1N61A

Crystal structure of the cu,mo-co dehydrogenase (codh); dithionite reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 48
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n61A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n61A01
1JRPA 1SIJA 5G5HA 1YQ3B 1DOIA 1PDXA 1JROA 3LXFA 2EKIA 2AX5A 2L52A 1RYJA 5G5GA 4P6VF 1PFDA 2Q5WD 3AV8A 1N60A 1FMAD 2ACZB 1CZPA 1JALA 2BT6A 3SFEB 2W55A 1DOYA 1WYGA 4KX6B 1XLOA 1XLNA 1ZP0B 1E7PB 1NENB 1FRDA 1GAQB 3KWLA 1L0VB 4YXDB 3W9CB 1T3QA 2JX5A 1J7CA 1YJIA 2DWQA 1N63A 5GXGB 1EWYC 3AEEB 1B9RA 3HUIA 1KF6B 1FIQA 1SF0A 1F0ZA 4A9AA 3AE4B 2BS4B 2KMMA 2E3TA 1JWAD 1IUEA 1L5PA 1SB3C 2M56B 3AH7A 5C2TB 4ZHOA 1A70A 1N5WA 3NVYA 1CJEA 3SR6A 1KRHA 2OHFA 2H89B 3B9JA 3AE7B 3P4QB 1XLPA 1ZUD2 1TYGB 3AE2B 3AE1B 3ABVB 1UWMA 1JWBD 4YSZB 2M19A 1V97A 2LEKA 1V8CA 1VJKA 3AMZA 3AB5A 2H88B 1RFKA 1J7AA 4WWMA 1JQ4A 2PIAA 2PVOD 4YTMB 1E10A 3AE5B 1KFYB 2WLBA 1QOGA 1FXAA 2QIEB 4YTNB 3NS1A 3ETRA 1NVID 4JX1C 1I7HA 2MJ3A 4N59A 5EE0A 2W54A 1TJEA 2MH7A 1ROEA 1WGKA 3AE9B 1VDVA 1DGJA 2BS3B 2HTME 2Y5CA 4YSYB 3AM9A 2KAJA 1ZXIA 3NVWA 1FFUA 1FO4A 1E0ZA 1QOFA 2W3SA 1QOBA 4LTUA 3WCQA 2MJDA 1XO3A 1NYQA 2PVGC 4YTPB 5EE1A 2K9XA 3AE8B 2BS2B 2WQYB 3EUB2 3CWIA 1L6UA 2K5PA 2WDVB 2WP9B 2CJNA 3W5UB 3NVVA 3B2GA 3AEAB 4HRSA 3SFDB 3FAHA 1DOXA 4HROA 1TKGA 4FXCA 4JWSC 1L6VA 2L83A 3P4RB 4USAA 3VR9B 3AEFB 4N6EB 4N58A 4YSXB 1WXQA 5EE9A 1NEKB 3L4PA 3AE6B 2CJOA 2DBYA 1OFFA 3DWGC 1QLBB 3AEDB 4C80A 3VRAB 2WS3B 3NRZA 3P63A 1N5XA 1TKYA 1VLBA 2PKOA 1ZOYB 1RM6C 1NYRA 1WRIA 4IDIA 1NI3A 4ITKA 3P4SB 1OQRA 2WU5B 4US9A 3HRDD 1FXIA 3B2FA 3W5VB 1E6EB 1QOAA 5MPOA 3AN1A 4C7YA 1RWSA 2G1EA 2W3RA 4JWUC 5AUIA 4ZOHC 4US8A 3NVZA 2B76B 1OQQA 2FBWB 2N0SB 2WDRB 5C3JB 4YT0B 1WWTA 3RPFC 4ZHPA 1AWDA 1FFVA 1J7BA 1QT9A 3LB8C 3BIID 1N62A 3HVZA 3PO0A 3AE3B 4C7ZA 1AYFA 5H8YE 1FRRA 3FC4A 1FM0D 3DWMA 1E9MA 2K22A 5AUKA 1XLQA 2CU3A 3AEBB 2WU2B 3VRBB 3AEGB 5EE3A 3VR8B 3ZYYX 1YQ4B 1GPXA 2QJLA 1PUTA 2JQRB 1YJJA 3P1MA 1QF6A 3CIRB 1N61A 2MJEA 1TKEA 2WDQB 3AECB 4WQMA 3P4PB 1R7SA 5H92C 1JW9D
chains in the Genus database with same CATH superfamily
4RZRA 2IBKA 3IM1A 1YQ3B 1JROA 1TT5B 2EKIA 4UAWA 1EWCA 2LUMA 2WDTB 2HBKA 4GIBA 4FJYA 3NGDA 2ZIWA 4I2BA 1TZOA 1WMHA 4HJGE 4TUQA 1KFDA 9ICTA 1C1YB 3M3JA 2BKFA 4M9LA 4ZH4A 3PZ7A 2H5XA 4DSFA 1T3QA 4DQOC 3KBBA 3QX7A 7ICQA 2MBBB 4KLQA 1ZRNA 3QZ7A 2KFZA 5DGAA 1Y8RC 3OJ3A 2BZFA 3T3NA 2R8JA 2BS4B 3N1YC 4QWCA 4Y2XA 1IUEA 1L5PA 2UYZB 4YQWA 2MBOA 1KFTA 3N3KB 2KWUB 4XA5A 2DQNB 3NZ3A 1HUOA 1O03A 1Z1BA 8ICQA 3RT3B 5DPWA 4NLCA 1F1HA 2HE7A 3PVLA 4YCXA 2QKQA 1JWMD 2ASJA 1RFKA 3UQ0A 3ICXA 4P0PB 3MC1A 3PSPA 3A1QB 4ED3A 1XCTL 3WA0A 2QEJC 2X38A 4GDKB 4IM0A 2MBEA 2MJ3A 2MCNB 2ODGA 5ALWA 1S0VA 3GFKB 4WWPA 4M01A 2D11A 2M17A 2XN9C 4FADA 4DSLA 1COKA 3L0WB 4DWFA 2R2OA 3IG8A 2UVUA 1TK0A 1CRXA 4EUTA 4HKQA 4KVGB 3L5KA 3WCQA 1V1OA 4JV2A 2KKVA 2MU2A 3QUCA 4EX7A 1K50A 2D3CA 2BS2B 1T0RC 3AE8B 2JYEA 4K7SA 3EPIA 2CRXA 3HWTA 2WXIA 3C2LA 3L10B 2DYMA 2MUTB 4FZMA 4MEYA 3BK2A 1P1AA 4NLZA 1YZ6A 7ICPA 4P0QA 2DAJA 1WGYA 4DHZB 1ZQYA 4N58A 2K8BB 5GTIU 9ICXA 4XUSA 2QC8A 4F7ZA 2HTHA 2G9HD 1K8RB 3UXOA 1N5XA 2JV3A 5KFWA 3PMNA 4ED8A 2ESEA 3ZDTA 4WJOA 4QZIA 2LI5A 2Y5BB 3Q3JA 5DBBA 2AGQA 5HFYA 2LRUA 1KLVA 1ZD4A 1WGHA 2J42A 2ZTCA 5D2MB 1FNUA 3Q8AA 4NJ6A 4DLGA 5AUIA 5BYRA 5HHDG 2K89A 4PYUA 5J2KA 1TS4A 1YN4A 3WAOA 2NPTA 2K4IA 4IRCA 4KMUA 2E5SA 5AKJA 1Z4OA 4KLGA 2BGFA 4F4KA 2LXCA 4WWNA 4JV1A 3V61A 4UQGA 3PMLA 2Z0DB 2OWOA 3SZ2A 2KVCA 2IZVB 5A0LA 5EE3A 2N7EA 3PRMB 3IN5A 2JQRB 4BAXA 2NRTA 4M0WB 8ICHA 5H2FU 1SE2A 3NS8A 4DS5A 3U30A 4PZOA 2NRZA 2BB5A 3U4EG 3V6CB 4F5PA 4FBTA 4OW0A 5KG4A 4UAZA 4MM3B 1JMLA 4I6LB 3AV8A 1N60A 4URKA 3PW5A 4OZAA 1JALA 3Q14C 1KRPA 3HW8A 5J0RA 1WGRA 4QZHA 3N9YC 1NENB 4UARA 4EBCA 1UNSA 4YXDB 4OJLA 4WIPA 2OCEA 4EENA 5DPSA 5IO9A 3LDAA 4EBDA 2C9WB 4OO1J 1Z4NA 1MQ2A 2FMQA 3NZUA 2FUG1 4PS7A 2KMMA 3IXSA 3QAQA 4GU2A 4KGTA 1YX5B 1YN5A 4QZ8A 1NKEA 2RR9A 3VH4B 5C1ZA 3KWVA 3HM6X 1LGRA 1Y88A 5JHBA 5IIMA 3C8YA 1LKYA 3V7KA 1WH3A 3H7PB 3QUQA 2W9AA 2J0JA 4BBNF 2H88B 3K9OB 2XGPA 2W7PA 1PVPA 2BYFA 3HPOA 2PPHA 4N59A 1NVID 1P0RA 2ZW1A 4D2KA 2W7OA 2MBHA 2R8IA 2HHQA 2KDEB 3N7SC 2YQEA 4MEMA 4R66A 1KW4A 2PMZF 2M0NA 3GE3C 5J0UA 4HEA1 2JU6X 3DDCB 2K8AA 2FUHB 1QCKA 2W3SA 3DCGA 4MGYE 3GQCA 2AXTU 1GJZA 3GIJA 4DLEA 1Z19A 3N32A 3RAQA 3Q8RB 2FPLA 4ZDVA 5J2IA 1GB4A 3RR7A 2K60A 5G55A 4XDCA 9ICJA 3HK0A 2N1WA 4ED2A 4R64A 5FP0A 3ZD8A 3IAS1 5EWGA 1U9LA 1JWSD 4G0NB 5AM2A 2V4QA 4ICVA 4I2GA 1CMXB 4RPYA 3GZFA 5J8YC 4DFJA 4EZ9A 2RDHA 2R8GA 4LJOB 3U8ZA 3W2DA 4XDDA 2L3ZA 2KVZA 4DSKA 4YXJA 1WRIA 4UAVA 2PFNA 1WSPA 2KDFB 1P7EA 3RNCC 4QW8A 3MR6A 2KIVA 2NMQA 3U7ZA 3IAM1 2GOWA 4EZLA 1TE2A 1BVSA 4ZOHC 5AKXA 2N0SB 3TKAA 1SL1A 2N9PC 5BMHA 9ICGA 4F92B 4P7IA 5AKYA 3PX4A 2PW9A 3EECA 5KFCA 2K25A 2KZMA 3FC4A 4F5NA 3QA8A 4BKTA 1ZQMA 4Q43A 2JEJA 5ALTA 2LMRA 1KEJA 2HOFA 5J2CA 5H92C 3UF8A 5ALGA 4ASWC 3SD7A 3WKAA 2LGXA 4WWOA 3DBSA 1MFWA 1OGWA 1GOZA 2MRLA 4WURA 1I35A 1QSLA 2KD1A 2BWFA 1FRDA 4DBGA 1JIHA 4L1BA 4KLSA 2DWQA 3MJWA 1ZPSA 5E79U 5J18A 4YR3A 2EANA 4CGZA 4RT2A 4KKIA 3L08A 4DFKA 2KE7A 1UF0A 1YMHE 2LVOA 2AQ2B 3OLMD 3SD5A 2KC1A 4ZHOA 4DHZE 2YTUA 4ELVA 2FPKA 1A70A 4G9BA 2AQ4A 2AJQA 3JPOA 1ZUD2 3V3XA 4BOZB 2JPHA 2JUOA 4NQKE 1WE7A 2QB1A 2MBQA 1I4RA 4PGXA 3QK0A 2C2EA 5J2FA 4K4IA 3AE5B 4FA6A 2FIFA 5FKAC 2WXGA 2UVRA 1MG4A 4MHVA 1H8CA 1QOGA 3RYTA 2KQ4X 3R9KA 3PW4A 1SE9A 2MRPA 4R8UB 5KT7A 3UQ2A 3HVDA 3X23A 5AICA 2GBKA 2FDRA 4C4TA 2ZG6A 1DGJA 2HTME 4GIVA 2N1VA 2KJ5A 1VJ5A 5CJ7A 1UA1A 1FCLA 3SEIA 2ISOA 1S1QB 5J0TA 2KTRB 5KNIA 1RAXA 2FNJB 1QOFA 1QOBA 2KD0A 1SKSA 3A33B 2KOBA 1A6SA 1T6BX 1RXVA 4BXOA 2PXIA 1WX8A 3RZFA 2JEGA 3H0RB 2J0KA 3N7RC 2FE9A 3EUB2 3URYA 3HX0A 1UA0A 2K6QA 1ZXHA 5KG2A 5EDSA 2DENB 4P4OA 4Y2VA 2OEDA 2EDUA 3M8RA 1SIFA 1D8LA 2KIWA 1VZ6A 1H38A 8ICUA 5KG1A 1BXTA 4JWMA 1UPHA 3E0FA 2BHNA 5CWRA 3RH5A 1OFFA 2WXFA 3ISDA 4F50A 2FLNA 3JSVB 1IGCA 4JWNA 4O9MA 1F5SA 4QZDA 3F2DA 3IVFA 1IYFA 2EMSA 3OG5A 2ZPNA 1RM6C 3OPXA 1D4BA 1TFRA 4QZFA 2KMAA 4NJ8A 3RF9A 1ZQXA 2BCRA 7ICTA 2LKYA 3SQIA 9ICWA 1IBXB 5IOIA 2WAQF 3ZRFA 2W3RA 2IOHA 3M62B 4DL3A 3PW2A 3NVZA 5JXVA 1ZD5A 5DQIA 1ZQLA 5ALUA 1BNPA 3RPFC 3DEEA 2WWZA 4O0IA 2VJ5A 2HHTA 3J9CA 5ALKA 2O2VB 2MA1A 4ZYNA 2HJ8A 3A9KA 3N4MB 5AUKA 2OJRA 4M0AA 1HUZA 4F91B 3PR4A 1N56A 5E6NA 4MACA 2CXYA 4NLBA 3RJIA 4RGTA 5G5HA 1C76A 2M4NA 3MFIA 4BWJA 1DOIA 5IIIA 4JB3A 4ANVA 1D9FA 4FE3A 2AX5A 3OGUA 1HJPA 4O5EA 4CO7A 4DOBA 5BPCA 1OUQA 2IHNA 1ZQQA 3ZDBA 2HW3A 2KWVB 2UWQA 3Q3NC 5CX3A 2NRXA 4Q8FA 3OAWA 4A55A 4JPSA 1L0VB 5BMGA 2B0CA 3KZXA 5IINA 2GB1A 1N63A 1DXSA 2KDMA 3OHBA 5ALZA 1XC9A 3AEEB 3HILA 2Q4TA 4PS3A 3ZQ4A 5C5JA 1X1MA 2R8HA 2C7NB 4W9IA 3GDXA 3R3MA 2CN1A 2B3AA 4YWGG 3RR8A 4YP3A 2GMIC 3HKZF 2ZIXB 2BBCA 2CHZA 3RZWC 1QTMA 4KMOB 2KWDA 2KO3A 7ICEA 1ZQ1C 4CF3A 1MPEA 1T4GA 3KUDB 1HZ5A 3VUWA 4XX5A 4F8CB 2INCC 3RNBC 5BYSA 2JXXA 4ARIA 2MX2A 1NI2A 3K75D 1IP9A 2LM4A 3BQ2A 2FIDA 4I2FA 3L54A 4DO9A 4A6QA 2PEAA 1NJXA 5KFRA 4HAIA 2JVCA 5AI9A 1EF1A 2FE8A 2W54A 4KV2A 4IL6U 1J2MA 4P0PA 2QCZA 4C56C 4BX9C 1UGJA 3QEBZ 3QCAA 3ZDAA 4TMAB 1BPZA 4XWWA 2IOFK 3IV6A 4CNQA 2BPSA 1L3UA 2DF4B 2CHXA 4YL8A 2V9WA 4TQ0A 3VUXA 4HCNB 2DFLA 4DOCA 2WQYB 1EUVB 3TAPA 5L1IA 3TADC 1V1PA 3SFDB 1WUDA 1L7PA 2KHQA 3QARA 2NBVB 4BWMA 4WJQA 5EWFA 1WXQA 4GXKA 3V6JA 2UU7A 1HE8A 2F3NA 2G45B 2A19A 1PK3A 3FYHA 2G09A 2WS3B 5KFGA 4RNMA 4P0QB 1UCVA 2ZIVA 4DQPA 4LZDA 1QH9A 9ICQA 3UIOB 1Q3UA 4RF1A 2KNBA 2CR5A 4AQ7A 2VA2A 2JRIB 1ZQPA 2KFJA 4REZA 3BQTA 4RQMA 3AL0B 4IWQA 5MPOA 1RWSA 3R7RA 3CW2C 2JZBB 3SAFA 3PSTA 2KOXA 7ICSA 1J7BA 4UB5A 1X42A 5KTQA 1SXEA 1JXEA 3H7IA 4ECYA 1T0SC 1TS5A 3ML8A 2W11A 4DXAB 3MFGA 2BYEA 4PHAA 4IS7A 2WXHA 3VRBB 4IWPA 1DK3A 4EFOA 2WTFA 3DVGX 2HSZA 1R7SA 3B0AA 3SHQA 3ZRCA 2BKRB 1Q1OA 3NRWA 1NKBA 1H4RA 4B0EA 1RYJA 5G5GA 1RFAA 2WNMA 4ECXA 1ZJNA 3IG5A 4OZBA 3U7DA 5KFHA 2AH5A 1ZD3A 4KLDA 1CZPA 2DUYA 2GWSA 3TQ1A 3KYCD 1DOYA 1X9SA 1D5ZC 3V6EB 1GAQB 4W9EA 4NL9A 4I2DA 4MM3A 2K8CA 3W9CB 4RH6A 3ZDEA 3A9JB 3DBHB 4C4SA 1EWYC 2ZNVC 1QQ6A 2CS4A 1S3SG 4WQOB 3VTVA 5DB6A 3LWLA 4F5QA 3DBRB 4IRDA 4IQUA 3OJUA 2INPE 4EEKA 3VFKA 3T3FA 3MC8A 3CMMB 1ZQZA 3NUHB 5FK9C 4LCDE 1RPLA 2MUTA 1NZPA 4GXJA 2J7QB 1C20A 3QX1A 2G5HB 4G50A 2EZYA 1SL2A 5J2HA 4W9HA 4C8LA 4GOCA 5LLIA 4PJ0U 5JH5C 1BPXA 3WK8A 4ACFA 2PIAA 3QQ8B 2Z0EB 5DBAA 1HQRD 3QU2A 2LUEA 4OJ5A 4O3PA 4NV0A 2PFOA 3UI3A 4XQ8A 3ZNHB 2Y5CA 5KFBA 5LXIB 4XE0A 3BS7A 7ICVA 2M9NA 4QWBA 4RU9A 4TURA 5D3IB 5DCNA 5AEKB 4JMUA 4YG2A 2JEIA 3CWIA 2K5PA 4OVVA 2FLPA 4NLGA 2CJNA 2L1AA 3H8SA 4BVUC 2XCPA 1E7UA 2L83A 3BZDB 5ALLA 4DK5A 3MGHA 5KFXA 4FBJB 4O3OA 4U6PA 3IT6B 2JSVX 2PTLA 3KHGA 3GIKA 1DYQA 2ZTEA 4M02A 3ZD9A 3NRZA 5KFZA 2W43A 3MGIA 3G6YA 1VLBA 4L2YA 4NPNA 2KMCA 1LXDA 4UB3A 2CKHB 7ICGA 1X6IA 4XYCA 5KFTA 4E74A 2W04A 1ZQUA 3TACB 4TQSA 1D6EC 1FXIA 4NNJB 1TY2A 4NAWB 3T3OA 1P98A 3RJKA 4HDOA 4LNIA 1E8XA 3FILA 3V7LA 5EOZA 3P2BA 4J03A 4DHJB 4IM2A 2J6UA 3Q8SB 2YLMA 4M9HA 2QSDA 4DS4A 5AM1A 3RB4A 2KNJA 2V3NA 2FI1A 2JZPA 2D5GA 4M8NA 3C21A 4ED1A 3R2TA 3JPRA 1YJ1A 2WYQA 3BYYB 3GIMA 5E6OA 3KUCB 2WF7A 4EYHB 3P1MA 4Y2QA 1WYWB 4HPPA 5AKKA 5CHWA 4YMMA 2JWUA 1SBBB 2ASQA 3PR5B 2K0PA 4KN7A 5B66U 5DG7A 1S10A 1OEYA 1N6ZA 1SSNA 1F0MA 3H7PA 3LXFA 2ZJAA 3T5HA 4O3NA 4K3BA 1SXDA 1NNLA 5J0OA 1HA5A 1M94A 2NR2A 3ZJVA 2DPIA 3MJ5A 1V1PB 8ICZA 1YNTE 1Y56A 5KFDA 2CU1A 3T79A 7ICRA 1BPEA 4YD2A 1DRGA 5ALDA 1Z00A 4AUQC 3HHMA 4A3OA 1TGZB 4RPXA 2G3QB 2KX3A 4YFKA 4NY8A 3DBRI 1FNWA 1B4FA 1NK9A 1C4PA 5AZFA 2H89B 3LYSA 2XCAA 3C5GA 8ICXA 2AWTA 3AE2B 1SV0C 4J9RA 3ABVB 3AE1B 3MC0B 4P16A 3L17A 4DL7A 1CK1A 3AUOA 3C28A 4AYBF 5KT4A 5CR0A 2FJ6A 2L00B 1TAQA 3EC8A 3H40A 4GDLB 4IC9A 5IILA 5AKIA 3RFAA 1KM7A 1SE3A 2KFKA 2PVOD 1E10A 3WK9A 4DFPA 1PVQA 2KTFA 5HI1A 2MH7A 2HBMA 2HHUA 5IN7A 2ES6A 5AHXA 3WK5A 4AP4C 4ANWA 5J2DA 8ICBA 3PV8A 2BQQA 4JLCA 4A8XC 1PUZA 3JPQA 1E0ZA 2YN4A 4BDPA 2ZJ5A 2F76X 3IHQB 2XY7A 2M1MA 3GP7A 1J0GA 3MR2A 1E90A 4RNAA 1KJTA 5KFUA 3LK9A 3VTWA 4RQ7A 2ASDA 3AULA 5CB1A 1R4MB 2IMWP 3JVZX 2IO0B 4KLIA 4XRHA 4PS8A 2V4IB 1QQRA 2AQ0A 2D3DA 1SL0A 4IW0A 5ALVA 3WU2U 4IRKA 1FEZA 3BZCA 2ZUBA 5DQGA 1RZTA 3MABA 1FPYA 1PQSA 1WXVA 5KG7A 3DOWA 2J6SA 1XEEA 2LMCA 2JMGA 1RYUA 1C78A 2IPKD 4YR2A 5KHQA 4RGOS 5HHIA 3WALA 3DVGY 3ZDMC 2IGHA 4RGNA 4EZ6A 5HMMA 4Z6DA 4GLSC 1Z1VA 4BGDA 3AU6A 1QT9A 2BCVA 4NAMA 4M9GA 1AYFA 4EEWA 1WCLA 3VH3B 4IM3A 7ICKA 3TJPA 2JR5A 3H4BA 1O08A 3SV4A 1YQ4B 3Q69A 4LNOA 5T8IA 2ZTDA 1TKEA 4NM1A 1XT9B 5ALYA 2Q0ZX 5AKGA 4PGYA 4TV3A 3H8WA 5ALIA 1L3SA 1SJHD 3GZNI 1L4ZB 2LM1A 1WGDA 2ISPA 3RULA 2FCNA 3UXNA 1KH0A 3SAHA 3H4DA 1WG8A 4KX6B 3PRZA 4WAFA 5IIKA 1ACCA 2EZZA 3BS5A 4KZ0A 4QIWC 3SYZA 4FHKA 3LVVA 2P6UA 3WKCA 1SF0A 4LJXA 1XXGA 1P7FA 1YOVB 5ALNA 3OHAA 1IXRA 5L95C 1JWAD 2KHWB 2JH7A 1C79A 2KDIA 4WH4A 1HIWA 1NJZA 1KRHA 4DSEA 4IG7B 4PYZA 2L7RA 1SWVA 2V4LA 9ICVA 4KLUA 3L16A 1HEZE 1WR1A 4ACOA 4UBCA 1GUAB 3ML9A 3AMZA 1ZDVA 3WK4A 3G6VA 3VQIA 2IO3B 3QZ8A 8ICPA 8ICNA 4K1RB 4RGMA 4FO6A 8ICWA 1C4AA 1K1SA 1CEZA 1A5RA 3NS1A 2W9BB 3RMKC 2E8NA 2LYHA 2A4ZA 2MHJA 5TSSA 2D07B 4W9LA 4II2B 1ZQOA 2FAZA 4I27A 1ZXIA 4RT3A 7ICUA 4P1CC 1OW5A 8ICOA 2HBJA 3Q8BA 2JGAA 4Z6EA 1P9DU 3UQAA 3RJJA 2N9XA 5KFYA 4HLEA 3PW7A 2MSED 3W5UB 4LZGA 5GMVA 4GMVA 5AI8A 3FAHA 3H9DA 4B9NA 5KG0A 1RLFA 3A9KB 2G5IB 5BYQA 4RNNA 3TEXA 3E56A 5AIAA 1ZQFA 4E71A 3ZI4A 2FLLA 4CRXA 3AE6B 3Q8CA 4KIKA 5DLFA 5GTHU 9ICEA 1UH6A 2HHSA 2O6KA 4EZKA 3BK1A 4KDIC 2GOLA 5KG3A 3QNMA 2V9HA 3EGRA 1BPBA 1MG8A 2KV2A 8ICEA 2JT4B 4US9A 3MR3A 4RPZA 3MDAA 1Q3VA 2LXAA 3F5EA 1KBUA 4W9FA 3B0XA 2YEPB 2G06A 3GOEA 4EKUA 4UW9A 1AWDA 3M6ZA 4QJFB 3NHEB 2F44A 2N7DA 3AE3B 2JXTA 3I57A 2L5YA 4DOAA 1ZQTA 3BVGA 3KLSX 4ZRJA 3TL5A 3BINA 4BKSA 3RRGA 2BYTA 1V9JA 4MT5A 4RQ4A 4G3XB 2LHEA 1B1ZA 3MP9A 3OTQA 5L83A 4Q44A 4Y2JA 4FS2A 4RMAA 4WQMA 3N28A 1IG6A 1RDFA 4C8KA 3PSFA 1ZDXA 5DLGA 2NPTB 5DG8A 2KZRA 4J9OA 4MH0E 3RRHA 2QB0A 1S77D 4RF0A 3LVWA 3IG3A 3GIIA 1WXAA 5F9NA 1TTNA 3UGBB 1XLOA 1V85A 1XLNA 4BZAA 3AQFA 1B22A 2KLCA 2M0AA 2LYAA 4E3CA 2DYOA 2JX5A 2KWCA 4QWAA 2KVRA 4L23A 2V1YA 3ZJTA 1FIQA 3ZO5B 1F77A 1YIWA 4ZRQA 1Z2MA 9ICKA 1X9XA 2IBIB 2EZXA 2E3TA 1C4CA 1L7NA 4X57B 4PZNA 3NVYA 2ZXHA 2WXJA 4FHJA 3AE7B 2RDIA 1ZQIA 3R66C 4KKJA 1ZQKA 1JCKB 2WHIA 5DKWA 2H3FA 5BOLA 1U47A 3B0YA 2EMTA 2JH1A 2YY6A 9ICRA 2KK0A 4YTMB 2LGIA 3GB1A 5HR6A 2JY6A 1KFYB 1D8YA 4FN2A 1LQBA 4JX1C 5AZGA 2W9CB 2ZUCA 5LXHA 1VDVA 3KFUF 2NYVA 2A1AA 4HPMB 1HZ6A 3H8MA 3N97B 3UMBA 2C28A 1LKYB 3Q8QB 2FPMA 3D2NA 1E8WA 2XK5B 2HD5B 4C4RA 3VTUA 2OH2A 1GC7A 2I1KA 3RJGA 4G3IA 4BFRA 5L1JA 3EZ5A 4PGQA 2BCSA 4MFFA 2WXNA 3AEAB 2ZVNA 4HRSA 4W9GA 1I42A 1OQYA 4DXGA 3QU7A 3JPNA 3AQEA 1ZQAA 2IGGA 3VR9B 1XSNA 4NWIA 3IHPC 4CYEA 4YR0A 2LRWA 2LGDA 2MQJA 2QARA 4TUPA 4R63A 5L9XA 1WX9A 4HVBA 2I1QA 1D8BA 2JWZA 4I2JA 1XSLA 4UASA 1LV5A 4O5CA 5KHOA 4WAAA 4P2HA 4J3OD 3LWMA 2GLEA 2NRWA 4QZEA 5KL8B 3QU4A 1VCBA 2GBMA 1ZOLA 2XI9A 2HVIA 2KJ8A 3H0MB 3N20C 3DVNV 5J2RA 3ZDCA 3PX6A 1L3TA 1TVAA 1A76A 4DQQA 1L7OA 3B08A 1ZQCA 1I4HA 3M63B 1CI4A 2G08A 4PK1A 1XLQA 1YT3A 1WCNA 5IIOA 2W9BA 1ED1A 3ZYYX 3ZVVA 1NK5A 1PUTA 2R8KA 4I2IA 3VCBA 1IV8A 2JZZA 3T5KA 3IP4B 1RYRA 4O3SA 2L32A 2INDC 5KFMA 3I9V1 2DAFA 3QE9Y 4ECZA 2KTRA 4M2YA 2VZKB 3DV9A 5AKZA 2KQ7A 2NS5A 3LYYA 4YN4A 2A3VA 3VAWA 5IIJA 1JN3A 3PO5A 1M6YA 4K7WA 5J0XA 4QZ9A 2GO7A 1QILA 4DXFA 2NTTA 4OCZA 2C7HA 1I4PA 4TSSA 1J7CA 3T8MA 1KDHA 2JF5A 3F2CA 3RB0A 4AJWA 5ALSA 2VA3A 4II3B 2O6VD 2XBBC 5CHFA 2BW2A 1ZYQA 2QLTA 1PGAA 4LDTB 3ZGZA 2PI4A 1N5WA 4Y2UA 1CJEA 3TSSA 3BVZA 4KITB 4H2AA 3CRXA 3E58A 4DQSA 4IWOA 3PTFC 1JWBD 2LHDA 2BDUA 5KAIU 1SGGA 3EW9A 2LD9A 2ZEQA 1DK2A 5KFEA 3E2EA 3LDZE 3NOBA 4BKGA 4EELA 2BPFA 2HMXA 7ICOA 3M9MB 3BQ0A 3R8BA 1NDDA 2ASLA 2D2QA 3KHHA 4EEYA 1F2RI 4KSLC 3S2AA 4J9NA 5G2NA 4I29A 4LK0M 3SENA 2JXJA 3DBLI 4Q8EA 3DDHA 4LNFA 2HCFA 2DZJA 2K9XA 2RMMA 8ICLA 1SEBD 2PE9A 4K3CA 4TQ1A 4KTQA 4RQ2A 1NK0A 3C23A 4DFDA 3VVWB 3OJSA 2QARB 4HROA 3RCZA 2ONQA 1AN8A 1L6VA 3P4RB 1SZHA 3WK6A 1S0NA 7ICNA 1ZQVA 4CF5A 1MSWD 1F9JA 2OYYA 1SXTA 2CJOA 2XEWA 9ICCA 1IIPA 3WK7A 4YVZA 4OJOA 1F44A 2MW5A 4ANXA 5AM0A 4O5KA 2R61A 5BO4B 3J81j 3RNFC 2GH1A 1WM2A 5AZHA 8ICGA 2RLTA 1RRBA 4AOFA 5J0WA 2ZVOA 2J0MA 4MJSB 1I4QA 3W5VB 2SEBD 1FXTB 3ETLA 3ZTCA 5AI5A 4M6WA 1QOAA 2N9EB 2G1EA 1T94A 2JHDA 3TI0A 2K39A 2MLBA 4US8A 3JPSA 7ICFA 4LNKA 5C3JB 5IA7A 1WWTA 4F71A 3TEZA 1X2IA 2CPRA 1E8YA 2KJRA 1UUPA 4QZCA 5DB8A 1KTKA 2PKEA 5AKHA 1U45A 3RBEA 3DWMA 1E9MA 4ECUA 2TSSA 4GLXA 1NBFC 3AEBB 4ED6A 3C29A 4IOIE 4F2RA 2WX0A 5TISU 2FCSA 1WGGA 3CIRB 1N61A 3Q3MC 5AI4A 2KT7A 4C0ZA 2XK5A 3EA6A 4FS1A 3JW0X 4NZLB 1QKZA 3MTNB 3T9LA 4R3DA 2BYVE 2X8XX 1YN3A 4W9DA 9ICSA 4EE2A 4QAYA 3CNHA 3PS6A 5KFFA 4O3RA 1FMAD 2ACZB 2OM6A 4I2AA 1OEYJ 1MHHE 1A77A 2JRZA 2ZXIA 3M95A 1E7PB 2L05A 1SV0A 3F2BA 2J53A 4Y2RA 2KYWA 5JTIA 2BPCA 4MSMB 1TAMA 2KLGA 1MA7A 2WB1C 1KF6B 3GV7B 2O6VB 4J9KA 1AQ6A 5AI6A 2L8JA 4A9AA 1UBIA 3M6KA 2AL6A 2NO5A 1WY8A 2VA8A 2HDEA 2L0FA 3N30A 5J8YA 1V38A 2KMDA 4KZCA 5D49A 4RM9A 4KLTA 3B9JA 4NQLB 1RXWA 1VRAB 2ZJ8A 3N7PD 4F4XA 3RBDA 2XIDA 3RAXA 1EU4A 2WXRA 2HDOA 1L5UA 1STEA 2RQ5A 2G4DB 1Q5WB 2L0TA 3DVNU 4WWMA 3PSIA 2Y0SC 3LJ3A 3RH6A 2JZBA 3QYPA 3DHIC 4YXMA 2RP5A 2M8SA 5CHVC 5J2GA 5HNKA 2GBJA 4QWDA 1XU4A 3AU4A 2WF8A 5ALRA 2ZUDA 1TJEA 2ZCBA 2REXA 5ALXA 4UB8U 3X0WA 4KLFA 2KAJA 2KJHB 2KXJA 8ICSA 3NVWA 5D94A 7ICHA 1PZNA 1S0MA 1ZQEA 2JRHA 2I2YA 3MGVA 4BKSD 1XO3A 3I5JC 3UMGA 2Z7JA 2XY6A 4YTPB 3TCAA 4C4VA 2KX0A 5BMIA 4WJPA 4EZJA 2WDVB 2ZIVB 2BF8B 3B2GA 5CTRC 1F2RC 5L1MA 3DBLB 2AGPA 4I2HA 5ALPA 5C23A 4UATA 3PO4A 2DKZA 2KP7A 1NEKB 3EFUA 5ALJA 3KVFB 1MC8A 4NJ7A 3A9JA 4HJKA 4QZGA 5JRTA 3ALRA 5AK4A 5AKLA 2FCMA 4M6WB 1ZQJA 3P63A 5J0QA 4F93B 2WF6A 1SZPA 4O3MA 1X6JA 2KKPA 4Q2JA 1LFDA 2AL3A 3PLUA 1KSPA 2ZPYA 5KT6A 3P4SB 1TY0A 1OQRA 2WU5B 2Z8LA 4M8MA 5AM3A 3PW0A 3A0HU 1KLGD 4XWTA 3NASA 3ZJUA 2H3ZA 2QMTA 1PYWD 4KLOA 4J9PA 1VR9A 3MR5A 2V3PA 2KN7A 4JQWC 2H3QA 4HYKA 4FZNA 1L4DB 1NOMA 3M1YA 4MGIE 3RTVA 2C22A 2IYDB 1NKCA 1ENFA 5KFLA 2XNAC 2F8LA 4OZCA 4Y2YA 1V49A 2DLBA 3QIJA 4YMOA 5D46A 2A1JA 2MSNA 5DB7A 1VZ8A 2KICA 2SAKA 2F8KA 3KD3A 4F72A 2J4XA 1GB1A 2Y1JA 2K8CB 5J2EA 4B9TA 5CHGA 3RNAC 3UXPA 4AJYB 3HM3A 2L52A 1ZQRA 3BDPA 2H3IA 2KSOA 4UAYA 1WX7A 3RD2A 4BBNC 1ZQWA 1RQLA 3A4RA 2QHOA 4NM2A 2BPGA 2P6RA 3CP8A 2MP2A 4PPXA 3H6NA 4Z6CA 2KK8A 5LNK1 1PK1B 3UM9A 4XC2A 3Q8LA 1ZQGA 1WRDB 3RNGC 2D3GA 1WZ3A 1F0ZA 1UWXA 2PMZC 1WMHB 3A1QA 2GBRA 2M56B 1I4GA 3PHWB 1QQ5A 3SR6A 1ZJMA 2WXKA 1KKXA 4MJSA 3H0LB 4UB4A 1FCCC 1XNSA 1V97A 1E7VA 2YB4A 4NAWA 5J0SA 1VJKA 4MH8A 3GE8C 1Q0WB 1JQ4A 3BWUD 3H8HA 4M47A 2E8MA 5HKHA 1UT5A 4GB9A 3V72A 1FXAA 3EPGA 2C60A 1LB2B 3P42A 3UINB 3RN9C 2BS3B 5D4BA 4DL6A 2D3AA 3PT2B 1TK8A 3BQ1A 2W9NA 4F8RA 3H8JA 1IBXA 2Y1IA 1E5WA 1XSPA 8ICMA 1UT8A 2ZIWB 4DSJA 5CA7A 3U52E 5HR7A 5IKCM 5ALMA 2F1IA 4F5RA 2WP9B 5CEHA 3Q6BA 2IY1B 2LVPA 3O13A 3V62A 1IPGA 4JWSC 4B9UA 1L0YB 1EXNA 3OSPA 4ELTA 3HP6A 2VH1A 4B0MA 5DPTA 2VJ4A 4J9SA 1WJ6A 3VRAB 1U4AA 2JZ3B 3ORYA 1HTOA 2MWSB 4C8OA 2DKXA 4W9JA 3RJFA 2KZZA 3MFHA 2O6VA 4JV0A 8ICTA 1KQQA 1ZOYB 1D3ZA 2AGOA 4IR1A 2A5UA 2RPVA 5KG5A 2LZ6A 2IJ0A 1S8OA 4DSIA 3PX0A 3W1YA 2IY0B 3AN1A 4C7YA 2KQSA 1L8LA 4W9CA 4F2SA 1TAUA 2ZIUA 1A0PA 1URJA 1OQQA 2WB1F 3TAQA 4GDLA 4QNLA 4DDGD 3QXGA 1L0XB 4U7CA 2EKEC 4YMNA 4CF4A 2I38A 2KFKB 1FRRA 2HHVA 3PSEB 1K5OA 7ICMA 2C7MB 5E6PA 1N2XA 4M9NA 1GPXA 1KOTA 3M8SA 1COOA 2ZIXA 1YJJA 4HK2A 3D32A 4GN1A 4BUGA 4HDQA 2WDQB 1BMLC 3C19A 9ICFA 2VH2A 2YMPA 5KFAA 2F2AB 1T0YA 3IBEA 1XF5L 2WXMA 3TUOA 5HG2A 2NBUA 2K3UA 4P6VF 1T3NA 1PFDA 1Z00B 2Q5WD 2N9KA 2BT6A 2K4PA 3RI7C 2W55A 3GV8B 3T5JA 1QQ7A 2AYOB 4NXZA 4IQVA 2W9CA 4F4WA 4GXBA 4M0WA 4MDKE 4GC6A 4DF4A 2OOBB 1ZQBA 4XZ4A 1DOQA 5L1LA 4UBBA 3RUIB 3KHRA 2YMLA 5BOMA 2LPEA 4PL1A 5AM5A 3JPPA 1XD3B 5DQHA 3SU8X 4NY0A 1NJWA 4NLNA 3H1UA 2KC2A 5DGBA 4C00A 3P4QB 1KFSA 3TANA 5B5EU 1FEHA 3I76A 4PT5A 3K9PB 2PLPA 1WJUA 2PMVA 3K1ZA 4PL2A 3MC9A 3Q8EA 4GXIA 5TZVA 1QSSA 2J52A 3NG0A 1FD6A 3UPQA 4F3OA 3M9OB 4HCPB 3R7QA 4AS1A 1MI0A 3L3FX 5EE0A 2DYBA 1WGKA 3IFWB 3PHXB 4CQNA 5AK5A 2LI6A 4C8NA 1D5XC 3ZW3A 8ICFA 4KX3A 1FFUA 3GZNB 4YD1A 2P35A 1UELA 4LTUA 4IUMB 4ZRIA 2CHWA 2PI5A 2KFNA 4ECRA 1TIFA 2KN4A 3T5LA 2IDYA 2HHWA 1L6UA 2DGZA 1CUKA 4JK1A 2E8PA 4RUCA 2KSOB 1E8ZA 3QUBA 1F52A 2KG5A 3PZDA 4ZYSA 3RH4A 2K4HA 3AEFB 1X66A 5JZEB 3HJEA 1RYSA 3G6XA 4EX6A 4NL9C 4B6WA 4FJZA 4R65A 5KFPA 3FM9A 2DZMA 2E1EA 3K1RB 8ICAA 3BZKA 5DG9A 1TKYA 2OXOA 4GGQA 4HKZE 1TBEA 2NTSA 4RQ8A 3MBYA 3K4GA 3I28A 5HP4A 1V81A 2INNE 4NLKA 2C2RA 3CSTA 3TEWA 2NO4A 1V5TA 4WJNA 2WDRB 4A90A 4TKNA 2I6XA 3Q8FA 8ICIA 3OJ4B 1OTRB 1PGBA 1FFVA 5KFVA 1VD2A 3I1YA 1XQQA 3HVZA 5AK3A 1ET6A 5KFIA 5H8YE 4RQNA 3RNEC 4UB6U 3KYDD 4B6JA 4S0RA 9ICMA 2BR0A 2JYTA 5KAFU 1BT0A 2AU0A 3MHSD 3NZSA 3PREA 1L3VA 2LYBA 7ICIA 3O65B 2MJEA 1C7YA 3PLVA 3GILA 2D3BA 2XY5A 2EAMA 2G07A 1BPYA 3RJEA 1SJED 4DF8A 3VC8A 2I5HA 1ISNA 3M7DA 9ICLA 1GNUA 4KDLB 3GU3A 3SFEB 4DHJD 1LO5D 4FLHA 4ECWA 8ICVA 3TARA 1V5OA 3RJHA 1SKWA 3ONSA 4DQRA 1Q46A 2GLSA 5GXGB 2VIXA 5D3DA 2HBLA 3CYMA 4DDID 4UB1A 3DPDA 2Z59B 2XC9A 8ICJA 9ICHA 2OJWA 3VHTC 2HVHA 1SB3C 4LDTD 5E6JA 4MFCA 4YSXB 1MN8A 1X40A 1LM8B 1V9PA 4PHDA 5JHAA 4JL9A 4XGAB 1HEKA 3BS5B 2K8HA 2RDBC 1XO1A 2RDGA 1JWUD 5ALFA 4CHKA 1BGXT 3WKBA 4I2CA 2LEKA 1ET9A 2QILA 1SWWA 1YX6B 2ATLA 3U2SC 3ZUNA 4A20A 2ZIUB 3IT4B 4IQWA 3V6HA 3ZLZA 4BXOB 4IC7B 2KANA 2ON8A 2WX1A 2QIEB 1J97A 1JXLA 1I7HA 3V05A 3N1XC 1WXMA 3V6KA 4ARCA 1ROEA 4HWIB 4BJQA 2NRVA 5HHHA 4JGHB 2LGYA 2XGQA 1T7PA 2WXLA 2ZZPB 4Y2TA 4QZBA 2DX5B 4KIKB 3FDSA 3KZIU 4W9KA 2Y0SF 9ICAA 1D5MC 3QHTA 5DBCA 4PHPA 2WFAA 4ED0A 4R8UA 2QB0B 5KFOA 4DFMA 1C9FA 4UDUC 4IQTA 2LVQA 3VXWA 1DOXA 3ZXRA 2VANA 1WE6A 3ZNGC 2E6XA 2AEHA 2I1JA 3WIMA 5J17A 2NV3A 5HMLA 4DEZA 3DQVA 1KN5A 1SV4A 2E1FA 2XO7A 5DB9A 2ZW0A 2RRDA 1V2YA 2WXQA 2PKOA 5J29A 1T5XD 3I63C 1NYRA 4QWEA 4K81A 5DDMA 2DL0A 3C1ZA 1KLNA 4ITKA 1KTQA 2IO1B 9ICOA 3HRDD 2KEYA 1BPDA 4UAUA 2L76A 4MFAA 9ICPA 5JU5A 4RQ0A 2XICA 2FCQA 4RQ1A 1ZW7A 2B76B 3JSVA 3QEAZ 4FZLA 4Q45A 2N7JA 5ALEA 3L13A 1UGMA 1WM3A 4MF8A 3SDLC 2MEKA 3BIID 1N62A 3PO0A 3ZTDA 2ALZA 5IP4D 2BVCA 1FM0D 3NUQA 2KJ9A 1XWLA 3QU9A 4Y2PA 4M9JA 1L6NA 2QJLA 1WJ4A 2J6TA 1T8EA 4KLMA 2D6FC 1ZE3D 2IGDA 3I3TB 4I6PA 1NJYA 2LGSA 1WZ0A 1QZEA 1JRPA 4TUSA 4LJPB 2NCNA 1B0XA 1UD7A 1ZQSA 1PDXA 1TKDA 3UIPB 3JYUA 4P4MA 1Z3EB 3BY4B 1AROP 1GC6A 5DDYA 2LJIA 1XO0A 3CSFA 3UMCA 1UHUA 1WYGA 4RNOA 1S76D 2YMQA 2P66A 1ZP0B 1HTQA 4M04A 4ZRKA 5JUMA 2N9LA 3N1ZC 1YJIA 1JRUA 2B21A 5J2JA 1WWUA 2AQ3B 2BGWA 3KTQA 3MHZA 1Q8KA 1B9RA 4P4PA 4O3QA 3HUIA 4MGZE 4Y2SA 2UVWA 4FJVB 3U26A 3HKZC 1IM4A 1J8CA 1V86A 3AH7A 1PK1A 2OHFA 5C0YA 5L1KA 1MQ3A 2BCQA 1XLPA 5IAAC 1TV9A 4ED7A 1TS3A 5ALQA 2IA6A 3BJYA 4GDKA 2F1JA 5KFQA 3A4SC 4EOYA 3SEBA 2LWPA 1Q10A 2F77X 3NJTA 1UQVA 1Z5SB 2K1FA 1TK5A 4K7UA 2LFIA 4MELA 3RFZB 3ETRA 4ECTA 2RHFA 2W9MA 1ZRMA 3JPTA 3NY5A 3M9NB 1UZXB 2GRIA 3SMVA 3QUTA 2W82A 1EO6A 5J2BA 1C3TA 3KKAA 1MJDA 1FO4A 5I4DA 4M00A 3VUYA 4KN4A 4I2EA 4KLLA 2KN5A 2PVGC 4ELUA 5EE1A 5F9LA 2W03A 8ICKA 2QDFA 3ENEA 5EWEA 1WI0A 5AIBA 1QLNA 1MVKA 1ECWA 2BDPA 4KLJA 2FMSA 4TUUA 2PFPA 3FKYA 3R2IA 4RQ5A 4QW9A 3APCA 4QZAA 3WAMA 2GBNA 4WJ3B 3WKEA 4B9SA 4ANUA 3QWZB 4N6EB 1M4VA 5EE9A 4F4ZA 5KFKA 3L4PA 4GC7A 3ZDDA 4IR9A 1TZ1A 4MF2A 3PZPA 2K4EA 2BCUA 3WKDA 4A8EA 3C0RB 5AK6A 3KW5B 4Z6FA 1NZBA 5AI0A 1NI3A 3CF6E 3EYZA 4MSQB 3F53A 2R18A 2LBOA 4E0DA 3OWEB 3ZIMA 2WHEA 1ZGUB 2HJ1A 3ECIA 4AWJA 2KHVA 4JWUC 2IHMA 3MDCA 2KVSA 4RM8A 4YT0B 2ZNVB 1X9WA 9ICBA 3PGEA 4ZHPA 2BQ3A 5K4LA 1PVRA 2YB1A 3KH0A 5ALOA 1WFYA 1RQNA 2RD0A 3PVXA 5AM4A 3EFCA 3TFSA 3A0BU 1TS2A 2HHXA 3ZNID 3VR8B 4JIOU 5FR6A 1K53A 3ISCA 4PH5A 3B1LX 3IDWA 7ICLA 2R2QA 2G0AA 1B43A 5AKEA 2PJHA 3PV1A 3EHVA 4NJCA 1XS9D 1JMSA 4DL5A 3ISBA 3DBHI 2XVTA 5D6JB 8ICYA 3V60A 4EYIB 3C5FA 1AARA 3RB3A 1I4XA 3DHHC 1UBQA 4F1SA 4BOSC 5KFSA 3AI5A 4TQRA 2BWES 3AEVA 4DCCA 3KWLA 1MHXA 2WF5A 2YMMA 1BNOA 3Q8PB 2C2DA 1S9FA 3BVMA 2F1HA 3TADA 1D9DA 3SV3A 2KKCA 5DPRA 3V7JA 3KKAC 1WIAA 5KT2A 1S0OA 2E8OA 4FBUA 4JE3B 1TYGB 2DHZA 3TFRA 3OSNA 4HPLB 3PNCA 2KZ3A 3C2KA 3PY8A 1UWMA 1WF9A 2BB6A 4A3PA 4YSZB 2IO2B 1C77A 1V8CA 3UQBA 1IGDA 1YQBA 1J7AA 2HI0A 1S5LU 2NBWB 4KSKC 2RDJA 1K1QA 1WXSA 4KX5A 2DPJA 2YVCA 2W8KA 3BYTB 3W1SA 1R4NI 1KLUD 4YTNB 1JX4A 4IKGA 4J6IA 1EF5A 2KJ6A 3KUZA 2OEHA 2H3VA 3AE9B 1LVHA 3WAPA 3E9SA 4YSYB 2VRRB 4ECQA 1RG6A 4ZRPA 1K51A 1K52A 1WWVA 9ICNA 2MJDA 2G4SA 5KFNA 1NK8A 5CP2A 2I9GA 5TR5A 4KLEA 3APDA 3NVVA 4RUAA 4RCOA 3ZNZB 9ICUA 4QIWF 2YX8A 3KOOA 1P3QU 3GS2A 4USAA 3IRUA 4F4YA 1SGHA 4FFDA 3THVA 1L7MA 3BQ7A 3QU5A 4CCHA 3VDZA 3DWGC 4C80A 1V6EA 3D2SA 4F5OA 4B9MA 3AXCA 2DNFA 5KFJA 5J2AA 1CQVA 1ZQNA 2C5LC 3B2FA 2BKEA 2EELA 4I6NB 3ED5A 2N4FA 1PGXA 2EQYA 2FBWB 4HXDA 4UB2A 2N1RA 3W1SC 3Q2AC 3D2QA 1FNVA 1J2NA 3LB8C 2HOQA 2EAOA 4C8MA 2LASA 2KTQA 4C7ZA 2D10A 3F5AA 1S97A 2VZKD 1ZKHA 1V80A 8ICCA 1ZD2P 1EM7A 2CU3A 1DGSA 3C1YA 1GG3A 3KQ4A 2BTEA 2MA9B 3TBLD 3RB6A 1T0QC 3P4PB 4AYBC 4GFJA 2B6GA 1XCQL 1SIJA 2GI9A 2KACA 1WR6E 2WF9A 5J0PA 1OXJA 2V3SA 5J0YA 5KT3A 2ZCCA 1EU3A 4LLGM 2DZIA 4B95A 1L8OA 2WXOA 3SI8A 4RQ3A 4OVUA 1KL9A 2BQRA 2Y3AA 1ZETA 9ICIA 2VKQA 3HT3A 3AU2A 3ALBA 4P1BC 3TEYA 4OVZA 4B9LA 4MEXA 3Q8MA 4OHJA 3Q8KA 4KGSA 1YD8U 3WANA 2RGFA 2MAXA 4B9KA 4DL4A 2W8LA 1SKRA 1X9MA 3ZXVA 3SAGA 4DQIA 2RSUA 4JUZA 4DL2A 5T14A 3AE4B 4X5VA 1JUDA 1VZ7A 8ICRA 4LVSA 5C2TB 2ICIA 3TMPB 5FR3A 1U4BA 2DZKA 1R4NB 3FILB 4ICUA 1L2NA 2JEFA 2K6DB 2M0XA 4K4HA 2M19A 1BUIC 1GO3F 2Y9UA 4FULA 3AB5A 4K4GA 2V4RA 3HIZA 4MGKE 2LJ5A 2WLBA 4EBEA 1N48A 4C4VB 2PFQA 4G11A 1YZ7A 3AM9A 3QC8B 2EAPA 3AU5A 1JI7A 3Q3FA 2IOFA 1U49A 1R4MI 1SE4A 3APFA 4S17A 5KL1B 4B9VA 3PZ8A 3EWAA 1NYQA 5CRXA 3O0FA 4I28A 4OJPA 2BQUA 3DHGC 3TIXA 1L7YA 2FMPA 5D7GA 3KHLA 1TKGA 3GV5B 2HOIA 4KLHA 2AQ1B 4FXCA 4N9F4 3D6JA 3C2MA 2ZJDA 1ZQDA 2DBYA 2V0GA 2UVVA 1QLBB 3AEDB 4RFBA 4ECSA 2Y9TA 3NTUA 4OJ6A 3QJZA 2K8BA 3ONNA 2YEPF 5KT5A 4LNNA 5F3XB 4GSWA 4O1NA 4IDIA 7ICJA 4CDGA 1E6EB 1J19A 1NK6A 3PRPB 2PE6B 2WXPA 2EH9A 4PHEA 4J9MA 1U48A 2A1JB 2AHOB 1ZQHA 1WJNA 4ECVA 2KDBA 2O2VA 2LHTA 2RPQA 1AW7A 3H7SA 1NK4A 4AP9A 3S6JA 3PPAA 3Q3OC 3ZKJC 2WGSA 4OD0A 5KG6A 2WAQC 2Y5PA 2NVUI 4J9QA 2K22A 4KGRA 1G6JA 5ALHA 2WU2B 3AEGB 1P7DA 2D8CA 4RQ6A 4CE6A 1NK7A 1HXYD 4ICAA 4J9LA 1ESFA 1QF6A 2MP2B 3AECB 4DWIA 1QSYA 1JW9D
chains in the Genus database with same CATH topology
1YQ3B 2VZKB 1JROA 2EKIA 2LUMA 1EWCA 1RYJA 4B0EA 5G5GA 3LYYA 2WNMA 1SJED 1TZOA 4OZBA 1CZPA 3SFEB 4HJGE 1DOYA 1LO5D 4DXFA 1D5ZC 1QILA 1GAQB 2NTTA 3PZ7A 3W9CB 4DQOC 1T3QA 1I4PA 4RH6A 1J7CA 4TSSA 5GXGB 1EWYC 5D3DA 3T3NA 2BS4B 2BW2A 2INPE 1IUEA 1SB3C 1L5PA 1PGAA 5E6JA 3ZGZA 1N5WA 4YSXB 1CJEA 3TSSA 3NUHB 3BVZA 5FK9C 4H2AA 3NZ3A 2RDGA 1JWUD 1JWBD 2LHDA 2LEKA 1ET9A 1JWMD 2QILA 1RFKA 3U2SC 2PIAA 3IT4B 3R8BA 1HQRD 1XCTL 2ON8A 2QEJC 2X38A 4GDKB 2QIEB 1F2RI 1I7HA 2MJ3A 3V05A 3UI3A 4ARCA 1ROEA 2XN9C 2Y5CA 4LK0M 2WXLA 4XE0A 4HKQA 3WCQA 1V1OA 5D3IB 1D5MC 2RMMA 2K9XA 1K50A 3AE8B 2BS2B 2JYEA 3CWIA 1SEBD 2K5PA 2WXIA 4TQ1A 2CJNA 2DYMA 1C9FA 2L1AA 4UDUC 1DOXA 4HROA 3BK2A 2ONQA 1AN8A 1L6VA 2L83A 3BZDB 3P4RB 2E6XA 4N58A 3IT6B 2JSVX 2PTLA 2CJOA 1SXTA 1DYQA 2G9HD 3NRZA 2ZW0A 2WXQA 1N5XA 2R61A 4L2YA 1VLBA 2PKOA 1T5XD 1NYRA 1I4QA 4ITKA 3W5VB 3HRDD 1D6EC 1FXIA 1TY2A 2SEBD 4NAWB 5HFYA 3T3OA 1QOAA 2J42A 2G1EA 1FNUA 3Q8AA 3FILA 5AUIA 4US8A 5HHDG 5BYRA 2B76B 1TS4A 1YN4A 5C3JB 2N7JA 1WWTA 2QSDA 3TEZA 2MEKA 2V3NA 1N62A 1UUPA 3BIID 2JZPA 2D5GA 3PO0A 1KTKA 1FM0D 3DWMA 1E9MA 2TSSA 3R2TA 3AEBB 3BYYB 5EE3A 4IOIE 2QJLA 2JQRB 3P1MA 1ZE3D 2IGDA 3CIRB 1N61A 1SE2A 1JRPA 2JWUA 1SBBB 3EA6A 2K0PA 2BB5A 1PDXA 1QKZA 4NZLB 3U4EG 3LXFA 1SSNA 4OW0A 4R3DA 1YN3A 4EE2A 4MM3B 1JMLA 3AV8A 1N60A 1FMAD 2ACZB 2LJIA 4OZAA 1JALA 1HA5A 1MHHE 3ZJVA 1WYGA 3MJ5A 3N9YC 1ZP0B 1E7PB 1NENB 1UNSA 1V1PB 4YXDB 2N9LA 1YNTE 1Y56A 1YJIA 2J53A 4WIPA 2AQ3B 3MHZA 1B9RA 3HUIA 1KF6B 4A9AA 2FUG1 2KMMA 3IXSA 4KGTA 2HDEA 3AH7A 1YN5A 1FNWA 1C4PA 2OHFA 2H89B 3B9JA 1XLPA 3KWVA 1TS3A 1VRAB 3ABVB 3AE2B 3AE1B 3MC0B 4P16A 1EU4A 1CK1A 3C8YA 2WXRA 1STEA 4GDLB 3SEBA 1Q10A 2H88B 4WWMA 1SE3A 2PVOD 1E10A 2LFIA 3RFZB 3ETRA 1NVID 2ZW1A 4N59A 5HI1A 4D2KA 1TJEA 2MH7A 2GRIA 2KAJA 2W82A 4A8XC 3NVWA 4HEA1 2JU6X 1FO4A 5I4DA 1E0ZA 2W3SA 2I2YA 1XO3A 2PVGC 4YTPB 5EE1A 5BMIA 3GP7A 1MVKA 2WDVB 4RNAA 3B2GA 1GB4A 3R2IA 1F2RC 4XDCA 4N6EB 1M4VA 5EE9A 1NEKB 3L4PA 2V4IB 3IAS1 1JWSD 1QQRA 2RDHA 3P63A 3W2DA 4XDDA 4Q2JA 1WRIA 1NI3A 1XEEA 1WSPA 3P4SB 1TY0A 1OQRA 2LMCA 2WU5B 2Z8LA 3OWEB 1C78A 1P7EA 4XWTA 1KLGD 2IPKD 3ZJUA 2NMQA 2QMTA 1PYWD 4RGOS 3IAM1 3U7ZA 4JWUC 4ZOHC 2IGHA 4RGNA 2N0SB 1VR9A 2V3PA 4YT0B 4GLSC 4ZHPA 5BMHA 1QT9A 2PW9A 1L4DB 4NAMA 1AYFA 2XNAC 3FC4A 1ENFA 1TS2A 4OZCA 2DLBA 3VR8B 1YQ4B 3Q69A 1VZ8A 1K53A 2SAKA 5T8IA 5H92C 1TKEA 2J4XA 1GB1A 1SJHD 4NJCA 1L4ZB 2L52A 1I4XA 1KH0A 1GOZA 4WURA 4KX6B 4WAFA 1ACCA 1FRDA 3KWLA 4L1BA 5LNK1 2DWQA 1ZPSA 1MHXA 1SF0A 1F0ZA 1UWXA 4KKIA 1XXGA 3I9V1 1YMHE 1P7FA 3BVMA 2AQ2B 1JWAD 4ZHOA 2M56B 1C79A 1I4GA 4WH4A 1A70A 3SR6A 1KRHA 2WXKA 1ZUD2 4JE3B 1TYGB 3V3XA 1UWMA 1FCCC 1HEZE 2BB6A 4YSZB 1V97A 1C77A 1V8CA 1I4RA 1VJKA 3AMZA 1ZDVA 1IGDA 4MH8A 1J7AA 1JQ4A 3VQIA 3BWUD 3H8HA 3AE5B 4RGMA 3BYTB 5FKAC 2WXGA 3W1SA 1C4AA 1KLUD 1FXAA 1QOGA 2KQ4X 3NS1A 4YTNB 4IKGA 3HVDA 3P42A 3AE9B 2HTME 1DGJA 2BS3B 5TSSA 3E9SA 4YSYB 1ZXIA 4ZRPA 1FCLA 1K51A 1K52A 1IBXA 1QOFA 1QOBA 3Q8BA 2MJDA 1T6BX 3U52E 3URYA 3EUB2 2WP9B 3W5UB 3NVVA 1ZXHA 4RCOA 3O13A 3FAHA 2OEDA 3GS2A 4JWSC 5BYQA 3TEXA 3E56A 4USAA 1VZ6A 1L0YB 1BXTA 3AE6B 3Q8CA 4B0MA 1OFFA 2WXFA 3DWGC 4C80A 3BK1A 3VRAB 1IGCA 3EGRA 1ZOYB 1RM6C 1D4BA 2RPVA 1CQVA 2IJ0A 4US9A 3B2FA 2EELA 1IBXB 3AN1A 4C7YA 2W3RA 1PGXA 2YEPB 2FBWB 3NVZA 1OQQA 5JXVA 3RPFC 1AWDA 1FNVA 3LB8C 3J9CA 1L0XB 2I38A 3AE3B 4C7ZA 2JXTA 1FRRA 2VZKD 3I57A 3KLSX 3BVGA 2BYTA 1EM7A 4MT5A 2CU3A 5AUKA 2LHEA 1B1ZA 3KQ4A 3MP9A 2BTEA 1GPXA 1YJJA 2WDQB 4MACA 1BMLC 4WQMA 3P4PB 4RGTA 1XCQL 2GI9A 5G5HA 1SIJA 1C76A 2KACA 1ZDXA 1XF5L 2WXMA 3TUOA 1DOIA 5HG2A 2AX5A 2K3UA 4RF0A 4P6VF 1EU3A 1PFDA 4LLGM 2Q5WD 2WXOA 2N9KA 2BT6A 2Y3AA 2W55A 3TEYA 1XLOA 4OVZA 1XLNA 4A55A 2M0AA 4M0WA 4JPSA 4OHJA 1L0VB 2DYOA 4KGSA 2JX5A 5BMGA 2GB1A 4L23A 1N63A 2KDMA 3AEEB 3ZJTA 1FIQA 3ZQ4A 1F77A 4ZRQA 3AE4B 2E3TA 1VZ7A 1C4CA 4YWGG 5C2TB 2ICIA 5FR3A 2WXJA 3NVYA 3P4QB 3AE7B 2BBCA 3FILB 1FEHA 4PT5A 4KKJA 1JCKB 2PLPA 2KWDA 2PMVA 2M19A 1BUIC 1MPEA 3AB5A 1HZ5A 5BYSA 4ARIA 3Q8EA 4YTMB 2J52A 2LGIA 3GB1A 1FD6A 1KFYB 2WLBA 4AS1A 4A6QA 4JX1C 1MI0A 2FE8A 5EE0A 2W54A 1WGKA 1VDVA 4C56C 1HZ6A 4CQNA 1D5XC 3AM9A 1UGJA 4TMAB 4XWWA 1FFUA 1SE4A 4TQ0A 4LTUA 3PZ8A 1NYQA 2KN4A 2IDYA 2WQYB 1L6UA 2WXNA 3AEAB 4HRSA 1V1PA 3SFDB 5D7GA 4DXGA 1TKGA 2AQ1B 4ZYSA 4FXCA 2IGGA 3VR9B 3AEFB 1WXQA 2DBYA 2V0GA 1QLBB 3AEDB 2WS3B 4RFBA 1TKYA 4HKZE 2YEPF 4RF1A 2NTSA 4O1NA 4IDIA 4AQ7A 2INNE 4REZA 4J3OD 1E6EB 5MPOA 1RWSA 2WXPA 3TEWA 2WDRB 4A90A 1AW7A 3Q8FA 1J7BA 1FFVA 1PGBA 3HVZA 1ET6A 1TS5A 5H8YE 2Y5PA 1I4HA 2K22A 3MFGA 4KGRA 1XLQA 2WU2B 2WXHA 2JYTA 3AEGB 3VRBB 3ZYYX 1PUTA 1HXYD 1QF6A 1ESFA 2MJEA 3AECB 2L32A 1R7SA 1JW9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  1SIJ A;  5G5H A;  1YQ3 B;  1DOI A;  1PDX A;  1JRO A;  3LXF A;  2EKI A;  2AX5 A;  2L52 A;  1RYJ A;  5G5G A;  4P6V F;  1PFD A;  2Q5W D;  3AV8 A;  1N60 A;  1FMA D;  2ACZ B;  1CZP A;  1JAL A;  2BT6 A;  3SFE B;  2W55 A;  1DOY A;  1WYG A;  4KX6 B;  1XLO A;  1XLN A;  1ZP0 B;  1E7P B;  1NEN B;  1FRD A;  1GAQ B;  3KWL A;  1L0V B;  4YXD B;  3W9C B;  1T3Q A;  2JX5 A;  1J7C A;  1YJI A;  2DWQ A;  1N63 A;  5GXG B;  1EWY C;  3AEE B;  1B9R A;  3HUI A;  1KF6 B;  1FIQ A;  1SF0 A;  1F0Z A;  4A9A A;  3AE4 B;  2BS4 B;  2KMM A;  2E3T A;  1JWA D;  1IUE A;  1L5P A;  1SB3 C;  2M56 B;  3AH7 A;  5C2T B;  4ZHO A;  1A70 A;  1N5W A;  3NVY A;  1CJE A;  3SR6 A;  1KRH A;  2OHF A;  2H89 B;  3B9J A;  3AE7 B;  3P4Q B;  1XLP A;  1ZUD 2;  1TYG B;  3AE2 B;  3AE1 B;  3ABV B;  1UWM A;  1JWB D;  4YSZ B;  2M19 A;  1V97 A;  2LEK A;  1V8C A;  1VJK A;  3AMZ A;  3AB5 A;  2H88 B;  1RFK A;  1J7A A;  4WWM A;  1JQ4 A;  2PIA A;  2PVO D;  4YTM B;  1E10 A;  3AE5 B;  1KFY B;  2WLB A;  1QOG A;  1FXA A;  2QIE B;  4YTN B;  3NS1 A;  3ETR A;  1NVI D;  4JX1 C;  1I7H A;  2MJ3 A;  4N59 A;  5EE0 A;  2W54 A;  1TJE A;  2MH7 A;  1ROE A;  1WGK A;  3AE9 B;  1VDV A;  1DGJ A;  2BS3 B;  2HTM E;  2Y5C A;  4YSY B;  3AM9 A;  2KAJ A;  1ZXI A;  3NVW A;  1FFU A;  1FO4 A;  1E0Z A;  1QOF A;  2W3S A;  1QOB A;  4LTU A;  3WCQ A;  2MJD A;  1XO3 A;  1NYQ A;  2PVG C;  4YTP B;  5EE1 A;  2K9X A;  3AE8 B;  2BS2 B;  2WQY B;  3EUB 2;  3CWI A;  1L6U A;  2K5P A;  2WDV B;  2WP9 B;  2CJN A;  3W5U B;  3NVV A;  3B2G A;  3AEA B;  4HRS A;  3SFD B;  3FAH A;  1DOX A;  4HRO A;  1TKG A;  4FXC A;  4JWS C;  1L6V A;  2L83 A;  3P4R B;  4USA A;  3VR9 B;  3AEF B;  4N6E B;  4N58 A;  4YSX B;  1WXQ A;  5EE9 A;  1NEK B;  3L4P A;  3AE6 B;  2CJO A;  2DBY A;  1OFF A;  3DWG C;  1QLB B;  3AED B;  4C80 A;  3VRA B;  2WS3 B;  3NRZ A;  3P63 A;  1N5X A;  1TKY A;  1VLB A;  2PKO A;  1ZOY B;  1RM6 C;  1NYR A;  1WRI A;  4IDI A;  1NI3 A;  4ITK A;  3P4S B;  1OQR A;  2WU5 B;  4US9 A;  3HRD D;  1FXI A;  3B2F A;  3W5V B;  1E6E B;  1QOA A;  5MPO A;  3AN1 A;  4C7Y A;  1RWS A;  2G1E A;  2W3R A;  4JWU C;  5AUI A;  4ZOH C;  4US8 A;  3NVZ A;  2B76 B;  1OQQ A;  2FBW B;  2N0S B;  2WDR B;  5C3J B;  4YT0 B;  1WWT A;  3RPF C;  4ZHP A;  1AWD A;  1FFV A;  1J7B A;  1QT9 A;  3LB8 C;  3BII D;  1N62 A;  3HVZ A;  3PO0 A;  3AE3 B;  4C7Z A;  1AYF A;  5H8Y E;  1FRR A;  3FC4 A;  1FM0 D;  3DWM A;  1E9M A;  2K22 A;  5AUK A;  1XLQ A;  2CU3 A;  3AEB B;  2WU2 B;  3VRB B;  3AEG B;  5EE3 A;  3VR8 B;  3ZYY X;  1YQ4 B;  1GPX A;  2QJL A;  1PUT A;  2JQR B;  1YJJ A;  3P1M A;  1QF6 A;  3CIR B;  1N61 A;  2MJE A;  1TKE A;  2WDQ B;  3AEC B;  4WQM A;  3P4P B;  1R7S A;  5H92 C;  1JW9 D; 
#chains in the Genus database with same CATH topology
 4RZR A;  2IBK A;  3IM1 A;  1YQ3 B;  1JRO A;  1TT5 B;  2EKI A;  4UAW A;  1EWC A;  2LUM A;  2WDT B;  2HBK A;  4GIB A;  4FJY A;  3NGD A;  2ZIW A;  4I2B A;  1TZO A;  1WMH A;  4HJG E;  4TUQ A;  1KFD A;  9ICT A;  1C1Y B;  3M3J A;  2BKF A;  4M9L A;  4ZH4 A;  3PZ7 A;  2H5X A;  4DSF A;  1T3Q A;  4DQO C;  3KBB A;  3QX7 A;  7ICQ A;  2MBB B;  4KLQ A;  1ZRN A;  3QZ7 A;  2KFZ A;  5DGA A;  1Y8R C;  3OJ3 A;  2BZF A;  3T3N A;  2R8J A;  2BS4 B;  3N1Y C;  4QWC A;  4Y2X A;  1IUE A;  1L5P A;  2UYZ B;  4YQW A;  2MBO A;  1KFT A;  3N3K B;  2KWU B;  4XA5 A;  2DQN B;  3NZ3 A;  1HUO A;  1O03 A;  1Z1B A;  8ICQ A;  3RT3 B;  5DPW A;  4NLC A;  1F1H A;  2HE7 A;  3PVL A;  4YCX A;  2QKQ A;  1JWM D;  2ASJ A;  1RFK A;  3UQ0 A;  3ICX A;  4P0P B;  3MC1 A;  3PSP A;  3A1Q B;  4ED3 A;  1XCT L;  3WA0 A;  2QEJ C;  2X38 A;  4GDK B;  4IM0 A;  2MBE A;  2MJ3 A;  2MCN B;  2ODG A;  5ALW A;  1S0V A;  3GFK B;  4WWP A;  4M01 A;  2D11 A;  2M17 A;  2XN9 C;  4FAD A;  4DSL A;  1COK A;  3L0W B;  4DWF A;  2R2O A;  3IG8 A;  2UVU A;  1TK0 A;  1CRX A;  4EUT A;  4HKQ A;  4KVG B;  3L5K A;  3WCQ A;  1V1O A;  4JV2 A;  2KKV A;  2MU2 A;  3QUC A;  4EX7 A;  1K50 A;  2D3C A;  2BS2 B;  1T0R C;  3AE8 B;  2JYE A;  4K7S A;  3EPI A;  2CRX A;  3HWT A;  2WXI A;  3C2L A;  3L10 B;  2DYM A;  2MUT B;  4FZM A;  4MEY A;  3BK2 A;  1P1A A;  4NLZ A;  1YZ6 A;  7ICP A;  4P0Q A;  2DAJ A;  1WGY A;  4DHZ B;  1ZQY A;  4N58 A;  2K8B B;  5GTI U;  9ICX A;  4XUS A;  2QC8 A;  4F7Z A;  2HTH A;  2G9H D;  1K8R B;  3UXO A;  1N5X A;  2JV3 A;  5KFW A;  3PMN A;  4ED8 A;  2ESE A;  3ZDT A;  4WJO A;  4QZI A;  2LI5 A;  2Y5B B;  3Q3J A;  5DBB A;  2AGQ A;  5HFY A;  2LRU A;  1KLV A;  1ZD4 A;  1WGH A;  2J42 A;  2ZTC A;  5D2M B;  1FNU A;  3Q8A A;  4NJ6 A;  4DLG A;  5AUI A;  5BYR A;  5HHD G;  2K89 A;  4PYU A;  5J2K A;  1TS4 A;  1YN4 A;  3WAO A;  2NPT A;  2K4I A;  4IRC A;  4KMU A;  2E5S A;  5AKJ A;  1Z4O A;  4KLG A;  2BGF A;  4F4K A;  2LXC A;  4WWN A;  4JV1 A;  3V61 A;  4UQG A;  3PML A;  2Z0D B;  2OWO A;  3SZ2 A;  2KVC A;  2IZV B;  5A0L A;  5EE3 A;  2N7E A;  3PRM B;  3IN5 A;  2JQR B;  4BAX A;  2NRT A;  4M0W B;  8ICH A;  5H2F U;  1SE2 A;  3NS8 A;  4DS5 A;  3U30 A;  4PZO A;  2NRZ A;  2BB5 A;  3U4E G;  3V6C B;  4F5P A;  4FBT A;  4OW0 A;  5KG4 A;  4UAZ A;  4MM3 B;  1JML A;  4I6L B;  3AV8 A;  1N60 A;  4URK A;  3PW5 A;  4OZA A;  1JAL A;  3Q14 C;  1KRP A;  3HW8 A;  5J0R A;  1WGR A;  4QZH A;  3N9Y C;  1NEN B;  4UAR A;  4EBC A;  1UNS A;  4YXD B;  4OJL A;  4WIP A;  2OCE A;  4EEN A;  5DPS A;  5IO9 A;  3LDA A;  4EBD A;  2C9W B;  4OO1 J;  1Z4N A;  1MQ2 A;  2FMQ A;  3NZU A;  2FUG 1;  4PS7 A;  2KMM A;  3IXS A;  3QAQ A;  4GU2 A;  4KGT A;  1YX5 B;  1YN5 A;  4QZ8 A;  1NKE A;  2RR9 A;  3VH4 B;  5C1Z A;  3KWV A;  3HM6 X;  1LGR A;  1Y88 A;  5JHB A;  5IIM A;  3C8Y A;  1LKY A;  3V7K A;  1WH3 A;  3H7P B;  3QUQ A;  2W9A A;  2J0J A;  4BBN F;  2H88 B;  3K9O B;  2XGP A;  2W7P A;  1PVP A;  2BYF A;  3HPO A;  2PPH A;  4N59 A;  1NVI D;  1P0R A;  2ZW1 A;  4D2K A;  2W7O A;  2MBH A;  2R8I A;  2HHQ A;  2KDE B;  3N7S C;  2YQE A;  4MEM A;  4R66 A;  1KW4 A;  2PMZ F;  2M0N A;  3GE3 C;  5J0U A;  4HEA 1;  2JU6 X;  3DDC B;  2K8A A;  2FUH B;  1QCK A;  2W3S A;  3DCG A;  4MGY E;  3GQC A;  2AXT U;  1GJZ A;  3GIJ A;  4DLE A;  1Z19 A;  3N32 A;  3RAQ A;  3Q8R B;  2FPL A;  4ZDV A;  5J2I A;  1GB4 A;  3RR7 A;  2K60 A;  5G55 A;  4XDC A;  9ICJ A;  3HK0 A;  2N1W A;  4ED2 A;  4R64 A;  5FP0 A;  3ZD8 A;  3IAS 1;  5EWG A;  1U9L A;  1JWS D;  4G0N B;  5AM2 A;  2V4Q A;  4ICV A;  4I2G A;  1CMX B;  4RPY A;  3GZF A;  5J8Y C;  4DFJ A;  4EZ9 A;  2RDH A;  2R8G A;  4LJO B;  3U8Z A;  3W2D A;  4XDD A;  2L3Z A;  2KVZ A;  4DSK A;  4YXJ A;  1WRI A;  4UAV A;  2PFN A;  1WSP A;  2KDF B;  1P7E A;  3RNC C;  4QW8 A;  3MR6 A;  2KIV A;  2NMQ A;  3U7Z A;  3IAM 1;  2GOW A;  4EZL A;  1TE2 A;  1BVS A;  4ZOH C;  5AKX A;  2N0S B;  3TKA A;  1SL1 A;  2N9P C;  5BMH A;  9ICG A;  4F92 B;  4P7I A;  5AKY A;  3PX4 A;  2PW9 A;  3EEC A;  5KFC A;  2K25 A;  2KZM A;  3FC4 A;  4F5N A;  3QA8 A;  4BKT A;  1ZQM A;  4Q43 A;  2JEJ A;  5ALT A;  2LMR A;  1KEJ A;  2HOF A;  5J2C A;  5H92 C;  3UF8 A;  5ALG A;  4ASW C;  3SD7 A;  3WKA A;  2LGX A;  4WWO A;  3DBS A;  1MFW A;  1OGW A;  1GOZ A;  2MRL A;  4WUR A;  1I35 A;  1QSL A;  2KD1 A;  2BWF A;  1FRD A;  4DBG A;  1JIH A;  4L1B A;  4KLS A;  2DWQ A;  3MJW A;  1ZPS A;  5E79 U;  5J18 A;  4YR3 A;  2EAN A;  4CGZ A;  4RT2 A;  4KKI A;  3L08 A;  4DFK A;  2KE7 A;  1UF0 A;  1YMH E;  2LVO A;  2AQ2 B;  3OLM D;  3SD5 A;  2KC1 A;  4ZHO A;  4DHZ E;  2YTU A;  4ELV A;  2FPK A;  1A70 A;  4G9B A;  2AQ4 A;  2AJQ A;  3JPO A;  1ZUD 2;  3V3X A;  4BOZ B;  2JPH A;  2JUO A;  4NQK E;  1WE7 A;  2QB1 A;  2MBQ A;  1I4R A;  4PGX A;  3QK0 A;  2C2E A;  5J2F A;  4K4I A;  3AE5 B;  4FA6 A;  2FIF A;  5FKA C;  2WXG A;  2UVR A;  1MG4 A;  4MHV A;  1H8C A;  1QOG A;  3RYT A;  2KQ4 X;  3R9K A;  3PW4 A;  1SE9 A;  2MRP A;  4R8U B;  5KT7 A;  3UQ2 A;  3HVD A;  3X23 A;  5AIC A;  2GBK A;  2FDR A;  4C4T A;  2ZG6 A;  1DGJ A;  2HTM E;  4GIV A;  2N1V A;  2KJ5 A;  1VJ5 A;  5CJ7 A;  1UA1 A;  1FCL A;  3SEI A;  2ISO A;  1S1Q B;  5J0T A;  2KTR B;  5KNI A;  1RAX A;  2FNJ B;  1QOF A;  1QOB A;  2KD0 A;  1SKS A;  3A33 B;  2KOB A;  1A6S A;  1T6B X;  1RXV A;  4BXO A;  2PXI A;  1WX8 A;  3RZF A;  2JEG A;  3H0R B;  2J0K A;  3N7R C;  2FE9 A;  3EUB 2;  3URY A;  3HX0 A;  1UA0 A;  2K6Q A;  1ZXH A;  5KG2 A;  5EDS A;  2DEN B;  4P4O A;  4Y2V A;  2OED A;  2EDU A;  3M8R A;  1SIF A;  1D8L A;  2KIW A;  1VZ6 A;  1H38 A;  8ICU A;  5KG1 A;  1BXT A;  4JWM A;  1UPH A;  3E0F A;  2BHN A;  5CWR A;  3RH5 A;  1OFF A;  2WXF A;  3ISD A;  4F50 A;  2FLN A;  3JSV B;  1IGC A;  4JWN A;  4O9M A;  1F5S A;  4QZD A;  3F2D A;  3IVF A;  1IYF A;  2EMS A;  3OG5 A;  2ZPN A;  1RM6 C;  3OPX A;  1D4B A;  1TFR A;  4QZF A;  2KMA A;  4NJ8 A;  3RF9 A;  1ZQX A;  2BCR A;  7ICT A;  2LKY A;  3SQI A;  9ICW A;  1IBX B;  5IOI A;  2WAQ F;  3ZRF A;  2W3R A;  2IOH A;  3M62 B;  4DL3 A;  3PW2 A;  3NVZ A;  5JXV A;  1ZD5 A;  5DQI A;  1ZQL A;  5ALU A;  1BNP A;  3RPF C;  3DEE A;  2WWZ A;  4O0I A;  2VJ5 A;  2HHT A;  3J9C A;  5ALK A;  2O2V B;  2MA1 A;  4ZYN A;  2HJ8 A;  3A9K A;  3N4M B;  5AUK A;  2OJR A;  4M0A A;  1HUZ A;  4F91 B;  3PR4 A;  1N56 A;  5E6N A;  4MAC A;  2CXY A;  4NLB A;  3RJI A;  4RGT A;  5G5H A;  1C76 A;  2M4N A;  3MFI A;  4BWJ A;  1DOI A;  5III A;  4JB3 A;  4ANV A;  1D9F A;  4FE3 A;  2AX5 A;  3OGU A;  1HJP A;  4O5E A;  4CO7 A;  4DOB A;  5BPC A;  1OUQ A;  2IHN A;  1ZQQ A;  3ZDB A;  2HW3 A;  2KWV B;  2UWQ A;  3Q3N C;  5CX3 A;  2NRX A;  4Q8F A;  3OAW A;  4A55 A;  4JPS A;  1L0V B;  5BMG A;  2B0C A;  3KZX A;  5IIN A;  2GB1 A;  1N63 A;  1DXS A;  2KDM A;  3OHB A;  5ALZ A;  1XC9 A;  3AEE B;  3HIL A;  2Q4T A;  4PS3 A;  3ZQ4 A;  5C5J A;  1X1M A;  2R8H A;  2C7N B;  4W9I A;  3GDX A;  3R3M A;  2CN1 A;  2B3A A;  4YWG G;  3RR8 A;  4YP3 A;  2GMI C;  3HKZ F;  2ZIX B;  2BBC A;  2CHZ A;  3RZW C;  1QTM A;  4KMO B;  2KWD A;  2KO3 A;  7ICE A;  1ZQ1 C;  4CF3 A;  1MPE A;  1T4G A;  3KUD B;  1HZ5 A;  3VUW A;  4XX5 A;  4F8C B;  2INC C;  3RNB C;  5BYS A;  2JXX A;  4ARI A;  2MX2 A;  1NI2 A;  3K75 D;  1IP9 A;  2LM4 A;  3BQ2 A;  2FID A;  4I2F A;  3L54 A;  4DO9 A;  4A6Q A;  2PEA A;  1NJX A;  5KFR A;  4HAI A;  2JVC A;  5AI9 A;  1EF1 A;  2FE8 A;  2W54 A;  4KV2 A;  4IL6 U;  1J2M A;  4P0P A;  2QCZ A;  4C56 C;  4BX9 C;  1UGJ A;  3QEB Z;  3QCA A;  3ZDA A;  4TMA B;  1BPZ A;  4XWW A;  2IOF K;  3IV6 A;  4CNQ A;  2BPS A;  1L3U A;  2DF4 B;  2CHX A;  4YL8 A;  2V9W A;  4TQ0 A;  3VUX A;  4HCN B;  2DFL A;  4DOC A;  2WQY B;  1EUV B;  3TAP A;  5L1I A;  3TAD C;  1V1P A;  3SFD B;  1WUD A;  1L7P A;  2KHQ A;  3QAR A;  2NBV B;  4BWM A;  4WJQ A;  5EWF A;  1WXQ A;  4GXK A;  3V6J A;  2UU7 A;  1HE8 A;  2F3N A;  2G45 B;  2A19 A;  1PK3 A;  3FYH A;  2G09 A;  2WS3 B;  5KFG A;  4RNM A;  4P0Q B;  1UCV A;  2ZIV A;  4DQP A;  4LZD A;  1QH9 A;  9ICQ A;  3UIO B;  1Q3U A;  4RF1 A;  2KNB A;  2CR5 A;  4AQ7 A;  2VA2 A;  2JRI B;  1ZQP A;  2KFJ A;  4REZ A;  3BQT A;  4RQM A;  3AL0 B;  4IWQ A;  5MPO A;  1RWS A;  3R7R A;  3CW2 C;  2JZB B;  3SAF A;  3PST A;  2KOX A;  7ICS A;  1J7B A;  4UB5 A;  1X42 A;  5KTQ A;  1SXE A;  1JXE A;  3H7I A;  4ECY A;  1T0S C;  1TS5 A;  3ML8 A;  2W11 A;  4DXA B;  3MFG A;  2BYE A;  4PHA A;  4IS7 A;  2WXH A;  3VRB B;  4IWP A;  1DK3 A;  4EFO A;  2WTF A;  3DVG X;  2HSZ A;  1R7S A;  3B0A A;  3SHQ A;  3ZRC A;  2BKR B;  1Q1O A;  3NRW A;  1NKB A;  1H4R A;  4B0E A;  1RYJ A;  5G5G A;  1RFA A;  2WNM A;  4ECX A;  1ZJN A;  3IG5 A;  4OZB A;  3U7D A;  5KFH A;  2AH5 A;  1ZD3 A;  4KLD A;  1CZP A;  2DUY A;  2GWS A;  3TQ1 A;  3KYC D;  1DOY A;  1X9S A;  1D5Z C;  3V6E B;  1GAQ B;  4W9E A;  4NL9 A;  4I2D A;  4MM3 A;  2K8C A;  3W9C B;  4RH6 A;  3ZDE A;  3A9J B;  3DBH B;  4C4S A;  1EWY C;  2ZNV C;  1QQ6 A;  2CS4 A;  1S3S G;  4WQO B;  3VTV A;  5DB6 A;  3LWL A;  4F5Q A;  3DBR B;  4IRD A;  4IQU A;  3OJU A;  2INP E;  4EEK A;  3VFK A;  3T3F A;  3MC8 A;  3CMM B;  1ZQZ A;  3NUH B;  5FK9 C;  4LCD E;  1RPL A;  2MUT A;  1NZP A;  4GXJ A;  2J7Q B;  1C20 A;  3QX1 A;  2G5H B;  4G50 A;  2EZY A;  1SL2 A;  5J2H A;  4W9H A;  4C8L A;  4GOC A;  5LLI A;  4PJ0 U;  5JH5 C;  1BPX A;  3WK8 A;  4ACF A;  2PIA A;  3QQ8 B;  2Z0E B;  5DBA A;  1HQR D;  3QU2 A;  2LUE A;  4OJ5 A;  4O3P A;  4NV0 A;  2PFO A;  3UI3 A;  4XQ8 A;  3ZNH B;  2Y5C A;  5KFB A;  5LXI B;  4XE0 A;  3BS7 A;  7ICV A;  2M9N A;  4QWB A;  4RU9 A;  4TUR A;  5D3I B;  5DCN A;  5AEK B;  4JMU A;  4YG2 A;  2JEI A;  3CWI A;  2K5P A;  4OVV A;  2FLP A;  4NLG A;  2CJN A;  2L1A A;  3H8S A;  4BVU C;  2XCP A;  1E7U A;  2L83 A;  3BZD B;  5ALL A;  4DK5 A;  3MGH A;  5KFX A;  4FBJ B;  4O3O A;  4U6P A;  3IT6 B;  2JSV X;  2PTL A;  3KHG A;  3GIK A;  1DYQ A;  2ZTE A;  4M02 A;  3ZD9 A;  3NRZ A;  5KFZ A;  2W43 A;  3MGI A;  3G6Y A;  1VLB A;  4L2Y A;  4NPN A;  2KMC A;  1LXD A;  4UB3 A;  2CKH B;  7ICG A;  1X6I A;  4XYC A;  5KFT A;  4E74 A;  2W04 A;  1ZQU A;  3TAC B;  4TQS A;  1D6E C;  1FXI A;  4NNJ B;  1TY2 A;  4NAW B;  3T3O A;  1P98 A;  3RJK A;  4HDO A;  4LNI A;  1E8X A;  3FIL A;  3V7L A;  5EOZ A;  3P2B A;  4J03 A;  4DHJ B;  4IM2 A;  2J6U A;  3Q8S B;  2YLM A;  4M9H A;  2QSD A;  4DS4 A;  5AM1 A;  3RB4 A;  2KNJ A;  2V3N A;  2FI1 A;  2JZP A;  2D5G A;  4M8N A;  3C21 A;  4ED1 A;  3R2T A;  3JPR A;  1YJ1 A;  2WYQ A;  3BYY B;  3GIM A;  5E6O A;  3KUC B;  2WF7 A;  4EYH B;  3P1M A;  4Y2Q A;  1WYW B;  4HPP A;  5AKK A;  5CHW A;  4YMM A;  2JWU A;  1SBB B;  2ASQ A;  3PR5 B;  2K0P A;  4KN7 A;  5B66 U;  5DG7 A;  1S10 A;  1OEY A;  1N6Z A;  1SSN A;  1F0M A;  3H7P A;  3LXF A;  2ZJA A;  3T5H A;  4O3N A;  4K3B A;  1SXD A;  1NNL A;  5J0O A;  1HA5 A;  1M94 A;  2NR2 A;  3ZJV A;  2DPI A;  3MJ5 A;  1V1P B;  8ICZ A;  1YNT E;  1Y56 A;  5KFD A;  2CU1 A;  3T79 A;  7ICR A;  1BPE A;  4YD2 A;  1DRG A;  5ALD A;  1Z00 A;  4AUQ C;  3HHM A;  4A3O A;  1TGZ B;  4RPX A;  2G3Q B;  2KX3 A;  4YFK A;  4NY8 A;  3DBR I;  1FNW A;  1B4F A;  1NK9 A;  1C4P A;  5AZF A;  2H89 B;  3LYS A;  2XCA A;  3C5G A;  8ICX A;  2AWT A;  3AE2 B;  1SV0 C;  4J9R A;  3ABV B;  3AE1 B;  3MC0 B;  4P16 A;  3L17 A;  4DL7 A;  1CK1 A;  3AUO A;  3C28 A;  4AYB F;  5KT4 A;  5CR0 A;  2FJ6 A;  2L00 B;  1TAQ A;  3EC8 A;  3H40 A;  4GDL B;  4IC9 A;  5IIL A;  5AKI A;  3RFA A;  1KM7 A;  1SE3 A;  2KFK A;  2PVO D;  1E10 A;  3WK9 A;  4DFP A;  1PVQ A;  2KTF A;  5HI1 A;  2MH7 A;  2HBM A;  2HHU A;  5IN7 A;  2ES6 A;  5AHX A;  3WK5 A;  4AP4 C;  4ANW A;  5J2D A;  8ICB A;  3PV8 A;  2BQQ A;  4JLC A;  4A8X C;  1PUZ A;  3JPQ A;  1E0Z A;  2YN4 A;  4BDP A;  2ZJ5 A;  2F76 X;  3IHQ B;  2XY7 A;  2M1M A;  3GP7 A;  1J0G A;  3MR2 A;  1E90 A;  4RNA A;  1KJT A;  5KFU A;  3LK9 A;  3VTW A;  4RQ7 A;  2ASD A;  3AUL A;  5CB1 A;  1R4M B;  2IMW P;  3JVZ X;  2IO0 B;  4KLI A;  4XRH A;  4PS8 A;  2V4I B;  1QQR A;  2AQ0 A;  2D3D A;  1SL0 A;  4IW0 A;  5ALV A;  3WU2 U;  4IRK A;  1FEZ A;  3BZC A;  2ZUB A;  5DQG A;  1RZT A;  3MAB A;  1FPY A;  1PQS A;  1WXV A;  5KG7 A;  3DOW A;  2J6S A;  1XEE A;  2LMC A;  2JMG A;  1RYU A;  1C78 A;  2IPK D;  4YR2 A;  5KHQ A;  4RGO S;  5HHI A;  3WAL A;  3DVG Y;  3ZDM C;  2IGH A;  4RGN A;  4EZ6 A;  5HMM A;  4Z6D A;  4GLS C;  1Z1V A;  4BGD A;  3AU6 A;  1QT9 A;  2BCV A;  4NAM A;  4M9G A;  1AYF A;  4EEW A;  1WCL A;  3VH3 B;  4IM3 A;  7ICK A;  3TJP A;  2JR5 A;  3H4B A;  1O08 A;  3SV4 A;  1YQ4 B;  3Q69 A;  4LNO A;  5T8I A;  2ZTD A;  1TKE A;  4NM1 A;  1XT9 B;  5ALY A;  2Q0Z X;  5AKG A;  4PGY A;  4TV3 A;  3H8W A;  5ALI A;  1L3S A;  1SJH D;  3GZN I;  1L4Z B;  2LM1 A;  1WGD A;  2ISP A;  3RUL A;  2FCN A;  3UXN A;  1KH0 A;  3SAH A;  3H4D A;  1WG8 A;  4KX6 B;  3PRZ A;  4WAF A;  5IIK A;  1ACC A;  2EZZ A;  3BS5 A;  4KZ0 A;  4QIW C;  3SYZ A;  4FHK A;  3LVV A;  2P6U A;  3WKC A;  1SF0 A;  4LJX A;  1XXG A;  1P7F A;  1YOV B;  5ALN A;  3OHA A;  1IXR A;  5L95 C;  1JWA D;  2KHW B;  2JH7 A;  1C79 A;  2KDI A;  4WH4 A;  1HIW A;  1NJZ A;  1KRH A;  4DSE A;  4IG7 B;  4PYZ A;  2L7R A;  1SWV A;  2V4L A;  9ICV A;  4KLU A;  3L16 A;  1HEZ E;  1WR1 A;  4ACO A;  4UBC A;  1GUA B;  3ML9 A;  3AMZ A;  1ZDV A;  3WK4 A;  3G6V A;  3VQI A;  2IO3 B;  3QZ8 A;  8ICP A;  8ICN A;  4K1R B;  4RGM A;  4FO6 A;  8ICW A;  1C4A A;  1K1S A;  1CEZ A;  1A5R A;  3NS1 A;  2W9B B;  3RMK C;  2E8N A;  2LYH A;  2A4Z A;  2MHJ A;  5TSS A;  2D07 B;  4W9L A;  4II2 B;  1ZQO A;  2FAZ A;  4I27 A;  1ZXI A;  4RT3 A;  7ICU A;  4P1C C;  1OW5 A;  8ICO A;  2HBJ A;  3Q8B A;  2JGA A;  4Z6E A;  1P9D U;  3UQA A;  3RJJ A;  2N9X A;  5KFY A;  4HLE A;  3PW7 A;  2MSE D;  3W5U B;  4LZG A;  5GMV A;  4GMV A;  5AI8 A;  3FAH A;  3H9D A;  4B9N A;  5KG0 A;  1RLF A;  3A9K B;  2G5I B;  5BYQ A;  4RNN A;  3TEX A;  3E56 A;  5AIA A;  1ZQF A;  4E71 A;  3ZI4 A;  2FLL A;  4CRX A;  3AE6 B;  3Q8C A;  4KIK A;  5DLF A;  5GTH U;  9ICE A;  1UH6 A;  2HHS A;  2O6K A;  4EZK A;  3BK1 A;  4KDI C;  2GOL A;  5KG3 A;  3QNM A;  2V9H A;  3EGR A;  1BPB A;  1MG8 A;  2KV2 A;  8ICE A;  2JT4 B;  4US9 A;  3MR3 A;  4RPZ A;  3MDA A;  1Q3V A;  2LXA A;  3F5E A;  1KBU A;  4W9F A;  3B0X A;  2YEP B;  2G06 A;  3GOE A;  4EKU A;  4UW9 A;  1AWD A;  3M6Z A;  4QJF B;  3NHE B;  2F44 A;  2N7D A;  3AE3 B;  2JXT A;  3I57 A;  2L5Y A;  4DOA A;  1ZQT A;  3BVG A;  3KLS X;  4ZRJ A;  3TL5 A;  3BIN A;  4BKS A;  3RRG A;  2BYT A;  1V9J A;  4MT5 A;  4RQ4 A;  4G3X B;  2LHE A;  1B1Z A;  3MP9 A;  3OTQ A;  5L83 A;  4Q44 A;  4Y2J A;  4FS2 A;  4RMA A;  4WQM A;  3N28 A;  1IG6 A;  1RDF A;  4C8K A;  3PSF A;  1ZDX A;  5DLG A;  2NPT B;  5DG8 A;  2KZR A;  4J9O A;  4MH0 E;  3RRH A;  2QB0 A;  1S77 D;  4RF0 A;  3LVW A;  3IG3 A;  3GII A;  1WXA A;  5F9N A;  1TTN A;  3UGB B;  1XLO A;  1V85 A;  1XLN A;  4BZA A;  3AQF A;  1B22 A;  2KLC A;  2M0A A;  2LYA A;  4E3C A;  2DYO A;  2JX5 A;  2KWC A;  4QWA A;  2KVR A;  4L23 A;  2V1Y A;  3ZJT A;  1FIQ A;  3ZO5 B;  1F77 A;  1YIW A;  4ZRQ A;  1Z2M A;  9ICK A;  1X9X A;  2IBI B;  2EZX A;  2E3T A;  1C4C A;  1L7N A;  4X57 B;  4PZN A;  3NVY A;  2ZXH A;  2WXJ A;  4FHJ A;  3AE7 B;  2RDI A;  1ZQI A;  3R66 C;  4KKJ A;  1ZQK A;  1JCK B;  2WHI A;  5DKW A;  2H3F A;  5BOL A;  1U47 A;  3B0Y A;  2EMT A;  2JH1 A;  2YY6 A;  9ICR A;  2KK0 A;  4YTM B;  2LGI A;  3GB1 A;  5HR6 A;  2JY6 A;  1KFY B;  1D8Y A;  4FN2 A;  1LQB A;  4JX1 C;  5AZG A;  2W9C B;  2ZUC A;  5LXH A;  1VDV A;  3KFU F;  2NYV A;  2A1A A;  4HPM B;  1HZ6 A;  3H8M A;  3N97 B;  3UMB A;  2C28 A;  1LKY B;  3Q8Q B;  2FPM A;  3D2N A;  1E8W A;  2XK5 B;  2HD5 B;  4C4R A;  3VTU A;  2OH2 A;  1GC7 A;  2I1K A;  3RJG A;  4G3I A;  4BFR A;  5L1J A;  3EZ5 A;  4PGQ A;  2BCS A;  4MFF A;  2WXN A;  3AEA B;  2ZVN A;  4HRS A;  4W9G A;  1I42 A;  1OQY A;  4DXG A;  3QU7 A;  3JPN A;  3AQE A;  1ZQA A;  2IGG A;  3VR9 B;  1XSN A;  4NWI A;  3IHP C;  4CYE A;  4YR0 A;  2LRW A;  2LGD A;  2MQJ A;  2QAR A;  4TUP A;  4R63 A;  5L9X A;  1WX9 A;  4HVB A;  2I1Q A;  1D8B A;  2JWZ A;  4I2J A;  1XSL A;  4UAS A;  1LV5 A;  4O5C A;  5KHO A;  4WAA A;  4P2H A;  4J3O D;  3LWM A;  2GLE A;  2NRW A;  4QZE A;  5KL8 B;  3QU4 A;  1VCB A;  2GBM A;  1ZOL A;  2XI9 A;  2HVI A;  2KJ8 A;  3H0M B;  3N20 C;  3DVN V;  5J2R A;  3ZDC A;  3PX6 A;  1L3T A;  1TVA A;  1A76 A;  4DQQ A;  1L7O A;  3B08 A;  1ZQC A;  1I4H A;  3M63 B;  1CI4 A;  2G08 A;  4PK1 A;  1XLQ A;  1YT3 A;  1WCN A;  5IIO A;  2W9B A;  1ED1 A;  3ZYY X;  3ZVV A;  1NK5 A;  1PUT A;  2R8K A;  4I2I A;  3VCB A;  1IV8 A;  2JZZ A;  3T5K A;  3IP4 B;  1RYR A;  4O3S A;  2L32 A;  2IND C;  5KFM A;  3I9V 1;  2DAF A;  3QE9 Y;  4ECZ A;  2KTR A;  4M2Y A;  2VZK B;  3DV9 A;  5AKZ A;  2KQ7 A;  2NS5 A;  3LYY A;  4YN4 A;  2A3V A;  3VAW A;  5IIJ A;  1JN3 A;  3PO5 A;  1M6Y A;  4K7W A;  5J0X A;  4QZ9 A;  2GO7 A;  1QIL A;  4DXF A;  2NTT A;  4OCZ A;  2C7H A;  1I4P A;  4TSS A;  1J7C A;  3T8M A;  1KDH A;  2JF5 A;  3F2C A;  3RB0 A;  4AJW A;  5ALS A;  2VA3 A;  4II3 B;  2O6V D;  2XBB C;  5CHF A;  2BW2 A;  1ZYQ A;  2QLT A;  1PGA A;  4LDT B;  3ZGZ A;  2PI4 A;  1N5W A;  4Y2U A;  1CJE A;  3TSS A;  3BVZ A;  4KIT B;  4H2A A;  3CRX A;  3E58 A;  4DQS A;  4IWO A;  3PTF C;  1JWB D;  2LHD A;  2BDU A;  5KAI U;  1SGG A;  3EW9 A;  2LD9 A;  2ZEQ A;  1DK2 A;  5KFE A;  3E2E A;  3LDZ E;  3NOB A;  4BKG A;  4EEL A;  2BPF A;  2HMX A;  7ICO A;  3M9M B;  3BQ0 A;  3R8B A;  1NDD A;  2ASL A;  2D2Q A;  3KHH A;  4EEY A;  1F2R I;  4KSL C;  3S2A A;  4J9N A;  5G2N A;  4I29 A;  4LK0 M;  3SEN A;  2JXJ A;  3DBL I;  4Q8E A;  3DDH A;  4LNF A;  2HCF A;  2DZJ A;  2K9X A;  2RMM A;  8ICL A;  1SEB D;  2PE9 A;  4K3C A;  4TQ1 A;  4KTQ A;  4RQ2 A;  1NK0 A;  3C23 A;  4DFD A;  3VVW B;  3OJS A;  2QAR B;  4HRO A;  3RCZ A;  2ONQ A;  1AN8 A;  1L6V A;  3P4R B;  1SZH A;  3WK6 A;  1S0N A;  7ICN A;  1ZQV A;  4CF5 A;  1MSW D;  1F9J A;  2OYY A;  1SXT A;  2CJO A;  2XEW A;  9ICC A;  1IIP A;  3WK7 A;  4YVZ A;  4OJO A;  1F44 A;  2MW5 A;  4ANX A;  5AM0 A;  4O5K A;  2R61 A;  5BO4 B;  3J81 j;  3RNF C;  2GH1 A;  1WM2 A;  5AZH A;  8ICG A;  2RLT A;  1RRB A;  4AOF A;  5J0W A;  2ZVO A;  2J0M A;  4MJS B;  1I4Q A;  3W5V B;  2SEB D;  1FXT B;  3ETL A;  3ZTC A;  5AI5 A;  4M6W A;  1QOA A;  2N9E B;  2G1E A;  1T94 A;  2JHD A;  3TI0 A;  2K39 A;  2MLB A;  4US8 A;  3JPS A;  7ICF A;  4LNK A;  5C3J B;  5IA7 A;  1WWT A;  4F71 A;  3TEZ A;  1X2I A;  2CPR A;  1E8Y A;  2KJR A;  1UUP A;  4QZC A;  5DB8 A;  1KTK A;  2PKE A;  5AKH A;  1U45 A;  3RBE A;  3DWM A;  1E9M A;  4ECU A;  2TSS A;  4GLX A;  1NBF C;  3AEB B;  4ED6 A;  3C29 A;  4IOI E;  4F2R A;  2WX0 A;  5TIS U;  2FCS A;  1WGG A;  3CIR B;  1N61 A;  3Q3M C;  5AI4 A;  2KT7 A;  4C0Z A;  2XK5 A;  3EA6 A;  4FS1 A;  3JW0 X;  4NZL B;  1QKZ A;  3MTN B;  3T9L A;  4R3D A;  2BYV E;  2X8X X;  1YN3 A;  4W9D A;  9ICS A;  4EE2 A;  4QAY A;  3CNH A;  3PS6 A;  5KFF A;  4O3R A;  1FMA D;  2ACZ B;  2OM6 A;  4I2A A;  1OEY J;  1MHH E;  1A77 A;  2JRZ A;  2ZXI A;  3M95 A;  1E7P B;  2L05 A;  1SV0 A;  3F2B A;  2J53 A;  4Y2R A;  2KYW A;  5JTI A;  2BPC A;  4MSM B;  1TAM A;  2KLG A;  1MA7 A;  2WB1 C;  1KF6 B;  3GV7 B;  2O6V B;  4J9K A;  1AQ6 A;  5AI6 A;  2L8J A;  4A9A A;  1UBI A;  3M6K A;  2AL6 A;  2NO5 A;  1WY8 A;  2VA8 A;  2HDE A;  2L0F A;  3N30 A;  5J8Y A;  1V38 A;  2KMD A;  4KZC A;  5D49 A;  4RM9 A;  4KLT A;  3B9J A;  4NQL B;  1RXW A;  1VRA B;  2ZJ8 A;  3N7P D;  4F4X A;  3RBD A;  2XID A;  3RAX A;  1EU4 A;  2WXR A;  2HDO A;  1L5U A;  1STE A;  2RQ5 A;  2G4D B;  1Q5W B;  2L0T A;  3DVN U;  4WWM A;  3PSI A;  2Y0S C;  3LJ3 A;  3RH6 A;  2JZB A;  3QYP A;  3DHI C;  4YXM A;  2RP5 A;  2M8S A;  5CHV C;  5J2G A;  5HNK A;  2GBJ A;  4QWD A;  1XU4 A;  3AU4 A;  2WF8 A;  5ALR A;  2ZUD A;  1TJE A;  2ZCB A;  2REX A;  5ALX A;  4UB8 U;  3X0W A;  4KLF A;  2KAJ A;  2KJH B;  2KXJ A;  8ICS A;  3NVW A;  5D94 A;  7ICH A;  1PZN A;  1S0M A;  1ZQE A;  2JRH A;  2I2Y A;  3MGV A;  4BKS D;  1XO3 A;  3I5J C;  3UMG A;  2Z7J A;  2XY6 A;  4YTP B;  3TCA A;  4C4V A;  2KX0 A;  5BMI A;  4WJP A;  4EZJ A;  2WDV B;  2ZIV B;  2BF8 B;  3B2G A;  5CTR C;  1F2R C;  5L1M A;  3DBL B;  2AGP A;  4I2H A;  5ALP A;  5C23 A;  4UAT A;  3PO4 A;  2DKZ A;  2KP7 A;  1NEK B;  3EFU A;  5ALJ A;  3KVF B;  1MC8 A;  4NJ7 A;  3A9J A;  4HJK A;  4QZG A;  5JRT A;  3ALR A;  5AK4 A;  5AKL A;  2FCM A;  4M6W B;  1ZQJ A;  3P63 A;  5J0Q A;  4F93 B;  2WF6 A;  1SZP A;  4O3M A;  1X6J A;  2KKP A;  4Q2J A;  1LFD A;  2AL3 A;  3PLU A;  1KSP A;  2ZPY A;  5KT6 A;  3P4S B;  1TY0 A;  1OQR A;  2WU5 B;  2Z8L A;  4M8M A;  5AM3 A;  3PW0 A;  3A0H U;  1KLG D;  4XWT A;  3NAS A;  3ZJU A;  2H3Z A;  2QMT A;  1PYW D;  4KLO A;  4J9P A;  1VR9 A;  3MR5 A;  2V3P A;  2KN7 A;  4JQW C;  2H3Q A;  4HYK A;  4FZN A;  1L4D B;  1NOM A;  3M1Y A;  4MGI E;  3RTV A;  2C22 A;  2IYD B;  1NKC A;  1ENF A;  5KFL A;  2XNA C;  2F8L A;  4OZC A;  4Y2Y A;  1V49 A;  2DLB A;  3QIJ A;  4YMO A;  5D46 A;  2A1J A;  2MSN A;  5DB7 A;  1VZ8 A;  2KIC A;  2SAK A;  2F8K A;  3KD3 A;  4F72 A;  2J4X A;  1GB1 A;  2Y1J A;  2K8C B;  5J2E A;  4B9T A;  5CHG A;  3RNA C;  3UXP A;  4AJY B;  3HM3 A;  2L52 A;  1ZQR A;  3BDP A;  2H3I A;  2KSO A;  4UAY A;  1WX7 A;  3RD2 A;  4BBN C;  1ZQW A;  1RQL A;  3A4R A;  2QHO A;  4NM2 A;  2BPG A;  2P6R A;  3CP8 A;  2MP2 A;  4PPX A;  3H6N A;  4Z6C A;  2KK8 A;  5LNK 1;  1PK1 B;  3UM9 A;  4XC2 A;  3Q8L A;  1ZQG A;  1WRD B;  3RNG C;  2D3G A;  1WZ3 A;  1F0Z A;  1UWX A;  2PMZ C;  1WMH B;  3A1Q A;  2GBR A;  2M56 B;  1I4G A;  3PHW B;  1QQ5 A;  3SR6 A;  1ZJM A;  2WXK A;  1KKX A;  4MJS A;  3H0L B;  4UB4 A;  1FCC C;  1XNS A;  1V97 A;  1E7V A;  2YB4 A;  4NAW A;  5J0S A;  1VJK A;  4MH8 A;  3GE8 C;  1Q0W B;  1JQ4 A;  3BWU D;  3H8H A;  4M47 A;  2E8M A;  5HKH A;  1UT5 A;  4GB9 A;  3V72 A;  1FXA A;  3EPG A;  2C60 A;  1LB2 B;  3P42 A;  3UIN B;  3RN9 C;  2BS3 B;  5D4B A;  4DL6 A;  2D3A A;  3PT2 B;  1TK8 A;  3BQ1 A;  2W9N A;  4F8R A;  3H8J A;  1IBX A;  2Y1I A;  1E5W A;  1XSP A;  8ICM A;  1UT8 A;  2ZIW B;  4DSJ A;  5CA7 A;  3U52 E;  5HR7 A;  5IKC M;  5ALM A;  2F1I A;  4F5R A;  2WP9 B;  5CEH A;  3Q6B A;  2IY1 B;  2LVP A;  3O13 A;  3V62 A;  1IPG A;  4JWS C;  4B9U A;  1L0Y B;  1EXN A;  3OSP A;  4ELT A;  3HP6 A;  2VH1 A;  4B0M A;  5DPT A;  2VJ4 A;  4J9S A;  1WJ6 A;  3VRA B;  1U4A A;  2JZ3 B;  3ORY A;  1HTO A;  2MWS B;  4C8O A;  2DKX A;  4W9J A;  3RJF A;  2KZZ A;  3MFH A;  2O6V A;  4JV0 A;  8ICT A;  1KQQ A;  1ZOY B;  1D3Z A;  2AGO A;  4IR1 A;  2A5U A;  2RPV A;  5KG5 A;  2LZ6 A;  2IJ0 A;  1S8O A;  4DSI A;  3PX0 A;  3W1Y A;  2IY0 B;  3AN1 A;  4C7Y A;  2KQS A;  1L8L A;  4W9C A;  4F2S A;  1TAU A;  2ZIU A;  1A0P A;  1URJ A;  1OQQ A;  2WB1 F;  3TAQ A;  4GDL A;  4QNL A;  4DDG D;  3QXG A;  1L0X B;  4U7C A;  2EKE C;  4YMN A;  4CF4 A;  2I38 A;  2KFK B;  1FRR A;  2HHV A;  3PSE B;  1K5O A;  7ICM A;  2C7M B;  5E6P A;  1N2X A;  4M9N A;  1GPX A;  1KOT A;  3M8S A;  1COO A;  2ZIX A;  1YJJ A;  4HK2 A;  3D32 A;  4GN1 A;  4BUG A;  4HDQ A;  2WDQ B;  1BML C;  3C19 A;  9ICF A;  2VH2 A;  2YMP A;  5KFA A;  2F2A B;  1T0Y A;  3IBE A;  1XF5 L;  2WXM A;  3TUO A;  5HG2 A;  2NBU A;  2K3U A;  4P6V F;  1T3N A;  1PFD A;  1Z00 B;  2Q5W D;  2N9K A;  2BT6 A;  2K4P A;  3RI7 C;  2W55 A;  3GV8 B;  3T5J A;  1QQ7 A;  2AYO B;  4NXZ A;  4IQV A;  2W9C A;  4F4W A;  4GXB A;  4M0W A;  4MDK E;  4GC6 A;  4DF4 A;  2OOB B;  1ZQB A;  4XZ4 A;  1DOQ A;  5L1L A;  4UBB A;  3RUI B;  3KHR A;  2YML A;  5BOM A;  2LPE A;  4PL1 A;  5AM5 A;  3JPP A;  1XD3 B;  5DQH A;  3SU8 X;  4NY0 A;  1NJW A;  4NLN A;  3H1U A;  2KC2 A;  5DGB A;  4C00 A;  3P4Q B;  1KFS A;  3TAN A;  5B5E U;  1FEH A;  3I76 A;  4PT5 A;  3K9P B;  2PLP A;  1WJU A;  2PMV A;  3K1Z A;  4PL2 A;  3MC9 A;  3Q8E A;  4GXI A;  5TZV A;  1QSS A;  2J52 A;  3NG0 A;  1FD6 A;  3UPQ A;  4F3O A;  3M9O B;  4HCP B;  3R7Q A;  4AS1 A;  1MI0 A;  3L3F X;  5EE0 A;  2DYB A;  1WGK A;  3IFW B;  3PHX B;  4CQN A;  5AK5 A;  2LI6 A;  4C8N A;  1D5X C;  3ZW3 A;  8ICF A;  4KX3 A;  1FFU A;  3GZN B;  4YD1 A;  2P35 A;  1UEL A;  4LTU A;  4IUM B;  4ZRI A;  2CHW A;  2PI5 A;  2KFN A;  4ECR A;  1TIF A;  2KN4 A;  3T5L A;  2IDY A;  2HHW A;  1L6U A;  2DGZ A;  1CUK A;  4JK1 A;  2E8P A;  4RUC A;  2KSO B;  1E8Z A;  3QUB A;  1F52 A;  2KG5 A;  3PZD A;  4ZYS A;  3RH4 A;  2K4H A;  3AEF B;  1X66 A;  5JZE B;  3HJE A;  1RYS A;  3G6X A;  4EX6 A;  4NL9 C;  4B6W A;  4FJZ A;  4R65 A;  5KFP A;  3FM9 A;  2DZM A;  2E1E A;  3K1R B;  8ICA A;  3BZK A;  5DG9 A;  1TKY A;  2OXO A;  4GGQ A;  4HKZ E;  1TBE A;  2NTS A;  4RQ8 A;  3MBY A;  3K4G A;  3I28 A;  5HP4 A;  1V81 A;  2INN E;  4NLK A;  2C2R A;  3CST A;  3TEW A;  2NO4 A;  1V5T A;  4WJN A;  2WDR B;  4A90 A;  4TKN A;  2I6X A;  3Q8F A;  8ICI A;  3OJ4 B;  1OTR B;  1PGB A;  1FFV A;  5KFV A;  1VD2 A;  3I1Y A;  1XQQ A;  3HVZ A;  5AK3 A;  1ET6 A;  5KFI A;  5H8Y E;  4RQN A;  3RNE C;  4UB6 U;  3KYD D;  4B6J A;  4S0R A;  9ICM A;  2BR0 A;  2JYT A;  5KAF U;  1BT0 A;  2AU0 A;  3MHS D;  3NZS A;  3PRE A;  1L3V A;  2LYB A;  7ICI A;  3O65 B;  2MJE A;  1C7Y A;  3PLV A;  3GIL A;  2D3B A;  2XY5 A;  2EAM A;  2G07 A;  1BPY A;  3RJE A;  1SJE D;  4DF8 A;  3VC8 A;  2I5H A;  1ISN A;  3M7D A;  9ICL A;  1GNU A;  4KDL B;  3GU3 A;  3SFE B;  4DHJ D;  1LO5 D;  4FLH A;  4ECW A;  8ICV A;  3TAR A;  1V5O A;  3RJH A;  1SKW A;  3ONS A;  4DQR A;  1Q46 A;  2GLS A;  5GXG B;  2VIX A;  5D3D A;  2HBL A;  3CYM A;  4DDI D;  4UB1 A;  3DPD A;  2Z59 B;  2XC9 A;  8ICJ A;  9ICH A;  2OJW A;  3VHT C;  2HVH A;  1SB3 C;  4LDT D;  5E6J A;  4MFC A;  4YSX B;  1MN8 A;  1X40 A;  1LM8 B;  1V9P A;  4PHD A;  5JHA A;  4JL9 A;  4XGA B;  1HEK A;  3BS5 B;  2K8H A;  2RDB C;  1XO1 A;  2RDG A;  1JWU D;  5ALF A;  4CHK A;  1BGX T;  3WKB A;  4I2C A;  2LEK A;  1ET9 A;  2QIL A;  1SWW A;  1YX6 B;  2ATL A;  3U2S C;  3ZUN A;  4A20 A;  2ZIU B;  3IT4 B;  4IQW A;  3V6H A;  3ZLZ A;  4BXO B;  4IC7 B;  2KAN A;  2ON8 A;  2WX1 A;  2QIE B;  1J97 A;  1JXL A;  1I7H A;  3V05 A;  3N1X C;  1WXM A;  3V6K A;  4ARC A;  1ROE A;  4HWI B;  4BJQ A;  2NRV A;  5HHH A;  4JGH B;  2LGY A;  2XGQ A;  1T7P A;  2WXL A;  2ZZP B;  4Y2T A;  4QZB A;  2DX5 B;  4KIK B;  3FDS A;  3KZI U;  4W9K A;  2Y0S F;  9ICA A;  1D5M C;  3QHT A;  5DBC A;  4PHP A;  2WFA A;  4ED0 A;  4R8U A;  2QB0 B;  5KFO A;  4DFM A;  1C9F A;  4UDU C;  4IQT A;  2LVQ A;  3VXW A;  1DOX A;  3ZXR A;  2VAN A;  1WE6 A;  3ZNG C;  2E6X A;  2AEH A;  2I1J A;  3WIM A;  5J17 A;  2NV3 A;  5HML A;  4DEZ A;  3DQV A;  1KN5 A;  1SV4 A;  2E1F A;  2XO7 A;  5DB9 A;  2ZW0 A;  2RRD A;  1V2Y A;  2WXQ A;  2PKO A;  5J29 A;  1T5X D;  3I63 C;  1NYR A;  4QWE A;  4K81 A;  5DDM A;  2DL0 A;  3C1Z A;  1KLN A;  4ITK A;  1KTQ A;  2IO1 B;  9ICO A;  3HRD D;  2KEY A;  1BPD A;  4UAU A;  2L76 A;  4MFA A;  9ICP A;  5JU5 A;  4RQ0 A;  2XIC A;  2FCQ A;  4RQ1 A;  1ZW7 A;  2B76 B;  3JSV A;  3QEA Z;  4FZL A;  4Q45 A;  2N7J A;  5ALE A;  3L13 A;  1UGM A;  1WM3 A;  4MF8 A;  3SDL C;  2MEK A;  3BII D;  1N62 A;  3PO0 A;  3ZTD A;  2ALZ A;  5IP4 D;  2BVC A;  1FM0 D;  3NUQ A;  2KJ9 A;  1XWL A;  3QU9 A;  4Y2P A;  4M9J A;  1L6N A;  2QJL A;  1WJ4 A;  2J6T A;  1T8E A;  4KLM A;  2D6F C;  1ZE3 D;  2IGD A;  3I3T B;  4I6P A;  1NJY A;  2LGS A;  1WZ0 A;  1QZE A;  1JRP A;  4TUS A;  4LJP B;  2NCN A;  1B0X A;  1UD7 A;  1ZQS A;  1PDX A;  1TKD A;  3UIP B;  3JYU A;  4P4M A;  1Z3E B;  3BY4 B;  1ARO P;  1GC6 A;  5DDY A;  2LJI A;  1XO0 A;  3CSF A;  3UMC A;  1UHU A;  1WYG A;  4RNO A;  1S76 D;  2YMQ A;  2P66 A;  1ZP0 B;  1HTQ A;  4M04 A;  4ZRK A;  5JUM A;  2N9L A;  3N1Z C;  1YJI A;  1JRU A;  2B21 A;  5J2J A;  1WWU A;  2AQ3 B;  2BGW A;  3KTQ A;  3MHZ A;  1Q8K A;  1B9R A;  4P4P A;  4O3Q A;  3HUI A;  4MGZ E;  4Y2S A;  2UVW A;  4FJV B;  3U26 A;  3HKZ C;  1IM4 A;  1J8C A;  1V86 A;  3AH7 A;  1PK1 A;  2OHF A;  5C0Y A;  5L1K A;  1MQ3 A;  2BCQ A;  1XLP A;  5IAA C;  1TV9 A;  4ED7 A;  1TS3 A;  5ALQ A;  2IA6 A;  3BJY A;  4GDK A;  2F1J A;  5KFQ A;  3A4S C;  4EOY A;  3SEB A;  2LWP A;  1Q10 A;  2F77 X;  3NJT A;  1UQV A;  1Z5S B;  2K1F A;  1TK5 A;  4K7U A;  2LFI A;  4MEL A;  3RFZ B;  3ETR A;  4ECT A;  2RHF A;  2W9M A;  1ZRM A;  3JPT A;  3NY5 A;  3M9N B;  1UZX B;  2GRI A;  3SMV A;  3QUT A;  2W82 A;  1EO6 A;  5J2B A;  1C3T A;  3KKA A;  1MJD A;  1FO4 A;  5I4D A;  4M00 A;  3VUY A;  4KN4 A;  4I2E A;  4KLL A;  2KN5 A;  2PVG C;  4ELU A;  5EE1 A;  5F9L A;  2W03 A;  8ICK A;  2QDF A;  3ENE A;  5EWE A;  1WI0 A;  5AIB A;  1QLN A;  1MVK A;  1ECW A;  2BDP A;  4KLJ A;  2FMS A;  4TUU A;  2PFP A;  3FKY A;  3R2I A;  4RQ5 A;  4QW9 A;  3APC A;  4QZA A;  3WAM A;  2GBN A;  4WJ3 B;  3WKE A;  4B9S A;  4ANU A;  3QWZ B;  4N6E B;  1M4V A;  5EE9 A;  4F4Z A;  5KFK A;  3L4P A;  4GC7 A;  3ZDD A;  4IR9 A;  1TZ1 A;  4MF2 A;  3PZP A;  2K4E A;  2BCU A;  3WKD A;  4A8E A;  3C0R B;  5AK6 A;  3KW5 B;  4Z6F A;  1NZB A;  5AI0 A;  1NI3 A;  3CF6 E;  3EYZ A;  4MSQ B;  3F53 A;  2R18 A;  2LBO A;  4E0D A;  3OWE B;  3ZIM A;  2WHE A;  1ZGU B;  2HJ1 A;  3ECI A;  4AWJ A;  2KHV A;  4JWU C;  2IHM A;  3MDC A;  2KVS A;  4RM8 A;  4YT0 B;  2ZNV B;  1X9W A;  9ICB A;  3PGE A;  4ZHP A;  2BQ3 A;  5K4L A;  1PVR A;  2YB1 A;  3KH0 A;  5ALO A;  1WFY A;  1RQN A;  2RD0 A;  3PVX A;  5AM4 A;  3EFC A;  3TFS A;  3A0B U;  1TS2 A;  2HHX A;  3ZNI D;  3VR8 B;  4JIO U;  5FR6 A;  1K53 A;  3ISC A;  4PH5 A;  3B1L X;  3IDW A;  7ICL A;  2R2Q A;  2G0A A;  1B43 A;  5AKE A;  2PJH A;  3PV1 A;  3EHV A;  4NJC A;  1XS9 D;  1JMS A;  4DL5 A;  3ISB A;  3DBH I;  2XVT A;  5D6J B;  8ICY A;  3V60 A;  4EYI B;  3C5F A;  1AAR A;  3RB3 A;  1I4X A;  3DHH C;  1UBQ A;  4F1S A;  4BOS C;  5KFS A;  3AI5 A;  4TQR A;  2BWE S;  3AEV A;  4DCC A;  3KWL A;  1MHX A;  2WF5 A;  2YMM A;  1BNO A;  3Q8P B;  2C2D A;  1S9F A;  3BVM A;  2F1H A;  3TAD A;  1D9D A;  3SV3 A;  2KKC A;  5DPR A;  3V7J A;  3KKA C;  1WIA A;  5KT2 A;  1S0O A;  2E8O A;  4FBU A;  4JE3 B;  1TYG B;  2DHZ A;  3TFR A;  3OSN A;  4HPL B;  3PNC A;  2KZ3 A;  3C2K A;  3PY8 A;  1UWM A;  1WF9 A;  2BB6 A;  4A3P A;  4YSZ B;  2IO2 B;  1C77 A;  1V8C A;  3UQB A;  1IGD A;  1YQB A;  1J7A A;  2HI0 A;  1S5L U;  2NBW B;  4KSK C;  2RDJ A;  1K1Q A;  1WXS A;  4KX5 A;  2DPJ A;  2YVC A;  2W8K A;  3BYT B;  3W1S A;  1R4N I;  1KLU D;  4YTN B;  1JX4 A;  4IKG A;  4J6I A;  1EF5 A;  2KJ6 A;  3KUZ A;  2OEH A;  2H3V A;  3AE9 B;  1LVH A;  3WAP A;  3E9S A;  4YSY B;  2VRR B;  4ECQ A;  1RG6 A;  4ZRP A;  1K51 A;  1K52 A;  1WWV A;  9ICN A;  2MJD A;  2G4S A;  5KFN A;  1NK8 A;  5CP2 A;  2I9G A;  5TR5 A;  4KLE A;  3APD A;  3NVV A;  4RUA A;  4RCO A;  3ZNZ B;  9ICU A;  4QIW F;  2YX8 A;  3KOO A;  1P3Q U;  3GS2 A;  4USA A;  3IRU A;  4F4Y A;  1SGH A;  4FFD A;  3THV A;  1L7M A;  3BQ7 A;  3QU5 A;  4CCH A;  3VDZ A;  3DWG C;  4C80 A;  1V6E A;  3D2S A;  4F5O A;  4B9M A;  3AXC A;  2DNF A;  5KFJ A;  5J2A A;  1CQV A;  1ZQN A;  2C5L C;  3B2F A;  2BKE A;  2EEL A;  4I6N B;  3ED5 A;  2N4F A;  1PGX A;  2EQY A;  2FBW B;  4HXD A;  4UB2 A;  2N1R A;  3W1S C;  3Q2A C;  3D2Q A;  1FNV A;  1J2N A;  3LB8 C;  2HOQ A;  2EAO A;  4C8M A;  2LAS A;  2KTQ A;  4C7Z A;  2D10 A;  3F5A A;  1S97 A;  2VZK D;  1ZKH A;  1V80 A;  8ICC A;  1ZD2 P;  1EM7 A;  2CU3 A;  1DGS A;  3C1Y A;  1GG3 A;  3KQ4 A;  2BTE A;  2MA9 B;  3TBL D;  3RB6 A;  1T0Q C;  3P4P B;  4AYB C;  4GFJ A;  2B6G A;  1XCQ L;  1SIJ A;  2GI9 A;  2KAC A;  1WR6 E;  2WF9 A;  5J0P A;  1OXJ A;  2V3S A;  5J0Y A;  5KT3 A;  2ZCC A;  1EU3 A;  4LLG M;  2DZI A;  4B95 A;  1L8O A;  2WXO A;  3SI8 A;  4RQ3 A;  4OVU A;  1KL9 A;  2BQR A;  2Y3A A;  1ZET A;  9ICI A;  2VKQ A;  3HT3 A;  3AU2 A;  3ALB A;  4P1B C;  3TEY A;  4OVZ A;  4B9L A;  4MEX A;  3Q8M A;  4OHJ A;  3Q8K A;  4KGS A;  1YD8 U;  3WAN A;  2RGF A;  2MAX A;  4B9K A;  4DL4 A;  2W8L A;  1SKR A;  1X9M A;  3ZXV A;  3SAG A;  4DQI A;  2RSU A;  4JUZ A;  4DL2 A;  5T14 A;  3AE4 B;  4X5V A;  1JUD A;  1VZ7 A;  8ICR A;  4LVS A;  5C2T B;  2ICI A;  3TMP B;  5FR3 A;  1U4B A;  2DZK A;  1R4N B;  3FIL B;  4ICU A;  1L2N A;  2JEF A;  2K6D B;  2M0X A;  4K4H A;  2M19 A;  1BUI C;  1GO3 F;  2Y9U A;  4FUL A;  3AB5 A;  4K4G A;  2V4R A;  3HIZ A;  4MGK E;  2LJ5 A;  2WLB A;  4EBE A;  1N48 A;  4C4V B;  2PFQ A;  4G11 A;  1YZ7 A;  3AM9 A;  3QC8 B;  2EAP A;  3AU5 A;  1JI7 A;  3Q3F A;  2IOF A;  1U49 A;  1R4M I;  1SE4 A;  3APF A;  4S17 A;  5KL1 B;  4B9V A;  3PZ8 A;  3EWA A;  1NYQ A;  5CRX A;  3O0F A;  4I28 A;  4OJP A;  2BQU A;  3DHG C;  3TIX A;  1L7Y A;  2FMP A;  5D7G A;  3KHL A;  1TKG A;  3GV5 B;  2HOI A;  4KLH A;  2AQ1 B;  4FXC A;  4N9F 4;  3D6J A;  3C2M A;  2ZJD A;  1ZQD A;  2DBY A;  2V0G A;  2UVV A;  1QLB B;  3AED B;  4RFB A;  4ECS A;  2Y9T A;  3NTU A;  4OJ6 A;  3QJZ A;  2K8B A;  3ONN A;  2YEP F;  5KT5 A;  4LNN A;  5F3X B;  4GSW A;  4O1N A;  4IDI A;  7ICJ A;  4CDG A;  1E6E B;  1J19 A;  1NK6 A;  3PRP B;  2PE6 B;  2WXP A;  2EH9 A;  4PHE A;  4J9M A;  1U48 A;  2A1J B;  2AHO B;  1ZQH A;  1WJN A;  4ECV A;  2KDB A;  2O2V A;  2LHT A;  2RPQ A;  1AW7 A;  3H7S A;  1NK4 A;  4AP9 A;  3S6J A;  3PPA A;  3Q3O C;  3ZKJ C;  2WGS A;  4OD0 A;  5KG6 A;  2WAQ C;  2Y5P A;  2NVU I;  4J9Q A;  2K22 A;  4KGR A;  1G6J A;  5ALH A;  2WU2 B;  3AEG B;  1P7D A;  2D8C A;  4RQ6 A;  4CE6 A;  1NK7 A;  1HXY D;  4ICA A;  4J9L A;  1ESF A;  1QF6 A;  2MP2 B;  3AEC B;  4DWI A;  1QSY A;  1JW9 D; 
#chains in the Genus database with same CATH homology
 1YQ3 B;  2VZK B;  1JRO A;  2EKI A;  2LUM A;  1EWC A;  1RYJ A;  4B0E A;  5G5G A;  3LYY A;  2WNM A;  1SJE D;  1TZO A;  4OZB A;  1CZP A;  3SFE B;  4HJG E;  1DOY A;  1LO5 D;  4DXF A;  1D5Z C;  1QIL A;  1GAQ B;  2NTT A;  3PZ7 A;  3W9C B;  4DQO C;  1T3Q A;  1I4P A;  4RH6 A;  1J7C A;  4TSS A;  5GXG B;  1EWY C;  5D3D A;  3T3N A;  2BS4 B;  2BW2 A;  2INP E;  1IUE A;  1SB3 C;  1L5P A;  1PGA A;  5E6J A;  3ZGZ A;  1N5W A;  4YSX B;  1CJE A;  3TSS A;  3NUH B;  3BVZ A;  5FK9 C;  4H2A A;  3NZ3 A;  2RDG A;  1JWU D;  1JWB D;  2LHD A;  2LEK A;  1ET9 A;  1JWM D;  2QIL A;  1RFK A;  3U2S C;  2PIA A;  3IT4 B;  3R8B A;  1HQR D;  1XCT L;  2ON8 A;  2QEJ C;  2X38 A;  4GDK B;  2QIE B;  1F2R I;  1I7H A;  2MJ3 A;  3V05 A;  3UI3 A;  4ARC A;  1ROE A;  2XN9 C;  2Y5C A;  4LK0 M;  2WXL A;  4XE0 A;  4HKQ A;  3WCQ A;  1V1O A;  5D3I B;  1D5M C;  2RMM A;  2K9X A;  1K50 A;  3AE8 B;  2BS2 B;  2JYE A;  3CWI A;  1SEB D;  2K5P A;  2WXI A;  4TQ1 A;  2CJN A;  2DYM A;  1C9F A;  2L1A A;  4UDU C;  1DOX A;  4HRO A;  3BK2 A;  2ONQ A;  1AN8 A;  1L6V A;  2L83 A;  3BZD B;  3P4R B;  2E6X A;  4N58 A;  3IT6 B;  2JSV X;  2PTL A;  2CJO A;  1SXT A;  1DYQ A;  2G9H D;  3NRZ A;  2ZW0 A;  2WXQ A;  1N5X A;  2R61 A;  4L2Y A;  1VLB A;  2PKO A;  1T5X D;  1NYR A;  1I4Q A;  4ITK A;  3W5V B;  3HRD D;  1D6E C;  1FXI A;  1TY2 A;  2SEB D;  4NAW B;  5HFY A;  3T3O A;  1QOA A;  2J42 A;  2G1E A;  1FNU A;  3Q8A A;  3FIL A;  5AUI A;  4US8 A;  5HHD G;  5BYR A;  2B76 B;  1TS4 A;  1YN4 A;  5C3J B;  2N7J A;  1WWT A;  2QSD A;  3TEZ A;  2MEK A;  2V3N A;  1N62 A;  1UUP A;  3BII D;  2JZP A;  2D5G A;  3PO0 A;  1KTK A;  1FM0 D;  3DWM A;  1E9M A;  2TSS A;  3R2T A;  3AEB B;  3BYY B;  5EE3 A;  4IOI E;  2QJL A;  2JQR B;  3P1M A;  1ZE3 D;  2IGD A;  3CIR B;  1N61 A;  1SE2 A;  1JRP A;  2JWU A;  1SBB B;  3EA6 A;  2K0P A;  2BB5 A;  1PDX A;  1QKZ A;  4NZL B;  3U4E G;  3LXF A;  1SSN A;  4OW0 A;  4R3D A;  1YN3 A;  4EE2 A;  4MM3 B;  1JML A;  3AV8 A;  1N60 A;  1FMA D;  2ACZ B;  2LJI A;  4OZA A;  1JAL A;  1HA5 A;  1MHH E;  3ZJV A;  1WYG A;  3MJ5 A;  3N9Y C;  1ZP0 B;  1E7P B;  1NEN B;  1UNS A;  1V1P B;  4YXD B;  2N9L A;  1YNT E;  1Y56 A;  1YJI A;  2J53 A;  4WIP A;  2AQ3 B;  3MHZ A;  1B9R A;  3HUI A;  1KF6 B;  4A9A A;  2FUG 1;  2KMM A;  3IXS A;  4KGT A;  2HDE A;  3AH7 A;  1YN5 A;  1FNW A;  1C4P A;  2OHF A;  2H89 B;  3B9J A;  1XLP A;  3KWV A;  1TS3 A;  1VRA B;  3ABV B;  3AE2 B;  3AE1 B;  3MC0 B;  4P16 A;  1EU4 A;  1CK1 A;  3C8Y A;  2WXR A;  1STE A;  4GDL B;  3SEB A;  1Q10 A;  2H88 B;  4WWM A;  1SE3 A;  2PVO D;  1E10 A;  2LFI A;  3RFZ B;  3ETR A;  1NVI D;  2ZW1 A;  4N59 A;  5HI1 A;  4D2K A;  1TJE A;  2MH7 A;  2GRI A;  2KAJ A;  2W82 A;  4A8X C;  3NVW A;  4HEA 1;  2JU6 X;  1FO4 A;  5I4D A;  1E0Z A;  2W3S A;  2I2Y A;  1XO3 A;  2PVG C;  4YTP B;  5EE1 A;  5BMI A;  3GP7 A;  1MVK A;  2WDV B;  4RNA A;  3B2G A;  1GB4 A;  3R2I A;  1F2R C;  4XDC A;  4N6E B;  1M4V A;  5EE9 A;  1NEK B;  3L4P A;  2V4I B;  3IAS 1;  1JWS D;  1QQR A;  2RDH A;  3P63 A;  3W2D A;  4XDD A;  4Q2J A;  1WRI A;  1NI3 A;  1XEE A;  1WSP A;  3P4S B;  1TY0 A;  1OQR A;  2LMC A;  2WU5 B;  2Z8L A;  3OWE B;  1C78 A;  1P7E A;  4XWT A;  1KLG D;  2IPK D;  3ZJU A;  2NMQ A;  2QMT A;  1PYW D;  4RGO S;  3IAM 1;  3U7Z A;  4JWU C;  4ZOH C;  2IGH A;  4RGN A;  2N0S B;  1VR9 A;  2V3P A;  4YT0 B;  4GLS C;  4ZHP A;  5BMH A;  1QT9 A;  2PW9 A;  1L4D B;  4NAM A;  1AYF A;  2XNA C;  3FC4 A;  1ENF A;  1TS2 A;  4OZC A;  2DLB A;  3VR8 B;  1YQ4 B;  3Q69 A;  1VZ8 A;  1K53 A;  2SAK A;  5T8I A;  5H92 C;  1TKE A;  2J4X A;  1GB1 A;  1SJH D;  4NJC A;  1L4Z B;  2L52 A;  1I4X A;  1KH0 A;  1GOZ A;  4WUR A;  4KX6 B;  4WAF A;  1ACC A;  1FRD A;  3KWL A;  4L1B A;  5LNK 1;  2DWQ A;  1ZPS A;  1MHX A;  1SF0 A;  1F0Z A;  1UWX A;  4KKI A;  1XXG A;  3I9V 1;  1YMH E;  1P7F A;  3BVM A;  2AQ2 B;  1JWA D;  4ZHO A;  2M56 B;  1C79 A;  1I4G A;  4WH4 A;  1A70 A;  3SR6 A;  1KRH A;  2WXK A;  1ZUD 2;  4JE3 B;  1TYG B;  3V3X A;  1UWM A;  1FCC C;  1HEZ E;  2BB6 A;  4YSZ B;  1V97 A;  1C77 A;  1V8C A;  1I4R A;  1VJK A;  3AMZ A;  1ZDV A;  1IGD A;  4MH8 A;  1J7A A;  1JQ4 A;  3VQI A;  3BWU D;  3H8H A;  3AE5 B;  4RGM A;  3BYT B;  5FKA C;  2WXG A;  3W1S A;  1C4A A;  1KLU D;  1FXA A;  1QOG A;  2KQ4 X;  3NS1 A;  4YTN B;  4IKG A;  3HVD A;  3P42 A;  3AE9 B;  2HTM E;  1DGJ A;  2BS3 B;  5TSS A;  3E9S A;  4YSY B;  1ZXI A;  4ZRP A;  1FCL A;  1K51 A;  1K52 A;  1IBX A;  1QOF A;  1QOB A;  3Q8B A;  2MJD A;  1T6B X;  3U52 E;  3URY A;  3EUB 2;  2WP9 B;  3W5U B;  3NVV A;  1ZXH A;  4RCO A;  3O13 A;  3FAH A;  2OED A;  3GS2 A;  4JWS C;  5BYQ A;  3TEX A;  3E56 A;  4USA A;  1VZ6 A;  1L0Y B;  1BXT A;  3AE6 B;  3Q8C A;  4B0M A;  1OFF A;  2WXF A;  3DWG C;  4C80 A;  3BK1 A;  3VRA B;  1IGC A;  3EGR A;  1ZOY B;  1RM6 C;  1D4B A;  2RPV A;  1CQV A;  2IJ0 A;  4US9 A;  3B2F A;  2EEL A;  1IBX B;  3AN1 A;  4C7Y A;  2W3R A;  1PGX A;  2YEP B;  2FBW B;  3NVZ A;  1OQQ A;  5JXV A;  3RPF C;  1AWD A;  1FNV A;  3LB8 C;  3J9C A;  1L0X B;  2I38 A;  3AE3 B;  4C7Z A;  2JXT A;  1FRR A;  2VZK D;  3I57 A;  3KLS X;  3BVG A;  2BYT A;  1EM7 A;  4MT5 A;  2CU3 A;  5AUK A;  2LHE A;  1B1Z A;  3KQ4 A;  3MP9 A;  2BTE A;  1GPX A;  1YJJ A;  2WDQ B;  4MAC A;  1BML C;  4WQM A;  3P4P B;  4RGT A;  1XCQ L;  2GI9 A;  5G5H A;  1SIJ A;  1C76 A;  2KAC A;  1ZDX A;  1XF5 L;  2WXM A;  3TUO A;  1DOI A;  5HG2 A;  2AX5 A;  2K3U A;  4RF0 A;  4P6V F;  1EU3 A;  1PFD A;  4LLG M;  2Q5W D;  2WXO A;  2N9K A;  2BT6 A;  2Y3A A;  2W55 A;  3TEY A;  1XLO A;  4OVZ A;  1XLN A;  4A55 A;  2M0A A;  4M0W A;  4JPS A;  4OHJ A;  1L0V B;  2DYO A;  4KGS A;  2JX5 A;  5BMG A;  2GB1 A;  4L23 A;  1N63 A;  2KDM A;  3AEE B;  3ZJT A;  1FIQ A;  3ZQ4 A;  1F77 A;  4ZRQ A;  3AE4 B;  2E3T A;  1VZ7 A;  1C4C A;  4YWG G;  5C2T B;  2ICI A;  5FR3 A;  2WXJ A;  3NVY A;  3P4Q B;  3AE7 B;  2BBC A;  3FIL B;  1FEH A;  4PT5 A;  4KKJ A;  1JCK B;  2PLP A;  2KWD A;  2PMV A;  2M19 A;  1BUI C;  1MPE A;  3AB5 A;  1HZ5 A;  5BYS A;  4ARI A;  3Q8E A;  4YTM B;  2J52 A;  2LGI A;  3GB1 A;  1FD6 A;  1KFY B;  2WLB A;  4AS1 A;  4A6Q A;  4JX1 C;  1MI0 A;  2FE8 A;  5EE0 A;  2W54 A;  1WGK A;  1VDV A;  4C56 C;  1HZ6 A;  4CQN A;  1D5X C;  3AM9 A;  1UGJ A;  4TMA B;  4XWW A;  1FFU A;  1SE4 A;  4TQ0 A;  4LTU A;  3PZ8 A;  1NYQ A;  2KN4 A;  2IDY A;  2WQY B;  1L6U A;  2WXN A;  3AEA B;  4HRS A;  1V1P A;  3SFD B;  5D7G A;  4DXG A;  1TKG A;  2AQ1 B;  4ZYS A;  4FXC A;  2IGG A;  3VR9 B;  3AEF B;  1WXQ A;  2DBY A;  2V0G A;  1QLB B;  3AED B;  2WS3 B;  4RFB A;  1TKY A;  4HKZ E;  2YEP F;  4RF1 A;  2NTS A;  4O1N A;  4IDI A;  4AQ7 A;  2INN E;  4REZ A;  4J3O D;  1E6E B;  5MPO A;  1RWS A;  2WXP A;  3TEW A;  2WDR B;  4A90 A;  1AW7 A;  3Q8F A;  1J7B A;  1FFV A;  1PGB A;  3HVZ A;  1ET6 A;  1TS5 A;  5H8Y E;  2Y5P A;  1I4H A;  2K22 A;  3MFG A;  4KGR A;  1XLQ A;  2WU2 B;  2WXH A;  2JYT A;  3AEG B;  3VRB B;  3ZYY X;  1PUT A;  1HXY D;  1QF6 A;  1ESF A;  2MJE A;  3AEC B;  2L32 A;  1R7S A;  1JW9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...