1N61A

Crystal structure of the cu,mo-co dehydrogenase (codh); dithionite reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n61A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n61A01
1TKYA 1JW9D 2DWQA 4KX6B 1WXQA 1FM0D 2WLBA 4YSYB 2W3RA 1WWTA 2WDVB 1VDVA 3VR9B 3AE2B 3AE8B 1QOGA 2QJLA 4ZOHC 1RM6C 2N0SB 5GXGB 1I7HA 1N63A 1NI3A 1QT9A 3LXFA 1ROEA 1WRIA 4YSZB 2H88B 3W5VB 1SB3C 1N5XA 1FXIA 3AE6B 4A9AA 4YTNB 4USAA 5MPOA 1TKGA 2AX5A 1TJEA 2M19A 5C2TB 1FFVA 1N5WA 3ETRA 1FFUA 3HUIA 4HROA 1V8CA 1JROA 4US8A 2DBYA 2PVOD 3DWMA 3AEGB 3LB8C 4YT0B 5AUIA 5H8YE 1CJEA 1NEKB 1N60A 2PIAA 5G5HA 3FC4A 3RPFC 3ZYYX 1DOXA 1E0ZA 2B76B 2JX5A 1VJKA 2M56B 2CJNA 3HVZA 1RFKA 3AE7B 1E10A 1SF0A 1KRHA 1ZOYB 2G1EA 3SFDB 2OHFA 1L6VA 2W55A 1PUTA 1YJIA 1YJJA 2LEKA 2WU2B 4FXCA 1OQQA 1QOFA 3SFEB 3EUB2 3B2GA 1J7CA 1L0VB 4N6EB 1QLBB 4JWSC 1GPXA 1FXAA 1N61A 1RWSA 1ZUD2 1ZXIA 3KWLA 4IDIA 1KF6B 1NYQA 1XLOA 2BS3B 1PDXA 1AWDA 2FBWB 2MJDA 1TYGB 2QIEB 3B2FA 2W54A 1JALA 1T3QA 2PKOA 1YQ4B 3PO0A 1JWAD 1OFFA 2BS4B 2HTME 2KMMA 5G5GA 2WS3B 3NVWA 4HRSA 4C7ZA 1CZPA 4YTMB 4JX1C 4ZHOA 5EE0A 2K5PA 3P1MA 1NENB 2BT6A 2Q5WD 1FO4A 2WDQB 3AE4B 2CJOA 1DGJA 1TKEA 2ACZB 1N62A 3P4RB 1B9RA 1L5PA 3B9JA 2MJ3A 2WP9B 3ABVB 2W3SA 3AMZA 1OQRA 1EWYC 3CWIA 1QOBA 4ZHPA 1SIJA 3HRDD 3NVZA 1QF6A 3AEFB 1WGKA 4YXDB 5H92C 1IUEA 3L4PA 2BS2B 4WQMA 1L6UA 3P4QB 3AB5A 1J7AA 5EE9A 3VR8B 1E7PB 3W5UB 1AYFA 3AEBB 2L83A 3NVVA 1PFDA 1GAQB 3AH7A 5AUKA 1DOIA 4WWMA 1XLNA 1FIQA 1RYJA 2MJEA 4US9A 3AEEB 4YTPB 4JWUC 1XO3A 1QOAA 1R7SA 3WCQA 1ZP0B 2WQYB 2K22A 1A70A 1FRRA 1FRDA 1XLQA 2H89B 2MH7A 3BIID 2EKIA 4N58A 3NRZA 1E6EB 5EE1A 5EE3A 2CU3A 3NS1A 3AE9B 4YSXB 4C80A 3AE5B 3VRAB 1WYGA 1NVID 1JQ4A 2WU5B 3W9CB 3DWGC 2Y5CA 4P6VF 1VLBA 2K9XA 1J7BA 1FMAD 3AE3B 2KAJA 1DOYA 1F0ZA 3SR6A 3AEDB 3AE1B 1JWBD 1KFYB 3AV8A 3CIRB 4N59A 3P4SB 1JRPA 1XLPA 2JQRB 2WDRB 1E9MA 3AECB 3P4PB 4LTUA 2PVGC 3AN1A 3P63A 3NVYA 1V97A 2E3TA 3FAHA 5C3JB 3AM9A 4C7YA 1UWMA 1YQ3B 2L52A 1NYRA 3VRBB 4ITKA 3AEAB
chains in the Genus database with same CATH superfamily
1ZQEA 4TUPA 1WXQA 3EA6A 4XGAB 4OVZA 4RQ2A 2W8KA 5AI9A 1BPEA 2YN4A 2WDVB 1N2XA 3H7PA 3TJPA 4UB3A 2XGPA 9ICUA 1RXWA 3SMVA 3C28A 1GJZA 3SDLC 2K25A 4EZKA 2D3DA 4FN2A 2H88B 5T8IA 4Y2UA 4MELA 5BYQA 5KFFA 1EO6A 1K1QA 3TARA 1ZQUA 1IG6A 2LGSA 4P16A 4EOYA 2E6XA 2LGYA 3IHPC 3JPQA 3EFUA 3KOOA 1SEBD 3F2CA 1KLGD 1ACCA 4JMUA 1V1PB 3UQ0A 1HZ6A 1WSPA 4RQMA 1EU3A 4NY0A 4HDOA 1DOXA 4UAVA 4ECQA 3VUXA 2XY6A 4NLCA 1UT5A 5ALKA 4M9HA 3K9PB 3DHHC 1D4BA 4RPYA 3NRWA 1TT5B 4F3OA 2CHZA 2ZUBA 3JPSA 4RZRA 2DUYA 3LK9A 2W03A 1TVAA 2FCSA 2N9PC 5L1JA 3LWMA 4ZH4A 2AU0A 5AK5A 2XK5B 2NRWA 2KZZA 4DQPA 2BCVA 1LV5A 5JXVA 4J9KA 2TSSA 3A0BU 5ALTA 2VA2A 2JEJA 2EMSA 4B0EA 1Q10A 4ANXA 3DVGX 4IR1A 2LFIA 1JWAD 1OFFA 2JEIA 4DLGA 3RFZB 8ICPA 5FP0A 4M0AA 3MJ5A 4PGXA 2KEYA 2LJIA 2JXJA 3VTWA 1OEYJ 5JZEB 4M00A 3FM9A 2IOFA 3N1ZC 7ICOA 2WP9B 2MJ3A 3KWVA 8ICTA 3ABVB 4DXGA 1OQRA 1XT9B 2J52A 4K7UA 3Q8EA 3ISCA 1B4FA 3ALBA 2MP2A 4YXDB 4C0ZA 3DPDA 3QEBZ 3P4QB 2W82A 2ZIWB 3ZDEA 3H0MB 2L83A 1CQVA 3CP8A 5CHVC 5E6OA 2I38A 3QNMA 2KICA 4J9OA 3WAOA 2G45B 4R8UB 3JYUA 2GBJA 3BS5B 3CW2C 1VR9A 3L54A 5CEHA 2YY6A 1D5ZC 5HR7A 1ZQMA 2M0XA 1X9XA 1JUDA 4KLQA 2BTEA 5D4BA 3WANA 2KZRA 2DZJA 2KVRA 2WU5B 5DPRA 4MGZE 4ECXA 3W1YA 1VLBA 5J0QA 5IOIA 2D6FC 1U4AA 2ZJAA 4ZRQA 3AE1B 3H7SA 3HT3A 2H5XA 2FJ6A 3EPGA 3Q8QB 3BDPA 1TTNA 5J17A 4J9LA 4ZRIA 5KFNA 2AL3A 1TV9A 1VRAB 3HKZC 4GDKB 1V97A 1ZDXA 3AM9A 3WALA 1NYRA 1QQRA 4DL3A 2L05A 2PJHA 4KLHA 4UB2A 2I5HA 8ICYA 2RLTA 5IIJA 1XSNA 1MSWD 3K1RB 4EENA 4O5CA 4B9SA 1UBIA 1KLNA 2GOLA 1U45A 2BKEA 1N63A 1F9JA 3C5FA 4BX9C 4GC6A 1NBFC 5J0XA 1FXIA 9ICAA 3CSFA 2G5HB 4ECWA 2JZZA 4MFAA 1TE2A 3HKZF 3M7DA 4BAXA 3IM1A 1TS4A 2K1FA 2RDHA 7ICKA 4QIWC 3HUIA 1T94A 3AU5A 2YLMA 2Q4TA 3QC8B 2HOQA 4EYIB 2KQSA 4AUQC 3V6CB 1JX4A 3L17A 4W9CA 4PHPA 3T5KA 1OQYA 5AIBA 1SE9A 2VRRB 3ZRCA 4N9F4 5A0LA 3G6XA 3D2QA 4UASA 4YG2A 4DSLA 7ICVA 3DBRB 2A3VA 4YR0A 5AI4A 5DQGA 3RZFA 2GBNA 2A1AA 3KVFB 1FEHA 1MVKA 4JV2A 2WHIA 3TADA 4JWSC 3CF6E 2KO3A 4IWOA 1ZXIA 1TFRA 3A9KB 3WAMA 3WK6A 4DL6A 1NYQA 2ASJA 1XEEA 5KFAA 2FIFA 4I2DA 4F93B 4ZRKA 3BVZA 5KAFU 1TAQA 3IG5A 3NVWA 3M8SA 2CRXA 5CTRC 3RI7C 3QU7A 4JX1C 2VA8A 4AQ7A 1WCNA 1ZQSA 2G5IB 4M8MA 2KJ5A 1T8EA 2KN4A 4UBCA 2CN1A 2W04A 4NAMA 4F91B 5HMMA 3PR5B 4HYKA 9ICEA 4FULA 2WXHA 5ALGA 1S76D 4QZDA 4GLSC 2BYFA 1SIJA 2ZJ8A 5AI0A 3L08A 1L6UA 5EE9A 2EZYA 4J9NA 9ICMA 3Q3MC 5J0SA 2R8KA 2ZVOA 1ZQFA 4C56C 3MDAA 1V5OA 2N1WA 4ACOA 1V81A 1D3ZA 2JV3A 2N1RA 2BYVE 2VH1A 3F53A 1QH9A 9ICQA 2A5UA 4M6WA 2KKPA 5EOZA 1K51A 2WQYB 5JU5A 3PSFA 4YQWA 3L0WB 3DVNV 5ALDA 2OH2A 3A33B 4F5NA 2F1IA 2IOHA 2AWTA 2HJ8A 3BWUD 3KTQA 4YSXB 3VRAB 1Z4OA 4BWMA 3APDA 1WYGA 8ICLA 4E0DA 1NVID 3L13A 4P6VF 4DBGA 4NLKA 2XNAC 1YZ6A 2FCNA 2W9NA 3RB0A 3R7RA 1ZD4A 4K4HA 5AKIA 2M9NA 3PS6A 4OCZA 4OZCA 3QU5A 2D2QA 4C4VA 2BCQA 4G11A 4ARIA 5AZFA 1GOZA 5HI1A 3RD2A 3U2SC 4CDGA 5BMIA 1SZPA 1T6BX 2RRDA 1VD2A 2KQ4X 9ICGA 4YTMB 3P2BA 3FKYA 1H4RA 2O6VA 1UUPA 3EGRA 4P0QA 3DCGA 4GFJA 3N20C 4YVZA 5FR3A 4CF3A 3UIOB 4GDLB 3OSNA 5KFWA 2QJLA 2FNJB 1WG8A 3SEIA 5DBBA 2W8LA 4C8MA 1SE2A 3ZKJC 1QT9A 4ICVA 2IBKA 4K3BA 2IHMA 3GB1A 4DHJB 3GOEA 3WAPA 3C29A 4KVGB 2KXJA 2UWQA 4A20A 3VUYA 1SL2A 3E9SA 3X0WA 4DSFA 3UXNA 4A3PA 2FCQA 2HDEA 3DBLB 4MJSB 3PREA 3F2DA 4GOCA 3ML9A 3WA0A 3Q2AC 3U4EG 4RPXA 1T0QC 3UXOA 3SEBA 3GILA 1LM8B 2R18A 3VDZA 1WR6E 1YMHE 2KOXA 3UQAA 4GMVA 1N48A 3J81j 1RFKA 4X57B 9ICFA 1SZHA 1PK1A 1NZPA 3BY4B 4KX3A 3ZD8A 4GXBA 5DQHA 2Y3AA 1PUTA 3VXWA 2G9HD 2WU2B 1MN8A 1PVPA 4B9VA 4NL9A 4LK0M 2L1AA 3DBRI 2E8MA 2C2RA 7ICPA 4EEWA 8ICXA 1O08A 3M8RA 3RNCC 4RQ1A 1AWDA 4KKIA 5J8YC 1D8YA 5ALUA 4AWJA 2BS4B 2D07B 7ICMA 2BPSA 5HKHA 7ICNA 2BVCA 4KLOA 4DHZE 4HPLB 5AKKA 3UMGA 2WXKA 4ECUA 1TKEA 2CHWA 2C9WB 1B9RA 2I9GA 4JUZA 2AQ0A 3EYZA 2YMPA 2VKQA 2PTLA 3UMCA 1C20A 3WKEA 2W9MA 3AU2A 4G3IA 1C9FA 2LHTA 4RF1A 5H92C 1WY8A 2MX2A 3B1LX 4KLGA 4MH8A 2LASA 2W11A 2WWZA 1P7DA 2M17A 3QU2A 4DCCA 2Z0EB 5T14A 4IC9A 1GC7A 2KJRA 4TUSA 4NAWB 2GO7A 2LPEA 4GXIA 2J4XA 3R2TA 3RN9C 4IRKA 1WWUA 4C4SA 2JYTA 2NPTA 4W9EA 5KG7A 3IAM1 1U9LA 3AUOA 1QZEA 4N58A 3J9CA 4ICAA 3V6HA 2C5LC 4B9NA 2KD1A 1HA5A 2ZJ5A 4MHVA 3SQIA 4S17A 4XZ4A 4ED2A 3CYMA 1XS9D 2KFNA 4UQGA 5GMVA 1F0ZA 2AGOA 2BQ3A 4EBEA 2DL0A 1KFYB 4BWJA 4JE3B 3LVWA 3N1YC 1KLVA 5E6PA 4IWQA 4FE3A 2DZKA 2Y9TA 4HAIA 2ZCCA 2IO2B 2PVGC 3AN1A 4F4YA 3NVYA 5DG7A 3TAQA 3JPOA 4XE0A 2IPKD 5H2FU 2LM4A 2L0FA 2DWQA 1RYSA 3A4SC 3N7SC 2K4IA 4P4OA 1WI0A 4F2SA 3E56A 3VTUA 4A55A 2MBEA 1QOGA 3RH5A 4KLDA 4AP4C 3VVWB 5GXGB 2EAOA 1UZXB 1SGHA 3U30A 1KFDA 4PL1A 3ZNGC 3JPTA 1WRIA 3Q8BA 4BOZB 1SV0C 2KV2A 3A4RA 2ASQA 1WCLA 2ZUCA 1TJEA 2HHUA 4BDPA 5KFZA 2IA6A 1S5LU 3N7PD 4HROA 4DF8A 2XO7A 1Z1VA 4RPZA 2W9BB 7ICLA 3VFKA 1WH3A 3ZJVA 2L7RA 3Q8CA 2WTFA 3GU3A 4QZIA 2EDUA 5BMHA 4CYEA 1BPDA 1C4AA 2CS4A 1ZQQA 2JY6A 1EF5A 2AQ3B 5TSSA 1C78A 2JH7A 2HMXA 1YJIA 1Z4NA 3R7QA 3PO5A 2N9LA 4I2FA 3T8MA 5K4LA 4KGRA 4UAZA 4FHJA 4YFKA 1OTRB 2DAFA 3MTNB 5KFPA 2IBIB 5KFVA 3KLSX 2QILA 4TQ0A 1K1SA 2IYDB 3M6KA 3TSSA 1KL9A 2NR2A 1J2NA 3OTQA 4BKSA 1ZJNA 2ZIWA 3P1MA 2FPKA 4KDIC 2HD5B 3NY5A 1S97A 1PGAA 2NVUI 2J7QB 3DVGY 4AJWA 5CX3A 1QQ7A 4O3MA 2QARB 3NVZA 1N56A 2BCSA 5HG2A 2BS2B 4F7ZA 3AB5A 3R8BA 4YR2A 2KTFA 1N6ZA 4ZRJA 3TFRA 3V6KA 4C4VB 1HTOA 4BUGA 2HOFA 1XLNA 4RFBA 3O0FA 1RPLA 1EWCA 1S0NA 2ZPNA 1L4ZB 2QSDA 4Q45A 2FAZA 4HLEA 3IP4B 1LO5D 3BIID 4FZMA 3PW4A 1DK2A 3O65B 2ZIXA 2YEPB 3TEXA 4EFOA 1T3NA 4NLZA 2WF5A 2INNE 4OHJA 3SHQA 4DXAB 3FILB 4MSMB 3WKBA 1ZQGA 2BF8B 2KJ8A 3EC8A 3G6YA 2WXPA 4RUAA 2BPGA 1OEYA 4JGHB 4BBNF 7ICUA 1DGSA 2Z7JA 1L8LA 1L7OA 2KOBA 4GN1A 4P0PB 4Y2YA 2OJWA 1ZD2P 1H38A 2HE7A 5ALRA 4B9MA 1XWLA 1RXVA 1V38A 3HW8A 3LDAA 3DHIC 4K81A 4M47A 1NI3A 4Y2VA 2KP7A 3LXFA 1SV4A 4GXJA 3I76A 3SAGA 4YTNB 3Q8KA 5AM2A 4K4GA 3AEVA 3MC8A 3PW2A 1FFVA 5KFCA 1SGGA 2HDOA 2PFQA 3DWMA 4WJQA 1ZD5A 4ED1A 2JZBB 2Y1JA 1IGCA 1I4QA 3M9MB 4B9UA 1UGMA 8ICFA 4KV2A 4QWEA 2BW2A 2XGQA 3FC4A 2NV3A 1SSNA 2K8HA 2KFKB 4RM9A 1LXDA 2LHEA 1E10A 4KLFA 4I2HA 1KRHA 3V05A 3OJSA 4QWDA 3KKAC 8ICCA 2KFJA 4W9KA 4F4ZA 2Z0DB 2KYWA 2QKQA 3MABA 4F5PA 3DDCB 4XDDA 3SFEB 5J2JA 4C8NA 3QYPA 1ZQBA 4U6PA 2I1JA 9ICXA 4OD0A 1TYGB 1YN4A 3D32A 8ICHA 2BCUA 1WGHA 4XQ8A 5IKCM 3W2DA 4QWAA 4P0PA 5AM0A 4FHKA 3EWAA 3Q69A 4FJVB 3C5GA 1CZPA 5KFQA 4URKA 3EZ5A 2KT7A 2LRWA 9ICHA 2VZKB 5BO4B 3D2NA 1WUDA 4FS2A 2CJOA 4W9LA 4DO9A 1E8WA 2ACZB 5L1LA 3I5JC 5J8YA 5KT5A 3CWIA 2PFOA 4F92B 2JSVX 1QOBA 5HMLA 5DLFA 2JWZA 5KFIA 1NKEA 1IUEA 4UB6U 3PNCA 4UB8U 2KJHB 2KHVA 1A6SA 1FCCC 4L23A 4Z6FA 3NVVA 3KYDD 3PPAA 1KBUA 2AQ1B 2IO0B 3ZW3A 1ZE3D 5IA7A 3R2IA 1XO3A 4XX5A 5KL1B 2A1JA 4QZBA 1A70A 4ECZA 3B0AA 1NK9A 2I1QA 1FRDA 5KFMA 1D5MC 4DK5A 3RAXA 2Z59B 3IT6B 2MCNB 2P35A 4PHEA 5AHXA 2SEBD 3ONNA 5HNKA 3QZ8A 4C80A 1V86A 4QZ9A 4HKQA 1E90A 2Y0SF 5J2CA 3IXSA 3URYA 2KAJA 2WF7A 5J0YA 3RB4A 2PE9A 3NTUA 2E8PA 4ELTA 1IIPA 4P0QB 3PSIA 4B6WA 1Z3EB 4ANUA 2DZIA 3P4PB 1ZQAA 1TY0A 3EHVA 4LNFA 2XBBC 1E8ZA 4BFRA 2OXOA 1ZJMA 1UNSA 2J6TA 4OJ5A 1S77D 4MEYA 3SYZA 4JWNA 3V6JA 3SI8A 2VA3A 4II2B 4NQLB 2MAXA 4QAYA 3QK0A 5HP4A 3OLMD 4MSQB 3AU4A 4FBJB 1L0XB 1MPEA 3VCBA 3HP6A 1V5TA 4C00A 1FPYA 1UHUA 1XSPA 3JPPA 5B5EU 2QC8A 3Q3FA 3HM3A 1TIFA 2K6DB 2PEAA 5DPTA 1DYQA 4IQWA 2K60A 3PVXA 4WJOA 1B22A 1IP9A 3ED5A 2QEJC 1P1AA 1B43A 2P6RA 1V6EA 2C7HA 2GBMA 3BZKA 4XUSA 3PZ7A 4UAWA 1SF0A 3L3FX 2KKCA 4EE2A 1WM2A 4QZ8A 2YMLA 1WMHA 2G1EA 4M8NA 5KFYA 3VQIA 1P7EA 3GIJA 4KX5A 1ZQYA 1QOFA 1COKA 1PGBA 2MQJA 3F5AA 2RR9A 2WXFA 3KHLA 1J7CA 4YD2A 4N6EB 3I63C 1QLBB 1BNOA 1WGGA 1Z1BA 2P66A 3H8WA 2FDRA 3SENA 4ASWC 1QCKA 1K53A 4WH4A 4E71A 3BJYA 8ICQA 1S8OA 4Y2RA 1HUOA 1XXGA 4DQSA 2LVQA 4M02A 4GC7A 2LI6A 5JTIA 2Y1IA 4C7ZA 3PLVA 4UB4A 1SV0A 2NRVA 4HWIB 1ZD3A 2Q5WD 4GLXA 1KH0A 1RRBA 1WX8A 2BWFA 3H8MA 2V9WA 3Q14C 8ICAA 2E8NA 2IJ0A 2Q0ZX 3AMZA 4UARA 5KG6A 2AL6A 3LYSA 3HJEA 2K8CB 2HVIA 2HBKA 3QXGA 2HW3A 1RQLA 5ALMA 5FK9C 8ICBA 3BS5A 2JT4B 3W5UB 3UMBA 1XF5L 5AUKA 5J2KA 3Q8AA 2E1FA 4RGMA 4PJ0U 2DYBA 3BK2A 2XY5A 1KLUD 4NY8A 3PX0A 1CK1A 2R2OA 3WCQA 1MFWA 1D6EC 3H8SA 3TAPA 4DFKA 1L7YA 3OGUA 3RNEC 2D5GA 3ZNID 2FE9A 5L9XA 2KX3A 4XWTA 1P98A 3PY8A 4Q8FA 4KDLB 3ZQ4A 1GO3F 3AE9B 3PR4A 3RH6A 1S0OA 2V9HA 4NAWA 3WK9A 1ZOLA 3NS8A 1X9SA 4NLGA 2ON8A 1NDDA 4DQQA 3H8JA 3NHEB 4ZYSA 3V62A 5DG8A 4JL9A 1GNUA 1UH6A 2RDIA 3BVMA 4CQNA 4R64A 3CNHA 2CHXA 3GE3C 3N3KB 2WB1C 2LZ6A 9ICSA 4EELA 3WKCA 3C2LA 4KLJA 1JW9D 2V1YA 4RQ5A 4KX6B 4II3B 4RQ3A 2BYEA 3DDHA 1BPXA 3M62B 2HI0A 1SIFA 5F9NA 2I1KA 4F4XA 2HTHA 1TAMA 3T3OA 1TS5A 4ED7A 2FLPA 2KTRA 1L5UA 1ZQVA 2EAPA 1LFDA 2K3UA 1WJ4A 5IINA 2AGPA 3TACB 3H0LB 3PV8A 5AUIA 4YL8A 3N4MB 4NLBA 3I9V1 1ZQOA 3U26A 2FPLA 3BYTB 3PHXB 1AN8A 2LGXA 4IS7A 3AE7B 4O3OA 4NJ7A 3VUWA 3MJWA 3SV3A 1Q3VA 3GDXA 3X23A 2BR0A 2NBUA 4FBTA 1E8XA 3UGBB 3PV1A 3L16A 2DPIA 3GZNI 5C23A 4KSKC 5KL8B 2LGIA 1GPXA 2LRUA 1B0XA 2FLNA 4IDIA 4LNKA 1C77A 5KFEA 1TKDA 5KT4A 2V3SA 5E6NA 4O9MA 3PO0A 2BGWA 4OJLA 2BCRA 3KUZA 4DF4A 2MWSB 4BXOB 2PPHA 4LDTD 2IO1B 5HHIA 3AI5A 2REXA 1DGJA 1EF1A 4PZOA 1OW5A 2Y9UA 2LUMA 3TBLD 4M0WB 3R3MA 2KN5A 1EUVB 4RU9A 3GFKB 5J29A 2HBJA 1J7AA 2B6GA 3RJIA 5DB9A 7ICHA 2NPTB 3N97B 1R4MB 1BGXT 3AH7A 9ICNA 4OVUA 3A0HU 3HWTA 2MJEA 1NNLA 4HK2A 3HIZA 4Z6CA 5KFKA 4RNOA 1WJ6A 3N30A 3ZUNA 3TEZA 2LVPA 3CRXA 2JHDA 5DBAA 2ZIUA 3PW0A 1WFYA 3RNBC 2GLEA 3U52E 3ORYA 2NO4A 2C2EA 2PI4A 5J0OA 3RJEA 1J97A 1IXRA 3UPQA 4X5VA 3NZSA 3IV6A 4C8OA 3SU8X 3VHTC 4LNIA 3WKAA 2MUTB 4TMAB 5KHQA 3PVLA 2XCPA 4F1SA 3SZ2A 2KDIA 3KBBA 2KFZA 2EMTA 1NJWA 2N1VA 1WJUA 2WYQA 2E8OA 3ISDA 2DENB 1JXEA 5AKJA 3TI0A 3I1YA 4IRCA 2YQEA 5DDMA 4KN4A 3RZWC 1YQ3B 1HEZE 5ALFA 5KG5A 1I4RA 2KACA 4EBCA 2ZTEA 2J42A 2EZZA 4RM8A 2DKZA 1WGRA 3MGVA 1XNSA 4ELUA 3BQTA 3AE2B 7ICTA 3ECIA 1FD6A 4NJCA 1RM6C 4UAUA 4R3DA 2K8CA 1X40A 8ICUA 2DKXA 2JU6X 3BK1A 4EZ6A 3N7RC 2WF9A 1JWMD 3RJFA 2KFKA 5L1KA 2DQNB 9ICTA 2AX5A 1EU4A 3KHHA 5C2TB 2KG5A 2KK0A 3QX7A 3SAFA 2DHZA 1FFUA 4WQOB 5HR6A 9ICBA 1SL0A 3JVZX 4OW0A 1T7PA 1D5XC 5L95C 2R8GA 1ECWA 1NEKB 2RDJA 1ZQCA 3ZYYX 2V4QA 4AP9A 1AQ6A 2JH1A 2N9KA 2OYYA 1OGWA 5AZGA 1L6NA 2YVCA 2H3ZA 4ZRPA 2JEFA 3B08A 3RJJA 3IG3A 4DEZA 4TQ1A 3OG5A 2QB1A 2LEKA 3RYTA 3V61A 1ZRNA 2ESEA 5F3XB 4DL7A 3QHTA 4CHKA 4QW9A 2JEGA 1E7VA 4PYZA 2EELA 1PYWD 1F0MA 3Q8MA 3KWLA 2BS3B 3RRGA 1XLOA 1D8LA 1K8RB 5AKXA 1JCKB 2R8JA 1YQ4B 5KG0A 4UB5A 4J9SA 1D8BA 2G3QB 2K0PA 2X8XX 5L83A 4WWOA 3HK0A 2ZPYA 4BKGA 4O3RA 4HPMB 3UQBA 2BKFA 3A9KA 1B1ZA 4GIVA 1N62A 3H7IA 5AK4A 5AKYA 4DSJA 2RPVA 4GB9A 4O1NA 3TIXA 3OHBA 1VZ7A 1STEA 1JMSA 5DB7A 1QILA 3WK4A 5D6JB 2FCMA 2H3FA 5LXIB 3GZFA 2LI5A 2WF6A 5HHHA 3IFWB 3KHRA 5ALHA 4RNAA 2FMPA 4PK1A 4H2AA 4TSSA 2C60A 3RUIB 2L3ZA 5AK6A 2DAJA 1X2IA 3M95A 4FJYA 2OJRA 3EFCA 8ICJA 4XA5A 2PXIA 1I4XA 1U49A 4EEKA 1ZQWA 2YMQA 9ICPA 1WGDA 1GG3A 4M2YA 4CNQA 2JMGA 1SWVA 4DL4A 2L00B 2OCEA 1L7NA 2C7NB 2YB1A 1PVQA 3VC8A 1Q0WB 2KJ9A 1J7BA 5KFXA 1XC9A 3Q6BA 1PQSA 1JWBD 4QZFA 2HHXA 2KWDA 4IW0A 1JXLA 3QCAA 1QQ6A 3BZDB 5G2NA 2XCAA 3BQ0A 5AKHA 1Z5SB 1V1PA 4QWBA 1NK6A 2YTUA 2JF5A 1FNWA 4DQIA 1YIWA 3C19A 2N9XA 2BKRB 4EX6A 2AQ4A 8ICWA 4J03A 2W3RA 4MGKE 1XCTL 3SD7A 5KT7A 1ENFA 9ICLA 2NBVB 3NZ3A 3MFIA 2MP2B 3ZLZA 3WU2U 2LBOA 1ROEA 4WIPA 4DL2A 4ED8A 1XU4A 3MR3A 4A9AA 2MA9B 4KZ0A 4USAA 2RSUA 3PX4A 1P9DU 4HEA1 2M19A 1GB1A 1F77A 5AK3A 2CXYA 1QSSA 1KM7A 1ZQHA 2KZMA 3G6VA 3NGDA 4Q8EA 9ICCA 3HVDA 1FNUA 2AHOB 1V80A 2PKEA 2JX5A 4RQ4A 2M56B 4Z6DA 4D2KA 3M6ZA 4MJSA 1PUZA 5DG9A 3PLUA 1VJ5A 5E6JA 5J18A 1YD8U 3QE9Y 1C79A 4Y2SA 4EEYA 2PFNA 3JSVA 3NZUA 4NNJB 3L10B 1OQQA 2L76A 3KH0A 4I28A 2KE7A 2Y0SC 4IKGA 3B2GA 1HQRD 4OVVA 5J0RA 5BMGA 3NUQA 9ICVA 1LKYA 1ZUD2 4NWIA 4FS1A 4B95A 3DBHI 1A0PA 4DL5A 2INCC 3F2BA 3PGEA 1DK3A 4PL2A 4IQTA 4PPXA 8ICNA 2PMVA 2ZVNA 4FADA 3ZXVA 3T3NA 1M94A 2IGDA 1UWXA 3FDSA 2WXLA 2BPCA 4DOCA 2HHWA 4ECRA 2QLTA 1BPZA 3AL0B 4ECVA 5ALPA 2RP5A 3P4RB 5KG1A 3HPOA 3QUTA 3V7KA 2R2QA 1QQ5A 1RG6A 1EWYC 3TL5A 2ZXIA 3H40A 4PGQA 3ENEA 5ALSA 4DFDA 2LXAA 2EANA 3AEFB 1WWVA 2PMZC 3AXCA 4YMNA 1IM4A 4BVUC 1T5XD 2ZIUB 2KVSA 2UU7A 1Z2MA 4RQNA 1U48A 1Y8RC 2LD9A 5D3DA 3TUOA 4J9QA 4UB1A 3H1UA 4UAYA 4W9JA 7ICGA 4EUTA 1ET9A 3QU9A 2WXQA 4JWUC 3TANA 3C23A 4K4IA 4MF2A 1I4HA 4IL6U 5AKEA 2BB6A 4XRHA 2V0GA 3M63B 1SXEA 4GXKA 2R61A 5DB8A 2HOIA 2RD0A 4JQWC 5KFLA 2FMQA 1U47A 5DPWA 3R66C 4I2BA 1HIWA 3W9CB 2XIDA 1KJTA 3AE3B 3LYYA 2EKEC 4KGSA 1DOYA 3AEDB 4EZJA 2CU1A 2MBQA 1FEZA 1D9DA 4R66A 2IO3B 5IIMA 3IRUA 5C1ZA 3WKDA 2QCZA 1LKYB 3ZDDA 4XWWA 2WDRB 4IUMB 4QZEA 2UVRA 4YN4A 2MBHA 3FAHA 4MGIE 4JPSA 2FPMA 1S10A 1KOTA 3VRBB 1F44A 3AEAB 3TKAA 5D7GA 3MBYA 3QX1A 3ZTDA 4ED0A 2D8CA 3RBDA 4MEXA 3RRHA 3MC9A 2IGGA 4ANWA 1LVHA 1ZW7A 1RZTA 1WGYA 1X42A 3UM9A 5J2AA 2KDEB 3ZJTA 4MACA 5GTHU 1MJDA 5ALNA 2LWPA 2G4SA 3KD3A 1ZRMA 1FXTB 5MPOA 1PVRA 2LMRA 4MM3A 4EX7A 1E7UA 4FBUA 5KNIA 1NK0A 1TZOA 1V8CA 2PVOD 2ATLA 4HJKA 3AEGB 1J2MA 1M6YA 1DOQA 2KDBA 4FLHA 3RB6A 1UF0A 2KHWB 3M9OB 5IIIA 3ZO5B 2BQRA 4FA6A 1H8CA 1U4BA 3Q8LA 2HHQA 2JR5A 2LM1A 5L1IA 2O6KA 4KITB 4WURA 1MG8A 3PRZA 4A3OA 4FXCA 1K5OA 4B0MA 2XEWA 2DLBA 3AULA 5KT6A 4NM1A 3RNGC 1JIHA 4YD1A 2ASLA 3KHGA 1KF6B 2FBWB 2WX1A 3RNAC 2V4LA 1ZQRA 1I4PA 3C8YA 5G5GA 4XYCA 3GZNB 4I2EA 2K4HA 1LQBA 2A4ZA 3N1XC 2JZPA 3BINA 1BMLC 4BJQA 1AARA 1NENB 2UVWA 4P1CC 3PW7A 1UD7A 2WXIA 2H3QA 2ZNVC 5J0UA 3GQCA 7ICFA 1VZ8A 2JZ3B 1K52A 1E5WA 4F5OA 3MR5A 5KG4A 1L0YB 2W9CB 2KIWA 3N28A 4B9LA 4WQMA 2KZ3A 3PSTA 4QZHA 2YB4A 2N7DA 2GWSA 2OOBB 2AGQA 1YN3A 3GIIA 5IP4D 1PFDA 2MSED 1YX6B 4KMOB 2Y5PA 4BZAA 1VCBA 4WWMA 1KKXA 2O2VB 3UIPB 3AEEB 8ICMA 1Y56A 1SJHD 4BKSD 5ALJA 2YMMA 1ZP0B 2PE6B 3LJ3A 1WXSA 5AICA 1ZPSA 2OEHA 1S3SG 3BQ1A 3QZ7A 1AW7A 2EKIA 1E6EB 5DDYA 4Q43A 4TURA 2OWOA 8ICKA 1NK7A 1C76A 2KDMA 1F52A 2UYZB 4KLSA 4KN7A 3T5HA 2KWUB 1X9WA 4M9LA 2KQ7A 3DBLI 5L1MA 1E8YA 4ED3A 1UA0A 4BBNC 1NK8A 3NG0A 1RDFA 2NCNA 2HHSA 1KFTA 1ZQXA 5BOMA 2KNJA 1KW4A 2ALZA 4CRXA 3H6NA 3QUCA 3JW0X 1RYRA 5CA7A 1NK5A 2JQRB 2LYAA 3BQ7A 3H7PB 4LTUA 4AS1A 4ARCA 3ZIMA 2K8BB 2QB0A 4FFDA 3TADC 3KUDB 4C7YA 3MP9A 3KFUF 4LDTB 2K39A 3QQ8B 1FM0D 5KFOA 1SKSA 3KZIU 1R4NB 1ZGUB 2WLBA 3RTVA 4KLTA 1IV8A 2EZXA 4I2CA 4RGTA 1A5RA 4LNNA 4HJGE 4IM3A 2F3NA 2V4RA 1MG4A 2FI1A 3RF9A 4KZCA 4JWMA 2DPJA 4NPNA 2KMDA 2Y5BB 2YX8A 1TKGA 2IZVB 3ICXA 2PFPA 3VAWA 1OXJA 1SKWA 8ICGA 3NJTA 1PGXA 3RJKA 3ZJUA 2WAQC 2O2VA 3MHZA 1JROA 3LB8C 1WX7A 1L8OA 1L3TA 4AYBF 3DBSA 5DB6A 1TGZB 3RR8A 5AEKB 1KDHA 2YEPF 3IDWA 4FZNA 1ESFA 3KUCB 2N7EA 4IM0A 5AKGA 4ZDVA 3PHWB 3SFDB 3TEYA 1UGJA 4IR9A 5KFGA 2LYBA 2W55A 2HHTA 2DYOA 5J0WA 4IC7B 1CI4A 1UPHA 1Q8KA 3OPXA 3EUB2 1PK3A 4LNOA 4MEMA 3ZDMC 2ZG6A 5J0PA 3DQVA 4PS8A 5ALZA 1N61A 4ELVA 4Y2JA 2CKHB 4CE6A 3K1ZA 1PDXA 4M9NA 4NZLB 3UI3A 4YXMA 1L7MA 4C4RA 2JZBA 1TY2A 1WIAA 4R65A 1WXMA 1XCQL 2KMCA 8ICOA 3VH3B 2K5PA 1NK4A 2C2DA 1IYFA 2ASDA 2KN7A 3OJ4B 2XC9A 3B9JA 2F44A 1F5SA 1YZ7A 2NRZA 2V4IB 2WXMA 4DSKA 4M9JA 1PK1B 2JPHA 4WJPA 1BNPA 1RLFA 5CHFA 1FNVA 2MBOA 5J2BA 2EH9A 2VANA 5AKLA 3A9JA 4RQ8A 2VH2A 3AEBB 1SL1A 5AM4A 4DS4A 2JWUA 2LHDA 1DOIA 1Z19A 4CF4A 1FIQA 5KG2A 1C4CA 1QSLA 3SAHA 1QOAA 4Q2JA 1ED1A 2K22A 3Q8RB 3FYHA 3ZI4A 1MC8A 2MLBA 3IVFA 5ALYA 2BWES 3A1QB 2GH1A 2DFLA 1YN5A 3QWZB 3QAQA 1L2NA 2CU3A 4OJPA 2RDBC 1ZDVA 5CHWA 2E5SA 4YMMA 3AQFA 4AOFA 1BT0A 2N9EB 3MGHA 3Q8FA 4BOSC 4JLCA 1IBXA 2D11A 3K4GA 3PRPB 4YP3A 2G06A 2JXXA 3HHMA 3JPNA 2ZTCA 2LUEA 5AM3A 1UWMA 2L52A 1E0ZA 3WIMA 5BOLA 4DLEA 3OWEB 4KLEA 3CSTA 5DBCA 2D10A 4PHAA 5CHGA 4OZAA 1L3UA 3O13A 1ZETA 1P0RA 1WWTA 2W43A 3RBEA 2X38A 1T0YA 4K1RB 1ET6A 5ALVA 2RGFA 2HBLA 4KLIA 2F8KA 2VJ5A 1QTMA 1XO1A 1KTKA 1SXDA 5DPSA 1ZQTA 4MT5A 2L8JA 2AQ2B 4ECSA 4UBBA 3PW5A 5AM1A 1K50A 2KC2A 2Z8LA 5G55A 3DEEA 3ETRA 4QWCA 2IOFK 3RCZA 9ICJA 3I57A 4US8A 2H3IA 4RUCA 2HCFA 4LZGA 3I3TB 3AQEA 4M6WB 4JV1A 2KLGA 1RFAA 2PIAA 4F5RA 3C1ZA 5G5HA 3RPFC 1JWUD 2I2YA 2DGZA 4EZLA 1VJKA 3Q3OC 3HVZA 5KFUA 3IT4B 3MR2A 2D3CA 3R9KA 3T3FA 1ZOYB 2PLPA 4M01A 2ZW0A 3C2MA 4GIBA 2MRPA 2W9AA 1KFSA 1BUIC 1ZQIA 1KRPA 3QARA 5BYSA 1Z00B 9ICKA 7ICSA 3V3XA 2RHFA 5KFJA 1YJ1A 2PKOA 5JHAA 3K9OB 4I27A 1S0VA 3LWLA 2WXRA 4F50A 4TQSA 2WXGA 2J0JA 1ZQ1C 1FO4A 5LXHA 1WE7A 2M1MA 3KZXA 3UXPA 2F77X 1L5PA 5EWFA 2KD0A 3DHGC 3PMNA 4Y2TA 3AU6A 2LJ5A 4PS3A 3UF8A 1WRDB 2ZJDA 8ICVA 2NS5A 1KEJA 2MSNA 1QSYA 4DHZB 2WB1F 4PH5A 3HX0A 3ISBA 4QNLA 1GB4A 2CR5A 1TK0A 5C5JA 3QJZA 5KAIU 1RYJA 2GI9A 3RR7A 2G0AA 3PSPA 4PT5A 4ICUA 2DNFA 4I2GA 3KW5B 1F1HA 4QW8A 5J2FA 1I4GA 2H89B 1CEZA 5AI8A 3ZRFA 4F5QA 3PX6A 3DBHB 1BPBA 5IIKA 1DRGA 1WF9A 4F8CB 2NTSA 2F1HA 3T9LA 4DSIA 4GDKA 4LLGM 5TR5A 1JQ4A 4YXJA 3DWGC 3NUHB 4RH6A 1JMLA 3OHAA 4EYHB 3CIRB 3M1YA 3V7LA 3THVA 4Z6EA 5CWRA 1AROP 2G08A 2WDTB 4MH0E 4TV3A 3E2EA 3P63A 2J0KA 4DWFA 2F8LA 4A8EA 4YCXA 1NJYA 4F8RA 2E3TA 4TUQA 1Q1OA 2LGDA 3ML8A 3CMMB 2VZKD 2DZMA 9ICIA 2NRXA 1L7PA 2NMQA 3TCAA 2ZCBA 3B0YA 3V72A 2ZIXB 2IHNA 3AE8B 4E3CA 4QIWF 5DQIA 2QHOA 4O3PA 7ICRA 1XO0A 1SBBB 2ISOA 3IG8A 2KX0A 3ZDAA 3D2SA 3EPIA 3PZ8A 1T4GA 2B0CA 5J2EA 1WZ0A 9ICRA 3IBEA 3H0RB 4RQ7A 4P1BC 4YT0B 2GOWA 1UQVA 2IY1B 4I2IA 1CJEA 3JSVB 4NL9C 3I28A 2C22A 2N4FA 2GMIC 3GV5B 4O3QA 2H3VA 2V3NA 4RGOS 5IIOA 3W1SA 3GP7A 2J0MA 3S2AA 3ZDCA 4RMAA 3T5LA 1ZQNA 5IN7A 3FILA 4HCPB 3PZPA 1T0SC 3L5KA 4GGQA 4W9DA 3PTFC 4I2JA 1DXSA 2A19A 2OEDA 4M9GA 4MDKE 1Q3UA 1C7YA 4WAFA 5D46A 2KVCA 2MJDA 1CMXB 1G6JA 2L5YA 3UINB 4NM2A 3H4DA 2K4EA 2BGFA 3Q3JA 2JRZA 1UA1A 2HTME 2M0NA 4J9RA 1JWSD 1SXTA 2WS3B 3GE8C 2JYEA 3ZD9A 1R4MI 5D3IB 4J3OD 2KC1A 3A9JB 2BT6A 2BQUA 3AE4B 4K7SA 2HHVA 2JRHA 3OAWA 1JRUA 2G07A 2W7OA 3BYYB 3HRDD 1D9FA 1QF6A 4G3XB 2V3PA 4B9TA 3L4PA 4DQOC 4RT2A 4GU2A 5ALWA 3VR8B 4R8UA 5E79U 5AKZA 4RCOA 4PS7A 3Q8PB 1XD3B 5AZHA 4DFJA 4MFFA 5KFDA 3EECA 4WJ3B 3ZNZB 2GRIA 4HVBA 3PMLA 2MRLA 2W9BA 2JUOA 5KHOA 2KJ6A 4J9MA 2MHJA 1FRRA 3V60A 1V85A 2MH7A 3H4BA 4F4KA 3N9YC 3ALRA 3V6EB 3B0XA 3TFSA 1HUZA 1GUAB 1ZXHA 3AE5B 5C0YA 1YX5B 1V9JA 2WXOA 3ZXRA 4CF5A 4I6NB 3RULA 4XDCA 2XICA 4F72A 1OUQA 4JK1A 1A76A 2XY7A 3ONSA 2KVZA 2WX0A 1JRPA 2M0AA 5CRXA 4GSWA 5JH5C 5LNK1 1HJPA 2W7PA 2BPFA 3AECB 1YOVB 2D3AA 2MUTA 2ODGA 4CGZA 2B21A 1J0GA 2MU2A 1X66A 1KN5A 2OHFA 5DKWA 1TKYA 1QLNA 3OJ3A 2ZTDA 1KQQA 1WJNA 1ZQLA 1C1YB 4HPPA 1Q46A 3VR9B 3RJHA 2LYHA 2NRTA 4KLMA 4W9GA 4RNMA 2FMSA 2K8BA 1XSLA 1QKZA 5J2GA 2QARA 5KFBA 4M0WA 4A8XC 4PGYA 4YSZB 2MA1A 1SB3C 1N5XA 2ISPA 3M9NB 2WAQF 4P7IA 4I6PA 1N5WA 2AH5A 5CB1A 3N32A 2KWVB 4U7CA 1C4PA 2DBYA 3ZTCA 3RFAA 3C1YA 4HDQA 2KDFB 1MA7A 3RH4A 1N60A 1L3SA 7ICEA 1ZQZA 4ANVA 2AJQA 2L0TA 4O3SA 4L1BA 4K7WA 1RYUA 1COOA 4P4PA 7ICIA 4TQRA 5ALEA 2P6UA 2C28A 3LDZE 2F76X 4C8KA 2O6VD 2QDFA 2FUHB 4FZLA 4DOAA 2G4DB 4QZCA 3RAQA 1ZQPA 1SE3A 2GBKA 2ZZPB 4KGTA 2WFAA 1FXAA 4Y2PA 1CRXA 4CCHA 5KT3A 5J2HA 1RWSA 3DVNU 4DHJD 5KFSA 3SD5A 4DOBA 2QIEB 2ONQA 2KMMA 3TEWA 1BXTA 4OJ6A 5ALIA 1XQQA 2CPRA 4RGNA 4ZHOA 3APCA 4UDUC 2WDQB 2XI9A 5ALOA 1KTQA 2AEHA 3HM6X 3IAS1 4ZYNA 2HVHA 4KLUA 2LVOA 5IO9A 4L2YA 1S1QB 1FCLA 4DXFA 1MQ3A 2LMCA 4PHDA 4J9PA 2KWCA 5ALXA 4TKNA 2K89A 3E0FA 2E1EA 5AM5A 4C8LA 1RQNA 1GAQB 5DGBA 4G9BA 3H9DA 2G09A 1T0RC 2ZNVB 9ICOA 2M4NA 4HCNB 5HHDG 1A77A 4QZAA 2MBBB 3U7DA 4MFCA 5J2RA 3MHSD 4A90A 3BVGA 1J19A 1IBXB 4DFPA 1JN3A 2KSOA 3NS1A 4P4MA 2KK8A 1WMHB 4KLLA 2WGSA 2MEKA 2Y5CA 2GB1A 2D3GA 2JXTA 5ALQA 2ICIA 3AV8A 3GV7B 3UQ2A 4IOIE 2O6VB 3PZDA 3VH4B 3MR6A 5J2DA 2MW5A 4EKUA 2RQ5A 4JV0A 1IGDA 4OZBA 2ZIVB 1EM7A 4O5EA 4W9IA 4IQUA 5C3JB 5KT2A 1IPGA 3PO4A 4DWIA 1UELA 5AIAA 4LJXA 4I2AA 2LXCA 8ICZA 3K75D 4DFMA 3WK5A 4YSYB 4ACFA 4R63A 5IAAC 3JPRA 4ECYA 2BDUA 4PZNA 2QB0B 2KSOB 2IGHA 1I7HA 2SAKA 3MFGA 4NV0A 3BZCA 2HJ1A 3W5VB 1UT8A 5TISU 1NJZA 2K6QA 1NKBA 2UVUA 1ZQJA 4GDLA 5FKAC 4AJYB 2FLLA 5CJ7A 1HXYD 2K4PA 4FO6A 2KIVA 1M4VA 3KKAA 3MGIA 5CR0A 3T79A 2RDGA 5H8YE 1WXVA 1PZNA 3PT2B 2KMAA 1F2RC 2PMZF 2CJNA 4XC2A 2DF4B 2ZXHA 4IWPA 5B66U 4J6IA 2JGAA 3QIJA 2ZUDA 1L6VA 7ICQA 1WYWB 3MC1A 3IN5A 3WK8A 3KYCD 3S6JA 4EZ9A 3IHQB 3QUQA 2BHNA 4S0RA 1TK8A 1TAUA 1NI2A 4NQKE 2BB5A 1V1OA 2KTRB 8ICIA 1ZQDA 3B2FA 4HXDA 3MFHA 2W54A 3QU4A 3RT3B 4JB3A 5TZVA 2N7JA 2ZIVA 1WM3A 1TK5A 2WXJA 1P7FA 4F71A 1HEKA 1SWWA 2LKYA 3TMPB 1HZ5A 2J53A 3QA8A 5D94A 2XVTA 1RAXA 4RQ6A 3ZVVA 4B9KA 3VTVA 4F4WA 1L3VA 2GBRA 4WWNA 3C2KA 3V7JA 1UCVA 1V49A 1WE6A 4NJ8A 3OSPA 1HE8A 1TZ1A 2F1JA 5BYRA 2KKVA 3RMKC 1X9MA 1WGKA 2F2AB 3Q3NC 3BS7A 4AYBC 3ZDBA 1X1MA 2KANA 5IILA 2K8AA 3GIMA 4IM2A 4W9HA 5DLGA 3ZDTA 3GV8B 2L32A 4CO7A 1O03A 3BQ2A 9ICWA 4NLNA 1R7SA 3T5JA 4QZGA 3PSEB 1URJA 4P2HA 1XLQA 2VJ4A 5EE1A 4BKTA 1SJED 5EE3A 1SE4A 5I4DA 2BBCA 2BQQA 2C7MB 1S0MA 4WAAA 5LLIA 1VZ6A 4FJZA 4W9FA 3D6JA 2PI5A 1LB2B 1Q5WB 5J2IA 1ISNA 2WNMA 3KQ4A 2HSZA 3A1QA 3SR6A 2B3AA 4ECTA 2ZW1A 1NKCA 2DYMA 2KNBA 2XK5A 3P4SB 4LZDA 3LVVA 1E9MA 1YT3A 4KIKB 5KFHA 3RB3A 4DDID 5KFRA 4BGDA 2R8IA 4QJFB 5DCNA 4DSEA 2IMWP 4LJPB 4YWGG 3QUBA 5BPCA 3ZNHB 1I35A 2KLCA 2EQYA 4UW9A 1VDVA 5JRTA 2DX5B 2NBWB 3DOWA 1BPYA 1X6JA 4ZOHC 2N0SB 2NTTA 2NYVA 2M8SA 3NASA 1L4DB 2FE8A 5EWEA 5HFYA 2J6SA 4K3CA 2BDPA 3AE6B 1TS3A 4IQVA 1EXNA 4ED6A 3TQ1A 4OO1J 4DDGD 1WXAA 5ALLA 2WXNA 5GTIU 5JHBA 1MHXA 4PYUA 4RQ0A 4WWPA 2BZFA 5FR6A 1MQ2A 3MC0B 3RJGA 2D3BA 1Y88A 2BYTA 2J6UA 3HILA 2UVVA 2B76B 1NJXA 4JIOU 2I6XA 4I29A 1MHHE 3U7ZA 1R4NI 7ICJA 2JVCA 2IDYA 4B6JA 5CP2A 2WHEA 4DQRA 1YJJA 3C21A 5EWGA 2INDC 4YMOA 5D2MB 4WJNA 4DS5A 4G50A 1GC6A 2GLSA 3C0RB 4REZA 4A6QA 4C4TA 3MDCA 8ICRA 1NOMA 1L0VB 4LVSA 4NJ6A 5EE0A 1MI0A 3ZGZA 1LGRA 3EW9A 2WF8A 2ZEQA 4HKZE 3PRMB 4KIKA 1JALA 1T3QA 2HBMA 1ZQKA 1NZBA 1YNTE 4KTQA 4MGYE 3APFA 4HRSA 1YQBA 4KKJA 1BVSA 1Z00A 4UATA 3GS2A 1SKRA 4YR3A 4Y2QA 4E74A 4TUUA 2INPE 4Y2XA 1ZYQA 3OJUA 2W3SA 5AI6A 4RT3A 3H8HA 4G0NB 4IG7B 4ZHPA 5EDSA 1C3TA 5F9LA 5JUMA 4OJOA 4O3NA 2KHQA 1JI7A 4O0IA 1E7PB 4RNNA 3SV4A 1X6IA 1AYFA 4M04A 5J0TA 3WK7A 4Q44A 2KTQA 4MM3B 1WR1A 2RPQA 4F2RA 4I6LB 5KTQA 1UBQA 2XN9C 4YTPB 4US9A 2AXTU 3ETLA 3RNFC 1KSPA 1V2YA 2AYOB 1F2RI 2NO5A 3QEAZ 2IY0B 8ICEA 1HTQA 1WZ3A 1P3QU 3NOBA 3GIKA 4IRDA 2R8HA 3NRZA 2OM6A 2FUG1 1I42A 5KFTA 1S9FA 4LCDE 5DGAA 5AI5A 8ICSA 1CUKA 4MF8A 3Q8SB 3P42A 2FIDA 4KSLC 2A1JB 3U8ZA 2K9XA 1FMAD 4KMUA 2W9CA 4N59A 1V9PA 2QMTA 2ES6A 3F5EA 4NXZA 1XLPA 1ZKHA 1WX9A 3W1SC 2PW9A 4LJOB 1TBEA 4EBDA 4O5KA 1J8CA 2JRIB 2RMMA 4RF0A 3E58A 1TS2A 3M3JA 2EAMA 4BXOA 5KG3A 2VIXA 4ITKA 3DV9A 5D49A
chains in the Genus database with same CATH topology
1WXQA 3EA6A 4OVZA 2W3RA 2WDVB 1XCTL 1ENFA 3AE8B 3NZ3A 1NI3A 1SBBB 3LXFA 1ROEA 4WIPA 2H88B 5T8IA 5BYQA 4A9AA 4YTNB 4USAA 3PZ8A 4P16A 4HEA1 2E6XA 2M19A 1GB1A 1F77A 1FFVA 1SEBD 1KLGD 1ACCA 3DWMA 1V1PB 1HZ6A 1WSPA 4YT0B 3HVDA 1EU3A 1IGCA 1CJEA 1FNUA 1I4QA 2BW2A 1DOXA 3FC4A 1SSNA 2JX5A 4D2KA 2M56B 2LHEA 1E10A 2V3NA 4RGOS 1KRHA 3V05A 3W1SA 3GP7A 5E6JA 1D4BA 2WXQA 1C79A 3FILA 1OQQA 4XDDA 3SFEB 4IKGA 3B2GA 1HQRD 2OEDA 4WAFA 5BMGA 5JXVA 1ZUD2 2MJDA 2TSSA 1TYGB 1YN4A 4B0EA 1Q10A 2PMVA 2LFIA 1JWAD 1OFFA 3W2DA 2HTME 3T3NA 2WS3B 1JWSD 1SXTA 2IGDA 3Q69A 1UWXA 2JYEA 3RFZB 2WXLA 1CZPA 3MJ5A 2LJIA 5D3IB 2VZKB 4J3OD 2BT6A 3AE4B 2CJOA 2ACZB 3P4RB 2WP9B 2MJ3A 3KWVA 3ABVB 3CWIA 4DXGA 1OQRA 1EWYC 2J52A 1QOBA 2JSVX 3Q8EA 3BYYB 3HRDD 1QF6A 3AEFB 2V3PA 4YXDB 1IUEA 3L4PA 4DQOC 3P4QB 2W82A 1T5XD 3VR8B 1FCCC 4RCOA 4L23A 2L83A 1CQVA 3NVVA 3TUOA 5D3DA 2AQ1B 2GRIA 1ET9A 1ZE3D 4JWUC 2I38A 1XO3A 3R2IA 1I4HA 2BB6A 1A70A 2V0GA 1FRRA 1VR9A 1FRDA 1D5MC 1D5ZC 2MH7A 2R61A 3N9YC 2BTEA 3IT6B 2SEBD 1ZXHA 4C80A 3AE5B 2WU5B 2WXOA 3W9CB 4HKQA 1VLBA 4XDCA 3IXSA 3AE3B 3URYA 2KAJA 3LYYA 4KGSA 1DOYA 3AEDB 3AE1B 4ZRQA 1JRPA 2M0AA 5LNK1 4XWWA 2WDRB 3P4PB 3AECB 1TY0A 1VRAB 4GDKB 1V97A 1ZDXA 3FAHA 4JPSA 1UNSA 3AM9A 3VRBB 2OHFA 1QQRA 1NYRA 3AEAB 1TKYA 5D7GA 3VR9B 2IGGA 1N63A 1QKZA 1L0XB 4M0WA 4A8XC 1MPEA 3ZJTA 4YSZB 4MACA 1SB3C 1N5XA 1FXIA 5MPOA 1TS4A 2RDHA 1N5WA 1DYQA 1TZOA 3HUIA 1C4PA 1V8CA 2DBYA 2PVOD 2QEJC 3AEGB 1N60A 4L1BA 3PZ7A 1SF0A 4EE2A 2G1EA 3VQIA 1P7EA 4WURA 4FXCA 1QOFA 4B0MA 1PGBA 2DLBA 1FEHA 1MVKA 2WXFA 1J7CA 4KGTA 1SE3A 4N6EB 1QLBB 4JWSC 1FXAA 1RWSA 1ZXIA 1KF6B 1NYQA 1XEEA 2FBWB 2QIEB 1K53A 4WH4A 2ONQA 1I4PA 2KMMA 3BVZA 3C8YA 5G5GA 1XXGA 3TEWA 1BXTA 3NVWA 4C7ZA 4JX1C 4RGNA 4ZHOA 4AQ7A 2JZPA 4UDUC 1BMLC 1NENB 2WDQB 2Q5WD 1KH0A 2WXIA 2KN4A 3IAS1 4NAMA 2IJ0A 3AMZA 1VZ8A 2WXHA 4L2YA 1K52A 4GLSC 1SIJA 1FCLA 4DXFA 1L0YB 2LMCA 4WQMA 1L6UA 5EE9A 5FK9C 3W5UB 1YN3A 1XF5L 1PFDA 5AUKA 1GAQB 2Y5PA 3Q8AA 4C56C 4WWMA 4RGMA 3BK2A 3AEEB 1Y56A 1KLUD 1SJHD 5HHDG 1CK1A 1ZP0B 3WCQA 1K51A 2WQYB 1D6EC 1ZPSA 1AW7A 2D5GA 4XWTA 2EKIA 3BVGA 4A90A 1E6EB 3BWUD 3ZQ4A 1IBXB 3NS1A 3AE9B 4YSXB 1C76A 2KDMA 3VRAB 1WYGA 1NVID 2MEKA 2Y5CA 4P6VF 2ON8A 2GB1A 2XNAC 2JXTA 2ICIA 3AV8A 4IOIE 4ZYSA 4OZCA 2JQRB 3BVMA 4LTUA 4OZBA 4CQNA 1IGDA 4ARIA 3U2SC 1GOZA 5HI1A 4AS1A 4ARCA 1EM7A 5BMIA 5C3JB 1T6BX 4C7YA 2KQ4X 3MP9A 4YTMB 1JW9D 1UUPA 3EGRA 4KX6B 5FR3A 1FM0D 2WLBA 4YSYB 4GDLB 2QJLA 2IGHA 3MFGA 4RGTA 2SAKA 1I7HA 1SE2A 4HJGE 1QT9A 3GB1A 3W5VB 3T3OA 1TS5A 1TKGA 5FKAC 1HXYD 3E9SA 1PGXA 2HDEA 2K3UA 3ZJUA 3MHZA 1M4VA 1JROA 3LB8C 2RDGA 5AUIA 3U4EG 5H8YE 3SEBA 3I9V1 1YMHE 1F2RC 3BYTB 1AN8A 2CJNA 2YEPF 1RFKA 3AE7B 1ESFA 3TEYA 3SFDB 1UGJA 2Y3AA 1L6VA 2W55A 1PUTA 2G9HD 2WU2B 2DYOA 4LK0M 2L1AA 3EUB2 2LGIA 1GPXA 1N61A 4IDIA 2BB5A 1V1OA 1C77A 1PDXA 1AWDA 4KKIA 3B2FA 2W54A 2N7JA 3PO0A 2BS4B 4NZLB 3UI3A 2WXJA 1P7FA 1HZ5A 1TY2A 1XCQL 2J53A 2K5PA 2WXKA 1DGJA 1TKEA 1B9RA 3B9JA 2LUMA 2PTLA 2V4IB 2WXMA 5BYRA 1C9FA 1WGKA 4RF1A 5H92C 1FNVA 4MH8A 1J7AA 3AEBB 2JWUA 3AH7A 2LHDA 1DOIA 2L32A 1FIQA 1C4CA 2MJEA 4NAWB 3TEZA 1QOAA 1R7SA 2J4XA 3R2TA 4Q2JA 2K22A 2JYTA 3U52E 1XLQA 3IAM1 4N58A 5EE1A 1SJED 3J9CA 5EE3A 1SE4A 1YN5A 5I4DA 2BBCA 1HA5A 2CU3A 1VZ6A 4TMAB 1ZDVA 2WNMA 3KQ4A 1F0ZA 3SR6A 1KFYB 2ZW1A 3Q8FA 2DYMA 4JE3B 3P4SB 1IBXA 1E9MA 2PVGC 3AN1A 3NVYA 4XE0A 2IPKD 1UWMA 2L52A 1YQ3B 1HEZE 1E0ZA 3OWEB 1I4RA 2KACA 2DWQA 2J42A 4YWGG 4OZAA 3O13A 1WWTA 1VDVA 4A55A 3E56A 3AE2B 2X38A 1QOGA 1FD6A 1ET6A 4ZOHC 1RM6C 2N0SB 2NTTA 4NJCA 5GXGB 4R3DA 2JU6X 3BK1A 1L4DB 2FE8A 1WRIA 3Q8BA 1KTKA 5HFYA 1JWMD 4MT5A 3AE6B 1TS3A 2AQ2B 2AX5A 2Z8LA 1TJEA 1EU4A 1K50A 5C2TB 3ETRA 2WXNA 1FFUA 1MHXA 4HROA 3I57A 4OW0A 4US8A 1D5XC 3MC0B 3ZJVA 1NEKB 2PIAA 2BYTA 3Q8CA 5G5HA 3RPFC 3ZYYX 1JWUD 5BMHA 2I2YA 2B76B 1VJKA 2N9KA 1C4AA 3HVZA 1MHHE 3IT4B 2AQ3B 4ZRPA 5TSSA 3U7ZA 1ZOYB 2PLPA 1C78A 2IDYA 2ZW0A 4TQ1A 1YJIA 1YJJA 2LEKA 2N9LA 4KGRA 1BUIC 4REZA 4A6QA 1L0VB 2EELA 1PYWD 5BYSA 5EE0A 3KWLA 1MI0A 3ZGZA 2BS3B 3V3XA 1XLOA 3KLSX 2QILA 1JCKB 4HKZE 4TQ0A 1JALA 1T3QA 2PKOA 1YQ4B 2K0PA 1YNTE 3TSSA 4HRSA 2WXRA 4KKJA 2WXGA 3P1MA 3GS2A 1FO4A 1B1ZA 1PGAA 1N62A 1L5PA 2INPE 2RPVA 3H8HA 4O1NA 2W3SA 4ZHPA 1VZ7A 1STEA 3NVZA 1QILA 5HG2A 2BS2B 3AB5A 3R8BA 1E7PB 1AYFA 1GB4A 4MM3B 4RNAA 1XLNA 2XN9C 1EWCA 1RYJA 4US9A 2GI9A 4H2AA 4RFBA 4YTPB 4TSSA 1L4ZB 1F2RI 2QSDA 4PT5A 1LO5D 1I4GA 1I4XA 2H89B 3BIID 3NRZA 2YEPB 2FUG1 3TEXA 2INNE 4OHJA 2NTSA 4LLGM 1JQ4A 3DWGC 3FILB 3NUHB 3P42A 4RH6A 2K9XA 1J7BA 1FMAD 1JMLA 3CIRB 2WXPA 4N59A 1JWBD 2QMTA 2KWDA 3BZDB 1XLPA 1V1PA 2PW9A 3P63A 2RMMA 2E3TA 1FNWA 4RF0A 1TS2A 2VZKD 2NMQA 4ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKY A;  1JW9 D;  2DWQ A;  4KX6 B;  1WXQ A;  1FM0 D;  2WLB A;  4YSY B;  2W3R A;  1WWT A;  2WDV B;  1VDV A;  3VR9 B;  3AE2 B;  3AE8 B;  1QOG A;  2QJL A;  4ZOH C;  1RM6 C;  2N0S B;  5GXG B;  1I7H A;  1N63 A;  1NI3 A;  1QT9 A;  3LXF A;  1ROE A;  1WRI A;  4YSZ B;  2H88 B;  3W5V B;  1SB3 C;  1N5X A;  1FXI A;  3AE6 B;  4A9A A;  4YTN B;  4USA A;  5MPO A;  1TKG A;  2AX5 A;  1TJE A;  2M19 A;  5C2T B;  1FFV A;  1N5W A;  3ETR A;  1FFU A;  3HUI A;  4HRO A;  1V8C A;  1JRO A;  4US8 A;  2DBY A;  2PVO D;  3DWM A;  3AEG B;  3LB8 C;  4YT0 B;  5AUI A;  5H8Y E;  1CJE A;  1NEK B;  1N60 A;  2PIA A;  5G5H A;  3FC4 A;  3RPF C;  3ZYY X;  1DOX A;  1E0Z A;  2B76 B;  2JX5 A;  1VJK A;  2M56 B;  2CJN A;  3HVZ A;  1RFK A;  3AE7 B;  1E10 A;  1SF0 A;  1KRH A;  1ZOY B;  2G1E A;  3SFD B;  2OHF A;  1L6V A;  2W55 A;  1PUT A;  1YJI A;  1YJJ A;  2LEK A;  2WU2 B;  4FXC A;  1OQQ A;  1QOF A;  3SFE B;  3EUB 2;  3B2G A;  1J7C A;  1L0V B;  4N6E B;  1QLB B;  4JWS C;  1GPX A;  1FXA A;  1N61 A;  1RWS A;  1ZUD 2;  1ZXI A;  3KWL A;  4IDI A;  1KF6 B;  1NYQ A;  1XLO A;  2BS3 B;  1PDX A;  1AWD A;  2FBW B;  2MJD A;  1TYG B;  2QIE B;  3B2F A;  2W54 A;  1JAL A;  1T3Q A;  2PKO A;  1YQ4 B;  3PO0 A;  1JWA D;  1OFF A;  2BS4 B;  2HTM E;  2KMM A;  5G5G A;  2WS3 B;  3NVW A;  4HRS A;  4C7Z A;  1CZP A;  4YTM B;  4JX1 C;  4ZHO A;  5EE0 A;  2K5P A;  3P1M A;  1NEN B;  2BT6 A;  2Q5W D;  1FO4 A;  2WDQ B;  3AE4 B;  2CJO A;  1DGJ A;  1TKE A;  2ACZ B;  1N62 A;  3P4R B;  1B9R A;  1L5P A;  3B9J A;  2MJ3 A;  2WP9 B;  3ABV B;  2W3S A;  3AMZ A;  1OQR A;  1EWY C;  3CWI A;  1QOB A;  4ZHP A;  1SIJ A;  3HRD D;  3NVZ A;  1QF6 A;  3AEF B;  1WGK A;  4YXD B;  5H92 C;  1IUE A;  3L4P A;  2BS2 B;  4WQM A;  1L6U A;  3P4Q B;  3AB5 A;  1J7A A;  5EE9 A;  3VR8 B;  1E7P B;  3W5U B;  1AYF A;  3AEB B;  2L83 A;  3NVV A;  1PFD A;  1GAQ B;  3AH7 A;  5AUK A;  1DOI A;  4WWM A;  1XLN A;  1FIQ A;  1RYJ A;  2MJE A;  4US9 A;  3AEE B;  4YTP B;  4JWU C;  1XO3 A;  1QOA A;  1R7S A;  3WCQ A;  1ZP0 B;  2WQY B;  2K22 A;  1A70 A;  1FRR A;  1FRD A;  1XLQ A;  2H89 B;  2MH7 A;  3BII D;  2EKI A;  4N58 A;  3NRZ A;  1E6E B;  5EE1 A;  5EE3 A;  2CU3 A;  3NS1 A;  3AE9 B;  4YSX B;  4C80 A;  3AE5 B;  3VRA B;  1WYG A;  1NVI D;  1JQ4 A;  2WU5 B;  3W9C B;  3DWG C;  2Y5C A;  4P6V F;  1VLB A;  2K9X A;  1J7B A;  1FMA D;  3AE3 B;  2KAJ A;  1DOY A;  1F0Z A;  3SR6 A;  3AED B;  3AE1 B;  1JWB D;  1KFY B;  3AV8 A;  3CIR B;  4N59 A;  3P4S B;  1JRP A;  1XLP A;  2JQR B;  2WDR B;  1E9M A;  3AEC B;  3P4P B;  4LTU A;  2PVG C;  3AN1 A;  3P63 A;  3NVY A;  1V97 A;  2E3T A;  3FAH A;  5C3J B;  3AM9 A;  4C7Y A;  1UWM A;  1YQ3 B;  2L52 A;  1NYR A;  3VRB B;  4ITK A;  3AEA B; 
#chains in the Genus database with same CATH topology
 1ZQE A;  4TUP A;  1WXQ A;  3EA6 A;  4XGA B;  4OVZ A;  4RQ2 A;  2W8K A;  5AI9 A;  1BPE A;  2YN4 A;  2WDV B;  1N2X A;  3H7P A;  3TJP A;  4UB3 A;  2XGP A;  9ICU A;  1RXW A;  3SMV A;  3C28 A;  1GJZ A;  3SDL C;  2K25 A;  4EZK A;  2D3D A;  4FN2 A;  2H88 B;  5T8I A;  4Y2U A;  4MEL A;  5BYQ A;  5KFF A;  1EO6 A;  1K1Q A;  3TAR A;  1ZQU A;  1IG6 A;  2LGS A;  4P16 A;  4EOY A;  2E6X A;  2LGY A;  3IHP C;  3JPQ A;  3EFU A;  3KOO A;  1SEB D;  3F2C A;  1KLG D;  1ACC A;  4JMU A;  1V1P B;  3UQ0 A;  1HZ6 A;  1WSP A;  4RQM A;  1EU3 A;  4NY0 A;  4HDO A;  1DOX A;  4UAV A;  4ECQ A;  3VUX A;  2XY6 A;  4NLC A;  1UT5 A;  5ALK A;  4M9H A;  3K9P B;  3DHH C;  1D4B A;  4RPY A;  3NRW A;  1TT5 B;  4F3O A;  2CHZ A;  2ZUB A;  3JPS A;  4RZR A;  2DUY A;  3LK9 A;  2W03 A;  1TVA A;  2FCS A;  2N9P C;  5L1J A;  3LWM A;  4ZH4 A;  2AU0 A;  5AK5 A;  2XK5 B;  2NRW A;  2KZZ A;  4DQP A;  2BCV A;  1LV5 A;  5JXV A;  4J9K A;  2TSS A;  3A0B U;  5ALT A;  2VA2 A;  2JEJ A;  2EMS A;  4B0E A;  1Q10 A;  4ANX A;  3DVG X;  4IR1 A;  2LFI A;  1JWA D;  1OFF A;  2JEI A;  4DLG A;  3RFZ B;  8ICP A;  5FP0 A;  4M0A A;  3MJ5 A;  4PGX A;  2KEY A;  2LJI A;  2JXJ A;  3VTW A;  1OEY J;  5JZE B;  4M00 A;  3FM9 A;  2IOF A;  3N1Z C;  7ICO A;  2WP9 B;  2MJ3 A;  3KWV A;  8ICT A;  3ABV B;  4DXG A;  1OQR A;  1XT9 B;  2J52 A;  4K7U A;  3Q8E A;  3ISC A;  1B4F A;  3ALB A;  2MP2 A;  4YXD B;  4C0Z A;  3DPD A;  3QEB Z;  3P4Q B;  2W82 A;  2ZIW B;  3ZDE A;  3H0M B;  2L83 A;  1CQV A;  3CP8 A;  5CHV C;  5E6O A;  2I38 A;  3QNM A;  2KIC A;  4J9O A;  3WAO A;  2G45 B;  4R8U B;  3JYU A;  2GBJ A;  3BS5 B;  3CW2 C;  1VR9 A;  3L54 A;  5CEH A;  2YY6 A;  1D5Z C;  5HR7 A;  1ZQM A;  2M0X A;  1X9X A;  1JUD A;  4KLQ A;  2BTE A;  5D4B A;  3WAN A;  2KZR A;  2DZJ A;  2KVR A;  2WU5 B;  5DPR A;  4MGZ E;  4ECX A;  3W1Y A;  1VLB A;  5J0Q A;  5IOI A;  2D6F C;  1U4A A;  2ZJA A;  4ZRQ A;  3AE1 B;  3H7S A;  3HT3 A;  2H5X A;  2FJ6 A;  3EPG A;  3Q8Q B;  3BDP A;  1TTN A;  5J17 A;  4J9L A;  4ZRI A;  5KFN A;  2AL3 A;  1TV9 A;  1VRA B;  3HKZ C;  4GDK B;  1V97 A;  1ZDX A;  3AM9 A;  3WAL A;  1NYR A;  1QQR A;  4DL3 A;  2L05 A;  2PJH A;  4KLH A;  4UB2 A;  2I5H A;  8ICY A;  2RLT A;  5IIJ A;  1XSN A;  1MSW D;  3K1R B;  4EEN A;  4O5C A;  4B9S A;  1UBI A;  1KLN A;  2GOL A;  1U45 A;  2BKE A;  1N63 A;  1F9J A;  3C5F A;  4BX9 C;  4GC6 A;  1NBF C;  5J0X A;  1FXI A;  9ICA A;  3CSF A;  2G5H B;  4ECW A;  2JZZ A;  4MFA A;  1TE2 A;  3HKZ F;  3M7D A;  4BAX A;  3IM1 A;  1TS4 A;  2K1F A;  2RDH A;  7ICK A;  4QIW C;  3HUI A;  1T94 A;  3AU5 A;  2YLM A;  2Q4T A;  3QC8 B;  2HOQ A;  4EYI B;  2KQS A;  4AUQ C;  3V6C B;  1JX4 A;  3L17 A;  4W9C A;  4PHP A;  3T5K A;  1OQY A;  5AIB A;  1SE9 A;  2VRR B;  3ZRC A;  4N9F 4;  5A0L A;  3G6X A;  3D2Q A;  4UAS A;  4YG2 A;  4DSL A;  7ICV A;  3DBR B;  2A3V A;  4YR0 A;  5AI4 A;  5DQG A;  3RZF A;  2GBN A;  2A1A A;  3KVF B;  1FEH A;  1MVK A;  4JV2 A;  2WHI A;  3TAD A;  4JWS C;  3CF6 E;  2KO3 A;  4IWO A;  1ZXI A;  1TFR A;  3A9K B;  3WAM A;  3WK6 A;  4DL6 A;  1NYQ A;  2ASJ A;  1XEE A;  5KFA A;  2FIF A;  4I2D A;  4F93 B;  4ZRK A;  3BVZ A;  5KAF U;  1TAQ A;  3IG5 A;  3NVW A;  3M8S A;  2CRX A;  5CTR C;  3RI7 C;  3QU7 A;  4JX1 C;  2VA8 A;  4AQ7 A;  1WCN A;  1ZQS A;  2G5I B;  4M8M A;  2KJ5 A;  1T8E A;  2KN4 A;  4UBC A;  2CN1 A;  2W04 A;  4NAM A;  4F91 B;  5HMM A;  3PR5 B;  4HYK A;  9ICE A;  4FUL A;  2WXH A;  5ALG A;  1S76 D;  4QZD A;  4GLS C;  2BYF A;  1SIJ A;  2ZJ8 A;  5AI0 A;  3L08 A;  1L6U A;  5EE9 A;  2EZY A;  4J9N A;  9ICM A;  3Q3M C;  5J0S A;  2R8K A;  2ZVO A;  1ZQF A;  4C56 C;  3MDA A;  1V5O A;  2N1W A;  4ACO A;  1V81 A;  1D3Z A;  2JV3 A;  2N1R A;  2BYV E;  2VH1 A;  3F53 A;  1QH9 A;  9ICQ A;  2A5U A;  4M6W A;  2KKP A;  5EOZ A;  1K51 A;  2WQY B;  5JU5 A;  3PSF A;  4YQW A;  3L0W B;  3DVN V;  5ALD A;  2OH2 A;  3A33 B;  4F5N A;  2F1I A;  2IOH A;  2AWT A;  2HJ8 A;  3BWU D;  3KTQ A;  4YSX B;  3VRA B;  1Z4O A;  4BWM A;  3APD A;  1WYG A;  8ICL A;  4E0D A;  1NVI D;  3L13 A;  4P6V F;  4DBG A;  4NLK A;  2XNA C;  1YZ6 A;  2FCN A;  2W9N A;  3RB0 A;  3R7R A;  1ZD4 A;  4K4H A;  5AKI A;  2M9N A;  3PS6 A;  4OCZ A;  4OZC A;  3QU5 A;  2D2Q A;  4C4V A;  2BCQ A;  4G11 A;  4ARI A;  5AZF A;  1GOZ A;  5HI1 A;  3RD2 A;  3U2S C;  4CDG A;  5BMI A;  1SZP A;  1T6B X;  2RRD A;  1VD2 A;  2KQ4 X;  9ICG A;  4YTM B;  3P2B A;  3FKY A;  1H4R A;  2O6V A;  1UUP A;  3EGR A;  4P0Q A;  3DCG A;  4GFJ A;  3N20 C;  4YVZ A;  5FR3 A;  4CF3 A;  3UIO B;  4GDL B;  3OSN A;  5KFW A;  2QJL A;  2FNJ B;  1WG8 A;  3SEI A;  5DBB A;  2W8L A;  4C8M A;  1SE2 A;  3ZKJ C;  1QT9 A;  4ICV A;  2IBK A;  4K3B A;  2IHM A;  3GB1 A;  4DHJ B;  3GOE A;  3WAP A;  3C29 A;  4KVG B;  2KXJ A;  2UWQ A;  4A20 A;  3VUY A;  1SL2 A;  3E9S A;  3X0W A;  4DSF A;  3UXN A;  4A3P A;  2FCQ A;  2HDE A;  3DBL B;  4MJS B;  3PRE A;  3F2D A;  4GOC A;  3ML9 A;  3WA0 A;  3Q2A C;  3U4E G;  4RPX A;  1T0Q C;  3UXO A;  3SEB A;  3GIL A;  1LM8 B;  2R18 A;  3VDZ A;  1WR6 E;  1YMH E;  2KOX A;  3UQA A;  4GMV A;  1N48 A;  3J81 j;  1RFK A;  4X57 B;  9ICF A;  1SZH A;  1PK1 A;  1NZP A;  3BY4 B;  4KX3 A;  3ZD8 A;  4GXB A;  5DQH A;  2Y3A A;  1PUT A;  3VXW A;  2G9H D;  2WU2 B;  1MN8 A;  1PVP A;  4B9V A;  4NL9 A;  4LK0 M;  2L1A A;  3DBR I;  2E8M A;  2C2R A;  7ICP A;  4EEW A;  8ICX A;  1O08 A;  3M8R A;  3RNC C;  4RQ1 A;  1AWD A;  4KKI A;  5J8Y C;  1D8Y A;  5ALU A;  4AWJ A;  2BS4 B;  2D07 B;  7ICM A;  2BPS A;  5HKH A;  7ICN A;  2BVC A;  4KLO A;  4DHZ E;  4HPL B;  5AKK A;  3UMG A;  2WXK A;  4ECU A;  1TKE A;  2CHW A;  2C9W B;  1B9R A;  2I9G A;  4JUZ A;  2AQ0 A;  3EYZ A;  2YMP A;  2VKQ A;  2PTL A;  3UMC A;  1C20 A;  3WKE A;  2W9M A;  3AU2 A;  4G3I A;  1C9F A;  2LHT A;  4RF1 A;  5H92 C;  1WY8 A;  2MX2 A;  3B1L X;  4KLG A;  4MH8 A;  2LAS A;  2W11 A;  2WWZ A;  1P7D A;  2M17 A;  3QU2 A;  4DCC A;  2Z0E B;  5T14 A;  4IC9 A;  1GC7 A;  2KJR A;  4TUS A;  4NAW B;  2GO7 A;  2LPE A;  4GXI A;  2J4X A;  3R2T A;  3RN9 C;  4IRK A;  1WWU A;  4C4S A;  2JYT A;  2NPT A;  4W9E A;  5KG7 A;  3IAM 1;  1U9L A;  3AUO A;  1QZE A;  4N58 A;  3J9C A;  4ICA A;  3V6H A;  2C5L C;  4B9N A;  2KD1 A;  1HA5 A;  2ZJ5 A;  4MHV A;  3SQI A;  4S17 A;  4XZ4 A;  4ED2 A;  3CYM A;  1XS9 D;  2KFN A;  4UQG A;  5GMV A;  1F0Z A;  2AGO A;  2BQ3 A;  4EBE A;  2DL0 A;  1KFY B;  4BWJ A;  4JE3 B;  3LVW A;  3N1Y C;  1KLV A;  5E6P A;  4IWQ A;  4FE3 A;  2DZK A;  2Y9T A;  4HAI A;  2ZCC A;  2IO2 B;  2PVG C;  3AN1 A;  4F4Y A;  3NVY A;  5DG7 A;  3TAQ A;  3JPO A;  4XE0 A;  2IPK D;  5H2F U;  2LM4 A;  2L0F A;  2DWQ A;  1RYS A;  3A4S C;  3N7S C;  2K4I A;  4P4O A;  1WI0 A;  4F2S A;  3E56 A;  3VTU A;  4A55 A;  2MBE A;  1QOG A;  3RH5 A;  4KLD A;  4AP4 C;  3VVW B;  5GXG B;  2EAO A;  1UZX B;  1SGH A;  3U30 A;  1KFD A;  4PL1 A;  3ZNG C;  3JPT A;  1WRI A;  3Q8B A;  4BOZ B;  1SV0 C;  2KV2 A;  3A4R A;  2ASQ A;  1WCL A;  2ZUC A;  1TJE A;  2HHU A;  4BDP A;  5KFZ A;  2IA6 A;  1S5L U;  3N7P D;  4HRO A;  4DF8 A;  2XO7 A;  1Z1V A;  4RPZ A;  2W9B B;  7ICL A;  3VFK A;  1WH3 A;  3ZJV A;  2L7R A;  3Q8C A;  2WTF A;  3GU3 A;  4QZI A;  2EDU A;  5BMH A;  4CYE A;  1BPD A;  1C4A A;  2CS4 A;  1ZQQ A;  2JY6 A;  1EF5 A;  2AQ3 B;  5TSS A;  1C78 A;  2JH7 A;  2HMX A;  1YJI A;  1Z4N A;  3R7Q A;  3PO5 A;  2N9L A;  4I2F A;  3T8M A;  5K4L A;  4KGR A;  4UAZ A;  4FHJ A;  4YFK A;  1OTR B;  2DAF A;  3MTN B;  5KFP A;  2IBI B;  5KFV A;  3KLS X;  2QIL A;  4TQ0 A;  1K1S A;  2IYD B;  3M6K A;  3TSS A;  1KL9 A;  2NR2 A;  1J2N A;  3OTQ A;  4BKS A;  1ZJN A;  2ZIW A;  3P1M A;  2FPK A;  4KDI C;  2HD5 B;  3NY5 A;  1S97 A;  1PGA A;  2NVU I;  2J7Q B;  3DVG Y;  4AJW A;  5CX3 A;  1QQ7 A;  4O3M A;  2QAR B;  3NVZ A;  1N56 A;  2BCS A;  5HG2 A;  2BS2 B;  4F7Z A;  3AB5 A;  3R8B A;  4YR2 A;  2KTF A;  1N6Z A;  4ZRJ A;  3TFR A;  3V6K A;  4C4V B;  1HTO A;  4BUG A;  2HOF A;  1XLN A;  4RFB A;  3O0F A;  1RPL A;  1EWC A;  1S0N A;  2ZPN A;  1L4Z B;  2QSD A;  4Q45 A;  2FAZ A;  4HLE A;  3IP4 B;  1LO5 D;  3BII D;  4FZM A;  3PW4 A;  1DK2 A;  3O65 B;  2ZIX A;  2YEP B;  3TEX A;  4EFO A;  1T3N A;  4NLZ A;  2WF5 A;  2INN E;  4OHJ A;  3SHQ A;  4DXA B;  3FIL B;  4MSM B;  3WKB A;  1ZQG A;  2BF8 B;  2KJ8 A;  3EC8 A;  3G6Y A;  2WXP A;  4RUA A;  2BPG A;  1OEY A;  4JGH B;  4BBN F;  7ICU A;  1DGS A;  2Z7J A;  1L8L A;  1L7O A;  2KOB A;  4GN1 A;  4P0P B;  4Y2Y A;  2OJW A;  1ZD2 P;  1H38 A;  2HE7 A;  5ALR A;  4B9M A;  1XWL A;  1RXV A;  1V38 A;  3HW8 A;  3LDA A;  3DHI C;  4K81 A;  4M47 A;  1NI3 A;  4Y2V A;  2KP7 A;  3LXF A;  1SV4 A;  4GXJ A;  3I76 A;  3SAG A;  4YTN B;  3Q8K A;  5AM2 A;  4K4G A;  3AEV A;  3MC8 A;  3PW2 A;  1FFV A;  5KFC A;  1SGG A;  2HDO A;  2PFQ A;  3DWM A;  4WJQ A;  1ZD5 A;  4ED1 A;  2JZB B;  2Y1J A;  1IGC A;  1I4Q A;  3M9M B;  4B9U A;  1UGM A;  8ICF A;  4KV2 A;  4QWE A;  2BW2 A;  2XGQ A;  3FC4 A;  2NV3 A;  1SSN A;  2K8H A;  2KFK B;  4RM9 A;  1LXD A;  2LHE A;  1E10 A;  4KLF A;  4I2H A;  1KRH A;  3V05 A;  3OJS A;  4QWD A;  3KKA C;  8ICC A;  2KFJ A;  4W9K A;  4F4Z A;  2Z0D B;  2KYW A;  2QKQ A;  3MAB A;  4F5P A;  3DDC B;  4XDD A;  3SFE B;  5J2J A;  4C8N A;  3QYP A;  1ZQB A;  4U6P A;  2I1J A;  9ICX A;  4OD0 A;  1TYG B;  1YN4 A;  3D32 A;  8ICH A;  2BCU A;  1WGH A;  4XQ8 A;  5IKC M;  3W2D A;  4QWA A;  4P0P A;  5AM0 A;  4FHK A;  3EWA A;  3Q69 A;  4FJV B;  3C5G A;  1CZP A;  5KFQ A;  4URK A;  3EZ5 A;  2KT7 A;  2LRW A;  9ICH A;  2VZK B;  5BO4 B;  3D2N A;  1WUD A;  4FS2 A;  2CJO A;  4W9L A;  4DO9 A;  1E8W A;  2ACZ B;  5L1L A;  3I5J C;  5J8Y A;  5KT5 A;  3CWI A;  2PFO A;  4F92 B;  2JSV X;  1QOB A;  5HML A;  5DLF A;  2JWZ A;  5KFI A;  1NKE A;  1IUE A;  4UB6 U;  3PNC A;  4UB8 U;  2KJH B;  2KHV A;  1A6S A;  1FCC C;  4L23 A;  4Z6F A;  3NVV A;  3KYD D;  3PPA A;  1KBU A;  2AQ1 B;  2IO0 B;  3ZW3 A;  1ZE3 D;  5IA7 A;  3R2I A;  1XO3 A;  4XX5 A;  5KL1 B;  2A1J A;  4QZB A;  1A70 A;  4ECZ A;  3B0A A;  1NK9 A;  2I1Q A;  1FRD A;  5KFM A;  1D5M C;  4DK5 A;  3RAX A;  2Z59 B;  3IT6 B;  2MCN B;  2P35 A;  4PHE A;  5AHX A;  2SEB D;  3ONN A;  5HNK A;  3QZ8 A;  4C80 A;  1V86 A;  4QZ9 A;  4HKQ A;  1E90 A;  2Y0S F;  5J2C A;  3IXS A;  3URY A;  2KAJ A;  2WF7 A;  5J0Y A;  3RB4 A;  2PE9 A;  3NTU A;  2E8P A;  4ELT A;  1IIP A;  4P0Q B;  3PSI A;  4B6W A;  1Z3E B;  4ANU A;  2DZI A;  3P4P B;  1ZQA A;  1TY0 A;  3EHV A;  4LNF A;  2XBB C;  1E8Z A;  4BFR A;  2OXO A;  1ZJM A;  1UNS A;  2J6T A;  4OJ5 A;  1S77 D;  4MEY A;  3SYZ A;  4JWN A;  3V6J A;  3SI8 A;  2VA3 A;  4II2 B;  4NQL B;  2MAX A;  4QAY A;  3QK0 A;  5HP4 A;  3OLM D;  4MSQ B;  3AU4 A;  4FBJ B;  1L0X B;  1MPE A;  3VCB A;  3HP6 A;  1V5T A;  4C00 A;  1FPY A;  1UHU A;  1XSP A;  3JPP A;  5B5E U;  2QC8 A;  3Q3F A;  3HM3 A;  1TIF A;  2K6D B;  2PEA A;  5DPT A;  1DYQ A;  4IQW A;  2K60 A;  3PVX A;  4WJO A;  1B22 A;  1IP9 A;  3ED5 A;  2QEJ C;  1P1A A;  1B43 A;  2P6R A;  1V6E A;  2C7H A;  2GBM A;  3BZK A;  4XUS A;  3PZ7 A;  4UAW A;  1SF0 A;  3L3F X;  2KKC A;  4EE2 A;  1WM2 A;  4QZ8 A;  2YML A;  1WMH A;  2G1E A;  4M8N A;  5KFY A;  3VQI A;  1P7E A;  3GIJ A;  4KX5 A;  1ZQY A;  1QOF A;  1COK A;  1PGB A;  2MQJ A;  3F5A A;  2RR9 A;  2WXF A;  3KHL A;  1J7C A;  4YD2 A;  4N6E B;  3I63 C;  1QLB B;  1BNO A;  1WGG A;  1Z1B A;  2P66 A;  3H8W A;  2FDR A;  3SEN A;  4ASW C;  1QCK A;  1K53 A;  4WH4 A;  4E71 A;  3BJY A;  8ICQ A;  1S8O A;  4Y2R A;  1HUO A;  1XXG A;  4DQS A;  2LVQ A;  4M02 A;  4GC7 A;  2LI6 A;  5JTI A;  2Y1I A;  4C7Z A;  3PLV A;  4UB4 A;  1SV0 A;  2NRV A;  4HWI B;  1ZD3 A;  2Q5W D;  4GLX A;  1KH0 A;  1RRB A;  1WX8 A;  2BWF A;  3H8M A;  2V9W A;  3Q14 C;  8ICA A;  2E8N A;  2IJ0 A;  2Q0Z X;  3AMZ A;  4UAR A;  5KG6 A;  2AL6 A;  3LYS A;  3HJE A;  2K8C B;  2HVI A;  2HBK A;  3QXG A;  2HW3 A;  1RQL A;  5ALM A;  5FK9 C;  8ICB A;  3BS5 A;  2JT4 B;  3W5U B;  3UMB A;  1XF5 L;  5AUK A;  5J2K A;  3Q8A A;  2E1F A;  4RGM A;  4PJ0 U;  2DYB A;  3BK2 A;  2XY5 A;  1KLU D;  4NY8 A;  3PX0 A;  1CK1 A;  2R2O A;  3WCQ A;  1MFW A;  1D6E C;  3H8S A;  3TAP A;  4DFK A;  1L7Y A;  3OGU A;  3RNE C;  2D5G A;  3ZNI D;  2FE9 A;  5L9X A;  2KX3 A;  4XWT A;  1P98 A;  3PY8 A;  4Q8F A;  4KDL B;  3ZQ4 A;  1GO3 F;  3AE9 B;  3PR4 A;  3RH6 A;  1S0O A;  2V9H A;  4NAW A;  3WK9 A;  1ZOL A;  3NS8 A;  1X9S A;  4NLG A;  2ON8 A;  1NDD A;  4DQQ A;  3H8J A;  3NHE B;  4ZYS A;  3V62 A;  5DG8 A;  4JL9 A;  1GNU A;  1UH6 A;  2RDI A;  3BVM A;  4CQN A;  4R64 A;  3CNH A;  2CHX A;  3GE3 C;  3N3K B;  2WB1 C;  2LZ6 A;  9ICS A;  4EEL A;  3WKC A;  3C2L A;  4KLJ A;  1JW9 D;  2V1Y A;  4RQ5 A;  4KX6 B;  4II3 B;  4RQ3 A;  2BYE A;  3DDH A;  1BPX A;  3M62 B;  2HI0 A;  1SIF A;  5F9N A;  2I1K A;  4F4X A;  2HTH A;  1TAM A;  3T3O A;  1TS5 A;  4ED7 A;  2FLP A;  2KTR A;  1L5U A;  1ZQV A;  2EAP A;  1LFD A;  2K3U A;  1WJ4 A;  5IIN A;  2AGP A;  3TAC B;  3H0L B;  3PV8 A;  5AUI A;  4YL8 A;  3N4M B;  4NLB A;  3I9V 1;  1ZQO A;  3U26 A;  2FPL A;  3BYT B;  3PHX B;  1AN8 A;  2LGX A;  4IS7 A;  3AE7 B;  4O3O A;  4NJ7 A;  3VUW A;  3MJW A;  3SV3 A;  1Q3V A;  3GDX A;  3X23 A;  2BR0 A;  2NBU A;  4FBT A;  1E8X A;  3UGB B;  3PV1 A;  3L16 A;  2DPI A;  3GZN I;  5C23 A;  4KSK C;  5KL8 B;  2LGI A;  1GPX A;  2LRU A;  1B0X A;  2FLN A;  4IDI A;  4LNK A;  1C77 A;  5KFE A;  1TKD A;  5KT4 A;  2V3S A;  5E6N A;  4O9M A;  3PO0 A;  2BGW A;  4OJL A;  2BCR A;  3KUZ A;  4DF4 A;  2MWS B;  4BXO B;  2PPH A;  4LDT D;  2IO1 B;  5HHI A;  3AI5 A;  2REX A;  1DGJ A;  1EF1 A;  4PZO A;  1OW5 A;  2Y9U A;  2LUM A;  3TBL D;  4M0W B;  3R3M A;  2KN5 A;  1EUV B;  4RU9 A;  3GFK B;  5J29 A;  2HBJ A;  1J7A A;  2B6G A;  3RJI A;  5DB9 A;  7ICH A;  2NPT B;  3N97 B;  1R4M B;  1BGX T;  3AH7 A;  9ICN A;  4OVU A;  3A0H U;  3HWT A;  2MJE A;  1NNL A;  4HK2 A;  3HIZ A;  4Z6C A;  5KFK A;  4RNO A;  1WJ6 A;  3N30 A;  3ZUN A;  3TEZ A;  2LVP A;  3CRX A;  2JHD A;  5DBA A;  2ZIU A;  3PW0 A;  1WFY A;  3RNB C;  2GLE A;  3U52 E;  3ORY A;  2NO4 A;  2C2E A;  2PI4 A;  5J0O A;  3RJE A;  1J97 A;  1IXR A;  3UPQ A;  4X5V A;  3NZS A;  3IV6 A;  4C8O A;  3SU8 X;  3VHT C;  4LNI A;  3WKA A;  2MUT B;  4TMA B;  5KHQ A;  3PVL A;  2XCP A;  4F1S A;  3SZ2 A;  2KDI A;  3KBB A;  2KFZ A;  2EMT A;  1NJW A;  2N1V A;  1WJU A;  2WYQ A;  2E8O A;  3ISD A;  2DEN B;  1JXE A;  5AKJ A;  3TI0 A;  3I1Y A;  4IRC A;  2YQE A;  5DDM A;  4KN4 A;  3RZW C;  1YQ3 B;  1HEZ E;  5ALF A;  5KG5 A;  1I4R A;  2KAC A;  4EBC A;  2ZTE A;  2J42 A;  2EZZ A;  4RM8 A;  2DKZ A;  1WGR A;  3MGV A;  1XNS A;  4ELU A;  3BQT A;  3AE2 B;  7ICT A;  3ECI A;  1FD6 A;  4NJC A;  1RM6 C;  4UAU A;  4R3D A;  2K8C A;  1X40 A;  8ICU A;  2DKX A;  2JU6 X;  3BK1 A;  4EZ6 A;  3N7R C;  2WF9 A;  1JWM D;  3RJF A;  2KFK A;  5L1K A;  2DQN B;  9ICT A;  2AX5 A;  1EU4 A;  3KHH A;  5C2T B;  2KG5 A;  2KK0 A;  3QX7 A;  3SAF A;  2DHZ A;  1FFU A;  4WQO B;  5HR6 A;  9ICB A;  1SL0 A;  3JVZ X;  4OW0 A;  1T7P A;  1D5X C;  5L95 C;  2R8G A;  1ECW A;  1NEK B;  2RDJ A;  1ZQC A;  3ZYY X;  2V4Q A;  4AP9 A;  1AQ6 A;  2JH1 A;  2N9K A;  2OYY A;  1OGW A;  5AZG A;  1L6N A;  2YVC A;  2H3Z A;  4ZRP A;  2JEF A;  3B08 A;  3RJJ A;  3IG3 A;  4DEZ A;  4TQ1 A;  3OG5 A;  2QB1 A;  2LEK A;  3RYT A;  3V61 A;  1ZRN A;  2ESE A;  5F3X B;  4DL7 A;  3QHT A;  4CHK A;  4QW9 A;  2JEG A;  1E7V A;  4PYZ A;  2EEL A;  1PYW D;  1F0M A;  3Q8M A;  3KWL A;  2BS3 B;  3RRG A;  1XLO A;  1D8L A;  1K8R B;  5AKX A;  1JCK B;  2R8J A;  1YQ4 B;  5KG0 A;  4UB5 A;  4J9S A;  1D8B A;  2G3Q B;  2K0P A;  2X8X X;  5L83 A;  4WWO A;  3HK0 A;  2ZPY A;  4BKG A;  4O3R A;  4HPM B;  3UQB A;  2BKF A;  3A9K A;  1B1Z A;  4GIV A;  1N62 A;  3H7I A;  5AK4 A;  5AKY A;  4DSJ A;  2RPV A;  4GB9 A;  4O1N A;  3TIX A;  3OHB A;  1VZ7 A;  1STE A;  1JMS A;  5DB7 A;  1QIL A;  3WK4 A;  5D6J B;  2FCM A;  2H3F A;  5LXI B;  3GZF A;  2LI5 A;  2WF6 A;  5HHH A;  3IFW B;  3KHR A;  5ALH A;  4RNA A;  2FMP A;  4PK1 A;  4H2A A;  4TSS A;  2C60 A;  3RUI B;  2L3Z A;  5AK6 A;  2DAJ A;  1X2I A;  3M95 A;  4FJY A;  2OJR A;  3EFC A;  8ICJ A;  4XA5 A;  2PXI A;  1I4X A;  1U49 A;  4EEK A;  1ZQW A;  2YMQ A;  9ICP A;  1WGD A;  1GG3 A;  4M2Y A;  4CNQ A;  2JMG A;  1SWV A;  4DL4 A;  2L00 B;  2OCE A;  1L7N A;  2C7N B;  2YB1 A;  1PVQ A;  3VC8 A;  1Q0W B;  2KJ9 A;  1J7B A;  5KFX A;  1XC9 A;  3Q6B A;  1PQS A;  1JWB D;  4QZF A;  2HHX A;  2KWD A;  4IW0 A;  1JXL A;  3QCA A;  1QQ6 A;  3BZD B;  5G2N A;  2XCA A;  3BQ0 A;  5AKH A;  1Z5S B;  1V1P A;  4QWB A;  1NK6 A;  2YTU A;  2JF5 A;  1FNW A;  4DQI A;  1YIW A;  3C19 A;  2N9X A;  2BKR B;  4EX6 A;  2AQ4 A;  8ICW A;  4J03 A;  2W3R A;  4MGK E;  1XCT L;  3SD7 A;  5KT7 A;  1ENF A;  9ICL A;  2NBV B;  3NZ3 A;  3MFI A;  2MP2 B;  3ZLZ A;  3WU2 U;  2LBO A;  1ROE A;  4WIP A;  4DL2 A;  4ED8 A;  1XU4 A;  3MR3 A;  4A9A A;  2MA9 B;  4KZ0 A;  4USA A;  2RSU A;  3PX4 A;  1P9D U;  4HEA 1;  2M19 A;  1GB1 A;  1F77 A;  5AK3 A;  2CXY A;  1QSS A;  1KM7 A;  1ZQH A;  2KZM A;  3G6V A;  3NGD A;  4Q8E A;  9ICC A;  3HVD A;  1FNU A;  2AHO B;  1V80 A;  2PKE A;  2JX5 A;  4RQ4 A;  2M56 B;  4Z6D A;  4D2K A;  3M6Z A;  4MJS A;  1PUZ A;  5DG9 A;  3PLU A;  1VJ5 A;  5E6J A;  5J18 A;  1YD8 U;  3QE9 Y;  1C79 A;  4Y2S A;  4EEY A;  2PFN A;  3JSV A;  3NZU A;  4NNJ B;  3L10 B;  1OQQ A;  2L76 A;  3KH0 A;  4I28 A;  2KE7 A;  2Y0S C;  4IKG A;  3B2G A;  1HQR D;  4OVV A;  5J0R A;  5BMG A;  3NUQ A;  9ICV A;  1LKY A;  1ZUD 2;  4NWI A;  4FS1 A;  4B95 A;  3DBH I;  1A0P A;  4DL5 A;  2INC C;  3F2B A;  3PGE A;  1DK3 A;  4PL2 A;  4IQT A;  4PPX A;  8ICN A;  2PMV A;  2ZVN A;  4FAD A;  3ZXV A;  3T3N A;  1M94 A;  2IGD A;  1UWX A;  3FDS A;  2WXL A;  2BPC A;  4DOC A;  2HHW A;  4ECR A;  2QLT A;  1BPZ A;  3AL0 B;  4ECV A;  5ALP A;  2RP5 A;  3P4R B;  5KG1 A;  3HPO A;  3QUT A;  3V7K A;  2R2Q A;  1QQ5 A;  1RG6 A;  1EWY C;  3TL5 A;  2ZXI A;  3H40 A;  4PGQ A;  3ENE A;  5ALS A;  4DFD A;  2LXA A;  2EAN A;  3AEF B;  1WWV A;  2PMZ C;  3AXC A;  4YMN A;  1IM4 A;  4BVU C;  1T5X D;  2ZIU B;  2KVS A;  2UU7 A;  1Z2M A;  4RQN A;  1U48 A;  1Y8R C;  2LD9 A;  5D3D A;  3TUO A;  4J9Q A;  4UB1 A;  3H1U A;  4UAY A;  4W9J A;  7ICG A;  4EUT A;  1ET9 A;  3QU9 A;  2WXQ A;  4JWU C;  3TAN A;  3C23 A;  4K4I A;  4MF2 A;  1I4H A;  4IL6 U;  5AKE A;  2BB6 A;  4XRH A;  2V0G A;  3M63 B;  1SXE A;  4GXK A;  2R61 A;  5DB8 A;  2HOI A;  2RD0 A;  4JQW C;  5KFL A;  2FMQ A;  1U47 A;  5DPW A;  3R66 C;  4I2B A;  1HIW A;  3W9C B;  2XID A;  1KJT A;  3AE3 B;  3LYY A;  2EKE C;  4KGS A;  1DOY A;  3AED B;  4EZJ A;  2CU1 A;  2MBQ A;  1FEZ A;  1D9D A;  4R66 A;  2IO3 B;  5IIM A;  3IRU A;  5C1Z A;  3WKD A;  2QCZ A;  1LKY B;  3ZDD A;  4XWW A;  2WDR B;  4IUM B;  4QZE A;  2UVR A;  4YN4 A;  2MBH A;  3FAH A;  4MGI E;  4JPS A;  2FPM A;  1S10 A;  1KOT A;  3VRB B;  1F44 A;  3AEA B;  3TKA A;  5D7G A;  3MBY A;  3QX1 A;  3ZTD A;  4ED0 A;  2D8C A;  3RBD A;  4MEX A;  3RRH A;  3MC9 A;  2IGG A;  4ANW A;  1LVH A;  1ZW7 A;  1RZT A;  1WGY A;  1X42 A;  3UM9 A;  5J2A A;  2KDE B;  3ZJT A;  4MAC A;  5GTH U;  1MJD A;  5ALN A;  2LWP A;  2G4S A;  3KD3 A;  1ZRM A;  1FXT B;  5MPO A;  1PVR A;  2LMR A;  4MM3 A;  4EX7 A;  1E7U A;  4FBU A;  5KNI A;  1NK0 A;  1TZO A;  1V8C A;  2PVO D;  2ATL A;  4HJK A;  3AEG B;  1J2M A;  1M6Y A;  1DOQ A;  2KDB A;  4FLH A;  3RB6 A;  1UF0 A;  2KHW B;  3M9O B;  5III A;  3ZO5 B;  2BQR A;  4FA6 A;  1H8C A;  1U4B A;  3Q8L A;  2HHQ A;  2JR5 A;  2LM1 A;  5L1I A;  2O6K A;  4KIT B;  4WUR A;  1MG8 A;  3PRZ A;  4A3O A;  4FXC A;  1K5O A;  4B0M A;  2XEW A;  2DLB A;  3AUL A;  5KT6 A;  4NM1 A;  3RNG C;  1JIH A;  4YD1 A;  2ASL A;  3KHG A;  1KF6 B;  2FBW B;  2WX1 A;  3RNA C;  2V4L A;  1ZQR A;  1I4P A;  3C8Y A;  5G5G A;  4XYC A;  3GZN B;  4I2E A;  2K4H A;  1LQB A;  2A4Z A;  3N1X C;  2JZP A;  3BIN A;  1BML C;  4BJQ A;  1AAR A;  1NEN B;  2UVW A;  4P1C C;  3PW7 A;  1UD7 A;  2WXI A;  2H3Q A;  2ZNV C;  5J0U A;  3GQC A;  7ICF A;  1VZ8 A;  2JZ3 B;  1K52 A;  1E5W A;  4F5O A;  3MR5 A;  5KG4 A;  1L0Y B;  2W9C B;  2KIW A;  3N28 A;  4B9L A;  4WQM A;  2KZ3 A;  3PST A;  4QZH A;  2YB4 A;  2N7D A;  2GWS A;  2OOB B;  2AGQ A;  1YN3 A;  3GII A;  5IP4 D;  1PFD A;  2MSE D;  1YX6 B;  4KMO B;  2Y5P A;  4BZA A;  1VCB A;  4WWM A;  1KKX A;  2O2V B;  3UIP B;  3AEE B;  8ICM A;  1Y56 A;  1SJH D;  4BKS D;  5ALJ A;  2YMM A;  1ZP0 B;  2PE6 B;  3LJ3 A;  1WXS A;  5AIC A;  1ZPS A;  2OEH A;  1S3S G;  3BQ1 A;  3QZ7 A;  1AW7 A;  2EKI A;  1E6E B;  5DDY A;  4Q43 A;  4TUR A;  2OWO A;  8ICK A;  1NK7 A;  1C76 A;  2KDM A;  1F52 A;  2UYZ B;  4KLS A;  4KN7 A;  3T5H A;  2KWU B;  1X9W A;  4M9L A;  2KQ7 A;  3DBL I;  5L1M A;  1E8Y A;  4ED3 A;  1UA0 A;  4BBN C;  1NK8 A;  3NG0 A;  1RDF A;  2NCN A;  2HHS A;  1KFT A;  1ZQX A;  5BOM A;  2KNJ A;  1KW4 A;  2ALZ A;  4CRX A;  3H6N A;  3QUC A;  3JW0 X;  1RYR A;  5CA7 A;  1NK5 A;  2JQR B;  2LYA A;  3BQ7 A;  3H7P B;  4LTU A;  4AS1 A;  4ARC A;  3ZIM A;  2K8B B;  2QB0 A;  4FFD A;  3TAD C;  3KUD B;  4C7Y A;  3MP9 A;  3KFU F;  4LDT B;  2K39 A;  3QQ8 B;  1FM0 D;  5KFO A;  1SKS A;  3KZI U;  1R4N B;  1ZGU B;  2WLB A;  3RTV A;  4KLT A;  1IV8 A;  2EZX A;  4I2C A;  4RGT A;  1A5R A;  4LNN A;  4HJG E;  4IM3 A;  2F3N A;  2V4R A;  1MG4 A;  2FI1 A;  3RF9 A;  4KZC A;  4JWM A;  2DPJ A;  4NPN A;  2KMD A;  2Y5B B;  2YX8 A;  1TKG A;  2IZV B;  3ICX A;  2PFP A;  3VAW A;  1OXJ A;  1SKW A;  8ICG A;  3NJT A;  1PGX A;  3RJK A;  3ZJU A;  2WAQ C;  2O2V A;  3MHZ A;  1JRO A;  3LB8 C;  1WX7 A;  1L8O A;  1L3T A;  4AYB F;  3DBS A;  5DB6 A;  1TGZ B;  3RR8 A;  5AEK B;  1KDH A;  2YEP F;  3IDW A;  4FZN A;  1ESF A;  3KUC B;  2N7E A;  4IM0 A;  5AKG A;  4ZDV A;  3PHW B;  3SFD B;  3TEY A;  1UGJ A;  4IR9 A;  5KFG A;  2LYB A;  2W55 A;  2HHT A;  2DYO A;  5J0W A;  4IC7 B;  1CI4 A;  1UPH A;  1Q8K A;  3OPX A;  3EUB 2;  1PK3 A;  4LNO A;  4MEM A;  3ZDM C;  2ZG6 A;  5J0P A;  3DQV A;  4PS8 A;  5ALZ A;  1N61 A;  4ELV A;  4Y2J A;  2CKH B;  4CE6 A;  3K1Z A;  1PDX A;  4M9N A;  4NZL B;  3UI3 A;  4YXM A;  1L7M A;  4C4R A;  2JZB A;  1TY2 A;  1WIA A;  4R65 A;  1WXM A;  1XCQ L;  2KMC A;  8ICO A;  3VH3 B;  2K5P A;  1NK4 A;  2C2D A;  1IYF A;  2ASD A;  2KN7 A;  3OJ4 B;  2XC9 A;  3B9J A;  2F44 A;  1F5S A;  1YZ7 A;  2NRZ A;  2V4I B;  2WXM A;  4DSK A;  4M9J A;  1PK1 B;  2JPH A;  4WJP A;  1BNP A;  1RLF A;  5CHF A;  1FNV A;  2MBO A;  5J2B A;  2EH9 A;  2VAN A;  5AKL A;  3A9J A;  4RQ8 A;  2VH2 A;  3AEB B;  1SL1 A;  5AM4 A;  4DS4 A;  2JWU A;  2LHD A;  1DOI A;  1Z19 A;  4CF4 A;  1FIQ A;  5KG2 A;  1C4C A;  1QSL A;  3SAH A;  1QOA A;  4Q2J A;  1ED1 A;  2K22 A;  3Q8R B;  3FYH A;  3ZI4 A;  1MC8 A;  2MLB A;  3IVF A;  5ALY A;  2BWE S;  3A1Q B;  2GH1 A;  2DFL A;  1YN5 A;  3QWZ B;  3QAQ A;  1L2N A;  2CU3 A;  4OJP A;  2RDB C;  1ZDV A;  5CHW A;  2E5S A;  4YMM A;  3AQF A;  4AOF A;  1BT0 A;  2N9E B;  3MGH A;  3Q8F A;  4BOS C;  4JLC A;  1IBX A;  2D11 A;  3K4G A;  3PRP B;  4YP3 A;  2G06 A;  2JXX A;  3HHM A;  3JPN A;  2ZTC A;  2LUE A;  5AM3 A;  1UWM A;  2L52 A;  1E0Z A;  3WIM A;  5BOL A;  4DLE A;  3OWE B;  4KLE A;  3CST A;  5DBC A;  2D10 A;  4PHA A;  5CHG A;  4OZA A;  1L3U A;  3O13 A;  1ZET A;  1P0R A;  1WWT A;  2W43 A;  3RBE A;  2X38 A;  1T0Y A;  4K1R B;  1ET6 A;  5ALV A;  2RGF A;  2HBL A;  4KLI A;  2F8K A;  2VJ5 A;  1QTM A;  1XO1 A;  1KTK A;  1SXD A;  5DPS A;  1ZQT A;  4MT5 A;  2L8J A;  2AQ2 B;  4ECS A;  4UBB A;  3PW5 A;  5AM1 A;  1K50 A;  2KC2 A;  2Z8L A;  5G55 A;  3DEE A;  3ETR A;  4QWC A;  2IOF K;  3RCZ A;  9ICJ A;  3I57 A;  4US8 A;  2H3I A;  4RUC A;  2HCF A;  4LZG A;  3I3T B;  3AQE A;  4M6W B;  4JV1 A;  2KLG A;  1RFA A;  2PIA A;  4F5R A;  3C1Z A;  5G5H A;  3RPF C;  1JWU D;  2I2Y A;  2DGZ A;  4EZL A;  1VJK A;  3Q3O C;  3HVZ A;  5KFU A;  3IT4 B;  3MR2 A;  2D3C A;  3R9K A;  3T3F A;  1ZOY B;  2PLP A;  4M01 A;  2ZW0 A;  3C2M A;  4GIB A;  2MRP A;  2W9A A;  1KFS A;  1BUI C;  1ZQI A;  1KRP A;  3QAR A;  5BYS A;  1Z00 B;  9ICK A;  7ICS A;  3V3X A;  2RHF A;  5KFJ A;  1YJ1 A;  2PKO A;  5JHA A;  3K9O B;  4I27 A;  1S0V A;  3LWL A;  2WXR A;  4F50 A;  4TQS A;  2WXG A;  2J0J A;  1ZQ1 C;  1FO4 A;  5LXH A;  1WE7 A;  2M1M A;  3KZX A;  3UXP A;  2F77 X;  1L5P A;  5EWF A;  2KD0 A;  3DHG C;  3PMN A;  4Y2T A;  3AU6 A;  2LJ5 A;  4PS3 A;  3UF8 A;  1WRD B;  2ZJD A;  8ICV A;  2NS5 A;  1KEJ A;  2MSN A;  1QSY A;  4DHZ B;  2WB1 F;  4PH5 A;  3HX0 A;  3ISB A;  4QNL A;  1GB4 A;  2CR5 A;  1TK0 A;  5C5J A;  3QJZ A;  5KAI U;  1RYJ A;  2GI9 A;  3RR7 A;  2G0A A;  3PSP A;  4PT5 A;  4ICU A;  2DNF A;  4I2G A;  3KW5 B;  1F1H A;  4QW8 A;  5J2F A;  1I4G A;  2H89 B;  1CEZ A;  5AI8 A;  3ZRF A;  4F5Q A;  3PX6 A;  3DBH B;  1BPB A;  5IIK A;  1DRG A;  1WF9 A;  4F8C B;  2NTS A;  2F1H A;  3T9L A;  4DSI A;  4GDK A;  4LLG M;  5TR5 A;  1JQ4 A;  4YXJ A;  3DWG C;  3NUH B;  4RH6 A;  1JML A;  3OHA A;  4EYH B;  3CIR B;  3M1Y A;  3V7L A;  3THV A;  4Z6E A;  5CWR A;  1ARO P;  2G08 A;  2WDT B;  4MH0 E;  4TV3 A;  3E2E A;  3P63 A;  2J0K A;  4DWF A;  2F8L A;  4A8E A;  4YCX A;  1NJY A;  4F8R A;  2E3T A;  4TUQ A;  1Q1O A;  2LGD A;  3ML8 A;  3CMM B;  2VZK D;  2DZM A;  9ICI A;  2NRX A;  1L7P A;  2NMQ A;  3TCA A;  2ZCB A;  3B0Y A;  3V72 A;  2ZIX B;  2IHN A;  3AE8 B;  4E3C A;  4QIW F;  5DQI A;  2QHO A;  4O3P A;  7ICR A;  1XO0 A;  1SBB B;  2ISO A;  3IG8 A;  2KX0 A;  3ZDA A;  3D2S A;  3EPI A;  3PZ8 A;  1T4G A;  2B0C A;  5J2E A;  1WZ0 A;  9ICR A;  3IBE A;  3H0R B;  4RQ7 A;  4P1B C;  4YT0 B;  2GOW A;  1UQV A;  2IY1 B;  4I2I A;  1CJE A;  3JSV B;  4NL9 C;  3I28 A;  2C22 A;  2N4F A;  2GMI C;  3GV5 B;  4O3Q A;  2H3V A;  2V3N A;  4RGO S;  5IIO A;  3W1S A;  3GP7 A;  2J0M A;  3S2A A;  3ZDC A;  4RMA A;  3T5L A;  1ZQN A;  5IN7 A;  3FIL A;  4HCP B;  3PZP A;  1T0S C;  3L5K A;  4GGQ A;  4W9D A;  3PTF C;  4I2J A;  1DXS A;  2A19 A;  2OED A;  4M9G A;  4MDK E;  1Q3U A;  1C7Y A;  4WAF A;  5D46 A;  2KVC A;  2MJD A;  1CMX B;  1G6J A;  2L5Y A;  3UIN B;  4NM2 A;  3H4D A;  2K4E A;  2BGF A;  3Q3J A;  2JRZ A;  1UA1 A;  2HTM E;  2M0N A;  4J9R A;  1JWS D;  1SXT A;  2WS3 B;  3GE8 C;  2JYE A;  3ZD9 A;  1R4M I;  5D3I B;  4J3O D;  2KC1 A;  3A9J B;  2BT6 A;  2BQU A;  3AE4 B;  4K7S A;  2HHV A;  2JRH A;  3OAW A;  1JRU A;  2G07 A;  2W7O A;  3BYY B;  3HRD D;  1D9F A;  1QF6 A;  4G3X B;  2V3P A;  4B9T A;  3L4P A;  4DQO C;  4RT2 A;  4GU2 A;  5ALW A;  3VR8 B;  4R8U A;  5E79 U;  5AKZ A;  4RCO A;  4PS7 A;  3Q8P B;  1XD3 B;  5AZH A;  4DFJ A;  4MFF A;  5KFD A;  3EEC A;  4WJ3 B;  3ZNZ B;  2GRI A;  4HVB A;  3PML A;  2MRL A;  2W9B A;  2JUO A;  5KHO A;  2KJ6 A;  4J9M A;  2MHJ A;  1FRR A;  3V60 A;  1V85 A;  2MH7 A;  3H4B A;  4F4K A;  3N9Y C;  3ALR A;  3V6E B;  3B0X A;  3TFS A;  1HUZ A;  1GUA B;  1ZXH A;  3AE5 B;  5C0Y A;  1YX5 B;  1V9J A;  2WXO A;  3ZXR A;  4CF5 A;  4I6N B;  3RUL A;  4XDC A;  2XIC A;  4F72 A;  1OUQ A;  4JK1 A;  1A76 A;  2XY7 A;  3ONS A;  2KVZ A;  2WX0 A;  1JRP A;  2M0A A;  5CRX A;  4GSW A;  5JH5 C;  5LNK 1;  1HJP A;  2W7P A;  2BPF A;  3AEC B;  1YOV B;  2D3A A;  2MUT A;  2ODG A;  4CGZ A;  2B21 A;  1J0G A;  2MU2 A;  1X66 A;  1KN5 A;  2OHF A;  5DKW A;  1TKY A;  1QLN A;  3OJ3 A;  2ZTD A;  1KQQ A;  1WJN A;  1ZQL A;  1C1Y B;  4HPP A;  1Q46 A;  3VR9 B;  3RJH A;  2LYH A;  2NRT A;  4KLM A;  4W9G A;  4RNM A;  2FMS A;  2K8B A;  1XSL A;  1QKZ A;  5J2G A;  2QAR A;  5KFB A;  4M0W A;  4A8X C;  4PGY A;  4YSZ B;  2MA1 A;  1SB3 C;  1N5X A;  2ISP A;  3M9N B;  2WAQ F;  4P7I A;  4I6P A;  1N5W A;  2AH5 A;  5CB1 A;  3N32 A;  2KWV B;  4U7C A;  1C4P A;  2DBY A;  3ZTC A;  3RFA A;  3C1Y A;  4HDQ A;  2KDF B;  1MA7 A;  3RH4 A;  1N60 A;  1L3S A;  7ICE A;  1ZQZ A;  4ANV A;  2AJQ A;  2L0T A;  4O3S A;  4L1B A;  4K7W A;  1RYU A;  1COO A;  4P4P A;  7ICI A;  4TQR A;  5ALE A;  2P6U A;  2C28 A;  3LDZ E;  2F76 X;  4C8K A;  2O6V D;  2QDF A;  2FUH B;  4FZL A;  4DOA A;  2G4D B;  4QZC A;  3RAQ A;  1ZQP A;  1SE3 A;  2GBK A;  2ZZP B;  4KGT A;  2WFA A;  1FXA A;  4Y2P A;  1CRX A;  4CCH A;  5KT3 A;  5J2H A;  1RWS A;  3DVN U;  4DHJ D;  5KFS A;  3SD5 A;  4DOB A;  2QIE B;  2ONQ A;  2KMM A;  3TEW A;  1BXT A;  4OJ6 A;  5ALI A;  1XQQ A;  2CPR A;  4RGN A;  4ZHO A;  3APC A;  4UDU C;  2WDQ B;  2XI9 A;  5ALO A;  1KTQ A;  2AEH A;  3HM6 X;  3IAS 1;  4ZYN A;  2HVH A;  4KLU A;  2LVO A;  5IO9 A;  4L2Y A;  1S1Q B;  1FCL A;  4DXF A;  1MQ3 A;  2LMC A;  4PHD A;  4J9P A;  2KWC A;  5ALX A;  4TKN A;  2K89 A;  3E0F A;  2E1E A;  5AM5 A;  4C8L A;  1RQN A;  1GAQ B;  5DGB A;  4G9B A;  3H9D A;  2G09 A;  1T0R C;  2ZNV B;  9ICO A;  2M4N A;  4HCN B;  5HHD G;  1A77 A;  4QZA A;  2MBB B;  3U7D A;  4MFC A;  5J2R A;  3MHS D;  4A90 A;  3BVG A;  1J19 A;  1IBX B;  4DFP A;  1JN3 A;  2KSO A;  3NS1 A;  4P4M A;  2KK8 A;  1WMH B;  4KLL A;  2WGS A;  2MEK A;  2Y5C A;  2GB1 A;  2D3G A;  2JXT A;  5ALQ A;  2ICI A;  3AV8 A;  3GV7 B;  3UQ2 A;  4IOI E;  2O6V B;  3PZD A;  3VH4 B;  3MR6 A;  5J2D A;  2MW5 A;  4EKU A;  2RQ5 A;  4JV0 A;  1IGD A;  4OZB A;  2ZIV B;  1EM7 A;  4O5E A;  4W9I A;  4IQU A;  5C3J B;  5KT2 A;  1IPG A;  3PO4 A;  4DWI A;  1UEL A;  5AIA A;  4LJX A;  4I2A A;  2LXC A;  8ICZ A;  3K75 D;  4DFM A;  3WK5 A;  4YSY B;  4ACF A;  4R63 A;  5IAA C;  3JPR A;  4ECY A;  2BDU A;  4PZN A;  2QB0 B;  2KSO B;  2IGH A;  1I7H A;  2SAK A;  3MFG A;  4NV0 A;  3BZC A;  2HJ1 A;  3W5V B;  1UT8 A;  5TIS U;  1NJZ A;  2K6Q A;  1NKB A;  2UVU A;  1ZQJ A;  4GDL A;  5FKA C;  4AJY B;  2FLL A;  5CJ7 A;  1HXY D;  2K4P A;  4FO6 A;  2KIV A;  1M4V A;  3KKA A;  3MGI A;  5CR0 A;  3T79 A;  2RDG A;  5H8Y E;  1WXV A;  1PZN A;  3PT2 B;  2KMA A;  1F2R C;  2PMZ F;  2CJN A;  4XC2 A;  2DF4 B;  2ZXH A;  4IWP A;  5B66 U;  4J6I A;  2JGA A;  3QIJ A;  2ZUD A;  1L6V A;  7ICQ A;  1WYW B;  3MC1 A;  3IN5 A;  3WK8 A;  3KYC D;  3S6J A;  4EZ9 A;  3IHQ B;  3QUQ A;  2BHN A;  4S0R A;  1TK8 A;  1TAU A;  1NI2 A;  4NQK E;  2BB5 A;  1V1O A;  2KTR B;  8ICI A;  1ZQD A;  3B2F A;  4HXD A;  3MFH A;  2W54 A;  3QU4 A;  3RT3 B;  4JB3 A;  5TZV A;  2N7J A;  2ZIV A;  1WM3 A;  1TK5 A;  2WXJ A;  1P7F A;  4F71 A;  1HEK A;  1SWW A;  2LKY A;  3TMP B;  1HZ5 A;  2J53 A;  3QA8 A;  5D94 A;  2XVT A;  1RAX A;  4RQ6 A;  3ZVV A;  4B9K A;  3VTV A;  4F4W A;  1L3V A;  2GBR A;  4WWN A;  3C2K A;  3V7J A;  1UCV A;  1V49 A;  1WE6 A;  4NJ8 A;  3OSP A;  1HE8 A;  1TZ1 A;  2F1J A;  5BYR A;  2KKV A;  3RMK C;  1X9M A;  1WGK A;  2F2A B;  3Q3N C;  3BS7 A;  4AYB C;  3ZDB A;  1X1M A;  2KAN A;  5IIL A;  2K8A A;  3GIM A;  4IM2 A;  4W9H A;  5DLG A;  3ZDT A;  3GV8 B;  2L32 A;  4CO7 A;  1O03 A;  3BQ2 A;  9ICW A;  4NLN A;  1R7S A;  3T5J A;  4QZG A;  3PSE B;  1URJ A;  4P2H A;  1XLQ A;  2VJ4 A;  5EE1 A;  4BKT A;  1SJE D;  5EE3 A;  1SE4 A;  5I4D A;  2BBC A;  2BQQ A;  2C7M B;  1S0M A;  4WAA A;  5LLI A;  1VZ6 A;  4FJZ A;  4W9F A;  3D6J A;  2PI5 A;  1LB2 B;  1Q5W B;  5J2I A;  1ISN A;  2WNM A;  3KQ4 A;  2HSZ A;  3A1Q A;  3SR6 A;  2B3A A;  4ECT A;  2ZW1 A;  1NKC A;  2DYM A;  2KNB A;  2XK5 A;  3P4S B;  4LZD A;  3LVV A;  1E9M A;  1YT3 A;  4KIK B;  5KFH A;  3RB3 A;  4DDI D;  5KFR A;  4BGD A;  2R8I A;  4QJF B;  5DCN A;  4DSE A;  2IMW P;  4LJP B;  4YWG G;  3QUB A;  5BPC A;  3ZNH B;  1I35 A;  2KLC A;  2EQY A;  4UW9 A;  1VDV A;  5JRT A;  2DX5 B;  2NBW B;  3DOW A;  1BPY A;  1X6J A;  4ZOH C;  2N0S B;  2NTT A;  2NYV A;  2M8S A;  3NAS A;  1L4D B;  2FE8 A;  5EWE A;  5HFY A;  2J6S A;  4K3C A;  2BDP A;  3AE6 B;  1TS3 A;  4IQV A;  1EXN A;  4ED6 A;  3TQ1 A;  4OO1 J;  4DDG D;  1WXA A;  5ALL A;  2WXN A;  5GTI U;  5JHB A;  1MHX A;  4PYU A;  4RQ0 A;  4WWP A;  2BZF A;  5FR6 A;  1MQ2 A;  3MC0 B;  3RJG A;  2D3B A;  1Y88 A;  2BYT A;  2J6U A;  3HIL A;  2UVV A;  2B76 B;  1NJX A;  4JIO U;  2I6X A;  4I29 A;  1MHH E;  3U7Z A;  1R4N I;  7ICJ A;  2JVC A;  2IDY A;  4B6J A;  5CP2 A;  2WHE A;  4DQR A;  1YJJ A;  3C21 A;  5EWG A;  2IND C;  4YMO A;  5D2M B;  4WJN A;  4DS5 A;  4G50 A;  1GC6 A;  2GLS A;  3C0R B;  4REZ A;  4A6Q A;  4C4T A;  3MDC A;  8ICR A;  1NOM A;  1L0V B;  4LVS A;  4NJ6 A;  5EE0 A;  1MI0 A;  3ZGZ A;  1LGR A;  3EW9 A;  2WF8 A;  2ZEQ A;  4HKZ E;  3PRM B;  4KIK A;  1JAL A;  1T3Q A;  2HBM A;  1ZQK A;  1NZB A;  1YNT E;  4KTQ A;  4MGY E;  3APF A;  4HRS A;  1YQB A;  4KKJ A;  1BVS A;  1Z00 A;  4UAT A;  3GS2 A;  1SKR A;  4YR3 A;  4Y2Q A;  4E74 A;  4TUU A;  2INP E;  4Y2X A;  1ZYQ A;  3OJU A;  2W3S A;  5AI6 A;  4RT3 A;  3H8H A;  4G0N B;  4IG7 B;  4ZHP A;  5EDS A;  1C3T A;  5F9L A;  5JUM A;  4OJO A;  4O3N A;  2KHQ A;  1JI7 A;  4O0I A;  1E7P B;  4RNN A;  3SV4 A;  1X6I A;  1AYF A;  4M04 A;  5J0T A;  3WK7 A;  4Q44 A;  2KTQ A;  4MM3 B;  1WR1 A;  2RPQ A;  4F2R A;  4I6L B;  5KTQ A;  1UBQ A;  2XN9 C;  4YTP B;  4US9 A;  2AXT U;  3ETL A;  3RNF C;  1KSP A;  1V2Y A;  2AYO B;  1F2R I;  2NO5 A;  3QEA Z;  2IY0 B;  8ICE A;  1HTQ A;  1WZ3 A;  1P3Q U;  3NOB A;  3GIK A;  4IRD A;  2R8H A;  3NRZ A;  2OM6 A;  2FUG 1;  1I42 A;  5KFT A;  1S9F A;  4LCD E;  5DGA A;  5AI5 A;  8ICS A;  1CUK A;  4MF8 A;  3Q8S B;  3P42 A;  2FID A;  4KSL C;  2A1J B;  3U8Z A;  2K9X A;  1FMA D;  4KMU A;  2W9C A;  4N59 A;  1V9P A;  2QMT A;  2ES6 A;  3F5E A;  4NXZ A;  1XLP A;  1ZKH A;  1WX9 A;  3W1S C;  2PW9 A;  4LJO B;  1TBE A;  4EBD A;  4O5K A;  1J8C A;  2JRI B;  2RMM A;  4RF0 A;  3E58 A;  1TS2 A;  3M3J A;  2EAM A;  4BXO A;  5KG3 A;  2VIX A;  4ITK A;  3DV9 A;  5D49 A; 
#chains in the Genus database with same CATH homology
 1WXQ A;  3EA6 A;  4OVZ A;  2W3R A;  2WDV B;  1XCT L;  1ENF A;  3AE8 B;  3NZ3 A;  1NI3 A;  1SBB B;  3LXF A;  1ROE A;  4WIP A;  2H88 B;  5T8I A;  5BYQ A;  4A9A A;  4YTN B;  4USA A;  3PZ8 A;  4P16 A;  4HEA 1;  2E6X A;  2M19 A;  1GB1 A;  1F77 A;  1FFV A;  1SEB D;  1KLG D;  1ACC A;  3DWM A;  1V1P B;  1HZ6 A;  1WSP A;  4YT0 B;  3HVD A;  1EU3 A;  1IGC A;  1CJE A;  1FNU A;  1I4Q A;  2BW2 A;  1DOX A;  3FC4 A;  1SSN A;  2JX5 A;  4D2K A;  2M56 B;  2LHE A;  1E10 A;  2V3N A;  4RGO S;  1KRH A;  3V05 A;  3W1S A;  3GP7 A;  5E6J A;  1D4B A;  2WXQ A;  1C79 A;  3FIL A;  1OQQ A;  4XDD A;  3SFE B;  4IKG A;  3B2G A;  1HQR D;  2OED A;  4WAF A;  5BMG A;  5JXV A;  1ZUD 2;  2MJD A;  2TSS A;  1TYG B;  1YN4 A;  4B0E A;  1Q10 A;  2PMV A;  2LFI A;  1JWA D;  1OFF A;  3W2D A;  2HTM E;  3T3N A;  2WS3 B;  1JWS D;  1SXT A;  2IGD A;  3Q69 A;  1UWX A;  2JYE A;  3RFZ B;  2WXL A;  1CZP A;  3MJ5 A;  2LJI A;  5D3I B;  2VZK B;  4J3O D;  2BT6 A;  3AE4 B;  2CJO A;  2ACZ B;  3P4R B;  2WP9 B;  2MJ3 A;  3KWV A;  3ABV B;  3CWI A;  4DXG A;  1OQR A;  1EWY C;  2J52 A;  1QOB A;  2JSV X;  3Q8E A;  3BYY B;  3HRD D;  1QF6 A;  3AEF B;  2V3P A;  4YXD B;  1IUE A;  3L4P A;  4DQO C;  3P4Q B;  2W82 A;  1T5X D;  3VR8 B;  1FCC C;  4RCO A;  4L23 A;  2L83 A;  1CQV A;  3NVV A;  3TUO A;  5D3D A;  2AQ1 B;  2GRI A;  1ET9 A;  1ZE3 D;  4JWU C;  2I38 A;  1XO3 A;  3R2I A;  1I4H A;  2BB6 A;  1A70 A;  2V0G A;  1FRR A;  1VR9 A;  1FRD A;  1D5M C;  1D5Z C;  2MH7 A;  2R61 A;  3N9Y C;  2BTE A;  3IT6 B;  2SEB D;  1ZXH A;  4C80 A;  3AE5 B;  2WU5 B;  2WXO A;  3W9C B;  4HKQ A;  1VLB A;  4XDC A;  3IXS A;  3AE3 B;  3URY A;  2KAJ A;  3LYY A;  4KGS A;  1DOY A;  3AED B;  3AE1 B;  4ZRQ A;  1JRP A;  2M0A A;  5LNK 1;  4XWW A;  2WDR B;  3P4P B;  3AEC B;  1TY0 A;  1VRA B;  4GDK B;  1V97 A;  1ZDX A;  3FAH A;  4JPS A;  1UNS A;  3AM9 A;  3VRB B;  2OHF A;  1QQR A;  1NYR A;  3AEA B;  1TKY A;  5D7G A;  3VR9 B;  2IGG A;  1N63 A;  1QKZ A;  1L0X B;  4M0W A;  4A8X C;  1MPE A;  3ZJT A;  4YSZ B;  4MAC A;  1SB3 C;  1N5X A;  1FXI A;  5MPO A;  1TS4 A;  2RDH A;  1N5W A;  1DYQ A;  1TZO A;  3HUI A;  1C4P A;  1V8C A;  2DBY A;  2PVO D;  2QEJ C;  3AEG B;  1N60 A;  4L1B A;  3PZ7 A;  1SF0 A;  4EE2 A;  2G1E A;  3VQI A;  1P7E A;  4WUR A;  4FXC A;  1QOF A;  4B0M A;  1PGB A;  2DLB A;  1FEH A;  1MVK A;  2WXF A;  1J7C A;  4KGT A;  1SE3 A;  4N6E B;  1QLB B;  4JWS C;  1FXA A;  1RWS A;  1ZXI A;  1KF6 B;  1NYQ A;  1XEE A;  2FBW B;  2QIE B;  1K53 A;  4WH4 A;  2ONQ A;  1I4P A;  2KMM A;  3BVZ A;  3C8Y A;  5G5G A;  1XXG A;  3TEW A;  1BXT A;  3NVW A;  4C7Z A;  4JX1 C;  4RGN A;  4ZHO A;  4AQ7 A;  2JZP A;  4UDU C;  1BML C;  1NEN B;  2WDQ B;  2Q5W D;  1KH0 A;  2WXI A;  2KN4 A;  3IAS 1;  4NAM A;  2IJ0 A;  3AMZ A;  1VZ8 A;  2WXH A;  4L2Y A;  1K52 A;  4GLS C;  1SIJ A;  1FCL A;  4DXF A;  1L0Y B;  2LMC A;  4WQM A;  1L6U A;  5EE9 A;  5FK9 C;  3W5U B;  1YN3 A;  1XF5 L;  1PFD A;  5AUK A;  1GAQ B;  2Y5P A;  3Q8A A;  4C56 C;  4WWM A;  4RGM A;  3BK2 A;  3AEE B;  1Y56 A;  1KLU D;  1SJH D;  5HHD G;  1CK1 A;  1ZP0 B;  3WCQ A;  1K51 A;  2WQY B;  1D6E C;  1ZPS A;  1AW7 A;  2D5G A;  4XWT A;  2EKI A;  3BVG A;  4A90 A;  1E6E B;  3BWU D;  3ZQ4 A;  1IBX B;  3NS1 A;  3AE9 B;  4YSX B;  1C76 A;  2KDM A;  3VRA B;  1WYG A;  1NVI D;  2MEK A;  2Y5C A;  4P6V F;  2ON8 A;  2GB1 A;  2XNA C;  2JXT A;  2ICI A;  3AV8 A;  4IOI E;  4ZYS A;  4OZC A;  2JQR B;  3BVM A;  4LTU A;  4OZB A;  4CQN A;  1IGD A;  4ARI A;  3U2S C;  1GOZ A;  5HI1 A;  4AS1 A;  4ARC A;  1EM7 A;  5BMI A;  5C3J B;  1T6B X;  4C7Y A;  2KQ4 X;  3MP9 A;  4YTM B;  1JW9 D;  1UUP A;  3EGR A;  4KX6 B;  5FR3 A;  1FM0 D;  2WLB A;  4YSY B;  4GDL B;  2QJL A;  2IGH A;  3MFG A;  4RGT A;  2SAK A;  1I7H A;  1SE2 A;  4HJG E;  1QT9 A;  3GB1 A;  3W5V B;  3T3O A;  1TS5 A;  1TKG A;  5FKA C;  1HXY D;  3E9S A;  1PGX A;  2HDE A;  2K3U A;  3ZJU A;  3MHZ A;  1M4V A;  1JRO A;  3LB8 C;  2RDG A;  5AUI A;  3U4E G;  5H8Y E;  3SEB A;  3I9V 1;  1YMH E;  1F2R C;  3BYT B;  1AN8 A;  2CJN A;  2YEP F;  1RFK A;  3AE7 B;  1ESF A;  3TEY A;  3SFD B;  1UGJ A;  2Y3A A;  1L6V A;  2W55 A;  1PUT A;  2G9H D;  2WU2 B;  2DYO A;  4LK0 M;  2L1A A;  3EUB 2;  2LGI A;  1GPX A;  1N61 A;  4IDI A;  2BB5 A;  1V1O A;  1C77 A;  1PDX A;  1AWD A;  4KKI A;  3B2F A;  2W54 A;  2N7J A;  3PO0 A;  2BS4 B;  4NZL B;  3UI3 A;  2WXJ A;  1P7F A;  1HZ5 A;  1TY2 A;  1XCQ L;  2J53 A;  2K5P A;  2WXK A;  1DGJ A;  1TKE A;  1B9R A;  3B9J A;  2LUM A;  2PTL A;  2V4I B;  2WXM A;  5BYR A;  1C9F A;  1WGK A;  4RF1 A;  5H92 C;  1FNV A;  4MH8 A;  1J7A A;  3AEB B;  2JWU A;  3AH7 A;  2LHD A;  1DOI A;  2L32 A;  1FIQ A;  1C4C A;  2MJE A;  4NAW B;  3TEZ A;  1QOA A;  1R7S A;  2J4X A;  3R2T A;  4Q2J A;  2K22 A;  2JYT A;  3U52 E;  1XLQ A;  3IAM 1;  4N58 A;  5EE1 A;  1SJE D;  3J9C A;  5EE3 A;  1SE4 A;  1YN5 A;  5I4D A;  2BBC A;  1HA5 A;  2CU3 A;  1VZ6 A;  4TMA B;  1ZDV A;  2WNM A;  3KQ4 A;  1F0Z A;  3SR6 A;  1KFY B;  2ZW1 A;  3Q8F A;  2DYM A;  4JE3 B;  3P4S B;  1IBX A;  1E9M A;  2PVG C;  3AN1 A;  3NVY A;  4XE0 A;  2IPK D;  1UWM A;  2L52 A;  1YQ3 B;  1HEZ E;  1E0Z A;  3OWE B;  1I4R A;  2KAC A;  2DWQ A;  2J42 A;  4YWG G;  4OZA A;  3O13 A;  1WWT A;  1VDV A;  4A55 A;  3E56 A;  3AE2 B;  2X38 A;  1QOG A;  1FD6 A;  1ET6 A;  4ZOH C;  1RM6 C;  2N0S B;  2NTT A;  4NJC A;  5GXG B;  4R3D A;  2JU6 X;  3BK1 A;  1L4D B;  2FE8 A;  1WRI A;  3Q8B A;  1KTK A;  5HFY A;  1JWM D;  4MT5 A;  3AE6 B;  1TS3 A;  2AQ2 B;  2AX5 A;  2Z8L A;  1TJE A;  1EU4 A;  1K50 A;  5C2T B;  3ETR A;  2WXN A;  1FFU A;  1MHX A;  4HRO A;  3I57 A;  4OW0 A;  4US8 A;  1D5X C;  3MC0 B;  3ZJV A;  1NEK B;  2PIA A;  2BYT A;  3Q8C A;  5G5H A;  3RPF C;  3ZYY X;  1JWU D;  5BMH A;  2I2Y A;  2B76 B;  1VJK A;  2N9K A;  1C4A A;  3HVZ A;  1MHH E;  3IT4 B;  2AQ3 B;  4ZRP A;  5TSS A;  3U7Z A;  1ZOY B;  2PLP A;  1C78 A;  2IDY A;  2ZW0 A;  4TQ1 A;  1YJI A;  1YJJ A;  2LEK A;  2N9L A;  4KGR A;  1BUI C;  4REZ A;  4A6Q A;  1L0V B;  2EEL A;  1PYW D;  5BYS A;  5EE0 A;  3KWL A;  1MI0 A;  3ZGZ A;  2BS3 B;  3V3X A;  1XLO A;  3KLS X;  2QIL A;  1JCK B;  4HKZ E;  4TQ0 A;  1JAL A;  1T3Q A;  2PKO A;  1YQ4 B;  2K0P A;  1YNT E;  3TSS A;  4HRS A;  2WXR A;  4KKJ A;  2WXG A;  3P1M A;  3GS2 A;  1FO4 A;  1B1Z A;  1PGA A;  1N62 A;  1L5P A;  2INP E;  2RPV A;  3H8H A;  4O1N A;  2W3S A;  4ZHP A;  1VZ7 A;  1STE A;  3NVZ A;  1QIL A;  5HG2 A;  2BS2 B;  3AB5 A;  3R8B A;  1E7P B;  1AYF A;  1GB4 A;  4MM3 B;  4RNA A;  1XLN A;  2XN9 C;  1EWC A;  1RYJ A;  4US9 A;  2GI9 A;  4H2A A;  4RFB A;  4YTP B;  4TSS A;  1L4Z B;  1F2R I;  2QSD A;  4PT5 A;  1LO5 D;  1I4G A;  1I4X A;  2H89 B;  3BII D;  3NRZ A;  2YEP B;  2FUG 1;  3TEX A;  2INN E;  4OHJ A;  2NTS A;  4LLG M;  1JQ4 A;  3DWG C;  3FIL B;  3NUH B;  3P42 A;  4RH6 A;  2K9X A;  1J7B A;  1FMA D;  1JML A;  3CIR B;  2WXP A;  4N59 A;  1JWB D;  2QMT A;  2KWD A;  3BZD B;  1XLP A;  1V1P A;  2PW9 A;  3P63 A;  2RMM A;  2E3T A;  1FNW A;  4RF0 A;  1TS2 A;  2VZK D;  2NMQ A;  4ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...