4F2RA

Dna polymerase i large fragment complex 3
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
578
structure length
578
Chain Sequence
MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 202
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2rA01
5KGXA 3Q8QB 1JLEA 2XCPA 3V7LA 5DDYA 3C2LA 1QHTA 4B3OA 3PMLA 5J2QA 5L1IA 4WE1A 3UQ2A 4DQSA 3QO9A 1XSLA 1B22A 3WNFA 4C8NA 3LDSA 2X6SA 4OPJA 5CWRA 2IAJA 3CQ8A 1ZQOA 1S76D 4RPYA 5FDLA 1C1AA 8ICUA 3JPPA 4GXJA 4I2GA 2HHTA 3O3HA 3RH6A 3AV9A 1RTJA 1MQ2A 5KFVA 3V9UA 1BVSA 4OLBA 5DB9A 3OJUA 9ICUA 4O3OA 3NGZA 4PPXA 5DQIA 1U49A 7ICTA 2HNYA 3CFPA 3RTVA 4R63A 4W5RA 3AVCA 3IM1A 1PZNA 4F50A 5D46A 3AU6A 7ICRA 2KZZA 4NLNA 4UB5A 3T19A 3KKSA 2R8KA 3AVLA 1DTTA 3ZT2A 1BL3A 3P5JA 4YVZA 4ECZA 2QK9A 4ZTFA 3LP1A 2EHGA 4CGJA 2HHWA 5KRTA 2OYQA 1RDCA 3DLBA 2I5JA 2BE2A 3C5FA 1ZQMA 5DG9A 1VSMA 4DTRA 3MGIA 3NDKA 1R0AA 4CIEA 2D0AA 3L3VA 3L2RA 4FLUA 2X6NA 3AA3A 1WSIA 4B8AB 4CEDA 5KG5A 3M9NB 1HUZA 3EPIA 4E7HA 4FJJA 4RQ7A 4P2HA 2JEFA 3ISDA 5HP4A 2YHAA 4NYNA 2RDIA 4B08A 3VA3A 9ICRA 1ZQBA 3C94A 4FJNA 4C8MA 1Y97A 5DBAA 1KLMA 1A5WA 3LK9A 2PFNA 4CHQA 1LB2B 1ASWA 5J2MA 2ASJA 3V9ZA 1KDHA 5KTQA 4F5RA 4AHSA 1YVUA 2UVUA 5SZTA 1HUOA 1ZQXA 3V72A 1QS4A 1WSFA 2FPMA 4FW2A 4CGFA 4OKKA 5J1EA 3F9KA 5J2CA 8ICCA 9ICAA 4KI6A 1ZQZA 3UPQA 3ZDDA 4ED0A 5CP2A 4YFKA 4YR2A 4DFMA 2BQRA 4FCYA 3IHQB 7ICMA 1B43A 3HPOA 1RXWA 2HB5A 4FLWA 3OYBA 4IQWA 3ZDAA 8ICQA 1LAWA 4FJ7A 3DLEA 2KZMA 4X5VA 2KFNA 4IQVA 3LP2A 4M3ZA 4C8LA 5C5JA 4I2HA 3RMDA 3WNGA 4CEFA 3MEEA 4FLVA 3VQCA 2FLPA 2UVVA 3V6DA 1NOMA 2FMQA 4F92B 4KLIA 3B6PA 1NK9A 4E89A 2W9BB 3V6KA 5J2JA 4DL3A 2G8FA 5KFBA 3TANA 3PW5A 1XSPA 5KT3A 3DOLA 1IKWA 4HUEA 1CZBA 1JMSA 5CB1A 5I3UA 4J9OA 3SI8A 1EKEA 2FLLA 2VA2A 1KVAA 1HNIA 1S1UA 3M8SA 4M47A 4KLDA 2XHBA 4E0DA 4JWNA 3LANA 4EYHB 3L2VA 4LZDA 1DLOA 4ECUA 2WOMA 1KFSA 1SL1A 1NJXA 4RZRA 3AO4A 3MR5A 4NCBA 4J9LA 4I2AA 2FLNA 1EXNA 2ETJA 8ICBA 3HPHA 3LZIA 2XY7A 2HHXA 4PHEA 4EP5A 4KFBA 3GV7B 9ICSA 1JLQA 2A1SA 1SZPA 4XIUA 1K1QA 1O1WA 1ZQPA 3QNOA 4F2RA 4HHTA 4GLXA 5EWGA 4KHQA 4BGDA 4JV1A 4YN4A 4KLFA 4RQ0A 1SL2A 1RBSA 1T4GA 1RYSA 3NF8A 1BPEA 4AILC 4F5NA 4ED3A 4XUSA 1BGXT 4HUGA 4F5QA 3JYTA 1BCOA 1TKXA 3AO2A 1QSLA 3AO5A 1BPYA 4QW8A 4FLZA 3BJYA 4DFKA 4TUPA 3GV5B 4DTXA 5J2NA 3H8WA 3CFOA 1C1BA 4M6WA 1S10A 3OYJA 5J0UA 4M3XA 3OSPA 4FBTA 2ZTDA 3S3NA 4FM1A 4Y1DA 2C2DA 3C2KA 8ICHA 1IKVA 3G0ZA 4H8KA 4CIGA 3S3OA 4GC6A 4FO6A 3VQBA 3RWUA 5KFQA 1IXRA 5CHGA 4FBUA 1S9EA 4FLXA 1ZQTA 1S9GA 3PR4A 4IFVA 1N56A 3ZT4A 1ZQCA 4MF2A 3B0YA 8ICVA 4DSLA 4W5QA 4M04A 1LWFA 4JS5A 2ITGA 4PQUA 3F73A 2NUBA 4YMMA 4M0AA 4ZTJA 2B4JA 2ZUCA 4FJ9A 1XO1A 4KLUA 4O5KA 2KW4A 4RW9A 5FRMA 4O44A 3RRHA 1TV9A 1U45A 4Z4CA 3K59A 8ICXA 3SNNA 3K5LA 4CJSA 4J9KA 5CR0A 4KTWA 1A77A 1Q9XA 3V6JA 4CFDA 3VQ5A 2FPLA 1L3UA 3JPNA 4CJ3A 4ICLA 5KFPA 4F4YA 4BWMA 1X9MA 2GUIA 4FXDA 4QZBA 3RR7A 4CJLA 1RXVA 3RJJA 4TSXA 3NBPA 3DRRA 2XGQA 3RRGA 4DQIA 4M45A 3OYNA 3PW7A 8ICTA 3V9WA 3H4DA 3NFAA 3LPTA 4YD1A 3PX0A 3ZSZA 3ISCA 4NLGA 4ELTA 3NCIA 5L1LA 1XSNA 1ZBHA 3AVMA 1TKDA 2G8VA 1RTDA 4FZYA 4OLAA 5KG7A 2BANA 4HYKA 3ZT3A 5DGBA 3S9HA 4QZCA 3THVA 1EXQA 5E41A 1S1XA 3ISNC 3TFRA 3VQPA 4W5TA 1DOQA 3AO3A 2GV9A 2H5XA 1RDAA 4I2CA 4ELUA 1S6QA 4FJGA 1JLFA 1JL1A 3AA5X 4FZXC 5KFYA 2O4GA 1IO2A 3GIIA 4DL2A 2HMIA 1CUKA 4UB4A 4J2BA 4YMOA 4IQUA 2O4IA 4DTJA 3RJEA 1VSFA 2W9MA 4TUQA 3SV3A 1WN7A 2FMSA 1JLGA 4FM0A 4FJ5A 2XGPA 3VQ6A 1MU2A 4O55A 3VQDA 9ICGA 3MEDA 4UBBA 4LSLA 1YTAA 1CLQA 4IR9A 3C1YA 2PYJA 3OYLA 2PY5A 2PXIA 3H7IA 2YNHA 3O3FA 4NY8A 2W8LA 3A2FA 4I28A 5DB8A 2BGGA 3JPQA 5KFJA 4RUCA 8ICJA 5L1JA 4FJ8A 3VQAA 2J6SA 1D9DA 1RT1A 3C6TA 4DL7A 3Q8PB 2LSNA 4LH4A 5KT5A 9ICQA 4AHCA 4E7JA 3EZ5A 3L2QA 2ZJ5A 1NKEA 4HTUA 1RT2A 3VQEA 4I2PA 2YV0X 3WNHA 2MAXA 2BPGA 4DTMA 4H4MA 3Q8LA 4M41A 4M6WB 3KLIA 8ICFA 2AGPA 2F1IA 1TK0A 1NOYA 2KFZA 1H38A 3PMNA 4DTOA 3HPGA 4KLTA 5IIMA 2JZBA 4KITB 4N47A 3QEVA 4F3OA 1SL0A 4KTQA 4MFFA 3B0XA 4JV0A 5JUMA 4CHOA 4ECSA 2LYHA 1HYVA 1JIHA 1WSEA 3M9MB 2KZ3A 2BCUA 3NF7A 4CJPA 4HUFA 1JKHA 5KT4A 4AHTA 5DG7A 3ISBA 4RPXA 1VRTA 1RT7A 4Q45A 3OGUA 5KT6A 2HNDA 4QWDA 4QZAA 2ASLA 4PGXA 2W9CA 3U6FA 3AU2A 2ZUDA 5HROA 2DPIA 3SUOA 8ICWA 3RJKA 4ID1A 4Z6DA 3PW2A 3LPUA 1GOCA 4J9QA 3PNCA 3BQ2A 4CCHA 3KK2A 2PI4A 4NXZA 1RTHA 3HVRA 2ZJ8A 3KD5E 1WAFA 4CHZA 4XRHA 3HT3A 3ZSOA 5KFNA 5I42A 1KCFA 1ZQNA 1UA0A 4RQ5A 5J29A 1X2IA 9ICOA 2UVWA 4IRCA 1ZQAA 8ICAA 4W5OA 2P6RA 5DQHA 4M3WA 4O3NA 5J0OA 1JLBA 1REVA 4FJLA 3RAXA 1QLNA 1NK4A 1BPXA 3G6XA 1HYZA 2J6TA 5J0YA 1VSEA 9ICLA 4JWMA 4F4WA 4JRPA 2ASDA 4O3RA 3MR2A 3QEIA 4RQ3A 4M9NA 4QWCA 3VQ7A 4MF8A 1KTQA 4KAZA 3NHGA 1ZQWA 4EBEA 3RH5A 1FKOA 1WAJA 3JPTA 1RDDA 1L5UA 5J2BA 1UWBA 3V1OA 1U4BA 3ZSWA 2OPQA 3ZDCA 2RN2A 4CERA 4DOAA 3UXPA 3HXMA 1T05A 4GVMA 2G8IA 4I2BA 3G10A 4RT2A 4F5OA 1S1VA 3CYMA 4KLHA 2F96A 4XA5A 3K75D 3C95A 5CYQA 2OPSA 3L2UA 2DPJA 2ATLA 1TFRA 2AU0A 2DFLA 4J9RA 4CF8A 3MFHA 5KI6A 4UAYA 2RKIA 4RW8A 4NM2A 3BDPA 5KFTA 3HX0A 1KLNA 2IHNA 3HL8A 7ICPA 4CK2A 4QWAA 4B9UA 2NRVA 3JPSA 2BCSA 4KLJA 9ICHA 3DI6A 2GWSA 1ZQJA 3V1RA 9ICEA 4BACA 1ZQUA 4C8OA 2BCQA 4F8RA 3K57A 1ZQYA 4OJRA 2DFFA 4RW4A 4IQTA 4QWBA 4ED6A 4YP3A 4HCBA 5JS2A 4M2YA 2W9AA 1L3VA 1ZBUA 1ZJNA 4CEZA 4CJKA 1TL3A 1BIZA 4KLGA 4BE0A 3AVAA 1MC8A 1KVBA 1WSHA 4B9NA 1YT3A 4TURA 1U04A 3OYDA 4DSIA 3EWAA 1G15A 4FW1A 3TWHA 2JZBB 7ICKA 1MQ3A 3TAEA 3ZSXA 3OYAA 4CJRA 3P83D 2AQ0A 4RPZA 2BGWA 1RT3A 1RBTA 3SQ4A 3MDCA 4I2FA 1MSWD 3FDSA 4I2JA 4M3RA 3ETLA 1U48A 1VSLA 2ZJAA 1JN3A 4NCAA 1UOCA 2ZQBA 2VWJA 4CJVA 3QIPA 1XC9A 5DMRA 2X74A 5IIJA 4CK1A 3KLHA 2W9CB 3OYIA 3SI6A 4GMJB 1D8LA 4DOCA 5T7BA 3BQTA 3UXOA 3IRXA 4CJFA 1BISA 4R64A 1TAQA 1RYRA 5D4BA 1TK8A 2BDPA 4E7IA 4CFAA 5DK5A 1Q9YA 1IKYA 4CIFA 3K5MA 2GBZA 1V9PA 4FVMA 3ALYA 2OWOA 1KVCA 1TV6A 3NTUA 4F93B 4O0JA 3DMJA 3QEBZ 4Z6EA 1HMVA 1RDBA 1UT5A 5DB7A 3SUQA 4ID5A 5KG3A 1FK9A 4R5PA 3Q8RB 2OZMA 1ZQKA 3C6UA 4J2DA 8ICGA 4CGDA 4KRFA 5HHHA 3S3MA 1KFDA 2XRIA 4FLTA 1RT4A 3RMCA 1D9FA 2QXFA 5J2IA 5CJ7A 7ICIA 3MXMA 3KHLA 4DS4A 4M9GA 4QZEA 1BQMA 4ECWA 4GXKA 3JPOA 3RB4A 5KT7A 5EWEA 4DWIA 2P66A 3TR8A 3MGHA 4PH5A 1VSIA 3NF9A 1ASVA 4MFCA 4CEEA 1IG9A 2Y1IA 3RJFA 4GW6A 1FKPA 5KFKA 2D0CA 1NJWA 3DLRA 3RR8A 5HRRA 2PFOA 2YNIA 3HJFA 3LP3A 1ZQEA 4H4OA 1Z26A 2XC9A 3KTQA 4BXOA 8ICMA 3LAMA 5BOMA 2OA8A 3WNEA 5CYMA 1IM4A 3T5HA 3QETA 1BQNA 4B9MA 5FROA 7ICLA 4CHNA 4K4GA 3LZJA 4CEAA 4ZHRA 1SKRA 4CEOA 4I2QA 4MEYA 5J2GA 2XY6A 4E7KA 1SV5A 4EEYA 1A76A 3I8DA 5TZVA 1CEZA 2E6LA 3NF6A 5JS1A 1QTMA 4ECYA 2VANA 1XHZA 1JXBA 3QINA 5HRPA 5HRSA 3I0RA 3OY9A 1N5YA 4UB2A 4TUSA 2FBYA 2VG7A 2R8JA 3K4GA 4KHWA 4NYFA 1C0TA 3MECA 2BPCA 1ZBLA 4CF9A 3JPRA 5KFUA 5KG0A 4E19A 3RJIA 4ECVA 1ZYQA 8ICEA 3KD1E 3HK2A 3RBEA 2RDJA 3O3GA 1S0VA 4TQRA 7ICQA 9ICXA 5K14A 4R8UA 4DSJA 4FYDA 9ICJA 2I9GA 4I27A 1B92A 3TAQA 3DLGA 3B6OA 3V1QA 2MUTA 1RCHA 1L3SA 2IC3A 3KLGA 3G6YA 3AVKA 3MBYA 2Q3SA 3GDXA 4F2SA 5IIKA 3ZT1A 4RQ2A 3NGYA 2VWKA 4I9QA 3LDAA 1F21A 4FM2A 3VQ4A 5D49A 5J2HA 7ICSA 2DTUA 4TQSA 3TFSA 3MAQA 4KLEA 3TAPA 3KJVA 1CXUA 3OYKA 1ZQQA 4Z6CA 4HCCA 3AUOA 3K58A 4PA1A 4MQ3A 9ICKA 4K4IA 4AH9A 3RMAA 1GOBA 4LH5A 3ZDBA 2BQUA 4AHVA 3LWLA 3OYEA 4DFPA 8ICNA 2IA6A 1BCMA 1VRUA 3OS1A 1Z00A 3D45A 5EU7A 4DL6A 2G8UA 3C1ZA 4I7FA 2BPFA 5CZ2A 9ICIA 1IKXA 3KLFA 5IILA 2IS3A 1UA1A 3OYHA 3HWTA 4ECTA 4ZH4A 1B9FA 3JSMA 1ITGA 2J6UA 4BDYA 4KLLA 3AA2A 4B9SA 1CZ9A 4PUOA 4CJ5A 3PW0A 4DSFA 4UB3A 4DL4A 4YG2A 4DO9A 2HHSA 2HHVA 2E4LA 1X1PA 1S0MA 5IINA 3AVBA 3CG7A 3Q8MA 1HRHA 4LZGA 1N6QA 3MDAA 3GIKA 4ECRA 1I39A 3CM5A 4R65A 1TGOA 2E6MA 4Z4HA 3G6VA 2AGQA 3RJHA 4RUAA 2XO7A 4KMUA 4RU9A 9ICCA 2BCVA 1NK8A 2PYLA 4G3IA 4CECA 2F8SA 1HJRA 2AJQA 5J2FA 4PHDA 5C42A 3SJJA 1LWCA 1S1WA 1NK6A 3QERA 2ZTCA 8ICIA 4N56A 3P1GA 1Y88A 3RB3A 4K8ZA 3NH2A 5DLGA 2Y1JA 2W8KA 4BXOB 7ICUA 4P4MA 3I0SA 3QESA 4J9SA 5IIOA 2ZTEA 2ALZA 1ZQIA 4PY5A 4KV8A 7ICHA 2V4RA 1LW0A 3OYMA 4DU1A 4NM1A 1S77D 3ZSVA 4Q43A 2DFEA 5DBCA 4Z0UA 1TKZA 1Q8IA 3QE9Y 2KQ2A 1BIUA 2M9NA 3HP9A 2WONA 4FK0A 1J53A 3HYFA 3V7JA 3VA0A 1K1SA 4Z6FA 4J9PA 8ICPA 3KHHA 3ZSQA 4KHNA 2FC0A 2VG6A 5KT2A 3MR6A 4K4HA 5HBMA 4DL5A 4KB1A 1TVAA 4CHYA 2FBVA 5HMMA 3QNNA 3ZT0A 4J2EA 1HYSA 2IMWP 3QEPA 1D5AA 4DFJA 1NKBA 3HM9A 1BPBA 3ZDEA 8ICKA 3QEXA 1ZQDA 4KI4A 4CK3A 3PW4A 4CE9A 4O3SA 2JGUA 1HJPA 4P4OA 1T8EA 4QZHA 4IFYA 3MR3A 4KHUA 2ISPA 4M9LA 4R8UB 3E2EA 4E1MA 4CGGA 4BDZA 4E3SA 2MUTB 4CF0A 2D0BA 2RF2A 4JV2A 2PZSA 5KFHA 3TAFA 1IH7A 5KG6A 4UB1A 4M9JA 3LALA 3SQ2A 4JK1A 4J9MA 3M8QA 4CJQA 2VA8A 4QZFA 7ICGA 3ORYA 3ZCMA 5HRNA 1S1TA 4QZGA 2ISOA 4CJEA 4DU3A 4KHYA 3H8SA 4P4PA 3KK3A 1NJZA 5KG2A 4KO0A 3OS0A 4RG8A 1TL1A 4R66A 1XS9D 4B9VA 5C24A 2G8HA 4EZ6A 3DYAA 4CJ4A 5J2AA 2NRXA 9ICTA 4CF2A 2B6AA 4EZ9A 1BHLA 3IG1A 1RBVA 4DQRA 1ZQVA 4M42A 4B9LA 5KFZA 1L3TA 2XY5A 4MFAA 4KLOA 1BPZA 3UIQA 4RQ6A 4IDKA 4JLHA 2IOCA 4RNMA 1U9LA 4CF1A 1Z00B 3PVXA 1RILA 7ICOA 2FBTA 5C25A 4F4ZA 1VSKA 2C28A 4YFUA 1QSSA 2HHQA 4PHAA 1RBRA 1ZBFA 3V9XA 4CJWA 5KFGA 2AQ4A 4CHPA 3AVJA 3TI0A 3DRSA 3DRPA 4M3YA 1C1CA 2JLEA 3C21A 4I2DA 3PY8A 1N48A 4CJUA 4ED8A 2A1RA 2Z1GA 1C0UA 1WCLA 4DLGA 3NGIA 3RBDA 3L8BA 4Z4EA 4IBNA 3HSTB 3VQQA 3V81A 1LW2A 4O0IA 4OKJA 4EBDA 2AGOA 3E01A 5J0SA 3HP6A 2IHMA 1WNSA 3UXNA 4ECQA 4QWEA 1B9DA 1D8YA 3SQ1A 4KLSA 1NK0A 1SUQA 5FRNA 1CXQA 2NRWA 4B8CA 4MEXA 7ICVA 3RJGA 4Z4FA 1ZJMA 4DSEA 5KG1A 4DU4A 4O3QA 4RNNA 3MEGA 4I29A 3U3GA 2HNZA 4IR1A 3CFRA 3KHGA 1JL2A 2V4QA 5EOZA 4ECXA 4M3UA 8ICOA 2ZUBA 4M9HA 4J2AA 2BR0A 2D5RA 4I9LA 1A5XA 2B5JA 5KG4A 3TAMA 3Q8SB 2HVHA 4Q0BA 1KRPA 4RQ4A 4BWJA 3ZD8A 5IIIA 3M9OB 3HW8A 4B9TA 3K2PA 4KN7A 2JEIA 4Q8EA 3T5KA 4OVLA 2HVIA 8ICLA 2WTFA 5KFEA 3OVNA 3GIJA 5BPCA 3KKRA 1W0HA 3DLHA 4JUZA 4YXJA 1WSJA 1S6PA 1ZBIA 5KFRA 4RW6A 4PWDA 3ZSYA 4CGIA 1KEJA 2F1HA 3BGRA 3SCXA 3TAGA 1HNVA 5KFWA 3SZ2A 3QEWA 1XWLA 4UQGA 2IDOA 5KGWA 1KSPA 1T03A 4UAZA 3MABA 2B21A 4F4XA 3T3FA 1U47A 5KFOA 4LVSA 4Q44A 1ZQHA 7ICNA 9ICMA 4CEBA 3UQ0A 3V9SA 1HQUA 4QZIA 4EYIB 4BDPA 4KPYA 2DFHA 5HP1A 3ZSRA 3NE6A 4FJMA 1RBUA 3OHBA 4EP4A 2KN7A 4O9MA 3PUFA 3HO1A 1NK7A 9ICVA 3AVFA 3FYHA 3ITHA 4F4KA 3AO1A 4CGHA 3OS2A 4RT3A 3GFKB 3OHAA 4QZDA 2R8GA 1C0MA 4O5BA 3CM6A 4AHUA 4QCLA 4DTSA 4IRKA 2C2RA 3QIOA 3T5LA 2YKNA 5F9NA 1A5VA 5BOLA 4E1NA 2F8TA 3AVIA 3RB0A 4KN4A 5DG8A 4NLZA 1QQCA 3SYZA 4YMNA 4CJTA 4EBCA 5DKWA 3TQ1A 1VK0A 4RNOA 1C6VA 2C2EA 3T5JA 4PHPA 3U3YA 4LD0A 4IRDA 3LWMA 1RZTA 8ICRA 1XU4A 4DG1A 2G8WA 1EP4A 5HHIA 1ZQGA 8ICZA 4QAGA 3NGDA 4KB0A 3N97B 2FPKA 1ZQRA 3VQ8A 4ED1A 2BCRA 4FLYA 3SUNA 3H08A 3O4NA 3BQ0A 1LAVA 2JEJA 4FS2A 2W42A 1Z25A 2BHNA 3OJSA 4YCXA 3EY1A 2A1JA 5D3GA 4CESA 1JX4A 1GOAA 3GIMA 4KLQA 2R8IA 4ED2A 1J54A 1DTQA 4I2IA 4FZZA 1S9FA 3D0PA 2XCAA 5HMLA 3SPYA 4DEZA 3L2WA 4RQ8A 3PO4A 4DLEA 2ZD1A 3SPZA 4AHRA 2NRZA 3VQ9A 4M3TA 1TAUA 1Z3EB 1LV5A 1C7YA 5J0PA 1RTIA 5DBBA 3MFIA 9ICPA 7ICEA 4O4GA 2PI5A 1BPDA 3KHRA 3OSNA 3HVTA 3SV4A 3H8JA 4HVJA 5DLFA 1RNHA 1JLCA 3MXJA 1SKWA 4OGCA 4Z4IA 1T3NA 3ASMA 4KREA 5KFAA 5KRSA 4F5PA 4DQPA 4F91B 4Y1CA 4QZ8A 4N41A 4J9NA 4LY7A 3RH4A 1BI4A 3T1AA 3KIOA 2QKBA 3TARA 3AVGA 1FXXA 4FJKA 4FJXA 3PV8A 5J2DA 9ICWA 2Z1HA 1VSJA 4IG3A 2OPPA 3V4IA 3DM2A 4PGYA 2JEGA 4Q5VA 4QOZB 4NCGA 4RW7A 4CEQA 4W5NA 4DF8A 1TK5A 4YXMA 3AVNA 4JRQA 1VSDA 3GV8B 3H4BA 3PR5B 3NAEA 3EW9A 5KFMA 4KTZA 4K8XA 4UAWA 4E7LA 5KFSA 3QEAZ 4C8KA 2KTQA 4I2EA 4DTUA 3GQCA 4YR3A 1YTUA 3K5OA 3QZ7A 3RB6A 2ATQA 4MFBA 3M8PA 4KKOA 4YR0A 3H40A 1S0OA 1WSGA 5EWFA 4FK2A 5J2KA 4XQ8A 1ZQSA 2Q0ZX 1K6YA 8ICYA 3LP0A 4FJIA 1RT6A 3IS9A 2F1JA 4G1QA 3Q8KA 3GILA 2EX3A 3DLKA 2P51A 1NJYA 8ICSA 2Z1JA 3KLEA 4N5SA 1NOZA 2DY4A 1NK5A 4F3TA 1S5JA 2Z1IA 1S97A 4ED7A 4YD2A 3M8RA 1ZQLA 1QSYA 3V7KA 7ICJA 2FMPA 5KFXA 5J0RA 3EYZA 1ZETA 2XY8A 2PFPA 3K5NA 3QLHA 5J2EA 4BE1A 1I3AA 5CZ1A 2I1QA 1DGSA 9ICBA 2R8HA 9ICFA 4OGEA 5J0XA 1W9HA 5HNKA 5J2PA 1S0NA 4FJHA 2OZSA 3AVHA 4CFBA 1XI1A 4DQQA 3KK1A 5KFIA 2IGIA 3TABA 4O3PA 1JLAA 5SWMA 2RPIA 1X9WA 9ICNA 2ZE2A 3FFIA 4ELVA 3OYFA 2BKEA 4QZ9A 4FS1A 1LWEA 3VN5A 5L9XA 5DB6A 3NH0A 1ASUA 4JS4A 2P5OA 3ZD9A 1T7PA 4NLKA 2HW3A 2YNGA 3LAKA 4PGQA 3V6HA 1HQEA 2FBXA 3SQ0A 3OYCA 4DTNA 4DMNA 1UAXA 4BE2A 2IBKA 4Q8FA 1JXLA 4RQ1A 4DSKA 4UBCA 1KFTA 2X78A 2R7YA 4O5CA 3BQ1A 2YHBA 5KFCA 3N4MB 3SUPA 5KFDA 2A1JB 5J0TA 3PX4A 5KFLA 2G8KA 3PO5A 4FK4A 4GC7A 4QW9A 2P6UA 3DOKA 5J0QA 5F9LA 4YNQA 4YQWA 5DQGA 1WLJA 5CA7A 3IAYA 1SKSA 1VSHA 2HHUA 4N76A 3OYGA 2VA3A 4DF4A 4DTPA 3C23A 3RAQA 3O4QA 4CFCA 4Z4GA 3MXIA 1XHXA 3EPGA 1TKTA 1TVRA 4LSNA 4DS5A 4KHSA 1J5OA 3C2MA 1RPLA 2OPRA 4O5EA 2PFQA 1X9SA 4DOBA 4OKEA 4IKFA 3AA4A 2YNFA 5DGAA 3L3UA 1HPZA 1WCNA 5KFFA 1ZQFA 2YKMA 1UT8A 5HLFA 1RT5A 4KLMA 4OPKA 2NRTA 1COOA 5L1KA 1EX4A 1JXEA 5J0WA 1QE1A 2BQ3A 1BI4B 4L8RB 2QKKA 2VG5A 1AROP 1EETA 3NH1A 3QZ8A 3PX6A 3RMBA 5DDMA 4GXIA 2C22A 7ICFA 2P1JA 2V9WA 2UVRA 2W9BA 3ULDA 1NKCA 1J9AA 4IG0A 2P5GA 3C5GA 5CY4A
chains in the Genus database with same CATH superfamily
1YITN 1X60A 2Z0GA 4LT6A 1JLEA 2N7YA 3V7LA 1ZD4A 1XJWB 2E66A 4A8SA 1P6TA 1QHTA 1K8AT 1D09B 2NZCA 2QYGA 4WE1A 1PK3A 2QMUB 1AFJA 4RQNA 3QO9A 1XSLA 1HNZK 1XN9A 2PN6A 3DGPA 5ETNA 3GCXP 1OWXA 4KKOB 2M0GB 1X4GA 4OPJA 5CWRA 2MXYA 3CXCM 2K4PA 3M6KA 1S76D 3CT9A 2BDUA 4X4UA 3CQ8A 3LP0B 3BKUA 3AL0B 1C1AA 3FZHA 4I2GA 3CIPA 3MMBB 4U7BA 3A0BU 1RTJA 1MQ2A 3CPWM 4OLBA 5CQGA 4OD0A 3MPUB 3F0NA 3NGZA 2QO3A 7ICTA 5FPNA 4JB3A 3RTVA 4JKBA 1BDGA 3GE9A 2HFZA 3QLHB 3BV8A 3AVCA 4DQ8A 2KRBA 3AN1A 2F4VF 3N7PD 3ADAC 4KAIA 2FJBB 2ZOGA 2R8KA 1KBRA 4X66J 3D67A 4Y2SA 3LVWA 2K8CB 4YVZA 4ECZA 3WX8A 5JLHA 3U1MA 2OYQA 2NUUG 2I5JA 1YAGA 5DG9A 1VSMA 4DTRA 1K47A 1JLAB 1OSCA 4CIEA 3ZETB 3UM9A 3L2RA 2X6NA 3CJKA 2M88A 4ZVOB 4YN3B 1VI7A 1LWEB 1HLUA 3M9NB 2G1DA 3BGUA 2JEFA 4ZCMA 4O4RA 2RDIA 3GFYA 5G4DA 2MZSA 4C9DA 3C94A 2FPHX 2AV5A 3E3XA 3L5KA 2QA2A 4NZ0A 1Y97A 2OUGA 2ROEA 2G1HA 2M8HA 3L4PA 2A10A 1K0VA 4NXMJ 1ASWA 3HBTA 2Q66A 1WNEA 3V9ZA 1KDHA 4F5RA 3DOKB 5BRDA 1RI7A 1VBYA 3ZZUA 2XLIA 4BC3A 3B8AX 4FWRA 5IV3A 1EIYB 1CLFA 1JJ2R 1WSFA 3HI0A 3BEXA 2P9NB 4CGFA 2HBLA 5J1EA 3QJJA 1TKTB 1F9FA 3F9KA 1TVRB 1SVDA 3UPQA 1F1BB 2ZIWB 2J4RA 5CP2A 3I31A 3L7UA 1U2RA 2FVQA 2OPRB 1IM6A 3QFWA 3V4MA 1PJ6A 1OY9A 4YFKA 4LF4J 1X0PA 4FCYA 2VDHA 3IHQB 3Q83A 2HCFA 1RWKB 3W3DA 2LMIA 5GMDA 3S6EA 4IQWA 1XMQF 4FJ7A 4DPXA 1T6CA 4HL9A 3UN3A 2E1CA 2DR8A 2KZMA 2V7ZA 3C7NA 4ISFA 3LP2A 3J7YP 3SEIA 4M3ZA 4C8LA 4NX9A 2MEWA 4CEFA 5KOWA 4FLVA 4FWMA 3V5RA 4X62F 2DEIA 2ZC3A 2UVVA 1NOMA 3AOAA 1PBUA 5ALPA 4JV5K 4YDUC 3RSEB 1TP7A 4I0WA 5AKKA 4KHPJ 3PYGA 1RWPB 2DGZA 2KEYA 4AXJA 3NEKA 3RAMA 3FQLA 3VVTA 3KZBA 2G8FA 5KFBA 3TANA 5KT3A 3H1VX 5BJRA 1NWKA 3M5RA 1VMBA 3KDNA 1JMSA 2IM1A 3W1YC 3FGUA 1EKEA 2VA2A 4ES3A 5CD4H 3M8SA 2DHXA 3TVZA 5A8KB 1I5OB 2XHBA 4ZPWR 4KO0B 4LZDA 2XLJA 3AGKA 2QARA 4CGZA 1SL1A 4IH7A 4GKKJ 3OTEA 1U1KA 2IAJB 2CQ4A 3M05A 3MR5A 3N6MA 1YQHA 2VFVA 2G0JA 1N4LA 3MUTP 5FDLB 1CJVA 1EXNA 4EP5A 4KFBA 3KWGA 2E44A 1CSJA 1CULB 5BREA 4BG9A 1FDDA 1HBUA 3LGHA 4AYBD 4IEEA 1FRLA 4MYUA 4OI4A 4CJ7A 1HKGA 1ZD5A 2AP6A 3NF8A 2VASA 2K3KA 4ZJOA 1NM1A 2O8FA 5AFUA 4F5QA 2JGAA 1BCOA 1D0EA 4BRAA 5JU5A 2BTFA 2D6FC 4QW8A 1RA6A 4FLZA 3BJYA 3QSYB 4DTXA 5J2NA 2N4CA 3CMES 4USAA 1BD6A 3US5A 4M3XA 2HVEA 4FBTA 2UXBF 5KPRA 2ZTDA 5LM7E 5DM6L 4WP9A 4OZ0A 1HFEL 4K50A 4H8KA 4CIGA 5B0GA 4FWQA 2VONA 3U4LA 2GH1A 4BRCA 5E3PA 1YSJA 4FLXA 1S9GA 3PR4A 3ZZYA 4USVA 3B0YA 3L4IA 2DK2A 4DX7A 1NMEB 1LWFA 4WXOA 2ITGA 2XI3A 3HM8A 4LUBA 2NUBA 4X65J 3MDFA 4KB7A 1SH3A 4M0AA 1XR6A 3QMLA 4FJ9A 1WOQA 4O5KA 4GV3A 2IYIA 4O44A 4B3TJ 2LA4A 2EPIA 3IN5A 3TAMB 2W54A 4C1NI 3AA8A 4CJSA 1OKJA 3V6JA 3MEKA 3H1QA 2VQFJ 3VQ5A 3PSIA 3JPNA 4HDGA 4CJ3A 3TADC 4JP8A 2Y1RI 1Z4OA 4FXDA 1CVJA 2NSCA 2UXDF 4RO0A 4CJLA 5EX0A 4WTOB 3HOSA 2PKEA 3NBPA 3MX2A 2HSEB 1UL3A 2XGQA 1WC1A 1VQOS 3RRGA 4DV6J 1R8BA 3PW7A 8ICTA 3C6HA 3H4DA 3NFAA 1NSQA 3DLEB 3ISCA 2DH7A 5HR7A 4PG4A 4NO7A 4TU7A 2YHYA 5B66U 2G8VA 4ZLJA 4HYKA 1XNSA 4WQ5C 2GJFA 3S9HA 2UUBJ 4XAKA 3POTA 1X0FA 5ETKA 3BPDA 2OGUA 3VQPA 1DOQA 2GV9A 2YWWA 4I2CA 1IKWB 3ZX2A 2KYZA 4B1VA 1U0SA 2FQQB 4QIWC 1S6QA 3T1YK 1M1KT 5D4NA 2WSEC 1JL1A 2HF4A 2ZM6K 3N5FA 3I4HX 4FXVA 1M1GA 3AAQA 2CZVC 3KOAA 2O4GA 1C2PA 3M2VA 3NY0A 4UB4A 3CEDA 2E5JA 1HNXF 5AICA 5EE0A 2O4IA 5CAAA 1WN7A 1JLGA 4FM0A 4Y2IA 2XGPA 2HFSA 1HARA 1WEXA 5E26A 3O1BA 2U1AA 2W3RA 4LSLA 3B6BA 5EY4A 3C1YA 1Q86T 4YHHF 2XMVA 3O3FA 4NY8A 2F5GA 4FWKA 5DB8A 3GMGA 3OLBA 3JPQA 5KFJA 4RUCA 8ICJA 4KC5A 2CQHA 4FJ8A 5AE2A 3HI9A 1F5CA 1D9DA 1RT1A 4LQ3A 4IC9A 4KH0B 9ICQA 5D6GA 2QIFA 2KG0A 1RT2A 3O8MA 3TUIC 2EZXA 2BPGA 4H4MA 2XWYA 3Q8LA 1HKCA 4EEKA 2D0OA 3G8QA 8ICFA 1TK0A 3M2UB 2QWNA 5HSPA 4F3OA 1IKVB 2MSTA 3MCPA 3N01A 3P39A 2IJFA 4AL7A 1SC4B 1VC6A 1S9EB 3M9MB 2JR5A 2RS8A 2NXCA 1JKHA 3CJBA 3ISBA 4RPXA 2ES6A 4CD3A 3EN9A 1ZA1B 4Q45A 2OO4A 2XM3A 4B02A 4EX6A 2U2FA 4IQXA 4TU8A 2ASLA 2Z56B 4FVUA 3TNVA 2OYYA 5AQWA 5GAGU 4DR6K 4QIWD 4JMUA 3ID8A 2DPIA 3OFFA 4CF3A 2K4IA 2F8LA 2CJXB 4NMLA 4Z6DA 3Q23A 1T44A 4J9QA 2ZZMA 4NXZA 1RTHA 1S22A 4UAVA 4IO1A 3DOMB 4C1NK 2GMHA 1WAFA 4NXNF 5LJ3Y 2QWPA 3ZSOA 4US8A 1FTCA 4LFAK 1UA0A 4QR0A 4C8YA 2CH6A 2E1AA 1NPRA 2KI2A 1E6YB 4LRCA 4W5OA 3WU2U 4B3MF 4C6AA 2O01C 4CBXA 4DR3K 1REVA 5J0OA 1RT6B 3Q8UA 4FJLA 3TPQA 2UP1A 3C0BA 4PG7A 1BPXA 3G6XA 1BXNA 4JWMA 5LY3A 1WUDA 1YJ9S 3KKFA 1HNZF 2LQ9A 4O3RA 3W5YA 2Y0SC 5GMKa 3NHGA 1ZQWA 1SV0A 4EBEA 3JQKA 4H0TB 1FKOA 4NLTA 4F26A 4FWSA 2ZH1A 3NWGA 3WZ0A 1L5UA 9RUBA 3EL2A 1GTEA 2F2AB 4WFBQ 3WUHA 4PQAA 2X51A 2MQOA 1RAGB 2BJ9A 3HXMA 2WHOA 3AXMA 1T05A 2VODA 4BROA 3T6BA 1VQNS 2F9TA 4BRIA 4F5OA 3CYMA 4KLHA 3CJQA 4XA5A 1AW0A 2I6WA 5CYQA 1T9VA 5F2RA 4RJVA 2DPJA 2M3DA 2G2YA 5AQJA 2ATLA 1N32K 1TFRA 3G87A 2ROPA 2P9LB 4CF8A 1YJNN 4E8UA 4GKJJ 4RW8A 3SMSA 3KUEA 2HK3A 3L9ZA 4YOXA 1U1LA 1HL6A 5AKYA 2GWSA 2ASYA 9ICEA 4BACA 4C8OA 1JUDA 4OJRA 4ZLPA 2RQCA 4RW4A 3OUYA 4IQTA 4FO0A 2X3GA 4AFFA 1AFIA 4HCBA 5JS2A 3RUBL 2CQIA 3QU5A 1GLFO 1ZBUA 2GEMA 1X42A 4AQYJ 4BCAA 4BE0A 3AVAA 1WSHA 3LH2S 2AYBA 3OYDA 3MPDA 4PL2A 2F9JA 1SPBP 3ZSXA 3G71N 3OYAA 3CIZA 4CJRA 2IYGA 2BGWA 2KHCA 3SQIA 1VC5A 3MDCA 4I2FA 1X4EA 3MXHP 3VEXA 1MSWD 3FDSA 4L75A 4M3RA 3ETLA 2YKMB 1VSLA 4LVOP 5A2QU 2Y0SD 1SXLA 1VRTB 3EO3A 2A1BA 2UYTA 5HMXA 2X74A 1KHWA 2HNDB 4CK1A 3I96A 3R5JB 5KNIA 3KLHA 2W9CB 1NI3A 3EVWA 3CCEN 4DOCA 4OJ6A 1CJUB 5T7BA 3B54A 1Q8BA 2CQ1A 4R64A 1TAQA 1I94K 2BZ2A 3WXIA 5GVQA 3PRVA 2WVDA 2BDPA 4LF7K 3DDIA 3KK2B 2H65B 1VK8A 4CFAA 1Q9YA 3VEZA 3EE3A 1ZD3A 3K5MA 3MN9A 1V9PA 5KQ8A 3NS5A 3ALYA 4M5LA 4X64K 3O9QA 3DMJA 1SQFA 5THWA 4Z6EA 2W43A 1UT5A 4ID5A 3IR5B 3GOIA 4R5PA 4JV5F 2BEFA 2FJAB 2F9WA 2LFVA 1ZQKA 4Y6IA 3MF5A 1ZS6A 1GQEA 1KXPA 1JLBB 4OI0A 1SB3C 3A0IX 1RT4A 5A6WA 1WHWA 4LFBJ 2KO1A 3OVSA 3NGSA 3MHYA 1IBKK 4ECWA 2EAMA 2R18A 3N5BA 2FZGB 5M2RA 4DV5K 3BS5A 2N7CA 3SCIE 4LF5J 2P66A 3NMAA 2QL5B 3MGHA 2VFTA 4PH5A 3UDVA 3VGUA 1VSIA 4MFCA 1YJUA 2MZRA 3N7SC 4OYAA 1IG9A 3RJFA 4DX5A 4GW6A 2KL8A 4AM6A 3LDNA 3EEQA 2ZNZA 3RR8A 3AMZA 2A2DA 2OPQB 3LP3A 1H0HB 3TJ9A 1Z26A 2MKHA 2ZZTA 1WBBA 2BRLA 5BOMA 2WF7A 3NGTA 3T5HA 2YKPA 2E1ZA 1N34K 2EFOA 3G8SA 2QTDA 7ICLA 4JHDA 4CHNA 3RGIA 4ZHRA 1SKRA 1T02A 4I2QA 4MEYA 2E5LK 1DKGD 3JSYA 3QJLA 2F63A 4J9UE 3VAIA 4K59A 3C2PA 2PD1A 5EUHA 2E6LA 3NF6A 5JS1A 2YTCA 2D1CA 4ECYA 2Q0UA 1JXBA 5HRPA 3DCAA 3MM9A 5A8WA 1N5YA 3M8WA 5B0DA 1FE4A 1RHUB 1ZZFA 3AD9C 3W8PA 2AH5A 3A8EA 5F3TA 4LF8J 5FPEA 2V69A 2Y0BB 5JVGQ 3THYB 1WORA 3BGLA 1LKZA 2ZXIA 1UEKA 3MI7X 5CRXA 4E19A 3RJIA 5ALIA 4ECVA 2QN6B 4TN2A 2FSNA 2MA1A 9ICJA 1RCXB 1TL3B 3V1QA 2YJFA 1L3SA 2YPZA 3C15B 4P74A 3G6YA 2P9IA 2MSSA 3D28A 2M4MA 3GDXA 4C7YA 4RQ2A 3K1ZA 1QZ6A 2R2TA 2VWKA 4I9QA 4OX9K 2P9UB 1YBUA 2OTJN 3FAHA 3J81Y 2CH5A 2ZIVB 4UOHA 5LMNJ 1RT3B 1IQZA 4Y2UA 4GIBA 2Y9UA 3K1RB 3A8KA 2DTUA 1WC4A 3TFSA 5T7LA 4KLEA 2W6LA 3TAPA 2H3QA 2C1EB 2FHJD 1F60B 3WBZA 2UXCK 3MTKA 2FJDB 1NAQA 1DZ5A 1SGGA 3QPIA 2XQCA 3A5LC 2LQBA 1OQ6A 9ICKA 5AKGA 4ZPTR 2CWXA 2AD9A 3LWLA 4DFPA 3IRXB 4C0ZA 1S99A 1VRUA 1BCMA 1Z00A 1REGX 4CTAB 2L41A 4CVNE 5CZ2A 4WCEL 9ICIA 1IN0A 1HR0K 2IS3A 3OYHA 1N5QA 5JVHQ 3HWTA 1WJ9A 4ZH4A 2D3ZA 3BYPA 3FMBA 2J6UA 4FPAA 1ILYA 5IWAK 1TV6B 1ZAWA 5BR8K 1S1UB 2HWIA 3AA2A 4ZOSA 1HMVB 5E3QA 4DSFA 4UB3A 4DL4A 2HAIA 4CNQA 2GJ2A 1QVGR 3SAHA 4A8QA 4XH1A 4X84A 5IINA 3AVBA 4WP8A 5AZIA 3MDAA 1UFKA 1NGDA 4ECRA 3T1YF 2E1EA 3RBZA 1F0XA 5GAEI 3G6VA 2BMBA 3CJ2A 2ZM6F 3TTFA 4ZIVA 4KMUA 4Y2PA 4JI6J 2KFYA 4RWWA 1NK8A 5HI7A 5LXYA 3VALA 2P9PA 4GV6A 1T3VA 1HJRA 4LRAA 2CIMA 4PHDA 2I38A 4PRFA 2WAQC 3VF6A 2AWZA 1RAHB 5C42A 3BO4A 1LWCA 1QHAA 5G5GA 4LMZA 3DN9A 3I4PA 2MKJA 3P1GA 2YNIB 2CYYA 1FD2A 5DLGA 1FRIA 2IA0A 4WQ4A 5IIOA 4PY5A 3EX7B 5CYMB 1K73T 4UB8U 2UU9J 3HHKA 4IEIA 1VQPN 2DGXA 5DBCA 1C20A 1TKZA 1Q8IA 2ADCA 2KQ2A 4WFNQ 2M9NA 4WFXA 2WONA 1YRUA 1OW5A 3GSIA 1VRQC 4FOEA 2CQ2A 3AY9A 3AJDA 1GLAG 3KHHA 4JNEA 3MR6A 5HBMA 4CLTA 1TVAA 1KC8T 4B3RJ 2FBVA 4HH1A 3ZT0A 3K8WA 5A0YA 1C0TB 1TL4A 5C0YA 1GEHA 2ZJQL 1D5AA 1YIJS 4PXBA 4DFJA 3X1LB 4EO8A 3HM9A 1BPBA 4BGAA 4KI4A 4BUGA 3PW4A 2H3EB 2JGUA 1H72C 4IFYA 3QRPA 2NSBA 2ISPA 4R8UB 5GAEP 4CZGA 2O8DA 1LQ9A 4CGGA 2EXUA 1WOPA 3CC4S 1ZD2P 2WVFA 1M0SA 2RF2A 4OYIA 5KFHA 4FKXA 4RWTA 3KKAC 3LALA 5LOQA 4DR6F 4JYAK 5IV4A 4J9MA 1RDWX 5JRTA 2BM0A 3UWTA 5HN0A 3SMPA 2XVTA 1ZQ1C 4P9SA 4CO3A 3WK5A 4CJEA 3TEGA 3CDAA 4P4PA 3BS7A 1V9OA 2Q3PA 3KK3A 5AQOA 2FJEB 2WAQD 2RQ5A 1JNRB 4RG8A 4R66A 4JD2A 2JVOA 4LFAF 1PVRA 4I56A 4EZ9A 2E88A 4LR9A 2EI5A 4M42A 2P5VA 4CLKA 5AQKA 4DR3F 1MG7A 1MMLA 1BPZA 3UIQA 3BGOP 4CF1A 3PVXA 3IRWP 3Q8YA 7ICOA 3CD5A 1NG9A 4I7FB 4A8MP 4NXMK 2BBEA 2HHHK 1PG5B 3G8TA 1B4FA 4DV2K 4GVBB 4KY3A 4JKFA 5A8RA 4U95A 3CPEA 3GR0A 3UMGA 1H3DA 5KFGA 4NYZA 3TI0A 2BOAA 3DRSA 4PUOB 4K7QA 4I2DA 4F04B 1QQ5A 3EVOA 1TMJA 4TYBA 2NPFA 3FCVA 2ZITA 3TA2A 4CJUA 2Z2MA 2QI2A 1RHQB 3NGIA 1LOTB 2RD5C 4PPZA 3L8BA 4C7ZA 3W5XA 1C4AA 4NLUA 2VJ4A 4C4TA 3PHEA 4OO1J 1RWVB 3ENAA 5E84A 4WU3A 4P0PB 4DV3J 4EBDA 3E01A 4H5TA 3HCXA 1RQ0A 3I56S 1COKA 2GZOA 3JSBA 1J6ZA 2B4VA 1B9DA 3SQ1A 4KLSA 3W2VA 3D9BA 2CPXA 1NK0A 5FRNA 1MROA 2M9KA 3DLJA 1XUPO 3RJGA 3R8EA 5KG1A 2KB2A 4DR5K 3U3GA 1HD1A 3I0SB 2F4VJ 3KHGA 2IHR1 3CFRA 4ECXA 4KV8B 3VZHA 2M52A 4J2AA 2GW8A 1VBZA 1VGYA 3HTVA 4OV1A 4PAAA 3K9KA 3ZNJ1 1KRPA 2B4PA 4RQ4A 2XB2D 1T6DA 4LJXA 3H6EA 3AB4B 3DJCA 3BF4A 1IG8A 2J7KA 2Z58B 3IBWA 3IG8A 4OVLA 3NCRA 3VESA 2H3VA 3VETA 1NGHA 1RCOB 3ILJA 3QGHA 3SCJE 4YXJA 1WSJA 1S6PA 2YWHA 3M2RA 1W97L 5AZJA 3ZSYA 3D2FB 3BN7A 1RAJA 4RPFA 4K4XA 3SCXA 1HNVA 2VHGA 5KFWA 2IRYA 4USUA 2VPZB 4UQGA 4LF9K 1T03A 4MDAA 3MABA 2GS8A 2MQ8A 3D6TB 3J8AA 7ICNA 3TYTA 2R7OA 2QA4S 1JJ4A 5IM0A 3IKMA 2VCPA 1DHMA 4CEBA 3UQ0A 4JKAA 2KT5A 4OX8A 2QWRA 2UV8G 1SC1B 4MJKA 4KPYA 2NNWA 4CO4A 1OH5A 1LXNA 4JB8B 3OHBA 2YQ1A 1X4CA 1GLDG 4FZMA 4CZLA 1N5WA 4OLOA 2QEXS 4M5DA 5AE1A 1H7WA 3ZZRA 2O8CA 3HO1A 3D68A 3ET6B 3N0VA 9ICVA 4F0MA 3HSCA 3FYHA 2PFFB 3UD5A 1I94F 4UOGA 1VQ9S 2MKCA 4LF7F 3OR1A 1OH7A 3OS2A 2DWQA 2CUYA 3OHAA 1OJ4A 1S1TB 1VQKN 5CHCB 4G6VB 4O5BA 4KX3A 4DKWA 1YRXA 4IRKA 4ZA1A 4Y3CA 4X64F 1FJ7A 3ILLA 3D0GE 1GMUA 4KN4A 3VEVA 1XMQJ 4J91A 2ZIUB 5AKHA 1BWFO 5FLXY 5DKWA 1VK0A 4RNOA 3T5JA 2BJDA 4YOWA 2MJUA 4IRDA 2DUYA 4IDKB 2A40A 5FIIA 4X62J 1BC6A 4QAGA 3NGDA 5C25B 4KB0A 2E3TA 1IBKF 2Y8YA 2FPKA 3NL0A 3IFRA 2E5SA 4FWOA 1WKJA 2B9EA 4HR2A 4K0KK 3L09A 5ALXA 3MURP 2CJQA 1VQ8N 4ED4A 4DV5F 3L6QA 1N8RT 1Z25A 2BHNA 1TR0A 3EY1A 3LDPA 3QB0A 2A1JA 4WF9L 1B4SA 3THTA 2A3VA 4KLQA 4ED2A 2KJ8A 2BVZA 3SSRA 1S9FA 2DF4B 4DEZA 2AZ3A 1HW9A 4RQ8A 3C14B 3PO4A 3MAAB 1C0UB 2VBXA 3KFUF 1H74A 2NRZA 3I1YA 4M3TA 2KYXA 1Z3EB 5J8YA 3EWGA 2JJ4D 2FY1A 2HOEA 4UOFA 4O4GA 1TU0B 2L9DA 2VF3A 2DNQA 3I9V9 4HTIA 4HVJA 5DLFA 1KQSR 4FNHA 2ZHAA 3W60A 1UJ4A 2YPYA 4OGCA 4BS2A 2E5LF 3ZTPA 3VEWA 1IV8A 3CW2C 4JI7K 5CZXA 5KRSA 4DQPA 3QNWB 5AK3A 1FFGB 4I1TA 5D77A 4Y1CA 2LEPA 3S1TA 1VQ4S 5F8LA 5DZ6A 4P7TA 4LY7A 2ZH9A 2HEKA 3T1AA 4PWUA 2HNZB 1ZBSA 1FXXA 4FJKA 2D9OA 3KG4A 4WKYA 1SJQA 1G3OA 4KGVB 5ALQA 2KJWA 1M90T 1NGCA 2XLKA 3DM2A 1PO6A 2CGJA 4J9VA 1BOTO 2JEGA 4Q5VA 3ZZ0A 1VDHA 2QC3A 3AVNA 3UB5A 2HS3A 7FDRA 4UY8T 4JRQA 1VJQA 5D15A 2VKZG 5ETPA 3PR5B 3NAEA 3EW9A 2UXBJ 1HWJA 2V8GA 3QQCD 3CJSA 1R31A 2ZXHA 1H2TZ 4DTUA 2FD2A 4C0BA 4J8FA 3EE8A 2ATQA 5B0EA 5AQQA 1UZDA 2KKVA 2E1PA 3WKDA 1VQSA 4KKOA 4RW6B 1GXLA 2B56A 2A3ZA 3BF3A 4FK2A 4OX9F 1ZQSA 2KICA 1QUPA 3LP0A 4CO0A 4FJIA 2PEHA 3Q8VA 5E33A 3I28A 4DCCA 2F1JA 3J81j 1P90A 3NGRA 3Q8KA 1KQQA 3O6QA 3CERA 8ICSA 2P9SB 3W5ZA 2UXCF 3UFCX 3EM1A 1VR6A 3CCSS 4CBWA 4OZ5A 5M2UA 3L7PA 3QDKA 1RADB 1QSYA 3EYZA 1K8AO 1ZETA 1IR2A 2XY8A 3QLHA 4ILLA 4K4TA 1D1UA 1FCAA 2JRSA 1DGSA 3A1YG 1FDAA 1HR0F 9ICFA 4DUYK 1L6NA 1YHQN 2UXDJ 1M5VC 2GLEA 1B3TA 3MAHA 4ES1A 1G7CB 2OZSA 2VFUA 5BR9A 3HZGA 5BR8F 2JFDA 4OLPA 1R6YA 3AA9A 2PMHA 1JLAA 1BQMB 2KH9A 2EG1A 3ZETA 3CI5A 5E5NA 4ELVA 3QYYA 4L72B 4AD6A 3OYFA 4BQZA 2BKEA 4P72A 1ECWA 1LWEA 3VN5A 4B1WB 1XK8A 4X4VA 2LBOA 3MD3A 4BR7A 2IPOB 4EIAA 4DG1B 4ZVSB 4NLKA 5AHXA 1EP4B 2I8EA 3UO0A 1O03A 2JH3A 3V6HA 1NHVA 5LMUK 2O3DA 1F2HA 2ZKTA 4DMNA 3O8WA 1JXLA 4EU0A 4IOAL 3CO9A 4B1ZA 2R7YA 1YLXA 4O5CA 2KG5A 1Q7YO 3SUPA 4DR1J 3KZIU 1Q16B 2ZUGA 3SDEB 3TR5A 5J0TA 3PX4A 5KFLA 2G8KA 1BQNB 4BVOA 3DOKA 3GG0A 4OQJA 1BA1A 2NZ4A 2A2CA 3G86A 2GVZB 2WZ1A 3V2UC 3IAYA 3BF1A 2HHUA 2DH9A 4N76A 2N3LA 1RDFA 4FL9A 2P9NA 3RAQA 4CFCA 1RTIB 2CGKA 4ZPCA 1TKTA 1TVRA 3N7RC 1IBLK 1RSCA 3ZTRA 5BN9A 5AT1B 2GCFA 2EK1A 4FF4A 2ZIWA 3PRDA 3AODA 1O5JA 2COLA 4IDHA 2ZJPL 1N61A 2OPRA 3IM9A 2BZFA 3D1HA 1JLCB 2PFQA 1X9SA 4DOBA 4IKFA 2YMQA 5DGAA 4I6YA 2ZBPA 4YHHJ 1N60A 4ALZA 2G5IB 4CW7B 5J0WA 3UE5A 1X5PA 5AR0A 4L8RB 2MU2A 2BQ3A 1BI4B 3AOCA 4X4SA 2LXFA 4K5RA 1AROP 3NH1A 1WG5A 3PX6A 2DNYA 3CC7S 2OPPB 4LRBA 2C22A 1KHVA 7ICFA 3PDNA 2XMUA 3C16B 3MM8B 2O6KA 2UVRA 4AYBF 1TUVA 1UJ6A 4IOXA 1DRZA 4JI1K 3Q8QB 4YB6A 5DDYA 1EWRA 3TRGA 5HJYA 2WSFC 4MHVA 5A8KA 4X66F 4EHTA 4DQSA 4YDXA 3X3UA 4NI2B 2VOOA 1A9NB 1WG1A 3D54A 3LTOA 1UJ5A 4JYAF 2RHQB 3GBTA 1I3OB 4DR2K 2X6SA 2IAJA 1ZQOA 2Z2YB 1SJ4P 2MZQA 1UVLA 3IS9B 3R7BB 2MMYA 1B0TA 3D2SA 5FDLA 2K2PA 4G1QB 3KLVA 2E9TA 1M5PC 5BRHA 4ZJQA 3ZTSA 4IFEA 2ZGYA 3KLEB 3O9TA 4LR8A 1BVSA 1FRKA 1CULA 3ULEB 3OJUA 9ICUA 4AUKA 4PPXA 3D2NA 5DQIA 2HNYA 3CFPA 1GO3F 4R63A 3CMEN 3LOUA 3W66A 2XTJP 4NLYA 4W5RA 3H98A 4NXNJ 2Y9TA 3JAMO 3OR2B 3M7DA 2VPYB 2DY1A 4NLNA 4OX6A 4NXMF 3NOCA 2HHHF 3ZT2A 2GHWA 4ENOA 4B9QA 4DV2F 3KWIA 2YHXA 1C0GA 3LP1A 4USTA 5F8JA 1RDCA 1S5LU 3W64A 2CQDA 1ZQMA 3MGIA 2ILYA 2W55A 3NDKA 1LK5A 3THXB 2D0AA 1VYAA 3AA3A 2LM1A 2ZE2B 3BQ7A 3KOOA 2B3TB 1WSIA 1BG3A 5KG5A 2HQGA 4C8ZA 3EPIA 1HNZJ 4FJJA 4MKVA 4C2MA 1VC0A 3MCMA 1SQEA 5HP4A 4NYNA 4B08A 4GMKA 2F65A 2ZHBA 2IOHA 1S1WB 2MLYA 1CZAN 1NSAA 3VA3A 2OEKA 2MPUA 4OZ1A 2DGOA 4FJNA 3D6FB 1MWMA 4MIWA 3GIRA 3MMCB 3LK9A 4CYUB 2PFNA 4CLUA 3A3OB 1L8LA 2NO5A 5ALKA 5CR4A 3VR1A 1YVUA 3UE2A 4F3QA 5AQMA 3K0JA 2LQ8A 2AMCB 3KMQA 4KRWA 1ZRMA 2OMOA 2VH7A 1UTAA 4DR5F 2FPMA 3I76A 1VQON 4NMXA 4DCPB 1RBLA 1RYUA 3CMQA 4R25A 9ICAA 4KI6A 2AX0A 1ZQZA 1NNLA 4Y2VA 1J5OB 5L8RC 2YKAA 2PE8A 4MO4A 1X5TA 3RF9A 2B7BB 2K8GA 4WU2A 2GA7A 2R3VA 2BQRA 1B43A 2YNFB 4NWBA 2HB5A 3ZDAA 8ICQA 5HLFB 2XMAA 3DLEA 3DLLQ 3ISZA 2YX7A 3BM7A 5CEHA 3WK4A 3PSPA 4NLPA 4X5VA 3T7ZA 3NG8A 4IQVA 2DRBA 2LYBA 3ENOA 4C4RA 5C5JA 3RMDA 4HHHA 1OQ3A 2VG5B 3CMAS 3O5TB 4F92B 1NZPA 3S41A 2QLWA 5IXUA 4IJAA 4TY8B 3B6PA 1NK9A 1B70B 4LF9F 1SAZA 1BLUA 3M8QB 2W9BB 3V6KA 4IG0B 4DL3A 2C2NA 1XSPA 2FF3B 1IKWA 1JXVA 1IV0A 5CB1A 1HA1A 3HRDD 4B3OB 5J2QB 1KVAA 4P10A 2PIIA 3FQKA 4KLDA 2W2QP 8AT1B 4JWNA 3H46O 4YB7A 2LQ5A 1KFSA 3M8ZA 1HI0P 2XI9A 5ALVA 4P6QA 1L7PA 3C19A 2FJ6A 2XZDB 4NCBA 4ZMMA 4DPOA 2FLNA 1RGIA 1Q53A 8ICBA 3HPHA 3GV7B 4XIUA 2IRXA 1K1QA 5KPTA 4WZMA 4QOTA 1F3FA 1NZAA 4BGDA 2V8DA 4KLFA 5AKLA 5BN8A 3QGGA 4CF5A 1RYSA 2ZZNA 4X65F 1WYGA 3QUBA 5IT9O 3WKBA 3IDWA 4CI6A 3BBCA 4FYXB 1QSLA 4JV5J 5HQMA 4YUDA 3QBWA 4K0KF 4O5FA 4JI0K 4FZVA 2H3GX 4LF6K 2XS5A 4D3HA 1S10A 2KN4A 4HH0A 5J0UA 1R0AB 3LYSA 1UPMB 3HZEA 1NGGA 1YI2S 3JTOA 3A5OC 1LW2B 3G82B 4AT1B 4FM1A 3C2KA 1IKVA 4CLZA 4Y0FA 3RWUA 4F67A 1OH8A 1FRJA 1S9EA 5K8MA 4JK7A 1ZQTA 2HMXA 4P75A 4QS9A 4MF2A 2H5EA 4K2XA 8ICVA 4W5QA 4M04A 4JS5A 3AH6A 1U1QA 1SH0A 4YMMA 2QG9B 2RHKA 1KQGB 3PIOL 2ZUCA 1BQXA 1D8BA 1KQFB 4KLUA 1YJRA 2KW4A 3O2IA 2V5HG 5FRMA 3SQGB 3NUQA 4OZLA 4JI7F 2B5JB 3K59A 1NU4A 3TZYA 3LDOA 8ICXA 3K5LA 4KTWA 1Y5IB 1Y10A 4B1YB 2YMLA 1DAXA 3DOMA 2FPLA 2RS2A 4GVLA 4EI2A 2EWHA 1L3UA 4NLDA 3L0QA 2H48B 2JHEA 4F4YA 1S6UA 2P9EA 1X9MA 1FX2A 2G09A 4QZBA 1YJ9N 4C3KA 2A19A 4ILRA 4TSXA 2K89A 4DFDA 2QLFB 2P9KB 4Y2QA 4M45A 3OYNA 3V9WA 4YD1A 2YB1A 4L76A 3O1LA 2XMKA 4NLGA 2VWBA 2NQPA 4WIIA 5L1LA 2W4DA 1IWAA 3RRKA 4UF4A 2J9DE 1XSNA 1ZBHA 3AVMA 1TKDA 3DWLA 3ZTOA 2ZJQQ 5C2DA 5ALJA 2BANA 2HBJA 2QMXA 3MEEB 2M2BA 3WXLA 2YX8A 4NLXA 5DGBA 1NDLA 3D3CJ 3V6DB 1VQNN 1W2BR 1XR7A 3IP4B 1LK7A 3GFHA 1KTVA 3FRZA 3I87A 3ISNC 1TL5A 3R2CJ 2UU9K 3TFRA 3AO3A 2H5XA 4ELUA 4OHXA 1FKAF 4Z2XA 2NV3A 2G4BA 1VFJA 1HNIB 5M1OA 2KT2A 3LL3A 4IH6A 3AA5X 3P6YC 3IAS9 3BSAA 3IXQA 1NJIO 1IO2A 3GIIA 1ZA2B 4DL2A 3ETOA 3ZYYX 4K4UA 2WOMB 1AA1B 3IMXA 5E0OA 4IQUA 4WZQA 3RJEA 2P9LA 4B3RK 2FMSA 2DIUA 4FJ5A 3VGVA 2G0IA 3PRBA 4DUYF 3SEOA 3DDNA 2G2ZA 4H54A 1WOSA 3BDEA 3UR0A 1QAIA 4YOYA 3WK6A 2NRRA 1PIEA 1QAXA 3OW2R 4XEIA 4PXEA 3FRYA 4PZNA 1JRPA 3OYLA 4RBUA 1UCNA 2UUAJ 2W8LA 3OL6A 1N5VA 2EBEA 4NRUA 5GAGI 1URNA 2A5XA 2Q0RA 2APOA 2E5HA 1TKXB 5LMUF 2JV3A 1P9QC 4EHUA 2JDJA 2Z8QA 3VQEA 2YV0X 1CBKA 2MAXA 4CLFA 4OV6A 4NPOA 4DTMA 2XHWA 1IUJA 2HQCA 4M41A 4WPAA 1C1BB 2KHOA 5G5HA 2IOFK 2F1IA 1NPPA 3T1YJ 5IIMA 5AM3A 1SL0A 2ZM6J 3U8XA 4MFFA 3B0XA 4BX9C 2H9ZA 3PSTA 4JV0A 5J1NA 4IOBA 4CHOA 2MZ1A 4CO2A 1WSEA 1HYVA 1JIHA 1O08A 2FLOA 4IFVB 2BCUA 1Q95G 3LQVA 3NF7A 1MA7A 4CJPA 5E79U 4HUFA 4KJIA 2WVCA 4AHTA 5BPLA 5DG7A 4MDBA 1VRTA 1IBLF 2DKOB 3H3OB 4M8LA 1FHTA 2CFXA 2HNDA 3SXLA 5ALFA 2HRUA 2W9CA 4FOIA 4RW9B 2ZUDA 1NB7A 2XZWA 1CJUA 4C7QA 4CO1A 3Q22A 4HLBA 4ID1A 3QXGA 3W63A 3LPUA 4WFZA 3PNCA 3BQ2A 4H4KC 3KK2A 5AKXA 3VHQA 3HVRA 3KD5E 1WKKA 2JX2A 4XRHA 1WTBA 4D3GA 2I0XA 2E8MA 4ICLB 3DNCA 5KFNA 1ZQNA 2E1YA 4CD1A 2FHKA 3TTCA 1SCJB 2H5IB 2W7OA 5GAGP 2V2QA 4ZPVR 5DQHA 1JLBA 4HTJA 3G9CA 3A8JA 4DV3K 2RJZA 4JI1F 2QWQA 4DB3A 2DNNA 1NK4A 2MQPA 2CA9A 2C3YA 1QDUB 2J6TA 1VSEA 9ICLA 3J80U 1HWLA 3FBEA 2DEJA 4MT1A 3E1YA 3QEIA 1NCLA 1YJWS 4BBYA 4RQ3A 2D8CA 4DR2F 3ALRA 2D4WA 1KTQA 1OMSA 4KH4A 1TQLA 1G4CA 5FLXU 4YY3K 5ALZA 1WAJA 3JPTA 4FZLA 1Q79A 4LRDA 2VQEK 1CJTB 2OLWA 1MN9A 3ZDCA 2OPQA 3IR7B 4DR6J 2Q6CA 2KOBA 3OTQA 4DOAA 3I8BA 2JOQA 2RQ4A 3A8YA 3UXPA 4G9ZA 4GVMA 1RZMA 5AK5A 3KK1B 3W61A 5ADXA 1X4HA 1YWXA 3C95A 3BKFA 4NJ8A 2ZIXB 1SV0C 5KAIU 2HIQA 3BBFA 2HMIB 1ZTTA 2CJYB 1EX8A 1SI9A 2HGNA 2DO0A 3HLUA 5I4MA 4LFAJ 3MFHA 5KI6A 2K06A 4NM2A 3TSQA 1DFDA 5AQFA 4NLCA 2IHNA 4FN5A 3OV7A 4CK2A 4DR3J 1TZ0A 2NRVA 2J0SD 2YNHB 1U2FA 1FD8A 4YOUA 2BCQA 1BHNA 2QSWA 3K57A 1ZQYA 4HI2A 3FC4A 3THYA 1IR0A 3MOJB 3C6TB 1BO5O 3A5NC 3HSDA 4ILHA 5DDRC 1E3MA 1R59O 3UDEA 1L3VA 2FB0A 2AF6A 3W0LA 4CJKA 1W25A 2AJ2A 3NGUA 1J2MA 1TL3A 3HMJG 3MM7B 4DU8A 3C15A 2HG4A 1MC8A 1KVBA 3MM5B 4B9NA 4FYVB 5B8HA 1U04A 3EWAA 1PILA 4FW1A 3TWHA 4GVEA 7ICKA 2P9UA 1PK1B 3D6JA 2ZIVA 3QATA 1RT3A 5KL1B 4CZIA 5JTIA 5C12A 4NV0A 3QT7A 1DGJA 4BGBA 3I55N 3KJQB 2ZJAA 2NXNA 3W3SA 1N32J 5TKWA 2VWJA 4GFJA 2MY7A 4CJVA 5DMRA 1ZM9A 2DNKA 4L3NA 1YKWA 4DXLA 4Z37A 5F8NA 2YMMA 4KGKA 3VQTA 2YH1A 3OYIA 1D8LA 3UXOA 2AJ4A 2RHSB 4AM7A 1U8WA 3IRXA 3ETMA 1TL7A 3KJNB 4KMOB 3B4DA 1ROFA 3RBXA 3NAIA 4V1Ak 2GHVC 1BMQB 5M1NA 4A57A 4FNIA 1T11A 4CIFA 3U7JA 2Q2RA 2VUGA 4F9OA 4JI4K 1RWUA 1RE1B 1TV6A 1N5XA 3NTUA 2VC0A 4U8VA 3QEBZ 4TVAB 1VLYA 1HMVA 1RDBA 1U09A 2W6KA 3SLCA 5DDPC 2EANA 2WF5A 3DXSX 3AQPA 3UCGA 2OZMA 4J2DA 3GSDA 4KRFA 1NDPA 3FC9A 5HHHA 2QZ8A 4RLEA 3CDEA 4HACB 4ATNA 2QXFA 5J2IA 3U9ZA 4PEOA 7ICIA 3KHLA 3E66A 3PM9A 4QZEA 3O08A 1RTJB 4V19X 2RU3A 5KT7A 1HUXA 4DWIA 1ACMB 2BUPA 2Y1IA 3AHPA 5KFKA 4E98A 2D3DA 4XDCA 3QAEA 3IO1A 2D0CA 5AI6A 2C3OA 5HR6A 3RU0A 2HKEA 3D0HE 3DLRA 1S7IA 2PFOA 2YNIA 5AQGA 4C0OC 2XC9A 3KTQA 4BC2A 8ICMA 4K8RA 1FRXA 2AX1A 5CYMA 4LF7J 3QETA 2V4JB 4B9MA 5FROA 3F44A 2KLAA 3AJ1A 2KRRA 4K4GA 2RU9A 1R0CB 1XTZA 4X64J 4BY9C 5J2GA 3J7ZO 2RKIB 1YIJN 4YOVA 3IV6A 2ZOFA 1QTMA 4JI0F 4FVCA 2VANA 4O0NA 2Z4PA 2Z30B 1X40A 4LF6F 4KQZA 2A41A 3QINA 3JQJA 5HRSA 5EDWA 4KX5A 4UB2A 4TUSA 4IOCL 4M7YA 2R8JA 3O80A 4KHWA 4URSA 1IBKJ 1C0TA 3CC4N 3JPRA 1K73O 1LCUA 4DV5J 2KU7A 4IOAQ 5D78A 1ZYQA 3KD1E 3RBEA 2RDJA 1H1VA 7ICQA 1QAYA 1WACA 4R8UA 4DSJA 2HIYA 3FZLA 1B92A 3FNNA 3B6OA 1FO4A 4OIXA 3M30B 3C3LA 3MK6A 3ENHA 3HHLD 3MBYA 4F2SA 5IIKA 1H73A 3ZT1A 2V8PA 1MN8A 3FZ2A 5K8NA 3NGYA 1VQMS 4EFHA 2B9YA 1KC8O 3Q86A 2GO8A 2OD4A 3CETA 3VQ4A 1N34J 3A0HU 5D49A 5A2QY 1ELOA 7ICSA 2ASOA 3I82A 4YOTA 3MAQA 5GAHU 2M7SA 2VGMA 3TVYA 4X4PA 4Z6CA 5JMNA 2OHFA 4Y34A 4HCCA 3QIPB 4QIGA 4PA1A 5D4OA 3CCQN 2QWLA 2HVZA 5KQDA 1TYQB 2E7VA 3OYEA 1FXDA 8ICNA 4USWA 1LFPA 3FBCA 2IA6A 3EZUA 4JKHA 1NDKA 3D45A 1KD1T 4I7FA 1EAYC 4DR1K 3PKMA 5G0RB 2HVDA 3ZC4A 5KAKA 4GVBA 1UA1A 2HWTA 4ZVRB 3OBIA 4OI1A 1NLVA 3KZXA 3DXBA 4BQLA 5H2FU 3ONQA 1S8OA 4BDYA 3U27A 2EWSA 4KLLA 1CZ9A 4PUOA 2VGNA 1RGVA 3PW0A 2MGZB 1KONA 1EQYA 2QSFA 2WK4A 3M32B 3C6UB 2HHVA 2KXNB 2WF8A 2UU9F 2E4LA 3I56N 4JBCA 3BR8A 1V5IB 3CTRA 3CM5A 2E6MA 4Z4HA 4OX9J 1Q82T 2F8EX 2A18A 4RUAA 5AI4A 2BCVA 2KIVA 4P0PA 2QLTA 4ZVEA 4CECA 4W92B 3IR6B 1TUYA 3HOTA 4ZITA 5J2FA 3UI3A 3ZTQA 3M1YA 4YORA 1WKLA 2UXCJ 2F77X 3OTOK 3SJJA 3OPXA 4B3RF 1JALA 5ALSA 3NVYA 4IH5A 3EKUA 1AYEA 2XSFA 3RB3A 3BO2A 1JJ2M 5AKEA 2Y1JA 7ICUA 3HVAA 3I0SA 2ALZA 4HI1A 1UZHA 4KV8A 2OH2A 3BZCA 3OYMA 2R7XA 2PC6A 1HR0J 4LREA 1S77D 2Q36A 1FJEB 3M1VB 3BKTA 4Z0UA 2WW8A 5IWAJ 5BR8J 1U2VB 3HP9A 1HQ2A 2YX1A 4LJMA 2G5HB 1ULRA 3VA0A 1I1GA 5K4LA 2YQ3A 2C2MB 1YJ7A 3MCOA 1LXJA 4ZCKA 3M4XA 1KL9A 2FC0A 1M5OC 3SD7A 4WQ4C 2CVIA 3SQOP 2MSNA 4O8KA 1XBWA 2L48A 2YKOA 4KB1A 1S4FA 4UOCA 3L7OA 3KG0A 3KD3A 4CHYA 3UW1A 1YG0A 1Z1ZA 3BPSP 2HYIB 5HATA 3D2FA 3F5TA 4U7CA 2FHMA 2IMWP 4ZVGA 5A6PA 3N4PA 4ZLNA 2KM8C 4L3QA 2QEXN 3OVAA 5AQXA 4M94A 1V3SA 1ZQDA 4EELA 4CE9A 1HJPA 4P4OA 1XMOK 1VQ9N 5BPNA 3K2YA 5LSRA 2LLZA 3PYDA 4DHYA 4M9LA 1NBWA 1Q1KA 2ZJRQ 2DR5A 2GTDA 4E1MA 4BDZA 4CF0A 2IC3B 3KLGB 4JV2A 2LM4A 3ZLJA 4M5MA 4M9JA 3FSYA 5ETQA 4LR7A 4JK1A 1TFYA 4WYLA 2HFVA 1AUSL 4QZFA 3ORYA 2UUTA 1KVIA 3CCRS 2PSZA 3ZCMA 5HRNA 4WYWA 1S1TA 2ISOA 4ZVPB 3CCWA 4KHYA 3IWNC 3CULA 3S6JA 1NJZA 4US9A 3EGWB 2PO4A 3OS0A 4LIWA 1L3KA 4AE5A 4A8FA 2G8HA 4EZ6A 1FI4A 2NRXA 4CF2A 2RMLA 4HVZA 3F9MA 1BHLA 4KIAA 2ZIUA 3U9DA 4DQRA 4JEPA 2H1YA 1R89A 4WJ3B 1L3TA 2CDRB 2XY5A 1VQLS 2VJ5A 3POTB 1JI7A 4DJBA 4DV3F 4RQ6A 4IDKA 4JLHA 2IOCA 4RNMA 1Y5NB 1F9HA 2MQLA 3AQOA 2O8BB 5C25A 5GTIU 1TE2A 4F4ZA 2YTUA 1OO0B 5IQQA 3JSMB 1HBNB 4PL8A 4RWXA 1RBRA 3M6GA 3V9XA 3JXOA 4I6MA 4BR0A 4J03A 3AVJA 5AQSA 2JLEA 3ATUA 3AEVA 4YY3F 2ZH6A 3TUJC 1N48A 3ZXWA 1NU0A 4ED8A 3C14A 3MDQA 2VQEF 3MAAA 2Z1GA 1C0UA 4C11B 2I1RA 4RQMA 5FP0A 1QM9A 2EKNA 4JYAJ 5ADXH 4JKEA 2YWEA 3BEGB 3UPFA 1FERA 1S72N 3MN7A 2LXUA 2DXEA 1Y7PA 3V81A 2NYIA 4HT5A 5JLFA 4PKGA 3D2EB 4OKJA 3MN6A 2OM6A 2AGOA 1PVPA 2QJ3A 3IBPA 3G4SN 3HP6A 1WNSA 4ZN3A 3UXNA 4ECQA 1RWWB 4QWEA 3O1WA 1D8YA 2V8VA 3PIPL 1P27B 2CNNB 1ATSA 1CXQA 2NRWA 4WYBA 4B8CA 1TUWA 1CJKB 2V94A 3TSUA 1NH8A 1ZJMA 4DSEA 3GPAA 2P6TA 2W7AA 2HNZA 5EOZA 3KWMA 4M9HA 2HHHJ 1LW0B 2A6MA 2Y3YA 4DV2J 4CZMA 2CPFA 3CJTA 4CLYA 4U7UD 1HIWA 5E3RA 4C0HA 2IVPA 3ZD8A 3KYLA 4AXIA 2LEAA 3HW8A 1N0UA 3K2PA 4UAUA 1E6VB 3K9JA 4Y2JA 4K4SA 2W01A 2VG6B 2HVIA 8ICLA 2O67A 4CZKA 5BPCA 3KKRA 2VOPA 4JUZA 3CCSN 4RW6A 1V38A 3R1HA 1HYSB 5AI0A 3LM2A 2RRBA 3THWB 1SC3B 4OZNA 1GX6A 1DT9A 3BB5A 3FLCO 2IDOA 2Y8WA 1KSPA 1Z05A 4UAZA 5KFOA 3U02A 4UUWA 2P9SA 1KVJA 1ZQHA 1GH8A 3GZ7A 4NA2A 1DBDA 9ICMA 1MWQA 1UW4A 3TA0A 2E8PA 4DCHA 3J7AN 3AOBA 2HQIA 1VISA 5CHIA 3NE6A 2VKQA 4FJMA 2G9OA 2YY6A 1G1XA 3TUZC 4EP4A 4UZCA 4DR5J 2DHHA 1S59A 1U2CA 2KMDA 5D0HA 1ATRA 3HKZF 2CJKA 3AVFA 1NBEB 1VHIA 5AQZA 3J81O 2FHJA 3BS9A 5AXKA 3I5BA 3GFKB 2R8GA 4QZDA 1C0MA 2KKPA 4CDGA 1JCGA 2LA6A 2RT3A 3PACA 2EG2A 4JI4F 2C2RA 3EVMA 2GVDA 4UARA 2G13A 5C24B 4E1NA 3RB0A 3MGVA 2BX6A 2EC2A 5M2PA 3MGJA 2A6AA 1KQKA 1ZTWA 3GB0A 1C6VA 1M6YA 1RZTA 8ICRA 3EDRB 4DG1A 4B6JA 2C2OB 3AT1B 1EP4A 3FSIA 5HHIA 1FTRA 1ZQRA 1X4DA 2AJ1A 3VQ8A 4ED1A 2I7PA 3H08A 4LF9J 1B0VA 2DITA 3KUGA 1LAVA 3G2XA 3PCOB 5ALYA 2JSXA 4YCXA 1Q4RA 2ZH7A 3UNYA 3SDEA 4CESA 3TX8A 3DRPB 1C1CB 2WCXA 4NYOA 3IP0A 1IG6A 4H0YB 5HOOA 4FZZA 2XCAA 5HMLA 1RK8A 2GVZA 3L2WA 3R5BA 4HKQA 3OFHA 3CC2N 2HMPA 5CCMA 3JTNA 3ULHA 4AHRA 3VQ9A 4BLGA 2RH3A 3JS6A 1LV5A 1LWXA 4TY9A 1K9MO 4A4JA 3N4QA 5J0PA 1RTIA 5DBBA 9ICPA 2PI5A 3Q7CA 4H5WA 4JI2K 5MLCV 3KHRA 3WQUA 4K42A 2DBBA 2OHDA 2F44A 3SV4A 5LT5A 1JLCA 3MXJA 4P2XA 1SKWA 4OPHA 5F8HA 4ISGA 1HIYA 1T3NA 1XMBA 1YJNS 3ASMA 1GLEG 2NREA 3GZFA 1GK8A 1SUQB 2XULA 5J8YC 4F5PA 1F5BA 4F91B 1FE0A 3H2LA 1XR5A 2R7WA 2V67A 1YJTA 3PFEA 3KXDA 4BC7A 1BI4A 3MEGB 3TARA 3AVGA 4A62A 4FJXA 3N4WA 1UPPA 2Z1HA 1VSJA 2G0AA 5DETA 2OPPA 3TWZA 1UQVA 2KNJA 4LF1A 4K0KJ 3C16A 4QOZB 3MM8A 4CEQA 4WK1A 4OYBA 4DF8A 1TK5A 4YXMA 4Q0BB 2IJRA 4TLQA 2JXJA 4XO0A 3H4BA 5IC6B 5B08A 4FPBA 4UAWA 1RFQA 4I6WA 2YI1A 2OD6A 5KFSA 3QEAZ 4C8KA 1XO0A 3MPYA 4I2EA 3GQCA 4Q7AA 3G96A 2XHCA 3PKYA 3ENQA 4NI2A 2HBQB 3KVGA 5U47A 1YBTA 4DPTA 4PWDB 4YR0A 3H40A 1WSGA 4KH5A 3G71S 1Z6RA 3IS9A 1P8GA 1LKYB 1GMWA 3ZX0A 4G1QA 3Q2TC 2DVIA 2UUAK 2EX3A 1L7NA 2BJ3A 1GXTA 4BREA 2CPDA 1TFWA 2Z1JA 2GNKA 3BSNA 3HHLB 3KLEA 4N5SA 3ULEA 1FXRA 4JI7J 4F3TA 1HQUB 4OJGA 2Z1IA 5K9FA 2FC9A 3MMJA 2FI1A 2K8BB 1ZQLA 3H59A 1BWVA 1GT8A 1HX1A 3EXYA 1AZSB 4C97A 1U6FA 3TTDA 3R6GB 5CZ1A 3OR2A 3ITHB 2MQQA 3DGVA 5AM2A 2IM2A 4DR1F 4V19J 4DV4K 2R8HA 2HF3A 5HNKA 5A0LA 3GJTB 4ZCLA 3JSRA 5AXLA 3QFPA 1XI1A 4DQQA 2MZTA 2YKNB 2IGIA 2DCUB 3TABA 3GG1A 4USKA 4OJOA 5DM7Q 3C66A 3THXA 5BXIA 2ZE2A 2RUGA 4DX6A 4QZ9A 2WFAA 5L9XA 3S7RA 1EWQA 2BW7A 2PMZC 5DB6A 1ASUA 2KHDA 3SSSA 5BYRA 1UHUA 1T7PA 1IR1A 3LAKA 4KHRA 2VPWB 4PGQA 3SQ0A 3OYCA 4DTNA 4ANCA 2RP5A 3IG5A 2IBKA 4Q8FA 4RQ1A 2OJ3A 2DQNB 3MMCA 1KFTA 3F56A 1DXSA 4CYUA 2YHBA 8ATCB 3NRBA 1ITPA 4M95A 5D3GB 3OTOF 3W9JA 4FK4A 3PO5A 2P6UA 2LCWA 3IGVA 3SBGA 2V63A 3R2DJ 1JQGA 4NLRA 5CA7A 1SKSA 1NHKL 2NLWA 3KG1A 4F72A 3MXIA 4ANDA 4CLWA 1JJHA 3HVTB 4DUYJ 1J5OA 3R7SB 3CCLN 4FPRA 2LPEA 1A7GE 2R7RA 2OP5A 2RIJA 2JWNA 1SIWB 4O5EA 3KKAA 1RABB 5B0BA 3AA4A 3CP8A 2YNFA 1B0XA 3CNQP 1WCNA 5KFFA 5MAOA 2QX0A 1UT8A 5HLFA 4KLMA 2E5GA 3F2KA 5FJ4A 4ZP6A 4H0PA 4DUZK 2Q4TA 5B0FA 5EOYA 3ZX3A 2VG5A 4M5NA 2V34A 5LMUJ 3RMBA 2Z2ZA 3RFAA 4NL5A 4W4MA 2IVNA 5AQIA 1WB9A 4RUHA 1S4EA 5J1PA 5TKYA 3WEEB 3JQMA 4TY8A 2P1JA 2POKA 2W9BA 3ULDA 4IG0A 4OHZA 2Q1NA 3C5GA 5CY4A 4XTTA 1XMOF 1RM6C 2XCPA 4HDHA 3QMQA 2Q79A 3TZZA 3C2LA 3VTIA 4B3OA 5J2QA 2ZWOA 3CWJA 5L1IA 2GUPA 3QFHA 3THPA 4NOHA 2BE7D 2RHFA 1XNRJ 1B22A 3WNFA 4C8NA 3SK3A 4MFBB 4A8EA 3VC8A 3LDSA 4NZ7A 3VVUA 1RKJA 4UQTA 1IBLJ 4LBIA 4H03B 2HQDA 4OZJA 2E1RA 3DLKB 4GXJA 3RH6A 4XH5A 3R6MA 3V9UA 3AAWB 3F53A 5DB9A 2X7IA 4I64A 2H3IA 4C3MA 5L46A 1J97A 4ED5A 1U49A 2IOFA 3PJ9A 3BSOA 1B99A 4F50A 1YI2N 1DEJA 1Q3VA 4UB5A 3CF5Q 3T19A 3AVLA 2YH0A 3CSKA 3P5JA 2QK9A 1CRXA 1X4AA 2HHWA 3DLBA 2CRLA 3C5FA 1QUVA 5H9FK 4JI1J 1R0AA 5E3AA 5EVZA 4Y65A 2EC0A 4FLUA 2RQMA 3GJRB 3QWUA 3CVKA 3G82A 4B8AB 5FLXO 4U67L 5CCLA 4CEDA 1ZXOA 1HUZA 2FDNA 4E7HA 2AJ0A 2ZDPA 1M1HA 3ISDA 2YHAA 1EZZB 3O6WA 2D74B 2O8EB 2YNGB 4DR2J 3R6LB 2F8KA 1HQEB 2VJVA 5AI5A 4C8MA 3DHXA 5DBAA 3W9IA 4G65A 2DNRA 3QT6A 3DAWA 4PJ0U 1URRA 2K7JA 2CG4A 4W98A 4EX7A 1LB2B 2DHGA 3ZNUA 2ASJA 2MJNA 4NL9A 2KD1A 2KK0A 3SQGA 2RQKA 4EK2A 4OCZA 1XNQK 2DNGA 3GTYX 3GU0A 2LVWA 1RB0A 1HUOA 1QS4A 1OYDA 3OTBA 3QSIA 3R9KA 3HHNB 4DCJB 3FFKB 2W2NP 4FW2A 3T9ZA 3CQYA 4QIFA 3H5UA 4N77A 3P4IA 4DU7A 3EGZA 1SS6A 2OFHX 4LSNB 4ED0A 1KAXA 2OANA 1UVJA 4PG6A 1WWUA 3SBMA 3GP9A 1ED1A 2XNRA 7ICMA 3N6LA 3D6HB 2A6OA 2HGMA 3P5BP 4F7VA 2P9KA 4FLWA 2AZ1A 4ZK7M 1LAWA 1RAIB 4X4NA 2BABA 5GIOA 2DXFA 3F41A 4IOCQ 1J27A 2MRLA 1QE1B 3CJ4A 4EUVA 4PYDA 4BR2A 3MEEA 1EETB 4WFBL 4DR7K 5GIPA 1AUDA 3BSCA 3V6DA 3T1HK 2ESEA 2DJWA 2AXTU 4KLIA 3CDWA 3MCAB 2BXJA 3FEXB 2XS7A 5EE3A 5CD4A 2OIHA 5J2JA 1QVGM 4DDFA 1NRKA 1UETA 1FX4A 4HUEA 1CZBA 4Y2KA 3CJ3A 3RVCA 5I3UA 4J9OA 3SI8A 3NMUA 1HNIA 1R7IA 1VQ6S 4M47A 3O9SA 3VCBA 1WOOA 4EYHB 3LANA 3WQPA 1QTNB 2AYEA 2KVSA 2WOMA 4BC4A 1NJXA 4RZRA 3AO4A 4ILJA 2WRMA 2WBMA 4OZ2A 5GADU 4F25A 1U26A 2QB1A 5F8MA 2YJEA 2XY7A 2VICA 4PHEA 9ICSA 1S79A 2A1SA 1TUGB 4KE5A 3VCDA 1PYSB 2JVRA 4XK8C 2JZ5A 1O1WA 3QNOA 4F2RA 4HHTA 1WDDA 3E0FA 4KHMA 4JV1A 1Q78A 3WIVA 4YN4A 3U1LA 7FD1A 1RBSA 4Z94A 1T4GA 3CCUS 1BPEA 1W7AA 4AILC 4XUSA 4ES2A 5HMWA 4KGXB 4HUGA