1N61A

Crystal structure of the cu,mo-co dehydrogenase (codh); dithionite reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n61A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n61A01
3AMZA 3FAHA 2KMMA 4C7YA 2W55A 4YSYB 1JQ4A 4WQMA 4ZOHC 3AEGB 2PKOA 3AE8B 2PVOD 2BT6A 1WGKA 3FC4A 1FM0D 1R7SA 1FFUA 1J7CA 1N61A 1KRHA 3VR9B 1CJEA 1FXIA 3W9CB 1YJJA 3VR8B 2JX5A 3CWIA 1KFYB 5G5HA 2Q5WD 1E0ZA 2LEKA 1JW9D 3CIRB 4USAA 2WU5B 3AECB 2WP9B 1FO4A 3AV8A 2PVGC 3SFDB 1TKGA 3P4PB 2ACZB 3LB8C 1ROEA 1TKEA 2H89B 1OFFA 3AM9A 1YQ4B 1VDVA 1WRIA 2FBWB 3AE7B 4HRSA 5C3JB 1QOFA 2QIEB 2BS3B 3B2FA 5EE9A 5EE1A 3NVWA 1FFVA 1DGJA 2G1EA 3AEFB 2MJ3A 2W3SA 3NRZA 2WDQB 1RWSA 3P1MA 1QF6A 1NI3A 3NS1A 1DOXA 1FRDA 3P4QB 1QOBA 5H92C 3HRDD 1V8CA 4N6EB 1N5XA 2K22A 3HUIA 5AUKA 1L5PA 1J7AA 2Y5CA 1YJIA 1RM6C 2DWQA 1F0ZA 3RPFC 5MPOA 1TKYA 1ZUD2 2BS4B 1V97A 3EUB2 1RYJA 3DWMA 4C80A 2DBYA 4YTNB 3AE4B 4YTMB 3AEBB 1E10A 4WWMA 1QLBB 3P63A 2EKIA 1L6UA 3AH7A 3AE9B 5C2TB 3AE3B 5EE0A 3DWGC 3AEAB 1N5WA 2BS2B 1ZXIA 3SFEB 2WQYB 1WYGA 1TYGB 1N63A 2N0SB 1AYFA 2WS3B 4LTUA 2M19A 1I7HA 4ZHPA 1CZPA 1GPXA 1VLBA 2QJLA 1J7BA 4YXDB 2JQRB 1QOAA 1QT9A 3P4RB 1QOGA 3ABVB 5EE3A 4IDIA 1DOYA 1FMAD 3VRAB 3ETRA 2H88B 3NVVA 2W54A 3PO0A 2AX5A 2E3TA 1SIJA 1NVID 4C7ZA 4ITKA 2MH7A 1NYQA 3LXFA 3B9JA 1FIQA 1T3QA 3AE1B 1JWAD 4JWSC 1E7PB 1ZP0B 3L4PA 5H8YE 1JWBD 4JX1C 1XLQA 2CJOA 1EWYC 1JRPA 3AN1A 2WU2B 4FXCA 2L83A 3AE5B 3KWLA 3AEEB 2CJNA 3W5UB 1FRRA 2L52A 5GXGB 1N60A 4P6VF 4ZHOA 3NVZA 1NEKB 2WLBA 2CU3A 2B76B 1E6EB 4YSZB 4A9AA 1YQ3B 3AB5A 1PDXA 1B9RA 1L6VA 4N58A 1N62A 1WWTA 2MJDA 4US9A 4US8A 1OQQA 1TJEA 2WDVB 3AE6B 3P4SB 4JWUC 4N59A 1PFDA 3W5VB 1UWMA 3ZYYX 2KAJA 1JROA 1E9MA 1VJKA 2M56B 2WDRB 1SF0A 2K9XA 1OQRA 1NYRA 4HROA 3NVYA 1WXQA 4YT0B 2MJEA 2W3RA 2K5PA 1XLPA 4YTPB 4KX6B 3HVZA 1XO3A 3WCQA 1NENB 3VRBB 3SR6A 5G5GA 1FXAA 3BIID 1RFKA 1GAQB 3AEDB 1KF6B 1ZOYB 4YSXB 1JALA 1A70A 1XLOA 2HTME 3AE2B 5AUIA 2OHFA 1AWDA 1L0VB 1XLNA 1PUTA 3B2GA 1IUEA 1SB3C 2PIAA 1DOIA
chains in the Genus database with same CATH superfamily
3FAHA 4NLBA 3ZI4A 2LXAA 3RBDA 3DHHC 4NL9A 3GU3A 2FJ6A 1D5XC 5AIAA 2CR5A 3LYSA 4HPLB 3G6YA 4DOAA 2AGQA 5CA7A 4G50A 3OAWA 2Y0SF 2AGOA 4R63A 3N28A 7ICJA 1FO4A 3AECB 4OZBA 3H8MA 1TKGA 4IQWA 4P7IA 9ICSA 2NPTB 1VDVA 4Y2XA 4O1NA 5HI1A 5J2KA 3SYZA 5J2CA 8ICTA 1D5MC 5EE1A 3C0RB 1BPZA 1XSNA 2PMZF 3KZIU 1DOQA 4F91B 3UQ2A 3AEFB 3IXSA 2RPVA 4FBUA 3A0BU 3GIKA 2DAJA 5KFNA 3QU7A 4ECQA 4DL6A 3P4QB 4GIBA 5KFXA 2HOFA 1V8CA 2FDRA 3TANA 1D9DA 2YEPF 3DBLI 4PT5A 4MFAA 5J17A 3AE4B 2R8GA 2JSVX 4PGXA 2ZXHA 4PGYA 4TQ1A 3DBRB 3SV3A 1IGCA 4AQ7A 1YN3A 3EPIA 3DEEA 2Z0EB 4IWOA 2JRHA 2LASA 2XCPA 2JQRB 1YD8U 2JEJA 2W9NA 4QWCA 2JRZA 1KJTA 5J2DA 3MFIA 3KD3A 1ZQGA 3ETLA 7ICGA 4HPMB 3ZNGC 3RB6A 1IG6A 1WXMA 3A4RA 3UI3A 2RDJA 4ICVA 3AU5A 3PX6A 5L1JA 1QSYA 3QWZB 1UELA 2KTFA 4JWSC 4NQLB 1B4FA 4JX1C 2B0CA 2O6VD 4UB4A 2BDPA 8ICQA 9ICGA 4DQIA 2DKZA 4QW8A 3DHGC 1KH0A 3RB3A 1T8EA 1AARA 4DWIA 2KWVB 4IQUA 1ZQLA 4TUPA 2B76B 1ZQNA 3N7RC 4WAFA 1P7DA 2AJQA 1N62A 5AZFA 4PS7A 2B21A 1J2NA 2HBMA 4P0QA 2D11A 5KL1B 3QEAZ 1UUPA 2K9XA 1HEZE 2V3NA 2WXIA 3DCGA 3BK1A 2DNFA 2L3ZA 3VTVA 2YMLA 5AK5A 9ICNA 3OLMD 5AKGA 4EYIB 1L3VA 2QEJC 4ED8A 1RFKA 3AEDB 1TAMA 3C5GA 4DL5A 3T3NA 2JZPA 4MGIE 4LVSA 2FPLA 1NK6A 3V6EB 1QSLA 2IO1B 4C7YA 2ZCBA 1ZD5A 4DSLA 4I2EA 1OXJA 2WGSA 1X66A 2FNJB 2NBUA 3QC8B 1JRUA 4HDOA 2JYEA 1IPGA 3UXPA 4W9KA 3F53A 4XE0A 4JQWC 1L2NA 1MSWD 2M9NA 2QMTA 4USAA 3F2DA 2KP7A 5BOLA 5L1LA 1S9FA 2F1HA 7ICNA 2ASLA 4O3SA 3CSFA 5ALXA 2OCEA 5C3JB 2LRUA 4NAWB 4XDDA 3NASA 4J9LA 3O65B 3VTUA 2HVIA 1HUZA 2MJ3A 2WXMA 3K1ZA 2I1JA 2ZJAA 2WDQB 4KLGA 1NDDA 3QX1A 5BO4B 2LWPA 1EO6A 2KMAA 5IOIA 3ZDEA 2AGPA 4QAYA 3RCZA 2GB1A 1DOXA 3GV5B 8ICIA 4JGHB 3PO5A 4CF5A 2MWSB 2IOHA 4C8MA 2Y5PA 3RPFC 2BB6A 3Q8AA 4WIPA 4KIKB 2Z7JA 5J0XA 2KHWB 2VA2A 3IP4B 1QLBB 4M2YA 3PZDA 4RT3A 3M1YA 2KOXA 2R61A 1CEZA 3P63A 2AQ2B 3TFRA 1ZOLA 2AL6A 2RR9A 1GNUA 2MSED 2IHNA 1FCLA 5EE0A 2UWQA 3C2LA 2L05A 4DSEA 3X23A 3UF8A 4KLFA 1I7HA 2XY5A 3D2SA 5IAAC 3N4MB 3PSTA 3UIOB 4ZHPA 3B0YA 1QLNA 5C1ZA 2IHMA 1PVRA 1IBXB 4JMUA 1A76A 4ECWA 3N1XC 2YY6A 3E2EA 3TAQA 1S0MA 2BWES 1MG8A 4RGMA 3WALA 3ZDBA 4MFCA 3UGBB 5ALWA 3W2DA 4QZGA 1WM2A 3MHSD 1TAUA 4G0NB 4PHPA 2Z0DB 5ALKA 5L83A 1XLQA 3WKAA 2O2VB 3EFUA 9ICVA 4KLHA 3VH3B 1F2RC 2W04A 1I4PA 1GB4A 3UXNA 4AP4C 2JZZA 3WA0A 5AM5A 3LDAA 3IVFA 4FFDA 2INNE 3NS8A 4F72A 4F5PA 3QJZA 1AN8A 3BK2A 4KZCA 1K5OA 3ICXA 2KZMA 1L6VA 2MJDA 1ZDVA 9ICOA 4KGTA 4PL1A 5KFFA 1C78A 4YR3A 1GUAB 3MTNB 1L5UA 1WXAA 4QZIA 1FD6A 3RT3B 3H9DA 3VAWA 3NVYA 2GBJA 4UARA 4NL9C 1OUQA 3M9MB 4J9RA 4TUSA 4DSJA 2ZUCA 8ICLA 7ICEA 4Z6EA 2MX2A 4W9EA 5E6PA 3MR5A 8ICUA 7ICHA 4HAIA 1EXNA 2A1AA 4NZLB 1WM3A 2PE9A 3B2GA 1L7PA 2LVOA 4L2YA 4JLCA 2K4EA 4EBEA 2PEAA 5DG9A 5JZEB 1JWUD 3PLVA 4DDID 2N1VA 5AKJA 1O03A 1ENFA 1PQSA 1FFUA 2I5HA 4RQ6A 4TQ0A 1CI4A 1N61A 3OTQA 3BDPA 1Z3EB 3GQCA 3N3KB 2IPKD 2LJIA 2M17A 4K4IA 5I4DA 1KFYB 4O3QA 3UMCA 2KTQA 5E6JA 3CIRB 3JW0X 3HP6A 1WIAA 4UB2A 3P4PB 2C2DA 3VC8A 2BPSA 5TZVA 3TARA 3N97B 2H89B 4I2AA 3RULA 1V80A 3GFKB 4P4PA 4EOYA 1ZQQA 7ICPA 2BS3B 1HQRD 5EE9A 4P0PA 3B2FA 3RNCC 2KD1A 2GBRA 2OM6A 4B0MA 1L4ZB 2DL0A 5L1MA 2ZCCA 4UAVA 3URYA 2KKVA 4ECYA 5CWRA 3GB1A 2M0XA 2JH1A 1NI3A 4OVVA 2R2OA 5H92C 5J0QA 1ZW7A 1AQ6A 1TY2A 5BYQA 5CP2A 4GXIA 1X42A 1A5RA 2KMCA 3OPXA 4WWPA 2PE6B 4QZHA 5KHOA 3QNMA 5KL8B 3RTVA 1RYJA 4C80A 4FZMA 2D3DA 3WKCA 1E10A 5DKWA 9ICCA 1T0RC 1CUKA 4FBTA 4DK5A 2H3QA 4A8XC 3KWVA 4F93B 2V9WA 1Z4OA 1H38A 2AQ3B 5L9XA 3G6VA 2LUEA 3DBHI 4NLKA 3PSIA 3RJHA 1JWSD 1YX5B 1EU3A 1RQNA 1S0VA 2HHUA 4F5OA 1P9DU 1V9JA 3T5KA 1WMHB 1KKXA 4LNOA 3PZPA 2JZBA 3ETRA 4ICAA 1UZXB 4J9OA 2VZKB 2KK0A 3H7SA 1NVID 2KTRA 8ICCA 9ICQA 1ZD3A 7ICIA 3U7DA 1YMHE 3EW9A 4M04A 3VXWA 4URKA 2KJ6A 2ESEA 1RPLA 3W5UB 5J0RA 2UVVA 1V1PA 3PW4A 5GXGB 3ZUNA 2LGDA 1IIPA 1K52A 4MFFA 2JF5A 2KANA 2WX1A 3RRHA 3PMLA 1UA1A 1WWTA 4BX9C 3ZDTA 3UQAA 2RLTA 5KT6A 2WDRB 3RUIB 2KDIA 3U7ZA 2DENB 3DDHA 4Q43A 4I2GA 4YT0B 3SAFA 4ELUA 2ZIUB 4RT2A 2HSZA 1HTQA 1WX8A 1WFYA 3MFHA 4WJNA 5DPTA 3H0RB 4YSXB 1KLGD 1A70A 2LFIA 2PFPA 4ANUA 3Q14C 2WB1F 4RPYA 2ASJA 1PK1B 3RAQA 3PRZA 4EELA 3PO4A 4LZDA 2JEIA 4RM8A 4IQVA 3KUDB 4CNQA 1R7SA 3ZW3A 4KGRA 1BPDA 1LB2B 2IGGA 1S8OA 4HVBA 2KMDA 2ZIWA 5G5HA 5L1KA 1TE2A 3WU2U 2CU1A 2G4SA 2LHTA 3H0LB 2ZZPB 2XK5A 3J9CA 2KVZA 3M62B 1NKEA 4K7WA 5LXHA 2WXHA 3T5JA 1XC9A 2LGXA 3ENEA 3KYDD 4MGZE 3RZWC 4J6IA 2PKEA 2E8PA 3AM9A 5ALMA 1WRIA 3I9V1 1X9WA 2OWOA 5J18A 4AP9A 2QC8A 3U2SC 1YNTE 3GZNB 3SENA 2KLGA 5KG3A 5JH5C 4FULA 2JY6A 2JWZA 4Q8EA 2FCQA 5HP4A 4KDIC 4O0IA 1SL1A 1T0QC 1YT3A 4FS1A 2E8OA 3MDCA 4KLUA 4UW9A 2WXRA 8ICRA 1C77A 4M9JA 4W9IA 5HHHA 1LV5A 2V0GA 4RNOA 2I1KA 4Y2PA 3U30A 4ECRA 5CJ7A 3QU2A 5DG7A 1ZKHA 3PZ7A 4MF8A 4CF3A 1J8CA 2WF7A 1V5OA 1F0MA 1Y56A 1ZXHA 2VZKD 3APFA 3UINB 3AE3B 1C4AA 4GGQA 3H8SA 2AHOB 3QA8A 4W9LA 2KVCA 2ODGA 1WYGA 2KZ3A 1TT5B 3SU8X 1V9PA 2XIDA 2ZIXB 3L17A 1E8XA 3NZUA 4BFRA 4MH8A 4BVUC 4QIWC 4QZAA 4QZDA 1L3UA 1EF5A 3PO0A 4JB3A 5DB9A 2D3GA 5KHQA 5BYRA 3HIZA 3EWAA 2L5YA 1UHUA 3ZO5B 4EZKA 2MHJA 3L08A 4UAYA 1E90A 4YG2A 2AQ4A 3OJ4B 4IOIE 4OCZA 4DSIA 1JRPA 2OJWA 4RNNA 1E7VA 1WH3A 1ZQIA 4DL7A 3SHQA 1SL0A 4DF4A 8ICHA 1KFDA 2K4PA 2XCAA 4NJ8A 3I3TB 3GIMA 4W9HA 1ZDXA 4ZHOA 1SBBB 4YSZB 9ICKA 2HE7A 1YQ3B 1BMLC 1OQQA 8ICPA 1LKYA 2KSOB 4M01A 4ANVA 3MFGA 5CEHA 2M56B 8ICBA 1ZD4A 2D6FC 1L8LA 2NO4A 1VRAB 3C28A 3CMMB 2MA1A 1XO1A 4YVZA 3FILB 5IP4D 2HW3A 3HHMA 3VRBB 3SR6A 3WK4A 2L76A 1JI7A 2K39A 3R2TA 4PS8A 3H40A 4M0WA 1XLOA 3AE2B 3WK5A 4DFDA 4BXOA 1NK7A 1SE2A 3K9OB 5JRTA 2R8KA 5H2FU 3PR5B 4KLMA 2OOBB 1N48A 2KVSA 4BDPA 4FBJB 1GG3A 4ECUA 3C23A 4QZ8A 1KRHA 1E5WA 3BS5B 3E0FA 2Z59B 1RG6A 3Q8LA 2J6TA 4H2AA 1Z00A 2KE7A 4I2HA 1Y88A 3L0WB 5KFJA 1LM8B 4XYCA 3A4SC 3T5LA 2L00B 2MW5A 4KLDA 4LNNA 2JR5A 3ISBA 2K4HA 5AI8A 3JPOA 3QE9Y 5KFYA 1BVSA 2MP2A 3IDWA 5T8IA 1X9XA 4AYBF 3PS6A 3DVNV 4AUQC 4XZ4A 2G1EA 4G3XB 1XT9B 2JXJA 3P1MA 1NK4A 2KK8A 1NJZA 3PSPA 2JVCA 2RHFA 3HRDD 3KHHA 5AI9A 2NTSA 4RQ5A 3HILA 1JN3A 4OJ5A 2X38A 3SMVA 1NNLA 2GI9A 5IIOA 2EKIA 1X6IA 3JPSA 5AKKA 2JHDA 1U48A 2WAQC 4FZLA 1I35A 2P35A 2EQYA 2KN7A 3DWGC 2RD0A 1N5WA 1S10A 1BPXA 1BNOA 2NS5A 1HEKA 4EYHB 2KYWA 2ALZA 1TYGB 1SJHD 2N0SB 5BOMA 4B6JA 4YCXA 4YP3A 5AI4A 3TACB 3SV4A 2INDC 1TK8A 4M8NA 1SV4A 2J42A 5DG8A 2RMMA 2FLPA 3VRAB 4YXJA 4YD2A 4EZ6A 2TSSA 1NJYA 5ALTA 1HUOA 4B9LA 1ZD2P 4KITB 1ZJMA 1F44A 1YOVB 3M6KA 1TZOA 2KZZA 2Y0SC 1TVAA 2INCC 4BBNC 5ALOA 1YJ1A 2BCVA 2DYMA 3AE1B 4WAAA 2IMWP 2ISPA 5HR7A 2LYBA 3ALRA 3BJYA 3GS2A 4K7SA 3NJTA 1FNVA 4DS4A 5EDSA 2ZIVB 4B9TA 1H4RA 5J2RA 3EA6A 2BCSA 1Q10A 4NLCA 2VH1A 2MRPA 2ASDA 2PMZC 1N6ZA 3DDCB 3IM1A 3AB5A 1UGMA 2FCNA 1WGYA 1KSPA 2KT7A 9ICFA 2HBLA 2EANA 4O3RA 9ICLA 3Q8CA 4PK1A 2AH5A 3PRPB 4ED1A 2I38A 1BT0A 3ALBA 2MU2A 2BQQA 1SGGA 2W9CB 3Q8KA 4EBCA 4IR9A 5AEKB 1SV0A 4YTPB 4IS7A 5KFHA 2W9BA 1FXAA 5AK4A 3V05A 2J6SA 1XCTL 3SAHA 3H6NA 2G5IB 1VZ8A 1UH6A 5E6NA 2OEHA 1D8YA 4F3OA 2KMMA 4N9F4 2K3UA 3VUYA 4ZOHC 4UBCA 2WXNA 4CO7A 4DEZA 2V9HA 1HA5A 1T94A 2K8HA 4KV2A 3RR7A 5KG2A 9ICTA 4A90A 1KQQA 2FPKA 3QYPA 1L7MA 3TMPB 5AKEA 3W9CB 1I4RA 3Q2AC 5B66U 2V4IB 2K8CB 2LEKA 8ICEA 1U45A 2C9WB 5G55A 2ACZB 3OSNA 3JPPA 2WDTB 4O5KA 1T7PA 3BZDB 1ZQBA 4RQ7A 1TKEA 3K75D 3EFCA 4F1SA 3GE3C 2KJ5A 2H3ZA 2R8HA 3S6JA 4IRDA 3ZQ4A 2AU0A 3L16A 4Y2QA 3NRWA 8ICOA 3GV8B 1ECWA 3NS1A 4NJ6A 2N1WA 2F77X 3AL0B 8ICNA 1KLUD 1WJ4A 2BYFA 4BKGA 1HJPA 2QDFA 1D8LA 5J2AA 1WYWB 2A5UA 4YTMB 2HI0A 4I28A 1RYUA 3V6CB 3TEZA 1WG8A 3KHRA 3C5FA 4F4YA 4F2SA 2WFAA 4NPNA 4AS1A 1ZQYA 1EM7A 2H5XA 3GIIA 5L95C 3ZD9A 1TV9A 3MR2A 4J9QA 1KTKA 2YMQA 1SXTA 3AEAB 1EWCA 1PGXA 3EC8A 5HG2A 2E8NA 5AKHA 1Q46A 5ALLA 1PK3A 1QOAA 2E1FA 4M8MA 5EE3A 4DLEA 2KXJA 1VZ6A 5AI0A 4ECXA 3TI0A 4E3CA 1TY0A 5DLGA 2IO0B 3Q3OC 3R2IA 4OHJA 3GZFA 2MBEA 4UAWA 3RAXA 1L0XB 2GLSA 1STEA 3D2QA 3AQFA 3KHGA 3H8WA 4KZ0A 4JK1A 3B9JA 5IILA 4QWDA 4NY0A 9ICRA 5KFAA 3E58A 4YL8A 3PR4A 3QHTA 2HMXA 4CGZA 2CJNA 2ON8A 3PZ8A 1U9LA 2L52A 2WF9A 1QSSA 4PHEA 3NVZA 2PTLA 2G0AA 5AK3A 2ZW0A 4IM2A 4GMVA 3OG5A 4JE3B 5IINA 1U4AA 2WXGA 3PSEB 2A1JA 3RH5A 4US9A 3IT4B 4MJSA 3Q8EA 4RQ2A 2D3CA 2HHWA 1VJKA 2PXIA 2D07B 2JH7A 2W9MA 4XWWA 4KLJA 4HROA 2MUTA 3GZNI 2W3RA 5HHDG 2LPEA 7ICRA 5ALYA 3JYUA 3N32A 5DPSA 5AM2A 3MDAA 5BMHA 2NO5A 2QARA 5KFKA 2ZNVC 4RQ0A 1JALA 1WJUA 4I29A 1DGSA 1URJA 4Y2VA 1Y8RC 2WP9B 1L6NA 1RAXA 1TKDA 1OTRB 4YN4A 2VA3A 2G4DB 1IM4A 5DQIA 4NWIA 2RDBC 3MGHA 1J7CA 2KV2A 4ELTA 3B0XA 5AI5A 2MBQA 2ZXIA 5IIJA 2ZTCA 4TQSA 2KWUB 3L10B 1HE8A 2LGYA 3MJ5A 1E0ZA 3LVWA 3M63B 2MAXA 5J29A 4KLLA 3V6KA 4IUMB 2IJ0A 3ZVVA 1T0YA 2KJRA 4RPXA 4Z6FA 4IWQA 4M6WA 2L0FA 1WJ6A 1ET9A 4TSSA 3SD7A 4I27A 2KZRA 5ALVA 4JWNA 3M9OB 3NRZA 4ZRKA 5EWFA 3H8HA 1B1ZA 1CK1A 4MEYA 3M8SA 1RDFA 2KWDA 1MHHE 2Y9UA 1KBUA 2AL3A 4K81A 2MA9B 2QKQA 3H8JA 2DAFA 2L32A 2JUOA 8ICFA 1CMXB 3TEWA 2HOIA 4BKSD 5D49A 1UT8A 4NJCA 5ALSA 3D32A 2KIWA 2BPFA 3C21A 4ED3A 2WXKA 2BTEA 1Q8KA 5TISU 2WQYB 4LNIA 4LTUA 3H0MB 1AYFA 2M19A 4XC2A 2MLBA 4KVGB 2QJLA 2EDUA 2UVRA 1RRBA 4J9KA 3BZCA 2I2YA 3H7PB 4NJ7A 4XWTA 3ZIMA 1WR1A 3BS7A 5KAFU 3SAGA 4KTQA 3W1SA 3ML9A 7ICSA 4QZCA 4WQOB 4L1BA 3QX7A 2W54A 2KNBA 4B95A 3NHEB 2HHQA 4RQ3A 2LI5A 4XX5A 3ZNID 4ACFA 4EEKA 3RH6A 4HLEA 4C0ZA 2W11A 2HDEA 4ED0A 4RPZA 4DS5A 2BZFA 3UIPB 4ELVA 4DDGD 5JTIA 4ECZA 2BWFA 1WGHA 2ZEQA 3RH4A 5BMIA 2F8LA 4RQNA 3EGRA 4QJFB 3H4BA 2XEWA 1UCVA 4M9HA 1SE4A 1TK5A 2F2AB 4I2DA 1SV0C 2FAZA 4P6VF 4J9MA 4X57B 3RNAC 4UBBA 1E6EB 3ZRFA 4A9AA 4AJYB 4KLOA 1WX9A 4N58A 5J0PA 3WKEA 4UB3A 5D4BA 8ICJA 5ALNA 3IAM1 1MC8A 2N7JA 1S5LU 2PLPA 2IOFA 1SWWA 3NTUA 5ALHA 2NR2A 1QQ6A 7ICUA 1D3ZA 3V62A 2MJEA 1WE7A 4RM9A 1Z19A 3ZLZA 1NZPA 2LM1A 3M8RA 3TQ1A 4NNJB 4UB6U 1L4DB 3S2AA 4CE6A 5JUMA 3AU6A 1TS4A 5KG0A 1GAQB 3UPQA 4F4XA 2O2VA 1ZOYB 4DOCA 8ICAA 4R3DA 3VH4B 2KICA 4DCCA 1DOIA 2KFKA 1SJED 5ALUA 1JQ4A 2ZUDA 1KLNA 3PY8A 4R64A 2PKOA 3HPOA 1RZTA 1F77A 4QZEA 3CRXA 1SE9A 4NV0A 4ECVA 3MJWA 4PYZA 3O0FA 4XQ8A 2BYTA 4QW9A 4NM1A 1K1QA 4FN2A 2D8CA 4F5QA 4K7UA 4DL3A 1Q3UA 2ASQA 2DQNB 1V81A 3A1QA 3AV8A 5AM4A 3SFDB 2PFOA 4NLNA 4GB9A 3PRMB 5ALEA 1ROEA 2D5GA 5TR5A 8ICVA 1VR9A 2KO3A 3BQ7A 5KFZA 1SKSA 3ZNHB 4MACA 1B43A 2CN1A 2NV3A 1EUVB 1DGJA 2CPRA 1UNSA 4QZFA 1X9MA 1S76D 3VHTC 7ICMA 2C2RA 7ICTA 2NMQA 2FLLA 3TUOA 2MRLA 1LO5D 1YIWA 2J7QB 4JV2A 4C8KA 2RDGA 3T3FA 2BCRA 5AUKA 2KQ7A 3A33B 4XGAB 2KX0A 4XA5A 4K4HA 2H3VA 2FIFA 3TSSA 4R8UA 2EZXA 2VANA 3AQEA 5KT7A 4HCNB 2G07A 5C0YA 2Q0ZX 1DRGA 3J81j 4MEMA 1K53A 4OD0A 2EELA 2ONQA 1KTQA 3Q8QB 1CZPA 3WK9A 4YXDB 4Y2YA 4MH0E 4PJ0U 4I2CA 4C8LA 1EF1A 3PW5A 3CP8A 4IDIA 4KKIA 5E6OA 1XU4A 2IBIB 2SEBD 2FIDA 4WH4A 4OJ6A 3OGUA 4XDCA 1TS5A 2K8BA 3IT6B 3RNEC 4GSWA 4TV3A 4EX6A 3RFAA 3GP7A 1WXVA 4LJXA 5CTRC 1KOTA 3Q3FA 4MF2A 2XY7A 1ZQJA 1GB1A 4F50A 4HEA1 2KJ8A 5AICA 3JPQA 3T5HA 4P0PB 3ZXRA 2Y3AA 4DHZB 2REXA 3B1LX 1HZ5A 2G3QB 2ISOA 1N60A 7ICOA 2GLEA 2AQ1B 2JGAA 3KQ4A 1WWVA 5ALGA 3RNFC 3JSVA 1B9RA 4UATA 2IYDB 3E56A 3MGIA 1PVPA 2N7DA 3BINA 4KLIA 4O5CA 3C19A 1B0XA 1KN5A 2E8MA 4C8NA 1FCCC 1WZ0A 4O9MA 1WXQA 4LNKA 4ZRIA 4FO6A 1XLPA 3RB4A 2KHQA 2BPCA 4BKTA 1NENB 4OZCA 1KW4A 5FKAC 2E1EA 2K25A 4JV1A 4P1CC 4Y2SA 2LI6A 1F2RI 1L0VB 1QOFA 3LK9A 3VCBA 2W55A 2LHEA 4WQMA 2QB1A 3V7JA 2PVOD 3VUWA 3RNGC 1R4NB 9ICWA 1WGKA 2WXPA 3QXGA 2JZBB 1PZNA 3GDXA 3N9YC 3VR8B 3OJSA 2GOLA 2KTRB 5IKCM 4YMNA 4KLSA 4C4RA 8ICYA 2J0JA 2KC2A 3AU2A 4EKUA 3N20C 3EPGA 2F44A 5J2BA 2D3AA 3HM6X 1V1PB 2YB4A 3QUCA 3OHBA 1B22A 3AXCA 3WKDA 1T4GA 5KG6A 4QWEA 3PV1A 2KDBA 3T9LA 2FUG1 1GOZA 2Y5BB 4I2FA 2J53A 3AI5A 5A0LA 5KG7A 3PPAA 4GDLA 2L1AA 3QK0A 4IR1A 1DK3A 5FR3A 3H7IA 3NZSA 2C7HA 5DCNA 1Z5SB 4IWPA 3DBRI 5ALIA 4UB1A 4MHVA 2CHWA 2V4QA 5ALRA 1TKYA 1SL2A 1VZ7A 3KUCB 4RH6A 3VFKA 2DUYA 1X40A 3W1SC 1T6BX 3DBLB 1MN8A 3O13A 5FP0A 1C9FA 3HKZF 3CF6E 1VD2A 2JXTA 4PS3A 2NRXA 1PYWD 2BS2B 2KDMA 2YEPB 2ZVOA 1WF9A 3OSPA 4BOZB 1NOMA 2BVCA 2HHSA 2AWTA 3QU4A 3FDSA 3TFSA 2WTFA 1DXSA 4DQPA 8ICZA 2ZIWB 4UAZA 1X1MA 2BCUA 4J9PA 4CQNA 5F9LA 2XK5B 3DVNU 4A3OA 4EZJA 1SXEA 2IO3B 1ET6A 2WYQA 2YB1A 3QZ8A 3LXFA 4C4TA 5KFSA 5KFVA 3I5JC 1U4BA 5H8YE 3VDZA 4DXGA 4HK2A 1I4QA 5DGBA 4DXAB 3AEEB 2QB0A 4RMAA 2A3VA 3ONSA 2KVRA 2D3BA 1YZ6A 4AYBC 3PVXA 1YN5A 1SXDA 4Y2JA 4MSMB 2LMCA 2CS4A 3R7RA 1FXTB 1ZRMA 5J0YA 4GLXA 2W03A 2ZIXA 5CHFA 2OXOA 2WDVB 2HDOA 1HZ6A 3GOEA 5J0SA 1PFDA 4J03A 3W5VB 2K60A 4I6PA 2K4IA 2CRXA 2E5SA 1LVHA 4DFPA 4F71A 4GDKA 4DHJB 1F9JA 4F8RA 2RP5A 2PW9A 4UAUA 4B0EA 1GO3F 4ECTA 1S0OA 4YQWA 2GWSA 1LFDA 1WSPA 2ICIA 2XVTA 2BQUA 2W9AA 3ISCA 1WGGA 2KLCA 4IC9A 4KSLC 3C29A 3SZ2A 4KX3A 3NUQA 1IUEA 2PFQA 4U7CA 2ZPNA 4YSYB 3F5AA 3BZKA 3WANA 1U49A 2JT4B 2CHZA 2BT6A 1ZQCA 2NRVA 1FM0D 1SZHA 9ICJA 3PGEA 2JXXA 2LUMA 4HKQA 3CWIA 2K6DB 5KAIU 4C4VA 5AK6A 4P1BC 1NK8A 2DYBA 3UQBA 5E79U 2HHVA 4NM2A 2FUHB 1PUZA 4F92B 1IV8A 4YFKA 1SEBD 1N2XA 3BVZA 5CHGA 2M0NA 3RZFA 2JEGA 1WGDA 2KJ9A 2GMIC 4HRSA 5AM3A 1WJNA 1NJXA 4J9SA 4B9VA 2IGHA 3BY4B 5DLFA 2WXLA 2R8JA 5KFGA 4DHZE 1ZQUA 3RMKC 2BW2A 2W8KA 2FCSA 3FM9A 1UBIA 2L7RA 1LKYB 1SIFA 3AU4A 4FLHA 2HCFA 1ZE3D 1ZQMA 1HTOA 2RDIA 4DL4A 2FCMA 5DBAA 3NOBA 4N6EB 4NLGA 2N1RA 3BS5A 3OJ3A 1D4BA 2QLTA 2Y5CA 4Y2TA 1F0ZA 3DPDA 4MM3B 4IL6U 2ZTEA 1V97A 2KD0A 9ICIA 5EWEA 2NRTA 3Q6BA 3VUXA 4ZDVA 3WKBA 3R8BA 4HJKA 8ICSA 1SGHA 1TK0A 1ESFA 1K50A 3L54A 1K1SA 1S97A 3AH7A 4UASA 3ZDDA 4P2HA 4JPSA 5CHVC 1WZ3A 2WF6A 4BGDA 2DYOA 2P6UA 4KMOB 4RUAA 2WS3B 4M00A 3R66C 1A0PA 2UVUA 1VLBA 4ICUA 1A77A 1E8YA 4ED6A 4II3B 1UPHA 4O3NA 1L0YB 3VVWB 4CYEA 4LDTB 3QIJA 2ZNVB 3U8ZA 1Z00B 2LHDA 3F5EA 3JPNA 1WX7A 2C5LC 4ACOA 4PHAA 4DSKA 5DBBA 4A3PA 2NCNA 1L3SA 9ICPA 3CYMA 1LQBA 1S3SG 2J4XA 2LGIA 5KFDA 4ITKA 4PL2A 1BPYA 1MQ3A 4IRCA 2WXQA 2MCNB 2MP2B 2LM4A 2XBBC 4II2B 2WU2B 9ICBA 1EWYC 3ZTCA 3AN1A 1V1OA 3UMGA 4KLQA 3RRGA 4TUQA 1X9SA 4RUCA 1C20A 3ZKJC 4DHJD 3L5KA 5J0TA 2K0PA 4W9GA 5ALPA 1Z1BA 3IRUA 5AKIA 3M95A 2JRIB 5C23A 1UF0A 9ICEA 5CHWA 3A9JA 1QZEA 2LVQA 3DHIC 2K8AA 1UD7A 5JHAA 4N59A 1WXSA 2EKEC 3NY5A 2KAJA 1E9MA 3RFZB 2VJ4A 1UA0A 1K51A 1OQRA 2O6KA 3G6XA 4EX7A 1MVKA 3HW8A 2ES6A 2R8IA 1V85A 4AOFA 1DK2A 4CRXA 1IGDA 2YTUA 1JIHA 5J8YA 4BZAA 3F2CA 1MHXA 3THVA 4XRHA 2BDUA 5GTIU 4L23A 4B9KA 5CR0A 3QUQA 3RN9C 3SI8A 2J52A 5EWGA 2N9PC 2SAKA 4E71A 4WURA 4Y2UA 2VJ5A 3HJEA 1TS3A 4NQKE 3TKAA 4I6NB 4LLGM 5KFLA 1E8ZA 4O3MA 3PW0A 1UT5A 4HDQA 4IRKA 2DF4B 2C28A 1P0RA 2KKPA 2HJ8A 2PI5A 2Q5WD 2BKFA 1RQLA 4ASWC 4DQRA 8ICGA 2EZZA 4OVUA 3IHQB 4JV0A 3GILA 1OFFA 1DYQA 3AE7B 4KKJA 5KT2A 3V72A 9ICHA 5KFUA 4LJOB 4DFJA 4CCHA 4YR2A 2G9HD 4GC6A 4EENA 1K8RB 2LRWA 3KTQA 4M02A 3Q3MC 5IO9A 1V49A 2W3SA 4RF1A 5J2FA 4DLGA 5HHIA 3M7DA 5HMLA 2IZVB 2CKHB 2WXFA 2HVHA 1J0GA 1D5ZC 3DVGY 3IAS1 3WIMA 1UQVA 4Y2RA 3PV8A 3A9KA 2FMQA 4QWAA 3SDLC 4X5VA 4Q45A 2K8CA 3HM3A 2O6VA 4DSFA 2W9BB 3Q8PB 1BGXT 1OGWA 4QNLA 2I1QA 3I63C 3VQIA 1MG4A 4NXZA 1D8BA 2MSNA 2C7NB 2MBOA 3NZ3A 3P42A 4JIOU 2GBNA 3MP9A 3M6ZA 3PVLA 4EUTA 2KOBA 2GRIA 3RJKA 3ABVB 4AJWA 3HWTA 3DBHB 2IBKA 1MQ2A 2J0KA 5JU5A 5KFBA 3Q3JA 1L7NA 1I4HA 2PPHA 1QQ5A 3UMBA 3WK8A 3JVZX 1NBFC 4DF8A 1ISNA 3N1ZC 4IW0A 2YX8A 1RYRA 1FIQA 4D2KA 2JWUA 4A20A 1FEHA 4FJYA 3NG0A 2KC1A 2F8KA 5DQGA 2RGFA 3N7SC 5GMVA 1J97A 4PYUA 4B6WA 2NPTA 2OYYA 2XN9C 2V4RA 1QCKA 3N1YC 3ZJTA 1I4XA 2WLBA 2BHNA 3C2KA 2I6XA 2MBHA 5J2IA 3GE8C 4CF4A 2F1JA 5AIBA 4B9NA 3LWLA 4JWUC 1ZQFA 3PHXB 4BKSA 2FE9A 1IP9A 3KBBA 1EU4A 1SF0A 2LVPA 2IOFK 4KLEA 5KNIA 4BBNF 2M8SA 1XXGA 5B5EU 2FPMA 2L0TA 1ZRNA 2DZMA 2J6UA 3BYTB 3WCQA 4G9BA 4DL2A 3D6JA 2UVWA 2G09A 3A0HU 1IYFA 4TQRA 2OHFA 2JEFA 2DLBA 4ZYNA 1P3QU 1R4MB 4CDGA 1C4CA 2J0MA 2XGPA 1YN4A 1FEZA 1XD3B 3KYCD 3L13A 1JXLA 2M1MA 2INPE 2XO7A 2DZIA 5DQHA 2N9LA 3ONNA 1UBQA 2V3PA 1XWLA 2G06A 3IV6A 1WRDB 1N56A 2PVGC 3KH0A 5KG4A 2W43A 3WAMA 1UGJA 2ZW1A 3QZ7A 1TBEA 3PW7A 2OJRA 7ICKA 1J2MA 1F52A 3KFUF 4C00A 1ZQXA 5GTHU 3RD2A 4MEXA 3V6JA 2QIEB 4BWJA 4JUZA 3U26A 4DFKA 5KFTA 4ZRPA 3V61A 2WNMA 5JXVA 4AWJA 2A1JB 4MJSB 1C4PA 1P7EA 2N4FA 1NK0A 2P6RA 3TAPA 1QOBA 4GFJA 4O3PA 1L8OA 1Z4NA 5ALDA 2NTTA 2MUTB 1A6SA 1RM6C 3D2NA 1JCKB 3IBEA 3ZJVA 4MELA 5D3DA 4P4MA 5IN7A 2FMPA 3R3MA 4RQ1A 2QARB 3RR8A 5L1IA 1JWMD 1L6UA 3EHVA 5C2TB 4WJ3B 2NRWA 4DWFA 3EZ5A 4HXDA 5T14A 1ZPSA 4DXFA 4GLSC 3SFEB 1I42A 3QUBA 1N63A 2HHXA 4Q2JA 3M3JA 1J7BA 2BYEA 1V38A 2BGWA 1D6EC 2YVCA 4P0QB 4ARCA 2H3FA 1DOYA 2JV3A 3V7KA 3ISDA 2H88B 3KUZA 1FNWA 4UDUC 3V7LA 3IFWB 4C7ZA 4MGKE 1E7UA 4F4KA 3RJIA 4M6WB 3MBYA 1ACCA 1E7PB 1JWBD 1ZP0B 1XF5L 2CJOA 2JMGA 1U47A 2L83A 2KQSA 4YD1A 5D6JB 2M4NA 3RJFA 1ZQZA 2G45B 4EFOA 3F2BA 4KGSA 2KWCA 4NAWA 3PT2B 5KFEA 3ZDAA 3ZTDA 4IM3A 3HT3A 3RYTA 4Z6DA 5J8YC 4BOSC 3M9NB 2BF8B 4YXMA 3H7PA 1SKRA 1F5SA 2V4LA 2KQ4X 5LNK1 1T3NA 4GOCA 1WUDA 1AW7A 5DPWA 5KFIA 4KN7A 5HMMA 5F3XB 1XQQA 2KACA 3HVZA 3TEXA 2PFNA 1RLFA 3JPRA 4ECSA 3AUOA 4KIKA 1BUIC 3LVVA 7ICQA 2VKQA 3EYZA 5BMGA 8ICKA 4DFMA 2M0AA 1SE3A 2BKRB 1XCQL 2LD9A 3AEVA 5LXIB 5AKYA 4DQOC 3PHWB 1JMLA 4JL9A 2YN4A 1YJJA 2JX5A 1IBXA 2ZPYA 1C79A 3PTFC 4RZRA 1JW9D 2RQ5A 1WI0A 1KEJA 2Q4TA 2N9EB 3PNCA 2HBJA 1TFRA 1QKZA 3OWEB 2JPHA 2DX5B 7ICLA 2EAMA 3I1YA 4GC7A 2ZJ5A 2BR0A 2FBWB 2F1IA 3NUHB 2FMSA 4W9CA 2YMPA 1FFVA 4PH5A 3V6HA 2GBKA 3CNHA 5K4LA 4TUUA 1RWSA 3APDA 1PGAA 4PPXA 1FRDA 1Z2MA 3OJUA 4KLTA 4ZRQA 2K22A 3TBLD 1KRPA 1J7AA 3C8YA 2MBBB 2VRRB 1HXYD 2ATLA 2BS4B 1P7FA 3DWMA 4YTNB 5KG5A 3UM9A 3AEBB 2BQRA 2LBOA 1YZ7A 3SQIA 4KX5A 1VCBA 8ICMA 3AE9B 1ED1A 2CXYA 2DGZA 3KKAA 3MABA 1YX6B 2KFKB 2WX0A 5AZGA 1S1QB 1KLVA 3C1YA 2WXJA 1QQ7A 1ZXIA 4F4WA 4YMMA 4K3BA 3TADA 3WK6A 5BPCA 4NLZA 4OO1J 2VIXA 1MFWA 1WE6A 2DZKA 2NBVB 1SKWA 3I57A 3B08A 4FHKA 1G6JA 5J2GA 1GPXA 2K89A 2YMMA 5HR6A 2HTHA 3MC8A 3QU9A 4O3OA 4YR0A 1ZQVA 3A1QB 2AX5A 4F4ZA 2HD5B 3QQ8B 2E3TA 4WJPA 2KFZA 2GBMA 4W9DA 1TS2A 1S77D 2C22A 1KFSA 1JWAD 2I9GA 2N9XA 4FXCA 3KWLA 4M0AA 4I2IA 3FKYA 1FRRA 1M6YA 2F3NA 1IXRA 3RJGA 1MPEA 3SEBA 4TURA 1NEKB 1WY8A 4PZOA 2WB1C 1PDXA 4HWIB 2KNJA 3N7PD 2K1FA 1WR6E 4QZBA 1UWMA 5ALFA 5ALJA 4OZAA 2WXOA 1L7YA 2Z8LA 4FJZA 2X8XX 5KT4A 2RDHA 4RQMA 4R8UB 4DOBA 4BUGA 3I76A 1HIWA 1Q1OA 3IG3A 4LZGA 4BWMA 1OEYA 2IDYA 2ZTDA 5DB6A 1AWDA 3HKZC 4Q8FA 1H8CA 1KM7A 2XGQA 5J2HA 4PHDA 4DQSA 2WHIA 5DB7A 2F76X 2WHEA 5J0UA 2HHTA 1GJZA 1CRXA 5AI6A 5KG1A 3GV7B 3AE8B 2LYHA 2DPJA 2Y1IA 2BPGA 1MJDA 4JWMA 3KW5B 1RFAA 1Q0WB 4HKZE 2R18A 4BAXA 2K8BB 3VR9B 1CJEA 1FXIA 4TKNA 1WMHA 4QZ9A 3OHAA 4NY8A 4HJGE 4GU2A 4MDKE 1ZQEA 4TMAB 3TEYA 1BNPA 1ZJNA 5IA7A 2GOWA 5AZHA 5EOZA 5D2MB 2MEKA 4A6QA 4S17A 4ED7A 2HBKA 1VJ5A 3T79A 2Y9TA 2DFLA 2RPQA 5KFMA 4GXJA 1D9FA 3NVWA 2LJ5A 2LMRA 8ICWA 1C1YB 3JSVB 3E9SA 4LCDE 5IIMA 3ECIA 2LZ6A 3B0AA 5D3IB 2N7EA 3Q69A 2K6QA 3MR6A 1JMSA 3K9PB 1KFTA 1COOA 3QARA 2A4ZA 3RNBC 3ZXVA 1JX4A 2XY6A 4WWNA 3WK7A 1XSPA 4RF0A 2LGSA 2OH2A 1Z1VA 4Q44A 1ZQAA 4RCOA 2ZIUA 3EECA 1LXDA 4F5RA 5FK9C 4R66A 1ZQDA 5F9NA 3WAPA 2IA6A 2IGDA 4E0DA 1XNSA 1NKBA 4IM0A 1BXTA 1ZQHA 5AKZA 5DBCA 2W7OA 1PK1A 5HKHA 1QT9A 5G2NA 1J19A 2KDFB 4ED2A 2C60A 3AULA 1X2IA 2KHVA 2AQ0A 3NVVA 2NRZA 1V2YA 2KJHB 4RGTA 1L7OA 5KT3A 2FLNA 5CX3A 3ED5A 3VTWA 3ZGZA 1NYQA 1R4MI 1QILA 1T3QA 4C8OA 5CRXA 4OVZA 2V1YA 4WWOA 2EMSA 1TGZB 4DBGA 1I4GA 1NZBA 4CHKA 2WWZA 1C3TA 4RGOS 4HPPA 4ANXA 3BQ2A 3BVMA 4GDLB 2LYAA 1UWXA 4KN4A 3Q8BA 1ZETA 3DQVA 4US8A 3P4SB 4DO9A 1TJEA 2EMTA 4P4OA 4RU9A 5JHBA 4EE2A 2LKYA 4J9NA 5D94A 5J2EA 2KN4A 3SD5A 3T3OA 2NYVA 5KFOA 4FJVB 4HCPB 4Z6CA 4KDLB 3ZNZB 2DPIA 3KOOA 7ICFA 4DQQA 2D2QA 4ANWA 2WF8A 3T8MA 2V3SA 4K1RB 3ORYA 1QQRA 3BIID 4I6LB 2ZJDA 1OEYJ 2JYTA 1NJWA 1XS9D 2KN5A 4OJPA 2HTME 4ZRJA 4ZYSA 2YQEA 5AUIA 1WGRA 1XLNA 3CW2C 2OEDA 1ZQRA 2DBYA 2H3IA 1ZQOA 3AMZA 4QWBA 1OQYA 5IIIA 5IIKA 2XI9A 3AEGB 4GXBA 4LJPB 3HX0A 4IQTA 4GIVA 2CHXA 1SSNA 3FC4A 3NGDA 1O08A 1WCLA 3MC9A 1SWVA 1GC6A 5KTQA 1MA7A 2PMVA 4RQ4A 3ML8A 3PMNA 5FR6A 4IKGA 1XO0A 3DV9A 3LDZE 9ICMA 2KFJA 2VH2A 3ZD8A 1Q5WB 3KLSX 1JXEA 4RNMA 2PI4A 2QHOA 1SZPA 3QAQA 5AM0A 2QB0B 4LNFA 5KFPA 1YQ4B 1QTMA 3DBSA 3MR3A 3PSFA 3RJJA 4FE3A 5DB8A 3Q8FA 3SEIA 1WCNA 3UXOA 1LGRA 4G11A 1TZ1A 4PZNA 3IHPC 2ZJ8A 1NK5A 4F7ZA 1QF6A 2IY1B 7ICVA 3QCAA 2AXTU 3KKAC 1L3TA 2NBWB 3P2BA 3I28A 3HUIA 4GDKB 2FE8A 3H4DA 2KSOA 3TADC 1YJIA 4M47A 8ICXA 1BPEA 4B9UA 3PW2A 3EUB2 2KX3A 1C7YA 4C56C 3ZDCA 4WWMA 4IG7B 4WJOA 3FILA 1TAQA 4EEYA 3Q8MA 4ZH4A 3ZRCA 3APCA 1FPYA 1XEEA 1YQBA 5LLIA 5CB1A 1GC7A 4FHJA 5DDYA 2BQ3A 3KZXA 2MQJA 3C2MA 5DPRA 3MHZA 2XICA 1KL9A 1RXWA 5D46A 1T0SC 1P98A 2BB5A 5TSSA 3U4EG 5HFYA 2L8JA 1ZGUB 4KMUA 3N30A 3PX0A 2QILA 1OW5A 4C4VB 2KG5A 4MGYE 3BQ1A 3RI7C 4MM3A 3TL5A 5DDMA 2MH7A 2XNAC 3K1RB 2IO2B 3QU5A 2KKCA 3X0WA 3IG8A 4W9JA 4F2RA 4IC7B 1T5XD 3AE5B 4M0WB 2BKEA 4BXOB 1PGBA 3MC0B 1RXVA 4FADA 3MC1A 2JU6X 2A19A 1NKCA 4BJQA 1V6EA 2CU3A 4A55A 3LYYA 2EAOA 1TIFA 3ZJUA 2UYZB 1ZQKA 3LWMA 2G5HB 1WWUA 4M9GA 1NK9A 3HVDA 1M94A 1COKA 1ZQTA 3TIXA 1P1AA 2DHZA 2G08A 3Q8RB 4F8CB 1X6JA 1ZYQA 2D10A 1M4VA 3BYYB 2JZ3B 3TJPA 5ALZA 4E74A 3KHLA 1KF6B 4A8EA 1Q3VA 1PUTA 1SB3C 3WAOA 2WF5A 4RGNA 4GXKA 1V86A 3GIJA 2QCZA 5AM1A 4EBDA 4F5NA 3HK0A 2BCQA 5BYSA 4QIWF 3RB0A 2B3AA 2W82A 4UB5A 4OJOA 2HJ1A 4I2BA 4EZLA 1ZQWA 3IN5A 2DKXA 4C4SA 3PREA 2AYOB 2WU5B 3PLUA 4K3CA 2RSUA 3BWUD 3C1ZA 3Q3NC 4KSKC 1NI2A 3LB8C 1MI0A 5KFRA 4R65A 1KDHA 2FI1A 3MGVA 5KT5A 9ICXA 1FNUA 2EH9A 3ZDMC 3H1UA 3PX4A 3RBEA 5D7GA 2ZIVA 5AHXA 1QH9A 4PGQA 4YMOA 3A9JB 4LK0M 3R7QA 3K4GA 3KVFB 1N5XA 4EZ9A 3DVGX 5ALQA 5J2JA 9ICUA 3DOWA 1L5PA 4HYKA 2QSDA 2DWQA 1V5TA 5MPOA 5C5JA 1ZQ1C 3R9KA 4FA6A 4WJQA 1ZUD2 1BPBA 3QUTA 2KFNA 2ZG6A 5KFQA 2W9CA 4S0RA 2GH1A 2R2QA 5DGAA 4XUSA 3U52E 3JPTA 4RQ8A 2BGFA 2DZJA 4GN1A 4RNAA 5J0OA 3RF9A 3TCAA 4MT5A 3BQTA 1CQVA 2P66A 2VA8A 4U6PA 4NAMA 1ZQPA 2Y1JA 2XC9A 3UQ0A 4EEWA 2BYVE 4J3OD 2HOQA 4RFBA 3P4RB 1QOGA 2C7MB 3RJEA 4B9MA 5HNKA 4FS2A 4M9LA 1FMAD 5KFCA 2ZUBA 2NVUI 2W8LA 3Q8SB 4B9SA 1SIJA 2RRDA 4UQGA 1ZQSA 4MSQB 3LJ3A 4OW0A 1RYSA 3V60A 4M9NA 4LDTD 3W1YA 3ZYYX 3L4PA 2C2EA 5AKXA 2W7PA 2ZVNA 2PJHA 1E8WA 2E6XA 5AKLA 2B6GA 4REZA 4K4GA 4W9FA 4P16A 2LXCA 3BQ0A 2EAPA 1F1HA 3CSTA 2BBCA 9ICAA 3BVGA 2N9KA 3FYHA 4G3IA 1JUDA 4FZNA 2UU7A 3AE6B 3A9KB 3V3XA 2EZYA 1JROA 2KDEB 2YLMA 2KEYA 1TTNA 1PVQA 2O6VB 5KFWA 1NYRA 1XSLA 1C76A 3IG5A 5J0WA 1AROP 3QEBZ 3L3FX 4OJLA 2K5PA 4KX6B 4O5EA 1XO3A 4YWGG 5G5GA 2AEHA 2WAQF 4ARIA 2GO7A 1S0NA 1R4NI 2KIVA 4I2JA 4UB8U 2IY0B 2PIAA
chains in the Genus database with same CATH topology
3FAHA 2M0AA 1SE3A 2W55A 1XCQL 2LHEA 4WQMA 2PVOD 1D5XC 1WGKA 2WXPA 4DQOC 1JMLA 1KRHA 3N9YC 1YJJA 3VR8B 2JX5A 1IBXA 1C79A 4H2AA 1JW9D 3AECB 4OZBA 1FO4A 1TKGA 1QKZA 3OWEB 1VDVA 2FBWB 4O1NA 5HI1A 1V1PB 3NUHB 5T8IA 1D5MC 5EE1A 1FFVA 3AEFB 2G1EA 3IXSA 2FUG1 1GOZA 2RPVA 3P1MA 1RWSA 2J53A 1PGAA 2L1AA 1FRDA 3P4QB 5FR3A 3HRDD 1V8CA 4ZRQA 2K22A 1J7AA 2YEPF 3C8YA 2NTSA 1HXYD 4PT5A 1TKYA 2BS4B 1P7FA 3DWMA 4YTNB 1VZ7A 2X38A 3AE4B 3AEBB 4RH6A 2JSVX 2GI9A 1T6BX 2EKIA 4TQ1A 1IGCA 3O13A 4AQ7A 1YN3A 1C9FA 3AE9B 2JXTA 3DWGC 1PYWD 1N5WA 2BS2B 2KDMA 1ZXIA 2WXJA 2YEPB 2N0SB 1TYGB 1SJHD 3I57A 1GPXA 2JQRB 2J42A 2RMMA 3VRAB 2TSSA 4CQNA 2AX5A 3UI3A 2E3TA 1ET6A 1TS2A 1TZOA 3LXFA 2DYMA 3AE1B 1JWAD 4JWSC 5H8YE 4JX1C 3GS2A 4FXCA 4DXGA 1I4QA 3KWLA 3AEEB 1FNVA 1FRRA 1KH0A 3EA6A 1Q10A 1YN5A 1MPEA 3SEBA 2LMCA 1NEKB 2B76B 3AB5A 1PDXA 4WAFA 1N62A 2WDVB 1HZ6A 3Q8CA 1PFDA 3W5VB 1UWMA 2I38A 2K9XA 1UUPA 2V3NA 1HEZE 2WXIA 2WXOA 4OZAA 3BK1A 2Z8LA 2PW9A 2RDHA 4B0EA 4YTPB 1WSPA 2ICIA 1FXAA 2QEJC 1RFKA 3AEDB 3V05A 1XCTL 2IDYA 3T3NA 1VZ8A 1AWDA 2JZPA 1IUEA 2KMMA 4C7YA 2K3UA 4YSYB 4ZOHC 2WXNA 3AE8B 2BT6A 1HA5A 1FM0D 4HKZE 4A90A 3VR9B 1CJEA 1FXIA 2JYEA 3W9CB 1I4RA 2LUMA 4HKQA 3CWIA 2V4IB 4XE0A 4HJGE 2LEKA 2QMTA 4USAA 4TMAB 3TEYA 2ACZB 3BZDB 1SEBD 2MEKA 3BVZA 4A6QA 1TKEA 4HRSA 5C3JB 2IGHA 4NAWB 4XDDA 2WXLA 3NVWA 3ZQ4A 2BW2A 2MJ3A 2WXMA 2WDQB 3E9SA 3NS1A 1DOXA 2GB1A 1ZE3D 5D3IB 4N6EB 3Q69A 1KLUD 1D4BA 2Y5CA 2Y5PA 1F0ZA 4MM3B 3RPFC 2BB6A 3Q8AA 4WIPA 1V97A 4RF0A 4YTMB 1QLBB 3R8BA 3TEZA 3P63A 4RCOA 2R61A 4AS1A 1ESFA 1K50A 2AQ2B 5FK9C 3AH7A 2IGDA 1EM7A 1FCLA 5EE0A 4JPSA 1KTKA 1SXTA 3AEAB 1BXTA 1EWCA 1PGXA 5HG2A 2DYOA 2WS3B 1I7HA 4ZHPA 1VLBA 1QOAA 1L0YB 1QT9A 1IBXB 5EE3A 1VZ6A 1TY0A 2LHDA 3NVVA 3R2IA 4RGMA 4OHJA 4RGTA 1L0XB 3W2DA 1STEA 2J4XA 2LGIA 3ZGZA 4ITKA 1NYQA 3B9JA 1QILA 1T3QA 4OVZA 2WXQA 1XLQA 2WU2B 1EWYC 3AN1A 1I4GA 1V1OA 1F2RC 1I4PA 2CJNA 2ON8A 3PZ8A 1GB4A 2L52A 4RGOS 2K0PA 3NVZA 2INNE 2PTLA 2ZW0A 3BVMA 4GDLB 1AN8A 3BK2A 1UWXA 3Q8BA 1L6VA 4JE3B 2WXGA 2MJDA 4US9A 4US8A 1ZDVA 1TJEA 3IT4B 3P4SB 3Q8EA 4KGTA 4N59A 2KAJA 1E9MA 1VJKA 5BMGA 4EE2A 3RFZB 1C78A 2KN4A 1K51A 1OQRA 4HROA 4XWWA 3T3OA 1FD6A 3NVYA 2W3RA 1MVKA 5HHDG 1QQRA 1IGDA 5BMHA 3BIID 1MHXA 2JYTA 1JALA 4L23A 4NZLB 2HTME 4ZYSA 5AUIA 2J52A 1XLNA 2OEDA 2SAKA 3B2GA 2WP9B 2DBYA 4WURA 4L2YA 3AMZA 1TS3A 1JWUD 3AEGB 4LLGM 1SSNA 3FC4A 1ENFA 1FFUA 4TQ0A 1J7CA 1N61A 2PMVA 2IPKD 2LJIA 4IKGA 5I4DA 3MJ5A 1KFYB 2Q5WD 1E0ZA 5E6JA 3CIRB 3KLSX 3P4PB 2IJ0A 2H89B 1OFFA 1DYQA 1YQ4B 3AE7B 4KKJA 1ET9A 4TSSA 2BS3B 3B2FA 1HQRD 5EE9A 2G9HD 3Q8FA 4B0MA 1L4ZB 3URYA 3GB1A 2W3SA 3NRZA 4RF1A 3H8HA 1B1ZA 1CK1A 1QF6A 1NI3A 2KWDA 1MHHE 5H92C 2WXFA 1TY2A 5BYQA 1D5ZC 3IAS1 3HUIA 4GDKB 2FE8A 1YJIA 2L32A 3EUB2 1RYJA 3TEWA 4C80A 4C56C 1E10A 4WWMA 4NJCA 3FILA 4A8XC 2PIAA 3VQIA 3KWVA 3NZ3A 2WXKA 1XEEA 3P42A 2BTEA 2AQ3B 2WQYB 4LTUA 1AYFA 2M19A 2QJLA 3MP9A 1JWSD 3MHZA 2BB5A 3U4EG 1EU3A 2I2YA 5TSSA 4XWTA 2GRIA 3ABVB 5HFYA 3W1SA 2QILA 3ETRA 4L1BA 2W54A 1I4HA 2VZKB 1NVID 2MH7A 2XNAC 2HDEA 4D2KA 1FIQA 1F2RI 1YMHE 2JWUA 1FEHA 1T5XD 3AE5B 5BMIA 1PGBA 3EGRA 3MC0B 3W5UB 2XN9C 1V1PA 5GXGB 1SE4A 2JU6X 4P6VF 3ZJTA 1I4XA 2WLBA 1K52A 2CU3A 1E6EB 4A55A 3LYYA 4A9AA 3ZJUA 4N58A 1WWTA 4JWUC 3HVDA 3IAM1 2WDRB 2N7JA 1EU4A 1SF0A 2PLPA 3U7ZA 1XXGA 4YT0B 2MJEA 1M4VA 3BYYB 1L4DB 3BYTB 3WCQA 1TS4A 1GAQB 1KF6B 1ZOYB 4YSXB 1KLGD 1A70A 2LFIA 4R3DA 2DLBA 2OHFA 1PUTA 1SB3C 1DOIA 4RGNA 1SJED 1JQ4A 1C4CA 2PKOA 1YN4A 1R7SA 5BYSA 1F77A 4KGRA 2W82A 2IGGA 2INPE 2BYTA 2N9LA 5G5HA 2V3PA 2WU5B 3AV8A 3J9CA 3SFDB 2PVGC 3BWUD 1UGJA 2ZW1A 3LB8C 1MI0A 2WXHA 1ROEA 2D5GA 3AM9A 1VR9A 1WRIA 3I9V1 1FNUA 2QIEB 4MACA 3U2SC 1YNTE 5D7GA 1DGJA 1UNSA 4ZRPA 2WNMA 5JXVA 2NMQA 3TUOA 4LK0M 1C4PA 1P7EA 1LO5D 1QOBA 2RDGA 2WXRA 2NTTA 1N5XA 1C77A 5AUKA 1L5PA 2QSDA 1RM6C 1JCKB 2DWQA 2V0GA 3ZJVA 5MPOA 5D3DA 1ZUD2 3TSSA 3PZ7A 3U52E 4RNAA 1JWMD 1L6UA 1Y56A 1ZXHA 2VZKD 5C2TB 3AE3B 1C4AA 4MT5A 1CQVA 4DXFA 1ZPSA 4GLSC 3SFEB 1WYGA 1K53A 1N63A 4NAMA 2EELA 2ONQA 1CZPA 4Q2JA 1J7BA 4YXDB 4J3OD 1D6EC 4RFBA 3P4RB 1QOGA 4ARCA 4MH8A 4IDIA 4KKIA 1DOYA 1FMAD 2SEBD 4WH4A 4XDCA 2H88B 3PO0A 1TS5A 3IT6B 1FNWA 1SIJA 5BYRA 4UDUC 3GP7A 4C7ZA 4OW0A 3ZYYX 1E7PB 1ZP0B 3L4PA 1ACCA 1JWBD 4IOIE 1XF5L 2CJOA 4HEA1 1JRPA 1GB1A 2E6XA 2L83A 4REZA 2Y3AA 4P16A 1HZ5A 2BBCA 1N60A 4KGSA 2AQ1B 4ZHOA 3BVGA 1ZDXA 3KQ4A 1SBBB 2N9KA 4YSZB 1YQ3B 1B9RA 1BMLC 1OQQA 3E56A 3AE6B 3V3XA 3MFGA 1JROA 2M56B 2KQ4X 5LNK1 1NYRA 1AW7A 1FCCC 1C76A 1VRAB 1WXQA 3FILB 2K5PA 1XLPA 4KX6B 3HVZA 2KACA 3TEXA 1XO3A 4YWGG 1NENB 4OZCA 3VRBB 3SR6A 5G5GA 1BUIC 5FKAC 3R2TA 4ARIA 4M0WA 1XLOA 3AE2B 1L0VB 1QOFA 1SE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AMZ A;  3FAH A;  2KMM A;  4C7Y A;  2W55 A;  4YSY B;  1JQ4 A;  4WQM A;  4ZOH C;  3AEG B;  2PKO A;  3AE8 B;  2PVO D;  2BT6 A;  1WGK A;  3FC4 A;  1FM0 D;  1R7S A;  1FFU A;  1J7C A;  1N61 A;  1KRH A;  3VR9 B;  1CJE A;  1FXI A;  3W9C B;  1YJJ A;  3VR8 B;  2JX5 A;  3CWI A;  1KFY B;  5G5H A;  2Q5W D;  1E0Z A;  2LEK A;  1JW9 D;  3CIR B;  4USA A;  2WU5 B;  3AEC B;  2WP9 B;  1FO4 A;  3AV8 A;  2PVG C;  3SFD B;  1TKG A;  3P4P B;  2ACZ B;  3LB8 C;  1ROE A;  1TKE A;  2H89 B;  1OFF A;  3AM9 A;  1YQ4 B;  1VDV A;  1WRI A;  2FBW B;  3AE7 B;  4HRS A;  5C3J B;  1QOF A;  2QIE B;  2BS3 B;  3B2F A;  5EE9 A;  5EE1 A;  3NVW A;  1FFV A;  1DGJ A;  2G1E A;  3AEF B;  2MJ3 A;  2W3S A;  3NRZ A;  2WDQ B;  1RWS A;  3P1M A;  1QF6 A;  1NI3 A;  3NS1 A;  1DOX A;  1FRD A;  3P4Q B;  1QOB A;  5H92 C;  3HRD D;  1V8C A;  4N6E B;  1N5X A;  2K22 A;  3HUI A;  5AUK A;  1L5P A;  1J7A A;  2Y5C A;  1YJI A;  1RM6 C;  2DWQ A;  1F0Z A;  3RPF C;  5MPO A;  1TKY A;  1ZUD 2;  2BS4 B;  1V97 A;  3EUB 2;  1RYJ A;  3DWM A;  4C80 A;  2DBY A;  4YTN B;  3AE4 B;  4YTM B;  3AEB B;  1E10 A;  4WWM A;  1QLB B;  3P63 A;  2EKI A;  1L6U A;  3AH7 A;  3AE9 B;  5C2T B;  3AE3 B;  5EE0 A;  3DWG C;  3AEA B;  1N5W A;  2BS2 B;  1ZXI A;  3SFE B;  2WQY B;  1WYG A;  1TYG B;  1N63 A;  2N0S B;  1AYF A;  2WS3 B;  4LTU A;  2M19 A;  1I7H A;  4ZHP A;  1CZP A;  1GPX A;  1VLB A;  2QJL A;  1J7B A;  4YXD B;  2JQR B;  1QOA A;  1QT9 A;  3P4R B;  1QOG A;  3ABV B;  5EE3 A;  4IDI A;  1DOY A;  1FMA D;  3VRA B;  3ETR A;  2H88 B;  3NVV A;  2W54 A;  3PO0 A;  2AX5 A;  2E3T A;  1SIJ A;  1NVI D;  4C7Z A;  4ITK A;  2MH7 A;  1NYQ A;  3LXF A;  3B9J A;  1FIQ A;  1T3Q A;  3AE1 B;  1JWA D;  4JWS C;  1E7P B;  1ZP0 B;  3L4P A;  5H8Y E;  1JWB D;  4JX1 C;  1XLQ A;  2CJO A;  1EWY C;  1JRP A;  3AN1 A;  2WU2 B;  4FXC A;  2L83 A;  3AE5 B;  3KWL A;  3AEE B;  2CJN A;  3W5U B;  1FRR A;  2L52 A;  5GXG B;  1N60 A;  4P6V F;  4ZHO A;  3NVZ A;  1NEK B;  2WLB A;  2CU3 A;  2B76 B;  1E6E B;  4YSZ B;  4A9A A;  1YQ3 B;  3AB5 A;  1PDX A;  1B9R A;  1L6V A;  4N58 A;  1N62 A;  1WWT A;  2MJD A;  4US9 A;  4US8 A;  1OQQ A;  1TJE A;  2WDV B;  3AE6 B;  3P4S B;  4JWU C;  4N59 A;  1PFD A;  3W5V B;  1UWM A;  3ZYY X;  2KAJ A;  1JRO A;  1E9M A;  1VJK A;  2M56 B;  2WDR B;  1SF0 A;  2K9X A;  1OQR A;  1NYR A;  4HRO A;  3NVY A;  1WXQ A;  4YT0 B;  2MJE A;  2W3R A;  2K5P A;  1XLP A;  4YTP B;  4KX6 B;  3HVZ A;  1XO3 A;  3WCQ A;  1NEN B;  3VRB B;  3SR6 A;  5G5G A;  1FXA A;  3BII D;  1RFK A;  1GAQ B;  3AED B;  1KF6 B;  1ZOY B;  4YSX B;  1JAL A;  1A70 A;  1XLO A;  2HTM E;  3AE2 B;  5AUI A;  2OHF A;  1AWD A;  1L0V B;  1XLN A;  1PUT A;  3B2G A;  1IUE A;  1SB3 C;  2PIA A;  1DOI A; 
#chains in the Genus database with same CATH topology
 3FAH A;  4NLB A;  3ZI4 A;  2LXA A;  3RBD A;  3DHH C;  4NL9 A;  3GU3 A;  2FJ6 A;  1D5X C;  5AIA A;  2CR5 A;  3LYS A;  4HPL B;  3G6Y A;  4DOA A;  2AGQ A;  5CA7 A;  4G50 A;  3OAW A;  2Y0S F;  2AGO A;  4R63 A;  3N28 A;  7ICJ A;  1FO4 A;  3AEC B;  4OZB A;  3H8M A;  1TKG A;  4IQW A;  4P7I A;  9ICS A;  2NPT B;  1VDV A;  4Y2X A;  4O1N A;  5HI1 A;  5J2K A;  3SYZ A;  5J2C A;  8ICT A;  1D5M C;  5EE1 A;  3C0R B;  1BPZ A;  1XSN A;  2PMZ F;  3KZI U;  1DOQ A;  4F91 B;  3UQ2 A;  3AEF B;  3IXS A;  2RPV A;  4FBU A;  3A0B U;  3GIK A;  2DAJ A;  5KFN A;  3QU7 A;  4ECQ A;  4DL6 A;  3P4Q B;  4GIB A;  5KFX A;  2HOF A;  1V8C A;  2FDR A;  3TAN A;  1D9D A;  2YEP F;  3DBL I;  4PT5 A;  4MFA A;  5J17 A;  3AE4 B;  2R8G A;  2JSV X;  4PGX A;  2ZXH A;  4PGY A;  4TQ1 A;  3DBR B;  3SV3 A;  1IGC A;  4AQ7 A;  1YN3 A;  3EPI A;  3DEE A;  2Z0E B;  4IWO A;  2JRH A;  2LAS A;  2XCP A;  2JQR B;  1YD8 U;  2JEJ A;  2W9N A;  4QWC A;  2JRZ A;  1KJT A;  5J2D A;  3MFI A;  3KD3 A;  1ZQG A;  3ETL A;  7ICG A;  4HPM B;  3ZNG C;  3RB6 A;  1IG6 A;  1WXM A;  3A4R A;  3UI3 A;  2RDJ A;  4ICV A;  3AU5 A;  3PX6 A;  5L1J A;  1QSY A;  3QWZ B;  1UEL A;  2KTF A;  4JWS C;  4NQL B;  1B4F A;  4JX1 C;  2B0C A;  2O6V D;  4UB4 A;  2BDP A;  8ICQ A;  9ICG A;  4DQI A;  2DKZ A;  4QW8 A;  3DHG C;  1KH0 A;  3RB3 A;  1T8E A;  1AAR A;  4DWI A;  2KWV B;  4IQU A;  1ZQL A;  4TUP A;  2B76 B;  1ZQN A;  3N7R C;  4WAF A;  1P7D A;  2AJQ A;  1N62 A;  5AZF A;  4PS7 A;  2B21 A;  1J2N A;  2HBM A;  4P0Q A;  2D11 A;  5KL1 B;  3QEA Z;  1UUP A;  2K9X A;  1HEZ E;  2V3N A;  2WXI A;  3DCG A;  3BK1 A;  2DNF A;  2L3Z A;  3VTV A;  2YML A;  5AK5 A;  9ICN A;  3OLM D;  5AKG A;  4EYI B;  1L3V A;  2QEJ C;  4ED8 A;  1RFK A;  3AED B;  1TAM A;  3C5G A;  4DL5 A;  3T3N A;  2JZP A;  4MGI E;  4LVS A;  2FPL A;  1NK6 A;  3V6E B;  1QSL A;  2IO1 B;  4C7Y A;  2ZCB A;  1ZD5 A;  4DSL A;  4I2E A;  1OXJ A;  2WGS A;  1X66 A;  2FNJ B;  2NBU A;  3QC8 B;  1JRU A;  4HDO A;  2JYE A;  1IPG A;  3UXP A;  4W9K A;  3F53 A;  4XE0 A;  4JQW C;  1L2N A;  1MSW D;  2M9N A;  2QMT A;  4USA A;  3F2D A;  2KP7 A;  5BOL A;  5L1L A;  1S9F A;  2F1H A;  7ICN A;  2ASL A;  4O3S A;  3CSF A;  5ALX A;  2OCE A;  5C3J B;  2LRU A;  4NAW B;  4XDD A;  3NAS A;  4J9L A;  3O65 B;  3VTU A;  2HVI A;  1HUZ A;  2MJ3 A;  2WXM A;  3K1Z A;  2I1J A;  2ZJA A;  2WDQ B;  4KLG A;  1NDD A;  3QX1 A;  5BO4 B;  2LWP A;  1EO6 A;  2KMA A;  5IOI A;  3ZDE A;  2AGP A;  4QAY A;  3RCZ A;  2GB1 A;  1DOX A;  3GV5 B;  8ICI A;  4JGH B;  3PO5 A;  4CF5 A;  2MWS B;  2IOH A;  4C8M A;  2Y5P A;  3RPF C;  2BB6 A;  3Q8A A;  4WIP A;  4KIK B;  2Z7J A;  5J0X A;  2KHW B;  2VA2 A;  3IP4 B;  1QLB B;  4M2Y A;  3PZD A;  4RT3 A;  3M1Y A;  2KOX A;  2R61 A;  1CEZ A;  3P63 A;  2AQ2 B;  3TFR A;  1ZOL A;  2AL6 A;  2RR9 A;  1GNU A;  2MSE D;  2IHN A;  1FCL A;  5EE0 A;  2UWQ A;  3C2L A;  2L05 A;  4DSE A;  3X23 A;  3UF8 A;  4KLF A;  1I7H A;  2XY5 A;  3D2S A;  5IAA C;  3N4M B;  3PST A;  3UIO B;  4ZHP A;  3B0Y A;  1QLN A;  5C1Z A;  2IHM A;  1PVR A;  1IBX B;  4JMU A;  1A76 A;  4ECW A;  3N1X C;  2YY6 A;  3E2E A;  3TAQ A;  1S0M A;  2BWE S;  1MG8 A;  4RGM A;  3WAL A;  3ZDB A;  4MFC A;  3UGB B;  5ALW A;  3W2D A;  4QZG A;  1WM2 A;  3MHS D;  1TAU A;  4G0N B;  4PHP A;  2Z0D B;  5ALK A;  5L83 A;  1XLQ A;  3WKA A;  2O2V B;  3EFU A;  9ICV A;  4KLH A;  3VH3 B;  1F2R C;  2W04 A;  1I4P A;  1GB4 A;  3UXN A;  4AP4 C;  2JZZ A;  3WA0 A;  5AM5 A;  3LDA A;  3IVF A;  4FFD A;  2INN E;  3NS8 A;  4F72 A;  4F5P A;  3QJZ A;  1AN8 A;  3BK2 A;  4KZC A;  1K5O A;  3ICX A;  2KZM A;  1L6V A;  2MJD A;  1ZDV A;  9ICO A;  4KGT A;  4PL1 A;  5KFF A;  1C78 A;  4YR3 A;  1GUA B;  3MTN B;  1L5U A;  1WXA A;  4QZI A;  1FD6 A;  3RT3 B;  3H9D A;  3VAW A;  3NVY A;  2GBJ A;  4UAR A;  4NL9 C;  1OUQ A;  3M9M B;  4J9R A;  4TUS A;  4DSJ A;  2ZUC A;  8ICL A;  7ICE A;  4Z6E A;  2MX2 A;  4W9E A;  5E6P A;  3MR5 A;  8ICU A;  7ICH A;  4HAI A;  1EXN A;  2A1A A;  4NZL B;  1WM3 A;  2PE9 A;  3B2G A;  1L7P A;  2LVO A;  4L2Y A;  4JLC A;  2K4E A;  4EBE A;  2PEA A;  5DG9 A;  5JZE B;  1JWU D;  3PLV A;  4DDI D;  2N1V A;  5AKJ A;  1O03 A;  1ENF A;  1PQS A;  1FFU A;  2I5H A;  4RQ6 A;  4TQ0 A;  1CI4 A;  1N61 A;  3OTQ A;  3BDP A;  1Z3E B;  3GQC A;  3N3K B;  2IPK D;  2LJI A;  2M17 A;  4K4I A;  5I4D A;  1KFY B;  4O3Q A;  3UMC A;  2KTQ A;  5E6J A;  3CIR B;  3JW0 X;  3HP6 A;  1WIA A;  4UB2 A;  3P4P B;  2C2D A;  3VC8 A;  2BPS A;  5TZV A;  3TAR A;  3N97 B;  2H89 B;  4I2A A;  3RUL A;  1V80 A;  3GFK B;  4P4P A;  4EOY A;  1ZQQ A;  7ICP A;  2BS3 B;  1HQR D;  5EE9 A;  4P0P A;  3B2F A;  3RNC C;  2KD1 A;  2GBR A;  2OM6 A;  4B0M A;  1L4Z B;  2DL0 A;  5L1M A;  2ZCC A;  4UAV A;  3URY A;  2KKV A;  4ECY A;  5CWR A;  3GB1 A;  2M0X A;  2JH1 A;  1NI3 A;  4OVV A;  2R2O A;  5H92 C;  5J0Q A;  1ZW7 A;  1AQ6 A;  1TY2 A;  5BYQ A;  5CP2 A;  4GXI A;  1X42 A;  1A5R A;  2KMC A;  3OPX A;  4WWP A;  2PE6 B;  4QZH A;  5KHO A;  3QNM A;  5KL8 B;  3RTV A;  1RYJ A;  4C80 A;  4FZM A;  2D3D A;  3WKC A;  1E10 A;  5DKW A;  9ICC A;  1T0R C;  1CUK A;  4FBT A;  4DK5 A;  2H3Q A;  4A8X C;  3KWV A;  4F93 B;  2V9W A;  1Z4O A;  1H38 A;  2AQ3 B;  5L9X A;  3G6V A;  2LUE A;  3DBH I;  4NLK A;  3PSI A;  3RJH A;  1JWS D;  1YX5 B;  1EU3 A;  1RQN A;  1S0V A;  2HHU A;  4F5O A;  1P9D U;  1V9J A;  3T5K A;  1WMH B;  1KKX A;  4LNO A;  3PZP A;  2JZB A;  3ETR A;  4ICA A;  1UZX B;  4J9O A;  2VZK B;  2KK0 A;  3H7S A;  1NVI D;  2KTR A;  8ICC A;  9ICQ A;  1ZD3 A;  7ICI A;  3U7D A;  1YMH E;  3EW9 A;  4M04 A;  3VXW A;  4URK A;  2KJ6 A;  2ESE A;  1RPL A;  3W5U B;  5J0R A;  2UVV A;  1V1P A;  3PW4 A;  5GXG B;  3ZUN A;  2LGD A;  1IIP A;  1K52 A;  4MFF A;  2JF5 A;  2KAN A;  2WX1 A;  3RRH A;  3PML A;  1UA1 A;  1WWT A;  4BX9 C;  3ZDT A;  3UQA A;  2RLT A;  5KT6 A;  2WDR B;  3RUI B;  2KDI A;  3U7Z A;  2DEN B;  3DDH A;  4Q43 A;  4I2G A;  4YT0 B;  3SAF A;  4ELU A;  2ZIU B;  4RT2 A;  2HSZ A;  1HTQ A;  1WX8 A;  1WFY A;  3MFH A;  4WJN A;  5DPT A;  3H0R B;  4YSX B;  1KLG D;  1A70 A;  2LFI A;  2PFP A;  4ANU A;  3Q14 C;  2WB1 F;  4RPY A;  2ASJ A;  1PK1 B;  3RAQ A;  3PRZ A;  4EEL A;  3PO4 A;  4LZD A;  2JEI A;  4RM8 A;  4IQV A;  3KUD B;  4CNQ A;  1R7S A;  3ZW3 A;  4KGR A;  1BPD A;  1LB2 B;  2IGG A;  1S8O A;  4HVB A;  2KMD A;  2ZIW A;  5G5H A;  5L1K A;  1TE2 A;  3WU2 U;  2CU1 A;  2G4S A;  2LHT A;  3H0L B;  2ZZP B;  2XK5 A;  3J9C A;  2KVZ A;  3M62 B;  1NKE A;  4K7W A;  5LXH A;  2WXH A;  3T5J A;  1XC9 A;  2LGX A;  3ENE A;  3KYD D;  4MGZ E;  3RZW C;  4J6I A;  2PKE A;  2E8P A;  3AM9 A;  5ALM A;  1WRI A;  3I9V 1;  1X9W A;  2OWO A;  5J18 A;  4AP9 A;  2QC8 A;  3U2S C;  1YNT E;  3GZN B;  3SEN A;  2KLG A;  5KG3 A;  5JH5 C;  4FUL A;  2JY6 A;  2JWZ A;  4Q8E A;  2FCQ A;  5HP4 A;  4KDI C;  4O0I A;  1SL1 A;  1T0Q C;  1YT3 A;  4FS1 A;  2E8O A;  3MDC A;  4KLU A;  4UW9 A;  2WXR A;  8ICR A;  1C77 A;  4M9J A;  4W9I A;  5HHH A;  1LV5 A;  2V0G A;  4RNO A;  2I1K A;  4Y2P A;  3U30 A;  4ECR A;  5CJ7 A;  3QU2 A;  5DG7 A;  1ZKH A;  3PZ7 A;  4MF8 A;  4CF3 A;  1J8C A;  2WF7 A;  1V5O A;  1F0M A;  1Y56 A;  1ZXH A;  2VZK D;  3APF A;  3UIN B;  3AE3 B;  1C4A A;  4GGQ A;  3H8S A;  2AHO B;  3QA8 A;  4W9L A;  2KVC A;  2ODG A;  1WYG A;  2KZ3 A;  1TT5 B;  3SU8 X;  1V9P A;  2XID A;  2ZIX B;  3L17 A;  1E8X A;  3NZU A;  4BFR A;  4MH8 A;  4BVU C;  4QIW C;  4QZA A;  4QZD A;  1L3U A;  1EF5 A;  3PO0 A;  4JB3 A;  5DB9 A;  2D3G A;  5KHQ A;  5BYR A;  3HIZ A;  3EWA A;  2L5Y A;  1UHU A;  3ZO5 B;  4EZK A;  2MHJ A;  3L08 A;  4UAY A;  1E90 A;  4YG2 A;  2AQ4 A;  3OJ4 B;  4IOI E;  4OCZ A;  4DSI A;  1JRP A;  2OJW A;  4RNN A;  1E7V A;  1WH3 A;  1ZQI A;  4DL7 A;  3SHQ A;  1SL0 A;  4DF4 A;  8ICH A;  1KFD A;  2K4P A;  2XCA A;  4NJ8 A;  3I3T B;  3GIM A;  4W9H A;  1ZDX A;  4ZHO A;  1SBB B;  4YSZ B;  9ICK A;  2HE7 A;  1YQ3 B;  1BML C;  1OQQ A;  8ICP A;  1LKY A;  2KSO B;  4M01 A;  4ANV A;  3MFG A;  5CEH A;  2M56 B;  8ICB A;  1ZD4 A;  2D6F C;  1L8L A;  2NO4 A;  1VRA B;  3C28 A;  3CMM B;  2MA1 A;  1XO1 A;  4YVZ A;  3FIL B;  5IP4 D;  2HW3 A;  3HHM A;  3VRB B;  3SR6 A;  3WK4 A;  2L76 A;  1JI7 A;  2K39 A;  3R2T A;  4PS8 A;  3H40 A;  4M0W A;  1XLO A;  3AE2 B;  3WK5 A;  4DFD A;  4BXO A;  1NK7 A;  1SE2 A;  3K9O B;  5JRT A;  2R8K A;  5H2F U;  3PR5 B;  4KLM A;  2OOB B;  1N48 A;  2KVS A;  4BDP A;  4FBJ B;  1GG3 A;  4ECU A;  3C23 A;  4QZ8 A;  1KRH A;  1E5W A;  3BS5 B;  3E0F A;  2Z59 B;  1RG6 A;  3Q8L A;  2J6T A;  4H2A A;  1Z00 A;  2KE7 A;  4I2H A;  1Y88 A;  3L0W B;  5KFJ A;  1LM8 B;  4XYC A;  3A4S C;  3T5L A;  2L00 B;  2MW5 A;  4KLD A;  4LNN A;  2JR5 A;  3ISB A;  2K4H A;  5AI8 A;  3JPO A;  3QE9 Y;  5KFY A;  1BVS A;  2MP2 A;  3IDW A;  5T8I A;  1X9X A;  4AYB F;  3PS6 A;  3DVN V;  4AUQ C;  4XZ4 A;  2G1E A;  4G3X B;  1XT9 B;  2JXJ A;  3P1M A;  1NK4 A;  2KK8 A;  1NJZ A;  3PSP A;  2JVC A;  2RHF A;  3HRD D;  3KHH A;  5AI9 A;  2NTS A;  4RQ5 A;  3HIL A;  1JN3 A;  4OJ5 A;  2X38 A;  3SMV A;  1NNL A;  2GI9 A;  5IIO A;  2EKI A;  1X6I A;  3JPS A;  5AKK A;  2JHD A;  1U48 A;  2WAQ C;  4FZL A;  1I35 A;  2P35 A;  2EQY A;  2KN7 A;  3DWG C;  2RD0 A;  1N5W A;  1S10 A;  1BPX A;  1BNO A;  2NS5 A;  1HEK A;  4EYH B;  2KYW A;  2ALZ A;  1TYG B;  1SJH D;  2N0S B;  5BOM A;  4B6J A;  4YCX A;  4YP3 A;  5AI4 A;  3TAC B;  3SV4 A;  2IND C;  1TK8 A;  4M8N A;  1SV4 A;  2J42 A;  5DG8 A;  2RMM A;  2FLP A;  3VRA B;  4YXJ A;  4YD2 A;  4EZ6 A;  2TSS A;  1NJY A;  5ALT A;  1HUO A;  4B9L A;  1ZD2 P;  4KIT B;  1ZJM A;  1F44 A;  1YOV B;  3M6K A;  1TZO A;  2KZZ A;  2Y0S C;  1TVA A;  2INC C;  4BBN C;  5ALO A;  1YJ1 A;  2BCV A;  2DYM A;  3AE1 B;  4WAA A;  2IMW P;  2ISP A;  5HR7 A;  2LYB A;  3ALR A;  3BJY A;  3GS2 A;  4K7S A;  3NJT A;  1FNV A;  4DS4 A;  5EDS A;  2ZIV B;  4B9T A;  1H4R A;  5J2R A;  3EA6 A;  2BCS A;  1Q10 A;  4NLC A;  2VH1 A;  2MRP A;  2ASD A;  2PMZ C;  1N6Z A;  3DDC B;  3IM1 A;  3AB5 A;  1UGM A;  2FCN A;  1WGY A;  1KSP A;  2KT7 A;  9ICF A;  2HBL A;  2EAN A;  4O3R A;  9ICL A;  3Q8C A;  4PK1 A;  2AH5 A;  3PRP B;  4ED1 A;  2I38 A;  1BT0 A;  3ALB A;  2MU2 A;  2BQQ A;  1SGG A;  2W9C B;  3Q8K A;  4EBC A;  4IR9 A;  5AEK B;  1SV0 A;  4YTP B;  4IS7 A;  5KFH A;  2W9B A;  1FXA A;  5AK4 A;  3V05 A;  2J6S A;  1XCT L;  3SAH A;  3H6N A;  2G5I B;  1VZ8 A;  1UH6 A;  5E6N A;  2OEH A;  1D8Y A;  4F3O A;  2KMM A;  4N9F 4;  2K3U A;  3VUY A;  4ZOH C;  4UBC A;  2WXN A;  4CO7 A;  4DEZ A;  2V9H A;  1HA5 A;  1T94 A;  2K8H A;  4KV2 A;  3RR7 A;  5KG2 A;  9ICT A;  4A90 A;  1KQQ A;  2FPK A;  3QYP A;  1L7M A;  3TMP B;  5AKE A;  3W9C B;  1I4R A;  3Q2A C;  5B66 U;  2V4I B;  2K8C B;  2LEK A;  8ICE A;  1U45 A;  2C9W B;  5G55 A;  2ACZ B;  3OSN A;  3JPP A;  2WDT B;  4O5K A;  1T7P A;  3BZD B;  1ZQB A;  4RQ7 A;  1TKE A;  3K75 D;  3EFC A;  4F1S A;  3GE3 C;  2KJ5 A;  2H3Z A;  2R8H A;  3S6J A;  4IRD A;  3ZQ4 A;  2AU0 A;  3L16 A;  4Y2Q A;  3NRW A;  8ICO A;  3GV8 B;  1ECW A;  3NS1 A;  4NJ6 A;  2N1W A;  2F77 X;  3AL0 B;  8ICN A;  1KLU D;  1WJ4 A;  2BYF A;  4BKG A;  1HJP A;  2QDF A;  1D8L A;  5J2A A;  1WYW B;  2A5U A;  4YTM B;  2HI0 A;  4I28 A;  1RYU A;  3V6C B;  3TEZ A;  1WG8 A;  3KHR A;  3C5F A;  4F4Y A;  4F2S A;  2WFA A;  4NPN A;  4AS1 A;  1ZQY A;  1EM7 A;  2H5X A;  3GII A;  5L95 C;  3ZD9 A;  1TV9 A;  3MR2 A;  4J9Q A;  1KTK A;  2YMQ A;  1SXT A;  3AEA B;  1EWC A;  1PGX A;  3EC8 A;  5HG2 A;  2E8N A;  5AKH A;  1Q46 A;  5ALL A;  1PK3 A;  1QOA A;  2E1F A;  4M8M A;  5EE3 A;  4DLE A;  2KXJ A;  1VZ6 A;  5AI0 A;  4ECX A;  3TI0 A;  4E3C A;  1TY0 A;  5DLG A;  2IO0 B;  3Q3O C;  3R2I A;  4OHJ A;  3GZF A;  2MBE A;  4UAW A;  3RAX A;  1L0X B;  2GLS A;  1STE A;  3D2Q A;  3AQF A;  3KHG A;  3H8W A;  4KZ0 A;  4JK1 A;  3B9J A;  5IIL A;  4QWD A;  4NY0 A;  9ICR A;  5KFA A;  3E58 A;  4YL8 A;  3PR4 A;  3QHT A;  2HMX A;  4CGZ A;  2CJN A;  2ON8 A;  3PZ8 A;  1U9L A;  2L52 A;  2WF9 A;  1QSS A;  4PHE A;  3NVZ A;  2PTL A;  2G0A A;  5AK3 A;  2ZW0 A;  4IM2 A;  4GMV A;  3OG5 A;  4JE3 B;  5IIN A;  1U4A A;  2WXG A;  3PSE B;  2A1J A;  3RH5 A;  4US9 A;  3IT4 B;  4MJS A;  3Q8E A;  4RQ2 A;  2D3C A;  2HHW A;  1VJK A;  2PXI A;  2D07 B;  2JH7 A;  2W9M A;  4XWW A;  4KLJ A;  4HRO A;  2MUT A;  3GZN I;  2W3R A;  5HHD G;  2LPE A;  7ICR A;  5ALY A;  3JYU A;  3N32 A;  5DPS A;  5AM2 A;  3MDA A;  5BMH A;  2NO5 A;  2QAR A;  5KFK A;  2ZNV C;  4RQ0 A;  1JAL A;  1WJU A;  4I29 A;  1DGS A;  1URJ A;  4Y2V A;  1Y8R C;  2WP9 B;  1L6N A;  1RAX A;  1TKD A;  1OTR B;  4YN4 A;  2VA3 A;  2G4D B;  1IM4 A;  5DQI A;  4NWI A;  2RDB C;  3MGH A;  1J7C A;  2KV2 A;  4ELT A;  3B0X A;  5AI5 A;  2MBQ A;  2ZXI A;  5IIJ A;  2ZTC A;  4TQS A;  2KWU B;  3L10 B;  1HE8 A;  2LGY A;  3MJ5 A;  1E0Z A;  3LVW A;  3M63 B;  2MAX A;  5J29 A;  4KLL A;  3V6K A;  4IUM B;  2IJ0 A;  3ZVV A;  1T0Y A;  2KJR A;  4RPX A;  4Z6F A;  4IWQ A;  4M6W A;  2L0F A;  1WJ6 A;  1ET9 A;  4TSS A;  3SD7 A;  4I27 A;  2KZR A;  5ALV A;  4JWN A;  3M9O B;  3NRZ A;  4ZRK A;  5EWF A;  3H8H A;  1B1Z A;  1CK1 A;  4MEY A;  3M8S A;  1RDF A;  2KWD A;  1MHH E;  2Y9U A;  1KBU A;  2AL3 A;  4K81 A;  2MA9 B;  2QKQ A;  3H8J A;  2DAF A;  2L32 A;  2JUO A;  8ICF A;  1CMX B;  3TEW A;  2HOI A;  4BKS D;  5D49 A;  1UT8 A;  4NJC A;  5ALS A;  3D32 A;  2KIW A;  2BPF A;  3C21 A;  4ED3 A;  2WXK A;  2BTE A;  1Q8K A;  5TIS U;  2WQY B;  4LNI A;  4LTU A;  3H0M B;  1AYF A;  2M19 A;  4XC2 A;  2MLB A;  4KVG B;  2QJL A;  2EDU A;  2UVR A;  1RRB A;  4J9K A;  3BZC A;  2I2Y A;  3H7P B;  4NJ7 A;  4XWT A;  3ZIM A;  1WR1 A;  3BS7 A;  5KAF U;  3SAG A;  4KTQ A;  3W1S A;  3ML9 A;  7ICS A;  4QZC A;  4WQO B;  4L1B A;  3QX7 A;  2W54 A;  2KNB A;  4B95 A;  3NHE B;  2HHQ A;  4RQ3 A;  2LI5 A;  4XX5 A;  3ZNI D;  4ACF A;  4EEK A;  3RH6 A;  4HLE A;  4C0Z A;  2W11 A;  2HDE A;  4ED0 A;  4RPZ A;  4DS5 A;  2BZF A;  3UIP B;  4ELV A;  4DDG D;  5JTI A;  4ECZ A;  2BWF A;  1WGH A;  2ZEQ A;  3RH4 A;  5BMI A;  2F8L A;  4RQN A;  3EGR A;  4QJF B;  3H4B A;  2XEW A;  1UCV A;  4M9H A;  1SE4 A;  1TK5 A;  2F2A B;  4I2D A;  1SV0 C;  2FAZ A;  4P6V F;  4J9M A;  4X57 B;  3RNA C;  4UBB A;  1E6E B;  3ZRF A;  4A9A A;  4AJY B;  4KLO A;  1WX9 A;  4N58 A;  5J0P A;  3WKE A;  4UB3 A;  5D4B A;  8ICJ A;  5ALN A;  3IAM 1;  1MC8 A;  2N7J A;  1S5L U;  2PLP A;  2IOF A;  1SWW A;  3NTU A;  5ALH A;  2NR2 A;  1QQ6 A;  7ICU A;  1D3Z A;  3V62 A;  2MJE A;  1WE7 A;  4RM9 A;  1Z19 A;  3ZLZ A;  1NZP A;  2LM1 A;  3M8R A;  3TQ1 A;  4NNJ B;  4UB6 U;  1L4D B;  3S2A A;  4CE6 A;  5JUM A;  3AU6 A;  1TS4 A;  5KG0 A;  1GAQ B;  3UPQ A;  4F4X A;  2O2V A;  1ZOY B;  4DOC A;  8ICA A;  4R3D A;  3VH4 B;  2KIC A;  4DCC A;  1DOI A;  2KFK A;  1SJE D;  5ALU A;  1JQ4 A;  2ZUD A;  1KLN A;  3PY8 A;  4R64 A;  2PKO A;  3HPO A;  1RZT A;  1F77 A;  4QZE A;  3CRX A;  1SE9 A;  4NV0 A;  4ECV A;  3MJW A;  4PYZ A;  3O0F A;  4XQ8 A;  2BYT A;  4QW9 A;  4NM1 A;  1K1Q A;  4FN2 A;  2D8C A;  4F5Q A;  4K7U A;  4DL3 A;  1Q3U A;  2ASQ A;  2DQN B;  1V81 A;  3A1Q A;  3AV8 A;  5AM4 A;  3SFD B;  2PFO A;  4NLN A;  4GB9 A;  3PRM B;  5ALE A;  1ROE A;  2D5G A;  5TR5 A;  8ICV A;  1VR9 A;  2KO3 A;  3BQ7 A;  5KFZ A;  1SKS A;  3ZNH B;  4MAC A;  1B43 A;  2CN1 A;  2NV3 A;  1EUV B;  1DGJ A;  2CPR A;  1UNS A;  4QZF A;  1X9M A;  1S76 D;  3VHT C;  7ICM A;  2C2R A;  7ICT A;  2NMQ A;  2FLL A;  3TUO A;  2MRL A;  1LO5 D;  1YIW A;  2J7Q B;  4JV2 A;  4C8K A;  2RDG A;  3T3F A;  2BCR A;  5AUK A;  2KQ7 A;  3A33 B;  4XGA B;  2KX0 A;  4XA5 A;  4K4H A;  2H3V A;  2FIF A;  3TSS A;  4R8U A;  2EZX A;  2VAN A;  3AQE A;  5KT7 A;  4HCN B;  2G07 A;  5C0Y A;  2Q0Z X;  1DRG A;  3J81 j;  4MEM A;  1K53 A;  4OD0 A;  2EEL A;  2ONQ A;  1KTQ A;  3Q8Q B;  1CZP A;  3WK9 A;  4YXD B;  4Y2Y A;  4MH0 E;  4PJ0 U;  4I2C A;  4C8L A;  1EF1 A;  3PW5 A;  3CP8 A;  4IDI A;  4KKI A;  5E6O A;  1XU4 A;  2IBI B;  2SEB D;  2FID A;  4WH4 A;  4OJ6 A;  3OGU A;  4XDC A;  1TS5 A;  2K8B A;  3IT6 B;  3RNE C;  4GSW A;  4TV3 A;  4EX6 A;  3RFA A;  3GP7 A;  1WXV A;  4LJX A;  5CTR C;  1KOT A;  3Q3F A;  4MF2 A;  2XY7 A;  1ZQJ A;  1GB1 A;  4F50 A;  4HEA 1;  2KJ8 A;  5AIC A;  3JPQ A;  3T5H A;  4P0P B;  3ZXR A;  2Y3A A;  4DHZ B;  2REX A;  3B1L X;  1HZ5 A;  2G3Q B;  2ISO A;  1N60 A;  7ICO A;  2GLE A;  2AQ1 B;  2JGA A;  3KQ4 A;  1WWV A;  5ALG A;  3RNF C;  3JSV A;  1B9R A;  4UAT A;  2IYD B;  3E56 A;  3MGI A;  1PVP A;  2N7D A;  3BIN A;  4KLI A;  4O5C A;  3C19 A;  1B0X A;  1KN5 A;  2E8M A;  4C8N A;  1FCC C;  1WZ0 A;  4O9M A;  1WXQ A;  4LNK A;  4ZRI A;  4FO6 A;  1XLP A;  3RB4 A;  2KHQ A;  2BPC A;  4BKT A;  1NEN B;  4OZC A;  1KW4 A;  5FKA C;  2E1E A;  2K25 A;  4JV1 A;  4P1C C;  4Y2S A;  2LI6 A;  1F2R I;  1L0V B;  1QOF A;  3LK9 A;  3VCB A;  2W55 A;  2LHE A;  4WQM A;  2QB1 A;  3V7J A;  2PVO D;  3VUW A;  3RNG C;  1R4N B;  9ICW A;  1WGK A;  2WXP A;  3QXG A;  2JZB B;  1PZN A;  3GDX A;  3N9Y C;  3VR8 B;  3OJS A;  2GOL A;  2KTR B;  5IKC M;  4YMN A;  4KLS A;  4C4R A;  8ICY A;  2J0J A;  2KC2 A;  3AU2 A;  4EKU A;  3N20 C;  3EPG A;  2F44 A;  5J2B A;  2D3A A;  3HM6 X;  1V1P B;  2YB4 A;  3QUC A;  3OHB A;  1B22 A;  3AXC A;  3WKD A;  1T4G A;  5KG6 A;  4QWE A;  3PV1 A;  2KDB A;  3T9L A;  2FUG 1;  1GOZ A;  2Y5B B;  4I2F A;  2J53 A;  3AI5 A;  5A0L A;  5KG7 A;  3PPA A;  4GDL A;  2L1A A;  3QK0 A;  4IR1 A;  1DK3 A;  5FR3 A;  3H7I A;  3NZS A;  2C7H A;  5DCN A;  1Z5S B;  4IWP A;  3DBR I;  5ALI A;  4UB1 A;  4MHV A;  2CHW A;  2V4Q A;  5ALR A;  1TKY A;  1SL2 A;  1VZ7 A;  3KUC B;  4RH6 A;  3VFK A;  2DUY A;  1X40 A;  3W1S C;  1T6B X;  3DBL B;  1MN8 A;  3O13 A;  5FP0 A;  1C9F A;  3HKZ F;  3CF6 E;  1VD2 A;  2JXT A;  4PS3 A;  2NRX A;  1PYW D;  2BS2 B;  2KDM A;  2YEP B;  2ZVO A;  1WF9 A;  3OSP A;  4BOZ B;  1NOM A;  2BVC A;  2HHS A;  2AWT A;  3QU4 A;  3FDS A;  3TFS A;  2WTF A;  1DXS A;  4DQP A;  8ICZ A;  2ZIW B;  4UAZ A;  1X1M A;  2BCU A;  4J9P A;  4CQN A;  5F9L A;  2XK5 B;  3DVN U;  4A3O A;  4EZJ A;  1SXE A;  2IO3 B;  1ET6 A;  2WYQ A;  2YB1 A;  3QZ8 A;  3LXF A;  4C4T A;  5KFS A;  5KFV A;  3I5J C;  1U4B A;  5H8Y E;  3VDZ A;  4DXG A;  4HK2 A;  1I4Q A;  5DGB A;  4DXA B;  3AEE B;  2QB0 A;  4RMA A;  2A3V A;  3ONS A;  2KVR A;  2D3B A;  1YZ6 A;  4AYB C;  3PVX A;  1YN5 A;  1SXD A;  4Y2J A;  4MSM B;  2LMC A;  2CS4 A;  3R7R A;  1FXT B;  1ZRM A;  5J0Y A;  4GLX A;  2W03 A;  2ZIX A;  5CHF A;  2OXO A;  2WDV B;  2HDO A;  1HZ6 A;  3GOE A;  5J0S A;  1PFD A;  4J03 A;  3W5V B;  2K60 A;  4I6P A;  2K4I A;  2CRX A;  2E5S A;  1LVH A;  4DFP A;  4F71 A;  4GDK A;  4DHJ B;  1F9J A;  4F8R A;  2RP5 A;  2PW9 A;  4UAU A;  4B0E A;  1GO3 F;  4ECT A;  1S0O A;  4YQW A;  2GWS A;  1LFD A;  1WSP A;  2ICI A;  2XVT A;  2BQU A;  2W9A A;  3ISC A;  1WGG A;  2KLC A;  4IC9 A;  4KSL C;  3C29 A;  3SZ2 A;  4KX3 A;  3NUQ A;  1IUE A;  2PFQ A;  4U7C A;  2ZPN A;  4YSY B;  3F5A A;  3BZK A;  3WAN A;  1U49 A;  2JT4 B;  2CHZ A;  2BT6 A;  1ZQC A;  2NRV A;  1FM0 D;  1SZH A;  9ICJ A;  3PGE A;  2JXX A;  2LUM A;  4HKQ A;  3CWI A;  2K6D B;  5KAI U;  4C4V A;  5AK6 A;  4P1B C;  1NK8 A;  2DYB A;  3UQB A;  5E79 U;  2HHV A;  4NM2 A;  2FUH B;  1PUZ A;  4F92 B;  1IV8 A;  4YFK A;  1SEB D;  1N2X A;  3BVZ A;  5CHG A;  2M0N A;  3RZF A;  2JEG A;  1WGD A;  2KJ9 A;  2GMI C;  4HRS A;  5AM3 A;  1WJN A;  1NJX A;  4J9S A;  4B9V A;  2IGH A;  3BY4 B;  5DLF A;  2WXL A;  2R8J A;  5KFG A;  4DHZ E;  1ZQU A;  3RMK C;  2BW2 A;  2W8K A;  2FCS A;  3FM9 A;  1UBI A;  2L7R A;  1LKY B;  1SIF A;  3AU4 A;  4FLH A;  2HCF A;  1ZE3 D;  1ZQM A;  1HTO A;  2RDI A;  4DL4 A;  2FCM A;  5DBA A;  3NOB A;  4N6E B;  4NLG A;  2N1R A;  3BS5 A;  3OJ3 A;  1D4B A;  2QLT A;  2Y5C A;  4Y2T A;  1F0Z A;  3DPD A;  4MM3 B;  4IL6 U;  2ZTE A;  1V97 A;  2KD0 A;  9ICI A;  5EWE A;  2NRT A;  3Q6B A;  3VUX A;  4ZDV A;  3WKB A;  3R8B A;  4HJK A;  8ICS A;  1SGH A;  1TK0 A;  1ESF A;  1K50 A;  3L54 A;  1K1S A;  1S97 A;  3AH7 A;  4UAS A;  3ZDD A;  4P2H A;  4JPS A;  5CHV C;  1WZ3 A;  2WF6 A;  4BGD A;  2DYO A;  2P6U A;  4KMO B;  4RUA A;  2WS3 B;  4M00 A;  3R66 C;  1A0P A;  2UVU A;  1VLB A;  4ICU A;  1A77 A;  1E8Y A;  4ED6 A;  4II3 B;  1UPH A;  4O3N A;  1L0Y B;  3VVW B;  4CYE A;  4LDT B;  3QIJ A;  2ZNV B;  3U8Z A;  1Z00 B;  2LHD A;  3F5E A;  3JPN A;  1WX7 A;  2C5L C;  4ACO A;  4PHA A;  4DSK A;  5DBB A;  4A3P A;  2NCN A;  1L3S A;  9ICP A;  3CYM A;  1LQB A;  1S3S G;  2J4X A;  2LGI A;  5KFD A;  4ITK A;  4PL2 A;  1BPY A;  1MQ3 A;  4IRC A;  2WXQ A;  2MCN B;  2MP2 B;  2LM4 A;  2XBB C;  4II2 B;  2WU2 B;  9ICB A;  1EWY C;  3ZTC A;  3AN1 A;  1V1O A;  3UMG A;  4KLQ A;  3RRG A;  4TUQ A;  1X9S A;  4RUC A;  1C20 A;  3ZKJ C;  4DHJ D;  3L5K A;  5J0T A;  2K0P A;  4W9G A;  5ALP A;  1Z1B A;  3IRU A;  5AKI A;  3M95 A;  2JRI B;  5C23 A;  1UF0 A;  9ICE A;  5CHW A;  3A9J A;  1QZE A;  2LVQ A;  3DHI C;  2K8A A;  1UD7 A;  5JHA A;  4N59 A;  1WXS A;  2EKE C;  3NY5 A;  2KAJ A;  1E9M A;  3RFZ B;  2VJ4 A;  1UA0 A;  1K51 A;  1OQR A;  2O6K A;  3G6X A;  4EX7 A;  1MVK A;  3HW8 A;  2ES6 A;  2R8I A;  1V85 A;  4AOF A;  1DK2 A;  4CRX A;  1IGD A;  2YTU A;  1JIH A;  5J8Y A;  4BZA A;  3F2C A;  1MHX A;  3THV A;  4XRH A;  2BDU A;  5GTI U;  4L23 A;  4B9K A;  5CR0 A;  3QUQ A;  3RN9 C;  3SI8 A;  2J52 A;  5EWG A;  2N9P C;  2SAK A;  4E71 A;  4WUR A;  4Y2U A;  2VJ5 A;  3HJE A;  1TS3 A;  4NQK E;  3TKA A;  4I6N B;  4LLG M;  5KFL A;  1E8Z A;  4O3M A;  3PW0 A;  1UT5 A;  4HDQ A;  4IRK A;  2DF4 B;  2C28 A;  1P0R A;  2KKP A;  2HJ8 A;  2PI5 A;  2Q5W D;  2BKF A;  1RQL A;  4ASW C;  4DQR A;  8ICG A;  2EZZ A;  4OVU A;  3IHQ B;  4JV0 A;  3GIL A;  1OFF A;  1DYQ A;  3AE7 B;  4KKJ A;  5KT2 A;  3V72 A;  9ICH A;  5KFU A;  4LJO B;  4DFJ A;  4CCH A;  4YR2 A;  2G9H D;  4GC6 A;  4EEN A;  1K8R B;  2LRW A;  3KTQ A;  4M02 A;  3Q3M C;  5IO9 A;  1V49 A;  2W3S A;  4RF1 A;  5J2F A;  4DLG A;  5HHI A;  3M7D A;  5HML A;  2IZV B;  2CKH B;  2WXF A;  2HVH A;  1J0G A;  1D5Z C;  3DVG Y;  3IAS 1;  3WIM A;  1UQV A;  4Y2R A;  3PV8 A;  3A9K A;  2FMQ A;  4QWA A;  3SDL C;  4X5V A;  4Q45 A;  2K8C A;  3HM3 A;  2O6V A;  4DSF A;  2W9B B;  3Q8P B;  1BGX T;  1OGW A;  4QNL A;  2I1Q A;  3I63 C;  3VQI A;  1MG4 A;  4NXZ A;  1D8B A;  2MSN A;  2C7N B;  2MBO A;  3NZ3 A;  3P42 A;  4JIO U;  2GBN A;  3MP9 A;  3M6Z A;  3PVL A;  4EUT A;  2KOB A;  2GRI A;  3RJK A;  3ABV B;  4AJW A;  3HWT A;  3DBH B;  2IBK A;  1MQ2 A;  2J0K A;  5JU5 A;  5KFB A;  3Q3J A;  1L7N A;  1I4H A;  2PPH A;  1QQ5 A;  3UMB A;  3WK8 A;  3JVZ X;  1NBF C;  4DF8 A;  1ISN A;  3N1Z C;  4IW0 A;  2YX8 A;  1RYR A;  1FIQ A;  4D2K A;  2JWU A;  4A20 A;  1FEH A;  4FJY A;  3NG0 A;  2KC1 A;  2F8K A;  5DQG A;  2RGF A;  3N7S C;  5GMV A;  1J97 A;  4PYU A;  4B6W A;  2NPT A;  2OYY A;  2XN9 C;  2V4R A;  1QCK A;  3N1Y C;  3ZJT A;  1I4X A;  2WLB A;  2BHN A;  3C2K A;  2I6X A;  2MBH A;  5J2I A;  3GE8 C;  4CF4 A;  2F1J A;  5AIB A;  4B9N A;  3LWL A;  4JWU C;  1ZQF A;  3PHX B;  4BKS A;  2FE9 A;  1IP9 A;  3KBB A;  1EU4 A;  1SF0 A;  2LVP A;  2IOF K;  4KLE A;  5KNI A;  4BBN F;  2M8S A;  1XXG A;  5B5E U;  2FPM A;  2L0T A;  1ZRN A;  2DZM A;  2J6U A;  3BYT B;  3WCQ A;  4G9B A;  4DL2 A;  3D6J A;  2UVW A;  2G09 A;  3A0H U;  1IYF A;  4TQR A;  2OHF A;  2JEF A;  2DLB A;  4ZYN A;  1P3Q U;  1R4M B;  4CDG A;  1C4C A;  2J0M A;  2XGP A;  1YN4 A;  1FEZ A;  1XD3 B;  3KYC D;  3L13 A;  1JXL A;  2M1M A;  2INP E;  2XO7 A;  2DZI A;  5DQH A;  2N9L A;  3ONN A;  1UBQ A;  2V3P A;  1XWL A;  2G06 A;  3IV6 A;  1WRD B;  1N56 A;  2PVG C;  3KH0 A;  5KG4 A;  2W43 A;  3WAM A;  1UGJ A;  2ZW1 A;  3QZ7 A;  1TBE A;  3PW7 A;  2OJR A;  7ICK A;  1J2M A;  1F52 A;  3KFU F;  4C00 A;  1ZQX A;  5GTH U;  3RD2 A;  4MEX A;  3V6J A;  2QIE B;  4BWJ A;  4JUZ A;  3U26 A;  4DFK A;  5KFT A;  4ZRP A;  3V61 A;  2WNM A;  5JXV A;  4AWJ A;  2A1J B;  4MJS B;  1C4P A;  1P7E A;  2N4F A;  1NK0 A;  2P6R A;  3TAP A;  1QOB A;  4GFJ A;  4O3P A;  1L8O A;  1Z4N A;  5ALD A;  2NTT A;  2MUT B;  1A6S A;  1RM6 C;  3D2N A;  1JCK B;  3IBE A;  3ZJV A;  4MEL A;  5D3D A;  4P4M A;  5IN7 A;  2FMP A;  3R3M A;  4RQ1 A;  2QAR B;  3RR8 A;  5L1I A;  1JWM D;  1L6U A;  3EHV A;  5C2T B;  4WJ3 B;  2NRW A;  4DWF A;  3EZ5 A;  4HXD A;  5T14 A;  1ZPS A;  4DXF A;  4GLS C;  3SFE B;  1I42 A;  3QUB A;  1N63 A;  2HHX A;  4Q2J A;  3M3J A;  1J7B A;  2BYE A;  1V38 A;  2BGW A;  1D6E C;  2YVC A;  4P0Q B;  4ARC A;  2H3F A;  1DOY A;  2JV3 A;  3V7K A;  3ISD A;  2H88 B;  3KUZ A;  1FNW A;  4UDU C;  3V7L A;  3IFW B;  4C7Z A;  4MGK E;  1E7U A;  4F4K A;  3RJI A;  4M6W B;  3MBY A;  1ACC A;  1E7P B;  1JWB D;  1ZP0 B;  1XF5 L;  2CJO A;  2JMG A;  1U47 A;  2L83 A;  2KQS A;  4YD1 A;  5D6J B;  2M4N A;  3RJF A;  1ZQZ A;  2G45 B;  4EFO A;  3F2B A;  4KGS A;  2KWC A;  4NAW A;  3PT2 B;  5KFE A;  3ZDA A;  3ZTD A;  4IM3 A;  3HT3 A;  3RYT A;  4Z6D A;  5J8Y C;  4BOS C;  3M9N B;  2BF8 B;  4YXM A;  3H7P A;  1SKR A;  1F5S A;  2V4L A;  2KQ4 X;  5LNK 1;  1T3N A;  4GOC A;  1WUD A;  1AW7 A;  5DPW A;  5KFI A;  4KN7 A;  5HMM A;  5F3X B;  1XQQ A;  2KAC A;  3HVZ A;  3TEX A;  2PFN A;  1RLF A;  3JPR A;  4ECS A;  3AUO A;  4KIK A;  1BUI C;  3LVV A;  7ICQ A;  2VKQ A;  3EYZ A;  5BMG A;  8ICK A;  4DFM A;  2M0A A;  1SE3 A;  2BKR B;  1XCQ L;  2LD9 A;  3AEV A;  5LXI B;  5AKY A;  4DQO C;  3PHW B;  1JML A;  4JL9 A;  2YN4 A;  1YJJ A;  2JX5 A;  1IBX A;  2ZPY A;  1C79 A;  3PTF C;  4RZR A;  1JW9 D;  2RQ5 A;  1WI0 A;  1KEJ A;  2Q4T A;  2N9E B;  3PNC A;  2HBJ A;  1TFR A;  1QKZ A;  3OWE B;  2JPH A;  2DX5 B;  7ICL A;  2EAM A;  3I1Y A;  4GC7 A;  2ZJ5 A;  2BR0 A;  2FBW B;  2F1I A;  3NUH B;  2FMS A;  4W9C A;  2YMP A;  1FFV A;  4PH5 A;  3V6H A;  2GBK A;  3CNH A;  5K4L A;  4TUU A;  1RWS A;  3APD A;  1PGA A;  4PPX A;  1FRD A;  1Z2M A;  3OJU A;  4KLT A;  4ZRQ A;  2K22 A;  3TBL D;  1KRP A;  1J7A A;  3C8Y A;  2MBB B;  2VRR B;  1HXY D;  2ATL A;  2BS4 B;  1P7F A;  3DWM A;  4YTN B;  5KG5 A;  3UM9 A;  3AEB B;  2BQR A;  2LBO A;  1YZ7 A;  3SQI A;  4KX5 A;  1VCB A;  8ICM A;  3AE9 B;  1ED1 A;  2CXY A;  2DGZ A;  3KKA A;  3MAB A;  1YX6 B;  2KFK B;  2WX0 A;  5AZG A;  1S1Q B;  1KLV A;  3C1Y A;  2WXJ A;  1QQ7 A;  1ZXI A;  4F4W A;  4YMM A;  4K3B A;  3TAD A;  3WK6 A;  5BPC A;  4NLZ A;  4OO1 J;  2VIX A;  1MFW A;  1WE6 A;  2DZK A;  2NBV B;  1SKW A;  3I57 A;  3B08 A;  4FHK A;  1G6J A;  5J2G A;  1GPX A;  2K89 A;  2YMM A;  5HR6 A;  2HTH A;  3MC8 A;  3QU9 A;  4O3O A;  4YR0 A;  1ZQV A;  3A1Q B;  2AX5 A;  4F4Z A;  2HD5 B;  3QQ8 B;  2E3T A;  4WJP A;  2KFZ A;  2GBM A;  4W9D A;  1TS2 A;  1S77 D;  2C22 A;  1KFS A;  1JWA D;  2I9G A;  2N9X A;  4FXC A;  3KWL A;  4M0A A;  4I2I A;  3FKY A;  1FRR A;  1M6Y A;  2F3N A;  1IXR A;  3RJG A;  1MPE A;  3SEB A;  4TUR A;  1NEK B;  1WY8 A;  4PZO A;  2WB1 C;  1PDX A;  4HWI B;  2KNJ A;  3N7P D;  2K1F A;  1WR6 E;  4QZB A;  1UWM A;  5ALF A;  5ALJ A;  4OZA A;  2WXO A;  1L7Y A;  2Z8L A;  4FJZ A;  2X8X X;  5KT4 A;  2RDH A;  4RQM A;  4R8U B;  4DOB A;  4BUG A;  3I76 A;  1HIW A;  1Q1O A;  3IG3 A;  4LZG A;  4BWM A;  1OEY A;  2IDY A;  2ZTD A;  5DB6 A;  1AWD A;  3HKZ C;  4Q8F A;  1H8C A;  1KM7 A;  2XGQ A;  5J2H A;  4PHD A;  4DQS A;  2WHI A;  5DB7 A;  2F76 X;  2WHE A;  5J0U A;  2HHT A;  1GJZ A;  1CRX A;  5AI6 A;  5KG1 A;  3GV7 B;  3AE8 B;  2LYH A;  2DPJ A;  2Y1I A;  2BPG A;  1MJD A;  4JWM A;  3KW5 B;  1RFA A;  1Q0W B;  4HKZ E;  2R18 A;  4BAX A;  2K8B B;  3VR9 B;  1CJE A;  1FXI A;  4TKN A;  1WMH A;  4QZ9 A;  3OHA A;  4NY8 A;  4HJG E;  4GU2 A;  4MDK E;  1ZQE A;  4TMA B;  3TEY A;  1BNP A;  1ZJN A;  5IA7 A;  2GOW A;  5AZH A;  5EOZ A;  5D2M B;  2MEK A;  4A6Q A;  4S17 A;  4ED7 A;  2HBK A;  1VJ5 A;  3T79 A;  2Y9T A;  2DFL A;  2RPQ A;  5KFM A;  4GXJ A;  1D9F A;  3NVW A;  2LJ5 A;  2LMR A;  8ICW A;  1C1Y B;  3JSV B;  3E9S A;  4LCD E;  5IIM A;  3ECI A;  2LZ6 A;  3B0A A;  5D3I B;  2N7E A;  3Q69 A;  2K6Q A;  3MR6 A;  1JMS A;  3K9P B;  1KFT A;  1COO A;  3QAR A;  2A4Z A;  3RNB C;  3ZXV A;  1JX4 A;  2XY6 A;  4WWN A;  3WK7 A;  1XSP A;  4RF0 A;  2LGS A;  2OH2 A;  1Z1V A;  4Q44 A;  1ZQA A;  4RCO A;  2ZIU A;  3EEC A;  1LXD A;  4F5R A;  5FK9 C;  4R66 A;  1ZQD A;  5F9N A;  3WAP A;  2IA6 A;  2IGD A;  4E0D A;  1XNS A;  1NKB A;  4IM0 A;  1BXT A;  1ZQH A;  5AKZ A;  5DBC A;  2W7O A;  1PK1 A;  5HKH A;  1QT9 A;  5G2N A;  1J19 A;  2KDF B;  4ED2 A;  2C60 A;  3AUL A;  1X2I A;  2KHV A;  2AQ0 A;  3NVV A;  2NRZ A;  1V2Y A;  2KJH B;  4RGT A;  1L7O A;  5KT3 A;  2FLN A;  5CX3 A;  3ED5 A;  3VTW A;  3ZGZ A;  1NYQ A;  1R4M I;  1QIL A;  1T3Q A;  4C8O A;  5CRX A;  4OVZ A;  2V1Y A;  4WWO A;  2EMS A;  1TGZ B;  4DBG A;  1I4G A;  1NZB A;  4CHK A;  2WWZ A;  1C3T A;  4RGO S;  4HPP A;  4ANX A;  3BQ2 A;  3BVM A;  4GDL B;  2LYA A;  1UWX A;  4KN4 A;  3Q8B A;  1ZET A;  3DQV A;  4US8 A;  3P4S B;  4DO9 A;  1TJE A;  2EMT A;  4P4O A;  4RU9 A;  5JHB A;  4EE2 A;  2LKY A;  4J9N A;  5D94 A;  5J2E A;  2KN4 A;  3SD5 A;  3T3O A;  2NYV A;  5KFO A;  4FJV B;  4HCP B;  4Z6C A;  4KDL B;  3ZNZ B;  2DPI A;  3KOO A;  7ICF A;  4DQQ A;  2D2Q A;  4ANW A;  2WF8 A;  3T8M A;  2V3S A;  4K1R B;  3ORY A;  1QQR A;  3BII D;  4I6L B;  2ZJD A;  1OEY J;  2JYT A;  1NJW A;  1XS9 D;  2KN5 A;  4OJP A;  2HTM E;  4ZRJ A;  4ZYS A;  2YQE A;  5AUI A;  1WGR A;  1XLN A;  3CW2 C;  2OED A;  1ZQR A;  2DBY A;  2H3I A;  1ZQO A;  3AMZ A;  4QWB A;  1OQY A;  5III A;  5IIK A;  2XI9 A;  3AEG B;  4GXB A;  4LJP B;  3HX0 A;  4IQT A;  4GIV A;  2CHX A;  1SSN A;  3FC4 A;  3NGD A;  1O08 A;  1WCL A;  3MC9 A;  1SWV A;  1GC6 A;  5KTQ A;  1MA7 A;  2PMV A;  4RQ4 A;  3ML8 A;  3PMN A;  5FR6 A;  4IKG A;  1XO0 A;  3DV9 A;  3LDZ E;  9ICM A;  2KFJ A;  2VH2 A;  3ZD8 A;  1Q5W B;  3KLS X;  1JXE A;  4RNM A;  2PI4 A;  2QHO A;  1SZP A;  3QAQ A;  5AM0 A;  2QB0 B;  4LNF A;  5KFP A;  1YQ4 B;  1QTM A;  3DBS A;  3MR3 A;  3PSF A;  3RJJ A;  4FE3 A;  5DB8 A;  3Q8F A;  3SEI A;  1WCN A;  3UXO A;  1LGR A;  4G11 A;  1TZ1 A;  4PZN A;  3IHP C;  2ZJ8 A;  1NK5 A;  4F7Z A;  1QF6 A;  2IY1 B;  7ICV A;  3QCA A;  2AXT U;  3KKA C;  1L3T A;  2NBW B;  3P2B A;  3I28 A;  3HUI A;  4GDK B;  2FE8 A;  3H4D A;  2KSO A;  3TAD C;  1YJI A;  4M47 A;  8ICX A;  1BPE A;  4B9U A;  3PW2 A;  3EUB 2;  2KX3 A;  1C7Y A;  4C56 C;  3ZDC A;  4WWM A;  4IG7 B;  4WJO A;  3FIL A;  1TAQ A;  4EEY A;  3Q8M A;  4ZH4 A;  3ZRC A;  3APC A;  1FPY A;  1XEE A;  1YQB A;  5LLI A;  5CB1 A;  1GC7 A;  4FHJ A;  5DDY A;  2BQ3 A;  3KZX A;  2MQJ A;  3C2M A;  5DPR A;  3MHZ A;  2XIC A;  1KL9 A;  1RXW A;  5D46 A;  1T0S C;  1P98 A;  2BB5 A;  5TSS A;  3U4E G;  5HFY A;  2L8J A;  1ZGU B;  4KMU A;  3N30 A;  3PX0 A;  2QIL A;  1OW5 A;  4C4V B;  2KG5 A;  4MGY E;  3BQ1 A;  3RI7 C;  4MM3 A;  3TL5 A;  5DDM A;  2MH7 A;  2XNA C;  3K1R B;  2IO2 B;  3QU5 A;  2KKC A;  3X0W A;  3IG8 A;  4W9J A;  4F2R A;  4IC7 B;  1T5X D;  3AE5 B;  4M0W B;  2BKE A;  4BXO B;  1PGB A;  3MC0 B;  1RXV A;  4FAD A;  3MC1 A;  2JU6 X;  2A19 A;  1NKC A;  4BJQ A;  1V6E A;  2CU3 A;  4A55 A;  3LYY A;  2EAO A;  1TIF A;  3ZJU A;  2UYZ B;  1ZQK A;  3LWM A;  2G5H B;  1WWU A;  4M9G A;  1NK9 A;  3HVD A;  1M94 A;  1COK A;  1ZQT A;  3TIX A;  1P1A A;  2DHZ A;  2G08 A;  3Q8R B;  4F8C B;  1X6J A;  1ZYQ A;  2D10 A;  1M4V A;  3BYY B;  2JZ3 B;  3TJP A;  5ALZ A;  4E74 A;  3KHL A;  1KF6 B;  4A8E A;  1Q3V A;  1PUT A;  1SB3 C;  3WAO A;  2WF5 A;  4RGN A;  4GXK A;  1V86 A;  3GIJ A;  2QCZ A;  5AM1 A;  4EBD A;  4F5N A;  3HK0 A;  2BCQ A;  5BYS A;  4QIW F;  3RB0 A;  2B3A A;  2W82 A;  4UB5 A;  4OJO A;  2HJ1 A;  4I2B A;  4EZL A;  1ZQW A;  3IN5 A;  2DKX A;  4C4S A;  3PRE A;  2AYO B;  2WU5 B;  3PLU A;  4K3C A;  2RSU A;  3BWU D;  3C1Z A;  3Q3N C;  4KSK C;  1NI2 A;  3LB8 C;  1MI0 A;  5KFR A;  4R65 A;  1KDH A;  2FI1 A;  3MGV A;  5KT5 A;  9ICX A;  1FNU A;  2EH9 A;  3ZDM C;  3H1U A;  3PX4 A;  3RBE A;  5D7G A;  2ZIV A;  5AHX A;  1QH9 A;  4PGQ A;  4YMO A;  3A9J B;  4LK0 M;  3R7Q A;  3K4G A;  3KVF B;  1N5X A;  4EZ9 A;  3DVG X;  5ALQ A;  5J2J A;  9ICU A;  3DOW A;  1L5P A;  4HYK A;  2QSD A;  2DWQ A;  1V5T A;  5MPO A;  5C5J A;  1ZQ1 C;  3R9K A;  4FA6 A;  4WJQ A;  1ZUD 2;  1BPB A;  3QUT A;  2KFN A;  2ZG6 A;  5KFQ A;  2W9C A;  4S0R A;  2GH1 A;  2R2Q A;  5DGA A;  4XUS A;  3U52 E;  3JPT A;  4RQ8 A;  2BGF A;  2DZJ A;  4GN1 A;  4RNA A;  5J0O A;  3RF9 A;  3TCA A;  4MT5 A;  3BQT A;  1CQV A;  2P66 A;  2VA8 A;  4U6P A;  4NAM A;  1ZQP A;  2Y1J A;  2XC9 A;  3UQ0 A;  4EEW A;  2BYV E;  4J3O D;  2HOQ A;  4RFB A;  3P4R B;  1QOG A;  2C7M B;  3RJE A;  4B9M A;  5HNK A;  4FS2 A;  4M9L A;  1FMA D;  5KFC A;  2ZUB A;  2NVU I;  2W8L A;  3Q8S B;  4B9S A;  1SIJ A;  2RRD A;  4UQG A;  1ZQS A;  4MSQ B;  3LJ3 A;  4OW0 A;  1RYS A;  3V60 A;  4M9N A;  4LDT D;  3W1Y A;  3ZYY X;  3L4P A;  2C2E A;  5AKX A;  2W7P A;  2ZVN A;  2PJH A;  1E8W A;  2E6X A;  5AKL A;  2B6G A;  4REZ A;  4K4G A;  4W9F A;  4P16 A;  2LXC A;  3BQ0 A;  2EAP A;  1F1H A;  3CST A;  2BBC A;  9ICA A;  3BVG A;  2N9K A;  3FYH A;  4G3I A;  1JUD A;  4FZN A;  2UU7 A;  3AE6 B;  3A9K B;  3V3X A;  2EZY A;  1JRO A;  2KDE B;  2YLM A;  2KEY A;  1TTN A;  1PVQ A;  2O6V B;  5KFW A;  1NYR A;  1XSL A;  1C76 A;  3IG5 A;  5J0W A;  1ARO P;  3QEB Z;  3L3F X;  4OJL A;  2K5P A;  4KX6 B;  4O5E A;  1XO3 A;  4YWG G;  5G5G A;  2AEH A;  2WAQ F;  4ARI A;  2GO7 A;  1S0N A;  1R4N I;  2KIV A;  4I2J A;  4UB8 U;  2IY0 B;  2PIA A; 
#chains in the Genus database with same CATH homology
 3FAH A;  2M0A A;  1SE3 A;  2W55 A;  1XCQ L;  2LHE A;  4WQM A;  2PVO D;  1D5X C;  1WGK A;  2WXP A;  4DQO C;  1JML A;  1KRH A;  3N9Y C;  1YJJ A;  3VR8 B;  2JX5 A;  1IBX A;  1C79 A;  4H2A A;  1JW9 D;  3AEC B;  4OZB A;  1FO4 A;  1TKG A;  1QKZ A;  3OWE B;  1VDV A;  2FBW B;  4O1N A;  5HI1 A;  1V1P B;  3NUH B;  5T8I A;  1D5M C;  5EE1 A;  1FFV A;  3AEF B;  2G1E A;  3IXS A;  2FUG 1;  1GOZ A;  2RPV A;  3P1M A;  1RWS A;  2J53 A;  1PGA A;  2L1A A;  1FRD A;  3P4Q B;  5FR3 A;  3HRD D;  1V8C A;  4ZRQ A;  2K22 A;  1J7A A;  2YEP F;  3C8Y A;  2NTS A;  1HXY D;  4PT5 A;  1TKY A;  2BS4 B;  1P7F A;  3DWM A;  4YTN B;  1VZ7 A;  2X38 A;  3AE4 B;  3AEB B;  4RH6 A;  2JSV X;  2GI9 A;  1T6B X;  2EKI A;  4TQ1 A;  1IGC A;  3O13 A;  4AQ7 A;  1YN3 A;  1C9F A;  3AE9 B;  2JXT A;  3DWG C;  1PYW D;  1N5W A;  2BS2 B;  2KDM A;  1ZXI A;  2WXJ A;  2YEP B;  2N0S B;  1TYG B;  1SJH D;  3I57 A;  1GPX A;  2JQR B;  2J42 A;  2RMM A;  3VRA B;  2TSS A;  4CQN A;  2AX5 A;  3UI3 A;  2E3T A;  1ET6 A;  1TS2 A;  1TZO A;  3LXF A;  2DYM A;  3AE1 B;  1JWA D;  4JWS C;  5H8Y E;  4JX1 C;  3GS2 A;  4FXC A;  4DXG A;  1I4Q A;  3KWL A;  3AEE B;  1FNV A;  1FRR A;  1KH0 A;  3EA6 A;  1Q10 A;  1YN5 A;  1MPE A;  3SEB A;  2LMC A;  1NEK B;  2B76 B;  3AB5 A;  1PDX A;  4WAF A;  1N62 A;  2WDV B;  1HZ6 A;  3Q8C A;  1PFD A;  3W5V B;  1UWM A;  2I38 A;  2K9X A;  1UUP A;  2V3N A;  1HEZ E;  2WXI A;  2WXO A;  4OZA A;  3BK1 A;  2Z8L A;  2PW9 A;  2RDH A;  4B0E A;  4YTP B;  1WSP A;  2ICI A;  1FXA A;  2QEJ C;  1RFK A;  3AED B;  3V05 A;  1XCT L;  2IDY A;  3T3N A;  1VZ8 A;  1AWD A;  2JZP A;  1IUE A;  2KMM A;  4C7Y A;  2K3U A;  4YSY B;  4ZOH C;  2WXN A;  3AE8 B;  2BT6 A;  1HA5 A;  1FM0 D;  4HKZ E;  4A90 A;  3VR9 B;  1CJE A;  1FXI A;  2JYE A;  3W9C B;  1I4R A;  2LUM A;  4HKQ A;  3CWI A;  2V4I B;  4XE0 A;  4HJG E;  2LEK A;  2QMT A;  4USA A;  4TMA B;  3TEY A;  2ACZ B;  3BZD B;  1SEB D;  2MEK A;  3BVZ A;  4A6Q A;  1TKE A;  4HRS A;  5C3J B;  2IGH A;  4NAW B;  4XDD A;  2WXL A;  3NVW A;  3ZQ4 A;  2BW2 A;  2MJ3 A;  2WXM A;  2WDQ B;  3E9S A;  3NS1 A;  1DOX A;  2GB1 A;  1ZE3 D;  5D3I B;  4N6E B;  3Q69 A;  1KLU D;  1D4B A;  2Y5C A;  2Y5P A;  1F0Z A;  4MM3 B;  3RPF C;  2BB6 A;  3Q8A A;  4WIP A;  1V97 A;  4RF0 A;  4YTM B;  1QLB B;  3R8B A;  3TEZ A;  3P63 A;  4RCO A;  2R61 A;  4AS1 A;  1ESF A;  1K50 A;  2AQ2 B;  5FK9 C;  3AH7 A;  2IGD A;  1EM7 A;  1FCL A;  5EE0 A;  4JPS A;  1KTK A;  1SXT A;  3AEA B;  1BXT A;  1EWC A;  1PGX A;  5HG2 A;  2DYO A;  2WS3 B;  1I7H A;  4ZHP A;  1VLB A;  1QOA A;  1L0Y B;  1QT9 A;  1IBX B;  5EE3 A;  1VZ6 A;  1TY0 A;  2LHD A;  3NVV A;  3R2I A;  4RGM A;  4OHJ A;  4RGT A;  1L0X B;  3W2D A;  1STE A;  2J4X A;  2LGI A;  3ZGZ A;  4ITK A;  1NYQ A;  3B9J A;  1QIL A;  1T3Q A;  4OVZ A;  2WXQ A;  1XLQ A;  2WU2 B;  1EWY C;  3AN1 A;  1I4G A;  1V1O A;  1F2R C;  1I4P A;  2CJN A;  2ON8 A;  3PZ8 A;  1GB4 A;  2L52 A;  4RGO S;  2K0P A;  3NVZ A;  2INN E;  2PTL A;  2ZW0 A;  3BVM A;  4GDL B;  1AN8 A;  3BK2 A;  1UWX A;  3Q8B A;  1L6V A;  4JE3 B;  2WXG A;  2MJD A;  4US9 A;  4US8 A;  1ZDV A;  1TJE A;  3IT4 B;  3P4S B;  3Q8E A;  4KGT A;  4N59 A;  2KAJ A;  1E9M A;  1VJK A;  5BMG A;  4EE2 A;  3RFZ B;  1C78 A;  2KN4 A;  1K51 A;  1OQR A;  4HRO A;  4XWW A;  3T3O A;  1FD6 A;  3NVY A;  2W3R A;  1MVK A;  5HHD G;  1QQR A;  1IGD A;  5BMH A;  3BII D;  1MHX A;  2JYT A;  1JAL A;  4L23 A;  4NZL B;  2HTM E;  4ZYS A;  5AUI A;  2J52 A;  1XLN A;  2OED A;  2SAK A;  3B2G A;  2WP9 B;  2DBY A;  4WUR A;  4L2Y A;  3AMZ A;  1TS3 A;  1JWU D;  3AEG B;  4LLG M;  1SSN A;  3FC4 A;  1ENF A;  1FFU A;  4TQ0 A;  1J7C A;  1N61 A;  2PMV A;  2IPK D;  2LJI A;  4IKG A;  5I4D A;  3MJ5 A;  1KFY B;  2Q5W D;  1E0Z A;  5E6J A;  3CIR B;  3KLS X;  3P4P B;  2IJ0 A;  2H89 B;  1OFF A;  1DYQ A;  1YQ4 B;  3AE7 B;  4KKJ A;  1ET9 A;  4TSS A;  2BS3 B;  3B2F A;  1HQR D;  5EE9 A;  2G9H D;  3Q8F A;  4B0M A;  1L4Z B;  3URY A;  3GB1 A;  2W3S A;  3NRZ A;  4RF1 A;  3H8H A;  1B1Z A;  1CK1 A;  1QF6 A;  1NI3 A;  2KWD A;  1MHH E;  5H92 C;  2WXF A;  1TY2 A;  5BYQ A;  1D5Z C;  3IAS 1;  3HUI A;  4GDK B;  2FE8 A;  1YJI A;  2L32 A;  3EUB 2;  1RYJ A;  3TEW A;  4C80 A;  4C56 C;  1E10 A;  4WWM A;  4NJC A;  3FIL A;  4A8X C;  2PIA A;  3VQI A;  3KWV A;  3NZ3 A;  2WXK A;  1XEE A;  3P42 A;  2BTE A;  2AQ3 B;  2WQY B;  4LTU A;  1AYF A;  2M19 A;  2QJL A;  3MP9 A;  1JWS D;  3MHZ A;  2BB5 A;  3U4E G;  1EU3 A;  2I2Y A;  5TSS A;  4XWT A;  2GRI A;  3ABV B;  5HFY A;  3W1S A;  2QIL A;  3ETR A;  4L1B A;  2W54 A;  1I4H A;  2VZK B;  1NVI D;  2MH7 A;  2XNA C;  2HDE A;  4D2K A;  1FIQ A;  1F2R I;  1YMH E;  2JWU A;  1FEH A;  1T5X D;  3AE5 B;  5BMI A;  1PGB A;  3EGR A;  3MC0 B;  3W5U B;  2XN9 C;  1V1P A;  5GXG B;  1SE4 A;  2JU6 X;  4P6V F;  3ZJT A;  1I4X A;  2WLB A;  1K52 A;  2CU3 A;  1E6E B;  4A55 A;  3LYY A;  4A9A A;  3ZJU A;  4N58 A;  1WWT A;  4JWU C;  3HVD A;  3IAM 1;  2WDR B;  2N7J A;  1EU4 A;  1SF0 A;  2PLP A;  3U7Z A;  1XXG A;  4YT0 B;  2MJE A;  1M4V A;  3BYY B;  1L4D B;  3BYT B;  3WCQ A;  1TS4 A;  1GAQ B;  1KF6 B;  1ZOY B;  4YSX B;  1KLG D;  1A70 A;  2LFI A;  4R3D A;  2DLB A;  2OHF A;  1PUT A;  1SB3 C;  1DOI A;  4RGN A;  1SJE D;  1JQ4 A;  1C4C A;  2PKO A;  1YN4 A;  1R7S A;  5BYS A;  1F77 A;  4KGR A;  2W82 A;  2IGG A;  2INP E;  2BYT A;  2N9L A;  5G5H A;  2V3P A;  2WU5 B;  3AV8 A;  3J9C A;  3SFD B;  2PVG C;  3BWU D;  1UGJ A;  2ZW1 A;  3LB8 C;  1MI0 A;  2WXH A;  1ROE A;  2D5G A;  3AM9 A;  1VR9 A;  1WRI A;  3I9V 1;  1FNU A;  2QIE B;  4MAC A;  3U2S C;  1YNT E;  5D7G A;  1DGJ A;  1UNS A;  4ZRP A;  2WNM A;  5JXV A;  2NMQ A;  3TUO A;  4LK0 M;  1C4P A;  1P7E A;  1LO5 D;  1QOB A;  2RDG A;  2WXR A;  2NTT A;  1N5X A;  1C77 A;  5AUK A;  1L5P A;  2QSD A;  1RM6 C;  1JCK B;  2DWQ A;  2V0G A;  3ZJV A;  5MPO A;  5D3D A;  1ZUD 2;  3TSS A;  3PZ7 A;  3U52 E;  4RNA A;  1JWM D;  1L6U A;  1Y56 A;  1ZXH A;  2VZK D;  5C2T B;  3AE3 B;  1C4A A;  4MT5 A;  1CQV A;  4DXF A;  1ZPS A;  4GLS C;  3SFE B;  1WYG A;  1K53 A;  1N63 A;  4NAM A;  2EEL A;  2ONQ A;  1CZP A;  4Q2J A;  1J7B A;  4YXD B;  4J3O D;  1D6E C;  4RFB A;  3P4R B;  1QOG A;  4ARC A;  4MH8 A;  4IDI A;  4KKI A;  1DOY A;  1FMA D;  2SEB D;  4WH4 A;  4XDC A;  2H88 B;  3PO0 A;  1TS5 A;  3IT6 B;  1FNW A;  1SIJ A;  5BYR A;  4UDU C;  3GP7 A;  4C7Z A;  4OW0 A;  3ZYY X;  1E7P B;  1ZP0 B;  3L4P A;  1ACC A;  1JWB D;  4IOI E;  1XF5 L;  2CJO A;  4HEA 1;  1JRP A;  1GB1 A;  2E6X A;  2L83 A;  4REZ A;  2Y3A A;  4P16 A;  1HZ5 A;  2BBC A;  1N60 A;  4KGS A;  2AQ1 B;  4ZHO A;  3BVG A;  1ZDX A;  3KQ4 A;  1SBB B;  2N9K A;  4YSZ B;  1YQ3 B;  1B9R A;  1BML C;  1OQQ A;  3E56 A;  3AE6 B;  3V3X A;  3MFG A;  1JRO A;  2M56 B;  2KQ4 X;  5LNK 1;  1NYR A;  1AW7 A;  1FCC C;  1C76 A;  1VRA B;  1WXQ A;  3FIL B;  2K5P A;  1XLP A;  4KX6 B;  3HVZ A;  2KAC A;  3TEX A;  1XO3 A;  4YWG G;  1NEN B;  4OZC A;  3VRB B;  3SR6 A;  5G5G A;  1BUI C;  5FKA C;  3R2T A;  4ARI A;  4M0W A;  1XLO A;  3AE2 B;  1L0V B;  1QOF A;  1SE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...