1N62A

Crystal structure of the mo,cu-co dehydrogenase (codh), n-butylisocyanide-bound state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
total genus 51
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n62A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n62A01
1E10A 3SFDB 1GAQB 1J7BA 3P4SB 3VRAB 2WS3B 1FM0D 1NENB 3AMZA 1QOGA 1N61A 1RM6C 2B76B 2KAJA 3W5UB 3EUB2 1L6VA 3PO0A 1I7HA 5EE3A 2BS2B 1JROA 3B2FA 1TKYA 2MH7A 3AEFB 1A70A 1FO4A 2AX5A 4US8A 3W9CB 2M19A 3AN1A 3ZYYX 2BT6A 1J7CA 5AUKA 2WDRB 4C7ZA 3DWMA 4WQMA 2H88B 4KX6B 2W3SA 2K5PA 1FXAA 2N0SB 2K22A 1DOYA 2WLBA 4P6VF 3NVWA 1QT9A 1CJEA 3FC4A 1TYGB 2JX5A 2E3TA 2PVGC 1VJKA 2CJOA 2BS4B 1L0VB 2MJEA 3B9JA 1YQ3B 2Y5CA 1SF0A 1WYGA 1YJJA 2EKIA 4YTMB 3HRDD 1NI3A 3HUIA 1OQQA 3P4QB 2MJ3A 2M56B 1KF6B 1OFFA 1RYJA 1ZUD2 3SR6A 2FBWB 3LB8C 3KWLA 4US9A 5EE0A 1N62A 1T3QA 1DOXA 1YQ4B 5C3JB 4LTUA 1FRDA 3AH7A 1FRRA 1OQRA 1UWMA 2CJNA 2PVOD 1L6UA 3WCQA 1FFVA 4C80A 1SIJA 1JALA 5G5HA 1IUEA 1RWSA 2DWQA 2PKOA 3AE7B 3AE9B 1VDVA 1TKEA 1N5WA 3W5VB 4N58A 2H89B 1ZOYB 3AE8B 1J7AA 3DWGC 1F0ZA 1JQ4A 2WU5B 3AE4B 4YSYB 4YTNB 5H8YE 1XLNA 2LEKA 4YSXB 3NS1A 2JQRB 3NVVA 3VRBB 4ZOHC 1ROEA 1V97A 2L83A 5AUIA 3CWIA 2K9XA 3AE3B 4A9AA 4N59A 5EE9A 3RPFC 2W54A 3VR9B 3CIRB 5G5GA 2WQYB 3AE6B 5GXGB 1FMAD 3AV8A 3NVZA 2L52A 2WDQB 4ITKA 4JX1C 1YJIA 3AM9A 1XLOA 1ZP0B 1B9RA 3AEGB 2HTME 4USAA 2CU3A 2W55A 1PUTA 3AEBB 1KRHA 2MJDA 2Q5WD 4C7YA 1QOAA 1SB3C 1WGKA 3AECB 3L4PA 2WP9B 3BIID 3FAHA 2BS3B 3AEAB 1XO3A 1N60A 3AE5B 1QOBA 3B2GA 1DGJA 3LXFA 2DBYA 1NEKB 4FXCA 4JWSC 1XLPA 1FIQA 4HROA 1PDXA 1N63A 4HRSA 4WWMA 1AWDA 2WDVB 1GPXA 1DOIA 1TJEA 1FXIA 2KMMA 1WWTA 5EE1A 4IDIA 2WU2B 1E6EB 3P63A 5C2TB 4YXDB 3SFEB 2ACZB 3P1MA 4ZHOA 1E0ZA 1NYQA 1JWAD 1R7SA 3AE1B 4N6EB 2PIAA 1ZXIA 3ETRA 1TKGA 1QOFA 3AEEB 4JWUC 3AB5A 3AE2B 1E7PB 3VR8B 1JWBD 1WRIA 1PFDA 1QF6A 3AEDB 3NVYA 1RFKA 1WXQA 1KFYB 1NYRA 1N5XA 5MPOA 5H92C 1NVID 1EWYC 1FFUA 1QLBB 2G1EA 2OHFA 1VLBA 3ABVB 1CZPA 2QJLA 1AYFA 1E9MA 1XLQA 2W3RA 1V8CA 3P4RB 3P4PB 4YT0B 4YTPB 1JRPA 4ZHPA 4YSZB 2QIEB 1L5PA 3NRZA 1JW9D 3HVZA
chains in the Genus database with same CATH superfamily
1E10A 1UT5A 5DQGA 2GB1A 5J18A 3EZ5A 1XT9B 2WXLA 1A77A 4DL3A 2EZZA 2F2AB 2QARB 4RPZA 1V9PA 3WK8A 2L76A 4DWIA 4TMAB 8ICEA 2JR5A 2IY1B 2NPTA 5ALJA 3RRGA 5AZFA 4K4HA 1MC8A 3MDAA 3V6CB 4KX6B 4W9JA 1ZQFA 3NVWA 7ICVA 1S3SG 1BPXA 4PL2A 2D3CA 2DYBA 3B9JA 3D6JA 2BYEA 3KYDD 2K4HA 4H2AA 4LLGM 4KLOA 2Y5CA 2WB1C 2JF5A 4LJPB 4IM3A 2MJ3A 1C9FA 4F4XA 1L0YB 1LGRA 4I6PA 1NZBA 2FBWB 1X9WA 3MC0B 2L0FA 4PS3A 9ICKA 2UVVA 3EWAA 2N9EB 2I2YA 3AH7A 1NK8A 3TFSA 5AK5A 2WXJA 2CJNA 3K9OB 1SIJA 1WXAA 3BQ0A 3SV3A 3RAXA 1J7AA 3GIMA 2DGZA 2E8NA 3QX7A 3UXNA 4YSYB 1ZQWA 4XWWA 2FCQA 2WXNA 1EXNA 2BGFA 3N9YC 4Y2UA 4RNAA 5CRXA 1XNSA 2HHTA 4O3PA 2BCSA 2LHDA 1GJZA 4KDIC 4I2HA 1P0RA 5G5GA 2LHTA 2KANA 3RNBC 3NVZA 1L4DB 2R8HA 4NLBA 2DX5B 4EYHB 5JRTA 3RJKA 1KRHA 2GBNA 2MWSB 3TJPA 4F2SA 2JSVX 5GMVA 3UIOB 4ZYSA 4HPMB 1QOAA 1SB3C 3DEEA 4PHEA 5FR6A 4QZFA 3AEAB 5KL8B 2KT7A 4W9IA 5AZHA 1SKWA 2HOIA 2MBHA 4XWTA 3MR2A 4C4VA 1BNOA 4OJLA 1WWUA 4WWMA 2K4PA 2FMPA 2WX0A 1DOIA 4W9KA 1ZQNA 1ZQSA 1TFRA 2FMSA 2FE9A 4RNMA 4O3RA 2WYQA 2N1RA 4RQ8A 3PNCA 3VFKA 4AQ7A 9ICXA 4XDDA 3PR4A 2C2EA 3AB5A 2MRLA 3RB6A 1KSPA 2KLCA 4P2HA 4B0MA 5D94A 3QYPA 4IKGA 4KZ0A 2NRVA 2NRZA 1CZPA 5DG7A 1E9MA 1TS4A 4OZAA 5EDSA 3LWLA 4ANUA 3GDXA 5E6JA 4GOCA 1T0YA 1YOVB 5ALKA 5KFJA 2VJ5A 1C3TA 4HLEA 2BPGA 7ICHA 1Q1OA 4JV2A 1ISNA 1Q46A 3GE8C 2F1IA 1ED1A 4C56C 8ICBA 4I2FA 4AOFA 1JWUD 2SEBD 1UHUA 2KJRA 3MFGA 3H4BA 4ECUA 2I1KA 5KG6A 1EF5A 2NTSA 1ZQQA 3Q3FA 3ZD8A 4ED8A 2QSDA 5KFVA 4YXJA 2HHQA 3ZYYX 1ZQZA 2F1JA 4R64A 3M9MB 2D3GA 1TE2A 2KK0A 2BPFA 1K53A 5L1IA 4DF8A 2R18A 2ZIXB 5DB9A 2PPHA 1J8CA 2E3TA 4AYBF 2IOFK 1S0MA 1LVHA 3H9DA 2V4LA 3MABA 3RTVA 4MFCA 3RNAC 1S0VA 3OHBA 5JUMA 3F2CA 5AKJA 1OUQA 4IR1A 2LVOA 4MFAA 4BZAA 4REZA 3IXSA 2ZZPB 4F4KA 4C8OA 1YNTE 1RZTA 3H0LB 4IL6U 3QNMA 2VJ4A 1L8OA 2F1HA 5BOMA 2JPHA 1LKYA 4YD1A 2E8OA 4B9LA 3N30A 2WF8A 1L6UA 1WY8A 4NY0A 4C80A 4UB5A 2MLBA 4KZCA 2O6VB 3S2AA 2XBBC 4TURA 3OSPA 1F2RC 3I63C 4RF0A 2IBIB 1ZQIA 1Q10A 3N20C 1WE6A 2D10A 4UAYA 3R8BA 3M6KA 2IO3B 3NGDA 4RQ1A 2D8CA 2A19A 4GDLA 5GXGB 3WAOA 3GOEA 1WSPA 1U47A 1YJIA 5HFYA 1B9RA 2JRZA 4USAA 2C7HA 2KQ4X 5IIOA 1YZ6A 1WMHB 2ODGA 4XE0A 2LGDA 4ED6A 3V6KA 5E6OA 3CRXA 2HJ8A 2IGDA 4HXDA 1ECWA 2RPQA 1GNUA 4GFJA 3N1XC 2DL0A 4F92B 1KFSA 5TISU 1I4PA 4MJSA 9ICOA 3GFKB 2KMMA 1WWTA 1TK5A 4XUSA 2W03A 3M6ZA 2LFIA 3TACB 2N1WA 3BDPA 2BF8B 3WIMA 4ELUA 1STEA 1PYWD 1OEYA 4NQKE 2FI1A 3IT4B 1F2RI 5BYRA 2ATLA 3SAFA 3VH4B 3HP6A 4GXIA 3ZDAA 2MP2A 4QZBA 4JV1A 2I5HA 1L7NA 2I6XA 2ZJAA 3BQTA 5KFBA 1XC9A 2ISOA 1OQYA 4TUUA 3P42A 3O13A 2YEPB 3P4PB 3L17A 3ZIMA 3JYUA 4QAYA 3ZDTA 3OHAA 2VIXA 2WAQC 4M9HA 3ML8A 4Y2JA 2QIEB 2KDBA 4ELTA 1J7BA 2RPVA 3IP4B 4YG2A 1PK3A 3RT3B 1KQQA 4FLHA 3KH0A 3B08A 1QKZA 1TZ1A 1RRBA 2V3SA 2QDFA 2D07B 2PMVA 2BCVA 1U4AA 4NQLB 3UGBB 1MN8A 4BKTA 4EEWA 1HXYD 1Y88A 2HOFA 5DB8A 3ALBA 4KN7A 4GXKA 2OEHA 4C7ZA 4IQWA 1C4CA 7ICOA 2ZJDA 3IG8A 1NK4A 3JPQA 4QIWF 1C4AA 2I1JA 4CF4A 8ICIA 4RQ7A 4KGSA 1XCTL 4TKNA 2MJEA 2Q0ZX 3ZI4A 4A8EA 3NJTA 2ZNVB 4OVZA 4RQ3A 2V9WA 8ICTA 4PHPA 2C7MB 2EKIA 3A4SC 2LGSA 3PSPA 4FHJA 2WX1A 1L3SA 1RYJA 1SXDA 2YB4A 4UBBA 2JZPA 3URYA 5LNK1 4O3MA 2EELA 4RGTA 4I2EA 3APCA 1JWMD 3J9CA 5C3JB 2HVIA 4MGYE 2DKXA 1OQRA 1UWMA 2W82A 8ICVA 3TQ1A 2GI9A 3AEBB 4J3OD 4EBEA 4BWMA 5IA7A 2BPCA 9ICWA 2ZTCA 2R2QA 2ES6A 1GC6A 2M0AA 4GU2A 1ZQJA 5KFQA 1WFYA 5KL1B 4DL7A 4M9NA 3H8HA 8ICNA 1D3ZA 3AL0B 3BZKA 3GU3A 5IIMA 4I2CA 3C29A 3R7RA 4RF1A 3ZRFA 2WXQA 3ZQ4A 1KM7A 4QZIA 2WQYB 2O6VD 4KKJA 4YWGG 2HHVA 3H8WA 3UI3A 3AV8A 2M1MA 1D5XC 2XK5B 2BYFA 3F2DA 2ZW1A 1WF9A 1WXMA 4HJGE 2YEPF 2INNE 3PZ8A 3VDZA 2KXJA 4KITB 3QUQA 3GQCA 3SV4A 1KTKA 2D2QA 4DSKA 2D3DA 2KWUB 1VJ5A 3KYCD 5DGAA 5KG1A 4W9EA 3NZ3A 4P0QA 4B9VA 2MBBB 3AU4A 1ZQMA 3OPXA 1M94A 1XLPA 2GBMA 3KUDB 3WK7A 3M8SA 4B9KA 1UA1A 2LZ6A 2WFAA 5EE1A 5G2NA 1UT8A 4IDIA 4UDUC 4DHJB 1N48A 4HVBA 3K4GA 4M9JA 3EW9A 2WDTB 1Z00B 2D3BA 4C4RA 3PGEA 4NWIA 3PX0A 5J0OA 1UBIA 4M6WB 1WXQA 2EH9A 1YX6B 2AQ4A 2L1AA 2HBJA 1QLNA 2G1EA 3H8SA 1CRXA 4F5NA 1K5OA 2IO0B 2WF9A 2K6QA 5AI5A 4RT2A 4MF2A 1S77D 2N7JA 2ZPYA 1A0PA 5BYQA 2B0CA 4M04A 4QWAA 3AMZA 2W9BB 3C19A 2WF7A 4RPXA 2LVPA 2CRXA 5EE3A 7ICSA 5L1JA 2RSUA 2JEJA 3M7DA 2M19A 3R2TA 1WE7A 1QZEA 3LK9A 1Q3UA 1HTOA 2QMTA 2NBUA 4LNKA 4ECQA 2C2DA 2K25A 4II2B 2MBEA 2K8BA 1ZJNA 5KTQA 1KLNA 4R8UA 3PTFC 2N7EA 3IRUA 5IKCM 1RPLA 1WUDA 2XO7A 5KG7A 1FEHA 2LMCA 1YJJA 1V86A 1NI3A 3C1ZA 1KLGD 2MEKA 1Z4OA 3TEYA 1GC7A 3LVVA 4KLLA 4US9A 4F93B 2FLLA 5ALFA 4BFRA 4XA5A 4A3OA 1RFAA 3RB4A 1FFVA 1JI7A 2KKPA 2LBOA 1Z5SB 4M0WA 5TR5A 1F0ZA 4UW9A 4I2BA 4WWOA 5AIAA 3Q8QB 4ELVA 4YTNB 1MVKA 3RFAA 5J0TA 1X42A 4OJ6A 1TZOA 2EMTA 4HJKA 2AHOB 4ZOHC 4QZGA 4TUQA 3OJUA 3A1QB 2LYAA 2GMIC 4DSLA 5JHBA 5ALPA 1H4RA 8ICYA 2IHMA 2FIDA 3J81j 2GBJA 3KW5B 5BPCA 2G0AA 1JXEA 1ZQCA 7ICRA 2DYMA 3QC8B 4JX1C 3ZNID 5BMIA 1ZP0B 3T5JA 4WJ3B 3HK0A 2KSOB 1Y8RC 5C23A 4DXFA 4EEYA 4LZGA 2P6RA 3JPSA 3N32A 4MEXA 4XX5A 4YQWA 4KLSA 1P7EA 3OJ4B 3T79A 1QOBA 1DOQA 4FJYA 4DQQA 3D2QA 3DHIC 4HRSA 1ZDVA 2UU7A 1NZPA 3TBLD 1EO6A 1GPXA 4GC6A 1FXIA 2IHNA 4BKSD 5HR7A 2JMGA 2Y0SC 3PSIA 4J9RA 2RR9A 7ICTA 2H3VA 1ZQRA 8ICXA 1C20A 1X9MA 1F1HA 2KWCA 2ZIVB 1QF6A 3N97B 1E7PB 1WRIA 1L7PA 8ICRA 2CR5A 3A9KA 3AEDB 1BPEA 2JUOA 4M8MA 1K51A 4JWNA 4DHJD 2JT4B 4Q45A 1XD3B 2ZIWB 4BWJA 3ABVB 4O3SA 3KLSX 2F8KA 4ARCA 4I2IA 3Q8PB 4FJZA 1ZQPA 2BHNA 2NBVB 1Q5WB 2DFLA 2W7PA 4W9HA 1YQBA 1PK1B 4HKZE 5ALZA 5AKEA 3ISDA 4I6NB 1L2NA 3FKYA 5IIIA 4QZ8A 1X2IA 4ICUA 8ICMA 1WJNA 4RCOA 1S5LU 2ASQA 2W9NA 3C1YA 1ZXHA 2CU1A 2HCFA 2MUTB 4WQMA 1FCCC 1X40A 4IQVA 4ECXA 1KOTA 2RGFA 1X6IA 4GXJA 1TYGB 1MFWA 2CJOA 3ZJUA 2W04A 2AH5A 5A0LA 3ISBA 1XCQL 3KZIU 7ICPA 4NXZA 1MG4A 1WH3A 3IN5A 2W7OA 4G50A 3SENA 4HDOA 2VA2A 4CGZA 4GMVA 2BVCA 1KF6B 3IT6B 3PY8A 1OFFA 3MJWA 1JIHA 1EUVB 4NL9A 1A5RA 4UB4A 5IILA 1FRRA 1Z1VA 3RAQA 4IR9A 7ICEA 2MA1A 4G3IA 1VCBA 3W5VB 4N58A 1ZOYB 4EENA 2KTQA 1TS3A 1JQ4A 3AE4B 1XSNA 4Y2RA 1L6NA 5IIJA 5AICA 3PZPA 3KHGA 2IZVB 1AROP 1C7YA 1VZ6A 4OJPA 5KG4A 5KT7A 4QW9A 2LXCA 3CWIA 2YMMA 4I2GA 2DZJA 2L7RA 4Q2JA 2V4RA 1TTNA 3GILA 4GLSC 4IRKA 2RDBC 8ICJA 2O2VA 3IHPC 2N9PC 3RNFC 3FILB 3V61A 1V5OA 2WXIA 1QQ7A 4GC7A 2CHWA 5L9XA 1JUDA 2IPKD 1L7OA 2Y1IA 2Y9TA 2AQ1B 2PE6B 3TADA 2E8MA 1ZRNA 2ZXHA 4WJNA 3B0AA 2K89A 4ED0A 3U8ZA 1FIQA 1SIFA 1PDXA 2WXOA 4FZMA 1WI0A 4J6IA 2KMAA 1KEJA 3TFRA 5LLIA 4GDKA 2G5HB 3E58A 3R9KA 3UF8A 1SZPA 3WALA 3GIIA 2AGQA 4FS2A 1FNVA 2ACZB 5C2TB 2VH2A 4ZHOA 2PEAA 1KLVA 1R7SA 5ALMA 4ANXA 3ENEA 3PLUA 2FUHB 2IO2B 1PVQA 3H40A 4RH6A 1ZD2P 2L8JA 2W11A 3ZW3A 3MC9A 1N5XA 2W8KA 3C21A 1NVID 1EWYC 1R4NI 1AARA 3WU2U 2KIWA 2DENB 4DO9A 4RQ5A 2R2OA 4QJFB 4A3PA 3PX6A 3SHQA 1ZQDA 1UNSA 3SFDB 2EMSA 2KC1A 1FM0D 8ICAA 1RM6C 4PHDA 3N28A 4Y2QA 4RT3A 1ZD4A 2AU0A 4CHKA 3CF6E 4G0NB 3TEZA 4OZCA 4D2KA 2ZUDA 5J0UA 3ZD9A 2AX5A 2XNAC 4XRHA 1PVRA 3WKDA 4EYIB 4DSJA 1COKA 4ZRQA 5KT4A 3ZDCA 4CF3A 1R4NB 4DL2A 4ICVA 3DWMA 4G3XB 4G9BA 8ICGA 4LJXA 2K5PA 4Y2PA 2N0SB 4I28A 4JMUA 1R4MI 4ZDVA 5ALXA 4MELA 1CJEA 2GOWA 2VA3A 2XCAA 3ZDBA 1XXGA 1KBUA 2G08A 1L0VB 1GUAB 2JYEA 2W9CB 2BKFA 2IGHA 4ECRA 3DBHI 1OXJA 4C00A 4YTMB 1LFDA 1NKEA 3HUIA 1OQQA 2Z59B 4BBNF 2F76X 2YQEA 3ZLZA 2FDRA 1UELA 3O65B 4MM3B 5ALSA 3R2IA 3WKBA 1DOXA 4ECSA 8ICWA 2YB1A 1PGBA 1J19A 1Q0WB 1R4MB 1NK5A 3WCQA 3DBLB 2HE7A 2PKOA 1IUEA 2VH1A 5CTRC 3PSTA 3KHLA 1SL0A 3RZWC 4HWIB 1I4HA 2OWOA 3BYYB 3GZFA 4FBUA 2KN5A 1TAUA 4R66A 1QCKA 4DOAA 2JWUA 3HX0A 2V1YA 9ICTA 4HPLB 2RD0A 4LJOB 2I9GA 1NDDA 2HHWA 3I5JC 1TAQA 2W54A 3A9JB 3AXCA 2LMRA 4PS8A 2HHUA 4IS7A 5L1MA 5ALYA 3HILA 4QZCA 2L52A 5ALIA 3DCGA 3BQ1A 4AP9A 1XLOA 3MR3A 2LJIA 1WZ0A 4N9F4 4JE3B 1IYFA 5IAAC 5KFUA 4BGDA 3Q8EA 4O1NA 1TBEA 7ICLA 1MG8A 3PW0A 4GB9A 4GDLB 5CX3A 4KLMA 2WXMA 1PGAA 8ICQA 2IOFA 2J0KA 4KSLC 3AE5B 5HHIA 5DQHA 4CDGA 3OJ3A 2E1EA 4ED2A 2KZZA 3H8JA 5HI1A 1WGHA 3JPPA 2C2RA 2K8CB 3P1MA 1V49A 3SAGA 1Z2MA 5J2RA 2UVUA 3AUOA 4J9LA 2ASDA 2QILA 4YCXA 2Z0DB 3AE1B 1L7MA 1I4RA 3DVGY 4MEMA 4AWJA 4RUAA 1NKCA 2GBRA 1SL2A 5CHWA 3C2LA 1MA7A 5H92C 5AM3A 2KFZA 2L5YA 3MGIA 3Q2AC 5KFYA 1V8CA 2DZIA 3C5GA 2DZMA 1B22A 3BK2A 3T3OA 1WGRA 5FR3A 3NRZA 1SL1A 3HVZA 5GTIU 2JU6X 2B76B 4DSIA 4M01A 4NJ8A 2KJ6A 3GB1A 4U7CA 4AS1A 2KFKB 3QXGA 1CI4A 1I7HA 2KWVB 1RDFA 1SGGA 3KKAA 4C4SA 3V6HA 2F77X 5ALGA 1UGJA 2PE9A 3BINA 3BZCA 4B9MA 1FCLA 4ZH4A 5D4BA 5E6PA 1SXTA 3W2DA 4P0PA 5AIBA 1L3UA 2DAFA 2ZEQA 4C4TA 4C0ZA 2HVHA 3G6VA 3D32A 1DOYA 3Q8BA 1S0NA 1PVPA 4MH0E 1KLUD 3M9NB 3PZ7A 3FC4A 4FBJB 1IBXA 4OJOA 2VANA 5ALLA 2GLSA 1V9JA 3GIKA 4J9SA 2KACA 4PYZA 1B4FA 4R3DA 1V1PA 4Y2TA 2ICIA 2HSZA 2KN4A 2PFNA 2M0XA 1KTQA 3RBEA 3UM9A 1ESFA 5KFAA 3H7PA 3QZ7A 4O0IA 4DS4A 1XEEA 3KWLA 2MAXA 1QILA 4QIWC 2G09A 3OSNA 1UA0A 2BTEA 1E8YA 4EZJA 4LTUA 2NS5A 3UMCA 4I6LB 5AKYA 4LNOA 4IM0A 4P1CC 3EECA 4PGXA 3PW4A 4YMMA 3GIJA 4S17A 2KNBA 4MFFA 1ZQKA 2X8XX 5G5HA 5DLGA 5AI9A 3IG5A 3IAM1 5FKAC 1N5WA 2ZTEA 4K7SA 4PH5A 3AI5A 5KFGA 4NM2A 2WHIA 3IG3A 4PL1A 1ZDXA 2PFPA 1T4GA 1MQ3A 3SDLC 3RF9A 2KYWA 4M2YA 5AI6A 1RYRA 3CIRB 3WKAA 1BVSA 3K1ZA 2BWFA 4JQWC 3MJ5A 2E6XA 4KLDA 4E71A 2C7NB 1ZETA 4EE2A 2CU3A 2ONQA 1ZE3D 5ALRA 4J9NA 3T5HA 5TZVA 1BT0A 3JPOA 2JXJA 3KD3A 2DPJA 8ICOA 2XIDA 2QARA 1WM2A 2RDJA 1KFDA 5JTIA 2VA8A 5CEHA 3I76A 2BDUA 1T0QC 2KZMA 4B0EA 5J0YA 2PMZF 1ZQOA 2LI6A 2LJ5A 1QSLA 4NLZA 2WU2B 1E6EB 3EGRA 4NPNA 3TIXA 3P63A 4X57B 4JGHB 2AQ0A 8ICCA 5J2JA 4BXOB 2AQ2B 4DWFA 3JSVB 2KVRA 2WB1F 1WM3A 3ETRA 2TSSA 1QOFA 3AEEB 4Z6EA 4Q44A 1Q8KA 2KOBA 4O3NA 2UYZB 4B9NA 4LZDA 1RLFA 7ICIA 5HR6A 3PV8A 5MPOA 4DQOC 2QB1A 2PW9A 4XDCA 4GSWA 1RAXA 2MRPA 4MGIE 3L0WB 4X5VA 1ZQBA 1MHXA 4GIVA 3KVFB 1NENB 4OVVA 3BS7A 4LK0M 2XN9C 3PZDA 2OCEA 2ALZA 2PFOA 3C23A 2JZBB 4DQSA 1JROA 9ICEA 1V38A 3L10B 5J2CA 4OHJA 1MI0A 2H3IA 2GO7A 3QU7A 3AU5A 2HTHA 3A0BU 2EAPA 4W9GA 5CB1A 5EWGA 1IV8A 1FEZA 3Q8KA 4TQ0A 2IGGA 3QEAZ 2K4EA 1TVAA 1D6EC 3U52E 1LO5D 5JHAA 4CO7A 1ZYQA 2KO3A 1YZ7A 1SF0A 1HJPA 1ZQTA 2V3NA 5AKKA 3P4QB 2ESEA 3CYMA 2KDEB 3DBSA 2ZCCA 3SR6A 2WF5A 3BS5B 4RZRA 2OOBB 4MSQB 5D49A 2HHSA 3TUOA 2QB0A 4FO6A 2AEHA 5IINA 1WCNA 3IV6A 2G4DB 2LM4A 1HUZA 5I4DA 2MCNB 4RQNA 1UZXB 2AWTA 3QX1A 4YFKA 2EDUA 3WK4A 3BWUD 4I2JA 1T0SC 4RQ0A 3ONSA 3EHVA 3N7SC 9ICJA 3E9SA 3TMPB 2LEKA 1VZ8A 4QWDA 1T7PA 5CHGA 2MU2A 1FPYA 2L05A 4IQUA 1ROEA 3KZXA 2P66A 5AUIA 1L3VA 3F5EA 4KSKC 3AE3B 1LM8B 2Y5BB 2KK8A 4WIPA 4F91B 5AKGA 1WZ3A 4KMUA 1NI2A 3Q14C 4KLJA 4JL9A 3UQBA 5DG9A 1ET6A 2WDQB 2D6FC 2M9NA 1NBFC 4FZNA 4IM2A 3MR6A 4UB3A 5J2DA 2N4FA 1GB1A 2KJHB 4NLNA 2L0TA 4MHVA 3N7PD 1M4VA 2KG5A 3TEXA 4F2RA 1WXVA 1L7YA 3V62A 3M9OB 1T0RC 3DOWA 1S9FA 1XO0A 3CW2C 3QK0A 2AXTU 4P1BC 4EZLA 5L95C 5EWEA 5EWFA 4OO1J 2M17A 2N1VA 2LRWA 4RGOS 2H3QA 5AK4A 5CR0A 1KJTA 1DYQA 2C60A 2ASLA 3SFEB 4GIBA 1NYQA 4MSMB 1JWAD 4S0RA 4M47A 1TGZB 5HKHA 1E8WA 3VUYA 1PFDA 3RJFA 4NL9C 2O6KA 1NYRA 5FK9C 4KX5A 2UWQA 2WXRA 2JGAA 3IHQB 5HNKA 2FCNA 7ICGA 4UAWA 1SXEA 4O5CA 3ZJTA 4ZYNA 4ZRKA 4KLEA 4NAMA 2RLTA 2UVWA 3FM9A 3AULA 2IO1B 5J2HA 4A6QA 1WX9A 4ECZA 3ZNHB 3PT2B 3A9KB 2MW5A 2ZIUB 3B0XA 5BO4B 1ZD3A 4ACOA 1S10A 2L00B 3LYYA 3W5UB 2LPEA 1SKRA 4ZRJA 4AUQC 3B2FA 4DF4A 2KLGA 1HIWA 2H3ZA 3ED5A 5J0WA 1A70A 4Z6DA 2KE7A 1ENFA 2BDPA 4NLCA 2PI4A 2SAKA 4B6JA 4TSSA 3SD5A 3AN1A 1J7CA 5KG3A 3RD2A 2LGXA 3LWMA 3AQEA 2CHXA 2G3QB 1QSSA 2K22A 5KHQA 4YR2A 1KDHA 1QT9A 4FS1A 1B0XA 1ZQUA 2JZ3B 1V81A 5JH5C 3PO4A 1LB2B 3QUCA 1P1AA 1WMHA 1WIAA 3O0FA 2JHDA 3TADC 5KFWA 1EU3A 2KQ7A 5D3DA 4EFOA 4WJQA 4HYKA 2ZCBA 3ZUNA 1SV4A 2GBKA 3ZTDA 9ICAA 3R66C 1E5WA 2HBKA 2FAZA 4RFBA 3L13A 2OM6A 2LKYA 3JPTA 4OZBA 2ZPNA 3SEBA 2F8LA 4KMOB 5KHOA 3EFCA 1DK3A 5AK6A 3EA6A 4F4WA 3NG0A 2NRXA 1TS2A 4PZOA 1B43A 1ACCA 3RH6A 3A4RA 3OJSA 3DVGX 5T8IA 3RN9C 4YN4A 1ZJMA 3NS1A 3NVVA 5D2MB 1DGSA 3Q3OC 3MR5A 4B95A 3M63B 3L08A 3AE6B 1XSPA 4MH8A 5KFIA 2V9HA 4B6WA 2K60A 4UARA 4ITKA 4CNQA 4FFDA 4DSFA 2KDFB 3W1YA 2KZ3A 5D7GA 3TARA 4ECTA 1UUPA 5LXIB 4UB8U 2Q5WD 2VRRB 8ICSA 1P98A 2WP9B 3JPNA 7ICKA 8ICHA 1HZ5A 4F5QA 3A0HU 1DGJA 4DOCA 4NLGA 1NEKB 2MHJA 4A8XC 4A55A 7ICQA 1QH9A 1AWDA 3PHWB 5AKIA 1NK9A 5HG2A 2WF6A 2W43A 4TQSA 5HP4A 4YXDB 3ZXRA 3AQFA 8ICKA 5AM5A 4JIOU 2RHFA 4F3OA 3RRHA 1TKGA 2HBLA 1Y56A 1N56A 3A33B 1I4QA 4ARIA 3NVYA 3QA8A 2I1QA 4OJ5A 4F4YA 1JN3A 4GDKB 2IMWP 1RXWA 3HVDA 5KAFU 3EPGA 3IFWB 1P3QU 1XLQA 3T5LA 5C5JA 5IO9A 4DHZE 4P4MA 3AEVA 3W1SA 1C1YB 4DL6A 1TY0A 3JVZX 3RFZB 4CYEA 2WS3B 4HAIA 1QOGA 2KVCA 2Q4TA 2A5UA 1TAMA 4MF8A 4PPXA 3EUB2 9ICBA 3PO0A 3U26A 5AKZA 4EX6A 3M8RA 1TKYA 1D5ZC 2MH7A 3GV8B 2FPKA 4BOZB 3Q8SB 4US8A 3KFUF 3DQVA 1X6JA 2PI5A 5CWRA 2V3PA 2M4NA 2KTRB 5BMHA 4FA6A 5FP0A 1BXTA 5DPRA 4Z6CA 2XY6A 9ICHA 2K1FA 2DYOA 2QEJC 3AU2A 1NNLA 4FBTA 2HHXA 2KHVA 2FLPA 3TCAA 2QKQA 4LDTB 2XK5A 4DFPA 4KIKB 1GG3A 2BQ3A 4EZ6A 2KX0A 1ZOLA 4QZDA 3VTWA 3KTQA 1IGCA 4MDKE 4M9LA 3QARA 3HKZC 1TIFA 3OGUA 2DPIA 2KVSA 1YD8U 4HPPA 4ANVA 3ZNGC 1RQNA 4GLXA 1YQ4B 4IWQA 3VUXA 2N9KA 1KW4A 3C28A 4I27A 4E0DA 2R8JA 4K3BA 4A20A 5BYSA 1UCVA 3T8MA 4BAXA 2FMQA 4UB2A 3E0FA 2HW3A 4Q8EA 3PLVA 3RUIB 4I29A 3H0MB 1C77A 2LWPA 4NAWA 3WKCA 5ALEA 4BBNC 4IRDA 4M6WA 3H8MA 5F9NA 4UAZA 2NPTB 4IWPA 1RG6A 1IG6A 3BK1A 3HM3A 2CN1A 3SMVA 4E74A 2EANA 2K4IA 5CP2A 1FMAD 2NMQA 3R3MA 4KV2A 1QQ5A 2KHWB 2PTLA 2KICA 1OGWA 3AM9A 4KKIA 1JWSD 1WGYA 3AEGB 4RQ6A 2ZG6A 3MC1A 5KFZA 1K50A 2W9BA 3KKAC 1FNWA 4NJCA 2RRDA 3ZO5B 1UPHA 2HDOA 3DVNU 4XZ4A 4AJWA 3QAQA 1F52A 3RMKC 3DVNV 1N60A 1WX7A 1BNPA 3L54A 4DDGD 3NZSA 1PQSA 2LVQA 5HMMA 5ALVA 3G6YA 4C8NA 4K4GA 2AQ3B 2A4ZA 2KV2A 2LYHA 2KD0A 1Z1BA 1NK7A 1E0ZA 1TT5B 4DK5A 2J6TA 1BPDA 2PIAA 1O08A 5ALWA 4EBCA 2R8GA 2K8AA 1UWXA 4P7IA 2KN7A 3PMNA 4KLUA 1WJUA 4NJ6A 1PGXA 3N3KB 4ZHPA 1AYFA 4YTPB 3Q8CA 4BJQA 1S76D 2LUEA 3OG5A 4F8CB 4UASA 1WXSA 2K0PA 1O03A 1GAQB 3VRAB 4QZAA 3APFA 2DHZA 2JRIB 5L83A 2KHQA 5AI8A 4Q43A 4HCPB 3N1YC 1FNUA 2EKEC 2PXIA 2IBKA 2BS2B 1ZGUB 1YIWA 1L8LA 4WJOA 3CMMB 2G5IB 2CPRA 4DL5A 2OJWA 2DZKA 3A1QA 5KG0A 3ZDMC 3RNCC 4C4VB 5AUKA 3FDSA 5G55A 1X9SA 1UQVA 3GZNI 3VHTC 2BQQA 3HM6X 4EKUA 5BMGA 5AI4A 1RXVA 2XCPA 1ZKHA 3RNGC 1AQ6A 1NK0A 2NVUI 3APDA 2JX5A 2PVGC 1VJKA 3K1RB 2IJ0A 1A76A 3HIZA 1H38A 3V6EB 1K1QA 2YMQA 5J2GA 4DFMA 2BB6A 4TV3A 3SU8X 4NY8A 3H7SA 3VC8A 1D9FA 4P0PB 2BKRB 2Y5PA 2BQUA 5AM1A 4IG7B 3WK6A 2F44A 3THVA 3ORYA 4LDTD 4QWEA 1CK1A 3NUHB 5KFRA 4RUCA 1SKSA 2ZVNA 3QZ8A 3C2KA 1WR1A 1X66A 4C8KA 2WXFA 2WGSA 3NTUA 1WG8A 4LCDE 1RWSA 3UQ0A 2FIFA 2EZXA 1HA5A 2IDYA 4F1SA 1VDVA 5AKLA 3H7PB 3I57A 4W9FA 3PW2A 3HWTA 4LNNA 3C5FA 2VKQA 2XEWA 1N2XA 4JB3A 2BCRA 3H7IA 2JZZA 2K9XA 3IM1A 2ZIWA 2KFJA 5KFNA 3KWVA 2NRWA 3NS8A 1YT3A 2R8KA 3RR8A 2HTME 4YXMA 2RDGA 1S8OA 4RM8A 3LVWA 1PK1A 2LGYA 4C7YA 4AYBC 4OCZA 4GGQA 2K6DB 1KKXA 9ICFA 3FAHA 1NJYA 1JMLA 4L23A 1U9LA 5DB6A 1DRGA 2C5LC 3DBHB 4K81A 3X0WA 2BCQA 3LXFA 3ZVVA 2RP5A 1URJA 1IM4A 1SE9A 4YR0A 2MUTA 5KFKA 4O5EA 2GRIA 4CRXA 2J7QB 3PSEB 1LKYB 4F71A 2RDIA 4K4IA 5J8YA 4EBDA 2PJHA 5DG8A 2JH1A 2QLTA 2N7DA 4RNOA 3ZDEA 4N6EB 3DPDA 4BOSC 1SV0A 2X38A 1XWLA 1SWWA 2WXKA 3ZNZB 3AE2B 4KLGA 1HZ6A 3ZKJC 3HW8A 1J0GA 4GN1A 3PX4A 1IXRA 3QWZB 2BCUA 3CSFA 1MJDA 7ICJA 1U49A 1FFUA 2R8IA 5KT6A 2PMZC 4YT0B 5AM2A 2MSED 2KZRA 1NOMA 4OVUA 2KKCA 5DKWA 3P4SB 1N61A 3OWEB 5DLFA 5F9LA 4FHKA 4HKQA 1L6VA 3UQ2A 9ICSA 5KFMA 3OLMD 5J29A 2LXAA 5AKHA 2BB5A 3UQAA 3RJJA 3ZGZA 3BJYA 2LYBA 2V4IB 1BPYA 4TQ1A 4MEYA 5ALDA 5BOLA 3V7KA 4DQIA 5GTHU 1ZQHA 5KFOA 4BDPA 1E8ZA 4URKA 1L0XB 1OEYJ 4A90A 4MJSB 3DDHA 2BBCA 1L4ZB 2NR2A 4P6VF 1D8BA 4RU9A 3MC8A 1JRUA 3FILA 4HCNB 1YQ3B 2JEGA 5LXHA 1RYUA 4ZRIA 1NJXA 4L1BA 3V60A 2LUMA 2MP2B 4Y2XA 1KFTA 5J0XA 2FCSA 5DBCA 2OYYA 2KJ5A 1ZUD2 2INCC 4NM1A 2BKEA 4HK2A 1YJ1A 5EE0A 4KN4A 1E7UA 2EAMA 3LDZE 5DDMA 1JXLA 3H6NA 2D5GA 1SGHA 5KAIU 5KFSA 2UVRA 2BWES 3UXPA 1JALA 1X9XA 2YX8A 3OAWA 4MGKE 1D8LA 3IAS1 1TKEA 2BGWA 2JVCA 1YMHE 2KDMA 3DWGC 4L2YA 1GB4A 4DOBA 3IVFA 2NO4A 3VVWB 2KC2A 1UGMA 3AU6A 2QB0B 4PGYA 2RMMA 9ICUA 2GH1A 4JWMA 1C76A 2J52A 3C0RB 3WK5A 2HI0A 5C0YA 2EQYA 3GE3C 4JK1A 1S97A 3ETLA 2FE8A 3NASA 1T5XD 2LHEA 9ICVA 2REXA 3MDCA 2PLPA 3G6XA 2LRUA 2IY0B 2V0GA 1J2MA 8ICFA 2BYTA 1TK8A 4FJVB 1KRPA 1V5TA 4OW0A 4M9GA 3RI7C 2WWZA 9ICLA 3D2SA 3L4PA 2FUG1 3SD7A 5IOIA 3L5KA 3QCAA 4UQGA 2IA6A 1G6JA 3B2GA 2B3AA 2W8LA 4KGRA 1T8EA 1N63A 3PVXA 4RGNA 2WDVB 3BVGA 2A1JA 2P35A 1RQLA 3PSFA 5J0SA 4KTQA 4KLIA 1QQRA 2OJRA 5DPTA 2KNJA 4Y2YA 7ICFA 2HJ1A 4CE6A 2AGOA 2HD5B 5J2BA 2YMPA 4O5KA 2VZKD 4ANWA 2W9CA 2BQRA 3IDWA 4TQRA 1TK0A 2INDC 1JWBD 2WXPA 4FZLA 5DQIA 4BX9C 2FNJB 3I9V1 5AKXA 3Q6BA 1NKBA 4BKGA 4F5OA 3RJIA 1YN5A 1HEKA 4O3QA 4MM3A 3LDAA 1JRPA 2CXYA 4YSZB 1J2NA 4DEZA 1Q3VA 1L5PA 4KX3A 2Z0EB 1SE3A 3VR8B 3Q8AA 1ZQYA 3KOOA 5IIKA 5DGBA 3NUQA 4JV0A 4EEKA 5J0QA 1BUIC 1FO4A 2XGQA 2AL3A 3I28A 2Y3AA 3W9CB 4DHZB 4P0QB 4WWNA 4EZKA 3ALRA 4I2DA 1EU4A 3LJ3A 1FD6A 4QWBA 2Y1JA 5CJ7A 2JEFA 7ICNA 2MQJA 5J2IA 3UMBA 3A9JA 3VH3B 2H88B 9ICIA 4IWOA 1IPGA 2KIVA 3QQ8B 2WLBA 4IUMB 2KX3A 5ALUA 2ZUBA 3UPQA 2JYTA 4RQ2A 1H8CA 2ZJ5A 3TI0A 2Z7JA 4IRCA 2XGPA 2JY6A 1WGDA 4RQ4A 4KVGB 4WQOB 2FPLA 3ICXA 1UBQA 1SE2A 3VAWA 4W9DA 1ZQ1C 3LB8C 4PZNA 1X1MA 1ZQEA 2BPSA 4F8RA 1N62A 4IC9A 4PK1A 1F77A 2D11A 2ZNVC 2H5XA 1CUKA 3PS6A 1S0OA 4WWPA 5D46A 2K39A 2K8CA 2KOXA 3TANA 3QHTA 1P9DU 4DS5A 3AE8B 2GLEA 5DPWA 1JX4A 2WU5B 3S6JA 3ZDDA 1UH6A 2ISPA 3M1YA 1OW5A 4B9TA 4NNJB 9ICRA 1WJ6A 2J0JA 3W1SC 3HT3A 4XGAB 4A9AA 2QCZA 4N59A 3MFHA 2KD1A 3OTQA 2KWDA 4XYCA 3RPFC 1BGXT 2BYVE 2K8BB 2MBOA 3EYZA 2DUYA 2FCMA 4R8UB 5JZEB 2YN4A 3V3XA 5E79U 4ED7A 2HBMA 1SBBB 5KG5A 4F5PA 2W55A 5K4LA 5KT3A 2MJDA 3U30A 1ZRMA 1C78A 2ON8A 4ACFA 4K1RB 4AJYB 2KFKA 3RR7A 3ZTCA 3QJZA 5F3XB 2W9AA 1XQQA 3RJEA 1JMSA 2A1AA 4XQ8A 5KFEA 1WRDB 3NHEB 4W9LA 8ICLA 5D3IB 2KKVA 4HROA 4NJ7A 3L16A 4RQMA 3PW5A 3NZUA 4IC7B 2EAOA 3CSTA 3Q3JA 3Q69A 2QC8A 4EELA 3QUBA 2G45B 4HDQA 4M0WB 5J17A 4CQNA 2KDIA 4JWUC 2M0NA 3V72A 3T3FA 4EZ9A 2ZW0A 1RFKA 5C1ZA 3KBBA 1QLBB 2JXTA 3VTVA 5J2FA 3Q8RB 2QJLA 3P4RB 2W3RA 2N9XA 3K9PB 1SWVA 4ZRPA 4J9MA 5KFPA 2ASJA 4RM9A 1WJ4A 4RPYA 2KAJA 3PR5B 3F2BA 1XU4A 4RNNA 2B6GA 1L3TA 4WURA 4K3CA 1J97A 2DF4B 2ZIXA 5KFTA 4YMNA 4YP3A 2L32A 3AEFB 4LNFA 3Q8FA 3NRWA 5KNIA 4UBCA 2RDHA 1I4XA 2BT6A 3BVZA 1HTQA 3QU9A 3GV7B 4KLTA 4M00A 2V4QA 3TAQA 1M6YA 3ZJVA 3M3JA 2W3SA 5H2FU 1IP9A 3KHRA 1RYSA 3MP9A 3E2EA 1MPEA 1UF0A 3NOBA 3TEWA 1ZQVA 1DK2A 1WWVA 3GS2A 4M02A 3KUZA 5TSSA 3V7JA 3V6JA 3RBDA 3M95A 1MQ2A 1TY2A 1LV5A 3BQ7A 3MHZA 1TS5A 2MSNA 1F9JA 4F7ZA 3HJEA 2I38A 2O6VA 4DQPA 5DPSA 3FYHA 1PZNA 3WAMA 2JEIA 2KP7A 2N9LA 1T3QA 2YTUA 2KJ8A 1FRDA 5JU5A 4WAFA 3T9LA 2XC9A 1HQRD 4BXOA 1V80A 2MBQA 4OD0A 1D8YA 3JSVA 2H89B 4WAAA 2J4XA 4C8MA 1V85A 1U48A 2JWZA 5KFCA 1F44A 2K8HA 2IOHA 5ALTA 4KDLB 9ICQA 2CHZA 4DLGA 3I1YA 4DFKA 3VCBA 3RB0A 1Z4NA 2FJ6A 5J0PA 1ZQXA 3EC8A 1AN8A 1ZD5A 2P6UA 2YY6A 4M0AA 3RNEC 4K7WA 3WAPA 4Q8FA 1T6BX 4NAWB 5IN7A 1VZ7A 2PKEA 2KEYA 3L3FX 1NK6A 4QWCA 4FE3A 4YD2A 3BZDB 2KFNA 3VTUA 5DDYA 2OEDA 1N6ZA 1WGKA 2CKHB 2JZBA 5KFFA 4K7UA 3MGVA 3B1LX 3VQIA 3U7ZA 3T3NA 4UB1A 8ICUA 3H4DA 2BZFA 2MX2A 1D5MC 4P4OA 2OH2A 2AJQA 2NRTA 2D3AA 1A6SA 4J03A 2FPMA 1WYWB 5ALHA 4U6PA 1D4BA 1BPBA 1L5UA 4J9PA 5L1KA 4RMAA 1I35A 2WAQF 5JXVA 2OXOA 1HUOA 5HMLA 1CEZA 3Q3MC 1ZXIA 3SI8A 3QIJA 2NO5A 3MFIA 4YL8A 2KMCA 4MACA 5B66U 5KT2A 1U4BA 2J53A 3Q3NC 4ASWC 4J9KA 1BPZA 3V7LA 3BYTB 3BS5A 4KLQA 1F0MA 4NZLB 1NJZA 2ZVOA 3PMLA 5ALQA 4R65A 3WA0A 8ICPA 3KUCB 3ZRCA 1WR6E 3ISCA 3RYTA 2E1FA 2O2VB 5J2KA 3DHHC 4DQRA 2J42A 3TSSA 1I42A 2LD9A 3BY4B 1E7VA 2M8SA 1GO3F 3UMGA 9ICCA 3I3TB 4R63A 3SAHA 5HHHA 3PVLA 4NLKA 4J9QA 4WJPA 5ALOA 2LASA 4YMOA 2GOLA 1F5SA 2EZYA 5J2AA 3C8YA 3JW0X 1COOA 2E5SA 1C4PA 5L1LA 2K3UA 2WDRB 3DHGC 3PW7A 4B9SA 4WH4A 3E56A 3RCZA 2J6SA 4M8NA 3N1ZC 2DKZA 3WANA 3ONNA 2AGPA 1K1SA 2KJ9A 4DSEA 2G06A 1XS9D 1SJHD 5AI0A 4ED1A 4KGTA 1D9DA 3PRZA 3PRMB 4DL4A 9ICGA 3DDCB 3HRDD 4UAVA 1ZW7A 3K75D 3C2MA 4C8LA 1FXTB 2M56B 3SZ2A 1P7DA 4F5RA 4DFJA 2A3VA 1I4GA 5J8YC 2AYOB 2BR0A 3HPOA 4MGZE 3ZXVA 4Y2SA 1P7FA 3PRPB 4ICAA 2BW2A 1SV0C 4Z6FA 2GWSA 4EUTA 3VXWA 1ZQLA 1PUZA 5AHXA 4DCCA 3T5KA 3SEIA 1MSWD 1V6EA 1V2YA 4AP4C 4B9UA 4QZEA 2XY7A 1XLNA 5H8YE 3RZFA 2KVZA 2WXGA 3U4EG 1T3NA 5B5EU 2JQRB 3VRBB 5AEKB 4PGQA 1QSYA 2L83A 3X23A 1TV9A 4BKSA 2MA9B 4PT5A 3N7RC 3QU5A 4YR3A 3SQIA 1T94A 4PHAA 2B21A 3RB3A 4JLCA 1K8RB 1WCLA 1ZPSA 1V1OA 2NTTA 4EX7A 4JUZA 3RH5A 2ZIUA 4II3B 4CF5A 2CS4A 2DAJA 4P16A 3AECB 5AM0A 1ZQAA 3LYSA 3CNHA 2WTFA 2JH7A 1Z00A 3MGHA 1DXSA 4IOIE 1KN5A 3PO5A 4UAUA 2G07A 2KQSA 2HOQA 4FXCA 2LM1A 1S1QB 4JWSC 4DXAB 3Q8LA 3UIPB 4E3CA 1C79A 4TUPA 3U2SC 5IP4D 4P4PA 1HEZE 2LGIA 3ML9A 2IYDB 3GP7A 1CMXB 7ICUA 1YN3A 4IW0A 5DBBA 4ED3A 3M62B 1E90A 2QHOA 4FN2A 4QZ9A 5CHVC 5KFDA 2INPE 2NBWB 1KFYB 3MTNB 2RQ5A 5AM4A 1K52A 4HEA1 3UINB 1E8XA 4F72A 3PHXB 3RULA 1U45A 2L3ZA 3QE9Y 3RJGA 2C22A 9ICPA 4KLFA 4KLHA 2DLBA 4JPSA 4BVUC 4DXGA 2W9MA 4FULA 5KFLA 1VLBA 3WKEA 2KMDA 4UB6U 3U7DA 3F53A 1KL9A 3GV5B 3PREA 2J0MA 4O9MA 5CA7A 3KHHA 1YN4A 5HHDG 1VR9A 2YMLA 4W9CA 4Y2VA 2C9WB 1UD7A 1TKDA 5AZGA 3V05A 4EOYA 2J6UA 1FXAA 1IGDA 2NCNA 4F50A 5KT5A 4PJ0U 3TAPA 1XO1A 5E6NA 3VUWA 3BVMA 3HHMA 4YVZA 2DQNB 3QUTA 2BS4B 2G9HD 4F4ZA 3D2NA 1QTMA 1WYGA 4I2AA 4J9OA 4DDID 3H1UA 4RGMA 2Z8LA 2G4SA 4DFDA 3B0YA 1HE8A 2YVCA 3BQ2A 3CP8A 4BUGA 4UATA 1BMLC 1SSNA 3ECIA 3F5AA 4IQTA 5DBAA 1EM7A 1LQBA 3RJHA 1SE4A 3IBEA 2XI9A 5KFHA 3PPAA 1YX5B 5EOZA 2PVOD 2AL6A 4GXBA 2DWQA 1B1ZA 3AE7B 3AE9B 5DB7A 3H0RB 4CCHA 1EWCA 1SZHA 2ZUCA 3R7QA 3N4MB 4YSXB 2KSOA 4ECVA 4MT5A 5DCNA 1V97A 1MHHE 1QQ6A 1VRAB 2ZTDA 1WGGA 4NV0A 5EE9A 3P2BA 3QEBZ 2NV3A 4QW8A 3EPIA 3VR9B 2YLMA 2JXXA 2KTFA 4PS7A 3DBRI 4QZHA 5KFXA 2ZJ8A 2C28A 4FADA 1SJED 4O3OA 2HMXA 1IBXB 9ICNA 2XY5A 1PUTA 3GZNB 3Q8MA 2E8PA 2Y0SF 5T14A 1NJWA 1GOZA 3MHSD 2JRHA 1WX8A 1SEBD 2WNMA 1V1PB 3WK9A 1LXDA 1OTRB 3BIID 2BS3B 3EFUA 2F3NA 1XO3A 2DNFA 3RH4A 2NYVA 1Z3EB 4LVSA 1ET9A 2LI5A 2DBYA 2ZIVA 4QNLA 4G11A 2KTRA 3JPRA 5CHFA 3DV9A 1ZQGA 3DBRB 1TJEA 5AK3A 2PFQA 5J0RA 2HDEA 3TL5A 5ALNA 3QU2A 1Z19A 4KIKA 1KH0A 2R61A 4XC2A 4LNIA 4ECYA 1XSLA 1EF1A 4DLEA 7ICMA 3MBYA 3TKAA 2JV3A 1AW7A 5D6JB 3HKZF 4ECWA 2ZXIA 3SYZA 1VD2A 5J2EA 2XVTA 2Y9UA 8ICZA 4PYUA 2WHEA 3NY5A 2A1JB 2H3FA 2XICA 3PV1A 2OHFA 3UXOA 1IIPA 1JCKB 5KG2A 3QU4A 3DBLI 2FLNA 3KQ4A 4TUSA 2WXHA 9ICMA 1CQVA 2VZKB 1XF5L 4DBGA 1JW9D
chains in the Genus database with same CATH topology
3Q8AA 1E10A 1B9RA 2GB1A 4HKZE 3LYYA 3W5UB 2WXLA 3B2FA 1BUIC 1FO4A 1A70A 2Y3AA 3W9CB 1ENFA 4TMAB 2SAKA 4TSSA 3AN1A 1EU4A 4RCOA 1FD6A 1J7CA 1ZXHA 4WQMA 1FCCC 2H88B 4KX6B 2K22A 2WLBA 3NVWA 1QT9A 2JYTA 1TYGB 2CJOA 3ZJUA 3B9JA 1XCQL 1EU3A 4H2AA 5D3DA 4LLGM 2Y5CA 2MJ3A 1SE2A 1C9FA 1L0YB 1KF6B 3IT6B 1OFFA 2FBWB 3LB8C 4RFBA 3MC0B 1N62A 4OZBA 2I2YA 3SEBA 3AH7A 1F77A 2WXJA 1FRRA 2CJNA 1SIJA 3EA6A 1TS2A 3W5VB 4N58A 1ZOYB 3AE8B 1J7AA 1ACCA 1TS3A 1JQ4A 2WU5B 3AE4B 4YSYB 5T8IA 4XWWA 3NS1A 2WXNA 1VZ6A 3NVVA 3N9YC 4RNAA 4Q2JA 2LHDA 3CWIA 4A9AA 4N59A 3RPFC 2KWDA 5G5GA 3AE6B 4GLSC 4MH8A 3NVZA 1L4DB 4ITKA 3V3XA 5D7GA 1SBBB 2W55A 3FILB 1KRHA 1UUPA 2MJDA 1C78A 2JSVX 2ON8A 2Q5WD 2WXIA 4ZYSA 1QOAA 1SB3C 2IPKD 2WP9B 3AEAB 2AQ1B 5D3IB 1HZ5A 1DGJA 4XWTA 1NEKB 1FIQA 4HROA 4A8XC 4A55A 2WXOA 1PDXA 4WWMA 1AWDA 1DOIA 5HG2A 3Q69A 5C2TB 4YXDB 1FNVA 2ACZB 4ZHOA 4AQ7A 1R7SA 4CQNA 4XDDA 1TKGA 1Y56A 4JWUC 3AB5A 4RH6A 1I4QA 4B0MA 4ARIA 3NVYA 1RFKA 2ZW0A 4IKGA 1N5XA 4GDKB 1NVID 1EWYC 1QLBB 2JXTA 1TS4A 1CZPA 2QJLA 1E9MA 3HVDA 1XLQA 2W3RA 3P4RB 4OZAA 4ZRPA 5E6JA 3W1SA 1UNSA 3SFDB 1TY0A 3RFZB 2WS3B 1FM0D 1QOGA 1RM6C 2KAJA 3EUB2 4WURA 3PO0A 4C56C 2L32A 1TKYA 1D5ZC 2MH7A 3AEFB 4OZCA 3TEZA 1JWUD 2SEBD 2AX5A 2XNAC 3MFGA 4D2KA 3Q8FA 4US8A 2NTSA 4ZRQA 2RDHA 2QSDA 2V3PA 1I4XA 2BT6A 3BVZA 3ZYYX 5BMHA 3DWMA 1BXTA 3ZJVA 2W3SA 2DYOA 1K53A 2K5PA 2N0SB 2QEJC 1CJEA 3MP9A 1XXGA 1MPEA 3TEWA 2E3TA 1L0VB 2JYEA 3GS2A 5TSSA 2IGHA 1IGCA 1TY2A 4YTMB 3MHZA 3HUIA 1TS5A 1OQQA 2I38A 4REZA 4MM3B 3IXSA 2N9LA 1T3QA 3R2IA 1YNTE 1YQ4B 1DOXA 1FRDA 1PGBA 2N9KA 4WAFA 3WCQA 1L6UA 5BYSA 4C80A 2PKOA 1IUEA 1HQRD 2H89B 1I4HA 2J4XA 1F2RC 3BYYB 4RF0A 1Q10A 1C77A 2JWUA 3R8BA 3BK1A 2W54A 5GXGB 1FMAD 2NMQA 1AN8A 1WSPA 2L52A 2PTLA 5HFYA 1YJIA 3AM9A 1XLOA 1T6BX 1JWSD 3AEGB 4KKIA 2LJIA 1VZ7A 4USAA 4NAWB 4JE3B 2KQ4X 1K50A 4XE0A 1FNWA 4NJCA 3Q8EA 3BZDB 4O1NA 2OEDA 1WGKA 4GDLB 2WXMA 1PGAA 2IGDA 3T3NA 3VQIA 1N60A 3U7ZA 3AE5B 1D5MC 2AQ3B 1I4PA 1D4BA 2KMMA 5HI1A 1WWTA 2LFIA 5JXVA 3P1MA 1E0ZA 1STEA 1PYWD 2PIAA 1ZXIA 2QILA 3AE1B 1F2RI 3IT4B 5BYRA 1I4RA 1UWXA 4MACA 2J53A 5H92C 1PGXA 3P42A 3BYTB 2YEPB 3O13A 1AYFA 3P4PB 3Q8CA 1V8CA 4YTPB 4NZLB 4ZHPA 3BK2A 3T3OA 2K0PA 2QIEB 5FR3A 3NRZA 2J42A 3HVZA 3TSSA 1GAQB 1J7BA 3VRAB 2RPVA 2JU6X 2B76B 3GB1A 1FNUA 4AS1A 1QKZA 1I7HA 2BS2B 2PMVA 3C8YA 1HXYD 1UGJA 1C4PA 2K3UA 1FCLA 5AUKA 2WDRB 4C7ZA 1SXTA 1C4CA 3W2DA 4WH4A 3E56A 1C4AA 1DOYA 3Q8BA 5BMGA 4KGSA 1XCTL 1KLUD 3PZ7A 3FC4A 1SJHD 2JX5A 2PVGC 1VJKA 2IJ0A 2MJEA 1IBXA 2KACA 2BB6A 4KGTA 4OVZA 4R3DA 2EKIA 1V1PA 3HRDD 2ICIA 2KN4A 2Y5PA 1ESFA 2M56B 1L5PA 1RYJA 1I4GA 1XEEA 2JZPA 3URYA 3KWLA 5LNK1 2EELA 1QILA 3NUHB 1CK1A 4RGTA 1JWMD 2BTEA 3J9CA 1P7FA 4LTUA 5C3JB 2BW2A 2WXFA 1OQRA 1UWMA 2W82A 2GI9A 1RWSA 5G5HA 3AEBB 4J3OD 1HA5A 2IDYA 3IAM1 1VDVA 5FKAC 1N5WA 3I57A 2M0AA 5H8YE 1XLNA 2WXGA 3U4EG 2JQRB 3VRBB 3H8HA 1ZDXA 2L83A 2K9XA 4PT5A 4RF1A 2WXQA 3CIRB 3ZQ4A 2WQYB 4KKJA 4YWGG 3KWVA 3UI3A 3AV8A 2E6XA 3MJ5A 4EE2A 1D5XC 2HTME 2CU3A 2ONQA 1ZPSA 1V1OA 2NTTA 2RDGA 2ZW1A 1ZE3D 4HJGE 2YEPF 2INNE 3PZ8A 4C7YA 4P16A 3AECB 1KTKA 3FAHA 1JMLA 4L23A 4IOIE 3NZ3A 3LXFA 4FXCA 4JWSC 1XLPA 1C79A 2GRIA 3U2SC 4B0EA 1HEZE 2LGIA 3GP7A 5EE1A 4IDIA 2WU2B 1E6EB 1YN3A 3EGRA 4UDUC 3P63A 2AQ2B 4N6EB 2TSSA 3ETRA 2X38A 1QOFA 3AEEB 2WXKA 3AE2B 2INPE 1HZ6A 1WXQA 1KFYB 5MPOA 2L1AA 2G1EA 1FFUA 1K52A 4HEA1 4DQOC 2PW9A 4XDCA 4YT0B 4DXGA 2DLBA 4JPSA 2N7JA 5BYQA 1VLBA 3P4SB 1MHXA 1NENB 3AMZA 1N61A 4LK0M 2XN9C 3OWEB 4HKQA 1L6VA 5EE3A 1JROA 1YN4A 2BB5A 5HHDG 3ZGZA 2V4IB 4OHJA 1MI0A 1VR9A 2M19A 4TQ1A 3R2TA 2QMTA 1L0XB 4A90A 3V05A 2BBCA 1FXAA 1L4ZB 1IGDA 4P6VF 4TQ0A 2IGGA 3BVMA 1D6EC 3U52E 1LO5D 2BS4B 3FILA 2G9HD 1YQ3B 1SF0A 1FEHA 1WYGA 2LMCA 1YJJA 4L1BA 2LUMA 1NI3A 2V3NA 3P4QB 1KLGD 4RGMA 2MEKA 2Z8LA 3TEYA 1ZUD2 3SR6A 4US9A 1BMLC 5EE0A 1SSNA 3TUOA 1EM7A 1SE4A 5I4DA 2D5GA 2PVOD 1FFVA 1JALA 1B1ZA 2DWQA 3AE7B 3AE9B 3BWUD 3IAS1 1TKEA 4M0WA 1EWCA 1YMHE 2KDMA 3DWGC 4L2YA 3E9SA 1F0ZA 1GB4A 4YTNB 1MVKA 2LEKA 4YSXB 1VZ8A 1TZOA 2RMMA 4ZOHC 1C76A 1ROEA 1V97A 2J52A 1MHHE 4MT5A 5AUIA 1VRAB 3AE3B 4WIPA 5EE9A 3VR9B 2FE8A 1T5XD 2LHEA 5BMIA 2PLPA 1ET6A 2DYMA 2WDQB 4JX1C 1SJED 1ZP0B 2V0GA 2BYTA 1IBXB 1GB1A 1PUTA 4DXFA 1GOZA 4OW0A 1SEBD 2WNMA 1V1PB 3L4PA 1M4VA 2FUG1 3BIID 2BS3B 3TEXA 1XO3A 1P7EA 1QOBA 3B2GA 1ET9A 2DBYA 4KGRA 1N63A 4HRSA 1ZDVA 4RGNA 2WDVB 1GPXA 1TJEA 3BVGA 1FXIA 1QQRA 4RGOS 2HDEA 1DYQA 3SFEB 1KH0A 2R61A 1NYQA 1JWAD 2VZKD 1AW7A 1QF6A 1E7PB 1JWBD 1WRIA 1PFDA 2WXPA 3AEDB 1NYRA 5FK9C 3I9V1 1K51A 2WXRA 2OHFA 1YN5A 1JCKB 3ABVB 3KLSX 3ZJTA 3KQ4A 4ARCA 1JRPA 4NAMA 2WXHA 4YSZB 4A6QA 1CQVA 2VZKB 1XF5L 1SE3A 1JW9D 3VR8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E10 A;  3SFD B;  1GAQ B;  1J7B A;  3P4S B;  3VRA B;  2WS3 B;  1FM0 D;  1NEN B;  3AMZ A;  1QOG A;  1N61 A;  1RM6 C;  2B76 B;  2KAJ A;  3W5U B;  3EUB 2;  1L6V A;  3PO0 A;  1I7H A;  5EE3 A;  2BS2 B;  1JRO A;  3B2F A;  1TKY A;  2MH7 A;  3AEF B;  1A70 A;  1FO4 A;  2AX5 A;  4US8 A;  3W9C B;  2M19 A;  3AN1 A;  3ZYY X;  2BT6 A;  1J7C A;  5AUK A;  2WDR B;  4C7Z A;  3DWM A;  4WQM A;  2H88 B;  4KX6 B;  2W3S A;  2K5P A;  1FXA A;  2N0S B;  2K22 A;  1DOY A;  2WLB A;  4P6V F;  3NVW A;  1QT9 A;  1CJE A;  3FC4 A;  1TYG B;  2JX5 A;  2E3T A;  2PVG C;  1VJK A;  2CJO A;  2BS4 B;  1L0V B;  2MJE A;  3B9J A;  1YQ3 B;  2Y5C A;  1SF0 A;  1WYG A;  1YJJ A;  2EKI A;  4YTM B;  3HRD D;  1NI3 A;  3HUI A;  1OQQ A;  3P4Q B;  2MJ3 A;  2M56 B;  1KF6 B;  1OFF A;  1RYJ A;  1ZUD 2;  3SR6 A;  2FBW B;  3LB8 C;  3KWL A;  4US9 A;  5EE0 A;  1N62 A;  1T3Q A;  1DOX A;  1YQ4 B;  5C3J B;  4LTU A;  1FRD A;  3AH7 A;  1FRR A;  1OQR A;  1UWM A;  2CJN A;  2PVO D;  1L6U A;  3WCQ A;  1FFV A;  4C80 A;  1SIJ A;  1JAL A;  5G5H A;  1IUE A;  1RWS A;  2DWQ A;  2PKO A;  3AE7 B;  3AE9 B;  1VDV A;  1TKE A;  1N5W A;  3W5V B;  4N58 A;  2H89 B;  1ZOY B;  3AE8 B;  1J7A A;  3DWG C;  1F0Z A;  1JQ4 A;  2WU5 B;  3AE4 B;  4YSY B;  4YTN B;  5H8Y E;  1XLN A;  2LEK A;  4YSX B;  3NS1 A;  2JQR B;  3NVV A;  3VRB B;  4ZOH C;  1ROE A;  1V97 A;  2L83 A;  5AUI A;  3CWI A;  2K9X A;  3AE3 B;  4A9A A;  4N59 A;  5EE9 A;  3RPF C;  2W54 A;  3VR9 B;  3CIR B;  5G5G A;  2WQY B;  3AE6 B;  5GXG B;  1FMA D;  3AV8 A;  3NVZ A;  2L52 A;  2WDQ B;  4ITK A;  4JX1 C;  1YJI A;  3AM9 A;  1XLO A;  1ZP0 B;  1B9R A;  3AEG B;  2HTM E;  4USA A;  2CU3 A;  2W55 A;  1PUT A;  3AEB B;  1KRH A;  2MJD A;  2Q5W D;  4C7Y A;  1QOA A;  1SB3 C;  1WGK A;  3AEC B;  3L4P A;  2WP9 B;  3BII D;  3FAH A;  2BS3 B;  3AEA B;  1XO3 A;  1N60 A;  3AE5 B;  1QOB A;  3B2G A;  1DGJ A;  3LXF A;  2DBY A;  1NEK B;  4FXC A;  4JWS C;  1XLP A;  1FIQ A;  4HRO A;  1PDX A;  1N63 A;  4HRS A;  4WWM A;  1AWD A;  2WDV B;  1GPX A;  1DOI A;  1TJE A;  1FXI A;  2KMM A;  1WWT A;  5EE1 A;  4IDI A;  2WU2 B;  1E6E B;  3P63 A;  5C2T B;  4YXD B;  3SFE B;  2ACZ B;  3P1M A;  4ZHO A;  1E0Z A;  1NYQ A;  1JWA D;  1R7S A;  3AE1 B;  4N6E B;  2PIA A;  1ZXI A;  3ETR A;  1TKG A;  1QOF A;  3AEE B;  4JWU C;  3AB5 A;  3AE2 B;  1E7P B;  3VR8 B;  1JWB D;  1WRI A;  1PFD A;  1QF6 A;  3AED B;  3NVY A;  1RFK A;  1WXQ A;  1KFY B;  1NYR A;  1N5X A;  5MPO A;  5H92 C;  1NVI D;  1EWY C;  1FFU A;  1QLB B;  2G1E A;  2OHF A;  1VLB A;  3ABV B;  1CZP A;  2QJL A;  1AYF A;  1E9M A;  1XLQ A;  2W3R A;  1V8C A;  3P4R B;  3P4P B;  4YT0 B;  4YTP B;  1JRP A;  4ZHP A;  4YSZ B;  2QIE B;  1L5P A;  3NRZ A;  1JW9 D;  3HVZ A; 
#chains in the Genus database with same CATH topology
 1E10 A;  1UT5 A;  5DQG A;  2GB1 A;  5J18 A;  3EZ5 A;  1XT9 B;  2WXL A;  1A77 A;  4DL3 A;  2EZZ A;  2F2A B;  2QAR B;  4RPZ A;  1V9P A;  3WK8 A;  2L76 A;  4DWI A;  4TMA B;  8ICE A;  2JR5 A;  2IY1 B;  2NPT A;  5ALJ A;  3RRG A;  5AZF A;  4K4H A;  1MC8 A;  3MDA A;  3V6C B;  4KX6 B;  4W9J A;  1ZQF A;  3NVW A;  7ICV A;  1S3S G;  1BPX A;  4PL2 A;  2D3C A;  2DYB A;  3B9J A;  3D6J A;  2BYE A;  3KYD D;  2K4H A;  4H2A A;  4LLG M;  4KLO A;  2Y5C A;  2WB1 C;  2JF5 A;  4LJP B;  4IM3 A;  2MJ3 A;  1C9F A;  4F4X A;  1L0Y B;  1LGR A;  4I6P A;  1NZB A;  2FBW B;  1X9W A;  3MC0 B;  2L0F A;  4PS3 A;  9ICK A;  2UVV A;  3EWA A;  2N9E B;  2I2Y A;  3AH7 A;  1NK8 A;  3TFS A;  5AK5 A;  2WXJ A;  2CJN A;  3K9O B;  1SIJ A;  1WXA A;  3BQ0 A;  3SV3 A;  3RAX A;  1J7A A;  3GIM A;  2DGZ A;  2E8N A;  3QX7 A;  3UXN A;  4YSY B;  1ZQW A;  4XWW A;  2FCQ A;  2WXN A;  1EXN A;  2BGF A;  3N9Y C;  4Y2U A;  4RNA A;  5CRX A;  1XNS A;  2HHT A;  4O3P A;  2BCS A;  2LHD A;  1GJZ A;  4KDI C;  4I2H A;  1P0R A;  5G5G A;  2LHT A;  2KAN A;  3RNB C;  3NVZ A;  1L4D B;  2R8H A;  4NLB A;  2DX5 B;  4EYH B;  5JRT A;  3RJK A;  1KRH A;  2GBN A;  2MWS B;  3TJP A;  4F2S A;  2JSV X;  5GMV A;  3UIO B;  4ZYS A;  4HPM B;  1QOA A;  1SB3 C;  3DEE A;  4PHE A;  5FR6 A;  4QZF A;  3AEA B;  5KL8 B;  2KT7 A;  4W9I A;  5AZH A;  1SKW A;  2HOI A;  2MBH A;  4XWT A;  3MR2 A;  4C4V A;  1BNO A;  4OJL A;  1WWU A;  4WWM A;  2K4P A;  2FMP A;  2WX0 A;  1DOI A;  4W9K A;  1ZQN A;  1ZQS A;  1TFR A;  2FMS A;  2FE9 A;  4RNM A;  4O3R A;  2WYQ A;  2N1R A;  4RQ8 A;  3PNC A;  3VFK A;  4AQ7 A;  9ICX A;  4XDD A;  3PR4 A;  2C2E A;  3AB5 A;  2MRL A;  3RB6 A;  1KSP A;  2KLC A;  4P2H A;  4B0M A;  5D94 A;  3QYP A;  4IKG A;  4KZ0 A;  2NRV A;  2NRZ A;  1CZP A;  5DG7 A;  1E9M A;  1TS4 A;  4OZA A;  5EDS A;  3LWL A;  4ANU A;  3GDX A;  5E6J A;  4GOC A;  1T0Y A;  1YOV B;  5ALK A;  5KFJ A;  2VJ5 A;  1C3T A;  4HLE A;  2BPG A;  7ICH A;  1Q1O A;  4JV2 A;  1ISN A;  1Q46 A;  3GE8 C;  2F1I A;  1ED1 A;  4C56 C;  8ICB A;  4I2F A;  4AOF A;  1JWU D;  2SEB D;  1UHU A;  2KJR A;  3MFG A;  3H4B A;  4ECU A;  2I1K A;  5KG6 A;  1EF5 A;  2NTS A;  1ZQQ A;  3Q3F A;  3ZD8 A;  4ED8 A;  2QSD A;  5KFV A;  4YXJ A;  2HHQ A;  3ZYY X;  1ZQZ A;  2F1J A;  4R64 A;  3M9M B;  2D3G A;  1TE2 A;  2KK0 A;  2BPF A;  1K53 A;  5L1I A;  4DF8 A;  2R18 A;  2ZIX B;  5DB9 A;  2PPH A;  1J8C A;  2E3T A;  4AYB F;  2IOF K;  1S0M A;  1LVH A;  3H9D A;  2V4L A;  3MAB A;  3RTV A;  4MFC A;  3RNA C;  1S0V A;  3OHB A;  5JUM A;  3F2C A;  5AKJ A;  1OUQ A;  4IR1 A;  2LVO A;  4MFA A;  4BZA A;  4REZ A;  3IXS A;  2ZZP B;  4F4K A;  4C8O A;  1YNT E;  1RZT A;  3H0L B;  4IL6 U;  3QNM A;  2VJ4 A;  1L8O A;  2F1H A;  5BOM A;  2JPH A;  1LKY A;  4YD1 A;  2E8O A;  4B9L A;  3N30 A;  2WF8 A;  1L6U A;  1WY8 A;  4NY0 A;  4C80 A;  4UB5 A;  2MLB A;  4KZC A;  2O6V B;  3S2A A;  2XBB C;  4TUR A;  3OSP A;  1F2R C;  3I63 C;  4RF0 A;  2IBI B;  1ZQI A;  1Q10 A;  3N20 C;  1WE6 A;  2D10 A;  4UAY A;  3R8B A;  3M6K A;  2IO3 B;  3NGD A;  4RQ1 A;  2D8C A;  2A19 A;  4GDL A;  5GXG B;  3WAO A;  3GOE A;  1WSP A;  1U47 A;  1YJI A;  5HFY A;  1B9R A;  2JRZ A;  4USA A;  2C7H A;  2KQ4 X;  5IIO A;  1YZ6 A;  1WMH B;  2ODG A;  4XE0 A;  2LGD A;  4ED6 A;  3V6K A;  5E6O A;  3CRX A;  2HJ8 A;  2IGD A;  4HXD A;  1ECW A;  2RPQ A;  1GNU A;  4GFJ A;  3N1X C;  2DL0 A;  4F92 B;  1KFS A;  5TIS U;  1I4P A;  4MJS A;  9ICO A;  3GFK B;  2KMM A;  1WWT A;  1TK5 A;  4XUS A;  2W03 A;  3M6Z A;  2LFI A;  3TAC B;  2N1W A;  3BDP A;  2BF8 B;  3WIM A;  4ELU A;  1STE A;  1PYW D;  1OEY A;  4NQK E;  2FI1 A;  3IT4 B;  1F2R I;  5BYR A;  2ATL A;  3SAF A;  3VH4 B;  3HP6 A;  4GXI A;  3ZDA A;  2MP2 A;  4QZB A;  4JV1 A;  2I5H A;  1L7N A;  2I6X A;  2ZJA A;  3BQT A;  5KFB A;  1XC9 A;  2ISO A;  1OQY A;  4TUU A;  3P42 A;  3O13 A;  2YEP B;  3P4P B;  3L17 A;  3ZIM A;  3JYU A;  4QAY A;  3ZDT A;  3OHA A;  2VIX A;  2WAQ C;  4M9H A;  3ML8 A;  4Y2J A;  2QIE B;  2KDB A;  4ELT A;  1J7B A;  2RPV A;  3IP4 B;  4YG2 A;  1PK3 A;  3RT3 B;  1KQQ A;  4FLH A;  3KH0 A;  3B08 A;  1QKZ A;  1TZ1 A;  1RRB A;  2V3S A;  2QDF A;  2D07 B;  2PMV A;  2BCV A;  1U4A A;  4NQL B;  3UGB B;  1MN8 A;  4BKT A;  4EEW A;  1HXY D;  1Y88 A;  2HOF A;  5DB8 A;  3ALB A;  4KN7 A;  4GXK A;  2OEH A;  4C7Z A;  4IQW A;  1C4C A;  7ICO A;  2ZJD A;  3IG8 A;  1NK4 A;  3JPQ A;  4QIW F;  1C4A A;  2I1J A;  4CF4 A;  8ICI A;  4RQ7 A;  4KGS A;  1XCT L;  4TKN A;  2MJE A;  2Q0Z X;  3ZI4 A;  4A8E A;  3NJT A;  2ZNV B;  4OVZ A;  4RQ3 A;  2V9W A;  8ICT A;  4PHP A;  2C7M B;  2EKI A;  3A4S C;  2LGS A;  3PSP A;  4FHJ A;  2WX1 A;  1L3S A;  1RYJ A;  1SXD A;  2YB4 A;  4UBB A;  2JZP A;  3URY A;  5LNK 1;  4O3M A;  2EEL A;  4RGT A;  4I2E A;  3APC A;  1JWM D;  3J9C A;  5C3J B;  2HVI A;  4MGY E;  2DKX A;  1OQR A;  1UWM A;  2W82 A;  8ICV A;  3TQ1 A;  2GI9 A;  3AEB B;  4J3O D;  4EBE A;  4BWM A;  5IA7 A;  2BPC A;  9ICW A;  2ZTC A;  2R2Q A;  2ES6 A;  1GC6 A;  2M0A A;  4GU2 A;  1ZQJ A;  5KFQ A;  1WFY A;  5KL1 B;  4DL7 A;  4M9N A;  3H8H A;  8ICN A;  1D3Z A;  3AL0 B;  3BZK A;  3GU3 A;  5IIM A;  4I2C A;  3C29 A;  3R7R A;  4RF1 A;  3ZRF A;  2WXQ A;  3ZQ4 A;  1KM7 A;  4QZI A;  2WQY B;  2O6V D;  4KKJ A;  4YWG G;  2HHV A;  3H8W A;  3UI3 A;  3AV8 A;  2M1M A;  1D5X C;  2XK5 B;  2BYF A;  3F2D A;  2ZW1 A;  1WF9 A;  1WXM A;  4HJG E;  2YEP F;  2INN E;  3PZ8 A;  3VDZ A;  2KXJ A;  4KIT B;  3QUQ A;  3GQC A;  3SV4 A;  1KTK A;  2D2Q A;  4DSK A;  2D3D A;  2KWU B;  1VJ5 A;  3KYC D;  5DGA A;  5KG1 A;  4W9E A;  3NZ3 A;  4P0Q A;  4B9V A;  2MBB B;  3AU4 A;  1ZQM A;  3OPX A;  1M94 A;  1XLP A;  2GBM A;  3KUD B;  3WK7 A;  3M8S A;  4B9K A;  1UA1 A;  2LZ6 A;  2WFA A;  5EE1 A;  5G2N A;  1UT8 A;  4IDI A;  4UDU C;  4DHJ B;  1N48 A;  4HVB A;  3K4G A;  4M9J A;  3EW9 A;  2WDT B;  1Z00 B;  2D3B A;  4C4R A;  3PGE A;  4NWI A;  3PX0 A;  5J0O A;  1UBI A;  4M6W B;  1WXQ A;  2EH9 A;  1YX6 B;  2AQ4 A;  2L1A A;  2HBJ A;  1QLN A;  2G1E A;  3H8S A;  1CRX A;  4F5N A;  1K5O A;  2IO0 B;  2WF9 A;  2K6Q A;  5AI5 A;  4RT2 A;  4MF2 A;  1S77 D;  2N7J A;  2ZPY A;  1A0P A;  5BYQ A;  2B0C A;  4M04 A;  4QWA A;  3AMZ A;  2W9B B;  3C19 A;  2WF7 A;  4RPX A;  2LVP A;  2CRX A;  5EE3 A;  7ICS A;  5L1J A;  2RSU A;  2JEJ A;  3M7D A;  2M19 A;  3R2T A;  1WE7 A;  1QZE A;  3LK9 A;  1Q3U A;  1HTO A;  2QMT A;  2NBU A;  4LNK A;  4ECQ A;  2C2D A;  2K25 A;  4II2 B;  2MBE A;  2K8B A;  1ZJN A;  5KTQ A;  1KLN A;  4R8U A;  3PTF C;  2N7E A;  3IRU A;  5IKC M;  1RPL A;  1WUD A;  2XO7 A;  5KG7 A;  1FEH A;  2LMC A;  1YJJ A;  1V86 A;  1NI3 A;  3C1Z A;  1KLG D;  2MEK A;  1Z4O A;  3TEY A;  1GC7 A;  3LVV A;  4KLL A;  4US9 A;  4F93 B;  2FLL A;  5ALF A;  4BFR A;  4XA5 A;  4A3O A;  1RFA A;  3RB4 A;  1FFV A;  1JI7 A;  2KKP A;  2LBO A;  1Z5S B;  4M0W A;  5TR5 A;  1F0Z A;  4UW9 A;  4I2B A;  4WWO A;  5AIA A;  3Q8Q B;  4ELV A;  4YTN B;  1MVK A;  3RFA A;  5J0T A;  1X42 A;  4OJ6 A;  1TZO A;  2EMT A;  4HJK A;  2AHO B;  4ZOH C;  4QZG A;  4TUQ A;  3OJU A;  3A1Q B;  2LYA A;  2GMI C;  4DSL A;  5JHB A;  5ALP A;  1H4R A;  8ICY A;  2IHM A;  2FID A;  3J81 j;  2GBJ A;  3KW5 B;  5BPC A;  2G0A A;  1JXE A;  1ZQC A;  7ICR A;  2DYM A;  3QC8 B;  4JX1 C;  3ZNI D;  5BMI A;  1ZP0 B;  3T5J A;  4WJ3 B;  3HK0 A;  2KSO B;  1Y8R C;  5C23 A;  4DXF A;  4EEY A;  4LZG A;  2P6R A;  3JPS A;  3N32 A;  4MEX A;  4XX5 A;  4YQW A;  4KLS A;  1P7E A;  3OJ4 B;  3T79 A;  1QOB A;  1DOQ A;  4FJY A;  4DQQ A;  3D2Q A;  3DHI C;  4HRS A;  1ZDV A;  2UU7 A;  1NZP A;  3TBL D;  1EO6 A;  1GPX A;  4GC6 A;  1FXI A;  2IHN A;  4BKS D;  5HR7 A;  2JMG A;  2Y0S C;  3PSI A;  4J9R A;  2RR9 A;  7ICT A;  2H3V A;  1ZQR A;  8ICX A;  1C20 A;  1X9M A;  1F1H A;  2KWC A;  2ZIV B;  1QF6 A;  3N97 B;  1E7P B;  1WRI A;  1L7P A;  8ICR A;  2CR5 A;  3A9K A;  3AED B;  1BPE A;  2JUO A;  4M8M A;  1K51 A;  4JWN A;  4DHJ D;  2JT4 B;  4Q45 A;  1XD3 B;  2ZIW B;  4BWJ A;  3ABV B;  4O3S A;  3KLS X;  2F8K A;  4ARC A;  4I2I A;  3Q8P B;  4FJZ A;  1ZQP A;  2BHN A;  2NBV B;  1Q5W B;  2DFL A;  2W7P A;  4W9H A;  1YQB A;  1PK1 B;  4HKZ E;  5ALZ A;  5AKE A;  3ISD A;  4I6N B;  1L2N A;  3FKY A;  5III A;  4QZ8 A;  1X2I A;  4ICU A;  8ICM A;  1WJN A;  4RCO A;  1S5L U;  2ASQ A;  2W9N A;  3C1Y A;  1ZXH A;  2CU1 A;  2HCF A;  2MUT B;  4WQM A;  1FCC C;  1X40 A;  4IQV A;  4ECX A;  1KOT A;  2RGF A;  1X6I A;  4GXJ A;  1TYG B;  1MFW A;  2CJO A;  3ZJU A;  2W04 A;  2AH5 A;  5A0L A;  3ISB A;  1XCQ L;  3KZI U;  7ICP A;  4NXZ A;  1MG4 A;  1WH3 A;  3IN5 A;  2W7O A;  4G50 A;  3SEN A;  4HDO A;  2VA2 A;  4CGZ A;  4GMV A;  2BVC A;  1KF6 B;  3IT6 B;  3PY8 A;  1OFF A;  3MJW A;  1JIH A;  1EUV B;  4NL9 A;  1A5R A;  4UB4 A;  5IIL A;  1FRR A;  1Z1V A;  3RAQ A;  4IR9 A;  7ICE A;  2MA1 A;  4G3I A;  1VCB A;  3W5V B;  4N58 A;  1ZOY B;  4EEN A;  2KTQ A;  1TS3 A;  1JQ4 A;  3AE4 B;  1XSN A;  4Y2R A;  1L6N A;  5IIJ A;  5AIC A;  3PZP A;  3KHG A;  2IZV B;  1ARO P;  1C7Y A;  1VZ6 A;  4OJP A;  5KG4 A;  5KT7 A;  4QW9 A;  2LXC A;  3CWI A;  2YMM A;  4I2G A;  2DZJ A;  2L7R A;  4Q2J A;  2V4R A;  1TTN A;  3GIL A;  4GLS C;  4IRK A;  2RDB C;  8ICJ A;  2O2V A;  3IHP C;  2N9P C;  3RNF C;  3FIL B;  3V61 A;  1V5O A;  2WXI A;  1QQ7 A;  4GC7 A;  2CHW A;  5L9X A;  1JUD A;  2IPK D;  1L7O A;  2Y1I A;  2Y9T A;  2AQ1 B;  2PE6 B;  3TAD A;  2E8M A;  1ZRN A;  2ZXH A;  4WJN A;  3B0A A;  2K89 A;  4ED0 A;  3U8Z A;  1FIQ A;  1SIF A;  1PDX A;  2WXO A;  4FZM A;  1WI0 A;  4J6I A;  2KMA A;  1KEJ A;  3TFR A;  5LLI A;  4GDK A;  2G5H B;  3E58 A;  3R9K A;  3UF8 A;  1SZP A;  3WAL A;  3GII A;  2AGQ A;  4FS2 A;  1FNV A;  2ACZ B;  5C2T B;  2VH2 A;  4ZHO A;  2PEA A;  1KLV A;  1R7S A;  5ALM A;  4ANX A;  3ENE A;  3PLU A;  2FUH B;  2IO2 B;  1PVQ A;  3H40 A;  4RH6 A;  1ZD2 P;  2L8J A;  2W11 A;  3ZW3 A;  3MC9 A;  1N5X A;  2W8K A;  3C21 A;  1NVI D;  1EWY C;  1R4N I;  1AAR A;  3WU2 U;  2KIW A;  2DEN B;  4DO9 A;  4RQ5 A;  2R2O A;  4QJF B;  4A3P A;  3PX6 A;  3SHQ A;  1ZQD A;  1UNS A;  3SFD B;  2EMS A;  2KC1 A;  1FM0 D;  8ICA A;  1RM6 C;  4PHD A;  3N28 A;  4Y2Q A;  4RT3 A;  1ZD4 A;  2AU0 A;  4CHK A;  3CF6 E;  4G0N B;  3TEZ A;  4OZC A;  4D2K A;  2ZUD A;  5J0U A;  3ZD9 A;  2AX5 A;  2XNA C;  4XRH A;  1PVR A;  3WKD A;  4EYI B;  4DSJ A;  1COK A;  4ZRQ A;  5KT4 A;  3ZDC A;  4CF3 A;  1R4N B;  4DL2 A;  4ICV A;  3DWM A;  4G3X B;  4G9B A;  8ICG A;  4LJX A;  2K5P A;  4Y2P A;  2N0S B;  4I28 A;  4JMU A;  1R4M I;  4ZDV A;  5ALX A;  4MEL A;  1CJE A;  2GOW A;  2VA3 A;  2XCA A;  3ZDB A;  1XXG A;  1KBU A;  2G08 A;  1L0V B;  1GUA B;  2JYE A;  2W9C B;  2BKF A;  2IGH A;  4ECR A;  3DBH I;  1OXJ A;  4C00 A;  4YTM B;  1LFD A;  1NKE A;  3HUI A;  1OQQ A;  2Z59 B;  4BBN F;  2F76 X;  2YQE A;  3ZLZ A;  2FDR A;  1UEL A;  3O65 B;  4MM3 B;  5ALS A;  3R2I A;  3WKB A;  1DOX A;  4ECS A;  8ICW A;  2YB1 A;  1PGB A;  1J19 A;  1Q0W B;  1R4M B;  1NK5 A;  3WCQ A;  3DBL B;  2HE7 A;  2PKO A;  1IUE A;  2VH1 A;  5CTR C;  3PST A;  3KHL A;  1SL0 A;  3RZW C;  4HWI B;  1I4H A;  2OWO A;  3BYY B;  3GZF A;  4FBU A;  2KN5 A;  1TAU A;  4R66 A;  1QCK A;  4DOA A;  2JWU A;  3HX0 A;  2V1Y A;  9ICT A;  4HPL B;  2RD0 A;  4LJO B;  2I9G A;  1NDD A;  2HHW A;  3I5J C;  1TAQ A;  2W54 A;  3A9J B;  3AXC A;  2LMR A;  4PS8 A;  2HHU A;  4IS7 A;  5L1M A;  5ALY A;  3HIL A;  4QZC A;  2L52 A;  5ALI A;  3DCG A;  3BQ1 A;  4AP9 A;  1XLO A;  3MR3 A;  2LJI A;  1WZ0 A;  4N9F 4;  4JE3 B;  1IYF A;  5IAA C;  5KFU A;  4BGD A;  3Q8E A;  4O1N A;  1TBE A;  7ICL A;  1MG8 A;  3PW0 A;  4GB9 A;  4GDL B;  5CX3 A;  4KLM A;  2WXM A;  1PGA A;  8ICQ A;  2IOF A;  2J0K A;  4KSL C;  3AE5 B;  5HHI A;  5DQH A;  4CDG A;  3OJ3 A;  2E1E A;  4ED2 A;  2KZZ A;  3H8J A;  5HI1 A;  1WGH A;  3JPP A;  2C2R A;  2K8C B;  3P1M A;  1V49 A;  3SAG A;  1Z2M A;  5J2R A;  2UVU A;  3AUO A;  4J9L A;  2ASD A;  2QIL A;  4YCX A;  2Z0D B;  3AE1 B;  1L7M A;  1I4R A;  3DVG Y;  4MEM A;  4AWJ A;  4RUA A;  1NKC A;  2GBR A;  1SL2 A;  5CHW A;  3C2L A;  1MA7 A;  5H92 C;  5AM3 A;  2KFZ A;  2L5Y A;  3MGI A;  3Q2A C;  5KFY A;  1V8C A;  2DZI A;  3C5G A;  2DZM A;  1B22 A;  3BK2 A;  3T3O A;  1WGR A;  5FR3 A;  3NRZ A;  1SL1 A;  3HVZ A;  5GTI U;  2JU6 X;  2B76 B;  4DSI A;  4M01 A;  4NJ8 A;  2KJ6 A;  3GB1 A;  4U7C A;  4AS1 A;  2KFK B;  3QXG A;  1CI4 A;  1I7H A;  2KWV B;  1RDF A;  1SGG A;  3KKA A;  4C4S A;  3V6H A;  2F77 X;  5ALG A;  1UGJ A;  2PE9 A;  3BIN A;  3BZC A;  4B9M A;  1FCL A;  4ZH4 A;  5D4B A;  5E6P A;  1SXT A;  3W2D A;  4P0P A;  5AIB A;  1L3U A;  2DAF A;  2ZEQ A;  4C4T A;  4C0Z A;  2HVH A;  3G6V A;  3D32 A;  1DOY A;  3Q8B A;  1S0N A;  1PVP A;  4MH0 E;  1KLU D;  3M9N B;  3PZ7 A;  3FC4 A;  4FBJ B;  1IBX A;  4OJO A;  2VAN A;  5ALL A;  2GLS A;  1V9J A;  3GIK A;  4J9S A;  2KAC A;  4PYZ A;  1B4F A;  4R3D A;  1V1P A;  4Y2T A;  2ICI A;  2HSZ A;  2KN4 A;  2PFN A;  2M0X A;  1KTQ A;  3RBE A;  3UM9 A;  1ESF A;  5KFA A;  3H7P A;  3QZ7 A;  4O0I A;  4DS4 A;  1XEE A;  3KWL A;  2MAX A;  1QIL A;  4QIW C;  2G09 A;  3OSN A;  1UA0 A;  2BTE A;  1E8Y A;  4EZJ A;  4LTU A;  2NS5 A;  3UMC A;  4I6L B;  5AKY A;  4LNO A;  4IM0 A;  4P1C C;  3EEC A;  4PGX A;  3PW4 A;  4YMM A;  3GIJ A;  4S17 A;  2KNB A;  4MFF A;  1ZQK A;  2X8X X;  5G5H A;  5DLG A;  5AI9 A;  3IG5 A;  3IAM 1;  5FKA C;  1N5W A;  2ZTE A;  4K7S A;  4PH5 A;  3AI5 A;  5KFG A;  4NM2 A;  2WHI A;  3IG3 A;  4PL1 A;  1ZDX A;  2PFP A;  1T4G A;  1MQ3 A;  3SDL C;  3RF9 A;  2KYW A;  4M2Y A;  5AI6 A;  1RYR A;  3CIR B;  3WKA A;  1BVS A;  3K1Z A;  2BWF A;  4JQW C;  3MJ5 A;  2E6X A;  4KLD A;  4E71 A;  2C7N B;  1ZET A;  4EE2 A;  2CU3 A;  2ONQ A;  1ZE3 D;  5ALR A;  4J9N A;  3T5H A;  5TZV A;  1BT0 A;  3JPO A;  2JXJ A;  3KD3 A;  2DPJ A;  8ICO A;  2XID A;  2QAR A;  1WM2 A;  2RDJ A;  1KFD A;  5JTI A;  2VA8 A;  5CEH A;  3I76 A;  2BDU A;  1T0Q C;  2KZM A;  4B0E A;  5J0Y A;  2PMZ F;  1ZQO A;  2LI6 A;  2LJ5 A;  1QSL A;  4NLZ A;  2WU2 B;  1E6E B;  3EGR A;  4NPN A;  3TIX A;  3P63 A;  4X57 B;  4JGH B;  2AQ0 A;  8ICC A;  5J2J A;  4BXO B;  2AQ2 B;  4DWF A;  3JSV B;  2KVR A;  2WB1 F;  1WM3 A;  3ETR A;  2TSS A;  1QOF A;  3AEE B;  4Z6E A;  4Q44 A;  1Q8K A;  2KOB A;  4O3N A;  2UYZ B;  4B9N A;  4LZD A;  1RLF A;  7ICI A;  5HR6 A;  3PV8 A;  5MPO A;  4DQO C;  2QB1 A;  2PW9 A;  4XDC A;  4GSW A;  1RAX A;  2MRP A;  4MGI E;  3L0W B;  4X5V A;  1ZQB A;  1MHX A;  4GIV A;  3KVF B;  1NEN B;  4OVV A;  3BS7 A;  4LK0 M;  2XN9 C;  3PZD A;  2OCE A;  2ALZ A;  2PFO A;  3C23 A;  2JZB B;  4DQS A;  1JRO A;  9ICE A;  1V38 A;  3L10 B;  5J2C A;  4OHJ A;  1MI0 A;  2H3I A;  2GO7 A;  3QU7 A;  3AU5 A;  2HTH A;  3A0B U;  2EAP A;  4W9G A;  5CB1 A;  5EWG A;  1IV8 A;  1FEZ A;  3Q8K A;  4TQ0 A;  2IGG A;  3QEA Z;  2K4E A;  1TVA A;  1D6E C;  3U52 E;  1LO5 D;  5JHA A;  4CO7 A;  1ZYQ A;  2KO3 A;  1YZ7 A;  1SF0 A;  1HJP A;  1ZQT A;  2V3N A;  5AKK A;  3P4Q B;  2ESE A;  3CYM A;  2KDE B;  3DBS A;  2ZCC A;  3SR6 A;  2WF5 A;  3BS5 B;  4RZR A;  2OOB B;  4MSQ B;  5D49 A;  2HHS A;  3TUO A;  2QB0 A;  4FO6 A;  2AEH A;  5IIN A;  1WCN A;  3IV6 A;  2G4D B;  2LM4 A;  1HUZ A;  5I4D A;  2MCN B;  4RQN A;  1UZX B;  2AWT A;  3QX1 A;  4YFK A;  2EDU A;  3WK4 A;  3BWU D;  4I2J A;  1T0S C;  4RQ0 A;  3ONS A;  3EHV A;  3N7S C;  9ICJ A;  3E9S A;  3TMP B;  2LEK A;  1VZ8 A;  4QWD A;  1T7P A;  5CHG A;  2MU2 A;  1FPY A;  2L05 A;  4IQU A;  1ROE A;  3KZX A;  2P66 A;  5AUI A;  1L3V A;  3F5E A;  4KSK C;  3AE3 B;  1LM8 B;  2Y5B B;  2KK8 A;  4WIP A;  4F91 B;  5AKG A;  1WZ3 A;  4KMU A;  1NI2 A;  3Q14 C;  4KLJ A;  4JL9 A;  3UQB A;  5DG9 A;  1ET6 A;  2WDQ B;  2D6F C;  2M9N A;  1NBF C;  4FZN A;  4IM2 A;  3MR6 A;  4UB3 A;  5J2D A;  2N4F A;  1GB1 A;  2KJH B;  4NLN A;  2L0T A;  4MHV A;  3N7P D;  1M4V A;  2KG5 A;  3TEX A;  4F2R A;  1WXV A;  1L7Y A;  3V62 A;  3M9O B;  1T0R C;  3DOW A;  1S9F A;  1XO0 A;  3CW2 C;  3QK0 A;  2AXT U;  4P1B C;  4EZL A;  5L95 C;  5EWE A;  5EWF A;  4OO1 J;  2M17 A;  2N1V A;  2LRW A;  4RGO S;  2H3Q A;  5AK4 A;  5CR0 A;  1KJT A;  1DYQ A;  2C60 A;  2ASL A;  3SFE B;  4GIB A;  1NYQ A;  4MSM B;  1JWA D;  4S0R A;  4M47 A;  1TGZ B;  5HKH A;  1E8W A;  3VUY A;  1PFD A;  3RJF A;  4NL9 C;  2O6K A;  1NYR A;  5FK9 C;  4KX5 A;  2UWQ A;  2WXR A;  2JGA A;  3IHQ B;  5HNK A;  2FCN A;  7ICG A;  4UAW A;  1SXE A;  4O5C A;  3ZJT A;  4ZYN A;  4ZRK A;  4KLE A;  4NAM A;  2RLT A;  2UVW A;  3FM9 A;  3AUL A;  2IO1 B;  5J2H A;  4A6Q A;  1WX9 A;  4ECZ A;  3ZNH B;  3PT2 B;  3A9K B;  2MW5 A;  2ZIU B;  3B0X A;  5BO4 B;  1ZD3 A;  4ACO A;  1S10 A;  2L00 B;  3LYY A;  3W5U B;  2LPE A;  1SKR A;  4ZRJ A;  4AUQ C;  3B2F A;  4DF4 A;  2KLG A;  1HIW A;  2H3Z A;  3ED5 A;  5J0W A;  1A70 A;  4Z6D A;  2KE7 A;  1ENF A;  2BDP A;  4NLC A;  2PI4 A;  2SAK A;  4B6J A;  4TSS A;  3SD5 A;  3AN1 A;  1J7C A;  5KG3 A;  3RD2 A;  2LGX A;  3LWM A;  3AQE A;  2CHX A;  2G3Q B;  1QSS A;  2K22 A;  5KHQ A;  4YR2 A;  1KDH A;  1QT9 A;  4FS1 A;  1B0X A;  1ZQU A;  2JZ3 B;  1V81 A;  5JH5 C;  3PO4 A;  1LB2 B;  3QUC A;  1P1A A;  1WMH A;  1WIA A;  3O0F A;  2JHD A;  3TAD C;  5KFW A;  1EU3 A;  2KQ7 A;  5D3D A;  4EFO A;  4WJQ A;  4HYK A;  2ZCB A;  3ZUN A;  1SV4 A;  2GBK A;  3ZTD A;  9ICA A;  3R66 C;  1E5W A;  2HBK A;  2FAZ A;  4RFB A;  3L13 A;  2OM6 A;  2LKY A;  3JPT A;  4OZB A;  2ZPN A;  3SEB A;  2F8L A;  4KMO B;  5KHO A;  3EFC A;  1DK3 A;  5AK6 A;  3EA6 A;  4F4W A;  3NG0 A;  2NRX A;  1TS2 A;  4PZO A;  1B43 A;  1ACC A;  3RH6 A;  3A4R A;  3OJS A;  3DVG X;  5T8I A;  3RN9 C;  4YN4 A;  1ZJM A;  3NS1 A;  3NVV A;  5D2M B;  1DGS A;  3Q3O C;  3MR5 A;  4B95 A;  3M63 B;  3L08 A;  3AE6 B;  1XSP A;  4MH8 A;  5KFI A;  2V9H A;  4B6W A;  2K60 A;  4UAR A;  4ITK A;  4CNQ A;  4FFD A;  4DSF A;  2KDF B;  3W1Y A;  2KZ3 A;  5D7G A;  3TAR A;  4ECT A;  1UUP A;  5LXI B;  4UB8 U;  2Q5W D;  2VRR B;  8ICS A;  1P98 A;  2WP9 B;  3JPN A;  7ICK A;  8ICH A;  1HZ5 A;  4F5Q A;  3A0H U;  1DGJ A;  4DOC A;  4NLG A;  1NEK B;  2MHJ A;  4A8X C;  4A55 A;  7ICQ A;  1QH9 A;  1AWD A;  3PHW B;  5AKI A;  1NK9 A;  5HG2 A;  2WF6 A;  2W43 A;  4TQS A;  5HP4 A;  4YXD B;  3ZXR A;  3AQF A;  8ICK A;  5AM5 A;  4JIO U;  2RHF A;  4F3O A;  3RRH A;  1TKG A;  2HBL A;  1Y56 A;  1N56 A;  3A33 B;  1I4Q A;  4ARI A;  3NVY A;  3QA8 A;  2I1Q A;  4OJ5 A;  4F4Y A;  1JN3 A;  4GDK B;  2IMW P;  1RXW A;  3HVD A;  5KAF U;  3EPG A;  3IFW B;  1P3Q U;  1XLQ A;  3T5L A;  5C5J A;  5IO9 A;  4DHZ E;  4P4M A;  3AEV A;  3W1S A;  1C1Y B;  4DL6 A;  1TY0 A;  3JVZ X;  3RFZ B;  4CYE A;  2WS3 B;  4HAI A;  1QOG A;  2KVC A;  2Q4T A;  2A5U A;  1TAM A;  4MF8 A;  4PPX A;  3EUB 2;  9ICB A;  3PO0 A;  3U26 A;  5AKZ A;  4EX6 A;  3M8R A;  1TKY A;  1D5Z C;  2MH7 A;  3GV8 B;  2FPK A;  4BOZ B;  3Q8S B;  4US8 A;  3KFU F;  3DQV A;  1X6J A;  2PI5 A;  5CWR A;  2V3P A;  2M4N A;  2KTR B;  5BMH A;  4FA6 A;  5FP0 A;  1BXT A;  5DPR A;  4Z6C A;  2XY6 A;  9ICH A;  2K1F A;  2DYO A;  2QEJ C;  3AU2 A;  1NNL A;  4FBT A;  2HHX A;  2KHV A;  2FLP A;  3TCA A;  2QKQ A;  4LDT B;  2XK5 A;  4DFP A;  4KIK B;  1GG3 A;  2BQ3 A;  4EZ6 A;  2KX0 A;  1ZOL A;  4QZD A;  3VTW A;  3KTQ A;  1IGC A;  4MDK E;  4M9L A;  3QAR A;  3HKZ C;  1TIF A;  3OGU A;  2DPI A;  2KVS A;  1YD8 U;  4HPP A;  4ANV A;  3ZNG C;  1RQN A;  4GLX A;  1YQ4 B;  4IWQ A;  3VUX A;  2N9K A;  1KW4 A;  3C28 A;  4I27 A;  4E0D A;  2R8J A;  4K3B A;  4A20 A;  5BYS A;  1UCV A;  3T8M A;  4BAX A;  2FMQ A;  4UB2 A;  3E0F A;  2HW3 A;  4Q8E A;  3PLV A;  3RUI B;  4I29 A;  3H0M B;  1C77 A;  2LWP A;  4NAW A;  3WKC A;  5ALE A;  4BBN C;  4IRD A;  4M6W A;  3H8M A;  5F9N A;  4UAZ A;  2NPT B;  4IWP A;  1RG6 A;  1IG6 A;  3BK1 A;  3HM3 A;  2CN1 A;  3SMV A;  4E74 A;  2EAN A;  2K4I A;  5CP2 A;  1FMA D;  2NMQ A;  3R3M A;  4KV2 A;  1QQ5 A;  2KHW B;  2PTL A;  2KIC A;  1OGW A;  3AM9 A;  4KKI A;  1JWS D;  1WGY A;  3AEG B;  4RQ6 A;  2ZG6 A;  3MC1 A;  5KFZ A;  1K50 A;  2W9B A;  3KKA C;  1FNW A;  4NJC A;  2RRD A;  3ZO5 B;  1UPH A;  2HDO A;  3DVN U;  4XZ4 A;  4AJW A;  3QAQ A;  1F52 A;  3RMK C;  3DVN V;  1N60 A;  1WX7 A;  1BNP A;  3L54 A;  4DDG D;  3NZS A;  1PQS A;  2LVQ A;  5HMM A;  5ALV A;  3G6Y A;  4C8N A;  4K4G A;  2AQ3 B;  2A4Z A;  2KV2 A;  2LYH A;  2KD0 A;  1Z1B A;  1NK7 A;  1E0Z A;  1TT5 B;  4DK5 A;  2J6T A;  1BPD A;  2PIA A;  1O08 A;  5ALW A;  4EBC A;  2R8G A;  2K8A A;  1UWX A;  4P7I A;  2KN7 A;  3PMN A;  4KLU A;  1WJU A;  4NJ6 A;  1PGX A;  3N3K B;  4ZHP A;  1AYF A;  4YTP B;  3Q8C A;  4BJQ A;  1S76 D;  2LUE A;  3OG5 A;  4F8C B;  4UAS A;  1WXS A;  2K0P A;  1O03 A;  1GAQ B;  3VRA B;  4QZA A;  3APF A;  2DHZ A;  2JRI B;  5L83 A;  2KHQ A;  5AI8 A;  4Q43 A;  4HCP B;  3N1Y C;  1FNU A;  2EKE C;  2PXI A;  2IBK A;  2BS2 B;  1ZGU B;  1YIW A;  1L8L A;  4WJO A;  3CMM B;  2G5I B;  2CPR A;  4DL5 A;  2OJW A;  2DZK A;  3A1Q A;  5KG0 A;  3ZDM C;  3RNC C;  4C4V B;  5AUK A;  3FDS A;  5G55 A;  1X9S A;  1UQV A;  3GZN I;  3VHT C;  2BQQ A;  3HM6 X;  4EKU A;  5BMG A;  5AI4 A;  1RXV A;  2XCP A;  1ZKH A;  3RNG C;  1AQ6 A;  1NK0 A;  2NVU I;  3APD A;  2JX5 A;  2PVG C;  1VJK A;  3K1R B;  2IJ0 A;  1A76 A;  3HIZ A;  1H38 A;  3V6E B;  1K1Q A;  2YMQ A;  5J2G A;  4DFM A;  2BB6 A;  4TV3 A;  3SU8 X;  4NY8 A;  3H7S A;  3VC8 A;  1D9F A;  4P0P B;  2BKR B;  2Y5P A;  2BQU A;  5AM1 A;  4IG7 B;  3WK6 A;  2F44 A;  3THV A;  3ORY A;  4LDT D;  4QWE A;  1CK1 A;  3NUH B;  5KFR A;  4RUC A;  1SKS A;  2ZVN A;  3QZ8 A;  3C2K A;  1WR1 A;  1X66 A;  4C8K A;  2WXF A;  2WGS A;  3NTU A;  1WG8 A;  4LCD E;  1RWS A;  3UQ0 A;  2FIF A;  2EZX A;  1HA5 A;  2IDY A;  4F1S A;  1VDV A;  5AKL A;  3H7P B;  3I57 A;  4W9F A;  3PW2 A;  3HWT A;  4LNN A;  3C5F A;  2VKQ A;  2XEW A;  1N2X A;  4JB3 A;  2BCR A;  3H7I A;  2JZZ A;  2K9X A;  3IM1 A;  2ZIW A;  2KFJ A;  5KFN A;  3KWV A;  2NRW A;  3NS8 A;  1YT3 A;  2R8K A;  3RR8 A;  2HTM E;  4YXM A;  2RDG A;  1S8O A;  4RM8 A;  3LVW A;  1PK1 A;  2LGY A;  4C7Y A;  4AYB C;  4OCZ A;  4GGQ A;  2K6D B;  1KKX A;  9ICF A;  3FAH A;  1NJY A;  1JML A;  4L23 A;  1U9L A;  5DB6 A;  1DRG A;  2C5L C;  3DBH B;  4K81 A;  3X0W A;  2BCQ A;  3LXF A;  3ZVV A;  2RP5 A;  1URJ A;  1IM4 A;  1SE9 A;  4YR0 A;  2MUT A;  5KFK A;  4O5E A;  2GRI A;  4CRX A;  2J7Q B;  3PSE B;  1LKY B;  4F71 A;  2RDI A;  4K4I A;  5J8Y A;  4EBD A;  2PJH A;  5DG8 A;  2JH1 A;  2QLT A;  2N7D A;  4RNO A;  3ZDE A;  4N6E B;  3DPD A;  4BOS C;  1SV0 A;  2X38 A;  1XWL A;  1SWW A;  2WXK A;  3ZNZ B;  3AE2 B;  4KLG A;  1HZ6 A;  3ZKJ C;  3HW8 A;  1J0G A;  4GN1 A;  3PX4 A;  1IXR A;  3QWZ B;  2BCU A;  3CSF A;  1MJD A;  7ICJ A;  1U49 A;  1FFU A;  2R8I A;  5KT6 A;  2PMZ C;  4YT0 B;  5AM2 A;  2MSE D;  2KZR A;  1NOM A;  4OVU A;  2KKC A;  5DKW A;  3P4S B;  1N61 A;  3OWE B;  5DLF A;  5F9L A;  4FHK A;  4HKQ A;  1L6V A;  3UQ2 A;  9ICS A;  5KFM A;  3OLM D;  5J29 A;  2LXA A;  5AKH A;  2BB5 A;  3UQA A;  3RJJ A;  3ZGZ A;  3BJY A;  2LYB A;  2V4I B;  1BPY A;  4TQ1 A;  4MEY A;  5ALD A;  5BOL A;  3V7K A;  4DQI A;  5GTH U;  1ZQH A;  5KFO A;  4BDP A;  1E8Z A;  4URK A;  1L0X B;  1OEY J;  4A90 A;  4MJS B;  3DDH A;  2BBC A;  1L4Z B;  2NR2 A;  4P6V F;  1D8B A;  4RU9 A;  3MC8 A;  1JRU A;  3FIL A;  4HCN B;  1YQ3 B;  2JEG A;  5LXH A;  1RYU A;  4ZRI A;  1NJX A;  4L1B A;  3V60 A;  2LUM A;  2MP2 B;  4Y2X A;  1KFT A;  5J0X A;  2FCS A;  5DBC A;  2OYY A;  2KJ5 A;  1ZUD 2;  2INC C;  4NM1 A;  2BKE A;  4HK2 A;  1YJ1 A;  5EE0 A;  4KN4 A;  1E7U A;  2EAM A;  3LDZ E;  5DDM A;  1JXL A;  3H6N A;  2D5G A;  1SGH A;  5KAI U;  5KFS A;  2UVR A;  2BWE S;  3UXP A;  1JAL A;  1X9X A;  2YX8 A;  3OAW A;  4MGK E;  1D8L A;  3IAS 1;  1TKE A;  2BGW A;  2JVC A;  1YMH E;  2KDM A;  3DWG C;  4L2Y A;  1GB4 A;  4DOB A;  3IVF A;  2NO4 A;  3VVW B;  2KC2 A;  1UGM A;  3AU6 A;  2QB0 B;  4PGY A;  2RMM A;  9ICU A;  2GH1 A;  4JWM A;  1C76 A;  2J52 A;  3C0R B;  3WK5 A;  2HI0 A;  5C0Y A;  2EQY A;  3GE3 C;  4JK1 A;  1S97 A;  3ETL A;  2FE8 A;  3NAS A;  1T5X D;  2LHE A;  9ICV A;  2REX A;  3MDC A;  2PLP A;  3G6X A;  2LRU A;  2IY0 B;  2V0G A;  1J2M A;  8ICF A;  2BYT A;  1TK8 A;  4FJV B;  1KRP A;  1V5T A;  4OW0 A;  4M9G A;  3RI7 C;  2WWZ A;  9ICL A;  3D2S A;  3L4P A;  2FUG 1;  3SD7 A;  5IOI A;  3L5K A;  3QCA A;  4UQG A;  2IA6 A;  1G6J A;  3B2G A;  2B3A A;  2W8L A;  4KGR A;  1T8E A;  1N63 A;  3PVX A;  4RGN A;  2WDV B;  3BVG A;  2A1J A;  2P35 A;  1RQL A;  3PSF A;  5J0S A;  4KTQ A;  4KLI A;  1QQR A;  2OJR A;  5DPT A;  2KNJ A;  4Y2Y A;  7ICF A;  2HJ1 A;  4CE6 A;  2AGO A;  2HD5 B;  5J2B A;  2YMP A;  4O5K A;  2VZK D;  4ANW A;  2W9C A;  2BQR A;  3IDW A;  4TQR A;  1TK0 A;  2IND C;  1JWB D;  2WXP A;  4FZL A;  5DQI A;  4BX9 C;  2FNJ B;  3I9V 1;  5AKX A;  3Q6B A;  1NKB A;  4BKG A;  4F5O A;  3RJI A;  1YN5 A;  1HEK A;  4O3Q A;  4MM3 A;  3LDA A;  1JRP A;  2CXY A;  4YSZ B;  1J2N A;  4DEZ A;  1Q3V A;  1L5P A;  4KX3 A;  2Z0E B;  1SE3 A;  3VR8 B;  3Q8A A;  1ZQY A;  3KOO A;  5IIK A;  5DGB A;  3NUQ A;  4JV0 A;  4EEK A;  5J0Q A;  1BUI C;  1FO4 A;  2XGQ A;  2AL3 A;  3I28 A;  2Y3A A;  3W9C B;  4DHZ B;  4P0Q B;  4WWN A;  4EZK A;  3ALR A;  4I2D A;  1EU4 A;  3LJ3 A;  1FD6 A;  4QWB A;  2Y1J A;  5CJ7 A;  2JEF A;  7ICN A;  2MQJ A;  5J2I A;  3UMB A;  3A9J A;  3VH3 B;  2H88 B;  9ICI A;  4IWO A;  1IPG A;  2KIV A;  3QQ8 B;  2WLB A;  4IUM B;  2KX3 A;  5ALU A;  2ZUB A;  3UPQ A;  2JYT A;  4RQ2 A;  1H8C A;  2ZJ5 A;  3TI0 A;  2Z7J A;  4IRC A;  2XGP A;  2JY6 A;  1WGD A;  4RQ4 A;  4KVG B;  4WQO B;  2FPL A;  3ICX A;  1UBQ A;  1SE2 A;  3VAW A;  4W9D A;  1ZQ1 C;  3LB8 C;  4PZN A;  1X1M A;  1ZQE A;  2BPS A;  4F8R A;  1N62 A;  4IC9 A;  4PK1 A;  1F77 A;  2D11 A;  2ZNV C;  2H5X A;  1CUK A;  3PS6 A;  1S0O A;  4WWP A;  5D46 A;  2K39 A;  2K8C A;  2KOX A;  3TAN A;  3QHT A;  1P9D U;  4DS5 A;  3AE8 B;  2GLE A;  5DPW A;  1JX4 A;  2WU5 B;  3S6J A;  3ZDD A;  1UH6 A;  2ISP A;  3M1Y A;  1OW5 A;  4B9T A;  4NNJ B;  9ICR A;  1WJ6 A;  2J0J A;  3W1S C;  3HT3 A;  4XGA B;  4A9A A;  2QCZ A;  4N59 A;  3MFH A;  2KD1 A;  3OTQ A;  2KWD A;  4XYC A;  3RPF C;  1BGX T;  2BYV E;  2K8B B;  2MBO A;  3EYZ A;  2DUY A;  2FCM A;  4R8U B;  5JZE B;  2YN4 A;  3V3X A;  5E79 U;  4ED7 A;  2HBM A;  1SBB B;  5KG5 A;  4F5P A;  2W55 A;  5K4L A;  5KT3 A;  2MJD A;  3U30 A;  1ZRM A;  1C78 A;  2ON8 A;  4ACF A;  4K1R B;  4AJY B;  2KFK A;  3RR7 A;  3ZTC A;  3QJZ A;  5F3X B;  2W9A A;  1XQQ A;  3RJE A;  1JMS A;  2A1A A;  4XQ8 A;  5KFE A;  1WRD B;  3NHE B;  4W9L A;  8ICL A;  5D3I B;  2KKV A;  4HRO A;  4NJ7 A;  3L16 A;  4RQM A;  3PW5 A;  3NZU A;  4IC7 B;  2EAO A;  3CST A;  3Q3J A;  3Q69 A;  2QC8 A;  4EEL A;  3QUB A;  2G45 B;  4HDQ A;  4M0W B;  5J17 A;  4CQN A;  2KDI A;  4JWU C;  2M0N A;  3V72 A;  3T3F A;  4EZ9 A;  2ZW0 A;  1RFK A;  5C1Z A;  3KBB A;  1QLB B;  2JXT A;  3VTV A;  5J2F A;  3Q8R B;  2QJL A;  3P4R B;  2W3R A;  2N9X A;  3K9P B;  1SWV A;  4ZRP A;  4J9M A;  5KFP A;  2ASJ A;  4RM9 A;  1WJ4 A;  4RPY A;  2KAJ A;  3PR5 B;  3F2B A;  1XU4 A;  4RNN A;  2B6G A;  1L3T A;  4WUR A;  4K3C A;  1J97 A;  2DF4 B;  2ZIX A;  5KFT A;  4YMN A;  4YP3 A;  2L32 A;  3AEF B;  4LNF A;  3Q8F A;  3NRW A;  5KNI A;  4UBC A;  2RDH A;  1I4X A;  2BT6 A;  3BVZ A;  1HTQ A;  3QU9 A;  3GV7 B;  4KLT A;  4M00 A;  2V4Q A;  3TAQ A;  1M6Y A;  3ZJV A;  3M3J A;  2W3S A;  5H2F U;  1IP9 A;  3KHR A;  1RYS A;  3MP9 A;  3E2E A;  1MPE A;  1UF0 A;  3NOB A;  3TEW A;  1ZQV A;  1DK2 A;  1WWV A;  3GS2 A;  4M02 A;  3KUZ A;  5TSS A;  3V7J A;  3V6J A;  3RBD A;  3M95 A;  1MQ2 A;  1TY2 A;  1LV5 A;  3BQ7 A;  3MHZ A;  1TS5 A;  2MSN A;  1F9J A;  4F7Z A;  3HJE A;  2I38 A;  2O6V A;  4DQP A;  5DPS A;  3FYH A;  1PZN A;  3WAM A;  2JEI A;  2KP7 A;  2N9L A;  1T3Q A;  2YTU A;  2KJ8 A;  1FRD A;  5JU5 A;  4WAF A;  3T9L A;  2XC9 A;  1HQR D;  4BXO A;  1V80 A;  2MBQ A;  4OD0 A;  1D8Y A;  3JSV A;  2H89 B;  4WAA A;  2J4X A;  4C8M A;  1V85 A;  1U48 A;  2JWZ A;  5KFC A;  1F44 A;  2K8H A;  2IOH A;  5ALT A;  4KDL B;  9ICQ A;  2CHZ A;  4DLG A;  3I1Y A;  4DFK A;  3VCB A;  3RB0 A;  1Z4N A;  2FJ6 A;  5J0P A;  1ZQX A;  3EC8 A;  1AN8 A;  1ZD5 A;  2P6U A;  2YY6 A;  4M0A A;  3RNE C;  4K7W A;  3WAP A;  4Q8F A;  1T6B X;  4NAW B;  5IN7 A;  1VZ7 A;  2PKE A;  2KEY A;  3L3F X;  1NK6 A;  4QWC A;  4FE3 A;  4YD2 A;  3BZD B;  2KFN A;  3VTU A;  5DDY A;  2OED A;  1N6Z A;  1WGK A;  2CKH B;  2JZB A;  5KFF A;  4K7U A;  3MGV A;  3B1L X;  3VQI A;  3U7Z A;  3T3N A;  4UB1 A;  8ICU A;  3H4D A;  2BZF A;  2MX2 A;  1D5M C;  4P4O A;  2OH2 A;  2AJQ A;  2NRT A;  2D3A A;  1A6S A;  4J03 A;  2FPM A;  1WYW B;  5ALH A;  4U6P A;  1D4B A;  1BPB A;  1L5U A;  4J9P A;  5L1K A;  4RMA A;  1I35 A;  2WAQ F;  5JXV A;  2OXO A;  1HUO A;  5HML A;  1CEZ A;  3Q3M C;  1ZXI A;  3SI8 A;  3QIJ A;  2NO5 A;  3MFI A;  4YL8 A;  2KMC A;  4MAC A;  5B66 U;  5KT2 A;  1U4B A;  2J53 A;  3Q3N C;  4ASW C;  4J9K A;  1BPZ A;  3V7L A;  3BYT B;  3BS5 A;  4KLQ A;  1F0M A;  4NZL B;  1NJZ A;  2ZVO A;  3PML A;  5ALQ A;  4R65 A;  3WA0 A;  8ICP A;  3KUC B;  3ZRC A;  1WR6 E;  3ISC A;  3RYT A;  2E1F A;  2O2V B;  5J2K A;  3DHH C;  4DQR A;  2J42 A;  3TSS A;  1I42 A;  2LD9 A;  3BY4 B;  1E7V A;  2M8S A;  1GO3 F;  3UMG A;  9ICC A;  3I3T B;  4R63 A;  3SAH A;  5HHH A;  3PVL A;  4NLK A;  4J9Q A;  4WJP A;  5ALO A;  2LAS A;  4YMO A;  2GOL A;  1F5S A;  2EZY A;  5J2A A;  3C8Y A;  3JW0 X;  1COO A;  2E5S A;  1C4P A;  5L1L A;  2K3U A;  2WDR B;  3DHG C;  3PW7 A;  4B9S A;  4WH4 A;  3E56 A;  3RCZ A;  2J6S A;  4M8N A;  3N1Z C;  2DKZ A;  3WAN A;  3ONN A;  2AGP A;  1K1S A;  2KJ9 A;  4DSE A;  2G06 A;  1XS9 D;  1SJH D;  5AI0 A;  4ED1 A;  4KGT A;  1D9D A;  3PRZ A;  3PRM B;  4DL4 A;  9ICG A;  3DDC B;  3HRD D;  4UAV A;  1ZW7 A;  3K75 D;  3C2M A;  4C8L A;  1FXT B;  2M56 B;  3SZ2 A;  1P7D A;  4F5R A;  4DFJ A;  2A3V A;  1I4G A;  5J8Y C;  2AYO B;  2BR0 A;  3HPO A;  4MGZ E;  3ZXV A;  4Y2S A;  1P7F A;  3PRP B;  4ICA A;  2BW2 A;  1SV0 C;  4Z6F A;  2GWS A;  4EUT A;  3VXW A;  1ZQL A;  1PUZ A;  5AHX A;  4DCC A;  3T5K A;  3SEI A;  1MSW D;  1V6E A;  1V2Y A;  4AP4 C;  4B9U A;  4QZE A;  2XY7 A;  1XLN A;  5H8Y E;  3RZF A;  2KVZ A;  2WXG A;  3U4E G;  1T3N A;  5B5E U;  2JQR B;  3VRB B;  5AEK B;  4PGQ A;  1QSY A;  2L83 A;  3X23 A;  1TV9 A;  4BKS A;  2MA9 B;  4PT5 A;  3N7R C;  3QU5 A;  4YR3 A;  3SQI A;  1T94 A;  4PHA A;  2B21 A;  3RB3 A;  4JLC A;  1K8R B;  1WCL A;  1ZPS A;  1V1O A;  2NTT A;  4EX7 A;  4JUZ A;  3RH5 A;  2ZIU A;  4II3 B;  4CF5 A;  2CS4 A;  2DAJ A;  4P16 A;  3AEC B;  5AM0 A;  1ZQA A;  3LYS A;  3CNH A;  2WTF A;  2JH7 A;  1Z00 A;  3MGH A;  1DXS A;  4IOI E;  1KN5 A;  3PO5 A;  4UAU A;  2G07 A;  2KQS A;  2HOQ A;  4FXC A;  2LM1 A;  1S1Q B;  4JWS C;  4DXA B;  3Q8L A;  3UIP B;  4E3C A;  1C79 A;  4TUP A;  3U2S C;  5IP4 D;  4P4P A;  1HEZ E;  2LGI A;  3ML9 A;  2IYD B;  3GP7 A;  1CMX B;  7ICU A;  1YN3 A;  4IW0 A;  5DBB A;  4ED3 A;  3M62 B;  1E90 A;  2QHO A;  4FN2 A;  4QZ9 A;  5CHV C;  5KFD A;  2INP E;  2NBW B;  1KFY B;  3MTN B;  2RQ5 A;  5AM4 A;  1K52 A;  4HEA 1;  3UIN B;  1E8X A;  4F72 A;  3PHX B;  3RUL A;  1U45 A;  2L3Z A;  3QE9 Y;  3RJG A;  2C22 A;  9ICP A;  4KLF A;  4KLH A;  2DLB A;  4JPS A;  4BVU C;  4DXG A;  2W9M A;  4FUL A;  5KFL A;  1VLB A;  3WKE A;  2KMD A;  4UB6 U;  3U7D A;  3F53 A;  1KL9 A;  3GV5 B;  3PRE A;  2J0M A;  4O9M A;  5CA7 A;  3KHH A;  1YN4 A;  5HHD G;  1VR9 A;  2YML A;  4W9C A;  4Y2V A;  2C9W B;  1UD7 A;  1TKD A;  5AZG A;  3V05 A;  4EOY A;  2J6U A;  1FXA A;  1IGD A;  2NCN A;  4F50 A;  5KT5 A;  4PJ0 U;  3TAP A;  1XO1 A;  5E6N A;  3VUW A;  3BVM A;  3HHM A;  4YVZ A;  2DQN B;  3QUT A;  2BS4 B;  2G9H D;  4F4Z A;  3D2N A;  1QTM A;  1WYG A;  4I2A A;  4J9O A;  4DDI D;  3H1U A;  4RGM A;  2Z8L A;  2G4S A;  4DFD A;  3B0Y A;  1HE8 A;  2YVC A;  3BQ2 A;  3CP8 A;  4BUG A;  4UAT A;  1BML C;  1SSN A;  3ECI A;  3F5A A;  4IQT A;  5DBA A;  1EM7 A;  1LQB A;  3RJH A;  1SE4 A;  3IBE A;  2XI9 A;  5KFH A;  3PPA A;  1YX5 B;  5EOZ A;  2PVO D;  2AL6 A;  4GXB A;  2DWQ A;  1B1Z A;  3AE7 B;  3AE9 B;  5DB7 A;  3H0R B;  4CCH A;  1EWC A;  1SZH A;  2ZUC A;  3R7Q A;  3N4M B;  4YSX B;  2KSO A;  4ECV A;  4MT5 A;  5DCN A;  1V97 A;  1MHH E;  1QQ6 A;  1VRA B;  2ZTD A;  1WGG A;  4NV0 A;  5EE9 A;  3P2B A;  3QEB Z;  2NV3 A;  4QW8 A;  3EPI A;  3VR9 B;  2YLM A;  2JXX A;  2KTF A;  4PS7 A;  3DBR I;  4QZH A;  5KFX A;  2ZJ8 A;  2C28 A;  4FAD A;  1SJE D;  4O3O A;  2HMX A;  1IBX B;  9ICN A;  2XY5 A;  1PUT A;  3GZN B;  3Q8M A;  2E8P A;  2Y0S F;  5T14 A;  1NJW A;  1GOZ A;  3MHS D;  2JRH A;  1WX8 A;  1SEB D;  2WNM A;  1V1P B;  3WK9 A;  1LXD A;  1OTR B;  3BII D;  2BS3 B;  3EFU A;  2F3N A;  1XO3 A;  2DNF A;  3RH4 A;  2NYV A;  1Z3E B;  4LVS A;  1ET9 A;  2LI5 A;  2DBY A;  2ZIV A;  4QNL A;  4G11 A;  2KTR A;  3JPR A;  5CHF A;  3DV9 A;  1ZQG A;  3DBR B;  1TJE A;  5AK3 A;  2PFQ A;  5J0R A;  2HDE A;  3TL5 A;  5ALN A;  3QU2 A;  1Z19 A;  4KIK A;  1KH0 A;  2R61 A;  4XC2 A;  4LNI A;  4ECY A;  1XSL A;  1EF1 A;  4DLE A;  7ICM A;  3MBY A;  3TKA A;  2JV3 A;  1AW7 A;  5D6J B;  3HKZ F;  4ECW A;  2ZXI A;  3SYZ A;  1VD2 A;  5J2E A;  2XVT A;  2Y9U A;  8ICZ A;  4PYU A;  2WHE A;  3NY5 A;  2A1J B;  2H3F A;  2XIC A;  3PV1 A;  2OHF A;  3UXO A;  1IIP A;  1JCK B;  5KG2 A;  3QU4 A;  3DBL I;  2FLN A;  3KQ4 A;  4TUS A;  2WXH A;  9ICM A;  1CQV A;  2VZK B;  1XF5 L;  4DBG A;  1JW9 D; 
#chains in the Genus database with same CATH homology
 3Q8A A;  1E10 A;  1B9R A;  2GB1 A;  4HKZ E;  3LYY A;  3W5U B;  2WXL A;  3B2F A;  1BUI C;  1FO4 A;  1A70 A;  2Y3A A;  3W9C B;  1ENF A;  4TMA B;  2SAK A;  4TSS A;  3AN1 A;  1EU4 A;  4RCO A;  1FD6 A;  1J7C A;  1ZXH A;  4WQM A;  1FCC C;  2H88 B;  4KX6 B;  2K22 A;  2WLB A;  3NVW A;  1QT9 A;  2JYT A;  1TYG B;  2CJO A;  3ZJU A;  3B9J A;  1XCQ L;  1EU3 A;  4H2A A;  5D3D A;  4LLG M;  2Y5C A;  2MJ3 A;  1SE2 A;  1C9F A;  1L0Y B;  1KF6 B;  3IT6 B;  1OFF A;  2FBW B;  3LB8 C;  4RFB A;  3MC0 B;  1N62 A;  4OZB A;  2I2Y A;  3SEB A;  3AH7 A;  1F77 A;  2WXJ A;  1FRR A;  2CJN A;  1SIJ A;  3EA6 A;  1TS2 A;  3W5V B;  4N58 A;  1ZOY B;  3AE8 B;  1J7A A;  1ACC A;  1TS3 A;  1JQ4 A;  2WU5 B;  3AE4 B;  4YSY B;  5T8I A;  4XWW A;  3NS1 A;  2WXN A;  1VZ6 A;  3NVV A;  3N9Y C;  4RNA A;  4Q2J A;  2LHD A;  3CWI A;  4A9A A;  4N59 A;  3RPF C;  2KWD A;  5G5G A;  3AE6 B;  4GLS C;  4MH8 A;  3NVZ A;  1L4D B;  4ITK A;  3V3X A;  5D7G A;  1SBB B;  2W55 A;  3FIL B;  1KRH A;  1UUP A;  2MJD A;  1C78 A;  2JSV X;  2ON8 A;  2Q5W D;  2WXI A;  4ZYS A;  1QOA A;  1SB3 C;  2IPK D;  2WP9 B;  3AEA B;  2AQ1 B;  5D3I B;  1HZ5 A;  1DGJ A;  4XWT A;  1NEK B;  1FIQ A;  4HRO A;  4A8X C;  4A55 A;  2WXO A;  1PDX A;  4WWM A;  1AWD A;  1DOI A;  5HG2 A;  3Q69 A;  5C2T B;  4YXD B;  1FNV A;  2ACZ B;  4ZHO A;  4AQ7 A;  1R7S A;  4CQN A;  4XDD A;  1TKG A;  1Y56 A;  4JWU C;  3AB5 A;  4RH6 A;  1I4Q A;  4B0M A;  4ARI A;  3NVY A;  1RFK A;  2ZW0 A;  4IKG A;  1N5X A;  4GDK B;  1NVI D;  1EWY C;  1QLB B;  2JXT A;  1TS4 A;  1CZP A;  2QJL A;  1E9M A;  3HVD A;  1XLQ A;  2W3R A;  3P4R B;  4OZA A;  4ZRP A;  5E6J A;  3W1S A;  1UNS A;  3SFD B;  1TY0 A;  3RFZ B;  2WS3 B;  1FM0 D;  1QOG A;  1RM6 C;  2KAJ A;  3EUB 2;  4WUR A;  3PO0 A;  4C56 C;  2L32 A;  1TKY A;  1D5Z C;  2MH7 A;  3AEF B;  4OZC A;  3TEZ A;  1JWU D;  2SEB D;  2AX5 A;  2XNA C;  3MFG A;  4D2K A;  3Q8F A;  4US8 A;  2NTS A;  4ZRQ A;  2RDH A;  2QSD A;  2V3P A;  1I4X A;  2BT6 A;  3BVZ A;  3ZYY X;  5BMH A;  3DWM A;  1BXT A;  3ZJV A;  2W3S A;  2DYO A;  1K53 A;  2K5P A;  2N0S B;  2QEJ C;  1CJE A;  3MP9 A;  1XXG A;  1MPE A;  3TEW A;  2E3T A;  1L0V B;  2JYE A;  3GS2 A;  5TSS A;  2IGH A;  1IGC A;  1TY2 A;  4YTM B;  3MHZ A;  3HUI A;  1TS5 A;  1OQQ A;  2I38 A;  4REZ A;  4MM3 B;  3IXS A;  2N9L A;  1T3Q A;  3R2I A;  1YNT E;  1YQ4 B;  1DOX A;  1FRD A;  1PGB A;  2N9K A;  4WAF A;  3WCQ A;  1L6U A;  5BYS A;  4C80 A;  2PKO A;  1IUE A;  1HQR D;  2H89 B;  1I4H A;  2J4X A;  1F2R C;  3BYY B;  4RF0 A;  1Q10 A;  1C77 A;  2JWU A;  3R8B A;  3BK1 A;  2W54 A;  5GXG B;  1FMA D;  2NMQ A;  1AN8 A;  1WSP A;  2L52 A;  2PTL A;  5HFY A;  1YJI A;  3AM9 A;  1XLO A;  1T6B X;  1JWS D;  3AEG B;  4KKI A;  2LJI A;  1VZ7 A;  4USA A;  4NAW B;  4JE3 B;  2KQ4 X;  1K50 A;  4XE0 A;  1FNW A;  4NJC A;  3Q8E A;  3BZD B;  4O1N A;  2OED A;  1WGK A;  4GDL B;  2WXM A;  1PGA A;  2IGD A;  3T3N A;  3VQI A;  1N60 A;  3U7Z A;  3AE5 B;  1D5M C;  2AQ3 B;  1I4P A;  1D4B A;  2KMM A;  5HI1 A;  1WWT A;  2LFI A;  5JXV A;  3P1M A;  1E0Z A;  1STE A;  1PYW D;  2PIA A;  1ZXI A;  2QIL A;  3AE1 B;  1F2R I;  3IT4 B;  5BYR A;  1I4R A;  1UWX A;  4MAC A;  2J53 A;  5H92 C;  1PGX A;  3P42 A;  3BYT B;  2YEP B;  3O13 A;  1AYF A;  3P4P B;  3Q8C A;  1V8C A;  4YTP B;  4NZL B;  4ZHP A;  3BK2 A;  3T3O A;  2K0P A;  2QIE B;  5FR3 A;  3NRZ A;  2J42 A;  3HVZ A;  3TSS A;  1GAQ B;  1J7B A;  3VRA B;  2RPV A;  2JU6 X;  2B76 B;  3GB1 A;  1FNU A;  4AS1 A;  1QKZ A;  1I7H A;  2BS2 B;  2PMV A;  3C8Y A;  1HXY D;  1UGJ A;  1C4P A;  2K3U A;  1FCL A;  5AUK A;  2WDR B;  4C7Z A;  1SXT A;  1C4C A;  3W2D A;  4WH4 A;  3E56 A;  1C4A A;  1DOY A;  3Q8B A;  5BMG A;  4KGS A;  1XCT L;  1KLU D;  3PZ7 A;  3FC4 A;  1SJH D;  2JX5 A;  2PVG C;  1VJK A;  2IJ0 A;  2MJE A;  1IBX A;  2KAC A;  2BB6 A;  4KGT A;  4OVZ A;  4R3D A;  2EKI A;  1V1P A;  3HRD D;  2ICI A;  2KN4 A;  2Y5P A;  1ESF A;  2M56 B;  1L5P A;  1RYJ A;  1I4G A;  1XEE A;  2JZP A;  3URY A;  3KWL A;  5LNK 1;  2EEL A;  1QIL A;  3NUH B;  1CK1 A;  4RGT A;  1JWM D;  2BTE A;  3J9C A;  1P7F A;  4LTU A;  5C3J B;  2BW2 A;  2WXF A;  1OQR A;  1UWM A;  2W82 A;  2GI9 A;  1RWS A;  5G5H A;  3AEB B;  4J3O D;  1HA5 A;  2IDY A;  3IAM 1;  1VDV A;  5FKA C;  1N5W A;  3I57 A;  2M0A A;  5H8Y E;  1XLN A;  2WXG A;  3U4E G;  2JQR B;  3VRB B;  3H8H A;  1ZDX A;  2L83 A;  2K9X A;  4PT5 A;  4RF1 A;  2WXQ A;  3CIR B;  3ZQ4 A;  2WQY B;  4KKJ A;  4YWG G;  3KWV A;  3UI3 A;  3AV8 A;  2E6X A;  3MJ5 A;  4EE2 A;  1D5X C;  2HTM E;  2CU3 A;  2ONQ A;  1ZPS A;  1V1O A;  2NTT A;  2RDG A;  2ZW1 A;  1ZE3 D;  4HJG E;  2YEP F;  2INN E;  3PZ8 A;  4C7Y A;  4P16 A;  3AEC B;  1KTK A;  3FAH A;  1JML A;  4L23 A;  4IOI E;  3NZ3 A;  3LXF A;  4FXC A;  4JWS C;  1XLP A;  1C79 A;  2GRI A;  3U2S C;  4B0E A;  1HEZ E;  2LGI A;  3GP7 A;  5EE1 A;  4IDI A;  2WU2 B;  1E6E B;  1YN3 A;  3EGR A;  4UDU C;  3P63 A;  2AQ2 B;  4N6E B;  2TSS A;  3ETR A;  2X38 A;  1QOF A;  3AEE B;  2WXK A;  3AE2 B;  2INP E;  1HZ6 A;  1WXQ A;  1KFY B;  5MPO A;  2L1A A;  2G1E A;  1FFU A;  1K52 A;  4HEA 1;  4DQO C;  2PW9 A;  4XDC A;  4YT0 B;  4DXG A;  2DLB A;  4JPS A;  2N7J A;  5BYQ A;  1VLB A;  3P4S B;  1MHX A;  1NEN B;  3AMZ A;  1N61 A;  4LK0 M;  2XN9 C;  3OWE B;  4HKQ A;  1L6V A;  5EE3 A;  1JRO A;  1YN4 A;  2BB5 A;  5HHD G;  3ZGZ A;  2V4I B;  4OHJ A;  1MI0 A;  1VR9 A;  2M19 A;  4TQ1 A;  3R2T A;  2QMT A;  1L0X B;  4A90 A;  3V05 A;  2BBC A;  1FXA A;  1L4Z B;  1IGD A;  4P6V F;  4TQ0 A;  2IGG A;  3BVM A;  1D6E C;  3U52 E;  1LO5 D;  2BS4 B;  3FIL A;  2G9H D;  1YQ3 B;  1SF0 A;  1FEH A;  1WYG A;  2LMC A;  1YJJ A;  4L1B A;  2LUM A;  1NI3 A;  2V3N A;  3P4Q B;  1KLG D;  4RGM A;  2MEK A;  2Z8L A;  3TEY A;  1ZUD 2;  3SR6 A;  4US9 A;  1BML C;  5EE0 A;  1SSN A;  3TUO A;  1EM7 A;  1SE4 A;  5I4D A;  2D5G A;  2PVO D;  1FFV A;  1JAL A;  1B1Z A;  2DWQ A;  3AE7 B;  3AE9 B;  3BWU D;  3IAS 1;  1TKE A;  4M0W A;  1EWC A;  1YMH E;  2KDM A;  3DWG C;  4L2Y A;  3E9S A;  1F0Z A;  1GB4 A;  4YTN B;  1MVK A;  2LEK A;  4YSX B;  1VZ8 A;  1TZO A;  2RMM A;  4ZOH C;  1C76 A;  1ROE A;  1V97 A;  2J52 A;  1MHH E;  4MT5 A;  5AUI A;  1VRA B;  3AE3 B;  4WIP A;  5EE9 A;  3VR9 B;  2FE8 A;  1T5X D;  2LHE A;  5BMI A;  2PLP A;  1ET6 A;  2DYM A;  2WDQ B;  4JX1 C;  1SJE D;  1ZP0 B;  2V0G A;  2BYT A;  1IBX B;  1GB1 A;  1PUT A;  4DXF A;  1GOZ A;  4OW0 A;  1SEB D;  2WNM A;  1V1P B;  3L4P A;  1M4V A;  2FUG 1;  3BII D;  2BS3 B;  3TEX A;  1XO3 A;  1P7E A;  1QOB A;  3B2G A;  1ET9 A;  2DBY A;  4KGR A;  1N63 A;  4HRS A;  1ZDV A;  4RGN A;  2WDV B;  1GPX A;  1TJE A;  3BVG A;  1FXI A;  1QQR A;  4RGO S;  2HDE A;  1DYQ A;  3SFE B;  1KH0 A;  2R61 A;  1NYQ A;  1JWA D;  2VZK D;  1AW7 A;  1QF6 A;  1E7P B;  1JWB D;  1WRI A;  1PFD A;  2WXP A;  3AED B;  1NYR A;  5FK9 C;  3I9V 1;  1K51 A;  2WXR A;  2OHF A;  1YN5 A;  1JCK B;  3ABV B;  3KLS X;  3ZJT A;  3KQ4 A;  4ARC A;  1JRP A;  4NAM A;  2WXH A;  4YSZ B;  4A6Q A;  1CQV A;  2VZK B;  1XF5 L;  1SE3 A;  1JW9 D;  3VR8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...