1N61A

Crystal structure of the cu,mo-co dehydrogenase (codh); dithionite reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n61A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n61A01
4YTNB 1QOFA 2L83A 2DWQA 1YJIA 1N5WA 2KMMA 1TKEA 2PKOA 1JROA 3AEEB 1SIJA 3LXFA 1J7CA 1AYFA 3ABVB 1TKGA 3AE4B 1TJEA 4JWUC 1E6EB 1DGJA 3NVZA 2ACZB 2WQYB 3AEAB 5EE0A 3AN1A 4N6EB 1OQQA 5C2TB 3NVWA 3P4PB 1KF6B 2W3RA 1N62A 2W3SA 1DOIA 3CWIA 1EWYC 2QJLA 1L0VB 1ROEA 3P63A 1QLBB 2QIEB 3P4QB 2JX5A 2WU2B 2WDVB 3VRBB 2BS2B 2L52A 1RM6C 1FO4A 4JWSC 3ZYYX 4YXDB 1DOYA 1VDVA 5H8YE 2CU3A 1WGKA 2PVOD 5C3JB 3L4PA 4ZHOA 1RWSA 1FRRA 1JWBD 2JQRB 1WXQA 2WP9B 3P1MA 4C80A 1N60A 1PFDA 4US8A 2M56B 1JWAD 1NENB 2Q5WD 1NYQA 2WU5B 3RPFC 5EE9A 1ZOYB 1XLQA 3EUB2 1DOXA 1VLBA 1I7HA 1TKYA 3AE8B 3HUIA 3HRDD 2BT6A 5G5GA 2DBYA 3DWGC 1FMAD 1UWMA 4YTPB 3AE7B 3NS1A 1IUEA 1ZP0B 2CJOA 3CIRB 2BS3B 1N61A 3BIID 1E10A 1GPXA 1JQ4A 1OFFA 3SFEB 3FC4A 1E7PB 1SB3C 1KRHA 3VR9B 1FM0D 4HRSA 2W55A 1WYGA 1KFYB 1JALA 2OHFA 5H92C 4N58A 4JX1C 3B2GA 3AEDB 1AWDA 4IDIA 1QOBA 1J7BA 1ZUD2 4KX6B 3AEBB 3NVYA 2MJEA 1F0ZA 1YQ4B 1T3QA 2CJNA 3AEFB 3SR6A 1CZPA 1YJJA 2G1EA 2K22A 1R7SA 1CJEA 4ZHPA 2PIAA 4YSXB 3KWLA 4ITKA 2HTME 4YSYB 2AX5A 4P6VF 1RFKA 1E9MA 1N63A 1FIQA 3HVZA 3LB8C 4HROA 4C7ZA 1JRPA 1JW9D 1RYJA 1XLOA 1V97A 1PDXA 1WRIA 2WS3B 1ZXIA 3AE3B 1NI3A 4US9A 3NRZA 4USAA 2MJDA 2WLBA 1FRDA 4ZOHC 2WDQB 1QOGA 1NVID 1XO3A 3AE5B 5AUIA 5EE3A 3FAHA 3P4RB 5G5HA 1FXAA 1L6UA 1OQRA 1L5PA 2MJ3A 5EE1A 2H89B 2PVGC 5AUKA 2K9XA 1L6VA 4WQMA 4YSZB 4WWMA 3B2FA 2K5PA 3W5UB 4YTMB 4C7YA 2H88B 1QT9A 3B9JA 3AM9A 2MH7A 1N5XA 3NVVA 1A70A 1PUTA 1XLNA 2B76B 2M19A 2FBWB 1J7AA 4YT0B 3AECB 3AE1B 3AV8A 1E0ZA 1FXIA 4A9AA 1QF6A 2KAJA 2N0SB 3AE9B 2EKIA 4FXCA 3W9CB 3ETRA 1WWTA 2WDRB 1NEKB 1NYRA 3AH7A 5GXGB 3VRAB 3PO0A 3VR8B 2E3TA 1FFVA 2BS4B 3DWMA 3SFDB 1B9RA 3WCQA 3AE2B 1YQ3B 1XLPA 3AB5A 1QOAA 1FFUA 3AE6B 1VJKA 2LEKA 2Y5CA 3P4SB 1TYGB 5MPOA 3W5VB 4LTUA 1SF0A 1V8CA 2W54A 1GAQB 3AEGB 4N59A 3AMZA
chains in the Genus database with same CATH superfamily
5AM5A 1QOFA 1WGYA 3R66C 3Q8SB 3IRUA 5T14A 2YTUA 3AU5A 4HCPB 4UB4A 3R8BA 2VZKD 2KEYA 2KJ6A 3TFRA 4KLIA 3LXFA 4EEWA 3IG3A 2UWQA 4EBEA 2DUYA 3DBHI 3TANA 3NOBA 2J53A 5J0UA 4M02A 1WXSA 3V3XA 4DXAB 1YN5A 1X66A 5KAFU 4B9SA 5KT7A 1WR6E 4KX3A 2KK8A 2G08A 5CA7A 1PZNA 5AM0A 3PX4A 5J0PA 2KWCA 3N32A 3O13A 1L0VB 3F2DA 4IWPA 3UQAA 1U48A 3IG5A 3DV9A 4KLUA 4MSMB 9ICVA 3OHAA 2A5UA 5KT5A 1E5WA 3P1MA 1K5OA 2M56B 2KZMA 4LJPB 3ZJVA 2N7JA 2KFZA 4OZCA 1IV8A 2ZZPB 4YQWA 4DF4A 2JGAA 1UWMA 4RQ2A 5EDSA 2N9PC 2BDPA 2JEIA 2PTLA 8ICEA 3GIIA 8ICCA 4AQ7A 1KTQA 3EPIA 3QC8B 2KJHB 2JH1A 3ZNID 1ISNA 1KFYB 4KMOB 1D8YA 3BQTA 5ALPA 1T0QC 1D6EC 4A3OA 1ZUD2 5E79U 1NK9A 2VRRB 1B22A 2IBKA 1TT5B 3BYYB 2CJNA 3SR6A 1S0MA 4P0PB 2KOXA 4WWNA 4RT2A 3EWAA 2FMPA 4RQ8A 1WMHA 5J2BA 1SKWA 1WCLA 3ETLA 3NG0A 2ZPYA 2ZW0A 3ZDAA 4GIBA 3SV3A 4NL9A 3QU5A 4DHZE 5ALKA 1HE8A 3PHWB 3PW2A 4EE2A 3D2NA 4GB9A 1SL1A 3JW0X 1C1YB 2I9GA 2BPFA 2FCSA 2WDQB 5EE3A 4UASA 1RYSA 2WHIA 4AJWA 3H8MA 2XK5B 2OCEA 1OQRA 1L5PA 2MJ3A 2W11A 4P4MA 2K9XA 4FZLA 1SXTA 4QNLA 3ONSA 1QT9A 4O9MA 1GC7A 2L32A 4IQTA 2R18A 3KBBA 3MGHA 1BT0A 3PZ7A 2NPTB 4IKGA 4MELA 3R2TA 3EHVA 4PL1A 5AK3A 4LLGM 2Y5PA 5GXGB 5C5JA 4ECRA 3DHGC 3ZJUA 2QCZA 2B0CA 2MP2B 1BUIC 1KN5A 4PHEA 2YMQA 4JLCA 2L05A 1VZ7A 1KJTA 2E1FA 3UXOA 9ICWA 1TZ1A 4IRKA 1KQQA 4TUPA 3ALBA 2VJ5A 1MQ2A 4ED0A 1KSPA 5DPWA 4IW0A 3WALA 7ICJA 4C56C 4S17A 4NV0A 1L6NA 1E90A 4C8KA 2WFAA 3UMCA 5ALGA 1ZQDA 4FBJB 3V7JA 1J7CA 4ED6A 4JQWC 1WH3A 4W9CA 4DDID 8ICBA 1QKZA 4RQ3A 2D10A 3OAWA 4F3OA 9ICPA 1N62A 1S1QB 4ED7A 3CWIA 3EECA 2IZVB 5KFGA 4F7ZA 3N1YC 3P63A 3EGRA 4UAWA 2BS2B 1DOYA 1UH6A 3ZTCA 2KQ4X 9ICGA 4XE0A 2LZ6A 4KLLA 2HBMA 1MVKA 4RFBA 1KLVA 3MC1A 3IP4B 2K6DB 1V85A 4QZCA 4KZ0A 4NAWA 5C0YA 1Y8RC 4M9NA 3FYHA 1ZOYB 2WXIA 2LGXA 2YY6A 2H5XA 4DSIA 3GP7A 1UELA 2VA8A 5J0RA 2Z0DB 4TMAB 4CF3A 2UYZB 1D8BA 1ZQNA 1MI0A 4PGQA 2IHMA 2AQ4A 2ODGA 2AL6A 2BF8B 2KQ7A 4KIKA 3WK8A 4ECYA 2XEWA 2RHFA 2BKFA 5D3DA 3A0BU 2F3NA 1V6EA 4HEA1 1JALA 2OHFA 2LGIA 4R64A 2BZFA 3NUHB 1SGGA 3TMPB 1SV0A 2BB6A 1SWWA 4OW0A 7ICNA 3M9MB 3C1YA 3PO5A 3PTFC 5J0XA 5TR5A 1ZQBA 1QTMA 4DXGA 1ACCA 4RNAA 2F77X 1J19A 2AX5A 4P6VF 5DPSA 3MFHA 2GB1A 4PS8A 2X8XX 4DF8A 1L8LA 4US9A 4M2YA 3PW5A 4IQWA 2KNJA 4RGNA 1QILA 2KFNA 4ECWA 1QOGA 1GNUA 1TVAA 3RMKC 3BQ1A 4KLFA 4J9SA 4B0EA 3HT3A 8ICKA 1FXAA 4ECQA 2ZJAA 1AARA 2FAZA 4GLSC 4Q2JA 4PS7A 2PVGC 3GILA 1D5MC 4DQOC 1L6VA 4BXOB 1ZJMA 5D4BA 4C0ZA 4Y2JA 2KTRA 5AKYA 2G5HB 3QU4A 1B4FA 1S3SG 2M19A 2D3AA 2KC1A 3CNHA 3HILA 4LDTD 1C79A 1SBBB 2J0JA 3Q14C 2MSNA 3D2SA 2KN5A 5EWEA 3K9PB 2BWES 5J2RA 3KZXA 4BUGA 4I2CA 2V4QA 2V3SA 5HFYA 3SFDB 3PLVA 2WF5A 3AE2B 1NK7A 4DHJB 2JWUA 2KXJA 3PGEA 5AM3A 2EDUA 2NYVA 5DKWA 1ZXHA 2FI1A 2CR5A 2I5HA 2LGSA 4NPNA 1L3SA 1S0VA 5ALNA 8ICPA 4M00A 2I1KA 1LKYA 3DHHC 1ZD2P 1XEEA 4LTUA 4RPYA 4XGAB 3PT2B 2ATLA 3AL0B 3RJHA 3H8SA 4F4WA 3T5JA 2WXOA 2MRPA 3MTNB 2KFJA 2KG5A 2E8NA 2BKRB 2WXPA 4PGXA 2K8BA 5IIMA 3C8YA 3T9LA 5AKGA 2GO7A 4YN4A 2LUEA 4LJOB 2OOBB 3UXNA 2MLBA 1VD2A 3A33B 4XA5A 3L5KA 2O2VA 3RR7A 4XDDA 3V72A 2W9BA 3H7IA 2WHEA 1DYQA 2KHVA 2JU6X 3SZ2A 2AXTU 4LCDE 5ALUA 1O03A 5JHBA 1YD8U 3T79A 2G09A 4BAXA 2SAKA 2K89A 4EEKA 3TACB 4GDLA 3MR2A 2HJ1A 2ZTEA 1WUDA 3SQIA 2A3VA 2MBQA 1KFSA 2ZXHA 4WWOA 2K25A 4LZGA 3NZUA 3ZD8A 2BT6A 2DBYA 2ZIWB 1JRUA 4L2YA 2CJOA 5ALLA 3BIID 1Q5WB 4GXJA 4KDLB 2PFNA 3Q8QB 4NLBA 4F2SA 1R4NB 1E7PB 2IPKD 2LASA 5FR3A 3LVWA 1KRHA 3PW0A 2QSDA 5DB6A 4B9TA 4K1RB 1WYGA 3ZIMA 1MJDA 4UBCA 3T3FA 3PW4A 2YX8A 4LVSA 2JYEA 4G3IA 2KDBA 4N9F4 2NO4A 4CYEA 2L0TA 1YQ4B 1T3QA 3HWTA 2EQYA 3ZDCA 3UIPB 4EZLA 3J81j 3ZLZA 4O5CA 2AQ3B 1ZQPA 4AOFA 5IILA 2HOFA 4IRDA 1S97A 3LB8C 1YQBA 4ZRPA 3PX6A 2IBIB 2KZRA 2ZUBA 1KM7A 2IGGA 4XC2A 2WLBA 2KOBA 5KFEA 4ZOHC 3PVXA 1L6UA 2PI5A 3H0LB 4Y2RA 5KNIA 1NJZA 2BBCA 2J0KA 5IO9A 1RYUA 1XU4A 2AGOA 2K39A 4ECVA 3WK6A 2WB1F 5KFMA 3BWUD 5J2CA 1F5SA 8ICWA 3ECIA 3TEWA 5D2MB 5ALMA 2MBHA 2H3VA 5EWGA 2XBBC 2RMMA 1KW4A 1V49A 4AYBF 2GBKA 5BMHA 5JXVA 2P6UA 3RTVA 4PT5A 1TKDA 1ZQCA 5KL1B 4LK0M 4QZ9A 5L1IA 3WKAA 5DLFA 1MFWA 3KUDB 2QKQA 5J2HA 4GMVA 1ZQUA 2HTHA 2WYQA 1UGMA 2F44A 3HJEA 4W9FA 4K4GA 2XGQA 2MAXA 3QU2A 1JIHA 2HVIA 1XQQA 2KX3A 4GIVA 4C4SA 5ALJA 2QHOA 4B9MA 3V6KA 1C77A 1D5ZC 1TYGB 4UDUC 2QB0B 1WZ0A 2CHWA 3K75D 1SXDA 2MA9B 2WWZA 4RPZA 5LXIB 8ICXA 2L83A 4ARIA 1S8OA 2PXIA 2KK0A 4OJLA 1IP9A 1TKEA 2VH1A 3NS8A 2A1JB 3VDZA 4JUZA 3PV1A 2KMDA 1Y88A 4KN4A 2XCPA 4O3PA 5J2EA 2A4ZA 2C60A 4J9OA 1EU4A 1I4HA 3BJYA 2HMXA 3QUTA 4C8LA 2D8CA 1DGJA 1TKGA 1WZ3A 3DVNU 3RI7C 2BWFA 3GE3C 4K3CA 2ZUCA 3WKBA 4QZEA 4RNNA 1ED1A 2BCVA 4F4KA 1STEA 3MC0B 4FBUA 4J3OD 1PK1A 3WK4A 1FEZA 2R8JA 2HHXA 1XD3B 1U47A 2QIEB 4C4VA 3B0AA 1ZQXA 2KKVA 2ZIUB 3PZPA 2I1QA 2MCNB 4A8XC 4NLGA 5C3JB 4KLEA 1QSSA 1GOZA 2M0XA 5EWFA 2MUTA 4C00A 4O5EA 4UB6U 3LYSA 5ALOA 2WU5B 4YXJA 1Q8KA 2OYYA 1E7UA 1NYQA 4XWWA 5ALQA 4FULA 5D46A 3HUIA 3AU2A 1M94A 4ACFA 4C8OA 4IWOA 1N61A 3V62A 3N7SC 5HR6A 3ZDBA 1S9FA 2I1JA 1UWXA 5IIOA 5DLGA 2LYHA 1S10A 1T6BX 2W9NA 2K8CA 3JPRA 2ZPNA 3I1YA 4AUQC 1RQNA 5J0QA 2JRHA 4M0WB 1XSPA 2DZJA 4K7SA 3AEFB 3H0MB 2ONQA 4UW9A 1YJJA 4RT3A 2KKCA 5DBCA 2HBJA 4RNOA 1HIWA 3HP6A 3H6NA 4MGIE 3CP8A 1MG8A 3MC8A 1P3QU 2PLPA 3KYCD 1IGDA 2D3GA 1HXYD 2SEBD 1HTQA 4TURA 1WRIA 2REXA 1ZXIA 3IT6B 3QQ8B 4L1BA 2BW2A 4ZRQA 3H40A 4QW9A 4RQ0A 2DHZA 2AEHA 2X38A 3AXCA 2ZVNA 2H89B 5ALHA 1URJA 2JZBA 2C22A 2K8HA 4PHPA 5DB9A 2KNBA 3RZWC 2NS5A 3B9JA 1WE7A 2GOWA 4I27A 1SJED 3DVNV 2DF4B 4Y2QA 3I57A 4UARA 4Z6CA 2OH2A 4I2JA 2RR9A 2HDEA 4ED3A 2KAJA 2IA6A 5D7GA 2MA1A 3OSNA 3CW2C 2JEJA 2FIDA 3P2BA 2JPHA 5IKCM 3HX0A 1NK6A 4M8MA 1RAXA 2G4DB 5KG6A 2NTSA 3W1SC 4QWBA 2O6VB 4HJGE 4HPPA 3RNFC 1A0PA 4HYKA 2XY6A 1EM7A 1QH9A 1V8CA 3L10B 2AWTA 4IWQA 4CQNA 3WAPA 5L83A 3UF8A 3V7KA 4GXIA 2F1IA 1WJ4A 2YEPF 5J8YC 2YEPB 2QARA 4UAZA 5AI0A 4O3QA 5CR0A 8ICLA 2CU1A 3DBHB 3QCAA 4BX9C 4ECUA 5EOZA 1Z4NA 3NY5A 4NJ6A 2OM6A 2C7NB 2LMCA 4J9QA 4XYCA 4EUTA 4IUMB 4ANWA 4M6WA 4NJ7A 4OVZA 3DEEA 8ICIA 3AUOA 3V7LA 3P4QB 2HHQA 1YNTE 1KLNA 2K6QA 4P2HA 3ZNHB 1VDVA 2HHTA 4A90A 1LVHA 3J9CA 1CI4A 2CN1A 3R2IA 3N7PD 1I4RA 8ICSA 2JQRB 3Q8EA 5DQIA 3B1LX 4DWFA 3NRWA 1Q46A 3PVLA 3Q8LA 5AK6A 4YP3A 2IGDA 3H8JA 3VH4B 4B9VA 3V6HA 4W9GA 4F92B 2YMMA 3WU2U 3RJIA 1FM0D 2O6KA 3M1YA 1P7DA 2G5IB 2QC8A 4ANVA 3ZVVA 1Z5SB 3AI5A 1TAMA 2JXTA 2BTEA 1J7BA 1EWCA 2J6SA 4EOYA 5ALWA 9ICUA 4I2HA 2I6XA 4BKGA 1XNSA 2LUMA 3ML9A 3QU7A 2BPCA 3RJEA 2AGQA 4NAWB 2GBNA 2JF5A 2FCMA 1LQBA 5DDYA 2EANA 3TJPA 4I29A 2N9KA 1T94A 2V3PA 4KIKB 1CK1A 1F77A 3MGIA 4HCNB 3TI0A 3WA0A 4KKJA 2EMTA 4OVVA 1NZPA 3VTUA 3C5GA 3N3KB 5D3IB 3EPGA 3N28A 2KTFA 5E6JA 4DS4A 4YXMA 4QJFB 3VTVA 2KACA 2V3NA 4E3CA 3VH3B 1WIAA 2NTTA 3V6JA 2MU2A 4TKNA 4PS3A 1GJZA 2F1HA 2KN4A 2WDTB 3DQVA 2JXXA 1Z1VA 3QE9Y 1UUPA 4B95A 4W9JA 3G6XA 4FS2A 9ICNA 3VXWA 4MDKE 3SAFA 4UAVA 4J9PA 4YG2A 1RXVA 2VA2A 2HW3A 1MHXA 3PRPB 9ICBA 2N9XA 1D4BA 1C9FA 2HBLA 2KFKB 5F9LA 4J9KA 3B08A 4ANUA 3R9KA 2JZZA 2FNJB 2B21A 3MBYA 2ISOA 1R4MI 1SF0A 4DO9A 1XCTL 3VUYA 4ZRIA 1V1OA 2KTRB 5KFLA 5KFWA 1DOQA 1KLUD 3MP9A 5J0WA 3QAQA 5ALTA 4AS1A 3GE8C 4I2BA 4CO7A 4UB3A 3TSSA 5HHHA 4RQ5A 2N1WA 5FKAC 2NRVA 3OPXA 4K4HA 1UA1A 4IQVA 2V9HA 5AM2A 3LJ3A 2MEKA 1OTRB 3RB0A 1XXGA 2HDOA 2KLGA 4JWNA 1V86A 2KE7A 5J0SA 2KX0A 2XGPA 1RM6C 4BBNC 1CRXA 4Q43A 4RM9A 5H8YE 4M04A 3RH5A 5DG7A 3L4PA 3IT4B 2ZEQA 2XICA 4HJKA 3HHMA 2DFLA 1PFDA 4US8A 4KGTA 3UGBB 5KFBA 3A1QB 1TGZB 3U26A 2OEDA 3BZKA 1HZ6A 1NKCA 2QLTA 3AE8B 2CPRA 4LZDA 4QWDA 3HRDD 5KFSA 3V60A 3AE7B 2GLEA 1JQ4A 4F1SA 4YR0A 2W9BB 3QNMA 2DZKA 4DFJA 1SXEA 2VH2A 2G9HD 3U2SC 4UB5A 3NASA 1BMLC 2D3DA 2PMZF 2CKHB 5H92C 2UVUA 3OJ3A 1J0GA 4RQNA 3JPPA 1S0NA 1AWDA 2FCNA 4I28A 1UCVA 1UNSA 1KKXA 3H7PB 3MR5A 4FE3A 2JYTA 3KOOA 4AP9A 4YSYB 2W7OA 4G11A 4BFRA 2JRZA 5B66U 3PNCA 5J2FA 3TAQA 5DBAA 1SSNA 2VANA 5FR6A 4U6PA 2XCAA 1NK8A 5J0TA 1PDXA 2RGFA 3AE3B 3NRZA 3WK9A 3JPSA 3GV7B 1RYRA 3BVZA 4TUUA 1VZ6A 4IM2A 4F50A 3BYTB 1WJ6A 1Z2MA 4DSEA 3E0FA 4IG7B 4KX5A 1MA7A 1D9DA 1P1AA 2M4NA 4NQLB 2MH7A 1ET6A 2CXYA 2EH9A 2ZTCA 3KUZA 4P7IA 3QX1A 5LNK1 1SKRA 2LYBA 1YJ1A 8ICFA 3RJFA 3UMBA 4DLGA 1ET9A 2W8LA 2EAOA 2KJ8A 4C4RA 4G50A 5D49A 4YWGG 2JRIB 3WK7A 5DQHA 3A9JB 1NJXA 2FUG1 5D94A 3MABA 5KFHA 1OUQA 2B3AA 4PZNA 1K51A 3W5VB 3OG5A 5J2IA 2IO2B 1NKBA 4Y2YA 2PW9A 3LK9A 4DS5A 4TQ1A 3I76A 2KVCA 2DWQA 1KEJA 8ICGA 3ZUNA 3E56A 1X1MA 2KMMA 2NBWB 4W9HA 3HW8A 2INDC 3ZNZB 3Q2AC 5AM4A 4MF8A 2K1FA 3QUCA 3AEAB 3E2EA 4BZAA 2WXKA 2KJ5A 4OCZA 4MGKE 5HI1A 3P4PB 1C4AA 1S5LU 2HI0A 4RF1A 4DQRA 1IGCA 2QJLA 4EX7A 4QWAA 4BGDA 2WDVB 1ZKHA 4EZ6A 3MGVA 1WGKA 2W9CA 1UA0A 1L5UA 4W9KA 2D2QA 1NOMA 4O3SA 1RXWA 2N4FA 2FE9A 5CHVC 9ICOA 3BS5A 4AJYB 1XO1A 3QXGA 4NLCA 3C5FA 3C2KA 2O6VD 1M6YA 2DYMA 4F4YA 4K3BA 3VR9B 2MHJA 4DXFA 2W55A 2G3QB 1K50A 3TAPA 4A20A 1OW5A 1OQYA 5KFKA 1HTOA 2LM4A 5ALIA 1PK1B 4Y2VA 3SMVA 1ZQSA 1JUDA 3SHQA 2G4SA 1DK3A 3KH0A 1SZHA 2B6GA 2BCRA 4PH5A 1IPGA 3SEBA 1K1QA 2K60A 4F72A 2K4PA 1KBUA 1MSWD 2BCQA 3ZQ4A 4LNNA 5TISU 2LI6A 4DOCA 1XT9B 4J9LA 2TSSA 7ICKA 4QZAA 3BS7A 5AKHA 2KHWB 3H4DA 3DVGX 4P4OA 5F9NA 5KT4A 2DQNB 3HKZF 5K4LA 2KD1A 4GLXA 8ICZA 5DPRA 2IY0B 1PYWD 4KVGB 1FRDA 4I2EA 3Q6BA 4XQ8A 1U49A 3T5HA 1V1PB 3RB4A 5AI6A 3Q3FA 2LHDA 2WGSA 1NK5A 5E6NA 3MHSD 2LPEA 1YMHE 2K8CB 2MX2A 4WWMA 3B2FA 3RNCC 2LBOA 2NMQA 2XI9A 3Q8FA 1E8YA 2PFOA 7ICUA 4KDIC 3BZCA 3MFGA 3KWVA 4WJNA 3O65B 1GO3F 3QZ7A 4KLSA 2FBWB 1I42A 3I28A 3AE1B 5HMMA 4QZBA 4NQKE 3Q3NC 4DBGA 1C3TA 4P0QB 2WAQC 2IOHA 2QDFA 3NJTA 4IL6U 2KICA 2W9MA 2ZNVB 5AEKB 2BPGA 1IYFA 2VJ4A 4WAFA 2KQSA 3IM1A 1QOAA 3V61A 1XWLA 3GB1A 2KJRA 4B9KA 1WM2A 2WF7A 4E0DA 2EAMA 1V80A 2R2QA 1GAQB 3AEGB 3JSVA 4HVBA 1SE2A 5L1JA 3H1UA 3TIXA 3PR5B 1J97A 2JZBB 1HZ5A 9ICFA 1XCQL 2C2DA 2PKOA 4O0IA 1C78A 1SIJA 1SL2A 2AL3A 1LGRA 5CHFA 4ZH4A 1B43A 4YR2A 4HKQA 1VZ8A 2AQ0A 1I35A 2CHZA 5B5EU 3VC8A 1FD6A 3UPQA 5KG2A 1LM8B 4J6IA 4EFOA 4F8RA 5I4DA 1ZDXA 2JMGA 3RNEC 5KFCA 3T5KA 1I4GA 4XDCA 4I6PA 4ELVA 4H2AA 3G6YA 2FPKA 3ZYYX 5KTQA 3QYPA 9ICSA 4NM1A 4TUSA 4J9NA 3B0YA 1YT3A 1Q0WB 1RWSA 3D32A 4ZHOA 1Q1OA 2LHTA 2ALZA 4R8UB 1PGXA 1TS5A 2LD9A 4ED1A 5JU5A 5AIAA 4M8NA 2QARB 1UD7A 4P1BC 2WXHA 4IR9A 5BOLA 2ESEA 7ICHA 1T7PA 1IUEA 1SJHD 2PFPA 8ICNA 1KFTA 2IOFA 2RQ5A 2I38A 4ECTA 2ZJDA 4TV3A 5BYSA 3APDA 3ZD9A 3W1SA 2V4LA 2R61A 1XF5L 2MBEA 4DL3A 4KV2A 4I2IA 2LVQA 2ASJA 2WXJA 1F0ZA 2CRXA 4NLZA 1T8EA 2XC9A 3GIJA 1EF5A 3P42A 4TQSA 4RCOA 5J8YA 4RQ4A 2K22A 4DEZA 1ZQKA 1VRAB 4ITKA 2VA3A 2KIWA 4G3XB 2DKXA 3SV4A 1WGRA 1C7YA 2ZIVB 2K0PA 1JW9D 9ICHA 3CSTA 3FILA 4OO1J 2DYBA 4WH4A 3SAHA 1JCKB 4GXBA 4R63A 2ZXIA 1Z4OA 1FCLA 3FAHA 2BR0A 2LGYA 1T3NA 2NRWA 3DOWA 4LNIA 3ZXRA 3PV8A 4EYIB 3KZIU 4QWCA 2Z59B 4S0RA 3W5UB 2K4IA 1WGDA 4YTMB 4J9RA 1DGSA 4FLHA 3U7ZA 4NNJB 1PVQA 1EUVB 5DDMA 2GBJA 5IA7A 1UGJA 2KVZA 1ZQYA 5F3XB 4RU9A 4DHZB 2JXJA 2ZJ5A 4XWTA 2KLCA 3KKAC 5KFOA 3W9CB 1WWTA 3VUXA 2HBKA 3X0WA 1GB1A 3PHXB 3VR8B 1FFVA 3GV8B 1ZJNA 4WAAA 3D2QA 4Z6DA 1XLPA 3AB5A 4MEXA 3PMLA 3WAMA 5BOMA 3F5AA 1X6JA 5AM1A 4W9DA 1J8CA 4TQ0A 3JPOA 3QU9A 2RSUA 4MSQB 1ZQQA 1FPYA 3O0FA 1YJIA 2ICIA 1BPBA 3U8ZA 1UPHA 1QSLA 3WAOA 2EZYA 1UT5A 1E7VA 4I6NB 1BGXT 2Y0SC 4PL2A 7ICOA 3ML8A 3E58A 1X9MA 1CEZA 5CHWA 4ZDVA 3CSFA 5EE0A 2D3CA 2YMPA 2JHDA 3PX0A 3RRGA 5BMGA 1U9LA 3SU8X 5ALYA 1J2MA 2HCFA 5KG1A 1YN3A 4Y2XA 3UIOB 4ZYSA 4M9LA 3VRBB 4ECSA 2LYAA 4OVUA 3T3NA 3KHLA 4RQ7A 1JWBD 1XSLA 1P7EA 4MJSA 4FADA 4GDKA 2INPE 1JWAD 9ICEA 2YLMA 1N2XA 4XUSA 1CMXB 2MSED 4MEMA 2FUHB 5JH5C 1AROP 3I3TB 4HPLB 5C23A 4BOZB 3AEVA 1ZQRA 2CS4A 5KFFA 3NS1A 1WGGA 2EAPA 2MP2A 2BS3B 1TK5A 5L1MA 1YX5B 1YZ7A 4P16A 3KHHA 8ICYA 2Z0EB 3EA6A 2EMSA 4FZMA 3SD7A 3ZXVA 1ZD4A 5ALVA 2XN9C 4HK2A 2KSOB 3ZW3A 2WNMA 4JX1C 3W2DA 1ZYQA 1L7YA 7ICTA 1SWVA 4ANXA 4C8NA 5FK9C 3JPNA 1TAQA 3MJWA 2BPSA 1ZQAA 1ZDVA 2Y9TA 3T5LA 3IHQB 2HTME 1KL9A 1ZETA 4IRCA 2DNFA 2LJ5A 4MGZE 1HJPA 3I63C 4JMUA 2BYEA 3AULA 3SD5A 3VQIA 5AKZA 8ICHA 2MBOA 2N7EA 3BQ7A 5AK5A 1UBIA 2OWOA 3H8HA 4KTQA 1IXRA 1JMLA 2PE6B 9ICTA 3HIZA 1WX7A 5DPTA 1P9DU 3EC8A 1WFYA 2J42A 2K5PA 3S6JA 2L0FA 3HPOA 5J2JA 4HDOA 4UBBA 2I2YA 3PMNA 4F8CB 3AECB 3PY8A 5AKXA 3RZFA 3K9OB 1GB4A 1P0RA 1JWMD 2N0SB 4FXCA 5IIKA 4B6JA 1UHUA 2WTFA 3VRAB 2PEAA 3PO0A 2AU0A 1IG6A 2L7RA 2JEFA 5H2FU 1U4AA 4NXZA 1KDHA 4MEYA 2RPQA 3A9KA 1L3UA 5KFTA 2FLNA 3M6KA 5J2GA 7ICQA 3ZRCA 2IO0B 4BKTA 1TIFA 4AWJA 1R4MB 1V2YA 1F0MA 3EW9A 4NLKA 1V81A 4MH0E 1O08A 1C4PA 2N1RA 3QUQA 5KG5A 3EZ5A 2ZCCA 1IM4A 1GC6A 5KFVA 3ZKJC 4DLEA 5CWRA 1EU3A 2E5SA 2L00B 1JXLA 4DFKA 1NKEA 1BPXA 1WMHB 3ABVB 4FFDA 4F5RA 2AYOB 4REZA 4WJOA 3RULA 3C28A 1PVRA 4O3MA 4E74A 1KF6B 2W3RA 2LXAA 2W3SA 1X9SA 1SEBD 2RDHA 3HVDA 3ALRA 4YMNA 4BXOA 1MPEA 1QZEA 2MWSB 4JWSC 1ZRNA 9ICLA 3BK1A 4BKSD 4YXDB 4I2DA 1X6IA 3QEBZ 1X2IA 1WJUA 3OJSA 3I5JC 1WXQA 4RH6A 1TFRA 1BPEA 1A77A 1N60A 5KFUA 3TFSA 3Q8MA 2AJQA 4EELA 3JYUA 4JV0A 1DOXA 4GSWA 1YOVB 3RJGA 3ZDEA 7ICLA 1TK0A 1DK2A 1FMAD 1OEYJ 4YTPB 1T5XD 3Q3OC 1WJNA 2KT7A 4HAIA 2W04A 1FNWA 2M0AA 3FC4A 1I4XA 3QARA 4JGHB 2K8AA 1S0OA 4LNFA 2RRDA 4KITB 2R2OA 3AEDB 4GXKA 2MJEA 2BDUA 5AKEA 4RZRA 1S76D 8ICMA 1ZW7A 3M8SA 1PK3A 1R7SA 4ZHPA 4WJ3B 1BPDA 2W43A 2NVUI 1RFKA 1L2NA 5DQGA 2D6FC 4DHJD 4C7ZA 2WS3B 2QILA 5KFPA 1V97A 3Q3MC 2EKEC 2Y9UA 2ZUDA 2LMRA 3M7DA 5KG3A 2XVTA 3IXSA 1A6SA 4WJPA 3AE5B 3N1XC 8ICOA 3APCA 3U4EG 4O5KA 2DZMA 2WF6A 4D2KA 2KV2A 2EZXA 4ELTA 2BQUA 1Z3EB 2LRUA 1F52A 1XC9A 1XS9D 4YSZB 4FS1A 3APFA 4DDGD 4KSLC 4QWEA 3BZDB 2DENB 4FHKA 1B1ZA 3VHTC 3QIJA 1XLNA 1ZQHA 2NO5A 1J7AA 4YL8A 2ZIWA 1WX9A 4A9AA 4PYZA 1F2RC 1PGAA 5TSSA 1NZBA 2WXFA 4NM2A 2FPMA 5LXHA 4KN7A 8ICQA 3L3FX 5BMIA 3KD3A 1WR1A 2BS4B 4IS7A 2LHEA 3IAM1 5KT6A 4RNMA 2HE7A 2DL0A 3JVZX 3CYMA 4IR1A 4PYUA 1F44A 2J6UA 9ICCA 2LEKA 4QZFA 9ICXA 2CHXA 2V9WA 4ED2A 1N48A 1OXJA 3H0RB 5ALDA 2NV3A 1K1SA 4DCCA 3U7DA 1Z19A 1NJYA 2KC2A 1SE4A 4M47A 1PUZA 4QZDA 1MN8A 4LNOA 2E8OA 2FMSA 4YMMA 4KSKC 3AE4B 1EF1A 4JWUC 1E6EB 2HJ8A 1ENFA 3NVZA 2N9EB 2INNE 2J6TA 4LDTB 4QIWF 3V6EB 3F5EA 5GTHU 2Y1IA 2GOLA 4YR3A 4Y2SA 2RDBC 2ASLA 2DPIA 5KG0A 2YMLA 1GG3A 2BGWA 2AGPA 5DCNA 3T3OA 5J0OA 2F76X 3IG8A 3L17A 4MT5A 3Q8KA 4RMAA 1FO4A 3Q3JA 2ES6A 4DSJA 1E8WA 4EZ9A 3JSVB 5CP2A 3PO4A 1T0YA 3C0RB 2R8GA 2HHVA 4M9GA 2DAFA 5HR7A 1K8RB 1PVPA 2D5GA 4BVUC 3DWGC 4B6WA 2V4RA 3OHBA 2L76A 2KKPA 4RGMA 5E6PA 4BDPA 3RFZB 2R8IA 4MM3A 3KQ4A 4OZBA 3QK0A 2JT4B 4CCHA 1RG6A 4WURA 2IY1B 4KLJA 3Q8PB 1QOBA 2ZJ8A 3AEBB 4F71A 3RAXA 2C5LC 5A0LA 5L1KA 3IFWB 5IINA 1A5RA 1LKYB 2HOIA 3Q8CA 3GQCA 2GBMA 2DKZA 3V6CB 1SIFA 3ONNA 4RQ1A 2Y1JA 1LB2B 9ICMA 2Z8LA 3R3MA 4YSXB 2W7PA 3KWLA 5IN7A 3DBRI 3MFIA 5BYQA 1L3TA 1C4CA 2BKEA 2RD0A 2BCUA 2K8BB 4HROA 4Z6FA 1ZGUB 2LI5A 2KZ3A 5LLIA 5DB7A 1RYJA 1TY0A 3PSIA 3LWLA 5HP4A 4Q8EA 3KLSX 4BOSC 4F4ZA 1UQVA 3RCZA 4USAA 1L0XB 3F53A 2O2VB 2C7MB 3N7RC 1XO3A 3MC9A 1ECWA 4OHJA 1TS2A 2KWDA 4BWJA 3GFKB 2JY6A 2WXLA 3QJZA 1NDDA 3LWMA 3WKCA 3ISCA 1H8CA 1AQ6A 1D5XC 2W82A 4ICVA 4TUQA 2WX0A 2DLBA 4A3PA 1BVSA 2C7HA 3TADC 4RF0A 1CQVA 4GDLB 3NVVA 5HNKA 3SEIA 4GU2A 4F93B 3K1ZA 2KVRA 1WY8A 5IOIA 5CB1A 3VFKA 1WG8A 4Y2PA 5DG8A 4ICUA 3ETRA 2AH5A 4W9EA 1NEKB 3UXPA 3FILB 2ZNVC 2KDIA 2DYOA 3LDZE 2R8KA 3LDAA 1UF0A 2KYWA 3THVA 1WF9A 2D11A 2H3FA 2K4HA 3IVFA 2G45B 2M9NA 8ICTA 2PE9A 1C20A 4M0WA 3TUOA 3K1RB 3KUCB 2ZIXA 1SV4A 7ICGA 1QQRA 4JL9A 2F1JA 4DOBA 4GGQA 3DVGY 1Q3VA 4NJ8A 4O3OA 1WM3A 2M1MA 3ISBA 3IAS1 3LYYA 4HDQA 2C9WB 1S77D 3DBLI 5AZFA 4EZJA 3RH4A 2OJWA 1TJEA 3N1ZC 8ICAA 1CUKA 3PRZA 2MQJA 4F5OA 1RFAA 2GLSA 4L23A 4KLTA 2HHWA 4M9HA 3UM9A 1DOIA 3GZNI 2LVPA 4ELUA 3OGUA 2ON8A 1L7PA 1ZQLA 4FBTA 3ZDMC 2WU2B 2KP7A 5JTIA 1TAUA 1JWSD 3BDPA 3L16A 1LV5A 4C8MA 4YMOA 2ISPA 4K7UA 3PSPA 3VVWB 5AHXA 4OJ6A 2NBVB 4II3B 2JEGA 4C80A 1ZPSA 2GWSA 2Z7JA 1LFDA 5KFQA 4EEYA 4CRXA 2NBUA 2RLTA 1XLQA 3E9SA 3KKAA 3C29A 1VLBA 4FA6A 4C4TA 2BCSA 4IC9A 1PGBA 1X40A 1L7OA 1QQ6A 7ICSA 1X9XA 9ICJA 4P4PA 4OJ5A 2JWZA 4RUAA 2PKEA 3RRHA 2FLPA 4DK5A 4M0AA 2BYVE 4DL6A 3UMGA 4GN1A 2O6VA 4WJQA 1JN3A 2WX1A 3WANA 4UQGA 3I9V1 1BXTA 4RUCA 4Y2TA 3F2BA 2GH1A 1CZPA 1V9JA 3M8RA 3GV5B 2M0NA 4ZYNA 3ZTDA 3RUIB 3DPDA 1YIWA 5ALRA 1ZE3D 4MJSB 3PSFA 4GDKB 4B0MA 1EXNA 2BQRA 2BYFA 3IHPC 3RBDA 4ED8A 2N1VA 5L1LA 1NI3A 2J4XA 1I4PA 2KMCA 2Y3AA 4KGSA 5AKJA 3FDSA 1BPYA 1RDFA 4EYHB 2LVOA 1ZQTA 1RZTA 3IV6A 1L7MA 2EZZA 1NVID 2FDRA 2YB4A 3QHTA 4UATA 3Q8RB 1V5OA 5G5HA 3P4RB 7ICIA 4U7CA 4CNQA 1AW7A 4KLQA 3W1YA 2V0GA 2GMIC 5AUKA 1RRBA 4IQUA 3BK2A 4C4VB 4UB1A 4C7YA 1ZQGA 5GTIU 4DSLA 9ICKA 1FNVA 1GUAB 2UVVA 4YVZA 1YX6B 2B76B 2MUTB 3TARA 3CF6E 4YT0B 8ICJA 2G06A 1KLGD 2PFQA 1ZQWA 4QZIA 2WDRB 2YVCA 2G07A 2DX5B 8ICUA 2W9AA 3RH6A 5KL8B 1B9RA 3EFCA 2KWVB 1Z00A 3SYZA 1YQ3B 4ASWC 1FFUA 5J29A 1RQLA 2BYTA 5AI9A 4HWIB 1VJKA 4QW8A 2V1YA 4EENA 3GZFA 4BBNF 4A6QA 4FZNA 4R65A 4N59A 2KD0A 3AMZA 2IHNA 4G0NB 3OJ4B 1JI7A 4YTNB 4PHAA 5AI8A 2LM1A 1WE6A 2WB1C 1COKA 1N5WA 2LXCA 2WF9A 4Q44A 4UB2A 4J9MA 4AYBC 4DQQA 1VCBA 1ZQMA 1WX8A 4DL2A 1IBXA 3AQEA 1D9FA 7ICRA 3ENEA 2NRZA 1LO5D 5C2TB 3NVWA 1U4BA 3ISDA 3NUQA 9ICRA 3M9OB 2N7DA 3A9KB 4K4IA 2YQEA 4Z6EA 4WWPA 5KT2A 3RD2A 3OLMD 2JZ3B 4DFDA 5J0YA 2NCNA 5AK4A 4YD2A 2WXRA 1NK0A 2WF8A 2L52A 5CEHA 3GIKA 3MJ5A 2E6XA 1TS4A 1OGWA 1QLNA 1NENB 2ZCBA 1J2NA 2KN7A 4EZKA 3TEYA 2XNAC 2HHSA 1ZQIA 5G2NA 2KDFB 3FKYA 4UB8U 2BGFA 3SFEB 1Z1BA 1F9JA 3TBLD 1QQ5A 4J03A 2KFKA 2IO1B 4DFMA 4DOAA 5GMVA 4IOIE 4FJZA 1JWUD 4II2B 4URKA 3ICXA 4ACOA 2RP5A 2LKYA 4CF4A 3UQ0A 2PJHA 4MHVA 5HG2A 3ED5A 2C2RA 4CE6A 2PI4A 4KGRA 3GIMA 2LGDA 3RJJA 2PPHA 2PIAA 3GU3A 1KTKA 3KHRA 4DQIA 2D3BA 3L08A 1A76A 3C19A 2HVHA 2QB1A 5JUMA 1F2RI 4XZ4A 3M62B 1WYWB 5E6OA 2DZIA 2YN4A 5KHOA 4F5NA 2W8KA 2F2AB 2LFIA 2RPVA 1SZPA 3TCAA 4NAMA 4M6WB 2Q4TA 1WSPA 2MBBB 3M63B 5DGBA 1YN4A 1T0SC 2IGHA 4UAUA 3AU6A 2IJ0A 3N20C 3N9YC 4YCXA 2KHQA 4WQMA 2ZTDA 4W9IA 3A1QA 1ZQZA 1N5XA 5AKKA 1V38A 1PUTA 1KOTA 4WQOB 5KFAA 2QEJC 1Q3UA 5AZGA 5KFNA 3HK0A 2XY5A 2EKIA 3RB3A 2IYDB 1L8OA 3NGDA 4G9BA 2GRIA 4EBDA 2M8SA 4NY0A 3G6VA 1OEYA 1RPLA 3KFUF 4KMUA 3NHEB 2E3TA 4JE3B 3DWMA 2AHOB 3MDAA 3DDCB 1KH0A 1WI0A 5CTRC 1Q10A 2FMQA 1DRGA 3AU4A 4F5QA 5MPOA 5L95C 3H7PA 2W54A 4MFAA 1E8XA 1L0YB 3VTWA 5C1ZA 2F8LA 2KWUB 4DWIA 4HKZE 4TQRA 3ZDTA 1XO0A 4NWIA 3PR4A 2Y5BB 1BPZA 4ECXA 4B9UA 1H4RA 5L9XA 3DBSA 3EFUA 2ACZB 2OEHA 3C2LA 2WQYB 3AN1A 2BQ3A 1OQQA 4NL9C 1WCNA 4DQPA 7ICPA 3C23A 3FM9A 4JPSA 1ZD3A 2ASDA 2P66A 4QZHA 1L3VA 1NK4A 3T8MA 4QZGA 3U52E 4F91B 1ZQJA 2KMAA 4ARCA 4YD1A 4P0PA 3PZDA 4UAYA 4P1CC 1KRPA 2CU3A 1FCCC 3L13A 5J2AA 1ESFA 2H3QA 2DAJA 2HD5B 3PREA 3VUWA 1VJ5A 4RGTA 3RPFC 3DHIC 2YB1A 5AI5A 3ZJTA 5EE9A 2LJIA 3EUB2 1I7HA 1FXTB 1SE3A 1C76A 2KO3A 5KFRA 1MC8A 1ZP0B 3ZDDA 3CIRB 2A19A 3A9JA 1E8ZA 1OFFA 7ICFA 2ZG6A 1SB3C 3MR6A 2XK5A 2OXOA 1EO6A 4KKIA 3TL5A 2JVCA 5KG4A 3VAWA 3JPTA 4N58A 2KANA 4KLHA 4IDIA 3RNBC 4KX6B 4IM0A 3HM6X 3NVYA 1YZ6A 3SDLC 2L8JA 3S2AA 2E8MA 2G1EA 4JV1A 1X42A 5BO4B 4I2GA 1CJEA 3N97B 2JV3A 5KFIA 5JRTA 2C2EA 4ZRJA 2NPTA 2INCC 4XRHA 2VIXA 2P35A 2IO3B 1TV9A 2KDMA 2BHNA 2WAQF 5G55A 1N63A 1FIQA 3HVZA 1Y56A 3RNGC 1SL0A 5ALZA 4I2FA 5KFYA 2H3IA 3KW5B 4FJVB 3PLUA 3N30A 3L54A 4GOCA 3L0WB 4KLGA 2MJDA 2VZKB 4MM3B 4I6LB 3AQFA 2RDGA 3Q8BA 3D6JA 7ICMA 1X9WA 4XX5A 1TE2A 3WIMA 2JH7A 1TS3A 2KJ9A 5EE1A 3M6ZA 1ZQEA 3UI3A 4PGYA 1V5TA 4LNKA 4O1NA 5AI4A 1IIPA 4RQMA 2WXQA 4FN2A 4DL5A 4KLOA 1ZQ1C 2K4EA 4X5VA 1P7FA 2WXNA 4HLEA 7ICVA 5JHAA 1HA5A 3M3JA 3DCGA 1L7NA 5DB8A 5KFDA 2KTQA 4FHJA 1E0ZA 1FXIA 3PRMB 1QF6A 3AE9B 4NZLB 3OJUA 4DL7A 1HUZA 1NYRA 4DL4A 2NR2A 3KTQA 3QWZB 4K7WA 2M17A 3RAQA 4WIPA 2G0AA 5AKIA 4PZOA 5KFZA 3B0XA 2FE8A 5HHIA 5BPCA 2Y5CA 1SE9A 1MG4A 3MR3A 3GOEA 4A8EA 2GI9A 4EKUA 1WXVA 1SV0C 1COOA 2FCQA 1TY2A 4RM8A 1HEKA 2BB5A 1B0XA 4KZCA 4A55A 4BJQA 4Y2UA 1JROA 2IMWP 3BVMA 5JZEB 3AEEB 9ICIA 5IP4D 1WGHA 1WXAA 5AZHA 3TQ1A 3RN9C 3BQ2A 4GC7A 5AICA 3NZ3A 3SI8A 2JR5A 3RFAA 4QIWC 2BVCA 1V1PA 1SGHA 4E71A 4PHDA 2UVWA 4M9JA 5HMLA 3TKAA 1EWYC 2XIDA 2LRWA 2ZW1A 1LXDA 1WWVA 4QZ8A 2F8KA 4HPMB 1FEHA 1N56A 1HEZE 2E8PA 2ZIXB 3TADA 1FNUA 4EBCA 2PVOD 3MHZA 2KVSA 4IC7B 1FRRA 4R3DA 2WP9B 2QMTA 4BKSA 3R7QA 2Q5WD 2IOFK 4OD0A 5DGAA 1T0RC 1T4GA 4P0QA 3ZNGC 4X57B 4ECZA 2E1EA 2HSZA 1L4DB 1TKYA 2LWPA 9ICAA 2EELA 2IDYA 1E10A 1ZQOA 5CHGA 1HQRD 1BNOA 1PQSA 4JB3A 2L1AA 4M01A 4F2RA 1R4NI 1ZOLA 3URYA 4K81A 4B9NA 2L5YA 3B2GA 3CMMB 1HUOA 1AN8A 3PSTA 3BVGA 1JMSA 4W9LA 1DXSA 3MDCA 4TSSA 5DBBA 3DBRB 4NY8A 3NTUA 5KFXA 1ZD5A 1RLFA 3IBEA 1JRPA 4NLNA 3BINA 5J2KA 4MACA 3A4SC 5FP0A 3OSPA 3PSEB 4DSKA 3ZGZA 2R8HA 3ZRFA 2KDEB 3EYZA 1QCKA 3A0HU 3ZO5B 3WKEA 3ZI4A 3UINB 3CRXA 5CJ7A 2PMZC 4MF2A 3WK5A 1K52A 2H88B 1QSYA 1NI2A 3AM9A 4R8UA 2FJ6A 3LVVA 4GC6A 3JPQA 3TEXA 2W9CB 2Y0SF 4LJXA 1A70A 5DG9A 1H38A 4Q8FA 3GDXA 3AV8A 3UQBA 2JUOA 3KVFB 3RR8A 2NRXA 3GS2A 4AP4C 3K4GA 3VCBA 3AH7A 3BS5B 3C1ZA 3C21A 2L3ZA 5AKLA 3RT3B 3WCQA 5AIBA 1TZOA 2AQ1B 3RNAC 4B9LA 3BY4B 4DSFA 2WXMA 2HHUA 2MRLA 3H9DA 3P4SB 3PS6A 4NJCA 2VKQA 3WKDA 3KHGA 4PJ0U 4OJPA 1F1HA 5J2DA 5CX3A 3V05A 3N4MB 4MGYE 4YFKA 4OJOA 4RQ6A 2NRTA 3HM3A 2ZIVA 2ASQA 2XY7A 3DBLB 1U45A 1V9PA 1WRDB 4CHKA 1AYFA 3QA8A 1UT8A 3TEZA 1L4ZB 3RJKA 3RF9A 1TBEA 3QZ8A 4N6EB 5T8IA 2H3ZA 4O3RA 4KLDA 1BNPA 3H8WA 2XO7A 3RBEA 4RPXA 2KZZA 2BQQA 3GZNB 3PPAA 1Z00B 4QAYA 4Q45A 5IAAC 4OZAA 1JXEA 4PK1A 4CF5A 1I4QA 1ROEA 5ALEA 3H4BA 1QLBB 2JX5A 2JSVX 1UBQA 4JK1A 5ALSA 3PZ8A 1JX4A 2C28A 4MH8A 1WWUA 4F5PA 1ZRMA 3RB6A 1KFDA 4CDGA 1MQ3A 2MW5A 4JIOU 4MFCA 4F4XA 3QUBA 4FJYA 5HHDG 2D07B 2JZPA 1NJWA 5G5GA 5ALXA 5BYRA 4JV2A 1NBFC 1GPXA 3IDWA 1IBXB 2A1AA 5IIJA 3X23A 3OWEB 2J52A 4HRSA 1M4VA 5KG7A 1P98A 2HOQA 3ORYA 4FO6A 1VR9A 2P6RA 3M9NB 1QQ7A 2J0MA 1TTNA 3QEAZ 5KT3A 1SKSA 4JWMA 4I2AA 8ICVA 2PMVA 5KHQA 3F2CA 1D3ZA 2WXGA 3QX7A 4DQSA 2DPJA 1XSNA 5KFJA 4PPXA 1E9MA 4DFPA 1MHHE 1UZXB 1XLOA 5J17A 9ICQA 5KAIU 2GBRA 2V4IB 3DDHA 2UVRA 1ZQFA 2K3UA 5IIIA 3M95A 4KLMA 3IN5A 5AUIA 4GFJA 3RYTA 3Q69A 4R66A 4IM3A 2QB0A 5HKHA 3SAGA 4ICAA 3Q8AA 4BWMA 1WXMA 1ZQVA 2FIFA 3U30A 8ICRA 5D6JB 3OTQA 5J18A 2A1JA 2UU7A 7ICEA 1D8LA 1K53A 3KYDD 2J7QB 3SENA 3UQ2A 5CRXA 3H7SA 2KIVA 2RDIA 4O3NA 2ZVOA 1N6ZA 4EX6A 2AQ2B 3A4RA 2Q0ZX 2DGZA 2KSOA 3HKZC 4ZRKA 3BQ0A 3C2MA 3PW7A 1G6JA 5TZVA 2W03A 2FPLA 4MFFA 3AE6B 2FLLA 3NZSA 2ZIUA 1NNLA 2RDJA 4CGZA 2N9LA 1TK8A 4RGOS 3R7RA 5ALFA 4HXDA 2OJRA
chains in the Genus database with same CATH topology
4YTNB 1QOFA 4CQNA 1YJIA 2ICIA 1N5WA 2YEPF 2YEPB 3R8BA 2VZKD 3LXFA 1IBXA 2LMCA 2J53A 5EE0A 1LO5D 3V3XA 5C2TB 3NVWA 1YN5A 5BMGA 4OVZA 3O13A 1L0VB 2WXRA 1YN3A 3P4QB 1YNTE 4ZYSA 3VRBB 2L52A 1VDVA 4A90A 3MJ5A 2E6XA 3J9CA 3T3NA 3R2IA 1I4RA 1TS4A 1JWBD 2JQRB 1P7EA 3P1MA 3Q8EA 2M56B 2INPE 1JWAD 1NENB 3TEYA 3ZJVA 2N7JA 2XNAC 4OZCA 1UWMA 3NS1A 2BS3B 2IGDA 2PTLA 3SFEB 4P16A 3EA6A 4AQ7A 1FM0D 2XN9C 1KFYB 4IOIE 2WNMA 1JWUD 4JX1C 3W2DA 1D6EC 2JXTA 2BTEA 1ZUD2 1J7BA 1EWCA 5HG2A 3BYYB 2CJNA 4KGRA 3SR6A 5FK9C 2LUMA 1ZDVA 2PIAA 1KTKA 2HTME 4NAWB 2ZW0A 1F2RI 3VQIA 2N9KA 4EE2A 2LFIA 2V3PA 2RPVA 2WDQB 1CK1A 1F77A 3H8HA 5EE3A 4NAMA 1WSPA 1JMLA 1YN4A 4KKJA 2IGHA 1OQRA 1L5PA 2MJ3A 2IJ0A 3N9YC 2K9XA 4WQMA 5D3IB 1SXTA 2J42A 2K5PA 5E6JA 1QT9A 1N5XA 2L32A 2I2YA 1PUTA 2KACA 2V3NA 3PZ7A 2QEJC 3AECB 2NTTA 4IKGA 1GB4A 1JWMD 2KN4A 2N0SB 3R2TA 2EKIA 4FXCA 4LLGM 2GRIA 3VRAB 1UUPA 2Y5PA 5GXGB 3ZJUA 3PO0A 4JE3B 2E3TA 3DWMA 1BUIC 1KH0A 1MHXA 1Q10A 1VZ7A 1D4BA 1C9FA 5MPOA 1SF0A 1XCTL 2W54A 1C4PA 1L0YB 1V1OA 4C56C 1EU3A 4HKZE 1KLUD 3MP9A 1J7CA 3ABVB 4AS1A 2ACZB 3TSSA 1QKZA 4REZA 2WQYB 3AN1A 1OQQA 5FKAC 1KF6B 2W3RA 1N62A 4JPSA 2W3SA 2MEKA 3CWIA 1SEBD 1XXGA 2RDHA 3HVDA 3P63A 3EGRA 1MPEA 3U52E 2BS2B 1DOYA 1RM6C 4JWSC 3BK1A 4YXDB 4ARCA 2KQ4X 5H8YE 2CU3A 1FCCC 4XE0A 1ESFA 3L4PA 3IT4B 1MVKA 4RFBA 1WXQA 4RH6A 1PFDA 1N60A 4US8A 4KGTA 4RGTA 3RPFC 3ZJTA 2OEDA 2LJIA 1ZOYB 2WXIA 3EUB2 5EE9A 1DOXA 1HZ6A 1I7HA 3AE8B 1SE3A 1C76A 3HRDD 3GP7A 1FMAD 4TMAB 3AE7B 1T5XD 1ZP0B 4YTPB 1JQ4A 3CIRB 1MI0A 2M0AA 1FNWA 1OFFA 3FC4A 1I4XA 1SB3C 5D3DA 2G9HD 4HEA1 4KKIA 1BMLC 1JALA 2LGIA 2OHFA 5H92C 4N58A 3U2SC 3NUHB 3AEDB 1AWDA 4IDIA 2BB6A 4KX6B 4OW0A 3NVYA 2MJEA 1UNSA 2G1EA 4DXGA 1ACCA 2JYTA 1R7SA 1CJEA 4RNAA 4ZHPA 4YSYB 2KDMA 2AX5A 4P6VF 1RFKA 1N63A 1FIQA 2GB1A 1Y56A 1SSNA 4C7ZA 2WS3B 3HVZA 2QILA 1V97A 1PDXA 3AE3B 4US9A 3NRZA 2VZKB 2MJDA 3IXSA 4RGNA 1QILA 3BVZA 4MM3B 1QOGA 1VZ6A 3AE5B 2RDGA 3Q8BA 3U4EG 1FXAA 4B0EA 1TS3A 4D2KA 4GLSC 3BYTB 4Q2JA 5EE1A 2PVGC 3UI3A 1D5MC 4DQOC 1L6VA 4YSZB 4O1NA 2WXQA 3BZDB 2MH7A 1ET6A 1B1ZA 2WXNA 1P7FA 2M19A 1XLNA 1HA5A 1J7AA 5LNK1 1C79A 1SBBB 1E0ZA 1FXIA 4A9AA 1QF6A 1ET9A 1F2RC 1PGAA 3AE9B 5TSSA 2WXFA 4NZLB 1NYRA 5HFYA 4YWGG 5BMIA 3SFDB 2BS4B 2LHEA 3IAM1 4WIPA 3AE2B 2JWUA 2FUG1 1ZXHA 2FE8A 2LEKA 2Y5CA 1K51A 3W5VB 4LTUA 1XEEA 2GI9A 2PW9A 1TY2A 2WXOA 4TQ1A 2DWQA 3E56A 2BB5A 2WXPA 1SE4A 2KMMA 4A55A 1JROA 3BVMA 3AEEB 3C8YA 3AE4B 4JWUC 1E6EB 1ENFA 3NVZA 2INNE 3AEAB 4XDDA 3NZ3A 2WXKA 5HI1A 1DYQA 1V1PA 3P4PB 1C4AA 4RF1A 1IGCA 2JU6X 1EWYC 3T3OA 2QJLA 2ZW1A 4MT5A 2WDVB 1FO4A 1FEHA 1HEZE 2SAKA 1FNUA 1WGKA 2PVOD 3MHZA 1FRRA 4R3DA 2WP9B 2QMTA 2Q5WD 1TKYA 1L4DB 2D5GA 2BT6A 2DBYA 3DWGC 2EELA 4L2YA 2IDYA 2CJOA 1E10A 3BIID 4RGMA 1HQRD 3RFZB 2L1AA 2IPKD 1E7PB 2DYMA 3KQ4A 5FR3A 1KRHA 4OZBA 3URYA 4DXFA 3VR9B 2QSDA 2W55A 1WYGA 1K50A 4WURA 3B2GA 1QOBA 2JYEA 3AEBB 1YQ4B 1T3QA 1AN8A 3Q8CA 3SEBA 3BVGA 3ZQ4A 4TSSA 2Z8LA 4YSXB 3KWLA 2AQ3B 5BYQA 1C4CA 2TSSA 4HROA 3LB8C 1RYJA 1JRPA 1TY0A 4ZRPA 3KLSX 4MACA 2IGGA 4USAA 1L0XB 1PYWD 2WLBA 1FRDA 3ZGZA 4ZOHC 1XO3A 4OHJA 1V1PB 1TS2A 2KWDA 2LHDA 4ZRQA 1L6UA 2WXLA 2BBCA 1D5XC 1YMHE 2W82A 4WWMA 3B2FA 2DLBA 3BWUD 1K52A 2NMQA 3Q8FA 2H88B 3AM9A 3TEWA 4RF0A 1CQVA 4GDLB 3TEXA 3NVVA 1A70A 3MFGA 3KWVA 2RMMA 5BMHA 2FBWB 5JXVA 3AE1B 3AV8A 3GS2A 4PT5A 4LK0M 3ETRA 3AH7A 1NEKB 3FILB 2DYOA 3WCQA 4WAFA 1TZOA 2AQ1B 1QOAA 2WXMA 3GB1A 4M0WA 1C77A 1D5ZC 3P4SB 1TYGB 4NJCA 3TUOA 4UDUC 1GAQB 3AEGB 1SE2A 1QQRA 3V05A 2L83A 1HZ5A 4ARIA 1XCQL 1TKEA 2PKOA 1C78A 3LYYA 3IAS1 1SIJA 1AYFA 1EU4A 1TKGA 1I4HA 1TJEA 1VZ8A 3TEZA 1L4ZB 4HKQA 1DGJA 4N6EB 5T8IA 4L23A 1FD6A 1STEA 3MC0B 1DOIA 1ZDXA 5I4DA 4OZAA 1I4GA 2ON8A 4XDCA 1I4QA 1ROEA 4J3OD 1QLBB 2QIEB 2JX5A 2WU2B 4H2AA 2JSVX 4A8XC 3ZYYX 1JWSD 3PZ8A 5C3JB 1GOZA 4MH8A 4ZHOA 1RWSA 4C80A 1ZPSA 2WU5B 1NYQA 1PGXA 1TS5A 4XWWA 1XLQA 3E9SA 5HHDG 1VLBA 2JZPA 3HUIA 1PGBA 2WXHA 5G5GA 5BYRA 1SJHD 1IUEA 5BYSA 1GPXA 1N61A 2I38A 1IBXB 3OWEB 3W1SA 2J52A 4HRSA 1M4VA 1UWXA 2R61A 1T6BX 1XF5L 1VR9A 2WXJA 3I9V1 1BXTA 1F0ZA 3P42A 4RCOA 3AEFB 1CZPA 2ONQA 2PMVA 1YJJA 2K22A 2WXGA 1VRAB 1ZE3D 4ITKA 4GDKB 4B0MA 1E9MA 2PLPA 1MHHE 1IGDA 2K0PA 1HXYD 1JW9D 1XLOA 2SEBD 3FILA 1WRIA 1ZXIA 3IT6B 2V4IB 1NI3A 2BW2A 1I4PA 2J4XA 2Y3AA 4KGSA 2K3UA 4L1BA 4WH4A 1JCKB 5AUIA 1NVID 2X38A 3Q69A 1FCLA 3FAHA 3P4RB 5G5HA 1AW7A 2V0GA 2H89B 5AUKA 3BK2A 3Q8AA 3W5UB 4YTMB 4C7YA 1FNVA 3U7ZA 3B9JA 1K53A 1SJED 2B76B 1UGJA 3I57A 4YT0B 1KLGD 2HDEA 2KAJA 4XWTA 3W9CB 1GB1A 1WWTA 2WDRB 5D7GA 3VR8B 2AQ2B 1FFVA 1B9RA 1YQ3B 1XLPA 3AB5A 1FFUA 2NTSA 3AE6B 2BYTA 1VJKA 4HJGE 2N9LA 4A6QA 4RGOS 1EM7A 1V8CA 4TQ0A 4N59A 3AMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTN B;  1QOF A;  2L83 A;  2DWQ A;  1YJI A;  1N5W A;  2KMM A;  1TKE A;  2PKO A;  1JRO A;  3AEE B;  1SIJ A;  3LXF A;  1J7C A;  1AYF A;  3ABV B;  1TKG A;  3AE4 B;  1TJE A;  4JWU C;  1E6E B;  1DGJ A;  3NVZ A;  2ACZ B;  2WQY B;  3AEA B;  5EE0 A;  3AN1 A;  4N6E B;  1OQQ A;  5C2T B;  3NVW A;  3P4P B;  1KF6 B;  2W3R A;  1N62 A;  2W3S A;  1DOI A;  3CWI A;  1EWY C;  2QJL A;  1L0V B;  1ROE A;  3P63 A;  1QLB B;  2QIE B;  3P4Q B;  2JX5 A;  2WU2 B;  2WDV B;  3VRB B;  2BS2 B;  2L52 A;  1RM6 C;  1FO4 A;  4JWS C;  3ZYY X;  4YXD B;  1DOY A;  1VDV A;  5H8Y E;  2CU3 A;  1WGK A;  2PVO D;  5C3J B;  3L4P A;  4ZHO A;  1RWS A;  1FRR A;  1JWB D;  2JQR B;  1WXQ A;  2WP9 B;  3P1M A;  4C80 A;  1N60 A;  1PFD A;  4US8 A;  2M56 B;  1JWA D;  1NEN B;  2Q5W D;  1NYQ A;  2WU5 B;  3RPF C;  5EE9 A;  1ZOY B;  1XLQ A;  3EUB 2;  1DOX A;  1VLB A;  1I7H A;  1TKY A;  3AE8 B;  3HUI A;  3HRD D;  2BT6 A;  5G5G A;  2DBY A;  3DWG C;  1FMA D;  1UWM A;  4YTP B;  3AE7 B;  3NS1 A;  1IUE A;  1ZP0 B;  2CJO A;  3CIR B;  2BS3 B;  1N61 A;  3BII D;  1E10 A;  1GPX A;  1JQ4 A;  1OFF A;  3SFE B;  3FC4 A;  1E7P B;  1SB3 C;  1KRH A;  3VR9 B;  1FM0 D;  4HRS A;  2W55 A;  1WYG A;  1KFY B;  1JAL A;  2OHF A;  5H92 C;  4N58 A;  4JX1 C;  3B2G A;  3AED B;  1AWD A;  4IDI A;  1QOB A;  1J7B A;  1ZUD 2;  4KX6 B;  3AEB B;  3NVY A;  2MJE A;  1F0Z A;  1YQ4 B;  1T3Q A;  2CJN A;  3AEF B;  3SR6 A;  1CZP A;  1YJJ A;  2G1E A;  2K22 A;  1R7S A;  1CJE A;  4ZHP A;  2PIA A;  4YSX B;  3KWL A;  4ITK A;  2HTM E;  4YSY B;  2AX5 A;  4P6V F;  1RFK A;  1E9M A;  1N63 A;  1FIQ A;  3HVZ A;  3LB8 C;  4HRO A;  4C7Z A;  1JRP A;  1JW9 D;  1RYJ A;  1XLO A;  1V97 A;  1PDX A;  1WRI A;  2WS3 B;  1ZXI A;  3AE3 B;  1NI3 A;  4US9 A;  3NRZ A;  4USA A;  2MJD A;  2WLB A;  1FRD A;  4ZOH C;  2WDQ B;  1QOG A;  1NVI D;  1XO3 A;  3AE5 B;  5AUI A;  5EE3 A;  3FAH A;  3P4R B;  5G5H A;  1FXA A;  1L6U A;  1OQR A;  1L5P A;  2MJ3 A;  5EE1 A;  2H89 B;  2PVG C;  5AUK A;  2K9X A;  1L6V A;  4WQM A;  4YSZ B;  4WWM A;  3B2F A;  2K5P A;  3W5U B;  4YTM B;  4C7Y A;  2H88 B;  1QT9 A;  3B9J A;  3AM9 A;  2MH7 A;  1N5X A;  3NVV A;  1A70 A;  1PUT A;  1XLN A;  2B76 B;  2M19 A;  2FBW B;  1J7A A;  4YT0 B;  3AEC B;  3AE1 B;  3AV8 A;  1E0Z A;  1FXI A;  4A9A A;  1QF6 A;  2KAJ A;  2N0S B;  3AE9 B;  2EKI A;  4FXC A;  3W9C B;  3ETR A;  1WWT A;  2WDR B;  1NEK B;  1NYR A;  3AH7 A;  5GXG B;  3VRA B;  3PO0 A;  3VR8 B;  2E3T A;  1FFV A;  2BS4 B;  3DWM A;  3SFD B;  1B9R A;  3WCQ A;  3AE2 B;  1YQ3 B;  1XLP A;  3AB5 A;  1QOA A;  1FFU A;  3AE6 B;  1VJK A;  2LEK A;  2Y5C A;  3P4S B;  1TYG B;  5MPO A;  3W5V B;  4LTU A;  1SF0 A;  1V8C A;  2W54 A;  1GAQ B;  3AEG B;  4N59 A;  3AMZ A; 
#chains in the Genus database with same CATH topology
 5AM5 A;  1QOF A;  1WGY A;  3R66 C;  3Q8S B;  3IRU A;  5T14 A;  2YTU A;  3AU5 A;  4HCP B;  4UB4 A;  3R8B A;  2VZK D;  2KEY A;  2KJ6 A;  3TFR A;  4KLI A;  3LXF A;  4EEW A;  3IG3 A;  2UWQ A;  4EBE A;  2DUY A;  3DBH I;  3TAN A;  3NOB A;  2J53 A;  5J0U A;  4M02 A;  1WXS A;  3V3X A;  4DXA B;  1YN5 A;  1X66 A;  5KAF U;  4B9S A;  5KT7 A;  1WR6 E;  4KX3 A;  2KK8 A;  2G08 A;  5CA7 A;  1PZN A;  5AM0 A;  3PX4 A;  5J0P A;  2KWC A;  3N32 A;  3O13 A;  1L0V B;  3F2D A;  4IWP A;  3UQA A;  1U48 A;  3IG5 A;  3DV9 A;  4KLU A;  4MSM B;  9ICV A;  3OHA A;  2A5U A;  5KT5 A;  1E5W A;  3P1M A;  1K5O A;  2M56 B;  2KZM A;  4LJP B;  3ZJV A;  2N7J A;  2KFZ A;  4OZC A;  1IV8 A;  2ZZP B;  4YQW A;  4DF4 A;  2JGA A;  1UWM A;  4RQ2 A;  5EDS A;  2N9P C;  2BDP A;  2JEI A;  2PTL A;  8ICE A;  3GII A;  8ICC A;  4AQ7 A;  1KTQ A;  3EPI A;  3QC8 B;  2KJH B;  2JH1 A;  3ZNI D;  1ISN A;  1KFY B;  4KMO B;  1D8Y A;  3BQT A;  5ALP A;  1T0Q C;  1D6E C;  4A3O A;  1ZUD 2;  5E79 U;  1NK9 A;  2VRR B;  1B22 A;  2IBK A;  1TT5 B;  3BYY B;  2CJN A;  3SR6 A;  1S0M A;  4P0P B;  2KOX A;  4WWN A;  4RT2 A;  3EWA A;  2FMP A;  4RQ8 A;  1WMH A;  5J2B A;  1SKW A;  1WCL A;  3ETL A;  3NG0 A;  2ZPY A;  2ZW0 A;  3ZDA A;  4GIB A;  3SV3 A;  4NL9 A;  3QU5 A;  4DHZ E;  5ALK A;  1HE8 A;  3PHW B;  3PW2 A;  4EE2 A;  3D2N A;  4GB9 A;  1SL1 A;  3JW0 X;  1C1Y B;  2I9G A;  2BPF A;  2FCS A;  2WDQ B;  5EE3 A;  4UAS A;  1RYS A;  2WHI A;  4AJW A;  3H8M A;  2XK5 B;  2OCE A;  1OQR A;  1L5P A;  2MJ3 A;  2W11 A;  4P4M A;  2K9X A;  4FZL A;  1SXT A;  4QNL A;  3ONS A;  1QT9 A;  4O9M A;  1GC7 A;  2L32 A;  4IQT A;  2R18 A;  3KBB A;  3MGH A;  1BT0 A;  3PZ7 A;  2NPT B;  4IKG A;  4MEL A;  3R2T A;  3EHV A;  4PL1 A;  5AK3 A;  4LLG M;  2Y5P A;  5GXG B;  5C5J A;  4ECR A;  3DHG C;  3ZJU A;  2QCZ A;  2B0C A;  2MP2 B;  1BUI C;  1KN5 A;  4PHE A;  2YMQ A;  4JLC A;  2L05 A;  1VZ7 A;  1KJT A;  2E1F A;  3UXO A;  9ICW A;  1TZ1 A;  4IRK A;  1KQQ A;  4TUP A;  3ALB A;  2VJ5 A;  1MQ2 A;  4ED0 A;  1KSP A;  5DPW A;  4IW0 A;  3WAL A;  7ICJ A;  4C56 C;  4S17 A;  4NV0 A;  1L6N A;  1E90 A;  4C8K A;  2WFA A;  3UMC A;  5ALG A;  1ZQD A;  4FBJ B;  3V7J A;  1J7C A;  4ED6 A;  4JQW C;  1WH3 A;  4W9C A;  4DDI D;  8ICB A;  1QKZ A;  4RQ3 A;  2D10 A;  3OAW A;  4F3O A;  9ICP A;  1N62 A;  1S1Q B;  4ED7 A;  3CWI A;  3EEC A;  2IZV B;  5KFG A;  4F7Z A;  3N1Y C;  3P63 A;  3EGR A;  4UAW A;  2BS2 B;  1DOY A;  1UH6 A;  3ZTC A;  2KQ4 X;  9ICG A;  4XE0 A;  2LZ6 A;  4KLL A;  2HBM A;  1MVK A;  4RFB A;  1KLV A;  3MC1 A;  3IP4 B;  2K6D B;  1V85 A;  4QZC A;  4KZ0 A;  4NAW A;  5C0Y A;  1Y8R C;  4M9N A;  3FYH A;  1ZOY B;  2WXI A;  2LGX A;  2YY6 A;  2H5X A;  4DSI A;  3GP7 A;  1UEL A;  2VA8 A;  5J0R A;  2Z0D B;  4TMA B;  4CF3 A;  2UYZ B;  1D8B A;  1ZQN A;  1MI0 A;  4PGQ A;  2IHM A;  2AQ4 A;  2ODG A;  2AL6 A;  2BF8 B;  2KQ7 A;  4KIK A;  3WK8 A;  4ECY A;  2XEW A;  2RHF A;  2BKF A;  5D3D A;  3A0B U;  2F3N A;  1V6E A;  4HEA 1;  1JAL A;  2OHF A;  2LGI A;  4R64 A;  2BZF A;  3NUH B;  1SGG A;  3TMP B;  1SV0 A;  2BB6 A;  1SWW A;  4OW0 A;  7ICN A;  3M9M B;  3C1Y A;  3PO5 A;  3PTF C;  5J0X A;  5TR5 A;  1ZQB A;  1QTM A;  4DXG A;  1ACC A;  4RNA A;  2F77 X;  1J19 A;  2AX5 A;  4P6V F;  5DPS A;  3MFH A;  2GB1 A;  4PS8 A;  2X8X X;  4DF8 A;  1L8L A;  4US9 A;  4M2Y A;  3PW5 A;  4IQW A;  2KNJ A;  4RGN A;  1QIL A;  2KFN A;  4ECW A;  1QOG A;  1GNU A;  1TVA A;  3RMK C;  3BQ1 A;  4KLF A;  4J9S A;  4B0E A;  3HT3 A;  8ICK A;  1FXA A;  4ECQ A;  2ZJA A;  1AAR A;  2FAZ A;  4GLS C;  4Q2J A;  4PS7 A;  2PVG C;  3GIL A;  1D5M C;  4DQO C;  1L6V A;  4BXO B;  1ZJM A;  5D4B A;  4C0Z A;  4Y2J A;  2KTR A;  5AKY A;  2G5H B;  3QU4 A;  1B4F A;  1S3S G;  2M19 A;  2D3A A;  2KC1 A;  3CNH A;  3HIL A;  4LDT D;  1C79 A;  1SBB B;  2J0J A;  3Q14 C;  2MSN A;  3D2S A;  2KN5 A;  5EWE A;  3K9P B;  2BWE S;  5J2R A;  3KZX A;  4BUG A;  4I2C A;  2V4Q A;  2V3S A;  5HFY A;  3SFD B;  3PLV A;  2WF5 A;  3AE2 B;  1NK7 A;  4DHJ B;  2JWU A;  2KXJ A;  3PGE A;  5AM3 A;  2EDU A;  2NYV A;  5DKW A;  1ZXH A;  2FI1 A;  2CR5 A;  2I5H A;  2LGS A;  4NPN A;  1L3S A;  1S0V A;  5ALN A;  8ICP A;  4M00 A;  2I1K A;  1LKY A;  3DHH C;  1ZD2 P;  1XEE A;  4LTU A;  4RPY A;  4XGA B;  3PT2 B;  2ATL A;  3AL0 B;  3RJH A;  3H8S A;  4F4W A;  3T5J A;  2WXO A;  2MRP A;  3MTN B;  2KFJ A;  2KG5 A;  2E8N A;  2BKR B;  2WXP A;  4PGX A;  2K8B A;  5IIM A;  3C8Y A;  3T9L A;  5AKG A;  2GO7 A;  4YN4 A;  2LUE A;  4LJO B;  2OOB B;  3UXN A;  2MLB A;  1VD2 A;  3A33 B;  4XA5 A;  3L5K A;  2O2V A;  3RR7 A;  4XDD A;  3V72 A;  2W9B A;  3H7I A;  2WHE A;  1DYQ A;  2KHV A;  2JU6 X;  3SZ2 A;  2AXT U;  4LCD E;  5ALU A;  1O03 A;  5JHB A;  1YD8 U;  3T79 A;  2G09 A;  4BAX A;  2SAK A;  2K89 A;  4EEK A;  3TAC B;  4GDL A;  3MR2 A;  2HJ1 A;  2ZTE A;  1WUD A;  3SQI A;  2A3V A;  2MBQ A;  1KFS A;  2ZXH A;  4WWO A;  2K25 A;  4LZG A;  3NZU A;  3ZD8 A;  2BT6 A;  2DBY A;  2ZIW B;  1JRU A;  4L2Y A;  2CJO A;  5ALL A;  3BII D;  1Q5W B;  4GXJ A;  4KDL B;  2PFN A;  3Q8Q B;  4NLB A;  4F2S A;  1R4N B;  1E7P B;  2IPK D;  2LAS A;  5FR3 A;  3LVW A;  1KRH A;  3PW0 A;  2QSD A;  5DB6 A;  4B9T A;  4K1R B;  1WYG A;  3ZIM A;  1MJD A;  4UBC A;  3T3F A;  3PW4 A;  2YX8 A;  4LVS A;  2JYE A;  4G3I A;  2KDB A;  4N9F 4;  2NO4 A;  4CYE A;  2L0T A;  1YQ4 B;  1T3Q A;  3HWT A;  2EQY A;  3ZDC A;  3UIP B;  4EZL A;  3J81 j;  3ZLZ A;  4O5C A;  2AQ3 B;  1ZQP A;  4AOF A;  5IIL A;  2HOF A;  4IRD A;  1S97 A;  3LB8 C;  1YQB A;  4ZRP A;  3PX6 A;  2IBI B;  2KZR A;  2ZUB A;  1KM7 A;  2IGG A;  4XC2 A;  2WLB A;  2KOB A;  5KFE A;  4ZOH C;  3PVX A;  1L6U A;  2PI5 A;  3H0L B;  4Y2R A;  5KNI A;  1NJZ A;  2BBC A;  2J0K A;  5IO9 A;  1RYU A;  1XU4 A;  2AGO A;  2K39 A;  4ECV A;  3WK6 A;  2WB1 F;  5KFM A;  3BWU D;  5J2C A;  1F5S A;  8ICW A;  3ECI A;  3TEW A;  5D2M B;  5ALM A;  2MBH A;  2H3V A;  5EWG A;  2XBB C;  2RMM A;  1KW4 A;  1V49 A;  4AYB F;  2GBK A;  5BMH A;  5JXV A;  2P6U A;  3RTV A;  4PT5 A;  1TKD A;  1ZQC A;  5KL1 B;  4LK0 M;  4QZ9 A;  5L1I A;  3WKA A;  5DLF A;  1MFW A;  3KUD B;  2QKQ A;  5J2H A;  4GMV A;  1ZQU A;  2HTH A;  2WYQ A;  1UGM A;  2F44 A;  3HJE A;  4W9F A;  4K4G A;  2XGQ A;  2MAX A;  3QU2 A;  1JIH A;  2HVI A;  1XQQ A;  2KX3 A;  4GIV A;  4C4S A;  5ALJ A;  2QHO A;  4B9M A;  3V6K A;  1C77 A;  1D5Z C;  1TYG B;  4UDU C;  2QB0 B;  1WZ0 A;  2CHW A;  3K75 D;  1SXD A;  2MA9 B;  2WWZ A;  4RPZ A;  5LXI B;  8ICX A;  2L83 A;  4ARI A;  1S8O A;  2PXI A;  2KK0 A;  4OJL A;  1IP9 A;  1TKE A;  2VH1 A;  3NS8 A;  2A1J B;  3VDZ A;  4JUZ A;  3PV1 A;  2KMD A;  1Y88 A;  4KN4 A;  2XCP A;  4O3P A;  5J2E A;  2A4Z A;  2C60 A;  4J9O A;  1EU4 A;  1I4H A;  3BJY A;  2HMX A;  3QUT A;  4C8L A;  2D8C A;  1DGJ A;  1TKG A;  1WZ3 A;  3DVN U;  3RI7 C;  2BWF A;  3GE3 C;  4K3C A;  2ZUC A;  3WKB A;  4QZE A;  4RNN A;  1ED1 A;  2BCV A;  4F4K A;  1STE A;  3MC0 B;  4FBU A;  4J3O D;  1PK1 A;  3WK4 A;  1FEZ A;  2R8J A;  2HHX A;  1XD3 B;  1U47 A;  2QIE B;  4C4V A;  3B0A A;  1ZQX A;  2KKV A;  2ZIU B;  3PZP A;  2I1Q A;  2MCN B;  4A8X C;  4NLG A;  5C3J B;  4KLE A;  1QSS A;  1GOZ A;  2M0X A;  5EWF A;  2MUT A;  4C00 A;  4O5E A;  4UB6 U;  3LYS A;  5ALO A;  2WU5 B;  4YXJ A;  1Q8K A;  2OYY A;  1E7U A;  1NYQ A;  4XWW A;  5ALQ A;  4FUL A;  5D46 A;  3HUI A;  3AU2 A;  1M94 A;  4ACF A;  4C8O A;  4IWO A;  1N61 A;  3V62 A;  3N7S C;  5HR6 A;  3ZDB A;  1S9F A;  2I1J A;  1UWX A;  5IIO A;  5DLG A;  2LYH A;  1S10 A;  1T6B X;  2W9N A;  2K8C A;  3JPR A;  2ZPN A;  3I1Y A;  4AUQ C;  1RQN A;  5J0Q A;  2JRH A;  4M0W B;  1XSP A;  2DZJ A;  4K7S A;  3AEF B;  3H0M B;  2ONQ A;  4UW9 A;  1YJJ A;  4RT3 A;  2KKC A;  5DBC A;  2HBJ A;  4RNO A;  1HIW A;  3HP6 A;  3H6N A;  4MGI E;  3CP8 A;  1MG8 A;  3MC8 A;  1P3Q U;  2PLP A;  3KYC D;  1IGD A;  2D3G A;  1HXY D;  2SEB D;  1HTQ A;  4TUR A;  1WRI A;  2REX A;  1ZXI A;  3IT6 B;  3QQ8 B;  4L1B A;  2BW2 A;  4ZRQ A;  3H40 A;  4QW9 A;  4RQ0 A;  2DHZ A;  2AEH A;  2X38 A;  3AXC A;  2ZVN A;  2H89 B;  5ALH A;  1URJ A;  2JZB A;  2C22 A;  2K8H A;  4PHP A;  5DB9 A;  2KNB A;  3RZW C;  2NS5 A;  3B9J A;  1WE7 A;  2GOW A;  4I27 A;  1SJE D;  3DVN V;  2DF4 B;  4Y2Q A;  3I57 A;  4UAR A;  4Z6C A;  2OH2 A;  4I2J A;  2RR9 A;  2HDE A;  4ED3 A;  2KAJ A;  2IA6 A;  5D7G A;  2MA1 A;  3OSN A;  3CW2 C;  2JEJ A;  2FID A;  3P2B A;  2JPH A;  5IKC M;  3HX0 A;  1NK6 A;  4M8M A;  1RAX A;  2G4D B;  5KG6 A;  2NTS A;  3W1S C;  4QWB A;  2O6V B;  4HJG E;  4HPP A;  3RNF C;  1A0P A;  4HYK A;  2XY6 A;  1EM7 A;  1QH9 A;  1V8C A;  3L10 B;  2AWT A;  4IWQ A;  4CQN A;  3WAP A;  5L83 A;  3UF8 A;  3V7K A;  4GXI A;  2F1I A;  1WJ4 A;  2YEP F;  5J8Y C;  2YEP B;  2QAR A;  4UAZ A;  5AI0 A;  4O3Q A;  5CR0 A;  8ICL A;  2CU1 A;  3DBH B;  3QCA A;  4BX9 C;  4ECU A;  5EOZ A;  1Z4N A;  3NY5 A;  4NJ6 A;  2OM6 A;  2C7N B;  2LMC A;  4J9Q A;  4XYC A;  4EUT A;  4IUM B;  4ANW A;  4M6W A;  4NJ7 A;  4OVZ A;  3DEE A;  8ICI A;  3AUO A;  3V7L A;  3P4Q B;  2HHQ A;  1YNT E;  1KLN A;  2K6Q A;  4P2H A;  3ZNH B;  1VDV A;  2HHT A;  4A90 A;  1LVH A;  3J9C A;  1CI4 A;  2CN1 A;  3R2I A;  3N7P D;  1I4R A;  8ICS A;  2JQR B;  3Q8E A;  5DQI A;  3B1L X;  4DWF A;  3NRW A;  1Q46 A;  3PVL A;  3Q8L A;  5AK6 A;  4YP3 A;  2IGD A;  3H8J A;  3VH4 B;  4B9V A;  3V6H A;  4W9G A;  4F92 B;  2YMM A;  3WU2 U;  3RJI A;  1FM0 D;  2O6K A;  3M1Y A;  1P7D A;  2G5I B;  2QC8 A;  4ANV A;  3ZVV A;  1Z5S B;  3AI5 A;  1TAM A;  2JXT A;  2BTE A;  1J7B A;  1EWC A;  2J6S A;  4EOY A;  5ALW A;  9ICU A;  4I2H A;  2I6X A;  4BKG A;  1XNS A;  2LUM A;  3ML9 A;  3QU7 A;  2BPC A;  3RJE A;  2AGQ A;  4NAW B;  2GBN A;  2JF5 A;  2FCM A;  1LQB A;  5DDY A;  2EAN A;  3TJP A;  4I29 A;  2N9K A;  1T94 A;  2V3P A;  4KIK B;  1CK1 A;  1F77 A;  3MGI A;  4HCN B;  3TI0 A;  3WA0 A;  4KKJ A;  2EMT A;  4OVV A;  1NZP A;  3VTU A;  3C5G A;  3N3K B;  5D3I B;  3EPG A;  3N28 A;  2KTF A;  5E6J A;  4DS4 A;  4YXM A;  4QJF B;  3VTV A;  2KAC A;  2V3N A;  4E3C A;  3VH3 B;  1WIA A;  2NTT A;  3V6J A;  2MU2 A;  4TKN A;  4PS3 A;  1GJZ A;  2F1H A;  2KN4 A;  2WDT B;  3DQV A;  2JXX A;  1Z1V A;  3QE9 Y;  1UUP A;  4B95 A;  4W9J A;  3G6X A;  4FS2 A;  9ICN A;  3VXW A;  4MDK E;  3SAF A;  4UAV A;  4J9P A;  4YG2 A;  1RXV A;  2VA2 A;  2HW3 A;  1MHX A;  3PRP B;  9ICB A;  2N9X A;  1D4B A;  1C9F A;  2HBL A;  2KFK B;  5F9L A;  4J9K A;  3B08 A;  4ANU A;  3R9K A;  2JZZ A;  2FNJ B;  2B21 A;  3MBY A;  2ISO A;  1R4M I;  1SF0 A;  4DO9 A;  1XCT L;  3VUY A;  4ZRI A;  1V1O A;  2KTR B;  5KFL A;  5KFW A;  1DOQ A;  1KLU D;  3MP9 A;  5J0W A;  3QAQ A;  5ALT A;  4AS1 A;  3GE8 C;  4I2B A;  4CO7 A;  4UB3 A;  3TSS A;  5HHH A;  4RQ5 A;  2N1W A;  5FKA C;  2NRV A;  3OPX A;  4K4H A;  1UA1 A;  4IQV A;  2V9H A;  5AM2 A;  3LJ3 A;  2MEK A;  1OTR B;  3RB0 A;  1XXG A;  2HDO A;  2KLG A;  4JWN A;  1V86 A;  2KE7 A;  5J0S A;  2KX0 A;  2XGP A;  1RM6 C;  4BBN C;  1CRX A;  4Q43 A;  4RM9 A;  5H8Y E;  4M04 A;  3RH5 A;  5DG7 A;  3L4P A;  3IT4 B;  2ZEQ A;  2XIC A;  4HJK A;  3HHM A;  2DFL A;  1PFD A;  4US8 A;  4KGT A;  3UGB B;  5KFB A;  3A1Q B;  1TGZ B;  3U26 A;  2OED A;  3BZK A;  1HZ6 A;  1NKC A;  2QLT A;  3AE8 B;  2CPR A;  4LZD A;  4QWD A;  3HRD D;  5KFS A;  3V60 A;  3AE7 B;  2GLE A;  1JQ4 A;  4F1S A;  4YR0 A;  2W9B B;  3QNM A;  2DZK A;  4DFJ A;  1SXE A;  2VH2 A;  2G9H D;  3U2S C;  4UB5 A;  3NAS A;  1BML C;  2D3D A;  2PMZ F;  2CKH B;  5H92 C;  2UVU A;  3OJ3 A;  1J0G A;  4RQN A;  3JPP A;  1S0N A;  1AWD A;  2FCN A;  4I28 A;  1UCV A;  1UNS A;  1KKX A;  3H7P B;  3MR5 A;  4FE3 A;  2JYT A;  3KOO A;  4AP9 A;  4YSY B;  2W7O A;  4G11 A;  4BFR A;  2JRZ A;  5B66 U;  3PNC A;  5J2F A;  3TAQ A;  5DBA A;  1SSN A;  2VAN A;  5FR6 A;  4U6P A;  2XCA A;  1NK8 A;  5J0T A;  1PDX A;  2RGF A;  3AE3 B;  3NRZ A;  3WK9 A;  3JPS A;  3GV7 B;  1RYR A;  3BVZ A;  4TUU A;  1VZ6 A;  4IM2 A;  4F50 A;  3BYT B;  1WJ6 A;  1Z2M A;  4DSE A;  3E0F A;  4IG7 B;  4KX5 A;  1MA7 A;  1D9D A;  1P1A A;  2M4N A;  4NQL B;  2MH7 A;  1ET6 A;  2CXY A;  2EH9 A;  2ZTC A;  3KUZ A;  4P7I A;  3QX1 A;  5LNK 1;  1SKR A;  2LYB A;  1YJ1 A;  8ICF A;  3RJF A;  3UMB A;  4DLG A;  1ET9 A;  2W8L A;  2EAO A;  2KJ8 A;  4C4R A;  4G50 A;  5D49 A;  4YWG G;  2JRI B;  3WK7 A;  5DQH A;  3A9J B;  1NJX A;  2FUG 1;  5D94 A;  3MAB A;  5KFH A;  1OUQ A;  2B3A A;  4PZN A;  1K51 A;  3W5V B;  3OG5 A;  5J2I A;  2IO2 B;  1NKB A;  4Y2Y A;  2PW9 A;  3LK9 A;  4DS5 A;  4TQ1 A;  3I76 A;  2KVC A;  2DWQ A;  1KEJ A;  8ICG A;  3ZUN A;  3E56 A;  1X1M A;  2KMM A;  2NBW B;  4W9H A;  3HW8 A;  2IND C;  3ZNZ B;  3Q2A C;  5AM4 A;  4MF8 A;  2K1F A;  3QUC A;  3AEA B;  3E2E A;  4BZA A;  2WXK A;  2KJ5 A;  4OCZ A;  4MGK E;  5HI1 A;  3P4P B;  1C4A A;  1S5L U;  2HI0 A;  4RF1 A;  4DQR A;  1IGC A;  2QJL A;  4EX7 A;  4QWA A;  4BGD A;  2WDV B;  1ZKH A;  4EZ6 A;  3MGV A;  1WGK A;  2W9C A;  1UA0 A;  1L5U A;  4W9K A;  2D2Q A;  1NOM A;  4O3S A;  1RXW A;  2N4F A;  2FE9 A;  5CHV C;  9ICO A;  3BS5 A;  4AJY B;  1XO1 A;  3QXG A;  4NLC A;  3C5F A;  3C2K A;  2O6V D;  1M6Y A;  2DYM A;  4F4Y A;  4K3B A;  3VR9 B;  2MHJ A;  4DXF A;  2W55 A;  2G3Q B;  1K50 A;  3TAP A;  4A20 A;  1OW5 A;  1OQY A;  5KFK A;  1HTO A;  2LM4 A;  5ALI A;  1PK1 B;  4Y2V A;  3SMV A;  1ZQS A;  1JUD A;  3SHQ A;  2G4S A;  1DK3 A;  3KH0 A;  1SZH A;  2B6G A;  2BCR A;  4PH5 A;  1IPG A;  3SEB A;  1K1Q A;  2K60 A;  4F72 A;  2K4P A;  1KBU A;  1MSW D;  2BCQ A;  3ZQ4 A;  4LNN A;  5TIS U;  2LI6 A;  4DOC A;  1XT9 B;  4J9L A;  2TSS A;  7ICK A;  4QZA A;  3BS7 A;  5AKH A;  2KHW B;  3H4D A;  3DVG X;  4P4O A;  5F9N A;  5KT4 A;  2DQN B;  3HKZ F;  5K4L A;  2KD1 A;  4GLX A;  8ICZ A;  5DPR A;  2IY0 B;  1PYW D;  4KVG B;  1FRD A;  4I2E A;  3Q6B A;  4XQ8 A;  1U49 A;  3T5H A;  1V1P B;  3RB4 A;  5AI6 A;  3Q3F A;  2LHD A;  2WGS A;  1NK5 A;  5E6N A;  3MHS D;  2LPE A;  1YMH E;  2K8C B;  2MX2 A;  4WWM A;  3B2F A;  3RNC C;  2LBO A;  2NMQ A;  2XI9 A;  3Q8F A;  1E8Y A;  2PFO A;  7ICU A;  4KDI C;  3BZC A;  3MFG A;  3KWV A;  4WJN A;  3O65 B;  1GO3 F;  3QZ7 A;  4KLS A;  2FBW B;  1I42 A;  3I28 A;  3AE1 B;  5HMM A;  4QZB A;  4NQK E;  3Q3N C;  4DBG A;  1C3T A;  4P0Q B;  2WAQ C;  2IOH A;  2QDF A;  3NJT A;  4IL6 U;  2KIC A;  2W9M A;  2ZNV B;  5AEK B;  2BPG A;  1IYF A;  2VJ4 A;  4WAF A;  2KQS A;  3IM1 A;  1QOA A;  3V61 A;  1XWL A;  3GB1 A;  2KJR A;  4B9K A;  1WM2 A;  2WF7 A;  4E0D A;  2EAM A;  1V80 A;  2R2Q A;  1GAQ B;  3AEG B;  3JSV A;  4HVB A;  1SE2 A;  5L1J A;  3H1U A;  3TIX A;  3PR5 B;  1J97 A;  2JZB B;  1HZ5 A;  9ICF A;  1XCQ L;  2C2D A;  2PKO A;  4O0I A;  1C78 A;  1SIJ A;  1SL2 A;  2AL3 A;  1LGR A;  5CHF A;  4ZH4 A;  1B43 A;  4YR2 A;  4HKQ A;  1VZ8 A;  2AQ0 A;  1I35 A;  2CHZ A;  5B5E U;  3VC8 A;  1FD6 A;  3UPQ A;  5KG2 A;  1LM8 B;  4J6I A;  4EFO A;  4F8R A;  5I4D A;  1ZDX A;  2JMG A;  3RNE C;  5KFC A;  3T5K A;  1I4G A;  4XDC A;  4I6P A;  4ELV A;  4H2A A;  3G6Y A;  2FPK A;  3ZYY X;  5KTQ A;  3QYP A;  9ICS A;  4NM1 A;  4TUS A;  4J9N A;  3B0Y A;  1YT3 A;  1Q0W B;  1RWS A;  3D32 A;  4ZHO A;  1Q1O A;  2LHT A;  2ALZ A;  4R8U B;  1PGX A;  1TS5 A;  2LD9 A;  4ED1 A;  5JU5 A;  5AIA A;  4M8N A;  2QAR B;  1UD7 A;  4P1B C;  2WXH A;  4IR9 A;  5BOL A;  2ESE A;  7ICH A;  1T7P A;  1IUE A;  1SJH D;  2PFP A;  8ICN A;  1KFT A;  2IOF A;  2RQ5 A;  2I38 A;  4ECT A;  2ZJD A;  4TV3 A;  5BYS A;  3APD A;  3ZD9 A;  3W1S A;  2V4L A;  2R61 A;  1XF5 L;  2MBE A;  4DL3 A;  4KV2 A;  4I2I A;  2LVQ A;  2ASJ A;  2WXJ A;  1F0Z A;  2CRX A;  4NLZ A;  1T8E A;  2XC9 A;  3GIJ A;  1EF5 A;  3P42 A;  4TQS A;  4RCO A;  5J8Y A;  4RQ4 A;  2K22 A;  4DEZ A;  1ZQK A;  1VRA B;  4ITK A;  2VA3 A;  2KIW A;  4G3X B;  2DKX A;  3SV4 A;  1WGR A;  1C7Y A;  2ZIV B;  2K0P A;  1JW9 D;  9ICH A;  3CST A;  3FIL A;  4OO1 J;  2DYB A;  4WH4 A;  3SAH A;  1JCK B;  4GXB A;  4R63 A;  2ZXI A;  1Z4O A;  1FCL A;  3FAH A;  2BR0 A;  2LGY A;  1T3N A;  2NRW A;  3DOW A;  4LNI A;  3ZXR A;  3PV8 A;  4EYI B;  3KZI U;  4QWC A;  2Z59 B;  4S0R A;  3W5U B;  2K4I A;  1WGD A;  4YTM B;  4J9R A;  1DGS A;  4FLH A;  3U7Z A;  4NNJ B;  1PVQ A;  1EUV B;  5DDM A;  2GBJ A;  5IA7 A;  1UGJ A;  2KVZ A;  1ZQY A;  5F3X B;  4RU9 A;  4DHZ B;  2JXJ A;  2ZJ5 A;  4XWT A;  2KLC A;  3KKA C;  5KFO A;  3W9C B;  1WWT A;  3VUX A;  2HBK A;  3X0W A;  1GB1 A;  3PHX B;  3VR8 B;  1FFV A;  3GV8 B;  1ZJN A;  4WAA A;  3D2Q A;  4Z6D A;  1XLP A;  3AB5 A;  4MEX A;  3PML A;  3WAM A;  5BOM A;  3F5A A;  1X6J A;  5AM1 A;  4W9D A;  1J8C A;  4TQ0 A;  3JPO A;  3QU9 A;  2RSU A;  4MSQ B;  1ZQQ A;  1FPY A;  3O0F A;  1YJI A;  2ICI A;  1BPB A;  3U8Z A;  1UPH A;  1QSL A;  3WAO A;  2EZY A;  1UT5 A;  1E7V A;  4I6N B;  1BGX T;  2Y0S C;  4PL2 A;  7ICO A;  3ML8 A;  3E58 A;  1X9M A;  1CEZ A;  5CHW A;  4ZDV A;  3CSF A;  5EE0 A;  2D3C A;  2YMP A;  2JHD A;  3PX0 A;  3RRG A;  5BMG A;  1U9L A;  3SU8 X;  5ALY A;  1J2M A;  2HCF A;  5KG1 A;  1YN3 A;  4Y2X A;  3UIO B;  4ZYS A;  4M9L A;  3VRB B;  4ECS A;  2LYA A;  4OVU A;  3T3N A;  3KHL A;  4RQ7 A;  1JWB D;  1XSL A;  1P7E A;  4MJS A;  4FAD A;  4GDK A;  2INP E;  1JWA D;  9ICE A;  2YLM A;  1N2X A;  4XUS A;  1CMX B;  2MSE D;  4MEM A;  2FUH B;  5JH5 C;  1ARO P;  3I3T B;  4HPL B;  5C23 A;  4BOZ B;  3AEV A;  1ZQR A;  2CS4 A;  5KFF A;  3NS1 A;  1WGG A;  2EAP A;  2MP2 A;  2BS3 B;  1TK5 A;  5L1M A;  1YX5 B;  1YZ7 A;  4P16 A;  3KHH A;  8ICY A;  2Z0E B;  3EA6 A;  2EMS A;  4FZM A;  3SD7 A;  3ZXV A;  1ZD4 A;  5ALV A;  2XN9 C;  4HK2 A;  2KSO B;  3ZW3 A;  2WNM A;  4JX1 C;  3W2D A;  1ZYQ A;  1L7Y A;  7ICT A;  1SWV A;  4ANX A;  4C8N A;  5FK9 C;  3JPN A;  1TAQ A;  3MJW A;  2BPS A;  1ZQA A;  1ZDV A;  2Y9T A;  3T5L A;  3IHQ B;  2HTM E;  1KL9 A;  1ZET A;  4IRC A;  2DNF A;  2LJ5 A;  4MGZ E;  1HJP A;  3I63 C;  4JMU A;  2BYE A;  3AUL A;  3SD5 A;  3VQI A;  5AKZ A;  8ICH A;  2MBO A;  2N7E A;  3BQ7 A;  5AK5 A;  1UBI A;  2OWO A;  3H8H A;  4KTQ A;  1IXR A;  1JML A;  2PE6 B;  9ICT A;  3HIZ A;  1WX7 A;  5DPT A;  1P9D U;  3EC8 A;  1WFY A;  2J42 A;  2K5P A;  3S6J A;  2L0F A;  3HPO A;  5J2J A;  4HDO A;  4UBB A;  2I2Y A;  3PMN A;  4F8C B;  3AEC B;  3PY8 A;  5AKX A;  3RZF A;  3K9O B;  1GB4 A;  1P0R A;  1JWM D;  2N0S B;  4FXC A;  5IIK A;  4B6J A;  1UHU A;  2WTF A;  3VRA B;  2PEA A;  3PO0 A;  2AU0 A;  1IG6 A;  2L7R A;  2JEF A;  5H2F U;  1U4A A;  4NXZ A;  1KDH A;  4MEY A;  2RPQ A;  3A9K A;  1L3U A;  5KFT A;  2FLN A;  3M6K A;  5J2G A;  7ICQ A;  3ZRC A;  2IO0 B;  4BKT A;  1TIF A;  4AWJ A;  1R4M B;  1V2Y A;  1F0M A;  3EW9 A;  4NLK A;  1V81 A;  4MH0 E;  1O08 A;  1C4P A;  2N1R A;  3QUQ A;  5KG5 A;  3EZ5 A;  2ZCC A;  1IM4 A;  1GC6 A;  5KFV A;  3ZKJ C;  4DLE A;  5CWR A;  1EU3 A;  2E5S A;  2L00 B;  1JXL A;  4DFK A;  1NKE A;  1BPX A;  1WMH B;  3ABV B;  4FFD A;  4F5R A;  2AYO B;  4REZ A;  4WJO A;  3RUL A;  3C28 A;  1PVR A;  4O3M A;  4E74 A;  1KF6 B;  2W3R A;  2LXA A;  2W3S A;  1X9S A;  1SEB D;  2RDH A;  3HVD A;  3ALR A;  4YMN A;  4BXO A;  1MPE A;  1QZE A;  2MWS B;  4JWS C;  1ZRN A;  9ICL A;  3BK1 A;  4BKS D;  4YXD B;  4I2D A;  1X6I A;  3QEB Z;  1X2I A;  1WJU A;  3OJS A;  3I5J C;  1WXQ A;  4RH6 A;  1TFR A;  1BPE A;  1A77 A;  1N60 A;  5KFU A;  3TFS A;  3Q8M A;  2AJQ A;  4EEL A;  3JYU A;  4JV0 A;  1DOX A;  4GSW A;  1YOV B;  3RJG A;  3ZDE A;  7ICL A;  1TK0 A;  1DK2 A;  1FMA D;  1OEY J;  4YTP B;  1T5X D;  3Q3O C;  1WJN A;  2KT7 A;  4HAI A;  2W04 A;  1FNW A;  2M0A A;  3FC4 A;  1I4X A;  3QAR A;  4JGH B;  2K8A A;  1S0O A;  4LNF A;  2RRD A;  4KIT B;  2R2O A;  3AED B;  4GXK A;  2MJE A;  2BDU A;  5AKE A;  4RZR A;  1S76 D;  8ICM A;  1ZW7 A;  3M8S A;  1PK3 A;  1R7S A;  4ZHP A;  4WJ3 B;  1BPD A;  2W43 A;  2NVU I;  1RFK A;  1L2N A;  5DQG A;  2D6F C;  4DHJ D;  4C7Z A;  2WS3 B;  2QIL A;  5KFP A;  1V97 A;  3Q3M C;  2EKE C;  2Y9U A;  2ZUD A;  2LMR A;  3M7D A;  5KG3 A;  2XVT A;  3IXS A;  1A6S A;  4WJP A;  3AE5 B;  3N1X C;  8ICO A;  3APC A;  3U4E G;  4O5K A;  2DZM A;  2WF6 A;  4D2K A;  2KV2 A;  2EZX A;  4ELT A;  2BQU A;  1Z3E B;  2LRU A;  1F52 A;  1XC9 A;  1XS9 D;  4YSZ B;  4FS1 A;  3APF A;  4DDG D;  4KSL C;  4QWE A;  3BZD B;  2DEN B;  4FHK A;  1B1Z A;  3VHT C;  3QIJ A;  1XLN A;  1ZQH A;  2NO5 A;  1J7A A;  4YL8 A;  2ZIW A;  1WX9 A;  4A9A A;  4PYZ A;  1F2R C;  1PGA A;  5TSS A;  1NZB A;  2WXF A;  4NM2 A;  2FPM A;  5LXH A;  4KN7 A;  8ICQ A;  3L3F X;  5BMI A;  3KD3 A;  1WR1 A;  2BS4 B;  4IS7 A;  2LHE A;  3IAM 1;  5KT6 A;  4RNM A;  2HE7 A;  2DL0 A;  3JVZ X;  3CYM A;  4IR1 A;  4PYU A;  1F44 A;  2J6U A;  9ICC A;  2LEK A;  4QZF A;  9ICX A;  2CHX A;  2V9W A;  4ED2 A;  1N48 A;  1OXJ A;  3H0R B;  5ALD A;  2NV3 A;  1K1S A;  4DCC A;  3U7D A;  1Z19 A;  1NJY A;  2KC2 A;  1SE4 A;  4M47 A;  1PUZ A;  4QZD A;  1MN8 A;  4LNO A;  2E8O A;  2FMS A;  4YMM A;  4KSK C;  3AE4 B;  1EF1 A;  4JWU C;  1E6E B;  2HJ8 A;  1ENF A;  3NVZ A;  2N9E B;  2INN E;  2J6T A;  4LDT B;  4QIW F;  3V6E B;  3F5E A;  5GTH U;  2Y1I A;  2GOL A;  4YR3 A;  4Y2S A;  2RDB C;  2ASL A;  2DPI A;  5KG0 A;  2YML A;  1GG3 A;  2BGW A;  2AGP A;  5DCN A;  3T3O A;  5J0O A;  2F76 X;  3IG8 A;  3L17 A;  4MT5 A;  3Q8K A;  4RMA A;  1FO4 A;  3Q3J A;  2ES6 A;  4DSJ A;  1E8W A;  4EZ9 A;  3JSV B;  5CP2 A;  3PO4 A;  1T0Y A;  3C0R B;  2R8G A;  2HHV A;  4M9G A;  2DAF A;  5HR7 A;  1K8R B;  1PVP A;  2D5G A;  4BVU C;  3DWG C;  4B6W A;  2V4R A;  3OHB A;  2L76 A;  2KKP A;  4RGM A;  5E6P A;  4BDP A;  3RFZ B;  2R8I A;  4MM3 A;  3KQ4 A;  4OZB A;  3QK0 A;  2JT4 B;  4CCH A;  1RG6 A;  4WUR A;  2IY1 B;  4KLJ A;  3Q8P B;  1QOB A;  2ZJ8 A;  3AEB B;  4F71 A;  3RAX A;  2C5L C;  5A0L A;  5L1K A;  3IFW B;  5IIN A;  1A5R A;  1LKY B;  2HOI A;  3Q8C A;  3GQC A;  2GBM A;  2DKZ A;  3V6C B;  1SIF A;  3ONN A;  4RQ1 A;  2Y1J A;  1LB2 B;  9ICM A;  2Z8L A;  3R3M A;  4YSX B;  2W7P A;  3KWL A;  5IN7 A;  3DBR I;  3MFI A;  5BYQ A;  1L3T A;  1C4C A;  2BKE A;  2RD0 A;  2BCU A;  2K8B B;  4HRO A;  4Z6F A;  1ZGU B;  2LI5 A;  2KZ3 A;  5LLI A;  5DB7 A;  1RYJ A;  1TY0 A;  3PSI A;  3LWL A;  5HP4 A;  4Q8E A;  3KLS X;  4BOS C;  4F4Z A;  1UQV A;  3RCZ A;  4USA A;  1L0X B;  3F53 A;  2O2V B;  2C7M B;  3N7R C;  1XO3 A;  3MC9 A;  1ECW A;  4OHJ A;  1TS2 A;  2KWD A;  4BWJ A;  3GFK B;  2JY6 A;  2WXL A;  3QJZ A;  1NDD A;  3LWM A;  3WKC A;  3ISC A;  1H8C A;  1AQ6 A;  1D5X C;  2W82 A;  4ICV A;  4TUQ A;  2WX0 A;  2DLB A;  4A3P A;  1BVS A;  2C7H A;  3TAD C;  4RF0 A;  1CQV A;  4GDL B;  3NVV A;  5HNK A;  3SEI A;  4GU2 A;  4F93 B;  3K1Z A;  2KVR A;  1WY8 A;  5IOI A;  5CB1 A;  3VFK A;  1WG8 A;  4Y2P A;  5DG8 A;  4ICU A;  3ETR A;  2AH5 A;  4W9E A;  1NEK B;  3UXP A;  3FIL B;  2ZNV C;  2KDI A;  2DYO A;  3LDZ E;  2R8K A;  3LDA A;  1UF0 A;  2KYW A;  3THV A;  1WF9 A;  2D11 A;  2H3F A;  2K4H A;  3IVF A;  2G45 B;  2M9N A;  8ICT A;  2PE9 A;  1C20 A;  4M0W A;  3TUO A;  3K1R B;  3KUC B;  2ZIX A;  1SV4 A;  7ICG A;  1QQR A;  4JL9 A;  2F1J A;  4DOB A;  4GGQ A;  3DVG Y;  1Q3V A;  4NJ8 A;  4O3O A;  1WM3 A;  2M1M A;  3ISB A;  3IAS 1;  3LYY A;  4HDQ A;  2C9W B;  1S77 D;  3DBL I;  5AZF A;  4EZJ A;  3RH4 A;  2OJW A;  1TJE A;  3N1Z C;  8ICA A;  1CUK A;  3PRZ A;  2MQJ A;  4F5O A;  1RFA A;  2GLS A;  4L23 A;  4KLT A;  2HHW A;  4M9H A;  3UM9 A;  1DOI A;  3GZN I;  2LVP A;  4ELU A;  3OGU A;  2ON8 A;  1L7P A;  1ZQL A;  4FBT A;  3ZDM C;  2WU2 B;  2KP7 A;  5JTI A;  1TAU A;  1JWS D;  3BDP A;  3L16 A;  1LV5 A;  4C8M A;  4YMO A;  2ISP A;  4K7U A;  3PSP A;  3VVW B;  5AHX A;  4OJ6 A;  2NBV B;  4II3 B;  2JEG A;  4C80 A;  1ZPS A;  2GWS A;  2Z7J A;  1LFD A;  5KFQ A;  4EEY A;  4CRX A;  2NBU A;  2RLT A;  1XLQ A;  3E9S A;  3KKA A;  3C29 A;  1VLB A;  4FA6 A;  4C4T A;  2BCS A;  4IC9 A;  1PGB A;  1X40 A;  1L7O A;  1QQ6 A;  7ICS A;  1X9X A;  9ICJ A;  4P4P A;  4OJ5 A;  2JWZ A;  4RUA A;  2PKE A;  3RRH A;  2FLP A;  4DK5 A;  4M0A A;  2BYV E;  4DL6 A;  3UMG A;  4GN1 A;  2O6V A;  4WJQ A;  1JN3 A;  2WX1 A;  3WAN A;  4UQG A;  3I9V 1;  1BXT A;  4RUC A;  4Y2T A;  3F2B A;  2GH1 A;  1CZP A;  1V9J A;  3M8R A;  3GV5 B;  2M0N A;  4ZYN A;  3ZTD A;  3RUI B;  3DPD A;  1YIW A;  5ALR A;  1ZE3 D;  4MJS B;  3PSF A;  4GDK B;  4B0M A;  1EXN A;  2BQR A;  2BYF A;  3IHP C;  3RBD A;  4ED8 A;  2N1V A;  5L1L A;  1NI3 A;  2J4X A;  1I4P A;  2KMC A;  2Y3A A;  4KGS A;  5AKJ A;  3FDS A;  1BPY A;  1RDF A;  4EYH B;  2LVO A;  1ZQT A;  1RZT A;  3IV6 A;  1L7M A;  2EZZ A;  1NVI D;  2FDR A;  2YB4 A;  3QHT A;  4UAT A;  3Q8R B;  1V5O A;  5G5H A;  3P4R B;  7ICI A;  4U7C A;  4CNQ A;  1AW7 A;  4KLQ A;  3W1Y A;  2V0G A;  2GMI C;  5AUK A;  1RRB A;  4IQU A;  3BK2 A;  4C4V B;  4UB1 A;  4C7Y A;  1ZQG A;  5GTI U;  4DSL A;  9ICK A;  1FNV A;  1GUA B;  2UVV A;  4YVZ A;  1YX6 B;  2B76 B;  2MUT B;  3TAR A;  3CF6 E;  4YT0 B;  8ICJ A;  2G06 A;  1KLG D;  2PFQ A;  1ZQW A;  4QZI A;  2WDR B;  2YVC A;  2G07 A;  2DX5 B;  8ICU A;  2W9A A;  3RH6 A;  5KL8 B;  1B9R A;  3EFC A;  2KWV B;  1Z00 A;  3SYZ A;  1YQ3 B;  4ASW C;  1FFU A;  5J29 A;  1RQL A;  2BYT A;  5AI9 A;  4HWI B;  1VJK A;  4QW8 A;  2V1Y A;  4EEN A;  3GZF A;  4BBN F;  4A6Q A;  4FZN A;  4R65 A;  4N59 A;  2KD0 A;  3AMZ A;  2IHN A;  4G0N B;  3OJ4 B;  1JI7 A;  4YTN B;  4PHA A;  5AI8 A;  2LM1 A;  1WE6 A;  2WB1 C;  1COK A;  1N5W A;  2LXC A;  2WF9 A;  4Q44 A;  4UB2 A;  4J9M A;  4AYB C;  4DQQ A;  1VCB A;  1ZQM A;  1WX8 A;  4DL2 A;  1IBX A;  3AQE A;  1D9F A;  7ICR A;  3ENE A;  2NRZ A;  1LO5 D;  5C2T B;  3NVW A;  1U4B A;  3ISD A;  3NUQ A;  9ICR A;  3M9O B;  2N7D A;  3A9K B;  4K4I A;  2YQE A;  4Z6E A;  4WWP A;  5KT2 A;  3RD2 A;  3OLM D;  2JZ3 B;  4DFD A;  5J0Y A;  2NCN A;  5AK4 A;  4YD2 A;  2WXR A;  1NK0 A;  2WF8 A;  2L52 A;  5CEH A;  3GIK A;  3MJ5 A;  2E6X A;  1TS4 A;  1OGW A;  1QLN A;  1NEN B;  2ZCB A;  1J2N A;  2KN7 A;  4EZK A;  3TEY A;  2XNA C;  2HHS A;  1ZQI A;  5G2N A;  2KDF B;  3FKY A;  4UB8 U;  2BGF A;  3SFE B;  1Z1B A;  1F9J A;  3TBL D;  1QQ5 A;  4J03 A;  2KFK A;  2IO1 B;  4DFM A;  4DOA A;  5GMV A;  4IOI E;  4FJZ A;  1JWU D;  4II2 B;  4URK A;  3ICX A;  4ACO A;  2RP5 A;  2LKY A;  4CF4 A;  3UQ0 A;  2PJH A;  4MHV A;  5HG2 A;  3ED5 A;  2C2R A;  4CE6 A;  2PI4 A;  4KGR A;  3GIM A;  2LGD A;  3RJJ A;  2PPH A;  2PIA A;  3GU3 A;  1KTK A;  3KHR A;  4DQI A;  2D3B A;  3L08 A;  1A76 A;  3C19 A;  2HVH A;  2QB1 A;  5JUM A;  1F2R I;  4XZ4 A;  3M62 B;  1WYW B;  5E6O A;  2DZI A;  2YN4 A;  5KHO A;  4F5N A;  2W8K A;  2F2A B;  2LFI A;  2RPV A;  1SZP A;  3TCA A;  4NAM A;  4M6W B;  2Q4T A;  1WSP A;  2MBB B;  3M63 B;  5DGB A;  1YN4 A;  1T0S C;  2IGH A;  4UAU A;  3AU6 A;  2IJ0 A;  3N20 C;  3N9Y C;  4YCX A;  2KHQ A;  4WQM A;  2ZTD A;  4W9I A;  3A1Q A;  1ZQZ A;  1N5X A;  5AKK A;  1V38 A;  1PUT A;  1KOT A;  4WQO B;  5KFA A;  2QEJ C;  1Q3U A;  5AZG A;  5KFN A;  3HK0 A;  2XY5 A;  2EKI A;  3RB3 A;  2IYD B;  1L8O A;  3NGD A;  4G9B A;  2GRI A;  4EBD A;  2M8S A;  4NY0 A;  3G6V A;  1OEY A;  1RPL A;  3KFU F;  4KMU A;  3NHE B;  2E3T A;  4JE3 B;  3DWM A;  2AHO B;  3MDA A;  3DDC B;  1KH0 A;  1WI0 A;  5CTR C;  1Q10 A;  2FMQ A;  1DRG A;  3AU4 A;  4F5Q A;  5MPO A;  5L95 C;  3H7P A;  2W54 A;  4MFA A;  1E8X A;  1L0Y B;  3VTW A;  5C1Z A;  2F8L A;  2KWU B;  4DWI A;  4HKZ E;  4TQR A;  3ZDT A;  1XO0 A;  4NWI A;  3PR4 A;  2Y5B B;  1BPZ A;  4ECX A;  4B9U A;  1H4R A;  5L9X A;  3DBS A;  3EFU A;  2ACZ B;  2OEH A;  3C2L A;  2WQY B;  3AN1 A;  2BQ3 A;  1OQQ A;  4NL9 C;  1WCN A;  4DQP A;  7ICP A;  3C23 A;  3FM9 A;  4JPS A;  1ZD3 A;  2ASD A;  2P66 A;  4QZH A;  1L3V A;  1NK4 A;  3T8M A;  4QZG A;  3U52 E;  4F91 B;  1ZQJ A;  2KMA A;  4ARC A;  4YD1 A;  4P0P A;  3PZD A;  4UAY A;  4P1C C;  1KRP A;  2CU3 A;  1FCC C;  3L13 A;  5J2A A;  1ESF A;  2H3Q A;  2DAJ A;  2HD5 B;  3PRE A;  3VUW A;  1VJ5 A;  4RGT A;  3RPF C;  3DHI C;  2YB1 A;  5AI5 A;  3ZJT A;  5EE9 A;  2LJI A;  3EUB 2;  1I7H A;  1FXT B;  1SE3 A;  1C76 A;  2KO3 A;  5KFR A;  1MC8 A;  1ZP0 B;  3ZDD A;  3CIR B;  2A19 A;  3A9J A;  1E8Z A;  1OFF A;  7ICF A;  2ZG6 A;  1SB3 C;  3MR6 A;  2XK5 A;  2OXO A;  1EO6 A;  4KKI A;  3TL5 A;  2JVC A;  5KG4 A;  3VAW A;  3JPT A;  4N58 A;  2KAN A;  4KLH A;  4IDI A;  3RNB C;  4KX6 B;  4IM0 A;  3HM6 X;  3NVY A;  1YZ6 A;  3SDL C;  2L8J A;  3S2A A;  2E8M A;  2G1E A;  4JV1 A;  1X42 A;  5BO4 B;  4I2G A;  1CJE A;  3N97 B;  2JV3 A;  5KFI A;  5JRT A;  2C2E A;  4ZRJ A;  2NPT A;  2INC C;  4XRH A;  2VIX A;  2P35 A;  2IO3 B;  1TV9 A;  2KDM A;  2BHN A;  2WAQ F;  5G55 A;  1N63 A;  1FIQ A;  3HVZ A;  1Y56 A;  3RNG C;  1SL0 A;  5ALZ A;  4I2F A;  5KFY A;  2H3I A;  3KW5 B;  4FJV B;  3PLU A;  3N30 A;  3L54 A;  4GOC A;  3L0W B;  4KLG A;  2MJD A;  2VZK B;  4MM3 B;  4I6L B;  3AQF A;  2RDG A;  3Q8B A;  3D6J A;  7ICM A;  1X9W A;  4XX5 A;  1TE2 A;  3WIM A;  2JH7 A;  1TS3 A;  2KJ9 A;  5EE1 A;  3M6Z A;  1ZQE A;  3UI3 A;  4PGY A;  1V5T A;  4LNK A;  4O1N A;  5AI4 A;  1IIP A;  4RQM A;  2WXQ A;  4FN2 A;  4DL5 A;  4KLO A;  1ZQ1 C;  2K4E A;  4X5V A;  1P7F A;  2WXN A;  4HLE A;  7ICV A;  5JHA A;  1HA5 A;  3M3J A;  3DCG A;  1L7N A;  5DB8 A;  5KFD A;  2KTQ A;  4FHJ A;  1E0Z A;  1FXI A;  3PRM B;  1QF6 A;  3AE9 B;  4NZL B;  3OJU A;  4DL7 A;  1HUZ A;  1NYR A;  4DL4 A;  2NR2 A;  3KTQ A;  3QWZ B;  4K7W A;  2M17 A;  3RAQ A;  4WIP A;  2G0A A;  5AKI A;  4PZO A;  5KFZ A;  3B0X A;  2FE8 A;  5HHI A;  5BPC A;  2Y5C A;  1SE9 A;  1MG4 A;  3MR3 A;  3GOE A;  4A8E A;  2GI9 A;  4EKU A;  1WXV A;  1SV0 C;  1COO A;  2FCQ A;  1TY2 A;  4RM8 A;  1HEK A;  2BB5 A;  1B0X A;  4KZC A;  4A55 A;  4BJQ A;  4Y2U A;  1JRO A;  2IMW P;  3BVM A;  5JZE B;  3AEE B;  9ICI A;  5IP4 D;  1WGH A;  1WXA A;  5AZH A;  3TQ1 A;  3RN9 C;  3BQ2 A;  4GC7 A;  5AIC A;  3NZ3 A;  3SI8 A;  2JR5 A;  3RFA A;  4QIW C;  2BVC A;  1V1P A;  1SGH A;  4E71 A;  4PHD A;  2UVW A;  4M9J A;  5HML A;  3TKA A;  1EWY C;  2XID A;  2LRW A;  2ZW1 A;  1LXD A;  1WWV A;  4QZ8 A;  2F8K A;  4HPM B;  1FEH A;  1N56 A;  1HEZ E;  2E8P A;  2ZIX B;  3TAD A;  1FNU A;  4EBC A;  2PVO D;  3MHZ A;  2KVS A;  4IC7 B;  1FRR A;  4R3D A;  2WP9 B;  2QMT A;  4BKS A;  3R7Q A;  2Q5W D;  2IOF K;  4OD0 A;  5DGA A;  1T0R C;  1T4G A;  4P0Q A;  3ZNG C;  4X57 B;  4ECZ A;  2E1E A;  2HSZ A;  1L4D B;  1TKY A;  2LWP A;  9ICA A;  2EEL A;  2IDY A;  1E10 A;  1ZQO A;  5CHG A;  1HQR D;  1BNO A;  1PQS A;  4JB3 A;  2L1A A;  4M01 A;  4F2R A;  1R4N I;  1ZOL A;  3URY A;  4K81 A;  4B9N A;  2L5Y A;  3B2G A;  3CMM B;  1HUO A;  1AN8 A;  3PST A;  3BVG A;  1JMS A;  4W9L A;  1DXS A;  3MDC A;  4TSS A;  5DBB A;  3DBR B;  4NY8 A;  3NTU A;  5KFX A;  1ZD5 A;  1RLF A;  3IBE A;  1JRP A;  4NLN A;  3BIN A;  5J2K A;  4MAC A;  3A4S C;  5FP0 A;  3OSP A;  3PSE B;  4DSK A;  3ZGZ A;  2R8H A;  3ZRF A;  2KDE B;  3EYZ A;  1QCK A;  3A0H U;  3ZO5 B;  3WKE A;  3ZI4 A;  3UIN B;  3CRX A;  5CJ7 A;  2PMZ C;  4MF2 A;  3WK5 A;  1K52 A;  2H88 B;  1QSY A;  1NI2 A;  3AM9 A;  4R8U A;  2FJ6 A;  3LVV A;  4GC6 A;  3JPQ A;  3TEX A;  2W9C B;  2Y0S F;  4LJX A;  1A70 A;  5DG9 A;  1H38 A;  4Q8F A;  3GDX A;  3AV8 A;  3UQB A;  2JUO A;  3KVF B;  3RR8 A;  2NRX A;  3GS2 A;  4AP4 C;  3K4G A;  3VCB A;  3AH7 A;  3BS5 B;  3C1Z A;  3C21 A;  2L3Z A;  5AKL A;  3RT3 B;  3WCQ A;  5AIB A;  1TZO A;  2AQ1 B;  3RNA C;  4B9L A;  3BY4 B;  4DSF A;  2WXM A;  2HHU A;  2MRL A;  3H9D A;  3P4S B;  3PS6 A;  4NJC A;  2VKQ A;  3WKD A;  3KHG A;  4PJ0 U;  4OJP A;  1F1H A;  5J2D A;  5CX3 A;  3V05 A;  3N4M B;  4MGY E;  4YFK A;  4OJO A;  4RQ6 A;  2NRT A;  3HM3 A;  2ZIV A;  2ASQ A;  2XY7 A;  3DBL B;  1U45 A;  1V9P A;  1WRD B;  4CHK A;  1AYF A;  3QA8 A;  1UT8 A;  3TEZ A;  1L4Z B;  3RJK A;  3RF9 A;  1TBE A;  3QZ8 A;  4N6E B;  5T8I A;  2H3Z A;  4O3R A;  4KLD A;  1BNP A;  3H8W A;  2XO7 A;  3RBE A;  4RPX A;  2KZZ A;  2BQQ A;  3GZN B;  3PPA A;  1Z00 B;  4QAY A;  4Q45 A;  5IAA C;  4OZA A;  1JXE A;  4PK1 A;  4CF5 A;  1I4Q A;  1ROE A;  5ALE A;  3H4B A;  1QLB B;  2JX5 A;  2JSV X;  1UBQ A;  4JK1 A;  5ALS A;  3PZ8 A;  1JX4 A;  2C28 A;  4MH8 A;  1WWU A;  4F5P A;  1ZRM A;  3RB6 A;  1KFD A;  4CDG A;  1MQ3 A;  2MW5 A;  4JIO U;  4MFC A;  4F4X A;  3QUB A;  4FJY A;  5HHD G;  2D07 B;  2JZP A;  1NJW A;  5G5G A;  5ALX A;  5BYR A;  4JV2 A;  1NBF C;  1GPX A;  3IDW A;  1IBX B;  2A1A A;  5IIJ A;  3X23 A;  3OWE B;  2J52 A;  4HRS A;  1M4V A;  5KG7 A;  1P98 A;  2HOQ A;  3ORY A;  4FO6 A;  1VR9 A;  2P6R A;  3M9N B;  1QQ7 A;  2J0M A;  1TTN A;  3QEA Z;  5KT3 A;  1SKS A;  4JWM A;  4I2A A;  8ICV A;  2PMV A;  5KHQ A;  3F2C A;  1D3Z A;  2WXG A;  3QX7 A;  4DQS A;  2DPJ A;  1XSN A;  5KFJ A;  4PPX A;  1E9M A;  4DFP A;  1MHH E;  1UZX B;  1XLO A;  5J17 A;  9ICQ A;  5KAI U;  2GBR A;  2V4I B;  3DDH A;  2UVR A;  1ZQF A;  2K3U A;  5III A;  3M95 A;  4KLM A;  3IN5 A;  5AUI A;  4GFJ A;  3RYT A;  3Q69 A;  4R66 A;  4IM3 A;  2QB0 A;  5HKH A;  3SAG A;  4ICA A;  3Q8A A;  4BWM A;  1WXM A;  1ZQV A;  2FIF A;  3U30 A;  8ICR A;  5D6J B;  3OTQ A;  5J18 A;  2A1J A;  2UU7 A;  7ICE A;  1D8L A;  1K53 A;  3KYD D;  2J7Q B;  3SEN A;  3UQ2 A;  5CRX A;  3H7S A;  2KIV A;  2RDI A;  4O3N A;  2ZVO A;  1N6Z A;  4EX6 A;  2AQ2 B;  3A4R A;  2Q0Z X;  2DGZ A;  2KSO A;  3HKZ C;  4ZRK A;  3BQ0 A;  3C2M A;  3PW7 A;  1G6J A;  5TZV A;  2W03 A;  2FPL A;  4MFF A;  3AE6 B;  2FLL A;  3NZS A;  2ZIU A;  1NNL A;  2RDJ A;  4CGZ A;  2N9L A;  1TK8 A;  4RGO S;  3R7R A;  5ALF A;  4HXD A;  2OJR A; 
#chains in the Genus database with same CATH homology
 4YTN B;  1QOF A;  4CQN A;  1YJI A;  2ICI A;  1N5W A;  2YEP F;  2YEP B;  3R8B A;  2VZK D;  3LXF A;  1IBX A;  2LMC A;  2J53 A;  5EE0 A;  1LO5 D;  3V3X A;  5C2T B;  3NVW A;  1YN5 A;  5BMG A;  4OVZ A;  3O13 A;  1L0V B;  2WXR A;  1YN3 A;  3P4Q B;  1YNT E;  4ZYS A;  3VRB B;  2L52 A;  1VDV A;  4A90 A;  3MJ5 A;  2E6X A;  3J9C A;  3T3N A;  3R2I A;  1I4R A;  1TS4 A;  1JWB D;  2JQR B;  1P7E A;  3P1M A;  3Q8E A;  2M56 B;  2INP E;  1JWA D;  1NEN B;  3TEY A;  3ZJV A;  2N7J A;  2XNA C;  4OZC A;  1UWM A;  3NS1 A;  2BS3 B;  2IGD A;  2PTL A;  3SFE B;  4P16 A;  3EA6 A;  4AQ7 A;  1FM0 D;  2XN9 C;  1KFY B;  4IOI E;  2WNM A;  1JWU D;  4JX1 C;  3W2D A;  1D6E C;  2JXT A;  2BTE A;  1ZUD 2;  1J7B A;  1EWC A;  5HG2 A;  3BYY B;  2CJN A;  4KGR A;  3SR6 A;  5FK9 C;  2LUM A;  1ZDV A;  2PIA A;  1KTK A;  2HTM E;  4NAW B;  2ZW0 A;  1F2R I;  3VQI A;  2N9K A;  4EE2 A;  2LFI A;  2V3P A;  2RPV A;  2WDQ B;  1CK1 A;  1F77 A;  3H8H A;  5EE3 A;  4NAM A;  1WSP A;  1JML A;  1YN4 A;  4KKJ A;  2IGH A;  1OQR A;  1L5P A;  2MJ3 A;  2IJ0 A;  3N9Y C;  2K9X A;  4WQM A;  5D3I B;  1SXT A;  2J42 A;  2K5P A;  5E6J A;  1QT9 A;  1N5X A;  2L32 A;  2I2Y A;  1PUT A;  2KAC A;  2V3N A;  3PZ7 A;  2QEJ C;  3AEC B;  2NTT A;  4IKG A;  1GB4 A;  1JWM D;  2KN4 A;  2N0S B;  3R2T A;  2EKI A;  4FXC A;  4LLG M;  2GRI A;  3VRA B;  1UUP A;  2Y5P A;  5GXG B;  3ZJU A;  3PO0 A;  4JE3 B;  2E3T A;  3DWM A;  1BUI C;  1KH0 A;  1MHX A;  1Q10 A;  1VZ7 A;  1D4B A;  1C9F A;  5MPO A;  1SF0 A;  1XCT L;  2W54 A;  1C4P A;  1L0Y B;  1V1O A;  4C56 C;  1EU3 A;  4HKZ E;  1KLU D;  3MP9 A;  1J7C A;  3ABV B;  4AS1 A;  2ACZ B;  3TSS A;  1QKZ A;  4REZ A;  2WQY B;  3AN1 A;  1OQQ A;  5FKA C;  1KF6 B;  2W3R A;  1N62 A;  4JPS A;  2W3S A;  2MEK A;  3CWI A;  1SEB D;  1XXG A;  2RDH A;  3HVD A;  3P63 A;  3EGR A;  1MPE A;  3U52 E;  2BS2 B;  1DOY A;  1RM6 C;  4JWS C;  3BK1 A;  4YXD B;  4ARC A;  2KQ4 X;  5H8Y E;  2CU3 A;  1FCC C;  4XE0 A;  1ESF A;  3L4P A;  3IT4 B;  1MVK A;  4RFB A;  1WXQ A;  4RH6 A;  1PFD A;  1N60 A;  4US8 A;  4KGT A;  4RGT A;  3RPF C;  3ZJT A;  2OED A;  2LJI A;  1ZOY B;  2WXI A;  3EUB 2;  5EE9 A;  1DOX A;  1HZ6 A;  1I7H A;  3AE8 B;  1SE3 A;  1C76 A;  3HRD D;  3GP7 A;  1FMA D;  4TMA B;  3AE7 B;  1T5X D;  1ZP0 B;  4YTP B;  1JQ4 A;  3CIR B;  1MI0 A;  2M0A A;  1FNW A;  1OFF A;  3FC4 A;  1I4X A;  1SB3 C;  5D3D A;  2G9H D;  4HEA 1;  4KKI A;  1BML C;  1JAL A;  2LGI A;  2OHF A;  5H92 C;  4N58 A;  3U2S C;  3NUH B;  3AED B;  1AWD A;  4IDI A;  2BB6 A;  4KX6 B;  4OW0 A;  3NVY A;  2MJE A;  1UNS A;  2G1E A;  4DXG A;  1ACC A;  2JYT A;  1R7S A;  1CJE A;  4RNA A;  4ZHP A;  4YSY B;  2KDM A;  2AX5 A;  4P6V F;  1RFK A;  1N63 A;  1FIQ A;  2GB1 A;  1Y56 A;  1SSN A;  4C7Z A;  2WS3 B;  3HVZ A;  2QIL A;  1V97 A;  1PDX A;  3AE3 B;  4US9 A;  3NRZ A;  2VZK B;  2MJD A;  3IXS A;  4RGN A;  1QIL A;  3BVZ A;  4MM3 B;  1QOG A;  1VZ6 A;  3AE5 B;  2RDG A;  3Q8B A;  3U4E G;  1FXA A;  4B0E A;  1TS3 A;  4D2K A;  4GLS C;  3BYT B;  4Q2J A;  5EE1 A;  2PVG C;  3UI3 A;  1D5M C;  4DQO C;  1L6V A;  4YSZ B;  4O1N A;  2WXQ A;  3BZD B;  2MH7 A;  1ET6 A;  1B1Z A;  2WXN A;  1P7F A;  2M19 A;  1XLN A;  1HA5 A;  1J7A A;  5LNK 1;  1C79 A;  1SBB B;  1E0Z A;  1FXI A;  4A9A A;  1QF6 A;  1ET9 A;  1F2R C;  1PGA A;  3AE9 B;  5TSS A;  2WXF A;  4NZL B;  1NYR A;  5HFY A;  4YWG G;  5BMI A;  3SFD B;  2BS4 B;  2LHE A;  3IAM 1;  4WIP A;  3AE2 B;  2JWU A;  2FUG 1;  1ZXH A;  2FE8 A;  2LEK A;  2Y5C A;  1K51 A;  3W5V B;  4LTU A;  1XEE A;  2GI9 A;  2PW9 A;  1TY2 A;  2WXO A;  4TQ1 A;  2DWQ A;  3E56 A;  2BB5 A;  2WXP A;  1SE4 A;  2KMM A;  4A55 A;  1JRO A;  3BVM A;  3AEE B;  3C8Y A;  3AE4 B;  4JWU C;  1E6E B;  1ENF A;  3NVZ A;  2INN E;  3AEA B;  4XDD A;  3NZ3 A;  2WXK A;  5HI1 A;  1DYQ A;  1V1P A;  3P4P B;  1C4A A;  4RF1 A;  1IGC A;  2JU6 X;  1EWY C;  3T3O A;  2QJL A;  2ZW1 A;  4MT5 A;  2WDV B;  1FO4 A;  1FEH A;  1HEZ E;  2SAK A;  1FNU A;  1WGK A;  2PVO D;  3MHZ A;  1FRR A;  4R3D A;  2WP9 B;  2QMT A;  2Q5W D;  1TKY A;  1L4D B;  2D5G A;  2BT6 A;  2DBY A;  3DWG C;  2EEL A;  4L2Y A;  2IDY A;  2CJO A;  1E10 A;  3BII D;  4RGM A;  1HQR D;  3RFZ B;  2L1A A;  2IPK D;  1E7P B;  2DYM A;  3KQ4 A;  5FR3 A;  1KRH A;  4OZB A;  3URY A;  4DXF A;  3VR9 B;  2QSD A;  2W55 A;  1WYG A;  1K50 A;  4WUR A;  3B2G A;  1QOB A;  2JYE A;  3AEB B;  1YQ4 B;  1T3Q A;  1AN8 A;  3Q8C A;  3SEB A;  3BVG A;  3ZQ4 A;  4TSS A;  2Z8L A;  4YSX B;  3KWL A;  2AQ3 B;  5BYQ A;  1C4C A;  2TSS A;  4HRO A;  3LB8 C;  1RYJ A;  1JRP A;  1TY0 A;  4ZRP A;  3KLS X;  4MAC A;  2IGG A;  4USA A;  1L0X B;  1PYW D;  2WLB A;  1FRD A;  3ZGZ A;  4ZOH C;  1XO3 A;  4OHJ A;  1V1P B;  1TS2 A;  2KWD A;  2LHD A;  4ZRQ A;  1L6U A;  2WXL A;  2BBC A;  1D5X C;  1YMH E;  2W82 A;  4WWM A;  3B2F A;  2DLB A;  3BWU D;  1K52 A;  2NMQ A;  3Q8F A;  2H88 B;  3AM9 A;  3TEW A;  4RF0 A;  1CQV A;  4GDL B;  3TEX A;  3NVV A;  1A70 A;  3MFG A;  3KWV A;  2RMM A;  5BMH A;  2FBW B;  5JXV A;  3AE1 B;  3AV8 A;  3GS2 A;  4PT5 A;  4LK0 M;  3ETR A;  3AH7 A;  1NEK B;  3FIL B;  2DYO A;  3WCQ A;  4WAF A;  1TZO A;  2AQ1 B;  1QOA A;  2WXM A;  3GB1 A;  4M0W A;  1C77 A;  1D5Z C;  3P4S B;  1TYG B;  4NJC A;  3TUO A;  4UDU C;  1GAQ B;  3AEG B;  1SE2 A;  1QQR A;  3V05 A;  2L83 A;  1HZ5 A;  4ARI A;  1XCQ L;  1TKE A;  2PKO A;  1C78 A;  3LYY A;  3IAS 1;  1SIJ A;  1AYF A;  1EU4 A;  1TKG A;  1I4H A;  1TJE A;  1VZ8 A;  3TEZ A;  1L4Z B;  4HKQ A;  1DGJ A;  4N6E B;  5T8I A;  4L23 A;  1FD6 A;  1STE A;  3MC0 B;  1DOI A;  1ZDX A;  5I4D A;  4OZA A;  1I4G A;  2ON8 A;  4XDC A;  1I4Q A;  1ROE A;  4J3O D;  1QLB B;  2QIE B;  2JX5 A;  2WU2 B;  4H2A A;  2JSV X;  4A8X C;  3ZYY X;  1JWS D;  3PZ8 A;  5C3J B;  1GOZ A;  4MH8 A;  4ZHO A;  1RWS A;  4C80 A;  1ZPS A;  2WU5 B;  1NYQ A;  1PGX A;  1TS5 A;  4XWW A;  1XLQ A;  3E9S A;  5HHD G;  1VLB A;  2JZP A;  3HUI A;  1PGB A;  2WXH A;  5G5G A;  5BYR A;  1SJH D;  1IUE A;  5BYS A;  1GPX A;  1N61 A;  2I38 A;  1IBX B;  3OWE B;  3W1S A;  2J52 A;  4HRS A;  1M4V A;  1UWX A;  2R61 A;  1T6B X;  1XF5 L;  1VR9 A;  2WXJ A;  3I9V 1;  1BXT A;  1F0Z A;  3P42 A;  4RCO A;  3AEF B;  1CZP A;  2ONQ A;  2PMV A;  1YJJ A;  2K22 A;  2WXG A;  1VRA B;  1ZE3 D;  4ITK A;  4GDK B;  4B0M A;  1E9M A;  2PLP A;  1MHH E;  1IGD A;  2K0P A;  1HXY D;  1JW9 D;  1XLO A;  2SEB D;  3FIL A;  1WRI A;  1ZXI A;  3IT6 B;  2V4I B;  1NI3 A;  2BW2 A;  1I4P A;  2J4X A;  2Y3A A;  4KGS A;  2K3U A;  4L1B A;  4WH4 A;  1JCK B;  5AUI A;  1NVI D;  2X38 A;  3Q69 A;  1FCL A;  3FAH A;  3P4R B;  5G5H A;  1AW7 A;  2V0G A;  2H89 B;  5AUK A;  3BK2 A;  3Q8A A;  3W5U B;  4YTM B;  4C7Y A;  1FNV A;  3U7Z A;  3B9J A;  1K53 A;  1SJE D;  2B76 B;  1UGJ A;  3I57 A;  4YT0 B;  1KLG D;  2HDE A;  2KAJ A;  4XWT A;  3W9C B;  1GB1 A;  1WWT A;  2WDR B;  5D7G A;  3VR8 B;  2AQ2 B;  1FFV A;  1B9R A;  1YQ3 B;  1XLP A;  3AB5 A;  1FFU A;  2NTS A;  3AE6 B;  2BYT A;  1VJK A;  4HJG E;  2N9L A;  4A6Q A;  4RGO S;  1EM7 A;  1V8C A;  4TQ0 A;  4N59 A;  3AMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...