4EEKA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound phosphate and sodium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
total genus 83
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eekA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eekA01
1NRWA 3L1VA 5AKYA 2CFSA 4O8CA 1RDFA 1QQ6A 2GO7A 1N9KA 3ZI4A 4XQ0A 3UMCA 4I9FA 2O9JA 5AK4A 3ZU6A 4RESA 3NASA 2RAVA 5AI6A 1CQZA 3DV9A 4UARA 4YGYA 3ZTYA 2C8LA 2JAOA 2PKEA 5ALVA 3ZWDA 4G9BA 4DW8A 3MMZA 4IG4A 1F5SA 3L5KA 2I54A 3J7TA 2YBDA 3NRJA 2P11A 4YH1A 3KD3A 1TA0A 1XPJA 3I76A 3A1CA 2ZXEA 4BKMA 5A3QA 4XPZA 3OCUA 1NNLA 3NANA 5ALUA 3N5KA 3DNPA 1WZCA 3U7EB 1S2OA 2RARA 2EATA 3QUQA 3PGLA 1Z4NA 4GIBA 3MN1A 4KYTA 3U13A 5AM1A 3ET5A 3QU5A 1WR8A 1YNSA 3E81A 4UMFA 3L0CA 4CF3A 3R4CA 1L8OA 2WF8A 3AR9A 2O2XA 2WF5A 5ALGA 2Q4RA 4UM5A 3M9LA 4BX3A 3AR8A 2OM6A 3KOOA 3PCTA 1EK1A 1L7PA 5ALEA 1ZJJA 1Z4QA 5AKXA 2BDEA 2HF7A 4ZEXA 2G09A 2R8YA 3L0BA 1Q92A 5AKKA 3CZ4A 2FPRA 3QYPA 3U7GA 3AR4A 5AW1A 4OCZA 4L6AA 2GFHA 1XVIA 5AI4A 3OTQA 3N07A 2W43A 3IB6A 4HYTA 1RMQA 1N8NA 1T5SA 4Y2XA 2B8JA 1NF2A 3QU9A 2D2VA 4UATA 5AKGA 2B1QA 3EWIA 1J97A 3WK4A 5AW0A 3W5DA 2I7DA 2HF2A 4HGOA 1ZOLA 4ZEVA 3ZVMA 3A1EA 1SWVA 3TLMA 5AKZA 1RMYA 5AVUA 2B82A 3B9BA 4UMVA 4Y2UA 5AI8A 1U2TA 3OCWA 1ZRMA 1YJ5A 4J03A 2JAWA 4DWOA 5AVYA 3WKAA 2C4NA 5ALHA 2NO5A 1VFPA 4AS2A 3FPBA 1T5TA 4QQFA 5AM5A 5E0OA 3QX7A 3U26A 3QNMA 3WK8A 3CNHA 5ALNA 2C9MA 2W4MA 3WKCA 1L7MA 5AM4A 4UM7A 4CF4A 4QJBA 3M1YA 2RBKA 1TJ5A 4B6JA 1ZD2P 1Z4JA 1QQ5A 3FVVA 4NWIA 3I28A 2HX1A 3R9KA 4HAIA 3FM9A 3ZWKA 1TJ4A 3QU7A 2MU2A 4E88A 4GXTA 4L57A 2YJ3A 4JDPA 4KX5A 3AR3A 2ZBGA 3L8GA 2HCFA 3EF1A 4KX3A 1J8DA 1Z5GA 3OPXA 2BY4A 4BNDA 3UM9A 1Q91A 3SD7A 1U02A 1RKQA 2FUCA 3NALA 1Z4IA 3EPRA 4AP9A 5A3RA 3L8EA 5JJBA 4Y2YA 2WF6A 3ZTWA 4NV0A 2G08A 1RQLA 3N1UA 3WK9A 4Y2PA 3A1DA 4NFLA 2JARA 3DDHA 2BDUA 3OCVA 1LVHA 5ALMA 4XOUA 5IT4A 3F9RA 4BBJA 5AKIA 2YN4A 3K1ZA 2HI0A 2FI1A 2YMQA 4EELA 4EX7A 2HSZA 4G63A 2B30A 5IT0A 3UMBA 5AVSA 4EEKA 2IYEA 1RQNA 3L8HA 3E8MA 4EX6A 4MUMA 2JAUA 2IOFK 3I6BA 5AICA 4NAVA 3GYGA 3ZVLA 4UU0A 4I9GA 4Y2JA 1RMTA 3WGVA 5AKLA 4Y2VA 2GHTA 2P9JA 3ZX4A 5AI5A 4DFDA 1Z4KA 3FGOA 1TJ3A 3PDWA 1PW5A 5ALXA 1AQ6A 2R8XA 1Z4OA 2FPXA 5AK6A 3AR6A 3W5CA 2C88A 5IS2A 3UMGA 2FPSA 3L0YA 5ALJA 3KDPA 4UAVA 2EAUA 1O08A 2HDOA 3WKDA 2FDRA 1Z4MA 2YY6A 3HYCA 3QLEA 3ZX5A 1RC8A 4H1WA 2I34A 1Z88A 5ALDA 5ALRA 3IJ5A 2YJ5A 5AW4A 3L8FA 5AM3A 3N28A 5AI0A 4FE3A 4UU1A 2G80A 3SKYA 1RKUA 4F71A 2I55A 3SKXA 3P96A 2FPUA 3B9RA 2Q4TA 2YFYA 3L7YA 2AMYA 2B1RA 5ALOA 1YDFA 1Z4LA 1K1EA 1U7OA 2B8EA 3BA6A 3ZUPA 1ZD5A 1XP5A 4UW9A 5ALIA 2CFTA 1TE2A 2NYVA 4BNDB 2MU1A 5AW3A 1QH9A 1LTQA 3E58A 4UASA 4L6CA 3W5BA 2YMMA 4C4TA 5AM2A 1RLMA 5AW9A 2FUEA 4OHFA 1YV9A 5AHXA 4YCMA 3QGMA 2GMWA 4OD0A 3BWVA 5AVTA 5FP0A 2QLTA 5AW2A 3NIWA 4KNWA 4PNHA 1JUDA 3FPSA 1RPZA 3S6JA 2X4DA 5ALQA 4MWOA 4Y2QA 4JB3A 3AR2A 2JGAA 4ZEWA 5AVRA 5ALSA 2GHQA 3N8GA 4Y2TA 2AH5A 3MC1A 2IA5A 4KNVA 2R8ZA 1YS9A 4KN8A 5ALLA 1Y8AA 3ET4A 5AW6A 3QUBA 1U2SA 2HOQA 3PGVA 5AVVA 5ALYA 3R09A 2MSNA 4DCCA 2YMLA 3NAMA 3I1YA 5ALTA 3SF0A 4EZEA 2RB5A 1O03A 4NABA 3OCYA 2WHEA 2I6XA 1SWWA 3HLTA 3U7HB 3AR5A 3MPOA 5AK5A 3SMVA 2WF9A 5AK3A 4Y2RA 2IOFA 5ALKA 3L1UA 4HGNA 3WKEA 2YJ6A 4J2TA 4BEWA 3E84A 4HGPA 4AS3A 2ZG6A 4BYGA 3U19A 2YJ4A 2YMPA 3ZVNA 5ALFA 4XE5A 2FPWA 1YMQA 2QYHA 3QUCA 2CN1A 4YCLA 2WM8A 2AGVA 2R8EA 4CE6A 3WK7A 5AW7A 1EK2A 1X42A 3VAYA 4Y2SA 3RF6A 2WFAA 4C4RA 1U7PA 2W11A 3ESQA 2IOHA 3QU2A 1WPGA 2PR7A 3KC2A 4FYPA 1QQ7A 2B0CA 1L6RA 3ED5A 4OFZA 2AUTA 5AKJA 2G1AA 2G06A 3QXGA 3ONNA 3AR7A 1RRCA 5AW5A 4EENA 3OCXA 3W5AA 2ODAA 2P69A 4HGQA 5T41A 1MH9A 2OYCA 1L7NA 4UMEA 3A3YA 2Q5EA 1CR6A 3SLRA 5ALWA 4UMDA 1Z4PX 1RLTA 5AVWA 3RFUA 2EARA 3QUTA 2ZBFA 3EF0A 2ZOSA 1ZD4A 2P27A 3NUQA 1SU4A 5AI9A 4RETA 3WKBA 4CNQA 1ZS9A 3OCZA 4FFDA 2G07A 5AM0A 1WVIA 5AVZA 4BX2A 2HO4A 5AESA 5A3SA 4BX0A 2DQSA 3WK5A 1ZD3A 3IRUA 4YIHA 5AIBA 5ALZA 4YIKA 5AW8A 1VJRA 3ESRA 2OA0A 5AKHA 4F72A 2HEGA 3WGUA 3QU4A 1KYTA 2WF7A 2FEAA 3ZW7A 1Z5UA 3DAOA 5AVXA 5AIAA 3SHQA 2ZBDA 5ALPA 1FEZA 3U7FB 3WK6A 1RLOA 1RKVA 2OBBA 4IFTA 1S8OA 2PQ0A 1QYIA 4Y3UA 2CFRA 1ZRNA 2ZBEA 5AKEA 2VKQA 3KBBA 3B8EA 2C8KA 1IWOA 2G0AA 2HHLA 1L7OA 2I33A 3KZXA 1T9ZA 4BEVA 1L8LA 2NO4A 5AVQA 1VJ5A 4UAUA 4C4SA 3D6JA 4YCNA 4HGRA 4CF5A 3FZQA
chains in the Genus database with same CATH superfamily
4O4IF 3U3ZA 3RH6A 4FMDB 5E2BA 3CZ9A 3O8CA 1S3GA 3IDQA 3VBEA 4BQQA 2GERA 3W1VA 1HL7A 2BI7A 5BN3A 2NRVA 1MU0A 3W6PA 4BATA 3EJWA 2RDJA 1CRLA 3SR6A 1AUVA 5P8WA 1QXSA 3BOSA 4A6PA 4KDRA 1RM5A 5BN5B 1QJCA 3OJEA 4XWAA 4YUAA 4OX9B 3V1YA 1R8QA 2PX0A 4XJSA 1PSZA 3RCBA 2YR0A 3RF7A 3T94A 5HOQA 4ENWA 2ZT6A 4HZUA 2J9RA 2JGNA 2PKCA 3L7NA 4PFSA 2H2IA 4U6QA 3OJFA 3VDMA 4ALIA 4EHLA 4NH4A 3KAKA 2QX4A 1QVZA 1BZYA 2ZI5A 1J06A 1FP1D 1XKQA 4IMJB 4ILEA 4CLEA 2O1EA 1MQ3A 4EHNA 1NQOA 1YFZA 4NPAA 1GPUA 1NHGA 2F8KA 1H2HA 3C3KA 2NZWA 4DMHA 5L3SA 3A2LA 1RM6C 4JVNA 1LZKA 3N2NA 3KD3A 2GZ3A 4AU1A 3AV0B 2PIAA 3MS4A 2Y1GA 1NJYA 3VU9B 4DLGA 1YZGA 4BRSA 2ZT5A 1NNLA 2A35A 3JQGB 1EJBA 3GDFA 1CZKA 4CLDA 3BMOA 5AHWA 4FS1A 5ALUA 2Q49A 3L8ZA 1XZIA 3MM4A 3P26A 2FG7C 1ZD8A 2ZT8A 3PXEA 3MR5A 5BQPA 1J21A 1YZNA 2WPDA 4DLSA 4UHDA 1VI6A 2W2QA 2UV8A 5KBYA 2QUZA 3CLUD 4AWXA 2ZYHA 1KZGB 3LX4A 2XVYA 5EEHA 4K7JA 4M1KA 1Z4NA 4MUGA 4NYIR 1UBSB 1G4UR 3RSQA 3SX4A 2O5VA 4H7EA 1PRYA 7ICTA 2DCUA 2XY5A 4ROTA 1EK5A 5LR6A 4HX5A 3VPSA 2YKGA 1JG1A 3JD3A 4HYEA 4QSMA 2F62A 3PX2A 2DE0X 2L2QA 2YHSA 1IH8A 3AR9A 4IDHA 4JP5A 5D6NA 3UFBA 2QM7A 3PR1A 4RS3A 4OAPA 1C4WA 3WNCA 3WLIA 5A6SA 4KITB 3I58A 2VUIB 2XYVA 4HAYA 1H5UA 3ZEIA 1DJOA 1ZICA 4AIRA 5FNZA 3OY7A 2DHRA 2IOQA 3HHEA 4W5QA 1IPEA 1O87A 3PFFA 3QFSA 1BKSB 4EW2A 1N2ZA 5EXEA 2YTZA 5CFQA 5AJZA 2QT9A 5J0UA 2IX9A 2JCXA 3UPUA 3VH3A 4N48A 2J3KA 3OJ0A 1I4LD 2EX1A 1KC1A 3FUXA 1KZ1A 2JB9A 2F9MA 3AU9A 5D46A 2IUYA 2W6IA 3FOBA 2VDKB 4CFZA 2HOFA 4DSNA 3UBTA 1HETA 4ND5A 5HKAA 1SIBE 2ZB3A 1KFDA 3O93A 3B3AA 4DL2A 1A4RA 1FVXA 3ILVA 2ZR7A 4J1TC 3H2SA 5KOIA 1QQBA 1XDSA 1ZQXA 1J25A 3AWDA 2VF5X 4OMDA 4DSZA 4R71A 5AW0A 1W48A 4NOLA 2XQVA 3U16A 5AKZA 4KMMA 5AVUA 2B82A 1U28C 2X1MA 4JC5A 5CDHA 1M10A 2V8BA 5KU7A 3GCXA 1L1EA 1SAYA 2HJHA 5B58T 4WCDA 3WRYC 3WLNA 1SU8A 2XW6A 4Q48A 1XZMA 1Z6PA 3ZQUA 1L3BA 2IY7A 2XTJA 5BQXA 5JNVA 2XCRB 2I22A 1F9EA 4YN4A 1JQLB 3OSUA 1U5CA 3N7UA 4QPNA 3K5PA 1Q6ZA 4WLVA 5IKPA 5IUKC 3BRWA 4UFNA 1NN1A 1YR9A 5ALHA 2Z4RA 1R64A 2P8JA 4PG5A 3TQTA 2NSYA 4U5XA 1LVUA 5JSZB 4IQVA 1E18A 4P6VF 3U4CA 3CW2A 5I7HA 5DLYA 5C34B 5KNBA 3M2TA 2IZ0A 1K7SN 4JWTA 2PLAA 2XCUA 3FWYA 3RLFA 1AGRA 3SPXA 1PZMA 3RJZA 2HBLA 2GLXA 1RLUA 3M6MD 3F6BX 3SICE 1DIRA 1PG2A 2HWWA 2YC2C 1RC1A 2AJDA 3IN5A 3D4BA 1KA9H 4JKOA 4WBXC 1R9JA 5BYAA 3NVAA 4LF8B 3H9UA 4BNTA 4YMOA 2W3SA 4O63O 2W70A 4JI7B 3S2SA 3BQ9A 2AQ8A 5GAJA 2CHUA 4XGIA 3QVUA 5FORA 4QKQA 5CJ2A 2MIIA 4A0QA 3O8OA 2H9IA 2V7QD 5AQ1A 2VJKA 2VT7A 2YWFA 3HHPA 4ZV7A 2AZXA 2H4JA 2HUPA 3NU1A 5KG6A 3LS2A 2E8NA 3PPIA 5DBHX 2QRZA 1NQVA 4DJJA 5JANA 4KLJA 5LKAA 4GKJB 3IMCA 4JMLA 1T9CA 1TYAE 3BF7A 2WG0A 2WSBA 3A0UA 1RIIA 4CCSA 3HA7A 2BGJA 3U49A 3DV0A 1SQGA 4EBCA 3THVA 1MV5A 1OX5A 2WA1A 3V2GA 4MQLA 3D6FA 5F5XA 3X1MA 1A5AB 4U2BA 2NUAA 2CV0A 2H9AA 3IQWA 4GC7A 1AN9A 2FUCA 3K35A 4I66A 4LTMA 4QA9A 4WXMA 3S2ZA 4ZTUB 2EGHA 2UUCB 5A7GA 1YB6A 2O8BA 2QUIA 5KNDH 2R1TA 5C9ZA 1Q0ZA 4MWSA 2NQTA 4ITVA 3ZTWA 3GNQA 1O89A 2ONYA 4LYDA 4DIUA 4K6GA 4L8FA 1TT7A 1AKTA 3HEMA 4HDRB 4IGAA 1E66A 1NKSA 4BNKA 5BV1A 3TADA 1WSBA 5ERYA 4DA9A 4OHVA 1SG6A 4YBZA 5F4ZA 5M7EA 1P0MA 5EFOA 1N56A 2J6UA 5BSHA 1IXRC 4TQSA 3CR7A 4E2FA 3GPDG 2ZJYA 4I4TA 2YMQA 1BX0A 3VCBA 3WNZA 3JR7A 1S2NA 3KKLA 5DB6A 1ZQLA 1L0BA 3RVSA 3V9AA 2COUA 1DL5A 1NW5A 2CNDA 3JVVA 4HQ6A 4L50A 1A69A 2JLCA 5CYOA 5BQ5A 5I7SA 1XD2B 2AC7A 4OK3A 3BS7A 1NQTA 2GRAA 3KX2A 3L8HA 3OE1A 3G2LA 3KTFA 2G9UA 4PLYA 3EUEA 1QG6A 4E07A 1DP4A 2IA6A 1SBZA 1XAHA 4IDBA 4K9NA 3EZ6A 4W4TA 1FJHA 4MICA 1E32A 2Z2KA 4QQKA 4FBMA 1UQVA 1QOPB 1W35A 2FR8A 5ETJA 4EVSA 3DQZA 1R50A 3KKZA 4LBZA 3TWOA 3OJCA 2K4HA 4CW7A 5DNAA 5JAZA 5J0RA 1IN4A 5T3YA 4QWDA 1LJLA 4TYNA 3AXTA 4EPRA 2PGDA 4Y2JA 1TCCA 4BTLA 1P17A 3X43A 3QG1A 2FG5A 4YQZA 1GNTA 4DTIA 4BLPA 3GLGB 3F2DA 3BE5A 4RU1A 3AVUA 3ROFA 1JQKA 1HC7A 1SZCA 1PVDA 2HFKA 5HJ5A 1OT3A 4MAMA 4ND3A 3S2FA 1FUYB 1ES9A 4ZVNA 2FPSA 2HF8A 1J2EA 4IS3A 1Q74A 16PKA 1W47A 4JV0A 3GJ7A 4P53A 2OESA 4LYHA 3ST7A 1T35A 5HIAA 3PSIA 5F3XB 1U0GA 2JGKA 2C2EA 1JFFA 2ZI3A 2DQYA 3HV0A 2EJVA 2XDAA 3QBJA 4ZU3A 5AJXA 3FMPB 4RA9B 3H04A 2D1TA 5AVJA 3OLWA 3F74A 4EECA 2DB3A 4FYWA 1E9SA 3JVIA 1GAWA 3QOYA 1G20B 1G7CA 2NNLD 4DBZA 3Q98A 3OD1A 1LLCA 5I8PA 3PX7A 4OGGA 5G0SA 2LD4A 3W7AA 1SL1A 3OU2A 1G60A 3D0QA 2OXTA 3VNBA 1H2EA 1HZJA 1VCHA 4WZBA 3X1XA 2WJAA 1NBWB 4BAUA 1B4DA 3CP8A 4Q1VA 5KQGA 2HM7A 2W2LA 2H2WA 3WMRA 1I9GA 5AXDA 3OZSA 4GGPA 5J4LA 3JPSA 3D43A 3H9CA 1Z5WA 2I3GA 3GRKA 5KSPA 4YDQA 1GSIA 3GH1A 1JLLB 4GKVA 3I2HA 5LDHA 4R1TA 1BGVA 1E92A 5B3KA 3FNQA 5TQ0A 4CMKA 2CJXA 3A06A 3PYMA 5JFGA 1FTSA 2B8EA 4YO8A 3ZUPA 3U5ZB 1SELA 1XPOA 3VKUA 3RFAA 4AJOA 4WBNB 4IQGA 1Z3CA 2J9ZB 4RKFA 3FHCB 2V4QA 1HE4A 4H4CA 3ZW9A 4URYR 4C0AC 3PLNA 3F7MA 4Y8VA 1WDKA 2P2LA 4DXDA 3D64A 4UB8U 2DPXA 3IHLA 4HHEA 4I1IA 3I5XA 2CF6A 1T4MA 5JAQA 3WB9A 5CVVA 2ZBRA 2P3OA 3IEXA 4PC7A 3RTBA 4ZZIA 4ASUD 3P97A 3SN6A 1IK4A 4DXHA 3UANA 1XPRA 2JJ2A 4P58A 2B5VA 4R7GA 5FYQA 3CNNA 1UODA 3ONFA 4ETMA 4YR9A 1LI4A 2NTEA 3X1DA 4PEVA 4M8IA 3THRA 1SKMA 2BIFA 1KEKA 8ICXA 5MGBA 1G0OA 3DNMA 2O19A 3QPAA 4R2WA 2Q27A 1GZ6A 2LYAA 1U7UA 4H16A 4M2YA 4FZRA 4XQ8A 3TR6A 2CZCA 2X2FA 3IHKA 1VXRA 4AQ7A 4GSLA 5A0LA 1SU6A 2E4AA 2ZJAA 1NW4A 1L5MA 2WABA 3AR2A 2FLPA 4I8XA 4UJ3A 3EA4A 3LUKA 1ADBA 1G3QA 3QIVA 5IBPA 3FKSD 2ZBPA 1Y1SA 3HB9A 4B3MB 3IP6A 4I55A 3S8YA 2FW1A 2XR1A 1P1JA 2HWUA 4KN8A 2ZTEA 4AROA 3OQHA 3B7GA 3SYMA 2K4PA 3Q4GA 3RARA 3N53A 4HWOA 1R10A 2O2CA 3PG5A 4QIWC 3ZWBA 1BG6A 3LC0A 3R6WA 2RIRA 1OB2A 5ALYA 4OI4A 4RHUA 4BUJA 2HBJA 1P7VA 2PSSA 2HEIA 5D3MA 2YMLA 3EGEA 3RWMB 1T2CA 2IF2A 2ZVJA 4OSOA 4ZOBA 2DUYA 2FXVA 3RGGA 3UUFA 1RABA 4MKZA 2V9ZA 4MI6A 4MQEA 3OHSX 3WNVA 4NAHA 1SXJE 1XCOA 1AK9A 2B1GA 2DFPA 2HAEA 3EUAA 1PWYE 3EXIB 3I62A 2W04A 1GPH1 4RLSA 1ND5A 3LU1A 2IOYA 3RSHA 2PD3A 1MABA 1VJ0A 1ESDA 4QYXA 2FLKA 4KLTA 2P77A 2VYQA 4HI0E 4DCTA 3W34A 4QUIA 4OQMA 2SHKA 1XRQA 1IAVA 1V38A 5ELXA 1QF6A 4Z8YA 2Z8XA 2WAYA 1N5WA 3OAAA 3ZXIA 1Y9AA 1RIFA 2C1EA 3R9WA 5ELLA 1SUSA 4CHGA 3C4QA 1SCAA 3JQAB 3NXSA 5HFNA 1JGTA 3RAPR 5A03A 2WFZA 2P78A 3VPXA 2VJAA 4TMKA 3WHPA 5HTOA 4AO6A 2AGVA 3HJFA 1JG2A 2FMUA 5KTPA 2QL5A 4CE6A 3M70A 5THQA 3ZU3A 1MAAA 2HSWA 5D3QA 3TQFA 3D1LA 3X1ZA 1CBUA 3IBFA 3PNBA 4BQOA 5GJBA 1XROA 5I9IA 4DYHA 3D7NA 1IJEA 5IZCC 1DC3A 4NBUA 1GFWA 3FG9A 3KPJA 1ZIYA 1D8LA 2ZATA 3DKPA 4RQAA 4ER0A 1OI3A 1Q5PA 4NLGA 3BMXA 4KYVA 3KYDB 1IDOA 2J7PD 1VZ3A 1JZTA 1MQAA 1QYCA 1WPGA 4LWQA 2Y6VA 4WXYB 4LECA 3KUXA 1G9TA 1NKCA 1QIFA 1T43A 4O6VA 2IV7A 3TW8B 3ZNNA 1AKUA 1U7ZA 2J0VA 3AFGA 3LH5A 1X19A 2A7QA 1YONA 2W22A 3EXFA 3HU1A 3BTVA 2W2TA 1A9QA 3QUSA 1BOFA 4XTRA 2OVBA 2QTTA 2P0AA 1W6UA 1XMOB 3QE3A 1NPYA 2IYSA 2ILTA 1Q84A 2PGIA 4MWZA 4NEQA 4PQRA 5T41A 3A1NA 1PJLA 1D2EA 2Q1XA 5KWEA 5LMNB 2FY8A 1DIOB 3K9FC 1HX7A 3RBVA 4UTNA 2Y0BA 1SKYB 3B1WA 3DC2A 2P4EA 3ELWA 1YZHA 1UBLS 3MABA 1V6CA 4I5EA 1RM4A 5BYBA 2Y1EA 1B3RA 5CDFA 2OZPA 5A5DA 3UC9A 1VE6A 2VYCA 4B83A 1SGWA 4HXEB 1G8KA 1AXEA 2EJTA 3QUTA 1XZFA 4N82A 3VR5D 4OG2A 4B4WA 4MV9A 3N59A 2OWEA 4BNNA 2V0GA 4PG6A 4YNBA 1ZD4A 4E31A 4OUKX 2CL0X 3QKIA 2P27A 4AO8A 4YV0A 5K9ZA 2XD9A 1GUAA 4UBCA 2OCAA 3FMOB 1TEXA 4B3FX 4JJZA 3RKSA 1GRCA 5HR5A 1S01A 5JC8A 3EBLA 2BDPA 1CIPA 5AM0A 1CZRA 1GNVA 2YYAA 5EESA 1WVIA 2OEPA 1DKQA 2EC5A 4FGKA 4GD3Q 13PKA 1PQUA 3I37X 2DG2A 1GITA 3G5LA 3L6DA 3OTIA 3LCCA 4FW8A 2P9YA 2CMHA 3SJZA 3UGKA 1HZZC 1XF1A 2A0YA 2MYUA 5HWSA 2X9LA 3ZY3A 4F2WA 4FBTA 1UDCA 1Z5OA 2BKUA 5JJ5A 1QP4A 5IUNC 4BZZA 5LM3A 2IPXA 3EA5A 1EFLA 2OZVA 3HP1A 4TUSA 4Z3DA 4HLDA 2PV0A 4XPIA 5FLYA 4EYIB 1Y1KE 4MRVA 5AW8A 1PFVA 1R5BA 2YDXA 2DWOA 4U1RA 2HEGA 3QPBA 3IQFA 4K6KA 1DIGA 1W5TA 2DR0A 4O25A 3VZDA 3B3GA 3GDXA 1KW4A 2CJFA 4BN4A 1CYDA 1XSPA 3DA8A 1LPOA 3UKJA 2ZBDA 4U3JA 4LVCA 3UWPA 2FU5C 2Z5VA 3H6HA 3HI6A 1WA5A 4JB2A 4DL6A 3ZOKA 1IM5A 4PPFA 4IFTA 4PX2A 3T9EA 1M8PA 2B94A 5BNTA 4ITUA 9ABPA 1UADA 4MV0A 3ED1A 3HNPA 1QYDA 2QP9X 5H8WA 3VBCA 1O77A 4OL9A 3EC1A 3NVDA 1LJUA 1WCYA 1HE3A 2VPPA 3ANMA 1T9ZA 5ARDA 5A05A 4QUGA 2XRFA 4BEVA 4EJSA 5ADVA 1KOGA 1ZX1A 3BD9A 1TA4A 4UAUA 3EDRA 4FCCA 3KYIB 1ZUHA 4C4SA 1CP2A 2X0KA 3GR6A 4MVWA 5L3SB 4TS3A 2B36A 3FHOA 4CF5A 4OGKA 3O2QB 2CGEA 1HFEL 4IJWA 4A9AA 4ZVUA 1O9HA 1ZAYA 3THYB 2AMJA 2IYVA 1O57A 3AUOA 2KZ3A 3M9MB 1LW7A 1U2DA 1QQ6A 2ODTX 2YC4C 3HU5A 3KJIA 4TYQA 2GO7A 4C0QC 5JQGB 5JRZA 2NO9A 4HH4A 4HQ0A 4L75A 4CYMA 4E5YA 1YIAA 3ZU6A 2XZLA 4CR8A 3AP2A 3ZBQA 1JIXA 1XF9A 2C58A 5E1MA 4EH1A 3PXCX 4EW3A 1R15A 5B36A 3PXBA 1UJCA 1YZ6A 2YINC 1WWUA 2QVXX 4RNMA 4IZHA 2PFQA 4YROA 3K71B 2QZSA 3IIIA 4IV0A 1SBYA 1DDIA 2ST1A 4QUAA 3NHAA 5LDGA 1DDOA 5J9FA 4G37A 3S27A 1DIBA 3AB7A 3FYDA 1I0LA 1N6HA 4ZGBA 4UULA 3A4TA 4F1JA 5DNCA 1HTWA 4HNAB 4RKYA 3EGVA 2YRWA 3B85A 2WSYB 1TA0A 4MUYA 3A1CA 2QNRA 1K75A 4Y1GA 4YXWA 3QKUA 2YXDA 1BA3A 2D8CA 4BO2A 3NP7A 1EIWA 5IAKA 5DM1A 2G5IB 3RJHA 4LJSA 4EG3A 3ZWNA 1JL3A 4DNPA 3TVYA 4TMXA 1KQPA 2CDCA 4LRYA 5C1IA 3U7EB 4CM6A 1G4AE 4GZMA 5B2FA 1DJLA 3G6YA 1W93A 2XMQA 2P91A 1DWPA 3MRVA 5CEHA 3HA3A 3GEEA 4BVAA 2HHTA 1CYEA 3ZE9A 2ZGVA 5GVSA 3PUWA 4LIPD 3MHPA 5FUBA 4MGHA 3TD9A 4YAEA 3HYRA 3ADPA 5KNCH 3C24A 2B7BA 4H6WA 2O2XA 3KVOA 2KE5A 3HCEA 1Z29A 2RJ3A 2W6ZA 4M1WA 2CHGA 4NF2A 4DJDC 4EMTA 3KXKA 3AY7A 3BKXA 3M9LA 5DYTA 5KX5F 2WD9A 3M4YA 3DUWA 4O4IB 1PNTA 2I8CA 3B82A 3IKTA 4PY2A 1MO5A 3JQDA 2XHEA 1E63A 1K9VF 4NZNA 2AOXA 4ZEXA 5JU5A 4OQZA 3REQB 4IV8A 4KDCA 3JQGA 2ZKIA 2V3CC 2PS3A 5J4VA 1ZI6A 3OPYB 3AR4A 3IBTA 4FWIB 4DDTA 3KL2A 3EBPA 3G6KA 9ICEA 3LCVB 1GZ4A 5BW4A 5GOZA 1QOZA 1NAHA 4Y2GA 3EIHA 2O07A 5KINB 1CS4C 3F4BA 5TDHA 1FDRA 1DQPA 3C5FA 1FJ2A 1EFHA 3INGA 4IIYA 4OQEA 3K9HA 5J2CA 2VLBA 2H7YA 5K0CA 3GU3A 2OXEA 5FWYB 4D4IA 2BR4A 3W5DA 4KQFA 3HKZC 3D6HA 4Z6DA 2GZRA 4FHZA 3S1AB 4RACA 5K0FA 1HA3A 1QCYA 3SHOA 3DVQX 2ECPA 3ENQA 4OU4A 3TKAA 1HI9A 1OZGA 5G5HA 2W8KA 2EQAA 1GAEO 2OORA 1GTRA 4GLLA 1MEEA 1NNSA 1XK7A 5I9NA 1JROA 1WTCA 2AHOB 3DE5X 4RM2A 5DGBA 3GNTA 4IDFA 1PK3A 4DPMA 5J63A 3UHOA 4DIMA 3WKAA 4HQLA 1CVLA 4JHLA 4O4HB 1QH0A 2PS1A 4D4LA 4I81A 1FDTA 3T3EA 1QTMA 3ETGA 2G17A 3P32A 3BTSA 2V5UA 4FC6A 3HGTA 3OTWA 3DH0A 2J08A 9ICKA 4NXMB 5CA7A 1EGQA 2B1IA 4W8GA 1QH1B 1HBJA 4B0OA 5H80A 3IODA 3QNWA 4HBZA 2YHAA 4EGSA 5KT7A 2E5SA 3ESCA 4CBVA 2DKOA 4D82A 1KQOA 5EIXA 3NH6A 2FEKA 4FXPA 3WB0A 5F5NA 1BE6A 1QDEA 1YRHA 1J07A 2W8LA 3QLVC 1F44A 4MMXB 4DR4B 3W2TA 2KZMA 1IXZA 3HMQA 2J48A 3HU3A 4G36A 1HEUA 1VHWA 2O2EA 4PHFA 5DHSA 1UJNA 4BO7A 4QUBA 3K8ZA 1IY1A 3MA0A 1Z5ZA 3U3XA 1PNRA 3PW7A 4U4AA 2XJ4A 3PX3A 3R3XA 4PQFA 2R97A 3JZFA 5FYDA 3U61B 2R96A 1JDJA 3TKYA 1YS7A 1KSFX 2WYIA 4GZ3A 2AI1A 4R1NA 3Q8PB 1FNMA 3EMVA 1G98A 3VOAA 1XZDA 2CLIB 5CTJA 8AT1A 1NR7A 3PNYA 3RRFA 1WDTA 3PVXA 2OK8A 4HADA 4E88A 1YBAA 4DV7B 3KZNA 3BMCB 2GOYA 1RI2A 3CUVA 4JDPA 3WSWA 2XNHA 2DKZA 2HGZA 3C7CB 3L4BC 1EVQA 4D3FA 2H4FA 3LWMA 4IG9A 1FVOA 1FXSA 1M75A 3F53A 4TS1A 4BNJA 4DSUA 1BH2A 3CPJB 5G0VA 4IGEA 3TJMA 3TZKA 4DNQA 3QNUA 2HJWA 4GC5A 1E0KA 2LUOA 1VHTA 2H00A 2QP4A 2DX7A 4MP8A 1ZGCA 4G0PA 4KO4S 2XUPA 3MWDB 3BPSA 4RJTA 1TK2A 2IXDA 4I9NA 1P7YA 4ZCMA 5KOHA 1FZTA 2WF6A 1XC9A 1H9CA 4NL9C 1RPAA 2ZRQA 3UN1A 5KTSA 1NBIA 4DSFA 5TVKA 2WT8A 4B7AA 4EJFA 3A11A 4I3FA 5DN6D 3JYQA 3DDHA 1ZRHA 7ICKA 2HA3A 2V7EA 4IH1A 2G1UA 1HDYA 1LVHA 1CB7A 4W5OA 3CXUA 2WTAA 4XM2A 2HSJA 2KJQA 1D1SA 1Y3BE 3A10A 4YACA 4HATA 3SC6A 3UTDA 4YP3A 3T3FA 3KB8A 1U3TA 2B8NA 1SM4A 2XKBA 3FGNA 4B3GA 1CVRA 3AWIA 4MKHA 4Q7JB 3ZE7A 4DR2B 5IN5A 3K7EA 1G2QA 2XSZA 2CXHA 4HLNA 4X54A 1KJWA 1LRLA 2JCGA 1W4AA 1SIWA 3AERA 3DC7A 4KXQA 1NDHA 4PBRA 2MHCA 3T5DA 4A15A 1JG6A 1XA3A 4I1SA 4B2YA 1WLYA 5B7QA 4PTLA 1JB1A 4JI2B 4JEIA 4MRPA 5J40A 4M47A 2ZSFA 2JAUA 4L95C 3OOYA 4WOJA 1L5QA 2Q2VA 3V32A 1OTHA 4LHWA 2OAP1 5CB4A 1Y63A 1PP4A 4LHZA 4AS1A 2GTPA 4DUGD 3FTDA 2HCBA 1GZDA 3C45A 5M04A 4OO1J 5KL1B 1PFQA 1TD1A 4MW6A 1VP3A 2CVOA 1WW8A 4MEYA 2GK3A 3PQCA 5JH7A 1LFDB 2B7LA 1N34B 1ZHHA 3HJEA 4DA7A 3ABZA 3FFBA 1GSAA 4HV4A 1E2DA 4E3WA 3OPYA 1CZNA 1SUCA 3RIGA 1XQVA 1LF5A 3KSMA 4QEKA 5DLDA 3PDWA 1OIWA 1AQ6A 1T4DA 2HH9A 2OZLB 4R1PA 3VJRA 3AR6A 3SYNA 2OCDA 4CKXA 5T67A 5J2TB 1TO6A 3QF4A 5ENVA 1QAOA 4C4XA 3D8SA 3UXHA 4D8UA 3NHLA 1M6NA 4ZOLB 3ZG6A 4DLEA 4PZUA 3RE1A 4D3XA 1YBMA 4Q9DA 3EEQA 3T5CA 3U3DA 1CXZA 2JEYA 4QFDA 1V7CA 2HSDA 4BNWA 1QTNA 3Q12A 1WABA 1O08A 5F1OA 1K5GA 1DJMA 1CQWA 1RP7A 2YHUA 1FZQA 4QQNA 4EWLA 3V1MA 2J4FA 1T0PA 2HMVA 2XD4A 4MCIA 3GAAA 3EXHB 3GPCA 3IKLA 1XU4A 4EA8A 1R8SA 2VQFB 1L3VA 3F49S 5J43A 1E3WA 1H42A 1UJBA 2YJ5A 2VEOA 3RU2A 1TM4E 1WRBA 4L5IA 4ZQEA 2GKGA 5AM3A 4Q45A 1OTXA 4DFKA 3EUWA 2AZDA 4G3XA 4HDNB 4FE3A 4P3OA 1TZCA 4Q9JA 2MSDB 3VZCA 2Z2ZA 2I55A 4PGXA 2ID8A 4H15A 4PYRA 5L53A 4Q6WA 3SKXA 4YRTA 1FQJA 5BSTA 3AJDA 4RUAA 1M6VA 3EVFA 4AKTA 4DQQA 4AY3A 2Q4TA 3M2PA 5KJ6A 2FOLA 1BXRA 1G291 2FWJA 2R6CA 3IAUA 4KXFB 5CT9A 4E11A 7ICLA 5C8ZA 2O4UX 1VG9B 1OWNA 5DXJA 1OAOC 4KPEC 1GD1O 1PAUA 3C3WA 1B3BA 4R81A 8ABPA 2KB0A 2POQX 2XLBA 2CFTA 2ZULA 1USWA 1XDBA 2R2AA 3EEOA 2NQ2C 2OGUA 3F0TA 4CU5A 1EFAA 5FF9A 2AJQA 5G4LA 3BDAA 2DAPA 2I4RA 1BE8A 2JGLA 1UXHA 1UWKA 3BD7A 8ICNA 3COZA 4NJMA 3KO8A 1IDN1 4UASA 2QR5A 2WUDA 4PZDA 3LBHA 5LYJF 1JXQA 4EG4A 2XUJA 1NVTA 3L8CA 4OQLA 1A7AA 4TMFA 3DBLB 3IQXA 1P1HA 4PO1A 3JALB 2ZZMA 5TS2A 1CRQA 3ZE1B 5HOEA 4YJHB 5JCPA 4QZBA 3T7JA 3STHA 5DMXA 2VBGA 4JKIA 3UMRA 4B3RB 1WBBA 2IYNA 2FMQA 3BHIA 1A8SA 4G2NA 3HYLA 4UBNA 4D8WA 4DUZB 4OD0A 1OGJA 4N7BA 1Z0KA 2NU7A 4RJLA 3PSPA 4DDHA 2KK0A 4KVAA 1V39A 4RTQA 2XYQA 4EYEA 2CMFA 3CUSA 2G1JA 4UD2A 3I53A 5C0OE 2GS9A 2XDWA 5KCZA 1DS6A 1VB5A 3PF8A 4YECA 3S2UA 4G8DA 2QQGA 8ICQA 2PMEA 2C2OA 1RFLA 1QRSA 3V97A 1BS2A 2HSGA 2X8LA 1MABB 2XCQA 2Z08A 2AD5A 3MERA 5DWDA 1HFWA 1YBVA 4OGFA 4C7XA 2XMSA 3K0FB 5ILOA 5JATA 2VYND 2IA5A 1QE3A 3GRCA 4MA0A 3ZE6A 1YE5A 3Q7PA 1JIHA 4DQVA 2IEDA 5DNVA 2K6GA 4YUZA 1U04A 1DVRA 5AD1A 3FKQA 4PLFA 4FDMA 3RFXA 1XJ5A 2VPQA 2HADA 1Y4SA 2X8JA 2W9AA 3AUXA 5AXAA 1DK2A 1ZH4A 5U4XA 2FMHA 3T3IA 3TN7A 4UEKA 2BFFB 4U2CA 4AUEA 4N5DA 1G8SA 3ETJA 3VHXB 3G3EA 4EMBA 1P4AA 3UHFA 4E6EA 4RCVA 2Q9BA 1ODCA 1SBIA 2MSNA 1EI9A 2J5RA 1H2YA 1ZP6A 4Z3KA 1AURA 3SF0A 1GU0A 2OOSA 3PCXA 4C5AA 3P71T 4KOAA 4BWMA 2OFOA 5BV0A 5C2JB 4FZ5A 5C46F 2TSYB 4K46A 4OQFA 1K2VN 3NGLA 4CR7A 4JJFA 3M7IA 2J8ZA 3BZCA 1FLVA 5AVOA 9ICCA 4C6HA 3HY6A 2XI4A 3L1UA 4OQPA 3WKEA 3B2QA 4FLEA 2VK1A 3ZW8A 4DY6A 3CVWA 2W0MA 4H7DA 3NJ4A 4P98A 5GP1A 4C0HA 4KXYA 4FZJA 1B1AA 1HTTA 3Q8XB 1IZZA 2WHQA 2NPIA 5EWFA 4KN5A 5LC1A 5TISU 2VAVA 1XAJA 2KJ9A 4AMUA 3WADA 2RHFA 5H59A 5ADUS 1KVUA 4FKBA 1HDEA 4AYBF 3R4VA 1FRZA 4V0ME 1KQNA 1C4XA 1EBBA 4MB0A 3AVVA 2LP4Y 3DFKA 4MW5A 3LT1A 4ZO7A 3VI3B 1HNZB 1N1EA 1P2SA 5GM1A 2V65A 4C2BA 4ZHQA 5JNTA 5JMPA 5BW6B 1RCUA 3VAYA 4X00A 3T61A 3ZGVA 3DL2A 8ICUA 2W6JD 4JBNA 5KFXA 3VR2D 2ZIVA 1NU6A 1WMAA 2EWVA 1XHEA 2IUSA 3E7XA 4R4JA 4EA6A 1IY2A 4QTZA 3DEKA 5COBA 3L4BA 4LF4B 4B9UA 2IITA 1P0CA 3K1YA 3NPAA 3S8MA 2QUBA 4ZMBA 4M1OA 3M6ZA 3RJ9A 4TKZA 3VU1A 1OT5A 1I51A 1V4NA 3WLOA 4OFZA 4N40A 3C5CA 4TV8F 3WLLA 4ZDJA 3GD5A 4N54A 4R9VA 3UV7A 3IEVA 4QUKA 2GFIA 4Y30A 1Z26A 4HGQA 1QBKC 1TC2A 2HV9A 3SM3A 3PZPA 3ASYA 3BVPA 4HPWA 1XP8A 1KK3A 2K4IA 1G3IA 2P67A 4OHYA 2OD2A 5BNWA 2C22A 1Z6YA 3OQOA 1F9AA 1K9SA 2VDOB 3Q8KA 3T3DA 5KFDA 1PZHA 1L4LA 3IPAA 4IRKA 3M6IA 5EE5B 5JQWA 4DG8A 3KJXA 5TE9A 3I0NA 1NIPA 3RTAA 3FCYA 1VCNA 5KFHA 3O4JA 5IK2A 5P21A 2W90A 1LBQA 2QHXA 4EB8A 4U3JB 4RHYA 3IEUA 4FFOA 3TL2A 2HMWA 3QBEA 4Z2AA 1K3TA 4QO7A 2NG1A 4WACA 2LV8A 3KSZO 2I67A 2TMYA 4FDTA 4BVKA 1ZQMA 3GRAA 3UWDA 1DOZA 1JA0A 3NRBA 3VX4A 3CV3A 4EMSA 1I32A 4K2AA 2OORC 1X1QA 3V80A 1A04A 2C3MA 3A32A 5T64A 4PS0A 1D6SA 1NJ5A 2OAQ1 2XUIA 3N2GA 3QBTA 3TBKA 2O8DB 1BYUA 3A58B 4ZO6A 1KMNA 5FKJA 5LB4A 1HDIA 1RYSA 5EJMA 3LLCA 1R0RE 4ZGGA 2AQ4A 3T52A 2FEAA 1OVMA 3DL0A 4M9RA 2PWAA 1X3LA 3QYFA 3WYFA 4XDYA 1M2OA 3K75D 1DC5A 3QWAA 3PMLA 3W9SA 3R77A 3II6X 5F64A 4ZWNA 4QZ8A 2XVMA 3SQNA 3Q7RA 3L41A 3WQQA 4A1OA 1P0QA 1OFVA 3M6FA 3S4YA 1ORRA 1H6BA 3WG9A 2O48X 3KR1A 3K0FA 1APBA 2ZQZA 4RA6B 1JKXA 2QL6A 2C0QA 2VFAA 4TRNA 2JLUA 2PVCA 4PGQA 1KP2A 3JU3A 3V2HA 2PRYA 2W6MA 5HHHA 1BQEA 3F96A 4X7BA 3SI7A 2G0AA 1BA2A 1LC3A 3KZXA 4RIIA 4LRSB 4ICIA 1KE1A 3RRGA 2AGOA 4X6LA 2R8HA 3CX6A 1NLZA 1N1MA 1AV7A 4X1KA 2VHEA 3MWKA 5D85A 1CUGA 4QJ3A 3ZGZA 3UUEA 4LXGA 1VJTA 5D51S 5LZ7A 4WI1A 2QKYA 5KVVA 1X1EA 4IGIA 5TGZA 2VWQA 2E5FA 2CRXA 3IPLA 3OX4A 4EUEA 4PG8A 1QX4A 4Q34A 4Y6OA 1HNXB 5K0BA 1M9NA 1B42A 3I9JA 1MNQA 4KSCA 5BUQA 4GX1A 4D74A 2ZAOA 5HRUA 1J33A 4OXKA 1PZFA 2XT9A 4P2HA 3VNSA 5FQNA 3STTA 3D31A 3VDXA 4RESA 1PE0A 2OHXA 2QYOA 2BMFA 4YD1A 8ICTA 2JFWA 2H59A 2OBLA 1UOPA 4P7BA 4MB6A 3FMFA 1I1HA 1M2NA 2C8LA 4QPPA 4TYPA 2JAOA 2CVPA 4I4CA 2PKEA 2VRCA 5JR3A 3V00A 4LN1A 1PVPA 2H4ZA 1OLSB 3HRDD 2O14A 1L9KA 4HR7A 4MRRA 4LC1A 3RJEA 3RIXA 1LDYA 2E82A 3K2BA 4LMAA 1XYVA 1TI7A 2HBZA 1XKTA 4RY9A 1V11B 4ARSA 4KLGA 2VQDA 3QXHA 3UQ0A 2LE0A 1AF7A 2PWBA 3ZKWA 4E22A 2HVHA 2WIDA 3OCUA 2G04A 1M2JA 2ZUEA 1Z22A 1JHUA 2IYLD 1C7QA 2VJMA 3R76A 3AQIA 4Q4LA 1CRZA 3OE7D 2AX3A 1QG2A 4N8DA 3TBFA 2OB2A 1T1JA 1S2OA 5HR6A 4C0JA 4X3CA 3J81A 1NJSA 3LLMA 2HBRA 4N6NA 4KLNA 3QEBZ 4W5JA 4CNBA 4YRIA 5J29A 1RBYA 2X0NA 3DJYA 3PE6A 2GZDA 3SOPA 3WMXA 4F45A 2RHCA 5KJCA 2AVDA 1JJIA 3L8YA 2ID7A 3QYAA 4M9NA 2GRUA 4IOLA 3Q0EA 3B36A 3IULA 3ZVKA 3LT2A 4S04A 1RYMA 4ENUA 4KO1S 5J2AA 4YONB 1SVMA 4CGYA 3DGEC 1CPYA 3VZRA 4TV9F 2WB4A 2GHIA 5J5VA 2SKCA 3DAYA 3I52A 2Z09A 4JLKA 1LCIA 1W0KD 1UAAA 2NMVA 1RI4A 3DXZA 2KMLA 2Q2OA 4BWVA 3DE3X 2D6FA 2SICE 4WLUA 4WOCA 3UF0A 1MOZA 4H31A 4DR3B 2GN4A 4YRZA 4UQLA 1A76A 2QNBA 4Y9TA 2VF4X 2OGSA 3ZWCA 3GEIA 1EDBA 3W5IA 4YT8A 2CJWB 3CKLA 1Q92A 5AKKA 4PGFA 5JYBA 4MEJA 1J20A 4L08A 1OX4A 4FJ2A 1FMTA 3DVAB 2PZFA 3G23A 4WN9A 3CISA 1G8PA 4YB8A 4KPFC 1IAQA 4HYTA 3U40A 4CIVA 2I7VA 3H0EA 4Y2XA 4R9NA 5D1NA 5EHNA 4DIDA 1M5RA 5L9XA 4G0UA 1JKMA 2AE1A 2XYGA 4IXTA 5D3ZA 5HG0A 3KKEA 3DMRA 1PJ8A 4P3XA 5HGJA 4C0LA 3WK4A 3CF6R 2CB9A 1RZUA 3I8XA 3WX0A 4ISCA 4RKQA 4B9NA 2EFCB 1N9GB 3CQ9A 4JJ6A 4ZEVA 4JSTA 5KFTA 4HUQB 1NURA 4R8VA 1S0MA 1DV2A 3IUJA 1CWUA 1JIVA 1V1JA 2LDXA 3DGFC 1VIDA 1B93A 2QG4A 2YJZA 5H81A 1MFPA 2ID9A 2K87A 4JI8B 1OHHA 1UXOA 5H16A 4RD6A 2IS4A 1ZRMA 2OO3A 1SB8A 3VU9A 3D7LA 4AG6A 4M7OA 4AJ2A 3AHJA 4QXRA 5A5GA 3AOGA 2AZMA 4NK4A 1B14A 2NO5A 3BQ0A 4MJ7A 4Q1EA 5FFNA 1B7GO 4HDMA 1J8YF 3FPBA 3RYCA 1T5TA 3ZQJA 4F84A 5T14A 5DCUA 4D0LB 1V9SA 5IC4A 1ZCZA 2REQB 3C16C 3WBJA 1IG0A 1KPIA 2VATA 3P19A 4IR1A 3VKWA 3WIOA 4YRMA 1NR1A 2P4SA 3JZAA 1CETA 3PCRB 3GHHA 5TEVA 2VN8A 3C2QA 4IOKA 1EGVB 2O8BB 2XMBA 4HDOB 4D9HA 4OSPA 3PFCA 5I51A 4BJ3A 2EFYA 2WJWA 3N8KA 2BJWA 4L8GA 4X5OA 5IJAA 3W78A 4KR3A 1ZQ1C 1I6MA 1XHFA 3LW8A 3NG1A 3OLXA 4HTFB 3VDRA 5KDOA 6ADHA 2XZOA 2YHIA 1D8BA 2FQQA 2XUDA 4FBGA 3Q11A 3GD7A 3DYIA 1L8AA 3BAFA 2C5SA 1AUOA 4RIHA 5K3CA 2I7XA 5EN4A 1GG9A 4MYSA 1FB5A 1YB4A 1Z3IX 4M4SA 3RASA 1ZEJA 2C4KA 1ESNA 4MR8B 1W85A 5EWJB 4CPDA 4MHOA 2XNSA 2YJ3A 2C83A 3CH4B 4DCVA 4DS4A 2OB1A 3JYLA 2K4EA 2ZBGA 3E3AA 4MJXA 2RGNC 2ZJ8A 4G0XA 3A26A 4KV7A 2OGZA 4QYWA 1MX1A 1ZL0A 3L49A 4ON9A 4FLMA 1ID1A 1JHDA 3F6CA 3KYJB 3Q2KA 5CFLA 5KWJA 5BSMA 1I4WA 5K2MA 3RTDA 3EN0A 2FF5A 2FK8A 3KD2A 4QZCA 5IAJA 5ABPA 1E3WB 4Y7DA 3HDQA 5T4FA 2VWGA 1KRPA 3R0XA 2PX4A 1RQLA 2NZ8A 1L4UA 4WNCA 3T9AA 1F6BA 1FX0B 3KVVA 1P7WA 2WHPB 4ZVTA 2A5GA 1CR0A 1WZIA 2ZUVA 4IQFA 2WJIA 4XA8A 4XWOA 2YVQA 4BLVA 2C5AA 1CUJA 4PHEA 4NBWA 2CNBA 3CKYA 1A5BB 1CC1S 4Y6QA 3LWNA 4IRDA 5KFRA 3TK1A 3DHEA 3DEHA 2O0LA 1Y8QB 5K0SA 4RPJA 4H4DA 5CFPA 2GCEA 4YRBA 2JI9A 1X9IA 4D96A 1RM3A 3ORRA 5I9SA 4PAMA 2FE4A 2GZ2A 3HGQA 2ZYGA 4GM0A 2KVCA 2IYEA 3C3XA 1E96A 1ARZA 3HFRA 1KEJA 1N0UA 1A8QA 3QE4A 4P4LA 3SV3A 1EVIA 2IIBA 3PQ2A 2V4UA 3NWPA 4GPIB 4L5CA 4TVOA 4UU7A 2FEOA 5KHAA 1DU4A 1Q0RA 2J3QA 2GN6A 5IVDA 1DTWA 4RZIA 4YJKA 4DZRA 1B00A 4TLCA 1RHJA 2IRWA 1KBUA 3ETHA 4XZ3A 3ZDQA 4C7VA 5LKRA 2C5EA 3RTVA 1V41E 4MX8A 1VMIA 4R1LA 5ED0A 3UYLA 3IAXA 4OLHA 1LJ8A 1XS9D 1M54A 1M83A 4AZSA 1XRRA 3MIZA 5FI5A 2ZXIA 4RULA 4BNIA 3LA6A 4BN5A 4ZDIA 2C5FA 4OOFA 5M34A 5CVEA 4Z86A 2YXNA 2XV1A 3CCFA 4RGBA 3EZ5A 4HFMA 4MQEB 2P66A 3FDSA 5E7IA 4C7ZA 3IB3A 1LBTA 1AKMA 1TO1E 4JN6B 1SU7A 1DBPA 1G5RA 1TMGE 4HDQB 3U3OA 1RC0A 2AJTA 4JOCA 4R2LA 4W9RA 3NWBA 1K63A 2HK8A 3EK2A 2ISSD 2HOIA 1CQJA 1WUYA 2QQEA 4D9MA 2YCLA 5KOJB 3SE0A 5SY6A 1J8MF 4YJGA 3SIRA 3QLEA 1V9PA 1DTWB 2UZ4A 4WJ3B 2RHRA 4HFJA 3C7TA 4OJKA 4RMJA 4B3BA 1SXJA 5LU9A 1MEJA 4RT2A 3TBHA 1ENPA 1N7JA 2QN6A 2G71A 4K28A 5L45A 1QP8A 4MYTA 1WPQA 2XA9A 2H1RA 4F8EA 3K9CA 1ZY2A 3EVTA 3PNLA 1Y3CE 4WVFA 3UTCA 3C3AA 2NU9B 1RKUA 1XLWA 4ZO8A 1O96A 2RGBA 2PMFA 2ZJ1A 3EZ2A 4D57A 3MGIA 3RABA 3UIEA 1M1YE 1UKCA 4IRUB 4JT4A 1QSSA 3EIQA 2RK6A 4QM6A 3GAZA 2FUG6 4BMXA 4KW7A 1ZNZA 2Q5LA 3ODGA 4D8YA 3TRHA 4UUMA 3OG9A 2VJDA 4B84A 4F38A 4N4AA 3FVWA 3SKVA 1O6FA 4ECWA 1OV6A 3OT4A 5HKLA 2RAFA 4DL5A 3AUFA 3GUUA 5JPDA 1YQGA 1EYZA 3CUWA 2NGRA 1ORTA 3CT6A 2AA3A 4JLDA 4ARZB 5FPYA 4B5KA 1N8TA 1VE5A 2H1SA 4LEIA 5C51B 2DWPA 1CUVA 4FEGA 4XUGB 1C4KA 1YKFA 4WDQA 5KT3A 7ICGA 2WZDA 2C00A 1DEAA 4AN1A 3ILXA 3DBVO 4M1SA 4P5PA 3I1IA 5B5EU 1FE8A 3LFTA 1NE7A 3W5BA 3UZUA 2VQEB 5KFJA 4ZFNA 4CLRB 5J2UA 4XGRA 1YR1A 4XDGA 2VT2A 1GZ7A 3UMVA 5F1YA 3F6EX 9ICNA 1NVEA 2W7PA 4NXNB 4G5OA 3CLRD 4RV5A 3WOHA 3EDOA 5C5IA 2E8MA 2I78A 3A70A 1P45A 1ZUNB 3FDZB 2IF0A 1QLNA 8ICGA 2H5LA 1FPQA 3BDIA 4P22A 1C7ZA 2I6UA 4B47A 3FGZA 2ZJ2A 1Y5NA 1ONNA 3CUYA 1R5JA 2XTNA 2PLNA 3GA7A 4WJKB 3M7DA 4XKJA 2C28A 1O6ZA 4X90A 2A78A 1NATA 3DAHA 3KQSA 4MUHA 2Y1FA 2ZIFA 4D80A 3QZ8A 9LDBA 1ORDA 4KNVA 5I5GA 2Y2VA 3IALA 1NVVR 1ONBA 2CWWA 3SJBA 2AFIE 1TTHA 2ZBUA 1AB5A 3R41A 4LXIA 4NSNA 4B45A 5K6RA 2VZEA 1FNBA 1FFXB 2IMWP 3AM4A 4WXHA 1NW3A 1OC2A 4P7JA 1IEWA 1KK1A 4FHFA 2RH5A 4WMLA 5K99A 3NTUA 2C2MA 3F4LA 4R9SA 3D6MA 2J5QA 1LGYA 1IUPA 2R4UA 1Q46A 2UZ1A 2Y1CA 1I1OA 3BBPA 2XHZA 1A1SA 1W75A 2J41A 3LUFA 4LBWA 4R98A 4ZT5A 2F1IA 1STOA 1FU8A 2P2CA 2RB5A 2VLIA 3I1JA 3OM9A 3TQCA 4EZEA 1TDJA 1IHUA 5I5EA 4URUR 5EG5A 5CEEA 3U7HB 5AK5A 4XM1A 3O4FA 1W4CA 1ZH6A 3AF1A 2PMCA 3NTQA 3DBRA 3BIXA 1V2GA 5IXJA 2FSHA 3HJNA 4CDRA 1X2BA 3QLUA 2AG6A 2XIQA 4TYMA 2CLMB 4FP9A 4TL8A 1NYTA 3IXLA 2QW0X 1OXBB 5IC5A 4BGEA 3ZS8A 5KFNA 1A4UA 1TT5B 4MR9B 1XNGA 4DCNA 1OFHA 4WXEA 5EFZA 3ZVNA 3O1LA 3TLXA 3KFLA 1ZQCA 1JDNA 4FBUA 3C0KA 4XE5A 2JFPA 3JCZA 1T9AA 1Y34E 3NRWA 4F5QA 5ISMA 2QYHA 2A14A 2JXJA 3CF2A 3H19A 2QLNA 1GVNB 3W7VA 3QTTA 5E6UB 4DJAA 2GFQA 1JDVA 2Z5LA 3BFPA 4L16A 4CF7A 1NASA 1RYBA 1P2DA 3IAHA 3L04A 4EZBA 1ZD9A 5AOBA 1ZN2A 1OX4B 2JHGA 2FGJA 4EKDA 1DBRA 1OYVA 1IHPA 2P7HA 5LA6F 2BCVA 1XAGA 2J0UB 2AXTU 4NE9A 3PENA 4XWYA 4CCHA 2HW8A 3LUPA 1IOLA 1NX9A 3NDRA 2Z4TA 3HRIA 4RY2A 4RPZA 5ECDA 4EUFA 5JU6A 3JQAD 2A5FA 3ML1A 4Y6GB 3TS1A 3V8RA 1VCIA 1TB4A 3GJXC 1R37A 4OXRA 4W1QA 2F48A 2BKEA 2BBTA 1DCMA 5HJ7A 3X1KA 4OB6A 2GUGA 3VYVA 2Q5FA 4I6GA 3ZV5A 4C2TA 4GOND 1RNLA 1QCCA 1ELOA 1C7EA 1Z25A 3DSRA 3HXLA 4PBTA 2ODAA 4Q93A 3M49A 3T34A 4GZ5A 1C80A 3PYXA 2O0MA 3AYZB 3VC3A 2FZEA 1FFVA 1F0MA 3IILA 1DJPA 1J9GA 4I9UA 3SLRA 1Y4UA 4UUNA 1TM1E 1DARA 1HFJA 1DC8A 4G9EA 3GV5B 2HHSA 1UOQA 2R86A 4A16A 2ZBFA 3EBOA 5EE1A 5LUBA 4M37A 2BKXA 3NHMA 4EFMA 1AKNA 2H5IA 4LFBB 1XZQA 2EAMA 3CW2C 4I4TF 4MVJF 4B4UA 3TNDA 1IVSA 2ZE7A 1KYIA 2BMVA 3L0OA 5AI9A 4M0EA 1U4OA 4MZXA 1KVTA 5BORA 3EDYA 1FSPA 3B7PA 2Z5FA 5FIUA 1WCWA 3WQHA 5B3LA 5A9SB 1Q11A 4C8MA 2B83A 1L5NA 1ECWA 4URZR 4I2IA 1MPTA 3SSAA 4ZZ3A 5BQFA 2XCAA 2X41A 1XNQB 2DF8A 1Z75A 2Z9DA 4HAUA 1U98A 5A3SA 3RBEA 5D87A 4QREA 2IHVA 1EUDA 2HQSA 3NDIA 5G40A 5HE8A 3K05A 4MKFA 2JEIA 1HOTA 3TGLA 4YIHA 3DEAA 3EQ9A 1ECCA 4NOJA 1CJSA 2JD2A 3OPVA 2YOHA 1LK0A 3QK7A 2X3UA 1VJRA 4IFBA 4RYDA 5IINA 3ES9A 1XNSA 1V5GA 1V3UA 1HUQA 2B2NA 2VRBA 2Y93A 1RCFA 2WAXA 1QNLA 4MKIA 2XBUA 3PLRA 1P2UA 4DSKA 5H3CA 1Z5UA 1S9FA 2QSZA 2F44A 3UJBA 3PDCA 2DUWA 1D7AA 2I6TA 3FTQA 3L7KA 5BYJA 1DI0A 1WDLA 3A4VA 1EVLA 3GLHE 2GASA 3TACB 4BQPA 4B40A 2DWQA 2D2FA 5J4HA 4I50B 2GBLA 1H9AA 2WYWA 5AKEA 1KMHB 3EPIA 3AGPA 4LYGA 1MVLA 4Z54A 1KO5A 2ZTUA 1ZNXA 4TXMA 4DJTA 1IWOA 4UTPA 4JBYA 1QHEA 2OQRA 1F14A 1KXJA 2VUTA 3E48A 3S55A 1E9CA 2D4HA 1U45A 4EOGA 1F4VA 4E14A 1YRQA 3DZCA 3HI4A 4MS4A 3VQTA 4H2DA 2IWHA 1FTYA 1H2RS 4Q12A 3LOQA 4DV5B 1U81A 3IV9A 1G19A 3QLJA 4MWEA 4QOGA 4RTRA 2YZGA 1H6AA 4RANA 2WVJA 2XXJA 1OB5A 2G5PA 4GYWA 5AKYA 4IDDA 6Q21A 4ZCLA 1JQDA 1U48A 1VJGA 3H87A 3NZEA 3HXOA 4Y98A 5EYPA 1NM5C 3RB4A 4YRLA 5CBPB 3TUJC 2JZBB 1SVIA 2WYOA 3TGWA 3OQIA 1PL8A 4MJLA 3LQFA 4I9FA 1R6TA 3ADOA 2O9JA 4OKSA 3W0LB 4D99A 3C7KA 2G63A 4HLCA 1G8GA 4GXNA 3UW1A 1G1AA 1BXGB 5JADA 4JL8A 5B6IA 2B6GA 3M81A 3SI8A 3GJRA 1XEXA 4J0IA 4KODA 2VR1A 1OGYA 4MKXA 5ALVA 2M1ZA 3KQWA 2C42A 4NULA 1SVKA 4G9BA 3UA3A 1B6GA 3WHIA 1N6OA 4KQGA 4Y9SA 4FOSA 4Q44A 5CTAA 1V8PA 3HLKA 4YJDA 1JJ7A 2BMAA 2P7IA 5CXUA 4WPGA 2AZTA 1YK0A 1ZCFA 4JA2A 1YZQA 3GZFA 1YB2A 1R0CA 4N47A 3RHFA 3I76A 4TKVA 5IJ9A 4OBEA 1XIVA 1QU3A 2B5OA 1ZI8A 2H07A 2XWQA 1F2UA 1LPSA 2ZIVB 1YZ3A 2VJNA 2GEKA 3NANA 4WH0A 1VG8A 1M1NB 4YMSA 3N5KA 3RUFA 3DNPA 2QRUA 1Q3HA 4Q6BA 4J7XA 3MAGA 3S68A 4NENB 3GZNB 2XBMA 2VCHA 2J6HA 5FI3A 1GIAA 4F5EA 5HZHA 5FWNA 1UCFA 1PQWA 5D7NA 3CONA 4EKEA 2YDYA 4YWHA 1SC3A 3A05A 4PZPA 4DSAA 3AKZA 1E1RA 1WXGA 1CX9B 1U9CA 3LTEA 2VANA 4IHKA 2A5YB 3PEVA 3L4SO 3EFOA 3RK0A 2JJ1D 4TWJA 4WLFA 3LAWA 3VV2A 5JAPA 5KSWB 1T5LA 4LHVA 2ZRLA 3T7AA 5ALGA 1JHRA 3W2IA 5E4TA 4HPXB 4BTVA 3GRRA 1P8JA 1RYZA 2IYYA 2OWOA 2EP7A 1U11A 2RBEA 2VPIA 3PKZA 1DKOA 1YQEA 2QJFA 3LK9A 2D4AA 2EVWX 3ONDA 4ZQFA 5FFMA 2X0FA 4AL4A 5ALEA 1ZJJA 4B09A 3OVMA 1CFJA 4BGUA 3UJPA 2HF7A 2Y1LA 1XZ8A 1JWAB 1KDZA 1XGKA 4QDZA 5EP1A 4AJ9A 4XX1A 2WIKA 2QRLA 3L05A 1H8EA 2Z0MA 4B3TB 4PYOA 3WAJA 3L3FX 1MB4A 4LWPA 3WYBA 3WXBA 2Q1TA 4OLFA 4RK0A 1FFYA 5AI4A 2BFCA 2NVUB 1KI7A 4M0UA 1SD2A 2VPTA 1QFMA 5A3VA 3H13A 1XQYA 1NC3A 1TIKA 4UB3A 2J5BA 3CB2A 3EWNA 1RQ7A 3KDAA 1X8LA 4KQEA 4S35A 3G2QA 5FUQA 2B1QA 3DMPA 4OJOA 3CLSC 3NEAA 2Y1IA 4NBVA 3DL7A 4H6PA 4JC8A 3ELUA 4YLEA 3T1HB 2FX5A 4PG7A 3E5HA 4LJXA 4UVDA 3D8TA 4FE4A 4U7JA 2OO5A 1NF9A 1DLIA 1XTPA 1LPAB 3T6KA 4J6EA 1H3FA 3UH0A 4C8NA 4U0JA 4F3KA 2CUNA 1C8LA 4R1SA 4TUPA 3T79A 5B55A 5IDQA 5D2CA 2X4GA 3GCGA 4BEBA 1YJ5A 4J03A 3I2JA 5FB3A 3HKDA 4PYNA 2IW1A 3KKNA 3Q3JB 1K1SA 1J22A 4N8EA 1MXFA 4KR9A 5DM60 4CL2A 2P79A 1BPDA 3PX0A 1QF9A 1P18A 1QR2A 3MOGA 4GWGA 1F0YA 3V6JA 1WBDA 3SX0A 1NX6A 1MC1A 2VA8A 4Q37A 3VVCA 4DANA 3IV6A 3B48A 1HFKA 7REQA 4RFLA 3UG6A 2OL4A 3LC2O 4J0JA 3PKJA 1L5RA 3QH4A 1B0XA 3WKCA 1S5LU 1T2NA 4P0QB 3EG5A 4V0SA 3BE8A 1U3CA 1OBVA 2Y3IA 2G5CA 3GVXA 4P5DA 4WFJA 3TO5A 3WU2U 1E7YA 4NATA 5AM4A 1M2VB 4S1NA 2GNOA 4X61A 6ABPA 1XL0A 1MMFB 3P9YA 1NK0A 3JQ8A 1LKYB 4XCXA 4W9MC 3W2GA 2GN2A 4X91A 4C4YA 1NN0A 2FW8A 4YMTA 1USGA 1FLNA 3UAGA 1T13A 2HX1A 3F3KA 4LAFA 1DZ3A 2XDQA 2XX3A 3GVCA 3MJCA 5CLHA 4ESEA 8ICFA 5LP6C 4B3IA 2CBXA 1UBTS 4Z0NA 3KR9A 3E23A 3LKDA 1TVMA 2POCA 4KH1A 5DF1A 4AZVA 3OA0A 3OX3A 1KHTA 4D0NA 4F7DA 4JLWA 4P0TA 3HBNA 1TU3A 3JAWB 1GQOA 1NBMD 4AXBA 3DQPA 1RBQA 3PQ3A 4N5IX 3F73A 5DSTA 1N77A 4LXTA 3W5VA 4PYKA 4OV6B 2WMDA 1DO2A 3DMDA 2WB1C 4DAEA 2M0NA 5D49A 1RLJA 3EISA 2CVHA 3OECA 4JZKA 3FF1A 4BO6A 3MTEA 3RD5A 3T5GA 4Z5XA 3IE0A 4I0WB 4L9AA 3N8HA 1LSOA 1MBZA 2PJZA 3B6IA 3RR7A 2VDMB 3EG9B 3ND9A 2OE2A 4G1MB 4HDAA 4ZVOA 5LXTB 4LRWA 4BVFA 1XEWX 3FDFA 1AE1A 4DC0A 2YYSA 2E6UX 5KYWA 2UUOA 2FP4B 3CB4A 5ALMA 2Q62A 2R7KA 3C3CA 4UTRA 2B98A 1Y5RA 4MWDA 3C41J 3GFFA 1R9GA 3PPXA 1GGVA 4K6MA 1QKKA 1ZRSA 4Q02A 1N4AA 3K1ZA 3GJQA 1DBQA 3MVEA 3ZPXA 4A0HA 4DLVA 1JN0A 2NU9A 3W2EA 1LPPA 4G1UC 2QLBA 3RK4A 2NIPA 3LY7A 1DBSA 3RJTA 3WMWA 3UV6A 1KMCA 4L74A 1F0NA 2DTDA 4M87A 5IT0A 4LHEA 4LXQA 3NHPA 2PUFA 3ROQA 1PSWA 3ZWAA 4N3AA 1TKRA 5JO9A 3ICOA 1OBHA 2QL9A 3V2IA 1HORA 2QK4A 4DSOA 1OZFA 9MHTA 1SMKA 3MYRA 3OEED 3JR3A 5CB4B 2KKPA 3BXFA 3EXHA 3GJYA 3Q8WA 2A30A 3R3YA 4XFKA 4DQKA 1DCFA 2VXOA 4RLFA 4MFFA 5AXBA 1T9HA 2GVNA 1ANKA 5CMLA 3BTUA 1V8ZA 2CFOA 3JALA 1N2CE 2FFAA 4QBFA 4DR5B 1J90A 2YS7A 5DBOA 1GLNA 5ITWA 4ZV9A 2BF7A 4EQ6A 1YVPA 1M33A 3AKEA 4BNVA 2EBWA 1Q3TA 4V2IA 2IU6A 4DV3B 4M7PA 4DUGA 4G5HA 4PXYA 1GM5A 3BX1A 1GGKA 2MYTA 3A6KA 3BN3A 4I6JA 3G9QA 2QBYB 2G9ZA 2FPKA 2BJHA 2WWWA 3F2IA 1MTZA 3QKTA 5HHTA 1D1PA 2PPVA 1PT6A 1VQ1A 2VSOA 1I4DD 4XQGA 5IS2A 5JJLA 3KUUA 3ZZ1A 2BMDA 4CKYA 1FP7A 4RA9A 2HLDA 2H2DA 1HDGO 4MS3A 4RLQA 1I24A 3H1AA 4Z1MA 4FJ1A 3O4IA 5AUPB 1N8SA 1F12A 5BXQC 3G6XA 1O97C 3ZX5A 2KHVA 1P2BA 1OUQA 3GIIA 1E1KA 1TYCA 3QZ7A 2YNMA 3OI7A 4R2MA 3H11A 4CMBA 3U44B 1TNDA 4QOIA 5CAEB 2HYIC 2I6GA 3MS7A 5JE8A 3IOYA 1U8ZA 2HRRA 2R1TB 3TTWA 4D92A 5L1IA 4LSZA 4QQ8A 3UJ6A 2I6QA 5E7JA 3GX1A 3O8QB 3GLGA 4QT4A 3HBJA 4CDGA 3KUKA 4PLVA 3ZV3A 3A9CA 1OYYA 1E9BA 2SECE 4JP8A 2QTRA 5BN4B 2DFNA 4JODA 4JI5B 2XKJE 1JS1X 4PN7A 4OPMA 3TNJA 5JUMA 1V96A 2WM3A 3GAMA 4ZA2A 1T5OA 2LI6A 1ZL2A 3HPOA 1MJ5A 3R3JA 3TVDA 1PDOA 1RPLA 3J80A 1NAIA 3OMWA 3KHGA 4PCAA 1CUIA 1Q50A 3REGA 5KYTA 2FFBA 1K06A 3FPAA 4REQB 1HF3A 2P9BA 1GKYA 1NVDA 3OO0A 2E0IA 4WA8A 3G0CA 1K1EA 4WVLA 3ACCA 3OSZA 4DCUA 1GGJA 4N3BA 3O9MA 3RS5A 2P8SA 3C6QA 5GMOA 2I4LA 4U6SA 1I2CA 5BSGA 4Z6CA 4E2XA 4EO4A 4M9XA 4MB2A 1LZLA 5DB9A 4IX1A 1AOXA 3DJFA 4ZARA 4X6YA 4OI2A 4AT1A 2I0FA 4BLQA 4DOAA 4X7MA 1XZAA 2OMKA 1ML3A 4MWGA 4JXZA 3EIFA 3LVFO 3ETEA 1XV5A 4A8JA 2J4DA 2JAXA 4DDWA 2P35A 2EYQA 5GTDA 1ATIA 3UAXA 4Q19A 1P80A 1NP6A 5KX5A 2GPYA 2RJNA 4R0MA 1CZOA 2OHFA 2W6OA 4GH5A 1K27A 4F4ZA 4QVGA 4BUCA 1GFZA 2DM6A 4I2FA 1TD9A 1J0AA 3B78A 2QUKA 2X6QA 3H5NA 4PSAA 2BPFA 1CUBA 3AIKA 3LI2A 3BIWA 2D5LA 3BCSA 3ZV6A 5KFUA 3PIRA 2OCGA 2VHVA 2ZYIA 4QUEA 1FRVA 1JPJA 2FUNB 3ZDYB 2GJ4A 3O3NB 2P2NA 2YN2A 2AUNA 3PZBA 3T9DA 4Z7NB 1N7GA 1RPZA 2PBRA 2F3SA 4NNPA 4DQLA 4MWOA 1PJRA 3PSFA 3DPUA 5B30A 2Q8NA 4AJNA 4GMGA 1IMJA 3IR5A 7REQB 1IB6A 3AJEA 2ZRFA 2ODEA 2I1VB 4J90A 4XUCA 2GHQA 1NVXQ 3MJRA 3TMKA 3C3BA 1DAMA 2AH5A 2A4MA 4N1AA 1XALA 4D3ZA 4LISA 3JWIA 1P0IA 2D1RA 4QGHA 4XLZA 2XADA 3A9UA 3R23A 2BI8A 1OX6A 3DR5A 4U7HA 4Q4JB 4YQYA 5BYKA 5AW6A 5C8DA 3DOIA 4YCJA 5EXXA 2EBFX 4DMMA 2XWPA 2HHXA 3K0HA 5MDHA 3H42B 4HTAA 4RHTA 3I04M 3N2KB 5CLGA 4RF3A 4ZAVA 4QOHA 2GPAA 1U47A 1H2AS 4W63A 4ES6A 2XWSA 4QASA 3AQFA 2I4NA 4NLCA 2OG1A 4ER3A 3PW5A 4UB5A 3AK4A 3A6ZA 5L1MA 1X15A 1XMIA 4I2AA 3IBSA 1NXOA 5E3JA 3ZI7A 1ZJ5A 3QM1A 4D4GA 2R751 4LZDA 2ZRNA 3V34A 3AR5A 1R6UA 4UXHA 2QJOA 4W5HA 2UVRA 4TUYF 2JI6A 1EFRA 2ZUUA 4EK9A 2WKQA 3IG5A 3GZTB 5HIMA 1ZGAA 2XQIA 2YIMA 4TKLA 1E1DA 4BEWA 2GPTA 5JZMA 2AYXA 1H65A 5A7FA 1AZWA 4MUNA 4P7GA 3F5FA 3VR3A 3A1SA 2XMZA 2UVVA 3FNEA 3NS7A 1Z35A 5JEEA 4C76A 2Q4DA 4FNMA 4HFRA 1G59A 5F1PA 3I9FA 3T5PA 4OA5A 4DVJA 5GTIU 2QRJA 1W5AA 5KHOC 1E9DA 1JXMA 2PSHA 3G82C 4QLAA 1G8MA 4MIEA 3QUCA 4KL8S 4MUFA 2GAIA 3UWKA 1OXTA 1FFXA 2GT1A 5B4TA 2NWQA 2IHKA 3ENZA 1SC6A 4K9LA 3ICCA 2QBYA 3F5SA 4L28A 1CVIA 5F35A 3KWLA 2GQ0A 3UK0A 4FEEA 4X65B 2AOVA 1KIFA 1JIIA 5ULLA 5CEJA 2F8TA 4C1BA 1RXSA 4J43A 5AUOB 2QTGA 3PRYA 3C85A 1GAJA 2K8BB 3RAJA 2WSLA 4BJ6A 3TOXA 2FPGB 2CXXA 5JWHA 4JGGA 3H05A 4IDQA 3QEJA 3H75A 1UQTA 1V0JA 1KI4A 4E2ZA 2WTMA 2HVIA 3DTVB 3DVRX 1KERA 4PIVA 4XLLA 4BP1A 3KC2A 1TTTA 4BUGA 1BHJA 5A4IS 1AGXA 3CH6A 4BO4A 4F4YA 4ED3A 1BWRA 1OXJA 1H2ZA 3AQEA 2ZXUA 1F3LA 4X71A 1YQXA 1P3DA 2C95A 4BNLA 1Z2CA 2V7WA 4I1RA 4O1HA 4BASA 4C0SA 3AMZA 5KOJA 1KI6A 3OCXA 1QRAA 1VYTA 5KNIA 8ICYA 1FUEA 1YZ7A 3FUTA 1L7NA 2HRQA 3IQGX 3JARB 5EY5B 5BSRA 1EG2A 2RHOA 3TSZA 4C22A 4KR7A 3THWA 1W581 1W76A 2VJMB 4M53A 4F4KA 1GZSA 1WV0A 2C84A 3CGWA 4KB5A 4UVIA 4OREX 1XQ9A 5BWLA 5I7OA 3EAFA 3L7AA 1W2WB 3B1ZA 1FLAA 1SXEA 4CKZA 4YY3B 3KEQA 1TTQB 5LOVA 1OPRA 3IEPA 4PTZA 1JWBB 3QYJA 2ZLBA 5EJ8A 1SU4A 1BXGA 3D5TA 3W2FA 4CNQA 2X4LA 2X15A 1SBHA 4RNDB 4KR6A 3OCZA 5LQJA 2AQKA 1E9EA 1POWA 3D8BA 4HYYA 5BWMA 9ICQA 2YWGA 1AVTA 1THZA 4JUBA 4L78A 3R40A 3V7NA 1XRMA 1I2ZA 1X1CA 2H0AA 2W9CB 1XN1A 2C9YA 2KBEA 4ZAXA 4QGBA 2HO4A 2X76A 3ACBA 2BFEA 3I04A 4KQ1A 2LPMA 3ZLJA 4A8JB 1E2MA 3GJ5A 1UBCA 4CG1A 2C3YA 1SGGA 3CINA 4HKTA 4ZGWA 3OBBA 4O5AA 1C2YA 3L92A 5CB4F 1MIHA 4I3GA 5JS8A 2PKQP 3MBYA 1RXEA 3U39A 4TTVA 3ZIAD 1GGNA 4IJMA 2NTYC 2OAGA 1YDMA 5KHLB 3G2HA 1D5CA 4WFKA 3WGUA 4BQFA 4YG2A 1T4CA 3UMSA 2Q3BA 2H4WA 4ZT2A 5ICCA 1XVVA 2DPMA 4TTSA 4EJ0A 1MJHA 2F3QA 4UE6A 5CDYA 2B69A 4LVSA 4WN9B 1N5OX 3RRZA 4EB6B 2LPEA 4B9AA 1V71A 1ND6A 3LDAA 1MRSA 1NQWA 4KQIA 3UK6A 3TH5A 3TSWA 1NMZA 2P65A 3NHZA 2HTFA 4IYJA 3DFUA 5AWFC 4NMMA 1OH5A 1H23A 3KKPA 1NBHA 2BEJA 3PNQA 4NLLA 1L1QA 2AR7A 1GA6A 1UCVA 2DSNA 1LLDA 2H48A 1PGOA 5E6RA 3FR7A 1BJKA 3OKAA 1YB5A 4J1NA 1XCBA 3QP9A 2QVZX 2QM3A 2ATCA 2NXJA 4S1TA 5EEGA 3QMVA 4IF6A 5DW0A 4RC9A 4S1VA 5ES3A 5BQOA 5JS2A 4P4SB 5CG2A 3FH0A 4IX9A 3LUCA 4PSKA 4BCDA 3D02A 3IP5A 3WQBA 3GFTA 1HSZA 3R75A 5DHRA 4ZU1X 4H60A 1TO2E 4C30A 5BOLA 1H94A 1OAOA 9ICWA 2ATIA 1TM5E 2BEVA 2GAAA 2XMGA 3DDOA 3HUTA 1ZQDA 3GQVA 4JELA 4W1SA 4O0IA 3T4EA 5A5FA 1UZUA 2QE6A 3GLSA 1EWTA 3QI7A 3DMHA 5JCJD 1QZ3A 2G40A 2MSWA 4KGXA 3WSTA 2EZ4A 3T9CA 2KD1A 2OR3A 5JO0A 5LQDA 2BQUA 3HGMA 1GQYA 2NO0A 1UK9A 2E5LB 5K8TA 5FFFA 1O5OA 1VIMA 3AM5A 4PAOA 4BRZA 3K0EA 3TZQA 4ETIA 4D02A 5BRJA 5TLSA 1Y7IA 4WKPA 5EZYF 5CHGA 1DXYA 5IJXA 1SZHA 3SAJA 3CTPA 3SS9X 4UCXA 4MMYB 1XEWY 2F3PA 3F6RA 2B3DA 1A2QA 4IXDA 4YT4A 4DW8A 3RB6A 1E4OA 3MGVA 1J5PA 3MMZA 3P0RA 3GJ3A 4IG4A 5IYZF 4G8JA 1UFVA 1DELA 3KHTA 3OF3A 3T4XA 4B4DA 1JVNA 4O2AF 3IA2A 5HDBB 5JJIA 1F1BA 1Z7WA 5C5EA 1DIHA 2FSPA 5JRTA 4CMIB 621PA 4LBYA 1SKUA 5G0UA 2O2SA 5J0SA 4IQWA 1BVYF 3OY2A 1LS6A 4F5NA 3IBCA 2CXUA 3N0WA 4UEQA 1EEHA 2WT9A 1W6RA 1T26A 4C29A 1Y9EA 1K5DA 1RT9A 2MT9A 4LY3A 2EATA 2WG1A 5T57A 3ZLBA 3NKLA 1RRVA 2OP0A 4GI3A 3FFTA 2RGEA 3ET5A 3CNLA 4NDZA 2JRCA 1Y6QA 2DLDA 3AM3A 3B5EA 2EFGA 2QGFA 3S2GA 3KKKA 5TZVA 4US8A 3CLSD 3P0EA 4COOA 2G6BA 4NMHA 3U4MA 2V4RA 4IMRA 1YB1A 5A3JA 2E49A 4V1CI 3TPCA 1Q44A 2UVQA 5IKOA 3RRJA 2IUFA 4O9MA 1VG1A 3EVAA 3IOEA 3TNYA 2GPSA 1Y7HA 5LLSA 2XNJA 3MYYA 4DF8A 3O8LA 3EF3A 1ZITA 1ULTA 3PNKA 2ZWVA 5KI6A 1TYBE 5CCBA 1Y8QA 2Q6OA 2VT3A 3H8WA 4Z7JA 1XMQB 4OMCA 3GA5A 4KC0A 2IEYA 3I1FA 2EEPA 3DAFA 3I4CA 5J0OA 4JV1A 4OCZA 3EYZA 1CW2B 1GGHA 3EW9A 1J24A 2XUGA 3KIPA 4MLZA 1KZHA 3G9TA 1RWQA 2RONA 3N0RA 4WEQA 1QGYA 1MFZA 5B66U 3MBOA 4S0XA 1GFIA 3MR3A 2WWHA 3MZ0A 3PJDA 3K16A 4EYOA 4LJYA 3CURA 2FMFA 2OFPA 3K5IA 4JH0A 5ER9A 1EUDB 5I7WA 4GKAA 1VKRA 1XTKA 2QQ0A 1B6TA 2HF2A 4MW1A 5E8JA 2P0YA 5DBCA 5CH8A 4D9JA 1ZC3A 3QOFA 2OO7A 1OVGA 2WHRA 3FIJA 1L5GB 3ITDA 4K9PA 4TVBA 3TLMA 2H2FA 4BXOA 2YB4A 2BAGA 4IMIB 1VGQA 1OUMA 1GKKA 3GW8A 1T36A 4MVJD 1GN9A 2VWHA 1K8YB 2BZSA 4QHSA 4UMVA 3TE7A 4HRVA 2C3OA 5IZ4A 1ZZEA 3U48A 1E2QA 3V2UA 1YQUA 3ICXA 4J1TA 1EFTA 2A9KA 1TAMA 3ESDA 4HP8A 3HM9A 4DWOA 5F2OA 1NL3A 5G3YA 1NI4B 1UDRA 1P31A 4C6TA 1VSQA 1T0BA 3X2FA 2QTAA 4EI8A 1MTOA 1T34A 3BQMB 1CP3A 4KG7A 1FY2A 1M8JA 3KUCA 1OH7A 3C29A 2RDMA 1W4BA 5AM5A 3V4OA 1EZ4A 3VAZA 2QT0A 3BJRA 2JGDA 1Q1EA 3R7WB 3WK8A 2FZVA 2EZXA 3EQ7A 3IA7A 5LUAA 2XF2A 3F8WA 3I8SA 5IBRA 4B7CA 1E0SA 3SR3A 1XN4A 1F06A 5LJLA 2V9WA 1WCXA 9ICMA 1VPDA 1VOTA 4ENVA 2CUZA 4DABA 4DOMA 2C5LA 3QLVA 3LYAA 3CEJA 1OWLA 2VBIA 4YRPA 1MAVA 3HYTA 1E5QA 2G88A 1QU2A 1V35A 3FVTA 1U7XA 2J32A 3KJEA 1L5YA 3P2MA 3TQHA 5B58C 1BCRA 2DF4B 4IFIA 4KUEA 4TYWA 2OXOA 4EHIA 2OZEA 5T4HA 2ZANA 2AMVA 2FK7A 5EL0A 3E5MA 3LY5A 1CUKA 2EIHA 3BE4A 4AYTA 1XHLA 3FPFA 3ZDCA 2ZIAA 4N76A 2VXYA 2DP4E 5JQGA 1N62A 1ZLYA 3EF1A 3ZWXA 2I8LA 3F7OA 3HV2A 1Z6TA 4LYYA 3COJA 3GJTA 2ES4A 1TAHA 2D5AA 3I01A 1JG7A 2KFNA 2H85A 721PA 4L1KA 1Z2OX 3T5KA 3F9IA 3FUCA 4JUFA 4BNDA 1B8UA 4ZOLF 5L6LB 2I6SA 1AQYA 1BEEA 1WXDA 1Z4IA 3FCSB 4FBLA 3T7RA 1AQJA 5CDUA 3F5EA 5IDVA 1FFBA 1QO0D 3B12A 4UZEA 4XUDA 4JNCA 1NDQA 5IW8A 3TI7A 5KFAA 3OE7A 2FCRA 2NT4A 2O3SA 3GF4A 1UR5A 2ZYRA 3BH6A 4PONA 5FI1B 3SDZA 2PKXA 1UMBB 1XCGB 3OZAA 4DFPA 4QRIA 3GEDA 5L1JA 4H35A 2HQBA 4WJZA 2YFQA 1EWYA 1Z34A 1ESZA 1O95A 2FN9A 3O8NA 3GQCA 4ZYLA 1XZEA 1Z1BA 2IHNA 1V95A 2CLOB 2ERYA 3O3OB 2RC6A 4OO3A 4JVOA 1EP9A 1XU9A 4LOAA 4Q3BA 1YF3A 4N5HX 3MXTA 3SIXA 5J1SB 3OM0A 1VJ1A 1KO8A 5EUBA 1VLBA 1U8UA 3PXGA 4N3CA 2WIGA 3PNPA 2H3EA 1XE3A 2PI4A 2J3LA 1L7BA 3WP1B 4ZJYA 4OI1A 2F3UA 4WK4B 1P81A 1RQNA 1KYYA 1S2MA 1PBTA 1ZVQA 2Y1XA 3W6ZA 3WL3A 3WYGA 4DEYA 1VIVA 1B8NA 2W6ID 3W79A 4CKEA 2X9GA 2PK3A 3MILA 4TKMA 3TJZA 1GPBA 1L4BA 4ZDWA 2Q0QA 2ZJ4A 3ETRA 4LNHA 5HUHA 5JYCA 5DQIA 1EX7A 2HREA 1T94A 1D5WA 2A86A 2CLLB 3ZS9A 1ISHA 4BQIA 2G76A 1UMBA </