1N62A

Crystal structure of the mo,cu-co dehydrogenase (codh), n-butylisocyanide-bound state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n62A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n62A01
1PFDA 1NI3A 1JALA 4ZOHC 1ZUD2 4C80A 1E0ZA 1FO4A 1FFUA 3AM9A 1NYQA 1SF0A 1XO3A 1WWTA 1L0VB 3B2FA 2MJEA 3NVZA 2PVOD 2WU5B 1EWYC 2WLBA 3W5VB 2WDRB 2K9XA 4N58A 1JROA 4HRSA 2MJDA 5GXGB 1FM0D 4JX1C 2MH7A 3SFDB 3VR8B 1I7HA 3B9JA 3HRDD 3AE5B 1PDXA 1TJEA 3AE9B 4JWSC 5EE1A 3AEDB 3NVYA 1TKEA 2DWQA 1KRHA 2H89B 3BIID 5H92C 1KF6B 3AE6B 2WP9B 5C3JB 2Q5WD 4YSZB 4YTMB 1VLBA 1RM6C 1E9MA 4HROA 3DWGC 2KAJA 3LXFA 1N63A 3NS1A 2CJOA 4YTPB 3VRBB 4WWMA 4USAA 1QOBA 3AEBB 2L52A 1WYGA 1AYFA 1B9RA 3AECB 1DOYA 3P4PB 1E10A 4ZHPA 1JW9D 3P1MA 4C7YA 2WS3B 1XLNA 1L6VA 4FXCA 3ZYYX 1OQRA 1ZOYB 4ZHOA 2BT6A 4KX6B 1QOAA 4LTUA 4YXDB 2WDQB 1R7SA 1YJJA 2OHFA 2CU3A 3AE7B 1QOFA 1XLOA 3AE3B 3SR6A 2WU2B 1N60A 2BS3B 3P4RB 5EE0A 1A70A 2B76B 4YSYB 4US8A 3NVVA 1CJEA 1XLQA 1SIJA 2CJNA 2L83A 3AB5A 3AE2B 1E6EB 1E7PB 1WXQA 3AEEB 3CIRB 3WCQA 1FIQA 2G1EA 2WDVB 3HUIA 3W5UB 2W54A 1TKYA 3NRZA 1RYJA 5EE9A 3AV8A 4N59A 3ETRA 5H8YE 1PUTA 1N62A 4A9AA 1OQQA 1QOGA 2PVGC 3AEAB 2H88B 1T3QA 2M56B 1XLPA 3EUB2 2EKIA 1JWAD 1WGKA 4US9A 5G5HA 2E3TA 1QLBB 3B2GA 1SB3C 5AUIA 1NVID 2PKOA 1L6UA 3AE4B 2KMMA 1J7BA 4P6VF 3AEGB 1OFFA 1VDVA 1FRDA 2BS4B 5G5GA 3ABVB 1N5WA 1QF6A 3W9CB 1YJIA 1KFYB 1ZP0B 3AE1B 2N0SB 5MPOA 1AWDA 2AX5A 1F0ZA 1NENB 5C2TB 3L4PA 1JWBD 2DBYA 2M19A 3HVZA 3AN1A 1ZXIA 3KWLA 1DOXA 1YQ3B 1FFVA 2QIEB 3P4QB 4JWUC 1UWMA 3AMZA 2JQRB 1FRRA 3RPFC 3P4SB 2W3SA 1V97A 1J7AA 1WRIA 1L5PA 1J7CA 2LEKA 2QJLA 4IDIA 1ROEA 1RWSA 1VJKA 1IUEA 3AE8B 3VR9B 2MJ3A 2BS2B 3LB8C 4YT0B 2W55A 1DGJA 3PO0A 2FBWB 2W3RA 3AEFB 1NYRA 1RFKA 2K22A 5AUKA 4ITKA 3SFEB 4YTNB 3FAHA 1JRPA 1CZPA 1N5XA 1TYGB 3AH7A 4C7ZA 2Y5CA 1GPXA 1QT9A 1FMAD 1FXAA 4YSXB 1JQ4A 3VRAB 2HTME 3P63A 2PIAA 1N61A 3CWIA 1V8CA 2WQYB 4N6EB 4WQMA 3NVWA 1FXIA 3FC4A 1NEKB 2JX5A 1YQ4B 5EE3A 3DWMA 1DOIA 2ACZB 1TKGA 2K5PA 1GAQB
chains in the Genus database with same CATH superfamily
3PO4A 1E7UA 1NI3A 3SV3A 2BGFA 1L0VB 1WRDB 4TUPA 2DZIA 2LHTA 3N30A 3C28A 3B1LX 3ZD9A 4ECQA 1ZDXA 2BWFA 2ZIWA 2HHUA 2XIDA 3B9JA 3HRDD 3AE5B 4GXJA 2FJ6A 2I1QA 4DL6A 3VTUA 3N7RC 3HP6A 2M0XA 2WNMA 4OHJA 1U9LA 2DUYA 3LVVA 2IJ0A 2V9HA 4UBBA 4O3MA 4BOZB 3PRPB 2NBWB 4USAA 4AYBC 1DK2A 3V7LA 2BCUA 5EWFA 3RH4A 4EUTA 4RT3A 1ZDVA 5ALOA 5HR7A 2VZKD 2Y5PA 2KKPA 4NAMA 2JV3A 5ALSA 4DSKA 5ALWA 1S0MA 2FCMA 3WKDA 2NTTA 3T5HA 3AU6A 4NLGA 1HA5A 2WU2B 3F2DA 3P4RB 4OJ5A 4QWCA 4K4GA 3NVVA 5KNIA 1ESFA 2L05A 2LRWA 3Q8KA 1E7PB 1BPBA 3A9JA 5AI0A 3JPNA 3QEAZ 2NPTA 2DPJA 4NJ6A 4WAAA 2DKZA 3ETRA 3VDZA 1WR1A 1VRAB 3WKBA 1S76D 3E0FA 4RU9A 2WDTB 3Q8AA 3RT3B 5DG8A 5IIIA 1X6IA 5CB1A 4TKNA 3NOBA 2ASDA 3RB3A 2QHOA 4C56C 2NV3A 3R7RA 3UIOB 3T3NA 1E8XA 4YN4A 1UA1A 3MR2A 3PLVA 4IQTA 5G5GA 4QWEA 4KLHA 3ZLZA 5AK6A 3KVFB 1T6BX 1RQLA 1KFYB 2QB1A 4B6JA 5CWRA 2QDFA 3QHTA 3TADC 2KQ7A 3T79A 4MDKE 2DYOA 4PHEA 1IM4A 4GXKA 4IG7B 2L76A 1WG8A 1PQSA 3VVWB 3I3TB 2ES6A 5DBAA 2JU6X 1C4CA 1ZQPA 3TACB 4A55A 1KTQA 1ZXHA 2V4LA 4IM2A 1Y8RC 1FD6A 2FE9A 2MUTA 5AK3A 3PO0A 2KYWA 4KITB 4QIWC 2G08A 4A6QA 2QKQA 1L7OA 2P6UA 1GPXA 1A0PA 2C22A 3IXSA 2WX0A 1LO5D 1DOQA 2Y5CA 4I6LB 4XE0A 2W9BA 8ICZA 5ALPA 3GIIA 4DFDA 4K4HA 1YD8U 2J0MA 1XNSA 2EZYA 4K3BA 2H3QA 2R8JA 3L17A 1TGZB 4ANXA 7ICKA 4DQQA 2KWDA 2SAKA 5KFUA 5IKCM 2O6VD 3DPDA 2LM4A 2MBOA 2Y1IA 5AKEA 2H3IA 2LBOA 5DBBA 3IG3A 2ISOA 2LYAA 3L0WB 5BMHA 4DFJA 1L3UA 2I5HA 2IY1B 2LVOA 3RJKA 1E5WA 4JX1C 2ZIXB 1WJ4A 3SFDB 1E8YA 5L95C 5KFEA 5D6JB 3ECIA 2DWQA 5H92C 3UMCA 2PFNA 4DSEA 3RAXA 4OVUA 2JZ3B 2P6RA 3PLUA 5HG2A 4NM1A 3ZUNA 3NS1A 4M04A 2M8SA 4ECXA 4NAWA 2EKEC 1K52A 5KG7A 4KGRA 4C7YA 2KOXA 1C20A 1YMHE 2JH1A 4AJYB 1R4NI 4F1SA 3KWVA 1XQQA 3AU4A 2FLPA 1QOAA 2AWTA 2KNBA 4IRCA 2MCNB 1OXJA 1GJZA 5BYSA 1ZQSA 5J17A 4M9JA 1QOFA 1SE3A 4FA6A 2ZUCA 4MHVA 3QUBA 4TUSA 1U4AA 3EECA 3UF8A 1TKDA 1F0MA 5AKZA 4FJZA 5C1ZA 2A19A 2INDC 4QW9A 7ICMA 4XWTA 3ZDMC 5F9NA 8ICOA 4WJPA 2IHNA 2W54A 5DPRA 2QARA 1TY0A 3UQBA 1EXNA 3RNEC 5AKKA 3TUOA 2KK0A 1C78A 1JWSD 1O03A 2K8HA 1QOGA 3BYYB 3V61A 3VTVA 3KOOA 4XC2A 1SKRA 3V7JA 3RB4A 8ICGA 2EKIA 3Q8BA 5J2JA 4FADA 1KFSA 2B3AA 2EAPA 2MQJA 3ZNGC 4KIKA 9ICRA 3ALBA 5KTQA 2MSNA 5TZVA 3A1QB 4MM3A 1UQVA 5G55A 2W82A 4O5EA 2L00B 1P98A 1GG3A 3UM9A 3KW5B 1LKYA 4RGTA 4ACFA 2ZIUA 2RPVA 1RXVA 5ALDA 2CKHB 4GMVA 2L0FA 2E8OA 1PK1A 1BVSA 2JZBA 4BJQA 3Q69A 4I2DA 1ZQOA 4I2CA 2UU7A 1S77D 4B9NA 1OW5A 4I27A 3WK5A 5AIAA 3QU7A 1S0VA 4BKTA 4GGQA 3BS7A 2DYMA 4LDTD 2YEPB 4XDCA 4A3PA 2MJ3A 3QWZB 1DGJA 1T5XD 2LJIA 1Q5WB 2XY7A 2AQ3B 1F2RC 1WCLA 4MFFA 1TYGB 4CRXA 4WJQA 1SL2A 1BPZA 3CSTA 5FP0A 4I2FA 3SEIA 3BZCA 3U7ZA 3PRZA 3H8HA 5J0OA 1WJ6A 3UPQA 2C5LC 1FXIA 4XQ8A 3UQAA 4QWAA 1KTKA 2KJ9A 5HHHA 1Q0WB 3MFIA 4F4YA 1UT8A 2BR0A 2AQ0A 1BMLC 1L0YB 2WB1C 1JALA 4DHJD 3CNHA 1XO3A 3TANA 1ZD2P 1EWYC 4ZRKA 2IMWP 3A9KA 4GDLA 5AI9A 4DL5A 3RJJA 4DWIA 3OHAA 3RZWC 2YN4A 5KG0A 5ALVA 5KFMA 2K4PA 4Y2XA 4J9PA 1NDDA 1KDHA 2DZKA 2KMCA 1RLFA 3Q3OC 2KNJA 2H89B 4J9SA 4K7SA 3BVMA 2ON8A 5LXHA 2UVWA 1VLBA 3SZ2A 3PREA 5C23A 3DWGC 4DWFA 2XCAA 2N7JA 3V7KA 1ZD5A 4M9GA 3Q8MA 4RF1A 2LUMA 2F44A 2ALZA 2W04A 3QZ7A 2G45B 2N9EB 4KZ0A 5BMGA 3P1MA 2QB0B 1L8OA 4ZHOA 3WKCA 2FUHB 3GILA 9ICSA 7ICOA 2V3SA 3WK9A 4M2YA 4ZYNA 2Y0SC 1GO3F 3GV7B 3RH5A 9ICKA 1XLOA 3RJEA 3M6ZA 5KFCA 4M0AA 4JWMA 2BS3B 4M6WB 1A70A 4C4SA 3KFUF 2HHXA 1YZ6A 1JX4A 3VHTC 4DQSA 2Q0ZX 5AM1A 1ZJMA 2DX5B 2LYHA 3WCQA 3CF6E 2VANA 3LYSA 5CHFA 3NRZA 2HBKA 4YMOA 4DL4A 7ICGA 1PGBA 4RQ8A 2L8JA 2DFLA 4HDQA 3EFUA 1HUZA 3CYMA 3ICXA 4PPXA 2IZVB 3DDCB 3DVGX 3RF9A 1C79A 2XO7A 4ECRA 1SB3C 1D8LA 1RPLA 4J9NA 9ICPA 2NBUA 1NNLA 4P6VF 2C2EA 1Q8KA 3KUZA 4RNNA 3ABVB 2KVZA 4OD0A 5KL8B 3SD5A 1L3SA 2ZW0A 1T8EA 3W9CB 1KM7A 5CHWA 4BKSD 2KKVA 2BYFA 3SMVA 2FLNA 5C2TB 4BXOA 4IQVA 4OZAA 4UB3A 1C4AA 4DDID 3N1ZC 1ZQJA 5D3DA 4JWUC 5T8IA 4JV2A 2GBKA 3DEEA 2CS4A 2VRRB 4C4RA 4I2AA 1V97A 2QILA 5J0WA 1WRIA 2LGDA 2NVUI 3PT2B 5BOMA 4EZ9A 4N9F4 4DQOC 2MRPA 1XO0A 1CRXA 1E7VA 2W7OA 2WXNA 4DBGA 7ICEA 4NV0A 3EHVA 2J0KA 5DGAA 5KFOA 3PW5A 4BFRA 2EZZA 1A6SA 3MGIA 4RT2A 3IBEA 3Q2AC 1ZQZA 1ZGUB 3PV8A 2HDEA 2KJRA 2Y9UA 4BBNF 1ZRNA 4DSJA 2G4DB 4RM9A 4M9NA 2NRWA 4B0MA 2BYTA 1K53A 3MR5A 2M0NA 4HDOA 3BQ2A 4EBCA 4BWJA 3Q6BA 4KMOB 1SJHD 3I28A 1P7FA 8ICRA 3C29A 4C0ZA 4KLMA 3ZIMA 4HWIB 4JWNA 5KT5A 2KXJA 2F76X 2WU5B 2LMRA 1N6ZA 3U7DA 3ZNID 4II3B 3SHQA 5E6JA 4O3OA 3PX6A 2CHZA 3UI3A 3K9PB 1N48A 2MJDA 1YN5A 2O2VB 4TMAB 4UB6U 5KFDA 2ASLA 2GBNA 3SU8X 1TJEA 3D2NA 2JT4B 2V9WA 4JPSA 2EAOA 2ONQA 1ZE3D 5I4DA 3OSPA 2AXTU 3KUCB 4LJOB 4FN2A 9ICAA 4NQLB 4PS7A 1CUKA 3PR4A 2AGPA 2BCQA 2K25A 2ZIWB 3AECB 7ICHA 2MRLA 3VUWA 1IGDA 7ICRA 3PX4A 1QQ6A 5DDYA 5J2GA 3M63B 3E56A 1WE7A 1GUAB 5ALGA 4C8NA 1R4MB 2LFIA 4LJPB 4UAVA 2DNFA 2D6FC 3TQ1A 1DGSA 2AGOA 3HHMA 4ICUA 4IOIE 1WWUA 5HHIA 4E0DA 2F2AB 2KDFB 3V05A 3IAS1 2D5GA 3UINB 1ZJNA 3PZ7A 1VZ6A 1FEZA 3H1UA 5JHAA 2MLBA 1I4HA 1T7PA 4W9EA 2ZTEA 3IM1A 1EF5A 3ISBA 5AI6A 3GV8B 1FIQA 4QJFB 2CHWA 2G1EA 3NZUA 2DYBA 3R66C 2C28A 1TZ1A 2XBBC 2ZW1A 4IRDA 1RQNA 1PUTA 1J97A 2R8IA 1YT3A 4J03A 4LNFA 1OQQA 1TY2A 2H3ZA 3R7QA 2MBEA 1O08A 3LWLA 3D6JA 4US9A 4O5CA 3TFRA 5AEKB 4I2HA 2NPTB 3AE4B 4YXMA 5KFZA 1UH6A 3ZNZB 1L7MA 2I1KA 2M17A 1NK0A 1IGCA 5TR5A 1GB1A 1SXDA 3HWTA 2FIDA 8ICTA 2DBYA 4Z6CA 4WJ3B 1V81A 3HVZA 2NRZA 4REZA 5LNK1 3A1QA 1BPEA 3ZDEA 2WTFA 1ZQMA 4W9JA 1L5PA 2A4ZA 5D7GA 2XCPA 4Y2VA 2JPHA 2FMPA 2MHJA 3MJ5A 2HJ1A 2D8CA 1NK4A 5DB8A 3NRWA 1QQ5A 5DB9A 2W3RA 3N7SC 3PW4A 2MBQA 4TQRA 1ZQAA 3ZDAA 9ICMA 2DKXA 3N20C 2PI4A 4GN1A 3RJIA 3HJEA 4JV1A 1KH0A 4YSXB 4GC7A 5IIMA 4L2YA 2PJHA 4FHJA 3P63A 3CWIA 3QJZA 4YD1A 4JQWC 4Q2JA 2D3DA 9ICCA 5DB7A 4RQ4A 1RDFA 2MH7A 4I2BA 1PFDA 4Y2TA 4NJCA 3WK6A 2ZXIA 2BDUA 1E8WA 2G07A 2KX0A 3SV4A 1TZOA 2KHWB 3W2DA 5IIJA 3IT4B 3SYZA 4EEWA 4B9MA 1VZ8A 5HHDG 1I4RA 2WF7A 1PDXA 2KC1A 1J2NA 4YVZA 2VA3A 2WF5A 1GOZA 8ICCA 2EH9A 2W7PA 4ZRJA 3DCGA 2KP7A 5BYRA 4IUMB 1MC8A 1T94A 3SI8A 2KHQA 2R8KA 5KFIA 3VRBB 5CHVC 4TQ0A 4EZKA 3Q8LA 4C8OA 3KUDB 2BDPA 2KFKA 3RZFA 4BKGA 1XLNA 2BT6A 1JWMD 3RNFC 2K60A 2W9MA 2G09A 4PL2A 1NK8A 5AICA 1HEZE 2WXHA 1UCVA 2KN5A 4NAWB 1L8LA 5AI4A 1N60A 2I38A 4US8A 1P3QU 2JHDA 1XLQA 4Y2JA 1Y56A 1RYUA 2W8KA 3AB5A 5HMLA 3J81j 4NY8A 8ICWA 2BTEA 3TIXA 1AARA 4O5KA 4FZMA 4M6WA 9ICOA 1Z1VA 2DHZA 4CQNA 1GC6A 4KKJA 3EFCA 5HP4A 7ICSA 4NNJB 1NK5A 4GOCA 2KVRA 2XEWA 3VXWA 1V38A 4MJSA 3ALRA 1WGGA 2OEHA 2JF5A 5G5HA 3RFAA 4ED1A 4IR9A 1ZQVA 3VQIA 2G3QB 2QARB 1J7BA 4U7CA 4HAIA 4HPPA 1B0XA 2BS4B 3OG5A 4EBEA 4UB2A 2BB5A 4KGSA 2KJ5A 2DQNB 2FE8A 3H8SA 1DK3A 2BCRA 3PV1A 4NLNA 1L7NA 3QCAA 8ICEA 3BWUD 2M19A 5KT6A 4M9HA 3AN1A 4ED7A 3JSVA 3LDZE 3PSEB 5KFVA 2YMLA 2JQRB 2NRTA 4MM3B 1WM3A 2QJLA 4GIBA 5DDMA 4C4TA 3QK0A 4P4OA 1UF0A 3VR9B 4AS1A 5DLFA 1I4QA 2ZIUB 3GZNI 3APDA 4YFKA 4I2EA 3QIJA 1ZQ1C 4RNOA 5DG7A 2IGGA 3N1YC 1PK1B 1N5XA 2HHVA 1EM7A 3AH7A 1LGRA 2Z59B 1SKSA 3DBRI 1QT9A 4IQWA 2OJWA 1BT0A 3VRAB 2C9WB 4OZCA 4ED0A 2IOFK 3NVWA 5KFJA 4DL7A 3EWAA 1V6EA 2RDHA 4OJ6A 2V4QA 1DOIA 2ACZB 5DB6A 2K5PA 4WWPA 3NY5A 2ZJAA 4C80A 9ICUA 2YB4A 1SF0A 1NYQA 2KWCA 4KDIC 3B2FA 4RCOA 4PHPA 3MABA 4RZRA 2K9XA 2Z7JA 3NASA 4C8MA 5IP4D 4C8KA 2DGZA 1WMHA 3VR8B 2FAZA 2N9KA 4KLOA 4CO7A 2KZ3A 2LXCA 3PRMB 1M94A 4R63A 5D49A 3CRXA 4BZAA 1FXTB 3H7SA 2CJOA 1EWCA 4K1RB 4QZGA 3KQ4A 2O2VA 4LZDA 3A9KB 4GDLB 3RD2A 1DOYA 3TFSA 4QZCA 2KMAA 3ZD8A 8ICSA 4EEKA 5KFYA 4EKUA 2BZFA 3TADA 1GC7A 3RR7A 1ZQUA 1OQRA 1ZOYB 3DHIC 4KX6B 2IO2B 2KO3A 2QLTA 2WDQB 3QAQA 3MP9A 4P0PB 3AE7B 3RBEA 3ZTCA 1SGHA 1KW4A 5CEHA 3QQ8B 5EE0A 5J0RA 1F52A 1WGHA 1WX7A 5KFBA 4W9GA 4PZNA 7ICFA 1TKYA 3TEZA 2JEGA 3JPQA 1DYQA 5KHQA 3PMNA 4X57B 4XX5A 4LZGA 2MP2B 3EGRA 1SV4A 3W1SA 2J6SA 3N28A 3VC8A 5KG2A 1KKXA 4G3IA 1RG6A 3OJUA 3C1YA 1P1AA 4YG2A 1SGGA 1V85A 4URKA 3ZDDA 3VH3B 4HPMB 3DVNU 5KG4A 3A0HU 2D3CA 2C60A 1NZBA 4MF8A 9ICIA 1V9PA 1NENB 3APFA 2BPSA 2YVCA 3KWLA 3SAHA 5DKWA 4ELVA 5AI8A 3B08A 1AW7A 4ARIA 2INNE 4RPZA 2LMCA 1MI0A 2W3SA 2LEKA 2LVQA 3H6NA 1QCKA 2BPFA 2ZNVC 2WXLA 4DEZA 2IY0B 5ALLA 4YT0B 2HBMA 2ZTCA 5AKJA 1NJXA 1X6JA 4BXOB 3WA0A 1LV5A 3WIMA 3PVLA 3ZI4A 3Q8EA 1JN3A 5AIBA 4YTNB 4PT5A 5ALQA 4ZH4A 1KBUA 3RNCC 2FDRA 2E1EA 4KTQA 1FMAD 1FXAA 2KDIA 3NZSA 3VFKA 4GLXA 2KEYA 2QMTA 1D5ZC 1TAQA 2GMIC 4Y2UA 4MT5A 4NQKE 4A90A 4KN7A 2M0AA 2Y1JA 2L5YA 4PGQA 4AOFA 5EE3A 3RJGA 3N7PD 2HSZA 3WAMA 3ZW3A 1QSSA 3RB0A 4QZAA 5L1KA 1GAQB 5HNKA 1ZUD2 2HMXA 2P66A 4F8RA 1FNUA 3HM6X 4M00A 5J18A 2FLLA 4DSFA 9ICTA 3BYTB 1MG4A 2G5HB 5ALZA 2GBMA 4BUGA 1I7HA 3H40A 3QX7A 2EMTA 4IS7A 4Y2SA 5DBCA 1RM6C 4R3DA 3KKAA 1D8BA 5KAIU 2GB1A 5ALYA 3K9OB 1QQ7A 3Q8SB 2AQ4A 4IQUA 1LFDA 4FULA 4BOSC 3W1SC 4E74A 1CEZA 1WJUA 1T4GA 3QU2A 2WS3B 3GU3A 3L10B 3P2BA 5DQIA 1Q3VA 4LNIA 4JV0A 4LTUA 3FYHA 7ICLA 5JHBA 4MELA 2FPMA 3KZXA 3Q8FA 5KG1A 1S3SG 1VCBA 3GDXA 3AE3B 3GOEA 3C2LA 2ASQA 4RNAA 1NZPA 2Q4TA 3QC8B 1UGMA 2XGPA 1PK3A 1KOTA 2G4SA 3H8JA 4IKGA 2F3NA 5L1IA 2MEKA 2L83A 2GH1A 3IRUA 1NJYA 1SSNA 5KFAA 3KZIU 4YMNA 1OGWA 1QZEA 3AEEB 3M3JA 3HUIA 4KLGA 1WUDA 3PR5B 4RMAA 3A0BU 1JMLA 2Y3AA 1N62A 1H4RA 8ICHA 4P1CC 4O9MA 2W03A 3VCBA 5J2FA 8ICXA 3AQFA 3AEAB 3UIPB 2KOBA 2WXKA 2HTHA 2BHNA 4YP3A 4G50A 4GIVA 2JRHA 1QLBB 5AUIA 3Q8QB 1L6UA 2AQ1B 2KN4A 3IN5A 2BQ3A 2KFJA 4KX5A 3RN9C 3U4EG 4IWPA 2I2YA 4HCNB 2HD5B 4GB9A 3L4PA 4B9TA 1B4FA 2OEDA 3P4QB 4YQWA 2UWQA 3I9V1 2WXFA 4F2SA 3PHWB 1RWSA 4EOYA 1PVQA 2FCNA 3MC8A 5KG3A 2FPKA 2NRVA 2LGIA 4WJNA 3JPRA 1SV0C 3V3XA 3LB8C 5AZFA 3UXOA 2HHQA 3AULA 1RZTA 5TISU 3BINA 3UMGA 1ACCA 2YX8A 1TS5A 3Q3FA 3KKAC 3DQVA 3PSFA 3DHGC 2WWZA 1C1YB 3HPOA 4F5NA 1WM2A 3EPIA 2PE9A 3IT6B 5ALNA 4WJOA 4UQGA 4N6EB 2RHFA 5CX3A 5DPSA 3DWMA 1S97A 2ZZPB 8ICYA 4K7UA 1OQYA 2JMGA 4B95A 1NOMA 4EBDA 1VR9A 2L3ZA 2KDEB 1Z19A 4R66A 3T3OA 2WXGA 2WX1A 3UQ2A 2BKRB 4LJXA 1JROA 3V72A 1WI0A 2M9NA 1PVPA 1URJA 1SKWA 5KG5A 1XF5L 2VJ4A 3W1YA 1ZQDA 1F77A 3IV6A 1I4XA 2JGAA 1KF6B 4B6WA 1ZQHA 4YSZB 3PW2A 4RQMA 4DOBA 5KFNA 1XT9B 4KLTA 2WFAA 1CQVA 2ICIA 1T0SC 3TEXA 3OPXA 7ICIA 1BGXT 3BQ1A 2K3UA 4ZHPA 5J2IA 4CGZA 1BNPA 4HLEA 5CA7A 1F9JA 1L7PA 2ZVOA 4WWOA 2BCSA 2ZTDA 3ZJUA 2HOIA 1C9FA 4O1NA 4JLCA 4PJ0U 4JIOU 2K89A 3IG8A 2EQYA 1NK7A 4B9SA 4R8UA 3I63C 3V6EB 2KLCA 5LLIA 4YR3A 3NUHB 2NS5A 5ALJA 2G06A 1UT5A 1RAXA 2KFKB 4AP4C 3MBYA 3B0AA 1HZ5A 1NKBA 3R3MA 4NJ7A 2W9AA 4HJKA 4P0PA 8ICAA 1K51A 1MA7A 4JE3B 4KZCA 5EE9A 3KHHA 3OLMD 3AV8A 4UAYA 2JYTA 2Y5BB 3OGUA 4YL8A 1Z2MA 4W9FA 1ED1A 2KT7A 1JIHA 1HUOA 2G5IB 1C76A 1VJ5A 5KL1B 2D3GA 3MTNB 4I2JA 5FKAC 5G2NA 2AEHA 4H2AA 2CXYA 2GBRA 2A1JB 4OJPA 3G6XA 2BYEA 2HE7A 3H0LB 2IA6A 2HI0A 1FRDA 1UBQA 1YX6B 2MP2A 2R2OA 2KZRA 2JZPA 2BQUA 4TQSA 1OUQA 1ZP0B 4M8NA 1JWUD 1C3TA 3G6VA 4KDLB 4F71A 4MJSB 1L3VA 2F1HA 2JEJA 2AYOB 2LM1A 1YQ3B 5D3IB 3MC0B 5CR0A 3F5AA 1UWMA 3RPFC 1WYWB 4ECSA 2LI5A 1J2MA 2KN7A 3GE3C 2CPRA 4BKSA 5KFQA 1K8RB 5FR6A 1L6NA 1ZQGA 1WGYA 4F50A 4HCPB 3TKAA 4DSIA 4DHZB 7ICUA 4Y2RA 2ISPA 4KLIA 4O3SA 3AEFB 4FE3A 3JSVB 3DBHI 4G0NB 2FCQA 4EX7A 2KHVA 3IDWA 7ICQA 1UHUA 3PY8A 4TSSA 3HIZA 3C2MA 4WQMA 2UVRA 2JYEA 4QZEA 5KFSA 1PGXA 2J0JA 2LGYA 4ELTA 1V2YA 4OVZA 1ZQFA 2X8XX 2O6KA 3ZQ4A 5KFHA 3GE8C 3OJ4B 2KVSA 2BB6A 3B0XA 3ZJVA 2JEFA 4ZDVA 3AM9A 2LXAA 4DXGA 3Q3JA 3NVZA 2LKYA 2ZUDA 2LJ5A 2KANA 1EF1A 3N32A 4GSWA 3MGVA 3GB1A 1ZQYA 2KSOA 3LWMA 3CMMB 4ANWA 3ENEA 2EZXA 3UGBB 3ZRFA 1U48A 5EE1A 4ECYA 2R8GA 2J6UA 4MFAA 1ENFA 2Z0DB 4DCCA 3F2BA 2J7QB 1XU4A 4EENA 2NTSA 3WAPA 2C7MB 2WAQF 3O0FA 4FS2A 2V3PA 3AL0B 1I4PA 4ZRQA 5JU5A 2FNJB 2KAJA 3RULA 1I4GA 2BF8B 1SE2A 1Q46A 1E10A 1OEYJ 1OEYA 1B9RA 2K8CA 2R8HA 3HX0A 1WMHB 1AROP 5F9LA 2ZNVB 3ISCA 2LWPA 1NI2A 4A3OA 5HFYA 2BKEA 3EPGA 1BUIC 1Z00B 1CK1A 1SZPA 4NWIA 2JSVX 4RM8A 4MEMA 1S9FA 2H5XA 4DLEA 3QUQA 1TS3A 4YSYB 1D8YA 5EWGA 3QNMA 1B22A 3EYZA 3BK1A 2OM6A 3T5JA 2FMQA 4PHAA 4UDUC 3DVNV 2MU2A 2Z8LA 1U45A 3C8YA 4NM2A 2VZKB 5CTRC 3ZDBA 2M56B 2JXJA 1TK0A 3EUB2 2PMZF 2JWUA 5L9XA 2I6XA 4NY0A 2KTFA 1WX8A 5DQHA 2PKOA 1GB4A 1I42A 4K7WA 1MHHE 4M0WA 4F8CB 2WYQA 2EELA 5EOZA 2JRIB 5MPOA 1R4NB 4GFJA 3MC1A 2RDBC 2CR5A 4CYEA 2J4XA 4KLSA 4EELA 4W9DA 2GOLA 3R8BA 2D07B 1A76A 1RYSA 2W11A 4MH0E 2V0GA 2E1FA 3T3FA 4IDIA 2L7RA 2VH1A 1PVRA 3RJHA 4AP9A 4YXJA 9ICVA 2W55A 1D6EC 1TE2A 2VIXA 1NYRA 5AKXA 2W9NA 1E8ZA 4ITKA 4RF0A 3PW0A 2JH7A 2ZG6A 3OAWA 4W9HA 4UAUA 4P2HA 1TBEA 1ZQEA 5BMIA 2WXMA 2WHEA 4ED8A 4DFKA 1E90A 2KACA 3D2QA 4J9LA 3NHEB 2K39A 1D4BA 4KLDA 2WB1F 4CDGA 4DF4A 2VH2A 5AKIA 2GO7A 1E0ZA 3DHHC 4F5OA 2QCZA 4I6PA 1WGDA 2PTLA 4KX3A 1YOVB 3EA6A 5KFTA 2ZJ5A 3P42A 2ZEQA 7ICTA 5GXGB 5AM2A 2J6TA 3NGDA 3NTUA 1WSPA 4RQ0A 4RH6A 2H3FA 3VTWA 1A5RA 9ICNA 2OXOA 3SAGA 4MGKE 3IHQB 2WP9B 5C3JB 3T5LA 4YTMB 1TK5A 1E9MA 2B6GA 4XUSA 1K1QA 1Z4OA 4DS5A 1NK6A 2G9HD 3MC9A 1N63A 2LYBA 4GLSC 1LVHA 3M1YA 2KFNA 4DFMA 2DLBA 2JEIA 5T14A 1HXYD 4F5RA 2DZJA 1WWVA 2AQ2B 2F1JA 5ALFA 4ICVA 5CP2A 4FXCA 1YIWA 2O6VB 3I76A 4KV2A 1SIFA 1TS4A 1R7SA 2RDGA 1HJPA 1V9JA 2Y0SF 1PYWD 5IA7A 2WXPA 2Z0EB 2OCEA 2GBJA 4ARCA 2R18A 5ALEA 3PGEA 3PS6A 3H8MA 4NZLB 2FPLA 1JCKB 4FBUA 1LXDA 2YQEA 1YZ7A 4JGHB 5ALUA 2IO3B 1SE9A 3F2CA 4P4MA 1ZETA 3NG0A 2EANA 5KT3A 3Q3MC 3N1XC 4OZBA 2NBVB 3M62B 3HKZF 1B43A 2HVHA 2PVGC 3C5GA 3M6KA 1ZRMA 1YN3A 3ML8A 3H0RB 2ZIVB 1XEEA 3GZFA 2K4IA 3TL5A 8ICVA 2CRXA 5E79U 1SL0A 1IG6A 3THVA 5J0UA 2MX2A 1BPDA 4M02A 2N0SB 2MA1A 5AHXA 3TAPA 4FJYA 1ZQBA 4PGYA 3ZXRA 2A1JA 2N7EA 2ZPYA 1AQ6A 3KH0A 3M9OB 3K1RB 3ED5A 5IINA 2FMSA 5J0XA 9ICHA 4KLJA 3EW9A 5L1JA 1V1OA 4FLHA 3EZ5A 4Y2YA 4B9VA 4MGZE 5B66U 1ET6A 3B0YA 3KHLA 4KLEA 4PK1A 4IRKA 3WK4A 3QA8A 3TEYA 5JH5C 5K4LA 1X40A 3Q8CA 2KD0A 4DHZE 1RFAA 3SFEB 2LGXA 2CN1A 5B5EU 4C7ZA 3PHXB 5BO4B 3SD7A 2HTME 1KLUD 1F1HA 1EO6A 3UMBA 5J0TA 3OHBA 4IWOA 3PMLA 2KQ4X 2XVTA 4JMUA 3PZ8A 1FNWA 1MJDA 1TKGA 1S8OA 4F93B 1JXLA 2TSSA 3V6JA 1XO1A 4EZJA 5KT4A 1HE8A 3U2SC 4UAWA 4F4ZA 2E8PA 1KEJA 2K4EA 2YMPA 4O3NA 1NJWA 1NK9A 4KLFA 1WXVA 4NLKA 4LDTB 4EYHB 3MFGA 3C23A 2N9XA 4RPXA 2LHDA 3U52E 4IC9A 3QUCA 5GMVA 3OJ3A 2IO1B 3IG5A 3BS5B 1SL1A 1ZQXA 2D3BA 5ALMA 3IHPC 4OVVA 3I57A 2JRZA 2BWES 1MG8A 3M95A 4J9OA 3P4PB 3ETLA 1VZ7A 4GDKA 3RYTA 5ALXA 4B9KA 4CNQA 3ZYYX 4DHJB 1WE6A 1XSPA 5EDSA 3BJYA 1BPXA 1D9DA 2PLPA 2NO5A 2FUG1 3K1ZA 3JYUA 1MPEA 5J2CA 4HK2A 4P16A 3WK7A 4NXZA 2A3VA 3DVGY 1V5TA 4JB3A 3R2IA 2EDUA 5H2FU 3LK9A 2XY6A 1Z00A 3MJWA 2KD1A 2KJHB 2XK5B 4R8UB 4HEA1 1P7EA 3PX0A 3S6JA 5L1MA 2X38A 4P0QA 3N4MB 1RXWA 4TUQA 4WURA 2P35A 3WALA 4ICAA 3ZTDA 3ZGZA 4CHKA 1HQRD 4OCZA 4F5QA 1FPYA 2D2QA 1WGKA 2FIFA 5AK5A 5HMMA 1XSLA 2FCSA 4GU2A 4I28A 5C0YA 2W9CA 2K0PA 4FZNA 2PPHA 4G3XB 2HW3A 2KKCA 4L1BA 4M9LA 1TAUA 1JUDA 1YX5B 2A1AA 1YJIA 3E2EA 2N7DA 2DL0A 4QWDA 4R64A 1K1SA 1AWDA 3OTQA 4F92B 3GP7A 2E8MA 1FFVA 2IPKD 2W43A 4E3CA 8ICPA 1XC9A 1T0YA 3P4SB 1J7AA 3T5KA 4W9CA 4C8LA 1AN8A 2E6XA 4WIPA 4J9RA 2G0AA 2ZPNA 3ZO5B 1ZQCA 2N9PC 8ICBA 4YCXA 2JZZA 2NYVA 2DPIA 2A5UA 5AUKA 4NLCA 4GXBA 4IM3A 1WGRA 5CJ7A 2KZMA 1B1ZA 4IC7B 1V80A 2JR5A 2DZMA 3TI0A 4G9BA 1S10A 3L13A 1N61A 1ZD3A 1D3ZA 3JPSA 2MAXA 3H4BA 4PGXA 2N4FA 3NJTA 2WHIA 2WXOA 2AH5A 4DL2A 2LGSA 3I1YA 1FFUA 3Q14C 1TAMA 2NMQA 1XWLA 2KVCA 4K81A 8ICKA 1X1MA 2V4IB 2KTQA 1COOA 3DOWA 3L54A 1TFRA 4Q44A 4MEYA 5ALHA 2QEJC 2IO0B 4WWNA 1TIFA 1V5OA 3CW2C 1XXGA 2ODGA 2HOFA 2ZJ8A 4F4KA 3BIID 4KSKC 2NO4A 1L4ZB 3AE6B 4LNNA 4ECVA 8ICIA 1V86A 3BZDB 4ECZA 2DAFA 4ANUA 4DS4A 4WQOB 4ASWC 8ICQA 2L52A 1WYGA 4O3RA 2KSOB 3V6CB 3RJFA 1H38A 1JW9D 3MDCA 1MSWD 1L6VA 2K8BA 2KQSA 5IN7A 1ZQKA 1WZ3A 3JVZX 3N97B 4BAXA 4O3PA 4YXDB 2WF6A 4LVSA 4QWBA 2KJ6A 4K3CA 2OHFA 3RB6A 4MSQB 3HVDA 4A8EA 1QQRA 3SR6A 1IXRA 3ONNA 2O6VA 2K8CB 2YB1A 5IIKA 2SEBD 4B9LA 1SV0A 4HXDA 2V3NA 5J2RA 1X9WA 1UUPA 4IM0A 4I29A 2M1MA 4FZLA 5J29A 1FCCC 2RP5A 1LM8B 1XCQL 5J8YA 4ECTA 3C0RB 3CIRB 5KFPA 3W5UB 1V1PA 4A20A 1Q3UA 5AM3A 3TAQA 5IOIA 2XICA 5DPTA 3O65B 2C2DA 5H8YE 4D2KA 4ACOA 5C5JA 2QSDA 3PTFC 3TCAA 3X23A 2LHEA 2H88B 4ED6A 3RRGA 2UYZB 2K8AA 4CF5A 3K4GA 5CHGA 2OH2A 3MHZA 1IV8A 2YEPF 3AQEA 4WH4A 4OO1J 3BVZA 3KTQA 2QC8A 4PZOA 1XSNA 3NZ3A 1X9XA 3JPOA 3PO5A 1SE4A 4IWQA 3RCZA 2ZIVA 2F8LA 4K4IA 2BKFA 3T8MA 3ISDA 2GI9A 5AM0A 5E6NA 2J42A 2QIEB 2K6QA 4ZRPA 9ICXA 1LB2B 4FJVB 4HKZE 1FRRA 3CP8A 4EEYA 5KFKA 4DLGA 4C4VA 4J3OD 2I9GA 4M0WB 1ROEA 4S0RA 3AU5A 4HPLB 3AE8B 1TVAA 4M8MA 2CHXA 3TSSA 5J0QA 3FILA 4YR2A 3PSPA 8ICFA 3C2KA 9ICEA 7ICVA 5BYQA 4I2IA 3A4RA 1L7YA 4BBNC 1OTRB 2BCVA 1JQ4A 4KGTA 2WAQC 1R4MI 3QUTA 3G6YA 3GIMA 3H4DA 2F1IA 1EU4A 2INPE 3TEWA 5KT7A 5AZGA 4W9KA 2IBKA 1UNSA 4PS8A 3EC8A 3L08A 4DL3A 1IBXB 3HM3A 2JY6A 1UPHA 2RR9A 3QE9Y 4ZOHC 2RLTA 4QZ8A 2BQRA 1FO4A 5FK9C 3V6HA 2WF8A 2KTRA 2MJEA 3R9KA 3WKAA 2ZXHA 4F72A 5KG6A 2WDRB 3Q3NC 3H9DA 1HTQA 3HT3A 1Y88A 3F5EA 3ORYA 2UVVA 1IYFA 1JMSA 1WH3A 4B9UA 4NPNA 5J8YC 8ICLA 5KFFA 2Q5WD 1MFWA 1L2NA 5KFGA 2KDBA 5L1LA 1HZ6A 2OOBB 1SXEA 4CF4A 4KLQA 4YTPB 4W9LA 4YD2A 3ZRCA 3UQ0A 2N1VA 3GZNB 2BYVE 2WGSA 3BS5A 4G11A 3PW7A 1KFTA 3UXPA 3JPTA 2PMZC 1ZQLA 4S17A 2HBJA 3DBRB 5IO9A 2RDIA 5BPCA 1ZQTA 4ANVA 5E6PA 5AM4A 3IVFA 1ZQQA 2ASJA 8ICUA 4Q8FA 5DG9A 2HCFA 2RGFA 2C7HA 3IFWB 4RQNA 1KLVA 4MGIE 2CJNA 1NJZA 3AE2B 4FBJB 1UGJA 5TSSA 4HYKA 5L83A 2WDVB 4DO9A 1HTOA 1Z4NA 3URYA 4AYBF 3A33B 5JRTA 2PMVA 1WCNA 2L32A 4BVUC 2PFQA 3RMKC 3GFKB 5J2KA 2HHSA 3DBLI 1ISNA 7ICNA 2XK5A 3BK2A 2KWUB 3RI7C 4F2RA 1PZNA 1SXTA 1QSLA 4YWGG 4EE2A 2PE6B 4RGNA 1OFFA 5AM5A 1TS2A 1M6YA 1VDVA 2MBBB 5ALRA 3E9SA 4MEXA 1WFYA 2GLEA 2LRUA 2I1JA 4M01A 1P0RA 3AE1B 1F0ZA 4Q45A 4PH5A 2KJ8A 1DOXA 2LI6A 4P7IA 4I6NB 3L3FX 5J2HA 4DXFA 3AMZA 2EMSA 2KDMA 4Z6DA 5DQGA 4ELUA 1J7CA 1L4DB 1Q1OA 1WXMA 3RUIB 3DDHA 3SENA 5BOLA 1X9MA 3H7PA 1P9DU 4EZLA 4QZFA 2K22A 1RFKA 3QU9A 3L16A 2BPGA 4RPYA 1PGAA 3CSFA 4Y2QA 2D3AA 1J0GA 4FHKA 1LQBA 1F2RI 4MSMB 4AJWA 4JK1A 4MGYE 4ED3A 1S0NA 3BDPA 5J0SA 3FC4A 1X9SA 4ED2A 1NEKB 4Q8EA 1K5OA 1ZOLA 3H7IA 3A4SC 1JI7A 1CI4A 3AXCA 3PPAA 4P1BC 3T9LA 1KQQA 2R61A 3TARA 4CE6A 2VKQA 4W9IA 3WAOA 1UELA 2JVCA 4OJOA 2PVOD 3Q8RB 3M9MB 1MVKA 1Z5SB 2IBIB 2IYDB 2WLBA 3KYDD 2IGHA 3PSIA 3APCA 5EWEA 4RGMA 4HRSA 2LPEA 1FM0D 2ATLA 3MFHA 4UB1A 3OWEB 2BVCA 1D5XC 4QIWF 3U26A 5J2BA 5D2MB 3NVYA 5DGBA 4LLGM 4KSLC 2L0TA 1L3TA 5KFWA 4BWMA 1KN5A 4QNLA 1N56A 3KLSX 2XC9A 4HROA 5JZEB 5J0YA 4FBTA 1C4PA 3PVXA 4DQRA 1QOBA 3AEBB 2YMMA 3DV9A 3MR6A 1KSPA 1AYFA 3M8RA 3HKZC 4TUUA 4MF2A 3VUXA 5KHOA 4HJGE 3V60A 2F77X 3I5JC 5J2EA 2D10A 3SQIA 5ALKA 9ICWA 4KKIA 3SEBA 1UD7A 4XRHA 4NLBA 1M4VA 3ML9A 4RUCA 2XN9C 4L23A 5HI1A 2JXXA 4O0IA 3DBSA 3AEVA 1WX9A 4RUAA 2B21A 2RSUA 4GDKB 3D32A 3GS2A 4UB5A 3E58A 5AI5A 3GQCA 1WXQA 4GXIA 5DCNA 1A77A 3HW8A 8ICMA 1XS9D 1YJ1A 4XZ4A 2BQQA 4NLZA 3MGHA 2RRDA 3UXNA 2C2RA 4UB4A 2EAMA 1N2XA 2XI9A 2OWOA 1HIWA 5GTHU 2PFPA 2N9LA 1SJED 5J2DA 2VJ5A 2E3TA 3VUYA 3B2GA 2J52A 4UBCA 2K1FA 1FEHA 1KFDA 4OJLA 4QZHA 4DOCA 1PUZA 2PW9A 3LYYA 3AEGB 4DXAB 5IIOA 2WXIA 5DLGA 5J2AA 1N5WA 1QF6A 1ZPSA 4P0QB 1KLNA 2PEAA 2BPCA 5LXIB 2DF4B 1RYRA 1MHXA 4Q43A 1JWBD 2PFOA 4DOAA 1X66A 2PXIA 2CU1A 4IR1A 3H8WA 2W9CB 4R65A 3KBBA 1ZQRA 2DENB 2GOWA 5AKGA 4UARA 3WK8A 3GV5B 2XY5A 2XGQA 4KMUA 3V62A 3M7DA 1WXAA 3FM9A 1J19A 4I2GA 5IAAC 1YQBA 5KT2A 4TV3A 3R2TA 1ZQWA 4YR0A 9ICBA 4UASA 4J6IA 1CZPA 1SWVA 4ZRIA 5AZHA 2KMDA 1ZD4A 2E8NA 1ZQIA 2MA9B 4PL1A 2AL3A 3ZDCA 1V8CA 1ZYQA 2ZCCA 4P4PA 5AKHA 4XYCA 2ZIXA 2JX5A 3NS8A 1YQ4B 3ZKJC 4LCDE 3QU5A 2KZZA 4FO6A 1D9FA 1QSYA 3GIKA 1YNTE 3LJ3A 2VA8A 1TTNA 2KX3A 4GC6A 4NJ8A 2WXRA 9ICGA 1SZHA 3IAM1 4N58A 1TV9A 4AUQC 1IBXA 4XGAB 2K6DB 2RPQA 4BGDA 4XDDA 3ZXVA 4F7ZA 3AE9B 1F44A 3TJPA 4JWSC 5KFXA 1TKEA 3AEDB 2RD0A 5F3XB 2LZ6A 4QAYA 2AGQA 3QZ8A 4RQ1A 2AL6A 4PS3A 1VD2A 9ICFA 3QXGA 1UWXA 3X0WA 3LXFA 1IIPA 4TQ1A 4BX9C 4FS1A 3U8ZA 4AQ7A 2WXQA 3NUQA 1X42A 3BZKA 1ECWA 4F4XA 2OYYA 5D46A 5KFRA 1TK8A 1YJJA 4CCHA 3A9JB 2CU3A 3QX1A 4UB8U 5KFLA 3WANA 1MN8A 4C00A 3BY4B 4BDPA 1V49A 2IHMA 3QARA 1IPGA 4XA5A 2B76B 3PZDA 2JWZA 1G6JA 4DQIA 4RQ5A 3V6KA 3L5KA 2K8BB 5A0LA 1UA0A 4MH8A 2HBLA 4B0EA 3QEBZ 3Q8PB 4J9KA 2K4HA 4EFOA 1CMXB 2YTUA 4OW0A 4QZDA 4LNOA 4N59A 1WZ0A 1J8CA 4RQ6A 8ICJA 1ZQNA 2IGDA 4F5PA 3RTVA 2KG5A 3ZNHB 4RQ3A 1BNOA 1T3QA 1L5UA 2ESEA 4UATA 1IP9A 2IOHA 8ICNA 2N1WA 1C77A 4LNKA 3HK0A 3D2SA 3F53A 3MR3A 1NVID 9ICLA 1V1PB 2N1RA 4UW9A 4RQ7A 4Y2PA 3RH6A 3O13A 1QILA 1MQ2A 1EU3A 1KLGD 2E5SA 3WU2U 2ZVNA 2HHTA 2LUEA 3S2AA 3DBLB 2MUTB 4PYZA 2KIVA 1WF9A 5KAFU 4F3OA 4U6PA 4DFPA 2GWSA 5JXVA 4RFBA 1NKCA 4PYUA 1ET9A 4O3QA 3JW0X 2C7NB 2W9BB 4JUZA 1VJKA 2MSED 4X5VA 3WKEA 2GLSA 4EYIB 2D11A 2BS2B 2AJQA 4IW0A 4KLLA 1Z3EB 2RDJA 3QYPA 3MDAA 2FBWB 4NL9A 1BXTA 1JXEA 7ICPA 2KICA 3FAHA 3SDLC 2BW2A 1F5SA 4WAFA 4RNMA 5JTIA 3JPPA 1T0RC 4HKQA 1WXSA 2LD9A 2PIAA 3KYCD 2H3VA 4C4VB 2R2QA 1H8CA 4EZ6A 3VH4B 2OJRA 2ZCBA 3QU4A 3FILB 4DDGD 2IOFA 2BGWA 5GTIU 2AU0A 1S5LU 3RAQA 1DRGA 1FNVA 4QZ9A 1S0OA 4KLUA 2RMMA 4DQPA 2ZUBA 5E6OA 1WWTA 2L1AA 3TMPB 3W5VB 3J9CA 1GNUA 2J53A 2MW5A 3AI5A 5AKYA 3GIJA 2F8KA 2QB0A 1YN4A 1WJNA 1KRHA 2NR2A 5IILA 5ALIA 2INCC 4QZBA 1T0QC 1TT5B 5HKHA 1QKZA 9ICQA 4YMMA 3TBLD 1BPYA 1K50A 1WY8A 4A8XC 2GRIA 2V1YA 2M4NA 2KTRB 4WWMA 2WXJA 4FFDA 3FDSA 5HR6A 1Q10A 5D94A 1QTMA 4MFCA 2JXTA 4DF8A 2ZJDA 3RNBC 4Z6FA 3PNCA 3DBHB 2JUOA 1XCTL 4Z6EA 4DSLA 3BQTA 2KC2A 4ECWA 4II2B 3AUOA 4KN4A 2LVPA 2FI1A 4DK5A 1U4BA 3C21A 4J9QA 3N3KB 2PKEA 1L0XB 2HJ8A 2XNAC 1STEA 4UAZA 2KIWA 1KJTA 1CJEA 1SIJA 2RQ5A 3RRHA 1ZW7A 3ZVVA 1E6EB 3LVWA 3BVGA 1UZXB 1KL9A 2KLGA 1X2IA 1WR6E 2KV2A 3KHRA 1RYJA 4F91B 1Z1BA 1U47A 4KIKB 3AU2A 4PHDA 1QLNA 5DPWA 2B0CA 4QW8A 3C5FA 1RRBA 4LK0M 4KVGB 4M47A 5JUMA 2KK8A 3U30A 4A9AA 5ALTA 4JL9A 4NL9C 3IP4B 2WF9A 2HDOA 1S1QB 1LKYB 1XLPA 3N9YC 4EX6A 3SAFA 3PZPA 1JWAD 1FCLA 4IL6U 1KRPA 2PI5A 1XD3B 1HEKA 3ONSA 1UBIA 4ZYSA 2HHWA 3M8SA 9ICJA 2W8LA 4J9MA 1NBFC 2KMMA 2JZBB 4F4WA 2YLMA 3FKYA 4MACA 3ZDTA 4QZIA 4RQ2A 1MQ3A 4AWJA 1I35A 3K75D 5J0PA 3PSTA 2V4RA 3H0MB 3OJSA 2AX5A 2KWVB 2REXA 5AKLA 5D4BA 2YY6A 1ZXIA 4TURA 2Y9TA 4RGOS 2BBCA 4E71A 2UVUA 2LASA 3M9NB 3RR8A 2MWSB 3C1ZA 1IUEA 2NCNA 2YMQA 2VA2A 3KD3A 3BQ0A 1JRUA 1SEBD 2DAJA 1DXSA 4XWWA 3KHGA 4ECUA 2KE7A 1WIAA 1NKEA 2KFZA 4HVBA 3VAWA 1QH9A 1U49A 4CF3A 2HVIA 1JRPA 2HOQA 3MHSD 2AHOB 3LDAA 3BQ7A 1ZKHA 2IDYA 3OSNA 2WQYB 5AK4A 2NRXA 1P7DA 3RFZB 1SWWA 1SBBB 3H7PB 1T3NA 5FR3A 3RBDA 7ICJA 2MBHA 5CRXA 3C19A 3HILA 1EUVB 3RNAC 3ZJTA 3RNGC 1D5MC 1COKA 1C7YA
chains in the Genus database with same CATH topology
1PFDA 1NI3A 4NJCA 4ZOHC 3ZJVA 1FO4A 3AM9A 5FK9C 4DXGA 1TZOA 1L0VB 2MJEA 3NVZA 3W2DA 3IT4B 2WDRB 1VZ8A 1ZDXA 3GB1A 5HHDG 1I4RA 3B9JA 3HRDD 3AE5B 1PDXA 5EE1A 1GOZA 1ENFA 5BYRA 2Q5WD 2NTSA 2WNMA 2V3PA 4OHJA 4ZRQA 1HZ6A 1I4PA 2KAJA 4YTPB 2IJ0A 1I4GA 3VRBB 4TQ0A 1SE2A 4USAA 1E10A 1B9RA 1XLNA 1ZDVA 2BT6A 2VZKD 2Y5PA 5HFYA 1JWMD 4NAMA 1BUIC 1CK1A 1HEZE 2JSVX 2NTTA 1HA5A 2WU2B 2WXHA 4NAWB 1N60A 3P4RB 2I38A 4US8A 1TS3A 4YSYB 3NVVA 1XLQA 1Y56A 2CJNA 1ESFA 3AB5A 3AE2B 3BK1A 1E7PB 1UGJA 5TSSA 2WDVB 2BTEA 4UDUC 3ETRA 3URYA 2PMVA 1VRAB 2Z8LA 2L32A 4CQNA 3C8YA 4KKJA 2VZKB 3Q8AA 2M56B 3EUB2 2JWUA 5G5HA 4C56C 3BK2A 3VQIA 3T3NA 2PKOA 1GB4A 1SXTA 1J7BA 1MHHE 4YWGG 4RGNA 4EE2A 1OFFA 1TS2A 1VDVA 2BS4B 4M0WA 5G5GA 3E9SA 1T6BX 2BB5A 2EELA 4KGSA 1KFYB 2FE8A 3AE1B 1F0ZA 5MPOA 2J4XA 2DYOA 2M19A 3BWUD 1DOXA 3AN1A 3R8BA 4DXFA 3AMZA 2JQRB 4MM3B 2KDMA 2QJLA 1L4DB 1J7CA 2V0GA 4IDIA 2JU6X 1C4CA 3VR9B 4A55A 4AS1A 1ZXHA 1I4QA 1FD6A 2W55A 1D6EC 3PO0A 1NYRA 1RFKA 2K22A 4RF0A 2IGGA 4ITKA 4A6QA 1PGAA 1GPXA 1N5XA 3AH7A 1EM7A 1LO5D 2Y5CA 3IXSA 4XE0A 1QT9A 3VRAB 1F2RI 4OZCA 5BMIA 2WXMA 3NVWA 2KACA 3FC4A 1NEKB 2KWDA 2RDHA 1D4BA 1DOIA 2ACZB 2SAKA 2K5PA 2R61A 4C80A 1E0ZA 1SF0A 1NYQA 3B2FA 4RCOA 2PVOD 2PTLA 1MVKA 2WLBA 4RGMA 5BMHA 2IGHA 2K9XA 3EA6A 4HRSA 3P42A 5GXGB 1FM0D 4JX1C 3SFDB 3OWEB 3VR8B 1WSPA 4RH6A 1D5XC 2N9KA 3NVYA 2DWQA 4LLGM 5H92C 2WP9B 5C3JB 4YTMB 3KLSX 1E9MA 2G9HD 4HROA 5HG2A 1N63A 3NS1A 1EWCA 2CJOA 4GLSC 2DLBA 3KQ4A 1C4PA 1QOBA 1HXYD 3AEBB 4GDLB 1AYFA 1K52A 1DOYA 2AQ2B 4FXCA 4KGRA 4C7YA 4HJGE 1YMHE 1OQRA 1ZOYB 3KWVA 4KX6B 1QOAA 1TS4A 2WDQB 1R7SA 2RDGA 3MP9A 4KKIA 3SEBA 5BYSA 1PYWD 3AE7B 1M4VA 1QOFA 1SE3A 2WXPA 2XN9C 4L23A 5HI1A 4ARCA 5EE0A 4GDKB 3GS2A 4NZLB 1JCKB 4XWTA 1WXQA 2W54A 1TKYA 1TY0A 3TEZA 3TUOA 4OZBA 1DYQA 1C78A 1JWSD 1QOGA 3BYYB 2PVGC 3EGRA 3W1SA 2N9LA 1YN3A 2EKIA 1SJED 3Q8BA 1XEEA 2E3TA 3B2GA 2J52A 1FEHA 2PW9A 3LYYA 3AEGB 2W82A 2WXIA 1QF6A 1N5WA 1ZPSA 4RGTA 2N0SB 2RPVA 1NENB 1MHXA 1JWBD 3KWLA 4ARIA 1AW7A 3Q69A 2INNE 2LMCA 1V1OA 1MI0A 2W3SA 2LEKA 1ET6A 2DYMA 2YEPB 4XDCA 2MJ3A 2WXLA 4YT0B 3TEYA 1DGJA 3Q8CA 1T5XD 2LJIA 3R2TA 3Q8EA 2AQ3B 1F2RC 3SFEB 4YTNB 4PT5A 1CZPA 1TYGB 4C7ZA 1FMAD 1FXAA 2HTME 2QMTA 4MT5A 1D5ZC 1KLUD 3U7ZA 3H8HA 4A90A 1V8CA 2M0AA 1FXIA 1KTKA 2KQ4X 2JX5A 5EE3A 1YQ4B 3PZ8A 1BMLC 1FNWA 1L0YB 1TKGA 1GAQB 2TSSA 1JALA 1ZUD2 1YNTE 3U2SC 1XO3A 1FNUA 1EWYC 2WXRA 3MFGA 3IAM1 4N58A 2LHDA 3BYTB 3U52E 1IBXA 4XDDA 1I7HA 3AE9B 4JWSC 3AEDB 1TKEA 2H89B 3BVMA 2ON8A 1VLBA 1RM6C 4R3DA 1UWXA 3DWGC 3LXFA 3I57A 2N7JA 4TQ1A 4RF1A 2GB1A 2LUMA 4AQ7A 2WXQA 3P4PB 1VZ7A 5BMGA 3P1MA 2WS3B 3ZYYX 4ZHOA 4LTUA 1YJJA 3Q8FA 2PLPA 2CU3A 2FUG1 1XLOA 1MPEA 3AE3B 4RNAA 4P16A 2BS3B 1A70A 2B76B 4IKGA 3R2IA 4MH8A 2MEKA 2L83A 4B0EA 1SSNA 3AEEB 3WCQA 3HUIA 3NRZA 4OW0A 1PGBA 4HEA1 1P7EA 4N59A 1JMLA 2Y3AA 1N62A 2X38A 4WURA 3ZGZA 2IGDA 1HQRD 3AEAB 1T3QA 2WXKA 1C79A 1WGKA 1C77A 1QLBB 5AUIA 1SB3C 1NVID 1L6UA 2K0PA 1V1PB 2AQ1B 4P6VF 4L1BA 2KN4A 3O13A 3ABVB 1QILA 2ZW0A 3W9CB 1EU3A 3U4EG 1YJIA 1KLGD 2I2YA 1AWDA 5C2TB 3GP7A 4OZAA 3L4PA 1C4AA 1FFVA 2IPKD 2OEDA 3P4QB 5D3DA 5JXVA 4JWUC 5T8IA 4RFBA 3I9V1 1ET9A 3P4SB 1J7AA 1V97A 2QILA 1WRIA 2WXFA 2BYTA 1RWSA 4DQOC 1AN8A 1VJKA 2E6XA 4WIPA 2LGIA 3V3XA 2BS2B 2WXNA 3LB8C 2FBWB 5AUKA 1BXTA 1ACCA 1TS5A 3FAHA 1B1ZA 2BW2A 2HDEA 4WAFA 4HKQA 2PIAA 1N61A 3IT6B 4B0MA 1K53A 4N6EB 3DWMA 3FILB 1SJHD 1FNVA 1P7FA 2WXOA 2RMMA 1FFUA 1VR9A 1WWTA 2L1AA 2NMQA 2WU5B 3T3OA 2WXGA 5E6JA 2V4IB 3W5VB 3UI3A 1JROA 3J9CA 2MJDA 1YN5A 2QEJC 2J53A 4TMAB 1XF5L 1TJEA 1XXGA 1YN4A 4JPSA 2ONQA 1ZE3D 1F77A 5I4DA 1KRHA 3BIID 1I4XA 1L4ZB 1KF6B 3AE6B 1QKZA 4YSZB 1K50A 3BZDB 4A8XC 2GRIA 1CQVA 2ICIA 3TEXA 4WWMA 2WXJA 2L52A 1WYGA 3AECB 2K3UA 1Q10A 4ZHPA 1JW9D 2JXTA 1IGDA 1L6VA 3ZJUA 3E56A 1XCTL 1C9FA 4YXDB 4O1NA 2LFIA 2OHFA 3HVDA 1QQRA 4IOIE 3SR6A 1L0XB 3NUHB 2XNAC 3V05A 2SEBD 3IAS1 2D5GA 1STEA 1VZ6A 3PZ7A 1I4HA 2V3NA 1CJEA 1HZ5A 1SIJA 1UUPA 1E6EB 1FCCC 3BVGA 1XCQL 3CIRB 1FIQA 2G1EA 1K51A 3W5UB 4JE3B 1V1PA 5EE9A 1RYJA 3AV8A 2JYTA 2ZW1A 5H8YE 1PUTA 4D2KA 4LK0M 4A9AA 1OQQA 2QSDA 1TY2A 2LHEA 1C76A 2H88B 5FKAC 1XLPA 3N9YC 1JWAD 1FCLA 4US9A 4H2AA 3MHZA 4ZYSA 2YEPF 3AE4B 2KMMA 4WH4A 3BVZA 4MACA 1FRDA 3NZ3A 1SE4A 2JZPA 1ZP0B 2AX5A 1JWUD 1IGCA 1GB1A 3HVZA 2DBYA 2GI9A 5LNK1 4REZA 1ZXIA 2J42A 1YQ3B 2QIEB 4ZRPA 4RGOS 3MC0B 5D3IB 2BBCA 1UWMA 4HKZE 3RPFC 1FRRA 1L5PA 4J3OD 5D7GA 1ROEA 1IUEA 3AE8B 3MJ5A 3TSSA 3FILA 1SEBD 4XWWA 2W3RA 3AEFB 5BYQA 1JRPA 1KH0A 4YSXB 4KGTA 1JQ4A 4L2YA 3P63A 4TSSA 1EU4A 2INPE 3TEWA 2IDYA 3CWIA 4WQMA 2WQYB 2JYEA 3RFZB 4Q2JA 1PGXA 1SBBB 1UNSA 4OVZA 5FR3A 1IBXB 3ZQ4A 3ZJTA 1D5MC 2BB6A 2MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFD A;  1NI3 A;  1JAL A;  4ZOH C;  1ZUD 2;  4C80 A;  1E0Z A;  1FO4 A;  1FFU A;  3AM9 A;  1NYQ A;  1SF0 A;  1XO3 A;  1WWT A;  1L0V B;  3B2F A;  2MJE A;  3NVZ A;  2PVO D;  2WU5 B;  1EWY C;  2WLB A;  3W5V B;  2WDR B;  2K9X A;  4N58 A;  1JRO A;  4HRS A;  2MJD A;  5GXG B;  1FM0 D;  4JX1 C;  2MH7 A;  3SFD B;  3VR8 B;  1I7H A;  3B9J A;  3HRD D;  3AE5 B;  1PDX A;  1TJE A;  3AE9 B;  4JWS C;  5EE1 A;  3AED B;  3NVY A;  1TKE A;  2DWQ A;  1KRH A;  2H89 B;  3BII D;  5H92 C;  1KF6 B;  3AE6 B;  2WP9 B;  5C3J B;  2Q5W D;  4YSZ B;  4YTM B;  1VLB A;  1RM6 C;  1E9M A;  4HRO A;  3DWG C;  2KAJ A;  3LXF A;  1N63 A;  3NS1 A;  2CJO A;  4YTP B;  3VRB B;  4WWM A;  4USA A;  1QOB A;  3AEB B;  2L52 A;  1WYG A;  1AYF A;  1B9R A;  3AEC B;  1DOY A;  3P4P B;  1E10 A;  4ZHP A;  1JW9 D;  3P1M A;  4C7Y A;  2WS3 B;  1XLN A;  1L6V A;  4FXC A;  3ZYY X;  1OQR A;  1ZOY B;  4ZHO A;  2BT6 A;  4KX6 B;  1QOA A;  4LTU A;  4YXD B;  2WDQ B;  1R7S A;  1YJJ A;  2OHF A;  2CU3 A;  3AE7 B;  1QOF A;  1XLO A;  3AE3 B;  3SR6 A;  2WU2 B;  1N60 A;  2BS3 B;  3P4R B;  5EE0 A;  1A70 A;  2B76 B;  4YSY B;  4US8 A;  3NVV A;  1CJE A;  1XLQ A;  1SIJ A;  2CJN A;  2L83 A;  3AB5 A;  3AE2 B;  1E6E B;  1E7P B;  1WXQ A;  3AEE B;  3CIR B;  3WCQ A;  1FIQ A;  2G1E A;  2WDV B;  3HUI A;  3W5U B;  2W54 A;  1TKY A;  3NRZ A;  1RYJ A;  5EE9 A;  3AV8 A;  4N59 A;  3ETR A;  5H8Y E;  1PUT A;  1N62 A;  4A9A A;  1OQQ A;  1QOG A;  2PVG C;  3AEA B;  2H88 B;  1T3Q A;  2M56 B;  1XLP A;  3EUB 2;  2EKI A;  1JWA D;  1WGK A;  4US9 A;  5G5H A;  2E3T A;  1QLB B;  3B2G A;  1SB3 C;  5AUI A;  1NVI D;  2PKO A;  1L6U A;  3AE4 B;  2KMM A;  1J7B A;  4P6V F;  3AEG B;  1OFF A;  1VDV A;  1FRD A;  2BS4 B;  5G5G A;  3ABV B;  1N5W A;  1QF6 A;  3W9C B;  1YJI A;  1KFY B;  1ZP0 B;  3AE1 B;  2N0S B;  5MPO A;  1AWD A;  2AX5 A;  1F0Z A;  1NEN B;  5C2T B;  3L4P A;  1JWB D;  2DBY A;  2M19 A;  3HVZ A;  3AN1 A;  1ZXI A;  3KWL A;  1DOX A;  1YQ3 B;  1FFV A;  2QIE B;  3P4Q B;  4JWU C;  1UWM A;  3AMZ A;  2JQR B;  1FRR A;  3RPF C;  3P4S B;  2W3S A;  1V97 A;  1J7A A;  1WRI A;  1L5P A;  1J7C A;  2LEK A;  2QJL A;  4IDI A;  1ROE A;  1RWS A;  1VJK A;  1IUE A;  3AE8 B;  3VR9 B;  2MJ3 A;  2BS2 B;  3LB8 C;  4YT0 B;  2W55 A;  1DGJ A;  3PO0 A;  2FBW B;  2W3R A;  3AEF B;  1NYR A;  1RFK A;  2K22 A;  5AUK A;  4ITK A;  3SFE B;  4YTN B;  3FAH A;  1JRP A;  1CZP A;  1N5X A;  1TYG B;  3AH7 A;  4C7Z A;  2Y5C A;  1GPX A;  1QT9 A;  1FMA D;  1FXA A;  4YSX B;  1JQ4 A;  3VRA B;  2HTM E;  3P63 A;  2PIA A;  1N61 A;  3CWI A;  1V8C A;  2WQY B;  4N6E B;  4WQM A;  3NVW A;  1FXI A;  3FC4 A;  1NEK B;  2JX5 A;  1YQ4 B;  5EE3 A;  3DWM A;  1DOI A;  2ACZ B;  1TKG A;  2K5P A;  1GAQ B; 
#chains in the Genus database with same CATH topology
 3PO4 A;  1E7U A;  1NI3 A;  3SV3 A;  2BGF A;  1L0V B;  1WRD B;  4TUP A;  2DZI A;  2LHT A;  3N30 A;  3C28 A;  3B1L X;  3ZD9 A;  4ECQ A;  1ZDX A;  2BWF A;  2ZIW A;  2HHU A;  2XID A;  3B9J A;  3HRD D;  3AE5 B;  4GXJ A;  2FJ6 A;  2I1Q A;  4DL6 A;  3VTU A;  3N7R C;  3HP6 A;  2M0X A;  2WNM A;  4OHJ A;  1U9L A;  2DUY A;  3LVV A;  2IJ0 A;  2V9H A;  4UBB A;  4O3M A;  4BOZ B;  3PRP B;  2NBW B;  4USA A;  4AYB C;  1DK2 A;  3V7L A;  2BCU A;  5EWF A;  3RH4 A;  4EUT A;  4RT3 A;  1ZDV A;  5ALO A;  5HR7 A;  2VZK D;  2Y5P A;  2KKP A;  4NAM A;  2JV3 A;  5ALS A;  4DSK A;  5ALW A;  1S0M A;  2FCM A;  3WKD A;  2NTT A;  3T5H A;  3AU6 A;  4NLG A;  1HA5 A;  2WU2 B;  3F2D A;  3P4R B;  4OJ5 A;  4QWC A;  4K4G A;  3NVV A;  5KNI A;  1ESF A;  2L05 A;  2LRW A;  3Q8K A;  1E7P B;  1BPB A;  3A9J A;  5AI0 A;  3JPN A;  3QEA Z;  2NPT A;  2DPJ A;  4NJ6 A;  4WAA A;  2DKZ A;  3ETR A;  3VDZ A;  1WR1 A;  1VRA B;  3WKB A;  1S76 D;  3E0F A;  4RU9 A;  2WDT B;  3Q8A A;  3RT3 B;  5DG8 A;  5III A;  1X6I A;  5CB1 A;  4TKN A;  3NOB A;  2ASD A;  3RB3 A;  2QHO A;  4C56 C;  2NV3 A;  3R7R A;  3UIO B;  3T3N A;  1E8X A;  4YN4 A;  1UA1 A;  3MR2 A;  3PLV A;  4IQT A;  5G5G A;  4QWE A;  4KLH A;  3ZLZ A;  5AK6 A;  3KVF B;  1T6B X;  1RQL A;  1KFY B;  2QB1 A;  4B6J A;  5CWR A;  2QDF A;  3QHT A;  3TAD C;  2KQ7 A;  3T79 A;  4MDK E;  2DYO A;  4PHE A;  1IM4 A;  4GXK A;  4IG7 B;  2L76 A;  1WG8 A;  1PQS A;  3VVW B;  3I3T B;  2ES6 A;  5DBA A;  2JU6 X;  1C4C A;  1ZQP A;  3TAC B;  4A55 A;  1KTQ A;  1ZXH A;  2V4L A;  4IM2 A;  1Y8R C;  1FD6 A;  2FE9 A;  2MUT A;  5AK3 A;  3PO0 A;  2KYW A;  4KIT B;  4QIW C;  2G08 A;  4A6Q A;  2QKQ A;  1L7O A;  2P6U A;  1GPX A;  1A0P A;  2C22 A;  3IXS A;  2WX0 A;  1LO5 D;  1DOQ A;  2Y5C A;  4I6L B;  4XE0 A;  2W9B A;  8ICZ A;  5ALP A;  3GII A;  4DFD A;  4K4H A;  1YD8 U;  2J0M A;  1XNS A;  2EZY A;  4K3B A;  2H3Q A;  2R8J A;  3L17 A;  1TGZ B;  4ANX A;  7ICK A;  4DQQ A;  2KWD A;  2SAK A;  5KFU A;  5IKC M;  2O6V D;  3DPD A;  2LM4 A;  2MBO A;  2Y1I A;  5AKE A;  2H3I A;  2LBO A;  5DBB A;  3IG3 A;  2ISO A;  2LYA A;  3L0W B;  5BMH A;  4DFJ A;  1L3U A;  2I5H A;  2IY1 B;  2LVO A;  3RJK A;  1E5W A;  4JX1 C;  2ZIX B;  1WJ4 A;  3SFD B;  1E8Y A;  5L95 C;  5KFE A;  5D6J B;  3ECI A;  2DWQ A;  5H92 C;  3UMC A;  2PFN A;  4DSE A;  3RAX A;  4OVU A;  2JZ3 B;  2P6R A;  3PLU A;  5HG2 A;  4NM1 A;  3ZUN A;  3NS1 A;  4M04 A;  2M8S A;  4ECX A;  4NAW A;  2EKE C;  1K52 A;  5KG7 A;  4KGR A;  4C7Y A;  2KOX A;  1C20 A;  1YMH E;  2JH1 A;  4AJY B;  1R4N I;  4F1S A;  3KWV A;  1XQQ A;  3AU4 A;  2FLP A;  1QOA A;  2AWT A;  2KNB A;  4IRC A;  2MCN B;  1OXJ A;  1GJZ A;  5BYS A;  1ZQS A;  5J17 A;  4M9J A;  1QOF A;  1SE3 A;  4FA6 A;  2ZUC A;  4MHV A;  3QUB A;  4TUS A;  1U4A A;  3EEC A;  3UF8 A;  1TKD A;  1F0M A;  5AKZ A;  4FJZ A;  5C1Z A;  2A19 A;  2IND C;  4QW9 A;  7ICM A;  4XWT A;  3ZDM C;  5F9N A;  8ICO A;  4WJP A;  2IHN A;  2W54 A;  5DPR A;  2QAR A;  1TY0 A;  3UQB A;  1EXN A;  3RNE C;  5AKK A;  3TUO A;  2KK0 A;  1C78 A;  1JWS D;  1O03 A;  2K8H A;  1QOG A;  3BYY B;  3V61 A;  3VTV A;  3KOO A;  4XC2 A;  1SKR A;  3V7J A;  3RB4 A;  8ICG A;  2EKI A;  3Q8B A;  5J2J A;  4FAD A;  1KFS A;  2B3A A;  2EAP A;  2MQJ A;  3ZNG C;  4KIK A;  9ICR A;  3ALB A;  5KTQ A;  2MSN A;  5TZV A;  3A1Q B;  4MM3 A;  1UQV A;  5G55 A;  2W82 A;  4O5E A;  2L00 B;  1P98 A;  1GG3 A;  3UM9 A;  3KW5 B;  1LKY A;  4RGT A;  4ACF A;  2ZIU A;  2RPV A;  1RXV A;  5ALD A;  2CKH B;  4GMV A;  2L0F A;  2E8O A;  1PK1 A;  1BVS A;  2JZB A;  4BJQ A;  3Q69 A;  4I2D A;  1ZQO A;  4I2C A;  2UU7 A;  1S77 D;  4B9N A;  1OW5 A;  4I27 A;  3WK5 A;  5AIA A;  3QU7 A;  1S0V A;  4BKT A;  4GGQ A;  3BS7 A;  2DYM A;  4LDT D;  2YEP B;  4XDC A;  4A3P A;  2MJ3 A;  3QWZ B;  1DGJ A;  1T5X D;  2LJI A;  1Q5W B;  2XY7 A;  2AQ3 B;  1F2R C;  1WCL A;  4MFF A;  1TYG B;  4CRX A;  4WJQ A;  1SL2 A;  1BPZ A;  3CST A;  5FP0 A;  4I2F A;  3SEI A;  3BZC A;  3U7Z A;  3PRZ A;  3H8H A;  5J0O A;  1WJ6 A;  3UPQ A;  2C5L C;  1FXI A;  4XQ8 A;  3UQA A;  4QWA A;  1KTK A;  2KJ9 A;  5HHH A;  1Q0W B;  3MFI A;  4F4Y A;  1UT8 A;  2BR0 A;  2AQ0 A;  1BML C;  1L0Y B;  2WB1 C;  1JAL A;  4DHJ D;  3CNH A;  1XO3 A;  3TAN A;  1ZD2 P;  1EWY C;  4ZRK A;  2IMW P;  3A9K A;  4GDL A;  5AI9 A;  4DL5 A;  3RJJ A;  4DWI A;  3OHA A;  3RZW C;  2YN4 A;  5KG0 A;  5ALV A;  5KFM A;  2K4P A;  4Y2X A;  4J9P A;  1NDD A;  1KDH A;  2DZK A;  2KMC A;  1RLF A;  3Q3O C;  2KNJ A;  2H89 B;  4J9S A;  4K7S A;  3BVM A;  2ON8 A;  5LXH A;  2UVW A;  1VLB A;  3SZ2 A;  3PRE A;  5C23 A;  3DWG C;  4DWF A;  2XCA A;  2N7J A;  3V7K A;  1ZD5 A;  4M9G A;  3Q8M A;  4RF1 A;  2LUM A;  2F44 A;  2ALZ A;  2W04 A;  3QZ7 A;  2G45 B;  2N9E B;  4KZ0 A;  5BMG A;  3P1M A;  2QB0 B;  1L8O A;  4ZHO A;  3WKC A;  2FUH B;  3GIL A;  9ICS A;  7ICO A;  2V3S A;  3WK9 A;  4M2Y A;  4ZYN A;  2Y0S C;  1GO3 F;  3GV7 B;  3RH5 A;  9ICK A;  1XLO A;  3RJE A;  3M6Z A;  5KFC A;  4M0A A;  4JWM A;  2BS3 B;  4M6W B;  1A70 A;  4C4S A;  3KFU F;  2HHX A;  1YZ6 A;  1JX4 A;  3VHT C;  4DQS A;  2Q0Z X;  5AM1 A;  1ZJM A;  2DX5 B;  2LYH A;  3WCQ A;  3CF6 E;  2VAN A;  3LYS A;  5CHF A;  3NRZ A;  2HBK A;  4YMO A;  4DL4 A;  7ICG A;  1PGB A;  4RQ8 A;  2L8J A;  2DFL A;  4HDQ A;  3EFU A;  1HUZ A;  3CYM A;  3ICX A;  4PPX A;  2IZV B;  3DDC B;  3DVG X;  3RF9 A;  1C79 A;  2XO7 A;  4ECR A;  1SB3 C;  1D8L A;  1RPL A;  4J9N A;  9ICP A;  2NBU A;  1NNL A;  4P6V F;  2C2E A;  1Q8K A;  3KUZ A;  4RNN A;  3ABV B;  2KVZ A;  4OD0 A;  5KL8 B;  3SD5 A;  1L3S A;  2ZW0 A;  1T8E A;  3W9C B;  1KM7 A;  5CHW A;  4BKS D;  2KKV A;  2BYF A;  3SMV A;  2FLN A;  5C2T B;  4BXO A;  4IQV A;  4OZA A;  4UB3 A;  1C4A A;  4DDI D;  3N1Z C;  1ZQJ A;  5D3D A;  4JWU C;  5T8I A;  4JV2 A;  2GBK A;  3DEE A;  2CS4 A;  2VRR B;  4C4R A;  4I2A A;  1V97 A;  2QIL A;  5J0W A;  1WRI A;  2LGD A;  2NVU I;  3PT2 B;  5BOM A;  4EZ9 A;  4N9F 4;  4DQO C;  2MRP A;  1XO0 A;  1CRX A;  1E7V A;  2W7O A;  2WXN A;  4DBG A;  7ICE A;  4NV0 A;  3EHV A;  2J0K A;  5DGA A;  5KFO A;  3PW5 A;  4BFR A;  2EZZ A;  1A6S A;  3MGI A;  4RT2 A;  3IBE A;  3Q2A C;  1ZQZ A;  1ZGU B;  3PV8 A;  2HDE A;  2KJR A;  2Y9U A;  4BBN F;  1ZRN A;  4DSJ A;  2G4D B;  4RM9 A;  4M9N A;  2NRW A;  4B0M A;  2BYT A;  1K53 A;  3MR5 A;  2M0N A;  4HDO A;  3BQ2 A;  4EBC A;  4BWJ A;  3Q6B A;  4KMO B;  1SJH D;  3I28 A;  1P7F A;  8ICR A;  3C29 A;  4C0Z A;  4KLM A;  3ZIM A;  4HWI B;  4JWN A;  5KT5 A;  2KXJ A;  2F76 X;  2WU5 B;  2LMR A;  1N6Z A;  3U7D A;  3ZNI D;  4II3 B;  3SHQ A;  5E6J A;  4O3O A;  3PX6 A;  2CHZ A;  3UI3 A;  3K9P B;  1N48 A;  2MJD A;  1YN5 A;  2O2V B;  4TMA B;  4UB6 U;  5KFD A;  2ASL A;  2GBN A;  3SU8 X;  1TJE A;  3D2N A;  2JT4 B;  2V9W A;  4JPS A;  2EAO A;  2ONQ A;  1ZE3 D;  5I4D A;  3OSP A;  2AXT U;  3KUC B;  4LJO B;  4FN2 A;  9ICA A;  4NQL B;  4PS7 A;  1CUK A;  3PR4 A;  2AGP A;  2BCQ A;  2K25 A;  2ZIW B;  3AEC B;  7ICH A;  2MRL A;  3VUW A;  1IGD A;  7ICR A;  3PX4 A;  1QQ6 A;  5DDY A;  5J2G A;  3M63 B;  3E56 A;  1WE7 A;  1GUA B;  5ALG A;  4C8N A;  1R4M B;  2LFI A;  4LJP B;  4UAV A;  2DNF A;  2D6F C;  3TQ1 A;  1DGS A;  2AGO A;  3HHM A;  4ICU A;  4IOI E;  1WWU A;  5HHI A;  4E0D A;  2F2A B;  2KDF B;  3V05 A;  3IAS 1;  2D5G A;  3UIN B;  1ZJN A;  3PZ7 A;  1VZ6 A;  1FEZ A;  3H1U A;  5JHA A;  2MLB A;  1I4H A;  1T7P A;  4W9E A;  2ZTE A;  3IM1 A;  1EF5 A;  3ISB A;  5AI6 A;  3GV8 B;  1FIQ A;  4QJF B;  2CHW A;  2G1E A;  3NZU A;  2DYB A;  3R66 C;  2C28 A;  1TZ1 A;  2XBB C;  2ZW1 A;  4IRD A;  1RQN A;  1PUT A;  1J97 A;  2R8I A;  1YT3 A;  4J03 A;  4LNF A;  1OQQ A;  1TY2 A;  2H3Z A;  3R7Q A;  2MBE A;  1O08 A;  3LWL A;  3D6J A;  4US9 A;  4O5C A;  3TFR A;  5AEK B;  4I2H A;  2NPT B;  3AE4 B;  4YXM A;  5KFZ A;  1UH6 A;  3ZNZ B;  1L7M A;  2I1K A;  2M17 A;  1NK0 A;  1IGC A;  5TR5 A;  1GB1 A;  1SXD A;  3HWT A;  2FID A;  8ICT A;  2DBY A;  4Z6C A;  4WJ3 B;  1V81 A;  3HVZ A;  2NRZ A;  4REZ A;  5LNK 1;  3A1Q A;  1BPE A;  3ZDE A;  2WTF A;  1ZQM A;  4W9J A;  1L5P A;  2A4Z A;  5D7G A;  2XCP A;  4Y2V A;  2JPH A;  2FMP A;  2MHJ A;  3MJ5 A;  2HJ1 A;  2D8C A;  1NK4 A;  5DB8 A;  3NRW A;  1QQ5 A;  5DB9 A;  2W3R A;  3N7S C;  3PW4 A;  2MBQ A;  4TQR A;  1ZQA A;  3ZDA A;  9ICM A;  2DKX A;  3N20 C;  2PI4 A;  4GN1 A;  3RJI A;  3HJE A;  4JV1 A;  1KH0 A;  4YSX B;  4GC7 A;  5IIM A;  4L2Y A;  2PJH A;  4FHJ A;  3P63 A;  3CWI A;  3QJZ A;  4YD1 A;  4JQW C;  4Q2J A;  2D3D A;  9ICC A;  5DB7 A;  4RQ4 A;  1RDF A;  2MH7 A;  4I2B A;  1PFD A;  4Y2T A;  4NJC A;  3WK6 A;  2ZXI A;  2BDU A;  1E8W A;  2G07 A;  2KX0 A;  3SV4 A;  1TZO A;  2KHW B;  3W2D A;  5IIJ A;  3IT4 B;  3SYZ A;  4EEW A;  4B9M A;  1VZ8 A;  5HHD G;  1I4R A;  2WF7 A;  1PDX A;  2KC1 A;  1J2N A;  4YVZ A;  2VA3 A;  2WF5 A;  1GOZ A;  8ICC A;  2EH9 A;  2W7P A;  4ZRJ A;  3DCG A;  2KP7 A;  5BYR A;  4IUM B;  1MC8 A;  1T94 A;  3SI8 A;  2KHQ A;  2R8K A;  5KFI A;  3VRB B;  5CHV C;  4TQ0 A;  4EZK A;  3Q8L A;  4C8O A;  3KUD B;  2BDP A;  2KFK A;  3RZF A;  4BKG A;  1XLN A;  2BT6 A;  1JWM D;  3RNF C;  2K60 A;  2W9M A;  2G09 A;  4PL2 A;  1NK8 A;  5AIC A;  1HEZ E;  2WXH A;  1UCV A;  2KN5 A;  4NAW B;  1L8L A;  5AI4 A;  1N60 A;  2I38 A;  4US8 A;  1P3Q U;  2JHD A;  1XLQ A;  4Y2J A;  1Y56 A;  1RYU A;  2W8K A;  3AB5 A;  5HML A;  3J81 j;  4NY8 A;  8ICW A;  2BTE A;  3TIX A;  1AAR A;  4O5K A;  4FZM A;  4M6W A;  9ICO A;  1Z1V A;  2DHZ A;  4CQN A;  1GC6 A;  4KKJ A;  3EFC A;  5HP4 A;  7ICS A;  4NNJ B;  1NK5 A;  4GOC A;  2KVR A;  2XEW A;  3VXW A;  1V38 A;  4MJS A;  3ALR A;  1WGG A;  2OEH A;  2JF5 A;  5G5H A;  3RFA A;  4ED1 A;  4IR9 A;  1ZQV A;  3VQI A;  2G3Q B;  2QAR B;  1J7B A;  4U7C A;  4HAI A;  4HPP A;  1B0X A;  2BS4 B;  3OG5 A;  4EBE A;  4UB2 A;  2BB5 A;  4KGS A;  2KJ5 A;  2DQN B;  2FE8 A;  3H8S A;  1DK3 A;  2BCR A;  3PV1 A;  4NLN A;  1L7N A;  3QCA A;  8ICE A;  3BWU D;  2M19 A;  5KT6 A;  4M9H A;  3AN1 A;  4ED7 A;  3JSV A;  3LDZ E;  3PSE B;  5KFV A;  2YML A;  2JQR B;  2NRT A;  4MM3 B;  1WM3 A;  2QJL A;  4GIB A;  5DDM A;  4C4T A;  3QK0 A;  4P4O A;  1UF0 A;  3VR9 B;  4AS1 A;  5DLF A;  1I4Q A;  2ZIU B;  3GZN I;  3APD A;  4YFK A;  4I2E A;  3QIJ A;  1ZQ1 C;  4RNO A;  5DG7 A;  2IGG A;  3N1Y C;  1PK1 B;  1N5X A;  2HHV A;  1EM7 A;  3AH7 A;  1LGR A;  2Z59 B;  1SKS A;  3DBR I;  1QT9 A;  4IQW A;  2OJW A;  1BT0 A;  3VRA B;  2C9W B;  4OZC A;  4ED0 A;  2IOF K;  3NVW A;  5KFJ A;  4DL7 A;  3EWA A;  1V6E A;  2RDH A;  4OJ6 A;  2V4Q A;  1DOI A;  2ACZ B;  5DB6 A;  2K5P A;  4WWP A;  3NY5 A;  2ZJA A;  4C80 A;  9ICU A;  2YB4 A;  1SF0 A;  1NYQ A;  2KWC A;  4KDI C;  3B2F A;  4RCO A;  4PHP A;  3MAB A;  4RZR A;  2K9X A;  2Z7J A;  3NAS A;  4C8M A;  5IP4 D;  4C8K A;  2DGZ A;  1WMH A;  3VR8 B;  2FAZ A;  2N9K A;  4KLO A;  4CO7 A;  2KZ3 A;  2LXC A;  3PRM B;  1M94 A;  4R63 A;  5D49 A;  3CRX A;  4BZA A;  1FXT B;  3H7S A;  2CJO A;  1EWC A;  4K1R B;  4QZG A;  3KQ4 A;  2O2V A;  4LZD A;  3A9K B;  4GDL B;  3RD2 A;  1DOY A;  3TFS A;  4QZC A;  2KMA A;  3ZD8 A;  8ICS A;  4EEK A;  5KFY A;  4EKU A;  2BZF A;  3TAD A;  1GC7 A;  3RR7 A;  1ZQU A;  1OQR A;  1ZOY B;  3DHI C;  4KX6 B;  2IO2 B;  2KO3 A;  2QLT A;  2WDQ B;  3QAQ A;  3MP9 A;  4P0P B;  3AE7 B;  3RBE A;  3ZTC A;  1SGH A;  1KW4 A;  5CEH A;  3QQ8 B;  5EE0 A;  5J0R A;  1F52 A;  1WGH A;  1WX7 A;  5KFB A;  4W9G A;  4PZN A;  7ICF A;  1TKY A;  3TEZ A;  2JEG A;  3JPQ A;  1DYQ A;  5KHQ A;  3PMN A;  4X57 B;  4XX5 A;  4LZG A;  2MP2 B;  3EGR A;  1SV4 A;  3W1S A;  2J6S A;  3N28 A;  3VC8 A;  5KG2 A;  1KKX A;  4G3I A;  1RG6 A;  3OJU A;  3C1Y A;  1P1A A;  4YG2 A;  1SGG A;  1V85 A;  4URK A;  3ZDD A;  3VH3 B;  4HPM B;  3DVN U;  5KG4 A;  3A0H U;  2D3C A;  2C60 A;  1NZB A;  4MF8 A;  9ICI A;  1V9P A;  1NEN B;  3APF A;  2BPS A;  2YVC A;  3KWL A;  3SAH A;  5DKW A;  4ELV A;  5AI8 A;  3B08 A;  1AW7 A;  4ARI A;  2INN E;  4RPZ A;  2LMC A;  1MI0 A;  2W3S A;  2LEK A;  2LVQ A;  3H6N A;  1QCK A;  2BPF A;  2ZNV C;  2WXL A;  4DEZ A;  2IY0 B;  5ALL A;  4YT0 B;  2HBM A;  2ZTC A;  5AKJ A;  1NJX A;  1X6J A;  4BXO B;  3WA0 A;  1LV5 A;  3WIM A;  3PVL A;  3ZI4 A;  3Q8E A;  1JN3 A;  5AIB A;  4YTN B;  4PT5 A;  5ALQ A;  4ZH4 A;  1KBU A;  3RNC C;  2FDR A;  2E1E A;  4KTQ A;  1FMA D;  1FXA A;  2KDI A;  3NZS A;  3VFK A;  4GLX A;  2KEY A;  2QMT A;  1D5Z C;  1TAQ A;  2GMI C;  4Y2U A;  4MT5 A;  4NQK E;  4A90 A;  4KN7 A;  2M0A A;  2Y1J A;  2L5Y A;  4PGQ A;  4AOF A;  5EE3 A;  3RJG A;  3N7P D;  2HSZ A;  3WAM A;  3ZW3 A;  1QSS A;  3RB0 A;  4QZA A;  5L1K A;  1GAQ B;  5HNK A;  1ZUD 2;  2HMX A;  2P66 A;  4F8R A;  1FNU A;  3HM6 X;  4M00 A;  5J18 A;  2FLL A;  4DSF A;  9ICT A;  3BYT B;  1MG4 A;  2G5H B;  5ALZ A;  2GBM A;  4BUG A;  1I7H A;  3H40 A;  3QX7 A;  2EMT A;  4IS7 A;  4Y2S A;  5DBC A;  1RM6 C;  4R3D A;  3KKA A;  1D8B A;  5KAI U;  2GB1 A;  5ALY A;  3K9O B;  1QQ7 A;  3Q8S B;  2AQ4 A;  4IQU A;  1LFD A;  4FUL A;  4BOS C;  3W1S C;  4E74 A;  1CEZ A;  1WJU A;  1T4G A;  3QU2 A;  2WS3 B;  3GU3 A;  3L10 B;  3P2B A;  5DQI A;  1Q3V A;  4LNI A;  4JV0 A;  4LTU A;  3FYH A;  7ICL A;  5JHB A;  4MEL A;  2FPM A;  3KZX A;  3Q8F A;  5KG1 A;  1S3S G;  1VCB A;  3GDX A;  3AE3 B;  3GOE A;  3C2L A;  2ASQ A;  4RNA A;  1NZP A;  2Q4T A;  3QC8 B;  1UGM A;  2XGP A;  1PK3 A;  1KOT A;  2G4S A;  3H8J A;  4IKG A;  2F3N A;  5L1I A;  2MEK A;  2L83 A;  2GH1 A;  3IRU A;  1NJY A;  1SSN A;  5KFA A;  3KZI U;  4YMN A;  1OGW A;  1QZE A;  3AEE B;  3M3J A;  3HUI A;  4KLG A;  1WUD A;  3PR5 B;  4RMA A;  3A0B U;  1JML A;  2Y3A A;  1N62 A;  1H4R A;  8ICH A;  4P1C C;  4O9M A;  2W03 A;  3VCB A;  5J2F A;  8ICX A;  3AQF A;  3AEA B;  3UIP B;  2KOB A;  2WXK A;  2HTH A;  2BHN A;  4YP3 A;  4G50 A;  4GIV A;  2JRH A;  1QLB B;  5AUI A;  3Q8Q B;  1L6U A;  2AQ1 B;  2KN4 A;  3IN5 A;  2BQ3 A;  2KFJ A;  4KX5 A;  3RN9 C;  3U4E G;  4IWP A;  2I2Y A;  4HCN B;  2HD5 B;  4GB9 A;  3L4P A;  4B9T A;  1B4F A;  2OED A;  3P4Q B;  4YQW A;  2UWQ A;  3I9V 1;  2WXF A;  4F2S A;  3PHW B;  1RWS A;  4EOY A;  1PVQ A;  2FCN A;  3MC8 A;  5KG3 A;  2FPK A;  2NRV A;  2LGI A;  4WJN A;  3JPR A;  1SV0 C;  3V3X A;  3LB8 C;  5AZF A;  3UXO A;  2HHQ A;  3AUL A;  1RZT A;  5TIS U;  3BIN A;  3UMG A;  1ACC A;  2YX8 A;  1TS5 A;  3Q3F A;  3KKA C;  3DQV A;  3PSF A;  3DHG C;  2WWZ A;  1C1Y B;  3HPO A;  4F5N A;  1WM2 A;  3EPI A;  2PE9 A;  3IT6 B;  5ALN A;  4WJO A;  4UQG A;  4N6E B;  2RHF A;  5CX3 A;  5DPS A;  3DWM A;  1S97 A;  2ZZP B;  8ICY A;  4K7U A;  1OQY A;  2JMG A;  4B95 A;  1NOM A;  4EBD A;  1VR9 A;  2L3Z A;  2KDE B;  1Z19 A;  4R66 A;  3T3O A;  2WXG A;  2WX1 A;  3UQ2 A;  2BKR B;  4LJX A;  1JRO A;  3V72 A;  1WI0 A;  2M9N A;  1PVP A;  1URJ A;  1SKW A;  5KG5 A;  1XF5 L;  2VJ4 A;  3W1Y A;  1ZQD A;  1F77 A;  3IV6 A;  1I4X A;  2JGA A;  1KF6 B;  4B6W A;  1ZQH A;  4YSZ B;  3PW2 A;  4RQM A;  4DOB A;  5KFN A;  1XT9 B;  4KLT A;  2WFA A;  1CQV A;  2ICI A;  1T0S C;  3TEX A;  3OPX A;  7ICI A;  1BGX T;  3BQ1 A;  2K3U A;  4ZHP A;  5J2I A;  4CGZ A;  1BNP A;  4HLE A;  5CA7 A;  1F9J A;  1L7P A;  2ZVO A;  4WWO A;  2BCS A;  2ZTD A;  3ZJU A;  2HOI A;  1C9F A;  4O1N A;  4JLC A;  4PJ0 U;  4JIO U;  2K89 A;  3IG8 A;  2EQY A;  1NK7 A;  4B9S A;  4R8U A;  3I63 C;  3V6E B;  2KLC A;  5LLI A;  4YR3 A;  3NUH B;  2NS5 A;  5ALJ A;  2G06 A;  1UT5 A;  1RAX A;  2KFK B;  4AP4 C;  3MBY A;  3B0A A;  1HZ5 A;  1NKB A;  3R3M A;  4NJ7 A;  2W9A A;  4HJK A;  4P0P A;  8ICA A;  1K51 A;  1MA7 A;  4JE3 B;  4KZC A;  5EE9 A;  3KHH A;  3OLM D;  3AV8 A;  4UAY A;  2JYT A;  2Y5B B;  3OGU A;  4YL8 A;  1Z2M A;  4W9F A;  1ED1 A;  2KT7 A;  1JIH A;  1HUO A;  2G5I B;  1C76 A;  1VJ5 A;  5KL1 B;  2D3G A;  3MTN B;  4I2J A;  5FKA C;  5G2N A;  2AEH A;  4H2A A;  2CXY A;  2GBR A;  2A1J B;  4OJP A;  3G6X A;  2BYE A;  2HE7 A;  3H0L B;  2IA6 A;  2HI0 A;  1FRD A;  1UBQ A;  1YX6 B;  2MP2 A;  2R2O A;  2KZR A;  2JZP A;  2BQU A;  4TQS A;  1OUQ A;  1ZP0 B;  4M8N A;  1JWU D;  1C3T A;  3G6V A;  4KDL B;  4F71 A;  4MJS B;  1L3V A;  2F1H A;  2JEJ A;  2AYO B;  2LM1 A;  1YQ3 B;  5D3I B;  3MC0 B;  5CR0 A;  3F5A A;  1UWM A;  3RPF C;  1WYW B;  4ECS A;  2LI5 A;  1J2M A;  2KN7 A;  3GE3 C;  2CPR A;  4BKS A;  5KFQ A;  1K8R B;  5FR6 A;  1L6N A;  1ZQG A;  1WGY A;  4F50 A;  4HCP B;  3TKA A;  4DSI A;  4DHZ B;  7ICU A;  4Y2R A;  2ISP A;  4KLI A;  4O3S A;  3AEF B;  4FE3 A;  3JSV B;  3DBH I;  4G0N B;  2FCQ A;  4EX7 A;  2KHV A;  3IDW A;  7ICQ A;  1UHU A;  3PY8 A;  4TSS A;  3HIZ A;  3C2M A;  4WQM A;  2UVR A;  2JYE A;  4QZE A;  5KFS A;  1PGX A;  2J0J A;  2LGY A;  4ELT A;  1V2Y A;  4OVZ A;  1ZQF A;  2X8X X;  2O6K A;  3ZQ4 A;  5KFH A;  3GE8 C;  3OJ4 B;  2KVS A;  2BB6 A;  3B0X A;  3ZJV A;  2JEF A;  4ZDV A;  3AM9 A;  2LXA A;  4DXG A;  3Q3J A;  3NVZ A;  2LKY A;  2ZUD A;  2LJ5 A;  2KAN A;  1EF1 A;  3N32 A;  4GSW A;  3MGV A;  3GB1 A;  1ZQY A;  2KSO A;  3LWM A;  3CMM B;  4ANW A;  3ENE A;  2EZX A;  3UGB B;  3ZRF A;  1U48 A;  5EE1 A;  4ECY A;  2R8G A;  2J6U A;  4MFA A;  1ENF A;  2Z0D B;  4DCC A;  3F2B A;  2J7Q B;  1XU4 A;  4EEN A;  2NTS A;  3WAP A;  2C7M B;  2WAQ F;  3O0F A;  4FS2 A;  2V3P A;  3AL0 B;  1I4P A;  4ZRQ A;  5JU5 A;  2FNJ B;  2KAJ A;  3RUL A;  1I4G A;  2BF8 B;  1SE2 A;  1Q46 A;  1E10 A;  1OEY J;  1OEY A;  1B9R A;  2K8C A;  2R8H A;  3HX0 A;  1WMH B;  1ARO P;  5F9L A;  2ZNV B;  3ISC A;  2LWP A;  1NI2 A;  4A3O A;  5HFY A;  2BKE A;  3EPG A;  1BUI C;  1Z00 B;  1CK1 A;  1SZP A;  4NWI A;  2JSV X;  4RM8 A;  4MEM A;  1S9F A;  2H5X A;  4DLE A;  3QUQ A;  1TS3 A;  4YSY B;  1D8Y A;  5EWG A;  3QNM A;  1B22 A;  3EYZ A;  3BK1 A;  2OM6 A;  3T5J A;  2FMQ A;  4PHA A;  4UDU C;  3DVN V;  2MU2 A;  2Z8L A;  1U45 A;  3C8Y A;  4NM2 A;  2VZK B;  5CTR C;  3ZDB A;  2M56 B;  2JXJ A;  1TK0 A;  3EUB 2;  2PMZ F;  2JWU A;  5L9X A;  2I6X A;  4NY0 A;  2KTF A;  1WX8 A;  5DQH A;  2PKO A;  1GB4 A;  1I42 A;  4K7W A;  1MHH E;  4M0W A;  4F8C B;  2WYQ A;  2EEL A;  5EOZ A;  2JRI B;  5MPO A;  1R4N B;  4GFJ A;  3MC1 A;  2RDB C;  2CR5 A;  4CYE A;  2J4X A;  4KLS A;  4EEL A;  4W9D A;  2GOL A;  3R8B A;  2D07 B;  1A76 A;  1RYS A;  2W11 A;  4MH0 E;  2V0G A;  2E1F A;  3T3F A;  4IDI A;  2L7R A;  2VH1 A;  1PVR A;  3RJH A;  4AP9 A;  4YXJ A;  9ICV A;  2W55 A;  1D6E C;  1TE2 A;  2VIX A;  1NYR A;  5AKX A;  2W9N A;  1E8Z A;  4ITK A;  4RF0 A;  3PW0 A;  2JH7 A;  2ZG6 A;  3OAW A;  4W9H A;  4UAU A;  4P2H A;  1TBE A;  1ZQE A;  5BMI A;  2WXM A;  2WHE A;  4ED8 A;  4DFK A;  1E90 A;  2KAC A;  3D2Q A;  4J9L A;  3NHE B;  2K39 A;  1D4B A;  4KLD A;  2WB1 F;  4CDG A;  4DF4 A;  2VH2 A;  5AKI A;  2GO7 A;  1E0Z A;  3DHH C;  4F5O A;  2QCZ A;  4I6P A;  1WGD A;  2PTL A;  4KX3 A;  1YOV B;  3EA6 A;  5KFT A;  2ZJ5 A;  3P42 A;  2ZEQ A;  7ICT A;  5GXG B;  5AM2 A;  2J6T A;  3NGD A;  3NTU A;  1WSP A;  4RQ0 A;  4RH6 A;  2H3F A;  3VTW A;  1A5R A;  9ICN A;  2OXO A;  3SAG A;  4MGK E;  3IHQ B;  2WP9 B;  5C3J B;  3T5L A;  4YTM B;  1TK5 A;  1E9M A;  2B6G A;  4XUS A;  1K1Q A;  1Z4O A;  4DS5 A;  1NK6 A;  2G9H D;  3MC9 A;  1N63 A;  2LYB A;  4GLS C;  1LVH A;  3M1Y A;  2KFN A;  4DFM A;  2DLB A;  2JEI A;  5T14 A;  1HXY D;  4F5R A;  2DZJ A;  1WWV A;  2AQ2 B;  2F1J A;  5ALF A;  4ICV A;  5CP2 A;  4FXC A;  1YIW A;  2O6V B;  3I76 A;  4KV2 A;  1SIF A;  1TS4 A;  1R7S A;  2RDG A;  1HJP A;  1V9J A;  2Y0S F;  1PYW D;  5IA7 A;  2WXP A;  2Z0E B;  2OCE A;  2GBJ A;  4ARC A;  2R18 A;  5ALE A;  3PGE A;  3PS6 A;  3H8M A;  4NZL B;  2FPL A;  1JCK B;  4FBU A;  1LXD A;  2YQE A;  1YZ7 A;  4JGH B;  5ALU A;  2IO3 B;  1SE9 A;  3F2C A;  4P4M A;  1ZET A;  3NG0 A;  2EAN A;  5KT3 A;  3Q3M C;  3N1X C;  4OZB A;  2NBV B;  3M62 B;  3HKZ F;  1B43 A;  2HVH A;  2PVG C;  3C5G A;  3M6K A;  1ZRM A;  1YN3 A;  3ML8 A;  3H0R B;  2ZIV B;  1XEE A;  3GZF A;  2K4I A;  3TL5 A;  8ICV A;  2CRX A;  5E79 U;  1SL0 A;  1IG6 A;  3THV A;  5J0U A;  2MX2 A;  1BPD A;  4M02 A;  2N0S B;  2MA1 A;  5AHX A;  3TAP A;  4FJY A;  1ZQB A;  4PGY A;  3ZXR A;  2A1J A;  2N7E A;  2ZPY A;  1AQ6 A;  3KH0 A;  3M9O B;  3K1R B;  3ED5 A;  5IIN A;  2FMS A;  5J0X A;  9ICH A;  4KLJ A;  3EW9 A;  5L1J A;  1V1O A;  4FLH A;  3EZ5 A;  4Y2Y A;  4B9V A;  4MGZ E;  5B66 U;  1ET6 A;  3B0Y A;  3KHL A;  4KLE A;  4PK1 A;  4IRK A;  3WK4 A;  3QA8 A;  3TEY A;  5JH5 C;  5K4L A;  1X40 A;  3Q8C A;  2KD0 A;  4DHZ E;  1RFA A;  3SFE B;  2LGX A;  2CN1 A;  5B5E U;  4C7Z A;  3PHX B;  5BO4 B;  3SD7 A;  2HTM E;  1KLU D;  1F1H A;  1EO6 A;  3UMB A;  5J0T A;  3OHB A;  4IWO A;  3PML A;  2KQ4 X;  2XVT A;  4JMU A;  3PZ8 A;  1FNW A;  1MJD A;  1TKG A;  1S8O A;  4F93 B;  1JXL A;  2TSS A;  3V6J A;  1XO1 A;  4EZJ A;  5KT4 A;  1HE8 A;  3U2S C;  4UAW A;  4F4Z A;  2E8P A;  1KEJ A;  2K4E A;  2YMP A;  4O3N A;  1NJW A;  1NK9 A;  4KLF A;  1WXV A;  4NLK A;  4LDT B;  4EYH B;  3MFG A;  3C23 A;  2N9X A;  4RPX A;  2LHD A;  3U52 E;  4IC9 A;  3QUC A;  5GMV A;  3OJ3 A;  2IO1 B;  3IG5 A;  3BS5 B;  1SL1 A;  1ZQX A;  2D3B A;  5ALM A;  3IHP C;  4OVV A;  3I57 A;  2JRZ A;  2BWE S;  1MG8 A;  3M95 A;  4J9O A;  3P4P B;  3ETL A;  1VZ7 A;  4GDK A;  3RYT A;  5ALX A;  4B9K A;  4CNQ A;  3ZYY X;  4DHJ B;  1WE6 A;  1XSP A;  5EDS A;  3BJY A;  1BPX A;  1D9D A;  2PLP A;  2NO5 A;  2FUG 1;  3K1Z A;  3JYU A;  1MPE A;  5J2C A;  4HK2 A;  4P16 A;  3WK7 A;  4NXZ A;  2A3V A;  3DVG Y;  1V5T A;  4JB3 A;  3R2I A;  2EDU A;  5H2F U;  3LK9 A;  2XY6 A;  1Z00 A;  3MJW A;  2KD1 A;  2KJH B;  2XK5 B;  4R8U B;  4HEA 1;  1P7E A;  3PX0 A;  3S6J A;  5L1M A;  2X38 A;  4P0Q A;  3N4M B;  1RXW A;  4TUQ A;  4WUR A;  2P35 A;  3WAL A;  4ICA A;  3ZTD A;  3ZGZ A;  4CHK A;  1HQR D;  4OCZ A;  4F5Q A;  1FPY A;  2D2Q A;  1WGK A;  2FIF A;  5AK5 A;  5HMM A;  1XSL A;  2FCS A;  4GU2 A;  4I28 A;  5C0Y A;  2W9C A;  2K0P A;  4FZN A;  2PPH A;  4G3X B;  2HW3 A;  2KKC A;  4L1B A;  4M9L A;  1TAU A;  1JUD A;  1YX5 B;  2A1A A;  1YJI A;  3E2E A;  2N7D A;  2DL0 A;  4QWD A;  4R64 A;  1K1S A;  1AWD A;  3OTQ A;  4F92 B;  3GP7 A;  2E8M A;  1FFV A;  2IPK D;  2W43 A;  4E3C A;  8ICP A;  1XC9 A;  1T0Y A;  3P4S B;  1J7A A;  3T5K A;  4W9C A;  4C8L A;  1AN8 A;  2E6X A;  4WIP A;  4J9R A;  2G0A A;  2ZPN A;  3ZO5 B;  1ZQC A;  2N9P C;  8ICB A;  4YCX A;  2JZZ A;  2NYV A;  2DPI A;  2A5U A;  5AUK A;  4NLC A;  4GXB A;  4IM3 A;  1WGR A;  5CJ7 A;  2KZM A;  1B1Z A;  4IC7 B;  1V80 A;  2JR5 A;  2DZM A;  3TI0 A;  4G9B A;  1S10 A;  3L13 A;  1N61 A;  1ZD3 A;  1D3Z A;  3JPS A;  2MAX A;  3H4B A;  4PGX A;  2N4F A;  3NJT A;  2WHI A;  2WXO A;  2AH5 A;  4DL2 A;  2LGS A;  3I1Y A;  1FFU A;  3Q14 C;  1TAM A;  2NMQ A;  1XWL A;  2KVC A;  4K81 A;  8ICK A;  1X1M A;  2V4I B;  2KTQ A;  1COO A;  3DOW A;  3L54 A;  1TFR A;  4Q44 A;  4MEY A;  5ALH A;  2QEJ C;  2IO0 B;  4WWN A;  1TIF A;  1V5O A;  3CW2 C;  1XXG A;  2ODG A;  2HOF A;  2ZJ8 A;  4F4K A;  3BII D;  4KSK C;  2NO4 A;  1L4Z B;  3AE6 B;  4LNN A;  4ECV A;  8ICI A;  1V86 A;  3BZD B;  4ECZ A;  2DAF A;  4ANU A;  4DS4 A;  4WQO B;  4ASW C;  8ICQ A;  2L52 A;  1WYG A;  4O3R A;  2KSO B;  3V6C B;  3RJF A;  1H38 A;  1JW9 D;  3MDC A;  1MSW D;  1L6V A;  2K8B A;  2KQS A;  5IN7 A;  1ZQK A;  1WZ3 A;  3JVZ X;  3N97 B;  4BAX A;  4O3P A;  4YXD B;  2WF6 A;  4LVS A;  4QWB A;  2KJ6 A;  4K3C A;  2OHF A;  3RB6 A;  4MSQ B;  3HVD A;  4A8E A;  1QQR A;  3SR6 A;  1IXR A;  3ONN A;  2O6V A;  2K8C B;  2YB1 A;  5IIK A;  2SEB D;  4B9L A;  1SV0 A;  4HXD A;  2V3N A;  5J2R A;  1X9W A;  1UUP A;  4IM0 A;  4I29 A;  2M1M A;  4FZL A;  5J29 A;  1FCC C;  2RP5 A;  1LM8 B;  1XCQ L;  5J8Y A;  4ECT A;  3C0R B;  3CIR B;  5KFP A;  3W5U B;  1V1P A;  4A20 A;  1Q3U A;  5AM3 A;  3TAQ A;  5IOI A;  2XIC A;  5DPT A;  3O65 B;  2C2D A;  5H8Y E;  4D2K A;  4ACO A;  5C5J A;  2QSD A;  3PTF C;  3TCA A;  3X23 A;  2LHE A;  2H88 B;  4ED6 A;  3RRG A;  2UYZ B;  2K8A A;  4CF5 A;  3K4G A;  5CHG A;  2OH2 A;  3MHZ A;  1IV8 A;  2YEP F;  3AQE A;  4WH4 A;  4OO1 J;  3BVZ A;  3KTQ A;  2QC8 A;  4PZO A;  1XSN A;  3NZ3 A;  1X9X A;  3JPO A;  3PO5 A;  1SE4 A;  4IWQ A;  3RCZ A;  2ZIV A;  2F8L A;  4K4I A;  2BKF A;  3T8M A;  3ISD A;  2GI9 A;  5AM0 A;  5E6N A;  2J42 A;  2QIE B;  2K6Q A;  4ZRP A;  9ICX A;  1LB2 B;  4FJV B;  4HKZ E;  1FRR A;  3CP8 A;  4EEY A;  5KFK A;  4DLG A;  4C4V A;  4J3O D;  2I9G A;  4M0W B;  1ROE A;  4S0R A;  3AU5 A;  4HPL B;  3AE8 B;  1TVA A;  4M8M A;  2CHX A;  3TSS A;  5J0Q A;  3FIL A;  4YR2 A;  3PSP A;  8ICF A;  3C2K A;  9ICE A;  7ICV A;  5BYQ A;  4I2I A;  3A4R A;  1L7Y A;  4BBN C;  1OTR B;  2BCV A;  1JQ4 A;  4KGT A;  2WAQ C;  1R4M I;  3QUT A;  3G6Y A;  3GIM A;  3H4D A;  2F1I A;  1EU4 A;  2INP E;  3TEW A;  5KT7 A;  5AZG A;  4W9K A;  2IBK A;  1UNS A;  4PS8 A;  3EC8 A;  3L08 A;  4DL3 A;  1IBX B;  3HM3 A;  2JY6 A;  1UPH A;  2RR9 A;  3QE9 Y;  4ZOH C;  2RLT A;  4QZ8 A;  2BQR A;  1FO4 A;  5FK9 C;  3V6H A;  2WF8 A;  2KTR A;  2MJE A;  3R9K A;  3WKA A;  2ZXH A;  4F72 A;  5KG6 A;  2WDR B;  3Q3N C;  3H9D A;  1HTQ A;  3HT3 A;  1Y88 A;  3F5E A;  3ORY A;  2UVV A;  1IYF A;  1JMS A;  1WH3 A;  4B9U A;  4NPN A;  5J8Y C;  8ICL A;  5KFF A;  2Q5W D;  1MFW A;  1L2N A;  5KFG A;  2KDB A;  5L1L A;  1HZ6 A;  2OOB B;  1SXE A;  4CF4 A;  4KLQ A;  4YTP B;  4W9L A;  4YD2 A;  3ZRC A;  3UQ0 A;  2N1V A;  3GZN B;  2BYV E;  2WGS A;  3BS5 A;  4G11 A;  3PW7 A;  1KFT A;  3UXP A;  3JPT A;  2PMZ C;  1ZQL A;  4S17 A;  2HBJ A;  3DBR B;  5IO9 A;  2RDI A;  5BPC A;  1ZQT A;  4ANV A;  5E6P A;  5AM4 A;  3IVF A;  1ZQQ A;  2ASJ A;  8ICU A;  4Q8F A;  5DG9 A;  2HCF A;  2RGF A;  2C7H A;  3IFW B;  4RQN A;  1KLV A;  4MGI E;  2CJN A;  1NJZ A;  3AE2 B;  4FBJ B;  1UGJ A;  5TSS A;  4HYK A;  5L83 A;  2WDV B;  4DO9 A;  1HTO A;  1Z4N A;  3URY A;  4AYB F;  3A33 B;  5JRT A;  2PMV A;  1WCN A;  2L32 A;  4BVU C;  2PFQ A;  3RMK C;  3GFK B;  5J2K A;  2HHS A;  3DBL I;  1ISN A;  7ICN A;  2XK5 A;  3BK2 A;  2KWU B;  3RI7 C;  4F2R A;  1PZN A;  1SXT A;  1QSL A;  4YWG G;  4EE2 A;  2PE6 B;  4RGN A;  1OFF A;  5AM5 A;  1TS2 A;  1M6Y A;  1VDV A;  2MBB B;  5ALR A;  3E9S A;  4MEX A;  1WFY A;  2GLE A;  2LRU A;  2I1J A;  4M01 A;  1P0R A;  3AE1 B;  1F0Z A;  4Q45 A;  4PH5 A;  2KJ8 A;  1DOX A;  2LI6 A;  4P7I A;  4I6N B;  3L3F X;  5J2H A;  4DXF A;  3AMZ A;  2EMS A;  2KDM A;  4Z6D A;  5DQG A;  4ELU A;  1J7C A;  1L4D B;  1Q1O A;  1WXM A;  3RUI B;  3DDH A;  3SEN A;  5BOL A;  1X9M A;  3H7P A;  1P9D U;  4EZL A;  4QZF A;  2K22 A;  1RFK A;  3QU9 A;  3L16 A;  2BPG A;  4RPY A;  1PGA A;  3CSF A;  4Y2Q A;  2D3A A;  1J0G A;  4FHK A;  1LQB A;  1F2R I;  4MSM B;  4AJW A;  4JK1 A;  4MGY E;  4ED3 A;  1S0N A;  3BDP A;  5J0S A;  3FC4 A;  1X9S A;  4ED2 A;  1NEK B;  4Q8E A;  1K5O A;  1ZOL A;  3H7I A;  3A4S C;  1JI7 A;  1CI4 A;  3AXC A;  3PPA A;  4P1B C;  3T9L A;  1KQQ A;  2R61 A;  3TAR A;  4CE6 A;  2VKQ A;  4W9I A;  3WAO A;  1UEL A;  2JVC A;  4OJO A;  2PVO D;  3Q8R B;  3M9M B;  1MVK A;  1Z5S B;  2IBI B;  2IYD B;  2WLB A;  3KYD D;  2IGH A;  3PSI A;  3APC A;  5EWE A;  4RGM A;  4HRS A;  2LPE A;  1FM0 D;  2ATL A;  3MFH A;  4UB1 A;  3OWE B;  2BVC A;  1D5X C;  4QIW F;  3U26 A;  5J2B A;  5D2M B;  3NVY A;  5DGB A;  4LLG M;  4KSL C;  2L0T A;  1L3T A;  5KFW A;  4BWM A;  1KN5 A;  4QNL A;  1N56 A;  3KLS X;  2XC9 A;  4HRO A;  5JZE B;  5J0Y A;  4FBT A;  1C4P A;  3PVX A;  4DQR A;  1QOB A;  3AEB B;  2YMM A;  3DV9 A;  3MR6 A;  1KSP A;  1AYF A;  3M8R A;  3HKZ C;  4TUU A;  4MF2 A;  3VUX A;  5KHO A;  4HJG E;  3V60 A;  2F77 X;  3I5J C;  5J2E A;  2D10 A;  3SQI A;  5ALK A;  9ICW A;  4KKI A;  3SEB A;  1UD7 A;  4XRH A;  4NLB A;  1M4V A;  3ML9 A;  4RUC A;  2XN9 C;  4L23 A;  5HI1 A;  2JXX A;  4O0I A;  3DBS A;  3AEV A;  1WX9 A;  4RUA A;  2B21 A;  2RSU A;  4GDK B;  3D32 A;  3GS2 A;  4UB5 A;  3E58 A;  5AI5 A;  3GQC A;  1WXQ A;  4GXI A;  5DCN A;  1A77 A;  3HW8 A;  8ICM A;  1XS9 D;  1YJ1 A;  4XZ4 A;  2BQQ A;  4NLZ A;  3MGH A;  2RRD A;  3UXN A;  2C2R A;  4UB4 A;  2EAM A;  1N2X A;  2XI9 A;  2OWO A;  1HIW A;  5GTH U;  2PFP A;  2N9L A;  1SJE D;  5J2D A;  2VJ5 A;  2E3T A;  3VUY A;  3B2G A;  2J52 A;  4UBC A;  2K1F A;  1FEH A;  1KFD A;  4OJL A;  4QZH A;  4DOC A;  1PUZ A;  2PW9 A;  3LYY A;  3AEG B;  4DXA B;  5IIO A;  2WXI A;  5DLG A;  5J2A A;  1N5W A;  1QF6 A;  1ZPS A;  4P0Q B;  1KLN A;  2PEA A;  2BPC A;  5LXI B;  2DF4 B;  1RYR A;  1MHX A;  4Q43 A;  1JWB D;  2PFO A;  4DOA A;  1X66 A;  2PXI A;  2CU1 A;  4IR1 A;  3H8W A;  2W9C B;  4R65 A;  3KBB A;  1ZQR A;  2DEN B;  2GOW A;  5AKG A;  4UAR A;  3WK8 A;  3GV5 B;  2XY5 A;  2XGQ A;  4KMU A;  3V62 A;  3M7D A;  1WXA A;  3FM9 A;  1J19 A;  4I2G A;  5IAA C;  1YQB A;  5KT2 A;  4TV3 A;  3R2T A;  1ZQW A;  4YR0 A;  9ICB A;  4UAS A;  4J6I A;  1CZP A;  1SWV A;  4ZRI A;  5AZH A;  2KMD A;  1ZD4 A;  2E8N A;  1ZQI A;  2MA9 B;  4PL1 A;  2AL3 A;  3ZDC A;  1V8C A;  1ZYQ A;  2ZCC A;  4P4P A;  5AKH A;  4XYC A;  2ZIX A;  2JX5 A;  3NS8 A;  1YQ4 B;  3ZKJ C;  4LCD E;  3QU5 A;  2KZZ A;  4FO6 A;  1D9F A;  1QSY A;  3GIK A;  1YNT E;  3LJ3 A;  2VA8 A;  1TTN A;  2KX3 A;  4GC6 A;  4NJ8 A;  2WXR A;  9ICG A;  1SZH A;  3IAM 1;  4N58 A;  1TV9 A;  4AUQ C;  1IBX A;  4XGA B;  2K6D B;  2RPQ A;  4BGD A;  4XDD A;  3ZXV A;  4F7Z A;  3AE9 B;  1F44 A;  3TJP A;  4JWS C;  5KFX A;  1TKE A;  3AED B;  2RD0 A;  5F3X B;  2LZ6 A;  4QAY A;  2AGQ A;  3QZ8 A;  4RQ1 A;  2AL6 A;  4PS3 A;  1VD2 A;  9ICF A;  3QXG A;  1UWX A;  3X0W A;  3LXF A;  1IIP A;  4TQ1 A;  4BX9 C;  4FS1 A;  3U8Z A;  4AQ7 A;  2WXQ A;  3NUQ A;  1X42 A;  3BZK A;  1ECW A;  4F4X A;  2OYY A;  5D46 A;  5KFR A;  1TK8 A;  1YJJ A;  4CCH A;  3A9J B;  2CU3 A;  3QX1 A;  4UB8 U;  5KFL A;  3WAN A;  1MN8 A;  4C00 A;  3BY4 B;  4BDP A;  1V49 A;  2IHM A;  3QAR A;  1IPG A;  4XA5 A;  2B76 B;  3PZD A;  2JWZ A;  1G6J A;  4DQI A;  4RQ5 A;  3V6K A;  3L5K A;  2K8B B;  5A0L A;  1UA0 A;  4MH8 A;  2HBL A;  4B0E A;  3QEB Z;  3Q8P B;  4J9K A;  2K4H A;  4EFO A;  1CMX B;  2YTU A;  4OW0 A;  4QZD A;  4LNO A;  4N59 A;  1WZ0 A;  1J8C A;  4RQ6 A;  8ICJ A;  1ZQN A;  2IGD A;  4F5P A;  3RTV A;  2KG5 A;  3ZNH B;  4RQ3 A;  1BNO A;  1T3Q A;  1L5U A;  2ESE A;  4UAT A;  1IP9 A;  2IOH A;  8ICN A;  2N1W A;  1C77 A;  4LNK A;  3HK0 A;  3D2S A;  3F53 A;  3MR3 A;  1NVI D;  9ICL A;  1V1P B;  2N1R A;  4UW9 A;  4RQ7 A;  4Y2P A;  3RH6 A;  3O13 A;  1QIL A;  1MQ2 A;  1EU3 A;  1KLG D;  2E5S A;  3WU2 U;  2ZVN A;  2HHT A;  2LUE A;  3S2A A;  3DBL B;  2MUT B;  4PYZ A;  2KIV A;  1WF9 A;  5KAF U;  4F3O A;  4U6P A;  4DFP A;  2GWS A;  5JXV A;  4RFB A;  1NKC A;  4PYU A;  1ET9 A;  4O3Q A;  3JW0 X;  2C7N B;  2W9B B;  4JUZ A;  1VJK A;  2MSE D;  4X5V A;  3WKE A;  2GLS A;  4EYI B;  2D11 A;  2BS2 B;  2AJQ A;  4IW0 A;  4KLL A;  1Z3E B;  2RDJ A;  3QYP A;  3MDA A;  2FBW B;  4NL9 A;  1BXT A;  1JXE A;  7ICP A;  2KIC A;  3FAH A;  3SDL C;  2BW2 A;  1F5S A;  4WAF A;  4RNM A;  5JTI A;  3JPP A;  1T0R C;  4HKQ A;  1WXS A;  2LD9 A;  2PIA A;  3KYC D;  2H3V A;  4C4V B;  2R2Q A;  1H8C A;  4EZ6 A;  3VH4 B;  2OJR A;  2ZCB A;  3QU4 A;  3FIL B;  4DDG D;  2IOF A;  2BGW A;  5GTI U;  2AU0 A;  1S5L U;  3RAQ A;  1DRG A;  1FNV A;  4QZ9 A;  1S0O A;  4KLU A;  2RMM A;  4DQP A;  2ZUB A;  5E6O A;  1WWT A;  2L1A A;  3TMP B;  3W5V B;  3J9C A;  1GNU A;  2J53 A;  2MW5 A;  3AI5 A;  5AKY A;  3GIJ A;  2F8K A;  2QB0 A;  1YN4 A;  1WJN A;  1KRH A;  2NR2 A;  5IIL A;  5ALI A;  2INC C;  4QZB A;  1T0Q C;  1TT5 B;  5HKH A;  1QKZ A;  9ICQ A;  4YMM A;  3TBL D;  1BPY A;  1K50 A;  1WY8 A;  4A8X C;  2GRI A;  2V1Y A;  2M4N A;  2KTR B;  4WWM A;  2WXJ A;  4FFD A;  3FDS A;  5HR6 A;  1Q10 A;  5D94 A;  1QTM A;  4MFC A;  2JXT A;  4DF8 A;  2ZJD A;  3RNB C;  4Z6F A;  3PNC A;  3DBH B;  2JUO A;  1XCT L;  4Z6E A;  4DSL A;  3BQT A;  2KC2 A;  4ECW A;  4II2 B;  3AUO A;  4KN4 A;  2LVP A;  2FI1 A;  4DK5 A;  1U4B A;  3C21 A;  4J9Q A;  3N3K B;  2PKE A;  1L0X B;  2HJ8 A;  2XNA C;  1STE A;  4UAZ A;  2KIW A;  1KJT A;  1CJE A;  1SIJ A;  2RQ5 A;  3RRH A;  1ZW7 A;  3ZVV A;  1E6E B;  3LVW A;  3BVG A;  1UZX B;  1KL9 A;  2KLG A;  1X2I A;  1WR6 E;  2KV2 A;  3KHR A;  1RYJ A;  4F91 B;  1Z1B A;  1U47 A;  4KIK B;  3AU2 A;  4PHD A;  1QLN A;  5DPW A;  2B0C A;  4QW8 A;  3C5F A;  1RRB A;  4LK0 M;  4KVG B;  4M47 A;  5JUM A;  2KK8 A;  3U30 A;  4A9A A;  5ALT A;  4JL9 A;  4NL9 C;  3IP4 B;  2WF9 A;  2HDO A;  1S1Q B;  1LKY B;  1XLP A;  3N9Y C;  4EX6 A;  3SAF A;  3PZP A;  1JWA D;  1FCL A;  4IL6 U;  1KRP A;  2PI5 A;  1XD3 B;  1HEK A;  3ONS A;  1UBI A;  4ZYS A;  2HHW A;  3M8S A;  9ICJ A;  2W8L A;  4J9M A;  1NBF C;  2KMM A;  2JZB B;  4F4W A;  2YLM A;  3FKY A;  4MAC A;  3ZDT A;  4QZI A;  4RQ2 A;  1MQ3 A;  4AWJ A;  1I35 A;  3K75 D;  5J0P A;  3PST A;  2V4R A;  3H0M B;  3OJS A;  2AX5 A;  2KWV B;  2REX A;  5AKL A;  5D4B A;  2YY6 A;  1ZXI A;  4TUR A;  2Y9T A;  4RGO S;  2BBC A;  4E71 A;  2UVU A;  2LAS A;  3M9N B;  3RR8 A;  2MWS B;  3C1Z A;  1IUE A;  2NCN A;  2YMQ A;  2VA2 A;  3KD3 A;  3BQ0 A;  1JRU A;  1SEB D;  2DAJ A;  1DXS A;  4XWW A;  3KHG A;  4ECU A;  2KE7 A;  1WIA A;  1NKE A;  2KFZ A;  4HVB A;  3VAW A;  1QH9 A;  1U49 A;  4CF3 A;  2HVI A;  1JRP A;  2HOQ A;  3MHS D;  2AHO B;  3LDA A;  3BQ7 A;  1ZKH A;  2IDY A;  3OSN A;  2WQY B;  5AK4 A;  2NRX A;  1P7D A;  3RFZ B;  1SWW A;  1SBB B;  3H7P B;  1T3N A;  5FR3 A;  3RBD A;  7ICJ A;  2MBH A;  5CRX A;  3C19 A;  3HIL A;  1EUV B;  3RNA C;  3ZJT A;  3RNG C;  1D5M C;  1COK A;  1C7Y A; 
#chains in the Genus database with same CATH homology
 1PFD A;  1NI3 A;  4NJC A;  4ZOH C;  3ZJV A;  1FO4 A;  3AM9 A;  5FK9 C;  4DXG A;  1TZO A;  1L0V B;  2MJE A;  3NVZ A;  3W2D A;  3IT4 B;  2WDR B;  1VZ8 A;  1ZDX A;  3GB1 A;  5HHD G;  1I4R A;  3B9J A;  3HRD D;  3AE5 B;  1PDX A;  5EE1 A;  1GOZ A;  1ENF A;  5BYR A;  2Q5W D;  2NTS A;  2WNM A;  2V3P A;  4OHJ A;  4ZRQ A;  1HZ6 A;  1I4P A;  2KAJ A;  4YTP B;  2IJ0 A;  1I4G A;  3VRB B;  4TQ0 A;  1SE2 A;  4USA A;  1E10 A;  1B9R A;  1XLN A;  1ZDV A;  2BT6 A;  2VZK D;  2Y5P A;  5HFY A;  1JWM D;  4NAM A;  1BUI C;  1CK1 A;  1HEZ E;  2JSV X;  2NTT A;  1HA5 A;  2WU2 B;  2WXH A;  4NAW B;  1N60 A;  3P4R B;  2I38 A;  4US8 A;  1TS3 A;  4YSY B;  3NVV A;  1XLQ A;  1Y56 A;  2CJN A;  1ESF A;  3AB5 A;  3AE2 B;  3BK1 A;  1E7P B;  1UGJ A;  5TSS A;  2WDV B;  2BTE A;  4UDU C;  3ETR A;  3URY A;  2PMV A;  1VRA B;  2Z8L A;  2L32 A;  4CQN A;  3C8Y A;  4KKJ A;  2VZK B;  3Q8A A;  2M56 B;  3EUB 2;  2JWU A;  5G5H A;  4C56 C;  3BK2 A;  3VQI A;  3T3N A;  2PKO A;  1GB4 A;  1SXT A;  1J7B A;  1MHH E;  4YWG G;  4RGN A;  4EE2 A;  1OFF A;  1TS2 A;  1VDV A;  2BS4 B;  4M0W A;  5G5G A;  3E9S A;  1T6B X;  2BB5 A;  2EEL A;  4KGS A;  1KFY B;  2FE8 A;  3AE1 B;  1F0Z A;  5MPO A;  2J4X A;  2DYO A;  2M19 A;  3BWU D;  1DOX A;  3AN1 A;  3R8B A;  4DXF A;  3AMZ A;  2JQR B;  4MM3 B;  2KDM A;  2QJL A;  1L4D B;  1J7C A;  2V0G A;  4IDI A;  2JU6 X;  1C4C A;  3VR9 B;  4A55 A;  4AS1 A;  1ZXH A;  1I4Q A;  1FD6 A;  2W55 A;  1D6E C;  3PO0 A;  1NYR A;  1RFK A;  2K22 A;  4RF0 A;  2IGG A;  4ITK A;  4A6Q A;  1PGA A;  1GPX A;  1N5X A;  3AH7 A;  1EM7 A;  1LO5 D;  2Y5C A;  3IXS A;  4XE0 A;  1QT9 A;  3VRA B;  1F2R I;  4OZC A;  5BMI A;  2WXM A;  3NVW A;  2KAC A;  3FC4 A;  1NEK B;  2KWD A;  2RDH A;  1D4B A;  1DOI A;  2ACZ B;  2SAK A;  2K5P A;  2R61 A;  4C80 A;  1E0Z A;  1SF0 A;  1NYQ A;  3B2F A;  4RCO A;  2PVO D;  2PTL A;  1MVK A;  2WLB A;  4RGM A;  5BMH A;  2IGH A;  2K9X A;  3EA6 A;  4HRS A;  3P42 A;  5GXG B;  1FM0 D;  4JX1 C;  3SFD B;  3OWE B;  3VR8 B;  1WSP A;  4RH6 A;  1D5X C;  2N9K A;  3NVY A;  2DWQ A;  4LLG M;  5H92 C;  2WP9 B;  5C3J B;  4YTM B;  3KLS X;  1E9M A;  2G9H D;  4HRO A;  5HG2 A;  1N63 A;  3NS1 A;  1EWC A;  2CJO A;  4GLS C;  2DLB A;  3KQ4 A;  1C4P A;  1QOB A;  1HXY D;  3AEB B;  4GDL B;  1AYF A;  1K52 A;  1DOY A;  2AQ2 B;  4FXC A;  4KGR A;  4C7Y A;  4HJG E;  1YMH E;  1OQR A;  1ZOY B;  3KWV A;  4KX6 B;  1QOA A;  1TS4 A;  2WDQ B;  1R7S A;  2RDG A;  3MP9 A;  4KKI A;  3SEB A;  5BYS A;  1PYW D;  3AE7 B;  1M4V A;  1QOF A;  1SE3 A;  2WXP A;  2XN9 C;  4L23 A;  5HI1 A;  4ARC A;  5EE0 A;  4GDK B;  3GS2 A;  4NZL B;  1JCK B;  4XWT A;  1WXQ A;  2W54 A;  1TKY A;  1TY0 A;  3TEZ A;  3TUO A;  4OZB A;  1DYQ A;  1C78 A;  1JWS D;  1QOG A;  3BYY B;  2PVG C;  3EGR A;  3W1S A;  2N9L A;  1YN3 A;  2EKI A;  1SJE D;  3Q8B A;  1XEE A;  2E3T A;  3B2G A;  2J52 A;  1FEH A;  2PW9 A;  3LYY A;  3AEG B;  2W82 A;  2WXI A;  1QF6 A;  1N5W A;  1ZPS A;  4RGT A;  2N0S B;  2RPV A;  1NEN B;  1MHX A;  1JWB D;  3KWL A;  4ARI A;  1AW7 A;  3Q69 A;  2INN E;  2LMC A;  1V1O A;  1MI0 A;  2W3S A;  2LEK A;  1ET6 A;  2DYM A;  2YEP B;  4XDC A;  2MJ3 A;  2WXL A;  4YT0 B;  3TEY A;  1DGJ A;  3Q8C A;  1T5X D;  2LJI A;  3R2T A;  3Q8E A;  2AQ3 B;  1F2R C;  3SFE B;  4YTN B;  4PT5 A;  1CZP A;  1TYG B;  4C7Z A;  1FMA D;  1FXA A;  2HTM E;  2QMT A;  4MT5 A;  1D5Z C;  1KLU D;  3U7Z A;  3H8H A;  4A90 A;  1V8C A;  2M0A A;  1FXI A;  1KTK A;  2KQ4 X;  2JX5 A;  5EE3 A;  1YQ4 B;  3PZ8 A;  1BML C;  1FNW A;  1L0Y B;  1TKG A;  1GAQ B;  2TSS A;  1JAL A;  1ZUD 2;  1YNT E;  3U2S C;  1XO3 A;  1FNU A;  1EWY C;  2WXR A;  3MFG A;  3IAM 1;  4N58 A;  2LHD A;  3BYT B;  3U52 E;  1IBX A;  4XDD A;  1I7H A;  3AE9 B;  4JWS C;  3AED B;  1TKE A;  2H89 B;  3BVM A;  2ON8 A;  1VLB A;  1RM6 C;  4R3D A;  1UWX A;  3DWG C;  3LXF A;  3I57 A;  2N7J A;  4TQ1 A;  4RF1 A;  2GB1 A;  2LUM A;  4AQ7 A;  2WXQ A;  3P4P B;  1VZ7 A;  5BMG A;  3P1M A;  2WS3 B;  3ZYY X;  4ZHO A;  4LTU A;  1YJJ A;  3Q8F A;  2PLP A;  2CU3 A;  2FUG 1;  1XLO A;  1MPE A;  3AE3 B;  4RNA A;  4P16 A;  2BS3 B;  1A70 A;  2B76 B;  4IKG A;  3R2I A;  4MH8 A;  2MEK A;  2L83 A;  4B0E A;  1SSN A;  3AEE B;  3WCQ A;  3HUI A;  3NRZ A;  4OW0 A;  1PGB A;  4HEA 1;  1P7E A;  4N59 A;  1JML A;  2Y3A A;  1N62 A;  2X38 A;  4WUR A;  3ZGZ A;  2IGD A;  1HQR D;  3AEA B;  1T3Q A;  2WXK A;  1C79 A;  1WGK A;  1C77 A;  1QLB B;  5AUI A;  1SB3 C;  1NVI D;  1L6U A;  2K0P A;  1V1P B;  2AQ1 B;  4P6V F;  4L1B A;  2KN4 A;  3O13 A;  3ABV B;  1QIL A;  2ZW0 A;  3W9C B;  1EU3 A;  3U4E G;  1YJI A;  1KLG D;  2I2Y A;  1AWD A;  5C2T B;  3GP7 A;  4OZA A;  3L4P A;  1C4A A;  1FFV A;  2IPK D;  2OED A;  3P4Q B;  5D3D A;  5JXV A;  4JWU C;  5T8I A;  4RFB A;  3I9V 1;  1ET9 A;  3P4S B;  1J7A A;  1V97 A;  2QIL A;  1WRI A;  2WXF A;  2BYT A;  1RWS A;  4DQO C;  1AN8 A;  1VJK A;  2E6X A;  4WIP A;  2LGI A;  3V3X A;  2BS2 B;  2WXN A;  3LB8 C;  2FBW B;  5AUK A;  1BXT A;  1ACC A;  1TS5 A;  3FAH A;  1B1Z A;  2BW2 A;  2HDE A;  4WAF A;  4HKQ A;  2PIA A;  1N61 A;  3IT6 B;  4B0M A;  1K53 A;  4N6E B;  3DWM A;  3FIL B;  1SJH D;  1FNV A;  1P7F A;  2WXO A;  2RMM A;  1FFU A;  1VR9 A;  1WWT A;  2L1A A;  2NMQ A;  2WU5 B;  3T3O A;  2WXG A;  5E6J A;  2V4I B;  3W5V B;  3UI3 A;  1JRO A;  3J9C A;  2MJD A;  1YN5 A;  2QEJ C;  2J53 A;  4TMA B;  1XF5 L;  1TJE A;  1XXG A;  1YN4 A;  4JPS A;  2ONQ A;  1ZE3 D;  1F77 A;  5I4D A;  1KRH A;  3BII D;  1I4X A;  1L4Z B;  1KF6 B;  3AE6 B;  1QKZ A;  4YSZ B;  1K50 A;  3BZD B;  4A8X C;  2GRI A;  1CQV A;  2ICI A;  3TEX A;  4WWM A;  2WXJ A;  2L52 A;  1WYG A;  3AEC B;  2K3U A;  1Q10 A;  4ZHP A;  1JW9 D;  2JXT A;  1IGD A;  1L6V A;  3ZJU A;  3E56 A;  1XCT L;  1C9F A;  4YXD B;  4O1N A;  2LFI A;  2OHF A;  3HVD A;  1QQR A;  4IOI E;  3SR6 A;  1L0X B;  3NUH B;  2XNA C;  3V05 A;  2SEB D;  3IAS 1;  2D5G A;  1STE A;  1VZ6 A;  3PZ7 A;  1I4H A;  2V3N A;  1CJE A;  1HZ5 A;  1SIJ A;  1UUP A;  1E6E B;  1FCC C;  3BVG A;  1XCQ L;  3CIR B;  1FIQ A;  2G1E A;  1K51 A;  3W5U B;  4JE3 B;  1V1P A;  5EE9 A;  1RYJ A;  3AV8 A;  2JYT A;  2ZW1 A;  5H8Y E;  1PUT A;  4D2K A;  4LK0 M;  4A9A A;  1OQQ A;  2QSD A;  1TY2 A;  2LHE A;  1C76 A;  2H88 B;  5FKA C;  1XLP A;  3N9Y C;  1JWA D;  1FCL A;  4US9 A;  4H2A A;  3MHZ A;  4ZYS A;  2YEP F;  3AE4 B;  2KMM A;  4WH4 A;  3BVZ A;  4MAC A;  1FRD A;  3NZ3 A;  1SE4 A;  2JZP A;  1ZP0 B;  2AX5 A;  1JWU D;  1IGC A;  1GB1 A;  3HVZ A;  2DBY A;  2GI9 A;  5LNK 1;  4REZ A;  1ZXI A;  2J42 A;  1YQ3 B;  2QIE B;  4ZRP A;  4RGO S;  3MC0 B;  5D3I B;  2BBC A;  1UWM A;  4HKZ E;  3RPF C;  1FRR A;  1L5P A;  4J3O D;  5D7G A;  1ROE A;  1IUE A;  3AE8 B;  3MJ5 A;  3TSS A;  3FIL A;  1SEB D;  4XWW A;  2W3R A;  3AEF B;  5BYQ A;  1JRP A;  1KH0 A;  4YSX B;  4KGT A;  1JQ4 A;  4L2Y A;  3P63 A;  4TSS A;  1EU4 A;  2INP E;  3TEW A;  2IDY A;  3CWI A;  4WQM A;  2WQY B;  2JYE A;  3RFZ B;  4Q2J A;  1PGX A;  1SBB B;  1UNS A;  4OVZ A;  5FR3 A;  1IBX B;  3ZQ4 A;  3ZJT A;  1D5M C;  2BB6 A;  2MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...