2Y1JA

Crystal structure of a r-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1jA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1jA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1jA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1jA01
4EP4A 2AGOA 2WONA 3VQDA 4P4MA 4FCYA 4RPZA 3ZD8A 1J5OA 3RH5A 4Y1CA 3HK2A 4CK3A 4BWJA 4QZFA 1JLEA 5KG5A 4AHSA 4YR0A 4I2DA 5C42A 1S10A 4CIEA 1D8LA 2BDPA 4ECWA 3PW4A 3RH4A 1NK8A 2DY4A 4O0JA 2HMIA 1GOAA 4Z6EA 1NOMA 4DLGA 1U48A 3QEIA 4FJIA 3ZD9A 4IRCA 3V1OA 1BPEA 4FO6A 4DL3A 3SV4A 1REVA 3PV8A 3UXNA 2AQ4A 4FJXA 2WOMA 4RQ5A 5KRSA 4TSXA 1S0NA 4HUEA 2XCPA 3BQTA 2BCSA 2R8HA 4KHWA 1TFRA 4O3PA 2BQRA 7ICNA 1DTTA 1WLJA 4EEYA 2XO7A 4UB4A 4KO0A 2PFNA 4GXKA 5DLGA 2ZUCA 5KFFA 4I28A 2Y1IA 1T7PA 1TL1A 4E0DA 3OS1A 3G6VA 3UXOA 5D3GA 3MGIA 4CHQA 1JIHA 1DOQA 4MFFA 1RCHA 3JYTA 1XS9D 1RZTA 4ZTFA 4QWCA 4I9QA 4YFUA 3OYMA 4FLWA 2ALZA 3KK2A 1YTUA 4NY8A 4WE1A 1NK7A 1SKWA 4B3OA 4FJ8A 3KHLA 4DTNA 1CXUA 9ICOA 4RQ7A 3RJKA 1O1WA 4YMNA 1BI4B 3OYCA 4HUGA 4CJEA 1N56A 4DFPA 5KG7A 2PZSA 3GIMA 2ZE2A 4DU3A 1DGSA 1KRPA 1CZ9A 4IQTA 7ICQA 2UVUA 8ICCA 4IG0A 9ICAA 4F4ZA 1ASUA 4CGDA 4Q8FA 2Z1JA 3MGHA 3UIQA 1UWBA 2OPRA 2FMQA 1Q8IA 3GFKB 3HP6A 3L2WA 1ZBFA 4KITB 1MSWD 4F50A 2HHSA 4FJKA 4MQ3A 2A1SA 2QXFA 1IKXA 4I2PA 1AROP 1W0HA 4RW4A 2ZTCA 1TV9A 4M47A 4KLFA 3PW7A 3LPTA 4M9GA 4KTQA 4KLGA 4O44A 4IFVA 2P6RA 1RBRA 2YHAA 3LP0A 1A77A 1LW2A 1KCFA 3QESA 4EYIB 4IKFA 4E7JA 5DBAA 3L2UA 2BKEA 7ICKA 2BGWA 3V4IA 3DOLA 8ICSA 1ZQCA 3KD1E 3RMCA 5DQIA 1X1PA 1N6QA 4EZ6A 1BIUA 2ZQBA 2B5JA 8ICFA 2JLEA 4ID1A 4DTSA 1XI1A 2KZZA 4KLMA 4ECSA 4CJWA 4I2BA 4FS1A 4E1MA 3NBPA 1TGOA 3OSPA 1RTJA 4HVJA 5KRTA 4B9UA 5DG8A 2KZ3A 3UQ0A 1SKRA 3SI6A 3LDSA 5J0QA 1Z00A 4TURA 3MABA 4I2EA 3AVFA 2C2EA 4F4YA 4FM2A 4RQ2A 2OYQA 4W5RA 1Q9YA 5KFOA 3N4MB 3CFPA 1WAJA 4QZ8A 1ZQKA 5CYQA 4CFBA 3GIJA 4IDKA 4O9MA 2Z1GA 3NGZA 4DL2A 4KI6A 4F2RA 2KW4A 4J2DA 9ICQA 3T5JA 1XSLA 3ZSQA 3K58A 3V6KA 4TQSA 4QWDA 1ZQLA 1HPZA 4CK1A 3VA0A 5CWRA 3AO3A 3VQEA 8ICKA 3JPRA 4JWNA 1RYRA 5DGAA 4ECXA 3HW8A 3SV3A 2UVVA 7ICFA 8ICEA 4J2AA 3NGIA 2YNFA 3PO5A 9ICXA 4UB1A 2B21A 5J2BA 1K1SA 3G6YA 4JV0A 1ZETA 2DFFA 1CLQA 1V9PA 2YKMA 5SWMA 4GMJB 1RTIA 4FZXC 1HYSA 1S1VA 3GIIA 3K5MA 3MAQA 4F91B 2BCUA 9ICNA 3K59A 4KPYA 2PXIA 2R8GA 1BISA 3V7JA 4YD2A 5KFEA 7ICIA 2D0BA 3T5LA 4QZAA 4KHUA 5KFSA 4CHPA 3KKSA 4IBNA 5DLFA 4CIFA 4C8OA 4LH4A 2C28A 1JX4A 1WCNA 1BPXA 4IR1A 3DOKA 4YNQA 3RJEA 4CEOA 3GIKA 7ICGA 4C8NA 4NM1A 2ZD1A 4CJUA 1NK9A 3MXJA 4ECTA 1VK0A 4OKJA 1JLFA 4G1QA 1FKOA 4B08A 4YFKA 7ICSA 3C94A 4IQWA 4ED3A 3RMAA 2BPFA 2MUTA 2I9GA 1ZQYA 4Z4HA 4FW1A 5EWEA 2OPQA 1ZBIA 3VQ4A 1YTAA 3SYZA 1B43A 4DTUA 3DMJA 4H4MA 3BJYA 3TFSA 5DG7A 2R8JA 3CG7A 3DLEA 4QZHA 4DFMA 1Y88A 4PGYA 1RNHA 9ICVA 5J2QA 2YKNA 3RJJA 2C2DA 1QQCA 2RKIA 4I2QA 3LZIA 2GBZA 1ZQQA 5EWGA 3AVJA 3NH2A 2AGQA 3VQ9A 3PX6A 1A5VA 4Q8EA 2X78A 3DM2A 1JL2A 3QEPA 3H4DA 3RAXA 3CYMA 3AUOA 4RQ8A 1Z25A 3AU6A 3TWHA 4O3SA 4Z0UA 4EBDA 5KFBA 4R65A 1K6YA 4LVSA 2XY5A 1S9GA 4I2JA 3C1YA 3DLGA 3SCXA 4BACA 7ICVA 2V4QA 4M6WB 4CFAA 3TAQA 4P4OA 4C8LA 1S77D 2HHTA 3VQCA 4NCBA 4PHAA 3OGUA 3HT3A 4OPJA 3TANA 9ICMA 1ZQEA 1S0OA 3RAQA 4DLEA 4AHRA 1U47A 2P1JA 3MR5A 5KFHA 4CCHA 2HHVA 2P5OA 2Y1JA 9ICHA 1ZQPA 4K8ZA 4O5BA 3NF7A 1ZBHA 1T3NA 4NLKA 4PA1A 1C0UA 4F5NA 3B6OA 2IC3A 1ZQGA 3ZDCA 5HBMA 1KFTA 5IIIA 1VSLA 3ZSZA 1JXBA 4DO9A 4CFDA 3ZCMA 3RRHA 1HYVA 3ZSWA 2FBYA 5D49A 3HVTA 3H8WA 4KLSA 1KSPA 5CR0A 1ZQSA 2AU0A 1VSDA 1MQ2A 2FC0A 2HVIA 4DU1A 3JSMA 3M8PA 2KTQA 4XUSA 2E4LA 4PQUA 3L3VA 4B9MA 5SZTA 3H7IA 2C22A 4M3RA 4JV2A 4UB3A 5KT5A 2NRXA 4QWEA 4ID5A 4F3OA 1RT2A 4OGCA 2ZJ5A 3C21A 5KT2A 1RT7A 4CGJA 2R8IA 4JV1A 1BGXT 3QO9A 3U3GA 4NCGA 1NK0A 4N41A 2Q0ZX 9ICKA 4F3TA 1D9FA 4CGHA 4ECUA 4M3XA 2JZBA 1CEZA 2D5RA 4LZGA 4O5KA 2JZBB 4CERA 4HUFA 9ICLA 3CQ8A 4CF1A 3GILA 4XRHA 4ICLA 5J2IA 4M9NA 4KMUA 4QAGA 4YCXA 3TABA 1BCMA 1C0TA 5CJ7A 4I2IA 3AVCA 3QE9Y 4DQPA 3UXPA 4ECZA 1L3TA 3ZSYA 3OSNA 3RJFA 1X2IA 4DF8A 1JN3A 2OPSA 5L1LA 2OWOA 1WSFA 3SJJA 3B0YA 3HSTB 2ASJA 3NGYA 2G8FA 3V7KA 2I5JA 1D5AA 3JPNA 2BCVA 4FYDA 1FXXA 3Q8SB 3MR2A 4TUSA 3SUOA 2HNDA 4YXJA 5JS1A 1S1WA 4UQGA 5DB6A 4DOAA 1LW0A 2ETJA 1H38A 4ELVA 1WCLA 5I42A 4FJ5A 4OPKA 3G10A 4Z4FA 3DLRA 4RW8A 3AVKA 3LP1A 3KK1A 5C24A 3HJFA 3OS0A 1TVRA 3M9MB 3NH1A 2KN7A 3C5GA 4CJ5A 4CJPA 3K57A 3VQPA 3RR7A 4I2HA 1ASWA 1IXRA 4CHZA 5DG9A 3RH6A 2JEJA 4Q5VA 3V81A 8ICYA 2OZMA 4Z4IA 1ZJMA 4CJ4A 2X6NA 3AVLA 1IH7A 4W5OA 2W42A 4DTMA 4KLOA 3KLEA 1KEJA 3QETA 4CEBA 1XSNA 3DRRA 1Q9XA 1U9LA 4ZTJA 2JEIA 1I3AA 1DTQA 5HRNA 4B9VA 3QERA 1WSGA 3PMLA 4R8UB 3L2RA 3OY9A 4Q43A 3RB3A 2R7YA 8ICJA 4JLHA 2XHBA 3EZ5A 2DPJA 5HHHA 1C1AA 3GV8B 1MC8A 3H8JA 3K2PA 3RBDA 5DKWA 4FJ7A 1LB2B 4RZRA 5DMRA 2LSNA 3Q8PB 4KLLA 4J9LA 4GXJA 2UVWA 4QZIA 4E1NA 2AJQA 4CJSA 3SQ1A 5HP4A 3ZT0A 2IDOA 7ICUA 2RDIA 4DSJA 1B9FA 5J0RA 4QZDA 2BPGA 5KT7A 4HHTA 2PY5A 1RT6A 3G6XA 1ZQBA 1R0AA 4FS2A 4BXOB 4YD1A 2XGQA 2E6MA 5J0OA 2VG6A 3WNHA 1S5JA 3CM6A 1IM4A 4FLYA 3H4BA 1FK9A 3AA5X 1TAQA 3KHGA 1WSJA 4PWDA 1TKXA 3TAPA 2IOCA 2IBKA 1Z00B 4KLDA 3Q8RB 1TKDA 4KAZA 2YV0X 4E7LA 2KQ2A 7ICEA 3C2MA 4C8KA 4KLIA 5JS2A 2B6AA 3IS9A 4KLTA 3AO5A 4CECA 3OJSA 4Z4CA 3RR8A 2HHWA 3OHAA 3RJGA 1NJWA 3F9KA 4GVMA 4I27A 2VANA 1N48A 2BPCA 2W9MA 5I3UA 4FLVA 4C8MA 2ATQA 5KT3A 4CGIA 3E2EA 1BQNA 2P51A 4CJ3A 3Q8KA 1RDAA 1A5XA 3JPOA 2QK9A 3PR4A 3LWLA 2FMPA 1HNVA 1D9DA 5CZ1A 3M8QA 4NM2A 5KT4A 4F5PA 2FMSA 1U4BA 4I29A 4M3YA 4F5QA 1SL2A 1RBSA 5DB8A 4ECYA 3QEWA 1T03A 3NCIA 5F9NA 4DSLA 5KI6A 4L8RB 8ICTA 4QZEA 5KFAA 1B92A 3NF6A 5KGXA 1J54A 4CF2A 1KLNA 4FBTA 3K5NA 4K8XA 1CUKA 2FLLA 1NJXA 2G8IA 3LPUA 4NLNA 5J2JA 4AH9A 4FLUA 3IHQB 3V9SA 5HNKA 1QS4A 4EZ9A 3T5KA 4DS4A 1IO2A 1S97A 1BIZA 3OYDA 5J0UA 1BCOA 2HW3A 3FFIA 5CYMA 3GV5B 9ICGA 7ICJA 4B9NA 4Z6DA 1WSIA 5J2CA 4ED2A 5T7BA 1F21A 1TAUA 4KREA 4MFAA 5J2AA 8ICNA 3TI0A 4YR2A 9ICRA 3I0SA 5EU7A 8ICWA 3OYBA 4AHUA 5J2MA 3UPQA 2EHGA 2FBVA 3BDPA 3KK3A 3QZ8A 3MECA 4YMMA 3C6UA 1S1UA 3ZSXA 3ZSRA 1QSLA 4J2EA 4CESA 4BGDA 4K4IA 1ZQXA 2OA8A 3NGDA 5J29A 5EOZA 5KFTA 1XU4A 4QWAA 5DDMA 3UQ2A 4J9SA 3NE6A 7ICTA 3RTVA 2ZJAA 2BQUA 4JRQA 1T05A 4PH5A 1DLOA 1GOCA 5C25A 4N76A 3B0XA 3WNGA 1TK8A 4CEFA 1T8EA 1S6QA 5L1KA 4QW8A 4F92B 1XHZA 3PUFA 5DDYA 2ISPA 4DSIA 3QZ7A 3HPOA 3SQ2A 1UA0A 1S76D 1NOZA 4RQ0A 5FDLA 3PW5A 5EWFA 5HLFA 4FZZA 2VG7A 2W8LA 2P66A 3KLGA 3H8SA 4OKEA 5CA7A 2BR0A 3B6PA 1HNIA 2C2RA 3OYFA 3AVMA 1LAWA 1ZQZA 4CJQA 5FRNA 1U45A 5BOLA 5CB1A 4PY5A 1RTDA 4XIUA 4DMNA 3LK9A 4OJRA 4J9OA 3A2FA 5BOMA 3V6JA 5HRRA 2ATLA 4KLHA 5KFUA 4DOCA 3HWTA 3TAMA 5KG0A 4DTXA 3QNOA 2J6UA 3MEGA 4PPXA 3ASMA 4J2BA 4J9RA 3ULDA 4DL5A 4CGGA 4FVMA 3NH0A 3MDAA 1X9WA 1C6VA 3C23A 1TKTA 1JLCA 1G15A 5DK5A 3C6TA 2DFLA 2G8WA 1UT8A 4Q44A 8ICLA 3TARA 7ICHA 4CHNA 1JL1A 9ICCA 4RT3A 2H5XA 5J0WA 2KFZA 5CY4A 3AVIA 4JK1A 4N56A 1YT3A 4KN4A 5E41A 8ICZA 4PHPA 4NXZA 3TAFA 1WNSA 5KFVA 3AU2A 1C1BA 4CF9A 3PMNA 4UAYA 4DG1A 4O0IA 1FKPA 4PUOA 2Z1HA 5TZVA 4DL4A 4ECRA 5J2PA 1S1TA 4J9MA 1ITGA 2DFEA 3K5OA 4EP5A 4DQIA 3SUPA 1SL0A 3CFOA 2RDJA 2D0CA 3AVGA 4OLAA 5KFDA 3C95A 4FM0A 3SUNA 1VSIA 3ZT3A 4RNNA 1JXLA 2BHNA 2F96A 5KG6A 3IG1A 4YXMA 3KTQA 4GC6A 3HP9A 1U04A 4M3UA 5L1JA 1D8YA 2FPLA 2FLNA 3NAEA 4J9KA 2KZMA 5IINA 2W9CB 4HTUA 3K4GA 2J6TA 2ZUBA 1S6PA 5CHGA 2QKKA 4K4GA 4M9JA 1UAXA 1VSEA 3H08A 2A1JA 3DLKA 3JPPA 2BQ3A 1U49A 4FJNA 1BPZA 2G8KA 4FK2A 3SZ2A 3VA3A 2Q3SA 3AVHA 5J0TA 3ETLA 1LWCA 4CEEA 2PI5A 4CK2A 3L2QA 2I1QA 4PHEA 2AQ0A 5J2NA 1NK5A 3KIOA 1NKCA 1HQEA 2GV9A 3Q8MA 5J2GA 3PNCA 4RW6A 3OS2A 2QKBA 3TQ1A 1RT3A 3V6DA 3Q8LA 4ELUA 1COOA 2LYHA 4UBCA 2JEFA 1SV5A 3ORYA 1ZQUA 1RDDA 3ZDEA 1L3VA 3HPHA 2PYLA 5J2KA 3HYFA 3SUQA 1ZBLA 3RRGA 3DYAA 3ISBA 8ICIA 5F9LA 5KFRA 3PR5B 3MXIA 3JPSA 4CE9A 5D4BA 4DTOA 3AO4A 3EWAA 2XY8A 3LANA 2HVHA 1HYZA 1BPDA 4FJHA 3OYKA 2VG5A 3L2VA 8ICGA 5J0XA 4LD0A 2FBTA 4GXIA 3S3NA 4DFJA 5KTQA 3LP3A 4CFCA 4DU4A 3OYAA 2ISOA 4FK0A 1X9SA 4UAZA 3ITHA 4TUPA 4QZCA 4EYHB 4TQRA 4CGFA 4B9SA 4NLZA 2MAXA 3THVA 1VSJA 3CM5A 3KLIA 1NJZA 1XO1A 3KLFA 3V1QA 2HHUA 3G0ZA 2JEGA 1BHLA 4CEZA 3ALYA 1RXVA 4ELTA 4G3IA 1KVCA 1ASVA 3M9OB 3L3UA 4KRFA 1RDCA 4O3QA 3O3FA 2YHBA 3Q8QB 4J9NA 4DSFA 4CIGA 3AA3A 4IQUA 3AA2A 2P5GA 3V7LA 1LV5A 2BCRA 4KHNA 3I0RA 1JKHA 4ECVA 5KFGA 9ICBA 4UB5A 1IKYA 3TFRA 3ISCA 1YVUA 5FRMA 4CJRA 3VQ7A 4E3SA 3ISNC 2YNIA 5KFJA 4DQRA 3ISDA 3PW0A 3FYHA 4DL6A 1UT5A 9ICEA 1JLBA 2BCQA 3RB4A 3O3HA 3NHGA 4FJLA 5CZ2A 4M3ZA 3U3YA 3QNNA 4DF4A 4Y1DA 9ICFA 3ZT2A 1JMSA 3RMBA 2MUTB 3QEAZ 1ZQJA 1VSKA 3P1GA 3C2LA 8ICMA 4I2CA 5KT6A 2BE2A 2F1HA 4CJVA 1RILA 4Z4EA 3ZSVA 3SPYA 4M9HA 3LDAA 3LAKA 1RBVA 3DRSA 1CXQA 4RU9A 4JUZA 5KFNA 4H4OA 9ICSA 5J2FA 4FM1A 4IRDA 4FLXA 2XRIA 8ICAA 4BDZA 8ICBA 4KLUA 4AHTA 4M9LA 4F5OA 3TAGA 2IHMA 3KHHA 4KTWA 3RWUA 4J9QA 1ZQWA 3PW2A 3IRXA 2G8HA 4JRPA 1WSEA 3QIOA 3O4QA 2FPKA 2ZUDA 1S9EA 1XSPA 4OLBA 9ICWA 2YNGA 4B8CA 2F8SA 4DSKA 4DEZA 4M04A 1ZQFA 3OHBA 4RPYA 3OYEA 2NRTA 3QEXA 9ICJA 4Z6FA 4F8RA 4IQVA 4OVLA 1Z26A 4FJMA 4IFYA 1QHTA 4CJKA 8ICRA 5DGBA 3N97B 2FPMA 4F5RA 5HMMA 4DTJA 3PO4A 4RW9A 2O4IA 5J2DA 5KFMA 3T3FA 3LP2A 8ICQA 1S0VA 4JS4A 3MFHA 2ZTDA 1VSHA 4RG8A 4QOZB 1XHXA 4QWBA 2ASDA 4I2AA 5J2EA 9ICPA 5KFYA 5L9XA 1RT5A 3OYGA 3JPTA 3MEEA 3AO2A 3EY1A 5KFPA 1EETA 4GW6A 4AHVA 3QLHA 5FROA 1L5UA 1QLNA 5DB7A 4RQ4A 3KHRA 4F4XA 3HVRA 4ED0A 4K4HA 2DFHA 1EKEA 1KVAA 5DB9A 5BPCA 2VWKA 5KG2A 3BQ0A 3V1RA 3IM1A 3T19A 4EBCA 1QSYA 2YNHA 3BGRA 4E7IA 3AVBA 4RNOA 9ICIA 1L3SA 4YG2A 2NRZA 3OYIA 3RJIA 3KJVA 3S3OA 1EX4A 1J9AA 1VSFA 3CFRA 5KFCA 2HHQA 5DBCA 4DS5A 4M42A 2XY7A 4IG3A 2PI4A 2X6SA 4NCAA 4MFCA 3NFAA 4LZDA 3QIPA 2IGIA 1RBTA 7ICOA 5J0YA 2W9AA 3MDCA 5J2HA 3V9ZA 4CF0A 4H8KA 2VA2A 1HRHA 2XCAA 4N5SA 4DFKA 3SQ4A 1ZQAA 4FXDA 1ZQHA 1C7YA 1B9DA 1N5YA 1A5WA 1RT4A 4QW9A 2ASLA 8ICPA 3ZDAA 1LAVA 4GC7A 4N47A 1KVBA 3VQBA 4I9LA 1C0MA 1ZQOA 4IR9A 2W9BA 3C2KA 5KG4A 2IS3A 4HCCA 4ED1A 2GUIA 5KFXA 4R8UA 1X9MA 1ZQRA 1KLMA 1WSHA 4RT2A 4W5TA 5HP1A 4IRKA 5CP2A 1UA1A 3IAYA 4ZHRA 2HB5A 3AVNA 1BPYA 4DQSA 4PGXA 1ZYQA 4ZH4A 4KLQA 5IIOA 2F1JA 4RQ6A 1ZQIA 1EXNA 7ICLA 2DPIA 2F8TA 1HUZA 4KLEA 1RPLA 5HROA 4M3TA 4OKKA 1T4GA 4E7KA 1JLAA 4Z6CA 2W9CA 4FK4A 1I39A 1TKZA 3DLHA 3F73A 7ICRA 2ZJ8A 4Z4GA 2VA8A 3DLBA 3AVAA 4YQWA 4LSNA 1NKEA 8ICVA 4EBEA 4M3WA 4FJJA 2AGPA 3AO1A 4GLXA 3C1ZA 4ED7A 4I2FA 2NRVA 3K5LA 1J53A 2NRWA 1C1CA 1TL3A 2A1JB 3K75D 4UAWA 3VQ6A 1Z3EB 4BE0A 4UB2A 3ZT4A 4M41A 5IIKA 4KV8A 2V9WA 2EX3A 4O4GA 2IA6A 1PZNA 3MFIA 4DSEA 3E01A 5HRSA 4RUCA 3ZDBA 3SPZA 3KKRA 3ZSOA 4DTRA 2IMWP 4KB1A 3QINA 5DQHA 4RW7A 4KLJA 3MR3A 1XWLA 1EP4A 1A76A 4RNMA 5J0SA 9ICUA 4FJ9A 4DL7A 5JUMA 2G8UA 1BPBA 1W9HA 4R63A 3I8DA 3NDKA 3P5JA 2VA3A 2IHNA 4YMOA 1CZBA 2BGGA 4RQ1A 2O4GA 1TK0A 2ZTEA 3M9NB 4AILC 3LAMA 4QZBA 1ZQMA 1SKSA 2PFQA 3PX4A 3VQ5A 3SNNA 4R66A 1BQMA 3AA4A 3M8SA 4ED6A 3MR6A 4UBBA 2G8VA 4CEDA 5IILA 1GOBA 3VQAA 4R64A 5KFQA 3M8RA 1VRTA 4W5QA 3PY8A 4B9LA 1SUQA 4QCLA 2J6SA 4FW2A 3RJHA 4O5CA 3D45A 1JLQA 4O3NA 3SQ0A 1NK4A 3ZDDA 3VQQA 8ICHA 3BQ2A 5KFZA 2DTUA 2RN2A 4X5VA 1IKWA 1VSMA 2OZSA 3OYHA 1NKBA 4O3OA 1QE1A 3RMDA 1VRUA 2B4JA 5J0PA 1ZBUA 1NK6A 1IG9A 7ICPA 4YN4A 2V4RA 2R8KA 2W9BB 4M6WA 3MEDA 1HJRA 3OYJA 4MFBA 4W5NA 1SL1A 1HUOA 5IIJA 4OGEA 2Z1IA 4JWMA 4KHSA 3V9XA 2P6UA 1MU2A 3OVNA 8ICXA 4YP3A 4CEQA 4CHOA 3EW9A 4BXOA 3KD5E 9ICTA 3RB6A 4KB0A 3BQ1A 2KFNA 1HQUA 4NYFA 2WTFA 1S1XA 3L8BA 3P83D 1WN7A 4KN7A 5KFLA 2RPIA 4Q0BA 4B8AB 4CJTA 2BANA 4NLGA 1ZQDA 3QEBZ 1JLGA 4FJGA 1BL3A 3QEVA 1ZQNA 3LALA 4RQ3A 4O55A 2HNZA 1HMVA 2VWJA 1ZQVA 3S3MA 3DRPA 4FLZA 1XC9A 3GV7B 4CJLA 2XGPA 3WNEA 4KHYA 3HO1A 3C5FA 4KKOA 2OPPA 4B9TA 3ZT1A 3V6HA 1BI4A 2UVRA 2E6LA 3RB0A 1UOCA 4CJFA 7ICMA 3U6FA 3T1AA 2JGUA 4BE1A 2FLPA 4PGQA 3VQ8A 4E7HA 3PX0A 4Q45A 5K14A 3VN5A 3TR8A 2HHXA 2PFPA 2XC9A 3AV9A 4BWMA 1EXQA 1TK5A 4DTPA 4MF8A 3MXMA 1NJYA 4MEYA 4DOBA 3HX0A 4F93B 5D46A 3T5HA 4I7FA 2F1IA 2PFOA 3OYLA 5IIMA 4O5EA 1RYSA 3V9UA 4O3RA 3EPGA 4P4PA 3RBEA 1LWEA 8ICUA 3LZJA 4FZYA 3V72A 4YR3A 1B22A 3SI8A 2ITGA 2PYJA 4F4WA 2HNYA 4E89A 4PHDA 4LH5A 4M2YA 4TUQA 3WNFA 4CF8A 1TV6A 3O4NA 1BVSA 5HMLA 5DBBA 4AHCA 1RBUA 1L3UA 3GQCA 4JS5A 3HL8A 4YVZA 2X74A 3JPQA 1MQ3A 4ED8A 4QZGA 3S9HA 2A1RA 4DWIA 4NYNA 4MF2A 3HXMA 2RF2A 2W8KA 3HPGA 3EPIA 2XY6A 4XA5A 4ECQA 4F4KA 8ICOA 4CEAA 3O3GA 4CHYA 3OJUA 4DQQA 1ZJNA 3TAEA 4LSLA 1NOYA 4BE2A 1HJPA 3OYNA 3MBYA 1QSSA 4P2HA 4R5PA 5L1IA 4J9PA 1KFDA 1KDHA 4XQ8A 4RPXA 2FBXA 1QTMA 3D0PA 5KFKA 2D0AA 1S0MA 5KG1A 1KFSA 5HHIA 1SZPA 1RTHA 4KHQA 3LWMA 4HYKA 5DQGA 4HCBA 4I2GA 2M9NA 5C5JA 4M0AA 5KFIA 2GWSA 1KTQA 4KTZA 3FDSA 3NTUA 3HM9A 2IAJA 3NF9A 3DI6A 3KLHA 4FBUA 4LY7A 4M45A 1WAFA 1Y97A 1JXEA 5KGWA 4E19A 4RUAA 1TVAA 4BDYA 4F2SA 5HRPA 1IKVA 1S9FA 3V9WA 4QZ9A 1ZQTA 3H40A 1RXWA 2NUBA 3NF8A 4KI4A 4FLTA 1RDBA 1K1QA 4BDPA 3PVXA 5J1EA 5KG3A 1LWFA 1RT1A 4MEXA 4KFBA 3EYZA 5KFWA 3GDXA
chains in the Genus database with same CATH superfamily
1U1QA 1RADB 2AGOA 1RKIA 4OLOA 1NDKA 3VQDA 5IT0A 3VEOA 1KVKA 2HQFA 2A3ZA 4WQ5A 3RH5A 4X65F 4BWJA 4QZFA 4Y34A 1NU0A 2YJEA 2A42A 5KG5A 3M6VA 3W5ZA 4DHYA 2HOIA 4D3HA 5C42A 3SSRA 1S10A 2LM4A 2BDPA 2RRDA 1EB0A 4F71A 1S79A 3EE3A 1GLJO 3CCES 1NK8A 2YX8A 3BN4A 1YVFA 4Q0BB 2AJFE 1FVSA 3CJ0A 2DRBA 4H4OB 3GJSB 1T3OA 1RBLA 4DLGA 2R4FA 2X3GA 3ZD9A 3V1OA 2B9WA 2N7CA 1IM6A 4M5DA 3SV4A 3W64A 2A1BA 2QT7A 1R31A 4XPCA 3VGTA 3BS7A 1EP4B 3ZX0A 3D6FB 2WOMA 1SV0A 2IVPA 5KRSA 4KGKA 4FPAA 4TSXA 1A0OB 4X65J 2XCPA 1K9MT 2NXJA 3QUBA 4NLTA 1TFRA 4O3PA 2HHHF 7ICNA 2PEHA 5LMNK 3CCWA 2GTDA 4EEYA 5AJ3K 3ENAA 2ROPA 4CVNE 1WHYA 4HVZA 3GTYX 5CYMB 2ZUCA 1FWLA 3R5CA 4I28A 1T7PA 2W4CA 3T1HF 5D3GA 3MGIA 5ALLA 1YUWA 3P96A 1JIHA 2VBYA 1OY6A 1SJQA 1VBXA 4FYVB 4DR3J 3NL0A 1XS9D 1JLAB 1HNZJ 1RZTA 3CPWR 4XDCA 4I9QA 3C16A 5E3RA 3QU4A 4DX5A 2CG8A 3B78A 5JVHQ 3M32A 1UHUA 2ALZA 1YJTA 2XI9A 4RLEA 4NY8A 3KVGA 3JSYA 4CE6A 5C12A 1SKWA 4NLXA 2LA6A 3H90A 2CQHA 5F8HA 4RQ7A 3ZNUA 3GB0A 3RJKA 4YMNA 3OFFA 4CJEA 1ZA1B 3ZTPA 1YJUA 5E2QA 3EJMA 3GIMA 3ZO7A 5A8WB 2J7UA 4AL5A 2R7QA 4HR2A 1ASUA 2NYIA 1VQ6N 1WG1A 3AB2B 4RPFA 3HP6A 2C3YA 3OTOK 1MSWD 2J4RA 2QMUB 4A8FA 1DY3A 2J5AA 1U2VB 1NSAA 3BGUA 4IO9Q 2B4VA 1ZOLA 3PRDA 2F8LA 1W0HA 1X4GA 4RW4A 4B3MF 1WTFA 3PXGa 1WF2A 4DUTA 4KTQA 1F2HA 5CHCB 1VQMS 2P6RA 2VDHA 3QESA 4WP8A 1KKXA 4E7JA 2CPDA 4FWNA 2OPSB 1Q0NA 2BGWA 4O4RA 2ASYA 3A0IX 4FOEA 1X40A 1D4XA 4KJIA 4JI5F 4K0KF 1Y7PA 3HKWA 1NMDA 3AEVA 1FK9B 1X1PA 3H46O 2EVZA 4OJ3A 4DTSA 3PSFA 1XI1A 1WOQA 4WYLA 3UE5A 4KLMA 2OEMA 4BRQA 1OO0B 5EGYA 2WVCA 3NBPA 1HI0P 4XH5A 2WF7A 5DG8A 3RFAA 2YKOA 2KZ3A 3UQ0A 3LDSA 5ALFA 3SBGA 1Z00A 3PLAA 4LQ3A 2CPXA 4I2EA 1TUWA 3AVFA 4FM2A 2W3SA 4RQ2A 1N33J 2VOOA 4W5RA 3A8JA 1KN5A 5ETSA 5KFOA 3CFPA 1Q8BA 3BGRB 4ZHRB 3CTRA 2Z1GA 4KI6A 2KW4A 3VF0B 3LYSA 3AQEA 3QNMA 1OQ3A 4M5GA 4DV0K 3WEEA 4CK1A 4USWA 3VA0A 1QD1A 3AO3A 1UJ6A 1X9XA 1RYRA 5DGAA 4JI6J 3UR3C 2QTWA 4PKIA 2UVVA 2AXTU 4ISEA 4J2AA 3TUJC 3NGIA 3PO5A 2V8HA 9ICXA 3C14A 2B21A 1SXDA 2WVEA 1LWCB 5SWMA 5B0DA 4CW7B 4AQYJ 3NG8A 4O4GB 2E7WA 3EE9A 2BCUA 3JB9k 3BN7A 1TL3B 4OX9K 3I4PA 2W4PA 7ICIA 2D0BA 2XG8A 4WU3A 3MM5A 4Y2JA 3OV7A 1N52B 5BPNA 4IBNA 2Y9HA 5DLFA 2X51A 3W62A 2V6AA 3AD9C 1X6IA 1A6SA 1U6BA 3J81U 4IO9L 5I3QA 4UB6U 4YNQA 1NZAA 3GIKA 5A8RA 3RJMB 1R8CA 4WFBQ 3CCQS 2MQLA 4QIVA 4FNHA 4CRJA 1H0HB 1BWVA 4KO0B 4FPIA 3MXJA 2D8CA 4BBYA 4OKJA 5HQLA 1PBUA 1FKOA 3NAHA 1RQNA 2LEAA 3R97A 3RMAA 1CJTB 1ZQYA 3VQ4A 3SYZA 3IBFB 3TRGA 4H4MA 2K60A 3TFSA 5DG7A 4PAAA 3CG7A 3DLEA 4A8MP 5F8MA 1HUXA 1VQ5N 2V52B 3NNHA 2O8DA 9ICVA 5J2QA 3P4IA 4C1NK 2MGZB 3H5SA 2C2DA 1U1MA 3ONNA 3X1LB 3PSTA 3O9TA 2GBZA 3ILJA 5EWGA 3PYGA 3R5DA 3AVJA 1P27B 4Q8EA 2CXEA 2GHVC 2J76E 3DM2A 2E2PA 3AUOA 2LBOA 4G9BA 1R27B 2JNJA 4DZ6A 4MFBB 4DPWA 3IS9B 5A2QO 3M2RA 1K6YA 2XY5A 4ZPCA 1CPZA 3HHLD 4JBCA 4BACA 7ICVA 4LF4K 5DJBA 4CFAA 2IM3A 4BRAA 4P4OA 4C8LA 3VQCA 3OGUA 3LDNA 1DQ8A 3K8VA 3TANA 2UU9F 2WONB 3CDWA 2HVZA 4WBFA 5F8IA 3UCZP 3MM9A 2CA9A 3I0SB 3PFOA 1BO5O 3MR5A 3I9V9 4CCHA 2P5OA 2FTRA 1CS4B 1X4BA 1ZQPA 3NF7A 1ZBHA 4OYOA 3KOAA 3L6QA 1T3NA 3BPSP 1J97A 5D0RA 5E5NA 4A8YA 3GU3A 4FWOA 2MSSA 1TP7A 1IBKF 3R1XA 2ERRA 3H2VE 2GHPA 4F25A 5IIIA 3GR1A 2OTJN 2ZBCA 4F04B 2VJUA 2AU0A 3I5BA 1VSDA 2HVIA 4QU6A 3CW2C 3M8PA 4XUSA 4AYBC 4ES1A 3LP2B 3VZHA 2KHOA 1HWLA 1VLOA 1NMEB 5KT5A 1Y11A 2G0CA 3CDUA 1RDUA 5DO2A 1P90A 1RWMB 4UW9A 2NO5A 4F3OA 1RT2A 1S1TB 4WK1A 1VIOA 2QM1A 4DFDA 2GUPA 4JV1A 5DM7L 2CFXA 3U3GA 2ZWOA 5HAOA 3IDHA 4N41A 9ICKA 2OTJS 1CC7A 3DKDA 4BR0A 2QLBB 3GPAA 5A2QY 3HI0A 2LDIA 2D5RA 2VODA 1UQVA 1UWBB 1VQKS 2GO8A 1C0UB 2K4EA 9ICLA 2XNRA 4B3SF 3U26A 3SLCA 2XMAA 4XRHA 4R0EA 4IG3B 4M9NA 4KMUA 4QAGA 1NJIT 1TUGB 3H8MA 1BCMA 2YXLA 4FZMA 1XNQK 4I2IA 1SV4A 2IRUA 1L3TA 1JJ2R 2XI2A 2AJ4A 2GEMA 1YX2A 2QXLA 1WSFA 3TZXA 3B0YA 4EIAA 1UFKA 2KICA 2ASOA 2U2FA 3V7KA 2L3MA 4FYDA 4I4BA 4E2FB 4TUSA 2Z56B 2BE9B 1P1LA 4JI8F 4JI7K 2FPHX 3G87A 2YBVA 5EX3A 3CJTA 2HFOA 1S1WA 2JH7A 3VOVA 5ETVA 1HKCA 1QZ6A 2FXUA 5ETOA 3H6EA 4XPEA 4KT0C 2C3OA 3OT9A 1FJGJ 5HLFB 3HSJA 3QU2A 5BN8A 3G10A 2I7NA 2MKHA 1X42A 3LP1A 3KK1A 4YDDB 5E3CA 4CT8A 3BR9A 2VFVA 2QE5A 2Q3PA 1TVRA 4OYZA 2RHSB 3NH1A 3C5GA 4ILJA 4K8RA 4LF8J 4GKJK 3D0GE 1N33F 3CMEN 3TQEA 4A2BA 4OYXA 1IXRA 5DG9A 1H7WA 3V81A 8ICYA 1HNWF 4Z4IA 3IAS9 3GR0A 4CJ4A 2YY6A 4WKYA 5AQZA 2W42A 3QQCD 2HNYB 3Q7CA 4KLOA 4OHWA 1BWEA 1GLEG 2I0XA 1Q9XA 3MM7A 2KKPA 2JEIA 1XERA 2D74B 5HRNA 4B9VA 1ZAVA 3T6BA 4R8UB 3L2RA 1B64A 3MEDB 4KYZA 4IS7A 1NPKA 1B0XA 2NRRA 3RB3A 8ICJA 5AXLA 1HARA 2DPJA 2HOEA 1OH7A 1ECWA 4K7QA 4BX9C 1CJUA 4FJ7A 5AQGA 2AJ1A 3VZIA 2AV5A 2R3VA 2EFPA 2XIDA 3PZPA 2LYVA 1AB8A 3D2FA 2VOPA 2J7WA 4PG5A 3NGRA 1U0SA 5KT7A 1RT6A 1AFJA 3G6XA 1R0AA 4FS2A 4YD1A 1FDNA 5AKIA 3OR2B 3ETRA 1G1XA 4X4RA 2YHYA 2VQEF 2Q31A 2DR8A 3H4BA 2DXDA 1FK9A 1WG5A 2ZVSA 3AA5X 1MMLA 5ALIA 4DV7K 2QA2A 3LPEA 5E7OB 2W4DA 5AKYA 1WSJA 4LMZA 2IBKA 1Z00B 2YV0X 4DR1K 3N9UC 4DV5K 1J5EK 3J8AA 2KQ2A 1YJNN 7ICEA 3MZIA 1JWWA 4C8KA 4PQUB 4MO4A 3O08A 1N5TA 3MUMP 4GVEA 3RR8A 2HHWA 3RJGA 1NJWA 3F9KA 4GVMA 3RSEB 2QV6A 4CI0B 2MU2A 4FLVA 3UO0A 5KT3A 4CGIA 1X4FA 1BQNA 2W3RA 4ZA1A 2P51A 4CJ3A 2EKNA 3PR4A 4Y0WA 2FMPA 2WF8A 4CO0A 5CZ1A 2QA1A 2RRNA 2KT3A 1MDUB 1IQTA 3HVTB 1HHTP 1J27A 3Q83A 4OFZA 3HRGA 1M5KC 3VEYA 1T03A 1VRTB 3ALRA 3W9HA 2QIFA 2PSZA 3TACB 3THYB 4RUHA 1ZD5A 2Z2LA 1OH5A 5KGXA 4BC5A 4P0PA 5IWAF 2QARB 1QAIA 4ATNA 3D2QA 2FLLA 1NJXA 1SJRA 1HQEB 3VC8A 3LPUA 3QRPA 5AKLA 3CC7S 1WOPA 2XMMA 5HNKA 1YAGA 3H2LA 2VBZA 4EZ9A 2MQOA 1IO2A 4G9ZA 1F0XA 1S97A 1VC5A 1SBRA 5GTIU 2HW3A 1HWUA 2QB0B 2CJBA 1YJVA 2QG9B 1VQ9N 5LY3A 4CZCA 1NXIA 4B9NA 1WI6A 4IFYB 4TNOA 2KXNB 1F21A 4NE9C 1VHXA 3JAMO 2ZH9A 1TAUA 4KREA 1N8RO 3GMGA 8ICNA 3ZZPA 5J2MA 4CQ1A 2FSNA 3UPQA 4CNYA 3HLUA 3A4TA 4BC9A 3KK3A 4FF2A 2QTDA 3CERA 4NO7A 4OX9F 3IBCB 3TADA 4CESA 3ETOA 2O8DB 1N4LA 3NGDA 1Z4OA 5EOZA 1GLFO 4DL0C 1MWQA 2J8AA 3EMTA 1NB7A 3UQ2A 3OHRA 7ICTA 1R0BG 3RTVA 2ZJAA 3CGIA 2HFSA 4KGZB 4PH5A 3M7DA 5HI7A 2MKSA 1YJWS 4N76A 3WNGA 1K44A 1XJWB 1TK8A 3DCAA 1U0HA 1T8EA 2KIVA 4F92B 2IVOA 1CRXA 2V5HG 2LCWA 1AXQA 3SQ2A 1KL9A 1S76D 2XQCA 3IFEA 1KC8T 4RNHA 4PWWA 3U8XA 2UUCK 4FZZA 2VG7A 2W8LA 3ZZUA 2QA4N 3FFIB 4HTLA 5ETQA 3UMCA 3KLGA 2YNIB 5CA7A 4LBPA 3IAM9 4HDHA 1H2VZ 2P6TA 1HNIA 2C2RA 4B1ZA 3AVMA 4ZVFA 4GRSA 2HWIA 1LAWA 1H6KX 5FRNA 1U45A 2CPIA 5F3TA 4KHMA 1DFDA 3OR1B 3D2EB 4J9OA 3V6JA 4X4SA 1MMDA 4B17A 1S99A 5KFUA 2AW0A 4DR3F 4RW9B 3FSYA 2AMCB 2VIXA 5DZ6A 3ASMA 2GNKA 4J2BA 2XICA 3CJ9A 2FHJD 3P31A 1LK7A 1C6VA 2QA4S 2LP4A 1AUSL 3C6TA 2DFLA 1UT8A 3AOBA 1YITS 1T9VA 2IA0A 4ZVSB 4LBIA 5AJ3J 9ICCA 2GW8A 4JK1A 1Q3VA 3TSQA 1ZBTA 2IPOB 3FRZA 3W2VB 1DQAA 1OMSA 4ZPBA 2HBKA 5GIOA 4KRWA 3SMVA 3JS6A 1SIJA 3CC2S 1RCXB 1Q18A 1R8HA 1HKBA 5F41A 2Z1HA 5ALNA 4ZP6A 3DXBA 4UOCA 2EBEA 2D41A 1GMVA 1PBAA 2QW9A 3W9JA 1SL0A 2D0CA 3UI3A 3SFUA 5G4DA 5KFDA 2QWPA 5ALWA 5IZHA 4OHZA 3M2VA 1IR0A 1NGBA 1NNEA 2O8CA 4RNNA 2KOBA 1H7XA 3SDEB 2O8CB 3QICA 2FPLA 4GVBB 3NAEA 2J6TA 2ZUBA 1XMOK 4Y2KA 1UKUA 1VQ7N 3MPYA 4K4GA 2D1CA 1KD1O 3DLKA 3ONQA 4DX7A 1BPZA 4DV3F 4DR4F 3U02A 5EE0A 3WIUA 3ETLA 4DI6A 1GO3F 2PI5A 4PHEA 1RJJA 3CJBA 4QS9A 1Z2LA 1U02A 4YY3K 4DR5F 2ZIXB 3Q8MA 5J2GA 4UY85 3TQ1A 4JN4A 4M5MA 2FHJA 1N5QA 2LYHA 3Q8VA 3BZQA 1SV5A 1G99A 3VF4A 3HYFA 2H3ZA 5F0UA 2OEJA 2O6KA 4M95A 3P8BB 4FPBA 4USAA 2HLTA 2D69A 2GFFA 3PR5B 3MXIA 3JPSA 4DR2J 5D4BA 1UZDA 3TUIC 1BA0A 2MZQA 4JHDB 3OYKA 2LECA 5C2FA 5J0XA 4LD0A 3BDEA 5KTQA 2X1AA 3CMAS 5EDWA 5AE2A 1WG4A 1ELOA 3DFEA 2UV8A 3H7HB 3W3SA 3ITHA 2P9UA 4QZCA 4OZ5A 3O8MA 3AGKA 1O08A 3QAEA 4JKAA 4CGFA 4W90B 4USTA 1G3OA 2DNOA 3Q24A 2XHCA 2MAXA 3QJJA 1NJZA 3G6EN 2RT3A 3GE9A 2FYXA 3VEWA 1TE2A 2JEGA 5DDPC 4CEZA 1AT1B 3ALYA 1TAMA 2P9PB 2E1MC 4LT6A 2QSFA 2YX6A 2CVIA 1SH0A 3R7NB 4DR6K 3CCVN 2NPIA 3TEHB 1RXOB 1KVCA 3L3UA 4KRFA 1RDCA 3PYDA 2Q6CA 2O8EB 2DEIA 3BM7A 3M1VB 5LJ5Y 2BCRA 4NEZA 2P9GA 2NNWA 4E1JA 9ICBA 4AL7A 1S59A 3OXGA 3VQ7A 2UUBF 3D66A 5H9FJ 4QR0A 5AT1B 2VGNA 3FYHA 4DL6A 2C42A 1JLBA 2RHKA 2CZVC 5IM0A 3NHGA 4BG8A 4FJLA 3WXLA 1QQ6A 1X0FA 2WFBA 4OLPA 3WIVA 2K89A 4AD6A 2DXEA 4JHDA 9ICFA 4JKBA 5IV4A 3BF4A 1VQPS 1SJ1A 3VHQA 1VSKA 4EUVA 1LK5A 2K3KA 5EY4A 5KT6A 3FE1A 2QZ8A 3EKSA 4YHHK 2A2CA 1NGGA 4CJVA 1RILA 3NMRA 4CZMA 3D7SB 3ZSVA 1V3RA 4LRFA 4JI2K 4Y00A 3DRSA 1CXQA 4H4OA 2GO9A 4IRDA 1KQFB 4BDZA 1IKWB 2YQEA 3RSEA 4M9LA 4F5OA 1OYDA 4L73A 4K2JA 2E5IA 2YNHB 4OI4A 2UU9J 3KHHA 4H4KC 1U26A 5CAAA 3NCRA 3V2UC 4JRPA 3POTA 3QIOA 4ERDA 3HVWA 1ZBSA 1S9EA 1NLVA 4C80A 1RAHB 2EK6A 2NRHA 4DSKA 1KBRA 3A12A 4DV5J 1DGJA 4MLHA 5AQFA 3OVSA 3G96A 1FVQA 4DDFA 8ICRA 4F0KA 5DGBA 1O13A 4PYAA 3D1HA 4KQZA 5HMMA 3PO4A 2NR0A 2O4IA 5FLXU 1JRPA 5ADXH 3M8YA 1QVFM 8ICQA 1S0VA 3SFGA 3MFHA 1VSHA 4ISGA 2RLTA 1E4GT 1TMMA 3DRYA 1BD6A 3DGPA 2IIRA 2MLXA 4XAKA 2G0AA 2KT5A 2JHDA 2ZIVB 2KM8C 1JLQB 3BGFA 2IAJB 4NA1A 3AO2A 1N2XA 5AK3A 5KFPA 4GW6A 4AHVA 5FROA 2HWTA 3DRSB 3JXOA 1L5UA 4OX7A 3F44A 5DB7A 4RQ4A 4OJLA 1GTHA 4CO5A 2DFHA 2PFDA 1EKEA 4CZIA 5DB9A 2E9ZA 2KO1A 2VWKA 2KFYA 4BVPA 3BQ0A 3BPDA 3NGUA 1JB0C 5AJ3F 2ZZMA 2YNHA 3BGRA 1LKYA 1JUDA 2MLYA 4ZP8A 5EX0A 1FD2A 5KFCA 2HHQA 5DBCA 4DS5A 2ZBIA 3T6JA 2X6SA 3N0VA 3NFAA 2AYGA 2B8QA 4OI3A 3K0SA 2FJVA 1I94J 7ICOA 1HLWA 4QS8A 2E9TA 3SCLE 3LDOA 1W7WA 2W7AA 3SQ4A 4MK9A 1XMQF 5GVQA 4FXDA 2D1KA 3ZTSA 2CPZA 3IMXA 4ZN3A 4OIXA 1Q86T 4J37A 4IZ9A 1YBTA 1HX1A 3DXKA 3L5KA 2YWEA 1LAVA 2CQ4A 1EQYA 1OKJA 3VQBA 3UDVA 4I9LA 3RAMA 3Q22A 2MTLA 1ATRA 2IS3A 2V9KA 3CO0P 4FVUA 2HS4A 4RT2A 5HP1A 1HBOB 3BSOA 4ETXA 3OFGA 1CBKA 2HB5A 3SENA 4KX5A 1IV8A 2VYPA 5HANA 1ZYQA 3DDIA 1NDPA 5C24B 2KMDA 2O8FA 2Z2YB 3EDQB 5HROB 1ZAXA 2CQCA 1EXNA 4GNIA 3ZZOA 2DPIA 4DXLA 1HNVB 3RU0A 2GGPB 4X84A 5IS2A 5HROA 3LUYA 4OKKA 1T4GA 3BF1A 1TYQB 3G8QA 5I4MA 2W9CA 1UAWA 2CRLA 3CJRA 5DDQC 4FK4A 2PKEA 4DQ8A 2CDRB 3MM6A 2I6WA 3BBFA 4K5RA 3DLBA 4QR1A 3KKAC 2ILZA 2ZNYA 1NKEA 8ICVA 2HS0A 2AGPA 1KTVA 4ED7A 4XTTA 1HNXK 1J53A 1C1CA 1TL3A 3FZHA 3R1HA 2P9CA 5A6WA 3K75D 2IIHA 5JLFA 4UAWA 1YHQS 4OJ1A 4BE0A 3F9MA 2XMWA 4UB2A 2O5DA 5H2FU 4O4GA 1PZNA 4DSEA 1XK8A 1DARA 1GXTA 1KBUA 1O03A 4RUCA 3ZDBA 1U1OA 2QEXS 5DQHA 4FO0A 1XWLA 5E3AA 3C19A 1UJ5A 2V8DA 4DL7A 3LO3A 3MF5A 3KJNB 2W7PA 2CRXA 3OQ2A 1HBMA 1PKUA 3NDKA 2DRAA 3MXHP 1NGDA 4O8KA 1ZM2A 2O4GA 5JU5A 3ZZYA 4DR6F 4QZBA 1DZ5A 2CQDA 3PX4A 4R66A 1BQMA 4ER8A 3MR6A 3R6MA 2BJ1A 2LLZA 4GY2B 1OJ4A 5IILA 1RLCL 1SC1B 1XNRJ 2WVFA 5AFUH 3FBBA 2ASMA 4OZ3A 5LMUK 2WCXA 4TLQA 2J6SA 3CJ2A 2NSBA 3FBEA 4MO5A 2Z8QA 3TSUA 2YTUA 3IA0A 3VERA 5AI0A 1RWPB 8ICHA 5KFZA 2ZH4A 5LT5A 3DM2B 4X5VA 2KN4A 1NKBA 4MYUA 4DU8A 4WF9Q 2NCKL 1NPPA 5ALZA 1Z4NA 2H5IB 2JX2A 4J90A 4DR6J 3I56S 2H5JB 1SZ2A 1HNWK 2R8KA 4NZ6A 3CCJN 2J9EA 1R7IA 2KJWA 1SQGA 3MTJA 4MFBA 1SL1A 3UM9A 3M2UB 2BW7A 3KD3A 1GMWD 2FQQB 1XNRF 1T94A 4JWMA 4X4PA 4NJ8A 4QIGA 2HIQA 5IOLA 2P6UA 3CD6S 4YP3A 1TQLA 1W26A 4CEQA 4R25A 4P73A 5KAIU 3JTNA 3KD5E 9ICTA 3QMLA 1V5VA 4PEOA 5AXMA 3VGSA 4RU2A 3KZBA 1NAQA 3NXZA 1OPZA 3FEXB 1FFGB 2O8BB 3P83D 4KN7A 1VQMN 2WB1D 4BLGA 2BJEA 4W92B 5H9EK 3KK7A 2ES6A 1YJNS 4NLGA 3D5MA 4QR2A 1ZQDA 2V68A 4DN0A 2KHCA 4FJGA 2LYAA 4MMOA 4PJ0U 1KLMB 2HNZA 3S3MA 3F56A 1IG8A 1KWMA 1KKHA 3DLGB 3PJWA 1XC9A 4CJLA 3M8PB 5AKEA 1N5YB 2AEFA 2NYVA 4KKOA 1VJQA 2LHTA 4H0OA 3ZT1A 2JDJA 1M0SA 3RB0A 1P1TA 1RWXB 1ZM3A 3U6FA 4JNEA 1NSPA 3SD7A 2ADCA 1EARA 2JGUA 1M1KT 4BE1A 1Q16B 1I1GA 1KQGB 4PGQA 1XTZA 4G1QB 1P9YA 1QVFR 4BRGA 2E66A 3A8KA 1ITPA 3KK1B 2DITA 3TR8A 2PFPA 1TK5A 3ENVA 4K4ZA 3HZ6A 4OX9J 5IIMA 4O5EA 4YOWA 3V9UA 4PRFA 2EFOA 4P4PA 3RBEA 4JP8A 8ICUA 2LMRA 2V94A 5CYJA 1VQNS 4EU0A 2HNYA 5G5HA 4PHDA 4LH5A 2BDUA 3L95X 2PMWA 4BREA 3WNFA 3MAAB 2RP5A 3RBZA 1RWOB 1RK8A 3K5PA 5GAEI 3JPQA 3FR0A 1B3TA 4DWIA 1NHKL 2XS5A 1V4SA 4OL8A 2ESEA 2RF2A 4NMXA 3PRVA 4MLEA 1VQ9S 3F2BA 2UXDJ 4I2QB 4EX7A 4XA5A 3R9KA 1L3KA 4CEAA 4CHYA 2CYYA 4DQQA 3GG4A 4LSLA 1NOYA 3UWTA 1JALA 1FDBA 2W01A 5J1NA 1RZMA 5ALSA 3D4JA 2M8DB 3F0NA 5BYRA 2EFQA 1KDHA 4RPXA 2W2NP 1DT9A 3E9LA 5IC4B 3W0LA 3CJAA 4HYKA 2EAMA 1L8OA 1WI8A 4L74A 5L38A 3PHTA 1C20A 2RQ4A 4FWLA 3OBIA 1WC3A 3M3ZA 2CZ4A 3TX0A 1FWKA 1KTQA 3E66A 2HMIB 3QX7A 1VRQC 3NTUA 3HM9A 3I33A 2IAJA 5CD4H 2KP7A 1S7IA 2ZH8A 2QWQA 5AR0A 3DI6A 1Z05A 4E19A 2VKRA 1VS3A 4BDYA 4F2SA 1ZRMA 5IWAJ 3PHEA 1S9FA 3V9WA 4M5DB 2WAQC 4QZ9A 4WXOA 1RXWA 1URRA 4RCHA 2GIRA 1IBMK 3SQIA 3KK2B 3NS1A 3HULA 3W63A 2D3O1 2DL0A 2B9EA 3HHKA 2GVDA 4BDPA 5GAHP 1W25A 3A3NB 2RAQA 4MEXA 1RT7B 3I8BA 5F0WA 1YRTA 3EYZA 3AJDA 3CJKA 2FZCB 1SCJB 1RGIA 4EP4A 2I9SA 5E26A 2EI5A 4P4MA 1GMWA 1S9EB 2EPIA 3TAMB 4ZMMA 1TUUA 2A2DA 3HK2A 2EEYA 1CQNA 4NLOA 3NRZA 4CK3A 4YOEA 1JLEA 1VCTA 1PC4A 1URJA 2CNLB 4I67A 4YR0A 3GOIA 1IBKJ 3I32A 1D8LA 3DHXA 3RH4A 4LRAA 4F3QA 1X9JA 1N0VC 3C46A 4JI3J 1HL6A 3J81Y 1GXLA 3AOCA 2HMIA 2XEXA 1S1XB 4H0TB 4DR2K 4A5AA 4CJ7A 2GIQA 2HBZB 2X1BA 4FJIA 2YKNB 4IRCA 4FO6A 4FNIA 4DL3A 4Y2PA 2MZTA 3WKDA 3ENHA 3C29A 1U1PA 3NMAA 1NSKL 4ANEA 3UXNA 4Y2CA 2AQ4A 3QYYA 1S0NA 1GMUA 2DHSA 2X1FA 2MQNA 1WJ9A 2EXUA 2HNDB 2GQCA 1DTTA 2OHDA 3O3LA 3EN9A 4KPCA 1UVMA 2XO7A 4ETZA 4GXKA 3R27A 5AM3A 2Q6BA 2VC0A 2F44A 4E0DA 3J7YP 2DBBA 2H3IA 4H03B 2BKPA 4CHQA 2UZAA 2RS8A 4LF5J 1T44A 1O0PA 1PVQA 1FD8A 1XMOJ 3DDHA 2B51A 2F63A 1IR1A 3JYTA 3W60A 4EENA 2V2VA 4C97A 4YFUA 4B1WB 1U1NA 1VISA 4P2SA 4URQU 3CCUN 3F53A 4FLWA 1X3NA 5DS7A 1T95A 3H59A 2C1EB 1YTUA 4L3NA 3DXKB 1JLGB 1NK7A 4B3OA 3WXIA 4FJ8A 1A9NB 2RIJA 4DTNA 3M6KA 4LVNP 3M1YA 2BANB 4KH1B 1OSDA 1BI4B 4HUGA 1N56A 1DRZA 5KG7A 5AQRA 2FY1A 2NZ4A 5SUHA 2W2PP 5HP1B 1IXKA 2ZH6A 1KRPA 2QARA 1CZ9A 2K8BB 3BH7B 1RYUA 2UVUA 8ICCA 1OWXA 4DUZJ 5H9FK 2ZWHA 3ID8A 2ZGYA 1WYGA 3WT0A 4WYWA 3MGHA 5B66U 2DNMA 2FMQA 1NLKL 2OPRA 3GFKB 5A8RB 4CH7A 3ZYYX 2ZDOA 4KHPJ 3MEKA 1WACA 4KITB 3VALA 3R8YA 2HHSA 4JKCA 2QXFA 3SSSA 2DR5A 3HT0A 1MN9A 3HVAA 1KVIA 1T11A 2CJXB 4ZDNA 1LKYB 3AAQA 4ICLB 1NDLA 3K7RA 3PW7A 3LPTA 4JK9A 4H5WA 3CNHA 2YHAA 4ID8A 4EFAC 5BJRA 1LW2A 5HOOA 3AQPA 3L2UA 2BKEA 4PL1A 4NLYA 2K7KA 4LFAJ 4GFJA 2GCFA 1RHQB 3MEEB 2F8MA 4P72A 2ZDPA 4BC7A 2B5JA 4ID1A 1PSDA 1X60A 1B0VA 3TVKA 4C23A 4I2BA 1HIYA 1TGOA 3OSPA 4ZPTR 1K8AT 4HVJA 1YQHA 3CCRS 4B9UA 1RDRA 5BYSA 3SI6A 2WC9A 4IG0B 2FY8A 5LJWA 3EEQA 3QBWA 5LSRA 1I94K 2OYQA 2UUBK 3UVJA 3W7BA 1Q9YA 2VDIA 3D67A 2ITMA 3N4MB 3N6LA 5CYQA 3ISND 4CFBA 1IKXB 4IDKA 3OL7A 4O9MA 2O67A 4NWBA 5ALRA 2LQ5A 4EAHD 4J2DA 1VJWA 9ICQA 3T5JA 5HMZA 5AQYA 2AJ0A 3K58A 4NLQA 3ZSQA 4TQSA 1ZQLA 1YSJA 1AYEA 2MJUA 4YY3J 3VQEA 2DGQA 8ICKA 3JPRA 4H5NA 3HHLA 4ECXA 4DX6A 2HHHK 3SV3A 3MWBA 7ICFA 8ICEA 5F3XB 3BYRA 3VF2A 2JFKA 1RBAA 4UOHA 3THTA 5IC6B 2P9IA 1CLQA 5F1XA 4GMJB 4RR5A 2BM0A 1WWUA 3MK6A 4LREA 3LM2A 3AJ1A 3GIIA 3K5MA 2XTJP 4KPYA 2HVDA 2M7SA 1NGEA 2W25A 2B7BB 4QZAA 2VB6A 2YWWA 2VPZB 1Y5IB 1D9AA 4CHPA 5KAFU 1K47A 3VESA 2VQFK 2DH9A 2HURA 3J7AN 4DPYA 1JX4A 5L9NA 3HTVA 1Q8KA 3ILIA 1BPXA 4DUYF 4RWXA 5IFMA 3BKUA 4DUZK 4I68A 1MN8A 4C8NA 4NM1A 3QUQA 1W2BM 1QVGM 5ALHA 1NK9A 2DISA 2XO6A 1JLFA 3O44A 2AZ1A 2RNEA 3OXLA 7ICSA 3TEGA 2RE2A 4BC3A 1FO1A 2BPFA 2J0QD 3UW1A 4FW1A 3ETMA 4ZPAA 2CGLA 3ZZ0A 5GAHU 1B43A 3KKFA 4A8KA 4DTUA 3BJYA 2R8JA 2O8BA 2DNZA 2OEKA 3UQSA 4DFMA 3H2UB 3ENBA 3HD1A 2BEFA 2RHFA 1J5EF 2FDNA 4DUYJ 3SQGA 1U1LA 4I2QA 3LZIA 3WX8A 5BXIA 3NH2A 2P9PA 2G2OA 2A40A 3MCPA 2MKKA 1JL2A 3H4DA 4NZ7A 3I82A 4RQ8A 3GFHA 3E9PA 4C4SA 4Z0UA 1PYTA 3SMPA 4C0OC 2K4IA 5B0FA 3C1YA 3DLGA 2E5LJ 2V4QA 2R7UA 1SV5B 3SQOP 1F60B 1S77D 4UOGA 4NCBA 1S49A 3HT3A 1J2MA 3VEVA 3BZKA 1SQKA 9ICMA 2G0IA 1J5EJ 3WK9A 3RAQA 5AKGA 4AHRA 1KHWA 2KI2A 3D6TB 2A41A 3CCLN 3BUZB 2HHVA 4L6V3 9ICHA 4K8ZA 1G2EA 4USJC 2BRLA 1JLFB 5AXKA 1Q95G 4USUA 4NLKA 1C0UA 4F5NA 2AZ3A 1FRJA 1ZQGA 3QIPB 2F77X 3KBBA 4JI3K 5CEHA 1BG3A 3ZSZA 1IWAA 4CFDA 1N62A 3RRHA 3BBCA 1HYVA 1NM1A 2IOFA 1N60A 2AP6A 3H8WA 5C25B 3EICA 1ZQSA 3FFKB 2YNFB 1T9WA 1MQ2A 3BKFA 2FC0A 3SAFA 2C3MA 1F6TA 3JSMA 4JK7A 2KTQA 2BBEA 4NYOA 2GVDB 4PQUA 1DBDA 3CB4A 1A7GE 4B9MA 2F3NA 2C22A 4M3RA 4BR4A 2XHWA 3POTB 4QWEA 4ID5A 3EDRB 2YCHA 1KAYA 2RQKA 4OGCA 3IR5B 2CJAA 4K4WA 3C21A 1ACMB 1RT7A 2ZUAA 5I3UB 1URNA 1ULRA 3QO9A 3BSNA 4LBHA 1MA9B 4BRMA 4F9OA 3D3BJ 1NK0A 2NLWA 3CDBA 1D9FA 3BO4A 2Y0SD 4ECUA 1FFVA 1H2UX 2LQBA 1U1KA 4M3XA 2JZBA 4Z37A 2DY1A 2LKZA 3N5BA 2PA3A 4OPAA 2JZBB 4CERA 4CF1A 4F67A 1VK8A 1WKKA 2F8HA 5AIBA 5J2IA 4YCXA 1ZTWA 4MAKA 5CJ7A 5D15A 3IP4B 3AVCA 3QE9Y 1BY9A 4PKGA 2FI1A 4PZVA 4UAUA 4WCEQ 5DZ7A 3RJFA 4Y2UA 4DF8A 5AKJA 4HHJA 2WF5A 2Z2ZA 3HSTB 4JI7F 2BRKA 3TJ9A 5BN9A 3M8ZA 3R3LA 2KKHA 2ZBPA 3SUOA 2KYXA 2ZIVA 2HRTA 2HNDA 2GQ2A 3MM7B 4JEPA 4RW7B 3HFKA 2GV1A 1F5BA 2O66A 3CE8A 4CGZA 1YBAA 5ALMA 5EE9A 3JS9A 3H3NO 4DOAA 5HO4A 4Y2QA 3HF5A 2CQ2A 1VQ6S 5ETKA 2DVIA 4Q7AA 1PILA 4RBTA 1WCLA 2VASA 3LGNA 4WFBL 2HDOA 4OPKA 5D77A 1PIEA 1C2PA 1XR5A 1BNOA 2OMLA 2UUAK 3QUCA 2GAGC 3U27A 4NLPA 4JI6K 3EGZA 2RQMA 2H51B 1TTHB 3C14B 3FC4A 2KB2A 4CJPA 4X4QA 4NYZA 3G2XA 3VQPA 2ROEA 2X7IA 1R0AB 1APSA 2G5IB 1Q5YA 3HZGA 4CHZA 3RH6A 4Q5VA 2LQJA 2OZMA 4CBXA 1UL3A 1ZJMA 3PG9A 3ET6A 2X6NA 2HBYB 1FFSB 5U47A 4DTMA 3D9BA 4WFNL 2F8EX 5C2GA 1IBLF 3F5AA 3C6HA 3KLEA 3KLFB 3QETA 1Q82T 4P2XA 1QAYA 4ZTJA 1I3AA 3QWPA 2WK4A 4A4JA 3PMLA 5AXNA 3OY9A 4JD2A 2QB0A 2G4BA 3EM1A 4UQTA 2BTFA 1PJ5A 2RD5C 2VCPA 2XS2A 3EZ5A 2JH3A 4AP9A 3V4MA 4LFBJ 2V69A 4BR2A 1MC8A 4BY9C 1ZAWA 4OCZA 5DKWA 2FJ6A 2LSNA 5KL8B 2V8VA 2OJ3A 4RQMA 5HMXA 2UVWA 2VJVA 4X64F 4E1NA 2VPWB 4CJSA 3SQ1A 5HP4A 2DO4A 4G1PA 3ZT0A 7ICUA 4DSJA 1CJVB 4QZDA 1H74A 4EFHA 2N82B 3VQSA 2LI6A 2GS8A 2VG6A 3WNHA 1S5JA 2CNNB 3CMAN 4DPUA 2YB4A 2MQQA 4XEIA 3KHGA 2VQEK 1ROFA 4K4TA 2WFAA 3R5JB 4KLDA 3Q8RB 2VC1A 2FVQA 3ID6A 1T0TV 5F2RA 3AN1A 4HI1A 4BRCA 3NVWA 1VRUB 1HW9A 4KLIA 2B6AA 4KLTA 4CECA 2ZVIA 3OJSA 2F3JA 3OHAA 1ZRNA 1B0PA 2DT9A 3HD2A 1XN9A 3BGLA 1WSRA 1HNIB 2P8IA 4FOIA 1VAZA 3E2EA 2QA4G 4QJVA 4IEEA 2NZTA 5G5GA 3CVKA 3F41A 3GCXP 2QK9A 3LP0B 2V2QA 2FIUA 5AQSA 1UCVA 1HNVA 3NUQA 3MCSA 1N54B 2IVNA 1WKJA 1RLDA 1VI7A 3Q2TC 4RUBA 1M5SA 5KT4A 4OI1A 2J0XA 2FMSA 1E3MA 1SL2A 4OJGA 5ALJA 2I8EA 4WFAL 2QL9B 3FVYA 3TUPA 3O9RA 4ECYA 3H0PA 5EXWA 3QU5A 1LW2B 4URSA 4AFFA 5AQWA 4ZP7A 4RTFD 4QZEA 2E5SA 2OSRA 2KVQE 1KLNA 1H2TZ 3P5BP 1LWXA 1RT4B 2QWRA 4Y0FA 1JJ2M 1GNKA 5J2JA 5I9EB 2XLIA 1SQEA 2Q36A 3V9SA 2WTUA 1QAXA 3T5KA 4DS4A 1WEXA 4WIQA 3UPFA 3OYDA 3GFYA 4YDXA 4CD1A 3FFIA 3M4XA 2MXYA 2E2OA 5GINA 9ICGA 1C4AA 4PG6A 1BUXA 3MGJA 2Q2RA 4P74A 3DDNA 3Q2SC 5J2CA 4ED2A 5JJBA 2E8AA 4YR2A 3I0SA 3LGHA 2PIIA 2F9TA 3RW6A 2EANA 1X31C 5FLXY 2H9ZA 2FJXA 1HHQA 3C6UA 2NPFA 2EW9A 4K4IA 1E6YA 2V8GA 2ZM6K 4LUBA 5J29A 5DDMA 3C15A 4ILGB 3D6HB 3Q8UA 3B8AX 5AKZA 4ANDA 3A13A 4TYBA 5BYQA 2BOPA 4B3SJ 4CEFA 4OYAA 2N4CA 1HI8A 4Z2XA 2PDAA 2KDOA 3HPOA 2FVRA 1WBDA 1UA0A 1IQZA 3AODA 1WHXA 5HLFA 1NNLA 4CM0A 1NBWA 3D2NA 2P66A 4A61A 2EZZA 4OKEA 1LKZA 4WKRA 2DHHA 1IKYB 1ZD2P 5BOLA 4LF4J 3J7YU 3QBXA 4XIUA 4DMNA 2FVCA 3BQ7A 3M2UA 5AM5A 4ZKAA 3ULEA 1K73T 3DAWA 3CIPA 4O44B 4NI2A 2J6UA 3MEGA 4PPXA 1IVZA 1KOOA 2H54B 5D4OA 4LF9J 4CGGA 4FVMA 2W43A 1LWEB 3C23A 3DWLA 3JXUA 1JLCA 2M3DA 1NNDA 4Q44A 5AQXA 3TARA 7ICHA 1U2CA 4FF3A 2WBNA 1JL1A 4UY8T 2Q97A 4KIAA 2KFZA 5CY4A 5KPTA 1VQNN 4HT5A 4N56A 1YT3A 3O9UA 2J0WA 1V3SA 4YMEA 1H73A 3TAFA 2YQ0A 4F02A 2H1YA 4CF9A 4DG1A 4O0IA 2OCEA 4KHPF 1LWFB 2XYGB 2Y8WA 2ABYA 4KB7A 1S1TA 1ITGA 2O01C 1R89A 3ATVA 4DQIA 2CJQA 1HPZB 1RKJA 3SUPA 1OUQA 1SWWA 3C95A 1AQ6A 5K20B 1KXPA 1S72N 2YWHA 2DNQA 4PPDA 2P9SB 2IDLA 2F96A 5KG6A 1VQON 3KTQA 1W7AA 2DHGA 3AGRA 3HP9A 5L1JA 1D8YA 4HH0A 2KZMA 3RYLA 4HTUA 3K4GA 4LFAF 3VR1A 4JYAK 5CHGA 4NI2B 1Y64A 5IT9O 4M9JA 1UAXA 3VCBA 4DV7F 1VSEA 2QX0A 3BBBA 2A1JA 3GZFA 1UVNA 3JPPA 2BQ3A 3EWGA 1YDLA 2G8KA 5FPEA 3VA3A 3UMBA 3LPYA 5HJYA 3THWA 2DR7A 5J0TA 3QATA 1TKXB 3KDNA 3FZFA 4CK2A 2I1QA 2AQ0A 1NK5A 4M5NA 4NX9A 1NKCA 2GJ2A 1O6XA 2ZGZA 1BOTO 4ZCMA 5TKWA 4N7TA 2M2BA 1UVLA 4PXCA 1RUSA 3Q8LA 2BKNA 2MSTA 1L3VA 3HPHA 2PYLA 2HWHA 3S8SA 2D0OA 1YGYA 5J2KA 4U7UK 4IJNA 4IFEA 3CSKA 2YVSA 3TZYA 2B4UA 4LJMA 1RTDB 4IQMA 2HFZA 3QO9B 3DOKB 2A6OA 5L46A 2MB0B 3HHNB 1CJUB 3HSZA 2Q0RA 2MHNA 3D2SA 1UTAA 2Q1NA 2JGAA 2HHPA 3EGVA 1S6OA 3EWAA 5D3GB 1Q53A 3G4SN 3L2VA 8ICGA 2JJ4D 2RHQB 2VFTA 2FBTA 3S3NA 2G09A 5GAGI 4DR5J 4DU4A 2ISOA 1JLBB 1VBZA 5BREA 3WQUA 3R8EA 2D3DA 3NVVA 3KLFA 1KN6A 3V1QA 2HHUA 3G0ZA 3MOJB 1X4CA 1NWKA 4BRFA 3FNNA 4WPAA 5I42B 1VC0A 3PACA 4DSFA 2WHOA 2D3UA 3AA3A 1R59O 3QGGA 3T7ZA 3V7LA 1LV5A 2YX1A 1A6LA 3I0RA 2QWMA 1RISA 1T9UA 4JKDA 4UB5A 3ISCA 4CM2A 1YVUA 4RKUC 3OPXA 2EK1A 3C7NA 5AICA 2K3IA 1RDWX 2KJ8A 5KFJA 4DQRA 3O1WA 3PW0A 2R2UA 5LJ3Y 4ZPVR 3RB4A 3O3HA 1VQYA 4DMZA 1VQ8S 4DF4A 3MPVA 3VPZA 3AM9A 2E7VA 4M5IA 3OD2A 3TYTA 4KBIA 1JMSA 4ILRA 1JXVA 3RMBA 3OTQA 2OSQA 5AQIA 1FIQA 3VAJA 2NYHA 3DN9A 4JI2F 1EZZB 2NXEA 4MKAA 3NAIA 3TUZC 4ISFA 2HBLA 3J80Y 3HBTA 3LDAA 3LAKA 1IBCB 3V6DB 4WQ5C 4JI0F 5KAKA 5KFNA 2CQPA 1OPIA 3QIDA 5AKXA 5J2FA 1IKVB 1KQQA 3AT1B 3W2WB 4WYBA 4ZLLA 1S7HA 4BGBA 1HBOA 3TAGA 2IHMA 1H98A 3AD8C 2WAQD 2WMMA 3RWUA 5GADU 3QGPA 3PW2A 1GLCG 1S12A 4IQXA 2G8HA 2X3DA 3O4QA 2FPKA 4A46A 5EUHA 2P9NA 2DRDA 4OLBA 1VBKA 9ICWA 2YNGA 3CMES 2F8SA 2EDUA 5KL1B 1PJ7A 4PPZA 1Z6RA 1HBNB 2O1PA 1ZQFA 2RUGA 1FRHA 4KH4A 3QEXA 4QJFB 3QRRA 3D7EO 4OVLA 1Z26A 4FJMA 3UCGA 1U2FA 5J8YC 1RG6A 4CTAA 3HX9A 5C2DA 4LR8A 3MC1A 4DTJA 5KOXA 3E9OA 2APOA 3B9JA 1Y0HA 2WB1C 1F5CA 4LF4F 1RHJB 3T3FA 4YOVA 3CETA 2R42A 4H5RA 4RG8A 4QOZB 5FPNA 2EQYA 1MNEA 5J2EA 3UD3P 3UD5A 1RT5A 4QIWF 3JPTA 1FDAA 3J7YI 1OW5A 1QQ5A 4J8FA 4US9A 3B82A 5ETPA 2DHXA 4IJAA 1P9QC 1QLNA 3KHRA 2UXCJ 3CCLS 2DB1A 5BPCA 2FJBB 4LR9A 5B0AA 4X4TA 3TX8A 1ICEB 4DV0J 2N4DA 4FDFA 5J2PB 1SJ3P 1JJ4A 3OR1A 3D2EA 4YG2A 2JVRA 1FRKA 3OYIA 3CCRN 3KJVA 4NXMF 2YPYA 3S1TA 4M42A 2XY7A 2PI4A 2FJEB 4MFCA 4X4OA 1IJJA 2E5GA 3L09A 5J0YA 3SQGB 1E6YB 2NLXA 3MDCA 3V9ZA 4BC2A 3KWIA 4KMOB 2VA2A 4JB8B 4N5SA 1NUEA 4DFKA 2MZRA 4KE5A 1ZQAA 4IO1A 1IJFB 4DZDA 1ZQHA 3DRRB 4AT1B 4I64A 4A48A 2P9LA 2UXBK 4DV0F 5CABA 3TZZA 4ZJQA 1N5YA 1RT4A 2ASLA 3ZDAA 4Y2RA 1HHSA 1PK3A 4IR9A 4YUDA 5KG4A 4BRPA 4ED1A 1ZQRA 5D4LA 4CO2A 4W5TA 5ETNA 3IAYA 3CHWA 2K4PA 2YQ3A 2BJDA 2HAIA 3L7UA 4DR4J 4DQSA 4H5VA 4ZH4A 4R5PB 3MWTA 3O2IA 4GO7X 1Q5VA 1Q81T 2VIHA 3MPUB 1ZQIA 4FWMA 2QWOA 3SBMA 1HUZA 4C0BA 2MPUA 4PZNA 2DGSA 2YWKA 3T1YF 3P6YC 4M3TA 3VAMA 2N3OA 3HOTA 4Z6CA 3ILOA 1N63A 1Q78A 4C4RA 3DLHA 4U96A 2NREA 3NVKA 1R8AA 4Z4GA 2VA8A 4GV6A 3SDEA 4LSNA 4UUWA 3C15B 2HZVA 1MWKA 4RBUA 3HHLB 4EBEA 4M3WA 3CRXA 2P9EA 3BH6B 2QL5B 4GLXA 4I2FA 4MN4C 3K5LA 5FDLB 2NRWA 3MCMA 2WZ1A 3DLKB 2KVCA 4OV1A 2GAHC 2DY9A 2VQFF 1LOTB 3C2PA 3RW7A 4JKHA 5IIKA 4KV8A 2E5LK 2V9WA 2AF6A 2IA6A 4U7BA 1JMTA 3E01A 3VEZA 3SMSA 3SPZA 4DG1B 4DTRA 4KB1A 4KFBB 5A0YB 3G9CA 1S5ZA 2FF6A 4KLJA 2GQQA 1A76A 4RNMA 1UEVA 5J1EB 4B3RK 1S72S 4C3LA 2J9DE 4LSZB 9ATCB 3MMVA 1RWWB 2OELA 2G8UA 2G9OA 3EZOA 2CQBA 1EWRA 4B1YB 1DEJA 2VA3A 4YMOA 1FERA 4QPXA 1QZ5A 4OYIA 3JQMA 1R3NA 2BGGA 4RQ1A 1TK0A 5D78A 2ZTEA 3KJQB 1N5VA 1SQFA 3SXLA 4D3GA 2W24A 4AILC 3LAMA 1ZQMA 2PFQA 2FB0A 1DHMA 5M2UA 3MTKA 2DGZA 3FEYB 3Q23A 2XLKA 2BV3A 3C28A 3H8YA 4LFCK 2L9DA 2F5GA 1REGX 4OYMA 4ZJOA 5FPDA 3PY8A 1P8GA 4B9LA 1SUQA 4FW2A 3PYEA 5A8WA 1CVJA 1J2VA 4X4UA 3BQ2A 4G6VB 1N6QB 3R2DJ 2DTUA 4NLBA 1N61A 5ALQA 3MMAA 2RN2A 1IKWA 4M5JA 4O3OA 1I5OB 2E5JA 2AX0A 1QE1A 3PYFA 2G06A 2PA8D 5J0PA 4LSLB 7ICPA 2IVFB 4X66F 4LJXA 2W9BB 4C8YA 1GTEA 3BKTA 1HJRA 5BPMA 2A19A 3BZCA 4DUZF 3H1QA 5IIJA 2KG0A 2Z1IA 3W5XA 4CD3A 3S6JA 2HFNA 4EO6A 4JI0J 1MU2A 4KSEB 3VMFB 3VV2B 8ICXA 1OYEA 1RT6B 3RB6A 3FCVA 3GP9A 4HAIA 1EKSA 5IM0B 2ATCB 4KB0A 3BQ1A 1RGVA 1F5SA 5ADZA 2DUYA 2KFNA 3BB5A 3GFXA 3M6UA 3TA2A 1S1XA 1WN7A 3ENWA 3MGVA 4X2BA 4X62J 4Q0BA 4CDGA 2DCLA 1RSCA 4KH5A 3B54A 3QEVA 3D0IE 3IM8A 3LALA 2QLJB 4RQ3A 2YH1A 4U8VA 1KAXA 4EI2A 1ZQVA 4E98A 1XNQF 4CLKA 3DRPA 4PWUA 3TJ8A 4FLZA 1QHAA 5C7PA 4TYAA 4KHYA 4LF9K 2FVPA 2NV3A 2M70A 3C7NB 3GSDA 3H25A 3VGLA 3EL2A 2UVRA 2E6LA 2DH7A 3THXA 1H1VA 2ZKTA 2CPRA 4M63C 2WOMB 4HLBA 4USMA 4W4MA 3A3OB 3G25A 3VQ8A 4E7HA 1G7CB 4MIAA 4PHTX 2WB4A 5ALKA 1WDDA 3VN5A 2HHXA 1VDHA 2XC9A 3MI7X 2C2OB 3AV9A 1EXQA 4MF8A 2Q79A 5I3PA 4DOBA 2VHGA 2PAVA 1U7LA 4EHUA 4US8A 1YITN 2K1RA 1RYSA 1BC6A 2Y9TA 4BR5A 3LZJA 3KLIB 2PC6A 1RACB 2HRYA 1L7PA 3SI8A 3UN5A 4TUQA 4H5TA 1TR0A 2JLFA 3SEIA 5AQQA 2UP1A 3B8HA 1RBUA 2XULA 4M94A 3EXYA 1GLLO 2QWLA 1K73O 3UB5A 1D8BA 4JI1K 4RX6A 5ALEA 4RL1A 1FNOA 3E8OA 1Y5LB 3DOMA 2F65A 2K8AA 3EPIA 2AP1A 2OH2A 2HFVA 1XMQJ 1NGCA 3FQKA 3O3GA 1FO4A 3OJUA 2OO4A 3G8TA 2KJVA 1ZJNA 4NYPA 1CLFA 5ALVA 3UR0A 4NZ0A 3OYNA 2E1CA 1QSSA 2VG5B 1K8KA 4CZHA 4J9PA 2BXJA 2GMHA 3CJKB 3GG1A 5ETRA 4XQ8A 4USKA 3NOCA 4Y2YA 2VKQA 4AUKA 4G1IA 7AT1B 1WC4A 2VD3A 5IT9U 1YIJN 4M0AA 1PUZA 4NOHA 3O80A 3FDSA 4AYBF 5AK6A 2XMVA 1VK3A 4ZCKA 3FSXA 3KLVA 5J8YA 3DRXA 4OJOA 4LY7A 1IBMF 1G4CA 3THPA 3U1LA 3E1YA 5F8JA 1TVAA 2PO4A 1OVQA 2M0GB 4IKAA 4NASA 1R6VA 5KOWA 5FJ4A 5HRPA 1IKVA 1GK8A 1ZQTA 4BS2A 4FVCA 4KI4A 1KOHA 4BCAA 2B0GA 4FLTA 3WUHA 2R7VA 1UW4A 1WC6A 1YBUA 1XC3A 2YMMA 4ZVGA 3AOAA 1RT1A 2CPYA 3TA0A 5K8OA 1QQMA 4K50A 2VQFJ 4Y2XA 1EWQA 2HQIA 4V19J 5KNIA 4IOXA 1NU4A 2P6SA 4JK8A 2U1AA 3HFVA 4ILMA 3CNQP 3BEGB 4RPZA 3CJ3A 2GGPA 4YOUA 3A1YG 3NGSA 2RB7A 3DLEB 4AHSA 3MN6A 2NXCA 4GIBA 1IJEB 4CIEA 2KD1A 3A0HU 3QSIA 1M1KO 2B9YA 2ASPA 4O0JA 3K1RB 4F4AA 3R9LA 1MROB 3L7OA 4Z6EA 1NOMA 1U48A 3QEIA 2XSJB 2E7XA 2HCFA 2OUGA 3ICXA 1BPEA 1M6YA 1C1CB 1NHUA 2YPZA 3ZFVA 4QU7A 3WX4A 5LSOA 2XSJA 1MLAA 3O1LA 3PV8A 2DIVA 3GSIA 4DV4F 2I1RA 2DNYA 3M2RB 1C0FA 3OA9A 3DNCA 4IOCQ 4FJXA 4RQ5A 4YOYA 1ZXOA 4OYPA 5M1KA 1M1GA 2PGCA 4DN9A 5GIPA 2BQRA 3GFZA 2D3OR 1P7DA 2OPRB 3CCZA 4UB4A 4KO0A 3Q7BA 1UFWA 2PFNA 4JI3F 5DLGA 5KFFA 2W2MP 2O8FB 2Y1IA 2C3PA 2MQPA 1TL1A 2ZJQQ 3OS1A 2W40A 4BG9A 2HG4A 5LL6Z 1F1BB 1RAOA 5JXSA 1SPBP 4LFAK 4LFBK 4I6MB 4BRLA 4MFFA 1FFUA 1RCHA 1S5LU 1B99A 1XBWA 3OL8A 4ZTFA 2NUUG 4U67Q 1CJVA 1UJ4A 3OYMA 1Y00A 4CLYA 2HNZB 1FEEA 3P38A 4DCHA 1N0UA 4CIOA 2OMOA 3O9QA 3GYNA 2EH9A 3JQJA 3KHLA 1CXUA 4TVAB 9ICOA 1ZH5A 4DV3K 1ZC6A 3OYCA 4IWVA 4KAIA 2ZKUA 1DGSA 5ALPA 1RT2B 3VAIA 3Q89A 1RAAB 4OZ1A 1NB2A 4I1TA 4IG0A 9ICAA 1T6DA 2GIFA 4F4ZA 4Q8FA 1PCAA 4FE3A 3WK5A 3R9PA 3UIQA 1FJEB 1UWBA 3TVZA 4BR7A 5ETTA 2HYIB 1ZBFA 1WBBA 2HMPA 3SAGA 2F9DA 3I55S 3ILLA 5CA5A 4MQ3A 2A1SA 3D0HE 1RTHB 1IKXA 5D8HB 4FF1A 5M2RA 3EKUA 3WKCA 3AHPA 2ZTCA 3PSIA 3O9SA 4M47A 2JMGA 1FKAF 4KLFA 2G13A 2CJYB 4M9GA 4KLGA 4O44A 1FXDA 5K8NA 5EX5A 1VLYA 3LP0A 2D4WA 2YX4A 2E3TA 1KCFA 1EAYC 2HOQA 1GXUA 7FDRA 5DBAA 4GKKF 1S1VB 2BE2B 4JI2J 3D2WA 2VBXA 3DOLA 2KHVA 4PWDB 2NUHA 1ZPWX 2WAQF 1UEUA 5GAGU 2OD6A 4F3MA 2CN1A 3WK7A 5DQIA 1LNQA 1N6QA 2OHFA 3SSQA 2MKCA 1BIUA 2RF2B 2ZQBA 2JLEA 3VGKA 2WSFC 3AFGA 4OI6A 1UPMB 4CJWA 1UVJA 3CIMA 3AQOA 1RTJA 3TO8A 1JNRB 2VFRA 3N01A 1RTJB 1AW0A 5J0QA 3MABA 3CMQA 5AK4A 1S4FA 3P5TL 4QIWC 5A0YA 4TKTA 1HR0F 2KVIA 4OQJA 1ZQKA 4YN3B 4I2PB 4ZVPB 5AQJA 1Q86O 5H9EJ 3NGZA 4DL2A 1XSLA 3V6KA 5BRDA 4QWDA 3F2DA 4U6PA 1TFWA 3L7PA 5CWRA 4IFVB 4FXWA 4JWNA 5ALUA 5C2CA 1DURA 2YNFA 4OJPA 5B0EA 4UB1A 3NCQA 2QFJA 5J2BA 1K1SA 3G6YA 3DI6B 2CADA 2DFFA 3QT6A 3H5XA 3M8QB 4PCQA 2MY7A 1IR2A 1RTIA 3KMSA 4UATA 3MEGB 1S1VA 2RVJA 2XBPA 4X4NA 3OLBA 3MAQA 1ZS6A 4WE1B 9ICNA 2R8GA 1MWZA 3V7JA 4YD2A 2QC3A 5KFEA 4KHUA 5KFSA 1WB9A 2Q43A 2UXCF 3KMQA 3AARA 4LH4A 3ZTRA 3LOUA 2C28A 2ZZTA 1FRIA 1F3FA 2DGWA 4OYBA 3DOKA 1ZPVA 4OMFG 2D9OA 3MUTP 2G1DA 7ICGA 3PTWA 4W98A 1SAZA 2XWXA 2CUYA 4JKEA 2ZD1A 3UNYA 4CJUA 1IBMJ 2E1PA 3FZ2A 3TW0A 3UE2A 3NVYA 4G1QA 5GTHU 4GO5X 4H4KA 3QAUA 4DV1K 4IQWA 2E1AA 2YKMB 2KG1A 2OPQA 1ZBIA 1YTAA 3DMJA 1OIAA 3G71N 2CQGA 1K8AO 4BUGA 4QZHA 4PGYA 1KEKA 3DXMA 1YG0A 4CLLA 2I38A 1GEHA 4ZVEA 2A10A 2YKNA 2CPEA 1QQCA 2KYZA 2ILYA 1YI2N 2A1AA 3IC1A 2WRMA 2AGQA 3KYLA 3VQ9A 1A5VA