4F2RA

Dna polymerase i large fragment complex 3
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
578
structure length
578
Chain Sequence
b'MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 202
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2rA01
4FLVA 4IQTA 3V81A 1C1CA 9ICQA 4O0IA 4FLTA 1MQ2A 3LALA 1D8YA 2OPSA 3MEEA 5KG5A 2IHNA 4Z4CA 5L1JA 2PYLA 9ICPA 4FCYA 4CJQA 3Q8LA 5KFYA 4AHCA 2JEGA 3LAKA 1X2IA 4KLMA 1RT7A 2D0CA 2RPIA 8ICZA 3O3FA 4NLKA 4RPYA 2ZQBA 1SKRA 3QZ7A 2JEFA 2BQ3A 4MFFA 4GC6A 3HPOA 5C24A 4JK1A 3Q8KA 4DTMA 3NAEA 4QCLA 3HT3A 3ZCMA 1ZQXA 2HHTA 4CJVA 5DQIA 4R8UB 4EZ9A 3LK9A 1QS4A 4CJ3A 4QW8A 4HHTA 5HRSA 8ICVA 1JLBA 4C8MA 4XUSA 5J0QA 3OYEA 2F1IA 1ZBHA 4QZCA 8ICIA 2BPCA 4O3SA 5DBAA 2UVUA 3OJUA 4ID5A 1KDHA 3PVXA 4F2RA 8ICLA 4UB5A 2ASDA 2A1JB 5IIMA 8ICXA 4CJKA 3ZSXA 3VQEA 4O5BA 1ITGA 4B8CA 3SQ1A 2Y1IA 7ICOA 1COOA 1AROP 4QZEA 5DBBA 4RNNA 3KK3A 5CR0A 4ZH4A 3RJJA 8ICSA 3MECA 3NF7A 1KFSA 2XCPA 3V1OA 3TR8A 1QTMA 2J6TA 5KFKA 2ATQA 5KT5A 4F2SA 2DFFA 3LDAA 5DGAA 4FJJA 1LWCA 3V9UA 3UPQA 1XS9D 1FKOA 4TQRA 2HB5A 1VRUA 3RRGA 3DRRA 5KG1A 4J9QA 5KFXA 3TARA 4UBBA 3L2UA 4IBNA 5KFZA 1IKVA 2BANA 2ZTEA 4K8XA 2NRWA 4IQVA 1RXWA 2P66A 1BISA 2HHQA 1VSKA 1BPBA 3OYMA 4E7IA 4KPYA 2VWJA 4OGCA 4WE1A 9ICWA 5KFTA 3AVGA 4PHDA 1N6QA 3RJEA 4G1QA 1BPXA 4DTOA 1WSGA 3HSTB 3HP9A 1JLEA 3EYZA 2BCVA 2MUTA 3D0PA 3JPTA 2NRZA 4CF0A 3C5GA 3K5MA 4Z4HA 4M42A 3G6YA 1A76A 3EZ5A 3DYAA 4E1MA 3C21A 1Y88A 1MSWD 3HK2A 4YD2A 3CM5A 1JMSA 4E3SA 4EBDA 4YR3A 3ZDAA 3PO4A 5EWGA 1RNHA 4TUSA 3GIIA 2HHXA 2OZSA 1J54A 4KN4A 4J2EA 4DFPA 3DI6A 3RJHA 1ZQJA 3UQ2A 7ICMA 3QEVA 4IR9A 2PY5A 2ISOA 2G8KA 1JXLA 3QEWA 3DOLA 1NOZA 1L3SA 1RT1A 4DSEA 4IFVA 2WOMA 4FJKA 2G8FA 3OYLA 5BOLA 3QEAZ 3ZSYA 1EX4A 4ZTFA 5C42A 1U45A 4E7LA 1RTIA 4F93B 3ZDBA 1S5JA 7ICGA 3CQ8A 4PQUA 1ZQVA 4YR2A 5KFWA 3GFKB 2HHSA 4PH5A 4RUAA 2C22A 4CK1A 3L2QA 3M9NB 2ZJAA 3OYCA 2HMIA 2XRIA 5KFIA 3S3MA 5DQHA 4I2HA 2Q0ZX 3F9KA 4CJSA 2J6SA 1IXRA 4F91B 3AO4A 4JV1A 3SV4A 3ISCA 4CF8A 1IM4A 2E6LA 1ZQGA 4J9LA 4TUQA 9ICJA 5BOMA 4IRKA 1ZQHA 3AV9A 4NYFA 1ZBUA 5HRPA 4CJUA 3DLBA 1JXEA 3ZD9A 5J2NA 4FJGA 4FJMA 3KLIA 2A1RA 4CEDA 4YMNA 2YKNA 5DG8A 3VQ5A 2G8VA 2RF2A 4M9HA 5J2DA 5DKWA 4KLLA 2HVIA 8ICGA 5KFNA 2X6SA 3C1ZA 3O4QA 1QE1A 4ED3A 3H7IA 4KITB 1JL1A 5D49A 4B9TA 3PW0A 4E7JA 4DSIA 3T5KA 3AVJA 3PMLA 4C8NA 4Y1DA 3AO2A 5IIKA 4YNQA 8ICYA 1VSFA 5L9XA 3JPNA 1Q9YA 4I2CA 4FLUA 2DY4A 1JL2A 4DU4A 1TVAA 2MUTB 2FPMA 3HVRA 3MR3A 3TAMA 1MU2A 2BCSA 4RT3A 4DL3A 3VQPA 1TK0A 2BDPA 5J1EA 4DSFA 4AHSA 1ZQUA 3NDKA 4B8AB 4OVLA 2F1HA 4PHPA 4Z4GA 1U48A 4MFCA 4AHTA 2XHBA 1T05A 4LD0A 3SUPA 5DQGA 3TAPA 9ICXA 4KHSA 4JWMA 1Z00A 4IQWA 8ICPA 4J9NA 2KZMA 1T8EA 4RPXA 3IS9A 2OYQA 1B22A 4LSNA 4FW2A 2NRTA 4F5OA 4FJ9A 1B92A 4RZRA 3A2FA 9ICUA 1S9EA 3OSPA 4OPKA 4ELUA 5HRNA 2FBVA 3DLGA 1ZETA 1U47A 2GWSA 1ZQBA 2HHWA 1LAWA 1GOBA 3VQAA 1RYSA 3V7JA 7ICJA 3EW9A 3L2WA 1VRTA 4OKJA 2W9BA 4F92B 4O3PA 9ICOA 1SUQA 4DQQA 1ZQKA 4FJHA 1WSIA 3ISBA 2QKBA 4M9JA 1X9MA 5C5JA 4J2AA 3AUOA 4N56A 4KTQA 4J9SA 3PW4A 4KTWA 4I2FA 4ECSA 5HMLA 2X78A 2QXFA 3LAMA 2X6NA 2I9GA 4FZZA 4FJ7A 2ZE2A 4FM1A 1SL1A 3RH6A 1SKSA 1Z3EB 1N5YA 5HMMA 1N56A 4RW9A 4DTXA 1CLQA 2BPFA 4F5PA 1VSHA 3K5OA 4PHAA 5J0RA 8ICAA 5KI6A 3OJSA 8ICJA 3QEIA 5L1LA 3GIMA 3ZT0A 4CF9A 3SPYA 1RBSA 1ZQLA 3T5LA 2VA2A 4HTUA 4QWDA 4YP3A 1UAXA 1T7PA 2FMQA 1D8LA 4H8KA 4CECA 5J0PA 4RQ6A 5IIIA 1S9GA 4P4PA 4JUZA 3P1GA 2IHMA 4LH5A 4O5CA 4UQGA 3NF9A 7ICRA 3Q8QB 4ECVA 2YHAA 4F5RA 4B9NA 1S1XA 1W0HA 4M3XA 1HQEA 1PZNA 5CP2A 3AO1A 2BGGA 2ZJ8A 3H08A 3OYHA 3GIKA 1FK9A 1JLQA 4W5OA 2FPLA 3PMNA 2ETJA 4P4OA 3DLKA 5KFRA 1TK5A 1Z00B 3AVBA 2C28A 2FBYA 3MDCA 4MQ3A 2IBKA 4EBCA 3OVNA 3S9HA 1VSMA 5T7BA 8ICRA 1TV6A 1RTDA 3GILA 1IKYA 1HQUA 3HL8A 4Z0UA 4KLJA 5E41A 4NLGA 5J2MA 3DMJA 2ZUBA 2KTQA 4TSXA 4C8LA 4UAYA 3PR4A 4I2EA 2XY6A 1RT5A 3LZJA 4DOBA 3AA4A 1EETA 3DRSA 1RILA 4CFAA 5FRNA 3AA5X 5CJ7A 4GVMA 5HBMA 4BDYA 3KHRA 4YXJA 3JPRA 4BE1A 3SCXA 3EPIA 5HP4A 3RB4A 1I39A 3C6TA 3AVNA 3M8QA 4CERA 1U9LA 2UVRA 3ALYA 1GOAA 1TGOA 2D0AA 4KHQA 2VG6A 5J2CA 1SL2A 2QKKA 4DSLA 4FLZA 4M9NA 4DEZA 1BI4A 4JS5A 4DLGA 2FC0A 3CFPA 3I0SA 4KTZA 1WLJA 4RUCA 1LWEA 3TFSA 2P5OA 7ICPA 4UAZA 2Z1IA 4RQ7A 5J2HA 4KLUA 3KHGA 9ICSA 3MFIA 4J9RA 3SUNA 8ICNA 4NLNA 2ISPA 3M8SA 1XI1A 1S1WA 2PFNA 5KGWA 4OJRA 3AO5A 2VG7A 3VQ8A 4QZDA 4CF2A 3OYIA 4ZHRA 2KN7A 4B9MA 3PX0A 1NJWA 4CJWA 2R8IA 3AA2A 1XC9A 4FBUA 4RG8A 4DL2A 3KHHA 3OYGA 3RMDA 4K4HA 1BHLA 1D5AA 2O4IA 1BQNA 1LAVA 4CEOA 2E6MA 7ICHA 1J5OA 4CEBA 4IQUA 3QEBZ 1BGXT 1D9DA 3DLRA 1ZQWA 2PZSA 4O5KA 1S9FA 9ICLA 4R65A 4FVMA 3RBDA 2Z1HA 4I9QA 4AHVA 5D3GA 3V9XA 4O3OA 1B43A 1U4BA 1KCFA 1Q9XA 4RU9A 3SQ0A 3P83D 3QINA 3NGIA 2E4LA 1CXUA 2M9NA 4N47A 1JXBA 3EWAA 2AJQA 4B9UA 3QO9A 4M3YA 2KFZA 3OGUA 1ZBLA 1BCMA 3AVKA 5FROA 1T03A 3SJJA 3V7LA 3M8RA 8ICTA 3NGDA 4M6WA 1BPDA 7ICTA 2P6UA 4ECWA 2RN2A 3GV8B 4CFCA 4F8RA 1XSPA 1I3AA 3KK1A 1HMVA 3SNNA 3GQCA 3RH5A 4G3IA 1TKTA 4DTRA 1YTAA 3RJFA 5J2AA 3T1AA 3Q8RB 4NCBA 4B9LA 3TFRA 2P6RA 3NCIA 3KHLA 3TANA 3RB3A 3Q8MA 3C6UA 3V9ZA 3K57A 5CZ2A 1XSLA 3NBPA 3LP3A 5KFOA 4JS4A 3TI0A 4FLYA 3JYTA 4CJLA 3MDAA 5KTQA 4I2GA 2UVWA 4OKKA 4PY5A 4RT2A 9ICHA 5J2KA 4I2BA 1BI4B 2YHBA 2FLPA 3QNOA 2VWKA 4HUEA 4QZ8A 1C1BA 3ETLA 3MGIA 3C23A 2F8SA 3ZDDA 1H38A 4Q8EA 3NGZA 4DFMA 4KLIA 1JLGA 4I7FA 3NH2A 1YTUA 2W8KA 4QWAA 1D9FA 2ITGA 4HUFA 1C7YA 5DG7A 4ECTA 4C8OA 4MF8A 4EP4A 3M9OB 4AH9A 1ZQOA 4KV8A 3I8DA 4FM2A 1UA1A 1ZQFA 1ASUA 1UT5A 2XO7A 3F73A 4J2BA 3E01A 3V9WA 4AHRA 3SUQA 4BWJA 4Y1CA 1X1PA 4FLWA 4M2YA 3RJKA 4IG3A 4UB2A 2MAXA 3V9SA 7ICNA 2KZZA 4KLGA 3LDSA 5J2IA 4M0AA 4F4WA 5HLFA 5CHGA 3TAGA 5KFJA 3QE9Y 1CZ9A 1JX4A 3K4GA 9ICBA 4O3QA 3MXMA 9ICRA 3KIOA 4QWEA 4I9LA 3RR8A 2DTUA 2DFLA 5J0SA 4J9MA 3H8SA 4FO6A 3PNCA 3KD5E 1DTQA 4JV2A 4Q43A 3Q8SB 4Z4EA 1K1SA 1UA0A 9ICEA 4DTNA 5KG3A 3MEGA 5J0TA 3SI6A 4CGGA 4QOZB 5KFDA 4KO0A 3MR6A 4CK3A 4N41A 2R8HA 1WCLA 4M6WB 1T3NA 4RW8A 4GXIA 5KFLA 5KFSA 4DTJA 1UWBA 2AGQA 5KG2A 3ZT1A 4CGJA 1LWFA 8ICFA 4FXDA 2FMSA 4ECZA 3NE6A 4YVZA 1NK7A 4DTPA 4Q8FA 4YMMA 3RBEA 3QETA 4KREA 1RBVA 4RQ3A 3C94A 3QIPA 3MFHA 3ZT3A 1K6YA 3QZ8A 4CHNA 5KG6A 5CYMA 2PFOA 5DB7A 4FK2A 4KI6A 1ZQMA 2PI4A 4KB1A 1C0UA 2BPGA 1BQMA 4JRQA 4UAWA 5KFFA 1EXNA 3OS1A 5CB1A 4OPJA 2BHNA 1JIHA 4DF8A 3T5JA 1NKCA 3UQ0A 3IRXA 3PR5B 3DLEA 4AILC 5KFBA 4W5RA 5DMRA 3UXNA 4I2IA 3C2LA 5EWEA 9ICKA 3B6PA 4EEYA 3G6VA 1S0NA 1DOQA 3ULDA 4HUGA 4RPZA 5KG0A 3V6KA 3JPSA 3PV8A 1TKZA 3OY9A 4BE2A 1S0VA 4DLEA 4NYNA 4R66A 2F96A 3T5HA 4M3RA 4DG1A 4CIEA 2YNGA 3KD1E 3V72A 2RKIA 1XU4A 4DTUA 2YV0X 4CEZA 2ALZA 3SZ2A 5HROA 4CEQA 3B6OA 3HXMA 5C25A 4YFUA 3VN5A 4ED1A 4RQ5A 9ICTA 8ICHA 4DF4A 4LZDA 4MF2A 4O0JA 1F21A 1JLFA 4KHYA 1TV9A 4I2QA 3M8PA 5KFHA 2KFNA 1CXQA 4BDPA 8ICEA 4CESA 3LPTA 4JLHA 1ZQYA 4UB4A 4YN4A 4FLXA 4R64A 4EYIB 4ED7A 1NOYA 3ZD8A 5DGBA 4ELVA 1C1AA 4YQWA 1S10A 4QZIA 7ICEA 4M3UA 5DDMA 1UOCA 4CEAA 4DOCA 2H5XA 4GC7A 3NHGA 3VQ9A 1VK0A 1QHTA 8ICMA 1Z26A 4DS4A 4F4XA 4FZYA 4NCGA 4F50A 1TK8A 2Z1GA 2B5JA 2FMPA 1RBUA 1RCHA 4J9OA 3AU2A 1QSLA 4JV0A 4CFDA 5J2QA 4W5QA 1TL3A 3K59A 3E2EA 3HJFA 1QSSA 3JPOA 3HO1A 1TVRA 2ZTCA 3AVCA 4I2JA 5TZVA 5J2JA 3PX6A 2OZMA 5KG7A 3G0ZA 2PFQA 4KHNA 3NF8A 2O4GA 3EY1A 1NJYA 2FPKA 3MGHA 1S97A 2G8UA 4FJNA 4R5PA 1TAQA 1R0AA 4GXKA 4O9MA 3JSMA 5KFEA 1A5WA 3LPUA 4IRCA 1A5VA 2G8HA 4KHWA 2FBXA 4PHEA 3VQQA 4HCCA 2IMWP 5L1KA 4Q45A 4LSLA 2JGUA 2PYJA 4FJ8A 1IO2A 3K5LA 3I0RA 2ZTDA 4MEYA 2R8KA 1S6QA 2XGPA 5KT2A 4RW7A 2YNIA 4H4MA 1BL3A 3B0YA 1KFDA 1KVCA 2IAJA 4KLDA 3QEPA 2XCAA 1JLCA 4KLTA 1QQCA 1RBTA 4DQSA 1NK9A 4DMNA 3JPQA 2DPJA 1HJRA 4JRPA 3DLHA 1KFTA 2HVHA 3DRPA 4Z6CA 4Z4IA 4B3OA 4M04A 3H40A 1RBRA 4GW6A 1CEZA 1ZQSA 4CJPA 1NKBA 2GBZA 4YG2A 1YVUA 1DGSA 3D45A 5KFGA 4QZGA 4IFYA 4M41A 2JZBA 3VQ7A 3QNNA 3OS2A 4P2HA 3BJYA 4F4KA 4DL5A 3EPGA 5HNKA 2I5JA 3WNHA 1XHXA 5IILA 4DQPA 3LWLA 2W9CA 3FFIA 1ZQZA 3CYMA 3G6XA 5CY4A 1ZJMA 1V9PA 2HNZA 1TAUA 4Z6FA 3O3HA 3QERA 2JLEA 4KLEA 5DB6A 1ASVA 5DG9A 5KFPA 2EHGA 2FBTA 2OWOA 4K4GA 5J0UA 3TAEA 9ICCA 4O5EA 4GMJB 3NF6A 1HUZA 9ICVA 1TL1A 4P4MA 3ZSWA 3HW8A 3T3FA 3KLEA 3K75D 3SI8A 1L5UA 2R8GA 3ZDEA 2W9BB 5DK5A 1S1UA 4DFJA 4ED8A 3JPPA 2IDOA 4CJRA 2KZ3A 3BQ1A 2P51A 2AGPA 1LV5A 3QLHA 3TWHA 2B4JA 5DBCA 3VQ6A 4YMOA 4F3TA 1SV5A 2P1JA 3KLFA 2I1QA 3U3GA 2BQUA 4CFBA 1RT2A 4QAGA 3GV7B 3QEXA 1ZBFA 3KTQA 1C0TA 4ICLA 4PUOA 3ASMA 2Q3SA 1L3VA 4F5QA 1RYRA 5J29A 1NK8A 3ITHA 2IOCA 3DOKA 2R8JA 1EP4A 4RNMA 3PW7A 1U04A 1IKXA 3OS0A 2ZJ5A 4Q5VA 5DLGA 1RDDA 4ECQA 4XIUA 3AVFA 1K1QA 5IIOA 1RDBA 2HHVA 1NK4A 1L3UA 5HP1A 1TKDA 4IG0A 4M45A 9ICAA 8ICWA 3L2VA 4F3OA 1MC8A 1C6VA 4J9PA 1ZBIA 3FYHA 1U49A 4O55A 4CJTA 4BWMA 3N97B 2OA8A 5KG4A 4CGHA 2ASLA 1ZJNA 2XC9A 5CZ1A 1HYZA 3RAXA 3OYFA 3TAFA 2F8TA 7ICKA 3ZT4A 4NLZA 3PW2A 1IH7A 1L3TA 4FW1A 4FK4A 5KGXA 1HUOA 4FYDA 2ASJA 4LVSA 4DFKA 4CJEA 4AHUA 2JZBB 4CGDA 1NK6A 4FJLA 4EZ6A 1HPZA 2W9CB 3HPGA 3K2PA 1NKEA 4I27A 2IC3A 4CHPA 4M47A 1O1WA 2A1SA 3SPZA 4MFAA 4DSKA 1LW2A 2ZUDA 1WAJA 3MXJA 1S76D 4PGYA 4BDZA 4NM1A 4M3ZA 5J2EA 3AVAA 2B6AA 3NH1A 3RJGA 3IAYA 4CJFA 4UB1A 1RT6A 3KLGA 4CK2A 2KQ2A 4DL6A 4HCBA 1N48A 2BE2A 7ICQA 3VQ4A 5F9LA 4KKOA 3P5JA 4QZ9A 3CG7A 1T4GA 2P5GA 3U6FA 1BIUA 4XRHA 4J9KA 4OKEA 9ICGA 4N5SA 2XY8A 3SQ2A 5SWMA 3DM2A 5KFVA 3RB0A 5FRMA 1XWLA 2AU0A 4IKFA 4B9VA 3AVLA 4CHOA 4FS2A 3SQ4A 1RT4A 3OHAA 3S3NA 5J2BA 3AVIA 3V7KA 1BCOA 2VA3A 4KLOA 2LSNA 4B08A 3U3YA 4M3TA 4CF1A 1RTJA 4PGQA 2VA8A 1ZQPA 1HNIA 4EYHB 5J2GA 2WONA 3GV5B 2KW4A 1CZBA 3MABA 4Z6DA 3L8BA 3CM6A 1KEJA 5HHIA 3LP2A 1ZQRA 9ICMA 3MR2A 2ZD1A 1A5XA 1VSLA 5KFMA 4KB0A 3LWMA 3NFAA 4KLFA 4ECUA 3VA3A 4RQ4A 3RH4A 3HPHA 4GXJA 1HRHA 3RAQA 1ZQDA 1KVBA 4CJ5A 4BXOA 5HRRA 3MR5A 2R7YA 2XGQA 3OYKA 1NJZA 5L1IA 4KLSA 5KFCA 1S0OA 5SZTA 1W9HA 2QK9A 4PWDA 4RQ2A 5DB8A 3OYBA 5KT4A 1JLAA 4XA5A 2B21A 5J0YA 4YXMA 2HW3A 1RXVA 4KMUA 2HNYA 2V4QA 3HWTA 1X9WA 4DSJA 5IIJA 4B9SA 1J9AA 3WNGA 1WSEA 4OLBA 3ISDA 2J6UA 3S3OA 3T19A 3HP6A 4DQIA 4YD1A 2W8LA 3C5FA 4CHZA 2V4RA 4DU1A 4DL7A 4FK0A 2IA6A 2GV9A 1TKXA 3SYZA 4CHQA 3V1RA 3V1QA 4X5VA 4O44A 2DFEA 3RJIA 4CJ4A 4I28A 4TUPA 4F4ZA 2AQ4A 2AGOA 2W9AA 3RTVA 4DL4A 5KT3A 4L8RB 4TQSA 4E0DA 2DFHA 3UXPA 1S1VA 4DS5A 1NK5A 4Q0BA 1TFRA 4XQ8A 4KFBA 3OSNA 1WSHA 4CEFA 1X9SA 3ORYA 3G10A 2IS3A 4RNOA 3RB6A 1KVAA 3ZSOA 4I2DA 5CYQA 4GLXA 3LP1A 3RWUA 1VSDA 7ICFA 4KAZA 1WN7A 2G8IA 3RR7A 5IINA 3V6JA 3AVHA 2F1JA 8ICCA 3MAQA 4W5NA 2W42A 1RDCA 4BGDA 1WAFA 1BPEA 3H4BA 1BVSA 4OGEA 4KRFA 1ZYQA 2RDIA 4NCAA 5D46A 3C2KA 5KT7A 3QIOA 2PFPA 2VG5A 3H4DA 4KLHA 3KKRA 4C8KA 2BCQA 1LW0A 4PGXA 3KLHA 1HJPA 4YR0A 4KN7A 5F9NA 3ISNC 3C2MA 3C1YA 4CIGA 4ECYA 1DLOA 5K14A 4FJXA 1B9FA 4TURA 4KHUA 4O3NA 3TAQA 2C2RA 4FZXC 5KRSA 1WNSA 7ICVA 2VANA 4O3RA 1J53A 2HNDA 3O3GA 4YCXA 3MBYA 2C2DA 2NRVA 1SL0A 4FBTA 2OPRA 2HHUA 3KKSA 5DDYA 4BACA 5JS2A 3ZDCA 3OHBA 4MFBA 4BXOB 8ICUA 3RMCA 3VQCA 4CGFA 4F4YA 4DTSA 5J0OA 4EBEA 1IKWA 1S6PA 4QW9A 9ICIA 9ICNA 2YNHA 1BPYA 5DB9A 3N4MB 3M9MB 1VSJA 4M3WA 4RQ8A 3MEDA 4I29A 4W5TA 3LP0A 1RPLA 1QLNA 4DU3A 4E1NA 3VQBA 8ICKA 4DO9A 3ZSVA 4CHYA 2AQ0A 1B9DA 2PI5A 1Z25A 3OYDA 2XY5A 1ZQNA 3V4IA 4ZTJA 1WCNA 1BPZA 5KT6A 1ASWA 1A77A 2BCUA 3RMAA 4M9GA 2WTFA 1HYVA 4E7KA 1ZQAA 3PW5A 4O4GA 4FJ5A 3L3UA 3VA0A 3BQ0A 4R63A 5KFUA 1EKEA 4ED2A 8ICOA 1ZQTA 3C95A 3SUOA 1S77D 3ZSRA 3HM9A 4NM2A 3HX0A 2RDJA 3TQ1A 1FXXA 2C2EA 5KFAA 1KRPA 4E89A 5I3UA 1G15A 1XSNA 4MEXA 4IRDA 3O4NA 1RT3A 2UVVA 1NJXA 4CE9A 4RQ1A 4OLAA 4K4IA 3THVA 1KSPA 1S0MA 3B0XA 4QWCA 4PA1A 4FM0A 1RDAA 4EP5A 3H8JA 5KRTA 3KJVA 4LH4A 3OYNA 1ZQCA 1GOCA 3AA3A 3BDPA 3VQDA 3FDSA 5EWFA 1C0MA 1NOMA 2LYHA 4E19A 3RMBA 8ICQA 3QESA 3MXIA 1WSFA 7ICIA 1HYSA 3CFRA 5DLFA 1KTQA 4ELTA 3H8WA 3TABA 1FKPA 3PO5A 7ICUA 4KI4A 2FLNA 4I2AA 4CGIA 2YNFA 3CFOA 2BKEA 9ICFA 1SKWA 4E7HA 2YKMA 3HVTA 1YT3A 3K5NA 2XY7A 2IGIA 2EX3A 5JS1A 1LB2B 2BQRA 3GDXA 4UB3A 3BGRA 1ZQQA 1JKHA 4M9LA 3PUFA 3AU6A 3NH0A 3NGYA 3KK2A 3AVMA 1Y97A 4H4OA 4Z6EA 4IR1A 4YFKA 3L2RA 4HYKA 2OPQA 3V6DA 4PPXA 4JWNA 5HHHA 1VSEA 1SZPA 3UIQA 4LZGA 4BE0A 5D4BA 1ZQIA 2W9MA 3IG1A 1CUKA 1QSYA 4QZFA 2Z1JA 3ZT2A 2G8WA 3V6HA 4QZBA 3K58A 2NUBA 1RZTA 1NK0A 4I2PA 3IM1A 4NXZA 4Q44A 2PXIA 4ID1A 2DPIA 5CWRA 1MQ3A 2ATLA 2D0BA 3HYFA 3BQTA 3NTUA 2X74A 4R8UA 4KLQA 4Z4FA 2JEIA 4QZAA 4FS1A 2BR0A 4UBCA 4CEEA 1RTHA 2JEJA 1XHZA 5EOZA 1WSJA 2OPPA 5BPCA 2BGWA 3PX4A 2V9WA 1Q8IA 3UXOA 3AO3A 5JUMA 7ICSA 1HNVA 2Y1JA 4RQ0A 4DQRA 4CIFA 1JN3A 5J0WA 4HVJA 4RW4A 3L3VA 1ZQEA 2FLLA 4QZHA 3OYAA 2A1JA 5CA7A 7ICLA 2D5RA 5J2PA 4F5NA 4N76A 1EXQA 5J2FA 3IHQB 5EU7A 3SV3A 2NRXA 3GIJA 4CCHA 2BCRA 1UT8A 5I42A 1KLMA 4RW6A 2ZUCA 3LANA 5J0XA 4J2DA 1S1TA 4K8ZA 3WNEA 4ECRA 3RRHA 4FJIA 1BIZA 8ICBA 1XO1A 4IDKA 1DTTA 4ED0A 3OYJA 3LZIA 3ZSZA 4DWIA 1KLNA 4LY7A 4ED6A 3BQ2A 3PY8A 5FDLA 1VSIA 2GUIA 4QWBA 5KFQA 3WNFA 4ECXA 1REVA 3Q8PB 1IG9A 3ZSQA 4DOAA 4NY8A
chains in the Genus database with same CATH superfamily
4Z2XA 3QGPA 1M1KO 4OX7A 3WIUA 3CIPA 2QLJB 1MQ2A 5ELZA 3MEEA 3FFIB 4Z4CA 4IO8A 5L1JA 1XMQK 2HNZB 9ICPA 1CQMA 3Q8LA 2W2MP 2JEGA 1X2IA 4IO1A 1WWVA 4A59A 3UDLA 3R27A 2R7XA 3O3FA 4DCHA 4XAKA 2ZQBA 2AEJA 2YPYA 4OYIA 3QAEA 2RHQB 2E29A 3QJPA 4JK1A 2G4BA 2F76X 4WFBQ 1F3FA 1VJWA 2CZ4A 3U1LA 1S5LU 3OR1A 1ZQXA 4YDUA 3ZCMA 4ZCMA 4KX5A 4CJVA 2W03A 3NRWA 4PYAA 1QS4A 4CJ3A 1VDHA 3FKBA 2HHHK 1X4FA 2DNRA 4JI6J 1RTHB 4JI7J 4C8MA 3KVGA 1N62A 1ZBHA 3QYYA 3DRYA 1WB9A 3HM8A 2MQNA 4ID5A 1RBLA 1IWAA 1OYDA 3B6BA 2FHMA 3N28A 3DKDA 3IDWA 1C0TB 4RW4B 2JLFA 2UXCF 4PUOB 3F0NA 2W4DA 2VQEK 4UB5A 4I6WA 2ASDA 4ZN3A 1X5PA 3N5FA 3H90A 3CTRA 2K7KA 2E3TA 3MM5A 3C28A 2WW4A 2GVZA 4ENOA 3MECA 3V1OA 1KLMB 1V6HA 2DFFA 2WMMA 1SJFA 4X4QA 4CH0S 1QJHA 4FJJA 1E6YA 3G71N 4BR2A 4IDKB 2GV1A 4N8OA 4ETXA 4DR2K 2VU5A 3Q8YA 2HB5A 2AP1A 3TJAA 4J9QA 3TARA 4P71A 3PHTA 3BSOA 5E3PA 4B17A 2DGWA 2JX2A 3ADAC 2V5HG 4R0EA 4IQVA 4TY8A 1RXWA 1XQSC 2GX8A 2P9UB 1P8GA 2WB1D 1BPBA 3IBFB 2GHWA 1T11A 4ZPBA 2C2OB 5F8GA 1E4FT 3R5BA 4OGCA 3L7OA 2JHEA 3BEXA 4G1QA 4WZQA 1KP6A 2QFJA 2QLXA 2CPYA 1AXQA 1JLEA 5AM4A 2FQQB 3CT9A 4X62F 3LDOA 3UCUP 4UB8U 4CF0A 3C5GA 4UY8O 5EE0A 4C0OC 3GDQA 1RT7B 3C21A 1LW2B 2PEHA 1FRXA 4OIXA 1NHKL 4YD2A 2ZNYA 3CM5A 4HHUA 2BYCA 5CHIA 1RUSA 3HX9A 5ETTA 3WIVA 5EWGA 3GZFA 5FP0A 1HNWF 2QZ8A 4KN4A 5F41A 4JI3K 2YQ3A 4J2EA 3I56N 4P6QA 1ZQJA 2CJYB 3UQ2A 7ICMA 4BUGA 5GAEU 3AD9C 1HX1A 4IR9A 3WT0A 5B7WA 2ISOA 1JXLA 3QEWA 1L3SA 1YBUA 4HWIA 1SQGA 3EX7B 4DSEA 2WOMA 1OS5A 2HHPA 1NZPA 4NWBA 4FJKA 4ISEA 3SAGA 3QMLA 1NB2A 4ZMMA 3ZSYA 4ILHA 2GQQA 2BDUA 5JRTA 1N4LA 2GA7A 4D3GA 4OLPA 2QXLA 3ZDBA 4KJIA 1YSJA 1S5JA 1HJOA 2KKVA 3VERA 2F7VA 2HFVA 1X4EA 1V4TA 4A8WA 3D2WA 4F26A 4PH5A 3L2QA 4P0QA 1JJ2R 2ZJAA 2XRIA 5C15A 3S3MA 2KG5A 5DQHA 1UHUA 3R8EA 1QCKA 1FJGJ 1T9VA 3SV4A 1VQ5S 4MYUA 3ISCA 1OYEA 1ZQGA 2WONB 2DKXA 5BOMA 1GXLA 2WSFC 2FJVA 2WRMA 1ZQHA 3Q22A 1RDRA 2KP7A 5IV3A 3KLIA 2ZD1B 4YMNA 2GQCA 2YKNA 5AQRA 4CEDA 2OO4A 3VEZA 2WC9A 2G8VA 2RF2A 4M9HA 2VV5A 3QXGA 1Q0NA 5KFNA 2X6SA 1RQLA 2LQ5A 4NXMK 2P6SA 2VQFF 3PW0A 4E7JA 3OTCA 1UW9A 1VHFA 3PMLA 4C8NA 4DV3J 3MHYA 3EGVA 8ICYA 1NNDA 1SBRA 4HACB 1N6QB 1ZRNA 1DQAA 1FRMA 1Q9YA 4B3SK 2C42A 5AKYA 2EFGA 1SV0C 1FWLA 1LEOA 1TVAA 2QB1A 4BRDA 3QUBA 2DNZA 4ES2A 1W2IA 2PSZA 4HAIA 3OL7A 4RT3A 3DYAB 1B7FA 3VQPA 4TLQA 2OKQA 3W63A 5J1EA 1ZQUA 4OJ1A 3NDKA 4F02A 3OW2M 1WWHA 2GMJA 4UOHA 3DI6B 4Z4GA 4JV5J 3QWPA 1VCTA 3MMAA 1T05A 4LD0A 2UU9K 3I32A 2FHJA 1LFWA 3D2EB 2H3QA 4Y0FA 3WU2U 2CYYA 4B6JA 4AYBF 4IFVB 4IXCA 1FHTA 2M52A 4QYZJ 3PXGa 1CJKB 4XO0A 2C3PA 1U0HB 4FW2A 3UMCA 1RU2A 1B92A 2GW8A 3I5BA 2HHHF 9ICUA 4CLPA 1WBBA 5AE3A 2H5IB 2ILYA 2E44A 2KD1A 4OPKA 4ELUA 3K0SA 3HHLB 4PQUB 4ILJA 3THWA 1Z6RA 4ZPCA 1U47A 1ZQBA 2NZTA 3X1LB 3EW9A 1VRTA 3VETA 4F92B 4O3PA 2HMIB 4J7CA 2V63A 3OUYA 1NH7A 4DQQA 4OX9F 3R97A 4TU8A 3ZNJ1 2KNJA 2HCFA 4M9JA 8RUCA 4GVBA 3OTOF 4TYAA 1NMNA 2W2NP 5AKLA 5LMUJ 3GOIA 3PW4A 1NEEA 3NWGA 4M94A 2B51A 5HMLA 2QXFA 3OT9A 2X6NA 3C0BA 4FYWB 4FM1A 3AGKA 4PXDA 1H2VZ 4CZMA 3BKUA 1N56A 4ZJQA 4AXJA 3KK7A 4RW9A 4XPCA 1CLQA 2ITMA 1QE1B 4PG6A 1RJJA 3EN9A 2ZIVB 1WF1A 3K5OA 2R7VA 8ICAA 3V4MA 3ZC4A 2KSOA 2EPIA 2V94A 3MAHA 8ICJA 4ZCIA 5L1LA 3ILLA 2QWLA 4X4TA 1PAUB 4FPAA 2KK0A 2FMQA 4E8UA 5AK5A 5IIIA 3W9IA 4DPWA 4KX3A 2OMLA 4GKJK 1HR0J 3R5JB 4OL8A 1TQLA 3BKTA 2NRHA 4LH5A 2R7WA 2D9PA 1LK7A 1S7HA 1IR2A 1M90O 4B9NA 3RW7A 7AT1B 2CH5A 1VQ4N 1K9MT 2IM0A 2AIRB 2ZXIA 5DO2A 4GFJA 2RDDA 4BC3A 1C0GA 5K8MA 5ALSA 3AO1A 1FNMA 1FX4A 3GIKA 4Q7AA 2JVRA 1JLQA 5LSLA 2FPLA 4Z7CA 2ETJA 4IOBA 3DLKA 5KFRA 2FHOB 2P8IA 4MQ3A 3MDCA 4AQYK 1ZM4A 3IS9B 1VSMA 1TV6A 3GILA 3GZ7A 4DV4J 4NLGA 1VQPS 4A2BA 2KYZA 3L4IA 2ZUBA 2M2BA 2Q79A 3S6EA 4I2EA 3ETOA 1KXPA 3DLGB 1EETA 3DRSA 1VC0A 4F3QA 5AQJA 1YJUA 2XLIA 2UXDF 4CFAA 3HZ6A 5IS2A 2YJEA 5CJ7A 5H1SV 3KHRA 4CRXA 4X64J 2YQ1A 4YXJA 1OPIA 1SUQB 3C6TA 4JKHA 3M8QA 4CERA 4NLRA 4OHVA 2HQDA 4PABA 1PYTA 2O8EB 2EK1A 2V51B 5GAEI 4NO7A 3UKRA 4AT1B 2HRYA 2CPXA 1N32K 5BYQA 2QKKA 3VENA 4DSLA 3IRWP 2AJ0A 4DR5K 3ZFVA 4M9NA 4JS5A 1G4CA 2FC0A 3QU2A 2W7OA 4WFZA 6AT1B 2Y0SF 4KTZA 4A5AA 1NHUA 2CRLA 5ALIA 1LWEA 3M2VA 2RU3A 1N5YB 1X6JA 1RBOB 2YX6A 2RB7A 2ZC4A 4BRIA 2ISPA 4FOIA 5IT0A 2VG7A 3TVZA 1RU1A 1NBWA 4P2SA 4B9MA 3OR2A 3C66A 1KC8O 5GMDA 5LJWA 4OZ2A 3N01A 3KK2B 3ALRA 1H1VA 4RLEA 1BHLA 2NS1B 1BQNA 2VFUA 1X4BA 3CP8A 1UCNA 4LF8K 2BEFA 4DPUA 1VAZA 3QEBZ 1RCXB 2ODGA 1ZM3A 3DLRA 1ZQWA 3NGRA 4EO6A 2PZSA 3QT6A 4O5KA 3S7RA 2RRDA 3IWLA 5D3GA 5ALEA 2J5AA 3VAHA 1U4BA 3X3UA 1PJ5A 1YKWA 2WF8A 3O0FA 4HVZA 2J8AA 1UZHA 4ISGA 2EAOA 5AT1B 4DV7J 4MT1A 1JXBA 1VQON 5C2GA 2AJQA 2YQ0A 3VHQA 3K5PA 2PFUA 3H42A 5FROA 3MMJA 2E9ZA 1R59O 3MMBB 2QL7B 3K9JA 1RT5B 2OTJS 1SC3B 2OPPB 4ECWA 2F4VJ 5HBMB 3F2BA 4RX6A 5ETLA 1TKTA 2IOFK 5EE1A 1FDAA 1YTAA 2QEXS 4BRPA 3T1AA 1ROFA 4JI2F 2J7KA 4Y2MA 4B9LA 1KQQA 3NCIA 1WF2A 2NXJA 3D6MB 3KHLA 5IT9O 2BBEA 3C6UA 3QGIA 4LF6K 3FMWA 1TFWA 4K2XA 1XMOJ 4FLYA 3JYTA 1MMLA 3H2VE 4CD3A 4OKKA 2XMVA 3MD1A 1EKRA 3CMAS 4HT7A 1URJA 3ETLA 3BO4A 1D0EA 4FWLA 4Y2XA 1H38A 4B3TJ 3NKYA 1CJTA 3POTB 1JLGA 4I7FA 1UL3A 3LQVA 3K17A 2W8KA 2IM2A 1D9FA 4ZJLA 1F60B 4HUFA 4ZHRB 5DG7A 1DEJA 1YJWS 4C8OA 4MF8A 1SCJB 3QWUA 2EAPA 3M9OB 2OP5A 5JVHL 1DRGA 1ZQOA 4NEYA 5K9FA 3MUTP 1ASUA 1UT5A 3F73A 2L48A 5CA5A 4FPIA 3SUQA 4BWJA 4Y1CA 4U7CA 1X1PA 5KPTA 4ZPWR 2MAXA 3V9SA 2KZZA 3EO3A 3LDSA 3QU9A 3GL1A 3WC2A 2E8MA 2YWGA 3VGTA 1NAQA 2MU2A 3VV2B 1JX4A 3K4GA 2FTRA 4KE5A 1Q46A 4FWSA 1IVZA 2YX7A 3RR8A 2DTUA 2W4CA 1NGFA 4BREA 4J9MA 4FO6A 1VQ5N 5ALTA 3FUYA 3GG1A 3Q8SB 3OR1B 1K1SA 3SDEA 4A8MP 2JR5A 2ZH3A 1I3OB 5CABA 2QG9B 3SI6A 4CGGA 2BKPA 4QOZB 5A6PA 4KO0A 3IR6B 4CK3A 3J80Y 1T3NA 2G0IA 3HI0A 2BJ1A 2KJ5A 1WKKA 2IVFB 4LF9K 1HBUA 4QIEA 4CGJA 4LRAA 4DR7J 3SCJE 1T6DA 4FXDA 1K44A 4ECZA 4YVZA 2GIRA 1FEZA 3SSSA 4L75A 1R8BA 3RBEA 1BXNA 3MXHP 4IEEA 1DHMA 1K6YA 4HL9A 2LI6A 1PVPA 2C3YA 1RBAA 2GVZB 4M5HA 3NBPB 1ZQMA 4KI6A 1N34K 4AYBD 2BPGA 1BQMA 4JRQA 3MECB 3BV8A 3TX8A 5I3QA 1C1BB 3H1VX 2HS3A 1JIHA 1RK8A 4Y2CA 1BDGA 2DGOA 5IV4A 3UQ0A 3PR5B 3UB5A 1WC5A 4W5RA 1LNQA 5AKGA 3O08A 1WHYA 8AT1B 3IP0A 3DCAA 2EG1A 1S0NA 4GV9A 3U1MA 4LBPA 4DX6A 1DOQA 4JHDA 3WXIA 1S57A 3AJ2A 3C6AA 2GMHA 4JKFA 3PV8A 3ED5A 3QT7A 3JPSA 1JWWA 4BRFA 5BRHA 2DO0A 1S0VA 4DLEA 3OPKA 5C0YA 4M3RA 3DHWC 1YJNS 3KD1E 3V72A 4KBIA 2YI1A 3L4QA 3NY0A 2CFXA 4OI1A 2ALZA 1CRXA 4LFBK 1IN0A 1PJ7A 1RB0A 4YFUA 4RQ5A 3QT5A 3PYEA 3M3ZA 4P10A 4O0JA 3NGUA 3R9LA 3BY5A 3AQOA 3TJ9A 2H9ZA 4DV5J 4ANEA 3K0JA 1WOPA 2P9LB 2KFNA 3FZKA 1VQYA 5IWAK 2DNMA 1I94F 4CESA 2UYTA 2MA1A 5LT5A 3A3OB 1S72S 4UB4A 3M8WA 4FLXA 1JRPA 4R64A 1MG7A 1P90A 1NOYA 2AEFA 3THXA 4ELVA 2YXLA 3B4DA 4YQWA 4H4KC 2G08A 1X6IA 3M6XA 1YLXA 7ICEA 3CJ7A 3M6ZA 1UOCA 5E2QA 2H5XA 3CUNA 1VBZA 2H4WB 4UW9A 3C65A 5JU5A 5ADXH 3WX8A 2JNJA 4GC7A 2Z30B 2JGAA 3NHGA 2R9LA 3VQ9A 1UEVA 3NP5A 2GHVC 2EFVA 4DS4A 1SC4B 5AKZA 4NCGA 2VBXA 4TY9A 2F9WA 3CNQP 2Z1GA 2B5JA 1N36J 2FMPA 2E20A 4J9OA 3AU2A 4JV0A 5J2QA 2DEIA 3U9ZA 2OI2A 1FWPA 3JPOA 3HO1A 3QIPB 3HF5A 2VH7A 5J2JA 2F1FA 3TR5A 2XI2A 4F72A 2IBOA 1IR1A 3SLCA 4M5DB 4DV2K 4LF6F 1S97A 1K8AT 1BNPA 2N3LA 2PBDA 1YZ6A 3QBCA 1FJEB 5T7LA 4O9MA 5KFEA 3DLEB 2X3GA 1OO0B 4M7XA 4CZKA 2G8HA 2ZG6A 8ATCB 3L6QA 2ZITA 4HCCA 2KO1A 2IMWP 3MZIA 1WKJA 1WI8A 4LSLA 3P39A 3IDHA 4NL5A 4ZJOA 2B0CA 3I0RA 2ZTDA 5ETPA 4MEYA 3JXUA 2XGPA 5KT2A 2KKHA 3MOZA 3T1YF 4WWSA 4TYBA 3FSIA 4K0KJ 2IAJA 2YNGB 3QEPA 1JLCA 2JFKA 1QQCA 4FPBA 4Y34A 3G8QA 2L3MA 2VBWA 1YZ7A 4PKDB 2DPJA 1EIYB 2HVHA 4CO0A 4ZKAA 2N3OA 4GW6A 4P74A 1CEZA 1L7NA 4ER8A 4G9ZA 1ZQSA 4IYQA 5GIOA 3IXQA 3G96A 4YG2A 4I2QB 5J1EB 1AYEA 4NMXA 3GU3A 4NLTA 1UPMB 3QNNA 2NXNA 3BJYA 2GJIA 2G06A 4F4KA 4DPXA 4DL5A 1AFJA 2EH9A 2GMLA 2ZHBA 3W7BA 2NZCA 5IILA 3LWLA 2Y9UA 4K7QA 3MMAB 1ZA1B 3G6XA 4AD6A 3BS7A 2CG8A 1FO4A 4UZCA 2JLEA 1E6VA 3T6JA 3PZPA 1HKCA 3UD3P 1NDKA 1WHXA 2E5LJ 2JWKA 9ICCA 2DNNA 1QAJA 4JI4J 1IBLF 4NLUA 4J8FA 1WC0A 4GV6A 2UUCK 2GOLA 3FM9A 2YX8A 5ALHA 5AXMA 1F44A 3MX5A 3ZSWA 4J03A 2DL0A 2YWKA 3U26A 3T3FA 4DUYJ 3K75D 4LF9F 4RNHA 1L5UA 3H7HB 3ZDEA 4LBIA 1TVRB 2E5IA 2FJBB 2ZKUA 3JPPA 4CJRA 5GVQA 1F0MA 4MK9A 2P51A 2AGPA 1LV5A 2DO4A 1A0PA 3QLHA 3DXMB 3N0VA 2XTJP 4EO8A 2XICA 3ILIA 3WQTA 3ET6A 1N34F 4CFBA 1U1OA 5AICA 4R5PB 5F8HA 3Q8UA 1L3VA 2FJ6A 4X4OA 1P9QC 3ILOA 5GADP 1EP4A 3VGLA 5DLGA 3BR8A 4ECQA 1RDBA 4AL7A 1NK4A 1TKDA 2GHPA 8ICWA 1K9MO 4RW7B 4F4AA 1RADB 3BO2A 1Q82T 2V2ZA 2CNOB 2B4PA 1U49A 4CJTA 2ZH9A 2J9DE 3O5BA 3N97B 2LKZA 3TP2A 1ZPWX 2AP6A 3EZWA 5KG4A 3T6BA 1Q86O 1Q18A 5CZ1A 5IZHA 3VQTA 4B3MJ 3PW2A 4PL7A 1IH7A 3HKZC 4FW1A 1NPRA 2AZ3A 3OV7A 1EARA 2EWHA 1VLBA 4FYDA 1QQMA 4IFYB 5A8RA 4AHUA 7FD1A 4CGDA 5IOLA 5C2FA 1NK6A 3TZXA 2I5JB 2V34A 5F0UA 1ZRMA 1HPZA 2XLKA 4LF4K 2C2ZB 5EVZA 1Y0HA 2A1SA 1N5QA 4DSKA 4K59A 3H5UA 4JI0F 3RW6A 1TV6B 3CMAN 5ALVA 3JSYA 3NH1A 4LFCK 2CQ4A 1RT6A 4JK7A 2J8SA 3H6EA 5LL6d 4CK2A 1RI7A 1YJRA 1EETB 3K1ZA 3DRSB 4A57A 3EZOA 2W7PA 7ICQA 3VQ4A 3P5TL 3HD1A 3P5JA 4FYYB 4XRHA 1U6BA 3NVMA 3C6TB 4OKEA 9ICGA 2Z2YB 2VZ9A 4R0JA 4N5SA 1T3OA 4CH7A 4ISFA 4WP8A 3SQ2A 2I2YA 5AQUA 1S22A 3RB0A 2CPEA 4IKFA 3AVLA 3RU0A 4Y2QA 4CHOA 1OSDA 4FS2A 1SV5B 3KLFB 2BMBA 2M8HA 3CWJA 3F9MA 5AI8A 4LF7J 3EGWB 1KOHA 3OHAA 2VC1A 2E7WA 5J2BA 2VA3A 2R7TA 3AJDA 2C1EB 3U3YA 3O8MA 3DOKB 2QWPA 3PSPA 2CZVC 3US5A 3TX0A 2CJQA 1RTJA 2L08A 3AQPA 1LFPA 2DGSA 1QH9A 4EX6A 4IG0B 2GJFA 3MABA 4DR3F 3A3NB 5D0GA 2B56A 4DPTA 3LP2A 4IKAA 9ICMA 3CF5Q 5CZXA 5KFMA 4K42A 4KB0A 4UT4A 3LWMA 4ECUA 4L74A 3F5EA 4CZGA 3VA3A 3NCPA 3E0FA 3DV9A 3UN5A 1HLWA 1NHVA 3HPHA 3ZTOA 3EMTA 4AP9A 4CZLA 3RAQA 2O8CB 1JK9B 1AA1B 3GYXB 4OI4A 4K4XA 2R7YA 2XGQA 3OYKA 1H6KX 2X51A 4KLSA 1XNRF 2UUBJ 1S0OA 4FYVB 2DTJA 1VQNS 2MQMA 1W9HA 4RQ2A 2JH3A 2B21A 1EQYA 4UOGA 2FVRA 2HW3A 1RXVA 4QPXA 2UV8G 1X8DA 2HNYA 2EFOA 3H0LB 3HWTA 3QJLA 1UZDA 3QJJA 4DSJA 4B9SA 1J9AA 3L95X 3S3OA 3T19A 3BZCA 1Y11A 4DQIA 2FB0A 1BE4A 4YD1A 2V4RA 2RU9A 2GV9A 3SYZA 3FEXB 4IQMA 4WF9Q 1VQMS 4IS7A 3D1OA 2CQIA 2EDUA 3PJ9A 3TA0A 3KMSA 3DRXA 3CCQS 2QWOA 1ECWA 4F4ZA 4NRTA 3TKAA 2UUCF 4TQSA 1KAYA 4L8RB 3D7EO 5IC6B 5AQSA 1TKTB 5ALUA 4M5IA 2YX4A 1SH0A 1HQ2A 2IS3A 1D09B 3OD2A 2D7SA 3RB6A 1BQXA 3G4SN 1VQ7N 4DR1K 4CO3A 4I2DA 4FZVA 3DWLA 2X7IA 3C6UB 1Z4OA 1VSDA 3FE1A 1RT4B 3RR7A 5IINA 3V6JA 3MAQA 8ICCA 3M6VA 3TADC 2F9JA 1RDCA 2OTLN 1VIOA 1BPEA 2IM3A 3FNNA 4PEOA 2UXCJ 1ZYQA 4A4JA 4WKRA 2ZBCA 5BN8A 3BGFA 3TOQA 4KMOB 5D46A 1FNXH 2VG5A 5DS7A 1JLGB 3AJ1A 4NI2A 3KKRA 4YOEA 3FJ2A 3FCWA 4C8KA 3KJFB 1G3OA 4PGXA 2QLFB 1KVKA 4YR0A 3FR0A 3TYTA 3JXOA 1DLOA 1MW7A 1S4FA 1FI4A 4FJXA 2DGUA 4WXOA 4JKDA 4OLOA 5KRSA 3UO0A 2X1FA 2ZIUA 1X40A 2BV3A 3MBYA 3CCRS 5AIAA 2PT0A 1LQ9A 4ITSA 4ZVEA 5DDYA 3ZDCA 3RMCA 2RIJA 2AWZA 4DTSA 4WQ4A 4RUBA 3JTPA 2WCXA 1WEYA 1IKWA 4U8VA 4PWDB 1N61A 1KDNA 2ZH6A 4M5NA 3MEDA 1WC6A 4M8LA 1RABB 3CCMN 4DO9A 1CBKA 3N79A 5ALPA 1F5AA 2PI5A 2LYAA 3R2DJ 3DDHA 5E7OB 2ADCA 3OL6A 2COLA 1FTRA 2PMWA 2KEYA 1WG1A 1BPZA 5DRKA 2HBMA 5KT6A 2J9CA 1YHQS 4ZVSB 1ASWA 3THTA 2H65B 4ZVQB 1Y4ZB 3R5DA 2FY1A 2HWIA 4XPEA 2Y8YA 4OJ6A 1HYVA 4E7KA 3VA0A 5KFUA 2KYXA 1NMEB 1HBUB 1ZQTA 3C95A 2ZIWB 1S1VB 2EAMA 4Q0BB 4DV0K 2WB1C 4WP3A 1R8HA 3LTOA 2BABA 2V8HA 5AK3A 1XSNA 2FJDB 4PZOA 3QSYB 2A10A 1NM2A 4HH0A 5TKWA 1J5EK 4PQAA 5DDRC 3SBMA 3MMVA 4RQ1A 2AH5A 3FAHA 3A5NC 3L7PA 3DLJA 1RDAA 1G6BA 2EK6A 1QDUB 4Y2JA 3PKYA 4YY3J 1XEZA 4LH4A 1ZQCA 2K4PA 3CSKA 3BDPA 1VDVA 3S6JA 2EC0A 1HPMA 1M5HA 5C12A 1LW0B 2XSFA 5ADZA 1HNXF 4NLDA 4JHDB 4W92B 1C0MA 1NOMA 4IO9Q 5K14B 4E19A 3RMBA 3MXIA 1X4GA 4YDUC 1WSFA 1WACA 1KTQA 1HWKA 4ZS6A 4ELTA 3H8WA 2HNDB 3M32A 7ICUA 4KI4A 5IM0A 2YNFA 2OPRB 2MKYA 2K1RA 3IO1A 5BR9A 5AXLA 2W11A 2EX3A 5JS1A 1ZXOA 1LB2B 2BQRA 2D69A 4A2AA 2LLZA 3GDXA 2VQFJ 2HMXA 4RCHA 1T94A 2EZYA 4NZ6A 4H4OA 4Y0WA 4RQMA 4Z6EA 1XIQA 5HMWA 1YUWA 3A5MC 4HYKA 4YMEA 1HA1A 4PPXA 3KHYA 2CPJA 4LZGA 3THXB 4K4YA 3H98A 1HI0P 4RWTA 1ZQIA 3OL8A 1YJ7A 4KB7A 2W9MA 1QSYA 4ZP6A 2A5XA 4BG8A 1XMQJ 4CI6A 3V5RA 3D4JA 4FZMA 2NUBA 2LEAA 4Y28C 5KL8B 3SSRA 3IM1A 4NXZA 2DPIA 5AQWA 1K8AO 4FF2A 3MM7B 4NCGB 3HYFA 2AJ1A 3NNCA 1WDTA 5AQKA 3BQTA 3PYDA 2IVPA 3NOGA 3NTUA 2VYPA 5LY3A 3CCJS 4LMZA 4PAAA 4C3LA 4FVCA 1MN7A 5I3UB 4FS1A 4QZAA 2BR0A 3SMPA 2R2RA 1OY8A 2XS7A 5KAKA 2ZUGA 2LBOA 5EOZA 3R9PA 1HIYA 4P2FA 2BGWA 4OYXA 3OTEA 2HHHJ 3D6HB 3UXOA 3AO3A 3M1FA 7ICSA 1HNVA 4RQ0A 3W8GA 2F7TA 1JN3A 4USWA 4NLPA 2MJUA 2LECA 4QU6A 3B8HA 4QZHA 3OYAA 3M6WA 2O1PA 2AYBA 5J2PA 1U26A 4N76A 5AQYA 1FA0A 2VQEJ 2JL9A 4X65F 4KGXB 5I42A 1TL4A 1WDDA 3QUQA 1HYSB 5J0XA 1S1TA 4K8ZA 3WNEA 2IIHA 4RBVA 4ECRA 2IRYA 2MLXA 1Q4RA 5ALMA 3W3DA 2H3IA 4DWIA 1Q95G 3IG8A 2A40A 3M2RA 1YRTA 2KT5A 2WVEA 1VJQA 3BQ2A 3A0HU 4DR2J 3KG0A 2FYXA 1KHVA 4CZHA 2N82B 2OEJA 1FRIA 1REVA 4PKHA 4DV1K 1LKZA 3DC2A 4MKVA 3C8YA 2OEMA 3ZSQA 4NY8A 5ALYA 1TYQB 3WC0A 3GG0A 4K5RA 4F0HA 4MLEA 4CLUA 4OI2A 4FLTA 4O0IA 3CJTA 3LALA 5KNIA 1N0VC 2GELA 2CRXA 3V6DB 2PYLA 4LRBA 3CJ9A 4FCYA 1GTEA 5KFYA 4AHCA 3LAKA 4KLMA 1HWIA 1E6VB 3C15A 2D0CA 1SPBP 2LXIA 2FSJA 3EDRB 2HLUA 2HLTA 4NLKA 1ITPA 1IBCB 3IBCB 4MFFA 1KN6A 4MMOA 5C24A 4TXSA 3Q8KA 2ZH2A 4DTMA 3DFEA 2U2FA 1EZZB 1QQOA 4QCLA 2VBZA 2HHTA 1R6VA 4JI3J 2XS2A 3LK9A 9RUBA 5G5HA 3F41A 1JLBA 4XUSA 2HGLA 1OH7A 1PK1A 2GAGC 4QZCA 2HZCA 4F0KA 3I55S 5DBAA 3R5GA 2O66A 4BC9A 1Q82O 3LDLA 1J5EF 4F2RA 3THYA 1TL7A 5IIMA 4B3RF 2CQGA 4O5BA 3AAPA 1HEKA 4ACOA 3LGMA 2M9KA 1HBMA 3QBXA 2DGTA 4QZEA 5DBBA 5DZ6A 1Y00A 1ZS6A 5LOQA 3AAWB 1GMWD 2C2KB 3NF7A 3TR8A 1QTMA 2DR7A 1SB3C 3L3FX 3QGHA 3LDAA 5DGAA 4JI8K 3V9UA 2KOBA 3UPQA 5LL6Z 1RLCL 1UVNA 2HGMA 2A0FB 1VRUA 3RRGA 3DRRA 3A13A 2UP1A 3QAUA 5DDQC 4EELA 5EXWA 3L2UA 3N4PA 3CCQN 3BBFA 4X84A 1IKVA 1BMQB 2BANA 4K8XA 2P66A 4V19J 2M0NA 4MLHA 1VSKA 3OYMA 4I67A 4E7IA 4KPYA 5HSPA 3CULA 9ICWA 4NXMJ 2HQ3A 3V81B 3RJEA 1C1CB 4KAIA 2FGCA 1H72C 3HSTB 3P38A 3HP9A 4X66F 2OPSB 5EE9A 4KT0C 2V2QA 2QGFB 4PCQA 3BYPA 3NGKA 2WUSA 2MUTA 3D0PA 2V2VA 2NRZA 2QX0A 2YN4A 3K5MA 4DJBA 1A76A 4B3SJ 3MCSA 3RVCA 1O51A 3K8VA 4EBDA 4YR3A 2AKWB 3ZDAA 2G0AA 3ENAA 2RS8A 2WF9A 5M1PA 1J54A 3J81O 5AXNA 3RJHA 2FF6A 4GKKK 3RF9A 1X31C 3G6ES 5AJ3F 2EG2A 2B8PA 2NREA 3QQCD 5AQNA 5HQMA 1EO1A 2VPZB 2DGQA 3R5CA 2QB0A 2DHAA 2RNEA 1IBKK 2ERRA 2E1YA 2H4YB 2UU9J 3QEAZ 3HULA 1U1MA 1ZAVA 3SCIE 1NGIA 1X4CA 4TNOA 2XHCA 3KNAA 4HDGA 1RTIA 4YB6A 5JVGQ 3CCRN 2O8DA 4E1JA 7ICGA 4OX6A 5D4LA 1ZQVA 4YR2A 4F36A 2A6AA 1EQ0A 3ZETB 3WK4A 1CJUA 2P35A 2LQ8A 3HHKA 2X3DA 4CK1A 5M1QA 2M88A 3D0GE 1FVSA 1ESVA 3CIZA 2LQJA 1IXRA 3I28A 4I69A 4F91B 1AZSB 3TUPA 4WYWA 2D3O1 2LPEA 2E6LA 5EHHA 1YDLA 3P6YC 2K89A 4IRKA 5GAGP 2OHFA 4C4WA 3AV9A 2DY1A 4NYFA 3VESA 2Z56B 1LWCB 2WBNA 4OYPA 4CJUA 5HRPA 1JXEA 2VB6A 4FJGA 5F8LA 5AQGA 4IOAQ 1FKOB 5E3QA 1N8RT 5DG8A 3VQ5A 1G99A 3A12A 3MGVA 1Q8BA 3O4QA 4NE9C 4YOUA 3F5TA 2D3ZA 3H7IA 1JL1A 1VGYA 4B9TA 2B8QA 2GJ2A 1RHQB 1T02A 1N52B 4DSIA 3M05A 4WPAA 4USJC 2G5HB 4EFAC 3S8SA 3AO2A 5IIKA 4YNQA 1HNZK 4LREA 4WE1B 1RGIA 3ZI4A 5L9XA 1T9XA 2W01A 3MUVP 4I6MA 3TTCA 4I2CA 4UF4A 1VFJA 4DU4A 2OMOA 1S6OA 3HVRA 1MROB 3TAMA 1MU2A 2K8GA 1VQ6S 2HKEA 1O5JA 4CLFA 1EWQA 2PGCA 3M4XA 5AZJB 1TK0A 3ZZPA 4GKJJ 4EEKA 2RHFA 3R1XA 1FX2A 4USUA 3A0BU 1X9XA 2KKZA 5BPLA 4BHQA 4EHUA 1U48A 1W97L 4AHTA 4YOTA 5GAHU 2GWJA 4TVAB 3W2WA 1WOOA 3DOLB 9ICXA 3ENBA 1RT1B 4A8FA 1IBMK 2LP4A 2OYYA 2DNKA 4JWMA 2RILA 4ED5A 1T8EA 4LSZB 2BM1A 3BP8A 1B22A 5AQFA 2A3ZA 2NRTA 2JC1A 5C42B 3FBCA 1CC8A 4RZRA 3W3SA 2RQMA 4OI3A 2XMUA 1S9EA 1UETA 4PXBA 2FC9A 5HRNA 2FBVA 1KKXA 1HL6A 2OUGA 2HBYB 4PRFA 4JNEA 3OFEA 3PIPQ 3CCVN 1GOBA 3MCOA 2P6TA 2QA4S 3RBXA 1BG3A 5HAOA 4PL8A 3FLCO 1ZQKA 1M5VC 4K5SA 3GWCA 4JYAF 4EFHA 4YB5A 3J7AP 3RG6A 4KTQA 4PYDA 3ENHA 4KTWA 4I2FA 1YK9A 5LSOA 4QIVA 5J2NB 2I9GA 4DCCA 3AM9A 4LVOP 1SL1A 4DU8A 1N32J 2ZIUB 1QM9A 4DR5J 1HW8A 1VSHA 1V38A 4KH4A 1X0FA 1HI1A 3OJSA 5B09A 1SAZA 4QR1A 2JV3A 3LVVA 3MPVA 3L7UA 4BC7A 3C7NA 4CF9A 4EMDA 1RBSA 4YP3A 1M6YA 5HL7Q 3RSEA 2ZIXB 2RUSA 1VQ8S 2HAFA 5J0PA 1U8SA 1Y5LB 3AH6A 3GE9A 3HHEA 4DV5K 2QW9A 1IWGA 3BS5A 2HS4A 4AYBC 3GYGA 5ALOA 4X4SA 7ICRA 4IQXA 3Q8QB 4ECVA 2YHAA 2Q31A 3FSXA 4G1PA 5JMVA 2P9SA 1S1XA 2UUAF 2D3OR 4OJPA 2PFDA 2IDEA 2HRTA 2HEKA 3HSDA 1Q78A 4LF8J 1A9NB 2HF3A 5HL7L 2OSRA 5F0WA 2QARB 1PZNA 3M6KA 5CP2A 1MA7A 1U6ZA 3WKAA 3GG4A 2ZJ8A 5BYRA 3EE9A 1UKUA 3TUZC 5AK4A 1TK5A 2G9OA 4XK8C 3CPWM 4WFAQ 1Z00B 3AVBA 3HKZF 2C28A 3VOVA 8ICRA 1RTDA 2F8LA 4Z0UA 3HL8A 3EUB2 5J2MA 1RYUA 3J81Y 3DMJA 1IBKF 4ZLJA 1BA0A 4PKIA 3B8AX 3LZJA 4JD2B 3SFGA 5DZ7A 3LF0A 1KS2A 3EICA 4DMZA 2BACA 2HPUA 4A8KA 4BDYA 2KXFA 3JPRA 3C2PA 3BYRA 3SCXA 3PSTA 3EPIA 3PIOQ 3RB4A 1I39A 1U9LA 5ALGA 2F4FA 2JWNA 3VCDA 3VALA 4KHQA 2J7WA 2HSTA 4Y2YA 2KT2A 3THPA 3LDPA 3GCXP 4UOCA 2VG6A 3AT1B 1BHNA 1HW9A 4FLZA 4M5LA 4DEZA 4LF6J 4NXNK 4DLGA 2ZJPL 3DGPA 3I0SA 1WUDA 1S3XA 1WLJA 1PJ6A 4YOWA 1QAIA 1DARA 1VQKS 2P5OA 4RQ7A 3M32B 5J2HA 1DRZA 5E84A 3KHGA 3SUNA 4J9RA 8ICNA 1A6LA 1XI1A 5GMEA 2K1RB 3OTBA 3N7SC 2PFNA 5DM7Q 2VKRA 2E5JA 2R2SA 2KN7A 2YJFA 2RS2A 2LM4A 1NJWA 3NASA 1RSCA 4DI6A 2O8FA 4CRJA 2P9NB 2AW0A 4CZEA 3O9QA 1QY7A 3TUJC 4RG8A 3KOOA 2IDLA 1JALA 1S9GB 2HVDA 1M5SA 1LAVA 1NDLA 3WKDA 2QL5B 3OBYA 2E6MA 7ICHA 3OXGA 3I55N 4QYRA 3RGIA 2KL8A 1CS4A 2DNLA 1NGGA 3IGNA 4KYZA 1UPPA 4M1KA 2Z1HA 4AHVA 1HQEB 2ASMA 4O3OA 2AYEA 1Q79A 1B43A 2O8BA 4U67Q 1KCFA 1FK9B 3FEZA 1Q9XA 1ATSA 5BR8K 3P83D 4JI4K 3VTHA 2EW9A 3NGIA 3UCGA 3PEHA 3O80A 1X4AA 4QBUA 4F9OA 2XWXA 2M9NA 1IKYB 1HQUB 3EWAA 2XNRA 4B9UA 5MAOA 3P4IA 2ZKTA 3QO9A 5DM6L 1ZBLA 3OGUA 2ZBRA 4C7QA 1T03A 4P52A 8ICTA 5AFUH 2YWWA 1YRUA 3ZEUB 2FIUA 1HNVB 1SS6A 3KK1A 4GY2B 3QMQA 4DTRA 4XH4A 2KG1A 3D2FB 4PWWA 3UD4P 3Q8RB 4NCBA 2CQ1A 2XMJA 4LF9J 4JKCA 2FDRA 3TANA 3RB3A 3P31A 5GAHI 4QIFA 3K57A 3M8ZA 5M1FA 2XSJB 5F8IA 2CJXB 3JS9A 3LYSA 4CJLA 3MDAA 5KTQA 4OYMA 2KVIA 3T1HF 1KQSR 1C20A 1BI4B 2IOFA 5AHXA 3QNOA 4YHHK 3BGLA 4HUEA 2BUPA 2V4JA 3ZZOA 1N34J 2HIQA 3C23A 1X4HA 4DPOA 2F8SA 3ZDDA 4ZVGA 2YHXA 2LXUA 1B0TA 5FPEA 4KLIA 1ZM9A 3ZX3A 3LOUA 4USIA 1YTUA 2I7NA 1QHAA 4P9SA 1EB0A 4U8YA 3P45B 3PACA 1KEKA 1REVB 2E7VA 5F8NA 2D41A 1RDUA 2LCWA 2M4MA 4KV8A 5ETNA 4YUDA 3LM2A 3FBFA 3I8DA 1UA1A 1ZQFA 2HBLA 5LMNK 3ZTPA 2XO7A 5BN9A 4J2BA 3E01A 2XHWA 4DX7A 2DHSA 4C48A 1ZA2B 7ICNA 4DL0C 4KLGA 3CCTA 2ZH4A 5J2IA 1HHSA 2V69A 4M5JA 5CHGA 4CLLA 3CJKA 2E1EA 3CDWA 4ANDA 1OVQA 3UM9A 4QWEA 2ZM6K 2HWTA 5J0SA 3J7ZT 2P9IB 3KD5E 1DTQA 1FWKA 3AGRA 2NV3A 4Z4EA 2KFYA 4GV3A 3A1YG 2R2TA 1JMTA 2LEBA 2QMWA 5IWAJ 4DTNA 3MEGA 4CZJA 1G1XA 3DXBA 2ZH1A 4LFAK 4EIAA 4B02A 4H5RA 3DLLL 2R8HA 4M6WB 5AQOA 1BD6A 3JAMO 4RW8A 2MLYA 1QVFM 3K89A 3EGNA 4GXIA 5KFLA 3MK6A 3RFAA 1BA1A 1HMVB 2X1AA 2AGQA 3WK7A 1FESA 3RBZA 4OD0A 2FGOA 4LF5K 3NE6A 4ZLPA 4DTPA 4Q8FA 1TL7B 2WSEC 4NB4A 4RQ3A 3MFHA 1N5TA 3HCXA 3ZT3A 5CYMA 2CNLB 1DGJA 2KH9A 5DB7A 2F77X 5L9NA 4MIWA 4KGVB 2POKA 1U1QA 2PI4A 3L09A 5BPMA 1VQ6N 3WKCA 5IQ6A 5KFFA 2ROEA 4K50A 4A8QA 3OS1A 2Y1RI 3P5BP 5CQGA 1B0VA 4OPJA 2BHNA 2WB1F 1GLFO 3EDQB 4WFNL 1WOQA 4DV2J 1NKCA 4DR4K 5KFBA 2RRAA 5DMRA 3C2LA 5ALRA 1VRUB 3U8XA 4EEYA 1N5WA 1RWOB 3UCZP 1UVJA 3DDIA 2IVMA 4OZLA 3ULDA 5AQLA 4OZ0A 1W2BR 4RPZA 3OY9A 1HHTP 2WBRA 2P9KB 4BE2A 4KHPK 4CBWA 1XMBA 2WAQF 1VC6A 1X3MA 1ACMB 2G2ZA 2W2QP 3IG5A 2DNOA 2QM1A 1BOTO 2RKIA 3MC1A 4U95A 3BZQA 1WNEA 1EKSA 3HXMA 4EENA 4PPDA 5C25A 1L7PA 1TELA 3GCWP 1NJIO 5CD4H 4AL6A 2YH0A 5HLFB 1M0SA 5G0RB 4MF2A 2QA4N 3MTJA 4KHYA 2E1ZA 2VPWB 3EVMA 3PJWA 4ILGB 3ZZRA 1YJVA 1XNRJ 3ZYYX 4FZLA 1WOSA 3LGNA 2LXFA 8ICEA 4H54A 1IG8A 1ZQYA 1R27B 4V1Ak 3IKMA 2MLZA 5U47A 3OFGA 2QB0B 3R6MA 3AB4B 1APSA 2DYAA 2XVTA 1S10A 4L3QA 4M3UA 3MI7X 4JI5F 4CEAA 4DOCA 2IIRA 3NCRA 1CI4A 4OJOA 1NCLA 1HBNB 1H2TZ 1QVGM 5FPDA 4JKBA 1VK0A 2AEMA 1H73A 4F4XA 1UWBB 3A8YA 2BE9B 3G82B 4ES1A 2WBMA 2UUCJ 1TL3A 1Z4NA 3E2EA 3VGMA 4BC4A 4K8RA 2HFUA 3R1HA 3QIDA 3I8BA 5KG7A 3G0ZA 1WWUA 1D8BA 4KHNA 3NF8A 1IQTA 3BKFA 4ZLLA 2UXCK 4JI1F 3MGHA 3HKZD 2MKCA 4JK8A 2Y8WA 1LWXA 1KD1O 5EX0A 3MN6A 4LRFA 4I6YA 1A5WA 1Q8KA 3LPUA 4IRCA 2CQBA 1A5VA 2CPZA 4PHEA 3VQQA 4KHMA 1RA7A 5L1KA 5B0EA 3CVKA 3W64A 1NLKL 2OELA 2PYJA 1IO2A 1F6TA 4MK7A 3OLAA 3MURP 2GO9A 3HFVA 3K5LA 1IIPA 2DRBA 1S6QA 2YNIA 4H4MA 1ELOA 1BL3A 3B0YA 1KFDA 4U96A 2V68A 4DG1B 2ZHAA 3J7YP 4KLDA 4Y2KA 2PIIA 4C80A 4NMLA 3MPUB 2FLOA 1YIJS 3NAHA 4C0BA 4DQSA 1NK9A 1VS3A 1K0VA 3ENVA 3T79A 4DMNA 1HJRA 3DRPA 4Z6CA 5T14A 2MTLA 3H40A 3WXKA 3BBBA 1NKBA 5MLCQ 2FVPA 2GBZA 1NO8A 2EFPA 1Z4UA 1XR7A 3M8PB 4QZGA 4M41A 2P9CA 1Y3KA 2JZBA 3FZFA 2K2PA 4P2HA 4X62K 1U2RA 5HNKA 3WNHA 2J0WA 4DQPA 4DUZF 3HRGA 2LVWA 2HBZB 4WBFA 3EVOA 3NS5A 4ILLA 1V9PA 2B4VA 3WEEA 4Z6FA 2GAHC 2QLBB 5B0AA 3FMBA 2HZVA 5GIPA 3QERA 4KLEA 5DG9A 3ENQA 2QSWA 1Q16B 4LF4J 2EHGA 1XNQF 1HNWK 4JI6F 1DQ8A 2ZUAA 2FBTA 4JI7F 2OEHA 2YY3A 1VQKN 2R18A 2MQ8A 2BJDA 4GMJB 3UNGC 5M2PA 2YHYA 9ICVA 1RWWB 1TL1A 4DBQA 4LFCJ 1AW0A 2MHEA 4NLOA 1KR4A 3W2VA 2JMGA 3CXCR 1EWRA 1LCUA 5BYSA 3LA0A 4ED8A 1SQEA 1MNEA 3J7Z5 2KZ3A 5CXTA 2JFDA 2W04A 2BXJA 2F3JA 2B4JA 3LGHA 5DBCA 3BSAA 2P1JA 2XMWA 3U3GA 3GSIA 1EHWA 2CQ3A 3VGUA 1R43A 1R0AB 3ASMA 1ZOTA 2DXFA 3GFZA 1X4DA 3ITHA 1GX6A 3Q86A 3D6TB 3VMFB 3PW7A 1W7WA 3OS0A 1GFWB 2ZJ5A 3IP4B 1RDDA 3BF1A 2Y9HA 5IIOA 2JOQA 4C4RA 3KFWX 3C3LA 2PC6A 1RQ0A 5HP1A 3NVVA 4I4BA 1SGGA 3L2VA 1C6VA 3ZNUA 1V85A 1U25A 4Y2SA 2Q43A 3DU6A 4O55A 2Q6BA 2AYGA 3M1YA 3H25A 2ASLA 2XC9A 3RAXA 4BBYA 4B3OB 3OYFA 2F8TA 2HVEA 7ICKA 4Y65A 3ZT4A 1NDCA 2QMUB 2PE8A 5AKXA 2RE2A 2GVDA 3ULEB 5G4DA 2MKSA 5ALFA 2PD1A 3VGKA 2ASJA 2ZVIA 4CDGA 1ZH5A 3I87A 4WCEL 1NH8A 3VPZA 2VJ4A 3BGUA 4FJLA 5A8WB 4EZ6A 2EKNA 2CQ2A 2W9CB 2IJRA 3HPGA 3H3NO 2IC3A 4I27A 5ALKA 1O1WA 2YTCA 1LXNA 1WORA 4BR7A 4MFAA 1MN8A 3FCVA 4YORA 5HJXA 2WF5A 1SH2A 3FK4A 4NM1A 4BDZA 1RTDB 1YXQA 5AKKA 3AVAA 2B6AA 3IAYA 2GIFA 2IA0A 3QUCA 2DT9A 1FEHA 3WXMB 3KLGA 4DL6A 4BVOA 3P49B 4HCBA 1N48A 2VASA 3KLEB 1YJ9S 3ICLA 1IV8A 4PG8A 2Q3PA 3CG7A 4K4WA 3DNCA 2EFQA 4I1TA 3KFUF 2R7SA 1S1UB 2ZHOA 3QPIA 4WQ4C 3CDEA 1S99A 4OI0A 2P9GA 3SAFA 1B7YB 3QU5A 1SC1B 3DM2A 5HN0A 1DXSA 2AMCB 1PUZA 2ES6A 2O01C 3A8IA 3ZTQA 2MDAA 2LFVA 3SQ4A 1FW6A 4WFBL 4DR1J 1RT2B 4ICLB 1M5OC 4OX9K 3AVIA 3B54A 3HHNB 2OFGX 1FJCA 1CZAN 3AXMA 3OTOK 2IVOA 3MCNA 1IKXB 3VEOA 4M3TA 1Y10A 3CQYA 4PGQA 2VA8A 1HNIA 3ATUA 4CF3A 2V7ZA 5J2GA 3LW5C 4OHYA 2KW4A 4DV3F 4CI0B 3CCZA 1F2GA 1PGZA 2R42A 1VQ9S 4NOHA 3CM6A 5AQTA 1T0TV 2HQCA 1KEJA 3ZXWA 3IFRA 1ZQRA 2E5HA 5HMYA 3MM6B 1U1KA 3LVWA 4CNYA 3NS1A 2ALYB 2FZGB 4KLFA 2IVYA 1WBDA 1CJVA 4UAUA 3A8EA 3OFHA 4K4UA 4GXJA 4IEIA 1ZQDA 1KVBA 3GP9A 4CJ5A 4BXOA 2YMLA 1NJZA 5L1IA 2WTUA 5KFCA 3R8YA 2ZZNA 2QK9A 2FJWA 2RHKA 3OYBA 2IM1A 1HLUA 4XA5A 4CDIA 4UTGA 1K8KB 5J0YA 2BA9A 3HOSA 1X9JA 5CEHA 2V4QA 3OXLA 3GPAA 2E2OA 4PZNA 2Z2LA 1X9WA 3DXSX 4OCZA 1GLJO 5IIJA 4XH5A 2WAQD 1WSEA 5A0YA 1ZD3A 1WG4A 4Y6IA 2IJNA 4NEZA 3W61A 1V3SA 4CD1A 4DL7A 3NNAA 4FK0A 2QLTA 1TKXA 3TUIC 4DZDA 3V1QA 1UTAA 1L3KA 4WK1A 2H1YA 3RJIA 2K8BB 2H3FA 4F3MA 5ETKA 3C16A 2PA3A 4CW7B 2DFHA 3HBTA 4KKOB 5J1NA 2ROPA 1X9SA 3ORYA 3G10A 1ZD5A 1WC1A 2AJFE 3PEJA 2DISA 2HK2A 1UPHA 3LP1A 5JMNA 3RWUA 2UXDK 3VQSA 4DV0J 3KZBA 4KAZA 5LMUF 5AR0A 2CWKA 2JRSA 2K4IA 1LKYA 5L8RC 3HMJG 3R7SB 2V4JB 3CC2S 4JOUA 1PC4A 3H4BA 1J5EJ 2BJ7A 2KMDA 2CVIA 2WW8A 3FZ2A 2RDIA 3R9KA 1KVJA 4WU2A 3C2KA 2PFPA 1X5SA 2JH7A 3BDEA 4IL6U 1RDWX 3ISNC 3C2MA 4CIGA 5BRFA 3CJBA 1B9FA 1R8PA 4KHUA 2QKQA 3KKAA 2C2RA 1PILA 2XMAA 1UP1A 4O3RA 3NGTA 4YCXA 3KG4A 1HR0F 3NVZA 2C2DA 3E01B 3J7ZO 2WZ1A 3TVKA 3DHXA 3IC1A 4RQNA 3C14A 3UI3A 4MFBA 2YBVA 5ALLA 1KAXA 4F4YA 3CCUS 3CJSA 1S6PA 3M7VA 2DPNA 5L39A 2YNHA 1BPYA 3JTNA 4CO2A 4M3WA 1JLAB 4I29A 1TTHB 3FQKA 2F44A 4Y2TA 1J97A 2CN1A 1DKGD 4AFFA 3ZZ0A 1MWKA 2FE9A 4DU3A 4E1NA 8ICKA 1GQEA 4C11B 3ZSVA 2E8NA 5DJBA 1UVLA 2KHOA 1Y3JA 2ABYA 5F3XB 3V4IA 3L0QA 4ZTJA 4CYUB 3HDSA 2QE5A 3MR7A 4K43A 3O4WA 1A77A 5D4NA 3VEWA 4O44B 4KC5A 1S48A 3PFOA 4M9GA 2E1PA 4RW8B 3N6NA 1ZQAA 4FJ5A 2PMZC 3IM9A 2VJUA 3BQ0A 1T9UA 1FRLA 1NPPA 1EKEA 3C6HA 4CZIA 4X64F 2KI2A 3Q83A 1JCEA 1S59A 3VF0B 4NM2A 2Z4PA 5AJ3J 4UW2A 1CG2A 4KFBB 3TQ1A 1P9YA 3E9LA 1HD0A 4KGZB 2P9EA 5CYQB 4E89A 3W9HA 3W5XA 5EGYA 3O4NA 2UVVA 3M2UA 4CE9A 1P7DA 4OLAA 1QZ5A 2MB0B 4W4MA 3AOCA 3UVJB 4JI2K 5HO4A 1KSPA 1S0MA 2DRAA 4WU3A 4IUFA 5ETMA 4U7BA 1OKJA 4FM0A 3FCHA 2D1CA 4LQ3A 5KRTA 3AY0A 3MOJB 4CZCA 1NSPA 1U2VA 3KLHB 5EWFA 2D8CA 4BROA 4Q2LA 3ZZUA 2RHSB 3MUMP 4XH1A 3W60A 2LYHA 3QESA 7ICIA 5AKJA 4K4SA 2ZZTA 1UJ6A 2IRXA 1FKPA 3SXLA 3RRKA 3PO5A 1WSVA 3CFOA 3BUZB 5IC4B 2JLGA 2GGPB 9ICFA 4ZVRB 1NU4A 1SKWA 3H5SA 1KONA 2FDNA 3HVTA 3KDOA 1OVYA 1SJRA 1URRA 1J6ZA 2XY7A 3SCKE 2IGIA 1SIJA 2VPXB 1DBDA 3H1QA 3PUFA 3P8BB 3FZBA 1ICEB 3LDQA 3GJTB 4CO5A 2RQ4A 2YTUA 3LP0B 2NPIA 5KOXA 2CJAA 4IJNA 2AX1A 4FVUA 3JQJA 4DV1J 3L2RA 3MF5A 2GIQA 2I5HA 5A8KB 5AZIA 3ONQA 1SZPA 4IWVA 3UIQA 1MN9A 4G65A 4CBXA 1SJQA 4BE0A 4DV7F 3B78A 2DRDA 2CQCA 1CULB 2Z1JA 1WHVA 3V6HA 2FD2A 4QZBA 4L3KA 2ZJQQ 4USVA 1RZTA 2QYCA 3H0PA 1NK0A 4O4GB 1TP7A 2IPOB 4I2PA 5E5NA 2PXIA 4ID1A 3GB0A 1HKBA 2VBYA 4WXWA 5CWRA 1MQ3A 2ATLA 2YMMA 2FHJD 2ZWHA 1U02A 2X74A 2HI0A 4Z4FA 2JEIA 4C4TA 1R8AA 3V2UC 1OH6A 2HWHA 1H3DA 3M30B 1RTHA 4YS2A 3O1BA 1RT3B 3L4BC 5EX3A 1XMOF 3QBWA 3CD6S 2E5SA 5BPCA 2LMRA 2EI5A 2L9NA 1R89A 4C2MA 2NYHA 4HVJA 2ZJRQ 4RW4A 1ZOLA 2DVIA 1D9AA 2MGZB 2FLLA 1YVNA 4Z94A 1B99A 1CVJA 2Q4TA 2D5RA 1FD8A 4V19X 2UV8A 1K5OA 1FFVA 1Q7YT 3IHQB 2W41A 5EU7A 3CB4A 2DHHA 4U7UD 1S8OA 3QNMA 5EUHA 1KLMA 1S6QB 2YNIB 4H4MB 3HHDA 2VJVA 1J2MA 2FZCB 3J81U 5A6WA 5L1MA 4IDKA 1VISA 2V67A 4NYZA 3AOBA 4MO4A 5KPZA 2RD5C 2YKMB 1FDDA 2DBBA 4JI8J 2NXUA 2K3KA 4QWBA 1YJ9N 5KFQA 1RWUA 3WNFA 2P9UA 3BGRB 3Q8PB 1JKHB 1XTZA 3Q23A 4DOAA 4FLVA 5B0FA 3SQGA 2NR0A 3PCOB 2BKNA 4MO5A 2UXBF 4FWQA 4QQBA 2IHNA 3E58A 3EL2A 1U1RA 2J4RA 2QA1A 2GZOA 1JJHA 3T9NA 1RT7A 4NL9A 1RHUB 2HQIA 1MWMA 1GT8A 4OHWA 1I94K 2JHDA 1OJ4A 3EKSA 4BRNA 3HD2A 4RPYA 1SKRA 3EXCX 2JEFA 1XERA 1AT1B 3HPOA 1K73T 3R7NB 3IV6A 5JTIA 2MSTA 2PO4A 1TL1B 4DR7F 2NXCA 4J91A 2AD9A 1KN5A 4R8UB 1HKAA 1LXJA 2O5DA 2J9DA 2OD6A 1U1PA 4UY8T 2ZDOA 4GKKJ 4QW8A 1UMJA 4HHTA 2GCFA 5JJBA 4DUTA 5J0QA 5IXUA 2CPRA 2HQFA 2K7JA 1RHJB 4O3SA 3WZ0A 1IBKJ 2C3MA 1PBUA 2OGUA 2UVUA 4IOCQ 1GLCG 3FQLA 1RAHB 2KJ8A 1O13A 3VAFA 2GTDA 3KWGA 1WEZA 1J2VA 8ICLA 5K4LA 2A1JB 8ICXA 3SCLE 4CJKA 3ZSXA 1PVQA 3VQEA 1UFKA 5ETVA 3W66A 3CXCM 2X1GA 1COOA 1AROP 1QD1A 3QATA 4RNNA 4I0WA 3HZEA 1NM1A 4ZH4A 3RJJA 5GAEP 2J76E 3UKUB 2C2NA 2VD3A 2XCPA 4ZVUB 2L9WA 2J6TA 2MHNA 4P7TA 2DNPA 4URQU 4BRAA 4RW6B 2Q0RA 2XWYA 3MM9B 2B4OA 1V9OA 5A76A 1XS9D 1RDFA 2G0CA 1C4CA 1DTTB 3DEEA 4TQRA 1L7OA 3H5YA 3AAQA 3DXKA 2BUNA 4UBBA 2FZKB 3RJMB 3T1YK 3VAMA 5FDLB 2GQ2A 2ZTEA 1NNLA 2GVDB 3M5RA 2KIWA 5D77A 1BISA 3OW2R 2NUHA 2B9YA 3CIMA 5KFTA 4NLXA 1M1HA 4HACA 4KY3A 1N6QA 5BPNA 3D2QA 3MEEB 1HNZJ 5CCLA 4NV0A 2VUGA 3O9SA 4H0YB 4TN2A 1NXIA 2RUGA 2RVJA 2HYIB 4EI2A 3G6YA 2MY8A 5C2CA 3DYAA 4E1MA 4BRHA 1Y88A 3HK2A 2OH2A 3OVAA 3TRGA 2M0GB 4E3SA 1IQZA 4NA2A 2K06A 4C7YA 2B6AB 2HHXA 1PC5A 3D66A 5AKEA 3K7RA 2VWBA 4DFPA 2QA4G 4OFZA 3DI6A 4MDBA 1TMJA 3KLGB 1HWLA 4NPOA 4NLSA 3QEVA 1NG9A 2OM6A 3KLVA 4OJ3A 1N36F 3D2EA 4ED4A 1RP5A 2E8PA 4IFVA 1Y64A 2FHKA 1KW4A 4CLWA 5E3CA 2G8FA 1IBLK 1CJKA 5A2QO 3OYLA 5BOLA 5F3ZA 3VAIA 1IBMJ 2CZ9A 1NNEA 1U45A 3HI9A 1IUJA 3F44A 3HHLA 4PQUA 4ID5B 2CKWA 2DH8A 4NYOA 5KFWA 4X4RA 3H5XA 2HVZA 4RUAA 2OAUA 3M9NB 4B1WB 5F1XA 5LJ3Y 3KWMA 4RTFD 1LVHA 2HMIA 3OYCA 2NLXA 3F9KA 4CJSA 1AQ6A 2J6SA 3MM5B 3I56S 3FGVA 4BG9A 3AO4A 4JV1A 1IJEB 4CF8A 1IM4A 9ICJA 2F8MA 4L6V3 1BY9A 1ZD4A 1FJ7A 4K0KF 2IY5B 1WEXA 5ADXA 2RH3A 1FRHA 3QUTA 1E6YB 4DOZA 2VODA 3R7BB 3DLBA 4J5OA 3IBWA 4FJMA 2A1RA 2MZRA 2LM1A 4EWTA 3W65A 5DKWA 1WELA 2YMQA 2OD4A 4KLLA 2HVIA 2HFZA 4RU2A 1QE1A 2ZIVA 3CPEA 4KITB 4OPAA 1CPZA 1IXKA 3NLCA 4JK9A 4FXWA