4CNQA

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
total genus 85
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cnqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cnqA01
3N5KA 3SLRA 3U13A 1WVIA 3WK4A 1YDFA 2ZG6A 4C4RA 3DNPA 1U02A 2HSZA 3ET4A 1KYTA 2G09A 2HOQA 3D6JA 3OCUA 5AM0A 3M9LA 2FI1A 4BKMA 1SWWA 1ZD4A 3WKCA 1ZRMA 2X4DA 5AI4A 4BEWA 1WR8A 5AM4A 2C8LA 5AVRA 2EARA 3WK8A 3ED5A 3EF0A 3ZWKA 1IWOA 1J8DA 3N1UA 5AKHA 2AH5A 2Q5EA 1XPJA 2B82A 2JAWA 4KYTA 4BEVA 2IYEA 5AW2A 2AMYA 1QQ6A 2ZXEA 4NWIA 5AICA 1RQNA 3ZI4A 1U2SA 5ALKA 5ALRA 1YV9A 4FFDA 2RBKA 4HGOA 4G63A 2C4NA 3AR5A 3ONNA 3L8FA 4J2TA 1RLMA 3N28A 2HHLA 4UMVA 4EX7A 4YCLA 4CF5A 1L6RA 2FUCA 4Y2TA 1RPZA 4DFDA 1T9ZA 3RFUA 1VJ5A 4DCCA 3AR2A 2P69A 3ZVNA 4C4TA 4HGPA 4UARA 5AK5A 4NV0A 1Z4PX 3QYPA 3P96A 4KX5A 2NO5A 2YMPA 4BYGA 2BDUA 4XQ0A 2OBBA 5AVWA 1U7OA 3U19A 4Y2JA 1S2OA 4YCMA 3W5DA 5AKXA 2MSNA 4G9BA 1TJ5A 4PNHA 3I76A 5AKIA 4UU0A 2WF7A 2HF2A 4RETA 3R9KA 2W43A 5AW0A 3BWVA 4L6AA 5AI0A 4UM5A 4F72A 3OTQA 3I28A 4DWOA 1L7OA 3WK5A 3AR3A 3AR4A 4EEKA 2B8JA 4RESA 3CNHA 4KX3A 3U7HB 2RB5A 3OCYA 2BY4A 4O8CA 4OHFA 3TLMA 3A1CA 3ZX5A 1NF2A 4B6JA 2G07A 3WKDA 3FGOA 3EPRA 1QH9A 4UATA 4YIKA 3UM9A 1RMQA 5AM3A 3ZUPA 2HCFA 1L7PA 4IG4A 3ZVLA 3U26A 5AIAA 1SU4A 2O9JA 4OFZA 1EK2A 2G06A 5IT4A 3BA6A 4UM7A 1Z5GA 1Z4QA 3A3YA 4L57A 5ALGA 2QLTA 3FM9A 5AVUA 1QYIA 5AW4A 2MU2A 2FPSA 2B0CA 3QUCA 2C88A 3QU4A 5AIBA 1RMYA 3ZW7A 2WM8A 2JAOA 3RF6A 3KC2A 5ALLA 2ZOSA 4CF3A 3SKYA 5FP0A 2B1RA 1WZCA 4KN8A 3QLEA 5AW9A 1WPGA 2FPRA 1RKVA 3QX7A 4OD0A 4J03A 1J97A 3PGVA 2I54A 3CZ4A 4UAUA 2YBDA 1CR6A 3I1YA 4F71A 2G08A 2WF9A 3SHQA 4NAVA 2YJ3A 1Z4KA 5AKYA 1CQZA 3EF1A 3HYCA 4AS3A 1YJ5A 3KDPA 3OCZA 5AW6A 2ODAA 2C9MA 5AVTA 3WK9A 2RARA 3FZQA 1RRCA 4FE3A 1N9KA 4CF4A 1L8LA 3QNMA 4GIBA 5AKEA 1Y8AA 3IJ5A 5ALIA 4YH1A 2WF8A 4E88A 4IFTA 1X42A 2JAUA 3IB6A 1Q92A 3SD7A 4Y2RA 3OCVA 4BBJA 1O08A 4UW9A 4CNQA 1YNSA 4UU1A 3KZXA 4HYTA 2AUTA 3DDHA 1RQLA 2EAUA 3L8GA 3SF0A 1RC8A 5ALXA 3B9RA 1Z4MA 2GMWA 2W11A 2WHEA 3L1VA 5ALDA 2I33A 4HGRA 3ZTYA 1QQ5A 5AKLA 3OPXA 4BX3A 1ZS9A 2YFYA 3AR6A 3MPOA 4Y2SA 2FUEA 4BX2A 2GHQA 4BNDA 5JJBA 2I55A 2HO4A 4Y2UA 4YCNA 3PCTA 4YIHA 3WK7A 1RMTA 3M1YA 3NANA 3NRJA 2I6XA 4AP9A 2OA0A 3ZTWA 5AVXA 5AW7A 4Y2PA 2WF5A 5AW5A 1T5TA 2NO4A 2AGVA 2W4MA 5ALJA 3VAYA 5ALPA 2P9JA 2CFSA 4FYPA 2PR7A 5A3QA 1TA0A 3L0BA 5AM5A 4XOUA 2P11A 2HI0A 2ZBDA 5AKGA 3QU5A 2PQ0A 3L7YA 5AVSA 3ZVMA 2JGAA 4XPZA 2HEGA 5AVVA 2YY6A 2CFRA 5ALHA 3J7TA 1ZD2P 1LVHA 4HGQA 5AVYA 5ALSA 2B8EA 3QUQA 4UASA 1T5SA 4UMEA 3S6JA 1RKQA 1U7PA 4UAVA 4MUMA 3U7FB 4KNVA 1YMQA 1Z4LA 3WGVA 3I6BA 5ALUA 3KD3A 5ALZA 2Q4TA 3QU9A 3U7GA 4QJBA 3QGMA 3L1UA 5AVZA 4MWOA 1MH9A 1L7MA 3ESQA 1PW5A 1S8OA 2MU1A 1SWVA 5ALWA 1TJ4A 3A1DA 2FDRA 1LTQA 3ZX4A 2ZBFA 3N07A 5AHXA 5A3SA 2BDEA 5AW3A 5AW8A 5AI9A 1Z5UA 5ALMA 2VKQA 4Y2VA 2YJ4A 3AR7A 3PGLA 4CE6A 2ZBGA 2YJ5A 2R8YA 3OCXA 2NYVA 2HDOA 2R8EA 3QXGA 4Y2QA 3R09A 3UMCA 4QQFA 4UMFA 2EATA 5AKKA 2YMLA 3MMZA 2G80A 1Z4OA 2JARA 5AW1A 2HX1A 3F9RA 3QUTA 4YGYA 3MN1A 3FPBA 4BX0A 4JB3A 3W5CA 5AVQA 2R8XA 3B9BA 1Z88A 5IT0A 3L8EA 2FEAA 1RLTA 1AQ6A 3AR8A 1Z4NA 4ZEXA 3E81A 5AKZA 5AI8A 4GXTA 4EELA 5IS2A 5AI6A 2D2VA 3DAOA 1N8NA 3NAMA 2OM6A 3PDWA 5ALEA 5ALFA 4EX6A 1VJRA 2I34A 3WKBA 3UMBA 1RLOA 5ALQA 1YS9A 3L8HA 1U2TA 1TJ3A 3DV9A 2YMQA 3W5AA 3L0CA 2CN1A 3E84A 5ALYA 2G1AA 3L5KA 3L0YA 1ZD3A 5ALNA 1RKUA 3WK6A 4XE5A 4ZEWA 4DW8A 1K1EA 2R8ZA 1TE2A 1F5SA 5E0OA 2RAVA 1ZD5A 2GHTA 4C4SA 2FPWA 4EENA 3ET5A 4H1WA 2IOHA 4Y2YA 1NNLA 1FEZA 4EZEA 1L8OA 1ZRNA 2GFHA 1XVIA 3ZWDA 2YN4A 5T41A 4OCZA 5AKJA 3KBBA 5ALOA 3KOOA 4ZEVA 2I7DA 2ZBEA 2FPUA 3QUBA 2YMMA 1RDFA 3R4CA 2HF7A 3WKEA 4I9FA 2WF6A 3SMVA 3WGUA 5AK3A 4I9GA 4Y3UA 2CFTA 1QQ7A 3A1EA 3N8GA 2O2XA 2FPXA 1Z4JA 2DQSA 3HLTA 4UMDA 2WFAA 4HGNA 5A3RA 5AM1A 3NUQA 3B8EA 2P27A 3QU2A 4Y2XA 3E8MA 1NRWA 4NFLA 4JDPA 3ESRA 3QU7A 5AM2A 1EK1A 5AK6A 1JUDA 1L7NA 4HAIA 3E58A 3GYGA 2IA5A 4BNDB 3NIWA 3W5BA 3K1ZA 4L6CA 2GO7A 2IOFK 3IRUA 4NABA 3FPSA 1VFPA 2B30A 5AK4A 5ALTA 1Q91A 3EWIA 3ZU6A 3MC1A 2Q4RA 3NASA 3SKXA 3OCWA 3FVVA 5ALVA 3AR9A 4AS2A 2IOFA 5AESA 1O03A 3WKAA 2QYHA 3UMGA 5AI5A 2B1QA 2C8KA 3U7EB 1ZOLA 2PKEA 2G0AA 4KNWA 1XP5A 1ZJJA 2OYCA 2YJ6A 3NALA 1Z4IA
chains in the Genus database with same CATH superfamily
3UG6A 1ZU4A 3BOSA 3GQCA 5C4GB 4I4IA 3M34A 2GRUA 3D6JA 4ARUA 4AZTA 2EZYA 1HLGA 3D0KA 2IS1A 4QUBA 3ND8A 2F3TA 2H31A 3G0DA 4F9FA 5GM1A 2I29A 3HU5A 1KK0A 3BH6A 4NOKA 3ZI4A 1HZJA 2A9RA 5LQSA 3BREA 1RVV1 2AOUB 2P4EA 2NSLA 5J3JA 1DIRA 1CUWA 4L7QA 4V3BA 5DLQC 1EK0A 2W55A 5EIFA 4L4UA 1YZ7A 3PMLA 1A4RA 4GQAA 1XROA 4P7JA 1G1MA 2JEOA 4KOAA 5BSFA 3BS7A 2P2NA 9ICFA 3E4CA 1VG0B 2VIXA 4M8SA 4DLLA 4RESA 4P34A 3UXEA 3BGOS 3BQ2A 1T1SA 4JVOA 1LS1A 3EIQA 3NTVA 4E4RA 3IDAA 4URFA 2WKWA 4O4LB 4Q3AA 4ZVUA 1UWVA 4UVGA 1UFQA 2QA5A 1NMSA 3H8WA 1F2UA 3TPCA 2KIVA 1TMGE 2E4WA 4F2SA 1XLTC 2WUEA 4KQMA 1MFPA 5GP1A 3DMTA 2PS1A 4UB8U 4IIFA 2VG8A 1A4XA 3N05A 3GFFA 3C5FA 1XT6A 4LRWA 3CPSA 4ZJUA 2WM8A 2V6GA 1N0HA 4KN8A 3ZJ5A 1SHUX 4XARA 1Y8QB 2IYXA 4UUQA 3H1GA 3AKYA 4ZV7A 1G1AA 2BFBA 4L4YA 2ODPA 4BO1A 5JDCA 2FLNA 4Y1EA 4E5DA 3C0KA 3DZBA 1TUBA 3ZWXA 3GPBA 4H77A 4RWZA 1UKCA 1N48A 2ZJFA 4KO8A 3STXA 4BNLA 3LVWA 4Q1FA 4RZXA 3V8BA 4O4JA 4UHKA 1W5BA 3UWSA 4QAJA 2FWBA 1E9FA 3WWCA 1YDMA 3BZWA 4Y6OA 5BW5A 1X3LA 5KYWB 1OASA 2VP2A 4D0LB 1FMFA 5E8JA 1QZTA 3IKVA 4G1EB 1G3QA 3ZVMA 1X7XA 1VKHA 3KOZA 3GZJA 1OKKD 3RC9A 2P7HA 4CMBA 4EYSA 2OL4A 1GL3A 2F1IA 2AN5A 3I6BA 3GUVA 4QUHA 4RNMA 1UOEA 2BQUA 4IV0A 4KQIA 5KQPA 1J25A 3DDCA 3W3AD 5TS2A 4A6DA 4QEDA 3O21A 2YWEA 1QU2A 1NURA 3PE6A 1B41A 1HYHA 1EG2A 2MTBA 3O7MA 2WNSA 1IY9A 3KXIA 3AIIA 1M2WA 3DWEX 4QQFA 3ZDYB 3D3EA 5IUNC 5J9FA 4NAHA 3L84A 1DRUA 4CLOB 5BVHB 4JB3A 4UB1A 4ZQBA 4YROA 5DJ5A 3NP7A 4QZ8A 4E3WA 4XGQA 1EVEA 4DFKA 3VVCA 3MCAA 3DDSA 5ALYA 5JDIC 4EI2A 3ETRA 4ZH4A 4E07A 3FY4A 3SHFA 3TMYA 1BS9A 2Y05A 2BR4A 4G81A 3WY9A 1HTBA 3P26A 2HBRA 4X7MA 2HOIA 5I47A 3W6UA 3CBGA 2DR3A 3IR6A 1S10A 3M33A 4TUSA 3S70A 1NRIA 4B9TA 5KYYA 1JAIA 3TQOA 3HU3A 3CRRA 2Z5LA 2H2WA 1YB5A 4CODB 1DX6A 2IU4A 4L5YA 2JI6A 1E9EA 1P2SA 1EWVA 1VFPA 1ODCA 4FYIA 2KLBA 4PG5A 4JEIA 2O8NA 4KQKA 3QPAA 4JR0A 1SCJA 1QWOA 5ENDA 2IE8A 1GKLA 3UXOA 3I30X 4QU5A 5KNCA 3DC2A 1H3FA 5E79U 1E5QA 2MR6A 1G20B 2WQ7A 3O2QB 3A7EA 2HF9A 4XD7D 4MV9A 1UZNA 3B3JA 4RXUA 2E4ZA 3HYTA 1C7QA 3CCFA 4FHZA 2PUCA 1TK0A 1KYTA 4MF8A 4RT2A 2CNWA 4M0CA 2HBQA 4BLPA 2VC2B 3GLIE 1CIPA 2O5RA 4FGJA 1GT91 4UZSA 3GV0A 2QX4A 3EF0A 5HQ3A 1ZQBA 3QLVC 2FZWA 2UZ0A 3DJYA 4CQLA 2AG1A 2YIMA 1ZM9A 2NOAA 1AMOA 2BEKA 4K9DA 4R0VA 4BU0A 4PQYA 5KFLA 2LZ0A 1KAOA 3EAFA 5J2EA 4C0QC 5JUWA 3RRNA 4JUCA 3JPPA 1T9ZA 3RKRA 4LJSA 2PKWA 2I4RA 3PTLA 3B0YA 2PL1A 5FOUA 2BCQA 2OQIA 2HK7A 5GJWC 3DTVB 1MB3A 2ZSJA 4QPJC 3PXDA 4U7JA 5DULA 1S1MA 4NATA 1CC1S 1UA0A 1H6BA 1IJKA 4MUIA 5THQA 5DB9A 2RHMA 2RKBA 3H8MA 5J58A 3PPIA 3AFMA 4V2UA 4RD1A 2NZWA 4UKDA 2J1LA 1OB5A 2AX4A 1L5NA 2NVBA 3BCHA 5K8JB 5CNJA 5A7GA 3MJFA 3VRHA 3WRWA 1KVUA 3DG9A 3QYFA 3CISA 3HRHA 3GLGB 2CUTA 1SIOA 2GHIA 3H2ZA 1KR5A 2OYYA 4Q9NA 3PXXA 3E22A 2CJFA 1E62A 4TKZA 2FP4B 3U2QA 2AR7A 1RCFA 3FMFA 4PTYA 4E21A 1DU4A 2EW8A 4X3OA 1JHOA 4N48A 2VDWA 4BCCA 4AECA 5EJMA 2Y1GA 2HO5A 3AP2A 3AEZA 3DEAA 2JHFA 1MHTA 2CKMA 4YT2A 4UREA 3PC6A 1Z5NA 3QNMA 4FDVA 4F5OA 5ALIA 5JYDA 3BQ1A 2DECA 2W2TA 1JFVA 3JQAA 3VPAA 3OX3A 3ED1A 3R0ZA 1DEHA 4IQVA 1O89A 4IJVA 4QRDA 3AOEA 1FYEA 2P5YA 1ULSA 3MQ2A 3P94A 1A6SA 3BIWA 2F6RA 1BQ3A 1MJNA 3G79A 1ORDA 2VDKB 3A31A 4RPKA 4J94A 5J4KA 4LIPD 3ZTWA 1CB0A 5BWOA 5TX7A 1Q57A 1UDAA 1WWVA 3K9LA 2YN2A 4ROTA 1G17A 1PFKA 3KEFA 4CM8A 4MQMA 3MOIA 3E18A 1XBTA 4DOAA 3RBZA 1YZ3A 4PLWA 4IIEA 1E3DA 4DXHA 1TKCA 4WNIA 5GIOE 3WR5A 3PU6A 5ALZA 3AHJA 8ICMA 2P67A 3AM3A 5E0KB 2NP7A 5CHGA 3C28A 4C2AA 3THXA 1DGQA 3E4DA 1T35A 3PQ3A 4AD8A 3PKJA 4AY4A 3KHRA 3EEQA 4WCFA 4F45A 4P7GA 4HDSA 3USES 3NDIA 3DXFA 3T4XA 2V6BA 3CS3A 2UDPA 4XAQA 3WIVA 2Q21A 3KKZA 8ICCA 1ISMA 3UOAB 1WMSA 1ST2A 2LGJA 3ALRA 4TN1A 4S1WA 1JHZA 2AR9A 3GLIA 1K08A 1GY8A 1AIPA 3DE4X 4IRXA 2LTAA 4U5XA 1GGVA 4ESHA 1X2IA 4DLTA 2W58A 3QWIA 4NDZA 4HUJA 3GAMA 3B20A 2KVCA 1MNAA 5KSWB 2Z6QA 3KR0A 4K9RA 4C7YA 5HHHA 1M73E 1F7UA 1IM2A 4IRCA 5KSYA 5CT4A 1SNYA 1A9RA 1Z2NX 1JILA 1MUUA 3RYTC 1SH7A 4JDPA 1N5XA 4JP3A 4LF8B 2V7PA 2QTFA 4ESVA 1VFNA 5CPBA 2CHVA 3N76A 3UWKA 5ALVA 2K8BB 5LQUA 1SOAA 4UM9B 5F4BA 5F12A 4TWIA 5DDMA 1EE1A 1GDTA 3S68A 2B25A 2Y1EA 3OIDA 5FWXA 2JJ1D 4BP8A 2QAGC 3T5AA 3JPQA 4LXYA 4O33A 2ZG6A 1VP3A 5DCLA 1ILWA 4MLZA 3ZEAA 3ND9A 2QXYA 2CCKA 1UJ2A 4ETIA 4CMJA 3PSFA 3EMBA 4PR0A 3L6OO 5E7IA 1T3HA 4KHPB 3SAHA 5FYDA 5AKHA 2Q5EA 1UJCA 2ONCA 1YJ8A 1ZM4A 5LB4A 1SVUA 4YUYA 4OK3A 1U48A 4H7IA 4UB5A 4DFMA 2PQ6A 1BGVA 3QWFA 4EX7A 1GAQA 2C5LA 1BNCA 1UKEA 2AWOA 1W1UA 2VTBA 1V9CA 4ZODA 2GGSA 1Y3BE 4RXMA 3T06B 3WLPA 3WSVA 2ZWAA 4KYIB 2WF7A 2XCAA 2Y4NA 4Q4HB 4POAA 4JJFA 2JEZA 4OKIA 4NCIA 3W9YA 1RXIA 2EAOA 4JBNA 4I0WB 5K5EA 5CLJA 1ONBA 4ENTA 4BIMA 2CT8A 2J6HA 5DBEX 3V46A 3IALA 1J5XA 2QI9C 1ZHFA 4AZWA 1PJZA 2HBKA 2IYWA 1U0LA 1B76A 3IAM6 3KS9A 1UBMS 3K6RA 4UHBA 3EMKA 1HTWA 3H6GA 2C83A 4H35A 1XO0A 3ZY3A 2PANA 4RQ5A 2VAPA 2I5HA 1G98A 5DBBA 1NK8A 3I1YA 3B48A 4M21A 4J3JA 1SCNE 4OI1A 4COOA 3SEAA 1KK3A 3OCZA 3K8YA 2SCUA 4CGYA 1SKAA 4G0MA 3FDSA 1Y8AA 3A3NA 2ZTEA 1POXA 2ACVA 3BZBA 3MRXA 3BIXA 2XAAA 3EDRA 4OP2A 3OIGA 4PC6A 1RC8A 1Z08A 2AFIE 4HEJA 3RSHA 1JG4A 2QRGA 3O8QA 5NLLA 1TVAA 1PQUA 2F77X 3FLMA 3HJRA 5T8KC 4ZHSA 1GUYA 5B2FA 1NLYA 1R0YA 1IK4A 4Y0VA 1E0DA 3V7YA 2B8NA 4XQ9A 4MI3A 5KINB 3OMLA 5I9MA 3RUHA 3VNVA 2W7TA 5CDHA 4BJ3A 4ZQGA 2ZSBA 4QZFA 3OIUA 4WE3A 3L1IA 2XYGA 2F76X 1KDYA 3TW8B 4G8DA 2PKCA 3Q7EA 2PQMA 2XRZA 4EITA 5HJ5A 2IEAA 3UW3A 4M8KA 2A88A 1DWOA 1O8BA 1IG6A 5A4JA 4A73A 3VUEA 1E61A 1QRSA 1T0BA 2ATIA 4N5MA 1K3UB 5FD8A 3EXG2 4IQ0A 3U3RA 3PNQA 3C15C 1LPPA 2P4HX 2V3VA 2P3OA 2P90A 4C9BA 4TKUA 1Z4NA 2R44A 8ICOA 4YP7A 4CT5A 3DAYA 3N74A 2OCLA 3V42A 1ADYA 5KG1A 2D06A 3UOGA 1OU0A 1XRLA 2GJ9A 3TOSA 1RHQA 1SKQA 4C0ZA 5LYJF 4MVJD 4JLAA 1AS2A 2O48X 2AZXA 1R0KA 2YVLA 3IC5A 3LUCA 5I5GA 3UA4A 2DRIA 2X2FA 2O7VA 1PK7A 3D8SA 1KK1A 3H2KA 3AOGA 4CEHA 3EMVA 3K53A 2XQVA 1EDBA 3ZV7A 4ES6A 3VGJA 1P5FA 3WRYC 1HY3A 4Z9XA 3LDUA 1K3FA 3F67A 1Y1QA 2JFPA 2FSUA 3T95A 5L4SA 3SVLA 2O6LA 2FXIA 2P27A 5HYVA 4KXNA 4C89A 2Z0MA 3KOWA 4RO0A 3ISBA 2LE0A 4H31A 5FLYA 1E58A 3TZKA 5D4BA 4DNFA 4KR6A 1JSZA 5JFOA 4ENWA 2R47A 5DGCA 4L73A 3ORQA 1OH6A 1DJQA 2B4TO 4XM0A 1G3MA 2V9CA 2HVIA 1E3TA 4GZMA 4YJFA 1R00A 3RRGA 3STVA 4K9PA 4K9QA 3IO5A 2PEZA 3GAFA 4FGZA 4TTQA 2WC1A 1HTTA 4C0XA 3WG9A 2C0PA 4LHYA 1ZUNB 1S2MA 5BSUA 4V0LA 2EZZA 2OCAA 1EWKA 4MV0A 3EEIA 1DKUA 3ZWMA 4KMUA 1EFHA 3HBMA 5K8IA 1G19A 4IUDS 1RYRA 3I39X 4PLHA 3COZA 2CF6A 4YCLA 3VDQA 2CZCA 1R2QA 4H16A 3OZUA 2C61A 2AFIA 4NBNA 4HLUA 4B32A 4HDMA 1ICEA 4MEAA 1XNSA 5J2HA 4NYJR 1XRPA 1ZG3A 2YBEA 1JDPA 1HURA 1NBIA 3ZBQA 1ZNYA 4OLHA 2IELA 3WLNA 8ATCA 5FL7D 3AR4A 2A5DA 2OZLB 2I9PA 1DO8A 2FE1A 1Z36A 3JQ7A 3KVRA 3B6MA 1SQSA 1N3BA 2KNJA 2HLNA 4TLEA 1LLCA 1E2BA 3TK1A 3G9QA 2H1LA 3MIIA 2L0XA 4D3DA 1PNQA 5IAOA 1P2GA 4Z6CA 3EDYA 2FLPA 4IIUA 4QDOA 4HQKA 4E5NA 5H3LA 3W78A 3A1UA 3OJEA 2AYYA 5IVDA 5KNIA 3JPOA 5DT2A 3DE5X 4QGBA 1QK4A 2VN8A 3H0CA 4PPNA 1T4CB 4R1SA 4YX9A 3IPYA 1Q0QA 3O3NB 2BTQB 2P30A 3UGJA 3F78A 1ZH2A 1GHTA 1CYDA 1JYFA 1XEXA 2IS6A 3ZD8A 1IOZA 2MT9A 3L7MA 1QIHA 2P6PA 3AVYA 1WNTA 3G89A 3HYRA 7MDHA 1E1RA 1B23P 2SECE 3DKPA 1K68A 5JCJD 4LHXA 1ZOPA 3AL0C 3UFBA 5A5FA 3AR6A 3SIWA 5JAQA 2I3AA 1ZAKA 4U1RA 1R4MB 4EHBA 1CE8B 2EDAA 4QT0A 4C4ZA 4MP3A 2PMZF 1VECA 4ZYLA 3VAYA 1BS1A 1T15A 3P52A 3LA8A 3SPXA 4B44A 2ZPAA 2PMFA 3CW8X 4OV6B 4Q4JB 4ZTUB 4I81A 1OXSC 4JLPA 1UT5A 1L7RA 4LY9A 3RRZA 2VZEA 3B82A 3RC8A 4LNHA 3WGVA 3L77A 1JL3A 3ZCSA 3A6LA 1NI4A 1LBQA 3G68A 3TI9A 4HAYA 3SCZA 4UPEA 4ZC1A 4E1AA 5KTOA 2JLQA 4TRRA 1KPGA 1NVXQ 2GXQA 3PT5A 2QP3A 6ABPA 4OHPA 1P74A 3AK4A 4TTAA 4GWLA 2O8DA 2WUVA 1N2CB 4ZRDA 3F7TA 1K7CA 2JRZA 4J1TC 3QM1A 4LJRA 1E8DA 1OVGA 2WM9B 1BPYA 3RVLA 1ZONA 2HSDA 1WB6A 5IS2A 1HE4A 3BRCA 4XWWA 2WT8A 3A4YA 2DY0A 5JANA 2H0RA 2FUG6 1N9ZA 3VOSA 3GMDA 1YIAA 4G9GA 3WGZA 3FPAA 2DUYA 4GQBA 2PQ2A 3L8DA 2R8GA 3Q8KA 1IIRA 2VHZA 2XY4A 1SVSA 3U6BA 2G6BA 4E33A 5IT5A 4RNDB 2HLDA 3DAFA 4F5NA 5CNMA 1XJQA 2QV7A 2CV0A 1Y8RB 1ZM3A 2ZR7A 4BTVA 4KAJA 5BV1A 2DTXA 2E0IA 1EX9A 2Z1NA 1F6DA 4WFQA 2IZ6A 2YYZA 4RZUA 3SXUA 1FVOA 9ICPA 1MIOB 2BMVA 5JRZA 5IM4F 4LBZA 1ZIOA 3E2PA 1ZKDA 4GI5A 3FF1A 4EA8A 4YMIA 4G4IA 3ESYA 2P2CA 3ZGLA 2HGSA 1LBHA 4E1VA 3G2QA 1PR4A 2VT6A 2CDAA 3KAQA 1I4WA 2R6GA 1WVIA 1JMKC 1GUBA 4WECA 1I1OA 4EHJA 4R0MA 1YR2A 5ICSA 3P27A 1URPA 1C4OA 1V2HE 2XHZA 4IPTA 3EQ7A 1KH1A 1F1JA 4KXLA 1Z6AA 1F20A 1BPBA 5CXUA 4G26A 5JI2E 2EARA 5DI3B 3DLBA 4QBHA 1IWOA 1THGA 1EXNA 3K05A 5CRIA 1S0MA 3UT5A 1JTEA 4V1CA 4DEYA 5TLSA 3H7AA 2IDJA 1K6EA 2IXFA 2XXAB 2QQFA 4TTIA 1XXHE 3GOQA 5TXGA 3T6KA 4YAIA 1KDVA 1QSYA 4GKBA 2GPSA 3JD2A 3I05A 3I6ZA 1SOUA 2O54A 1J2UA 3O9MA 1I7PA 1GUAA 1NW3A 4HTFB 2H7CA 3AVQA 4RM2A 3HL4A 3H0LB 4MR8B 2RIRA 1XJ5A 4REQA 3AVTA 5CB4A 4OHFA 4MGEA 4AMBA 5TNXA 1O77A 2FRXA 3TEJA 4EKNB 5KFQA 4J0HA 4OAOA 2R4UA 1XPOA 3LVQE 5FUMA 2EX1A 4M8LA 2RC5A 3RAFC 2B94A 1C7YA 3O8DA 4PLZA 5FHRA 1IM8A 2YY5A 2O5CA 2IYQA 2YWHA 1RKVA 3JRWA 3C43A 1G8SA 1V8FA 1B0UA 3SHVA 4TVBA 3FDJA 4NAVA 1XSLA 5LVAA 1TKAA 3ACCA 4KNYA 4I2EA 3GB9A 4B3IA 4M1OA 2R1TB 3WXMA 3FZQA 3ELUA 4V0QA 3QMVA 1OH7A 2FPPB 4MP6A 1E2MA 3M8RA 3CHYA 3OOWA 3U7JA 2QJFA 4IXTA 5KG3A 3A4MA 4UUMA 1IRXA 3EGWA 3VGPA 4QPDA 1A4UA 3NHZA 1NJFA 3O26A 1I8TA 3HN7A 1Z1VA 4PZOA 3NATA 2N47A 1T8TA 1ND6A 4URZR 4WL0A 3T7IA 3DH0A 5HJ2A 2WINI 5A3QA 3GT7A 1XVVA 1K89A 4BBZA 3NYWA 3QWBA 4XH9B 2ZRQA 3D8NA 1UH5A 3N2ZB 4LNUB 2J5KA 3X1JA 4BQNA 4X6XA 1XCMA 3DOHA 4BNXA 2PKRA 4DIBA 2Y3IA 3PQ8A 1JTVA 1WQ1R 3Q5DA 3KSZO 3BK1A 2Y0DA 2DOKA 5JUMA 3EBOA 2H3EA 3L4PA 2G7MC 1GTG1 3C7CB 2EATA 1EWYA 1P77A 3FWPA 2P8SA 3T94A 1WUYA 2ZZMA 1C20A 4FC7A 4PGXA 2FHSA 4H7JA 3I61A 2JMGA 1J0EA 1QX3A 1QHSA 3IDFA 2O59A 3UO8B 1PD1A 2IIBA 3T7KA 2GPJA 4I3GA 2Z3ZA 3G0CA 2FQYA 1YA4A 1KK2A 1JR4A 3DFKA 2HV9A 2V4ZA 2OK7A 1KMQA 4O3MA 4EI8A 4BNGA 5BQ3A 3A1VA 2PUTA 1QF7A 3O4FA 4JQOA 4F6RA 3BILA 3V1UA 2A5GA 4JMPA 1XXHA 2NO7A 1C0IA 1SKWA 4G97A 4II7A 2H59A 3HP6A 2Z6VA 5AR1A 2O0JA 3O94A 4GG1A 4U7WA 4XQCA 2ASJA 2VKTA 1KFCB 4IVRA 5I7UA 5AM2A 4TL9A 2VDLB 2GZ3A 4D99A 4ZI7B 4XX0B 1VL2A 1PHRA 1ZK3A 2IE0A 2HBYA 1ZW6A 4TZTA 3SKXA 2GEBA 4M8NE 1U2DA 4ZZ2A 5KJFA 3F49S 3Q3JB 5FBZA 4LRQA 2VSXA 1SZHA 4ZREA 2QRJA 2H1FA 3HI4A 1XYGA 4CMGA 2P7IA 3V7FA 2HRRA 4AYBF 4KO1S 3TS1A 5CXXA 3FSJX 7ICUA 2DWCA 2DWQA 1XN1A 3T8YA 5JPDA 4BHTA 3IBGA 4HEHA 4X5VA 3FC4A 1RWWA 4NQRA 5FKJA 2V9ZA 4TZ0A 3NHAA 2V0NA 2AJTA 1BPEA 4BBAA 3AU6A 4R66A 2NU9A 4ZYZA 1ODFA 2D1YA 5E1MA 3E2IA 3WHLA 3TCKA 1KBOA 4QTXA 1K7EB 2AEMA 4K9LA 4I2IA 3S5JA 4ZCIA 1QRAA 3NHSA 3KE9A 4URUR 5BSEA 2DG2A 1EUYA 4DRXA 1D1TA 3F3KA 1IHYA 2P9GA 2SKDA 1OE0A 4BUCA 4RD0A 4GPTA 5FX2A 1UMDA 3MLAA 3DOFA 2R86A 3G8AA 3NEYA 3ZR4B 4Y30A 4EB6B 4BXOB 3O93A 4YIKA 3W8NA 4A0GA 4XM1A 4A2QA 5A06A 5AJWA 3SM9A 2BCSA 1SHTX 1GQRA 1T7PA 1JQDA 3AL0B 5TT0A 5C5EA 4KWEA 3CKMA 1RE0A 2R8JA 4KWIA 2RHOA 1MAVA 3KC2A 1T8WA 4PAGA 2QAIA 3AJDA 4M8IA 2D59A 1S3FA 3W4KA 3EFOB 3HJFA 2A14A 2UXCB 1NOMA 4X00A 3NJ4A 2EJWA 3H11A 3R0VA 3OQ1A 1HA3A 1F4PA 3K94A 5CVDA 1F0MA 3H2YA 3PPWA 2N9UA 4ZI5A 1NU6A 2NUAA 1SXIA 4WXYB 4LDNA 4MHSA 3R9XB 1W85A 4CKZA 2WBLC 5BWMA 1QLJA 3ZJYA 1JXAA 3A6HA 3DAPA 4RAQA 4B2LA 3BERA 2GHQA 3DDUA 1TEXA 4LJ8A 3W8FA 4ECQA 3NRJA 5FO1A 2I6XA 3NC0C 1EBBA 4JLVA 1ZQSA 4FNMA 4XA5A 1N3LA 1FJ2A 4N47A 3VC2A 4Z4FA 1RKBA 3U4QA 4TTVA 4U3JA 4KQHA 4JR2A 2VPTA 4C6HA 3OLWA 1XZQA 3S3TA 2VDUE 1UBKS 2HNBA 3U4GA 1ZD2P 1MIHA 2WW8A 2EQAA 3C1OA 1QTIA 4A2CA 3DZKA 4H1UA 5LLDA 2YC4C 1Z4LA 4KKVA 3ZE2B 1U3WA 1FNNA 1H6AA 5B1SA 3I34X 3HSYA 3LVBA 1KU0A 2ATCA 1GZHB 4CW7A 5JHGB 3KHGA 3JATB 1AHHA 4K9OA 1A7UA 4B3CA 3NWEA 1G5FA 3I52A 3DD1A 4XGNA 2KVSA 2WKRA 5TC4A 3LQFA 3WGOA 3CNLA 2FEAA 3NDJA 4LZZA 2XTJA 3C3KA 3D6VA 5CG1A 4RCZA 2WHXA 4GLOA 4UBOA 1MLDA 5T57A 4CR8A 2WHPB 1NKEA 2RJNA 5ITWA 3OPVA 2K4MA 5JFTA 4U2GA 3AZOA 1DLJA 5HIKA 4IOKA 5C34B 1RYNA 4PRYA 2DLNA 3MGIA 2QL7A 3HFGA 4FW9A 1VHJA 3ET5A 4FP9A 5EESA 3DEZA 3D59A 2QUKA 3IM1A 4LYDA 4KLZA 2PZBA 4WACA 1MDFA 4PFQA 4DQLA 2I4IA 4DLUA 4RS4A 1E2PA 5FWDA 2IL1A 2OORC 1AK2A 3ZCUA 3S5UA 4BMSA 3W6PA 2KM1A 3HCNA 2Y6VA 3N2KA 4NIMA 3C3JA 1G9SA 2ISQA 3VC1A 1KYWA 3FYUB 2DFNA 4LISA 3GYGA 2ETVA 3H87A 3IRUA 5LNK6 5CDSA 4R9NA 3OIFA 5BN4A 4AMZA 3F96A 2PWBA 2QWXA 2JAXA 3N2EA 1JHYA 3B6JA 3VXKA 5FEUA 4AKSA 5DGHA 2ZI4A 3I53A 3HB7A 4OQPA 3DPSA 1R6XA 3DLTA 4ZOHC 2BM0A 1E7WA 3L4KA 4QT4A 1L5KA 4Q16A 1P3Y1 1B43A 2PV0A 3EARA 5KQLA 1R88A 3QPVA 4DMCA 5KFPA 1RYUA 1JX4A 4O59O 4YQFA 1NRJB 4X66B 4GLXA 1S2NA 4DLEA 4HC4A 4JP5A 3SWWA 1MXFA 3RUPA 4BKQA 1QKIA 1CZHA 4ECXA 3ICCA 3FNBA 1UZUA 1A5AB 3Q8RB 2B36A 2BDUA 3QVUA 4LHVA 1UBSB 3UPTA 4KMOB 1HOXA 3G9TA 3LDAA 4HADA 2GN4A 1ZL0A 2QV0A 3R9KA 3RYHA 2HHTA 4DWOA 3Q9SA 3U7HB 2FG6C 2NQ8A 3MFIA 5DX0A 4DDTA 1JLKA 3M9WA 4YDQA 3CNBA 3CWCA 2YYSA 4RS3A 1B22A 4NYMQ 5J5AA 4RQBA 3W5UA 2GF0A 3WMFA 4IIDA 1RWNA 3KQOA 4DQ0A 1P9RA 3UXPA 3DMRA 3HKZF 4DDKA 3G02A 1C1YA 1JT2A 2QD5A 4KXUA 4YCJA 2FZGA 3QX7A 3SQLA 5EE3A 4LVCA 2ZJZA 2Z8YA 4K5QA 1MC5A 1M8PA 2VUUA 5L53A 3QPWA 4RORA 2Y1IA 1TFRA 3QFTA 4LVUA 3RRHA 2AXPA 1TAHA 4UEJA 3WNCA 2ZUEA 1NKTA 1O0CA 4A0SA 2VSNA 2P4UA 4DIEA 3R9IA 3IB6A 4CNQA 4HQRA 1HRKA 2B35A 4GWKA 5LZ9A 1GGHA 4YVFA 3GLFE 1YZHA 1K5HA 3K1TA 3PC8A 1TLFA 2FFAA 3O38A 2G4CA 5D87A 4LY3A 4YJ2B 3I83A 1JN3A 1P2BA 1OYOA 1RYYA 5I7AA 1JPVA 1OX6A 3AU2A 4X3CA 5CGZA 5EIOA 3PCRB 1GTJ1 2OPHA 5IAAA 4Z9AA 5KTQA 4NAUA 2CK3A 4S0ZA 3K4QA 3X1WA 4U7HA 4X71A 3QUQA 4PGQA 4WNAB 3GG2A 1MA0A 4L78A 4LDRA 3Q40A 2KMLA 5G53C 2DFLA 4GP7A 2IP1A 2VIIA 2VHWA 4E6PA 4N82A 2YQ5A 1Q15A 5KWSA 1V96A 5IM4A 5KFNA 2BCEA 2V74B 2FCRA 4R7ZA 3PX3A 1U3UA 4P3OA 3I37X 2XITA 4IIJB 4R71A 1XZEA 2HA2A 4RUCA 1P2DA 4XWOA 5GPBA 4J0EA 2GN2A 2KWIA 1FDOA 3NBYC 2I3GA 4RDHA 5AI8A 3N8DA 1KFDA 3FWYA 3WNZA 1Y6RA 4B8YA 3COYA 1F8UA 2EH9A 2ZIXA 3Q88A 5LJIA 2I7CA 1J2JA 3WK6A 2G76A 3CC8A 4KR9A 4EHNA 4D74A 5E0OA 4ALJA 2O14A 3JY6A 4KMSA 1E4VA 1KMHB 3ORFA 2GLUA 3K9QO 4KSYA 3TSZA 2P9FA 5IJWA 3RTCA 3EGDA 2FSGA 3V9AA 4YT4A 1F0YA 1XZFA 4BN5A 5LUBA 2G04A 2VP6A 3BIOA 4DZRA 4P4SB 2X2EA 5LMUB 1I2ZA 1BA2A 2D5BA 3U7QA 4PF1A 5LDGA 5CURA 2JLUA 3WGNA 1WSDA 3MTQA 2E4YA 3LUDA 2PY6A 1DQSA 3LC2O 4MICA 2I1WA 1TK9A 1KH3A 4QUAA 5JSUA 3SAGA 3GVIA 4L8FA 2CXPA 2BHRA 1L5SA 1ES9A 2NSHA 3ASZA 4OXIA 3AKEA 2CHGA 1QH8B 1U2RA 4XDGA 1JH8A 3CLSD 3U3JA 3BD6A 3MINB 5A5EA 2JIZD 2AH5A 2QN2A 2VYCA 4GZLA 4YPVA 2R7AA 1PX2A 3ZI0A 3OH8A 4FEAA 1GO3F 3WLIA 1FIQA 1KAMA 1XDWA 1ZCJA 3LUKA 1HUZA 3J80A 5EWJB 1UBUS 3JQRA 3W7AA 2XGJA 4C4TA 3OE1A 2AX3A 5TARA 2GZ2A 4NU6A 3R7DA 5B7QA 1B8PA 1ORWA 1BYIA 2FMUA 2E1FA 4WDRA 4DPKA 3D4IA 4EHIA 2YS6A 1PN3A 4F2RA 4DLYA 1V41E 5KAPA 1A72A 2FMKA 4ZU1X 2Q99A 4LMAA 3ZX5A 1KVTA 1BWQA 5I7SA 4OB6A 1SK8A 4UTNA 9ICAA 3GUZA 3KJQA 1WB9A 5KZMB 1I2CA 1YDEA 5KVAA 5COAA 2XA2A 3I2IA 5LP1A 4YTEA 3OJOA 3QUCA 1GIAA 3NV7A 3D6AA 1NL3A 1Q3HA 1RWPA 4OJOA 2VYVD 5FTWA 5KTRA 1GXSB 4IZOA 4AJJA 1CWUA 4WW0A 4ZEMA 4H27A 4UEOA 5AKYA 2MUTB 2VWPA 3WLSA 3K0CC 1PGPA 4CCSA 2HREA 5EKTA 1SBIA 3KSUA 1E1LA 3IELA 2XTNA 2L19A 3G85A 4P4GA 1UWCA 2WVHA 2GOYA 4BLSA 2DUNA 2OV1A 1F0PA 1DBIA 3EY4A 1T43A 2VBGA 1ZQXA 5C52B 1F0NA 3B9RA 4L2IB 3V8RA 3RAEC 4Y0NA 1HDRA 2PI5A 2G5HB 1J0DA 4J7CA 4D81A 9ICXA 3K9FC 5IUKC 2ZJOA 4CDNA 5JNWA 1SC1A 4JBWA 3ZC3A 1SU8A 4H0FA 3DTYA 2BZ1A 2B4YA 3PPXA 4FBGA 3AM5A 3R3YA 9ICCA 3DBOB 2MYNA 2VAXA 2HRCA 4MGIR 4CV3A 3D3KA 3FYHA 5LQMA 1U0BB 1WF3A 4C6TB 4YMWA 5CVTA 3NB0A 4TL6A 2WJJA 1Z25A 2ZBPA 1ZA1A 4Y7CA 1X86B 1H8HA 1FNCA 2I87A 4OUDB 3K2QA 1DQPA 3A1NA 1J22A 3WE7A 2YWJA 1IY1A 4CE6A 4URXR 2WD7B 2VAVA 3BWYA 4INPA 1US8A 2CC2A 5C7LO 1VL6A 4H17A 2HA3A 4RTMA 2VLBA 4BKOA 3BRWA 2R1VB 2FW9A 4QXRA 2WE8A 4B7AA 4J0QA 5AKZA 3HE3A 2GK6A 4WN9B 4BJQA 1NKBA 1XDZA 4CKCB 2F3RA 4HNQA 2FJUA 1B6GA 3UMBA 4RV4A 2BZSA 2ZYDA 2FUG1 1BE6A 1L0BA 1LBTA 3TM5A 3P71T 4GOKA 1J0CA 2GLXA 2IHYA 1U8FO 4C14A 1F9AA 3HUFA 1Q1QA 2GT1A 1ZK2A 5TF4A 3F9CA 4XX1A 4OP1A 2OFPA 2W6MA 4YMVA 3NOXA 1VI2A 1W36C 2YHIB 1JU4A 1W5EA 3V2HA 5JJKA 1DP4A 4F2DA 3H17A 4MW4A 3HDHA 2ZRMA 3RJFA 1ZQQA 4B4VA 1SUSA 2QVZX 3R74A 1E3MA 1WXXA 4DL4A 4XUGB 1P0FA 1W75A 5IBQA 1QE5A 2AU0A 2EIHA 1W88A 2VJDA 3BGDA 3MUEA 2HMXA 3GIIA 2F62A 4E46A 1E0SA 8ICPA 2Z3WA 3T5MA 4UEKA 1RM5A 3PX4A 2CDRA 1IH8A 2BSXA 2GM9A 5D6OA 3IVGA 3C4VA 4JBGA 1WXDA 1P1RA 4MEYA 3UWOA 4RX1A 4P5PA 4CVNA 3B9PA 1M10A 3FA2A 5D1NA 5FULA 2IGBA 2PRJA 5TGTA 5F64A 4TMWA 1Z1BA 3UUEA 2GLEA 5LQRA 2XJ9A 3PF8A 4RE6A 3O2JA 1Z68A 3QENA 1DAGA 1Z37A 2QN9A 5KNCD 3LF1A 1UK6A 2IYEA 3IH5A 3PO4A 2A9KA 2F1KA 4KSBA 1XCJA 3U4MA 4B5KA 2CNWD 3CKLA 2RHJA 1A9XB 2EKPA 1NNSA 1GGNA 1CU1A 4QQNA 5BW4A 1ZQNA 1CBUA 5BWNA 1YZUA 1BU8A 3DYBA 1RZ3A 2IU0A 4G5FA 1TYAE 4AVYA 3AUTA 3U9SA 4YV0A 2DKOA 1VOTA 4HGZA 1XRQA 5EYPB 2NP6A 1VPLA 3MAJA 2H3ZA 3ENVA 3OCYA 2EBFX 1CDZA 2M6SA 4NJMB 4HMQA 4QPPA 2ON6A 3ZJVA 2C1XA 4KPEC 4TTJA 1C7FA 1ZGHA 1FRNA 3F2CA 3NVKI 2INGX 4FINA 3NU1A 1JI7A 4RIGA 2XADA 4L3VA 4HH4A 2CVOA 5FAKA 4IS3A 3GVPA 2YVKA 4LJ7A 1SG9A 5T6BA 2XMBA 4FWBA 5A5GA 4HWPA 3M7IA 2JKYA 4FJ1A 4K4IA 1JSRA 3LL7A 2OD7A 4E03A 5TQ0B 3AI7A 3OTOB 2PK3A 3TAXA 2O8EA 1S97A 2Q2WA 1KAGA 1O08A 2HBZA 4LFBB 2PT5A 4MUAA 1QHHA 1ESDA 2XNKA 2WHEA 2ZAMA 4NHOA 2KI5A 4MRMA 5J43A 4XPIA 3QW4B 3PFNA 4DQQA 2QVXX 3NHBA 5EI5A 2FFBA 3EUWA 1EJ6A 4FEGA 3HFSA 1TA0A 1RQPA 3BMCB 3JQAD 3A32A 1HIWA 1PLJA 4IDFA 3B53X 3QE2A 2NO6A 5J4YA 3BMNA 3IXLA 5AVVA 2HWXA 4QJ3A 2NACA 3WLFA 1UXJA 5E6RA 4XYLA 1U9JA 1D4AA 3RG8A 4LCEA 3DMYA 4NJEA 2Q0XA 3TI7A 4N0DA 5H82A 2F43A 5FTNA 3H4TA 1FYFA 4E5YA 4D4JA 1U9YA 3GCXA 1Z6PA 2GAIA 1P44A 1RYMA 2OO7A 1J8VA 2FDRA 3EXFB 1MA7A 4F96A 3LLCA 5JCXA 4EGFA 1Q19A 4JYPA 5K8VA 2ORYA 5GTHU 1NYQA 3MELA 4DBLE 4MR7A 2JARA 5FWNA 3BKWA 1ZQTA 3HN2A 3KKQA 1KZ9A 2VL7A 3HEMA 2I4MA 4QO7A 3DZGA 3GZNB 3EPIA 4B40A 4ZOQI 3T35A 3HN6A 2Q07A 2Q6OA 2WUGA 3CG0A 1N36B 4V38A 1JSCA 2WZDA 1SKYB 3OUUA 4JI5B 3FNEA 1BXRA 4ZRMA 1ZM2A 2IPLA 4EHHA 2AG0A 3B7WA 1MSWD 4RPLA 1SQ0A 2O4CA 1TE2A 4IUCS 1UCFA 1XO1A 4IDAA 4M7PA 3HDQA 4MULA 2EWWA 3RRMA 1Y1SA 5HE8A 4LC1A 1AURA 1DTSA 2Q3EA 4Z53A 2SKEA 1D7OA 3VKHA 2DQ4A 3PHBE 2FGJA 1II8A 4R8KA 4A0RA 4K9MA 4KGDA 2YJGA 3NQ41 3WADA 1PJ2A 4UTRA 2B5WA 1ADJA 1JECA 2REOA 2VJMB 5C5DA 3GEMA 2CYAA 4P4PA 2XCIA 1WZEA 1WDTA 2K4IA 2JIQA 5EVCA 3UK2A 2PX4A 4RHCA 4URVR 1O54A 5JWOA 2YOHA 3OCWA 2FZ5A 2WIBA 4RIHA 4XJSA 3LYLA 4KPYA 1TF2A 4GC6A 4AX4A 3EXEA 5L3SA 4OK5A 4FSXA 2QTWB 3UHOA 2RRDA 2C2EA 2J48A 3DF7A 4RHUA 1G8MA 1E7SA 1NW8A 3DLPX 2J5QA 3VZBA 1N5IA 4BKMA 2FPIB 1R0ZA 3SOZA 5KKAA 1X1TA 3ABQB 3KL2A 3UK1A 1A2BA 2VT2A 2WUWE 2QP9X 1JAYA 2I4LA 2IEIA 2VZ9A 1FFAA 1HEIA 4KE8A 5J5CA 2AFHE 1J39A 5JE8A 4QHTA 2BAGA 3OIWA 2EFEB 1ISHA 3HB4X 3WOHA 1J1UA 3QYPA 2QMHA 4DSLA 2KIWA 2WK1A 3JPYA 4UM5A 3TSAA 4C0BA 5FPQA 3AHHA 3LVRE 1IC6A 2WVJA 1P7DA 3MJRA 3TZEA 3AY6A 4ZK2A 5IXJA 2W4IA 1KQOA 2HIHA 3FSGA 1AQJA 5FNVF 1GCIA 4YRMA 4CMAA 2OV4A 2D8AA 3CXRA 5EIXA 4ZO6A 5HK8A 4K6KA 1T9DA 2PTGA 1I7QB 3CUYA 3C6ZA 2OXFA 1VL0A 1TVKA 2V1UA 5AIBA 2VTKA 5FPKA 5EE0A 5CFRA 3MK31 4GLBA 1NZJA 3TBKA 1OT5A 3GLHB 4NFHA 4WN3A 3DA8A 3TOZA 3FNGA 4PYNA 3HJTA 3RJJA 4QFMA 5BN5A 3HEBA 5TV2A 3IN5A 2WTXA 4ZGWA 3SI7A 1V5FA 2PS3A 1NW7A 1ISSA 3RHZA 2WV7A 5FPPA 4YRZA 3TLGA 3Q7SA 2OK8A 3PUKA 3RTEA 4R83A 4CTJA 4PGAA 1QX4A 2HCRA 4XSGA 3H5WA 5KVVA 2OXOA 3RFAA 3KQYA 1T9KA 3ZTYA 1V43A 5C7IO 1S01A 2XOXA 4LAFA 3M6KA 5BPHA 1D1PA 4RMJA 1C8BA 2OHXA 4HWKA 4CU2A 2GYUA 3LBIA 1TQDA 5G4KB 3UAXA 2KZ3A 3RUAA 2DQZA 4TXNA 4DS3A 3R77A 2YY6A 3WNBA 3C74A 1ZMOA 2YCBA 1ONPA 1L4GA 3SF8B 4Q9HA 4FZ3A 4QC2A 3H5NA 1O95C 4TWBA 4NE9A 3AM1A 2J7KA 3D2LA 4JROA 4RA6B 2YNMA 2R751 4YACA 5SYMA 1EFKA 1N33B 5IDVA 4CLHA 4DLPA 4ECWA 1L4EA 5AW8A 1H2ZA 4YP5A 4YJ3B 5D84A 5JZMA 1W36B 4UHCA 5DOVA 1CTQA 4C0AC 2GOLA 4MCJA 4XIYA 2R00A 3EXHA 1GRNA 4ERNA 4UDOA 2XD4A 2ZI7A 1K6XA 2EEZA 2ATEA 5KFFA 4JVMA 3PNOA 2E89A 1UM8A 2BFAA 4TVOA 3O4HA 2YINC 3RFFA 1LRKA 1YJQA 3QJYA 4DWJA 1RD4A 2Y0EA 5IC6A 5CPFA 2EYQA 1KI7A 3UJ3X 3L6CA 2XUOA 4D3YA 2KN7A 6AT1A 4MS3A 2AFHA 1YOVA 2HB6A 4IOLA 2IITA 4QNLA 5DSZA 2IW3A 4I55F 4IH1A 3UGQA 2I7XA 1FNSA 2H92A 3OX1A 1YONA 2EOAA 5AOVA 1P1IA 1ZDMA 1ECGA 2X5NA 1KQPA 5DLGA 3DQZA 4IXMA 4G0ZA 4B6GA 2DKFA 1Y34E 2ECFA 1CY1A 2HN9A 1R0RE 4F50A 4OSEA 1DDGA 1DJPA 1DWUA 1NC1A 1E94E 1MJGA 5AK4A 5LNK1 3KZIU 1DT5A 4BMNA 2P62A 1EFPB 4E5MA 7ICIA 2G0NA 1SQGA 1J09A 3E9ZA 4RZSA 4TLCA 5DNCA 4KQXA 4L7VA 4NS4A 2XDQB 1PQWA 1U8TA 2QJOA 3PX2A 5J8YA 2Z83A 3E9MA 4QNMA 4N54A 1YS7A 3PR4A 2FEOA 3G0HA 1DLIA 5JS8A 5IEBA 2PFOA 3ZNQA 1E9VA 3LXUX 3TQFA 2XD9A 3I32A 1R7RA 1QKKA 4QOFA 1JHPA 1QZ3A 2XY7A 3I09A 2DAPA 1UDBA 5FFNA 1G8KA 4QVIA 3KYCB 3DNFA 4PO1A 3INYA 3PKZA 4I9NA 5DBCA 1VLZA 4L4SA 3TFOA 4MKXA 3I01M 4R8MA 1NUSA 3FGPA 4V02A 1A7KA 4BAZA 1JE1A 4G0XA 4H6PA 1IBLB 2ZEJA 3FUXA 2AOWA 1GGEA 2QYTA 3JQ8B 5K6AA 3T7TA 3SHTA 1SXDA 1YO6A 3AU8A 3CVWA 5GADl 5G1OA 4QDUA 3VR5H 4K6GA 1B6TA 2FAXA 1M2VA 3C2MA 1CVRA 4X84A 1WSWA 1LV8A 3G59A 1RSZA 1JFLA 1M2EA 3OSZA 1JIQA 5K45A 3T4UA 2JIDA 4ZDKA 1Z00A 3IIEA 1KL7A 4CQMA 4IHJF 2FWMX 3CB4A 3QKUA 4J7UA 4KQ6A 5L1JA 2J87A 2J59A 3REQB 4PIPA 1N75A 3MWGA 5K3DA 2W2OA 2CDBA 4EYKA 7AT1A 2W6CX 4ER3A 4M0DA 5J0OA 4O2BF 4OFXA 2IY9A 4GEKA 3A25A 4RQ1A 2KJQA 2X7JA 3AUJB 4IH9A 3GD5A 4ZT5A 2WFLB 2VA2A 4KHZA 4TMTA 3SZ3A 4DQRA 3PDCA 3N53A 1DC5A 5C3MA 1N6RA 3H1BA 4YMOA 2DPHA 2P68A 3GJYA 4MWEA 4ZZIA 5TY0A 2II6A 1BCRB 4DV7B 1A8IA 1TUEA 1EFUA 5HX7A 1D1SA 4YP1A 3SV3A 1KH2A 2RQ5A 3HKEB 4CLDA 1Y1RA 1N62A 4BVBA 4YA6A 5FOSA 3GDFA 1DINA 3C8HA 2FMSA 1K9VF 4A0QA 2PGDA 2VRBA 5B4UA 2CLFB 2IS4A 1R5NA 1IOWA 1Y42X 1XTQA 1HQDA 2QPOA 4R51A 4A8EA 4GMFA 4JLSA 1DZIA 1E1RD 4RK4A 3FZNA 1ZOSA 4N3CA 5ESWA 1JV2B 3LYAA 3IA7A 2D2IA 1QZZA 1XNHA 2IGTA 4Q9AA 2XYQA 5EIWA 4BFZA 1WWKA 3MDCA 5KPDA 1M33A 1PFGA 4ECVA 4UHHA 4R68A 3DB2A 1YR3A 1NJXA 1SVKA 1GPLA 5FFMA 5IC4A 1T24A 3U17A 3MHTA 3LE8A 4Z8YA 3HY6A 3WRXC 3E53A 3HP4A 1UCVA 2MYTA 1GM5A 3VPFA 4NENB 4CKBB 2FN4A 3RVJA 1OFVA 3DL4A 3MXTA 3V4ZA 2DTEA 4A4DA 5J0UA 5HF5A 9ICMA 1Z4OA 2KYRA 1OREA 5AW1A 2IVZA 4OHXA 2A1TR 5L9AA 1U4SA 4M0AA 5HIAA 3TQSA 3R6LA 1XKQA 4YRNA 3H1FA 4N03A 2A1AA 1ZETA 1L3CA 3KAPA 3FYUC 1JMVA 1UDRA 4CR7A 1X0VA 4BO8A 1Y7HA 1E3IA 2VSQA 2GTIA 2IWHA 4AMUA 1NK5A 3MWEA 3BYZA 3VVLA 1G0NA 1XWIA 4GPEA 2PI4A 4G3XA 3LL4A 4WQMA 3F8SA 1WMBA 4NE7A 3KQPA 2J33A 4ZV9A 4KSCA 2YYAA 3T15A 4EPTA 3FFAA 3FZYA 3WB1A 1P72A 1ZH4A 3P4YA 4HYQA 2HJWA 2HXSA 1RWXA 2BGWA 1RJ9A 4B75A 1BN7A 421PA 2NV3A 3MJ4A 4KIJA 1VSVA 1XZHA 2J3JA 3B8EA 1AB6A 1A5TA 1JG3A 2RLTA 3ESRA 3R0QA 1QP0A 3P4UA 3TKLA 1T9GR 5KFMA 1EQUA 4RL4A 2VJ5A 3P0EA 1LW6E 1CS0B 1Z0JA 2HLDD 2NYUA 1A69A 1NF3A 1ZRHA 1CUCA 1UKVY 2C9YA 4F4WA 2IT1A 2C57A 3TL6A 3M9OB 1Z7EA 4MFCA 7ICHA 3WK4A 2GN0A 1ULAA 4MRRA 1JVSA 3ABZA 3U3MA 4MMYB 4P33A 2ZCJA 1ZEMA 3QG5A 1L4FA 2AJDA 1Q22A 3JPRA 1CLEA 3VU3A 2PJZA 1DVRA 1N2JA 3HKCB 3L8YA 4R69A 4KE9A 3AR5A 1DBQA 4NH4A 2RG7A 1RXYA 4OOEA 4ZT4A 1BC5A 1FZTA 3GJSA 3K0AB 4JODA 2O7QA 1CY8A 2O3JA 2DKZA 4PC3A 1PS0A 4DV5B 3B12A 3JARA 5AK0A 1AZSC 1NX6A 1U2PA 4QD3A 5M04A 3M1AA 1ZGCA 3TW4A 4C1NA 4IX1A 2H9AA 3JV7A 5KFTA 2FR0A 4OMUA 2G5CA 3OP4A 2GPAA 1NVKA 2GX6A 3AGPA 3A0RB 2V4RA 2X3FA 5JZBA 3ISDA 2A3RA 3OPYA 1Z5GA 3N87A 5TQ2B 3GEDA 3WDLA 3IUMA 3LLUA 5CA0B 3HPQA 1QIGA 3ONDA 4KR7A 4JU9A 4ZZ1A 4FQ8A 4K05A 4QPCA 4AUKA 4LDZA 2GEUA 2JLCA 1WB5A 3EVGA 1M5UA 1FU7A 1N4DA 4AB1A 2YBDA 3QVGB 4FKZA 4IJKA 4RWEA 4A9AA 4E5VA 2ZJ2A 3PDIB 2BR3A 3G2NA 4KJZA 3R7WB 1RLUA 3NMUF 2Q9BA 3PZBA 4GRDA 5L7WA 1YJXA 4RV9A 1N2HA 3SDZA 4AJ9A 1LQTA 4M37A 3Q15C 3FPJA 4ZQCB 1RHRA 1SPXA 2UZ1B 4KR0A 4WIAA 2IXEA 4QTZA 1CUSA 1Q6YA 3OOJA 4KIGA 1TTPB 1ZJ6A 4OXKA 4IZHA 1XA0A 2X76A 2ATXA 4XB1A 5E7JA 5ALPA 2PUHA 3N0XA 5C8ZA 5J29A 1M34E 2X86A 3UATA 5JNUA 4J9KA 1NUPA 3M6MD 1QVAA 3QVXA 4LRUA 4DZZA 2HCTA 4FZJA 1X7HA 4EO7A 1DAOA 2K2QB 2X13A 1GQQA 2X0FA 3LQYA 2ZLBA 3TECE 3P9SA 4RTNA 3H18A 2I2FA 1PW5A 3EVDA 1JIIA 1DUIA 3P9NA 4U7PB 2VCYA 3MOGA 2HADA 2XXBA 3U62A 3JTEA 1HEKA 3JR7A 3AR7A 3OCJA 2CFCA 2NXEA 1HDIA 1NDHA 3N2IA 1NMEA 2PUEA 3U6KA 4G85A 3QKRA 2WZCA 3GWGA 3PQ5A 3PFCA 3G5UA 5ICCA 2V55B 3C5CA 3O8CA 1OXUA 1O4WA 2WTUA 4TKVA 2EZUA 2JRLA 4Z1MA 4CM1A 3CF2A 3OHMA 1VE1A 3CW2C 1LPNA 3WV5A 3OQOA 3D7LA 3QOFA 4AF7A 4F4YA 4F4UA 4FGWA 2DZDA 2LYHA 3CRXA 2KS6A 2W6QA 3PNKA 1YBAA 4BL5A 1GV1A 4S2UA 1JR3E 1NNLA 3WBBA 1IHDA 1U0OC 1E6WA 1ML3A 5HCUA 1T0PA 1MDBA 4OAQA 4QQKA 4QZHA 1A3CA 4NZOA 1IZYA 2AGQA 1S7GA 1GEGA 3A1EA 2DUWA 4AN4A 2Q46A 4JDUA 4DABA 3NM6B 3H65A 1SG0A 2EKZA 2JHGA 2OMKA 5LLTA 3RTGA 4RXTA 5JSZA 4QPNA 4QHYA 4TMFA 4LXTA 1GNVA 1M2GA 3QBEA 1ZLYA 1P81A 4WPGA 2QG9A 3PW0A 5L1MA 5FNVA 3BQNB 3E35A 4PG8A 3BZKA 2B1QA 5JMPA 4RD4A 1K8RA 3IMGA 4FFVA 5FWAA 2BUAA 2XRYA 3DEYX 5A0VA 2ESRA 5CG2A 5L95A 4BQFA 1XMPA 4QM6A 2GA9A 4DNQA 3OCUA 2GCIA 4FMBB 3GQBB 4DNOA 3C23A 4P2HA 4PIVA 4EKYA 3QNWA 4P92A 5T4HA 3H9BA 4CKYA 3K4HA 3RBVA 3ADPA 3C3CA 5KU7A 2JEIA 2EJVA 1RQNA 5J2BA 2Z57A 4A5SA 5KYXB 3GLTA 4UZFA 3T1NA 3U0BA 1CEXA 2JC3A 3RSFA 2A92A 1NP6A 2W83A 3GDXA 2QW1A 2POCA 4BE4A 1L3TA 1I3KA 5LYJA 2NU8B 3CH6A 1Q0TA 2ZJ3A 3IEIA 3FTCA 1XX6A 3HXKA 3BWVA 2R3SA 4K6OA 5HS6A 2VEOA 1TKRA 1D4OA 1YB7A 2PGIA 4EEKA 5IX8A 4Z3DA 1TTQB 1C14A 2VHXA 4XYEA 5JG7A 4W9NC 3TLAA 4DE5A 2QAJA 5KEIA 1M34A 1NQTA 4GUAA 3AQ4A 3R3XA 4ND4A 1WU7A 2R7MA 1UAYA 4WY8A 2ZU6A 3BA6A 3OAAA 3IPXA 2P9BA 2VF5X 4OQFA 1T2AA 1BWPA 2DEUA 3MABA 2FMPA 3ZW7A 5T6MA 3DQQA 4QUIA 1M5TA 2OB1A 2R4QA 4US8A 4DDUA 1U7DA 4A3SA 3JQ9C 1VDZA 4GOJA 1WO8A 2VA9A 4H3VA 3EXG1 2ZQZA 4AKIA 3COVA 3WBFA 4Q18A 3G5MA 4QDTA 5G1NA 2Z6AA 2A0UA 2RKWA 3MQ4A 4ZGBA 4FFPA 2WD9A 3VZCA 1CERA 5EJ4A 4GX1A 1XQXA 3V1NA 4GC7A 1PT5A 3A9TA 3H4DA 3ROTA 3VZPA 4EA6A 1RCTE 2HWUA 1RMTA 4KLTA 5DHUA 3JQBC 3ID6C 5DN6A 5BN1A 3K9NA 4OIMA 2HWYA 1W5FA 1PWHA 3O8LA 1RG6A 4C3OB 3UOWA 1K7FB 7ICGA 4I55A 1KIMA 5REQB 1ZU5A 1RXCA 4DARA 4I2NA 4YMSA 1XA3A 3RS4A 1NIPA 5SYNA 1QB7A 3GFGA 4CEIB 3DMNA 2XR1A 4TQGA 1KDZA 3QGMA 1IG3A 1NZFA 4ZVMA 4AYWA 5ERYA 2ZRIA 3QBDA 3K1AB 4M53A 3AIMA 4MV5A 1SKUA 2WWYA 1KYQA 1X7ZA 4NJ8A 1BRMA 2BPOA 1R50A 2XYRA 2IHVA 4P81A 3ZY2A 1SC6A 4Q3DA 4YFKA 5K0EA 3FCXA 2A59A 2CB9A 1TMKA 3I8OA 2BHSA 2CL6X 3PHHA 3K0FB 5DE3A 3A7DA 1RJWA 1S0VA 1L5LA 4OHZA 2I9GA 5JCOC 3CBQA 2Z1DA 5DSXA 5DWQA 5KFOA 4EPRA 2YXDA 4Q82A 3UQ0A 2E6KA 4GKVA 3KBBA 4M49A 3WKEA 2PFSA 4DAEA 1APBA 3JAWA 4TUYB 1KZHA 2AN4A 2PAAA 2NUBA 4TRNA 3T3FA 1GNTA 1N2SA 1X66A 4H15A 2XTZA 4HDCA 3SHOA 4LXUA 3GV5B 1N6IA 1K27A 5CYFA 3WQSB 2WSIA 3PF9A 3NASA 1ZLXA 1JPNA 4B9SA 2XQGA 3NO4A 3NAQA 2Q3DA 3IAM1 1QNLA 4OHYA 3A9SA 5A05A 1YR8A 3NALA 2YKGA 4QYWA 4F4XA 1YDFA 4P7KA 5D2CA 3V48A 3IOEA 3WJ7A 4IDPA 2RDIA 2IUUA 1AZLA 4RJJA 4DLBA 2GD6A 1FU8A 4CTNA 1JQEA 5EGNA 3KKLA 4QO8A 2BCUA 1O6ZA 1W581 2TECE 2ACEA 2XI4A 4O2BA 1GUDA 1UBTS 3WSWA 3OJUA 1ZCAA 2FV8A 1PT6A 2NO9A 5EZSA 1WHSA 3A4NA 4OSPA 1QGUA 5JH7F 4D0NA 4P0QA 4ZVLA 2R8RA 5CRXA 4UVIA 1VHWA 1Z0FA 1FQKA 3TDNA 1B0AA 3NLLA 4MVJP 5DCWA 3ZZUA 1WX1A 4OSOA 1DBPA 3I04A 5CFOA 2W2MA 1K6MA 1Q74A 4INOA 4DO9A 1XDDA 4MAMA 4CR6A 1EU1A 2WT4A 3UJ6A 2PD6A 5KT6A 2QBYA 2G06A 2PJUA 1C30A 5FBVB 4MKGA 4KQGA 4YCAA 3PFKA 2F55A 2D2EA 3PWKA 3P2YA 1RFLA 1JFTA 3TXYA 3PIIA 1U90A 3FSRA 4RD6A 4X1KB 3VNAA 2ASEA 4PTLA 5A9TA 2ZS9A 3HHPA 3O8RA 2BQ3A 4QUDA 3I3OA 3T3HA 4MWBA 3W05A 3KB1A 1DOAA 3OJLA 5LXTF 3TQRA 4D3SA 3FJ1A 1FFVA 4FE3A 1N9KA 8ICRA 3X1KA 5HM6A 5CVVA 2V8OA 3UNXA 4YP3A 4O5KA 1G6OA 2WHQA 1GD1O 5DDIP 1PT8A 3MAAC 1SC3A 2OXTA 1C7JA 1B6SA 4DCNA 1QSGA 5FOVA 4EATA 4NYJQ 4LJ9A 2EKBA 1JHAA 4ASUA 3D5QA 1S5LU 4PC2A 1YK0A 4QATA 5G0WA 2V5AA 3KQTA 1J5PA 2F59A 4KQFA 4D82A 4NNJA 1B00A 3AEUA 1FTYA 1X15A 3SBDA 3OUZA 3B1JA 5DFAA 3C5GA 1GPUA 2V6JA 1TI7A 4L0DA 3J81k 2ZUCA 1TQ2A 1ZC3A 3TADC 1UWKA 1Q0LA 3LDHA 2R6CA 2FX3A 221PA 2PMCA 5AHOA 3ZHUA 4F93B 4HDRA 3K73O 4C3ZA 5JMWA 5HBGA 4WZAE 3TFSA 3V97A 1EBUA 4I6JA 2WB2A 3H9CA 1ZSYA 2E4UA 1GQ2A 1WV0A 3C97A 5ICEA 2Z4TA 3ETLA 3E8SA 2CK3D 1RPLA 5BRJA 2JLYA 2WYWA 4X94A 4L8VA 2WNHA 2JLZA 1ZQGA 1T1JA 2C5AA 1CIJA 2GAAA 2OE2A 3E70C 1JFFA 4Z9FA 4DCPA 2YIVX 3T7EA 4XQ8A 2O8FB 3SR3A 4I2AA 2I2AA 5EGSA 3MF4A 2CGEA 4GD3Q 3ODPA 1PJBA 1I3MA 2A94A 1O97D 2YW2A 3H1PA 2D7CA 3BCRA 4GAEA 4JA2A 2FMTA 4J1SA 2G1AA 3MTBA 3RVNA 3LQRA 5JI3E 2YXLA 3C7AA 5DBFA 3NTOA 3GV8B 4F7WA 4QWBA 4ZEVA 3UKDA 3EXIA 2YMMA 4O2AF 1Q46A 3S1SA 3GLFA 1LB1B 5IINA 2DPIA 1CZRA 2QARA 3TARA 4QYIA 4LK2A 1NXQA 1A8PA 4D2IA 2IY8A 2QZ9A 3D0QA 3RADC 3OQPA 2C2ZA 3UFXA 2MCFA 3NRBA 4ZVSA 1KEWA 5ES4B 1PJAA 1PR0A 1VDVA 3O8OA 3SZMA 2MYPA 4QYSA 2DWOA 4H7FA 4Q7MB 2C28A 3CIFA 5EE9A 3RO7A 3AVOA 5AI5A 2C4MA 4DSTA 1U8EA 2F1JA 3DMPA 2PKEA 2ZWMA 2VPYA 5KTSA 2D5AA 1LVUA 4RY8A 3P97A 2VWGA 1I2BA 5YASA 2IKQA 4W5NA 1VKRA 3DKIA 4DKJA 2ZBRA 4F5QA 3W4JA 4QDKA 5KOJA 1WDMA 4KLMA 2R8KA 4YR2A 1ISJA 1C1XB 1TIPA 1A04A 3OLZA 1FP6A 2BI8A 3WHPA 4TMYA 5BWBA 5BSKA 4U9IS 2QNBA 1VB5A 4KYTA 1GZ5A 5KC8A 2YICA 4PCUA 1FSSA 1AD2A 5IKEA 1Q16A 5B6IA 3SFVA 4M22A 1E2UA 1AU9A 2GEFA 1DFGA 5CT5A 3KZCA 4QODA 4BFTA 4R63A 2QB0B 2ZBUA 3I4CA 4CG2A 3IIJA 4AZ0A 3N97B 3HXLA 1S9FA 4HSEA 4Y2JA 1QUEA 4N49A 4RAOA 2YDXA 2XMDA 4JWNA 5BOSB 2PUAA 3N7AA 1USUA 4EF6A 3I28A 1X9SA 1F06A 2ONYA 2QLNA 1OYYA 1RQGA 4B9VA 1GZUA 3EC1A 4P3YA 1PUZA 4EMSA 5T7BA 4LHSA 1VCHA 2VTDA 3ZHTA 2W42A 3ZQJA 1FP4B 2PMBA 3CNQS 3EY9A 4AJIA 3RH0A 4M3NA 4O0MA 4JYZA 3KTDA 3OZBA 3KDAA 4WZAA 3U44B 4ACBA 4P38A 2ZJAA 3TG2A 1M6VA 2DT5A 1QXSA 3OFNA 1FFBA 3Q8MA 5B4VA 1C3VA 3NXSA 1CKEA 2GBLA 1L3UA 3IEUA 4YRBA 1R16A 4CF6A 1A9OA 3S2UA 1MEEA 2HNAA 5EWEA 8ICQA 4M9QA 1CUJA 3K35A 4G1BA 1U8XX 3QFCA 4EZ6A 5HR6A 1Y7TA 4X3PA 4L3OA 1PWZA 2A4MA 1G8JA 3GZFA 1OWNA 8ICAA 3PDUA 2D00A 1DSSG 3T0GA 4EVSA 3PA8A 3HCAA 4YIHA 2CZQA 3IQFA 1JIHA 3EFBA 1L7QA 4HH3C 1G64A 3EW9A 5ALJA 2UXBB 1SXPA 2NUTA 2J9ZB 2YRFA 1K5OA 4F3CA 4YMLA 3HILA 4MUHA 5CW1A 1EFDN 1KO5A 2Q1XA 4D9NA 5HMLA 1YCFA 2PSSA 1EP2B 1DX9A 3S40A 4PX3A 3S7ZA 1AUOA 5DWDA 1YVRA 1B6RA 2B2CA 4MHOA 5DEOA 1WS6A 3FI0A 2DHDA 4UC0A 2XCPA 1KEEB 2H5IA 2X9VA 1UJNA 2B78A 4R2WA 1UKBA 1YL7A 4RNCA 1FP7A 1XSPA 4YGXB 1PSWA 3W5CA 2R8XA 1PDWA 1VJCA 1V4BA 2NT4A 4IKEA 1DAEA 1H8HD 4US9A 1CJUC 2YZMA 2HFKA 4OHBA 3DBLA 3E2EA 1G4AE 2A6PA 1U0SY 1TX4B 2HHXA 1F5SA 2C7VA 2QXTA 1PTJA 2P0AA 3BRWD 3KUXA 2DPGA 4GNKA 4PZCA 2D1FA 3BE4A 1YKSA 4UD2A 1JI0A 4EZBA 2PRIA 2FDCA 2WAOA 3ZD6A 4I8DA 1Q7RA 1N9GA 1ESZA 3D43A 3KHSA 1UOPA 5GINE 4Y6GB 4WFIA 5KX5B 1FMLA 2C2BA 3Q7QA 4IUBS 3LD9A 1FMJA 2I3BA 3AT1A 4L0MA 2VJOA 3ZV6A 3FPSA 1RZUA 1VCIA 4P31A 2PFNA 1PTKA 2BP7A 1VCMA 5H7XA 2VF4X 2Q3CA 3CEMA 1PQ4A 2FWIA 1RPNA 1E89A 4WBXC 2P91A 1BW9B 2JGDA 5KOIA 4DG9A 2XUFA 4DMFA 1WPXA 4R81A 5JLAA 2PL3A 3FCUB 5HUHA 4Q9LA 3PP8A 3OEWA 1RR6A 4ENVA 3RU2A 2EAPA 3HY4A 3PV8A 2Q3BA 1NTOA 2EHDA 3VSBA 2IXDA 3IP9A 1JALA 1Z62A 4BFCA 5CBPA 2I03A 4HZGA 3ZGZA 4GPBA 1GOTA 2QTVB 5EIHA 3SN6A 1UIRA 1H2YA 5IZ4A 4NWIA 5L6LB 2XSZA 1P1HA 4KYVA 4C0SA 2LYBA 1KL9A 2EIXA 1GAEO 5LKAA 4L50A 2W22A 1SXQA 1Z7WA 3WLQA 3LQ4A 2ODEA 4YQWA 4N8EA 2V0CA 3DYVA 1HI9A 3AHCA 1U9IA 4M9ZA 4NL4H 1U7OA 3U19A 2XF2A 4Z1OA 5H83A 2AHRA 1YZGA 1M6NA 4BMOB 1NN3A 5K8TA 2HRDA 2QKQA 3PVXA 2VJYA 1CI4A 2ACKA 2CVPA 4GMDA 5DIFA 3Q2KA 2ZE5A 2YUIA 3LOQA 4KMMA 4ZYUA 1YGPA 4JOBA 4TPKA 1IHUA 3VC3A 2ZCVA 1KWKA 4RADA 2BUBA 1T3QA 3WA7A 3O6VA 2FW0A 2CHQA 1M8KA 1WKCA 3QU4A 3AONB 3VISA 5HW0A 3G0GA 2XPCA 3F6YA 2V45A 4OHMA 3ROEA 3ZE9A 3KUUA 3KPJA 3ZGXA 3UCEA 1AUPA 1MENA 4ZMSA 2FX5A 4XLLA 1N1EA 1UEIA 4DV4B 5LQJA 1RACA 2WWXA 5IAEA 2KB0A 3A70A 1IV8A 3LVVA 3O0FA 2YJTD 3HDGA 5FJJA 3VR6H 1SUEA 1RQ7A 3GEHA 2P6RA 3KKAC 2OP1A 4BZQA 3GCZA 4Y2RA 3U1BA 3PXCX 3UCXA 1M72A 5EEGA 5LP6F 4DDVA 3ICPA 2X6TA 1PNVA 4BX2A 1A2OA 3VI3B 3PE4A 1U7HA 4V0SA 3T4PA 2F44A 2QR5A 3O4RA 4FK8A 3F97A 1U9ZA 4ZXFA 3A6DA 1MU0A 2VYFA 2IMWP 3LO5A 1IAQA 4PLPA 1FXUA 4J0IA 4F6LA 4RFLA 1WIWA 4EY7A 1EGHA 2HPAA 3TOCA 5CCDA 2B21A 1Z2CA 2DERA 3P9ZA 5ILGA 2RI1A 2D0OB 4B82A 2JCXA 3L1UA 3G49A 4BNTA 1EDDA 4XJVA 1TA4A 1O6GA 4QU9A 2E8MA 3MSCA 4AYXA 1QRDA 3OU2A 1HE5A 5BPCA 2YFKA 4F6CA 4BMPB 3OQVA 5AUQA 4RKFA 5IDYA 2LR0A 1F2UB 3INTA 3CUWA 1A96A 2G9RA 4ZAZA 4YQYA 1UM9A 4ED1A 1J0XO 3DHWC 2ZIWA 3CZRA 5B7PA 3LYUA 1N8NA 2AR0A 4PPQA 2BGUA 4DR6B 4UU7A 1Y88A 5FHQA 5IJAA 3L0CA 3TF5A 4ZEWA 3QV2A 1GTRA 1NSFA 3K32A 1U0HC 2DHEA 4NC9A 2AWNA 3ZOKA 2ORWA 4TROA 3RBXA 1X6VA 1JVNA 5DQIA 5JH7A 2CL7X 2ADOA 5HCIA 3UKOA 1TUBB 4QDJA 1JNYA 3U48A 3W9BA 1YULA 1JLHA 4J9QA 2UKDA 3H0RB 2XUPA 3I9JA 4F86A 1YUBA 4RVGA 3PNCA 2UVPA 1TM3E 5LDHA 3KLMX 4EPYA 3ZW9A 4O4JB 4BC1A 2O3UA 1G18A 5FLEX 2WOOA 5HF6A 3UMJA 1E63A 4R9UC 5KC9A 1AZTA 1UPHA 3I23A 4PPFA 5KOYA 4EF5A 4BV9A 4JLDA 4YMNA 3H5RA 2FTKE 3R5KA 4C7ZA 1JHVA 3RGGA 3BQTA 1ZKMA 5JS6A 3QMMA 5SY9A 5F9HA 3FRJA 1IPEA 4R3WA 3N8NA 4OIFA 4QYMA 4JV1A 3IVRA 1MC1A 3P4XA 5FWYB 1SV0A 4OHKA 1SZJG 3GFOA 2D6FA 3JPNA 2WPDA 1S96A 4LZPA 2KZZA 4BFXA 1SXEA 1ZK4A 1V85A 2QSYA 3EUFA 5FT9A 1B14A 4WADA 2C4NA 5KQMA 1NWHA 5F3RA 1B16A 2H06A 4PGHA 1CDDA 1C0LA 3P96A 5F98A 3K71B 1J8MF 5KMGA 4TWRA 2NQ2C 1QFJA 5MDHA 1B73A 3LPNA 5LFAA 1PWEA 2RH4A 2WMOB 2HU8A 4QW8A 1DTWB 3L40A 5EQJB 4C21A 1FLAA 4Z0NA 3RFCA 3SZLA 1USKA 2I8AA 3LHFA 2MWMA 2RDJA 3I4LA 3KK0A 4Z51A 2NUPA 3IUPA 4LX8A 2O9JA 4N0EA 5EHQA 5DYTA 5A9SB 3GUYA 4Y2HA 5GWXA 2CNDA 2QMUA 2EX0A 4K28A 1MABB 1OH5A 3WMXA 5H02A 5BP7A 2ZIGA 1PGOA 4QU8A 2A9VA 5DHRA 2BONA 4J03A 3FRHA 2PRZA 2V4UA 1CJMA 5UKDA 3MVEA 4KXWA 2BBOA 2XGOA 3HNPA 4HWGA 2PDAA 4EFLA 1I0IA 2VP4A 2IYAA 1CUBA 4F4ZA 1EVLA 3VVBA 2C9MA 2NAFA 1P3DA 4ZAWA 3RW9A 1ZZEA 1UAAA 4N6OA 4ZICA 2ISCA 1J99A 4MWSA 1H42A 3P0IA 4WUTA 5ESXA 1Z4MA 2W11A 3MHPA 4F2PA 1VE7A 2K4EA 4PBSA 2PPLA 5F77A 3I58A 3MPOA 4NARA 4U7CA 4IJ5A 1G42A 2JJ8A 1HYGA 1D8YA 2R6AA 5HQ3B 3PTAA 2J6IA 1P1BA 2E3TA 1YDGA 2J6SA 2W4MA 3IG5A 4RPGA 3K9GA 3TVTA 3ZVKA 3IFSA 2GN1A 3RK1A 1QJ4A 1M1YE 4UQOA 3S8YA 2FFRA 1BYUA 4IOJA 1NW9B 3VYRB 2VATA 5HFJA 4F8RA 4TQSA 4DMMA 2A1JA 4C5AA 3RJ9A 3FZGA 3LPMA 3PQ2A 1YZLA 3DO8A 4J90A 4D9JA 3HJBA 3V2UA 1CF4A 3ISJA 2VT3A 2M0NA 2A78A 4Q3EA 2XRMA 3QF7A 4IIBA 4OQNA 3F46A 4UMFA 5KU1A 4PAOA 3TM4A 1M2OB 3EDOA 3CN9A 3N39C 5FI3A 1XTUA 3RWMB 4QG7A 3VX4A 4RQ6A 4QBIA 3HKBA 2YNMD 5E4JA 3DC7A 2WTFA 4PYMA 4KOEC 3DYIA 3DAOA 5ARCA 5ESDA 1V7ZA 3LO8A 2JAPA 3V7WA 4W63A 3JVUA 3JTMA 1JDBB 4F5EA 5DCYA 2C2XA 4ZCRA 5F7JA 2UVQA 3FWZA 4S04A 2VDWB 3S2ZA 2W2PA 2ZJ5A 3B51X 4FGKA 2O8VA 1VCOA 3MG9A 2GK4A 2PWZA 1CZUA 2GAJA 1TIBA 4XUEA 3WGUA 3JQAB 3NBZC 3HYSA 4PS1A 2P78A 4I6GA 1T91A 5FBQB 3QFFA 3PUYA 4RSMA 4HPXB 3QXXA 1AUXA 3MMPA 3L1JA 1Y6JA 3G9XA 3DHEA 5DDYA 2OWEA 4DC0A 5I7HA 1MQAA 4C06A 4B3TB 1L5VA 3N2GB 2BEVA 3SSNA 3MLBA 2Y0SC 5F52A 1PX0A 3R41A 1KFKB 4ONEA 3QF4A 4RBNA 2C4UA 4M7OA 4NZPA 4CM8B 1WU8A 2AFVA 4R41A 3S1AB 3OM0A 3MCZA 3U13A 1Z73A 3SC2A 3AUUA 3R7AA 2HKIA 2PVSA 4ED0A 1KJ8A 4D4HA 1PK1A 5JPIA 1W0CA 1RPJA 5KFXA 3T7RA 1XCLA 3EVFA 1X9GA 4I5GA 2B61A 3GN2A 4UE2A 4S1NA 3SS9X 4CIYA 3AJ8A 3QI7A 5IUJC 4PAQA 1L1EA 3R8CA 1UFOA 4HDSB 9ICRA 4LFAB 2VCEA 4MDEA 4L5CA 3BKXA 3C3AA 2AE1A 2H5EA 1QQAA 4D8TA 4MV1A 1VLLA 3SC4A 5A04A 1MB2A 3T9AA 4FCTA 2C5FA 4R05A 2JR5A 4MWZA 3FHLA 4KEAA 2AMVA 4OYYA 4ZYYA 3G17A 3HMKA 4C0WA 1HT2E 2BFDB 1CG6A 3M4YA 5KYTA 2RB5A 1DJOA 3WAJA 1ZMXA 3DFMA 5KYGA 2V0GA 3WLKX 4B6JA 4UHDA 2IQ5A 1W2WB 1M1YA 4AO6A 1SCUA 1AQYA 1INLA 3AI2A 3RYCA 1ZJWA 5HRUA 1AN9A 1Q83A 4IC9A 3GRPA 2QIPA 3HNRA 2XF8A 1W5AA 2H08A 2Q5QA 2Z04A 2DM6A 3DE3X 1SQ5A 4CQMD 3ZYCA 2FQXA 4BX9C 4MQBA 3WK9A 3TIGA 1SC4A 4U8HA 3TRIA 1N3IA 5FWXB 4L8GA 2BPGA 1ZN2A 3WIUA 1RNLA 3SD7A 2KW5A 2K7ZA 4R1NA 3SF0A 1VPWA 5I4CA 1Q20A 1KR2A 2VQDA 2D5CA 4FQ7A 2JHPA 1LC3A 4ZD6A 3ZNPA 3ZXXA 3H6HA 2XT0A 3QWAA 3C4JA 2ZITA 4L4RA 1YDWA 2VDRB 1N5OX 1FTNA 2YX8A 1CRQA 3IP1A 5AKGA 1MA3A 2ECOA 2WAQC 2M1ZA 4G8BA 1W0JA 4KFUA 1KETA 3N7TA 2VT7A 1ZVMA 4B4UA 3HLKA 2COKA 4DSUA 2FVXA 4IX9A 3N8IA 3OWOA 4KLUA 1ZK1A 3N6RA 2YVQA 3LA6A 1TUGA 4JLKA 1T6NA 4LCJA 4AC9A 4LF9B 2I7TA 1MT0A 3MFYA 4KUGA 4JWKA 2YJ5A 1UP6A 3VNBA 3KHUA 4PWYA 2RGUA 1NXXA 1KI1A 3IJEB 3TFWA 1ODIA 3H04A 5D01A 4IWNA 4F60A 1P1CA 2IQIA 4IQWA 5C1PA 1JJVA 3LKDA 1BHQ1 1I94B 1DEAA 2PX8A 3SVTA 2X8WA 3UXNA 1E2EA 4DR4B 1XKLA 4Y9TA 5AVOA 4R4JA 5K0BA 2WZQA 3U1TA 5KJCA 2P0EA 2CLEB 4ZFNA 4KREA 4PLTA 1MV5A 5JV5A 5IKMA 4ESOA 4YD2A 1RDFA 4A92A 1Z8HA 2FSPA 3I6IA 1TD9A 1L9XA 1UOQA 2VF2A 4HNUA 1IEQA 2XB8A 3AM4A 1RYEA 2JIBA 2DQSA 3DEHA 2V5VA 4LWQA 3MJHA 5KHLB 1HDYA 2B0JA 3A4LA 3M5WA 2NRZA 2AJBA 2W2KB 1VI5A 3WFJA 1XA4A 5T67A 1E5XA 1IUNA 2CVZA 4ARIA 2JANA 5A3JA 1E2GA 2WQ6A 3WB9A 1FMCA 3PJFA