2BZFA

Structural basis for dna bridging by barrier-to-autointegration factor (baf)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2bzfA00
2EZZA 1QCKA 2EZXA 2ODGA 1CI4A 2EZYA 2BZFA
chains in the Genus database with same CATH superfamily
4RUAA 5HR6A 9ICCA 3QZ8A 4TURA 2NRVA 4PHPA 2F8KA 1GO3F 2LM1A 1S76D 4Q45A 1AQ6A 2I1QA 4DFMA 4DSLA 2BGWA 4C8MA 2ZIXB 2IHNA 2QB0B 5AK5A 2HBJA 2RHFA 4O3SA 2F2AB 4NM2A 2LM4A 2YB1A 4O5EA 3F2DA 4QWAA 5IILA 3KHRA 3ZD8A 3PV8A 1DK3A 3V7KA 5D4BA 2ZTDA 3C23A 5J2IA 1NK0A 4OJOA 5J0QA 4MFFA 1QQ5A 9ICTA 1XO1A 3SZ2A 3N7SC 9ICUA 4RPXA 5KFZA 9ICXA 3TACB 5ALXA 4Q8EA 4IQVA 8ICJA 3B0YA 4MHVA 3HT3A 1NK4A 1S0NA 4OJPA 2ZJ5A 7ICMA 5KG7A 3NGDA 1DK2A 3QEBZ 4UAYA 3HWTA 1ECWA 4F3OA 7ICRA 4IL6U 3E58A 4QWCA 2IOFK 7ICTA 3DDHA 8ICRA 7ICSA 5BOLA 1Z1BA 4J9MA 3Q8MA 3MGHA 1ZQDA 2DQNB 2YN4A 3ONNA 1D9DA 1ZQVA 3UXOA 1A76A 1PK1B 2M9NA 4EBDA 4DQSA 1PZNA 5ALSA 1O03A 4O3NA 1Q46A 1UPHA 4RQ0A 4UATA 2UVVA 2BCUA 4UB6U 4F4XA 2V9WA 2V4QA 2JGAA 1TAMA 2Q4TA 2I6XA 5AKZA 2L5YA 5ALQA 2YTUA 3UMCA 2G5HB 1DGSA 4RNMA 3H8JA 4QZCA 5E79U 4JMUA 4R63A 2E1FA 4I2DA 2V4RA 4QJFB 2BPFA 1IIPA 1KRPA 3OGUA 5DLFA 5KFCA 1RM6C 2W3SA 1ZJNA 3M6KA 5J2HA 2A19A 1X9SA 1RYUA 1NKBA 2PKEA 3QNMA 4QZHA 4FO6A 2VIXA 1TE2A 5HMLA 1BPXA 1B43A 5ALHA 4RPYA 3N4MB 3ORYA 1TK8A 3L4PA 4KLGA 4B9SA 3OPXA 2ODGA 3H4DA 5KFDA 5EE3A 2IMWP 4KLHA 1HJPA 4KLFA 1BGXT 3M7DA 3N97B 8ICFA 9ICOA 3V6HA 9ICVA 2AGPA 4DL6A 5AKKA 5AICA 2WAQC 2C28A 5J8YA 3RH4A 4ED7A 4B6JA 5J2DA 3QE9Y 3RH5A 1ZQCA 2R8GA 4M47A 2KEYA 2YY6A 2AQ4A 4JV1A 2NO4A 2H3IA 5EWFA 4F5RA 2K89A 3H0LB 4QWBA 2F8LA 5EOZA 3K1ZA 1KEJA 3FDSA 4QZEA 4M6WA 3JPRA 4UB2A 5DB7A 5AM4A 4OD0A 2XVTA 1SZPA 3QUQA 2KKPA 5IIJA 3R9KA 3RJHA 4CE6A 1PK1A 2ZTCA 3RBEA 2E5SA 3IRUA 1XU4A 3C2KA 1SB3C 5J2JA 3MR5A 3SV4A 5DG7A 1TAUA 4QZGA 1ZRNA 3LWMA 2EDUA 4EBEA 3T5HA 3UXNA 5HR7A 2W8KA 4Q44A 2ZUBA 4I2JA 4O0IA 1OUQA 4HYKA 4RQ3A 4EEKA 3KKAC 4YR0A 4ED6A 3H0RB 5ALYA 5AKEA 3WKCA 2B0CA 2HBMA 1JI7A 2XO7A 3CP8A 1N62A 5CJ7A 1XNSA 3H8SA 4BXOB 1IV8A 1DRGA 3C1YA 8ICZA 4QW8A 2DBYA 2OYYA 7ICOA 4I2HA 4YD1A 5KG3A 1X40A 3KHLA 2MAXA 1UT5A 2XY7A 5HHHA 2LKYA 5KNIA 3NVZA 8ICOA 5DQHA 1JUDA 7ICNA 1HEKA 1CUKA 4GXJA 1S8OA 2FLPA 3AU6A 5KFQA 4ECRA 5F9NA 2MA1A 2MSNA 1ZYQA 3A0BU 2WF8A 1SV0C 4ECUA 2I5HA 3ZDDA 1D9FA 1SXEA 4DL5A 4EX6A 4NLZA 4RQ7A 4UB5A 2P6RA 5AI6A 4TQRA 3AUOA 3L3FX 5KT4A 4RPZA 2JEIA 1IXRA 4PPXA 4C4TA 3UQ2A 3K75D 5AKHA 1NKCA 2JH7A 3N7RC 3PMLA 5F3XB 4JWNA 3ALRA 2VANA 1VLBA 2R8JA 1SKRA 2A1JA 5B66U 4O3OA 1MN8A 5DDYA 3U26A 3UM9A 9ICNA 2HOQA 3KD3A 4KLMA 2FMPA 1ZJMA 2R8KA 3M9MB 4O3QA 8ICVA 5KL1B 5KFFA 4UBBA 8ICEA 9ICAA 4O5CA 3C28A 1J2NA 4QNLA 4ECXA 3GZFA 1ZQKA 4GC7A 3LWLA 5CR0A 4YG2A 4AYBC 1Q8KA 7ICKA 3QYPA 3OHAA 2M0NA 2DKXA 1Z4NA 9ICBA 5AK6A 4NLCA 4DOCA 5ALRA 2QKQA 4NL9A 2HHXA 5J2EA 4UQGA 2JMGA 5DBCA 3SMVA 5ALLA 4BXOA 1U47A 2KFNA 4Q43A 1U45A 4O9MA 3M9OB 3H8MA 3QUTA 2FMQA 1L3UA 5ALVA 1JRPA 2K4HA 2VA8A 3QU2A 3TFSA 4MFCA 4BWMA 3IV6A 4ELVA 3PSFA 1ZQGA 4DLGA 4BUGA 2G09A 3N7PD 4J9SA 4I2FA 2VJ5A 3RB6A 8ICUA 4MEYA 7ICQA 2HOFA 3L5KA 4GXKA 1RXWA 4KTQA 4KLUA 2KIWA 3TAQA 1SL0A 2W7OA 1KTQA 2KJ5A 2C2RA 1XSLA 4Z6DA 3GIIA 1ZD3A 3PR5B 5DG8A 5KG4A 3AEVA 1LVHA 3H0MB 7ICHA 4KLTA 3H4BA 4PHEA 4DL4A 2K8CB 2Y0SC 4ED3A 3G6YA 4NL9C 2LYHA 5L1JA 3MR3A 5ALUA 1ZQTA 1QQ6A 4ED2A 4RQ6A 2BCVA 5J29A 2DL0A 3BQ2A 4DFDA 3JPQA 1L7NA 2FPMA 3E2EA 2VA3A 1UT8A 2ZXHA 2HVIA 2PFPA 4DQIA 4X5VA 2W3RA 4F4ZA 4DSFA 1QQ7A 1S9FA 2OEHA 1COKA 3KHGA 1ZQIA 2BKEA 5J0WA 2CN1A 4ECTA 4RQMA 1H38A 5KFLA 2ESEA 3RB4A 4PGYA 3KHHA 4A8EA 1LB2B 4YXMA 4XQ8A 5AM5A 4F91B 5ALDA 4YR3A 4BDPA 1Z4OA 2KVCA 3ZD9A 1T7PA 2ASLA 2JRZA 1JIHA 4QIWF 4QZFA 2EAOA 4MF2A 9ICWA 1NK6A 7ICPA 5J2FA 4FZMA 3IG5A 1QSLA 2HDOA 1RZTA 2WF6A 1X2IA 4C0ZA 2Y1JA 5G5GA 1N60A 1ZQOA 5J0TA 4UBCA 1ZD2P 5CA7A 4U7CA 3SD7A 3ETRA 4Y2QA 2IA6A 8ICMA 4YMNA 1HUOA 3RR8A 5KFKA 2KZZA 2KVSA 5CP2A 4E0DA 1RDFA 1NK8A 3RJKA 3QZ7A 1Z1VA 3OSNA 4FS1A 8ICIA 1ZQFA 3HILA 4DL7A 1MQ2A 2WB1F 2G5IB 5KTQA 4F8RA 1ED1A 1Z19A 1A77A 1BNPA 2MUTB 2W9BA 5AIAA 5A0LA 1T94A 2BHNA 5KFGA 2WF9A 5JTIA 2FJ6A 2WB1C 3LK9A 2UVRA 3QEAZ 3BZCA 2KMDA 1JX4A 7ICVA 5AKJA 4ECYA 3F2BA 5JRTA 3NTUA 3IG8A 4DFJA 5KFWA 2OCEA 1XSNA 5DLGA 3MGIA 1NJWA 2EZXA 4F50A 1S10A 4J9QA 4ED8A 4DF4A 4LZDA 1NK9A 1QSYA 1TKDA 3TKAA 5F9LA 4HAIA 4PH5A 5EE1A 2EZZA 2HBKA 2IBKA 3IN5A 1T3QA 2PXIA 3J81j 2NRWA 3FC4A 3S6JA 1K1SA 2FI1A 2D6FC 3B0XA 2HHTA 9ICPA 3BZKA 1MA7A 3ZDBA 4ECVA 4YXJA 1KN5A 4K4HA 1WYGA 1NJZA 2F1IA 4I2AA 5L1MA 3SAGA 4OCZA 3N28A 5ALIA 4GXIA 4M9LA 4K4GA 1Q3UA 2KKVA 1RXVA 2JR5A 2HHSA 1ZQHA 4FBTA 4TUPA 3NS1A 3C1ZA 2WHEA 3Q8RB 3LYSA 4F4WA 3F53A 3WKAA 1SIJA 2OXOA 3MC1A 5AM1A 3CYMA 9ICQA 3QU7A 1BVSA 4O3MA 3K4GA 1MC8A 1RPLA 3HKZF 3WKDA 2D8CA 1LKYB 5KFRA 5IIOA 4XRHA 4F92B 3PX4A 4LJXA 4NLGA 5AKIA 3Q8PB 2MUTA 4FE3A 4R64A 3HW8A 4Y2PA 3Q8KA 4C8OA 4IRKA 3ZI4A 2AU0A 2HCFA 1S77D 1S0VA 5AK3A 2W55A 3KZXA 4PHAA 4Y2UA 5CHGA 3JPOA 9ICRA 5C0YA 4I27A 2W9MA 1L8OA 1CI4A 5J2GA 4B9TA 3EW9A 2AGQA 3PW5A 1V97A 1NNLA 1RQNA 4C4SA 4I2BA 2HW3A 3C5FA 4KLQA 2BCRA 3HX0A 1X6IA 2ZIXA 2QB0A 4GFJA 1P7DA 4Z6EA 5KG6A 3IP4B 5CWRA 4FZLA 4RU9A 4EYHB 8ICAA 5KFSA 4TUQA 3UMGA 3SI8A 2XGQA 1SGGA 2CRXA 2HVHA 3SYZA 3PSPA 3BS7A 4KLIA 1NKEA 5AI4A 5H2FU 5DKWA 2KTQA 5T14A 5BPCA 1FEZA 3KKAA 5DG9A 1KBUA 4KMUA 3V72A 4C7ZA 3NRZA 5TISU 4B9NA 5AI8A 5ALKA 8ICXA 2JH1A 2JEGA 2JZBB 1QCKA 5J0SA 1WG8A 2KIVA 4CCHA 4RZRA 3WKBA 2J6TA 2JV3A 2E8PA 3EZ5A 2ZIUB 5DBBA 2FPLA 5J2CA 2KK0A 5KFPA 2UVUA 5KFNA 3CW2C 1ZQZA 4QZDA 2Z7JA 1JALA 2MRLA 1RYSA 1XSPA 1SKSA 5EWEA 1O08A 4BGDA 2G0AA 4B9UA 3OSPA 4DQRA 2ZIWB 4UB1A 8ICPA 4IQWA 1FO4A 4M9HA 1LKYA 4PGXA 5ALEA 1BPDA 4YFKA 5EE9A 3PO5A 2NRXA 4CF5A 2HBLA 1V85A 4UAVA 4QWEA 4PZNA 1ZETA 2P66A 1SV0A 1TVAA 1SZHA 8ICKA 3FM9A 3TFRA 4DFKA 3VCBA 1NZPA 2XC9A 4DOBA 1ZQEA 2RLTA 5ALOA 4UB8U 4KX3A 5KFXA 1KKXA 5DQIA 5FP0A 2KV2A 4KITB 5KL8B 1NJYA 5J0PA 4FS2A 1WCLA 5KFYA 2W43A 5DGAA 4M04A 4R65A 1ZQNA 3PMNA 2PI5A 2O6KA 4YN4A 2ASJA 4NJ8A 2QLTA 3MR2A 2W03A 4EEYA 1UQVA 5AKGA 2BZFA 1COOA 1J2MA 4O5KA 4B9MA 2WTFA 2YMMA 2JEJA 4DSJA 1B4FA 2KOBA 5C5JA 3NVYA 1QSSA 1XC9A 5AKXA 3RBDA 2JZBA 3H40A 4KLSA 2EH9A 5KT6A 3TI0A 1X9MA 4DSEA 4RUCA 1KLNA 1YZ7A 2YMQA 5J0RA 3KFUF 5L9XA 2XCAA 3GIMA 2ZIUA 4P0PB 2W8LA 4IR1A 1WWVA 4EX7A 1ZQJA 3SAFA 4Z6FA 3T3FA 4Y2RA 3HJEA 4DCCA 2HMXA 5AHXA 3GFKB 2H3VA 4I29A 2E3TA 4LZGA 1V9PA 2I9GA 3RRHA 3GV8B 2H5XA 1JN3A 1SV4A 3V7JA 5ALPA 2VA2A 1ZRMA 1U4BA 2P6UA 4DQPA 1TAQA 1ZQ1C 3M6ZA 4EENA 4I2EA 4CRXA 4ZH4A 4Y2YA 5ALMA 4UB4A 2XCPA 3FAHA 4ECWA 4P4MA 2C2DA 4IRCA 4EZ6A 5GTHU 4OO1J 5KG0A 2B6GA 3KZIU 2DPJA 1BNOA 4IRDA 2HOIA 1OXJA 4IQUA 5AK4A 4QZAA 3BDPA 4QZ8A 4AP9A 1C7YA 3MDAA 4I2GA 1WWUA 1J97A 2LYAA 4R8UB 1YZ6A 3PSIA 3JPNA 4F2RA 4P4OA 2FPKA 3F5AA 1L3SA 5AI5A 4GC6A 2NYVA 3SV3A 5ALGA 5AM0A 4F5PA 4RNOA 3OJUA 9ICEA 2LMRA 2NRTA 5KFTA 4DOAA 2BCQA 3Q8SB 3C29A 3ED5A 3MFHA 4DSKA 4YQWA 3RJIA 4RT3A 2ZXIA 1SL2A 2AGOA 4OJLA 4JWMA 3TANA 2F3NA 2KJ8A 2LYBA 1BPEA 3NVVA 4PL2A 3C2MA 1U9LA 5IIMA 2BPGA 1K1QA 5CEHA 5EE0A 2EZYA 4C8NA 2G07A 5DQGA 4F5OA 3M9NB 4P0PA 3ISDA 1FFUA 1M6YA 3GV5B 2DKZA 2FLLA 4KLOA 2KNJA 3D2NA 1HIWA 1X6JA 1D8BA 3OJSA 3PX6A 5L1LA 4BX9C 1Q3VA 3PZPA 2HHUA 4F4YA 8ICNA 3JPTA 4Y2TA 3BQ7A 4FBUA 2E8MA 5J0XA 2D3DA 2P35A 3HRDD 5KG1A 3T5LA 2C2EA 9ICGA 5L1IA 3H7IA 1KL9A 5ALJA 1OW5A 4B9VA 4Y2VA 2IOFA 4O3PA 3PW4A 2FE9A 2YMLA 3THVA 5DB8A 2IHMA 3CNHA 2AH5A 3ICXA 4G3IA 1L8LA 1Y88A 5GTIU 4CF4A 2G06A 3GU3A 4QIWC 3HP6A 3BJYA 4J9KA 4YCXA 4GLXA 2H3QA 2OHFA 3A0HU 4J9OA 3O0FA 3T5KA 4XA5A 3NUQA 5KT2A 5KG5A 4M9JA 1L7OA 5CRXA 2W9CB 4DF8A 9ICFA 3PY8A 2BQ3A 2Y9TA 2W04A 3I28A 1BPYA 1X9XA 1VDVA 8ICBA 8ICHA 3ISBA 2YB4A 3ISCA 2PMZF 1ZQPA 1ZQMA 4I28A 3T79A 4PZOA 2KICA 1LV5A 5J2BA 4Y2XA 1DXSA 8ICWA 3LVWA 3PW2A 4F93B 2G08A 3BQ0A 4MF8A 1N2XA 1WCNA 1PVRA 2ATLA 3RH6A 1ZQXA 1NI3A 4U6PA 1UCVA 1L5UA 2QARB 5KFVA 1UA1A 1XO0A 1N48A 1TK0A 5HP4A 3RRGA 3M8RA 2RP5A 1RG6A 4Z6CA 3PVXA 4GIBA 1PUZA 5AM3A 5AKYA 3GIKA 4UAWA 2ZIVB 3QX7A 4DQQA 2NV3A 8ICSA 4F72A 3V7LA 2BCSA 1S5LU 3KOOA 3ZDEA 1S0MA 1URJA 4EELA 4DS4A 2R8IA 5D46A 4KLLA 2ZG6A 3PO4A 3OHBA 4R66A 3G6XA 3RB3A 3UXPA 5KFBA 5KFEA 5TZVA 3BS5B 4NV0A 4F4KA 5KT3A 5JUMA 4MEXA 4CGZA 4XUSA 4ED0A 1A0PA 1PK3A 2ES6A 4M2YA 2W9CA 1ZQLA 8ICTA 3DEEA 4ELTA 4UARA 5HNKA 4IQTA 1CRXA 5ALFA 4PJ0U 4NY8A 3EPIA 2GOLA 3QU5A 2OWOA 4ECSA 4TUSA 4TQSA 4MFAA 4ICAA 1D8YA 2DF4B 5J0UA 2E1EA 3MGVA 7ICJA 2AJQA 1S97A 2DFLA 3RB0A 5AIBA 1ZQUA 2KD1A 4UAUA 3SR6A 1ZQWA 1WUDA 2XY5A 3GILA 4I2IA 4IC9A 2EQYA 4M6WB 5KFAA 3GQCA 1NK7A 3T5JA 2B21A 4F71A 2W9AA 1JXEA 4USAA 2HHQA 1VJ5A 3HKZC 4JV2A 3WU2U 1FIQA 1UHUA 4F2SA 2LI6A 1L7MA 2BPCA 1ZD5A 2ZUDA 5L1KA 5DDMA 5K4LA 3UMBA 2QARA 9ICSA 2PFQA 2LHTA 4YMMA 4UW9A 4O3RA 4YP3A 2DPIA 4EZ9A 2KZ3A 2ISOA 1ZQAA 4QZ9A 1N5WA 3PW0A 2LPEA 4J03A 1KFTA 2J6UA 2ZIVA 4Y2SA 1NK5A 3PX0A 7ICFA 3E0FA 4JB3A 2YQEA 1JMSA 3AMZA 4NLKA 3PR4A 4KLEA 2F44A 4C80A 2HHWA 1C20A 1L3VA 4EBCA 4C8LA 5KT7A 3WK7A 1ZXIA 1ZOLA 4UASA 2OH2A 2FDRA 2IOHA 1Z00B 3OTQA 2GH1A 5BOMA 2K4IA 2Y9UA 3BS5A 4JK1A 2W11A 4CNQA 5KAIU 1B0XA 3AN1A 3B9JA 1B22A 4J9RA 2ZJ8A 1T4GA 2W7PA 2WAQF 4CDGA 4K4IA 2RRDA 3TQ1A 7ICLA 1L7PA 3RR7A 4QWDA 3LDAA 1KFDA 8ICQA 2K4EA 8ICGA 3EWAA 4M0AA 4P4PA 2R18A 2E8OA 2C22A 4DEZA 4DS5A 4PL1A 3WK4A 3QU4A 1F5SA 5ALWA 3K1RB 5IIKA 4YR2A 4NWIA 3EPGA 2J6SA 4FZNA 4DL2A 3I1YA 3KBBA 1IG6A 3RFAA 2RDIA 3VC8A 1NJXA 3GV7B 2HI0A 2KE7A 5ALNA 2KG5A 3WK9A 1KFSA 1XWLA 2K8BB 2A1JB 2PFNA 1DOQA 4RQ4A 5AI9A 1KSPA 3M8SA 4J9NA 3EYZA 4DLEA 4P2HA 1ZQSA 3M1YA 2BQUA 4LVSA 7ICEA 2BDPA 4J9PA 9ICKA 3D2QA 4RQ5A 1TFRA 3RTVA 2BR0A 4RQ2A 5ALTA 4KX5A 3DV9A 3WK6A 5DB6A 5J8YC 5B5EU 3RJGA 4KLJA 1Z3EB 1KW4A 2CPRA 3SENA 3I76A 1Z00A 1JROA 1EXNA 4RT2A 2ASDA 4PHDA 3WKEA 4B9LA 2DWQA 2Y1IA 4RQ1A 3SEIA 5KG2A 1N56A 3PSTA 3GDXA 2DUYA 2ZJAA 1BPZA 1PVPA 3ZDCA 2MU2A 4IR9A 3MDCA 2WFAA 2YMPA 3HPOA 4Y2JA 3RAQA 1SWWA 4UB3A 3D2SA 2KP7A 3MABA 1TK5A 3H8WA 2NRZA 1JXLA 5KFHA 1YT3A 1PVQA 3ZDAA 1X66A 2RDJA 1SKWA 7ICIA 1N5XA 4BJQA 1QTMA 5D49A 1DGJA 2ZIWA 4OJ6A 4DO9A 4UAZA 3TADA 3LVVA 3AU2A 3ETLA 3AQFA 2HSZA 4JV0A 2KZMA 4KN4A 2N1RA 2AQ0A 2H3ZA 2CXYA 3F5EA 1L3TA 1F0MA 3QUBA 7ICUA 1QH9A 2JHDA 2EAPA 2JEFA 4AYBF 2HHVA 2F76X 5CB1A 4P0QB 4QZIA 2EANA 1L6NA 2ALZA 1QLNA 2VJ4A 3EUB2 5J0YA 2KHVA 1D8LA 3RF9A 1IM4A 4F5NA 2F1JA 2R8HA 3JPPA 1ZQRA 4ACOA 4KMOB 3CRXA 2KN7A 1S0OA 3V6KA 2KSOB 3TARA 1A6SA 2K4PA 3AQEA 3UPQA 5AM2A 4ECQA 5AI0A 1CEZA 3D6JA 3PNCA 4RNNA 5HMMA 1T3NA 1SWVA 1XS9D 3TADC 2BDUA 3JPSA 2WF5A 5J2KA 3GIJA 2KJ9A 3C21A 4BWJA 5KFOA 1U49A 4I2CA 4QZBA 2GO7A 2F77X 3TAPA 4ECZA 4C7YA 1KQQA 1MQ3A 1HUZA 2XIDA 1T8EA 2Y0SF 8ICYA 9ICHA 4F5QA 4KN7A 3V6JA 1ZD4A 2XGPA 5DGBA 5HHIA 4QW9A 4WJ3B 5KFJA 1FFVA 4DL3A 9ICMA 2ZUCA 3RJEA 4US8A 4YMOA 4RQ8A 3Q8QB 2FLNA 1TV9A 1AROP 3FYHA 5KFUA 7ICGA 4NXZA 3NVWA 2W54A 3MFIA 3WK8A 2XI9A 5DB9A 2W9BB 4ED1A 5J2AA 3F2CA 2DGZA 3MBYA 2QB1A 3G6VA 2LBOA 5KT5A 3AM9A 4P0QA 3NASA 3PW7A 3RJFA 1SXDA 2GLEA 5IINA 2PI4A 1ZQBA 4J9LA 3C5GA 3QUCA 4NLNA 3IM1A 3BQ1A 2YX8A 2AHOB 4RQNA 4EYIB 2JXJA 2A3VA 9ICLA 5IIIA 9ICIA 4IS7A 2AXTU 4R8UA 4Q8FA 5EWGA 4C4RA 1UA0A 2RQ5A 8ICLA 1RYRA 1K5OA 4OJ5A 5G5HA 4ZOHC 2EAMA 2K8AA 2KSOA 2Q0ZX 5KFMA 3QU9A 2BQRA 3NRWA 2FMSA 2WF7A 1SL1A 1X9WA 2XY6A 4C8KA 2F1HA 5J0OA 8ICCA 2XICA 1BPBA 4NLBA 1ZQYA 2KFZA 4NM1A 2E8NA 4PGQA 4DFPA 1KDHA 1U48A 2GWSA 1NZBA 1ZQQA 3KTQA 3IHQB 5DBAA 3RAXA 1N61A 2NO5A 2OM6A 9ICJA 4YVZA 1F44A 4CF3A 3SQIA 2UVWA 5ALZA 4JUZA 1RQLA 2ISPA 4DWIA 2VKQA 4FFDA 1MSWD 3WK5A 2ZTEA 3IDWA 3C2LA 4ELUA 2PFOA 1N63A 5JU5A 2K60A 3BQTA 2PMZC 1V38A 1X42A 5KFIA 2H3FA 4M9GA 4US9A 3UQ0A 3Q8LA 4DSIA 3SAHA 5AKLA 3RJJA 5KAFU 4M9NA 1NOMA 2KHQA 4G9BA 3MR6A 4KLDA 4YD2A 3AL0B 2A1AA 3QXGA
chains in the Genus database with same CATH topology
2EZZA 1QCKA 2EZXA 2ODGA 1CI4A 2EZYA 2BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZZ A;  1QCK A;  2EZX A;  2ODG A;  1CI4 A;  2EZY A;  2BZF A; 
#chains in the Genus database with same CATH topology
 4RUA A;  5HR6 A;  9ICC A;  3QZ8 A;  4TUR A;  2NRV A;  4PHP A;  2F8K A;  1GO3 F;  2LM1 A;  1S76 D;  4Q45 A;  1AQ6 A;  2I1Q A;  4DFM A;  4DSL A;  2BGW A;  4C8M A;  2ZIX B;  2IHN A;  2QB0 B;  5AK5 A;  2HBJ A;  2RHF A;  4O3S A;  2F2A B;  4NM2 A;  2LM4 A;  2YB1 A;  4O5E A;  3F2D A;  4QWA A;  5IIL A;  3KHR A;  3ZD8 A;  3PV8 A;  1DK3 A;  3V7K A;  5D4B A;  2ZTD A;  3C23 A;  5J2I A;  1NK0 A;  4OJO A;  5J0Q A;  4MFF A;  1QQ5 A;  9ICT A;  1XO1 A;  3SZ2 A;  3N7S C;  9ICU A;  4RPX A;  5KFZ A;  9ICX A;  3TAC B;  5ALX A;  4Q8E A;  4IQV A;  8ICJ A;  3B0Y A;  4MHV A;  3HT3 A;  1NK4 A;  1S0N A;  4OJP A;  2ZJ5 A;  7ICM A;  5KG7 A;  3NGD A;  1DK2 A;  3QEB Z;  4UAY A;  3HWT A;  1ECW A;  4F3O A;  7ICR A;  4IL6 U;  3E58 A;  4QWC A;  2IOF K;  7ICT A;  3DDH A;  8ICR A;  7ICS A;  5BOL A;  1Z1B A;  4J9M A;  3Q8M A;  3MGH A;  1ZQD A;  2DQN B;  2YN4 A;  3ONN A;  1D9D A;  1ZQV A;  3UXO A;  1A76 A;  1PK1 B;  2M9N A;  4EBD A;  4DQS A;  1PZN A;  5ALS A;  1O03 A;  4O3N A;  1Q46 A;  1UPH A;  4RQ0 A;  4UAT A;  2UVV A;  2BCU A;  4UB6 U;  4F4X A;  2V9W A;  2V4Q A;  2JGA A;  1TAM A;  2Q4T A;  2I6X A;  5AKZ A;  2L5Y A;  5ALQ A;  2YTU A;  3UMC A;  2G5H B;  1DGS A;  4RNM A;  3H8J A;  4QZC A;  5E79 U;  4JMU A;  4R63 A;  2E1F A;  4I2D A;  2V4R A;  4QJF B;  2BPF A;  1IIP A;  1KRP A;  3OGU A;  5DLF A;  5KFC A;  1RM6 C;  2W3S A;  1ZJN A;  3M6K A;  5J2H A;  2A19 A;  1X9S A;  1RYU A;  1NKB A;  2PKE A;  3QNM A;  4QZH A;  4FO6 A;  2VIX A;  1TE2 A;  5HML A;  1BPX A;  1B43 A;  5ALH A;  4RPY A;  3N4M B;  3ORY A;  1TK8 A;  3L4P A;  4KLG A;  4B9S A;  3OPX A;  2ODG A;  3H4D A;  5KFD A;  5EE3 A;  2IMW P;  4KLH A;  1HJP A;  4KLF A;  1BGX T;  3M7D A;  3N97 B;  8ICF A;  9ICO A;  3V6H A;  9ICV A;  2AGP A;  4DL6 A;  5AKK A;  5AIC A;  2WAQ C;  2C28 A;  5J8Y A;  3RH4 A;  4ED7 A;  4B6J A;  5J2D A;  3QE9 Y;  3RH5 A;  1ZQC A;  2R8G A;  4M47 A;  2KEY A;  2YY6 A;  2AQ4 A;  4JV1 A;  2NO4 A;  2H3I A;  5EWF A;  4F5R A;  2K89 A;  3H0L B;  4QWB A;  2F8L A;  5EOZ A;  3K1Z A;  1KEJ A;  3FDS A;  4QZE A;  4M6W A;  3JPR A;  4UB2 A;  5DB7 A;  5AM4 A;  4OD0 A;  2XVT A;  1SZP A;  3QUQ A;  2KKP A;  5IIJ A;  3R9K A;  3RJH A;  4CE6 A;  1PK1 A;  2ZTC A;  3RBE A;  2E5S A;  3IRU A;  1XU4 A;  3C2K A;  1SB3 C;  5J2J A;  3MR5 A;  3SV4 A;  5DG7 A;  1TAU A;  4QZG A;  1ZRN A;  3LWM A;  2EDU A;  4EBE A;  3T5H A;  3UXN A;  5HR7 A;  2W8K A;  4Q44 A;  2ZUB A;  4I2J A;  4O0I A;  1OUQ A;  4HYK A;  4RQ3 A;  4EEK A;  3KKA C;  4YR0 A;  4ED6 A;  3H0R B;  5ALY A;  5AKE A;  3WKC A;  2B0C A;  2HBM A;  1JI7 A;  2XO7 A;  3CP8 A;  1N62 A;  5CJ7 A;  1XNS A;  3H8S A;  4BXO B;  1IV8 A;  1DRG A;  3C1Y A;  8ICZ A;  4QW8 A;  2DBY A;  2OYY A;  7ICO A;  4I2H A;  4YD1 A;  5KG3 A;  1X40 A;  3KHL A;  2MAX A;  1UT5 A;  2XY7 A;  5HHH A;  2LKY A;  5KNI A;  3NVZ A;  8ICO A;  5DQH A;  1JUD A;  7ICN A;  1HEK A;  1CUK A;  4GXJ A;  1S8O A;  2FLP A;  3AU6 A;  5KFQ A;  4ECR A;  5F9N A;  2MA1 A;  2MSN A;  1ZYQ A;  3A0B U;  2WF8 A;  1SV0 C;  4ECU A;  2I5H A;  3ZDD A;  1D9F A;  1SXE A;  4DL5 A;  4EX6 A;  4NLZ A;  4RQ7 A;  4UB5 A;  2P6R A;  5AI6 A;  4TQR A;  3AUO A;  3L3F X;  5KT4 A;  4RPZ A;  2JEI A;  1IXR A;  4PPX A;  4C4T A;  3UQ2 A;  3K75 D;  5AKH A;  1NKC A;  2JH7 A;  3N7R C;  3PML A;  5F3X B;  4JWN A;  3ALR A;  2VAN A;  1VLB A;  2R8J A;  1SKR A;  2A1J A;  5B66 U;  4O3O A;  1MN8 A;  5DDY A;  3U26 A;  3UM9 A;  9ICN A;  2HOQ A;  3KD3 A;  4KLM A;  2FMP A;  1ZJM A;  2R8K A;  3M9M B;  4O3Q A;  8ICV A;  5KL1 B;  5KFF A;  4UBB A;  8ICE A;  9ICA A;  4O5C A;  3C28 A;  1J2N A;  4QNL A;  4ECX A;  3GZF A;  1ZQK A;  4GC7 A;  3LWL A;  5CR0 A;  4YG2 A;  4AYB C;  1Q8K A;  7ICK A;  3QYP A;  3OHA A;  2M0N A;  2DKX A;  1Z4N A;  9ICB A;  5AK6 A;  4NLC A;  4DOC A;  5ALR A;  2QKQ A;  4NL9 A;  2HHX A;  5J2E A;  4UQG A;  2JMG A;  5DBC A;  3SMV A;  5ALL A;  4BXO A;  1U47 A;  2KFN A;  4Q43 A;  1U45 A;  4O9M A;  3M9O B;  3H8M A;  3QUT A;  2FMQ A;  1L3U A;  5ALV A;  1JRP A;  2K4H A;  2VA8 A;  3QU2 A;  3TFS A;  4MFC A;  4BWM A;  3IV6 A;  4ELV A;  3PSF A;  1ZQG A;  4DLG A;  4BUG A;  2G09 A;  3N7P D;  4J9S A;  4I2F A;  2VJ5 A;  3RB6 A;  8ICU A;  4MEY A;  7ICQ A;  2HOF A;  3L5K A;  4GXK A;  1RXW A;  4KTQ A;  4KLU A;  2KIW A;  3TAQ A;  1SL0 A;  2W7O A;  1KTQ A;  2KJ5 A;  2C2R A;  1XSL A;  4Z6D A;  3GII A;  1ZD3 A;  3PR5 B;  5DG8 A;  5KG4 A;  3AEV A;  1LVH A;  3H0M B;  7ICH A;  4KLT A;  3H4B A;  4PHE A;  4DL4 A;  2K8C B;  2Y0S C;  4ED3 A;  3G6Y A;  4NL9 C;  2LYH A;  5L1J A;  3MR3 A;  5ALU A;  1ZQT A;  1QQ6 A;  4ED2 A;  4RQ6 A;  2BCV A;  5J29 A;  2DL0 A;  3BQ2 A;  4DFD A;  3JPQ A;  1L7N A;  2FPM A;  3E2E A;  2VA3 A;  1UT8 A;  2ZXH A;  2HVI A;  2PFP A;  4DQI A;  4X5V A;  2W3R A;  4F4Z A;  4DSF A;  1QQ7 A;  1S9F A;  2OEH A;  1COK A;  3KHG A;  1ZQI A;  2BKE A;  5J0W A;  2CN1 A;  4ECT A;  4RQM A;  1H38 A;  5KFL A;  2ESE A;  3RB4 A;  4PGY A;  3KHH A;  4A8E A;  1LB2 B;  4YXM A;  4XQ8 A;  5AM5 A;  4F91 B;  5ALD A;  4YR3 A;  4BDP A;  1Z4O A;  2KVC A;  3ZD9 A;  1T7P A;  2ASL A;  2JRZ A;  1JIH A;  4QIW F;  4QZF A;  2EAO A;  4MF2 A;  9ICW A;  1NK6 A;  7ICP A;  5J2F A;  4FZM A;  3IG5 A;  1QSL A;  2HDO A;  1RZT A;  2WF6 A;  1X2I A;  4C0Z A;  2Y1J A;  5G5G A;  1N60 A;  1ZQO A;  5J0T A;  4UBC A;  1ZD2 P;  5CA7 A;  4U7C A;  3SD7 A;  3ETR A;  4Y2Q A;  2IA6 A;  8ICM A;  4YMN A;  1HUO A;  3RR8 A;  5KFK A;  2KZZ A;  2KVS A;  5CP2 A;  4E0D A;  1RDF A;  1NK8 A;  3RJK A;  3QZ7 A;  1Z1V A;  3OSN A;  4FS1 A;  8ICI A;  1ZQF A;  3HIL A;  4DL7 A;  1MQ2 A;  2WB1 F;  2G5I B;  5KTQ A;  4F8R A;  1ED1 A;  1Z19 A;  1A77 A;  1BNP A;  2MUT B;  2W9B A;  5AIA A;  5A0L A;  1T94 A;  2BHN A;  5KFG A;  2WF9 A;  5JTI A;  2FJ6 A;  2WB1 C;  3LK9 A;  2UVR A;  3QEA Z;  3BZC A;  2KMD A;  1JX4 A;  7ICV A;  5AKJ A;  4ECY A;  3F2B A;  5JRT A;  3NTU A;  3IG8 A;  4DFJ A;  5KFW A;  2OCE A;  1XSN A;  5DLG A;  3MGI A;  1NJW A;  2EZX A;  4F50 A;  1S10 A;  4J9Q A;  4ED8 A;  4DF4 A;  4LZD A;  1NK9 A;  1QSY A;  1TKD A;  3TKA A;  5F9L A;  4HAI A;  4PH5 A;  5EE1 A;  2EZZ A;  2HBK A;  2IBK A;  3IN5 A;  1T3Q A;  2PXI A;  3J81 j;  2NRW A;  3FC4 A;  3S6J A;  1K1S A;  2FI1 A;  2D6F C;  3B0X A;  2HHT A;  9ICP A;  3BZK A;  1MA7 A;  3ZDB A;  4ECV A;  4YXJ A;  1KN5 A;  4K4H A;  1WYG A;  1NJZ A;  2F1I A;  4I2A A;  5L1M A;  3SAG A;  4OCZ A;  3N28 A;  5ALI A;  4GXI A;  4M9L A;  4K4G A;  1Q3U A;  2KKV A;  1RXV A;  2JR5 A;  2HHS A;  1ZQH A;  4FBT A;  4TUP A;  3NS1 A;  3C1Z A;  2WHE A;  3Q8R B;  3LYS A;  4F4W A;  3F53 A;  3WKA A;  1SIJ A;  2OXO A;  3MC1 A;  5AM1 A;  3CYM A;  9ICQ A;  3QU7 A;  1BVS A;  4O3M A;  3K4G A;  1MC8 A;  1RPL A;  3HKZ F;  3WKD A;  2D8C A;  1LKY B;  5KFR A;  5IIO A;  4XRH A;  4F92 B;  3PX4 A;  4LJX A;  4NLG A;  5AKI A;  3Q8P B;  2MUT A;  4FE3 A;  4R64 A;  3HW8 A;  4Y2P A;  3Q8K A;  4C8O A;  4IRK A;  3ZI4 A;  2AU0 A;  2HCF A;  1S77 D;  1S0V A;  5AK3 A;  2W55 A;  3KZX A;  4PHA A;  4Y2U A;  5CHG A;  3JPO A;  9ICR A;  5C0Y A;  4I27 A;  2W9M A;  1L8O A;  1CI4 A;  5J2G A;  4B9T A;  3EW9 A;  2AGQ A;  3PW5 A;  1V97 A;  1NNL A;  1RQN A;  4C4S A;  4I2B A;  2HW3 A;  3C5F A;  4KLQ A;  2BCR A;  3HX0 A;  1X6I A;  2ZIX A;  2QB0 A;  4GFJ A;  1P7D A;  4Z6E A;  5KG6 A;  3IP4 B;  5CWR A;  4FZL A;  4RU9 A;  4EYH B;  8ICA A;  5KFS A;  4TUQ A;  3UMG A;  3SI8 A;  2XGQ A;  1SGG A;  2CRX A;  2HVH A;  3SYZ A;  3PSP A;  3BS7 A;  4KLI A;  1NKE A;  5AI4 A;  5H2F U;  5DKW A;  2KTQ A;  5T14 A;  5BPC A;  1FEZ A;  3KKA A;  5DG9 A;  1KBU A;  4KMU A;  3V72 A;  4C7Z A;  3NRZ A;  5TIS U;  4B9N A;  5AI8 A;  5ALK A;  8ICX A;  2JH1 A;  2JEG A;  2JZB B;  1QCK A;  5J0S A;  1WG8 A;  2KIV A;  4CCH A;  4RZR A;  3WKB A;  2J6T A;  2JV3 A;  2E8P A;  3EZ5 A;  2ZIU B;  5DBB A;  2FPL A;  5J2C A;  2KK0 A;  5KFP A;  2UVU A;  5KFN A;  3CW2 C;  1ZQZ A;  4QZD A;  2Z7J A;  1JAL A;  2MRL A;  1RYS A;  1XSP A;  1SKS A;  5EWE A;  1O08 A;  4BGD A;  2G0A A;  4B9U A;  3OSP A;  4DQR A;  2ZIW B;  4UB1 A;  8ICP A;  4IQW A;  1FO4 A;  4M9H A;  1LKY A;  4PGX A;  5ALE A;  1BPD A;  4YFK A;  5EE9 A;  3PO5 A;  2NRX A;  4CF5 A;  2HBL A;  1V85 A;  4UAV A;  4QWE A;  4PZN A;  1ZET A;  2P66 A;  1SV0 A;  1TVA A;  1SZH A;  8ICK A;  3FM9 A;  3TFR A;  4DFK A;  3VCB A;  1NZP A;  2XC9 A;  4DOB A;  1ZQE A;  2RLT A;  5ALO A;  4UB8 U;  4KX3 A;  5KFX A;  1KKX A;  5DQI A;  5FP0 A;  2KV2 A;  4KIT B;  5KL8 B;  1NJY A;  5J0P A;  4FS2 A;  1WCL A;  5KFY A;  2W43 A;  5DGA A;  4M04 A;  4R65 A;  1ZQN A;  3PMN A;  2PI5 A;  2O6K A;  4YN4 A;  2ASJ A;  4NJ8 A;  2QLT A;  3MR2 A;  2W03 A;  4EEY A;  1UQV A;  5AKG A;  2BZF A;  1COO A;  1J2M A;  4O5K A;  4B9M A;  2WTF A;  2YMM A;  2JEJ A;  4DSJ A;  1B4F A;  2KOB A;  5C5J A;  3NVY A;  1QSS A;  1XC9 A;  5AKX A;  3RBD A;  2JZB A;  3H40 A;  4KLS A;  2EH9 A;  5KT6 A;  3TI0 A;  1X9M A;  4DSE A;  4RUC A;  1KLN A;  1YZ7 A;  2YMQ A;  5J0R A;  3KFU F;  5L9X A;  2XCA A;  3GIM A;  2ZIU A;  4P0P B;  2W8L A;  4IR1 A;  1WWV A;  4EX7 A;  1ZQJ A;  3SAF A;  4Z6F A;  3T3F A;  4Y2R A;  3HJE A;  4DCC A;  2HMX A;  5AHX A;  3GFK B;  2H3V A;  4I29 A;  2E3T A;  4LZG A;  1V9P A;  2I9G A;  3RRH A;  3GV8 B;  2H5X A;  1JN3 A;  1SV4 A;  3V7J A;  5ALP A;  2VA2 A;  1ZRM A;  1U4B A;  2P6U A;  4DQP A;  1TAQ A;  1ZQ1 C;  3M6Z A;  4EEN A;  4I2E A;  4CRX A;  4ZH4 A;  4Y2Y A;  5ALM A;  4UB4 A;  2XCP A;  3FAH A;  4ECW A;  4P4M A;  2C2D A;  4IRC A;  4EZ6 A;  5GTH U;  4OO1 J;  5KG0 A;  2B6G A;  3KZI U;  2DPJ A;  1BNO A;  4IRD A;  2HOI A;  1OXJ A;  4IQU A;  5AK4 A;  4QZA A;  3BDP A;  4QZ8 A;  4AP9 A;  1C7Y A;  3MDA A;  4I2G A;  1WWU A;  1J97 A;  2LYA A;  4R8U B;  1YZ6 A;  3PSI A;  3JPN A;  4F2R A;  4P4O A;  2FPK A;  3F5A A;  1L3S A;  5AI5 A;  4GC6 A;  2NYV A;  3SV3 A;  5ALG A;  5AM0 A;  4F5P A;  4RNO A;  3OJU A;  9ICE A;  2LMR A;  2NRT A;  5KFT A;  4DOA A;  2BCQ A;  3Q8S B;  3C29 A;  3ED5 A;  3MFH A;  4DSK A;  4YQW A;  3RJI A;  4RT3 A;  2ZXI A;  1SL2 A;  2AGO A;  4OJL A;  4JWM A;  3TAN A;  2F3N A;  2KJ8 A;  2LYB A;  1BPE A;  3NVV A;  4PL2 A;  3C2M A;  1U9L A;  5IIM A;  2BPG A;  1K1Q A;  5CEH A;  5EE0 A;  2EZY A;  4C8N A;  2G07 A;  5DQG A;  4F5O A;  3M9N B;  4P0P A;  3ISD A;  1FFU A;  1M6Y A;  3GV5 B;  2DKZ A;  2FLL A;  4KLO A;  2KNJ A;  3D2N A;  1HIW A;  1X6J A;  1D8B A;  3OJS A;  3PX6 A;  5L1L A;  4BX9 C;  1Q3V A;  3PZP A;  2HHU A;  4F4Y A;  8ICN A;  3JPT A;  4Y2T A;  3BQ7 A;  4FBU A;  2E8M A;  5J0X A;  2D3D A;  2P35 A;  3HRD D;  5KG1 A;  3T5L A;  2C2E A;  9ICG A;  5L1I A;  3H7I A;  1KL9 A;  5ALJ A;  1OW5 A;  4B9V A;  4Y2V A;  2IOF A;  4O3P A;  3PW4 A;  2FE9 A;  2YML A;  3THV A;  5DB8 A;  2IHM A;  3CNH A;  2AH5 A;  3ICX A;  4G3I A;  1L8L A;  1Y88 A;  5GTI U;  4CF4 A;  2G06 A;  3GU3 A;  4QIW C;  3HP6 A;  3BJY A;  4J9K A;  4YCX A;  4GLX A;  2H3Q A;  2OHF A;  3A0H U;  4J9O A;  3O0F A;  3T5K A;  4XA5 A;  3NUQ A;  5KT2 A;  5KG5 A;  4M9J A;  1L7O A;  5CRX A;  2W9C B;  4DF8 A;  9ICF A;  3PY8 A;  2BQ3 A;  2Y9T A;  2W04 A;  3I28 A;  1BPY A;  1X9X A;  1VDV A;  8ICB A;  8ICH A;  3ISB A;  2YB4 A;  3ISC A;  2PMZ F;  1ZQP A;  1ZQM A;  4I28 A;  3T79 A;  4PZO A;  2KIC A;  1LV5 A;  5J2B A;  4Y2X A;  1DXS A;  8ICW A;  3LVW A;  3PW2 A;  4F93 B;  2G08 A;  3BQ0 A;  4MF8 A;  1N2X A;  1WCN A;  1PVR A;  2ATL A;  3RH6 A;  1ZQX A;  1NI3 A;  4U6P A;  1UCV A;  1L5U A;  2QAR B;  5KFV A;  1UA1 A;  1XO0 A;  1N48 A;  1TK0 A;  5HP4 A;  3RRG A;  3M8R A;  2RP5 A;  1RG6 A;  4Z6C A;  3PVX A;  4GIB A;  1PUZ A;  5AM3 A;  5AKY A;  3GIK A;  4UAW A;  2ZIV B;  3QX7 A;  4DQQ A;  2NV3 A;  8ICS A;  4F72 A;  3V7L A;  2BCS A;  1S5L U;  3KOO A;  3ZDE A;  1S0M A;  1URJ A;  4EEL A;  4DS4 A;  2R8I A;  5D46 A;  4KLL A;  2ZG6 A;  3PO4 A;  3OHB A;  4R66 A;  3G6X A;  3RB3 A;  3UXP A;  5KFB A;  5KFE A;  5TZV A;  3BS5 B;  4NV0 A;  4F4K A;  5KT3 A;  5JUM A;  4MEX A;  4CGZ A;  4XUS A;  4ED0 A;  1A0P A;  1PK3 A;  2ES6 A;  4M2Y A;  2W9C A;  1ZQL A;  8ICT A;  3DEE A;  4ELT A;  4UAR A;  5HNK A;  4IQT A;  1CRX A;  5ALF A;  4PJ0 U;  4NY8 A;  3EPI A;  2GOL A;  3QU5 A;  2OWO A;  4ECS A;  4TUS A;  4TQS A;  4MFA A;  4ICA A;  1D8Y A;  2DF4 B;  5J0U A;  2E1E A;  3MGV A;  7ICJ A;  2AJQ A;  1S97 A;  2DFL A;  3RB0 A;  5AIB A;  1ZQU A;  2KD1 A;  4UAU A;  3SR6 A;  1ZQW A;  1WUD A;  2XY5 A;  3GIL A;  4I2I A;  4IC9 A;  2EQY A;  4M6W B;  5KFA A;  3GQC A;  1NK7 A;  3T5J A;  2B21 A;  4F71 A;  2W9A A;  1JXE A;  4USA A;  2HHQ A;  1VJ5 A;  3HKZ C;  4JV2 A;  3WU2 U;  1FIQ A;  1UHU A;  4F2S A;  2LI6 A;  1L7M A;  2BPC A;  1ZD5 A;  2ZUD A;  5L1K A;  5DDM A;  5K4L A;  3UMB A;  2QAR A;  9ICS A;  2PFQ A;  2LHT A;  4YMM A;  4UW9 A;  4O3R A;  4YP3 A;  2DPI A;  4EZ9 A;  2KZ3 A;  2ISO A;  1ZQA A;  4QZ9 A;  1N5W A;  3PW0 A;  2LPE A;  4J03 A;  1KFT A;  2J6U A;  2ZIV A;  4Y2S A;  1NK5 A;  3PX0 A;  7ICF A;  3E0F A;  4JB3 A;  2YQE A;  1JMS A;  3AMZ A;  4NLK A;  3PR4 A;  4KLE A;  2F44 A;  4C80 A;  2HHW A;  1C20 A;  1L3V A;  4EBC A;  4C8L A;  5KT7 A;  3WK7 A;  1ZXI A;  1ZOL A;  4UAS A;  2OH2 A;  2FDR A;  2IOH A;  1Z00 B;  3OTQ A;  2GH1 A;  5BOM A;  2K4I A;  2Y9U A;  3BS5 A;  4JK1 A;  2W11 A;  4CNQ A;  5KAI U;  1B0X A;  3AN1 A;  3B9J A;  1B22 A;  4J9R A;  2ZJ8 A;  1T4G A;  2W7P A;  2WAQ F;  4CDG A;  4K4I A;  2RRD A;  3TQ1 A;  7ICL A;  1L7P A;  3RR7 A;  4QWD A;  3LDA A;  1KFD A;  8ICQ A;  2K4E A;  8ICG A;  3EWA A;  4M0A A;  4P4P A;  2R18 A;  2E8O A;  2C22 A;  4DEZ A;  4DS5 A;  4PL1 A;  3WK4 A;  3QU4 A;  1F5S A;  5ALW A;  3K1R B;  5IIK A;  4YR2 A;  4NWI A;  3EPG A;  2J6S A;  4FZN A;  4DL2 A;  3I1Y A;  3KBB A;  1IG6 A;  3RFA A;  2RDI A;  3VC8 A;  1NJX A;  3GV7 B;  2HI0 A;  2KE7 A;  5ALN A;  2KG5 A;  3WK9 A;  1KFS A;  1XWL A;  2K8B B;  2A1J B;  2PFN A;  1DOQ A;  4RQ4 A;  5AI9 A;  1KSP A;  3M8S A;  4J9N A;  3EYZ A;  4DLE A;  4P2H A;  1ZQS A;  3M1Y A;  2BQU A;  4LVS A;  7ICE A;  2BDP A;  4J9P A;  9ICK A;  3D2Q A;  4RQ5 A;  1TFR A;  3RTV A;  2BR0 A;  4RQ2 A;  5ALT A;  4KX5 A;  3DV9 A;  3WK6 A;  5DB6 A;  5J8Y C;  5B5E U;  3RJG A;  4KLJ A;  1Z3E B;  1KW4 A;  2CPR A;  3SEN A;  3I76 A;  1Z00 A;  1JRO A;  1EXN A;  4RT2 A;  2ASD A;  4PHD A;  3WKE A;  4B9L A;  2DWQ A;  2Y1I A;  4RQ1 A;  3SEI A;  5KG2 A;  1N56 A;  3PST A;  3GDX A;  2DUY A;  2ZJA A;  1BPZ A;  1PVP A;  3ZDC A;  2MU2 A;  4IR9 A;  3MDC A;  2WFA A;  2YMP A;  3HPO A;  4Y2J A;  3RAQ A;  1SWW A;  4UB3 A;  3D2S A;  2KP7 A;  3MAB A;  1TK5 A;  3H8W A;  2NRZ A;  1JXL A;  5KFH A;  1YT3 A;  1PVQ A;  3ZDA A;  1X66 A;  2RDJ A;  1SKW A;  7ICI A;  1N5X A;  4BJQ A;  1QTM A;  5D49 A;  1DGJ A;  2ZIW A;  4OJ6 A;  4DO9 A;  4UAZ A;  3TAD A;  3LVV A;  3AU2 A;  3ETL A;  3AQF A;  2HSZ A;  4JV0 A;  2KZM A;  4KN4 A;  2N1R A;  2AQ0 A;  2H3Z A;  2CXY A;  3F5E A;  1L3T A;  1F0M A;  3QUB A;  7ICU A;  1QH9 A;  2JHD A;  2EAP A;  2JEF A;  4AYB F;  2HHV A;  2F76 X;  5CB1 A;  4P0Q B;  4QZI A;  2EAN A;  1L6N A;  2ALZ A;  1QLN A;  2VJ4 A;  3EUB 2;  5J0Y A;  2KHV A;  1D8L A;  3RF9 A;  1IM4 A;  4F5N A;  2F1J A;  2R8H A;  3JPP A;  1ZQR A;  4ACO A;  4KMO B;  3CRX A;  2KN7 A;  1S0O A;  3V6K A;  2KSO B;  3TAR A;  1A6S A;  2K4P A;  3AQE A;  3UPQ A;  5AM2 A;  4ECQ A;  5AI0 A;  1CEZ A;  3D6J A;  3PNC A;  4RNN A;  5HMM A;  1T3N A;  1SWV A;  1XS9 D;  3TAD C;  2BDU A;  3JPS A;  2WF5 A;  5J2K A;  3GIJ A;  2KJ9 A;  3C21 A;  4BWJ A;  5KFO A;  1U49 A;  4I2C A;  4QZB A;  2GO7 A;  2F77 X;  3TAP A;  4ECZ A;  4C7Y A;  1KQQ A;  1MQ3 A;  1HUZ A;  2XID A;  1T8E A;  2Y0S F;  8ICY A;  9ICH A;  4F5Q A;  4KN7 A;  3V6J A;  1ZD4 A;  2XGP A;  5DGB A;  5HHI A;  4QW9 A;  4WJ3 B;  5KFJ A;  1FFV A;  4DL3 A;  9ICM A;  2ZUC A;  3RJE A;  4US8 A;  4YMO A;  4RQ8 A;  3Q8Q B;  2FLN A;  1TV9 A;  1ARO P;  3FYH A;  5KFU A;  7ICG A;  4NXZ A;  3NVW A;  2W54 A;  3MFI A;  3WK8 A;  2XI9 A;  5DB9 A;  2W9B B;  4ED1 A;  5J2A A;  3F2C A;  2DGZ A;  3MBY A;  2QB1 A;  3G6V A;  2LBO A;  5KT5 A;  3AM9 A;  4P0Q A;  3NAS A;  3PW7 A;  3RJF A;  1SXD A;  2GLE A;  5IIN A;  2PI4 A;  1ZQB A;  4J9L A;  3C5G A;  3QUC A;  4NLN A;  3IM1 A;  3BQ1 A;  2YX8 A;  2AHO B;  4RQN A;  4EYI B;  2JXJ A;  2A3V A;  9ICL A;  5III A;  9ICI A;  4IS7 A;  2AXT U;  4R8U A;  4Q8F A;  5EWG A;  4C4R A;  1UA0 A;  2RQ5 A;  8ICL A;  1RYR A;  1K5O A;  4OJ5 A;  5G5H A;  4ZOH C;  2EAM A;  2K8A A;  2KSO A;  2Q0Z X;  5KFM A;  3QU9 A;  2BQR A;  3NRW A;  2FMS A;  2WF7 A;  1SL1 A;  1X9W A;  2XY6 A;  4C8K A;  2F1H A;  5J0O A;  8ICC A;  2XIC A;  1BPB A;  4NLB A;  1ZQY A;  2KFZ A;  4NM1 A;  2E8N A;  4PGQ A;  4DFP A;  1KDH A;  1U48 A;  2GWS A;  1NZB A;  1ZQQ A;  3KTQ A;  3IHQ B;  5DBA A;  3RAX A;  1N61 A;  2NO5 A;  2OM6 A;  9ICJ A;  4YVZ A;  1F44 A;  4CF3 A;  3SQI A;  2UVW A;  5ALZ A;  4JUZ A;  1RQL A;  2ISP A;  4DWI A;  2VKQ A;  4FFD A;  1MSW D;  3WK5 A;  2ZTE A;  3IDW A;  3C2L A;  4ELU A;  2PFO A;  1N63 A;  5JU5 A;  2K60 A;  3BQT A;  2PMZ C;  1V38 A;  1X42 A;  5KFI A;  2H3F A;  4M9G A;  4US9 A;  3UQ0 A;  3Q8L A;  4DSI A;  3SAH A;  5AKL A;  3RJJ A;  5KAF U;  4M9N A;  1NOM A;  2KHQ A;  4G9B A;  3MR6 A;  4KLD A;  4YD2 A;  3AL0 B;  2A1A A;  3QXG A; 
#chains in the Genus database with same CATH homology
 2EZZ A;  1QCK A;  2EZX A;  2ODG A;  1CI4 A;  2EZY A;  2BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...