4EEKA

Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound phosphate and sodium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
229
structure length
229
Chain Sequence
DAPFDAVLFDLDGVLVESEGIIAQVWQSVLAERGLHLDLTEIAMYFTGQRFDGVLAYLAQQHDFVPPPDFLDVLETRFNAAMTGVTAIEGAAETLRALRAAGVPFAIGSNSERGRLHLKLRVAGLTELAGEHIYDPSWVGGRGKPHPDLYTFAAQQLGILPERCVVIEDSVTGGAAGLAAGATLWGLLVPGHPHPDGAAALSRLGAARVLTSHAELRAALAEAGLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-phosphoglucomutase-related protein
publication title Crystal structure of HAD HYDROLASE DR_1622 Deinococcus radiodurans R1 (TARGET EFI-501256)
rcsb
source organism Deinococcus radiodurans
total genus 83
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4eekA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4eekA01
3WK8A 2WHEA 3ZUPA 1T5TA 4XE5A 4BNDA 5T41A 1RQNA 3M9LA 2YMLA 3QGMA 3AR5A 3I76A 3UMGA 2FPWA 1YNSA 2MSNA 5AKJA 3QXGA 1Z5UA 1Z4IA 2EARA 4H1WA 3FM9A 3HYCA 2AGVA 5AVWA 3WKCA 1TA0A 2BY4A 2R8EA 3QU5A 3SMVA 4UM7A 4C4RA 3SKXA 4MUMA 2GFHA 3KZXA 3PDWA 5AKGA 4OFZA 3MPOA 3HLTA 4PNHA 3L8HA 4Y2SA 2FDRA 3L0YA 2YMMA 5AVXA 5IS2A 3E58A 4F72A 3NRJA 2B0CA 2G09A 2ZG6A 1ZD3A 2AMYA 2AUTA 5AW1A 4I9FA 4KNWA 1LVHA 1RKUA 3FPBA 4HYTA 3R4CA 1XP5A 2FPXA 2WF6A 5ALQA 2FEAA 4UARA 4CF4A 5ALTA 3L8EA 3QLEA 2W11A 2B1QA 3UMBA 2WF5A 1Z5GA 3BA6A 4KN8A 2CN1A 4NV0A 2O9JA 2R8YA 2YJ5A 4KX5A 1ZS9A 3QNMA 2P69A 3AR2A 3EF0A 1AQ6A 3AR4A 2HO4A 2ZBFA 3WKAA 1Z4MA 2QYHA 5AW5A 4Y2YA 4BBJA 1VJ5A 4FYPA 4BKMA 4Y2PA 5ALSA 5AKHA 4JB3A 3MC1A 2ZBEA 2YMPA 1LTQA 4FE3A 5ALKA 5JJBA 2GO7A 5AI5A 3OCVA 2I6XA 4C4SA 4NAVA 4KYTA 5AKKA 3U7EB 5AW7A 4EX7A 3ZWKA 2MU2A 3AR3A 3SLRA 5AVZA 4L6CA 2FPRA 3DV9A 2MU1A 3AR7A 2ODAA 4CF3A 1TJ4A 3A1DA 3P96A 3U19A 5AI8A 4YCLA 5AK4A 1SWVA 1Z4JA 2JAUA 5ALYA 3L5KA 1RDFA 4CNQA 1YS9A 3L7YA 4Y2JA 2PKEA 4Y2RA 1ZJJA 2I55A 1RRCA 4YIKA 2GHQA 5AM1A 1SU4A 1ZD5A 1CQZA 2G07A 3SKYA 4ZEXA 2X4DA 4AP9A 5AVYA 2AH5A 2W43A 4DWOA 4F71A 1YDFA 1Z4OA 1KYTA 5AM3A 2B1RA 4FFDA 5ALMA 3FPSA 2Q4RA 1T5SA 3L1UA 5IT4A 4UAVA 2B8JA 4JDPA 4J03A 1Q92A 4GIBA 2GMWA 2YBDA 4UMFA 3QUBA 3QX7A 5AIBA 4G9BA 4G63A 3W5AA 3QUTA 1TE2A 4UAUA 4XQ0A 3KD3A 4EEKA 3AR9A 4BX3A 2NO4A 1RKQA 3A3YA 1S8OA 1Z4QA 3OCXA 4EZEA 5AM4A 3I6BA 2B30A 5AHXA 5AI4A 2YJ6A 1MH9A 5AK3A 4UMVA 1O08A 4NABA 1J8DA 5ALIA 1RMQA 3ZVMA 2CFSA 3SF0A 5AW2A 2DQSA 3B8EA 4EENA 3DNPA 3ET4A 5AVSA 2YJ3A 3MMZA 4QQFA 3WK4A 3WGVA 3VAYA 2I7DA 3EF1A 1RPZA 4KNVA 3OCZA 1EK1A 1QH9A 2JGAA 1L7PA 3A1CA 2WM8A 3BWVA 3U26A 3DAOA 3QU4A 5AKZA 2ZBGA 2P27A 5ALJA 2P11A 1Z4NA 4C4TA 3R09A 2G08A 3A1EA 1Q91A 1FEZA 2I34A 3ZU6A 3FGOA 3ZI4A 4OHFA 5AI0A 2C9MA 2HHLA 4EX6A 3OTQA 1X42A 5ALPA 3L0CA 3KDPA 3ESQA 3AR8A 4UASA 2W4MA 1L8OA 3GYGA 2WF9A 5ALHA 4Y3UA 1XVIA 1QQ7A 5E0OA 1RKVA 1XPJA 3SHQA 3OCYA 4KX3A 3WKDA 2IYEA 3IB6A 2YY6A 4I9GA 4HGPA 2BDUA 5AK5A 1SWWA 4DFDA 4GXTA 3QU7A 2OYCA 2ZBDA 3J7TA 3E81A 1O03A 1ZRMA 5AI6A 2PQ0A 2HF7A 5AVRA 3KOOA 2C8KA 4UATA 1CR6A 5AKIA 1L7MA 3M1YA 2HI0A 5A3RA 5AKXA 2B8EA 3W5CA 1L7NA 3KC2A 4UW9A 3IRUA 3L8GA 4HGOA 1ZRNA 2G1AA 3N5KA 3ET5A 5AI9A 3ZW7A 2EATA 3AR6A 2YMQA 2HOQA 1L8LA 1YV9A 2YN4A 1YMQA 1RQLA 3CNHA 3WK5A 3PGVA 4YGYA 4ZEVA 2WFAA 1RC8A 4YCNA 3WKBA 2IOFK 5AM0A 5AESA 2B82A 4Y2TA 2OBBA 4O8CA 2I54A 2FUCA 3B9RA 2WF8A 1VJRA 2OM6A 3WKEA 3KBBA 3SD7A 4UM5A 1N9KA 4UU0A 2R8ZA 1Y8AA 5ALNA 5ALLA 1RLOA 1U02A 2HDOA 3QYPA 2C4NA 2HF2A 1U7OA 2R8XA 4L6AA 3ESRA 1RLMA 4NWIA 5FP0A 2IOHA 3DDHA 3ZWDA 2HX1A 4EELA 2YJ4A 4AS3A 4IFTA 5AW0A 2WF7A 3U7FB 4UMEA 2G80A 3ZX5A 4NFLA 1RLTA 1QYIA 3RFUA 5AKYA 4BNDB 3QUCA 5AVVA 5AVTA 3WK6A 4DCCA 2NYVA 3U13A 2CFRA 3NIWA 1WVIA 2NO5A 2Q5EA 1N8NA 1Z4PX 3E84A 2JARA 3QU2A 5AIAA 4AS2A 1ZOLA 3OCWA 4BX2A 4DW8A 5ALVA 4J2TA 3D6JA 2FUEA 4UMDA 3WGUA 4Y2UA 3N07A 3CZ4A 3L0BA 2BDEA 3N28A 4B6JA 3W5DA 3UM9A 3NALA 3OPXA 4Y2VA 1NF2A 5AW8A 1U2SA 3E8MA 2RAVA 5ALXA 3ZTWA 3K1ZA 4Y2QA 3WK9A 1WR8A 2HSZA 1J97A 4QJBA 4RETA 3EPRA 5ALZA 1U7PA 4ZEWA 3NUQA 2IOFA 5AK6A 4BEVA 2D2VA 3PGLA 5ALWA 5ALDA 3U7GA 2RARA 2YFYA 1T9ZA 3PCTA 3L1VA 2FPUA 2ZOSA 4E88A 3ONNA 3N8GA 1QQ6A 3R9KA 4RESA 1EK2A 4L57A 4XOUA 1TJ5A 3F9RA 4Y2XA 1L7OA 3FVVA 4OD0A 4BX0A 2I33A 5ALRA 2FI1A 3WK7A 3TLMA 5IT0A 1NNLA 3ED5A 2VKQA 3OCUA 2P9JA 5AW3A 3QU9A 5AW9A 5ALFA 1F5SA 4CE6A 4IG4A 1Z4KA 3FZQA 1U2TA 3NAMA 3N1UA 3RF6A 2EAUA 5AW6A 5ALGA 2O2XA 1WPGA 3I1YA 4BEWA 3EWIA 4BYGA 2PR7A 5A3SA 2RBKA 3QUQA 5AVQA 5ALUA 1PW5A 1ZD2P 2HCFA 3L8FA 2IA5A 1NRWA 2G0AA 1IWOA 3ZVLA 4YCMA 5ALOA 1Z4LA 1ZD4A 2QLTA 4HGQA 2HEGA 3MN1A 1VFPA 3UMCA 1TJ3A 2ZXEA 5AKEA 4XPZA 5ALEA 4CF5A 4YH1A 3ZX4A 2C8LA 3ZTYA 5A3QA 3I28A 5AM5A 3B9BA 1L6RA 2JAOA 4HAIA 2RB5A 5AVUA 2C88A 3S6JA 3IJ5A 2G06A 1WZCA 4UU1A 4HGRA 1Z88A 5AICA 2JAWA 2FPSA 3U7HB 2Q4TA 5AM2A 3NANA 1QQ5A 4HGNA 2OA0A 4YIHA 3NASA 5AW4A 1YJ5A 5AKLA 3W5BA 3ZVNA 1S2OA 2GHTA 4MWOA 4OCZA 1RMYA 1RMTA 2CFTA 1JUDA 1K1EA
chains in the Genus database with same CATH superfamily
2V7VA 3PNLA 1HM5A 4LWPA 2E4YA 3HLKA 2IBKA 4J91A 1R0BA 1P0QA 4OUDA 1LV5A 1HE8B 3TZEA 1NVVR 3ETRA 3OTHA 3L7NA 1OREA 5AVKA 3B52X 4TUYF 1XTIA 2VA3A 1TYAE 3AFOA 3FTFA 2M9MA 3BJZA 2H6EA 3NU1A 1RZRA 2GZMA 5EKUA 3CF4A 1CJKC 121PA 1C3OA 2IBTA 4N76A 1J20A 2P69A 3SC4A 1XU7A 4ZOLA 5DTQA 3ANXA 1VE9A 5D6OA 3ZZTA 4BBJA 2VLBA 4UUAA 5DN9A 4KAJA 5CA1F 2GN6A 9ICXA 1JG2A 5EGNA 3C15C 4R4JA 1B6TA 3OJ0A 4H59A 3RBXA 4MRNA 1G5HA 3RQSA 4BCDA 4ZCMA 1ZLXA 1XFDA 3MBOA 4IMRA 1E1KA 3VDNB 2ZSEA 3HDVA 4R1UA 2PBFA 3LRXA 2X9QA 3E9CA 3SKYA 2YWBA 5LYJA 1WW3A 1U90A 1F2VA 1U5BB 3K92A 1SG0A 1GZUA 4DCSA 1BE8A 1JIVA 4IIYA 1JA0A 3A1FA 4WZAA 2BKUA 4KIUA 4XUDA 1UBCA 1WSAA 4HJXA 1WTCA 1CRWG 1X19A 3MFYA 4AXXA 5FL7D 3K8OE 5TZVA 4PG8A 3EQ8A 4I2GA 1IAQA 3R3JA 3P0HA 4DV2B 1NW3A 3OOHA 2HXGA 1ZNYA 4W5RA 1VB5A 3KWMA 3G9XA 4KDEA 1TRHA 5J59A 3VTFA 4RQNA 2PS9A 1RVDA 4GQIA 1N6KA 4KUHA 3LBIA 5L3ZA 5CFOA 4YI5A 1W5AA 3NIFB 3D6NB 4RS3A 4QRIA 1XQWA 2ZJZA 3CP8A 4JI7B 1L9XA 1UJ4A 2QPTA 3ZGZA 1BFKA 4BE9A 3D6TB 4MA4A 2KM1A 3WGHA 2I03A 2IHKA 3E5RA 4RDXA 1L6IA 1RQPA 4MRSA 2FGJA 4RVSA 2LZ0A 4II7A 2ZBDA 1L5VA 2E4XA 3RO7A 5EIFA 4ALKA 4HQOA 2D5AA 1NIJA 5KT7A 1R5JA 5EHZA 2GJSA 5L51A 3L4EA 3ZEAA 2LCIA 1E1QA 2HA0A 1A2KC 5E8JA 4UBCA 4O3RA 4P6VF 5ALNA 3REQB 1V45E 3A3OA 3RAQA 4IFTA 4X1KB 1V48A 1Z07A 4MCJA 4NIMA 1RFGE 3ZX5A 1ISIA 4XYGA 2WZDA 2MMGA 4K40A 1SUCA 3PC8A 4ZAFA 5FA5A 1RJFA 3CONA 1JXOA 4TPKA 2B7BA 4IUDS 4OHMA 3N3AC 2Q2WA 4U4AA 3ZIAD 4M0UA 1SKAA 2ZTVA 3RIGA 3UM9A 3TD9A 1YRHA 1KGDA 1QZTA 3UWOA 3QHAA 2C7RA 1OYVA 5GOZA 2PWYA 5GY7A 1BPEA 3V2GA 4OLJA 4I19A 5LMZA 1BD3A 4DHEA 2HIAA 4KJZA 2O7NA 4ZOAA 2WIAA 4GVXA 1NNLA 3BL8A 1G5IA 2PK3A 2O14A 5AW9A 3OJOA 3R77A 1JJIA 4NE2A 4IG4A 1NLZA 3C45A 1UUFA 2O54A 4CLDA 3TR5A 3AESB 3BGSA 4Y1RA 1E79A 3PFIA 2GBLA 3I4FA 5E1OA 3T0FA 1M1ZA 4L8LA 2VCYA 1NE7A 3KFXA 4YRKA 3PDJA 1YBHA 1J2TA 2RG7A 4D2IA 4L50A 1FJ2A 5JQGA 2QN9A 4J90A 4URHA 1MH1A 5F64A 5FOVA 5FD8A 3S27A 2R4UA 4ECAA 2K4IA 3MJDA 3D8HA 2R7LA 3Q8QB 2H92A 4OBBA 1NDHA 2ZIAA 1KMCA 2HNBA 2CLMB 3FNBA 1UBRS 2WWHA 1P5FA 4EZIA 4F93B 1FYFA 4QUBA 1OVGA 1WZEA 2PUHA 3SZLA 5LQCA 4U5XA 1FFVA 5EGSA 4EYOA 5SZHB 3OSPA 1BEZA 3D3WA 1QF9A 2O3RA 2HNKA 4EY7A 4EFMA 4L0QA 3LC7O 3G2JA 3KZMA 5LDDC 4LW8A 2Y1GA 1E5DA 3BCRA 4NARA 1W9HA 1L4BA 4E5DA 2UZAA 4AI6A 2GGSA 4G2TA 2GWRA 2ZZKA 4H27A 1V4VA 2B9EA 3DJYA 2X9LA 2POQX 1NU8A 1POXA 5AVZA 1ND6A 4WESA 4P4SA 1M2VB 1ODFA 3ZVRA 2AFHA 5L53A 2QYOA 1D8LA 2BFDB 4OGGA 4JT9A 5ERYA 4KFUA 3HUTA 5YASA 1KJ9A 3ASZA 4MJ3A 4I28A 3HFRA 5HIMA 3RWMB 5FOSA 3LHDA 5BW4A 4PHDA 2XQFA 4A27A 1EUZA 5DM2A 4XWYA 2V5AA 1PGQA 5DB6A 3NCHA 4HAOA 5L3QB 3WLSA 2GM4A 2I9GA 3RJIA 1MV5A 3FYUB 4L1KA 2HHJA 1TECE 1YR3A 1IJFA 2KVCA 2ZIWB 3OM1A 2JCVA 4RDCA 5DNUA 1YU9A 4B40A 1NJSA 3A2KA 4D9KA 4UMVA 3INNA 2ZIXA 2VQFB 2NAPA 2K5UA 2FSIA 3LP5A 1GCIA 2CFSA 1R18A 4IV0A 3E7PA 3W5HA 2I22A 1H2FA 4D0RA 4D79A 5EPUA 3S8EA 2TMGA 3WMEA 1CQJA 4NQRA 4XIIA 3MEQA 5D3MA 2GBCA 3T4UA 1UBOS 5H1YA 3RUFA 3PXCX 2MSDB 2RGYA 8ICVA 2EX4A 1EE2A 3LX5A 4QBIA 2IYFA 3H9QA 5B66U 3LBYA 1QPGA 2O59A 4RIIA 2V9ZA 1PS0A 5LU9A 5BP7A 5AK5A 4R3WA 1IU9A 1QXSA 2KP7A 4WX2B 3N8HA 4DM4A 4UATA 5LQSA 4FTWA 2BRUC 2BQ3A 4CM4B 4BN5A 3EZ7A 2VYVA 4F91B 5REQA 1IHPA 1K06A 4XB6B 2CC2A 1AA6A 2ZUDA 4KITB 4O8CA 1FFUA 2YXPX 2C31A 3FJ1A 3A6ZA 3AG5A 2AZDA 1CUXA 3LGAA 3HT3A 1CD5A 1LDBA 4H31A 3EGWA 5U4XA 2DPYA 4OJ6A 3PEWA 4MI9A 4UJ3A 1STOA 3C3BA 4ISBA 4MGEA 5A0VA 4DCCA 1ISPA 1JKJB 1U2PA 1H5UA 2NN3C 4C7ZA 2DH6A 4WLNA 1UT6A 2EJTA 2FUG6 5IIIA 3R41A 1N0UA 1PR2A 1YB2A 1CDOA 1SB8A 3RS9A 5EIHA 1DTWA 2R5WA 3W2FA 1QQTA 1XSEA 1YZGA 4Z7JA 2V3CC 2K4MA 3M6XA 1MC5A 2V6IA 4BUGA 1P9RA 4R8KA 4MYDA 4ZQFA 2R96A 2XSZA 2I7TA 2Q7OE 3JAWB 2KN7A 3ZDCA 3H8VA 4CU5A 3EPLA 3NHRA 3TB6A 2EFYA 5C8YA 2OYRA 3VX4A 4Q6WA 2C3PA 3FTQA 2PR7A 2I4MA 2NU9B 1ONNA 2XD4A 5CXSA 1GYRA 3H8SA 1D2NA 4ALLA 2FCAA 3P2OA 5H3HA 5AVUA 2RAFA 3UICA 4XQ8A 2W8ZA 1HZZA 1FU4A 5C34B 1O9GA 3R3XA 2ZIGA 1GT91 4PZZA 1FS4A 3W79A 4TTQA 4FIDA 3HUFA 3OH8A 1GQOA 4GDFA 1W5BA 5GJVC 5JCJD 4K9PA 5K0EA 4JNCA 2FLNA 4IRKA 3NKLA 2VDUE 5LDHA 3NM5A 3E9DA 1P18A 5T8KC 3I83A 5KQSA 5BMVB 2RI6A 5MGNA 5JRTA 5JATA 3RSZA 2XNSA 4GOND 1CJBA 4CV1A 5FFNA 4DLAA 3PPVA 2CPRA 1WHSB 1VBKA 1K3TA 3GIKA 2Y1DA 1JU4A 3OVMA 3LZDA 4IIUA 3V8NA 3KEQA 4NZ9A 1P33A 1PL0A 3E8XA 3D6AA 4DA8A 4M1SA 5AFSA 3MHTA 2VT6A 3TZ6A 4C0QC 3GAMA 2FN8A 2WKWA 1T94A 3X1DA 1UAYA 3F6EX 5CVVA 3A4YA 3LBFA 3CUVA 2A9FA 3WXMA 1ZVVA 7ICUA 5JH7A 1KY2A 4S0ZA 2P6PA 1GUDA 4BNIA 1B0UA 3IVCA 4GNRA 1CFJA 2ZDHA 1Y9ZA 4E32A 3QFRA 4OBXA 1G8KA 4NJMA 2NPFA 4MVYA 4JVNA 4DIMA 5BSUA 2HW8A 4B3FX 2W9AA 2W93A 3N0VA 5KO2A 1I2ZA 2H1FA 2H2WA 1ZGGA 5A4JA 1HOXA 4YUVA 1HDOA 1XZDA 5DHTA 1A5ZA 2N1BA 1LDNA 2WTAA 2BI7A 1SXPA 1EFPA 2FN4A 3GAAA 4JC5A 3HCBA 3CBGA 1GVNB 1G5RA 1NXTA 1SVNA 2WJ3A 3WDSA 3R3YA 5FWDA 1JIHA 1PKEA 3VVLA 3KOWA 4DV3B 3TLGA 4BTEA 1BJTA 5CIQA 4BNGA 4KXNA 3D4PA 3O83A 4V0LA 4FHFA 5KQRA 3IDAA 2H2IA 2ZRNA 5FULA 3WYCA 1XYVA 1RADA 4AN0A 1XNSA 2P11A 5BOSB 3EQ7A 3OY2A 4ZZ1A 4NK4A 1JJAA 3AQFA 2W7TA 5BRAA 4OA5A 3O8LA 2XZLA 3IP6A 4Q05A 1ECJA 5HQTA 4LYYA 3DLHA 3UAWA 3PUYA 1ZX1A 1EZZA 3PV0A 5K0JA 5F9MA 4JODA 3M1YA 5B3KA 1BGXT 4X1OA 5E1DA 4WOBA 1ICEA 5HZMA 2VJ4A 4RY8A 5K0FA 3UXEA 1RCTE 1KO8A 2AOUB 3MRVA 3FLAA 2I0FA 1KK0A 4A36A 1R5OA 1XMXA 2WAYA 4LHEA 1JHRA 4G3IA 1AB5A 1F4LA 2Z04A 4RQUA 1KQNA 1TA9A 2GBGA 5KTQA 2PX8A 3EB9A 3JVEA 2EFGA 4N82A 1DFHA 5I7HA 1N6IA 4OEHA 5CPFA 2AHOB 4G5SA 1RRKA 1OU4A 3FTPA 3M4ZA 2A5GA 4F2PA 4ZCRA 4JXZA 2H1HA 1BS1A 4FD3A 1HL3A 4WADA 4OFXA 1VJCA 3GPIA 3W2TA 3Q0TA 3F5QA 5IXSA 2MOKA 4Q1BA 3ZIUA 1CS4C 2D2VA 1BVSA 4IOLA 1V38A 1DBWA 4MLPA 3BJMA 1LQUA 1I0IA 2HSWA 3TTSA 1PR9A 4N5MA 4IS3A 1ZVJA 2HUPA 1E2KA 2P9JA 1T0JB 1MG5A 3N1UA 1UJ5A 2Z3ZA 5K05A 1NI3A 3M3DA 1SXJA 4IH4A 4LSZA 2HCTA 3PC3A 3EXG1 3HZRA 3I4LA 1ZK1A 1FC0A 2D06A 4G1MB 3IUPA 4IRXA 1ZHOA 2G88A 3S5JA 4CM6A 4MI3A 1LZLA 2VDVE 1OGYA 2EW8A 4E6PA 4R16A 1M9NA 1E9VA 5J2TA 4G0ZA 2P9QA 3SEAA 1XOIA 3ZWCA 3A0UA 1WXWA 1KAQA 4CLRB 2CFTA 2FFRA 3I6ZA 3T3NA 4G23A 2CD9A 4MQFA 3I5AA 4OQDA 1OTXA 3ZHSA 2GLTA 1NT2A 3EFHA 1ST2A 1D9XA 3W7AA 1UXOA 2JBAB 1WB6A 4KDFA 4RTJA 4Y6SA 1SEVA 3SIPA 1XQYA 4YT2A 1VSTA 3A6EA 5EP1A 1F6DA 1RD4A 2Q9AA 1SZCA 2WU3A 3N05A 3C29A 3X2SA 1ZAKA 4IO0A 5L4SA 3BXXA 4JR0A 1DX9A 5A6VA 3UANA 2I8AA 4YI3A 1ZQJA 4LJKA 2XCQA 2QW8A 3PNQA 4YS6A 3NT5A 2IHNA 1MJNA 4A6XA 1N7JA 3GFKB 1FY2A 3T7CA 3F6BX 1MPTA 4LF9B 2ZRAA 1AUQA 3DE2X 4Z2YA 2LHTA 1UJ2A 1PF7E 1AMUA 3Q8WA 3F4BA 1EXMA 4DS4A 4TURA 9ICEA 2JNWA 1AX9A 3CYFA 2FZLA 8ICRA 5IWAB 3KWLA 1DRUA 3OJUA 2A0WA 5KDLA 2NT3A 3EVTA 3WV4A 4YWHA 1LQ2A 3PCRB 4WCDA 1T9DA 4AKEA 1RXWA 2IZ1A 1SO8A 2W8BB 3EDYA 4I1UA 2LDBA 2ZYTX 4LXTA 2ARKA 3BILA 4JFAA 3E27A 1GSIA 2AUNA 1WCYA 2ALZA 1YVDA 3F7MA 4R0NA 1QJCA 2K4HA 4R9VA 5KOIA 3E2IA 4TV8A 4ED9A 3BZKA 3FNGA 5EHGA 3KCQA 1GARA 2A5YB 2VK4A 3D7NA 1ADYA 3A70A 3LAWA 5IABA 4DAOA 3N8NA 4BDTA 3H05A 4NHEA 1J0XO 4QDOA 1XMIA 5GIPE 4J49A 4AX8A 1E2FA 1JMKC 4MV1A 3SC2A 1G63A 1WP4A 5FOUA 1NVFA 3NTLA 1L1QA 3HFJA 2HT6A 5I9SA 2AVNA 1E0JA 5LJIA 3T1OA 4KZKA 3IHKA 3WA7A 1OH8A 3A6KA 3PVSA 1C8LA 9ICJA 1EUCB 1NW5A 3IRUA 1QHIA 1UMCB 1S0VA 3ROZA 4K6KA 4EGJA 4BRWA 1OLSB 2HOQA 2O3QA 3Q9UA 4BB6A 5KSOA 1EDBA 3FPJA 5BOLA 2C4WA 3WZLA 4QOEA 4H7DA 5T67A 4L5AA 1HYGA 2VP0A 3ZZNA 1VJRA 1EUDB 2YJNA 1NATA 3A1TA 5L3SB 1F60A 2NQ2C 4CKCA 1ZEMA 1XXHA 4BLVA 2CGEA 2ZIUA 4B3IA 4YP6A 1DC4A 4ECTA 3Q7EA 4WBNA 3LHKA 2Z98A 1FTGA 1XQXA 1KY4A 1G38A 4B0PA 3PF8A 5FI5A 1ECCA 5CT4A 3DM5A 1CE8B 2J6IA 4L2IB 3QVMA 4KYIB 1YA8A 3FUXA 4BLUA 3LP6A 5LCXA 4Y2VA 4EPRA 1HIWA 5CG2A 2RHDA 1TZCA 3EVZA 1LNQA 3PJFA 3WZMA 1FXUA 3HXMA 4UFPA 5HVNA 3HNRA 3JPNA 4B7ZA 2DULA 5JG7A 2QQEA 1L8AA 3KT6A 2XBLA 3ZWVA 4O0LA 4OMDA 2X0NA 4DSZA 3OCUA 2G9NA 2REQB 4KLSA 3JPQA 3JQCA 3GH3A 4DIFA 2MDTA 3AOEC 2XMCA 2GVNA 3ZHBA 5DP2A 2AJBA 1IHXA 3ZIDA 1XHLA 1JE0A 2JLUA 4J0HA 2RH8A 3ZDZB 3L8YA 4CIBA 3EXEA 1P5JA 3DE6X 4BO8A 3DCYA 4OF4A 2H1OA 3BBLA 3BDAA 1QKKA 4EG8A 4JROA 2A3VA 5CDFA 3VR5D 5FJJA 4PHPA 2WAOA 1VG1A 4D9HA 1KSGA 1UQRA 5KNDA 4OB6A 2HWXA 4RXMA 1JHAA 4GPEA 2PZMA 3VMFA 3OU2A 4RU1A 1RWPA 1C9JA 4F6LA 5HZGA 2B7LA 3NVKI 2HWUA 4X6UA 1T1RA 5HKBA 4CTOA 4A10A 4QG3A 1E4VA 3RS8A 1SD1A 1I9CA 1XHEA 1BPDA 4MEBA 3WJAA 4AUKA 2IHYA 4DIDA 3A11A 1DBQA 1Y1QA 2J08A 3K35A 3F2IA 1QFMA 2QE6A 1OKKD 1WB9A 2NV2B 2QAGA 1E2BA 4BN4A 4Q3AA 1NVVQ 4XD2A 1XP5A 3DF9A 5JDIC 2GF9A 1Y3BE 4ID3A 4P4NA 2X13A 2F64A 1N5WA 4JEMA 2Q28A 4WK0B 1GN8A 1KAEA 1IB0A 5EHNA 4R64A 3IUMA 3TAPA 4E1BA 2GO7A 2VZ8A 3R44A 4Q9AA 1R3DA 5GONA 1T43A 3WDKA 1RRVA 2FZ4A 1TZKA 3D3NA 2EBWA 3E9EA 3UH0A 3N7PD 2W48A 3T5TA 3HVRA 2HADA 3P5SA 1OX4A 1S10A 2ZKLA 4IQGA 4AK9A 1RE0A 4BUZA 3D4OA 4K2AA 3TEMA 3PRJA 1KBZA 1ORRA 4P4LA 3FAKA 2C29D 3P52A 4BN0A 1EE9A 3W05A 1JIXA 2GPAA 3CNEA 2WD7A 1VIMA 5AWFC 4ZO4A 5G1NA 1KDOA 4CM9A 3MCUA 3FWYA 1UWKA 3LJKA 2FSVC 2YOGA 5EQFA 3PO4A 3GPLA 3UJBA 3GFTA 4N12A 2D1YA 4CM5A 2CNWA 3HJGA 1WF6A 2SHKA 4EB3A 5B7PA 2ZSUA 3PWTA 2B69A 4PTLA 1JU9A 4QYIB 1GKYA 2BELA 4F7DA 3UV7A 1A7KA 4AMVA 1PR6A 1KSHA 4Z99A 1ORHA 1QS0A 1KYXA 1GUBA 2YHIA 2HU2A 1L8XA 1LDEA 1KH1A 3L41A 3O8RA 4MITA 1SURA 4US8A 4U8GA 3PNOA 3HKCB 3H9EO 7ABPA 1U6KA 1QHGA 1IPFA 3E2MA 4BMDA 1VKHA 2JBHA 3E23A 1EX9A 4FW8A 4MW2A 3IB6A 3BD7A 5K3OA 5KOHB 2QL9A 1ZIPA 5AVRA 5AI6A 2IQ5A 2JIRA 1ZHFA 5KAFU 2H4WA 3HKEB 2R6JA 3PWSA 3L4BC 2WUEA 4X1YB 2MINB 5CT8A 2LYHA 2ZWVA 2WVJA 4P2HA 1XD8A 1H3EA 1W6RA 1ZA1A 2CLOB 1UDBA 2JIZA 2OAEA 2A94A 4UMEA 7REQA 4C2BA 1OQAA 4FIZA 4C8NA 1ULAA 4H16A 1GA1A 3R24A 1YK0A 4AS2A 1I2BA 1QE3A 5K4GA 4JLPA 1EDDA 2JRZA 4RULA 5K09A 5HMMA 5CVDA 8ICZA 5AVJA 3DOJA 3FMGA 2JFNA 4NXNB 1UBNA 1E2HA 2QPAA 4JVLA 3GLVA 1CYDA 4MGHA 4HQ6A 4A3SA 1Z6YA 3NH6A 4D9FA 2H0RA 3RYFA 1Y6ZA 4IRUB 2YFYA 4KPUB 4QZEA 3JAKA 4NL4H 1ZUHA 2WSSD 1QYDA 4QYTA 2JLSA 3LCUA 1VKJA 5FHRA 1M2WA 1ZQBA 3PD7A 3AG6A 1NBME 4LZGA 4GXIA 2X0EA 3REGA 5KMGA 1KSJA 3FHJA 4IDCA 3WYFA 5JJKA 1OXMA 1YOVB 2PFKA 3ILSA 1EMDA 4YAUA 1MO5A 4R83A 2GN8A 3W77A 1DZ3A 1VJDA 5KJ6A 1AS3A 5K3SA 4FC6A 4QZFA 2HCBA 2OA0A 4FBTA 1O57A 2DQYA 2YWHA 5HIJA 1N5MA 1G7SA 3IIKA 1TNDA 2OGWA 3A7EA 1ECGA 3PNPA 5JCOA 9ICAA 2BPOA 5F2KA 1BJRE 3EIFA 4CT0A 4DLNA 1YJCA 4DV1B 4H1WA 3T3EA 5CMLA 4ZGWA 1EFTA 2NO6A 5M29A 1E32A 1OLXA 3M6UA 5IDYA 4HX5A 1UKVY 5K6AA 2IXBA 1O6ZA 2ROQA 1D1TA 2FDRA 3SYKA 3KAKA 4NPHA 2D54A 2ALJA 5JCPA 5FQNA 2C3YA 3IIJA 2VDJA 1HFWA 2I99A 2BOVA 3VH1A 1PUJA 1UCVA 3NXSA 4FN4A 1X7GA 3TNJA 4LJ6A 1JDUA 2VSQA 2H1IA 2V03A 4LKRA 4GLJA 4RHTA 2ZSJA 2BM0A 4AWAA 5I47A 2AD5A 3QA9A 1O77A 2GD6A 2H11A 5JZBA 2GX6A 4NY1A 1PJ8A 4G24A 1J8YF 1RRFA 4PGAA 1NRJB 2OB1A 3V4OA 3LD9A 4QWAA 2LNDA 4CCHA 4FYJA 1EK6A 5BQ5A 3AUYA 3E9RA 2C42A 5M2QA 2PJRA 5IHXA 1Q1AA 2YBEA 4QICA 4NBTA 1TV9A 1GPKA 4FEGA 1I94B 4I1PA 1S77D 1WQ4A 2QLJA 4TQ9A 4W9RA 4YRLA 1PV2A 2DF4B 3D7LA 1C3VA 4RZRA 7ICGA 1TOAA 3L8CA 1NK8A 2B8JA 5J0TA 3EC1A 5AK0A 2G1UA 4IDFA 4O4HB 3CNNA 3L18A 4JYPA 4KLFA 4A7PA 5DI3A 4BMOB 2O20A 1FIUA 4RZIA 1QGED 5NLLA 1R4NA 2CNNA 4YR0A 2DQSA 3OZDA 2E6UX 4Q82A 3G0DA 1UEIA 4AF7A 2AOXA 3ADDA 1FZTA 1CJVC 3E7FA 3KUUA 4B1FA 3UT5A 3EXHB 5MF6A 3ORHA 2MSLA 2HVIA 4UE6A 3MRSA 1FEZA 2PLAA 2CW5A 3MGHA 3V8VA 1MA0A 4OJLA 3DP9A 2VJQA 2H57A 3G82C 1Y3IA 3RJTA 4K81B 3ESQA 4ZEOA 4G8CA 3VR2A 2Y6UA 1XCMA 2P66A 3FVTA 5J63A 4EAQA 3D4NA 1P2BA 3IO3A 1ZGJA 3LDUA 1WVGA 4FN5A 3PQEA 4B81A 2FPLA 2CNKA 3DEFA 1FLAA 1Q16A 3RVLA 1U6IA 3LXUX 2MJLA 4EHKA 1I3CA 1XEWY 1OXUA 3TL3A 3VH3A 4ND2A 1VP3A 1GGVA 2Q6KA 2XWPA 4OHRA 2I54A 1V9LA 2FX3A 4X6LA 1JHQA 1KJQA 3C87A 2HRCA 3TKAA 4NENB 4H7JA 1DCKA 3F74A 1QNLA 3BXHA 2N3ZA 1ADJA 4I2JA 5HHHA 4QZCA 4MK4A 3AY6A 5EOVA 4WFIA 1Q6ZA 4KDRA 1B76A 2W54A 4N65A 2DGDA 4BDPA 2A57A 4IDGA 3B20A 2RH9B 4C7KA 5B2EA 4EB6B 2RI1A 1VBFA 2HOFA 1O54A 3N07A 3R2JA 4J9OA 1U0EA 4QJ4A 2XQJA 3OPXA 2VAMA 5CX1A 3IR5A 4PC7A 1G21E 1XCOA 3JPSA 2EJVA 1JECA 1CEEA 4Y2QA 2V7PA 2QJOA 5LUAA 5TLSA 4HQNA 4BCBA 4WOJA 4B7CA 5F5LA 3W8EA 1RZVA 1W44A 3E4DA 2YYAA 1VHTA 2KX7A 1PT9A 4FK8A 4S1PA 1F5SA 2DBQA 2VF7A 3ZWNA 3EIXA 1XG5A 2D6FC 3OEWA 4LJ8A 1GITA 2P5YA 1Z12A 3JQRA 3MFIA 5IZCA 1WDTA 2QVCA 1RM6C 5AM5A 3EZYA 1UFVA 3BSFA 3MAAC 2J46A 4QU8A 1KZHA 1BC5A 2EFEB 4MYTA 1VP9A 3AK4A 3TADC 2PMWB 1JLHA 4BKPA 4KO3S 4JEIA 4CMJA 2BWJA 5H8WA 1ZH0A 4B9EA 3CN9A 4BTLA 3QKSA 1A96A 1R15A 1ZH8A 1KAHA 3PHLA 4H3KB 3G02A 4P4PA 2JHCA 1V8FA 2IC5A 4LJXA 4L16A 1L4LA 1ZMTA 4CT5A 9ICLA 1R0KA 3EWAA 3KTFA 5D1NA 4YJ2A 1RXUA 4YTEA 3OKAA 3R7BA 4LF5B 1B22A 4QNLA 1CC1S 2OT3B 3HH8A 4OB8A 2DZDA 4X95A 4YT8A 2CXTA 4F5WA 2GPWA 5IVPA 2KZZA 1M1NA 4JQOA 4LMPA 3THVA 3P9CA 4J9NA 1I7LA 2OR3A 3NV7A 3AJEA 3UGJA 1SKQA 3WB9A 7ICHA 1ISJA 2BPCA 2KS6A 5DSTA 1FFEA 4E0DA 4B4OA 3PHJA 2JGIA 5JMTA 4IMIB 4YK7A 3DXXA 2MSCB 3PENA 4CIAA 2Z4SA 1RLIA 3KQOA 4TKMA 4QZVA 4X9XA 1U99A 2IL1A 3L4KA 3DHWC 3MWKA 3T79A 4RIEA 1XTQA 1JAHA 5AM1A 4HPWA 5ILOA 8GPBA 1ZQAA 1OFVA 2VPTA 4C6SA 4PPYA 3DBRB 4LISA 4J9RA 3HJRA 2KKVA 1AHIA 1N4AA 4NZPA 4C5BA 2AQIA 3M8RA 1IJKA 4S1TA 2WNSA 9LDBA 2D0DA 5ENDA 5SY6A 3BEDA 5TR9A 1AQLA 2F3TA 5ALIA 4HWRA 4N1AA 4L28A 1EQUA 4Z4HA 4WZAE 4I55B 5C4IA 2LW7A 4WLOA 1RYDA 4PRLA 4ARZA 1WDKA 1JEQA 1G59A 1RBYA 2HM7A 1L7PA 3BMNB 4BV8A 1RWMA 5CNMA 4CNBA 4X64B 3ZBUA 1CJTC 3LXMA 2B4QA 1C29B 2QZSA 1T2DA 4PSAA 2CZQA 1O6CA 4LF7B 5CA7A 1M1UA 3GDXA 2QORA 2P6NA 2CY0A 1QQ7A 1T5LA 4CDNA 1IE3A 3GN2A 2OYCA 4DIKA 4DLKA 3NWEA 2ZT7A 4C0HA 3D4BA 3ZHVA 3M9XA 2HA5A 1NGSA 3NNNA 4PSKA 4OP2A 4QWWA 3L93A 1SRQA 2XYRA 4ROTA 4JVMA 4M0LA 5J4YA 3EDMA 4L6AA 5A5FA 4QXRA 3ZYZA 2G8LA 1T1EA 2F1KA 3LY9A 2VK1A 1SKBA 2X9VA 1CY7A 4ZA2A 2JJ1D 8ICFA 1P9OA 3GLIB 7ICMA 1YJAA 3JQQA 2BMFA 3P5BA 4D0GA 4AYBC 1TCUA 2G71A 4AZTA 4A16A 1DJNA 2WZQA 4Q9JA 1C0PA 4P22A 3LS2A 2RCNA 3R9XA 3BWDD 5E7JA 4IJQA 4IV5A 1ZGAA 2BFFB 4XWTA 4XYEA 3B60A 2GJ8A 3F2BA 2VPZA 4JUCA 2ZIVB 1U2SA 4BBPA 2PUTA 1SV0C 3DLPX 4YP7A 1K6IA 1R27A 3IAAA 4TMZA 4N7RA 1BMFD 4Z51A 3G8BA 1QVRA 3FGNA 1PT6A 1X94A 5IANA 3ES9A 1HDZA 4D9BA 2O5CA 3ACDA 1JKIA 3O31A 3WLMA 5LZ4A 1NWCA 5IVHA 5JAHA 1QLHA 2AR7A 4CTJA 1JJBA 2QP4A 1NASA 3PX2A 3LUBA 4YCMA 2L42A 1QH1B 4DCUA 4GBGA 3K2IA 1TJ3A 4X71A 4CF5A 2C2HA 1N62A 3ADPA 1L5LA 3K1JA 1MA7A 3TMYA 3F73A 3QUSA 3UXYA 1MBZA 3Q2KA 3RIEA 3MXOA 4DCOA 4QUAA 5AH0A 2YOFA 3OZIA 4AY4A 1GTG1 2I2XB 4C7JA 4IIVA 4HGNA 2XGMA 2R8PA 4JJ6A 3WRWA 4D57A 3NIDB 3AERB 5HE9A 1QHSA 4ZCLA 5AW7A 2PRIA 1SHTX 4MIOA 5SYMA 4I4IA 4IGKA 3L4PA 3KL2A 4A73A 3QEBZ 4NPCA 4RHUA 4ED3A 2V5VA 2V6JA 1NT4A 2DH5A 1LBQA 4YAOA 1U7WA 1CFZA 4GPAA 3KEFA 1LTHR 5FA6A 2JLXA 2OZLA 4DSIA 4IYJA 3HDJA 3DCNA 3WL4A 4FDMA 1QR2A 3PUWA 1GTSA 3DUWA 3UMBA 1II0A 1Z6ZA 4L75A 4XA8A 5KX5A 2Z8ZA 3UJDA 3DLTA 4D97A 4M2LA 1VJ5A 2Y8EA 2IBSA 4BKMA 3H2KA 2NRWA 3V97A 5AQ1A 4FR2A 3DOEA 1GPUA 2AJTA 3SS9X 2DPIA 5DXJA 2YIJA 4JQYA 3U62A 5K4AA 3VOTA 4DPMA 3VPFA 4P58A 3PPWA 3T06B 1FX0B 3G2QA 4E51A 4G01B 2VYCA 1KEZA 2QJWA 4BTVA 2VNJA 4XRGA 4MQEA 3A1UA 3QBTA 3O4HA 1V4NA 8ICKA 2AFHE 4IH9A 2OL4A 3GRZA 4C4YA 1JILA 2E2WA 4OQMA 2IZOA 4P7GA 2F8KA 3BTVA 3SDZA 2YWEA 1TE2A 1D1SA 3QKRA 4HLNA 4GR9A 2V8OA 3T5LA 2CEKA 1TQHA 2WIJA 5CH5A 3W1VA 4M4SA 2PYZA 4EGAA 3EZ9A 4JY7A 2IE8A 3H2ZA 3T5BA 1JYFA 3SS7X 3ZQ4A 4UUBA 3QX9A 4AMBA 5D00A 2HHQA 3DM9B 5EE5B 2V4QA 3VR0A 2H9YA 1KEJA 4GPTA 5BR1A 5GJBA 4OAOA 3IB3A 4OV6B 1MQSA 3HBLA 1KF0A 4IX9A 4N7JA 3ZY5A 1XZCA 2PV7A 4ILEA 1MU0A 4DWJA 5C52B 1YQWA 2ZB4A 2DGZA 1Y88A 1NU6A 3ACCA 4O3QA 3VJRA 5JSYA 3B53X 3HWTA 1BXRA 4DA0A 3EW7A 2G40A 3P9XA 3E3MA 3JQGB 1RQXA 1T5DX 1YRYE 1UKBA 3W9UA 5K9ZA 5TARA 1ZM4A 3IN5A 3NH9A 2CXPA 2WTNA 3T9EA 5KFZA 1YI8A 1BWPA 2HHHB 2P3SA 4O63O 1CQIA 2PIDA 2RIPA 3PI7A 3NBKA 4KTQA 3E0QA 1ZDMA 3RYCA 1M8KA 4M9NA 4I4CA 3T3IA 3TRHA 3EF3A 3DDHA 4QUDA 4DTIA 4IEIA 3H7IA 1KORA 4EHHA 3MS4A 4P0TA 1C7RA 7ICLA 8ICHA 4IR7A 1JDBC 4N9QA 3VUFA 3BD9A 1V1MA 2IV3A 1A9QA 4J0KA 5ADWA 1CLUA 3L6BA 3RDPA 2ZYWX 4F4IA 2QY9A 4P1ZA 3UGKA 2PUCA 3X1WA 3AFMA 1KOFA 4G84A 4MUAA 3LVFO 2QNIA 2J4CA 4C7YA 4L4UA 3GJ8A 3RC1A 1JNYA 2GZDA 1T0IA 3I9NA 2QN1A 5DBIA 4ZP1A 1OOEA 3DTNA 3HDYA 4YC7A 5KCMA 3BWCA 4YUWA 8ICBA 4RKFA 1TK2A 3DAFA 3NIGB 4KKXB 2RK4A 2J3LA 1AS0A 1U0HC 3MR6A 2C5SA 2XTZA 4RZ3A 2W6JA 1MAAA 4FW9A 2HLDA 1JLKA 4RNOA 1PZEA 1SY7A 4M2YA 3EYAA 3NDBB 1PGPA 1E2LA 7YASA 1P3Y1 2OXFA 1KMNA 4E22A 3OIYA 1HDGO 1TVKA 4JR1A 4GX0A 4B3DA 3DFZA 4NBWA 4Z3KA 2G06A 1M8GA 1DBIA 2FSFA 2V7TA 3FBGA 3LF2A 1FFBA 1LQTA 4KEAA 3KLNA 1XPOA 1HI9A 2OZEA 3K0SA 2BP7B 1J0DA 1MC1A 1GP2A 1XSPA 4ZQHA 3O1HB 4FDUA 4LDNA 1WB5A 1TCBA 4ADSG 4US2R 5C4GB 1F6WA 3CR8A 2V6FA 5B1EA 1CR2A 1TYZA 2BFMA 2O3TA 1QZ3A 2OYYA 5C81A 2J9FA 1T34A 2R4TA 3IQZA 1H4QA 1CF2O 4IXWA 4P98A 4Q4LA 5FOTA 3JALA 3LLSA 5D5PA 2J3IA 3ITKA 4B6SA 1NG1A 4WXRA 2ZDGA 3RFAA 1J22A 2VHTA 2C4MA 1XAGA 2E5LB 2A4MA 1T2EA 4O4JB 2JIMA 4DA9A 3QOXA 1R0RE 3E2PA 1CP3A 2E4WA 4J76A 4Z49A 4GSYA 3IT3A 3WLQA 5JYBA 3RBAA 4MDHA 3VNRA 1FFYA 5MN5A 2FH5B 3L7YA 1N63A 3GJ6A 3EMVA 5L7YA 2E8NA 1GYPA 1DVRA 5J8YC 4PWZA 1K6XA 5K0LA 2V8BA 4TTSA 3DMNA 2Y0SC 3PZRA 3DKIA 2RG1A 1DXSA 1RACA 3K9BA 2A0YA 1F7VA 1BDJA 8ICUA 1GU0A 1UQUA 4O4HF 2HGZA 2VAPA 1Z08A 4H3VA 3PJRA 2HO5A 2VWQA 1NR7A 4Y98A 3VOSA 3HXPA 1KAGA 5DMHA 1G3IA 3N6VA 3BXEA 2EANA 3MERA 4V0RA 1X1SA 3KG2A 4UTXA 3OKCA 1BG6A 4BJ5A 2ZM5A 4UCQA 3WI7A 3VM6A 2PKCA 4N0DA 4CV0A 5KWVA 2G83A 1NZFA 4GYJA 3QPCA 3A31A 3MFHA 4R65A 2JRLA 4XB1A 4XAQA 1NLMA 4WXYB 4A8JC 1QGYA 3B1FA 4KO4S 3IQIX 4ER0A 1LF5A 3REFA 2OHXA 3AR8A 3RANA 2VJDA 1X9WA 3LSTA 4QARA 4BIIA 2O6LA 1EUYA 1NP6A 1ULSA 5JW6A 2F1IA 4TZKA 2GT1A 2QG6A 1VSUA 2WUDA 4D43A 1D6MA 2GDZA 3ZDQA 2IXEA 3P9IA 3X44A 4YQZA 1FX1A 2F3SA 1K75A 1KWKA 4X3CA 2G1KA 2AN3A 3QKIA 2YMQA 2DC1A 2BZSA 1C4WA 1US8B 3GB9A 3INRA 3J81k 4HQ0A 2HHCA 1P9LA 3I9KA 2MA1A 2R8XA 4EDFA 5IP5A 5J2HA 2IOHA 3TAXA 2QV0A 4P3NA 4GF5A 4OMUA 4OQLA 4Z6DA 3LT2A 4K86A 2H54A 1PJBA 2BKEA 2JGDB 1ZJMA 1XWFA 1NJ6A 2B61A 5EXEA 1Z4PX 2QT0A 1AZWA 4BWVA 5TV2A 3I72A 3HYLA 1SG6A 5ALVA 1I51A 5ARCA 2VHYA 4PQRA 4E15A 5IAGA 5FFFA 3JWIA 2BDEA 4K6FA 1JLLA 2GDJA 1UFKA 1XS9D 4C20A 5K0NA 2RONA 1KEKA 1GG5A 3WK9A 3ZE0B 3C97A 2EG5A 1JR3D 3GI1A 1GRVA 1E1MA 4X6XA 2OXIA 3U7GA 3J81j 1Q0UA 1HLGA 2ZOSA 4ATNA 3N8GA 2Q8PA 5CFZA 5I9NA 5C7LO 1JFRA 3A6JA 4QXQA 5AW3A 1SCUA 5K8UA 5KIAA 4ABTA 1QK5A 3JQAB 2RBKA 4MEJA 4PVCA 9ICCA 4BX9A 3H0CA 1I14A 1RM5A 4I5IA 4NU6A 1AKYA 3D6FA 1Q19A 2J33A 5DGIA 1SXJE 3UPTA 1ZR4A 1HEIA 5INTA 1Y4ZA 3KXIA 4W1SA 1YOBA 4LKOA 2Q29A 4WZ6A 1PT5A 3WLAA 3CLKA 2BGJA 3I04M 1OWOA 1YZUA 2BCVA 3IDSA 1K5OA 4EI8A 3K72B 4TL9A 4ZALA 4MEXA 1DAGA 3R3WA 5TF0A 1S89A 2C1ZA 5EWGA 2R66A 1DQRA 3C5FA 2FPKA 3M5PA 5IM4A 3K70C 3HKDA 5KYWA 2FWIA 5FKJA 4GUDA 3ADCA 2YMMA 2Q0SA 3EZ2A 1UQVA 4K9SA 3AJDA 2NPIA 3JQAD 3IRVA 2JRCA 4BVJA 3AEKA 1YS6A 2R6HA 2CN1A 4QLAA 4ZOHC 3QPDA 2EBFX 5DK6A 1WPXA 1QTMA 4Y2YA 2XY4A 4AYWA 1YC5A 3O1LA 1XVTA 4C06A 3OQIA 1KY5A 3W04A 1MOPA 4J9UE 3N5CA 1IXRA 1GD1O 5AK4A 4EPTA 1R0LA 4NE9A 1YS9A 2QGFA 2N1MA 4DLGA 4BJ1A 5KDOA 1CEYA 5HFJA 3Q1KA 4HRXA 2PGIA 4DWOA 2XMZA 4B8ZA 3FTNA 2A1UB 4ND8B 1YFLA 2F4VB 4MVXA 3WGMA 3V3TA 1NUUA 1JP7A 3EGXA 1GUFA 4ZZ0A 2AJ8A 1PVOA 2W22A 4C8OA 1ZRHA 3Q3CA 4LV5B 4HXFB 2HLHA 4BO1A 3LBAA 1XB2A 2KLHA 4I55F 2IX9A 2GK3A 3RS3A 2XCUA 1YVPA 4EO9A 1DIAA 1M10A 3BMOB 2DBZA 2D1RA 1F2DA 3WL8A 1D8BA 4BP3A 2Z1DA 3W4IA 4RIHA 5JANA 4DF3A 1Z0JA 2K8BB 2ZUEA 2EX0A 5LLDA 3AH8A 4TS3A 1W0KA 1VA4A 3TGPA 5B3JC 4F3RA 1P72A 4G4GA 8ICOA 3EUEA 8ICPA 2W4QA 4D4HA 3NHBA 3PF9A 1PVDA 5FTKA 5JAZA 1QUFA 1L4UA 1IZ9A 2HF7A 1YAJA 4DF8A 5ULLA 3EN0A 4DSNA 4R7GA 1ZQ1C 4OQXA 1YV9A 2SCUA 4YAKA 3JD4A 4LZOA 4UAGA 1TLLA 2JL1A 3L0OA 3PEEA 1AU9A 1DCFA 3QKTA 4XQEA 3AEUA 5KNBA 2R8ZA 1JEDA 2WIFA 4U39A 1S2GA 3AGQA 4RE6A 5AW0A 4OM7A 3HO6A 2N46A 3MWDB 1X14A 3HK2A 1E0DA 1DGJA 3D81A 4H18A 3LVQE 1XYYA 1XXHE 5BN5A 1N7IA 3H6KA 3N2IA 2G6TA 5JV5A 2IY7A 5A0TA 2K4EA 4L7VA 3QMPA 1EP9A 4DUGD 2XUFA 3ESCA 3A4TA 2R5NA 3QEOA 1E99A 5D3KA 3ZN2A 4JMLA 1ZQUA 1KPHA 1Q77A 4DSFA 3TL2A 2FEKA 5ALDA 4RMHA 4RESA 3ISBA 4JV5B 1RXYA 1YZQA 4Q4AB 4NLGA 4GMHA 4ND1A 1DINA 1Z83A 3QH4A 1L3IA 4QD3A 4YMUA 1XDGA 2ZJ6A 2IDMA 3QUQA 3GLTA 5FBZA 2BEJA 4QDUA 4EIWA 1KE1A 4CLOA 1R6VA 1XI2A 1F1BA 5ELMA 1RYBA 3BMXA 5H9WA 4LMAA 2X40A 1JFSA 4P7FA 4Q03A 1X0VA 2NU8B 1S8NA 3RB0A 3LUGA 4NDAA 4KLQA 5CAEB 1VDZA 4I3FA 4EHAA 3P71T 421PA 3KNZA 3TOSA 5CDFE 2WSYB 2A58A 1DLJA 2G9VA 2H5JA 1ZSNA 2J6HA 2GVDC 2BFBB 1J7JA 1KOGA 2WWVD 1DEKA 3LL7A 4C8KA 4NJEA 4JLMA 3RK1A 4RQ0A 5D86A 3PC6A 3L92A 4HHEA 5JADA 2RJNA 4CQJA 1X1EA 2XO7A 3WQSB 4FFPA 2VA2A 1VLJA 3BUSA 5B53A 4RPCA 4G1UC 1F3OA 4M8SA 3K9CA 1ZC4A 2GXUA 5F2NA 4LFAB 4ECVA 4I66A 4S1NA 3B2NA 3DOUA 2VHQA 5CD9A 2ATLA 4KN8A 1KE2A 4YHBA 3M33A 4RT2A 3TBKA 1GY8A 2R48A 4I6GA 3SFVA 3I01M 1B93A 4U7CA 1H8HA 4C7OA 1TMYA 2QE7D 4K05A 5G1PA 5KNCD 4WKBA 4CNQA 1PLJA 3UFXB 2JCBA 1XZHA 2X58A 2HMVA 2XBUA 4FI3F 5F98A 3UQYS 3R5KA 3HQ4O 2OECA 5K03A 4ZIRB 3STUA 4KN7A 3EK2A 1G8MA 3DAHA 3A0RB 4YXWA 1W0JD 2FSPA 1OIWA 4J4TA 1QCKA 4CUJA 4DREA 3SYZA 3L07A 3NWJA 3V48A 4A8HA 1DWUA 2FWBA 2XVMA 2HQRA 1YB1A 2E1FA 4C76A 1XQ1A 4ALJA 1CUKA 3J81A 1C7EA 2FQQA 1V25A 2FW1A 5FF9A 3TTUA 1GQSA 5JPCA 1OZGA 1C9EA 1FB5A 2VPPA 3A2NA 1GPWB 3GDGA 5K3DA 3QWHA 4PC2A 1YT5A 2DUMA 1SC1A 1U9IA 3DTVB 4F6RB 1CTQA 3VR3D 4PZEA 1GTZA 1PK7A 4ZMSA 5BNWA 4ZO7A 2YFQA 3BXGA 4TXMA 3LT1A 1XL1A 4K4IA 4REMA 5IAAA 3RM3A 4RXUA 3DCJA 4KMRA 4IJKA 5KVVA 1TUIA 4QYXA 4O6VA 4HF7A 1NDQA 2IGBA 2FMPA 1LLDA 3H42B 3FB4A 3HUEA 4J9VA 5HX7A 4LJ7A 3EGDA 4RH3A 2ZTDA 3W5CA 3ZXIA 4OI0A 5DASA 1ILEA 1L3CA 2FJ6A 2P9EA 1N5JA 1GNPA 3PSIA 3GOHA 4ZEVA 5CJ2A 2JZBB 2HTEA 4LOIA 1NY6A 4UDXX 3ORYA 1U5BA 3A6PC 10MHA 4YR2A 1JQJC 2B5OA 2BR3A 1C9YA 1Y48E 1ILWA 1C2YA 2JH7A 1UKYA 4R1SA 1BKDR 1H9BA 4ZAGA 4ZDKA 3AP2A 4RU9A 1VIVA 3T7TA 3DAPA 3DTVD 1UHUA 2BV3A 1ZWKA 3SZ2A 4RUKA 2FQWA 1OFIA 3QU2A 4EUSA 4AZ0B 1JS1X 2O0MA 3P4YA 1AKRA 4ON9A 2WKQA 2ECPA 1UZNA 2ZTMA 4G07A 3UB3A 2XUQA 3GRCA 3MXTA 5G2OA 4D9CA 3QV1A 4KPEC 2HHAA 3WIEA 5JS7A 3VH4A 4QE3A 2IY9A 3NRZA 2L18A 1WMEA 3EULA 2JKYA 4ZYVA 1U1IA 5L1LA 4B9VA 9ICBA 5KT5A 3VKUA 1PZNA 1E8NA 4GH5A 3P0EA 2FPUA 1Y6JA 3ZQJA 2WPDA 5GIOE 4QPNA 3ZIAA 5I8WA 4KMOB 1NUTA 3CLTD 1RHRA 4NLLA 1K4MA 3PGA1 1L9KA 3AF5A 2ADMA 3MQ4A 1DKLA 4RVOA 4R7TA 4BYGA 1FK8A 2YQZA 2OQVA 3DMDA 4LRUA 1NNUA 4WK6A 1LFAA 1S4MA 1KJZA 1CK4A 4LV6A 1OB5A 4B5KA 2R6GA 4LNHA 3RT9A 4EJSC 5E7IA 4CKEB 2CLCX 1G16A 2X6TA 4OLFA 4BRZA 3OZCA 2BDPA 4WI1A 2ZW9A 3REQA 1DO2A 4DIEA 4AL4A 1QRDA 3JPOA 3JASA 2NSYA 4CF6A 1AO0A 2VPYA 1RHUA 4L8GA 3V1KA 2CUKA 3CQ9A 3FLMA 4FJ2A 4IFIA 1D2MA 1N8TA 5BOMA 3FUWA 3TQTA 4JP3A 4UPEA 1H1DA 1N6RA 1UWLA 4DLZA 4TZTA 4RPYA 3NVWA 1KJJA 3VJLA 4XKJA 4PZDA 5A4AA 1LX6A 1ZXBA 4GR4A 4LJAA 5BYBA 3QNUA 2OG1A 2AN4A 1TYDE 2B20A 3QLEA 3PUKA 1OBOA 2VBFA 4DSKA 1E8MA 2DSNA 3SVTA 3WXBA 2VYQA 4O4JF 3DZIA 2NGRA 4RACA 4BMCA 2BZ0A 1KO4A 3ZS8A 2JEJA 4EKNB 4ZQCB 4NCXA 4CMAA 1BAPA 4CL3A 3AESA 4J9KA 1WCNA 4QHTA 4RF2A 5BN3B 3TTVA 4LZPA 4OREX 3BN3A 3OA2A 2JLAA 4K9DA 5LVAA 4UB2A 5ALYA 1P2DA 4PC3A 5FYDA 1CUHA 1DV2A 1XLTA 1OJLA 4UHFA 4DWWA 3KZOA 5JROA 3GVCA 3FNFA 1K68A 4IHJB 5EP3A 3H0EA 3MGCA 3STWA 4EY8A 2ZE7A 3FNEA 1A0PA 2Y1JA 4UAVA 3RRMA 3QFTA 4P35A 3NNDA 3EPIA 3DONA 3UCFA 4QZGA 3FWHA 1BXZA 1K7FB 1MOSA 1NC1A 2IYRA 3FNIA 5KSPA 3TOCA 3OICA 2ZTCA 1M8FA 4EFLA 1XDZA 3P0IA 1RIIA 4W5TA 4LHWA 1U8AA 2IU6A 5DZSA 4O3FA 2B5VA 2YJ3A 2H0QA 4P4OA 1G6OA 3ZZ0A 4NPAA 1SVIA 2H63A 3KOMA 1PJQA 4Q4DA 3AT1A 1O97C 5KQGA 2AFIE 2V7UA 2WHRA 2ZBGA 1ISSA 5CGZA 5HKKA 2C59A 4DY4A 3LYLA 2JI6A 4X41A 3FN4A 1GEEA 1P4RA 3CB2A 3TUJC 3B12A 3HB4X 2R7MA 3T6KA 1UOEA 3TOZA 2XR1A 4LVOA 4B9MA 3KRTA 5HS4A 1ORWA 3IR7A 3C1OA 3UUWA 3H5VA 1G6HA 1Z3EB 4D7AA 1M2VA 1PI3A 1Y5RA 3HR8A 5HMLA 1WB4A 1PR0A 1RTTA 3PZBA 5KG1A 1GA4A 4NR0A 2J0UB 2ONYA 5HF8A 5JSKA 4CBVA 1USUA 1Y4UA 1RXEA 1QIFA 4TQUS 2HRZA 2OM6A 1JALA 2Z5LA 3SYLA 3U17A 1GSHA 2QX9A 5L3QA 4UXHA 5ECYA 4MP3A 2YJ4A 3I8OA 3FYUA 2GR9A 2Q3JA 4K3UA 4G4IA 3EJ6A 2ZI3A 2B2XA 1UXGA 4OVKA 5BMVF 1DOQA 3FOFC 1SQ5A 1RJGA 2VT3A 3NFRA 2O5RA 3N9IA 2BISA 2I4NA 2OQRA 9ATCA 4Q00A 5TJ9A 1NKSA 2JDIA 1Y7TA 2Q5LA 4UCFA 4U0KA 1C4KA 4V0NA 2YCBA 1UZLA 2KMLA 3HB7A 2HL6A 4JXJA 3WLKX 2IYYA 2GZHA 2UUBB 2YC2C 4GGMX 3OT1B 1KVSA 3GOQA 2WYWA 2VQEB 4D6YA 1NVAA 3OFVA 1G7RA 3UWSA 3TTWA 4MEAA 3JXEA 5LP1A 1CF4A 3MCZA 3RT1A 3MINA 3MOIA 5ALFA 4RQAA 4PYNA 4D9JA 4S04A 2NVWA 4AICA 2PZEA 3VC1A 1UM9B 4IICA 2CMHA 5ER9A 2HDNB 4CM4A 4QWMA 8ADHA 4TKZA 1UT5A 4KODA 4MV9A 1RS0A 1WCXA 3S2EA 1L1EA 3GRPA 4EJMA 2WY2D 4HNSA 1QQ5A 2G5IB 1QFYA 1IUPA 1Q0LA 3PL5A 2DY1A 4NVRA 3NHUA 1TAMA 3C1ZA 3GEMA 4LY0A 4Q21A 3KIPA 3URKA 5H7XA 4XDGA 4ANFA 2R9VA 3IELA 2OSBA 1NZPA 8ATCA 2XGJA 3NM4A 1FFWA 4EYQA 5DBGA 3RR8A 6ABPA 1YS4A 5EP4A 5AJUA 1E5XA 4H7PA 2QZZA 2GLEA 1QGAA 2AFIA 2X23A 2F3QA 4R8UB 1MVOA 4FU0A 1V26A 4D8TA 1YFJA 4UU7A 1V8OA 1T2VA 3AIKA 4EY5A 4QTUB 3STTA 1KJYA 2KMDA 1Y42X 2OXTA 4YLEA 3OZTA 5IF3A 3K9NA 4EG4A 3CRMA 4QFMA 4TMWA 2HA3A 3JAWA 2V65A 4CHGA 4NQZA 2I1WA 2A67A 1Z2DA 2NU6A 5E1MA 4A9AA 3C39A 2CCJA 3DOFA 3COWA 1MAWA 4LJ9A 2GF2A 2ZRPA 2R97A 5EKXA 2AHRA 4Q5IA 1I1OA 2P91A 1TIKA 3EQ6A 4B2IA 3GQVA 1P7ZA 2HK6A 1H1LB 2AMVA 3K09C 3CW2A 3PLNA 2IWHA 5CDYA 1RFLA 2BL4A 2DY0A 3F5DA 1E2QA 2OK7A 1QH8B 4X8MA 4YCCA 4N03A 2CK3A 1QYCA 3WTCA 1JWLA 3PDIA 4G89A 1WMBA 1U7ZA 5K5EA 2GYWA 4C8MA 4C0SA 5LD2B 4ETNA 4IWNA 2K89A 4WL0A 3SV3A 5C0OE 5F7JA 1ZQCA 1A5AB 4P80A 1DXOA 2PX0A 3PA8A 4G5XA 2RGNA 2ZBRA 4G63A 4PIMA 2VBIA 3H17A 2R47A 2YZKA 2CYBA 3QBJA 4ELTA 3NXKA 2DT5A 3MW8A 1QB8A 2PG3A 3WY9A 1YONA 2SKDA 2RHHA 1M6NA 4H6PA 3PXXA 3LWMA 1ODIA 4KXXA 4JWKA 3B8EA 4YJ3B 2HD4A 3H84A 5DIZA 1IL0A 1M1YB 4PL1A 3RH5A 4AJPA 1J4AA 2KW5A 4M0CA 5E3JA 1U7HA 5M3BA 3VDMA 4J2OA 4F3KA 1FW8A 5DB9A 2ORYA 3V7KA 2X0KA 3O5AA 1URPA 1VL6A 5HR7A 2YTZA 1N6OA 3UATA 4CU2A 5ALPA 1K3UB 4F0JA 4JX8A 3CRZA 2LP4Y 4Q15A 1PX0A 1IY9A 4Z8XA 4S35A 1YSCA 1IZ7A 2OHJA 2W7PA 2ZETA 5K0GA 4JP1A 5AOCA 1YL5A 4Z3DA 2A7XA 4IOJA 4R2LA 1L7DA 2ESEA 4KIWA 1OROA 4PYJA 3HJFA 1IN7A 4DABA 3GGDA 2X3FA 1VYHA 4HEA1 3VJKA 2PCJA 1DIOB 3D0OA 4XW2A 2I7XA 3FWZA 1KFJB 1O94A 4CM8A 1P0MA 1SHKA 2ZANA 1IRIA 1KZ7B 3RV4A 4TKLA 1QQAA 3CRXA 1QK4A 5I7SA 1KEVA 1YGPA 1UWCA 3HA7A 2OP0A 2I2BA 5ABPA 2PFQA 1FP6A 4UOZA 2BFAA 2BPGA 4RFSB 3VPXA 3H2HA 3LUDA 4GT1A 1L4YA 4QZ8A 3ICQB 5M7EA 4FBMA 4Y9DA 1NVWQ 1K6MA 3I6MA 3KAQA 1GL3A 4IRDA 4ZHQA 5B6JA 1SUEA 5BSHA 3K1AB 2IX3A 1X9SA 4FFOA 2IWRA 1NF2A 2PKXA 2WIBA 3FHLA 1M8JA 2VR1A 3HJUA 4IRCA 4U2KA 2DFTA 2AOWA 5BOSA 5CH3A 3ZGNA 3SAJA 1EP1B 4I5EA 3QTLA 4II3A 2GEDA 2RHWA 4WCFB 1HNZB 3KXLA 3MYYA 3VKHA 3FZEA 9ICHA 1RLUA 1KEEA 4LCBA 1QWSA 3UZUA 3KKOA 1ZVQA 2HW3A 4AU1A 4JD5A 5J2DA 1QMGA 5J1SB 4J16A 1IV8A 4HN9A 2XXAA 2B9VA 4PAOA 3RPEA 4S0XA 5LJLA 5KNLA 2QLTA 3LA8A 5JFGA 1SHZA 2Q1YA 4NZNA 3JD2A 3ZCVA 5CYGA 5JHGB 1LBEA 1OAAA 4C2UA 4EQZA 1WZCA 4ONEA 4WEOA 3DLIA 4P9NA 1PVVA 1KI2A 2AOUA 3M7DA 3R0VA 2C95A 1O0CA 2VA8A 5FCDA 1YRWA 1VCMA 1K63A 2J9YB 3GV0A 3VPGA 1TVEA 2YHAA 2A1IA 2B98A 5T3UA 4OKNA 5T4FA 1TTHA 5J2FA 4LJ5A 3QK7A 3KPYA 2M9NA 1NXPA 2D74A 3VTAA 5JWHA 1ED1A 5FPHA 2QTWB 2G9RA 2AGVA 1JG7A 2IUUA 3UJPA 1P3DA 3H1GA 3L8MA 2WUVA 4NEHB 3PDWA 2YY7A 4Q3CA 2DLDA 4ZV9A 3PGJA 4UZFA 5EWFA 3LQ1A 3TQQA 3OLQA 2HJGA 3WYBA 3UT0A 2BEVB 1T4BA 4P84A 2OO5A 1DGSA 4JB3A 1XPUA 4UQPA 2H1RA 4EUHA 3H40A 4EX7A 3VZRA 1RI4A 3SLRA 2O57A 4J0CA 5FUVA 2QUKA 5LP6B 1DQSA 3L6UA 4JOCA 2PNFA 4D98A 3A4VA 3SFTA 4P3XA 2X42A 3SYNA 4ACBA 2WT4A 3FDJA 3AFNA 2A9PA 2NP7A 2YY5A 2HQOA 4RZSA 2O8CB 2JGMA 1SOWA 1Q7EA 3KKQA 1XO0A 4Z5XA 5H81A 2DERA 3ACBA 1EX6A 1II8B 2Q1SA 3LC2O 1FUEA 5HSGA 1ULHA 4LFCB 1A8SA 1JZSA 1O6FA 2Z4TA 4PNPA 4DA4A 3GEHA 2X9NA 4EENA 3MJ4A 3KXKA 4C1NA 2HQBA 3ZW9A 4LN1A 1FXWF 1Z68A 2WAXA 3VNVA 4C9BA 4TT3A 1QP8A 2CVQA 4MVJG 2VKTA 2ACVA 1YRQA 1E1LA 4M04A 1JDPA 2AA3A 4NAUA 1KPIA 1F06A 2F9MA 2FGKA 1QRTA 3JPYA 5FPKA 2FJUA 3TK1A 3NJ4A 4OLAA 2GUGA 1FUKA 3NG1A 4PG7A 3ZZ1A 1YCDA 3B78A 3MJRA 2QYSA 3RU7A 4N39A 2EAOA 3CLUD 5JVDB 3RROA 2C2KA 3IUJA 3CO0S 2I6QA 1GLGA 4UEOA 2PI5A 5TC4A 1H2RS 1CP2A 5JJCA 2OV6A 5IBCA 2EDUA 3JQ9C 3KOZA 4GPD1 4EHIA 1BCSB 3KWFA 3ZE1B 3GCGA 2OHGA 4Z0PA 1CS0B 1QM5A 4DR2B 2XCIA 4MCIA 1T8SA 4HDMB 4RQ7A 2H7XA 2GI4A 2FPIA 1Y63A 5KG4A 1GZ5A 4KFCA 2W8BA 1ANKA 4OXQA 3LRTA 3B8HA 3FTDA 4AWXA 1J9GA 1CU1A 4Y6QA 3WFJA 1OXVA 5J58A 4EKYA 1ZKMA 4E0BA 1VXOA 3UHFA 4NZOA 2AFRA 4B4DA 1Z34A 2J5XA 3ER8A 4QZAA 4C3ZA 2JEOA 3W90A 1YUBA 2I6SA 4TVOA 2BGTA 1XVUA 1GO2A 4CKYA 3QYJA 4QJBA 2P1RA 3DQZA 1U7PA 4BQSA 4RMJA 1N3LA 1GRRA 3VZSA 5IDXA 4IY1A 3RB3A 4MWGA 4JWNA 1M0TA 2A33A 3NUGA 2XIQA 4MW5A 5ALGA 3TINA 2QBYA 1CUJA 2CMKA 1ZYUA 1ZOIA 1UXHA 2ATVA 1XCLA 1XWWA 2A35A 4NYMR 3I37X 4UUPA 1EUCA 1ABBA 2VP6A 5DM0A 1K8RA 4Z7OB 4IVQA 1UMCA 4MI1A 4I1IA 1OLSA 3ICWA 2FW0A 2AUMA 3H11A 4LOHA 4R41A 8ICGA 4UUOA 2YXEA 3CJRA 3FSRA 1X66A 2R7NA 4PINA 2V1UA 1EUDA 2QZJA 1KIAA 5L3SA 3NEJA 4RZQA 1ONPA 3MJHA 2PO5A 1K86A 4AO6A 3CCCA 3V46A 3QGMA 3H0LB 3WLJA 3ZCTA 1OD6A 3VR5A 1VSBA 5CITA 4MQ4A 4YCBA 2EF1A 2IPXA 3IXQA 1X1DA 4HVLA 5CPBA 3RSFA 5JHHB 1DAHA 5C1PA 2Q1UA 2I7VA 1IK6A 4ERXA 2ZTLA 2V74B 4R7ZA 1W2WB 5E79U 1EM8B 2GOYA 4Y2SA 2DBRA 4DQKA 4BQRA 3DOIA 5FI1B 1VMEA 4REQB 4TUYA 3CRQA 1GNSA 1DNPA 1EZ1A 2IVFA 1ENZA 3SBOA 3DVAB 5H16A 2CFCA 4HJRA 3UWMA 6ADHA 4M89A 4RELA 2EBUA 5BSFA 1NVUQ 4PYKA 4DJTA 2A86A 3KV1A 2REQA 4L73A 1OKKA 3FSGA 4MMZB 4B4WA 2XZPA 1CZUA 3Q87B 2PVPA 3IP4B 1AKMA 2ZJ2A 2EZYA 2X4IA 3D9QX 5CA1A 3SYRA 3EQZA 1SXHA 4J9SA 3ZH9B 1JSXA 3R7SA 4ZZIA 2IDJA 4N8DA 4ZDIA 1I6LA 1YZTA 3A9VA 4IHJF 4ZO9A 3L8DA 5MN6A 5E9AA 4G4JA 4JDUA 3PUJA 1R8XA 4YUYA 4Q4HA 2O8FB 4FGZA 3NHZA 1I7NA 5AIBA 4B47A 3I9V1 1A4UA 1I13A 1P39A 2GLXA 4XH9B 3V8EA 5L95A 4ESEA 3ANNA 3D6UA 4YPOA 2Y0EA 5DLDA 5GJCA 1V8ZA 2NP6A 1Z6PA 2YV4A 2R1VB 4LDQA 3B6EA 3WFZA 2WWGA 4IJMA 1QGOA 1DAOA 3ZDXB 1EK1A 1MJGM 3RUAA 2JLRA 1WHTA 3KXDA 3VYSB 3H18A 1GRNA 3RJZA 1Q20A 2O8VA 1FPMA 1DIGA 1JAIA 1JH9A 2ID8A 3GUVA 1ESCA 1FFSA 3AB7A 4M6WB 4FR0A 4JK1A 5C3MA 4Z9FA 2CCGA 5B37A 1N5DA 1X6JA 4KYVA 3OKPA 3QQPA 1TTTA 3KJXA 1SBNE 1KDTA 1OI4A 1AN0A 4XGQA 2R1TA 4JBYA 5AI9A 3ZQUA 2ZJOA 2HLPA 4N6OA 4AJ4A 3HGTA 1DSSG 4DCTA 1ADCA 3EODA 2VNKA 4NX2A 2OEHA 1RC1A 4CGYA 3B70A 4DADA 2HF2A 3ZWAA 3GPBA 3O90A 3IEXA 1P4HA 3RIXA 2UYOA 1ZCFA 2FFHA 1CIPA 3A9CA 3QUCA 1P80A 2FZEA 2D4HA 1E1CA 5KZMB 2RHLA 1JEEA 4Q48A 1FFDA 1N2IA 2OPHA 4HH4A 9ICSA 3B2EA 1XRQA 3U4HA 3PW2A 4HEA6 4KLCA 1AN9A 3LUKA 2PRYA 4NOKA 2D8AA 4OM8A 4P4UA 4KQWA 4B35A 4MWCA 5EZYB 3Q3IA 1IEXA 4V0OA 1L8QA 3V7WA 3HABA 3ID6C 2DMRA 1TF2A 4I8IA 3ZDDA 4OD0A 3CB4A 3CX7A 1V3VA 4KR2A 5IIJA 3E5MA 2DR0A 1U2TA 2CL6X 1W36B 3RHSA 3PQ8A 5CCDA 2OK8A 1TJNA 4W82A 4PRZA 1O95A 5KOHA 1IUOA 1Z7WA 1D9ZA 2H00A 3B1VA 3EA4A 3EBOA 4XDZA 1JFVA 3L0SA 1Z00A 3S1LA 3IUYA 1XPRA 2NIPA 3HKEA 2X0DA 2HJHA 3HMQA 1Q0RA 1OH5A 3TLBA 4X1YA 5A2QA 2MINA 5AOAA 3K2BA 1T8TA 1GLVA 1IWBB 4TTJA 3NJRA 2F3PA 2IXFA 3D5QA 3O7MA 1CULC 5AKLA 2GHTA 4XR4A 4J0FA 1X0XA 1TADA 2H17A 3O84A 4QYWA 3M9LA 1Y6GA 4CFSA 3OWHA 5LN1A 5CW1A 1P1IA 2GTIA 1BQEA 1K89A 1XNGA 2YNMC 4F86A 1EX7A 3OMLA 5F7XA 1PR5A 3BIOA 2Z3WA 1I7PA 4CT4B 3OZRA 4BGIA 4GKAA 2AKAB 1JZTA 3AINA 3JPRA 2Y9PB 3IYLW 1W36D 4KLGA 1OWNA 1WKBA 4GX5A 3LY8A 2QN3A 1ND5A 5EZ6B 2WB2A 1ATIA 1U98A 4KPUA 1OW3B 3VGJA 4AW9A 1DAKA 5BNTA 1HBJA 3UCEA 1SELA 3E18A 3L7BA 1ZEJA 1UMDB 2QV7A 3GP3A 1ZXLA 3R6TA 3ZDFA 2GZ1A 3K4HA 1O9HA 3A58B 4RTOA 3DEEA 1NFRA 1TEZA 3QFHA 3CIOA 3BXZA 4KI7A 1L5FA 5A5EA 3QQ5A 3RJKA 3O9ZA 2LDXA 2Y1KA 1XWLA 2CXNA 2ZFUA 4Z1MD 5T64A 3BE6A 3O3NB 1VLBA 5IJ9B 2DFNA 5EJ5A 2EYQA 2XXBA 3T9AA 3EA5A 1HTBA 1T26A 1GXSB 3FPCA 1AXGA 1SXEA 2YBDA 2DETA 4GL4A 4OGKA 2OD9A 4D0SA 1VLVA 1Y5LA 3HB5X 4PZUA 4QUHA 5B4VA 4YJ3F 2C2GA 2B5WA 3Q7IA 3OZVA 1L5KA 3U60B 2NADA 4KLMA 4G4SP 3ODGA 2ZYRA 3WJ1A 4P2BA 5L40A 3BSYA 2EIHA 4YMSA 3V7JA 1NXXA 1CHNA 2YZ2A 1KA9H 3N39C 2G9UA 5DQIA 3U3DA 4ZD6A 2WR8A 3SAGA 3HP4A 1YQTA 4ZOBA 4JB8A 3G3EA 4YMNA 1NSYA 4ZEMA 2VJPA 2VWHA 4LGVA 1T3NA 3ANTA 3IDOA 1KHTA 3PSPA 2JJMA 3EVCA 2IZ7A 5MDHA 1WXDA 4MW1A 2DUYA 1F48A 1E2PA 4HSEA 4A2PA 1R6AA 4C30A 3IQHX 4FYWA 3NP7A 5BQ3A 3M1IA 4LPSA 1W4CA 1DHRA 3A4LA 5F9NA 1L8LA 2IYTA 2A92A 2PKWA 1CETA 2C4TA 4I2IA 2X2PA 2JAQA 2PANA 1HMPA 3LIPA 1TXGA 1BKSB 1GZ6A 5CYFA 3ABZA 2HDOA 2PMBA 3QZ8A 1R8JA 2WF7A 5UKDA 4O4HA 3FKQA 4LVNA 1CUVA 1X6VA 2G25A 3P2KA 2ORWA 3NVYA 2X4LA 3P9ZA 4BE7B 2GZ3A 2RHCA 3IHTA 4MMXB 4HVTA 3VR6H 1L5QA 5C0YA 1NMZA 4P82A 3EZLA 2GF0A 3IE2A 2NACA 3GCZA 4PC6A 3EW9A 5BURA 4AFNA 4RSHA 3MF4A 1KTIA 5DGHA 1SCAA 2D1SA 4JENA 3T1QA 2I33A 4LE0A 4DMCA 5IT0A 3OHBA 2WWWA 2PEZA 5BWLA 1AHPA 3IDWA 3IKTA 1ZN7A 3M9MB 2P6OA 4EHFA 4BEWA 2E1EA 4Q1DA 3OCCA 4KWTA 1IY0A 2NSJA 3P1JA 3F7NA 1GDHA 5CURA 4XPZA 5AKEA 3ESXA 5KNIA 2WIGA 2J59A 3UIEA 2OHOA 1JLMA 3W3AA 3HCAA 3RJ9A 2GCIA 5KFTA 3L1JA 3VSDA 3KBOA 2BR4A 1D8AA 2WHPA 1YF3A 1EDEA 4BLSA 1SKYB 5KTPA 3DBIA 4CIVA 4B7UA 4PO3X 3ZHRA 1KKUA 2WSMA 4W8OA 2FP3A 1MB2A 3DZJA 5LB2A 5B55A 4EI2A 2REOA 1YHYA 5KREA 2W71A 4AB1A 3G79A 1FNSA 5JAIA 1SBHA 4Q93A 3MABA 4MQBA 1SQSA 3EZFA 4N48A 2O4CA 1KMMA 2HWYA 1KI4A 3T9BA 3KSZO 2N47A 4M87A 1TJYA 3D2LA 3OO0A 5TMBA 2P1ZA 4RQ5A 4MUKA 3F3KA 1CZOA 3Q85A 1BWRA 4WNCA 1F1JA 3K5HA 3ZWBA 2J5BA 3K0HA 4FMCB 3AEYA 4YRTA 3HYTA 4UOEA 1WCIB 1XELA 4QG7A 4GEGA 1C3LA 5KUTA 2J09A 3FPHA 5CR0A 5LP6F 4Q9DA 2W90A 3WOHA 4JLDA 2PFGA 1WUYA 4OHZA 3NPAA 4D26A 3GT3A 5ISMA 2W2TA 4R54A 5FUXA 2CB0A 3BSSA 1LB1B 4BNFA 1Z4OA 3IO5A 3WE7A 1T9BA 4I14A 2PJZA 5KU1A 2PZBA 3DWFA 4IQTA 1TM2A 4P4TA 2R8JA 4WLFA 2XKBA 2CL7X 3AL3A 1G2IA 3H5TA 2E1RA 3JD3A 4LRYA 3WLLA 3HVKA 1X3SA 4HYYA 3RAXA 3DQQA 3SR0A 2BR5A 1KO5A 1NP3A 2Y0CA 1Y98A 1N92A 1K8ZB 2OM2A 3GAZA 2AJQA 1MX9A 3V72A 4R1OA 1BRTA 1FU8A 4MDYA 3DNPA 4V0SA 3MMZA 1WXQA 5FPYA 4EEXA 4C0XA 1MJGA 4FZJA 1MJHA 2C03A 4G0OA 3B1KA 3QFSA 1DTSA 3GDOA 4HYQA 5JSUA 2WAAA 4TLMB 2B36A 3I9V6 4GAEA 4DSJA 4YMWA 3U0BA 4B2LA 4ZC1A 3OOSA 3DXYA 2QR2A 4TYQA 1QIMA 5G4LA 3D4IA 3KLBA 1BXKA 4A0HA 4HB4A 2FF5A 1X1BA 5KB3A 4L9WA 1QZZA 1Q50A 4BJHB 4CG3A 5CCXA 3HCNA 3D64A 3FA2A 1VL1A 4IL6U 1XDSA 5I5EA 1YMQA 1RQLA 1YS7A 4V3BA 4GZ3A 4ZAZA 3IPRA 5IC4A 3DBRA 4INAA 4TVSA 3T5AA 1OAOC 4RPIA 1GWNA 2PFPA 1WXFA 1CG6A 1C0IA 3AJAA 2QMEA 2CLDX 3RFUA 4ED8A 4Q3EA 4CDRA 5ERGB 2BBTA 1UDWA 2P5UA 1F3LA 1QAQA 4K5QA 2J7PA 4I55A 4YJFA 4ZAXA 1P3JA 1V9SA 1XA0A 5EAIA 1JJFA 1GQFA 3BMNA 4QVKA 3AL0C 1WR8A 3WAKA 3AZQA 1TZJA 1OH7A 2C9OA 2I1VB 2R6DA 4ZCQA 2JZOA 4M9JA 3S68A 3L7OA 5JO9A 1AF4A 1XZJA 4JUDX 2C0QA 1IBMB 1ICIA 2F1RA 2CB9A 2A8YA 1QTQA 3FZQA 3QOFA 1YCHA 5AW6A 1QSLA 2N42A 1KR2A 3O3MB 1N32B 2VDMB 1NKVA 4W5OA 1Q0QA 1U4BA 3VI3B 1VL5A 4OQPA 4IG9A 4CMHA 1KEPA 1NVMB 2P35A 3TANA 1HKUA 4ZO8A 3BQ1A 2J1LA 1PU2A 3WMRA 3UFBA 4LVCA 4L4RA 1UDXA 1T5TA 3FMVA 1NJ5A 5JZOA 1RI5A 3GLIA 1L6NA 4P4GA 4FQ7A 1E7RA 2VJMB 3LCMA 3KQLA 3WGIA 1W96A 4K9MA 4BP1A 5EQTA 4Z0TA 3AY7A 5KG6A 4C89A 4ARIA 2JAHA 2O3JA 2P3OA 2IGTA 1FDUA 4FYKA 3CH7A 4DOCA 3UBTA 3KZXA 3HLTA 2ZIVA 3TTYA 3CURA 1GADO 1F2TB 4FS2A 2BONA 3QMWA 6Q21A 1HEUA 3FPGA 1XC7A 3DBLB 3AEZA 4RWZA 4WBXC 3MS7A 1O1YA 4BVKA 5IJZA 1O2DA 5FL7A 3U61B 3R75A 1CZHA 3NATA 3EE6A 2VT7A 3CLRC 1NUAA 5ALKA 3CVVA 4S1WA 1MXHA 3CY6A 2OV2A 4C4SA 5AKKA 2J31A 1CNMA 5IJ0B 5J2CA 3B0YA 2ERXA 4MO9A 3F5EA 2J3QA 1QH1A 3CLHA 5DQHA 4AF6A 4BBAA 1FNDA 1N0WA 3B85A 2WP8J 1L5GB 1NI5A 4GOLD 1G66A 3EISA 3LY7A 4TWJA 1R5BA 2RHRA 2C84A 3BSWA 3GPDG 4HX2A 4R2KA 4C0LA 2VHVA 2IMWP 2NZYA 3AERA 4J03A 1EJ2A 2GMWA 4JUIA 1ESNA 1RVV1 4AX4A 3PNSA 5JEEA 2J9XB 5KI6A 4F5EA 2O3UA 1Y0BA 1SGGA 3NBYC 4UD2A 1QOPB 1I2MA 5TSDA 2FJ0A 4PO1A 2Z6QA 3IQFA 3MTQA 5E1BA 1JKMA 4NJ8A 4X1IB 4CG2A 2VHCA 1XAHA 1T8PA 2QXUA 4EZ9A 4YMIA 3FCSB 4JFRA 1XGKA 1ZUNB 5KC8A 2CBGA 5EOZA 5C80A 4QEDA 1JQAA 5MFPA 4RZXA 1E7YA 3EMBA 2ZE6A 5DXAA 4F5PA 4BVHA 4HDOB 5JWOA 2H2AA 4QZDA 4Y18A 5JS1A 3HBNA 2Q3BA 3L7DA 5BVGB 2NYAA 4INJA 1EFLA 4EA8A 1KTQA 3B89A 4V0ME 4DBVO 1TI7A 4E5MA 2B4TO 1M6HA 3C6KA 4ZYWA 3KJEA 4DXDA 3OG9A 2YY6A 2QMQA 4KRXA 3U7IA 3DZ8A 1TMGE 4QXPA 4AZ3B 2OY0A 5H5JA 4Q9HA 1ULBA 3L6OO 3I6QA 2JJ8A 1D6JA 5J2JA 4AZWA 3BIXA 1CUEA 3V2IA 1FX0A 3TARA 1DDIA 5TNXA 5G0UA 3MT9A 2FFQA 2EQBA 5IN4A 2FX2A 3G8AA 4JV1A 4GLBA 7ICSA 1E1RD 2FE4A 1AXEA 4KDCA 3GQBB 3Q72A 4DR3B 4I2HA 1CRXA 1W1WA 2BYTA 2C4NA 2PHZA 3PR4A 4LOLA 3CTMA 4J07A 1OXBB 3ORQA 1PFVA 3I04A 4X1KA 2OESA 4NTZA 2H3IA 5E4JA 4EEYA 4MR7B 1KKXA 1FYDA 5CEEA 4LTMA 4IF4A 5LL6P 1E9AA 3FSJX 3VYVA 4BVFA 2OO7A 3GNTA 5L4LA 1M5TA 3C98A 1NN1A 2E4VA 1N75A 1X9XA 1RT9A 2ZVQX 4V38A 3FTEA 3M70A 5E2IA 3EPRA