4CNQA

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
226
structure length
225
Chain Sequence
b'RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 85
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cnqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cnqA01
4OD0A 5AKYA 4YCLA 2MU2A 3L1VA 1ZD3A 2W11A 5AHXA 2WF5A 2AGVA 1ZD2P 1EK2A 3L8HA 3FGOA 2OA0A 4J2TA 2WF8A 3L8GA 1Q92A 3SD7A 4NABA 5ALZA 4JB3A 3KDPA 3U7FB 3ZW7A 1F5SA 4Y2TA 4UMVA 2I33A 4Y2XA 3IRUA 3E81A 1YS9A 3U7EB 3N28A 4JDPA 1JUDA 3NAMA 1PW5A 2HO4A 4FE3A 1Z4NA 3WK9A 3R4CA 3AR3A 4GXTA 2R8EA 3IB6A 3AR5A 4BBJA 4YH1A 2G80A 3ED5A 3PDWA 2YMMA 2GHQA 2AH5A 3VAYA 3FPSA 3W5AA 1TE2A 5FP0A 5AKLA 5AI4A 3WKEA 3A1EA 5AM4A 5AKEA 3SF0A 3HLTA 2HEGA 1YMQA 3I28A 1RKVA 3TLMA 2YMQA 5IS2A 3DDHA 4Y2SA 3N8GA 4EZEA 2IA5A 3OCZA 2WM8A 5IT0A 2P11A 1WR8A 5AK4A 2VKQA 1ZD5A 5AICA 2ZG6A 3IJ5A 1KYTA 1Y8AA 4MWOA 3QNMA 4UAVA 5AI5A 2ZBFA 5AK6A 1LTQA 3ET5A 3L8FA 5AW9A 1RRCA 1RQLA 3UMCA 3NALA 3OCVA 5ALSA 4EELA 2EATA 2B0CA 2AMYA 1ZD4A 3R9KA 2G09A 4EEKA 2W43A 5ALQA 4B6JA 2WF7A 1ZRMA 3FM9A 2ZOSA 3A3YA 3KZXA 1ZJJA 4AS3A 2CFSA 5AK5A 1TJ5A 4F71A 5AVYA 4C4SA 5AVQA 1XVIA 3WGVA 1Z5GA 2FUEA 5ALTA 3UM9A 3A1DA 3U19A 1Z4MA 2YMPA 4L6AA 1TJ3A 3OCWA 3QX7A 3PGVA 4YCMA 2FDRA 3OPXA 2QLTA 5ALEA 1CR6A 1Z4PX 5AESA 3DAOA 3KC2A 3N07A 4RESA 4NFLA 5T41A 3PCTA 3OCXA 1L7OA 1Z4QA 1XPJA 1Z5UA 5ALOA 2CFRA 1NRWA 2I54A 2IYEA 3KBBA 3ZVNA 4ZEXA 3W5BA 3QU4A 1T5SA 4ZEVA 2IOHA 4HGRA 1K1EA 4BYGA 4C4TA 3D6JA 3AR4A 3RF6A 1LVHA 2FI1A 3QXGA 1U02A 2QYHA 4NAVA 5AVWA 3MPOA 3PGLA 4Y2JA 3ZU6A 1L7MA 3DNPA 2B1QA 2I7DA 2JAWA 3ZWKA 1SU4A 2B82A 1MH9A 2D2VA 2HX1A 1RMQA 5ALFA 4UMEA 2ZXEA 2P27A 3L0BA 1VFPA 3KOOA 5ALJA 3B8EA 5AKZA 5ALDA 2DQSA 3FPBA 3EF1A 2RAVA 1QQ5A 5AIAA 3BA6A 4L57A 2YBDA 3QU5A 1NNLA 4UASA 4UARA 3L8EA 1Q91A 3OTQA 2MSNA 3I76A 3ZUPA 1S2OA 5ALGA 4UATA 3OCYA 3SKYA 1N9KA 3ZVMA 5AM3A 2GFHA 4I9GA 5AVZA 2PKEA 5AW0A 3FZQA 2HHLA 1T5TA 2OYCA 4BEWA 2JAOA 4J03A 2I34A 5ALMA 4KNVA 3L5KA 3W5DA 3ZTYA 3E84A 3MMZA 5IT4A 2BDEA 4RETA 1ZRNA 2FPSA 2PQ0A 3MN1A 4BX0A 5AW6A 5JJBA 2CFTA 2C9MA 2EAUA 4UMFA 3WKCA 4DW8A 1RKUA 2RB5A 1L8LA 4CF5A 4HGNA 5AM0A 2C4NA 4DCCA 3WK8A 2Q4RA 5E0OA 4HAIA 4XOUA 3MC1A 3AR7A 5AVUA 2W4MA 5AKJA 2JAUA 3NANA 3AR2A 3QU2A 2EARA 1QYIA 2YFYA 2NO5A 3QUTA 3I1YA 2RARA 5AW2A 4PNHA 1L7PA 4G63A 2R8ZA 5A3QA 4Y2QA 2R8XA 1X42A 4HGQA 4AS2A 4C4RA 2FPWA 4KYTA 4UU0A 3UMGA 3SHQA 1CQZA 2ZBGA 5ALHA 4E88A 4OFZA 5A3SA 1IWOA 4L6CA 4OHFA 3SLRA 3E8MA 2HF7A 2FUCA 5ALNA 4GIBA 3OCUA 1YNSA 1Z4LA 1RC8A 2YJ6A 3WGUA 1U7PA 2P69A 5AK3A 4I9FA 3E58A 4UU1A 3SKXA 2YJ5A 1FEZA 4HGPA 1AQ6A 1VJ5A 3EF0A 2FEAA 4EX7A 3BWVA 3WK7A 2JGAA 2R8YA 5AM1A 2C8KA 5AW5A 4Y2VA 4CF3A 2I6XA 5AKGA 5AVRA 3RFUA 4BNDA 1L7NA 5AI0A 1S8OA 5AW4A 2MU1A 4HYTA 3EWIA 4YIKA 5AVSA 4Y2YA 2YJ3A 1L8OA 2ODAA 2AUTA 5AM2A 3A1CA 1RMYA 1Z4OA 4MUMA 2OM6A 3QYPA 4QQFA 3ZWDA 2GMWA 2B8EA 3NASA 2ZBDA 3ZX4A 1QQ6A 1RLOA 5ALIA 3WK4A 1J8DA 3AR9A 1L6RA 1Z4IA 3UMBA 3QU9A 2I55A 3WKBA 3QLEA 2B1RA 1RKQA 3W5CA 4G9BA 4F72A 3EPRA 1TA0A 3U13A 4IFTA 3M1YA 2GO7A 2GHTA 5ALUA 3N1UA 4HGOA 5AW8A 5ALYA 1ZS9A 1U2TA 3L7YA 4UW9A 4O8CA 3WKAA 4FFDA 2FPRA 2IOFK 3N5KA 1RLMA 4YIHA 4Y2RA 2YN4A 4BEVA 3U7GA 5AI9A 1Z4KA 4KX5A 3K1ZA 2PR7A 2G08A 1RQNA 3GYGA 3L0YA 4CE6A 4XQ0A 5AKHA 3ESQA 3NIWA 1SWVA 5AKXA 5ALRA 4EX6A 5A3RA 2WFAA 1Z4JA 1J97A 2G1AA 1WPGA 1RPZA 2G06A 3U7HB 1NF2A 5AVTA 5AKIA 4YGYA 3ZI4A 1WZCA 2OBBA 4KN8A 5AW3A 3FVVA 5AKKA 3L1UA 1YDFA 4UAUA 3WKDA 1RLTA 3F9RA 3SMVA 2FPXA 2NYVA 1EK1A 2O2XA 4CF4A 2WF6A 2HOQA 1YV9A 4DWOA 5AVVA 3ESRA 4Y2PA 4XPZA 4FYPA 2B8JA 2G0AA 4BX3A 2IOFA 2WF9A 3ZTWA 2G07A 2ZBEA 1VJRA 3CZ4A 5AW1A 4YCNA 5AI6A 4OCZA 3NUQA 3QUCA 3QU7A 3S6JA 4UM5A 5AM5A 1WVIA 4Y3UA 4XE5A 1TJ4A 5AI8A 1T9ZA 2X4DA 1RDFA 4H1WA 3L0CA 2YMLA 5ALXA 2JARA 1U7OA 5ALWA 3ET4A 2WHEA 1ZOLA 2Q4TA 2HSZA 5ALPA 3QUQA 1QQ7A 2YY6A 1O08A 3AR8A 2FPUA 3CNHA 3I6BA 5AW7A 4DFDA 2BY4A 1U2SA 4EENA 3WK6A 3HYCA 2RBKA 2P9JA 2Q5EA 3B9RA 2HF2A 3ONNA 4NWIA 2B30A 2HI0A 2NO4A 3KD3A 3DV9A 2C88A 2YJ4A 4IG4A 3R09A 2C8LA 3U26A 3WK5A 5ALVA 3AR6A 4AP9A 4UMDA 4NV0A 4CNQA 4ZEWA 5ALKA 1XP5A 3ZX5A 1RMTA 2O9JA 3ZVLA 5ALLA 2CN1A 3QUBA 1QH9A 4Y2UA 5AVXA 1YJ5A 3J7TA 4BX2A 1SWWA 4BKMA 1N8NA 4UM7A 3NRJA 3QGMA 1Z88A 3M9LA 4KX3A 3B9BA 3P96A 2HCFA 4QJBA 4KNWA 2HDOA 4BNDB 5AIBA 1O03A 2BDUA
chains in the Genus database with same CATH superfamily
3IDFA 2YH2A 1NXPA 1CIPA 3HYSA 4FEEA 1A2QA 1PK1A 4LZZA 3RIYA 3FVQA 4EL0A 3VR4A 3ELYA 3S55A 5TV2A 1G55A 3D2CA 2FVYA 4LGVA 5L45A 2QAJA 1G5QA 2BFDA 1FY2A 4RTSA 3W5AA 1S0VA 2A5GA 4N5LA 1R6XA 4LTDA 1R0CA 2QMZA 1NK7A 5CDFE 3LFHA 1XZFA 4DOAA 3IJRA 4IOJA 4R3WA 1XMQB 5AW9A 3ZH2A 1WUKS 1XA0A 4K4GA 4ED3A 2BELA 4GWLA 3VM6A 1NN3A 4NLLA 4BIMA 1EHYA 4AN0A 2G36A 2MSDB 3K0FA 1I10A 2GA8A 4OKSA 4NZOA 4YPVA 1D9XA 3JS5A 3IDZA 1BH2A 4WD3A 4P22A 4RHYA 2F9LA 2JI8A 3C43A 1NWHA 4L8YA 5KFPA 1O94C 1PCXA 4Q05A 3RRHA 3HM2A 3N2KA 5F1OA 2KN7A 3JCZA 1GDHA 4QEKA 4BGIA 2BKXA 3D6TB 4XGNA 6Q21A 4TTTS 3H5OA 1MTOA 3GUYA 4L57A 2UVUA 2Q3FA 4QM6A 3DE3X 5DI9A 3DT9A 1EQUA 4AF7A 3ZGOA 2QRZA 4S2UA 1JG6A 1P62B 2SNIE 1QJCA 3O8NA 4KC0A 4TROA 5JSZB 4Q9IA 2GBLA 3VA7A 4EMUA 2I87A 4DQVA 1KDPA 2H65A 5AVUA 2DC1A 2H3EA 5DHUA 5B2FA 2HIAA 4OPMA 5KU7A 3OJ0A 4WJLA 3AUKA 5LJLA 1TM2A 5EIXA 2GSWA 2HT1A 1N1GA 2RHTA 3A6PC 3QYJA 1Z35A 2NZYA 2WSBA 3JD2A 5BNTA 1W0KD 1WY7A 4M9GA 3CPSA 1VI2A 5KG7A 3BKXA 1PR2A 2C31A 2OOSA 4B8YA 1VLZA 3OY7A 1P8JA 1ECCA 5LMZA 1XZGA 1BFDA 3ZBPA 1ZD1A 1N34B 4J16A 1VCNA 2IUUA 2IZZA 1SVLA 1CEYA 2ONZA 7MDHA 1EFLA 2BCJQ 1S2IA 2ZITA 2PVCA 1R6TA 3BTVA 3AH8A 3ADDA 2CUZA 2KJ8A 4UW9A 4HGZA 4BX8A 3V4OA 2NADA 3FETA 5DSXA 5DT2A 3UEOA 2XXAB 3PUHA 3MQFA 4P9NA 3EGDA 3TCNA 3OE4A 3N2LA 3TB4A 1PV2A 1GA1A 2ZTUA 4ZC1A 4O2BA 2WM3A 4ERXA 2BKVA 5HZHA 1AKUA 1Z25A 4R64A 1HG0A 4NZPA 2XOKA 4D6PA 1SKMA 2D06A 4QO8A 2XVMA 4FYPA 4MVCA 2AFVA 1KBZA 1T0JB 4IIJA 2OB2A 3L7MA 3OURA 5HF5A 3G5UA 4ZXPA 5K99A 3PCRB 4KR0A 1SBQA 2Y76A 4IUCS 3RNOA 4D56A 5FAKA 1XAJA 4C7OB 3SENA 3EHDA 4PSKA 1EG2A 1LNZA 4KODA 1I4TD 4KZPA 3BMCB 4HDRB 3SHTA 8ICEA 2VPXA 5BNZA 1NU6A 1K89A 3U7IA 1ZETA 1XP5A 3QVUA 4NPHA 5IFKA 2VHXA 4ED6A 3E3MA 1UDRA 3NGLA 4D6YA 1L4LA 5EPUA 2VK2A 2HLNA 4UPVA 2QG4A 2AR7A 1EDZA 5KNDA 2V4MA 4JFRA 5CLQA 1RQRA 5B53A 3HRHA 1R2QA 3W6UA 4AYTA 2XCOA 1G0NA 3DZHA 1M0TA 2JEOA 2YJTD 4I1YA 1DG9A 1TVEA 2IUTA 4UU7A 4OLAA 4CMBA 1CQXA 4L8GA 2PX8A 2MA1A 1E7YA 3F97A 3H5NA 5LXTA 1RM3A 1ZHOA 1PT7A 1GKYA 2D0DA 1U7HA 3OIYA 4CNBA 2WSSD 1D9DA 1QVVA 4PAQA 3NT4A 5CDSA 4UXIA 3MSXA 4E5SA 1GNQA 3CWQA 1F2UB 3QMMA 2A33A 4XGIA 1PJ2A 2O2DA 2VAMA 4NZZA 1NZDA 3EVBA 2I66A 3L1IA 2BGTA 4CQLB 2IZOA 3TOZA 5DIFA 3PW0A 1WLYA 1J2EA 3W04A 3I5MA 2XCPA 4L9RA 2BFBB 5KCZA 3THXA 2ZRGA 3KPWA 3IIMA 3VISA 2CVQA 2H08A 4BVAA 2CBXA 3CEHA 2C77A 2VNJA 4TQRA 4DRXA 1C30B 5L40A 1RJ9A 1YB6A 3CVJA 2O2JA 1RRGA 5IRCD 2IYNA 2YWEA 2IF2A 4RTOA 1PK3A 1YCDA 4BGVA 1IBSA 3L8EA 1XF9A 4X97A 2FPIA 2D7DA 2ZKIA 2CZQA 5J0TA 3OC0A 2E4WA 2HJRA 1W35A 2WUFA 2BCGY 5DQGA 3OLYA 7REQB 2VUIB 1J2JA 5DRYA 3AB8A 2G5PA 4A16A 4J7XA 1QCDA 3E9QA 1V0JA 4FKZA 1LQUA 5DLDA 2OWDA 2Q45A 1TT5B 4PNHA 3QLJA 4IIUA 3GRAA 3BE5A 1PWZA 3T79A 3JQBC 5E7MA 1JLHA 3IG8A 4BNNA 3EGCA 3GXBA 3NWOA 5EUMA 5B2EA 4MRMB 2OHIA 2WAOA 3FR8A 1U1GA 1U9IA 2VPIA 3CISA 1V1RB 3HCCA 4PLTA 4Q9AA 3T7KA 3DBLA 3VO1A 2QL5A 3OMXA 2XQIA 3QXXA 1SXJE 2H1WA 4AXBA 3BXFA 1OGIA 5G41A 1YBVA 4OFBA 1XZBA 3O31A 1CVIA 3UPQA 3O4HA 5E1OA 2IUYA 1U7XA 1WCXA 5A3VA 4Q03A 4RVDA 1ZQAA 2DUMA 2Z3ZA 5CW1A 4MQUA 2QZ9A 5D51S 2HRBA 3CB4A 2X7HA 5F64A 3NNSA 3FTDA 2IZ5A 4EBEA 4XZ3A 3WRWA 4M9QA 1IAVA 4EW1A 4DMLA 1M6EX 4YRNA 1QGAA 4UCQA 2H54A 2JLSA 5IWCA 2Q2OA 1CQJA 4BLPA 3LWDA 3S70A 2Z8ZA 3L04A 4AO7A 1ZK3A 2ZSJA 1GQSA 1Z7BA 3SK0A 1WZCA 4BVLA 3FUVA 1WU8A 2HUNA 1T3TA 3T3MB 4PRYA 3HZZA 4OHBA 1Q95A 2WYWA 1W5EA 3GP3A 3ISVA 5ESXA 3HYNA 3C1TA 1R0KA 5HILA 1ZGBA 1M1YE 4DV5B 1FXSA 4M21A 5A05A 2ZJAA 2YL2A 3JWJA 4KLEA 1Q7EA 3U6BA 4XE5A 3OZVA 2PUEA 3H13A 1GLVA 1TKRA 5TS3A 1QV6A 1XCBA 3K1TA 1QB7A 3GLRA 1J0DA 5J2UB 5A7FA 4BZZA 5IWAB 1FFUA 5HX7A 4US1R 1L7EA 1Z5VA 1Q1ZA 2ZUWA 3RUPA 4DOMA 3MCAA 4L5JA 1E7QA 3R1IA 2IV2X 2JJ8A 2GDZA 5CFNA 1PQWA 4OX9Y 4LJRA 5KFAA 1CUBA 1LPBB 3TMYA 1VI5A 4G5FA 2F48A 5SZIA 1DWUA 4P4NA 1OBCA 3RPEA 1W85B 1PSWA 1VG8A 1A71A 3O4VA 4QJBA 5JH7A 2Y99A 5D3ZA 3LA6A 4G5QA 4M53A 3PX3A 1WD5A 4KE6A 1O5OA 4D9FA 4YRAA 1JTFA 3PRYA 1T8UA 4Z6CA 3T5HA 1FVHA 4RNMA 2FK7A 5FFMA 3Q10A 2BLNA 1T0PA 4DXHA 1QOZA 3VUEA 3JPTA 1E98A 3OE7A 5CYGA 1H5UA 4B6RA 3HCRA 4MJ7A 2EZUA 4CCSA 2OFPA 4Z9FA 3I6IA 5BYAA 4RCZA 1Z4NA 4EB6B 3UQYS 1HQDA 1O6BA 1DRKA 1NBME 1ZBDA 4C01A 4Y6PA 1Q0QA 2HCTA 1JBKA 2GM9A 4C4XA 1PYOA 4OQEA 5FBZA 4DA6A 1ZSVA 4ARUA 2ZJOA 3RSSA 4DDTA 2HPVA 3UV3A 2JATA 4J0IA 3INTA 5TQVA 2H57A 2OCPA 1LJ8A 2DOKA 2IX9A 4S2EA 3ZXYA 5F98A 2XUIA 1MBZA 1QZTA 3O91A 3TACB 1PNRA 5DGCA 1N0WA 1UEXC 2CUKA 4UTRA 3DMHA 4EARA 5JXIA 5FADA 1PVRA 4ZT2A 4IDFA 1C8VB 2ZT7A 5HIJA 3DMGA 1TQDA 3UN1A 4JC4A 3GAZA 4YP1A 3EC7A 7YASA 4DDWA 4PHHA 3PXGA 3ICOA 3BN3A 3WNVA 1HQKA 5MFPA 1KFEB 2ZI7A 3LFTA 3KB6A 3AU9A 3UAXA 1A8SA 3SAHA 2W6JA 1ZGAA 4KI7A 2KZZA 2C84A 2G7ZA 2XQFA 1Y5RA 3E53A 2DQSA 1NNLA 2BF4A 2VSXA 3BZBA 1JIQA 1ESDA 1H8ED 3ZVMA 4WDRA 4Q5IA 3IIIA 1VL5A 4Z2YA 1QFXA 1EUDB 4PSAA 2G5HB 3C6XA 1SURA 4NNPA 1C0LA 4FDVA 4UMFA 4C22A 3KALA 4W9NA 5KYXA 5L53A 4KWTA 3O8RA 4H4DA 2P90A 3QSGA 2ON6A 3CCFA 4L15A 2OO5C 3JQ9C 2V7BA 5AJTA 2BDTA 1A5AB 1NK6A 3L79A 1CQZA 5FNVF 4LQCA 1N8TA 3M1AA 4MKXA 4HK4A 4OHFA 2BE7A 3BA1A 4ZWNA 4NZNA 2I6QA 2DFDA 4FZMA 1R9GA 4OF4A 5IC4A 2JAQA 2I9KA 2X8AA 4ZYYA 2Q46A 4BUGA 4CQMD 1P44A 5CB4A 2Z58A 4WE3A 3PQDA 1XJQA 4ZPJA 3DQQA 5L1IA 1ZCJA 3INRA 3W1EA 1C1DB 2WWRA 4O1MA 3SAFA 4FONA 4DDUA 4WBSA 2JW5A 1WHTA 4RGQA 1TA0A 2Z04A 4J7AA 1T36A 3EW9A 5ALYA 5BR7A 4EFLA 3LPLA 4IOKA 4HXGA 1VHTA 2J6IA 2YZ2A 1KJIA 4L0MA 4B81A 3UPTA 1KYVA 3RBVA 3FUWA 3HXPA 5ECDA 1UXGA 1E5QA 4OAOA 2XIJA 3P0IA 4N5IX 5I7EA 5K0LA 6REQB 4KPGA 1XCOA 1EM8A 2BTQA 3K9FC 1VDMA 3SMVA 1JAZA 2I99A 5I7UA 4LOJA 4LXGA 5AT1A 1DJNA 3RFTA 1EFDN 1HH4A 3O92A 3DG9A 4CFYA 1L4EA 1EVIA 1YAHA 3V42A 4GR9A 2BGRA 2I2CA 1CUCA 4BFWA 1UFKA 2ZBQA 2JARA 1W94A 1U7OA 1UANA 4XDGA 3IR5A 3NMUF 1J8FA 4XB1A 5HRAA 2CJWB 3MJTA 4F4DA 2W2MA 5C1DA 3TQQA 4YMSA 4KPUB 4GM4A 1IH8A 3W7AA 1X7DA 4EPVA 4R31A 1I1NA 3OLXA 5A4KA 2O6HA 1KJZA 1PGJA 4QSHA 4CKEA 1SUPA 3P27A 5FBVB 1MT3A 1ZQGA 3GGOA 9ABPA 3ZIAA 3GVXA 1XWIA 4IFEA 4OK5A 3RTBA 4DUZB 2BMVA 3PBKA 4UEQA 2A1JB 2XE6A 5C5IA 1H4QA 1WF6A 2JIDA 4QASA 2PX2A 421PA 3OVMA 1LJLA 4GQBA 4N4AA 3FY4A 3PE3A 4HLDA 4JDPA 1ZG3A 1MZVA 2F77X 3RS4A 3R4CA 2YYAA 1MRNA 1IJEA 2WYUA 3PA8A 5IEBA 5E6SA 1V3VA 3EPIA 3ZS9A 3S4YA 2WYHA 1E94E 5DYTA 4FKMA 3CGWA 4RGBA 1XMVA 4N5NA 4AYWA 2XDWA 3THYA 3JQAD 5E38A 1FTWA 2DPLA 1R4ZA 8ADHA 3ACBA 1JQ3A 1E4YA 4MQ6A 1X77A 3VU9B 2C58A 2A0UA 1XPOA 3JQ7B 3OJEA 4ISBA 1D6JA 3IOYA 2RHWA 2I8CA 3H6HA 1MIOA 4D9BA 4B3DA 4O08A 1M2NA 5E3JA 4B87A 3VR3A 4YCMA 1QVAA 3PNOA 5ALEA 1U3FA 3H4IA 2JJ1A 1PR0A 5CBPB 1GPYA 1R5JA 2VUTA 5J2TA 1G16A 4KBGA 4FUQA 5K01A 2VEDA 1L5VA 4MEAA 3ZY6A 4RZSA 2QTRA 4WCVA 3N39C 4QLAA 4MR9A 3WI7A 5AVWA 3MPOA 3IN5A 3MTBA 2FSGA 1DCKA 1RWVA 4KK3A 5KB3A 3CPHA 1RWPA 2DB3A 1A76A 1QUEA 1GA6A 1YA4A 3VR6A 3OTQA 1E60A 1PG5A 2MSNA 2TMKA 1A7AA 4AM8A 5CPFA 4QHSA 4BE7B 2DGDA 1RZRA 4LW8A 16PKA 4E51A 2BHRA 3BULA 1DINA 1Q0ZA 1WXGA 2OR3A 1GVHA 1XU9A 4S12A 3MC1A 3HVJA 1OE0A 1C7IA 4RHUA 3BILA 2DY0A 2PLRA 2Z9BA 3A10A 1WQ1R 1XOIA 3CVUA 4X3CA 5A5VA 3SXJA 4RADA 2BJWA 4UEOA 2SHKA 2O54A 5L4LA 2H1LA 5CVDA 2H4FA 3WTCA 1RAEA 2FUCA 4ZZIA 3FTCA 3H5VA 1HORA 4OXQA 3RT9A 4Q45A 3E58A 1CUIA 1VJ5A 3RK1A 2MTBA 1P1IA 1V37A 2VK1A 1TO6A 3DE1X 1T9BA 4PPGA 2KHQA 2NU7A 4LVCA 1XQWA 4RA9B 4Z4HA 3UICA 1BMFD 4Z4FA 3N7RC 1FDTA 4KFCA 3LX4A 4AY2A 2JBAA 3L7DA 4GI7A 2VP2A 2GO7A 1L8XA 2BFPA 4R05A 1EUYA 1QVRA 1IM2A 4M6WB 5KC9A 4KO8A 2C82A 2UVWA 3T5KA 1W73A 2O2HA 3FTEA 5AUPB 2GCOB 1OB5A 3GRRA 1ZKDA 1BX3A 4OM8A 4JVLA 1D0SA 1GGHA 1TMKA 3N0TA 2H3VA 3THOA 1TOAA 2WWTA 4RGVA 4P5EA 2WUDA 4INOA 3HU2A 2P5SA 1R3UA 1Y8QB 1FYXA 4PTLA 3MF4A 1BZYA 1SZHA 4WESA 1JRPA 2XGPA 3C8DA 4BZPA 2B8JA 1AHPA 3D43A 1J7JA 3F0TA 2IUFA 1K7XB 1C9EA 3O7MA 4L4XA 4X6XA 4YBRA 1UP6A 2VAPA 4TURA 4QG7A 4QZGA 4OYYA 4HY3A 2JGRA 3V2HA 4YRZA 1TC2A 3TIVA 2ZRAA 5D2CA 1OXVA 4IWNA 2NU6B 1I36A 2ABWA 3HDTA 2YRFA 2C5EA 3AETA 3PVXA 5C3MA 3OX3A 4JR2A 4ZOLF 3HN2A 5FIUA 1TK3A 1NG9A 2DZDA 1MPXA 3LLCA 2KI5A 3JZAA 3IAS6 1KZYC 5TF0A 2ZAGA 5K05A 4PR3A 2AZMA 4NEHB 2FPLA 1MX5A 3O2JA 2P79A 2NWQA 1EKXA 1ZISA 1GXSB 3CZMA 1TUIA 3NRJA 2A0WA 2A2ZA 3UAYA 3DHYA 5D49A 1DPFA 4WY5A 5K8IA 3GJQA 2XVTA 1EUCB 4YAIA 2Z6AA 4BGDA 1SQ0A 3LLUA 3T1NA 1WETA 4KOAA 1NF8A 3LWLA 5FTLA 1JFVA 2P1RA 3Q9UA 4Y6SA 1NVWQ 5J0YA 4L5IA 2CC2A 3SX2A 5KTKA 1KMQA 2YUTA 3RAFC 3NIDB 3F7MA 4GECA 1PD1A 1S3IA 5AKEA 1Z6XA 3AVVA 2BKUA 5LNK1 4ZZ3A 5M3BA 4GKBA 4JEMA 1RVDA 2AZDA 5KO2A 2C4WA 4ETIA 9ICMA 4A6DA 1DO8A 1NUAA 2EAPA 1DELA 4URWR 9ICVA 1QU2A 2VR1A 2GBPA 4K2HA 5IJ0B 1BXKA 2JAPA 5GJCA 1CRWG 1OWPA 2J3HA 5GOZA 3UM9A 5BUQA 5J3JA 4JYCA 2FRDA 4J0JA 1D8TA 4MYDA 3A6ZA 4F6LA 5GIPE 1U11A 1U2GA 4UB1A 1LBTA 5IUNC 4BVGA 4Q48A 1XZPA 1NI4A 4B35A 5LB2A 1NRWA 1PJQA 2X7JA 1U4OA 4ND5A 4ZV7A 1FFCA 3PX7A 3ELUA 4WZAB 3KZIU 4FLEA 2AA3A 2NYUA 2QTMA 2AHOA 2HB6A 4B44A 1QHXA 2BFCA 3SYKA 3UANA 3B8EA 1G21A 2JI6A 3LRTA 2XICA 1BKSB 1WMFA 2GAAA 4OXRA 3R7WB 1X9XA 5DCLA 1OIXA 4ECSA 1HYEA 1DKMA 2VF2A 3ZJUA 5BSGA 3U4DA 1YF3A 2XRZA 1DRVA 5KT7A 3ER9A 3DAGA 3GEIA 3NOVA 2CPRA 2DHRA 1PP4A 3LV8A 4A0GA 2JFPA 4BMSA 3W3AH 2BMFA 5JTTA 3WK8A 1TYDE 4FGKA 3UBMA 1VIYA 4F2GA 4OP3A 3CH6A 3GD5A 1DP4A 3DKPA 4NIMA 2A3NA 3BF8A 1TQHA 1Z8HA 1L3VA 3BGVA 1JSRA 5G0WA 2ZBGA 3LW8A 2PBRA 3B5EA 5D6OA 1OI3A 2A9FA 3DEYX 4GFJA 1QS0B 2ODPA 1LNSA 4IV0A 2G0TA 3LWNA 1PRYA 4D3SA 4J9OA 5ULLA 3GFSA 5F4ZA 1EMDA 3HFGA 3ENVA 3U1TA 4JC8A 3IBFA 3B2EA 3N0RA 3JALB 1C3VA 3MYRA 4YMGA 1T2DA 2A5YB 3AVWA 2X19A 3QX3A 4JOCA 5BV2P 4F5PA 1J8DA 3L93A 3C3CA 4NDAA 3ZGLA 2AXEA 4UDOA 3TQIA 1Z56C 4K6OA 1M3SA 1XB2A 1SOWA 5FWNA 4UBLA 4LOKA 5ALUA 3TI7A 1SQSA 2QL9A 2QXUA 1T4BA 4W5WA 3QV1A 4AJOA 2E1PA 1NOKA 1JMYA 3TOSA 5G3YA 4ZRMA 1ISJA 4MJXA 4HDNA 3CP8A 2PR7A 2PD4A 3M4NA 2W00A 1CUXA 3LFUA 1ENPA 4RNOA 2CLKB 3MA0A 3W0LB 2OORA 4ZYLA 1QQAA 4H3VA 4J2HA 4JYZA 2Y9PB 1QIHA 4PC2A 2W03A 3KTAB 4WBNA 4US9A 3B2QA 1UKZA 2VG8A 3NS7A 1RM0A 5DM4A 1NIPA 4KMSA 4EQ6B 1XXLA 4TTQA 2OY0A 4AICA 4J6EA 1YVUA 4KE8A 4A92A 2X5OA 1W29A 1MTZA 2LWIA 4A8PA 3GT0A 3O0DA 1QAMA 1WY5A 1OMOA 1Z2EA 2L18A 2P3SA 3ZHOA 3P20A 4FCCA 4M9HA 2FXVA 4DFDA 4JV2A 4MULA 4OV6B 1ST2A 2G9QA 4IG4A 4H7IA 1NI5A 1FBNA 2HD4A 4PGXA 1YZVA 4FT4A 2ID7A 3G0HA 1P0PA 1VE7A 1ULBA 1ZQLA 2X9QA 1MAVA 4I1RA 4WINA 1O1YA 1TVMA 1J1ZA 2C29D 1EFPB 4HAXA 3DZCA 3ZGVA 2ODTX 4FI3C 3Q72A 4MWDA 5H81A 3O47A 3A3NA 1DHRA 1GTRA 1MB3A 4ZV4A 2B9VA 5KJ6A 2H52A 1NW7A 1PL8A 2FFJA 3WJ2A 3H17A 3DE2X 2DFKB 3FMFA 5FPHA 2H18A 1OT3A 4N6GA 1E9BA 3KEOA 1NJWA 4FIDA 4W9RA 1QP0A 2NU8A 1YDMA 5JYEA 4ZDJA 3ROZA 5EMNA 4U0KA 3T6KA 3LC2O 3CX7A 4PG4A 2KWIA 3EY9A 4I55A 4P31A 2YRWA 3RVOA 1HR0B 5CEHA 4TXNA 1PVVA 4RFLA 2FH5B 3ML1A 1P4HA 5FPSA 7ICLA 3IPRA 4KVGA 3GX1A 3ZU5A 3ISTA 3HY6A 4KQ6A 3DOOA 1IHUA 2O2IA 5ESDA 3GUHA 3G49A 4BQNA 1CNEA 4F5ZA 3D8BA 3DFUA 2RI6A 1UPAA 2R3SA 4WLVA 4KLNA 3PV8A 3WLQA 3UMSA 1H42A 2EKBA 1UR5A 5EKUA 4G0VA 4LF7B 1YR7A 4Q82A 3VXKA 2AFIE 4L0CA 1XPJA 4YYEA 1MG0A 2C7VA 1L7BA 1YQWA 4UTOA 4FN4A 4GMDA 2VF8A 1AKMA 2RK4A 1GLNA 1YQEA 4JLNA 5HIAA 5C80A 5JBIA 1SVNA 2WJPA 3CXRA 5LOVF 4DF4A 4FYVA 3LY8A 1P1KA 2M6RA 5D84A 1XD2B 2Y4OA 2FLKA 4QO7A 2ZK7A 3T5MA 3AUTA 1P33A 1H6AA 3KVRA 5EINA 4WLEA 1CUYA 1LC3A 2P2GA 2E1EA 1SUWA 4KVFA 2W3RA 2A3RA 4AVYA 2LZ0A 3OPYA 5DHSA 4YQEA 2VA3A 5BURA 2PJZA 3UYKA 4KXMA 3FSEA 1G5RA 5KPDA 1YAJA 4X1YA 1MVNA 5FEUA 4X45A 4EMSA 1USWA 3RYHA 4P4OA 1FP6A 2IDMA 4JZKA 5AI0A 5C8YB 1OX4B 4K6KA 5B2ZA 1V9CA 3CUWA 3BKWA 5FI0B 1ZQHA 3QVKA 4N7RA 5DYIA 3JRXA 1G3UA 4EP1A 2RBGA 4NX2A 3SKVA 3RBAA 4OFWA 3MFIA 4C07A 2IZ0A 2WFLB 2XUKA 4HGOA 1U2TA 4YRMA 3WGZA 3RSCA 2PKQO 2IOFK 3EZGA 2P6RA 3HJHA 3BM5A 1YVEI 3GJXC 5JADA 4GWGA 1YCFA 2MIIA 5BMVA 2GXSA 2AGPA 2PXXA 3G0IA 1ISHA 3N53A 1ZSNA 1BHSA 2RK3A 5L3VA 2VWGA 4DLYA 3IYLW 5HS6A 2I2BA 3W9BA 2F8TA 2AXPA 3TB6A 1TGYA 4M38A 1ZQDA 1AY0A 2I6GA 4ZQHA 2WZQA 2ZT5A 3K9GA 3W3ZB 4B9VA 4P34A 3AP3A 1DCMA 2CLFB 2W9BB 2OGTA 2VS1A 2AK3A 2FUKA 2K8AA 1AVTA 1KS2A 1OR8A 1YGYA 3CNEA 3HCPA 4JJAA 4R8UA 1Q84A 2X8WA 4QUJA 3PHIA 3I6ZA 1P4GA 2C7GA 1SCQA 1QOPB 4OQXA 3S2SA 5JJKA 3HFRA 4NENB 2ZTMA 4GZ5A 2JIQA 2HI0A 1PVDA 2DPIA 1CIVA 4ZT4A 2QP4A 5HHTA 4BDSA 2OYRA 4RVCA 3ROTA 2BEVA 1IXRA 2FN7A 2I5PO 4HFNA 1PTJC 2X8LA 3W3AD 4DWWA 4LF8B 4OBWA 2CYCA 4I2GA 4HQRA 1TK0A 5AXAA 2XMZA 1U0BB 1QO9A 2PMCA 4R3NA 4W5JA 1Y1RA 4R8RA 2YTZA 4FNMA 1AXEA 4LYJA 4D3XA 3FDSA 2NXWA 1E9DA 3DVAA 2FEXA 1T3NA 4C7MA 1E2JA 5BW6B 3HABA 1GT6A 1JLMA 3ZHZA 1HDXA 4RTPA 4YR0A 3HUFA 4HZGA 1LLQA 1I6KA 2X14A 1X15A 3ADOA 3PDWA 5K0ZA 3C97A 3CO0S 1L4NA 4ZTUB 4X63A 2FA9A 1G8YA 1KEPA 3SLGA 1JSXA 4B3BA 4PPQA 2BR5A 3OQJA 5F2EA 3RYCB 2WB2A 3ENWA 3RH4A 1CS0A 3BG5A 4E1VA 5JPIA 3PVCA 5AVJA 3QNMA 3EPKA 4P7FA 3HJNA 3V1TC 4EO4A 5KNBH 3IVRA 3PKZA 2EL7A 1T8TA 3BAZA 5AVYA 4YEDA 5EHGA 1N6LA 1WNTA 1RWWA 3AL0C 4MEYA 2HMXA 1X87A 5IYZA 4L2IB 3CLTD 2WHXA 2YVKA 5JMTA 3SE0A 3E3AA 3UTCA 3U5TA 5J0WA 3NRWA 5B6PA 1T5SA 3BWMA 4JKYA 3P94A 1KDVA 1O97D 5BWCA 4NAVA 5L3RA 3ZY4A 5HTKA 3COJA 2CVPA 3HO1A 2FNAA 4YRLA 2YBEA 4IDBA 3C7CB 8ICHA 1P4JA 3HZHA 1VIMA 4C8OA 4IDHA 5HF8A 4XUSA 4Z4IA 3ABOB 4YI5A 4NULA 4NNOA 1SVUA 3LS2A 2ZU0C 4CIDA 4HNVA 2JFNA 4Y0NA 1P39A 3FZQA 3JYPA 2HHLA 4IQ4A 2TRSB 3WGTA 4ARZB 3PFHA 2YJZA 2IYLD 3O8CA 4HFMA 1A2KC 1L8LA 1XC7A 2KMDA 4YHBA 2IHJA 5I9TA 5IP5A 2VT3A 3CUYA 1S89A 2HSEA 4PQYA 3ZK9A 3Q7EA 4QECA 3PHHA 1YWGO 1B41A 4C4RA 4YRBA 1PX0A 4WTOA 4ZCLA 5K3OA 1ONSA 3O8OA 5FOUA 3OQVA 1R0ZA 4MITA 4HDMB 9ICEA 5KX5F 1FP4A 5DNUA 2ASDA 2YRXA 3AKZA 3PR5B 2DG2A 3GH1A 3IH5A 1W4RA 2J07A 4ML3A 5DRTA 1E5DA 3C7TA 3KOYA 1EVKA 4I2CA 4MO9A 5CRXA 2C2MA 2B4TO 3ETNA 1VRWA 3VZPA 1Z83A 3N8HA 3FYUB 1Z4IA 3OLWA 1IUOA 2VXBA 3K30A 3OZDA 5IH3A 1I2ZA 4ZQBA 4NBVA 1T2CA 2Z6QA 4NE2A 5J2IA 4AY6A 1ZMRA 3HA7A 3H87A 4FW8A 3IXQA 2LKYA 1REQB 1DBIA 1R0SA 3BDAA 2HPAA 4CIYA 1M0WA 3OOYA 3K5PA 3R8XA 2WIFA 1JKXA 4BNTA 2NOAA 3NIWA 3DKVA 2HA6A 3FUXA 3H3FA 3CRMA 3OBBA 1ENOA 3AGQA 2QN9A 3YASA 4I29A 3AILA 2GR9A 3ZHTA 3W90A 1TXGA 4GOKA 2RAPA 1NLUA 1YFLA 4DL6A 3AF4A 1Q3TA 2XTJA 4X24A 4GLOA 2PKXA 5AJYA 1JZQA 2PD3A 1TJNA 3EXIB 4JB8A 1T94A 1N33B 3JSXA 4TSFA 4ECUA 1U04A 5JCOA 2OAQ1 4I5EA 2PLFA 3IEXA 1UT6A 2GBLC 1Y6JA 3AR8A 4R7TA 2R62A 4JJKA 2NV3A 2J87A 1O5TA 2J9ZB 4GC5A 1I30A 1LEHA 5B4VA 1NK4A 3NUGA 1FCJA 1CDOA 2N9UA 4QQRA 4UC0A 3PXBA 3SM9A 5JLJA 1X7YA 1EFVA 3I45A 3ZPXA 2EJTA 1K9SA 2VLIA 5EWLB 1SXQA 2YDXA 1UJ6A 2XIDA 1ZH6A 1UZMA 1PKXA 1ZVQA 1SKYE 1JQJC 4Y6QA 2UZ0A 4JXXA 3ZYZA 1S1CA 1ZIDA 3ZWWA 4F5RA 2B5OA 4FSDA 4J16C 3VZCA 3LT1A 1DKLA 1BGVA 2AR9A 4ECYA 1HF3A 2NPFA 2ZREA 5H80A 3A9TA 3CF4A 1ZUIA 5FOSA 5JVDA 4XD7D 3FFAA 3A1VA 3R4VA 1PSDA 3NW9A 1L4MA 4B2PA 1Z6PA 2PVSA 3BSWA 1SVIA 2QMEA 5B1SA 5MN6A 3MJVA 4YO8A 4EY4A 1XWWA 1NWCA 1C9MA 1G20B 2CXXA 1KI2A 1DKNA 4JLSA 3Q8MA 4RBNA 7ICMA 5F76A 2XPCA 3WHIA 2VP3A 7ICNA 3MT8A 2FDRA 2HMAA 3AM9A 4F7DA 4XX1A 3UW3A 2C7OA 1L5KA 3VVMA 1YZYA 1OZAA 4QBHA 5D1HA 1FNDA 1W1UA 1Q2UA 4JI0B 2EFDB 2O06A 3EEYA 5HK9A 2CF5A 3MUNA 1H1TA 5EMJA 1L4UA 4KMOA 3EA4A 2G9VA 4MS3A 3BUSA 3L7LA 4YRRA 2PT5A 3P8ZA 4LJSA 1JR3E 2OV3A 3TSYA 3AERB 1V6SA 1P3JA 5EA2A 1GUZA 1QH8B 3ODGA 5D7NA 1GZ4A 4HH3C 3T12A 3M1LA 1FYEA 4GVXA 2J08A 4IDNA 2FXIA 4ITRC 4QYSA 4UQLA 1ODTC 2H5JA 3RRMA 2Z3WA 1VJGA 3H5WA 2C9CA 5KHOC 2GI4A 1XA4A 3GJ6A 2ES4A 4F3TA 4ZEMA 2FOIA 1W2GA 1CP2A 4Z86A 2AW3A 2RHBA 1N2CE 2KJ5A 4F9GA 4S3MA 3GMIA 4MAAA 4KGVA 1N9ZA 3GVPA 4EB0A 3WK7A 2Y1CA 2WIBA 3SHOA 2E3TA 5EOZA 3FNGA 1MX1A 4YCDA 1SUBA 2YX1A 1N5KA 3EXEA 4DL5A 4BBPA 4ZDWA 1T9GR 4TS9A 1W88B 2M1XA 1CYDA 4W6ZA 2WPDD 1E0JA 5C81A 1LQTA 1U7ZA 1IVNA 3B9JA 1IBCA 2PR2A 2IYAA 4U4AA 3ZCPA 3Q0TA 3STXA 2PMDA 2VSFA 3RUFA 3PHJA 5IABA 4KLHA 3O73A 2HHTA 1HEIA 1I14A 1Y7PA 2JLAA 5ICMA 1YKFA 2BBOA 3OSZA 3UG7A 1TA9A 1VL0A 1IOLA 1P2GA 4GPBA 1EFTA 5E8RA 4P3KA 3B1VA 4YAEA 5H68A 1ED1A 2GZRA 5ARCA 1KIFA 4IJUA 3E6AA 2Z2IA 5KNBD 4UBIA 5IIIA 1V8OA 4FDUA 2GK7A 5AKIA 4OOEA 1SXJD 1PJ3A 4ZU6X 2Q0HA 2PRKA 1QLWA 5CA1F 4H35A 4F56A 2VBFA 2JFYA 3V72A 5JQGA 5HVNA 2J30A 5E6RB 1KDTA 5ITZA 4E4TA 3PJDA 1JP7A 2QZ4A 2BGWA 3P9ZA 1H2WA 1DTEA 2G4CA 4QDXA 2IHKA 1II8B 1YC5A 1IK6A 2O8EB 1SV0A 2BEWB 2VC2B 3ZLTA 1R4MA 3ACCA 1RJFA 5B55A 3ICCA 1DFIA 1Z6GA 3VFDA 3IQEA 3GCGA 1VA4A 1Q7CA 5LQDA 4IR1A 2Y67A 3HYCA 4IINA 2ASEA 3EASA 2WTAA 2WWHA 2OKCA 4RTKA 1CKEA 2O20A 3CY6A 2C2RA 5CM2Z 5JJIA 2I78A 1G4UR 1NC3A 3L6RA 4E5DA 2JMGA 5DTEA 1U9IC 5ECGC 9ICPA 2R8HA 3P2JA 2R60A 3KYCA 1N3YA 1UKCA 3PNSA 2A9PA 1I33A 4JBLA 2E8MA 4QRHA 1AROP 1CV2A 3K9BA 2PO5A 3TEMA 4UVEA 4JT8A 1YIDA 4UU8A 4EAAA 3N2ZB 2YNMD 2Y1IA 4E46A 3GLGA 2D6FA 3LYAA 4MV0A 1JILA 4HOYA 4ZO6A 1MQSA 1G5PA 3UBTA 3CIOA 4OHRA 5F3WB 2VJCA 4JMUA 1IBKB 2GN8A 2O2YA 1UDBA 1PJ8A 3G2LA 4C80A 3DBHB 4RANA 3CV3A 2B25A 3TJRA 4HDQB 3QY9A 4LSWA 2CL7X 3CNNA 2C0CA 4XIJA 3LIPA 4BQOA 2FPPB 2GEVA 5I7WA 1H66A 2ZDGA 4DZRA 2JRLA 4WWHA 1ZJNA 2RJOA 3R3ZA 2FX3A 2ZIGA 1S0UA 4TTPA 1C0IA 4LJ5A 4P2GA 5IIKA 1UDWA 1XWLA 1SR8A 5AD1A 2PGOA 4U9IS 1SAYA 5AESA 4DDMA 5FH9A 4QRIA 1NBHA 2W9CB 1FMFA 1OKKD 5CFLA 2I6TA 1Z0JA 3LXUX 2CGEA 1E7WA 4S35A 2OUIA 4QPDA 1Z47A 7ABPA 3T9FA 8ABPA 3DE4X 1F12A 1RHUA 3OFSA 2JH8A 1YKSA 3U61B 1K92A 2ZXEA 5FV7A 3EBLA 3C39A 4TYMA 2QU8A 3WGQA 1DXOA 5EHQA 1XPUA 2QXTA 3U7QA 3UATA 1QM5A 2JXJA 4LF9B 4ALKA 8ICMA 1EWVA 5J5CA 4BJ5A 3WL4A 1GEGA 4DCSA 3LDAA 2OSVA 5DM70 1E3QA 2CV1A 3K9LA 3STTA 1R74A 2GESA 2R65A 3QA3E 2X5XA 3TR0A 2VYVA 2GPSA 3ADKA 4BV3A 1T8PA 3TJZA 2V6BA 1WHSA 3HPRA 3GLTA 4U8GA 1E7RA 1PR5A 3LBAA 4UZEA 1CC1S 1MAAA 1VE9A 4NKRA 4F6RB 4RT2A 4HSEA 4V24A 2CLLB 2OHOA 3EGXA 4MRRA 4P3PA 2YHIA 3F74A 3JARA 3E23A 4LHZA 5HZGA 3UUWA 2QMQA 1Y3CE 2QHXA 4CLXA 5B7NA 5KI6A 1U1EA 3ZTTA 1NQTA 3O3NB 4D92A 3T7IA 4E31A 1ZQSA 9ICBA 1FJXA 2VTKA 4MGZR 3MBIA 1H38A 2C4MA 3OQ1A 3RK0A 3GVIA 1OHHD 2ECKA 5C8ZA 2TS1A 3VKHA 2LP4Y 5LCXA 3M8KA 3NWJA 5G53C 4N48A 4RM2A 2EJCA 1T91A 4YS6A 2RK6A 5DV9A 3TNDA 4MUIA 3ZY3A 2GPAA 1KZ7B 4YDSA 5KOYA 2AG6A 4OYHA 3EWSA 4WNAA 1JIUA 1CZLA 1T25A 2BI4A 5EZQA 5KNIA 1SZCA 5HGXA 2GCEA 3NEAA 1VLBA 3M1IA 2V9ZA 4UQOA 2XYVA 2BONA 5F7JA 3HV2A 4HN4B 2ISPA 2GKSA 3LTEA 3NV9A 1KJQA 3LQYA 4IXMA 1JI7A 1XMIA 3WQQA 2PS1A 4M9UA 3AM4A 5JAZA 1HUQA 3ITKA 1RRFA 5JCJA 1R64A 3KLPX 2INGX 1AKNA 2QK4A 3COSA 4YJKA 4P4GA 2DX7A 3A4VA 5EP1A 5CB6A 1Z33A 3P0RA 2I3AA 2HDWA 5HEKA 4W9NC 1B0PA 2WSMA 4WV3A 4EYOA 4BV2A 3I42A 3UAZA 2FLVA 2YXNA 5FLYA 1AOXA 3JPSA 5F7ZA 2IP2A 5CT6A 5A5EA 4MWEA 2VCHA 4F1KA 3LPAA 1DAMA 1RG6A 1X6JA 3TG2A 3N2YA 3O8BA 3ES9A 5J0QA 2Q3MA 3PC4A 4RTLA 1FYDA 3SY8A 5FHRA 4MCHA 1UINA 2XRYA 4BBZA 4GVPA 5FNVB 5EZSA 4KLGA 4HB2A 2OA0A 1LU9A 4GOMD 5EUCA 5CVJA 4B6EA 1BMTA 1S2NA 1XLVA 1JE0A 1JMKC 1TFUA 4XGRA 5FL3A 3HHPA 5SY4A 3WGJA 1F9EA 5DDMA 3QEMB 3FCOA 4M1KA 4JGGA 3KJGA 3RTGA 1QH1B 1XRLA 3A0RB 3VNSA 2D2EA 1CZUA 3QITA 2B83A 4RSHA 4C0BA 1WR8A 4KPYA 1HA3A 1M2VB 2W8BB 1ZMBA 3IJ5A 4C3UA 1ZVJA 4UUQA 1SQFA 5ESWA 2QNRA 1TIBA 1FBTA 3HDYA 2GB4A 1ZM7A 1M1XB 2CK3A 3QVVA 3QOXA 3TTSA 2ZOSA 4UVDA 3WB0A 1JPNA 4TS3A 2XYGA 1J20A 3TRFA 1T1IA 4D2IA 3F9IA 4PGMA 3RT7A 3S81A 1LY1A 4JA2A 1ZJZA 3G1TA 4NHOA 2KW5A 1OA1A 1Y9EA 3U80A 3DOFA 3E3LA 3HGQA 5LB4A 2ID9A 2RMKA 2I22A 3T7AA 2F4VB 5ERGB 3QEAZ 2Q3LA 3L8MA 2XKAA 1L9KA 1NUPA 3SCZA 1IHXA 1Y6ZA 1EE2A 2Q99A 3EG9B 3RTVA 1BJTA 3K8QA 5GIOE 3A4MA 1UOOA 4IPTA 1E6LA 5ALJA 1XKTA 4MUYA 3T7TA 1LLUA 1DC7A 4MS1A 2NVOA 1ZX1A 2KJ9A 1NTOA 5LZ4A 1K1QA 4IDCA 2B8WA 4P08A 4WIAA 3B1XA 4LQ4A 4DSOA 1W7AA 1UBKS 3N76A 5IBQA 1CETA 3GWGA 4G4SP 4DQPA 2UU9B 2VOEA 5LQNA 1JXEA 2OCAA 3SHQA 2BP7A 4MWCA 5D7BA 1XLWA 1JFTA 2F8KA 4PG8A 4C2UA 3W4KA 2ZSAA 4GKVA 4MIKA 4X20B 4GIBA 1F6DA 3CH4B 2CLHB 3KDSE 4YAKA 3WNQA 2W93A 4MV1A 4ZT3A 2K4MA 3REGA 2Y1KA 3E15A 4ANFA 4RTMA 3LQFA 5AJXA 3FF4A 4BU0A 2B92A 1EP1B 2C42A 5A5GA 4IXDA 1JGTA 1XSEA 4YIKA 1X9MA 1KFBB 1SY7A 4F5EA 2FUG6 3IP7A 3VPXA 4QDOA 4Q9NA 2AYZA 5FUXA 2QMOA 3L7BA 1NN0A 3C3KA 3KFVA 2GBCA 4FEYA 3F96A 4ER6A 2RIPA 4M0DA 1SL1A 2V9PA 1N7IA 4BOYA 2FWBA 4M8NE 3SMQA 3WWPA 3BQTA 1EYZA 1NQ5A 3C3EA 1F3LA 4C0XA 2Z5LA 3OA2A 2IY8A 4WRRA 2OHXA 3PQ7A 5CLIA 4B7CA 4E2XA 3FKSD 2I0FA 3ZE8A 4LJLA 2BGJA 3KQWA 4O2LA 4QQNA 5G02A 4WOCA 4YMTA 3KXKA 3A1SA 3P52A 2VHUA 1A69A 4P3XA 3A2NA 3Q8RB 2FPMA 1IVSA 4BUZA 3HYRA 4ZCSA 3VKGA 1DG3A 5G0UA 4DQUA 3MJ4A 1JG4A 3PYLA 4BY9E 3X1KA 5JSQA 4I9HA 1JXMA 4OIMA 1B6GA 3LPDA 3VSBA 2QZJA 3DO6A 1BDMA 3DBRA 2KBEA 2R86A 1I80A 1FZTA 2BDPA 4FYMA 4X1IA 2REQA 4DQSA 3VKWA 1IN7A 1N60A 1U3VA 1URJA 3Q5DA 4UXHA 2GA9A 1KYQA 1PS8A 2LW7A 1FX0A 3KD3A 1XQ9A 4BVBA 4KAXA 1Z07A 3H2BA 2HBJA 1AGYA 4NV0A 2G5GX 4J9MA 4RJIA 5JSYA 2IHTA 2CN1A 4B7XA 2IYZA 2VA8A 3HGTA 5DOZA 3DTVB 5KG5A 3FFTA 4PS0A 3WA7A 4BEBA 4YV2A 2QRKA 2ZTSA 2MRLA 4I6GA 2NVBA 1WBBA 1KVQA 4O2RA 2PRZA 4Q43A 1Q92A 1QUFA 1XZEA 3F4BA 1CF4A 3CNQS 2WWYA 3A6LA 1DDIA 4OBXA 4QELA 4C8KA 4LF4B 4JSRA 3D3KA 2MSEB 4A6EA 1V8ZA 3OM8A 4MV7A 3JZIA 3VHLB 3DF7A 4Z5XA 1DUIA 4KQXA 2HBZA 2HEGA 2Z43A 4XCXA 3ALRA 2YMQA 1XWFA 4Y98A 2WAXA 4DN6A 2WHPB 4GMXA 4Z4EA 5DLQC 5BYKA 4KUHA 4LHWA 3KAJA 2Q7XA 2JGFA 2Z4SA 5EXSA 3BMQA 4PWYA 4H7HA 4PHFA 3VHXB 2DLCX 3E3NA 1J8MF 5EIAA 4B3HA 2JCYA 4EBDA 4W1SA 2XW6A 4X84A 5COQA 3PEEA 3IMGA 1A9XB 8ICQA 5EESA 4C4OA 1CI4A 3TL3A 4DIMA 2P7IA 5K3FB 1QC5A 2R7NA 8ICUA 1N25A 4GMGA 1WYGA 1IRIA 1FL9A 4QVIA 5KSWB 3IT0A 4FFWA 3U31A 2RJ3A 1R8XA 1E79A 1VL1A 5FFFA 4M1SA 5ENVA 1Y7LA 4EHHA 3S1LA 4KW7A 4NCJA 2ENWA 4KTTE 2HFJA 2GPYA 4K9RA 4B84A 2ZUEA 3MWEB 3VO9A 5LC1A 4K9QA 4ZO4A 5BPCA 1X6IA 1VL8A 1X7ZB 1YZHA 1P6UA 2PUJA 2NZUG 2Y9MB 4AX8A 3MN1A 1PL7A 2XXBA 4ZOLB 3F4LA 5I7SA 5CT9A 1W30A 2V6MA 4Z6FA 2JI7A 2XZTA 3V6MA 3BRCA 3EIOA 5JZBA 1NVAA 1KQPA 1E2QA 3TLBA 5SV2A 3LF2A 2OO3A 2V5UA 3CEAA 1E5LA 1JXOA 1S10A 2WZBA 1XCGB 4I4TA 1YL7A 2BFMA 3ETRA 2KE7A 1JYEA 3ZK7A 1TTPB 3OU2A 2Y77A 2QARA 4F5QA 4P3YA 4ATNA 4FSHA 4RF3A 3M6XA 1QQTA 3H1PA 4R7GA 4B8WA 2Y6VA 2ODBA 2I03A 4HR7A 2W2OA 4A1OA 3L77A 3VX4A 1GNVA 1IM5A 4FXOA 3JVIA 1ID1A 2XUDA 3T7RA 2WMOB 1GRQA 1JG1A 4MR8B 2ES6A 1GPWB 4HNAB 1DHTA 1SCKA 2ZPTX 1NYLA 3I12A 1F8UA 1FUYB 1DQZA 1R9NA 3N1UA 3RVRA 3NEYA 2YB4A 2P4EA 1AGXA 1KJWA 3PNMA 3I09A 1ZC4A 3IBGA 1E2LA 2FRDC 1U5BA 4XASA 3K0HA 4CM8B 1U2GC 1YZLA 3P5BA 2CHVA 1NHGA 6LDHA 3NBMA 3RJMA 2NVUA 5AVTA 1BWSA 5AKKA 4QVKA 2O4UX 5LQKA 3DEIA 1H23A 4KLTA 3QX8A 9ICTA 3NX4A 4OGWA 4U3JA 2WG0A 4EO9A 1E2EA 2EJBA 4PWZA 1IDN1 2XQVA 4PO9A 3DQZA 3CIFA 3V4SA 1JDJA 1YK1A 3S6JA 2EF1A 3N8IA 4UTXA 2X4DA 5M04A 4Z0NA 1N1MA 3GLIE 3LQRA 2FCRA 4IKOA 2PV7A 3Q3VA 4D4IA 2Z9CA 5A4JA 4C04A 4AF8A 1A0OA 2ROQA 1P18A 4GDMA 3RB0A 4EUNA 1SJ9A 1JAYA 4GUAA 4OK3A 1J9ZA 4QBTA 3L4JA 4MIEA 1U2QA 3THWB 4D4MA 5DYWA 2GJ8A 4ZOAA 5DVZA 3THSA 2A92A 1V97A 1E18A 1U9CA 2EX4A 3HP6A 5KQMA 4Z6KA 3AHGA 4M54A 1CEXA 5I9BA 2R87A 1Q0PA 3L4PA 1T24A 1SFRA 2EG9A 3IKVA 1FRVA 5JAMA 3FJOA 1NVVR 5JDCA 3WFJA 3NTUA 3ZQUA 9ICFA 3N28A 4Q02A 3NPAA 5TQ2B 4RDCA 3FTPA 3ECAA 4EHFA 1SBZA 2HWXA 5ES4B 4QOGA 4RE5A 4ZN6A 2FSFA 3RVDA 4NLKA 1ZN7A 4AURA 4JLUA 2GVZC 2OWOA 5KQPA 3TLMA 3B51X 5CIQA 3PHBE 3X0DA 2VVTA 2PTHA 2BBSA 4ZVTA 3DZBA 5HQJA 3TRJA 1JHZA 3A36A 4DLNA 4EFDA 3NB0A 3PDHA 5EHNA 5KDOA 1U0SY 3LGAA 5DW0A 2OORC 1WB4A 1B3RA 1Z6AA 1V5FA 3ECSA 3SQWA 1SHLA 5GOTA 3T94A 1Z4MA 3ZV6A 1E96A 1N5OX 4RS3A 2M1ZA 4BLSA 3WRVA 1QWSA 5CXQA 1Z39A 3VKFA 4YXWA 2V96A 4GU5A 4QYIB 1F6WA 4RPGA 2C7RA 2WDPA 5L3QA 4US2R 2OBNA 4K03A 4ZVOA 1X8JA 5CYFA 1B2LA 3IKJA 4EA9A 3DZFA 4D1YA 2HK6A 4WI1A 1XEAA 4OHUA 1E2IA 5EJ2A 1JKJB 2WJAA 1J1IA 5AW0A 2G25A 4AG3A 1XEXA 2QN3A 5CYPA 4F5YA 2JHDA 4CN9A 4IR7A 4HGNA 2PDAA 1JSZA 1S02A 2QE7A 1G4AE 3RIMA 3TL2A 5B1DA 1X8LA 3UXMA 2HWYA 4JQSA 4MHSA 1KAMA 3H2JA 2Q9BA 2NXJA 4QLOA 1GFIA 2FP3A 5E7IA 2LE0A 3BGWA 4ASUD 2IYRA 3SYNA 5CG2A 4E88A 2W6QA 5TPZD 3PVZA 1A0PA 1FVOA 2O2EA 4OMCA 1Y4ZA 1AQ6A 4KO4S 1SCIA 2HHXA 1FSSA 3ZBUA 1AUQA 3ZHBA 4XYEA 2KTQA 4GQIA 3P9CA 1MO3A 5CVVA 3RVNA 2PUVA 3VPFA 1PD0A 5F35A 1SA0A 1ONBA 4L28A 1H05A 1E7MA 2HCBA 3ZJYA 3G2OA 2WIKA 1BXGB 3OTIA 3ZWDA 2YB1A 3MFQA 3AR9A 4FLFA 4YJ3A 5LJIA 4HUQB 5MN5A 4XYLA 4A2QA 5ADHA 1XSNA 2ZRPA 3EZ2A 2CNWA 4MWGA 1T15A 4KLJA 2CD7A 2XQGA 5LPNA 1TEHA 1T9HA 5A71A 3TK1A 3MTJA 4GZ6A 2IS6A 1ISRA 4D99A 2DFLA 1XALA 1LRLA 3PFWO 4W7SA 1KVSA 1Y5IA 3KQSA 1QIMA 1UJNA 3UJPA 2B4RO 4EA8A 2ASJA 1XAGA 2E55A 4DBLC 1EWTA 5E4TA 5GVRA 1NFQA 4FQ5A 5ECWA 4JI5B 2FP4B 2D5LA 1HKHA 1WX1A 3GZFA 1AUXA 3F8SA 1ADFA 4TMWA 4BUCA 3C5HA 4DZZA 4OJOA 5AW1A 1HEYA 2V7WA 1J33A 2DY1A 2WEKA 4M8SA 2VWPA 1QONA 4CU5A 4QUHA 2X3UA 5AI8A 5FOXA 4JHLA 3N05A 3A9UA 1FW8A 2YMLA 1AIPA 3C6MA 3PNCA 3GK3A 3X1DA 2C2ZA 4O3PA 5LOVB 4CEHB 3V8VA 1HSOA 3WBKA 4FFRA 2EDAA 1YH3A 2B30A 4IHJA 2QJTA 4JI8B 4RORA 4TSKA 4YX9A 5TJHA 2OBLA 1MJGM 3BMOB 4B0OA 2Q1UA 4C0QC 3MABA 1OJ7A 3CN7A 1KFDA 4PZZA 5A6SB 1Q11A 5DCWA 1G8HA 4RFSB 1DIAA 2ZJ6A 2OKGA 1I0IA 3TS1A 4IMJB 2JFWA 3QENA 1RXCA 4MW7A 1FS6A 4HAWA 4PPFA 5EY5B 4EA6A 4JI7B 2ORVA 3ZLJA 3Q8XB 3EIUA 2QTLA 5KG1A 4OLHA 5J0SA 4FYIA 2GTHA 1H2AS 4EGCB 2R1VA 2IV7A 2UUOA 3K8YA 1ZOOA 2RIRA 3TN7A 4KDCA 3EVFA 4TOIA 1YE8A 2BZ0A 1ZL0A 3Q11A 2XGGA 3KWLA 1VIAA 5TPWB 4R1TA 1AV7A 5L3ZA 2ZJYA 1BDHA 1N3IA 3L6UA 2RDIA 4RMJA 5DSTA 3WLPA 3IAXA 3ZWQA 1COKA 2A9RA 2F6RA 3QJYA 5AUNB 4QIWC 3BWYA 1F4LA 2FKNA 4GOND 4LRQA 2O6LA 4RXTA 2FE9A 4TPKA 4WH0A 1VP3A 3RVPA 3ISCA 5ALTA 2PUTA 1VKJA 4OUDB 3HA3A 3O4RA 5K0EA 1EAMA 1QLHA 1N6IA 5F1KA 5DKWA 4L0DA 3BTSA 5M2QA 3M2TA 4LRWA 1TIKA 8ICGA 5KG4A 3Q8KA 2AXNA 2I7VA 1J2TA 4L5AA 3AVOA 3CUKA 4EEZA 1LKZA 4PNEA 1S8FA 1P2VA 2EZ9A 1ESMA 5BSRA 2ZW9A 1ZQKA 4PIVA 2DH6A 1D9ZA 1U7TA 3L4EA 2BCUA 1IXRC 2VOJA 1SHZA 3O90A 4JB0A 4RA6A 2EBFX 5ENDA 4K40A 4MA5A 4TV9A 2NGRA 4DLAA 5CX1B 3IUMA 4BJ3A 2IXAA 1LQ2A 3PUKA 3P9SA 3OZBA 2VRCD 3R3WA 5DWQA 2W8LA 4PN3A 1VDZA 3L1KA 4MUHA 1P3DA 4TMTA 1DTWB 1WRBA 1QK3A 4R84A 4BN4A 1U0RA 5AVRA 1G64A 4OMDA 2Q3BA 2XUPA 4XWYA 1FX1A 2JGDA 2QBYB 4UUAA 1PF7E 2YV1A 1DBQA 5L1LA 2GF0A 1IE3A 1F4VA 1E3IA 2XRMA 5DM2A 3HV0A 2V7PA 4Q3LA 1E4VA 4GZ3A 2BT4A 4AJIA 1JDNA 1SU6A 1OYWA 3AESA 4FMBB 3C8ZA 3KPVA 4Q21A 2Z7JA 2JLBA 3FLEA 1PJAA 3NHZA 5FUYA 4MQLA 4CTNA 4ICIA 3U3MA 4PZUA 4DSIA 4CKZA 5IPFA 4P5DA 3RBEA 4Q4HA 4ZPXA 4X1OA 4PLCA 5DKFA 4LYFA 2HC9A 2OMEA 3OX1A 1MCZA 1E6CA 4PX3A 4AIIA 4TTAA 2SICE 2XY4A 4RVUA 3D0QA 2H2IA 4BFZA 1SGGA 2IEZA 3WGHA 2W90A 1L3UA 1G7TA 3U3RA 3TFQA 4QZVA 5E79U 2DPXA 5J1SB 3KKQA 3CZ4A 1KFKB 4W5HA 4LY9A 1AQJA 4ABTA 3K0BA 4QZBA 2RJNA 3JAWB 1QE0A 4KWEA 1V5IA 5JZSA 2QIPA 2ZB4A 2XCUA 2Y0CA 3ZC3A 4JUZA 1RYDA 4A1FA 4HI0E 4GPTA 4B3FX 2CUNA 3B0YA 1VE6A 2BJHA 1BXRA 4LCJA 3GRVA 2X1VA 2ATEA 3U7RA 5LR6A 5IKEA 4B71A 4YT8A 3BOSA 5B36A 1Q1NA 1PNVA 2CY0A 4QJFB 3UFXB 1AKWA 5L4SA 1T4CA 1YVRA 3O26A 4NOLA 1NQVA 2AD1A 2BR4A 1A9ZA 4IDDA 4MI6A 3D6VA 3H8MA 2IW1A 4RDXA 3UA3A 2JEGA 3IHTA 1NJ2A 3ECCA 4I3HA 2W6ID 1Y3DE 3ODPA 2XWQA 3ROGA 3N6VA 1IBRA 1HNNA 4JVNA 4D97A 2PA0A 5KX5B 1N63A 5TNXA 5KYVA 3NAMA 4FE3A 2R8KA 1WU7A 3Q1KA 3N0XA 3S5JA 1K4MA 2I5HA 4JC5A 1JFRA 5AI4A 4J9PA 4HDOB 4PYLA 1W19A 4DVGA 1HDEA 4WLNA 3KRTA 3WNZA 4F97A 5E95A 5K3CA 5KWEA 4PVDA 1UEJA 1PZMA 4R1MA 2GZ3A 1AT1A 1U9LA 1RJEA 3LKVA 1YRBA 4DCJA 5ARDA 4KLOA 2YHUA 2FG7C 4JYPA 3KDAA 2GO1A 2LMRA 3R74A 2OLJA 2RH9B 4JUIA 5EI5A 1JDPA 5HKBA 1LK5A 1FMLA 1ZQZA 1WOMA 1PQYA 1JF8A 1WWVA 1KMNA 1V16A 2AQ8A 3TX2A 4OKIA 2ACKA 5GVSA 2R6FA 1PT9A 3R7FA 3ZWCA 4EVRA 5KNCH 2XVYA 1I1HA 4QWCA 1C8LA 3CG0A 4KL8S 2NUAB 4DILA 4P35A 3HFSA 3JVVA 5JCOC 1GTVA 1KI9A 2YZKA 1SB3C 1YJQA 2I4LA 2I29A 1MN6A 2FAXA 3LQQA 4LVUA 3QJ5A 2QR3A 5DCUA 1ZMTA 4W99A 4LEIA 4N01A 3HLKA 3EZ9A 1C7JA 3VR5H 5BUCA 2P9FA 2OVBA 3HVUA 1OPRA 5HDQA 2OILA 1WMAA 4NMXB 4I2EA 2J7PD 3AQFA 3OZCA 3G88A 5E0OA 2K7ZA 3AR7A 4M87A 1SXPA 1YDGA 1T0UA 4XB2A 2O3RA 4C3ZA 3HR8A 3G5LA 3PDJA 2X4IA 2PUDA 4TN5A 9ICIA 3DYIA 4ID3A 4I8DA 4L8WB 1K63A 1W4CA 5KFQA 1IN4A 2IYYA 1T9DA 1IONA 3R7BA 1HYQA 3JW8A 4C6SA 3EE6A 3BCHA 3QK7A 1V5EA 5GV7A 3NBZC 3WMFA 4P7BA 3R6TA 2NZWA 5E3IA 4CLDA 1ID8A 4MEJA 1UPUA 3AXTA 3BJEA 2OG1A 4EHLA 4Q01A 4JP8A 4C5CA 1JAIA 4H60A 3FA2A 3BRWD 1VKOA 1M10A 1SCUA 1T2UA 2JZBA 1HFKA 3ABQB 4R2IA 1GOTA 1GTJ1 2QPTA 2YOHA 3RABA 3Q8SB 2SKDA 3TPCA 5BSTA 3KNZA 3VU8A 3TINA 2P75A 1Q3UA 2V4RA 1OUMA 4IXTA 1KI1A 2Q49A 3K0AA 1WSWA 1GGNA 3NFYA 3W06A 5JLAA 3PNKA 4CXMA 3O3OB 3HKEA 2K8CB 2ZJ5A 4HF7A 3NJ8A 3AHIA 5CAEA 4HZUB 5CRIA 4TTSA 4ZAYA 5IMSA 3P2MA 1K7YA 4XEHA 1I4DD 3V8PA 4F2SA 4IJQA 5C46F 3S7TA 3LZ6A 3L8DA 3EG5A 1Y8RA 4CR6A 2E5LB 1LX7A 1E9EA 5EXDA 5KVQA 3OEHD 5DT9A 4G86A 2Z0MA 5AI6A 2ATIA 3GZTB 3E9MA 4G25A 3FSGA 4M22A 3MILA 3D7RA 4E4RA 2B21A 3I8XA 3BFPA 3OOHA 5DSZA 5M34A 1OU4A 5LD2C 4OHXA 2QSYA 3LK6A 4RQNA 2WBLC 2GD6A 4HSGA 3R7NA 3O3MB 2OESA 4UEWA 1SELA 4QOSA 1I13A 4GXRA 1M33A 1GHTA 2ODEA 4H6XA 2IS1A 3C5EA 1A88A 2D0OB 5K5EA 3N0WA 1RI2A 4MGKR 4G89A 2Y1JA 4HLQB 2XWJI 2ZIWB 1YZGA 4YQYA 1RADA 4FQ8A 1GSIA 1JHRA 5DTIA 1UMCB 3VO8A 1L7AA 3PP8A 3RGWS 2GLEA 2QVXX 3OSUA 4Q6WA 4LC9A 2QQ0A 1NVGA 4MYCA 3JD4A 2C4UA 4K5QA 1NMSA 5LDHA 4HTFB 5BN1A 3P9YA 1BE1A 1ZQYA 2JFGA 2Z3VA 1ISFA 1XRMA 1ZGZA 2C4VA 3AFNA 1JQEA 3HKCB 1MP0A 3EPHA 4YRKA 3D2LA 4LYGA 2XNJA 2FK8A 1SKSA 4FZRA 2CHGA 1AKEA 3E7DA 1WXIA 4AO8A 3TIGA 1PZNA 3ILYA 2XXJA 4UZFA 4YCJA 4AXXA 4JVOA 4R40A 1H93A 4WCFA 3WB9A 2AG8A 4R83A 4CKCA 2B7BA 1W52X 4ZYVA 4PAOA 1Y98A 3I01M 1Z00B 2OHGA 1HDCA 5COBA 3PCTA 1U5CA 4J76A 5CA1B 4YVZA 3QG1A 4HEA1 2CXRA 1YUMA 1K06A 2YFHA 3K70C 2JG3A 1SV0C 1OYOA 3HMKA 4JVMA 4G0QA 1GZVA 3QXCA 3EFOA 2BM8A 4HDKB 3R40A 1Q1AA 4YO7A 1WQ3A 1UZAA 4QOIA 3W7VA 1P5ZB 4F86A 2PU7A 1IHPA 1OBVA 3BHNA 4C05A 4ELUA 4Q3CA 3UNXA 4GP9A 4HWSA 4P5PA 2C07A 1NJ6A 2XO7A 1D1SA 2XMDA 4UUBA 2QR2A 4NY1A 2B4KA 4UTVA 3AHFA 1YA6A 2AU0A 5JJBA 2PS0A 1D3AA 2YQ4A 3LP5A 4IRUB 2G5CA 1U3CA 2X42A 4BO8A 4YJ2A 3H4VA 5CP8A 2HBMA 1WTAA 1OPXA 3NH6A 4A8TA 4R16A 2VATA 2L69A 3HXKA 3BIOA 2E4XA 4PX5A 2D6FC 2XB9A 4MK4A 2GEBA 1U1IA 2EKZA 3VKVA 5FLKA 3GELA 3UWOA 4LMAA 1QAQA 2R18A 3AIOA 2OGWA 2GH1A 1CR1A 3OQ6A 4U9HS 4NOJA 3SG0A 1RCUA 1X74A 3T1OA 1G7RA 3B1KA 5F3RA 5ESRA 4BZWA 4FQ7A 5DGHA 1IB6A 7ICIA 3RRFA 1Q22A 4KYUA 1E0DA 1Q50A 2H92A 1GCIA 4RQMA 3QU9A 2IHUA 4IZ6A 2FE1A 1SQ6A 2W2XA 1SM4A 3NXSA 4UTNA 1K97A 1KK0A 1US8A 3ESYA 4JR1A 2J4FA 3COVA 2O2SA 4F4KA 1SHKA 3V8MA 1NW3A 2WC1A 2EH9A 2I71A 4E4YA 3RJZA 3Q3JB 3KXIA 1EG7A 4QHTA 2BM1A 4NS4A 3OLQA 3LL7A 3DFZA 1T35A 3W77A 1FUEA 1OSNA 3UXOA 2X5NA 3S2ZA 4GPIB 3AW9A 3X1WA 2WB4A 4GOLD 3QXSA 1BS1A 1NVEA 5K8TA 2HF9A 4KXUA 1HC7A 3PHGA 4BP8A 4JB2A 3AYXB 1SOUA 4WZBB 2VF5X 2Z5GA 1DJLA 4MP3A 1MNQA 3OCCA 3P97A 4NCBA 4CL2A 1J24A 2E0IA 2NT4A 2FMSA 4HXYA 5KNCD 5FTWA 3V33A 2PNJA 3UFBA 3QU7A 4Q9JA 4U00A 1JIXA 4M9SA 1IG3A 4MCAA 1TUBA 3T1YB 3E61A 3ZWNA 1PZEA 4P4SB 2J67A 3KELA 3ERCA 2AOTB 2CDNA 2HUPA 3SU8A 4GEKA 2M9MA 1T6NA 2FN4A 2IBSA 3VR5D 4ZQIA 2C8LA 4CJXA 2QW8A 4I1OA 5J2KA 2ZFUA 1NBMD 4TS4A 1SVWA 2XA2A 4Y2UA 1YCGA 1WUIS 1MRZA 4WY8A 3FPHA 3C7DB 1V8DA 3V1YA 1X1CA 1FFYA 1MOSA 2HCFA 4LBYA 4PIMA 2W7OA 3ZLUA 3M6WA 2QJRA 1UBCA 1QKJA 1W36D 2WP0A 5JCZA 4FGZA 2AX4A 4QX6A 1Q15A 2EJWA 4AJ9A 4E5YA 1M34A 3RKUA 1CE8B 3E0QA 1E92A 1THGA 1JPUA 3S28A 3OPNA 1UC8A 1TE2A 3MM4A 4LYHA 4JYAB 1HETA 3GP8A 3SNHA 4YD2A 1H9CA 5K4GA 2VFAA 5FUWA 5C5CA 5HKOA 3SBXA 3GFGA 3GIJA 2HJGA 2CV0A 3K9WA 3OBIA 4LZWA 1PLLA 2A8YA 2PUAA 2ZYWX 2W9XA 2CLEB 4R0NA 4RPIA 2VSOA 2JZOA 4ZGWA 3H84A 2FUEA 4BFUA 1EX1A 2HIMA 2XGJA 2ZVPX 1DBRA 3T34A 1LB2B 3UH1A 1LV8A 4OQFA 2IP4A 1U6KA 1QIDA 3T7EA 2EFCB 3V7WA 4FM9A 3OFND 4TKUA 4IJ5A 2J3DA 2FVXA 4CI0B 8GPBA 1T0IA 3AUJB 3NHSA 2O7NA 3DNPA 4PSUA 3VDMA 4X1KB 1IEXA 5FA8A 1S2DA 1S3GA 1F2VA 4IX1A 4Z9AA 2IY9A 4MKHA 5DXAA 2B4YA 4ND8A 1XKLA 1Z5OA 3SQLA 5FUQA 1L5NA 3UH0A 2C3MA 2BH9A 3GB9A 3EGIA 3FNQA 1KO4A 1RWXA 1UFQA 3MMZA 3ANSA 1AGPA 4JJ8A 2OCEA 4BB9A 2ZBVA 3DP7A 4Y1FA 5J47A 1ELOA 4XW2A 1KRHA 2RGGA 3F5EA 4URFA 2PJUA 6PFKA 5HRUA 4JP3A 2E5SA 1C5KA 1ILEA 2XJ4A 5EPOA 1CUEA 3ABZA 2HF7A 1I3OA 1V45E 4AQ7A 3AHCA 3PW5A 5HFJA 2H07A 4ZZ0A 2PZ8A 1TM3E 3E2EA 5AH0A 1XDDA 4RZXA 4PGGA 3DB1A 5M7EA 5TMDA 2J5KA 2UYOA 1B14A 3PT5A 1UL1X 3IT1A 1LW7A 4Z3KA 5HGJA 2J9FB 3EPGA 1TT7A 2LI6A 2K8BB 4LRYA 4NMMA 5CEEA 2X8BA 2ZVDA 3ETJA 4ZYWA 1NM5A 1K88A 1TVCA 3CXUA 3EYWA 1O6ZA 3GJ0A 1SD1A 2OH2A 4MLZA 1U98A 2HHQA 3N8KA 4EPWA 3FTQA 3I3OA 1XLTA 2J0UB 1EFCA 1EVLA 3IE2A 1R1DA 3M6MD 4H15A 5C7YA 1ZH8A 2JIMA 1UDAA 1JBQA 5BR4A 3RGGA 2O8NA 2QLMA 5IXYA 4Y7DA 2QGNA 1WVMA 3BJZA 2D8MA 3NT2A 4UDXX 1NMYA 4PFSA 1USKA 1T8EA 3S2UA 3P4UA 3QBDA 5HUHA 1M1NA 1F6BA 3B1JA 3ROXA 2W7PA 4EG8A 3RS3A 4ZIRB 3M5PA 4IQWA 4IQ0A 1BVYF 3A4YA 4ZFNA 5HZKA 2QWXA 2OK7A 2DU8A 5EHIA 1ZOLA 2G40A 3IX7A 3PQ6A 5BSHA 1JT2A 1ONNA 2FSUA 4X8MA 3CX8A 3FD8A 3DV9A 2H6EA 5EIBD 3R3XA 4Y1RA 3V4RA 5FPPA 1WIWA 5AOBA 3NUZA 3MERA 2Y9TA 3GOHA 2JDID 2J0EA 4BN0A 3RHSA 2QRMA 4JJEA 3TUJC 2VZ9A 1KP2A 3DT6A 3SX4A 2HXYA 3U0VA 4X61A 4JMPA 4ISCA 5G0TA 5KSYA 1LBHA 4ZC8A 2WJIA 3K4QA 2WWWA 4H27A 1YZ3A 1GYQA 1YS1X 2J4DA 1HYHA 1DIBA 5EYPB 4Q4CA 4YD1A 4AKTA 5JV5A 2OPHA 2FW8A 3L06A 4N39A 2J3QA 3C4JA 2FYTA 4Y2XA 3OCJA 1YI0A 3TTVA 4V0RA 4G09A 1W76A 4C7BA 3AR3A 2B61A 4N76A 3GFKB 3OQOA 1WPXA 2EX0A 3A1EA 2IHVA 3D6FA 3R9WA 4WGFA 2QYOA 2RHDA 3U09A 5F7OA 3FYTA 4QBFA 2WU4A 4M1ZA 2IK8A 4JLPA 5K3AA 4QWAA 1D5WA 1U4NA 5JWRA 2LYHA 5FL7D 2J46A 5I3CA 1RXIA 3FXAA 3IAM1 4MLCA 2Q50A 2HHWA 1OWMA 4GWKA 3OFVA 2C5FA 3C3BA 1HSZA 4RTJA 4JH0A 5K3DA 2B5WA 1E7SA 4INPA 1JG7A 2R79A 3OUUA 3FNIA 4OL9A 1EFRD 4WBXC 3LDGA 1O4WA 5ALOA 1W9MA 2CFRA 4OSOA 1T8WA 2JLUA 3O9MA 2DPMA 4NXZA 4KYIB 3PKIA 1ML3A 1HDYA 1FQOA 4IIDA 4P58A 4NRDA 1DBVO 2BCEA 4C4YA 3H42B 3RSQA 3PHLA 1A98A 1M9NA 5DLYA 2W4IA 2D7CA 1VI6A 3CTMA 5BV1A 4ZTZB 3PR1A 3PGJA 3EEFA 2VXYA 2H29A 1J9EA 1G21E 1L5SA 2FF5A 2WR8A 4RLQA 1XVVA 5D4BA 2QDXA 1ZIYA 5C2JB 2HW8A 4MW1A 2ZSBA 2AJCA 1KAQA 3TL6A 4D82A 1HGXA 4PO8A 2W2PA 4AB1A 1KP9A 1Y9DA 4FC6A 3LECA 2EWMA 4DMUB 5DYGA 3TLGB 3SEAA 4D9MA 3WLSA 5CCBA 3FW1A 5MGNA 2H3HA 4A82A 4B82A 1HTTA 3WP1B 1Y4AE 4B6OA 3AEKB 4MF8A 3M3DA 3GBSA 1RWNA 2V7XA 1PJBA 2RP5A 3TD6A 4S1PA 5AXDA 5HJ5A 3I30X 1CQIA 4XD2A 2AJBA 4OB6A 3C2MA 3RWBA 4CDNA 1T1SA 1TA4A 3U48A 2WTNA 4FOTA 3DFKA 1QXSA 5DX8A 4IFTA 4NCXA 2XHZA 4PHGA 3FDFA 5KJEA 4A23A 5LSAA 3AMZA 2QRLA 3STYA 4HN9A 3KOZA 2BGUA 2VH5R 4RKRA 2HU8A 4FKBA 4LXIA 2ZP1A 5TY0A 1X0XA 4MUKA 2QB5A 4KK4A 4OHYA 2OBFA 4ENWA 1RS0A 4CODB 3IMCA 4LQLA 1O3YA 2OMKA 2YIDA 3AIMA 5B1EA 3PJFA 3RYTC 2KG5A 1ZFNA 2WD7A 1XTRA 4D45A 3Q6IA 3VR4H 2JS7A 3D9QX 3HCNA 1N7HA 4AECA 3LHKA 4A6XA 4I3FA 1Q3KA 5F77A 4RQ2A 5TVKA 2DULA 3KYIB 2C7QA 3QELB 4CKXA 1CK4A 4J29A 1AKTA 4IZIA 4PTZA 5KOIA 3UGJA 4PLFA 3QF4A 4K9NA 4QOEA 4RZIA 1P2TA 3L01A 2WM9B 1OLXB 2XODA 4JK1A 4DV2B 3Q3EA 2V8OA 2V3WA 4PNZA 3SIXA 2RH5A 3DDNA 3DO8A 1SUAA 1HO3A 3SC2B 2JV3A 4QT4A 3T06B 3QVLA 4PC6A 2RONA 2AXTU 5EMMA 4OJYA 4BVEA 1Z13A 1FLVA 5IDWA 2DBZA 3TUIC 2VHWA 4M9JA 1GQYA 2O8BB 3H2GA 4KNWA 3TNFA 2OQ2A 1ZGJA 3O83A 5KOHB 5EKXA 2IQIA 1Z73A 4BCCA 2VSNA 5DTRA 3LW7A 5KTQA 4Z6EA 3B70A 1OOEA 4NABA 3F5FA 3AC0A 4V02A 5JW6A 4Q8FA 4M37A 4N03A 5KBYA 1ZYQA 5EIOA 1PW5A 2ODQA 4H17A 5JD4A 4OLBA 3G6VA 3FUUA 3IPLA 1JHPA 2JLXA 4IGAA 4EY7A 2QNBA 4O4LA 2R6R1 3FN4A 1J70A 4MWSA 5EJ9A 1ESNA 2VH1A 1GG9A 3SS7X 4AYXA 1J0AA 2O8FA 2GUWA 2DR0A 2M6KA 4DXAA 1ACJA 6ADHA 1ZJMA 4E09A 4KTQA 4QW9A 3KAPA 5A0TA 3MVEA 4Q44A 4DL4A 3DMNA 3L7CA 5E4YA 1GPNA 1EXNA 4BWMA 4PV7A 3NTOA 4Q3KA 1SKQA 3HU5A 4JBIA 4Q18A 1B22A 3X1ZA 4D4GA 5FXMA 2IYEA 4NLZA 3AP2A 4B9MA 4P0QA 3SQDA 1IIPA 1ISMA 3FWHA 5FWXB 3LK7A 1GYRA 4ZMBA 3V55A 5TGDA 3JD1A 4BNYA 3ZE7A 4AN1A 3H9CA 1UA1A 1T8YA 3ANXA 3L9XA 3CX6A 3NM5A 2DQYA 4DOCA 4ZOCA 4DBLE 1S9DA 3E2MA 2GN6A 4BE4A 5DLEA 3STUA 2WIGA 3ZKWB 3U39A 1JZSA 2FZCA 1OH6A 1QNLA 8ICWA 2A14A 1QMPA 1PV4A 2RC6A 1QF6A 4D4KA 4BFXA 4DBVO 2BISA 4G0MA 5KWSA 4CMIA 3UCFA 1O96B 4XTCS 4L5YA 4KYTA 3SYTA 1F60A 1ZVVA 4C03A 5KUTA 4C6TA 5JDCC 4WDQA 3TBKA 2JLRA 1P9WA 3V7UA 5J2GA 1NNEA 3HNPA 2NIPA 4PXYA 2ZJ8A 4JJFA 3JWEA 3WGUA 3WQHA 1FTGA 2ISOA 1HMYA 5DI3B 1UQUA 1LJUA 3JQ6A 5FT9A 1TUGA 2G8LA 5JNSA 3AMVA 1TLTA 5A1JA 1XTPA 3QFHA 1CLUA 3X1MA 2JA2A 3KFXA 4AQDA 1QPGA 4E32A 4KHPB 1LDNA 2ZATA 1MN8A 4L8LA 4O63O 5D3MA 1JI3A 2HBKA 1A97A 1PI3A 3HSYA 3ESCA 4FOOA 5F1PA 3IR7A 3WKBA 3DGFC 5C1BA 4P3NA 4N65A 2X6TA 5JALA 4J3FA 3KTQA 1ZS9A 8ICZA 3CW2A 2GK4A 3WDSA 1H3NA 1HUZA 2C78A 5IM4A 2XT0A 2IOYA 4PC3A 3VTAA 1FIQA 4YMHA 4ENPA 1C9DB 1NOIA 3RR8A 3X3HA 2W6MA 4BNIA 3AB7A 1NKCA 4XIGS 5IVPA 1TEZA 2B37A 4NK4A 2UYHA 4CR8A 2XBUA 5DLFA 4REMA 1NBAA 2A59A 2NNWB 1YV9A 2FZWA 5GONF 4PCVA 4NLCA 3D8HA 3F5QA 1VJRA