2QARA

Structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
ASIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQRPGGGGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 19
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qarA00
2QARB 2ES6A 2DKXA 1JI7A 2EAOA 2F8KA 1B0XA 5F3XB 2JV3A 1UQVA 1X9XA 2E8PA 2K60A 2QB1A 1SV0A 1PK3A 2F44A 3BQ7A 1X40A 2YTUA 3SEIA 2KE7A 2FE9A 2KMDA 1WWVA 3IDWA 2QB0B 2KG5A 4IS7A 3TACB 1OW5A 2LPEA 1V38A 5JU5A 1COKA 1SXDA 1KW4A 4PZOA 5JTIA 1SV4A 4NJ8A 3TADA 1SV0C 2Y9TA 1SXEA 3KKAA 2F3NA 2KIVA 2QKQA 2D8CA 2L5YA 1F0MA 5KNIA 5J8YA 3HILA 4NL9A 5J8YC 3BS5A 2GLEA 1B4FA 1WWUA 2D3DA 2E8OA 1Z1VA 2ESEA 2EANA 4RQMA 1LKYA 1UCVA 2KSOA 3BS7A 4RQNA 3TADC 4MHVA 2B6GA 2DKZA 1PK1A 1DXSA 1SGGA 3KKAC 3BS5B 2QARA 2LMRA 3SENA 2DL0A 4NL9C 2E8NA 2Y9UA 2K4PA 1X66A 5L1MA 2E8MA 4PZNA 1OXJA 1LKYB 1V85A 2KSOB 3H8MA 3K1RB 5JRTA 1RG6A 2EAPA 1PK1B 2QB0A 2EAMA
chains in the Genus database with same CATH superfamily
4QZDA 2ZIVB 3QNMA 4Y2YA 2FI1A 1JALA 2CRXA 1ZQTA 5J0TA 3K75D 3RJIA 1UQVA 4KLEA 1NJZA 4CF4A 4DCCA 3G6XA 3T5LA 4NY8A 3PY8A 4FS1A 1B43A 4DSIA 4BXOA 1IM4A 8ICPA 1X6IA 5EE1A 4OD0A 1Q3UA 3ISCA 4RQ2A 2JEJA 2ZUBA 3QU5A 2G08A 3MGVA 4M47A 3M9OB 1O08A 4I2BA 2KJ8A 2D8CA 5KFHA 5J8YA 2Y1JA 2KKPA 3PSTA 8ICAA 1SZHA 3PNCA 2KIWA 2J6UA 4ED2A 1XSLA 2IHMA 1SZPA 2DWQA 1ZQKA 1RYRA 4YMOA 4DFJA 5ALGA 1S10A 2RLTA 2ZIXA 4OJ6A 2YMMA 4YXJA 5KFOA 4B9MA 2B6GA 5C5JA 2B0CA 2KHQA 5IIIA 4RZRA 5DQIA 1TV9A 9ICGA 4YD1A 2AXTU 4IRDA 3MR5A 1UA0A 1HUOA 1Z00B 1MC8A 4PGXA 8ICKA 1TK0A 4RT2A 1ZQDA 1QQ7A 4P0QB 5KFXA 2PMZF 1KTQA 2E1EA 2FPLA 3EZ5A 3PO4A 1T94A 5J29A 1Z1BA 2PFQA 1L3UA 2HBJA 3GQCA 4RQ1A 5HNKA 4QZIA 2UVUA 1X9MA 3RBEA 1Q8KA 9ICBA 3JPQA 5KFGA 4J9OA 4QNLA 5CA7A 1SV0A 3AQEA 2P35A 3NVWA 5CB1A 4DQQA 4Q8FA 2KMDA 2KOBA 4FO6A 9ICSA 3IDWA 1ZQZA 4EEYA 4DQIA 3NVZA 1WUDA 4IRKA 7ICRA 3NVVA 2LHTA 2LYHA 2G5IB 3AEVA 1SXDA 4F4ZA 1WCLA 2KICA 4JWNA 3SMVA 4ECXA 5ALEA 5DB8A 2IA6A 4F5PA 2ZG6A 5CRXA 2AGQA 3M7DA 3WKCA 4RU9A 4C7ZA 3RJJA 4C4RA 2W43A 1EXNA 2AHOB 1P7DA 7ICNA 2WTFA 4M6WA 3LYSA 7ICMA 3BQ1A 3QZ8A 8ICVA 5AM0A 3AMZA 2ASJA 4F92B 4CRXA 4UBCA 3M1YA 3C1YA 5J0OA 1ZQRA 2DPJA 5AM4A 4U6PA 2DL0A 2XICA 4Y2UA 2HW3A 1L7MA 3LK9A 3NS1A 2K4PA 7ICUA 4EENA 4PZNA 2C28A 4EYHB 4F4XA 2R18A 2MUTB 2KSOB 4F5NA 4ECVA 3K1RB 4UAYA 2KZMA 5ALJA 1D9DA 4EBDA 1ZQNA 2BCRA 1S8OA 5AK5A 4GFJA 5J2BA 1DRGA 2QB0A 1V97A 8ICTA 2EAMA 4KLGA 2M0NA 4QZCA 3H4BA 1PUZA 3TAPA 3KOOA 4XA5A 5KFPA 2WF5A 4YXMA 1ZQUA 2XIDA 4MFFA 1QCKA 5KFCA 4M2YA 1L7OA 4UATA 1XS9D 4R8UB 4IC9A 5ALMA 3MGIA 4GC6A 1QTMA 5ALOA 1L3VA 1FFVA 1Z3EB 2WHEA 9ICRA 5KFZA 1ZQSA 2GO7A 1F5SA 2UVRA 4B9SA 4UARA 1SV0C 4YR2A 1KFTA 1UT8A 2Z7JA 4CE6A 2DQNB 2E5SA 3IV6A 3KKAA 3HX0A 2XY7A 3GV7B 3BQ2A 4GXKA 4NL9A 3ZD8A 3F2CA 5ALPA 3PX4A 3QXGA 4BUGA 4DFKA 4RQ5A 3MC1A 4JWMA 4ECUA 4QZAA 1BNPA 1A6SA 3GDXA 3IG5A 4KLIA 4J9KA 2ZUCA 3SV4A 4LVSA 4QZHA 1S5LU 4C0ZA 5J2EA 4Y2JA 4O3PA 1ZJMA 1SWVA 7ICJA 2AQ4A 3MR3A 2XCPA 3PW4A 9ICMA 3JPTA 4M9NA 4KTQA 4F5QA 3Q8RB 3NTUA 5CHGA 2QARB 2JH1A 4JB3A 4UB6U 5IINA 4EX6A 4DLGA 2W11A 5J2FA 1ZYQA 2KFZA 2K60A 8ICQA 2ASLA 3V7JA 4GXJA 2I1QA 3WK9A 2HBMA 1TKDA 5KFSA 2HOFA 3L4PA 1FIQA 4PGYA 2NV3A 4M9LA 2HHXA 8ICSA 3LWMA 2HSZA 3HPOA 4MEYA 4XQ8A 3C5GA 2I6XA 2HVHA 2PFNA 4IQTA 1UA1A 4F93B 5HR6A 4RPXA 3LVWA 8ICHA 4PZOA 3PSPA 2CPRA 2VANA 2YN4A 2P6RA 5DBBA 2Q0ZX 4OJOA 4P4OA 3WK8A 1VDVA 4DF8A 4ED7A 5AICA 1JXEA 5F9LA 1Z4NA 8ICUA 3H4DA 2GLEA 5G5HA 4ECZA 3AUOA 2E8OA 3H0RB 3GIIA 1JN3A 2LYBA 4DS5A 1NKCA 1HIWA 3HRDD 1XSNA 1NK8A 4I2DA 3UXOA 2W04A 1URJA 3KKAC 1LB2B 5KFLA 4Z6CA 5J0YA 4NL9C 3OHAA 1KFDA 5ALKA 2E8NA 4TQRA 2Y9UA 2E1FA 5J2AA 3OTQA 4UAVA 4YG2A 3R9KA 3HW8A 2V9WA 2HOQA 4M9JA 5AI0A 3ISDA 3BQTA 2R8GA 2ZUDA 2EZZA 4AP9A 1X2IA 5KL8B 1K1QA 1PZNA 1S0OA 2E8PA 1NOMA 2QB1A 2A3VA 3C1ZA 3MABA 5DDMA 2KK0A 3TFSA 3LVVA 4O3QA 2F1HA 4P0PB 1S0VA 4CGZA 1XC9A 9ICLA 5KG1A 4XUSA 2VKQA 4QZFA 3TACB 2BPCA 1NK5A 4RNMA 4J9MA 4MFCA 2H3IA 3ISBA 3HT3A 2Q4TA 4YN4A 2FLPA 3MR2A 1RXVA 5ALFA 4PHEA 4QIWC 2W8LA 8ICIA 2F3NA 3GILA 2MAXA 4UB8U 2V4QA 2OYYA 2KJ9A 4EYIB 3QEAZ 2BGWA 5KG6A 1ZOLA 4ZOHC 1L8LA 2VIXA 5ALWA 4J9QA 2K4HA 5DGAA 2VJ4A 2K8CB 4MHVA 3QU2A 1ED1A 3H8WA 2LM1A 2EZYA 2ZIUA 8ICXA 4NM2A 3C21A 2AGPA 3BS5B 1BVSA 4RQ4A 2MA1A 3EYZA 2JH7A 4DQRA 4ECYA 1LKYB 3RB3A 7ICGA 3HKZC 1CI4A 2KVCA 2W3SA 3PW2A 4O3RA 2W9CA 3QUCA 4RQMA 2RHFA 3I1YA 4BGDA 5EWFA 5J2GA 2XY5A 5F3XB 1KFSA 3EWAA 2A1AA 3FAHA 3Q8MA 8ICYA 3KHGA 4DLEA 4ACOA 3PVXA 4KX3A 4O5KA 3NRZA 1BNOA 4DOBA 5EWGA 5E79U 3PSFA 2GWSA 3WKEA 2AGOA 4OJ5A 2JZBB 2HBLA 2RQ5A 4P4MA 5HHHA 5KFUA 4AYBF 3MGHA 2HMXA 3F2BA 4B6JA 3ED5A 2ATLA 2R8IA 4J03A 1J2MA 2W9BA 5L9XA 5IILA 8ICLA 1U48A 1SXEA 2KIVA 3OSNA 1F0MA 3JPNA 5DKWA 4EX7A 3M8SA 1C7YA 1SWWA 2IMWP 1ZD4A 9ICWA 5AKHA 2UVWA 1MN8A 1NJYA 4FZLA 4DSKA 1MSWD 1FO4A 1ZQQA 4FS2A 4ELTA 2DGZA 4ICAA 3RAXA 1BPBA 1NK4A 4O3OA 5J0XA 1PVRA 1VLBA 1TAMA 4RT3A 4Y2QA 9ICJA 2EH9A 1S9FA 2WF8A 3DV9A 3Q8LA 4DL2A 5DDYA 5L1MA 2PKEA 4O3NA 5EWEA 3NRWA 3F2DA 2PI5A 4DL3A 1NNLA 1M6YA 3SYZA 4I2GA 3IRUA 2OEHA 4O9MA 2MSNA 4R65A 4IQVA 1NK9A 4Y2VA 1S0NA 3KHRA 2XVTA 4DL7A 3RB4A 1X9SA 1RYSA 5HMLA 4TUPA 4F5OA 8ICNA 3JPRA 2LKYA 4FFDA 4FZMA 2WFAA 4Y2XA 3C2LA 3KBBA 4FE3A 3RFAA 5ALDA 2KE7A 1ZQJA 1TFRA 4UAWA 7ICTA 2D6FC 2HHQA 2C2RA 4MF2A 5KT6A 2W7PA 4Q45A 1ZD3A 2C2EA 2DPIA 1V38A 3MBYA 7ICPA 2Y0SC 5TISU 1KW4A 5JTIA 2Y1IA 2H3QA 2EDUA 4NJ8A 3TADA 2A19A 5J2HA 3ETLA 3QUQA 4DS4A 3ZDDA 2IOHA 4YMNA 5DG7A 4BXOB 4Q8EA 1T8EA 3H8JA 4Q44A 1L3SA 1SKRA 5J2IA 3AM9A 3HILA 5CJ7A 2KFNA 3SD7A 1Z4OA 3UXNA 2W9MA 4RUAA 3H40A 2VA2A 3RRHA 1N2XA 4QWAA 3QU7A 5KFJA 1XO0A 2WF6A 1MQ3A 3RJHA 2W7OA 9ICXA 1ZQMA 4CDGA 3JPOA 3ZDCA 5DGBA 4F2RA 4CNQA 1L5UA 9ICUA 4US9A 2K4IA 2EZXA 4O0IA 2WB1C 4M0AA 2ZIXB 2H3ZA 4KN7A 1QSYA 5FP0A 4TURA 4C8LA 1AQ6A 2BKEA 1TVAA 1JMSA 4KITB 3VC8A 4GC7A 4O3SA 2FDRA 1RQLA 4UW9A 2CXYA 3D2NA 3T79A 4O5CA 4C8KA 1X6JA 3TARA 2NO5A 4NLCA 5DB6A 1QQ5A 3C29A 3GIMA 1X40A 3H0MB 3MDCA 3OSPA 2AU0A 1ZETA 9ICQA 5AI9A 1N48A 3KTQA 5KFNA 4P4PA 2BQUA 1ZD5A 4QWBA 2JEIA 2NRWA 2LBOA 4NXZA 3AU6A 3PO5A 5CEHA 1FFUA 4LJXA 2ZIWA 4RQ0A 3C28A 5AK4A 1BPZA 3OPXA 4QWEA 5DG9A 2W3RA 5ALZA 5KFRA 3KFUF 2OWOA 5AIAA 4UAUA 1NK0A 3TKAA 4GXIA 2ESEA 3L3FX 5AI6A 4ED3A 3CW2C 4ECWA 4ECTA 1ZRNA 4EZ9A 3TADC 4J9LA 1U9LA 3N97B 2OM6A 2UVVA 4P2HA 3RH4A 2XO7A 1SGGA 2FLNA 2F1IA 3MDAA 4YCXA 2KN7A 1KKXA 2KNJA 4M6WB 4IR9A 4PJ0U 2AQ0A 3O0FA 4KLFA 2WAQC 2JRZA 2RP5A 3QU4A 4ED6A 3Q8QB 3M8RA 3E2EA 3ONNA 4KN4A 1ZQBA 4NM1A 4A8EA 2FPMA 4PHAA 1B0XA 4UBBA 4PHDA 2G07A 5ALYA 1TAUA 1NZBA 3T5JA 1Q3VA 2BCQA 2IOFA 5AKXA 4QZBA 3BQ7A 5KG0A 3BJYA 1MQ2A 2W8KA 1WWVA 4MFAA 1QH9A 2QB0B 4C8OA 3KZXA 1X9WA 4I28A 5AI4A 2ALZA 5KT4A 2LPEA 3OJUA 5CR0A 1D8BA 5AHXA 2IBKA 5AK3A 4C4TA 4DFPA 2BQRA 3M6KA 5KG4A 3N7SC 2G06A 5HHIA 1N62A 3UPQA 2BPFA 3L5KA 2JEFA 2L5YA 1ZQGA 4F4YA 4ELUA 2GOLA 3AQFA 1BPEA 3T3FA 3IM1A 2AJQA 4ED1A 4M04A 1ZQOA 5DLFA 9ICHA 9ICOA 5DQGA 3PX0A 3PMNA 2QLTA 3T5KA 4YR3A 1L3TA 1HEKA 1L7PA 1DXSA 2YMLA 1ZQFA 2FLLA 4Z6FA 4US8A 3RH6A 4F8RA 2BCVA 1N61A 5KFTA 1J97A 3SAHA 2MU2A 4UASA 1SIJA 3M9NB 3TFRA 3FDSA 1ZRMA 1RPLA 1X66A 2E8MA 2HHVA 4J9NA 2BCSA 5CWRA 2LI6A 4EEKA 5L1KA 4ELVA 3GU3A 9ICCA 4USAA 2EAPA 4RUCA 2PI4A 5T14A 3ZDAA 1CEZA 2F1JA 4PL2A 2C2DA 4R66A 4DOCA 1AROP 2AH5A 4NLKA 1CRXA 4ECQA 5KFDA 5HR7A 5DBCA 3F53A 2LM4A 3PSIA 3UQ2A 5IIKA 4OO1J 1LV5A 1X9XA 1OUQA 7ICFA 9ICPA 5ALUA 3ETRA 3BQ0A 4F50A 4F2SA 1RYUA 7ICKA 2A1JA 5A0LA 3WK7A 1ZQ1C 3C2KA 1A77A 3SEIA 2BZFA 2K8AA 4KLLA 1JIHA 1ZQAA 5KFAA 2FJ6A 1DK3A 1QLNA 4RQ8A 2V4RA 1NKEA 5EOZA 4BX9C 1HJPA 5ALNA 4F4WA 4B9NA 2ASDA 3E0FA 5ALQA 1J2NA 4IR1A 1B22A 4MF8A 3SI8A 2XC9A 4ZH4A 4ED8A 4NV0A 1XNSA 5B5EU 1BPYA 2PMZC 1RM6C 4DL6A 1ZQCA 4HAIA 5KT5A 3RH5A 2OH2A 4DQPA 2D3DA 3H0LB 2OXOA 4F5RA 1H38A 4BWMA 1SKSA 5ALHA 5KFWA 3RF9A 3FM9A 1F44A 4U7CA 1PK1A 1JXLA 3N7PD 4PPXA 4Z6EA 4NLZA 2ZIVA 4F4KA 1CUKA 1RZTA 5H2FU 5F9NA 2P66A 2DBYA 1YT3A 3I76A 4ECSA 3E58A 3FYHA 3V6KA 7ICLA 3CP8A 1TK5A 4K4HA 1KEJA 3WKBA 1WG8A 3H8MA 3QYPA 1QSLA 3PR5B 5KFYA 1K1SA 5HMMA 4DQSA 1S97A 1NKBA 2EAOA 3UM9A 4O3MA 3PW5A 5EE9A 1DGSA 4Y2PA 3RJEA 5KFFA 8ICGA 5AKKA 2R8KA 3WK4A 1ZQXA 4DWIA 2ZTDA 1Q46A 1GO3F 7ICVA 5DB9A 4RQ6A 2DFLA 4IS7A 5KFVA 2RDIA 5KAIU 1KN5A 3PMLA 2B21A 3WK5A 3A0BU 1UPHA 3SAFA 1PVQA 4YP3A 2JR5A 4K4IA 1FEZA 3ALRA 4DSEA 4OJPA 1JX4A 2G5HB 3UQ0A 4B9LA 1S77D 4GLXA 3F5EA 4M9GA 2NO4A 4DL4A 1HUZA 4B9UA 2FMPA 3V6JA 1ZQLA 3RB0A 2W54A 2RRDA 3GIKA 1Z00A 3PX6A 3WKDA 5J0QA 4DSFA 4IRCA 4C80A 1TE2A 5J0WA 4KX5A 5J0RA 4QZ8A 4P0QA 4C7YA 5IIJA 1ZQHA 8ICRA 5HP4A 5IIMA 2IOFK 5KT2A 4PL1A 1N5XA 3GV8B 4QZGA 1QSSA 1TK8A 4WJ3B 4TUQA 3J81j 1RXWA 3GFKB 4Q43A 1ZJNA 2BHNA 2O6KA 8ICBA 4I2HA 2ZIUB 3C23A 4KLQA 4QJFB 2W9AA 3HWTA 3UMBA 4DSLA 4UB5A 4PGQA 3EPIA 2ES6A 2IHNA 8ICCA 3QU9A 1JI7A 2F8KA 2F8LA 3D6JA 5L1LA 1UT5A 2XGPA 3RJKA 3RAQA 1SKWA 4IL6U 5KG3A 2F44A 4EELA 3N4MB 1ZQWA 3DDHA 3AL0B 4YVZA 2HHUA 3N7RC 2W9CB 8ICWA 5ALSA 3ZI4A 4M9HA 4MEXA 1U47A 4BDPA 5AM2A 4FBUA 5KFEA 1WCNA 4QW8A 3ZDEA 4C4SA 5KAFU 8ICJA 4UB1A 3V6HA 3TANA 3G6VA 1COKA 4KLTA 1TAQA 4DFDA 2BQ3A 5EE0A 2VA3A 2MRLA 2JHDA 2PFPA 4R63A 2ISOA 2GH1A 2PFOA 4BWJA 2YMPA 4LZGA 2J6TA 5KT7A 5KNIA 2KKVA 7ICQA 2OHFA 3THVA 1B4FA 5AI5A 4JMUA 3ORYA 4YFKA 4UB2A 3EPGA 3RTVA 5KFQA 2YQEA 3RR8A 9ICFA 2H5XA 1D9FA 2W9BB 1UCVA 2MUTA 2KSOA 3TI0A 3JPPA 2F2AB 5AKYA 4KMOB 1JUDA 4XRHA 2YB4A 3CRXA 4B9VA 2JEGA 5KT3A 4RPZA 4JV0A 2BDPA 1ZQVA 4TUSA 2DUYA 4DOAA 1LVHA 5AKIA 1VJ5A 2P6UA 3OHBA 2G0AA 3Q8SB 4QIWF 1NZPA 2DF4B 1L6NA 4RQ3A 5BOMA 2KZ3A 1NI3A 4F71A 3S6JA 2W03A 5C0YA 4R8UA 2ZJAA 4EBCA 3CNHA 3Q8PB 4KLDA 4NLNA 9ICNA 3V72A 2R8JA 5DB7A 4NLBA 1KDHA 3WKAA 1RQNA 2KHVA 5EE3A 3ZDBA 2BPGA 4UQGA 2YX8A 2NRVA 4JUZA 2KG5A 4E0DA 1U4BA 5K4LA 3UXPA 1OW5A 5AIBA 1IG6A 3HKZF 4JK1A 3QZ7A 4OCZA 3V7LA 3H8SA 2NYVA 1MA7A 2KTQA 3RB6A 5AKEA 4I27A 3WK6A 4DO9A 2KEYA 5L1IA 3SZ2A 7ICHA 1S0MA 5KFBA 2ZJ8A 1SL1A 5J8YC 2WF9A 4IQUA 4QWDA 2XCAA 2I9GA 3PR4A 4KLOA 4FZNA 5DLGA 3OGUA 4J9SA 4TQSA 4KLSA 1ZQYA 3PZPA 4RQ7A 3QUTA 2BCUA 3QEBZ 2R8HA 4QWCA 2QARA 3EW9A 1DK2A 2LMRA 1X42A 5D46A 8ICOA 3QUBA 2HBKA 3MFIA 8ICZA 4I2EA 3M9MB 1V85A 5D4BA 1UHUA 5KL1B 3T5HA 5JRTA 4R64A 1PVPA 5DBAA 1U49A 4YMMA 1JRPA 7ICOA 1A0PA 3SV3A 1XU4A 3RJFA 4X5VA 2F76X 1ZQPA 5ALRA 2EQYA 1PK3A 3N28A 5AKLA 2YTUA 3B0YA 2K4EA 5D49A 3K4GA 3HP6A 1KL9A 4JV1A 2HHWA 2C22A 3B0XA 5B66U 1K5OA 3MR6A 2YY6A 1RDFA 3AN1A 3LDAA 1IXRA 5JU5A 4I2AA 3MFHA 2RDJA 1ECWA 9ICEA 4RPYA 2HOIA 9ICTA 2KV2A 7ICEA 2H3FA 2XY6A 4DL5A 2JGAA 5J2KA 1YZ6A 2JXJA 2CN1A 4Z6DA 4RNOA 3U26A 3GIJA 2QKQA 1Y88A 2HHSA 5ALXA 1N60A 3KHLA 1D8LA 4QZ9A 4J9PA 1KSPA 5ALVA 4I2FA 5DG8A 8ICEA 1SL2A 2ZIWB 3K1ZA 7ICSA 1Z1VA 2KVSA 4ECRA 5GTHU 2EANA 3M6ZA 3IHQB 4NWIA 5J0SA 4I29A 2XGQA 4RQNA 4I2JA 3D2SA 4UB4A 1XWLA 2FPKA 2ISPA 2Y0SF 4OJLA 1BGXT 4CF3A 4LZDA 4YQWA 3VCBA 7ICIA 3QX7A 4KLHA 4C8MA 5ALIA 1NK6A 2ZXIA 8ICMA 1COOA 1IV8A 3B9JA 5J0PA 4AYBC 3NVYA 3BZCA 4P0PA 1KBUA 8ICFA 2K89A 3NUQA 9ICKA 5DQHA 1SB3C 1S76D 1YZ7A 1C20A 3C2MA 5GTIU 2XI9A 2ODGA 2FMSA 2JV3A 4K4GA 3JPSA 3IG8A 1T3QA 3NGDA 2HHTA 2PXIA 5J0UA 1BPDA 4FBTA 1T7PA 5AKJA 5AM1A 2YMQA 1Z19A 2FE9A 3QE9Y 1DGJA 2I5HA 4F91B 5AM5A 5AI8A 4YR0A 3RR7A 3UMGA 4KLUA 3SQIA 1L7NA 5J2CA 3CYMA 1IIPA 4KLMA 4I2IA 2HCFA 1NJWA 1T4GA 2WB1F 3KZIU 2F77X 2LYAA 2JMGA 2HDOA 4G9BA 3PW0A 4IQWA 1L8OA 3LWLA 4RNNA 5IIOA 5L1JA 3Q8KA 2NRXA 1KLNA 3BS5A 3BZKA 4C8NA 1QQ6A 2ZJ5A 2N1RA 1O03A 3HJEA 4HYKA 4F72A 1KQQA 1D8YA 2HI0A 3BDPA 3V7KA 3KD3A 1ZQEA 1LKYA 2ZTCA 4YD2A 3BS7A 1XO1A 5KFIA 4CCHA 1ZD2P 4EBEA 5AM3A 4F3OA 4G3IA 5KG5A 2WF7A 4Y2TA 3SENA 3KHHA 3UMCA 9ICIA 1NK7A 2HVIA 9ICVA 3C5FA 4JV2A 2J6SA 3DEEA 5ALTA 3WU2U 1N56A 5KG2A 4DSJA 1ZXIA 2OCEA 3EUB2 1OXJA 2BDUA 5CP2A 4QZEA 3SAGA 4Y2RA 5KFMA 1XSPA 3ZD9A 1JROA 4CF5A 3I28A 4QW9A 3RRGA 1N5WA 1KRPA 2DKXA 2FMQA 3SR6A 2JZBA 3PV8A 2M9NA 5KFKA 5G5GA 2KD1A 4PH5A 3H7IA 3NASA 3GZFA 9ICAA 5KTQA 4NLGA 4I2CA 3OJSA 1BPXA 4O5EA 3IP4B 3TQ1A 4Y2SA 1A76A 4PHPA 4ED0A 3GV5B 2KJ5A 2WAQF 2KZZA 1N63A 2BR0A 3RBDA 5J2DA 1SV4A 2A1JB 2YB1A 5TZVA 3PW7A 1V9PA 3TAQA 2W55A 3IN5A 5BPCA 5KG7A 2Y9TA 5AKZA 1WYGA 5ALLA 2ZTEA 3G6YA 1WWUA 4DEZA 3D2QA 3F5AA 2VJ5A 4KMUA 1SL0A 5JUMA 2KP7A 4DF4A 1U45A 4UB3A 4BJQA 3ICXA 2K8BB 2VA8A 2DKZA 1ZQIA 2ZXHA 4DFMA 2H3VA 4UAZA 1T3NA 1NJXA 3A0HU 1DOQA 2E3TA 4GIBA 2NRTA 4KLJA 5AK6A 4EZ6A 5BOLA 2G09A 1RG6A 5J2JA 2NRZA 4B9TA 4J9RA 3RJGA 1PK1B 3AU2A 3FC4A 5AKGA
chains in the Genus database with same CATH topology
2QARB 2ES6A 2DKXA 1JI7A 2EAOA 2F8KA 1B0XA 5F3XB 2JV3A 1UQVA 1X9XA 2E8PA 2K60A 2QB1A 1SV0A 1PK3A 2F44A 3BQ7A 1X40A 2YTUA 3SEIA 2KE7A 2FE9A 2KMDA 1WWVA 3IDWA 2QB0B 2KG5A 4IS7A 3TACB 1OW5A 2LPEA 1V38A 5JU5A 1COKA 1SXDA 1KW4A 4PZOA 5JTIA 1SV4A 4NJ8A 3TADA 1SV0C 2Y9TA 1SXEA 3KKAA 2F3NA 2KIVA 2QKQA 2D8CA 2L5YA 1F0MA 5KNIA 5J8YA 3HILA 4NL9A 5J8YC 3BS5A 2GLEA 1B4FA 1WWUA 2D3DA 2E8OA 1Z1VA 2ESEA 2EANA 4RQMA 1LKYA 1UCVA 2KSOA 3BS7A 4RQNA 3TADC 4MHVA 2B6GA 2DKZA 1PK1A 1DXSA 1SGGA 3KKAC 3BS5B 2QARA 2LMRA 3SENA 2DL0A 4NL9C 2E8NA 2Y9UA 2K4PA 1X66A 5L1MA 2E8MA 4PZNA 1OXJA 1LKYB 1V85A 2KSOB 3H8MA 3K1RB 5JRTA 1RG6A 2EAPA 1PK1B 2QB0A 2EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR B;  2ES6 A;  2DKX A;  1JI7 A;  2EAO A;  2F8K A;  1B0X A;  5F3X B;  2JV3 A;  1UQV A;  1X9X A;  2E8P A;  2K60 A;  2QB1 A;  1SV0 A;  1PK3 A;  2F44 A;  3BQ7 A;  1X40 A;  2YTU A;  3SEI A;  2KE7 A;  2FE9 A;  2KMD A;  1WWV A;  3IDW A;  2QB0 B;  2KG5 A;  4IS7 A;  3TAC B;  1OW5 A;  2LPE A;  1V38 A;  5JU5 A;  1COK A;  1SXD A;  1KW4 A;  4PZO A;  5JTI A;  1SV4 A;  4NJ8 A;  3TAD A;  1SV0 C;  2Y9T A;  1SXE A;  3KKA A;  2F3N A;  2KIV A;  2QKQ A;  2D8C A;  2L5Y A;  1F0M A;  5KNI A;  5J8Y A;  3HIL A;  4NL9 A;  5J8Y C;  3BS5 A;  2GLE A;  1B4F A;  1WWU A;  2D3D A;  2E8O A;  1Z1V A;  2ESE A;  2EAN A;  4RQM A;  1LKY A;  1UCV A;  2KSO A;  3BS7 A;  4RQN A;  3TAD C;  4MHV A;  2B6G A;  2DKZ A;  1PK1 A;  1DXS A;  1SGG A;  3KKA C;  3BS5 B;  2QAR A;  2LMR A;  3SEN A;  2DL0 A;  4NL9 C;  2E8N A;  2Y9U A;  2K4P A;  1X66 A;  5L1M A;  2E8M A;  4PZN A;  1OXJ A;  1LKY B;  1V85 A;  2KSO B;  3H8M A;  3K1R B;  5JRT A;  1RG6 A;  2EAP A;  1PK1 B;  2QB0 A;  2EAM A; 
#chains in the Genus database with same CATH topology
 4QZD A;  2ZIV B;  3QNM A;  4Y2Y A;  2FI1 A;  1JAL A;  2CRX A;  1ZQT A;  5J0T A;  3K75 D;  3RJI A;  1UQV A;  4KLE A;  1NJZ A;  4CF4 A;  4DCC A;  3G6X A;  3T5L A;  4NY8 A;  3PY8 A;  4FS1 A;  1B43 A;  4DSI A;  4BXO A;  1IM4 A;  8ICP A;  1X6I A;  5EE1 A;  4OD0 A;  1Q3U A;  3ISC A;  4RQ2 A;  2JEJ A;  2ZUB A;  3QU5 A;  2G08 A;  3MGV A;  4M47 A;  3M9O B;  1O08 A;  4I2B A;  2KJ8 A;  2D8C A;  5KFH A;  5J8Y A;  2Y1J A;  2KKP A;  3PST A;  8ICA A;  1SZH A;  3PNC A;  2KIW A;  2J6U A;  4ED2 A;  1XSL A;  2IHM A;  1SZP A;  2DWQ A;  1ZQK A;  1RYR A;  4YMO A;  4DFJ A;  5ALG A;  1S10 A;  2RLT A;  2ZIX A;  4OJ6 A;  2YMM A;  4YXJ A;  5KFO A;  4B9M A;  2B6G A;  5C5J A;  2B0C A;  2KHQ A;  5III A;  4RZR A;  5DQI A;  1TV9 A;  9ICG A;  4YD1 A;  2AXT U;  4IRD A;  3MR5 A;  1UA0 A;  1HUO A;  1Z00 B;  1MC8 A;  4PGX A;  8ICK A;  1TK0 A;  4RT2 A;  1ZQD A;  1QQ7 A;  4P0Q B;  5KFX A;  2PMZ F;  1KTQ A;  2E1E A;  2FPL A;  3EZ5 A;  3PO4 A;  1T94 A;  5J29 A;  1Z1B A;  2PFQ A;  1L3U A;  2HBJ A;  3GQC A;  4RQ1 A;  5HNK A;  4QZI A;  2UVU A;  1X9M A;  3RBE A;  1Q8K A;  9ICB A;  3JPQ A;  5KFG A;  4J9O A;  4QNL A;  5CA7 A;  1SV0 A;  3AQE A;  2P35 A;  3NVW A;  5CB1 A;  4DQQ A;  4Q8F A;  2KMD A;  2KOB A;  4FO6 A;  9ICS A;  3IDW A;  1ZQZ A;  4EEY A;  4DQI A;  3NVZ A;  1WUD A;  4IRK A;  7ICR A;  3NVV A;  2LHT A;  2LYH A;  2G5I B;  3AEV A;  1SXD A;  4F4Z A;  1WCL A;  2KIC A;  4JWN A;  3SMV A;  4ECX A;  5ALE A;  5DB8 A;  2IA6 A;  4F5P A;  2ZG6 A;  5CRX A;  2AGQ A;  3M7D A;  3WKC A;  4RU9 A;  4C7Z A;  3RJJ A;  4C4R A;  2W43 A;  1EXN A;  2AHO B;  1P7D A;  7ICN A;  2WTF A;  4M6W A;  3LYS A;  7ICM A;  3BQ1 A;  3QZ8 A;  8ICV A;  5AM0 A;  3AMZ A;  2ASJ A;  4F92 B;  4CRX A;  4UBC A;  3M1Y A;  3C1Y A;  5J0O A;  1ZQR A;  2DPJ A;  5AM4 A;  4U6P A;  2DL0 A;  2XIC A;  4Y2U A;  2HW3 A;  1L7M A;  3LK9 A;  3NS1 A;  2K4P A;  7ICU A;  4EEN A;  4PZN A;  2C28 A;  4EYH B;  4F4X A;  2R18 A;  2MUT B;  2KSO B;  4F5N A;  4ECV A;  3K1R B;  4UAY A;  2KZM A;  5ALJ A;  1D9D A;  4EBD A;  1ZQN A;  2BCR A;  1S8O A;  5AK5 A;  4GFJ A;  5J2B A;  1DRG A;  2QB0 A;  1V97 A;  8ICT A;  2EAM A;  4KLG A;  2M0N A;  4QZC A;  3H4B A;  1PUZ A;  3TAP A;  3KOO A;  4XA5 A;  5KFP A;  2WF5 A;  4YXM A;  1ZQU A;  2XID A;  4MFF A;  1QCK A;  5KFC A;  4M2Y A;  1L7O A;  4UAT A;  1XS9 D;  4R8U B;  4IC9 A;  5ALM A;  3MGI A;  4GC6 A;  1QTM A;  5ALO A;  1L3V A;  1FFV A;  1Z3E B;  2WHE A;  9ICR A;  5KFZ A;  1ZQS A;  2GO7 A;  1F5S A;  2UVR A;  4B9S A;  4UAR A;  1SV0 C;  4YR2 A;  1KFT A;  1UT8 A;  2Z7J A;  4CE6 A;  2DQN B;  2E5S A;  3IV6 A;  3KKA A;  3HX0 A;  2XY7 A;  3GV7 B;  3BQ2 A;  4GXK A;  4NL9 A;  3ZD8 A;  3F2C A;  5ALP A;  3PX4 A;  3QXG A;  4BUG A;  4DFK A;  4RQ5 A;  3MC1 A;  4JWM A;  4ECU A;  4QZA A;  1BNP A;  1A6S A;  3GDX A;  3IG5 A;  4KLI A;  4J9K A;  2ZUC A;  3SV4 A;  4LVS A;  4QZH A;  1S5L U;  4C0Z A;  5J2E A;  4Y2J A;  4O3P A;  1ZJM A;  1SWV A;  7ICJ A;  2AQ4 A;  3MR3 A;  2XCP A;  3PW4 A;  9ICM A;  3JPT A;  4M9N A;  4KTQ A;  4F5Q A;  3Q8R B;  3NTU A;  5CHG A;  2QAR B;  2JH1 A;  4JB3 A;  4UB6 U;  5IIN A;  4EX6 A;  4DLG A;  2W11 A;  5J2F A;  1ZYQ A;  2KFZ A;  2K60 A;  8ICQ A;  2ASL A;  3V7J A;  4GXJ A;  2I1Q A;  3WK9 A;  2HBM A;  1TKD A;  5KFS A;  2HOF A;  3L4P A;  1FIQ A;  4PGY A;  2NV3 A;  4M9L A;  2HHX A;  8ICS A;  3LWM A;  2HSZ A;  3HPO A;  4MEY A;  4XQ8 A;  3C5G A;  2I6X A;  2HVH A;  2PFN A;  4IQT A;  1UA1 A;  4F93 B;  5HR6 A;  4RPX A;  3LVW A;  8ICH A;  4PZO A;  3PSP A;  2CPR A;  2VAN A;  2YN4 A;  2P6R A;  5DBB A;  2Q0Z X;  4OJO A;  4P4O A;  3WK8 A;  1VDV A;  4DF8 A;  4ED7 A;  5AIC A;  1JXE A;  5F9L A;  1Z4N A;  8ICU A;  3H4D A;  2GLE A;  5G5H A;  4ECZ A;  3AUO A;  2E8O A;  3H0R B;  3GII A;  1JN3 A;  2LYB A;  4DS5 A;  1NKC A;  1HIW A;  3HRD D;  1XSN A;  1NK8 A;  4I2D A;  3UXO A;  2W04 A;  1URJ A;  3KKA C;  1LB2 B;  5KFL A;  4Z6C A;  5J0Y A;  4NL9 C;  3OHA A;  1KFD A;  5ALK A;  2E8N A;  4TQR A;  2Y9U A;  2E1F A;  5J2A A;  3OTQ A;  4UAV A;  4YG2 A;  3R9K A;  3HW8 A;  2V9W A;  2HOQ A;  4M9J A;  5AI0 A;  3ISD A;  3BQT A;  2R8G A;  2ZUD A;  2EZZ A;  4AP9 A;  1X2I A;  5KL8 B;  1K1Q A;  1PZN A;  1S0O A;  2E8P A;  1NOM A;  2QB1 A;  2A3V A;  3C1Z A;  3MAB A;  5DDM A;  2KK0 A;  3TFS A;  3LVV A;  4O3Q A;  2F1H A;  4P0P B;  1S0V A;  4CGZ A;  1XC9 A;  9ICL A;  5KG1 A;  4XUS A;  2VKQ A;  4QZF A;  3TAC B;  2BPC A;  1NK5 A;  4RNM A;  4J9M A;  4MFC A;  2H3I A;  3ISB A;  3HT3 A;  2Q4T A;  4YN4 A;  2FLP A;  3MR2 A;  1RXV A;  5ALF A;  4PHE A;  4QIW C;  2W8L A;  8ICI A;  2F3N A;  3GIL A;  2MAX A;  4UB8 U;  2V4Q A;  2OYY A;  2KJ9 A;  4EYI B;  3QEA Z;  2BGW A;  5KG6 A;  1ZOL A;  4ZOH C;  1L8L A;  2VIX A;  5ALW A;  4J9Q A;  2K4H A;  5DGA A;  2VJ4 A;  2K8C B;  4MHV A;  3QU2 A;  1ED1 A;  3H8W A;  2LM1 A;  2EZY A;  2ZIU A;  8ICX A;  4NM2 A;  3C21 A;  2AGP A;  3BS5 B;  1BVS A;  4RQ4 A;  2MA1 A;  3EYZ A;  2JH7 A;  4DQR A;  4ECY A;  1LKY B;  3RB3 A;  7ICG A;  3HKZ C;  1CI4 A;  2KVC A;  2W3S A;  3PW2 A;  4O3R A;  2W9C A;  3QUC A;  4RQM A;  2RHF A;  3I1Y A;  4BGD A;  5EWF A;  5J2G A;  2XY5 A;  5F3X B;  1KFS A;  3EWA A;  2A1A A;  3FAH A;  3Q8M A;  8ICY A;  3KHG A;  4DLE A;  4ACO A;  3PVX A;  4KX3 A;  4O5K A;  3NRZ A;  1BNO A;  4DOB A;  5EWG A;  5E79 U;  3PSF A;  2GWS A;  3WKE A;  2AGO A;  4OJ5 A;  2JZB B;  2HBL A;  2RQ5 A;  4P4M A;  5HHH A;  5KFU A;  4AYB F;  3MGH A;  2HMX A;  3F2B A;  4B6J A;  3ED5 A;  2ATL A;  2R8I A;  4J03 A;  1J2M A;  2W9B A;  5L9X A;  5IIL A;  8ICL A;  1U48 A;  1SXE A;  2KIV A;  3OSN A;  1F0M A;  3JPN A;  5DKW A;  4EX7 A;  3M8S A;  1C7Y A;  1SWW A;  2IMW P;  1ZD4 A;  9ICW A;  5AKH A;  2UVW A;  1MN8 A;  1NJY A;  4FZL A;  4DSK A;  1MSW D;  1FO4 A;  1ZQQ A;  4FS2 A;  4ELT A;  2DGZ A;  4ICA A;  3RAX A;  1BPB A;  1NK4 A;  4O3O A;  5J0X A;  1PVR A;  1VLB A;  1TAM A;  4RT3 A;  4Y2Q A;  9ICJ A;  2EH9 A;  1S9F A;  2WF8 A;  3DV9 A;  3Q8L A;  4DL2 A;  5DDY A;  5L1M A;  2PKE A;  4O3N A;  5EWE A;  3NRW A;  3F2D A;  2PI5 A;  4DL3 A;  1NNL A;  1M6Y A;  3SYZ A;  4I2G A;  3IRU A;  2OEH A;  4O9M A;  2MSN A;  4R65 A;  4IQV A;  1NK9 A;  4Y2V A;  1S0N A;  3KHR A;  2XVT A;  4DL7 A;  3RB4 A;  1X9S A;  1RYS A;  5HML A;  4TUP A;  4F5O A;  8ICN A;  3JPR A;  2LKY A;  4FFD A;  4FZM A;  2WFA A;  4Y2X A;  3C2L A;  3KBB A;  4FE3 A;  3RFA A;  5ALD A;  2KE7 A;  1ZQJ A;  1TFR A;  4UAW A;  7ICT A;  2D6F C;  2HHQ A;  2C2R A;  4MF2 A;  5KT6 A;  2W7P A;  4Q45 A;  1ZD3 A;  2C2E A;  2DPI A;  1V38 A;  3MBY A;  7ICP A;  2Y0S C;  5TIS U;  1KW4 A;  5JTI A;  2Y1I A;  2H3Q A;  2EDU A;  4NJ8 A;  3TAD A;  2A19 A;  5J2H A;  3ETL A;  3QUQ A;  4DS4 A;  3ZDD A;  2IOH A;  4YMN A;  5DG7 A;  4BXO B;  4Q8E A;  1T8E A;  3H8J A;  4Q44 A;  1L3S A;  1SKR A;  5J2I A;  3AM9 A;  3HIL A;  5CJ7 A;  2KFN A;  3SD7 A;  1Z4O A;  3UXN A;  2W9M A;  4RUA A;  3H40 A;  2VA2 A;  3RRH A;  1N2X A;  4QWA A;  3QU7 A;  5KFJ A;  1XO0 A;  2WF6 A;  1MQ3 A;  3RJH A;  2W7O A;  9ICX A;  1ZQM A;  4CDG A;  3JPO A;  3ZDC A;  5DGB A;  4F2R A;  4CNQ A;  1L5U A;  9ICU A;  4US9 A;  2K4I A;  2EZX A;  4O0I A;  2WB1 C;  4M0A A;  2ZIX B;  2H3Z A;  4KN7 A;  1QSY A;  5FP0 A;  4TUR A;  4C8L A;  1AQ6 A;  2BKE A;  1TVA A;  1JMS A;  4KIT B;  3VC8 A;  4GC7 A;  4O3S A;  2FDR A;  1RQL A;  4UW9 A;  2CXY A;  3D2N A;  3T79 A;  4O5C A;  4C8K A;  1X6J A;  3TAR A;  2NO5 A;  4NLC A;  5DB6 A;  1QQ5 A;  3C29 A;  3GIM A;  1X40 A;  3H0M B;  3MDC A;  3OSP A;  2AU0 A;  1ZET A;  9ICQ A;  5AI9 A;  1N48 A;  3KTQ A;  5KFN A;  4P4P A;  2BQU A;  1ZD5 A;  4QWB A;  2JEI A;  2NRW A;  2LBO A;  4NXZ A;  3AU6 A;  3PO5 A;  5CEH A;  1FFU A;  4LJX A;  2ZIW A;  4RQ0 A;  3C28 A;  5AK4 A;  1BPZ A;  3OPX A;  4QWE A;  5DG9 A;  2W3R A;  5ALZ A;  5KFR A;  3KFU F;  2OWO A;  5AIA A;  4UAU A;  1NK0 A;  3TKA A;  4GXI A;  2ESE A;  3L3F X;  5AI6 A;  4ED3 A;  3CW2 C;  4ECW A;  4ECT A;  1ZRN A;  4EZ9 A;  3TAD C;  4J9L A;  1U9L A;  3N97 B;  2OM6 A;  2UVV A;  4P2H A;  3RH4 A;  2XO7 A;  1SGG A;  2FLN A;  2F1I A;  3MDA A;  4YCX A;  2KN7 A;  1KKX A;  2KNJ A;  4M6W B;  4IR9 A;  4PJ0 U;  2AQ0 A;  3O0F A;  4KLF A;  2WAQ C;  2JRZ A;  2RP5 A;  3QU4 A;  4ED6 A;  3Q8Q B;  3M8R A;  3E2E A;  3ONN A;  4KN4 A;  1ZQB A;  4NM1 A;  4A8E A;  2FPM A;  4PHA A;  1B0X A;  4UBB A;  4PHD A;  2G07 A;  5ALY A;  1TAU A;  1NZB A;  3T5J A;  1Q3V A;  2BCQ A;  2IOF A;  5AKX A;  4QZB A;  3BQ7 A;  5KG0 A;  3BJY A;  1MQ2 A;  2W8K A;  1WWV A;  4MFA A;  1QH9 A;  2QB0 B;  4C8O A;  3KZX A;  1X9W A;  4I28 A;  5AI4 A;  2ALZ A;  5KT4 A;  2LPE A;  3OJU A;  5CR0 A;  1D8B A;  5AHX A;  2IBK A;  5AK3 A;  4C4T A;  4DFP A;  2BQR A;  3M6K A;  5KG4 A;  3N7S C;  2G06 A;  5HHI A;  1N62 A;  3UPQ A;  2BPF A;  3L5K A;  2JEF A;  2L5Y A;  1ZQG A;  4F4Y A;  4ELU A;  2GOL A;  3AQF A;  1BPE A;  3T3F A;  3IM1 A;  2AJQ A;  4ED1 A;  4M04 A;  1ZQO A;  5DLF A;  9ICH A;  9ICO A;  5DQG A;  3PX0 A;  3PMN A;  2QLT A;  3T5K A;  4YR3 A;  1L3T A;  1HEK A;  1L7P A;  1DXS A;  2YML A;  1ZQF A;  2FLL A;  4Z6F A;  4US8 A;  3RH6 A;  4F8R A;  2BCV A;  1N61 A;  5KFT A;  1J97 A;  3SAH A;  2MU2 A;  4UAS A;  1SIJ A;  3M9N B;  3TFR A;  3FDS A;  1ZRM A;  1RPL A;  1X66 A;  2E8M A;  2HHV A;  4J9N A;  2BCS A;  5CWR A;  2LI6 A;  4EEK A;  5L1K A;  4ELV A;  3GU3 A;  9ICC A;  4USA A;  2EAP A;  4RUC A;  2PI4 A;  5T14 A;  3ZDA A;  1CEZ A;  2F1J A;  4PL2 A;  2C2D A;  4R66 A;  4DOC A;  1ARO P;  2AH5 A;  4NLK A;  1CRX A;  4ECQ A;  5KFD A;  5HR7 A;  5DBC A;  3F53 A;  2LM4 A;  3PSI A;  3UQ2 A;  5IIK A;  4OO1 J;  1LV5 A;  1X9X A;  1OUQ A;  7ICF A;  9ICP A;  5ALU A;  3ETR A;  3BQ0 A;  4F50 A;  4F2S A;  1RYU A;  7ICK A;  2A1J A;  5A0L A;  3WK7 A;  1ZQ1 C;  3C2K A;  1A77 A;  3SEI A;  2BZF A;  2K8A A;  4KLL A;  1JIH A;  1ZQA A;  5KFA A;  2FJ6 A;  1DK3 A;  1QLN A;  4RQ8 A;  2V4R A;  1NKE A;  5EOZ A;  4BX9 C;  1HJP A;  5ALN A;  4F4W A;  4B9N A;  2ASD A;  3E0F A;  5ALQ A;  1J2N A;  4IR1 A;  1B22 A;  4MF8 A;  3SI8 A;  2XC9 A;  4ZH4 A;  4ED8 A;  4NV0 A;  1XNS A;  5B5E U;  1BPY A;  2PMZ C;  1RM6 C;  4DL6 A;  1ZQC A;  4HAI A;  5KT5 A;  3RH5 A;  2OH2 A;  4DQP A;  2D3D A;  3H0L B;  2OXO A;  4F5R A;  1H38 A;  4BWM A;  1SKS A;  5ALH A;  5KFW A;  3RF9 A;  3FM9 A;  1F44 A;  4U7C A;  1PK1 A;  1JXL A;  3N7P D;  4PPX A;  4Z6E A;  4NLZ A;  2ZIV A;  4F4K A;  1CUK A;  1RZT A;  5H2F U;  5F9N A;  2P66 A;  2DBY A;  1YT3 A;  3I76 A;  4ECS A;  3E58 A;  3FYH A;  3V6K A;  7ICL A;  3CP8 A;  1TK5 A;  4K4H A;  1KEJ A;  3WKB A;  1WG8 A;  3H8M A;  3QYP A;  1QSL A;  3PR5 B;  5KFY A;  1K1S A;  5HMM A;  4DQS A;  1S97 A;  1NKB A;  2EAO A;  3UM9 A;  4O3M A;  3PW5 A;  5EE9 A;  1DGS A;  4Y2P A;  3RJE A;  5KFF A;  8ICG A;  5AKK A;  2R8K A;  3WK4 A;  1ZQX A;  4DWI A;  2ZTD A;  1Q46 A;  1GO3 F;  7ICV A;  5DB9 A;  4RQ6 A;  2DFL A;  4IS7 A;  5KFV A;  2RDI A;  5KAI U;  1KN5 A;  3PML A;  2B21 A;  3WK5 A;  3A0B U;  1UPH A;  3SAF A;  1PVQ A;  4YP3 A;  2JR5 A;  4K4I A;  1FEZ A;  3ALR A;  4DSE A;  4OJP A;  1JX4 A;  2G5H B;  3UQ0 A;  4B9L A;  1S77 D;  4GLX A;  3F5E A;  4M9G A;  2NO4 A;  4DL4 A;  1HUZ A;  4B9U A;  2FMP A;  3V6J A;  1ZQL A;  3RB0 A;  2W54 A;  2RRD A;  3GIK A;  1Z00 A;  3PX6 A;  3WKD A;  5J0Q A;  4DSF A;  4IRC A;  4C80 A;  1TE2 A;  5J0W A;  4KX5 A;  5J0R A;  4QZ8 A;  4P0Q A;  4C7Y A;  5IIJ A;  1ZQH A;  8ICR A;  5HP4 A;  5IIM A;  2IOF K;  5KT2 A;  4PL1 A;  1N5X A;  3GV8 B;  4QZG A;  1QSS A;  1TK8 A;  4WJ3 B;  4TUQ A;  3J81 j;  1RXW A;  3GFK B;  4Q43 A;  1ZJN A;  2BHN A;  2O6K A;  8ICB A;  4I2H A;  2ZIU B;  3C23 A;  4KLQ A;  4QJF B;  2W9A A;  3HWT A;  3UMB A;  4DSL A;  4UB5 A;  4PGQ A;  3EPI A;  2ES6 A;  2IHN A;  8ICC A;  3QU9 A;  1JI7 A;  2F8K A;  2F8L A;  3D6J A;  5L1L A;  1UT5 A;  2XGP A;  3RJK A;  3RAQ A;  1SKW A;  4IL6 U;  5KG3 A;  2F44 A;  4EEL A;  3N4M B;  1ZQW A;  3DDH A;  3AL0 B;  4YVZ A;  2HHU A;  3N7R C;  2W9C B;  8ICW A;  5ALS A;  3ZI4 A;  4M9H A;  4MEX A;  1U47 A;  4BDP A;  5AM2 A;  4FBU A;  5KFE A;  1WCN A;  4QW8 A;  3ZDE A;  4C4S A;  5KAF U;  8ICJ A;  4UB1 A;  3V6H A;  3TAN A;  3G6V A;  1COK A;  4KLT A;  1TAQ A;  4DFD A;  2BQ3 A;  5EE0 A;  2VA3 A;  2MRL A;  2JHD A;  2PFP A;  4R63 A;  2ISO A;  2GH1 A;  2PFO A;  4BWJ A;  2YMP A;  4LZG A;  2J6T A;  5KT7 A;  5KNI A;  2KKV A;  7ICQ A;  2OHF A;  3THV A;  1B4F A;  5AI5 A;  4JMU A;  3ORY A;  4YFK A;  4UB2 A;  3EPG A;  3RTV A;  5KFQ A;  2YQE A;  3RR8 A;  9ICF A;  2H5X A;  1D9F A;  2W9B B;  1UCV A;  2MUT A;  2KSO A;  3TI0 A;  3JPP A;  2F2A B;  5AKY A;  4KMO B;  1JUD A;  4XRH A;  2YB4 A;  3CRX A;  4B9V A;  2JEG A;  5KT3 A;  4RPZ A;  4JV0 A;  2BDP A;  1ZQV A;  4TUS A;  2DUY A;  4DOA A;  1LVH A;  5AKI A;  1VJ5 A;  2P6U A;  3OHB A;  2G0A A;  3Q8S B;  4QIW F;  1NZP A;  2DF4 B;  1L6N A;  4RQ3 A;  5BOM A;  2KZ3 A;  1NI3 A;  4F71 A;  3S6J A;  2W03 A;  5C0Y A;  4R8U A;  2ZJA A;  4EBC A;  3CNH A;  3Q8P B;  4KLD A;  4NLN A;  9ICN A;  3V72 A;  2R8J A;  5DB7 A;  4NLB A;  1KDH A;  3WKA A;  1RQN A;  2KHV A;  5EE3 A;  3ZDB A;  2BPG A;  4UQG A;  2YX8 A;  2NRV A;  4JUZ A;  2KG5 A;  4E0D A;  1U4B A;  5K4L A;  3UXP A;  1OW5 A;  5AIB A;  1IG6 A;  3HKZ F;  4JK1 A;  3QZ7 A;  4OCZ A;  3V7L A;  3H8S A;  2NYV A;  1MA7 A;  2KTQ A;  3RB6 A;  5AKE A;  4I27 A;  3WK6 A;  4DO9 A;  2KEY A;  5L1I A;  3SZ2 A;  7ICH A;  1S0M A;  5KFB A;  2ZJ8 A;  1SL1 A;  5J8Y C;  2WF9 A;  4IQU A;  4QWD A;  2XCA A;  2I9G A;  3PR4 A;  4KLO A;  4FZN A;  5DLG A;  3OGU A;  4J9S A;  4TQS A;  4KLS A;  1ZQY A;  3PZP A;  4RQ7 A;  3QUT A;  2BCU A;  3QEB Z;  2R8H A;  4QWC A;  2QAR A;  3EW9 A;  1DK2 A;  2LMR A;  1X42 A;  5D46 A;  8ICO A;  3QUB A;  2HBK A;  3MFI A;  8ICZ A;  4I2E A;  3M9M B;  1V85 A;  5D4B A;  1UHU A;  5KL1 B;  3T5H A;  5JRT A;  4R64 A;  1PVP A;  5DBA A;  1U49 A;  4YMM A;  1JRP A;  7ICO A;  1A0P A;  3SV3 A;  1XU4 A;  3RJF A;  4X5V A;  2F76 X;  1ZQP A;  5ALR A;  2EQY A;  1PK3 A;  3N28 A;  5AKL A;  2YTU A;  3B0Y A;  2K4E A;  5D49 A;  3K4G A;  3HP6 A;  1KL9 A;  4JV1 A;  2HHW A;  2C22 A;  3B0X A;  5B66 U;  1K5O A;  3MR6 A;  2YY6 A;  1RDF A;  3AN1 A;  3LDA A;  1IXR A;  5JU5 A;  4I2A A;  3MFH A;  2RDJ A;  1ECW A;  9ICE A;  4RPY A;  2HOI A;  9ICT A;  2KV2 A;  7ICE A;  2H3F A;  2XY6 A;  4DL5 A;  2JGA A;  5J2K A;  1YZ6 A;  2JXJ A;  2CN1 A;  4Z6D A;  4RNO A;  3U26 A;  3GIJ A;  2QKQ A;  1Y88 A;  2HHS A;  5ALX A;  1N60 A;  3KHL A;  1D8L A;  4QZ9 A;  4J9P A;  1KSP A;  5ALV A;  4I2F A;  5DG8 A;  8ICE A;  1SL2 A;  2ZIW B;  3K1Z A;  7ICS A;  1Z1V A;  2KVS A;  4ECR A;  5GTH U;  2EAN A;  3M6Z A;  3IHQ B;  4NWI A;  5J0S A;  4I29 A;  2XGQ A;  4RQN A;  4I2J A;  3D2S A;  4UB4 A;  1XWL A;  2FPK A;  2ISP A;  2Y0S F;  4OJL A;  1BGX T;  4CF3 A;  4LZD A;  4YQW A;  3VCB A;  7ICI A;  3QX7 A;  4KLH A;  4C8M A;  5ALI A;  1NK6 A;  2ZXI A;  8ICM A;  1COO A;  1IV8 A;  3B9J A;  5J0P A;  4AYB C;  3NVY A;  3BZC A;  4P0P A;  1KBU A;  8ICF A;  2K89 A;  3NUQ A;  9ICK A;  5DQH A;  1SB3 C;  1S76 D;  1YZ7 A;  1C20 A;  3C2M A;  5GTI U;  2XI9 A;  2ODG A;  2FMS A;  2JV3 A;  4K4G A;  3JPS A;  3IG8 A;  1T3Q A;  3NGD A;  2HHT A;  2PXI A;  5J0U A;  1BPD A;  4FBT A;  1T7P A;  5AKJ A;  5AM1 A;  2YMQ A;  1Z19 A;  2FE9 A;  3QE9 Y;  1DGJ A;  2I5H A;  4F91 B;  5AM5 A;  5AI8 A;  4YR0 A;  3RR7 A;  3UMG A;  4KLU A;  3SQI A;  1L7N A;  5J2C A;  3CYM A;  1IIP A;  4KLM A;  4I2I A;  2HCF A;  1NJW A;  1T4G A;  2WB1 F;  3KZI U;  2F77 X;  2LYA A;  2JMG A;  2HDO A;  4G9B A;  3PW0 A;  4IQW A;  1L8O A;  3LWL A;  4RNN A;  5IIO A;  5L1J A;  3Q8K A;  2NRX A;  1KLN A;  3BS5 A;  3BZK A;  4C8N A;  1QQ6 A;  2ZJ5 A;  2N1R A;  1O03 A;  3HJE A;  4HYK A;  4F72 A;  1KQQ A;  1D8Y A;  2HI0 A;  3BDP A;  3V7K A;  3KD3 A;  1ZQE A;  1LKY A;  2ZTC A;  4YD2 A;  3BS7 A;  1XO1 A;  5KFI A;  4CCH A;  1ZD2 P;  4EBE A;  5AM3 A;  4F3O A;  4G3I A;  5KG5 A;  2WF7 A;  4Y2T A;  3SEN A;  3KHH A;  3UMC A;  9ICI A;  1NK7 A;  2HVI A;  9ICV A;  3C5F A;  4JV2 A;  2J6S A;  3DEE A;  5ALT A;  3WU2 U;  1N56 A;  5KG2 A;  4DSJ A;  1ZXI A;  2OCE A;  3EUB 2;  1OXJ A;  2BDU A;  5CP2 A;  4QZE A;  3SAG A;  4Y2R A;  5KFM A;  1XSP A;  3ZD9 A;  1JRO A;  4CF5 A;  3I28 A;  4QW9 A;  3RRG A;  1N5W A;  1KRP A;  2DKX A;  2FMQ A;  3SR6 A;  2JZB A;  3PV8 A;  2M9N A;  5KFK A;  5G5G A;  2KD1 A;  4PH5 A;  3H7I A;  3NAS A;  3GZF A;  9ICA A;  5KTQ A;  4NLG A;  4I2C A;  3OJS A;  1BPX A;  4O5E A;  3IP4 B;  3TQ1 A;  4Y2S A;  1A76 A;  4PHP A;  4ED0 A;  3GV5 B;  2KJ5 A;  2WAQ F;  2KZZ A;  1N63 A;  2BR0 A;  3RBD A;  5J2D A;  1SV4 A;  2A1J B;  2YB1 A;  5TZV A;  3PW7 A;  1V9P A;  3TAQ A;  2W55 A;  3IN5 A;  5BPC A;  5KG7 A;  2Y9T A;  5AKZ A;  1WYG A;  5ALL A;  2ZTE A;  3G6Y A;  1WWU A;  4DEZ A;  3D2Q A;  3F5A A;  2VJ5 A;  4KMU A;  1SL0 A;  5JUM A;  2KP7 A;  4DF4 A;  1U45 A;  4UB3 A;  4BJQ A;  3ICX A;  2K8B B;  2VA8 A;  2DKZ A;  1ZQI A;  2ZXH A;  4DFM A;  2H3V A;  4UAZ A;  1T3N A;  1NJX A;  3A0H U;  1DOQ A;  2E3T A;  4GIB A;  2NRT A;  4KLJ A;  5AK6 A;  4EZ6 A;  5BOL A;  2G09 A;  1RG6 A;  5J2J A;  2NRZ A;  4B9T A;  4J9R A;  3RJG A;  1PK1 B;  3AU2 A;  3FC4 A;  5AKG A; 
#chains in the Genus database with same CATH homology
 2QAR B;  2ES6 A;  2DKX A;  1JI7 A;  2EAO A;  2F8K A;  1B0X A;  5F3X B;  2JV3 A;  1UQV A;  1X9X A;  2E8P A;  2K60 A;  2QB1 A;  1SV0 A;  1PK3 A;  2F44 A;  3BQ7 A;  1X40 A;  2YTU A;  3SEI A;  2KE7 A;  2FE9 A;  2KMD A;  1WWV A;  3IDW A;  2QB0 B;  2KG5 A;  4IS7 A;  3TAC B;  1OW5 A;  2LPE A;  1V38 A;  5JU5 A;  1COK A;  1SXD A;  1KW4 A;  4PZO A;  5JTI A;  1SV4 A;  4NJ8 A;  3TAD A;  1SV0 C;  2Y9T A;  1SXE A;  3KKA A;  2F3N A;  2KIV A;  2QKQ A;  2D8C A;  2L5Y A;  1F0M A;  5KNI A;  5J8Y A;  3HIL A;  4NL9 A;  5J8Y C;  3BS5 A;  2GLE A;  1B4F A;  1WWU A;  2D3D A;  2E8O A;  1Z1V A;  2ESE A;  2EAN A;  4RQM A;  1LKY A;  1UCV A;  2KSO A;  3BS7 A;  4RQN A;  3TAD C;  4MHV A;  2B6G A;  2DKZ A;  1PK1 A;  1DXS A;  1SGG A;  3KKA C;  3BS5 B;  2QAR A;  2LMR A;  3SEN A;  2DL0 A;  4NL9 C;  2E8N A;  2Y9U A;  2K4P A;  1X66 A;  5L1M A;  2E8M A;  4PZN A;  1OXJ A;  1LKY B;  1V85 A;  2KSO B;  3H8M A;  3K1R B;  5JRT A;  1RG6 A;  2EAP A;  1PK1 B;  2QB0 A;  2EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...