1N62A

Crystal structure of the mo,cu-co dehydrogenase (codh), n-butylisocyanide-bound state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
b'KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n62A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n62A01
4YTPB 1XLOA 1T3QA 4US9A 1N60A 2EKIA 1FM0D 4LTUA 1ZOYB 2MJDA 2CU3A 1JALA 1JW9D 1YQ4B 1PFDA 2CJOA 3AH7A 3W9CB 1QT9A 3AE6B 2W54A 1YJJA 2WDRB 1OQRA 4YSZB 1J7AA 1EWYC 2AX5A 2MJ3A 1N5XA 1FRDA 2PIAA 1QOFA 1NYRA 2H88B 3LB8C 5AUKA 3RPFC 4A9AA 1RWSA 5EE1A 2KAJA 2WS3B 2WP9B 3NVVA 1XLPA 3AECB 1QF6A 1CJEA 3AEAB 1IUEA 2BS3B 1FXAA 3EUB2 2PKOA 2PVGC 1XLNA 3AE9B 3W5VB 4YXDB 1DOIA 2B76B 2L52A 1SB3C 2PVOD 3NS1A 3P4SB 1TYGB 5G5GA 1NENB 3KWLA 3VRBB 2KMMA 1WXQA 2LEKA 1ZP0B 4YTMB 1FFVA 3VR9B 3AE1B 4N6EB 1N5WA 1N62A 4ZHPA 1ROEA 1NEKB 3NVWA 2CJNA 1QOGA 2H89B 3FAHA 2W3RA 1KFYB 3B2GA 1OFFA 1SIJA 1ZUD2 3VRAB 1E10A 1RFKA 1WRIA 3ZYYX 2HTME 3P1MA 4WWMA 3PO0A 1FRRA 1NYQA 4C80A 2MH7A 3AE2B 4IDIA 1V97A 3SFEB 1V8CA 2G1EA 2WLBA 1OQQA 3AN1A 1VJKA 3ABVB 1JROA 3AE4B 1JQ4A 1FIQA 3W5UB 3VR8B 2Q5WD 1WGKA 2WDVB 2WDQB 1AYFA 3LXFA 3P4QB 3ETRA 4FXCA 1DOXA 3HRDD 5C2TB 1SF0A 2BT6A 4YTNB 2DBYA 3P63A 5EE9A 1KF6B 3L4PA 4ZHOA 1JWAD 4USAA 1L6UA 3AV8A 3BIID 4YSXB 1VLBA 2M19A 2WU2B 1L6VA 1YQ3B 4N58A 1GPXA 1XLQA 3AEEB 2W55A 1PDXA 2MJEA 2W3SA 3NVYA 5EE3A 1DGJA 2JX5A 2OHFA 1R7SA 3AE5B 5G5HA 2K22A 5AUIA 2E3TA 1FFUA 3CWIA 3AM9A 1NVID 1N61A 1YJIA 3AMZA 3AE8B 1VDVA 1E6EB 1B9RA 4US8A 5H92C 4C7YA 4JWSC 2M56B 1F0ZA 3SR6A 5C3JB 3FC4A 1RYJA 3HUIA 2N0SB 2BS4B 3WCQA 4KX6B 3AE7B 4P6VF 5H8YE 2JQRB 3AE3B 3AEFB 1TKYA 4HRSA 1E0ZA 3DWMA 1AWDA 4ZOHC 1FO4A 1L0VB 3B9JA 1A70A 1E9MA 1PUTA 1UWMA 2WU5B 1WWTA 2FBWB 4WQMA 3AEBB 3NRZA 3CIRB 3AB5A 1ZXIA 1FXIA 1QOAA 1XO3A 2L83A 3P4RB 2ACZB 1QLBB 1NI3A 1E7PB 3AEDB 4JX1C 4N59A 1TKEA 1JWBD 1TKGA 5EE0A 1KRHA 3HVZA 2K5PA 3DWGC 3P4PB 1J7BA 4ITKA 1TJEA 1WYGA 1DOYA 4C7ZA 3B2FA 1L5PA 2Y5CA 1FMAD 5GXGB 2DWQA 1RM6C 2BS2B 4YSYB 1CZPA 2K9XA 2QJLA 1J7CA 1JRPA 3SFDB 1I7HA 4JWUC 1GAQB 2QIEB 4YT0B 5MPOA 1N63A 2WQYB 1QOBA 4HROA 3NVZA 3AEGB
chains in the Genus database with same CATH superfamily
4WQOB 1XLOA 4PZNA 2RDHA 2DKXA 2EKIA 4MM3B 1FM0D 5DKWA 2L8JA 4IM2A 4W9FA 1WGGA 3AUOA 1YN3A 4MEYA 3MC1A 3RAXA 2V4IB 2KN4A 1RXWA 2M1MA 2ONQA 3THVA 4EZLA 3VUXA 2MBHA 2MHJA 3PZ7A 3ZDMC 4AJYB 1F52A 4O5CA 1MI0A 3AE9B 2IHNA 1HTQA 9ICQA 2DKZA 5DPTA 1ZQXA 4QZDA 4W9JA 3APCA 2CS4A 3SU8X 4YL8A 1D9FA 2BR0A 4GU2A 4B0EA 3BQ0A 1TBEA 2O6KA 1HUZA 5BOLA 4TURA 2N1RA 3WK9A 2J6SA 1H8CA 4WURA 1JCKB 2W3RA 2LRUA 4DHJB 1E10A 1Z00A 1ZQMA 2RP5A 2KMAA 1WE6A 2A4ZA 2QARA 1S5LU 1KFSA 1V5OA 3ED5A 3AE4B 4KN7A 5KFZA 5IO9A 3P4QB 2KJHB 4UAYA 3IFWB 5EE9A 5J0SA 3KH0A 3F5EA 3M6ZA 4TQ0A 2LVQA 2N9PC 1ZQGA 1GC6A 1UUPA 3HK0A 2EH9A 4YSXB 2K89A 2WF7A 4G3IA 3Q8AA 5BYSA 2HE7A 2JVCA 5DBAA 2IGGA 4GGQA 1WXAA 4UB3A 4ED3A 4PHEA 1WI0A 1ZDVA 4ZRIA 4DS4A 3PLVA 3RCZA 4ED1A 4E0DA 5J2GA 1R4MB 2L1AA 2A1JA 4YFKA 5IN7A 1ZD5A 2PE9A 4US8A 4WIPA 1S0OA 5H92C 1SE9A 1EXNA 2WAQF 3FC4A 3MJWA 1E7VA 3GQCA 2O2VB 7ICEA 4GB9A 4RQ6A 4DF8A 2QDFA 3OTQA 3U7DA 2VJ5A 3FDSA 1K50A 1RYUA 1MG8A 1WWUA 5TR5A 4Z6EA 1T6BX 2GO7A 2D07B 1JRUA 2LGIA 3RF9A 4EZJA 3PGEA 5KFBA 2KNBA 3V05A 2M0AA 3QAQA 2KKCA 4RCOA 4K4GA 2N9XA 2HD5B 4EFOA 1WZ3A 4DO9A 1YMHE 1ZQ1C 5J0RA 5AM5A 1TKGA 3WALA 2UVRA 5T8IA 1Q46A 4ITKA 3RNBC 3WK7A 4F4YA 1DOYA 1T8EA 1PGXA 5FK9C 3MC9A 3F2BA 2EMSA 4YSYB 3JPNA 1I4XA 7ICUA 4C8OA 5AKIA 2WHEA 1X2IA 2LD9A 3LJ3A 1S9FA 5J17A 1C77A 3M62B 3RH6A 5AICA 3UXNA 4ED0A 2LXCA 3HILA 3EFCA 2XICA 4KZ0A 5E6PA 4IWQA 2K6DB 4EYHB 3RB3A 2LWPA 4B95A 1I4HA 2I1JA 2ZUDA 5FKAC 3RAQA 3SAGA 5DB7A 1V86A 1DOQA 4RNOA 1OQRA 3QCAA 4YSZB 2KJ6A 3JPQA 2PLPA 3V6KA 2PIAA 3M8RA 3DBRI 1NYRA 7ICVA 3NTUA 4QW8A 2ZCBA 4O3SA 3CMMB 2PFPA 2P35A 4F93B 3SAFA 4HWIB 4ICVA 3AECB 1SXDA 1U48A 2YMMA 4P2HA 4DXFA 3GU3A 2OEDA 3W5VB 3V3XA 4EBEA 3Q6BA 2JEIA 3N4MB 3CF6E 2K0PA 1CK1A 4EKUA 5HI1A 1F0MA 1S10A 3C5FA 1NNLA 2P66A 4QZ8A 1LGRA 4OVVA 1S1QB 4NY8A 1WCLA 2AQ3B 3LWLA 2QCZA 3ZDTA 1KM7A 1D9DA 2LYHA 2X8XX 9ICKA 2XY6A 3ONNA 4QIWF 5AK6A 4O3RA 5L83A 2JF5A 4WWMA 2MU2A 1TE2A 4IDIA 4RM9A 1E0ZA 3O65B 2N9LA 3VFKA 3WKCA 5HR6A 2K4EA 3IBEA 2X38A 5AI6A 1L6UA 3H40A 4J9QA 4MGZE 4NM2A 3AU2A 5ALGA 1J2MA 1L4ZB 3PLUA 3OWEB 4NLCA 1ZYQA 4I28A 5KFNA 4YVZA 1BGXT 3QUBA 3G6XA 4BGDA 2A1JB 5EWFA 2FPKA 3ZJTA 3PHXB 4DDGD 1E7UA 1ZQUA 2KJ8A 5DG7A 1KFTA 4AUQC 2R8IA 3QU4A 3D2NA 2JZ3B 4IQVA 3AU6A 1J2NA 4KDIC 4MHVA 4YR0A 4HVBA 1RYJA 4WJPA 5CWRA 3KQ4A 4EEYA 2KLGA 5LXHA 5BO4B 1NBFC 9ICBA 2WXLA 4E71A 2L0FA 3OJ3A 4PYUA 1TT5B 4RQ2A 5AM4A 3P4RB 4R63A 4GXIA 4FFDA 2G4DB 2QC8A 3A9JA 4ECXA 1A76A 4KX5A 2CKHB 2KVZA 1TKEA 4M02A 1ZQOA 3X0WA 3ECIA 4TUQA 4IL6U 1UGMA 1WR1A 4LK0M 4DSKA 3DEEA 2K8BA 2KN5A 2NRWA 1NK4A 2LYAA 3NUQA 3OPXA 7ICNA 1C1YB 5HHDG 2KICA 1CEZA 1EF5A 2BQRA 2ZZPB 4DSFA 1BPYA 3QQ8B 5EWGA 1PVRA 2BKRB 4Q2JA 2D11A 4ARCA 3HX0A 4MJSA 1SXEA 2FCNA 2WX0A 1JALA 3NRWA 4F5OA 4JPSA 3U30A 2XN9C 3I5JC 3W9CB 2W54A 2VZKB 3QEBZ 4I6PA 2MJ3A 2WX1A 2XK5A 4EZ9A 3NGDA 4NQLB 3ML8A 3IG5A 1C4PA 1NK8A 2DF4B 1NJZA 4ZRQA 5AEKB 5DDMA 3M7DA 1P1AA 3QXGA 2OEHA 4RQ7A 4B9UA 2WDTB 2R8KA 1C76A 2PVGC 1XWLA 5BOMA 8ICQA 5AI8A 4YMMA 2L52A 2N7EA 2PVOD 4HLEA 2A5UA 2ALZA 5G5GA 1MSWD 4NLZA 3DDHA 1NK7A 2HHXA 3KHHA 4DSLA 3ALBA 3AU4A 3IAS1 2LJ5A 3PMNA 3H0MB 4JV1A 1NEKB 1XSPA 2DFLA 2FE8A 1X9XA 1ZQYA 1KFYB 3RULA 4FZMA 3ZNZB 3QK0A 4W9EA 5HNKA 3DOWA 3HJEA 1Q1OA 4BKTA 2IDYA 4KLGA 2BGFA 4FADA 1JQ4A 2FI1A 4NLNA 2PEAA 2WDQB 5J2AA 5BMIA 4EOYA 4RQNA 3TAPA 1NKEA 2GBMA 4MSQB 3VUWA 4ED7A 1P7EA 2GOWA 1UNSA 4NQKE 2K1FA 3DQVA 2ASJA 1GB1A 3LYSA 2BCUA 4F4KA 9ICNA 1KDHA 4I2JA 2JSVX 5KT3A 3NVYA 1A0PA 1L7OA 3JW0X 2E8MA 1PYWD 3MJ5A 2NRVA 1X6IA 4P1BC 4OVUA 1YN5A 1WH3A 2EQYA 3NASA 1L6NA 1GG3A 3UINB 5DG8A 2YEPF 2LMRA 1VDVA 1X9SA 2KJ9A 1A6SA 1E8ZA 5AZHA 3L5KA 2BQ3A 3SR6A 2WF9A 4Y2RA 1P7DA 2ZIVA 4A3OA 5DDYA 2BS4B 3I9V1 3AEFB 3Q3OC 4RPZA 2EZXA 3L3FX 1IGDA 3L0WB 2KK0A 1AWDA 3DWMA 2WXGA 1TFRA 2L76A 2MEKA 1YOVB 3OJ4B 3A9JB 1WM2A 3WKEA 5J2HA 2KWDA 2LZ6A 2HDOA 1AW7A 3L13A 2KFZA 4JK1A 2GRIA 3PO4A 3PW0A 4IKGA 2CRXA 3PW5A 2W8KA 2K8BB 3JPSA 1L5PA 4RU9A 3K75D 4HCPB 3IXSA 5D3IB 4ANUA 2K9XA 3ZDAA 4KITB 5IIOA 3PSPA 1QQRA 3IG3A 2BW2A 2M0NA 2Y1JA 4DWIA 5EDSA 5F9LA 2XGQA 5KG0A 4NJ8A 3GP7A 3Q3FA 2HHSA 5E6JA 2EAOA 3RFAA 2GOLA 4F92B 5J2IA 2MJDA 3I1YA 2DYOA 2Z8LA 4NNJB 3RN9C 3C28A 1NK9A 4U6PA 2ZPNA 3U4EG 3H6NA 4UAZA 4KLEA 4XDCA 2W9AA 1J7AA 4UB2A 4FJZA 4I29A 1VRAB 2ES6A 9ICEA 1BPEA 5J29A 4A9AA 4NXZA 2XNAC 2YMQA 2KAJA 2O6VD 3MR6A 3TIXA 3BVZA 3ZI4A 1QF6A 4IQWA 5AKXA 3C0RB 1TAMA 3PY8A 3ZDEA 4P0PA 1UA0A 2NRZA 5B5EU 4EYIB 5IIMA 1ZQAA 2B76B 3GDXA 3NS1A 1QZEA 3EA6A 4QWEA 1ZQWA 2DLBA 1Z19A 2QB0A 1ACCA 3MFHA 4HEA1 4GLXA 2HMXA 3EHVA 4LLGM 4N6EB 2MA1A 1TGZB 4C56C 2IHMA 2H89B 2V3NA 1N48A 2PFNA 1HEZE 3B08A 1FPYA 2L00B 3PSIA 4C80A 3B0YA 1B0XA 1U47A 2V3PA 2Q4TA 3RTVA 3OGUA 1OQQA 1XCTL 4HYKA 1NK5A 4J9OA 4F4ZA 2BCQA 4L2YA 4TQ1A 3VR8B 3W5UB 5IP4D 4KKJA 1T0SC 4YTNB 2IGDA 4C8KA 1KF6B 2OYYA 4NV0A 4QZIA 5KFHA 1ZQQA 2KC1A 1GJZA 3L10B 1VLBA 2W8LA 1GPXA 2D6FC 1V9PA 3UM9A 3V6EB 3IDWA 3KKAA 1ZQEA 5AUIA 2TSSA 1Q0WB 1NVID 2F77X 1I4QA 5ALHA 3K9PB 3JPRA 1N61A 4XYCA 2ZPYA 1MVKA 5CX3A 1WG8A 4ECTA 5J0PA 3C19A 2BYEA 3EYZA 3JSVB 4IW0A 1L8LA 1Q10A 1OXJA 5KFTA 1V5TA 5ALFA 1N6ZA 3RB0A 4HRSA 2MUTA 1BUIC 5DQHA 2M0XA 4RQ8A 3IP4B 8ICXA 2BDUA 1SE4A 1WX8A 1Q8KA 2LGDA 4NLGA 4WQMA 3AEBB 2VJ4A 1XT9B 2ZUBA 3MHZA 1I4RA 3TKAA 2D3AA 4URKA 3T3OA 1NOMA 3PSTA 1NI3A 4IQUA 4DHJD 2VA2A 3BK1A 4RQ5A 3IT4B 2JMGA 1TJEA 2GLSA 3UIOB 3UMCA 3ORYA 9ICWA 4LZGA 2DWQA 3H0RB 4MEMA 3N1YC 1MG4A 2BS2B 1FEZA 1MN8A 4J9PA 2CPRA 1I7HA 2KZ3A 3I3TB 2VA8A 3N7RC 2KDIA 3ZRFA 3KUDB 1IPGA 1N60A 2E1FA 3SV3A 5J2FA 1ZQHA 2N7DA 3DBSA 4Q8EA 1KW4A 1ZD4A 5FR3A 1YQ4B 3RJGA 9ICIA 5F3XB 4QWAA 1LFDA 2ZIWB 9ICGA 2KFKA 2MWSB 3VXWA 1QOFA 2MRPA 3E58A 5J0UA 4ZDVA 1UD7A 4LJPB 4KLTA 4P0PB 5EWEA 1DRGA 3F2CA 5KHOA 4KIKA 3RNCC 4R66A 3WU2U 4PPXA 1AQ6A 1ZOLA 3N97B 1HTOA 2RGFA 2KP7A 3NOBA 2LPEA 1KN5A 4ELUA 2KN7A 3VRBB 3WAOA 1LB2B 4O3QA 4JL9A 2Y0SF 3VR9B 1N5WA 4NL9A 2BGWA 2RPVA 4JWNA 3ZLZA 2IZVB 4KLMA 3PRZA 2B21A 1SIJA 1SZPA 2LFIA 1RFKA 1DGSA 2XGPA 4KGRA 3QU7A 1H38A 2G1EA 3PVXA 4PS3A 2NO4A 1XS9D 2BWFA 1JROA 2FUHB 2NVUI 3ZUNA 1UH6A 3RMKC 2J0KA 2LASA 3Q69A 1Q3UA 3NZUA 2BPFA 4FHKA 4J9SA 3AEVA 1F2RC 2WU2B 1KLVA 2FPLA 1BPZA 4IRCA 2OXOA 3AEEB 3H9DA 3PW2A 3UXPA 5G55A 8ICNA 2HHTA 4BJQA 3Q14C 5G5HA 4PHDA 4MGIE 1YJIA 2JRHA 3AE8B 2H3IA 4DHZB 3BINA 2M56B 3KOOA 1LV5A 3F2DA 3TJPA 5DLFA 4M9HA 3C2MA 1MFWA 3PHWB 4AOFA 4RQ4A 2XIDA 4M6WB 3GIKA 5IAAC 4IRKA 1Z1VA 2YLMA 4RMAA 4ICUA 1N56A 2LRWA 3UF8A 3D6JA 3OAWA 4A8XC 1WSPA 2L7RA 4IRDA 3C5GA 4N9F4 3MDCA 2AQ1B 8ICYA 2GH1A 3KW5B 3Q8MA 7ICJA 1B43A 2KO3A 3MR2A 3D32A 1JWBD 3MHSD 4UARA 3GV8B 3DBLI 1WYGA 2JRIB 2KANA 3RFZB 7ICIA 4KLFA 2W03A 1T0QC 5IIIA 4M00A 5BMGA 2AYOB 3QARA 4XC2A 2IY0B 2LJIA 4KV2A 2LI6A 4I2FA 1MQ2A 1XF5L 1TVAA 1KSPA 3KUZA 3KYCD 3K1ZA 5DGBA 4DFKA 2INNE 2LVOA 2FCMA 1BPBA 1VZ6A 3CW2C 2RMMA 1HEKA 3Q8SB 1YNTE 8ICCA 4F72A 3LK9A 2AU0A 2MAXA 1WM3A 1XQQA 2C9WB 4QZ9A 5KL1B 4JQWC 3Q3MC 1KEJA 2HI0A 4NAWA 4BFRA 3TI0A 2DZKA 4JB3A 3H7SA 4FA6A 2ZEQA 5AKGA 1TK5A 4KIKB 2D10A 1WJNA 4CYEA 2JR5A 4UB5A 4EBDA 5E6NA 3PNCA 5AKYA 4NPNA 2KHWB 2BWES 2BS3B 4YP3A 3AULA 5D49A 9ICAA 3KLSX 1IGCA 2C60A 4A3PA 4A90A 4GN1A 3H8WA 2ZIUA 2KMMA 1K8RB 2WB1C 5KFFA 5CTRC 5KFLA 1ZRMA 2KFJA 2RHFA 3BQ7A 3M6KA 1LVHA 2BQQA 3ZIMA 4C00A 2JEGA 4DQRA 2OJRA 4TUUA 4P4MA 2PXIA 3TEWA 2VANA 3PR5B 3CP8A 1S97A 8ICKA 5J18A 4QNLA 2MH7A 1RPLA 4BWJA 8ICAA 1QILA 2F8LA 4NLBA 3AN1A 4GXBA 1DOXA 2JYEA 1J97A 3M95A 3V7KA 3TL5A 4ASWC 4PL1A 2R8HA 3W1SA 4GXKA 2WF6A 4BWMA 4F50A 4KSLC 2M19A 4LVSA 4N58A 4DS5A 3ETLA 5L1MA 2BCVA 1P3QU 3P42A 4LDTB 1PDXA 4RFBA 5HP4A 4UAUA 1I4PA 2IOFK 5AM0A 2W9BB 2VZKD 4WAAA 2E8PA 4F5QA 2UVWA 4J9NA 3FILA 2XY5A 3AMZA 2KHVA 1E6EB 5L1JA 1B9RA 3S6JA 3RNFC 1EU3A 3IT6B 4OJOA 2JZZA 2NO5A 4LNIA 4W9HA 3R9KA 3QZ7A 1KFDA 4P0QB 3V61A 3ZRCA 2VH1A 8ICIA 1TV9A 4JLCA 3B9JA 1CUKA 5KFUA 3KHRA 1ZQSA 3V60A 3PX4A 1IBXA 3WKBA 2CHXA 3KZXA 3AB5A 1MC8A 3WKDA 3VVWB 4RUCA 4BVUC 2VH2A 3N7PD 2L32A 5D7GA 7ICQA 1JUDA 2KIVA 4BXOA 2YN4A 4I2EA 4IM0A 2NRXA 1WIAA 4IOIE 4QZEA 1KLGD 5LNK1 4KLIA 4I2IA 4QZHA 2FIFA 4KLQA 2KDMA 3T5KA 2WXJA 2XCAA 1D8YA 3AXCA 4PL2A 5KG6A 1K5OA 1FD6A 3AEGB 4RGNA 4P4PA 2NRTA 3R7RA 5CHFA 1ZDXA 4IWPA 1ZQLA 4QJFB 3LYYA 4TMAB 2V4RA 3PV8A 1SKRA 3N20C 5J2RA 1LM8B 3MR3A 3BZDB 2PI5A 2PPHA 2AL6A 1L0YB 1VCBA 1ZW7A 1HXYD 4QZGA 1ZGUB 3BK2A 2FCSA 9ICJA 3LB8C 4ECZA 2ZIXB 1D8LA 3LWMA 4WAFA 1ZJMA 3H8JA 1EWCA 3FYHA 5DBCA 2IPKD 2WXQA 3HPOA 5ALQA 1FXAA 1RZTA 4B9MA 5BPCA 2ZIUB 4YD2A 5KFJA 2XI9A 2AQ2B 3RT3B 8ICJA 1RQNA 1YX6B 2KDBA 2WXHA 3QC8B 4YTMB 4FJYA 3AE1B 3V6HA 2KZMA 2K60A 1HIWA 3CNHA 5E79U 4IWOA 2KYWA 5AZGA 2AXTU 5KFWA 4B9NA 4BBNC 3B2GA 1ZUD2 2KHQA 4C4TA 5AIBA 2LKYA 4GDKA 2KX3A 1V97A 5K4LA 2GLEA 3EC8A 1QTMA 3Q8EA 1QQ5A 1D3ZA 4BKSD 1SF0A 2KX0A 3P63A 2QHOA 3L4PA 4ZHOA 2KDFB 4Q44A 1MA7A 3VH3B 5HMLA 5HKHA 1T0RC 1MQ3A 2JXTA 3MGHA 5KAFU 3TANA 3G6YA 1T7PA 2FPMA 3V7LA 4F3OA 8ICMA 1KQQA 1KH0A 4KSKC 2W55A 4R8UA 1LKYA 1SL0A 1I35A 2PFQA 3FILB 3RR8A 3BZKA 4ECUA 3NZ3A 3QIJA 4RUAA 2HHWA 1Z00B 9ICTA 4CGZA 1FFUA 3G6VA 3DVNU 4A55A 1KOTA 2F1IA 2QARB 1IV8A 1WE7A 2KK8A 5ALLA 4B9TA 2MA9B 1F0ZA 1AROP 1T94A 3EPGA 9ICLA 2INCC 4PYZA 3PVLA 1ZQTA 1R4MI 1IBXB 1WYWB 4RF1A 4W9LA 3SQIA 4RNNA 3RRGA 8ICFA 7ICOA 1E9MA 1L4DB 5J2KA 2WU5B 4NZLB 1WWTA 2KXJA 1L7PA 1ZXIA 4DFMA 1ZQBA 1RQLA 3TCAA 2YTUA 8ICEA 1VJ5A 2HBMA 1LQBA 2G5HB 2N7JA 4BXOB 2EZYA 2F1JA 5TZVA 4ARIA 1TS5A 3K1RB 3HKZC 4C7ZA 3SMVA 1TS4A 3W1SC 3C2KA 4J3OD 2JHDA 1WZ0A 5KFCA 1NJYA 2KV2A 2NS5A 1GAQB 4PS8A 3QA8A 5IOIA 4WWNA 4XDDA 4MFFA 4F4WA 4YTPB 4WJQA 3T79A 2GBNA 2RPQA 2M9NA 2KDEB 4F5PA 1JXLA 4QIWC 4IC7B 2G09A 2V9WA 2Z7JA 1SGGA 4KN4A 4LNNA 2F2AB 1V2YA 5AK3A 1C7YA 2WYQA 2D2QA 2Y9UA 4B6WA 8ICHA 1XLPA 1COKA 4NY0A 2EMTA 1UPHA 1CJEA 4I6LB 3EPIA 4CQNA 2PKOA 1GNUA 4ZYSA 4P7IA 5AI0A 4M0WA 1PQSA 4CF5A 4ECVA 4GC6A 2HBJA 2SEBD 3GV5B 1I42A 5DQIA 2WF5A 4MT5A 3I57A 3FKYA 2XCPA 3U7ZA 3B0XA 2H3VA 4XQ8A 1EO6A 2ZJ5A 3N1ZC 2BDPA 5DB8A 2E6XA 5JTIA 2JZPA 3QX7A 2M17A 4PHAA 1RYSA 1S0NA 2KG5A 1L2NA 1BNPA 2E1EA 3T9LA 1PVQA 4Y2JA 4GDKB 9ICPA 2Y5PA 2AGPA 1X9MA 2YY6A 3UXOA 3AL0B 1WRIA 9ICCA 4PZOA 4B0MA 3A0BU 7ICKA 2LHEA 2HOFA 2RR9A 3UMBA 3M9NB 1GO3F 4DCCA 4DQSA 5KT5A 1WGKA 1WX9A 2LMCA 2KWUB 3PMLA 2HTHA 2NMQA 3A1QA 4ZYNA 3SD7A 3ZDBA 2K8CA 3RD2A 1X42A 5JH5C 3JPPA 2IO0B 1L7MA 1SEBD 2DX5B 1FXTB 1YJ1A 5DB6A 2B0CA 5KT2A 1LO5D 1SGHA 4R8UB 1LKYB 5AKKA 4TUPA 2ZJ8A 5HHIA 4YN4A 1YQBA 2INPE 1XLQA 5KFOA 2Y5BB 5EE3A 4Y2QA 5AKLA 2OCEA 1L3VA 3QYPA 4KLUA 2D5GA 4ZRJA 3ZNHB 4Y2SA 4KMOB 1UBIA 3ZVVA 3PTFC 1Z4OA 2LHTA 3VAWA 3ML9A 1BPXA 2G9HD 2KNJA 5FR6A 1L7NA 2F3NA 3GIMA 2KFNA 7ICTA 3HUIA 3RJHA 1NK6A 1GOZA 2OOBB 1X40A 4ED6A 3AU5A 2JQRB 2PMZC 1TKYA 4JGHB 4ZOHC 4UB4A 1FO4A 2G5IB 1X1MA 3C8YA 3KZIU 1PZNA 2LI5A 3DHHC 1ESFA 5L1IA 4BDPA 1QOAA 1HA5A 2KD0A 1NJWA 1R4NB 1BPDA 2WF8A 2Q0ZX 2ZTDA 4Y2VA 5T14A 1HUOA 3AEDB 3GS2A 5AKZA 4QWCA 2KKVA 4FZNA 2MSNA 4II2B 4DBGA 1UQVA 2ZG6A 2Y5CA 1FMAD 2BF8B 1S0VA 2YVCA 1AN8A 9ICOA 4BZAA 1J8CA 3GZNI 1UF0A 2JXXA 2QJLA 3TUOA 2BPGA 4O9MA 2RLTA 3Q8QB 2DAFA 4C8NA 2LGYA 1C78A 5L9XA 5F9NA 2EAPA 4J9RA 2CHWA 4EENA 3GE8C 3H7PA 2B3AA 3DVNV 5KFDA 1KRPA 2F8KA 1RDFA 4LNFA 3ISCA 4EELA 4EZ6A 1MJDA 2AWTA 4NJ6A 2LYBA 2HSZA 4RGOS 4RQ1A 1FRDA 2G45B 5C0YA 4YQWA 1SL1A 3A0HU 5DCNA 4YCXA 4O0IA 1OEYJ 4TV3A 1OQYA 1ZETA 4TQRA 2RQ5A 3CSTA 4UATA 2WS3B 4AS1A 5KFEA 3RI7C 3TADA 4F2SA 2BBCA 2P6UA 4YXDB 2V3SA 4MJSB 2UYZB 2ZTEA 1SB3C 3RUIB 5DPWA 2K4IA 3MR5A 1TAUA 4K4IA 2K8HA 3HM3A 5IA7A 3H4DA 1ZP0B 3DBHB 4KVGB 4ANWA 2MBEA 4L23A 1WWVA 4J9KA 3O13A 1OUQA 3TFRA 2CJNA 1QOGA 2XK5B 9ICSA 1U4BA 4Z6FA 2A1AA 4U7CA 2C2DA 3BS5A 2VRRB 1XCQL 3EW9A 4C4SA 2MW5A 2IO2B 3A1QB 2MBQA 2ASQA 3OHBA 4ICAA 2WNMA 1EF1A 5C2TB 4OJLA 4MACA 4GSWA 1Y8RC 1NI2A 3C2LA 1T3NA 4MGKE 4UB8U 1L6VA 2DAJA 3OG5A 1DK2A 1VD2A 3QE9Y 5H2FU 1URJA 3CYMA 1R7SA 1WXSA 3QEAZ 2NV3A 2JWUA 1KKXA 1IIPA 3SI8A 2ON8A 4C7YA 2ISPA 1NKCA 1ZRNA 1J19A 2G07A 4GMVA 4X5VA 3DDCB 1R4NI 1QSLA 2N0SB 5KFQA 1E8WA 2K3UA 4P6VF 2BZFA 5H8YE 5KL8B 3SENA 2F44A 3SAHA 4B9SA 2L0TA 3ZNID 1TZ1A 2E8OA 2G08A 1K52A 1Y88A 2KWVB 3Q3NC 4XGAB 2W7PA 1U9LA 3OJUA 3GV7B 1TK0A 5L95C 1JX4A 2KTFA 3Q8PB 4WJ3B 2J52A 5DLGA 1XO3A 5CRXA 4CDGA 3MABA 4DFPA 4K7WA 4P4OA 2KJ5A 3RNAC 5J2EA 4N59A 1L3SA 3ICXA 1SE2A 4Y2PA 1SSNA 3NZSA 3P4PB 1RG6A 1HQRD 3SYZA 2ZIVB 3QU2A 2AQ4A 3N1XC 2ODGA 5LXIB 1C9FA 2I1QA 2JU6X 4ECYA 1OW5A 1VR9A 4W9GA 1WX7A 2DZMA 3JVZX 2G0AA 2HBLA 4QZCA 3LDZE 2QIEB 4J9LA 5AHXA 3VCBA 3H7PB 1JI7A 3GZFA 4GDLA 1FNWA 4IG7B 4O3OA 5ALPA 2WXOA 4LDTD 2H3QA 1K53A 1YN4A 5ALUA 3RNGC 2CXYA 3BQ2A 1QT9A 1V80A 4FULA 5DPSA 2W82A 3TEZA 2KD1A 4K4HA 2DPIA 4HKZE 4DL3A 5AUKA 4JWMA 3N3KB 2PKEA 2REXA 2WP9B 2MCNB 4RPXA 4PHPA 4E74A 3MGVA 1RLFA 3EUB2 2ESEA 4OD0A 1UWXA 1SV0A 5D4BA 1DOIA 4HAIA 4AYBF 3L16A 3PR4A 4I2DA 3H4BA 3DCGA 3KWLA 2FE9A 4KGSA 4DK5A 3UQ2A 4MELA 3Q2AC 2LBOA 1OGWA 1RFAA 4UAVA 1SL2A 4TKNA 4UBCA 4ZHPA 1ROEA 4A8EA 3IV6A 4UASA 3VC8A 2JGAA 3JYUA 3BS5B 2NTSA 1OFFA 9ICFA 1L3TA 5KFSA 2G06A 2W11A 4CRXA 9ICMA 1TS2A 5AKJA 2KJRA 4DL7A 3ABVB 3IAM1 3R3MA 3TFSA 4KDLB 2O6VA 2PMVA 4O3MA 3APDA 1JWAD 2QB0B 2I1KA 4IQTA 2J0JA 3NHEB 1SJED 4YWGG 4REZA 2MJEA 1D6EC 3TAQA 3Q3JA 4HDQA 3TADC 3J81j 1RRBA 4XE0A 4RF0A 4ECRA 3BQ1A 2JPHA 2BYFA 4DQIA 4CHKA 3ZKJC 5D94A 1WMHA 2IA6A 3QUCA 3IG8A 4DWFA 3Q8CA 2G4SA 3SD5A 2MP2A 3A9KA 2LHDA 3NG0A 3BWUD 2KZRA 2D3BA 5AK4A 1BT0A 4CE6A 1T0YA 2BQUA 2FIDA 3FM9A 4C4VA 2HCFA 1FEHA 4UAWA 3K9OB 3RZWC 1PVPA 4F71A 3GB1A 4AQ7A 5KG5A 1PUTA 2WXIA 1ZQNA 2R8JA 2KT7A 1NDDA 2GMIC 4MM3A 5J0WA 2L83A 4DOBA 4R64A 4RGMA 2OWOA 4JX1C 1WRDB 1ZKHA 5JHBA 3APFA 4ANXA 3TQ1A 2NBWB 3HVZA 3MP9A 5D6JB 2FLPA 3GZNB 2BTEA 2F1HA 4RPYA 1TKDA 2DPJA 1TZOA 4DSJA 4HKQA 3PT2B 4J6IA 1OTRB 4KX3A 3RZFA 1ISNA 1ZQVA 3QHTA 2NR2A 1XC9A 4GDLB 4XUSA 2J6TA 2MUTB 5CA7A 3KHGA 4JWUC 4PH5A 2UVUA 4ECSA 5DGAA 4EUTA 2LXAA 1WJUA 4IUMB 3V62A 3T5JA 2QMTA 4DXAB 2J53A 2V4QA 4PGQA 1N2XA 2VA3A 2CU3A 3WK6A 3RB4A 4KLDA 4P16A 2MBOA 3AH7A 2WDRB 1EWYC 2AX5A 2RDJA 2UU7A 4FJVB 4R65A 5KFPA 3IM1A 4HJKA 4S17A 5JRTA 4MF2A 3C23A 2IBKA 5AM2A 4G11A 2AJQA 1SE3A 5AKEA 3AEAB 2C7HA 3BQTA 1NK0A 4YR3A 1F2RI 4PT5A 1TS3A 2IMWP 4M01A 4WH4A 3QU5A 3T5HA 4M9LA 3KKAC 2EDUA 1KLUD 4HPMB 2R18A 4YXJA 1TYGB 1Z5SB 1C3TA 5FP0A 1PGBA 3MGIA 4W9DA 3BY4B 2RRDA 4MH8A 2KSOA 4ACFA 3BS7A 4OZAA 2KFKB 4QAYA 5KT4A 1V1OA 5G2NA 4GLSC 3GFKB 2AEHA 5KFXA 4RH6A 3ZYYX 2HTME 2BPSA 3OSNA 2O6VB 3SFEB 1V8CA 3IHPC 2EKEC 1MHXA 1VJKA 2Z59B 3KD3A 2GI9A 2EZZA 5ALDA 1AYFA 1UT8A 4M9NA 1TAQA 1OEYA 1T5XD 3HWTA 2LVPA 3HP6A 1JIHA 5CB1A 2C7MB 1PUZA 2R2QA 2AH5A 4BAXA 2K39A 3H1UA 4BX9C 1YQ3B 4ELVA 1JXEA 2KMCA 1RYRA 2K4HA 2JX5A 3AE5B 2J4XA 2A19A 1SKSA 4OZBA 4II3B 3OLMD 5AI4A 1L3UA 1UELA 1YX5B 2FLLA 2MP2B 2WXPA 3A9KB 1V81A 2KQ4X 1O03A 3WK4A 5ALZA 3L54A 1RAXA 2C22A 1D5ZC 3BYYB 1K51A 5KG3A 5C3JB 1C4CA 2HJ1A 2LUMA 1Z2MA 2AL3A 1JWSD 4OJ6A 3AQEA 3PW7A 2KKPA 2JUOA 2UWQA 3R66C 2FLNA 3N9YC 3ZD9A 2JY6A 1F77A 3VTUA 2JEJA 3HT3A 1ZQJA 1XD3B 4HK2A 4KZCA 4E3CA 1E7PB 5CHVC 4OZCA 3SV4A 9ICXA 5A0LA 2ZXHA 4O5EA 5GTIU 4LJOB 3SEIA 2QEJC 4F7ZA 1GB4A 4KGTA 2KEYA 1V49A 3MC0B 1J7CA 2R61A 2BB5A 4DXGA 5ALTA 4NL9C 5J0YA 5J2JA 1V9JA 2HDEA 3BDPA 2K8AA 1SJHD 3M63B 1SWWA 1WUDA 4M9JA 9ICVA 3CIRB 4QWBA 3DBRB 7ICGA 4YXMA 4AP4C 2LGSA 3TEXA 1F9JA 4LTUA 3WAPA 3C29A 5IILA 2AQ0A 2BB6A 1HZ6A 1IG6A 4FS1A 3QZ8A 1PFDA 2CJOA 3PSEB 2WHIA 4IM3A 4EEKA 2PTLA 1V85A 1IP9A 2BKFA 5KT6A 4OO1J 2IOHA 5KNIA 3U8ZA 4YMNA 1RWSA 5C1ZA 3T8MA 4QWDA 3TMPB 2W9CA 2KC2A 3NJTA 2AGQA 5KFKA 1M4VA 4M2YA 4MDKE 3UQBA 3WA0A 3LVVA 3UQAA 2KSOB 5KG1A 1NENB 1UGJA 3TSSA 5IIJA 4KLSA 3Q8BA 5HFYA 1HZ5A 1ZQZA 2DENB 1KTKA 4NAWB 3JPOA 3B0AA 5ALMA 3VRAB 2KOBA 4DDID 1QQ6A 3KFUF 5TSSA 4FHJA 4BBNF 8ICOA 2QLTA 3ALRA 4DF4A 4G0NB 1O08A 2BHNA 2CR5A 4O1NA 4FS2A 3PZPA 2PI4A 4K81A 2E8NA 4YG2A 3I63C 3K4GA 4MFAA 2ZNVB 4FXCA 2BT6A 3BVGA 4XZ4A 4FN2A 1TY2A 2GB1A 2MBBB 4Z6CA 3AV8A 5J2DA 3ZJVA 1K1QA 3GIJA 1KLNA 3RJIA 4FBTA 3T3NA 3F53A 2FUG1 5ALOA 1DGJA 1YT3A 1SWVA 2NCNA 5HMMA 4F8RA 2HHVA 2WAQC 1ZJNA 1E5WA 4JWSC 1GC7A 4C4RA 3WKAA 1DK3A 1WGHA 4NWIA 2VIXA 1L7YA 3ZD8A 5CJ7A 4ECQA 8ICUA 2J6UA 3EECA 2C2EA 4KTQA 1PGAA 3WCQA 4DSEA 4EBCA 3AE3B 2XVTA 5ALIA 5AI9A 2K6QA 3EGRA 5ALXA 3IRUA 8ICVA 2YMLA 4RQMA 4Y2UA 5DBBA 4UDUC 1XO1A 3L17A 1BVSA 1U49A 3PO5A 2I9GA 4CF4A 1S3SG 2DL0A 4DEZA 4DHZE 3H0LB 3SZ2A 1SKWA 2NTTA 1BNOA 1CQVA 2K5PA 3SDLC 2KQSA 4LNOA 2ZNVC 3AI5A 2WFAA 3U2SC 3WANA 3UPQA 4EE2A 1DYQA 1AARA 2KVCA 3HKZF 1CZPA 2DYMA 2IY1B 5JHAA 5B66U 1WGYA 5AKHA 4Q8FA 1N63A 2QSDA 3QU9A 4XX5A 4AWJA 5KFIA 1SXTA 4HROA 4LNKA 2LUEA 3ISBA 4HPLB 4I27A 1T3QA 1Z1BA 3MFGA 4AJWA 2B6GA 4WWPA 2V9HA 1S77D 4F1SA 3DVGX 2N9KA 2I2YA 2N9EB 2DZIA 2UVVA 4PS7A 1QLNA 2N4FA 3H8HA 1N5XA 3P2BA 1YZ6A 4KKIA 1WGDA 1COOA 2H88B 2D3CA 1QH9A 5CR0A 3OHAA 4UQGA 1L5UA 2EANA 2W9CB 1WGRA 3KUCB 3N7SC 3UIPB 4BKGA 1EUVB 3F5AA 4Q45A 7ICHA 2JYTA 3RJJA 1ENFA 5L1LA 1E90A 4KLLA 3C1ZA 1B4FA 1CI4A 1IXRA 1ZQRA 2ZVOA 3PREA 8ICTA 4I6NB 2W43A 1N62A 4DOCA 2HVHA 3NVWA 2G3QB 3M1YA 2H3ZA 4OJPA 3Q8KA 3N28A 4F5RA 2JEFA 3KTQA 3DPDA 3VUYA 1X66A 1S8OA 5J0QA 5ALSA 5KFVA 2QILA 1RXVA 1WY8A 2I5HA 3HRDD 2KTRA 3BYTB 3RRHA 3HIZA 3T3FA 1U45A 3RYTA 3I76A 2ZCCA 5ALEA 3HHMA 1KL9A 3TBLD 3QUTA 2ATLA 3BIID 1K1SA 2HOQA 4OCZA 4LZDA 4GXJA 4O3NA 2HOIA 1MHHE 2ZVNA 2OJWA 3URYA 2F76X 3IVFA 3H7IA 5ALNA 4JUZA 4XRHA 1JMSA 1I4GA 4W9KA 5DQGA 4I2GA 2N1VA 1ET9A 3DHGC 3IN5A 1XO0A 4IR1A 4DSIA 1ZQCA 8ICPA 3A33B 4K7SA 3DVGY 4DL6A 4NJ7A 5DPRA 4Y2YA 2ASLA 2W7OA 7ICFA 4FLHA 5GTHU 4F4XA 4FZLA 1Z3EB 3KHLA 2MQJA 4HPPA 4XWTA 2FDRA 4BKSA 1L0VB 2PMZF 1NKBA 4MF8A 2WXKA 2HBKA 3UMGA 1V38A 1ZQKA 2I38A 4J9MA 8ICRA 2W9NA 4EX7A 3PZ8A 5J0OA 2KZZA 2HJ8A 2GBKA 4UB6U 3WK5A 4GC7A 4CO7A 2L3ZA 4LCDE 1D4BA 4Y2TA 1HJPA 3MC8A 5EE0A 1FNUA 3ZXVA 4UB1A 5BYQA 1IM4A 5J8YA 2IJ0A 2YQEA 2ICIA 4HJGE 2IYDB 1E8XA 3U52E 4DQOC 1M94A 8ICWA 4WJOA 3SFDB 1XNSA 7ICMA 1V1PA 2JH1A 1YD8U 4FBJB 3BVMA 2MRLA 2BVCA 4GIBA 4JV0A 2ZJDA 1WFYA 3NVZA 2QB1A 2AHOB 2DHZA 4W9CA 1NZBA 3VH4B 3VTWA 1B1ZA 4G50A 4AP9A 3E56A 4DLEA 2KIWA 1KTQA 2HW3A 2RSUA 3O0FA 1FNVA 1ZD2P 5CHGA 1KJTA 2WWZA 4FO6A 1IYFA 2YEPB 3RPFC 4BOSC 4B9LA 3RJFA 3R7QA 4K3CA 3NVVA 4XWWA 1ZQDA 5ALRA 5CEHA 3QNMA 3V7JA 2IO1B 2SAKA 2WXFA 4G3XB 8ICBA 1SV4A 3RR7A 1XLNA 2EAMA 3VHTC 3MFIA 4F5NA 1BMLC 1T4GA 3IHQB 4R3DA 4CF3A 1WXQA 2LGXA 3MTNB 4Z6DA 3TARA 2KE7A 1FFVA 1XSLA 1E8YA 2R8GA 4DL4A 1C79A 2NBUA 1WCNA 3HVDA 2Y1IA 5DG9A 2K25A 4A6QA 5KFRA 4PJ0U 2J42A 2KMDA 2DZJA 2BKEA 4I2BA 1ET6A 3H8SA 2BCSA 4RQ0A 4LJXA 1TTNA 4NAMA 3P1MA 5AM3A 5J0XA 4ZRPA 3ZW3A 1S0MA 3PRPB 2L5YA 9ICHA 2BYVE 3ZTCA 2ASDA 9ICRA 2KTRB 3H8MA 7ICLA 1FIQA 1D8BA 4M0WB 2Q5WD 2WDVB 3LXFA 3JSVA 4IC9A 3ZDDA 1XEEA 2FMQA 4PGXA 3B1LX 5J0TA 3S2AA 2DQNB 2I6XA 4USAA 3ZQ4A 1TIFA 3KVFB 5HHHA 3W1YA 3V72A 4Q43A 1UCVA 2NPTA 2J7QB 3LDAA 4I2HA 3PX0A 2PFOA 2FMSA 1FCCC 4ZRKA 1H4RA 4PK1A 1P7FA 2XC9A 3EWAA 2K22A 1X9WA 1QSSA 1F1HA 3N32A 1VZ7A 5AIAA 4IR9A 1UHUA 5EOZA 1NJXA 1Y56A 4YR2A 2FJ6A 2L05A 3ZO5B 5CP2A 3N30A 2K8CB 4ZH4A 4QZBA 3AE7B 2A3VA 3ZTDA 4QZAA 4RGTA 4C0ZA 3PSFA 2PJHA 2ZXIA 1U4AA 3PPAA 3ZDCA 1A70A 4KMUA 2W9MA 4OHJA 2ZW0A 4P1CC 3UGBB 3NRZA 3DHIC 5BYRA 1FXIA 1TK8A 4JV2A 2FNJB 5KT7A 2KACA 1QLBB 5GMVA 2IOFA 4QZFA 1ZPSA 2IGHA 3PW4A 2P6RA 1KRHA 2WXRA 4KLOA 3ISDA 2V1YA 2ZIWA 2V4LA 2BYTA 7ICPA 4F91B 5GXGB 4EEWA 3M9OB 1F44A 5KFGA 1V1PB 1L0XB 3R8BA 3OJSA 2N1WA 3VTVA 5KFAA 3MDAA 3ENEA 1A5RA 1BXTA 5MPOA 4MFCA 2ZJAA 3R2TA 2IBIB 2KWCA 3M8SA 7ICRA 1YIWA 2IO3B 4US9A 3L08A 3NS8A 5KG7A 1EU4A 3TACB 1ZOYB 2KOXA 2RDGA 4EZKA 3RB6A 1TY0A 4JE3B 2YMPA 3EZ5A 4CCHA 2WXNA 2JRZA 2WTFA 5ALJA 3RJKA 3RBEA 1XU4A 4OJ5A 2FMPA 2Y9TA 5EE1A 3ZXRA 4B6JA 1Q5WB 5C5JA 1C20A 2D8CA 2LM4A 1GUAB 2YB1A 4IS7A 1WJ4A 1NZPA 3NY5A 4O5KA 5KTQA 4KLJA 2KVRA 4W9IA 5J8YC 5KFMA 3E2EA 4ELTA 4EX6A 1D5MC 3GIIA 4JIOU 1QKZA 4F2RA 4MEXA 3FAHA 2XEWA 5CHWA 2ZUCA 4RT3A 2AGOA 2ISOA 1NYQA 3AE2B 3DBHI 5JZEB 3I28A 5D46A 4ACOA 1F5SA 1UZXB 2WLBA 3SHQA 3D2SA 4M0AA 5JUMA 4FE3A 2D3DA 5HG2A 3DV9A 3C21A 1KBUA 2DBYA 4RM8A 4M6WA 3Q8RB 2NPTB 4DFDA 1EM7A 4DQPA 3UI3A 4UBBA 5D2MB 4RQ3A 3E0FA 3V6JA 5TISU 2NBVB 2PE6B 4NM1A 1QSYA 1SZHA 2W3SA 2D3GA 2OHFA 1ZQFA 3PV1A 5JU5A 4BOZB 5JXVA 2J0MA 2WXMA 2ZW1A 1ZQIA 2LM1A 1JN3A 4GOCA 3SEBA 2BCRA 2NYVA 2YX8A 3RH5A 5ALWA 5ALKA 3BZCA 5LLIA 5AZFA 5E6OA 2H3FA 2E5SA 1ZXHA 1DXSA 3DBLB 1P98A 4DOAA 4M9GA 4C8LA 1UWMA 4WJNA 2DUYA 3E9SA 2VKQA 1Q3VA 2M4NA 4OVZA 4M8MA 1SBBB 5AK5A 2ACZB 3QJZA 3MBYA 2JWZA 2ZTCA 1G6JA 4CNQA 2K4PA 3DWGC 1PK1A 2C5LC 4ED2A 2PW9A 3RNEC 1C4AA 3ZNGC 1J0GA 4M47A 7ICSA 3Q8FA 1B22A 4GFJA 4AYBC 3BJYA 2JZBA 4DLGA 1JRPA 3GE3C 3PRMB 2FAZA 4GIVA 4X57B 1ED1A 2CU1A 4YMOA 4D2KA 2H5XA 1ZQPA 4FBUA 3CRXA 2RD0A 1A77A 3W2DA 2JH7A 4H2AA 2RDIA 1JW9D 2GWSA 2MLBA 4WWOA 5KG4A 2HHQA 3AE6B 3A4SC 1YJJA 2DNFA 2Z0EB 1D5XC 5HR7A 4HCNB 1CMXB 1WJ6A 4MGYE 1M6YA 4RNAA 3QUQA 2Z0DB 4MSMB 1ZE3D 4OW0A 2JV3A 1VZ8A 3X23A 3J9CA 2OH2A 1IUEA 1P9DU 1WR6E 1JMLA 4HDOA 2KQ7A 4A20A 4F8CB 4RZRA 3OSPA 1UBQA 4PGYA 5DB9A 4I2CA 5KG2A 4J03A 5I4DA 5L1KA 2Y0SC 5KAIU 9ICUA 3P4SB 1SIFA 2DYBA 3EFUA 2LEKA 4ECWA 1QCKA 2JT4B 4K3BA 2R2OA 4UW9A 2BPCA 4XA5A 4YD1A 4Y2XA 3V6CB 3AQFA 3VDZA 4TSSA 5J2CA 2W9BA 3T5LA 2W04A 5J2BA 4K7UA 3PX6A 4KLHA 1QQ7A 3PO0A 4B9VA 1FRRA 2KLCA 2KTQA 4NLKA 4MH0E 1Z4NA 5C23A 2JXJA 1JWUD 4S0RA 2HVIA 2INDC 3ETRA 4QW9A 2KVSA 1MPEA 4I2AA 4HXDA 2C2RA 3RJEA 4P0QA 4RNMA 3U26A 4C8MA 3KWVA 4B9KA 3D2QA 4TQSA 5IKCM 1CRXA 3M9MB 1WXVA 3GOEA 4G9BA 1X6JA 3HW8A 4ANVA 2RDBC 5AI5A 4DFJA 2WB1F 2E3TA 3CWIA 2GBJA 3AM9A 2HHUA 3CSFA 1WF9A 1STEA 3C1YA 4TUSA 1HE8A 1ZD3A 2CN1A 3Q8LA 3HM6X 5KFYA 3RBDA 4M04A 3TEYA 1L8OA 4DQQA 2C7NB 3UQ0A 2YB4A 3WK8A 4M8NA 4KX6B 4O3PA 2QKQA 3GILA 8ICGA 2XBBC 1ECWA 5IINA 3VQIA 1YZ7A 2OM6A 2O2VA 3PS6A 1FCLA 1V6EA 2MSED 3A4RA 3R2IA 5ALVA 1WXMA 2FCQA 4DL5A 1PK3A 8ICSA 2FBWB 4ED8A 3NUHB 2WGSA 5D3DA 5BMHA 3PZDA 8ICZA 4JMUA 2GBRA 2EELA 3KYDD 4K1RB 1PK1B 5IIKA 5AM1A 2C28A 2M8SA 4NJCA 4BUGA 3WIMA 2Y3AA 1WMHB 1JWMD 1J7BA 1P0RA 1SV0C 3WAMA 3LVWA 5ALYA 1UA1A 2CHZA 1XXGA 3B2FA 1XSNA 2V0GA 8ICLA 2JZBB 3RH4A 2XY7A 1RM6C 2ZIXA 3QX1A 3QWZB 3ZGZA 2DGZA 1S76D 4L1BA 4C4VB 3JPTA 5KHQA 3KBBA 3M3JA 2XO7A 4YT0B 1LXDA 2WQYB 3ONSA 1UT5A 2MX2A 1QOBA 4RT2A 3ZJUA 4DL2A
chains in the Genus database with same CATH topology
1C78A 1XLOA 1T3QA 1N60A 2RDHA 2EKIA 3MFGA 4MM3B 1FM0D 5FR3A 1YQ4B 1YN3A 2N9KA 2I2YA 4RGOS 3H8HA 1N5XA 1FRDA 1QOFA 4KKIA 2V4IB 2KN4A 2H88B 2ONQA 2WS3B 4AS1A 3PZ7A 2BBCA 1MI0A 2JYTA 3AE9B 4YXDB 1ENFA 1SB3C 4B0EA 3VRBB 1ZP0B 3VR9B 4L23A 1N5WA 1N62A 3O13A 2RPVA 3NVWA 2CJNA 1QOGA 4WURA 1JCKB 2W3RA 1E10A 1SIJA 2LFIA 1RFKA 1XCQL 4KGRA 2G1EA 1JROA 3AE4B 2QILA 3P4QB 2WNMA 3HRDD 3BYTB 5C2TB 4MACA 3Q69A 5EE9A 4TQ0A 1UUPA 3BIID 4YSXB 1F2RC 1L6VA 2WU2B 3Q8AA 5BYSA 1MHHE 3AEEB 2IGGA 3URYA 1R7SA 5G5HA 1ZDVA 1I4GA 2JWUA 1YJIA 2L1AA 3AE8B 1ET9A 2ON8A 4US8A 4WIPA 5H92C 4C7YA 2M56B 3FC4A 2N0SB 2K3UA 4P6VF 5H8YE 1K50A 4XWTA 1K52A 1L0VB 1T6BX 2LGIA 4A8XC 2WXKA 1WSPA 2I38A 2J52A 3PZ8A 3V05A 2M0AA 2AQ1B 1XO3A 4RCOA 1YMHE 4N59A 1D4BA 1JWBD 1TKGA 1SE2A 1FNUA 5EE0A 1SSNA 5T8IA 3P4PB 4ITKA 5BYQA 1WYGA 1DOYA 3RFZB 1HQRD 1PGXA 5FK9C 1C9FA 2IJ0A 4HJGE 2ICIA 5BMGA 3U52E 2JU6X 4YSYB 4DQOC 1VR9A 1I4XA 2LJIA 3SFDB 2QIEB 1V1PA 1XF5L 3BVMA 1C77A 3NVZA 1FNWA 2INNE 2WXOA 1VZ6A 1K53A 1YN4A 1B1ZA 2RMMA 1I4HA 1YNTE 5FKAC 1QT9A 3E56A 1OQRA 4YSZB 2W82A 2PLPA 2PIAA 3TEZA 1FNVA 1NYRA 4HKZE 2YEPB 5AUKA 3RPFC 2WP9B 3NVVA 4XWWA 3AECB 2SAKA 2WXFA 4DXFA 2BS3B 3EUB2 1XLNA 2OEDA 3W5VB 1UWXA 3V3XA 3KLSX 1DOIA 1IGCA 4A90A 1BMLC 4KGSA 4R3DA 3KWLA 2K0PA 1CK1A 1WXQA 2KMMA 5HI1A 1FFVA 3HVDA 1C79A 4A6QA 1ROEA 4ZHPA 2AQ3B 2J42A 2NTSA 1OFFA 1ET6A 3TEWA 4NAMA 3P1MA 4WWMA 4ZRPA 1TS2A 4IDIA 2MH7A 1QILA 3AN1A 3ABVB 3IAM1 1FIQA 2Q5WD 2WDVB 2JYEA 3LXFA 1E0ZA 2N9LA 1XEEA 2PMVA 2X38A 3W1SA 1JWAD 4USAA 1L6UA 3ZQ4A 1L4ZB 2M19A 4N58A 1SJED 3OWEB 4YWGG 3P42A 4RFBA 2MJEA 1PDXA 1D6EC 1FCCC 1I4PA 4REZA 2VZKD 1P7FA 2K22A 4XE0A 3ZJTA 4RF0A 3FILA 1VZ7A 3AMZA 1E6EB 1B9RA 1Y56A 3Q8CA 1EU3A 3IT6B 2LHDA 1RYJA 3BWUD 3AE7B 3KQ4A 4RGTA 1FEHA 2WXLA 3B9JA 1A70A 3GB1A 4AQ7A 1PUTA 2WXIA 4OHJA 1IBXA 2ZW0A 3NRZA 3AB5A 2L83A 1FXIA 2KACA 3P4RB 5BYRA 1QLBB 2L32A 5D7GA 4RGMA 1ZPSA 4JX1C 1TKEA 2IGHA 2WXRA 1KRHA 3HVZA 3MP9A 2BTEA 4LK0M 2BYTA 1TZOA 5GXGB 4HKQA 4IOIE 1V1PB 1L0XB 1KLGD 5HHDG 3R8BA 5LNK1 4GDLB 2KDMA 2WXJA 4JWUC 1BXTA 5MPOA 3R2TA 4Q2JA 4ARCA 1FD6A 3AEGB 4RGNA 4US9A 2QMTA 1EU4A 1ZDXA 2J53A 1ZOYB 3LYYA 4TMAB 2CU3A 1JALA 2RDGA 4P16A 4JPSA 2XN9C 1TY0A 3AH7A 3W9CB 4JE3B 2W54A 2VZKB 3BZDB 2WDRB 1EWYC 2MJ3A 1L0YB 2AX5A 2WXNA 1HXYD 3BK2A 3LB8C 1C4PA 5EE1A 4ZRQA 4WAFA 1EWCA 1SE3A 3AEAB 2IPKD 2WXQA 1FXAA 1C76A 2PVGC 1F2RI 4PT5A 1TS3A 4WH4A 2L52A 2PVOD 2AQ2B 1KLUD 1TYGB 5G5GA 2WXHA 1PGBA 4YTMB 3AE1B 4MH8A 3IAS1 1D5MC 1NEKB 4OZAA 2FE8A 1QKZA 1V1OA 3FAHA 4GLSC 1KFYB 3B2GA 1ZUD2 4RH6A 3ZYYX 2HTME 3AE2B 1NYQA 1V97A 3SFEB 1V8CA 2WLBA 2IDYA 1MHXA 1VJKA 1JQ4A 2GI9A 2WDQB 3Q8EA 1AYFA 5HG2A 1SF0A 1T5XD 5BMIA 2DBYA 3P63A 3L4PA 4ZHOA 1P7EA 1EM7A 1UNSA 3UI3A 2JXTA 1GB1A 1KH0A 1YQ3B 2W55A 2JSVX 2W3SA 3NVYA 3FILB 2JX5A 3MJ5A 2OHFA 1PYWD 3AE5B 3NZ3A 2J4XA 1YN5A 1FFUA 4OZBA 4A55A 5JXVA 2YEPF 2WXMA 1VDVA 2ZW1A 2WXPA 2KQ4X 1D5ZC 3SR6A 3BYYB 1K51A 3SEBA 1F0ZA 5C3JB 1C4CA 2BS4B 2LUMA 3I9V1 3AEFB 1JWSD 1IGDA 1ZXHA 4RF1A 3DWMA 1AWDA 1IBXB 2WXGA 4NZLB 3N9YC 1L4DB 1E9MA 2MEKA 1UWMA 2WU5B 1WWTA 1F77A 3E9SA 2KWDA 1ZXIA 4OVZA 1AW7A 1SBBB 2ACZB 2N7JA 1E7PB 2GRIA 4OZCA 4IKGA 3DWGC 4ARIA 1TS5A 1TS4A 4C7ZA 2QEJC 1L5PA 2PW9A 1GB4A 4J3OD 1C4AA 4KGTA 3IXSA 5D3IB 3Q8FA 3MC0B 2K9XA 1J7CA 2R61A 1JRPA 2BB5A 1QQRA 4DXGA 1GAQB 2BW2A 2HDEA 1SJHD 4XDDA 4D2KA 3CIRB 3GP7A 4YTPB 5E6JA 3TEXA 3W2DA 4H2AA 4LTUA 2MJDA 2DYOA 2BB6A 1HZ6A 1JW9D 2Z8LA 1PFDA 2CJOA 3U4EG 3AE6B 1YJJA 4XDCA 1D5XC 2PTLA 1J7AA 1VRAB 4RNAA 4A9AA 1RWSA 2XNAC 2KAJA 1ZE3D 4OW0A 1XLPA 1VZ8A 3BVZA 3J9CA 1QF6A 1CJEA 1IUEA 4CQNA 1JMLA 2PKOA 4ZYSA 4M0WA 1M4VA 2B76B 5I4DA 3NS1A 2SEBD 3P4SB 3EA6A 4MT5A 1NENB 3I57A 1UGJA 2DLBA 2LEKA 3Q8BA 1ACCA 4HEA1 3TSSA 1HZ5A 3U7ZA 5HFYA 4LLGM 2JZPA 4N6EB 2E6XA 1KTKA 4C56C 4NAWB 2H89B 4TSSA 2V3NA 4GDKB 3VRAB 1HEZE 2Y5PA 1WRIA 5TSSA 3PO0A 1FRRA 4C80A 2V3PA 4O1NA 4B0MA 1OQQA 1XCTL 2LHEA 4TQ1A 4L2YA 3W5UB 3VR8B 1JWUD 1WGKA 2LMCA 4FXCA 1DOXA 3ETRA 2NMQA 4KKJA 2BT6A 4YTNB 1MPEA 2IGDA 1SEBD 1TY2A 2GB1A 1KF6B 3BVGA 1LO5D 3AV8A 3KWVA 2INPE 1VLBA 3ZJVA 1GPXA 1XLQA 3T3NA 2FUG1 5EE3A 1DGJA 2D5GA 5AUIA 2E3TA 2TSSA 3CWIA 3AM9A 1I4QA 1NVID 1STEA 1N61A 2G9HD 1MVKA 4JWSC 3TEYA 1Q10A 3HUIA 3WCQA 4KX6B 1GOZA 1PGAA 2JQRB 3AE3B 3VQIA 1TKYA 4HRSA 1BUIC 1FCLA 4ZOHC 3EGRA 1FO4A 3R2IA 3C8YA 1SE4A 3NUHB 2FBWB 4UDUC 5D3DA 4WQMA 5BMHA 1ESFA 3AEBB 3MHZA 1I4RA 1QOAA 2EELA 1HA5A 3T3OA 1NI3A 3AEDB 4NJCA 2Y3AA 2NTTA 3BK1A 1CQVA 2K5PA 1JWMD 3GS2A 3IT4B 1J7BA 1TJEA 1XXGA 3B2FA 2Y5CA 3U2SC 1FMAD 2V0GA 2DWQA 1DYQA 4EE2A 1RM6C 1AN8A 2BS2B 3ZGZA 1CZPA 2DYMA 2QJLA 3TUOA 4L1BA 1I7HA 4YT0B 1N63A 2QSDA 2WQYB 1SXTA 1QOBA 4HROA 3ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTP B;  1XLO A;  1T3Q A;  4US9 A;  1N60 A;  2EKI A;  1FM0 D;  4LTU A;  1ZOY B;  2MJD A;  2CU3 A;  1JAL A;  1JW9 D;  1YQ4 B;  1PFD A;  2CJO A;  3AH7 A;  3W9C B;  1QT9 A;  3AE6 B;  2W54 A;  1YJJ A;  2WDR B;  1OQR A;  4YSZ B;  1J7A A;  1EWY C;  2AX5 A;  2MJ3 A;  1N5X A;  1FRD A;  2PIA A;  1QOF A;  1NYR A;  2H88 B;  3LB8 C;  5AUK A;  3RPF C;  4A9A A;  1RWS A;  5EE1 A;  2KAJ A;  2WS3 B;  2WP9 B;  3NVV A;  1XLP A;  3AEC B;  1QF6 A;  1CJE A;  3AEA B;  1IUE A;  2BS3 B;  1FXA A;  3EUB 2;  2PKO A;  2PVG C;  1XLN A;  3AE9 B;  3W5V B;  4YXD B;  1DOI A;  2B76 B;  2L52 A;  1SB3 C;  2PVO D;  3NS1 A;  3P4S B;  1TYG B;  5G5G A;  1NEN B;  3KWL A;  3VRB B;  2KMM A;  1WXQ A;  2LEK A;  1ZP0 B;  4YTM B;  1FFV A;  3VR9 B;  3AE1 B;  4N6E B;  1N5W A;  1N62 A;  4ZHP A;  1ROE A;  1NEK B;  3NVW A;  2CJN A;  1QOG A;  2H89 B;  3FAH A;  2W3R A;  1KFY B;  3B2G A;  1OFF A;  1SIJ A;  1ZUD 2;  3VRA B;  1E10 A;  1RFK A;  1WRI A;  3ZYY X;  2HTM E;  3P1M A;  4WWM A;  3PO0 A;  1FRR A;  1NYQ A;  4C80 A;  2MH7 A;  3AE2 B;  4IDI A;  1V97 A;  3SFE B;  1V8C A;  2G1E A;  2WLB A;  1OQQ A;  3AN1 A;  1VJK A;  3ABV B;  1JRO A;  3AE4 B;  1JQ4 A;  1FIQ A;  3W5U B;  3VR8 B;  2Q5W D;  1WGK A;  2WDV B;  2WDQ B;  1AYF A;  3LXF A;  3P4Q B;  3ETR A;  4FXC A;  1DOX A;  3HRD D;  5C2T B;  1SF0 A;  2BT6 A;  4YTN B;  2DBY A;  3P63 A;  5EE9 A;  1KF6 B;  3L4P A;  4ZHO A;  1JWA D;  4USA A;  1L6U A;  3AV8 A;  3BII D;  4YSX B;  1VLB A;  2M19 A;  2WU2 B;  1L6V A;  1YQ3 B;  4N58 A;  1GPX A;  1XLQ A;  3AEE B;  2W55 A;  1PDX A;  2MJE A;  2W3S A;  3NVY A;  5EE3 A;  1DGJ A;  2JX5 A;  2OHF A;  1R7S A;  3AE5 B;  5G5H A;  2K22 A;  5AUI A;  2E3T A;  1FFU A;  3CWI A;  3AM9 A;  1NVI D;  1N61 A;  1YJI A;  3AMZ A;  3AE8 B;  1VDV A;  1E6E B;  1B9R A;  4US8 A;  5H92 C;  4C7Y A;  4JWS C;  2M56 B;  1F0Z A;  3SR6 A;  5C3J B;  3FC4 A;  1RYJ A;  3HUI A;  2N0S B;  2BS4 B;  3WCQ A;  4KX6 B;  3AE7 B;  4P6V F;  5H8Y E;  2JQR B;  3AE3 B;  3AEF B;  1TKY A;  4HRS A;  1E0Z A;  3DWM A;  1AWD A;  4ZOH C;  1FO4 A;  1L0V B;  3B9J A;  1A70 A;  1E9M A;  1PUT A;  1UWM A;  2WU5 B;  1WWT A;  2FBW B;  4WQM A;  3AEB B;  3NRZ A;  3CIR B;  3AB5 A;  1ZXI A;  1FXI A;  1QOA A;  1XO3 A;  2L83 A;  3P4R B;  2ACZ B;  1QLB B;  1NI3 A;  1E7P B;  3AED B;  4JX1 C;  4N59 A;  1TKE A;  1JWB D;  1TKG A;  5EE0 A;  1KRH A;  3HVZ A;  2K5P A;  3DWG C;  3P4P B;  1J7B A;  4ITK A;  1TJE A;  1WYG A;  1DOY A;  4C7Z A;  3B2F A;  1L5P A;  2Y5C A;  1FMA D;  5GXG B;  2DWQ A;  1RM6 C;  2BS2 B;  4YSY B;  1CZP A;  2K9X A;  2QJL A;  1J7C A;  1JRP A;  3SFD B;  1I7H A;  4JWU C;  1GAQ B;  2QIE B;  4YT0 B;  5MPO A;  1N63 A;  2WQY B;  1QOB A;  4HRO A;  3NVZ A;  3AEG B; 
#chains in the Genus database with same CATH topology
 4WQO B;  1XLO A;  4PZN A;  2RDH A;  2DKX A;  2EKI A;  4MM3 B;  1FM0 D;  5DKW A;  2L8J A;  4IM2 A;  4W9F A;  1WGG A;  3AUO A;  1YN3 A;  4MEY A;  3MC1 A;  3RAX A;  2V4I B;  2KN4 A;  1RXW A;  2M1M A;  2ONQ A;  3THV A;  4EZL A;  3VUX A;  2MBH A;  2MHJ A;  3PZ7 A;  3ZDM C;  4AJY B;  1F52 A;  4O5C A;  1MI0 A;  3AE9 B;  2IHN A;  1HTQ A;  9ICQ A;  2DKZ A;  5DPT A;  1ZQX A;  4QZD A;  4W9J A;  3APC A;  2CS4 A;  3SU8 X;  4YL8 A;  1D9F A;  2BR0 A;  4GU2 A;  4B0E A;  3BQ0 A;  1TBE A;  2O6K A;  1HUZ A;  5BOL A;  4TUR A;  2N1R A;  3WK9 A;  2J6S A;  1H8C A;  4WUR A;  1JCK B;  2W3R A;  2LRU A;  4DHJ B;  1E10 A;  1Z00 A;  1ZQM A;  2RP5 A;  2KMA A;  1WE6 A;  2A4Z A;  2QAR A;  1S5L U;  1KFS A;  1V5O A;  3ED5 A;  3AE4 B;  4KN7 A;  5KFZ A;  5IO9 A;  3P4Q B;  2KJH B;  4UAY A;  3IFW B;  5EE9 A;  5J0S A;  3KH0 A;  3F5E A;  3M6Z A;  4TQ0 A;  2LVQ A;  2N9P C;  1ZQG A;  1GC6 A;  1UUP A;  3HK0 A;  2EH9 A;  4YSX B;  2K89 A;  2WF7 A;  4G3I A;  3Q8A A;  5BYS A;  2HE7 A;  2JVC A;  5DBA A;  2IGG A;  4GGQ A;  1WXA A;  4UB3 A;  4ED3 A;  4PHE A;  1WI0 A;  1ZDV A;  4ZRI A;  4DS4 A;  3PLV A;  3RCZ A;  4ED1 A;  4E0D A;  5J2G A;  1R4M B;  2L1A A;  2A1J A;  4YFK A;  5IN7 A;  1ZD5 A;  2PE9 A;  4US8 A;  4WIP A;  1S0O A;  5H92 C;  1SE9 A;  1EXN A;  2WAQ F;  3FC4 A;  3MJW A;  1E7V A;  3GQC A;  2O2V B;  7ICE A;  4GB9 A;  4RQ6 A;  4DF8 A;  2QDF A;  3OTQ A;  3U7D A;  2VJ5 A;  3FDS A;  1K50 A;  1RYU A;  1MG8 A;  1WWU A;  5TR5 A;  4Z6E A;  1T6B X;  2GO7 A;  2D07 B;  1JRU A;  2LGI A;  3RF9 A;  4EZJ A;  3PGE A;  5KFB A;  2KNB A;  3V05 A;  2M0A A;  3QAQ A;  2KKC A;  4RCO A;  4K4G A;  2N9X A;  2HD5 B;  4EFO A;  1WZ3 A;  4DO9 A;  1YMH E;  1ZQ1 C;  5J0R A;  5AM5 A;  1TKG A;  3WAL A;  2UVR A;  5T8I A;  1Q46 A;  4ITK A;  3RNB C;  3WK7 A;  4F4Y A;  1DOY A;  1T8E A;  1PGX A;  5FK9 C;  3MC9 A;  3F2B A;  2EMS A;  4YSY B;  3JPN A;  1I4X A;  7ICU A;  4C8O A;  5AKI A;  2WHE A;  1X2I A;  2LD9 A;  3LJ3 A;  1S9F A;  5J17 A;  1C77 A;  3M62 B;  3RH6 A;  5AIC A;  3UXN A;  4ED0 A;  2LXC A;  3HIL A;  3EFC A;  2XIC A;  4KZ0 A;  5E6P A;  4IWQ A;  2K6D B;  4EYH B;  3RB3 A;  2LWP A;  4B95 A;  1I4H A;  2I1J A;  2ZUD A;  5FKA C;  3RAQ A;  3SAG A;  5DB7 A;  1V86 A;  1DOQ A;  4RNO A;  1OQR A;  3QCA A;  4YSZ B;  2KJ6 A;  3JPQ A;  2PLP A;  3V6K A;  2PIA A;  3M8R A;  3DBR I;  1NYR A;  7ICV A;  3NTU A;  4QW8 A;  2ZCB A;  4O3S A;  3CMM B;  2PFP A;  2P35 A;  4F93 B;  3SAF A;  4HWI B;  4ICV A;  3AEC B;  1SXD A;  1U48 A;  2YMM A;  4P2H A;  4DXF A;  3GU3 A;  2OED A;  3W5V B;  3V3X A;  4EBE A;  3Q6B A;  2JEI A;  3N4M B;  3CF6 E;  2K0P A;  1CK1 A;  4EKU A;  5HI1 A;  1F0M A;  1S10 A;  3C5F A;  1NNL A;  2P66 A;  4QZ8 A;  1LGR A;  4OVV A;  1S1Q B;  4NY8 A;  1WCL A;  2AQ3 B;  3LWL A;  2QCZ A;  3ZDT A;  1KM7 A;  1D9D A;  2LYH A;  2X8X X;  9ICK A;  2XY6 A;  3ONN A;  4QIW F;  5AK6 A;  4O3R A;  5L83 A;  2JF5 A;  4WWM A;  2MU2 A;  1TE2 A;  4IDI A;  4RM9 A;  1E0Z A;  3O65 B;  2N9L A;  3VFK A;  3WKC A;  5HR6 A;  2K4E A;  3IBE A;  2X38 A;  5AI6 A;  1L6U A;  3H40 A;  4J9Q A;  4MGZ E;  4NM2 A;  3AU2 A;  5ALG A;  1J2M A;  1L4Z B;  3PLU A;  3OWE B;  4NLC A;  1ZYQ A;  4I28 A;  5KFN A;  4YVZ A;  1BGX T;  3QUB A;  3G6X A;  4BGD A;  2A1J B;  5EWF A;  2FPK A;  3ZJT A;  3PHX B;  4DDG D;  1E7U A;  1ZQU A;  2KJ8 A;  5DG7 A;  1KFT A;  4AUQ C;  2R8I A;  3QU4 A;  3D2N A;  2JZ3 B;  4IQV A;  3AU6 A;  1J2N A;  4KDI C;  4MHV A;  4YR0 A;  4HVB A;  1RYJ A;  4WJP A;  5CWR A;  3KQ4 A;  4EEY A;  2KLG A;  5LXH A;  5BO4 B;  1NBF C;  9ICB A;  2WXL A;  4E71 A;  2L0F A;  3OJ3 A;  4PYU A;  1TT5 B;  4RQ2 A;  5AM4 A;  3P4R B;  4R63 A;  4GXI A;  4FFD A;  2G4D B;  2QC8 A;  3A9J A;  4ECX A;  1A76 A;  4KX5 A;  2CKH B;  2KVZ A;  1TKE A;  4M02 A;  1ZQO A;  3X0W A;  3ECI A;  4TUQ A;  4IL6 U;  1UGM A;  1WR1 A;  4LK0 M;  4DSK A;  3DEE A;  2K8B A;  2KN5 A;  2NRW A;  1NK4 A;  2LYA A;  3NUQ A;  3OPX A;  7ICN A;  1C1Y B;  5HHD G;  2KIC A;  1CEZ A;  1EF5 A;  2BQR A;  2ZZP B;  4DSF A;  1BPY A;  3QQ8 B;  5EWG A;  1PVR A;  2BKR B;  4Q2J A;  2D11 A;  4ARC A;  3HX0 A;  4MJS A;  1SXE A;  2FCN A;  2WX0 A;  1JAL A;  3NRW A;  4F5O A;  4JPS A;  3U30 A;  2XN9 C;  3I5J C;  3W9C B;  2W54 A;  2VZK B;  3QEB Z;  4I6P A;  2MJ3 A;  2WX1 A;  2XK5 A;  4EZ9 A;  3NGD A;  4NQL B;  3ML8 A;  3IG5 A;  1C4P A;  1NK8 A;  2DF4 B;  1NJZ A;  4ZRQ A;  5AEK B;  5DDM A;  3M7D A;  1P1A A;  3QXG A;  2OEH A;  4RQ7 A;  4B9U A;  2WDT B;  2R8K A;  1C76 A;  2PVG C;  1XWL A;  5BOM A;  8ICQ A;  5AI8 A;  4YMM A;  2L52 A;  2N7E A;  2PVO D;  4HLE A;  2A5U A;  2ALZ A;  5G5G A;  1MSW D;  4NLZ A;  3DDH A;  1NK7 A;  2HHX A;  3KHH A;  4DSL A;  3ALB A;  3AU4 A;  3IAS 1;  2LJ5 A;  3PMN A;  3H0M B;  4JV1 A;  1NEK B;  1XSP A;  2DFL A;  2FE8 A;  1X9X A;  1ZQY A;  1KFY B;  3RUL A;  4FZM A;  3ZNZ B;  3QK0 A;  4W9E A;  5HNK A;  3DOW A;  3HJE A;  1Q1O A;  4BKT A;  2IDY A;  4KLG A;  2BGF A;  4FAD A;  1JQ4 A;  2FI1 A;  4NLN A;  2PEA A;  2WDQ B;  5J2A A;  5BMI A;  4EOY A;  4RQN A;  3TAP A;  1NKE A;  2GBM A;  4MSQ B;  3VUW A;  4ED7 A;  1P7E A;  2GOW A;  1UNS A;  4NQK E;  2K1F A;  3DQV A;  2ASJ A;  1GB1 A;  3LYS A;  2BCU A;  4F4K A;  9ICN A;  1KDH A;  4I2J A;  2JSV X;  5KT3 A;  3NVY A;  1A0P A;  1L7O A;  3JW0 X;  2E8M A;  1PYW D;  3MJ5 A;  2NRV A;  1X6I A;  4P1B C;  4OVU A;  1YN5 A;  1WH3 A;  2EQY A;  3NAS A;  1L6N A;  1GG3 A;  3UIN B;  5DG8 A;  2YEP F;  2LMR A;  1VDV A;  1X9S A;  2KJ9 A;  1A6S A;  1E8Z A;  5AZH A;  3L5K A;  2BQ3 A;  3SR6 A;  2WF9 A;  4Y2R A;  1P7D A;  2ZIV A;  4A3O A;  5DDY A;  2BS4 B;  3I9V 1;  3AEF B;  3Q3O C;  4RPZ A;  2EZX A;  3L3F X;  1IGD A;  3L0W B;  2KK0 A;  1AWD A;  3DWM A;  2WXG A;  1TFR A;  2L76 A;  2MEK A;  1YOV B;  3OJ4 B;  3A9J B;  1WM2 A;  3WKE A;  5J2H A;  2KWD A;  2LZ6 A;  2HDO A;  1AW7 A;  3L13 A;  2KFZ A;  4JK1 A;  2GRI A;  3PO4 A;  3PW0 A;  4IKG A;  2CRX A;  3PW5 A;  2W8K A;  2K8B B;  3JPS A;  1L5P A;  4RU9 A;  3K75 D;  4HCP B;  3IXS A;  5D3I B;  4ANU A;  2K9X A;  3ZDA A;  4KIT B;  5IIO A;  3PSP A;  1QQR A;  3IG3 A;  2BW2 A;  2M0N A;  2Y1J A;  4DWI A;  5EDS A;  5F9L A;  2XGQ A;  5KG0 A;  4NJ8 A;  3GP7 A;  3Q3F A;  2HHS A;  5E6J A;  2EAO A;  3RFA A;  2GOL A;  4F92 B;  5J2I A;  2MJD A;  3I1Y A;  2DYO A;  2Z8L A;  4NNJ B;  3RN9 C;  3C28 A;  1NK9 A;  4U6P A;  2ZPN A;  3U4E G;  3H6N A;  4UAZ A;  4KLE A;  4XDC A;  2W9A A;  1J7A A;  4UB2 A;  4FJZ A;  4I29 A;  1VRA B;  2ES6 A;  9ICE A;  1BPE A;  5J29 A;  4A9A A;  4NXZ A;  2XNA C;  2YMQ A;  2KAJ A;  2O6V D;  3MR6 A;  3TIX A;  3BVZ A;  3ZI4 A;  1QF6 A;  4IQW A;  5AKX A;  3C0R B;  1TAM A;  3PY8 A;  3ZDE A;  4P0P A;  1UA0 A;  2NRZ A;  5B5E U;  4EYI B;  5IIM A;  1ZQA A;  2B76 B;  3GDX A;  3NS1 A;  1QZE A;  3EA6 A;  4QWE A;  1ZQW A;  2DLB A;  1Z19 A;  2QB0 A;  1ACC A;  3MFH A;  4HEA 1;  4GLX A;  2HMX A;  3EHV A;  4LLG M;  4N6E B;  2MA1 A;  1TGZ B;  4C56 C;  2IHM A;  2H89 B;  2V3N A;  1N48 A;  2PFN A;  1HEZ E;  3B08 A;  1FPY A;  2L00 B;  3PSI A;  4C80 A;  3B0Y A;  1B0X A;  1U47 A;  2V3P A;  2Q4T A;  3RTV A;  3OGU A;  1OQQ A;  1XCT L;  4HYK A;  1NK5 A;  4J9O A;  4F4Z A;  2BCQ A;  4L2Y A;  4TQ1 A;  3VR8 B;  3W5U B;  5IP4 D;  4KKJ A;  1T0S C;  4YTN B;  2IGD A;  4C8K A;  1KF6 B;  2OYY A;  4NV0 A;  4QZI A;  5KFH A;  1ZQQ A;  2KC1 A;  1GJZ A;  3L10 B;  1VLB A;  2W8L A;  1GPX A;  2D6F C;  1V9P A;  3UM9 A;  3V6E B;  3IDW A;  3KKA A;  1ZQE A;  5AUI A;  2TSS A;  1Q0W B;  1NVI D;  2F77 X;  1I4Q A;  5ALH A;  3K9P B;  3JPR A;  1N61 A;  4XYC A;  2ZPY A;  1MVK A;  5CX3 A;  1WG8 A;  4ECT A;  5J0P A;  3C19 A;  2BYE A;  3EYZ A;  3JSV B;  4IW0 A;  1L8L A;  1Q10 A;  1OXJ A;  5KFT A;  1V5T A;  5ALF A;  1N6Z A;  3RB0 A;  4HRS A;  2MUT A;  1BUI C;  5DQH A;  2M0X A;  4RQ8 A;  3IP4 B;  8ICX A;  2BDU A;  1SE4 A;  1WX8 A;  1Q8K A;  2LGD A;  4NLG A;  4WQM A;  3AEB B;  2VJ4 A;  1XT9 B;  2ZUB A;  3MHZ A;  1I4R A;  3TKA A;  2D3A A;  4URK A;  3T3O A;  1NOM A;  3PST A;  1NI3 A;  4IQU A;  4DHJ D;  2VA2 A;  3BK1 A;  4RQ5 A;  3IT4 B;  2JMG A;  1TJE A;  2GLS A;  3UIO B;  3UMC A;  3ORY A;  9ICW A;  4LZG A;  2DWQ A;  3H0R B;  4MEM A;  3N1Y C;  1MG4 A;  2BS2 B;  1FEZ A;  1MN8 A;  4J9P A;  2CPR A;  1I7H A;  2KZ3 A;  3I3T B;  2VA8 A;  3N7R C;  2KDI A;  3ZRF A;  3KUD B;  1IPG A;  1N60 A;  2E1F A;  3SV3 A;  5J2F A;  1ZQH A;  2N7D A;  3DBS A;  4Q8E A;  1KW4 A;  1ZD4 A;  5FR3 A;  1YQ4 B;  3RJG A;  9ICI A;  5F3X B;  4QWA A;  1LFD A;  2ZIW B;  9ICG A;  2KFK A;  2MWS B;  3VXW A;  1QOF A;  2MRP A;  3E58 A;  5J0U A;  4ZDV A;  1UD7 A;  4LJP B;  4KLT A;  4P0P B;  5EWE A;  1DRG A;  3F2C A;  5KHO A;  4KIK A;  3RNC C;  4R66 A;  3WU2 U;  4PPX A;  1AQ6 A;  1ZOL A;  3N97 B;  1HTO A;  2RGF A;  2KP7 A;  3NOB A;  2LPE A;  1KN5 A;  4ELU A;  2KN7 A;  3VRB B;  3WAO A;  1LB2 B;  4O3Q A;  4JL9 A;  2Y0S F;  3VR9 B;  1N5W A;  4NL9 A;  2BGW A;  2RPV A;  4JWN A;  3ZLZ A;  2IZV B;  4KLM A;  3PRZ A;  2B21 A;  1SIJ A;  1SZP A;  2LFI A;  1RFK A;  1DGS A;  2XGP A;  4KGR A;  3QU7 A;  1H38 A;  2G1E A;  3PVX A;  4PS3 A;  2NO4 A;  1XS9 D;  2BWF A;  1JRO A;  2FUH B;  2NVU I;  3ZUN A;  1UH6 A;  3RMK C;  2J0K A;  2LAS A;  3Q69 A;  1Q3U A;  3NZU A;  2BPF A;  4FHK A;  4J9S A;  3AEV A;  1F2R C;  2WU2 B;  1KLV A;  2FPL A;  1BPZ A;  4IRC A;  2OXO A;  3AEE B;  3H9D A;  3PW2 A;  3UXP A;  5G55 A;  8ICN A;  2HHT A;  4BJQ A;  3Q14 C;  5G5H A;  4PHD A;  4MGI E;  1YJI A;  2JRH A;  3AE8 B;  2H3I A;  4DHZ B;  3BIN A;  2M56 B;  3KOO A;  1LV5 A;  3F2D A;  3TJP A;  5DLF A;  4M9H A;  3C2M A;  1MFW A;  3PHW B;  4AOF A;  4RQ4 A;  2XID A;  4M6W B;  3GIK A;  5IAA C;  4IRK A;  1Z1V A;  2YLM A;  4RMA A;  4ICU A;  1N56 A;  2LRW A;  3UF8 A;  3D6J A;  3OAW A;  4A8X C;  1WSP A;  2L7R A;  4IRD A;  3C5G A;  4N9F 4;  3MDC A;  2AQ1 B;  8ICY A;  2GH1 A;  3KW5 B;  3Q8M A;  7ICJ A;  1B43 A;  2KO3 A;  3MR2 A;  3D32 A;  1JWB D;  3MHS D;  4UAR A;  3GV8 B;  3DBL I;  1WYG A;  2JRI B;  2KAN A;  3RFZ B;  7ICI A;  4KLF A;  2W03 A;  1T0Q C;  5III A;  4M00 A;  5BMG A;  2AYO B;  3QAR A;  4XC2 A;  2IY0 B;  2LJI A;  4KV2 A;  2LI6 A;  4I2F A;  1MQ2 A;  1XF5 L;  1TVA A;  1KSP A;  3KUZ A;  3KYC D;  3K1Z A;  5DGB A;  4DFK A;  2INN E;  2LVO A;  2FCM A;  1BPB A;  1VZ6 A;  3CW2 C;  2RMM A;  1HEK A;  3Q8S B;  1YNT E;  8ICC A;  4F72 A;  3LK9 A;  2AU0 A;  2MAX A;  1WM3 A;  1XQQ A;  2C9W B;  4QZ9 A;  5KL1 B;  4JQW C;  3Q3M C;  1KEJ A;  2HI0 A;  4NAW A;  4BFR A;  3TI0 A;  2DZK A;  4JB3 A;  3H7S A;  4FA6 A;  2ZEQ A;  5AKG A;  1TK5 A;  4KIK B;  2D10 A;  1WJN A;  4CYE A;  2JR5 A;  4UB5 A;  4EBD A;  5E6N A;  3PNC A;  5AKY A;  4NPN A;  2KHW B;  2BWE S;  2BS3 B;  4YP3 A;  3AUL A;  5D49 A;  9ICA A;  3KLS X;  1IGC A;  2C60 A;  4A3P A;  4A90 A;  4GN1 A;  3H8W A;  2ZIU A;  2KMM A;  1K8R B;  2WB1 C;  5KFF A;  5CTR C;  5KFL A;  1ZRM A;  2KFJ A;  2RHF A;  3BQ7 A;  3M6K A;  1LVH A;  2BQQ A;  3ZIM A;  4C00 A;  2JEG A;  4DQR A;  2OJR A;  4TUU A;  4P4M A;  2PXI A;  3TEW A;  2VAN A;  3PR5 B;  3CP8 A;  1S97 A;  8ICK A;  5J18 A;  4QNL A;  2MH7 A;  1RPL A;  4BWJ A;  8ICA A;  1QIL A;  2F8L A;  4NLB A;  3AN1 A;  4GXB A;  1DOX A;  2JYE A;  1J97 A;  3M95 A;  3V7K A;  3TL5 A;  4ASW C;  4PL1 A;  2R8H A;  3W1S A;  4GXK A;  2WF6 A;  4BWM A;  4F50 A;  4KSL C;  2M19 A;  4LVS A;  4N58 A;  4DS5 A;  3ETL A;  5L1M A;  2BCV A;  1P3Q U;  3P42 A;  4LDT B;  1PDX A;  4RFB A;  5HP4 A;  4UAU A;  1I4P A;  2IOF K;  5AM0 A;  2W9B B;  2VZK D;  4WAA A;  2E8P A;  4F5Q A;  2UVW A;  4J9N A;  3FIL A;  2XY5 A;  3AMZ A;  2KHV A;  1E6E B;  5L1J A;  1B9R A;  3S6J A;  3RNF C;  1EU3 A;  3IT6 B;  4OJO A;  2JZZ A;  2NO5 A;  4LNI A;  4W9H A;  3R9K A;  3QZ7 A;  1KFD A;  4P0Q B;  3V61 A;  3ZRC A;  2VH1 A;  8ICI A;  1TV9 A;  4JLC A;  3B9J A;  1CUK A;  5KFU A;  3KHR A;  1ZQS A;  3V60 A;  3PX4 A;  1IBX A;  3WKB A;  2CHX A;  3KZX A;  3AB5 A;  1MC8 A;  3WKD A;  3VVW B;  4RUC A;  4BVU C;  2VH2 A;  3N7P D;  2L32 A;  5D7G A;  7ICQ A;  1JUD A;  2KIV A;  4BXO A;  2YN4 A;  4I2E A;  4IM0 A;  2NRX A;  1WIA A;  4IOI E;  4QZE A;  1KLG D;  5LNK 1;  4KLI A;  4I2I A;  4QZH A;  2FIF A;  4KLQ A;  2KDM A;  3T5K A;  2WXJ A;  2XCA A;  1D8Y A;  3AXC A;  4PL2 A;  5KG6 A;  1K5O A;  1FD6 A;  3AEG B;  4RGN A;  4P4P A;  2NRT A;  3R7R A;  5CHF A;  1ZDX A;  4IWP A;  1ZQL A;  4QJF B;  3LYY A;  4TMA B;  2V4R A;  3PV8 A;  1SKR A;  3N20 C;  5J2R A;  1LM8 B;  3MR3 A;  3BZD B;  2PI5 A;  2PPH A;  2AL6 A;  1L0Y B;  1VCB A;  1ZW7 A;  1HXY D;  4QZG A;  1ZGU B;  3BK2 A;  2FCS A;  9ICJ A;  3LB8 C;  4ECZ A;  2ZIX B;  1D8L A;  3LWM A;  4WAF A;  1ZJM A;  3H8J A;  1EWC A;  3FYH A;  5DBC A;  2IPK D;  2WXQ A;  3HPO A;  5ALQ A;  1FXA A;  1RZT A;  4B9M A;  5BPC A;  2ZIU B;  4YD2 A;  5KFJ A;  2XI9 A;  2AQ2 B;  3RT3 B;  8ICJ A;  1RQN A;  1YX6 B;  2KDB A;  2WXH A;  3QC8 B;  4YTM B;  4FJY A;  3AE1 B;  3V6H A;  2KZM A;  2K60 A;  1HIW A;  3CNH A;  5E79 U;  4IWO A;  2KYW A;  5AZG A;  2AXT U;  5KFW A;  4B9N A;  4BBN C;  3B2G A;  1ZUD 2;  2KHQ A;  4C4T A;  5AIB A;  2LKY A;  4GDK A;  2KX3 A;  1V97 A;  5K4L A;  2GLE A;  3EC8 A;  1QTM A;  3Q8E A;  1QQ5 A;  1D3Z A;  4BKS D;  1SF0 A;  2KX0 A;  3P63 A;  2QHO A;  3L4P A;  4ZHO A;  2KDF B;  4Q44 A;  1MA7 A;  3VH3 B;  5HML A;  5HKH A;  1T0R C;  1MQ3 A;  2JXT A;  3MGH A;  5KAF U;  3TAN A;  3G6Y A;  1T7P A;  2FPM A;  3V7L A;  4F3O A;  8ICM A;  1KQQ A;  1KH0 A;  4KSK C;  2W55 A;  4R8U A;  1LKY A;  1SL0 A;  1I35 A;  2PFQ A;  3FIL B;  3RR8 A;  3BZK A;  4ECU A;  3NZ3 A;  3QIJ A;  4RUA A;  2HHW A;  1Z00 B;  9ICT A;  4CGZ A;  1FFU A;  3G6V A;  3DVN U;  4A55 A;  1KOT A;  2F1I A;  2QAR B;  1IV8 A;  1WE7 A;  2KK8 A;  5ALL A;  4B9T A;  2MA9 B;  1F0Z A;  1ARO P;  1T94 A;  3EPG A;  9ICL A;  2INC C;  4PYZ A;  3PVL A;  1ZQT A;  1R4M I;  1IBX B;  1WYW B;  4RF1 A;  4W9L A;  3SQI A;  4RNN A;  3RRG A;  8ICF A;  7ICO A;  1E9M A;  1L4D B;  5J2K A;  2WU5 B;  4NZL B;  1WWT A;  2KXJ A;  1L7P A;  1ZXI A;  4DFM A;  1ZQB A;  1RQL A;  3TCA A;  2YTU A;  8ICE A;  1VJ5 A;  2HBM A;  1LQB A;  2G5H B;  2N7J A;  4BXO B;  2EZY A;  2F1J A;  5TZV A;  4ARI A;  1TS5 A;  3K1R B;  3HKZ C;  4C7Z A;  3SMV A;  1TS4 A;  3W1S C;  3C2K A;  4J3O D;  2JHD A;  1WZ0 A;  5KFC A;  1NJY A;  2KV2 A;  2NS5 A;  1GAQ B;  4PS8 A;  3QA8 A;  5IOI A;  4WWN A;  4XDD A;  4MFF A;  4F4W A;  4YTP B;  4WJQ A;  3T79 A;  2GBN A;  2RPQ A;  2M9N A;  2KDE B;  4F5P A;  1JXL A;  4QIW C;  4IC7 B;  2G09 A;  2V9W A;  2Z7J A;  1SGG A;  4KN4 A;  4LNN A;  2F2A B;  1V2Y A;  5AK3 A;  1C7Y A;  2WYQ A;  2D2Q A;  2Y9U A;  4B6W A;  8ICH A;  1XLP A;  1COK A;  4NY0 A;  2EMT A;  1UPH A;  1CJE A;  4I6L B;  3EPI A;  4CQN A;  2PKO A;  1GNU A;  4ZYS A;  4P7I A;  5AI0 A;  4M0W A;  1PQS A;  4CF5 A;  4ECV A;  4GC6 A;  2HBJ A;  2SEB D;  3GV5 B;  1I42 A;  5DQI A;  2WF5 A;  4MT5 A;  3I57 A;  3FKY A;  2XCP A;  3U7Z A;  3B0X A;  2H3V A;  4XQ8 A;  1EO6 A;  2ZJ5 A;  3N1Z C;  2BDP A;  5DB8 A;  2E6X A;  5JTI A;  2JZP A;  3QX7 A;  2M17 A;  4PHA A;  1RYS A;  1S0N A;  2KG5 A;  1L2N A;  1BNP A;  2E1E A;  3T9L A;  1PVQ A;  4Y2J A;  4GDK B;  9ICP A;  2Y5P A;  2AGP A;  1X9M A;  2YY6 A;  3UXO A;  3AL0 B;  1WRI A;  9ICC A;  4PZO A;  4B0M A;  3A0B U;  7ICK A;  2LHE A;  2HOF A;  2RR9 A;  3UMB A;  3M9N B;  1GO3 F;  4DCC A;  4DQS A;  5KT5 A;  1WGK A;  1WX9 A;  2LMC A;  2KWU B;  3PML A;  2HTH A;  2NMQ A;  3A1Q A;  4ZYN A;  3SD7 A;  3ZDB A;  2K8C A;  3RD2 A;  1X42 A;  5JH5 C;  3JPP A;  2IO0 B;  1L7M A;  1SEB D;  2DX5 B;  1FXT B;  1YJ1 A;  5DB6 A;  2B0C A;  5KT2 A;  1LO5 D;  1SGH A;  4R8U B;  1LKY B;  5AKK A;  4TUP A;  2ZJ8 A;  5HHI A;  4YN4 A;  1YQB A;  2INP E;  1XLQ A;  5KFO A;  2Y5B B;  5EE3 A;  4Y2Q A;  5AKL A;  2OCE A;  1L3V A;  3QYP A;  4KLU A;  2D5G A;  4ZRJ A;  3ZNH B;  4Y2S A;  4KMO B;  1UBI A;  3ZVV A;  3PTF C;  1Z4O A;  2LHT A;  3VAW A;  3ML9 A;  1BPX A;  2G9H D;  2KNJ A;  5FR6 A;  1L7N A;  2F3N A;  3GIM A;  2KFN A;  7ICT A;  3HUI A;  3RJH A;  1NK6 A;  1GOZ A;  2OOB B;  1X40 A;  4ED6 A;  3AU5 A;  2JQR B;  2PMZ C;  1TKY A;  4JGH B;  4ZOH C;  4UB4 A;  1FO4 A;  2G5I B;  1X1M A;  3C8Y A;  3KZI U;  1PZN A;  2LI5 A;  3DHH C;  1ESF A;  5L1I A;  4BDP A;  1QOA A;  1HA5 A;  2KD0 A;  1NJW A;  1R4N B;  1BPD A;  2WF8 A;  2Q0Z X;  2ZTD A;  4Y2V A;  5T14 A;  1HUO A;  3AED B;  3GS2 A;  5AKZ A;  4QWC A;  2KKV A;  4FZN A;  2MSN A;  4II2 B;  4DBG A;  1UQV A;  2ZG6 A;  2Y5C A;  1FMA D;  2BF8 B;  1S0V A;  2YVC A;  1AN8 A;  9ICO A;  4BZA A;  1J8C A;  3GZN I;  1UF0 A;  2JXX A;  2QJL A;  3TUO A;  2BPG A;  4O9M A;  2RLT A;  3Q8Q B;  2DAF A;  4C8N A;  2LGY A;  1C78 A;  5L9X A;  5F9N A;  2EAP A;  4J9R A;  2CHW A;  4EEN A;  3GE8 C;  3H7P A;  2B3A A;  3DVN V;  5KFD A;  1KRP A;  2F8K A;  1RDF A;  4LNF A;  3ISC A;  4EEL A;  4EZ6 A;  1MJD A;  2AWT A;  4NJ6 A;  2LYB A;  2HSZ A;  4RGO S;  4RQ1 A;  1FRD A;  2G45 B;  5C0Y A;  4YQW A;  1SL1 A;  3A0H U;  5DCN A;  4YCX A;  4O0I A;  1OEY J;  4TV3 A;  1OQY A;  1ZET A;  4TQR A;  2RQ5 A;  3CST A;  4UAT A;  2WS3 B;  4AS1 A;  5KFE A;  3RI7 C;  3TAD A;  4F2S A;  2BBC A;  2P6U A;  4YXD B;  2V3S A;  4MJS B;  2UYZ B;  2ZTE A;  1SB3 C;  3RUI B;  5DPW A;  2K4I A;  3MR5 A;  1TAU A;  4K4I A;  2K8H A;  3HM3 A;  5IA7 A;  3H4D A;  1ZP0 B;  3DBH B;  4KVG B;  4ANW A;  2MBE A;  4L23 A;  1WWV A;  4J9K A;  3O13 A;  1OUQ A;  3TFR A;  2CJN A;  1QOG A;  2XK5 B;  9ICS A;  1U4B A;  4Z6F A;  2A1A A;  4U7C A;  2C2D A;  3BS5 A;  2VRR B;  1XCQ L;  3EW9 A;  4C4S A;  2MW5 A;  2IO2 B;  3A1Q B;  2MBQ A;  2ASQ A;  3OHB A;  4ICA A;  2WNM A;  1EF1 A;  5C2T B;  4OJL A;  4MAC A;  4GSW A;  1Y8R C;  1NI2 A;  3C2L A;  1T3N A;  4MGK E;  4UB8 U;  1L6V A;  2DAJ A;  3OG5 A;  1DK2 A;  1VD2 A;  3QE9 Y;  5H2F U;  1URJ A;  3CYM A;  1R7S A;  1WXS A;  3QEA Z;  2NV3 A;  2JWU A;  1KKX A;  1IIP A;  3SI8 A;  2ON8 A;  4C7Y A;  2ISP A;  1NKC A;  1ZRN A;  1J19 A;  2G07 A;  4GMV A;  4X5V A;  3DDC B;  1R4N I;  1QSL A;  2N0S B;  5KFQ A;  1E8W A;  2K3U A;  4P6V F;  2BZF A;  5H8Y E;  5KL8 B;  3SEN A;  2F44 A;  3SAH A;  4B9S A;  2L0T A;  3ZNI D;  1TZ1 A;  2E8O A;  2G08 A;  1K52 A;  1Y88 A;  2KWV B;  3Q3N C;  4XGA B;  2W7P A;  1U9L A;  3OJU A;  3GV7 B;  1TK0 A;  5L95 C;  1JX4 A;  2KTF A;  3Q8P B;  4WJ3 B;  2J52 A;  5DLG A;  1XO3 A;  5CRX A;  4CDG A;  3MAB A;  4DFP A;  4K7W A;  4P4O A;  2KJ5 A;  3RNA C;  5J2E A;  4N59 A;  1L3S A;  3ICX A;  1SE2 A;  4Y2P A;  1SSN A;  3NZS A;  3P4P B;  1RG6 A;  1HQR D;  3SYZ A;  2ZIV B;  3QU2 A;  2AQ4 A;  3N1X C;  2ODG A;  5LXI B;  1C9F A;  2I1Q A;  2JU6 X;  4ECY A;  1OW5 A;  1VR9 A;  4W9G A;  1WX7 A;  2DZM A;  3JVZ X;  2G0A A;  2HBL A;  4QZC A;  3LDZ E;  2QIE B;  4J9L A;  5AHX A;  3VCB A;  3H7P B;  1JI7 A;  3GZF A;  4GDL A;  1FNW A;  4IG7 B;  4O3O A;  5ALP A;  2WXO A;  4LDT D;  2H3Q A;  1K53 A;  1YN4 A;  5ALU A;  3RNG C;  2CXY A;  3BQ2 A;  1QT9 A;  1V80 A;  4FUL A;  5DPS A;  2W82 A;  3TEZ A;  2KD1 A;  4K4H A;  2DPI A;  4HKZ E;  4DL3 A;  5AUK A;  4JWM A;  3N3K B;  2PKE A;  2REX A;  2WP9 B;  2MCN B;  4RPX A;  4PHP A;  4E74 A;  3MGV A;  1RLF A;  3EUB 2;  2ESE A;  4OD0 A;  1UWX A;  1SV0 A;  5D4B A;  1DOI A;  4HAI A;  4AYB F;  3L16 A;  3PR4 A;  4I2D A;  3H4B A;  3DCG A;  3KWL A;  2FE9 A;  4KGS A;  4DK5 A;  3UQ2 A;  4MEL A;  3Q2A C;  2LBO A;  1OGW A;  1RFA A;  4UAV A;  1SL2 A;  4TKN A;  4UBC A;  4ZHP A;  1ROE A;  4A8E A;  3IV6 A;  4UAS A;  3VC8 A;  2JGA A;  3JYU A;  3BS5 B;  2NTS A;  1OFF A;  9ICF A;  1L3T A;  5KFS A;  2G06 A;  2W11 A;  4CRX A;  9ICM A;  1TS2 A;  5AKJ A;  2KJR A;  4DL7 A;  3ABV B;  3IAM 1;  3R3M A;  3TFS A;  4KDL B;  2O6V A;  2PMV A;  4O3M A;  3APD A;  1JWA D;  2QB0 B;  2I1K A;  4IQT A;  2J0J A;  3NHE B;  1SJE D;  4YWG G;  4REZ A;  2MJE A;  1D6E C;  3TAQ A;  3Q3J A;  4HDQ A;  3TAD C;  3J81 j;  1RRB A;  4XE0 A;  4RF0 A;  4ECR A;  3BQ1 A;  2JPH A;  2BYF A;  4DQI A;  4CHK A;  3ZKJ C;  5D94 A;  1WMH A;  2IA6 A;  3QUC A;  3IG8 A;  4DWF A;  3Q8C A;  2G4S A;  3SD5 A;  2MP2 A;  3A9K A;  2LHD A;  3NG0 A;  3BWU D;  2KZR A;  2D3B A;  5AK4 A;  1BT0 A;  4CE6 A;  1T0Y A;  2BQU A;  2FID A;  3FM9 A;  4C4V A;  2HCF A;  1FEH A;  4UAW A;  3K9O B;  3RZW C;  1PVP A;  4F71 A;  3GB1 A;  4AQ7 A;  5KG5 A;  1PUT A;  2WXI A;  1ZQN A;  2R8J A;  2KT7 A;  1NDD A;  2GMI C;  4MM3 A;  5J0W A;  2L83 A;  4DOB A;  4R64 A;  4RGM A;  2OWO A;  4JX1 C;  1WRD B;  1ZKH A;  5JHB A;  3APF A;  4ANX A;  3TQ1 A;  2NBW B;  3HVZ A;  3MP9 A;  5D6J B;  2FLP A;  3GZN B;  2BTE A;  2F1H A;  4RPY A;  1TKD A;  2DPJ A;  1TZO A;  4DSJ A;  4HKQ A;  3PT2 B;  4J6I A;  1OTR B;  4KX3 A;  3RZF A;  1ISN A;  1ZQV A;  3QHT A;  2NR2 A;  1XC9 A;  4GDL B;  4XUS A;  2J6T A;  2MUT B;  5CA7 A;  3KHG A;  4JWU C;  4PH5 A;  2UVU A;  4ECS A;  5DGA A;  4EUT A;  2LXA A;  1WJU A;  4IUM B;  3V62 A;  3T5J A;  2QMT A;  4DXA B;  2J53 A;  2V4Q A;  4PGQ A;  1N2X A;  2VA3 A;  2CU3 A;  3WK6 A;  3RB4 A;  4KLD A;  4P16 A;  2MBO A;  3AH7 A;  2WDR B;  1EWY C;  2AX5 A;  2RDJ A;  2UU7 A;  4FJV B;  4R65 A;  5KFP A;  3IM1 A;  4HJK A;  4S17 A;  5JRT A;  4MF2 A;  3C23 A;  2IBK A;  5AM2 A;  4G11 A;  2AJQ A;  1SE3 A;  5AKE A;  3AEA B;  2C7H A;  3BQT A;  1NK0 A;  4YR3 A;  1F2R I;  4PT5 A;  1TS3 A;  2IMW P;  4M01 A;  4WH4 A;  3QU5 A;  3T5H A;  4M9L A;  3KKA C;  2EDU A;  1KLU D;  4HPM B;  2R18 A;  4YXJ A;  1TYG B;  1Z5S B;  1C3T A;  5FP0 A;  1PGB A;  3MGI A;  4W9D A;  3BY4 B;  2RRD A;  4MH8 A;  2KSO A;  4ACF A;  3BS7 A;  4OZA A;  2KFK B;  4QAY A;  5KT4 A;  1V1O A;  5G2N A;  4GLS C;  3GFK B;  2AEH A;  5KFX A;  4RH6 A;  3ZYY X;  2HTM E;  2BPS A;  3OSN A;  2O6V B;  3SFE B;  1V8C A;  3IHP C;  2EKE C;  1MHX A;  1VJK A;  2Z59 B;  3KD3 A;  2GI9 A;  2EZZ A;  5ALD A;  1AYF A;  1UT8 A;  4M9N A;  1TAQ A;  1OEY A;  1T5X D;  3HWT A;  2LVP A;  3HP6 A;  1JIH A;  5CB1 A;  2C7M B;  1PUZ A;  2R2Q A;  2AH5 A;  4BAX A;  2K39 A;  3H1U A;  4BX9 C;  1YQ3 B;  4ELV A;  1JXE A;  2KMC A;  1RYR A;  2K4H A;  2JX5 A;  3AE5 B;  2J4X A;  2A19 A;  1SKS A;  4OZB A;  4II3 B;  3OLM D;  5AI4 A;  1L3U A;  1UEL A;  1YX5 B;  2FLL A;  2MP2 B;  2WXP A;  3A9K B;  1V81 A;  2KQ4 X;  1O03 A;  3WK4 A;  5ALZ A;  3L54 A;  1RAX A;  2C22 A;  1D5Z C;  3BYY B;  1K51 A;  5KG3 A;  5C3J B;  1C4C A;  2HJ1 A;  2LUM A;  1Z2M A;  2AL3 A;  1JWS D;  4OJ6 A;  3AQE A;  3PW7 A;  2KKP A;  2JUO A;  2UWQ A;  3R66 C;  2FLN A;  3N9Y C;  3ZD9 A;  2JY6 A;  1F77 A;  3VTU A;  2JEJ A;  3HT3 A;  1ZQJ A;  1XD3 B;  4HK2 A;  4KZC A;  4E3C A;  1E7P B;  5CHV C;  4OZC A;  3SV4 A;  9ICX A;  5A0L A;  2ZXH A;  4O5E A;  5GTI U;  4LJO B;  3SEI A;  2QEJ C;  4F7Z A;  1GB4 A;  4KGT A;  2KEY A;  1V49 A;  3MC0 B;  1J7C A;  2R61 A;  2BB5 A;  4DXG A;  5ALT A;  4NL9 C;  5J0Y A;  5J2J A;  1V9J A;  2HDE A;  3BDP A;  2K8A A;  1SJH D;  3M63 B;  1SWW A;  1WUD A;  4M9J A;  9ICV A;  3CIR B;  4QWB A;  3DBR B;  7ICG A;  4YXM A;  4AP4 C;  2LGS A;  3TEX A;  1F9J A;  4LTU A;  3WAP A;  3C29 A;  5IIL A;  2AQ0 A;  2BB6 A;  1HZ6 A;  1IG6 A;  4FS1 A;  3QZ8 A;  1PFD A;  2CJO A;  3PSE B;  2WHI A;  4IM3 A;  4EEK A;  2PTL A;  1V85 A;  1IP9 A;  2BKF A;  5KT6 A;  4OO1 J;  2IOH A;  5KNI A;  3U8Z A;  4YMN A;  1RWS A;  5C1Z A;  3T8M A;  4QWD A;  3TMP B;  2W9C A;  2KC2 A;  3NJT A;  2AGQ A;  5KFK A;  1M4V A;  4M2Y A;  4MDK E;  3UQB A;  3WA0 A;  3LVV A;  3UQA A;  2KSO B;  5KG1 A;  1NEN B;  1UGJ A;  3TSS A;  5IIJ A;  4KLS A;  3Q8B A;  5HFY A;  1HZ5 A;  1ZQZ A;  2DEN B;  1KTK A;  4NAW B;  3JPO A;  3B0A A;  5ALM A;  3VRA B;  2KOB A;  4DDI D;  1QQ6 A;  3KFU F;  5TSS A;  4FHJ A;  4BBN F;  8ICO A;  2QLT A;  3ALR A;  4DF4 A;  4G0N B;  1O08 A;  2BHN A;  2CR5 A;  4O1N A;  4FS2 A;  3PZP A;  2PI4 A;  4K81 A;  2E8N A;  4YG2 A;  3I63 C;  3K4G A;  4MFA A;  2ZNV B;  4FXC A;  2BT6 A;  3BVG A;  4XZ4 A;  4FN2 A;  1TY2 A;  2GB1 A;  2MBB B;  4Z6C A;  3AV8 A;  5J2D A;  3ZJV A;  1K1Q A;  3GIJ A;  1KLN A;  3RJI A;  4FBT A;  3T3N A;  3F53 A;  2FUG 1;  5ALO A;  1DGJ A;  1YT3 A;  1SWV A;  2NCN A;  5HMM A;  4F8R A;  2HHV A;  2WAQ C;  1ZJN A;  1E5W A;  4JWS C;  1GC7 A;  4C4R A;  3WKA A;  1DK3 A;  1WGH A;  4NWI A;  2VIX A;  1L7Y A;  3ZD8 A;  5CJ7 A;  4ECQ A;  8ICU A;  2J6U A;  3EEC A;  2C2E A;  4KTQ A;  1PGA A;  3WCQ A;  4DSE A;  4EBC A;  3AE3 B;  2XVT A;  5ALI A;  5AI9 A;  2K6Q A;  3EGR A;  5ALX A;  3IRU A;  8ICV A;  2YML A;  4RQM A;  4Y2U A;  5DBB A;  4UDU C;  1XO1 A;  3L17 A;  1BVS A;  1U49 A;  3PO5 A;  2I9G A;  4CF4 A;  1S3S G;  2DL0 A;  4DEZ A;  4DHZ E;  3H0L B;  3SZ2 A;  1SKW A;  2NTT A;  1BNO A;  1CQV A;  2K5P A;  3SDL C;  2KQS A;  4LNO A;  2ZNV C;  3AI5 A;  2WFA A;  3U2S C;  3WAN A;  3UPQ A;  4EE2 A;  1DYQ A;  1AAR A;  2KVC A;  3HKZ F;  1CZP A;  2DYM A;  2IY1 B;  5JHA A;  5B66 U;  1WGY A;  5AKH A;  4Q8F A;  1N63 A;  2QSD A;  3QU9 A;  4XX5 A;  4AWJ A;  5KFI A;  1SXT A;  4HRO A;  4LNK A;  2LUE A;  3ISB A;  4HPL B;  4I27 A;  1T3Q A;  1Z1B A;  3MFG A;  4AJW A;  2B6G A;  4WWP A;  2V9H A;  1S77 D;  4F1S A;  3DVG X;  2N9K A;  2I2Y A;  2N9E B;  2DZI A;  2UVV A;  4PS7 A;  1QLN A;  2N4F A;  3H8H A;  1N5X A;  3P2B A;  1YZ6 A;  4KKI A;  1WGD A;  1COO A;  2H88 B;  2D3C A;  1QH9 A;  5CR0 A;  3OHA A;  4UQG A;  1L5U A;  2EAN A;  2W9C B;  1WGR A;  3KUC B;  3N7S C;  3UIP B;  4BKG A;  1EUV B;  3F5A A;  4Q45 A;  7ICH A;  2JYT A;  3RJJ A;  1ENF A;  5L1L A;  1E90 A;  4KLL A;  3C1Z A;  1B4F A;  1CI4 A;  1IXR A;  1ZQR A;  2ZVO A;  3PRE A;  8ICT A;  4I6N B;  2W43 A;  1N62 A;  4DOC A;  2HVH A;  3NVW A;  2G3Q B;  3M1Y A;  2H3Z A;  4OJP A;  3Q8K A;  3N28 A;  4F5R A;  2JEF A;  3KTQ A;  3DPD A;  3VUY A;  1X66 A;  1S8O A;  5J0Q A;  5ALS A;  5KFV A;  2QIL A;  1RXV A;  1WY8 A;  2I5H A;  3HRD D;  2KTR A;  3BYT B;  3RRH A;  3HIZ A;  3T3F A;  1U45 A;  3RYT A;  3I76 A;  2ZCC A;  5ALE A;  3HHM A;  1KL9 A;  3TBL D;  3QUT A;  2ATL A;  3BII D;  1K1S A;  2HOQ A;  4OCZ A;  4LZD A;  4GXJ A;  4O3N A;  2HOI A;  1MHH E;  2ZVN A;  2OJW A;  3URY A;  2F76 X;  3IVF A;  3H7I A;  5ALN A;  4JUZ A;  4XRH A;  1JMS A;  1I4G A;  4W9K A;  5DQG A;  4I2G A;  2N1V A;  1ET9 A;  3DHG C;  3IN5 A;  1XO0 A;  4IR1 A;  4DSI A;  1ZQC A;  8ICP A;  3A33 B;  4K7S A;  3DVG Y;  4DL6 A;  4NJ7 A;  5DPR A;  4Y2Y A;  2ASL A;  2W7O A;  7ICF A;  4FLH A;  5GTH U;  4F4X A;  4FZL A;  1Z3E B;  3KHL A;  2MQJ A;  4HPP A;  4XWT A;  2FDR A;  4BKS A;  1L0V B;  2PMZ F;  1NKB A;  4MF8 A;  2WXK A;  2HBK A;  3UMG A;  1V38 A;  1ZQK A;  2I38 A;  4J9M A;  8ICR A;  2W9N A;  4EX7 A;  3PZ8 A;  5J0O A;  2KZZ A;  2HJ8 A;  2GBK A;  4UB6 U;  3WK5 A;  4GC7 A;  4CO7 A;  2L3Z A;  4LCD E;  1D4B A;  4Y2T A;  1HJP A;  3MC8 A;  5EE0 A;  1FNU A;  3ZXV A;  4UB1 A;  5BYQ A;  1IM4 A;  5J8Y A;  2IJ0 A;  2YQE A;  2ICI A;  4HJG E;  2IYD B;  1E8X A;  3U52 E;  4DQO C;  1M94 A;  8ICW A;  4WJO A;  3SFD B;  1XNS A;  7ICM A;  1V1P A;  2JH1 A;  1YD8 U;  4FBJ B;  3BVM A;  2MRL A;  2BVC A;  4GIB A;  4JV0 A;  2ZJD A;  1WFY A;  3NVZ A;  2QB1 A;  2AHO B;  2DHZ A;  4W9C A;  1NZB A;  3VH4 B;  3VTW A;  1B1Z A;  4G50 A;  4AP9 A;  3E56 A;  4DLE A;  2KIW A;  1KTQ A;  2HW3 A;  2RSU A;  3O0F A;  1FNV A;  1ZD2 P;  5CHG A;  1KJT A;  2WWZ A;  4FO6 A;  1IYF A;  2YEP B;  3RPF C;  4BOS C;  4B9L A;  3RJF A;  3R7Q A;  4K3C A;  3NVV A;  4XWW A;  1ZQD A;  5ALR A;  5CEH A;  3QNM A;  3V7J A;  2IO1 B;  2SAK A;  2WXF A;  4G3X B;  8ICB A;  1SV4 A;  3RR7 A;  1XLN A;  2EAM A;  3VHT C;  3MFI A;  4F5N A;  1BML C;  1T4G A;  3IHQ B;  4R3D A;  4CF3 A;  1WXQ A;  2LGX A;  3MTN B;  4Z6D A;  3TAR A;  2KE7 A;  1FFV A;  1XSL A;  1E8Y A;  2R8G A;  4DL4 A;  1C79 A;  2NBU A;  1WCN A;  3HVD A;  2Y1I A;  5DG9 A;  2K25 A;  4A6Q A;  5KFR A;  4PJ0 U;  2J42 A;  2KMD A;  2DZJ A;  2BKE A;  4I2B A;  1ET6 A;  3H8S A;  2BCS A;  4RQ0 A;  4LJX A;  1TTN A;  4NAM A;  3P1M A;  5AM3 A;  5J0X A;  4ZRP A;  3ZW3 A;  1S0M A;  3PRP B;  2L5Y A;  9ICH A;  2BYV E;  3ZTC A;  2ASD A;  9ICR A;  2KTR B;  3H8M A;  7ICL A;  1FIQ A;  1D8B A;  4M0W B;  2Q5W D;  2WDV B;  3LXF A;  3JSV A;  4IC9 A;  3ZDD A;  1XEE A;  2FMQ A;  4PGX A;  3B1L X;  5J0T A;  3S2A A;  2DQN B;  2I6X A;  4USA A;  3ZQ4 A;  1TIF A;  3KVF B;  5HHH A;  3W1Y A;  3V72 A;  4Q43 A;  1UCV A;  2NPT A;  2J7Q B;  3LDA A;  4I2H A;  3PX0 A;  2PFO A;  2FMS A;  1FCC C;  4ZRK A;  1H4R A;  4PK1 A;  1P7F A;  2XC9 A;  3EWA A;  2K22 A;  1X9W A;  1QSS A;  1F1H A;  3N32 A;  1VZ7 A;  5AIA A;  4IR9 A;  1UHU A;  5EOZ A;  1NJX A;  1Y56 A;  4YR2 A;  2FJ6 A;  2L05 A;  3ZO5 B;  5CP2 A;  3N30 A;  2K8C B;  4ZH4 A;  4QZB A;  3AE7 B;  2A3V A;  3ZTD A;  4QZA A;  4RGT A;  4C0Z A;  3PSF A;  2PJH A;  2ZXI A;  1U4A A;  3PPA A;  3ZDC A;  1A70 A;  4KMU A;  2W9M A;  4OHJ A;  2ZW0 A;  4P1C C;  3UGB B;  3NRZ A;  3DHI C;  5BYR A;  1FXI A;  1TK8 A;  4JV2 A;  2FNJ B;  5KT7 A;  2KAC A;  1QLB B;  5GMV A;  2IOF A;  4QZF A;  1ZPS A;  2IGH A;  3PW4 A;  2P6R A;  1KRH A;  2WXR A;  4KLO A;  3ISD A;  2V1Y A;  2ZIW A;  2V4L A;  2BYT A;  7ICP A;  4F91 B;  5GXG B;  4EEW A;  3M9O B;  1F44 A;  5KFG A;  1V1P B;  1L0X B;  3R8B A;  3OJS A;  2N1W A;  3VTV A;  5KFA A;  3MDA A;  3ENE A;  1A5R A;  1BXT A;  5MPO A;  4MFC A;  2ZJA A;  3R2T A;  2IBI B;  2KWC A;  3M8S A;  7ICR A;  1YIW A;  2IO3 B;  4US9 A;  3L08 A;  3NS8 A;  5KG7 A;  1EU4 A;  3TAC B;  1ZOY B;  2KOX A;  2RDG A;  4EZK A;  3RB6 A;  1TY0 A;  4JE3 B;  2YMP A;  3EZ5 A;  4CCH A;  2WXN A;  2JRZ A;  2WTF A;  5ALJ A;  3RJK A;  3RBE A;  1XU4 A;  4OJ5 A;  2FMP A;  2Y9T A;  5EE1 A;  3ZXR A;  4B6J A;  1Q5W B;  5C5J A;  1C20 A;  2D8C A;  2LM4 A;  1GUA B;  2YB1 A;  4IS7 A;  1WJ4 A;  1NZP A;  3NY5 A;  4O5K A;  5KTQ A;  4KLJ A;  2KVR A;  4W9I A;  5J8Y C;  5KFM A;  3E2E A;  4ELT A;  4EX6 A;  1D5M C;  3GII A;  4JIO U;  1QKZ A;  4F2R A;  4MEX A;  3FAH A;  2XEW A;  5CHW A;  2ZUC A;  4RT3 A;  2AGO A;  2ISO A;  1NYQ A;  3AE2 B;  3DBH I;  5JZE B;  3I28 A;  5D46 A;  4ACO A;  1F5S A;  1UZX B;  2WLB A;  3SHQ A;  3D2S A;  4M0A A;  5JUM A;  4FE3 A;  2D3D A;  5HG2 A;  3DV9 A;  3C21 A;  1KBU A;  2DBY A;  4RM8 A;  4M6W A;  3Q8R B;  2NPT B;  4DFD A;  1EM7 A;  4DQP A;  3UI3 A;  4UBB A;  5D2M B;  4RQ3 A;  3E0F A;  3V6J A;  5TIS U;  2NBV B;  2PE6 B;  4NM1 A;  1QSY A;  1SZH A;  2W3S A;  2D3G A;  2OHF A;  1ZQF A;  3PV1 A;  5JU5 A;  4BOZ B;  5JXV A;  2J0M A;  2WXM A;  2ZW1 A;  1ZQI A;  2LM1 A;  1JN3 A;  4GOC A;  3SEB A;  2BCR A;  2NYV A;  2YX8 A;  3RH5 A;  5ALW A;  5ALK A;  3BZC A;  5LLI A;  5AZF A;  5E6O A;  2H3F A;  2E5S A;  1ZXH A;  1DXS A;  3DBL B;  1P98 A;  4DOA A;  4M9G A;  4C8L A;  1UWM A;  4WJN A;  2DUY A;  3E9S A;  2VKQ A;  1Q3V A;  2M4N A;  4OVZ A;  4M8M A;  1SBB B;  5AK5 A;  2ACZ B;  3QJZ A;  3MBY A;  2JWZ A;  2ZTC A;  1G6J A;  4CNQ A;  2K4P A;  3DWG C;  1PK1 A;  2C5L C;  4ED2 A;  2PW9 A;  3RNE C;  1C4A A;  3ZNG C;  1J0G A;  4M47 A;  7ICS A;  3Q8F A;  1B22 A;  4GFJ A;  4AYB C;  3BJY A;  2JZB A;  4DLG A;  1JRP A;  3GE3 C;  3PRM B;  2FAZ A;  4GIV A;  4X57 B;  1ED1 A;  2CU1 A;  4YMO A;  4D2K A;  2H5X A;  1ZQP A;  4FBU A;  3CRX A;  2RD0 A;  1A77 A;  3W2D A;  2JH7 A;  4H2A A;  2RDI A;  1JW9 D;  2GWS A;  2MLB A;  4WWO A;  5KG4 A;  2HHQ A;  3AE6 B;  3A4S C;  1YJJ A;  2DNF A;  2Z0E B;  1D5X C;  5HR7 A;  4HCN B;  1CMX B;  1WJ6 A;  4MGY E;  1M6Y A;  4RNA A;  3QUQ A;  2Z0D B;  4MSM B;  1ZE3 D;  4OW0 A;  2JV3 A;  1VZ8 A;  3X23 A;  3J9C A;  2OH2 A;  1IUE A;  1P9D U;  1WR6 E;  1JML A;  4HDO A;  2KQ7 A;  4A20 A;  4F8C B;  4RZR A;  3OSP A;  1UBQ A;  4PGY A;  5DB9 A;  4I2C A;  5KG2 A;  4J03 A;  5I4D A;  5L1K A;  2Y0S C;  5KAI U;  9ICU A;  3P4S B;  1SIF A;  2DYB A;  3EFU A;  2LEK A;  4ECW A;  1QCK A;  2JT4 B;  4K3B A;  2R2O A;  4UW9 A;  2BPC A;  4XA5 A;  4YD1 A;  4Y2X A;  3V6C B;  3AQF A;  3VDZ A;  4TSS A;  5J2C A;  2W9B A;  3T5L A;  2W04 A;  5J2B A;  4K7U A;  3PX6 A;  4KLH A;  1QQ7 A;  3PO0 A;  4B9V A;  1FRR A;  2KLC A;  2KTQ A;  4NLK A;  4MH0 E;  1Z4N A;  5C23 A;  2JXJ A;  1JWU D;  4S0R A;  2HVI A;  2IND C;  3ETR A;  4QW9 A;  2KVS A;  1MPE A;  4I2A A;  4HXD A;  2C2R A;  3RJE A;  4P0Q A;  4RNM A;  3U26 A;  4C8M A;  3KWV A;  4B9K A;  3D2Q A;  4TQS A;  5IKC M;  1CRX A;  3M9M B;  1WXV A;  3GOE A;  4G9B A;  1X6J A;  3HW8 A;  4ANV A;  2RDB C;  5AI5 A;  4DFJ A;  2WB1 F;  2E3T A;  3CWI A;  2GBJ A;  3AM9 A;  2HHU A;  3CSF A;  1WF9 A;  1STE A;  3C1Y A;  4TUS A;  1HE8 A;  1ZD3 A;  2CN1 A;  3Q8L A;  3HM6 X;  5KFY A;  3RBD A;  4M04 A;  3TEY A;  1L8O A;  4DQQ A;  2C7N B;  3UQ0 A;  2YB4 A;  3WK8 A;  4M8N A;  4KX6 B;  4O3P A;  2QKQ A;  3GIL A;  8ICG A;  2XBB C;  1ECW A;  5IIN A;  3VQI A;  1YZ7 A;  2OM6 A;  2O2V A;  3PS6 A;  1FCL A;  1V6E A;  2MSE D;  3A4R A;  3R2I A;  5ALV A;  1WXM A;  2FCQ A;  4DL5 A;  1PK3 A;  8ICS A;  2FBW B;  4ED8 A;  3NUH B;  2WGS A;  5D3D A;  5BMH A;  3PZD A;  8ICZ A;  4JMU A;  2GBR A;  2EEL A;  3KYD D;  4K1R B;  1PK1 B;  5IIK A;  5AM1 A;  2C28 A;  2M8S A;  4NJC A;  4BUG A;  3WIM A;  2Y3A A;  1WMH B;  1JWM D;  1J7B A;  1P0R A;  1SV0 C;  3WAM A;  3LVW A;  5ALY A;  1UA1 A;  2CHZ A;  1XXG A;  3B2F A;  1XSN A;  2V0G A;  8ICL A;  2JZB B;  3RH4 A;  2XY7 A;  1RM6 C;  2ZIX A;  3QX1 A;  3QWZ B;  3ZGZ A;  2DGZ A;  1S76 D;  4L1B A;  4C4V B;  3JPT A;  5KHQ A;  3KBB A;  3M3J A;  2XO7 A;  4YT0 B;  1LXD A;  2WQY B;  3ONS A;  1UT5 A;  2MX2 A;  1QOB A;  4RT2 A;  3ZJU A;  4DL2 A; 
#chains in the Genus database with same CATH homology
 1C78 A;  1XLO A;  1T3Q A;  1N60 A;  2RDH A;  2EKI A;  3MFG A;  4MM3 B;  1FM0 D;  5FR3 A;  1YQ4 B;  1YN3 A;  2N9K A;  2I2Y A;  4RGO S;  3H8H A;  1N5X A;  1FRD A;  1QOF A;  4KKI A;  2V4I B;  2KN4 A;  2H88 B;  2ONQ A;  2WS3 B;  4AS1 A;  3PZ7 A;  2BBC A;  1MI0 A;  2JYT A;  3AE9 B;  4YXD B;  1ENF A;  1SB3 C;  4B0E A;  3VRB B;  1ZP0 B;  3VR9 B;  4L23 A;  1N5W A;  1N62 A;  3O13 A;  2RPV A;  3NVW A;  2CJN A;  1QOG A;  4WUR A;  1JCK B;  2W3R A;  1E10 A;  1SIJ A;  2LFI A;  1RFK A;  1XCQ L;  4KGR A;  2G1E A;  1JRO A;  3AE4 B;  2QIL A;  3P4Q B;  2WNM A;  3HRD D;  3BYT B;  5C2T B;  4MAC A;  3Q69 A;  5EE9 A;  4TQ0 A;  1UUP A;  3BII D;  4YSX B;  1F2R C;  1L6V A;  2WU2 B;  3Q8A A;  5BYS A;  1MHH E;  3AEE B;  2IGG A;  3URY A;  1R7S A;  5G5H A;  1ZDV A;  1I4G A;  2JWU A;  1YJI A;  2L1A A;  3AE8 B;  1ET9 A;  2ON8 A;  4US8 A;  4WIP A;  5H92 C;  4C7Y A;  2M56 B;  3FC4 A;  2N0S B;  2K3U A;  4P6V F;  5H8Y E;  1K50 A;  4XWT A;  1K52 A;  1L0V B;  1T6B X;  2LGI A;  4A8X C;  2WXK A;  1WSP A;  2I38 A;  2J52 A;  3PZ8 A;  3V05 A;  2M0A A;  2AQ1 B;  1XO3 A;  4RCO A;  1YMH E;  4N59 A;  1D4B A;  1JWB D;  1TKG A;  1SE2 A;  1FNU A;  5EE0 A;  1SSN A;  5T8I A;  3P4P B;  4ITK A;  5BYQ A;  1WYG A;  1DOY A;  3RFZ B;  1HQR D;  1PGX A;  5FK9 C;  1C9F A;  2IJ0 A;  4HJG E;  2ICI A;  5BMG A;  3U52 E;  2JU6 X;  4YSY B;  4DQO C;  1VR9 A;  1I4X A;  2LJI A;  3SFD B;  2QIE B;  1V1P A;  1XF5 L;  3BVM A;  1C77 A;  3NVZ A;  1FNW A;  2INN E;  2WXO A;  1VZ6 A;  1K53 A;  1YN4 A;  1B1Z A;  2RMM A;  1I4H A;  1YNT E;  5FKA C;  1QT9 A;  3E56 A;  1OQR A;  4YSZ B;  2W82 A;  2PLP A;  2PIA A;  3TEZ A;  1FNV A;  1NYR A;  4HKZ E;  2YEP B;  5AUK A;  3RPF C;  2WP9 B;  3NVV A;  4XWW A;  3AEC B;  2SAK A;  2WXF A;  4DXF A;  2BS3 B;  3EUB 2;  1XLN A;  2OED A;  3W5V B;  1UWX A;  3V3X A;  3KLS X;  1DOI A;  1IGC A;  4A90 A;  1BML C;  4KGS A;  4R3D A;  3KWL A;  2K0P A;  1CK1 A;  1WXQ A;  2KMM A;  5HI1 A;  1FFV A;  3HVD A;  1C79 A;  4A6Q A;  1ROE A;  4ZHP A;  2AQ3 B;  2J42 A;  2NTS A;  1OFF A;  1ET6 A;  3TEW A;  4NAM A;  3P1M A;  4WWM A;  4ZRP A;  1TS2 A;  4IDI A;  2MH7 A;  1QIL A;  3AN1 A;  3ABV B;  3IAM 1;  1FIQ A;  2Q5W D;  2WDV B;  2JYE A;  3LXF A;  1E0Z A;  2N9L A;  1XEE A;  2PMV A;  2X38 A;  3W1S A;  1JWA D;  4USA A;  1L6U A;  3ZQ4 A;  1L4Z B;  2M19 A;  4N58 A;  1SJE D;  3OWE B;  4YWG G;  3P42 A;  4RFB A;  2MJE A;  1PDX A;  1D6E C;  1FCC C;  1I4P A;  4REZ A;  2VZK D;  1P7F A;  2K22 A;  4XE0 A;  3ZJT A;  4RF0 A;  3FIL A;  1VZ7 A;  3AMZ A;  1E6E B;  1B9R A;  1Y56 A;  3Q8C A;  1EU3 A;  3IT6 B;  2LHD A;  1RYJ A;  3BWU D;  3AE7 B;  3KQ4 A;  4RGT A;  1FEH A;  2WXL A;  3B9J A;  1A70 A;  3GB1 A;  4AQ7 A;  1PUT A;  2WXI A;  4OHJ A;  1IBX A;  2ZW0 A;  3NRZ A;  3AB5 A;  2L83 A;  1FXI A;  2KAC A;  3P4R B;  5BYR A;  1QLB B;  2L32 A;  5D7G A;  4RGM A;  1ZPS A;  4JX1 C;  1TKE A;  2IGH A;  2WXR A;  1KRH A;  3HVZ A;  3MP9 A;  2BTE A;  4LK0 M;  2BYT A;  1TZO A;  5GXG B;  4HKQ A;  4IOI E;  1V1P B;  1L0X B;  1KLG D;  5HHD G;  3R8B A;  5LNK 1;  4GDL B;  2KDM A;  2WXJ A;  4JWU C;  1BXT A;  5MPO A;  3R2T A;  4Q2J A;  4ARC A;  1FD6 A;  3AEG B;  4RGN A;  4US9 A;  2QMT A;  1EU4 A;  1ZDX A;  2J53 A;  1ZOY B;  3LYY A;  4TMA B;  2CU3 A;  1JAL A;  2RDG A;  4P16 A;  4JPS A;  2XN9 C;  1TY0 A;  3AH7 A;  3W9C B;  4JE3 B;  2W54 A;  2VZK B;  3BZD B;  2WDR B;  1EWY C;  2MJ3 A;  1L0Y B;  2AX5 A;  2WXN A;  1HXY D;  3BK2 A;  3LB8 C;  1C4P A;  5EE1 A;  4ZRQ A;  4WAF A;  1EWC A;  1SE3 A;  3AEA B;  2IPK D;  2WXQ A;  1FXA A;  1C76 A;  2PVG C;  1F2R I;  4PT5 A;  1TS3 A;  4WH4 A;  2L52 A;  2PVO D;  2AQ2 B;  1KLU D;  1TYG B;  5G5G A;  2WXH A;  1PGB A;  4YTM B;  3AE1 B;  4MH8 A;  3IAS 1;  1D5M C;  1NEK B;  4OZA A;  2FE8 A;  1QKZ A;  1V1O A;  3FAH A;  4GLS C;  1KFY B;  3B2G A;  1ZUD 2;  4RH6 A;  3ZYY X;  2HTM E;  3AE2 B;  1NYQ A;  1V97 A;  3SFE B;  1V8C A;  2WLB A;  2IDY A;  1MHX A;  1VJK A;  1JQ4 A;  2GI9 A;  2WDQ B;  3Q8E A;  1AYF A;  5HG2 A;  1SF0 A;  1T5X D;  5BMI A;  2DBY A;  3P63 A;  3L4P A;  4ZHO A;  1P7E A;  1EM7 A;  1UNS A;  3UI3 A;  2JXT A;  1GB1 A;  1KH0 A;  1YQ3 B;  2W55 A;  2JSV X;  2W3S A;  3NVY A;  3FIL B;  2JX5 A;  3MJ5 A;  2OHF A;  1PYW D;  3AE5 B;  3NZ3 A;  2J4X A;  1YN5 A;  1FFU A;  4OZB A;  4A55 A;  5JXV A;  2YEP F;  2WXM A;  1VDV A;  2ZW1 A;  2WXP A;  2KQ4 X;  1D5Z C;  3SR6 A;  3BYY B;  1K51 A;  3SEB A;  1F0Z A;  5C3J B;  1C4C A;  2BS4 B;  2LUM A;  3I9V 1;  3AEF B;  1JWS D;  1IGD A;  1ZXH A;  4RF1 A;  3DWM A;  1AWD A;  1IBX B;  2WXG A;  4NZL B;  3N9Y C;  1L4D B;  1E9M A;  2MEK A;  1UWM A;  2WU5 B;  1WWT A;  1F77 A;  3E9S A;  2KWD A;  1ZXI A;  4OVZ A;  1AW7 A;  1SBB B;  2ACZ B;  2N7J A;  1E7P B;  2GRI A;  4OZC A;  4IKG A;  3DWG C;  4ARI A;  1TS5 A;  1TS4 A;  4C7Z A;  2QEJ C;  1L5P A;  2PW9 A;  1GB4 A;  4J3O D;  1C4A A;  4KGT A;  3IXS A;  5D3I B;  3Q8F A;  3MC0 B;  2K9X A;  1J7C A;  2R61 A;  1JRP A;  2BB5 A;  1QQR A;  4DXG A;  1GAQ B;  2BW2 A;  2HDE A;  1SJH D;  4XDD A;  4D2K A;  3CIR B;  3GP7 A;  4YTP B;  5E6J A;  3TEX A;  3W2D A;  4H2A A;  4LTU A;  2MJD A;  2DYO A;  2BB6 A;  1HZ6 A;  1JW9 D;  2Z8L A;  1PFD A;  2CJO A;  3U4E G;  3AE6 B;  1YJJ A;  4XDC A;  1D5X C;  2PTL A;  1J7A A;  1VRA B;  4RNA A;  4A9A A;  1RWS A;  2XNA C;  2KAJ A;  1ZE3 D;  4OW0 A;  1XLP A;  1VZ8 A;  3BVZ A;  3J9C A;  1QF6 A;  1CJE A;  1IUE A;  4CQN A;  1JML A;  2PKO A;  4ZYS A;  4M0W A;  1M4V A;  2B76 B;  5I4D A;  3NS1 A;  2SEB D;  3P4S B;  3EA6 A;  4MT5 A;  1NEN B;  3I57 A;  1UGJ A;  2DLB A;  2LEK A;  3Q8B A;  1ACC A;  4HEA 1;  3TSS A;  1HZ5 A;  3U7Z A;  5HFY A;  4LLG M;  2JZP A;  4N6E B;  2E6X A;  1KTK A;  4C56 C;  4NAW B;  2H89 B;  4TSS A;  2V3N A;  4GDK B;  3VRA B;  1HEZ E;  2Y5P A;  1WRI A;  5TSS A;  3PO0 A;  1FRR A;  4C80 A;  2V3P A;  4O1N A;  4B0M A;  1OQQ A;  1XCT L;  2LHE A;  4TQ1 A;  4L2Y A;  3W5U B;  3VR8 B;  1JWU D;  1WGK A;  2LMC A;  4FXC A;  1DOX A;  3ETR A;  2NMQ A;  4KKJ A;  2BT6 A;  4YTN B;  1MPE A;  2IGD A;  1SEB D;  1TY2 A;  2GB1 A;  1KF6 B;  3BVG A;  1LO5 D;  3AV8 A;  3KWV A;  2INP E;  1VLB A;  3ZJV A;  1GPX A;  1XLQ A;  3T3N A;  2FUG 1;  5EE3 A;  1DGJ A;  2D5G A;  5AUI A;  2E3T A;  2TSS A;  3CWI A;  3AM9 A;  1I4Q A;  1NVI D;  1STE A;  1N61 A;  2G9H D;  1MVK A;  4JWS C;  3TEY A;  1Q10 A;  3HUI A;  3WCQ A;  4KX6 B;  1GOZ A;  1PGA A;  2JQR B;  3AE3 B;  3VQI A;  1TKY A;  4HRS A;  1BUI C;  1FCL A;  4ZOH C;  3EGR A;  1FO4 A;  3R2I A;  3C8Y A;  1SE4 A;  3NUH B;  2FBW B;  4UDU C;  5D3D A;  4WQM A;  5BMH A;  1ESF A;  3AEB B;  3MHZ A;  1I4R A;  1QOA A;  2EEL A;  1HA5 A;  3T3O A;  1NI3 A;  3AED B;  4NJC A;  2Y3A A;  2NTT A;  3BK1 A;  1CQV A;  2K5P A;  1JWM D;  3GS2 A;  3IT4 B;  1J7B A;  1TJE A;  1XXG A;  3B2F A;  2Y5C A;  3U2S C;  1FMA D;  2V0G A;  2DWQ A;  1DYQ A;  4EE2 A;  1RM6 C;  1AN8 A;  2BS2 B;  3ZGZ A;  1CZP A;  2DYM A;  2QJL A;  3TUO A;  4L1B A;  1I7H A;  4YT0 B;  1N63 A;  2QSD A;  2WQY B;  1SXT A;  1QOB A;  4HRO A;  3ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...