4F2RA

Dna polymerase i large fragment complex 3
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
578
structure length
578
Chain Sequence
MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 202
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2rA01
5L1LA 4NLGA 4O4GA 1DTTA 3EY1A 4TUQA 4KLMA 5J2HA 3HM9A 1BHLA 5K14A 2BPFA 1EXQA 5FROA 4Y1CA 2IHNA 3L2QA 4QCLA 4OGEA 3EPGA 4JLHA 4CIEA 3RJIA 3ZDAA 4F5OA 3AO3A 3K58A 4I2BA 4Z4CA 1TGOA 2LYHA 1BPZA 4FYDA 4OLBA 2HHXA 1BPEA 4KLGA 2G8WA 4RT2A 4CGGA 1TL3A 1U4BA 3MEDA 2ZE2A 3L2UA 3UXPA 1QQCA 5HP1A 3RTVA 4O3NA 4O0IA 5CY4A 1RT1A 3PX4A 3QEWA 4QZEA 4KHYA 1MQ3A 5DB7A 1U49A 4C8MA 3G6XA 4O5EA 1B92A 3TAQA 2FMSA 1TV9A 3G0ZA 4YMMA 3AVCA 4IKFA 3V9SA 4GXJA 2AGQA 3AVNA 5I3UA 4JS4A 5KG1A 5KG5A 1WSIA 3T5KA 4C8NA 1BPBA 2V4RA 1S97A 5DB8A 3WNHA 4NYFA 8ICNA 5J0OA 1RTHA 1U45A 4I2PA 3VN5A 4KO0A 3NGDA 3KLFA 3LALA 1T7PA 3RJEA 2KTQA 2W9CB 7ICNA 5HRRA 2HHUA 1RILA 2JGUA 2XY7A 3ZT2A 8ICFA 2A1SA 4PHEA 2ZTDA 4F3OA 4KLEA 4KLIA 4KLSA 4Z4HA 5J2AA 3M8QA 5KFCA 4JRQA 3QNOA 3KLGA 3JSMA 2QKBA 3AA3A 1CEZA 3PW5A 4O5KA 3Q8KA 3DLHA 4J9RA 4UAZA 3WNEA 1RT2A 1S9GA 4BDZA 5DDYA 1NOMA 4DU3A 2QXFA 3HP6A 2W8KA 3LP2A 3HT3A 3PUFA 4PUOA 2F8TA 3O4QA 4DSEA 4DL4A 5EWFA 2AQ4A 4GW6A 3AA2A 4QZBA 3T5JA 3MXJA 1T03A 3MABA 2UVRA 3RH6A 3KHHA 4R63A 4FW2A 4ELVA 3TAMA 2XO7A 5KFSA 3JPPA 4EP4A 4F5NA 3NF9A 4O3SA 5J2CA 3JPNA 4CJ4A 2BQ3A 4M42A 9ICKA 4RW7A 3TI0A 5KFTA 2DY4A 1HUZA 1RDBA 2QK9A 4FZYA 4M04A 1S77D 3AUOA 1LW2A 2I5JA 4KPYA 4H4OA 2BGGA 1TVAA 4KLHA 3V72A 4YMNA 3DRPA 4FK2A 2C28A 4K8ZA 1RDAA 4HVJA 4O9MA 1RCHA 4AH9A 4M3TA 4JK1A 7ICSA 4EP5A 2IMWP 3VQEA 4QZGA 3ZSVA 4F91B 4CJQA 5KT5A 9ICMA 2W9BB 4F3TA 1K1QA 1RT3A 3V9WA 2NRZA 4F5PA 1XU4A 3RJFA 1VSHA 2R8IA 1ZBHA 1VSMA 1S5JA 4J2DA 4FJKA 1S1WA 1QSLA 3HVRA 4XA5A 3Q8SB 5IIOA 4CJWA 1KVBA 3AVFA 5BOLA 2B6AA 5J29A 4TQSA 4XUSA 4IFVA 3KK1A 4DFJA 2FPMA 1S10A 3IS9A 4R64A 1ZQUA 1ZQBA 1TK5A 3AVLA 3AVBA 1ZQLA 4NM1A 3AA4A 4J9NA 3I0RA 4KREA 1S0OA 4KLJA 1LV5A 3L8BA 2AGPA 4ZTFA 4K4GA 2KZZA 1ZQHA 2KFNA 4NCAA 4DOBA 8ICPA 4KHUA 1WAJA 3EYZA 2BCUA 1ZYQA 4CK2A 3DLRA 3VQQA 3H08A 5D4BA 3JPTA 1N6QA 1KFTA 2PFNA 2DFLA 1ZQPA 5L1JA 3IHQB 3QLHA 4RQ6A 4NM2A 3C21A 3PX6A 2HNZA 1XSLA 7ICPA 2D0AA 2ZTEA 4F5QA 2PFPA 5KT6A 3GIIA 3RAQA 1SKSA 3V6DA 5J0WA 4BE2A 1TKTA 2AJQA 3PO5A 2RPIA 1NK5A 1WSGA 3K5MA 1NOYA 1S1UA 2DPIA 2WTFA 3OS1A 5DBAA 4E19A 3NDKA 3NCIA 4IQVA 4UB1A 1XC9A 4QWDA 3RMAA 2YNFA 1KSPA 3LAKA 1X1PA 3V1OA 4FK0A 5HRPA 1S9FA 2OWOA 1I3AA 1N56A 2AU0A 3V1QA 3IRXA 2D5RA 2PY5A 3C95A 1A5XA 2PYLA 4W5TA 2ITGA 3QO9A 1ZQMA 2XY5A 4FBUA 4I29A 5KFFA 2VWJA 3UXOA 4J9PA 1XSNA 1RDCA 2FLNA 1RT7A 3D0PA 3MGIA 4DL3A 2X78A 2JZBA 4DEZA 2MUTA 4YN4A 3AVAA 4CJSA 5HROA 5KFLA 1BQMA 2FPLA 4F8RA 1HRHA 4M9NA 4B9MA 1Z25A 2ISPA 1ASWA 1RT4A 5T7BA 1N5YA 3HJFA 4YXMA 3OYKA 5DLFA 4PGXA 4ID5A 5DBCA 1RYRA 3CQ8A 3OSNA 4Q5VA 3OJSA 5IILA 1S6QA 3GIKA 4TUSA 3TFRA 3WNFA 2MAXA 3L2RA 1UA0A 4CEDA 4QW9A 1IXRA 1C0MA 4BDPA 3PR4A 5DGBA 2O4IA 1ZQQA 4CERA 4ECWA 1GOBA 4ECYA 3CG7A 1L3TA 3NF6A 5KT7A 4K8XA 1JLGA 4JS5A 4M3WA 8ICYA 3K59A 4NCGA 2KFZA 3T1AA 1D8YA 5KFOA 7ICRA 3HX0A 4LY7A 1C0UA 1RBVA 2OA8A 3H8JA 3DRRA 4UB4A 1KEJA 4W5NA 3U3YA 1T4GA 2NRWA 2P51A 3PR5B 3NF8A 1KTQA 3EWAA 1QS4A 2R8GA 4YVZA 2BQUA 3VQAA 4FJHA 3B6PA 3F73A 4RQ5A 4DG1A 1RT6A 3GV7B 2ZJ5A 5HLFA 4PGYA 3RR8A 1EETA 1RNHA 3RRGA 3M9NB 1VSIA 4CF9A 2OZMA 2JEIA 5EOZA 4ECVA 5JS2A 1J53A 4O3QA 4CJKA 4RQ3A 4FLXA 3DRSA 1RDDA 4Z4IA 2GWSA 1VSLA 4NYNA 1EX4A 2M9NA 1Q8IA 3HK2A 4OLAA 4GC7A 7ICLA 3U3GA 1KFSA 2BPCA 2X74A 5L9XA 1BPDA 3A2FA 2W8LA 2PI5A 4O55A 1CXQA 4RW8A 3ZT0A 4DLGA 8ICRA 2FMQA 4BXOA 3MECA 4F50A 2P1JA 2HVIA 4IQUA 4RUCA 3THVA 3PV8A 1ZBLA 1ZQXA 4RU9A 4KITB 4RQ4A 4KLUA 4OKJA 3L2VA 4CEBA 2G8VA 3MDAA 4CJVA 4E1MA 3OYFA 9ICGA 1VSEA 2YHAA 4AHVA 2IAJA 1TKXA 4PH5A 4CJFA 3UXNA 4EZ6A 5HBMA 1L3SA 1C0TA 4ED2A 4C8KA 2BQRA 3E01A 4QWBA 3G6YA 3OVNA 2KW4A 1JLAA 4F4KA 1JIHA 1ZQSA 3ZSZA 3RB3A 3LPUA 4AHRA 2YNIA 3ZSYA 4MF8A 3NHGA 9ICCA 1ZJMA 5J0UA 4ECTA 9ICTA 1D9DA 5KFEA 1L5UA 4QZAA 4IQWA 3ZD8A 2VG5A 3OYJA 4IQTA 3M8SA 2ASDA 3K5OA 9ICFA 4EZ9A 3TWHA 2BPGA 4UAWA 3SQ4A 4QZDA 4J9KA 2YKNA 5CR0A 4I7FA 4BDYA 4FJ7A 4B8AB 3S3OA 2FMPA 1Q9XA 2ATLA 4CFDA 1RTDA 3EPIA 1ZQJA 4QZCA 2VA3A 3PW2A 1HNVA 4B9VA 1HNIA 3QEPA 4I2IA 7ICFA 2VANA 3AO1A 1U9LA 3H8WA 2BR0A 3V9XA 3OYMA 2FLPA 4DLEA 4Q44A 4YR0A 1NJWA 4Q8FA 3WNGA 4FZXC 2X6SA 5HRNA 3CYMA 3VQCA 4DU4A 1XO1A 1HQEA 5KT3A 3PY8A 5TZVA 4NCBA 4M47A 4LH4A 2XY6A 3GV8B 1YTUA 3NH0A 1XSPA 4KLDA 3PMNA 3IG1A 5KFGA 5KRSA 3LZJA 3RR7A 4OVLA 4JUZA 3HVTA 1ZQYA 3CFOA 2A1JB 3C2MA 1HYVA 2RKIA 4CIGA 2JZBB 2MUTB 4IR1A 4CHQA 3F9KA 5KGWA 4OKEA 3OYAA 4I2AA 1ZBUA 3LAMA 3DI6A 9ICHA 8ICCA 3KD5E 2P6UA 4M41A 5FDLA 1L3VA 4TQRA 5KFKA 5C42A 1FXXA 2BDPA 3L3VA 4RZRA 3MXMA 4CHNA 1ZBIA 3QE9Y 7ICHA 8ICAA 4I2HA 4B3OA 4UB5A 7ICIA 3H7IA 4DTJA 4OGCA 1TAQA 4NLKA 2Z1JA 4MFFA 2PFOA 5HMLA 3MFHA 1X9MA 3QIPA 3QEIA 2ZUCA 1BCOA 4F92B 1ZQRA 1QSSA 1JLQA 5J1EA 3M8RA 3C6TA 3RBDA 8ICOA 8ICTA 1EXNA 2P5GA 4DSJA 1IH7A 1L3UA 5DLGA 2KN7A 4MFBA 4CJPA 1S76D 4RW9A 3DMJA 2FBYA 3SQ2A 4KN4A 1JL2A 4FK4A 3K5LA 4WE1A 8ICUA 2OPRA 2XY8A 4CJEA 3TAEA 3RBEA 3Q8MA 2XGQA 5CZ1A 3C5GA 1SUQA 1U47A 5IIKA 3DOKA 5DQHA 4AHSA 3VQ9A 3N97B 2GV9A 4HCCA 4NLNA 3OYCA 5KFNA 4ECUA 2ISOA 2ALZA 4DTRA 4FJGA 5FRMA 4DU1A 3SV4A 4KI6A 3C23A 3C2LA 4HTUA 3HPGA 4J2BA 1S1XA 4CGHA 4I2EA 9ICIA 4E7LA 2H5XA 4Z6DA 3T5LA 4L8RB 2E6MA 2YKMA 4IDKA 4ECZA 5C24A 3Q8LA 3K2PA 4H4MA 3VQ5A 3HPHA 7ICQA 4IR9A 4FJIA 5J2DA 4Z4GA 5J0XA 1RBTA 4IG0A 4M6WA 4HUFA 3SQ1A 4RQ0A 3MR2A 4ZTJA 4FS2A 2C22A 4QWAA 3HPOA 1B43A 1KLNA 5F9LA 4BXOB 4DF8A 3RB6A 1J5OA 2BCRA 3DYAA 4YCXA 4O3RA 4N47A 2OPSA 4F4WA 5DBBA 4OPKA 1WCNA 5DGAA 3V6HA 4DS4A 3MR3A 3ZDBA 4FJMA 4W5OA 3C5FA 4CEAA 5IIJA 3K75D 4FM0A 5CA7A 4E7IA 3OHBA 3RAXA 4DO9A 3TARA 2BANA 4KB1A 4B9NA 4FZZA 4DL6A 5IIMA 3V7KA 3H8SA 4DWIA 4O3OA 4FJXA 1WAFA 4I2DA 3OYIA 4FW1A 2BCQA 1B9DA 2BE2A 2HNYA 2XCAA 1IKYA 1QLNA 3LWMA 3QEVA 4DFPA 7ICOA 4CIFA 4DFKA 2DFHA 3V81A 1G15A 4M9JA 3O3GA 4QZFA 4KLFA 4G1QA 3G10A 5CZ2A 2PXIA 1IM4A 4IFYA 2RF2A 2UVVA 4JV1A 3C6UA 5HP4A 4CFBA 3PW7A 5KFHA 8ICVA 4RNNA 3P83D 1IKWA 3OYEA 3JYTA 2R8HA 9ICJA 2DTUA 4DTNA 4W5RA 5KG7A 1NKCA 2HNDA 5C5JA 3GIMA 4UBBA 3KK3A 1TVRA 4BACA 4KN7A 4EBDA 5J2MA 3LK9A 2DPJA 3TAGA 1IG9A 2W42A 4GXKA 1GOCA 4NXZA 2DFFA 2XC9A 1RYSA 5J2FA 5J2EA 4F4XA 1ZQZA 2FLLA 3S3NA 5CP2A 5KFVA 4CECA 4J9QA 2D0CA 4UB2A 4E3SA 4DF4A 5CHGA 4KTQA 3HL8A 2IHMA 3KHRA 3B6OA 1KRPA 1JLCA 1ASUA 4CFAA 4O5CA 4RPYA 8ICHA 3EW9A 3ULDA 4LZDA 3GIJA 3ZSWA 5BOMA 1JLFA 3AVIA 1T05A 4IRCA 5KG4A 3OS2A 4GXIA 2Z1IA 4CF8A 4PGQA 3SNNA 3VA0A 1BIUA 3OJUA 3TAFA 3NH2A 4ED6A 2HHWA 4PHAA 4Q45A 3HYFA 4DTUA 3K57A 4YXJA 4QWCA 1ZQOA 3SUPA 4GC6A 2F8SA 5J2NA 4R8UA 4FBTA 2HB5A 3NF7A 4DQRA 3ORYA 1WSFA 3OYDA 1O1WA 3OYHA 3S9HA 2F1JA 1ZQAA 1NK9A 3KHLA 4YFUA 1ZQNA 1Y88A 3RJHA 2F96A 3QEBZ 1JLBA 1U04A 3SUNA 8ICIA 1C1AA 3LDSA 1C1BA 3BJYA 1JXEA 2FBXA 8ICMA 4E7JA 8ICKA 1RBUA 5JS1A 4I28A 3P1GA 5C25A 3GILA 4R66A 4YQWA 1S0VA 1CUKA 2Q3SA 4KHWA 5D49A 3ZT1A 3BGRA 3TANA 4LSNA 8ICLA 3T5HA 1VSFA 4DL5A 4YP3A 1Y97A 1SKWA 2AGOA 1V9PA 4DL7A 3OY9A 4XQ8A 1NK4A 4DFMA 1MQ2A 3C1ZA 3LANA 3VA3A 4FM2A 1BQNA 3KK2A 2A1RA 3JPOA 7ICGA 5HMMA 4M0AA 5J2PA 4Z6CA 3QNNA 1U48A 1B9FA 1S1TA 1BPXA 4B9SA 1LWEA 2C2DA 1WSHA 4F5RA 1TK0A 4PWDA 3NGZA 1TFRA 1FKOA 1WLJA 4I27A 1KVAA 2J6TA 4RQ7A 4BE1A 3CFRA 4M6WB 4DTSA 3RWUA 5EWEA 1B22A 3ZSQA 4TUPA 4KTWA 4J9MA 4DSIA 1UOCA 1Z3EB 1NK8A 2W9CA 9ICXA 3JPQA 5KFZA 1JX4A 4HHTA 3U6FA 1IKXA 3SYZA 5J2KA 4F2RA 2I9GA 1VK0A 4RPZA 4E89A 5DQGA 4M2YA 1AROP 2IOCA 1ZQFA 4FJNA 9ICAA 4Q43A 4ED1A 5CYQA 1SL2A 4FJLA 4XRHA 3PO4A 3OYGA 4CF0A 1BGXT 1ZQKA 4CHPA 5KFAA 2ZUDA 8ICJA 1JXLA 5J0PA 4KHNA 4M9HA 4DMNA 3PMLA 2G8IA 4KLOA 2DFEA 2IA6A 1BIZA 2KQ2A 4ECRA 3CFPA 4E7HA 4DS5A 4P4PA 5J0RA 4RG8A 3N4MB 2BGWA 2I1QA 1HPZA 3SI6A 9ICNA 5KFMA 5DG7A 4Z0UA 3V9ZA 2YNGA 3HWTA 3VQ7A 3TABA 3DLKA 1BPYA 3ZCMA 4CK1A 4B08A 2LSNA 3C94A 4C8OA 9ICVA 2ZJ8A 5L1IA 3KHGA 2ATQA 5DK5A 4RW6A 4FVMA 2XRIA 4CEZA 3OS0A 3KLHA 4IBNA 2G8FA 5J2GA 4JWNA 2XCPA 3DM2A 1WSJA 1CZBA 4YNQA 2NRXA 4DQSA 3ZSRA 5KFPA 1NKEA 3LZIA 4FLYA 3ZT3A 4DTOA 8ICZA 5IINA 4KAZA 4E0DA 2JEFA 3QEXA 1UAXA 2R8KA 4XIUA 3E2EA 2RDIA 2W9AA 5J0YA 3QINA 2Z1HA 1A5WA 4EYHB 4B8CA 3TQ1A 4YMOA 3ZSXA 4KTZA 4CF2A 4HCBA 4YG2A 2Y1IA 2YV0X 4ED8A 3P5JA 1QHTA 2ZJAA 1SKRA 2BCVA 4DTXA 3MXIA 1XHZA 4YR2A 2RDJA 4LSLA 4CJRA 2ASLA 2R7YA 1LWFA 3NFAA 3AO2A 1XI1A 3FFIA 9ICRA 3HP9A 4CEEA 4CHOA 4M3UA 3QETA 2OZSA 1VSDA 4QOZB 4M45A 1I39A 2P6RA 1S1VA 1MSWD 4MEXA 4P2HA 4FJJA 5I42A 3NBPA 4F93B 1FKPA 4R5PA 1TV6A 1S0MA 1S6PA 1YVUA 2VA2A 3S3MA 1CZ9A 3H40A 4QW8A 1C7YA 2JLEA 5BPCA 5F9NA 1ASVA 9ICLA 3FYHA 4ELTA 1VSKA 4DTMA 2J6SA 4J9SA 1BVSA 3LP3A 1J9AA 3V1RA 2KZ3A 3LP0A 4N76A 1KDHA 4RNMA 3MEGA 4CF1A 3OGUA 4KI4A 4Z6EA 1NK0A 5FRNA 3QZ8A 3VQPA 4OKKA 4FJ9A 5KFXA 1VSJA 3V6KA 2PYJA 1Z00A 9ICEA 2IS3A 3NE6A 3M8PA 4TSXA 9ICBA 4I2JA 1RTJA 2F1IA 2O4GA 1T3NA 3VQ4A 2YHBA 4EEYA 3H4DA 4J2AA 4QZ9A 5DDMA 5KG2A 1RT5A 2OPPA 2FBVA 5KG3A 3QESA 1FK9A 5KT2A 2HVHA 1KFDA 3GDXA 1NJZA 1BISA 4I2CA 4JV0A 1HYSA 4ED0A 2F1HA 1DLOA 3SUQA 4I2FA 4ED3A 1COOA 1ZQIA 4QZHA 1TK8A 1W9HA 2WONA 3HO1A 4FLVA 3G6VA 5KFQA 4CESA 3ASMA 3Q8RB 1XHXA 1JLEA 5KFWA 3MFIA 1HQUA 4CEOA 1Q9YA 2V9WA 3AU6A 2D0BA 4QWEA 3RMCA 5KFDA 2JEJA 3PX0A 1ZQEA 1SL1A 1N48A 1ZQDA 1DOQA 2W9MA 5SWMA 3NTUA 1LW0A 3TFSA 1C6VA 2EX3A 4DL2A 3AVJA 1ZJNA 4RQ1A 4FJ8A 4QZIA 1EKEA 1LWCA 3AV9A 4ID1A 4R65A 1J54A 9ICWA 3OYLA 4MF2A 3IAYA 4G3IA 4M3ZA 3O4NA 2B5JA 3LPTA 4RPXA 3MBYA 1SZPA 3ZDEA 3RJJA 3ISBA 4DQPA 4DSLA 3ISNC 3ZD9A 4I2QA 4MFCA 3PW0A 2IGIA 3BQ1A 2C2RA 1TKZA 4J9LA 4KB0A 5DKWA 2B21A 9ICSA 1MC8A 3PW4A 4KFBA 2NUBA 1PZNA 3PVXA 4DSKA 4EYIB 2IDOA 1D8LA 4MFAA 5HHHA 4KRFA 3B0XA 5DG8A 1DGSA 5DB9A 2PFQA 4GMJB 4DQQA 3SJJA 2HMIA 4CJLA 3DLGA 3NH1A 3OYNA 5CWRA 4DSFA 1RPLA 3RJGA 3V6JA 2EHGA 3OYBA 3NAEA 4I9LA 4PHDA 4F4ZA 2G8HA 4B9UA 5CB1A 4RW4A 4CCHA 3V7LA 5J2IA 4K4HA 4O44A 4O3PA 4YD2A 1XS9D 1TKDA 4CGFA 1RBRA 2FPKA 1UT8A 1Z26A 3CM6A 3O3FA 2ZD1A 4KLQA 1IO2A 5J2JA 1HYZA 8ICQA 4FS1A 4F2SA 7ICMA 3KLEA 1UWBA 4AILC 2BHNA 3GQCA 4FLZA 4O0JA 3BQ2A 3ZDCA 1D9FA 3BDPA 4O5BA 5J2QA 3QZ7A 3D45A 4M9GA 4IRKA 4K4IA 4FLWA 3KIOA 3UQ0A 3V9UA 2E4LA 4KHQA 5EU7A 3O3HA 4DOCA 4QAGA 3VQBA 3KTQA 3BQTA 4BE0A 3KLIA 1RBSA 5KFIA 1T8EA 2UVUA 5KFUA 5KFJA 2ETJA 7ICJA 1KCFA 4CGJA 3KKRA 3AO5A 1YTAA 3K5NA 4CJ5A 9ICUA 4Z4FA 5CJ7A 4CHZA 7ICKA 1QTMA 8ICEA 1BL3A 4DQIA 2FC0A 3NGIA 5J2BA 5KGXA 3SI8A 1TAUA 3KKSA 4PHPA 4RQ2A 1NK6A 4CJ3A 1JKHA 3SV3A 4HYKA 1UT5A 4ED7A 2P5OA 1WSEA 5J0TA 4FO6A 3VQDA 4TURA 3BQ0A 2GBZA 1KVCA 4KLLA 4BGDA 3T3FA 2V4QA 1Z00B 1A76A 5KG6A 3MAQA 5L1KA 7ICUA 1ZQGA 4PA1A 3GV5B 1RXVA 3MGHA 1BI4A 2G8KA 4KMUA 5JUMA 4P4OA 4ZH4A 1MU2A 3AVGA 8ICXA 4CJTA 2IC3A 1JN3A 3MR6A 3SZ2A 2VA8A 3LDAA 3ISCA 4FJ5A 1A5VA 8ICWA 3B0YA 4N41A 1HJPA 3AU2A 4DOAA 3DLEA 1LAWA 1F21A 3AA5X 4PY5A 4CGDA 3H4BA 3RB0A 1NKBA 3DLBA 3VQ6A 5J0SA 5KI6A 1BCMA 2A1JA 5KFBA 3ZDDA 4CE9A 2BCSA 4Z6FA 3L3UA 2HHTA 2XGPA 2J6UA 9ICPA 4LVSA 7ICVA 2C2EA 2Q0ZX 1YT3A 3RH4A 1X2IA 3SUOA 2HHVA 3OHAA 4CK3A 4LD0A 4CJUA 4KKOA 3Q8QB 5HNKA 4Q0BA 3RRHA 1VRUA 4ECSA 1R0AA 4ECXA 2VG6A 5J0QA 2GUIA 4E1NA 1TL1A 5EWGA 3SCXA 1W0HA 1ZBFA 2PI4A 4FXDA 2Z1GA 2ZQBA 1K1SA 1LB2B 3RB4A 4JRPA 3OSPA 1A77A 5DQIA 4CEQA 4H8KA 5SZTA 5KT4A 1ZQTA 5E41A 2HHSA 4F4YA 3AVMA 1X9SA 4EBCA 3ETLA 4M3RA 5HRSA 3I0SA 4EBEA 3TAPA 4YFKA 3MR5A 1ZQCA 2HHQA 4FCYA 4RNOA 3V4IA 2YNHA 3RMDA 4YD1A 4E7KA 4AHUA 3KJVA 1WN7A 4OJRA 5KFRA 3K4GA 4N5SA 2ZUBA 4CHYA 1WCLA 2JEGA 4J2EA 1HUOA 2PZSA 4BWMA 3QERA 1HMVA 3GFKB 2P66A 1JL1A 4UQGA 1EP4A 3M9OB 8ICSA 3AVKA 3JPSA 2B4JA 3HXMA 1GOAA 4ICLA 1JXBA 3Q8PB 3LWLA 3HW8A 2ASJA 1IKVA 4OPJA 2IBKA 8ICBA 3AVHA 2QKKA 3AO4A 3ISDA 5CYMA 3HSTB 4LH5A 3LP1A 3UIQA 1X9WA 4QZ8A 4CEFA 3ZSOA 4KLTA 1RTIA 2WOMA 4J9OA 4IG3A 4IRDA 3VQ8A 1SV5A 3RJKA 3T19A 4AHCA 1SL0A 4PQUA 4I2GA 1C1CA 3UQ2A 2AQ0A 2OYQA 2VG7A 8ICGA 5D46A 1RXWA 2NRTA 2XHBA 3QEAZ 3MEEA 7ICEA 3DOLA 2KZMA 3MDCA 4B9LA 4YR3A 4PPXA 3I8DA 5DB6A 4M3XA 1LAVA 1QSYA 3C2KA 4MEYA 5KTQA 4UB3A 1S0NA 4UBCA 4CFCA 9ICQA 2NRVA 3M9MB 1ZQVA 4N56A 5DG9A 3ZT4A 5KRTA 3L2WA 1CLQA 1RZTA 3KD1E 3EZ5A 4Q8EA 4HUGA 4KV8A 4GLXA 3ALYA 4P4MA 2BKEA 1NJYA 4RUAA 3JPRA 1WNSA 3SPZA 2HW3A 4ECQA 3PNCA 1K6YA 2X6NA 2ZTCA 2W9BA 4CGIA 4RT3A 2RN2A 7ICTA 1NJXA 3FDSA 4ZHRA 4KHSA 3NGYA 5DMRA 3IM1A 3UPQA 2G8UA 1ZETA 4X5VA 2VWKA 5IIIA 1JMSA 4NLZA 4MQ3A 4B9TA 4FLUA 3TR8A 3ITHA 1XWLA 1QE1A 3SQ0A 4FM1A 4M3YA 1ITGA 2E6LA 1NK7A 5KG0A 1REVA 1DTQA 4JV2A 1H38A 4AHTA 1ZQWA 5HHIA 1CXUA 2R8JA 3SPYA 4JWMA 4BWJA 2FBTA 4R8UB 4W5QA 4ELUA 2UVWA 1BI4B 4HUEA 3QIOA 4I9QA 4Z4EA 4DTPA 1S9EA 4Y1DA 5KFYA 3CM5A 4UAYA 4RQ8A 1HJRA 4M9LA 3V7JA 1UA1A 3RMBA 5D3GA 2Y1JA 3C1YA 4LZGA 3RH5A 1D5AA 4GVMA 4FLTA 9ICOA 4NY8A 1KLMA 1VRTA 4C8LA 1NOZA 2OPQA
chains in the Genus database with same CATH superfamily
3MCAB 2QMWA 2WTUA 1Y11A 1VQOS 2MQQA 4BX9C 1VK3A 4B1ZA 3F9MA 1QDUB 3I76A 2QYGA 1F2HA 3L95X 4MT1A 4PWUA 1HWJA 2UXCK 2GIRA 3K0SA 3AODA 3TRGA 4DR1K 3H0RB 4OGEA 5EE1A 3TQEA 1WDTA 5GTHU 4UAVA 3RJIA 3I87A 2ZJPL 2FYXA 3K58A 1FRLA 2L9DA 3EVMA 2EBEA 2BOAA 5ETOA 1ELOA 4FYDA 2G8WA 1FHTA 1VQYA 1F9EB 2FF6A 1ED1A 3PG9A 4EUVA 1UMJA 1RT1A 1S72N 2D74B 2KRRA 3E0FA 4BRGA 4C8MA 3SDEA 2QEXS 2JRSA 2KVSA 1WC3A 1B92A 1RGVA 5GTIU 1BQNB 3G8SA 1TV9A 1ZZFA 3G0ZA 2O66A 4IKFA 3V9SA 2AGQA 3X3UA 5LJVA 5KG5A 4DHVA 4S0MA 1TUGB 2OHFA 1FWPA 1UKUA 5ALDA 1RWVB 2QWMA 5J0OA 1IR0A 2CJAA 3V4IB 2YNHB 4KO0A 3KLFA 5ALFA 2OP5A 3MF5A 5F8JA 4CZGA 3RJEA 3QU9A 4OZ0A 2UUTA 3MAAB 4PHEA 5J8YC 2B4PA 4KRWA 2FI1A 3FZ2A 3B8AX 4KLEA 4KLSA 4OJGA 2L9WA 4BRQA 4XH5A 3WT0A 1GMUA 3Q8KA 3LA0A 3DLHA 1S9GA 1IKVB 3P38A 2CPFA 2YKOA 1NOMA 2K3IA 2ZDPA 4DU3A 1HKAA 2LMRA 4RLEA 5HL7L 4XEIA 3DDHA 2XYPB 4DSEA 5EWFA 4GW6A 4QZBA 4C23A 4P73A 1TL4A 3MXJA 2QL9B 2YN4A 3KOOA 5LY3A 2V8DA 4LFAF 2UVRA 3FZKA 2D8CA 2QB0A 1HBNA 2EC2A 3RH6A 2VG7B 4LF4J 3I4PA 1XC3A 3TAMA 1JUDA 5KFSA 1W25A 4OHVA 2ADBA 4EP4A 5B0BA 5ALNA 3UQSA 9ICKA 1J5EK 3TI0A 4MO5A 1RFQA 1HUZA 2WBMA 1RDBA 1PK1A 1V5VA 1FEZA 3QUQA 4EX6A 2YWGA 5AQGA 3AUOA 1LW2A 4KPYA 2VJ4A 3U1LA 4JKFA 3KDNA 1NH8A 2BBEA 2C28A 2YH0A 3VCDA 4AH9A 3P39A 1DARA 4I1TA 2IMWP 4ZN3A 3DLLQ 3EKUA 5E3CA 4B1YB 4QS8A 3ZSVA 1MDUB 5AQSA 2VF3A 3M1FA 3ZTOA 3QFUA 2W9BB 4F3TA 3ILJA 2YMQA 3K2YA 2NRZA 2FHMA 4EFAC 4JB8B 1IR2A 3QBWA 1Q3UA 5ETMA 2M8HA 4A4JA 3D0HE 1YRUA 2RE2A 2R8IA 3HI9A 4O8KA 1SV0C 5C2GA 2E9ZA 4TY9A 2LHTA 4XA5A 3Q8SB 2V6AA 1REVB 2GAGC 4TQSA 2NZ4A 2J4RA 2KKVA 4JI7F 4V19S 4F26A 4DFJA 2FPMA 2Q6CA 1ZQUA 1ZM3A 8AT1B 4OD0A 3DHXA 3C14A 5GAHI 4CZIA 2X7IA 3AVLA 1VHXA 3AA4A 4OPHA 4KREA 1VLOA 4H5TA 4GVBB 2AGPA 3E9PA 2IVFB 2KZZA 3SJHA 3WEEB 5HMYA 1S6PB 3ZZ0A 2KFNA 4DOBA 4US8A 3OR1B 1WAJA 3Q22A 3QFWA 2BCUA 2OI2A 1ZYQA 5D4LA 1SH3A 3DLRA 3VQQA 2XMAA 3JPTA 2LEBA 2DFLA 4IOXA 5A2QO 5L1JA 4O4GB 3HFZB 4DV7F 3KNAA 1IN0A 3ZLJA 1F60B 1T9WA 3LDPA 3TZXA 3C21A 4CZCA 4BR5A 2PFPA 1IM6A 3GIIA 1JJ4A 5EGYA 1SKSA 3ZEUA 3V6DA 1U1MA 2AJQA 3PO5A 4ISEA 2W01A 4OYZA 2DPIA 4LJMA 2B4OA 2DHXA 2G0CA 4D3HA 1UW9A 5H1SQ 3NDKA 4EMDA 1XC9A 1UTAA 4ED5A 3LAKA 5BRHA 3RW6A 2P9SA 1ZAXA 3V1OA 1N56A 2AU0A 3V1QA 4EX7A 2HFVA 1FA0A 1A5XA 4W5TA 3QO9A 1ZQMA 4FBUA 3PEJA 1VQ6S 5D0HA 2ZJQQ 5I3UB 3D0PA 3MGIA 2JZBA 5AQWA 1OKJA 2ZG6A 2NZTA 2CKWA 1WI6A 2HHHJ 3MDFA 2ZIXA 2FHJD 1Z25A 1RTHB 5T7BA 2ILYA 3OTOF 1Z05A 2JVOA 2CZ4A 3KUGA 4ZVFA 2QE5A 3CQ8A 4LFAK 1KHWA 1XMBA 4GKJJ 4XH4A 1S6QA 3GIKA 4TUSA 3G8QA 2P8IA 2MAXA 1FKAF 1WC6A 4BDPA 4F3QA 2O8EA 2RRDA 3O8MA 4CERA 4ECYA 4P72A 5KT7A 4K8XA 1B0XA 3K9JA 3JSMB 5HQLA 5AQYA 2C2ZB 5I4MA 3DGPB 1R27B 5BR8F 3MMBB 3U8XA 1V6HA 1D8YA 3TACB 1NHVA 1X4GA 1ZOLA 2ZBQA 4ZKAA 2YX4A 4CLKA 1URNA 2O5DA 1O13A 3DRRA 1KEJA 1T4GA 1R89A 3L7UA 2I6XA 2P51A 4ZN1A 1MWZA 1S72S 3NF8A 3QBCA 1BHNA 3DRYA 1KTQA 1VJ5A 2DNRA 5G4DA 2W2NP 2KHVA 2E2NA 3VQAA 3AB4B 4A8WA 4UY85 4US9A 2OTJS 4AM7A 1KL9A 3CXCM 2M9KA 1X4DA 2CQDA 2CQPA 4LFCF 2ZJ5A 2E5IA 2E1FA 2D41A 4LBIA 1DY3A 4PGYA 1NGIA 4DR2K 4UZBA 2HFOA 4W92B 4J8FA 4EO6A 3M9NB 1WF0A 3FM9A 2ZHOA 4CF9A 2NPIA 2I5JB 1OSCA 4JI7K 1JNZB 4DPYA 3DU6A 3MCOA 5F8MA 4LSZB 4CJKA 4ZPBA 2BJ7A 4IO1A 4LF1A 3DRSA 1VQ7N 2HBYB 1WKJA 1Z1BA 4PG8A 4GC7A 2QYCA 4ZJOA 1VBZA 2WF8A 1URRA 4JEPA 4JYAJ 3A3OB 4YORA 2W8LA 2PI5A 2FZGB 2JV3A 3ZT0A 2H4YB 3P6YC 3TJ9A 4CVNE 3MECA 4H0PA 5D77A 2P1JA 4OX7A 5LXRA 1YZ7A 2XMJA 4LF7J 1S1WB 1U2VA 3ED5A 1R0BG 2OH2A 4DV7K 1MLAA 2JFKA 4MYTA 2B6AB 2QARA 4CEBA 4E1MA 1VFJA 4IFVB 3MPUB 2OEMA 4OFZA 1SIZA 1XN9A 2WAQC 4PZNA 2VKRA 2XWXA 4KAIA 2F9WA 4ZP6A 3PJWA 5JJBA 1TKXA 3SAFA 3ET6A 1C0TA 5AQPA 4QWBA 1B4FA 1S8OA 2KW4A 1JLAA 4F4KA 3GG1A 3MCSA 4WP8A 1DFDA 3SCIE 1IWGA 4AHRA 3ZSYA 3KNGA 9ICCA 3HSZA 4M63A 2C2MB 4IH6A 2ROPA 2QLBB 4QZAA 1D8ZA 3ZD8A 3OYJA 4IQTA 1YUWA 2Q1NA 3G6EN 3TWHA 5D8HB 1X6IA 1RBAA 2JRZA 3SQ4A 4A8SA 2I7PA 4FSVA 3I28A 3F53A 4B8AB 1XTZA 1Q9XA 2ATLA 5H2FU 1RU2A 4CWBA 4CFDA 3G87A 2HNZB 3ONNA 3EPIA 1HNIA 1O08A 2YTCA 7ICFA 4UB6U 1PO6A 3AO1A 5H9EJ 1U9LA 3M1VA 1BA1A 2W3RA 1TKTB 4YOWA 3AAPA 3IG8A 1ZM4A 1WC0A 2OUGA 3GZ7A 4WFYA 3WC0A 1S1UB 2ZC4A 3MCNA 1J5EJ 4JI0K 1NSPA 1R6YA 5DJBA 2MKIA 3IWNC 4DU4A 1XO1A 1CC7A 2MSTA 3D3BJ 4M94A 2VODA 3EDRB 1KAYA 2GMJA 2QLWA 2XY6A 3PRVA 3OL6A 1XSPA 1NB2A 4FVCA 2Z30B 3RR7A 3CJ0A 2YWHA 4CZFA 3HVTA 3KHYA 2P9NB 1ZQYA 1NI3A 2A1JB 1HYVA 1A0PA 5TISU 2J5AA 1SVDA 2ERRA 2MUTB 2P9PB 3F9KA 4B6JA 1BQMB 1X40A 4TY8A 3ENOA 3KD5E 5KFKA 4FXVA 1R0AB 2BDPA 1BG3A 2BUPA 3BO4A 3VZHA 1ZBIA 3QE9Y 8ICAA 4ZCIA 4PL8A 4KYZA 4LFCK 7ICIA 4YDDB 4CZKA 1T9XA 1LEOA 1SQFA 1K8AO 4OI6A 2RJZA 4NCGB 4NA2A 3TA1A 3MFHA 3QEIA 1FWLA 1BCOA 1SV4A 1JLQA 1QSSA 4NWBA 4FF4A 5J1EA 4BR0A 2E5JA 3IKMA 5TKYA 2HBRB 3HSGA 2KN7A 1Q4RA 2XNQA 4MFBA 3R9PA 2DEIA 3DMJA 2FBYA 4KN4A 1JL2A 3K5LA 3BSAA 3KJVB 3NVVA 4CJEA 3D6JA 3N7SC 3NVMA 3RG6A 3QUCA 1VHIA 3VQ9A 4DV5F 3N97B 5IQ6A 4DG1B 1RE1B 1QCKA 2GV9A 1DQ9A 4BROA 1X4BA 5KFNA 3FZFA 3M6ZA 2HI0A 1ZA2B 4ICLB 2ISOA 3NMUA 5JU5A 3W5XA 2DIUA 2IFXA 3CP8A 4C3KA 5CYMB 1S1XA 2RSQA 4CGHA 2H65B 4ERDA 4PG7A 3HCXA 5CA5A 2H5XA 1E6YB 2XM3A 2C1EB 4L8RB 2E6MA 2CQGA 2WB1D 1SV5B 3BREA 2W25A 2IM1A 5J0XA 1P7DA 2ZH9A 3OLAA 3SQ1A 2A41A 4RW8B 3F44A 4YOYA 3CDBA 4NYPA 1NMNA 2E2PA 3RB6A 2BCRA 2WVCA 2LQBA 4YCXA 4O3RA 4N47A 1R8HA 3DXBA 1WKLA 1CJUB 5DGAA 4BUGA 3TVKA 3VENA 4FJMA 2ZHBA 2W11A 2E5HA 4W5OA 4X4NA 4CLFA 1IQZA 4QIVA 1IJEB 4E7IA 3RAXA 3TARA 2BANA 1FX2A 4TU8A 2IAJB 3H5UA 4DL6A 5IIMA 1RQLA 3H8SA 4Y2QA 3E01B 4O3OA 3UMBA 3ISZA 2XNRA 1PJ7A 4I2DA 1L7MA 3OVBA 1B9DA 1ZAVA 1NGGA 4CNZA 4JKGA 5LMNK 7ICOA 3DDIA 4CIFA 1LVHA 1UHUA 1KEKA 4QZFA 4KLFA 3J7AP 5CZ2A 3UWTA 4IFYA 2EZZA 1PJ5A 2DY1A 2P35A 4JV1A 4I7FB 1VGYA 3PW7A 5KFHA 3MTJA 4WTOB 1IUJA 5A8WB 1VQLS 1PVQA 1HNVB 2R8HA 9ICJA 3N7PD 2OLWA 2HNDA 4YN3B 5C5JA 1NDKA 2G0AA 5E3QA 2W6KA 3KK3A 3RFAA 1VLBA 3FE1A 4YOXA 5CXTA 1DEJA 3T1YF 5BPMA 2E1RA 2XMVA 4NASA 3AAQA 4K43A 1FE0A 5JMNA 2FLLA 2K7JA 3J7YU 4AXIA 3S3NA 2KP7A 2ZVSA 3I33A 5KFVA 3UVJA 2OPQB 3IG1B 2JVRA 2I1RA 1I51B 2W4DA 4E3SA 4ILRA 4DV2F 3L9ZA 4RU2A 3HL8A 2IHMA 1NDLA 1KOHA 3FZLA 3Q89A 5B8HA 4NI2A 4RPYA 3EW9A 2CJKA 1YIJN 5BOMA 1JLFA 3AVIA 3OBIA 4U9RA 5ALOA 2HRYA 5KG4A 1C0GA 3KBBA 4NO7A 4CF8A 4PGQA 2YTUA 3OXLA 3N79A 2G0IA 3DI6B 3TAFA 3V4MA 2LVWA 4ED6A 2W2OP 2VIHA 2QTWA 4Q45A 4M5HA 3G6ES 3LQVA 4OZNA 4EIAA 2ZE2B 5HR7A 4CLPA 1FD8A 4AT1B 2R7TA 3BB5A 3ZNJ1 2ZJQL 1P27B 5HVHA 1NLVA 3J7Z5 4DCOB 3NASA 1M5KC 3OYDA 1ZQAA 1VI7A 3RJHA 3R5AA 2YQEA 3EE9A 4N8NA 5U47A 1JLBA 3NS5A 2GNKA 5MAOA 3D1HA 4DPUA 3C6TB 3UN3A 1Y00A 2JLFA 3NUQA 5GMEA 1RA7A 2FBXA 1ZQ1C 4E7JA 4ZVEA 1PYOB 8ICKA 2GQCA 3O9TA 2NXNA 2E8OA 2V68A 4RW9B 2DL0A 2A2CA 2UU9K 2HLTA 2YKAA 4HR2A 1S3XA 5ETQA 3VEZA 3M6VA 2EFVA 4R66A 2KVIA 1BA0A 3QU5A 1P8ZA 2IRXA 2Q3SA 4G1PA 4ZCLA 4BVPA 2ASYA 1SJ4P 3ZT1A 4NOHA 1OH6A 3CCLS 4LSNA 3KLGB 1J6ZA 1GX5A 1WWUA 3LW5C 3PJXA 4NLYA 3PIOL 1E4FT 1NEEA 1Y97A 4YP3A 2HBLA 3OTOJ 1RABB 3PDNA 2AGOA 1V9PA 3OY9A 5HN0A 1NK4A 3C1ZA 1CSJA 3JS6A 3LANA 1UETA 1BQNA 2A1RA 5J2PA 1CS4B 4Z6CA 3QNNA 1NWKA 2KL8A 1B9FA 3CNQP 4BC5A 2YKMB 1BPXA 5ETPA 4B9SA 1NSQA 2E8MA 1TFRA 2CN1A 1G7CB 3BPSP 1WLJA 2FSNA 4I27A 3TUIC 2QWQA 4RQ7A 5BR8J 3CQYA 2DO4A 5EWEA 3O1BA 3LH2S 4JKBA 4RWWA 3SSSA 2VD3A 1Z4UA 1P9QC 3NS6A 4YEAA 4DU7A 4NLQA 3HMJG 4DR5F 9ICXA 3JPQA 2AJ2A 1GLBG 4BRIA 1RDRA 5A0YB 1M1HA 1K0TA 5J2KA 3D9BA 2G0JA 1FO1A 1VK0A 2IRYA 3LOUA 4E89A 3IG5A 4M2YA 4PQAA 1WDDA 1IJFB 1CJKB 3TO8A 4FJNA 3TTDA 3WU2U 2A18A 3DXKB 2WF5A 5C2FA 4NA3A 1EKRA 3L4PA 2EFPA 2O8DB 4LFCJ 1FNOA 3OYGA 1IIPA 3BZCA 3MM9B 1ZQKA 1DKGD 1HNWK 2WF7A 8ICJA 3H3NO 2V0NA 3SCKE 3WKEA 2BE7D 4M9HA 1A6LA 2DH7A 3PMLA 3RZAA 2X1AA 3WIVA 4QR0A 1BIZA 4K41A 3V81B 1FDDA 2ZH4A 1NBWA 3VGVA 2PSZA 2CH5A 1T6CA 1K73T 1VIXA 3FEYB 2HS0A 1SC6A 2CQ1A 1HPZA 3SI6A 4JD2B 3BUZB 4I64A 1T95A 3QAUA 5DG7A 2NZCA 3X1LB 2QWOA 2ZWOA 3VQ7A 3KKAC 3IS9B 4ES3A 1IKWB 1BPYA 3FBCA 2L48A 3M2VA 3ZI4A 1S48A 3SMSA 3C94A 2DQNB 9ICVA 4LR9A 4C4TA 4BR9A 2M5YA 2WZ1A 2ATQA 4RW6A 2XRIA 3BYRA 2G5IB 3VHQA 5J2MB 4WBFA 3B6BA 3UR3C 3E9OA 2ODGA 5THWA 3MM7B 1CZBA 3EZUA 2UUCF 1S59A 1WBDA 3ZSRA 5KFPA 1GTEA 3H8YA 2J0XA 1NPPA 5E5NA 3QLHB 2R8KA 2Y9TA 4NLUA 1HNXF 4H5RA 3FNNA 1Y0HA 3ZZZA 2XZWA 1FJ7A 5J0YA 1F0MA 4JI4J 2C2KB 4L74A 2XQCA 3NAHA 4EYHB 2G1HA 4LRFA 5A8KB 2DXFA 3D3CJ 1S6UA 4RR5A 4KTZA 2YMMA 3WBZA 2YV0X 4ED8A 4KH6A 1XHZA 3W5ZA 1U7LA 2ASLA 1LWFA 3NFAA 3MM8B 4CEEA 4M3UA 1BO5O 3QETA 1Q0NA 4QOZB 2CGKA 4GRSA 1N34F 1Q95G 2QXLA 4KGVB 4F93B 4R5PA 4U95A 3CCRS 2DUYA 3WEEA 5AKHA 1PVPA 1S6PA 1YVUA 1OSDA 2HLUA 2H9ZA 5FLXO 1C7YA 4NYOA 3VVTA 2W4PA 9ICLA 1MWYA 3ZTPA 2BJ1A 2GMLA 3VQTA 4RTFD 2KZ3A 4N76A 5M1OA 3UN2A 3SIPB 3QRRA 2H4WB 4ZLLA 1XMQF 2XTJP 4OKKA 5C25B 4KT0C 1AA1B 3OV7A 1RK8A 5CCLA 3PXGa 4N77A 3B78A 1LK5A 9ICEA 4AL6A 5K8PA 2FJ6A 2E5LF 2N7CA 3NE6A 3QXGA 5EX3A 4B1VA 4I2JA 5D15A 3O5TB 2W40A 4DR5K 3TYTA 2YWEA 3A4TA 1HNZJ 2YHBA 3H4DA 1NB7A 2FBVA 5KG3A 4U7CA 4JKHA 1SQGA 3MPVA 5IT9U 2RP5A 2HVHA 2F40A 2H5IB 2XULA 2KYXA 1V9OA 1WC4A 2F1HA 3BEGB 1IR1A 4I2FA 3FBBA 4MO4A 3IGVA 4ZVRB 1E6VB 1LWEB 5AM3A 3ASMA 4CI6A 2QO3A 1HARA 2K60A 5KFWA 1OMSA 2XO6A 5ALYA 1X7VA 3AU6A 2CWKA 4DXLA 3K9KA 5C15A 2C3MA 1RAIB 1IQTA 5KFDA 2JEJA 2U1AA 3O9QA 3MPYA 4USHA 3MWPA 3W0LA 3KJQB 4I4BA 2W9MA 3VTIA 3U02A 1BOTO 2KOBA 2EX3A 4DL2A 1ZJNA 3D7SB 4X84A 2BABA 5ADXH 5F0WA 1YJWN 1NPRA 4GV6A 3GPAA 3E8OA 4K42A 2IIHA 1LWCA 4Y2CA 4DUZK 5CYQB 4DV5J 2VOPA 2KNJA 3IAYA 3F0NA 3CGIA 2QX0A 3LPTA 4BRKA 1HW8A 3MBYA 1SZPA 3ISBA 2K8BB 2UUCK 1O51A 3H0MB 3BR9A 3FBFA 2C2RA 1UPMB 1KQSM 3K1ZA 3N4WA 5JVGL 1MC8A 3SQIA 2VDIA 1HNXK 5IWAF 4NJ8A 4EYIB 2IDOA 2BRLA 4MFAA 4NRUA 2FVCA 3GLJA 3HLUA 4MKVA 4B3MF 2YX7A 2NSBA 2ZIWB 3C16A 1FF2A 1WF2A 1QM9A 2CQBA 5GAGI 3OYNA 1GAOA 2E44A 3D2WA 2X3DA 2QV6A 4WZQA 4PR6A 4UW9A 5EDWA 3A5LC 2ZOMA 3I56N 3VEWA 3V7LA 3DM2B 4NWIA 5J2IA 1U1PA 2JXJA 1EAYC 2MKHA 1N34K 4YD2A 1XS9D 2ES6A 5B66U 4F36A 1VQMN 3T79A 3O3FA 4PG5A 3R5BA 1OH8A 2VGMA 2IYIA 2LXIA 5ALXA 2AEJA 2BEFA 5J2JA 1HYZA 2HWIA 1SZHA 3IXQA 3BY5A 7ICMA 1KW4A 4F9OA 1UWBA 3GQCA 4L3NA 2KSOA 3ZDCA 2Y3YA 3QZ7A 4KB7A 4M9GA 1V5IB 1HD1A 3TADC 4C4SA 2QL5B 4IRKA 4K4IA 2JFDA 4B9QA 3KIOA 3UQ0A 5D0EA 3HKZF 4CBUA 1XMQK 3NWGA 3SMVA 4KHQA 2DNPA 2W6LA 1F0XA 1HQEB 3AQOA 2E5LK 5KAKA 4QAGA 3VQBA 3KTQA 5F3XB 3C65A 4L72B 3A5MC 1RBSA 3QFPA 2BW2A 4IOAQ 1VYAA 5GAHP 5KFUA 3GSIA 2LI6A 2HRTA 3GFXA 3NGKA 3MMAB 3O1LA 2K8AA 2G09A 2GO9A 2RKIB 3JAMU 3T1YJ 3H5YA 4ZPCA 3ZX0A 1I3OB 8ICEA 2QA2A 2FC0A 2WAQD 3SI8A 1ICEB 2HQFA 1T6DA 4YOTA 4RQ2A 2A2DA 1JKHA 3MEGB 5FDLB 4ED7A 2R2TA 1UT5A 2R4FA 4F72A 2NNWA 2CPHA 4HACB 2R7XA 3VQDA 4QNLA 2VB6A 4OJ3A 2GBZA 3UW1A 4DV2J 3OLBA 1KVCA 3TUJC 5E79U 4NV0A 2GVZB 3BS5B 3KMSA 1QVFM 2IVOA 4QS7A 3TPQA 1A76A 2DR8A 4XH1A 3SEOA 1ZQGA 3IM8A 4O4RA 3TSUA 1RXVA 1BI4A 2LU1A 2G8KA 1RTJB 4KMUA 4ZH4A 2OSRA 1U1NA 4CJTA 5AI5A 1K9MO 2OPPB 3JTOA 2VA8A 2LKYA 3LDAA 3ISCA 2KVQE 4N7TA 3S6EA 1FRKA 1A5VA 4CIOA 3S7RA 4EI2A 3AU2A 3DLEA 1HYSB 3EUB2 2PMZF 2D1CA 4CGDA 3H4BA 4CT8A 1CG2A 3VQ6A 2PBDA 4QIWC 2A1JA 2B9WA 2BCSA 2Y8YA 1Q5YA 4OCZA 1LKZA 2VFVA 4EFHA 2P9PA 3T9ZA 1JLEB 3BSCA 1S5LU 4CYUA 9ICPA 3O4WA 3MEKA 7ICVA 4LF5F 1FXLA 1N62A 1PIEA 1CJTB 3RH4A 1X2IA 2HHVA 3OHAA 5AK6A 1VQ9N 1FE4A 1QVGM 4Q0BA 4KY3A 1NGDA 1UPPA 1R0AA 5IWAK 3OFFA 4B3TF 3A0IX 3CCUN 4C11B 2VG6A 4ZLPA 3AGRA 4B3MK 4E1NA 1TL1A 4ETZA 2FGOA 3SCXA 2XS2A 2FY1A 2CNNB 1T9TA 1X4AA 3HFVA 1K1SA 4C3LA 3RB4A 3OSPA 3ULHA 4XDDA 4NZ0A 4UARA 2B5JB 2BZ2A 3PFEA 4YFKA 3H46O 4RNOA 4BRNA 4NX9A 4YD1A 4E7KA 3KJVA 1WN7A 2FQQB 2OPSB 3FEZA 2BJDA 2ZUBA 3FZMA 4CHYA 2F9DA 4CZLA 4KFBB 2ZKTA 1HMVA 3RW7A 2P66A 4UQGA 1M90T 5AXNA 2VC0A 2MKCA 1ZM9A 3HXMA 1GOAA 4ICLA 3Q2SC 1K9MT 4FKXA 3BS7A 1XJWB 2IBKA 8ICBA 3M2RB 3QWUA 2NV3A 1QQOA 1XERA 5CYMA 3HSTB 4ZCMA 4Y6IA 4LH5A 4RW4B 4QZ8A 5D4NA 2HF3A 4KLTA 1RTIA 3J81U 1HBMA 4CW7B 5AK5A 4IRDA 3S01A 3VQ8A 1SV5A 5IFMA 1SL0A 2E8NA 3S41A 2RF2B 4I2GA 2APOA 2CGJA 3C28A 2ACMA 1RXWA 1FDAA 1X5TA 2VU5A 2K1RA 3HKWA 4U6PA 1IBCB 2KZMA 3U1NA 1M6YA 1XR6A 4KH0B 4YR3A 5J2QB 3K0JA 2ZZMA 1LAVA 5KTQA 1NMEB 2CAJA 2ROGA 3CJ5A 3A3NB 1F9FA 3NGUA 3M9MB 2D6FC 2VBWA 1Q1KA 3ZT4A 1EWRA 3VESA 1TL5A 3IN5A 3CCMN 4KV8A 5CD4A 3LGNA 4JV5F 2BKEA 1X0FA 4EAHD 3J80O 5AICA 3ENQA 2BRKA 5BRDA 1N5QA 2QM1A 3SPZA 2WMMA 3UDCA 2Y9HA 3KLIB 2ZTCA 4WJBA 1N32F 2QA4S 4Q7AA 4RT3A 1R7IA 4ZP7A 5DZ6A 1YVNA 1YI2N 2Q3PA 1JB0C 2R7SA 1WHYA 5IIIA 3M32A 4DCCA 2C2NA 1FX4A 4FLUA 3G82B 2ZBRA 4DR6F 4QJFB 2OMOA 3ITHA 1KN6A 3PM9A 4LC9B 1RZMA 4QJVA 1QE1A 4WJ3B 3SQ0A 4ZVGA 1IXKA 3OXGA 1YHQN 2E6LA 1NK7A 4GKKJ 1DTQA 2EFOA 5BPLA 2YX1A 1TR0A 3E66A 4JV2A 2ZM6F 2EW9A 4CBXA 2VICA 3VERA 4DZDA 5AE1A 2NXUA 1HA1A 3U9ZA 5AFUA 4RX6A 2R8JA 4ZVQB 4JWMA 2MYFA 2E1CA 1HX1A 2FBTA 1K0VA 1KVIA 2UVWA 3O08A 4NLRA 4FKYA 1HJRA 3W2WB 3KG0A 3QGPA 4B3TK 3RMBA 2DISA 3DDNA 4JK8A 2O1PA 3TW0A 1W2BR 2DKOB 4LZGA 3TTFA 4FLTA 3I96A 3KVGA 1Y64A 3OFGA 4BRPA 2V8VA 4I28A 4C8LA 2ZD1A 2OPQA 2KJWA 4CO0A 2D69A 4NLGA 1O6XA 2MHEA 3MN9A 3FCHA 2KJ9A 1YXQA 1HFEL 5K14A 3IBCB 2ZC3A 5A6PA 1EXQA 3HKZC 2FB0A 2IIRA 3EPGA 4CIEA 2FF3B 4F5OA 1Z2ZA 2CPDA 3ICLA 1DK3A 5CZXA 5HR6A 4I2BA 2XG8A 1EX8A 1TGOA 2LYHA 5AQTA 1UVNA 4K59A 2HHXA 1BPEA 4KLGA 1TL3A 4A46A 1JXVA 3MEDA 2D4WA 2ZE2A 4USIA 1FT8A 1KOOA 4O0IA 3PX4A 5CHIA 6FD1A 1XMQJ 1MQ3A 5B09A 4GV9A 2LYVA 3H2UB 3OL8A 3ENBA 2EFGA 3KK2B 3TAQA 4Y65A 4NLXA 3C29A 5HANA 1V4TA 4YMMA 3QUTA 1FXRA 2JHEA 3FCWA 4JS4A 2B3TB 4PG6A 1HPMA 1WSIA 2MKYA 1S97A 3VPZA 4AFFA 2HURA 3TWZA 3WNHA 2B56A 2KT5A 8ICNA 3TU5A 3AA9A 5AJ3F 1T7PA 1MROB 7ICNA 2HHUA 1RILA 2W41A 3SFUA 8ICFA 5AQJA 3MHYA 1OH7A 1ZZNA 1YRXA 2UUBF 1VHFA 3M8QA 2G1DA 3KLGA 2NYHA 5IXUA 3RF9A 3ETRA 2PMZC 4K5RA 3KZBA 2A1BA 1RJJA 1WJ9A 1AFIA 4XPCA 4BDZA 5DDYA 2G2YA 1O0PA 4Y2KA 2FY8A 2EWHA 3ILLA 1VQ9S 1FIQA 3C7NB 4K4WA 2W8KA 2BV3A 3TSPA 2DITA 3LP1B 3O4QA 2Y1LB 1U24A 4MJKA 5LMUJ 2WOMB 1RB0A 1CS4A 4FZNA 2B4VA 4IG3B 3CCUS 4FF1A 2AQ4A 4AL5A 3J7AN 4JKAA 1N32K 4USJC 3MABA 2XBPA 5ITHA 1C1CB 4R63A 1EWQA 2DEJA 3H0LB 2JOQA 3JPNA 3R6MA 3Q2TC 4DR6K 2GO8A 2Q97A 3UB5A 2GJ2A 3FRYA 3H98A 3GL1A 5KFTA 5A0YA 1H0HB 3HHLD 1KWMA 2O67A 3T1HF 1S77D 3H3OB 2ZM6K 3GONA 3C6AA 1B64A 4F7VA 3WXJA 2CPJA 1T3QA 4K8ZA 5IWAJ 3R2DJ 4HVJA 1XBWA 4M3TA 4JK1A 2AYMA 4EP5A 4OV6A 3E51A 2P9KB 2RQ4A 1R8BA 3LUYA 2G06A 1UCVA 3W1YC 5KT5A 1IBKF 4OZ3A 4ZIVA 3GBTA 3V9WA 4CH0S 2RHFA 1F5BA 4NA1A 3R1LA 4KE5A 5LSLA 4F5PA 3WX8A 4TU9A 3RJFA 2V8GA 2ACYA 3FFKB 3BYPA 5IIOA 4AQYJ 4CJWA 1MNEA 3IS9A 4R64A 1TK5A 4CLLA 5KAIU 4J7CA 1ZQLA 3FQLA 4NM1A 2DVIA 3ZZTA 1RG6A 2DGUA 3T69A 4WFNL 4KLJA 3BN4A 4PL1A 1LV5A 5I42B 3NBPB 5B0GA 4O8UA 4WFBL 4LRBA 4BCAA 1ZQHA 1S9EB 1TV6B 1TQLA 1GO3F 4LRCA 1PVRA 4F67A 4NCAA 3US5A 2DF4B 4KHUA 4B3SF 2A10A 2HBQB 4CK2A 1VRTB 3H08A 3OW2R 1ZQPA 4FVUA 3QLHA 2LQ8A 2V4JA 3CCMS 4K2JA 4NM2A 2F8KA 3LPEA 1DHMA 3CJSA 5KT6A 3RAQA 3QGHA 5L38A 1UEVA 2DNGA 5J0WA 1Y10A 2B51A 5AJ3K 2O8BA 4B02A 4GV3A 2P6TA 1NOYA 2KVCA 3F2DA 1L7OA 3FAHA 4IJAA 1D1UA 3BR8A 4L3KA 4UB1A 1DQAA 4WKRA 4QWDA 3RMAA 1KR4A 2YNFA 2UUBK 4CM2A 2ATCB 1YHQS 3TA2A 1RT1B 3QGIA 2DRBA 3EKSA 4B3RF 2GMHA 1ZD3A 3HRDD 2G2OA 4HI2A 5LL6d 4DL0C 1XNRK 3DEEA 3SDEB 3SMPA 3IRXA 2D5RA 2HFUA 2PY5A 4LIRA 1MWQA 2PYLA 1QQ6A 2ITGA 3IBPA 4I29A 5KFFA 1ZC6A 3UXOA 1PJ6A 4UY8O 2C3PA 1RWMB 4KIAA 1RDCA 3OPKA 2FLNA 1CBKA 1RHQB 2J76E 4C80A 4CJSA 2KXHA 4F8RA 3CJ8A 1HRHA 4IKAA 2RQCA 3PLAA 4B9MA 4DCHA 3GG4A 2CQHA 1ASWA 1RT4A 5AI0A 3U4LA 3OYKA 4KO0B 2MKKA 5DLFA 3KLFB 4ID5A 5DBCA 3NS7B 5AK4A 1XMOJ 3OSNA 4Q5VA 4NLBA 3BEXA 5IILA 3NWRA 1VJWA 2KG0A 3MPDA 2NR0A 2X1FA 3VEOA 3ADAC 3VF2A 3CCQN 5ETKA 1GOBA 1YJNS 3D2NA 1JLGA 2O01C 8ICYA 4LF5J 3BGUA 2FJWA 2KFZA 5KFOA 1ZD4A 1N52B 3VOVA 4OYAA 1C0UA 3R2CJ 3H8JA 4WU2A 1OPIA 4B3TJ 3DXSX 4UB4A 3CMEN 4W5NA 3U3YA 4I2QB 4CP5A 3GJRB 3PR5B 1JQGA 1IBKK 1QS4A 2QB0B 1HBNB 3IBWA 3W62A 4YVZA 1UJ6A 3TAMB 3B6PA 4RL1A 2GH1A 2JSXA 2IVMA 1WBBA 4P74A 1EETA 1PK1B 4M63C 2OD4A 1LW2B 2OZMA 3P5BP 1JMTA 5JS2A 2XEXA 4U67L 2FUG9 2Q43A 2RHKA 4FLXA 1RDDA 1F3FA 2N82B 4NYNA 2M9NA 4KMOB 4OJPA 2E1YA 1Q8IA 2N3LA 3MDQA 2KMDA 4NXNK 3EE8A 5IS2A 4M1KA 3KKFA 2VJUA 2X74A 3OT9A 2H3IA 2F8LA 1BPDA 4HHUA 1SIJA 3O80A 3C46A 2E2QA 4B3SK 4DI6A 4F50A 5K8MA 1NGCA 4FWPA 6FDRA 4Q2MA 2MZRA 1G1XA 4OJ6A 3HHLA 5K8OA 1H7XA 4RQ4A 1EARA 3DN9A 4WK3A 2G8VA 3VVUA 2WVEA 2M70A 4ZMMA 3MDAA 2HMXA 2ZIWA 2CPRA 2ZFHA 4AXJA 4A61A 2QFJA 3C14B 4ZPWR 2Y0SD 5B0FA 4AHVA 4OL8A 4PH5A 3D68A 1RACB 2RMLA 5HBMA 1LOTB 1JCGA 1L3SA 1UWAA 2BQRA 2J7KA 1Q3VA 4DR3J 1ZQSA 4QYZK 3LM2A 2AMCB 3I5AA 3ZSZA 3H8MA 5D6GA 3QYYA 1ZJMA 2ZHAA 4H54A 4B3RK 3FR0A 1D9DA 5IV3A 2B0GA 3M8SA 2ASDA 1GMWD 1XNQF 2HF4A 2CQ2A 1FI4A 2AYGA 5IT9Y 4DV6J 1HJOA 3L4BC 4JV5J 2YJFA 5CR0A 4BDYA 2OM6A 2PEBA 4FL9A 2EBGA 2IJRA 1N32J 1KXPA 4JI2F 2IOFK 4B9VA 3QEPA 5LSRA 3ZEUB 3V6DB 2OGUA 4HHHA 2VKZG 2G9OA 1QQMA 1U8WA 2YWFA 4CRXA 3WNGA 4FZXC 5HRNA 3CO0P 1TZ0A 3AD7C 2M52A 1HQEA 2JDJA 2WB1F 3AMZA 3J7YI 3PY8A 3L3FX 9ATCB 2M7SA 5TZVA 3NS1A 1YTUA 4EENA 3GG0A 3JS9A 2HMPA 4OZJA 1V85A 3M30A 3LZJA 1N0VC 1SJRA 1YJRA 4OVLA 4JUZA 3QO9B 4WZMA 1LKYA 5F1XA 1X5PA 3EZOA 3CFOA 2KJ8A 4MDBA 3C2MA 2RKIA 2JZBB 2LXFA 3SLCA 1RAJA 1WG5A 4A57A 4CHQA 5KGWA 2ZIXB 4I2AA 4RO0A 3I55N 3FSXA 8ICCA 2P6UA 2ZZTA 3VAFA 5FDLA 3BBFA 1QAXA 5AQIA 4TQRA 1QQ5A 2EK1A 1RDFA 2GC8A 4PXDA 1S6QB 4CDIA 5JRTA 3GE1A 1Z6RA 2GVZA 2V8HA 3LL3A 1RCOB 1BU6O 3MXMA 4CHNA 1Z4NA 3EXYA 4CLTA 4FWRA 7ICHA 3A0BU 3VF4A 4B3OA 2O8EB 3TNVA 4K5SA 4USTA 2KKHA 4DPTA 3CCWA 1FEEA 2HGNA 4DTJA 2R42A 1TAQA 3HVAA 2G4BA 5FPDA 2PFOA 3W5YA 4IOCL 3B9JA 3QIPA 1I94F 2J8AA 1PYSB 3M8RA 2Y8WA 4DFDA 1W2BM 3DXMA 8ICTA 1EXNA 3R3TA 5DLGA 3DRRB 3M8YA 2VASA 4FK4A 2XY8A 4J37A 3RBEA 3Q8MA 4JOUA 5CZ1A 1VBXA 1SUQA 3BS9A 1U47A 5IIKA 3H59A 1QD1A 4F0MA 4HDGA 2W1BA 4NLTA 5E26A 3NXZA 1WI8A 4JI3J 1FCAA 2HPUA 1ECWA 4ECUA 3AQPA 4DTRA 5AJ3J 1VQ5N 5FRMA 1RWXB 3W63A 4DU1A 1WG4A 4QIWD 3C2LA 3SSRA 4J2BA 4I2EA 5CABA 3DRSB 5LOQA 4Z6DA 2UUBJ 3T5LA 4ILHA 1EQYA 5ALWA 1AFJA 4ECZA 5L39A 3CCQS 4H4MA 3VQ5A 4FJIA 4M5DA 5J2DA 4Z4GA 1RBTA 3KG4A 2OYYA 4IG0A 5AKKA 4HUFA 3MR2A 4ZTJA 4FS2A 2C22A 1ULRA 4YS2A 3MECB 3QNWB 4CTAB 3PSPA 5K4LA 2OPSA 3JAMY 3I4HX 1WCNA 4NEYA 1U2VB 3V6HA 2K89A 4TU7A 3MR3A 1UEUA 4EU0A 5DM6L 3IWLA 3C5FA 5IIJA 2HSZA 2E8AA 2QARB 3NY0A 3LVVA 4FM0A 1SJFA 4OJ5A 2AT1B 1YQHA 1TYQB 4B9NA 4CM0A 3CPWR 1FNXH 1S7IA 1H74A 3CJ4A 2D3UA 1C0TB 3GU3A 2NXCA 1BMQB 2BACA 1IVZA 2MQMA 1JLAB 1WAFA 3TZZA 3IDHA 1RLDA 2IJNA 3IWXA 4KHPF 3T1HJ 2PT0A 3ATUA 4FWOA 5GAGP 3G25A 3H5XA 2I0XA 1IKYA 1QLNA 1PC5A 4DFPA 3QEVA 2RDDA 4I6YA 4DFKA 3NCPA 2RF2A 2QA4G 2P9UA 4NLVA 2YX6A 4PKHA 3D0IE 5M1PA 3FCVA 5EXWA 1IBKJ 3J7ZO 8ICVA 1ZPWX 3OYEA 3VGSA 1HNIB 2MQNA 3CC2S 3M1VB 1NKCA 2CH6A 3GIMA 4O23A 4KHRA 2B7BB 1TVRA 3GYNA 4MYUA 4BACA 1ZTTA 1Q8LA 1FFGB 3BGOP 2FJDB 1IG9A 1VQON 3HZ6A 1JJ2R 4WCEQ 1GOCA 4IZ9A 1KBUA 2HDOA 2XC9A 1RYSA 3FZBA 4X66J 1ZQZA 3D1QA 5CP2A 1ZH5A 1SKUB 4EGLA 3CJKB 2XLKA 1DTTB 4DF4A 4KTQA 3CF5Q 2GQQA 3HVTB 2V67A 1Z19A 3KHRA 1JLCA 3CJ9A 1ZXIA 1R3NA 3NMRA 8ICHA 1I94K 3ULDA 4LZDA 2VPWB 1QH9A 3GIJA 3THYA 1X4HA 1R31A 3ZSWA 2DCUB 2K8CB 3CD7A 2L9NA 4IRCA 1NU0A 4A8FA 4GXIA 2IM0A 1ATSA 2Z1IA 4PJ0U 3T6BA 2NYIA 3EN9A 1FTRA 1BIUA 2QW9A 4Y2IA 4TY8B 4FPAA 3NH2A 4DN0A 2QEXN 5CQGA 3D2EA 2D3ZA 1WEXA 4DTUA 2WC9A 3K57A 2YKQA 1DAXA 1BUPA 3MCMA 4QWCA 2PMHA 4CGZA 3SUPA 4GC6A 5J2NA 4FBTA 2DNHA 2VIXA 3NF7A 4DQRA 1O1WA 3AQFA 3MGJA 1URJA 3FVYA 1N5TA 4PPZA 2EEYA 1UEKA 3IAM9 3QEBZ 2CQ3A 4BLGA 4RNFA 5BN9A 1U04A 1JLQB 5J1EB 5DZ7A 1C1BA 1NGHA 1JXEA 5AQMA 4IH7A 4QR2A 1TUVA 3T6JA 3D4JA 4MFBB 2AEFA 4WF9Q 4KBOA 3R9LA 1Q8KA 4O5FA 2FD2A 3H7HB 3J81Y 3J7ZT 2QZ8A 3GILA 3UKRA 1RHKB 2HZVA 4MAKA 3OXFA 4OX9F 1WG1A 2D3O1 2WB1C 5D49A 2JH3A 4PWWA 3EXCX 4C0BA 2YX8A 2HS4A 4ZK7M 3JTPA 4DMZA 3UCUP 1UVLA 1RT2B 3I55S 1YBUA 3LF0A 4KX5A 2I5HA 4XQ8A 4DFMA 1MN8A 1MQ2A 2H1YA 3VA3A 1S1XB 1GLFO 4FM2A 4OI1A 3KK2A 5HMMA 4KGXB 2HAIA 1TFWA 2HBZB 2KYZA 1TK0A 4URGA 4GVLA 1KVAA 2A42A 3RWUA 1O5JA 4PL2A 1TL7A 4KTWA 4XTTA 3SAGA 1UOCA 4DBQA 3CD5A 1MROA 2QA1A 1Z3EB 2KG5A 1NK8A 1RBLA 5DM7L 1NNEA 4RW7B 5EHHA 1NNLA 3SYZA 4DUYJ 1I5OB 1T44A 2IOHA 2OSQA 1K8KA 2VQFF 4G6VB 3DRPB 2E66A 1FJEB 4I67A 2Q36A 2ASMA 4J90A 2N4CA 1LXJA 4ED1A 3N5BA 2F9JA 1OY9A 3ENAA 5ETTA 1SL2A 3ZO7A 4JYAF 1OVQA 1M5PC 4K2XA 1HWIA 1BGXT 2BW7A 4OV1A 5HOOA 2NLXA 3UE2A 1CQNA 4LF7F 2G8IA 1SB3C 1HEKA 3D6MB 2DTJA 2RS8A 3N4PA 4USUA 4ECRA 1FRIA 4P4PA 1OXJA 2MZSA 1BUXA 4I56A 3FQKA 3N4MB 2BM0A 2BGWA 1SBRA 4Z0UA 3WQTA 3V9ZA 2YNGA 3D67A 4ZPTR 1IWAA 1PCAA 3KK1B 3H1VX 1D4XA 5C2DA 2KE7A 3ZZOA 3ZCMA 4E1JA 4B08A 2HNDB 2VONA 5BR9A 3KHGA 4FVMA 3ISND 3KK3B 3Q8UA 3H42A 5KL8B 3BBBA 1NHUA 2KU7A 3L0QA 1UZHA 1KP6A 1RGIA 2QSWA 4FYWB 2V34A 2OFGX 4DQSA 2HWHA 3O6QA 3LZIA 4Y2SA 3OTEA 2YVSA 3MN5A 4DTOA 5IINA 4KAZA 4E0DA 5DS7A 4KQZA 4NLCA 5A0LA 1UAXA 2W3SA 4IH5A 4DV1F 3VZIA 2HHHK 3E2EA 4C48A 3M8ZA 1JLFB 2KHOA 2YCHA 4IC9A 4B1WB 2WSEC 3TQ1A 5GINA 4YMOA 3JSYA 2F4VF 3BGLA 2KKPA 3M7VA 3NMAA 4A47A 3P5JA 2GA7A 3R6GB 3N6NA 3TX0A 1XNQJ 3R7BB 1NZAA 5A2QY 2RDJA 3QNMA 1N0UA 3FFIA 4OX9K 1VSDA 2VFSA 1I39A 1S1VA 4CD3A 4P2MA 4JI2J 3Q23A 5B0AA 5I42A 3NBPA 1FKPA 2QLJB 4DCJB 1TV6A 4M5JA 1QUVA 3FKBA 3H40A 2JLEA 1JLBB 4YOEA 4LF6F 3JSRA 4YB7A 1ASVA 4PRFA 5HROB 4ELTA 1VSKA 4DX6A 3W9HA 2YQ0A 1UP1A 2MQOA 5AT1B 3LP0A 4ILJA 4ZPVR 3OGUA 4KI4A 5GADU 3QZ8A 3VQPA 1HKBA 3ULEA 4I0WA 1NCLA 1GX6A 1Z00A 2X1GA 4RBUA 2WFBA 5ALSA 2DGQA 4XK8C 2ZXHA 2P9GA 3M8PA 5D0GA 2V5HG 4TSXA 5ETRA 2F1IA 4LSNB 5GIPA 1T3NA 3R5GA 4EEYA 1VISA 2JH7A 5G0RA 4J2AA 2XICA 2XI3A 2M0GB 5AIBA 1BD6A 3QESA 1C2PA 1KC8O 2G5HB 2YB4A 3GDXA 2F65A 5D4OA 5A76A 2DGVA 2DY9A 4ID8A 4DB3A 3BF1A 2X51A 3WQPA 5J2PB 3SUQA 2OTJN 4JYAK 4QZHA 4PABA 4FLVA 5KFQA 1U2FA 3Q8RB 1XHXA 2LQ9A 3HD1A 4YUDA 4HWIA 2ZOFA 4CH7A 4LF7K 1WACA 1I94J 2KH9A 4QWEA 3RMCA 4WWSA 2FJBB 3BV8A 2EZXA 4CLWA 5K20B 1N48A 3SFGA 3I5CA 1OY8A 1SJQA 2WF9A 1BNOA 4X4OA 5DO2A 4OYIA 1YK9A 4NYZA 5IV4A 2ABYA 2VKQA 2ZJRL 3AVJA 3MD3A 3CCTA 1EKEA 2KT3A 4FN5A 5IZHA 4R65A 1LK7A 2RS2A 3D2FA 3CB4A 1HKGA 4MF2A 1GMVA 3O4NA 2SXLA 2WAQF 1Z1VA 3VGKA 4Y2VA 3A5OC 3ZDEA 3RJJA 3DU5A 5ETSA 4MH8A 4EO8A 2GWKA 2GELA 4DQPA 4I2QA 3K8VA 4MFCA 3FC9A 2Z2LA 1RKJA 3ENVA 4BC7A 5AR0A 2RH3A 4DV1K 4YY3F 4DSKA 4BC3A 1D8LA 1HPZB 4KRFA 2RVJA 2QN6B 5H9EK 5AKZA 5DB9A 4QS9A 1P8GA 2E7XA 2HMIA 5C10A 1JJCB 3C19A 5JVHQ 2B8QA 3M2VB 4NXMF 3GCXP 1RPLA 1YWXA 2EHGA 1UCNA 4I9LA 3VCBA 4RW6B 3CJ1A 1LFWA 4F4ZA 1KC8T 5ELZA 3M5RA 3CJ3A 2JMGA 1NSAA 3B54A 2KEYA 2K2PA 2Z56B 4CCHA 3RAMA 1VK8A 3HULA 2MY8A 4A5AA 3ZTSA 4Y00A 4R0EA 3I5BA 3NLCA 5F3TA 8ICQA 2BJ8A 1RTDB 2R2UA 4F4AA 3CJCA 3KLEA 2W04A 1CPZA 4KHPJ 4FLZA 4BR2A 3BQ2A 1ZBTA 3BDPA 2M0NA 2NUHA 1YJVA 2DHHA 4OHYA 3H90A 4OZ2A 3S6JA 3LGHA 3EGWB 4EELA 5FJ4A 3V9UA 1QAIA 1DT9A 3PKMA 3PKYA 2EK6A 1LWFB 5IT4A 2ZVIA 4ED4A 1R8CA 2GO7A 4XDCA 5MLCQ 4DOCA 2CJ9A 3CPWM 3MMCA 5F0XA 2KI2A 3CIZA 4JNEA 3BQTA 4C6AA 4LFBF 5KFIA 5AM2A 2UVUA 2MLYA 2AJ0A 4R5PB 3JXOA 7ICJA 4CGJA 3AO5A 1YTAA 3K5NA 4CJ5A 3QT5A 9ICUA 7ICKA 2IY5B 3AARA 3UNYA 1HBUB 5KGXA 1DGJA 4WKYA 1MA9B 1TAUA 4PHPA 2JZ5A 2P5OA 4HYKA 1WSEA 5J0TA 4FO6A 1TUWA 3BQ0A 2BDUA 4BGDA 3F2BA 1JRPA 1SPBP 3MAQA 4XPEA 3C6HA 5CZVA 3GV5B 3MGHA 2VBYA 2LYBA 5JUMA 4P4OA 3MM6B 3AVGA 1DQ8A 2WBRA 1YJ9N 3SZ2A 4WFZA 3T9NA 2FSJA 3IR7B 4BRMA 2E88A 1JWWA 4JKCA 1JJ2M 3FEXB 3FSIA 2BKNA 2OEHA 1OS5A 2ZWPA 3KYLA 4DOAA 2Q0RA 1F21A 4RBVA 2K06A 3AA5X 1NKBA 3HZGA 3SQGA 4I6MB 3VQSA 1QUPA 2GWJA 4QIEA 4ISFA 2HHTA 3BKUA 2DJWA 2FC9A 2XGPA 3SEIA 4CNQA 2Q0ZX 5KOXA 3RUBL 1YT3A 4NMXA 4RJVA 4KKOA 1WSVA 2ROEA 4RPFA 2XLJA 1VRUA 2UXBF 4YY3K 4KR0B 5KPRA 1SI9A 1FRXA 2GUIA 3BZQA 2XLIA 4NXMK 4OX9J 3TVZA 2J0SD 2ZQBA 1GXTA 1LWCB 1V97A 2AJ1A 1X5OA 7FD1A 1A77A 5C24B 5SZTA 3WK6A 4WQ5A 4CDGA 1Q5VA 1NDPA 4F4YA 3OUYA 1D3WA 2VOOA 4C7ZA 4TYBA 1N36F 4ZVHA 4NLWA 3DKDA 2MQ8A 3I0SA 4JI8J 4F0HA 4IJNA 1IBMJ 3FLCO 3TAPA 5AE2A 1X4CA 3CI5A 2VQEF 1VR6A 2MEWA 2DNQA 4WXOA 3G71S 2P5VA 1J5OB 2NPFA 1QAJA 4OJRA 4N5SA 1WCLA 2GGPB 2JEGA 5IM0B 2CJQA 5D4PA 3A8JA 4OMFG 3IDWA 2P9CA 3C16B 2B7CB 3M9OB 3EEQA 4BY9C 5K8NA 4EEKA 2B4JA 4AYBD 5HVFA 3CDEA 1VQ8S 4OHWA 3MMVA 3LWLA 2HBJA 2MDAA 5EE3A 2ASJA 4QIGA 1VS3A 4CO1A 4ILGB 4LF9J 3D1OA 3ISDA 1NUEA 3JQMA 3ZXWA 2OFHX 3UIQA 2DR9A 2R7RA 4JI5F 3AHPA 3TVYA 2VQFJ 4J9OA 4I6AA 2HAFA 4LFBK 1ATNA 3PIPL 4DQ8A 4WFAQ 4G9BA 1YKWA 4PQUA 1VQLN 2KJ5A 5AQXA 3OA9A 1R8PA 2XHBA 2JLGA 7ICEA 5ALJA 1FO4A 3W64A 3ID6A 4CTAA 3MDCA 1UWBB 2BM1A 4F04B 2H3VA 2KSOB 3LDNA 5DB6A 1VC0A 1APSA 4WXWA 3PSTA 4M3XA 4MEYA 3WDOA 4UB3A 2QGFB 2H5EA 1S0NA 4UBCA 3Q8YA 2OTLS 4WYLA 5DDRC 2I38A 4YOUA 3KZIU 2CPEA 2ZBCA 1ZQVA 5DG9A 3L2WA 4X2BA 1RISA 3TEHB 1TYQA 1FEHA 1NGBA 3EZ5A 3ZETA 1IG8A 3G4SS 4ZVSB 4E98A 4KBIA 1R8AA 1WNSA 3W3SA 3CUNA 2ZNZA 3W65A 4OYXA 1K6YA 1RWOB 4JI4F 2BVZA 2HEKA 2CJYB 2GW8A 3FDSA 4GO5X 3H1QA 5DMRA 2G8UA 4ETXA 1ZETA 4X5VA 1JMSA 4NLZA 2V7YA 4MQ3A 4X62J 1ZTWA 1KD1O 1X0PA 2L3MA 1XWLA 4TVAB 4J9UE 1ITGA 1OO0B 1BWFO 4MN4C 4FNIA 3G9CA 1JKHB 2QSFA 3GR0A 1ZQWA 2R18A 1GLEG 4DV1J 4I69A 5ETNA 3SPYA 2ZH6A 3L09A 4K0KF 2VPYB 4DR7J 5LM7E 3OTOK 3JTNA 1BI4B 2JHDA 4W90B 5IC4B 2F4VJ 1HR0F 1BY9A 1RAOA 4OI4A 3CM5A 3VMFB 1Z1ZA 2I8EA 2DNMA 3K89A 3V7JA 2A19A 3FBEA 5D3GA 5KAFU 2ADCA 3VF6A 1D5AA 2NRHA 4GVMA 9ICOA 1KLMA 4J9PA 1OH5A 5L1LA 3ZZRA 3CJKA 5A8RA 4ZDNA 3CJBA 3DLEB 1DTTA 4BREA 3EY1A 2F8MA 2V9KA 3AY9A 3J7YP 5BR8K 4NZ7A 3CCLN 2RU9A 4FE3A 5FROA 4Y1CA 3WX4A 3WC2A 1N36K 2IHNA 3S1TA 4P75A 3L2QA 1YX2A 4QCLA 3CC7S 2GJIA 1B0TA 2PC6A 1HNZF 4IXCA 4CYUB 2BKOA 3W7BA 2VQEK 3ZDAA 2HIQA 4LF6J 1OJ4A 5K5MA 4Z4CA 2KFYA 1XO0A 2QWPA 3MX5A 6AT1B 1BPZA 3A8KA 2IJFA 1P9YA 3O3LA 4Q0BB 1X4EA 2WB4A 2UP1A 4X4PA 1U4BA 3UXPA 4ANCA 5HP1A 2ZJPQ 3RTVA 2R2SA 2VG6B 4M95A 3QEWA 4QZEA 1TL1B 2OJ3A 2H3FA 1U49A 3HOTA 1T94A 5ALHA 4Z94A 2OEJA 4O5EA 2QLTA 2RQ5A 5JICA 2DR6A 2KHCA 3AVCA 4GXJA 2HSTA 3AVNA 5KG1A 2ITMA 3T5KA 4C8NA 1BPBA 5DB8A 1X5SA 4NYFA 1YJ9S 1ZA1B 3HHNB 1Y9OA 1EB0A 1U45A 4LQ9A 4BHQA 4I2PA 3VC8A 3NGDA 3LALA 4UOCA 2HQDA 1CULA 1KQSR 1SJ1A 1ZS6A 5L46A 2WVFA 4PEOA 2VCPA 5HRRA 3WK9A 2XY7A 3NVKA 3ZT2A 3KG1A 2ZTDA 5GVQA 3ALRA 1HMVB 4KLIA 3MK6A 3GE9A 2DGTA 5J2AA 2PD1A 5KFCA 4JRQA 3QNOA 2EAMA 4OYWA 2QKBA 5T7LB 1ZRNA 3N0VA 5BYQA 3T41A 4O5KA 3SQOP 2YHWA 1HBOA 4J9RA 3OTCA 1RT2A 3BH6B 4URQU 4H0OA 1M5SA 1GT8A 5G5HA 1MMDA 2FHOB 3D6FB 2QXFA 3WK5A 2H48B 3W8GA 3LP2A 3HT3A 4PUOA 1TUUA 4ILMA 1RTIB 3QICA 1HBMB 1Z2LA 2YH1A 4F71A 3AA2A 1VQNN 1UFKA 4Y2RA 3T5JA 4YB1P 3EWGA 4JI4K 5IT0A 2E7VA 5HL7Q 2EVZA 1SQKA 3ETMA 5IOLA 3GIRA 2B0CA 1RAGB 2W54A 1FW6A 3Q83A 2K1RB 4O3SA 3DLKB 4CJ4A 2BQ3A 3K1RB 5HMXA 4RW7A 2DY4A 4C1NK 2RLTA 2QK9A 2DRAA 3DLLL 5H1SV 4M04A 3MOZA 4LT6A 4H4OA 3KLHB 4KLHA 3V72A 3L7OA 1U0SA 3DRPA 3DWLA 5F2RA 3WXLA 3S8SA 1RDAA 5AM1A 4YY3J 3A0HU 4X4RA 3KZXA 4C0ZA 7ICSA 4KV8B 4K0KK 3VQEA 1K8AT 3OFHA 3M7DA 4A59A 3SXLA 1HR0K 4NXMJ 3T7ZA 1K1QA 1Q86O 1RT3A 2N7YA 4J03A 2MQLA 3SCLE 4DV0F 1VSHA 3M32B 1H73A 1GNKA 4WP9A 2EKNA 5CEHA 3ITHB 4FJKA 3HVRA 1QE1B 1WG8A 5BOLA 5E3AA 2B9EA 5J29A 3DNCA 1DTQB 5AQUA 1X66A 3KK1A 4Y2PA 1S10A 1QVFR 4BRDA 3CCRN 3PTWA 3UMCA 7FDRA 2HQ3A 2UUWA 1HNZK 5IT9O 3AVBA 2EDUA 2HGMA 5HI7A 3I0RA 1S0OA 3H45C 3CIMA 4K4GA 4L3QA 4DKWA 2XS7A 1BNPA 3RU0A 3EYZA 3CD6N 1H2VZ 5D4BA 2CNKB 2ZD1B 1N6QA 4UASA 1KFTA 2PFNA 3IHQB 2I2YA 4JHDA 1WUDA 1RP5A 2JNJA 2XS5A 4OZ1A 2A0FB 3QX7A 3M6XA 4K25A 4LFBJ 5K14B 1XSLA 2J9DE 2KLAA 3SBTA 4X4TA 4MDAA 3KD3A 1MW7A 1WELA 1VC6A 1N33J 2RD5C 3MWTA 1XEZA 5BN8A 2F5GA 2ZEJA 1PYTA 1HI0P 2DGZA 3CTRA 3E3XA 1J2MA 4DPWA 1QVGR 2GZOA 3GJTB 3K5MA 3RBZA 2WTFA 5DBAA 4E19A 1TL3B 4DUTA 1H2TZ 3MEDB 2V94A 2B43A 4BRFA 1KSPA 2EWSA 4OJ1A 2RILA 4M5LA 5HRPA 1FK9B 2QTDA 3GMGA 4DV5K 4J91A 3CD0A 2IMOA 1FFVA 1Q86T 2XY5A 2K7KA 2BYCA 4Y2UA