1N62A

Crystal structure of the mo,cu-co dehydrogenase (codh), n-butylisocyanide-bound state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n62A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n62A01
4P6VF 3WCQA 1N5XA 1WWTA 5EE1A 1ROEA 4A9AA 1JQ4A 1AYFA 3NVWA 3AEGB 3CIRB 1NYQA 5C2TB 1YQ3B 1TKEA 3W5UB 1GPXA 3AEDB 4HROA 1RM6C 2BS4B 1N60A 4YTNB 4N59A 1WGKA 2WDVB 2PKOA 3AB5A 4WWMA 3VRAB 1VJKA 4JWUC 1TYGB 2CU3A 1DOXA 3LXFA 3P63A 1CZPA 1OQRA 1TKGA 1QOGA 1B9RA 2LEKA 2WQYB 1E7PB 1J7CA 2CJNA 3PO0A 3AMZA 1F0ZA 3FC4A 5G5HA 3P1MA 2AX5A 5EE3A 1OFFA 1NENB 1PUTA 2EKIA 4C80A 2OHFA 1XO3A 1N62A 2K5PA 4N6EB 1FXAA 2M19A 3AH7A 1FM0D 1TJEA 1KRHA 1PFDA 3SFDB 1JWAD 1NVID 5MPOA 5C3JB 4US9A 1DOYA 2G1EA 1UWMA 1ZP0B 2BT6A 4ZHPA 1JW9D 1R7SA 3AE6B 3HUIA 3LB8C 1KF6B 3ETRA 1QT9A 1SB3C 1ZXIA 5H92C 1RYJA 4YSXB 2L83A 2WDRB 1JALA 2BS2B 1GAQB 4YTMB 2H88B 2CJOA 2MJEA 3FAHA 4JX1C 4N58A 3EUB2 3AE8B 5AUIA 4IDIA 3HRDD 2W55A 1FO4A 1EWYC 4US8A 1JWBD 2K9XA 2L52A 2JX5A 1L5PA 1RFKA 5G5GA 4ZOHC 4YSYB 1I7HA 2W3SA 1CJEA 1NI3A 1J7AA 1N61A 2KMMA 5H8YE 2Y5CA 2DWQA 2WU5B 4ITKA 3ABVB 2M56B 1L6UA 2JQRB 3ZYYX 2K22A 3NS1A 2W54A 1ZUD2 3AECB 1DOIA 1QLBB 4USAA 1FFUA 1E6EB 1SF0A 2FBWB 3VR9B 5EE0A 3L4PA 4YSZB 2W3RA 1E0ZA 1VLBA 2HTME 3KWLA 1V97A 4HRSA 3AE4B 4LTUA 3SFEB 1E10A 1YQ4B 2WS3B 1QF6A 3P4RB 5GXGB 3NRZA 1FIQA 1YJIA 2MH7A 1OQQA 1XLQA 4JWSC 2DBYA 3VRBB 3AEFB 1FRRA 1L0VB 1QOAA 1WXQA 2WLBA 1J7BA 3AV8A 1YJJA 1T3QA 2N0SB 1SIJA 1RWSA 3W5VB 1JRPA 1FFVA 3AN1A 1A70A 1QOFA 1FXIA 2KAJA 2PVOD 1VDVA 1DGJA 3AE7B 2QIEB 4YTPB 1NEKB 3BIID 3P4QB 3VR8B 2Q5WD 1XLNA 1V8CA 3DWGC 4FXCA 1ZOYB 3B2FA 4KX6B 1IUEA 1JROA 4ZHOA 3AEEB 4YXDB 2WU2B 1L6VA 2PIAA 4C7ZA 3AE2B 4WQMA 3DWMA 3AE9B 3AM9A 1N63A 2ACZB 2MJ3A 5EE9A 1WRIA 1AWDA 1FMAD 1XLPA 2MJDA 3AE1B 1KFYB 2QJLA 5AUKA 2B76B 3AEAB 3P4SB 1E9MA 1TKYA 3SR6A 1XLOA 3AEBB 2WP9B 1N5WA 1WYGA 3AE5B 3AE3B 3NVVA 3P4PB 2WDQB 1PDXA 3HVZA 3W9CB 3CWIA 3B2GA 3NVZA 1NYRA 2E3TA 2H89B 4C7YA 3NVYA 1FRDA 2PVGC 2BS3B 4YT0B 3RPFC 3B9JA 1QOBA
chains in the Genus database with same CATH superfamily
3A9JB 3I63C 1WWTA 2OJRA 3QU2A 3V60A 3NVWA 2HBKA 3BK1A 4WAFA 4B9KA 2WXPA 5C1ZA 1F52A 4LK0M 4RPXA 2JXJA 4WJNA 2AQ0A 4ECRA 3OJUA 3AU2A 4RGOS 4JL9A 2VANA 4UB1A 3LXFA 1TS5A 2Q0ZX 3KUDB 3M62B 4TQ0A 4W9JA 2KX0A 1H38A 3FM9A 2WB1C 4CRXA 3QE9Y 3Q3NC 2A3VA 2DYBA 1PUTA 1GJZA 3LVVA 1S0VA 4ANVA 4RU9A 2YMLA 3V7JA 2R2QA 3PVLA 2M8SA 4NM2A 3M95A 4CDGA 4RF1A 4BGDA 1DGSA 3IFWB 3Q14C 1WXMA 5DCNA 3ZDCA 2C2RA 2KDEB 4K7UA 4F3OA 3GV5B 1T8EA 4Y2XA 3MFIA 3AE6B 2VA8A 2RDHA 4NJ6A 3BQTA 2KJ6A 4DXGA 1E8ZA 4KLUA 1NZBA 4L23A 4DK5A 4N58A 2M9NA 2MLBA 5TISU 1YN5A 4IDIA 5LNK1 4ECQA 2K9XA 2BQQA 3BS7A 7ICUA 1RFAA 2JVCA 2KE7A 2JEIA 8ICVA 2DX5B 5CHGA 3KHLA 3ABVB 3TL5A 1ZXHA 2BCSA 3DHGC 4I2GA 4QZDA 4KDIC 2EAOA 4EEYA 2IGGA 3PW2A 1NK7A 1P7EA 8ICEA 2LASA 3VAWA 4IG7B 3GFKB 2AGQA 2K8HA 3WK7A 4RQ2A 3BY4B 1QSYA 3CSFA 4LTUA 2LI6A 5ALHA 3ZDBA 4A90A 3APCA 3P4RB 4ECSA 5DG9A 4NJ8A 2XC9A 2D5GA 1RQNA 3VRBB 3PTFC 1VJ5A 4NWIA 5ALKA 4QZIA 5AK4A 4UARA 2GRIA 2H3VA 2YY6A 1COOA 1VDVA 4O3QA 3WALA 3BIID 3UXOA 7ICLA 2CN1A 1A0PA 2WXHA 4CNQA 1UGJA 5TZVA 2UVRA 4F8RA 5AKYA 3KKAC 4KKIA 4NQLB 3LDAA 4C7ZA 3EPIA 3AM9A 4UAWA 3K1ZA 1S10A 4RQ6A 2MJ3A 3DPDA 3MC8A 4NNJB 4LDTB 3MFGA 4KLOA 2DYMA 2AXTU 4EEWA 1NJZA 4DL7A 1NK8A 2KVSA 4IRKA 1HTOA 1AQ6A 2ZUCA 8ICUA 1WRDB 2LYBA 2BCRA 2JWZA 3LYYA 1I35A 2JUOA 4ED8A 2JV3A 4DQSA 9ICIA 1R4NB 5D94A 5G55A 1NOMA 3GIIA 4C4TA 3NVYA 4FJVB 4QIWF 4Y2RA 2CRXA 4MACA 3QCAA 3PHXB 4JB3A 4WQOB 1N5XA 1ZETA 4RM9A 4RQ5A 2O6VA 2RMMA 2ESEA 4I2IA 2HBJA 2GLEA 3M6KA 7ICPA 4QZHA 5KG7A 4YMMA 1RXWA 2WF8A 1XU4A 4M2YA 2G06A 2PKOA 4ZYSA 3PSIA 5ALRA 5CP2A 4F4ZA 1T0RC 3P63A 3PZ7A 1SIFA 1GNUA 1KJTA 4PL2A 2MP2B 1E7PB 2KNJA 4JLCA 5G5HA 3VTWA 5L1KA 2GH1A 5J2FA 5C0YA 1UZXB 8ICCA 3PMLA 2HBMA 1BPZA 3IM1A 1SE3A 3L13A 4LDTD 3OLMD 2DF4B 4DSIA 1SV4A 1JWAD 5F3XB 4TV3A 3QZ7A 5DBAA 4A3OA 4UAYA 1TIFA 2A1JA 5DLGA 1R7SA 4K4IA 4HWIB 4P0QB 1RYJA 4HEA1 2RPVA 3IBEA 2JRIB 3BJYA 5AI4A 4DS4A 1PVRA 2N9EB 3PRPB 5DGBA 1TS2A 4F92B 2NBUA 2F44A 3QEBZ 2I6XA 2UU7A 4C00A 4ZOHC 3MGHA 2L5YA 2W3SA 3ZDTA 8ICWA 3OHAA 2DGZA 1ZJNA 2YLMA 2DWQA 7ICHA 3MJ5A 4F4WA 1F9JA 1FNVA 1SV0A 2HDOA 2MP2A 3KYDD 9ICJA 1V5OA 1WR6E 3I76A 3Q8LA 1QLBB 2FJ6A 3QIJA 1HEKA 4P4PA 5KFKA 4A8XC 3LYSA 4Y2TA 5GTHU 7ICRA 2ES6A 2KJ5A 5IIJA 3C28A 2FPKA 3RJHA 3N28A 2M0AA 2REXA 1ET6A 2K3UA 2QKQA 3NRWA 4E0DA 2NS5A 4EKUA 2FPLA 2JH1A 4QIWC 9ICKA 1L0VB 2WLBA 4EBCA 3PVXA 1HE8A 4W9DA 5CWRA 4R64A 1Z5SB 4P0QA 2J0KA 3X23A 3V62A 2HOQA 2WDTB 2NRZA 4ED2A 3Q3JA 1KDHA 3J81j 4KZ0A 4WAAA 4XGAB 2ZJ8A 5J2AA 5KFMA 4QZEA 5J0RA 2AGOA 3NOBA 4OVVA 4RCOA 3NJTA 9ICNA 5J17A 2F77X 3UMGA 4QWBA 4MJSA 1MN8A 4RNMA 3U8ZA 4X5VA 2AH5A 2BR0A 1QSSA 2QJLA 8ICBA 2PI5A 2HJ8A 4EX7A 2V1YA 4AQ7A 5JZEB 5DB9A 4M9GA 2WHEA 3V6EB 2FMQA 1SSNA 1UWXA 1V81A 2H3FA 1QQ6A 3PV8A 3B1LX 5IO9A 4ICVA 1X2IA 2J0JA 3MR2A 2NRXA 2J6SA 5L9XA 4WJPA 3ZUNA 2LD9A 3RB3A 1HUOA 2FCQA 3M9OB 1XSLA 2ZIUB 3HIZA 4MHVA 1JQ4A 3CIRB 1ZQUA 4WWPA 3WK6A 1X9SA 1LXDA 2D3DA 2LFIA 4BUGA 2KHQA 1U4AA 1TV9A 3AB5A 2EDUA 3U4EG 2KJRA 2C7HA 1TYGB 3GS2A 1QKZA 5HHIA 4YMNA 2D3AA 1ZQDA 2KFKB 2BHNA 4DL3A 1O03A 3DOWA 3C1ZA 4OZAA 3P1MA 3PHWB 2IPKD 5HP4A 2FE8A 5FR3A 5ALZA 2G45B 4EFOA 9ICPA 4BKSD 2BKFA 1B43A 3PR5B 2ALZA 3WU2U 1ZQEA 5ALWA 4JUZA 2KQ7A 1KRHA 3DHHC 3HM3A 4W9GA 2KD0A 3C5FA 2IBKA 4I2HA 1TE2A 1FNUA 4NLCA 5J0PA 4I2CA 2HCFA 4RQ8A 4F50A 1S97A 3RCZA 2IMWP 4HXDA 3I5JC 2WF7A 3HPOA 2IGHA 2KKCA 4TQ1A 2ZIUA 4RQ3A 1WMHB 5AUIA 4MH0E 3H0MB 2W55A 2W43A 1FO4A 1D9DA 3UQAA 1XCQL 3SAHA 4DSEA 2GI9A 1IGDA 1J7AA 5H8YE 1S0NA 3QYPA 4NL9C 4EOYA 4B0EA 2AHOB 3H8SA 2B3AA 3SYZA 5C23A 3H9DA 1LM8B 1WCLA 5AM2A 3M8RA 1T0YA 4WJ3B 9ICWA 3ZDMC 1UD7A 3VH3B 1KFSA 2JMGA 1WX9A 2ZIXB 1CEZA 3W1YA 1WH3A 2KMAA 1S8OA 4WWOA 1ZQTA 3KQ4A 2DZKA 5TR5A 2FIFA 3SFEB 1IYFA 1Q0WB 4F5QA 5J0OA 4Q43A 2KWCA 4BBNF 1OQQA 1F5SA 4TUPA 1SGHA 1TBEA 2K1FA 5E6PA 1WG8A 4UASA 3AN1A 2KAJA 1JXEA 2FNJB 4RQNA 3G6VA 4FZLA 1MG8A 2OEDA 2P35A 1ZRMA 3B2FA 5IOIA 5KHQA 1JROA 2KG5A 4RUCA 4J9KA 1FCCC 2FDRA 4TSSA 2I2YA 2PLPA 4P0PB 3RULA 2A19A 4ARCA 2XY7A 3U7DA 2GBKA 2GOLA 3RT3B 2IZVB 3VTVA 4K4HA 1D3ZA 1A76A 2L7RA 4GC7A 2LGXA 5ALNA 2LGYA 3AE3B 3BINA 5J2BA 3NVVA 4HDOA 1D8YA 1WJ6A 4DSFA 1SXEA 5ALVA 2HHVA 3ZLZA 2NRTA 4GIVA 4FO6A 2ASQA 4ECYA 2G4DB 1JUDA 1OEYA 4ANWA 1JWSD 3EFCA 2M4NA 2N7DA 4A9AA 1TK8A 2LHEA 2WXRA 2I1KA 4BKTA 4B6WA 1WGRA 1WGKA 1WGGA 2K89A 2WDVB 4WJOA 2XI9A 4DOCA 1B0XA 2LVPA 3SD7A 4DF8A 2CU3A 3B0XA 2HHXA 4MFCA 1EU4A 2K6QA 1KLUD 5KT7A 4KSKC 2MSNA 1YJ1A 3QX1A 3MGVA 1MHHE 3N9YC 3QHTA 3VTUA 4P0PA 1GC7A 3KHHA 3APFA 4IWOA 3ORYA 2WX1A 2K8CB 1X6IA 2PMZF 5ALLA 1C79A 2C5LC 4W9CA 4FJZA 1Z4OA 1L5UA 2WYQA 3EECA 2J52A 3VXWA 1DOYA 1WI0A 1C4PA 3WKEA 2EKEC 2G1EA 1X1MA 2N7JA 4PZOA 4PK1A 5DPSA 3L0WB 1U48A 2BYFA 3F5EA 3TACB 4TQSA 1S0MA 2I1JA 2KVRA 3Q8MA 4J3OD 4BBNC 2H88B 5AICA 2CJOA 3H4DA 2VZKB 3TUOA 3EUB2 1PK3A 3N1XC 1YN4A 4O1NA 1K53A 1ZQVA 2CHXA 4S17A 2G07A 5C2TB 2KTRB 3ZRCA 3FYHA 3DCGA 3R3MA 5J2EA 2FI1A 4KLTA 3PLUA 2FCSA 4YR3A 1L4ZB 2YN4A 1M4VA 4M01A 4HPLB 4FBTA 4KLSA 4DLGA 2AL3A 3NS1A 4I2JA 4YMOA 7ICIA 1SF0A 5KFFA 4W9LA 2NYVA 5AK3A 5EE0A 4W9KA 2BQRA 4ECUA 1N6ZA 2K8CA 4M8MA 2JR5A 1YQ4B 2VJ4A 2PE6B 3PW5A 4YN4A 1SWVA 9ICGA 1ZQXA 4JWSC 4FBUA 1X9WA 3PZPA 2D6FC 3URYA 5AEKB 2QC8A 4O3PA 3BK2A 4ZRJA 7ICTA 3DVGX 1ZQOA 3ZI4A 2VZKD 4DFJA 3PGEA 4UB3A 1V2YA 4RGNA 5J0TA 1L8LA 2L00B 2WF6A 3U7ZA 4ZHOA 2L0FA 2DFLA 3DBSA 3NS8A 1ZQLA 1OTRB 2YEPB 2BB6A 4BOZB 2LPEA 2L76A 4DWIA 3H7PB 5KFTA 1BPBA 2VRRB 1J2MA 1N63A 3R8BA 4NM1A 4ZRPA 5J0XA 3AE1B 4P16A 3V72A 2Z7JA 4CE6A 2W03A 2SAKA 5D2MB 1VZ8A 4F4XA 2OEHA 1X6JA 5D6JB 3IXSA 2PMZC 2IO1B 2JEGA 1FEHA 2BYTA 3NVZA 1EWCA 1EF5A 1K52A 4ZYNA 5AM3A 3K1RB 5BOLA 4C56C 4OO1J 1ZQMA 2ZIVA 1E8XA 2ON8A 5IIOA 2K4EA 2HMXA 2W8KA 1N2XA 2YTUA 2NO5A 4NPNA 3JPOA 3Q8QB 5IIKA 5ALJA 1T5XD 1PVQA 1IM4A 1V38A 3JPNA 1K8RB 4M0AA 4PL1A 5D4BA 4A55A 5J8YC 2LXCA 3MC1A 1Z19A 2NR2A 3C29A 3T79A 1TS3A 2K25A 4Z6CA 3H8MA 4I6PA 2GBMA 3H8WA 3HKZC 2V4IB 3UXNA 4YXJA 2AWTA 5AHXA 5J0SA 3ZNGC 1TJEA 4UAZA 4CQNA 4C8LA 2DZIA 2ZVOA 4US9A 5J2CA 2WAQF 3RNEC 3H6NA 3C23A 3EZ5A 2H3QA 3BYYB 3PX4A 2W9NA 3ETRA 4C8MA 4WIPA 4YR0A 1A5RA 5KG5A 5AZGA 4R3DA 2ISOA 4XQ8A 4CF5A 4GOCA 7ICFA 4DHZE 5KFEA 4GXBA 1YIWA 4BKGA 4DCCA 2LZ6A 4CF4A 4GB9A 7ICGA 4QZ8A 1WUDA 3GV8B 1RFKA 1V86A 5J2HA 4I28A 3V3XA 3MGIA 2OXOA 3F2CA 3WKAA 4ASWC 5HG2A 3L08A 4GLSC 5HMMA 5DDYA 5FK9C 2ZTCA 1SXTA 5KFIA 1GC6A 1ZQCA 1XT9B 1RPLA 4IL6U 3OSNA 2JHDA 2KNBA 2Q4TA 1HJPA 5GTIU 2BPCA 3L4PA 5D49A 3NZ3A 2G9HD 3C2KA 3I9V1 4DFKA 5BYRA 3RYTA 1D5MC 1Z1BA 4LLGM 5J29A 2KC1A 2KQ4X 4BZAA 2NRWA 4UDUC 2DBYA 2N1WA 3QAQA 5HI1A 3ZJUA 4Y2SA 5DLFA 1SE9A 2L8JA 2XGPA 3SI8A 3PO4A 8ICZA 4P2HA 2OYYA 5ALUA 3T5KA 1UGMA 4GU2A 2N7EA 2XVTA 2ZVNA 2K39A 4QAYA 4GFJA 4UQGA 4LZGA 4XRHA 2WWZA 2IOHA 3Q3FA 3R7RA 4KLHA 1ZOYB 2RDJA 1X9XA 2N9LA 2NTSA 2KKPA 1CQVA 4RF0A 2WU2B 3WA0A 1UA1A 1KLVA 4EZLA 3MTNB 1OXJA 2ACZB 2ZNVB 4Q8FA 2R8HA 3F5AA 4PHPA 1JX4A 2MU2A 3UQ2A 3AEVA 3P4SB 3R7QA 4NLBA 3P4PB 3PW4A 3T3FA 1D5XC 3DV9A 2WDQB 4W9EA 3ZQ4A 3KHGA 4PPXA 1KLGD 1ZQNA 3D32A 4WJQA 1Q8KA 4O3NA 3VC8A 2PJHA 2BWES 2C60A 4S0RA 2MAXA 4MGYE 5ALMA 2LYAA 4M0WB 1ROEA 4BXOB 1K1SA 1YMHE 5CJ7A 2KWVB 2MEKA 3A9KB 4LJPB 3OJ4B 2FAZA 3VUWA 5T14A 2KOBA 4CO7A 4E71A 2VA2A 4GDKA 3KH0A 1LVHA 1QH9A 4QNLA 2CU1A 3ZVVA 1MC8A 3VCBA 4GLXA 1F0ZA 2RP5A 3JSVB 3FC4A 4B9VA 2G4SA 5EE3A 3PREA 5J18A 3TFSA 3CP8A 4A6QA 1MJDA 2K5PA 4OW0A 2EAMA 1RG6A 2LYHA 3VDZA 2BGFA 4RH6A 2E8OA 4UW9A 2KXJA 2LMRA 1J8CA 5B66U 5KG4A 5CA7A 5LXIB 3UMBA 3RBDA 3RH6A 1NK0A 3RNCC 3O13A 2N1RA 2E5SA 1UWMA 3MBYA 4II2B 4E3CA 3K4GA 3LB8C 4MH8A 2N1VA 2BQ3A 1TAUA 3RAQA 2E1FA 3A0BU 4KZCA 1JALA 4QWDA 4B9TA 1KRPA 1GAQB 1R4MB 2PMVA 1KTQA 2KQSA 3IP4B 2A4ZA 4XWWA 1KQQA 4JK1A 3KVFB 2QMTA 3A9KA 4FULA 3GZFA 4KDLB 2LBOA 5HR7A 5G5GA 2F1IA 1AROP 1N61A 3APDA 2K4PA 5KFJA 2EZXA 3PS6A 1TTNA 3V6HA 2KTFA 3CSTA 4ITKA 5KG3A 3ZXVA 1YZ6A 5KFWA 2GBRA 1L6UA 3ZYYX 2CHZA 4F8CB 2W9MA 4Y2YA 3ZW3A 4HAIA 2G5IB 4O5KA 3Q8AA 4OCZA 1PYWD 3IV6A 4A3PA 4B9MA 3NG0A 5JTIA 1FFUA 4B9LA 3UGBB 2PFPA 4KGSA 1WM2A 4E74A 1E8WA 5E6JA 5CHWA 1Z4NA 3TI0A 9ICVA 3KWLA 4IM0A 1QF6A 1PGXA 3A9JA 1UA0A 1XXGA 2K8BB 1IG6A 8ICHA 1T3QA 3D2SA 1HZ6A 3DVNU 4G3XB 5AI5A 1FXIA 4JQWC 2YX8A 1O08A 3BVGA 3MR6A 4O3SA 5ALOA 2UYZB 1XLNA 3DWGC 1IUEA 4GC6A 3C2LA 3OTQA 4HCPB 3PRMB 4D2KA 4MF2A 2M17A 3Q8BA 2MQJA 4RPYA 3WKBA 4WQMA 4DQIA 5JH5C 4F4KA 2MBOA 3DEEA 3SAFA 4DO9A 2OWOA 2DNFA 3MHSD 1WWVA 1U45A 1E9MA 4RGTA 3AE5B 1N5WA 2GLSA 2INCC 3CMMB 2D2QA 3RZWC 4NJ7A 3EHVA 3CWIA 1FEZA 2Y5PA 3V7LA 1NNLA 1RZTA 2WNMA 4KKJA 2BGWA 2NV3A 2BS3B 1ZOLA 1FNWA 2Y1JA 3JVZX 1HXYD 4GN1A 1WZ0A 5BMHA 5IIMA 4F1SA 1I4GA 3DVNV 1TKEA 1F2RI 3KBBA 3SD5A 1MPEA 3UINB 3MP9A 4YTNB 1R4NI 1XO1A 4HK2A 4F5OA 5HKHA 1BNPA 1E8YA 2KDMA 3RRGA 1LGRA 4EUTA 5L83A 2ZEQA 2LGSA 2WQYB 3R2TA 2CJNA 1X66A 2G08A 2AX5A 1QLNA 2MWSB 1JN3A 3EW9A 4C4VB 4G0NB 2ISPA 1XO0A 2UVUA 3EFUA 3IT4B 2I1QA 4O5EA 8ICMA 2NPTB 4GMVA 1XSNA 2AYOB 1U9LA 4EBEA 4GXIA 4OJ5A 3QUTA 2D11A 1S9FA 4R8UB 3PPAA 1ECWA 1I4PA 1KOTA 3HUIA 2C2EA 5FKAC 2SEBD 5CHVC 2EAPA 3VUYA 1OEYJ 3TCAA 2PW9A 3O0FA 2JXTA 2LGDA 4GIBA 2KIWA 4K81A 2M0XA 1C3TA 1C20A 1UUPA 1UBQA 3RFZB 1HUZA 3MC9A 2IGDA 4M9HA 1SXDA 1IV8A 2BVCA 3H8HA 4DL4A 1S5LU 2H3ZA 5H2FU 2UVVA 1I4RA 1NI3A 5AKIA 3OAWA 1QZEA 2ZZPB 2DAFA 4F93B 1ENFA 4PZNA 3GV7B 2JGAA 9ICQA 3ENEA 1LKYB 1ZGUB 2JWUA 1MSWD 3IRUA 4ED1A 2M56B 4DQRA 3VVWB 3T5HA 4R66A 8ICQA 3O65B 4C8KA 3AECB 4ZRIA 4YXMA 4C4VA 5KFSA 1D8LA 5HR6A 4M9LA 2YMPA 4IWQA 9ICXA 3RBEA 1VLBA 1ZQGA 4J03A 2KKVA 4DOAA 2RHFA 2ONQA 4J9PA 2G3QB 2FLNA 2N9PC 1HIWA 1KEJA 2LRUA 1U49A 5J2JA 4R8UA 2R8IA 4NAWB 4ANUA 1ZD2P 1FRRA 4MM3B 3AV8A 2KWUB 2MHJA 5HNKA 2KJ9A 3RB4A 2PVOD 3GIKA 3IT6B 4Y2PA 3IVFA 4YL8A 2DHZA 2HHTA 3HK0A 3QU5A 5ALFA 5JRTA 5KT5A 4TQRA 1XF5L 1SV0C 3QU7A 4AS1A 4UB6U 4PS8A 1XC9A 2KZRA 4XUSA 1LKYA 5ALXA 1KSPA 1AWDA 2PFOA 3N7SC 5E6OA 8ICFA 3PX0A 4EYIB 2ZJAA 3ISDA 1UHUA 9ICBA 3ZTDA 5EWEA 3NZSA 3JPSA 4I2FA 2LWPA 3RJJA 3VHTC 1D5ZC 3F53A 4Q8EA 3B2GA 1WGHA 2RLTA 5BOMA 2WXMA 4YT0B 1BPEA 5JU5A 2EQYA 3GDXA 4P6VF 4A8EA 2IY0B 4IWPA 2O6KA 9ICCA 4IUMB 8ICXA 2KEYA 4MFAA 2KFZA 3Q8KA 1WR1A 3DQVA 5KG1A 3PZDA 2XCPA 4WURA 3N30A 1GPXA 4MM3A 4IQTA 1GB4A 1L3SA 5E79U 2MW5A 3E58A 4FZNA 1GB1A 2OOBB 5BMGA 4DXAB 1RYSA 4FFDA 4OJOA 3TAPA 1H8CA 5KFLA 1ZD3A 2NBVB 3OWEB 2F1HA 2W82A 1IPGA 1NENB 2IOFA 3EA6A 4N6EB 1XO3A 4JV0A 1ZD5A 3J9CA 1HZ5A 1FM0D 1SE4A 1M6YA 1KKXA 3PSEB 4RFBA 2QARB 1WFYA 2X8XX 9ICOA 3AU5A 1SKSA 4F91B 2ZTDA 2HI0A 1L7NA 3ALRA 4PHDA 3H1UA 2N4FA 1ZQPA 1RRBA 4MSMB 3SU8X 4IQUA 2RR9A 4HPMB 3AE8B 1YZ7A 4UATA 4YD2A 1ZKHA 3BQ7A 3KW5B 3ZNID 5AIBA 3PO5A 2Y5CA 4AP9A 1K51A 2WX0A 3QK0A 2E6XA 2WGSA 4BKSA 1A77A 1HTQA 4Q45A 3N32A 1NJXA 3L17A 3HW8A 4ZRKA 2ICIA 2JYEA 1DOIA 4PJ0U 2MSED 2H5XA 3L54A 3D2QA 3GU3A 4RUAA 1SZPA 2PPHA 4TMAB 2JZPA 1L3VA 3AE4B 3R9KA 5DB6A 2FLLA 4KX5A 1WXSA 4BOSC 4RNAA 1L0XB 2QARA 4LJOB 4M04A 3PR4A 1QSLA 2NMQA 4XWTA 4O3RA 3EC8A 1NEKB 4L1BA 2KFKA 3ZIMA 3K9OB 1V8CA 4KMOB 1BVSA 2D3BA 3L3FX 2Y0SC 4MEMA 3QUCA 3H7IA 1Q46A 2G5HB 3OG5A 3RJGA 1ACCA 1Z1VA 4G9BA 4G3IA 5DG7A 4DSJA 4J9QA 7ICSA 4OZCA 2HVIA 3AEAB 5EWFA 2LMCA 1XD3B 2MBEA 1PDXA 1CI4A 3UQ0A 3UIPB 3VRAB 2G09A 4TKNA 2J7QB 3GP7A 4ICUA 3QA8A 1WJUA 2OH2A 3WCQA 1ZD4A 4UAVA 2AEHA 2Y3AA 4NJCA 1MG4A 1ZDVA 2R2OA 1WMHA 2W9CB 4JWMA 3C1YA 4PS7A 1P3QU 3GILA 5AI0A 5ALDA 4IW0A 7ICJA 3DBLB 1ZW7A 1VJKA 4KGTA 4BJQA 1QOGA 3ETLA 3EYZA 2NO4A 3S6JA 2RPQA 2Y1IA 4M6WB 3QC8B 2HBLA 3TQ1A 5EWGA 5CRXA 1N62A 4IM2A 5IAAC 2ATLA 4ANXA 2ZIXA 1TZ1A 3W1SC 2M19A 4FLHA 1TZOA 2O2VB 3AU6A 1PFDA 2IDYA 4XYCA 4B9SA 3DBRB 5C3JB 3K75D 2Z0DB 2KFJA 2D10A 1ZP0B 1NDDA 1YN3A 3ZKJC 4GSWA 1C4CA 2WXOA 2F8LA 2VJ5A 2C7NB 2JT4B 2FPMA 4IC9A 2W7OA 3WAOA 2INDC 2E1EA 5EE9A 1BPDA 5AI8A 1I7HA 1MVKA 4P1CC 3IDWA 5HFYA 2LI5A 4UBBA 4XE0A 5BPCA 2QDFA 2I5HA 1TK0A 2AU0A 2XN9C 1KLNA 3T3OA 5KG0A 1ZJMA 4KN4A 2KYWA 2BQUA 1BUIC 3U2SC 2MX2A 1E6EB 2E8PA 1J97A 4M6WA 1X40A 3PLVA 4JIOU 1FXTB 2BB5A 3PW7A 3JPPA 3DVGY 3RF9A 1Y8RC 4IQVA 4KLIA 1E10A 2BWFA 9ICFA 1TY2A 1YJIA 2MH7A 3TADC 4F4YA 1C78A 2JYTA 4YG2A 5ALPA 4BX9C 5KFNA 1BT0A 1VZ7A 4Z6EA 1QOAA 4I6NB 1S0OA 2ODGA 1TK5A 4ELTA 2V3PA 4R63A 1PVPA 5DPWA 1RYRA 4GXKA 2PKEA 2E8MA 5ALQA 2RQ5A 3HKZF 4MT5A 3A1QB 2KC2A 3UPQA 5HMLA 8ICJA 3M3JA 2DYOA 2YMQA 2ZG6A 2Y9TA 3KOOA 1NKCA 3Q8CA 5J0YA 3OHBA 2RD0A 3ZRFA 4KSLC 3KUCB 4H2AA 2WHIA 1TVAA 1SZHA 3ZO5B 4NY8A 3BDPA 4FADA 1ZE3D 3SR6A 5AM0A 2J6TA 1P7FA 1U4BA 1DXSA 2VH1A 4M9JA 3RR7A 7ICNA 1GO3F 1WXVA 3HVZA 3CF6E 4QZCA 5I4DA 1ZYQA 1QTMA 1FRDA 1ESFA 3ML8A 3V05A 4CGZA 5KL1B 4Q2JA 1M94A 1XEEA 3TJPA 4DSLA 4YQWA 1LB2B 4DF4A 4F5PA 1AYFA 2MBBB 1NYQA 3PZ8A 3W5UB 1COKA 3ECIA 2YQEA 1L4DB 2KTRA 4N59A 2GWSA 4EZ6A 4RZRA 3RH5A 3RZFA 4PGXA 2AQ3B 2HSZA 2KT7A 1OQRA 4MF8A 1D4BA 3TEYA 3BZKA 3A1QA 1J7CA 3AMZA 1T0SC 4J9RA 1SE2A 1OFFA 3SDLC 2OHFA 2HHWA 1WJ4A 2PI4A 4M8NA 3C2MA 3KZIU 4KGRA 5KFYA 2XGQA 2LKYA 2J53A 3TKAA 5J0QA 1KL9A 4MEYA 4QZ9A 8ICAA 2JY6A 1Y88A 3SZ2A 4ED6A 2FE9A 3SV4A 4LNFA 2HE7A 2KK8A 2HHQA 5ALGA 4PHAA 5H92C 3QXGA 2HDEA 1QCKA 2ASDA 2P6RA 2V3NA 4IC7B 2WXQA 5AI9A 2INNE 2ZCCA 2J6UA 1DOQA 3TAQA 3ZTCA 2PEAA 1LQBA 5IKCM 2BCVA 4O5CA 4GDLB 4JWNA 1L2NA 1LO5D 1V1OA 5BYQA 3OPXA 4B9UA 3BQ1A 4M47A 1IGCA 3EPGA 4HPPA 2GBNA 5IP4D 3PX6A 9ICUA 3H7PA 1JXLA 5CEHA 3D2NA 2JZZA 4ECZA 3TEXA 4DL6A 3U26A 5T8IA 1IIPA 4KLEA 2FCMA 4LNIA 5KT2A 2KX3A 2V3SA 3K9PB 3AUOA 5J8YA 2GO7A 2VIXA 2P66A 2W3RA 1J2NA 3H7SA 4UBCA 3OSPA 3Q8PB 5HHHA 1WXAA 4IR9A 1T3NA 2FUG1 4EZ9A 2F8KA 3HP6A 2HD5B 2MA9B 3Q3MC 1ZQQA 1L7OA 1X9MA 3WK5A 1WXQA 2OM6A 1KW4A 4J6IA 4DLEA 3L10B 3M7DA 2XCAA 5ALSA 1ZQFA 2CR5A 2FUHB 1I4QA 3MDAA 1IBXB 1DGJA 3I3TB 2QIEB 4W9HA 2J42A 3SV3A 4GDLA 1NK4A 4KLQA 1BPXA 1HQRD 4ZRQA 1UCVA 2ZJ5A 2KACA 4PS3A 4EYHB 2MBQA 4W9FA 2LVOA 3AE9B 5ALEA 1HEZE 4TUQA 3RMKC 3NUHB 4OVZA 2MJDA 3P2BA 1V80A 4P7IA 4AUQC 5AUKA 2W04A 2GB1A 4BVUC 2MCNB 5FP0A 2V0GA 3PNCA 1WYGA 3PY8A 4DHZB 2I9GA 1YQBA 4FS2A 3GOEA 1URJA 4CF3A 1ZQHA 2KDFB 5DB7A 3RNGC 3Q3OC 1C9FA 3KD3A 2JRHA 3RPFC 3UQBA 1ZQ1C 4F5RA 2F76X 1NKEA 2KVCA 1Z3EB 4FE3A 3H0LB 1NJWA 4NY0A 5D3DA 1AN8A 1ZQRA 4W9IA 2GMIC 4N9F4 1N60A 4MELA 5KTQA 3RD2A 2CXYA 1PK1B 3PW0A 2J0MA 4NQKE 3GZNB 4JWUC 3X0WA 1BPYA 2VH2A 3IHQB 1CZPA 2IJ0A 2JZBB 1TKGA 2HW3A 4CHKA 3BWUD 4IM3A 3HHMA 3FDSA 3KHRA 4F2RA 1WGYA 4QZBA 3P42A 3SHQA 4C4RA 1B22A 1GOZA 2EKIA 4O3OA 4C80A 3A33B 3R2IA 3M9NB 1FXAA 3OJ3A 4MGZE 4B9NA 1DK2A 3SENA 2XY6A 4MGIE 4AJYB 3QUBA 3HJEA 3TBLD 2BW2A 5MPOA 2BTEA 5FR6A 2IYDB 5KFHA 2E8NA 4HDQA 3PSFA 3QX7A 1WX8A 2BT6A 2NTTA 2PFQA 3QU4A 2HHSA 3DBHB 5IA7A 3A4SC 1NKBA 1B4FA 1IP9A 1WSPA 4GXJA 3ONNA 4YFKA 1CK1A 1QILA 4F5NA 5F9LA 3KFUF 2FIDA 4NAMA 5KNIA 1WYWB 3HRDD 1TGZB 4AP4C 4AYBF 7ICOA 4YSYB 2KIVA 3IAS1 4EBDA 4DFMA 2W7PA 8ICKA 1N56A 1I4XA 3KUZA 1PK1A 3I1YA 4NLGA 4RT2A 3QQ8B 1D8BA 3GIJA 1SBBB 2WXNA 9ICRA 5KFDA 4UB4A 3UF8A 2CPRA 4RQMA 4JPSA 3SEBA 1OUQA 4IRDA 2FMPA 2LM1A 3IG3A 3H0RB 3ZJVA 1DRGA 4U7CA 2KO3A 2ASLA 1NJYA 5L1IA 3C21A 4I29A 5KFRA 4RQ0A 4FS1A 1FIQA 4M0WA 1J19A 4BXOA 2KV2A 2IHNA 4QWCA 5AM5A 3UXPA 5J2RA 3JPTA 1ZQYA 5AK5A 3TMPB 2AJQA 1JRPA 1K5OA 3KTQA 2NBWB 2KZ3A 2KK0A 4EENA 4EELA 3Q8SB 3N3KB 4MDKE 1WGDA 2Q5WD 4DWFA 1RLFA 3JSVA 3HVDA 1EXNA 4KLMA 4EZJA 2EANA 3AE2B 3N1ZC 2DZJA 2KDBA 4RGMA 1FMAD 3ML9A 3TANA 2W9AA 1XLOA 2Z8LA 4LNNA 2WP9B 2G0AA 3EGRA 5KFOA 2F3NA 3PMNA 3MC0B 5AZHA 4Y2QA 3JYUA 1D9FA 3HX0A 1NYRA 3ZNHB 3M63B 2J4XA 2BDUA 2A5UA 2LJIA 5JHBA 3PSPA 2BPSA 3AEGB 1Q10A 3ICXA 4DDGD 3AEDB 2QLTA 1VRAB 1NBFC 4KLJA 2ZIWB 7ICVA 3TSSA 3UIOB 5IINA 1JWUD 3RTVA 3N1YC 3GE8C 4AYBC 3M8SA 1GG3A 2LEKA 1F77A 4P4OA 2AL6A 1L3UA 3TEWA 2IO2B 4K1RB 3HILA 5AIAA 5AKLA 4QZFA 1P98A 4F7ZA 3M1YA 1JI7A 3T8MA 1F44A 1UF0A 1HA5A 5IIIA 1KBUA 3LK9A 2XY5A 4RM8A 3SFDB 1YD8U 1NVID 1XSPA 7ICMA 1SL0A 1T4GA 1YX6B 2WXKA 2K8BA 4ZHPA 1ZXIA 4O9MA 3QEAZ 1STEA 3Q2AC 4DFPA 5ALTA 3GIMA 4YD1A 4YTMB 1TT5B 3FAHA 4R65A 1UELA 4K4GA 1C76A 4K7SA 4HVBA 2KZZA 3ISCA 2O6VB 7ICKA 1JWBD 5AKEA 1L5PA 4RT3A 5D3IB 3RNBC 1K50A 2LHDA 4L2YA 2ZIWA 2KMMA 3E56A 4YVZA 2LM4A 1GUAB 1Q5WB 1RDFA 2EH9A 1SGGA 1P0RA 4DQQA 4PHEA 2NVUI 2P6UA 3AI5A 3KKAA 2W54A 1ZQKA 2INPE 1E7VA 2D8CA 4URKA 4KMUA 2MBHA 1KN5A 4OZBA 1Q3VA 2R8GA 3H40A 4DQOC 2DLBA 1WX7A 2C7MB 1V97A 4HRSA 3AL0B 1N48A 2JF5A 2EMSA 4HLEA 2ZW1A 4IS7A 3MR3A 2A1JB 5F9NA 2JEJA 1UQVA 2OJWA 1LFDA 2CS4A 3UI3A 1XQQA 2IO3B 1NI2A 3W2DA 3KZXA 1NK5A 2HJ1A 4RQ1A 4JE3B 1SIJA 4Q44A 3MDCA 2JSVX 2NRVA 3ZD9A 4YCXA 3DDCB 1YX5B 5HHDG 2ZTEA 1KFTA 2O6VD 2DKZA 2HHUA 3RNFC 4I2AA 2WXFA 1G6JA 1UH6A 4C4SA 9ICSA 4YXDB 3HT3A 1TAMA 4OJLA 2BCQA 5IILA 3NTUA 1T94A 4IQWA 3DWMA 5AKKA 2V4QA 8ICGA 4U6PA 2BBCA 1F2RC 4P4MA 1CMXB 3RJFA 2DPJA 4Y2JA 2NPTA 1X42A 4MEXA 2XICA 5J0WA 3M6ZA 2RDGA 4JGHB 4KLDA 3Q8RB 4KX3A 3T5JA 4XZ4A 1OQYA 2H89B 4I2EA 4NXZA 4KV2A 1Q3UA 4IRCA 1EO6A 2L3ZA 1JCKB 5KFXA 3GQCA 2PE9A 2XBBC 5JHAA 4HYKA 1VCBA 3C5GA 5G2NA 4KITB 1ZQSA 3ZDDA 3A4RA 5C5JA 4WWMA 2LUMA 3LWLA 2FMSA 4I27A 1C7YA 4EE2A 2K60A 1MFWA 3B0YA 3ZDEA 4F2SA 3F2DA 2KN5A 2QCZA 2KFNA 4J9MA 4REZA 2K8AA 1EUVB 2IO0B 4F71A 5KFAA 1J0GA 3NUQA 5L1MA 4MJSB 2EZYA 1VD2A 3BVMA 5DBCA 4QJFB 3ALBA 2F2AB 5DQHA 3RJKA 4DL2A 3IN5A 4NAWA 3WAPA 1KF6B 1QT9A 5DPRA 1D6EC 2KICA 2KN7A 2BPFA 3ED5A 3QNMA 1SJED 3JW0X 2Y0SF 3ZNZB 3RB6A 1JMSA 8ICNA 2MRPA 1WM3A 5BMIA 3C8YA 4US8A 3SMVA 1VR9A 4ED3A 5L1LA 1U47A 3VUXA 3AQEA 9ICEA 1P1AA 3G6YA 5J2DA 5LLIA 4ACOA 2JRZA 5KFUA 4J9SA 2L05A 4G11A 4OJPA 1A6SA 1WCNA 2IHMA 1OGWA 4XC2A 5AM1A 4USAA 3RUIB 4EZKA 1WF9A 4LCDE 2FBWB 2V9HA 1XCTL 3WKCA 3SAGA 4PYZA 2KLCA 3H4BA 2DZMA 2WF9A 2M1MA 4QZAA 1MQ2A 4J9NA 1LV5A 2RSUA 4Y2VA 2JEFA 5D46A 2XNAC 1YOVB 3AU4A 2I38A 5J0UA 4CYEA 4ARIA 4BDPA 4YP3A 2FCNA 5AKGA 2N0SB 5KT3A 3SQIA 1IXRA 2KOXA 2UWQA 4DFDA 1A70A 5KAFU 3E2EA 1CRXA 1UBIA 4OD0A 2VA3A 4P1BC 9ICAA 3BZDB 5B5EU 5AKXA 5AKHA 3WANA 1CUKA 2B6GA 2KVZA 2JXXA 2ZXIA 3RJEA 4Y2UA 1MA7A 3PSTA 4BWJA 2PIAA 4BFRA 2M0NA 2WXGA 4PGQA 4PT5A 1JRUA 2WF5A 1WRIA 2UVWA 2KD1A 2HOIA 5TSSA 4ED0A 3DHIC 4AWJA 1V9PA 4K3BA 3L5KA 4IKGA 2KSOB 3AEBB 3NGDA 5CHFA 3UM9A 1UT5A 1MHXA 2AQ1B 1SJHD 5CX3A 5DG8A 2W8LA 2B21A 3TARA 3TEZA 1UPHA 3WK9A 2KLGA 1KH0A 2KWDA 4UB2A 1V9JA 5EE1A 4RQ7A 4KTQA 4DHJB 4FZMA 1PGBA 1Z2MA 2HVHA 2PTLA 4HJGE 2BS4B 1ZRNA 5DQGA 2YB4A 4XA5A 4F72A 1E90A 3N7PD 5KT4A 4QWEA 1V5TA 4JMUA 1FD6A 2ZJDA 3PO0A 2MRLA 1VZ6A 3MR5A 3IAM1 4RPZA 4NL9A 3WK8A 1ZPSA 1JWMD 4DXFA 2KHVA 4OJ6A 3DBLI 5BO4B 3BS5B 3VH4B 1ZQIA 9ICLA 1RQLA 4WWNA 3BZCA 2W9BB 2HOFA 4FHJA 2IOFK 2KSOA 5AK6A 5KAIU 2WXIA 2KTQA 4NZLB 2LHTA 2OCEA 2N9KA 2L1AA 1L7MA 3FKYA 1C1YB 1DK3A 2KJ8A 1MQ3A 1WZ3A 3CNHA 3RN9C 2ASJA 2C2DA 1FPYA 4NLZA 2WDRB 4DEZA 4LNKA 2PFNA 4Z6DA 5DPTA 1V85A 4KN7A 1TS4A 4DHJD 2MJEA 5KFBA 2R61A 3DBRI 4KVGB 1WE6A 3BQ2A 1S77D 4NV0A 2KZMA 1L8OA 2NCNA 2TSSA 4I2DA 3WKDA 5KFGA 2XIDA 4B0MA 1JMLA 1TAQA 2IBIB 2WU5B 2CKHB 9ICHA 1C4AA 2KANA 1AW7A 2K22A 4DOBA 4WH4A 3ZD8A 1XNSA 3MFHA 4KLGA 4C0ZA 3H8JA 1AARA 5KFCA 2LRWA 1E0ZA 3BS5A 2HTME 1OW5A 3U30A 4IR1A 2VKQA 4BAXA 2W9BA 4NLNA 3NRZA 1TFRA 3W1SA 4NLKA 5E6NA 1ZDXA 1QQ5A 4J9OA 1MI0A 2W9CA 3AEFB 4JV1A 3RNAC 3RRHA 1YJJA 3QUQA 2F1JA 2BZFA 1FFVA 2X38A 1QOFA 1TY0A 1Y56A 1I4HA 2BCUA 1KTKA 3AE7B 4K3CA 8ICTA 1L6NA 4KX6B 4J9LA 1E7UA 3QARA 4QWAA 3ISBA 4BWMA 3V61A 1ET9A 2FLPA 4DS5A 2YB1A 2R8KA 8ICYA 4C8OA 4ZH4A 2PXIA 3C19A 4GGQA 5LXHA 2DUYA 1KFYB 2O2VA 2B76B 4TURA 2RGFA 3GB1A 2CHWA 1ZQZA 2EMTA 3WAMA 2DKXA 2LUEA 1WWUA 2Y9UA 3B0AA 4XX5A 2DPIA 4C8NA 3OJSA 2ZXHA 4C7YA 4TUSA 1RAXA 1BMLC 8ICSA 3AULA 2C22A 3CW2C 3GE3C 3IG5A 2QB0B 3CYMA 2WXLA 2BKEA 5J2GA 8ICOA 2YEPF 3BYTB 4HROA 3HM6X 1SKWA 2GOWA 5DB8A 3TADA 1EU3A 5DGAA 1DOXA 2DENB 2BYVE 4I6LB 4MGKE 3WIMA 1EM7A 2BYEA 1B9RA 4PGYA 4DQPA 3QU9A 2WTFA 2V4RA 3LDZE 5L1JA 4KLLA 2D07B 1S76D 3C0RB 3RH4A 3QJZA 3F2BA 3AH7A 5CTRC 2DL0A 1ZQBA 3U52E 8ICLA 3R66C 3Q6BA 2IY1B 1XWLA 4I2BA 5DBBA 8ICIA 3PV1A 5L95C 2LJ5A 3V6KA 3KYCD 1L3TA 4FHKA 3PT2B 1SB3C 3IG8A 3KLSX 2AQ2B 4UB5A 2BS2B 4QW8A 1RXVA 1H4RA 2ZIVB 3JPQA 4JX1C 2QEJC 2ZUDA 3WK4A 2WXJA 4EEKA 5K4LA 3LWMA 1EWYC 2QB0A 1SKRA 4ACFA 5ALIA 3I57A 5J2IA 4FJYA 1S1QB 4YR2A 2WFAA 5CR0A 2XK5B 1L0YB 2C28A 2GBJA 4KLFA 1L7PA 4ECVA 2JU6X 3MABA 2DQNB 1B1ZA 5CB1A 2Z59B 5AZFA 4PYUA 1T0QC 2KHWB 4OHJA 4II3B 2MA1A 2V9WA 3BVZA 2ZW0A 3RI7C 1YT3A 7ICEA 3ZXRA 1PUZA 2R8JA 1P7DA 3T9LA 3OGUA 9ICMA 1T7PA 1V1PB 3QZ8A 2ZCBA 1ED1A 1UT8A 3LVWA 1WJNA 2KMCA 2QILA 2WS3B 1JIHA 5GXGB 4M02A 4LNOA 1XLQA 1BXTA 4XDDA 3THVA 4DSKA 1J7BA 3MHZA 2QSDA 1BNOA 1RWSA 3NHEB 3TIXA 3W5VB 4FBJB 4ED7A 3ZGZA 3MJWA 4PH5A 5KFQA 3Q69A 2KJHB 1SL1A 2LXAA 3ZJTA 1XS9D 3N20C 3IHPC 3VR8B 3T5LA 4FXCA 3TFRA 4M00A 4LJXA 4RNOA 2DAJA 7ICQA 4IOIE 2BDPA 2K0PA 3RJIA 2XK5A 5KG2A 1FCLA 5AKZA 2K4HA 2KMDA 4ECTA 4ECWA 1T6BX 4LZDA 2D3GA 4X57B 5ALYA 3RR8A 4B6JA 1NK9A 2JPHA 4TUUA 1KM7A 4RMAA 5KHOA 1Z00B 2IA6A 2AQ4A 3RFAA 1S3SG 2PVGC 2E3TA 4ELUA 1V1PA 3FILB 3NASA 3S2AA 2AGPA 3KWVA 2MUTB 8ICRA 2L32A 1NK6A 3PRZA 1YQ3B 4FN2A 1E5WA 3I28A 2H3IA 1RM6C 1V49A 2QB1A 5KFPA 4OVUA 3G6XA 1ZQJA 4DL5A 2L0TA 2QHOA 4ZDVA 4A20A 2LGIA 3AQFA 4EX6A 4AJWA 1C77A 2KDIA 1KFDA 2ZPYA 1PGAA 2KN4A 5KFVA 5JXVA 5AM4A 1DYQA 2A1AA 4DBGA 5IN7A 1SEBD 4G50A 5EDSA 3L16A 5J2KA 3GZNI 2BF8B 2RDIA 1K1QA 2EELA 3EWAA 1SL2A 3RB0A 1WIAA 3QWZB 2BPGA 1BGXT 2V4LA 3HWTA 1QQRA 4LVSA 3V6JA 3ZDAA 1WY8A 2ZPNA 1JW9D 4MSQB 4YWGG 1Z00A 1P9DU 2JZ3B 5JUMA 3AXCA 4UAUA 1PZNA 3N97B 4YSXB 3VFKA 2L83A 3FILA 2B0CA 3T3NA 4RNNA 5KG6A 3UMCA 1IBXA 2MUTA 1NZPA 5KL8B 4QZGA 3D6JA 1L7YA 2L52A 2JX5A 9ICTA 4K7WA 2WB1F 1CJEA 3DBHI 1V6EA 5D7GA 1TKDA 4GDKB 4HJKA 3VQIA 4B95A 5BYSA 3A0HU 1ZQWA 5AKJA 2JQRB 2EZZA 5A0LA 2XEWA 1ZUD2 2Y5BB 4QW9A 3CRXA 2ZUBA 4KIKB 3SEIA 2JH7A 3Q8EA 4O0IA 5KT6A 4HKZE 3B08A 3LJ3A 3VR9B 2XO7A 4MFFA 4YSZB 3DDHA 5DQIA 1EF1A 1UNSA 3V7KA 4ECXA 2C9WB 2KP7A 4ELVA 2K4IA 5GMVA 2N9XA 5EOZA 1Q1OA 4ICAA 2YVCA 1QQ7A 3V6CB 2W11A 3RAXA 2WAQC 4CCHA 3ONSA 1R4MI 4YTPB 4FA6A 2JZBA 3Q8FA 3P4QB 2RDBC 1I42A 3E0FA 5KFZA 1ISNA 2R18A 4AOFA 2ZNVC 3AEEB 4M9NA 4XDCA 3N4MB 4UB8U 2HTHA 4JV2A 5AI6A 1L6VA 3BQ0A 8ICPA 2LVQA 3NZUA 4DDID 1RYUA 1ZQAA 2D3CA 1F1HA 1PQSA 1XLPA 4HKQA 2BKRB 1WE7A 4HCNB 1TKYA 5DDMA 4Z6FA 4RQ4A 3NY5A 1SWWA 2Z0EB 4KIKA 3N7RC 2RRDA 4O3MA 1YNTE 1F0MA 3M9MB 3W9CB 3E9SA 3JPRA 2K6DB 2YMMA 5DKWA 3B9JA 1QOBA
chains in the Genus database with same CATH topology
4C56C 3WCQA 1JCKB 1WWTA 2Y3AA 4NJCA 1ZDVA 3NVWA 2ON8A 3BK1A 4WAFA 2WXPA 4LK0M 4WWMA 2LUMA 1T5XD 1VJKA 4RGOS 3LXFA 1TS5A 4KGTA 4EE2A 4TQ0A 1QOGA 4A55A 4REZA 1TS3A 1PUTA 1N62A 2V4IB 2M19A 1TZOA 3BVMA 1TJEA 4CQNA 1PFDA 2IDYA 4RF1A 5C3JB 4US9A 3BYYB 1ZP0B 3AE6B 1KF6B 3ETRA 1QT9A 1YN3A 2RDHA 4WIPA 1D6EC 1C4CA 4R3DA 4DXGA 2WXOA 1SJED 4L23A 4N58A 5BMIA 5LNK1 1YN5A 4IDIA 3C8YA 2K9XA 5EE9A 4US8A 1RFKA 1VR9A 1I7HA 1MVKA 3V3XA 5HFYA 4XE0A 5HG2A 3ABVB 4GLSC 5FK9C 1ZXHA 1SXTA 2XN9C 3T3OA 2IGGA 1BUIC 3U2SC 4USAA 1E6EB 2FBWB 1XCTL 2BB5A 1P7EA 3L4PA 3NZ3A 2G9HD 3I9V1 5BYRA 1D5MC 4LLGM 1E10A 4LTUA 4A90A 3P4RB 2KQ4X 1TY2A 2XNAC 1YJIA 2MH7A 2JYTA 2I38A 1C78A 2D5GA 4UDUC 2DBYA 5HI1A 1VZ7A 3VRBB 3ZJUA 4ARIA 1QOAA 2V3PA 2N0SB 1A70A 2GRIA 1VDVA 4MT5A 3BZDB 3BIID 1ZOYB 2WXHA 2DYOA 2N9LA 2NTSA 1CQVA 4RF0A 1UGJA 2WU2B 3Q8CA 4KKIA 2PIAA 4C7ZA 2WXGA 3AM9A 2ACZB 4PT5A 4H2AA 2MJ3A 1WRIA 5TSSA 1ZE3D 3MFGA 2DYMA 3P4SB 3SR6A 3AEBB 4IKGA 1P7FA 3P4PB 1D5XC 2WDQB 3LYYA 1MHXA 3ZQ4A 2AQ1B 1KLGD 1SJHD 3HVZA 5I4DA 3TEZA 1FRDA 3NVYA 1ESFA 3V05A 1KH0A 2KWDA 4MACA 4Q2JA 1XEEA 1N5XA 5EE1A 1ROEA 1YMHE 1AYFA 2MEKA 1NYQA 1PGBA 2RMMA 3PZ8A 3W5UB 2PTLA 4HJGE 1L4DB 2BS4B 4N59A 4ZYSA 2PKOA 2AQ3B 3P63A 3PZ7A 1OQRA 1D4BA 3TEYA 1FD6A 1E7PB 1J7CA 3PO0A 3AMZA 1VZ6A 1F0ZA 3FC4A 5G5HA 3IAM1 5EE3A 1SE2A 1OFFA 1ZPSA 4A6QA 1JWMD 2OHFA 4DXFA 2K5PA 4OW0A 1SE3A 4RH6A 4KGRA 1JWAD 2J53A 2WXIA 4NZLB 3O13A 1UWMA 2N9KA 2L1AA 1R7SA 3LB8C 4MH8A 5H92C 1RYJA 4HEA1 2RPVA 2HDEA 2WDRB 1JALA 2PMVA 1GAQB 2V3NA 1TS4A 2WXQA 2MJEA 2R61A 1TS2A 2INNE 4XWWA 4GDLB 2QMTA 1LO5D 5G5GA 4ZOHC 2TSSA 2W3SA 1V1OA 5BYQA 4B0MA 1N61A 1JMLA 1IGCA 2DWQA 2WU5B 4ITKA 3MJ5A 3TEXA 3ZYYX 1L6UA 1C4AA 1FNVA 1AW7A 2K22A 5T8IA 3Q8AA 1PYWD 1QLBB 4WH4A 1FFUA 4KGSA 4A8XC 5E6JA 1E0ZA 2W3RA 2HTME 3KWLA 2M0AA 1ET6A 2K3UA 1PGXA 1QF6A 1XXGA 3NRZA 2FUG1 3W1SA 1ZDXA 1MI0A 3AEFB 1L0VB 1WXQA 2WLBA 1YJJA 1T3QA 1HZ6A 2X38A 1FFVA 1QOFA 1FXIA 1TY0A 1Y56A 1I4HA 1I4QA 1KTKA 1IBXB 1DGJA 3AE7B 2QIEB 3BVGA 1XLNA 2J42A 3DWGC 4KX6B 1IUEA 1HQRD 4ZRQA 4RCOA 4D2KA 2KACA 3Q8BA 4WQMA 1ET9A 3AE9B 1HEZE 3NUHB 4OVZA 2MJDA 1KFYB 2QJLA 5AUKA 2B76B 2GB1A 3GB1A 1E9MA 4AQ7A 2V0GA 4RGTA 3AE5B 1N5WA 1WYGA 1SSNA 1UWXA 3CWIA 2Y5PA 2WNMA 4C7YA 4KKJA 2BS3B 1C9FA 1FNWA 3RPFC 1HXYD 1BMLC 5BMHA 1JQ4A 5D3DA 1I4GA 3CIRB 1AN8A 1F2RI 1TKEA 2WXLA 1MPEA 2YEPF 3BYTB 4HROA 3MP9A 4YTNB 1N60A 2LFIA 3AB5A 1EU3A 3U4EG 2KDMA 4JWUC 1TYGB 3GS2A 1QKZA 1DOXA 1CZPA 2IJ0A 1TKGA 1EM7A 1B9RA 2WQYB 3BWUD 2CJNA 3R2TA 4OZAA 3P1MA 2AX5A 2IPKD 3P42A 2FE8A 5FR3A 1GOZA 2EKIA 3R2IA 4C80A 3IT4B 1FXAA 3AH7A 1KRHA 3U52E 5MPOA 2BTEA 2BW2A 1I4PA 2BT6A 2NTTA 3HUIA 5FKAC 2SEBD 1SB3C 1FNUA 3KLSX 2AQ2B 2PW9A 2BS2B 2JXTA 1WSPA 1QILA 1CK1A 4JX1C 2QEJC 2IGHA 4NAMA 1UUPA 4TQ1A 2WXJA 3RFZB 5AUIA 3HRDD 2W55A 1FO4A 1EWYC 2IGDA 3H8HA 1XCQL 3I57A 4YSYB 2GI9A 1I4RA 1IGDA 1NI3A 3IAS1 1J7AA 1I4XA 1ENFA 5H8YE 1L0YB 2JWUA 2JU6X 4B0EA 2M56B 1B1ZA 1SBBB 2WXNA 3AECB 4JPSA 3SEBA 4OHJA 3BVZA 2ZW0A 3ZJVA 1VLBA 1V1PB 3KQ4A 2ONQA 3SFEB 2QILA 2WS3B 5GXGB 4M0WA 1FIQA 1OQQA 1XLQA 1BXTA 4NAWB 4XDDA 4MM3B 1FRRA 3AV8A 1J7BA 3MHZA 2QSDA 1RWSA 3W5VB 1JRPA 3ZGZA 3AN1A 2KAJA 2PVOD 3Q69A 3IT6B 3ZJTA 2OEDA 3VR8B 2Q5WD 4FXCA 3B2FA 1JROA 1FCCC 3HVDA 1XF5L 4IOIE 2K0PA 2PLPA 4TSSA 2I2YA 4AS1A 3AE2B 4ARCA 4RGMA 1FCLA 1AWDA 1FMAD 1T6BX 1XLOA 2Z8LA 2WP9B 3AE3B 3NVVA 3EGRA 3MC0B 1D5ZC 3B2GA 1NYRA 2E3TA 2PVGC 2WXMA 4YT0B 2J4XA 1V1PA 3FILB 4P6VF 2LJIA 3KWVA 2L32A 1JWSD 4A9AA 2LHEA 2WXRA 3AEGB 1Q10A 5C2TB 4WURA 1YQ3B 1GPXA 3AEDB 1VRAB 1RM6C 1WGKA 1GB4A 2WDVB 1GB1A 3TSSA 5BMGA 2CU3A 2LGIA 1EU4A 1JWUD 1C77A 1KLUD 2LEKA 1F77A 3TEWA 1PGAA 2KN4A 5JXVA 3OWEB 1MHHE 2W82A 3N9YC 1DYQA 1NENB 3EA6A 4N6EB 1SEBD 1XO3A 3J9CA 1HZ5A 1HA5A 1FM0D 1C79A 1SE4A 3SFDB 2EELA 1NVID 2J52A 1DOYA 1QQRA 1C4PA 2WXKA 2G1EA 4RFBA 2N7JA 4ZHPA 1JW9D 4YWGG 1ZXIA 1STEA 4YSXB 2L83A 4J3OD 3FILA 3T3NA 4YTMB 2H88B 2CJOA 3FAHA 2VZKB 3TUOA 1IBXA 1C76A 3EUB2 3AE8B 1YN4A 4O1NA 1K53A 1JWBD 2L52A 2JX5A 1L5PA 5D3IB 1K50A 1CJEA 2LHDA 4L2YA 2KMMA 3E56A 5D7GA 4GDKB 2Y5CA 1L4ZB 1M4VA 3VQIA 1K51A 5BYSA 2E6XA 2JQRB 3NS1A 2ICIA 2W54A 1ZUD2 2INPE 2JYEA 1DOIA 1SF0A 3Q8EA 4HKZE 4OZBA 3VR9B 5EE0A 4YSZB 4DQOC 2DLBA 4TMAB 2JZPA 1V97A 1UNSA 3AE4B 4HRSA 1YQ4B 2ZW1A 4RNAA 1L0XB 4JWSC 3UI3A 3URYA 3W2DA 2NMQA 4JE3B 4XWTA 1SIJA 3BK2A 2JSVX 5HHDG 2VZKD 4YTPB 4RGNA 1NEKB 3Q8FA 3P4QB 4L1BA 2WXFA 1V8CA 3U7ZA 4ZHOA 3AEEB 4XDCA 4YXDB 2YEPB 2BB6A 1L6VA 3DWMA 1N63A 2BBCA 1ACCA 3R8BA 4ZRPA 3AE1B 1XLPA 1F2RC 4P16A 4HKQA 2SAKA 4OZCA 3AEAB 1TKYA 2LMCA 1VZ8A 2RDGA 1PDXA 1YNTE 3IXSA 3W9CB 3E9SA 1FEHA 2BYTA 3NVZA 1EWCA 2H89B 3VRAB 1K52A 3GP7A 3B9JA 1QOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6V F;  3WCQ A;  1N5X A;  1WWT A;  5EE1 A;  1ROE A;  4A9A A;  1JQ4 A;  1AYF A;  3NVW A;  3AEG B;  3CIR B;  1NYQ A;  5C2T B;  1YQ3 B;  1TKE A;  3W5U B;  1GPX A;  3AED B;  4HRO A;  1RM6 C;  2BS4 B;  1N60 A;  4YTN B;  4N59 A;  1WGK A;  2WDV B;  2PKO A;  3AB5 A;  4WWM A;  3VRA B;  1VJK A;  4JWU C;  1TYG B;  2CU3 A;  1DOX A;  3LXF A;  3P63 A;  1CZP A;  1OQR A;  1TKG A;  1QOG A;  1B9R A;  2LEK A;  2WQY B;  1E7P B;  1J7C A;  2CJN A;  3PO0 A;  3AMZ A;  1F0Z A;  3FC4 A;  5G5H A;  3P1M A;  2AX5 A;  5EE3 A;  1OFF A;  1NEN B;  1PUT A;  2EKI A;  4C80 A;  2OHF A;  1XO3 A;  1N62 A;  2K5P A;  4N6E B;  1FXA A;  2M19 A;  3AH7 A;  1FM0 D;  1TJE A;  1KRH A;  1PFD A;  3SFD B;  1JWA D;  1NVI D;  5MPO A;  5C3J B;  4US9 A;  1DOY A;  2G1E A;  1UWM A;  1ZP0 B;  2BT6 A;  4ZHP A;  1JW9 D;  1R7S A;  3AE6 B;  3HUI A;  3LB8 C;  1KF6 B;  3ETR A;  1QT9 A;  1SB3 C;  1ZXI A;  5H92 C;  1RYJ A;  4YSX B;  2L83 A;  2WDR B;  1JAL A;  2BS2 B;  1GAQ B;  4YTM B;  2H88 B;  2CJO A;  2MJE A;  3FAH A;  4JX1 C;  4N58 A;  3EUB 2;  3AE8 B;  5AUI A;  4IDI A;  3HRD D;  2W55 A;  1FO4 A;  1EWY C;  4US8 A;  1JWB D;  2K9X A;  2L52 A;  2JX5 A;  1L5P A;  1RFK A;  5G5G A;  4ZOH C;  4YSY B;  1I7H A;  2W3S A;  1CJE A;  1NI3 A;  1J7A A;  1N61 A;  2KMM A;  5H8Y E;  2Y5C A;  2DWQ A;  2WU5 B;  4ITK A;  3ABV B;  2M56 B;  1L6U A;  2JQR B;  3ZYY X;  2K22 A;  3NS1 A;  2W54 A;  1ZUD 2;  3AEC B;  1DOI A;  1QLB B;  4USA A;  1FFU A;  1E6E B;  1SF0 A;  2FBW B;  3VR9 B;  5EE0 A;  3L4P A;  4YSZ B;  2W3R A;  1E0Z A;  1VLB A;  2HTM E;  3KWL A;  1V97 A;  4HRS A;  3AE4 B;  4LTU A;  3SFE B;  1E10 A;  1YQ4 B;  2WS3 B;  1QF6 A;  3P4R B;  5GXG B;  3NRZ A;  1FIQ A;  1YJI A;  2MH7 A;  1OQQ A;  1XLQ A;  4JWS C;  2DBY A;  3VRB B;  3AEF B;  1FRR A;  1L0V B;  1QOA A;  1WXQ A;  2WLB A;  1J7B A;  3AV8 A;  1YJJ A;  1T3Q A;  2N0S B;  1SIJ A;  1RWS A;  3W5V B;  1JRP A;  1FFV A;  3AN1 A;  1A70 A;  1QOF A;  1FXI A;  2KAJ A;  2PVO D;  1VDV A;  1DGJ A;  3AE7 B;  2QIE B;  4YTP B;  1NEK B;  3BII D;  3P4Q B;  3VR8 B;  2Q5W D;  1XLN A;  1V8C A;  3DWG C;  4FXC A;  1ZOY B;  3B2F A;  4KX6 B;  1IUE A;  1JRO A;  4ZHO A;  3AEE B;  4YXD B;  2WU2 B;  1L6V A;  2PIA A;  4C7Z A;  3AE2 B;  4WQM A;  3DWM A;  3AE9 B;  3AM9 A;  1N63 A;  2ACZ B;  2MJ3 A;  5EE9 A;  1WRI A;  1AWD A;  1FMA D;  1XLP A;  2MJD A;  3AE1 B;  1KFY B;  2QJL A;  5AUK A;  2B76 B;  3AEA B;  3P4S B;  1E9M A;  1TKY A;  3SR6 A;  1XLO A;  3AEB B;  2WP9 B;  1N5W A;  1WYG A;  3AE5 B;  3AE3 B;  3NVV A;  3P4P B;  2WDQ B;  1PDX A;  3HVZ A;  3W9C B;  3CWI A;  3B2G A;  3NVZ A;  1NYR A;  2E3T A;  2H89 B;  4C7Y A;  3NVY A;  1FRD A;  2PVG C;  2BS3 B;  4YT0 B;  3RPF C;  3B9J A;  1QOB A; 
#chains in the Genus database with same CATH topology
 3A9J B;  3I63 C;  1WWT A;  2OJR A;  3QU2 A;  3V60 A;  3NVW A;  2HBK A;  3BK1 A;  4WAF A;  4B9K A;  2WXP A;  5C1Z A;  1F52 A;  4LK0 M;  4RPX A;  2JXJ A;  4WJN A;  2AQ0 A;  4ECR A;  3OJU A;  3AU2 A;  4RGO S;  4JL9 A;  2VAN A;  4UB1 A;  3LXF A;  1TS5 A;  2Q0Z X;  3KUD B;  3M62 B;  4TQ0 A;  4W9J A;  2KX0 A;  1H38 A;  3FM9 A;  2WB1 C;  4CRX A;  3QE9 Y;  3Q3N C;  2A3V A;  2DYB A;  1PUT A;  1GJZ A;  3LVV A;  1S0V A;  4ANV A;  4RU9 A;  2YML A;  3V7J A;  2R2Q A;  3PVL A;  2M8S A;  4NM2 A;  3M95 A;  4CDG A;  4RF1 A;  4BGD A;  1DGS A;  3IFW B;  3Q14 C;  1WXM A;  5DCN A;  3ZDC A;  2C2R A;  2KDE B;  4K7U A;  4F3O A;  3GV5 B;  1T8E A;  4Y2X A;  3MFI A;  3AE6 B;  2VA8 A;  2RDH A;  4NJ6 A;  3BQT A;  2KJ6 A;  4DXG A;  1E8Z A;  4KLU A;  1NZB A;  4L23 A;  4DK5 A;  4N58 A;  2M9N A;  2MLB A;  5TIS U;  1YN5 A;  4IDI A;  5LNK 1;  4ECQ A;  2K9X A;  2BQQ A;  3BS7 A;  7ICU A;  1RFA A;  2JVC A;  2KE7 A;  2JEI A;  8ICV A;  2DX5 B;  5CHG A;  3KHL A;  3ABV B;  3TL5 A;  1ZXH A;  2BCS A;  3DHG C;  4I2G A;  4QZD A;  4KDI C;  2EAO A;  4EEY A;  2IGG A;  3PW2 A;  1NK7 A;  1P7E A;  8ICE A;  2LAS A;  3VAW A;  4IG7 B;  3GFK B;  2AGQ A;  2K8H A;  3WK7 A;  4RQ2 A;  3BY4 B;  1QSY A;  3CSF A;  4LTU A;  2LI6 A;  5ALH A;  3ZDB A;  4A90 A;  3APC A;  3P4R B;  4ECS A;  5DG9 A;  4NJ8 A;  2XC9 A;  2D5G A;  1RQN A;  3VRB B;  3PTF C;  1VJ5 A;  4NWI A;  5ALK A;  4QZI A;  5AK4 A;  4UAR A;  2GRI A;  2H3V A;  2YY6 A;  1COO A;  1VDV A;  4O3Q A;  3WAL A;  3BII D;  3UXO A;  7ICL A;  2CN1 A;  1A0P A;  2WXH A;  4CNQ A;  1UGJ A;  5TZV A;  2UVR A;  4F8R A;  5AKY A;  3KKA C;  4KKI A;  4NQL B;  3LDA A;  4C7Z A;  3EPI A;  3AM9 A;  4UAW A;  3K1Z A;  1S10 A;  4RQ6 A;  2MJ3 A;  3DPD A;  3MC8 A;  4NNJ B;  4LDT B;  3MFG A;  4KLO A;  2DYM A;  2AXT U;  4EEW A;  1NJZ A;  4DL7 A;  1NK8 A;  2KVS A;  4IRK A;  1HTO A;  1AQ6 A;  2ZUC A;  8ICU A;  1WRD B;  2LYB A;  2BCR A;  2JWZ A;  3LYY A;  1I35 A;  2JUO A;  4ED8 A;  2JV3 A;  4DQS A;  9ICI A;  1R4N B;  5D94 A;  5G55 A;  1NOM A;  3GII A;  4C4T A;  3NVY A;  4FJV B;  4QIW F;  4Y2R A;  2CRX A;  4MAC A;  3QCA A;  3PHX B;  4JB3 A;  4WQO B;  1N5X A;  1ZET A;  4RM9 A;  4RQ5 A;  2O6V A;  2RMM A;  2ESE A;  4I2I A;  2HBJ A;  2GLE A;  3M6K A;  7ICP A;  4QZH A;  5KG7 A;  4YMM A;  1RXW A;  2WF8 A;  1XU4 A;  4M2Y A;  2G06 A;  2PKO A;  4ZYS A;  3PSI A;  5ALR A;  5CP2 A;  4F4Z A;  1T0R C;  3P63 A;  3PZ7 A;  1SIF A;  1GNU A;  1KJT A;  4PL2 A;  2MP2 B;  1E7P B;  2KNJ A;  4JLC A;  5G5H A;  3VTW A;  5L1K A;  2GH1 A;  5J2F A;  5C0Y A;  1UZX B;  8ICC A;  3PML A;  2HBM A;  1BPZ A;  3IM1 A;  1SE3 A;  3L13 A;  4LDT D;  3OLM D;  2DF4 B;  4DSI A;  1SV4 A;  1JWA D;  5F3X B;  4TV3 A;  3QZ7 A;  5DBA A;  4A3O A;  4UAY A;  1TIF A;  2A1J A;  5DLG A;  1R7S A;  4K4I A;  4HWI B;  4P0Q B;  1RYJ A;  4HEA 1;  2RPV A;  3IBE A;  2JRI B;  3BJY A;  5AI4 A;  4DS4 A;  1PVR A;  2N9E B;  3PRP B;  5DGB A;  1TS2 A;  4F92 B;  2NBU A;  2F44 A;  3QEB Z;  2I6X A;  2UU7 A;  4C00 A;  4ZOH C;  3MGH A;  2L5Y A;  2W3S A;  3ZDT A;  8ICW A;  3OHA A;  2DGZ A;  1ZJN A;  2YLM A;  2DWQ A;  7ICH A;  3MJ5 A;  4F4W A;  1F9J A;  1FNV A;  1SV0 A;  2HDO A;  2MP2 A;  3KYD D;  9ICJ A;  1V5O A;  1WR6 E;  3I76 A;  3Q8L A;  1QLB B;  2FJ6 A;  3QIJ A;  1HEK A;  4P4P A;  5KFK A;  4A8X C;  3LYS A;  4Y2T A;  5GTH U;  7ICR A;  2ES6 A;  2KJ5 A;  5IIJ A;  3C28 A;  2FPK A;  3RJH A;  3N28 A;  2M0A A;  2REX A;  1ET6 A;  2K3U A;  2QKQ A;  3NRW A;  4E0D A;  2NS5 A;  4EKU A;  2FPL A;  2JH1 A;  4QIW C;  9ICK A;  1L0V B;  2WLB A;  4EBC A;  3PVX A;  1HE8 A;  4W9D A;  5CWR A;  4R64 A;  1Z5S B;  4P0Q A;  2J0K A;  3X23 A;  3V62 A;  2HOQ A;  2WDT B;  2NRZ A;  4ED2 A;  3Q3J A;  1KDH A;  3J81 j;  4KZ0 A;  4WAA A;  4XGA B;  2ZJ8 A;  5J2A A;  5KFM A;  4QZE A;  5J0R A;  2AGO A;  3NOB A;  4OVV A;  4RCO A;  3NJT A;  9ICN A;  5J17 A;  2F77 X;  3UMG A;  4QWB A;  4MJS A;  1MN8 A;  4RNM A;  3U8Z A;  4X5V A;  2AH5 A;  2BR0 A;  1QSS A;  2QJL A;  8ICB A;  2PI5 A;  2HJ8 A;  4EX7 A;  2V1Y A;  4AQ7 A;  5JZE B;  5DB9 A;  4M9G A;  2WHE A;  3V6E B;  2FMQ A;  1SSN A;  1UWX A;  1V81 A;  2H3F A;  1QQ6 A;  3PV8 A;  3B1L X;  5IO9 A;  4ICV A;  1X2I A;  2J0J A;  3MR2 A;  2NRX A;  2J6S A;  5L9X A;  4WJP A;  3ZUN A;  2LD9 A;  3RB3 A;  1HUO A;  2FCQ A;  3M9O B;  1XSL A;  2ZIU B;  3HIZ A;  4MHV A;  1JQ4 A;  3CIR B;  1ZQU A;  4WWP A;  3WK6 A;  1X9S A;  1LXD A;  2D3D A;  2LFI A;  4BUG A;  2KHQ A;  1U4A A;  1TV9 A;  3AB5 A;  2EDU A;  3U4E G;  2KJR A;  2C7H A;  1TYG B;  3GS2 A;  1QKZ A;  5HHI A;  4YMN A;  2D3A A;  1ZQD A;  2KFK B;  2BHN A;  4DL3 A;  1O03 A;  3DOW A;  3C1Z A;  4OZA A;  3P1M A;  3PHW B;  2IPK D;  5HP4 A;  2FE8 A;  5FR3 A;  5ALZ A;  2G45 B;  4EFO A;  9ICP A;  4BKS D;  2BKF A;  1B43 A;  3PR5 B;  2ALZ A;  3WU2 U;  1ZQE A;  5ALW A;  4JUZ A;  2KQ7 A;  1KRH A;  3DHH C;  3HM3 A;  4W9G A;  2KD0 A;  3C5F A;  2IBK A;  4I2H A;  1TE2 A;  1FNU A;  4NLC A;  5J0P A;  4I2C A;  2HCF A;  4RQ8 A;  4F50 A;  1S97 A;  3RCZ A;  2IMW P;  4HXD A;  3I5J C;  2WF7 A;  3HPO A;  2IGH A;  2KKC A;  4TQ1 A;  2ZIU A;  4RQ3 A;  1WMH B;  5AUI A;  4MH0 E;  3H0M B;  2W55 A;  2W43 A;  1FO4 A;  1D9D A;  3UQA A;  1XCQ L;  3SAH A;  4DSE A;  2GI9 A;  1IGD A;  1J7A A;  5H8Y E;  1S0N A;  3QYP A;  4NL9 C;  4EOY A;  4B0E A;  2AHO B;  3H8S A;  2B3A A;  3SYZ A;  5C23 A;  3H9D A;  1LM8 B;  1WCL A;  5AM2 A;  3M8R A;  1T0Y A;  4WJ3 B;  9ICW A;  3ZDM C;  1UD7 A;  3VH3 B;  1KFS A;  2JMG A;  1WX9 A;  2ZIX B;  1CEZ A;  3W1Y A;  1WH3 A;  2KMA A;  1S8O A;  4WWO A;  1ZQT A;  3KQ4 A;  2DZK A;  5TR5 A;  2FIF A;  3SFE B;  1IYF A;  1Q0W B;  4F5Q A;  5J0O A;  4Q43 A;  2KWC A;  4BBN F;  1OQQ A;  1F5S A;  4TUP A;  1SGH A;  1TBE A;  2K1F A;  5E6P A;  1WG8 A;  4UAS A;  3AN1 A;  2KAJ A;  1JXE A;  2FNJ B;  4RQN A;  3G6V A;  4FZL A;  1MG8 A;  2OED A;  2P35 A;  1ZRM A;  3B2F A;  5IOI A;  5KHQ A;  1JRO A;  2KG5 A;  4RUC A;  4J9K A;  1FCC C;  2FDR A;  4TSS A;  2I2Y A;  2PLP A;  4P0P B;  3RUL A;  2A19 A;  4ARC A;  2XY7 A;  3U7D A;  2GBK A;  2GOL A;  3RT3 B;  2IZV B;  3VTV A;  4K4H A;  1D3Z A;  1A76 A;  2L7R A;  4GC7 A;  2LGX A;  5ALN A;  2LGY A;  3AE3 B;  3BIN A;  5J2B A;  3NVV A;  4HDO A;  1D8Y A;  1WJ6 A;  4DSF A;  1SXE A;  5ALV A;  2HHV A;  3ZLZ A;  2NRT A;  4GIV A;  4FO6 A;  2ASQ A;  4ECY A;  2G4D B;  1JUD A;  1OEY A;  4ANW A;  1JWS D;  3EFC A;  2M4N A;  2N7D A;  4A9A A;  1TK8 A;  2LHE A;  2WXR A;  2I1K A;  4BKT A;  4B6W A;  1WGR A;  1WGK A;  1WGG A;  2K89 A;  2WDV B;  4WJO A;  2XI9 A;  4DOC A;  1B0X A;  2LVP A;  3SD7 A;  4DF8 A;  2CU3 A;  3B0X A;  2HHX A;  4MFC A;  1EU4 A;  2K6Q A;  1KLU D;  5KT7 A;  4KSK C;  2MSN A;  1YJ1 A;  3QX1 A;  3MGV A;  1MHH E;  3N9Y C;  3QHT A;  3VTU A;  4P0P A;  1GC7 A;  3KHH A;  3APF A;  4IWO A;  3ORY A;  2WX1 A;  2K8C B;  1X6I A;  2PMZ F;  5ALL A;  1C79 A;  2C5L C;  4W9C A;  4FJZ A;  1Z4O A;  1L5U A;  2WYQ A;  3EEC A;  2J52 A;  3VXW A;  1DOY A;  1WI0 A;  1C4P A;  3WKE A;  2EKE C;  2G1E A;  1X1M A;  2N7J A;  4PZO A;  4PK1 A;  5DPS A;  3L0W B;  1U48 A;  2BYF A;  3F5E A;  3TAC B;  4TQS A;  1S0M A;  2I1J A;  2KVR A;  3Q8M A;  4J3O D;  4BBN C;  2H88 B;  5AIC A;  2CJO A;  3H4D A;  2VZK B;  3TUO A;  3EUB 2;  1PK3 A;  3N1X C;  1YN4 A;  4O1N A;  1K53 A;  1ZQV A;  2CHX A;  4S17 A;  2G07 A;  5C2T B;  2KTR B;  3ZRC A;  3FYH A;  3DCG A;  3R3M A;  5J2E A;  2FI1 A;  4KLT A;  3PLU A;  2FCS A;  4YR3 A;  1L4Z B;  2YN4 A;  1M4V A;  4M01 A;  4HPL B;  4FBT A;  4KLS A;  4DLG A;  2AL3 A;  3NS1 A;  4I2J A;  4YMO A;  7ICI A;  1SF0 A;  5KFF A;  4W9L A;  2NYV A;  5AK3 A;  5EE0 A;  4W9K A;  2BQR A;  4ECU A;  1N6Z A;  2K8C A;  4M8M A;  2JR5 A;  1YQ4 B;  2VJ4 A;  2PE6 B;  3PW5 A;  4YN4 A;  1SWV A;  9ICG A;  1ZQX A;  4JWS C;  4FBU A;  1X9W A;  3PZP A;  2D6F C;  3URY A;  5AEK B;  2QC8 A;  4O3P A;  3BK2 A;  4ZRJ A;  7ICT A;  3DVG X;  1ZQO A;  3ZI4 A;  2VZK D;  4DFJ A;  3PGE A;  4UB3 A;  1V2Y A;  4RGN A;  5J0T A;  1L8L A;  2L00 B;  2WF6 A;  3U7Z A;  4ZHO A;  2L0F A;  2DFL A;  3DBS A;  3NS8 A;  1ZQL A;  1OTR B;  2YEP B;  2BB6 A;  4BOZ B;  2LPE A;  2L76 A;  4DWI A;  3H7P B;  5KFT A;  1BPB A;  2VRR B;  1J2M A;  1N63 A;  3R8B A;  4NM1 A;  4ZRP A;  5J0X A;  3AE1 B;  4P16 A;  3V72 A;  2Z7J A;  4CE6 A;  2W03 A;  2SAK A;  5D2M B;  1VZ8 A;  4F4X A;  2OEH A;  1X6J A;  5D6J B;  3IXS A;  2PMZ C;  2IO1 B;  2JEG A;  1FEH A;  2BYT A;  3NVZ A;  1EWC A;  1EF5 A;  1K52 A;  4ZYN A;  5AM3 A;  3K1R B;  5BOL A;  4C56 C;  4OO1 J;  1ZQM A;  2ZIV A;  1E8X A;  2ON8 A;  5IIO A;  2K4E A;  2HMX A;  2W8K A;  1N2X A;  2YTU A;  2NO5 A;  4NPN A;  3JPO A;  3Q8Q B;  5IIK A;  5ALJ A;  1T5X D;  1PVQ A;  1IM4 A;  1V38 A;  3JPN A;  1K8R B;  4M0A A;  4PL1 A;  5D4B A;  4A55 A;  5J8Y C;  2LXC A;  3MC1 A;  1Z19 A;  2NR2 A;  3C29 A;  3T79 A;  1TS3 A;  2K25 A;  4Z6C A;  3H8M A;  4I6P A;  2GBM A;  3H8W A;  3HKZ C;  2V4I B;  3UXN A;  4YXJ A;  2AWT A;  5AHX A;  5J0S A;  3ZNG C;  1TJE A;  4UAZ A;  4CQN A;  4C8L A;  2DZI A;  2ZVO A;  4US9 A;  5J2C A;  2WAQ F;  3RNE C;  3H6N A;  3C23 A;  3EZ5 A;  2H3Q A;  3BYY B;  3PX4 A;  2W9N A;  3ETR A;  4C8M A;  4WIP A;  4YR0 A;  1A5R A;  5KG5 A;  5AZG A;  4R3D A;  2ISO A;  4XQ8 A;  4CF5 A;  4GOC A;  7ICF A;  4DHZ E;  5KFE A;  4GXB A;  1YIW A;  4BKG A;  4DCC A;  2LZ6 A;  4CF4 A;  4GB9 A;  7ICG A;  4QZ8 A;  1WUD A;  3GV8 B;  1RFK A;  1V86 A;  5J2H A;  4I28 A;  3V3X A;  3MGI A;  2OXO A;  3F2C A;  3WKA A;  4ASW C;  5HG2 A;  3L08 A;  4GLS C;  5HMM A;  5DDY A;  5FK9 C;  2ZTC A;  1SXT A;  5KFI A;  1GC6 A;  1ZQC A;  1XT9 B;  1RPL A;  4IL6 U;  3OSN A;  2JHD A;  2KNB A;  2Q4T A;  1HJP A;  5GTI U;  2BPC A;  3L4P A;  5D49 A;  3NZ3 A;  2G9H D;  3C2K A;  3I9V 1;  4DFK A;  5BYR A;  3RYT A;  1D5M C;  1Z1B A;  4LLG M;  5J29 A;  2KC1 A;  2KQ4 X;  4BZA A;  2NRW A;  4UDU C;  2DBY A;  2N1W A;  3QAQ A;  5HI1 A;  3ZJU A;  4Y2S A;  5DLF A;  1SE9 A;  2L8J A;  2XGP A;  3SI8 A;  3PO4 A;  8ICZ A;  4P2H A;  2OYY A;  5ALU A;  3T5K A;  1UGM A;  4GU2 A;  2N7E A;  2XVT A;  2ZVN A;  2K39 A;  4QAY A;  4GFJ A;  4UQG A;  4LZG A;  4XRH A;  2WWZ A;  2IOH A;  3Q3F A;  3R7R A;  4KLH A;  1ZOY B;  2RDJ A;  1X9X A;  2N9L A;  2NTS A;  2KKP A;  1CQV A;  4RF0 A;  2WU2 B;  3WA0 A;  1UA1 A;  1KLV A;  4EZL A;  3MTN B;  1OXJ A;  2ACZ B;  2ZNV B;  4Q8F A;  2R8H A;  3F5A A;  4PHP A;  1JX4 A;  2MU2 A;  3UQ2 A;  3AEV A;  3P4S B;  3R7Q A;  4NLB A;  3P4P B;  3PW4 A;  3T3F A;  1D5X C;  3DV9 A;  2WDQ B;  4W9E A;  3ZQ4 A;  3KHG A;  4PPX A;  1KLG D;  1ZQN A;  3D32 A;  4WJQ A;  1Q8K A;  4O3N A;  3VC8 A;  2PJH A;  2BWE S;  2C60 A;  4S0R A;  2MAX A;  4MGY E;  5ALM A;  2LYA A;  4M0W B;  1ROE A;  4BXO B;  1K1S A;  1YMH E;  5CJ7 A;  2KWV B;  2MEK A;  3A9K B;  4LJP B;  3OJ4 B;  2FAZ A;  3VUW A;  5T14 A;  2KOB A;  4CO7 A;  4E71 A;  2VA2 A;  4GDK A;  3KH0 A;  1LVH A;  1QH9 A;  4QNL A;  2CU1 A;  3ZVV A;  1MC8 A;  3VCB A;  4GLX A;  1F0Z A;  2RP5 A;  3JSV B;  3FC4 A;  4B9V A;  2G4S A;  5EE3 A;  3PRE A;  5J18 A;  3TFS A;  3CP8 A;  4A6Q A;  1MJD A;  2K5P A;  4OW0 A;  2EAM A;  1RG6 A;  2LYH A;  3VDZ A;  2BGF A;  4RH6 A;  2E8O A;  4UW9 A;  2KXJ A;  2LMR A;  1J8C A;  5B66 U;  5KG4 A;  5CA7 A;  5LXI B;  3UMB A;  3RBD A;  3RH6 A;  1NK0 A;  3RNC C;  3O13 A;  2N1R A;  2E5S A;  1UWM A;  3MBY A;  4II2 B;  4E3C A;  3K4G A;  3LB8 C;  4MH8 A;  2N1V A;  2BQ3 A;  1TAU A;  3RAQ A;  2E1F A;  3A0B U;  4KZC A;  1JAL A;  4QWD A;  4B9T A;  1KRP A;  1GAQ B;  1R4M B;  2PMV A;  1KTQ A;  2KQS A;  3IP4 B;  2A4Z A;  4XWW A;  1KQQ A;  4JK1 A;  3KVF B;  2QMT A;  3A9K A;  4FUL A;  3GZF A;  4KDL B;  2LBO A;  5HR7 A;  5G5G A;  2F1I A;  1ARO P;  1N61 A;  3APD A;  2K4P A;  5KFJ A;  2EZX A;  3PS6 A;  1TTN A;  3V6H A;  2KTF A;  3CST A;  4ITK A;  5KG3 A;  3ZXV A;  1YZ6 A;  5KFW A;  2GBR A;  1L6U A;  3ZYY X;  2CHZ A;  4F8C B;  2W9M A;  4Y2Y A;  3ZW3 A;  4HAI A;  2G5I B;  4O5K A;  3Q8A A;  4OCZ A;  1PYW D;  3IV6 A;  4A3P A;  4B9M A;  3NG0 A;  5JTI A;  1FFU A;  4B9L A;  3UGB B;  2PFP A;  4KGS A;  1WM2 A;  4E74 A;  1E8W A;  5E6J A;  5CHW A;  1Z4N A;  3TI0 A;  9ICV A;  3KWL A;  4IM0 A;  1QF6 A;  1PGX A;  3A9J A;  1UA0 A;  1XXG A;  2K8B B;  1IG6 A;  8ICH A;  1T3Q A;  3D2S A;  1HZ6 A;  3DVN U;  4G3X B;  5AI5 A;  1FXI A;  4JQW C;  2YX8 A;  1O08 A;  3BVG A;  3MR6 A;  4O3S A;  5ALO A;  2UYZ B;  1XLN A;  3DWG C;  1IUE A;  4GC6 A;  3C2L A;  3OTQ A;  4HCP B;  3PRM B;  4D2K A;  4MF2 A;  2M17 A;  3Q8B A;  2MQJ A;  4RPY A;  3WKB A;  4WQM A;  4DQI A;  5JH5 C;  4F4K A;  2MBO A;  3DEE A;  3SAF A;  4DO9 A;  2OWO A;  2DNF A;  3MHS D;  1WWV A;  1U45 A;  1E9M A;  4RGT A;  3AE5 B;  1N5W A;  2GLS A;  2INC C;  3CMM B;  2D2Q A;  3RZW C;  4NJ7 A;  3EHV A;  3CWI A;  1FEZ A;  2Y5P A;  3V7L A;  1NNL A;  1RZT A;  2WNM A;  4KKJ A;  2BGW A;  2NV3 A;  2BS3 B;  1ZOL A;  1FNW A;  2Y1J A;  3JVZ X;  1HXY D;  4GN1 A;  1WZ0 A;  5BMH A;  5IIM A;  4F1S A;  1I4G A;  3DVN V;  1TKE A;  1F2R I;  3KBB A;  3SD5 A;  1MPE A;  3UIN B;  3MP9 A;  4YTN B;  1R4N I;  1XO1 A;  4HK2 A;  4F5O A;  5HKH A;  1BNP A;  1E8Y A;  2KDM A;  3RRG A;  1LGR A;  4EUT A;  5L83 A;  2ZEQ A;  2LGS A;  2WQY B;  3R2T A;  2CJN A;  1X66 A;  2G08 A;  2AX5 A;  1QLN A;  2MWS B;  1JN3 A;  3EW9 A;  4C4V B;  4G0N B;  2ISP A;  1XO0 A;  2UVU A;  3EFU A;  3IT4 B;  2I1Q A;  4O5E A;  8ICM A;  2NPT B;  4GMV A;  1XSN A;  2AYO B;  1U9L A;  4EBE A;  4GXI A;  4OJ5 A;  3QUT A;  2D11 A;  1S9F A;  4R8U B;  3PPA A;  1ECW A;  1I4P A;  1KOT A;  3HUI A;  2C2E A;  5FKA C;  2SEB D;  5CHV C;  2EAP A;  3VUY A;  1OEY J;  3TCA A;  2PW9 A;  3O0F A;  2JXT A;  2LGD A;  4GIB A;  2KIW A;  4K81 A;  2M0X A;  1C3T A;  1C20 A;  1UUP A;  1UBQ A;  3RFZ B;  1HUZ A;  3MC9 A;  2IGD A;  4M9H A;  1SXD A;  1IV8 A;  2BVC A;  3H8H A;  4DL4 A;  1S5L U;  2H3Z A;  5H2F U;  2UVV A;  1I4R A;  1NI3 A;  5AKI A;  3OAW A;  1QZE A;  2ZZP B;  2DAF A;  4F93 B;  1ENF A;  4PZN A;  3GV7 B;  2JGA A;  9ICQ A;  3ENE A;  1LKY B;  1ZGU B;  2JWU A;  1MSW D;  3IRU A;  4ED1 A;  2M56 B;  4DQR A;  3VVW B;  3T5H A;  4R66 A;  8ICQ A;  3O65 B;  4C8K A;  3AEC B;  4ZRI A;  4YXM A;  4C4V A;  5KFS A;  1D8L A;  5HR6 A;  4M9L A;  2YMP A;  4IWQ A;  9ICX A;  3RBE A;  1VLB A;  1ZQG A;  4J03 A;  2KKV A;  4DOA A;  2RHF A;  2ONQ A;  4J9P A;  2G3Q B;  2FLN A;  2N9P C;  1HIW A;  1KEJ A;  2LRU A;  1U49 A;  5J2J A;  4R8U A;  2R8I A;  4NAW B;  4ANU A;  1ZD2 P;  1FRR A;  4MM3 B;  3AV8 A;  2KWU B;  2MHJ A;  5HNK A;  2KJ9 A;  3RB4 A;  2PVO D;  3GIK A;  3IT6 B;  4Y2P A;  3IVF A;  4YL8 A;  2DHZ A;  2HHT A;  3HK0 A;  3QU5 A;  5ALF A;  5JRT A;  5KT5 A;  4TQR A;  1XF5 L;  1SV0 C;  3QU7 A;  4AS1 A;  4UB6 U;  4PS8 A;  1XC9 A;  2KZR A;  4XUS A;  1LKY A;  5ALX A;  1KSP A;  1AWD A;  2PFO A;  3N7S C;  5E6O A;  8ICF A;  3PX0 A;  4EYI B;  2ZJA A;  3ISD A;  1UHU A;  9ICB A;  3ZTD A;  5EWE A;  3NZS A;  3JPS A;  4I2F A;  2LWP A;  3RJJ A;  3VHT C;  1D5Z C;  3F53 A;  4Q8E A;  3B2G A;  1WGH A;  2RLT A;  5BOM A;  2WXM A;  4YT0 B;  1BPE A;  5JU5 A;  2EQY A;  3GDX A;  4P6V F;  4A8E A;  2IY0 B;  4IWP A;  2O6K A;  9ICC A;  4IUM B;  8ICX A;  2KEY A;  4MFA A;  2KFZ A;  3Q8K A;  1WR1 A;  3DQV A;  5KG1 A;  3PZD A;  2XCP A;  4WUR A;  3N30 A;  1GPX A;  4MM3 A;  4IQT A;  1GB4 A;  1L3S A;  5E79 U;  2MW5 A;  3E58 A;  4FZN A;  1GB1 A;  2OOB B;  5BMG A;  4DXA B;  1RYS A;  4FFD A;  4OJO A;  3TAP A;  1H8C A;  5KFL A;  1ZD3 A;  2NBV B;  3OWE B;  2F1H A;  2W82 A;  1IPG A;  1NEN B;  2IOF A;  3EA6 A;  4N6E B;  1XO3 A;  4JV0 A;  1ZD5 A;  3J9C A;  1HZ5 A;  1FM0 D;  1SE4 A;  1M6Y A;  1KKX A;  3PSE B;  4RFB A;  2QAR B;  1WFY A;  2X8X X;  9ICO A;  3AU5 A;  1SKS A;  4F91 B;  2ZTD A;  2HI0 A;  1L7N A;  3ALR A;  4PHD A;  3H1U A;  2N4F A;  1ZQP A;  1RRB A;  4MSM B;  3SU8 X;  4IQU A;  2RR9 A;  4HPM B;  3AE8 B;  1YZ7 A;  4UAT A;  4YD2 A;  1ZKH A;  3BQ7 A;  3KW5 B;  3ZNI D;  5AIB A;  3PO5 A;  2Y5C A;  4AP9 A;  1K51 A;  2WX0 A;  3QK0 A;  2E6X A;  2WGS A;  4BKS A;  1A77 A;  1HTQ A;  4Q45 A;  3N32 A;  1NJX A;  3L17 A;  3HW8 A;  4ZRK A;  2ICI A;  2JYE A;  1DOI A;  4PJ0 U;  2MSE D;  2H5X A;  3L54 A;  3D2Q A;  3GU3 A;  4RUA A;  1SZP A;  2PPH A;  4TMA B;  2JZP A;  1L3V A;  3AE4 B;  3R9K A;  5DB6 A;  2FLL A;  4KX5 A;  1WXS A;  4BOS C;  4RNA A;  1L0X B;  2QAR A;  4LJO B;  4M04 A;  3PR4 A;  1QSL A;  2NMQ A;  4XWT A;  4O3R A;  3EC8 A;  1NEK B;  4L1B A;  2KFK A;  3ZIM A;  3K9O B;  1V8C A;  4KMO B;  1BVS A;  2D3B A;  3L3F X;  2Y0S C;  4MEM A;  3QUC A;  3H7I A;  1Q46 A;  2G5H B;  3OG5 A;  3RJG A;  1ACC A;  1Z1V A;  4G9B A;  4G3I A;  5DG7 A;  4DSJ A;  4J9Q A;  7ICS A;  4OZC A;  2HVI A;  3AEA B;  5EWF A;  2LMC A;  1XD3 B;  2MBE A;  1PDX A;  1CI4 A;  3UQ0 A;  3UIP B;  3VRA B;  2G09 A;  4TKN A;  2J7Q B;  3GP7 A;  4ICU A;  3QA8 A;  1WJU A;  2OH2 A;  3WCQ A;  1ZD4 A;  4UAV A;  2AEH A;  2Y3A A;  4NJC A;  1MG4 A;  1ZDV A;  2R2O A;  1WMH A;  2W9C B;  4JWM A;  3C1Y A;  4PS7 A;  1P3Q U;  3GIL A;  5AI0 A;  5ALD A;  4IW0 A;  7ICJ A;  3DBL B;  1ZW7 A;  1VJK A;  4KGT A;  4BJQ A;  1QOG A;  3ETL A;  3EYZ A;  2NO4 A;  3S6J A;  2RPQ A;  2Y1I A;  4M6W B;  3QC8 B;  2HBL A;  3TQ1 A;  5EWG A;  5CRX A;  1N62 A;  4IM2 A;  5IAA C;  2ATL A;  4ANX A;  2ZIX A;  1TZ1 A;  3W1S C;  2M19 A;  4FLH A;  1TZO A;  2O2V B;  3AU6 A;  1PFD A;  2IDY A;  4XYC A;  4B9S A;  3DBR B;  5C3J B;  3K75 D;  2Z0D B;  2KFJ A;  2D10 A;  1ZP0 B;  1NDD A;  1YN3 A;  3ZKJ C;  4GSW A;  1C4C A;  2WXO A;  2F8L A;  2VJ5 A;  2C7N B;  2JT4 B;  2FPM A;  4IC9 A;  2W7O A;  3WAO A;  2IND C;  2E1E A;  5EE9 A;  1BPD A;  5AI8 A;  1I7H A;  1MVK A;  4P1C C;  3IDW A;  5HFY A;  2LI5 A;  4UBB A;  4XE0 A;  5BPC A;  2QDF A;  2I5H A;  1TK0 A;  2AU0 A;  2XN9 C;  1KLN A;  3T3O A;  5KG0 A;  1ZJM A;  4KN4 A;  2KYW A;  2BQU A;  1BUI C;  3U2S C;  2MX2 A;  1E6E B;  2E8P A;  1J97 A;  4M6W A;  1X40 A;  3PLV A;  4JIO U;  1FXT B;  2BB5 A;  3PW7 A;  3JPP A;  3DVG Y;  3RF9 A;  1Y8R C;  4IQV A;  4KLI A;  1E10 A;  2BWF A;  9ICF A;  1TY2 A;  1YJI A;  2MH7 A;  3TAD C;  4F4Y A;  1C78 A;  2JYT A;  4YG2 A;  5ALP A;  4BX9 C;  5KFN A;  1BT0 A;  1VZ7 A;  4Z6E A;  1QOA A;  4I6N B;  1S0O A;  2ODG A;  1TK5 A;  4ELT A;  2V3P A;  4R63 A;  1PVP A;  5DPW A;  1RYR A;  4GXK A;  2PKE A;  2E8M A;  5ALQ A;  2RQ5 A;  3HKZ F;  4MT5 A;  3A1Q B;  2KC2 A;  3UPQ A;  5HML A;  8ICJ A;  3M3J A;  2DYO A;  2YMQ A;  2ZG6 A;  2Y9T A;  3KOO A;  1NKC A;  3Q8C A;  5J0Y A;  3OHB A;  2RD0 A;  3ZRF A;  4KSL C;  3KUC B;  4H2A A;  2WHI A;  1TVA A;  1SZH A;  3ZO5 B;  4NY8 A;  3BDP A;  4FAD A;  1ZE3 D;  3SR6 A;  5AM0 A;  2J6T A;  1P7F A;  1U4B A;  1DXS A;  2VH1 A;  4M9J A;  3RR7 A;  7ICN A;  1GO3 F;  1WXV A;  3HVZ A;  3CF6 E;  4QZC A;  5I4D A;  1ZYQ A;  1QTM A;  1FRD A;  1ESF A;  3ML8 A;  3V05 A;  4CGZ A;  5KL1 B;  4Q2J A;  1M94 A;  1XEE A;  3TJP A;  4DSL A;  4YQW A;  1LB2 B;  4DF4 A;  4F5P A;  1AYF A;  2MBB B;  1NYQ A;  3PZ8 A;  3W5U B;  1COK A;  3ECI A;  2YQE A;  1L4D B;  2KTR A;  4N59 A;  2GWS A;  4EZ6 A;  4RZR A;  3RH5 A;  3RZF A;  4PGX A;  2AQ3 B;  2HSZ A;  2KT7 A;  1OQR A;  4MF8 A;  1D4B A;  3TEY A;  3BZK A;  3A1Q A;  1J7C A;  3AMZ A;  1T0S C;  4J9R A;  1SE2 A;  1OFF A;  3SDL C;  2OHF A;  2HHW A;  1WJ4 A;  2PI4 A;  4M8N A;  3C2M A;  3KZI U;  4KGR A;  5KFY A;  2XGQ A;  2LKY A;  2J53 A;  3TKA A;  5J0Q A;  1KL9 A;  4MEY A;  4QZ9 A;  8ICA A;  2JY6 A;  1Y88 A;  3SZ2 A;  4ED6 A;  2FE9 A;  3SV4 A;  4LNF A;  2HE7 A;  2KK8 A;  2HHQ A;  5ALG A;  4PHA A;  5H92 C;  3QXG A;  2HDE A;  1QCK A;  2ASD A;  2P6R A;  2V3N A;  4IC7 B;  2WXQ A;  5AI9 A;  2INN E;  2ZCC A;  2J6U A;  1DOQ A;  3TAQ A;  3ZTC A;  2PEA A;  1LQB A;  5IKC M;  2BCV A;  4O5C A;  4GDL B;  4JWN A;  1L2N A;  1LO5 D;  1V1O A;  5BYQ A;  3OPX A;  4B9U A;  3BQ1 A;  4M47 A;  1IGC A;  3EPG A;  4HPP A;  2GBN A;  5IP4 D;  3PX6 A;  9ICU A;  3H7P A;  1JXL A;  5CEH A;  3D2N A;  2JZZ A;  4ECZ A;  3TEX A;  4DL6 A;  3U26 A;  5T8I A;  1IIP A;  4KLE A;  2FCM A;  4LNI A;  5KT2 A;  2KX3 A;  2V3S A;  3K9P B;  3AUO A;  5J8Y A;  2GO7 A;  2VIX A;  2P66 A;  2W3R A;  1J2N A;  3H7S A;  4UBC A;  3OSP A;  3Q8P B;  5HHH A;  1WXA A;  4IR9 A;  1T3N A;  2FUG 1;  4EZ9 A;  2F8K A;  3HP6 A;  2HD5 B;  2MA9 B;  3Q3M C;  1ZQQ A;  1L7O A;  1X9M A;  3WK5 A;  1WXQ A;  2OM6 A;  1KW4 A;  4J6I A;  4DLE A;  3L10 B;  3M7D A;  2XCA A;  5ALS A;  1ZQF A;  2CR5 A;  2FUH B;  1I4Q A;  3MDA A;  1IBX B;  1DGJ A;  3I3T B;  2QIE B;  4W9H A;  2J42 A;  3SV3 A;  4GDL A;  1NK4 A;  4KLQ A;  1BPX A;  1HQR D;  4ZRQ A;  1UCV A;  2ZJ5 A;  2KAC A;  4PS3 A;  4EYH B;  2MBQ A;  4W9F A;  2LVO A;  3AE9 B;  5ALE A;  1HEZ E;  4TUQ A;  3RMK C;  3NUH B;  4OVZ A;  2MJD A;  3P2B A;  1V80 A;  4P7I A;  4AUQ C;  5AUK A;  2W04 A;  2GB1 A;  4BVU C;  2MCN B;  5FP0 A;  2V0G A;  3PNC A;  1WYG A;  3PY8 A;  4DHZ B;  2I9G A;  1YQB A;  4FS2 A;  3GOE A;  1URJ A;  4CF3 A;  1ZQH A;  2KDF B;  5DB7 A;  3RNG C;  3Q3O C;  1C9F A;  3KD3 A;  2JRH A;  3RPF C;  3UQB A;  1ZQ1 C;  4F5R A;  2F76 X;  1NKE A;  2KVC A;  1Z3E B;  4FE3 A;  3H0L B;  1NJW A;  4NY0 A;  5D3D A;  1AN8 A;  1ZQR A;  4W9I A;  2GMI C;  4N9F 4;  1N60 A;  4MEL A;  5KTQ A;  3RD2 A;  2CXY A;  1PK1 B;  3PW0 A;  2J0M A;  4NQK E;  3GZN B;  4JWU C;  3X0W A;  1BPY A;  2VH2 A;  3IHQ B;  1CZP A;  2IJ0 A;  2JZB B;  1TKG A;  2HW3 A;  4CHK A;  3BWU D;  4IM3 A;  3HHM A;  3FDS A;  3KHR A;  4F2R A;  1WGY A;  4QZB A;  3P42 A;  3SHQ A;  4C4R A;  1B22 A;  1GOZ A;  2EKI A;  4O3O A;  4C80 A;  3A33 B;  3R2I A;  3M9N B;  1FXA A;  3OJ3 A;  4MGZ E;  4B9N A;  1DK2 A;  3SEN A;  2XY6 A;  4MGI E;  4AJY B;  3QUB A;  3HJE A;  3TBL D;  2BW2 A;  5MPO A;  2BTE A;  5FR6 A;  2IYD B;  5KFH A;  2E8N A;  4HDQ A;  3PSF A;  3QX7 A;  1WX8 A;  2BT6 A;  2NTT A;  2PFQ A;  3QU4 A;  2HHS A;  3DBH B;  5IA7 A;  3A4S C;  1NKB A;  1B4F A;  1IP9 A;  1WSP A;  4GXJ A;  3ONN A;  4YFK A;  1CK1 A;  1QIL A;  4F5N A;  5F9L A;  3KFU F;  2FID A;  4NAM A;  5KNI A;  1WYW B;  3HRD D;  1TGZ B;  4AP4 C;  4AYB F;  7ICO A;  4YSY B;  2KIV A;  3IAS 1;  4EBD A;  4DFM A;  2W7P A;  8ICK A;  1N56 A;  1I4X A;  3KUZ A;  1PK1 A;  3I1Y A;  4NLG A;  4RT2 A;  3QQ8 B;  1D8B A;  3GIJ A;  1SBB B;  2WXN A;  9ICR A;  5KFD A;  4UB4 A;  3UF8 A;  2CPR A;  4RQM A;  4JPS A;  3SEB A;  1OUQ A;  4IRD A;  2FMP A;  2LM1 A;  3IG3 A;  3H0R B;  3ZJV A;  1DRG A;  4U7C A;  2KO3 A;  2ASL A;  1NJY A;  5L1I A;  3C21 A;  4I29 A;  5KFR A;  4RQ0 A;  4FS1 A;  1FIQ A;  4M0W A;  1J19 A;  4BXO A;  2KV2 A;  2IHN A;  4QWC A;  5AM5 A;  3UXP A;  5J2R A;  3JPT A;  1ZQY A;  5AK5 A;  3TMP B;  2AJQ A;  1JRP A;  1K5O A;  3KTQ A;  2NBW B;  2KZ3 A;  2KK0 A;  4EEN A;  4EEL A;  3Q8S B;  3N3K B;  4MDK E;  1WGD A;  2Q5W D;  4DWF A;  1RLF A;  3JSV A;  3HVD A;  1EXN A;  4KLM A;  4EZJ A;  2EAN A;  3AE2 B;  3N1Z C;  2DZJ A;  2KDB A;  4RGM A;  1FMA D;  3ML9 A;  3TAN A;  2W9A A;  1XLO A;  2Z8L A;  4LNN A;  2WP9 B;  2G0A A;  3EGR A;  5KFO A;  2F3N A;  3PMN A;  3MC0 B;  5AZH A;  4Y2Q A;  3JYU A;  1D9F A;  3HX0 A;  1NYR A;  3ZNH B;  3M63 B;  2J4X A;  2BDU A;  2A5U A;  2LJI A;  5JHB A;  3PSP A;  2BPS A;  3AEG B;  1Q10 A;  3ICX A;  4DDG D;  3AED B;  2QLT A;  1VRA B;  1NBF C;  4KLJ A;  2ZIW B;  7ICV A;  3TSS A;  3UIO B;  5IIN A;  1JWU D;  3RTV A;  3N1Y C;  3GE8 C;  4AYB C;  3M8S A;  1GG3 A;  2LEK A;  1F77 A;  4P4O A;  2AL6 A;  1L3U A;  3TEW A;  2IO2 B;  4K1R B;  3HIL A;  5AIA A;  5AKL A;  4QZF A;  1P98 A;  4F7Z A;  3M1Y A;  1JI7 A;  3T8M A;  1F44 A;  1UF0 A;  1HA5 A;  5III A;  1KBU A;  3LK9 A;  2XY5 A;  4RM8 A;  3SFD B;  1YD8 U;  1NVI D;  1XSP A;  7ICM A;  1SL0 A;  1T4G A;  1YX6 B;  2WXK A;  2K8B A;  4ZHP A;  1ZXI A;  4O9M A;  3QEA Z;  1STE A;  3Q2A C;  4DFP A;  5ALT A;  3GIM A;  4YD1 A;  4YTM B;  1TT5 B;  3FAH A;  4R65 A;  1UEL A;  4K4G A;  1C76 A;  4K7S A;  4HVB A;  2KZZ A;  3ISC A;  2O6V B;  7ICK A;  1JWB D;  5AKE A;  1L5P A;  4RT3 A;  5D3I B;  3RNB C;  1K50 A;  2LHD A;  4L2Y A;  2ZIW A;  2KMM A;  3E56 A;  4YVZ A;  2LM4 A;  1GUA B;  1Q5W B;  1RDF A;  2EH9 A;  1SGG A;  1P0R A;  4DQQ A;  4PHE A;  2NVU I;  2P6U A;  3AI5 A;  3KKA A;  2W54 A;  1ZQK A;  2INP E;  1E7V A;  2D8C A;  4URK A;  4KMU A;  2MBH A;  1KN5 A;  4OZB A;  1Q3V A;  2R8G A;  3H40 A;  4DQO C;  2DLB A;  1WX7 A;  2C7M B;  1V97 A;  4HRS A;  3AL0 B;  1N48 A;  2JF5 A;  2EMS A;  4HLE A;  2ZW1 A;  4IS7 A;  3MR3 A;  2A1J B;  5F9N A;  2JEJ A;  1UQV A;  2OJW A;  1LFD A;  2CS4 A;  3UI3 A;  1XQQ A;  2IO3 B;  1NI2 A;  3W2D A;  3KZX A;  1NK5 A;  2HJ1 A;  4RQ1 A;  4JE3 B;  1SIJ A;  4Q44 A;  3MDC A;  2JSV X;  2NRV A;  3ZD9 A;  4YCX A;  3DDC B;  1YX5 B;  5HHD G;  2ZTE A;  1KFT A;  2O6V D;  2DKZ A;  2HHU A;  3RNF C;  4I2A A;  2WXF A;  1G6J A;  1UH6 A;  4C4S A;  9ICS A;  4YXD B;  3HT3 A;  1TAM A;  4OJL A;  2BCQ A;  5IIL A;  3NTU A;  1T94 A;  4IQW A;  3DWM A;  5AKK A;  2V4Q A;  8ICG A;  4U6P A;  2BBC A;  1F2R C;  4P4M A;  1CMX B;  3RJF A;  2DPJ A;  4Y2J A;  2NPT A;  1X42 A;  4MEX A;  2XIC A;  5J0W A;  3M6Z A;  2RDG A;  4JGH B;  4KLD A;  3Q8R B;  4KX3 A;  3T5J A;  4XZ4 A;  1OQY A;  2H89 B;  4I2E A;  4NXZ A;  4KV2 A;  1Q3U A;  4IRC A;  1EO6 A;  2L3Z A;  1JCK B;  5KFX A;  3GQC A;  2PE9 A;  2XBB C;  5JHA A;  4HYK A;  1VCB A;  3C5G A;  5G2N A;  4KIT B;  1ZQS A;  3ZDD A;  3A4R A;  5C5J A;  4WWM A;  2LUM A;  3LWL A;  2FMS A;  4I27 A;  1C7Y A;  4EE2 A;  2K60 A;  1MFW A;  3B0Y A;  3ZDE A;  4F2S A;  3F2D A;  2KN5 A;  2QCZ A;  2KFN A;  4J9M A;  4REZ A;  2K8A A;  1EUV B;  2IO0 B;  4F71 A;  5KFA A;  1J0G A;  3NUQ A;  5L1M A;  4MJS B;  2EZY A;  1VD2 A;  3BVM A;  5DBC A;  4QJF B;  3ALB A;  2F2A B;  5DQH A;  3RJK A;  4DL2 A;  3IN5 A;  4NAW A;  3WAP A;  1KF6 B;  1QT9 A;  5DPR A;  1D6E C;  2KIC A;  2KN7 A;  2BPF A;  3ED5 A;  3QNM A;  1SJE D;  3JW0 X;  2Y0S F;  3ZNZ B;  3RB6 A;  1JMS A;  8ICN A;  2MRP A;  1WM3 A;  5BMI A;  3C8Y A;  4US8 A;  3SMV A;  1VR9 A;  4ED3 A;  5L1L A;  1U47 A;  3VUX A;  3AQE A;  9ICE A;  1P1A A;  3G6Y A;  5J2D A;  5LLI A;  4ACO A;  2JRZ A;  5KFU A;  4J9S A;  2L05 A;  4G11 A;  4OJP A;  1A6S A;  1WCN A;  2IHM A;  1OGW A;  4XC2 A;  5AM1 A;  4USA A;  3RUI B;  4EZK A;  1WF9 A;  4LCD E;  2FBW B;  2V9H A;  1XCT L;  3WKC A;  3SAG A;  4PYZ A;  2KLC A;  3H4B A;  2DZM A;  2WF9 A;  2M1M A;  4QZA A;  1MQ2 A;  4J9N A;  1LV5 A;  2RSU A;  4Y2V A;  2JEF A;  5D46 A;  2XNA C;  1YOV B;  3AU4 A;  2I38 A;  5J0U A;  4CYE A;  4ARI A;  4BDP A;  4YP3 A;  2FCN A;  5AKG A;  2N0S B;  5KT3 A;  3SQI A;  1IXR A;  2KOX A;  2UWQ A;  4DFD A;  1A70 A;  5KAF U;  3E2E A;  1CRX A;  1UBI A;  4OD0 A;  2VA3 A;  4P1B C;  9ICA A;  3BZD B;  5B5E U;  5AKX A;  5AKH A;  3WAN A;  1CUK A;  2B6G A;  2KVZ A;  2JXX A;  2ZXI A;  3RJE A;  4Y2U A;  1MA7 A;  3PST A;  4BWJ A;  2PIA A;  4BFR A;  2M0N A;  2WXG A;  4PGQ A;  4PT5 A;  1JRU A;  2WF5 A;  1WRI A;  2UVW A;  2KD1 A;  2HOI A;  5TSS A;  4ED0 A;  3DHI C;  4AWJ A;  1V9P A;  4K3B A;  3L5K A;  4IKG A;  2KSO B;  3AEB B;  3NGD A;  5CHF A;  3UM9 A;  1UT5 A;  1MHX A;  2AQ1 B;  1SJH D;  5CX3 A;  5DG8 A;  2W8L A;  2B21 A;  3TAR A;  3TEZ A;  1UPH A;  3WK9 A;  2KLG A;  1KH0 A;  2KWD A;  4UB2 A;  1V9J A;  5EE1 A;  4RQ7 A;  4KTQ A;  4DHJ B;  4FZM A;  1PGB A;  1Z2M A;  2HVH A;  2PTL A;  4HJG E;  2BS4 B;  1ZRN A;  5DQG A;  2YB4 A;  4XA5 A;  4F72 A;  1E90 A;  3N7P D;  5KT4 A;  4QWE A;  1V5T A;  4JMU A;  1FD6 A;  2ZJD A;  3PO0 A;  2MRL A;  1VZ6 A;  3MR5 A;  3IAM 1;  4RPZ A;  4NL9 A;  3WK8 A;  1ZPS A;  1JWM D;  4DXF A;  2KHV A;  4OJ6 A;  3DBL I;  5BO4 B;  3BS5 B;  3VH4 B;  1ZQI A;  9ICL A;  1RQL A;  4WWN A;  3BZC A;  2W9B B;  2HOF A;  4FHJ A;  2IOF K;  2KSO A;  5AK6 A;  5KAI U;  2WXI A;  2KTQ A;  4NZL B;  2LHT A;  2OCE A;  2N9K A;  2L1A A;  1L7M A;  3FKY A;  1C1Y B;  1DK3 A;  2KJ8 A;  1MQ3 A;  1WZ3 A;  3CNH A;  3RN9 C;  2ASJ A;  2C2D A;  1FPY A;  4NLZ A;  2WDR B;  4DEZ A;  4LNK A;  2PFN A;  4Z6D A;  5DPT A;  1V85 A;  4KN7 A;  1TS4 A;  4DHJ D;  2MJE A;  5KFB A;  2R61 A;  3DBR I;  4KVG B;  1WE6 A;  3BQ2 A;  1S77 D;  4NV0 A;  2KZM A;  1L8O A;  2NCN A;  2TSS A;  4I2D A;  3WKD A;  5KFG A;  2XID A;  4B0M A;  1JML A;  1TAQ A;  2IBI B;  2WU5 B;  2CKH B;  9ICH A;  1C4A A;  2KAN A;  1AW7 A;  2K22 A;  4DOB A;  4WH4 A;  3ZD8 A;  1XNS A;  3MFH A;  4KLG A;  4C0Z A;  3H8J A;  1AAR A;  5KFC A;  2LRW A;  1E0Z A;  3BS5 A;  2HTM E;  1OW5 A;  3U30 A;  4IR1 A;  2VKQ A;  4BAX A;  2W9B A;  4NLN A;  3NRZ A;  1TFR A;  3W1S A;  4NLK A;  5E6N A;  1ZDX A;  1QQ5 A;  4J9O A;  1MI0 A;  2W9C A;  3AEF B;  4JV1 A;  3RNA C;  3RRH A;  1YJJ A;  3QUQ A;  2F1J A;  2BZF A;  1FFV A;  2X38 A;  1QOF A;  1TY0 A;  1Y56 A;  1I4H A;  2BCU A;  1KTK A;  3AE7 B;  4K3C A;  8ICT A;  1L6N A;  4KX6 B;  4J9L A;  1E7U A;  3QAR A;  4QWA A;  3ISB A;  4BWM A;  3V61 A;  1ET9 A;  2FLP A;  4DS5 A;  2YB1 A;  2R8K A;  8ICY A;  4C8O A;  4ZH4 A;  2PXI A;  3C19 A;  4GGQ A;  5LXH A;  2DUY A;  1KFY B;  2O2V A;  2B76 B;  4TUR A;  2RGF A;  3GB1 A;  2CHW A;  1ZQZ A;  2EMT A;  3WAM A;  2DKX A;  2LUE A;  1WWU A;  2Y9U A;  3B0A A;  4XX5 A;  2DPI A;  4C8N A;  3OJS A;  2ZXH A;  4C7Y A;  4TUS A;  1RAX A;  1BML C;  8ICS A;  3AUL A;  2C22 A;  3CW2 C;  3GE3 C;  3IG5 A;  2QB0 B;  3CYM A;  2WXL A;  2BKE A;  5J2G A;  8ICO A;  2YEP F;  3BYT B;  4HRO A;  3HM6 X;  1SKW A;  2GOW A;  5DB8 A;  3TAD A;  1EU3 A;  5DGA A;  1DOX A;  2DEN B;  2BYV E;  4I6L B;  4MGK E;  3WIM A;  1EM7 A;  2BYE A;  1B9R A;  4PGY A;  4DQP A;  3QU9 A;  2WTF A;  2V4R A;  3LDZ E;  5L1J A;  4KLL A;  2D07 B;  1S76 D;  3C0R B;  3RH4 A;  3QJZ A;  3F2B A;  3AH7 A;  5CTR C;  2DL0 A;  1ZQB A;  3U52 E;  8ICL A;  3R66 C;  3Q6B A;  2IY1 B;  1XWL A;  4I2B A;  5DBB A;  8ICI A;  3PV1 A;  5L95 C;  2LJ5 A;  3V6K A;  3KYC D;  1L3T A;  4FHK A;  3PT2 B;  1SB3 C;  3IG8 A;  3KLS X;  2AQ2 B;  4UB5 A;  2BS2 B;  4QW8 A;  1RXV A;  1H4R A;  2ZIV B;  3JPQ A;  4JX1 C;  2QEJ C;  2ZUD A;  3WK4 A;  2WXJ A;  4EEK A;  5K4L A;  3LWM A;  1EWY C;  2QB0 A;  1SKR A;  4ACF A;  5ALI A;  3I57 A;  5J2I A;  4FJY A;  1S1Q B;  4YR2 A;  2WFA A;  5CR0 A;  2XK5 B;  1L0Y B;  2C28 A;  2GBJ A;  4KLF A;  1L7P A;  4ECV A;  2JU6 X;  3MAB A;  2DQN B;  1B1Z A;  5CB1 A;  2Z59 B;  5AZF A;  4PYU A;  1T0Q C;  2KHW B;  4OHJ A;  4II3 B;  2MA1 A;  2V9W A;  3BVZ A;  2ZW0 A;  3RI7 C;  1YT3 A;  7ICE A;  3ZXR A;  1PUZ A;  2R8J A;  1P7D A;  3T9L A;  3OGU A;  9ICM A;  1T7P A;  1V1P B;  3QZ8 A;  2ZCB A;  1ED1 A;  1UT8 A;  3LVW A;  1WJN A;  2KMC A;  2QIL A;  2WS3 B;  1JIH A;  5GXG B;  4M02 A;  4LNO A;  1XLQ A;  1BXT A;  4XDD A;  3THV A;  4DSK A;  1J7B A;  3MHZ A;  2QSD A;  1BNO A;  1RWS A;  3NHE B;  3TIX A;  3W5V B;  4FBJ B;  4ED7 A;  3ZGZ A;  3MJW A;  4PH5 A;  5KFQ A;  3Q69 A;  2KJH B;  1SL1 A;  2LXA A;  3ZJT A;  1XS9 D;  3N20 C;  3IHP C;  3VR8 B;  3T5L A;  4FXC A;  3TFR A;  4M00 A;  4LJX A;  4RNO A;  2DAJ A;  7ICQ A;  4IOI E;  2BDP A;  2K0P A;  3RJI A;  2XK5 A;  5KG2 A;  1FCL A;  5AKZ A;  2K4H A;  2KMD A;  4ECT A;  4ECW A;  1T6B X;  4LZD A;  2D3G A;  4X57 B;  5ALY A;  3RR8 A;  4B6J A;  1NK9 A;  2JPH A;  4TUU A;  1KM7 A;  4RMA A;  5KHO A;  1Z00 B;  2IA6 A;  2AQ4 A;  3RFA A;  1S3S G;  2PVG C;  2E3T A;  4ELU A;  1V1P A;  3FIL B;  3NAS A;  3S2A A;  2AGP A;  3KWV A;  2MUT B;  8ICR A;  2L32 A;  1NK6 A;  3PRZ A;  1YQ3 B;  4FN2 A;  1E5W A;  3I28 A;  2H3I A;  1RM6 C;  1V49 A;  2QB1 A;  5KFP A;  4OVU A;  3G6X A;  1ZQJ A;  4DL5 A;  2L0T A;  2QHO A;  4ZDV A;  4A20 A;  2LGI A;  3AQF A;  4EX6 A;  4AJW A;  1C77 A;  2KDI A;  1KFD A;  2ZPY A;  1PGA A;  2KN4 A;  5KFV A;  5JXV A;  5AM4 A;  1DYQ A;  2A1A A;  4DBG A;  5IN7 A;  1SEB D;  4G50 A;  5EDS A;  3L16 A;  5J2K A;  3GZN I;  2BF8 B;  2RDI A;  1K1Q A;  2EEL A;  3EWA A;  1SL2 A;  3RB0 A;  1WIA A;  3QWZ B;  2BPG A;  1BGX T;  2V4L A;  3HWT A;  1QQR A;  4LVS A;  3V6J A;  3ZDA A;  1WY8 A;  2ZPN A;  1JW9 D;  4MSQ B;  4YWG G;  1Z00 A;  1P9D U;  2JZ3 B;  5JUM A;  3AXC A;  4UAU A;  1PZN A;  3N97 B;  4YSX B;  3VFK A;  2L83 A;  3FIL A;  2B0C A;  3T3N A;  4RNN A;  5KG6 A;  3UMC A;  1IBX A;  2MUT A;  1NZP A;  5KL8 B;  4QZG A;  3D6J A;  1L7Y A;  2L52 A;  2JX5 A;  9ICT A;  4K7W A;  2WB1 F;  1CJE A;  3DBH I;  1V6E A;  5D7G A;  1TKD A;  4GDK B;  4HJK A;  3VQI A;  4B95 A;  5BYS A;  3A0H U;  1ZQW A;  5AKJ A;  2JQR B;  2EZZ A;  5A0L A;  2XEW A;  1ZUD 2;  2Y5B B;  4QW9 A;  3CRX A;  2ZUB A;  4KIK B;  3SEI A;  2JH7 A;  3Q8E A;  4O0I A;  5KT6 A;  4HKZ E;  3B08 A;  3LJ3 A;  3VR9 B;  2XO7 A;  4MFF A;  4YSZ B;  3DDH A;  5DQI A;  1EF1 A;  1UNS A;  3V7K A;  4ECX A;  2C9W B;  2KP7 A;  4ELV A;  2K4I A;  5GMV A;  2N9X A;  5EOZ A;  1Q1O A;  4ICA A;  2YVC A;  1QQ7 A;  3V6C B;  2W11 A;  3RAX A;  2WAQ C;  4CCH A;  3ONS A;  1R4M I;  4YTP B;  4FA6 A;  2JZB A;  3Q8F A;  3P4Q B;  2RDB C;  1I42 A;  3E0F A;  5KFZ A;  1ISN A;  2R18 A;  4AOF A;  2ZNV C;  3AEE B;  4M9N A;  4XDC A;  3N4M B;  4UB8 U;  2HTH A;  4JV2 A;  5AI6 A;  1L6V A;  3BQ0 A;  8ICP A;  2LVQ A;  3NZU A;  4DDI D;  1RYU A;  1ZQA A;  2D3C A;  1F1H A;  1PQS A;  1XLP A;  4HKQ A;  2BKR B;  1WE7 A;  4HCN B;  1TKY A;  5DDM A;  4Z6F A;  4RQ4 A;  3NY5 A;  1SWW A;  2Z0E B;  4KIK A;  3N7R C;  2RRD A;  4O3M A;  1YNT E;  1F0M A;  3M9M B;  3W9C B;  3E9S A;  3JPR A;  2K6D B;  2YMM A;  5DKW A;  3B9J A;  1QOB A; 
#chains in the Genus database with same CATH homology
 4C56 C;  3WCQ A;  1JCK B;  1WWT A;  2Y3A A;  4NJC A;  1ZDV A;  3NVW A;  2ON8 A;  3BK1 A;  4WAF A;  2WXP A;  4LK0 M;  4WWM A;  2LUM A;  1T5X D;  1VJK A;  4RGO S;  3LXF A;  1TS5 A;  4KGT A;  4EE2 A;  4TQ0 A;  1QOG A;  4A55 A;  4REZ A;  1TS3 A;  1PUT A;  1N62 A;  2V4I B;  2M19 A;  1TZO A;  3BVM A;  1TJE A;  4CQN A;  1PFD A;  2IDY A;  4RF1 A;  5C3J B;  4US9 A;  3BYY B;  1ZP0 B;  3AE6 B;  1KF6 B;  3ETR A;  1QT9 A;  1YN3 A;  2RDH A;  4WIP A;  1D6E C;  1C4C A;  4R3D A;  4DXG A;  2WXO A;  1SJE D;  4L23 A;  4N58 A;  5BMI A;  5LNK 1;  1YN5 A;  4IDI A;  3C8Y A;  2K9X A;  5EE9 A;  4US8 A;  1RFK A;  1VR9 A;  1I7H A;  1MVK A;  3V3X A;  5HFY A;  4XE0 A;  5HG2 A;  3ABV B;  4GLS C;  5FK9 C;  1ZXH A;  1SXT A;  2XN9 C;  3T3O A;  2IGG A;  1BUI C;  3U2S C;  4USA A;  1E6E B;  2FBW B;  1XCT L;  2BB5 A;  1P7E A;  3L4P A;  3NZ3 A;  2G9H D;  3I9V 1;  5BYR A;  1D5M C;  4LLG M;  1E10 A;  4LTU A;  4A90 A;  3P4R B;  2KQ4 X;  1TY2 A;  2XNA C;  1YJI A;  2MH7 A;  2JYT A;  2I38 A;  1C78 A;  2D5G A;  4UDU C;  2DBY A;  5HI1 A;  1VZ7 A;  3VRB B;  3ZJU A;  4ARI A;  1QOA A;  2V3P A;  2N0S B;  1A70 A;  2GRI A;  1VDV A;  4MT5 A;  3BZD B;  3BII D;  1ZOY B;  2WXH A;  2DYO A;  2N9L A;  2NTS A;  1CQV A;  4RF0 A;  1UGJ A;  2WU2 B;  3Q8C A;  4KKI A;  2PIA A;  4C7Z A;  2WXG A;  3AM9 A;  2ACZ B;  4PT5 A;  4H2A A;  2MJ3 A;  1WRI A;  5TSS A;  1ZE3 D;  3MFG A;  2DYM A;  3P4S B;  3SR6 A;  3AEB B;  4IKG A;  1P7F A;  3P4P B;  1D5X C;  2WDQ B;  3LYY A;  1MHX A;  3ZQ4 A;  2AQ1 B;  1KLG D;  1SJH D;  3HVZ A;  5I4D A;  3TEZ A;  1FRD A;  3NVY A;  1ESF A;  3V05 A;  1KH0 A;  2KWD A;  4MAC A;  4Q2J A;  1XEE A;  1N5X A;  5EE1 A;  1ROE A;  1YMH E;  1AYF A;  2MEK A;  1NYQ A;  1PGB A;  2RMM A;  3PZ8 A;  3W5U B;  2PTL A;  4HJG E;  1L4D B;  2BS4 B;  4N59 A;  4ZYS A;  2PKO A;  2AQ3 B;  3P63 A;  3PZ7 A;  1OQR A;  1D4B A;  3TEY A;  1FD6 A;  1E7P B;  1J7C A;  3PO0 A;  3AMZ A;  1VZ6 A;  1F0Z A;  3FC4 A;  5G5H A;  3IAM 1;  5EE3 A;  1SE2 A;  1OFF A;  1ZPS A;  4A6Q A;  1JWM D;  2OHF A;  4DXF A;  2K5P A;  4OW0 A;  1SE3 A;  4RH6 A;  4KGR A;  1JWA D;  2J53 A;  2WXI A;  4NZL B;  3O13 A;  1UWM A;  2N9K A;  2L1A A;  1R7S A;  3LB8 C;  4MH8 A;  5H92 C;  1RYJ A;  4HEA 1;  2RPV A;  2HDE A;  2WDR B;  1JAL A;  2PMV A;  1GAQ B;  2V3N A;  1TS4 A;  2WXQ A;  2MJE A;  2R61 A;  1TS2 A;  2INN E;  4XWW A;  4GDL B;  2QMT A;  1LO5 D;  5G5G A;  4ZOH C;  2TSS A;  2W3S A;  1V1O A;  5BYQ A;  4B0M A;  1N61 A;  1JML A;  1IGC A;  2DWQ A;  2WU5 B;  4ITK A;  3MJ5 A;  3TEX A;  3ZYY X;  1L6U A;  1C4A A;  1FNV A;  1AW7 A;  2K22 A;  5T8I A;  3Q8A A;  1PYW D;  1QLB B;  4WH4 A;  1FFU A;  4KGS A;  4A8X C;  5E6J A;  1E0Z A;  2W3R A;  2HTM E;  3KWL A;  2M0A A;  1ET6 A;  2K3U A;  1PGX A;  1QF6 A;  1XXG A;  3NRZ A;  2FUG 1;  3W1S A;  1ZDX A;  1MI0 A;  3AEF B;  1L0V B;  1WXQ A;  2WLB A;  1YJJ A;  1T3Q A;  1HZ6 A;  2X38 A;  1FFV A;  1QOF A;  1FXI A;  1TY0 A;  1Y56 A;  1I4H A;  1I4Q A;  1KTK A;  1IBX B;  1DGJ A;  3AE7 B;  2QIE B;  3BVG A;  1XLN A;  2J42 A;  3DWG C;  4KX6 B;  1IUE A;  1HQR D;  4ZRQ A;  4RCO A;  4D2K A;  2KAC A;  3Q8B A;  4WQM A;  1ET9 A;  3AE9 B;  1HEZ E;  3NUH B;  4OVZ A;  2MJD A;  1KFY B;  2QJL A;  5AUK A;  2B76 B;  2GB1 A;  3GB1 A;  1E9M A;  4AQ7 A;  2V0G A;  4RGT A;  3AE5 B;  1N5W A;  1WYG A;  1SSN A;  1UWX A;  3CWI A;  2Y5P A;  2WNM A;  4C7Y A;  4KKJ A;  2BS3 B;  1C9F A;  1FNW A;  3RPF C;  1HXY D;  1BML C;  5BMH A;  1JQ4 A;  5D3D A;  1I4G A;  3CIR B;  1AN8 A;  1F2R I;  1TKE A;  2WXL A;  1MPE A;  2YEP F;  3BYT B;  4HRO A;  3MP9 A;  4YTN B;  1N60 A;  2LFI A;  3AB5 A;  1EU3 A;  3U4E G;  2KDM A;  4JWU C;  1TYG B;  3GS2 A;  1QKZ A;  1DOX A;  1CZP A;  2IJ0 A;  1TKG A;  1EM7 A;  1B9R A;  2WQY B;  3BWU D;  2CJN A;  3R2T A;  4OZA A;  3P1M A;  2AX5 A;  2IPK D;  3P42 A;  2FE8 A;  5FR3 A;  1GOZ A;  2EKI A;  3R2I A;  4C80 A;  3IT4 B;  1FXA A;  3AH7 A;  1KRH A;  3U52 E;  5MPO A;  2BTE A;  2BW2 A;  1I4P A;  2BT6 A;  2NTT A;  3HUI A;  5FKA C;  2SEB D;  1SB3 C;  1FNU A;  3KLS X;  2AQ2 B;  2PW9 A;  2BS2 B;  2JXT A;  1WSP A;  1QIL A;  1CK1 A;  4JX1 C;  2QEJ C;  2IGH A;  4NAM A;  1UUP A;  4TQ1 A;  2WXJ A;  3RFZ B;  5AUI A;  3HRD D;  2W55 A;  1FO4 A;  1EWY C;  2IGD A;  3H8H A;  1XCQ L;  3I57 A;  4YSY B;  2GI9 A;  1I4R A;  1IGD A;  1NI3 A;  3IAS 1;  1J7A A;  1I4X A;  1ENF A;  5H8Y E;  1L0Y B;  2JWU A;  2JU6 X;  4B0E A;  2M56 B;  1B1Z A;  1SBB B;  2WXN A;  3AEC B;  4JPS A;  3SEB A;  4OHJ A;  3BVZ A;  2ZW0 A;  3ZJV A;  1VLB A;  1V1P B;  3KQ4 A;  2ONQ A;  3SFE B;  2QIL A;  2WS3 B;  5GXG B;  4M0W A;  1FIQ A;  1OQQ A;  1XLQ A;  1BXT A;  4NAW B;  4XDD A;  4MM3 B;  1FRR A;  3AV8 A;  1J7B A;  3MHZ A;  2QSD A;  1RWS A;  3W5V B;  1JRP A;  3ZGZ A;  3AN1 A;  2KAJ A;  2PVO D;  3Q69 A;  3IT6 B;  3ZJT A;  2OED A;  3VR8 B;  2Q5W D;  4FXC A;  3B2F A;  1JRO A;  1FCC C;  3HVD A;  1XF5 L;  4IOI E;  2K0P A;  2PLP A;  4TSS A;  2I2Y A;  4AS1 A;  3AE2 B;  4ARC A;  4RGM A;  1FCL A;  1AWD A;  1FMA D;  1T6B X;  1XLO A;  2Z8L A;  2WP9 B;  3AE3 B;  3NVV A;  3EGR A;  3MC0 B;  1D5Z C;  3B2G A;  1NYR A;  2E3T A;  2PVG C;  2WXM A;  4YT0 B;  2J4X A;  1V1P A;  3FIL B;  4P6V F;  2LJI A;  3KWV A;  2L32 A;  1JWS D;  4A9A A;  2LHE A;  2WXR A;  3AEG B;  1Q10 A;  5C2T B;  4WUR A;  1YQ3 B;  1GPX A;  3AED B;  1VRA B;  1RM6 C;  1WGK A;  1GB4 A;  2WDV B;  1GB1 A;  3TSS A;  5BMG A;  2CU3 A;  2LGI A;  1EU4 A;  1JWU D;  1C77 A;  1KLU D;  2LEK A;  1F77 A;  3TEW A;  1PGA A;  2KN4 A;  5JXV A;  3OWE B;  1MHH E;  2W82 A;  3N9Y C;  1DYQ A;  1NEN B;  3EA6 A;  4N6E B;  1SEB D;  1XO3 A;  3J9C A;  1HZ5 A;  1HA5 A;  1FM0 D;  1C79 A;  1SE4 A;  3SFD B;  2EEL A;  1NVI D;  2J52 A;  1DOY A;  1QQR A;  1C4P A;  2WXK A;  2G1E A;  4RFB A;  2N7J A;  4ZHP A;  1JW9 D;  4YWG G;  1ZXI A;  1STE A;  4YSX B;  2L83 A;  4J3O D;  3FIL A;  3T3N A;  4YTM B;  2H88 B;  2CJO A;  3FAH A;  2VZK B;  3TUO A;  1IBX A;  1C76 A;  3EUB 2;  3AE8 B;  1YN4 A;  4O1N A;  1K53 A;  1JWB D;  2L52 A;  2JX5 A;  1L5P A;  5D3I B;  1K50 A;  1CJE A;  2LHD A;  4L2Y A;  2KMM A;  3E56 A;  5D7G A;  4GDK B;  2Y5C A;  1L4Z B;  1M4V A;  3VQI A;  1K51 A;  5BYS A;  2E6X A;  2JQR B;  3NS1 A;  2ICI A;  2W54 A;  1ZUD 2;  2INP E;  2JYE A;  1DOI A;  1SF0 A;  3Q8E A;  4HKZ E;  4OZB A;  3VR9 B;  5EE0 A;  4YSZ B;  4DQO C;  2DLB A;  4TMA B;  2JZP A;  1V97 A;  1UNS A;  3AE4 B;  4HRS A;  1YQ4 B;  2ZW1 A;  4RNA A;  1L0X B;  4JWS C;  3UI3 A;  3URY A;  3W2D A;  2NMQ A;  4JE3 B;  4XWT A;  1SIJ A;  3BK2 A;  2JSV X;  5HHD G;  2VZK D;  4YTP B;  4RGN A;  1NEK B;  3Q8F A;  3P4Q B;  4L1B A;  2WXF A;  1V8C A;  3U7Z A;  4ZHO A;  3AEE B;  4XDC A;  4YXD B;  2YEP B;  2BB6 A;  1L6V A;  3DWM A;  1N63 A;  2BBC A;  1ACC A;  3R8B A;  4ZRP A;  3AE1 B;  1XLP A;  1F2R C;  4P16 A;  4HKQ A;  2SAK A;  4OZC A;  3AEA B;  1TKY A;  2LMC A;  1VZ8 A;  2RDG A;  1PDX A;  1YNT E;  3IXS A;  3W9C B;  3E9S A;  1FEH A;  2BYT A;  3NVZ A;  1EWC A;  2H89 B;  3VRA B;  1K52 A;  3GP7 A;  3B9J A;  1QOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...