4F2RA

Dna polymerase i large fragment complex 3
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
578
structure length
578
Chain Sequence
b'MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
molecule tags Transferase/dna
source organism Geobacillus kaustophilus
publication title Structures of a High-fidelity DNA Polymerase
rcsb
total genus 202
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2rA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2rA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2rA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2rA01
5KFZA 1Q9XA 4XQ8A 4QZDA 4DSFA 7ICQA 1C6VA 5D3GA 3V6DA 2FLPA 3QEXA 2UVRA 4LH4A 1ZQKA 1TVRA 4CEBA 1NOYA 1FK9A 1DGSA 5DB6A 5J1EA 4QOZB 4CIFA 2HW3A 9ICXA 2D5RA 3GQCA 9ICNA 4B08A 5KTQA 4RT3A 4O3OA 3SUQA 5EOZA 4Q5VA 2B5JA 3V1RA 1U47A 2FLNA 4FK2A 8ICJA 1NOMA 3MR5A 2WOMA 2YNGA 1RT3A 4IRDA 5J2PA 3CFOA 3NF9A 4W5RA 4RUAA 3NAEA 4DTPA 4DTNA 4CFCA 3C6UA 3QETA 1TAQA 3KLEA 5KFPA 4BGDA 5J0QA 5CYMA 3LZIA 2PY5A 5CA7A 4BXOB 2KFZA 3K75D 4DFMA 3T5HA 3SPYA 4UB5A 4F4XA 2G8HA 4DL6A 2XY8A 2Z1IA 5CZ2A 1ZBFA 3L2VA 4F3TA 4M47A 4G3IA 4CJ3A 5J0PA 5CR0A 5HRNA 3AVMA 2Q0ZX 2NRZA 3H4BA 1C1BA 2XCPA 3KLGA 3DM2A 1V9PA 2G8UA 3EW9A 1LWEA 2VWKA 3MBYA 7ICOA 4YNQA 4F2SA 4GC6A 4DSJA 1ZQAA 2GUIA 3SI6A 2FPKA 4F5NA 2M9NA 3F73A 3SYZA 2HHVA 2B21A 4BDYA 1VSLA 1RBVA 4ECTA 1Y97A 2W9AA 4KN7A 8ICOA 1XO1A 4E3SA 4E1NA 1RYRA 3NF6A 1VSKA 5L1LA 1S0VA 1Q9YA 1KEJA 5FROA 2AJQA 3LDSA 2HHXA 5J2MA 8ICZA 3S3MA 5L1IA 5KG3A 3KKRA 2E6LA 4I2JA 1JL1A 1WAFA 4FS1A 2Y1IA 4OKEA 2OA8A 1S6QA 4PH5A 4DFPA 3SUPA 1A5XA 1IH7A 5BPCA 3QINA 3GIKA 3AV9A 2BGGA 1VRUA 2EX3A 4LZGA 1S9EA 4RW9A 2PZSA 1BPEA 4IBNA 4FLTA 2W9CB 4UB4A 5KT3A 4ECSA 4IG0A 3V9ZA 5EWGA 2FPMA 4DL2A 3ZT3A 3RAQA 3LDAA 1IXRA 4MF2A 1K1QA 2BCQA 4LH5A 2PFOA 5CYQA 5DLGA 1Z3EB 4Z6FA 3CQ8A 2PFQA 8ICRA 4O0JA 4N56A 5DBAA 3DOKA 4CGFA 1O1WA 1TV6A 1S1VA 1QS4A 4KO0A 4ZH4A 2PFPA 5HP4A 2KZ3A 4R66A 1RXVA 4ECXA 4CGHA 3MDCA 3BQ2A 2DFEA 4JWMA 4CHPA 4YCXA 5J2FA 4FBUA 4B9UA 4DQPA 4TURA 1TGOA 4IFVA 2RKIA 4J9PA 4YR3A 3RR7A 2C22A 2DPJA 2VG7A 4NM2A 3H8SA 4Y1DA 1VSJA 5HRPA 3QIOA 4F91B 1ZBHA 4ED0A 1NJWA 1A77A 4FM1A 3LZJA 4BE0A 4O9MA 3HL8A 3RJEA 3I0SA 1LWCA 2YNHA 2KQ2A 4KLTA 3LANA 3ITHA 4C8MA 2VA2A 4DTRA 2FPLA 9ICIA 3Q8LA 4ED7A 1UA1A 3MGIA 7ICKA 2ALZA 5KFJA 5J2BA 3QZ7A 7ICEA 2AGOA 2Q3SA 3SNNA 4MFFA 1KFDA 1KDHA 1HJPA 3ISDA 2JEGA 5IIKA 3S3OA 4KTQA 2ASJA 4KHWA 1JL2A 4IR9A 2VANA 2P5OA 5BOLA 2XGPA 2W8KA 4FLXA 3LWMA 4K8XA 1EXQA 1VSHA 4F50A 5J2CA 4DU4A 5E41A 2VG6A 3KK1A 3I0RA 4HUGA 3L2WA 4FZZA 3IHQB 4XUSA 3CYMA 5CZ1A 3VN5A 2Y1JA 2IAJA 9ICCA 4NYFA 9ICHA 1RDDA 4RW6A 4GLXA 2YHAA 3SZ2A 5KFXA 4CGGA 2KZZA 4R63A 1JXLA 4MF8A 5HMMA 3JPNA 4KHYA 3GV7B 5KI6A 1J5OA 3VQ7A 3NBPA 4FK0A 4QWCA 9ICVA 3PX4A 1CEZA 1BGXT 3QIPA 1ZQRA 3KD5E 1BQMA 3VQ9A 3LP2A 4MFCA 4KI4A 2HNYA 3AO2A 2FMSA 3QZ8A 1A5VA 4CJ4A 1NK5A 3KHHA 2GWSA 4DTUA 4RUCA 1BI4A 4ECQA 5CHGA 4B8CA 4P2HA 1RBSA 4K4HA 2F1HA 1KFTA 3L2QA 1A76A 2F8TA 4E7KA 3QNOA 2HHQA 3NCIA 4YN4A 1L3VA 1IKWA 2H5XA 4PA1A 1F21A 5FRMA 4EYHB 8ICWA 4HHTA 3OYLA 4DLEA 4NY8A 1X9MA 5KFIA 1ZQYA 3Q8QB 3C2KA 3WNHA 3MABA 2YKMA 4KLMA 1TKZA 3K5NA 1WLJA 9ICLA 1NK0A 4Z6DA 1NK9A 5F9LA 3KK2A 4E7IA 4AHRA 4FXDA 3P1GA 4Q45A 1JXEA 1KVAA 1RILA 1R0AA 4YMMA 4M2YA 4IRCA 4DS5A 4YVZA 4M3UA 3D0PA 4C8KA 1XHZA 1CXUA 2DTUA 3VQQA 4DLGA 1KSPA 3RJKA 4QZCA 3RJHA 4CHZA 3EY1A 3HW8A 3PV8A 7ICGA 2PI4A 5D49A 3PNCA 3MGHA 8ICNA 1RBUA 4HVJA 1RTIA 1ZBLA 5KFMA 3MR3A 7ICSA 2BQRA 2YNIA 4NLKA 3ZT4A 2XY5A 1VRTA 5J2EA 1RBTA 3UQ0A 3OYGA 1GOBA 2E6MA 2KW4A 1WSGA 4FM0A 4KV8A 2WTFA 1YTUA 4PGXA 3TAPA 4Z4CA 4ID5A 4DL7A 3VQEA 1SKWA 3L3UA 4F3OA 4RQ1A 4Y1CA 4DL5A 4K8ZA 3KIOA 3H40A 4E1MA 1XSNA 4CHYA 4ZHRA 4EEYA 2ITGA 3OYDA 8ICVA 4ECUA 5J0YA 1ZYQA 4O5CA 2V4QA 3JPPA 4QZHA 3OYNA 1WSHA 3NH1A 4EZ6A 3C5GA 3BQ0A 1BVSA 3VQ5A 3PX0A 3V9SA 4UB2A 2AQ0A 1B92A 4CF8A 3DLBA 1KTQA 4CHOA 3TANA 4TQRA 4QZFA 3NF8A 3UPQA 4ELVA 1TK8A 1S77D 4M9JA 3LP1A 4QAGA 3IM1A 7ICIA 3SJJA 4Z6EA 4TQSA 1JLQA 4CE9A 2XGQA 3QEBZ 4KLEA 5DG9A 2FLLA 3B6PA 3AU6A 2J6TA 4I29A 9ICJA 2IHMA 1Z00A 1S97A 4N47A 3ZSYA 4FJ8A 1UT5A 5KT5A 3RJGA 1RZTA 1RYSA 9ICMA 4CJUA 2BPCA 1BPBA 2JZBA 4QW9A 3VQPA 4J9LA 2KFNA 4B9TA 1CZ9A 3M8QA 1Y88A 4BE2A 2NRVA 1S0MA 1T3NA 3GFKB 5J0SA 5KG7A 4ZTFA 3KKSA 4CGJA 9ICFA 4F4KA 4Z4HA 4J9QA 4J2AA 4MEXA 4QWEA 3HM9A 2BCSA 2HMIA 2BCRA 2RN2A 4FVMA 4IDKA 3JPTA 4E19A 3B0YA 4RU9A 1VSDA 4M0AA 1U45A 3HJFA 5T7BA 4FJ5A 9ICWA 2BQUA 4Z4GA 3AA4A 4O5BA 5DQHA 3AVCA 5J0WA 3A2FA 1NKBA 4WE1A 3PUFA 2ZUBA 4CHNA 4FJIA 3MECA 3K2PA 4I2PA 2R8KA 4DTMA 1ITGA 2ZUDA 2I5JA 3WNGA 4KLUA 2HB5A 4CJQA 5DG8A 3KJVA 4Q44A 1HYVA 1U9LA 4CGDA 4R64A 2KTQA 1C0MA 4E7LA 1A5WA 1BISA 4HUEA 3TAQA 3QE9Y 3CFPA 4AHTA 4QWBA 2P5GA 1SKSA 4DOCA 5L9XA 1W0HA 5DK5A 2LYHA 3OYEA 3MEGA 4FW2A 5KFUA 4J9KA 2ZJ8A 3V1QA 2FMPA 3OS2A 4R5PA 1NJZA 4CFDA 7ICUA 4F5QA 2D0CA 1RT5A 4FJGA 5TZVA 2DPIA 3G6YA 3OHAA 4Z4EA 1D9FA 4GXIA 1QLNA 4KTZA 4DQQA 1J9AA 1KVCA 3OYKA 3SV4A 4EZ9A 9ICUA 5KFGA 3EYZA 5J0XA 3ZSRA 4RQ5A 2XY7A 3PMNA 4QZ8A 3FDSA 3MR6A 2NRTA 3V4IA 1SL1A 3DI6A 4RT2A 4RPZA 3N97B 2G8FA 3V6JA 3MDAA 3ALYA 4LSLA 4LVSA 5KFCA 4DMNA 4DQRA 5KFQA 1IG9A 4OLAA 3O3HA 5IILA 3FFIA 3LK9A 1ZQJA 4W5QA 1IKYA 4KHNA 8ICXA 4I2QA 1C1CA 3OYAA 4CJPA 3ISBA 4NLZA 3UXOA 9ICAA 5HHHA 4RQ2A 1S0NA 3RH4A 3RBEA 1MQ3A 4I2HA 4I7FA 5FRNA 5DQGA 2OPPA 2ZTEA 4DU1A 4F4YA 4CJSA 1S1XA 4Z4IA 3QNNA 3QESA 1QE1A 1HYZA 3K5LA 4CF2A 1BHLA 3ZDEA 1QSYA 1CZBA 3KK3A 1XWLA 4DL3A 3C94A 4YD1A 2UVVA 4CIGA 4FZYA 5KFHA 3JPRA 1NKEA 1QSSA 1J54A 2EHGA 1RDAA 4JS5A 1WNSA 4KLHA 5CWRA 5DLFA 3V6KA 1S1WA 2FMQA 3P83D 5D4BA 3CM5A 3PW4A 3AO3A 1BIUA 4I28A 4CJFA 5KG6A 3U6FA 3THVA 3AA2A 3RB3A 1XSLA 4J2BA 4CEZA 2WONA 1Z26A 4DTJA 4L8RB 3ZCMA 4B9MA 3SQ1A 4RQ8A 4B9LA 4KN4A 4W5NA 8ICHA 2R8HA 4EP5A 1L3UA 4GMJB 3IAYA 2B4JA 1MU2A 4OKJA 4FJJA 1HUZA 1KVBA 4ED2A 4CK1A 2FBVA 3KLHA 1K6YA 4Q8FA 1TK5A 2BPGA 1QSLA 2J6UA 4I2EA 1BI4B 1L3SA 4DWIA 1KFSA 3AVJA 5KFOA 4I9QA 2UVWA 4HCBA 5HHIA 4H4MA 3MEEA 3HPHA 5DDYA 7ICFA 3C21A 1HPZA 3BQTA 4RNOA 7ICJA 3IS9A 8ICKA 4ICLA 2BR0A 1BPDA 3QLHA 3TAFA 4B3OA 3T1AA 2JEIA 3RAXA 4AH9A 4KAZA 1YVUA 1DLOA 3NGIA 1ASWA 2YNFA 2IC3A 2NRWA 5KFEA 2I9GA 1UOCA 4QZEA 3HP9A 3JPQA 5DGAA 4PUOA 1S10A 1WSIA 1ZQOA 4CJLA 1FKOA 5HRSA 2P51A 2ZD1A 2O4GA 1IKVA 2XO7A 4B9VA 5EWEA 3LWLA 2G8IA 3AO5A 4FLVA 2MUTA 4JRPA 3MFHA 3TQ1A 4CHQA 3M8PA 4FLYA 1TL3A 2NUBA 1I3AA 2JZBB 5JUMA 5DBCA 4JWNA 1WCNA 2ZJAA 3OVNA 2HVIA 1LWFA 4YMOA 1L5UA 3ZD9A 5KRTA 8ICTA 5KFVA 4QCLA 1JLAA 3HPGA 2W9CA 1JIHA 4RPYA 3ULDA 3RMCA 4F4WA 3PW0A 3TFSA 4QZIA 4CEDA 1CLQA 1T8EA 3WNFA 1SV5A 1XC9A 4JK1A 4JV2A 3PW7A 1JLCA 4FZXC 3U3YA 4NM1A 3M9NB 4QW8A 4QZGA 4EBEA 3VQ8A 8ICMA 4OPKA 5KFFA 4OGEA 5KFRA 1X9SA 3SQ2A 4C8OA 4NCAA 3LPUA 5KG5A 1NK7A 3EWAA 5IIIA 5DDMA 2PFNA 1RT7A 3AVAA 2ISPA 4FJHA 3VQ6A 3H8WA 2ZQBA 3T5LA 3SV3A 4O3RA 5FDLA 2XHBA 3AVGA 2W42A 4FYDA 4RQ6A 1REVA 5IIMA 1TAUA 3PR4A 3E01A 2PYJA 4JV0A 1T05A 4F5PA 3V1OA 4YD2A 4MQ3A 4CECA 2X74A 4GXKA 1ZQBA 5I42A 2Z1JA 5DBBA 3T19A 1RTDA 4IQWA 3V7KA 2I1QA 1VSFA 3H08A 3CG7A 2FC0A 4DL4A 4IQUA 2QXFA 1QQCA 1D9DA 3KHGA 3OYFA 4ECRA 4KREA 1UT8A 4R8UB 4MFAA 8ICGA 2MUTB 1ZQZA 3OGUA 2OZMA 3D45A 2PXIA 5EWFA 3ZT1A 7ICPA 4DSKA 1KRPA 1XI1A 4ED6A 8ICUA 1U4BA 2JEFA 4YP3A 3HWTA 2A1RA 4KPYA 3RBDA 4FO6A 5DKWA 3OSPA 2OYQA 4X5VA 3K4GA 1WN7A 2IS3A 1ZQVA 4DS4A 3GILA 3UQ2A 2YKNA 3ZSVA 3GIMA 1DTTA 2XC9A 4NCBA 3Q8PB 5J0RA 4PQUA 1C0TA 1NK4A 3EPIA 4DSLA 8ICPA 4IG3A 4RZRA 3LP3A 2P6UA 2FBXA 5KG4A 3QEIA 1ZQNA 4YFUA 3DLGA 3EZ5A 1TV9A 4K4IA 2DFFA 3O4NA 4W5OA 2ATLA 4P4OA 5D46A 1C1AA 1EXNA 4LY7A 2F8SA 9ICGA 1J53A 5J2KA 3Q8MA 4DQIA 4P4PA 3RMBA 3C95A 1EP4A 4YQWA 7ICRA 3MFIA 1JX4A 1GOAA 2VG5A 2IGIA 5J0OA 2VWJA 3N4MB 3H8JA 4M9LA 1KLMA 3DLEA 3U3GA 1RTJA 4ECZA 3RRHA 4CJRA 4M45A 2OPRA 4EYIB 4ZTJA 1KCFA 3B6OA 4FK4A 3DRSA 4QZAA 3AA5X 4FLZA 1B9FA 1JN3A 3K58A 4FM2A 3TAEA 4KHQA 2R7YA 4N41A 1VK0A 5KT7A 3KLIA 4GVMA 1JLBA 5K14A 1FXXA 2PYLA 4ELTA 4KKOA 3NTUA 3KHLA 4PGQA 4NLGA 2BANA 3DLRA 2JEJA 4GW6A 4CCHA 2RDIA 3VA0A 4RW8A 1LAVA 7ICMA 1C0UA 4QWAA 3GV5B 1ZQUA 4O3SA 2V9WA 1N6QA 3C23A 4KHSA 4DF8A 1BCMA 4YR2A 2HHWA 5BOMA 4PY5A 4KMUA 4PHEA 1X1PA 2P66A 2BHNA 1TKXA 3V9WA 2BKEA 3PMLA 3IG1A 4Z0UA 3RH5A 1RCHA 3ZDBA 4KLFA 3PW5A 1IM4A 3T5JA 4KITB 5KGWA 1S9GA 3G0ZA 3WNEA 3C1ZA 3AUOA 4ELUA 5J2IA 4BWJA 1NJYA 3T3FA 4H4OA 1KLNA 1CXQA 4Q43A 4FS2A 4BWMA 5J2GA 2AU0A 1X9WA 4NXZA 5J29A 1ZQFA 4Q8EA 2IDOA 4F93B 4M9HA 4CJEA 3LP0A 1VSIA 3P5JA 2JGUA 3ZD8A 5C42A 1ZQLA 4IQVA 2B6AA 3GDXA 4N76A 5DB7A 4UB3A 1ZQMA 3BGRA 4FW1A 4KHUA 3HP6A 3AVLA 1S1UA 4IR1A 3T5KA 2ATQA 1S76D 1UWBA 4CEFA 3O3FA 5CY4A 1VSMA 1NK6A 5CB1A 1HUOA 5HBMA 9ICTA 1QHTA 3DYAA 3K5MA 4PHAA 1SL2A 5KFTA 3LAMA 4O0IA 4CFBA 1SL0A 4AHCA 1T03A 4B9NA 3ZSZA 3K5OA 3ASMA 4O55A 3VQ4A 3PO5A 4ED3A 1EKEA 1ASUA 1RT1A 1UA0A 3TAMA 1ZETA 3M9MB 4O5EA 1JLFA 5KT6A 3PVXA 3HT3A 4E7HA 5DB8A 1NKCA 4NCGA 5C25A 8ICEA 3L3VA 2ZE2A 4UAYA 4GC7A 2GV9A 1D8YA 5IIOA 3G6VA 5HROA 1RT4A 3FYHA 3LALA 1YTAA 3TR8A 4E7JA 3MAQA 2O4IA 3V7JA 3L8BA 4BDPA 4IQTA 4I9LA 4CEQA 2P1JA 4CJVA 3NGYA 3H7IA 1WSJA 3MXJA 1BCOA 3Q8RB 4FLWA 2ASDA 4CEAA 1WSFA 3VQBA 3QEPA 2AQ4A 5J2DA 3RJJA 4O5KA 5HRRA 2YV0X 5KFLA 5J0TA 2F96A 2XCAA 3SUOA 1BIZA 4CEEA 3VA3A 4CF9A 3QEAZ 1NJXA 1DTQA 4KLOA 1MSWD 7ICVA 4PGYA 4I2BA 3JPSA 3MXMA 4J2DA 2C2EA 1ASVA 4DOAA 3ZSOA 3ZT2A 4UQGA 1ZQIA 3OYHA 2KZMA 4AILC 4OGCA 5HLFA 3ZSXA 3ETLA 4YMNA 3DRPA 1N48A 3RTVA 3V9XA 1HQEA 1L3TA 3OYMA 1HYSA 1SKRA 2BCUA 4RQ7A 4BE1A 1MQ2A 1GOCA 3AVIA 4DTSA 5KFNA 1S5JA 2IA6A 3NE6A 1RT6A 3NHGA 1HJRA 2RPIA 5SZTA 2ZUCA 4BDZA 1ZQCA 4M3WA 2IMWP 4DTOA 3I8DA 3RB6A 4M3RA 4UAZA 2NRXA 4QZ9A 4RW4A 4OLBA 3AVBA 1X2IA 3L2RA 3ISNC 3IRXA 1ZBUA 3ZDAA 2BE2A 1FKPA 2F1JA 5CP2A 5DG7A 3OYCA 4N5SA 2ZJ5A 2FBYA 2GBZA 1ZQTA 4UBCA 1SZPA 2LSNA 4HTUA 4IKFA 4R65A 4KLDA 3V72A 1JMSA 5KFBA 3C1YA 4LZDA 4XRHA 4J9RA 1WCLA 4AHUA 4M3XA 2A1JB 2DY4A 3NH0A 2C2RA 1JLEA 1TK0A 2MAXA 3UXPA 1K1SA 8ICCA 3VQCA 4CGIA 4O3QA 4CEOA 3DLHA 1YT3A 2QKKA 4DSIA 4H8KA 5KFKA 4DO9A 4I27A 4CK3A 9ICQA 3OHBA 5DGBA 5KGXA 4F2RA 2A1SA 3VQAA 3TABA 3C6TA 4BXOA 3ZSWA 5KT4A 3TWHA 3RMDA 2HNZA 4TSXA 1ZBIA 5DQIA 4RNMA 4UBBA 4TUQA 1TL1A 4QWDA 1S9FA 1XS9D 4O3PA 1COOA 2QKBA 5KFAA 1ZQSA 1B9DA 4KLJA 4M9NA 3TI0A 9ICPA 2R8JA 1LW2A 3M9OB 4FLUA 4DTXA 3GIJA 5KG1A 1C7YA 2D0AA 2BCVA 3V9UA 2OPQA 4G1QA 1ZQEA 4DF4A 2G8VA 3BQ1A 4GXJA 3M8SA 4KFBA 4BACA 3C2LA 3MR2A 1CUKA 3DMJA 4RPXA 4ED1A 3ORYA 4JS4A 2VA8A 1LB2B 4YG2A 3KTQA 5HNKA 4C8NA 1S1TA 3O3GA 4KB0A 1G15A 8ICIA 1D8LA 4KI6A 1RDBA 4M3ZA 3BJYA 4YXJA 1HMVA 4JV1A 5C24A 3C2MA 4J9MA 3AVKA 4O4GA 5J0UA 8ICQA 4W5TA 4J2EA 3BDPA 4Z6CA 2C28A 1RXWA 2FBTA 3HYFA 2AGPA 4M6WB 1EX4A 2J6SA 9ICBA 2Z1GA 4MFBA 3NDKA 3QO9A 1TKDA 3AO4A 3QEWA 2W9BB 1BPZA 1EETA 3OYIA 3OJUA 2XRIA 2ZTDA 4HUFA 4M3YA 1S0OA 3HO1A 1SUQA 4TUPA 4M9GA 4ED8A 4KTWA 2C2DA 3NH2A 3OY9A 4M04A 9ICRA 5DMRA 1BPXA 4EBCA 1WSEA 4IFYA 3OYBA 3KLFA 4XA5A 4B9SA 4O3NA 4IRKA 2ISOA 1ZQHA 1IKXA 4FJ9A 4C8LA 1UAXA 3OYJA 3MXIA 1BL3A 4I2FA 4RW7A 5L1KA 2X6NA 3B0XA 1Z00B 3HXMA 2HHSA 4ECYA 1JLGA 4OPJA 5KFDA 5KT2A 4CJTA 2ASLA 4ECVA 4PHDA 4DOBA 4UAWA 3NGZA 4ECWA 4KRFA 3TAGA 3MEDA 4M6WA 5HP1A 4I2GA 3Q8SB 3HK2A 3L2UA 2BGWA 5JS1A 5C5JA 3K57A 4M3TA 1HNIA 3TFRA 1B43A 4M41A 4KLGA 3ZT0A 3PO4A 4FJMA 1U49A 3HX0A 5CJ7A 4J9NA 4EBDA 1RTHA 1RDCA 4F8RA 5KFYA 4KB1A 3S3NA 3V7LA 2X78A 8ICAA 3AVHA 4I2DA 3ZDDA 1HRHA 1RT2A 1BQNA 5I3UA 5J2HA 4LD0A 2HHTA 2BDPA 1JKHA 2D0BA 2QK9A 2OWOA 2R8GA 1B22A 3RB0A 1NK8A 3NF7A 3G6XA 3GIIA 4I2IA 5EU7A 3F9KA 1N5YA 8ICLA 1TKTA 1HQUA 3CFRA 4FBTA 4F5OA 5KRSA 3KD1E 8ICSA 4NYNA 1RNHA 3AVNA 3AA3A 2BPFA 4LSNA 4O44A 4DG1A 4DQSA 4KLSA 3JSMA 9ICEA 2V4RA 4FJ7A 3QERA 3PY8A 4XIUA 4DEZA 3JYTA 3AVFA 9ICSA 3SQ0A 2HNDA 2W9MA 2RF2A 4HCCA 5KG0A 4CIEA 2RDJA 4NLNA 8ICYA 1NOZA 4FJNA 5KFSA 4KLQA 1S6PA 5J2QA 2BQ3A 1Z25A 4DU3A 3RH6A 3ZDCA 1JXBA 3QEVA 2Z1HA 4Z4FA 2IHNA 1BPYA 2W9BA 1ZQDA 1RBRA 3PX6A 3VQDA 1N56A 2AGQA 3SQ4A 3V81A 3RWUA 2A1JA 3LPTA 2UVUA 1QTMA 4PHPA 3RMAA 4CFAA 1LAWA 4CESA 3AU2A 1U48A 4CJWA 3OSNA 4PPXA 3OJSA 3SPZA 5J2NA 2G8KA 1LW0A 4F4ZA 5SWMA 4CERA 4QZBA 2F1IA 4UB1A 3KHRA 4B8AB 4ID1A 9ICKA 4PWDA 4I2AA 5DB9A 4Q0BA 2JLEA 2X6SA 4YFKA 4OKKA 4FJLA 5J2JA 1U04A 1WAJA 3O4QA 3TARA 4FJKA 2R8IA 3V6HA 4RQ0A 7ICTA 4FJXA 2E4LA 1TFRA 1ZJNA 1ZQQA 1ZQWA 3NGDA 4MEYA 4KLLA 3ISCA 1MC8A 4J9SA 3M8RA 3EPGA 3CM6A 3DRRA 3RJIA 3SUNA 3K59A 1XSPA 4AHSA 4I2CA 4JUZA 5KG2A 3OS1A 4OVLA 2W8LA 4CJ5A 2HVHA 5JS2A 5F9NA 3ZSQA 5KFWA 1ZQPA 4P4MA 5IIJA 4KLIA 4TUSA 4FCYA 3LAKA 3HVTA 3Q8KA 3OS0A 3SI8A 2HHUA 1AROP 3UXNA 1VSEA 3HSTB 3JPOA 8ICBA 3RRGA 3HPOA 3AO1A 3E2EA 4HYKA 4J9OA 3RJFA 7ICLA 1I39A 4E89A 2VA3A 5L1JA 4DFJA 3DLKA 1T4GA 4DSEA 4CK2A 2OPSA 1RPLA 8ICFA 2G8WA 1PZNA 4RNNA 1HNVA 2OZSA 4CF0A 3PR5B 3GV8B 4EP4A 4M42A 2IBKA 2PI5A 1ZQXA 4RQ3A 4E0DA 1ZJMA 1H38A 3H4DA 3DOLA 2IOCA 1DOQA 4AHVA 1ZQGA 4DFKA 2ETJA 2DFHA 3UIQA 5HMLA 4YR0A 4OJRA 4JRQA 2P6RA 3RB4A 1T7PA 4R8UA 4RG8A 5J2AA 1Q8IA 3S9HA 2DFLA 3SCXA 3RR8A 1IO2A 9ICOA 4CJKA 4CF1A 4JLHA 4F92B 1W9HA 2XY6A 4K4GA 1LV5A 7ICNA 2KN7A 4YXMA 1XHXA 3PW2A 3HVRA 1XU4A 1D5AA 3G10A 3C5FA 5IINA 2YHBA 1TVAA 2ZTCA 7ICHA 4F5RA 4RQ4A 3NFAA
chains in the Genus database with same CATH superfamily
5KFZA 4NO7A 3KK2B 1C6VA 2YN4A 4UB6U 5ALJA 1U26A 5D3GA 3V6DA 4R25A 3W2WB 4XTTA 4LH4A 3DRRB 1UJ5A 3Q24A 5K4LA 1YJUA 5AM5A 2YBVA 1NGIA 2JHEA 4CIFA 2ZVSA 3FNNA 4JI8F 2N3LA 5H9EJ 3FEYB 3R1LA 2QJ3A 3V1RA 2RUGA 1WHYA 1FJGK 1RT3A 4P73A 3GONA 3NF9A 2V4JA 4W5RA 3CB4A 4RUAA 3O0FA 1RB0A 4GIBA 5AKKA 3QETA 5LL6d 3T1HF 5CYMA 3EXYA 4LF7K 3PIOL 3SPYA 4UB5A 2GUPA 3W63A 3HSZA 3BN4A 4ZCKA 2XY8A 4LF9F 2E5IA 2QA4N 3THWB 3LUYA 3LF0A 3BH7B 2ZFHA 5G4DA 5CR0A 3QU2A 3H4BA 4LC9B 4M7YA 2V69A 1WACA 2GLEA 5B09A 1V9PA 2G8UA 3SQGA 2VWKA 3KBBA 3MBYA 2RF2B 4YNQA 1C1BB 4GC6A 3IA0A 4EU0A 1KD1T 4WIQA 3HHLC 2QC3A 3DHXA 4P2XA 4NWIA 2FPKA 1NZAA 8RUCA 2A40A 2YXLA 1D09B 1RBVA 3A4TA 4JI5J 5AZIB 3J7AP 5HLFB 4QR0A 1YLXA 4E1NA 2W04A 2P9PB 2CNKB 1VSKA 5L1LA 2HBLA 2FY8A 1TQLA 3P5BP 2HZAA 1MG7A 3KG4A 2N4DA 3LDSA 2HHXA 5J2MA 8ICZA 1LWFB 3IO1A 5L1IA 2VQEF 5HBMB 2D41A 2E6LA 3OW2R 1JL1A 4FS1A 4OKEA 3CMAS 2ZIVA 3BSCA 2ZBPA 1YHQS 3D68A 4KGKA 4F9OA 4X2BA 2LQ5A 3F9MA 4X4NA 3DKDA 2YJEA 3DCAA 1MN7A 2QFJA 5H2FU 1NGJA 2CJKA 2YQ0A 2H5JB 2LEAA 4DL2A 2NXEA 3ZT3A 1UCVA 2Q36A 3LDAA 3SIPB 1K1QA 1JJ2M 5DZ6A 3J81O 1IV0A 1SC6A 1VQOS 4Z6FA 1UP1A 4OI4A 2KHOA 1CLFA 2YH1A 2ZWPA 3CHWA 2HWHA 3DOKA 1C0TB 2MHNA 3LP1B 1S1VA 3M7DA 2LA6A 5HP4A 3NGUA 2Q79A 2IRUA 5D6GA 1AUDA 3BR8A 5BPNA 3M6WA 4FYVB 4B9UA 4I64A 4DQPA 3HHKA 4IFVA 4J9PA 4ZPAA 3RR7A 2V94A 3FM9A 1RT7B 3D6MB 2DPJA 2VG7A 3H8SA 1HKAA 3TSPA 4QU6A 5HRPA 1X4EA 4ED0A 1VQ5S 4OJHA 3LZJA 5KL1B 3JTOA 4BE0A 4DR6F 3IM9A 4XO0A 3HL8A 5AE3A 1Q8BA 2BUNA 4DX6A 3LANA 4DJBA 4KT0C 2OTLS 4C8MA 4DTRA 2FPLA 2HRUA 5GTHU 3DOMA 2EFVA 1NHVA 2YB4A 1SXDA 3Q8LA 1UA1A 3MGIA 1FTRA 7ICKA 1FJ7A 1RBLA 5IWAF 1UTAA 4KC5A 3SNNA 2P6TA 4MFFA 1KFDA 1HJPA 1ZBSA 5LMUF 2LMIA 4Y2UA 3S3OA 1WELA 1RCOB 1EKSA 5JICA 4KHWA 1VQLN 2P5OA 2WBMA 4UAUA 1EXQA 2UUCF 4B3RK 2VG6A 3L2WA 2B56A 3IRWP 4XUSA 5U47A 2BKPA 1SQKA 3W8PA 1YIJS 3GBTA 2IAJA 1WBDA 9ICCA 3G6ES 1EHWA 1YI2S 4CH1A 1SIWB 3ZNJ1 4X4OA 2CYYA 4MF8A 3JPNA 2HNDB 2PFFB 4DR1F 2PT0A 1I6JA 4QWCA 1GLEG 2OELA 3C6HA 3PX4A 1QHAA 1BGXT 4DCPB 5HVFA 2QI2A 1RHMB 3LP2A 4O5FA 4F71A 2EKNA 3QZ8A 3W2VB 4EX6A 1SB6A 4BRMA 4UQTA 3GIRA 3I28A 3G8SA 1NK5A 4CJ4A 1IIPA 1LEOA 4ZLNA 3KHHA 2GWSA 1BI4A 3ENQA 4Y2IA 1HARA 4B8CA 5LMUK 2EH9A 2ZH3A 4YN4A 3FC9A 1UAWA 1IKWA 3D3CJ 4P2MA 1NGGA 2HAIA 4Z37A 8ICWA 4CLLA 1HNWJ 2ASMA 2NUUG 2DEIA 4ZDNA 2VG5B 2IIRA 5ALZA 1VJ5A 3ATUA 1LK5A 4Z6DA 3FRYA 1RFQA 3GU3A 4B3OB 1AFIA 3SEOA 1NK9A 3KK2A 3CJ1A 4E7IA 3K7RA 3P1GA 1NJIO 2N7YA 6FDRA 1RQ0A 2F63A 3VAGA 2ZXHA 4M2YA 1YJ9N 3W3SA 1D8BA 2D3UA 2IFXA 4HH1A 4X66K 2KSOB 1KSPA 1Y9OA 2LQ8A 4PAAA 1TAMA 3HW8A 4XPCA 3M5RA 4YOEA 3KK1B 5JU5A 4MK7A 2OD6A 5GAGU 1SQFA 2XWYA 2YNIA 3MM8A 1RLCL 2OAUA 3E66A 3NRBA 1NDPA 1UW9A 1KAYA 2WK4A 1GOBA 2DNMA 2KW4A 1WSGA 4FM0A 3P4UB 4AQYF 1LW2B 3TAPA 1CULB 3GE1A 1Q1KA 3I56N 4F3OA 4RQ1A 3H40A 1NH8A 3PHTA 3MDQA 2ZH4A 2ITGA 4B1YB 2EI5A 5J0YA 1YRXA 1JJCB 3JPPA 4QZHA 4DUYF 3TUZC 1SJQA 3PX0A 4PXEA 1B92A 2ODGA 3TANA 3PM9A 3CJ9A 3GMGA 3TSQA 1SV0A 1S77D 4M9JA 3GG1A 1H2UX 3VMFB 2W3SA 2WW8A 3FCWA 4Z6EA 4TQSA 1NGBA 3EEQA 1JLQA 4CE9A 4KLEA 5DG9A 3C28A 3OTQA 2FLLA 1YJNN 1NI3A 3P96A 5GAGI 2O8BA 2NR0A 1S97A 4NLXA 4FJ8A 1GTEA 1RZTA 1RYSA 4CJUA 1S1WB 2DT9A 2R2SA 3VQPA 4LFCK 2BW7A 2KFNA 2KKVA 2VFVA 4FSVA 2GWKA 1WKLA 4BE2A 4MO4A 4OHZA 2F1FA 5FIIA 3SBMA 4JD2B 3GFKB 5J8YA 2ZXIA 5J0SA 1RHUB 5M1NA 2G2OA 2VONA 3M30A 1PUZA 1U0SA 4CZFA 2BCSA 2HMIA 4QIWF 4KY3A 2V7YA 1JNRB 2FJDB 3J7A1 4RNFA 3S8SA 1NBWA 4E19A 3B0YA 1VSDA 3ULEA 2XI3A 2OHDA 1U45A 3HJFA 3DMJB 2YB1A 4FJ5A 2G5IB 3H25A 4Z4GA 4LQ9A 2FGOA 4AE5A 2B51A 1OQ6A 1REVB 3AVCA 1N2XA 2G0JA 3TZWA 2L5YA 4M63C 2J9DA 2O8CB 4WYLA 4DTMA 2I5JA 3WNGA 3THXB 4CJQA 2XLIA 3KJVA 4Q44A 2W6KA 4DR4J 2RHQB 2OFHX 1HHSA 1KS2A 5TKWA 1UVKA 2KTQA 1FT8A 4E7LA 4RO0A 4OLOA 1Z4OA 3TX0A 2O8EA 2OMLA 4JI7F 2P5GA 4PYDA 2DGVA 2QA1A 5L9XA 3TVYA 2V8VA 3TX8A 2J9EA 1NJZA 3VC8A 4CFDA 3OFGA 3EDRB 4DZ6A 5IT0A 1RAGB 4WWSA 3UD5A 1CJUB 1E6YB 4FJGA 1WUAA 4Z4EA 4GXIA 4DQQA 5HQ8A 3MHYA 4K2JA 3AAQA 3DAWA 4QYRA 5CEHA 5IM0B 3T6BA 4JI4J 1A7GE 9ICUA 1PIEA 4EX7A 4O4RA 5J0XA 4MKYA 2B8QA 3ZNUA 2BA9A 1E6VA 2EKYA 3AY9A 4ZLPA 3VZIA 3EGZA 4C97A 4HWIA 2DEJA 5GADU 3FDSA 3MR6A 2NRTA 1WOOA 1SL1A 4RT2A 4WQ4C 3IR7B 3T6JA 2EWSA 1Q95G 4M5KA 5A76A 5F0WA 5E0OA 2KRRA 3IAS9 2C1EB 2P9LA 1IG9A 4A46A 5KQ8A 3CIMA 4ES3A 1C1CA 3D5MA 3OYAA 4CJPA 3WQPA 5HHHA 4RQ2A 2BEFA 4I2HA 4I7FA 3W1YC 4WP3A 3BN7A 4F4YA 1S1XA 2D9PA 5ALHA 3QNNA 5BJRA 3EGVA 4O8UA 1RXOB 1FEZA 2PD1A 3QIPB 1HYZA 4IZ9A 2KJ9A 4D3HA 5IV4A 1BHLA 1N32J 3ZDEA 4BC9A 3FAHA 3HZEA 1CZBA 4DCJB 1QE1B 4LF4K 2QLBB 2F4VJ 3AOAA 2UVVA 4HTJA 3PEHA 5KFHA 5CRXA 2BZ2A 3QFWA 2RKIB 2MZ1A 1F0XA 3U7JA 4PL1A 5LMNK 4KLHA 4DV7K 1VOMA 5DLFA 2MQ8A 4BX9C 1S1WA 2FMQA 3GFXA 4RU2A 2ZF5O 5D4BA 4UY8O 3FGUA 2FD2A 4ZVQB 1RSCA 1WSRA 1S7IA 4PPDA 4C7YA 5D0HA 2GIFA 1AA1B 5KG6A 3AA2A 2KVQE 1XSLA 3UCZP 2XLKA 4KHRA 4DV1J 4L8RB 2D6FC 3O08A 4RNHA 2YQ1A 1NXIA 2IJFA 5KOWA 4P0PA 2R8HA 5FLXO 5H9FJ 3JSBA 3Q7CA 3NS6A 3IAYA 4F0KA 2B4JA 3RW7A 5HSPA 4FJJA 1HUZA 1OY6A 1KVBA 1Z05A 1PK1B 4CK1A 3KLHA 2E44A 2DO4A 3D6TB 1QQ6A 1TK5A 5AQMA 3CDAA 2YH0A 3AVJA 3AN1A 2X1BA 2B4VA 1BQNB 1N34F 1VQ5N 4HCBA 4I69A 5HHIA 1R89A 4OZ3A 2VPYB 4U7CA 4HT7A 3HZGA 3BQTA 3JQMA 3MEGB 2GVDA 4UZCA 3JAMO 4USTA 2BR0A 4U67L 3ICXA 2A2DA 4Y2QA 1B0VA 3NGIA 1NHUA 3THYA 1ICEB 2YNFA 3I87A 2NRWA 3UKUA 1UOCA 1UEUA 1S4FA 1N62A 2R42A 4LF6F 3DGPB 2WZ1A 4GO5X 4XH4A 1S10A 3PRDA 3VEVA 2K2PA 4NXNK 2NXCA 1VQ7S 1OXJA 1FFSB 5HRSA 2B6AB 2KIVA 4B9VA 4JRPA 3ZX2A 4JI1K 4CHQA 5I4MA 4LFBJ 4IUFA 3NKYA 4ER8A 3D2NA 2XULA 4A4JA 3HOSA 1PVQA 2HK2A 5DBCA 5FPEA 2Y9TA 3A5MC 1W25A 4C23A 2CPDA 5AXMA 3ILOA 1WCNA 2HVIA 1LWFA 1R6VA 4YMOA 1FRJA 2G0IA 4J90A 1LWCB 3HPGA 2W9CA 5EE9A 1NGCA 4F4WA 1X5OA 3FZHA 1JRPA 1ZXIA 4QZIA 1SXLA 1U0HA 3BDEA 4KGZB 4US8A 3CMES 2HS3A 4FZXC 2FVCA 1SIZA 3SENA 2H4WB 3LW5C 1TZ0A 1N5SA 2NSCA 4IG3B 4QZGA 4GKJF 8ICMA 3Q2SC 2CGKA 4BQZA 1NSAA 2D3OR 1VQPS 4X62K 2CQDA 5LJ3Y 3SQ2A 3CCWA 3VAHA 2RRAA 6AT1B 2W01A 2OANA 5BRFA 4E8UA 1DFDA 3B6BA 1LKYA 3FK4A 1NK7A 4DV5F 3W60A 3IRUA 3MUTP 3EWAA 2H3FA 1L8LA 1RAAB 4H0OA 1EIYB 2CH5A 1S57A 3A12A 1U09A 4WFYA 2H51B 1SJFA 3D2FB 5IQ6A 2J0SD 2XZTB 4FYDA 2W42A 2BJ8A 3M2RB 4OYWA 4NLOA 2DF4B 1DGKN 3W2WA 5IIMA 1FXDA 2J7UA 4U9RA 3PR4A 1NM2A 4QYZK 1HI1A 3HX9A 3M1YA 2KP7A 2FGCA 2ZVIA 3MN9A 4DR2K 2FDNA 2KM8B 4ZIWA 3IGNA 2X74A 3CCSN 3CIPA 4GXKA 3BKFA 1ZQBA 5EVZA 2E29A 1N5QA 1VSFA 4IQUA 2V8PA 3GL1A 4CZHA 2DY9A 4ZVPB 3OYFA 4L6V3 1Z6RA 4M5DB 1KD1O 3C0BA 3VAMA 3WC0A 2IYGA 5BR9A 3SLCA 3JS6A 2DNHA 3S01A 2V52B 5EWFA 4FYWB 4DSKA 5F3TA 3CGIA 3I4PA 5E3PA 8ICUA 2JEFA 3UE2A 1KWMA 2KHDA 3KMQA 2VFSA 4KPYA 3RBDA 3OSPA 4RW7B 4X5VA 1RGVA 2GS8A 2CQCA 3UR3C 1S48A 2MJNA 3FZKA 3DN9A 3GR0A 3O6WA 4FOEA 5FLXY 1U1LA 4YOYA 2C3OA 4OX8A 3UQ2A 2YKNA 3VAJA 4JI1J 3ZSVA 3GIMA 4DQ8A 1ZRMA 2F77X 1NSPA 3B78A 5AIAA 5KPZA 4NCBA 4KX3A 1AYEA 3C16A 1C0TA 2QO3A 1NK4A 4R0JA 1ESVA 4DSLA 8ICPA 2VQFK 3V4MA 2DCUB 4IG3A 4LF7J 4RZRA 2GO9A 2FBXA 4LF4F 2AA4A 4BRLA 5D77A 1IBMJ 4K43A 4DV6J 1KQSM 3EZ5A 3RSEB 3O4NA 4W5OA 3AD9C 2HBRB 2JMGA 4P4OA 2WVDA 3Q0AA 5EUHA 5D46A 1C1AA 3KUGA 2ERRA 4LY7A 3UMGA 2IBOA 2M7SA 1O8BA 3FRZA 4DQIA 4P4PA 4OYOA 5LSLA 3RMBA 5AKEA 4M5NA 3D2FA 4KH1B 2VG5A 2IGIA 1JQGA 3N4MB 1KLMA 2PMZC 3POTA 3I56S 1U6FA 5A8KB 1Z2ZA 3IG8A 4ZHRB 3QB0A 3TA0A 4WFNL 5AI0A 3M1VB 3H98A 3AA5X 4KPCA 1B9FA 1JN3A 1IWGA 3PTWA 2LVWA 4N41A 4F0HA 4GVMA 1JLBA 2VODA 3UD3P 1F60B 4B1ZA 3H6EA 2AF6A 3GLJA 4KKOA 4RBUA 1BA1A 3AMZA 3R8EA 4NLGA 2EG1A 4GW6A 3M6GA 3ENWA 4QYZJ 1LAVA 4CGZA 1B3TA 2OSQA 2P9KB 2I8EA 2EQYA 5A0LA 1DK3A 3C23A 1RU1A 4KHSA 4DI6A 3TR5A 1TL7A 1R59O 4YR2A 1LOTB 3ZETA 2RVJA 4LSLB 4EK2A 5BOMA 2Q1LA 1FO1A 4PHEA 3PSIA 2P66A 3OTBA 2BKEA 4J7CA 1G99A 1GLAG 4U95A 3AARA 3VQSA 4CLKA 5IS2A 4K59A 5C2DA 1FRXA 1VLBA 5E79U 4KLFA 4P7VA 5KGWA 3OLAA 3C1ZA 3AUOA 4NLQA 3KOOA 1U2FA 1VQKN 4NOHA 3ZEUB 5AI9A 4BWJA 1HWJA 1MROB 3TEGA 4F72A 3DGPA 1X9WA 3OVBA 2AYBA 2WFBA 1HNWF 2HURA 4H0XB 5AQXA 4C8ZA 2X1AA 4OL8A 3HBTA 4N8NA 4BC7A 4IQVA 2B6AA 5ALRA 3TEHB 4UB3A 3D3BJ 1ZQMA 2O8DA 4FW1A 4KH4A 2PFDA 2WW4A 4PWDB 2GOLA 1ZS6A 2ATQA 2IAJB 1S76D 3IM8A 4BRCA 2WFAA 2ZM6F 1NPRA 2A0FB 4DR3F 2KT5A 5AQHA 1HUOA 5CB1A 2PA8D 2MU2A 2MTLA 4V19X 3DYAA 3KWGA 1N32K 1HPMA 4RUBA 4CFBA 2IIHA 1SL0A 1FE4A 1R43A 3BGUA 4IH6A 4O55A 1KVJA 5LT5A 2LYAA 1OO0B 4JKCA 1UA0A 4O23A 3R8YA 5A2QO 1VQNS 2E5LJ 3VZHA 4B1UB 5FPMA 4E7HA 2OEMA 1ZBTA 4M1KA 3IN5A 3KUEA 8ICEA 3L3VA 3CF5L 4AP9A 3BGRB 1U1PA 5JVGL 4FZLA 1XUPO 3G6VA 4CIOA 3RW6A 1N5XA 1V38A 3CJ7A 2CXEA 3ZC4A 1CQNA 3S7RA 3LOUA 3ZZ0A 5KNIA 2O4IA 1CPZA 2K89A 3L8BA 4BDPA 5B0DA 1DAXA 1KQQA 4IQTA 4I9LA 1NZBA 5KL8B 4CEQA 4QS9A 1MMLA 2UV8A 3QU5A 3CJTA 3H7IA 3WK8A 2QWQA 3V2UC 3Q8RB 4FLWA 3J7ZT 2ASDA 4CEAA 2LBOA 1WSFA 4CF5A 3VQBA 2KXNB 2GO8A 1RG6A 4KSEB 4O5KA 1WNEA 1VRUB 2PO4A 3GFYA 5KFLA 1WBBA 3ILJA 3SUOA 4BRDA 1H7WA 1SBRA 3MCPA 3MDFA 1Q7LB 2UUBJ 4CEEA 2JV3A 1WOPA 1NJXA 1FX4A 5ALMA 2VBXA 2H65B 1DTQA 4PGYA 3A8KA 2A41A 3DNCA 3MXMA 4DU7A 3AJ2A 1QY7A 5M1PA 4DOAA 3G82A 1OH5A 1HW9A 5EE1A 1FRLA 1I94K 1UJ4A 3CDUA 1HQEA 3ENHA 2F3JA 1SKRA 4RQ7A 2X1FA 2IA6A 2KJWA 3CCRN 2BJ3A 4ERDA 1PYSB 1VGYA 2RQ4A 3Q83A 2NPFA 2IOFK 4MKVA 2MQMA 2CQPA 4V1Ak 5HK4A 3SQIA 1FK9B 4JI1F 4BDZA 3M6KA 4BROA 2MMYA 4M3WA 2IMWP 4MK9A 4P74A 1AB8A 4EFHA 3CJBA 4UAZA 4HVZA 2NRXA 2G9OA 3MM9B 2UYTA 2P9UA 5F8JA 2ZBIA 2P9IB 2FBYA 2GBZA 1MROA 4HTUA 4R65A 1TMMA 1PJ6A 1JMSA 1V9OA 1C1CB 2XMVA 1K9MO 4M3XA 2E2OA 2DYAA 3CC2S 4OI6A 4NJ8A 2WF8A 1TK0A 2E5LK 2IJNA 3KNGA 4ANDA 2ZZMA 4ISGA 3VQCA 3LVWA 4O3QA 3ILIA 2HCFA 1U2VB 2UUBF 2QLFB 9ICQA 3OHBA 5DGBA 3ILLA 1T9YA 3TABA 4PL7A 2H3EB 5CH7B 2E9TA 1FI4A 3TWHA 2DRBA 1VRTB 1XTZA 3CJRA 5DQIA 3GYGA 3T1YK 4NLVA 1TL1A 4ETXA 1S9FA 1HEKA 5F8HA 2AIRB 1RDUA 3MM5B 4O3PA 2QKBA 1ZQSA 4NL9A 2Q2RA 3TI0A 2LPEA 3DGVA 1VHIA 3ENOA 2R8JA 1RLDA 4AQYJ 2DRDA 1Q86O 4DTXA 4EWTA 4B3MF 2D0AA 2BCVA 3V9UA 2OPQA 2HBKA 1ZQEA 2LLZA 3TADC 3BQ1A 4KHPF 4BR9A 1YBUA 4N77A 3C2LA 1U6ZA 4MIAA 1B4SA 4ED1A 3ORYA 1WC1A 2MKHA 3MMAA 1LB2B 3R6GB 2XMUA 3B54A 3CW2C 5HNKA 4KB0A 4WKRA 1EP4B 8ICIA 2L9NA 1RA6A 1QH9A 4H0VB 1RDBA 4C11B 5T41A 3WEEB 4O4GA 2YX7A 1L7MA 1TR0A 3ZO7A 4GFJA 2FBTA 5CQGA 5BRHA 4AL7A 2HKEA 4HDHA 3DLGB 5ETTA 4MFBA 3NDKA 2C3UA 1R31A 3QEWA 3H8MA 3OYIA 1H2TZ 2GA7A 2VZ9A 1S0OA 1JK9B 2X1GA 4CO4A 3MOJB 1J2MA 1VI7A 1RAHB 4M9GA 3GR1A 3NH2A 1VQ9S 2VPWB 3UVJB 3R2DJ 5DMRA 3KK7A 1WSEA 3PG9A 4IFYA 4B9SA 4BRPA 1ZQHA 2G07A 3DEEA 2A18A 2Y8YA 4YB1P 3B0XA 3FBBA 2HHSA 4ECYA 1XN9A 4CJTA 1J2VA 2ASLA 3CJQA 2MSNA 2Q6BA 1XJWB 2R7VA 1BWEA 3MTKA 3NGZA 4DV7J 1RWMB 4KRFA 4OYMA 3CT9A 3Q8SB 1EX8A 4G9BA 3TFRA 1B43A 3CC4S 1U49A 5IQQA 1ZOLA 4UF4A 2E5HA 4J9NA 1RDCA 3KZIU 2OPQB 2IPOB 3ZTPA 3S3NA 2X78A 1IUJA 2NUHA 3E9OA 3ZDDA 1HRHA 1Q46A 3SMZA 4Y34A 1BQNA 1T02A 2HHTA 3FJ2A 2BDPA 2DKOB 4QIWD 2D0BA 2DXDA 2E9ZA 1T94A 2DCLA 3L4IA 1GNKA 4YMEA 4LVNP 3RB0A 4ZJOA 1I94F 1RU2A 2W40A 3NF7A 2R7RA 1O08A 4I2IA 1RWNB 1N5YA 3CFRA 1QUPA 3DDIA 2LKYA 4UOCA 3HI0A 3SBGA 3ZZZA 2WAQF 1NGDA 2XBPA 1RE1B 4O44A 4ISEA 1RT6B 1B7FA 1KN6A 1XNQK 4JHDA 1U2VA 3VENA 3JSMA 2LU2A 3X3UA 2F8LA 4FJ7A 2ZC4A 2DNRA 3HTVA 3KJQB 4OO1J 5ALQA 3SQ0A 2HNDA 2W9MA 4CIEA 5C7PA 3ZI4A 2KKPA 2Y9UA 8ICYA 4OHWA 4KLQA 5GTIU 3PYGA 4PG6A 2EC2A 2QG9B 2VL1A 1JXBA 4NE9C 3NOGA 2K3IA 1BQMB 1IKXB 1VQ7N 2AGQA 3CNHA 1S4EA 3V81A 4P0QB 3KK3B 4V19S 2H3QA 1B70B 2UVUA 4PHPA 1MU2B 1IBMF 1U48A 3OSNA 2DQNB 3SCIE 4PPXA 4QJFB 5ALVA 2OPPB 3SPZA 2WB1D 4X64J 5SWMA 3AEVA 4CERA 2E20A 2I6XA 3SDEB 1RHJB 1YVFA 1NRKA 1T0TV 3RJMB 4MTPA 1JALA 4I2AA 3IMXA 2YNIB 3MM8B 3OA9A 1W2BR 1LFWA 4A47A 2X6SA 1LWEB 2DNQA 4NLCA 3V6HA 7ICTA 4RQ0A 4DBQA 2ZH1A 2MZSA 2HLUA 1TFRA 3WXJA 3MCNA 3O6QA 5AQLA 4KLLA 2MSTA 2O5DA 4LFBF 1ZQ1C 3I96A 3K59A 4DUZJ 4LF7F 3IG5A 1VISA 3NS1A 5JS2A 5KFWA 2KRBA 4CLYA 3CERA 1FTCA 2CZ9A 4FCYA 3LAKA 4EGLA 4EAHD 2WB4A 3OS0A 3TJAA 1JI7A 2HSEB 5K8OA 3NP5A 3VVTA 2HBZB 2YWFA 5LSRA 2FJXA 1X4HA 5AKZA 3JPOA 2IVPA 3RRGA 1XO0A 4CO5A 3LL3A 3AO1A 3E2EA 2NXNA 4CDGA 4UZBA 2M88A 3W9HA 2VQFF 1I39A 4E89A 3JQJA 1URJA 1D4XA 4W98A 2FJAB 1T4GA 1RWUA 4PXBA 1N34J 1RPLA 1Y5IB 1LXNA 3UDVA 4K41A 2OZSA 4CF0A 3GV8B 3O5TB 4WFBQ 4B3MJ 4BBYA 4LF6K 1ZQXA 1T9VA 3UO0A 4E0DA 4NLYA 3HRGA 3H4DA 3DOLA 4ENOA 5K20B 1DOQA 3BPDA 3TTFA 1J6ZA 2XQCA 4C4WA 2ZGZA 1VQNN 4DFKA 2W03A 5D4LA 4H5TA 1HI8A 4U67Q 2FJWA 3EWGA 2CXYA 4AXIA 4RG8A 5J2AA 1XBWA 4TLRA 1TYQA 4F92B 2AJ1A 2CQ0A 2XY6A 3VF0B 1R8HA 2WB1C 3LTOA 4FF2A 2KN7A 3V5RA 4YXMA 4NZ7A 4JI6K 1IG6A 1XU4A 2VYPA 3MGJA 2YWWA 5CD4H 2MQPA 4KH6A 4NYOA 4QZDA 7ICQA 1A0PA 3OR1B 2DTJA 3CC7N 4IOCL 1QAXA 1M90T 2DIVA 3AD8C 4YOXA 1ZQKA 4FWKA 2J0QD 1NOYA 3KJVB 3KLVA 3AGKA 2D9OA 5A8RB 4FN5A 2HW3A 1WWUA 2HFNA 2CPJA 5KTQA 4RT3A 4O3OA 2WBRA 4RWXA 3VGVA 4Q5VA 3M8WA 2Z57B 4LF5J 4YY3K 4XPEA 2OO4A 4IRDA 4FZVA 1K8KB 5J2PA 2A3VA 5JRTA 2MJUA 5ETNA 1SJRA 3QFHA 3V81B 1TAQA 1HWUA 3KLEA 2XO6A 5J0QA 2O6KA 4F4XA 2RS2A 4ETZA 4ZP7A 2G8HA 2OIHA 2OLWA 2CG8A 1HKGA 1VDHA 4DL6A 2O8CA 4CH7A 3ENBA 4DR7K 3HSJA 1RAIB 2GHPA 5KOXA 1IVZA 4K5SA 1S59A 4WQ5C 3AVMA 5LOQA 1T03B 3DXMB 2XCPA 3BGFA 3EW9A 3BP8A 2OEKA 1GMVA 7ICOA 1FDNA 2A19A 1FCAA 2GIQA 1M1HA 5H9EK 4P6QA 3L9ZA 2ROEA 1Z4NA 3DOLB 3SI6A 2ZH6A 2MLZA 3MM7A 2WUSA 1ATRA 2HHVA 1I3OB 4BDYA 1VSLA 2CJYB 1Y97A 2AX0A 4P75A 3WK9A 1PC4A 3BGLA 3EGNA 1RYRA 3HVAA 2OHFA 3OL7A 1WDTA 1WHWA 3CC4N 1X40A 2G2YA 1UCNA 3QMQA 3S3MA 3R6MA 2A1AA 3CPEA 2BM1A 1L8OA 1K8AT 3B9JA 3GSIA 3TPQA 2GX8A 2RRNA 3UMCA 4I2JA 2Z7JA 4NXNF 4RUHA 1WAFA 2OA8A 4PH5A 4DFPA 1M0SA 3L0QA 1IH7A 5BPCA 3QINA 2DUYA 1PAEX 1S1UB 4CO3A 3MR7A 3AV9A 4ZCIA 3G8QA 4B3TJ 4C0ZA 4LZGA 3WKDA 1WUUA 1NO8A 1K0TA 4P2SA 1KXPA 4U7BA 3HCXA 3BS7A 5KT3A 2KD1A 3GCXP 3NNHA 4IG0A 5EWGA 3GPAA 4ILMA 2WC9A 2FXUA 2O01C 4DUZK 4MF2A 3QGPA 2HWIA 1UQVA 2PFOA 3J7AN 2G09A 1Z3EB 3BSAA 3CQ8A 2OTJN 2PFQA 4O0JA 1RI7A 1ZA2B 4WIIA 4JB3A 2M0GB 4CGFA 1FFUA 2ZBCA 1TV6A 4KE5A 3CWJA 1QS4A 4KO0A 3L4BC 1Q3VA 3BQ2A 3A0HU 5J2FA 4TURA 4A8FA 2RRBA 1ZM4A 5AR0A 3WKCA 2RKIA 3HT0A 4YOWA 1N33K 4NM2A 1F1BB 2RQMA 4Y1DA 1VSJA 4IKAA 3SFUA 2QXLA 1ROFA 3DLKB 3EZOA 2GV1A 4UOHA 1N0UA 2IM0A 3RJEA 1LWCA 4HHHA 4WK1A 3UNYA 1YJNS 4CLZA 3JSRA 3PACA 1VK8A 5D4NA 4F0MA 3KYLA 3OD2A 9ICIA 1JNZB 3QDKA 4AXJA 4C1NK 1P9YA 2HHHK 1GK8A 4NMXA 5ETQA 1SWWA 1KONA 2Q3SA 1N52B 1IBKJ 1PBAA 2ASJA 1NGAA 4X65J 4IR9A 2KHVA 5BOLA 2XGPA 1HJOA 2W8KA 5AQNA 1VSHA 5E41A 4WP9A 3I0RA 4MLEA 3T79A 2LP4A 1UETA 1ZD5A 1BWFO 3CYMA 2KT3A 3WXLA 1RP5A 3IWXA 3E9PA 2CH6A 1E4FT 3HD1A 1RDDA 4RW6A 2BXJA 3SZ2A 3KJNB 1WF2A 4QR1A 1JXLA 5HMMA 2P9NA 3GV7B 1J5OA 2ZH5A 1V5IB 3NBPA 1U1RA 2R7WA 1WWVA 1NSKL 1CEZA 3KD5E 3Q7BA 3VQ9A 4IO1A 5FPDA 2V7ZA 3CDWA 1HX1A 5ADXA 4DR2J 3EO3A 4FPRA 3TRGA 1X7VA 2AH5A 2PFUA 2WCXA 1NGFA 1NNLA 4RUCA 1R8PA 1U0HB 4EO6A 1A76A 2E8PA 4E7KA 3QNOA 4I1TA 3DOKB 4OI0A 5M1QA 1L3VA 5E3AA 4OCZA 4X4UA 4DR6J 3HZ6A 4ZN1A 4PA1A 1F21A 2K60A 4EYHB 4GVBA 1XMOK 3OYLA 4Y00A 4DLEA 1WC5A 3FEZA 3THWA 2C3MA 2HQIA 2VF3A 2F8MA 2YNFB 3O2IA 9ICLA 1NK0A 1HKCA 4CLSA 2QM1A 5LY3A 4HL9A 2G1HA 3KHYA 4DHVA 3OR1A 3P49B 4F26A 2JDJA 2Z0GA 1JXEA 4X64K 1KVAA 1R0AA 1PCAA 1CS4A 4DFDA 2KDOA 3LM2A 4YMMA 3R2CJ 4M3UA 3D0PA 1WORA 4DLGA 3DOMB 4CD3A 4QZCA 3F41A 4CHZA 3AQEA 1Y3KA 2HVZA 2O67A 2PI4A 5HI7A 5D49A 3MGHA 8ICNA 2E9RX 4HVJA 3MR3A 2J5AA 3MWTA 4NLKA 1VRTA 2K1RB 2F9WA 5CHCB 2IYIA 5BYQA 5J2EA 3SCJE 1F5BA 2ESEA 3M6UA 4XH5A 2UUBK 3HSGA 4ZJQA 2WTFA 4DX5A 2PMZF 4RBTA 4LF9J 3PJ9A 1Q16B 3NBPB 1SKWA 4ZS6A 1FWPA 1IKWB 3QLHB 2CGJA 3U9DA 1D9AA 4DL5A 4L75A 4E1MA 1XSNA 2KN4A 3UD4P 5HMZA 4ZHRA 3NG8A 4EEYA 3DLJA 2B9WA 8ICVA 3EE9A 4ECUA 3TACB 2MKIA 1F6TA 1ZYQA 4KMOB 3D7SB 4O5CA 5F2RA 1ZPVA 3BQ0A 1H0HB 3QO9B 1U2CA 4IWVA 5E84A 4UB2A 2AQ0A 2EFPA 4CHOA 2JRZA 3NF8A 2UU9J 4ELVA 3LP1A 2ADCA 3GU0A 1KQSR 1LKYB 3H2VE 3ZXWA 2LQJA 2V6AA 4QAGA 7ICIA 1FERA 4A8QA 5ETRA 3E0FA 4DCHA 4HEA9 1UKUA 2ES6A 2AJ4A 4LFAK 2J6TA 5HR7A 1P8GA 4DN0A 3NNCA 4L3QA 5F8NA 2CNOB 4O44B 4QW9A 1L3KA 3BPSP 4A57A 1BU6O 1G1XA 1H3DA 1HL6A 3M8QA 3C46A 3KZXA 2U1AA 3J81U 1FRHA 3H3NO 3THYB 1RK8A 3H7HB 2HHPA 2HOFA 5AM4A 3A5LC 2F4VF 4NASA 3HD2A 2VUGA 1NNEA 1LNQA 3RZAA 2ZBRA 4CWBA 1A6SA 4I6AA 1KOHA 4BG9A 3ZYYX 4F4KA 4FZNA 5F41A 2OM6A 4IJAA 1K47A 1XQSC 1S49A 3PDNA 4J9QA 3SSSA 2QLWA 4IDKA 2LM4A 2FSJA 5ALKA 4RU9A 4NB4A 4M0AA 4OJGA 4I2QB 2APOA 3EXCX 3SR6A 1HNZK 5C42B 4BCAA 3TVZA 4C4RA 1GXTA 3VERA 4C7ZA 3TA1A 5J0WA 3A2FA 3WT0A 2QWMA 4WE1A 2I6WA 1Y64A 5G0RA 2D3O1 5H9FK 1ZC6A 3PUFA 2C42A 4I2PA 2OP5A 3HM8A 1Q8LA 4LF5K 4DV4J 1ITGA 4KLUA 2HB5A 3IBFB 2VPZB 1HYVA 1U9LA 4CGDA 4R64A 2F8EX 3PJXA 4X64F 5D8HB 5C10A 1BISA 2MKYA 3TAQA 2D8CA 4AHTA 2QV6A 5JVGQ 4YS2A 3FE1A 2H3IA 1Y5NB 5BYSA 3OYEA 1MN8A 3CD6N 4LUBA 2B6GA 4CZGA 2GNKA 1T3VA 3D6JA 1EKRA 7ICUA 1FXRA 2D0CA 1FJEB 2D3DA 3TP2A 4R5PB 1KVKA 2DPIA 3G6YA 1D9FA 2ZEJA 4A48A 4A8YA 3MX2A 4KTZA 5D78A 2YNHB 3OL6A 3OYKA 3SV4A 2HQFA 4L72B 1SWVA 2F4FA 3KFWX 3BB5A 2CDRB 5F0XA 4CJ7A 4U8VA 5AM0A 1HBMA 2Y3YA 3DI6A 3QAUA 2E1MC 3UM9A 3V6JA 3PYEA 2DD8S 3LH2S 4DR5F 1X31C 2NQPA 1R8CA 3H2UB 3W3DA 1BNPA 1MDUB 3ALYA 4ANCA 5T7LB 5KFCA 2D3ZA 1PJ5A 4LFAJ 3DRYA 4OLAA 1SZ2A 3BYRA 4UT4A 4QZVB 2QSWA 4CZJA 1VK3A 3C6AA 1OPZA 5EN1A 4NLZA 1SC1B 3UXOA 1X66A 4QS8A 3H1QA 3RH4A 3IP4B 1MQ3A 5D0GA 2W54A 3LPYA 2OPPA 2ZTEA 4DU1A 4Z4IA 1U7LA 3F0NA 2GWJA 2R9LA 2Y0SC 3BV8A 4GVEA 2B0CA 5GAGP 2DWQA 3TW0A 4JI8J 1QSYA 1KP6A 4B3RJ 2P9GA 3KK3A 5AKGA 3R5JB 2WSCC 3C94A 2FC8A 3I55N 3F2DA 1QSSA 4LF9K 2EHGA 2UXCF 1RDAA 1WNSA 4B3SF 1KKXA 5CWRA 5EX0A 2KJVA 5GINA 2A42A 4CTAB 2CPYA 3CM5A 3PW4A 3AO3A 2VV5A 3VHQA 4DZDA 2ROPA 4MJKA 3C16B 2B0GA 4I28A 3AAWB 4CJFA 2VD3A 3TWZA 2HFVA 2XG8A 3VV2B 3MEKA 4J2BA 4QNLA 2AMCB 3ZCMA 4B9MA 3DC2A 2C3PA 2B5JB 1Q5YA 1DK2A 4J9UE 2UU9K 3DV9A 4KN4A 1RHQB 1AZSB 4BRAA 2UZAA 3WKEA 2IY5B 1L3UA 4GMJB 3CD7A 5H1SQ 1HW8A 1MU2A 2FI1A 4EI2A 1WHVA 5EX5A 2FBVA 1TELA 2LFVA 1MWZA 2LDIA 1QSLA 3DYAB 2K06A 2KHQA 4DWIA 3G71S 4L73A 5KFOA 4XH1A 2A10A 4OFZA 2IRXA 2RS8A 3CJ8A 4J8FA 5JTIA 2QZ8A 5DDYA 7ICFA 5GAEP 4RNOA 3SCKE 7ICJA 2VQEJ 1V85A 4ICLA 3QLHA 3TAFA 3J7YP 4CE6A 2K8AA 3RAXA 4KAZA 3ZFVA 1YVUA 2R2RA 2VGNA 1Q18A 3M2VB 2I9GA 5ITHA 1VAZA 4ZPCA 4BRNA 4X66J 5LSOA 1J2NA 1C20A 2MGZA 3QICA 4H5WA 4CM0A 3M7VA 2HZCA 4ZPBA 2KO1A 3C15A 2UUCK 5HMXA 3H5SA 2P51A 2ZD1A 5M1KA 3QRPA 5EE3A 5EWEA 5CCLA 2MSSA 1BD6A 4OLPA 1ZA1B 3JSMB 4CO1A 1GLCG 1RJJA 4WFAQ 2E2PA 3J80U 1QM9A 5B8HA 1TL3A 1I3AA 4NYZA 1XNRJ 1JCFA 4NZ6A 3HVTB 4MN4C 2DH8A 4HHUA 4JWNA 2WHOA 3D66A 3OVNA 1XMQF 2D0PA 4QCLA 5KRTA 1JIHA 2CFXA 3VGSA 3ULDA 3IP0A 3PW0A 3TFSA 3NXZA 1CLQA 1XC9A 1NH7A 4JV2A 5CD4A 5A8WA 1JLCA 2AX1A 3C19A 3U3YA 3K8WA 3DXKB 2HNYB 2AEJA 2R4FA 3M9NB 2MKJA 3VWSA 1GTHA 3I9ZA 4OPKA 5KFFA 2CQ3A 1BG3A 2OEJA 2QL7B 4CNQA 2B8PA 1DY3A 5IM0A 5CABA 1K8KA 3QMLA 5B0FA 1UPPA 2HOIA 5DDMA 3IG1B 4CZIA 2ISPA 2DXEA 3VQ6A 3H8WA 3DLLL 2ZQBA 5F1XA 3T5LA 2GCFA 2HVDA 2ZUGA 3MOZA 1HD0A 3PKYA 2GMLA 4RQ6A 2ATCB 2DKZA 3IAM9 4KB7A 3CUNA 1TAUA 4TU7A 2BE9B 3E01A 2KYXA 1OSCA 3WK4A 1F5SA 2YMMA 4F5PA 5AE2A 4YD2A 3V1OA 4MQ3A 3AY0A 2FJ6A 3PSTA 2L3MA 2DGQA 3C15B 3TTDA 3T19A 2WF6A 2Z1JA 3MWPA 3V7KA 2VQEK 3CG7A 2AEFA 4A8KA 2QXFA 1QQCA 2W25A 3KHGA 3CCEN 4DN9A 4ECRA 4MFAA 2E5SA 3OGUA 3D45A 2FSKA 2PXIA 3W5ZA 3ZT1A 1KRPA 1GX5A 1HBNA 2CN1A 4YY3F 1U4BA 3L3FX 2FDRA 4YP3A 3G2XA 1ZAXA 4DR5J 5DKWA 2OYQA 2I9SA 4LJXA 2HAFA 4TKTA 2IS3A 2QTDA 1BY9A 2H48B 3MM5A 3PIPL 2W7PA 3GILA 1F44A 4YEAA 1DTTA 4HLBA 2FJBB 3BBCA 2GW8A 3Q8PB 5J0RA 1NGEA 4PRFA 3RBZA 2NPIA 1IBCB 3LP3A 3M32A 1Y0HA 1WB9A 2VIHA 3QUTA 3NVZA 2GEMA 2F5GA 3E1YA 5LJ5Y 1YITN 4K4IA 3I31A 2ATLA 3QYPA 2HBYB 2XZDB 3PRVA 2OGUA 3BF3A 3IDWA 3LO3A 2VGMA 5J2KA 3JAMU 2GELA 5AQSA 1FESA 2UUAK 3GWCA 5C25B 2N3OA 4RX6A 2KHCA 2YI1A 1R27B 4CF3A 4LRAA 2QMXA 2R7OA 3O3LA 4J9VA 1EP4A 1XMQK 7ICRA 1JX4A 4NLDA 1GOAA 3CTRA 4X84A 3PFEA 2VWJA 3DLEA 4ZVFA 1RTJA 1EWQA 4ECZA 3RRHA 3MMAB 2OPRA 3VVUA 4N7TA 1MN9A 2IDLA 1X8DA 1U25A 4ZTJA 3NOCA 3M2UB 4CLWA 3DRSA 2VICA 4QZAA 2RNEA 1R0BG 5LM7E 4FLZA 3K58A 3BS9A 2R7YA 1VK0A 1Y5LB 3NY0A 1FXXA 4DR3J 4DUYK 4ELTA 2IA0A 2XYPB 3NTUA 4PGQA 3TYTA 4X4PA 2UUWA 3BH6B 2RDIA 1P9QC 4RW8A 7ICMA 1C0UA 1VLOA 4BC5A 3R3LA 3EKSA 4WXOA 3VF4A 4MFBB 2BJ7A 4QWAA 3GV5B 1X9XA 4RL1A 2V9WA 1N6QA 4KGVB 4XDDA 3K89A 4HI1A 2E1AA 3EVWA 1UZDA 5AQKA 2UUAF 2R2UA 2DNNA 4X65K 2F8KA 1DQAA 2PA3A 1X1PA 1SXEA 2BHNA 4QS7A 4J03A 3IG1A 3UNGC 3CD0A 5IT9O 1HBOB 1QTNB 2VJ4A 3RH5A 1RCHA 3ZDBA 1N61A 1TVRB 4GKKF 3DJCA 3PW5A 5DDQC 1S9GA 3BKUA 1MLAA 3G0ZA 2KXFA 1T95A 4ELUA 2L9DA 2HMXA 1VHXA 3DM2B 3OPKA 3LDLA 1X6IA 4NI2B 1NJYA 4H4OA 1CXQA 2YNGB 4E1JA 1RTDB 4LQ3A 4BVOA 5J29A 3TOQA 3V4IB 4Q8EA 2IDOA 4F93B 1GLDG 4LF6J 4CJEA 3LP0A 1VSIA 3TZZA 3P5JA 2IM2A 3H8YA 1KEKA 5DB7A 3LDOA 3ZTSA 3VR1A 3C2PA 1M1KT 4KHUA 3HP6A 1RDWX 3AVLA 1S1UA 3GP9A 4LF8K 1S6QB 3TKAA 3O3FA 3E8OA 4G9ZA 1VSMA 1NK6A 4O3MA 3KLIB 3K5MA 4WP8A 1NZ8A 2IC3B 3ELHA 4O0IA 2VCPA 4HTIA 3TUJC 2P2CB 3WX4A 4B9NA 3K5OA 3M1VA 2XM3A 1KKHA 4FPBA 3D1HA 2V2QA 1RT1A 2NCKL 2CJ9A 1Y7PA 3HOTA 2MPUA 4RW8B 3VTIA 3UCGA 5KT6A 3PVXA 2KG5A 3EZWA 5KPTA 3HT3A 1MNEA 5LJWA 2FB0A 2W41A 4PYAA 3W66A 3OXLA 2PDAA 5CCMA 2VDIA 3BM7A 3I0SB 3NL0A 2GV9A 4G65A 3U26A 5HROA 3G4SN 5LXYA 2ZITA 3H59A 2HDOA 4U7UK 3FYHA 3KOAA 2FVRA 2EVZA 2DGSA 4E7JA 5GIPA 2UXBF 3IV6A 1X4CA 3O9QA 1HMVB 3NAIA 1IV8A 5AQUA 2P1JA 1RKJA 3NGYA 4TU9A 5AQVA 1HHTP 3OR2B 2ZH9A 4QIWC 3QBWA 1WSJA 3MXJA 2O8FA 3C65A 2YKAA 1FRKA 2OD4A 2QMUB 5J2DA 5HRRA 3QU7A 2F3NA 2AV5A 2F96A 3CCLS 2XCAA 5D15A 1Z4UA 5E26A 2W1BA 1BIZA 2VBZA 3R5BA 2CPZA 5G5HA 3W64A 3KDOA 2WBNA 3WIVA 2UXCK 2LECA 2ZOMA 7ICVA 2A1BA 3BEGB 3D2WA 4I2BA 3JPSA 4O0NA 3S41A 4J2DA 4X62J 5I3QA 1ZAWA 3ZT2A 3CCSS 1ZQIA 2QB0B 2K1RA 1JCEA 4DR4K 2AJ0A 4OGCA 3M8QB 4CZMA 3ETLA 3V9XA 3IS9B 3OYMA 4RCHA 1HYSA 2BCUA 4IQXA 1GOCA 3AVIA 5IXUA 4GV3A 1S5JA 4ZN3A 3NE6A 4DG1B 4X4VA 4KHMA 3NHGA 4LVOP 1TUWA 2GMHA 5SZTA 2ZUCA 2YX1A 3KLEB 3TAMB 5F8GA 3AQFA 1ZQCA 1URNA 1M1GA 4K4WA 3I8DA 2QEXS 4FF1A 3WUHA 4M3RA 3PXGa 4LF8J 4QIFA 3QJLA 2LQBA 1XNRF 5ALIA 1X4DA 3KD3A 2BE2A 2V51B 3UN2A 1GLJO 3KZBA 5DG7A 4RWWA 2ZJ5A 3G4SS 4UBCA 1SZPA 3F53A 3F5TA 4FL9A 2FZGB 2QKQA 3OW2M 3C1YA 4KIAA 2A1JB 4NLUA 3ETOA 2DY4A 1AW0A 1HWLA 5M1FA 3TA2A 3CPWM 2QWLA 3WU2U 2QE5A 4K0KK 2JGAA 3UXPA 2YMLA 2RDDA 4H54A 3HSCA 4CEOA 5CYJA 1WEXA 2QYCA 2W3RA 1T3OA 3FQLA 1RABB 1M5KC 4I27A 2WF9A 1CS4B 3W5YA 1FNOA 2IOFA 3DHWC 3RMDA 2HNZA 4BS2A 4TSXA 1ZBIA 4UBBA 1OSDA 2VB6A 5C2CA 2XNRA 1BXNA 2QWRA 3ZZYA 3M4XA 1COOA 5KFAA 3UPFA 1B9DA 2LU1A 2DHGA 3QWPA 2RJZA 4K7QA 4I7FB 3M9OB 2GH1A 2JFDA 3GIJA 1VQLS 3MM7B 4P2FA 1HNWK 4DPWA 2HG4A 5LL6Z 3G9CA 3QNMA 1NPPA 5HR6A 3TUPA 1X5PA 5DDPC 1Q82T 4BACA 4A8SA 3FMWA 2QN6B 2HFSA 1Q7YO 3MD1A 3CCLN 2YKPA 3EL2A 2WAQD 4QPTA 1U1NA 2YKMB 4YG2A 2MZJA 1Z1BA 1S1TA 4KV8B 4TN2A 1NDCA 4KI6A 3MN7A 2EW9A 4NA3A 2L08A 3BJYA 1HBMB 1HMVA 1RTHB 2A5XA 3BBBA 3AVKA 3JXUA 1CJTB 5J0UA 2VASA 4IO9Q 3C14B 4Z6CA 3NCRA 5DJBA 2AYMA 3FQKA 1RACB 3DU5A 1R8BA 2AGPA 3U02A 4HH0A 2YHYA 3OXGA 3ICLA 3KJFB 1SH3A 1FEEA 2HYIB 4OYPA 2XB2D 4LMZA 5DETA 1Z1VA 3DDHA 1NUEA 1PYTA 4M7XA 5ALSA 2HQCA 1YWXA 4H4KC 2OXOA 1SUQA 3TSUA 1IBMK 1ZM2A 1P6TA 4I6MB 4QIEA 9ICRA 4DR1K 3LM9A 3OYBA 3KLFA 1WC3A 4XA5A 1ITPA 3L7OA 4YOVA 4O3NA 5AXKA 2ISOA 2VG7B 5J1PA 2IVYA 1HLUA 2OTLN 4FJ9A 1UAXA 3D4JA 2DR9A 4OJLA 1NBEB 1Z00B 4OPJA 1QVGR 5KFDA 4ECVA 4PHDA 3FGVA 4DPTA 1YI2N 2AYGA 5IV3A 3L7PA 3HK2A 1CBKA 2NZTA 4M5GA 2OJ3A 3K57A 4M3TA 1XMQJ 4JN4A 4KLGA 1N32F 4U6PA 3PO4A 5CJ7A 1B0XA 4K8RA 4F8RA 3V7LA 4Y65A 4JV5K 1N8RO 2W11A 1RT2A 2QWOA 2J76E 4LD0A 1C2PA 2E3TA 2EK1A 4IG0B 2R8GA 2G0CA 1OMSA 4FOIA 5ALGA 1G2EA 3CJKB 1HR0F 2GJ2A 3G6XA 1P1TA 5EU7A 1RWXB 1UFKA 4CYUA 1KQGB 4F5OA 5GAHI 5KQDA 2BJEA 5AKJA 3QT8A 5HMYA 4QQBA 1UPMB 4MYUA 3QYYA 1NLVA 2KG0A 2VKQA 2CAJA 3NMUA 1OY9A 2F2AB 4G1PA 2V4RA 2DR5A 3QERA 2JFKA 3PY8A 4U8YA 3UI3A 3CCRS 2FUG9 5BPMA 3HI9A 1YBTA 2L48A 2DNKA 4HCCA 4NLNA 2B4OA 3AJDA 2XICA 4FJNA 3ETRA 1SKUB 3LDPA 4GNIA 3TJ8A 3RH6A 3NASA 3ZDCA 2W2OP 3D7EO 2Z1HA 3QT6A 1YG0A 4Q7AA 3VQDA 1TL3B 4HHJA 4C4SA 1N56A 2O1PA 5L9NA 1YX2A 3CCJS 1QTMA 3NGTA 3UVJA 3RMAA 3AU2A 1TMJA 2EFNA 2HEKA 2FVQA 2G8KA 4C3KA 1LW0A 4F4ZA 4M5HA 4OMFG 4NL9C 2YMPA 2FHJD 5A8WB 2WF5A 2F1IA 4UB1A 1HKBA 4B02A 4C48A 5DB9A 2E8MA 1XC3A 5ALNA 3ZLJA 2QA4G 4LF8F 4JKGB 4DMZA 4PZOA 3KWIA 4TYAA 1HA1A 1DT9A 3DXBA 1X5TA 1TL4A 1RT2B 4Y6IA 4JYAJ 2CPHA 1ZQWA 1X4GA 5HQLA 3NGDA 4MEYA 2XEXA 3ISCA 3M8RA 3EPGA 3GYNA 4GKJK 3DRRA 1UWBB 3UKRA 3SUNA 3FMBA 4AHSA 4I2CA 2VOOA 4JUZA 3D6HB 2ZDPA 3OS1A 2W8LA 2CJBA 5F9NA 2PSZA 5AZJB 2K7JA 1QAIA 1VC0A 3FVYA 1H2VZ 2KXHA 4DV0F 2D0OA 3HVTA 3Q8KA 1CZAN 2HHUA 1CQMA 1YF5L 3UXNA 3FR0A 4YDDB 2LYBA 3FSXA 3MMJA 2DGXA 4CF4A 8ICBA 2YX8A 3K1RB 1WKKA 2P9SA 4HYKA 1XR5A 5L1MA 4J9OA 7ICLA 2AXTU 3N7SC 4ZP6A 2HS0A 2UXDF 4DFJA 4BJQA 3R9KA 2FHOB 4JI0K 4DSEA 4OX6A 2X51A 4YDXA 1PZNA 1IR0A 2B3TB 1CULA 1PG5B 2DHHA 3PR5B 2QL9B 3J8AA 4M42A 2PI5A 1HNVB 4K0KF 5IC6B 1JLQB 2I38A 3BO2A 1TFYA 3MZIA 3SBTA 2DFHA 2VDHA 2IJRA 5D0EA 4JRQA 2P6RA 5IT9Y 1T7PA 1FDBA 4CP5A 1WJ9A 3GFZA 1Q8IA 1PK3A 3SCXA 1FVQA 3RR8A 4CF1A 3MUVP 4IDKB 3P3DA 1UWAA 1LV5A 4QIVA 5HO4A 4LT6A 2YY3A 1XHXA 2P9EA 2RAQA 3GG4A 3HVRA 3G10A 3C5FA 2YHBA 2V8GA 1Q79A 5CR4A 1HIYA 4UUXA 2ZM6J 4H5VA 1VCTA 2WONB 4F5RA 3T1YJ 3NFAA 2GVZA 1Q9XA 3QNWB 2J9CA 3C14A 4DSFA 3CRXA 2IVNA 4ED4A 4BUGA 2FLPA 2V8DA 2UVRA 1N5VA 2AJ2A 4C9DA 1TVRA 4JV5J 1DRZA 4USMA 5J1EA 3MN5A 3W9JA 4QOZB 1XMOF 1XR7A 9ICNA 2DNOA 4USKA 4B3RF 1U47A 2FLNA 4C1NI 8ICJA 2YNGA 2AHOB 1HBNB 2CQIA 2JOQA 2CNLB 2ZBQA 3IFRA 4NLWA 3C6UA 2VKZG 1IBLF 2GJFA 2EG2A 1VR6A 4K2XA 1YJVA 5MLCQ 3TU5A 3ULEB 1S12A 3LZIA 5CA7A 4BXOB 2KFZA 4DFMA 3T5HA 1HPZB 4HI2A 1UZHA 2JVRA 4GKJJ 1M90O 2FIUA 1NMNA 2ZJRQ 1ZBFA 4H5NA 4JI6F 4F3TA 4G3IA 4CJ3A 5J0PA 4DV7F 4OX9F 3ZZTA 4NPOA 5HRNA 2Q0ZX 3LA0A 1C1BA 1UHUA 5DDRC 3ENAA 1L6NA 2FF6A 3QUQA 2B7BB 3AQOA 4YN3B 1JLAB 3WZ0A 4KX5A 3ID6A 4IXCA 4DCOB 1ZQAA 4C2MA 1KC8T 2BABA 2GUIA 2HPUA 2M9NA 3THPA 3G8TA 3F73A 2B21A 3W2VA 4DUYJ 5CE3A 4X4QA 2XYHB 3HDSA 4L74A 3TTCA 1VQ6N 2W9AA 4JI7K 2HBQB 4WU3A 4URQU 2GHWA 5HROB 2E2NA 5B7WA 2F44A 5CXTA 1S0VA 2YTCA 5HMWA 5FROA 3A0BU 1OQ3A 3GG0A 3I5CA 5KG3A 3KKFA 3KKRA 2IVFB 1V6HA 5AK4A 3P5TL 3SDEA 3G6EN 1IM6A 4RJVA 5J2NB 3T7ZA 1UPHA 2CRXA 2Q0UA 2ZH2A 3UFCX 1S9EA 1MW7A 4RW9A 2PZSA 1BPEA 4IBNA 4FLTA 3NUQA 2W9CB 1KHWA 3X1LB 1TKZB 5L38A 4C0OC 1U02A 4I6YA 1N0VC 1RT3B 3A8JA 1JROA 3HRDD 5AXNA 2ZM6K 2BCQA 2HLTA 8ICRA 1J5EK 1QVGM 3MN6A 4IH7A 5DBAA 4IOCQ 4ZH4A 1URRA 1Q78A 4WFNQ 5L39A 2KZ3A 4DV3K 1RXVA 3CXCM 1V5VA 2ZE2B 4ECXA 4CGHA 3MDCA 2ZUAA 4QOTA 2DFEA 4BC3A 4FBUA 1XNQJ 4PKDB 3QSYB 1TGOA 1LW0B 5LXRA 3CD5A 2JLFA 3K8VA 1ZBHA 1NMEB 2KNJA 4ILGB 1M1KO 1D1UA 2HS4A 3OFFA 3SMVA 4O9MA 2CGLA 2RP5A 4K42A 2XHWA 3I0SA 1YSJA 2KEYA 2KQ2A 4KLTA 5M1OA 2EAPA 5FLXU 1FW6A 3T1HJ 1S22A 4BVPA 1VDVA 4ED7A 1IXKA 2DGZA 1JLCB 1KQKA 2ALZA 4Y2YA 1HNIB 1GXLA 1PJ7A 5J2BA 3AT1B 2AEMA 2AGOA 4KO0B 2MEWA 4ZOHC 1JLEB 2GIRA 1VFJA 4KTQA 1JL2A 3O80A 3LWMA 3VQTA 2HMPA 2RB7A 3L6QA 4F50A 5J2CA 2HIYA 3KK1A 2NSBA 4HUGA 4HACA 4OZ5A 4OX7A 1Q86T 4W4MA 4C0HA 4ZIVA 5CZ1A 3TADA 2Y1JA 3QUBA 2VQFJ 9ICHA 2FQQB 4GLXA 4DX7A 4CGGA 3R97A 3BREA 2NNWA 4AM7A 1M5OC 4C7QA 3VQ7A 4IO8A 1YIJN 3QIPA 1JMTA 1Y3JA 4IOAL 4MFCA 5IWAJ 4KI4A 4OV1A 3EGWB 3HHEA 1Q53A 3AO2A 3ISND 4NXMF 4YDUC 1A5VA 4Y2TA 1X4AA 4DTUA 1OJ4A 1VBKA 1VIXA 1DKGD 4NA2A 4ECQA 3QGHA 1CJKB 5CHGA 1HBUA 3NS5A 3N6MA 3O8WA 3L2QA 2F8TA 1MWMA 3NCIA 2E1CA 1TV6B 3S6EA 2H5XA 2K8BB 2HSTA 1FE0A 4USVA 3R9PA 5GADP 5ALOA 4F36A 3I9V9 1VQKS 4NY8A 1X9MA 2POKA 4ZVRB 5KFIA 3Q8QB 3DDNA 4AQYK 3CCZA 1W2BM 5ALWA 2NRRA 2YKMA 4KLMA 4ZOSA 3K5NA 4AUKA 2VJVA 1WEZA 1AXQA 3MPUB 2O8EB 5F9LA 4KJIA 5LMUJ 1DBDA 4FXDA 1QQ7A 2R7TA 1KTVA 3ZX0A 2MQQA 4K4TA 1RILA 2W4DA 4LR8A 2XMAA