4KLGA 3WK7A 2BDPA 5KFEA 5HHIA 1ZQDA 5EWEA 3C2KA 2HVIA 4ED2A 5IIMA 3RRGA 2BCRA 3RRHA 5KG2A 3EPGA 4IQTA 5KFJA 4O0IA 3Q8KA 4P4PA 3OHAA 5KFOA 2ZIWA 3H0LB 4IRCA 2ZTDA 3PNCA 4RT2A 1MSWD 5J29A 2KIWA 4KLSA 2FI1A 2H3IA 1HEKA 2LYBA 2WB1F 4PL1A 4B9MA 2LPEA
chains in the Genus database with same CATH topology
2ODGA 2EZXA 2BZFA 2EZYA 2EZZA 1QCKA 1CI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODG A;  2EZX A;  2BZF A;  2EZY A;  2EZZ A;  1QCK A;  1CI4 A; 
#chains in the Genus database with same CATH topology
 2KNJ A;  3PSP A;  3SQI A;  4DF8 A;  4DL7 A;  4O3O A;  4CGZ A;  4R8U A;  2W3R A;  3ED5 A;  8ICC A;  5ALZ A;  4PH5 A;  1S0V A;  7ICP A;  2K4H A;  2LKY A;  5DDY A;  3SR6 A;  2QKQ A;  4RT3 A;  5DG7 A;  2VA8 A;  1P7D A;  2EDU A;  3FAH A;  5DB7 A;  2UVR A;  4Y2R A;  3H8W A;  2PXI A;  2ODG A;  2AJQ A;  1Z1V A;  3ICX A;  5EWF A;  2DFL A;  1J97 A;  2W9C B;  2D3D A;  4C80 A;  4YMM A;  1PK1 B;  3RAX A;  1JMS A;  7ICV A;  1L3S A;  3CRX A;  1XS9 D;  5AKZ A;  5IIK A;  4P0Q A;  2RLT A;  3QU4 A;  4F91 B;  1U49 A;  3BJY A;  2HMX A;  4JV0 A;  4I2G A;  5KG4 A;  3SV4 A;  4C0Z A;  2KD1 A;  3SEN A;  2EQY A;  5F9L A;  9ICU A;  3RFA A;  2CXY A;  3NS1 A;  4DQS A;  5J8Y C;  3SMV A;  5CR0 A;  3BZC A;  2E8M A;  5J0Q A;  3KHH A;  4O5C A;  3SAH A;  2PFQ A;  2D6F C;  3C28 A;  2PFO A;  3UMB A;  3ZD9 A;  4M9N A;  1ZQS A;  4P2H A;  1SKS A;  4GC6 A;  4K4I A;  1D8L A;  2BPG A;  2KE7 A;  4C8N A;  5ALN A;  5L1J A;  4AYB F;  1YZ7 A;  3V6J A;  3F2B A;  1BNO A;  9ICR A;  3QU7 A;  3NRW A;  3UXN A;  2FMQ A;  1X2I A;  3WK8 A;  5J0P A;  2W9A A;  4MFF A;  8ICJ A;  1RQL A;  4RU9 A;  1HUZ A;  1VLB A;  1QQ7 A;  2OCE A;  5DB6 A;  4NLZ A;  3JPP A;  3AM9 A;  4DFM A;  2ISO A;  1BPY A;  2C2D A;  2HHU A;  1A0P A;  4UB1 A;  2W11 A;  3OJS A;  4M9H A;  3GIK A;  4IS7 A;  4QNL A;  3QX7 A;  3E58 A;  1SXE A;  1U47 A;  1KRP A;  4PHA A;  4G3I A;  3AN1 A;  3U26 A;  5E79 U;  2V9W A;  3RJE A;  3AUO A;  3MBY A;  2LI6 A;  4YD2 A;  2B21 A;  3QU9 A;  3LK9 A;  3RBD A;  2F1J A;  4RQM A;  4F4K A;  2G0A A;  1ZJM A;  2NV3 A;  3IG8 A;  8ICN A;  8ICY A;  1BNP A;  2OYY A;  5HNK A;  2EH9 A;  3PX6 A;  3H8S A;  4OJP A;  1TAQ A;  3KHG A;  2YQE A;  5EE0 A;  2LM4 A;  2I5H A;  1IM4 A;  1ZD5 A;  1XSP A;  2JEI A;  3T5L A;  4Q45 A;  1KDH A;  1F5S A;  2ZIU A;  2FLL A;  3ZDD A;  3FM9 A;  3TI0 A;  2OHF A;  2W55 A;  2QAR B;  3ZDB A;  4P0P A;  4ZH4 A;  4F5R A;  3TAR A;  4ECX A;  2JEJ A;  3VC8 A;  1HJP A;  1S0O A;  2W8L A;  4M2Y A;  5J0U A;  4B9V A;  1ZYQ A;  4R63 A;  5JU5 A;  2YX8 A;  1XC9 A;  4NLB A;  1SL0 A;  5HML A;  2ISP A;  2ZJA A;  3IRU A;  1J2N A;  2BDU A;  4ED6 A;  2NRW A;  3C23 A;  4OO1 J;  2XID A;  2IHN A;  3NRZ A;  2YTU A;  4BWM A;  3I76 A;  1TVA A;  2F1H A;  4ED8 A;  3L5K A;  2DPI A;  2IOH A;  4RQ0 A;  4C8K A;  3ETL A;  3N4M B;  4Y2J A;  1YT3 A;  2F76 X;  3MDC A;  4EEL A;  4DL4 A;  2H3V A;  4K4G A;  1HUO A;  1F44 A;  1JI7 A;  1ZQW A;  5KT3 A;  5AI0 A;  4RZR A;  4IL6 U;  4QZH A;  5KFD A;  1B43 A;  2ZIV A;  8ICB A;  4F5Q A;  1T8E A;  8ICU A;  2KSO A;  4UAS A;  4NLK A;  2W8K A;  5ALV A;  4R65 A;  8ICI A;  4J9P A;  4F5O A;  5KFQ A;  4BXO B;  2H3F A;  3KFU F;  2WF5 A;  4F5N A;  3HRD D;  4ACO A;  4FS1 A;  2KHV A;  2Y1J A;  2IMW P;  1ZQO A;  1KFS A;  4ED0 A;  4UAZ A;  4E0D A;  4RQ7 A;  3BZK A;  5J2E A;  4RPZ A;  2MUT A;  3RJG A;  4I2B A;  2AQ4 A;  4UB6 U;  2RRD A;  8ICZ A;  4JK1 A;  3HX0 A;  8ICH A;  2K4I A;  2KKP A;  2CN1 A;  9ICG A;  4MFA A;  4FBU A;  4M04 A;  1KQQ A;  1SB3 C;  3UXP A;  1N63 A;  1DK2 A;  2HBM A;  5KFC A;  3GIJ A;  4MF8 A;  1S77 D;  3ZDC A;  1V9P A;  1TFR A;  4UAR A;  5KFW A;  2NRZ A;  3B0Y A;  4DCC A;  2ASL A;  4J9L A;  3C5F A;  4LVS A;  5G5G A;  1X6J A;  2E1F A;  2EZZ A;  3HIL A;  5TIS U;  4ECZ A;  3SAF A;  2F77 X;  4DSE A;  4NWI A;  3HWT A;  1SV0 C;  4F2R A;  3LVV A;  3H0R B;  4NV0 A;  1U45 A;  1UHU A;  5KFF A;  5DQH A;  3PV8 A;  3Q8M A;  5KT4 A;  7ICL A;  4TUR A;  2CPR A;  1O03 A;  4QWB A;  2KJ9 A;  3TKA A;  2ZTC A;  5EWG A;  4IRK A;  1ZQB A;  1Q46 A;  8ICE A;  1VDV A;  4Y2X A;  2BQR A;  9ICL A;  4C8L A;  1IG6 A;  3B9J A;  2AGQ A;  2GOL A;  4DL5 A;  4MFC A;  3DV9 A;  4KLI A;  3NVW A;  1Z00 B;  2QB0 B;  3KD3 A;  4I2F A;  5DGA A;  2EAN A;  4DL6 A;  3PVX A;  2F8L A;  4MEX A;  3WKB A;  2DUY A;  5J2A A;  1NK7 A;  3AEV A;  2GLE A;  1QH9 A;  2FPM A;  1UQV A;  5KT5 A;  3HKZ F;  9ICQ A;  3GV5 B;  3PR5 B;  3KZI U;  1C7Y A;  4UAV A;  2LYA A;  2VJ5 A;  2WAQ C;  3LYS A;  1X9W A;  2JXJ A;  5CA7 A;  5AM3 A;  1WG8 A;  1TKD A;  2WF8 A;  4I27 A;  1T94 A;  1JUD A;  2FE9 A;  4PGX A;  4DOC A;  2JEF A;  5BOM A;  4DL3 A;  4BDP A;  5J2H A;  3J81 j;  4TQR A;  4DO9 A;  4RQ5 A;  5KL1 B;  3F2D A;  4UAW A;  4PPX A;  3N7R C;  2L5Y A;  2A1J B;  3MC1 A;  3C21 A;  2XCA A;  4NL9 C;  1L7O A;  1QCK A;  2KMD A;  2NRV A;  1WWV A;  3QUT A;  2JRZ A;  3I28 A;  2E8O A;  2DBY A;  3N7S C;  4JWM A;  3L4P A;  3IN5 A;  2V4R A;  3IV6 A;  4O3N A;  4QWE A;  2QLT A;  3WKC A;  2G06 A;  3TAP A;  3NVV A;  4C7Z A;  3VCB A;  4DFD A;  9ICX A;  4F2S A;  3RB3 A;  1Q8K A;  3QEB Z;  3M9O B;  3KKA A;  3BS5 B;  2R8G A;  1NK4 A;  4KLF A;  3SD7 A;  2XGQ A;  4KLQ A;  4GXK A;  3AU6 A;  4CRX A;  1PZN A;  1TAU A;  3IG5 A;  2KTQ A;  1X40 A;  2JZB A;  1Y88 A;  3A0B U;  1COO A;  3D2Q A;  5FP0 A;  3WU2 U;  5B5E U;  2EAM A;  1PUZ A;  1ZQG A;  4Y2Y A;  3SEI A;  4EEY A;  1NOM A;  3ISD A;  1WWU A;  2HOF A;  3OJU A;  5C0Y A;  2KP7 A;  2W7O A;  2R18 A;  5KG7 A;  3QU5 A;  3UQ2 A;  2DKX A;  2AXT U;  4RQ4 A;  3PML A;  5ALP A;  3MGH A;  2HHW A;  2EZY A;  3NVY A;  3TQ1 A;  1LKY A;  5D46 A;  4Q44 A;  5KG3 A;  2W7P A;  1X66 A;  5ALU A;  3C5G A;  3LWM A;  2KV2 A;  1ZXI A;  5KL8 B;  1ZQU A;  3QYP A;  8ICT A;  1UT5 A;  4UBB A;  5III A;  1ZQ1 C;  5DGB A;  1U4B A;  4QJF B;  2IOF K;  2OM6 A;  4B9L A;  2EAP A;  1NKE A;  3NUQ A;  5KFY A;  2AGP A;  1NK5 A;  4UW9 A;  3L3F X;  5J0R A;  1NKB A;  1QSL A;  4O3R A;  4DOA A;  9ICH A;  7ICE A;  3RR7 A;  7ICR A;  1UCV A;  4NM1 A;  3RF9 A;  4B9T A;  3JPO A;  2M9N A;  2ZJ8 A;  3AU2 A;  1URJ A;  2J6T A;  2O6K A;  4M9L A;  7ICJ A;  3CP8 A;  2AGO A;  2HCF A;  5DQI A;  5KFN A;  1UA1 A;  3WK9 A;  1L7P A;  3NAS A;  5AKE A;  2KHQ A;  4OJO A;  1JXL A;  4QIW C;  4ECW A;  4DS5 A;  2HHX A;  4ZOH C;  3K1R B;  7ICH A;  1IV8 A;  2ASD A;  4EYH B;  4PHP A;  5KAF U;  4UQG A;  2EZX A;  2AQ0 A;  5J2F A;  3C29 A;  3ZDA A;  4QZ8 A;  3RH5 A;  5AKI A;  1S9F A;  3SZ2 A;  1NKC A;  4F93 B;  3IP4 B;  1K1Q A;  2VA3 A;  1X9S A;  4GXJ A;  4KLL A;  3JPT A;  2LM1 A;  4FFD A;  2MAX A;  2V4Q A;  2E3T A;  2XO7 A;  2K60 A;  4RQ3 A;  4CE6 A;  2A19 A;  3WKA A;  3H8J A;  3AQE A;  4UB4 A;  5DBB A;  4F50 A;  1RXV A;  5ALY A;  4EX6 A;  5BOL A;  2DGZ A;  5ALE A;  4UBC A;  4RQN A;  3PSF A;  4Z6D A;  4YVZ A;  4JV2 A;  5HR7 A;  5AM5 A;  3H4D A;  3WKE A;  2IHM A;  2R8H A;  3Q8S B;  3Q8Q B;  2C22 A;  2F1I A;  5AIC A;  2HSZ A;  1EXN A;  5F9N A;  1X42 A;  3DDH A;  1X9X A;  2P35 A;  3TAN A;  1L7N A;  5AKL A;  1MQ2 A;  4Q43 A;  3R9K A;  1BPZ A;  4Y2P A;  2W9B B;  3THV A;  1RYR A;  2KZ3 A;  3BQT A;  2VIX A;  4US8 A;  2BPF A;  5KFT A;  5G5H A;  1RQN A;  4M6W B;  3T5H A;  1S8O A;  2ASJ A;  1T7P A;  9ICJ A;  4R64 A;  2C28 A;  3PMN A;  5IIL A;  1DRG A;  5AKH A;  1F0M A;  1N5W A;  4EBC A;  2KKV A;  3D2N A;  3LWL A;  1Z3E B;  5AKY A;  1ZD4 A;  2ZIX B;  2F2A B;  3G6V A;  4J9N A;  4TUQ A;  4DLG A;  5AKG A;  4OJ5 A;  3RH6 A;  1X6I A;  4QZG A;  2FMP A;  4K4H A;  2VJ4 A;  5HMM A;  5DG9 A;  1JXE A;  4DWI A;  2KIC A;  4FBT A;  4GFJ A;  3RB4 A;  3BQ7 A;  5KFV A;  4IR9 A;  5L1I A;  4UAY A;  1LB2 B;  1C20 A;  1XNS A;  5KTQ A;  5AM4 A;  3MR2 A;  3JPQ A;  2ZXI A;  5KFZ A;  5CEH A;  5J8Y A;  5IIJ A;  1KEJ A;  2YMP A;  2K4P A;  1N56 A;  5AIB A;  5CWR A;  1LV5 A;  1N62 A;  3Q8P B;  1V85 A;  3ORY A;  1XO0 A;  2FMS A;  2NRX A;  3H4B A;  3RJF A;  3EUB 2;  4QZA A;  4I29 A;  4NLG A;  2W04 A;  5KG1 A;  1NZP A;  2GH1 A;  4Q8F A;  4WJ3 B;  2CRX A;  4P4M A;  2DL0 A;  4RPX A;  1V38 A;  3V6H A;  1SL1 A;  4O5K A;  1ZQL A;  4F72 A;  4LJX A;  1L7M A;  2JH7 A;  1COK A;  4QZD A;  4DSJ A;  4ELV A;  2HI0 A;  4IR1 A;  5DDM A;  2XC9 A;  5ALM A;  2DQN B;  5L1K A;  3ZI4 A;  1IXR A;  2D8C A;  5BPC A;  3SYZ A;  8ICA A;  3H0M B;  2FPL A;  5AM1 A;  2IOF A;  5AHX A;  2UVU A;  4UAU A;  2BCV A;  4QWC A;  2NRT A;  3GFK B;  1ZQM A;  4DSK A;  5DLG A;  4TUP A;  4DSL A;  5KFA A;  3TAC B;  2LMR A;  2KZZ A;  4Y2V A;  4GLX A;  3N97 B;  1BPD A;  5KT6 A;  1FO4 A;  3G6Y A;  1A77 A;  3LDA A;  4PZN A;  4YR3 A;  9ICF A;  2OXO A;  4NLN A;  5ALO A;  4R66 A;  4EBE A;  4UB2 A;  5AK6 A;  1LVH A;  1H38 A;  5AI9 A;  3FDS A;  1RYU A;  2YY6 A;  5ALD A;  4F4X A;  4IQW A;  3GZF A;  4OD0 A;  5KFL A;  2HHS A;  3KZX A;  4HAI A;  2XI9 A;  1SIJ A;  2PMZ C;  5KFG A;  2PI4 A;  2HBK A;  5J0T A;  3A0H U;  1ZQK A;  1GO3 F;  1Z4N A;  3RJK A;  3PSI A;  5B66 U;  9ICP A;  1CRX A;  1CI4 A;  2KVS A;  3NVZ A;  3ETR A;  4C4R A;  4A8E A;  1KFT A;  3O0F A;  3QEA Z;  3MR5 A;  1FIQ A;  5ALK A;  3QUC A;  1SV4 A;  2OWO A;  8ICM A;  4DQP A;  5KFB A;  4BUG A;  2MRL A;  2ZTE A;  5J2J A;  3HJE A;  3OSP A;  2WF7 A;  3BQ0 A;  4TUS A;  3E2E A;  2W9C A;  4RPY A;  1PK1 A;  2WFA A;  4QZE A;  3UM9 A;  2W54 A;  2F3N A;  4YN4 A;  1QLN A;  3QUQ A;  4KLD A;  3M7D A;  4EZ9 A;  1PVQ A;  4KX5 A;  5J0S A;  3HW8 A;  1WYG A;  1T3N A;  2KZM A;  4RNO A;  1ECW A;  7ICT A;  4YFK A;  1BPE A;  4DEZ A;  3UXO A;  3V7K A;  2ZIW B;  3WKD A;  4UAT A;  5AK4 A;  2HHV A;  3PO5 A;  3LVW A;  4RUA A;  4Y2S A;  1TK5 A;  1SWW A;  2ATL A;  2IBK A;  4C4S A;  5AKJ A;  1L8L A;  4O3P A;  2PFP A;  4I28 A;  3HPO A;  3ZDE A;  3ISC A;  4F71 A;  2YB4 A;  1DGJ A;  1XWL A;  2J6S A;  2Y0S C;  2IA6 A;  4F3O A;  4Z6C A;  3K4G A;  3KHR A;  2HVH A;  1N2X A;  2WAQ F;  1SL2 A;  4I2C A;  2ZJ5 A;  4J9K A;  4ECY A;  3GU3 A;  4I2D A;  5AIA A;  4CF3 A;  1JX4 A;  1KBU A;  4RUC A;  1MA7 A;  2Q0Z X;  4B6J A;  2DWQ A;  2G09 A;  4FE3 A;  3RB0 A;  5HHH A;  3JPS A;  4ICA A;  3WK5 A;  4P0Q B;  3G6X A;  2UVV A;  1PVR A;  3GIM A;  5KT2 A;  2QB1 A;  2W43 A;  4EYI B;  2JMG A;  2K89 A;  3AL0 B;  4PL2 A;  4B9S A;  5AK3 A;  2KK0 A;  3IM1 A;  4J9S A;  3MGI A;  1SV0 A;  7ICS A;  3AMZ A;  1RPL A;  1CUK A;  1ED1 A;  1S5L U;  3WK6 A;  3HP6 A;  3M9M B;  5AI5 A;  3OSN A;  5KFR A;  1VJ5 A;  3RJJ A;  5EOZ A;  3GIL A;  4KLJ A;  5L9X A;  2ZUD A;  4NJ8 A;  2K4E A;  2QAR A;  4RQ1 A;  1B22 A;  1D9F A;  3HT3 A;  3MAB A;  1KSP A;  7ICI A;  4ECV A;  3V7J A;  4DF4 A;  5AKK A;  2G07 A;  4YD1 A;  5KFS A;  4Y2U A;  4NY8 A;  4OCZ A;  4KMO B;  4F5P A;  1FEZ A;  1L3U A;  4XQ8 A;  2E8P A;  2XY5 A;  2E1E A;  4EZ6 A;  3BS7 A;  1UT8 A;  2GO7 A;  3IHQ B;  3E0F A;  2Y9U A;  4C8M A;  1XU4 A;  8ICK A;  1ZQT A;  2E5S A;  1OUQ A;  4KN4 A;  1D8B A;  4C8O A;  3N7P D;  4U7C A;  1ZQH A;  1Z19 A;  1WCN A;  2DF4 B;  3DEE A;  4ECQ A;  3RJI A;  2JR5 A;  3MDA A;  4CF5 A;  4PJ0 U;  3TAD C;  5L1L A;  3UMG A;  4JMU A;  3EZ5 A;  3RTV A;  5K4L A;  2N1R A;  1S0M A;  4FO6 A;  1Q3U A;  5KNI A;  3PW5 A;  5GTI U;  1DGS A;  3ONN A;  5JTI A;  3F2C A;  2ZIU B;  7ICK A;  2XIC A;  4RNM A;  7ICF A;  3SI8 A;  4FS2 A;  3OHB A;  4P0P B;  3IDW A;  1NZB A;  1B0X A;  4O3Q A;  2VKQ A;  9ICK A;  1K1S A;  4BXO A;  1ZQV A;  2RQ5 A;  2KIV A;  4QIW F;  2MU2 A;  4ECR A;  2FLN A;  2G5H B;  2ZG6 A;  5KG0 A;  5DBA A;  1ZQI A;  4YQW A;  1ZQR A;  2HOQ A;  3GQC A;  5ALS A;  2JEG A;  3GV8 B;  4ED7 A;  3PW7 A;  2P66 A;  1JN3 A;  4IQU A;  4J9O A;  1S0N A;  3T3F A;  2M0N A;  2H3Q A;  2BHN A;  4MF2 A;  5IIN A;  2BQ3 A;  2KFZ A;  3QE9 Y;  4JUZ A;  4Z6E A;  4O3M A;  5EE1 A;  5C5J A;  5KFM A;  4M9J A;  1T4G A;  9ICT A;  2JH1 A;  3FC4 A;  5JUM A;  3K1Z A;  4DLE A;  2BPC A;  3MFI A;  3V72 A;  3CYM A;  3M8R A;  3QZ7 A;  2VAN A;  3S6J A;  4I2A A;  8ICR A;  1L3V A;  2HBJ A;  1ZRN A;  4QZ9 A;  1TK8 A;  5ALG A;  4YXJ A;  4I2I A;  4BJQ A;  1AQ6 A;  4ED3 A;  2ZIV B;  5DB8 A;  2KSO B;  2KEY A;  3RB6 A;  3NGD A;  5HR6 A;  2K8B B;  2XVT A;  4BX9 C;  4UB8 U;  4DQQ A;  4YR2 A;  4KLM A;  4DFP A;  5KAI U;  1Z00 A;  2QB0 A;  2XY6 A;  4X5V A;  4UB3 A;  4BGD A;  4USA A;  2A1A A;  3RH4 A;  3RBE A;  1NK9 A;  2MUT B;  2WB1 C;  5DBC A;  2OH2 A;  5KT7 A;  5HP4 A;  4O5E A;  4YMN A;  4Y2Q A;  3D2S A;  1UA0 A;  4DOB A;  1Z4O A;  4DS4 A;  2RDJ A;  4YP3 A;  3C2M A;  4J9M A;  3TFR A;  1N48 A;  3BDP A;  3KTQ A;  3H40 A;  4ELT A;  1J2M A;  5H2F U;  7ICQ A;  5EE3 A;  1ZD2 P;  2FJ6 A;  4RQ6 A;  5KFI A;  8ICS A;  3GV7 B;  1WUD A;  4J9R A;  4M9G A;  2ALZ A;  1A6S A;  2K8A A;  2J6U A;  4XA5 A;  2BCQ A;  4F4Z A;  4M47 A;  2KJ8 A;  1FFU A;  3TAQ A;  2Y9T A;  5DQG A;  4PHD A;  4RQ8 A;  2OEH A;  1A76 A;  4DFK A;  5J2C A;  5J0O A;  1QQ6 A;  2A1J A;  1L5U A;  1KTQ A;  8ICF A;  3JPR A;  1NK0 A;  3F5A A;  4KLO A;  5KG5 A;  1RG6 A;  2JHD A;  4YG2 A;  4Y2T A;  5ALT A;  1RM6 C;  4QW8 A;  2KVC A;  4NXZ A;  4JB3 A;  5ALI A;  4DFJ A;  1MQ3 A;  4KX3 A;  3MGV A;  2GWS A;  2DPJ A;  9ICE A;  3QXG A;  1RXW A;  4DQR A;  4KTQ A;  3M8S A;  1S76 D;  1D9D A;  1RZT A;  4LZD A;  3BS5 A;  5TZV A;  1SXD A;  1ZQJ A;  4AYB C;  5AK5 A;  4I2H A;  3Q8R B;  1ZOL A;  5KFK A;  4ECS A;  4DQI A;  1L8O A;  1XO1 A;  5J0X A;  1B4F A;  1DK3 A;  1OW5 A;  3N28 A;  4KLE A;  2AHO B;  3KBB A;  2ZUC A;  1ARO P;  2E8N A;  8ICG A;  4CNQ A;  4EEN A;  2JGA A;  5J2I A;  3MR3 A;  4G9B A;  4GXI A;  2P6U A;  5ALX A;  1L3T A;  4KLH A;  1KFD A;  1ZQC A;  5J2B A;  4F4Y A;  5DLF A;  3M6K A;  3SAG A;  1ZQX A;  1YZ6 A;  8ICO A;  4LZG A;  3TFS A;  1PK3 A;  2YMQ A;  4Q8E A;  1NNL A;  1DOQ A;  4PHE A;  1PVP A;  4B9N A;  2KFN A;  2FPK A;  2YMM A;  4XRH A;  1RDF A;  4ELU A;  4ECT A;  1UPH A;  1D8Y A;  1NJX A;  4NLC A;  2RP5 A;  4US9 A;  5AI6 A;  4MHV A;  5CP2 A;  4EBD A;  5JRT A;  1XSL A;  1U48 A;  1KL9 A;  1KLN A;  2ZXH A;  2PMZ F;  4EEK A;  9ICV A;  3PX0 A;  1BPX A;  5EE9 A;  3PW4 A;  1ZD3 A;  1NK6 A;  3QUB A;  2YN4 A;  2W03 A;  3ALR A;  4CDG A;  2JV3 A;  2JZB B;  1Z1B A;  1QTM A;  5KFH A;  1NJZ A;  5CRX A;  4QZF A;  2R8K A;  8ICL A;  1MC8 A;  2PFN A;  1FFV A;  2H3Z A;  5T14 A;  2ESE A;  2R8I A;  1ZJN A;  5ALL A;  5DG8 A;  3QZ8 A;  2HHT A;  2BZF A;  4YXM A;  2FLP A;  8ICV A;  4NM2 A;  7ICU A;  4TQS A;  1JRO A;  2C2E A;  1NI3 A;  3CNH A;  4PZO A;  2YML A;  3PW0 A;  2W9M A;  2AU0 A;  9ICN A;  5ALJ A;  1LKY B;  4QWD A;  3UPQ A;  1QSY A;  1SGG A;  4AP9 A;  4KIT B;  2MA1 A;  3C1Z A;  1HIW A;  2I6X A;  1ZQP A;  3C2L A;  4GC7 A;  4C7Y A;  2WF6 A;  1SWV A;  2XY7 A;  4IRD A;  4YCX A;  4YMO A;  1JAL A;  1U9L A;  1ZQA A;  4DSF A;  2B6G A;  5AM2 A;  1BVS A;  3V7L A;  1JIH A;  1SZP A;  2KN7 A;  2NO4 A;  1SKW A;  4F8R A;  9ICM A;  3PX4 A;  2XCP A;  5CB1 A;  1Q3V A;  2H5X A;  1QSS A;  2EAO A;  2R8J A;  4I2E A;  1T3Q A;  9ICC A;  4F92 B;  3JPN A;  4HYK A;  1ZRM A;  2Y0S F;  4QZB A;  5CHG A;  3PW2 A;  3KOO A;  4DSI A;  4DL2 A;  2BR0 A;  3Q8L A;  4FZM A;  3MFH A;  2FDR A;  2BKE A;  4Z6F A;  4U6P A;  2LYH A;  3NTU A;  2ES6 A;  4I2J A;  4JV1 A;  3T5J A;  5L1M A;  2W9B A;  1JRP A;  1TAM A;  4OJ6 A;  1L6N A;  2BGW A;  5DB9 A;  4J9Q A;  2YB1 A;  1TV9 A;  4M6W A;  3ISB A;  1QQ5 A;  1KN5 A;  4R8U B;  1X9M A;  3V6K A;  4J03 A;  2ZIX A;  2KG5 A;  3KHL A;  2LBO A;  2WF9 A;  2BCS A;  4C4T A;  3MR6 A;  9ICS A;  4CCH A;  5CJ7 A;  2NYV A;  7ICN A;  2G08 A;  1NJW A;  2RHF A;  4O9M A;  4F4W A;  4IQV A;  1SKR A;  5KFP A;  3M1Y A;  5KFU A;  3OGU A;  2W3S A;  4P4O A;  3RJH A;  1NK8 A;  1N60 A;  2LHT A;  1TK0 A;  2HDO A;  3EW9 A;  3FYH A;  9ICA A;  2BCU A;  4JWN A;  2KOB A;  1V97 A;  2C2R A;  5AKX A;  4KLT A;  3H8M A;  3UQ0 A;  2F8K A;  4QWA A;  3AQF A;  3SV3 A;  2HW3 A;  7ICO A;  5AM0 A;  4KMU A;  1ZQY A;  2B0C A;  5AI4 A;  1IIP A;  3KKA C;  5J0W A;  1ZQN A;  2HOI A;  3WK4 A;  4FZL A;  3D6J A;  4PGY A;  4B9U A;  3C1Y A;  1ZQQ A;  2MSN A;  2P6R A;  3QU2 A;  3F53 A;  2G5I B;  3F5E A;  3I1Y A;  3OTQ A;  1S10 A;  2VA2 A;  3RAQ A;  1MN8 A;  1O08 A;  5J2K A;  3PZP A;  3PST A;  5D49 A;  3BQ2 A;  8ICW A;  5A0L A;  3ZD8 A;  4FZN A;  3UMC A;  2WHE A;  4IC9 A;  4O3S A;  2I9G A;  2DKZ A;  3H7I A;  1N61 A;  3PO4 A;  3OPX A;  5J0Y A;  1XSN A;  4MEY A;  3PY8 A;  3RR8 A;  4CF4 A;  3HKZ C;  5KG6 A;  4OJL A;  1ZET A;  2PI5 A;  4UB5 A;  3EYZ A;  5GTH U;  8ICQ A;  4RNN A;  1NJY A;  4KN7 A;  1OXJ A;  1DXS A;  5J2D A;  8ICP A;  1S97 A;  5DKW A;  3B0X A;  2AH5 A;  1TE2 A;  5KFX A;  4ED1 A;  1ZQZ A;  4EX7 A;  5J2G A;  3T79 A;  1K5O A;  3BQ1 A;  1BPB A;  5D4B A;  9ICO A;  2ZUB A;  1ZQE A;  2KJ5 A;  4QW9 A;  4GIB A;  2XGP A;  1M6Y A;  4QZI A;  1KW4 A;  5ALF A;  8ICX A;  4ECU A;  9ICW A;  3T5K A;  1KKX A;  4BWJ A;  2Q4T A;  5ALQ A;  3GDX A;  1N5X A;  2Z7J A;  2WTF A;  4NL9 A;  2RDI A;  3K75 D;  1ZQF A;  9ICI A;  5ALW A;  9ICB A;  2BQU A;  4XUS A;  2HBL A;  2F44 A;  7ICG A;  7ICM A;  2HHQ A;  5ALR A;  5AI8 A;  3M6Z A;  2NO5 A;  4KLU A;  1SZH A;  2K8C B;  5F3X B;  3EWA A;  1BGX T;  1CEZ A;  4M0A A;  3QNM A;  2A3V A;  2UVW A;  4YR0 A;  1RYS A;  3GII A;  2I1Q A;  2PKE A;  1WCL A;  5IIO A;  5ALH A;  2Y1I A;  3CW2 C;  3TAD A;  4QZC A;  4RQ2 A;  4PGQ A;  3M9N B;  3EPI A;  3PR4 A;  4KLG A;  3WK7 A;  2BDP A;  5KFE A;  5HHI A;  1ZQD A;  5EWE A;  3C2K A;  2HVI A;  4ED2 A;  5IIM A;  3RRG A;  2BCR A;  3RRH A;  5KG2 A;  3EPG A;  4IQT A;  5KFJ A;  4O0I A;  3Q8K A;  4P4P A;  3OHA A;  5KFO A;  2ZIW A;  3H0L B;  4IRC A;  2ZTD A;  3PNC A;  4RT2 A;  1MSW D;  5J29 A;  2KIW A;  4KLS A;  2FI1 A;  2H3I A;  1HEK A;  2LYB A;  2WB1 F;  4PL1 A;  4B9M A;  2LPE A; 
#chains in the Genus database with same CATH homology
 2ODG A;  2EZX A;  2BZF A;  2EZY A;  2EZZ A;  1QCK A;  1CI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...