2Y1JA

Crystal structure of a r-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1jA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1jA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1jA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1jA01
1EXNA 1UT8A 3JPQA 1TK8A 5E41A 4MFFA 3OYAA 1KVCA 3PV8A 8ICNA 4IQVA 3SCXA 4DL5A 4ECXA 4OPKA 1VSMA 4DTRA 1QLNA 1IKWA 4EZ6A 4HHTA 3OHAA 1WSIA 3DLKA 2O4GA 2ZTEA 1Q8IA 4BE1A 1TAUA 1CXQA 4J9OA 2FLNA 4KHQA 3SYZA 3PX4A 2FMQA 5J0SA 3QE9Y 2X6SA 2G8VA 2AGPA 1NKBA 1TVRA 2W9CB 4M9GA 4RT3A 2VG6A 9ICBA 4I2DA 4FBTA 3RB6A 3OYHA 3PX6A 3QZ7A 1QE1A 3RH6A 4ECUA 4X5VA 3EWAA 4OLBA 2FBVA 4W5NA 2XY6A 3KK2A 4KLSA 3NBPA 3M8QA 1ZBIA 3LPUA 2WOMA 3QESA 1C1AA 5L9XA 5KGXA 1MSWD 2AQ4A 1SKWA 4UQGA 2AGQA 4RT2A 2V4RA 2IS3A 1VSLA 5IIJA 2GV9A 4FJJA 4FJ5A 4PGXA 3EY1A 1MC8A 4ED2A 4LSLA 2ITGA 9ICMA 4FLXA 4FBUA 3AU2A 5KRSA 4E3SA 4CEDA 3ITHA 4B9VA 2IOCA 3O4QA 4LY7A 5DGAA 1RT7A 3WNGA 5BOMA 3AU6A 5DB7A 3C2LA 2ZQBA 4DTMA 4EYHB 4HTUA 2BCRA 4UAWA 1CZ9A 5KRTA 5KT2A 3CFOA 4KITB 7ICRA 3C94A 3V7KA 3QO9A 3AUOA 2HNYA 3NFAA 4KTWA 5KFOA 2UVRA 1V9PA 2W8KA 3L3VA 3O3GA 3V6KA 4CIFA 1ZQAA 1RNHA 4Q0BA 4J9MA 2JEJA 3AVLA 4M9JA 2DFEA 4ECSA 3AVFA 1QHTA 7ICQA 2HHXA 3E2EA 1CEZA 3TFRA 3RJJA 5DBBA 4IRKA 3TANA 5IIIA 3RR8A 1S1UA 2E4LA 4FJIA 5KFCA 4OVLA 2IAJA 4W5QA 2C2EA 2XRIA 5KFHA 2JLEA 3SV3A 5KFZA 1U04A 3V9UA 8ICQA 4E7KA 3HPGA 2PFNA 3HYFA 4JRQA 3IM1A 3T19A 8ICAA 2M9NA 5HRSA 1ASWA 4YR2A 1NK8A 2F1IA 3OSPA 1VSIA 1ZJMA 7ICFA 4C8LA 3V9WA 4DF8A 1C6VA 4YMOA 2PFOA 4O3SA 3IRXA 1MU2A 4CFBA 1C1BA 3Q8SB 4RQ7A 2RKIA 7ICNA 3CM5A 1IG9A 2PY5A 3JYTA 4YD1A 5KG4A 1FKPA 3MECA 1QSYA 3SUOA 2W8LA 1IKXA 1HNIA 9ICWA 1XS9D 2O4IA 1NK4A 1VSKA 1JX4A 4BWJA 4B9MA 1XSNA 5KFSA 3LPTA 5J0RA 3RJFA 3OY9A 3G10A 7ICOA 2NRXA 4RNNA 2GBZA 5J0QA 1Q9XA 4EBEA 4BXOA 5JUMA 3SZ2A 2XY7A 4OGEA 4KHWA 4FK4A 1KRPA 3LK9A 1UT5A 8ICHA 4PHEA 4M42A 4Q45A 1ZQVA 2KN7A 1WSGA 3RWUA 4DSEA 4PGYA 3CFPA 4LD0A 3AVCA 4IG0A 3EPGA 3PMNA 4XRHA 4JV2A 1WSEA 3DRRA 3I8DA 2YV0X 1L3SA 4DTNA 4O5BA 3K58A 4YMNA 5EU7A 4CJ5A 2D0CA 4Z6EA 3V81A 5KG7A 4EP5A 3L3UA 4R5PA 4P4MA 4B9LA 9ICEA 9ICHA 4KN4A 3AA3A 3I0SA 4M3RA 4AH9A 4N5SA 2ISPA 4YMMA 3SI6A 3PW0A 1S1WA 3V7JA 4Z4IA 4RUAA 3KHGA 4CEOA 5F9NA 2X6NA 1YT3A 4FJ9A 4DSIA 5HROA 3OYMA 3T5HA 2UVVA 9ICGA 4FJKA 1HMVA 1TKXA 4CHYA 4JUZA 2X78A 4ED6A 8ICTA 4JV0A 4QZEA 5I3UA 3D45A 3B6PA 2P6RA 4DS4A 4QZ8A 4FM0A 1I3AA 4ECZA 3AO1A 1HUZA 2HNDA 3M8SA 1B22A 4QOZB 4RW9A 1S9GA 4QZDA 1TK0A 4FLTA 4GMJB 1ZQFA 3RR7A 4MEXA 4TUPA 4KPYA 5KFTA 4F4YA 2XHBA 3EYZA 3O4NA 2W9BB 3H8JA 2R8GA 3TAMA 2F8TA 4RUCA 4DU1A 4F5NA 3V4IA 2G8HA 2D5RA 4QZCA 2ZUCA 5J2IA 3AVGA 4W5RA 3ULDA 1Z00A 3ORYA 2JEIA 4I27A 1RDAA 3KLGA 1GOBA 3K5MA 4OJRA 2QK9A 3UQ0A 2JEGA 1COOA 4F91B 3ALYA 4M9HA 4KO0A 1TKDA 4KB1A 3GIIA 5DGBA 1ZQDA 4O3PA 1D9DA 3AVBA 4FW2A 2FBXA 1JL1A 4CIEA 3M8RA 1IM4A 8ICXA 1ZQEA 3TARA 1RTJA 3QEIA 8ICUA 1X1PA 5KG3A 4YVZA 2Q0ZX 1TKZA 2JGUA 2NRZA 4I2JA 4QWEA 3LANA 8ICWA 3QETA 3VQEA 2P66A 4I2IA 4CGIA 1EKEA 4PQUA 9ICAA 8ICOA 4CIGA 1VSJA 1TFRA 3Q8MA 3NH0A 4EBCA 1FK9A 3IG1A 3ZDAA 9ICFA 4JWNA 4PWDA 4QWBA 3G6XA 1KCFA 4F4ZA 4F3TA 4ED7A 3N97B 4KLEA 3NF9A 3BQ2A 7ICLA 1XSPA 4M6WA 3D0PA 4B9SA 4M3UA 2B21A 1Z26A 1L3TA 3KHLA 4E1MA 2J6UA 1BPEA 4I2AA 3LP0A 1XC9A 4KAZA 4QW8A 1ZQTA 5KFYA 3M9MB 4YG2A 2KW4A 3M9OB 3AVKA 4CEEA 3SV4A 4FZYA 3ASMA 3AVNA 4RNOA 1C0UA 4Z0UA 4M47A 2ZUBA 3SQ4A 1JKHA 3PO5A 1X9SA 2BCQA 7ICSA 3MDCA 1S1VA 1KFDA 3EPIA 1S1TA 1REVA 2IDOA 4KLUA 8ICEA 3RMBA 2EX3A 3QEVA 8ICGA 1ZQUA 1H38A 5KG0A 5KFRA 3PY8A 3PVXA 3UXPA 9ICVA 2XCPA 1XU4A 4IRCA 3QEXA 5J0PA 4YR0A 4CFAA 8ICVA 2G8FA 1T8EA 3TR8A 5J2QA 1RXWA 3U6FA 4F93B 1X9WA 4HVJA 3RMAA 1CLQA 4TSXA 5KTQA 4LH4A 1TAQA 4CJ4A 5KFNA 5J0WA 4K4IA 4CJUA 3QINA 3IAYA 3RMCA 2PI4A 1JLBA 1F21A 1VK0A 4I2EA 5HHHA 4OKKA 1K1QA 5HRNA 1W9HA 5DKWA 1JLGA 4M0AA 1S6QA 1U9LA 4W5TA 3ZCMA 5HHIA 1D8YA 1X2IA 3AO5A 3ZDEA 2C2RA 4XA5A 4RQ0A 4RPXA 3MR2A 4GLXA 4FO6A 4NLNA 4E7HA 4FM2A 4OGCA 2R7YA 4FK2A 4QWAA 3S9HA 1BCMA 4AHUA 1VRUA 2BKEA 3H4BA 4FJMA 1BPXA 1HYSA 7ICUA 3VQ9A 2ZJ5A 1TVAA 4Y1CA 3DMJA 2DFLA 3N4MB 3K75D 1L3VA 4DSKA 3KJVA 4GXJA 1BVSA 4ED1A 1S0OA 4DTUA 2IBKA 3NF7A 4FJNA 3HXMA 3JPOA 1LB2B 5DQGA 3JPTA 4M04A 2R8IA 4DTXA 8ICIA 4FJ8A 3QNNA 1W0HA 3HP9A 3AO4A 3LALA 4ZH4A 4BXOB 4BACA 5K14A 3KKRA 1JLEA 2YKMA 5DDYA 4FJGA 1WSHA 2NUBA 3RAXA 5DB8A 3VQ5A 4CGHA 1LWCA 5KFWA 1RT4A 1ZJNA 4B9NA 1WAJA 2FPMA 4BDZA 1UA0A 4OKEA 5J2HA 5CB1A 4N47A 1CUKA 4RG8A 1UAXA 2RN2A 4P4PA 1NK6A 4CEAA 5L1LA 3ZDDA 1XHZA 5J2JA 3P5JA 1Z3EB 4KLFA 3OYIA 4HCCA 1ZQKA 3QNOA 3UIQA 4FS1A 5J2NA 1D5AA 4J9NA 1UWBA 3VQPA 4NYFA 4E7IA 5DG7A 3F73A 3V1QA 3T5KA 1B43A 3OYKA 2FC0A 5EWGA 3C6UA 2YNFA 8ICRA 2PYJA 3ISBA 3IHQB 4CECA 3AA2A 3CM6A 4EEYA 4CEQA 4YQWA 3HX0A 1BQMA 3ISDA 4DG1A 4FZXC 3JPRA 3LWLA 1RT5A 5CZ2A 4ID1A 1ZQPA 3HSTB 1ZQRA 4IQTA 3BQTA 1A5VA 5JS1A 1C7YA 1DTQA 4AHCA 3GV7B 3TABA 1T03A 1WSFA 4CK1A 1TV9A 2MUTA 1AROP 4KHUA 4N76A 4CK3A 5KFVA 2GWSA 4GC6A 3DLHA 1KVAA 4GW6A 3AVIA 3U3YA 1O1WA 2BQRA 4JV1A 1FXXA 1Z00B 2I1QA 2W42A 4RZRA 1MQ2A 1ITGA 4MFAA 2BR0A 3DLBA 4KLHA 3UXOA 3C1YA 4DOBA 2NRVA 1B92A 4KLJA 4I7FA 3LP1A 3L2RA 3VA0A 3LDAA 3S3MA 5J0UA 1XO1A 5HMMA 5BOLA 4ED8A 1S76D 3K5NA 3E01A 4HUEA 5J2FA 4PA1A 2J6SA 4DSFA 2A1RA 4C8MA 1ZBHA 4GXIA 4NCBA 2ZE2A 2KTQA 1RBVA 3NH1A 3TI0A 2ASDA 3UQ2A 2XGPA 4DF4A 2DY4A 4UBCA 2BPGA 4TQSA 4M2YA 3LWMA 2A1SA 4CHPA 4QZ9A 5KFXA 1HRHA 3AVMA 4LSNA 9ICCA 3GDXA 3WNEA 3MBYA 1SL2A 3LP3A 1BPZA 3KIOA 2VA2A 4BDYA 8ICBA 4Q5VA 4FZZA 4Z4FA 3RB4A 3QERA 3HK2A 4CF9A 3PNCA 4M6WB 2OA8A 3F9KA 4EZ9A 5DG8A 3ETLA 4C8NA 4E19A 2P5GA 3OS0A 3GFKB 3KHRA 4B9UA 3C95A 1U49A 3OS2A 3ZT4A 1ASVA 3JPPA 3KLIA 3ZDBA 3C5FA 4AILC 4NLKA 4FM1A 3AVHA 4UAYA 5J0YA 4DLGA 4OKJA 1BCOA 4Z6FA 4CEBA 4CJVA 1N6QA 2RDJA 1GOAA 4IR9A 3Q8QB 3VQ8A 2BE2A 2BCSA 4BGDA 3AA4A 4Y1DA 1Y88A 4N41A 2F1JA 4EBDA 4Z4CA 3HO1A 5KFDA 1QSSA 4UAZA 2F96A 4I28A 4YNQA 3Q8RB 4KHNA 2B5JA 3L2QA 2XGQA 1ZBLA 1HJPA 1LW2A 3S3NA 2AGOA 4CJSA 3KD5E 1VRTA 3V9SA 4FJHA 1CZBA 1RBRA 1BPYA 5DLGA 4B3OA 1TL3A 3QEWA 1LWEA 2I5JA 4IQUA 3MXMA 1WCLA 4CF1A 4ELVA 2HMIA 3BDPA 1N48A 4KKOA 5KFUA 3G0ZA 1HQEA 1RYRA 1NOMA 3DRSA 2ZTDA 4RW8A 5SWMA 2PI5A 3BJYA 5KG1A 4I2CA 1JLFA 4PHPA 1NK9A 1J53A 4I2PA 4BE0A 3NF6A 5DMRA 1U4BA 4TUSA 3MR6A 4ZTFA 1ZQOA 4Z4HA 3TQ1A 3HJFA 1LAWA 7ICVA 2VWJA 4J9RA 3EW9A 3ZT0A 1T4GA 3TAGA 4CJEA 3MGHA 3H40A 4QZBA 3QEPA 3TAEA 4QWDA 4MF8A 2V9WA 2FBYA 4NCGA 1U45A 4C8KA 5CR0A 4DQQA 5DB6A 2AU0A 4RQ5A 1QQCA 4O44A 5J1EA 3HW8A 5KFGA 3TAPA 4AHVA 4O0JA 4YFUA 1NOYA 1Z25A 3NF8A 4PHDA 4UB3A 1L3UA 1TKTA 2ZUDA 4EYIB 3RJKA 4O4GA 3ZD8A 3RRHA 2ASJA 5KI6A 3MEEA 4J2DA 3K4GA 4UBBA 4I2FA 1MQ3A 4CFCA 1BHLA 1DOQA 2XY5A 4FCYA 1B9DA 1YTUA 2XC9A 3QZ8A 5KFIA 1RTDA 3IS9A 1CXUA 4FLZA 2FBTA 3ISCA 9ICIA 2I9GA 5HRPA 4NM2A 2JZBA 3TFSA 2FLLA 2G8WA 1IXRA 3LDSA 4O3QA 4W5OA 3VQ4A 4IFYA 4NCAA 3OJSA 4ELTA 5IINA 5KGWA 2WTFA 4M3XA 4TQRA 4O5CA 5L1JA 2BHNA 3ZT2A 1VSDA 1SZPA 4NXZA 3V1OA 1ASUA 4YCXA 1KSPA 4M45A 3WNHA 2C28A 4OPJA 4GC7A 5J2GA 1WSJA 1QS4A 4UB5A 4CF0A 4ED3A 3VQQA 2OPPA 2NRWA 2UVWA 1Y97A 1BQNA 4DSJA 1D9FA 3LZIA 7ICKA 5I42A 5KT3A 3TAFA 4QCLA 4FVMA 4P4OA 1JXBA 3ZSYA 4DQRA 1UA1A 4ICLA 4K8ZA 4C8OA 3GILA 4PY5A 2ZJ8A 2KZZA 2AJQA 2W9AA 1RCHA 1U48A 1ZQBA 1S9FA 3L2WA 4KI6A 5IIOA 1GOCA 2D0BA 2YHAA 3HVTA 1JN3A 3NGIA 4O3RA 1S10A 4R65A 3NTUA 5C5JA 3SQ2A 3VQAA 2IC3A 3SUQA 4J9QA 4F5OA 4IG3A 1RILA 3L2UA 1RBTA 3V1RA 8ICLA 3K57A 3MFIA 3H4DA 4BDPA 1C1CA 4J9KA 4CHNA 4DU4A 1IKVA 3H7IA 2MUTB 3H8WA 7ICMA 2LYHA 5J2PA 4O5EA 9ICNA 3HP6A 1RYSA 1ZQQA 4DFMA 5SZTA 2VG7A 4R63A 2UVUA 5KT4A 1B9FA 1HNVA 2XCAA 2H5XA 4CJPA 4Q8FA 1TK5A 3DI6A 4JK1A 5JS2A 3DYAA 3ZSOA 4H8KA 1NKEA 2R8KA 3CQ8A 2XY8A 4FYDA 4R66A 3OYJA 5DBCA 3OS1A 8ICYA 1JLQA 1RXVA 3AVJA 3GV8B 3QIPA 4KLLA 4RQ1A 3JSMA 5HNKA 1SL0A 3MGIA 4O3OA 3B0YA 2JEFA 1TV6A 3MEDA 1RTHA 1RT1A 1UOCA 3C2MA 2B6AA 1PZNA 4IKFA 3NDKA 3MXJA 5FRMA 4RQ6A 4CF8A 3BQ0A 1QTMA 5DBAA 2DTUA 4ECWA 1JL2A 5DQIA 3RJGA 3KLFA 4UB2A 2BCVA 2OPRA 3PW7A 4P2HA 2RPIA 3B6OA 1BPDA 4I2GA 3KHHA 3Q8PB 1JMSA 3CFRA 1NK7A 1KLMA 4KHYA 2P1JA 2XO7A 2G8UA 2OZSA 1ZBFA 3ZT1A 4PH5A 5HLFA 3SJJA 3PR4A 3MEGA 4F5QA 2OPQA 9ICPA 4KN7A 4E7JA 4CJ3A 7ICHA 9ICRA 1ZQYA 5L1KA 3PW2A 3KD1E 4RPZA 3MR5A 2BQ3A 1KVBA 3C21A 3BGRA 4CEFA 1HYVA 5DK5A 1WLJA 4ELUA 7ICPA 3A2FA 1RPLA 4KLGA 2D0AA 2EHGA 2QXFA 3FFIA 4DQPA 1EETA 4IBNA 4M3ZA 2BGWA 9ICUA 5J29A 3JPNA 4IQWA 5CY4A 3DOLA 1NKCA 2VANA 4IR1A 3OYNA 3BQ1A 4UB4A 1JIHA 1FKOA 3P1GA 2F1HA 1HQUA 3NE6A 3NGDA 2B4JA 4DQIA 1WN7A 4DEZA 4NYNA 2J6TA 4DSLA 4QZFA 4KLDA 4NLZA 8ICFA 2IHNA 4HUFA 2C2DA 4FS2A 1ZQGA 3HM9A 3UXNA 9ICJA 8ICSA 5CZ1A 1N56A 4KLOA 9ICKA 5D3GA 3HT3A 1RZTA 4CJFA 3Q8LA 4MFCA 3NGZA 1KDHA 4KTZA 4CK2A 1U47A 4E0DA 4R8UA 4CHQA 3DLRA 1KEJA 4CGJA 2HHQA 4NY8A 4DQSA 4KLTA 4MEYA 1D8LA 3RMDA 3LAMA 3OYGA 4DL3A 3WNFA 3M9NB 3SPYA 3PUFA 3RJHA 2PFPA 4BWMA 4KB0A 5J2CA 3T3FA 4K8XA 4YXMA 2VWKA 4DL7A 3V6JA 5HP1A 4B9TA 1S97A 5J0OA 5KFAA 1NK0A 2HB5A 3O3FA 2P5OA 1N5YA 4JS4A 4KLIA 4J2EA 4DWIA 4KFBA 3SQ1A 4DOCA 5KFLA 4FJ7A 3GV5B 1BGXT 4RU9A 5J0TA 3PR5B 9ICSA 4F2SA 2E6LA 2A1JA 4DMNA 4HUGA 4NM1A 4K4GA 4DO9A 4CE9A 4K4HA 4QZIA 9ICQA 4LZDA 5EWEA 1ZQWA 4I29A 3EZ5A 5KFFA 3OYBA 3RJEA 5HRRA 1YVUA 3O3HA 3FDSA 4N56A 1T7PA 2YNGA 4RPYA 2P6UA 1K1SA 2NRTA 1ZQNA 1KTQA 3OJUA 4Q43A 2HNZA 4RNMA 2JZBB 3LZJA 1JLAA 1ZQMA 3K5LA 1BIUA 2V4QA 4LH5A 1IKYA 5KG2A 4DFJA 3H08A 4EP4A 4FW1A 2DFHA 4QWCA 3S3OA 4CJWA 2R8HA 4O3NA 2BPFA 3DRPA 2DPIA 2Y1IA 3C5GA 2FPLA 1ZQJA 4RQ3A 4J9PA 4YR3A 2VA8A 5BPCA 1ZQXA 1C0TA 5EOZA 1DTTA 3KKSA 4YN4A 4XQ8A 3GQCA 5IIMA 1G15A 2ZTCA 8ICJA 4RW4A 4E1NA 3TWHA 3OGUA 4AHSA 4Z6CA 4KMUA 1IH7A 5DG9A 4ID5A 3ZSXA 3DLGA 3T5JA 5HMLA 2ETJA 2QKKA 2PZSA 1RDDA 4J2AA 1ZQSA 4DLEA 5J2KA 8ICZA 1J54A 5HBMA 4QZGA 3V7LA 1ZQCA 5D49A 5KG6A 4FJLA 4YFKA 4YP3A 2KQ2A 1VSHA 3PO4A 3QIOA 4CGGA 3VQDA 3PMLA 5C25A 2Q3SA 7ICGA 4CF2A 3M8PA 3H8SA 5L1IA 2W9MA 1S0NA 5KFKA 3V6DA 4KLQA 4KV8A 5TZVA 7ICEA 1KFSA 2KZ3A 4DL4A 1VSFA 3TAQA 4KREA 4M3WA 1NOZA 1I39A 2BGGA 3ZD9A 2IHMA 4M3YA 3B0XA 4KI4A 5FRNA 1BI4A 3K2PA 4RW7A 4M9NA 3V9ZA 4OLAA 4ECRA 2BCUA 3OYEA 9ICLA 1NJYA 3ZSQA 4CJQA 2WONA 4RW6A 1J5OA 1LV5A 4M3TA 4RQ8A 3CYMA 1NJWA 4B8CA 3MFHA 1HUOA 3HPOA 2ALZA 3RBEA 1EP4A 1LAVA 5CHGA 5KFBA 1JLCA 4XIUA 3MDAA 4CJTA 4F5PA 1A5WA 5EWFA 1TL1A 4ED0A 3SNNA 2LSNA 3HVRA 5IILA 1DLOA 1T05A 1LWFA 1JXEA 3THVA 4FJXA 3VA3A 2BANA 3RH5A 1LW0A 4NLGA 1J9AA 4CERA 1RT2A 2OPSA 1R0AA 1ZETA 4YD2A 3CG7A 3DOKA 3ZT3A 3OYFA 3V9XA 1IO2A 5J2BA 8ICKA 4M9LA 2OZMA 1S6PA 5C24A 1ZQLA 2FLPA 2ATLA 3KK1A 2BQUA 1Q9YA 3K5OA 7ICIA 2FPKA 4CESA 5J2AA 1S77D 1SL1A 1ZBUA 4DFKA 2R8JA 4J9SA 1EXQA 2G8IA 3RJIA 1KLNA 2W9CA 2YKNA 4TUQA 5DQHA 5KT7A 4FLVA 2DFFA 4JS5A 4JLHA 3NGYA 4B08A 4Z6DA 4J2BA 3RB0A 1KFTA 3L8BA 5KFMA 4LVSA 1RBUA 4Q44A 4KTQA 4FLUA 4F4KA 2ISOA 1SKRA 2ZJAA 4ECTA 1WCNA 1SKSA 3QLHA 1RDBA 4Z4GA 1T3NA 2HVIA 1A5XA 5F9LA 4ECVA 2OYQA 4PGQA 4GVMA 4F4WA 4QAGA 4M41A 3V6HA 2PYLA 4F2RA 2FMSA 2Z1GA 1NJXA 1RBSA 4MQ3A 5FDLA 4O5KA 2Y1JA 3LP2A 3RRGA 3UPQA 4ECQA 4CFDA 4PUOA 1BL3A 1A77A 3QEBZ 7ICJA 3T1AA 4ZHRA 4DL6A 3I0RA 3K59A 4B8AB 5CYMA 3AA5X 4HYKA 4H4MA 1SV5A 3OHBA 1QSLA 1HPZA 3FYHA 1ZYQA 3NH2A 4O0IA 4ECYA 2VA3A 4R8UB 3KLHA 5KT5A 4DL2A 4O9MA 3C2KA 1EX4A 9ICOA 1S0VA 3AV9A 1NJZA 3LAKA 4F92B 1C0MA 4RQ4A 5KG5A 2P51A 4CJKA 3ZSZA 3NAEA 4JWMA 1BPBA 4LZGA 4E7LA 2IGIA 4CJLA 3NHGA 4YXJA 1XI1A 1YTAA 2YNIA 1BIZA 8ICMA 5CJ7A 3GIKA 2HHVA 4IDKA 2YHBA 3VQCA 4F3OA 4QZHA 3JPSA 1JXLA 4ZTJA 8ICPA 3NCIA 4I9QA 5KFEA 9ICXA 2VG5A 5DDMA 3Q8KA 4G1QA 1S9EA 2ATQA 3KK3A 2KFNA 1S0MA 3AVAA 5D4BA 2HW3A 2RF2A 2X74A 2A1JB 4CCHA 5J2EA 1XSLA 3AO3A 2BDPA 3AO2A 2ZD1A 3PW5A 3DM2A 3C6TA 1RTIA 2PFQA 4DTSA 4QW9A 4FK0A 2G8KA 3RTVA 2OWOA 2YNHA 3ZSRA 1TGOA 3L2VA 4Q8EA 3RAQA 2KZMA 2HHUA 1DGSA 3OYCA 2HHWA 4R64A 4FXDA 4MFBA 1NK5A 2RDIA 2HVHA 5C42A 1XHXA 3OSNA 5KFJA 4CGFA 5D46A 3V72A 3ZSVA 4AHTA 4HCBA 4CHOA 4DTOA 4PHAA 3SUNA 4DU3A 1L5UA 1RT3A 5FROA 4DFPA 4O55A 2BPCA 1SUQA 3VQ6A 1ZQIA 5KFQA 1K6YA 3QEAZ 4CEZA 3MAQA 2F8SA 1S5JA 4I9LA 2IMWP 5KT6A 4J9LA 5CA7A 5CWRA 4UB1A 4AHRA 2AQ0A 4KHSA 3C1ZA 5J2DA 4F50A 4F5RA 3RH4A 2HHTA 4L8RB 4XUSA 2Z1JA 4RQ2A 2HHSA 4DS5A 1ZQZA 5HP4A 1RT6A 5T7BA 3DLEA 1RDCA 5CYQA 3HWTA 3GIJA 3T5LA 3RBDA 3C23A 1X9MA 4CHZA 5CP2A 4JRPA 3GIMA 4FLWA 1HYZA 1S1XA 1WNSA 5J2MA 1ZQHA 3HPHA 3PX0A 2GUIA 1WAFA 3ZSWA 4CGDA 3P83D 3G6YA 4DTJA 3MR3A 3KLEA 4DOAA 3OYDA 4H4OA 4G3IA 3U3GA 4QZAA 5KFPA 4I2HA 3VN5A 4WE1A 4CJRA 2DPJA 4Z4EA 4E89A 3ISNC 1HJRA 1BI4B 2Z1HA 5DLFA 3SUPA 3VQ7A 4FLYA 4I2BA 2MAXA 4KLMA 4GXKA 9ICTA 4I2QA 2W9BA 1VSEA 2C22A 4F8RA 2ASLA 4IRDA 5IIKA 4F4XA 1XWLA 2PXIA 7ICTA 3OYLA 1A76A 4BE2A 2KFZA 3MXIA 4KRFA 5J0XA 4PPXA 3OVNA 3RB3A 3VQBA 4MF2A 3HL8A 4TURA 3SI8A 3ZDCA 3KTQA 5DB9A 3SQ0A 3SPZA 2Z1IA 3MABA 2E6MA 3PW4A 8ICCA 4DTPA 3G6VA 1BISA 4IFVA 2IA6A 2QKBA 2FMPA
chains in the Genus database with same CATH superfamily
2KI2A 2DO0A 1EXNA 1UT8A 1KVCA 3PV8A 5C2FA 4EU0A 2K4HA 4AL6A 4TU7A 4TLQA 2O8FA 2IDEA 4OPKA 4EZ6A 4HHTA 4QU7A 4FPAA 2OPSB 5H9EK 2PBDA 2ZTEA 3O0FA 4WJ3B 3SXLA 3GYNA 2LM1A 2W6LA 1CS4B 3KK1B 2WVDA 3PTWA 4ACOA 1VQ9S 3SYZA 3PX4A 2KHCA 2X6SA 2G8VA 4DR4K 1NKBA 3MGVA 3AA8A 1T9XA 4DHVA 5IM0B 4YY3F 3NNAA 4CZEA 2AYGA 2ALYB 1RBOB 4CTAA 3G8QA 1WOSA 4JKGB 4QIVA 1SQEA 2XY6A 2RRNA 4CLSA 4FN5A 1ZBIA 1SV4A 2L5YA 2WOMA 1IBKJ 1C1AA 5CEHA 1SKWA 1XNRF 2AGQA 5ALXA 4OZ3A 4JKAA 2IS3A 2Q43A 1VSLA 4FJ5A 3FCVA 5CR4A 1MC8A 3VAJA 4PUOB 2W04A 2ITGA 3CNQP 2FVSA 2GO7A 4FLXA 3AU2A 1HBOA 3CJTA 3HSDA 5DGAA 3WNGA 5D0RA 3KLHB 2N1RA 1Z2LA 1H1VA 2DGXA 1RADB 4YOTA 2Q2RA 4DR5K 4ZPVR 7ICRA 3WQTA 4BRNA 3QO9A 5CCLA 1B70B 3AUOA 4KTWA 1PAUB 3W62A 1PBUA 2A10A 3KBBA 3L3VA 2R7RA 3O3GA 2RU3A 3RBXA 3V6KA 1ZQAA 5IXUA 1RNHA 2JEJA 3AVLA 3AB2B 4OFZA 5JMVA 4ECSA 1OY9A 2YNIB 4RR5A 3TZWA 2HWTA 7ICQA 1K44A 1TP7A 2K1RB 4IDKB 3RJJA 5DZ7A 3IG5A 3MWPA 3TANA 5IIIA 1S1UA 2E4LA 1CQMA 2HS3A 4AYBD 4E7KA 3HPGA 3MM7A 4B17A 4ES2A 2V2ZA 3C7NB 3A8KA 3TU5A 3HYFA 2MSTA 2DNNA 3IM1A 3T19A 3D1OA 2FVRA 3W66A 4C8YA 2LQ8A 5AZIA 2KJ5A 1CI4A 3BO4A 4B3SJ 3DM2B 2OHDA 4B1UB 3F2DA 4NEYA 3H2LA 2E9ZA 4HHJA 4C8LA 3V9WA 2L3MA 2UUCF 3EO3A 4O3SA 4C3LA 4CFBA 2KFYA 1K9MO 2XS5A 4EO6A 3PJWA 2FJVA 3W2VA 5IT9O 1UJ4A 2RKIA 2ZWPA 1IG9A 5KG4A 1FKPA 3MECA 1QSYA 1UVMA 2E2QA 2O4IA 2VKQA 3KDOA 3MDFA 1XSNA 4X4QA 2P9KA 3G82A 2OIHA 3LPTA 1IN0A 3OY9A 2XSFA 1SUQB 2O3DA 4ZPDA 2QB1A 2GBZA 5J0QA 1Q9XA 4ZVPB 4BXOA 4FK4A 4KHWA 3DDKA 5FPDA 5CHCB 4CNYA 1UQVA 4PHEA 4M42A 1SIZA 1PK1A 3RWUA 2QWMA 4PGYA 1RAJA 2JR5A 4WWSA 5LJ3Y 2RRAA 3LOUA 2P9GA 3HFZB 1SQFA 4EX7A 2KHQA 4CVNE 4HEA9 3I8DA 1KKHA 2YV0X 3FCWA 3HHLC 4O5BA 3MMAB 3BSOA 2Y0SC 2PAVA 4MIWA 2JNJA 5CYQB 3L3UA 4P4MA 2HVEA 2ZC4A 9ICEA 9ICHA 1RA7A 1XQSC 2ZIXA 4N5SA 4ILLA 3OFFA 1S1XB 1Q18A 2W7AA 4EENA 5HATA 3MPUB 1NAQA 3R7NB 3EKUA 5F9NA 3QAEA 2W54A 1T94A 4P72A 9ICGA 2I1RA 1HMVA 4DV4J 1XMOK 4H4OB 4KGVB 5CXTA 2P6RA 4UY85 1Q8KA 2ZNZA 2PMZC 1HNZF 1I3AA 4OYZA 4FPBA 3VAFA 3KWMA 5AK3A 5D0GA 1G4CA 1Y3JA 2P9LB 5K8MA 3H0MB 1B22A 2G06A 1S9GA 3T1HF 2ZF5O 2LBOA 2IRXA 4GMJB 1ZQFA 3H1VX 1WDTA 1XIQA 1S4FA 3R8YA 3GE9A 4KPYA 4CWBA 3CCQS 4I2QB 3EYZA 3VGUA 2R8GA 2KK0A 1EAYC 2CZ9A 3CJ4A 3QBWA 1A6SA 2G8HA 2D5RA 1W2IA 2MKSA 5J2IA 4W5RA 1Z00A 1XBWA 1WI8A 2JEIA 5EE1A 5KAFU 3KLGA 3K5MA 2BOAA 4J37A 4Y2JA 2QEXS 3M1FA 2QN6B 3NXZA 3U4LA 1Q3VA 4KB1A 2V51B 3GIIA 1DHMA 5DGBA 3FCHA 3LPYA 1ZQDA 2B9WA 4PKDB 4L73A 3VTIA 3M8RA 3UD5A 3TARA 2KHVA 1VQOS 5F0WA 1VQMN 1FX2A 1VDVA 1HNXJ 2C2KB 2AX0A 4DCCA 8ICUA 1YJRA 1X1PA 2F4VK 3O9QA 2A3ZA 1YIJN 1RFQA 4NA1A 2JGUA 3MAAA 5AQKA 2DNZA 3TJ9A 5ALZA 8ICWA 3HILA 3W0LA 3KNAA 3THXA 3VQEA 2P66A 4CGIA 4ANDA 2IJFA 4P2MA 4DX5A 2OP5A 2DHSA 3P38A 4KX3A 1DGKN 3ZDAA 2QA4S 2W7PA 1N34F 4JWNA 1TVRB 5HAOA 1Q86O 1F9EB 4CRJA 2JJ4D 2VG6B 4F4ZA 4ED7A 3ZFVA 4KLEA 3NF9A 1QE1B 2V4JB 5IV4A 4PZVA 5BR8J 3D0PA 5BPMA 3CPWM 3D2QA 3KHLA 3BREA 3KK2B 4XH5A 2D1CA 2YMLA 4IL6U 1ZQTA 3M9MB 4YG2A 4RJVA 3Q23A 3DXKA 1UJ5A 3AAWB 3AVKA 4DV2F 3CD5A 4FZYA 2KVQE 4MJKA 1AB8A 4FPRA 4LFAF 4LF6J 4LSLB 1WDDA 2ZUBA 3SQ4A 1ZM2A 2FSJA 1NRKA 3ETRA 1ZS6A 3LF0A 1S1VA 2MPUA 3D3BJ 1REVA 1RT7B 1IJJA 2C3OA 2EX3A 1SQGA 5KG0A 3CMES 3FLCO 9ICVA 2CYYA 5C2DA 4BUGA 3MCMA 5J0PA 4PWUA 5G5HA 7FDRA 2G8FA 2WK4A 3TR8A 4WQ4A 3GJRB 2YWEA 4FKXA 4LQ9A 3U6FA 2OEKA 3PHEA 1CLQA 1ZXIA 2JOQA 3HRGA 3QFPA 4CJ4A 3H8MA 5KFNA 5J0WA 3QGIA 3IAYA 1KBRA 4KHPK 1Q46A 2IAJB 3BEXA 2X7IA 5HRNA 4LRDA 4OHWA 5DKWA 4M0AA 4NLPA 3BQ7A 1S6QA 1RXOB 3HHDA 1B4FA 2HK2A 3HKWA 4PG4A 1MG7A 4C4SA 2YKOA 4RQ0A 3MR2A 4GLXA 4NLNA 3Q2SC 1YJNS 2HBJA 3MN6A 1MLAA 3S9HA 1BCMA 4AHUA 2M9KA 3A0HU 4RU2A 5L1MA 1HYSA 2GC8A 1HI1A 1XR7A 1MU2B 5JICA 3WHIA 3J7A1 3K75D 2CJYB 3HM8A 4DSKA 3KJVA 5AQPA 4DTUA 1RGIA 4ZCMA 1I94K 4LF8F 3JYTB 4FJNA 3H20A 2BW7A 2WBRA 2OLWA 1IKXB 1RKIA 2HEKA 3O8MA 5FP0A 1N36J 3GJQB 3VF4A 2IA0A 1V3RA 3D54A 8ICIA 4FJ8A 2J9EA 3HP9A 5ALDA 3IV6A 4OX9K 3HULA 3LALA 3RBZA 1X4FA 1FIQA 2FY8A 1JLEA 3MF5A 3E66A 4DR6J 3OTOK 5GADP 3J8AA 3O3LA 4F7VA 4C48A 1TELA 4IG0B 5JXSA 4AE5A 1T02A 3ZZPA 2FPMA 1S3XA 4ILMA 2MDAA 5J2HA 4N47A 4PYDA 5GVQA 1CUKA 3QXGA 3HHNB 1UKUA 4BR7A 2OJ3A 2ZG6A 3TUJC 3ZDDA 1M1KT 3V81B 1N63A 5J2JA 2IVYA 4UOGA 1YDLA 3IP4B 4KLFA 1FRKA 3W2WB 1VQ5S 3CDAA 1ZQKA 1DQAA 1D5AA 4JKEA 4H5RA 1S1WB 2O01C 2MQLA 4LF9J 2DQNB 1WG1A 4CLWA 1B43A 3AGRA 3OYKA 3OVSA 2UXBF 1E6YB 8ICRA 5HROB 4LC9B 4BR0A 8RUCA 4LJMA 1TKXB 3SSQA 3AA2A 3CM6A 1UZHA 2YPYA 2E8NA 2BOPA 2Z2YB 4EEYA 4YQWA 1F1BB 1BQMA 2MHEA 4FYVB 2BJ9A 4DG1A 3FAHA 2AJFE 2MQNA 3LWLA 1RT5A 1WC4A 4JI3J 2O8EB 3K8VA 3BQTA 3OUYA 4PG5A 1Q0NA 1DTQA 4PL7A 5E0OA 4NLWA 1WSFA 1U2CA 4ZJLA 1AROP 4CZHA 3EVOA 1F3VA 3EE8A 4N76A 4CK3A 2C42A 2E8PA 4I6MA 4DL0C 5E3QA 4LBIA 3AVIA 5EX5A 1S99A 4GVBA 3U3YA 2NCKL 2LCWA 2BQRA 1NGEA 3MWBA 1FXXA 2GVDB 2W42A 2H3EB 1CJKB 1KQQA 4PR6A 3QT6A 2ZKUA 4LFCK 2MKCA 3RYLA 1B92A 3S3MA 2HBMA 3PFEA 4LR8A 4K0KK 2JMGA 5BOLA 3MM6B 3DXBA 1BWVA 3WQPA 3P31A 5AR0A 4DPWA 2J0XA 1MNEA 2UP1A 4QQBA 5LSLA 1RTJB 5CYJA 3H5UA 1HI0P 2EWHA 4JHDB 4NCBA 4AQYK 1RAEB 2P9EA 4LVNP 1RCOB 1NZPA 2AH5A 4PQUB 3VMFB 3TI0A 2P8IA 1FK9B 2ASDA 4LVOP 1T9VA 3LW5C 2NXJA 3QRQA 1UCNA 1NUEA 4TQSA 4M2YA 1HI8A 1SXLA 3AVMA 3CCRS 2DNMA 2F2AB 1BPZA 1I3OB 4BDYA 2E1MC 1YVNA 4DPOA 3G8SA 3HK2A 2KIVA 4M6WB 4RBVA 3ETLA 3VGKA 2DGZA 2YMPA 3LP0B 4ZOHC 3KLVA 3NAIA 4CZCA 2ZM6K 4M1KA 3MCSA 3ZT4A 1SWWA 3JPPA 4GMKA 3UCUP 5ALSA 3ZDBA 2KYXA 4NLKA 4FM1A 3ZZUA 5I9EB 3AVHA 3V2UC 2XEXA 5DM7L 2GQQA 4CEBA 3Q86A 3NWGA 1RHJB 1S1TB 2HMPA 4W4MA 1KTVA 4BGDA 3H5YA 1Y88A 3WXMB 3A0IX 4X62J 4Z4CA 3HO1A 1QSSA 4KHNA 3L2QA 1OQ3A 3QNMA 1V4TA 3CJSA 2XGQA 1XMBA 2CXEA 3S3NA 3D6HB 4LF4K 3KJFB 3UI3A 1MDUB 4FE3A 2WFBA 1RBRA 3KHYA 3G71N 2R2SA 4IQUA 1MA9B 3TSPA 3ZTQA 1JMTA 4CF1A 3UR3C 1B4SA 4CLYA 4FF4A 2HMIA 3WK7A 5IC4B 2U2FA 1HQEA 3JSBA 1JLFA 2YB4A 1ZXOA 1NK9A 1J53A 4I2PA 3CXCR 4DV4F 2Q66A 2E5GA 3QRPA 3MUVP 2PO4A 2YY3A 3F2KA 7ICVA 2VWJA 3M30B 4FYYB 4CJEA 4M94A 3QNWB 3H40A 2VC1A 3CMAN 1HPMA 2XSJA 1GLEG 2FBYA 2EFNA 4DZ6A 5DM7Q 4DQQA 2AU0A 4RQ5A 3HW8A 4YOYA 4ZN1A 2EZXA 4AHVA 3L4BC 2OD6A 3CCES 3GU3A 4UB3A 1TKTA 5HL7L 2QARA 5AK6A 2RDDA 3RJKA 5GAGU 4X64J 3I56N 5AKLA 3RRHA 2ASJA 3MEEA 2EK6A 3X3UA 2VFRA 2Z8QA 3TVYA 3K4GA 3ED5A 1FERA 4JI2J 4I2FA 5EOYA 3PRDA 1BHLA 4KMOB 2XY5A 4FCYA 2DUYA 2EC0A 2OEJA 5K14B 3NVZA 3MN9A 1TL7B 2K4IA 2HKEA 4M63C 4ISGA 4QIWC 2I9GA 3H0PA 3N01A 1LWCB 4O3QA 1JJCB 4W5OA 3LGMA 3VQ4A 2GQ2A 1AZSA 1HNXF 2YJEA 3ZC4A 1CC7A 4O5CA 5L1JA 2BHNA 3CD6S 2R7WA 2E20A 2E88A 1MMDA 2GJ2A 3WUHA 2YWGA 2NV3A 2VBYA 3L4PA 2FHMA 4Y2SA 2CG8A 2QL9B 3D6MB 2NREA 2F7TA 1KKXA 4OPJA 1WSJA 1UWBB 1VJQA 4CF0A 2OPPA 5AFUH 3LZIA 2V34A 4JBCA 4JV5J 7ICKA 3AFGA 3TAFA 4A61A 4FVMA 4KE5A 4BBYA 3C6UB 2A1AA 1HFEL 5BR8F 1UPMB 3NNCA 2DGVA 5HL7Q 3GILA 4PY5A 2ZJ8A 2G0AA 2KZZA 5AKXA 5E3CA 4ZVOB 3C0BA 3TTFA 1CG2A 2MLXA 3L2WA 1S9FA 4KI6A 5IIOA 4R65A 2CPRA 2NYIA 3SQ2A 3VQAA 2IC3A 1N61A 1FRHA 4J9QA 4FYWB 4F5OA 4IG3A 2M8HA 3UD3P 2WW8A 1C1CA 2BDUA 2M8DB 3CCVS 4LF6F 1K73O 2HWIA 2LYHA 2HRYA 4O5EA 4RUHA 2KEYA 1ZQQA 5SZTA 4R63A 2FGCA 2YQ1A 3H7HB 3ULEA 5BR9A 3I9ZA 1T9WA 5D78A 1VDHA 3I76A 1PGZA 1B9FA 1Y64A 4QS7A 1HNVA 2XCAA 4CJPA 3CJBA 1RDRA 1SB6A 4DOZA 2BKNA 3I82A 4A48A 2IRYA 5AQLA 3JTOA 4I7FB 3H1QA 1H7WA 2DR8A 1H3DA 4DX8H 3GBTA 3FRYA 5DDOC 5DBCA 2C2ZB 1JLQA 4NV0A 2OHFA 1D0EA 2EAMA 1M90O 1YI2S 3CJ0A 3MGIA 1HKGA 1TV6A 5T14A 4NXMJ 1LVHA 3IUCA 1RT1A 1UOCA 2CRLA 2YI1A 3ETOA 3H45C 2B6AA 3K0JA 2MQQA 3AXMA 3R97A 1M0SA 3M7DA 2ZE2B 3TA2A 2LPEA 3BQ0A 2XIDA 2HBLA 3CDEA 2WHEA 4ECWA 1JL2A 3NNHA 2NZCA 2BCVA 3UN2A 3UCZP 3GL1A 3NUQA 4OX7A 2F3NA 2OPRA 4P2HA 1BPDA 2AEJA 3GFZA 2DIUA 1JMSA 3CI5A 1N60A 1SAZA 1KLMA 4DPTA 2XO7A 2G8UA 4L6V3 3O8WA 3MEGA 3CJ8A 1FWLA 2VFVA 3GG1A 2OPQA 2V8PA 4CJ3A 1ITPA 1HBUB 1NEEA 4X4UA 3LDNA 1NGGA 1GLCG 2F8KA 3BS5B 3MR5A 5CHIA 3C21A 1N36F 2P9SA 4CEFA 1HYVA 3L09A 1B99A 1WSRA 3FSIA 1E6VB 1NDLA 2E7WA 1QAXA 1RPLA 4KLGA 3M6WA 4DQPA 2HPUA 1RWOB 2WVFA 1WUAA 1YBAA 1VQ6S 1Y9OA 4MAKA 4L3NA 5AI5A 4IQWA 1LKYB 3IA0A 1OY6A 4ZVQB 2K89A 5B8HA 1N6QB 4DHYA 3WXKA 3KG4A 4UB4A 3QPIA 1JIHA 2D0OA 3NE6A 2IYIA 3NGDA 3J7ZO 4DQIA 1WN7A 3OHRA 4DSLA 2GAGC 4NLZA 2VICA 5HQ8A 2V68A 4HTLA 4WTYA 2N3LA 2J8AA 4OZ2A 9ICKA 3ENBA 2HGNA 3HT3A 2MB0B 4YB5A 4KTZA 2DXDA 1LWEB 2I5JB 2IVFB 1U47A 4CW7B 3M6UA 2WVBA 4OPHA 4ZIWA 3IC1A 2HHQA 2QMWA 2HIQA 3OYGA 5ALKA 4DL3A 3EM1A 2DPNA 3ZETB 1HWUA 4BR4A 3N7RC 3VAKA 4TN2A 3GFXA 3G87A 4YXMA 4IO1A 3WIVA 1Y10A 3LUYA 2LKZA 4CO1A 3NMUA 3KXDA 5DZ6A 4DCOB 5AM1A 5B0BA 5ALUA 5J0OA 1NK0A 4NLDA 3K9JA 3BF3A 4JS4A 3SBTA 4DWIA 4ZLJA 3UE2A 4DOCA 1RQLA 1NMNA 2WF8A 5B0EA 1FO4A 1HBNB 2ZH6A 1O13A 4K4GA 2VPWB 5JTIA 4DO9A 1WHWA 4NX9A 3TQEA 4DR7F 1BXNA 1HWKA 5A2QY 4I29A 5AQQA 4DR1F 3SAGA 3OYBA 1NHVA 3VF0B 1GLDG 3RJEA 2KM8B 1YVUA 1KQKA 1FFSB 2JH7A 4DV1F 2CQGA 4K4YA 1RTDB 3O44A 4DCHA 1KS2A 3CEDA 3RGIA 3JSYA 4FNIA 4Q43A 2WSFC 2PA3A 2XMMA 3WKBA 4B6JA 2K3IA 3SAFA 4IFYB 3KKAA 1WKJA 5KG2A 4DV3J 4DFJA 3PSTA 2HBZB 2GELA 3H08A 4FZNA 3UPFA 1XMQF 1ROFA 3G6ES 2DPIA 2ZJQQ 3CF5Q 3C5GA 1Q7YO 1VQ9N 5AQGA 1FEZA 4RQ3A 3DLLL 2VA8A 2V7YA 3DHWC 3M7VA 1ZQXA 2OH2A 4GVLA 3KKSA 2UUAJ 4I6AA 5HJYA 4NXNK 1G15A 2QSFA 2HI0A 5H9FK 8ICJA 5BYRA 2DNOA 3VGSA 5LJVA 4KT0C 2VJ5A 3NWRA 4NLCA 1IH7A 4FOEA 3ZSXA 3F5EA 3DLGA 1L7MA 3AOCA 3H0RB 4DV7J 1J5EK 5HMLA 5A8WA 2QKKA 1RDDA 3SEOA 3JQMA 1S5LU 4H5NA 5HSPA 4EHTA 5D49A 5JMNA 5KG6A 2NO4A 3BZKA 3Q0AA 1QVGR 4YFKA 3ET6A 3KDNA 4WQ5A 3AH6A 2BJ3A 4XPEA 5C25A 7ICGA 5J2PB 1ZZFA 3L3FX 4DBQA 2A1BA 3V6DA 3ISND 5AZJA 1JQGA 2UZAA 4OI1A 1FXDA 3VCDA 4M3WA 1VYAA 2W4PA 1KBUA 3LTOA 5M2UA 4X62F 3ZD9A 1NSAA 3HF5A 2FJXA 1BI4A 3VHQA 2ZJPL 1RSCA 2R18A 4M9NA 2Z7JA 3BF1A 2VKZG 4FWKA 2K4EA 1YAGA 2ZVSA 2R7UA 4M3TA 4LRCA 4JI6K 4RQ8A 5T7LA 4IZ9A 4USIA 4B8CA 1U25A 4M5DA 2CAJA 3JSMB 2ALZA 4RNHA 3MD1A 1EP4A 2BA9A 2G13A 4QR2A 1RCXB 4WK3A 5CHGA 4WFNQ 3FKBA 5GAEI 3MDAA 4F5PA 5EWFA 4F72A 3OR2B 2KLAA 4ED0A 4AD6A 1M5PC 3MX2A 5D8HB 4YUDA 3KG0A 3TW0A 2YX6A 2YXLA 3KLFB 1IG6A 4WP3A 2HG4A 2D3O1 1VCTA 2A6OA 4JI5J 4UASA 1FE4A 2QGFB 3NL0A 3FZKA 1UVKA 4NLGA 2UU9J 2OPSA 4NYZA 2B9XA 3V9XA 4YD2A 5HLFB 4M9LA 1MROB 2KOBA 2OZMA 4CDGA 2CADA 1ZQLA 3ETMA 1WUUA 1CS4A 3KK1A 3SSRA 3K5OA 5FLXY 1Q9YA 1J97A 1S4EA 4CESA 5J2AA 3QX7A 4KH0B 3FZ2A 4DUZK 2R8JA 4X64F 2ZJPQ 4OYIA 2YKNA 3MMCB 5G5GA 2RJZA 4FLVA 2DFFA 1EWQA 4C80A 3IKMA 4JI2F 1L8LA 2JSXA 3PXGa 3ZZYA 4Z6DA 5IM0A 1Z2ZA 1FRMA 3ENOA 2GV1A 3L8BA 1KDNA 1NO8A 1RBUA 2OUGA 4JKGA 4F4KA 5ETNA 3SMPA 3OVBA 4BRFA 3U26A 4AT1B 3DOLB 1RDBA 1T3NA 2HVIA 4F0MA 4I64A 3EVWA 4FF2A 2OYQA 4F4WA 4FXWA 1N8RO 3HZEA 4FF1A 4M41A 3PYFA 1OO0B 3KZBA 4F2RA 2E1PA 2XLIA 4OD0A 2Y1JA 3QBCA 2XWXA 3C14B 4ZVEA 4PUOA 1PO6A 4QNLA 5K5MA 2B43A 3T1AA 4A8WA 4H0XB 4DL6A 5D3GB 2DD8S 4WF9L 3AA5X 3R9PA 4F9OA 2F5GA 3GJTB 4JI8K 1QSLA 3FYHA 1ZYQA 4O0IA 2VA3A 3KLHA 5F8NA 4O9MA 3KWGA 1EX4A 1W2BR 1PJ5A 1UPPA 3TVKA 4JWMA 4O8KA 1FKAF 1BPBA 2X1BA 4AL5A 3MN5A 2WF7A 4BRPA 2Q3PA 5HK4A 3FNNA 2YNIA 1LFWA 5CJ7A 1H73A 3GIKA 2K1RA 4IDKA 4F3OA 1ZA2B 2DGTA 3MWTA 5HP1B 3C66A 5GAHU 3I55N 3BSAA 5THWA 3K0SA 2A2CA 3Q8KA 3CCQN 3BPDA 3US5A 2FYXA 1S0MA 4K4TA 3C7NA 2HW3A 4ZP7A 2OD4A 4NOHA 4ZVRB 3D0HE 2BDPA 4UY8O 3PW5A 1WG5A 3DM2A 5ADZA 3I28A 1VBYA 4DTSA 2G8KA 5GMKa 2OWOA 3ZSRA 1TGOA 2QEXN 3RAQA 2HHUA 5D0HA 4B1YB 2H51B 2YY6A 1FXLA 2GVZB 1GK8A 3VEYA 1OPZA 4WIQA 4URGA 3HCXA 4LF7F 3VTHA 4LJXA 4F0HA 3MTKA 3CJKB 1JLAB 2E1ZA 1QDUB 1VQON 3IFEA 3BUZB 1RU1A 3T7ZA 1ED1A 1TUGB 4TU9A 4DU3A 3ATUA 3NRZA 2WF5A 1L5UA 1Q86T 5FROA 2G0CA 3A0BU 4DFPA 4O55A 1SUQA 3VQ6A 5EX0A 1ZQIA 4YDXA 4CJ7A 4K4XA 1S49A 3QEAZ 3BBFA 3LYSA 3MAQA 2NNWA 2RMLA 3NVMA 1NGHA 1ZC6A 4AUKA 4J9LA 1FEHA 5D4OA 2QA4N 4AHRA 1AT1B 2AQ0A 4KHSA 1DTTB 1SBRA 5J2DA 3FBCA 3AB4B 3RH4A 1CPZA 4GKKJ 1X5TA 4OV1A 3TPQA 3MMAA 2ZH5A 3LL3A 1ZQZA 5HP4A 3AMZA 2Z30B 3GG4A 3TEHB 2Z56B 3TVZA 4NZ7A 3QT7A 5CYQA 1RDCA 3C23A 1FTCA 2QG9B 4UTGA 1S1XA 4KSEB 2EANA 2CQ2A 4I67A 4DV5K 2JXJA 3HPHA 3E58A 3PX0A 5LMUK 2OSQA 2VYPA 4DN9A 2ZHBA 3ZSWA 2HHHJ 4B3MJ 1U6ZA 3WC0A 4A8KA 1KHVA 2FHOB 1VQNS 1LKZA 3CIPA 4H4OA 1YJWS 5M2PA 1PJ7A 3CJRA 5AIBA 2HFSA 4JI0J 5KFPA 2LKYA 4UZCA 3VN5A 3TZXA 3UDLA 2DGSA 2P9LA 3CMEN 5A0YB 3Q7CA 4DCPB 2MAXA 3DOMB 2K4PA 4GXKA 1OW5A 1JNZB 3A3OB 1UTAA 2E2NA 4I2QA 3D6TB 4OJLA 2FTRA 2WONB 4RW6B 3U7JA 1J5OB 1N0UA 5AQJA 1I51B 2ASLA 3C15B 1EQ0A 4JEPA 5RUBA 4CLFA 2GIQA 1ZAVA 3J81j 2KJVA 1O5JA 1S22A 4TURA 4BHQA 4DV0K 3T9NA 3BDEA 3BKFA 5C0YA 2D1KA 1FI4A 1DKGD 3FRZA 8ICCA 1NI3A 1BISA 1HNWJ 3FBFA 1KD1T 1D9AA 3JPQA 2KJWA 1QVFM 3OYAA 2VPYB 3BGFA 3A5LC 8ICNA 1CRXA 4IQVA 5D4PA 4BGAA 4GKJK 3SCXA 1YKWA 4ECXA 4C1NI 1YJNN 3NASA 1LW0B 1YJ9S 3J80Y 4ZJOA 1SIJA 3DOKB 3OPKA 4PXCA 1TAUA 1CXQA 4J9OA 4LUBA 1RJJA 4ZOSA 5KNIA 1V4SA 3QE9Y 1Q81T 1G99A 5CZXA 1TVRA 2W9CB 3CCLS 1RGVA 4M9GA 1EWRA 4RT3A 2VG6A 3Q83A 3HFKA 2FE9A 3QZ7A 1QE1A 2MY7A 4EMDA 4X5VA 4OLBA 2V4JA 3MM9B 3FMBA 3CC7S 4FZLA 4W5NA 3CO9A 3QUBA 2LA4A 3KK2A 1MWZA 3A5OC 2FZCB 2KSOB 3R2CJ 3AQFA 2R2TA 2OM6A 4UQGA 2CQIA 4KGZB 3DWLA 2H1YA 1PILA 5IIJA 1BUXA 5M1OA 1RQNA 2GIFA 1D4XA 3ZZ0A 4YOWA 4LSLA 3DHXA 3DLJA 4E3SA 3I0RB 1U2RA 4B9VA 1T3VA 1G7CB 4H4MB 1Q1KA 2UUAF 1IBCB 1RT7A 1HPZB 2VKRA 1OH7A 3C2LA 1F9FA 4UAWA 1CZ9A 4X4TA 2RS8A 4P7TA 5KT2A 3C94A 3FEYB 2XZWA 3OBYA 1IV0A 3NFAA 2ZHOA 3NCRA 2UVRA 1I1GA 4WP9A 3DCAA 4ISFA 4DV7F 3EL2A 3CCTA 3VGTA 1J2NA 2Q0UA 2BKOA 3K89A 1QHTA 1LK7A 3RW7A 3CGIA 3TFRA 2QFIA 2CQ0A 2MZQA 4FJIA 4Y00A 4OVLA 2IAJA 3E8OA 2C2EA 3N79A 2PSZA 3HMJG 4C7QA 2UUBJ 4DR3K 3C29A 2H48B 3SV3A 2QLTA 2AKWB 4WFXA 2KN4A 2RQCA 2PFNA 3ZI4A 2RF2B 4JRQA 2AXTU 3X1LB 8ICAA 5ALFA 2E9RX 4I4BA 4JI7J 4O0NA 1ASWA 3N0VA 1UVJA 4CM2A 2CPDA 4LRBA 2MYFA 4OI0A 1RTIB 1P1TA 1N5XA 2YNHB 2XZTB 3LPEA 4K59A 5DJBA 1MU2A 2OELA 2KIWA 1M5HA 4JI1K 5B0GA 1JNRB 4A62A 2CGKA 1HHTP 2KHOA 7ICNA 4MIAA 2ZIVB 3CM5A 3JYTA 2VQFK 1NB2A 4CT8A 1IKXA 1WC5A 6FDRA 3WX4A 4BWJA 2ZIWA 1W7AA 5KFSA 1RT3B 5M1KA 3UWTA 1RWVB 4IYQA 2AMCB 1KRPA 1F5SA 3WU2U 2JX2A 3HRDD 4MKVA 3NRBA 5A6WA 2WSEC 1N0VC 2KN7A 1ZQVA 2EXUA 2KYZA 1O51A 4JI5F 4IO9L 4DSEA 3GTYX 4RPFA 2VOPA 2I5HA 3QU5A 2MGZB 2CPXA 3GR1A 1WBBA 2E8MA 4IG0A 2UU9F 3D2WA 3PMNA 1FDNA 4BVPA 4ZCKA 1BWFO 1WSEA 3FBBA 1IG8A 4YMNA 4CJ5A 3AOBA 1U2VB 3LDPA 2N7CA 3S6JA 4Z6EA 3DLEB 4V19S 1F5BA 3V81A 4X65J 4BRDA 3DDHA 3PACA 3UMBA 3J7YU 3WK6A 2W24A 1TFYA 4B9LA 1NGFA 4N7TA 3W2WA 4AH9A 2G0IA 3KFUF 2ISPA 3SI6A 4A8YA 3PW0A 1S1WA 3Q8UA 4OZJA 3M1VB 4RUAA 2D3UA 2LDIA 3R5GA 4CEOA 1HNZK 2WB1D 3OL9A 1E6YA 1BHNA 2YH1A 4DSIA 2HQCA 5HROA 1NBWA 4L75A 5GTIU 4M63A 4FJKA 1TKXA 4CT9A 4CHYA 1YRUA 2QB0B 5AQSA 1QUVA 3D45A 1R6YA 2VZ9A 4XAKA 1VQ4S 1TE2A 3O9SA 4NASA 2FDNA 4WE1B 2O8EA 1HUZA 1OYEA 2FUG9 2K60A 4OI4A 1PC4A 4QYRA 3W5ZA 3O9RA 3HSZA 2LXIA 3UM9A 9ATCB 2RHKA 1TK0A 1HA1A 4IO9Q 3UMCA 5HQMA 4PXEA 4JKCA 4C6AA 1EO1A 2W9BB 1OYDA 4YDUC 4DU1A 2ZZTA 3CJ3A 4Z7CA 2Q4TA 3AVGA 4KX5A 2GVDA 1O08A 3HI9A 3UVJB 2F44A 1CJKA 1GOBA 4OJRA 4FFDA 1COOA 3D0IE 1JRPA 2GJIA 4M9HA 1PG5B 3EZUA 1IJFB 5LL6d 3MM6A 4IFVB 3NY0A 1JL1A 1IM4A 2XG8A 4DR2K 1R8AA 1ZQEA 4IOBA 1RTJA 4RQMA 1IKWB 2C1EB 5KG3A 1O03A 2FSNA 2Q0ZX 2JLGA 4JHDA 3GJSB 4ITSA 3QETA 1VQ7S 4PQUA 1EKEA 4CIGA 3CCEN 3CCMS 4U8YA 2E1RA 4EBCA 1FK9A 2J4RA 3B54A 4HTIA 2LMRA 4UAVA 1RP5A 4QWBA 4CZJA 1APSA 3OLBA 4ES3A 2ZDPA 1KCFA 3DC2A 1GTEA 1U1OA 4N8NA 2BX6A 4DV2K 4ZMMA 4OYWA 1XSPA 4M6WA 3I87A 4B9SA 4J7CA 4M3UA 1L3TA 3F0NA 1LNQA 2HBQB 2Q1NA 4E1MA 4LFAK 2DHAA 3NBPB 3LP0A 1VOMA 1XC9A 3DXSX 3I1YA 2V50A 4QW8A 1ZM3A 2RRBA 5ALMA 2KW4A 3M9OB 4CEEA 2OTJS 1FJEB 4WXWA 1JROA 2HZAA 3EVMA 3L9ZA 4Z0UA 4LT6A 4RUBA 3J81U 3WZ0A 1FD8A 3MOZA 3PO5A 1F0MA 2BCQA 7ICSA 1B3TA 3VAMA 1S1TA 4FPIA 2VBZA 4LRFA 2ZOFA 4WFBL 8ICEA 4GKKF 8ICGA 1U1PA 3M05A 2GQCA 2NLWA 4B3TF 3P8BB 2BE9B 1BWEA 4YR0A 4CFAA 1T8EA 3A8JA 4Q0BB 2B51A 5K8PA 1RXWA 1FF2A 1OXJA 1UPHA 1AYEA 4HVJA 1WWUA 4TSXA 3L0QA 4K4IA 1GX6A 2AJ1A 3LDOA 2BKPA 5IT0A 3RMCA 3W8GA 4MYTA 4NJ8A 5BN8A 5HHHA 2ODGA 5I3QA 3CCVN 2OI2A 2EC2A 1W9HA 1OH5A 1SKUB 4JAXA 1NGBA 4BRQA 2HOFA 1U9LA 3BPSP 2AEFA 3AA9A 4W5TA 1MMNA 2ZOMA 1RWUA 4JI0F 1TUUA 1D8YA 2BMBA 3M30A 4ANEA 3ZDEA 1WF0A 4AYBC 3JAMY 2MZSA 4FO6A 4A5BA 4ZK7M 3M3ZA 5MAOA 4OGCA 2R7YA 4FK2A 2D8CA 2EAOA 1SQKA 4URQU 2AEMA 7ICUA 3VQ9A 1QTNB 1TVAA 3HTVA 1NLKL 3IRXB 3EKSA 3QIDA 1C1BB 3RZAA 4EGLA 4UUXA 4GXJA 1E3MA 1SIWB 4MDBA 2WAQC 4Y2RA 3PEHA 3JPOA 1LB2B 1MN8A 1HNIB 2A41A 4OIXA 4LFBJ 5DQGA 5HMZA 4M04A 3GMGA 3R7BB 2MKIA 4CBUA 3VERA 4DTXA 2ILYA 4PEOA 2GFFA 1RAAB 2MEWA 4YOVA 3AO4A 4OJ1A 3UN5A 3CD0A 3CJQA 4BACA 5K14A 3KKRA 1TL7A 4CP5A 5D6GA 1HNWF 3ENQA 2VQEK 5DDYA 5AM0A 1WSHA 1KHWA 3M5RA 2QIFA 2V2VA 4FDFA 1LWCA 3MTJA 2HFOA 3TNVA 5KFWA 2VJUA 3GYGA 2AX1A 4YHHF 1SV0C 2BE7D 4BDZA 1UA0A 4JB8B 3DRRB 5IS2A 2DY9A 2JVOA 1YG0A 2W2OP 3HKZD 1L7PA 1UCVA 2DEJA 3I0SB 1WB9A 1ECWA 1S6PB 3GSDA 4FS1A 4OI2A 1UWBA 3VQPA 4MO5A 2Q6BA 4E7IA 5DG7A 2B4UA 2CPIA 5LT5A 1IBKK 3T5KA 3E3XA 5IC6B 3C6UA 2XMVA 3BO3A 4XH1A 4EI2A 3BH6B 3ISBA 3IHQB 1VQ6N 1F5AA 2AJ0A 1NU0A 2H3VA 5LXRA 1CJVA 3ISDA 3M6VA 3Q8YA 5L9NA 3KJQB 1F5CA 1DBDA 3R9LA 5CZ2A 3D6RA 2AJ4A 3HSTB 1MA7A 3TUPA 4WFAQ 4WU3A 3ZZRA 3AQPA 4AHCA 4RW9B 3I5AA 1U09A 3ILIA 4CF4A 2D7SA 3G9CA 2H4WB 3TTCA 2KDOA 2PFDA 5KFVA 2KE7A 5AQUA 2GWSA 3DLHA 4K5RA 1KVAA 4GW6A 3DU6A 1R0CB 1NLVA 3AN1A 2LXUA 1O1WA 4NMXA 2H3ZA 2I1QA 2CKWA 1YRTA 1RAHB 1NPPA 1ITGA 4WCEL 3H5XA 1RWKB 3HVWA 2DIVA 1GX5A 2BJ1A 4KLHA 3WT0A 3C1YA 4DOBA 3HHKA 3OW2M 4I7FA 3L2RA 3LDAA 3CD7A 5J0UA 3QT8A 5HMMA 4UARA 1S76D 3K5NA 2GCFA 1XNRJ 5J2FA 4PA1A 3GPAA 1JCEA 2FGOA 2KKHA 2YQ0A 4QBUA 1TR0A 2UUBF 1P90A 4B3SK 3SBGA 4GXIA 1NWKA 5AQOA 1ZD5A 2ZE2A 1GFWB 2KTQA 3ZLJA 2I7PA 2QL5B 1KXPA 2ROEA 2ZH7A 2HYIB 1SH3A 5B5EU 3EGVA 3KKFA 4JI7F 4K0KJ 3IG1B 4WXOA 4ANCA 5H1SQ 2XGPA 2DY4A 4C4WA 2ZUAA 4PWDB 3LWMA 4OHZA 4QR1A 4CHPA 1N32K 4QZ9A 5ALVA 1HRHA 3WNEA 3FZLA 4DUYK 2VA2A 4Q5VA 3JSRA 3QERA 3CP8A 3PNCA 4WKYA 4CF9A 2OA8A 3K1ZA 4EZ9A 4HACB 1K8AT 1HBUA 2EG2A 2K2PA 2P5GA 3OS0A 4GV3A 3DAWA 4TY8B 2K8GA 4B9UA 4ICAA 1A6LA 3BS5A 2VUGA 1X0FA 3OV7A 3B8HA 3VV2B 1E6VA 1JJ2M 1X7VA 3O1BA 4OI3A 4CZLA 3BH7B 2W1BA 4NLXA 1R43A 2H5IB 1VQKN 5AM3A 3CWJA 3GWCA 1LKYA 4DLGA 1DJ0A 4Z6FA 1N6QA 2RDJA 1GOAA 2UUCJ 3T79A 2F40A 2BCSA 4P71A 2BACA 4Y1DA 2F1JA 4EBDA 2DF4B 4A8FA 1DY3A 5GADI 1KP6A 4DQ8A 5A2QO 3E0FA 4I28A 5ETKA 2HWHA 5JRTA 2Y0BB 4LRAA 1ZBLA 4X65F 1HJPA 3I8BA 3TA0A 4UW2A 1WC1A 2Z0GA 4FJHA 1CZBA 4DV4K 5DM6Q 5DLGA 2G08A 1WTFA 1LWEA 2I5JA 4U67L 5K9FA 2YJFA 4M5JA 3BDPA 5KFUA 3G0ZA 3TACB 1TZ0A 4GNIA 1VHFA 4BE0A 3NF6A 1MWMA 2WB1F 3IXQA 1JLGB 3QATA 3ZETA 4EIAA 1ZQOA 4B02A 7AT1B 3WIUA 3SR6A 5E79U 2IIRA 4LF4J 4IOAL 3MGHA 5GAGP 4QZBA 3QEPA 3TAEA 3OTDA 1JALA 3GZFA 2V9WA 1A9NB 3R6MA 1S72N 4CZMA 3VENA 2NXNA 5BRFA 3DMJB 4QZVB 1HBNA 3ULHA 1C4AA 2FIUA 1SJ3P 3NF8A 5KAIU 4Z7YA 1L3UA 4DX6A 5A0LA 5AKHA 4EYIB 1Q82T 3LO3A 2A0FB 3MMBB 3MMJA 3ZD8A 2RQKA 3R6GB 1IR0A 3TJAA 1IQZA 1M5OC 1MQ3A 4CFCA 1HNXK 1B9DA 3HVAA 1YTUA 5KFIA 1RTDA 2AP1A 1CXUA 2FBTA 9ICIA 3JTPA 5AQMA 1JUDA 3MUMP 1IIPA 1XNSA 3LQVA 2IDLA 3CO0P 5F2RA 3QU4A 2FLLA 4HI2A 1KONA 4IFYA 2E5HA 2LQ9A 3ILJA 4ELTA 5CQGA 5KGWA 3THWB 1HR0J 4NYOA 4MKYA 4KH6A 3QDKA 1SZPA 2NR0A 2XMAA 4KH4A 3V1OA 2KXFA 2M0GB 1NG9A 4NLQA 1KSPA 3QSIA 1R7IA 2C28A 1URRA 5BR8K 5J2GA 5ELZA 5J2NB 2P35A 1U0HB 3FEZA 3VQQA 4NB4A 2UVWA 2PKEA 2OAUA 5A6PA 2F4VF 2YNFB 3CTRA 1JXBA 4DQRA 1VJWA 4CLZA 1EARA 5U47A 4NE9C 2IM0A 2YPZA 2VL1A 4LF6K 5JJBA 2AJQA 2KVCA 4KJIA 1RCHA 1ZQBA 2DRBA 2D0BA 1JN3A 3NGIA 4O3RA 4F4AA 2MKKA 1L6NA 4NPOA 3SUQA 2KICA 3L2UA 3V1RA 3H4DA 4BDPA 4QR0A 4W98A 3D67A 5J2PA 4CI6A 1N34J 9ICNA 3HP6A 1RYSA 5D4LA 4DFMA 4USJC 3TSQA 4M5NA 2N82B 1CZAN 3MGJA 2YBVA 5AKJA 2U1AA 1VMBA 2H5XA 3KG1A 3U8XA 4Q8FA 4CBXA 2XLKA 2NQPA 4H8KA 1NKEA 2R8KA 3N6NA 2XY8A 3CPEA 1NH8A 1R89A 2Y0SF 2JC1A 2Y1RI 2LU2A 5AE1A 8ICYA 3EZOA 3VEWA 1SXDA 3E01B 4USMA 3JSMA 3ZNJ1 4P9SA 1TL4A 3N4QA 1TUYA 3VESA 5GTHU 1U1KA 3ONNA 1PZNA 4IKFA 3OR2A 1ZPVA 3PYEA 4V19J 1RYUA 4OX8A 2E5LJ 2DGWA 2L9DA 2D9OA 4MK9A 3IG8A 5DBAA 3FVYA 2DTUA 2CWXA 5DQIA 3KLFA 4UB2A 5IZHA 4ZLNA 2FVPA 2RPIA 3B6OA 1V3ZA 2E5JA 3MM7B 3KHHA 4L3QA 3DRXA 3CFRA 4QS8A 2ZJRL 2P1JA 4LSNB 1BNPA 1VC0A 1RWXB 4A8XA 3ZT1A 4P75A 5HLFA 1N36K 1MROA 1FJGJ 4C3MA 3T1YK 4F5QA 3GDQA 5B08A 2VHGA 9ICPA 4KN7A 4OJGA 2OCEA 2MQPA 3BBCA 5L1KA 4DCJB 1AFJA 3PW2A 2X1FA 4DR6K 2ZWOA 5TISU 1X60A 3MMCA 3M2VB 2IM1A 3A2FA 2QXFA 5C7PA 1TFWA 2XI2A 4EWTA 3RF9A 2MZ1A 4IBNA 9ICUA 5J29A 1X9XA 4FSVA 3HHLB 3DOLA 3KWIA 4QIGA 3CT9A 2QSWA 3OYNA 3KNGA 1MN9A 2I6XA 2XNRA 1F9HA 1WYGA 2F1HA 2ESEA 3GZ7A 4IUFA 1V85A 4LF9K 3KJNB 3C14A 4FS2A 4LF8J 5ETVA 4X84A 2QLFB 4OX9F 1LW2B 5CZ1A 4H5TA 2O5DA 2W7OA 5ALQA 2FJWA 5E3RA 5D3GA 4J9VA 4CJFA 4MFCA 4K2JA 2B8PA 3OTOF 1YX2A 3HKZF 2QRRA 1ZTWA 3B8AX 4CGJA 4KKOB 5AQNA 4U7BA 4JI3K 4AF1A 4KLTA 4BS2A 4MEYA 1YJWN 3SPYA 2MJUA 2B4PA 3W64A 2WTUA 2PFPA 2YCHA 4BWMA 5K8NA 4KB0A 3CNHA 2J0SD 5IT9Y 5J2CA 4K2XA 3EGNA 2CVEA 1L7OA 3FM9A 1RWWB 3GFYA 5CCMA 3ELHA 4DL7A 5ALLA 3V6JA 2GX8A 5HP1A 4B9TA 1S97A 3CCJN 2HB5A 4NCGB 4BG9A 3N6LA 4JKDA 4KLIA 4R79A 4O44B 4FJ7A 5AQIA 5J1EB 3PR5B 2CNOB 4IQXA 2ZXHA 4F2SA 4HUGA 1HARA 2UXBJ 2XZDB 3FFKB 4LZDA 1ZQWA 2FD2A 4C98A 1YVFA 3O3HA 5JVGQ 1FRLA 3D7EO 4N56A 1Z1BA 2GVZA 2CNNB 4RPYA 4USWA 5A8RB 2JLFA 2NRTA 1KTQA 3OJUA 1DQ8A 4RNMA 2JZBB 3CJKA 1OSCA 3LZJA 1JLAA 3F41A 4FKYA 2P9NB 1ZQMA 2Y9HA 1VQYA 1WD6A 1YJ9N 1BIUA 4NRUA 4LH5A 4WPAA 3SENA 4OI6A 4EP4A 2NPIA 1P27B 1WNEA 2KG1A 2K8AA 2FF6A 3S3OA 1AW0A 4LREA 1UEUA 4LFCF 2VDHA 4O3NA 3CJ1A 1ZOTA 4JOUA 2Y1IA 3I31A 4CF3A 5GMDA 4Y2IA 4JMUA 4J9PA 4K0KF 4YR3A 2XS7A 4M5MA 5BPCA 3D28A 3UCGA 5EOZA 1DTTA 2NZ4A 4RKUC 4OJ5A 1VBZA 3R6LB 3S8SA 1ZA1B 3O4WA 1VC6A 4UOHA 3SJHA 1N88A 3OGUA 2R4FA 3TUIC 3MX5A 2EZZA 4Z6CA 4KMUA 3CC7N 1SZHA 1ULRA 3OBIA 2ZGZA 2PT0A 3ALRA 1LK5A 3MZIA 4J2AA 2BM1A 4OJ6A 5ALWA 2VBWA 2XI9A 1RHMB 3H0LB 8ICZA 3HVTB 4PKIA 2DR9A 3THTA 3H46O 2HS4A 1KOOA 1O6XA 1WEYA 1HWJA 5H9FJ 2KJ8A 4YP3A 2KQ2A 4Y6IA 3PO4A 3QIOA 4X62K 4CGGA 2JDJA 3PMLA 3R5DA 4XPCA 2Q3SA 4CF2A 4WZMA 5AQWA 1NMEB 3MURP 4ER8A 2F8EX 4UQTA 3L5KA 1UMJA 1J5EJ 3Q89A 1KFSA 2KZ3A 2PD1A 3TAQA 4HR2A 3WK8A 1NOZA 1I39A 4ALZA 3QGGA 2KH9A 1EKSA 3ZTSA 5A0YA 3K2PA 2RU9A 3DI6B 3R1HA 2XNQA 2GS8A 4NL9C 3DYAB 3DOMA 4ECRA 2G2YA 4EHUA 1UFWA 2QLBB 3OYEA 1NJYA 4P2XA 2V5HG 1ZRMA 2YX4A 3ZSQA 2WONA 4RW6A 1J5OA 3C15A 3CYMA 2PN6A 2CPJA 4U7CA 5IOLA 3QIPB 2UUWA 4KAIA 3VQSA 3RSEB 2YWHA 1LAVA 1NSPA 3KVGA 1HHSA 1RTHB 4EAHD 1A5WA 4KIAA 5HR6A 4R0JA 4MIBA 3SNNA 2P9IB 2WRMA 2LSNA 2DNHA 3HVRA 1U1MA 5BPNA 1K0VA 2CN1A 3W61A 2F8HA 2VBXA 2KHDA 4LF4F 1R8CA 2CJKA 1FNOA 2CQCA 1VQ8S 3RH5A 3TADA 4V19X 1LW0A 1DFDA 1J9AA 3H90A 1YQHA 2YTCA 3W8PA 3CG7A 3DOKA 4X64K 4HTJA 3B4MA 3NVVA 1GLJO 3ZTOA 2M70A 2JRSA 1H6KX 4JI2K 5E5NA 2BQUA 3BY5A 2C3YA 3R9KA 3BM7A 3O2IA 7ICIA 1YIJS 2FPKA 4ES1A 2G8IA 4Y2PA 1KLNA 1WUDA 2W9CA 3L6QA 4JS5A 4JLHA 4B08A 4K42A 4J2BA 4K4UA 1KFTA 2LHTA 2VGNA 2GHPA 3UKRB 2J9CA 5KFMA 3DDNA 4LVSA 2BM0A 3MM9A 4KTQA 4FLUA 1X4CA 1SKRA 2ZJAA 4ECTA 5LMNJ 2E9TA 3UMGA 1W26A 3I5BA 3OL6A 4KY3A 2R7SA 3VAGA 4N77A 4ECVA 2KSOA 2RE2A 3CQYA 1FKOB 1GMVA 4J9UE 3V6HA 2PYLA 2FMSA 3ENAA 3SBMA 1HR0F 4Q2LA 1NJXA 1RBSA 3L7UA 4WK1A 4C0OC 3QU2A 3UPQA 4JV5K 1FNXH 2HQDA 2JVRA 2QWLA 4BRMA 4CFDA 1OIAA 4HHUA 1ZAWA 1RU2A 1Q5YA 4UAUA 3I0RA 3K59A 4ZJQA 4B8AB 1LWXA 5CYMA 4H4MA 1T0TV 5CD4A 3OXGA 3FZHA 2GHVC 3W63A 1HPZA 2D9PA 3CCUS 1G6BA 4R8UB 2CQ3A 5KT5A 4DL2A 2CVIA 2PE8A 1S0VA 2M4MA 5GAHP 1SC4B 3LAKA 1VLYA 4RQ4A 1QM9A 4CJKA 3ZSZA 3R3TA 2HZCA 3FZMA 3TUZC 2V2KA 4LZGA 2CZVC 3NHGA 4YXJA 2FC8A 2LU1A 3QBXA 4RX6A 1VQ4N 1R3NA 4CLTA 4BG8A 4M95A 3VQCA 1U1NA 3HD2A 5AI8A 2JH1A 4QZHA 3JPSA 3ICLA 1K8KB 8ICPA 5L39A 3I33A 1DRZA 5JLFA 1RDUA 8ATCB 2ATQA 1TUVA 4KHRA 1YHQS 2KFNA 4BRLA 1EIYB 5AKGA 2RF2A 2ZNYA 1HW9A 3D2EB 4CCHA 5J2EA 1XSLA 2XMWA 1WG4A 1WOQA 3PCOB 4XK8C 2ROPA 4LIWA 5AM2A 1RTIA 2PFQA 2HRUA 4QW9A 2IM2A 1XQIA 1T6DA 3RTVA 2YNHA 3ZO7A 2KZMA 2ZH8A 2D3ZA 4NXMK 1DEJA 4B1XB 3OYCA 2HHWA 2HOQA 3HZGA 2HVHA 3J7AP 3OSNA 2ZIVA 1SC1B 3ILLA 5D46A 1JK9B 3H5SA 2CRXA 4J91A 3IWNC 3RU0A 4CHOA 4DTOA 1UAWA 3BN7A 1B7YB 1Q16B 1RT3A 4H5WA 2HDOA 1K6YA 2E5LF 2VIXA 1VQ7N 3DRPB 3UKUB 1PVRA 4WYWA 2UXCJ 1Z4UA 5GIPA 4FZMA 1VISA 1C0TB 2MGZA 1QQMA 3B6BA 4HI1A 3PYDA 4ZITA 5FPMA 1QH9A 2F9TA 3MHYA 1DK3A 1HQ2A 2BUNA 2A6AA 4F5RA 2HHTA 4L8RB 4NI2B 2HHSA 1FJGF 1R8HA 4OYPA 4DS5A 1CULB 1U2VA 1Q3UA 4ID5B 3DLEA 4ILJA 1JI7A 3HWTA 3GIJA 2BYCA 1VBXA 2HF4A 4JRPA 1RHRB 2RHFA 1ZQHA 1EHWA 5A2QU 1ZTTA 3BEGB 4PKGA 3M1VA 1YBUA 1BMQB 4L3KA 1NGCA 4P7VA 4LR9A 4WQ4C 2PEHA 4ZVTB 1BC6A 4DOAA 3OYDA 2IVPA 3L4IA 2QB0A 4G1PA 1PJ6A 1HKBA 5LSOA 3UE5A 2HFVA 3U3GA 5AXLA 1D8BA 5KOWA 4YMEA 2P9PB 5KPRA 4WE1A 4G1IA 4CJRA 2DPJA 1UJ6A 4E89A 3ISNC 2JC0A 2Z1HA 2C2MB 4FLYA 1KD1O 4I2BA 1PIEA 5F3ZA 4C2MA 2VJVA 4A57A 2CQDA 2W9BA 1L8OA 1RTZA 5F41A 4ZDNA 2UUTA 5IIKA 4F4XA 1WHYA 1M1GA 1XWLA 3OYLA 4WJBA 4JI4J 2YHXA 1BLUA 1A76A 2J5AA 4BE2A 2B56A 1RUSA 4PPXA 3OVNA 3UVJA 3RB3A 2HSTA 4C4TA 2ATCB 3VQBA 5K4LA 3IBFB 3VEZA 3SI8A 1JLCB 2W43A 1S57A 3O08A 3SCIE 1Y3KA 3KTQA 1Q81O 5DB9A 1TL1B 6AT1B 3SPZA 3A4TA 1U0SA 3MABA 3PHTA 4DTPA 3UW1A 3ZNUA 4IFVA 2FMPA 1T05B 4B1ZA 1LWFB 1V6HA 2CZ4A 2LYVA 3D4JA 5E41A 1SXEA 2BANB 2O8CB 4K43A 2YKPA 1VSMA 3QJLA 1QLNA 2CDRB 3EEQA 1IKWA 1R0AB 1WSIA 1X31C 2NXUA 1QAIA 2O4GA 1FVQA 2MMYA 3UDVA 1Q8IA 3FSXA 3BZQA 4ZVSB 4KHQA 3SQGB 5B09A 1T3OA 3O6WA 1R8BA 2KKPA 2OFHX 2BUPA 4DFDA 3W5XA 2LMIA 3UNGC 4I2DA 4FBTA 3RB6A 3OYHA 2WC9A 1FDBA 3PX6A 1H2UX 1L7NA 4DV3K 3RH6A 4ECUA 2J7UA 3D2FB 3QJJA 2H9ZA 2DKOB 1PAEX 4NZ6A 4G9ZA 1X42A 3AL0B 1FTRA 4C0BA 2YX8A 3NBPA 3IGNA 2OMLA 4TU8A 1LFPA 4U7UD 3QESA 2PEBA 2ZKTA 5L9XA 1MSWD 2LYAA 3N5BA 2AQ4A 2UUAK 3AAPA 4PPZA 2L9WA 1YITS 3JAMO 5FDLB 2V4RA 3HLUA 2GV9A 3LP2B 3AD7C 4FJJA 3EY1A 1CC8A 4ED2A 5ETTA 4DR7J 9ICMA 4OZ0A 2IVMA 4DR1J 2LM4A 2V69A 4CEDA 4FL9A 2IOCA 3O4QA 1V38A 4DV7K 5BOMA 4BX9C 4DV1J 4DTMA 2ZQBA 4EYHB 2DO4A 3GIRA 4HTUA 2BCRA 3EJMA 2A5XA 2QZ8A 5AICA 5KRTA 1IM6A 3CFOA 5C2GA 3WXIA 4KITB 4WU2A 5EY4A 4OLOA 2SXLA 4X4OA 2MKHA 2W8KA 1N5TA 4CIFA 4WTOB 3UR0A 2GEMA 5DO2A 3OL8A 4Q0BA 2H3GX 4J9MA 5JVHL 2DKXA 4LSZB 3AVFA 2E7VA 4ZVFA 3GP9A 2HHXA 3R1LA 3E2EA 1CEZA 3IBWA 1KC8T 5DBBA 4E2FB 4IRKA 4NXNF 3RR8A 1XMQJ 4W5QA 2QKQA 2VB6A 2Y3YA 2XRIA 5KFHA 1FT8A 5KFZA 3PKMA 1U04A 2EW9A 8ICQA 4G1QB 1S9EB 5I4MA 3KK3B 3HBTA 5ITHA 1UHUA 3SDEB 1T95A 2DNKA 2KMDA 2D3DA 2MQ8A 3ICXA 4ZKAA 1J5EF 1RAFB 3VWSA 2HBKA 5BPLA 5HRSA 2ZD1B 4YR2A 2DNRA 2F1IA 1N2XA 2QC3A 3LM9A 3C6TB 2EFPA 1VSIA 1ZJMA 4P52A 7ICFA 3W3SA 4YMOA 2PFOA 1DAXA 3IRXA 2HK3A 4NWIA 1C1BA 4H54A 4DR3J 3Q8SB 4W92B 3HZ6A 3OT9A 3A3NB 1IWGA 4MFBB 3CMAS 4RQ7A 1FDDA 2NXEA 1RAOA 2PY5A 4YD1A 1D3WA 4PYAA 2W8LA 3Q8VA 1HNIA 1X3NA 3A5MC 1XS9D 1NK4A 1VSKA 3D5MA 4B9MA 4CLLA 2CPYA 3CQXA 3RJFA 4C11B 1VQPS 3G4SS 3NMRA 4OZ5A 4PPDA 4OGEA 5JUMA 4TLRA 3LK9A 3I56S 1UT5A 4BRKA 3WKCA 3R5AA 8ICHA 2E1CA 3GSIA 3H98A 4Q45A 1O0PA 2Z2MA 3AHPA 4JI6F 2QMXA 2R7XA 1SZ2A 1N33K 2AYBA 2VQFJ 4JYAK 4UB8U 3CJ7A 1GXLA 3GFHA 1NHUA 4O23A 4JV2A 1WF2A 3M2UB 3DRRA 4K8RA 1L3SA 4N8OA 2M2BA 5EU7A 3WXLA 2LEAA 2VFTA 5KG7A 1RHQB 4EP5A 3AA3A 3I0SA 2IHR1 1AQ6A 1RLDA 4YMMA 2KT2A 2GUPA 2HAIA 4MO4A 3V7JA 4Z4IA 1ZD4A 1OPIA 3KHGA 2ZVIA 2YHYA 2EQYA 2R7OA 4BR9A 2W25A 4YN3B 2X6NA 4AP9A 4C8ZA 2NO5A 2UVVA 2DITA 1KQGB 2XTJP 4JUZA 5J8YA 1UW9A 2X78A 5LMNF 3M4XA 4ED6A 4HT5A 2XS2A 3E9OA 4K41A 1TMMA 1Y4ZB 2LVWA 4DS4A 4QZ8A 2ZC3A 4FM0A 4RWXA 2WCXA 5AKEA 4DUZF 5B7WA 1XUPO 1FD2A 4PL8A 3HJEA 3M8SA 3TRGA 1HLUA 3G86A 4RW9A 3OBWA 1WG8A 4QZDA 3QUCA 1IBLJ 4FLTA 3RR7A 4MEXA 1KNZA 4F4YA 2XHBA 2W3RA 1NDKA 5DDPC 2F8TA 3D66A 1I6JA 4RUCA 2POKA 2R7TA 2GOLA 2MSNA 1Q53A 2NYHA 2ZUCA 2ZBCA 3ULDA 4LBPA 4PKHA 3PG9A 1DRGA 1RDAA 1NU4A