1N61A

Crystal structure of the cu,mo-co dehydrogenase (codh); dithionite reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n61A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n61A01
2W3SA 4C7ZA 2WP9B 1N62A 1TKEA 2PKOA 2OHFA 1FXIA 3PO0A 3NS1A 1RYJA 1NEKB 3W9CB 3AE4B 2Q5WD 2AX5A 3KWLA 1NI3A 1NYRA 3LXFA 4IDIA 1JRPA 2CJOA 3AEFB 4N6EB 5H92C 4YXDB 1SIJA 1ZP0B 1XLPA 1DGJA 3NVWA 2MJDA 2W55A 2WDRB 3AEGB 3B2FA 3SR6A 1JROA 3DWMA 3P4QB 4ITKA 5G5GA 1RM6C 5EE0A 4A9AA 2JX5A 3HVZA 2BT6A 3AV8A 3B2GA 2WLBA 3VR8B 2FBWB 1AWDA 3AE8B 1F0ZA 5EE3A 2E3TA 1WXQA 3AM9A 3CWIA 1E0ZA 3AEBB 2MH7A 2Y5CA 3AEAB 1WGKA 2PVGC 1KFYB 5C2TB 2B76B 1VJKA 4YT0B 1VLBA 1T3QA 3W5VB 2PVOD 1ZUD2 4JWSC 1QOAA 1QOBA 4YTNB 2KAJA 2DWQA 3HUIA 5AUKA 5C3JB 1V97A 4P6VF 3SFEB 3NVYA 2MJEA 1JWAD 1TKGA 4KX6B 3NVZA 1IUEA 1I7HA 2WDVB 1SB3C 1AYFA 3P4RB 2WDQB 1UWMA 4FXCA 1YQ4B 2WQYB 2MJ3A 1FMAD 1DOYA 2K22A 1KF6B 3HRDD 1TJEA 2CJNA 3AE1B 3CIRB 5G5HA 4N58A 4US9A 1FM0D 1FRRA 2DBYA 2H88B 4YTMB 3NRZA 1QLBB 3FC4A 1B9RA 1QOFA 3W5UB 1QT9A 1YQ3B 5H8YE 2WS3B 3AECB 1PDXA 1QOGA 1R7SA 1VDVA 2M19A 2QIEB 2G1EA 3AE6B 1TKYA 1WWTA 2CU3A 3ZYYX 1RFKA 1PUTA 5EE1A 2BS4B 4LTUA 1TYGB 1E7PB 1JALA 1L5PA 1J7AA 3AE3B 3VRAB 4YTPB 3VR9B 3WCQA 1GAQB 1FFUA 2WU5B 1DOXA 4C7YA 1WYGA 3P63A 1N60A 1FIQA 2BS2B 2KMMA 1WRIA 3AB5A 1L6VA 5MPOA 2H89B 3ETRA 3AMZA 1V8CA 1N63A 1YJIA 4HRSA 3AEDB 3AE2B 4USAA 1SF0A 1NENB 1A70A 1CJEA 1J7BA 3ABVB 1ZXIA 4HROA 4WWMA 2JQRB 1ZOYB 2L52A 3B9JA 1OQRA 1OQQA 1XLQA 1L6UA 1JWBD 1JQ4A 1PFDA 3AE7B 3AEEB 4ZHOA 3FAHA 4ZOHC 2W54A 1DOIA 4JWUC 1XLOA 3NVVA 1E9MA 2M56B 5GXGB 1N5WA 2N0SB 3AE5B 4JX1C 1NYQA 2K5PA 1NVID 5EE9A 1N5XA 1RWSA 2HTME 2PIAA 3AE9B 3LB8C 1E10A 3P4SB 3VRBB 1GPXA 1QF6A 4YSYB 1YJJA 2W3RA 1ROEA 2L83A 1FFVA 1J7CA 3AH7A 1E6EB 4WQMA 2K9XA 2WU2B 2EKIA 3AN1A 3EUB2 1EWYC 2BS3B 1FRDA 1JW9D 3DWGC 3L4PA 4US8A 3P4PB 1L0VB 4YSXB 3SFDB 1XLNA 1FXAA 5AUIA 1N61A 1FO4A 3RPFC 3P1MA 2LEKA 4YSZB 1OFFA 4C80A 1XO3A 2ACZB 2QJLA 3BIID 4ZHPA 1CZPA 1KRHA 4N59A
chains in the Genus database with same CATH superfamily
1I4HA 3DDHA 3GIKA 4DSJA 3NZUA 3TKAA 2UVRA 1WX9A 4C0ZA 2W43A 2DUYA 2MBHA 4MDKE 4RNAA 1G6JA 4WAAA 3RNBC 3AE4B 3SAHA 2LBOA 2KT7A 2CN1A 2QHOA 9ICVA 5BMHA 2CJOA 2O6VA 5KFGA 2CXYA 1ZP0B 4QWCA 1RQNA 1WRDB 4DS5A 4A9AA 2WFAA 5DCNA 5FR3A 1P0RA 2YMLA 2JU6X 3AV8A 1NDDA 1XU4A 4DSKA 2KFKB 1JXEA 2NTSA 4QWAA 3SYZA 4O3RA 4G0NB 2K8HA 1OEYA 2PVGC 3G6XA 4A20A 2HCFA 1OTRB 5EDSA 2PE9A 4I6NB 2QLTA 2R2OA 1T3QA 4B0EA 3RJKA 3HUIA 3T9LA 4WWOA 3Q69A 5HHIA 4P6VF 4ZRKA 3T5LA 1N2XA 1PK1A 2YN4A 5MPOA 2D3CA 2KEYA 1AW7A 4R66A 5AI5A 2XICA 4HKZE 4PS7A 3M7DA 5KFYA 4C4SA 4RPZA 3DOWA 1S77D 1ZE3D 5LNK1 3V7LA 1ZQEA 2AU0A 2AL6A 3BYTB 5H8YE 1I4QA 5AM4A 8ICLA 4XDDA 2DAFA 4P4OA 3AXCA 3VXWA 1HJPA 1TK5A 2RR9A 4UB4A 5HG2A 2KVSA 4LLGM 1L3SA 1JALA 1ZQQA 4LNFA 4DLEA 3J81j 5AK3A 4C7YA 4PT5A 3ZDCA 4AQ7A 4YD1A 4RQMA 2UVUA 3OLMD 3QUTA 2K6DB 3VHTC 1Z4OA 2XN9C 3ML9A 2H5XA 2NVUI 5A0LA 3TAPA 4M00A 4B9VA 1J7BA 4DOBA 3V7KA 5AIBA 4G50A 5L9XA 2AEHA 4M9LA 2ZJDA 3FAHA 5HFYA 4NLGA 2LKYA 3NVVA 5DQGA 4YP3A 2EZXA 4F50A 5AI6A 2EAMA 2N0SB 3O65B 4FJVB 5EE9A 2M17A 3R3MA 3N28A 3QZ8A 3O13A 1YN4A 2RDBC 1YNTE 4ANUA 5JH5C 3JPNA 2AQ3B 2L83A 1ZD4A 2J52A 2KZRA 4I28A 2LGDA 1D8BA 3OJ3A 2W8LA 1Q8KA 2BQRA 2BS3B 1ECWA 2A5UA 3OWEB 4IR1A 4PHDA 3LVVA 1FO4A 2FE9A 2NTTA 2VH2A 4F71A 1K1SA 1S76D 4J9PA 3D6JA 3RYTA 1S9FA 2FCMA 3GDXA 4TQ0A 1KRHA 5L1JA 2E8MA 1JMLA 2D8CA 4KLOA 1TAUA 4W9EA 3S2AA 1CMXB 2WXOA 3RNFC 1QQRA 4QAYA 1K51A 2FDRA 2LVPA 1RYJA 4BBNC 2NRZA 4HVBA 3QUCA 1WJUA 3EECA 1I4RA 1NYRA 4KDLB 4KDIC 4YQWA 1AROP 2R8HA 1XLPA 2WDRB 3WKAA 1WE6A 3IAM1 4RQ4A 3RN9C 3P4QB 2IOFK 2KVZA 3WKDA 4DOCA 4Q2JA 4ECQA 2LHEA 1AARA 3HVZA 3KLSX 1ZQCA 3DHIC 2WLBA 3F5EA 1TKDA 1FNUA 3PVLA 3AM9A 2L0TA 4OZBA 2WHEA 3WK8A 2WGSA 2YQEA 3L0WB 2XVTA 2KQ7A 2IGHA 3BZCA 4JWSC 1NOMA 1QOAA 4GDLB 1P7DA 2KAJA 2LI5A 4CF3A 4F5RA 2WWZA 2I1KA 5C5JA 3QAQA 2ODGA 4J03A 4ANXA 2G9HD 4GSWA 4EE2A 2NPTB 4BAXA 2YMQA 4FADA 4DEZA 2JZ3B 4IM0A 3SAGA 2C60A 3PW7A 1NKEA 1OXJA 4P0PA 2KTFA 3PZPA 4IC9A 1P98A 4C4TA 2ZZPB 3RNAC 1K53A 4PK1A 2JXJA 4MHVA 3GZFA 1X9SA 1QSLA 2MBOA 3CSFA 3M95A 2WS3B 1R7SA 2KFZA 9ICMA 1WGYA 3NS8A 4E3CA 3BYYB 2UYZB 4K7WA 3OGUA 4JE3B 2QKQA 1KLNA 3JPQA 1E8WA 3AE3B 3OG5A 1L7NA 4HWIB 4LJPB 1FEHA 3L10B 1F2RI 5KG6A 1FIQA 5BOLA 2LGSA 4K7SA 3JVZX 1WRIA 3V6HA 3VTWA 4F8CB 5ALMA 1ZD5A 3MR2A 3LYSA 1KJTA 3SAFA 4WJNA 3BQ2A 4J9SA 1ZQAA 4Q44A 3DV9A 1ZQGA 8ICZA 4HROA 2IOFA 3DBHI 1V38A 2LVQA 2ASJA 4MF2A 4ED7A 1JWBD 4QW8A 3Q8SB 4IR9A 1V5OA 3ZNID 3GV7B 5EWGA 1E8YA 4MM3B 3SV4A 7ICLA 2JEJA 4WJQA 4M9GA 5L1MA 2RP5A 7ICMA 4W9KA 4DSIA 1NKBA 4OZAA 4ED8A 4DQIA 1BPDA 1STEA 4OD0A 4BBNF 1J7CA 1IGCA 3DHHC 4NLCA 1I4XA 3I9V1 5CRXA 1E6EB 3C0RB 2RHFA 2DYMA 2QB0B 2D3GA 3L4PA 3V6CB 1X1MA 4KMOB 3M9MB 1ZQMA 4YG2A 3IVFA 5KTQA 1ZRMA 1SJED 1UQVA 4QZDA 3HW8A 1Q3VA 1CZPA 4UAYA 1PVPA 4KGSA 3WIMA 3KHLA 5KT4A 3ZLZA 4XQ8A 3DQVA 1SL2A 3RTVA 4C8LA 1UT8A 2KWDA 3AEFB 4DOAA 1E8ZA 4DL5A 1C77A 2WXLA 2WXPA 3UMBA 2F44A 3OHAA 2LJIA 2A3VA 4GLXA 3L54A 3EPIA 4ECXA 2VIXA 3HM3A 3TEWA 4WAFA 1AWDA 2KFKA 5EE3A 2LHDA 4UAWA 3BQ1A 3U7ZA 3M6KA 3QUQA 3U4EG 5AZGA 4DXAB 3W2DA 1URJA 1K50A 1D5XC 1IYFA 3B0XA 4U7CA 3PLVA 3M3JA 5AUKA 4M47A 4AJWA 4RQNA 2LGIA 2BBCA 2FMSA 1WXVA 2XCPA 3BDPA 1AYFA 2WDVB 3H9DA 1TFRA 3P4RB 1JIHA 2KJ8A 3Q8MA 3ZDDA 2BW2A 2M0NA 2W9CB 4FHJA 1IBXB 5G5HA 1HIWA 1CI4A 4O1NA 3UMGA 2DPJA 4QZHA 2ASDA 4LVSA 1PDXA 2GLEA 3E9SA 4L2YA 3UQAA 2WF7A 5KFTA 1L0YB 2PMZC 2L00B 3PMLA 2BS4B 4UAZA 5CB1A 4ZRPA 1Z00B 1WFYA 3WALA 1MQ2A 1NKCA 4B9KA 4NM2A 3V62A 3ZO5B 2K4IA 1NI2A 4FJZA 4UBCA 4HDQA 4ELTA 4KLLA 4DHJB 2XI9A 1U49A 4B9SA 3QARA 4YMNA 1SWVA 2UVWA 1ZQOA 4RUCA 4LZDA 3BS5A 2W9BB 2IGGA 2MLBA 4ZDVA 2KICA 1C4AA 3RZWC 1LV5A 2PLPA 4WWMA 4NQKE 3GV8B 4IM2A 2D07B 2PI4A 3MR5A 1XLQA 2JF5A 5AI0A 1ZJMA 4QZ9A 3GU3A 2K6QA 3AEEB 1IIPA 1RXVA 3AQFA 2N9PC 1DOIA 2PEAA 4QWDA 3V6EB 5GXGB 4JX1C 4ZYNA 5HR7A 4DHZB 3ZJUA 4EYHB 4UQGA 4M2YA 3QC8B 2ZIUB 4S17A 2QB1A 4NNJB 2GMIC 4ED0A 2KK0A 4KLQA 5FR6A 2PKEA 4A8EA 2ZJ5A 3RBEA 2K9XA 2WU2B 3A33B 1CRXA 2ES6A 3N20C 1B0XA 5AKJA 1E7VA 3A0BU 1OFFA 2QILA 3FM9A 4I6PA 1HQRD 1L3TA 3KYCD 1V86A 3QX1A 2J0MA 4EZKA 9ICJA 1VJ5A 1WCNA 1ISNA 3BK2A 1SV0A 3EA6A 4N59A 4BKSD 3QCAA 5E79U 2G09A 2JHDA 3ETLA 2XEWA 3A9KB 1ZQNA 3OJ4B 3GV5B 4R8UB 3PR5B 2AX5A 3AEGB 4JIOU 1WF9A 5LXHA 1BUIC 1JROA 4KITB 3V7JA 2KZ3A 1Z3EB 3PVXA 2RDGA 4TUUA 5AKHA 2N9KA 4F4YA 3H0MB 4IOIE 1IP9A 5FK9C 4KKIA 2ISOA 5AIAA 4NM1A 5IKCM 2L76A 5IIIA 2AGPA 4DXGA 3HT3A 5HR6A 2D3DA 1FNWA 3RFZB 4II3B 3MFGA 5E6OA 5EWEA 1ZUD2 1DOQA 4GDLA 4YCXA 1A6SA 3T3OA 2GO7A 9ICKA 1TE2A 2C2RA 1Z1VA 2Y1JA 1KQQA 2D11A 1ZQXA 2JR5A 2PMZF 3TFSA 4L1BA 8ICYA 4KMUA 4AYBC 5D2MB 2REXA 2KVRA 1I7HA 2NPTA 1C4PA 2IBIB 3QA8A 2FLPA 3R8BA 5AKKA 4URKA 3R2IA 2MP2B 1D6EC 5KFVA 2K22A 3I57A 1OW5A 3WKBA 1BNOA 1ZQLA 1A76A 3HHMA 3R9KA 1A0PA 5ALLA 4UBBA 3L13A 1R4MB 1KRPA 3JPTA 1Z19A 4MEMA 1LM8B 4UAVA 1WGGA 2CU3A 3X23A 4N9F4 1U48A 5ALOA 4HPMB 3LVWA 5KNIA 2N7EA 3VRAB 3PW5A 4KLTA 3K1ZA 2LASA 2PTLA 4HXDA 3VR9B 4OVVA 4UB2A 2IHNA 3ZDEA 2JV3A 1NJWA 1UT5A 1N6ZA 3C1YA 3KW5B 1TIFA 1GB4A 1UH6A 5G55A 3KVFB 3WAOA 2F1IA 2O2VB 3UPQA 4OJ6A 3N7SC 4RGOS 3BJYA 2C5LC 3MC9A 4YMOA 4NJ8A 2KHQA 2MX2A 3LDAA 1D8LA 4JK1A 2PFQA 2FI1A 4CF4A 4F4WA 1SE2A 1S0MA 3PX6A 1F9JA 2MQJA 5IAAC 4ZHOA 1UA0A 1WGHA 4MM3A 3A4SC 4I27A 4KGTA 1S97A 2G5IB 5KL1B 2HTME 3LB8C 3P4SB 4KIKB 1C3TA 1MQ3A 4Q8FA 2WXHA 2W3RA 4IWPA 3QU2A 3RNGC 1L4ZB 3NASA 2CHZA 3IDWA 4IS7A 4P0QB 1WJNA 5AI9A 2X38A 3QHTA 4PHAA 3N1ZC 5HNKA 1J97A 1L0VB 3B08A 4IW0A 2INCC 1YN3A 3ONSA 3SD5A 2DKZA 5CJ7A 1VCBA 3ALBA 3DBRB 3QZ7A 1WMHB 3U30A 4AWJA 4RM9A 4O3PA 4C8NA 1WE7A 5I4DA 3MHSD 3JPPA 2OHFA 3WAPA 4DBGA 2KJHB 4XUSA 2C22A 1VRAB 3H8MA 2C2EA 4P16A 1R4NI 2FJ6A 9ICXA 1TZOA 2FLNA 1TAQA 4PGYA 1M94A 5AZHA 1T0YA 2H3VA 3UXNA 2MJDA 3B2FA 3TEZA 7ICGA 3V61A 4AYBF 5J0QA 5DB9A 4Q45A 4QZAA 5G5GA 1RM6C 5EE0A 2KDIA 3NY5A 4PS8A 2JX5A 3GS2A 2AQ0A 3JSVB 4EKUA 2N9XA 2CRXA 1TTNA 3F2BA 2KLCA 3OSNA 4GXJA 4WJ3B 1WGKA 1XQQA 3AU6A 2OJRA 3ED5A 3WK4A 2KJRA 3R2TA 4DQOC 4KX3A 2WXRA 2E8OA 5G2NA 2PVOD 4LDTD 3C2MA 4JB3A 3QQ8B 3BQ7A 3QU7A 2ZPYA 3SFEB 5DGAA 2L7RA 1L8OA 2BQ3A 3CP8A 1SXEA 2KQSA 3SMVA 3ENEA 8ICUA 4PHPA 4ARIA 2K60A 3PLUA 1IBXA 4DS4A 4FBJB 2MCNB 8ICIA 3PSPA 1FRRA 3U52E 2MRPA 1GB1A 1X66A 2ISPA 1XXGA 1QT9A 2B21A 3NJTA 3FYHA 4O0IA 4LCDE 1XCQL 5KFWA 1JXLA 4TQ1A 5JRTA 5J2DA 4P1BC 1U4AA 2DL0A 2LFIA 1D4BA 1YZ7A 5KG5A 3QWZB 3RR8A 2LRUA 4YTPB 2KC1A 1DOXA 3BVZA 4CF5A 1TS2A 5DPRA 2WB1C 5GTHU 2M9NA 5KFPA 4XA5A 4W9IA 5CHFA 3IT4B 5AKYA 4R64A 2A19A 1EXNA 2KVCA 2ZTDA 1L6NA 1WIAA 2ZNVC 4FN2A 4BOSC 2HD5B 2QDFA 3BINA 1OGWA 2V3SA 2I5HA 2PFOA 1B22A 2SEBD 4GGQA 2H3QA 4UAUA 1F44A 2FAZA 3GIJA 3MGIA 4REZA 3UF8A 1E8XA 1OQQA 5IIMA 4K1RB 2JXTA 2EAOA 2ZVOA 2CS4A 5BYRA 1DK3A 2N9EB 4IQUA 2NMQA 2JGAA 5AKIA 4M9JA 2I38A 2KWUB 5BYQA 3G6YA 4GIVA 2BZFA 1V6EA 4O5CA 1U9LA 1RXWA 1RWSA 2PIAA 3AE9B 5D7GA 1V80A 3VRBB 2ZIUA 4NLBA 2YVCA 4DLGA 2OXOA 3IXSA 5F9LA 1Z2MA 1JWSD 1WM2A 2XIDA 4RU9A 2X8XX 5JZEB 4AP9A 4F91B 1YMHE 3GOEA 4UB1A 3KUDB 3AQEA 2FUG1 3SDLC 3WAMA 4YSXB 4MFAA 4BKTA 2WF5A 4US8A 1DGSA 1OQYA 4KKJA 1EO6A 1XLNA 3P1MA 2BPFA 2J6TA 2KFJA 2ACZB 2ZTCA 3TARA 5CX3A 2KTRA 2XY5A 2QCZA 1V9PA 5ALWA 1RAXA 1EU3A 3RUIB 5ALGA 2CU1A 4TURA 2DYBA 4LNOA 3SQIA 3A9KA 4PH5A 3W9CB 4R8UA 2A1JA 3T8MA 4NAMA 3NUQA 1NK9A 1IPGA 2KDBA 2N4FA 5J29A 1GOZA 3KZXA 5KFSA 1COKA 2K1FA 1I4GA 2JVCA 3MTNB 4ZYSA 4ECTA 2HBKA 1RPLA 3AE8B 3X0WA 2UVVA 3MP9A 1F2RC 2WXIA 2IY0B 1VD2A 5AHXA 3ZDMC 3JPRA 8ICCA 2DQNB 1WXMA 5HP4A 1QSSA 3VTUA 4QZCA 1ZETA 4YTNB 3OSPA 1WY8A 4DQSA 3RNEC 4QNLA 4DDID 2NO5A 2MP2A 9ICSA 1XCTL 1FMAD 4FHKA 4M01A 2WB1F 4MSMB 4HKQA 3ALRA 2ATLA 4YR0A 3C19A 4MFCA 2K89A 1UWXA 2NR2A 7ICUA 1BGXT 1YQBA 4RQ0A 3PW0A 1WWTA 4UB8U 2ZUBA 3ZYYX 2LUMA 3GZNB 5KFAA 4F2RA 9ICRA 3RFAA 4DSEA 1D8YA 5DQHA 3S6JA 4JV0A 3PTFC 4RQ2A 3D32A 4DWFA 2IPKD 1WYGA 2KFNA 1GC7A 3ZD8A 1KTKA 3EHVA 4ECUA 5JHBA 2GRIA 3BZKA 2O2VA 2H89B 1Q5WB 3KZIU 4J9LA 1P9DU 3Q8FA 5ALDA 4USAA 1KTQA 4PL2A 4HEA1 1LVHA 1P7EA 2AYOB 2E8PA 4Z6EA 3D2NA 2HVHA 1K52A 2BCUA 4F1SA 5KT3A 1JRUA 5K4LA 1TT5B 1JWMD 1CQVA 5DG9A 2IJ0A 1KBUA 4P7IA 2E8NA 5J2GA 2K0PA 1X9XA 4W9CA 3VFKA 5AK4A 1A77A 5FKAC 3WKCA 4KIKA 2WAQC 1MVKA 5KG4A 3DVNV 5JTIA 5D6JB 3H8SA 3AH7A 4NWIA 2VJ4A 3DBLI 5J0UA 1H38A 4P0QA 3H7SA 4O5EA 3M63B 3DVGX 3BS5B 1S0NA 1ENFA 5KG2A 9ICWA 2JZBA 9ICLA 1C78A 4A3PA 3ZIMA 4DFJA 3RPFC 4KLJA 5JHAA 4I2EA 4I2IA 5ALZA 4MJSB 3RR7A 3PSTA 1WMHA 1SL0A 1X42A 5DLGA 3RI7C 2W3SA 5L1KA 2OEDA 3BWUD 2LHTA 3TANA 3GQCA 1PK3A 2BCRA 2KN5A 4NLNA 4MGIE 2LVOA 3TJPA 4NL9A 4BUGA 4ZRQA 4N6EB 4G3XB 1XS9D 4MEXA 1DGJA 2BCSA 1E0ZA 3GIIA 4ICUA 4YN4A 1UCVA 2W7OA 4DL2A 4DSLA 1K1QA 5KFFA 1BPYA 3PO4A 3EZ5A 2BKRB 3JPOA 3LYYA 5J0TA 4NLZA 5L1LA 2WF6A 2WXNA 4Y2YA 3C2LA 4B0MA 2BYTA 4M9HA 3JSVA 9ICEA 2E3TA 4QWBA 3PY8A 2XGQA 1J0GA 3TADA 3Q8EA 5E6JA 4NJ6A 4YWGG 5KG1A 3HWTA 1JI7A 5J8YC 2LYHA 5J2FA 1I42A 2DWQA 2WTFA 1PZNA 4RNMA 4MGYE 3URYA 2HDEA 2IDYA 2XY7A 1LGRA 3IHQB 2ZPNA 3QNMA 1L4DB 1M4VA 2EZZA 2DENB 3DBSA 4J3OD 2KJ9A 4G9BA 2R18A 2IMWP 2CJNA 2KN7A 8ICSA 4EUTA 3UM9A 4MSQB 3Q8PB 2KO3A 3PRPB 3L08A 2H3FA 3P2BA 1DXSA 2V3PA 3W5UB 4Q43A 5DKWA 3AECB 1TVAA 3RULA 2I6XA 3ZI4A 2HHWA 3KKAA 2KDFB 2EH9A 4RT2A 2CPRA 4EX7A 3FILB 2HHSA 3PRZA 3APDA 1XSPA 1TYGB 2LXAA 3WCQA 1J7AA 1NJXA 3CSTA 3KQ4A 4MELA 3IBEA 3T5HA 3U2SC 5ALFA 3T3NA 4HCNB 1X9WA 4OJOA 1L6VA 3T3FA 4LZGA 1WI0A 2HJ1A 2WAQF 4RQ5A 3RB4A 7ICKA 3BY4B 4BZAA 2PW9A 1YJIA 3MGVA 3I76A 3UXPA 3PMNA 4JWMA 1U47A 4Y2PA 5CR0A 2G0AA 5J0XA 3H6NA 2JQRB 3C5FA 2NYVA 2AH5A 1ZGUB 1T5XD 5ALIA 8ICKA 2IGDA 1L5UA 4K4HA 2CHXA 2IYDB 2QARB 2WYQA 2M56B 1GJZA 3UQ0A 9ICAA 1SZHA 4EENA 4QZEA 4DQQA 4I2GA 3Q8CA 2N1RA 3I63C 5ALUA 1S8OA 1GPXA 1QF6A 3RB0A 5AM0A 9ICOA 9ICBA 9ICIA 3PZDA 1S5LU 2Y5PA 4B9UA 4QJFB 1KH0A 4IRCA 5KG3A 3P4PB 3NGDA 2XC9A 1FRDA 3EGRA 3H7PB 3E2EA 4CO7A 1FXAA 1N61A 1MHHE 5BOMA 1KFDA 4Z6FA 2R8GA 4OO1J 4BVUC 2Y9UA 2B6GA 3K9OB 2K25A 3T79A 9ICNA 3NHEB 2HOFA 8ICHA 4O9MA 1A5RA 2RMMA 2K3UA 2IO2B 5D4BA 2V4IB 2DYOA 3I3TB 4UATA 3ZXRA 4YXDB 4RPYA 4BOZB 3IT6B 3PZ7A 3M62B 3SR6A 5KFDA 2BYEA 1TV9A 2L5YA 1GNUA 4KLIA 3N9YC 4HDOA 3BQ0A 1UD7A 1ZW7A 2IO1B 2JZPA 4LNKA 4OCZA 1RG6A 1HZ6A 2Y3AA 3QIJA 4CGZA 2K8BB 3TBLD 4K4IA 2FBWB 2BDUA 1NNLA 4PZNA 5D49A 3RJJA 3EFUA 2HI0A 2RQ5A 4BXOB 5ALQA 3SD7A 4FZNA 1UA1A 8ICVA 4YT0B 4PGQA 2KNJA 1X40A 4BGDA 2N1VA 2NV3A 3IHPC 2VZKD 5L83A 2KD0A 5IP4D 1I35A 4DFMA 1B1ZA 3RF9A 5KT2A 2FIDA 5F3XB 4EBCA 1TKGA 5DQIA 3DCGA 4JLCA 1CUKA 1GG3A 1IV8A 1SGGA 2WQYB 2YMMA 2FLLA 2D3AA 2CHWA 4P2HA 2KX0A 2NRVA 3PW4A 3FC4A 3JYUA 3IG5A 3MDAA 3NOBA 1SWWA 2M19A 5DDYA 2FCSA 2G1EA 4JQWC 5J0SA 1JN3A 2DGZA 2KK8A 3ZJTA 4RCOA 1RFKA 3RJIA 2NBVB 1SKSA 2ZCBA 1U45A 4LTUA 3KWVA 3QU4A 4ASWC 1ZD2P 2OCEA 2VH1A 2BPCA 2HBJA 3QE9Y 5ALYA 2OH2A 1SE9A 1WCLA 2QC8A 5KFNA 3ZDTA 2BDPA 1UPHA 5DDMA 4II2B 3RH5A 2BVCA 5J2HA 4ICVA 2WX0A 3RAQA 2W03A 2R8IA 4P4PA 2XY6A 1TK0A 4X57B 2GLSA 2AGOA 1F52A 3RRHA 5AKLA 4TUSA 5AZFA 3E58A 2G06A 1SKWA 2BYVE 3AU2A 4QWEA 2P6UA 1E9MA 4Z6DA 3ZNGC 2BKEA 4WURA 2RPVA 2BYFA 1EUVB 2HHVA 2BF8B 2V3NA 3W1SC 9ICFA 3MGHA 2V1YA 1KW4A 3Q3FA 3BVMA 5DB8A 3RRGA 4F92B 1TS5A 2Q0ZX 4IC7B 2KMAA 2Z8LA 3AN1A 2PFPA 1LO5D 2VA8A 2KIVA 4F4KA 2JEGA 4A8XC 4I2DA 4B9LA 4IQVA 1HA5A 3AI5A 1PVQA 2Y9TA 1XO3A 1MC8A 4MJSA 1YD8U 4MGZE 4JMUA 1C79A 5IOIA 2MRLA 8ICBA 1FXIA 4PYZA 3ZD9A 3MJWA 2G3QB 5J2EA 1VZ8A 4HPLB 4S0RA 4GXBA 4KLGA 3QU5A 2BGFA 3DWMA 2KMCA 1ZQIA 3Q8QB 2KKCA 3NG0A 3HKZC 4ED1A 3KTQA 1WXAA 2ZUDA 5DLFA 1J2MA 4M8NA 2INDC 1RZTA 4HPPA 5CHVC 2BT6A 1ED1A 5IO9A 3C28A 3RH6A 2P6RA 2NS5A 3GILA 5D94A 3ZNZB 3AEBB 2FPMA 2M4NA 3ZKJC 4IQTA 4KSKC 2B76B 4YXMA 4C8MA 2KTRB 3M9OB 2L0FA 3K9PB 1T7PA 5J2BA 2N7DA 5AI4A 3NUHB 4BFRA 3ECIA 2MW5A 3QX7A 1Q46A 2EZYA 1JWAD 3DVGY 5FP0A 2A1JB 5HMLA 3OJSA 4DL3A 1T6BX 5TISU 2EAPA 1BVSA 1WH3A 3CNHA 3CIRB 1KSPA 1F1HA 3I28A 1YN5A 3ISDA 1HUZA 3DEEA 2WXQA 3SHQA 2MUTB 5DBCA 2JWUA 2GWSA 1VDVA 5ALRA 3M8RA 4LDTB 3TMPB 1PGXA 2MEKA 2M0AA 1AQ6A 2KZZA 3HILA 5AI8A 3RB3A 4ZH4A 2JYEA 3FILA 1PUTA 5KAFU 5EE1A 4ARCA 1ZKHA 3UIPB 4P4MA 4PPXA 3PO5A 5KFLA 2KKVA 3TQ1A 4F4XA 3IG8A 1MJDA 2ZEQA 4DK5A 2N7JA 2BS2B 4OJPA 8ICJA 4WWPA 2K4EA 4RPXA 5CTRC 3UINB 4EZ6A 2D10A 3HX0A 3AB5A 1YOVB 3B0YA 1J8CA 1RDFA 2J6UA 4F5NA 2PMVA 3N7PD 1MHXA 4MFFA 1KM7A 2MA1A 5BMIA 1GO3F 3KOOA 1ZOYB 4LNIA 2L52A 4ANVA 1D3ZA 3M6ZA 3AE7B 5C1ZA 2QARA 2EKEC 4FLHA 7ICPA 2AGQA 3LDZE 3F2DA 4LJOB 2WXKA 4P1CC 2D6FC 4DFDA 2SAKA 2AJQA 4PJ0U 3PX0A 1X9MA 2XBBC 3AULA 3KHHA 2F8KA 4O5KA 4WQMA 2AXTU 5D3IB 3QUBA 4F8RA 1D5ZC 1YX6B 4HJGE 4ED3A 3H7PA 2JPHA 1SL1A 1ZDXA 3K75D 4KN7A 5AUIA 3HKZF 2F1HA 3O0FA 4C80A 2FUHB 2GBJA 4YR3A 2LGXA 3ZNHB 9ICPA 4EBEA 4IQWA 4EEYA 1NK6A 1FEZA 2KSOB 2JH7A 4RQ3A 3ORYA 1RQLA 3WK6A 1H4RA 1L2NA 3D2SA 1E5WA 1T0SC 1KN5A 3QXGA 2DLBA 2IZVB 4ECVA 5ALTA 5KG0A 4GDKB 2F2AB 5LXIB 1PGBA 2FPLA 2C7MB 1P1AA 3UXOA 4F93B 4B6WA 1SE3A 5J2JA 4K7UA 1NZBA 2K8BA 3B2GA 2YEPF 4KZCA 3VR8B 2XNAC 1MI0A 2JZBB 4BKSA 1FCLA 2F1JA 3NTUA 4BXOA 1WM3A 4FULA 4RFBA 2C9WB 4RQ7A 3F53A 3V3XA 1QTMA 5HI1A 3TADC 5KFCA 3T5KA 1QOBA 4NLKA 4GU2A 4JUZA 2G07A 2WF8A 1ZD3A 4NJCA 1KDHA 4QZBA 3SENA 1IUEA 4B95A 2MJ3A 2VJ5A 5J2AA 4BX9C 1C20A 1OEYJ 4YTMB 2HE7A 1QQ7A 2HJ8A 2IBKA 1B9RA 2F77X 1YQ3B 1C76A 3ICXA 2J42A 2GB1A 2WHIA 5DGBA 3F2CA 1V81A 2LD9A 5GMVA 4EX6A 3VH3B 4EELA 3QEAZ 4AJYB 3ZJVA 3MC0B 1S3SG 3B1LX 3N4MB 3VH4B 4IUMB 1QSYA 5KG7A 2E5SA 4F4ZA 1SIFA 1N60A 5TSSA 2LYAA 4LNNA 2JT4B 1WG8A 2J7QB 2LRWA 2V9HA 4OJLA 4CRXA 4RUAA 4IRDA 3H1UA 4DSFA 5DB7A 1UELA 1WXSA 4Y2VA 2P66A 5KFIA 1V49A 5ALKA 4GB9A 3CW2C 3PS6A 3ONNA 1UUPA 5KFZA 1MN8A 2K8CB 2EMTA 2YB4A 2ALZA 1JQ4A 5AKEA 3TSSA 5HHDG 2W82A 2WDTB 2ON8A 2KC2A 2GBKA 3HPOA 3E56A 4CHKA 4DL7A 4DL4A 1BMLC 1NVID 4K3BA 1L7YA 1E10A 4Y2RA 2ZW0A 2ZIXB 2Z7JA 1PUZA 3V72A 2I1JA 2KACA 4M6WB 4J9KA 4RGMA 9ICTA 1WUDA 3IM1A 3VC8A 3LWMA 2K8AA 2MU2A 3SI8A 2O6VD 4XX5A 5HKHA 3PREA 1L7OA 4IWOA 3KUZA 4C4VB 3TEXA 2W9NA 3H0LB 1S10A 3R7QA 2LUEA 4ELVA 1FD6A 4M0WB 3GE3C 1FNVA 2BB6A 4RF1A 1KLVA 3AU4A 2IA6A 3EC8A 2JZZA 5J0RA 2LYBA 1NEKB 3A1QA 1WJ4A 2V9WA 2JUOA 2AQ4A 4IDIA 1NI3A 3JW0X 1R4MI 1ZQRA 2I9GA 1PQSA 1XC9A 4F5OA 4EZ9A 5IIKA 2MBBB 2NRWA 4W9LA 3EFCA 2Z0DB 1ZQHA 3RZFA 4XRHA 2HW3A 5CEHA 1JUDA 5ALEA 4ECZA 2GBMA 2KDMA 3TAQA 2Y5CA 3AEAB 4C4RA 4CNQA 2NCNA 5C2TB 3MR3A 2DKXA 1VLBA 2FCQA 1NBFC 4XE0A 3W5VB 3THVA 2A1AA 4J9MA 1XSNA 3Q6BA 4RM8A 2OJWA 5E6NA 4NQLB 5KAIU 5HHHA 4GIBA 4EBDA 4FZMA 4Y2XA 4KV2A 1Z1BA 4I2AA 1YX5B 5BO4B 4RF0A 3H7IA 3QEBZ 1TJEA 2D2QA 5J2RA 4DHZE 2N1WA 4A55A 3K4GA 2IOHA 2G45B 2RDJA 4O3SA 2MUTA 3PHXB 2QMTA 4E71A 2E6XA 3AE6B 3EWAA 3Q3JA 1NK4A 1TKYA 3PPAA 9ICGA 4CQNA 1N48A 5JUMA 4ACOA 1Y56A 4DCCA 2KG5A 4MEYA 3Q8KA 2DPIA 3V6KA 1GAQB 3RJEA 3RJFA 4TSSA 3P63A 4G11A 4A3OA 4JV2A 2L3ZA 4RMAA 1SSNA 1DYQA 1L7PA 1HEKA 4NY0A 3AMZA 3BQTA 4C8KA 3DBRI 1V8CA 1HUOA 1LFDA 3A0HU 3H40A 3ABVB 4BJQA 5CHGA 2W11A 3AUOA 3KD3A 1P7FA 1OQRA 3CF6E 1YT3A 7ICEA 3MR6A 2F3NA 2V0GA 1PFDA 2OYYA 4GN1A 4BWMA 2EDUA 4ZOHC 2B0CA 7ICOA 4F72A 2W54A 1F5SA 1LB2B 3GFKB 4KGRA 5ALHA 3PV8A 1EU4A 1N5XA 4NZLB 2DZIA 3ZVVA 1RYSA 2ASQA 1X2IA 2FPKA 2WNMA 8ICXA 1ZRNA 4Y2SA 5AM5A 2XCAA 2ZG6A 5C0YA 8ICFA 4A90A 1COOA 5ALVA 5BYSA 1SJHD 2W9AA 1JW9D 3DWGC 3TUOA 8ICQA 3NZSA 4W9DA 2KZMA 4ZRJA 1XO1A 2RGFA 3ZQ4A 3KBBA 4RGTA 2RPQA 4UDUC 1XSLA 3A9JB 5CHWA 2HSZA 3L17A 2KSOA 5T14A 1ET9A 4LJXA 2BWFA 1KL9A 1QILA 3AU5A 3DBHB 4DDGD 4QIWC 1SXDA 1ZQTA 4FBTA 1IXRA 1SXTA 5H92C 4GDKA 3MC8A 1WJ6A 5DB6A 3WK7A 2KWCA 3KYDD 3WKEA 5KT5A 4ITKA 4ED6A 4RNNA 1MPEA 1ZQUA 4J9NA 5AK6A 2HMXA 8ICEA 1RFAA 1YIWA 4CCHA 4PYUA 2JMGA 1BPZA 3UQ2A 2R8JA 3CWIA 4I2JA 1C9FA 3IN5A 3V6JA 1KFYB 2V4QA 1VJKA 3PNCA 2R2QA 2V4LA 2KMDA 4K3CA 4G3IA 4C00A 4JV1A 3NVYA 5KFQA 1GC6A 1SV0C 4KLHA 3N1XC 4NJ7A 3ZGZA 3LWLA 1XT9B 1I4PA 1YQ4B 4HK2A 1EF1A 4I6LB 4PL1A 2PJHA 3HRDD 4GFJA 4RGNA 1B4FA 1JWUD 3TEYA 1ZQVA 1HTQA 1QLBB 4C56C 5KFHA 2L32A 1WZ3A 3MFHA 4W9FA 5IINA 2ASLA 3KHGA 4IRKA 3PR4A 2VZKB 4W9JA 3V05A 4FS2A 1LXDA 2Y0SC 3UMCA 1WGRA 1TY2A 4PHEA 1ZQ1C 4J6IA 2E1EA 3IRUA 5GTIU 1SZPA 3KUCB 1QCKA 4RZRA 3BVGA 2ZIVB 5EWFA 1HE8A 2J53A 4F5PA 2MBQA 2KMMA 2WXFA 4QZ8A 4DFKA 4MH8A 1GUAB 3RJGA 1XF5L 2DZJA 1M6YA 1KLUD 2ZVNA 4MGKE 4OVUA 2E1FA 4EEKA 2KOXA 2KX3A 4WIPA 4GOCA 3MBYA 4NXZA 2IO0B 1QZEA 3LK9A 1IGDA 1CJEA 1BPBA 3MJ5A 4KN4A 4EYIB 5J18A 1YJ1A 2K8CA 4UASA 2J6SA 3R66C 4FE3A 3Q8AA 2EANA 1QLNA 2M8SA 2QEJC 2BCVA 2KHVA 3L16A 1JX4A 2GH1A 3UI3A 4MF8A 2D3BA 5KHOA 2K39A 1NYQA 1WYWB 1SGHA 1XD3B 1ZPSA 3Q8BA 3WA0A 3WK5A 2ZIXA 2HDOA 2VRRB 5BPCA 4ANWA 4QIWF 1J2NA 1SBBB 4H2AA 4UW9A 4M6WA 5J2KA 5CWRA 4I2FA 1SE4A 2J0KA 2EKIA 3VQIA 2L05A 2BR0A 4QZIA 4ECWA 2BB5A 2NBUA 4PZOA 2GOLA 4C4VA 4MT5A 4GXKA 4M0WA 3I1YA 1ZQWA 3U26A 5HMMA 1ZXHA 2WP9B 3HJEA 1N62A 3KFUF 3Q14C 2V4RA 7ICVA 3QJZA 5F9NA 1ZQPA 4DFPA 3N7RC 2DX5B 3EPGA 2BGWA 2WXGA 4YFKA 3ZTCA 4RQ8A 1C4CA 1PYWD 3LXFA 2WXJA 2RDIA 3H0RB 3TI0A 4I29A 1KKXA 2AQ2B 2F8LA 1WWVA 1RRBA 3PZ8A 2LPEA 3GZNI 2MSED 1HZ5A 2JY6A 4A6QA 1Q1OA 2MWSB 2W9MA 3NZ3A 2I1QA 4LK0M 4HLEA 1KOTA 2KIWA 4YD2A 1F0ZA 3ZXVA 2FMPA 2W7PA 2XGPA 3QYPA 2OOBB 3ZRCA 2YLMA 2OM6A 1NJZA 5KFJA 2BPSA 1E90A 4FJYA 8ICPA 3APCA 4ICAA 2F76X 2FMQA 4FBUA 2LXCA 1H8CA 2Y0SF 3H8HA 4NAWB 2KXJA 4DWIA 3N30A 1WR1A 1YZ6A 2RLTA 4J9RA 4J9OA 1KFSA 3IG3A 2HOIA 4JPSA 4DO9A 3HIZA 4TKNA 1N56A 3HP6A 4Z6CA 1NJYA 1FM0D 1HEZE 1CK1A 2DBYA 2H88B 3SEBA 3NRZA 5KFRA 5KFUA 1UGJA 3VUXA 1V5TA 3PSEB 4FZLA 5AKZA 2HTHA 2LMCA 3PV1A 2BHNA 3CRXA 2TSSA 4F7ZA 1V2YA 2VA2A 4AUQC 4YR2A 1D9FA 2VA3A 2JSVX 2JH1A 2IHMA 2HHTA 2WF9A 1PVRA 1EM7A 2Z0EB 1WZ0A 2INPE 8ICWA 2KTQA 1V1OA 2FE8A 1BT0A 1RLFA 4WWNA 3RBDA 4I2BA 1E7UA 4GXIA 2KYWA 2HBMA 2H3ZA 4HRSA 4YVZA 3C2KA 3OJUA 2ZCCA 4XDCA 1SV4A 2ZUCA 1XNSA 4HCPB 2HHQA 5KT6A 5AM3A 2JRZA 2XO7A 9ICHA 1L6UA 1UF0A 4YL8A 3ZW3A 1S0OA 5IA7A 4M9NA 1L0XB 3IAS1 1XLOA 2FIFA 2OWOA 2MHJA 4KLSA 1S1QB 4W9GA 1T94A 2YMPA 3TFRA 2KE7A 5ALPA 2GOWA 2KJ5A 1BXTA 3C21A 1ROEA 1MG4A 4KLUA 5CA7A 1ZQDA 3Q3MC 4OJ5A 5AEKB 2KDEB 5KT7A 3BK1A 3EUB2 2GBRA 5JXVA 5J0OA 2Y5BB 4TUPA 4X5VA 1BPEA 1VR9A 2JXXA 2QJLA 3FDSA 3BZDB 1Y8RC 4Y2JA 3AL0B 4BKGA 2YTUA 5J17A 3A9JA 4R63A 4E74A 1V9JA 1NK5A 3PRMB 3IP4B 2ZIWB 4Y2TA 8ICRA 2PKOA 3SU8X 4MH0E 1L3VA 3VTVA 3KHRA 2ESEA 3APFA 1T0QC 3KH0A 3KWLA 5DBAA 1JRPA 1NK8A 1S0VA 1Z4NA 2BQQA 1X6IA 3EYZA 3RB6A 3C29A 2JEIA 3WK9A 5B5EU 3ML8A 3QK0A 2KANA 2CR5A 4F2SA 4KTQA 2DZMA 1TK8A 4IWQA 2A4ZA 1WR6E 5C23A 3DVNU 2N9LA 3PT2B 2MH7A 4O3QA 5KHQA 4HYKA 4BDPA 4XWTA 1WX8A 3SZ2A 4KVGB 5DG8A 2KNBA 4K81A 1IM4A 1HXYD 1MSWD 3PGEA 4TV3A 3A1QB 3NVZA 4FXCA 1LQBA 1ZQBA 1ZOLA 1QH9A 2LGYA 2C2DA 1VZ7A 3CMMB 3F5AA 3Q8LA 1L3UA 5ALJA 4US9A 1R4NB 5AM1A 4RQ1A 4IG7B 2PI5A 4KX5A 5AK5A 4M04A 1J19A 3I5JC 4AP4C 2KD1A 7ICRA 3H4DA 1LKYB 4GC7A 3QU9A 2O6KA 9ICUA 3H8JA 2EELA 5AICA 5AKGA 1KEJA 2YY6A 4WJOA 4YMMA 2Y1IA 4R65A 3WANA 2ZIVA 4F3OA 3N97B 4KSLC 1ZQFA 4Y2UA 1K5OA 3ISBA 5J2CA 1ZJNA 3RJHA 3H8WA 4AS1A 4RH6A 4UB5A 2ZXHA 5BMGA 4KLMA 1XO0A 1V1PB 1N63A 4TQRA 1BPXA 2C28A 1SF0A 3VDZA 5ALSA 4FO6A 4ZRIA 4CE6A 1ZXIA 3IFWB 1C1YB 3B9JA 4NY8A 4XWWA 3Q8RB 1HTOA 3MHZA 2ZJ8A 3M1YA 5L1IA 2FNJB 2XK5B 3TL5A 3M8SA 7ICNA 2J0JA 2JRHA 4B9MA 2HBLA 4I2HA 4TQSA 4GC6A 4RT3A 1NK7A 1WSPA 4M02A 1N5WA 1DRGA 1TY0A 4L23A 2DZKA 2KQ4X 1L7MA 2HHXA 1RYRA 1QQ5A 5B66U 2M0XA 4YSYB 4F5QA 3U8ZA 4EOYA 2H3IA 2W8KA 4K4GA 1EF5A 4FA6A 5AKXA 2NBWB 1CEZA 7ICJA 2DFLA 5TR5A 1T0RC 3PSFA 3VAWA 2MA9B 4M8MA 3VCBA 4EFOA 3C5GA 3UIOB 2AL3A 2M1MA 2ZJAA 1MFWA 3SFDB 2D5GA 5J8YA 4B9TA 2KJ6A 4YSZB 1U4BA 1UNSA 4ECYA 4WJPA 4PS3A 3J9CA 2C7HA 4XZ4A 1T4GA 9ICCA 1JCKB 2BWES 3ZTDA 4QZGA 2INNE 4GLSC 2LJ5A 3SV3A 5ALXA 4C8OA 2W04A 2Q5WD 2YEPB 2IO3B 3TCAA 2HHUA 3OPXA 2O6VB 1SIJA 5DPWA 3NVWA 3M9NB 4DQRA 4O3MA 1ET6A 4I2CA 2PFNA 4IKGA 5KFBA 1D5MC 3HVDA 3RT3B 2RDHA 1QQ6A 1UZXB 2L1AA 1UGMA 4NV0A 1NK0A 4OHJA 5E6PA 2G5HB 4IM3A 2K4HA 2EMSA 2AHOB 1ZQYA 2G4DB 3C1ZA 1V97A 4NAWA 5DPTA 2KP7A 4EEWA 1PK1B 3P42A 1ZQZA 1RYUA 4W9HA 1O08A 8ICTA 4JWNA 3W1YA 4O3NA 1KF6B 2VKQA 3VUWA 4NL9C 2WX1A 4DHJD 2B3AA 3PX4A 2LWPA 7ICIA 8ICAA 3H4BA 1QOGA 2QIEB 1JMSA 2LI6A 4ECRA 2R61A 1Q0WB 3RNCC 2ZXIA 3E0FA 2DF4B 3K1RB 5IN7A 3LJ3A 4QW9A 1BNPA 1L5PA 2CKHB 1XWLA 4UB6U 4KLDA 2NRXA 2NRTA 3V60A 3DHGC 5DPSA 3OTQA 1SKRA 7ICSA 1WGDA 4ACFA 2RRDA 1IG6A 5H2FU 3AEVA 2GI9A 2LM1A 3ETRA 3PSIA 3RD2A 3CYMA 7ICQA 2QB0A 3RCZA 2BTEA 5L95C 3AEDB 4UB3A 8ICGA 4KLFA 2G08A 8ICNA 1Y88A 5EOZA 1TS3A 2KLGA 2RD0A 4TUQA 3U7DA 2KOBA 4HAIA 4DF8A 2DHZA 2JEFA 3GP7A 5KL8B 2G4SA 1ZYQA 3MDCA 3MFIA 2MBEA 5J0PA 2BPGA 3KKAC 3AE5B 3ISCA 2R8KA 3PW2A 4B9NA 2DNFA 2BQUA 1ZQKA 7ICHA 4IL6U 1YJJA 3HK0A 4UARA 4JL9A 1Z5SB 2L8JA 3EW9A 1FFVA 3JPSA 1AN8A 2J4XA 1D9DA 3R7RA 3MABA 5KFKA 4OVZA 2MAXA 2YX8A 4MACA 2EQYA 1UBIA 2Z59B 4WH4A 2LEKA 3N3KB 7ICTA 1Q10A 2OEHA 4XGAB 1VZ6A 3BS7A 3NRWA 2JYTA 3Q2AC 1ZQJA 4C7ZA 2ZIWA 1TKEA 3PO0A 4CYEA 5IIJA 4EZLA 3NS1A 4EZJA 3DPDA 7ICFA 3RMKC 3TIXA 2JRIB 2KHWB 2WXMA 4TMAB 2KKPA 3UGBB 2VANA 2W9CA 1PGAA 2W55A 5KFOA 3G6VA 4FFDA 1DK2A 3L5KA 1KLGD 4HJKA 2C7NB 1B43A 4BWJA 3TACB 8ICMA 3T5JA 1WXQA 1T3NA 5J0WA 3DBLB 1C7YA 1L8LA 4KZ0A 4CDGA 1T8EA 1OUQA 3A4RA 2K4PA 2HVIA 5KFMA 2AWTA 5T8IA 4RQ6A 1F0MA 4Y2QA 2KN4A 3C8YA 3ZUNA 1ESFA 2DAJA 1Z00A 2RSUA 3SEIA 5KFEA 3HM6X 5C3JB 2QSDA 5JU5A 4XYCA 1UBQA 1FCCC 2MJEA 5TZVA 2UU7A 4KX6B 2PPHA 1SB3C 4KLEA 4QZFA 4ELUA 1TAMA 1ZQSA 1FPYA 1UWMA 2WDQB 3Q3NC 1UHUA 2MSNA 4ED2A 8ICOA 3UQBA 1DOYA 2LMRA 2W9BA 4P0PB 3AE1B 1FXTB 2I2YA 4N58A 1F77A 1TBEA 4DXFA 3FKYA 2UWQA 1QOFA 1QKZA 4XC2A 4AOFA 1P3QU 4J9QA 5LLIA 2ZTEA 3PHWB 3VVWB 3DDCB 1V85A 1LKYA 3OHBA 3GE8C 2YB1A 1WX7A 5D46A 2JWZA 1XEEA 4Q8EA 4GMVA 3IV6A 2P35A 5IILA 1E7PB 3W1SA 3GB1A 4DL6A 3Q3OC 2WU5B 1FFUA 5DBBA 3MC1A 4YXJA 1K8RB 2ZNVB 2ONQA 5IIOA 2AQ1B 2Q4TA 4OZCA 4D2KA 4FS1A 1O03A 3ZDAA 2GBNA 3WU2U 1X6JA 5J0YA 1V1PA 2LM4A 2ICIA 3D2QA 3AE2B 2KWVB 2HOQA 1EWCA 1NENB 4PGXA 1A70A 2IY1B 5KFXA 5AM2A 1KFTA 2XK5A 2LZ6A 5J2IA 4WQOB 1SEBD 5ALNA 2FCNA 2NO4A 4OW0A 4JWUC 2BCQA 1ACCA 5DG7A 3VUYA 1MG8A 1TZ1A 3RH4A 2K5PA 2PXIA 4DQPA 1TS4A 3N32A 1Q3UA 4M0AA 3ZDBA 4O3OA 5D3DA 3C23A 3OAWA 4NPNA 4B6JA 3L3FX 4RNOA 4R3DA 1NZPA 1ZDVA 1EWYC 2PE6B 1WWUA 4E0DA 4JGHB 2KV2A 9ICQA 3ZRFA 1TGZB 4ECSA 4DF4A 3BIID 2BKFA 5CP2A 3RAXA 4ZHPA 4U6PA 3B0AA 3GIMA 3N1YC 2ZW1A 1MA7A
chains in the Genus database with same CATH topology
1I4HA 1ZXHA 2WP9B 5I4DA 1N62A 2OHFA 1FXIA 1VRAB 4RNAA 4P16A 2WXGA 3AE4B 1TZOA 1VZ8A 1C4CA 1PYWD 3LXFA 5BMHA 2CJOA 2WXJA 1ZP0B 2MJDA 3B2FA 3DWMA 3TEZA 2AQ2B 5G5GA 1RM6C 3PZ8A 5EE0A 4A9AA 5FR3A 1HZ5A 4A6QA 2JX5A 3GS2A 2JU6X 3NZ3A 4LK0M 2BT6A 3AV8A 1F0ZA 2NTSA 3AEBB 1WGKA 2PVGC 3R2TA 2B76B 4DQOC 2WXRA 1T3QA 2PVOD 4B0EA 3HUIA 3H8HA 3NUHB 3Q69A 4NAWB 4P6VF 3SFEB 1JWAD 4JPSA 5MPOA 1T6BX 1AW7A 4ARIA 4HKZE 1IBXA 3CIRB 1FM0D 1YN5A 1CK1A 1FRRA 1HEZE 2DBYA 3NRZA 1UGJA 1ZE3D 2H88B 2WXQA 5LNK1 1GB1A 1XXGA 1QT9A 3BYTB 5H8YE 2JWUA 1I4QA 2LMCA 1VDVA 4TQ1A 1XCQL 2TSSA 1PGXA 2MEKA 2M0AA 4XDDA 2JYEA 3FILA 1D4BA 2JSVX 2LFIA 1PUTA 5EE1A 5HG2A 4ARCA 4LLGM 1JALA 1EM7A 4YTPB 2INPE 1V1OA 2FE8A 1DOXA 4C7YA 3BVZA 4PT5A 1TS2A 4AQ7A 2N7JA 2BS2B 3AB5A 3IT4B 4HRSA 2PMVA 2XN9C 2SEBD 1MHXA 4XDCA 1J7BA 5BMIA 1ZOYB 2L52A 4REZA 1OQQA 1L6UA 2JXTA 5BYRA 3AE7B 5HFYA 3FAHA 2NMQA 2I38A 1L0XB 3IAS1 1XLOA 5BYQA 3NVVA 2N0SB 2WXKA 5EE9A 1RWSA 5D7GA 2PIAA 3AE9B 3O13A 3VRBB 2SAKA 1YN4A 3IXSA 1YNTE 1BXTA 1JWSD 1ROEA 2AQ3B 2L83A 2J52A 1YMHE 4WQMA 5D3IB 2FUG1 1D5ZC 4HJGE 3BK1A 3EUB2 2BS3B 4YSXB 5JXVA 3OWEB 4US8A 4KKJA 1ZDXA 1XLNA 5AUIA 1FO4A 3P1MA 1VR9A 2NTTA 2ACZB 4C80A 2QJLA 3BZDB 4TQ0A 1KRHA 1JMLA 2PKOA 2WXOA 1EU3A 1QQRA 1K51A 1RYJA 3W9CB 2DLBA 3KWLA 1I4RA 1NYRA 1JRPA 4GDKB 4NAMA 3IAM1 1PGBA 1XLPA 2WDRB 3P4QB 4Q2JA 1GOZA 2LHEA 1I4GA 1SE3A 3HVZA 3KLSX 4ZYSA 3B2GA 2YEPF 2WLBA 3VR8B 3AE8B 2XNAC 1MI0A 1FNUA 3MP9A 3AM9A 1FCLA 1F2RC 4OZBA 2N9LA 2WXIA 2MH7A 4RFBA 3V3XA 4XWTA 2IGHA 5HI1A 4JWSC 1QOAA 1QOBA 4YTNB 4GDLB 2KAJA 1HXYD 4NJCA 3NVZA 1IUEA 2G9HD 4EE2A 4FXCA 1XCTL 2MJ3A 1FMAD 1VZ7A 4HKQA 4US9A 4YTMB 1K53A 1B9RA 1UWXA 1YQ3B 1C76A 2WS3B 1R7SA 2J42A 2GB1A 1WWTA 3BYYB 3ZYYX 2LUMA 3ZJVA 4JE3B 3MC0B 2EELA 3AE3B 1FEHA 1F2RI 2IPKD 1WYGA 1N60A 1FIQA 1KTKA 5TSSA 3U52E 1WRIA 2GRIA 4AS1A 4RH6A 5BMGA 2H89B 1V1PB 1N63A 3Q8FA 4USAA 1SF0A 1P7EA 4HROA 1ZXIA 1UUPA 3B9JA 4XWWA 1K52A 3MHZA 1JWBD 1JQ4A 3TSSA 5HHDG 2W82A 2ON8A 4MM3B 1JWMD 1CQVA 2IJ0A 1WSPA 1N5WA 3E56A 1TY0A 2K0PA 4L23A 1BMLC 1NVID 2KQ4X 5FKAC 1E10A 1MVKA 2ZW0A 4OZAA 4YSYB 1STEA 1J7CA 1IGCA 3AH7A 1I4XA 3I9V1 2KACA 1E6EB 2DYMA 4RGMA 3L4PA 1ENFA 1C78A 3SFDB 2D5GA 3RPFC 3TEXA 4YSZB 1UNSA 1SJED 1CZPA 1FD6A 3J9CA 4KGSA 1FNVA 2W3SA 2BB6A 4RF1A 2OEDA 1JCKB 3BWUD 2INNE 4GLSC 1NEKB 2Q5WD 2YEPB 4IDIA 1NI3A 2KWDA 3AEFB 4ZRQA 4N6EB 1SIJA 1DGJA 3NVWA 1E0ZA 2WXLA 1C77A 2WXPA 1ET6A 2LJIA 2WXNA 3LYYA 4IKGA 4B0MA 1D5MC 3HVDA 2BYTA 3TEWA 4WAFA 2RDHA 1AWDA 5EE3A 2LHDA 2E3TA 2KDMA 2L1AA 3U7ZA 3U4EG 3Q8EA 2Y5CA 3AEAB 4OHJA 3W2DA 1K50A 5E6JA 5C2TB 4YWGG 1VLBA 4XE0A 3W5VB 1D5XC 2DWQA 5AUKA 1V97A 4M0WA 3URYA 2HDEA 2IDYA 3P42A 2LGIA 2BBCA 1L4DB 2WDVB 1AYFA 1M4VA 3P4RB 4RF0A 2BW2A 1KF6B 1TJEA 4J3OD 2CJNA 1IBXB 5G5HA 4A55A 4O1NA 2QMTA 3W5UB 2V3PA 3AECB 1PDXA 1QOGA 2QIEB 2E6XA 3AE6B 1TKYA 2R61A 3E9SA 4L2YA 1L0YB 3FILB 4CQNA 2BS4B 1Y56A 1TYGB 3WCQA 1L5PA 1J7AA 3KQ4A 4ZRPA 1GAQB 3U2SC 4TSSA 3P63A 3T3NA 1SSNA 1DYQA 1L6VA 2GI9A 3ETRA 3AMZA 1V8CA 2PW9A 2IGGA 1YJIA 2BTEA 3AEDB 1C4AA 2PLPA 3ABVB 4WWMA 2JQRB 1P7FA 1OQRA 1TS3A 1XLQA 2V0GA 1PFDA 1T5XD 3AEEB 3GP7A 4ZOHC 2IGDA 2W54A 1DOIA 2M56B 4KGRA 5GXGB 4JX1C 3AE5B 1EU4A 3Q8CA 1N5XA 3ZJUA 4NZLB 3SEBA 1QF6A 1GPXA 1YJJA 2WNMA 1FFVA 1AN8A 2J4XA 2Y5PA 4A90A 1KH0A 5BYSA 2K9XA 2WU2B 1SJHD 4OVZA 3P4PB 3EGRA 1FRDA 1JW9D 3DWGC 3TUOA 4MACA 1FXAA 1N61A 4WH4A 1MHHE 2LEKA 1OFFA 2QILA 3ZQ4A 1HQRD 4RGTA 1Q10A 4UDUC 1VZ6A 2JYTA 4N59A 3BK2A 4C7ZA 3EA6A 1TKEA 3PO0A 1ET9A 3NS1A 1QILA 1SXTA 2RMMA 2K3UA 2WXMA 4TMAB 2AX5A 5H92C 2V4IB 2DYOA 4YXDB 3AEGB 1PGAA 3IT6B 2W55A 3PZ7A 1BUIC 3SR6A 1JROA 4ITKA 1MPEA 1KLGD 2RDGA 3N9YC 2N9KA 2JZPA 4IOIE 1HZ6A 5FK9C 4KKIA 2Y3AA 2FBWB 1WXQA 3CWIA 4DXGA 1C9FA 1KFYB 1FNWA 1VJKA 4YT0B 5T8IA 3MFGA 3RFZB 1ZUD2 2KN4A 3C8YA 1ESFA 2VZKD 3T3OA 5C3JB 2QSDA 4L1BA 1B1ZA 1FCCC 3NVYA 2MJEA 3ZGZA 1TKGA 4KX6B 1I7HA 1SB3C 1C4PA 2WDQB 1UWMA 1I4PA 1YQ4B 2WQYB 4HEA1 3R2IA 3R8BA 1D6EC 1DOYA 2K22A 3I57A 3HRDD 3AE1B 4RGNA 2I2YA 1JWUD 3TEYA 4N58A 1F77A 4DXFA 1QLBB 4C56C 3FC4A 1QOFA 2L32A 1QKZA 2M19A 2G1EA 2VZKB 3V05A 3ZJTA 2CU3A 4RCOA 1RFKA 1XEEA 1TY2A 4LTUA 3KWVA 3VRAB 1E7PB 3W1SA 3GB1A 3VR9B 2PTLA 2WU5B 1FFUA 3BVGA 2J53A 2WXFA 2KMMA 2ONQA 4MH8A 2AQ1B 1GB4A 4OZCA 1XF5L 1KLUD 4D2KA 4WIPA 1V1PA 4RGOS 2ICIA 3AE2B 1EWCA 1IGDA 1A70A 1CJEA 1NENB 3MJ5A 1SE2A 1SEBD 4ZHOA 3Q8AA 4OW0A 2QEJC 4JWUC 1E9MA 3UI3A 1ACCA 4KGTA 4WURA 1NYQA 1ZPSA 2K5PA 2RPVA 1TS4A 2HTME 3Q8BA 3LB8C 3P4SB 2V3NA 2WXHA 2W3RA 5D3DA 1SBBB 4H2AA 3BVMA 1L4ZB 4R3DA 1TS5A 2X38A 1SE4A 2EKIA 1ZDVA 3AN1A 1EWYC 2Z8LA 1LO5D 3VQIA 1L0VB 2BB5A 4A8XC 1YN3A 1HA5A 1XO3A 3BIID 4MT5A 4ZHPA 1C79A 2ZW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3S A;  4C7Z A;  2WP9 B;  1N62 A;  1TKE A;  2PKO A;  2OHF A;  1FXI A;  3PO0 A;  3NS1 A;  1RYJ A;  1NEK B;  3W9C B;  3AE4 B;  2Q5W D;  2AX5 A;  3KWL A;  1NI3 A;  1NYR A;  3LXF A;  4IDI A;  1JRP A;  2CJO A;  3AEF B;  4N6E B;  5H92 C;  4YXD B;  1SIJ A;  1ZP0 B;  1XLP A;  1DGJ A;  3NVW A;  2MJD A;  2W55 A;  2WDR B;  3AEG B;  3B2F A;  3SR6 A;  1JRO A;  3DWM A;  3P4Q B;  4ITK A;  5G5G A;  1RM6 C;  5EE0 A;  4A9A A;  2JX5 A;  3HVZ A;  2BT6 A;  3AV8 A;  3B2G A;  2WLB A;  3VR8 B;  2FBW B;  1AWD A;  3AE8 B;  1F0Z A;  5EE3 A;  2E3T A;  1WXQ A;  3AM9 A;  3CWI A;  1E0Z A;  3AEB B;  2MH7 A;  2Y5C A;  3AEA B;  1WGK A;  2PVG C;  1KFY B;  5C2T B;  2B76 B;  1VJK A;  4YT0 B;  1VLB A;  1T3Q A;  3W5V B;  2PVO D;  1ZUD 2;  4JWS C;  1QOA A;  1QOB A;  4YTN B;  2KAJ A;  2DWQ A;  3HUI A;  5AUK A;  5C3J B;  1V97 A;  4P6V F;  3SFE B;  3NVY A;  2MJE A;  1JWA D;  1TKG A;  4KX6 B;  3NVZ A;  1IUE A;  1I7H A;  2WDV B;  1SB3 C;  1AYF A;  3P4R B;  2WDQ B;  1UWM A;  4FXC A;  1YQ4 B;  2WQY B;  2MJ3 A;  1FMA D;  1DOY A;  2K22 A;  1KF6 B;  3HRD D;  1TJE A;  2CJN A;  3AE1 B;  3CIR B;  5G5H A;  4N58 A;  4US9 A;  1FM0 D;  1FRR A;  2DBY A;  2H88 B;  4YTM B;  3NRZ A;  1QLB B;  3FC4 A;  1B9R A;  1QOF A;  3W5U B;  1QT9 A;  1YQ3 B;  5H8Y E;  2WS3 B;  3AEC B;  1PDX A;  1QOG A;  1R7S A;  1VDV A;  2M19 A;  2QIE B;  2G1E A;  3AE6 B;  1TKY A;  1WWT A;  2CU3 A;  3ZYY X;  1RFK A;  1PUT A;  5EE1 A;  2BS4 B;  4LTU A;  1TYG B;  1E7P B;  1JAL A;  1L5P A;  1J7A A;  3AE3 B;  3VRA B;  4YTP B;  3VR9 B;  3WCQ A;  1GAQ B;  1FFU A;  2WU5 B;  1DOX A;  4C7Y A;  1WYG A;  3P63 A;  1N60 A;  1FIQ A;  2BS2 B;  2KMM A;  1WRI A;  3AB5 A;  1L6V A;  5MPO A;  2H89 B;  3ETR A;  3AMZ A;  1V8C A;  1N63 A;  1YJI A;  4HRS A;  3AED B;  3AE2 B;  4USA A;  1SF0 A;  1NEN B;  1A70 A;  1CJE A;  1J7B A;  3ABV B;  1ZXI A;  4HRO A;  4WWM A;  2JQR B;  1ZOY B;  2L52 A;  3B9J A;  1OQR A;  1OQQ A;  1XLQ A;  1L6U A;  1JWB D;  1JQ4 A;  1PFD A;  3AE7 B;  3AEE B;  4ZHO A;  3FAH A;  4ZOH C;  2W54 A;  1DOI A;  4JWU C;  1XLO A;  3NVV A;  1E9M A;  2M56 B;  5GXG B;  1N5W A;  2N0S B;  3AE5 B;  4JX1 C;  1NYQ A;  2K5P A;  1NVI D;  5EE9 A;  1N5X A;  1RWS A;  2HTM E;  2PIA A;  3AE9 B;  3LB8 C;  1E10 A;  3P4S B;  3VRB B;  1GPX A;  1QF6 A;  4YSY B;  1YJJ A;  2W3R A;  1ROE A;  2L83 A;  1FFV A;  1J7C A;  3AH7 A;  1E6E B;  4WQM A;  2K9X A;  2WU2 B;  2EKI A;  3AN1 A;  3EUB 2;  1EWY C;  2BS3 B;  1FRD A;  1JW9 D;  3DWG C;  3L4P A;  4US8 A;  3P4P B;  1L0V B;  4YSX B;  3SFD B;  1XLN A;  1FXA A;  5AUI A;  1N61 A;  1FO4 A;  3RPF C;  3P1M A;  2LEK A;  4YSZ B;  1OFF A;  4C80 A;  1XO3 A;  2ACZ B;  2QJL A;  3BII D;  4ZHP A;  1CZP A;  1KRH A;  4N59 A; 
#chains in the Genus database with same CATH topology
 1I4H A;  3DDH A;  3GIK A;  4DSJ A;  3NZU A;  3TKA A;  2UVR A;  1WX9 A;  4C0Z A;  2W43 A;  2DUY A;  2MBH A;  4MDK E;  4RNA A;  1G6J A;  4WAA A;  3RNB C;  3AE4 B;  3SAH A;  2LBO A;  2KT7 A;  2CN1 A;  2QHO A;  9ICV A;  5BMH A;  2CJO A;  2O6V A;  5KFG A;  2CXY A;  1ZP0 B;  4QWC A;  1RQN A;  1WRD B;  4DS5 A;  4A9A A;  2WFA A;  5DCN A;  5FR3 A;  1P0R A;  2YML A;  2JU6 X;  3AV8 A;  1NDD A;  1XU4 A;  4DSK A;  2KFK B;  1JXE A;  2NTS A;  4QWA A;  3SYZ A;  4O3R A;  4G0N B;  2K8H A;  1OEY A;  2PVG C;  3G6X A;  4A20 A;  2HCF A;  1OTR B;  5EDS A;  2PE9 A;  4I6N B;  2QLT A;  2R2O A;  1T3Q A;  4B0E A;  3RJK A;  3HUI A;  3T9L A;  4WWO A;  3Q69 A;  5HHI A;  4P6V F;  4ZRK A;  3T5L A;  1N2X A;  1PK1 A;  2YN4 A;  5MPO A;  2D3C A;  2KEY A;  1AW7 A;  4R66 A;  5AI5 A;  2XIC A;  4HKZ E;  4PS7 A;  3M7D A;  5KFY A;  4C4S A;  4RPZ A;  3DOW A;  1S77 D;  1ZE3 D;  5LNK 1;  3V7L A;  1ZQE A;  2AU0 A;  2AL6 A;  3BYT B;  5H8Y E;  1I4Q A;  5AM4 A;  8ICL A;  4XDD A;  2DAF A;  4P4O A;  3AXC A;  3VXW A;  1HJP A;  1TK5 A;  2RR9 A;  4UB4 A;  5HG2 A;  2KVS A;  4LLG M;  1L3S A;  1JAL A;  1ZQQ A;  4LNF A;  4DLE A;  3J81 j;  5AK3 A;  4C7Y A;  4PT5 A;  3ZDC A;  4AQ7 A;  4YD1 A;  4RQM A;  2UVU A;  3OLM D;  3QUT A;  2K6D B;  3VHT C;  1Z4O A;  2XN9 C;  3ML9 A;  2H5X A;  2NVU I;  5A0L A;  3TAP A;  4M00 A;  4B9V A;  1J7B A;  4DOB A;  3V7K A;  5AIB A;  4G50 A;  5L9X A;  2AEH A;  4M9L A;  2ZJD A;  3FAH A;  5HFY A;  4NLG A;  2LKY A;  3NVV A;  5DQG A;  4YP3 A;  2EZX A;  4F50 A;  5AI6 A;  2EAM A;  2N0S B;  3O65 B;  4FJV B;  5EE9 A;  2M17 A;  3R3M A;  3N28 A;  3QZ8 A;  3O13 A;  1YN4 A;  2RDB C;  1YNT E;  4ANU A;  5JH5 C;  3JPN A;  2AQ3 B;  2L83 A;  1ZD4 A;  2J52 A;  2KZR A;  4I28 A;  2LGD A;  1D8B A;  3OJ3 A;  2W8L A;  1Q8K A;  2BQR A;  2BS3 B;  1ECW A;  2A5U A;  3OWE B;  4IR1 A;  4PHD A;  3LVV A;  1FO4 A;  2FE9 A;  2NTT A;  2VH2 A;  4F71 A;  1K1S A;  1S76 D;  4J9P A;  3D6J A;  3RYT A;  1S9F A;  2FCM A;  3GDX A;  4TQ0 A;  1KRH A;  5L1J A;  2E8M A;  1JML A;  2D8C A;  4KLO A;  1TAU A;  4W9E A;  3S2A A;  1CMX B;  2WXO A;  3RNF C;  1QQR A;  4QAY A;  1K51 A;  2FDR A;  2LVP A;  1RYJ A;  4BBN C;  2NRZ A;  4HVB A;  3QUC A;  1WJU A;  3EEC A;  1I4R A;  1NYR A;  4KDL B;  4KDI C;  4YQW A;  1ARO P;  2R8H A;  1XLP A;  2WDR B;  3WKA A;  1WE6 A;  3IAM 1;  4RQ4 A;  3RN9 C;  3P4Q B;  2IOF K;  2KVZ A;  3WKD A;  4DOC A;  4Q2J A;  4ECQ A;  2LHE A;  1AAR A;  3HVZ A;  3KLS X;  1ZQC A;  3DHI C;  2WLB A;  3F5E A;  1TKD A;  1FNU A;  3PVL A;  3AM9 A;  2L0T A;  4OZB A;  2WHE A;  3WK8 A;  2WGS A;  2YQE A;  3L0W B;  2XVT A;  2KQ7 A;  2IGH A;  3BZC A;  4JWS C;  1NOM A;  1QOA A;  4GDL B;  1P7D A;  2KAJ A;  2LI5 A;  4CF3 A;  4F5R A;  2WWZ A;  2I1K A;  5C5J A;  3QAQ A;  2ODG A;  4J03 A;  4ANX A;  2G9H D;  4GSW A;  4EE2 A;  2NPT B;  4BAX A;  2YMQ A;  4FAD A;  4DEZ A;  2JZ3 B;  4IM0 A;  3SAG A;  2C60 A;  3PW7 A;  1NKE A;  1OXJ A;  4P0P A;  2KTF A;  3PZP A;  4IC9 A;  1P98 A;  4C4T A;  2ZZP B;  3RNA C;  1K53 A;  4PK1 A;  2JXJ A;  4MHV A;  3GZF A;  1X9S A;  1QSL A;  2MBO A;  3CSF A;  3M95 A;  2WS3 B;  1R7S A;  2KFZ A;  9ICM A;  1WGY A;  3NS8 A;  4E3C A;  3BYY B;  2UYZ B;  4K7W A;  3OGU A;  4JE3 B;  2QKQ A;  1KLN A;  3JPQ A;  1E8W A;  3AE3 B;  3OG5 A;  1L7N A;  4HWI B;  4LJP B;  1FEH A;  3L10 B;  1F2R I;  5KG6 A;  1FIQ A;  5BOL A;  2LGS A;  4K7S A;  3JVZ X;  1WRI A;  3V6H A;  3VTW A;  4F8C B;  5ALM A;  1ZD5 A;  3MR2 A;  3LYS A;  1KJT A;  3SAF A;  4WJN A;  3BQ2 A;  4J9S A;  1ZQA A;  4Q44 A;  3DV9 A;  1ZQG A;  8ICZ A;  4HRO A;  2IOF A;  3DBH I;  1V38 A;  2LVQ A;  2ASJ A;  4MF2 A;  4ED7 A;  1JWB D;  4QW8 A;  3Q8S B;  4IR9 A;  1V5O A;  3ZNI D;  3GV7 B;  5EWG A;  1E8Y A;  4MM3 B;  3SV4 A;  7ICL A;  2JEJ A;  4WJQ A;  4M9G A;  5L1M A;  2RP5 A;  7ICM A;  4W9K A;  4DSI A;  1NKB A;  4OZA A;  4ED8 A;  4DQI A;  1BPD A;  1STE A;  4OD0 A;  4BBN F;  1J7C A;  1IGC A;  3DHH C;  4NLC A;  1I4X A;  3I9V 1;  5CRX A;  1E6E B;  3C0R B;  2RHF A;  2DYM A;  2QB0 B;  2D3G A;  3L4P A;  3V6C B;  1X1M A;  4KMO B;  3M9M B;  1ZQM A;  4YG2 A;  3IVF A;  5KTQ A;  1ZRM A;  1SJE D;  1UQV A;  4QZD A;  3HW8 A;  1Q3V A;  1CZP A;  4UAY A;  1PVP A;  4KGS A;  3WIM A;  3KHL A;  5KT4 A;  3ZLZ A;  4XQ8 A;  3DQV A;  1SL2 A;  3RTV A;  4C8L A;  1UT8 A;  2KWD A;  3AEF B;  4DOA A;  1E8Z A;  4DL5 A;  1C77 A;  2WXL A;  2WXP A;  3UMB A;  2F44 A;  3OHA A;  2LJI A;  2A3V A;  4GLX A;  3L54 A;  3EPI A;  4ECX A;  2VIX A;  3HM3 A;  3TEW A;  4WAF A;  1AWD A;  2KFK A;  5EE3 A;  2LHD A;  4UAW A;  3BQ1 A;  3U7Z A;  3M6K A;  3QUQ A;  3U4E G;  5AZG A;  4DXA B;  3W2D A;  1URJ A;  1K50 A;  1D5X C;  1IYF A;  3B0X A;  4U7C A;  3PLV A;  3M3J A;  5AUK A;  4M47 A;  4AJW A;  4RQN A;  2LGI A;  2BBC A;  2FMS A;  1WXV A;  2XCP A;  3BDP A;  1AYF A;  2WDV B;  3H9D A;  1TFR A;  3P4R B;  1JIH A;  2KJ8 A;  3Q8M A;  3ZDD A;  2BW2 A;  2M0N A;  2W9C B;  4FHJ A;  1IBX B;  5G5H A;  1HIW A;  1CI4 A;  4O1N A;  3UMG A;  2DPJ A;  4QZH A;  2ASD A;  4LVS A;  1PDX A;  2GLE A;  3E9S A;  4L2Y A;  3UQA A;  2WF7 A;  5KFT A;  1L0Y B;  2PMZ C;  2L00 B;  3PML A;  2BS4 B;  4UAZ A;  5CB1 A;  4ZRP A;  1Z00 B;  1WFY A;  3WAL A;  1MQ2 A;  1NKC A;  4B9K A;  4NM2 A;  3V62 A;  3ZO5 B;  2K4I A;  1NI2 A;  4FJZ A;  4UBC A;  4HDQ A;  4ELT A;  4KLL A;  4DHJ B;  2XI9 A;  1U49 A;  4B9S A;  3QAR A;  4YMN A;  1SWV A;  2UVW A;  1ZQO A;  4RUC A;  4LZD A;  3BS5 A;  2W9B B;  2IGG A;  2MLB A;  4ZDV A;  2KIC A;  1C4A A;  3RZW C;  1LV5 A;  2PLP A;  4WWM A;  4NQK E;  3GV8 B;  4IM2 A;  2D07 B;  2PI4 A;  3MR5 A;  1XLQ A;  2JF5 A;  5AI0 A;  1ZJM A;  4QZ9 A;  3GU3 A;  2K6Q A;  3AEE B;  1IIP A;  1RXV A;  3AQF A;  2N9P C;  1DOI A;  2PEA A;  4QWD A;  3V6E B;  5GXG B;  4JX1 C;  4ZYN A;  5HR7 A;  4DHZ B;  3ZJU A;  4EYH B;  4UQG A;  4M2Y A;  3QC8 B;  2ZIU B;  4S17 A;  2QB1 A;  4NNJ B;  2GMI C;  4ED0 A;  2KK0 A;  4KLQ A;  5FR6 A;  2PKE A;  4A8E A;  2ZJ5 A;  3RBE A;  2K9X A;  2WU2 B;  3A33 B;  1CRX A;  2ES6 A;  3N20 C;  1B0X A;  5AKJ A;  1E7V A;  3A0B U;  1OFF A;  2QIL A;  3FM9 A;  4I6P A;  1HQR D;  1L3T A;  3KYC D;  1V86 A;  3QX1 A;  2J0M A;  4EZK A;  9ICJ A;  1VJ5 A;  1WCN A;  1ISN A;  3BK2 A;  1SV0 A;  3EA6 A;  4N59 A;  4BKS D;  3QCA A;  5E79 U;  2G09 A;  2JHD A;  3ETL A;  2XEW A;  3A9K B;  1ZQN A;  3OJ4 B;  3GV5 B;  4R8U B;  3PR5 B;  2AX5 A;  3AEG B;  4JIO U;  1WF9 A;  5LXH A;  1BUI C;  1JRO A;  4KIT B;  3V7J A;  2KZ3 A;  1Z3E B;  3PVX A;  2RDG A;  4TUU A;  5AKH A;  2N9K A;  4F4Y A;  3H0M B;  4IOI E;  1IP9 A;  5FK9 C;  4KKI A;  2ISO A;  5AIA A;  4NM1 A;  5IKC M;  2L76 A;  5III A;  2AGP A;  4DXG A;  3HT3 A;  5HR6 A;  2D3D A;  1FNW A;  3RFZ B;  4II3 B;  3MFG A;  5E6O A;  5EWE A;  1ZUD 2;  1DOQ A;  4GDL A;  4YCX A;  1A6S A;  3T3O A;  2GO7 A;  9ICK A;  1TE2 A;  2C2R A;  1Z1V A;  2Y1J A;  1KQQ A;  2D11 A;  1ZQX A;  2JR5 A;  2PMZ F;  3TFS A;  4L1B A;  8ICY A;  4KMU A;  4AYB C;  5D2M B;  2REX A;  2KVR A;  1I7H A;  2NPT A;  1C4P A;  2IBI B;  3QA8 A;  2FLP A;  3R8B A;  5AKK A;  4URK A;  3R2I A;  2MP2 B;  1D6E C;  5KFV A;  2K22 A;  3I57 A;  1OW5 A;  3WKB A;  1BNO A;  1ZQL A;  1A76 A;  3HHM A;  3R9K A;  1A0P A;  5ALL A;  4UBB A;  3L13 A;  1R4M B;  1KRP A;  3JPT A;  1Z19 A;  4MEM A;  1LM8 B;  4UAV A;  1WGG A;  2CU3 A;  3X23 A;  4N9F 4;  1U48 A;  5ALO A;  4HPM B;  3LVW A;  5KNI A;  2N7E A;  3VRA B;  3PW5 A;  4KLT A;  3K1Z A;  2LAS A;  2PTL A;  4HXD A;  3VR9 B;  4OVV A;  4UB2 A;  2IHN A;  3ZDE A;  2JV3 A;  1NJW A;  1UT5 A;  1N6Z A;  3C1Y A;  3KW5 B;  1TIF A;  1GB4 A;  1UH6 A;  5G55 A;  3KVF B;  3WAO A;  2F1I A;  2O2V B;  3UPQ A;  4OJ6 A;  3N7S C;  4RGO S;  3BJY A;  2C5L C;  3MC9 A;  4YMO A;  4NJ8 A;  2KHQ A;  2MX2 A;  3LDA A;  1D8L A;  4JK1 A;  2PFQ A;  2FI1 A;  4CF4 A;  4F4W A;  1SE2 A;  1S0M A;  3PX6 A;  1F9J A;  2MQJ A;  5IAA C;  4ZHO A;  1UA0 A;  1WGH A;  4MM3 A;  3A4S C;  4I27 A;  4KGT A;  1S97 A;  2G5I B;  5KL1 B;  2HTM E;  3LB8 C;  3P4S B;  4KIK B;  1C3T A;  1MQ3 A;  4Q8F A;  2WXH A;  2W3R A;  4IWP A;  3QU2 A;  3RNG C;  1L4Z B;  3NAS A;  2CHZ A;  3IDW A;  4IS7 A;  4P0Q B;  1WJN A;  5AI9 A;  2X38 A;  3QHT A;  4PHA A;  3N1Z C;  5HNK A;  1J97 A;  1L0V B;  3B08 A;  4IW0 A;  2INC C;  1YN3 A;  3ONS A;  3SD5 A;  2DKZ A;  5CJ7 A;  1VCB A;  3ALB A;  3DBR B;  3QZ7 A;  1WMH B;  3U30 A;  4AWJ A;  4RM9 A;  4O3P A;  4C8N A;  1WE7 A;  5I4D A;  3MHS D;  3JPP A;  2OHF A;  3WAP A;  4DBG A;  2KJH B;  4XUS A;  2C22 A;  1VRA B;  3H8M A;  2C2E A;  4P16 A;  1R4N I;  2FJ6 A;  9ICX A;  1TZO A;  2FLN A;  1TAQ A;  4PGY A;  1M94 A;  5AZH A;  1T0Y A;  2H3V A;  3UXN A;  2MJD A;  3B2F A;  3TEZ A;  7ICG A;  3V61 A;  4AYB F;  5J0Q A;  5DB9 A;  4Q45 A;  4QZA A;  5G5G A;  1RM6 C;  5EE0 A;  2KDI A;  3NY5 A;  4PS8 A;  2JX5 A;  3GS2 A;  2AQ0 A;  3JSV B;  4EKU A;  2N9X A;  2CRX A;  1TTN A;  3F2B A;  2KLC A;  3OSN A;  4GXJ A;  4WJ3 B;  1WGK A;  1XQQ A;  3AU6 A;  2OJR A;  3ED5 A;  3WK4 A;  2KJR A;  3R2T A;  4DQO C;  4KX3 A;  2WXR A;  2E8O A;  5G2N A;  2PVO D;  4LDT D;  3C2M A;  4JB3 A;  3QQ8 B;  3BQ7 A;  3QU7 A;  2ZPY A;  3SFE B;  5DGA A;  2L7R A;  1L8O A;  2BQ3 A;  3CP8 A;  1SXE A;  2KQS A;  3SMV A;  3ENE A;  8ICU A;  4PHP A;  4ARI A;  2K60 A;  3PLU A;  1IBX A;  4DS4 A;  4FBJ B;  2MCN B;  8ICI A;  3PSP A;  1FRR A;  3U52 E;  2MRP A;  1GB1 A;  1X66 A;  2ISP A;  1XXG A;  1QT9 A;  2B21 A;  3NJT A;  3FYH A;  4O0I A;  4LCD E;  1XCQ L;  5KFW A;  1JXL A;  4TQ1 A;  5JRT A;  5J2D A;  4P1B C;  1U4A A;  2DL0 A;  2LFI A;  1D4B A;  1YZ7 A;  5KG5 A;  3QWZ B;  3RR8 A;  2LRU A;  4YTP B;  2KC1 A;  1DOX A;  3BVZ A;  4CF5 A;  1TS2 A;  5DPR A;  2WB1 C;  5GTH U;  2M9N A;  5KFP A;  4XA5 A;  4W9I A;  5CHF A;  3IT4 B;  5AKY A;  4R64 A;  2A19 A;  1EXN A;  2KVC A;  2ZTD A;  1L6N A;  1WIA A;  2ZNV C;  4FN2 A;  4BOS C;  2HD5 B;  2QDF A;  3BIN A;  1OGW A;  2V3S A;  2I5H A;  2PFO A;  1B22 A;  2SEB D;  4GGQ A;  2H3Q A;  4UAU A;  1F44 A;  2FAZ A;  3GIJ A;  3MGI A;  4REZ A;  3UF8 A;  1E8X A;  1OQQ A;  5IIM A;  4K1R B;  2JXT A;  2EAO A;  2ZVO A;  2CS4 A;  5BYR A;  1DK3 A;  2N9E B;  4IQU A;  2NMQ A;  2JGA A;  5AKI A;  4M9J A;  2I38 A;  2KWU B;  5BYQ A;  3G6Y A;  4GIV A;  2BZF A;  1V6E A;  4O5C A;  1U9L A;  1RXW A;  1RWS A;  2PIA A;  3AE9 B;  5D7G A;  1V80 A;  3VRB B;  2ZIU A;  4NLB A;  2YVC A;  4DLG A;  2OXO A;  3IXS A;  5F9L A;  1Z2M A;  1JWS D;  1WM2 A;  2XID A;  4RU9 A;  2X8X X;  5JZE B;  4AP9 A;  4F91 B;  1YMH E;  3GOE A;  4UB1 A;  3KUD B;  3AQE A;  2FUG 1;  3SDL C;  3WAM A;  4YSX B;  4MFA A;  4BKT A;  2WF5 A;  4US8 A;  1DGS A;  1OQY A;  4KKJ A;  1EO6 A;  1XLN A;  3P1M A;  2BPF A;  2J6T A;  2KFJ A;  2ACZ B;  2ZTC A;  3TAR A;  5CX3 A;  2KTR A;  2XY5 A;  2QCZ A;  1V9P A;  5ALW A;  1RAX A;  1EU3 A;  3RUI B;  5ALG A;  2CU1 A;  4TUR A;  2DYB A;  4LNO A;  3SQI A;  3A9K A;  4PH5 A;  3W9C B;  4R8U A;  2A1J A;  3T8M A;  4NAM A;  3NUQ A;  1NK9 A;  1IPG A;  2KDB A;  2N4F A;  5J29 A;  1GOZ A;  3KZX A;  5KFS A;  1COK A;  2K1F A;  1I4G A;  2JVC A;  3MTN B;  4ZYS A;  4ECT A;  2HBK A;  1RPL A;  3AE8 B;  3X0W A;  2UVV A;  3MP9 A;  1F2R C;  2WXI A;  2IY0 B;  1VD2 A;  5AHX A;  3ZDM C;  3JPR A;  8ICC A;  2DQN B;  1WXM A;  5HP4 A;  1QSS A;  3VTU A;  4QZC A;  1ZET A;  4YTN B;  3OSP A;  1WY8 A;  4DQS A;  3RNE C;  4QNL A;  4DDI D;  2NO5 A;  2MP2 A;  9ICS A;  1XCT L;  1FMA D;  4FHK A;  4M01 A;  2WB1 F;  4MSM B;  4HKQ A;  3ALR A;  2ATL A;  4YR0 A;  3C19 A;  4MFC A;  2K89 A;  1UWX A;  2NR2 A;  7ICU A;  1BGX T;  1YQB A;  4RQ0 A;  3PW0 A;  1WWT A;  4UB8 U;  2ZUB A;  3ZYY X;  2LUM A;  3GZN B;  5KFA A;  4F2R A;  9ICR A;  3RFA A;  4DSE A;  1D8Y A;  5DQH A;  3S6J A;  4JV0 A;  3PTF C;  4RQ2 A;  3D32 A;  4DWF A;  2IPK D;  1WYG A;  2KFN A;  1GC7 A;  3ZD8 A;  1KTK A;  3EHV A;  4ECU A;  5JHB A;  2GRI A;  3BZK A;  2O2V A;  2H89 B;  1Q5W B;  3KZI U;  4J9L A;  1P9D U;  3Q8F A;  5ALD A;  4USA A;  1KTQ A;  4PL2 A;  4HEA 1;  1LVH A;  1P7E A;  2AYO B;  2E8P A;  4Z6E A;  3D2N A;  2HVH A;  1K52 A;  2BCU A;  4F1S A;  5KT3 A;  1JRU A;  5K4L A;  1TT5 B;  1JWM D;  1CQV A;  5DG9 A;  2IJ0 A;  1KBU A;  4P7I A;  2E8N A;  5J2G A;  2K0P A;  1X9X A;  4W9C A;  3VFK A;  5AK4 A;  1A77 A;  5FKA C;  3WKC A;  4KIK A;  2WAQ C;  1MVK A;  5KG4 A;  3DVN V;  5JTI A;  5D6J B;  3H8S A;  3AH7 A;  4NWI A;  2VJ4 A;  3DBL I;  5J0U A;  1H38 A;  4P0Q A;  3H7S A;  4O5E A;  3M63 B;  3DVG X;  3BS5 B;  1S0N A;  1ENF A;  5KG2 A;  9ICW A;  2JZB A;  9ICL A;  1C78 A;  4A3P A;  3ZIM A;  4DFJ A;  3RPF C;  4KLJ A;  5JHA A;  4I2E A;  4I2I A;  5ALZ A;  4MJS B;  3RR7 A;  3PST A;  1WMH A;  1SL0 A;  1X42 A;  5DLG A;  3RI7 C;  2W3S A;  5L1K A;  2OED A;  3BWU D;  2LHT A;  3TAN A;  3GQC A;  1PK3 A;  2BCR A;  2KN5 A;  4NLN A;  4MGI E;  2LVO A;  3TJP A;  4NL9 A;  4BUG A;  4ZRQ A;  4N6E B;  4G3X B;  1XS9 D;  4MEX A;  1DGJ A;  2BCS A;  1E0Z A;  3GII A;  4ICU A;  4YN4 A;  1UCV A;  2W7O A;  4DL2 A;  4DSL A;  1K1Q A;  5KFF A;  1BPY A;  3PO4 A;  3EZ5 A;  2BKR B;  3JPO A;  3LYY A;  5J0T A;  4NLZ A;  5L1L A;  2WF6 A;  2WXN A;  4Y2Y A;  3C2L A;  4B0M A;  2BYT A;  4M9H A;  3JSV A;  9ICE A;  2E3T A;  4QWB A;  3PY8 A;  2XGQ A;  1J0G A;  3TAD A;  3Q8E A;  5E6J A;  4NJ6 A;  4YWG G;  5KG1 A;  3HWT A;  1JI7 A;  5J8Y C;  2LYH A;  5J2F A;  1I42 A;  2DWQ A;  2WTF A;  1PZN A;  4RNM A;  4MGY E;  3URY A;  2HDE A;  2IDY A;  2XY7 A;  1LGR A;  3IHQ B;  2ZPN A;  3QNM A;  1L4D B;  1M4V A;  2EZZ A;  2DEN B;  3DBS A;  4J3O D;  2KJ9 A;  4G9B A;  2R18 A;  2IMW P;  2CJN A;  2KN7 A;  8ICS A;  4EUT A;  3UM9 A;  4MSQ B;  3Q8P B;  2KO3 A;  3PRP B;  3L08 A;  2H3F A;  3P2B A;  1DXS A;  2V3P A;  3W5U B;  4Q43 A;  5DKW A;  3AEC B;  1TVA A;  3RUL A;  2I6X A;  3ZI4 A;  2HHW A;  3KKA A;  2KDF B;  2EH9 A;  4RT2 A;  2CPR A;  4EX7 A;  3FIL B;  2HHS A;  3PRZ A;  3APD A;  1XSP A;  1TYG B;  2LXA A;  3WCQ A;  1J7A A;  1NJX A;  3CST A;  3KQ4 A;  4MEL A;  3IBE A;  3T5H A;  3U2S C;  5ALF A;  3T3N A;  4HCN B;  1X9W A;  4OJO A;  1L6V A;  3T3F A;  4LZG A;  1WI0 A;  2HJ1 A;  2WAQ F;  4RQ5 A;  3RB4 A;  7ICK A;  3BY4 B;  4BZA A;  2PW9 A;  1YJI A;  3MGV A;  3I76 A;  3UXP A;  3PMN A;  4JWM A;  1U47 A;  4Y2P A;  5CR0 A;  2G0A A;  5J0X A;  3H6N A;  2JQR B;  3C5F A;  2NYV A;  2AH5 A;  1ZGU B;  1T5X D;  5ALI A;  8ICK A;  2IGD A;  1L5U A;  4K4H A;  2CHX A;  2IYD B;  2QAR B;  2WYQ A;  2M56 B;  1GJZ A;  3UQ0 A;  9ICA A;  1SZH A;  4EEN A;  4QZE A;  4DQQ A;  4I2G A;  3Q8C A;  2N1R A;  3I63 C;  5ALU A;  1S8O A;  1GPX A;  1QF6 A;  3RB0 A;  5AM0 A;  9ICO A;  9ICB A;  9ICI A;  3PZD A;  1S5L U;  2Y5P A;  4B9U A;  4QJF B;  1KH0 A;  4IRC A;  5KG3 A;  3P4P B;  3NGD A;  2XC9 A;  1FRD A;  3EGR A;  3H7P B;  3E2E A;  4CO7 A;  1FXA A;  1N61 A;  1MHH E;  5BOM A;  1KFD A;  4Z6F A;  2R8G A;  4OO1 J;  4BVU C;  2Y9U A;  2B6G A;  3K9O B;  2K25 A;  3T79 A;  9ICN A;  3NHE B;  2HOF A;  8ICH A;  4O9M A;  1A5R A;  2RMM A;  2K3U A;  2IO2 B;  5D4B A;  2V4I B;  2DYO A;  3I3T B;  4UAT A;  3ZXR A;  4YXD B;  4RPY A;  4BOZ B;  3IT6 B;  3PZ7 A;  3M62 B;  3SR6 A;  5KFD A;  2BYE A;  1TV9 A;  2L5Y A;  1GNU A;  4KLI A;  3N9Y C;  4HDO A;  3BQ0 A;  1UD7 A;  1ZW7 A;  2IO1 B;  2JZP A;  4LNK A;  4OCZ A;  1RG6 A;  1HZ6 A;  2Y3A A;  3QIJ A;  4CGZ A;  2K8B B;  3TBL D;  4K4I A;  2FBW B;  2BDU A;  1NNL A;  4PZN A;  5D49 A;  3RJJ A;  3EFU A;  2HI0 A;  2RQ5 A;  4BXO B;  5ALQ A;  3SD7 A;  4FZN A;  1UA1 A;  8ICV A;  4YT0 B;  4PGQ A;  2KNJ A;  1X40 A;  4BGD A;  2N1V A;  2NV3 A;  3IHP C;  2VZK D;  5L83 A;  2KD0 A;  5IP4 D;  1I35 A;  4DFM A;  1B1Z A;  3RF9 A;  5KT2 A;  2FID A;  5F3X B;  4EBC A;  1TKG A;  5DQI A;  3DCG A;  4JLC A;  1CUK A;  1GG3 A;  1IV8 A;  1SGG A;  2WQY B;  2YMM A;  2FLL A;  2D3A A;  2CHW A;  4P2H A;  2KX0 A;  2NRV A;  3PW4 A;  3FC4 A;  3JYU A;  3IG5 A;  3MDA A;  3NOB A;  1SWW A;  2M19 A;  5DDY A;  2FCS A;  2G1E A;  4JQW C;  5J0S A;  1JN3 A;  2DGZ A;  2KK8 A;  3ZJT A;  4RCO A;  1RFK A;  3RJI A;  2NBV B;  1SKS A;  2ZCB A;  1U45 A;  4LTU A;  3KWV A;  3QU4 A;  4ASW C;  1ZD2 P;  2OCE A;  2VH1 A;  2BPC A;  2HBJ A;  3QE9 Y;  5ALY A;  2OH2 A;  1SE9 A;  1WCL A;  2QC8 A;  5KFN A;  3ZDT A;  2BDP A;  1UPH A;  5DDM A;  4II2 B;  3RH5 A;  2BVC A;  5J2H A;  4ICV A;  2WX0 A;  3RAQ A;  2W03 A;  2R8I A;  4P4P A;  2XY6 A;  1TK0 A;  4X57 B;  2GLS A;  2AGO A;  1F52 A;  3RRH A;  5AKL A;  4TUS A;  5AZF A;  3E58 A;  2G06 A;  1SKW A;  2BYV E;  3AU2 A;  4QWE A;  2P6U A;  1E9M A;  4Z6D A;  3ZNG C;  2BKE A;  4WUR A;  2RPV A;  2BYF A;  1EUV B;  2HHV A;  2BF8 B;  2V3N A;  3W1S C;  9ICF A;  3MGH A;  2V1Y A;  1KW4 A;  3Q3F A;  3BVM A;  5DB8 A;  3RRG A;  4F92 B;  1TS5 A;  2Q0Z X;  4IC7 B;  2KMA A;  2Z8L A;  3AN1 A;  2PFP A;  1LO5 D;  2VA8 A;  2KIV A;  4F4K A;  2JEG A;  4A8X C;  4I2D A;  4B9L A;  4IQV A;  1HA5 A;  3AI5 A;  1PVQ A;  2Y9T A;  1XO3 A;  1MC8 A;  4MJS A;  1YD8 U;  4MGZ E;  4JMU A;  1C79 A;  5IOI A;  2MRL A;  8ICB A;  1FXI A;  4PYZ A;  3ZD9 A;  3MJW A;  2G3Q B;  5J2E A;  1VZ8 A;  4HPL B;  4S0R A;  4GXB A;  4KLG A;  3QU5 A;  2BGF A;  3DWM A;  2KMC A;  1ZQI A;  3Q8Q B;  2KKC A;  3NG0 A;  3HKZ C;  4ED1 A;  3KTQ A;  1WXA A;  2ZUD A;  5DLF A;  1J2M A;  4M8N A;  2IND C;  1RZT A;  4HPP A;  5CHV C;  2BT6 A;  1ED1 A;  5IO9 A;  3C28 A;  3RH6 A;  2P6R A;  2NS5 A;  3GIL A;  5D94 A;  3ZNZ B;  3AEB B;  2FPM A;  2M4N A;  3ZKJ C;  4IQT A;  4KSK C;  2B76 B;  4YXM A;  4C8M A;  2KTR B;  3M9O B;  2L0F A;  3K9P B;  1T7P A;  5J2B A;  2N7D A;  5AI4 A;  3NUH B;  4BFR A;  3ECI A;  2MW5 A;  3QX7 A;  1Q46 A;  2EZY A;  1JWA D;  3DVG Y;  5FP0 A;  2A1J B;  5HML A;  3OJS A;  4DL3 A;  1T6B X;  5TIS U;  2EAP A;  1BVS A;  1WH3 A;  3CNH A;  3CIR B;  1KSP A;  1F1H A;  3I28 A;  1YN5 A;  3ISD A;  1HUZ A;  3DEE A;  2WXQ A;  3SHQ A;  2MUT B;  5DBC A;  2JWU A;  2GWS A;  1VDV A;  5ALR A;  3M8R A;  4LDT B;  3TMP B;  1PGX A;  2MEK A;  2M0A A;  1AQ6 A;  2KZZ A;  3HIL A;  5AI8 A;  3RB3 A;  4ZH4 A;  2JYE A;  3FIL A;  1PUT A;  5KAF U;  5EE1 A;  4ARC A;  1ZKH A;  3UIP B;  4P4M A;  4PPX A;  3PO5 A;  5KFL A;  2KKV A;  3TQ1 A;  4F4X A;  3IG8 A;  1MJD A;  2ZEQ A;  4DK5 A;  2N7J A;  2BS2 B;  4OJP A;  8ICJ A;  4WWP A;  2K4E A;  4RPX A;  5CTR C;  3UIN B;  4EZ6 A;  2D10 A;  3HX0 A;  3AB5 A;  1YOV B;  3B0Y A;  1J8C A;  1RDF A;  2J6U A;  4F5N A;  2PMV A;  3N7P D;  1MHX A;  4MFF A;  1KM7 A;  2MA1 A;  5BMI A;  1GO3 F;  3KOO A;  1ZOY B;  4LNI A;  2L52 A;  4ANV A;  1D3Z A;  3M6Z A;  3AE7 B;  5C1Z A;  2QAR A;  2EKE C;  4FLH A;  7ICP A;  2AGQ A;  3LDZ E;  3F2D A;  4LJO B;  2WXK A;  4P1C C;  2D6F C;  4DFD A;  2SAK A;  2AJQ A;  4PJ0 U;  3PX0 A;  1X9M A;  2XBB C;  3AUL A;  3KHH A;  2F8K A;  4O5K A;  4WQM A;  2AXT U;  5D3I B;  3QUB A;  4F8R A;  1D5Z C;  1YX6 B;  4HJG E;  4ED3 A;  3H7P A;  2JPH A;  1SL1 A;  1ZDX A;  3K75 D;  4KN7 A;  5AUI A;  3HKZ F;  2F1H A;  3O0F A;  4C80 A;  2FUH B;  2GBJ A;  4YR3 A;  2LGX A;  3ZNH B;  9ICP A;  4EBE A;  4IQW A;  4EEY A;  1NK6 A;  1FEZ A;  2KSO B;  2JH7 A;  4RQ3 A;  3ORY A;  1RQL A;  3WK6 A;  1H4R A;  1L2N A;  3D2S A;  1E5W A;  1T0S C;  1KN5 A;  3QXG A;  2DLB A;  2IZV B;  4ECV A;  5ALT A;  5KG0 A;  4GDK B;  2F2A B;  5LXI B;  1PGB A;  2FPL A;  2C7M B;  1P1A A;  3UXO A;  4F93 B;  4B6W A;  1SE3 A;  5J2J A;  4K7U A;  1NZB A;  2K8B A;  3B2G A;  2YEP F;  4KZC A;  3VR8 B;  2XNA C;  1MI0 A;  2JZB B;  4BKS A;  1FCL A;  2F1J A;  3NTU A;  4BXO A;  1WM3 A;  4FUL A;  4RFB A;  2C9W B;  4RQ7 A;  3F53 A;  3V3X A;  1QTM A;  5HI1 A;  3TAD C;  5KFC A;  3T5K A;  1QOB A;  4NLK A;  4GU2 A;  4JUZ A;  2G07 A;  2WF8 A;  1ZD3 A;  4NJC A;  1KDH A;  4QZB A;  3SEN A;  1IUE A;  4B95 A;  2MJ3 A;  2VJ5 A;  5J2A A;  4BX9 C;  1C20 A;  1OEY J;  4YTM B;  2HE7 A;  1QQ7 A;  2HJ8 A;  2IBK A;  1B9R A;  2F77 X;  1YQ3 B;  1C76 A;  3ICX A;  2J42 A;  2GB1 A;  2WHI A;  5DGB A;  3F2C A;  1V81 A;  2LD9 A;  5GMV A;  4EX6 A;  3VH3 B;  4EEL A;  3QEA Z;  4AJY B;  3ZJV A;  3MC0 B;  1S3S G;  3B1L X;  3N4M B;  3VH4 B;  4IUM B;  1QSY A;  5KG7 A;  2E5S A;  4F4Z A;  1SIF A;  1N60 A;  5TSS A;  2LYA A;  4LNN A;  2JT4 B;  1WG8 A;  2J7Q B;  2LRW A;  2V9H A;  4OJL A;  4CRX A;  4RUA A;  4IRD A;  3H1U A;  4DSF A;  5DB7 A;  1UEL A;  1WXS A;  4Y2V A;  2P66 A;  5KFI A;  1V49 A;  5ALK A;  4GB9 A;  3CW2 C;  3PS6 A;  3ONN A;  1UUP A;  5KFZ A;  1MN8 A;  2K8C B;  2EMT A;  2YB4 A;  2ALZ A;  1JQ4 A;  5AKE A;  3TSS A;  5HHD G;  2W82 A;  2WDT B;  2ON8 A;  2KC2 A;  2GBK A;  3HPO A;  3E56 A;  4CHK A;  4DL7 A;  4DL4 A;  1BML C;  1NVI D;  4K3B A;  1L7Y A;  1E10 A;  4Y2R A;  2ZW0 A;  2ZIX B;  2Z7J A;  1PUZ A;  3V72 A;  2I1J A;  2KAC A;  4M6W B;  4J9K A;  4RGM A;  9ICT A;  1WUD A;  3IM1 A;  3VC8 A;  3LWM A;  2K8A A;  2MU2 A;  3SI8 A;  2O6V D;  4XX5 A;  5HKH A;  3PRE A;  1L7O A;  4IWO A;  3KUZ A;  4C4V B;  3TEX A;  2W9N A;  3H0L B;  1S10 A;  3R7Q A;  2LUE A;  4ELV A;  1FD6 A;  4M0W B;  3GE3 C;  1FNV A;  2BB6 A;  4RF1 A;  1KLV A;  3AU4 A;  2IA6 A;  3EC8 A;  2JZZ A;  5J0R A;  2LYB A;  1NEK B;  3A1Q A;  1WJ4 A;  2V9W A;  2JUO A;  2AQ4 A;  4IDI A;  1NI3 A;  3JW0 X;  1R4M I;  1ZQR A;  2I9G A;  1PQS A;  1XC9 A;  4F5O A;  4EZ9 A;  5IIK A;  2MBB B;  2NRW A;  4W9L A;  3EFC A;  2Z0D B;  1ZQH A;  3RZF A;  4XRH A;  2HW3 A;  5CEH A;  1JUD A;  5ALE A;  4ECZ A;  2GBM A;  2KDM A;  3TAQ A;  2Y5C A;  3AEA B;  4C4R A;  4CNQ A;  2NCN A;  5C2T B;  3MR3 A;  2DKX A;  1VLB A;  2FCQ A;  1NBF C;  4XE0 A;  3W5V B;  3THV A;  2A1A A;  4J9M A;  1XSN A;  3Q6B A;  4RM8 A;  2OJW A;  5E6N A;  4NQL B;  5KAI U;  5HHH A;  4GIB A;  4EBD A;  4FZM A;  4Y2X A;  4KV2 A;  1Z1B A;  4I2A A;  1YX5 B;  5BO4 B;  4RF0 A;  3H7I A;  3QEB Z;  1TJE A;  2D2Q A;  5J2R A;  4DHZ E;  2N1W A;  4A55 A;  3K4G A;  2IOH A;  2G45 B;  2RDJ A;  4O3S A;  2MUT A;  3PHX B;  2QMT A;  4E71 A;  2E6X A;  3AE6 B;  3EWA A;  3Q3J A;  1NK4 A;  1TKY A;  3PPA A;  9ICG A;  4CQN A;  1N48 A;  5JUM A;  4ACO A;  1Y56 A;  4DCC A;  2KG5 A;  4MEY A;  3Q8K A;  2DPI A;  3V6K A;  1GAQ B;  3RJE A;  3RJF A;  4TSS A;  3P63 A;  4G11 A;  4A3O A;  4JV2 A;  2L3Z A;  4RMA A;  1SSN A;  1DYQ A;  1L7P A;  1HEK A;  4NY0 A;  3AMZ A;  3BQT A;  4C8K A;  3DBR I;  1V8C A;  1HUO A;  1LFD A;  3A0H U;  3H40 A;  3ABV B;  4BJQ A;  5CHG A;  2W11 A;  3AUO A;  3KD3 A;  1P7F A;  1OQR A;  3CF6 E;  1YT3 A;  7ICE A;  3MR6 A;  2F3N A;  2V0G A;  1PFD A;  2OYY A;  4GN1 A;  4BWM A;  2EDU A;  4ZOH C;  2B0C A;  7ICO A;  4F72 A;  2W54 A;  1F5S A;  1LB2 B;  3GFK B;  4KGR A;  5ALH A;  3PV8 A;  1EU4 A;  1N5X A;  4NZL B;  2DZI A;  3ZVV A;  1RYS A;  2ASQ A;  1X2I A;  2FPK A;  2WNM A;  8ICX A;  1ZRN A;  4Y2S A;  5AM5 A;  2XCA A;  2ZG6 A;  5C0Y A;  8ICF A;  4A90 A;  1COO A;  5ALV A;  5BYS A;  1SJH D;  2W9A A;  1JW9 D;  3DWG C;  3TUO A;  8ICQ A;  3NZS A;  4W9D A;  2KZM A;  4ZRJ A;  1XO1 A;  2RGF A;  3ZQ4 A;  3KBB A;  4RGT A;  2RPQ A;  4UDU C;  1XSL A;  3A9J B;  5CHW A;  2HSZ A;  3L17 A;  2KSO A;  5T14 A;  1ET9 A;  4LJX A;  2BWF A;  1KL9 A;  1QIL A;  3AU5 A;  3DBH B;  4DDG D;  4QIW C;  1SXD A;  1ZQT A;  4FBT A;  1IXR A;  1SXT A;  5H92 C;  4GDK A;  3MC8 A;  1WJ6 A;  5DB6 A;  3WK7 A;  2KWC A;  3KYD D;  3WKE A;  5KT5 A;  4ITK A;  4ED6 A;  4RNN A;  1MPE A;  1ZQU A;  4J9N A;  5AK6 A;  2HMX A;  8ICE A;  1RFA A;  1YIW A;  4CCH A;  4PYU A;  2JMG A;  1BPZ A;  3UQ2 A;  2R8J A;  3CWI A;  4I2J A;  1C9F A;  3IN5 A;  3V6J A;  1KFY B;  2V4Q A;  1VJK A;  3PNC A;  2R2Q A;  2V4L A;  2KMD A;  4K3C A;  4G3I A;  4C00 A;  4JV1 A;  3NVY A;  5KFQ A;  1GC6 A;  1SV0 C;  4KLH A;  3N1X C;  4NJ7 A;  3ZGZ A;  3LWL A;  1XT9 B;  1I4P A;  1YQ4 B;  4HK2 A;  1EF1 A;  4I6L B;  4PL1 A;  2PJH A;  3HRD D;  4GFJ A;  4RGN A;  1B4F A;  1JWU D;  3TEY A;  1ZQV A;  1HTQ A;  1QLB B;  4C56 C;  5KFH A;  2L32 A;  1WZ3 A;  3MFH A;  4W9F A;  5IIN A;  2ASL A;  3KHG A;  4IRK A;  3PR4 A;  2VZK B;  4W9J A;  3V05 A;  4FS2 A;  1LXD A;  2Y0S C;  3UMC A;  1WGR A;  1TY2 A;  4PHE A;  1ZQ1 C;  4J6I A;  2E1E A;  3IRU A;  5GTI U;  1SZP A;  3KUC B;  1QCK A;  4RZR A;  3BVG A;  2ZIV B;  5EWF A;  1HE8 A;  2J53 A;  4F5P A;  2MBQ A;  2KMM A;  2WXF A;  4QZ8 A;  4DFK A;  4MH8 A;  1GUA B;  3RJG A;  1XF5 L;  2DZJ A;  1M6Y A;  1KLU D;  2ZVN A;  4MGK E;  4OVU A;  2E1F A;  4EEK A;  2KOX A;  2KX3 A;  4WIP A;  4GOC A;  3MBY A;  4NXZ A;  2IO0 B;  1QZE A;  3LK9 A;  1IGD A;  1CJE A;  1BPB A;  3MJ5 A;  4KN4 A;  4EYI B;  5J18 A;  1YJ1 A;  2K8C A;  4UAS A;  2J6S A;  3R66 C;  4FE3 A;  3Q8A A;  2EAN A;  1QLN A;  2M8S A;  2QEJ C;  2BCV A;  2KHV A;  3L16 A;  1JX4 A;  2GH1 A;  3UI3 A;  4MF8 A;  2D3B A;  5KHO A;  2K39 A;  1NYQ A;  1WYW B;  1SGH A;  1XD3 B;  1ZPS A;  3Q8B A;  3WA0 A;  3WK5 A;  2ZIX A;  2HDO A;  2VRR B;  5BPC A;  4ANW A;  4QIW F;  1J2N A;  1SBB B;  4H2A A;  4UW9 A;  4M6W A;  5J2K A;  5CWR A;  4I2F A;  1SE4 A;  2J0K A;  2EKI A;  3VQI A;  2L05 A;  2BR0 A;  4QZI A;  4ECW A;  2BB5 A;  2NBU A;  4PZO A;  2GOL A;  4C4V A;  4MT5 A;  4GXK A;  4M0W A;  3I1Y A;  1ZQW A;  3U26 A;  5HMM A;  1ZXH A;  2WP9 B;  3HJE A;  1N62 A;  3KFU F;  3Q14 C;  2V4R A;  7ICV A;  3QJZ A;  5F9N A;  1ZQP A;  4DFP A;  3N7R C;  2DX5 B;  3EPG A;  2BGW A;  2WXG A;  4YFK A;  3ZTC A;  4RQ8 A;  1C4C A;  1PYW D;  3LXF A;  2WXJ A;  2RDI A;  3H0R B;  3TI0 A;  4I29 A;  1KKX A;  2AQ2 B;  2F8L A;  1WWV A;  1RRB A;  3PZ8 A;  2LPE A;  3GZN I;  2MSE D;  1HZ5 A;  2JY6 A;  4A6Q A;  1Q1O A;  2MWS B;  2W9M A;  3NZ3 A;  2I1Q A;  4LK0 M;  4HLE A;  1KOT A;  2KIW A;  4YD2 A;  1F0Z A;  3ZXV A;  2FMP A;  2W7P A;  2XGP A;  3QYP A;  2OOB B;  3ZRC A;  2YLM A;  2OM6 A;  1NJZ A;  5KFJ A;  2BPS A;  1E90 A;  4FJY A;  8ICP A;  3APC A;  4ICA A;  2F76 X;  2FMQ A;  4FBU A;  2LXC A;  1H8C A;  2Y0S F;  3H8H A;  4NAW B;  2KXJ A;  4DWI A;  3N30 A;  1WR1 A;  1YZ6 A;  2RLT A;  4J9R A;  4J9O A;  1KFS A;  3IG3 A;  2HOI A;  4JPS A;  4DO9 A;  3HIZ A;  4TKN A;  1N56 A;  3HP6 A;  4Z6C A;  1NJY A;  1FM0 D;  1HEZ E;  1CK1 A;  2DBY A;  2H88 B;  3SEB A;  3NRZ A;  5KFR A;  5KFU A;  1UGJ A;  3VUX A;  1V5T A;  3PSE B;  4FZL A;  5AKZ A;  2HTH A;  2LMC A;  3PV1 A;  2BHN A;  3CRX A;  2TSS A;  4F7Z A;  1V2Y A;  2VA2 A;  4AUQ C;  4YR2 A;  1D9F A;  2VA3 A;  2JSV X;  2JH1 A;  2IHM A;  2HHT A;  2WF9 A;  1PVR A;  1EM7 A;  2Z0E B;  1WZ0 A;  2INP E;  8ICW A;  2KTQ A;  1V1O A;  2FE8 A;  1BT0 A;  1RLF A;  4WWN A;  3RBD A;  4I2B A;  1E7U A;  4GXI A;  2KYW A;  2HBM A;  2H3Z A;  4HRS A;  4YVZ A;  3C2K A;  3OJU A;  2ZCC A;  4XDC A;  1SV4 A;  2ZUC A;  1XNS A;  4HCP B;  2HHQ A;  5KT6 A;  5AM3 A;  2JRZ A;  2XO7 A;  9ICH A;  1L6U A;  1UF0 A;  4YL8 A;  3ZW3 A;  1S0O A;  5IA7 A;  4M9N A;  1L0X B;  3IAS 1;  1XLO A;  2FIF A;  2OWO A;  2MHJ A;  4KLS A;  1S1Q B;  4W9G A;  1T94 A;  2YMP A;  3TFR A;  2KE7 A;  5ALP A;  2GOW A;  2KJ5 A;  1BXT A;  3C21 A;  1ROE A;  1MG4 A;  4KLU A;  5CA7 A;  1ZQD A;  3Q3M C;  4OJ5 A;  5AEK B;  2KDE B;  5KT7 A;  3BK1 A;  3EUB 2;  2GBR A;  5JXV A;  5J0O A;  2Y5B B;  4TUP A;  4X5V A;  1BPE A;  1VR9 A;  2JXX A;  2QJL A;  3FDS A;  3BZD B;  1Y8R C;  4Y2J A;  3AL0 B;  4BKG A;  2YTU A;  5J17 A;  3A9J A;  4R63 A;  4E74 A;  1V9J A;  1NK5 A;  3PRM B;  3IP4 B;  2ZIW B;  4Y2T A;  8ICR A;  2PKO A;  3SU8 X;  4MH0 E;  1L3V A;  3VTV A;  3KHR A;  2ESE A;  3APF A;  1T0Q C;  3KH0 A;  3KWL A;  5DBA A;  1JRP A;  1NK8 A;  1S0V A;  1Z4N A;  2BQQ A;  1X6I A;  3EYZ A;  3RB6 A;  3C29 A;  2JEI A;  3WK9 A;  5B5E U;  3ML8 A;  3QK0 A;  2KAN A;  2CR5 A;  4F2S A;  4KTQ A;  2DZM A;  1TK8 A;  4IWQ A;  2A4Z A;  1WR6 E;  5C23 A;  3DVN U;  2N9L A;  3PT2 B;  2MH7 A;  4O3Q A;  5KHQ A;  4HYK A;  4BDP A;  4XWT A;  1WX8 A;  3SZ2 A;  4KVG B;  5DG8 A;  2KNB A;  4K81 A;  1IM4 A;  1HXY D;  1MSW D;  3PGE A;  4TV3 A;  3A1Q B;  3NVZ A;  4FXC A;  1LQB A;  1ZQB A;  1ZOL A;  1QH9 A;  2LGY A;  2C2D A;  1VZ7 A;  3CMM B;  3F5A A;  3Q8L A;  1L3U A;  5ALJ A;  4US9 A;  1R4N B;  5AM1 A;  4RQ1 A;  4IG7 B;  2PI5 A;  4KX5 A;  5AK5 A;  4M04 A;  1J19 A;  3I5J C;  4AP4 C;  2KD1 A;  7ICR A;  3H4D A;  1LKY B;  4GC7 A;  3QU9 A;  2O6K A;  9ICU A;  3H8J A;  2EEL A;  5AIC A;  5AKG A;  1KEJ A;  2YY6 A;  4WJO A;  4YMM A;  2Y1I A;  4R65 A;  3WAN A;  2ZIV A;  4F3O A;  3N97 B;  4KSL C;  1ZQF A;  4Y2U A;  1K5O A;  3ISB A;  5J2C A;  1ZJN A;  3RJH A;  3H8W A;  4AS1 A;  4RH6 A;  4UB5 A;  2ZXH A;  5BMG A;  4KLM A;  1XO0 A;  1V1P B;  1N63 A;  4TQR A;  1BPX A;  2C28 A;  1SF0 A;  3VDZ A;  5ALS A;  4FO6 A;  4ZRI A;  4CE6 A;  1ZXI A;  3IFW B;  1C1Y B;  3B9J A;  4NY8 A;  4XWW A;  3Q8R B;  1HTO A;  3MHZ A;  2ZJ8 A;  3M1Y A;  5L1I A;  2FNJ B;  2XK5 B;  3TL5 A;  3M8S A;  7ICN A;  2J0J A;  2JRH A;  4B9M A;  2HBL A;  4I2H A;  4TQS A;  4GC6 A;  4RT3 A;  1NK7 A;  1WSP A;  4M02 A;  1N5W A;  1DRG A;  1TY0 A;  4L23 A;  2DZK A;  2KQ4 X;  1L7M A;  2HHX A;  1RYR A;  1QQ5 A;  5B66 U;  2M0X A;  4YSY B;  4F5Q A;  3U8Z A;  4EOY A;  2H3I A;  2W8K A;  4K4G A;  1EF5 A;  4FA6 A;  5AKX A;  2NBW B;  1CEZ A;  7ICJ A;  2DFL A;  5TR5 A;  1T0R C;  3PSF A;  3VAW A;  2MA9 B;  4M8M A;  3VCB A;  4EFO A;  3C5G A;  3UIO B;  2AL3 A;  2M1M A;  2ZJA A;  1MFW A;  3SFD B;  2D5G A;  5J8Y A;  4B9T A;  2KJ6 A;  4YSZ B;  1U4B A;  1UNS A;  4ECY A;  4WJP A;  4PS3 A;  3J9C A;  2C7H A;  4XZ4 A;  1T4G A;  9ICC A;  1JCK B;  2BWE S;  3ZTD A;  4QZG A;  2INN E;  4GLS C;  2LJ5 A;  3SV3 A;  5ALX A;  4C8O A;  2W04 A;  2Q5W D;  2YEP B;  2IO3 B;  3TCA A;  2HHU A;  3OPX A;  2O6V B;  1SIJ A;  5DPW A;  3NVW A;  3M9N B;  4DQR A;  4O3M A;  1ET6 A;  4I2C A;  2PFN A;  4IKG A;  5KFB A;  1D5M C;  3HVD A;  3RT3 B;  2RDH A;  1QQ6 A;  1UZX B;  2L1A A;  1UGM A;  4NV0 A;  1NK0 A;  4OHJ A;  5E6P A;  2G5H B;  4IM3 A;  2K4H A;  2EMS A;  2AHO B;  1ZQY A;  2G4D B;  3C1Z A;  1V97 A;  4NAW A;  5DPT A;  2KP7 A;  4EEW A;  1PK1 B;  3P42 A;  1ZQZ A;  1RYU A;  4W9H A;  1O08 A;  8ICT A;  4JWN A;  3W1Y A;  4O3N A;  1KF6 B;  2VKQ A;  3VUW A;  4NL9 C;  2WX1 A;  4DHJ D;  2B3A A;  3PX4 A;  2LWP A;  7ICI A;  8ICA A;  3H4B A;  1QOG A;  2QIE B;  1JMS A;  2LI6 A;  4ECR A;  2R61 A;  1Q0W B;  3RNC C;  2ZXI A;  3E0F A;  2DF4 B;  3K1R B;  5IN7 A;  3LJ3 A;  4QW9 A;  1BNP A;  1L5P A;  2CKH B;  1XWL A;  4UB6 U;  4KLD A;  2NRX A;  2NRT A;  3V60 A;  3DHG C;  5DPS A;  3OTQ A;  1SKR A;  7ICS A;  1WGD A;  4ACF A;  2RRD A;  1IG6 A;  5H2F U;  3AEV A;  2GI9 A;  2LM1 A;  3ETR A;  3PSI A;  3RD2 A;  3CYM A;  7ICQ A;  2QB0 A;  3RCZ A;  2BTE A;  5L95 C;  3AED B;  4UB3 A;  8ICG A;  4KLF A;  2G08 A;  8ICN A;  1Y88 A;  5EOZ A;  1TS3 A;  2KLG A;  2RD0 A;  4TUQ A;  3U7D A;  2KOB A;  4HAI A;  4DF8 A;  2DHZ A;  2JEF A;  3GP7 A;  5KL8 B;  2G4S A;  1ZYQ A;  3MDC A;  3MFI A;  2MBE A;  5J0P A;  2BPG A;  3KKA C;  3AE5 B;  3ISC A;  2R8K A;  3PW2 A;  4B9N A;  2DNF A;  2BQU A;  1ZQK A;  7ICH A;  4IL6 U;  1YJJ A;  3HK0 A;  4UAR A;  4JL9 A;  1Z5S B;  2L8J A;  3EW9 A;  1FFV A;  3JPS A;  1AN8 A;  2J4X A;  1D9D A;  3R7R A;  3MAB A;  5KFK A;  4OVZ A;  2MAX A;  2YX8 A;  4MAC A;  2EQY A;  1UBI A;  2Z59 B;  4WH4 A;  2LEK A;  3N3K B;  7ICT A;  1Q10 A;  2OEH A;  4XGA B;  1VZ6 A;  3BS7 A;  3NRW A;  2JYT A;  3Q2A C;  1ZQJ A;  4C7Z A;  2ZIW A;  1TKE A;  3PO0 A;  4CYE A;  5IIJ A;  4EZL A;  3NS1 A;  4EZJ A;  3DPD A;  7ICF A;  3RMK C;  3TIX A;  2JRI B;  2KHW B;  2WXM A;  4TMA B;  2KKP A;  3UGB B;  2VAN A;  2W9C A;  1PGA A;  2W55 A;  5KFO A;  3G6V A;  4FFD A;  1DK2 A;  3L5K A;  1KLG D;  4HJK A;  2C7N B;  1B43 A;  4BWJ A;  3TAC B;  8ICM A;  3T5J A;  1WXQ A;  1T3N A;  5J0W A;  3DBL B;  1C7Y A;  1L8L A;  4KZ0 A;  4CDG A;  1T8E A;  1OUQ A;  3A4R A;  2K4P A;  2HVI A;  5KFM A;  2AWT A;  5T8I A;  4RQ6 A;  1F0M A;  4Y2Q A;  2KN4 A;  3C8Y A;  3ZUN A;  1ESF A;  2DAJ A;  1Z00 A;  2RSU A;  3SEI A;  5KFE A;  3HM6 X;  5C3J B;  2QSD A;  5JU5 A;  4XYC A;  1UBQ A;  1FCC C;  2MJE A;  5TZV A;  2UU7 A;  4KX6 B;  2PPH A;  1SB3 C;  4KLE A;  4QZF A;  4ELU A;  1TAM A;  1ZQS A;  1FPY A;  1UWM A;  2WDQ B;  3Q3N C;  1UHU A;  2MSN A;  4ED2 A;  8ICO A;  3UQB A;  1DOY A;  2LMR A;  2W9B A;  4P0P B;  3AE1 B;  1FXT B;  2I2Y A;  4N58 A;  1F77 A;  1TBE A;  4DXF A;  3FKY A;  2UWQ A;  1QOF A;  1QKZ A;  4XC2 A;  4AOF A;  1P3Q U;  4J9Q A;  5LLI A;  2ZTE A;  3PHW B;  3VVW B;  3DDC B;  1V85 A;  1LKY A;  3OHB A;  3GE8 C;  2YB1 A;  1WX7 A;  5D46 A;  2JWZ A;  1XEE A;  4Q8E A;  4GMV A;  3IV6 A;  2P35 A;  5IIL A;  1E7P B;  3W1S A;  3GB1 A;  4DL6 A;  3Q3O C;  2WU5 B;  1FFU A;  5DBB A;  3MC1 A;  4YXJ A;  1K8R B;  2ZNV B;  2ONQ A;  5IIO A;  2AQ1 B;  2Q4T A;  4OZC A;  4D2K A;  4FS1 A;  1O03 A;  3ZDA A;  2GBN A;  3WU2 U;  1X6J A;  5J0Y A;  1V1P A;  2LM4 A;  2ICI A;  3D2Q A;  3AE2 B;  2KWV B;  2HOQ A;  1EWC A;  1NEN B;  4PGX A;  1A70 A;  2IY1 B;  5KFX A;  5AM2 A;  1KFT A;  2XK5 A;  2LZ6 A;  5J2I A;  4WQO B;  1SEB D;  5ALN A;  2FCN A;  2NO4 A;  4OW0 A;  4JWU C;  2BCQ A;  1ACC A;  5DG7 A;  3VUY A;  1MG8 A;  1TZ1 A;  3RH4 A;  2K5P A;  2PXI A;  4DQP A;  1TS4 A;  3N32 A;  1Q3U A;  4M0A A;  3ZDB A;  4O3O A;  5D3D A;  3C23 A;  3OAW A;  4NPN A;  4B6J A;  3L3F X;  4RNO A;  4R3D A;  1NZP A;  1ZDV A;  1EWY C;  2PE6 B;  1WWU A;  4E0D A;  4JGH B;  2KV2 A;  9ICQ A;  3ZRF A;  1TGZ B;  4ECS A;  4DF4 A;  3BII D;  2BKF A;  5CP2 A;  3RAX A;  4ZHP A;  4U6P A;  3B0A A;  3GIM A;  3N1Y C;  2ZW1 A;  1MA7 A; 
#chains in the Genus database with same CATH homology
 1I4H A;  1ZXH A;  2WP9 B;  5I4D A;  1N62 A;  2OHF A;  1FXI A;  1VRA B;  4RNA A;  4P16 A;  2WXG A;  3AE4 B;  1TZO A;  1VZ8 A;  1C4C A;  1PYW D;  3LXF A;  5BMH A;  2CJO A;  2WXJ A;  1ZP0 B;  2MJD A;  3B2F A;  3DWM A;  3TEZ A;  2AQ2 B;  5G5G A;  1RM6 C;  3PZ8 A;  5EE0 A;  4A9A A;  5FR3 A;  1HZ5 A;  4A6Q A;  2JX5 A;  3GS2 A;  2JU6 X;  3NZ3 A;  4LK0 M;  2BT6 A;  3AV8 A;  1F0Z A;  2NTS A;  3AEB B;  1WGK A;  2PVG C;  3R2T A;  2B76 B;  4DQO C;  2WXR A;  1T3Q A;  2PVO D;  4B0E A;  3HUI A;  3H8H A;  3NUH B;  3Q69 A;  4NAW B;  4P6V F;  3SFE B;  1JWA D;  4JPS A;  5MPO A;  1T6B X;  1AW7 A;  4ARI A;  4HKZ E;  1IBX A;  3CIR B;  1FM0 D;  1YN5 A;  1CK1 A;  1FRR A;  1HEZ E;  2DBY A;  3NRZ A;  1UGJ A;  1ZE3 D;  2H88 B;  2WXQ A;  5LNK 1;  1GB1 A;  1XXG A;  1QT9 A;  3BYT B;  5H8Y E;  2JWU A;  1I4Q A;  2LMC A;  1VDV A;  4TQ1 A;  1XCQ L;  2TSS A;  1PGX A;  2MEK A;  2M0A A;  4XDD A;  2JYE A;  3FIL A;  1D4B A;  2JSV X;  2LFI A;  1PUT A;  5EE1 A;  5HG2 A;  4ARC A;  4LLG M;  1JAL A;  1EM7 A;  4YTP B;  2INP E;  1V1O A;  2FE8 A;  1DOX A;  4C7Y A;  3BVZ A;  4PT5 A;  1TS2 A;  4AQ7 A;  2N7J A;  2BS2 B;  3AB5 A;  3IT4 B;  4HRS A;  2PMV A;  2XN9 C;  2SEB D;  1MHX A;  4XDC A;  1J7B A;  5BMI A;  1ZOY B;  2L52 A;  4REZ A;  1OQQ A;  1L6U A;  2JXT A;  5BYR A;  3AE7 B;  5HFY A;  3FAH A;  2NMQ A;  2I38 A;  1L0X B;  3IAS 1;  1XLO A;  5BYQ A;  3NVV A;  2N0S B;  2WXK A;  5EE9 A;  1RWS A;  5D7G A;  2PIA A;  3AE9 B;  3O13 A;  3VRB B;  2SAK A;  1YN4 A;  3IXS A;  1YNT E;  1BXT A;  1JWS D;  1ROE A;  2AQ3 B;  2L83 A;  2J52 A;  1YMH E;  4WQM A;  5D3I B;  2FUG 1;  1D5Z C;  4HJG E;  3BK1 A;  3EUB 2;  2BS3 B;  4YSX B;  5JXV A;  3OWE B;  4US8 A;  4KKJ A;  1ZDX A;  1XLN A;  5AUI A;  1FO4 A;  3P1M A;  1VR9 A;  2NTT A;  2ACZ B;  4C80 A;  2QJL A;  3BZD B;  4TQ0 A;  1KRH A;  1JML A;  2PKO A;  2WXO A;  1EU3 A;  1QQR A;  1K51 A;  1RYJ A;  3W9C B;  2DLB A;  3KWL A;  1I4R A;  1NYR A;  1JRP A;  4GDK B;  4NAM A;  3IAM 1;  1PGB A;  1XLP A;  2WDR B;  3P4Q B;  4Q2J A;  1GOZ A;  2LHE A;  1I4G A;  1SE3 A;  3HVZ A;  3KLS X;  4ZYS A;  3B2G A;  2YEP F;  2WLB A;  3VR8 B;  3AE8 B;  2XNA C;  1MI0 A;  1FNU A;  3MP9 A;  3AM9 A;  1FCL A;  1F2R C;  4OZB A;  2N9L A;  2WXI A;  2MH7 A;  4RFB A;  3V3X A;  4XWT A;  2IGH A;  5HI1 A;  4JWS C;  1QOA A;  1QOB A;  4YTN B;  4GDL B;  2KAJ A;  1HXY D;  4NJC A;  3NVZ A;  1IUE A;  2G9H D;  4EE2 A;  4FXC A;  1XCT L;  2MJ3 A;  1FMA D;  1VZ7 A;  4HKQ A;  4US9 A;  4YTM B;  1K53 A;  1B9R A;  1UWX A;  1YQ3 B;  1C76 A;  2WS3 B;  1R7S A;  2J42 A;  2GB1 A;  1WWT A;  3BYY B;  3ZYY X;  2LUM A;  3ZJV A;  4JE3 B;  3MC0 B;  2EEL A;  3AE3 B;  1FEH A;  1F2R I;  2IPK D;  1WYG A;  1N60 A;  1FIQ A;  1KTK A;  5TSS A;  3U52 E;  1WRI A;  2GRI A;  4AS1 A;  4RH6 A;  5BMG A;  2H89 B;  1V1P B;  1N63 A;  3Q8F A;  4USA A;  1SF0 A;  1P7E A;  4HRO A;  1ZXI A;  1UUP A;  3B9J A;  4XWW A;  1K52 A;  3MHZ A;  1JWB D;  1JQ4 A;  3TSS A;  5HHD G;  2W82 A;  2ON8 A;  4MM3 B;  1JWM D;  1CQV A;  2IJ0 A;  1WSP A;  1N5W A;  3E56 A;  1TY0 A;  2K0P A;  4L23 A;  1BML C;  1NVI D;  2KQ4 X;  5FKA C;  1E10 A;  1MVK A;  2ZW0 A;  4OZA A;  4YSY B;  1STE A;  1J7C A;  1IGC A;  3AH7 A;  1I4X A;  3I9V 1;  2KAC A;  1E6E B;  2DYM A;  4RGM A;  3L4P A;  1ENF A;  1C78 A;  3SFD B;  2D5G A;  3RPF C;  3TEX A;  4YSZ B;  1UNS A;  1SJE D;  1CZP A;  1FD6 A;  3J9C A;  4KGS A;  1FNV A;  2W3S A;  2BB6 A;  4RF1 A;  2OED A;  1JCK B;  3BWU D;  2INN E;  4GLS C;  1NEK B;  2Q5W D;  2YEP B;  4IDI A;  1NI3 A;  2KWD A;  3AEF B;  4ZRQ A;  4N6E B;  1SIJ A;  1DGJ A;  3NVW A;  1E0Z A;  2WXL A;  1C77 A;  2WXP A;  1ET6 A;  2LJI A;  2WXN A;  3LYY A;  4IKG A;  4B0M A;  1D5M C;  3HVD A;  2BYT A;  3TEW A;  4WAF A;  2RDH A;  1AWD A;  5EE3 A;  2LHD A;  2E3T A;  2KDM A;  2L1A A;  3U7Z A;  3U4E G;  3Q8E A;  2Y5C A;  3AEA B;  4OHJ A;  3W2D A;  1K50 A;  5E6J A;  5C2T B;  4YWG G;  1VLB A;  4XE0 A;  3W5V B;  1D5X C;  2DWQ A;  5AUK A;  1V97 A;  4M0W A;  3URY A;  2HDE A;  2IDY A;  3P42 A;  2LGI A;  2BBC A;  1L4D B;  2WDV B;  1AYF A;  1M4V A;  3P4R B;  4RF0 A;  2BW2 A;  1KF6 B;  1TJE A;  4J3O D;  2CJN A;  1IBX B;  5G5H A;  4A55 A;  4O1N A;  2QMT A;  3W5U B;  2V3P A;  3AEC B;  1PDX A;  1QOG A;  2QIE B;  2E6X A;  3AE6 B;  1TKY A;  2R61 A;  3E9S A;  4L2Y A;  1L0Y B;  3FIL B;  4CQN A;  2BS4 B;  1Y56 A;  1TYG B;  3WCQ A;  1L5P A;  1J7A A;  3KQ4 A;  4ZRP A;  1GAQ B;  3U2S C;  4TSS A;  3P63 A;  3T3N A;  1SSN A;  1DYQ A;  1L6V A;  2GI9 A;  3ETR A;  3AMZ A;  1V8C A;  2PW9 A;  2IGG A;  1YJI A;  2BTE A;  3AED B;  1C4A A;  2PLP A;  3ABV B;  4WWM A;  2JQR B;  1P7F A;  1OQR A;  1TS3 A;  1XLQ A;  2V0G A;  1PFD A;  1T5X D;  3AEE B;  3GP7 A;  4ZOH C;  2IGD A;  2W54 A;  1DOI A;  2M56 B;  4KGR A;  5GXG B;  4JX1 C;  3AE5 B;  1EU4 A;  3Q8C A;  1N5X A;  3ZJU A;  4NZL B;  3SEB A;  1QF6 A;  1GPX A;  1YJJ A;  2WNM A;  1FFV A;  1AN8 A;  2J4X A;  2Y5P A;  4A90 A;  1KH0 A;  5BYS A;  2K9X A;  2WU2 B;  1SJH D;  4OVZ A;  3P4P B;  3EGR A;  1FRD A;  1JW9 D;  3DWG C;  3TUO A;  4MAC A;  1FXA A;  1N61 A;  4WH4 A;  1MHH E;  2LEK A;  1OFF A;  2QIL A;  3ZQ4 A;  1HQR D;  4RGT A;  1Q10 A;  4UDU C;  1VZ6 A;  2JYT A;  4N59 A;  3BK2 A;  4C7Z A;  3EA6 A;  1TKE A;  3PO0 A;  1ET9 A;  3NS1 A;  1QIL A;  1SXT A;  2RMM A;  2K3U A;  2WXM A;  4TMA B;  2AX5 A;  5H92 C;  2V4I B;  2DYO A;  4YXD B;  3AEG B;  1PGA A;  3IT6 B;  2W55 A;  3PZ7 A;  1BUI C;  3SR6 A;  1JRO A;  4ITK A;  1MPE A;  1KLG D;  2RDG A;  3N9Y C;  2N9K A;  2JZP A;  4IOI E;  1HZ6 A;  5FK9 C;  4KKI A;  2Y3A A;  2FBW B;  1WXQ A;  3CWI A;  4DXG A;  1C9F A;  1KFY B;  1FNW A;  1VJK A;  4YT0 B;  5T8I A;  3MFG A;  3RFZ B;  1ZUD 2;  2KN4 A;  3C8Y A;  1ESF A;  2VZK D;  3T3O A;  5C3J B;  2QSD A;  4L1B A;  1B1Z A;  1FCC C;  3NVY A;  2MJE A;  3ZGZ A;  1TKG A;  4KX6 B;  1I7H A;  1SB3 C;  1C4P A;  2WDQ B;  1UWM A;  1I4P A;  1YQ4 B;  2WQY B;  4HEA 1;  3R2I A;  3R8B A;  1D6E C;  1DOY A;  2K22 A;  3I57 A;  3HRD D;  3AE1 B;  4RGN A;  2I2Y A;  1JWU D;  3TEY A;  4N58 A;  1F77 A;  4DXF A;  1QLB B;  4C56 C;  3FC4 A;  1QOF A;  2L32 A;  1QKZ A;  2M19 A;  2G1E A;  2VZK B;  3V05 A;  3ZJT A;  2CU3 A;  4RCO A;  1RFK A;  1XEE A;  1TY2 A;  4LTU A;  3KWV A;  3VRA B;  1E7P B;  3W1S A;  3GB1 A;  3VR9 B;  2PTL A;  2WU5 B;  1FFU A;  3BVG A;  2J53 A;  2WXF A;  2KMM A;  2ONQ A;  4MH8 A;  2AQ1 B;  1GB4 A;  4OZC A;  1XF5 L;  1KLU D;  4D2K A;  4WIP A;  1V1P A;  4RGO S;  2ICI A;  3AE2 B;  1EWC A;  1IGD A;  1A70 A;  1CJE A;  1NEN B;  3MJ5 A;  1SE2 A;  1SEB D;  4ZHO A;  3Q8A A;  4OW0 A;  2QEJ C;  4JWU C;  1E9M A;  3UI3 A;  1ACC A;  4KGT A;  4WUR A;  1NYQ A;  1ZPS A;  2K5P A;  2RPV A;  1TS4 A;  2HTM E;  3Q8B A;  3LB8 C;  3P4S B;  2V3N A;  2WXH A;  2W3R A;  5D3D A;  1SBB B;  4H2A A;  3BVM A;  1L4Z B;  4R3D A;  1TS5 A;  2X38 A;  1SE4 A;  2EKI A;  1ZDV A;  3AN1 A;  1EWY C;  2Z8L A;  1LO5 D;  3VQI A;  1L0V B;  2BB5 A;  4A8X C;  1YN3 A;  1HA5 A;  1XO3 A;  3BII D;  4MT5 A;  4ZHP A;  1C79 A;  2ZW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...