4CNQA

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 85
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cnqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cnqA01
2G08A 2I55A 1EK1A 1QQ5A 4F72A 3A3YA 4BX3A 1F5SA 2CN1A 3QU4A 3N07A 1ZD5A 2Q4TA 3QNMA 2P11A 3QGMA 5AVVA 5AK3A 1Z4KA 1WZCA 1RRCA 4EX7A 3QXGA 1FEZA 2B0CA 3QUQA 3I76A 4KN8A 4CE6A 3EWIA 3OCXA 4BYGA 1ZD4A 3ZVMA 2FI1A 2MSNA 2YMLA 3L8HA 3B9BA 1YJ5A 2G1AA 2HF7A 3M9LA 3OCVA 2BDUA 4Y2PA 2FUCA 4YCMA 1U02A 4UU1A 1RMQA 5AW1A 2O2XA 2RB5A 5AVSA 3U19A 3W5AA 1NNLA 4YCLA 3ZX5A 2P69A 4FFDA 2NO5A 3CZ4A 5AKYA 5FP0A 2AGVA 2G80A 1Q91A 2C8LA 2QYHA 5A3SA 5AVWA 3WKCA 4BEVA 3I1YA 4Y2YA 5AKJA 4XPZA 3OPXA 5AK5A 2MU2A 3E58A 4KX3A 1RQNA 2GMWA 3L5KA 3B8EA 1YNSA 2VKQA 3UMCA 4AS3A 3QUCA 4Y2JA 1Z4LA 2ZBFA 1RDFA 5AW9A 2FDRA 4OD0A 2RAVA 3R4CA 2FEAA 2R8YA 4JDPA 3PDWA 2HI0A 1TE2A 2JAUA 5AKXA 3PCTA 5ALRA 5ALYA 3OCYA 3AR4A 4NFLA 3W5CA 4I9GA 3B9RA 3WK9A 3MPOA 3SKYA 1ZD3A 5AKLA 4GXTA 5AVXA 1TJ5A 5AW0A 3ESRA 4EX6A 2MU1A 2I6XA 1L7MA 2JARA 3NRJA 4BX2A 2R8ZA 4CF5A 1QH9A 1L7OA 2G09A 3WK7A 4UM7A 1Q92A 3ET5A 3KC2A 4FE3A 5ALWA 1RLOA 5ALJA 2C9MA 2JGAA 4G63A 2YN4A 4DW8A 3OCWA 3QU7A 2IOFA 4J2TA 1WR8A 2P9JA 4Y2XA 1S8OA 5IS2A 1KYTA 3MC1A 3ZU6A 1LVHA 1TJ4A 1T5SA 4UATA 3QUTA 5ALIA 5AIBA 4CF4A 2IYEA 4YIKA 2FUEA 5AM1A 4HGRA 3WGVA 1ZD2P 1YMQA 4G9BA 4XE5A 3HYCA 1Z4IA 2WF8A 4QQFA 2BDEA 3WGUA 2IOFK 3FVVA 1O03A 1SWWA 3KOOA 2G06A 5AW5A 1AQ6A 3U7EB 2FPXA 2B82A 4YGYA 1VJRA 5AVZA 4C4TA 3WKAA 5AM4A 1O08A 1X42A 3NAMA 3NASA 3D6JA 5AI6A 4IFTA 3WK6A 3QX7A 4EZEA 1SU4A 3MMZA 4UMFA 4XQ0A 4YCNA 5AK4A 3UM9A 1CR6A 2G0AA 2ZOSA 4O8CA 4Y2VA 4BKMA 5ALHA 3WKDA 1RLTA 1RQLA 5ALNA 4UM5A 3L7YA 3WK5A 4OHFA 5AVRA 2WFAA 4UW9A 3A1DA 1L7PA 3U7FB 2YMQA 1U2TA 2HEGA 4RETA 2CFRA 2WHEA 2ZBGA 5AM2A 1K1EA 1ZS9A 3FM9A 2X4DA 4NV0A 4ZEXA 2PKEA 3N28A 5ALKA 3R9KA 1U2SA 2FPRA 3OCZA 3ZUPA 1ZJJA 2PQ0A 4OCZA 2B1RA 4C4SA 5AI4A 3ZTYA 5AW8A 2B8JA 1LTQA 2IA5A 2EAUA 5IT0A 5ALTA 5AM0A 2EARA 3TLMA 2HO4A 1J97A 3DAOA 4HAIA 3PGVA 5ALGA 2GFHA 4JB3A 2ZBEA 3RFUA 2EATA 5AKGA 3L8EA 2FPUA 3AR2A 5ALSA 2AH5A 2FPWA 3L8FA 1JUDA 2OM6A 2P27A 4Y2TA 4HGNA 1QQ7A 2OBBA 4HGPA 1ZRMA 2WF7A 4KX5A 4L6CA 5AW2A 4UMVA 3OCUA 2WF6A 1Z4MA 4DCCA 3AR5A 1Z4PX 3WK4A 3IB6A 2G07A 3L1UA 5ALEA 3IJ5A 5ALVA 3SMVA 5JJBA 1VFPA 3E8MA 5AKHA 5ALDA 3KZXA 2GHTA 1T5TA 3QYPA 2WM8A 2YJ3A 2HF2A 2NYVA 2HX1A 3NIWA 5ALUA 1IWOA 2YY6A 1RMTA 2ZG6A 2JAWA 1U7OA 4UMEA 5AVQA 3BA6A 2B1QA 2Q4RA 2YJ5A 5AKKA 5AW6A 4UAUA 3GYGA 4KYTA 2CFTA 2Q5EA 4OFZA 4NABA 3ZVLA 4RESA 3A1EA 1L7NA 2W43A 1QYIA 5AI5A 1TA0A 3W5BA 3EF0A 3WK8A 5AI0A 3QU9A 1RKQA 4CF3A 5AW4A 1VJ5A 3ESQA 5AW7A 2RBKA 1L6RA 3U13A 4GIBA 2DQSA 1XVIA 2AUTA 5AVYA 3J7TA 1RC8A 3UMGA 4QJBA 1ZOLA 4I9FA 3FPSA 3R09A 1TJ3A 4UU0A 3DDHA 4Y2UA 5AKZA 3QU2A 3QLEA 3ZWKA 3I28A 3N5KA 4BBJA 3CNHA 3SF0A 5A3RA 1N8NA 5AW3A 2WF5A 3VAYA 4PNHA 2JAOA 3S6JA 2OYCA 2R8XA 1WPGA 3P96A 3HLTA 5AESA 3FPBA 4HYTA 1U7PA 3UMBA 3KDPA 1J8DA 4C4RA 2IOHA 1ZRNA 5AVTA 3ZVNA 2CFSA 2W11A 2BY4A 3N8GA 1RKVA 2C4NA 4HGQA 2YMMA 3SLRA 2I7DA 4UMDA 3E84A 5ALPA 4ZEVA 3PGLA 1YS9A 3ONNA 3U7GA 4L57A 5AHXA 3KD3A 3SKXA 5T41A 1YV9A 5ALXA 1SWVA 2HOQA 3FZQA 4EENA 3U26A 3MN1A 4Y3UA 5E0OA 4AS2A 3WKEA 4BX0A 3QUBA 1YDFA 1Y8AA 2B8EA 4MUMA 3F9RA 3AR8A 4KNWA 3NALA 4BNDA 4B6JA 2HHLA 1NRWA 3RF6A 5ALQA 2HCFA 5AIAA 2NO4A 3ZTWA 4XOUA 4Y2RA 1XP5A 3DV9A 2YFYA 3FGOA 2B30A 2C88A 3DNPA 5AK6A 5AVUA 2YJ6A 2I54A 3K1ZA 3SD7A 5AKIA 2YMPA 2GHQA 2WF9A 2GO7A 2ODAA 3W5DA 1Z5UA 1XPJA 2HDOA 1Z4OA 5ALZA 3KBBA 1Z4QA 2O9JA 2YBDA 3L0YA 1RKUA 4AP9A 4IG4A 4UARA 3ZW7A 3L0BA 5ALOA 5AKEA 3NANA 4EEKA 3QU5A 1Z88A 5ALFA 3ZI4A 3L0CA 4NAVA 1Z4JA 3E81A 4UAVA 1L8OA 1T9ZA 4Y2QA 2W4MA 1S2OA 3I6BA 5ALMA 2ZBDA 4EELA 2PR7A 4H1WA 2R8EA 3EF1A 1QQ6A 3BWVA 2I33A 3M1YA 2HSZA 3N1UA 1MH9A 4YH1A 2QLTA 3AR3A 3U7HB 4E88A 4DWOA 4YIHA 2OA0A 4NWIA 5AICA 1Z4NA 3ZWDA 4KNVA 5ALLA 1RLMA 3L8GA 3EPRA 4HGOA 3ZX4A 1N9KA 4FYPA 5AM5A 5A3QA 3OTQA 4L6AA 4UASA 2AMYA 1RPZA 3ED5A 4CNQA 1PW5A 2ZXEA 1WVIA 4F71A 2YJ4A 3L1VA 3AR7A 4BEWA 3AR9A 3A1CA 5AI8A 5AM3A 3ET4A 1NF2A 2RARA 4MWOA 2I34A 1RMYA 1EK2A 3WKBA 4Y2SA 5AI9A 2D2VA 2FPSA 4ZEWA 4J03A 1L8LA 4BNDB 1CQZA 4DFDA 5IT4A 3NUQA 3AR6A 3SHQA 3IRUA 1Z5GA 2C8KA
chains in the Genus database with same CATH superfamily
1A04A 4MTLA 1KH2A 1CUVA 3UC5A 1E7YA 2RLTA 5E6UB 2CXUA 2ZRIA 3QUQA 4HNAB 4CQJA 2PPVA 4LXHA 5F5XA 2QIPA 1QK5A 8ICRA 1KH3A 4MQMA 3TBFA 4JSTA 4G9EA 4K0KB 2XODA 2J6BA 4G89A 4IQVA 1ZL0A 3CA8A 3K20A 4D99A 2XGSA 4R1TA 4LGMA 1ULHA 3OM8A 3BSFA 1RP7A 1CV2A 4E4YA 1GYQA 4PE5B 3RYFA 1POWA 4JLOA 2ZAMA 2R8YA 1HURA 2I6QA 1TE2A 2BV3A 4WZZA 3JARB 4O29A 3RIMA 4UPDA 1DKPA 3HO8A 4TS1A 1VE1A 1GPWB 3ZOKA 4EX6A 5KT4A 5EWJB 4HEHA 3TG2A 1EE2A 3L7NA 2ZJ5A 3KOUA 5LYJA 1WKCA 3VPDA 1KJWA 4QZIA 1LDNA 2CK3D 1DG9A 1PEKE 1UKVY 1U7HA 2R4TA 2VAMA 4PHHA 4C88A 1QWSA 3FYDA 2KZZA 4D42A 4AJLA 3A9VA 1F8FA 3EPPA 1ECBA 3F0TA 3E23A 2P40A 4AYBF 4NCIA 3A3NA 1LS6A 4BKUA 2G5CA 1BMTA 3I9V1 1G291 1BC5A 3HKZC 4ARSA 4I5GA 5CX1A 1GD1O 4G5YA 4ZO6A 4MK4A 3U7FB 2UUAB 3A1SA 5E9AA 3NTOA 7ICIA 3TECE 4DS4A 4MXDA 1YVEI 1AT1A 1SKBA 4RPJA 1Z5VA 4OCZA 1B26A 2CLEB 1V5IA 2NT3A 5DM1A 2JEJA 5E6SA 4Q18A 4BO1A 1JZTA 1H8ED 2OEHA 3TQRA 5JEDA 3TTTA 2XQJA 1TTTA 3AJEA 4RMHA 3E35A 3KAPA 1P7YA 4MP8A 4AJ4A 3A9CA 3UK7A 1ENZA 2OP0A 4R2MA 2X0EA 1NVGA 1TCVA 2FEXA 1SPBS 5JJBA 3MINA 3GRCA 3N2IA 5DNCA 4KRFA 4O2BB 4MV1A 5FV7A 1QX3A 2V55B 1ZW6A 4MKXA 4UEJA 3TOSA 4NTZA 1JLHA 3OQ6A 3GNQA 5B1IA 3ELDA 4AYXA 3R41A 3WLHA 1I7QB 2O7VA 5JCOC 3HA2A 4HDRA 2VJMB 1LQUA 4MJXA 5UKDA 1EVQA 3WYFA 3KQOA 1ICEA 3Q40A 1Z3IX 2O5CA 2EGUA 2ZKLA 4P2HA 2OD9A 3MGAA 5KTYA 3IMEA 2FN4A 3PEVA 3HLTA 1GLVA 1N6IA 5DP1A 3DE2X 5DLEA 1LD3A 1P2TA 4NY1A 1X70A 1MNAA 3DVRX 3DLTA 3ACBA 1BRTA 5ILOA 1E2QA 1QVVA 5BSRA 2HU8A 5SV2A 1DG3A 1KP2A 5TDHA 2OHIA 2RB4A 3CGGA 3KB1A 1P5JA 2D3TA 2IPNA 1YDFA 1KQ3A 2YINC 4D9IA 1F8UA 1PZGA 1YUBA 4HFMA 4TVBA 1J0DA 1L3BA 3V8MA 8ICHA 1DKMA 3LYAA 4C7BA 5TY0A 2XQVA 1YUMA 2CK3A 1NW6A 5JOQA 4EKIA 1I3CA 1GPH1 4UZFA 2YIDA 2EP5A 4J16C 4QU8A 1NDQA 1PTJA 2GBGA 2VWQA 5EXEA 4B9AA 2FXVA 3R7DA 4NV1A 4BFYA 1GVNB 2ZQZA 1SBHA 4XVRA 3EXEB 1DUVG 1I01A 3GLGB 4I6EA 1PEDA 1YDWA 3SQWA 4IO1A 1NJYA 2C2BA 4IY1A 3AHIA 4Q12A 3MWGA 4M9LA 1VMIA 4D6PA 1MRZA 1YZ3A 3DTTA 5SYNA 1Y3HA 3OSPA 4N7MA 3MJTA 4RACA 4EW3A 3VO8A 4B4VA 3BMOA 3QTLA 2YWBA 1DIBA 2LPEA 1KNXA 1JHXA 5JD5A 1EBBA 2CLIB 5AH0A 3COVA 2EX0A 2XYHA 5KINB 2IYWA 1H8EA 2AQ0A 4FFNA 2W6ID 4PL2A 5GTHU 1T2DA 1NAIA 3OBIA 4YDHB 9ICFA 5AW1A 4YJKA 3PW2A 3WB2A 4IGKA 4R2JA 3SHWA 3I1FA 2D2XA 2QU7A 5DKFA 3UO8B 5B7QA 4YJ2B 3KQYA 2PRZA 2UXDB 4MF2A 4USAA 1N2CA 3MMSA 2VKQA 3TVDA 3HG7A 2CHEA 3GFPA 3RFAA 3LVWA 1OXBB 3H6GA 1FRVA 3SAJA 3OJSA 1T6BY 3WISA 2CLSA 1RVDA 1RVV1 1SZPA 2Q62A 1WDKA 2C9DA 3A3KA 2F8SA 1SC9A 3WAJA 3KC2A 1JTFA 2V3CC 1X14A 1RLOA 3LUDA 1X7DA 2O20A 5DWQA 1K66A 3IRVA 3SICE 2BFFA 3BL6A 1R0BA 5A9TA 5HW0A 3L9XA 2P9YA 4WXRA 3ZCRA 1WUKS 4E0DA 3FF4A 2NYRA 4HQFA 1M5RA 1HETA 1W6UA 3CURA 5DHFA 1QCDA 1HNNA 2NZWA 4PONA 5C8YA 1GNRA 4QTXA 1X2EA 4PLVA 4DLUA 4HT3B 1GUBA 3AYXB 4C14A 3KYBA 2VYNA 3RYFB 4RQ3A 5PGMA 3RJKA 1JEOA 1OU4A 4PO3X 5JS6A 4WLFA 3U60B 4OM8A 4Q24A 1C7IA 3DPIA 2P2CA 3IEPA 1P1FA 1G60A 1KK2A 5LYJB 1M7GA 3VNUA 4LJRA 4RF2A 1SK8A 2B9VA 3QLUA 1DBVO 4BJ1A 4QNLA 4RZ2A 4UQOA 3L4SO 3EGOA 4L6CA 3AFGA 1JR3E 1XCMA 3AWIA 3E1KA 4K9KA 2QTNA 1NVXQ 1TFUA 3E8MA 3JAKA 1F1BA 3WVNA 4UBBA 2QX9A 2J1LA 1FVFA 3GIDA 3SC2B 1KIFA 5CFOA 4UMEA 2KPOA 4OFZA 5CX1B 2O2GA 4AM8A 4DMCA 2P6NA 621PA 1VRVA 3TUJC 2OGSA 2IHTA 3I52A 1TMOA 5F9HA 2VHYA 2C29D 1A8IA 2Y2VA 3UZUA 3DLCA 2H07A 2QRGA 1I0LA 3RS5A 5ECDA 1TJ3A 4IRKA 2W6IA 1T26A 3UG7A 4BNYA 2FLVA 3S2EA 4MYUA 4Y8VA 4BECA 2MSWA 4GLOA 1A7AA 2ZULA 4ZQCB 1I5OA 1RCTE 2ZKIA 5JQWA 1RP1A 4BE4A 4EF4A 1MEJA 4TVSA 1BDBA 2YXDA 1KMIY 1JMKC 5L9XA 3VDQA 1T5OA 1WB5A 2P2LA 3MINB 3VU8A 3FDXA 3FLBA 3T3FA 2OGUA 4RDCA 4LRTB 4Z6KA 3U40A 1X40A 4L85A 1DZ3A 4YP9A 2WJYA 1OZAA 1WXEA 1K3FA 4OGLA 1M8GA 2ZRBA 1JRPA 4UKDA 3DV9A 2AFVA 3CLRC 5B3LA 1PJQA 4LVNA 4JP3A 1OH7A 3DE6X 4WKBA 3AU9A 4A8TA 4XD7D 5F5LA 3TLZA 3KQVA 4BO5A 1I3LA 3IAEA 1QZ3A 3I6QA 1DCTA 2FDCA 1JS1X 4RKWA 1RBZA 5IZ4A 3EOZA 4NDNE 4JEMA 3HZRA 3WGQA 4UUQA 4O08A 5F64A 3RIGA 3THRA 3OP1A 3SMQA 1YR6A 3ZKWA 1EFLA 4EO4A 1EX6A 2XMPA 2VUUA 1EWQA 3PU6A 2FP4A 2ZIWA 1FCJA 1UXIA 1ZH4A 2X8LA 4Q9AA 1Z5GA 2CNLA 3MR5A 1ED1A 3RJMA 3ZCPA 2C5AA 3CUSA 1R5BA 1CDOA 1WZCA 5HGXA 3HH8A 3OJOA 1PT8A 5IAAA 1DX6A 3F5QA 3R0JA 1T3NA 3B5JA 4HK4A 4CGZA 1FNNA 3ADOA 3KPJA 4BC1A 3CZRA 4OA5A 4O2BF 5J2HA 2AGOA 3T1VA 3DJFA 5LP6A 2IPMA 3FWPA 4GRAA 3CG0A 3EZYA 4II2A 4GYYA 2G9ZA 3UKDA 4FR2A 4R54A 5KTSA 3LK6A 4MUEA 5DLFA 3AMVA 4TQSA 4UCQA 4PZEA 3SAHA 3SYRA 3NHAA 2FZGA 3UJ6A 1KBQA 3LZCA 1TVCA 2AHOA 1GEEA 2VT7A 4PPQA 4TTAA 3F6RA 1VJCA 3P9SA 1U8EA 1GZ3A 2NUPB 1T10A 2A1IA 4JFRA 3BMOB 4R81A 4RNDB 5EIHA 4PBSA 2ZYHA 3IOEA 2RGRA 4EMTA 1Y3CE 2KP7A 3IVGA 2H1OA 2MJLA 3OZAA 4LY6A 4RL4A 1B2LA 3CEPB 3CZCA 4HZIA 2BHTA 4Q7MB 1BYIA 1MABB 3WGUA 5EJ2A 3RU2A 2XY5A 4WAUA 3FIJA 4GSKA 3WFIA 2C2MA 1G6OA 4EW2A 4MVWA 1I7SB 2GBLC 2A4MA 5ELXA 2VIIA 4IG9A 3MYYA 2Q5LA 3E4CA 4DREA 1A2KC 2ALZA 2FU5C 2P9EA 5KFXA 5KT2A 1F60A 1NM5C 3JTEA 3KEFA 2D5IA 2CXPA 3LA6A 2C95A 3BIJA 3WLSA 3ZZ1A 1G3MA 4DBLC 2AQKA 2CBGA 4FR0A 1HDZA 3IPXA 2JV3A 4B40A 3ZLVA 1J23A 1LLDA 4XD7A 1RI2A 4M98A 2BFFB 2JGLA 5D5HA 4Y2TA 5FOUA 7ICEA 1SKSA 4JBLA 5CHEA 4FFLA 3WQSB 3IR7A 4E07A 1M6EX 3LUAA 1V48A 4M0PA 2CUKA 1VCIA 4LOLA 3QLUC 2ZDGA 2GN4A 3PT9A 1PWHA 1NHGA 3GCWA 4XFJA 2QB1A 2BJHA 4YCBA 4WFKA 2AJDA 5C8YB 5IAKA 4FINA 2PZBA 4NCJA 4H77A 2X0JA 4ETWA 4COKA 4L4RA 3JWIA 1R10A 5TRTA 2VQ6A 1PZNA 1R3UA 3O7MA 1P6UA 1HFJA 2P0YA 4D98A 1JN3A 2RI0A 3D5TA 3PNSA 3FOFC 2HLDD 3D0OA 1KEJA 1KVUA 3ZZUA 5ISMA 4PCLA 5KC8A 2WQ7A 2JKZA 2ORIA 2VJOA 4PNHA 4YJ2F 1JBEA 2WDPA 2XH8A 4EI2A 3H97A 3GFSA 2VSOA 3NJ4A 1U98A 2QD2A 2EKLA 4AP5A 3N8GA 3TQSA 1RKVA 1A4IA 2I8CA 1U7UA 4UB3A 4DQDA 4DSIA 4JMUA 1PJAA 4RQNA 1B0ZA 1XLVA 4Z4IA 4ZQHA 3BD7A 3ENWA 1WCXA 5HKKA 4D8WA 3IERA 3SHFA 3RS8A 3AW9A 1GGJA 5DEIA 3B1VA 4JP1A 5KB3A 3G13A 1M76A 2OB2A 3UAYA 2VSYA 4ABYA 2C88A 3OTIA 5HPYB 5JXGA 2WAOA 3TLAA 1NL3A 1W0JD 1JXQA 1I4LD 3OF5A 3HXOA 2QLFA 1QOQB 3VSDA 3LWBA 3IPAA 5J0YA 5J59A 5K05A 4ME6A 1KRXA 1AHPA 1H2HA 1KO4A 5GJWC 3FUWA 4BU0A 3FPEA 5C52B 3TOVA 3CN9A 3H6HA 4NWIA 4D4GA 1X38A 1AS2A 4ZO7A 1ZL2A 1DPFA 5F21A 1M2WA 4ZI2A 5JEEA 5KFMA 3GOQA 4TS4A 2H2WA 5KYTA 4DL5A 1OLSA 5H3CA 1JKJA 1MO4A 1YASA 1VIAA 3AEXA 2PL9A 1WCLA 1TU3A 4U7CA 5LYJF 1RI3A 5ETJA 5SZIA 2C5EA 1H69A 1ZN7A 5EUCA 2WJZB 3WYGA 4EYQA 3FUXA 1QFZA 3G0OA 2ZUVA 2IU3A 3ONVA 1Y1LA 1PEYA 1G8JA 2HPZA 1BN6A 2MDTA 5JAHA 4CDNA 2X1LA 1UXKA 2YXLA 1X92A 1BXGA 4H35A 3WWDA 1WP9A 1B8NA 1ISFA 1E2KA 2PT9A 1G21E 2GAFA 5DBHX 4D0RA 1RRPA 1O9BA 4ZHQA 1XF1A 3RUCA 4XSVA 3IKMB 3ZV5A 3IAAA 1IK6A 2IPOA 4KPEC 1S9DA 2X2OA 5AJTA 1JQJC 2EYQA 3VKWA 3HGQA 3D2CA 2W58A 2WKWA 4OKSA 5AQEA 5EQDA 1E3JA 4QHYA 2WUFA 3ZKWB 1AC5A 1M2KA 5LP6C 1FFSA 1T2FA 5K01A 5G1PA 2FP4B 2ZIWB 1M5UA 2KBFA 1V7QA 3K1TA 1O5TA 1ESNA 4PYRA 1UQRA 1QKKA 5E7IA 2V1UA 1TYZA 3MT8A 3DFFA 5D51S 3UB3A 4RPLA 3VH4A 2W2MA 1GTJ1 5K4AA 1JMVA 2YWEA 2P3QA 4NX2A 1GGHA 3NHWA 4B81A 1M6VA 4TRRA 2YV2A 4R40A 3BULA 1T15A 3LNTA 1PD1A 3CVUA 5EXXA 3KOWA 1EIWA 3QE4A 1YZHA 4F0JA 5C7LO 1XHFA 2CBXA 2GPWA 4XYMA 3K71B 2X5JO 4U63A 4R0MA 1R18A 5EJMA 2I80A 5T64A 1FLNA 1OLUA 1DC5A 2BEJA 4PFSA 2D0PB 5AP9A 3RF9A 1O8BA 1P7DA 3D4OA 5TT1A 1T1SA 2OK7A 5A04A 4ESHA 1E18A 2WP8J 4XCVA 3ZXSA 4XEUA 2EATA 2SICE 4YAGA 1MA3A 4GOOD 5F52A 1PL0A 3QEMA 2HMSA 4JEUA 3AH8A 4Z5XA 2HNBA 3IPRA 4BNNA 1ZP6A 1XZFA 1M34A 1CQPA 2A78A 4KOEC 4LRYA 1CQXA 3AJDA 4RVNA 3JQGA 1NJFA 2V96A 3L0IB 4E2ZA 1NN0A 1FP2A 5KBYA 2GCGA 2XWPA 3VO2A 2PL1A 1XALA 1AK9A 1PW7A 3MWLA 3ZXIA 1QV9A 1TK0A 1P6XA 2CUTA 5K99A 4JLBA 1SZDA 1Z16A 4BFCA 3ZWKA 4GZ5A 4C5AA 3MWDB 2J0EA 1T4MA 2ZWAA 1Z1BA 1VTKA 2PN1A 1P19A 1J7KA 4PG5A 1CX9B 3NW9A 5NULA 1T2CA 5F9LA 2BR3A 3X2FA 2DOKA 3K2QA 2Q3FA 1Z6YA 3AY0A 4FNGA 2VCHA 1PBTA 3DGFC 2AMVA 4D25A 3C5FA 1KYQA 1U4SA 4QZ8A 3R6WA 5I3ZA 3NPMA 1MXHA 4B74A 5HOEA 3TZKA 4DA0A 3RBZA 2BMWA 2PTGA 4L08A 2FB9A 3P9KA 4K81B 3PX3A 4C8MA 2M0NA 4QGSA 5JALA 1E2LA 1U63A 4ZDKA 5CCXA 1RRFA 5CFLA 4DV3B 3M9XA 1ZNYA 2J9GA 2OECA 4P84A 5EJ6A 2BGGA 2BE7A 4CDGA 4I5EA 1BO6A 1JKMA 5A5FA 2Y76A 4OF4A 5DWVA 5EJ9A 4DDWA 2BKAA 5KSZA 2HL6A 5K0SA 2X5KO 5K3BA 1ZGCA 1R5OA 2W7TA 1NVBA 5LVAA 2HJVA 4KLTA 2ASDA 3D2BA 2P66A 1FDTA 2CL5A 1K98A 1S8NA 3TINA 5K2MA 3LQFA 5T7BA 2VJCA 3M7IA 2CNOA 3H17A 3LAWA 1HXHA 1D8LA 1B0PA 4H6VA 3FKSD 3DXXA 3ILVA 4Y1FA 3OCCA 4TYWA 2QVYX 1NY5A 1J8VA 1E77A 3L18A 3DV0B 2B35A 5G41A 5J4KA 1KSJA 2BHRA 3RAFC 3RGWS 3KKOA 4P0QA 3ND7A 3P1JA 1WCYA 1QRTA 5C8YF 3CUEF 1HL3A 1UK6A 3U81A 1NXWA 3PVSA 1UJCA 4PGGA 2C7RA 3OA2A 4IDGA 2UV8A 3INRA 3L5KA 3EZFA 3LOQA 5TX7A 1ZH6A 3DKKA 1EFCA 2F3UA 5MGNA 3WL3A 2A5DA 2IUYA 4LWPA 2LP4Y 5AKXA 2VT6A 2XQFA 4R84A 4V24A 3K4GA 2ZTSA 1OLSB 2RGBA 1JKJB 4I2VA 3C28A 5GIPE 2ZSFA 4CV2A 3ETLA 3EIXA 5TMPA 1QCYA 4J0JA 1HL7A 4US1R 2YN4A 2G4LA 1GPKA 1OSNA 3JQ7A 4KPYA 1CP2A 4BFLA 5KTNA 3N39C 2B21A 1GDTA 5I7FA 1SKQA 2CKMA 1G3IA 3H4IA 5LP1A 1BXGB 1USIA 1EUCA 3TMYA 1W4LA 1Y6GA 3OJWA 2FMTA 1C8VB 3UQZA 1CJBA 4ZHQB 1OBFO 1BYUA 1XZKA 2C31A 4JY7A 3R7AA 4I5DA 5DB6A 4DUPA 2B78A 3ZHYA 3WNCA 3AFMA 4ESVA 2FWNA 4WASA 3NTVA 3EULA 3ZDYB 2V45A 4RL6A 4LI3X 3QJYA 2XNKA 4KIGA 2IEAA 3RT7A 2EDUA 2UUOA 1R66A 3BQ7A 3KPUA 1K7SN 5BRJA 1JHPA 1L5OA 4YMNA 2QN7A 4JVOA 3HQ4O 3A6EA 4PZZA 4UQLA 1W5TA 2FPWA 2OM6A 4UD2A 4EDHA 1T0BA 1ZISA 4LY0A 5HKBA 2EW8A 1JG4A 2HD4A 3MWYW 3PX4A 5M34A 5EXDA 1OPXA 2DPXA 1QSYA 5A4DA 1M6VB 1O4WA 3WGGA 4AFNA 4BP3A 5JTTA 2XICA 3OQ1A 4HRAA 3EQ7A 1DJPA 1V3UA 4F3OA 4GKKB 3KJEA 2IZZA 1N5WA 2UZ0A 1J25A 1M2JA 3PQ5A 4LK2A 5FWAA 5I9NA 2XMSA 3CP8A 4B9MA 3UPQA 1TMYA 1MB9A 4B7AA 3CWCA 2PQ2A 2XO7A 2ZLBA 4CM3A 3IDQA 1O2DA 1Z0FA 4ILKA 4XQEA 3KVNA 1A3CA 1CRLA 4RSMA 2R47A 5KWSA 2WMNB 4UTVA 3ANNA 1ZIDA 4ZHSA 4D92A 1AF7A 3FJOA 2QN8A 1DDIA 3DDWA 2DWCA 4WD3A 4NRDA 2PFPA 2GEJA 2I29A 4URWR 5FTJA 2NSHA 3R2JA 1APBA 1JXOA 3JQGB 4DUZB 4RD3A 3FZEA 1RPNA 4LDPA 3SDZA 1MBZA 3CKKA 3GA0A 4GKVA 4X7RA 4AT1A 2WSYB 4RO0A 4BIMA 4RF5A 5HJ2A 4A15A 3N0XA 4P08A 4EEKA 2F2AB 1MJNA 5G0VA 2OQ2A 3GT4A 1QQ6A 3NC0C 1NC1A 4Q9HA 2OCGA 4V2IA 1HRKA 3ZDZB 3QI7A 3PS9A 3GLFA 1BAPA 4LDNA 3V1NA 2QRUA 4F9FA 2IQIA 4XB1A 5G1OA 1MAWA 5A1TA 2RHTA 2EC5A 4OK6A 1JDSA 4OOFA 5KYYA 4YUWA 3UQ0A 4KBGA 5AI9A 4RW0A 3WLPA 2ZRKA 4F72A 3RLIA 4DL4A 1FNSA 4PZNA 1KU0A 2Q6OA 3TRFA 4A6DA 1U1GA 4R3NA 2SHKA 3L8HA 2OAP1 3DMFA 1TZ2A 1MGOA 2XHZA 3A2NA 3G2NA 1D07A 4Q6WA 3OJXA 3UHOA 3KAKA 4H1UA 1LDGA 4TUYA 4BEVA 2HH9A 3NT2A 3HJEA 3L8DA 1SXQA 4Q1FA 1DEHA 2B34A 5C5JA 3PUKA 2Z6VA 3MGHA 1LPNA 2H1FA 4BS9A 4D3SA 2VNKA 4BLUA 4TMXA 1TNDA 3HCPA 5A4IS 4GI3A 1L7AA 5K20A 4J9MA 1L7OA 2QTCA 2IHNA 5FA8A 3T3HA 1IBSA 4J2TA 4GX1A 1P45A 2VPZA 2P62A 3OZVA 3VDMA 3ZE7A 3W7BA 3I92A 3V34A 4PTZA 4ND6A 2GF9A 1ZYUA 1WAMA 4DMFA 1MAAA 1X66A 4P0QB 5JO9A 3E7DA 3BJZA 2GZ1A 3RFCA 3ZK8A 3PUZA 1E64A 4PRKA 1CJKC 2GCEA 4M9HA 1A5AB 5JCXA 2NTJA 4YQZA 2JI7A 4L15A 5AM2A 5LB2A 3LFHA 2A5FA 1X1SA 3ZJVA 2ZT5A 1ZJJA 3LPLA 5DNWA 2C2HA 2VTBA 4QUGA 1YQTA 3ILHA 1FQKA 1PG2A 1HK7A 1E94E 2G6BA 2JLYA 1KZ9A 1UT6A 1L3TA 2HRQA 5JXJA 5D2CA 4R31A 4J4HA 2R68A 3JQ7B 2I5PO 1B73A 3N2KA 1SO8A 1DTWA 3EAGA 2WSMA 1CFJA 4V38A 5D3QA 5LQAA 1OVGA 4WLOA 5AJUA 1AHHA 5F33A 5ENZA 2AOVA 4MUHA 4PFJA 1T3HA 1NXXA 3VX3A 4DUGA 1OYYA 2BE9A 2OO7A 2R87A 4RYLA 3CUWA 1VJTA 1UF9A 3GNTA 2F8LA 3ZZ0A 3PHGA 1T0PA 4ZEMA 4UE6A 2JGNA 5F1KA 4F11A 4FYKA 4YAWA 2IIQA 4JUIA 5G4KA 5CR0A 1N48A 2O7QA 3ZI0A 2C1ZA 2C9BA 1JALA 1C3JA 3KFUF 2CFSA 1GKUB 2V9PA 3CB4A 1SB9A 4K6CA 1E62A 2R97A 1ZNXA 2Q7OE 3NHYA 3U2QA 2HB6A 1U7XA 3L6CA 3WKEA 4AMUA 2RC5A 3K6JA 4QJ3A 1QIMA 4DLYA 4LFCB 2BSAA 5ALQA 3WL6A 5GIOE 2A92A 4CPDA 1V6AA 3IT2A 2CMKA 2K4EA 1USKA 4DNXA 3T4UA 2IYRA 1CTQA 1RWWA 4OSEA 2RGCA 1HDGO 2VJBA 1BS2A 3HRKA 3LS2A 4OQFA 1XJCA 2I6GA 3QQ5A 5EFZA 1GEGA 4ZHQF 1N6RA 1QTIA 3ZI4A 3IAHA 3MTAA 5HJ7A 5DDIP 3R6TA 1S2DA 2YV4A 1QIIA 1IE3A 4RD2A 3TO5A 4EA7A 4ZOBA 4TUPA 2OFWA 1I4TD 1YAHA 4KLRA 1T3QA 2GZRA 1CY2A 1RWXA 2X9GA 1XC7A 2M1XA 3AQIA 4QIWC 2FMXA 1YOBA 4CXMA 4NLNA 2Q8QA 1ZOPA 1VIYA 4DPKA 1G18A 4CTMA 4Q1AA 1FBTA 1GKYA 4CCHA 4PH5A 3R0XA 4MW1A 3Q3JB 4HZUB 5JAMA 2G1UA 1EWKA 1XFDA 2QMQA 3MABA 1G5FA 4V03A 1CZUA 2I2AA 1RMQA 4LXUA 2ZVPX 4F86A 5AKYA 1C7ZA 3HILA 4U8GA 3OPXA 5DNAA 3RRYA 5DLQC 3I83A 2PX5A 2BI7A 3TEFA 1EQUA 5KTQA 4YX9A 3GLFB 2ZBRA 1IJKA 4QOJA 2Z5VA 1SL0A 4XWKA 3SZLA 1BMFA 4WTOA 3MQ4A 1GGMA 5JCOA 1P4RA 1Q92A 3QI2A 1OLXA 4QO7A 3U56A 4M0CA 2NX2A 3H9UA 4N0DA 3HWTA 1OROA 4CUJA 4WXEA 1HT0A 2B4KA 3IAM1 1JWBB 2B4AA 3AEKA 1N77A 3O0TA 4WN3A 4NECA 3CKMA 2K4IA 2HSWA 3EVNA 2XE7A 3N8KA 4QOSA 1YRHA 2KI5A 3C8UA 3MQ2A 4NYIR 4TUYB 5FUBA 2AN5A 5GONA 5ALNA 5TEWA 2I3DA 1RJEA 4OG2A 4CBVA 1C0IA 2HRDA 2GF2A 1XVLA 2H52A 1WUIS 1VXRA 3TM5A 2JC3A 3NRCA 3BC1A 2WNSA 4EEZA 1HE8B 3HO6A 2A5LA 3FOEC 1YR2A 1HG0A 1CLUA 3DLHA 3BORA 1C3VA 2IEGA 3CLSD 4JV1A 3DEZA 4FBUA 4IX9A 2Z5FA 1XVTA 4J16A 3W1EA 2D0IA 3HKCA 4BBPA 1GUZA 2O59A 4E5KA 2VG8A 4CCSA 2YTZA 2GK7A 3UMRA 1HM5A 4ECTA 5K1ZA 1KYWA 4DLGA 4ARIA 1VYTA 3A9RA 1V8ZA 2OCKA 1PLLA 2R6CA 1DGQA 1UR5A 2Q5EA 4I9UA 1N92A 1WPRA 1V9SA 5DE3A 2LBOA 2X15A 5KTRA 3VISA 3LVFO 2PLFA 2JLAA 5D3KA 5ER6A 1JIHA 3H4TA 1GILA 2F7SA 1ZOLA 4J43A 3BGVA 1SXJD 3F78A 3DZCA 4MYTA 3L01A 2VTBB 1KFDA 2DTEA 3N5KA 4ODIA 2ATEA 4BNIA 1X1EA 1UWCA 2BJWA 2WZBA 2O2JA 1DXHA 4I2JA 2PT6A 1AUQA 1XD9A 2CHGA 1RAHA 3N2KB 1KXJA 4QW8A 4RH1A 1DTWB 3WBJA 3STXA 1M8JA 2AJ8A 1ENPA 2E85A 4WFIA 1YZYA 3JPSA 1E2IA 4DILA 4LJXA 2V7GA 4R41A 3TRIA 4IJWA 3ABZA 5ECYA 3VJKA 4PY2A 3TD6A 1JB1A 2JGRA 2WWIA 1MEOA 1LBIA 2Z98A 3PRHA 5FFNA 1XP5A 1BVRA 4NOMA 4QVGA 2BKVA 3UCXA 2KLBA 3PLRA 1MU0A 3AM4A 3CLRD 3CISA 1Z4OA 1C41A 2Q4EA 2PRIA 3HGTA 3M3DA 2H1LA 3RRMA 3DTYA 2PUTA 3PSHA 1YGYA 4GP6A 1QAQA 2OQRA 3GEMA 4NV3A 3ZWCA 4C07A 5G4KB 3CR8A 1X1BA 2PR7A 3MW8A 4YN3A 1E7QA 4MDYA 1MH9A 1Q74A 2LI6A 3QEAZ 2ASJA 2MCFA 3V7LA 3B51X 1KI1A 2PLRA 1IOWA 2QM3A 4DIDA 4BRWA 5JY6A 1X8LA 1MW8X 1FRNA 3WMFA 3DVSX 5J0TA 3SNKA 3PPWA 1ZGBA 2I7XA 3STUA 2QN3A 5BUQA 2XUQA 5LIRA 1QQ5A 1JFFA 5H83A 1YDHA 3REFA 4H31A 2WLTA 3KIPA 1RWOA 5AVVA 3VJLA 1P8AA 2JFHA 4D9CA 4Q93A 1GPJA 2IBMA 3O93A 4HLQB 5CUQA 2ESRA 3RDPA 1UFKA 1YZGA 2V0NA 3CVWA 3DDSA 1I24A 3QG5A 5FV4A 4KQ1A 5AVSA 2ZAOA 1XEFA 1UDXA 3U3MA 1HV8A 1R74A 3LC2O 3EUEA 4RNNA 3JPRA 1GU7A 1NQAO 2ZJ2A 4P2GA 4KGXA 3FNIA 4WOCA 1D2CA 3H83A 3RK0A 3OFND 3ILYA 1ZD8A 4FKBA 3GRFA 4DLXA 7ICSA 3F5EA 4CLHA 4O33A 4OA8A 3W9SA 5I48A 9ICOA 3GCXA 4X94A 4D6YA 3QPCA 3EXG2 4DQIA 4MIEA 4B9TA 1UEJA 3DHWC 3IFSA 1V45E 3WMXA 1EM6A 4K1LA 4JXZA 3A1FA 5L45A 3AOEC 1LWNA 3H8VA 2PEYA 4QAQA 4ZJZA 3KS9A 4H3VA 1X0XA 4EYKA 4NR0A 4XASA 1SRQA 2H8GA 3HGMA 5IKXA 3U4MA 2NUTA 3FYUC 1LSJA 3MB8A 4HQKA 3ACDA 2VPIA 3BXZA 3D3KA 2R1UA 3HU1A 1MN6A 3TW8A 4GP9A 1ECLA 2K8BB 2PBFA 1JH9A 2X14A 1Y5IA 4M9RA 4XQ8A 1IN6A 2HJHA 4MRPA 5F5NA 1ZOSA 2ZJ6A 3ZUPA 4M88A 1JA0A 2NU7B 3I6ZA 1J2YA 4LYYA 4J7AA 1A2BA 1H2AS 5ALTA 1TC2A 4DDMA 1VI6A 2HO4A 3R76A 2AJLI 3UMFA 1TRKA 3L8EA 1PUIA 1O58A 3UW1A 3IQGX 2OFFA 1JUDA 4B35A 4DE5A 1Z39A 4G3XA 2UXBB 3VR2D 1XJWA 4K28A 1IRXA 3O8NA 4U0KA 3AEKB 3VMMA 3PCXA 3UJHA 3I9OA 2HA4A 1NF9A 3KZXA 5JTUA 4DKJA 1NMEA 3VU3A 3QVVA 3K9WA 2JLQA 4AY4A 4XAQA 5ED0A 2ZT6A 3E1SA 3AMZA 2X8JA 3KUDA 4PYLA 5GONB 2RBEA 4H0CA 1X2BA 3I09A 3DKIA 4S0ZA 3DTNA 5HMLA 2C9YA 5DXJA 2JA2A 2NGRA 3TBKA 3C16C 3VO9A 4IXMA 4D5GA 1WCNA 4Q48A 2XTNA 4I99A 1EYZA 1N0VC 3EUFA 1XD8A 2SNIE 4RS3A 2FA9A 2H06A 5CJPA 4UZSA 1U5CA 4IQ8A 4CKCA 3NDRA 3CRQA 4U6NA 2J0QA 1QP4A 4OSPA 2XUGA 2W4IA 3NGDA 4HYTA 1N6HA 4KQIA 1KMCA 1WMBA 1KI6A 2OCEA 4ZVSA 3KEGA 3UNXA 2HK6A 3HKCB 1WEKA 1WZNA 4HGQA 2VDWA 4RU9A 1E66A 1Z7WA 4KLSA 1THZA 1U2PA 2HTFA 1Q6ZA 3OFNA 2O7SA 4EKEA 1NJ8A 4FSXA 2CMDA 1SVNA 4P3KA 3TNDA 3PFGA 1KC3A 4Q1BA 2BCQA 4HUJA 2QWXA 2GTPA 2HMYB 3SS8A 2FPIA 2JFGA 2VTKA 1H1TA 2R11A 2GO7A 3K0BA 2VDQB 4UARA 4C0BA 4O3SA 3I2KA 4AS1A 2NO1A 1U0SY 2VF2A 2A9VA 2ZZMA 3KO8A 4TUYF 2QY9A 2QVCA 1BQ3A 2QGFA 4MUKA 2HA6A 2B61A 2KYRA 3IQFA 3TVTA 2FGKA 1VGQA 1PR1A 4QBTA 5IN4A 3IMGA 2GBLA 5BVHA 2CL0X 1Z5WA 2AV6A 4YHBA 1G8MA 4IFIA 2HMXA 1YZ6A 3D6AA 4OX9B 4XZ3A 1I13A 1L5NA 3T1TA 2VP2A 1VJ0A 4MAFA 3NHMA 3LUFA 1NM5A 3ZXXA 1B76A 4EYSA 1H8HD 3BWDD 1F5SA 4QJ4A 2PX8A 2C3YA 1K8QA 4LJ7A 5FBKA 4PC3A 4ZN6A 4O5EA 2AR9A 2GAJA 5AQ1A 2YRXA 3WLFA 5GMOA 4XWWA 1S7CA 4BN5A 3UK2A 4U3JA 1LV8A 2WB1C 3AHFA 1ILEA 4IQWA 4AY6A 3CLSC 3C39A 4P7GA 3H75A 3AT1A 3VKHA 4F7WA 1CZNA 1Z00A 1J90A 4MZXA 4I29A 2XD9A 4OD0A 4LV8B 4QATA 4J9OA 1JKXA 1TGVA 4CNBA 4XFDA 2V9WA 4B3BA 1KR5A 4RDXA 5G53C 2IH2A 3G49A 1XPRA 1PCXA 3NRJA 4E11A 5AFSA 3EUB2 5FQNA 2P5TB 1Y3BE 2OYYA 8ICGA 4K9NA 3MYRA 2I4TA 1UMDA 1QONA 3KG2A 2AZDA 4DFKA 3LX6A 4CF4A 4EYOA 2VK4A 4DSAA 4DDHA 4CIWA 1V8FA 4OQNA 2RRDA 1SXJC 3U7IA 3DJYA 3QTBA 4DV1B 1R12A 5IJZA 1RWKA 3NNDA 4D3XA 2AE2A 4N01A 1LU9A 4BGVA 1AF4A 1YRAA 1F7VA 5E6SB 4BAZA 4GQBA 2KLHA 2BM0A 4QU9A 4BPBA 5EXPA 2VJAA 2Q1WA 3LBIA 2Z95A 2DPJA 3MAGA 3WLJA 2Z56A 5B7PA 3D8NA 4CM4A 3MS7A 4DF8A 3AF1A 1ZS9A 4D02A 1ODTC 3LF2A 3OCZA 4TRNA 1MVLA 2C2YA 3A1VA 1M6HA 1M2VA 1OFIA 1OA0A 4ZICA 2XQIA 4OHPA 1JU9A 3QW4B 5JCPA 1EDZA 1I9GA 9LDTA 2FG7C 3RTDA 1SV4A 4YP3A 3T41A 2BGJA 2OBBA 2BONA 2WF7A 2Q21A 3RODA 2E4YA 3FWHA 1KNQA 1WWKA 1MAVA 4OLHA 2QJFA 2NUTB 4HDRB 1E1KA 4X54A 3AVVA 3DONA 3JQAD 3CWQA 3ROFA 3CF2A 2V4ZA 4PX9A 1A4RA 3ZCVA 3TW8B 1Z15A 1ZQDA 1P1RA 1XA3A 2BFMA 1CUDA 2H7YA 2QI9C 3GJ5A 4U5XA 1H8HA 3E7WA 2DKNA 2FQYA 3AGQA 3NLLA 3UV3A 3FPSA 4XR4A 1P31A 4YY3B 2DPLA 1EM8A 4JLKA 3MWFA 3W04A 4YRCA 4JP8A 1MVOA 1JHVA 1GSAA 5B1SA 4L5AA 1DCFA 4KITB 1HR0B 4JUZA 3I01M 1IUNA 4BLRA 4M9CA 3HY3A 5CFMA 1CDDA 4YMLA 1XKXA 8ICPA 3KR1A 1M3SA 3HKZF 3M0EA 3JVDA 4DNFA 2J48A 4MI1A 3DOUA 1RQRA 4FDVA 4L4ZA 4MINA 3MGBA 3KHUA 4IBOA 4FO6A 4R8UA 2FZEA 2X8JB 1UBEA 4HWPA 3ZBPA 5H70A 5A06A 3BE6A 1CIPA 3E5MA 3KKAC 5JMPA 2FW9A 3K4PA 4FHZA 4D44A 1JNYA 1I3KA 1KP3A 1GA1A 2VJ5A 2EQAA 4CCWA 1EAMA 3VM6A 1TAMA 1NURA 2XLBA 5I3CA 2QNBA 4XM0A 1NSYA 1SG0A 4CKCB 1XZHA 4TYNA 1RLJA 3Q8LA 2WYVA 1KI6B 3BWBA 1FDWA 5DYWA 1KLNA 2XRYA 1W49A 3HJCA 2VDWB 4TT3D 2FSGA 3WYCA 3RVLA 4LY3A 1NV8A 4NXNB 3UXOA 3A6GA 3D4BA 2FRDC 3PC3A 2OBMA 1NI4A 3IP9A 3SR0A 2PUVA 4LVSA 1K7XB 4OH7A 4RIHA 4DLSA 4DNPA 1JHRA 3GJTA 4OO3A 2PCLA 5HF9A 4MPRA 3W90A 3FHCB 2PX3A 5DLYA 1AUPA 4ACOA 1II0A 5BMOA 5AT1A 4B73A 3Q3EA 1N2CB 1G7SA 2FPIB 3K73O 3TSYA 4YUYA 3REGA 2HWXA 3L02A 3MJRA 1QF9A 3EMVA 1UODA 4YCMA 4N4AA 4CF7A 3T9DA 1QJ4A 5F1OA 5EJ8A 1YE8A 1W5SA 3DP7A 5KYKA 2RGWA 2P5YA 2G17A 4JIGA 1P4GA 4XPZA 5GONF 2QZPA 1L3VA 2ZUUA 2GMWA 4HDSA 3UMCA 7ICLA 4NYMQ 2WJ4A 5DB7A 1X87A 5FYDA 3QE2A 1TAQA 1V39A 4IDHA 4IXNA 5BVHB 7ICVA 1XAGA 4R05A 1AB5A 2E5SA 4EJFA 4IPTA 3RYCA 1HYGA 2A84A 5IC5A 4FW9A 5EP2A 5IABA 1JI0A 3JWGA 4QJ5A 4INZA 2IU4A 1Z19A 1DKRA 1ZGAA 3S81A 3FTNA 3F3MA 4Q05A 3DFKA 3V2GA 1XJ0A 3C7TA 4UC0A 3M81A 3AJRA 2UYOA 3U17A 3TB4A 3T7TA 3FD8A 3WIOA 2OWEA 1H1LA 4U3JB 3WKAA 4G0ZA 2WPDD 1PYDA 4UMFA 3UQ2A 4F12A 2LZ0A 3EQ8A 4X3OA 3VVMA 4Z4CA 2KE5A 4KZPA 5DQGA 1YKGA 3PFIA 2J3KA 3TCNA 4NZNA 1D8TA 1MCZA 2Y1GA 1EGMB 3BT7A 1OH6A 1BKSB 1M67A 2J5KA 5IKMA 4TMTA 1XCLA 3A2MA 2ERCA 1E20A 2V1XA 3JAKB 4Z3KA 5TLSA 2AC7A 3DOHA 4MDHA 4CLOA 4HKTA 4QGFA 4F45A 1UMDB 1CRQA 4RELA 6GPBA 3LLVA 4OHKA 2HXYA 4GO1A 1VLBA 1FFUA 4YFVA 3BMCA 1T13A 5AKHA 3H0RB 3DMDA 3FYHA 2PS3A 2UAGA 4TT3A 1UJ6A 4R8VA 3F67A 5L7TA 2H92A 4PRZA 5B7GA 4RESA 5EINA 2E5FA 2IIBA 2BUAA 3IILA 5LCXA 1VL0A 2GBFA 1IVYA 4CM4B 3D6TB 3NVKI 2WEKA 1JNXX 2CCKA 4L28A 3PX0A 1HTWA 4OK3A 1J5PA 1TIPA 3KV3O 1PR4A 4WBXC 1TT7A 3I28A 1OC2A 4GOLD 1M2VB 2ANBA 2FH5B 4PRLA 4LY9A 2BKEA 1NFRA 1ADCA 1D2HA 1ZQGA 1Q3VA 2NV6A 3H9JA 4JR1A 1MF7A 1YZFA 4PSVA 3SHOA 2IDZA 4HS9A 1V6SA 4RF3A 2NTVA 3AB8A 2XGMA 1XKLA 2AJBA 2DQYA 4BUCA 3PGLA 3EIFA 4D9NA 1O6ZA 1E5QA 4V0SA 4C89A 3NVAA 1AMOA 5B66U 5JHHB 1KEEA 2IK8A 4HBZA 5KQRA 1NRWA 3S2SA 2A0FA 3PJDA 2ES4A 5TARA 2FPKA 2YFYA 1TF2A 3V7FA 3AM5A 3SZRA 3CINA 3IX7A 2PS1A 3VCBA 3QIAA 3DHVA 2BF4A 1KAOA 4AKHA 4ALLA 1Q0QA 2WI8A 1EM8B 2YYYA 3QFFA 3GJQA 1MPTA 4A03A 1NFFA 2W4MA 3I6BA 3K0EA 2PXCA 2R66A 3BWVA 2VF8A 2HLDA 4NP6A 4BNLA 4HH4A 3M82A 3RC9A 2BMDA 2EHJA 1LC0A 2C82A 1SUIA 4AVYA 3VNVA 1OZGA 1FA9A 2O2YA 1Y9EA 4YFKA 5TMEA 1TL7C 4A6XA 2H65A 4R8UB 3C1TA 3UG6A 2UYYA 3ROZA 2ACWA 1WB4A 3D2LA 5LP6B 3NXKA 2QR3A 3VJRA 1Q11A 4DL3A 1K27A 2FN3A 2OBNA 3IJPA 3OZXA 2EX1A 2QRZA 3QUSA 3JQFA 1V9CA 9MHTA 2AHOB 1Y34E 1PLJA 3WGZA 3TL6A 3J7AC 1Z62A 4P7JA 3GPIA 4QSHA 5AVWA 1W0JA 2WVGA 4KX3A 2WMDA 3M1IA 4R1LA 5K3FA 4MVCA 3NVVA 4R9RA 2HCRA 1W73A 3OM9A 4J3JA 3PQDA 1WD5A 1OGYA 4YCXA 4N5NA 2C98A 1OWOA 3W5CA 5C1OA 4BX8A 4RLHA 2LM4A 2GM4A 1ZDMA 3PEWA 1OW3B 2Q0XA 2X6QA 1KI2A 1NI4B 2FSUA 3E3LA 4KQGA 2NQTA 1V25A 3W5SA 2CW5A 2VHXA 4HNUA 4IXTA 2NVBA 2WP0A 1PR6A 4N5MA 4IIFA 1FIQA 2GZSA 2BD0A 3ADDA 2HHCA 2CVOA 5K8LA 3CCBA 5HIMA 3HFRA 3JQ9A 3UOWA 4LSZA 4LWZA 5IDVA 3T15A 1GPDG 1IDN1 4LZLA 3PTZA 2JFPA 3GRYA 3STTA 1DG1G 3NBFA 1SM4A 4HDSB 1ELOA 2WAXA 4QPZA 5LM3A 1DAPA 1F0NA 1ZC3A 3G0CA 2QSYA 5CIQA 3HVHA 1RJGA 3RVKA 2B8JA 3LCCA 4PNEA 1YCFA 1GFZA 4OLFA 3WRYC 3N7TA 2L19A 3QENA 4D4MA 2H1CA 3RYCB 4JB3A 3T3GA 1M66A 1TM7E 2EAMA 1O54A 3LDUA 1HNWB 3RFTA 4FHEA 2B98A 4DV0B 1PI3A 3ITEA 3ZU5A 4IMPA 2E89A 1MT0A 4P4SA 3KJHA 4UD6A 4RU1A 2AUMA 2ID9A 1JU4A 1U31A 4D96A 4YR2A 1VFPA 3C1YA 3HCFA 1H1LB 4AAYA 2JH7A 4GNKA 4DANA 5FLYA 2JAQA 3LFTA 4ROSA 1LA2A 1RCUA 2YZGA 3AF5A 4UAUA 4RMJA 4RZSA 3X1JA 2DU8A 5D86A 2Q6VA 4P3YA 2QG6A 1XT6A 3O8BA 1AZTA 1UPTA 4MF8A 4FR5A 4NOKA 3PUWA 3ZHTA 3PW5A 2CHUA 3K0FA 2DQSA 1FW6A 1PRYA 3MTBA 5I7VA 3V6JA 1L7EA 5HUQA 2BEKA 4L9AA 5KFOA 4MWGA 3OE7D 4Q4DA 1PT9A 2RDIA 3SBDA 4CLOB 2NMVA 1IZZA 2VHJA 3FMGA 4C7OA 3B12A 4EM6A 2OGWA 2IY8A 4GXRA 2HIAA 5KCZA 3PRYA 1FDUA 3DBHA 2X8AA 3TN7A 1XAHA 3BMCB 1JFSA 4AJPA 3GAMA 1KY2A 4KK4A 4YQEA 1NK8A 4IILA 4MW5A 3CVYA 2AZMA 1IOVA 3GGJA 1XQVA 1UXJA 5K0JA 4QRIA 2W98A 2NQ2C 3JPNA 2OVFA 2GLXA 1VJ1A 3BFVA 5HIJA 2CV1A 4DQSA 5KFTA 1XWWA 2ZS8A 3OZIA 4FUTA 3AVWA 3LZDA 4JITA 1B6SA 4YJDA 3RFFA 4GLJA 5ALOA 3I62A 4DCJA 3IBSA 5LKAA 4QWEA 1DLJA 3HEMA 2CXQA 3SV3A 1ZK0A 3WL5A 1XI2A 1I7PA 1M83A 3KT0A 2HSZA 3FTFA 3MMPA 3TYXA 2HAEA 4F96A 1R7RA 3RUPA 5GGXA 5J9FA 2EZ4A 2ZXEA 2AF4C 3G8CA 4D4IA 2QZJA 3PJFA 1EXNA 4EVIA 4Y6PA 3EISA 4EGAA 4E08A 4L8YA 2P7IA 4RY0A 1KEEB 5HM8A 3G5UA 1Y8CA 1VMKA 4KVFA 4QXRA 5HQTA 1TA9A 3S70A 2UKDA 1SBIA 1GDHA 4IWNA 4BB9A 4YD1A 5FNVA 2QL5A 1X9SA 3PUYA 2JLCA 1SUEA 1SU8A 1UUFA 3RK4A 3BZUA 3BGWA 1M8PA 4H7HA 2FN9A 1XCJA 3BZWA 4PHAA 5JJCA 5DNVA 3KK0A 4B31A 1YL5A 2AKYA 4YC7A 1OI7A 4GLBA 1FTSA 4J94A 4MKHA 1KJNA 5EIOA 3QPVA 2LUOA 1TB4A 2FUG1 2Z58A 5BQ5A 4IFEA 3JQFC 4GDMA 3L4PA 3V7WA 5CLFA 4NFLA 4OJYA 1ABFA 3FCCA 1Y63A 3B9RA 3KVVA 4JHXA 1T0HB 5EIEA 5KFRA 4G0VA 4CKXA 1B8VA 3VR6D 1IB6A 1KZ4A 4DLNA 1P1BA 2PH5A 1DAFA 4RKEA 3VTKA 5THQA 5A9RA 3ZV3A 3D7NA 5FFMA 2E21A 1CDZA 1O77A 4TLEA 2HRRA 3GNSA 2H3ZA 2LCIA 4U2DA 1QZZA 3DZ8A 3FKSA 3O26A 1WTCA 5CA1A 1OLUB 4MQBA 4PZ9A 3RTVA 1YZQA 2EWVA 3NAMA 3SU8A 3PDJA 3NGXA 4FBTA 2C99A 2JZBA 2C2XA 5K3FB 3AL0C 4OHFA 3TAHA 4LVCA 4LMBA 1XO0A 4N6GA 2JLBA 3JQRA 3JQ9C 1HE3A 3QEMB 3RTCA 2GD1O 2P6OA 4I2GA 4PO8A 4TWJA 4C22A 4LF5B 1ICIA 3EVEA 1M34B 1IL0A 1J1IA 5DB9A 1BA2A 1P3DA 3V6LA 4QL3A 1XLTA 1O6GA 5EPEA 2GFHA 2Q27A 3FXAA 4D45A 1EI9A 1SB8A 3IBGA 3C3AA 1K4KA 3DE3X 4BNWA 3RBDA 3C5EA 4C78A 3RC7A 1W5AA 3AERA 3QK7A 3Q0IA 1DIGA 2HNAA 2CVPA 3G8AA 1PYGA 2YBEA 1DXQA 3KLNA 1U0TA 3NKFA 1R4AA 5F4BA 1Y81A 3LUPA 4C0KA 3ZDCA 2AQ4A 2PIAA 4RJ2A 4WDRA 1VLMA 1IY8A 4D43A 4V1CA 3ZHVA 2X1HA 1P7CA 3AFHA 4B4OA 5LP6F 4TKZA 2DB3A 1QYIA 1QGAA 4RNOA 4KYVA 3K05A 1Q57A 1VJ5A 4CL3A 4CV1A 3V9PA 2OCYC 1WOYA 1U48A 1A96A 3LT2A 3RSFA 4RTLA 5H02A 2JANA 3L2OB 5EZQA 1KRPA 3TCKA 2X5OA 2B99A 5I5GA 1E89A 1HDRA 3GRUA 3N53A 2UVRA 1T1EA 1XBTA 2WWRA 4NE7A 5C8ZA 1WP4A 3T8YA 2VK8A 4MPJA 4J9NA 2OK8A 4KQFA 9ICTA 4UM9D 4CW7A 4EYIB 4PEVA 3SI8A 1BEEA 4E0BA 4P4SB 3N2EA 4A8PA 1RRGA 4L57A 1ISIA 4JUFA 4MNTA 2QMZA 3S0JA 1OBOA 5FO1A 2ZE7A 1CY0A 1J5EB 5CA7A 1HT3A 4FP9A 1CG6A 4ZDWA 1N63A 1JGTA 2PWZA 3HW8A 1UC8A 2EP7A 3UXNA 5JZBA 2R8IA 4N3GA 4JVMA 3LWDA 1ZUD1 3MFHA 4G1CA 1CDEA 1B43A 1ORHA 3NWOA 1JR4A 1NYLA 4JYMA 3K0FB 1MR3F 1SIWA 5CJ2A 2Q6TA 4WBNA 1S9FA 3IO3A 1GQFA 4TTRA 1QGOA 4DQPA 2HU7A 1K7YA 1H2YA 4JI1B 5L9AA 4UUPA 3LKVA 4ZVTA 4TTQA 1P5RA 1P62B 4ADSG 4C7OB 4EAAA 3VC7A 1NZDA 4HGOA 3MHTA 1BEUB 4DJEC 1RPZA 4XWAA 3DBHB 2DWQA 1EHCA 3T94A 1S10A 4HEA6 3TD2A 3KE9A 1JV2B 1ZQVA 3BIXA 4YP1A 4JJFA 5IVHA 2E8NA 1G2PA 3BCSA 5CLLA 2F55A 1AN0A 1L8LA 3L7KA 4DJFC 1T29A 1BX1A 1MH1A 1YGPA 1XGKA 2Y0PA 4JZYA 1P7VA 1NYTA 3U09A 3FMFA 5I9IA 3B9BA 3MZ0A 2P1RA 1EQ2A 1HTTA 3G7NA 3L82B 2O5RA 4KV7A 3G59A 4I55A 3R7LA 4A36A 2V8BA 2JATA 4RVUA 2B5VA 4F92B 2WKSA 1OBCA 4RV5A 1D4OA 2MOKA 2VJYA 3L7JA 1Z4LA 2G0TA 2RCYA 5CHYA 1L6IA 2RSLA 4AURA 1KERA 2UDPA 5ALRA 5ALYA 3B6JA 4A6EA 2RMKA 3ZU2A 1P72A 4I9GA 1F2TA 4XYLA 3QV1A 3AO0B 1ZAKA 3M4JA 1EUCB 3G6KA 2IU0A 3GGPA 4DHWA 3KV1A 1M0TA 1L8AA 1ZITA 4WZ6A 1Z2OX 4W5QA 1TUIA 3OD5A 5E79U 1SJ9A 1TM4E 3ADCA 3WGKA 5FNVB 1KYXA 4ERNA 1GP2A 2FMSA 3IODA 4JLAA 3C1AA 1UT5A 1MJGA 2IYEA 2YZ2A 4HJRA 3V3TA 1DC3A 2C0CA 4G4GA 4PBRA 1Z7GA 3EFBA 3CPHA 3CX3A 4U1RA 5IKPA 1DQZA 3TI9A 1ISSA 3CZAA 4HAXA 1DADA 1U4BA 4HMPA 1ZJ6A 4M9UA 3ZV7A 4ER6A 1ORVA 4DOCA 5BXQC 4PAQA 2CFRA 4PINA 4QE3A 3O4JA 4E30A 4J1QA 5G2OA 4YROA 4S04A 2YCLA 5T8KA 1FUKA 1LJ8A 3G82C 3H9QA 3PY8A 2IUSA 2Y1DA 4AZ3A 3BPSA 3PW4A 2DPMA 1FDRA 5J2KA 4M55A 1OIXA 3T7IA 4CRXA 5LBIA 3SC3A 5IHXA 4A23A 4NOLA 1GPLA 3IC5A 5ES3A 2X8WA 1XLTC 5BNTA 1OXXK 2VIXA 4RTQA 5CA1B 2X5NA 1XRLA 5FOTA 3ASUA 3M9MB 4PQRA 4IHQA 4E3WA 3KEOA 3EE6A 2JZBB 3CH6A 2CFTA 5ENDA 2RGYA 4GGMX 5T57A 2GJ9A 3OMXA 4LC0A 1M0EA 3QXXA 2LTAA 4RGVA 3JPTA 1LZKA 4MRMA 1YCHA 5L40A 3REOA 1BMQA 3EODA 2V9ZA 3P71T 3HBMA 5CH3A 1IXRA 3H5NA 4FWBA 3DP9A 3TIIA 4OJMX 3ON5A 1B2RA 2IEIA 4EHAA 1V2HE 2JD1A 4LYAA 3WWZA 3B9JA 4I28A 2XGQA 1V7CA 3C2QA 3AERB 4KW7A 2ZCVA 1W0CA 3A1TA 2J8ZA 1UBSB 3DEFA 1VHWA 4PCUA 3C14C 4PR0A 3B85A 4PFQA 3TG8A 4LN1A 3VSAA 2WIDA 5I7UA 1U8AA 1UP7A 1RQ7A 3GVIA 5EHIA 1Y8AA 2QXTA 2P0EA 1Q2UA 2PGJA 4V1CB 2FFAA 1Z3EB 1Z13A 1ZD9A 2R96A 4R66A 3RIHA 1SBZA 3CB2A 2GKGA 4U4AA 4HC4A 4QRHA 2WF9A 2VYCA 2F8TA 3KWMA 1UM9A 1ZG3A 5FBZA 3U0BA 4HDAA 3AOEA 5JNSA 4IDDA 3PEUA 5KYYB 4TWBA 3GEBA 1SA0A 2YC4C 3LHDA 3EF1A 4H6PA 2Y1WA 3FYUA 3K75D 4PX5A 2VJQA 1DQNA 1O97D 1ZESA 3AVTA 3A8TA 2BOVA 4HB4A 1LDEA 3BUSA 4JXXA 4HN9A 3B6ZA 1GGFA 3ITDA 3GCZA 2V54A 5DULA 4WJLA 1H2BA 2HDWA 3CT4A 2YHBA 2CJYA 1L4YA 1LV5A 1W4AA 5CTJA 1XROA 1SZHA 5B6IA 4FN5A 4DSNA 2CN1A 2VNSA 3P2IA 1CZKA 3STWA 4BVLA 1IU9A 1XZAA 4PWYA 1H22A 4RDHA 2P5UA 4N0EA 4DLPA 1AGXA 3ICWA 2ZSBA 3T0GA 2DL0A 5HCUA 5HVNA 2PSHA 4XM1A 5JS1A 2G1JA 4WBNB 3FMPB 3IOMA 4RTKA 1N5MA 2W03A 1GYRA 3A7EA 4KSCA 3U4GA 4TQUS 4ZPJA 1S0MA 4D57A 1KSFX 1UBNA 1BVHA 3ZIDA 5CVCA 3R4CA 2HFJA 2XKAA 3LVBA 2G83A 4Q9KA 8MHTA 5B7NA 4WKGA 4RWZA 5JCJD 4JX8A 4ROTA 1SD5A 2VLBA 3FB1A 4YUZA 1ULUA 1W19A 3GY0A 4KH1A 1RM6C 2R0QC 2GPSA 2FWBA 1E7MA 3I42A 5TQVA 3L04A 4Z0TA 1ZA1A 5EN4A 4GDFA 2GR9A 4QUKA 2JIZD 3N05A 3NEJA 3PWSA 1C1HA 4EI8A 3G0HA 4JZKA 3E9YA 4YEDA 3ZU6A 2EQ5A 5IP5A 1Y5MA 4QPNA 3RRZA 4CFZA 5FWYA 3IHTA 3KFXA 1MEEA 1D2AA 3M89A 1AM4D 1MIOA 2GLEA 5TQJA 2CE7A 1TYBE 3TQHA 3H4BA 2CLKB 1URPA 2IXAA 1G63A 4I55B 1VMEA 3NIGB 1XTUA 5IAEA 2I4MA 5CFZA 3SFTA 1U8UA 4N8DA 1IY2A 2LPMA 2PUAA 2BEUA 4ITUA 4UNRA 2R4UA 1MC4A 2Q5JA 3CO5A 2EBHX 4PC7A 3ZH2A 2ZBGA 2YFKA 4LWQA 2M9NA 5BN5A 2ZETA 3TNJA 5DHSA 4ISBA 3RJGA 1F2TB 4DR3B 4V0KA 4IS2A 5P21A 5I8WA 1JX4A 3ZH9B 3QV2A 1WUJS 3H0LB 5BOSA 2QLBA 3R9XA 1AKTA 3ICEA 5H8WA 1FSZA 2BFCA 3KM0A 1LPBB 1NATA 5T8KC 3FDSA 2AC4A 2JJ1D 3GUYA 2QL6A 4UM9B 2WF6A 2B25A 3KRTA 4MCHA 3BRQA 4OOEA 2A3RA 3MFQA 1PV2A 1A72A 4QDUA 1DTEA 5FQOA 2W2TA 2WTBA 3BGOS 1B74A 1QHIA 2LBPA 4OB6A 3BSSA 4GPZA 9ICVA 2C7OA 1YL6A 2ZRQA 2P2SA 1Z26A 2LNDA 1BOFA 1UL1X 4R2IA 2EHDA 4E46A 4MROA 1QKIA 1NQXA 1ZMRA 2FEPA 2H59A 3LP6A 3I30X 3LDFA 3DQQA 3F97A 4NPCA 2QZ9A 3I73A 3KXKA 3OHPA 3CLTD 3KSAC 4K4GA 2H2IA 3SEIA 4V0NA 4F93B 1Z7BA 1DJLA 3AEVA 1Z0DA 2WIKA 4AZ3B 3S6JA 2R8XA 4Y0VA 4B9NA 4F8RA 1L5SA 1Z29A 5CM2Z 1F2VA 2EKDA 4S1TA 1IXRC 5IM5A 5LDDC 4HH1A 1XRNA 3DHYA 4Z7JA 5T6MA 1Y4AE 2BBSA 4W8GA 3TLYA 2NN3C 5AYVA 2EGGA 3DPUA 1QU3A 4V1CI 3Q6NA 4LIPD 3DE0X 4ZT2A 3CUTA 1I33A 3E18A 3CSDA 3JYHA 4LE1A 3FYCA 5GZ6A 5FNVF 4FGUA 3EZGA 1QSLA 3TD9A 4Z7OB 3NM5A 1ZCFA 4BWFB 2G9QA 4URYR 3U9LA 2P68A 2NTEA 3BJYA 2RJNA 4Y0NA 5AR1A 1F8XA 3PPIA 1O3YA 4MITA 1V97A 3NNNA 3CXUA 3VR4D 3MSCA 3QSYA 4I66A 2EZXA 5EJIA 5JPDA 3M1YA 1SXJA 2ZM5A 3WGOA 3UK0A 1CUGA 4RZQA 4RKRA 4QAJA 5KS2A 1U0FA 3UWKA 1K6JA 4DA7A 1QIKA 4OAQA 5AI8A 5IBQA 4ND2A 2BGUA 1EHIA 5B37A 1NNEA 1FNDA 4I8XA 4H7PA 2BH9A 4ZU3A 3IBYA 2J59A 1GKKA 1E8NA 1Z35A 3UTDA 5CB1A 5L1JA 4O3RA 1VKOA 2FFJA 4FD2A 3GOHA 5CT9A 3T4PA 2M9MA 1OREA 4FNOA 1TU0A 2XDAA 3A9WA 1I4DD 3WNZA 1DARA 4D4LA 5CA1F 3BXFA 2DBRA 3BREA 4RK1A 5KNBD 1UM9B 5BMVA 2JJ1A 4GR5A 1ZIPA 5TZVA 1L4LA 3URKA 5K03A 2EJVA 1S9HA 3FCSB 1M2HA 1XRMA 3EC2A 4OBWA 1SXHA 4K8OA 3BXGA 4CN9A 5K6TA 4X44A 5ICFA 3GQCA 3FYUB 4YECA 1OLXB 4HVTA 4N40A 4ZV9A 2B36A 1U6IA 1U9YA 2W2VA 3KAQA 4RX1A 1P5ZB 2ETVA 1R50A 2CYAA 2XX3A 1W4CA 5EE3A 4QD3A 2A1JA 2NRXA 3M6ZA 2R8GA 4L4UA 3NDBB 3LVQE 3RVBA 3GEIA 4CF5A 4YAKA 5TNXA 1J0XO 1S0NA 4DRYA 3Q3HA 4FYVA 1XN4A 3WA6A 3PNYA 5FBWB 1EX7A 5JH7A 3Q8RB 5ANRB 1T2UA 4EYEA 5FBRB 5JWOA 1MG5A 1IM8A 5FLKA 2HSEA 3IIJA 4QUDA 1YCGA 1V9LA 1J8FA 2DSTA 3RANA 1XMPA 4K86A 1E9DA 1OF1A 3FR7A 1RHMA 4O5AA 4XW2A 3W2EA 4KXXA 4TZ6A 2OHVA 3BWYA 2VP0A 2QS9A 3EVDA 2XVAA 3MILA 2HPAA 3MGGA 3IE0A 2PDAA 5ERXA 4QIWF 4N7BA 5LC1A 3IELA 2XMDA 4NFHA 2G5TA 3P0HA 3PLAE 1GGKA 5H3LA 4E2YA 4X5OA 4ZVVA 3AU8A 1EVJA 4D82A 2GYVA 1HFKA 2DQKA 1LTKA 3MGKA 4B71A 2YFQA 3WICA 3KKAA 3O6VA 1TTHA 4R51A 3USZA 5FPQA 3KETA 5E3HA 5CWRA 3IPYA 1VKZA 1BPYA 4HNRA 4W1PA 3RB8A 4JROA 2FQQA 1UKYA 4BMDA 2PAFA 3HKBA 3VR4A 4P38A 2VZ9A 3IHWA 4DCMA 3NEAA 5FWYB 1FZQA 1QHNA 3OIYA 5E2AA 1C7QA 3AHCA 2G07A 5FAXA 4G8CA 2Q1XA 4PVCA 4RM3A 5L3VA 3OEED 2OQIA 4M4SA 1N78A 4EO9A 3CCFA 3K92A 2BEUB 2XEXA 1M5TA 1O97C 1USGA 4WH0A 2FRDA 2QN9A 2ORWA 1V95A 4CF3A 5H81A 5BN5B 1QORA 1VG1A 1YNOA 4GWLA 4R0NA 2E4WA 5CFNA 4WBNF 4BDPA 4Y6RA 1N5IA 5CRIA 3A14A 3B89A 3FF1A 4J9LA 5BOSB 3R9XB 3L6EA 2QAJA 1NK0A 1U7PA 1ZQFA 3G6VA 1BROA 3KDPA 2FJUA 5HEKA 2BFCB 2WK1A 2YYZA 1G8KA 4FZRA 2R8OA 3Q6IA 2Q0HA 2J6CA 3JPPA 2OCIA 3A28A 2UVVA 3M1AA 4AS2A 2FZ5A 4ZO8A 4RD1A 4Y9SA 1FMTA 1JDJA 3VR2A 3F9RA 1YQWA 3JWJA 2PSEA 1OUQA 1GCOA 1YKSA 2FPOA 3A36A 2PZ8A 5SZJA 3DB2A 2OXRA 3RIYA 5LA6A 5JS7A 4NEHB 3O9ZA 1Q22A 2HSGA 3SXJA 4Q39A 3A9TA 1ETUA 1YCDA 4KIJA 4F5WA 4I55F 5ICSA 3H99A 3GHYA 3EGDA 3G6XA 3VYSB 1KYIA 5ALFA 1CY6A 3D6HA 3BGDA 221PA 4HG2A 4A82A 3N8HA 5A05A 1JR3D 4NXZA 4HX5A 3HRHA 4F85A 1JFFB 2JCVA 2GLUA 1AB6A 2GX6A 3DL0A 4OQMA 2WOOA 2I7CA 2R8RA 4F3CA 4DJDC 4MVXA 3PDHA 1MRSA 2XDWA 1OB2A 2Q2NA 3T5HA 1RYBA 5JMTA 1DX4A 4ECXA 3H87A 1X1CA 3QFTA 3RAQA 4FFSA 2ECQA 2VP6A 5DIFA 1ZQNA 1USWA 2XCQA 2PU5A 3M7DA 2FWIA 3Q7SA 1E5XA 5EMNA 2I55A 3DFUA 1NV9A 4ZZ1A 3HXKA 2OTCA 5CB4A 4MPPA 1UCVA 1E1MA 3NHKA 3SX2A 1HDCA 1TYDE 3NHLA 1OGJA 1V9PA 4X95A 1X9HA 1VKRA 1A5TA 3LVVA 4G0XA 3JASA 1WCV1 4O1MA 4B75A 5HS4A 2NO5A 5C35A 2Z8ZA 1TVKA 1AO0A 4JFAA 5EMMA 1NI5A 1SXJB 3OEEA 5K2OA 1N4AA 2YQEA 2FDRA 5EHNA 2VF5X 1YKFA 4EGCB 5LBTA 3H5OA 1MTOA 3LMKA 3UHJA 1QTMA 3FPCA 4C0ZA 2YX1A 4LF9B 4YCCA 1X7YA 1FFHA 1T36A 2PZAA 4W5JA 3OLZA 2C7BA 1G9SA 2CNKA 1PT6A 3Q9LA 2DQZA 2J9XB 3MPUA 2F00A 3LPNA 2AEEA 4MCJA 3P9YA 4L5YA 1CUCA 3UXYA 3BE8A 1SIOA 1H2ZA 4WCVA 4PYJA 3DR3A 3AOGA 4GS5A 1JHMA 4HDMA 2BDEA 3RT9A 3CLTC 3PC2A 4O4JA 2XLCA 2PVCA 1C7RA 1YWGO 1E2DA 2W2PA 1URJA 4HDQB 1FDIA 3LLMA 1UCFA 3COWA 1L7PA 5BPFA 2HBQA 2CV0A 4DPMA 2R8PA 3ZQKA 1CHDA 3DDNA 4GKAA 3FBGA 1NULA 2BVNA 2O8DA 4AX4A 3EDCA 2BCRA 2GSDA 1DI0A 3OPNA 3IOYA 2ZRFA 4XUEA 4MHSA 3SENA 1TZBA 4HB0A 5JSFA 5JH7B 3GYBA 4B9SA 4MTCA 2Q9BA 3PVCA 4XSGA 2DWOA 4YTEA 4Z54A 4IO0A 4D56A 4M0UA 3OQBA 3IDOA 5DNEA 3OIUA 3AF4A 2VZEA 4EIWA 4FT2A 2W83A 4YP0A 1KO7A 5ALEA 3TIVA 1XQXA 1IJEA 3Q85A 1IY0A 1F38A 2VN8A 1AA6A 3OSUA 4B2YA 4GM1A 3R3YA 1XTKA 3DNFA 5I51A 4Z3DA 5T14A 2GXUA 3LQ4A 2AX4A 1DX9A 2W7PA 1OUMA 2CFCA 3A0BU 2J4DA 4LDJA 2GZAA 4NE9A 3W6NA 5TIIA 3BXEA 4AO7A 5I5EA 2WIFA 721PA 1U3DA 2QSZA 4K9PA 2NSDA 3NVYA 1SOUA 1D7AA 1RC1A 3BAZA 2DPGA 3L8ZA 3ESZA 5I45A 3IEMA 4G1BA 4OHUA 3NTUA 5CYPA 1Z83A 5C53B 4UNSA 5DV9A 3VR4H 3PT5A 1EE9A 1T25A 3Q8XB 3UGKA 3N76A 1WMEA 1S2IA 1NN5A 3MLAA 4W1SA 3LXRA 9LDBA 3HKBB 1FNMA 3M4ZA 5DGDA 1DGSA 4D2IA 1Q1AA 2ENWA 4WI1A 4NMXB 3GVHA 4MOWA 4ZEVA 4D6XA 5ALXA 3ZW9A 4M9SA 5EGSA 3OX4A 4CEJA 3FNBA 4M1ZA 1KAQA 2KJQA 1KZHA 3OZWA 4CV3A 2KIVA 4Y2RA 2W3RA 2FW7A 3C48A 4KRYA 3JQAA 4UOZA 1Q0ZA 1M33A 4MWTA 3SD7A 3UA4A 5KG0A 3KKEA 1R0RE 5TGDA 2Y68A 4OU5A 1GPYA 3ZDEA 5JZMA 4F5YA 1LLCA 2PKWA 1D8BA 4S0XA 4EJSC 4F6RA 1S2OA 3LD9A 2EP8A 3GJ6A 1CUUA 3EXHA 1HG1A 5AUOB 2O0LA 3TZBA 1IONA 4W9MC 2XMRA 5ARCA 3EPGA 5CAEA 1XXHE 2XIQA 1BKYA 4DMRA 3NV9A 1HQYE 4RGQA 4C0WA 4KDFA 1JIXA 5TISU 2H6EA 4HBGA 4OI4A 4CEHA 3AR9A 4UBMA 2MSKA 5J4YA 4D9FA 4DSOA 1X7XA 4HPWA 4EGSA 3Q5GA 2C7PA 1GDDA 3A3YA 1TRHA 1Y6QA 3O2JA 1CR1A 4Q15A 5JVDA 3WRYA 1Z00B 5KCMA 5HX7A 1I2AA 4GKJB 5TGZA 1AY0A 3Q7QA 2GEDA 4KXUA 2OPHA 1FNCA 4FB5A 2I1QA 3EGDB 4DSZA 4KQ2A 1TGYA 2DUJA 2ZTVA 3H2BA 1C0EA 1NK6A 4C7ZA 5ILQA 3SQXA 1GFSA 2GAAA 2HA2A 1JA9A 1GCAA 3PUVA 1K89A 4YRKA 1YZNA 3GUCA 2MYTA 3IV7A 2PL3A 4CMHA 5J63A 3AM3A 3LQRA 3RFXA 2HYDA 5LZ9A 4OHXA 3MPOA 4PIPA 4GSLA 4CRWB 4YK7A 4DSUA 1BS1A 2ECFA 4ACBA 3MK31 4PGYA 4L0CA 2JRCA 1PT7A 4JCOA 4Y67A 2Y77A 1R00A 3ZR4B 4MEYA 5CB4B 1HH4A 4TMZA 5I7OA 2GWSA 2RKWA 3G0DA 1CBUA 3FKQA 5FKJA 2E8PA 4DG5A 1RXUA 2LYAA 1I3MA 1COZA 8ICUA 3JASB 2VANA 3D6JA 4IFTA 4MV5A 4Q6BA 4L76A 3M6AA 2DUUA 1PWYE 4WZAE 3E5RA 2V7EA 3JWEA 1X1DA 4DJTA 1E3DA 1GUAA 4V0LA 5I47A 1TF7A 4WSOA 1G3QA 3OE1A 1J21A 1F6BA 2JG3A 5JARA 3KJIA 1T4DA 4ETNA 1ZQWA 1ST2A 3UXMA 4G1VA 4LHSA 1QVWA 1YRYE 2DC1A 1CB7A 2QKQA 1VLZA 1T36B 3FZGA 1GRCA 1P9NA 2C4MA 5EY5B 3DBLA 4A2QA 1L5LA 1ZMXA 3WDLA 2WB1F 2HSDA 4QOFA 3NC1C 4Q3NA 5CNIA 2KMLA 1CCWA 4ZJYA 1XNGA 4O2LA 5AW2A 3PLNA 2ZUWA 3FVTA 3FSEA 3D81A 3RU9A 2IEBA 2FMFA 3W5IA 4HDMB 3BWEA 4UU7A 1XUOA 4MKGA 2RDJA 4O4JB 2XOKD 1QR6A 3L07A 1Y3AA 2DM6A 4BLOA 2YIJA 3RS3A 1UBTS 4XWYA 7ICGA 2GZ3A 2FMQA 5CT6A 2WPDA 2JHFA 2YJNA 5EIAA 2O8DB 3VTAA 1CVIA 4AMBA 2UVQA 2G9UA 4OU4A 3KD2A 2ONYA 4PR3A 2JEGA 4KGZA 4KVZA 5LUAA 4M89A 1CETA 3GDXA 2DZDA 3AI7A 3HA7A 1SVMA 2OXEA 4IVRA 4BGDA 3QWIA 3ONWA 1WDTA 4MFCA 1VP9A 2A33A 3GLVA 3HBJA 2VK2A 3ZE8A 1BGVA 3FY4A 5AVTA 4JEIA 3WTBA 4KR0A 2C2RA 4NBLA 4TYMA 1ZHOA 3PF9A 1U8YA 3VJMA 1ZWLA 4NDAA 5J1SB 3H1TA 1NONA 3KBOA 5KHAA 3DB1A 3RS4A 2P0AA 4EENA 4WLVA 2DHQA 2QN6A 1C30A 3MTQA 3QUBA 4C0JA 1V1RA 4ZJPA 4GICA 4LPSA 1YB6A 1Y1QA 3G2IA 4F38A 3HLKA 4BLPA 4WW0A 4TN1A 1K86A 5IW8A 2ON6A 1R8YA 5H16A 1UJNA 1F4PA 2ORVA 2NLOA 4PYKA 1OXSC 5JNWA 4ELTA 2HMVA 3IEVA 4LJYA 4XQ9A 3TH5A 3IT1A 3E1GA 3Q12A 1DC8A 4PNZA 3EXHC 1VFNA 4NU0A 3JX9A 1DRWA 2QI9F 3IDFA 3Q2OA 1KR2A 3WTCA 2Z09A 5BWOA 4GPAA 5JH7F 2JBAA 3AVYA 2DWPA 1W88A 4CEJB 1TECE 3PI7A 1WE2A 1JXMA 2A9RA 3JQAB 5IIIA 1D0SA 1VHJA 2JCGA 2F67A 4AMVA 3R5HA 3MGVA 1C9KA 1HYHA 4PM4A 3TQFA 1QMGA 4UU1A 1YSCA 4ZYWA 2GBCA 1N0UA 2O8CA 5MFPA 4M47A 4F6RB 4I2HA 5EZYA 2C7QA 1IUOA 3B8EA 1ABEA 2XOKA 2QMUA 1KE1A 5CAEB 5D1NA 4B3IA 4DZZA 3VZDA 3E48A 5E9QA 3C15C 5IU6A 3DKRA 2J09A 1R6VA 8ICMA 1QGDA 4CEHB 1BFDA 2WHQA 1X7XB 4UM7A 4XDZA 3VR3D 4CM9D 2HBJA 2VL7A 1LNQA 1Z1VA 3QBVA 3TPFA 3HACA 1HIWA 1GAQA 3KP1A 1KFJB 1GO2A 2WF8A 2O3TA 2PSSA 2WFLA 1Z68A 1C7JA 1D8YA 5C34B 3QXSA 1PGOA 3VR1A 1G6HA 4OQEA 3WY9A 1PAUA 5DNDA 2QN2A 2ATXA 1MHPA 2Q9AA 4LAFA 4P4OA 4Q5IA 4ZOLA 3UWOA 1GNPA 1NRJB 3H4DA 1DAKA 4CTJA 3PNPA 1G41A 2C4WA 5EUBA 1RCFA 2B2NA 4CMJA 3KQQA 5IT9A 4OBXA 3F3YA 5FR2A 1TJYA 5DBIA 4KI0A 4UAJA 2JKYA 1P39A 2WD8A 4XGKA 3G6WA 2R7NA 3SV4A 3R23A 5LOVA 3V48A 2DRIA 1WY5A 3PQ2A 3C3MA 1QHHA 5CP2A 5LZ7A 3IYLW 1A71A 4DQVA 3KWJA 1S2NA 1BU8A 1L3IA 2NXEA 1XKTA 5FBQB 1W1IA 3PX6A 1VHTA 4MAAA 2PBZA 4KL8S 3TK1A 3FPLA 2UVDA 2Z5LA 3NGMA 1RM0A 4RTOA 4WY2A 1NY6A 4WK6A 3LIIA 4OMFG 1YQ9A 1AMUA 1T0IA 4WKPA 2JCSA 1E4YA 4MCIA 3OEYA 4N39A 4IQUA 4FCCA 1X7GA 3G88A 3DXZA 4TQRA 1L3SA 4YXJA 3S8MA 1RI1A 2NNWB 4TKVA 3RW9A 3Q8KA 4RZXA 4RLFA 4B9EA 3TAPA 4M54A 3WLTA 5TR9A 4IEFB 3AKDA 4JL8A 3PE6A 1RWPA 3BKXA 4IJ5A 2ZW9A 4JWNA 1ZO8A 4LFAB 5SYMA 2AXNA 4JL6A 4K3UA 2H00A 4KQXA 2OG2A 4REQA