4EEKA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound phosphate and sodium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
229
structure length
229
Chain Sequence
b'DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 83
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eekA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eekA01
2HF2A 2R8XA 3L8FA 4QJBA 5AI8A 5AM3A 3WGUA 3WK9A 5AK3A 1RKVA 4BEWA 3A1EA 4BKMA 3FM9A 5AKEA 3E84A 1WPGA 1L7NA 1L7OA 4HGOA 3R9KA 2RARA 4HGPA 1RQNA 5AKGA 4Y2UA 3B9BA 3NIWA 5AKKA 3OCXA 2P9JA 2YJ5A 3U7GA 2FUCA 5AM5A 3OCVA 3ZI4A 2EAUA 5ALVA 1RLMA 2BDUA 2I33A 2ZOSA 3WK5A 1RPZA 1RMQA 4NFLA 1CR6A 3HLTA 4GXTA 1Y8AA 2C9MA 2RBKA 2ZBDA 5ALMA 1NF2A 1J97A 5AW4A 1YMQA 3AR3A 3WGVA 2YMQA 5T41A 5AW6A 3WKAA 2YBDA 1YNSA 2FPSA 4YH1A 4J2TA 3A1DA 4DWOA 2EATA 3WKEA 4OFZA 2W4MA 2G1AA 2JAOA 1LTQA 5AVYA 3OCUA 3KD3A 1T5TA 2OA0A 4Y3UA 4UM7A 2OBBA 5AKXA 3ZTWA 4XOUA 1Z4PX 2AGVA 1SWWA 1Q92A 3QX7A 2RB5A 2FEAA 1CQZA 4YIKA 2C8KA 3DAOA 3EPRA 2PR7A 1NRWA 4UMFA 4Y2XA 5AKYA 4B6JA 3SHQA 5AI4A 1SU4A 2FDRA 5ALIA 5AW5A 3SD7A 1U7OA 1XPJA 2HF7A 3MPOA 4XE5A 4BX0A 2QLTA 3L1UA 1TJ5A 5JJBA 3QU5A 5ALWA 4EX6A 4BBJA 1O03A 5ALLA 5AM1A 2FPXA 3N07A 3SF0A 3FZQA 3FVVA 4IFTA 1RMYA 4F71A 2G06A 3U13A 3WK7A 2WHEA 4Y2PA 2YMPA 4UU0A 4HYTA 2AUTA 4KNVA 2GO7A 1TJ3A 2HSZA 4BEVA 2W11A 4L57A 3QU4A 1RMTA 2G0AA 3SLRA 3UMGA 3ZVNA 1Z4JA 4UM5A 3WK4A 1J8DA 3U19A 1ZD2P 3E58A 3R09A 1U7PA 4RESA 1VJ5A 2FPWA 4Y2RA 3L5KA 4UARA 2R8ZA 2RAVA 2GHTA 1RLTA 5AM0A 2ZXEA 2HOQA 2P69A 2P27A 1Z4OA 4CE6A 4C4RA 4ZEWA 2R8YA 3ESRA 5AVTA 3U7HB 3D6JA 3L1VA 3B9RA 4MUMA 1ZJJA 3L8GA 3OCZA 4H1WA 1ZD3A 5ALGA 2HO4A 4UASA 1XP5A 3ZVMA 3QU9A 5ALDA 2HHLA 3QU7A 2D2VA 4Y2TA 2YN4A 5AESA 2G80A 5ALNA 2BY4A 1N8NA 5AVSA 2MU1A 3QNMA 5ALUA 4KX3A 1U02A 3I6BA 4EELA 1NNLA 3E81A 4CF5A 3L7YA 3NRJA 1QYIA 2OM6A 2OYCA 5AKIA 1TA0A 5ALSA 5A3SA 2GMWA 5AIBA 3QU2A 2R8EA 2B8EA 1VFPA 3QUTA 2YY6A 2I6XA 3KBBA 2O2XA 4UATA 2NO5A 5ALZA 1Z4MA 3L0BA 3I1YA 3BWVA 5AM2A 3KDPA 2I34A 2WF8A 5AK5A 5AVWA 5AICA 5AW2A 2I55A 5AVXA 3EWIA 3TLMA 1WVIA 3ZVLA 3L8HA 4EZEA 4FE3A 1YJ5A 1IWOA 1RLOA 4E88A 4UU1A 4Y2YA 1L8LA 2FI1A 3U26A 2YJ3A 4HAIA 3OCYA 1L7PA 4OD0A 5AW1A 3PGLA 3QLEA 4XQ0A 2VKQA 2EARA 2FPUA 1TJ4A 1WR8A 4Y2VA 3OPXA 3WKCA 3DNPA 3QGMA 4UMEA 3W5CA 3EF1A 4UMVA 3MN1A 5AK6A 2I7DA 3ZX5A 5ALJA 3QXGA 3BA6A 2G07A 2DQSA 1Z4KA 2G08A 2B30A 3L0YA 4AP9A 2HEGA 4KNWA 1JUDA 4JDPA 5AI9A 2C8LA 4BYGA 1PW5A 5AKLA 3ZW7A 3ONNA 5AVVA 2ODAA 4HGNA 3OCWA 3AR9A 4RETA 3ED5A 5ALPA 1L6RA 5AI6A 1XVIA 5AW0A 3IRUA 5AI5A 2WF5A 4IG4A 1LVHA 5ALOA 3SKXA 1L7MA 4YGYA 5ALTA 2CFSA 1U2SA 3AR6A 4C4TA 4HGQA 3GYGA 1U2TA 4DFDA 3EF0A 3ZUPA 3ZTYA 1EK2A 3ZX4A 1N9KA 3M1YA 4HGRA 4BNDB 5ALEA 3IJ5A 5AIAA 2B1QA 5AW3A 4UW9A 4DW8A 5ALKA 2FPRA 2PKEA 3FGOA 1T9ZA 4BX2A 1MH9A 2YFYA 3ZWKA 1Z4NA 1RRCA 2CFRA 4UAVA 1RDFA 4JB3A 3AR7A 3B8EA 3I28A 3QYPA 2G09A 2HI0A 3I76A 2NYVA 2WF6A 5AVZA 5A3QA 3ET5A 4UMDA 3W5BA 5AW9A 2IOHA 2AH5A 1KYTA 3W5AA 3W5DA 1VJRA 3FPSA 4YCLA 1Z88A 1FEZA 1ZD5A 4UAUA 2ZBFA 3A1CA 3SMVA 4CNQA 5ALQA 3SKYA 2WM8A 2JARA 5AW7A 3CZ4A 2BDEA 3KC2A 3NANA 3PDWA 3ZWDA 1Z4LA 4NWIA 1WZCA 3DV9A 3UM9A 3HYCA 2JAWA 1YS9A 2HDOA 4GIBA 4KN8A 4OHFA 3CNHA 1K1EA 3AR2A 1Z5UA 2CFTA 3WK8A 4OCZA 1F5SA 4CF4A 2B8JA 4J03A 3RF6A 2GHQA 3ET4A 2WF7A 4BNDA 2PQ0A 3L8EA 2MSNA 4DCCA 1Z5GA 2Q5EA 4KX5A 1ZRMA 2HCFA 3AR8A 2JGAA 4I9FA 1RKUA 4AS2A 4QQFA 3J7TA 4BX3A 2B1RA 5E0OA 3NUQA 4FFDA 2B0CA 1Z4IA 2X4DA 4EEKA 1YV9A 3FPBA 4C4SA 2Q4TA 2YJ6A 4G63A 3PCTA 2HX1A 5AW8A 3ZU6A 2IOFA 2MU2A 1RQLA 2P11A 4YCMA 2CN1A 2IA5A 5ALXA 3E8MA 2Q4RA 1L8OA 4ZEVA 1EK1A 1O08A 1AQ6A 3AR5A 4L6AA 5AVRA 3WKBA 4Y2QA 3KOOA 3PGVA 5ALFA 2YMMA 3MC1A 4I9GA 1T5SA 1S2OA 4NV0A 3NASA 3N8GA 4EENA 1ZD4A 5ALRA 2YJ4A 3N1UA 3NALA 5IS2A 5ALHA 2B82A 1QQ6A 4F72A 5AM4A 1YDFA 2AMYA 3AR4A 4EX7A 5AK4A 5IT0A 3QUQA 2GFHA 5AHXA 5ALYA 3K1ZA 3RFUA 4Y2JA 1Q91A 4MWOA 1RC8A 1ZOLA 5AKJA 3R4CA 3WKDA 4L6CA 3WK6A 2JAUA 3DDHA 1RKQA 1QQ5A 3L0CA 3QUCA 4AS3A 2IOFK 1Z4QA 2C88A 2W43A 3OTQA 4Y2SA 2O9JA 2YMLA 3U7EB 2WF9A 5AKHA 3N5KA 2ZBGA 2NO4A 2FUEA 3A3YA 2ZG6A 3VAYA 4O8CA 1QH9A 4NABA 5IT4A 5AKZA 1S8OA 3IB6A 3KZXA 1ZS9A 4PNHA 4YCNA 1QQ7A 3UMCA 5FP0A 1ZRNA 3MMZA 2I54A 5AI0A 3M9LA 4KYTA 5AVQA 3QUBA 5A3RA 1TE2A 1SWVA 4YIHA 2QYHA 3S6JA 3NAMA 4NAVA 3ESQA 3F9RA 2IYEA 3UMBA 4G9BA 4CF3A 3N28A 4XPZA 3U7FB 4FYPA 2WFAA 4ZEXA 3P96A 2ZBEA 2C4NA 5AVUA 1X42A
chains in the Genus database with same CATH superfamily
1AK1A 3SOPA 1KSHA 3R5JA 4ENPA 1RKVA 2RBGA 2FUG6 1FPQA 3P9YA 2Q3HA 1OVGA 4NOJA 2NT3A 3L49A 1WWVA 3PQ3A 4I4IA 1SUPA 3QHPA 4Y1RB 4CKXA 3RADC 3TKYA 3AUFA 3JD0A 2QF7A 3WL3A 1RZVA 1NI4A 3CZPA 4YH1A 1X15A 2IX3A 2EZ4A 3H83A 4H3SA 3MELA 1GO3F 2BFCB 4GQAA 2J32A 1FS5A 4R3UC 4FKBA 5FV7A 1CZHA 3CNNA 4INOA 1SKYB 2ONZA 2VAMA 4IIDA 5IUJC 2VCHA 1V48A 4QGBA 4ENVA 2C2KA 3TW4A 1CJBA 5J0XA 3BFJA 4FS2A 2O1XA 1HE1C 2ADFA 1A71A 5IJ9B 4EKEA 1UOEA 4DR3B 1RBQA 2XIQA 4F4IA 4PX2A 4OMDA 4GRAA 3WHLA 1U1GA 3V2UA 1RRGA 3G02A 4B4KA 4U8HA 4MHTA 2ZWOA 2BMVA 3NO4A 3EZ2A 4H9GA 1NC3A 4X5OA 1X8LA 2P91A 2YR0A 3VR4D 3INNA 4ACOA 1W34A 2Z1MA 1J09A 1WU7A 3FC4A 3RSFA 3VPBA 3KETA 3RABA 1AV6A 2XQVA 3BFPA 5DXFA 4DBVO 2PTGA 4KX3A 2A1UA 4Q9IA 1COKA 1DJQA 2OLKA 3VKVA 1BHO1 1M1YA 2I91A 1PJLA 1TVCA 1BHJA 1NOJA 5IHPA 1W0KA 1U5BA 1W25A 3EWIA 1M0TA 2WSSA 4NARA 1B23P 2W0MA 1SXDA 1RBYA 2E4VA 3NDJA 2WAOA 1SPXA 2XE8A 4CN8A 3RT9A 5DK6A 1CUJA 1SZJG 4XGKA 1KOFA 3I0MA 1UJ5A 3P9ZA 5J2JA 4X44A 3AHGA 4N03A 1LUAA 2VZ0A 5H70A 3NVWA 1PSWA 3M2PA 3O8NA 4WZAA 7ICIA 3EG5A 5FPYA 3UYLA 1Y3FE 4TVKA 1GT6A 5TMEA 5DBBA 1WXQA 4IH4A 4DFMA 4JOCA 2DRIA 3JQ7A 4EUNA 2LKYA 3DKRA 3ZU3A 2C2YA 5KFRA 5KNBH 2NQTA 1R0SA 1ZP6A 4CM8A 4TN5A 2ZZMA 4C7BA 5IXSA 4H6XA 4UAVA 3B1YA 2V8OA 4DQPA 1DUVG 4ZO9A 2G3YA 2JI4A 4RVGA 5F9FA 1FNNA 3OE4A 2FE9A 1E3WA 5EXEA 2AG1A 3DMNA 4C88A 2AD5A 4R51A 3NWEA 4TL9A 4XD7D 2DUJA 3NKLA 2LP4Y 1L5SA 4KN7A 1QKKA 5EEHA 4CEJA 1RXIA 5ECDA 3NVZA 2CMFA 4DIMA 2ZIXA 2NTEA 1RWKA 2CUZA 4P0QA 5HKLA 4XGQA 4KLAA 1ZN2A 1E62A 5LXTA 4F91B 1JVNA 2GLXA 2Z0MA 3MT0A 2FP4B 3PKZA 1N6KA 2NUBA 4GPD1 3WIEA 3AKYA 1B14A 1BGWA 1B1CA 4DARA 1AQ6A 2R1VA 3F3YA 3T3DA 2Z2KA 5B2EA 1QV7A 3WLNA 2EKDA 3IDWA 3H1EA 4LDRA 3F8TA 2OXIA 1CUCA 3EAGA 1UOQA 5GVSA 2JKYA 4HH3C 3U4QB 4C01A 1OWOA 2HRDA 5HNKA 3R24A 5ILOA 3JQ9A 3K4HA 4ARZB 5KIAA 3CF2A 1DRKA 2GNAA 4KLLA 4PPGA 3EVNA 3NBYC 1WMDA 4BVEA 4IICA 3RVNA 5CA1F 3DW1X 1EBFA 3LC7O 2ORWA 3PVSA 2J9FB 4XVCA 1N33B 4RD0A 4F92B 3F71A 2ZTDA 5HQ3B 4JLVA 2BGWA 1N6LA 3A2KA 3UCEA 2I2DA 1D2GA 4LGMA 3VU3A 3ZLJA 3CWQA 5AM3A 3NRZA 3A14A 3SF8B 5IX8A 2JFYA 1DUIA 2RGBA 2VANA 3HA7A 3A7EA 1QH1A 1SIBE 1A50B 3I83A 3TX2A 2HU2A 2PKRA 1YMUA 2EZYA 2HSJA 5FBRB 5AKKA 3S2UA 2HQRA 2OILA 3DCJA 2BDUA 3L1IA 4KPYA 1Y8QB 1OAKA 4QZDA 1DIHA 1VE6A 2EDCA 1L4EA 1D2HA 3O3CA 4X66B 1R6BX 3CE9A 1SZHA 2HHUA 2IHKA 2A4MA 2VK4A 2PCJA 2VDKB 2C3PA 1ZISA 1NBEA 3KJNA 3JQ9C 3QIAA 2JBHA 2FEAA 2GAIA 2DHQA 2HU7A 3M1LA 1EVYA 1W30A 4I46A 5F98A 4BUZA 4BGDA 3SE0A 4X93A 5AM1A 1ICEA 3NPMA 3BFXA 2NZ8A 2HHJA 4XR9A 3C74A 2X9QA 2WJ6A 4FIZA 3O90A 5FBWB 4JI3B 4Q7KA 1WEHA 3AINA 2RCYA 3ABIA 1LC0A 3W2IA 2E6UX 5IAJA 1QAMA 1Z6QA 3AHHA 3DGEC 2WQZA 1ADGA 2CZGA 4ND4A 3SN6A 3V97A 4MIYA 4CCHA 3OJCA 2OV8A 4DSZA 4O4IA 3N0WA 3W1EA 1IEVA 1Q22A 1QGYA 4NL9A 5ALDA 2AXQA 5IIJA 4DFPA 3FJOA 1GAQA 3A25A 1K7XB 2PUVA 2UU9B 5CR9A 2Y1EA 1JXMA 3QOYA 1ESDA 5TISU 1ONOA 4ZYXA 2YJTD 3V7UA 4FMCF 2O2XA 4UB8U 3L40A 3TEMA 1PFQA 3VZSA 2ZPAA 3HKBA 2IHTA 1D8YA 4ZQHA 5I3ZA 4UCXA 2YJ3A 3QTLA 3AG6A 3PGLA 4P7BA 3QGMA 1MQ9A 3RH6A 5EJMA 1CS0A 1YQUA 3RC3A 3TTXA 1JLSA 3FMPB 4DFJA 1EFCA 1YC5A 1OPXA 1V7ZA 1HFWA 1JILA 3DO5A 4FDLA 4L8GA 4XARA 3MJCA 3MERA 2EQ5A 2DXIA 2ZI3A 2Y0DA 4HDAA 3HL4A 4W5JA 3EQ9A 1VE7A 4NL9C 4NCHA 2YFYA 3CZCA 2PWBA 3G79A 3UMFA 2L69A 3Q8MA 2P77A 1S6YA 3DFMA 4YRFA 4BZWA 2IOHA 3LY9A 3RS3A 3GIWA 1YA8A 4D0GA 5BYAA 2I6TA 2X5OA 2MINB 2DH5A 2WJWA 1IBCA 4ZCSA 4R8UA 4M9SA 1DKMA 4I2AA 3HC7A 1C9YA 3FTFA 2PA3A 2BE9A 1G4AE 1FX1A 4KN8A 5K0GA 3CNHA 2QPTA 4JIMA 1SHUX 3ET4A 4LVCA 3W1VA 1GTVA 2KHZA 1S9HA 3DAYA 2Y4OA 2ZETA 5B3JA 1C1XB 3V1UA 2QRMA 1PGJA 1DP4A 3VSAA 1XSLA 1N7GA 3GCZA 4J1SA 1QONA 1KFDA 2J8ZA 2FR8A 1TD1A 1UDCA 4OQYA 1P72A 1PNQA 2GWRA 1DNPA 4DYDA 8ICQA 4B48A 1X9XA 3PGVA 4H35A 1QH8A 5C1PA 2FWRA 2IYOA 3P2KA 2FDCA 2XBMA 2VJPA 4MUFA 4IDGA 5C7IO 2DR3A 3BZKA 1RIFA 1F0KA 2GI4A 3MHPA 4ICAA 1KPGA 2D3WA 3TSAA 2O3TA 5EI5A 1XAJA 4WNAB 5D87A 5BW6B 2X2FA 1BVHA 3CX4A 5GVRA 2W37A 2ZYGA 2IHVA 3AKEA 5IT9A 4LYFA 3RJKA 3PX4A 1Y4AE 1FS4A 4BO8A 4DIDA 3OZCA 1P7PA 2SICE 5HM8A 3VM6A 5B3JC 2O8EB 1VE9A 1HPLA 2VJNA 3PDHA 3OZWA 4K88A 5LP6F 1KERA 2GF0A 1IZ8A 1EI9A 3WLJA 4YJ3B 1KJIA 2P6MA 1GPWB 1K9VF 4MEYA 2FR8C 4HAWA 3RK4A 3HA2A 1WCV1 4EI7A 1WW8A 4GWLA 1VL6A 3TD6A 2E48A 2XUAA 3ADBA 1JJ7A 1VCHA 3DWGA 3R3JA 4D9NA 1CR6A 3GP3A 3QUSA 1TAHA 4Q3KA 1P80A 4O4LF 3PFIA 3VVMA 4EA9A 2VDWB 4MFFA 2JFOA 2QE7D 2P1DA 3R8XA 2XY5A 1JX4A 1VLZA 3K20A 1WNFA 1C3LA 1ONBA 4JLUA 1N2BA 2VSOA 5EXPA 3WDMA 3KR2A 3MIIA 4EATA 1A7KA 1V1RA 4IXWA 3EPRA 1BMFA 1MJFA 5JRZA 4E4RA 2VP9A 1IXKA 2D8MA 1TTQB 4RDCA 4IMJB 3L0IB 5EWLB 5BMVB 2W42A 1O03A 2RGYA 1N2OA 3D8TA 4L1KA 5DGTA 1RMYA 4ONEA 2W6JA 3RNOA 3LY5A 5LMUB 4Q1AA 5JFGA 3ND7A 1R16A 5IN4A 1QUFA 2GN9A 4FNMA 1T9HA 5JATA 3HN7A 1XEWY 4GE0A 4AYBC 3M7IA 3AUTA 4B40A 4B9EA 3OIUA 1P1KA 5CT6A 5AHRA 5BSUA 3D2NA 1N3IA 3T1OA 2V4RA 2KFZA 5A9RA 1CJVC 4CKCA 5FX2A 2QTHA 3DL0A 2Q7DA 5AKIA 3MOIA 5JPDA 4JQYA 3CZQA 2WRZA 4MGEA 2BR4A 4PFQA 4Q8EA 4A2CA 3AVUA 2P66A 1Z47A 3D3QA 3VR1A 1WJGA 3WS7A 4HNVA 1KZ1A 4XX1A 2X41A 1P5HA 1TLLA 6ABPA 1N0VC 4TTRA 5K1ZA 4C7ZA 4KGXA 9LDTA 1Z68A 2CYBA 5J2CA 4LHEA 3NIGB 2XDQA 3ZG6A 2MA1A 3KO8A 4GYWA 2ETVA 2K89A 1AO3A 3JWPA 1NBAA 4JELA 4UM8B 4FQ8A 1FNCA 1XMVA 4U6NA 2WY2D 1W2HA 2C4TA 3HMQA 1I80A 3SHTA 1JH9A 2EKPA 2OHFA 1QNLA 1ZOPA 3ZTYA 4D3SA 1Y98A 1LS6A 4DOBA 3IAFA 2VXOA 2R66A 3OEED 3EVTA 4Q1FA 4DQXA 1ZI8A 4M98A 1VTKA 4Y9RA 1J39A 1NQVA 5CAEB 2EX4A 1CJUC 1EK0A 3O47A 1QFYA 4JBXA 2CXUA 5EWJB 4A8JA 2QBYA 1TV9A 4WXEA 2YWEA 4TUYF 3WRWA 1ZC4A 2OCKA 3JYOA 4S1NA 3BAFA 2ICAA 3ZLBA 4CDGA 1PCXA 4RY0A 1LPOA 3PQCA 3H5AA 4REMA 2VP4A 1V85A 3MMNA 4BNDA 1HY3A 3CUTA 3A6JA 3AIIA 1Y37A 1RKUA 1NWHA 1R3UA 4FFDA 5JJ5A 3LT2A 3AX6A 2XKAA 2BZGA 2Z95A 2I6SA 5EMLA 2JR5A 4YLEA 4P34A 2HHQA 1E89A 4KHPB 5JPCA 2QM3A 2ZB8A 5AVKA 4KN9S 4WV3A 3CR3C 2FZCA 5K0FA 3Q6NA 4A6DA 4WOPA 4PZLA 2X0JA 3MJFA 4BE7B 3T1YB 1SBHA 5K05A 4I50B 3K73O 1P0IA 4QQKA 1E9VA 3N39C 4IIBA 4JUIA 4AJJA 721PA 3CLUD 4KQGA 5INTA 1XROA 2QRGA 3CPHA 3Q4GA 1VPVA 3GJSA 4O8CA 3VC8A 3TW6A 2VPTA 3F47A 1TA9A 3KLBA 3L93A 2FRVA 4IVRA 3GC6A 1MENA 3NAMA 2V6GA 3UT0A 2WDZA 2F9MA 1JHPA 2R1TB 4BPBA 5F73A 3THXB 3ESBA 5JSZA 1LY1A 4M9HA 4H1VA 3A4VA 4E4YA 3WDLA 4HB2A 4DF8A 3GGCA 4FB5A 4FYVA 1JGTA 4BNYA 2HPAA 4CGYA 3DBOB 4H18A 2LMRA 2PYIA 3C3JA 2H31A 4RQMA 3MJRA 4ELUA 2AWNA 2FCAA 4WY2A 1YNSA 1SURA 1TB4A 1XR3A 2V7TA 2GRJA 4YQZA 4H7PA 3KTDA 5JC8A 4IIVA 1NVDA 3LWBA 3E9EA 3P9CA 1J0EA 2P4QA 4L8FA 1J8QA 5EXXA 2WUGA 1JPNA 1QIMA 1FQWA 3HKCB 3KHSA 4X90A 2JRZA 4KNYA 4O3PA 2WLSA 5CFOA 1E7QA 5C8YA 3SF0A 4D8UA 3VPDA 4QRDA 5HHIA 3CG0A 4ZCTA 3WMXA 1GA4A 4HC4A 4B6RA 1Q0UA 3I8XA 3JQFA 2VZ8A 1I6WA 3KKZA 3GT4A 3RIGA 1ZICA 4JLAA 4Z3DA 2H54A 2LCIA 3RT1A 1WHTB 2GHTA 3EZLA 4QVGA 3TKLA 3PYMA 1CQIA 3GLFE 1JR3A 4A6XA 1AXEA 2WWIA 1NXOA 4J2HA 2Q27A 4JI5B 3SEFA 3RBZA 1CQWA 4YMIA 1F2VA 3OA2A 2JDIA 3VC1A 5K6AA 4OBBA 1JHZA 2Z8XA 3GJ4A 1XLVA 2ZT5A 2NLOA 2FEMA 3BD6A 4XB2A 2WG0A 1OAOA 2G0NA 4RCYA 5FWNA 1NL3A 4YJFA 2BEUB 2HK8A 1LPAB 3T34A 1LC3A 4BJ1A 3P4YA 1O4VA 2G9QA 1O57A 3H2BA 3HLKA 1A8UA 3E3LA 5ECWA 3LHKA 3I2IA 4IDBA 3EOBI 4LW8A 3OA0A 2XAAA 2ONKA 2CUNA 4UVEA 4CQLA 2D1QA 3UJ8A 1VYUA 4UTNA 1XZMA 5AD1A 2GN2A 4RIFA 5GONB 1U2DA 1M2JA 5DLDA 2VA9A 5LZ5A 1UMBA 1XEAA 1EWTA 3Q7TA 2PXXA 2ZATA 2GK6A 521PA 5CT5A 1HLDA 1H6DA 2QVCA 2WK1A 1HG0A 2ZTUA 5EE3A 3F90A 2XKJE 2JFXA 3I6ZA 3PX2A 4YJHB 3MFIA 1XD2B 1MTZA 1V37A 4IPTA 2F2AB 4YAFA 5K6AC 2JH3A 3FWPA 1RYRA 2JFFA 1HM5A 2XKBA 3OPVA 4MWCA 4RACA 4PHHA 1TD9A 2ENWA 3WG9A 4F5NA 1UPAA 4G89A 4TXHA 3AF5A 3E8SA 3HABA 2W2KA 3OZXA 3ZR4B 2WF7A 3RHFA 2W7PA 4KX5A 4CLOB 3NPAA 3JARA 5IJWA 2CVZA 3GIMA 2B1RA 1U2DC 3IV9A 4B3HA 1MA0A 5D6OA 2JGIA 2XQIA 2HX1A 4M83A 3G5LA 1SRRA 5KC8A 3T9EA 1D2AA 3R3VA 4C6TA 3T3NA 5JAIA 3MC1A 3Q3IA 4TS4A 2WJ4A 1KO8A 3F78A 1YACA 3C3AA 4DC9A 1TMKA 1HSZA 2GPNA 5K8VA 3MINA 3Q9UA 3CU5A 5D5PA 2JGEA 1MKYA 3PGXA 5I8WA 3HU3A 5EHQA 2CBZA 3A6HA 2RHHA 2FK8A 5T3UA 2GH1A 3V4OA 5CCDA 3KKOA 2HMWA 4HQFA 4L4SA 4BO9A 4UKDA 4F2WA 2PGAA 4H6PA 2WE8A 5EGSA 2RHMA 4OLHA 4N9WA 1YB5A 3CRVA 5KFWA 5EJ7A 3O9ZA 3IESA 1COOA 4Q39A 1T25A 3FOEC 2G83A 4RPIA 3AQ4A 3KSMA 4YMSA 3OCXA 4DDVA 2Y9UA 2FUCA 2HT6A 2TS1A 3KTFA 3N3AC 4JJ8A 3WLKX 4BFTA 2PUCA 3FZYA 4CQNA 4GL4A 4PHGA 4XX0B 3M6KA 4KR7A 1KI8A 5GIPE 2CY0A 4IL6U 1X3LA 1XMSA 4QJIA 4L5YA 4A73A 5LOVB 2H2DA 4KO8A 5D86A 1XEFA 5KC9A 2QRJA 2QGZA 1WCWA 5B55A 2GA9A 1YCHA 3SZRA 1OXXK 1MGPA 3R7WB 4DSNA 5KSYA 3GYBA 3UJNA 2HF7A 1VBMA 5JBIA 3VR5A 1EK5A 1T0PA 3FH0A 2UYCA 1XHFA 2HQSA 1OV4A 3WNDA 2B2XA 3W34A 3ROTA 4FCTA 2J6HA 3M9WA 1A4IA 4K9MA 4S0ZA 1V0JA 4OB8A 3G9XA 4F5QA 2R5FA 1NX6A 3RARA 3U49A 1DC4A 2D59A 3FHTA 3LMKA 5A7GA 1W4ZA 1V9PA 2VHVA 1MR3F 2WJ3A 2AJDA 1GNVA 2D1YA 3RBVA 3UJ9A 2IP1A 2QARB 1LZKA 3E53A 5FWYB 4ZEWA 5F9LA 3DDWA 2R8YA 4W8HA 1ZESA 4WCDA 4FJ2A 3ND9A 1H1TA 2YQZA 1QIHA 1RLIA 4I2IA 1OIWA 2QLNA 3GJQA 5BVGB 3OWHA 4IQ8A 6REQB 1MEJA 3GLGB 3PSAA 2HR1A 1T4BA 2IWRA 1BU8A 4YPVA 4E08A 2BRUA 2JGKA 2PSFA 3PDJA 1H1LB 4K0KB 5EMJA 3KPUA 4P4MA 3DHNA 3VUFA 5JO9A 1GADO 4Y2YA 1UC9A 3P8ZA 2W9BB 3PWSA 3P2OA 2XMDA 3JQCA 3IV7A 1NPDA 4UHJA 3H84A 3BJRA 1CT9A 4F4YA 2BF4A 4M9NA 3I52A 4BWGA 3NV7A 1XZNA 2V5UA 2KSOB 9ICBA 4C30A 1FFBA 3MTEA 4PX5A 2AHOA 2BKEA 4DIBA 3P26A 4ZCMA 3QNWA 4NICA 3OLZA 4W5HA 2X8AA 3EZ7A 4QOJA 5GJVC 3VTAA 4BO5A 4Z0TA 4MI9A 2PVPA 3RS7A 1ULZA 1N3LA 4TMVA 4I29A 3P9IA 2WYOA 1XSEA 1KFCB 3ITDA 1RU3A 4BASA 2AQHA 4KLOA 2WP8J 1C7JA 4EY3A 1FMJA 4DM7A 1G6KA 3AUJB 3O2JA 2XYHA 3FMVA 3LPAA 3T1HB 4MO9A 4U7GA 1SAYA 1M0EA 4H3VA 4OMFG 5DYWA 4J75A 3HTXA 3B12A 4G07A 5FADA 3GV7B 3AL3A 4IUDS 2EAMA 3IAM1 1KI6B 4QTZA 1EUDB 3JPWA 2EW2A 9ATCA 1N61A 2PO7A 3OLCX 5A6VA 5TNXA 1FUEA 1RI2A 2B0JA 1F2TB 3AHIA 4P3KA 5JTUA 2OBMA 1KZ4A 5B1EA 3S55A 3TZCA 3LRPA 1JJFA 2PVSA 2HAEA 3JV7A 3U44A 5SYNA 3E8MA 1UH5A 3QKTA 4RXMA 3ZDQA 2KG5A 3B1ZA 4UXJA 5IDXA 1XQ6A 3D8UA 4X7PA 4AKSA 1JP7A 3AMVA 3THYA 2PUEA 4KQKA 1MJGA 3KQOA 2QL6A 3PGA1 1OFUA 2LPMA 3QM1A 3H5NA 3WP0A 2GRUA 2XUQA 3WNVA 4ENUA 2ISSD 1H93A 4AMGA 3HB0A 1DWPA 3RW9A 4RHXA 1DSSG 3PWTA 2FUEA 3VMMA 5TPZD 1ZYUA 3P27A 4MMZB 1M75A 2IXDA 5F1PA 3JTMA 3IJEB 3C5FA 1CERA 5FRDA 4YIHA 1G3QA 5DI9A 3HCWA 1G2OA 1H0RA 2DY0A 1E9SA 1G5QA 1V2GA 3N2KB 3ENQA 4BFLA 4RYDA 2K7ZA 2H3IA 3DMRA 2HHTA 2V7VA 1UKCA 1VDMA 4WMLA 1VSTA 5E7QA 4TL8A 4G1CA 1VCNA 1L7NA 1SVKA 1RQ7A 3TRFA 4RPXA 5LD2B 5JDCC 5IIMA 3L0OA 1Z45A 3GLSA 3WGZA 3VR2A 1RG6A 1ZGGA 2BISA 4MW5A 3RKSA 3VKUA 4UBKA 5AJHA 3GH3A 3C70A 5DYYA 5CYOA 3N0VA 4MEJA 2CXXA 3UHOA 5J8YC 1Z29A 1T5TA 2F90A 3HG7A 1LBEA 3HJAA 1U3VA 2H9IA 3O21A 3EC2A 4U8GA 1M34E 1UT5A 1FDSA 2CMHA 4AY4A 3K70B 4URZR 2VI5A 1CYEA 4S04A 4BBJA 3RWMB 3PW2A 4LVSA 2RKBA 1E3JA 4B81A 1YK0A 9ICOA 2QD2A 5CLHA 3MBIA 3DXYA 2JANA 1XEXB 1HI9A 3P9SA 4KBGA 5KYWA 3LUGA 4I1IA 2BP7B 1WZIA 1CQXA 5CBPB 5HR5A 5KAIU 3TNFA 3GP5A 1L4MA 4G24A 4F4KA 4O4JF 1GD1O 3BMNA 3C1OA 4QU0A 2YJZA 1H85A 2NSYA 3E27A 5L3ZA 3UG7A 4C3UA 5CRXA 4J9MA 4BXOA 5KX5A 4A5OA 1KAGA 2J41A 3I53A 4LVNA 1GTL1 5IRCD 5KG6A 3RU3A 4IZIA 4NPHA 3J81k 5B6PA 2CMKA 4ZJZA 2H2FA 3GQVA 4RVOA 3ECCA 3FBWA 3DEIA 2RI0A 3GF4A 1Z6PA 2IPOA 2JATA 5LQRA 2X8JB 5K8CA 1KPIA 5ES3A 2IYVA 4PG7A 1QZZA 1YAJA 4PQYA 2JLXA 1ZIDA 4YREA 2GETA 3LP5A 2VKQA 1BFKA 2VHUA 5EG5A 1K0FA 3KXKA 1DADA 3X2SA 4GMXA 4JI7B 3RSLA 3DEFA 1CCWA 1CZNA 4XVQA 4HDRA 1KRXA 4BLVA 5K3OA 1PW5A 1ECCA 2FX3A 1SM4A 5TR9A 4R0VA 1ZQUA 2DKXA 4AZTA 1YGYA 4IKEA 1FBNA 1TLFA 2TMGA 4O0LA 4GZMA 1MOZA 4IQGA 3GJ6A 3IJ5A 1MQSA 4IR9A 2XT0A 2BFPA 2CDNA 4FC7A 1XO1A 1F0NA 3ONWA 1BNCA 4KBYA 1RZRD 3SXUA 1GFIA 4CV2A 4ZVKA 3BL8A 3NTXA 3CUSA 1QRAA 4D97A 4UAUA 2XYRA 2YWJA 3PLNA 4LHWA 2WA2A 6ADHA 1VLQA 1WB4A 2BGGA 3KSDO 1A77A 1X7ZB 3JWEA 2Z8YM 5FUMA 1TYBE 3UM9A 2DM6A 2WYVA 2PI5A 4YD2A 1ZCBA 2OMKA 1S2LA 3N0TA 3F2BA 4B75A 3L7OA 2OY0A 3MAAC 5A05A 2VDPB 4J9SA 1X9WA 1NVAA 2JHGA 4WN3A 1ECJA 4X94A 4WJ3B 4AS2A 4C0QC 4ZEMA 1E4EB 3F5EA 3S28A 3ZEAA 5F1YA 2Q5IA 3A0UA 3NHWA 4V24A 4I2JA 2NU7B 3U3KA 1ABEA 4YCJA 3G6VA 1LA2A 5B2FA 4X64B 3K9WA 1JQJC 1YIAA 2B7CA 5JJKA 4QBHA 3HI6A 2IV2X 4AMUA 3NHFA 4TMYA 2Q6IA 2OV4A 4I4NA 4J6FA 2ADMA 1E3TA 5KFTA 5IZ4A 3QV2A 3UQYS 1ZOLA 1AT1A 3R4CA 3PQ2A 4N3BA 4C0BA 2W58A 3NEJA 2JHDA 1QBKC 3QBVA 4PGGA 5DB6A 3D0OA 2CDBA 2F9FA 1YH3A 3A8TA 3FKJA 2AYZA 1ZS9A 4MCHA 3B6KA 2W54A 4FOSA 4NJOA 4BB5A 3NEPX 2IYEA 4AWAA 1U9CA 4B79A 2MUTB 3CIOA 3FWZA 3RROA 1WY5A 3EZNA 3AHJA 4NXZA 2HF2A 1RAFA 3GLIB 1TVEA 3DOUA 3PKJA 8OHMA 3WK9A 1H6BA 5AJWA 2A7XA 3H9BA 1C0IA 4E2FA 2EQYA 1Q19A 3N97B 5DGCA 1HQKA 2F62A 1A9OA 1R8JA 2Q50A 3O4IA 3GDWA 2YZGA 2OV3A 3FMIA 3NBAA 3NIWA 3B85A 1YDMA 3MRSA 1WA5A 3ZHCA 4TOIA 3LKBA 4QARA 1RRFA 5JMWA 1POWA 2YJNA 3PX7A 5C1OA 3O8DA 2WZCA 4E12A 3BM5A 5EKDA 2EATA 3THOA 1LKYB 3NX4A 4Y3UA 2FN4A 2FZEA 4XOUA 1VCOA 4EYIB 3QX7A 4G4IA 2IIVA 4BGIA 2GSWA 2ES6A 9LDBA 2NG1A 2I22A 2AQ4A 2XQFA 1B43A 4DHWA 5CJ2A 1I6KA 2FJUA 1VIMA 2WMYA 5EZQA 2CZQA 5JCPA 3ILXA 3GT3A 3G17A 4TKZA 2EZZA 3W9BA 2WJVA 3ZVNA 5J2EA 1WKCA 4AROA 5HW0A 2BZ1A 2ZAMA 4PVCA 3ELYA 1G9SA 2WG1A 1PIWA 3TFWA 2HYIC 1ZZGA 3DL2A 3GQCA 2LE0A 1J8FA 1M9NA 2W9AA 1OQAA 3HP7A 3IB3A 1WU8A 2O2IA 5EFZA 1H4QA 4HDNA 4EHNA 4A2WA 1KAOA 5KKCA 3GK3A 2XY6A 3DZDA 1X9MA 2HD4A 4DZTA 2AFHA 3G2OA 4KN4A 2GMWA 1DEAA 1E94E 3PNLA 3X2EA 2W6CX 1NDHA 1TEXA 5LYJB 5AM2A 4PBSA 4BMOB 4RV5A 1E2FA 4B3CA 2C2ZA 3QSYA 4F86A 4QELA 1GUFA 4BDSA 4KI7A 4OD0A 1SHLA 3SI8A 3EPGA 4RH0A 3KVVA 4F38A 4B5LA 4RTKA 1XE3A 5G1NA 3G2LA 4IMPA 2FPIB 4X1IB 1ZA2A 5EJGA 4B6GA 5HS6A 4MCJA 3SKXA 2IE8A 1T10A 3QMPA 3URKA 3Q85A 4XI9A 4KREA 4O2RA 3H5RA 3TLKA 3DFFA 1S2GA 4BRWA 4M9JA 3F4BA 4GFDA 1BIFA 2F1JA 4UMDA 3B36A 4XM0A 1SVLA 2BSAA 3WMGA 4Q3AA 4EBEA 4UM9B 1FXSA 3HDGA 5DLYA 1HT3A 1WKVA 5EQJB 1C7IA 3SKVA 3F0TA 5JO0A 3O8QB 4ARUA 3JZAA 2KE7A 5DLEA 5IEJA 4OFXA 3W6PA 1C41A 4LF9B 1HO3A 4JASB 3C8UA 4LXXA 3C3MA 4WLNA 2FSFA 1M6EX 2ZS8A 3ICCA 1F5SA 3MQFA 1L3CA 4Q19A 4R69A 1BKDR 3UJ7A 4DJDC 3CLRD 5K0EA 4YBZA 1XTSA 3K6RA 5DM60 1KAEA 2FZVA 2ORIA 3PCTA 4F11A 3OAAA 5CM2Z 2CN1A 4DCJA 5BW8A 3GT0A 1ZXXA 2UUCB 4ZOLA 2C9DA 4ZU1X 2RB4A 5JS6A 4RL6A 4NNOA 4EJSC 4U3JB 1GSIA 2C4UA 3DV0B 2N0SA 4PAWA 3VPXA 3MG9A 3H9QA 3N7TA 3TFQA 1T6XA 2W2TA 1OLUA 3ZXXA 3IELA 3WFZA 4TL6A 4FKZA 1QV9A 1MXFA 2P4SA 1T6ZA 3U9LA 4WT7A 3A6GA 4FS1A 5EIHA 1PV1A 2W48A 1J1IA 1ZQTA 2JJMA 1GU1A 1MC1A 1NK5A 3D5EA 1EUCA 2YHUA 2KYRA 3U60B 1XMJA 4WESA 2XWBF 2PG3A 2H4JA 1AMNA 3AB3A 1H9AA 3E0XA 3O31A 4XPZA 2QSYA 1GV0A 3IXLA 3JVUA 1T6NA 4FHCA 4D8VA 4LXYA 4FUTA 4U63A 1XLUA 1DJPA 1OB5A 2YWRA 2Q1TA 3DBLA 1L7XA 3QVLA 2QR3A 1YB7A 2OG2A 3EW7A 1OB2A 4QXPA 4RVCA 1QOZA 3WLEA 1PFWA 2RHOA 3L0DA 4KH0A 3V6HA 4DQUA 2YJ5A 3OCVA 3Q9SA 1M67A 3DFZA 9ICNA 1NNI1 2AJCA 2F8SA 2OCDA 1Q1AA 4KUEA 5CVJA 3MBYA 2I5PO 3OCJA 3T1TA 1EKXA 3IO5A 1OT3A 3HO1A 7ICMA 3AWIA 4PLFA 3IAM6 4MW7A 2RJOA 4M8IA 3EVZA 4N6NA 4M0KA 3LP6A 2C83A 4E1VA 1UL1X 1KTVA 3G7NA 3THVA 1MAWA 5BWBA 4TMTA 3QELB 4OX9Y 2JASA 4RFSA 4OYYA 2HBZA 1ZVKA 3EEQA 3C29A 3G0DA 2J3QA 5IFKA 5KNIA 1NV9A 3LBAA 4CT0A 4HN2A 5C46F 5CNIA 3F97A 4IGFA 3EXIA 3SX0A 5BPHA 1I8TA 3OJOA 4MRAA 5CVVA 1XTRA 3OQHA 2ZWPA 2RAVA 1T0UA 4U00A 5L6LB 1S9DA 3UHFA 3JATA 5AVTA 1UMCA 3KQYA 1A5AB 2CKDA 1VIYA 5BVHB 2P2CA 4WASA 4KWEA 3OIFA 1RQGA 2B98A 1VLBA 3QZ8A 5BN5B 4F8RA 2NVBA 4QYMA 1P6QA 5B7PA 4RE5A 3FB4A 3LZ6A 1GUDA 1THMA 2ACEA 1FFAA 2O3QA 1LSSA 1N2CE 3TF5A 5H3CA 1YB6A 3B3GA 4HLUA 4UB5A 5L1IA 2RH8A 1GUAA 3RB0A 2RE8A 1GRNA 2M6KA 2JLCA 3N76A 5KYGA 4KXMA 3EBPA 3DOHA 2BEVA 3BJMA 4N3AA 4C9BA 2OFWA 4YRSA 2C7GA 4ZQBA 1YONA 3RUDA 3AQEA 3KKNA 3ANXA 1TJPB 1DAIA 4N76A 5ALEA 1V25A 3IOYA 1FFXA 2BGUA 4QPNA 5FNVF 4QYTA 2YB4A 4NLGA 4I5GA 4Q24A 1J70A 4B5KA 1KYTA 3ZH2A 2G8LA 3OECA 3RJHA 1TT7A 2J6CA 3CV3A 1YAHA 5EE0A 3JQAD 4BO1A 2AV6A 2EX0A 4KQJA 1U0HC 4OQEA 4JI4B 3PHJA 3JY6A 3FD8A 2CJFA 1X13A 3W2FA 1BDIA 3AP3A 5KFXA 2EEZA 4HLUC 5EQFA 1GTMA 5I7UA 4AKGA 1GILA 2PRZA 5I47A 2GEDA 3DF9A 2DY1A 4F3RA 3RYIA 3PV8A 4DJ5X 4HB0A 1CY0A 1T2FA 4LQCA 4XFKA 1N78A 2Q9BA 3CQ9A 2GTPA 3BYZA 4TKVA 4AJOA 4ZAGA 3CYMA 1MOSA 3AW8A 2OXEA 3MCUA 2MYUA 4CMKA 4YJ2F 4U7FA 2IZZA 1K6MA 1QIFA 2PMZF 1W4BA 2C5SA 3AVOA 5K3BA 4QLBA 1ZLYA 1SG9A 1UJBA 1YJCA 4XRRA 5L9XA 2VF8A 4RGQA 4RSGA 4YY3B 3X1KA 2QIOA 4UJ3A 1KI7A 3FSGD 4XVRA 3OFJA 4RWZA 4OJ5A 1JYSA 5ALRA 1AF4A 1CS4C 5B1SA 3QKUA 3VAZA 3THWA 1EE1A 2NZWA 5B7QA 4RK6A 1KOGA 4TTAA 3N2IA 1Q91A 4D6PA 1UK8A 3PNQA 3DS8A 3IAHA 4KV7A 1OGIA 4ASUD 3R9XA 3C3PA 3ZV4A 2OYYA 3EDCA 1JQDA 2D0DA 9ICVA 1C0LA 1L4YA 4JYAB 4JBIA 3H65A 1XXHE 1LK7A 3CZ5A 1JSLA 2E5LB 1YS7A 2PY6A 2VPXA 1SKQA 4ZPXA 2F2TA 3NIFB 2KFNA 4DLZA 5HTKA 4ANFA 2RH4A 3S44A 3OC6A 2FE1A 4WFIA 1YA6A 1KGSA 2BGIA 3GAFA 4NOKA 1SA0B 5TMDA 3VV3A 3SI7A 1R5BA 3ROFA 4A9AA 3N4MB 2O8VA 3LT4A 3D4OA 4M1EA 3UOGA 3VH4A 4ROTA 1U8UA 4JEMA 1QGDA 3ZQ4A 4K9SA 3H2HA 5KFHA 3MBOA 3AEZA 3Q3JB 3A2NA 1A5BB 1QHSA 2O52A 5A4JA 1E18A 3F98A 5A9SB 1MAUA 3GNSA 3LL4A 1KMHA 3LA8A 5DISB 1Q74A 1T4MA 1V4NA 5EIFA 1P4AA 4D8WA 4Z3KA 1E7RA 5CDFA 3AF1A 5H3HA 1H9BA 1XVLA 1X87A 1SOUA 4Q16A 1K3UB 1D5WA 3SZOA 1ZPDA 5IAAA 1OBFO 4YRDA 1UPHA 1DQRA 2I7CA 4DLXA 1FQOA 1U94A 3W3AA 1FSZA 2OBLA 3EHEA 4I9UA 4NYMR 3G2KA 4IIUA 2IYXA 3WE7A 4UNSA 3GP8A 1V5WA 1A3CA 2ZCJA 2UXCB 4WBNB 1VJCA 2FN8A 3FB1A 4MUMA 4DLNA 2GCGA 2KJ8A 3HKZC 1W93A 4TV9B 2HO4A 3P0RA 3MTQA 2IVZA 4CV1A 4JJAA 4DQKA 1DTEA 1FU7A 1MCZA 2VJAA 2N46A 3HWX1 5LWHA 5KG1A 3E23A 3NRJA 1E6EA 4Z9FA 5REQB 1O3YA 4F06A 3MOGA 3JD2A 1U0RA 4M1TA 4EUKA 5EMHA 1GQQA 1KS9A 4J91A 5JT1A 4IDAA 3PYXA 3FVQA 4EFLA 1CWUA 1QMPA 1MQ2A 1ZIYA 3U3OA 5AXCA 1YXMA 1U2QA 4MJ7A 1CNFA 2I1WA 3PW5A 3H05A 1JMSA 3QVWA 1ZD8A 3ZNPA 4P54A 4LYYA 4QEKA 4DUGA 4XOIA 2O8BA 4UQPA 5JR3A 2PZEA 2IH4A 3A04A 1HZJA 4LI3X 4XTRA 2HJ9A 4PSDA 3HWSA 5BSKA 2BJHA 3I4FA 3P32A 3VVLA 4IS3A 2TYSB 2VWPA 2ZTVA 1RFLA 1Q83A 4FOLA 2DPIA 1H38A 5K3FB 3I0NA 1FQJA 4J9QA 3OF5A 1Z19A 1R6XA 4NM2A 3ZWVA 5AOCA 3AEYA 2BJWA 1P7CA 2C98A 1D2MA 3FPAA 3OIGA 2Z98A 5JNTA 4PL2A 5JVDB 3CIFA 3G2HA 5FQNA 1VOTA 3VJLA 1RWOA 1YL5A 4B2YA 2WIGA 4V1CA 4JLBA 1V8PA 1WXHA 2P79A 5DW3A 1G20E 2A1IA 3LW7A 3AL2A 3TOXA 4LKRA 1HFKA 3STWA 1BQ4A 3OY7A 4V0MA 4G36A 3V3TA 2F1OA 2LDBA 4QUGA 4G86A 2ZIEA 1ZRMA 4ZVLA 3L5OA 4GKVA 4BQQA 3AP2A 3H1GA 4PLVA 4H16A 4YJDA 5CD1A 5ECYA 4PG8A 4OUDA 2EBUA 3RU7A 3KYJB 1YCFA 2XZDA 4JVSB 2NSHA 1WPRA 2PNFA 1NJYA 1XO0A 3RTCA 4IRKA 5F7OA 1T3GA 1WUIS 1BW9A 4CDNA 2VFAA 5LQAA 5LZ4A 1QZUA 4X63A 2E4XA 5BNTA 4QQNA 1XN1A 3ECAA 3GEDA 1Q7GA 4ALLA 5DYTA 1E3IA 4K9KA 1VI5A 4KMMA 3EBLA 1EJ0A 5MGNA 4N54A 4PHPA 1MDBA 2QM7A 4H6VA 5G4LA 4I2GA 2E4AA 2DQ4A 3PFCA 1JSCA 1IN7A 4L2IB 4JA2A 4D3FA 3QY9A 4YXWA 2DP4E 3ESQA 3ZWWA 4FW8A 1H2XA 4F5WA 2V55B 3MGVA 3RFXA 3ZWYA 3VR6A 2R8XA 3AW9A 2Z2XA 1M2GA 2JJQA 4GR5A 4FYMA 1T91A 1ZDMA 1URJA 2DFPA 3UWSA 5EKUA 2RARA 4DL9A 2PAFA 1PWZA 4BWFB 5AM5A 3W5SA 3VZCA 3RVDA 3L7MA 5BNWA 4HYYA 1MFZA 1U4OA 2VJBA 1UXKA 3GLUA 4CHGA 4WK4B 7MDHA 3ESXA 4DQRA 2AXNA 4NLKA 4B82A 2X19A 2EHJA 9ICIA 1SVNA 1I6MA 5FL7A 1Z38A 2DEUA 3ZK7A 2P8JA 3PE3A 1IHPA 3RAQA 2W2NA 3UAYA 2ES4A 1Y5LA 1UBRS 1ZEJA 1HOTA 1TM4E 2DULA 2M32A 3BMCA 3B0XA 1I2AA 3KKAA 1OFGA 1OLXB 3L4PA 2FETA 2C1ZA 1XT6A 3PHCA 1XQWA 2ZP1A 4DE5A 5BWOA 2H0AA 4I14A 2C5BA 3K0AB 3N07A 5IH3A 4C4XA 2A9OA 2Q6KA 2GZ1A 3PC4A 2XEXA 3HMKA 3PSHA 1ECPA 4AKEA 4HYTA 1BCSA 5CGZA 4EB8A 3PR3A 5GM1A 5BURA 3BHNA 4IKOA 3PP8A 4MRPA 4M0MA 3CUKA 2EBWA 3KZOA 1PV2A 2LWIA 5ITSA 3OQBA 1DO8A 1RYHA 1EQ2A 4CM9A 3RFTA 1CB7A 2G80A 2AEMA 3K0BA 3OLXA 4J0FA 3JTEA 4DTCA 4AWBA 2FLWA 4EGSA 3KSAC 2I6XA 4PRYA 1Y6JA 1KETA 5HA5A 3LVRE 4CN9A 3KKAC 4NG4A 1U3DA 1ZNZA 2POQX 3TLMA 2QSZA 3L8HA 1ZI6A 2RAUA 1U6IA 3SZUA 4UVHA 5JQGA 3LVVA 1A9YA 2QTGA 2D2FA 3SJUA 5IBCA 3ADKA 2XEDA 3WAJA 4HQLA 4PQEA 4LK3A 4PC7A 3GVHA 2K4HA 1ZNXA 2C0CA 3NOOA 2AJLI 3ED5A 2XMBA 1QO0D 5CDUA 4N01A 1TX4B 2EZ8A 1U2TA 4C3VA 1SJ9A 2OR3A 1U0LA 4MYHA 4A8JC 4TV8A 4UW9A 5CA0B 1QLHA 3K6SA 5JTIA 4JQCA 1UDWA 1MORA 3CW9A 3VH3A 4BQEA 2VP5A 3HA5A 1TECE 1FUYB 4OMUA 3VHQA 4N5NA 1Z88A 3GVXA 4QNMA 4GYJA 4BV2A 1I24A 4MULA 5IYZA 3P71T 4PYLA 3H4DA 1LF5A 1CEYA 3FPFA 4C87A 1TPYA 5I48A 4GEGA 2PX2A 4AJ2A 8ICTA 3EQ8A 3QJYA 4MW6A 4YLGA 4J8PA 1AJEA 2UZ0A 3EDOA 1A4UA 2Q8QA 2BPGA 4EHKA 4MVJI 2QY9A 5DU2A 2DECA 1CDZA 2AKAB 5T7BA 3PC2A 5JYCA 2DH6A 4DA0A 2HRCA 2BUBA 8ICOA 4KEAA 1K9SA 5CG1A 4Y6GB 1YVDA 2HRBA 4UZEA 1GGJA 2FEXA 2SHKA 1YU9A 1N25A 1DG3A 2BEJA 3DVAA 2X1MA 4CLRB 2Q5CA 3PGJA 1TYDE 3G0GA 1IJBA 1QIGA 2AFRA 4X00A 3W7BA 1XK6A 5CB8A 3E2MA 1OCEA 9ICJA 2V3VA 4NECA 4XXHA 3L92A 1FJHA 4UJ5A 2AF3C 4AXXA 4BBZA 2GVDC 4IWYA 1PR2A 3IA2A 5BRNA 1NXWA 2CLMB 5F5LA 5I4CA 1ND5A 3WA6A 2ZULA 3N53A 4JWNA 4DT1A 3HB7A 1TADA 2X0RA 4R7TA 3K96A 3UAOA 3OZFA 1L3IA 1PVPA 2V9WA 4XH9B 3CPJB 2C1XA 1W36C 1PUXA 3TQFA 5IJ0A 4EPWA 4AXBA 4AMYA 4N7MA 8LDHA 2P0AA 1NFQA 4CF6A 4DXDA 2YZ2A 1GGKA 4DN6A 4IUBS 2WD7B 1G8KA 2ROQA 1X6VA 2RCNA 4OSEA 4Z2AA 1LKZA 1K75A 1A8PA 5AHOA 3EH2A 5ANRB 2IYWA 1VHLA 1L7OA 4LYEA 1DAKA 2GZRA 1T9DA 2HJWA 3HN2A 1I3CA 4MUIA 4RFLA 3ED1A 1GL3A 3SOZA 3KCNA 8AT1A 1X1TA 4RQ7A 1Z2OX 2NTVA 4YX9A 4OHKA 5IIIA 4D9EA 2KX7A 4ZAWA 1DIAA 3R77A 1ZIPA 3QW4B 5DHQA 4RFVA 2XNKA 4LS3A 4YBRA 1QIEA 3AQIA 3PNBA 3TB6A 4HCJA 4LZPA 3JQFC 3S8EA 4J0GA 3QE9Y 4EMBA 5KYYA 5DWQA 4M21A 4MUNA 4QW9A 5KEIA 1SFRA 1X1SA 2QP3A 1RPTA 4EFNA 2KM1A 4IJQA 4F2GA 4CG3A 3LK7A 4HDMA 4KKVA 3I2KA 4Z4IA 3IOEA 3VX4A 1X0XA 4OJPA 4XPIA 2E8MA 3UQ0A 3R0IA 4N4AA 3ZS9A 5I9NA 3T5DA 4JXKA 4OJTA 1E0AA 3ZZ0A 1NX9A 1OAOC 3MUNA 1BWSA 4LC0A 1Y42X 5ED4A 4H08A 1VMIA 2ID9A 2PI4A 5DBCA 5SY6A 2J0UB 5TEWA 4KQCA 1JECA 3WYCA 1T13A 1AUXA 2EP5A 4J0KA 1PR0A 5DM70 4OBEA 3V55A 3BGWA 4H7HA 3HLYA 3IM1A 3T7EA 4LXUA 5JASA 1IOLA 1ACLA 3SJBA 3B2NA 3HRKA 3ZE1B 4S12A 1V3VA 4WUTA 4LEIA 3VSCA 4F1WA 1MW8X 4DR7B 5DI3A 3S40A 4RDIA 3LKDA 5EIAA 2R87A 1OWLA 1JXLA 3DE6X 2QUHA 3FPEA 3M6XA 4EKNB 3H9EO 5KFGA 4OGFA 8ICRA 1IEWA 3PVZA 3FYSA 1F3LA 3T5JA 4BFXA 3ZJ4A 5BW4A 3O1IC 3N8KA 5FOSA 5HMMA 1ZR2A 1C80A 1H2BA 1II8A 5LM3A 2HQBA 1YS1X 1DO2A 3GT7A 3TBFA 3ST7A 3STTA 1P7WA 4YRIA 5SICE 3PENA 1GNLA 4G1MB 1IULA 1BVRA 5ALKA 2IYLD 4A8EA 5BR7A 3SR0A 4CKYA 2G09A 2GJAA 2FSHA 4R3WA 3T4PA 1PYDA 3TTYA 1Q7TA 1A5TA 2JH1A 1M2KA 1VE1A 3BPSA 3FYUA 1YFZA 2FSPA 4WLOA 2A57A 4UCFA 5BN3A 1KSGA 3SSMA 2A3VA 3QX8A 4CR6A 1I2ZA 3OEHA 1G4HA 4LTNA 3NATA 2YZNA 4HNGA 1O0BA 3RREA 2WG2A 3MWEB 3WLMA 2JGAA 1DQSA 3GFTA 5HKKA 3GFQA 4CNBA 2O23A 4W6QA 5FR1A 4MPTA 1N5WA 1ECWA 4B45A 4J9KA 4M38A 2XUKA 3FTCA 3STYA 3HQ4O 3H7IA 5J2TB 1RRVA 4B4WA 3IUEA 1WCIB 4RPCA 2FRDA 3MGGA 3BCHA 2NU6A 2Y1CA 1YL7A 2FPPA 4IIEA 2QRVB 1U81A 1J6UA 1ODTC 1N8KA 3ZHQA 1QU2A 2GYVA 1FNDA 1KSJA 1L1QA 4XIFA 3VNUA 4ITRC 4KN6A 1V1JA 1IN1A 3A2LA 3LLUA 1TQ6A 5J23A 3HE3A 3AONB 2OG1A 3PPXA 1S5PA 3RM3A 2CDRA 4LRTB 1GYQA 1P81A 5GJWC 4IHJA 3FYUC 1XDBA 1P60A 4UAWA 5HZHA 2FMUA 1OXVA 1SXGA 4TURA 3UWMA 3LQRA 4C29A 4DEVA 3R0QA 1KEEB 2JIBA 2TSYB 1E1QD 4H15A 4HNRA 1BJKA 2HRRA 2CJYA 1I0IA 4G2NA 2ZREA 3EUWA 3UYKA 2J0SA 4OAQA 4CM4B 4CTOA 7ICGA 1BX0A 4ZYZA 2FU5C 4WOCA 2I80A 2QQGA 2O7QA 4D41A 2QV0A 4BYMA 3ANSA 1YRWA 4D4KA 1T9BA 1EUZA 3D43A 5AKEA 4G0MA 1GXSA 5TE9A 2WTMA 4H4EA 2VNSA 1OXSC 2G76A 2C22A 2B94A 2FPGB 2FRDC 4IEFB 3U7GA 2P9JA 1MRNA 2PLWA 1XVTA 3HUTA 4X97A 2AB0A 4PTZA 1DKQA 4ZHQA 3MD9A 3EF3A 3KEGA 4MQBA 1XF9A 2QSJA 5DKFA 3HZZA 4F5PA 1S96A 1SRQA 1EBBA 5HZGA 3QOXA 4FX5A 4HMQA 5FD8A 4FP9A 1RWWA 1LPPA 5C5JA 3MTBA 3EFHA 2PZMA 4BWMA 4RUCA 3EIHA 4NLCA 4W5TA 1JHAA 1YDGA 4B4OA 1HNXB 3UZUA 5TLSA 2Q3CA 1LDEA 4GX0A 2BBSA 5LU9A 4RZUA 4TRMA 3RC9A 3TUIC 3T3IA 3V8BA 4E6PA 4HRVA 1IVYA 8ICSA 3PRHA 1DV1A 3NM6B 2GM4A 1CRLA 3A3OA 3KQWA 3BXGA 4NULA 2CSXA 1CUFA 1IEXA 4Q1EA 2OP1A 3AERB 1ZD2P 3AUAA 3D4PA 3WDSA 4J1NA 3NUGA 3QXJA 2ZQYA 5CITA 4PLTA 1W88A 4MKIA 3GFFA 3UFXA 2F43A 2BRUC 2BFDA 3A4IA 3AT1A 4FLMA 3RIEA 3UJHA 4QZEA 5L7YA 4IIGA 3TEJA 4ED8A 4KYIB 3V6KA 1K7YA 1XRJA 2XJ4A 3WLAA 3GNTA 1GPLA 2OZLA 2FR0A 3SAHA 1DTSA 1KEVA 2PXAA 2YDXA 2GKGA 5I5EA 4KLZA 2GZ3A 1XZKA 1Q20A 2G5GX 4CMBA 3GOHA 3WXMA 4P5DA 3GBSA 3WBFA 1V5EA 4C04A 3UB2A 2H92A 2V58A 1PG2A 1M74A 1JU4A 1IJFA 4LHVA 4KAAA 3HVHA 1H1DA 4X62B 4KFCA 3HP6A 3MN1A 4BQIA 2V7GA 4HFNA 1GZ5A 4LJ9A 5B2ZA 3DP7A 1JVBA 4IFBA 5JLAA 3PL5A 3DE3X 2Q46A 1WIWA 3KQVA 3T0GA 4X7RA 1T5LA 4YDRA 4RDHA 3M8RA 1AKTA 2DFTA 1HMYA 3UANA 1TK2A 5AIAA 1LK0A 4B7UA 1QF6A 5J4YA 1CB0A 1RRCA 3WJAA 1LFDB 2H59A 2A86A 3TB4A 2XTMA 2P1RA 1O6CA 2A5JA 4DWVA 3G8YA 4A8HA 2ZYTX 2P4HX 2B4RO 1SZCA 1RHJA 4YAIA 2OESA 1U45A 5ALQA 1PVVA 1OVMA 4L4RA 1Z39A 2GEBA 1WYGA 3UN1A 3UFBA 2ZUWA 3OOJA 1WZCA 4WCVA 2JAWA 1M66A 4Z53A 1Y89A 1LV5A 4C0SA 4FQ7A 4M9QA 3LD9A 4RF2A 3AY6A 3R3ZA 2EFJA 2GPTA 3ORFA 1RYDA 4IDNA 4BO2A 1II9A 3MGKA 2NVUA 5L3VA 1RM4A 2QNIA 3AL0B 2KBFA 2WINI 3IP5A 4LJ4A 2Z5FA 2NUTA 3PD1A 1Q2XA 1J20A 8ABPA 5L4NA 4XCVA 1QNFA 4KYVA 2XGOA 4YUYA 1SC4A 2MIIA 3MGAA 3TSOA 3ZWOA 4DMGA 4JVMA 4EW2A 4AQYB 4OYLA 1PT7A 2HNKA 2X0FA 4FX2A 2FB9A 5TS3A 2Z8YA 4GBMA 6AT1A 3GCGA 3FPKA 1KI9A 2A4KA 5HUQA 3FOAA 3WWCA 4HN9A 4WFQA 1Z07A 4DPKA 4RVHA 1HLGA 1SB9A 2ZPTX 3R23A 1M6VB 3L0SA 1KYIA 3AFIA 1BXKA 2C2RA 1XC7A 4DJAA 3A3YA 3PIDA 1R9GA 1TDJA 2QPOA 3IURA 1AS0A 4DL4A 4LXTA 1BGVA 1FY2A 4MQ4A 1OYWA 2FZ4A 1D9XA 2I5HA 4QJ5A 3FKSD 1T2UA 1N75A 4CODB 4BMVA 4URHA 2ERCA 4W63A 2Y3IA 2VH5R 4PLPA 2AGPA 2REXB 2V74B 2IXAA 4XM1A 4E5MA 4HGOA 4D42A 4Q48A 2HA6A 5KWSA 2PVCA 4IV5A 1JBKA 3GPCA 3JQ8A 1FTQA 5TMBA 5BNIA 2IZ7A 5C4IA 1BDHA 1YZQA 1N6IA 1IMOA 1XLWA 2ABWA 5H9WA 7ICFA 1WHSA 5HFJA 1HDZA 3I5AA 1UUFA 1G2PA 1H2HA 3H5VA 1SWWA 3CURA 1EFRA 4FDVA 3UW1A 3V4ZA 2EGUA 4LJYA 3NCTA 3FCXA 3DBRB 2QGFA 1RVV1 2I3GA 5EQTA 1ZUIA 1V95A 4GZLA 2VOJA 5AQEA 4DCPA 2CRXA 3WWOA 2O5VA 4Y2PA 2XW6A 5A6SA 3KZCA 3OP1A 2ZXHA 2QUBA 3CVVA 1Y1RA 1A4RA 3MEQA 1KRPA 2BFFA 3DTTA 1GN8A 3LPCA 4G8DA 4NX2A 5HGJA 1IZZA 3B20A 5C9ZA 1XOIA 4L3OA 1VHQA 5C7LO 3DVSX 3QVSA 4WKOA 1QTNA 1ICIA 2O8CA 3O8RA 4ZZ1A 2H2HA 4KK3A 2EIXA 3FG9A 2HHCA 1ZINA 3UXNA 3QI2A 1U90A 2GB4A 3L8GA 4H1WA 4ZMRA 2AVNA 3Q40A 3W9UA 3IHLA 2CEAA 2F4VB 2OL4A 5DG8A 5A7HA 2BGJA 2HDNB 3G8BA 3QLTA 4KQ2A 1D9FA 5KAFU 2YN0A 2OFFA 4XZ3A 4FHDA 3L7LA 1IWOA 2VHJA 3TW8B 2W9CA 4ZGBA 4QDKA 3ES9A 4L78A 4B4VA 2M6SA 3ISCA 4R83A 5CFMA 2GZHA 3BIOA 4EVIA 3BA6A 1PR9A 2JZBA 1R12A 1W5EA 4U7DA 1MO6A 1F8YA 1IB6A 2NYUA 5KQMA 3ZV7A 3M8KA 1RSZA 4HDSB 2FK7A 3B3QA 3FNHA 5TV2A 1CNMA 2R2AA 4TQUS 4AUNA 2OGZA 1NZJA 4OJNA 5D6NA 3JPRA 2YY5A 1OIXA 1V41E 1NLUA 3VI4B 3EIOA 2PJDA 1IRXA 3TG2A 4MXDA 3FZEA 3OKAA 1KOJA 4MTLA 1GGVA 2O20A 3GXBA 3AR7A 5TXGA 1UM8A 3TLCA 3ZPXA 1LCIA 1C7RA 1ZH8A 1N6HA 1VJRA 3PFWO 1N56A 3BK1A 3CUEF 2PWZA 2IKSA 1W94A 4YRAA 4RF4A 2OCPA 3WVNA 3BS5B 3DEHA 3CZ4A 3KUCA 2KHVA 4EYHB 4GVLA 3PICA 2HN9A 2RLTA 2HYDA 4UUMA 5DFAA 3AR2A 2YRWA 1KORA 4V0KA 2R5NA 4E2ZA 2Z9CA 1TCCA 3RUPA 2QRLA 4QYXA 1Z00A 2VJOA 1X1CA 3BIWA 4AN4A 1UPCA 3FVWA 1EAYA 1JG1A 1XTUA 9ICLA 3IDAA 3FVRA 3G8DA 5EPEA 5HJ2A 2B3TA 1YKSA 4EDFA 4NU0A 3NS7A 1J5PA 1BWQA 1SB8A 3N8GA 4I3FA 2C2GA 4IZOA 1JR6A 3HGMA 4FYIA 3VZRA 2GT1A 3VHXB 2L0XA 4NCBA 4ZZIA 4P35A 3KVRA 2IQIA 2VUTA 2Z43A 2OQRA 2P3LA 1NYRA 3FNIA 1F3OA 4FN4A 3VTFA 4K87A 5DP1A 2XCIA 2G67A 4DRXB 3OQIB 3KZXA 3UBTA 2G6TA 1JAXA 3UJDA 3P2EA 1Q11A 3QVVA 4CDMA 4GPEA 4D1YA 2GEUA 5IK2A 2Y1FA 2IRWA 5CYGA 1ZCFA 1U3TA 3HXMA 4RULA 3TGLA 3SV4A 1H8EA 5GQSA 1GQRA 2BV3A 3WC4A 13PKA 1XDSA 5J1TB 2QRNA 5H2FU 3VU8A 2EAUA 4UAZA 1MSWD 3M9OB 2C9MA 1D6MA 4MWBA 1ZRSA 1C3XA 4HRAA 4ZEOA 3PMLA 4M0PA 5CYFA 3ICQB 1S3SA 2CVFA 2O14A 4QZBA 4C7OA 1UBKS 4ZO6A 4DWIA 5JARA 3PE6A 5B12A 4NESA 1CQZA 2OBYA 4J0HA 1GITA 4HNAB 4YAOA 4YMHA 2MAXA 3PD0A 4PGXA 1E79A 4TROA 1NSFA 4F60A 1I4LD 1NHGA 4Q9NA 4XQEA 4QWEA 4F04A 4MEBA 4H1TA 4RD4A 4E5YA 5EEGA 4EYKA 3SWWA 3ENWA 4ZAFA 1NBHA 3B1VA 4MRSA 4FZNA 3AM1A 1MABA 3M3HA 1O2DA 3K16A 1AURA 3RU2A 4PAOA 4LYJA 2FLNA 1D8AA 3O4FA 1BDMA 2GPYA 5CDHA 3MR6A 3GG2A 4XRHA 3L5KA 2WYWA 4AIRA 4HD8A 1DFIA 5F7ZA 3GEIA 4PZAA 1VHWA 3L8YA 3FGPA 2GBPA 1G1AA 4GR4A 3E61A 2FWMX 4OIMA 1U63A 3ZCPA 2QD5A 1XP5A 2E6KA 4ZODA 4RQ1A 5KNDD 4F8JA 1ARZA 5EZYF 3ADDA 3R0XA 5AESA 3DOJA 1EP9A 1F1BA 4KMUA 3H6KA 3CLSC 3RCBA 1JN3A 3TRJA 1EHYA 2DGZA 4UHHA 5FBKA 1KBZA 4JCCA 3G7UA 4NH4A 1HXHA 1T9AA 2QT0A 4UDXX 3GZNA 1LDGA 1I5EA 1RWBA 1DC7A 2Q4EA 5AW2A 1GZDA 3A9CA 5AVXA 3I2GA 3VZPA 2V0CA 4YASA 3JAKB 2XRFA 3DXZA 2GYWA 1SIUA 2BC9A 5LZ2A 2FXVA 4LYDA 2PLAA 1NW4A 4JKOA 4E5KA 4LXHA 2SKDA 1ETUA 2BSXA 1KAMA 2G07A 4Z99A 2FMHA 4JDPA 4IIYA 3U3RA 1UIRA 2DFKB 5KNBA 3MAGA 5AI6A 3F7TA 1V11B 3WSWA 1WNTA 1DJOA 4BJ6A 1QGUB 1OZHA 1GTG1 4P5PA 4QOHA 3PCXA 4DLKA 3LWDA 3STXA 3R8CA 5JJLA 1Q0TA 3HBLA 1ENOA 1Y1PA 3I64A 1B0UA 5KQGA 3ZBQA 4QNRA 3MUFA 4QOGA 1X7XA 3KT6A 1X1QA 4D2IA 3FI9A 2QAGA 4YP0A 3K72B 4DOAA 2WAQF 5KVQA 3EIFA 3L0PA 1UM9A 3CVJA 4OHFA 1LSOA 5KFEA 3P52A 3GY0A 4FBGA 1IQRA 3IP7A 4RV9A 3SVTA 4MI1A 5E1BA 4MKGA 3VR3D 4FYJA 3ETHA 5KT3A 1MC8A 3WU2U 5JWOA 4FBMA 1YZHA 1FFSA 3IIKA 2KQUA 1IPHA 3C4VA 1ODLA 1TZCA 3U81A 5FWDA 3BMOA 1G5FA 1E0KA 1ZM2A 5IKEA 2ZRJA 5DK4A 1Y6FA 2ZSFA 3RAGA 4HPXB 4H7EA 1DQZA 1WMBA 1WDTA 4YD1A 2ASLA 4GPBA 4BIMA 3NHJA 3TLJA 1P3DA 1O5IA 2ZRGA 3AILA 3M4YA 2YTZA 3WJ2A 1N1GA 5AYVA 5ITWA 4ZXFA 1PT8A 4D96A 3WNBA 1SUEA 2H6EA 3FF4A 1CHDA 2SKEA 4WJKB 2X22A 4AZ0A 5SZJA 3U7EB 4ES6A 2C9CA 4G0WA 1G17A 2HKIA 1XZQA 3FR8A 5CB4B 3GWGA 1Z7GA 4X41A 2GCIA 3FPGA 3S6JA 5K3EA 4ED3A 2HSWA 4ALKA 3GO4A 3OFVA 3O8LA 5DGBA 1J24A 4B0OA 1K97A 1JQLB 3GU3A 3KQTA 1N2EA 3V9AA 4NENB 1YHZA 2ZJ5A 3OIWA 2G4LA 2HA0A 4KIJA 6GPBA 1A97A 4OFWA 5L3QA 2VAPA 2EOAA 2IKQA 1YJBA 3CJQA 5I6DA 3MYYA 1J97A 4R9SA 4PO8A 5ITZA 5KTNA 3KLNA 4I5FA 4K6GA 3JQEA 5EWMA 3KKKA 1T36B 2BBTA 1N5MA 2JAOA 3LUKA 3COYA 1AHHA 2X40A 4G5SA 3TPCA 5CFQA 2E3TA 3LFUA 4PZEA 3Q6MA 4I2CA 5C3UA 5A0VA 5F77A 1UBNA 1DWQA 1OX4B 2QTNA 1CRZA 3WLPA 1YBFA 3ASUA 4ZANA 1R4ZA 2WWVD 4DJTA 5H0IA 3C21A 5GADl 2OQVA 2XGPA 4DEXA 1R74A 4IIJF 4OAPA 4DSTA 4IYJA 1XI2A 3RSQA 4UU0A 5K8IA 1VL8A 4UD2A 1SHTX 3U4HA 5JHHB 4DR4B 3JQGA 1PEDA 4D9CA 2PXIA 5J47A 4BKRA 7REQB 5ETJA 4G5RA 5K0LA 2O4CA 1TUEA 2BPOA 3S2FA 2IY9A 3T12A 4GGOA 2XIDA 1FP4A 2RHBA 4F3KA 1P73A 5B3AA 2HRQA 4F96A 1BCRB 3ZDYB 1FLNA 4FFBA 2ZRNA 1XEWX 4HMPA 2BY4A 1QK3A 3ESYA 4JMPA 3LDGA 4OQ4A 1NNLA 3LC2O 3AMZA 4AJKA 3V7JA 1TZJA 4O2BA 2UYHA 4JGIA 3GRKA 5EE5B 5BN4B 5ARBA 5L53A 1B00A 3BWDD 4NCXA 1Y34E 4M76B 1R50A 2CYCA 1PZFA 1UEIA 4ZAXA 3PNOA 4N18A 1QZXA 4ZZ3A 1YWGO 2ZRMA 2D5AA 5DBIA 5L40A 3CF4A 3I01M 2WMNB 2GZDA 4BAUA 1PJAA 3ZCQA 4Q21A 4X9XA 3EVEA 2AGOA 2ZSHA 4CT4B 4QYWA 1A6SA 1KY5A 2D4AA 4LWOA 1XCPA 4M9LA 5C4MA 4G6ZA 2XIJA 2Z4SA 1QPZA 1W6RA 5FQOA 3DA8A 2B8WA 3LO8A 5DH9A 3T79A 2DU8A 4QHTA 1BU5A 3G9TA 1J2YA 1BPDA 1FDUA 2A67A 3QWIA 3MIZA 1TCAA 1P74A 1B1AA 4M2LA 1D4ZA 5FO1A 2AC2A 3EXFB 2BDEA 3AO0B 3KC2A 1N2GA 8ATCA 5DN6A 3HNOA 3C98A 3JR3A 4TVBA 4ZI5A 4JK3A 4CFZA 4WGFA 4NS4A 1Y88A 4KE8A 4HKTA 4J03A 1H3NA 1AZWA 4DSLA 2O7NA 4HUQA 3BIFA 1I7LA 5EIBC 4ED1A 1Z5OA 1CEEA 4GDFA 2A3NA 1SG6A 3TL3A 2P2LA 4G4SP 2W4IA 1G42A 1MQ8B 1K27A 4OKSA 1EFPA 4P33A 2V1XA 3ROPA 5C1DA 3A1VA 1L1FA 4E46A 4QHSA 1RM0A 1UFRA 2J59A 3FTEA 4QULA 1ML3A 4NSNA 1U9ZA 3EXG1 1XRPA 4NTZA 1FTSA 5CLIA 3WADA 2V8BA 1CJCA 4G0QA 4EJMA 2HPVA 5KOYA 1XNHA 2ASDA 5NLLA 2QLJA 4H6WA 4OI0A 2GPSA 1ZWKA 4FZRA 1Y63A 3M4XA 2ODEA 3CNBA 2QI9C 2YWFA 5GM2A 2ZR9A 3B7GA 5IAOA 3B0YA 4AS3A 2C88A 2O9JA 7GPBA 4IDFA 4REQA 3ZZ1A 1WDMA 4NQRA 1JZQA 1NIPA 5E3HA 3TZKA 5DYGA 4KK4A 2ZUUA 2A84A 4NBNA 2GXSA 3PXAA 4C07A 1SU6A 1RJDA 1QOPB 3PCRB 5G0VA 4MKRA 5F21A 3JQDA 2G9RA 1VJDA 2JLSA 2FSSA 5E4FA 3SIXA 1HDXA 5DLPA 4JQSA 4CI9A 4UVGA 1AUQA 2CLKB 2PRIA 3TJZA 4QODA 2QWXA 2GM5A 5DNWA 4Q3NA 5AWFC 4KQEA 4WZAE 4UE6A 2EFHB 1RI3A 2HFJA 3K09A 2FLLA 2M2IA 1BYUA 1E0JA 1RQNA 1B8PA 4ZKDA 1T2VA 2OBNA 1T0HB 2WU1A 3CWZA 4NBVA 2CW5A 5C1IA 3EFOB 1CTQA 2Q5JA 4C0JA 3IT3A 6YASA 1CJKC 3SJAA 1Y80A 1MT0A 4IJ5A 3FXAA 3C8DA 5TQ2A 4Q4AA 2X42A 3LXUX 2JG3A 2VP2A 3KHLA 3G6KA 2H4ZA 2NVWA 3X1ZA 4Z6CA 2HPZA 1JL3A 4D45A 3E4DA 3S7TA 3VJKA 4O0IA 4Z9BA 2CL6X 1DRJA 4Q3CA 2DBVO 3RAJA 4RQBA 3G2QA 4RABA 5E3JA 5C5CA 4JP2A 1FTYA 3A11A 2IDMA 4PYQA 1EFUA 3DYIA 4IXNA 3PBKA 4IXMA 3WRXA 2J3LA 2PSDA 2A78A 2Q4DA 1RLJA 3BXEA 4I19A 4P81A 3T3PB 3K09C 3QEKA 3N2EA 2ZIVB 1GKKA 1FVXA 2VTBA 2JFZA 5LQSA 1UA0A 1WZUA 1T1RA 3LBIA 1SXJB 1QUEA 3GVPA 5FYQA 5DBHX 5KFUA 2QUZA 2D5IA 1FX0B 5DHUA 3QVGA 4P9NA 2F3UA 1N8NA 1ZQSA 1U7HA 4QO7A 3PPIA 1ONPA 3ROQA 2FA9A 3PEUA 1XMIA 5JANA 5B1IA 9ICRA 4Q9HA 3IDFA 7AT1A 4CQMA 3HZHA 5LQJA 3KQUA 2PMKA 4K3UA 2XUFA 1YB1A 1IJEA 5K8JB 3P0JA 5HCUA 2EWWA 4QHYA 2CMGA 1J5EB 4LXGA 2AFIA 4MGZR 3E9ZA 3WRXC 2BKXA 5J2UA 4CMIB 2DSTA 5TPWA 3KNZA 4URVR 2D1FA 5CR0A 2UZ1A 5L3SB 1X7YB 3ENZA 2IA6A 4JI6B 1PUIA 4MVXA 3ETEA 1MDFA 4D8XA 3DEYX 4S1PA 3EIWA 2I87A 1XTIA 1R5OA 1ZQ1A 4ECYA 3A4NA 1LD3A 4YR3A 4LVOA 1E3MA 4ELTA 5C0OE 4II7A 3PC7A 2C2EA 4EB3A 4OJMX 4JSTA 4ZC1A 2MSLA 4P4SA 1NSYA 2VR1A 2JH8A 3SMVA 1N1DA 1Q0ZA 3BMQA 4AG3A 1O96A 3AESB 3OJWA 3QP9A 1R00A 4D4MA 4BDPA 3WTCA 1MA7A 4G4SO 2BR0A 4ZH4A 1IL0A 3HHEA 2GO1A 1QCKA 2A1AA 3K5WA 4UBIA 1KEKA 4PQGA 2XZPA 3AQFA 2QW0X 5JRDS 1XC9A 3JPYA 4BJ3A 2BN4A 2NN3C 4HWGA 3RAFC 3VZDA 3Q8WA 2HBQA 3C2KA 4D6YA 2Q2QA 2GYUA 1ZQ1C 3K4GA 3REQA 3E9DA 2OV6A 4DUPA 1ZSYA 2YMMA 3PQFA 2QTMA 1ZG3A 4TKMA 4KI0A 1FBTA 3L2OB 4IGKA 1KFEB 1B7GO 4N3GA 3UJCA 1UJ2A 2AMYA 4XRGA 1HV8A 4JZYA 3ACCA 3IXQA 3H8VA 4P0PB 4V2UA 1QDLB 2JJYA 2LV8A 4P7FA 1U1FA 3E22A 1NKSA 4NABA 1NUSA 3FPHA 3TSYA 3TM5A 3B51X 3IDSA 2DHDA 4DPLA 2HXYA 1TE2A 4U02A 2XB4A 3WB2A 4G5QA 3JPSA 2CWDA 5H8WA 2EFCB 4EG0A 1MIOA 1D4FA 2B21A 3G5UA 2VNKA 4CEHB 4CL2A 2NP6A 5CTJA 1T2CA 4DLWA 3UATA 2PHZA 1BG6A 4M0UA 3ETJA 2QQ5A 4U2FA 4R71A 5JJCA 1T9CA 2PV0A 2QOEA 2EWVA 1NK0A 5WRFA 3GD5A 2NQ8A 4B80A 5J5CA 1AZSC 3TNLA 4C7VA 2XXBA 1FE8A 4ECAA 2ZBPA 1B0AA 1QBGA 1DIGA 1R64A 1EWRA 5HR6A 4K40A 1CUZA 4FFMA 5BT9A 2XLBA 4FYWA 3HVIA 4L3VA 1GM5A 2C4KA 2MSKA 1J1UA 4L5AA 2MRLA 1EJ2A 1KI1A 1BXRA 1P1CA 5KJEA 1IK6A 3VBEA 4G5OA 1P0PA 2I67A 5BR8B 3ZCSA 4R9UC 2IU4A 4H4DA 1R4NB 1UC8A 2R8PA 4O2LA 4MEXA 4GVPA 3ESAA 4OVKA 1UBUS 4F4HA 2RKWA 4KSCA 5T6MA 2H17A 3L1JA 4ZJPA 2AZXA 1PZNA 1AKWA 5DKWA 4B3MB 1NUHA 4B83A 5DG7A 1RP7A 1AQIA 1C4KA 3RAPR 2W98A 1GGEA 3VA7A 3H18A 3DMYA 3QLUA 5JH7F 2OM6A 1W0JD 4PNPA 3JALB 4PPYA 1EU1A 1PVRA 1Q3KA 4MPPA 3DDUA 1FMLA 5A5DA 3HCEA 4LFBB 4N12A 4Y6RA 1V5GA 5ER9A 3C7KA 2JLBA 4QASA 1QIIA 1QTMA 4WWHA 5FUVA 3NM4A 4TMKA 4MP6A 3OQ6A 3WGGA 3RYFA 3I3SR 1J0BA 2WD9A 2WKQA 2IUTA 1GN9A 4YT5A 5L1JA 5DCUA 1YKFA 2I6QA 2VDQB 1I4DD 4F9TA 1IHXA 1T43A 5LDDC 2X2PA 5BUSA 2VJCA 1XTKA 3RVOA 4OJLA 4I8DA 4G8CA 3BTVA 4KE9A 1J9EA 1X92A 1TUBB 3M1YA 3JWIA 4ZT5A 1GG5A 4TKLA 2R8OA 1Z4NA 2ZRKA 3V8MA 3WLIA 4KXQA 5A02A 5HBGA 1RQ2A 4E7OA 4XASA 4L75A 2QJTA 1X6IA 5EINA 4X45A 1UZMA 3A4MA 2DUUA 4P82A 1HT0A 1WX1A 3MT9A 1XD9A 2A9RA 1Z0FA 3L01A 3NVDA 4BNKA 3HJUA 2V7PA 3BB4A 3PV0A 1ZXBA 1X3SA 1AQLA 3B6EA 1I1QB 4V38A 2AUMA 5DLGA 3I9KA 5U4XA 4XR4A 2H2AA 1O87A 1KJ9A 3GEBA 3KJGA 2ALZA 1R0LA 4IV8A 1P4SA 3GGDA 3LYAA 4NHOA 4N41A 1XIVA 5KTYA 3ZGLA 3B9PA 2YQ4A 3VU0A 2EYUA 7YASA 3K5IA 1EFLA 5DIFA 2C0PA 4ZVUA 1Q1NA 5AOAA 4O02B 2WAAA 2B5WA 3PT5A 4Z8YA 4AO6A 4I55A 2IYYA 4UBCA 2MDTA 2ON6A 1GZ3A 4D4IA 4HRYA 2ECPA 3SSOA 3MJDA 2AOXA 2GCOB 2VZ9A 2IHYA 1O5OA 1YOBA 5KTKA 4YACA 4X95A 1PJ2A 3P0FA 1N5RA 1LF0A 3PO5A 1ZN8A 3I6QA 5JAQA 3DEEA 1QH9A 1TTTA 4HGZA 1ATIA 4WXPA 5DEIA 4WLEA 2RI1A 3HX0A 5IPFA 3DLTA 1KY4A 2VT3A 3TTUA 3MQ2A 4G25A 2Y1KA 4GMHA 3F9CA 3OZRA 1I7PA 5LZ9A 1X42A 4PG5A 4N8SA 3M70A 3IMCA 2SKCA 3H17A 3UBMA 4ZJYA 2PT9A 4I4TA 4DEYA 2WKWA 2FQXA 1PAUA 2FFJA 2BI8A 1ZXLA 1YDWA 2Q3BA 1NJGA 3E5HA 2YOHA 2QMQA 3LY7A 4Q4HB 3W05A 2AX3A 5AXDA 1HDYA 5IVPA 5EJ4A 3BH0A 3KD3A 2W7OA 3R7FA 4OK3A 5LLSA 5HTOA 5JYDA 3QVKA 2NTNA 1VI2A 1XNGA 3DMPA 4GOMD 3CNQS 1SKRA 5BUQA 3ACDA 3KT8A 5AW5A 4FWIB 3OBIA 1FSPA 3IOBA 2Z09A 3NOQA 2YFQA 3MHTA 3CHYA 3GAZA 1G3IA 2HW3A 1JNXX 5COAA 4AQDA 2QN7A 1NY6A 1H5UA 3AV3A 2OXFA 3MW8A 2VQFB 1F8GA 3ACBA 3HKEB 1X9SA 2YC2C 1RYMA 1Z56C 1XZCA 2JVJA 2CVPA 3M34A 5CLJA 1P2FA 2JA2A 2PUDA 4K6CA 2PRYA 1MC5A 1NURA 5ALGA 3C5HA 3IEVA 1PJSA 2V6IA 3ETDA 4IR7A 3FYDA 1VGQA 2OD2A 4TLLB 2VDNB 1Z0AA 2ORVA 5DTRA 3W5JA 1Z0UA 4XDYA 4W5QA 4R16A 2PQ2A 1GAXA 2YQ5A 3U6KA 2OHHA 4DS3A 3E35A 3NNNA 1EFVA 3SLGA 3L4BA 1KDRA 4HAUA 4Z1MD 1AB6A 3GZTB 4UQGA 3IBGA 5A62A 4OY3A 3E0QA 1YT5A 2O0JA 1JRPA 5COBA 2IDKA 3GZFA 4AN0A 1PEYA 4P31A 3GCXA 3QLVA 1XKTA 3T9BA 1YASA 4CKBB 3UH0A 2ZYWX 2Q7XA 3ILYA