2Y1JA

Crystal structure of a r-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1jA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1jA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1jA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1jA01
5KFQA 5D3GA 1XC9A 9ICSA 1ZQWA 4ID5A 4E0DA 3CFPA 2B21A 2YNFA 5KFGA 4IQVA 3MGHA 4FLTA 5DBAA 3JPOA 2UVVA 1X9SA 1TK8A 3DOLA 4OLBA 2PZSA 3HW8A 4J9NA 4QWEA 3FFIA 3V9SA 5J0OA 3AA4A 1IO2A 1QSLA 1ZQVA 4KTWA 2JEIA 4EZ6A 1NK0A 5HP1A 1J53A 2GBZA 4F4WA 2KFNA 1RBTA 4XIUA 2M9NA 1ZQQA 3VA3A 3SPYA 2KQ2A 4B9TA 4I28A 1R0AA 1BVSA 4PGYA 8ICEA 4DLEA 4EYHB 2OPRA 4ELTA 1C1CA 3C2MA 3RAQA 2I9GA 1DGSA 4LH4A 4CEZA 3DLBA 3C1YA 3QIPA 3KLEA 1EXQA 1D5AA 5KFEA 4O0IA 2DFFA 5D4BA 2A1JB 1KFDA 1QS4A 4LD0A 1JX4A 4HUGA 4DU3A 5DB7A 5JS1A 2BDPA 4H8KA 1HJPA 1B92A 4OLAA 2FMQA 3K75D 4YP3A 3H7IA 2ASLA 3ZSVA 1KVBA 2A1JA 2QKKA 3GDXA 3NHGA 3DMJA 5C42A 3AA3A 4W5OA 3PMNA 1ZQYA 4NCBA 4C8LA 3B6PA 3HYFA 4UB1A 1N5YA 3GIKA 3SUQA 4B3OA 2RN2A 4CGGA 1UAXA 4J9QA 2MAXA 2W9AA 1RBUA 3KTQA 4OJRA 3ISBA 3M8RA 4J9MA 4KTQA 4F4ZA 1RDCA 4R8UB 2HHVA 1TKZA 2IMWP 4BDYA 3RJJA 2IGIA 7ICSA 4CFBA 5J0PA 5HMLA 2W9CB 4FJHA 7ICQA 1RZTA 3MFIA 1VSEA 4CHZA 3SYZA 1NJXA 4RNNA 3H40A 2P5GA 1C0TA 4R8UA 5I3UA 4CGIA 4YD1A 4P4PA 3OHAA 4FYDA 3M9MB 4ECZA 4YMMA 3AVGA 3RJEA 3C23A 4KI4A 1TAUA 4CK1A 3OYMA 4TUPA 1C0UA 4FM0A 2QKBA 3KHRA 1Q8IA 4EYIB 1V9PA 1TVAA 4RQ0A 4ECTA 1HUZA 1S9EA 3SV4A 4M47A 3V6KA 4FCYA 1B22A 7ICIA 4N56A 3VQDA 2XRIA 5I42A 1IXRA 1ZQMA 4FJKA 7ICHA 2H5XA 1VSHA 4E7IA 3NF9A 1U04A 2BHNA 3JPNA 1NK4A 3KK3A 3V1OA 4LY7A 2X78A 4AILC 4YG2A 1ITGA 5KG4A 3RR7A 4AH9A 8ICBA 1HYSA 1ASVA 2X74A 5J2PA 4Y1DA 4ZHRA 4J9PA 1MC8A 5J0UA 4CIGA 5KT7A 5J0XA 2R8GA 1XSLA 3LALA 4UAZA 3OHBA 1UWBA 3OYDA 4KLUA 4KI6A 4FK0A 1JN3A 2XCAA 4LSLA 8ICHA 2ZE2A 2F8SA 2VWKA 7ICTA 1TKDA 1RT4A 1S6PA 3L2VA 5EWGA 4DTMA 2QXFA 2BGGA 3C2KA 3CM5A 4HVJA 5J0YA 7ICKA 4NLGA 4NLNA 1I39A 4I9LA 1EXNA 9ICCA 4YD2A 3VQ5A 4BE0A 3V7JA 1XSNA 2PFPA 4E1NA 2FPLA 4IRCA 4ED3A 3NBPA 5CY4A 3RWUA 4NY8A 1BCMA 3OJUA 5KTQA 5E41A 3LP2A 3U3YA 2GWSA 3LAKA 4EP5A 8ICPA 1ZQAA 2HHWA 2DTUA 1KTQA 3ALYA 3RMBA 4E7HA 3VQ6A 1K6YA 3CG7A 4Q44A 4UB3A 2EHGA 5J1EA 2BCQA 2B5JA 4DOCA 2KTQA 3KLIA 4UAWA 3ZT0A 1QE1A 2VA2A 2GV9A 3DLHA 4DU4A 4I2DA 1QSSA 1NKCA 2BGWA 3GFKB 1RTIA 3RJIA 1VSKA 4QZBA 4GC6A 3CYMA 5KG7A 3OY9A 4MF2A 3QESA 2RF2A 4Q8EA 9ICRA 4DL4A 5F9LA 4Q43A 4J9SA 3AVNA 4C8OA 2ZJ5A 4RPYA 4CF9A 1ZQIA 2UVWA 4RQ2A 4P2HA 8ICJA 4AHRA 2ZQBA 3S3MA 1TAQA 4F4KA 2OPQA 3SPZA 4J2DA 5CR0A 3N97B 1BI4B 1HNVA 3OYHA 4F91B 1TV6A 2UVRA 5IIIA 4F5RA 2FPMA 4O3RA 1ZBIA 4CJFA 4O9MA 3CFRA 2R7YA 4DL3A 4KLLA 4LSNA 3AVCA 4ELUA 5SWMA 5J2QA 5IIOA 1SZPA 3HK2A 5CWRA 2BPGA 1U45A 4CJUA 3SUOA 4DWIA 1RYSA 3N4MB 2HVIA 2C2RA 1RDBA 3NTUA 3HWTA 1CLQA 4RQ3A 8ICVA 4Z4HA 3IG1A 1ZQFA 5HLFA 3HVTA 3QEVA 1RCHA 8ICNA 4FLUA 2BE2A 4CCHA 7ICEA 3MXIA 3LZJA 3HJFA 2ATLA 1N48A 4FXDA 5HHIA 5EOZA 1SKSA 4CEDA 2F1HA 4RNOA 1T03A 4N41A 4ELVA 3AVHA 3H08A 4RW6A 2ZJ8A 3PUFA 1JL1A 1B9DA 2XY8A 4Z6EA 3UXPA 2IOCA 3HP9A 4BACA 4J9KA 4DTJA 2J6TA 4ECWA 5J2FA 5CP2A 2XCPA 1GOBA 1VRTA 5CJ7A 4Q5VA 4Z6DA 2KZMA 4DOBA 4I9QA 2Q0ZX 1ZQTA 4DTXA 2KN7A 3NGDA 2PFOA 3V7LA 4FVMA 2BKEA 4GXIA 2JEGA 1BIZA 3VQAA 5DG8A 4FW2A 4KLJA 3C21A 2Y1IA 4KB1A 1T05A 4FS2A 5EU7A 4PHDA 4TSXA 4KKOA 3VQPA 1ZJMA 4DQPA 1DOQA 1MSWD 5F9NA 3ZSOA 1L3UA 2BPCA 8ICCA 2G8UA 4RPZA 1J54A 3VQEA 5KFBA 3C94A 3OSNA 2AJQA 4ED0A 2P1JA 3TAQA 3B0YA 4MFFA 2ATQA 4CFAA 3WNEA 4E7KA 3BQ0A 3NE6A 4MFBA 3IM1A 5KFUA 3PNCA 8ICWA 3OS1A 3RB0A 5KG2A 5DQGA 4CJQA 5BPCA 1JMSA 1T4GA 4E7JA 5KT2A 3OJSA 2O4GA 3TQ1A 1RDDA 1KLMA 4KHYA 4IDKA 4J2AA 2C28A 4ED7A 4OPJA 1LWEA 3PX4A 4F5QA 4RQ1A 3PVXA 1RXWA 4MEXA 4IR9A 4Z4GA 1D9DA 2JZBB 4K8XA 4DF8A 2Z1HA 4PWDA 3LPTA 1LWFA 4TUSA 3ZDCA 4KLIA 5J2MA 5KGXA 3C1ZA 3H4BA 3AUOA 2FLLA 3KD5E 5J2BA 3KK2A 3CQ8A 3NGIA 4TQSA 9ICQA 3ZSQA 2BR0A 1ASWA 8ICZA 3BQ2A 9ICVA 4ECYA 1WLJA 3SJJA 1N6QA 1ZQKA 1QLNA 4FJ7A 4BE2A 4RW4A 3UQ2A 4UBBA 4ZTJA 3I0RA 1U47A 3VQQA 4ICLA 4NLZA 1S1XA 4DFJA 5J2AA 3RH5A 4KHWA 1X2IA 4QZIA 1C7YA 5IIMA 5KG0A 4DL5A 2F1JA 4JV0A 5KFIA 1T8EA 5D49A 2W42A 4B9MA 3QZ8A 1TL1A 5EWFA 4I27A 4B08A 1JIHA 4R66A 1HYZA 4KO0A 2GUIA 1X9MA 1JLEA 4Z4EA 3ULDA 3QEXA 4O4GA 3C6UA 1NK6A 3DRPA 3M9OB 4O5CA 3L2WA 1SKWA 4M9NA 1AROP 4DG1A 3NH1A 3NH2A 1S77D 1BQMA 2BCUA 4ZTFA 4MFCA 3KKSA 3M8QA 4QWAA 4I2EA 2ZTEA 3TAMA 4DQRA 4QZDA 1RT2A 2MUTB 1RTDA 4JV1A 1RDAA 2G8WA 1S0NA 3AVJA 5EWEA 7ICFA 2PI4A 4DO9A 4HYKA 1XHXA 3L3VA 2KZZA 3JPRA 3D45A 4FJ8A 9ICKA 2WONA 1J9AA 1Z3EB 4CJTA 5KFFA 1EP4A 2LSNA 5JUMA 1HQEA 7ICGA 4ED1A 2FBXA 4KREA 3RTVA 5DG9A 3K5LA 4XA5A 3GV5B 1B9FA 5KG6A 3KHHA 7ICUA 2HMIA 1RT5A 4PY5A 2R8JA 1IG9A 1L5UA 1NJZA 4NYNA 1ZQRA 4NLKA 4EP4A 1NK9A 4PPXA 1RT7A 3VQ7A 1N56A 1ZJNA 4MFAA 4IKFA 5J2KA 3AVKA 2BCSA 3RB4A 4KPYA 3AA2A 4FZXC 1D8YA 3HPHA 1CXQA 4I2PA 4RQ5A 5FRNA 3TAEA 1K1QA 5DKWA 4HHTA 3RB6A 2OPPA 4NCGA 2HHUA 1FK9A 4CHYA 3NGYA 4RZRA 9ICPA 3C2LA 4E19A 3RJFA 4DOAA 2EX3A 3OYJA 4OKJA 2FMPA 3E2EA 2RDJA 4GW6A 3LP0A 3ZT3A 4RT2A 1L3SA 3RJHA 2ZUDA 2YKNA 3V1RA 2ASDA 4CEOA 4R5PA 1JLBA 1WSIA 1BPBA 3IHQB 3EWAA 3ZD8A 3PY8A 1ZQCA 4O3QA 9ICBA 3AVAA 3G10A 3I0SA 2FBVA 2HNDA 5DLFA 2PI5A 4F5PA 2E6MA 4JRQA 1U4BA 3Q8PB 4N76A 2W8KA 1MQ2A 4DU1A 2PYJA 3SQ2A 1Z26A 3K2PA 4Z4CA 7ICMA 1NK8A 4DFPA 5BOMA 4UBCA 3BGRA 5J0QA 3BQ1A 3ZSYA 4CJEA 4KHNA 3TARA 4CIEA 4I2AA 1KFTA 2F8TA 2LYHA 3DRSA 4DFKA 1RBSA 4ECRA 3OSPA 1JLCA 1JLQA 1HRHA 3JYTA 4O44A 4O0JA 3NCIA 2C2EA 1UOCA 5J2CA 5HRRA 2Z1GA 1TKXA 5DBCA 4ZH4A 2OWOA 5J0RA 1S76D 4FJIA 3NAEA 2W9CA 4CESA 4DTSA 1C1AA 3AVBA 4YMOA 4BDZA 4QZ8A 2VG7A 3KD1E 4HCBA 4FLYA 4JS4A 3V6HA 4AHTA 5KFCA 3V7KA 5C25A 1NJYA 4DQSA 3U3GA 1QSYA 3HP6A 9ICMA 3OYBA 1TGOA 5K14A 2PFQA 3MGIA 8ICGA 1HJRA 3V1QA 4QWDA 3C5FA 4BDPA 4FBTA 3L8BA 3MEEA 1YVUA 4Z6FA 4DTPA 3V9XA 3PX0A 3I8DA 3LDSA 2OZSA 4CHPA 3QERA 2VG6A 1U48A 1D9FA 2BCVA 2A1RA 3PW5A 1XSPA 5J0SA 4FK2A 4CEBA 4EBCA 3DLKA 4I2HA 2FBTA 4QW8A 4G1QA 4YNQA 2DPJA 7ICRA 2FLPA 5DK5A 1S0VA 1IH7A 3Q8LA 1GOAA 4RNMA 3VQ8A 4KN4A 4K4GA 1RT3A 4N5SA 1NOZA 3PX6A 4KFBA 7ICVA 5KFNA 3KHLA 4M9JA 3PO4A 4B9NA 2DPIA 1RNHA 5KRSA 4IQTA 1LWCA 3OYKA 7ICJA 3TAPA 1DTQA 1UT5A 5KFMA 1XHZA 5HHHA 5KFDA 4PH5A 3HXMA 2C22A 3M8PA 3VQ9A 2XHBA 3K5OA 4BWMA 4Z6CA 3HL8A 3IAYA 1WAJA 2JGUA 5KFSA 4ECVA 3HPGA 4C8NA 4F3TA 7ICLA 4KLHA 3QE9Y 4J9LA 4B8CA 4CE9A 3PR5B 1NKEA 4FW1A 3T5KA 1A76A 1COOA 1O1WA 3OYEA 5J0WA 3OS2A 5CB1A 2HHSA 4DTNA 2BQRA 4OGCA 4UQGA 1BISA 3Q8MA 4JRPA 3HT3A 4FBUA 3ORYA 3KLFA 3CM6A 3V9UA 1KLNA 3G0ZA 4QZEA 4J9OA 1S5JA 3FYHA 4KMUA 3SZ2A 3P83D 2IA6A 1Z25A 4IRKA 9ICOA 4QZHA 3PW4A 4QW9A 2PY5A 3WNGA 5CZ2A 3ZT2A 1RT1A 1ZBUA 3CFOA 3QLHA 2YNIA 3OYFA 3HVRA 2R8HA 2FC0A 5C5JA 4M9HA 1BI4A 3TAFA 3NF6A 4FM2A 2FLNA 4ECXA 3M8SA 1KRPA 4CGDA 2E6LA 3IS9A 3RJGA 1JLFA 3OYLA 5DMRA 3T5LA 5KFVA 4HCCA 3EPIA 5DBBA 4P4OA 2J6SA 1SUQA 1L3TA 5KT5A 3IRXA 4BWJA 4EBDA 4CIFA 2YNGA 2J6UA 1ASUA 1BPZA 2P66A 4YXMA 2D0AA 3PW7A 3QNOA 3BDPA 4EZ9A 4CJRA 4Z4FA 1NKBA 4M9LA 3AO1A 4JS5A 1RTJA 4CJVA 4RQ8A 3LP3A 5J29A 4B9SA 3TABA 1TKTA 3LAMA 4JLHA 2NUBA 4CGHA 2ZUCA 4PGXA 4ID1A 3SQ0A 4FS1A 3RRGA 5HROA 4BXOB 3QIOA 4KN7A 1KDHA 4F4XA 3L3UA 4JK1A 4FLZA 3OYNA 1ZQZA 1GOCA 2DY4A 1ZBHA 4YR2A 3F73A 8ICSA 2ETJA 4TQRA 3H8JA 2NRXA 4FJNA 4CHOA 2NRWA 4JUZA 4TUQA 3DM2A 2ISPA 2HB5A 5T7BA 3HO1A 3SI8A 2V4QA 4R65A 1LV5A 1BPEA 3RBDA 3MXMA 9ICAA 5DGAA 4KLQA 1XU4A 1ZQUA 1T3NA 1HYVA 4CF0A 2OA8A 5L1IA 3LP1A 2XC9A 4DTRA 3WNHA 1F21A 4RQ4A 1ZQDA 3ISNC 4DS4A 4I2CA 1S97A 4CERA 1WSFA 9ICWA 4UAYA 3G6VA 4F50A 3QO9A 3MFHA 3QEIA 4P4MA 4PGQA 1B43A 4BGDA 4F92B 4CEEA 5KFZA 4I2GA 3UXNA 3ZSWA 5DDMA 4DSEA 4F93B 4O3NA 5J2GA 1KFSA 2IC3A 1ZETA 1ZQOA 4AHUA 2PYLA 4YVZA 3L2QA 2PFNA 1CUKA 3AU2A 5KFLA 3TR8A 1QQCA 3O4NA 4CEAA 5FDLA 3DOKA 4H4MA 1WCLA 1S1TA 4IBNA 3H8WA 2WTFA 4OKKA 1RTHA 4IQWA 4KLTA 4CGFA 4M3XA 3EY1A 1LW0A 1LAWA 2B6AA 5BOLA 2JZBA 1KSPA 4YXJA 4AHSA 5HP4A 3PR4A 2P6UA 4YMNA 1KCFA 1UT8A 3EPGA 4Z0UA 4I29A 9ICHA 3KLGA 5J2DA 2DFEA 5J2IA 8ICIA 3ZSZA 5JS2A 3L2UA 3RMDA 1ZQBA 3SUPA 2JEJA 4DFMA 4CK2A 2ZUBA 5IINA 1A5VA 3F9KA 1BPYA 2UVUA 5KFJA 3VQ4A 4YQWA 4O3PA 2NRTA 2G8IA 5KFWA 4TURA 1NJWA 5IIKA 4J2EA 2AQ4A 4NXZA 2KW4A 4QWCA 3LWMA 3PO5A 1UA0A 8ICXA 3B0XA 2XO7A 2BPFA 3UQ0A 2XY7A 2RDIA 3ZD9A 1IKYA 9ICUA 1JLAA 3RMAA 4DQIA 3NH0A 4M2YA 1ZBFA 3GV7B 4RW9A 2Q3SA 1CZ9A 3KIOA 5KFYA 3V9WA 3TI0A 3TANA 3ISCA 3AO4A 4FM1A 3ZDEA 4M3WA 3BQTA 4FZZA 3SQ4A 3ZSXA 4UB5A 5DG7A 3H4DA 2D0BA 2RKIA 1IKXA 4B9UA 4O55A 1SL1A 4IFYA 3MAQA 3QEPA 9ICIA 4M3TA 4GXJA 2YV0X 4QZFA 4EEYA 3O3GA 5HBMA 5DQIA 3VQCA 4DSJA 2MUTA 5KFKA 3C6TA 4KRFA 4CK3A 3VA0A 4H4OA 3C5GA 3MABA 3UIQA 2X6SA 4E3SA 3P1GA 4PHAA 5L1KA 4IG3A 1REVA 8ICTA 3AO3A 4FO6A 5IILA 3QZ7A 4YR0A 4DL7A 1S1UA 4CJ3A 3RRHA 1ZQXA 4M9GA 3OYIA 3GV8B 3LPUA 4O3SA 2VA8A 5KFRA 4M3YA 4CJKA 3GIIA 4ED8A 2A1SA 1WCNA 8ICQA 4CJWA 1RILA 4LVSA 2JLEA 5FRMA 4F3OA 2JEFA 4CFCA 3QETA 4QZCA 4HUFA 4R63A 4IR1A 3NFAA 4I2FA 4K8ZA 1HNIA 5HRSA 1FKOA 3PW0A 2HNYA 4KLMA 5IIJA 3RJKA 2YNHA 3AV9A 3DYAA 4M0AA 1DLOA 4NYFA 4DLGA 3DLGA 1XWLA 1W9HA 3LDAA 1VSDA 9ICXA 2P6RA 5KG5A 1VSFA 3V72A 4E89A 1ZQHA 2YHAA 3T19A 2XGQA 4DL6A 4F2SA 4Q8FA 2F1IA 1YTAA 3GIMA 3ASMA 1ZQEA 3Q8SB 3KLHA 4FJXA 4RQ6A 4QZAA 4RW8A 1HUOA 3SCXA 4IQUA 3MXJA 3GQCA 3ZDBA 3S9HA 1BIUA 2G8VA 4I7FA 1Q9XA 3HX0A 4DS5A 4ECUA 5C24A 4UB4A 2W8LA 4YFKA 4M3UA 3LK9A 3T1AA 1I3AA 1SKRA 3O3HA 1RBVA 3AVLA 3G6XA 1RBRA 3NDKA 3D0PA 1VRUA 3MR3A 4KB0A 3EZ5A 2Y1JA 2ZTDA 1JL2A 4KLOA 4QZ9A 5KT3A 2P5OA 4FJGA 1TK5A 1CXUA 3VN5A 5CHGA 2IDOA 2BCRA 1LAVA 4Y1CA 3JPPA 3OYAA 4BE1A 3AU6A 2YHBA 2ASJA 1NK5A 1JXLA 3OVNA 3G6YA 2D5RA 4RT3A 8ICRA 3AVMA 4DSLA 4E7LA 3V4IA 1BPDA 1ZBLA 2HHQA 3K57A 2HNZA 5DB9A 3RB3A 3KK1A 1H38A 1S0OA 3ITHA 2QK9A 3MBYA 4FJJA 5D46A 3HPOA 3C95A 2XY5A 7ICPA 4NM2A 4M3RA 4OVLA 4JWNA 3LANA 4KLDA 3GILA 5L1JA 4F5OA 2ITGA 3AVIA 5CZ1A 4DSFA 4ECQA 4AHVA 5J2HA 1A5XA 1CZBA 3ZDAA 2IHNA 1A77A 3SQ1A 4I2BA 4B9VA 4RW7A 1FXXA 4DEZA 4DSKA 3OYCA 1C6VA 3RMCA 4CF8A 4GXKA 8ICYA 4XUSA 1FKPA 2X6NA 3RAXA 2G8HA 5DB8A 4RG8A 1ZQGA 4MF8A 3KJVA 4YCXA 3QEBZ 4C8KA 1VSIA 1WSGA 8ICKA 1ZQLA 1YT3A 4CF1A 4UB2A 2VANA 2IAJA 5KFHA 4KHUA 3OGUA 2HHXA 2Z1IA 4I2QA 2V4RA 7ICOA 3QINA 4KLSA 1A5WA 2AU0A 1XO1A 4CJSA 1SL2A 3QNNA 1SL0A 3Q8RB 4GLXA 4DTUA 1KEJA 2DFLA 4CFDA 4KLEA 3ZCMA 4ED6A 1BHLA 3A2FA 1TFRA 4RUAA 1JXBA 4FZYA 2FMSA 2ZD1A 4FJMA 5KG3A 1JKHA 3ZT1A 1ZQJA 3EW9A 3THVA 9ICGA 4NCAA 2BQ3A 1X9WA 4CGJA 8ICAA 8ICLA 2VG5A 1RYRA 4G3IA 1CEZA 4M3ZA 3UPQA 3TFSA 1QHTA 4R64A 2D0CA 3V6DA 5KT4A 3MEGA 4PUOA 3VQBA 4RQ7A 4DF4A 1VSJA 1SV5A 3B6OA 4M45A 3BJYA 1BQNA 8ICFA 5KFTA 2G8FA 2IHMA 1TVRA 1BL3A 4JV2A 5DGBA 4K4HA 3JPTA 4O5EA 3T3FA 1HPZA 3NF7A 3H8SA 4EBEA 2B4JA 5DQHA 4KTZA 1BCOA 5HRNA 1S1WA 4C8MA 4CJLA 4HUEA 1D8LA 4I2IA 4YN4A 2NRVA 3PW2A 1T7PA 3MECA 4IRDA 2AGQA 4LZGA 2ALZA 5TZVA 3JSMA 4KLFA 4I2JA 1JLGA 4RUCA 5L1LA 5FROA 4FJ9A 3JPSA 1S1VA 9ICJA 2HVHA 5DDYA 3L2RA 2NRZA 4FJ5A 5L9XA 2C2DA 7ICNA 4FK4A 4OGEA 3AO5A 4QOZB 3ETLA 2G8KA 2XY6A 1MU2A 3AA5X 1J5OA 1Y88A 1NK7A 3PV8A 2R8IA 3U6FA 4WE1A 3MR5A 4YFUA 1LB2B 1TL3A 2BANA 3NF8A 4XQ8A 1QTMA 2P51A 4MQ3A 4B8AB 3LZIA 3FDSA 4CECA 4N47A 5KFOA 4CHQA 3V81A 1VSMA 4DTOA 4MEYA 2XGPA 1YTUA 4DSIA 2AGPA 2W9BB 4PHPA 1IKVA 1HQUA 4J2BA 5KFXA 1U49A 3MDAA 3KHGA 4AHCA 4GMJB 3K59A 4DL2A 2OYQA 1X1PA 9ICLA 1ZQPA 4CEFA 3OS0A 4Z4IA 2R8KA 1EKEA 1JXEA 1ZQNA 9ICTA 2E4LA 5HMMA 3SV3A 2BQUA 5CA7A 2W9BA 1BPXA 4KITB 4LZDA 3V6JA 2HW3A 1VSLA 1IKWA 2I1QA 3Q8KA 4BXOA 5CYQA 9ICFA 1LW2A 5KGWA 4W5QA 4B9LA 4IFVA 4RU9A 5J2JA 2OPSA 3OYGA 1VK0A 1BGXT 4CJPA 3MDCA 2IS3A 3V9ZA 4J9RA 1ZQSA 1Z00B 3K58A 1Q9YA 2KZ3A 4OKEA 4HTUA 2Z1JA 3K5MA 1Y97A 2FPKA 3JPQA 3PMLA 3UXOA 5KT6A 4PA1A 4KHSA 4IG0A 1NOYA 1Z00A 2RPIA 4W5NA 1RT6A 1K1SA 4CJ5A 4DMNA 3DI6A 4QZGA 4L8RB 3ZSRA 1KVAA 1WAFA 4YR3A 2I5JA 2DFHA 4QCLA 4W5RA 3ISDA 2AGOA 2HHTA 3RR8A 3ZT4A 1S10A 1C0MA 5SZTA 3Q8QB 5J2NA 1DTTA 3P5JA 3TFRA 1WSEA 4F5NA 5KI6A 3HSTB 3S3NA 4DQQA 3O3FA 3AO2A 2ZJAA 2FBYA 1XS9D 5HRPA 3GIJA 3HM9A 4F4YA 4Q0BA 3MR2A 1G15A 3WNFA 5KRTA 4E1MA 1TK0A 3E01A 5KFAA 1ZYQA 3SUNA 2WOMA 2KFZA 3MEDA 5KFPA 3NGZA 1PZNA 4K4IA 4PHEA 4F2RA 4GC7A 1EETA 4CF2A 1C1BA 2YKMA 1XI1A 3S3OA 3T5HA 3QEAZ 2OZMA 2AQ0A 1EX4A 4KV8A 3EYZA 1RPLA 4M41A 4FLVA 4ED2A 4Q45A 4CHNA 1U9LA 8ICOA 2F96A 4KAZA 2IBKA 4CJ4A 3K4GA 5J0TA 3TWHA 3KKRA 4O5KA 3DLRA 5DLGA 3SNNA 1WSJA 1WSHA 3ZDDA 4FLWA 1KVCA 3AVFA 3LWLA 4KHQA 1L3VA 4RPXA 2ZTCA 4CEQA 1WN7A 3T5JA 4LH5A 4M42A 3SI6A 4FLXA 3M9NB 4F8RA 4M04A 4GVMA 5J2EA 3RH4A 1W0HA 3DLEA 1S0MA 2VA3A 3RH6A 4QAGA 1S9FA 4M6WB 1TV9A 1WNSA 9ICEA 3DRRA 4ECSA 1RXVA 1UA1A 3TAGA 2PXIA 3MR6A 8ICMA 3O4QA 1MQ3A 4FJLA 5HNKA 4OPKA 2V9WA 8ICUA 1S9GA 1HMVA 2VWJA 4X5VA 9ICNA 3K5NA 1S6QA 4M6WA 2O4IA 4O5BA 3QEWA 2W9MA 4QWBA 5DB6A 4PQUA 4JWMA 4W5TA 1IM4A 5KG1A 1NOMA 4XRHA 2ISOA 3RBEA 5CYMA 4NM1A 4KLGA 4O3OA
chains in the Genus database with same CATH superfamily
1VQPS 2RS8A 4WTYA 3FFIB 5A0YA 9ICSA 2QWOA 2YNFA 3QYYA 4OLPA 5F0XA 1DQ8A 1WKLA 2HWHA 2RNEA 2DISA 4JAXA 2GMLA 1LK5A 1YBAA 4OLBA 1TE2A 2PZSA 5L8RC 1T3VA 3TRGA 3ZX3A 4NXMK 2H54B 3EDQB 4LF1A 4XH4A 3QIPB 1SJ3P 1ZD4A 1NK0A 3P45B 1J53A 3AB4B 2DGZA 4F4WA 3BQ7A 1SVDA 2CFXA 2ES6A 2M9NA 3VA3A 3SPYA 4LF7J 2A6AA 8ICEA 2OPRA 2MYFA 3W2WA 3P49B 3C2MA 3RAQA 4Y2QA 4LH4A 3C1YA 1EXQA 3T1YK 2KG0A 4QIWC 4Y2MA 3S8SA 4B1UB 5D4BA 2VIHA 4UZCA 2A1JB 1Z19A 2O66A 3CMEN 2ZNYA 3J81O 1Q81T 3JTPA 4EI2A 5HK4A 4DV0K 4WFBQ 5JU5A 4H0OA 1NHUA 1NSKL 1F5CA 4LBPA 1D8BA 3ZC4A 4OLAA 2JC1A 3K75D 1IXKA 1ELOA 2ASLA 2CKWA 5ETPA 1PGZA 5GAEI 2J0QD 3B6PA 4JK8A 4FOIA 1KD1O 3H5SA 1WOSA 4M7XA 2MQLA 1AUDA 2GIRA 3US5A 1B7FA 3I8BA 3BR8A 3IWXA 3TEHB 3NP5A 3PIOQ 3TW0A 4CDGA 3MM9B 1FVQA 3D2SA 2J0WA 4IYQA 1KBRA 1C0TB 1VAZA 4ZP7A 2IMWP 1O5JA 2IGIA 2IM3A 3EL2A 5TKWA 2PT0A 4CFBA 1V5VA 3TP2A 2RQ5A 3CCRN 1TFWA 5EX5A 3MFIA 3W8PA 1FRJA 5B0DA 2IDEA 1OPIA 5BPLA 3SYZA 2O8DB 3CO9A 4P2SA 3H40A 2XZDB 2MA1A 2WB1C 2W01A 3FBEA 2GV1A 1S9EB 3CQYA 1Q82T 3NMAA 4ECZA 3U1MA 3C23A 2DR9A 2GX9A 3NASA 2CQ0A 2K8AA 4KT0C 3N4WA 3R27A 4CK1A 2B9YA 3MCAB 4A8SA 1C0UA 4UAVA 1Q8IA 1KWMA 2DIVA 2UXDJ 1WB9A 4NWBA 3HVWA 4B3MJ 4FCYA 3V6KA 2X1GA 1B22A 7ICIA 3DXSX 3VQDA 5I42A 1ZQMA 4JI3K 4K0KK 4FJKA 1QZ6A 4E7IA 2AX0A 1MDUB 3NF9A 1A6LA 4Q2MA 1U04A 1QHAA 2N4CA 3M4XA 3A4TA 3ENWA 3M7VA 4WFNQ 4ERDA 3NCRA 3LDPA 4YG2A 2W2OP 4Y65A 3QUCA 4LSLB 1HYSA 4ZJLA 1ASVA 2BJ9A 1S6PB 3RGIA 4ZHRA 3N4PA 2H48B 2A41A 4HL9A 1MC8A 4JNEA 2UUBJ 2H9ZA 3F41A 3F2KA 1DTQB 4OX9F 2F8SA 1IM6A 4KHMA 1RT4A 4DPOA 4DTMA 4CTAB 1O13A 1OSCA 3E9LA 2QXFA 4HVJA 2GIFA 4L74A 1I39A 1IBLJ 1NDPA 2ZH9A 2G1HA 4BE0A 1TMMA 3V7JA 2PFPA 3UVJB 2V5HG 4LF5F 3CPWM 3SQOP 2FPLA 2DO4A 3ADAC 3OTCA 3EZUA 5CY4A 1WSVA 4NY8A 3NGKA 5GADP 1KQSM 4OLOA 4YN3B 2X1AA 3OJUA 5KTQA 2GWSA 3QNWB 1FWLA 2FJDB 4OYOA 4DV1K 8ICPA 1ZQAA 2B4OA 1RU1A 4Y2AA 4LR8A 2YKOA 1RTIB 2DTUA 3ETOA 3VQ6A 2JDJA 2Y0SD 2B5JA 2XZTB 5C2GA 4IO9L 2KTQA 5ALEA 4LFAK 3BF3A 2DF4B 4ZLPA 3SJHA 4W98A 1QE1A 2GV9A 4ZVPB 3DLHA 2CJ9A 1R0BG 4DU4A 4I2DA 3CJKA 4QS9A 3SEOA 5DO2A 2ZDOA 3DDNA 3ETMA 5A8RB 1LXJA 3VAKA 3CYMA 4MF2A 2Y0SF 4Q8EA 1I3OB 5D15A 4DL4A 3UMGA 5ETQA 4NA1A 3AVNA 4UOCA 3SQGA 1VQNS 3V5RA 2DNRA 2AP1A 5T7LB 2Z30B 4AHRA 4RQ2A 2ZQBA 4P0PB 5AI4A 4OI3A 2KFYA 3EEQA 4F4KA 5CR0A 4ZVUB 1U1PA 1N2XA 5ETSA 4F9OA 1HBOB 1TV6A 5AM5A 5IIIA 2UVRA 1NU0A 3IG1B 1FHTA 4O3RA 3CFRA 2R7YA 2HVEA 2ABYA 9RUBA 4LSNA 1MROB 4ELUA 5SWMA 5J2QA 2J0SD 3LO3A 4K59A 4LF7K 1P90A 2BPGA 1RSCA 3SQIA 3R1LA 5JLFA 4OJ3A 4BG8A 3NTUA 2SXLA 4RQ3A 3ILIA 1ZD2P 5C2DA 4CLLA 3R6LB 3HVTA 4IUFA 3QEVA 3M30A 2BE2A 2HYIB 1BWFO 1SZ2A 3H3OB 3HJFA 3LM2A 2OFGX 1AFIA 3H1QA 1EARA 5HHIA 1SKSA 4JI7J 2F1HA 2QWPA 3GG0A 4L72B 5ALRA 4I6WA 4Y6IA 1DFDA 2F63A 2CQGA 5F0UA 2W2PP 4BACA 2J6TA 2HLTA 1TQLA 5AI0A 1VRTA 4PRFA 4YOTA 2Q0ZX 4DTXA 2HGMA 3UWTA 4DR6J 1H2VZ 4FVMA 1XR6A 4WQ4C 2KSOB 2F44A 1CC7A 2NR0A 3MURP 4H54A 3EVWA 5EU7A 4PHDA 3AB2B 4WFZA 1ZJMA 4MN4C 2Z7JA 2AEJA 1MSWD 3OHRA 3ZSOA 2EAPA 2RQCA 8ICCA 2G8UA 1NMNA 4L73A 1QAJA 3NMRA 3VQEA 4Z94A 3J81Y 2P1JA 5HVGA 3QBCA 3ZTPA 3B0YA 2HAFA 5H1SQ 4E7KA 3NE6A 4MFBA 4ZCIA 3CC7S 5HQ8A 1UZHA 3DWLA 1LWEB 5ALVA 5DQGA 2GO8A 3NOCA 2UXDK 2V8GA 2EWHA 4L3NA 2KKPA 1JMSA 2LYBA 5D0RA 3OJSA 2MMYA 3CE8A 5AZIA 4IDKA 1XR5A 4DHYA 4OPJA 3DLLQ 1LWFB 4F5QA 2FGOA 4MEXA 4QQBA 4IR9A 4I6MA 2ESEA 4TU8A 2B6AB 2OELA 1OVYA 2MLZA 2V68A 3CCLN 4NZ0A 4NLTA 3KJQB 5DM7Q 3OL9A 4MKAA 2FQQB 5E7OB 2OM6A 3LPTA 3LTOA 1NGCA 3F5EA 1EKSA 4TUSA 3OTQA 3BS5B 1WKJA 2UUBK 4KLIA 5L38A 2KHCA 1EHWA 3C1ZA 5AQOA 2W4PA 3I96A 3C66A 3AUOA 2FLLA 2K3IA 2ZIUA 4ICLB 3KK2A 1XNQF 1WG4A 2D4WA 9ICQA 4H0YB 7AT1B 3K1RB 2F4FA 1ASWA 4IEIA 4JI5K 3FQLA 5AKGA 2W55A 5ALDA 1FFVA 2CNKB 3SJJA 2CPEA 1TUGB 1KR4A 4DCPB 4EIAA 1N62A 3MM7A 1DRZA 3VQQA 3MK6A 2ZWPA 4NLZA 1S1XA 1IBLK 3NS1A 2LVWA 5J2AA 3H59A 4CO5A 4KO0B 2I38A 2DPNA 4HDGA 4FZVA 4ZDNA 3H0PA 4X4RA 1MWMA 4DG1B 4P52A 3IP0A 1TL1A 3M8QB 2XS7A 3NVMA 4C8YA 2JL9A 3T79A 3HZGA 1RT2B 3QEXA 1NK6A 2QLFB 3DOMA 4M9NA 1RXOB 2E9TA 3LDLA 3NH2A 2KYXA 1XN9A 2CDQA 1T0TV 1BQMA 4MFCA 2J9EA 3ZEUA 1Y5LB 2ZTEA 3UKRB 5F8IA 4NB4A 4M5KA 2G8WA 1S0NA 3CCUN 3UQSA 3L3CA 1Q7YO 4OYWA 4DO9A 2W43A 2LA6A 5B0AA 2NXUA 3D66A 3R5AA 2KHDA 5A76A 1E6VB 4RWTA 2C2NA 5HJXA 2J5AA 2EC0A 5HANA 2M88A 3D0HE 4PG8A 2KYZA 1I94F 3EM1A 3RTVA 4LF4J 1BLUA 3KHHA 2B4VA 7ICUA 3TZZA 2HMIA 2XNRA 4PY5A 4C8ZA 1L5UA 2OEKA 5E3RA 1ZQRA 4EP4A 3QU5A 2MZRA 3IM9A 3BB5A 3L95X 3U26A 1FK9B 1H74A 4IH7A 1N56A 2KJ8A 1ZJNA 2ZJRL 5LJ5Y 3AVKA 3RB4A 5AQYA 3R2CJ 1PVRA 4JKCA 2CGKA 4FZXC 4XH5A 4RQ5A 5FRNA 7FDRA 1RK8A 1HNIB 1MWZA 3ZX0A 2HBJA 4HHTA 1BU6O 3Q7CA 3L7PA 4WXWA 2VCPA 2I7NA 4JI7K 3ICXA 2EX3A 3OYJA 4NLUA 4C7YA 2FMPA 3E2EA 2RDJA 3AY9A 3H8YA 2KVQE 5LOQA 2UZAA 3ETRA 3ZZ0A 4EX7A 2KI2A 2CH5A 1X5TA 1GX5A 1ZBSA 4EEKA 1WSIA 1PVQA 1URNA 2CN1A 5AK5A 4DR6K 2XHWA 3Q8VA 3QFPA 3HFKA 5D4NA 3N5FA 3I0SA 4PXDA 2HNDA 1ZS6A 5DLFA 3AFGA 2F9DA 2PI5A 2HZAA 2ZIXB 1TR0A 2E6MA 4Y2XA 1U4BA 5IOLA 1MQ2A 1N61A 3UKUA 3K2PA 3TA0A 3UCGA 1JLQB 4Z4CA 7ICMA 1NK8A 3RF9A 3JYTB 4IC9A 2CPIA 1FEHA 3CETA 5H1SV 3DHWC 2JR5A 3BQ1A 1HWJA 4KHNA 4W4MA 4I2AA 1HNXF 3OVBA 5EDWA 4GKJF 1HNWF 2PFUA 2F8TA 2BJ7A 2VG7B 3P31A 5IC4B 3FRYA 4KX3A 1UOCA 1FI4A 3SCJE 5J2CA 1U7LA 1W26A 1SPBP 2B51A 3WK8A 4JBCA 1W7WA 5J0RA 3LGHA 3NAEA 4J8FA 3K8VA 4YMOA 4QZ8A 4OX9J 3VESA 1OMSA 3KD1E 2ZJPQ 1FNXH 2GHWA 1WHVA 2NS1B 4JS4A 1OY9A 5KFCA 5C25A 1NJYA 3K0JA 3AQOA 3PKMA 4KBOA 3HP6A 9ICMA 3NRZA 1TGOA 3HRGA 5GINA 1X6JA 2MPUA 2PFQA 3MGIA 2QLJB 4QOTA 3OR1A 5AXLA 1NLKL 2YX1A 1DK2A 4FOEA 2A1AA 4G1QB 1YVUA 4LF5J 4JD2A 3TTDA 2FHOB 2ZKTA 3QAEA 3I8DA 3LDSA 1BUPA 2F8HA 2PA3A 4DI6A 1GLFO 3D6JA 3MOZA 4WFYA 2G2YA 2A1RA 3RSEB 2E5LF 1S49A 4HEA9 2KG5A 4FE3A 3CCJN 3VF6A 5J0SA 2K1RB 4LRBA 2Q66A 3G8TA 1CLFA 4KFBB 4QW8A 2BZFA 2AZ3A 4CO1A 2DPJA 5DK5A 3MEKA 1ZRMA 4GVBB 3ZYYX 4LIRA 3VHQA 5IV4A 3Q8LA 1GOAA 3VQ8A 2W1BA 4DX6A 4C0OC 3PX6A 1DK3A 3KHLA 3H20A 3PO4A 1RNHA 1LWCA 1VQSA 2GAGC 3TAPA 1DTQA 5HMWA 3B8AX 5KFDA 3BUZB 3O1BA 4BWMA 1X5PA 2IVPA 4LRCA 2JGUA 3HPGA 4ALZA 2QTDA 2RRAA 4NOHA 1P27B 1SWVA 4HT7A 3J7AN 4M5NA 4J9LA 4LRDA 4B8CA 2Q36A 2B9XA 2MKJA 4X62F 2EFOA 3BBFA 3GYGA 1D4XA 1COOA 1O1WA 3OYEA 1UW9A 3VZHA 5CB1A 3WKCA 3TOQA 3CCVS 4JEPA 3H90A 2MZ1A 3THXB 2KT3A 3Q8MA 1NJIO 3HT3A 4PCQA 3ORYA 1RGIA 2P9PB 5ALZA 1S22A 1KLNA 2DEJA 2KJWA 2IYIA 4J9OA 4OZ2A 1S5JA 5M2UA 5TKYA 3NOGA 2D3O1 1BXNA 1SB3C 3P83D 2YNIB 1Z25A 4ZVFA 2O67A 3Q2TC 1FIQA 1QQ6A 3VF2A 4QZHA 3MD3A 1U24A 2Q6CA 2KJVA 4QW9A 3DAWA 5T7LA 4F3QA 3CFOA 3QLHA 2Q79A 1BA1A 3FRZA 1VQLS 3HVRA 1AZSB 3QJJA 2FC0A 4M9HA 1JUDA 5C2CA 1UFWA 4S0MA 4CGDA 5B0EA 3WIUA 3IS9A 4ZOHC 4RBUA 2XSFA 5DMRA 2YX4A 4NLXA 3EPIA 2BDUA 1L3TA 1FNOA 2VKRA 3LGNA 3X1LB 1GMUA 1ATSA 2VPZB 4CJVA 3LP3A 4FWMA 5J29A 1WHXA 1I5OB 2VONA 2V7YA 2NLXA 4W90B 1UCVA 2EKNA 4M5MA 4IJAA 4JLHA 3CC2S 2HSEB 4XO0A 5H9EJ 2CGLA 4NEYA 2ZUCA 1GAOA 1MN7A 4DX5A 1PYOB 1QJHA 3CJRA 1LW2B 3MCSA 2BH1A 2B4UA 4FLZA 1YJ7A 2HZVA 3ULEB 3AXMA 3NL0A 2ETJA 2NRWA 2EPIA 4IO1A 2JFDA 2KSOA 2ZNZA 4NV0A 1RAJA 4H03B 1FJ7A 3BS7A 2DNMA 3DEEA 5AFUA 2HSTA 2V4QA 1LV5A 4C3KA 3L7OA 4KLQA 1ZQUA 1T3NA 1HYVA 4CF0A 5L1IA 2P9NA 3THWA 4XPCA 3TSQA 3BBCA 4BLGA 1F2HA 1RA6A 3R5BA 3CJ4A 1F21A 3DI6B 3R6MA 4BRIA 5LMUJ 1SS6A 4OX9K 4CERA 1DAXA 4DUTA 2EFGA 4RU2A 3UW1A 2VPYB 5AM2A 3QO9A 4ES1A 3I5BA 3R3TA 1YITS 1IWGA 1NH7A 4BGDA 4LFBF 5IFMA 4CEEA 3UXNA 3ZSWA 4DPUA 1X60A 4F0HA 5J2GA 4LF5K 3IAS9 4F0MA 5ETOA 2DT9A 4A48A 3AU2A 1KQKA 3OVAA 5KFLA 3TR8A 4ENOA 3QICA 1MMDA 3Q8YA 3I55N 1UEVA 3DOKA 4FNHA 1QVGR 2E1EA 1HHQA 1BQXA 4YEAA 5AI6A 1AYEA 3H8WA 1NGDA 4OKKA 1RTHA 1Y00A 2P9LB 4KLTA 3CSKA 4M3XA 3I31A 2DKOB 2B6AA 1X7VA 2XO6A 4YXJA 5HP4A 2P6UA 4YMNA 4LJXA 1X4EA 1YJUA 4KV8B 5BYSA 5ELZA 3DRXA 1N5TA 3KLGA 2DFEA 5ALOA 4FYVB 1YZ6A 4QJFB 3MAAA 4BC5A 4OX6A 1K44A 3ZNJ1 3FBFA 8ICIA 1V3RA 2O8BB 5EXWA 1RM6C 1Z4OA 1H73A 5IINA 5ALKA 1HARA 2G0IA 1FJEB 1A5VA 3CDBA 2ODGA 9ATCB 1BPYA 3BZKA 1NCLA 1AA1B 3RBXA 4ZLNA 4OJPA 1FA0A 3M8YA 3CJ9A 4NXZA 3BGLA 2KW4A 3WEEA 1UA0A 8ICXA 4OHWA 2XO7A 3AM9A 1I94J 1CC8A 3DDKA 1BWVA 9ICUA 1GLCG 1KAYA 4DQIA 3WXLA 4I0WA 3GV7B 4RW9A 2XS2A 1CZ9A 1NGGA 3FMBA 1XMQJ 1FD8A 2VJ4A 2GZOA 3TANA 1J97A 4CF5A 3AGKA 3ISCA 1OIAA 2J7WA 4UB5A 1ZAVA 5DG7A 3HMJG 3H4DA 4J5OA 5AQZA 2D0BA 3M6ZA 4B9UA 4PQUB 3M6WA 1T3QA 2C3OA 3M6XA 4US9A 9ICIA 2BM0A 2O8CB 4M3TA 2CZVC 5HL7Q 2A3ZA 2YV0X 4QZFA 1IQTA 2QSFA 5HBMA 4MK8A 5AHXA 1LOTB 4DSJA 2VHGA 2ZIVB 3WKEA 2YPZA 1M1KT 4CK3A 4U8VA 3VA0A 4EO6A 3EMTA 3V2UC 1NGEA 3FEZA 2V8PA 5L1KA 3AO3A 5IILA 3FBBA 2MLXA 2DIUA 2YPYA 2EFPA 4A2BA 4CJ3A 2YKQA 3GV8B 2GEMA 1CS4B 3I6PA 3VERA 2LFVA 4UQTA 2PFFB 2ZH7A 1FKOB 4NEZA 3GIIA 1J2VA 3M1VB 3DYAB 2M3DA 8ICQA 4LVSA 1JXVA 2PGCA 4CFCA 3WC2A 4K8ZA 1HNIA 4H5NA 2LKZA 1HNXJ 4YB7A 4GKJJ 4KLMA 4C7ZA 5JVHQ 3AV9A 4M0AA 1DLOA 2ZBQA 5ALWA 3UN2A 5H9EK 3EZWA 4K42A 1KVIA 1NU4A 1XWLA 4CD1A 1VS3A 9ICXA 2HQGA 4IZ9A 4N8OA 5KG5A 1SB6A 1U2RA 4TU7A 2F4VF 1F0XA 1WUDA 3ENQA 4O3MA 1WEXA 3E8OA 1F0MA 3HX9A 2H3FA 4CZFA 5LSRA 2R7XA 1NNLA 3SCXA 1VRUB 1ZRNA 3DFEA 4I7FA 4NYOA 2ZIXA 3HX0A 4FZLA 4UARA 3O3HA 1SKRA 3QNMA 2B6GA 2NYIA 3WK7A 3MDFA 1JJHA 4Y3CA 1S72S 3G6XA 2BE9B 4I1TA 4J9UE 2YMQA 3NDKA 3FE1A 4DZ6A 4OI0A 5MLCQ 3MMBB 3JAMU 5LMUK 2QWMA 1FD2A 1HI8A 3VTHA 3PIOL 2MKCA 1KS2A 1U1KA 3VN5A 1ZBTA 1LAVA 4BE1A 2QARB 2YHBA 2ASJA 1NK5A 2VB6A 3POTB 4RT3A 1G99A 8ICRA 3AVMA 2HHQA 2WBNA 4HH0A 2HNZA 5AKYA 1UJ4A 5DB9A 3VVUA 3RB3A 3KK1A 1S0OA 3ITHA 1T9TA 4QR0A 4DX8H 3MBYA 3BO3A 2WF8A 3C95A 3U9ZA 2HBQB 4OVLA 4JWNA 1IWAA 3LANA 2OFHX 2F7TA 1FKPB 4TXSA 5CZ1A 1KQFB 4X62J 2ZUGA 4WTOB 2OCEA 4ZVRB 2IHNA 2GA7A 2OAUA 2LYVA 3LYSA 1R31A 4WFNL 1KQSR 4GXKA 3QFHA 5ALQA 2G06A 4XUSA 1GT8A 4O5FA 2EZXA 2G8HA 2AYGA 4RG8A 2QA1A 1IBKJ 4A62A 1PUZA 2H3IA 4BRDA 3KJVA 3K17A 2ZD1B 3LGMA 1YT3A 1ZXIA 1ZQLA 4UB2A 2VANA 4CF1A 2Z1IA 5BYRA 3D3BJ 7ICOA 4ZJQA 1YDLA 3GU3A 4KLSA 4DHVA 1I94K 3FZ2A 4CJSA 1GNKA 2VFVA 3Q8RB 1HHSA 4GLXA 2L5YA 4DTUA 2DFLA 4CFDA 3LP2B 4KLEA 4DUZF 1HBUA 4PUOB 1XNRF 3K8WA 2ADBA 5KG3A 1FEEA 4P74A 1JB0C 4A57A 3EW9A 2VG5A 8ICLA 4G3IA 1CEZA 3UPQA 2G0CA 3U27A 5KT4A 1HW9A 1S1WB 4OYIA 4RQ7A 1SV5A 1SQFA 3H2LA 3BJYA 2G8FA 5AKEA 2VQEF 4K4HA 3JPTA 4O5EA 3JSMB 1WWVA 1HPZA 5LM7E 3TPQA 4ILHA 3EGWB 1E3MA 3BF1A 2HBLA 4ZVEA 1JLGB 5HRNA 4HUEA 2RAQA 2P9CA 1DKGD 2FSJA 2YQ3A 2F3NA 4BC7A 2CJYB 3NNHA 4KLFA 3FMWA 3GIRA 4DN9A 1N5SA 1PYSB 1ILYA 4IH5A 2PEBA 5L1LA 1JJ2R 1OS5A 3JPSA 4CIOA 4F71A 3PHEA 3W65A 2HVHA 1J5OB 2KD1A 1FJGF 3UD4P 5DDYA 2DTJA 2D1KA 4FJ5A 1BNPA 5AKKA 3DHXA 4WE1B 3ZZTA 4CM2A 4NXNF 4LBIA 3MPYA 3HJVA 1HHTP 3IP4B 3AA5X 1AZSA 1Y88A 2XYPB 3CCZA 3V81B 1HNXK 2NPFA 2KIWA 4GKJK 4WF9Q 1T03B 1HNWK 2Z58B 1Z1BA 2R8IA 1GMWD 1F9EB 2QC3A 3BO2A 2EDUA 1QTMA 2ROGA 2KL8A 2VFSA 4FXWA 3FDSA 4N47A 2E5IA 4P7TA 4CHQA 3GCXP 4DTOA 1T9UA 3FK4A 2XGPA 4MAKA 4CNZA 3MCPA 3G2XA 4CF3A 3IMQJ 4DL2A 2AJ1A 2OYQA 3VGMA 1ZQPA 3GSDA 4ILRA 3CXCM 1YVFA 2RHSB 4FPRA 3SV3A 2W9BA 2DGTA 3L0QA 4LZDA 2HW3A 1VSLA 3D7SB 3Q8KA 2RMLA 2EH9A 9ICFA 1LW2A 5KGWA 2AIRB 1C20A 5IT4A 3W9IA 5JLHA 5JMVA 5J2JA 2E5LK 2VICA 4LC9B 1VK0A 3I32A 4K4YA 4CJPA 5LJWA 2QLBB 1MN8A 4XEIA 2P6TA 2KE7A 1T02A 2ZHBA 2QZ8A 3K5MA 3WXJA 4ILGB 2K06A 2LEBA 1RDRA 3DGPB 4WFAQ 2MKYA 3SCKE 2XHCA 5CEHA 1Z00A 2YX7A 2OHFA 4TY9A 2OIHA 3DI6A 1XNSA 2HHHJ 5KPTA 4L8RB 1KVAA 1WAFA 3P6YC 3T41A 2AGOA 2HHTA 3CJ7A 3RR8A 1YJ9S 3PRVA 4CO3A 4I64A 5J2NA 3WK5A 1DTTA 1AB8A 1RP5A 5KI6A 1FRLA 3HSTB 3JSBA 3O3FA 4C4SA 2H3VA 4OYAA 3M2UB 2ZJAA 2MJUA 1XS9D 4A61A 1WI6A 4QU7A 4CO4A 2DK2A 1Q7YT 2KHVA 3GZ7A 1TUVA 3OUYB 4X62K 3SBTA 2F9WA 5A8WA 3DLLL 4FPAA 2IM2A 1TK0A 2QW9A 3VENA 3E01A 1ZYQA 2XMWA 5C0YA 3SUNA 3HI9A 3OFGA 3MEDA 2C1EB 1T6CA 3R3LA 5CR4A 2LHTA 1L8OA 3AY0A 4PHTX 3T1HJ 1HD1A 1K0TA 3F2DA 4RW4B 3N7RC 4OD0A 1C2PA 1IBKK 1S7IA 4I67A 1FXRA 4RUHA 4KV8A 4P7VA 3WT0A 3H25A 4PXEA 4WJ3B 4KAZA 2IBKA 2MDAA 2O8BA 2O5DA 4CJ4A 1PJ7A 5J0TA 1WSJA 3DXKA 4TY8B 3BH6B 1YJWS 1OKJA 2QB1A 1KVCA 3DLEB 1M90T 1SQEA 3LWLA 2IFXA 1CPZA 1L3VA 2ZTCA 5CZVA 3NMUA 3C6UB 4NWIA 2WVBA 4LH5A 3LA0A 1L6NA 4FLXA 4M04A 3QBWA 4TYBA 5J2EA 1X9JA 1W0HA 2GGPB 3U8XA 1MLAA 3GFXA 5AQXA 2BKOA 2VA3A 3RH6A 1TV9A 3CT9A 1WNSA 3DRRA 1DQ9A 3A13A 3FZLA 1WYGA 1N34J 3TAGA 2PXIA 4Z2XA 4WXOA 3VWSA 1RCOB 2WONB 5HNKA 2V9WA 1S9GA 3X3UA 1CRXA 1S6QA 3BSNA 3PKYA 2AW0A 5DB6A 2RRDA 1RAGB 1NBWA 4PQUA 2DH9A 5M2PA 3VAIA 3FLCO 3TTFA 2O8CA 3RBEA 5CYMA 4EUVA 4AL6A 2DH7A 4JI8J 5EE0A 5EN1A 5J8YA 2WFAA 5D3GA 1XC9A 5DS7A 1ZQWA 4ID5A 4G6VB 2M7SA 5CRXA 4AM6A 2F4VJ 5JMNA 2UVVA 2AH5A 4KR0B 3DOLA 4ZK7M 5CD4H 3HW8A 3SAHA 4QWEA 5FIIA 1R0AB 4Q7AA 4B02A 4YMEA 5J0OA 1C1CB 3IG5A 4CT8A 1U25A 5J8YC 3J7Z5 1ECWA 5HP1A 2P35A 3G87A 3KFUF 5BYQA 4OI4A 3DU6A 3H6EA 2EANA 4IEEA 2E44A 2F77X 1ZQQA 1QVFR 5GMDA 2KQ2A 2QTWA 4I28A 1KQQA 1UWAA 4PGYA 4B6JA 4DLEA 2QYCA 2KJ5A 4ELTA 2I9GA 1DY3A 1TFYA 2ZBCA 4CEZA 2QA4G 2BUPA 3KLEA 1Q86O 2O8EA 3PEHA 4EFHA 3FEYB 5KFEA 2MXYA 4K7QA 4MDAA 3CCSN 1WD6A 4MLEA 3DJCA 3QDKA 5BPMA 4LD0A 1JX4A 1ZM3A 2F8MA 2OTLS 2HOEA 4HUGA 1ZQ1C 4DU3A 3EVMA 1RI7A 1HJPA 1B92A 2KO1A 4LJMA 3J7AP 4LFBK 3H7IA 3ZSVA 2O1PA 3IR6B 3D6MB 3FQKA 3DMJA 4W5OA 1ZH5A 1ZQYA 3GR1A 3AAQA 2J7KA 4OX7A 4B1VA 1M5KC 4DR4F 4B3OA 2DHXA 3BN4A 3C16B 1UAXA 4J9QA 2MAXA 2W9AA 3KTQA 4MKBA 3O1WA 2VC1A 3NRWA 3D2FB 3UI3A 3M8RA 4KTQA 5L46A 2WC9A 4C4RA 4X4TA 4PKGA 4LVNP 5FPEA 1Y5IB 3UNGC 3GTYX 2CJAA 1RDCA 5AI8A 3P4UB 1UEKA 1TKZA 3MAHA 1GH8A 2LCWA 1NDKA 3WXIA 3SMZA 3SD7A 2W9CB 2HMXA 4FJHA 1RZTA 3OVSA 4KGXB 4LF9F 4DOZA 1Q0NA 2HHHK 1NJXA 2P5GA 4R8UA 2DR8A 3HSCA 2U1AA 3M9MB 4YMMA 3RJEA 2MLYA 2OD4A 1IN0A 2IA0A 3RZAA 4FM0A 2RLTA 1JCEA 2DGXA 1TVAA 1P7DA 3SV4A 3H2UB 2NXJA 4N56A 2JHDA 2HS0A 4C2MA 5EOYA 2WVFA 1Q5YA 5J2PB 1VQ4N 1NJIT 1FDAA 4DUZJ 7ICHA 3VAJA 3J7YU 5B0CA 5F8NA 4ID8A 1NK4A 1X6IA 1P1LA 3V1OA 4JKFA 4LBHA 4Y00A 5C10A 1HKBA 5KG4A 3RR7A 8ICBA 2CQ3A 4EHUA 3BGUA 2YWFA 2HOIA 3UB5A 2F40A 1VQYA 3R7SB 3UDLA 3OD2A 2ERRA 2KM8C 5KT7A 5J0XA 4GO5X 1XSLA 1GLLO 3LALA 2DNHA 3RW6A 1UWBA 1HI0P 2M8HA 4AP9A 2HK2A 2VQEJ 4FK0A 3IBFB 1EB0A 4U96A 2VWKA 2GUPA 5AKXA 3T6BA 4YOUA 2V7ZA 2NZCA 3MGJA 3RYLA 4JYAJ 2K4EA 7ICKA 2YJEA 3TU5A 4DV7F 1D0EA 4I9LA 2CZ9A 2V94A 4Y2JA 3M6KA 1XSNA 3CDEA 3G6ES 3P4IA 4ED3A 1SXLA 3RU0A 1BCMA 3KLIB 3KUEA 4GO7X 3CCMN 4C3LA 3LP2A 3U3YA 4EP5A 1FJGJ 1RHJB 4BRAA 2ZZMA 1R7IA 4RL1A 1KTQA 1N34K 3RMBA 2H3ZA 4E7HA 2LPEA 1K6YA 4Q44A 5J1EA 2PMWA 2EHGA 2BCQA 2RF2B 4DOCA 1Q46A 3Q89A 2QJ3A 4UAWA 2VA2A 2QEXS 2BGWA 5ALTA 2Y9TA 2OPQB 3PHTA 1F5AA 4DR3F 2YH1A 3OY9A 4IJNA 4JI8K 1NXIA 3IBWA 2D7SA 5F9LA 1QD1A 4WJBA 2ZJ5A 2JHEA 4CNYA 1VMBA 2UVWA 8ICJA 3EGNA 1AW0A 4DU8A 2F4VK 1TAQA 1W25A 1RHQB 4J2DA 4GV6A 3B8HA 3OR2B 5LSLA 1HNVA 1BI4B 5AI9A 4JI0J 2G07A 4PPDA 2QWRA 3ELHA 3OYHA 3CCVN 3M2RA 3BS9A 1NRKA 3PSPA 5AXNA 4NMLA 4GVLA 4KB7A 4O9MA 1NPRA 3AVCA 3C15B 5AQVA 2NYVA 4GRSA 3UDCA 5IIOA 3THYA 1SZPA 3M2VB 1SC1B 1U45A 4DWIA 2H5EA 3N4MB 2W25A 3UCUP 2A3JA 3JTNA 2CNOB 2HVZA 5J1PA 1ZA2B 2C3UA 2Z2LA 4Z4HA 4J91A 1ZQFA 4RW6B 1HBNA 5HLFA 5B66U 1UKUA 3SCIE 1VQ7S 4A8EA 4UUWA 4BRNA 3MXIA 3PLAA 4DBQA 2JZ5A 3J80Y 4O23A 1H3DA 3J7A1 1Z2LA 4FXDA 3TVZA 4CEDA 4DN0A 4NYZA 1T03A 2Z0GA 2YTCA 3ZTQA 5IT9Y 3H08A 1WUAA 5HMZA 3QWUA 5EX0A 3PUFA 2QA4N 4ZLLA 2V2VA 5A2QU 2GVZA 2XY8A 3EZOA 1VQLN 2XSJA 5G4DA 3KJFB 4C97A 1A6SA 2RJZA 2IOCA 5J2FA 2XLIA 1BMQB 3U9DA 5CJ7A 4BC9A 1ZZNA 1VQ6S 1OY6A 2B4PA 5ADXH 1ZQTA 1WEZA 2KN7A 1P9YA 3K0SA 2LM4A 3H0MB 1BIZA 3UD5A 3CJ5A 2R7RA 2V4JB 1AQ6A 3QSIA 4FW2A 4EO8A 1VI7A 1UP1A 2DGVA 1T05A 4KB1A 4FS2A 4USHA 2A0FB 4KKOA 3HZEA 1ZZFA 4EX6A 2UUAF 4WZMA 1NPKA 4DQPA 3ATVA 1DOQA 4H5TA 2P9IB 1PVPA 4TKTA 4IOCQ 4HACA 1L3UA 1P1TA 5A6WA 4ZVGA 1J54A 1TAMA 3LUYA 5AKIA 5KFBA 2DCUB 4YB6A 3NWGA 3EVOA 3OBWA 2LQ9A 2XTJP 2F65A 3FKBA 4MFFA 1IG6A 3WNEA 2B7CB 3T1YF 5KL8B 1FDNA 5GAEP 1DJ0A 3AJ1A 2MKHA 5GIOA 3AGRA 3OS1A 2MY8A 1W2IA 4PG6A 3R6GB 2DB1A 1VC0A 2J8SA 5BPCA 1T4GA 4E7JA 2PEHA 4GV3A 2A19A 5KT2A 1S79A 1KLMA 1F5BA 3H5YA 1PJ6A 4DUZK 4WU2A 1Z1ZA 4RQ1A 3PVXA 2R2SA 2XNQA 1N0UA 5BRDA 1LW0B 4PR6A 1N63A 4O0NA 1Z4UA 4EK2A 1KXPA 1U6ZA 2GWKA 4DF8A 1BDGA 2KHOA 4BRKA 5D8HB 2YTUA 4QYZJ 2Q0UA 3IGNA 1WI8A 2ACMA 5DDOC 3OUYA 1T94A 3KD5E 5J2BA 3LVWA 3NGIA 4TQSA 3LVVA 2VQEK 3A3PB 2MSTA 2NUHA 4MK7A 3ZSQA 2ZG6A 2BR0A 1YIJN 1SV0A 2G1DA 8ICZA 3BQ2A 2FJ6A 3MTJA 1BG3A 4DR5F 4PL2A 1ZQKA 1QLNA 3ISZA 2Q2RA 3SBMA 4NRTA 4A46A 1KOHA 4RW4A 3KMSA 3UQ2A 2B8QA 3CMAS 1S4FA 1EZZB 5JXSA 8RUCA 3EGVA 2BJ8A 3LDOA 3UN5A 4X4PA 3RH5A 1U8SA 1JLEB 4X4VA 1SV0C 2HCFA 2KKZA 2UUCF 2DY9A 2RU3A 5KFIA 4ES2A 4TY8A 5D49A 4LVOP 4EAHD 1FJGK 4B9MA 4IL6U 2EXUA 4B08A 3ENHA 3NEKA 4R66A 3NAIA 1WOQA 1X9MA 3ULDA 3LW5C 3C6UA 4O4GA 3HBTA 3S7RA 3DRPA 4JI3F 2CYYA 4NXNK 3L2WA 3C8YA 4ZTFA 3KKSA 4KX5A 4B3SJ 4DQRA 1MN9A 3OLBA 1CJTA 2MUTB 3AVJA 4ZN1A 7ICFA 2PI4A 4WYLA 3GJQB 4G1IA 4MLHA 4GVEA 3MUVP 1RT5B 2DHSA 2L48A 4LF8F 2WONA 1IG8A 5AQWA 1C0GA 5KFFA 2I5HA 1EP4A 3LH2S 5JUMA 5KAKA 1YHQS 4DR7F 3L5KA 1VDVA 3R1HA 7ICGA 5HL7L 4JI0K 1PIEA 4KREA 5DG9A 4NO7A 3H45C 2APOA 2P9GA 3GV5B 1B9FA 1VQKS 5ALUA 1RWXB 1XR7A 4I2PB 5JJBA 4WCEQ 2R8JA 3OA9A 3QMLA 1T44A 4NLKA 4NA2A 1NK9A 4M7YA 2G13A 3VF0B 3VQ7A 1U26A 3GJRB 4MFAA 1X5SA 3A8KA 4IKFA 4NLRA 4Y34A 3NGRA 5HR7A 3AA2A 2CG4A 1WEYA 4BREA 1K1QA 5DKWA 1QQNA 4DR4J 2DGUA 3RB6A 2HNYB 2LBOA 3MPVA 4NCGA 1N36F 3KMQA 4ZPAA 1Z05A 4CHYA 4FYXB 1JLBB 4WP8A 2DRAA 3RJFA 4KHPJ 4DOAA 4HTIA 4M5IA 4LFAF 1S8OA 1HFEL 3IR5B 2DITA 1WUUA 4KH0B 5AQJA 3LP0A 1VQOS 1YLXA 1NZAA 5AE3A 2PMZD 3WQUA 1L3SA 5EUHA 1GXUA 1NDCA 4A8YA 4B17A 1VFJA 4LF9J 1RACB 1BPBA 4WK1A 2X3GA 4O3QA 3AVAA 1PJ5A 3L6QA 2GCFA 1IR0A 4DFDA 3ILOA 4F04B 2R18A 3BGRB 2PMZF 3K9KA 4BRFA 4JRQA 2E8PA 1OY8A 4B1XB 1PBAA 2E7XA 2HFVA 3TJ9A 2PYJA 4K4WA 5DJBA 1Z26A 4Y2SA 1JLCB 1RLCL 3M32B 1KC8T 4N77A 1NI3A 4NLDA 3ZSYA 4ED5A 3C16A 2A42A 5E3CA 4LF6F 4USWA 2LYHA 3AH6A 1NZBA 3DRSA 1T3OA 4PG7A 3OSPA 2W3SA 2FIUA 1HRHA 1ACMB 2O8FA 2C2EA 5HRRA 1TKXA 5DBCA 1TYQA 3BKUA 2W9CA 4DTSA 3KWGA 3IDHA 2IRXA 4FLYA 5CHCB 3ATUA 1RQNA 1BE4A 1R0CB 1B64A 4AHTA 4H0PA 3U3GA 1Q79A 1UMJA 2DL0A 5ITHA 4LREA 3OYBA 2FJAB 3SMVA 2DO0A 4DV7J 1RG6A 4A4JA 4UY8T 3CCQS 4BR5A 3MC1A 3N0VA 4QWDA 4BDPA 3O3LA 3IG8A 2GO7A 3F2CA 5AQTA 1WELA 3V9XA 4CD3A 4PXCA 3CRXA 2OZSA 3ZZRA 3QERA 4QYZK 5HMXA 2XMVA 5D78A 2VG6A 2QWNA 5GVQA 2AYMA 5HN0A 1URJA 1KW4A 2K89A 2ILZA 1RT3B 4YDXA 4AYBD 3QXGA 5D4PA 2ZJQQ 4I2HA 3UE2A 4DV6F 4YNQA 7ICRA 2FLPA 1WACA 2ZDPA 2NZ4A 2Z56B 4JI4F 4BGBA 3FZKA 3A8IA 1S0VA 4RNMA 2D9PA 4KN4A 5GMKa 3HHLD 4K4GA 4AYBF 3IAM9 2ITMA 4BVPA 4HR2A 3TZYA 2DCLA 3W60A 3H0LB 3DGVA 4IQTA 7ICJA 1XHZA 5HHHA 4ZPDA 4PH5A 2C22A 4E2FB 5GAHU 2N7YA 3I28A 2UXDF 1CZAN 4P0QA 2FD2A 1WAJA 3LDQA 1EWQA 2KVCA 4CF4A 4B3MF 1HA1A 1UPPA 2JLGA 4UT4A 4ED4A 2EBEA 3MEGB 3R5DA 4DR1J 3MN6A 4IWVA 3NWRA 3BGFA 5TISU 4DMZA 3KWMA 2XI9A 3VCDA 1NKEA 4FW1A 3MM8B 1HWLA 1QQMA 4B3SK 1WWHA 3IFEA 3N5BA 1K73T 2RE2A 4CZMA 3OS2A 2HHSA 4DTNA 2BQRA 2UUBF 4UQGA 1JNZB 2V2ZA 1Q1KA 3LF0A 2ZGZA 1BISA 2I9SA 3OT9A 2BE7D 4FBUA 3RVCA 3CM6A 2HRYA 3FSIA 2WB4A 2GNKA 3GONA 2YMLA 4QZEA 5HR6A 3EGZA 3QBXA 1CJVB 4KMUA 1XQIA 4BRGA 3O9TA 2RT3A 2XULA 2UV8A 1X4AA 1IBLF 9ICOA 2R7SA 5KAIU 3PW4A 4ZCKA 5E3AA 3WU2U 5AK3A 1RT1A 2WF5A 2CWXA 1URRA 3KD3A 1WHYA 4KQZA 3IRXB 4F72A 2QLWA 3H42A 5E84A 2CGJA 1BI4A 4DR4K 2FLNA 5CXTA 2I0XA 3RJGA 2H4WB 5HAOA 1X0PA 2FJXA 2EFVA 1RAHB 2IY5B 4P4OA 2J6SA 3ULHA 2NSBA 5AM4A 2J6UA 1F9FA 5G0RA 1BPZA 4JKAA 2V52B 4BC3A 2NNWA 2R7TA 3PW7A 3BDPA 4CJRA 4LF9K 3AO1A 1YI2N 4RQ8A 1B3TA 4X66J 1RBLA 2EBGA 3MGVA 3TABA 4NRUA 3KK7A 3E9OA 3VQSA 1TKTA 5EY4A 2NUBA 4CGHA 1QQOA 3UE5A 4PGXA 4ID1A 3RRGA 5HROA 3O6WA 3QIOA 2F8EX 3R8EA 4JK1A 3OYNA 4UOHA 1ZQZA 1H0HB 2DY4A 1ZPWX 3KKAA 4FJNA 1SCJB 4M5DB 4CHOA 4QYRA 3OW2R 5ALNA 3DM2A 4CGZA 4NASA 3SSRA 4CH1A 2HB5A 4GFJA 2VGNA 3ZZZA 4U7BA 4R65A 1NB2A 4J90A 4UB8U 4MTPA 1Y0HA 1FX4A 2HFNA 3LP1A 1FXLA 2P9IA 3KKAC 1OWXA 3U1NA 3WNHA 4RQ4A 4F67A 4JI7F 2R3VA 1K5OA 2HBZB 2I5JB 1HWUA 4E8UA 1WSFA 2N1RA 2IC3B 5FLXU 2PIIA 1SQGA 5JICA 5AKLA 4F50A 1G1XA 1RHMB 3MFHA 4DR5J 4BS2A 1IJEB 2NRHA 1IV0A 3UMBA 2ZZNA 2LM1A 4P4MA 4K4VA 2Y8YA 5FDLB 4DV7K 5D4OA 2H65B 4WFAL 4I2GA 1WDTA 2IJNA 1VHXA 3BKFA 4DSEA 1YQHA 4O3NA 2DNNA 3IDWA 4K50A 2PYLA 2EAOA 2PFNA 1TL7B 4BR0A 5AQPA 4CO2A 1AT1B 2E2NA 4CEAA 4H4MA 1S1TA 3ISND 3LDNA 3VC8A 3HSGA 4B3TJ 3CJ8A 3CIZA 2KOBA 3B9JA 3EY1A 1LW0A 2IJFA 4Y28C 1LAWA 4A59A 3D6FB 3HTVA 4AHSA 3K5PA 1SAZA 1KCFA 2FGCA 3IV6A 1UVKA 5LY3A 5ALLA 2DBBA 3WDOA 2GHPA 5DM6Q 3SBGA 5J2IA 4A8XA 1QCKA 5L39A 3RMDA 1ZQBA 3A0IX 3N7SC 2HWIA 2J0XA 4JI1F 3CPEA 4BRHA 3SUPA 4CK2A 4OJ1A 2ZUBA 2K4PA 5GTIU 4CLYA 4X4OA 2QE5A 5KFJA 2NRTA 1WWUA 5HMYA 4LF8J 1QVGM 5IIKA 2ZUAA 4J2EA 5IC6B 2AQ4A 4CBWA 2XMKA 3T9ZA 2G5IB 4QWCA 3LWMA 3PO5A 3WQTA 4XDCA 4PXBA 4DR7J 3B0XA 1YF5L 2D6FC 2W7AA 1YJRA 2RDIA 3ZD9A 1G2EA 1IKYA 2XYHB 1R27B 1JLAA 3CJCA 4I4BA 3NH0A 4M2YA 3J7YI 2C2OB 2Q3SA 2VKZG 1SXDA 2ZVIA 4FNIA 1NZ8A 5KFYA 5IM0B 3E3XA 3V9WA 3FSXA 3HVAA 4M63C 5IXUA 2GLEA 4LIWA 3ENBA 3J7ZT 3AO4A 3ZDEA 2KRRA 1X31C 2EZYA 3W63A 4CZCA 2RKIA 1PC5A 3PFOA 1IKXA 2HIQA 3GU0A 1D09B 1SL1A 1OH7A 4H4OB 2FZGB 1N54B 1E6YB 4I56A 3M6UA 2XEXA 4IG3B 1REVB 4PL1A 2C3YA 4EEYA 3O3GA 2Y8WA 3UMCA 3SCLE 4FF3A 3CHWA 2QT7A 2MUTA 5KFKA 3C6TA 2VZ9A 2G2OA 1FRKA 4WQ5A 1F44A 4CLZA 1ROFA 2CPXA 4ZKAA 2H5IB 3MABA 3OTBA 3UIQA 2X6SA 4E3SA 1K8KB 1JJCB 3D1OA 2UYTA 4PHAA 1YJTA 3CMES 3PRDA 1X3MA 4FO6A 2DGSA 1TL4A 1Y3JA 1GK8A 1ZTWA 2OTJS 1ZQXA 4M9GA 1H6KX 4AQYJ 4JI2F 1M5OC 1CULB 2E8AA 4WQ5C 3D67A 2VA8A 2CIMA 4CJKA 4DCHA 1I51B 3SR6A 3N79A 2B3TB 2UUAK 2YNHB 1GLEG 2FVQA 3ET6B 1L3KA 5FRMA 4F3OA 5IS2A 2JEFA 5M1QA 4QZCA 1JJ4A 4HUFA 4R63A 2GQQA 3NFAA 1NGJA 1LKYB 3ZO7A 1TU0B 4I68A 3T6JA 2HNYA 4C0HA 4X66K 4LF6J 4UASA 4MH8A 2U2FA 2OSQA 3VOVA 2MZJA 1ESVA 1W9HA 3DXBA 2QLXA 4RW8B 4YUDA 3CCRS 3V72A 5A8KA 2BUNA 2VFRA 4LF4F 4MO4A 4MT1A 2W11A 1U1OA 5B7WA 2COLA 1N5YB 1N5XA 4MIBA 4CLFA 3SLCA 1K8AO 2DNOA 4KH5A 3ASMA 3UCZP 1F9HA 2UUWA 3NCQA 3FAHA 4DL0C 1HUOA 4TLQA 3SDEA 4IH6A 1Z1VA 3MXJA 3GQCA 3ZDBA 4JI6F 2DKZA 1M1KO 1YZ7A 4NLSA 5C24A 3TYTA 2W8LA 1IR1A 4M3UA 1D1UA 1UZDA 1I3AA 4CLPA 1RBRA 3DLJA 3C3LA 2AYEA 2UU9J 2LLZA 3VVTA 3QSYB 3EZ5A 1VCTA 3NS7B 3WIVA 2HQCA 5I3UB 4DV6J 5HO4A 5I3QA 4ZPTR 2EK6A 3I5CA 2YB4A 4JI4J 4QZ9A 4DR5K 3QFUA 4LF2A 4FJGA 1FF2A 2JJ4D 1WC1A 1KAXA 4JOUA 3EE8A 3JPPA 2MZTA 5AZJB 3NXZA 2XM3A 4JB3A 2WZ1A 2YVSA 1JXLA 4FDFA 3G4SN 2D5RA 2OP5A 3J8AA 1BPDA 4YOXA 3K57A 2ROEA 1MWKA 2UUCK 5LL6Z 1S7HA 1N88A 4A8FA 3GZFA 2XY5A 1TL5A 3R5CA 4M3RA 1X66A 4RW7B 2WCXA 3CWJA 1HKAA 4F5OA 3PYEA 2ITGA 3AVIA 2KVSA 3D2NA 1RFQA 4ECQA 2WW8A 3C14B 2K7KA 5J2HA 1DHMA 1A5XA 2ASPA 2A18A 4TN2A 3ZDAA 4ILMA 2HFSA 4I2BA 2EI5A 2ZE2B 4KYZA 1FXXA 4DSKA 3RMCA 4CF8A 2HDOA 2GQ2A 3JQKA 4MKVA 2NPIA 2YCHA 4LF8K 3I1YA 8ICKA 4WYWA 2CDRB 3FR0A 5KFHA 1JKHB 3OGUA 4DR7K 3TA1A 2V4RA 1RAIB 2AU0A 1UJ5A 3TADA 1KEJA 4IS7A 2Q43A 3W66A 4I69A 3V6DB 5ALJA 4ZVHA 4ED6A 1NWKA 3M1YA 2LKYA 4RUAA 2LA4A 2FMSA 4FJMA 3RRKA 2GVDA 2MQQA 2EW9A 4TNOA 3JAMO 3CGIA 3THVA 3VMFB 4CLWA 1S5LU 2BQ3A 1X9WA 2JFKA 1OXJA 1X9XA 2YBVA 1RYRA 4CQ1A 4M3ZA 3TFSA 5ALPA 1QHTA 1S57A 3MEGA 2KH9A 3TADC 4UW2A 2KU7A 5M2RA 3PXGa 1KKHA 3CNQP 1N36K 4DF4A 1U0HA 1VSJA 1BQNA 3O9RA 2R2TA 2NYHA 2EZZA 2IHMA 3Q24A 3C7NB 5L1MA 4QR1A 4JV2A 2BW2A 1GMWA 3NF7A 3GYNA 2KIVA 4EBEA 1BCOA 3B54A 4HT5A 2E5JA 2CXYA 1S1VB 1T7PA 2YI1A 2FPHX 4C1NI 3MECA 4X64F 2AGQA 1V85A 4F36A 3MMAA 2ALZA 5TZVA 3DV9A 2X7IA 4B3RF 4MK9A 5AIAA 4EGLA 1E4GT 2I7PA 1N4LA 4I2JA 1CJVA 3ALRA 3IMXA 1MU2B 2W4CA 3QJLA 2ZIWA 1GMVA 3MMVA 1IV8A 3ZTOA 2QEXN 3Q0AA 3FZHA 1KTVA 3G82A 3AO5A 2HGNA 2VJVA 2G8KA 2G9OA 3CJ2A 2B43A 1NK7A 3VQTA 4CO0A 4LF6K 4E1JA 3TQEA 3U6FA 2XLJA 1LQ9A 2KXHA 3MR5A 1LB2B 1TL3A 2BANA 3HZ6A 3ID8A 4XQ8A 1JJ2M 3AMZA 2P51A 4MQ3A 4B8AB 3LZIA 4K41A 5KFOA 2RS2A 2CJQA 2GO9A 2D3ZA 3BDEA 1VQ5N 4DSIA 2AGPA 2MHEA 4J2BA 5KFXA 1U49A 3OXLA 3KHGA 3GJTB 3K59A 4GMJB 4NPOA 4LR7A 5CYQB 4C6AA 4Y0FA 4IFVB 1X1PA 4CEFA 2RHFA 1GO3F 4Z4IA 3IGVA 2OPSB 1SZHA 5IWAJ 2KXFA 1JXEA 1ZQNA 9ICTA 1IVZA 2E4LA 2BQUA 4UTGA 2DHHA 4KITB 2RUGA 2FDRA 2IPOB 3V6JA 2FVPA 2I1QA 2P9SB 4FN5A 2FZCB 4PL7A 1R3NA 4B9LA 3IKMA 1WG5A 3CI5A 4FYWB 1NMEB 1BGXT 3A0HU 4IG0B 5CCMA 4DV6K 3I56N 2NQPA 2YX6A 3TSPA 3K58A 3CCLS 1RT6B 1Q9YA 4JI4K 2KZ3A 1WTBA 2GJFA 4HTUA 3HFZB 3QAUA 2BXJA 4OHXA 3PMLA 1VQ6N 4JHDA 3UXOA 5BRHA 4IOCL 3BSAA 2ZF5O 3CTRA 3TJAA 4URSA 3ZFVA 1FX2A 3MPWA 4X2BA 2RPIA 2ZBIA 2DJWA 4JI1J 1RKJA 1KVKA 3TUJC 2M5YA 3H8MA 3M6GA 4H0TB 2WVEA 3F5TA 4YR3A 2I5JA 5LXYA 3ISDA 3EE3A 1F3FA 1S10A 2YXLA 2RB7A 1C0MA 2E1YA 1CQNA 2OO4A 4B3MK 3TFRA 3SENA 1RWVB 2WHEA 4DQQA 3S3NA 4PWDB 2WOMB 3GIJA 2V2QA 1ZA1B 3QQCD 2ZWHA 4EELA 3C65A 1SV4A 1H7XA 1RQLA 5ALMA 2H51B 4Q0BA 2WVCA 3MM5B 2B8PA 2Z2MA 1G15A 4E1MA 2WVDA 3DXMB 1HBMB 2JRZA 4DV5F 2F1FA 2GIQA 1XUPO 4K4IA 1N6QB 2R7VA 3VGTA 4F2RA 1FXDA 2FHKA 4CF2A 2VC0A 3GWCA 3UO0A 3R1XA 3BZCA 2YKMA 3S3OA 2GFFA 1EX4A 5LMUF 4XAKA 3CC4S 1RPLA 1YJNN 4Y2VA 8ICOA 1WG1A 3KG4A 1UQVA 2LECA 5D0GA 5GTHU 5DLGA 3SNNA 1WSHA 3AVFA 4RPXA 2H5JB 4M5HA 1WN7A 3T5JA 3CJSA 3CJAA 5F3ZA 2RDDA 3M9NB 4MIWA 4F8RA 2V34A 1XK8A 1T9VA 4FWQA 3S6EA 4QIFA 2BMBA 2X3DA 1HMVB 3TAMB 4JI2J 4QAGA 4M6WB 4WU3A 3H0RB 3L3FX 4ECSA 4KY3A 5IQQA 2R4FA 4ATNA 1N32F 2W24A 3LL3A 8ICMA 3O4QA 2FC8A 2K3KA 4FJLA 5D0EA 4OPKA 3KZBA 5A0YB 1X4FA 2VD3A 2B9EA 2W9MA 3QU7A 2YNFB 1HQEB 2H4YB 2KT2A 2DXEA 3KOOA 3CIMA 1NOMA 3G9CA 4NM1A 4O3OA 1Y5NB 5KFQA 5DDQC 5GAGU 2P9KA 5GAHI 4FPBA 2ASOA 3HULA 1RT7B 4Y2RA 2BABA 3JAMY 4DPYA 3I9ZA 3M8ZA 4CBXA 4IQVA 3MGHA 4FLTA 1TK8A 2Z2YB 1YK9A 4DV4F 2V6AA 2GMHA 4USIA 1LEOA 3FFIA 2OPPB 1XMQF 1WSRA 1PCAA 3W2WB 5BXIA 1QSLA 1ZQVA 4KTWA 4YDUA 4WCEL 3CQXA 2JEIA 1V3ZA 2QO3A 1QAYA 4HH1A 4ZITA 4XPEA 2GX8A 3J81j 1RWPB 4ZS6A 2KFNA 4JI6J 2E2OA 1XBWA 4ETXA 1RAFB 2DNLA 1BVSA 1D3WA 1M90O 2Q4TA 3IRUA 1NBEB 1YHQN 4EYHB 3PG9A 3S01A 1DGSA 3DLBA 3QIPA 3KXDA 8ATCB 4O0IA 4YDUC 2DFFA 1PC4A 2VDHA 1VQKN 2J4RA 3LPEA 3VGKA 6FD1A 1KFDA 1SC6A 5KOWA 1WC4A 2W03A 1WBBA 4H8KA 5ALFA 1JNRB 2FMQA 2VOPA 3C0BA 4AF1A 4WK3A 5IZHA 1SJ4P 2A1JA 2EVZA 4CM0A 5HQMA 2E29A 4USKA 4RNHA 3GDXA 2F8LA 1YX2A 3NHGA 3IFRA 2VPWB 3AA3A 3PMNA 2FF3B 1QVFM 2XYGB 4CT9A 2BOPA 4UB1A 3CJQA 1FFGB 1N5YA 3GIKA 1JROA 4CGGA 4YORA 4OJRA 3DRYA 3QJPA 4NLPA 1VQON 4GY2B 5M1PA 5M1KA 2QB0B 4F4ZA 5KPRA 4O44B 3NGTA 3HHLB 1X3NA 1O03A 4OI1A 4URQU 3RJJA 1EKRA 2DXDA 4C0ZA 5CAAA 5J0PA 5HMLA 1E4FT 4CW7B 3CCJS 1VSEA 4CHZA 1C0UB 4JI1K 1HL6A 3MM9A 3AOCA 4RNNA 3NKYA 1C0TA 5I3UA 4C23A 4YD1A 4P4PA 1Y64A 3OHAA 4FYDA 1HEKA 5I42B 2B56A 3AVGA 4KSEB 3JXUA 2B0GA 1TAUA 2YKAA 3UPFA 4DR2F 2ILYA 3OYMA 3AT1B 3KHRA 5AZJA 1DEJA 1WTFA 1ZD5A 2O8DA 1V9PA 3FEXB 3WQPA 1WHWA 4RQ0A 1HUZA 4TYAA 3SEIA 1S9EA 3ZNUA 1FKAF 4M47A 2DNPA 1IXRA 4ZHRB 3RUBL 1KEKA 3G8QA 1VSHA 2MQPA 3DLKB 3I33A 3JSYA 2BHNA 3JPNA 3G71S 4LY7A 1F1BB 2C42A 4CLTA 1Y10A 2Y1RI 2CJXB 2HAIA 3P96A 3BH7B 5B0BA 2QWLA 5ETVA 1KP6A 4J9PA 2MU2A 5ETRA 4CIGA 3HRDD 2R8GA 2BV3A 2CUYA 4X4NA 2JMGA 3MM6B 4UAZA 3OHBA 3OYDA 4KLUA 2XMTA 2ZJQL 1U2FA 2Z4PA 1JN3A 1RB0A 3M8PB 4LSLA 2ZE2A 7ICTA 1TKDA 3ID6A 1S6PA 1N5WA 5EWGA 1RLDA 2DBYA 4YOVA 4MIAA 3P38A 3A5MC 3C2KA 1M0SA 4ZIWA 4HI2A 1LK7A 1SH3A 4LQ9A 4Y2IA 3SFGA 4NLGA 3HHDA 3GDQA 4X64J 2IOHA 4ILLA 3CEDA 4YD2A 2FB0A 4P73A 4B3RJ 2NUUG 5HSPA 2HMPA 4IRCA 4LMZA 4QNLA 2GWJA 1O0PA 2B5JB 1WF2A 4CTAA 5F3TA 3RWUA 5T41A 4JI2K 2E9RX 1ICEB 1QE1B 1FVSA 4PZNA 3LAKA 5ALHA 3CJKB 1GX6A 3UDVA 5ETTA 2HHWA 3UVJA 4C4WA 3ALYA 2WHOA 3PJXA 4DZDA 3BR9A 2MRLA 4UB3A 5LSOA 3CP8A 4YB5A 4KC5A 3BP8A 3ZT0A 2RH3A 2BA9A 4MDBA 5F8MA 3SQGB 1QSSA 3MHYA 3HHEA 3GFKB 1RTIA 3RJIA 1VSKA 4OYZA 4QZBA 3L4IA 3CCEN 1IBKF 4GC6A 5KG7A 4JK9A 3QESA 4Q43A 4J9SA 4UF4A 2DR6A 2OEHA 1TV6B 4OZLA 4BCAA 4CF9A 1JWWA 5AQIA