1N61A

Crystal structure of the cu,mo-co dehydrogenase (codh); dithionite reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
b'KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n61A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n61A01
1JROA 1XLOA 3AE9B 1VLBA 2WQYB 1E0ZA 4N6EB 1WXQA 4ITKA 3AM9A 5H8YE 1J7AA 2H89B 1N61A 3AEGB 1ROEA 4YXDB 1B9RA 1JWAD 1OFFA 1YJJA 4WWMA 3P4PB 3AH7A 3SFEB 3LB8C 2PVGC 3DWMA 5EE1A 3HRDD 3AE6B 1FRRA 1WRIA 1QOFA 2W3SA 3AEBB 4IDIA 1WGKA 2WDRB 4N59A 3ETRA 2BS4B 4HROA 3VRBB 5MPOA 1JALA 2JQRB 5H92C 4LTUA 4ZOHC 1JW9D 1F0ZA 1QOGA 2WDVB 1ZXIA 2WU2B 2MJ3A 1NYRA 1TKYA 1KRHA 3AE7B 1GAQB 1FIQA 1JRPA 4YSXB 1DOXA 3NVVA 1NYQA 5G5GA 4C80A 1L0VB 1RFKA 1TKGA 1E6EB 3SFDB 2L52A 1I7HA 4YTPB 4WQMA 1V8CA 2LEKA 2M19A 2MH7A 2ACZB 1J7CA 1KFYB 1FXIA 2CJNA 3BIID 3W5UB 4YTNB 1SIJA 2FBWB 3AV8A 3AE8B 1FM0D 2BS3B 5EE9A 4YTMB 1EWYC 1TYGB 4A9AA 2K9XA 4FXCA 3SR6A 2MJEA 1T3QA 1OQQA 3NVZA 4C7ZA 3FAHA 3AEDB 1QOAA 3CWIA 3DWGC 1PDXA 1GPXA 3AE4B 1FXAA 1WWTA 2B76B 2N0SB 2WP9B 3B9JA 1CJEA 3P63A 2PIAA 3AE1B 1N5XA 3FC4A 1CZPA 4JWSC 1QLBB 1DOYA 3LXFA 4USAA 2W55A 1XO3A 1FFUA 1NVID 1RWSA 1FRDA 1ZOYB 2QJLA 4JWUC 4YSYB 5C3JB 1XLNA 2E3TA 3ABVB 2WDQB 4JX1C 3W9CB 2H88B 3WCQA 3CIRB 5EE3A 1E10A 1L6VA 2CU3A 1YJIA 3NS1A 1JQ4A 1KF6B 3AEEB 5EE0A 1JWBD 1V97A 5G5HA 2Y5CA 3AECB 2AX5A 1FO4A 1OQRA 1VJKA 3L4PA 1E7PB 3AN1A 3ZYYX 3KWLA 3AMZA 1VDVA 1YQ3B 2G1EA 1YQ4B 2K5PA 2KMMA 2WLBA 3B2GA 3HVZA 3VRAB 3VR9B 1QOBA 1QT9A 1PUTA 4KX6B 3W5VB 1RM6C 1AWDA 3HUIA 2WU5B 2PVOD 1FFVA 2L83A 3P1MA 5GXGB 3NRZA 1SB3C 2KAJA 4YT0B 1J7BA 2QIEB 2BT6A 4US9A 3P4RB 1RYJA 3RPFC 2DBYA 2K22A 1L5PA 3AEFB 2OHFA 4ZHPA 1N63A 1IUEA 4YSZB 1NI3A 1UWMA 1ZUD2 4HRSA 2M56B 4ZHOA 1A70A 1XLPA 1N62A 4N58A 1PFDA 2WS3B 3AB5A 4C7YA 1R7SA 2DWQA 3PO0A 1XLQA 1N60A 3AE3B 2HTME 1N5WA 1DOIA 1NEKB 1ZP0B 2CJOA 5AUIA 2PKOA 3EUB2 1NENB 1QF6A 3AEAB 3VR8B 1E9MA 3AE5B 2EKIA 3P4SB 3AE2B 1L6UA 2MJDA 4US8A 1FMAD 2BS2B 3P4QB 2W3RA 3NVYA 2JX5A 1WYGA 2Q5WD 3NVWA 4P6VF 2W54A 1TKEA 5AUKA 1DGJA 5C2TB 1TJEA 1AYFA 1SF0A 3B2FA
chains in the Genus database with same CATH superfamily
2N1VA 2JZPA 4HPLB 3HIZA 3HM3A 4MF2A 4ECWA 1KN5A 3V6HA 4FN2A 4KDIC 2KO3A 2K8AA 2AGPA 4JIOU 5ALWA 3Q8EA 3AH7A 2PVGC 4NQLB 1TK0A 1V80A 3VDZA 2WDTB 4CHKA 3U4EG 3EFUA 4NWIA 2IHMA 3WA0A 2XNAC 2CRXA 2KJRA 4A55A 4J9QA 7ICNA 1PGBA 2MSNA 1R4MB 2BQUA 2AYOB 1ZXIA 2BWFA 3RNAC 4TUPA 4DF8A 1SL1A 1E6EB 4B0EA 2QC8A 2REXA 2IMWP 4WQMA 5D6JB 3RR7A 4P0QB 2ACZB 2CJNA 3SV3A 1MVKA 5EE9A 5JHBA 2LRWA 2DQNB 4NY0A 1UPHA 1JUDA 2HTHA 4BOSC 3WK7A 3KHGA 3U7ZA 4DFDA 2EMSA 1ZE3D 4NQKE 5BPCA 2K4EA 2VRRB 4P4OA 5J8YC 2HE7A 2ZIUB 4YCXA 4UBCA 5J2IA 1L7MA 3G6YA 3A0HU 4XA5A 3ABVB 5J0WA 2W8KA 2Z0EB 1YIWA 1UGJA 1SEBD 3APCA 4EELA 3PO5A 3OPXA 1TZ1A 3VAWA 5KG2A 2PI4A 1E7UA 3RULA 4KGRA 2K4PA 1XXGA 3T3OA 1NZBA 4DQRA 3IG3A 3O0FA 1I42A 2DL0A 3R66C 4M9HA 3KWLA 1O03A 1YT3A 2YX8A 2N1RA 4EEWA 2IPKD 4FADA 3PZPA 1SZHA 4F92B 3OJSA 2OEDA 1PUTA 4P2HA 3T5KA 1Q5WB 1ZJNA 3TSSA 2JWZA 2L83A 1UCVA 3HJEA 5KT6A 4I2IA 5CP2A 4FZLA 2MP2B 4RQNA 3AEVA 4HPPA 2NRZA 5AKZA 3Q8QB 4XGAB 4YFKA 8ICPA 5BYQA 3AU6A 1MHXA 8ICYA 2AQ2B 2WHIA 3BYYB 2E5SA 4ZRKA 2QKQA 4WJ3B 3DBLB 4DHJB 4F4XA 1SWVA 9ICJA 5G2NA 1N5WA 2C5LC 1XF5L 1ZP0B 2A1JA 3IRUA 2WGSA 3A33B 3KHRA 3ISBA 1TKDA 4L1BA 3UQAA 1JN3A 4PGYA 1X6IA 1SZPA 3DBSA 2ZJ5A 1V1PA 1UBQA 3K9PB 3V6EB 4REZA 2DX5B 1ZQVA 4HYKA 3C28A 4O1NA 2ZXHA 1ZQAA 4W9LA 7ICJA 1E10A 1Q0WB 2WF8A 4W9JA 4ECSA 9ICQA 2KE7A 3Q8CA 3UXNA 4UB1A 3BS5B 3QEAZ 2KANA 3KVFB 1F1HA 2NO5A 3Q8KA 1K50A 1P98A 9ICFA 4HKZE 3PZ8A 4K1RB 2DZIA 4LK0M 2JGAA 5FK9C 3T3NA 2EANA 2XY6A 3PY8A 8ICGA 2J42A 2JZ3B 2WHEA 1Z00B 5KG0A 4HXDA 2BKRB 1YMHE 2NTSA 2G09A 1C77A 4R8UA 4GXIA 5L1LA 4Q44A 3ZXVA 1YNTE 2JQRB 2BCVA 2AL6A 2PEAA 2E8OA 5B5EU 4YXMA 1N2XA 2ZTCA 2JF5A 5DG8A 3LWMA 4C80A 4ED6A 4FJVB 3ZDDA 3GFKB 1ZXHA 1ZQEA 1KLVA 1PGXA 3ZJVA 3H0LB 1ECWA 4NXZA 1WIAA 2YMLA 5J2RA 5IIJA 3BQ2A 1FPYA 2FPMA 3AV8A 1RQLA 4MFFA 2MWSB 4OVZA 1UA1A 4S17A 3RF9A 3RBDA 2VJ5A 2N0SB 3TUOA 2JRHA 3H6NA 4QWDA 5D7GA 3BYTB 3I76A 2IYDB 1X9MA 2KNJA 1ZD4A 4O5KA 2IO0B 4MJSB 3Q3MC 1XO3A 3E9SA 1NVID 1PZNA 5KG6A 3ZDEA 2OOBB 3GS2A 3UXOA 1WY8A 4TKNA 4JX1C 3W9CB 2Y5BB 3CIRB 2FLNA 2L0FA 5EE3A 2ATLA 2R8HA 3G6VA 2JXXA 1UQVA 2Y9TA 3JPSA 3N1YC 2UU7A 2IGDA 3ALBA 2FUHB 4P16A 4MGYE 1Z2MA 3H8MA 1GJZA 4U7CA 2L0TA 1WF9A 3AU4A 3GIIA 4Y2JA 2K8CB 4I2GA 3AMZA 2HVIA 3HKZC 5CEHA 4E74A 2MBOA 2QILA 2KMMA 2PI5A 2V4QA 4LNNA 1TE2A 1WZ0A 4YL8A 4ZRPA 5TISU 2PMVA 3EA6A 3URYA 2KAJA 2HOFA 1Z5SB 1SV0C 2JEGA 1ZQOA 5DB9A 1WM2A 2KTRA 2K22A 3SDLC 1L5PA 4I2FA 4O3QA 1PK1A 4RNOA 4M00A 3NUQA 1DYQA 2W82A 4DL3A 3LYYA 1PYWD 3D32A 5ALPA 3TADC 1VD2A 2M0XA 4W9DA 4WWNA 2VH2A 3V7JA 4AP4C 2OCEA 1YJ1A 1KFSA 2OWOA 2HSZA 1JRUA 4UATA 5I4DA 2LGSA 3Q8FA 1KW4A 2D3BA 1WG8A 4KITB 5DB6A 1BPEA 4CO7A 1U4BA 2HBMA 4F7ZA 3N3KB 2F1IA 1P7FA 1D5MC 2WXRA 3H9DA 4F5PA 2BKFA 4NJ7A 1XWLA 3TEYA 5BMIA 2N9XA 5AI9A 2DKXA 4ITKA 1U49A 1IGDA 3MJWA 4H2AA 2G9HD 4GSWA 5JH5C 5DGBA 3TANA 4RM8A 1OFFA 4JE3B 3QUQA 1KJTA 3C21A 1ZD3A 2J6SA 4K4IA 3C2KA 2G5HB 5D46A 1TY2A 2A5UA 2C7MB 4BAXA 5JZEB 1WXVA 3HKZF 1TGZB 4QWBA 1T0RC 2LFIA 2JUOA 3P42A 3ZD9A 2ZW1A 1TAMA 4MEXA 4LTUA 3RJJA 3ML9A 4NM2A 1D8YA 3A9KA 2G0AA 1ZDVA 4OJ6A 3NVVA 5J2EA 2W7OA 4O3MA 7ICGA 2L52A 5HKHA 4C4TA 4EEKA 2WFAA 4JMUA 4EKUA 1X6JA 2AGOA 2YMPA 4AS1A 2XI9A 2HW3A 2XY7A 1Y88A 1WWUA 4IQVA 3MR5A 5AK6A 8ICHA 4YMMA 2KOXA 2WWZA 4QZIA 1V9JA 3SAFA 3RNEC 3HX0A 1CZPA 4M9GA 3MHZA 2KT7A 5J0SA 3WK5A 4AJWA 1RWSA 4ECQA 2L1AA 5ALOA 1L8OA 2IGGA 1EF1A 1CEZA 2WTFA 3RCZA 3C1YA 4LLGM 4ECRA 3KKAA 4ED3A 3NS1A 3BK2A 4II2B 3DBRB 2ZJ8A 3H7IA 4KKIA 3AECB 2R18A 3BZDB 5BOLA 2KVZA 1ZKHA 3PW7A 2E8MA 2CHZA 1V9PA 5KG4A 2EQYA 1NK4A 3GIMA 4TV3A 4QZAA 1RM6C 2MUTA 3V62A 3K75D 5AIAA 3T8MA 3VH3B 4M02A 3WKCA 3RPFC 3T5LA 2KFJA 1QSYA 4YVZA 2IOHA 5AI4A 5KFUA 4ZHPA 5ALLA 1IUEA 2R2QA 8ICBA 3Q8AA 2EZXA 5IP4D 2K25A 2YTUA 1XSPA 4DL7A 4OHJA 2P35A 4GU2A 1IM4A 4JK1A 5J2FA 2WXHA 2ZNVB 5ALNA 2OYYA 4JUZA 4GDLB 4M6WA 3QNMA 4DQIA 1Z4OA 2NBVB 2W7PA 2OEHA 2YMMA 2YVCA 5GTHU 3Q3JA 2ZIVA 2NYVA 2BGFA 4ANUA 4F5RA 1Q10A 3MFIA 1MHHE 2LYHA 1S5LU 3HWTA 2F1JA 3KUDB 2FUG1 1D6EC 1WGRA 5E6JA 3U26A 3KD3A 4MM3A 2FAZA 1J97A 3B2FA 2KTQA 3IG5A 3BVGA 2NO4A 2HCFA 2WXMA 3PSEB 3ZQ4A 4DBGA 5KFVA 1XD3B 1I35A 3QEBZ 5H2FU 4WJQA 3APFA 4M9LA 4WWMA 3DOWA 3GP7A 4WWPA 2LI6A 2PE9A 2FIDA 4LNOA 1QSLA 2Y5PA 4BGDA 4M0WB 4O3SA 5HR6A 2C7HA 2I1JA 2KN5A 3H40A 1E8ZA 4Y2QA 2INNE 4ZOHC 2BPCA 5AI8A 3AE7B 1EF5A 3ZO5B 1NKCA 2FIFA 2N7JA 3EPGA 2ASJA 1L0YB 1P1AA 4A20A 1EU3A 1MJDA 3PRMB 9ICOA 1U9LA 3E56A 1IG6A 3SAHA 2GOWA 4Z6DA 4CCHA 2BS3B 4YTMB 1B1ZA 4FXCA 4PYUA 8ICUA 4B9SA 1LQBA 5D4BA 1L3TA 7ICHA 2KFKB 4Q2JA 2YY6A 3VUWA 4AWJA 5KFCA 1PDXA 4F50A 3M6KA 3P63A 4P1CC 1T0YA 2I5HA 2LHEA 2VA8A 3QC8B 4DHJD 4USAA 2KSOA 4JWUC 3JPOA 5J2AA 1WXSA 5KHQA 2GRIA 3VFKA 4EENA 2FCSA 3H8HA 2KG5A 5TZVA 3RJGA 2JPHA 4C4SA 1V97A 5G5HA 3RJEA 2AX5A 2I2YA 2MQJA 2E1EA 1UBIA 1NK0A 3RNFC 4ECUA 3FILB 3QX7A 2ASLA 3MP9A 2R8KA 4B9VA 4P1BC 4C00A 2JZZA 5EWFA 7ICOA 4J9LA 2L00B 4ELTA 2W8LA 1AWDA 3HUIA 2WAQF 4A8EA 3QE9Y 4P4MA 3L08A 2KKCA 4JWMA 3ISCA 2J0KA 1MI0A 3RT3B 5KG3A 3CSTA 3IXSA 4KX5A 3T5HA 4P0QA 4JGHB 3ZXRA 2M56B 3UINB 5CB1A 2KKPA 5AM0A 3W1YA 1RQNA 2PFQA 3PO0A 3IHQB 2EELA 3IHPC 2HTME 3D2NA 2AEHA 2LM4A 3F5EA 3GQCA 3BVMA 3ML8A 5DDYA 3Q3NC 4QW8A 5L9XA 3J9CA 3EUB2 8ICOA 1V81A 1U4AA 3A0BU 4PGXA 4AUQC 4KLJA 3M95A 2JYEA 2LUEA 4XDCA 2ZIUA 5ALQA 1IGCA 4W9CA 4C4VB 1ZQSA 4B6JA 3QUCA 3P4QB 1QZEA 2W3RA 4EUTA 1ZPSA 2EAOA 3BK1A 5J0RA 4CYEA 2H3FA 5GMVA 1TS2A 4ACFA 2BBCA 1ZD5A 4ANWA 4RH6A 1SGGA 1TS4A 2MCNB 2HJ1A 3PS6A 4ED8A 4RQ1A 4N6EB 1SKRA 4KLDA 1HUZA 1WGDA 1WXQA 3H8SA 2HBKA 2Z8LA 5FKAC 1TK5A 1T4GA 3JYUA 4MGKE 3VTUA 2DKZA 3PW2A 3PVLA 4WJPA 1WX8A 3UM9A 5J0UA 1F2RI 1SE2A 4B95A 2DPJA 4PPXA 2KMAA 4PYZA 4Z6EA 1X2IA 3M8SA 3SFEB 3J81j 2AJQA 1CMXB 1WRIA 4RFBA 3VUXA 1JI7A 4IDIA 5AZGA 4EYIB 1VRAB 3GE8C 4DFPA 4B9NA 2MP2A 4HROA 2LM1A 1L0XB 5C0YA 2INPE 4Q43A 2LGXA 1F0ZA 8ICRA 4HPMB 4RNMA 1NYRA 1D8BA 1XSNA 2RSUA 1GAQB 4FHJA 1FIQA 1NYQA 2KZRA 1ACCA 3T79A 4W9KA 2NMQA 1YQBA 4EE2A 3PSTA 4RGNA 4M04A 2FBWB 4NZLB 2YN4A 2ISOA 1LXDA 4W9GA 4TUUA 4O5CA 1OQQA 3TARA 3FAHA 4ACOA 3LYSA 2K4IA 1MSWD 9ICRA 3GZNI 3MTNB 2WB1F 3B9JA 3NJTA 4EZ9A 2JEIA 1QLBB 5J29A 5JTIA 5AK4A 4YR2A 1FFUA 2IBKA 1EUVB 5DCNA 5TSSA 3GU3A 2V1YA 2ZXIA 4K81A 1MG8A 3EW9A 1B0XA 2CU3A 2N1WA 1ZQMA 5F3XB 1AARA 1JQ4A 1HUOA 3BS5A 4DS5A 1WXMA 4WH4A 2RDIA 1OW5A 2RGFA 3G6XA 3CMMB 3BZCA 3ZRCA 4IW0A 4B9KA 3MABA 2DENB 4HDOA 1Q1OA 3AU5A 4UARA 1BPBA 1Z00A 3BS7A 2BYEA 3VR9B 5A0LA 5CTRC 4RQ8A 2FLPA 4M8MA 2JVCA 4PL1A 3P1MA 9ICBA 2N9PC 5GXGB 4JB3A 3KKAC 2A4ZA 5D3DA 4U6PA 4RU9A 4I2DA 2WF7A 5KT5A 1K8RB 2KN7A 2LASA 2RDBC 4HK2A 2Y0SF 1QTMA 4FS1A 4K3CA 5AM2A 5AI5A 3H7PB 4PZNA 1SL2A 1ZQTA 1HEZE 2KVSA 3VH4B 2DWQA 4JV2A 1L7YA 3WK9A 3QAQA 5J0YA 3OGUA 3TMPB 1G6JA 3C19A 5DGAA 1ZQHA 2GBJA 2ZEQA 3RB6A 3DVNV 2KHVA 2UWQA 2BZFA 3VR8B 5KTQA 1S0NA 2W43A 1ZQRA 3L16A 4MJSA 4URKA 4US8A 3F53A 4F93B 1EO6A 3NVYA 1KTQA 1MC8A 2MRLA 1NK9A 2YLMA 2KJ8A 5AUKA 3R3MA 2NR2A 2SEBD 1CUKA 4A3PA 4KLLA 1D9DA 2F77X 1K52A 2KC1A 1RAXA 2W04A 1NK6A 4BKGA 5GTIU 3ZDTA 1ED1A 3SQIA 3E2EA 1RFAA 4BKTA 4G50A 2K8CA 3M1YA 2KV2A 1S1QB 2E8NA 1N61A 2MBBB 2LGDA 4CF3A 4I29A 3GE3C 2KJ6A 4I6NB 5AHXA 1FD6A 1S10A 1D5ZC 3N7RC 3HRDD 2W9CB 4C4RA 2J53A 5HG2A 4TMAB 4QZDA 4B9LA 1F77A 3N1XC 4WWOA 4P0PB 4LJPB 4NAWB 3JPTA 3QQ8B 2QHOA 2BF8B 3JSVB 2L32A 1IBXA 3NZ3A 4ZRJA 5AM1A 3SFDB 3PPAA 1BPYA 3ZTDA 4FLHA 2F8KA 4WAFA 2M19A 3C2LA 2V4RA 2UVRA 1SBBB 2Z7JA 3MC9A 3W5UB 2D6FC 1TYGB 4A9AA 1BPXA 9ICCA 1T3QA 1R4NI 1B43A 2FMPA 3AEDB 1GPXA 3R7QA 2LBOA 2DGZA 2KD0A 3M63B 3PV8A 4PHDA 2WP9B 2ZUCA 2DZKA 3KZIU 3NHEB 1A76A 2N4FA 4XX5A 3GIKA 2EDUA 2G5IB 1VR9A 4Q45A 1XLNA 2H88B 5F9LA 2G08A 1GUAB 2INDC 1KF6B 5EE0A 2J6TA 2OJRA 3WKEA 2IA6A 4YR3A 4PHPA 4F2SA 1E8WA 2D3DA 5ALVA 9ICSA 2E6XA 3AN1A 4DSIA 3ZGZA 1TBEA 5L1IA 4ECZA 2XEWA 4DF4A 2I1KA 2K5PA 3QJZA 3IDWA 2XVTA 3V7LA 4DFKA 1QT9A 2LXCA 4GIVA 2HOQA 3ED5A 2FMQA 5ALTA 1ET6A 4DQOC 1KDHA 1NKEA 5DQGA 2XGPA 1C78A 2M0AA 2C28A 1PVQA 5L1KA 4YD1A 3N7SC 1K51A 3OLMD 2ZUDA 1PVRA 1SJED 1IXRA 1MFWA 1ZQLA 3ETLA 1WX9A 3RUIB 4YSZB 4IQTA 5KG7A 1UWMA 4DXGA 1L3SA 9ICPA 1IYFA 1KFTA 2OJWA 2XIDA 1EWCA 1KSPA 2BCQA 4IL6U 2QARB 1HZ5A 1XU4A 3ZJTA 4C7YA 5J0PA 1F52A 2LGIA 5B66U 1RPLA 3DDCB 7ICQA 4EZ6A 1V49A 2KC2A 4K4GA 5DLFA 2KDEB 2J4XA 2KZMA 1UF0A 4RUCA 3OSPA 3A9JB 4EEYA 1Y56A 3L10B 3RJIA 4ELVA 2RR9A 2Q5WD 5KFEA 5KT3A 1UNSA 4ED1A 2H3IA 1C9FA 4DSEA 4KZCA 4DXAB 1BNPA 4FS2A 3O13A 3DVGX 5FR6A 3SENA 3WALA 2LYAA 2JR5A 1UT8A 1TIFA 2UVUA 1H4RA 1ROEA 3C23A 3MJ5A 4AJYB 2KMCA 1T5XD 2JHDA 2K8BB 2LYBA 3O65B 1P3QU 4TURA 3RD2A 4Y2PA 1C4CA 3OSNA 1WE7A 4R65A 3QU9A 2JRZA 2P6RA 4RGTA 4DL6A 4A90A 1NZPA 2WU2B 4J9PA 2MJ3A 2NBWB 3PSIA 3F2CA 3QX1A 4IM0A 5DBCA 1JXLA 2ZTDA 3QU2A 2GLSA 2Z0DB 4JLCA 4Z6FA 5ALRA 3ZNGC 4J9KA 5DQIA 4JPSA 5L95C 3HP6A 4CF4A 9ICIA 2MBEA 3M9OB 2BW2A 3A1QA 4GDLA 1NJYA 4UAVA 4Y2RA 5JUMA 5CWRA 3LWLA 4UB2A 4C7ZA 1U48A 3BVZA 4I2EA 3NG0A 5DDMA 2ALZA 1WGGA 4IG7B 4FZNA 2C2RA 3BQ1A 3UQ0A 4YSYB 2WDQB 2VKQA 8ICCA 1GB1A 4PS3A 3EC8A 4OD0A 4DLGA 4FO6A 2XCAA 4B0MA 5KL8B 2JXJA 1SE4A 2BB5A 1VJKA 1NJZA 2D8CA 2F8LA 4AP9A 8ICTA 1OGWA 3ZYYX 2O2VA 4KVGB 3Q3OC 4MSQB 4JV0A 3JPRA 2KFNA 1BMLC 5IIOA 1I4PA 4M0WA 2K4HA 4LJOB 4QZHA 3SEBA 5DQHA 1Q8KA 3TEXA 2FE9A 5HHHA 2KACA 2NRXA 3L0WB 4GDKB 1SL0A 2PLPA 4XQ8A 1RYJA 1QSSA 3JW0X 4O3NA 3P4RB 2PKEA 4DL5A 5F9NA 3NTUA 3C1ZA 2OHFA 2UVWA 3K1RB 2DAFA 2LD9A 3ZD8A 5KFOA 2G4SA 4ZHOA 4FZMA 2W9NA 4QW9A 1QQRA 1L4ZB 4R66A 4NLBA 3CP8A 3VCBA 3PHWB 4G3XB 2MW5A 5DB7A 4KGTA 9ICWA 3MBYA 2LHTA 2KFKA 1RXVA 4LVSA 1I4HA 2BPSA 1NEKB 5LXIB 5FR3A 1E8XA 4S0RA 1B4FA 5AI0A 2KJ5A 2ZPNA 4MEYA 3RB3A 3RH6A 3OJUA 1SV4A 4ICUA 1MQ2A 1S97A 1SGHA 3F2BA 5HMLA 4RF1A 4Y2YA 7ICIA 4Z6CA 5J2GA 4RPYA 2ESEA 1TTNA 3GV7B 2ON8A 4F5NA 4IRCA 3UIPB 5JU5A 1MPEA 3V7KA 4Y2VA 4EZJA 2KWCA 1TT5B 4E71A 2PFPA 1I4GA 4BXOB 3I3TB 9ICNA 1MA7A 2LXAA 1J7AA 3VXWA 3GILA 3FILA 2IY1B 3ORYA 3LJ3A 1L5UA 1X42A 3T3FA 5EE1A 3PW5A 2D3GA 4AQ7A 3PLUA 4CE6A 3EZ5A 1D9FA 3KUZA 1X9SA 3RNBC 2RMMA 4KLFA 2YEPB 4LNIA 4DSFA 2K8HA 1KRHA 4JL9A 4FJZA 1JRPA 4HEA1 2RP5A 2ES6A 1DOXA 2BQ3A 1L0VB 1QLNA 3KQ4A 4G0NB 2LVPA 3ZI4A 2NRVA 2KTFA 4PS7A 2JYTA 2VH1A 1SIJA 2M9NA 2HHSA 4DEZA 3WANA 1S76D 2X8XX 4NV0A 4C4VA 5KFDA 3V05A 4W9HA 5KG1A 4ICAA 3RH4A 5C5JA 4QZCA 3L54A 1FRDA 4F8RA 5CHFA 4OVUA 8ICAA 1A77A 3ONNA 4I28A 2LJ5A 3JPPA 4GC6A 2L76A 3L17A 3RAQA 3RMKC 3DDHA 3ZDMC 2FMSA 1XSLA 2GOLA 2L3ZA 1V1OA 2PE6B 4K4HA 1BVSA 1O08A 2DF4B 3WKDA 5IAAC 3R9KA 5L1MA 1D5XC 2KX3A 5J2CA 2EKEC 2ZVOA 1YQ3B 3B2GA 1JIHA 4QJFB 3DBRI 3TAPA 4KX6B 4IWQA 2PFOA 4KKJA 1C7YA 9ICEA 4F4YA 1OEYJ 4YT0B 1J7BA 4YN4A 5KFQA 4YXJA 4UW9A 1SXEA 5IO9A 8ICNA 4DK5A 1P7EA 1T94A 4F71A 1UT5A 3SD5A 4Q8FA 1XCTL 2Y1JA 5CJ7A 4BOZB 2ZCBA 3PRZA 3UGBB 2WF9A 1K1SA 2MBQA 1DOQA 4ECVA 1NENB 2M1MA 1VJ5A 1Q3VA 1F0MA 3RBEA 2BWES 3AU2A 2RRDA 2CKHB 1UA0A 4NAMA 1YX5B 4RQ0A 1GOZA 3PTFC 5ALUA 1TKEA 2FCQA 3B0YA 2LVQA 3UMBA 4NLNA 3PRPB 1AYFA 8ICEA 1XLOA 4RNNA 3N32A 3H0RB 4QWCA 4PHEA 4KSLC 3DQVA 3V6CB 2KWUB 5CR0A 2M8SA 1UUPA 2TSSA 2R2OA 3Q6BA 4ZH4A 1V5OA 4BVUC 4UBBA 5G55A 1JWAD 4BWMA 2I9GA 2M0NA 4LNFA 5KT2A 2AGQA 1C76A 1LKYB 2ASDA 1Q46A 4QNLA 1WJ6A 2L05A 4I2BA 3LK9A 4N9F4 1JCKB 5T8IA 8ICQA 2BQQA 2ZW0A 3TEZA 3QIJA 5H92C 2KICA 3GZFA 2KJ9A 5D3IB 5LLIA 2EZYA 4NLKA 4O3OA 2QLTA 2HJ8A 2L5YA 3NS8A 1TAUA 1GB4A 3L3FX 4C8NA 4YTPB 1PGAA 4EZKA 2LWPA 2ASQA 3KYDD 1E7VA 2MH7A 1J7CA 3HPOA 3CF6E 4A6QA 4F4WA 1LVHA 3A4RA 3SV4A 1FM0D 1XCQL 2D3AA 3RN9C 2NRWA 2WAQC 2IY0B 2N9LA 1ZQDA 1WWVA 2C2EA 1D4BA 2AU0A 5L1JA 4J3OD 2WX0A 4W9IA 3CRXA 4KV2A 1N56A 4RM9A 2AQ0A 2LRUA 1AW7A 3H4DA 3Q8BA 4KMOB 3OJ3A 3OWEB 2EAMA 2ZNVC 1OUQA 2QMTA 4OJ5A 2CPRA 4NL9A 4HCPB 1JWBD 2Y5CA 4QZ9A 5KAFU 3H4BA 3RYTA 5HMMA 1YD8U 2YB1A 4DQPA 4YWGG 2JH1A 2FLLA 3HK0A 1VDVA 2IGHA 4RPZA 2Y3AA 2WLBA 2W9CA 4ZYNA 2BPGA 4ECTA 4TQ1A 4PHAA 4P0PA 2K39A 2INCC 2PVOD 1J2NA 4NAWA 5AKHA 3NRZA 4BWJA 1FNWA 5KHOA 1SKWA 4F2RA 2NPTB 3S2AA 2J52A 2NV3A 2JXTA 2BYFA 2K0PA 3JSVA 4L2YA 5HP4A 4MHVA 5KNIA 2MSED 4KIKB 4IKGA 1Y8RC 2RHFA 3BQTA 3BWUD 4HRSA 5ALFA 1QH9A 5AKXA 2L7RA 2LZ6A 1RRBA 2DZMA 3U7DA 1ZDXA 3CYMA 1R7SA 1TY0A 1XLQA 3ZDAA 2B3AA 3PX4A 2OH2A 2DNFA 3SMVA 2ZIXB 3N20C 3OAWA 2NBUA 1E9MA 3P4SB 4DO9A 3DHGC 4UB6U 2G06A 4IOIE 1BUIC 2OM6A 2BS2B 2CXYA 2LMRA 2UYZB 2KXJA 4MDKE 2X38A 4MSMB 4P6VF 2AQ4A 1ZQPA 2KTRB 2ZG6A 5ALGA 3R2TA 2KJHB 9ICTA 5FP0A 4FBTA 3AE9B 2IZVB 2KN4A 1BNOA 4MT5A 3PT2B 1J0GA 2W9BB 3PX0A 4DQQA 3JPQA 3AM9A 3N28A 1KBUA 4PH5A 1T8EA 1SIFA 4QAYA 1V85A 1B9RA 2WB1C 4EBDA 1ZRMA 4C8LA 1YJJA 1JX4A 1JMSA 3HT3A 2GBKA 1COOA 3QYPA 1IP9A 4MF8A 4BDPA 5KFKA 3RJHA 1E5WA 3WK8A 3PSPA 2DLBA 3ICXA 4GMVA 1ZQGA 9ICKA 2WDVB 2JEFA 3RB0A 3DPDA 3QU7A 2RD0A 2NS5A 3KLSX 1VCBA 4W9EA 4RZRA 3UXPA 1OEYA 4GN1A 3KOOA 1T3NA 2WF6A 4MH8A 2ZIWB 4IC9A 2QARA 1L8LA 2C7NB 3BIID 2GO7A 2JZBB 3AE8B 4F91B 1WRDB 3CWIA 3GV8B 2LKYA 3MGIA 3AE4B 1PVPA 1HE8A 3A9JA 4RMAA 2GH1A 1S0OA 2VZKB 1DOYA 5ALSA 1SKSA 2Y0SC 2E3TA 3WKBA 3IBEA 3AULA 5KT7A 3NY5A 4NNJB 2W03A 4OW0A 3WCQA 4JWNA 2KLCA 3HVDA 4F4ZA 1LM8B 2N9EB 4MEMA 3EYZA 3WKAA 3D2QA 1KL9A 4CGZA 3IT4B 2JMGA 4KLMA 1KQQA 4I6PA 2K1FA 4WURA 2BTEA 2GI9A 2H3QA 2D5GA 3CSFA 3U30A 1RYSA 3L4PA 1E7PB 5KFIA 2R8IA 4NPNA 4WAAA 3KZXA 3RTVA 3NASA 1ZQZA 3M9MB 2K8BA 3SZ2A 5AKYA 5KFNA 1DK3A 4BZAA 2RPVA 5ALZA 3PHXB 4A3OA 2DBYA 3PVXA 1GC7A 4OZAA 3QA8A 3AEFB 3DBHI 1N63A 5IIMA 4DFJA 2LHDA 3BQ7A 1ZQWA 4EBEA 4IRKA 3I9V1 3F2DA 1ZQJA 4WIPA 3M62B 4UQGA 4KLQA 1A70A 1HJPA 3FM9A 2MAXA 1I4RA 2LJIA 3X0WA 4F72A 3VC8A 2BQRA 4ANVA 1UWXA 7ICMA 2CJOA 3A4SC 4MELA 2V4LA 1V2YA 3AEAB 3MC1A 4DWIA 3AE5B 2EKIA 3AI5A 4UDUC 4TQRA 4QZGA 1M4VA 4TUSA 2MUTB 1Z1VA 4AYBF 4J9SA 3ZW3A 1T6BX 3NVWA 3IAS1 1QQ5A 2KKVA 1ZQFA 1BPDA 2WXNA 5KFXA 2K60A 3RJFA 4RT3A 4J9MA 3GZNB 5IKCM 2R8GA 5IN7A 1L4DB 3FDSA 5AM5A 4CNQA 4KN4A 3THVA 1V5TA 1D8LA 2H89B 1STEA 4RT2A 3AEGB 3TI0A 2KIWA 3RRGA 3ONSA 1WE6A 1XC9A 3P4PB 1T7PA 9ICVA 4BBNF 3AQEA 4GDKA 4ED2A 2O6VB 3H8WA 4HDQA 2ODGA 1C4PA 4BKSD 2M17A 4ZRIA 3QUBA 5KG5A 2XC9A 3UPQA 4R3DA 1WCNA 5AK5A 3RI7C 3T5JA 5J2DA 3MR6A 3W1SA 3Q14C 2WXLA 1RFKA 3IP4B 4MM3B 1IIPA 1I7HA 4R64A 2LEKA 1JWSD 1WR1A 5D94A 3K4GA 1YX6B 4XC2A 2ZUBA 3MR3A 3LDZE 4IRDA 2KDIA 2LGYA 2XY5A 2K9XA 1UELA 3GDXA 1GO3F 2F76X 4DS4A 1NK8A 2KLGA 4B9UA 1ZQNA 1FXAA 1WWTA 4KLEA 2V0GA 5J0OA 3M3JA 3RAXA 1S0VA 4D2KA 3PO4A 2GLEA 2GBMA 4FULA 1L6NA 1X9WA 4LDTB 4M9JA 1SE3A 2ICIA 1ZETA 4IQUA 1K5OA 4UB4A 3T9LA 1ZQ1C 3TACB 1V86A 1YJIA 1ET9A 1P7DA 3ZNZB 1I4QA 3PREA 2ISPA 1TFRA 7ICSA 1FO4A 4RQ6A 1PUZA 7ICLA 1R4MI 2CHWA 5KFFA 4MFAA 2JWUA 5J17A 1ZRNA 2HBLA 3ECIA 2G1EA 4DSKA 1WGHA 1KLNA 1QOBA 2KK8A 2DYBA 2KNBA 3B1LX 3L13A 3TCAA 2RDJA 1FFVA 3L5KA 2BGWA 5ALMA 1COKA 4KLOA 3Q3FA 3VTWA 3P2BA 2QIEB 2BT6A 4IS7A 4NL9C 4EX7A 2HOIA 3Q2AC 1BXTA 4YMNA 1HZ6A 3BINA 5BMHA 3GB1A 2AXTU 4EOYA 3RR8A 1LV5A 3B0AA 4I2JA 4CQNA 3WAMA 1N62A 4KGSA 2DHZA 5HNKA 2VA3A 4UASA 2JV3A 1QCKA 3AB5A 4UB3A 5HFYA 2MEKA 1WYWB 2K3UA 1BT0A 1CI4A 4RPXA 3Q8SB 2V9HA 2KHWB 2MBHA 3H1UA 2QB1A 1FCLA 1UH6A 2F1HA 5KFGA 1XQQA 3EFCA 1RYUA 2J6UA 3HM6X 3AE2B 2NRTA 2QB0B 1QQ6A 3EWAA 1FMAD 1LO5D 2B6GA 4HVBA 2EMTA 3B08A 2DUYA 2Q4TA 1NI2A 2WXFA 1R4NB 2RPQA 5C2TB 2MA9B 1ISNA 8ICKA 1KKXA 1WJNA 1U47A 1Z1BA 2BVCA 7ICRA 4BKSA 3JVZX 5J18A 4B6WA 1Q3UA 3U8ZA 2KX0A 2IO2B 2G4DB 7ICPA 2AH5A 1FNVA 8ICFA 1N6ZA 1A6SA 2ZCCA 5KFBA 5AIBA 3PNCA 5EWGA 4NLGA 1UHUA 2NVUI 5TR5A 1TVAA 3C5FA 2KK0A 2LPEA 3VRBB 1WUDA 5KL1B 1FEHA 2E8PA 4Y2UA 1J2MA 3DBLI 2IO1B 3RFZB 3M6ZA 5KFZA 2KIVA 1TKYA 3TQ1A 5AK3A 2IOFA 4HAIA 3UQBA 1QQ7A 3AQFA 4F3OA 2HHXA 5ALDA 2ZTEA 1FXIA 1GC6A 2PPHA 2DFLA 4X5VA 1NOMA 1X40A 1IV8A 3SR6A 5C1ZA 2MJEA 4GB9A 4OJOA 1MG4A 4RGOS 3SD7A 4KZ0A 1A0PA 4KLIA 5HHIA 2FNJB 1ZQXA 2BCSA 2PIAA 3V6JA 7ICUA 4DL2A 2HHVA 2KVRA 4Q8EA 7ICEA 2O6KA 3GIJA 5CHVC 2KDBA 3Q8LA 8ICVA 5KFTA 1ZQYA 1AROP 1UGMA 4WJOA 1RDFA 2IDYA 4GFJA 1H8CA 5KFAA 5CA7A 3N1ZC 2I38A 3Q69A 2GMIC 4DDGD 1B22A 5ALIA 1X9XA 3PR5B 4M2YA 5LNK1 2WYQA 3I28A 1LKYA 4KLSA 4FE3A 3PGEA 4DWFA 2M4NA 3UMGA 2PXIA 4I6LB 4J9RA 1RYRA 4C8OA 5ALEA 2JT4B 3HHMA 1ZGUB 2KQSA 1XNSA 4O5EA 2KQ7A 4KDLB 4US9A 2PW9A 4WQOB 2A3VA 2NCNA 8ICWA 4RUAA 3MR2A 2KZ3A 1KLGD 4IUMB 5DPRA 2ZPYA 4LJXA 4J9NA 4LZDA 3UQ2A 4DOBA 5DPTA 2ZJAA 4RNAA 1YZ7A 3SEIA 2BHNA 4N58A 3MDCA 3ZUNA 4BUGA 5IOIA 3EPIA 4RQ2A 4XUSA 2WX1A 4MGIE 4I2HA 5AKIA 2BR0A 4ASWC 4DSLA 5AI6A 5IIKA 3KBBA 5AKGA 2HMXA 4PS8A 2G45B 2E1FA 3VQIA 1VZ6A 4QIWC 1ZQKA 3IG8A 3TAQA 2YQEA 3C5GA 3AUOA 1ZOLA 3NZUA 3PZ7A 4IWPA 1S3SG 4MH0E 3JPNA 1FCCC 1E0ZA 3RZFA 2VZKD 2MX2A 3TIXA 3KWVA 2WXGA 1LGRA 4UB5A 2BB6A 2BCUA 2XBBC 3ZNID 1S0MA 8ICZA 3F5AA 4NY8A 8ICSA 1WMHB 2JRIB 1L2NA 2RLTA 4OCZA 9ICAA 3DWMA 1X1MA 4DXFA 5CHGA 2C22A 3Q8RB 1KTKA 3EHVA 3BJYA 3V3XA 2KP7A 4UB8U 3C29A 3TFRA 1WGKA 5LXHA 4QZBA 2MA1A 4DOAA 2NPTA 4NM1A 4GC7A 2V3SA 3CNHA 1QKZA 4LCDE 3QHTA 7ICVA 4KIKA 1VZ7A 4XYCA 3E58A 2C60A 4YSXB 1TAQA 1YN5A 2HHUA 1FNUA 2PTLA 3E0FA 2F2AB 1C3TA 3CW2C 2WXQA 3APDA 2N7DA 5BYRA 3GOEA 5KFHA 1WM3A 4RQ7A 2IO3B 3V61A 2GBNA 2G3QB 4NJ6A 2ZIXA 2R8JA 4II3B 4ZDVA 2KOBA 5BMGA 2RDGA 4OZCA 2B0CA 4QWEA 4TQSA 3R2IA 4UAUA 1ESFA 5JXVA 1CJEA 1M94A 2HBJA 3FC4A 1C4AA 2XK5B 3W1SC 5DB8A 3OHAA 2W55A 2W11A 4IM3A 1WH3A 1ZQIA 1WJ4A 2KQ4X 3RZWC 4DHZB 9ICGA 4ZRQA 1IBXB 3QU4A 2W9BA 3AEEB 1HTOA 4QIWF 3KUCB 5ALKA 4FA6A 1YOVB 5AZFA 4JQWC 1PQSA 2AQ3B 2IHNA 4XE0A 2RQ5A 1S8OA 2QCZA 2V3PA 1YQ4B 5J2BA 2JU6X 4F5QA 4RQ3A 1L3VA 3PW0A 4RCOA 2F3NA 2FPLA 3WIMA 8ICLA 3TL5A 5DBBA 1SB3C 2KVCA 1KOTA 1C1YB 3DHHC 3PSFA 5BO4B 4QZ8A 3VTVA 4O9MA 1JXEA 5AKKA 7ICTA 3Q8PB 2K6QA 3U52E 2O6VD 1JWMD 3PV1A 1NI3A 2ZIWA 2VIXA 2DPIA 4PGQA 4DCCA 2JZBA 2HHWA 3NUHB 2FE8A 4YP3A 1XT9B 4MACA 3OTQA 4Y2XA 2L8JA 4EBCA 1SJHD 3RH5A 4X57B 5KFYA 3DCGA 2LMCA 1TZOA 5AUIA 2P6UA 2BCRA 4F1SA 4PT5A 1PK3A 3ALRA 2LUMA 4BJQA 5IINA 5E6NA 2Z59B 4XWWA 3KH0A 1LB2B 1UZXB 4IQWA 5JHAA 1TS3A 2BDUA 4XRHA 9ICMA 4HLEA 2IJ0A 5KFMA 2W54A 3FYHA 4DSJA 3DVGY 4Y2SA 3GV5B 1F44A 2GWSA 1TJEA 1QF6A 4R63A 2FI1A 1OXJA 2WQYB 2KD1A 4LDTD 3LVWA 5J2HA 1WXAA 3IAM1 3SHQA 1I4XA 2KYWA 5HI1A 4HKQA 4YG2A 8ICJA 4YXDB 4RGMA 5J2JA 1TV9A 3I57A 3H7SA 4K7WA 3AE6B 2HDOA 3AEBB 3NGDA 1XEEA 5ALHA 1SXDA 2EZZA 2MU2A 1J19A 4MFCA 1EU4A 5T14A 3KFUF 3RJKA 4K3BA 2KMDA 2CN1A 4M0AA 2YB4A 2JEJA 9ICXA 2ONQA 3UI3A 3C2MA 1WGYA 4A8XC 3OJ4B 3MDAA 3DHIC 2XO7A 3DV9A 4I2AA 4J9OA 9ICUA 1GG3A 1WJUA 2ZZPB 1HA5A 2YMQA 3TKAA 4XDDA 3ZKJC 4YTNB 3TBLD 1L7OA 1L7PA 1CRXA 1EWYC 3MGHA 1CK1A 1WR6E 3WAPA 3NVZA 4OJLA 3N97B 3UF8A 5AKLA 2CHXA 4KMUA 2A1JB 2EAPA 3QZ8A 1S9FA 2B76B 3RB4A 4KX3A 1KRPA 3C8YA 2KFZA 2WF5A 4RQ5A 3VHTC 4YD2A 2YEPF 3NOBA 2QJLA 1V1PB 2V9WA 1ZOYB 2W9MA 5KT4A 4M9NA 3SI8A 3V6KA 3B0XA 5IIIA 3KHLA 4HCNB 4OO1J 4EFOA 3FKYA 5J0QA 3H7PA 1DK2A 3PZDA 2KEYA 4XWTA 2HDEA 1OQRA 4FJYA 3SYZA 3A1QB 5KAIU 2VA2A 2CS4A 3VRAB 2KDFB 2O6VA 4RQ4A 3UMCA 2FDRA 3W5VB 3QCAA 5DBAA 4HWIB 5AKEA 1RZTA 1DRGA 5HR7A 1JMLA 2DYMA 2VJ4A 4R8UB 1ENFA 4E3CA 3PR4A 2GBRA 2KHQA 2J7QB 3IFWB 3RNCC 2SAKA 3KYCD 3ZJUA 4TQ0A 1F5SA 2AQ1B 2JSVX 3QZ7A 4KTQA 4UAWA 1SSNA 1XO0A 4K7SA 4E0DA 1NKBA 4J6IA 4BFRA 2GB1A 4NJCA 2FJ6A 3HW8A 1YN4A 4P7IA 1MQ3A 3K9OB 1PFDA 3AXCA 2WS3B 2CU1A 4QZEA 4NLCA 3PLVA 4DHZE 1N60A 8ICMA 1Z19A 2O2VB 2A19A 2PKOA 4ELUA 3EGRA 1P9DU 5L83A 2UVVA 2B21A 2J0JA 2WXJA 2XN9C 1TS5A 2N7EA 1D3ZA 1FEZA 1L6UA 4ECXA 4CDGA 3N7PD 3DVNU 2JX5A 4EZLA 3ZDCA 2FCMA 5DPWA 4ARCA 3TJPA 4IM2A 3OG5A 5AZHA 3MGVA 1KH0A 2XICA 4G9BA 5JRTA 1V6EA 3QXGA 1EM7A 3HILA 2D10A 1SF0A 2WXOA 4NLZA 3W2DA 4IR9A 1JROA 5CX3A 4L23A 2QDFA 1SXTA 4ICVA 5C23A 7ICFA 2N9KA 2FPKA 5DG7A 2I6XA 1UD7A 3BZKA 2XGQA 2MLBA 3LB8C 2MRPA 5AKJA 2Y9UA 2ZVNA 1K1QA 1WZ3A 1N48A 1NDDA 3SU8X 1WI0A 2WDRB 1AN8A 3ETRA 3H8JA 2BS4B 4ANXA 4O3RA 4UAZA 5E6PA 4C56C 1JALA 3QU5A 3TFSA 3D6JA 4CF5A 4DLEA 3Q8MA 2FCNA 3NRWA 3PW4A 9ICHA 3KTQA 2W9AA 4Y2TA 5J8YA 5DKWA 1XO1A 5G5GA 4ED7A 4W9FA 1GNUA 5BYSA 1OTRB 2G07A 2WNMA 3X23A 1PK1B 4ED0A 4I2CA 1V8CA 1EXNA 5ALYA 1KFYB 5CHWA 8ICXA 1HXYD 2PJHA 1KM7A 1Z3EB 2D11A 1KEJA 4KSKC 2R61A 3I5JC 3N30A 2AL3A 1SE9A 3DWGC 4O0IA 3V72A 3ISDA 2QB0A 4G3IA 3AE1B 2HHTA 1N5XA 5KFJA 3ZDBA 4KLUA 4DDID 5KFSA 4DQSA 3BY4B 2K6DB 5DPSA 4DFMA 3LDAA 4LZGA 3OHBA 2JH7A 4PZOA 2PFNA 5AEKB 3N4MB 5AICA 4KLHA 2I1QA 2K89A 4YR0A 4M01A 5DG9A 1L7NA 1XS9D 4KN7A 2DAJA 5IA7A 5ALJA 2V4IB 4C8KA 3R8BA 2A1AA 3QARA 4B9TA 3WU2U 4AYBC 4KLGA 1ZQQA 4FBJB 3M9NB 1AQ6A 2WU5B 4RQMA 2H3VA 4ARIA 5KFLA 3QK0A 1NK7A 1K53A 3U2SC 4LNKA 3MC0B 3RRHA 4IR1A 3N9YC 5IILA 3ZVVA 4TSSA 9ICLA 3A9KB 5D2MB 2DZJA 4NJ8A 2P66A 3EECA 3ENEA 1XLPA 5DLGA 4BBNC 5EWEA 5ALXA 3H0MB 3AE3B 2WXKA 4J03A 1YZ6A 4WJNA 2H5XA 1FXTB 1OQYA 2AHOB 5K4LA 3QUTA 1SWWA 4G11A 2QSDA 2BDPA 3IT6B 2PMZC 2MJDA 1U45A 4JV1A 4HJGE 1QILA 2MHJA 3IM1A 3RNGC 4QZFA 4M47A 4AOFA 7ICKA 4M8NA 4FBUA 1E90A 3MHSD 1VLBA 1NJXA 1KLUD 4DL4A 5H8YE 5J0TA 4QWAA 4GIBA 5AM4A 2LVOA 3ZLZA 3ZNHB 2D07B 2ZJDA 2D2QA 4PK1A 2QEJC 5HHDG 1WCLA 2XCPA 2NTTA 4BX9C 1FRRA 1QOFA 4HJKA 2W3SA 1CQVA 5E79U 4N59A 3WAOA 2D3CA 2RDHA 2KDMA 4F4KA 5MPOA 2JY6A 2IOFK 3M8RA 1JW9D 4I27A 3TEWA 1QOGA 2OXOA 5KFWA 4GXJA 1ZQBA 4MGZE 2C9WB 2KWVB 4TUQA 1TKGA 3I1YA 1BPZA 4KLTA 3K1ZA 1WFYA 3MC8A 4GLSC 2BYTA 3ZTCA 4DOCA 3NZSA 3QWZB 3KW5B 4GXBA 4CRXA 1KFDA 5E6OA 2J0MA 4F8CB 1X66A 4GOCA 3DEEA 4YQWA 4UAYA 4B9MA 1C79A 1RXWA 1T0QC 1ZJMA 3V60A 4OVVA 5AM3A 1ZQCA 1YN3A 1RG6A 3S6JA 2KWDA 1QOAA 3DBHB 1F2RC 3KHHA 2HI0A 4M6WB 2HHQA 4ECYA 2DYOA 4FHKA 5BOMA 1VZ8A 4JWSC 2V3NA 2ZIVB 3LXFA 3RFAA 1C20A 3VVWB 1NBFC 5J2KA 4XZ4A 2BKEA 5C3JB 1ZD2P 2VANA 4EX6A 2PMZF 2Y1IA 2BYVE 1L6VA 2Q0ZX 4YMOA 1HQRD 3I63C 1SV0A 4OJPA 1DXSA 2HD5B 1RLFA 3R7RA 1ZW7A 1WX7A 3WK4A 1WMHA 1NNLA 2IBIB 3SAGA 2BPFA 3PMLA 3AL0B 3HVZA 3IN5A 4ZYSA 3TADA 1HIWA 1MN8A 1NK5A 3LVVA 4C8MA 2AWTA 4IWOA 5KFPA 4OZBA 3IV6A 1WSPA 8ICIA 1IPGA 3MFGA 1S77D 1E8YA 1HTQA 1H38A 1V38A 4FFDA 2WXPA 2KZZA 2WXIA 4IC7B 1Z4NA 1ZUD2 4K7UA 4O3PA 4C0ZA 3IVFA 4BXOA 2EH9A 3VUYA 1M6YA 3PX6A 2HVHA 1T0SC 5D49A 3WK6A 3C0RB 1ZQUA 3BQ0A 4PL2A 1URJA 1L3UA 3BDPA 2CR5A 4P4PA 3ZRFA 5CRXA 1HEKA 1F9JA 1DOIA 4GGQA 1J8CA 2H3ZA 5EDSA 1TK8A 5KFRA 1BGXT 3PMNA 2F44A 2LI5A 2XK5A 2C2DA 4EYHB 1DGSA 1ZYQA 4GLXA 4F5OA 1JWUD 5EOZA 3MFHA 3D2SA 1WYGA 1LFDA 2KSOB 3M7DA 4RF0A 1P0RA 1DGJA 1NJWA 3UIOB 3ZIMA 4PJ0U 5J0XA 4GXKA 1A5RA
chains in the Genus database with same CATH topology
1XLOA 1FCCC 2JZPA 1E0ZA 2VZKD 4N6EB 1WXQA 2Z8LA 3KWVA 5FKAC 2WXGA 2TSSA 1UUPA 2BB6A 1JWAD 1F2RI 1SE2A 3Q8EA 1C76A 3AH7A 3SFEB 2PVGC 3DWMA 4DXFA 1WRIA 4RFBA 1KTKA 3V3XA 3U4EG 4IDIA 1JCKB 1WGKA 1VRAB 5T8IA 4HROA 2XNAC 4A55A 2ZW0A 3TEZA 1L0XB 5H92C 1PGBA 2INPE 5D3IB 1F0ZA 1QKZA 1ZXIA 1NYRA 1GAQB 1VZ7A 1FIQA 4YSXB 1YN5A 1NYQA 1FNUA 1E6EB 4B0EA 2PTLA 4YTPB 1GB4A 1ACCA 1PGAA 4WQMA 2MH7A 2ACZB 1J7CA 2NMQA 2WXQA 4A6QA 2CJNA 5BYRA 4EE2A 4RGNA 2FBWB 1MVKA 1FM0D 1XCQL 4NZLB 5EE9A 1OQQA 5BMGA 2RDGA 3FAHA 4OZCA 3U7ZA 3R2IA 1ZE3D 1ESFA 2N9LA 5JXVA 3B9JA 1CJEA 1D4BA 3FC4A 1C4AA 4J3OD 1QLBB 2W55A 1FFUA 5TSSA 1AW7A 3Q8BA 3ABVB 3OWEB 2KQ4X 1UGJA 1SEBD 2QMTA 2CU3A 4ZRQA 1IBXB 1JQ4A 3AEEB 1JWBD 2Y5CA 4KGRA 4WH4A 1XXGA 3T3OA 2AQ3B 4YWGG 4XE0A 2V3PA 3KWLA 1VDVA 2IGHA 2Y3AA 1YQ4B 2WLBA 2IPKD 2JU6X 3VR9B 2OEDA 4TQ1A 1PUTA 4RCOA 3TSSA 2PVOD 2L83A 3P1MA 5GXGB 3NRZA 1SB3C 1FNWA 5D3DA 2J52A 2JXTA 2K0PA 5BYQA 4L2YA 3U52E 1JWMD 1MHXA 1NI3A 4IKGA 2AQ2B 3BWUD 3BYYB 4HRSA 1HEZE 3NUHB 1ZDXA 2FE8A 1R7SA 1TY0A 2DWQA 1XLQA 4MACA 1SJHD 1N5WA 1XF5L 1ZP0B 2LMCA 1TZOA 5AUIA 4PT5A 4L1BA 2LUMA 1E9MA 3P4SB 3VR8B 4XWWA 4US8A 1BUIC 1V1PA 4IOIE 2BS2B 1TS3A 4REZA 3NVYA 2X38A 2IJ0A 4P6VF 2W54A 4O1NA 5AUKA 2SEBD 3R2TA 1TJEA 1K52A 1QF6A 1E10A 3AE9B 2KN4A 2WQYB 4MT5A 3Q8CA 3AM9A 3IAM1 1I4XA 1N61A 5HI1A 4HKQA 1K50A 1B9RA 4YXDB 4HKZE 3PZ8A 4LK0M 4RGMA 5FK9C 3T3NA 1YJJA 1FD6A 2J42A 1D5ZC 3I57A 3HRDD 3AE6B 2J53A 5HG2A 4TMAB 1YMHE 2NTSA 1C77A 3AEBB 1F77A 1XEEA 1YNTE 2JQRB 2DLBA 1EU4A 4NAWB 2WDVB 3KLSX 2ONQA 3UI3A 2L32A 4C80A 1IBXA 3NZ3A 3SFDB 4A8XC 1ZXHA 1PGXA 4MH8A 4XDDA 3ZJVA 1HA5A 4WAFA 2M19A 1SBBB 3BIID 3W5UB 4YTNB 3AV8A 3AE8B 4OVZA 1EWYC 1TYGB 4A9AA 1CK1A 1T3QA 3NVZA 3CWIA 3AEDB 1GPXA 3AE4B 2B76B 2N0SB 2WP9B 3TUOA 5D7GA 3C8YA 3BYTB 2VZKB 2YEPF 1DOYA 1XO3A 3E9SA 2QJLA 1NVID 1V1PB 1ZOYB 3GS2A 1VR9A 1XLNA 2E3TA 4JX1C 3W9CB 4OW0A 2H88B 3WCQA 3CIRB 5EE3A 3HVDA 1KF6B 5EE0A 2IGDA 3IT4B 4P16A 4WURA 4XWTA 2GI9A 2D5GA 2BTEA 2HDEA 1OQRA 2E6XA 3L4PA 1E7PB 3AN1A 3AMZA 3ZGZA 2QILA 2KMMA 2K5PA 3VRAB 1QT9A 3W5VB 2RPVA 1ET6A 4ZRPA 2PMVA 3EA6A 4DQOC 1JMLA 1C78A 2DYMA 2M0AA 3URYA 1ENFA 2KAJA 2SAKA 3ZJUA 1K51A 4TQ0A 2DBYA 1SJED 2AQ1B 1L5PA 2JSVX 2K22A 4OZAA 3AEFB 1SSNA 1N63A 4YSZB 1UWMA 4DXGA 2LHDA 3I9V1 2GB1A 4NJCA 1DYQA 1EWCA 2W82A 3LYYA 1YN4A 1PYWD 1A70A 4WIPA 1I4RA 1PFDA 2LJIA 1HZ5A 2WS3B 3ZJTA 4C7YA 2LGIA 1N60A 1UWXA 2CJOA 2PKOA 5I4DA 3EGRA 3AEAB 2J4XA 2WXJA 2XN9C 3Q8FA 3AE5B 1TS5A 2EKIA 4UDUC 1L6UA 1M4VA 1Y56A 1T6BX 2JX5A 2Q5WD 3NVWA 3IAS1 4ARCA 1P7FA 1UNSA 1D5MC 1KH0A 2WXRA 2WXNA 1C9FA 1EM7A 1SF0A 2WXOA 3W2DA 5BMIA 3TEYA 1JROA 4L23A 1L4DB 1SXTA 3O13A 4ITKA 2N9KA 1IGDA 4H2AA 2H89B 2G9HD 1STEA 3AEGB 1ROEA 1OFFA 4JE3B 3P4PB 3LB8C 3MJ5A 1T5XD 1TY2A 2WDRB 1AN8A 3ETRA 1C4CA 2BS4B 1C4PA 2LFIA 3P42A 4C56C 1JALA 2ZW1A 4RGTA 4LTUA 4A90A 4R3DA 2WU2B 2MJ3A 1ZDVA 3W1SA 3NVVA 2WXLA 5G5GA 1RFKA 5BYSA 4MM3B 2L52A 1I7HA 2WNMA 1V8CA 2LEKA 4JPSA 1JWSD 1KFYB 1HXYD 2BW2A 4AS1A 2K9XA 2R61A 4C7ZA 3DWGC 3BVZA 1FXAA 1WWTA 2V0GA 3AE1B 4D2KA 1N5XA 1CZPA 3MHZA 1SE3A 1RWSA 2ICIA 2L1AA 4YSYB 2IGGA 2WDQB 1GB1A 4LLGM 1YJIA 3NS1A 3BK2A 1ET9A 4B0MA 1I4QA 3AECB 4KKIA 3BZDB 1SE4A 1FO4A 2BB5A 1VJKA 3ZYYX 2JWUA 2V4IB 3R8BA 2G1EA 1BMLC 1I4PA 1QOBA 4M0WA 3SEBA 1RM6C 3TEXA 4GDKB 2KACA 2WU5B 1FFVA 4ARIA 2QIEB 2BT6A 2PLPA 3P4RB 1RYJA 3RPFC 3U2SC 1K53A 3MC0B 1BXTA 1HZ6A 2OHFA 3N9YC 4ZHPA 5BMHA 4TSSA 1IUEA 3GB1A 4ZHOA 3Q8AA 4CQNA 1QQRA 1L4ZB 1XLPA 1N62A 4KGSA 4KGTA 4OHJA 3AB5A 5HFYA 2MEKA 2K3UA 3AE3B 2WXKA 2WXHA 1I4HA 1NEKB 4GDLB 1FCLA 5FR3A 2QSDA 3AE2B 3IT6B 2MJDA 4HJGE 1LO5D 1FMAD 1QILA 1Q10A 1MHHE 4RF1A 2WXFA 2FUG1 1D6EC 2ON8A 5E6JA 5C2TB 1MPEA 3B2FA 3BVGA 1VLBA 1I4GA 1KLUD 2WXMA 5H8YE 1J7AA 3FILA 3ZQ4A 2QEJC 4WWMA 5HHDG 2NTTA 1FNVA 3GP7A 5EE1A 1FRRA 1QOFA 2W3SA 1CQVA 2Y5PA 4N59A 4AQ7A 2RDHA 2KDMA 3VRBB 5MPOA 2RMMA 1FEHA 2INNE 4ZOHC 1JW9D 3TEWA 3RFZB 1QOGA 2YEPB 3AE7B 1TKYA 1KRHA 1JRPA 4HEA1 1DOXA 2N7JA 1TKGA 1L0VB 1L0YB 1EU3A 4GLSC 2BYTA 3E56A 3KQ4A 1FXIA 2JYTA 1SIJA 2BS3B 4YTMB 1B1ZA 4FXCA 1C79A 3SR6A 4Q2JA 2MJEA 1YN3A 2KWDA 4RGOS 1QOAA 1PDXA 1F2RC 3P63A 3V05A 2PIAA 2LHEA 2DYOA 4JWSC 1VZ8A 2V3NA 3LXFA 4USAA 1FRDA 4JWUC 5C3JB 2GRIA 3H8HA 1L6VA 2IDYA 1HQRD 3Q69A 2I38A 1V97A 5G5HA 1V1OA 2AX5A 2I2YA 5LNK1 1D5XC 3FILB 1YQ3B 3B2GA 3HVZA 3MP9A 4ZYSA 4KX6B 4KKJA 1AWDA 3HUIA 4OZBA 4YT0B 1J7BA 1WSPA 4US9A 2PW9A 1MI0A 3MFGA 1P7EA 2WXPA 3IXSA 2WXIA 1KLGD 1XCTL 1ZUD2 4RNAA 2M56B 4N58A 3PO0A 2EELA 2HTME 1DOIA 3BVMA 3J9CA 3EUB2 1NENB 2JYEA 4XDCA 1IGCA 3P4QB 4NAMA 2W3RA 1JWUD 1ZPSA 3BK1A 1GOZA 3VQIA 1WYGA 1VZ6A 4RF0A 1TKEA 1DGJA 3PZ7A 1TS2A 2BBCA 4RH6A 1TS4A 1AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRO A;  1XLO A;  3AE9 B;  1VLB A;  2WQY B;  1E0Z A;  4N6E B;  1WXQ A;  4ITK A;  3AM9 A;  5H8Y E;  1J7A A;  2H89 B;  1N61 A;  3AEG B;  1ROE A;  4YXD B;  1B9R A;  1JWA D;  1OFF A;  1YJJ A;  4WWM A;  3P4P B;  3AH7 A;  3SFE B;  3LB8 C;  2PVG C;  3DWM A;  5EE1 A;  3HRD D;  3AE6 B;  1FRR A;  1WRI A;  1QOF A;  2W3S A;  3AEB B;  4IDI A;  1WGK A;  2WDR B;  4N59 A;  3ETR A;  2BS4 B;  4HRO A;  3VRB B;  5MPO A;  1JAL A;  2JQR B;  5H92 C;  4LTU A;  4ZOH C;  1JW9 D;  1F0Z A;  1QOG A;  2WDV B;  1ZXI A;  2WU2 B;  2MJ3 A;  1NYR A;  1TKY A;  1KRH A;  3AE7 B;  1GAQ B;  1FIQ A;  1JRP A;  4YSX B;  1DOX A;  3NVV A;  1NYQ A;  5G5G A;  4C80 A;  1L0V B;  1RFK A;  1TKG A;  1E6E B;  3SFD B;  2L52 A;  1I7H A;  4YTP B;  4WQM A;  1V8C A;  2LEK A;  2M19 A;  2MH7 A;  2ACZ B;  1J7C A;  1KFY B;  1FXI A;  2CJN A;  3BII D;  3W5U B;  4YTN B;  1SIJ A;  2FBW B;  3AV8 A;  3AE8 B;  1FM0 D;  2BS3 B;  5EE9 A;  4YTM B;  1EWY C;  1TYG B;  4A9A A;  2K9X A;  4FXC A;  3SR6 A;  2MJE A;  1T3Q A;  1OQQ A;  3NVZ A;  4C7Z A;  3FAH A;  3AED B;  1QOA A;  3CWI A;  3DWG C;  1PDX A;  1GPX A;  3AE4 B;  1FXA A;  1WWT A;  2B76 B;  2N0S B;  2WP9 B;  3B9J A;  1CJE A;  3P63 A;  2PIA A;  3AE1 B;  1N5X A;  3FC4 A;  1CZP A;  4JWS C;  1QLB B;  1DOY A;  3LXF A;  4USA A;  2W55 A;  1XO3 A;  1FFU A;  1NVI D;  1RWS A;  1FRD A;  1ZOY B;  2QJL A;  4JWU C;  4YSY B;  5C3J B;  1XLN A;  2E3T A;  3ABV B;  2WDQ B;  4JX1 C;  3W9C B;  2H88 B;  3WCQ A;  3CIR B;  5EE3 A;  1E10 A;  1L6V A;  2CU3 A;  1YJI A;  3NS1 A;  1JQ4 A;  1KF6 B;  3AEE B;  5EE0 A;  1JWB D;  1V97 A;  5G5H A;  2Y5C A;  3AEC B;  2AX5 A;  1FO4 A;  1OQR A;  1VJK A;  3L4P A;  1E7P B;  3AN1 A;  3ZYY X;  3KWL A;  3AMZ A;  1VDV A;  1YQ3 B;  2G1E A;  1YQ4 B;  2K5P A;  2KMM A;  2WLB A;  3B2G A;  3HVZ A;  3VRA B;  3VR9 B;  1QOB A;  1QT9 A;  1PUT A;  4KX6 B;  3W5V B;  1RM6 C;  1AWD A;  3HUI A;  2WU5 B;  2PVO D;  1FFV A;  2L83 A;  3P1M A;  5GXG B;  3NRZ A;  1SB3 C;  2KAJ A;  4YT0 B;  1J7B A;  2QIE B;  2BT6 A;  4US9 A;  3P4R B;  1RYJ A;  3RPF C;  2DBY A;  2K22 A;  1L5P A;  3AEF B;  2OHF A;  4ZHP A;  1N63 A;  1IUE A;  4YSZ B;  1NI3 A;  1UWM A;  1ZUD 2;  4HRS A;  2M56 B;  4ZHO A;  1A70 A;  1XLP A;  1N62 A;  4N58 A;  1PFD A;  2WS3 B;  3AB5 A;  4C7Y A;  1R7S A;  2DWQ A;  3PO0 A;  1XLQ A;  1N60 A;  3AE3 B;  2HTM E;  1N5W A;  1DOI A;  1NEK B;  1ZP0 B;  2CJO A;  5AUI A;  2PKO A;  3EUB 2;  1NEN B;  1QF6 A;  3AEA B;  3VR8 B;  1E9M A;  3AE5 B;  2EKI A;  3P4S B;  3AE2 B;  1L6U A;  2MJD A;  4US8 A;  1FMA D;  2BS2 B;  3P4Q B;  2W3R A;  3NVY A;  2JX5 A;  1WYG A;  2Q5W D;  3NVW A;  4P6V F;  2W54 A;  1TKE A;  5AUK A;  1DGJ A;  5C2T B;  1TJE A;  1AYF A;  1SF0 A;  3B2F A; 
#chains in the Genus database with same CATH topology
 2N1V A;  2JZP A;  4HPL B;  3HIZ A;  3HM3 A;  4MF2 A;  4ECW A;  1KN5 A;  3V6H A;  4FN2 A;  4KDI C;  2KO3 A;  2K8A A;  2AGP A;  4JIO U;  5ALW A;  3Q8E A;  3AH7 A;  2PVG C;  4NQL B;  1TK0 A;  1V80 A;  3VDZ A;  2WDT B;  4CHK A;  3U4E G;  3EFU A;  4NWI A;  2IHM A;  3WA0 A;  2XNA C;  2CRX A;  2KJR A;  4A55 A;  4J9Q A;  7ICN A;  1PGB A;  2MSN A;  1R4M B;  2BQU A;  2AYO B;  1ZXI A;  2BWF A;  3RNA C;  4TUP A;  4DF8 A;  1SL1 A;  1E6E B;  4B0E A;  2QC8 A;  2REX A;  2IMW P;  4WQM A;  5D6J B;  3RR7 A;  4P0Q B;  2ACZ B;  2CJN A;  3SV3 A;  1MVK A;  5EE9 A;  5JHB A;  2LRW A;  2DQN B;  4NY0 A;  1UPH A;  1JUD A;  2HTH A;  4BOS C;  3WK7 A;  3KHG A;  3U7Z A;  4DFD A;  2EMS A;  1ZE3 D;  4NQK E;  5BPC A;  2K4E A;  2VRR B;  4P4O A;  5J8Y C;  2HE7 A;  2ZIU B;  4YCX A;  4UBC A;  5J2I A;  1L7M A;  3G6Y A;  3A0H U;  4XA5 A;  3ABV B;  5J0W A;  2W8K A;  2Z0E B;  1YIW A;  1UGJ A;  1SEB D;  3APC A;  4EEL A;  3PO5 A;  3OPX A;  1TZ1 A;  3VAW A;  5KG2 A;  2PI4 A;  1E7U A;  3RUL A;  4KGR A;  2K4P A;  1XXG A;  3T3O A;  1NZB A;  4DQR A;  3IG3 A;  3O0F A;  1I42 A;  2DL0 A;  3R66 C;  4M9H A;  3KWL A;  1O03 A;  1YT3 A;  2YX8 A;  2N1R A;  4EEW A;  2IPK D;  4FAD A;  3PZP A;  1SZH A;  4F92 B;  3OJS A;  2OED A;  1PUT A;  4P2H A;  3T5K A;  1Q5W B;  1ZJN A;  3TSS A;  2JWZ A;  2L83 A;  1UCV A;  3HJE A;  5KT6 A;  4I2I A;  5CP2 A;  4FZL A;  2MP2 B;  4RQN A;  3AEV A;  4HPP A;  2NRZ A;  5AKZ A;  3Q8Q B;  4XGA B;  4YFK A;  8ICP A;  5BYQ A;  3AU6 A;  1MHX A;  8ICY A;  2AQ2 B;  2WHI A;  3BYY B;  2E5S A;  4ZRK A;  2QKQ A;  4WJ3 B;  3DBL B;  4DHJ B;  4F4X A;  1SWV A;  9ICJ A;  5G2N A;  1N5W A;  2C5L C;  1XF5 L;  1ZP0 B;  2A1J A;  3IRU A;  2WGS A;  3A33 B;  3KHR A;  3ISB A;  1TKD A;  4L1B A;  3UQA A;  1JN3 A;  4PGY A;  1X6I A;  1SZP A;  3DBS A;  2ZJ5 A;  1V1P A;  1UBQ A;  3K9P B;  3V6E B;  4REZ A;  2DX5 B;  1ZQV A;  4HYK A;  3C28 A;  4O1N A;  2ZXH A;  1ZQA A;  4W9L A;  7ICJ A;  1E10 A;  1Q0W B;  2WF8 A;  4W9J A;  4ECS A;  9ICQ A;  2KE7 A;  3Q8C A;  3UXN A;  4UB1 A;  3BS5 B;  3QEA Z;  2KAN A;  3KVF B;  1F1H A;  2NO5 A;  3Q8K A;  1K50 A;  1P98 A;  9ICF A;  4HKZ E;  3PZ8 A;  4K1R B;  2DZI A;  4LK0 M;  2JGA A;  5FK9 C;  3T3N A;  2EAN A;  2XY6 A;  3PY8 A;  8ICG A;  2J42 A;  2JZ3 B;  2WHE A;  1Z00 B;  5KG0 A;  4HXD A;  2BKR B;  1YMH E;  2NTS A;  2G09 A;  1C77 A;  4R8U A;  4GXI A;  5L1L A;  4Q44 A;  3ZXV A;  1YNT E;  2JQR B;  2BCV A;  2AL6 A;  2PEA A;  2E8O A;  5B5E U;  4YXM A;  1N2X A;  2ZTC A;  2JF5 A;  5DG8 A;  3LWM A;  4C80 A;  4ED6 A;  4FJV B;  3ZDD A;  3GFK B;  1ZXH A;  1ZQE A;  1KLV A;  1PGX A;  3ZJV A;  3H0L B;  1ECW A;  4NXZ A;  1WIA A;  2YML A;  5J2R A;  5IIJ A;  3BQ2 A;  1FPY A;  2FPM A;  3AV8 A;  1RQL A;  4MFF A;  2MWS B;  4OVZ A;  1UA1 A;  4S17 A;  3RF9 A;  3RBD A;  2VJ5 A;  2N0S B;  3TUO A;  2JRH A;  3H6N A;  4QWD A;  5D7G A;  3BYT B;  3I76 A;  2IYD B;  1X9M A;  2KNJ A;  1ZD4 A;  4O5K A;  2IO0 B;  4MJS B;  3Q3M C;  1XO3 A;  3E9S A;  1NVI D;  1PZN A;  5KG6 A;  3ZDE A;  2OOB B;  3GS2 A;  3UXO A;  1WY8 A;  4TKN A;  4JX1 C;  3W9C B;  2Y5B B;  3CIR B;  2FLN A;  2L0F A;  5EE3 A;  2ATL A;  2R8H A;  3G6V A;  2JXX A;  1UQV A;  2Y9T A;  3JPS A;  3N1Y C;  2UU7 A;  2IGD A;  3ALB A;  2FUH B;  4P16 A;  4MGY E;  1Z2M A;  3H8M A;  1GJZ A;  4U7C A;  2L0T A;  1WF9 A;  3AU4 A;  3GII A;  4Y2J A;  2K8C B;  4I2G A;  3AMZ A;  2HVI A;  3HKZ C;  5CEH A;  4E74 A;  2MBO A;  2QIL A;  2KMM A;  2PI5 A;  2V4Q A;  4LNN A;  1TE2 A;  1WZ0 A;  4YL8 A;  4ZRP A;  5TIS U;  2PMV A;  3EA6 A;  3URY A;  2KAJ A;  2HOF A;  1Z5S B;  1SV0 C;  2JEG A;  1ZQO A;  5DB9 A;  1WM2 A;  2KTR A;  2K22 A;  3SDL C;  1L5P A;  4I2F A;  4O3Q A;  1PK1 A;  4RNO A;  4M00 A;  3NUQ A;  1DYQ A;  2W82 A;  4DL3 A;  3LYY A;  1PYW D;  3D32 A;  5ALP A;  3TAD C;  1VD2 A;  2M0X A;  4W9D A;  4WWN A;  2VH2 A;  3V7J A;  4AP4 C;  2OCE A;  1YJ1 A;  1KFS A;  2OWO A;  2HSZ A;  1JRU A;  4UAT A;  5I4D A;  2LGS A;  3Q8F A;  1KW4 A;  2D3B A;  1WG8 A;  4KIT B;  5DB6 A;  1BPE A;  4CO7 A;  1U4B A;  2HBM A;  4F7Z A;  3N3K B;  2F1I A;  1P7F A;  1D5M C;  2WXR A;  3H9D A;  4F5P A;  2BKF A;  4NJ7 A;  1XWL A;  3TEY A;  5BMI A;  2N9X A;  5AI9 A;  2DKX A;  4ITK A;  1U49 A;  1IGD A;  3MJW A;  4H2A A;  2G9H D;  4GSW A;  5JH5 C;  5DGB A;  3TAN A;  4RM8 A;  1OFF A;  4JE3 B;  3QUQ A;  1KJT A;  3C21 A;  1ZD3 A;  2J6S A;  4K4I A;  3C2K A;  2G5H B;  5D46 A;  1TY2 A;  2A5U A;  2C7M B;  4BAX A;  5JZE B;  1WXV A;  3HKZ F;  1TGZ B;  4QWB A;  1T0R C;  2LFI A;  2JUO A;  3P42 A;  3ZD9 A;  2ZW1 A;  1TAM A;  4MEX A;  4LTU A;  3RJJ A;  3ML9 A;  4NM2 A;  1D8Y A;  3A9K A;  2G0A A;  1ZDV A;  4OJ6 A;  3NVV A;  5J2E A;  2W7O A;  4O3M A;  7ICG A;  2L52 A;  5HKH A;  4C4T A;  4EEK A;  2WFA A;  4JMU A;  4EKU A;  1X6J A;  2AGO A;  2YMP A;  4AS1 A;  2XI9 A;  2HW3 A;  2XY7 A;  1Y88 A;  1WWU A;  4IQV A;  3MR5 A;  5AK6 A;  8ICH A;  4YMM A;  2KOX A;  2WWZ A;  4QZI A;  1V9J A;  3SAF A;  3RNE C;  3HX0 A;  1CZP A;  4M9G A;  3MHZ A;  2KT7 A;  5J0S A;  3WK5 A;  4AJW A;  1RWS A;  4ECQ A;  2L1A A;  5ALO A;  1L8O A;  2IGG A;  1EF1 A;  1CEZ A;  2WTF A;  3RCZ A;  3C1Y A;  4LLG M;  4ECR A;  3KKA A;  4ED3 A;  3NS1 A;  3BK2 A;  4II2 B;  3DBR B;  2ZJ8 A;  3H7I A;  4KKI A;  3AEC B;  2R18 A;  3BZD B;  5BOL A;  2KVZ A;  1ZKH A;  3PW7 A;  2E8M A;  2CHZ A;  1V9P A;  5KG4 A;  2EQY A;  1NK4 A;  3GIM A;  4TV3 A;  4QZA A;  1RM6 C;  2MUT A;  3V62 A;  3K75 D;  5AIA A;  3T8M A;  3VH3 B;  4M02 A;  3WKC A;  3RPF C;  3T5L A;  2KFJ A;  1QSY A;  4YVZ A;  2IOH A;  5AI4 A;  5KFU A;  4ZHP A;  5ALL A;  1IUE A;  2R2Q A;  8ICB A;  3Q8A A;  2EZX A;  5IP4 D;  2K25 A;  2YTU A;  1XSP A;  4DL7 A;  4OHJ A;  2P35 A;  4GU2 A;  1IM4 A;  4JK1 A;  5J2F A;  2WXH A;  2ZNV B;  5ALN A;  2OYY A;  4JUZ A;  4GDL B;  4M6W A;  3QNM A;  4DQI A;  1Z4O A;  2NBV B;  2W7P A;  2OEH A;  2YMM A;  2YVC A;  5GTH U;  3Q3J A;  2ZIV A;  2NYV A;  2BGF A;  4ANU A;  4F5R A;  1Q10 A;  3MFI A;  1MHH E;  2LYH A;  1S5L U;  3HWT A;  2F1J A;  3KUD B;  2FUG 1;  1D6E C;  1WGR A;  5E6J A;  3U26 A;  3KD3 A;  4MM3 A;  2FAZ A;  1J97 A;  3B2F A;  2KTQ A;  3IG5 A;  3BVG A;  2NO4 A;  2HCF A;  2WXM A;  3PSE B;  3ZQ4 A;  4DBG A;  5KFV A;  1XD3 B;  1I35 A;  3QEB Z;  5H2F U;  4WJQ A;  3APF A;  4M9L A;  4WWM A;  3DOW A;  3GP7 A;  4WWP A;  2LI6 A;  2PE9 A;  2FID A;  4LNO A;  1QSL A;  2Y5P A;  4BGD A;  4M0W B;  4O3S A;  5HR6 A;  2C7H A;  2I1J A;  2KN5 A;  3H40 A;  1E8Z A;  4Y2Q A;  2INN E;  4ZOH C;  2BPC A;  5AI8 A;  3AE7 B;  1EF5 A;  3ZO5 B;  1NKC A;  2FIF A;  2N7J A;  3EPG A;  2ASJ A;  1L0Y B;  1P1A A;  4A20 A;  1EU3 A;  1MJD A;  3PRM B;  9ICO A;  1U9L A;  3E56 A;  1IG6 A;  3SAH A;  2GOW A;  4Z6D A;  4CCH A;  2BS3 B;  4YTM B;  1B1Z A;  4FXC A;  4PYU A;  8ICU A;  4B9S A;  1LQB A;  5D4B A;  1L3T A;  7ICH A;  2KFK B;  4Q2J A;  2YY6 A;  3VUW A;  4AWJ A;  5KFC A;  1PDX A;  4F50 A;  3M6K A;  3P63 A;  4P1C C;  1T0Y A;  2I5H A;  2LHE A;  2VA8 A;  3QC8 B;  4DHJ D;  4USA A;  2KSO A;  4JWU C;  3JPO A;  5J2A A;  1WXS A;  5KHQ A;  2GRI A;  3VFK A;  4EEN A;  2FCS A;  3H8H A;  2KG5 A;  5TZV A;  3RJG A;  2JPH A;  4C4S A;  1V97 A;  5G5H A;  3RJE A;  2AX5 A;  2I2Y A;  2MQJ A;  2E1E A;  1UBI A;  1NK0 A;  3RNF C;  4ECU A;  3FIL B;  3QX7 A;  2ASL A;  3MP9 A;  2R8K A;  4B9V A;  4P1B C;  4C00 A;  2JZZ A;  5EWF A;  7ICO A;  4J9L A;  2L00 B;  4ELT A;  2W8L A;  1AWD A;  3HUI A;  2WAQ F;  4A8E A;  3QE9 Y;  4P4M A;  3L08 A;  2KKC A;  4JWM A;  3ISC A;  2J0K A;  1MI0 A;  3RT3 B;  5KG3 A;  3CST A;  3IXS A;  4KX5 A;  3T5H A;  4P0Q A;  4JGH B;  3ZXR A;  2M56 B;  3UIN B;  5CB1 A;  2KKP A;  5AM0 A;  3W1Y A;  1RQN A;  2PFQ A;  3PO0 A;  3IHQ B;  2EEL A;  3IHP C;  2HTM E;  3D2N A;  2AEH A;  2LM4 A;  3F5E A;  3GQC A;  3BVM A;  3ML8 A;  5DDY A;  3Q3N C;  4QW8 A;  5L9X A;  3J9C A;  3EUB 2;  8ICO A;  1V81 A;  1U4A A;  3A0B U;  4PGX A;  4AUQ C;  4KLJ A;  3M95 A;  2JYE A;  2LUE A;  4XDC A;  2ZIU A;  5ALQ A;  1IGC A;  4W9C A;  4C4V B;  1ZQS A;  4B6J A;  3QUC A;  3P4Q B;  1QZE A;  2W3R A;  4EUT A;  1ZPS A;  2EAO A;  3BK1 A;  5J0R A;  4CYE A;  2H3F A;  5GMV A;  1TS2 A;  4ACF A;  2BBC A;  1ZD5 A;  4ANW A;  4RH6 A;  1SGG A;  1TS4 A;  2MCN B;  2HJ1 A;  3PS6 A;  4ED8 A;  4RQ1 A;  4N6E B;  1SKR A;  4KLD A;  1HUZ A;  1WGD A;  1WXQ A;  3H8S A;  2HBK A;  2Z8L A;  5FKA C;  1TK5 A;  1T4G A;  3JYU A;  4MGK E;  3VTU A;  2DKZ A;  3PW2 A;  3PVL A;  4WJP A;  1WX8 A;  3UM9 A;  5J0U A;  1F2R I;  1SE2 A;  4B95 A;  2DPJ A;  4PPX A;  2KMA A;  4PYZ A;  4Z6E A;  1X2I A;  3M8S A;  3SFE B;  3J81 j;  2AJQ A;  1CMX B;  1WRI A;  4RFB A;  3VUX A;  1JI7 A;  4IDI A;  5AZG A;  4EYI B;  1VRA B;  3GE8 C;  4DFP A;  4B9N A;  2MP2 A;  4HRO A;  2LM1 A;  1L0X B;  5C0Y A;  2INP E;  4Q43 A;  2LGX A;  1F0Z A;  8ICR A;  4HPM B;  4RNM A;  1NYR A;  1D8B A;  1XSN A;  2RSU A;  1GAQ B;  4FHJ A;  1FIQ A;  1NYQ A;  2KZR A;  1ACC A;  3T79 A;  4W9K A;  2NMQ A;  1YQB A;  4EE2 A;  3PST A;  4RGN A;  4M04 A;  2FBW B;  4NZL B;  2YN4 A;  2ISO A;  1LXD A;  4W9G A;  4TUU A;  4O5C A;  1OQQ A;  3TAR A;  3FAH A;  4ACO A;  3LYS A;  2K4I A;  1MSW D;  9ICR A;  3GZN I;  3MTN B;  2WB1 F;  3B9J A;  3NJT A;  4EZ9 A;  2JEI A;  1QLB B;  5J29 A;  5JTI A;  5AK4 A;  4YR2 A;  1FFU A;  2IBK A;  1EUV B;  5DCN A;  5TSS A;  3GU3 A;  2V1Y A;  2ZXI A;  4K81 A;  1MG8 A;  3EW9 A;  1B0X A;  2CU3 A;  2N1W A;  1ZQM A;  5F3X B;  1AAR A;  1JQ4 A;  1HUO A;  3BS5 A;  4DS5 A;  1WXM A;  4WH4 A;  2RDI A;  1OW5 A;  2RGF A;  3G6X A;  3CMM B;  3BZC A;  3ZRC A;  4IW0 A;  4B9K A;  3MAB A;  2DEN B;  4HDO A;  1Q1O A;  3AU5 A;  4UAR A;  1BPB A;  1Z00 A;  3BS7 A;  2BYE A;  3VR9 B;  5A0L A;  5CTR C;  4RQ8 A;  2FLP A;  4M8M A;  2JVC A;  4PL1 A;  3P1M A;  9ICB A;  2N9P C;  5GXG B;  4JB3 A;  3KKA C;  2A4Z A;  5D3D A;  4U6P A;  4RU9 A;  4I2D A;  2WF7 A;  5KT5 A;  1K8R B;  2KN7 A;  2LAS A;  2RDB C;  4HK2 A;  2Y0S F;  1QTM A;  4FS1 A;  4K3C A;  5AM2 A;  5AI5 A;  3H7P B;  4PZN A;  1SL2 A;  1ZQT A;  1HEZ E;  2KVS A;  3VH4 B;  2DWQ A;  4JV2 A;  1L7Y A;  3WK9 A;  3QAQ A;  5J0Y A;  3OGU A;  3TMP B;  1G6J A;  3C19 A;  5DGA A;  1ZQH A;  2GBJ A;  2ZEQ A;  3RB6 A;  3DVN V;  2KHV A;  2UWQ A;  2BZF A;  3VR8 B;  5KTQ A;  1S0N A;  2W43 A;  1ZQR A;  3L16 A;  4MJS A;  4URK A;  4US8 A;  3F53 A;  4F93 B;  1EO6 A;  3NVY A;  1KTQ A;  1MC8 A;  2MRL A;  1NK9 A;  2YLM A;  2KJ8 A;  5AUK A;  3R3M A;  2NR2 A;  2SEB D;  1CUK A;  4A3P A;  4KLL A;  1D9D A;  2F77 X;  1K52 A;  2KC1 A;  1RAX A;  2W04 A;  1NK6 A;  4BKG A;  5GTI U;  3ZDT A;  1ED1 A;  3SQI A;  3E2E A;  1RFA A;  4BKT A;  4G50 A;  2K8C A;  3M1Y A;  2KV2 A;  1S1Q B;  2E8N A;  1N61 A;  2MBB B;  2LGD A;  4CF3 A;  4I29 A;  3GE3 C;  2KJ6 A;  4I6N B;  5AHX A;  1FD6 A;  1S10 A;  1D5Z C;  3N7R C;  3HRD D;  2W9C B;  4C4R A;  2J53 A;  5HG2 A;  4TMA B;  4QZD A;  4B9L A;  1F77 A;  3N1X C;  4WWO A;  4P0P B;  4LJP B;  4NAW B;  3JPT A;  3QQ8 B;  2QHO A;  2BF8 B;  3JSV B;  2L32 A;  1IBX A;  3NZ3 A;  4ZRJ A;  5AM1 A;  3SFD B;  3PPA A;  1BPY A;  3ZTD A;  4FLH A;  2F8K A;  4WAF A;  2M19 A;  3C2L A;  2V4R A;  2UVR A;  1SBB B;  2Z7J A;  3MC9 A;  3W5U B;  2D6F C;  1TYG B;  4A9A A;  1BPX A;  9ICC A;  1T3Q A;  1R4N I;  1B43 A;  2FMP A;  3AED B;  1GPX A;  3R7Q A;  2LBO A;  2DGZ A;  2KD0 A;  3M63 B;  3PV8 A;  4PHD A;  2WP9 B;  2ZUC A;  2DZK A;  3KZI U;  3NHE B;  1A76 A;  2N4F A;  4XX5 A;  3GIK A;  2EDU A;  2G5I B;  1VR9 A;  4Q45 A;  1XLN A;  2H88 B;  5F9L A;  2G08 A;  1GUA B;  2IND C;  1KF6 B;  5EE0 A;  2J6T A;  2OJR A;  3WKE A;  2IA6 A;  4YR3 A;  4PHP A;  4F2S A;  1E8W A;  2D3D A;  5ALV A;  9ICS A;  2E6X A;  3AN1 A;  4DSI A;  3ZGZ A;  1TBE A;  5L1I A;  4ECZ A;  2XEW A;  4DF4 A;  2I1K A;  2K5P A;  3QJZ A;  3IDW A;  2XVT A;  3V7L A;  4DFK A;  1QT9 A;  2LXC A;  4GIV A;  2HOQ A;  3ED5 A;  2FMQ A;  5ALT A;  1ET6 A;  4DQO C;  1KDH A;  1NKE A;  5DQG A;  2XGP A;  1C78 A;  2M0A A;  2C28 A;  1PVQ A;  5L1K A;  4YD1 A;  3N7S C;  1K51 A;  3OLM D;  2ZUD A;  1PVR A;  1SJE D;  1IXR A;  1MFW A;  1ZQL A;  3ETL A;  1WX9 A;  3RUI B;  4YSZ B;  4IQT A;  5KG7 A;  1UWM A;  4DXG A;  1L3S A;  9ICP A;  1IYF A;  1KFT A;  2OJW A;  2XID A;  1EWC A;  1KSP A;  2BCQ A;  4IL6 U;  2QAR B;  1HZ5 A;  1XU4 A;  3ZJT A;  4C7Y A;  5J0P A;  1F52 A;  2LGI A;  5B66 U;  1RPL A;  3DDC B;  7ICQ A;  4EZ6 A;  1V49 A;  2KC2 A;  4K4G A;  5DLF A;  2KDE B;  2J4X A;  2KZM A;  1UF0 A;  4RUC A;  3OSP A;  3A9J B;  4EEY A;  1Y56 A;  3L10 B;  3RJI A;  4ELV A;  2RR9 A;  2Q5W D;  5KFE A;  5KT3 A;  1UNS A;  4ED1 A;  2H3I A;  1C9F A;  4DSE A;  4KZC A;  4DXA B;  1BNP A;  4FS2 A;  3O13 A;  3DVG X;  5FR6 A;  3SEN A;  3WAL A;  2LYA A;  2JR5 A;  1UT8 A;  1TIF A;  2UVU A;  1H4R A;  1ROE A;  3C23 A;  3MJ5 A;  4AJY B;  2KMC A;  1T5X D;  2JHD A;  2K8B B;  2LYB A;  3O65 B;  1P3Q U;  4TUR A;  3RD2 A;  4Y2P A;  1C4C A;  3OSN A;  1WE7 A;  4R65 A;  3QU9 A;  2JRZ A;  2P6R A;  4RGT A;  4DL6 A;  4A90 A;  1NZP A;  2WU2 B;  4J9P A;  2MJ3 A;  2NBW B;  3PSI A;  3F2C A;  3QX1 A;  4IM0 A;  5DBC A;  1JXL A;  2ZTD A;  3QU2 A;  2GLS A;  2Z0D B;  4JLC A;  4Z6F A;  5ALR A;  3ZNG C;  4J9K A;  5DQI A;  4JPS A;  5L95 C;  3HP6 A;  4CF4 A;  9ICI A;  2MBE A;  3M9O B;  2BW2 A;  3A1Q A;  4GDL A;  1NJY A;  4UAV A;  4Y2R A;  5JUM A;  5CWR A;  3LWL A;  4UB2 A;  4C7Z A;  1U48 A;  3BVZ A;  4I2E A;  3NG0 A;  5DDM A;  2ALZ A;  1WGG A;  4IG7 B;  4FZN A;  2C2R A;  3BQ1 A;  3UQ0 A;  4YSY B;  2WDQ B;  2VKQ A;  8ICC A;  1GB1 A;  4PS3 A;  3EC8 A;  4OD0 A;  4DLG A;  4FO6 A;  2XCA A;  4B0M A;  5KL8 B;  2JXJ A;  1SE4 A;  2BB5 A;  1VJK A;  1NJZ A;  2D8C A;  2F8L A;  4AP9 A;  8ICT A;  1OGW A;  3ZYY X;  2O2V A;  4KVG B;  3Q3O C;  4MSQ B;  4JV0 A;  3JPR A;  2KFN A;  1BML C;  5IIO A;  1I4P A;  4M0W A;  2K4H A;  4LJO B;  4QZH A;  3SEB A;  5DQH A;  1Q8K A;  3TEX A;  2FE9 A;  5HHH A;  2KAC A;  2NRX A;  3L0W B;  4GDK B;  1SL0 A;  2PLP A;  4XQ8 A;  1RYJ A;  1QSS A;  3JW0 X;  4O3N A;  3P4R B;  2PKE A;  4DL5 A;  5F9N A;  3NTU A;  3C1Z A;  2OHF A;  2UVW A;  3K1R B;  2DAF A;  2LD9 A;  3ZD8 A;  5KFO A;  2G4S A;  4ZHO A;  4FZM A;  2W9N A;  4QW9 A;  1QQR A;  1L4Z B;  4R66 A;  4NLB A;  3CP8 A;  3VCB A;  3PHW B;  4G3X B;  2MW5 A;  5DB7 A;  4KGT A;  9ICW A;  3MBY A;  2LHT A;  2KFK A;  1RXV A;  4LVS A;  1I4H A;  2BPS A;  1NEK B;  5LXI B;  5FR3 A;  1E8X A;  4S0R A;  1B4F A;  5AI0 A;  2KJ5 A;  2ZPN A;  4MEY A;  3RB3 A;  3RH6 A;  3OJU A;  1SV4 A;  4ICU A;  1MQ2 A;  1S97 A;  1SGH A;  3F2B A;  5HML A;  4RF1 A;  4Y2Y A;  7ICI A;  4Z6C A;  5J2G A;  4RPY A;  2ESE A;  1TTN A;  3GV7 B;  2ON8 A;  4F5N A;  4IRC A;  3UIP B;  5JU5 A;  1MPE A;  3V7K A;  4Y2V A;  4EZJ A;  2KWC A;  1TT5 B;  4E71 A;  2PFP A;  1I4G A;  4BXO B;  3I3T B;  9ICN A;  1MA7 A;  2LXA A;  1J7A A;  3VXW A;  3GIL A;  3FIL A;  2IY1 B;  3ORY A;  3LJ3 A;  1L5U A;  1X42 A;  3T3F A;  5EE1 A;  3PW5 A;  2D3G A;  4AQ7 A;  3PLU A;  4CE6 A;  3EZ5 A;  1D9F A;  3KUZ A;  1X9S A;  3RNB C;  2RMM A;  4KLF A;  2YEP B;  4LNI A;  4DSF A;  2K8H A;  1KRH A;  4JL9 A;  4FJZ A;  1JRP A;  4HEA 1;  2RP5 A;  2ES6 A;  1DOX A;  2BQ3 A;  1L0V B;  1QLN A;  3KQ4 A;  4G0N B;  2LVP A;  3ZI4 A;  2NRV A;  2KTF A;  4PS7 A;  2JYT A;  2VH1 A;  1SIJ A;  2M9N A;  2HHS A;  4DEZ A;  3WAN A;  1S76 D;  2X8X X;  4NV0 A;  4C4V A;  5KFD A;  3V05 A;  4W9H A;  5KG1 A;  4ICA A;  3RH4 A;  5C5J A;  4QZC A;  3L54 A;  1FRD A;  4F8R A;  5CHF A;  4OVU A;  8ICA A;  1A77 A;  3ONN A;  4I28 A;  2LJ5 A;  3JPP A;  4GC6 A;  2L76 A;  3L17 A;  3RAQ A;  3RMK C;  3DDH A;  3ZDM C;  2FMS A;  1XSL A;  2GOL A;  2L3Z A;  1V1O A;  2PE6 B;  4K4H A;  1BVS A;  1O08 A;  2DF4 B;  3WKD A;  5IAA C;  3R9K A;  5L1M A;  1D5X C;  2KX3 A;  5J2C A;  2EKE C;  2ZVO A;  1YQ3 B;  3B2G A;  1JIH A;  4QJF B;  3DBR I;  3TAP A;  4KX6 B;  4IWQ A;  2PFO A;  4KKJ A;  1C7Y A;  9ICE A;  4F4Y A;  1OEY J;  4YT0 B;  1J7B A;  4YN4 A;  5KFQ A;  4YXJ A;  4UW9 A;  1SXE A;  5IO9 A;  8ICN A;  4DK5 A;  1P7E A;  1T94 A;  4F71 A;  1UT5 A;  3SD5 A;  4Q8F A;  1XCT L;  2Y1J A;  5CJ7 A;  4BOZ B;  2ZCB A;  3PRZ A;  3UGB B;  2WF9 A;  1K1S A;  2MBQ A;  1DOQ A;  4ECV A;  1NEN B;  2M1M A;  1VJ5 A;  1Q3V A;  1F0M A;  3RBE A;  2BWE S;  3AU2 A;  2RRD A;  2CKH B;  1UA0 A;  4NAM A;  1YX5 B;  4RQ0 A;  1GOZ A;  3PTF C;  5ALU A;  1TKE A;  2FCQ A;  3B0Y A;  2LVQ A;  3UMB A;  4NLN A;  3PRP B;  1AYF A;  8ICE A;  1XLO A;  4RNN A;  3N32 A;  3H0R B;  4QWC A;  4PHE A;  4KSL C;  3DQV A;  3V6C B;  2KWU B;  5CR0 A;  2M8S A;  1UUP A;  2TSS A;  2R2O A;  3Q6B A;  4ZH4 A;  1V5O A;  4BVU C;  4UBB A;  5G55 A;  1JWA D;  4BWM A;  2I9G A;  2M0N A;  4LNF A;  5KT2 A;  2AGQ A;  1C76 A;  1LKY B;  2ASD A;  1Q46 A;  4QNL A;  1WJ6 A;  2L05 A;  4I2B A;  3LK9 A;  4N9F 4;  1JCK B;  5T8I A;  8ICQ A;  2BQQ A;  2ZW0 A;  3TEZ A;  3QIJ A;  5H92 C;  2KIC A;  3GZF A;  2KJ9 A;  5D3I B;  5LLI A;  2EZY A;  4NLK A;  4O3O A;  2QLT A;  2HJ8 A;  2L5Y A;  3NS8 A;  1TAU A;  1GB4 A;  3L3F X;  4C8N A;  4YTP B;  1PGA A;  4EZK A;  2LWP A;  2ASQ A;  3KYD D;  1E7V A;  2MH7 A;  1J7C A;  3HPO A;  3CF6 E;  4A6Q A;  4F4W A;  1LVH A;  3A4R A;  3SV4 A;  1FM0 D;  1XCQ L;  2D3A A;  3RN9 C;  2NRW A;  2WAQ C;  2IY0 B;  2N9L A;  1ZQD A;  1WWV A;  2C2E A;  1D4B A;  2AU0 A;  5L1J A;  4J3O D;  2WX0 A;  4W9I A;  3CRX A;  4KV2 A;  1N56 A;  4RM9 A;  2AQ0 A;  2LRU A;  1AW7 A;  3H4D A;  3Q8B A;  4KMO B;  3OJ3 A;  3OWE B;  2EAM A;  2ZNV C;  1OUQ A;  2QMT A;  4OJ5 A;  2CPR A;  4NL9 A;  4HCP B;  1JWB D;  2Y5C A;  4QZ9 A;  5KAF U;  3H4B A;  3RYT A;  5HMM A;  1YD8 U;  2YB1 A;  4DQP A;  4YWG G;  2JH1 A;  2FLL A;  3HK0 A;  1VDV A;  2IGH A;  4RPZ A;  2Y3A A;  2WLB A;  2W9C A;  4ZYN A;  2BPG A;  4ECT A;  4TQ1 A;  4PHA A;  4P0P A;  2K39 A;  2INC C;  2PVO D;  1J2N A;  4NAW A;  5AKH A;  3NRZ A;  4BWJ A;  1FNW A;  5KHO A;  1SKW A;  4F2R A;  2NPT B;  3S2A A;  2J52 A;  2NV3 A;  2JXT A;  2BYF A;  2K0P A;  3JSV A;  4L2Y A;  5HP4 A;  4MHV A;  5KNI A;  2MSE D;  4KIK B;  4IKG A;  1Y8R C;  2RHF A;  3BQT A;  3BWU D;  4HRS A;  5ALF A;  1QH9 A;  5AKX A;  2L7R A;  2LZ6 A;  1RRB A;  2DZM A;  3U7D A;  1ZDX A;  3CYM A;  1R7S A;  1TY0 A;  1XLQ A;  3ZDA A;  2B3A A;  3PX4 A;  2OH2 A;  2DNF A;  3SMV A;  2ZIX B;  3N20 C;  3OAW A;  2NBU A;  1E9M A;  3P4S B;  4DO9 A;  3DHG C;  4UB6 U;  2G06 A;  4IOI E;  1BUI C;  2OM6 A;  2BS2 B;  2CXY A;  2LMR A;  2UYZ B;  2KXJ A;  4MDK E;  2X38 A;  4MSM B;  4P6V F;  2AQ4 A;  1ZQP A;  2KTR B;  2ZG6 A;  5ALG A;  3R2T A;  2KJH B;  9ICT A;  5FP0 A;  4FBT A;  3AE9 B;  2IZV B;  2KN4 A;  1BNO A;  4MT5 A;  3PT2 B;  1J0G A;  2W9B B;  3PX0 A;  4DQQ A;  3JPQ A;  3AM9 A;  3N28 A;  1KBU A;  4PH5 A;  1T8E A;  1SIF A;  4QAY A;  1V85 A;  1B9R A;  2WB1 C;  4EBD A;  1ZRM A;  4C8L A;  1YJJ A;  1JX4 A;  1JMS A;  3HT3 A;  2GBK A;  1COO A;  3QYP A;  1IP9 A;  4MF8 A;  4BDP A;  5KFK A;  3RJH A;  1E5W A;  3WK8 A;  3PSP A;  2DLB A;  3ICX A;  4GMV A;  1ZQG A;  9ICK A;  2WDV B;  2JEF A;  3RB0 A;  3DPD A;  3QU7 A;  2RD0 A;  2NS5 A;  3KLS X;  1VCB A;  4W9E A;  4RZR A;  3UXP A;  1OEY A;  4GN1 A;  3KOO A;  1T3N A;  2WF6 A;  4MH8 A;  2ZIW B;  4IC9 A;  2QAR A;  1L8L A;  2C7N B;  3BII D;  2GO7 A;  2JZB B;  3AE8 B;  4F91 B;  1WRD B;  3CWI A;  3GV8 B;  2LKY A;  3MGI A;  3AE4 B;  1PVP A;  1HE8 A;  3A9J A;  4RMA A;  2GH1 A;  1S0O A;  2VZK B;  1DOY A;  5ALS A;  1SKS A;  2Y0S C;  2E3T A;  3WKB A;  3IBE A;  3AUL A;  5KT7 A;  3NY5 A;  4NNJ B;  2W03 A;  4OW0 A;  3WCQ A;  4JWN A;  2KLC A;  3HVD A;  4F4Z A;  1LM8 B;  2N9E B;  4MEM A;  3EYZ A;  3WKA A;  3D2Q A;  1KL9 A;  4CGZ A;  3IT4 B;  2JMG A;  4KLM A;  1KQQ A;  4I6P A;  2K1F A;  4WUR A;  2BTE A;  2GI9 A;  2H3Q A;  2D5G A;  3CSF A;  3U30 A;  1RYS A;  3L4P A;  1E7P B;  5KFI A;  2R8I A;  4NPN A;  4WAA A;  3KZX A;  3RTV A;  3NAS A;  1ZQZ A;  3M9M B;  2K8B A;  3SZ2 A;  5AKY A;  5KFN A;  1DK3 A;  4BZA A;  2RPV A;  5ALZ A;  3PHX B;  4A3O A;  2DBY A;  3PVX A;  1GC7 A;  4OZA A;  3QA8 A;  3AEF B;  3DBH I;  1N63 A;  5IIM A;  4DFJ A;  2LHD A;  3BQ7 A;  1ZQW A;  4EBE A;  4IRK A;  3I9V 1;  3F2D A;  1ZQJ A;  4WIP A;  3M62 B;  4UQG A;  4KLQ A;  1A70 A;  1HJP A;  3FM9 A;  2MAX A;  1I4R A;  2LJI A;  3X0W A;  4F72 A;  3VC8 A;  2BQR A;  4ANV A;  1UWX A;  7ICM A;  2CJO A;  3A4S C;  4MEL A;  2V4L A;  1V2Y A;  3AEA B;  3MC1 A;  4DWI A;  3AE5 B;  2EKI A;  3AI5 A;  4UDU C;  4TQR A;  4QZG A;  1M4V A;  4TUS A;  2MUT B;  1Z1V A;  4AYB F;  4J9S A;  3ZW3 A;  1T6B X;  3NVW A;  3IAS 1;  1QQ5 A;  2KKV A;  1ZQF A;  1BPD A;  2WXN A;  5KFX A;  2K60 A;  3RJF A;  4RT3 A;  4J9M A;  3GZN B;  5IKC M;  2R8G A;  5IN7 A;  1L4D B;  3FDS A;  5AM5 A;  4CNQ A;  4KN4 A;  3THV A;  1V5T A;  1D8L A;  2H89 B;  1STE A;  4RT2 A;  3AEG B;  3TI0 A;  2KIW A;  3RRG A;  3ONS A;  1WE6 A;  1XC9 A;  3P4P B;  1T7P A;  9ICV A;  4BBN F;  3AQE A;  4GDK A;  4ED2 A;  2O6V B;  3H8W A;  4HDQ A;  2ODG A;  1C4P A;  4BKS D;  2M17 A;  4ZRI A;  3QUB A;  5KG5 A;  2XC9 A;  3UPQ A;  4R3D A;  1WCN A;  5AK5 A;  3RI7 C;  3T5J A;  5J2D A;  3MR6 A;  3W1S A;  3Q14 C;  2WXL A;  1RFK A;  3IP4 B;  4MM3 B;  1IIP A;  1I7H A;  4R64 A;  2LEK A;  1JWS D;  1WR1 A;  5D94 A;  3K4G A;  1YX6 B;  4XC2 A;  2ZUB A;  3MR3 A;  3LDZ E;  4IRD A;  2KDI A;  2LGY A;  2XY5 A;  2K9X A;  1UEL A;  3GDX A;  1GO3 F;  2F76 X;  4DS4 A;  1NK8 A;  2KLG A;  4B9U A;  1ZQN A;  1FXA A;  1WWT A;  4KLE A;  2V0G A;  5J0O A;  3M3J A;  3RAX A;  1S0V A;  4D2K A;  3PO4 A;  2GLE A;  2GBM A;  4FUL A;  1L6N A;  1X9W A;  4LDT B;  4M9J A;  1SE3 A;  2ICI A;  1ZET A;  4IQU A;  1K5O A;  4UB4 A;  3T9L A;  1ZQ1 C;  3TAC B;  1V86 A;  1YJI A;  1ET9 A;  1P7D A;  3ZNZ B;  1I4Q A;  3PRE A;  2ISP A;  1TFR A;  7ICS A;  1FO4 A;  4RQ6 A;  1PUZ A;  7ICL A;  1R4M I;  2CHW A;  5KFF A;  4MFA A;  2JWU A;  5J17 A;  1ZRN A;  2HBL A;  3ECI A;  2G1E A;  4DSK A;  1WGH A;  1KLN A;  1QOB A;  2KK8 A;  2DYB A;  2KNB A;  3B1L X;  3L13 A;  3TCA A;  2RDJ A;  1FFV A;  3L5K A;  2BGW A;  5ALM A;  1COK A;  4KLO A;  3Q3F A;  3VTW A;  3P2B A;  2QIE B;  2BT6 A;  4IS7 A;  4NL9 C;  4EX7 A;  2HOI A;  3Q2A C;  1BXT A;  4YMN A;  1HZ6 A;  3BIN A;  5BMH A;  3GB1 A;  2AXT U;  4EOY A;  3RR8 A;  1LV5 A;  3B0A A;  4I2J A;  4CQN A;  3WAM A;  1N62 A;  4KGS A;  2DHZ A;  5HNK A;  2VA3 A;  4UAS A;  2JV3 A;  1QCK A;  3AB5 A;  4UB3 A;  5HFY A;  2MEK A;  1WYW B;  2K3U A;  1BT0 A;  1CI4 A;  4RPX A;  3Q8S B;  2V9H A;  2KHW B;  2MBH A;  3H1U A;  2QB1 A;  1FCL A;  1UH6 A;  2F1H A;  5KFG A;  1XQQ A;  3EFC A;  1RYU A;  2J6U A;  3HM6 X;  3AE2 B;  2NRT A;  2QB0 B;  1QQ6 A;  3EWA A;  1FMA D;  1LO5 D;  2B6G A;  4HVB A;  2EMT A;  3B08 A;  2DUY A;  2Q4T A;  1NI2 A;  2WXF A;  1R4N B;  2RPQ A;  5C2T B;  2MA9 B;  1ISN A;  8ICK A;  1KKX A;  1WJN A;  1U47 A;  1Z1B A;  2BVC A;  7ICR A;  4BKS A;  3JVZ X;  5J18 A;  4B6W A;  1Q3U A;  3U8Z A;  2KX0 A;  2IO2 B;  2G4D B;  7ICP A;  2AH5 A;  1FNV A;  8ICF A;  1N6Z A;  1A6S A;  2ZCC A;  5KFB A;  5AIB A;  3PNC A;  5EWG A;  4NLG A;  1UHU A;  2NVU I;  5TR5 A;  1TVA A;  3C5F A;  2KK0 A;  2LPE A;  3VRB B;  1WUD A;  5KL1 B;  1FEH A;  2E8P A;  4Y2U A;  1J2M A;  3DBL I;  2IO1 B;  3RFZ B;  3M6Z A;  5KFZ A;  2KIV A;  1TKY A;  3TQ1 A;  5AK3 A;  2IOF A;  4HAI A;  3UQB A;  1QQ7 A;  3AQF A;  4F3O A;  2HHX A;  5ALD A;  2ZTE A;  1FXI A;  1GC6 A;  2PPH A;  2DFL A;  4X5V A;  1NOM A;  1X40 A;  1IV8 A;  3SR6 A;  5C1Z A;  2MJE A;  4GB9 A;  4OJO A;  1MG4 A;  4RGO S;  3SD7 A;  4KZ0 A;  1A0P A;  4KLI A;  5HHI A;  2FNJ B;  1ZQX A;  2BCS A;  2PIA A;  3V6J A;  7ICU A;  4DL2 A;  2HHV A;  2KVR A;  4Q8E A;  7ICE A;  2O6K A;  3GIJ A;  5CHV C;  2KDB A;  3Q8L A;  8ICV A;  5KFT A;  1ZQY A;  1ARO P;  1UGM A;  4WJO A;  1RDF A;  2IDY A;  4GFJ A;  1H8C A;  5KFA A;  5CA7 A;  3N1Z C;  2I38 A;  3Q69 A;  2GMI C;  4DDG D;  1B22 A;  5ALI A;  1X9X A;  3PR5 B;  4M2Y A;  5LNK 1;  2WYQ A;  3I28 A;  1LKY A;  4KLS A;  4FE3 A;  3PGE A;  4DWF A;  2M4N A;  3UMG A;  2PXI A;  4I6L B;  4J9R A;  1RYR A;  4C8O A;  5ALE A;  2JT4 B;  3HHM A;  1ZGU B;  2KQS A;  1XNS A;  4O5E A;  2KQ7 A;  4KDL B;  4US9 A;  2PW9 A;  4WQO B;  2A3V A;  2NCN A;  8ICW A;  4RUA A;  3MR2 A;  2KZ3 A;  1KLG D;  4IUM B;  5DPR A;  2ZPY A;  4LJX A;  4J9N A;  4LZD A;  3UQ2 A;  4DOB A;  5DPT A;  2ZJA A;  4RNA A;  1YZ7 A;  3SEI A;  2BHN A;  4N58 A;  3MDC A;  3ZUN A;  4BUG A;  5IOI A;  3EPI A;  4RQ2 A;  4XUS A;  2WX1 A;  4MGI E;  4I2H A;  5AKI A;  2BR0 A;  4ASW C;  4DSL A;  5AI6 A;  5IIK A;  3KBB A;  5AKG A;  2HMX A;  4PS8 A;  2G45 B;  2E1F A;  3VQI A;  1VZ6 A;  4QIW C;  1ZQK A;  3IG8 A;  3TAQ A;  2YQE A;  3C5G A;  3AUO A;  1ZOL A;  3NZU A;  3PZ7 A;  4IWP A;  1S3S G;  4MH0 E;  3JPN A;  1FCC C;  1E0Z A;  3RZF A;  2VZK D;  2MX2 A;  3TIX A;  3KWV A;  2WXG A;  1LGR A;  4UB5 A;  2BB6 A;  2BCU A;  2XBB C;  3ZNI D;  1S0M A;  8ICZ A;  3F5A A;  4NY8 A;  8ICS A;  1WMH B;  2JRI B;  1L2N A;  2RLT A;  4OCZ A;  9ICA A;  3DWM A;  1X1M A;  4DXF A;  5CHG A;  2C22 A;  3Q8R B;  1KTK A;  3EHV A;  3BJY A;  3V3X A;  2KP7 A;  4UB8 U;  3C29 A;  3TFR A;  1WGK A;  5LXH A;  4QZB A;  2MA1 A;  4DOA A;  2NPT A;  4NM1 A;  4GC7 A;  2V3S A;  3CNH A;  1QKZ A;  4LCD E;  3QHT A;  7ICV A;  4KIK A;  1VZ7 A;  4XYC A;  3E58 A;  2C60 A;  4YSX B;  1TAQ A;  1YN5 A;  2HHU A;  1FNU A;  2PTL A;  3E0F A;  2F2A B;  1C3T A;  3CW2 C;  2WXQ A;  3APD A;  2N7D A;  5BYR A;  3GOE A;  5KFH A;  1WM3 A;  4RQ7 A;  2IO3 B;  3V61 A;  2GBN A;  2G3Q B;  4NJ6 A;  2ZIX A;  2R8J A;  4II3 B;  4ZDV A;  2KOB A;  5BMG A;  2RDG A;  4OZC A;  2B0C A;  4QWE A;  4TQS A;  3R2I A;  4UAU A;  1ESF A;  5JXV A;  1CJE A;  1M94 A;  2HBJ A;  3FC4 A;  1C4A A;  2XK5 B;  3W1S C;  5DB8 A;  3OHA A;  2W55 A;  2W11 A;  4IM3 A;  1WH3 A;  1ZQI A;  1WJ4 A;  2KQ4 X;  3RZW C;  4DHZ B;  9ICG A;  4ZRQ A;  1IBX B;  3QU4 A;  2W9B A;  3AEE B;  1HTO A;  4QIW F;  3KUC B;  5ALK A;  4FA6 A;  1YOV B;  5AZF A;  4JQW C;  1PQS A;  2AQ3 B;  2IHN A;  4XE0 A;  2RQ5 A;  1S8O A;  2QCZ A;  2V3P A;  1YQ4 B;  5J2B A;  2JU6 X;  4F5Q A;  4RQ3 A;  1L3V A;  3PW0 A;  4RCO A;  2F3N A;  2FPL A;  3WIM A;  8ICL A;  3TL5 A;  5DBB A;  1SB3 C;  2KVC A;  1KOT A;  1C1Y B;  3DHH C;  3PSF A;  5BO4 B;  4QZ8 A;  3VTV A;  4O9M A;  1JXE A;  5AKK A;  7ICT A;  3Q8P B;  2K6Q A;  3U52 E;  2O6V D;  1JWM D;  3PV1 A;  1NI3 A;  2ZIW A;  2VIX A;  2DPI A;  4PGQ A;  4DCC A;  2JZB A;  2HHW A;  3NUH B;  2FE8 A;  4YP3 A;  1XT9 B;  4MAC A;  3OTQ A;  4Y2X A;  2L8J A;  4EBC A;  1SJH D;  3RH5 A;  4X57 B;  5KFY A;  3DCG A;  2LMC A;  1TZO A;  5AUI A;  2P6U A;  2BCR A;  4F1S A;  4PT5 A;  1PK3 A;  3ALR A;  2LUM A;  4BJQ A;  5IIN A;  5E6N A;  2Z59 B;  4XWW A;  3KH0 A;  1LB2 B;  1UZX B;  4IQW A;  5JHA A;  1TS3 A;  2BDU A;  4XRH A;  9ICM A;  4HLE A;  2IJ0 A;  5KFM A;  2W54 A;  3FYH A;  4DSJ A;  3DVG Y;  4Y2S A;  3GV5 B;  1F44 A;  2GWS A;  1TJE A;  1QF6 A;  4R63 A;  2FI1 A;  1OXJ A;  2WQY B;  2KD1 A;  4LDT D;  3LVW A;  5J2H A;  1WXA A;  3IAM 1;  3SHQ A;  1I4X A;  2KYW A;  5HI1 A;  4HKQ A;  4YG2 A;  8ICJ A;  4YXD B;  4RGM A;  5J2J A;  1TV9 A;  3I57 A;  3H7S A;  4K7W A;  3AE6 B;  2HDO A;  3AEB B;  3NGD A;  1XEE A;  5ALH A;  1SXD A;  2EZZ A;  2MU2 A;  1J19 A;  4MFC A;  1EU4 A;  5T14 A;  3KFU F;  3RJK A;  4K3B A;  2KMD A;  2CN1 A;  4M0A A;  2YB4 A;  2JEJ A;  9ICX A;  2ONQ A;  3UI3 A;  3C2M A;  1WGY A;  4A8X C;  3OJ4 B;  3MDA A;  3DHI C;  2XO7 A;  3DV9 A;  4I2A A;  4J9O A;  9ICU A;  1GG3 A;  1WJU A;  2ZZP B;  1HA5 A;  2YMQ A;  3TKA A;  4XDD A;  3ZKJ C;  4YTN B;  3TBL D;  1L7O A;  1L7P A;  1CRX A;  1EWY C;  3MGH A;  1CK1 A;  1WR6 E;  3WAP A;  3NVZ A;  4OJL A;  3N97 B;  3UF8 A;  5AKL A;  2CHX A;  4KMU A;  2A1J B;  2EAP A;  3QZ8 A;  1S9F A;  2B76 B;  3RB4 A;  4KX3 A;  1KRP A;  3C8Y A;  2KFZ A;  2WF5 A;  4RQ5 A;  3VHT C;  4YD2 A;  2YEP F;  3NOB A;  2QJL A;  1V1P B;  2V9W A;  1ZOY B;  2W9M A;  5KT4 A;  4M9N A;  3SI8 A;  3V6K A;  3B0X A;  5III A;  3KHL A;  4HCN B;  4OO1 J;  4EFO A;  3FKY A;  5J0Q A;  3H7P A;  1DK2 A;  3PZD A;  2KEY A;  4XWT A;  2HDE A;  1OQR A;  4FJY A;  3SYZ A;  3A1Q B;  5KAI U;  2VA2 A;  2CS4 A;  3VRA B;  2KDF B;  2O6V A;  4RQ4 A;  3UMC A;  2FDR A;  3W5V B;  3QCA A;  5DBA A;  4HWI B;  5AKE A;  1RZT A;  1DRG A;  5HR7 A;  1JML A;  2DYM A;  2VJ4 A;  4R8U B;  1ENF A;  4E3C A;  3PR4 A;  2GBR A;  2KHQ A;  2J7Q B;  3IFW B;  3RNC C;  2SAK A;  3KYC D;  3ZJU A;  4TQ0 A;  1F5S A;  2AQ1 B;  2JSV X;  3QZ7 A;  4KTQ A;  4UAW A;  1SSN A;  1XO0 A;  4K7S A;  4E0D A;  1NKB A;  4J6I A;  4BFR A;  2GB1 A;  4NJC A;  2FJ6 A;  3HW8 A;  1YN4 A;  4P7I A;  1MQ3 A;  3K9O B;  1PFD A;  3AXC A;  2WS3 B;  2CU1 A;  4QZE A;  4NLC A;  3PLV A;  4DHZ E;  1N60 A;  8ICM A;  1Z19 A;  2O2V B;  2A19 A;  2PKO A;  4ELU A;  3EGR A;  1P9D U;  5L83 A;  2UVV A;  2B21 A;  2J0J A;  2WXJ A;  2XN9 C;  1TS5 A;  2N7E A;  1D3Z A;  1FEZ A;  1L6U A;  4ECX A;  4CDG A;  3N7P D;  3DVN U;  2JX5 A;  4EZL A;  3ZDC A;  2FCM A;  5DPW A;  4ARC A;  3TJP A;  4IM2 A;  3OG5 A;  5AZH A;  3MGV A;  1KH0 A;  2XIC A;  4G9B A;  5JRT A;  1V6E A;  3QXG A;  1EM7 A;  3HIL A;  2D10 A;  1SF0 A;  2WXO A;  4NLZ A;  3W2D A;  4IR9 A;  1JRO A;  5CX3 A;  4L23 A;  2QDF A;  1SXT A;  4ICV A;  5C23 A;  7ICF A;  2N9K A;  2FPK A;  5DG7 A;  2I6X A;  1UD7 A;  3BZK A;  2XGQ A;  2MLB A;  3LB8 C;  2MRP A;  5AKJ A;  2Y9U A;  2ZVN A;  1K1Q A;  1WZ3 A;  1N48 A;  1NDD A;  3SU8 X;  1WI0 A;  2WDR B;  1AN8 A;  3ETR A;  3H8J A;  2BS4 B;  4ANX A;  4O3R A;  4UAZ A;  5E6P A;  4C56 C;  1JAL A;  3QU5 A;  3TFS A;  3D6J A;  4CF5 A;  4DLE A;  3Q8M A;  2FCN A;  3NRW A;  3PW4 A;  9ICH A;  3KTQ A;  2W9A A;  4Y2T A;  5J8Y A;  5DKW A;  1XO1 A;  5G5G A;  4ED7 A;  4W9F A;  1GNU A;  5BYS A;  1OTR B;  2G07 A;  2WNM A;  3X23 A;  1PK1 B;  4ED0 A;  4I2C A;  1V8C A;  1EXN A;  5ALY A;  1KFY B;  5CHW A;  8ICX A;  1HXY D;  2PJH A;  1KM7 A;  1Z3E B;  2D11 A;  1KEJ A;  4KSK C;  2R61 A;  3I5J C;  3N30 A;  2AL3 A;  1SE9 A;  3DWG C;  4O0I A;  3V72 A;  3ISD A;  2QB0 A;  4G3I A;  3AE1 B;  2HHT A;  1N5X A;  5KFJ A;  3ZDB A;  4KLU A;  4DDI D;  5KFS A;  4DQS A;  3BY4 B;  2K6D B;  5DPS A;  4DFM A;  3LDA A;  4LZG A;  3OHB A;  2JH7 A;  4PZO A;  2PFN A;  5AEK B;  3N4M B;  5AIC A;  4KLH A;  2I1Q A;  2K89 A;  4YR0 A;  4M01 A;  5DG9 A;  1L7N A;  1XS9 D;  4KN7 A;  2DAJ A;  5IA7 A;  5ALJ A;  2V4I B;  4C8K A;  3R8B A;  2A1A A;  3QAR A;  4B9T A;  3WU2 U;  4AYB C;  4KLG A;  1ZQQ A;  4FBJ B;  3M9N B;  1AQ6 A;  2WU5 B;  4RQM A;  2H3V A;  4ARI A;  5KFL A;  3QK0 A;  1NK7 A;  1K53 A;  3U2S C;  4LNK A;  3MC0 B;  3RRH A;  4IR1 A;  3N9Y C;  5IIL A;  3ZVV A;  4TSS A;  9ICL A;  3A9K B;  5D2M B;  2DZJ A;  4NJ8 A;  2P66 A;  3EEC A;  3ENE A;  1XLP A;  5DLG A;  4BBN C;  5EWE A;  5ALX A;  3H0M B;  3AE3 B;  2WXK A;  4J03 A;  1YZ6 A;  4WJN A;  2H5X A;  1FXT B;  1OQY A;  2AHO B;  5K4L A;  3QUT A;  1SWW A;  4G11 A;  2QSD A;  2BDP A;  3IT6 B;  2PMZ C;  2MJD A;  1U45 A;  4JV1 A;  4HJG E;  1QIL A;  2MHJ A;  3IM1 A;  3RNG C;  4QZF A;  4M47 A;  4AOF A;  7ICK A;  4M8N A;  4FBU A;  1E90 A;  3MHS D;  1VLB A;  1NJX A;  1KLU D;  4DL4 A;  5H8Y E;  5J0T A;  4QWA A;  4GIB A;  5AM4 A;  2LVO A;  3ZLZ A;  3ZNH B;  2D07 B;  2ZJD A;  2D2Q A;  4PK1 A;  2QEJ C;  5HHD G;  1WCL A;  2XCP A;  2NTT A;  4BX9 C;  1FRR A;  1QOF A;  4HJK A;  2W3S A;  1CQV A;  5E79 U;  4N59 A;  3WAO A;  2D3C A;  2RDH A;  2KDM A;  4F4K A;  5MPO A;  2JY6 A;  2IOF K;  3M8R A;  1JW9 D;  4I27 A;  3TEW A;  1QOG A;  2OXO A;  5KFW A;  4GXJ A;  1ZQB A;  4MGZ E;  2C9W B;  2KWV B;  4TUQ A;  1TKG A;  3I1Y A;  1BPZ A;  4KLT A;  3K1Z A;  1WFY A;  3MC8 A;  4GLS C;  2BYT A;  3ZTC A;  4DOC A;  3NZS A;  3QWZ B;  3KW5 B;  4GXB A;  4CRX A;  1KFD A;  5E6O A;  2J0M A;  4F8C B;  1X66 A;  4GOC A;  3DEE A;  4YQW A;  4UAY A;  4B9M A;  1C79 A;  1RXW A;  1T0Q C;  1ZJM A;  3V60 A;  4OVV A;  5AM3 A;  1ZQC A;  1YN3 A;  1RG6 A;  3S6J A;  2KWD A;  1QOA A;  3DBH B;  1F2R C;  3KHH A;  2HI0 A;  4M6W B;  2HHQ A;  4ECY A;  2DYO A;  4FHK A;  5BOM A;  1VZ8 A;  4JWS C;  2V3N A;  2ZIV B;  3LXF A;  3RFA A;  1C20 A;  3VVW B;  1NBF C;  5J2K A;  4XZ4 A;  2BKE A;  5C3J B;  1ZD2 P;  2VAN A;  4EX6 A;  2PMZ F;  2Y1I A;  2BYV E;  1L6V A;  2Q0Z X;  4YMO A;  1HQR D;  3I63 C;  1SV0 A;  4OJP A;  1DXS A;  2HD5 B;  1RLF A;  3R7R A;  1ZW7 A;  1WX7 A;  3WK4 A;  1WMH A;  1NNL A;  2IBI B;  3SAG A;  2BPF A;  3PML A;  3AL0 B;  3HVZ A;  3IN5 A;  4ZYS A;  3TAD A;  1HIW A;  1MN8 A;  1NK5 A;  3LVV A;  4C8M A;  2AWT A;  4IWO A;  5KFP A;  4OZB A;  3IV6 A;  1WSP A;  8ICI A;  1IPG A;  3MFG A;  1S77 D;  1E8Y A;  1HTQ A;  1H38 A;  1V38 A;  4FFD A;  2WXP A;  2KZZ A;  2WXI A;  4IC7 B;  1Z4N A;  1ZUD 2;  4K7U A;  4O3P A;  4C0Z A;  3IVF A;  4BXO A;  2EH9 A;  3VUY A;  1M6Y A;  3PX6 A;  2HVH A;  1T0S C;  5D49 A;  3WK6 A;  3C0R B;  1ZQU A;  3BQ0 A;  4PL2 A;  1URJ A;  1L3U A;  3BDP A;  2CR5 A;  4P4P A;  3ZRF A;  5CRX A;  1HEK A;  1F9J A;  1DOI A;  4GGQ A;  1J8C A;  2H3Z A;  5EDS A;  1TK8 A;  5KFR A;  1BGX T;  3PMN A;  2F44 A;  2LI5 A;  2XK5 A;  2C2D A;  4EYH B;  1DGS A;  1ZYQ A;  4GLX A;  4F5O A;  1JWU D;  5EOZ A;  3MFH A;  3D2S A;  1WYG A;  1LFD A;  2KSO B;  3M7D A;  4RF0 A;  1P0R A;  1DGJ A;  1NJW A;  3UIO B;  3ZIM A;  4PJ0 U;  5J0X A;  4GXK A;  1A5R A; 
#chains in the Genus database with same CATH homology
 1XLO A;  1FCC C;  2JZP A;  1E0Z A;  2VZK D;  4N6E B;  1WXQ A;  2Z8L A;  3KWV A;  5FKA C;  2WXG A;  2TSS A;  1UUP A;  2BB6 A;  1JWA D;  1F2R I;  1SE2 A;  3Q8E A;  1C76 A;  3AH7 A;  3SFE B;  2PVG C;  3DWM A;  4DXF A;  1WRI A;  4RFB A;  1KTK A;  3V3X A;  3U4E G;  4IDI A;  1JCK B;  1WGK A;  1VRA B;  5T8I A;  4HRO A;  2XNA C;  4A55 A;  2ZW0 A;  3TEZ A;  1L0X B;  5H92 C;  1PGB A;  2INP E;  5D3I B;  1F0Z A;  1QKZ A;  1ZXI A;  1NYR A;  1GAQ B;  1VZ7 A;  1FIQ A;  4YSX B;  1YN5 A;  1NYQ A;  1FNU A;  1E6E B;  4B0E A;  2PTL A;  4YTP B;  1GB4 A;  1ACC A;  1PGA A;  4WQM A;  2MH7 A;  2ACZ B;  1J7C A;  2NMQ A;  2WXQ A;  4A6Q A;  2CJN A;  5BYR A;  4EE2 A;  4RGN A;  2FBW B;  1MVK A;  1FM0 D;  1XCQ L;  4NZL B;  5EE9 A;  1OQQ A;  5BMG A;  2RDG A;  3FAH A;  4OZC A;  3U7Z A;  3R2I A;  1ZE3 D;  1ESF A;  2N9L A;  5JXV A;  3B9J A;  1CJE A;  1D4B A;  3FC4 A;  1C4A A;  4J3O D;  1QLB B;  2W55 A;  1FFU A;  5TSS A;  1AW7 A;  3Q8B A;  3ABV B;  3OWE B;  2KQ4 X;  1UGJ A;  1SEB D;  2QMT A;  2CU3 A;  4ZRQ A;  1IBX B;  1JQ4 A;  3AEE B;  1JWB D;  2Y5C A;  4KGR A;  4WH4 A;  1XXG A;  3T3O A;  2AQ3 B;  4YWG G;  4XE0 A;  2V3P A;  3KWL A;  1VDV A;  2IGH A;  2Y3A A;  1YQ4 B;  2WLB A;  2IPK D;  2JU6 X;  3VR9 B;  2OED A;  4TQ1 A;  1PUT A;  4RCO A;  3TSS A;  2PVO D;  2L83 A;  3P1M A;  5GXG B;  3NRZ A;  1SB3 C;  1FNW A;  5D3D A;  2J52 A;  2JXT A;  2K0P A;  5BYQ A;  4L2Y A;  3U52 E;  1JWM D;  1MHX A;  1NI3 A;  4IKG A;  2AQ2 B;  3BWU D;  3BYY B;  4HRS A;  1HEZ E;  3NUH B;  1ZDX A;  2FE8 A;  1R7S A;  1TY0 A;  2DWQ A;  1XLQ A;  4MAC A;  1SJH D;  1N5W A;  1XF5 L;  1ZP0 B;  2LMC A;  1TZO A;  5AUI A;  4PT5 A;  4L1B A;  2LUM A;  1E9M A;  3P4S B;  3VR8 B;  4XWW A;  4US8 A;  1BUI C;  1V1P A;  4IOI E;  2BS2 B;  1TS3 A;  4REZ A;  3NVY A;  2X38 A;  2IJ0 A;  4P6V F;  2W54 A;  4O1N A;  5AUK A;  2SEB D;  3R2T A;  1TJE A;  1K52 A;  1QF6 A;  1E10 A;  3AE9 B;  2KN4 A;  2WQY B;  4MT5 A;  3Q8C A;  3AM9 A;  3IAM 1;  1I4X A;  1N61 A;  5HI1 A;  4HKQ A;  1K50 A;  1B9R A;  4YXD B;  4HKZ E;  3PZ8 A;  4LK0 M;  4RGM A;  5FK9 C;  3T3N A;  1YJJ A;  1FD6 A;  2J42 A;  1D5Z C;  3I57 A;  3HRD D;  3AE6 B;  2J53 A;  5HG2 A;  4TMA B;  1YMH E;  2NTS A;  1C77 A;  3AEB B;  1F77 A;  1XEE A;  1YNT E;  2JQR B;  2DLB A;  1EU4 A;  4NAW B;  2WDV B;  3KLS X;  2ONQ A;  3UI3 A;  2L32 A;  4C80 A;  1IBX A;  3NZ3 A;  3SFD B;  4A8X C;  1ZXH A;  1PGX A;  4MH8 A;  4XDD A;  3ZJV A;  1HA5 A;  4WAF A;  2M19 A;  1SBB B;  3BII D;  3W5U B;  4YTN B;  3AV8 A;  3AE8 B;  4OVZ A;  1EWY C;  1TYG B;  4A9A A;  1CK1 A;  1T3Q A;  3NVZ A;  3CWI A;  3AED B;  1GPX A;  3AE4 B;  2B76 B;  2N0S B;  2WP9 B;  3TUO A;  5D7G A;  3C8Y A;  3BYT B;  2VZK B;  2YEP F;  1DOY A;  1XO3 A;  3E9S A;  2QJL A;  1NVI D;  1V1P B;  1ZOY B;  3GS2 A;  1VR9 A;  1XLN A;  2E3T A;  4JX1 C;  3W9C B;  4OW0 A;  2H88 B;  3WCQ A;  3CIR B;  5EE3 A;  3HVD A;  1KF6 B;  5EE0 A;  2IGD A;  3IT4 B;  4P16 A;  4WUR A;  4XWT A;  2GI9 A;  2D5G A;  2BTE A;  2HDE A;  1OQR A;  2E6X A;  3L4P A;  1E7P B;  3AN1 A;  3AMZ A;  3ZGZ A;  2QIL A;  2KMM A;  2K5P A;  3VRA B;  1QT9 A;  3W5V B;  2RPV A;  1ET6 A;  4ZRP A;  2PMV A;  3EA6 A;  4DQO C;  1JML A;  1C78 A;  2DYM A;  2M0A A;  3URY A;  1ENF A;  2KAJ A;  2SAK A;  3ZJU A;  1K51 A;  4TQ0 A;  2DBY A;  1SJE D;  2AQ1 B;  1L5P A;  2JSV X;  2K22 A;  4OZA A;  3AEF B;  1SSN A;  1N63 A;  4YSZ B;  1UWM A;  4DXG A;  2LHD A;  3I9V 1;  2GB1 A;  4NJC A;  1DYQ A;  1EWC A;  2W82 A;  3LYY A;  1YN4 A;  1PYW D;  1A70 A;  4WIP A;  1I4R A;  1PFD A;  2LJI A;  1HZ5 A;  2WS3 B;  3ZJT A;  4C7Y A;  2LGI A;  1N60 A;  1UWX A;  2CJO A;  2PKO A;  5I4D A;  3EGR A;  3AEA B;  2J4X A;  2WXJ A;  2XN9 C;  3Q8F A;  3AE5 B;  1TS5 A;  2EKI A;  4UDU C;  1L6U A;  1M4V A;  1Y56 A;  1T6B X;  2JX5 A;  2Q5W D;  3NVW A;  3IAS 1;  4ARC A;  1P7F A;  1UNS A;  1D5M C;  1KH0 A;  2WXR A;  2WXN A;  1C9F A;  1EM7 A;  1SF0 A;  2WXO A;  3W2D A;  5BMI A;  3TEY A;  1JRO A;  4L23 A;  1L4D B;  1SXT A;  3O13 A;  4ITK A;  2N9K A;  1IGD A;  4H2A A;  2H89 B;  2G9H D;  1STE A;  3AEG B;  1ROE A;  1OFF A;  4JE3 B;  3P4P B;  3LB8 C;  3MJ5 A;  1T5X D;  1TY2 A;  2WDR B;  1AN8 A;  3ETR A;  1C4C A;  2BS4 B;  1C4P A;  2LFI A;  3P42 A;  4C56 C;  1JAL A;  2ZW1 A;  4RGT A;  4LTU A;  4A90 A;  4R3D A;  2WU2 B;  2MJ3 A;  1ZDV A;  3W1S A;  3NVV A;  2WXL A;  5G5G A;  1RFK A;  5BYS A;  4MM3 B;  2L52 A;  1I7H A;  2WNM A;  1V8C A;  2LEK A;  4JPS A;  1JWS D;  1KFY B;  1HXY D;  2BW2 A;  4AS1 A;  2K9X A;  2R61 A;  4C7Z A;  3DWG C;  3BVZ A;  1FXA A;  1WWT A;  2V0G A;  3AE1 B;  4D2K A;  1N5X A;  1CZP A;  3MHZ A;  1SE3 A;  1RWS A;  2ICI A;  2L1A A;  4YSY B;  2IGG A;  2WDQ B;  1GB1 A;  4LLG M;  1YJI A;  3NS1 A;  3BK2 A;  1ET9 A;  4B0M A;  1I4Q A;  3AEC B;  4KKI A;  3BZD B;  1SE4 A;  1FO4 A;  2BB5 A;  1VJK A;  3ZYY X;  2JWU A;  2V4I B;  3R8B A;  2G1E A;  1BML C;  1I4P A;  1QOB A;  4M0W A;  3SEB A;  1RM6 C;  3TEX A;  4GDK B;  2KAC A;  2WU5 B;  1FFV A;  4ARI A;  2QIE B;  2BT6 A;  2PLP A;  3P4R B;  1RYJ A;  3RPF C;  3U2S C;  1K53 A;  3MC0 B;  1BXT A;  1HZ6 A;  2OHF A;  3N9Y C;  4ZHP A;  5BMH A;  4TSS A;  1IUE A;  3GB1 A;  4ZHO A;  3Q8A A;  4CQN A;  1QQR A;  1L4Z B;  1XLP A;  1N62 A;  4KGS A;  4KGT A;  4OHJ A;  3AB5 A;  5HFY A;  2MEK A;  2K3U A;  3AE3 B;  2WXK A;  2WXH A;  1I4H A;  1NEK B;  4GDL B;  1FCL A;  5FR3 A;  2QSD A;  3AE2 B;  3IT6 B;  2MJD A;  4HJG E;  1LO5 D;  1FMA D;  1QIL A;  1Q10 A;  1MHH E;  4RF1 A;  2WXF A;  2FUG 1;  1D6E C;  2ON8 A;  5E6J A;  5C2T B;  1MPE A;  3B2F A;  3BVG A;  1VLB A;  1I4G A;  1KLU D;  2WXM A;  5H8Y E;  1J7A A;  3FIL A;  3ZQ4 A;  2QEJ C;  4WWM A;  5HHD G;  2NTT A;  1FNV A;  3GP7 A;  5EE1 A;  1FRR A;  1QOF A;  2W3S A;  1CQV A;  2Y5P A;  4N59 A;  4AQ7 A;  2RDH A;  2KDM A;  3VRB B;  5MPO A;  2RMM A;  1FEH A;  2INN E;  4ZOH C;  1JW9 D;  3TEW A;  3RFZ B;  1QOG A;  2YEP B;  3AE7 B;  1TKY A;  1KRH A;  1JRP A;  4HEA 1;  1DOX A;  2N7J A;  1TKG A;  1L0V B;  1L0Y B;  1EU3 A;  4GLS C;  2BYT A;  3E56 A;  3KQ4 A;  1FXI A;  2JYT A;  1SIJ A;  2BS3 B;  4YTM B;  1B1Z A;  4FXC A;  1C79 A;  3SR6 A;  4Q2J A;  2MJE A;  1YN3 A;  2KWD A;  4RGO S;  1QOA A;  1PDX A;  1F2R C;  3P63 A;  3V05 A;  2PIA A;  2LHE A;  2DYO A;  4JWS C;  1VZ8 A;  2V3N A;  3LXF A;  4USA A;  1FRD A;  4JWU C;  5C3J B;  2GRI A;  3H8H A;  1L6V A;  2IDY A;  1HQR D;  3Q69 A;  2I38 A;  1V97 A;  5G5H A;  1V1O A;  2AX5 A;  2I2Y A;  5LNK 1;  1D5X C;  3FIL B;  1YQ3 B;  3B2G A;  3HVZ A;  3MP9 A;  4ZYS A;  4KX6 B;  4KKJ A;  1AWD A;  3HUI A;  4OZB A;  4YT0 B;  1J7B A;  1WSP A;  4US9 A;  2PW9 A;  1MI0 A;  3MFG A;  1P7E A;  2WXP A;  3IXS A;  2WXI A;  1KLG D;  1XCT L;  1ZUD 2;  4RNA A;  2M56 B;  4N58 A;  3PO0 A;  2EEL A;  2HTM E;  1DOI A;  3BVM A;  3J9C A;  3EUB 2;  1NEN B;  2JYE A;  4XDC A;  1IGC A;  3P4Q B;  4NAM A;  2W3R A;  1JWU D;  1ZPS A;  3BK1 A;  1GOZ A;  3VQI A;  1WYG A;  1VZ6 A;  4RF0 A;  1TKE A;  1DGJ A;  3PZ7 A;  1TS2 A;  2BBC A;  4RH6 A;  1TS4 A;  1AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...