1N62A

Crystal structure of the mo,cu-co dehydrogenase (codh), n-butylisocyanide-bound state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 51
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n62A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n62A01
1ZXIA 3AV8A 3CIRB 3PO0A 4LTUA 1FFUA 1L0VB 3CWIA 3HRDD 1QOGA 4JX1C 2QJLA 2WLBA 3AE8B 4JWUC 5C2TB 1T3QA 1WXQA 3B2GA 3SFEB 1NVID 2MJEA 1V97A 4ZOHC 3AE1B 1TKEA 3B2FA 3B9JA 1JQ4A 3SR6A 3AECB 2K22A 2FBWB 1N60A 3AEBB 3AEGB 1VDVA 1JWBD 3AE5B 1SIJA 4ZHPA 2E3TA 1FM0D 2KMMA 4YXDB 2WU5B 2N0SB 5EE1A 2JQRB 1FIQA 1E7PB 3AEDB 1OQQA 1E10A 3AEAB 2OHFA 4USAA 1N5WA 3AE7B 2BT6A 1UWMA 1J7AA 1F0ZA 1KRHA 1E0ZA 1NI3A 3FAHA 1RFKA 4FXCA 1YJIA 5C3JB 1N63A 4WQMA 2K5PA 1YJJA 2HTME 2PIAA 5MPOA 4HROA 4ZHOA 1YQ3B 2W3RA 5G5HA 1TKGA 3ZYYX 1N5XA 2BS3B 1WYGA 2W3SA 3NVYA 1PFDA 1E6EB 3AE6B 2MH7A 4N6EB 1NEKB 1J7BA 1N61A 3NRZA 1EWYC 4N59A 2H88B 2G1EA 1L6UA 1JALA 2JX5A 3P63A 3HUIA 1WWTA 2WDQB 4C80A 3BIID 2AX5A 1J7CA 3DWGC 1TJEA 2ACZB 3AEEB 2Q5WD 1OQRA 1QOBA 5G5GA 4ITKA 3AH7A 4YTPB 1JW9D 2CJNA 2WDRB 1TYGB 1FXIA 3W9CB 1DOIA 2M19A 1V8CA 2PKOA 2KAJA 2WS3B 1FRRA 3NVWA 2L52A 3VRAB 2W54A 4YT0B 3KWLA 1KFYB 1AWDA 1PDXA 1PUTA 3LB8C 4YSZB 2DBYA 2WDVB 1QLBB 1DOYA 1XO3A 4WWMA 1OFFA 1QOAA 2BS4B 2PVOD 2Y5CA 1JRPA 2B76B 1NYRA 3FC4A 1DOXA 3ABVB 3NS1A 4C7ZA 1QF6A 1FXAA 1GAQB 3NVVA 1JWAD 3EUB2 1NYQA 1L5PA 1XLOA 1ZP0B 2WP9B 3AE9B 3P1MA 3P4SB 1YQ4B 4P6VF 5EE0A 5H92C 2K9XA 3HVZA 1XLQA 4HRSA 2L83A 4US9A 1CJEA 1R7SA 1WGKA 3AE3B 2EKIA 5GXGB 1ZOYB 1N62A 3W5UB 1QOFA 5H8YE 1TKYA 1XLPA 3P4QB 1JROA 1RYJA 3DWMA 2W55A 5EE9A 1E9MA 2DWQA 2M56B 4JWSC 1SB3C 4A9AA 4YTMB 3L4PA 1IUEA 3AB5A 5AUIA 3AM9A 4US8A 1AYFA 3LXFA 3NVZA 3AEFB 1XLNA 5EE3A 3AE2B 3VR8B 3AMZA 1RM6C 3VRBB 1RWSA 1GPXA 3AN1A 1A70A 1KF6B 2WQYB 1VLBA 1ZUD2 4IDIA 1L6VA 2LEKA 1WRIA 1VJKA 3P4RB 1FFVA 2H89B 2CU3A 2MJDA 4KX6B 1FMAD 5AUKA 3P4PB 1ROEA 1DGJA 1SF0A 4YTNB 1CZPA 4YSYB 2CJOA 3SFDB 1NENB 2MJ3A 3ETRA 2WU2B 3W5VB 1FO4A 3AE4B 1I7HA 4N58A 1B9RA 3VR9B 1FRDA 3WCQA 2PVGC 3RPFC 2QIEB 2BS2B 4YSXB 1QT9A 4C7YA
chains in the Genus database with same CATH superfamily
3NUQA 2EZZA 3W1YA 2K0PA 3PZDA 1YIWA 2L05A 1DK2A 2LM4A 2W9BA 1HUZA 4PH5A 2N1RA 1V1OA 2KSOB 2V1YA 3VVWB 2MW5A 4Y2YA 2M0XA 3A4RA 4ED3A 1Q10A 5ALIA 1V86A 4FJZA 2F2AB 3LK9A 2KZZA 4KLGA 4HDOA 2ZJ5A 3PSTA 1GB1A 1WGRA 4RMAA 3U2SC 4RPXA 1J7AA 1SGHA 1S97A 1S0OA 3Q8LA 4IS7A 5DPSA 2I38A 2MUTA 2FCSA 3WU2U 2HTME 2MBOA 4XWWA 4C56C 4RQMA 2UU7A 2IDYA 4RM9A 1S77D 4DLEA 4GDKB 1F1HA 1X66A 2G5IB 1GOZA 2KLGA 3SD5A 3UIOB 4DL6A 4HPMB 2RSUA 4ACOA 4DOCA 1VZ7A 3QA8A 4PPXA 2M1MA 3WAMA 4HKQA 4GDLB 4IKGA 1WCLA 4RGOS 5CR0A 2LHEA 2PMVA 2A3VA 1DK3A 1ZJNA 2FLNA 4WJPA 1H8CA 4ECSA 5AM4A 1UF0A 3SYZA 4BXOB 1RPLA 4QZFA 2X38A 2LVPA 4I29A 3IHQB 1KFYB 3AULA 3M9NB 3FILB 5HHDG 3LB8C 2KC2A 1Z4NA 1DRGA 3L0WB 2FI1A 4A90A 1IGCA 1T0YA 2BS4B 1Z00B 2FUHB 3SQIA 4NV0A 4OO1J 5FP0A 5KAFU 3AUOA 4RT2A 3DQVA 1L4ZB 4G11A 5H92C 1KQQA 4E3CA 2YQEA 4TQ0A 1M94A 4UB2A 4DQOC 3WANA 1SGGA 1CJEA 2ZTDA 3DVGY 1N62A 2KMCA 1S3SG 3N1YC 1NK5A 2M56B 2OJRA 2DZIA 2W9CB 2EZYA 2XIDA 4Z6CA 1Z4OA 3ZJTA 3KTQA 3GE3C 4JQWC 4NAMA 1T6BX 1ZE3D 1SXTA 3M3JA 1CQVA 1VZ6A 4G3IA 1WZ0A 3K1ZA 3AN1A 1TS2A 3H8SA 1PGXA 2YEPF 4JV0A 2AGOA 4GFJA 1FD6A 3C29A 2G5HB 4ECVA 3DOWA 3V7LA 1R4NB 1ED1A 3P4RB 4AP9A 3ZNID 2OEDA 3F5AA 2ASDA 5HHIA 3EPGA 5CJ7A 2BB5A 4IM0A 5KT7A 4MH8A 4OCZA 5KFOA 2R8KA 1EM7A 3LWMA 1WXAA 4A8XC 3PW5A 2K8BA 1QQ5A 3WK9A 4FULA 1UA0A 7ICOA 2HVIA 1OTRB 2CKHB 3H7PB 1HTQA 1ZD2P 1JI7A 4Z6FA 5AI5A 5KHQA 4KLOA 5K4LA 1ECWA 3AV8A 4K81A 3PNCA 2BQRA 3QEAZ 3CWIA 4JX1C 1TIFA 3B0XA 4M02A 4XUSA 4GLSC 3WALA 4R65A 2DYBA 4FZLA 2IBKA 1NVID 1IBXB 2YVCA 3UXNA 2GRIA 4K3CA 5T14A 2ZNVB 3BS5B 4ZHPA 1L7PA 9ICWA 3WKDA 1ZOLA 2DENB 4C4TA 2LKYA 1V6EA 4WJNA 4GIBA 4GU2A 3TFSA 1Z3EB 4KMUA 2O6VD 4FXCA 4I2DA 2QCZA 2AQ3B 2G3QB 5DB7A 1N63A 2FUG1 4M0WA 1UT8A 2A1AA 5ALQA 3PVXA 2AL6A 2D10A 4ACFA 4GLXA 4BKSA 4URKA 4NXZA 4OZCA 2W3SA 1WI0A 1IV8A 5AK4A 4DQPA 2GO7A 1L7YA 3PZ7A 2WWZA 2PLPA 2HBKA 4KZ0A 4JMUA 2PMZF 4ZH4A 5KFTA 1M4VA 3ZI4A 5F3XB 3BIID 2B6GA 2KWCA 4K3BA 2WFAA 4ANXA 3HM3A 4M9HA 2VJ4A 2SAKA 5BPCA 3VXWA 3IN5A 3TARA 4QZDA 4MJSB 1TYGB 3IG5A 9ICLA 2G08A 4RCOA 3HP6A 1TK8A 1ZGUB 2FCNA 2KN5A 2C2RA 1WYWB 1WSPA 5KFEA 1YT3A 4KGSA 4F71A 5AKYA 1XSPA 2JEFA 2BTEA 1UPHA 4ZRPA 4FHJA 2WX1A 4Q45A 2A4ZA 3L16A 4O1NA 3RH5A 3KH0A 1ZDVA 5C5JA 5AM3A 3TAPA 1L0XB 3HVZA 1XLQA 2V3NA 3M62B 2E8OA 8ICOA 5JTIA 4DEZA 3RAXA 3PX0A 3Q8KA 1ZOYB 2ZIWA 3H4DA 8ICAA 5H8YE 4F5NA 5BYSA 1VRAB 2YEPB 2M0AA 2O6VB 1NK4A 4JWNA 2D3DA 4I6PA 1ZQLA 3ZNGC 3OLMD 4M0AA 1KKXA 4ZRIA 3BS7A 2DGZA 1KTQA 4CRXA 3RB0A 1MHXA 1BMLC 4HLEA 4IDIA 1L8LA 2XK5A 4Q8FA 2KX3A 3IAS1 5AKHA 3X23A 1ZQNA 3VUXA 4F4WA 2H5XA 1GG3A 3WAOA 1OEYJ 4I2AA 3ZXRA 3I28A 1Y56A 1KFTA 4Q8EA 3NZ3A 4FBUA 2EELA 2CS4A 4EX7A 1C4PA 4BOZB 1P7DA 5IN7A 1PVRA 3P42A 4C4VB 4DXFA 1SKWA 3UXPA 5EOZA 2P6RA 3R7RA 2LGYA 2GBNA 3AXCA 1WX8A 3RCZA 2JUOA 1MQ2A 4F3OA 1QT9A 2PEAA 4NJ6A 3IAM1 1U45A 4IOIE 1WH3A 5F9LA 3SDLC 3M1YA 2H3ZA 2LYAA 1YMHE 3IXSA 5LLIA 5GMVA 3LWLA 5HNKA 2QJLA 3Q8FA 1U47A 4DF8A 3SHQA 2LUEA 5BOMA 4GXJA 2PFPA 2WXRA 4QIWF 4P0QA 2ZJAA 3UQ0A 1B4FA 2FMSA 2IZVB 4DHJB 2QLTA 2PFNA 4PL2A 1LQBA 3UQBA 1ZQCA 1FM0D 3ML8A 2LFIA 4Y2XA 1MG4A 3G6YA 2NTSA 2AHOB 1AROP 5ALZA 4RUCA 2QEJC 4B9UA 8ICYA 1O03A 4ECWA 1F0ZA 5AI4A 7ICUA 1E0ZA 1LV5A 1TBEA 1YJIA 3OHAA 3TMPB 5IILA 1WJNA 2UVWA 5G5HA 1ZQSA 3E0FA 5KFDA 9ICOA 2WF9A 1E6EB 4EZ6A 2LGDA 2H88B 1KRPA 2KWDA 1NZPA 1IXRA 1NJZA 3GB1A 1J97A 5AIBA 3MGIA 2MSED 3FM9A 2L00B 1X2IA 5L1MA 4K4HA 2WXNA 4M6WB 5IIIA 1ZQXA 2JT4B 1SXDA 4JUZA 4XQ8A 3V72A 3ORYA 4M9LA 1SJED 4YT0B 1C4AA 1BVSA 4I2IA 3Q8BA 3OTQA 1BPDA 8ICXA 2ZW0A 3QQ8B 5IIMA 2PVOD 3HPOA 3CSTA 3U7DA 4UB6U 2C7HA 5KL1B 1S5LU 1RFAA 3VHTC 2I1QA 5DQGA 3P4SB 1MHHE 3V7KA 3GQCA 2R61A 2VA2A 1DYQA 2K6QA 4NPNA 5T8IA 4ANVA 4HRSA 1EUVB 2RMMA 4DL3A 4QW9A 1BPZA 2LWPA 3TEXA 1F0MA 1JROA 2I5HA 3EYZA 1XSLA 3RNCC 2FIFA 2J7QB 1ZW7A 2CHZA 3RZWC 2R2QA 2JZBB 1CUKA 5J29A 4KLHA 1YZ7A 5ALGA 2RLTA 2IO1B 2KICA 1T94A 4MF2A 1RWSA 2J0KA 4IRCA 3Q2AC 1YN5A 3C19A 2ASJA 2E5SA 3RF9A 2AGPA 2H89B 2NS5A 1UT5A 3QX7A 4KX6B 1I4XA 5J17A 2PFOA 5AUKA 1UGJA 2QC8A 3HIZA 2AGQA 2ODGA 5CWRA 1EXNA 3KOOA 4JB3A 4IR1A 1BXTA 2V3PA 4HCNB 2H3QA 1RLFA 5BYQA 4A20A 4ED1A 2JWUA 2XEWA 4BWJA 4ED7A 2LJ5A 2R8IA 2ZZPB 1HEZE 2RDGA 4Y2QA 4EX6A 1TV9A 2KFKA 4NY0A 2I2YA 3BYTB 2PE9A 3PO5A 4KN7A 4ECZA 5LXHA 2WXFA 3TFRA 2XY7A 3B2FA 2CXYA 3ONNA 3AECB 2ON8A 3X0WA 4KMOB 2JZZA 2ZUDA 1HJPA 3KHHA 4I2GA 8ICBA 4OZAA 1A76A 3WK5A 4YXDB 4AOFA 1M6YA 1BNPA 3F5EA 4II3B 1K5OA 4F4KA 2DZMA 2OM6A 2WXLA 2Y1IA 1SZPA 1NI3A 1XEEA 3V3XA 4BKSD 2M8SA 2K4EA 3Q3MC 4JV1A 2JZPA 9ICFA 4HK2A 3IT4B 3RNGC 3QZ7A 4MEXA 2FAZA 3URYA 1BPBA 3DHIC 2DYOA 1R4MB 4BKTA 2ZIXB 4HPLB 2L32A 2BYFA 2RDBC 5KFYA 3UXOA 9ICQA 2ZIVB 2KJ8A 1EWYC 7ICQA 4ASWC 3QZ8A 3AI5A 1P1AA 2O2VA 4DSLA 3QIJA 3T5HA 4O5EA 3APDA 2INCC 2REXA 2MUTB 1HIWA 3KWVA 2Q5WD 1WFYA 1FNVA 2KQ4X 1D5XC 5AK3A 1NNLA 1EU3A 1YN4A 3ONSA 3PREA 2XNAC 3HW8A 3QUQA 1NK0A 2Z59B 4KLFA 3AL0B 2EH9A 4FFDA 3PS6A 3EZ5A 3KUDB 4GSWA 2HDOA 4F92B 1NJYA 3O65B 1NKCA 4DL2A 2Y5CA 3BK2A 2OJWA 4IW0A 3ISDA 4XX5A 4I27A 1NZBA 1FXAA 5ALWA 3A4SC 4FZMA 3RRHA 4B9NA 3D2SA 3T5KA 5AKEA 5BMIA 1VCBA 4J03A 1NOMA 4DFPA 4J6IA 1OQYA 3FILA 4UB4A 2LBOA 3DWMA 7ICVA 3RB6A 3I9V1 1E9MA 1Z00A 2MSNA 4KVGB 4E0DA 2KIVA 5EWEA 3C2KA 2XCAA 3AE2B 4DBGA 5J2IA 1X6IA 3H0RB 4JGHB 2HE7A 5AKGA 1Y8RC 1TZOA 3MFGA 4DXGA 1TZ1A 4K7SA 3WA0A 2KP7A 4I2JA 1V1PA 2I1JA 4P1CC 1NJXA 4ED0A 2MJDA 2FIDA 4MEYA 4K1RB 1XXGA 4YMNA 3P4PB 7ICNA 1DGJA 5AK6A 2BCVA 3IVFA 3HKZF 3EHVA 1NI2A 4MHVA 4P0PA 2F1IA 2JRHA 1ZQRA 2Z0EB 4NAWA 2HOIA 2K25A 2FMQA 2ZEQA 2KKVA 2VIXA 2QIEB 2NO4A 3R2IA 1PGBA 5AI6A 3EPIA 1XCTL 5IO9A 2BYTA 3FDSA 2BB6A 3PZPA 3DV9A 3HVDA 1UGMA 1T8EA 1AN8A 3A9KB 5J0XA 1TS5A 1JQ4A 1K1QA 3NUHB 1C20A 4MDKE 2KD1A 2FBWB 3ENEA 1HXYD 2KK8A 3QU9A 3A33B 3ZJUA 2KMMA 5HI1A 1P98A 5ALVA 4UQGA 1QZEA 2ESEA 5EWGA 1TAMA 5EWFA 5BOLA 8ICHA 4Q44A 5J2EA 4W9DA 2FCMA 2BWES 4AS1A 1P0RA 3ZDMC 2D8CA 5MPOA 1E90A 1YQ3B 4FBJB 3C2MA 1RG6A 3GIMA 3ZYYX 5LNK1 4YXMA 3GZFA 3U4EG 3IRUA 2AU0A 1CK1A 2HHXA 4PK1A 9ICCA 3HUIA 2W7OA 2QDFA 3QUBA 2VH1A 8ICVA 9ICXA 4YP3A 4DSKA 4O5KA 3H1UA 2HTHA 1XC9A 1FXIA 2A5UA 3AU6A 3R9KA 1DOIA 2KVRA 4ZDVA 2GWSA 2UVRA 4DF4A 5KFBA 4IG7B 2E1EA 3HT3A 4BGDA 5HMMA 4OHJA 5KT4A 3EECA 2LVQA 4EEYA 2YB4A 4UB1A 1OFFA 2GBRA 4J3OD 2PE6B 3ZDAA 1I4PA 3EA6A 3H8WA 4NJCA 4Q43A 2ZJ8A 5ALPA 3AEGB 3P1MA 2WP9B 4KDIC 4A55A 2WAQF 1O08A 2KG5A 3TIXA 2GB1A 1SV0C 2EKIA 2BCRA 1E7UA 4PZOA 5KT6A 4OJPA 5EE9A 1XQQA 4JWSC 1XO0A 4C8OA 1E8YA 4J9MA 1SBBB 3BQTA 3AM9A 1AYFA 3NVZA 2ZVOA 4FJYA 1YJ1A 1UBIA 2IBIB 1TT5B 1UA1A 2K4HA 2W9MA 5DKWA 3TCAA 3N30A 1UHUA 1ZD4A 4EKUA 4GMVA 3JPTA 2UVVA 1HQRD 2RRDA 3KQ4A 2C22A 4MH0E 2PW9A 3MJWA 2VZKB 4Q2JA 3E56A 2OEHA 4DL4A 1JWUD 1LGRA 2XBBC 3RB4A 3LJ3A 4R8UA 3TADC 3VFKA 1HA5A 1T0SC 3ML9A 3A9JA 4MM3A 3WCQA 2HCFA 3K4GA 2P35A 2PFQA 4EZ9A 4KLSA 2PVGC 2XK5B 4CQNA 2R2OA 4RNAA 4PYUA 5AZGA 2K4PA 2YMLA 4PS3A 1X42A 3WK6A 4M2YA 3W2DA 3MC9A 2FPKA 3HRDD 4NLKA 1ZQYA 5KHOA 1TY2A 3MABA 2P6UA 2I9GA 1COKA 1V97A 2K8HA 2DF4B 3AE1B 4MSQB 1SKRA 4DLGA 4NLNA 5FK9C 2ATLA 2R8JA 1L8OA 3AEBB 5DCNA 1VDVA 3QU7A 5AI9A 4YMOA 1X9WA 1WWUA 2WXOA 5DBAA 2B3AA 5HFYA 5HR7A 4F4XA 3TL5A 3CNHA 1GO3F 1QSYA 2HOQA 2I1KA 9ICMA 5BO4B 4C4RA 1KLUD 2E1FA 4UARA 3Q8EA 5DDYA 5KFMA 2K6DB 4AJYB 1UQVA 5JUMA 1YNTE 3F2CA 4HROA 2JHDA 1TKGA 1KFSA 3T3FA 2BS3B 1IYFA 5KG0A 3RZFA 2MH7A 4EYHB 4W9KA 2DPJA 4LNIA 3C5FA 4ELUA 3SENA 2AJQA 1JMLA 2Z0DB 2BPGA 2BDPA 1STEA 3AEEB 4DOAA 2BBCA 4ITKA 4JPSA 3AH7A 2NRWA 2WDTB 5DBBA 4YL8A 4CYEA 1SE4A 3IT6B 3T3OA 3PLUA 4NLCA 3AU2A 3I1YA 3EC8A 2WXHA 4KIKB 5AM0A 3GP7A 2MRLA 3S6JA 4U7CA 3MC8A 4WWOA 5ALLA 1C3TA 5HHHA 3AEVA 2MBEA 3ABVB 2YMPA 5GXGB 2K4IA 5EE1A 1ZP0B 3WK7A 2ZPNA 1EF1A 2KHQA 4RPZA 2LVOA 2PJHA 2JGAA 1URJA 2HVHA 2KDIA 4K4GA 1BGXT 2JZ3B 1RQLA 4HPPA 2WNMA 1PK1A 3LVVA 2NRTA 2KMDA 3O0FA 1YX5B 3GV8B 5JRTA 2C9WB 2PI4A 4O3OA 3W1SC 2XY5A 5D46A 1UUPA 3A0HU 3DVNU 2V0GA 3RT3B 3AEFB 1XLNA 1T4GA 3ED5A 3BQ0A 2IHMA 2OH2A 3L10B 3QHTA 3C8YA 4KLEA 3AMZA 4F8CB 4GXIA 5CP2A 2N9KA 1ZJMA 2QKQA 1NK7A 1WJ6A 3QU5A 3JVZX 1Z1VA 9ICBA 1S8OA 3PTFC 2KWUB 4OW0A 4BAXA 2K8CA 1E8WA 4YTNB 1C79A 2PKEA 3WAPA 4J9RA 1Z5SB 1YN3A 3M6KA 3TKAA 1YZ6A 5AKIA 4MGZE 2ZUCA 3BQ1A 2KC1A 1KJTA 3VR9B 1H38A 4L2YA 4XE0A 2MU2A 2PI5A 1K51A 1L2NA 2D3BA 3RD2A 3QX1A 1F9JA 2M4NA 4QZIA 3SV3A 4II2B 3TEWA 2Q0ZX 3HKZC 2WXGA 4JWUC 3UM9A 5J8YC 2DFLA 2MJEA 2FMPA 1B1ZA 1UCVA 4EZKA 2KE7A 2LGXA 5AKZA 3DEEA 3SR6A 5B5EU 2BGWA 3ZDEA 7ICLA 1BNOA 2H3IA 2J6UA 2JEIA 4BWMA 4OJ6A 2WGSA 3R8BA 2MBHA 5KFSA 3TAQA 3MP9A 5DB8A 4PYZA 3RMKC 2NO5A 2D2QA 3DVNV 5J0QA 5KFWA 3B08A 3I3TB 3DBLB 4YQWA 5L83A 1C9FA 1GJZA 4NJ7A 4UB8U 4E71A 2K5PA 5DB9A 4RQ1A 4KGRA 3ZGZA 1SSNA 1ESFA 1QLNA 1N6ZA 7ICMA 8ICWA 1TFRA 3K75D 4DCCA 1J7BA 4MFAA 1ZQPA 1KFDA 4KLMA 1L0YB 5DG9A 2JPHA 3JPQA 2YLMA 2DAFA 3IFWB 8ICJA 5KFNA 1K50A 4QNLA 4ANUA 4ICVA 2QMTA 2JH7A 5D7GA 2RQ5A 4KLDA 3KFUF 1JW9D 4W9JA 4O3MA 3QC8B 5D2MB 1Z1BA 4ED2A 4JV2A 5CRXA 2JRZA 1WZ3A 1SL1A 2BCUA 4F4ZA 2JV3A 2MQJA 2A1JA 2KO3A 2DBYA 2K8BB 2WDVB 2ZTCA 2FDRA 1L3TA 2JY6A 4WWMA 5KTQA 2BR0A 2LYBA 5J2KA 2B76B 1ZQ1C 3RTVA 3MGVA 2Y5PA 1X9XA 4B9KA 4Y2SA 4MSMB 4RNNA 4GOCA 3ZNZB 3IP4B 4US9A 3N20C 2JEGA 5TSSA 2WXKA 3W5UB 1IBXA 1SIFA 2ZIUA 2ZNVC 4W9FA 2FLPA 2M0NA 2KANA 3BS5A 2BCSA 2KZRA 3MGHA 4LZDA 5KFRA 1IG6A 4O5CA 4YCXA 3CMMB 3PZ8A 2DX5B 2F8LA 1Q8KA 3PVLA 1X40A 2HBMA 4DL5A 2LEKA 5BYRA 3U8ZA 1AW7A 4EYIB 2WYQA 2OWOA 1WMHA 5E6JA 1F77A 5TZVA 4ZRJA 1CEZA 3IM1A 4M9JA 1AARA 3DBHB 5J2CA 4HJKA 5J0WA 2AL3A 4PS7A 4HVBA 2DNFA 2F77X 1YX6B 4UAUA 2XO7A 5ALDA 2C60A 5KG5A 4BBNC 5DDMA 1V1PB 4I6LB 4TUPA 1WGYA 1R4MI 5J8YA 4FHKA 2RPVA 5KFVA 4PS8A 5JHAA 2WLBA 3ZD9A 2ASLA 5CB1A 1PYWD 4REZA 4QZCA 1S0MA 4GC6A 2LMCA 2MA9B 3PV1A 1VR9A 3Q3JA 4FJVB 2Z7JA 2MWSB 5AKXA 5CEHA 3B0AA 4JL9A 4XZ4A 5JHBA 4ELVA 1WWVA 3WIMA 3H7SA 4OD0A 2JYTA 7ICRA 1FEZA 4LJPB 2W82A 1QQRA 3U7ZA 4IC7B 5FR6A 4UAWA 2L1AA 2KDEB 3F53A 5KG6A 4NNJB 1Q0WB 1ZQFA 3CF6E 4CHKA 2IJ0A 3T8MA 3C2LA 3PT2B 4EOYA 2K89A 2FLLA 4QWDA 2QB0A 3UI3A 1MC8A 3NVYA 4PJ0U 1GNUA 5FR3A 5DGAA 5ALMA 2XICA 3DHHC 4YMMA 4F4YA 3TEZA 3NRZA 3ICXA 1QSLA 1ZDXA 1ZXHA 3KW5B 1KLVA 1WX7A 3BVMA 4WJ3B 3DHGC 3MFHA 4KSLC 4RQ3A 4UAYA 2WB1C 4UW9A 4NL9A 4O3QA 1KTKA 3QYPA 1NK6A 2TSSA 2IOFK 1DOQA 1NBFC 3NY5A 1WJUA 2DLBA 5AZFA 1A0PA 1ZQDA 1F2RI 4YTPB 3SV4A 3PRZA 1FCCC 2RGFA 2K1FA 3IBEA 4RNOA 4YXJA 2ZTEA 2VKQA 4B9SA 2DAJA 2MEKA 2JWZA 3TACB 4DSIA 2E8NA 4YN4A 1J2MA 4C4VA 4PGQA 5KG1A 8ICLA 1T5XD 1JRPA 2BQUA 4YR0A 4B9TA 4QZBA 8ICRA 1JWAD 4BOSC 4P6VF 3JPSA 3SI8A 1FNWA 4UDUC 4AQ7A 1S9FA 2KACA 2KIWA 1RXWA 1VZ8A 3DBRB 3RULA 1E7VA 4A6QA 3UMGA 5AICA 4DWFA 9ICHA 1ZQZA 1ZQEA 1DXSA 4WWPA 1R4NI 4F7ZA 2GLEA 2HMXA 1ZQGA 4EFOA 5KFLA 3M9MB 2D6FC 4I2FA 2NR2A 2KTFA 2V9HA 2KVZA 3PRMB 1RM6C 3K9PB 4CF3A 3M95A 2CR5A 4IWOA 1ISNA 1GPXA 1A70A 2IHNA 2YMQA 5I4DA 4CNQA 2HJ1A 4C00A 4I6NB 3PX6A 4M01A 1VJKA 3U52E 3KLSX 3V61A 2DZJA 2J6SA 4H2AA 4F50A 1V5TA 4DO9A 3MDCA 2KTQA 3ZTCA 3C5GA 1Q3UA 1E8ZA 1T0QC 1QKZA 2ZCCA 3SU8X 1L7OA 1B0XA 1FO4A 9ICEA 1KLGD 2BGFA 2N9PC 3ZW3A 2RDHA 3N7PD 1GUAB 2QSDA 2BS2B 2DHZA 3PR4A 4LVSA 4YSXB 5AEKB 2XGQA 4IM3A 4B9MA 1EU4A 5E6NA 4RZRA 2F1HA 3NZSA 2LXAA 1L7NA 3GZNB 1AQ6A 4QZHA 2WXPA 1D9DA 4K4IA 4MM3B 3N1XC 1N60A 4RQ8A 3Q8PB 1S10A 3RNBC 2BYVE 4IWQA 3MDAA 3WKCA 2K8AA 4EZJA 2Q4TA 4W9LA 3GIKA 1RAXA 5DPWA 2OHFA 3N97B 1C7YA 1L5UA 4EELA 2JSVX 2HHWA 3I5JC 2OOBB 2F3NA 5C3JB 3BZKA 2PIAA 1B43A 5J2FA 3VAWA 2KDFB 2ISOA 2W9AA 2NBVB 1QILA 5KNIA 4WJQA 1PFDA 3AE6B 4P16A 4F2SA 3ETLA 1S1QB 4TV3A 2JZBA 2KDBA 2J6TA 3A1QA 5J2RA 2R18A 2JX5A 3SEBA 3AQEA 1LB2B 2UVUA 2GBJA 1C1YB 5KFQA 4Z6EA 5KFHA 4IWPA 3UPQA 3DWGC 2ZXIA 3M7DA 5G5GA 2IGHA 1E5WA 4RT3A 4HJGE 3VTUA 3QEBZ 5J0YA 1RYSA 5ALJA 4KLJA 4PHPA 1TTNA 2WX0A 4OZBA 1UBQA 3KWLA 3R66C 2VA8A 1PUTA 4QZ8A 1KW4A 1XO3A 3ZDBA 2G06A 4FE3A 5LXIB 2PMZC 4KTQA 3JSVA 3OJ4B 3RH4A 1G6JA 3UGBB 2EANA 1V49A 3AE9B 2LI5A 3L5KA 5ALYA 5EE0A 5J2DA 1MPEA 4OVZA 4C8KA 3PSFA 7ICJA 4QJFB 3GDXA 4Y2PA 4IQVA 2HOFA 3PV8A 3KHRA 4FA6A 3Q8SB 3SAFA 2W55A 3HJEA 2KWVB 3NZUA 4CGZA 4KN4A 2IY1B 3G6XA 4M8NA 1SE2A 3L4PA 4M9NA 3E9SA 5J18A 1X6JA 4ED6A 4US8A 2CN1A 4M04A 2NBUA 4WURA 5ALXA 1LO5D 2HHVA 4RQ0A 2M9NA 4A3PA 2L0FA 4KITB 4MGIE 1TY0A 3T79A 3MC0B 1WIAA 4WIPA 4B6WA 3F2BA 4MFFA 1JN3A 2VH2A 1ET9A 2WU2B 3ETRA 2D3AA 1CI4A 3AE4B 2MBQA 4XDCA 4N58A 4Y2RA 2C5LC 2CHWA 4M00A 3EWAA 2BPSA 2O2VB 1T7PA 2NPTB 2JXXA 2NCNA 1ZXIA 8ICKA 1U9LA 2C2EA 4WAAA 4LTUA 3BZCA 1V85A 1T3NA 4JIOU 1MG8A 4TKNA 3D2QA 3MHZA 1JXLA 5CTRC 4NQKE 1QSSA 2KVCA 4LCDE 1U4BA 1BT0A 1BPEA 1OW5A 3LDAA 4EBCA 4C4SA 1WGDA 1MVKA 2BKEA 1L3UA 2L8JA 4W9GA 1FIQA 1E10A 3AEAB 1N5WA 5KG7A 4RU9A 4ICAA 4P2HA 4GGQA 2GBKA 3IV6A 3H4BA 2IMWP 4KDLB 3TI0A 4HAIA 2E6XA 4LNNA 3OWEB 4CE6A 2E8MA 2KX0A 4J9QA 3TQ1A 1XNSA 3BVZA 3VUWA 1FCLA 8ICCA 2EQYA 3H9DA 2K3UA 4A8EA 1QTMA 4RF0A 1F5SA 3PRPB 1GC7A 2QHOA 3NG0A 4KLTA 4Z6DA 1OEYA 1ZD5A 3FYHA 1L6UA 1Q1OA 4R3DA 1E8XA 5C23A 4QWEA 3C23A 1A6SA 5KG2A 2WXIA 2M17A 2KVSA 2RHFA 1J7CA 3JW0X 2LGIA 2INDC 3S2AA 4PHAA 4EZLA 4BX9C 2KN4A 1D5MC 3DDHA 1L4DB 2D3GA 1V38A 4OJLA 2QARB 2R8HA 2GOWA 3VRAB 1FRRA 2DKZA 2NRZA 4AYBC 4DFJA 1KL9A 1JRUA 1D4BA 2V4QA 3RR7A 5L9XA 5DPTA 1UH6A 4RQ6A 4B6JA 4C8LA 2PTLA 1V80A 3V60A 5D3DA 3K1RB 2K9XA 4EUTA 3RNAC 5D3IB 1I4QA 1WGKA 2J52A 2DQNB 4LK0M 2KFZA 2A1JB 4NL9C 1WXSA 3H40A 5AI0A 3GS2A 5KL8B 5D4BA 3BZDB 5TR5A 2H3VA 4UAZA 3AB5A 4B0EA 2IYDB 2EAOA 4FO6A 4KLLA 2V4LA 4G3XB 3IDWA 5IINA 3QNMA 3KZXA 5IIJA 4UB5A 2NRVA 9ICUA 1IIPA 2OYYA 3M8RA 3KD3A 4S17A 5J2AA 2JH1A 3KUCB 3M6ZA 4F5PA 4CF5A 1I42A 2N4FA 2R8GA 3N7RC 1CZPA 1X1MA 2XCPA 4ICUA 2W43A 9ICAA 4LDTB 1WR1A 2C7NB 2BCQA 3TSSA 1WGGA 4JWMA 2DPIA 2D3CA 1V9JA 2G4SA 2INPE 3D32A 3DBLI 3LYYA 4PL1A 2VZKD 4YR2A 4M47A 3GV7B 4KLQA 2NMQA 2NTTA 3Q3OC 2AYOB 5IAAC 4DSJA 2ZVNA 5AK5A 4N9F4 5IOIA 3B2GA 3MR3A 1WY8A 1HZ6A 3ZIMA 4TUUA 3B9JA 5HMLA 1RRBA 1MFWA 4MACA 2XC9A 4IRDA 3AE5B 3KKAC 5F9NA 7ICKA 3BINA 2JQRB 4USAA 3AE7B 3PPAA 2BT6A 3H8JA 5KFFA 3N1ZC 3FAHA 4UB3A 1TK5A 3THVA 8ICQA 1SE3A 1FEHA 2LJIA 2WXMA 3UINB 3QARA 1ZQWA 3U26A 2DUYA 1YJJA 3RR8A 3GFKB 3UF8A 2G9HD 2D11A 2J0JA 2LM1A 4A3OA 2WF5A 2G1EA 3ZVVA 3QU4A 1XT9B 3ECIA 2G07A 4X5VA 2DL0A 3PR5B 2O6KA 3L3FX 3ZD8A 4LJXA 2AX5A 2VJ5A 2KTRA 2XN9C 3Q8AA 4JE3B 4RQNA 4KZCA 5KFKA 3NTUA 4MGKE 3ISBA 2IO3B 3GE8C 4WQOB 2QB0B 2WHEA 1DGSA 3RB3A 1D9FA 3DPDA 3SD7A 1F52A 8ICIA 4G50A 4S0RA 4D2KA 3NVWA 3RAQA 2IA6A 3BDPA 1KOTA 8ICPA 2XVTA 3RJGA 8ICSA 1AWDA 2KMAA 4YSZB 4MFCA 3VH3B 4ZRKA 4R8UB 4QWAA 4UBCA 1WCNA 4R66A 2KJ9A 8ICEA 2BVCA 4UBBA 4TUQA 3RJJA 3RYTA 4NWIA 1XLOA 2V4IB 4RM8A 5E6PA 5AIAA 4BVUC 1GB4A 1IPGA 4Y2JA 1R7SA 3Q8QB 1UNSA 3V7JA 3MFIA 7ICEA 5AHXA 2ZXHA 3C28A 5DLFA 3OPXA 3BQ2A 3O13A 3N28A 4EBDA 2WXQA 3OJ3A 2W7PA 4P4PA 2G45B 5KG3A 2A19A 3ALRA 2HDEA 2RPQA 4KLIA 3RBDA 5J0TA 5EE3A 4NJ8A 2RDJA 1WM2A 1T0RC 3QUTA 4LNKA 5ALEA 2EDUA 5IIKA 2G09A 2AH5A 4GDLA 2CRXA 4F93B 1K53A 1LFDA 1OGWA 1J0GA 3CP8A 3MR6A 2N7EA 4AP4C 2ZCBA 3Q3FA 4BXOA 4F1SA 1V2YA 5IKCM 4LLGM 5KFGA 2N9XA 2CJOA 1SWVA 2KV2A 1NENB 3ZRFA 5JXVA 3R2TA 4JK1A 4FADA 1SV0A 4J9NA 2YB1A 1XF5L 5GTIU 1QQ6A 5JU5A 3MR2A 3I57A 2WTFA 4C7YA 1WJ4A 2KOXA 3L17A 2D5GA 2KNJA 1SKSA 1NDDA 3E58A 1L0VB 2KJRA 3PW0A 5IP4D 5D6JB 1TVAA 1T3QA 3UMBA 3MTNB 3GV5B 5E79U 3ZQ4A 3KYCD 3WKBA 1MQ3A 4KIKA 2W8LA 2NV3A 1XD3B 3UQAA 2IOHA 4F5QA 1WUDA 9ICKA 9ICTA 3ZO5B 3VTVA 3WKEA 4C8NA 3VDZA 4KV2A 3DDCB 3V6JA 3T5LA 5KFPA 3KUZA 1ZYQA 5G2NA 2FE8A 4EEWA 1ENFA 4O3RA 2N7DA 2BQ3A 1PK1B 5KT3A 4P1BC 4F91B 2RP5A 1Q46A 2LHDA 3P2BA 4MELA 3QUCA 1HUOA 1TGZB 4KLUA 1Y88A 2BWFA 4HKZE 2L3ZA 2HD5B 5CA7A 1D3ZA 3H0MB 3H7PA 3JYUA 3DBRI 7ICTA 2LUMA 2WDQB 4DDGD 2KQ7A 3KZIU 1U49A 3RRGA 4RGMA 2L76A 4CDGA 4XDDA 4DS5A 2AEHA 2F76X 4PZNA 1SL2A 3W1SA 2KNBA 5KT5A 2F1JA 1V8CA 5D49A 1YOVB 2KAJA 4DL7A 2JU6X 2K8CB 4KX5A 2W54A 9ICRA 3A1QB 4K7UA 3Q8MA 3I76A 4NLBA 4DK5A 1WE6A 3MR5A 4RQ5A 2MRPA 4ZRQA 2G0AA 4C7ZA 3BJYA 1D8LA 2FPMA 3EUB2 3OGUA 2HBJA 2KN7A 2KHWB 2ZW1A 3NRWA 3WK8A 2BDUA 2JXJA 2MHJA 1ZD3A 2HBLA 1QOFA 3RN9C 3RFAA 1XO1A 4DQIA 3QAQA 1MA7A 1SB3C 1MI0A 3JSVB 4A9AA 2ZJDA 3AQFA 2JF5A 3ZJVA 2BHNA 3BQ7A 3APFA 7ICHA 3Q6BA 1TE2A 4XC2A 1RQNA 8ICTA 5ALRA 5DGBA 3H7IA 3I63C 4GC7A 2MA1A 3BWUD 1KF6B 1VLBA 1HE8A 5DQHA 2VA3A 2VANA 3APCA 4CF4A 8ICUA 3AU5A 4MJSA 2DKXA 1P9DU 2MP2A 2NRXA 3PGEA 3CRXA 8ICFA 2HW3A 5C1ZA 3PHXB 4EBEA 2MJ3A 3LVWA 1SE9A 3RJHA 1RDFA 5KFCA 1SEBD 1L7MA 1J8CA 5D94A 2HJ8A 3RPFC 2BKFA 3VRBB 3IG8A 5KFXA 2V4RA 4DHZB 4L1BA 3CIRB 4ZYSA 4IUMB 1IP9A 2ZUBA 2KD0A 1QOGA 1YD8U 4ANWA 4C0ZA 2KJ5A 4ECYA 5JH5C 3PX4A 5KAIU 4ZOHC 3EGRA 1TKEA 5TISU 4LNFA 2IOFA 4NM2A 4GXKA 3TADA 3TUOA 3R3MA 1SIJA 5KFAA 4RUAA 3PHWB 4GXBA 4F8RA 3AEDB 3T9LA 1JX4A 2IGDA 4LZGA 3VTWA 2LASA 2K39A 2JEJA 4DSEA 1N56A 4DS4A 1ZQQA 1PZNA 2KOBA 4PGXA 2DYMA 3N3KB 4WQMA 4AUQC 2W3RA 3RI7C 2ZIUB 1N5XA 5CX3A 2WF6A 2NYVA 1WYGA 5EDSA 1ET6A 4RPYA 2QB1A 1N61A 2QILA 2YN4A 1VJ5A 2CHXA 2HHSA 3P63A 4ECTA 2YMMA 2C28A 2N9LA 1ZQKA 3SAHA 2HHQA 1FNUA 2K60A 1LKYB 3Q14C 5L1JA 1JIHA 3JPNA 2MX2A 5DB6A 1OUQA 3W9CB 3A0BU 2AXTU 1ZQUA 2YTUA 1I4HA 1V5OA 5DBCA 1Q5WB 1KH0A 2LPEA 1WMHB 2L52A 2PKOA 3U30A 3OSNA 4IM2A 4E74A 2B0CA 3M8SA 2NVUI 4Y2TA 4EE2A 3C0RB 1QOAA 2KXJA 5AKKA 5HR6A 2N1VA 2KKPA 1EF5A 4YWGG 1GAQB 1SZHA 1RZTA 4W9IA 3MHSD 2JXTA 4RFBA 1XCQL 3GILA 2QARA 2N1WA 1N2XA 1D8YA 2D07B 2F8KA 2AWTA 3MJ5A 1YQBA 4M9GA 1TKYA 5ALOA 3OAWA 1MJDA 3P4QB 1S0NA 1RYJA 4XYCA 5L1KA 2LMRA 4TUSA 1ZQTA 4HDQA 4YTMB 1KSPA 3NOBA 1TK0A 4BKGA 2CU1A 8ICGA 3CSFA 5ALFA 1CRXA 3TANA 1TS4A 4FN2A 4RGTA 3KVFB 3JPOA 3VR8B 5J2GA 5DQIA 2CPRA 4MT5A 3ISCA 4FBTA 1KLNA 1MN8A 4P4OA 1I4GA 1FFVA 4BFRA 5G55A 3PO4A 2CU3A 3C1YA 4DQSA 4DHZE 1ROEA 2W9BB 1ZQHA 4HCPB 4O3NA 3V6CB 1LXDA 3UIPB 2BF8B 2KSOA 2IPKD 4KKIA 4WH4A 4TQ1A 5CHFA 4DQRA 5ALTA 4KGTA 4I28A 1SJHD 3PO0A 1Z2MA 3H0LB 1PVQA 5J0PA 2Y0SF 1XS9D 1D6EC 2AQ2B 2DZKA 3ZLZA 4DHJD 2I6XA 4DXAB 1COOA 3IG3A 3AE8B 5C2TB 3VCBA 5DPRA 2LHTA 3KKAA 2LRWA 4JLCA 2YX8A 5AM1A 4XWTA 3RUIB 2K22A 4QZAA 2N7JA 3H6NA 4PHDA 1JCKB 2GMIC 4MF8A 1SXEA 2W9NA 1ZQMA 3QU2A 3QK0A 1J19A 4GDKA 1E7PB 5KFZA 3V6HA 1JWSD 3QCAA 1UWMA 4IR9A 3VUYA 5J0OA 3PMNA 1ZQAA 3N7SC 4DOBA 2LZ6A 3PW2A 2AQ0A 3QWZB 3ZKJC 1ZQBA 1KEJA 4ZHOA 4K7WA 3N9YC 2ONQA 2BYEA 4MGYE 1QH9A 4ED8A 4BDPA 2UYZB 3J9CA 4N6EB 4QZ9A 9ICVA 2WAQC 1NEKB 7ICIA 4FLHA 2XY6A 3EW9A 4RQ2A 2LD9A 3EFUA 3HK0A 1WWTA 5IIOA 3HX0A 5AM2A 4ECRA 3AU4A 3T3NA 4ECUA 1I4RA 4I2HA 3B0YA 4G0NB 1WR6E 2KFKB 2P66A 4J9KA 4B9VA 3VH4B 1ZRNA 4AYBF 4ECQA 3OJSA 5KFUA 1ZETA 4KSKC 2WS3B 3K9OB 5J0RA 4XA5A 2LYHA 3G6VA 5HKHA 1NJWA 4G9BA 2MCNB 2KDMA 4B0MA 2FPLA 1SL0A 1QLBB 7ICFA 3ZNHB 3QE9Y 1LVHA 3RJFA 2W9CA 9ICNA 4GN1A 2GBMA 3DCGA 1ZKHA 8ICMA 1J2NA 4GIVA 2Y9UA 3OHBA 4OVVA 1WXVA 3PSIA 3BVGA 4P4MA 2YY6A 4IRKA 1YQ4B 2BKRB 1WGHA 2G4DB 4YVZA 1LM8B 3AE3B 3ZDTA 4QZEA 4RQ7A 2GH1A 4RNMA 5JZEB 3Q8RB 4ECXA 1IGDA 3DBSA 3QJZA 2BQQA 4KX3A 2ZIXA 4FS2A 2DWQA 2EKEC 2J53A 2L0TA 2GLSA 2X8XX 3B1LX 4MEMA 2ZIVA 3F2DA 1CMXB 2SEBD 3MBYA 3LXFA 1JUDA 1Q3VA 3ALBA 4X57B 4IQTA 2PPHA 5ALSA 5J2BA 3UQ2A 2J4XA 1SWWA 1ZUD2 1P7EA 2NBWB 2GI9A 4Y2UA 5CHWA 1WRIA 3HILA 1QQ7A 1H4RA 1PQSA 1K52A 2HHUA 2FCQA 4CO7A 5L1LA 4I2EA 5A0LA 2WF7A 1FPYA 3SFDB 4J9PA 1UWXA 3RJIA 3V05A 5KFJA 2B21A 2ES6A 4J9OA 5DLGA 2C2DA 4LJOB 4NQLB 3TEYA 4QZGA 2OCEA 3VQIA 4ELTA 1KN5A 4F2RA 3GZNI 5BMGA 1WM3A 3IHPC 1PUZA 2ZPYA 8ICNA 4YD2A 1IM4A 1A77A 1JWMD 1TAQA 1NKEA 2Y9TA 1P7FA 2EMSA 4XGAB 3HM6X 1WXQA 3LYSA 5AM5A 3Q8CA 4DFDA 4EEKA 1WRDB 1U4AA 2KT7A 1RXVA 5AI8A 2BPCA 4I2CA 4M0WB 4RF1A 3C1ZA 1XWLA 2LI6A 5L1IA 1B22A 4F5OA 2N9EB 3ZDCA 2KJ6A 2N0SB 2Y3AA 1A5RA 1K8RB 3JPRA 2FE9A 4UASA 1OQQA 3UMCA 3PW4A 4J9SA 1KM7A 2HHTA 4RH6A 2ICIA 4W9CA 2WXJA 1PK3A 3RH6A 3SZ2A 5J0UA 4QWCA 2W03A 5KG4A 2W8KA 7ICPA 3NS8A 2RDIA 5DG8A 1WG8A 1NK9A 5CHVC 3PY8A 4P0PB 4NAWB 2OXOA 5ALUA 5IA7A 3KHGA 2JMGA 1MSWD 4YG2A 4O0IA 1JALA 2EAMA 3C21A 2L7RA 2Y0SC 2IO2B 2LGSA 1BPXA 2FNJB 4C80A 3T5JA 5AKLA 3GIIA 3D6JA 4NM1A 3J81j 1L6NA 1NK8A 1QOBA 3KBBA 3RJKA 4M8MA 2CJNA 4F72A 1TKDA 2KQSA 1C78A 4EENA 3A9KA 2FJ6A 3NASA 4PGYA 4QW8A 4BJQA 1ZRMA 2ZIWB 3WK4A 2AQ1B 4ARIA 3VC8A 3PMLA 2KZMA 1DOYA 1V9PA 3L54A 2O6VA 4RGNA 5AKJA 1F44A 3PW7A 1DOXA 2NPTA 2IO0B 4WJOA 3ZXVA 5L95C 3NVVA 4TMAB 1NYQA 1QF6A 1L5PA 4IC9A 4R64A 1C4CA 4LDTD 3BY4B 4NY8A 5C0YA 4YD1A 1ZQIA 3ZTDA 4IL6U 3NJTA 1JXEA 4U6PA 3JPPA 2KLCA 4DQQA 3CW2C 2ASQA 4LNOA 2XI9A 2INNE 2IGGA 2EZXA 1IUEA 4F5RA 1K1SA 2KFNA 1C77A 3FKYA 4XRHA 3KHLA 2Y1JA 4J9LA 1X9MA 1ZPSA 3RNFC 2W11A 4Y2VA 3OSPA 1XSNA 2L5YA 1L3SA 1PGAA 5KFIA 2WQYB 3H8HA 4TSSA 3RFZB 1V81A 5ALNA 2JRIB 2MLBA 3RJEA 4CCHA 1GC6A 2HSZA 2BPFA 7ICGA 9ICIA 9ICJA 4BUGA 1SF0A 4YFKA 5ALKA 9ICGA 4PHEA 2RR9A 3W5VB 4DDID 4OJOA 3V6EB 4R63A 1UZXB 1VD2A 1FXTB 1ZQJA 3N32A 3TBLD 3M9OB 4P0QB 3R7QA 2XGPA 4B95A 2JVCA 4W9HA 4HYKA 4NLGA 4P7IA 2MP2B 7ICSA 5FKAC 2Y5BB 1RYRA 2KHVA 1UD7A 1FFUA 3H8MA 2KK0A 3NGDA 1WF9A 4I2BA 1KBUA 2RD0A 5HG2A 3ZDDA 3GIJA 2C7MB 3WKAA 3DBHI 3SFEB 1NKBA 2V9WA 1ACCA 2WHIA 4OVUA 2ALZA 3KYDD 1JWBD 2J42A 4FS1A 2E3TA 1UELA 2AQ4A 3LDZE 2JYEA 4RQ4A 2WU5B 4O3SA 5J2JA 5H2FU 3PLVA 4L23A 1F2RC 4TQSA 3Q69A 2KEYA 4NLZA 3E2EA 1SV4A 9ICSA 1ZQVA 3GU3A 1KRHA 3ZUNA 3OJUA 1Z19A 1RFKA 1U48A 4WAFA 1OXJA 4TQRA 1D5ZC 4DFMA 4ARCA 5CHGA 2ISPA 2LRUA 2JR5A 2MAXA 4M6WA 3SAGA 1RYUA 1N48A 1HTOA 3NHEB 3A9JB 4N59A 4ZYNA 4FZNA 5DG7A 1P3QU 9ICPA 1TS3A 3ZRCA 1S76D 2EAPA 2BW2A 4B9LA 2PXIA 4PT5A 2WF8A 1TJEA 2ACZB 3L13A 4BBNF 4DSFA 1KDHA 3V62A 1OQRA 3RBEA 2WDRB 2H3FA 3TJPA 2KFJA 2KZ3A 1D8BA 4NZLB 1X9SA 1TAUA 2M19A 2GOLA 3M63B 3BK1A 4O3PA 4AWJA 4WWNA 3MC1A 4QWBA 4GB9A 3Q3NC 1PDXA 3SEIA 1I35A 2KYWA 3D2NA 2WB1F 1S0VA 1EO6A 4AJWA 1LKYA 3FC4A 4IQUA 2BZFA 1NYRA 3NS1A 5B66U 2F44A 2W04A 5GTHU 1ZQOA 5KT2A 4UAVA 2L83A 3CYMA 1HZ5A 5J2HA 3HHMA 3PSEB 1XLPA 1BUIC 2KJHB 4UATA 5J0SA 1HEKA 4HWIB 3N4MB 4TURA 1EWCA 2HI0A 1BPYA 2EMTA 2LXCA 2MBBB 3EFCA 5AUIA 3V6KA 1WX9A 2VRRB 8ICZA 3GOEA 2UWQA 3DVGX 5ALHA 4W9EA 1JMSA 3QXGA 3PSPA 1C76A 5AZHA 4O9MA 1WE7A 5HP4A 4IQWA 1L6VA 2ZG6A 1WXMA 3OG5A 4QIWC 4BZAA 4KKJA 2KKCA 1FMAD 2J0MA 3L08A 4HEA1 4DFKA 3BYYB 4HXDA 4YSYB 2IY0B 1QCKA 3RNEC 5BMHA 4C8MA 5E6OA 2V3SA 3HWTA 4YR3A 1I7HA 4DWIA 1B9RA 1L3VA 1FRDA 2E8PA 1PVPA 4OJ5A 2Z8LA 1XU4A 2KTRB 4QAYA 3SMVA
chains in the Genus database with same CATH topology
1PGBA 4L1BA 3CIRB 4ZYSA 2BYTA 1XCTL 2K0PA 2BB6A 1EU4A 1QOGA 3HVDA 1AN8A 1V1OA 4ZOHC 3EGRA 1TKEA 1TS5A 2WXPA 1JQ4A 4MM3B 3NUHB 1Q10A 2FBWB 1N60A 3TUOA 1SIJA 1HXYD 3ZJUA 2KMMA 5HI1A 1GB1A 3AEDB 2OHFA 3U2SC 2IGDA 1J7AA 2JSVX 4AS1A 5C3JB 2I38A 2DYMA 4WQMA 2PIAA 2HTME 5MPOA 4XWWA 1YQ3B 2W3RA 4C56C 3ZYYX 5LNK1 1N5XA 1QILA 1WYGA 1ET6A 1PFDA 2IDYA 3AE6B 4GDKB 4P16A 3U4EG 1N61A 1GOZA 2QILA 1CK1A 2JX5A 3P63A 3SEBA 1VZ7A 3HUIA 2N9LA 3DWGC 1FNUA 4HKQA 4GDLB 4IKGA 4RGOS 5G5GA 2IGHA 2LHEA 2PMVA 4HJGE 1FXIA 3W9CB 1DOIA 1I4HA 2PKOA 1KH0A 2L52A 2X38A 4OZBA 3KWLA 4OHJA 1KFYB 5HHDG 3FILB 1PUTA 3LB8C 4A90A 1IGCA 4EE2A 1XO3A 4J3OD 1OFFA 1QOAA 2BS4B 1I4PA 3EA6A 4NJCA 4YWGG 1GAQB 3AEGB 2WP9B 3AE9B 3P1MA 4A55A 1L4ZB 2JXTA 4RFBA 1XCQL 1MPEA 4OVZA 5EE0A 5H92C 4TQ0A 4DQOC 1CJEA 2GB1A 2EKIA 1N62A 3MJ5A 1TKYA 3P4QB 1RYJA 2W55A 5EE9A 2M56B 4JWSC 4YTMB 1SE2A 3L4PA 1SBBB 3E9SA 3ZJTA 3AM9A 4US8A 1AYFA 3NVZA 1TS4A 4NAMA 1T6BX 4RGTA 1LO5D 1ZE3D 1SXTA 4WURA 3VR8B 1CQVA 1VZ6A 4MT5A 3AN1A 1TS2A 1PGXA 2YEPF 1FD6A 1I4GA 3P4RB 1TY0A 1FFVA 2OEDA 1HQRD 3MC0B 4WIPA 3KQ4A 2CU3A 2BB5A 4MH8A 2PW9A 1ET9A 1ROEA 2VZKB 4Q2JA 3E56A 2WU2B 3ETRA 1EM7A 1JWUD 4A8XC 3AE4B 4XDCA 1HA5A 2IPKD 4N58A 4KKIA 4WH4A 4TQ1A 3WCQA 2PVGC 4CQNA 4RNAA 4KGTA 1ZXIA 1SJHD 3AV8A 3PO0A 4LTUA 3W2DA 1D6EC 3CWIA 4JX1C 3HRDD 2AQ2B 4GLSC 3AE8B 3MHZA 5C2TB 1TY2A 1NVID 1IBXB 1V97A 3AE1B 2GRIA 5FK9C 4XWTA 2K22A 3AEBB 1VDVA 2N7JA 4ZHPA 1JCKB 2WXOA 5HFYA 1MVKA 1FIQA 1E7PB 1E10A 1JWSD 3AEAB 1N5WA 1UWMA 1KLUD 4FXCA 3Q8EA 2E6XA 2AQ3B 3OWEB 1N63A 2FUG1 4M0WA 1YNTE 4HROA 4ZHOA 3N9YC 1TKGA 2ONQA 3BVZA 1FCLA 2BS3B 2K3UA 4OZCA 2W3SA 4RF0A 3J9CA 4N6EB 2MH7A 1NEKB 3PZ7A 1L6UA 2PLPA 4R3DA 1JMLA 1WWTA 1M4VA 2WXIA 3BIID 1J7CA 1STEA 3T3NA 3AEEB 1I4RA 2LGIA 2SAKA 2BBCA 2KN4A 1D5MC 3AH7A 4ITKA 4JPSA 1L4DB 1TYGB 1SE4A 3IT6B 4RCOA 3T3OA 2WS3B 3VRAB 1FRRA 1WSPA 2WXHA 3GP7A 4KGSA 2KDMA 4B0MA 1D4BA 1QLBB 2BTEA 4ZRPA 3ABVB 4O1NA 1ZDVA 5GXGB 1ZP0B 2PTLA 5EE1A 3BVGA 5D3DA 1YQ4B 1L0XB 2K9XA 3HVZA 1XLQA 2V3NA 5D3IB 1I4QA 1WGKA 3AE3B 2J52A 1ZOYB 4LK0M 5H8YE 1IGDA 2WNMA 5BYSA 1VRAB 2YEPB 2M0AA 4XE0A 2DWQA 2J53A 3GS2A 3BZDB 2SEBD 1UUPA 3AB5A 4B0EA 3LXFA 2V0GA 3AEFB 1XLNA 3C8YA 3AMZA 1MHXA 1BMLC 2J4XA 4IDIA 1ZUD2 2N9KA 1P7EA 2GI9A 3IAS1 1WRIA 1K52A 4OW0A 4YTNB 1C79A 1CZPA 3SFDB 1Y56A 1UWXA 3NZ3A 2EELA 3V05A 1YN3A 1C4PA 3TSSA 4DXFA 3VR9B 3TEYA 3LYYA 4L2YA 2INPE 3VQIA 5BMGA 1QT9A 1K51A 2VZKD 2NMQA 3IAM1 4IOIE 2NTTA 3IXSA 1YMHE 1JWMD 3TEWA 3Q8FA 2QJLA 1P7FA 2WXGA 4JWUC 3B2GA 1WXQA 2MJEA 1B1ZA 3Q8CA 1HZ6A 2WXRA 3B9JA 3SR6A 4MACA 4RF1A 3AE5B 3R8BA 1FM0D 3MP9A 2LFIA 2N0SB 2Y3AA 2JQRB 2NTSA 2QEJC 1OQQA 4USAA 3AE7B 2BT6A 4RH6A 1F0ZA 2ICIA 1E0ZA 2WXJA 3FAHA 2LJIA 1C9FA 1SE3A 1FEHA 1YJIA 2WXMA 2K5PA 1YJJA 4KGRA 3ZGZA 1SSNA 5G5HA 2G9HD 1ESFA 4NAWB 1E6EB 1J7BA 2H88B 2G1EA 2KWDA 1JALA 1L0YB 2XN9C 4C80A 3GB1A 4JE3B 2AX5A 3Q8AA 1K50A 1QOBA 2QMTA 5D7GA 1JW9D 2CJNA 2WXNA 1C78A 1SJED 4D2KA 3NVWA 4YT0B 1C4AA 1AWDA 3Q8BA 4YSZB 2AQ1B 2DBYA 2WDVB 4ARIA 2ZW0A 1DOYA 4WWMA 2PVOD 2B76B 4RGNA 1DOXA 1QF6A 3NVVA 4TMAB 1NYQA 2Y5PA 1L5PA 1XLOA 1MHHE 2R61A 2V4IB 3P4SB 1GB4A 1DYQA 5T8IA 4HRSA 1C4CA 4US9A 1R7SA 1UNSA 2RMMA 5TSSA 2WXKA 3W5UB 3TEXA 1IBXA 1JROA 3O13A 2WXQA 2INNE 2IGGA 2HDEA 1IUEA 1C77A 5EE3A 1ZPSA 1RWSA 1PGAA 2WQYB 3H8HA 3PZ8A 4TSSA 3RFZB 1K53A 1YN5A 2LEKA 5BYRA 1AW7A 2H89B 4KX6B 1I4XA 5AUKA 4LLGM 1SF0A 1F77A 1UGJA 5E6JA 2CJOA 2V3PA 1NENB 1BXTA 3W5VB 5JXVA 3R2TA 5BYQA 1XF5L 2JWUA 1HEZE 3I57A 4C7YA 2RDGA 1V1PB 2D5GA 5FKAC 1FFUA 1L0VB 2RPVA 2I2YA 2WLBA 3BYTB 5HG2A 1PYWD 1T3QA 4REZA 2WXFA 3SFEB 3B2FA 3ZQ4A 2LMCA 3AECB 1ACCA 2ON8A 1VR9A 1JWBD 2J42A 2E3TA 4OZAA 2JYTA 2JYEA 2WU5B 4YXDB 2W82A 1QQRA 3U7ZA 4L23A 1F2RC 3Q69A 2L1AA 2WXLA 1KRHA 1NI3A 1RFKA 1XEEA 4WAFA 3V3XA 1D5ZC 2IJ0A 2FE8A 4ARCA 2JZPA 3IT4B 1ENFA 3URYA 2DYOA 3UI3A 5FR3A 2L32A 3NVYA 2LHDA 3TEZA 3NRZA 1EWYC 1ZXHA 1ZDXA 4HKZE 4N59A 3BVMA 2LUMA 1TS3A 2WDQB 1KTKA 2BW2A 4PT5A 2TSSA 1TJEA 2ACZB 3KWVA 2Q5WD 4RGMA 2DLBA 1FNVA 2KQ4X 1D5XC 1OQRA 4XDDA 1F2RI 4YTPB 1EU3A 2WDRB 1YN4A 1FCCC 3W1SA 2XNAC 4NZLB 2M19A 1V8CA 2KAJA 2JU6X 3BK1A 2W54A 2MEKA 1PDXA 2Y5CA 1T5XD 4ZRQA 1JRPA 3BK2A 1NYRA 3FC4A 3NS1A 4C7ZA 1FXAA 1JWAD 3EUB2 4P6VF 1FNWA 4UDUC 4AQ7A 2KACA 1VZ8A 2ZW1A 2L83A 5BMIA 4A6QA 1HZ5A 3FILA 1QOFA 1XLPA 3DWMA 1BUIC 3I9V1 1E9MA 1SB3C 1MI0A 4A9AA 1EWCA 3ZJVA 5AUIA 3AE2B 1RM6C 3BWUD 1GPXA 1A70A 1C76A 1KF6B 1VLBA 5I4DA 1TZOA 1L6VA 3MFGA 4DXGA 1VJKA 3U52E 3KLSX 4H2AA 1V1PA 4KKJA 2MJDA 1FMAD 1XXGA 4HEA1 3P4PB 3BYYB 1DGJA 4YSYB 1QKZA 2MJ3A 5BMHA 1FO4A 1KLGD 1SEBD 1I7HA 2RDHA 1B9RA 1FRDA 2QSDA 3RPFC 2QIEB 2BS2B 2Z8LA 3VRBB 4YSXB 3P42A 3R2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXI A;  3AV8 A;  3CIR B;  3PO0 A;  4LTU A;  1FFU A;  1L0V B;  3CWI A;  3HRD D;  1QOG A;  4JX1 C;  2QJL A;  2WLB A;  3AE8 B;  4JWU C;  5C2T B;  1T3Q A;  1WXQ A;  3B2G A;  3SFE B;  1NVI D;  2MJE A;  1V97 A;  4ZOH C;  3AE1 B;  1TKE A;  3B2F A;  3B9J A;  1JQ4 A;  3SR6 A;  3AEC B;  2K22 A;  2FBW B;  1N60 A;  3AEB B;  3AEG B;  1VDV A;  1JWB D;  3AE5 B;  1SIJ A;  4ZHP A;  2E3T A;  1FM0 D;  2KMM A;  4YXD B;  2WU5 B;  2N0S B;  5EE1 A;  2JQR B;  1FIQ A;  1E7P B;  3AED B;  1OQQ A;  1E10 A;  3AEA B;  2OHF A;  4USA A;  1N5W A;  3AE7 B;  2BT6 A;  1UWM A;  1J7A A;  1F0Z A;  1KRH A;  1E0Z A;  1NI3 A;  3FAH A;  1RFK A;  4FXC A;  1YJI A;  5C3J B;  1N63 A;  4WQM A;  2K5P A;  1YJJ A;  2HTM E;  2PIA A;  5MPO A;  4HRO A;  4ZHO A;  1YQ3 B;  2W3R A;  5G5H A;  1TKG A;  3ZYY X;  1N5X A;  2BS3 B;  1WYG A;  2W3S A;  3NVY A;  1PFD A;  1E6E B;  3AE6 B;  2MH7 A;  4N6E B;  1NEK B;  1J7B A;  1N61 A;  3NRZ A;  1EWY C;  4N59 A;  2H88 B;  2G1E A;  1L6U A;  1JAL A;  2JX5 A;  3P63 A;  3HUI A;  1WWT A;  2WDQ B;  4C80 A;  3BII D;  2AX5 A;  1J7C A;  3DWG C;  1TJE A;  2ACZ B;  3AEE B;  2Q5W D;  1OQR A;  1QOB A;  5G5G A;  4ITK A;  3AH7 A;  4YTP B;  1JW9 D;  2CJN A;  2WDR B;  1TYG B;  1FXI A;  3W9C B;  1DOI A;  2M19 A;  1V8C A;  2PKO A;  2KAJ A;  2WS3 B;  1FRR A;  3NVW A;  2L52 A;  3VRA B;  2W54 A;  4YT0 B;  3KWL A;  1KFY B;  1AWD A;  1PDX A;  1PUT A;  3LB8 C;  4YSZ B;  2DBY A;  2WDV B;  1QLB B;  1DOY A;  1XO3 A;  4WWM A;  1OFF A;  1QOA A;  2BS4 B;  2PVO D;  2Y5C A;  1JRP A;  2B76 B;  1NYR A;  3FC4 A;  1DOX A;  3ABV B;  3NS1 A;  4C7Z A;  1QF6 A;  1FXA A;  1GAQ B;  3NVV A;  1JWA D;  3EUB 2;  1NYQ A;  1L5P A;  1XLO A;  1ZP0 B;  2WP9 B;  3AE9 B;  3P1M A;  3P4S B;  1YQ4 B;  4P6V F;  5EE0 A;  5H92 C;  2K9X A;  3HVZ A;  1XLQ A;  4HRS A;  2L83 A;  4US9 A;  1CJE A;  1R7S A;  1WGK A;  3AE3 B;  2EKI A;  5GXG B;  1ZOY B;  1N62 A;  3W5U B;  1QOF A;  5H8Y E;  1TKY A;  1XLP A;  3P4Q B;  1JRO A;  1RYJ A;  3DWM A;  2W55 A;  5EE9 A;  1E9M A;  2DWQ A;  2M56 B;  4JWS C;  1SB3 C;  4A9A A;  4YTM B;  3L4P A;  1IUE A;  3AB5 A;  5AUI A;  3AM9 A;  4US8 A;  1AYF A;  3LXF A;  3NVZ A;  3AEF B;  1XLN A;  5EE3 A;  3AE2 B;  3VR8 B;  3AMZ A;  1RM6 C;  3VRB B;  1RWS A;  1GPX A;  3AN1 A;  1A70 A;  1KF6 B;  2WQY B;  1VLB A;  1ZUD 2;  4IDI A;  1L6V A;  2LEK A;  1WRI A;  1VJK A;  3P4R B;  1FFV A;  2H89 B;  2CU3 A;  2MJD A;  4KX6 B;  1FMA D;  5AUK A;  3P4P B;  1ROE A;  1DGJ A;  1SF0 A;  4YTN B;  1CZP A;  4YSY B;  2CJO A;  3SFD B;  1NEN B;  2MJ3 A;  3ETR A;  2WU2 B;  3W5V B;  1FO4 A;  3AE4 B;  1I7H A;  4N58 A;  1B9R A;  3VR9 B;  1FRD A;  3WCQ A;  2PVG C;  3RPF C;  2QIE B;  2BS2 B;  4YSX B;  1QT9 A;  4C7Y A; 
#chains in the Genus database with same CATH topology
 3NUQ A;  2EZZ A;  3W1Y A;  2K0P A;  3PZD A;  1YIW A;  2L05 A;  1DK2 A;  2LM4 A;  2W9B A;  1HUZ A;  4PH5 A;  2N1R A;  1V1O A;  2KSO B;  2V1Y A;  3VVW B;  2MW5 A;  4Y2Y A;  2M0X A;  3A4R A;  4ED3 A;  1Q10 A;  5ALI A;  1V86 A;  4FJZ A;  2F2A B;  3LK9 A;  2KZZ A;  4KLG A;  4HDO A;  2ZJ5 A;  3PST A;  1GB1 A;  1WGR A;  4RMA A;  3U2S C;  4RPX A;  1J7A A;  1SGH A;  1S97 A;  1S0O A;  3Q8L A;  4IS7 A;  5DPS A;  2I38 A;  2MUT A;  2FCS A;  3WU2 U;  2HTM E;  2MBO A;  4XWW A;  4C56 C;  4RQM A;  2UU7 A;  2IDY A;  4RM9 A;  1S77 D;  4DLE A;  4GDK B;  1F1H A;  1X66 A;  2G5I B;  1GOZ A;  2KLG A;  3SD5 A;  3UIO B;  4DL6 A;  4HPM B;  2RSU A;  4ACO A;  4DOC A;  1VZ7 A;  3QA8 A;  4PPX A;  2M1M A;  3WAM A;  4HKQ A;  4GDL B;  4IKG A;  1WCL A;  4RGO S;  5CR0 A;  2LHE A;  2PMV A;  2A3V A;  1DK3 A;  1ZJN A;  2FLN A;  4WJP A;  1H8C A;  4ECS A;  5AM4 A;  1UF0 A;  3SYZ A;  4BXO B;  1RPL A;  4QZF A;  2X38 A;  2LVP A;  4I29 A;  3IHQ B;  1KFY B;  3AUL A;  3M9N B;  3FIL B;  5HHD G;  3LB8 C;  2KC2 A;  1Z4N A;  1DRG A;  3L0W B;  2FI1 A;  4A90 A;  1IGC A;  1T0Y A;  2BS4 B;  1Z00 B;  2FUH B;  3SQI A;  4NV0 A;  4OO1 J;  5FP0 A;  5KAF U;  3AUO A;  4RT2 A;  3DQV A;  1L4Z B;  4G11 A;  5H92 C;  1KQQ A;  4E3C A;  2YQE A;  4TQ0 A;  1M94 A;  4UB2 A;  4DQO C;  3WAN A;  1SGG A;  1CJE A;  2ZTD A;  3DVG Y;  1N62 A;  2KMC A;  1S3S G;  3N1Y C;  1NK5 A;  2M56 B;  2OJR A;  2DZI A;  2W9C B;  2EZY A;  2XID A;  4Z6C A;  1Z4O A;  3ZJT A;  3KTQ A;  3GE3 C;  4JQW C;  4NAM A;  1T6B X;  1ZE3 D;  1SXT A;  3M3J A;  1CQV A;  1VZ6 A;  4G3I A;  1WZ0 A;  3K1Z A;  3AN1 A;  1TS2 A;  3H8S A;  1PGX A;  2YEP F;  4JV0 A;  2AGO A;  4GFJ A;  1FD6 A;  3C29 A;  2G5H B;  4ECV A;  3DOW A;  3V7L A;  1R4N B;  1ED1 A;  3P4R B;  4AP9 A;  3ZNI D;  2OED A;  3F5A A;  2ASD A;  5HHI A;  3EPG A;  5CJ7 A;  2BB5 A;  4IM0 A;  5KT7 A;  4MH8 A;  4OCZ A;  5KFO A;  2R8K A;  1EM7 A;  3LWM A;  1WXA A;  4A8X C;  3PW5 A;  2K8B A;  1QQ5 A;  3WK9 A;  4FUL A;  1UA0 A;  7ICO A;  2HVI A;  1OTR B;  2CKH B;  3H7P B;  1HTQ A;  1ZD2 P;  1JI7 A;  4Z6F A;  5AI5 A;  5KHQ A;  4KLO A;  5K4L A;  1ECW A;  3AV8 A;  4K81 A;  3PNC A;  2BQR A;  3QEA Z;  3CWI A;  4JX1 C;  1TIF A;  3B0X A;  4M02 A;  4XUS A;  4GLS C;  3WAL A;  4R65 A;  2DYB A;  4FZL A;  2IBK A;  1NVI D;  1IBX B;  2YVC A;  3UXN A;  2GRI A;  4K3C A;  5T14 A;  2ZNV B;  3BS5 B;  4ZHP A;  1L7P A;  9ICW A;  3WKD A;  1ZOL A;  2DEN B;  4C4T A;  2LKY A;  1V6E A;  4WJN A;  4GIB A;  4GU2 A;  3TFS A;  1Z3E B;  4KMU A;  2O6V D;  4FXC A;  4I2D A;  2QCZ A;  2AQ3 B;  2G3Q B;  5DB7 A;  1N63 A;  2FUG 1;  4M0W A;  1UT8 A;  2A1A A;  5ALQ A;  3PVX A;  2AL6 A;  2D10 A;  4ACF A;  4GLX A;  4BKS A;  4URK A;  4NXZ A;  4OZC A;  2W3S A;  1WI0 A;  1IV8 A;  5AK4 A;  4DQP A;  2GO7 A;  1L7Y A;  3PZ7 A;  2WWZ A;  2PLP A;  2HBK A;  4KZ0 A;  4JMU A;  2PMZ F;  4ZH4 A;  5KFT A;  1M4V A;  3ZI4 A;  5F3X B;  3BII D;  2B6G A;  2KWC A;  4K3B A;  2WFA A;  4ANX A;  3HM3 A;  4M9H A;  2VJ4 A;  2SAK A;  5BPC A;  3VXW A;  3IN5 A;  3TAR A;  4QZD A;  4MJS B;  1TYG B;  3IG5 A;  9ICL A;  2G08 A;  4RCO A;  3HP6 A;  1TK8 A;  1ZGU B;  2FCN A;  2KN5 A;  2C2R A;  1WYW B;  1WSP A;  5KFE A;  1YT3 A;  4KGS A;  4F71 A;  5AKY A;  1XSP A;  2JEF A;  2BTE A;  1UPH A;  4ZRP A;  4FHJ A;  2WX1 A;  4Q45 A;  2A4Z A;  3L16 A;  4O1N A;  3RH5 A;  3KH0 A;  1ZDV A;  5C5J A;  5AM3 A;  3TAP A;  1L0X B;  3HVZ A;  1XLQ A;  2V3N A;  3M62 B;  2E8O A;  8ICO A;  5JTI A;  4DEZ A;  3RAX A;  3PX0 A;  3Q8K A;  1ZOY B;  2ZIW A;  3H4D A;  8ICA A;  5H8Y E;  4F5N A;  5BYS A;  1VRA B;  2YEP B;  2M0A A;  2O6V B;  1NK4 A;  4JWN A;  2D3D A;  4I6P A;  1ZQL A;  3ZNG C;  3OLM D;  4M0A A;  1KKX A;  4ZRI A;  3BS7 A;  2DGZ A;  1KTQ A;  4CRX A;  3RB0 A;  1MHX A;  1BML C;  4HLE A;  4IDI A;  1L8L A;  2XK5 A;  4Q8F A;  2KX3 A;  3IAS 1;  5AKH A;  3X23 A;  1ZQN A;  3VUX A;  4F4W A;  2H5X A;  1GG3 A;  3WAO A;  1OEY J;  4I2A A;  3ZXR A;  3I28 A;  1Y56 A;  1KFT A;  4Q8E A;  3NZ3 A;  4FBU A;  2EEL A;  2CS4 A;  4EX7 A;  1C4P A;  4BOZ B;  1P7D A;  5IN7 A;  1PVR A;  3P42 A;  4C4V B;  4DXF A;  1SKW A;  3UXP A;  5EOZ A;  2P6R A;  3R7R A;  2LGY A;  2GBN A;  3AXC A;  1WX8 A;  3RCZ A;  2JUO A;  1MQ2 A;  4F3O A;  1QT9 A;  2PEA A;  4NJ6 A;  3IAM 1;  1U45 A;  4IOI E;  1WH3 A;  5F9L A;  3SDL C;  3M1Y A;  2H3Z A;  2LYA A;  1YMH E;  3IXS A;  5LLI A;  5GMV A;  3LWL A;  5HNK A;  2QJL A;  3Q8F A;  1U47 A;  4DF8 A;  3SHQ A;  2LUE A;  5BOM A;  4GXJ A;  2PFP A;  2WXR A;  4QIW F;  4P0Q A;  2ZJA A;  3UQ0 A;  1B4F A;  2FMS A;  2IZV B;  4DHJ B;  2QLT A;  2PFN A;  4PL2 A;  1LQB A;  3UQB A;  1ZQC A;  1FM0 D;  3ML8 A;  2LFI A;  4Y2X A;  1MG4 A;  3G6Y A;  2NTS A;  2AHO B;  1ARO P;  5ALZ A;  4RUC A;  2QEJ C;  4B9U A;  8ICY A;  1O03 A;  4ECW A;  1F0Z A;  5AI4 A;  7ICU A;  1E0Z A;  1LV5 A;  1TBE A;  1YJI A;  3OHA A;  3TMP B;  5IIL A;  1WJN A;  2UVW A;  5G5H A;  1ZQS A;  3E0F A;  5KFD A;  9ICO A;  2WF9 A;  1E6E B;  4EZ6 A;  2LGD A;  2H88 B;  1KRP A;  2KWD A;  1NZP A;  1IXR A;  1NJZ A;  3GB1 A;  1J97 A;  5AIB A;  3MGI A;  2MSE D;  3FM9 A;  2L00 B;  1X2I A;  5L1M A;  4K4H A;  2WXN A;  4M6W B;  5III A;  1ZQX A;  2JT4 B;  1SXD A;  4JUZ A;  4XQ8 A;  3V72 A;  3ORY A;  4M9L A;  1SJE D;  4YT0 B;  1C4A A;  1BVS A;  4I2I A;  3Q8B A;  3OTQ A;  1BPD A;  8ICX A;  2ZW0 A;  3QQ8 B;  5IIM A;  2PVO D;  3HPO A;  3CST A;  3U7D A;  4UB6 U;  2C7H A;  5KL1 B;  1S5L U;  1RFA A;  3VHT C;  2I1Q A;  5DQG A;  3P4S B;  1MHH E;  3V7K A;  3GQC A;  2R61 A;  2VA2 A;  1DYQ A;  2K6Q A;  4NPN A;  5T8I A;  4ANV A;  4HRS A;  1EUV B;  2RMM A;  4DL3 A;  4QW9 A;  1BPZ A;  2LWP A;  3TEX A;  1F0M A;  1JRO A;  2I5H A;  3EYZ A;  1XSL A;  3RNC C;  2FIF A;  2J7Q B;  1ZW7 A;  2CHZ A;  3RZW C;  2R2Q A;  2JZB B;  1CUK A;  5J29 A;  4KLH A;  1YZ7 A;  5ALG A;  2RLT A;  2IO1 B;  2KIC A;  1T94 A;  4MF2 A;  1RWS A;  2J0K A;  4IRC A;  3Q2A C;  1YN5 A;  3C19 A;  2ASJ A;  2E5S A;  3RF9 A;  2AGP A;  2H89 B;  2NS5 A;  1UT5 A;  3QX7 A;  4KX6 B;  1I4X A;  5J17 A;  2PFO A;  5AUK A;  1UGJ A;  2QC8 A;  3HIZ A;  2AGQ A;  2ODG A;  5CWR A;  1EXN A;  3KOO A;  4JB3 A;  4IR1 A;  1BXT A;  2V3P A;  4HCN B;  2H3Q A;  1RLF A;  5BYQ A;  4A20 A;  4ED1 A;  2JWU A;  2XEW A;  4BWJ A;  4ED7 A;  2LJ5 A;  2R8I A;  2ZZP B;  1HEZ E;  2RDG A;  4Y2Q A;  4EX6 A;  1TV9 A;  2KFK A;  4NY0 A;  2I2Y A;  3BYT B;  2PE9 A;  3PO5 A;  4KN7 A;  4ECZ A;  5LXH A;  2WXF A;  3TFR A;  2XY7 A;  3B2F A;  2CXY A;  3ONN A;  3AEC B;  2ON8 A;  3X0W A;  4KMO B;  2JZZ A;  2ZUD A;  1HJP A;  3KHH A;  4I2G A;  8ICB A;  4OZA A;  1A76 A;  3WK5 A;  4YXD B;  4AOF A;  1M6Y A;  1BNP A;  3F5E A;  4II3 B;  1K5O A;  4F4K A;  2DZM A;  2OM6 A;  2WXL A;  2Y1I A;  1SZP A;  1NI3 A;  1XEE A;  3V3X A;  4BKS D;  2M8S A;  2K4E A;  3Q3M C;  4JV1 A;  2JZP A;  9ICF A;  4HK2 A;  3IT4 B;  3RNG C;  3QZ7 A;  4MEX A;  2FAZ A;  3URY A;  1BPB A;  3DHI C;  2DYO A;  1R4M B;  4BKT A;  2ZIX B;  4HPL B;  2L32 A;  2BYF A;  2RDB C;  5KFY A;  3UXO A;  9ICQ A;  2ZIV B;  2KJ8 A;  1EWY C;  7ICQ A;  4ASW C;  3QZ8 A;  3AI5 A;  1P1A A;  2O2V A;  4DSL A;  3QIJ A;  3T5H A;  4O5E A;  3APD A;  2INC C;  2REX A;  2MUT B;  1HIW A;  3KWV A;  2Q5W D;  1WFY A;  1FNV A;  2KQ4 X;  1D5X C;  5AK3 A;  1NNL A;  1EU3 A;  1YN4 A;  3ONS A;  3PRE A;  2XNA C;  3HW8 A;  3QUQ A;  1NK0 A;  2Z59 B;  4KLF A;  3AL0 B;  2EH9 A;  4FFD A;  3PS6 A;  3EZ5 A;  3KUD B;  4GSW A;  2HDO A;  4F92 B;  1NJY A;  3O65 B;  1NKC A;  4DL2 A;  2Y5C A;  3BK2 A;  2OJW A;  4IW0 A;  3ISD A;  4XX5 A;  4I27 A;  1NZB A;  1FXA A;  5ALW A;  3A4S C;  4FZM A;  3RRH A;  4B9N A;  3D2S A;  3T5K A;  5AKE A;  5BMI A;  1VCB A;  4J03 A;  1NOM A;  4DFP A;  4J6I A;  1OQY A;  3FIL A;  4UB4 A;  2LBO A;  3DWM A;  7ICV A;  3RB6 A;  3I9V 1;  1E9M A;  1Z00 A;  2MSN A;  4KVG B;  4E0D A;  2KIV A;  5EWE A;  3C2K A;  2XCA A;  3AE2 B;  4DBG A;  5J2I A;  1X6I A;  3H0R B;  4JGH B;  2HE7 A;  5AKG A;  1Y8R C;  1TZO A;  3MFG A;  4DXG A;  1TZ1 A;  4K7S A;  3WA0 A;  2KP7 A;  4I2J A;  1V1P A;  2I1J A;  4P1C C;  1NJX A;  4ED0 A;  2MJD A;  2FID A;  4MEY A;  4K1R B;  1XXG A;  4YMN A;  3P4P B;  7ICN A;  1DGJ A;  5AK6 A;  2BCV A;  3IVF A;  3HKZ F;  3EHV A;  1NI2 A;  4MHV A;  4P0P A;  2F1I A;  2JRH A;  1ZQR A;  2Z0E B;  4NAW A;  2HOI A;  2K25 A;  2FMQ A;  2ZEQ A;  2KKV A;  2VIX A;  2QIE B;  2NO4 A;  3R2I A;  1PGB A;  5AI6 A;  3EPI A;  1XCT L;  5IO9 A;  2BYT A;  3FDS A;  2BB6 A;  3PZP A;  3DV9 A;  3HVD A;  1UGM A;  1T8E A;  1AN8 A;  3A9K B;  5J0X A;  1TS5 A;  1JQ4 A;  1K1Q A;  3NUH B;  1C20 A;  4MDK E;  2KD1 A;  2FBW B;  3ENE A;  1HXY D;  2KK8 A;  3QU9 A;  3A33 B;  3ZJU A;  2KMM A;  5HI1 A;  1P98 A;  5ALV A;  4UQG A;  1QZE A;  2ESE A;  5EWG A;  1TAM A;  5EWF A;  5BOL A;  8ICH A;  4Q44 A;  5J2E A;  4W9D A;  2FCM A;  2BWE S;  4AS1 A;  1P0R A;  3ZDM C;  2D8C A;  5MPO A;  1E90 A;  1YQ3 B;  4FBJ B;  3C2M A;  1RG6 A;  3GIM A;  3ZYY X;  5LNK 1;  4YXM A;  3GZF A;  3U4E G;  3IRU A;  2AU0 A;  1CK1 A;  2HHX A;  4PK1 A;  9ICC A;  3HUI A;  2W7O A;  2QDF A;  3QUB A;  2VH1 A;  8ICV A;  9ICX A;  4YP3 A;  4DSK A;  4O5K A;  3H1U A;  2HTH A;  1XC9 A;  1FXI A;  2A5U A;  3AU6 A;  3R9K A;  1DOI A;  2KVR A;  4ZDV A;  2GWS A;  2UVR A;  4DF4 A;  5KFB A;  4IG7 B;  2E1E A;  3HT3 A;  4BGD A;  5HMM A;  4OHJ A;  5KT4 A;  3EEC A;  2LVQ A;  4EEY A;  2YB4 A;  4UB1 A;  1OFF A;  2GBR A;  4J3O D;  2PE6 B;  3ZDA A;  1I4P A;  3EA6 A;  3H8W A;  4NJC A;  4Q43 A;  2ZJ8 A;  5ALP A;  3AEG B;  3P1M A;  2WP9 B;  4KDI C;  4A55 A;  2WAQ F;  1O08 A;  2KG5 A;  3TIX A;  2GB1 A;  1SV0 C;  2EKI A;  2BCR A;  1E7U A;  4PZO A;  5KT6 A;  4OJP A;  5EE9 A;  1XQQ A;  4JWS C;  1XO0 A;  4C8O A;  1E8Y A;  4J9M A;  1SBB B;  3BQT A;  3AM9 A;  1AYF A;  3NVZ A;  2ZVO A;  4FJY A;  1YJ1 A;  1UBI A;  2IBI B;  1TT5 B;  1UA1 A;  2K4H A;  2W9M A;  5DKW A;  3TCA A;  3N30 A;  1UHU A;  1ZD4 A;  4EKU A;  4GMV A;  3JPT A;  2UVV A;  1HQR D;  2RRD A;  3KQ4 A;  2C22 A;  4MH0 E;  2PW9 A;  3MJW A;  2VZK B;  4Q2J A;  3E56 A;  2OEH A;  4DL4 A;  1JWU D;  1LGR A;  2XBB C;  3RB4 A;  3LJ3 A;  4R8U A;  3TAD C;  3VFK A;  1HA5 A;  1T0S C;  3ML9 A;  3A9J A;  4MM3 A;  3WCQ A;  2HCF A;  3K4G A;  2P35 A;  2PFQ A;  4EZ9 A;  4KLS A;  2PVG C;  2XK5 B;  4CQN A;  2R2O A;  4RNA A;  4PYU A;  5AZG A;  2K4P A;  2YML A;  4PS3 A;  1X42 A;  3WK6 A;  4M2Y A;  3W2D A;  3MC9 A;  2FPK A;  3HRD D;  4NLK A;  1ZQY A;  5KHO A;  1TY2 A;  3MAB A;  2P6U A;  2I9G A;  1COK A;  1V97 A;  2K8H A;  2DF4 B;  3AE1 B;  4MSQ B;  1SKR A;  4DLG A;  4NLN A;  5FK9 C;  2ATL A;  2R8J A;  1L8O A;  3AEB B;  5DCN A;  1VDV A;  3QU7 A;  5AI9 A;  4YMO A;  1X9W A;  1WWU A;  2WXO A;  5DBA A;  2B3A A;  5HFY A;  5HR7 A;  4F4X A;  3TL5 A;  3CNH A;  1GO3 F;  1QSY A;  2HOQ A;  2I1K A;  9ICM A;  5BO4 B;  4C4R A;  1KLU D;  2E1F A;  4UAR A;  3Q8E A;  5DDY A;  5KFM A;  2K6D B;  4AJY B;  1UQV A;  5JUM A;  1YNT E;  3F2C A;  4HRO A;  2JHD A;  1TKG A;  1KFS A;  3T3F A;  2BS3 B;  1IYF A;  5KG0 A;  3RZF A;  2MH7 A;  4EYH B;  4W9K A;  2DPJ A;  4LNI A;  3C5F A;  4ELU A;  3SEN A;  2AJQ A;  1JML A;  2Z0D B;  2BPG A;  2BDP A;  1STE A;  3AEE B;  4DOA A;  2BBC A;  4ITK A;  4JPS A;  3AH7 A;  2NRW A;  2WDT B;  5DBB A;  4YL8 A;  4CYE A;  1SE4 A;  3IT6 B;  3T3O A;  3PLU A;  4NLC A;  3AU2 A;  3I1Y A;  3EC8 A;  2WXH A;  4KIK B;  5AM0 A;  3GP7 A;  2MRL A;  3S6J A;  4U7C A;  3MC8 A;  4WWO A;  5ALL A;  1C3T A;  5HHH A;  3AEV A;  2MBE A;  3ABV B;  2YMP A;  5GXG B;  2K4I A;  5EE1 A;  1ZP0 B;  3WK7 A;  2ZPN A;  1EF1 A;  2KHQ A;  4RPZ A;  2LVO A;  2PJH A;  2JGA A;  1URJ A;  2HVH A;  2KDI A;  4K4G A;  1BGX T;  2JZ3 B;  1RQL A;  4HPP A;  2WNM A;  1PK1 A;  3LVV A;  2NRT A;  2KMD A;  3O0F A;  1YX5 B;  3GV8 B;  5JRT A;  2C9W B;  2PI4 A;  4O3O A;  3W1S C;  2XY5 A;  5D46 A;  1UUP A;  3A0H U;  3DVN U;  2V0G A;  3RT3 B;  3AEF B;  1XLN A;  1T4G A;  3ED5 A;  3BQ0 A;  2IHM A;  2OH2 A;  3L10 B;  3QHT A;  3C8Y A;  4KLE A;  3AMZ A;  4F8C B;  4GXI A;  5CP2 A;  2N9K A;  1ZJM A;  2QKQ A;  1NK7 A;  1WJ6 A;  3QU5 A;  3JVZ X;  1Z1V A;  9ICB A;  1S8O A;  3PTF C;  2KWU B;  4OW0 A;  4BAX A;  2K8C A;  1E8W A;  4YTN B;  1C79 A;  2PKE A;  3WAP A;  4J9R A;  1Z5S B;  1YN3 A;  3M6K A;  3TKA A;  1YZ6 A;  5AKI A;  4MGZ E;  2ZUC A;  3BQ1 A;  2KC1 A;  1KJT A;  3VR9 B;  1H38 A;  4L2Y A;  4XE0 A;  2MU2 A;  2PI5 A;  1K51 A;  1L2N A;  2D3B A;  3RD2 A;  3QX1 A;  1F9J A;  2M4N A;  4QZI A;  3SV3 A;  4II2 B;  3TEW A;  2Q0Z X;  3HKZ C;  2WXG A;  4JWU C;  3UM9 A;  5J8Y C;  2DFL A;  2MJE A;  2FMP A;  1B1Z A;  1UCV A;  4EZK A;  2KE7 A;  2LGX A;  5AKZ A;  3DEE A;  3SR6 A;  5B5E U;  2BGW A;  3ZDE A;  7ICL A;  1BNO A;  2H3I A;  2J6U A;  2JEI A;  4BWM A;  4OJ6 A;  2WGS A;  3R8B A;  2MBH A;  5KFS A;  3TAQ A;  3MP9 A;  5DB8 A;  4PYZ A;  3RMK C;  2NO5 A;  2D2Q A;  3DVN V;  5J0Q A;  5KFW A;  3B08 A;  3I3T B;  3DBL B;  4YQW A;  5L83 A;  1C9F A;  1GJZ A;  4NJ7 A;  4UB8 U;  4E71 A;  2K5P A;  5DB9 A;  4RQ1 A;  4KGR A;  3ZGZ A;  1SSN A;  1ESF A;  1QLN A;  1N6Z A;  7ICM A;  8ICW A;  1TFR A;  3K75 D;  4DCC A;  1J7B A;  4MFA A;  1ZQP A;  1KFD A;  4KLM A;  1L0Y B;  5DG9 A;  2JPH A;  3JPQ A;  2YLM A;  2DAF A;  3IFW B;  8ICJ A;  5KFN A;  1K50 A;  4QNL A;  4ANU A;  4ICV A;  2QMT A;  2JH7 A;  5D7G A;  2RQ5 A;  4KLD A;  3KFU F;  1JW9 D;  4W9J A;  4O3M A;  3QC8 B;  5D2M B;  1Z1B A;  4ED2 A;  4JV2 A;  5CRX A;  2JRZ A;  1WZ3 A;  1SL1 A;  2BCU A;  4F4Z A;  2JV3 A;  2MQJ A;  2A1J A;  2KO3 A;  2DBY A;  2K8B B;  2WDV B;  2ZTC A;  2FDR A;  1L3T A;  2JY6 A;  4WWM A;  5KTQ A;  2BR0 A;  2LYB A;  5J2K A;  2B76 B;  1ZQ1 C;  3RTV A;  3MGV A;  2Y5P A;  1X9X A;  4B9K A;  4Y2S A;  4MSM B;  4RNN A;  4GOC A;  3ZNZ B;  3IP4 B;  4US9 A;  3N20 C;  2JEG A;  5TSS A;  2WXK A;  3W5U B;  1IBX A;  1SIF A;  2ZIU A;  2ZNV C;  4W9F A;  2FLP A;  2M0N A;  2KAN A;  3BS5 A;  2BCS A;  2KZR A;  3MGH A;  4LZD A;  5KFR A;  1IG6 A;  4O5C A;  4YCX A;  3CMM B;  3PZ8 A;  2DX5 B;  2F8L A;  1Q8K A;  3PVL A;  1X40 A;  2HBM A;  4DL5 A;  2LEK A;  5BYR A;  3U8Z A;  1AW7 A;  4EYI B;  2WYQ A;  2OWO A;  1WMH A;  5E6J A;  1F77 A;  5TZV A;  4ZRJ A;  1CEZ A;  3IM1 A;  4M9J A;  1AAR A;  3DBH B;  5J2C A;  4HJK A;  5J0W A;  2AL3 A;  4PS7 A;  4HVB A;  2DNF A;  2F77 X;  1YX6 B;  4UAU A;  2XO7 A;  5ALD A;  2C60 A;  5KG5 A;  4BBN C;  5DDM A;  1V1P B;  4I6L B;  4TUP A;  1WGY A;  1R4M I;  5J8Y A;  4FHK A;  2RPV A;  5KFV A;  4PS8 A;  5JHA A;  2WLB A;  3ZD9 A;  2ASL A;  5CB1 A;  1PYW D;  4REZ A;  4QZC A;  1S0M A;  4GC6 A;  2LMC A;  2MA9 B;  3PV1 A;  1VR9 A;  3Q3J A;  4FJV B;  2Z7J A;  2MWS B;  5AKX A;  5CEH A;  3B0A A;  4JL9 A;  4XZ4 A;  5JHB A;  4ELV A;  1WWV A;  3WIM A;  3H7S A;  4OD0 A;  2JYT A;  7ICR A;  1FEZ A;  4LJP B;  2W82 A;  1QQR A;  3U7Z A;  4IC7 B;  5FR6 A;  4UAW A;  2L1A A;  2KDE B;  3F53 A;  5KG6 A;  4NNJ B;  1Q0W B;  1ZQF A;  3CF6 E;  4CHK A;  2IJ0 A;  3T8M A;  3C2L A;  3PT2 B;  4EOY A;  2K89 A;  2FLL A;  4QWD A;  2QB0 A;  3UI3 A;  1MC8 A;  3NVY A;  4PJ0 U;  1GNU A;  5FR3 A;  5DGA A;  5ALM A;  2XIC A;  3DHH C;  4YMM A;  4F4Y A;  3TEZ A;  3NRZ A;  3ICX A;  1QSL A;  1ZDX A;  1ZXH A;  3KW5 B;  1KLV A;  1WX7 A;  3BVM A;  4WJ3 B;  3DHG C;  3MFH A;  4KSL C;  4RQ3 A;  4UAY A;  2WB1 C;  4UW9 A;  4NL9 A;  4O3Q A;  1KTK A;  3QYP A;  1NK6 A;  2TSS A;  2IOF K;  1DOQ A;  1NBF C;  3NY5 A;  1WJU A;  2DLB A;  5AZF A;  1A0P A;  1ZQD A;  1F2R I;  4YTP B;  3SV4 A;  3PRZ A;  1FCC C;  2RGF A;  2K1F A;  3IBE A;  4RNO A;  4YXJ A;  2ZTE A;  2VKQ A;  4B9S A;  2DAJ A;  2MEK A;  2JWZ A;  3TAC B;  4DSI A;  2E8N A;  4YN4 A;  1J2M A;  4C4V A;  4PGQ A;  5KG1 A;  8ICL A;  1T5X D;  1JRP A;  2BQU A;  4YR0 A;  4B9T A;  4QZB A;  8ICR A;  1JWA D;  4BOS C;  4P6V F;  3JPS A;  3SI8 A;  1FNW A;  4UDU C;  4AQ7 A;  1S9F A;  2KAC A;  2KIW A;  1RXW A;  1VZ8 A;  3DBR B;  3RUL A;  1E7V A;  4A6Q A;  3UMG A;  5AIC A;  4DWF A;  9ICH A;  1ZQZ A;  1ZQE A;  1DXS A;  4WWP A;  1R4N I;  4F7Z A;  2GLE A;  2HMX A;  1ZQG A;  4EFO A;  5KFL A;  3M9M B;  2D6F C;  4I2F A;  2NR2 A;  2KTF A;  2V9H A;  2KVZ A;  3PRM B;  1RM6 C;  3K9P B;  4CF3 A;  3M95 A;  2CR5 A;  4IWO A;  1ISN A;  1GPX A;  1A70 A;  2IHN A;  2YMQ A;  5I4D A;  4CNQ A;  2HJ1 A;  4C00 A;  4I6N B;  3PX6 A;  4M01 A;  1VJK A;  3U52 E;  3KLS X;  3V61 A;  2DZJ A;  2J6S A;  4H2A A;  4F50 A;  1V5T A;  4DO9 A;  3MDC A;  2KTQ A;  3ZTC A;  3C5G A;  1Q3U A;  1E8Z A;  1T0Q C;  1QKZ A;  2ZCC A;  3SU8 X;  1L7O A;  1B0X A;  1FO4 A;  9ICE A;  1KLG D;  2BGF A;  2N9P C;  3ZW3 A;  2RDH A;  3N7P D;  1GUA B;  2QSD A;  2BS2 B;  2DHZ A;  3PR4 A;  4LVS A;  4YSX B;  5AEK B;  2XGQ A;  4IM3 A;  4B9M A;  1EU4 A;  5E6N A;  4RZR A;  2F1H A;  3NZS A;  2LXA A;  1L7N A;  3GZN B;  1AQ6 A;  4QZH A;  2WXP A;  1D9D A;  4K4I A;  4MM3 B;  3N1X C;  1N60 A;  4RQ8 A;  3Q8P B;  1S10 A;  3RNB C;  2BYV E;  4IWQ A;  3MDA A;  3WKC A;  2K8A A;  4EZJ A;  2Q4T A;  4W9L A;  3GIK A;  1RAX A;  5DPW A;  2OHF A;  3N97 B;  1C7Y A;  1L5U A;  4EEL A;  2JSV X;  2HHW A;  3I5J C;  2OOB B;  2F3N A;  5C3J B;  3BZK A;  2PIA A;  1B43 A;  5J2F A;  3VAW A;  2KDF B;  2ISO A;  2W9A A;  2NBV B;  1QIL A;  5KNI A;  4WJQ A;  1PFD A;  3AE6 B;  4P16 A;  4F2S A;  3ETL A;  1S1Q B;  4TV3 A;  2JZB A;  2KDB A;  2J6T A;  3A1Q A;  5J2R A;  2R18 A;  2JX5 A;  3SEB A;  3AQE A;  1LB2 B;  2UVU A;  2GBJ A;  1C1Y B;  5KFQ A;  4Z6E A;  5KFH A;  4IWP A;  3UPQ A;  3DWG C;  2ZXI A;  3M7D A;  5G5G A;  2IGH A;  1E5W A;  4RT3 A;  4HJG E;  3VTU A;  3QEB Z;  5J0Y A;  1RYS A;  5ALJ A;  4KLJ A;  4PHP A;  1TTN A;  2WX0 A;  4OZB A;  1UBQ A;  3KWL A;  3R66 C;  2VA8 A;  1PUT A;  4QZ8 A;  1KW4 A;  1XO3 A;  3ZDB A;  2G06 A;  4FE3 A;  5LXI B;  2PMZ C;  4KTQ A;  3JSV A;  3OJ4 B;  3RH4 A;  1G6J A;  3UGB B;  2EAN A;  1V49 A;  3AE9 B;  2LI5 A;  3L5K A;  5ALY A;  5EE0 A;  5J2D A;  1MPE A;  4OVZ A;  4C8K A;  3PSF A;  7ICJ A;  4QJF B;  3GDX A;  4Y2P A;  4IQV A;  2HOF A;  3PV8 A;  3KHR A;  4FA6 A;  3Q8S B;  3SAF A;  2W55 A;  3HJE A;  2KWV B;  3NZU A;  4CGZ A;  4KN4 A;  2IY1 B;  3G6X A;  4M8N A;  1SE2 A;  3L4P A;  4M9N A;  3E9S A;  5J18 A;  1X6J A;  4ED6 A;  4US8 A;  2CN1 A;  4M04 A;  2NBU A;  4WUR A;  5ALX A;  1LO5 D;  2HHV A;  4RQ0 A;  2M9N A;  4A3P A;  2L0F A;  4KIT B;  4MGI E;  1TY0 A;  3T79 A;  3MC0 B;  1WIA A;  4WIP A;  4B6W A;  3F2B A;  4MFF A;  1JN3 A;  2VH2 A;  1ET9 A;  2WU2 B;  3ETR A;  2D3A A;  1CI4 A;  3AE4 B;  2MBQ A;  4XDC A;  4N58 A;  4Y2R A;  2C5L C;  2CHW A;  4M00 A;  3EWA A;  2BPS A;  2O2V B;  1T7P A;  2NPT B;  2JXX A;  2NCN A;  1ZXI A;  8ICK A;  1U9L A;  2C2E A;  4WAA A;  4LTU A;  3BZC A;  1V85 A;  1T3N A;  4JIO U;  1MG8 A;  4TKN A;  3D2Q A;  3MHZ A;  1JXL A;  5CTR C;  4NQK E;  1QSS A;  2KVC A;  4LCD E;  1U4B A;  1BT0 A;  1BPE A;  1OW5 A;  3LDA A;  4EBC A;  4C4S A;  1WGD A;  1MVK A;  2BKE A;  1L3U A;  2L8J A;  4W9G A;  1FIQ A;  1E10 A;  3AEA B;  1N5W A;  5KG7 A;  4RU9 A;  4ICA A;  4P2H A;  4GGQ A;  2GBK A;  3IV6 A;  3H4B A;  2IMW P;  4KDL B;  3TI0 A;  4HAI A;  2E6X A;  4LNN A;  3OWE B;  4CE6 A;  2E8M A;  2KX0 A;  4J9Q A;  3TQ1 A;  1XNS A;  3BVZ A;  3VUW A;  1FCL A;  8ICC A;  2EQY A;  3H9D A;  2K3U A;  4A8E A;  1QTM A;  4RF0 A;  1F5S A;  3PRP B;  1GC7 A;  2QHO A;  3NG0 A;  4KLT A;  4Z6D A;  1OEY A;  1ZD5 A;  3FYH A;  1L6U A;  1Q1O A;  4R3D A;  1E8X A;  5C23 A;  4QWE A;  3C23 A;  1A6S A;  5KG2 A;  2WXI A;  2M17 A;  2KVS A;  2RHF A;  1J7C A;  3JW0 X;  2LGI A;  2IND C;  3S2A A;  4PHA A;  4EZL A;  4BX9 C;  2KN4 A;  1D5M C;  3DDH A;  1L4D B;  2D3G A;  1V38 A;  4OJL A;  2QAR B;  2R8H A;  2GOW A;  3VRA B;  1FRR A;  2DKZ A;  2NRZ A;  4AYB C;  4DFJ A;  1KL9 A;  1JRU A;  1D4B A;  2V4Q A;  3RR7 A;  5L9X A;  5DPT A;  1UH6 A;  4RQ6 A;  4B6J A;  4C8L A;  2PTL A;  1V80 A;  3V60 A;  5D3D A;  3K1R B;  2K9X A;  4EUT A;  3RNA C;  5D3I B;  1I4Q A;  1WGK A;  2J52 A;  2DQN B;  4LK0 M;  2KFZ A;  2A1J B;  4NL9 C;  1WXS A;  3H40 A;  5AI0 A;  3GS2 A;  5KL8 B;  5D4B A;  3BZD B;  5TR5 A;  2H3V A;  4UAZ A;  3AB5 A;  4B0E A;  2IYD B;  2EAO A;  4FO6 A;  4KLL A;  2V4L A;  4G3X B;  3IDW A;  5IIN A;  3QNM A;  3KZX A;  5IIJ A;  4UB5 A;  2NRV A;  9ICU A;  1IIP A;  2OYY A;  3M8R A;  3KD3 A;  4S17 A;  5J2A A;  2JH1 A;  3KUC B;  3M6Z A;  4F5P A;  4CF5 A;  1I42 A;  2N4F A;  2R8G A;  3N7R C;  1CZP A;  1X1M A;  2XCP A;  4ICU A;  2W43 A;  9ICA A;  4LDT B;  1WR1 A;  2C7N B;  2BCQ A;  3TSS A;  1WGG A;  4JWM A;  2DPI A;  2D3C A;  1V9J A;  2G4S A;  2INP E;  3D32 A;  3DBL I;  3LYY A;  4PL1 A;  2VZK D;  4YR2 A;  4M47 A;  3GV7 B;  4KLQ A;  2NMQ A;  2NTT A;  3Q3O C;  2AYO B;  5IAA C;  4DSJ A;  2ZVN A;  5AK5 A;  4N9F 4;  5IOI A;  3B2G A;  3MR3 A;  1WY8 A;  1HZ6 A;  3ZIM A;  4TUU A;  3B9J A;  5HML A;  1RRB A;  1MFW A;  4MAC A;  2XC9 A;  4IRD A;  3AE5 B;  3KKA C;  5F9N A;  7ICK A;  3BIN A;  2JQR B;  4USA A;  3AE7 B;  3PPA A;  2BT6 A;  3H8J A;  5KFF A;  3N1Z C;  3FAH A;  4UB3 A;  1TK5 A;  3THV A;  8ICQ A;  1SE3 A;  1FEH A;  2LJI A;  2WXM A;  3UIN B;  3QAR A;  1ZQW A;  3U26 A;  2DUY A;  1YJJ A;  3RR8 A;  3GFK B;  3UF8 A;  2G9H D;  2D11 A;  2J0J A;  2LM1 A;  4A3O A;  2WF5 A;  2G1E A;  3ZVV A;  3QU4 A;  1XT9 B;  3ECI A;  2G07 A;  4X5V A;  2DL0 A;  3PR5 B;  2O6K A;  3L3F X;  3ZD8 A;  4LJX A;  2AX5 A;  2VJ5 A;  2KTR A;  2XN9 C;  3Q8A A;  4JE3 B;  4RQN A;  4KZC A;  5KFK A;  3NTU A;  4MGK E;  3ISB A;  2IO3 B;  3GE8 C;  4WQO B;  2QB0 B;  2WHE A;  1DGS A;  3RB3 A;  1D9F A;  3DPD A;  3SD7 A;  1F52 A;  8ICI A;  4G50 A;  4S0R A;  4D2K A;  3NVW A;  3RAQ A;  2IA6 A;  3BDP A;  1KOT A;  8ICP A;  2XVT A;  3RJG A;  8ICS A;  1AWD A;  2KMA A;  4YSZ B;  4MFC A;  3VH3 B;  4ZRK A;  4R8U B;  4QWA A;  4UBC A;  1WCN A;  4R66 A;  2KJ9 A;  8ICE A;  2BVC A;  4UBB A;  4TUQ A;  3RJJ A;  3RYT A;  4NWI A;  1XLO A;  2V4I B;  4RM8 A;  5E6P A;  5AIA A;  4BVU C;  1GB4 A;  1IPG A;  4Y2J A;  1R7S A;  3Q8Q B;  1UNS A;  3V7J A;  3MFI A;  7ICE A;  5AHX A;  2ZXH A;  3C28 A;  5DLF A;  3OPX A;  3BQ2 A;  3O13 A;  3N28 A;  4EBD A;  2WXQ A;  3OJ3 A;  2W7P A;  4P4P A;  2G45 B;  5KG3 A;  2A19 A;  3ALR A;  2HDE A;  2RPQ A;  4KLI A;  3RBD A;  5J0T A;  5EE3 A;  4NJ8 A;  2RDJ A;  1WM2 A;  1T0R C;  3QUT A;  4LNK A;  5ALE A;  2EDU A;  5IIK A;  2G09 A;  2AH5 A;  4GDL A;  2CRX A;  4F93 B;  1K53 A;  1LFD A;  1OGW A;  1J0G A;  3CP8 A;  3MR6 A;  2N7E A;  4AP4 C;  2ZCB A;  3Q3F A;  4BXO A;  4F1S A;  1V2Y A;  5IKC M;  4LLG M;  5KFG A;  2N9X A;  2CJO A;  1SWV A;  2KV2 A;  1NEN B;  3ZRF A;  5JXV A;  3R2T A;  4JK1 A;  4FAD A;  1SV0 A;  4J9N A;  2YB1 A;  1XF5 L;  5GTI U;  1QQ6 A;  5JU5 A;  3MR2 A;  3I57 A;  2WTF A;  4C7Y A;  1WJ4 A;  2KOX A;  3L17 A;  2D5G A;  2KNJ A;  1SKS A;  1NDD A;  3E58 A;  1L0V B;  2KJR A;  3PW0 A;  5IP4 D;  5D6J B;  1TVA A;  1T3Q A;  3UMB A;  3MTN B;  3GV5 B;  5E79 U;  3ZQ4 A;  3KYC D;  3WKB A;  1MQ3 A;  4KIK A;  2W8L A;  2NV3 A;  1XD3 B;  3UQA A;  2IOH A;  4F5Q A;  1WUD A;  9ICK A;  9ICT A;  3ZO5 B;  3VTV A;  3WKE A;  4C8N A;  3VDZ A;  4KV2 A;  3DDC B;  3V6J A;  3T5L A;  5KFP A;  3KUZ A;  1ZYQ A;  5G2N A;  2FE8 A;  4EEW A;  1ENF A;  4O3R A;  2N7D A;  2BQ3 A;  1PK1 B;  5KT3 A;  4P1B C;  4F91 B;  2RP5 A;  1Q46 A;  2LHD A;  3P2B A;  4MEL A;  3QUC A;  1HUO A;  1TGZ B;  4KLU A;  1Y88 A;  2BWF A;  4HKZ E;  2L3Z A;  2HD5 B;  5CA7 A;  1D3Z A;  3H0M B;  3H7P A;  3JYU A;  3DBR I;  7ICT A;  2LUM A;  2WDQ B;  4DDG D;  2KQ7 A;  3KZI U;  1U49 A;  3RRG A;  4RGM A;  2L76 A;  4CDG A;  4XDD A;  4DS5 A;  2AEH A;  2F76 X;  4PZN A;  1SL2 A;  3W1S A;  2KNB A;  5KT5 A;  2F1J A;  1V8C A;  5D49 A;  1YOV B;  2KAJ A;  4DL7 A;  2JU6 X;  2K8C B;  4KX5 A;  2W54 A;  9ICR A;  3A1Q B;  4K7U A;  3Q8M A;  3I76 A;  4NLB A;  4DK5 A;  1WE6 A;  3MR5 A;  4RQ5 A;  2MRP A;  4ZRQ A;  2G0A A;  4C7Z A;  3BJY A;  1D8L A;  2FPM A;  3EUB 2;  3OGU A;  2HBJ A;  2KN7 A;  2KHW B;  2ZW1 A;  3NRW A;  3WK8 A;  2BDU A;  2JXJ A;  2MHJ A;  1ZD3 A;  2HBL A;  1QOF A;  3RN9 C;  3RFA A;  1XO1 A;  4DQI A;  3QAQ A;  1MA7 A;  1SB3 C;  1MI0 A;  3JSV B;  4A9A A;  2ZJD A;  3AQF A;  2JF5 A;  3ZJV A;  2BHN A;  3BQ7 A;  3APF A;  7ICH A;  3Q6B A;  1TE2 A;  4XC2 A;  1RQN A;  8ICT A;  5ALR A;  5DGB A;  3H7I A;  3I63 C;  4GC7 A;  2MA1 A;  3BWU D;  1KF6 B;  1VLB A;  1HE8 A;  5DQH A;  2VA3 A;  2VAN A;  3APC A;  4CF4 A;  8ICU A;  3AU5 A;  4MJS A;  2DKX A;  1P9D U;  2MP2 A;  2NRX A;  3PGE A;  3CRX A;  8ICF A;  2HW3 A;  5C1Z A;  3PHX B;  4EBE A;  2MJ3 A;  3LVW A;  1SE9 A;  3RJH A;  1RDF A;  5KFC A;  1SEB D;  1L7M A;  1J8C A;  5D94 A;  2HJ8 A;  3RPF C;  2BKF A;  3VRB B;  3IG8 A;  5KFX A;  2V4R A;  4DHZ B;  4L1B A;  3CIR B;  4ZYS A;  4IUM B;  1IP9 A;  2ZUB A;  2KD0 A;  1QOG A;  1YD8 U;  4ANW A;  4C0Z A;  2KJ5 A;  4ECY A;  5JH5 C;  3PX4 A;  5KAI U;  4ZOH C;  3EGR A;  1TKE A;  5TIS U;  4LNF A;  2IOF A;  4NM2 A;  4GXK A;  3TAD A;  3TUO A;  3R3M A;  1SIJ A;  5KFA A;  4RUA A;  3PHW B;  4GXB A;  4F8R A;  3AED B;  3T9L A;  1JX4 A;  2IGD A;  4LZG A;  3VTW A;  2LAS A;  2K39 A;  2JEJ A;  4DSE A;  1N56 A;  4DS4 A;  1ZQQ A;  1PZN A;  2KOB A;  4PGX A;  2DYM A;  3N3K B;  4WQM A;  4AUQ C;  2W3R A;  3RI7 C;  2ZIU B;  1N5X A;  5CX3 A;  2WF6 A;  2NYV A;  1WYG A;  5EDS A;  1ET6 A;  4RPY A;  2QB1 A;  1N61 A;  2QIL A;  2YN4 A;  1VJ5 A;  2CHX A;  2HHS A;  3P63 A;  4ECT A;  2YMM A;  2C28 A;  2N9L A;  1ZQK A;  3SAH A;  2HHQ A;  1FNU A;  2K60 A;  1LKY B;  3Q14 C;  5L1J A;  1JIH A;  3JPN A;  2MX2 A;  5DB6 A;  1OUQ A;  3W9C B;  3A0B U;  2AXT U;  1ZQU A;  2YTU A;  1I4H A;  1V5O A;  5DBC A;  1Q5W B;  1KH0 A;  2LPE A;  1WMH B;  2L52 A;  2PKO A;  3U30 A;  3OSN A;  4IM2 A;  4E74 A;  2B0C A;  3M8S A;  2NVU I;  4Y2T A;  4EE2 A;  3C0R B;  1QOA A;  2KXJ A;  5AKK A;  5HR6 A;  2N1V A;  2KKP A;  1EF5 A;  4YWG G;  1GAQ B;  1SZH A;  1RZT A;  4W9I A;  3MHS D;  2JXT A;  4RFB A;  1XCQ L;  3GIL A;  2QAR A;  2N1W A;  1N2X A;  1D8Y A;  2D07 B;  2F8K A;  2AWT A;  3MJ5 A;  1YQB A;  4M9G A;  1TKY A;  5ALO A;  3OAW A;  1MJD A;  3P4Q B;  1S0N A;  1RYJ A;  4XYC A;  5L1K A;  2LMR A;  4TUS A;  1ZQT A;  4HDQ A;  4YTM B;  1KSP A;  3NOB A;  1TK0 A;  4BKG A;  2CU1 A;  8ICG A;  3CSF A;  5ALF A;  1CRX A;  3TAN A;  1TS4 A;  4FN2 A;  4RGT A;  3KVF B;  3JPO A;  3VR8 B;  5J2G A;  5DQI A;  2CPR A;  4MT5 A;  3ISC A;  4FBT A;  1KLN A;  1MN8 A;  4P4O A;  1I4G A;  1FFV A;  4BFR A;  5G55 A;  3PO4 A;  2CU3 A;  3C1Y A;  4DQS A;  4DHZ E;  1ROE A;  2W9B B;  1ZQH A;  4HCP B;  4O3N A;  3V6C B;  1LXD A;  3UIP B;  2BF8 B;  2KSO A;  2IPK D;  4KKI A;  4WH4 A;  4TQ1 A;  5CHF A;  4DQR A;  5ALT A;  4KGT A;  4I28 A;  1SJH D;  3PO0 A;  1Z2M A;  3H0L B;  1PVQ A;  5J0P A;  2Y0S F;  1XS9 D;  1D6E C;  2AQ2 B;  2DZK A;  3ZLZ A;  4DHJ D;  2I6X A;  4DXA B;  1COO A;  3IG3 A;  3AE8 B;  5C2T B;  3VCB A;  5DPR A;  2LHT A;  3KKA A;  2LRW A;  4JLC A;  2YX8 A;  5AM1 A;  4XWT A;  3RUI B;  2K22 A;  4QZA A;  2N7J A;  3H6N A;  4PHD A;  1JCK B;  2GMI C;  4MF8 A;  1SXE A;  2W9N A;  1ZQM A;  3QU2 A;  3QK0 A;  1J19 A;  4GDK A;  1E7P B;  5KFZ A;  3V6H A;  1JWS D;  3QCA A;  1UWM A;  4IR9 A;  3VUY A;  5J0O A;  3PMN A;  1ZQA A;  3N7S C;  4DOB A;  2LZ6 A;  3PW2 A;  2AQ0 A;  3QWZ B;  3ZKJ C;  1ZQB A;  1KEJ A;  4ZHO A;  4K7W A;  3N9Y C;  2ONQ A;  2BYE A;  4MGY E;  1QH9 A;  4ED8 A;  4BDP A;  2UYZ B;  3J9C A;  4N6E B;  4QZ9 A;  9ICV A;  2WAQ C;  1NEK B;  7ICI A;  4FLH A;  2XY6 A;  3EW9 A;  4RQ2 A;  2LD9 A;  3EFU A;  3HK0 A;  1WWT A;  5IIO A;  3HX0 A;  5AM2 A;  4ECR A;  3AU4 A;  3T3N A;  4ECU A;  1I4R A;  4I2H A;  3B0Y A;  4G0N B;  1WR6 E;  2KFK B;  2P66 A;  4J9K A;  4B9V A;  3VH4 B;  1ZRN A;  4AYB F;  4ECQ A;  3OJS A;  5KFU A;  1ZET A;  4KSK C;  2WS3 B;  3K9O B;  5J0R A;  4XA5 A;  2LYH A;  3G6V A;  5HKH A;  1NJW A;  4G9B A;  2MCN B;  2KDM A;  4B0M A;  2FPL A;  1SL0 A;  1QLB B;  7ICF A;  3ZNH B;  3QE9 Y;  1LVH A;  3RJF A;  2W9C A;  9ICN A;  4GN1 A;  2GBM A;  3DCG A;  1ZKH A;  8ICM A;  1J2N A;  4GIV A;  2Y9U A;  3OHB A;  4OVV A;  1WXV A;  3PSI A;  3BVG A;  4P4M A;  2YY6 A;  4IRK A;  1YQ4 B;  2BKR B;  1WGH A;  2G4D B;  4YVZ A;  1LM8 B;  3AE3 B;  3ZDT A;  4QZE A;  4RQ7 A;  2GH1 A;  4RNM A;  5JZE B;  3Q8R B;  4ECX A;  1IGD A;  3DBS A;  3QJZ A;  2BQQ A;  4KX3 A;  2ZIX A;  4FS2 A;  2DWQ A;  2EKE C;  2J53 A;  2L0T A;  2GLS A;  2X8X X;  3B1L X;  4MEM A;  2ZIV A;  3F2D A;  1CMX B;  2SEB D;  3MBY A;  3LXF A;  1JUD A;  1Q3V A;  3ALB A;  4X57 B;  4IQT A;  2PPH A;  5ALS A;  5J2B A;  3UQ2 A;  2J4X A;  1SWW A;  1ZUD 2;  1P7E A;  2NBW B;  2GI9 A;  4Y2U A;  5CHW A;  1WRI A;  3HIL A;  1QQ7 A;  1H4R A;  1PQS A;  1K52 A;  2HHU A;  2FCQ A;  4CO7 A;  5L1L A;  4I2E A;  5A0L A;  2WF7 A;  1FPY A;  3SFD B;  4J9P A;  1UWX A;  3RJI A;  3V05 A;  5KFJ A;  2B21 A;  2ES6 A;  4J9O A;  5DLG A;  2C2D A;  4LJO B;  4NQL B;  3TEY A;  4QZG A;  2OCE A;  3VQI A;  4ELT A;  1KN5 A;  4F2R A;  3GZN I;  5BMG A;  1WM3 A;  3IHP C;  1PUZ A;  2ZPY A;  8ICN A;  4YD2 A;  1IM4 A;  1A77 A;  1JWM D;  1TAQ A;  1NKE A;  2Y9T A;  1P7F A;  2EMS A;  4XGA B;  3HM6 X;  1WXQ A;  3LYS A;  5AM5 A;  3Q8C A;  4DFD A;  4EEK A;  1WRD B;  1U4A A;  2KT7 A;  1RXV A;  5AI8 A;  2BPC A;  4I2C A;  4M0W B;  4RF1 A;  3C1Z A;  1XWL A;  2LI6 A;  5L1I A;  1B22 A;  4F5O A;  2N9E B;  3ZDC A;  2KJ6 A;  2N0S B;  2Y3A A;  1A5R A;  1K8R B;  3JPR A;  2FE9 A;  4UAS A;  1OQQ A;  3UMC A;  3PW4 A;  4J9S A;  1KM7 A;  2HHT A;  4RH6 A;  2ICI A;  4W9C A;  2WXJ A;  1PK3 A;  3RH6 A;  3SZ2 A;  5J0U A;  4QWC A;  2W03 A;  5KG4 A;  2W8K A;  7ICP A;  3NS8 A;  2RDI A;  5DG8 A;  1WG8 A;  1NK9 A;  5CHV C;  3PY8 A;  4P0P B;  4NAW B;  2OXO A;  5ALU A;  5IA7 A;  3KHG A;  2JMG A;  1MSW D;  4YG2 A;  4O0I A;  1JAL A;  2EAM A;  3C21 A;  2L7R A;  2Y0S C;  2IO2 B;  2LGS A;  1BPX A;  2FNJ B;  4C80 A;  3T5J A;  5AKL A;  3GII A;  3D6J A;  4NM1 A;  3J81 j;  1L6N A;  1NK8 A;  1QOB A;  3KBB A;  3RJK A;  4M8M A;  2CJN A;  4F72 A;  1TKD A;  2KQS A;  1C78 A;  4EEN A;  3A9K A;  2FJ6 A;  3NAS A;  4PGY A;  4QW8 A;  4BJQ A;  1ZRM A;  2ZIW B;  3WK4 A;  2AQ1 B;  4ARI A;  3VC8 A;  3PML A;  2KZM A;  1DOY A;  1V9P A;  3L54 A;  2O6V A;  4RGN A;  5AKJ A;  1F44 A;  3PW7 A;  1DOX A;  2NPT A;  2IO0 B;  4WJO A;  3ZXV A;  5L95 C;  3NVV A;  4TMA B;  1NYQ A;  1QF6 A;  1L5P A;  4IC9 A;  4R64 A;  1C4C A;  4LDT D;  3BY4 B;  4NY8 A;  5C0Y A;  4YD1 A;  1ZQI A;  3ZTD A;  4IL6 U;  3NJT A;  1JXE A;  4U6P A;  3JPP A;  2KLC A;  4DQQ A;  3CW2 C;  2ASQ A;  4LNO A;  2XI9 A;  2INN E;  2IGG A;  2EZX A;  1IUE A;  4F5R A;  1K1S A;  2KFN A;  1C77 A;  3FKY A;  4XRH A;  3KHL A;  2Y1J A;  4J9L A;  1X9M A;  1ZPS A;  3RNF C;  2W11 A;  4Y2V A;  3OSP A;  1XSN A;  2L5Y A;  1L3S A;  1PGA A;  5KFI A;  2WQY B;  3H8H A;  4TSS A;  3RFZ B;  1V81 A;  5ALN A;  2JRI B;  2MLB A;  3RJE A;  4CCH A;  1GC6 A;  2HSZ A;  2BPF A;  7ICG A;  9ICI A;  9ICJ A;  4BUG A;  1SF0 A;  4YFK A;  5ALK A;  9ICG A;  4PHE A;  2RR9 A;  3W5V B;  4DDI D;  4OJO A;  3V6E B;  4R63 A;  1UZX B;  1VD2 A;  1FXT B;  1ZQJ A;  3N32 A;  3TBL D;  3M9O B;  4P0Q B;  3R7Q A;  2XGP A;  4B95 A;  2JVC A;  4W9H A;  4HYK A;  4NLG A;  4P7I A;  2MP2 B;  7ICS A;  5FKA C;  2Y5B B;  1RYR A;  2KHV A;  1UD7 A;  1FFU A;  3H8M A;  2KK0 A;  3NGD A;  1WF9 A;  4I2B A;  1KBU A;  2RD0 A;  5HG2 A;  3ZDD A;  3GIJ A;  2C7M B;  3WKA A;  3DBH I;  3SFE B;  1NKB A;  2V9W A;  1ACC A;  2WHI A;  4OVU A;  2ALZ A;  3KYD D;  1JWB D;  2J42 A;  4FS1 A;  2E3T A;  1UEL A;  2AQ4 A;  3LDZ E;  2JYE A;  4RQ4 A;  2WU5 B;  4O3S A;  5J2J A;  5H2F U;  3PLV A;  4L23 A;  1F2R C;  4TQS A;  3Q69 A;  2KEY A;  4NLZ A;  3E2E A;  1SV4 A;  9ICS A;  1ZQV A;  3GU3 A;  1KRH A;  3ZUN A;  3OJU A;  1Z19 A;  1RFK A;  1U48 A;  4WAF A;  1OXJ A;  4TQR A;  1D5Z C;  4DFM A;  4ARC A;  5CHG A;  2ISP A;  2LRU A;  2JR5 A;  2MAX A;  4M6W A;  3SAG A;  1RYU A;  1N48 A;  1HTO A;  3NHE B;  3A9J B;  4N59 A;  4ZYN A;  4FZN A;  5DG7 A;  1P3Q U;  9ICP A;  1TS3 A;  3ZRC A;  1S76 D;  2EAP A;  2BW2 A;  4B9L A;  2PXI A;  4PT5 A;  2WF8 A;  1TJE A;  2ACZ B;  3L13 A;  4BBN F;  4DSF A;  1KDH A;  3V62 A;  1OQR A;  3RBE A;  2WDR B;  2H3F A;  3TJP A;  2KFJ A;  2KZ3 A;  1D8B A;  4NZL B;  1X9S A;  1TAU A;  2M19 A;  2GOL A;  3M63 B;  3BK1 A;  4O3P A;  4AWJ A;  4WWN A;  3MC1 A;  4QWB A;  4GB9 A;  3Q3N C;  1PDX A;  3SEI A;  1I35 A;  2KYW A;  3D2N A;  2WB1 F;  1S0V A;  1EO6 A;  4AJW A;  1LKY A;  3FC4 A;  4IQU A;  2BZF A;  1NYR A;  3NS1 A;  5B66 U;  2F44 A;  2W04 A;  5GTH U;  1ZQO A;  5KT2 A;  4UAV A;  2L83 A;  3CYM A;  1HZ5 A;  5J2H A;  3HHM A;  3PSE B;  1XLP A;  1BUI C;  2KJH B;  4UAT A;  5J0S A;  1HEK A;  4HWI B;  3N4M B;  4TUR A;  1EWC A;  2HI0 A;  1BPY A;  2EMT A;  2LXC A;  2MBB B;  3EFC A;  5AUI A;  3V6K A;  1WX9 A;  2VRR B;  8ICZ A;  3GOE A;  2UWQ A;  3DVG X;  5ALH A;  4W9E A;  1JMS A;  3QXG A;  3PSP A;  1C76 A;  5AZH A;  4O9M A;  1WE7 A;  5HP4 A;  4IQW A;  1L6V A;  2ZG6 A;  1WXM A;  3OG5 A;  4QIW C;  4BZA A;  4KKJ A;  2KKC A;  1FMA D;  2J0M A;  3L08 A;  4HEA 1;  4DFK A;  3BYY B;  4HXD A;  4YSY B;  2IY0 B;  1QCK A;  3RNE C;  5BMH A;  4C8M A;  5E6O A;  2V3S A;  3HWT A;  4YR3 A;  1I7H A;  4DWI A;  1B9R A;  1L3V A;  1FRD A;  2E8P A;  1PVP A;  4OJ5 A;  2Z8L A;  1XU4 A;  2KTR B;  4QAY A;  3SMV A; 
#chains in the Genus database with same CATH homology
 1PGB A;  4L1B A;  3CIR B;  4ZYS A;  2BYT A;  1XCT L;  2K0P A;  2BB6 A;  1EU4 A;  1QOG A;  3HVD A;  1AN8 A;  1V1O A;  4ZOH C;  3EGR A;  1TKE A;  1TS5 A;  2WXP A;  1JQ4 A;  4MM3 B;  3NUH B;  1Q10 A;  2FBW B;  1N60 A;  3TUO A;  1SIJ A;  1HXY D;  3ZJU A;  2KMM A;  5HI1 A;  1GB1 A;  3AED B;  2OHF A;  3U2S C;  2IGD A;  1J7A A;  2JSV X;  4AS1 A;  5C3J B;  2I38 A;  2DYM A;  4WQM A;  2PIA A;  2HTM E;  5MPO A;  4XWW A;  1YQ3 B;  2W3R A;  4C56 C;  3ZYY X;  5LNK 1;  1N5X A;  1QIL A;  1WYG A;  1ET6 A;  1PFD A;  2IDY A;  3AE6 B;  4GDK B;  4P16 A;  3U4E G;  1N61 A;  1GOZ A;  2QIL A;  1CK1 A;  2JX5 A;  3P63 A;  3SEB A;  1VZ7 A;  3HUI A;  2N9L A;  3DWG C;  1FNU A;  4HKQ A;  4GDL B;  4IKG A;  4RGO S;  5G5G A;  2IGH A;  2LHE A;  2PMV A;  4HJG E;  1FXI A;  3W9C B;  1DOI A;  1I4H A;  2PKO A;  1KH0 A;  2L52 A;  2X38 A;  4OZB A;  3KWL A;  4OHJ A;  1KFY B;  5HHD G;  3FIL B;  1PUT A;  3LB8 C;  4A90 A;  1IGC A;  4EE2 A;  1XO3 A;  4J3O D;  1OFF A;  1QOA A;  2BS4 B;  1I4P A;  3EA6 A;  4NJC A;  4YWG G;  1GAQ B;  3AEG B;  2WP9 B;  3AE9 B;  3P1M A;  4A55 A;  1L4Z B;  2JXT A;  4RFB A;  1XCQ L;  1MPE A;  4OVZ A;  5EE0 A;  5H92 C;  4TQ0 A;  4DQO C;  1CJE A;  2GB1 A;  2EKI A;  1N62 A;  3MJ5 A;  1TKY A;  3P4Q B;  1RYJ A;  2W55 A;  5EE9 A;  2M56 B;  4JWS C;  4YTM B;  1SE2 A;  3L4P A;  1SBB B;  3E9S A;  3ZJT A;  3AM9 A;  4US8 A;  1AYF A;  3NVZ A;  1TS4 A;  4NAM A;  1T6B X;  4RGT A;  1LO5 D;  1ZE3 D;  1SXT A;  4WUR A;  3VR8 B;  1CQV A;  1VZ6 A;  4MT5 A;  3AN1 A;  1TS2 A;  1PGX A;  2YEP F;  1FD6 A;  1I4G A;  3P4R B;  1TY0 A;  1FFV A;  2OED A;  1HQR D;  3MC0 B;  4WIP A;  3KQ4 A;  2CU3 A;  2BB5 A;  4MH8 A;  2PW9 A;  1ET9 A;  1ROE A;  2VZK B;  4Q2J A;  3E56 A;  2WU2 B;  3ETR A;  1EM7 A;  1JWU D;  4A8X C;  3AE4 B;  4XDC A;  1HA5 A;  2IPK D;  4N58 A;  4KKI A;  4WH4 A;  4TQ1 A;  3WCQ A;  2PVG C;  4CQN A;  4RNA A;  4KGT A;  1ZXI A;  1SJH D;  3AV8 A;  3PO0 A;  4LTU A;  3W2D A;  1D6E C;  3CWI A;  4JX1 C;  3HRD D;  2AQ2 B;  4GLS C;  3AE8 B;  3MHZ A;  5C2T B;  1TY2 A;  1NVI D;  1IBX B;  1V97 A;  3AE1 B;  2GRI A;  5FK9 C;  4XWT A;  2K22 A;  3AEB B;  1VDV A;  2N7J A;  4ZHP A;  1JCK B;  2WXO A;  5HFY A;  1MVK A;  1FIQ A;  1E7P B;  1E10 A;  1JWS D;  3AEA B;  1N5W A;  1UWM A;  1KLU D;  4FXC A;  3Q8E A;  2E6X A;  2AQ3 B;  3OWE B;  1N63 A;  2FUG 1;  4M0W A;  1YNT E;  4HRO A;  4ZHO A;  3N9Y C;  1TKG A;  2ONQ A;  3BVZ A;  1FCL A;  2BS3 B;  2K3U A;  4OZC A;  2W3S A;  4RF0 A;  3J9C A;  4N6E B;  2MH7 A;  1NEK B;  3PZ7 A;  1L6U A;  2PLP A;  4R3D A;  1JML A;  1WWT A;  1M4V A;  2WXI A;  3BII D;  1J7C A;  1STE A;  3T3N A;  3AEE B;  1I4R A;  2LGI A;  2SAK A;  2BBC A;  2KN4 A;  1D5M C;  3AH7 A;  4ITK A;  4JPS A;  1L4D B;  1TYG B;  1SE4 A;  3IT6 B;  4RCO A;  3T3O A;  2WS3 B;  3VRA B;  1FRR A;  1WSP A;  2WXH A;  3GP7 A;  4KGS A;  2KDM A;  4B0M A;  1D4B A;  1QLB B;  2BTE A;  4ZRP A;  3ABV B;  4O1N A;  1ZDV A;  5GXG B;  1ZP0 B;  2PTL A;  5EE1 A;  3BVG A;  5D3D A;  1YQ4 B;  1L0X B;  2K9X A;  3HVZ A;  1XLQ A;  2V3N A;  5D3I B;  1I4Q A;  1WGK A;  3AE3 B;  2J52 A;  1ZOY B;  4LK0 M;  5H8Y E;  1IGD A;  2WNM A;  5BYS A;  1VRA B;  2YEP B;  2M0A A;  4XE0 A;  2DWQ A;  2J53 A;  3GS2 A;  3BZD B;  2SEB D;  1UUP A;  3AB5 A;  4B0E A;  3LXF A;  2V0G A;  3AEF B;  1XLN A;  3C8Y A;  3AMZ A;  1MHX A;  1BML C;  2J4X A;  4IDI A;  1ZUD 2;  2N9K A;  1P7E A;  2GI9 A;  3IAS 1;  1WRI A;  1K52 A;  4OW0 A;  4YTN B;  1C79 A;  1CZP A;  3SFD B;  1Y56 A;  1UWX A;  3NZ3 A;  2EEL A;  3V05 A;  1YN3 A;  1C4P A;  3TSS A;  4DXF A;  3VR9 B;  3TEY A;  3LYY A;  4L2Y A;  2INP E;  3VQI A;  5BMG A;  1QT9 A;  1K51 A;  2VZK D;  2NMQ A;  3IAM 1;  4IOI E;  2NTT A;  3IXS A;  1YMH E;  1JWM D;  3TEW A;  3Q8F A;  2QJL A;  1P7F A;  2WXG A;  4JWU C;  3B2G A;  1WXQ A;  2MJE A;  1B1Z A;  3Q8C A;  1HZ6 A;  2WXR A;  3B9J A;  3SR6 A;  4MAC A;  4RF1 A;  3AE5 B;  3R8B A;  1FM0 D;  3MP9 A;  2LFI A;  2N0S B;  2Y3A A;  2JQR B;  2NTS A;  2QEJ C;  1OQQ A;  4USA A;  3AE7 B;  2BT6 A;  4RH6 A;  1F0Z A;  2ICI A;  1E0Z A;  2WXJ A;  3FAH A;  2LJI A;  1C9F A;  1SE3 A;  1FEH A;  1YJI A;  2WXM A;  2K5P A;  1YJJ A;  4KGR A;  3ZGZ A;  1SSN A;  5G5H A;  2G9H D;  1ESF A;  4NAW B;  1E6E B;  1J7B A;  2H88 B;  2G1E A;  2KWD A;  1JAL A;  1L0Y B;  2XN9 C;  4C80 A;  3GB1 A;  4JE3 B;  2AX5 A;  3Q8A A;  1K50 A;  1QOB A;  2QMT A;  5D7G A;  1JW9 D;  2CJN A;  2WXN A;  1C78 A;  1SJE D;  4D2K A;  3NVW A;  4YT0 B;  1C4A A;  1AWD A;  3Q8B A;  4YSZ B;  2AQ1 B;  2DBY A;  2WDV B;  4ARI A;  2ZW0 A;  1DOY A;  4WWM A;  2PVO D;  2B76 B;  4RGN A;  1DOX A;  1QF6 A;  3NVV A;  4TMA B;  1NYQ A;  2Y5P A;  1L5P A;  1XLO A;  1MHH E;  2R61 A;  2V4I B;  3P4S B;  1GB4 A;  1DYQ A;  5T8I A;  4HRS A;  1C4C A;  4US9 A;  1R7S A;  1UNS A;  2RMM A;  5TSS A;  2WXK A;  3W5U B;  3TEX A;  1IBX A;  1JRO A;  3O13 A;  2WXQ A;  2INN E;  2IGG A;  2HDE A;  1IUE A;  1C77 A;  5EE3 A;  1ZPS A;  1RWS A;  1PGA A;  2WQY B;  3H8H A;  3PZ8 A;  4TSS A;  3RFZ B;  1K53 A;  1YN5 A;  2LEK A;  5BYR A;  1AW7 A;  2H89 B;  4KX6 B;  1I4X A;  5AUK A;  4LLG M;  1SF0 A;  1F77 A;  1UGJ A;  5E6J A;  2CJO A;  2V3P A;  1NEN B;  1BXT A;  3W5V B;  5JXV A;  3R2T A;  5BYQ A;  1XF5 L;  2JWU A;  1HEZ E;  3I57 A;  4C7Y A;  2RDG A;  1V1P B;  2D5G A;  5FKA C;  1FFU A;  1L0V B;  2RPV A;  2I2Y A;  2WLB A;  3BYT B;  5HG2 A;  1PYW D;  1T3Q A;  4REZ A;  2WXF A;  3SFE B;  3B2F A;  3ZQ4 A;  2LMC A;  3AEC B;  1ACC A;  2ON8 A;  1VR9 A;  1JWB D;  2J42 A;  2E3T A;  4OZA A;  2JYT A;  2JYE A;  2WU5 B;  4YXD B;  2W82 A;  1QQR A;  3U7Z A;  4L23 A;  1F2R C;  3Q69 A;  2L1A A;  2WXL A;  1KRH A;  1NI3 A;  1RFK A;  1XEE A;  4WAF A;  3V3X A;  1D5Z C;  2IJ0 A;  2FE8 A;  4ARC A;  2JZP A;  3IT4 B;  1ENF A;  3URY A;  2DYO A;  3UI3 A;  5FR3 A;  2L32 A;  3NVY A;  2LHD A;  3TEZ A;  3NRZ A;  1EWY C;  1ZXH A;  1ZDX A;  4HKZ E;  4N59 A;  3BVM A;  2LUM A;  1TS3 A;  2WDQ B;  1KTK A;  2BW2 A;  4PT5 A;  2TSS A;  1TJE A;  2ACZ B;  3KWV A;  2Q5W D;  4RGM A;  2DLB A;  1FNV A;  2KQ4 X;  1D5X C;  1OQR A;  4XDD A;  1F2R I;  4YTP B;  1EU3 A;  2WDR B;  1YN4 A;  1FCC C;  3W1S A;  2XNA C;  4NZL B;  2M19 A;  1V8C A;  2KAJ A;  2JU6 X;  3BK1 A;  2W54 A;  2MEK A;  1PDX A;  2Y5C A;  1T5X D;  4ZRQ A;  1JRP A;  3BK2 A;  1NYR A;  3FC4 A;  3NS1 A;  4C7Z A;  1FXA A;  1JWA D;  3EUB 2;  4P6V F;  1FNW A;  4UDU C;  4AQ7 A;  2KAC A;  1VZ8 A;  2ZW1 A;  2L83 A;  5BMI A;  4A6Q A;  1HZ5 A;  3FIL A;  1QOF A;  1XLP A;  3DWM A;  1BUI C;  3I9V 1;  1E9M A;  1SB3 C;  1MI0 A;  4A9A A;  1EWC A;  3ZJV A;  5AUI A;  3AE2 B;  1RM6 C;  3BWU D;  1GPX A;  1A70 A;  1C76 A;  1KF6 B;  1VLB A;  5I4D A;  1TZO A;  1L6V A;  3MFG A;  4DXG A;  1VJK A;  3U52 E;  3KLS X;  4H2A A;  1V1P A;  4KKJ A;  2MJD A;  1FMA D;  1XXG A;  4HEA 1;  3P4P B;  3BYY B;  1DGJ A;  4YSY B;  1QKZ A;  2MJ3 A;  5BMH A;  1FO4 A;  1KLG D;  1SEB D;  1I7H A;  2RDH A;  1B9R A;  1FRD A;  2QSD A;  3RPF C;  2QIE B;  2BS2 B;  2Z8L A;  3VRB B;  4YSX B;  3P42 A;  3R2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...