4CNQA

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 85
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cnqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cnqA01
3AR5A 4BX2A 2B0CA 3ONNA 4L57A 3IJ5A 5AM4A 1U2TA 3EWIA 4J2TA 5ALVA 1Z5GA 1ZRMA 5AKZA 3BWVA 1RMYA 1RMQA 1Z4MA 3KDPA 4I9GA 2FPSA 3QUCA 4OHFA 2GFHA 4L6AA 1O08A 4UAVA 2W43A 2B30A 3R4CA 2OYCA 2YJ6A 4I9FA 2I33A 3RFUA 2HX1A 3R09A 5AW2A 5ALFA 3QU2A 5ALDA 3WKAA 1Z4NA 3E81A 4UM7A 2WFAA 2Q4TA 3HYCA 4EENA 4MWOA 3KOOA 2WF5A 5AI6A 2R8ZA 3FM9A 1YMQA 4IG4A 1TJ4A 3L8GA 4NWIA 5AM1A 2OM6A 2AMYA 3L0YA 1Z4LA 3PCTA 3K1ZA 1TJ5A 2FI1A 3M1YA 4UMFA 3ZX5A 1RKUA 4AS3A 5AK4A 3QXGA 4CNQA 3E8MA 3U13A 1XP5A 4JDPA 2Q4RA 4HGQA 3ET5A 3DAOA 1L7MA 3AR3A 3WKBA 5AVWA 2C88A 3WK5A 3L1VA 3L8EA 3E58A 5ALZA 2JAUA 1PW5A 4ZEXA 5AVVA 3B9BA 2OBBA 4HGRA 4CF5A 1WPGA 4KNVA 1S8OA 2B1RA 2IOFA 4NFLA 3WK8A 2QYHA 1TE2A 3NUQA 2NO5A 2R8YA 4HGPA 1YJ5A 1RRCA 3L8FA 5IT4A 2ZBFA 4YCLA 1L8OA 3L0BA 4NAVA 4OD0A 5AI9A 2G08A 2FPWA 5AW7A 2ZXEA 3GYGA 1L7NA 1QQ6A 4YCNA 5IT0A 4KN8A 2HI0A 3MPOA 3QLEA 4Y2JA 1Z4JA 3ED5A 3B8EA 3PGVA 1ZOLA 4UMEA 4FE3A 2JARA 3SMVA 1QYIA 2G80A 2AUTA 4RESA 4GXTA 4C4RA 4BEWA 1YV9A 1Z4KA 5AK6A 2IA5A 2YFYA 3A1CA 2BDUA 5AM0A 2JGAA 3WKEA 4F71A 2YJ4A 3CNHA 3L1UA 3N1UA 5AI5A 5ALOA 2GMWA 3ZX4A 3A3YA 2BY4A 3FVVA 3R9KA 3EPRA 5AKEA 1Z4PX 2R8XA 5ALSA 4IFTA 1EK2A 3FPBA 4KX3A 3W5DA 5ALKA 3MC1A 2YJ3A 5AICA 3N5KA 1YDFA 4G9BA 5AESA 3RF6A 2WF6A 2W11A 4UAUA 4HYTA 1RLOA 1RC8A 4UMDA 1ZRNA 5AVXA 3ESRA 4O8CA 2B1QA 3IRUA 4Y2QA 1QH9A 1T5SA 2WM8A 3QU5A 1RPZA 1MH9A 2HEGA 3M9LA 3F9RA 5ALXA 3B9RA 2CFRA 3UM9A 3J7TA 4PNHA 1RKVA 2ZBGA 5AHXA 3OTQA 2YBDA 4QQFA 5ALRA 4UASA 5ALGA 1U2SA 3AR2A 5AM2A 4EZEA 3OCXA 4YCMA 3ZTYA 5A3QA 2I54A 4FYPA 3ZTWA 3NANA 5AW0A 2RAVA 3QUBA 5ALMA 3QNMA 4UM5A 4JB3A 1IWOA 1L7PA 3KD3A 3W5CA 4UARA 5ALLA 3QU7A 4Y3UA 2HO4A 3WKCA 1EK1A 2CFSA 2FPXA 3WK6A 5A3RA 1Q92A 2NO4A 1N8NA 1ZD5A 3QGMA 2I6XA 2B8JA 1LTQA 3A1EA 1WZCA 4NABA 2BDEA 4EX6A 3DNPA 2FDRA 2HF7A 3HLTA 4HGNA 3NIWA 5AVSA 2JAWA 2HCFA 5AKLA 1J97A 2RBKA 3SLRA 5AKYA 4YIKA 4H1WA 5ALHA 2I55A 4DWOA 2AH5A 4BKMA 4Y2VA 1U7PA 3ZUPA 5ALPA 1RKQA 4YIHA 2P27A 1S2OA 5E0OA 1Z4IA 5AVYA 5AKHA 4BBJA 5AKKA 2ZBDA 2C8LA 2JAOA 2ZOSA 1O03A 4DFDA 2G09A 4BX0A 3QUQA 1NF2A 2FUCA 5ALYA 3ZWKA 1KYTA 1NNLA 2ODAA 4YGYA 3WGVA 2DQSA 5AK5A 1RQLA 3OCUA 4ZEVA 1VFPA 3CZ4A 2YJ5A 1TJ3A 4HGOA 4BYGA 2GO7A 2WHEA 3L5KA 4UU1A 4XQ0A 4B6JA 3FPSA 3WK9A 1ZJJA 3U7EB 2VKQA 3AR8A 4OCZA 3OCZA 3U7GA 3QYPA 3AR9A 3TLMA 4Y2UA 2EATA 1L7OA 3D6JA 2G06A 3ZU6A 1F5SA 1NRWA 3WK7A 4DCCA 4GIBA 5AIBA 2RARA 1XPJA 3OPXA 3NALA 5ALNA 2X4DA 2YY6A 4QJBA 4NV0A 5AI0A 4BNDB 3IB6A 3NAMA 3PDWA 4EELA 5FP0A 3L8HA 3WKDA 5AVUA 5A3SA 3ZWDA 5AIAA 2ZG6A 2MSNA 1SWWA 2AGVA 3BA6A 4UATA 2PQ0A 3ZW7A 3ZVMA 3L0CA 3SKYA 5ALJA 5AW3A 3QUTA 2C4NA 4CF3A 1U7OA 3S6JA 1YS9A 5AVZA 3QU9A 3WGUA 3PGLA 3FGOA 4OFZA 3VAYA 5AVRA 4XOUA 1LVHA 1L6RA 4CF4A 3E84A 1RDFA 3U7HB 4G63A 2ZBEA 3L7YA 1ZD2P 2YMMA 4Y2XA 3KBBA 1XVIA 5AW9A 2PR7A 4UW9A 2CFTA 3W5AA 2W4MA 5ALWA 4Y2YA 3NASA 2RB5A 1SU4A 1QQ5A 4RETA 5AM3A 2G07A 1N9KA 5AW1A 3I6BA 3QX7A 3WK4A 4KX5A 5ALTA 2YMPA 2HSZA 2D2VA 2I34A 2P69A 1K1EA 5ALQA 1RMTA 3ZVNA 4C4TA 3I1YA 2GHQA 1J8DA 1VJ5A 4J03A 3P96A 2FPRA 1JUDA 2P11A 2IOFK 2WF9A 1ZD3A 1L8LA 4KNWA 3U26A 2G1AA 3ET4A 2IOHA 1QQ7A 4AS2A 4Y2PA 2YMLA 3DDHA 4C4SA 1Y8AA 5AKXA 2FEAA 5AVTA 4ZEWA 3SF0A 3OCVA 3FZQA 5AKJA 2NYVA 5AI8A 2C8KA 5AW4A 2O2XA 1Z5UA 1Z4OA 2C9MA 3AR6A 4E88A 1TA0A 1T5TA 3QU4A 2FUEA 5ALEA 2HDOA 1CR6A 2PKEA 4XPZA 2HOQA 3MN1A 5IS2A 5AK3A 1X42A 5AM5A 5T41A 3ZI4A 3EF1A 5ALIA 3ESQA 4YH1A 1RQNA 5AW8A 4BX3A 3UMBA 2IYEA 3U19A 5AI4A 3UMGA 3UMCA 3U7FB 1Z4QA 1WR8A 5AW5A 2Q5EA 4UU0A 1ZS9A 4DW8A 3ZVLA 2EAUA 1U02A 1CQZA 3N28A 5ALUA 2HF2A 4AP9A 4XE5A 1WVIA 4EX7A 1VJRA 3OCYA 2WF7A 4Y2SA 3OCWA 5AKGA 3SKXA 3AR7A 4UMVA 2HHLA 4Y2RA 4CE6A 3I28A 3I76A 2R8EA 3SD7A 3A1DA 3SHQA 2G0AA 1Q91A 2YN4A 4BEVA 2MU1A 3NRJA 5AVQA 4F72A 1FEZA 5AW6A 1T9ZA 1YNSA 4L6CA 2MU2A 4BNDA 4Y2TA 2CN1A 1Z88A 2B8EA 4MUMA 3W5BA 1RLMA 3N8GA 2EARA 4HAIA 5JJBA 3KZXA 3AR4A 1SWVA 4EEKA 2B82A 2QLTA 3MMZA 3DV9A 3N07A 2OA0A 5AKIA 4KYTA 1ZD4A 2FPUA 4FFDA 2P9JA 2O9JA 1AQ6A 2YMQA 2WF8A 2GHTA 3KC2A 1RLTA 3EF0A 2I7DA
chains in the Genus database with same CATH superfamily
2HA0A 1Q21A 4F5NA 3NWOA 4HQ6A 3IJ5A 4TMYA 1YO6A 4C4OA 1YUMA 4KLTA 2KHVA 2YDYA 1HO3A 2V3VA 1JKXA 4FI3C 5DMXA 1ZQUA 1TAHA 3DVAB 3TW6A 4DCGA 3QSYA 4YDSA 1A1VA 1KETA 2GN9A 2OV6A 1YZNA 5E6UB 1VLBA 1ZRMA 4UAWA 5KSZA 3D4BA 2PR2A 2VRCD 5F3WB 1YQUA 1N60A 2G71A 3M6WA 2P2CA 1YH3A 4BFUA 4EHHA 1T8YA 1XZEA 8GPBA 5JY6A 3O8OA 2QT1A 2J46A 4LJ4A 3ZHSA 1JEYA 1ZXIA 2C84A 1FYVA 5KT7A 2XMSA 3EF3A 2ZJ1A 4HXFB 4PNPA 4UQGA 1J9ZA 4AO8A 3EWNA 1NYLA 3RJHA 1PK3A 3DDSA 4Y9TA 1KJIA 1Y6FA 2UUBB 1SQGA 1ZW1A 4L85A 5IUNC 3KXKA 4QDXA 2IP1A 3RFUA 3AM4A 4DZZA 4ZDIA 4DUPA 4WFKA 3EGDA 3NBYC 3U62A 1PFGA 3WRYA 1BMQA 1W5FA 1KK3A 1X7GA 4X7MA 2A0KA 1ESZA 4OIMA 3CNNA 1RBQA 3HADA 3VCBA 5I7VA 2LPMA 3VI3B 2PI5A 2VF2A 4R98A 4XCXA 2C4KA 2LCFA 1SKYE 3PNBA 4OBXA 3LWMA 4PZCA 5IPFA 1IDOA 1J8MF 2F3TA 3R76A 4D9NA 4ED6A 1V3QE 4YAJA 4EYGA 2EWMA 1I94B 3H1EA 3WYFA 5DWQA 1GA1A 3BQMB 4AYXA 1L7RA 3V2IA 3VM6A 4CLDA 4YBRA 1TX4B 2VUIB 3FAHA 1BH6A 4HH4A 3FNRA 4MTLA 4KBYA 4MUAA 3L6RA 3TQSA 1O3YA 3O8DA 2R66A 5JEDA 4H9GA 4TYPA 2XBUA 4L3VA 4LN1A 1X86B 3K1ZA 3K05A 2GBFA 3V3KA 1XYYA 4GC7A 5G4KA 1TKCA 1EZ4A 2JEFA 3DKIA 3ZJ5A 1TVKA 5K4LA 1UH5A 2OV2A 4LMBA 1U9LA 3JQFA 2HWYA 3KXDA 3T3HA 4OMFG 2O2JA 4GYKA 5HMMA 2XTMA 3LTEA 2J6TA 3MZ0A 4WOJA 1VCHA 3DFUA 2GCOA 2JATA 1E18A 3IQGX 5I4BA 2HBKA 1BC5A 1UJNA 4M46A 4W99A 5GADl 1N61A 1RRFA 2A2ZA 4G0MA 3VX3A 4AZ0B 3KQUA 1E9AA 3HEMA 3E58A 1KFBB 3EGWA 4HRAA 5D86A 4DNOA 3RTEA 1PVOA 8ICSA 1H05A 3UB2A 4R54A 4DA7A 1W1UA 1XEWY 2QRVB 3V7YA 5I5EA 4NXNB 4PBTA 1U3GA 4OJ5A 1XZMA 1P31A 1XFDA 1JDTA 3OJOA 1KJWA 2WSLA 1M74A 1GZ6A 3EFOA 1NA5A 2VJCA 3LDHA 4ZHSA 3ZJVA 3NIGB 2PUJA 3F3SA 4NFLA 2JLCA 2P9GA 4V0LA 2CMKA 4D9JA 5KCZA 2HHQA 4ONEA 2CDAA 4JXXA 3UENA 1H3NA 4EOGA 1YRQA 1SUWA 4UDYX 1YONA 2X7JA 3EBPA 3ZIAA 2Y67A 3DE7X 2P9HA 4Z1MA 2ZWAA 3A1VA 2QWXA 4D9CA 5IT4A 1JIXA 4LDJA 2ZYVX 1NW3A 3K1AB 5EIHA 3G2JA 2HOIA 4EEXA 5JSQA 1G8JA 1BN7A 4H4DA 4KGZA 1AUPA 2ZXEA 3HVHA 2BKLA 4MDHA 3UWOA 5JQGB 2EFCB 1I2CA 4AMGA 4BQRA 4URXR 3AEQA 4IIBA 1KAGA 1EWRA 4J43A 3RS8A 4BEBA 4YMUA 3OOJA 1XTJA 1TVEA 1I6MA 2YL2A 5CD1A 3NGLA 2HZBA 3AX6A 1UPBA 4NK5A 4AJ2A 4R1QA 4FINA 3MHTA 1M3SA 2D2XA 2R2AA 3AZPA 3DO8A 4ASUA 1WPQA 4KJZA 3PVCA 5DNDA 1CYDA 3HPQA 1H8ED 2ZJ6A 4GLFA 1P17A 4N5IX 2A1UA 3V42A 4RVUA 2ZVPX 3NT4A 4GLJA 5DE3A 3GV7B 4H6PA 4K4IA 5BMVB 3WP0A 1BVUA 2GTHA 3MCWA 1TFUA 3IIIA 3S0JA 3TJRA 2PWBA 1Z13A 2B8NA 1CRQA 4ZI7F 5KG0A 1L4UA 3IP6A 3MINB 1X7ZB 1XZBA 4MS3B 3RLFA 3E2EA 4QM7A 1SVSA 2QUBA 4M1WA 1GPLA 4ACBA 2ORED 1HT2E 1ULUA 1T1RA 4TV8A 1Y6QA 2I1LA 1RM0A 5ESWA 1X7HA 1P2UA 1VCIA 1JXMA 4B40A 2VJYA 1OFUA 1JAZA 1AHHA 1ECCA 2XB9A 3ELBA 3EVTA 4M8IA 3MQFA 1DWQA 4QREA 3OE1A 1R4AA 5BWNA 2EJUA 4MGZR 4QDZA 2PL1A 4HWRA 3TIGA 1WBDA 4YJDA 1ID1A 2GEDA 4PG6A 2IPOA 1MIHA 5LB4A 1JPUA 4RVNA 3AY6A 3TTWA 5EMMA 4HYTA 1EVQA 1M2HA 5JLJA 1UXGA 4EA6A 1PV2A 3IKLA 4AB1A 4YUWA 4DMHA 1J8FA 1LKYB 2WYUA 4QJ5A 2QTNA 3BKWA 4LX8A 1ZRNA 4D9FA 1X7WA 3QBDA 1NBMD 2D7CA 2ZUUA 1XS9D 1YCDA 2OAP1 3HKCB 3NJ4A 3NKVA 5ILGA 5JCJA 4AC9A 1HNXB 3QU5A 4I2GA 4GH5A 4CL0A 4BZQA 2GM4A 1WUTA 3CGWA 3ESCA 3I62A 2JGLA 4Y0VA 1PZNA 1QOPB 2H1HA 3D6NB 4R8SA 4HZGA 1RKVA 1R10A 1N6RA 5JJLA 4LQDA 3JAWB 2GJAA 2HU8A 1X7YA 1GKUB 3CF2A 1FMLA 4FFPA 4FCTA 4OAOA 4YROA 2MYPA 4ODIA 4EYIB 2F4VB 3WYAA 2NUAA 4N40A 4EUSA 5AM2A 2FLPA 1DQYA 3Q0EA 5GONF 4EZEA 2HZ7A 3WBBA 4UOEA 2XQVA 2ZBRA 3I12A 4QTTB 4I1IA 4NOLA 5UKDA 2X0DA 3TOSA 3VHQA 1FLVA 2W5UA 1GLNA 5AW0A 1JFLA 1LV8A 1TMYA 2Y0BA 3DXYA 1L5LA 3ISBA 4V1CB 1OFGA 2C20A 2DPMA 1CC1S 1U11A 4PFKA 4WUVA 3KALA 1IWOA 1U1EA 3P9YA 1LJLA 1MJ5A 3W5CA 2DSNA 3UATA 3KZCA 1EK5A 3KTQA 2PLRA 1II9A 1NNSA 5A71A 1RI2A 4BB0A 4WBXC 5COBA 3JQAA 4R1NA 4E33A 2B1GA 3D3KA 3AG6A 1OQAA 3CO5A 1B8PA 5J2JA 1IBCA 4BZXA 3EA5A 2OVFA 1KQPA 2XITA 4YV1A 2I78A 3KB8A 4ZGGA 1BYUA 3FOZA 1O8BA 1O1YA 2IP2A 2ZYRA 1FXWA 4ND4A 3STXA 4YRSA 2XODA 4TMVA 1OASA 4N76A 2VL7A 2BI4A 1SV0C 2Y0SC 5BPCA 3AUTA 3EXIA 2IYUA 4R68A 5FAXA 5BOMA 2F3NA 4JXJA 4BXOA 5ALPA 3I01A 2JGNA 3FSRA 1E9EA 3ZUPA 5JTTA 5KPDA 3C7DB 4GR4A 4JLSA 1YQEA 4HUTA 3JQ7B 2V6JA 2FH5B 1ED1A 3MBOA 1B8UA 2VHTA 1NT2A 3B6KA 4JB2A 1HJPA 2XNHA 4BV2A 2ZQYA 4I29A 3HKDA 3QXHA 4PO3X 4HAVA 4URHA 3NPAA 2HTFA 3DGFC 2JAOA 4F2WA 1THZA 4J3FA 1L5MA 4CM9A 1Z8FA 1ZM7A 2KQUA 1YB4A 1P2SA 3USES 4BNLA 1ZJZA 3CUKA 3QUQA 1Y3DE 5A9RA 4EGFA 3GFTA 1HQDA 4QT4A 4IRCA 3MBIA 4KFTA 1KR2A 4KK4A 4D42A 1RQLA 4YR0A 2O3TA 2AX3A 1TZMA 3TSOA 2Q29A 3L0IB 4OSOA 1EFKA 1MQ9A 1SHJA 4I8XA 2OYYA 1G17A 2VJMB 2Z4TA 4Y7DA 5KFQA 4BWGA 3T12A 1CR0A 1SKAA 5JNTA 2ODBA 4LXQA 4ARIA 1E9FA 2Q8QA 3NIFB 4NCIA 5KOHA 4IIVA 3IV6A 3PXEA 1VRCA 2DKFA 3TN7A 5DSXA 3JW8A 4ROTA 3ZXYA 4QBGB 4YACA 3TLXA 3PR5B 4P0PB 1GNTA 4B8ZA 3ITNA 4QOFA 1PK1A 3CEPB 4Z4CA 3O7MA 5BN3A 5K09A 3MFHA 1E61A 1LGYA 1UBCA 3EZ6A 4L4YA 2QKYA 3AR9A 1TM1E 4ZT7A 3KYCB 3MCAA 4PYRA 4EPYA 4BJ1A 4F5PA 5KWJA 3Q3IA 1KMHB 2I4OA 2QAGC 3WDLA 4RF4A 4YRZA 5J5CA 1FYDA 2BOVA 2A88A 3IMKA 1DDOA 4J16C 1LDGA 1Z36A 3DLIA 1JXOA 3OPXA 2FW1A 4KQKA 4MEJA 1JXQA 3M6ZA 2X4DA 2X9VA 4A1FA 2BFDB 1PGPA 1NY5A 3NZEA 4QJBA 4QG3A 2BFCB 4JEUA 5BYKA 4UDXX 1OLOA 1I7SB 1L7EA 3FNQA 3NVKI 4DGQA 1ETHA 4EELA 2NPOA 2I5HA 2AFIE 2ZT5A 3EGCA 4L1KA 2GN1A 1EM6A 3N0WA 4AZ0A 5JC8A 1IN5A 4JYAB 3WGTA 4DMKA 3WWZA 4LWPA 2QSJA 4YAIA 4A82A 4TTQA 1KK1A 3F7MA 5FTMA 4UATA 3T34A 1CJVC 3TECE 1CR2A 1NOIA 3L0CA 1BS1A 5CTAA 5FIUA 3S40A 1ZR4A 1KGDA 4CF3A 2Q07A 3KTDA 2CF5A 4HGZA 1YR3A 1KL9A 3UXOA 1A97A 2XTJA 3AQIA 4DLXA 3RROA 4Q9HA 1SMKA 4KN9S 2FB9A 4UPDA 4MP8A 1YL5A 4R1UA 4F7DA 5M29A 5EP3A 4XB6B 3PEEA 2Y1EA 3PP8A 5IAGA 4DNPA 3B3QA 4RHCA 4PJ0U 3TNJA 2FE9A 3KYJB 3QFFA 4G5YA 5ES4B 3SAHA 4G5XA 3VYSB 4BE9A 2EIHA 3QY0A 2IFTA 2ODEA 4PPNA 2HK9A 3OLYA 3QPUA 2KIWA 4RNMA 3PQ2A 1RYDA 4O4HA 1NVEA 1P1CA 1YI8A 3DDNA 3MQ2A 4MKIA 4K1LA 4LAFA 1CDEA 5KC9A 1PZHA 2GK3A 1EX6A 1NVGA 4GE3A 3QX7A 2Q3HA 1Y7TA 3AERB 4N47A 5IDWA 3JQ7A 2OO7A 3LWLA 2FZCA 5ALTA 3A7EA 4N6NA 4P80A 3ZZ1A 3S44A 1OLSA 1TIPA 4UHBA 5CPBA 3AEYA 1XKXA 4B0PA 1K1EA 1G0NA 4QASA 1LU9A 4ER5A 2C0QA 3C2QA 3DCJA 2O1EA 3EZYA 3IUYA 4NV3A 3P97A 1K7YA 4M9HA 2PRYA 1U04A 1E2BA 2MT9A 4ECXA 2RGAA 3IXQA 3MUOA 3P96A 3HJTA 2VJPA 4MV1A 4XD7A 4E5KA 4AJ1A 5EEGA 2Q9UA 2OSBA 5IILA 1YDGA 3OZDA 1SY7A 4Z8YA 4ZOEA 2PO7A 3WWOA 5IYZA 1RHUA 3IYLW 3U26A 4P4GA 4YP5A 3C28A 2W8LA 1BGWA 2O2HA 4IEFB 2GK6A 1WMBA 2XA1A 4G07A 4W9RA 3NHPA 5LQAA 1W2HA 3ZGLA 1U28A 4BPBA 4GZMA 1FFEA 1QHIA 1FFUA 3OICA 1DTWA 4J9OA 4IW3B 4QZHA 5THKA 1IY8A 4CEHA 3RRHA 1U8TA 4IF4A 1Y6RA 1PG5A 2EW2A 3FGPA 3GUYA 3MOIA 1FRNA 1T6NA 4PZDA 5D2CA 4DDHA 5JAMA 1W88B 2EBHX 2PKEA 3DR3A 3GJ0A 3AH8A 3QOYA 1AC5A 2HOFA 1MB4A 5IS2A 1KIFA 4IFBA 4B32A 1MHTA 4RL4A 3D2QA 1WB9A 3F2VA 1PG0A 2PSEA 2ZWMA 1QG6A 3B85A 4LZPA 4QXAA 2V7WA 1JJVA 1OX6A 2CLHB 3ESYA 3F3KA 3IVMA 4B5LA 2Z2JA 5IEJA 3PRJA 3H2GA 4OKSA 2C3PA 2IYEA 2VPWA 2ZVQX 2ZPAA 4M8SA 3R5KA 5C18A 4ECSA 1Z00B 1AG9A 4KFSA 5LA6F 1ENYA 1Z2OX 4BV3A 1WXFA 2IQ5A 3DMNA 4GC5A 3R5HA 1S8NA 2JI6A 3K0CA 3KOZA 4IZIA 1MB0A 1ZS9A 4KQ6A 3PQ3A 3Q8LA 5GZ6A 1ZN8A 3K71B 4C3UA 3OZAA 5CH8A 3N2KA 3N28A 3BJEA 1JZTA 1T8WA 1WCWA 2GD1O 5FUWA 4EVRA 4BMSA 1ZD1A 2VF8A 1M2FA 4P0TA 4HQNA 2XIQA 1VKOA 4LDNA 2B5OA 3BHIA 4QRIA 1HLDA 2BQUA 3HHEA 2UVVA 4MVJG 5EOVA 4QYIA 5GONA 2JAQA 2OCLA 1HH4A 1OZ0A 4EZBA 3CZCA 1PFKA 1UF9A 1Z6AA 3MTJA 4HDMB 2WWVD 2P5UA 4B48A 3OQOA 3GJ8A 2FN8A 4YQWA 3WGOA 1FQJA 4PYJA 3DM9B 1XRPA 2QRHA 3LI2A 3OMLA 1IEXA 4PZ9A 4UMVA 4CG1A 3FOFC 3WL3A 2QZZA 3A27A 4MCAA 3LD9A 2VJ5A 3WY9A 1ZL0A 4AZTA 4JLMA 4YPFA 4PQRA 3BE4A 2O8BB 4XWOA 3ZUGA 1WHTA 2WKRA 1ACJA 3W7VA 2HNKA 2YN4A 4OXXA 3GGDA 1BZYA 2I8AA 3RJZA 4GVPA 3U9SA 1IXRA 2J3MA 3M34A 4AYBF 2QGZA 4TKLA 1KDZA 4GOXA 2BDPA 2RGUA 1RJ9A 1XDSA 2HXGA 1JG2A 1NHWA 1H5QA 1G3RA 4NCJA 5C35A 1AUXA 4BMOB 1SVMA 2RH5A 3INRA 1SB8A 3LRTA 5JJ5A 1NSYA 2JLVA 1OWOA 4QOSA 3AGQA 3A1WA 5J2KA 4XWGA 3LGSA 3PNLA 1UBLS 2Q3EA 1JR4A 2PS0A 1EJ0A 5JJBA 1X1DA 4PIMA 7ICJA 1EGHA 1SBCA 1BPXA 2J09A 5FLYA 1N4DA 1UT8A 3VYVA 3ZY4A 1MO2A 3FFWA 4UBMA 1THMA 2WTFA 3K1JA 3MJHA 2OD7A 3HSSA 4LJKA 3SQMA 1T36B 2OHGA 1T0UA 3KKKA 3KVYA 3PUKA 4HH1A 1JR3A 4J0JA 4HEA1 4EL5A 4ESOA 4YT8A 1GD1O 4P4SA 1DEHA 3PGMA 3DV9A 3SE0A 2XCIA 1MJHA 2J3HA 2JA1A 3R0ZA 4JJGA 4L5CA 1B41A 1E3DA 1UBUS 3Q41A 1ACLA 2XO7A 4C0SA 4I4CA 3IUJA 1AF7A 1OXBB 4NHOA 2PUCA 3KHHA 4MIYA 1GCGA 2QRGA 5DLPA 4OYRA 1IZYA 4B9UA 1RLTA 5KMGB 2NVUA 3EGDB 3NX4A 4J2TA 4ZCQA 4EJ0A 5C3MA 3A2KA 1QZ3A 4HX9A 4NVRA 1XUOA 3OFVA 2BFFA 2ZAIA 3B78A 1SHZA 4DIFA 3ACDA 4HX2A 3MAAC 3QTLA 2O2YA 3PNCA 4NDNE 3OZTA 2OR3A 4BMZA 1LTHR 3UBTA 3I61A 5HYVA 5K03A 1KJNA 3HUDA 4DL7A 2B8TA 2YZMA 3L7LA 3FRIA 3H11B 4L15A 1JHOA 1Z29A 4M9XA 4JLPA 1QS0A 2LUOA 3ZWQA 4K6KA 1RZRA 4I9UA 4CKBB 5C5EA 3EXG1 4I2NA 2GCOB 2E8MA 4ISBA 2W43A 1ZHFA 1FP7A 2B30A 4KE8A 4MAMA 3TCXB 1SO8A 1QANA 4N7RA 4E14A 2EAPA 4EDFA 1IY0A 4RTKA 3I9OA 2YVLA 2B34A 3GLFB 3RKRA 3V1LA 5LBTA 4O2BB 1L5SA 4F5YA 1J70A 3YASA 4RK7A 2FA9A 4RTJA 1SZJG 2JCGA 2BKAA 3Q0TA 4OLJA 3ROZA 3GL9A 2QQGA 3E9EA 3GC6A 5ELXA 4LGVA 2D7DA 1L2TA 4HOYA 3CF6R 2QS9A 3DBOB 4OA5A 3W2EA 5HZGA 4JIGA 1AGNA 4MX8A 5F1OA 4PC6A 3COVA 4NWIA 2RCYA 1ZQNA 5H8WA 1ZD9A 1G2OA 2OM6A 1RBZA 3U09A 1OGIA 3H5NA 1LBEA 1XSLA 2ZULA 1NRXA 2M2IA 1F1JA 4M6WB 1X9IA 1AKUA 1LTKA 5DXAA 1M6NA 1DI0A 2FN7A 3A7DA 2VPPA 1C7ZA 1GZ4A 2N1RA 1NL3A 8ICOA 1N2HA 2HMTA 2Q3MA 4Y1EA 4KH0A 3U13A 2VF7A 2W2VA 1MQ3A 2HCRA 5C7LO 4B2YA 4JNCA 4PRKA 1NXTA 2KX7A 5KNDH 3VNVA 1PYGA 1SCBA 4PGGA 4FBTA 1BU8A 1QDLB 5A2QA 2Y1KA 3BXGA 1CUJA 1ZPDA 2BUBA 3BFXA 1S9DA 3L1VA 3K5WA 4P81A 3ZGNA 3PIDA 4O29A 2EC5A 3GRPA 3R3ZA 3SZ3A 3AWIA 2CHQA 3SZMA 1PJAA 3EG9B 5DHUA 1NPDA 3VUEA 3WDSA 3BVPA 2IA6A 1Y0BA 5KDOA 2B1RA 2NUTA 4AZSA 1YZQA 1X6JA 1P61B 4QUEA 2VNAA 3BJMA 4WERA 2P35A 1H2YA 1C7YA 4WKPA 4B9EA 3DKPA 4NBSA 1OCEA 2WAAA 3I9V6 3NUQA 1DINA 1RAGA 2R8HA 2HQBA 2ZTVA 3EC1A 4U7GA 2ZXHA 3NVWA 1DJNA 1G2IA 2GKGA 4B2LA 3KSUA 4KE7A 5EKUA 4YRPA 4QZFA 1RRCA 1STOA 3SSAA 4KLZA 2Q4EA 4B75A 1PX2A 4WE3A 5T4EA 2G72A 1HG1A 3PC4A 4MLCA 3REQB 3MJDA 1MVLA 2MTBA 3V4VB 1NRIA 3LDAA 3R6WA 1RYYA 3MOGA 4JI6B 1V9PA 4YQFA 3G8DA 1FFVA 2C4VA 1ISIA 5ILQA 4MVCA 5CA1F 1AD2A 4U7JA 5FLKA 2Y1FA 1R0KA 2XDAA 4CU2A 4Q3CA 3ED5A 3IOMA 3IDZA 4TL8A 3RO7A 1SU8A 7ABPA 4LF4B 2JARA 2HADA 1LC0A 4AF8A 4L08A 3R8FA 2J5KA 1RWVA 3ZJTA 1QBGA 5TJHA 1U1GA 1A96A 3SY8A 1YV9A 1RRMA 2IA5A 4ECAA 1K6MA 4TRMA 1T4BA 4YBZA 4DJFC 3MUNA 2PCLA 3MGIA 3RIEA 3I9NA 3MIIA 2QQEA 3JPPA 1J06A 2F3PA 2H7CA 2NNLD 2RJNA 3ORQA 5FEMA 3OQ6A 2R0QC 2R85A 3L1UA 1Q3UA 1CUYA 1YCHA 3TLGA 5E79U 5DQIA 3QENA 3MMXA 4BOYA 1EFCA 1JKJA 3H8SA 1W4ZA 2DULA 3UOWA 5JBIA 5LL6P 2HWWA 2QRNA 4OY3A 2YBEA 1G18A 3DWGA 2W6JA 4LF9B 5BWOA 3NIDB 3AVQA 4XYBA 1NDUA 2QLLA 3GO4A 4I4NA 5ALSA 3WNVA 2VA3A 1U3FA 3LLCA 2JGFA 5CMLA 4ZT3A 4DLYA 4PC7A 4GX0A 2KJ9A 3PSHA 5LXTF 1I0IA 1ZH4A 1FVHA 1T1JA 2YJ3A 4RJ2A 1MU0A 4IYJA 2OY0A 3BX1A 3GPCA 1Z2PX 1ORTA 2Z8YM 3IUQA 4F0JA 2OM2A 4UNSA 4NRDA 4G9BA 1WM1A 4Y9DA 4YQYA 2I99A 2EU8A 3GPIA 4ECUA 4M9LA 1DELA 3G79A 4URYR 5GY7A 4AF6A 1A9XA 3OA0A 1JHAA 3Q7SA 5G1PA 3GU3A 1M1YE 3THSA 5KFUA 2HUPA 3VR5A 1ZQOA 1OV6A 4RCYA 3RJ9A 1WYGA 4NJ8A 1OYOA 3BGWA 5DT2A 3ESRA 3ZHCA 1N0WA 1WU7A 5K99A 4C5BA 1O0CA 1U1CA 1C50A 3WZ2A 3AUAA 5LMUB 3MFQA 1M0SA 2J07A 1C1XA 4FT4A 2VHJA 1DK3A 1GA4A 2W22A 4HVTA 3TG8A 1GGVA 2JLUA 4WIAA 3E5HA 2VYFA 2FTKE 1P2VA 2V9ZA 1G59A 3FF4A 1G7TA 1KXJA 3QUAA 2WJ6A 2TYSB 2H1SA 4Y1GA 3AJDA 5BNWA 1VE5A 4Q05A 2OH2A 4NE9A 3OHAA 3HV0A 4CCHA 1HEYA 1YDMA 2WW8A 5EJEA 3NP7A 1L4NA 3OIUA 3RREA 4IQFA 3O7WA 3WQHA 3H99A 3VV3A 1GPBA 4WOCA 2IU3A 4Q1EA 1H4TA 5HKKA 2ZIVB 2ENWA 1DLJA 1YQTA 5C5DA 4M9NA 1BQEA 2XIJA 3N87A 1FF9A 5BWBA 2P6PA 3C8UA 1IN1A 4MTCA 4INJA 4JB3A 1Y3CE 4MPJA 4F46A 3WWDA 2FW6A 4RK1A 3SE7A 1EGAA 2I1QA 2NSLA 2DFDA 5LIRA 1SXPA 4TS9A 4K03A 1ABFA 3EWSA 1NASA 1CJUC 1SM4A 1WLYA 3E61A 4M0MA 4MMZB 4Q7EA 4B3IA 3DE5X 2GJ8A 4EHAA 1G5RA 2QGNA 3GJ5A 1PD1A 3AEKB 3V55A 4ZHQA 5KJFA 5CCXA 2R8OA 5EJ5A 3FCCA 3BQ2A 4QQRA 3V1MA 2PH7A 4KQMA 3RAGA 1G5PA 1MC1A 4OHPA 3D3EA 4UREA 3VVCA 2GBCA 3GYBA 3JQCA 2FWRA 4IQVA 2QTVA 4TL7A 1UJ4A 5ESDA 5JNVA 2IXDA 9ICJA 4EHJA 1VDVA 4M0CA 3H5LA 4IO0A 4MVJE 4RF2A 4JLAA 1GDDA 3CM0A 3COPA 3N8IA 4YAKA 1Y7LA 1FFXB 3BXHA 3BILA 4FYJA 1ZI8A 3EQ9A 2XD4A 3QVLA 5CWRA 3BL5A 3Q7RA 4FOTA 1J99A 4IIYA 1U8FO 5HQ3B 3ERCA 3KAQA 1JGTA 2MA1A 1OAAA 4QL3A 5ECDA 3SBXA 4J4BA 3C1ZA 5AKHA 1MJNA 3GRYA 3VJMA 1KEUA 3BCRA 4TXNA 3EDRA 1Y8ZA 3BSYA 2V96A 4ND6A 1ZQHA 3SXJA 2XI9A 1ZBQA 2VK1A 2IS4A 1PJLA 1P3JA 3A6HA 1KVRA 3N2NA 3TQFA 3RJFA 3P9XA 5U4XA 1FJHA 3N7UA 2PT9A 2H16A 1N92A 2C5HA 1NW4A 1KQ3A 3NWBA 5IUJC 1P45A 1B7GO 5FOVA 9ICLA 3TIVA 4Y6PA 1SPBS 4CTMA 2CHGA 3RSLA 4WMLA 1WXHA 5KSPA 4QM6A 4XVHA 2I2AA 5EXEA 1FFWA 1B4FA 4ZOBA 1T9DA 5C4MA 1DFHA 3NXKA 5MFZA 4B6GA 1ZOIA 2OZVA 1JG1A 1M8KA 2ONCA 3TARA 1R6UA 3D8BA 2UYHA 1NU8A 4AS1A 4FSDA 2AQ0A 2EFEB 2J6CA 1GFIA 3R3SA 1T15A 4DL2A 1F06A 2H4WA 3EC7A 4RORA 4NQZA 8ICXA 4CIDA 2BH2A 4QFMA 3W90A 3OCZA 4EMBA 3U80A 3U7GA 1NP3A 1Q2UA 4Z6FA 4CKEB 3HCRA 4HWKA 1GAQA 2EATA 1JI0A 3TW4A 4ID3A 2EYUA 3HYTA 5I8WA 1ONPA 4ZVKA 1UAYA 1QO0D 5I7OA 4EB6A 2R7AA 3UJ9A 4B76A 4BB9A 2ZDGA 4E5SA 1YBHA 4YEDA 4I4LA 1U8CB 5AIBA 4MR7A 4NBKA 2VTVA 5H70A 1E8DA 2NM0A 3AESB 1QOQB 1OZHA 1Y1RA 2ZIUA 4FSHA 1BE0A 3H84A 2D4HA 4IS3A 5DVZA 2QLFA 5P21A 3W1EA 1JWLA 1SVUA 3SHTA 2WK1A 1TUEA 4OQNA 4R2LA 4UTVA 5AUOB 1JYEA 1KQGA 2IMWP 2NUBA 4QZ9A 3DKRA 4MVJA 3UMYA 1MW8X 3CLUC 3IQIX 4KI7A 4KQ9A 3AEVA 2X3YA 4TLLB 1C8KA 2YQEA 3QEMA 4LZOA 1FW6A 1ZQYA 2JZNA 2AGVA 2I4MA 3BMQB 3P9NA 3DLHA 4C6SA 3HQ4O 3MJRA 3RQIA 3RF7A 1E9RA 5KG3A 2ZRLA 4QUDA 5FULA 3VNSA 3O21A 1U7OA 3CTMA 3NBAA 2NYRA 4L75A 3COJA 2G7MC 2J0UA 3E15A 1EEHA 1HL3A 4IVPA 3IOYA 2YV3A 2Y0SF 4H1TA 3HH8A 1II0A 2VRWA 1RDFA 5JSHA 3D8RA 4JASB 1R50A 1BN6A 1MKYA 2RH8A 1YFLA 2VP5A 4QU0A 4O8ZA 1GXSB 2ZSBA 4GF5A 1HQYE 4K81B 5JO9A 4QVIA 5BOVA 2KMDA 4G01B 2H7VA 4C0XA 3U3ZA 3FVRA 4I6EA 1YBFA 3DWFA 4YRBA 5EE3A 2QNIA 3PDHA 4GOLD 1OFHA 4OEHA 1L7QA 2TMDA 3AI2A 5L7TA 4BQSA 4MIOA 2UVRA 2J85A 3EPIA 2AEEA 3GT4A 4LI3X 3UXMA 1YZ7A 4FT2A 4NM2A 4FMBB 1U45A 2WIDA 3PIIA 1RE0A 4CL3A 2YJZA 2E87A 3EGXA 3GLQA 2D2VA 5F33A 5FUXA 3M8KA 1VIVA 2R6R1 1UBRS 1SIJA 3WB1A 1QHYA 4JX9A 3PQ8A 1BNOA 5KJ6A 2GESA 1MAHA 2C5BA 3W2HA 3IE0A 1Y48E 5FHQA 2AKAB 4RQ1A 3JWJA 2P9YA 3FHJA 3E0QA 3RC1A 1E99A 4OAPA 4PGAA 5IJAA 4RQMA 2OQRA 4PWYA 3VDMA 3VGJA 2HJ9A 3FRHA 5HS4A 1Q8KA 4PZOA 3NBKA 2Y05A 4M2LA 4CQMB 1KQFA 4DLVA 4WN9A 1N77A 3MF4A 2PM8A 4EPVA 2J3KA 3S2SA 5HKBA 4KFRA 4ZVOA 1PSWA 4I28A 2GZDA 3H6KA 1FTQA 4UB1A 1VI2A 1YDEA 2WAXA 2BFDA 4BATA 4D3YA 4ALLA 1O4VA 3BCSA 1R0XA 2X0IA 5F2NA 5LXTB 1KY4A 3OD5A 5CLFA 4FILA 1OU0A 1QVAA 4OF4A 1U6JA 4EBBA 4EZ6A 1SRQA 1UPUA 2UVUA 2RK4A 2WIKA 1DO8A 3FTDA 2VYQA 4KLGA 1PTKA 2VIXA 3MJTA 5K0ZA 2YZ2A 3ZH2A 2CLFB 2G7ZA 4DYHA 4BGVA 7ICKA 2DB3A 1WPXA 4XYLA 3H9BA 3DZFA 1E7SA 2I6GA 4NU0A 4BRWA 4JI4B 2J8ZA 1EWKA 4BQQA 2D5CA 2QD3A 1YB1A 4Q4HA 2W04A 1N2CA 1WR8A 2EXXA 3PUHA 3M83A 5AJZA 5DRTA 5AW5A 2WD9A 4J7XA 1THTA 5FD8A 4X8MA 3SIPA 2C82A 4XPIB 1XQ9A 3UJ3X 2F48A 4E13A 1NBMA 4Q39A 2HJSA 5LDHA 4ECWA 1DIBA 2F3UA 2PMZC 2DPIA 2K8AA 3DVLA 3QBEA 1V3UA 4CTOA 5J0RA 1VJRA 3LBNA 4NC9A 4AUNA 3AOGA 2V03A 2CEAA 4X84A 3F47A 1C80A 5C4GB 4PHPA 4LJAA 4IXDA 1SH7A 1N1DA 2WD7A 4QEZA 5D7NA 4G3IA 2ATIA 2QX4A 1XWFA 1NUHA 1CP2A 2HO5A 2OAQ1 1A9OA 3FX2A 3GB9A 4DBLE 2JGRA 2FPGA 4F1JA 2DUWA 2OP1A 3N0TA 4FX5A 5IC4A 4UM9D 3TKLA 4EG3A 2IELA 2D3TA 1U7DA 2QUZA 3OLCX 4Q3DA 4UUAA 1QIEA 1H5UA 2VDMB 3MWGA 1QF9A 1B0XA 1Y8QA 4PBSA 5TQ0B 3GRFA 4RF5A 5SYNA 3RS7A 4B85A 1OW5A 2IW1A 1XRNA 3ZQ4A 4WCFA 1FFCA 1UK9A 1UJMA 4MPRA 4KXLA 4NL9A 3CQ9A 1HE4A 3BK1A 3O73A 5NLLA 3A3KA 4ZHQB 3I9KA 1JEQB 4X65B 5CLHA 3TNLA 1DOAA 3BMOB 1OXVA 4D56A 3WBFA 5AH0A 1UBGA 2ACKA 4B3MB 4QPZA 3JQAD 1V8PA 2FETA 4NBWA 4OL9A 1X8KA 2NU8B 1X7DA 3TO5A 1Y4UA 4Q44A 4XUGB 4EAQA 1ZK3A 1P8AA 3HWWA 2YOGA 4U6PA 4KGXA 4Y0NA 4GZ5A 2AU0A 1EINA 4UZEA 2EARA 3AB7A 3FLBA 2Z9BA 2Q3FA 1LFDB 4KACA 4YAFA 4MHVA 2V4ZA 1JIQA 1LD3A 2L17A 3EFBA 2BPGA 1NR5A 1CEZA 3H83A 4KPUA 5H80A 5IBRA 5H9VA 5KWVA 4UB4A 5BRJA 2L2QA 4GBGA 3DMRA 4IVRA 3NVZA 2DTXA 4N4AA 3H2IA 4CT0A 2JZOA 3OU2A 4OHRA 4OK3A 3VSEA 3WOHA 3KVNA 4YJ2F 5DHQA 1BHQ1 3R0IA 1JWBB 2CHEA 1XQWA 2Y1GA 3AFGA 3P32A 5CH5A 5JBNA 4S1PA 3ROKA 4RJKA 4CUJA 5DSZA 2R5WA 3JQQA 1IJFA 4BFLA 2VLBA 5HE8A 4Q8EA 2BGMA 3UH1A 1ULAA 2O8DA 1MAAA 4S1TA 3QQ5A 5CP2A 1XEXA 4LHEA 4ZOLA 2A1JA 3ONNA 1DTEA 4L57A 2UDPA 2PUTA 9ICSA 1JVSA 1ZQ9A 2WJPA 4Z3DA 3L9WA 3Q6MA 3TTTA 2VKTA 1VLZA 4I1SA 4A0RA 4C4PA 4YR9A 2VZ0A 1J8VA 3H04A 4D26A 3G5MA 5BQXA 2V6IA 3C4VA 1D1SA 4ERNA 2BR0A 3DT6A 2V6FA 3K2EA 3QG1A 3UPUA 6NULA 2PLNA 3HN2A 4YRFA 3C15C 2L19A 1MH1A 3RTGA 4MWSA 1I2ZA 1WMDA 1TAQA 4W7IA 4G1UC 1OBFO 4UQOA 1D3AA 4PHFA 2BQ3A 2OLKA 3OHMA 3Q3JB 4JQSA 3B6ZA 3SMQA 1CRWG 3T9EA 5IXYA 2QZ4A 2HHUA 3G0CA 4EJFA 4YCCA 1XR3A 3KKOA 4FDUA 1YE8A 3RUPA 2FLNA 3VR5D 1JSRA 3A1UA 3KEOA 2ORWA 5T8KC 4ED2A 2XB8A 4BNKA 4EFMA 5B1YA 1I10A 4LUCA 1BJKA 5J0YA 2O1SA 1CULC 4MWOA 4M4SA 4UM9B 1SNYA 1Z7EA 1NLMA 4DSJA 1XJ0A 1A4XA 2DP4E 2GF9A 1AM4D 3BCHA 5U4QA 5BMVA 3HDJA 4WV3A 3L8GA 1L4GA 3RRBA 1F8YA 1QPGA 2IHVA 1QYCA 2V1XA 3RC2A 4MCJA 4B31A 4F4JA 1PVVA 2P1RA 4IXNA 4MYHA 3K9BA 5EMHA 1L3SA 5J5AA 5K0BA 5KYYA 4KRFA 3MS2A 1G1MA 5I3ZA 4YVZA 1ADJA 3BH0A 4FD2A 4MI9A 3REQA 2XYRA 5JSZA 2AR9A 2J5QA 1NVVR 4JDPA 5CA0B 1D1PA 3RAXA 1A98A 2QVXX 5EXXA 3OWXA 3C6XA 5GVSA 4EJSC 1ORVA 1R37A 1DIOB 4L22A 1ZYQA 4GI7A 4WESA 2R8JA 1IEWA 5IT9A 4RLHA 4NFYA 1FNMA 3NT5A 4ZQEA 5EIBD 5IULC 2D54A 3D6TB 3PT5A 1QSGA 4WJ3B 2VTEA 1Q17A 3ASZA 5E7QA 5EWJB 4CDNA 2YWJA 4X8HA 3GEBA 1WPGA 3K0HA 5CXSA 4R05A 5HOEA 2WYOA 4EKNB 3UVEA 2IOFA 1G4HA 2VDLB 2PYZA 3A36A 1DKLA 1TE2A 3CKYA 1PNTA 1Z82A 3NEPX 4FHFA 1U0EA 5EUBA 1M72A 2QT9A 3F5SA 4PWZA 5BR8B 5E7IA 5DDYA 5C53B 2R8YA 2VIIA 1R6XA 3QLTA 4HGPA 3H5IA 3IEUA 1HYBA 2BM0A 2X5JO 1BWRA 1QR6A 1MGOA 3SAFA 4P98A 3VJKA 2FR1A 2O2EA 2X8BA 3F6BX 4MLPA 5CAEA 3U4DA 1SVIA 1XFAA 1BDJA 2ZRKA 2XKJE 4DR6B 3MWFA 4ZO4A 2GVZC 4QULA 5EE9A 3GA7A 3T0FA 3W6UA 5B57C 3K35A 4D6YA 3JWIA 5FX2A 1YZYA 3X1JA 3LT2A 3FIUA 2A4MA 1X3LA 4B9MA 4BY9E 5FBWB 1ZQLA 1E2PA 2XT0A 1J8YF 4I2BA 2ZR9A 3EHEA 2XNCA 3UJ7A 3W3AH 2D1TA 3Q7IA 3C1AA 4D97A 3W9UA 4AUEA 3FCUB 2OESA 4DNQA 3THWA 2NRVA 3KHSA 3PGVA 3SGLA 4X41A 1HI9A 4RAOA 2OO5A 1U0NA 4QOIA 1MB2A 4XA8A 4IUBS 2Q5HA 4BEWA 2YY5A 3IAM1 3O0TA 4IHJF 5CIYA 2J9RA 1ODFA 4ZCPA 1GKLA 1XZIA 2V9WA 3GJRA 4LJLA 2VS1A 5I6DA 4W1SA 1OLUA 1H1DA 2W7PA 1P80A 2Q4BA 4C21A 2J0VA 3ILVA 4FGSA 3NHRA 3G6WA 3OVMA 1K9SA 5J0WA 1KORA 2WT8A 3M6IA 1GIAA 2Z9CA 4EABA 2Q1WA 1YK1A 4Y6SA 5CDGA 1C1XB 1X9GA 4XGKA 5G0UA 5K0CA 4G23A 2A9QA 2PLFA 1T2NA 2LMRA 3IEPA 3GFGA 4ROSA 4BQIA 2VTBB 2ODTX 2AHRA 1Q16A 4J8PA 5B3LA 2G83A 4ER0A 4TMTA 1BXRA 1VXRA 2BGRA 2M9MA 3F1LA 3L7NA 3X1DA 3U4QA 1OFVA 1R12A 4X97A 2PNJA 5ELLA 1K8YB 1XALA 5EMLA 1N0VC 4MUKA 4ABTA 4BNJA 1OIXA 1V25A 3GG2A 2QROA 5E9QA 4LFBB 3UPQA 3BIWA 1K9VF 1B26A 2CK3D 1XKLA 2X86A 3ICXA 2ONZA 2VQ6A 4Z0NA 1L5HA 4MR9A 2CGEA 2G9ZA 3PV8A 3CS3A 3ENWA 2GUWA 4GP9A 7ICTA 4RD1A 2Q1XA 4RM3A 1Y1SA 1I2MA 3DYVA 3G02A 4HNQA 4RLSA 3E2PA 1OVMA 1L3UA 1TF5A 1Z7GA 5C51B 4B3BA 4TXJA 3UMVA 2AKYA 4QBTA 4DCSA 5JPDA 4H7EA 3KUKA 3DAHA 4RCZA 4KXWA 1WVMA 4QYSA 1NBAA 4DHEA 5HUQA 3EFEA 1T3NA 4JY7A 1UM9A 2ZAOA 5MN4A 2G9VA 1UIRA 1JXLA 4F4XA 2G17A 3FYUA 3NHJA 1KRHA 1XLVA 4W5TA 4JLNA 4FPXA 3EXFB 1H2RS 1N6PA 5BPHA 1A9RA 1U3TA 4ZT6A 3LT5A 1QZTA 1F9AA 3HY3A 1PS8A 3NO4A 5KOYA 4FYPA 1LQ2A 1OAOA 4DSKA 1JSLA 1QGZA 2OZLA 3NAQA 5CLGA 3QUBA 2Q5CA 2ZROA 3M89A 4YQZA 3TDMA 4YPVA 2C5EA 3KD3A 5KX5A 2RCNA 2FR8C 4F56A 1W5AA 1C1YA 4W5OA 1WTCA 1OX4B 3PJDA 2HBJA 3GDHA 4J91A 5F98A 2W2LD 1LNQA 1NJFA 2C29D 2NX2A 3R0JA 4PX3A 3R0QA 4BRUA 1NFRA 1WSWA 2PA0A 2R6DA 1AXGA 1G5IA 4N9WA 3RS2A 2QR3A 2O19A 2I7XA 2BKEA 2ZBUA 1BJTA 1HDZA 1U1FA 1P0MA 1QIGA 2W6IA 3H1FA 1JNYA 2CXUA 1FNSA 1OUMA 2EYQA 3EARA 3PDJA 5GTHU 4U02A 4MV6A 5BR1A 1VL2A 3HLTA 2KZMA 2FMFA 1UA1A 1LPMA 1SC3A 1W85A 5SY4A 2CUKA 1YHZA 2ZRHA 1IAQA 3H5AA 2VJMA 4F3OA 3B9JA 1U65A 2AWNA 1S9HA 1TJNA 2WHRA 4AKIA 1I6KA 5FLXA 1A72A 3HJUA 1MV5A 1S10A 7ICGA 2DSTA 1D6NA 1S2OA 2WD8A 3C87A 1M34A 3EQ8A 3G2PA 5AHRA 1KY2A 5TEWA 1P1IA 4N12A 3P94A 3HO1A 1N2IA 2P1DA 4LSGA 3BCUA 2VH5R 1NW5A 1SXJE 1NKSA 4OB6A 4QTZA 1E1YA 3X1YA 4EZIA 3T5AA 6Q21A 2HHAA 1X80B 4Q5IA 3H3FA 4G2NA 5KAFU 2KSOA 3TVYA 1W7AA 3AHCA 3SDZA 1NVDA 1NF2A 4LEIA 5EN4A 4G9EA 9ICOA 3KE8A 3UPDA 1NNLA 1DXSA 2PD3A 3DZBA 2DJ5A 2BFMA 2XJ4A 3CIOA 4XFKA 1WW3A 2I0FA 4KXVA 3TQOA 2X6TA 1SIBE 4A9AA 4DSZA 4CF7A 3TZKA 5A4JA 2FCAA 1SG6A 3IHTA 3NVYA 3EXIB 3QEMB 4Q12A 5H83A 1QQBA 3R9IA 1H94A 2BMFA 2BRUC 1Y5LA 3P0IA 4MW1A 5EJ2A 2QX8A 2FN4A 2OBXA 3BMQA 4C7XA 4C3ZA 2HWXA 3L6UA 3WLKX 2P3QA 5D85A 3NHKA 4ITVA 1A8SA 3OZUA 2XY5A 3J81k 1PBNA 1XCLA 4L9SA 4OQPA 2QI9F 1FFGA 3O8NA 4GYWA 3FC4A 3FKSD 3U7EB 4MGIR 3U7IA 1K0FA 3D2SA 4OYYA 3WB9A 2GPAA 4BWFB 5FUQA 2WB2A 3QYPA 4Z4HA 1QTQA 4YDHB 3TLMA 3UF0A 4XB2A 3T38A 1JFVA 2HH9A 1PJCA 1QDUA 3JYLA 1V6CA 1CUIA 5F7JA 2PZMA 1BWSA 4OFXA 4IS7A 2CNWD 2UVPB 4ZI7B 1UKAA 3IAXA 4XYEA 9ICEA 1T4MA 4M47A 1XXHE 4PYOA 4KK3A 2BFWA 3RJTA 5IN4A 3CR8A 3LLMA 4V3BA 2RHJA 2CLDX 3LWDA 4H08A 4EYEA 3BN3A 1PEKE 3QYJA 2W8ZA 5CTJA 1XYGA 4DQSA 2H1FA 5EAIA 5JS2A 5CFLA 5JYDA 3PDIA 2UYGA 1TTHA 4LZJA 5KG6A 3IEXA 1K6IA 3E2MA 3GOHA 3HXMA 1GTL1 3MLAA 2PZKA 3K31A 4EJ6A 1KEKA 4HNAA 4A8HA 2BF7A 2LYBA 1ZHHA 4IGAA 4TTPA 1K7CA 4YP7A 3C5CA 1XLTC 4OHZA 3KP1A 3V1UA 2YXNA 3RYHA 2FHSA 2I4TA 2P9EA 1QFZA 1B3RA 3PL1A 4HQ0A 3H05A 2IXGA 1XRLA 4IDOA 4QRHA 2PL5A 5EGSA 2QPTA 2FG6C 3FNHA 5AQEA 4C7YA 1BEZA 1JB1A 4MEYA 1REQA 1C9NA 2FSHA 3ZWNA 4D6XA 4YYEA 2VQEB 1PFWA 1ZJNA 3HYRA 5AUNB 2FF7A 3RBDA 3T95A 1HIWA 1BFDA 3LUAA 4OHBA 4RPJA 4YC7A 2KHZA 4DQXA 5D87A 1QG0A 2O7QA 5DNCA 1SXJC 1OB5A 1ORIA 3ZDEA 2ZJ0A 3ZD8A 3LO5A 4G63A 4OLFA 3WMFA 1ARZA 5BSRA 2GRAA 5JPIA 4RE5A 4ENUA 2D62A 2PR7A 5AW9A 3RS4A 4F9TA 3RSHA 2IEAA 1MABB 5EPOA 2H11A 3MLBA 3F8SA 5KFXA 2BELA 4QTXA 1K98A 4BIMA 5IJ0A 2NYAA 1PNVA 2EKZA 3MVEA 2XMPA 5DG7A 2W54A 5FWDA 3AXSA 3VXKA 4A10A 3KAPA 4J0IA 4YRAA 1USGA 1N9KA 3HJNA 3OESA 2WNHA 3N74A 4YR7A 1X1RA 4MFAA 2EGHA 3CUUA 4WZAE 4BP1A 2E1RA 2OV4A 5BSUA 3ZDRA 8ADHA 3IKVA 1ZCZA 2Q2NA 3OIDA 1FP2A 3HR4A 4Q3KA 4U5QA 4JX8A 4XIYA 5DBHX 3TTYA 1R15A 4GL4A 4UAJA 1R0YA 3M9XA 1CEQA 1X80A 3I2HA 1V4VA 1J5PA 1XLTA 1TK3A 2I2FA 1Q7CA 4DLKA 1JIKA 1PL8A 1UFOA 3LKZA 2XB4A 1OI4A 3F98A 4V24A 2Q4OA 4RZIA 2R7KA 3D4NA 3MGGA 5FCDA 1RAFA 3RSCA 3V8PA 2BZGA 1UZUA 4YJFA 3BL8A 1N7IA 3BS7A 2AJQA 2P2ZA 4CIXA 5GAJA 3DB1A 1NZJA 3KLNA 3IDQA 1KJ9A 4POAA 2C00A 4Y2PA 4H31A 4Q4HB 4C3VA 3DDHA 4C4SA 1NKVA 1TTPB 3FMPB 3I92A 3KEMA 3B53X 4IMRA 4OG2A 4PZ0A 4XCQA 1ZVMA 5FTWA 1CP3A 3UH0A 4OGWA 3REGA 1QCKA 2BTQB 4YCXA 1AF4A 2QRMA 2XB6A 3NPMA 3W5UA 4PHEA 3KOXA 3QU4A 4KRYA 2PJUA 4L5BA 1V5WA 1DBIA 4FN5A 1XX6A 3KJEA 3MN1A 5CHEA 3N2IA 5CR9A 4HVCA 3W05A 1W25A 2JIZA 4K5QA 2XMCA 2ISPA 2YS6A 1N56A 2FF5A 3UCXA 1Y7PA 3ACBA 5EIBC 3ESQA 5BN4A 4PQEA 3K72B 2PTHA 2XE6A 1AS0A 3QBVA 2QLNA 3T3OA 4FNOA 2WJWA 4N0DA 3VHXA 4YRDA 4F8YA 4MQEA 2WBLC 1T7PA 2UYYA 3AG5A 3JRWA 4MITA 4PO1A 2WSYB 2ZW9A 3IR6A 1WUJS 2QBYB 5D8DA 3CLUD 1IWBB 4QNMA 2RKWA 3EUB2 3DL7A 1O4WA 3HDVA 3O82A 3E4CA 4MVJF 4L07A 4P08A 4WKBA 5JMPA 2XCTB 1NUAA 1J2MA 3EGEA 3O47A 1KE2A 2K4MA 3TNDA 1NVKA 3WO1A 2PUAA 3KBOA 5E38A 5LUAA 1JFSA 2O05A 5FWYA 3D5EA 2HYIC 2GJ9A 2FE4A 4MWBA 1R8SA 4JBNA 1E63A 3LPAA 1E6LA 2G5IB 2ZITA 3ZTTA 1KK0A 2WJAA 3O4HA 1HOTA 4X93A 1OBHA 4IY1A 5CVVA 4X60A 5AXBA 1RJGA 2Y1DA 1V7ZA 3EGXB 3LCVB 4QPCA 3U3OA 4A8JA 2NSJA 5EYPA 1GITA 4I2DA 1P4AA 2J4FA 3NHAA 3QEOA 2HU2A 3R75A 1K68A 2WVAA 4PNEA 1KH2A 3VDXA 2C7BA 1HEUA 2HW8A 5J5VA 5LBUA 3PFHA 2W0MA 3ZDXB 5CRXA 3SEFA 4EGJA 3NCHA 1KFDA 3PNKA 3INNA 3ENZA 4OUKX 4IIJF 4WJKB 4E32A 3VDQA 2QGFA 4MDFA 4D74A 2B61A 3FE2A 1DGQA 1LDBA 4EL0A 4PPXA 3WGZA 1UXJA 1SU6A 1ONNA 2LYAA 3I45A 4MDYA 2W9BA 1K5PA 4PPFA 2F00A 4PLYA 5EZYA 2XY7A 3NYQA 3PFFA 1VFNA 2W6ZA 2HCTA 3UO8B 4DMMA 3QV2A 2X8LA 3PUJA 4GI1A 4UXIA 1RM6C 2VSOA 3AERA 1HE1C 2E1PA 3K9GA 4JBHA 4LZZA 1FYFA 4QVKA 5DYNA 5G1OA 3OSUA 3IPAA 3L5OA 5K51A 2ADOA 4M36A 3F5AA 5DB7A 3L8YA 4WLFA 2Y1IA 1NX6A 2R5NA 4FIZA 4ZEOA 2BGIA 3NONA 4EFLA 3ZGZA 4NEQA 4TLMB 4IL5A 1L4HA 5KTNA 1ZGBA 5MF6A 1ZGHA 2HSJA 2PT7A 1TADA 3DFIA 1NP6A 1OXKB 4O1HA 1XQ6A 4DA9A 4E03A 3HGQA 4WINA 5HPYB 1ONSA 5ENDA 2HHVA 1GNSA 2FFRA 5EWMB 3SZRA 2C2BA 1SWVA 2YCBA 4IWNA 1X1AA 2G82A 3LVFO 4WI1A 2X76A 3FDJA 4B17A 4ZYYA 2ATEA 4G9GA 4N9QA 3B51X 2VDVE 2CXPA 3H5RA 3WL6A 3O9MA 2AE2A 2H3QA 2BCJQ 1GPJA 2NT3A 3F5MA 3II6X 4U2FA 3GV8B 1TK0A 3NS1A 1RTKA 3C85A 3LC1O 2O0HA 5HR5A 2VSXA 3QKSA 2WWFA 5DXFA 2ZIZA 4XGIA 2JGEA 3ZWXA 3GCZA 5JT1A 4O3MA 4YR3A 3TTXA 3DV2A 1UFRA 5DRYA 2NUTB 1PIWA 2JIQA 4O6VA 2VBGA 1QONA 4PSKA 5EKSA 1G98A 1YOBA 5F1PA 3WDKA 5CFPA 3AO0B 1J1UA 3RG2A 3HDHA 3NOOA 5CVJA 3VNQA 4R2JA 1EE9A 5JAOA 1SZDA 3MOSA 1HE8B 4M0PA 1SUFA 1ZM3A 1OYVA 2X5NA 4TKMA 3DLBA 5BORA 4BFCA 3BWVA 3SR6A 2FWAA 4E12A 1BO6A 4QIWF 2IEGA 2OVBA 1RMYA 3JD0A 2G5TA 2R47A 2ZS9A 1UKCA 3C6MA 3KFLA 4XIGS 2XHEA 3U3MA 3T06B 2Z43A 5HKAA 2I80A 5DULA 2EG5A 4UAVA 1BX3A 4QKQA 4CG0A 2PVPA 3JPNA 1XZAA 1UPTA 2KE5A 4NLCA 3Q87B 2PD4A 4I9FA 4JL5A 4LJRA 3UUGA 1JRPA 1CT9A 3CMMA 3GT7A 4IJWA 4YAWA 5HK9A 1ZHOA 1U7ZA 1W4AA 5JNWA 2PJDA 5JS1A 3QV1A 4YHBA 4NM1A 1Y4ZA 2DH5A 5K4AA 3EJ6A 2CLLB 1E8MA 2HJHA 4HJRA 2HBZA 1FFBA 1P9LA 2E0IA 1YIAA 2FGKA 2ISCA 3C24A 4RV5A 1ECFA 1O5OA 3HK2A 1ICIA 4IH1A 3TNYA 4MHOA 1IN6A 1WULS 1OOEA 2IUTA 5CDHA 4DOCA 2WB1F 1VL0A 4XWYA 2CY0A 2R8ZA 2WF5A 3GXOA 1GT6A 3KEFA 4O3FA 2WU8A 4TLDA 4GECA 4P36A 4XFJA 3UXYA 1NYRA 2PAFA 5DHPA 5C81A 2AC7A 2ARKA 1EQAA 4EFDA 5LQNA 4AECA 3LK7A 4TUYF 1Q83A 1OI7A 1TJ5A 2AQIA 2NOAA 1PJTA 2IUEA 3KSDO 3KOYA 1GGNA 4B73A 2C22A 2VWPA 1A5SB 2HTEA 1BDIA 3OOYA 3LYSA 2EAMA 3OT5A 3M6MD 5H59A 3JVDA 1YSCA 3PSFA 4FFWA 3VKVA 4EBFA 4JIMA 1QH8B 1L7MA 1B6RA 4Q34A 4URWR 1QUFA 5DBIA 3H0LB 2C88A 3TIIA 1D2NA 1URPA 3UGQA 5TMPA 1KH3A 3D5QA 4CR8A 2FPOA 2Y2UA 1Z0IA 1D0SA 1AUOA 1S5PA 2Q9CA 3CRNA 3EYAA 5IVPA 1U99A 3V8NA 1USUA 3ROQA 1H0SA 3GPLA 3MWLA 3IUBA 2XRMA 4LQ4A 1CQJB 2AGOA 3PWTA 4LECA 4FZMA 2QU7A 3RUIA 3R0VA 2NO1A 1CERA 1DCMA 4J1QA 1Y80A 4BLSA 3KR9A 2AFHB 1A7JA 2G8LA 2RGWA 1B14A 1KKLA 3PJGA 4HKTA 3PTZA 3UUFA 1GEEA 2W8BA 1PS9A 2G88A 1Y1TA 3ZDBA 4G5HA 1TLTA 1OKKD 2DLDA 3MSXA 2PMZF 9ICXA 3SXUA 1L7BA 2C1ZA 4F3KA 5KSOA 1XHFA 3VH4A 2DKNA 5LZ2A 3ND8A 1QXSA 2YZKA 1C8VB 2WKQA 2DHRA 4K6OA 4DIDA 4EJSB 3WJ2A 4OX9Y 1NWCA 2X8JB 1F7VA 4UHJA 1AHNA 1C4OA 2AYZA 2X5KO 3PNVA 4C89A 2RDMA 3FLMA 3UUWA 4YCNA 3PXUA 3CZPA 5HQJA 2VRCA 3BJRA 1ZMOA 1ZWKA 1N75A 4ZAGA 4BO9A 3RHFA 4KO3S 3GW8A 2R1TB 3FFTA 3NWJA 4G0OA 3NB0A 5F5LA 3F2IA 1O95D 4CV1A 3QLEA 3F90A 2R7LA 1RJ9B 3OEHA 2F8MA 1P29A 1RKBA 3OQVA 2UVQA 2UZIR 2A0UA 4L4UA 1J22A 1M2KA 3C7KA 2ATVA 1QP0A 3IKTA 3WU2U 1C0KA 3NNSA 2DR3A 2F43A 5H3LA 1QTIA 521PA 2O8VA 4IVNA 4BZPA 3WLQA 1KL7A 2QTFA 2DBVO 1ZLYA 3O6VA 1M2JA 1UDWA 2WA2A 1M34B 4E5VA 3HJCA 1LV5A 1PT8A 2R68A 3BUSA 2KP7A 3IHQB 2MYUA 2YWFA 3EOAI 4WK6A 1M8GA 4WNCA 4A1OA 2NP6A 1DRUA 3KZIU 3DL4A 4HFNA 4CM1A 3W2FA 3OIFA 4LFAB 2ZR8A 5KFAA 4AUMA 3EOZA 3K09C 1L8XA 1KO4A 3G2NA 2GAAA 4EEZA 1GM5A 1SAYA 2AOTB 2OHIA 3KLBA 4RPGA 2H0QA 4Z54A 1WQ1R 3DVRX 3DMHA 3FYUB 4U3JB 4UC0A 2WM3A 1P9RA 4P7GA 5BR4A 1O6GA 3IPLA 4W1QA 5DG8A 1XRMA 3IAS6 5CT5A 4LDRA 1N9GB 1YB6A 3H75A 3R20A 3L9XA 4JN6B 4TV9A 5BNFA 3RF6A 1CY2A 3IAUA 1VKZA 1DWOA 1ZIXA 2VDOB 3GJTA 3AEUB 4RDCA 3RBAA 3ZLVA 3ABQB 5ADUS 4JP5A 5JCZA 3EPKA 4EYHB 1RLOA 1W4LA 1DO0A 2GPBA 4RXUA 1NR1A 1ZMRA 5I7WA 4AW9A 4JV5B 5KZMB 1NMQA 1HEKA 3T41A 2B1QA 3KYDB 3MB8A 4CLHA 2DVMA 2XVZA 4ZZ0A 2XXJA 3LHIA 2HFJA 2H18A 4KGDA 621PA 2O7NA 2NRZA 3Q9LA 1Q12A 4OHVA 3W4KA 4RTPA 4KL8S 3AY7A 5KFMA 4LK3A 2PRZA 3ZCPA 1SD5A 3AEKA 3ROMA 3BQ7A 4NIMA 5CRIA 2XLBA 3LX5A 4MKZA 1T43A 1THGA 2YBDA 2G0NA 4ZALA 4BLRA 4EQ6B 3M5DA 2FEOA 2C7VA 3DF7A 4DF4A 1W73A 3MAJA 4TT3A 3TBFA 2W58A 2Z2YA 3FPFA 4UULA 3Q8WA 5DLGA 4BXOB 1M1XB 3ZTYA 5A3QA 1KZ9A 3I01M 3JAKB 1W4CA 4C0WA 4YY3B 4Y18A 2V0GA 3RC8A 2W6QA 4MQMA 1Z83A 2E4XA 2NU9B 4Q7QA 3B9QA 3NANA 3T1TA 3OOHA 2NNWB 1RQRA 1NT4A 3C1OA 1MPTA 4G65A 3PR3A 4MW5A 1AROP 4PS1A 1U2DA 5JD6A 3H42B 4EATA 5KNCH 2EX0A 5B1DA 5EUMA 2XEDA 1K2VN 1O9HA 1D8YA 3ONEA 4X54A 4PC3A 5EWMA 1Q1QA 2L5YA 3CC8A 3EXHA 3L7CA 2LM1A 3NIBA 2Z09A 4OK5A 4RMNA 5JAQA 1U4BA 4FR0A 4F45A 2JGDB 4M7WA 4WH0A 5FO0A 2VHCA 1N8NA 3QGMA 4EHNA 4R31A 2HM7A 4DM3A 1ZIDA 2SNIE 1LTQA 3A1EA 3A28A 3LUBA 4P53A 5IARA 1J8QA 1GQOA 5H0IA 4UB3A 3G0GA 1HL7A 3EVCA 3NP9A 4M7PA 5K01A 5AVSA 4AO6A 4TOIA 1T2FA 1Z5VA 5C37A 4MXDA 1FYXA 4RZUA 1RAEA 3I3OA 1EA7A 2CUTA 3DCIA 3STYA 3H87A 4TLAA 1N5LA 2Q0HA 9ICTA 1QE0A 1IFXA 1UBSB 3GXBA 5EP1A 3F49S 2F3SA 1V47A 4GSKA 1CFJA 1PVDA 1DBVO 1NUTA 3SG0A 1QGED 3AUFA 4HN9A 1BCSA 1W59A 3QLVC 2O7VA 1V85A 2RGXA 3F96A 4FNMA 5AVYA 1X15A 4UUNA 4K4GA 3TLEA 3AJEA 1QGOA 3OJWA 1INLA 4G81A 5E4YA 4MWEA 3PLNA 4CM9D 3OO1A 4PXAA 4F4HA 3HUTA 3VKWA 4FZJA 1UWCA 3D4OA 2G67A 3HEAA 2I7VA 3L8ZA 4DFDA 3RV3A 4E4YA 5KAPA 3GGOA 3WA7A 1NQWA 5ALYA 1R5JA 3DQQA 2PXAA 3LBIA 4FHCA 1JR3D 4FHEA 4Z4FA 2B37A 4CGZA 3OHSX 4BTVA 7ICQA 2YJ5A 3GRVA 3MCVA 1W9MA 3Q40A 2WHPA 3ZD6A 5FWYB 4EA9A 1X9XA 3GEMA 4C87A 1UXIA 2HLDA 2P65A 4CKZA 2QE7D 2WHYA 3ROFA 2EZZA 2TMKA 5KVAA 3ODPA 1UDBA 4DJAA 1HLFA 5HHIA 4OVKA 5JZ9A 1LNZA 2EJBA 3QIAA 3RV4A 2KG5A 3B8HA 1NXQA 1UUFA 3BGDA 4MV0A 5IP5A 4PH5A 2R84A 3HCPA 4PIVA 4OHMA 3K32A 4GXRA 5CYPA 4KLLA 2HSGA 5CNJA 1O94D 2W3SA 1EEXB 1YL6A 1GPMA 4UEJA 3ZU6A 5LKRA 1GNQA 3FR7A 3O75A 4QZGA 4GIBA 1UQRA 1AVTA 2ERXA 2O52A 2RARA 3M5PA 4KQ1A 3TW0A 1ABBA 3T9FA 3F71A 2PU5A 4BQEA 5ALNA 2C2MA 5HTKA 4KO1S 2YY6A 1IBSA 1KYYA 1QH8A 3HNRA 3Q7PA 4IO1A 1MAWA 3SC4A 5KEIA 1PO7A 3RRYA 2A57A 3ALRA 3DLAA 1IRXA 1HZZC 3SBEA 1V9LA 5CX1A 5DU2A 4W5QA 2EHDA 1TK2A 2BP7A 5ERYA 3V97A 3ZWDA 2A9JA 9ICHA 5BQOA 4AQ7A 3MPUA 5CX1B 3W1WA 3ZH9B 3A4NA 1Z75A 3DEJA 4HD8A 1PNRA 2V7QD 3SKYA 5GIOE 2HMUA 5J4YA 2E8NA 1N1MA 5KYUA 4QWWA 1A2BA 1FRQA 1NFQA 3HC7A 4DM7A 2VZ9A 4JR0A 4UAYA 3BB1A 3PXBA 4U0KA 1TKDA 3ZHZA 1K89A 3R5TA 4INOA 3X0DA 5AVZA 1VKHA 3OTGA 3MD9A 5KTOA 1KYWA 3PXCX 4XRHA 1WDTA 1QSLA 3ANTA 4W9NC 2FFQA 4G24A 4P83A 2NTNA 5B5EU 3D02A 1B6SA 4C7OB 1J0BA 3L7YA 1RLJA 3V7LA 2EBUA 3PJFA 4QHYA 2GKSA 5DN6A 1NZBA 3BXOA 1UXKA 3AP1A 2OENG 2ORYA 1R64A 5BQ5A 4I50B 4FBUA 1UEXC 4AVYA 4DANA 3T3IA 2FMXA 1QQ5A 3RGWS 1AO0A 3PW5A 3S4YA 1LSUA 3DXXA 1YRYE 2RG7A 3QPBA 4CV0A 3UJHA 4CLRA 5K6AC 1EBFA 1SVKA 1Q5PA 4F9FA 4N1AA 4PAOA 3E0XA 1ORHA 2HRQA 5KHLB 1TO1E 4YUYA 2YMPA 1XVUA 3H9GA 4CM4B 2QUKA 1T0HB 3EMKA 1EVJA 1XEAA 3GMSA 3PC7A 4G67A 5HF8A 9ICMA 1Q11A 2PMFA 3V8RA 2NTEA 1G3UA 3SX0A 1WEHA 4B47A 4YASA 4D9HA 3QVUA 3CLRD 3VC8A 2VBFA 3HACA 4DDVA 1L6NA 1KBZA 1EFRA 4HS9A 4I55A 5H4GA 4TWRA 3IPCA 5K3FA 3A8TA 3MAGA 4LYGA 4GC6A 2KKVA 1W5SA 5JQWA 1IOZA 3N6RA 1JDUA 1GTSA 3BEDA 2QORA 1I4DD 4GRIA 3EDYA 4M54A 4DCJA 2BSQA 4PHDA 1XZDA 2HQRA 4F1KA 2QAGB 1L7VC 2PKWA 4FYWA 2Y1LA 3VSAA 1A9TA 3QVGB 3ET4A 2SKDA 5D84A 3GMDA 2NZ8A 1ZAYA 5F3XB 1QQ7A 4ND2A 2REBA 3PW0A 1OH8A 3M82A 4GBED 3V46A 2LHTA 4CKCA 2OCAA 3LQYA 1P91A 1ELOA 3HFGA 2HHCA 3LT1A 3ZCVA 1YVEI 1ZMTA 5AW4A 1YZ6A 3GCXA 5I01A 2O8EB 3GN2A 1ZZGA 3GVHA 1ICEA 2AJ8A 2OCBA 4B9LA 1I0LA 2H2GA 2KI5A 1NXWA 1QCYA 1RI5A 1BGXT 1ODKA 2BGNA 2IEIA 3I5AA 4JBGA 4B9NA 3KJGA 2IIBA 5DP2A 4RGYA 1W88A 1WF3A 2JFOA 4GS5A 3AV3A 4G1EB 3IS3A 3IVGA 3IOCA 1LPBB 1E2QA 1HYGA 4MKRA 5ALIA 1ORRA 1MC5A 3I6QA 4B2IA 5J2TF 4FFOA 4G0YA 3TZCA 1XTTA 5EQDA 2O5EA 1KSGA 2CLKB 2R1ZA 2G9RA 4YLEA 1T3TA 2H07A 3U19A 5J2TB 3LK6A 2CXQA 1JH8A 3C3JA 4GVXA 3B36A 4U6QA 4KMUA 4B9VA 4EHFA 4MMXB 1QO0A 1WZ2A 1GGJA 3ZHOA 3DOUA 2ZIXA 3DT9A 3LY9A 3H4MA 3WO0A 2DQNB 2OFPA 5CJPA 4ZFNA 2BLLA 3G6YA 4QXOA 4F1WA 3NDIA 2CD7A 4J6EA 5AUPB 2DC1A 3N76A 2OORA 2UAGA 3P2EA 2X0JA 1WTAA 1T3SA 2QTRA 2ZB4A 1JQ3A 1T94A 3PQ6A 3TE7A 3U31A 4ARUA 1IBKB 3MTBA 3O2JA 5CH3A 3VFDA 1JIUA 5KT4A 5DEOA 5TF0A 5JU5A 4RIFA 2P9FA 3JQPA 3SR3A 9ICFA 2DYKA 1DG1G 3DZIA 2PZFA 3IILA 3ZOKA 1TEVA 2GNOA 1RJDA 4MVJM 2ZJBA 2JFBA 3KX2A 1Z38A 1JWAB 1FJXA 4J1TA 1MDFA 1T6BY 2OWOA 3IAAA 4DHWA 2PTGA 1LFAA 1DJQA 1T0PA 4E3ZA 1M2EA 1I80A 1ULSA 3M6AA 3PTAA 3A37A 4AG3A 4D9MA 4CKEA 3SD7A 1CR1A 5I7HA 1Z6QA 3GJ3A 2B4QA 1GPH1 3BBPA 4P58A 3IAEA 1SUSA 1V96A 2M6SA 4NLLA 2GN8A 1UBOS 4XSHA 2OFXA 3MB5A 1KO8A 1GZ3A 2FJPA 4UDNA 1Q1ZA 3LSTA 3T52A 3CZMA 4RMJA 3RU9A 2E4UA 1YZ3A 3VPGA 1SBQA 2Z2ZA 3EPLA 3O4VA 4PTZA 2GWSA 2XUKA 1Y9DA 1VE9A 1TTQB 2PSDA 3KT0A 4GM4A 2FKAA 1P77A 3AF1A 3B0XA 4C8KA 3HG7A 3GELA 3ETRA 1EK0A 1KC1A 1WP9A 1U2GA 2H9AA 2HA7A 2J87A 3HUFA 1YMVA 4FDLA 4TQ9A 4EARA 4Z2YA 3RJGA 1NWHA 4KLIA 2ZYHA 1RI4A 4E3WA 3K0BA 3DUWA 5M04A 1KAOA 4EB8A 4KPGA 3EJWA 5AJTA 1CNFA 1LLUA 2ZZMA 4E2YA 5KI6A 2C2XA 2Z98A 3EOBI 3RTCA 3ZCSA 4Z51A 2NP7A 3RFFA 1D4AA 3JCZA 5BUQA 2DFVA 2OD9A 3PE6A 4K6MA 4MUIA 2KJ8A 5ESXA 4EB3A 1JQLB 2XUPA 2VWGA 3ABOB 4BVGA 4YCJA 2NPIA 4OKIA 3KKMA 4BN4A 1EGQA 4CQNA 1X2IA 1H6DA 3VTFA 4D4MA 2YXDA 2O0KA 5EMKA 1F0YA 2JFQA 3GIKA 5IM4A 2MAXA 1M8PA 3OMXA 2B5VA 1JMVA 3EXEA 3ZJYA 1E1QD 1GCAA 4BFSA 2RGRA 4MF8A 3GDFA 4P3OA 3FJOA 2GZ3A 3L01A 4DRXB 1O2DA 4XUDA 2IHYA 5HR7A 1EVIA 2H2HA 4MRSA 5EJIA 2IPLA 8AT1A 2NTJA 1Q7TA 4WXEA 1ECPA 1XCPA 2BEKA 2OBNA 1M10A 5AKZA 3M1AA 1ZW6A 3G23A 1JNXX 3GLIA 4D4LA 1WA5A 5TGZA 5LQSA 4PZYA 1VBKA 4BGEA 1GGEA 4J6FA 4GLBA 2IYLD 1IQ0A 8ABPA 2F9MA 2PBRA 5HDQA 3ROGA 1M54A 2A0WA 4QPDA 2XNKA 1WW8A 3PXAA 3WHPA 1GUYA 4GYYA 1DJLA 1ZO8A 1PJ4A 4AJEA 3OX2A 1V95A 3EULA 2AJCA 4ICAA 3JQ9C 3LM8A 3ZE9A 3TOZA 2HX1A 3EY4A 3GLUA 2OFWA 3D2AA 1LA2A 1UINA 4HDNB 4A73A 1YB5A 3N7RC 1HE3A 2ESRA 3HWSA 4O0LA 4RD4A 4V39A 4XDGA 4M0UA 5SYMA 1P5FA 3T4UA 1ZSVA 3CLRC 2Q27A 1KP3A 1G6Q1 2JHPA 3E1GA 4WA8A 1CZNA 3TQ1A 4RGBA 3CYMA 1N5OX 1KI4A 1DKMA 5KT5A 3QE9Y 2OP0A 1DO2A 3G17A 3K6KA 5CM8B 3KS9A 4EENA 4HEHA 4C30A 4DFMA 2R4UA 3QLUA 3INTA 1YVUA 2CNKA 4JB0A 4LBVA 2BFFB 5AOVA 3T5GA 4DIEA 4IOJA 3PEFA 3K8ZA 3TBKA 4PLZA 3KQNA 3RH4A 4WCFC 3MYRA 1VHJA 4PHCA 1ZJWA 2VHQA 1JVBA 3ESAA 1QO7A 3AKDA 2D1YA 3V33A 3AMZA 3FFAA 4PX9A 5KAIU 2WZBA 3CF0A 3HDGA 1TW2A 2WIBA 3FNIA 4XIJA 4PG8A 1W5TA 2D2FA 3WZLA 5JR3A 3GLHA 4QDOA 4DREA 1OXJA 2XWSA 5CA0F 2WV7A 1UPAA 3WKBA 3DQZA 3CV3A 3E35A 2V3WA 3CXRA 5I48A 3LQFA 3AETB 1ZG3A 3VPDA 5KYXA 4H0NA 1EWVA 2GLXA 1ZM9A 4DQVA 1ZIPA 2J9FA 3VKFA 4EG4A 3UTDA 4RKYA 4H18A 3JTMA 1RWKA 2D1QA 3HMQA 1TIBA 2VNKA 3N6VA 4CF5A 3DZDA 1N1GA 3OBBA 4KNVA 1DJOA 2FMIA 2JJQA 4EWLA 2GO1A 4N65A 2LZ0A 4LC0A 4LQLA 3JAKA 1SKSA 1FPMA 3IMFA 3K53A 4ZKEA 1JX4A 1PD0A 3X43A 3IDOA 3ID6C 5HIAA 4G0QA 2JHDA 1SV0A 2PZLA 1KS2A 1PUXA 4Y0AA 4RIGA 1DOZA 5DASA 1XCOA 4Z4QA 4LF6B 4YPOA 1JF8A 5JSZB 2E4VA 3RF9A 4LBZA 5T4BA 4FFNA 4CM5A 3U5ZB 3JPOA 3PMNA 1R7RA 2O4UX 2PAAA 4HAYA 5TQ0A 4UXJA 3OURA 4UVDA 3WWPA 4A23A 2O7SA 4Z6KA 3A9TA 3ZEAA 1L8OA 4BX9C 5GM2A 9MHTA 3NYWA 1NY6A 3K4GA 1PL7A 1P1HA 2ZRAA 3U40A 1GNVA 1CQIB 2ILVA 3KDAA 3P2MA 1ZQIA 1W75A 1Y9JA 3PTLA 4F06A 3MJFA 4F96A 5B5SA 5HFAA 1L7NA 1C8LA 2J6UA 1TD9A 3BJZA 4LBYA 1BA3A 2ISOA 1R16A 4B46A 1LEHA 5IVHA 1BQ3A 3KQTA 4EUHA 1G4UR 5T57A 4OQQA 5KL1B 3X2SA 3T3NA 2J0QA 4WZBB 4Y2JA 1DEOA 4ND3A 1VGRA 1RHQA 1MDBA 3DM5A 4XX1A 5DISB 5DSTA 1JEDA 1JTFA 1Q7BA 1U2PA 4RESA 2XWJI 1AJEA 2EZ9A 2ZRNA 2WUFA 4F21A 1W87A 1ZRSA 1XEWX 1RYBA 2QTWB 3I30X 3OAAD 4TTJA 3RTAA 5BXYA 1IV8A 2YJ4A 2OXFA 1N33B 4EAAA 2ALZA 3EEQA 1I7QB 4UBKA 2XGQA 1H6AA 1W30A 1ZYUA 1E3WA 2REOA 3BAZA 3H9EO 4BLQA 4DSNA 2I3DA 3TEFA 4U8HA 1GCUA 4G5OA 1ZGGA 3TIXB 4AD8A 3HBNA 3JD4A 1W4BA 3NVMB 1KO1A 3WGLA 4AKTA 4HUQB 2JD1A 1M9NA 3ELDA 1TPZA 3JX9A 2AOUB 2HMWA 3E9CA 2JH8A 4ASUD 4FMDF 2XT9A 2HUNA 2PFNA 2Y66A 2PX8A 3LKBA 3AOEA 5I4KA 3FZEA 3ADKA 4FMDB 3L02A 3DOJA 4M55A 5ALKA 1O6ZA 1YWGO 3AZOA 3MQ4A 1WX1A 2HCJB 4FQ8A 1XHLA 4UKDA 5HKLA 3TM5A 2B1IA 2KS6A 5I9BA 4C9BA 2ZZNA 4G1BA 3A0HU 1QLJA 2K8BB 1Q3VA 2CL0X 2W11A 5EESA 3QP9A 2MCFA 2O7RA 3SYNA 1BXZA 1PDVA 3RVNA 3ANXA 3IAM6 4BCCA 5A0FA 4N01A 3TTVA 3KT6A 3V8EA 3EIEA 5EQFA 4GMHA 4IRMA 1DX4A 1G3IA 1V6AA 1Z26A 2FZ5A 1D7OA 3I09A 3VOBA 3MJCA 1GN8A 1T5SA 2CFIA 4IS2A 1H22A 1TT5A 3MJVA 4HMQA 4CMEC 1XGKA 4WFJA 1GKYA 3OQMA 1EFAA 1LLCA 3UWSA 5ICMA 1I9GA 4L16A 3RFCA 4DAEA 5J2UA 2WQZA 2YWGA 4EY5A 5DHRA 1T5BA 1RC1A 4IJMA 3CN9A 3TTSA 1P7PA 3U81A 3TIFA 1XAHA 3PVSA 5AHXA 4FEEA 4J2HA 1X1EA 4L5JA 1E7QA 1M1UA 2IY7A 1IRIA 1T9BA 1MLDA 1QP8A 2NVWA 3H8WA 16PKA 1X7XB 3LOU