2Y1JA

Crystal structure of a r-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1jA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1jA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1jA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1jA01
5DBBA 5J2QA 3HPOA 3OYEA 4KLIA 4QZ8A 5J29A 3GILA 3Q8LA 3AUOA 2IBKA 4BWMA 1TKXA 2ZTCA 1NK7A 2ZTEA 3K57A 2IA6A 4CECA 4IG0A 4J9SA 1ZQUA 3JPNA 1O1WA 2P1JA 2VG5A 1MQ2A 4M41A 2G8FA 4YVZA 4FJ9A 3TARA 4E7HA 3GIIA 1TK5A 3IAYA 4FM0A 3UQ2A 4C8MA 1L3TA 1QLNA 8ICEA 8ICXA 1QQCA 4YMOA 4JV2A 4Z4IA 3Q8KA 3ZD8A 4CGIA 9ICKA 4NY8A 2KFZA 1TL3A 1XWLA 1BIUA 5CZ2A 5KGWA 5IIMA 1Z3EB 2HHVA 4ED6A 2YKMA 3ZT1A 4KI6A 2RDJA 1BHLA 3MGHA 4DTSA 4NLGA 4KLFA 5BOLA 4FBTA 1CXQA 3RJFA 1CEZA 3GIKA 1TFRA 1NK4A 2J6UA 3SCXA 4Q45A 3V72A 3M9OB 9ICJA 1UA0A 4C8OA 8ICWA 3P5JA 1X2IA 3C1ZA 1ZQAA 4NM1A 3HX0A 2KZ3A 2AQ0A 4QZCA 3QZ8A 4YFKA 3OYAA 3LZIA 3EW9A 5KFMA 3AO2A 2XC9A 4Y1DA 2B6AA 2AQ4A 1J53A 4W5QA 5KFVA 4CHOA 4M3RA 1HQEA 4MEXA 1ZBUA 5CY4A 1Y97A 2OZMA 3EPIA 4EBEA 1JLCA 3SUNA 1TKDA 3M9NB 4ID1A 3LWMA 4N76A 3HYFA 1I3AA 1JXEA 3KHGA 4GXKA 1BL3A 1FKOA 2ASLA 4UAYA 3THVA 5L1JA 4R66A 4O5CA 3QIOA 1Y88A 4IRCA 1L5UA 9ICVA 1N5YA 2JZBB 3AO1A 2UVUA 3ZDCA 3SYZA 1S97A 2YNGA 3V1OA 1VSFA 4DEZA 3E01A 4DU1A 3C95A 1B22A 2RPIA 3RJEA 4I27A 1N6QA 2ASJA 5DMRA 3ITHA 1C1BA 2VWJA 3ZSZA 2YKNA 3KKSA 5KT2A 1ZQPA 2J6TA 1YT3A 1MC8A 4KLEA 2RN2A 8ICCA 2W9MA 4IKFA 1Z00A 2JZBA 1ZQSA 3RJGA 1RBVA 1XS9D 4W5NA 4CJQA 4M47A 8ICIA 4BE1A 2I9GA 2A1JA 4J9QA 1C0UA 5KFBA 2XGPA 4KMUA 5CWRA 4Z4EA 4GVMA 4F5OA 3ORYA 3NFAA 3HT3A 4YQWA 4OPJA 2W9AA 1BCOA 4CHYA 4DTMA 5HLFA 4J9KA 4DL7A 2NRTA 4F5NA 4E7KA 9ICRA 5DQIA 3DLBA 5CZ1A 4EYIB 3RJHA 4CJSA 2ALZA 4I7FA 4IFVA 2FBXA 4AHVA 1ZQJA 4KLQA 1PZNA 2G8VA 3PW5A 4HHTA 1HNIA 3EWAA 4CJWA 1DTQA 5J2FA 1JLQA 2HHTA 4DSIA 2FPKA 2FMQA 4RPYA 1W9HA 3AVNA 3OHBA 2R8HA 4G3IA 4I2IA 1C7YA 3HSTB 5KG6A 1IH7A 4FXDA 4CK3A 3LP2A 4M3WA 2DY4A 3UQ0A 5HNKA 3PMNA 5JUMA 3OYDA 3KLFA 4OJRA 1EXNA 3MDAA 2FLPA 1LWEA 4J9LA 4GW6A 3OGUA 3PX0A 3KIOA 4ZH4A 3L2WA 5KFRA 4YR0A 1SKWA 3VA3A 2D5RA 9ICNA 3TAMA 3VQCA 1KLMA 4E1NA 4UB2A 3ASMA 2PZSA 4CGHA 3OYNA 3E2EA 4O5EA 4HUGA 1XSPA 1RBSA 4GC6A 2D0AA 1RBUA 1H38A 1SKRA 5J0RA 2NRZA 3RMDA 3V9WA 3MFIA 2LYHA 1A76A 4B9MA 4MQ3A 2XHBA 3C21A 3DOLA 3ZSYA 2B21A 1JXBA 8ICSA 1NKEA 4PHPA 4IRDA 3F9KA 2ZTDA 2OPPA 2BCSA 3LANA 5I42A 2Z1GA 3NBPA 4CIEA 5DG8A 1KFTA 3V9UA 3AA3A 4QCLA 2VA8A 4OKKA 3NF9A 4M6WB 3RB3A 1IKVA 1BPDA 2ISOA 4CEFA 5HROA 4FLYA 4OKJA 3EYZA 1GOAA 7ICTA 4I9QA 5DQGA 4CCHA 7ICLA 4ECVA 1VSKA 3RAQA 4EZ6A 3QZ7A 4YXJA 4KREA 4PGQA 4NLNA 1S77D 1U45A 4M6WA 1BPYA 1EKEA 7ICJA 4KN4A 3OYCA 4GC7A 5KFPA 4B8AB 4KHUA 2MAXA 9ICGA 4EBCA 3PW2A 3OYJA 3VQ7A 2LSNA 1RBTA 5KG2A 2ATQA 4I2HA 4E19A 2DTUA 3MR5A 3G10A 3NHGA 2BCVA 1N48A 4GXJA 5KG4A 3OYKA 4FO6A 1ZQVA 2IHMA 3Q8SB 4TUSA 3OY9A 2R8JA 4YR2A 4DL2A 1ZQLA 4O3NA 5IILA 1UAXA 3OYFA 4DTJA 4HVJA 1SV5A 4P4PA 5IINA 4H4MA 4PWDA 2ZUDA 4J9RA 5J2JA 4HTUA 3NTUA 4KLTA 4BXOA 1KRPA 3BQ2A 3NGYA 1B43A 3K5NA 4IG3A 5CYMA 1WAFA 3LALA 1S6QA 1NJWA 2DPJA 3QNNA 3PV8A 1WSJA 1MSWD 4CJTA 5IIOA 4J9PA 5J2BA 1YTAA 1ZQFA 3QO9A 4DSJA 4MFBA 2BKEA 1UA1A 2W9BB 3AU6A 5L9XA 3HM9A 2A1SA 2PFQA 1HRHA 4E7LA 1RTHA 1LWCA 5J0QA 4FW2A 3S3MA 4KV8A 1YTUA 4RNMA 4KITB 2PI5A 4ECZA 5KFYA 7ICOA 5J2MA 1RT5A 1D9DA 3PY8A 2NRWA 4JV0A 8ICLA 3V7KA 1BPBA 1DGSA 2XCPA 2QK9A 1LWFA 1D5AA 5J0TA 4M9GA 5J2GA 1S9EA 4QWEA 4CJKA 1DTTA 5T7BA 4CFDA 5DKWA 1S1UA 4DQIA 2Z1JA 1UT5A 4ELVA 7ICSA 3KK2A 3HVRA 1B9DA 3O3HA 4M0AA 1NJXA 5KFNA 3TI0A 4QWDA 3LAKA 2E6LA 1I39A 3AV9A 3AVFA 3QE9Y 3NGIA 4FM2A 4IBNA 1WSEA 3OJSA 4PA1A 3KHHA 2BQUA 3RMAA 1JXLA 1WCNA 3OYHA 7ICMA 4KLGA 4CHZA 3SJJA 2Y1JA 3PX4A 4KLUA 5D4BA 3RRGA 4JLHA 4QZ9A 4RUCA 3MR6A 4PGYA 4KHQA 9ICAA 4B9NA 3AVLA 5HP1A 4O44A 3SZ2A 4CK1A 4FJKA 4BDYA 3UPQA 4CGGA 3ULDA 4PGXA 3B6OA 4RQ7A 4F4XA 3KD1E 1T05A 4W5RA 3LDSA 1ZQQA 1ZBFA 3VN5A 4FJ8A 4DOAA 1A77A 5DB9A 3QINA 3QEIA 2QKBA 4KHWA 4KAZA 4RW6A 4RZRA 3U6FA 3NF8A 1BPEA 4TQSA 4M04A 3TANA 5SWMA 4AHUA 3V7LA 3H8SA 5KFTA 1ZQHA 4R5PA 3OYIA 3TABA 1NJZA 2UVVA 3OS2A 3D0PA 4F4KA 1A5XA 4ECXA 2IMWP 3VQ8A 3K2PA 3LZJA 1ZQOA 3SUOA 3NAEA 4PHDA 4I2EA 1WN7A 5C25A 3ISNC 9ICXA 4DL6A 4B9SA 1LAWA 3SI6A 1SL0A 4C8NA 5DQHA 4RU9A 7ICFA 2W9CB 3RBEA 4AILC 3EPGA 4I2AA 4ED8A 5KFKA 4F2SA 1J5OA 1JLGA 1QHTA 2JEJA 7ICRA 1KFSA 7ICUA 1ZQWA 5HMMA 1U04A 3TAQA 1W0HA 2W9CA 4PPXA 3V9SA 4K4GA 3MECA 3NGZA 3V6HA 4CEDA 1JKHA 2V4RA 4NCGA 4F92B 3FFIA 3QEVA 4LH4A 3ZSXA 2KFNA 4NYFA 3NH1A 2C22A 3GIMA 4DOCA 1HYSA 1JLEA 3Q8PB 3GV5B 1TVAA 2E4LA 4Z4CA 1XU4A 1ZQZA 3PO5A 9ICFA 3AA4A 5DDYA 4KLJA 4CEBA 1ASVA 3FDSA 1BVSA 4ELUA 2P5GA 3D45A 1ZQDA 5J2HA 5J0UA 3SQ2A 1NOMA 4CGFA 3K5LA 1JN3A 1FKPA 1SKSA 1RILA 2V4QA 3T5LA 5DB7A 4RPXA 4Z4FA 3G6VA 1TV6A 4FLUA 3VQBA 1KFDA 1JX4A 1JLFA 2OPRA 2GWSA 2VG7A 2PFPA 2KZZA 2BR0A 1RYRA 4DTXA 3MEGA 2XGQA 5KFHA 3CM6A 1GOCA 3MAQA 4K4IA 4AHCA 4ECUA 4CHNA 1IKWA 3M9MB 3I0SA 4DU4A 5J0PA 3QEBZ 1KVCA 5KFFA 3NH2A 3DRRA 3T3FA 1VSLA 4C8LA 2KZMA 2UVRA 1SZPA 1WAJA 2AGOA 4QW9A 2MUTB 2VANA 2D0BA 1T03A 1BIZA 3AA5X 3C5FA 4RNNA 2JGUA 1FK9A 1ZQTA 4DS4A 2F8TA 3OSPA 1KSPA 3HL8A 4EEYA 4FBUA 2DFEA 1NK5A 2I5JA 3ZSQA 3HW8A 3KLHA 1SL1A 4KB0A 2C2DA 3LK9A 2V9WA 3DM2A 5KTQA 4OGCA 2G8IA 3BGRA 5KI6A 3RB0A 3QEPA 9ICWA 2ZJ8A 2PI4A 1VSDA 4BWJA 2EX3A 1RNHA 4FJHA 2NRVA 2A1RA 2B4JA 5KFEA 1L3VA 4CF8A 1SUQA 3RB6A 3KLEA 5KG5A 1XSNA 3QESA 4KI4A 4P4MA 2ZUCA 2ZJAA 2RKIA 4Z4GA 3PMLA 4UB4A 3ALYA 3LDAA 3LPUA 4MFFA 8ICMA 4DFKA 3OVNA 2ZUBA 4Q44A 3LP3A 1KCFA 3IHQB 3SUPA 2HB5A 4QW8A 2IDOA 3KJVA 2I1QA 4R8UB 1HYVA 4J2BA 1KTQA 2W8KA 1Q9XA 2QKKA 3HJFA 2Q0ZX 3MXJA 1HUOA 1ITGA 5J0YA 2HNDA 2Q3SA 3ZDDA 1ZQXA 5KT6A 1NK0A 1S0VA 5HP4A 2H5XA 1KVBA 3C23A 4FLWA 1Q8IA 8ICRA 1ZQYA 4TUQA 5DLGA 5KT7A 4WE1A 2HHXA 1RT3A 4CEZA 3SQ0A 1VSMA 5FROA 2Z1IA 1ZQKA 1JLAA 5CYQA 5CR0A 3O3GA 3OHAA 8ICQA 5K14A 2BPGA 4I2FA 4IQWA 4F50A 3VA0A 4RQ2A 4I2GA 4F3OA 4O3RA 3HWTA 1NKCA 3ZCMA 4O5KA 3TFRA 4QZDA 1S9FA 1L3UA 2HHSA 3CFRA 3OYBA 1CUKA 2OZSA 5KFUA 4FJNA 2BHNA 4F4WA 2ZQBA 3G0ZA 3MGIA 3DRSA 4IQVA 2F1JA 4HYKA 4Z0UA 4FJ7A 3KLIA 4B9LA 3PVXA 1LV5A 3V81A 4RW4A 1L3SA 3SV4A 3RH4A 4BDPA 1RTJA 4UB5A 3U3GA 3O4NA 3C94A 4Q8FA 3BQ0A 4H4OA 4DL4A 3FYHA 1C0MA 4O3SA 3O3FA 4KHNA 2J6SA 3T19A 3KK3A 3GDXA 1RBRA 3DI6A 4J2AA 4F93B 5KRTA 4Q8EA 5HRSA 4F5PA 4W5TA 4MFAA 3SUQA 3HPHA 7ICIA 4CFBA 2VG6A 4DL3A 3L2UA 5HHHA 3N4MB 2P6RA 4HUEA 1TV9A 4JWNA 5J2DA 1K1SA 4JRPA 5KGXA 4QZGA 1WSGA 3C6TA 4ICLA 4JUZA 4M45A 3NF7A 2HVIA 4L8RB 3SPYA 4CF0A 1HYZA 3SNNA 3AVCA 3IRXA 1TL1A 1IG9A 4ECYA 1C1CA 4UBBA 1COOA 4FZZA 2FMPA 4DLGA 4CJFA 4DTOA 1XHXA 5KFXA 3SI8A 5KFZA 4F3TA 3TFSA 3F73A 4CJRA 4FS1A 2VA3A 2X74A 5KFDA 1BQNA 3TWHA 3L2RA 4QWAA 1S76D 4RQ8A 2OYQA 3DLEA 5FDLA 5KT4A 3JPQA 4FM1A 1RDBA 4OLAA 4H8KA 1C0TA 4RQ3A 4M42A 4QZIA 2F96A 4LSLA 5DGAA 2IS3A 3QLHA 2R8KA 3RJJA 3V9XA 1NOYA 2X78A 1LW0A 4IQTA 3PW0A 4ELTA 3B0XA 1RT7A 5FRNA 7ICVA 3JPTA 3NCIA 2AGQA 2JEGA 3AVKA 1HJPA 4OPKA 4JK1A 4E89A 4MFCA 3C1YA 2P51A 5IIJA 3EZ5A 2NRXA 2KQ2A 4CFAA 5JS1A 3PNCA 1RCHA 4AHRA 2ETJA 4ECRA 2P66A 3WNHA 4F5RA 3DOKA 4K4HA 1K6YA 3RMBA 4RQ1A 3H40A 3JYTA 1D8YA 5JS2A 2M9NA 3C2MA 1BI4B 5J0XA 2C28A 3RMCA 1ZBLA 5EOZA 4DSFA 1NOZA 4EP5A 3HP6A 5CJ7A 1RXWA 9ICCA 4OVLA 4RQ4A 4FK4A 4ED0A 4UQGA 1BPXA 4O9MA 4FZYA 4KN7A 4Z6FA 4F91B 2W9BA 3NGDA 2FMSA 4M9NA 3V1QA 4YMMA 4B9UA 3A2FA 3ZDAA 4GXIA 9ICUA 5HBMA 4O4GA 1TKZA 4M3UA 8ICKA 2QXFA 1JL1A 1X9SA 3LP0A 3OSNA 3AVBA 3MR2A 1IXRA 1NK8A 3I8DA 1HQUA 5C24A 5DBCA 3DLHA 9ICPA 1JL2A 5KFWA 1VRTA 4CK2A 3N97B 5F9NA 3SQ1A 1AROP 1XSLA 4DWIA 3K5MA 2YNIA 4JWMA 3DLRA 2IAJA 3OJUA 3RB4A 1XC9A 5KFSA 4Z6EA 3PR5B 2JLEA 3EY1A 4I2JA 4B9TA 4LVSA 2YHBA 4FJIA 5KFIA 3ZSRA 2BCUA 1UOCA 2BGGA 3ZT3A 4PY5A 3MEDA 4O5BA 4I9LA 9ICMA 4KFBA 4CEAA 1ASWA 8ICVA 1G15A 3TQ1A 4CFCA 3I0RA 3UXNA 4Q0BA 5L1KA 2VWKA 2HNYA 4AH9A 1HUZA 2AU0A 4FJMA 4RPZA 4ECTA 1VSHA 4Z6CA 3PUFA 1JIHA 4I29A 4QWBA 1EP4A 4FLTA 4CHPA 3VQ9A 4EP4A 4CF9A 5KRSA 3G6XA 4IRKA 4YCXA 4FJ5A 1RT2A 3MR3A 3PW4A 2DFHA 1ZJNA 2FC0A 4KTQA 3HVTA 1ZQEA 3Q8QB 5CHGA 4CGDA 3S3NA 4BGDA 4FZXC 5TZVA 1RT6A 8ICPA 1A5VA 4EBDA 3KHRA 7ICHA 4I2QA 3C5GA 3VQ6A 5E41A 3ZD9A 1KDHA 1S6PA 5KFLA 3K58A 4M3XA 3CQ8A 5J0WA 4GMJB 4P4OA 1U4BA 3S9HA 3QERA 3GQCA 7ICGA 1U49A 8ICOA 3T1AA 1VK0A 4XA5A 4NYNA 5J2PA 4RQ5A 3V7JA 8ICJA 2BGWA 4B9VA 4OGEA 3QETA 2PY5A 2RDIA 3RRHA 2HW3A 2FBTA 5DK5A 5IIIA 5EWGA 3NF6A 1C1AA 4PH5A 9ICLA 3AO4A 1LW2A 4OLBA 7ICEA 3RJIA 5C42A 3PR4A 4M9LA 3V6DA 4O0JA 5IIKA 8ICNA 4YFUA 1J54A 1B92A 2YV0X 1CZ9A 4ZTFA 2X6NA 2GUIA 7ICKA 1S0OA 4ECSA 2BDPA 4KB1A 4ED3A 2FPLA 4Y1CA 5EU7A 3CFPA 1EETA 9ICTA 2IC3A 2BANA 3RBDA 1X9WA 2KTQA 1T3NA 2VA2A 1UT8A 4FLZA 4TQRA 3VQAA 3SQ4A 4ID5A 4CHQA 4JS5A 1XO1A 3NE6A 4PQUA 4I2DA 8ICFA 3K5OA 4E7JA 3DLGA 1TK8A 4IR9A 1LB2B 3DMJA 3KKRA 1FXXA 3RR8A 4M9HA 4TSXA 9ICBA 3TAPA 1R0AA 3L3UA 4MF8A 3L2VA 4FS2A 5J2KA 4IDKA 3S3OA 1EXQA 2OPSA 1ZQCA 4LD0A 3AVJA 2WONA 1ZQNA 4ZHRA 3P83D 1V9PA 3CG7A 1MQ3A 4F2RA 3RJKA 4KO0A 2WOMA 5DLFA 4QZEA 5KFQA 1RPLA 4CJ4A 4DOBA 5HMLA 3GIJA 1HPZA 3V9ZA 2ASDA 3QIPA 3M8SA 4OKEA 2ZE2A 4DS5A 4DL5A 4CJ5A 1TAQA 4QZAA 3T5JA 1UWBA 3LP1A 4FLVA 3HO1A 4QOZB 5DG9A 5SZTA 4YD2A 4PHEA 2FBYA 2OA8A 2IGIA 2FPMA 3HK2A 5J2IA 4AHSA 5D46A 1Q9YA 3CFOA 1RTDA 4NCBA 5C5JA 3OYMA 2Z1HA 7ICQA 2FBVA 4J2EA 2G8WA 4QZFA 1D8LA 4J9MA 3OS1A 2W8LA 4F8RA 1S1XA 3GV8B 1TAUA 3NH0A 4R64A 4NXZA 1QSLA 3RAXA 1F21A 3H08A 1D9FA 1RDAA 1K1QA 2MUTA 2HHQA 5DG7A 3QEWA 3V6JA 1Z00B 3M8PA 2G8UA 3GFKB 2BCRA 2HHUA 4FK2A 4MF2A 2O4IA 4DTNA 4DFMA 4YR3A 5L1LA 4KHSA 1SL2A 2A1JB 4RW8A 4FJGA 4F5QA 4DSKA 4DG1A 4KLMA 2GV9A 2F1IA 4ECWA 5KFGA 1U9LA 1BISA 5KT5A 8ICTA 1LAVA 1QE1A 2XY5A 3TAGA 2NUBA 3AO5A 4F4YA 8ICGA 4ED2A 1VSEA 4JS4A 4HUFA 3OYGA 4K8ZA 5D3GA 4QZHA 3Q8RB 2HHWA 4JRQA 3MXMA 1U48A 3IG1A 3K75D 3VQDA 4EZ9A 2R7YA 4NM2A 4BE2A 4DFJA 1NK6A 5DBAA 5I3UA 5KG7A 1WLJA 2IHNA 2C2RA 2YNFA 2ISPA 1GOBA 4XRHA 1RZTA 1KVAA 3TAFA 3H4BA 5BPCA 1WSFA 3JSMA 3U3YA 4Z6DA 1RT4A 3RWUA 2G8HA 5DB8A 4CF2A 3T5KA 9ICQA 4KLOA 1YVUA 3QEAZ 4CJUA 4R8UA 3T5HA 4UB3A 5J0OA 3K59A 1ZQMA 5J0SA 3OS0A 4DTRA 1ZJMA 1RDCA 3KD5E 3H4DA 4NLZA 4XIUA 1IM4A 3KLGA 4RNOA 3ZT4A 5HHIA 2FLLA 1B9FA 4RG8A 3MXIA 1TVRA 2XY7A 2OWOA 2B5JA 4M3TA 3VQPA 5FRMA 1T7PA 4KLHA 1NK9A 3ZSVA 5KT3A 4BACA 3VQ4A 2BE2A 4FLXA 1XI1A 5J2EA 4M3YA 4B3OA 1BGXT 1KEJA 3ETLA 3RH5A 2ITGA 3HPGA 2BQ3A 4N41A 2HMIA 5EWEA 4M9JA 3AVHA 3M8RA 4FJJA 2RF2A 1ZQBA 4YMNA 3L3VA 3SPZA 5CA7A 4CJVA 3GV7B 3V4IA 2XO7A 4O55A 4W5OA 3O4QA 5KG1A 3IS9A 5KG0A 3MEEA 3VQQA 2PYJA 3K4GA 4RT2A 3CM5A 4RQ0A 4IQUA 3UXOA 2HNZA 5CP2A 4CERA 4XQ8A 1IKXA 5KFCA 4X5VA 1BPZA 3DRPA 3WNEA 4FCYA 3LWLA 4YNQA 1S9GA 4Q5VA 4DFPA 1DLOA 4KHYA 4I2BA 2G8KA 1ZETA 1RTIA 4LZDA 1N56A 4M2YA 4C8KA 4KLLA 1VSJA 4N47A 4K8XA 4M3ZA 4TURA 4QWCA 1S10A 4PHAA 1WSHA 1WSIA 4ECQA 1EX4A 4BE0A 4R63A 4LSNA 1S1WA 5D49A 2XCAA 3KK1A 3HXMA 4GLXA 4CGJA 4FW1A 4QAGA 4CJPA 3HP9A 4CJEA 4RW9A 3ISBA 4G1QA 3H8WA 4N56A 2HVHA 5KFJA 5J2NA 4DF4A 1A5WA 4YN4A 4TUPA 2PFNA 1ASUA 3KTQA 4NCAA 3L2QA 3JPSA 7ICNA 3LAMA 4E1MA 1VSIA 4J9OA 1QSYA 4DU3A 3AU2A 3AA2A 4BDZA 4KPYA 1IKYA 4KRFA 2ATLA 3WNFA 3MDCA 3ZDEA 3ZT0A 4CE9A 2IOCA 9ICIA 4E7IA 4BXOB 1TKTA 4RUAA 4QZBA 3P1GA 2PFOA 4O3QA 4J9NA 4LZGA 4CJ3A 2OPQA 4B8CA 1JMSA 1BCMA 4YXMA 4JV1A 9ICSA 5DDMA 1HNVA 4E0DA 1RDDA 2BPCA 3V1RA 5DB6A 2X6SA 4KTZA 1S1VA 3UIQA 4XUSA 5J2CA 3BQ1A 4I2PA 9ICEA 1ZQGA 1T8EA 4FJLA 4FK0A 3JPOA 2BQRA 3UXPA 2ZD1A 2F1HA 4UAWA 3L8BA 1U47A 3BJYA 4YP3A 3Q8MA 1HJRA 4RW7A 4I2CA 8ICBA 3C2KA 4FVMA 3PO4A 1S0NA 3BQTA 4IR1A 8ICYA 4Z4HA 4I28A 4DTPA 1S5JA 4UB1A 4MEYA 3G6YA 1S0MA 2D0CA 1X9MA 2C2EA 5DGBA 1NKBA 4AHTA 2W42A 1RYSA 1ZBHA 4YG2A 3AVIA 2O4GA 3BDPA 2R8IA 5HRRA 4P2HA 2XRIA 4DQRA 5HRNA 3IM1A 5HRPA 4RQ6A 3JPRA 1QSSA 3TAEA 2DPIA 3ISDA 1TGOA 5J1EA 4DSEA 3OYLA 3QNOA 1BI4A 4ZTJA 2Y1IA 1NJYA 4CEOA 4ED7A 2BCQA 3H8JA 3SV3A 4HCCA 3RTVA 4YD1A 4KLDA 9ICHA 4IFYA 1BQMA 3JPPA 3CYMA 3DLKA 4CEEA 4F4ZA 3MBYA 2DFLA 2P5OA 2UVWA 4EYHB 2P6UA 3TR8A 1Z25A 4CJLA 4DQSA 2AJQA 4CIFA 4N5SA 4KKOA 3V6KA 1X1PA 5F9LA 4LH5A 2JEFA 4KTWA 3ZT2A 7ICPA 4E3SA 2EHGA 4HCBA 2F8SA 2BPFA 8ICHA 1C6VA 3AVAA 2YHAA 1VRUA 4ED1A 1J9AA 3ZSWA 4FJXA 1DOQA 2AGPA 4DQQA 2E6MA 1KLNA 1MU2A 2JEIA 4J2DA 4O3OA 4DMNA 4DSLA 1ZBIA 3MABA 1RXVA 3WNGA 3DYAA 3B0YA 4CESA 1REVA 4KLSA 3LPTA 4DO9A 1XHZA 3RH6A 2PXIA 8ICZA 2R8GA 4CF1A 4DF8A 3B6PA 5EWFA 3ISCA 1Z26A 1CZBA 1CXUA 4DTUA 2WTFA 5BOMA 3NDKA 4UBCA 2DFFA 5KFOA 3VQ5A 3PX6A 8ICUA 3AVMA 1ZQRA 1QTMA 4FYDA 5KFAA 1JLBA 2XY6A 3ZDBA 4LY7A 3RR7A 1IO2A 4DQPA 3M8QA 1ZQIA 2ZJ5A 5J2AA 4Q43A 1T4GA 1RT1A 4R65A 3ZSOA 3VQEA 9ICOA 3AO3A 4CIGA 4RT3A 1S1TA 3C2LA 1QS4A 3PW7A 8ICAA 5CB1A 3MFHA 2FLNA 4O3PA 4CEQA 3KHLA 4UAZA 1CLQA 3C6UA 4B08A 4NLKA 3H7IA 2PYLA 1TK0A 2KW4A 1HMVA 2KN7A 4PUOA 5L1IA 1WNSA 3AVGA 1WCLA 5KG3A 4DLEA 2YNHA 3QEXA 2GBZA 4O0IA 2XY8A 1ZYQA
chains in the Genus database with same CATH superfamily
3M6GA 5GAEP 2LU1A 2ADCA 5J2QA 4QZ8A 5J29A 3AUOA 3L5KA 1T0TV 3H8MA 4P0PB 3MECB 2HPUA 3W0LA 1JKHB 1RQ0A 2ZTEA 3A5OC 2QWNA 2DH8A 2BM0A 5AQYA 4IL6U 3HSDA 1WC0A 4DJBA 4J9SA 5IT9U 2L9WA 2O8FA 3JPNA 2P1JA 3CVKA 2VG5A 1Q5VA 2G8FA 4YVZA 2YN4A 4GO5X 3OPXA 5EN1A 3U02A 4ZCKA 4ES1A 1EQ0A 4QS7A 3CJKA 4IFEA 4YMOA 4Z4IA 2JZ5A 3UD5A 1A0OB 4UB6U 5AZIA 5AXMA 1YJ7A 1W2BM 2KFZA 2P9LB 1XWLA 1RGIA 5IIMA 1P8GA 4ZIVA 1QH9A 4KI6A 2DGOA 2RDJA 5C2CA 2O8DB 1N36F 3W2VA 4FBTA 2X1GA 1CXQA 3RJFA 1Q78A 4ZLNA 1CEZA 2PKEA 3QBCA 4B1UB 5BR8K 2C3OA 2J6UA 1FVQA 1YI2N 2ERRA 4LVNP 9ICJA 1UA0A 4C8OA 3BSCA 3P38A 1FHTA 3C1ZA 3CCQN 1FO4A 4NM1A 4DKWA 2QL9B 1RACB 2JWKA 4YFKA 2J5AA 2OTLS 1LOTB 1HW8A 1M1KO 3C7NB 1SWWA 4B3SF 1HD1A 4CYUA 2A3JA 1U1RA 5KFMA 1R0CB 4Y1DA 2PMWA 2B6AA 3R2CJ 4ZKAA 1J53A 4M1KA 2H48B 4RL1A 2OZMA 4JYAF 3EPIA 3P31A 1JLCA 2P9UA 3G9CA 1RDWX 5AQLA 5HMYA 1IN0A 3BKTA 1KBUA 3KHGA 1FKOA 2ASLA 4Y0FA 2QEXS 2CJ9A 2P9KB 3THVA 5HL7L 4AM7A 4IOBA 3KG4A 4X4VA 5CD4H 2JZBB 3L7UA 5AJ3K 3D2NA 1WI6A 1Z05A 3NOCA 1VSFA 2NUUG 2AP1A 4AUKA 1UEKA 1AFIA 2VWJA 5CR4A 2YKNA 3KKSA 3QIDA 4K4XA 2VKQA 5KT2A 4RUBA 4I6MB 2J6TA 4FWOA 3D67A 8ICCA 2W9MA 2JHEA 3RJGA 2WVFA 2RQ5A 3KJVB 3TADC 1EKRA 3VEYA 3UDEA 1Y4ZB 4BE1A 2I9GA 2W7AA 3R97A 3TZXA 4IFVB 2A1JA 4GVLA 3IUCA 1X4FA 3BUZB 2CNKB 3D6MB 4CBWA 1OYDA 3HT3A 4ZVPB 1MWQA 2ZIXA 3CDAA 4WZMA 5H1SV 4WTOB 3VCDA 5HLFA 1MA7A 1LKYB 4C8YA 5CZ1A 2GOLA 1NSQA 4K4UA 3O9TA 4EFHA 4KLQA 1NDCA 3EWAA 2W7PA 4C9DA 4X2BA 3HFKA 4JI0K 3KFWX 1QAJA 2BABA 3OHBA 3KLFB 3A8YA 4G3IA 1VC0A 1Y00A 2MMYA 2Z2LA 1XTZA 4DR2J 5EE9A 5C2GA 1YJ9S 3LPYA 4CO2A 2B0CA 4PYDA 3HMJG 3D7SB 5ALDA 4USUA 3J7ZO 3MAHA 5GAEI 3JXUA 4UY85 4C4RA 2EKNA 2VJUA 2B8QA 3IG8A 2KFYA 2ZJRL 1LWEA 4GW6A 5IWAJ 4X62K 1KC8T 3KIOA 4RW4B 4MK7A 3L2WA 5KFRA 4YR0A 3VQCA 3P8BB 1RTJB 4UB2A 3I5CA 2F44A 3AJDA 1EARA 4HUGA 4ZA1A 5IC6B 1QVFR 1RBUA 1H38A 5ETSA 2QMWA 2RRAA 5GADP 3RMDA 1RSCA 4B9MA 2VU5A 3CIPA 5AQSA 3HHLC 4BRNA 3ZSYA 2E8NA 2QXLA 3HBTA 5BR9A 3I8BA 3PIPL 4NXNJ 1T9XA 4TVAB 5LJ5Y 4PHPA 4WP3A 1HNXJ 1P6TA 3CPEA 5D15A 3HSJA 5K8OA 4OJHA 2LEPA 5I42A 2Z1GA 4DV7F 1R8CA 5LMUF 3CPWM 3V9UA 3AA3A 3CCWA 1UVIA 1CBKA 2NZ4A 1CQMA 2OO4A 1PK3A 1IKVA 2J76E 3JS9A 4CLUA 1TL1B 4DV2K 3IC1A 3B9JA 3IGNA 3PKMA 2E7WA 3H8YA 1VSKA 4EZ6A 4DV7K 3ENAA 2ZZNA 1DGKN 2PSZA 1OSCA 1C0TB 3K9KA 3CC2N 1KOOA 1ZOTA 2W2PP 2DCUB 3OVAA 5IT4A 4TKTA 4LSLB 2Y9TA 1LQ9A 3GSDA 1RBTA 1YJNN 4I2HA 3CCZA 2DTUA 1QVGM 1LW0B 3FBFA 2P9GA 3NGSA 3SDEA 3G10A 1HWJA 2BCVA 3WEEB 3KZIU 3BM7A 5AR0A 3NHGA 5KG4A 4FO6A 2IHMA 4F0HA 1NWKA 3FEYB 2R3VA 3QJJA 3Q8SB 2SXLA 4JI7F 1ZQLA 1M1HA 3JSRA 5IILA 3GIRA 5AQGA 3L95X 4B02A 3W8GA 4DTJA 1SV5A 4H4MA 3BBFA 2RIJA 1YRUA 2HG4A 3NTUA 2HZCA 1V3SA 5LSLA 2YJFA 1KRPA 3VC8A 1YRTA 2YX7A 2X3DA 4NOHA 1T9WA 5CYMA 2YVSA 3QXGA 2F76X 2JFDA 4JI7K 4H4KA 3GFZA 3W3SA 1MSWD 4H5VA 3HHEA 5IIOA 3WXMB 3CJ3A 3BY5A 5J2BA 1FTRA 3DOMB 3PG9A 3D2FB 4R0JA 4MFBA 1YF5L 1HKAA 5CXTA 2W9BB 3RGIA 2ZGYA 3TZWA 3AU6A 3HM9A 2GFFA 4NRUA 4L73A 1HRHA 2FHJD 1K9MT 3AMZA 1CS4A 4KV8A 4RNMA 1KS2A 1ELOA 1Q0NA 3E3XA 5ALGA 2RRNA 1S8OA 2XMVA 2AJFE 2HEKA 1EZZB 4OYBA 1M5VC 3SD7A 3EUNA 4KPCA 1I6JA 1BPBA 1DGSA 3H25A 2BKPA 4MYTA 2Q79A 2FSNA 1WC4A 4Z7CA 4NXMJ 1D5AA 5J0TA 3ATUA 2KU7A 2VFUA 2GMLA 3P45B 1RZMA 5T7BA 4KHMA 3MMBA 5DKWA 2VQEJ 1S1UA 4DQIA 2RNEA 5GAGU 4ELVA 1U25A 7ICSA 4OZ5A 4OHVA 1YWXA 3HVRA 3H45C 3O3HA 1DEJA 1LCUA 5KFNA 2E6LA 3VEZA 2DWQA 2HNYB 1BG3A 1L7MA 1NGCA 1HIYA 5F8IA 1Y9OA 4AYBD 3KHHA 1T3VA 1W25A 1WCNA 7ICMA 4BR4A 4CHZA 3CC7N 1OQ3A 4NWBA 4JLHA 4WYLA 4PGYA 4KHQA 9ICAA 1PJ5A 1W26A 4K4WA 2G4BA 2EBGA 3FRZA 4O44A 4FJKA 4BDYA 3ULDA 4R5PB 3P96A 4RWXA 4RQ7A 3O5BA 1ZQQA 1MW7A 1S6PB 2ZNYA 5AI5A 3JQKA 3VN5A 1X60A 5GADI 4DOAA 4BR2A 4DOZA 3D68A 3SFGA 3MM5B 4KAZA 5HJYA 4RZRA 4ZLJA 2Q6CA 3O1BA 1S6OA 1BPEA 4TQSA 3TANA 3O3LA 5J2PB 1J97A 1RWXB 3I56S 3H8SA 3OYIA 1ICEB 3TABA 3NMUA 2KNJA 2MU2A 3MM8A 4JNEA 5HL7Q 2NCKL 3WHIA 4CQ1A 3SUOA 4CNQA 1K73O 4BGBA 3S6JA 2WAQD 3CWJA 1VQ7S 1NZ8A 1LAWA 3SI6A 2E88A 1MNEA 2QEXN 5DQHA 2J9EA 4NYZA 7ICFA 3WXKA 3WKDA 2HAIA 2KSOB 4AQYJ 5ALRA 4H54A 5AT1B 2Z7JA 2PIIA 3OFHA 4LRDA 4ED8A 1ED1A 2V8GA 3A1YG 2BKNA 1BUPA 4N7TA 5AE1A 1N5VA 3IXQA 2NQPA 4C0BA 4KJIA 2L9DA 4H5NA 2K3IA 1Y5LB 2JEJA 1TAMA 4PZNA 7ICUA 3UKRA 2XTJP 2V8HA 2AT1B 4X4OA 1XUPO 2ROPA 1ATSA 1FRLA 2VKZG 3TAQA 2W9CA 4PPXA 3J81U 1QY7A 4P0PA 3MECA 3V6HA 1C2PA 1NB7A 4B6JA 1JKHA 1F3VA 2V4RA 4PR6A 2Y3YA 3QEVA 3ZSXA 3EUB2 2DIVA 2VQFF 2KFNA 3QGGA 3VAJA 1X31C 3NH1A 3GIMA 4DOCA 4ZN3A 2CZVC 5AK3A 2A18A 1GLLO 2E4LA 1REGX 4JV5F 1ZQZA 1L8OA 5KPTA 4NYOA 3AODA 2H3EB 2QWLA 2OPSB 1URNA 4UB8U 1BVSA 4ELUA 2WONB 1BOTO 1ZQDA 3KMSA 1U6FA 4ZPDA 5ETPA 1W97L 3AAPA 1N61A 4YB5A 4CGFA 2QA4S 2A10A 4URGA 2P9LA 2V4QA 1FX4A 3AQFA 1CPZA 2DNGA 4Z4FA 4CDGA 2MKIA 1TV6A 3BR9A 3VR1A 3VQBA 1JX4A 1WWHA 2O8DA 2GWSA 4K2XA 2E5HA 4CM2A 2QZ8A 4B3RF 5LL6Z 4DX8H 5KL8B 1RKJA 1OQ6A 2F8HA 4LFAK 2W2QP 3P4UB 3SQGB 1GOCA 3BZKA 1T03B 4DR3F 3R3LA 1UVKA 4K4IA 4WFNL 2PAVA 1YJ9N 1FNOA 1RTDB 1RHMB 3QJLA 2HFNA 1XC3A 4AF1A 3MPYA 3MCNA 4USIA 2QFJA 3OFEA 1XNQJ 1DT9A 3C7NA 1Y5NB 2QSFA 3LTOA 4BUGA 4QW9A 2XHWA 5DRKA 2NZCA 1UQVA 4P71A 2G07A 2UUCK 4DR6F 1FK9A 1FVSA 4EEYA 4KH4A 1ZBTA 3THYB 1TYQB 4NZ7A 2V8VA 1FTCA 2VFRA 2P9KA 4OGCA 4XH1A 1XMBA 3QEPA 2EEYA 2PI4A 4NLTA 1VSDA 2EX3A 4B3MJ 1WDTA 1DJ0A 1L3VA 1BLUA 2BW2A 4K0KF 4DR1J 5KG5A 1H7XA 3QESA 4P4MA 2ZJAA 1U0HB 2OP5A 3PMLA 2WF5A 5ETMA 1UAWA 1Q81O 1OPZA 2HS4A 2YNFB 2D1KA 3J7YU 1B64A 4EO6A 4I6MA 4LF5F 5B0GA 5JVHQ 1FERA 2ZUBA 2JMGA 1YRXA 2HB5A 4ES2A 1WHWA 3KJVA 5B09A 2VBZA 1HYVA 3W62A 2UUBF 1KTQA 2QKKA 2Q0ZX 2IYIA 4BR0A 2E1FA 5DDOC 1ITGA 2Q3SA 5DDQC 1UVJA 1NK0A 1S0VA 1QD1A 3OTOK 4KGXB 1X4CA 3C23A 4FLWA 4NLUA 4LF6J 3KJFB 3M1FA 3UW1A 2CIMA 1VBYA 5DLGA 4GKJJ 1KL9A 4GKKJ 3V2UC 1RQLA 2NS1B 2HHXA 5A2QO 1GEHA 4BVPA 1JJCB 5LL6d 2F2AB 1S59A 3TA0A 2DGZA 2HBJA 2QWPA 1E3MA 3A3OB 1N54B 1AT1B 5K14A 3CETA 4IQWA 4FXVA 4I2GA 2YX4A 4F3OA 4O3RA 1NKCA 2GA7A 5F2RA 2FVQA 3T1HJ 4NA2A 2HHSA 1WOPA 4EUVA 3OYBA 1R8PA 3DNCA 4CLYA 1YG0A 3SLCA 1FEEA 3FR0A 3D6FB 5HMWA 4JI6K 5BRHA 2ZHAA 3IWXA 3MGIA 4CO4A 1VBXA 4DCHA 1HI1A 2MQLA 2F1JA 4WYWA 4HYKA 4Z0UA 3KNAA 3HCXA 4FJ7A 2DYAA 1CG2A 4B9LA 1XNRF 2WFBA 5T41A 2MA1A 3V81A 4B1XB 3VVUA 4RW4A 2WC9A 2Q4TA 3RH4A 2PE8A 1RTJA 2E8AA 3I76A 2EH9A 4Q8FA 3OT9A 4DL4A 1C0MA 2XSJA 4ZP7A 2E1EA 1TUWA 4KHNA 4NEYA 4P2XA 1X5OA 2J9DE 5HRSA 2G2OA 3I96A 3N28A 7ICIA 5ETOA 3HPHA 2DKXA 2KV2A 1N60A 4P2MA 3CD6S 3J7A1 4HVZA 2DNQA 2KI2A 1JCGA 3L2UA 4BC2A 4RW9B 4HUEA 2ZH9A 1K8KB 2CKWA 3A12A 5J2NB 5J2DA 5KGXA 1PAEX 4PG8A 4UUWA 2GJ2A 3MF5A 4RUHA 5FDLB 4CF0A 1P9QC 3MAAB 3AVCA 2V94A 1TL1A 3NCQA 3RJMB 3B82A 2DEIA 2E5LK 4US8A 3MCSA 4DLGA 2MZ1A 3SXLA 1TKTB 4DTOA 3C6AA 4BRDA 4LIWA 4CJRA 4FS1A 2VA3A 3RBZA 2X74A 2OPQB 2BEFA 4JOUA 1S76D 5CZXA 2AHOB 1NEEA 2OYQA 1JJ4A 3TTFA 5KT4A 2LKYA 4LFCF 3OQ2A 1TP7A 2B4UA 2KEYA 3U1LA 1C0TA 1QVFM 4LRBA 3O9QA 4QZIA 4I2PB 2F96A 4LSLA 4BC3A 5DGAA 1VQPN 4WCEQ 3V9XA 3CCLS 3NRBA 2VPWB 1LW0A 4JKGB 3WZ0A 2UXBJ 3WEEA 4HH1A 4FOIA 3CJ9A 3T6BA 3NCIA 2CH6A 1U24A 4ZJLA 4DPWA 4CI6A 1RLCL 3Q86A 4MFCA 3C1YA 2HGMA 4NZ0A 1ZM3A 1J5EJ 5JS1A 4C4WA 4ECRA 3WNHA 3EGNA 1K6YA 4K50A 5EY4A 4RQ1A 4MTPA 1WYGA 3H46O 5B0BA 2MY7A 3DFEA 1RE1B 4CM0A 3JTPA 2LDYA 2VBWA 2C28A 2E8MA 3M05A 2HFUA 1NOZA 5G5GA 2KXNB 1NI3A 2MKSA 2XM3A 4OVLA 2Q1NA 1QJHA 2O66A 4XEIA 1VQ7N 1T02A 1IR0A 4K59A 4UQGA 2P9SA 1BPXA 3D2FA 2W9BA 2KP7A 2FMSA 2AEFA 4FOEA 2VDHA 5D0HA 3P49B 3A2FA 1FA0A 1JJHA 4PHTX 3C29A 4O4GA 4Z94A 4NL9C 2AMCB 1XIQA 3PRVA 3BZQA 2ZVSA 1NK8A 3C2PA 4NLXA 1XR6A 5DBCA 4DV5K 2IVYA 5D0GA 4PL1A 4DR4F 1VRTA 4CK2A 3N97B 1ZD4A 2Q3PA 1UETA 2GNKA 3K5MA 2L48A 1WNEA 1H3DA 4I6AA 2GIFA 1S48A 2UXCF 2HBMA 5D8HB 4I2JA 4ES3A 3Q2SC 1ZXIA 2GWJA 1QAIA 9ICMA 4KFBA 4JP8A 4CLSA 3KG0A 3TQ1A 1ASWA 1BD6A 5L1KA 2HNYA 1NJIT 3L0QA 4UF4A 2QI2A 1HUZA 1JB0C 2LECA 1YITS 4FJMA 3M1VB 2EAMA 2HOIA 3TPQA 4Z6CA 1JIHA 4YEAA 1EP4A 1GMVA 4C97A 2QA4N 2IVMA 3VQ9A 3IKMA 2C3UA 2P9EA 1W7AA 1KDNA 3G6XA 4IRKA 3S41A 4FJ5A 1RXOB 1GTHA 1RT2A 2YCHA 1G4CA 3C65A 2KG0A 3HKZC 4BGDA 2FGOA 3MDFA 1HI8A 4OJ6A 1A5VA 1MMDA 4OYXA 7ICHA 3NKYA 5C10A 1T9YA 3ZD9A 2ZNZA 2VPYB 1WEZA 1S6PA 4M3XA 2OIHA 4GMJB 1U4BA 3S9HA 3MM5A 2V51B 4C0HA 3PIOL 1IJEB 1L3KA 3GQCA 4V19J 1IBKJ 4LBIA 3OBWA 5E5NA 3GSIA 4CF4A 4Y2CA 3TTCA 2XMWA 3S6EA 1MDUB 2GQCA 5J2PA 3V7JA 1KVKA 2AKWB 1TKXB 2BGWA 4B9VA 3ZX0A 2K4EA 2G9OA 1M90O 3QETA 5ETLA 1YIJS 3R1HA 5IIIA 3NF6A 5JU5A 4I67A 9ICLA 2E1MC 4OLBA 3I9ZA 7ICEA 5C42A 4JI2J 3FUYA 1VGYA 8ICNA 4YFUA 5IV3A 1CZ9A 2FJAB 4ZTFA 2H5JB 3L4QA 4JD2B 4CZJA 1S0OA 4QR0A 4K41A 2BJ1A 2H65B 2KSOA 1QQ5A 5G0RB 2L3MA 3ISND 3NVKA 1G3OA 5AICA 3W64A 4OI2A 4Y1CA 4UW2A 5EU7A 4U7CA 2IIRA 3CT9A 1TL3B 4Y34A 9ICTA 2KXHA 2V50A 1SH3A 1X9WA 3WC0A 3MN6A 3X1LB 2DNOA 5F41A 3L9ZA 1UL3A 2DIUA 5B66U 3E9OA 1UT8A 4YOXA 2FLOA 4LRFA 3TA1A 3EVWA 2RS8A 1M1KT 2UU9J 4JS5A 5AQNA 1R8AA 2F7TA 2OEJA 8ICFA 2F3JA 2MYFA 2OANA 1TK8A 4ZHRB 1LB2B 2RUSA 3MPDA 3RR8A 1P27B 4NLSA 3CIZA 2EFNA 4PL2A 3S7RA 2MQQA 3TAPA 1R0AA 4MF8A 1FDNA 5HN0A 2VF3A 2ASYA 3ONNA 2V4JB 4LF8J 2GVDA 2OPSA 3NVWA 4LD0A 4Y0WA 5A6PA 2WONA 3QU9A 1BUXA 3P83D 1NO8A 4U67L 4MKBA 2HSZA 3CC4S 3D66A 4FZMA 5KFQA 2IVFB 4DV6K 4CJ4A 4DOBA 4WF9L 1VJ5A 1Z2ZA 2ASDA 1FNMA 3V9ZA 2Y9HA 2WF7A 4P10A 4K8RA 2H54B 1U2FA 4PG5A 4Y2SA 1R31A 2NREA 1TAQA 2B3TB 5KL1B 4NLBA 2MSTA 4MO5A 4FLVA 3SQGA 4FWSA 1DRZA 3JAMU 5LMNJ 3CMES 4I69A 4KX5A 4ZMMA 5D46A 3BO4A 1RTDA 4YOTA 4IO9L 3E01B 2Z1HA 7ICQA 4E98A 5AQWA 3RSEB 4J2EA 4QZFA 3OS1A 3GDQA 3QWPA 2W8LA 1X6IA 2NZTA 3CQYA 4F9OA 3G8TA 1VQ4S 5A8RB 1QSLA 4TYAA 3OUYB 3Q89A 3GLJA 4HHUA 1RDAA 4BRFA 1B4SA 3QEWA 1VBZA 1P8ZA 5D3GB 3GFKB 2HQCA 2O4IA 3IG1B 5L1LA 1O6XA 2CGLA 4WU2A 2ZOMA 4OZ3A 4IQMA 1TYQA 4DSKA 4DG1A 4X4UA 3MR7A 2F1IA 3N4PA 4A8KA 1LAVA 1X4DA 2X7IA 1H6KX 2HHPA 4UATA 2P6TA 3Q8RB 4L3QA 1PGZA 5GIOA 4LSZB 2R7RA 2QB0A 2M70A 4EZ9A 1NZBA 4I7FB 1U0HA 1T94A 1S7HA 4DFJA 2HBQB 4PRFA 2HS3A 5I3UA 1V5VA 2NXCA 4EWTA 4FYVB 1HNIB 1WLJA 2IHNA 1E4FT 4P52A 4WFAL 2C2RA 2YNFA 4I6YA 1JLQB 2ISPA 1T6CA 1GOBA 3J7ZT 3DGVA 1XMOF 3TAFA 5AKKA 4Z6DA 5HJXA 1G7CB 4QR2A 2DHXA 2A6OA 4WYBA 2G8HA 1BWFO 3SMPA 5BJRA 5D6GA 1KWMA 3RVCA 3HFZB 4UB3A 4FXWA 5J0OA 3HZ6A 3KWGA 3I4PA 2F4VK 3AJ2A 2HVEA 3T1YF 1RDCA 3C19A 4NLZA 2OH2A 4OFZA 2UUAK 4X65F 4RNOA 1I94K 1KONA 2FLLA 1B9FA 2ZWPA 4Y2JA 5HVGA 1OXJA 3MXIA 2GV1A 5ALIA 2ROEA 2OWOA 2YX1A 2FDRA 1ITPA 4M3TA 1ZD3A 1GX5A 5JVGL 4KLHA 2IFXA 5KT3A 3CCLN 2OAUA 4BACA 3R7BB 1VQNS 3VQ4A 3T79A 1Y3KA 3FBCA 4JI4J 3FZHA 4CF5A 3DRYA 3DXMB 3ETLA 2BQ3A 1VHFA 2NXEA 3AVHA 2FQQB 1VR6A 4J37A 1DK3A 4FJJA 2RF2A 4P2SA 1MLAA 3BN7A 3D9BA 2KXFA 4ZVEA 4YMNA 2CDRB 5CA7A 4I1TA 4DR5J 2QV6A 1DLOB 2K7JA 3VTHA 3GV7B 1WHXA 3WDOA 1JROA 4PKHA 4W5OA 5A0YB 3IS9A 4H0OA 4JI5K 3CCTA 1NM2A 2OPPB 3J80U 2WRMA 3R5GA 2CPRA 2XYPB 1NGDA 1N34J 1GAOA 2HQDA 4FWKA 4NRTA 4YNQA 1MN7A 1NGJA 3H1VX 4I2BA 2R4FA 3HHKA 2G8KA 3EGWB 3NS6A 4DV4F 3W9IA 3F5TA 1VK8A 2JLGA 4GV6A 1HWKA 4N47A 3TADA 3DCAA 3HVWA 1JWWA 3N4QA 5F0UA 2FDNA 4PHAA 1DXSA 4BE0A 2DVIA 1GLBG 1PCAA 1SGGA 1IKYB 5ALVA 3KK1A 3LDQA 2M2BA 4GLXA 1EX8A 1RYUA 4C1NK 4RW9A 3ZETA 3LA0A 2N3LA 3H8WA 5DM7L 1XMQK 2WVEA 4BG8A 5J2NA 4DF4A 3LM2A 4YN4A 4NCAA 3PHEA 1ASUA 3MX5A 2NPFA 4E1MA 1HNVB 1BU6O 3L7OA 1QSYA 3MM7B 4BDZA 3MAAA 1NH7A 4CD1A 1YJWS 1S1VB 1HPMA 2ATLA 3WNFA 2F8MA 4ENOA 4MT1A 3ZT0A 1YITN 3ZYYX 1MMNA 9ICIA 1TKTA 4RUAA 3O80A 5AI9A 1X7VA 2ZD1B 1FFUA 4WBFA 2OPQA 4B8CA 1JMSA 4TNOA 3AQPA 4YXMA 9ICSA 1RDDA 4E0DA 2CQ1A 2YXLA 4YUDA 3V1RA 4G65A 2X6SA 1ZAXA 4M95A 4I2PA 4Y2TA 3GFXA 3R5AA 3UXPA 4DX5A 3OTBA 4JKGA 1HJRA 2OMOA 4I2CA 8ICBA 1LWCB 3C2KA 4FVMA 3PO4A 8RUCA 1NGEA 4I28A 2CFXA 3I33A 5D0RA 2VWBA 1X9MA 4M7YA 2YKPA 2NSCA 2MKHA 3BKUA 3OFGA 1VQ8S 4Z7YA 2K4PA 3HHNB 3TU5A 1RYSA 4M63A 4YG2A 4J7CA 4ER8A 1SJQA 3VV2B 2XRIA 2BACA 4LT6A 1QTNB 2AZ3A 5HRPA 1QSSA 3ZLJA 3TAEA 3Q8YA 2Y1IA 1S9EB 1SJ4P 4KMOB 2WB1D 4ED7A 3H8JA 2BCQA 2JL9A 4YMEA 3RTVA 1IUJA 3D6HB 5HSPA 2BUPA 2MY8A 3SSSA 3CYMA 4CEEA 4F4ZA 1N2XA 1Q7LB 3CDBA 4WKYA 2DFLA 3N7PD 2P5OA 2UVWA 3UE5A 1Z25A 1MWZA 4DQSA 2DBBA 3H5SA 2LYAA 5EDWA 2HOFA 2CQ2A 4N5SA 1X1PA 5F9LA 5AKLA 2JEFA 4DV1K 2B9WA 3ZT2A 1FWKA 2MKKA 4HCBA 3EO3A 8ICHA 1RWVB 1UWAA 2KD1A 1VRUA 4M5LA 1J9AA 4BRMA 4A47A 1N36J 2Q43A 4DMNA 3C3LA 1RXVA 3WNGA 3B0YA 4CESA 3D0HE 1P1TA 2ZJPL 3RH6A 2XMJA 3VERA 2LEAA 5K8NA 2RQMA 4DF8A 5M1KA 5EWFA 4CZMA 4RW6B 2H3ZA 1OMSA 4LVOP 3G82B 1SQKA 3ISZA 1VI7A 3F44A 5BOMA 4B3SJ 3NDKA 2F8EX 5F3XB 4F4AA 3M1VA 3PX6A 2J0WA 1IBMF 3CCJS 4WF9Q 4DR7K 4KHPK 1ZQRA 2WAQC 5AM1A 1WG4A 3CC4N 2GWKA 3OR1B 5AQJA 1WHYA 4JYAJ 4KH0B 3ZDBA 4LY7A 4DQPA 1ZQIA 3G2XA 4NLRA 2ZJ5A 5C25B 3CXCM 4Y2KA 2YNHB 4QYZJ 4M5DB 4NZ6A 1J6ZA 3ZSOA 3PJ9A 5A76A 4O3MA 2KVIA 3AO3A 3M8ZA 1RA6A 4IO9Q 2W7OA 5AQXA 5DM6Q 1QS4A 3CULA 8ICAA 2FLNA 3MFHA 1VQ6S 2OXOA 3KHLA 4B08A 3H7IA 3PSFA 4DCJB 3LUYA 3M30B 1HMVA 3D2EB 2E44A 1UEVA 1WCLA 2IJFA 5JMVA 2EI5A 2ZH7A 3DXKB 3QEXA 2OLWA 3ZFVA 2G2YA 3CJRA 2XB2D 3Q8LA 5J8YC 1TKXA 3DDIA 2IA6A 1Z1VA 4Q2MA 4ALZA 2F9DA 3BH6B 1ZQUA 5ALMA 5EOYA 2HQGA 4NWIA 2K06A 1ACMB 1ECWA 1TUGB 1N32K 4UW9A 3A8JA 2P9PA 5FPEA 3TARA 4E7HA 2C3YA 3Q2TC 3MXHP 4GY2B 1TK5A 4R0EA 4JD2A 3DRXA 2NLXA 1L3TA 5FPNA 1QLNA 1JJ2R 4FNIA 2XMUA 1WKKA 5G0RA 3MD1A 4ETZA 3CCSS 3Q8KA 5M1QA 4CH0S 3CJ1A 4CGIA 9ICKA 2ZG6A 4NY8A 1TL3A 1BIUA 5CZ2A 2YPZA 1DKGD 1Z3EB 2HHVA 3NVYA 5LY3A 2QTWA 3H5XA 1RHKB 5AIAA 1BHLA 3MGHA 4DTSA 1OY6A 4KLFA 2VG7B 3ILJA 4ISGA 2GUPA 3FZMA 3J81j 4C3MA 1ZOLA 4MKYA 4QU7A 2OELA 2OSQA 4BLGA 5B0DA 1SC3B 3V72A 1E6VB 3O6WA 4Y2AA 5EGYA 4MYUA 1VS3A 3HX0A 3W60A 2KZ3A 2AQ0A 3N6MA 3M2UB 3W9JA 3LZIA 3O9SA 1S3XA 1KAYA 5JVGQ 3GJRB 3AO2A 2XC9A 4QIWF 2DBYA 4CHOA 5C2DA 4M3RA 2ZXIA 4C3KA 4E2FB 2YWHA 4R25A 2UP1A 1HNZK 1IXKA 4HR2A 3SUNA 3AQEA 2I5JB 1SJ3P 2FHKA 3VWSA 1JXEA 1RWMB 2MZJA 3ITHB 1WG8A 4DI6A 5M1FA 4YY3K 3BGRB 1OWXA 4R66A 5LXYA 2RE2A 1UCNA 1Y88A 4IRCA 3S1TA 9ICVA 3AO1A 4OX9K 2QWQA 4USMA 1SUQB 3KKAA 4KGZB 4OJLA 3SYZA 1RUSA 1S97A 4A8QA 3E01A 3C95A 1KD1T 2RPIA 1Q8BA 3RJEA 2R7XA 3AHPA 1OO0B 2HK3A 2ASJA 3MM9B 1OS5A 1HHTP 3ZSZA 4JAXA 5AXLA 4DV7J 2DEJA 2RLTA 2K8GA 1ZQPA 5LMUJ 3OUYA 1YT3A 4A8SA 4KLEA 2RN2A 3GBTA 2YQEA 1Q5YA 3CEDA 3HSZA 2RUGA 3N79A 4KB7A 1RBVA 1XS9D 5LJ3Y 3WX8A 4CJQA 4M47A 3JSYA 1HWUA 1PSDA 3TTDA 3OL7A 2IVNA 3W61A 4J9QA 4ZITA 1RWOB 2BA9A 3LDOA 2FJDB 4KMUA 3ULHA 4KBOA 4F5OA 1ZH5A 5C15A 3WKBA 1NGBA 4OI6A 4X64F 1BCOA 4CHYA 4X4QA 1Q1KA 4J9KA 4DL7A 3BS9A 4F5NA 2QL7B 4NMXA 5DQIA 3DLBA 5HANA 5DM7Q 1HBMA 3RJHA 1RT3B 4I7FA 2JH7A 3SCJE 2FBXA 1ZQJA 3QGPA 3VQTA 1HNIA 1DTQA 4RNHA 3HRGA 4C7YA 1JLQA 2ROGA 4WJBA 1VQ9S 4UUXA 4DSIA 2FPKA 2FMQA 5F3TA 4JI7J 1W9HA 3AVNA 1S72S 1L8LA 1WUDA 3PYDA 2E5JA 2XZWA 5H9FJ 5AFUA 1ZTTA 3UMBA 5KG6A 1WOSA 1CLFA 4K2JA 3LP2A 1RAOA 2DY4A 3R5CA 2ZJQL 2EK6A 3H98A 3UQ0A 3K2YA 1CJKA 3VZIA 3PDNA 5HNKA 3KLIB 2BYCA 4BRAA 2J7KA 1OH7A 3OYDA 2CPIA 1EXNA 4CLZA 3MDAA 4J9LA 3OGUA 4WU3A 2LDIA 2AYEA 5SUHA 1Z4OA 4ZH4A 1K0TA 2HLUA 3OXGA 2D5RA 1KLMA 2R2UA 4E1NA 1J27A 2F8KA 3DOLB 4ERDA 5AM4A 4CGHA 3OYNA 3E2EA 1XSPA 3KJNB 4JKFA 2COLA 5BRDA 1RBSA 2AJ4A 1R8BA 4US9A 3DXMA 2C3PA 2J4RA 3O4WA 5J1NA 3V5RA 2H4WB 3C6HA 2GMHA 3KK3B 4G1IA 3KUHA 4ITSA 2R9LA 3GU0A 3MFIA 3EM1A 1A76A 1X9XA 1VQ8N 3A3NB 3NMAA 1P9YA 2IRYA 2P9NA 2B21A 2PGCA 4OJOA 4F02A 2ZIUB 1JXBA 8ICSA 1F9EB 3IAM9 3WKCA 2W3SA 5A0YA 2OPPA 3IG5A 1BA0A 2CQCA 1DZ5A 1FCAA 4CIEA 4JI1K 3U4LA 3KMQA 2VONA 4XPEA 2NRRA 4KYZA 4ICLB 1VQYA 4QCLA 1BWVA 1CULB 3L4BC 4M6WB 1B7YB 3RB3A 1BPDA 2ZKTA 3IRXB 2JNJA 2NXUA 4YHHK 2MPUA 5GAEU 3IGVA 2JXJA 3GE1A 3K8VA 7ICTA 4CCHA 1XERA 2PMZF 2XG8A 7ICLA 4YXJA 2GVZB 4RO0A 1K8AO 3C16A 1S77D 3EKSA 2P8IA 3DLEB 2YHWA 1U45A 3L7PA 4P74A 4G9BA 3WK8A 4GC7A 1WF2A 2WBMA 3LDLA 1QZ5A 4RR5A 9ICGA 5ALZA 4EBCA 2KYXA 3QLHB 3LGMA 2LSNA 2ATQA 4Z37A 4TLRA 2MRLA 3CNHA 2GO8A 2KICA 2Q0UA 1RT7B 1LK5A 3OYKA 1ZQVA 4EX6A 1SB6A 3OY9A 4LRCA 2R8JA 1BO5O 5CCLA 1ZC6A 3U1MA 4KBIA 3VGTA 3MM7A 2BRLA 4HVJA 4P7TA 4MLEA 3UQSA 5J2JA 1BNOA 1QAYA 2JRZA 2GH1A 3NS7B 1NNDA 3CCJN 1PJ7A 3NGYA 3JYTB 3F5AA 4ZVSB 2QB1A 1B43A 1WAFA 2XMKA 1RTHB 4JHDB 2DPJA 3QNNA 3PV8A 2HURA 1WSJA 2HSEB 4X66K 2HBLA 4J9PA 2ZZMA 2E1YA 2RVJA 3VZHA 1RT5B 3MD3A 2CYYA 4MIBA 2PFQA 1HNWF 4E7LA 1LWCA 1LWFB 4V19S 4QYRA 1PKUA 2PA8D 3X3UA 4IQXA 3KDOA 3LP0B 1SC4B 2IVOA 4MLHA 5KPZA 2HFSA 1FDBA 3TNVA 1HQUB 3RBXA 5AM2A 3I4HX 2P9CA 3OTQA 2QG9B 3A13A 4EI2A 2IM1A 3QPIA 2QK9A 3ZTOA 2IAJB 4D3HA 3PKYA 2UXDF 1S9EA 2VQFJ 4QWEA 3CJ7A 2HQIA 2X3GA 4URSA 1Q3UA 4CFDA 1SIWB 2Z1JA 4JV5J 3ID6A 4QWDA 3LF0A 4NLQA 4K42A 1I39A 2KOBA 3QE9Y 3NGIA 3K8WA 4IBNA 2DY1A 2WCXA 2RS2A 1IBLF 3M3ZA 1KW4A 3ZO7A 4KLGA 1SV4A 2BJDA 2FZKB 5F3ZA 4LFBF 3HDSA 3PX4A 4DV0K 4ZVRB 4RUCA 1HFEL 3MR6A 3GJQB 3VTIA 1RABB 4A5AA 3AVLA 4OMFG 4B3RJ 2L9NA 4LR7A 2AJ2A 3UPQA 2VFVA 1OYEA 4I2QB 4IEIA 2OEMA 4JKEA 4DR3J 1RP5A 2QGFB 4ILGB 4W5RA 2GEMA 3ZZUA 3QU4A 2W2NP 2VBYA 2HHHF 4KHWA 3O2IA 2K60A 4RW6A 2BE7D 1GMWA 2AF6A 3DDKA 3SSQA 1RWWB 1RAGB 3G82A 2XIDA 5CAAA 3QMLA 5SWMA 5C0YA 3V7LA 4S0MA 1OSDA 3MI7X 1ZQHA 1MA9B 5L39A 1KOHA 1YVNA 1RAAB 1WTBA 3UN3A 4DR6J 3GOIA 3IR7B 3OR1A 4WQ5C 3D0PA 1FJGK 2J9CA 2CH5A 3VQ8A 4B3TK 1WHVA 3I28A 2VZ9A 1RKIA 1J5OB 3NAEA 4I2EA 5C25A 1WN7A 1WBDA 1KQSR 3ISNC 4DL6A 4M5DA 3IMXA 4GO7X 3H0PA 1XQIA 4NE9C 5JRTA 2DNPA 3VEOA 1QHAA 4QZVB 3UD3P 3EPGA 4ZPCA 4IOAL 4I2AA 2JVRA 5KFKA 1Q8KA 2EFVA 2AX1A 4K0KJ 1FEHA 4F2SA 2YB1A 1DBDA 2IC3B 3M30A 1B0TA 4OJGA 7ICRA 1KFSA 5AM0A 3VVTA 5KAIU 4M5KA 3DXKA 4HT5A 4JK7A 2GTDA 4DCPB 1QCKA 1FRIA 3VF0B 5HMMA 2DXFA 3SSRA 1U26A 1U04A 2MSSA 4ID5B 4LF5J 3GCWP 3NGZA 2DITA 4NL9A 5GADU 4I68A 4LF9K 4IH5A 2W43A 3QRQA 2BTFA 4NYFA 1Z6RA 1YHQN 2DR5A 2UUBJ 1HYSA 1S7IA 1JLEA 3Q8PB 3MURP 3Q8VA 4DCCA 4P0QB 4NLWA 4GVBB 2F8LA 2D6FC 4CIOA 1VQKN 2G0AA 3D1HA 2WSEC 3O9RA 4CEBA 1ILYA 3WU2U 2G1DA 3R7NB 3VQSA 2J0QD 2P5GA 1AFJA 1AW0A 2F63A 3CIMA 3IBFB 4EMDA 2R7VA 1ROFA 1TL7B 1S5ZA 2JFKA 3K5LA 1JN3A 3M8YA 1RILA 4LF4K 3BS5B 3T5LA 4RPXA 2ZBRA 1GXLA 1HPZB 4FLUA 1KFDA 2MZRA 3US5A 4ZVHA 2ZE2B 2VG7A 5K20B 2PFPA 1RYRA 5A0LA 3UN2A 4DUYF 4DTXA 3ENVA 3LP1B 5KFHA 3CM6A 4FVCA 5BYQA 1D9AA 2ZJQQ 2ZH2A 4H0VB 2WW4A 2MQOA 4DU4A 2WVCA 1TU0B 1KVCA 3JQJA 1FJCA 3ZXWA 1PIEA 2HDOA 3M2UA 5EX5A 1S1XB 3FCVA 4C8LA 2KZMA 5L46A 2DGUA 1Z19A 4JI8K 2R2TA 2RE1A 5BREA 4FWQA 2VANA 1XNRJ 2BVZA 3PSTA 2HOEA 2JGUA 1HR0K 2XNRA 3PLAA 2GAHC 2F8TA 2FHMA 2W11A 3OSPA 5I3QA 2CA9A 1U1PA 4AYBF 4UZBA 3KLEB 3EX7B 2I5JA 1JJ2M 3AJ1A 3UO0A 1SL1A 3IP4B 4JI3F 3R3TA 2C2DA 2C3MA 4U8YA 3ZNJ1 4QU6A 1QE1B 3EZOA 3BGRA 3RB0A 1YBAA 1WEYA 3QYPA 3NCPA 4ZPAA 3FZBA 4Q7AA 1SUQA 1NDKA 3EZWA 2FVSA 3CCEN 1RAFB 1HEKA 2A19A 3JTNA 4FSVA 3QSIA 5D4OA 2CPZA 4UB4A 2O01C 5AQIA 3LDAA 2HNDB 2DH7A 4DB3A 1QDUB 4FKYA 1VK3A 3U27A 3OVNA 3G87A 4P9SA 3LP3A 4BRGA 3SUPA 1DAXA 1N8RO 4HL9A 4C0OC 3IM8A 4QW8A 3CJAA 2I1QA 2ABYA 2HVZA 1X5SA 1C0GA 4J2BA 3WK6A 2Q31A 3AOBA 5KT6A 5HP4A 2OTJS 2H5XA 5CYQB 4C11A 1VQMS 5AQFA 3RZAA 1Q8IA 8ICRA 4DV3F 4LFCJ 1FJ7A 1R7IA 3D6JA 5KT7A 5GMKa 1Y5IB 2A1AA 2NNWA 1RT3A 5IT9Y 4A46A 4C1NI 5GINA 3OBYA 4A8FA 3ETOA 3TUZC 2AYMA 5FROA 3RAMA 4B3OB 2NRHA 2FUG9 1RBAA 2KT2A 1JLAA 3O3GA 5CR0A 3MCOA 1DK2A 8ICQA 1T3OA 1B0VA 2BPGA 2QA4G 2CAJA 3CI5A 4RQ2A 2F4FA 1NDLA 2V5HG 4CVNE 1U1QA 3T7ZA 3QUCA 2BZ2A 1S9FA 3KUEA 3CFRA 3PEJA 3V4IB 4CLWA 3ICXA 4FJNA 4GNIA 4U6PA 3DRSA 4IQVA 3QMQA 3MMCB 3KLIA 2AP6A 3NGUA 3CF5Q 2DKZA 3VEWA 1S9GB 2Q1LA 2H5IB 1L3SA 3SV4A 1OUQA 4BC9A 1PYSB 1RTIB 2NUHA 3U3GA 3O4NA 4OI3A 2UYTA 4UY8O 2XLKA 4NA1A 3EE9A 3O3FA 2E66A 3M1YA 2OHDA 4EENA 3KK3A 4OIXA 3C6TB 1RBRA 4LIRA 3CJBA 3MCPA 2FGCA 2AV5A 2ZM6F 4MFAA 1JCEA 3JB9k 1ZPVA 4DR4J 5HO4A 1R27B 3C15B 5HHHA 4Y2IA 2I7PA 3THPA 5IM0B 4JRPA 4QZGA 4PABA 1VQ5N 1WSGA 4A5BA 7AT1B 2A1BA 5ALJA 3OLAA 4ICLA 2UXCJ 1CULA 1WJ9A 2BM1A 2ZM6K 1FXRA 2WHOA 2Y0SF 4FYYB 3IRXA 1EQYA 4MK9A 2CJBA 2IVPA 3VGUA 1FFVA 1L7NA 3BGLA 2IHR1 3HT0A 2DPNA 4YS2A 3F73A 2L08A 3OHRA 3V4MA 2M7SA 2HS0A 3D0GE 2E20A 2IBOA 4RQ8A 3DLEA 2H5EA 2CXEA 2AW0A 2OYYA 3O9UA 2LQ8A 4Y2QA 3NS5A 4W92B 2CN1A 4DN0A 4RQ3A 4NLYA 4M42A 3PJWA 4IS7A 3ULEB 3QLHA 2GHVC 1X5TA 1S49A 2CADA 2IA0A 3MCMA 4IH7A 4LRAA 5A8KB 3F2CA 2DY9A 1OVQA 2WF8A 1H2TZ 2X78A 1FNXH 4ELTA 4UASA 1RT7A 5FRNA 1M5HA 4U96A 2GC8A 1WDDA 2JEGA 3AVKA 3GG4A 1WELA 4YOUA 1JRPA 1U2RA 2YHYA 1U8SA 2P51A 3T69A 2NRXA 2KQ2A 4CFAA 3Q23A 4AHRA 1RCHA 2ETJA 1S6UA 2P66A 2L41A 3N7RC 3ILLA 2WB1C 4AL6A 3I5BA 2ZHOA 1DRGA 3DOKA 4QIEA 3MDQA 3NWRA 2C2ZB 3RMBA 3H40A 1CZAN 3JYTA 3DWLA 2LYVA 4P2FA 2M9NA 3C2MA 5J0XA 5RUBA 2Y9UA 1C0FA 2BV3A 3DV9A 3DKDA 1TKZB 5IWAK 2HSTA 1WSRA 3SMSA 1BQMB 4LUBA 4IOAQ 3H20A 3DLKB 3EGZA 3DLLL 1YUWA 3Q7BA 3V1QA 4YMMA 4B9UA 1QQ6A 2FJ6A 4ANCA 3H5UA 5CHCB 1VLBA 2RHKA 1F3FA 1JL1A 1S4EA 2QA2A 3ICLA 3LP0A 4WFZA 1Y64A 3R5BA 3MR2A 3SCLE 4IYQA 1HQUA 2VC1A 4L76A 1RM6C 1Q7YT 3SQ1A 1AROP 1HNXK 1XSLA 2ZEJA 4DWIA 1N5WA 1REVB 1N5SA 2DNKA 3SJHA 2E1AA 2IAJA 4W98A 3AB4B 3CO0P 4Y2VA 5KFSA 1DY3A 4QPXA 4Z6EA 4LVSA 2R7UA 2DHAA 3ZSRA 2H1YA 1UOCA 3NNHA 2BGGA 4ILLA 4CEAA 2GO7A 2ZHBA 1H2VZ 4M5NA 2OFHX 1CC7A 4AH9A 1CJVB 2AU0A 1GO3F 4RPZA 2MKJA 5KNIA 2DRAA 4ZVOB 5HMXA 3PUFA 4YOYA 4FLTA 1VLYA 4CHPA 3C28A 2EANA 1KHWA 5GTHU 1YLXA 4EP4A 3GFHA 4YCXA 2RD5C 2ZWOA 2ZOFA 2RILA 2WK4A 1ZJNA 4ZJOA 1ZQEA 5ADXA 2E1RA 4W4MA 1RT1B 3MPWA 2H3QA 2LM1A 3S3NA 3E0FA 1D0EA 2FB0A 1UVNA 2HZVA 8ICPA 2HBKA 3EKUA 4Y28C 3KHRA 1RI7A 4I2QA 3TW0A 2EG1A 5E41A 1CQNA 2R7WA 5KFLA 3UWTA 4P4OA 2GELA 2VB6A 3G71S 5AI0A 1O51A 1NMNA 3MMVA 5GAHP 2HCFA 2ZH8A 4XA5A 4RQNA 4OGEA 4L75A 2PY5A 3RRHA 5EWGA 4NLVA 3AB2B 2E9TA 1IR1A 5ETTA 1NCLA 1N62A 3V6DA 5E3RA 1KKHA 4O0JA 4AXJA 2AWZA 2X6NA 3PHTA 3K0JA 4HDHA 3NMRA 2ZDPA 1KTVA 2BDPA 1RU1A 4KB1A 4ED3A 1HW9A 3WIUA 4F36A 1BQXA 3FAHA 2CQBA 3CFPA 2NSBA 1UFLA 5AQPA 2IC3A 3RBDA 2ZKUA 1WG1A 1NSKL 4PYAA 2YKMB 3BV8A 2LQ5A 2VYPA 3DDNA 2KH9A 2E2OA 1F5SA 2E1PA 1UCVA 4OO1J 2GCFA 3OTDA 3ZZYA 4ID5A 1XMOJ 2GW8A 3VQAA 5THWA 4E8UA 4XH4A 3NE6A 5JXSA 5BR8F 2HYIB 3K5OA 3F9MA 4PXEA 3G8QA 3K0SA 1P90A 4NXMK 2X1BA 2ILYA 3A4TA 4IXCA 4KGKA 1NU0A 3KKRA 4CLFA 4TSXA 1PUZA 1MWMA 4KO0B 2VQEK 2WOMB 1PO6A 3T1YJ 3NVZA 2YHXA 4FS2A 5J2KA 3CCMS 4KH5A 1R0BG 4X65J 2ACYA 2O8CB 2ODGA 1TFWA 1VQMN 1SIJA 2KL8A 5AQVA 4CT9A 1HQEB 1KQSM 3SAHA 2VICA 1V9PA 3K1ZA 1AZSA 1R89A 1TL7A 3CG7A 1V3RA 3AQOA 3MM6A 4F2RA 2PT0A 3HHDA 1IR2A 4QZEA 1MROB 5HMLA 4PZOA 1HPZA 2DR7A 3M8SA 2ZE2A 4RBTA 1KKXA 3LP1A 1RWKB 5DG9A 2MGZA 3R1XA 3A3PB 5SZTA 2FBYA 2OA8A 4TU8A 2FPMA 5AJ3F 4AHSA 3IA0A 4YB7A 2CRXA 5IQ6A 3U9DA 2OFGX 1FEZA 1VFJA 3MCAB 4K43A 2G8WA 2KYZA 3UD4P 1N0UA 2BXJA 1S4FA 2IMOA 1C1BB 1S1XA 4KR0B 1TAUA 5JJBA 2V2KA 4R64A 4UOCA 4PJ0U 3H08A 3PYFA 3CDWA 1M5SA 5M1OA 5DG7A 1YQHA 2G8UA 2BCRA 2HHUA 1VQSA 4MF2A 4DTNA 2U2FA 3EL2A 2A42A 4DFMA 2DL0A 4YR3A 2P9IB 4DV4J 4EIAA 5ALNA 4FJGA 1TELA 5CHIA 1BISA 4A59A 2GMJA 1QE1A 5EE1A 4AQYK 2NUBA 4K8ZA 4ED2A 1N33F 3OYGA 4P73A 1RT4B 3GYGA 3NAHA 2O67A 3K75D 3VQDA 2R7YA 5AK5A 4BE2A 5DBAA 1UVMA 3CW2C 4CZFA 4ZCIA 5EHHA 1RAHB 3UDVA 3R9PA 1LK7A 4XRHA 5BPMA 4JI0F 1V97A 1Z4UA 1N33K 3H4BA 5A8WB 5BPCA 1AA1B 4F71A 1HARA 4K4VA 9ICQA 1SQFA 3W5ZA 4CJUA 1DHMA 3T5HA 2VODA 2KVQE 5J0SA 1ZJMA 5GAHI 1IM4A 2M3DA 4E1JA 3PRBA 3J81Y 4X62F 1OH8A 3FM9A 2XSFA 2DNMA 1UVLA 3VQPA 1T44A 1NK9A 2EW9A 2BE2A 4FLXA 5J2EA 4H4KC 2KG5A 1L6NA 3CJQA 4B3OA 4BC5A 2P35A 2MLYA 2ZH5A 5K8PA 3RH5A 1GT8A 2CDQA 4N41A 4M9JA 1IKXB 1PBUA 2AEMA 3M8RA 3TJ8A 2CG4A 2HQ3A 2N3OA 4PG4A 3TSPA 1K0VA 3F2DA 1ZQBA 3ZTSA 3SPZA 3EZUA 4CJVA 4Q2LA 3V4IA 4O55A 1D1UA 1FRXA 2HKEA 1DQ8A 2IOFK 1KN6A 3VGVA 2Q97A 3O4QA 5KG1A 5KG0A 2B51A 3MK6A 5B0AA 3CM5A 3NBPB 1XNQK 4IQUA 2W54A 3DLLQ 3UXOA 5CP2A 1M5OC 1BPZA 3DRPA 3ALRA 4GRSA 1KC8O 1S9GA 2UV8G 4GVEA 3MOZA 4NJ8A 2BOPA 4KHYA 5F0XA 5HROB 4DV2F 3L3CA 1RTIA 2LMRA 2DB1A 2KT5A 4WFYA 4LZDA 1IVZA 3O5TB 1K47A 2GX8A 4K4TA 3R6MA 4RKUC 3MX2A 4KLLA 1RBLA 4G1QB 4QWCA 3B8AX 2J0SD 4OHYA 1WSIA 4H5WA 1EX4A 4B3MK 3QYYA 5D49A 5JVHL 1HBOB 3HXMA 3D4JA 4FW1A 4CJPA 3M2RB 1RAJA 2CGKA 3HP9A 3A0HU 3QBWA 5IM0A 4OL8A 5KFJA 3QU7A 1H2UX 4C98A 3EN9A 2RSQA 3LAMA 4DU3A 4NX9A 3AA2A 2XO6A 4H0TB 1WC3A 2E8PA 3ZDEA 5K4LA 3N0VA 1X3MA 4CE9A 2ZF5O 4E7IA 4BXOB 1IBMJ 4QZBA 2PFOA 4IG3B 2KKPA 4LZGA 2POKA 3U7JA 2QIFA 3QBXA 4N8NA 1FWPA 4JV1A 4LF6K 5DDMA 4H0YB 1RGVA 3ED5A 4BRKA 5DB6A 4KTZA 3C66A 5K5MA 4GKJK 4B9QA 4GKKK 4HTIA 1UW4A 4BR9A 5J2CA 2GJFA 5FJ4A 3BQ1A 1PC5A 9ICEA 4CBUA 2A3ZA 2BKOA 4F25A 3ULEA 1R59O 5D4LA 5A8KA 2F1HA 4FPRA 1U47A 2D7SA 4YP3A 4ICAA 4M5JA 1GLDG 1B0XA 1LOUA 3BQTA 1F60B 2A3VA 8ICYA 4HKQA 4DU8A 8ATCB 1S0MA 2DRBA 2D0CA 1B70B 1YX2A 3AEVA 3T1HK 1FXLA 2FVRA 2FSJA 5J2MB 5F8NA 5D4NA 1ZBHA 3BPSP 4WFBL 2R8IA 4C23A 5CABA 4P2HA 4WP9A 3H6EA 2V9KA 4DQRA 1U6BA 3KYLA 4NB4A 3ISDA 5J1PA 5J1EA 1TGOA 3OYLA 1Q82O 4NMLA 2ZIWA 3UI3A 3I55S 4YDUA 2ZFHA 4PXBA 3KK2B 1BQMA 1FDAA 2M4MA 3DLKA 1W7WA 4HTLA 3WXJA 1F9FA 2V2QA 1RHJB 3B4MA 1MU2B 4IOXA 4MHVA 5E3CA 1QQ7A 2YX6A 2P6UA 3KBBA 2FJBB 4CIFA 1WUUA 1K9MO 1KR4A 4OZLA 2AJ0A 4KTWA 3T41A 2AXTU 2GQ2A 1UJ5A 3T9NA 1C6VA 3AVAA 2I7NA 2YHAA 2B7CB 2AGPA 2KE7A 1KLNA 2V8DA 4OZJA 2K2PA 4A48A 4ID8A 3DYAA 3ENHA 4OYZA 1REVA 4KLSA 1XO0A 3LPTA 3GL1A 2FF6A 4EX7A 5CA5A 3T9ZA 1T05B 1V3ZA 2W6LA 1XHZA 1H7WA 2PXIA 1ULRA 3QSYB 4CLLA 2OM6A 2DQNB 5CCMA 3W1YC 4HHJA 1ZZNA 4B17A 3ISCA 4ZPVR 1WF1A 3A8IA 3CCMN 4DTUA 2WTFA 4UBCA 5T7LA 1NBEB 3AVMA 4EO8A 1LWXA 1QTMA 1JLBA 2GHPA 4WCEL 3THXA 2IJRA 1IO2A 3C6UB 2CJQA 4PUOB 2OTLN 3VEVA 2XI3A 1OKJA 1RT1A 1COKA 3VQEA 5CE3A 4IC9A 9ICOA 3AAQA 1PC4A 3VALA 2CPYA 4ZP9A 2E5GA 4CIGA 2E2PA 4H03B 1UEUA 5ALHA 2UXBK 1K44A 2QLBB 4C6AA 3PW7A 3TOQA 4O3PA 4CEQA 2WFAA 3EXYA 3KHYA 1JLGB 3WKAA 2CVIA 2KN7A 3PZPA 2VG5B 5LJVA 3AVGA 5KG3A 3D7EO 1J5EK 2RMLA 4URQU 3C14B 1J2MA 3E9LA 3ONQA 3OXFA 4BWMA 2ZTCA 4J90A 3P4IA 3K57A 4CECA 3FFIB 4IG0A 5F8MA 5AZIB 4H0XB 4Y2XA 4HDGA 2JSXA 3M5RA 3T6JA 1AXQA 2UUTA 5H2FU 1MQ2A 4M41A 2G2ZA 3LQVA 2HRTA 4AXIA 1PG5B 3ILIA 1ZD5A 3IAYA 3DLJA 2VUGA 3UQ2A 3W2VB 4C8MA 4X64J 1X6JA 3KUGA 1RJJA 1AQ6A 2RB7A 3CE8A 3R5DA 8ICXA 4ED5A 2BDUA 3ZD8A 4A8WA 1EWRA 4YB6A 1BDGA 2R18A 3ELHA 1UPPA 2YKOA 1WSVA 4ZPWR 5KGWA 2A2DA 1T11A 3TKAA 4ED6A 3AOAA 2YKMA 4K4ZA 1D4XA 1JLFB 1TTHB 3TEHB 5BOLA 4PQAA 4C2MA 1TQLA 1FF2A 3GIKA 3MEGB 4LFAF 3WXLA 3SCXA 4Q45A 3FC9A 3M9OB 1IKWB 1RB0A 5AQZA 8ICWA 2MKYA 3W3DA 4O5FA 2FHOB 1MWKA 1X2IA 1JLCB 1ZQAA 2P9UB 3MN7A 2YTUA 1U1LA 4USWA 3DRRB 2DGSA 3EW9A 4AFFA 3P39A 2OKQA 3RUBL 1N88A 2O8CA 4RWWA 2D9PA 2HGNA 1GFWB 2AQ4A 5KFVA 2B6GA 1HQEA 2Z2YB 1NG9A 5HQMA 4MEXA 2UUCF 1M6YA 5CY4A 1JI7A 2WF9A 2CQGA 4BRIA 3EDQB 1SJ1A 2C2OB 2IDLA 4ID1A 3HX9A 1I3AA 3O1LA 4U7UD 3KLHB 2QMUB 1BL3A 4GXKA 3TVKA 3CCVS 4UAYA 2X51A 3GP9A 2YKNB 3DM2B 5EE3A 3VETA 1KBRA 3QIOA 1RCXB 2MJNA 1RQNA 1KQQA 3ZDCA 3S01A 2D3O1 3V1OA 1RK8A 4CZHA 1M0SA 2PFFB 5DS7A 4OX6A 4DU1A 1B22A 3KZXA 2IJNA 4I27A 5DMRA 1C1BA 1IBKK 3NGRA 2EKYA 1MC8A 5ETRA 2ZIXB 2VJ4A 1BY9A 3G96A 3H3OB 4NLOA 4IKFA 5T14A 2JZBA 1Q3VA 5HLFB 4WQ4A 4W5NA 4ANEA 2MTLA 3CDEA 8ICIA 2E5IA 3NL0A 3CJ4A 4JI2K 1SV0A 4DZ6A 3AM9A 2XGPA 2YPYA 5CWRA 3KWMA 4DU7A 4Z4EA 3D2SA 4GVMA 3ORYA 4CO3A 3NFAA 5E3PA 3OTOF 3DXBA 4YQWA 4TLQA 4DTMA 2NRTA 2LHTA 4E7KA 2J7WA 3FGUA 1YI2S 4QPTA 1GTEA 2ALZA 2V68A 4IFVA 3GG0A 1SCJB 2G8VA 1PZNA 3CCQS 1EO1A 4FPIA 2RHQB 4CJWA 4B1ZA 5J2FA 4KC5A 1X66A 2Q36A 4MAKA 2HWIA 5EX0A 2UU9K 5A8WA 2K8CB 3ZI4A 4RPYA 4A8XA 1WACA 1LKYA 2W2MP 6FDRA 1C7YA 1NZAA 1F6TA 4CLKA 3HSTB 1IH7A 2AH5A 1RWUA 2YY6A 2DF4B 4F26A 4QNLA 4JI6F 2GO9A 2EWSA 4UY8T 2I9SA 3NWGA 2HGLA 2KHVA 4LF8K 3PMNA 4LQ9A 1DARA 2E1CA 5JUMA 3KLFA 4OJRA 2BJ8A 1UHUA 3PX0A 4PL8A 2ZH1A 3VA3A 9ICNA 2WTUA 1AYEA 2ZITA 5ETKA 3D6TB 3ASMA 2JX2A 3AGKA 4H4OB 2NV3A 2XMMA 1WORA 1HNWJ 2AZ1A 2HVDA 2XS7A 4DHYA 2QSWA 5HR7A 5J0RA 4WFBQ 2NRZA 3DI6B 2ITMA 2KJVA 4Y65A 2DUYA </