2QARA

Structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
ASIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQRPGGGGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
total genus 19
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qarA00
3KKAC 2YTUA 2E8MA 2D8CA 2B6GA 2EAMA 2KSOA 2LPEA 4NL9A 2QARB 2E8PA 1OW5A 3H8MA 1JI7A 2EAPA 2L5YA 2KE7A 2Y9UA 1B4FA 1KW4A 1X40A 2E8OA 4RQMA 5L1MA 4NL9C 2ESEA 3SEIA 1OXJA 1SXEA 1SV0A 2QB1A 5J8YC 2KSOB 1PK3A 2KG5A 2F8KA 2E8NA 1PK1B 2KMDA 1V85A 3HILA 4NJ8A 2QB0A 1V38A 1LKYA 2F44A 4MHVA 3KKAA 4IS7A 2JV3A 3TADC 2FE9A 1SGGA 3TACB 2KIVA 5J8YA 1SV4A 3BS5A 1PK1A 1B0XA 2Y9TA 5JTIA 2DKXA 3BQ7A 2ES6A 3K1RB 1SXDA 2K4PA 1RG6A 4RQNA 5JRTA 2DKZA 1SV0C 4PZNA 1LKYB 1UCVA 4PZOA 3BS7A 3SENA 2QB0B 2EAOA 3IDWA 2DL0A 1Z1VA 5F3XB 2LMRA 1WWVA 2EANA 1X9XA 3TADA 1DXSA 2F3NA 2GLEA 1WWUA 2QKQA 1F0MA 5KNIA 1X66A 1UQVA 3BS5B 1COKA 2QARA 2D3DA 2K60A 5JU5A
chains in the Genus database with same CATH superfamily
1HUOA 4DL5A 1L3VA 1RQNA 2D8CA 3T79A 4P0QA 4B9MA 4BJQA 5KFGA 3WK8A 1RYSA 1FEZA 2QARB 4F92B 1T3NA 2ASLA 5ALMA 4DSJA 1IIPA 2L5YA 4FZLA 3UXOA 2K89A 5AKYA 4DOAA 5KFPA 1NJWA 2DBYA 1X9WA 1MSWD 5IIIA 4YXJA 3C2MA 3BQ0A 4Z6FA 5E79U 2HVIA 5HHIA 2QLTA 2F1HA 5FP0A 3HW8A 3Q8RB 4KTQA 4NLKA 4YG2A 5ALFA 1NKEA 2MAXA 4CE6A 4NJ8A 3JPTA 3RJEA 2JH7A 1U47A 4YR2A 1ZQCA 4WJ3B 3TFRA 3R9KA 3TACB 1PUZA 5TZVA 4KLQA 3BZCA 3RH4A 1A77A 2K4HA 4O3QA 2ZTEA 2FPKA 1SKWA 1LVHA 3HT3A 3PW2A 1ZQRA 5KG7A 4QWBA 3M8RA 3RRHA 1N5WA 2W9CB 4GXIA 3EW9A 3SV3A 4FZNA 3Q8MA 1N56A 1Z00A 1V97A 1MQ3A 4MEYA 4ED7A 8ICHA 2H5XA 2ZTCA 4DO9A 5KFZA 4BXOB 3N97B 5EE9A 5ALVA 1QQ7A 9ICIA 2ZUCA 2KKPA 2JEJA 2FJ6A 5ALIA 2K60A 3QE9Y 5AM5A 1D9FA 1Z1BA 5KFJA 5D46A 4DL4A 3WKBA 5ALUA 3D2QA 3UXPA 7ICOA 2XIDA 3SQIA 3RJHA 2HSZA 4DFMA 2NRVA 3C2LA 2KZ3A 4ECZA 2G07A 1RM6C 1D8LA 3AUOA 1KQQA 5KFLA 5ALQA 8ICYA 4F93B 1ZD3A 2RLTA 2XCPA 4UASA 9ICAA 2G0AA 4ACOA 2XCAA 2IOHA 4KLDA 4RQ2A 1QH9A 4I2CA 2VJ4A 3LK9A 1J2MA 2H3QA 4Y2VA 4I27A 2YN4A 2KP7A 4IS7A 9ICVA 1TAUA 5ALLA 1K5OA 4TURA 3AL0B 4P0PB 1ZQJA 3F2DA 4PHDA 9ICJA 4DSIA 5AK6A 3QU7A 3SENA 4MEXA 2W54A 7ICQA 4RQ6A 4KLUA 4PHPA 1D8BA 3QU5A 4B9SA 3UQ2A 4DL6A 3MFIA 2LYHA 3GIKA 4J9PA 2JEGA 5ALRA 8ICRA 1RPLA 2AQ0A 3BQTA 3RBDA 3GIJA 3G6VA 1BPXA 2VA3A 3JPPA 5DB8A 3M9MB 4DFDA 1QSYA 5IIJA 1Q3UA 3WU2U 2ZIVB 1UHUA 1Q46A 1OW5A 3FAHA 1ZQIA 8ICTA 2W11A 1TK5A 1N5XA 3PO5A 4UAUA 3ZI4A 5DBCA 2Y9UA 5KFUA 2BDPA 2KHQA 5DB9A 2MUTA 2IOFK 5DBAA 1BVSA 3PSPA 4OD0A 1KTQA 2ESEA 4EZ9A 5AKXA 3BQ2A 3TQ1A 5KFFA 2WF5A 1TE2A 4F4XA 8ICIA 5J2CA 4Q8EA 8ICLA 2KZMA 2MA1A 2P6UA 9ICWA 2Q4TA 2JZBA 3H8WA 1ECWA 3QU9A 4NM1A 5KL8B 3Q8KA 2JR5A 3KHGA 1DGJA 4O3RA 2R18A 4ED6A 1N48A 2IBKA 1TAMA 2PI5A 4G3IA 2K4PA 1JX4A 3H4BA 3F53A 4P4PA 4MFCA 3NVWA 1NNLA 1J97A 2KICA 4CF4A 3PX0A 3UQ0A 2LYAA 2FLLA 3IDWA 4O3OA 1SKSA 1UT5A 1X2IA 3NVYA 4C4SA 5AK3A 5F3XB 1WWVA 2AU0A 3GFKB 5KG3A 3CYMA 9ICPA 5KAFU 4RPYA 4F8RA 4NWIA 2D3DA 3KZIU 5KFHA 4TQSA 1BPBA 4M0AA 4YFKA 2KFNA 2VKQA 2MUTB 1ZJMA 3PW5A 3T5JA 3RB3A 2BDUA 5HMLA 5JUMA 3ZDBA 5EWGA 3LVVA 4ED8A 3ICXA 1XO0A 4UAYA 1MA7A 4GLXA 1COOA 1B4FA 4PGXA 4KLSA 5KT7A 4EX7A 2RQ5A 2W7OA 5KFEA 4DQIA 4HAIA 4DQPA 1ZYQA 2PXIA 5KFQA 1XC9A 1LV5A 4CDGA 4R64A 4DS5A 2BHNA 2OXOA 4ECRA 4UB3A 3H40A 4ICAA 1U9LA 2YB4A 1ZQMA 3AEVA 2W55A 2BPCA 3H0RB 1D9DA 4R66A 1J2NA 2RDJA 2UVVA 3QU4A 2JH1A 2J6TA 1L7OA 3NVVA 5CJ7A 3SD7A 4NLBA 1IM4A 4RNNA 1SXDA 4PPXA 3PR4A 2DKZA 3E2EA 4F5NA 1S97A 1C20A 3KHHA 1K1SA 3ETRA 2WF7A 2QB0B 1Q8KA 1U45A 2XI9A 3AU2A 3PR5B 1X6IA 3TAQA 4J9KA 3QEAZ 2Z7JA 5KFMA 4USAA 4O3SA 2EANA 1X9XA 2IOFA 2DUYA 4P0QB 1UQVA 2DF4B 4RQ4A 2PMZC 3QUQA 2ZTDA 3RB0A 2W43A 2XY5A 5KG6A 2JGAA 4NXZA 2CN1A 4US9A 5DQGA 2VA8A 4NL9A 4M6WA 3UMCA 2HDOA 2W8LA 4ECYA 1T94A 1NK6A 3PY8A 4M9HA 5KFWA 1YZ6A 4PGQA 1ZQOA 2ZUDA 5AKLA 1KW4A 4F5RA 4GC7A 2DGZA 1ZOLA 7ICKA 3F2BA 2GH1A 4ECXA 5EE0A 1SV0A 3PW4A 1VDVA 1ZETA 1UPHA 2W7PA 4J9MA 2RRDA 5KG0A 5J0TA 5KT4A 3HILA 5AM4A 1LKYA 3K75D 5ALXA 4ECQA 2WF9A 5KAIU 1FIQA 4QZ9A 3MBYA 2Y1JA 3D2NA 4I2AA 4B9TA 3FC4A 1XNSA 3EZ5A 2W9CA 4DLEA 4ZH4A 5DDMA 4FS2A 5KG2A 5AI8A 2ZJAA 3OGUA 4RU9A 2PFOA 1RG6A 1S9FA 4FS1A 5EWEA 4PZNA 4FO6A 3RJGA 5L1IA 2XO7A 2HOQA 2UVUA 4IQWA 4RQ5A 5AKJA 1ZQZA 1Z4OA 1ZRMA 4Z6DA 3L3FX 5KFSA 7ICVA 8ICZA 3NVZA 3OJSA 2NRXA 4QZ8A 1KL9A 3JPSA 9ICFA 2K8BB 1L8LA 5ALEA 4UAVA 3EYZA 1ZXIA 3WKAA 1HJPA 3MGHA 1N2XA 1N61A 4DFPA 2W9BA 3JPRA 1DRGA 8ICGA 3IN5A 4KLIA 1HUZA 4MF2A 5DG8A 3RJKA 5J29A 5AIBA 1U49A 9ICKA 1L7MA 9ICGA 1JMSA 2BKEA 3RBEA 5IIMA 4US8A 2PFNA 2HHVA 2XY7A 3BJYA 5AI5A 1VJ5A 4C4TA 3MGIA 4QWCA 4ECWA 2BPGA 4J9LA 5AK4A 4P4OA 2E8OA 2VANA 2AQ4A 4KN7A 5J8YC 2FI1A 1PK3A 1XU4A 1KN5A 2RDIA 1U48A 1RXWA 2PKEA 4QNLA 2FLPA 2QB0A 4DSLA 5DB6A 2PMZF 4F4YA 3C5GA 3UXNA 9ICMA 2ZXIA 5J0XA 2HHWA 3TAPA 4JWMA 1SIJA 2ZIUA 5J8YA 1NK8A 5JTIA 5HNKA 2XY6A 2KZZA 2ISPA 4FBTA 5J2HA 3RJJA 2NO5A 5JRTA 3GZFA 3HJEA 4XUSA 5CEHA 4FE3A 1UCVA 4QWDA 4Y2UA 4I2IA 8ICOA 4F91B 3GV7B 2OM6A 3QUTA 1XO1A 1DK2A 4KLJA 4M04A 3V72A 1KFDA 1PVRA 2KVSA 1BPEA 5DGBA 2WTFA 3B0XA 2I6XA 8ICKA 1SL0A 3ISDA 2DPJA 5HR7A 4B6JA 1QSLA 5CB1A 7ICNA 1L3TA 1T4GA 4R63A 1RXVA 5ALZA 4QWAA 5KFCA 1JROA 4KLEA 2LPEA 3PMNA 5ALJA 3PX4A 3WKDA 4Y2SA 2WB1C 3Q8PB 2YMLA 5J2DA 2OH2A 4I2HA 1KRPA 2BCVA 3QNMA 5AKEA 2JZBB 4DOBA 3M9OB 3TKAA 1IXRA 2DFLA 4NL9C 5CP2A 1URJA 3VC8A 2MSNA 1NJXA 3RB6A 2K4EA 1S0NA 4CNQA 4MF8A 1NZBA 7ICRA 3N7RC 2AGPA 2F8KA 2ZUBA 1CI4A 5HHHA 1XSNA 2F44A 4EBEA 1X9SA 3AQFA 5AICA 3PO4A 2HOFA 3M6KA 4I2DA 3RJFA 4IR9A 1ZQLA 5J2KA 3GILA 3ZD8A 3B9JA 1KKXA 4YQWA 3BS5A 5IINA 7ICJA 3GIIA 4GIBA 4EYIB 2AGQA 2KJ9A 1SZHA 5IIOA 2OHFA 5KG4A 3HWTA 3QU2A 2ZIVA 1ZQFA 2RP5A 3IG5A 1ZQXA 2OEHA 4ED0A 3C21A 1N60A 4K4GA 1KFSA 2IHMA 2QKQA 1XSLA 5F9NA 4QZHA 1L7PA 3T5KA 2PFPA 1AROP 2QARA 4OJ6A 1S0MA 1WCLA 2ZJ5A 5KFXA 4IQTA 3HPOA 1L8OA 2DPIA 1Z00B 4C0ZA 2FDRA 4RPXA 4C7ZA 2WF6A 2B6GA 3RRGA 3L4PA 2H3FA 4BWJA 1ZD4A 5J2JA 5G5GA 3OJUA 4RT2A 5DBBA 3WK4A 3V7JA 2C2RA 5J0WA 4B9VA 1ZQYA 4R8UB 3NRWA 2V4RA 2P6RA 2W3SA 5KFKA 2G09A 1X40A 2W9BB 1TV9A 4F4WA 4NY8A 2V9WA 3NRZA 3KOOA 5DKWA 1OXJA 4QZFA 2KSOB 5HP4A 4RUAA 3AQEA 3ZDAA 2XC9A 3OTQA 2KMDA 3ORYA 1V85A 4X5VA 3GV5B 3KKAA 5AKZA 2JHDA 2G5IB 3SV4A 3F5EA 2AJQA 1Z3EB 1L7NA 5DDYA 5H2FU 4FZMA 3IP4B 4F4ZA 1ZQPA 4O3PA 5J0OA 2ZIXB 1JRPA 4BXOA 1V9PA 1S76D 4Q8FA 2ISOA 4XA5A 3RB4A 3QX7A 1WCNA 2BCRA 4JK1A 4PJ0U 4YD1A 4NM2A 3PW0A 5AKKA 2B21A 4CGZA 3BZKA 3HP6A 4QIWF 2A1JB 4RZRA 4PL1A 3UMBA 1SL2A 1X42A 4EBCA 5ALNA 4B9UA 4QZAA 2ZIWA 1NKBA 4C8LA 3GIMA 5JU5A 9ICBA 2CXYA 2HHSA 4IR1A 1WG8A 4KLGA 3EWAA 3ETLA 4J9NA 2C2EA 3RAQA 9ICCA 5EE1A 3RH6A 3IG8A 1SKRA 3RH5A 3KD3A 4J9SA 5DLGA 3MDAA 4CF3A 3N28A 1SWWA 4PHAA 2VA2A 4I2GA 4F71A 2JEIA 8ICXA 4I2EA 2YY6A 5HR6A 2R8JA 8ICSA 2EQYA 1TVAA 2HI0A 4F5QA 2JV3A 3AU6A 4DF8A 3KTQA 2VJ5A 4IRDA 2YMMA 2H3VA 4EX6A 4FFDA 1S8OA 3D6JA 4DLGA 7ICLA 2NRWA 3DV9A 4ED3A 1ZQKA 5J0UA 4YP3A 3L5KA 4QZIA 5GTIU 1JN3A 5KFTA 4RQNA 5DLFA 1SV0C 3LVWA 1XS9D 9ICLA 4DEZA 4UB4A 5AKIA 2F8LA 4BDPA 5EWFA 1ZRNA 3TI0A 3OHAA 4I2BA 1Z1VA 3T5HA 3QZ7A 1S5LU 2BZFA 2LMRA 5KFBA 4R65A 3GQCA 5K4LA 3UMGA 2YQEA 4CCHA 1B43A 2IA6A 4EYHB 1H38A 3M9NB 5ALGA 3QUBA 1QLNA 2JMGA 4DCCA 4C7YA 4C8NA 3UM9A 3M6ZA 3HRDD 4ED1A 3SZ2A 4IRCA 2E3TA 5L9XA 5C5JA 3V7LA 2FMSA 3PX6A 2AGOA 2XGPA 1X9MA 4CF5A 2MU2A 4I29A 2KOBA 5KFRA 1ZQNA 1ZQGA 2V4QA 1PVPA 1VLBA 1KLNA 5ALWA 3V6JA 1Y88A 3U26A 4RQMA 4AYBF 2LI6A 2K8AA 4TQRA 2FMQA 4Y2YA 4RUCA 5AI6A 5KFNA 4ECTA 1GO3F 5TISU 2J6UA 4FBUA 3VCBA 2KNJA 3MC1A 2LM4A 2BCUA 4QZGA 9ICHA 1MC8A 5DB7A 3IHQB 4GFJA 3FYHA 1F5SA 2HOIA 4DQSA 2C28A 1Q3VA 4F2RA 2Y0SC 1JXEA 2VIXA 3C28A 2FE9A 2HMXA 2KJ5A 3F5AA 2AHOB 2KJ8A 4MFFA 3PMLA 4YXMA 1TKDA 2W8KA 3H8JA 1TK0A 4NLCA 3ZDEA 2P66A 4PH5A 1IG6A 5CHGA 4OCZA 2KN7A 2R8HA 4C80A 4QW8A 4OJLA 4OJPA 2RHFA 2D6FC 4Y2PA 2HHXA 4UBBA 1JUDA 4GC6A 4XQ8A 2HBKA 1X6JA 1ZQSA 1FO4A 2G06A 5ALOA 5CA7A 3FDSA 4O3MA 4ED2A 3V6KA 2BQRA 2KEYA 3RF9A 1RYRA 1DXSA 1PVQA 5KT5A 4E0DA 5GTHU 2F77X 3NS1A 3E58A 4I2FA 3A0BU 1BNPA 5J2EA 5AIAA 2BCSA 1F44A 4G9BA 4Y2TA 3AM9A 2E8PA 2WAQF 1T3QA 1ZJNA 4LZDA 4EBDA 2F1IA 2EAPA 4Z6EA 2KE7A 2ZJ8A 3DDHA 1SB3C 2MRLA 5B66U 4UB6U 9ICXA 3H8SA 3ZDDA 9ICSA 3ISCA 3ALRA 3C5FA 4Y2QA 4P2HA 3RR8A 2K8CB 4JV0A 9ICTA 2QB1A 1JIHA 4NLNA 4M9NA 2BR0A 9ICQA 2E8NA 4IQUA 4DL7A 1BPYA 1PK1B 4KN4A 2EDUA 4U7CA 2ODGA 3QZ8A 1ZQAA 3OSNA 3HX0A 3KBBA 3GV8B 3G6YA 3LWMA 3JPOA 2KHVA 3TADC 3T5LA 2KIVA 1K1QA 1UT8A 1SV4A 1ZQDA 4DF4A 1NJYA 1B0XA 1ZQVA 1T7PA 2DKXA 4O5KA 4DQRA 4RQ7A 4MFAA 2I9GA 3RFAA 7ICFA 1CUKA 4Y2JA 5J0YA 4KLFA 4PZOA 3LDAA 4J9OA 2EAOA 5ALHA 4IL6U 2F2AB 4K4HA 2UVRA 1RQLA 1MN8A 2NV3A 4R8UA 2LM1A 4Y2RA 5B5EU 5DQIA 2I1QA 2WHEA 4QZDA 2E5SA 2YB1A 3OHBA 2YTUA 1YZ7A 3CP8A 1XSPA 3EPGA 4QZEA 4PL2A 1SL1A 4O9MA 4ELUA 2OYYA 4F72A 1TFRA 5KL1B 4M9GA 3I1YA 2DWQA 3MR3A 2EH9A 4OJ5A 4RNMA 5KT6A 4DSFA 4EELA 5AI4A 4DFJA 4PHEA 5J0PA 4C8MA 8ICPA 1ZQ1C 9ICOA 1B22A 3QYPA 7ICSA 5ALTA 2HBMA 3KHLA 4UB1A 1ZQBA 1SZPA 3ISBA 2N1RA 5ALSA 9ICUA 2NO4A 2KG5A 3PW7A 1L5UA 4ECSA 8ICEA 2FPMA 1NK9A 1BNOA 1WUDA 4NLGA 1V38A 2NRZA 2ALZA 2C22A 2KD1A 5L1KA 1SGGA 3SR6A 3WK9A 4DSEA 3CRXA 5EE3A 3WK6A 4ZOHC 3SMVA 1L6NA 3K1RB 4C4RA 1RZTA 2KV2A 3E0FA 1UA0A 3TANA 4BWMA 2F1JA 3T3FA 5J2IA 2WAQC 2PFQA 4A8EA 5KT3A 1S0OA 3J81j 4M9LA 2W9AA 5F9LA 7ICHA 9ICRA 2LKYA 4HYKA 8ICMA 9ICEA 2PI4A 3O0FA 5CR0A 2GO7A 4YMOA 2CPRA 3IM1A 2M9NA 4M2YA 7ICEA 7ICPA 3BS5B 1COKA 5IILA 1DK3A 1NZPA 2B0CA 3PSTA 1KEJA 5ALDA 3ZD9A 3PZPA 3D2SA 3C2KA 2A3VA 2AXTU 4KMOB 3KHRA 1O08A 3N7SC 2Q0ZX 4M9JA 3WKEA 3MR6A 2M0NA 4I2JA 2LHTA 1JI7A 1LB2B 5J0SA 5AKGA 3NTUA 4ELVA 3FM9A 5BOMA 4M47A 5L1MA 3ZDCA 5AKHA 4DSKA 5AM0A 7ICIA 3SEIA 5D49A 1SXEA 4NLZA 2EZXA 2YMPA 1N63A 4DWIA 1HIWA 3Q8SB 2W03A 2JXJA 4EEYA 1A6SA 4KX3A 1MQ2A 1DOQA 4RNOA 2JRZA 1KBUA 3UPQA 4QWEA 1IV8A 3S6JA 4KLLA 3NASA 2AH5A 4RQ3A 5IIKA 5KT2A 5CRXA 2ATLA 2KIWA 3JPNA 3H7IA 5A0LA 5ALPA 5AI9A 4YN4A 1NK4A 5J2GA 4RQ1A 4TUQA 3LYSA 3KFUF 4NV0A 2ASJA 3ED5A 2KVCA 5AM3A 5DQHA 5AHXA 4Y2XA 3HKZF 1JALA 1NK7A 2XGQA 3KZXA 4BX9C 2LBOA 3A0HU 4J03A 3C1ZA 2DL0A 4J9QA 3RR7A 4Q43A 1HEKA 3I76A 2FPLA 3CNHA 8ICBA 1L3UA 2CRXA 4EZ6A 5KNIA 1X66A 2G5HB 4O5EA 3SAFA 5KFIA 4KLHA 4AYBC 1U4BA 3IV6A 3ONNA 3AMZA 4U6PA 3PVXA 3SAHA 4YMMA 3HKZC 5J0RA 4RPZA 4F4KA 2IMWP 4UAWA 3GU3A 2JEFA 3OSPA 2FLNA 4F5PA 4GXJA 2ZIWB 1C7YA 1CRXA 3Q8LA 4UB8U 2NYVA 4CRXA 5BPCA 2C2DA 5CWRA 5DGAA 4AP9A 4YR0A 4P4MA 4J9RA 1S77D 2KK0A 2XICA 4IC9A 5L1LA 1XWLA 3DEEA 5KG5A 2ASDA 2HCFA 2HBJA 4YVZA 2HVHA 4IRKA 8ICFA 3G6XA 1ZQHA 1RDFA 4MHVA 2I5HA 2W9MA 4YD2A 8ICCA 2KFZA 1QQ5A 2EZZA 5AM1A 2K4IA 4Z6CA 4UB5A 2BQ3A 4KLOA 1LKYB 3B0YA 3BS7A 3NUQA 1FFUA 4OJOA 3SYZA 2P35A 4Q45A 1CEZA 1QSSA 4K4IA 2KTQA 2J6SA 4DOCA 4EEKA 3F2CA 5J2FA 2YMQA 4M6WB 3MDCA 3IRUA 2F3NA 4C8OA 5ALKA 1S0VA 4F5OA 4O5CA 9ICNA 2GWSA 1A0PA 3V7KA 3WK5A 4RQ0A 2W04A 2WF8A 3K1ZA 2Y1IA 4YCXA 1PZNA 2ZXHA 4F50A 4JB3A 3KKAC 3MR2A 2H3IA 4UARA 4YMNA 3MR5A 2EAMA 1SWVA 2KSOA 4BUGA 1ZD5A 2YX8A 4UQGA 4QW9A 4UATA 4TUSA 1ZQQA 4KLTA 3H8MA 1TAQA 3TARA 3C1YA 2O6KA 5AK5A 4JMUA 2HHUA 1S10A 1EXNA 2R8KA 2HHTA 1QCKA 1D8YA 5EOZA 4KITB 2GOLA 4LJXA 5KTQA 2IHNA 3BQ1A 2W3RA 4TUPA 3CW2C 1WYGA 5KFAA 4UW9A 3H4DA 3C23A 3PNCA 3M8SA 4DL3A 1TK8A 5AM2A 2HHQA 4JWNA 2ZIXA 4QZCA 2Y0SF 4P0PA 4I28A 1ZQTA 4EENA 8ICVA 1UA1A 4B9NA 1NJZA 7ICUA 3RJIA 1NK0A 3RAXA 1KSPA 2Y9TA 8ICUA 5ALYA 1ZQWA 3H0MB 8ICAA 1ED1A 5KFDA 2R8IA 4BGDA 4DS4A 3C29A 2BQUA 1JXLA 3MGVA 5J2AA 4RQ8A 2F76X 8ICQA 2ZIUB 5T14A 4XRHA 2R8GA 3BDPA 1N62A 1NI3A 4LVSA 1OUQA 4UBCA 8ICJA 4B9LA 4PGYA 2A1AA 3K4GA 1FFVA 2WFAA 3MFHA 4YR3A 4F2SA 8ICWA 5J0QA 3TADA 2GLEA 1DGSA 1BGXT 5KFOA 4JV1A 1ZD2P 3AN1A 1BPDA 3EUB2 1BPZA 2G08A 1YT3A 3M7DA 1KFTA 2E8MA 3WK7A 4KLMA 1A76A 4GXKA 2OCEA 5DG7A 5C0YA 1AQ6A 4UAZA 4RT3A 3GDXA 3THVA 3EPIA 4O3NA 3RTVA 4C8KA 3N4MB 5HMMA 2LYBA 1NKCA 5G5HA 4DFKA 1NOMA 3QXGA 5AI0A 1RYUA 4OO1J 1QQ6A 1ZQEA 4JV2A 3M1YA 1T8EA 3WKCA 2E1EA 2HBLA 5BOLA 3PSIA 5DG9A 3MABA 7ICGA 1O03A 2UVWA 3H0LB 1NK5A 4F3OA 4DQQA 5L1JA 1QTMA 2DQNB 2A1JA 4KMUA 1Z4NA 4QIWC 4Q44A 4DL2A 3NGDA 2NRTA 3PV8A 4LZGA 1PK1A 3QUCA 3BQ7A 2ES6A 4ELTA 7ICMA 3N7PD 3Q8QB 2EZYA 5KFYA 2H3ZA 2WB1F 2XVTA 2A19A 2HW3A 5D4BA 3V6HA 5KFVA 5J2BA 4ECVA 2BPFA 3SI8A 3I28A 2BGWA 1L3SA 4O0IA 1ZQUA 3PSFA 5KG1A 3JPQA 2BCQA 2ZG6A 4IQVA 3SAGA 1WWUA 1F0MA 2KKVA 3TFSA 4QJFB 4UB2A 4KX5A 2FMPA 8ICNA 1Z19A 2OWOA 4QZBA 3OPXA 4JUZA 7ICTA 1P7DA 3QEBZ 4ECUA 3LWLA 2E1FA 1KDHA 1M6YA
chains in the Genus database with same CATH topology
3KKAC 2YTUA 2E8MA 2D8CA 2B6GA 2EAMA 2KSOA 2LPEA 4NL9A 2QARB 2E8PA 1OW5A 3H8MA 1JI7A 2EAPA 2L5YA 2KE7A 2Y9UA 1B4FA 1KW4A 1X40A 2E8OA 4RQMA 5L1MA 4NL9C 2ESEA 3SEIA 1OXJA 1SXEA 1SV0A 2QB1A 5J8YC 2KSOB 1PK3A 2KG5A 2F8KA 2E8NA 1PK1B 2KMDA 1V85A 3HILA 4NJ8A 2QB0A 1V38A 1LKYA 2F44A 4MHVA 3KKAA 4IS7A 2JV3A 3TADC 2FE9A 1SGGA 3TACB 2KIVA 5J8YA 1SV4A 3BS5A 1PK1A 1B0XA 2Y9TA 5JTIA 2DKXA 3BQ7A 2ES6A 3K1RB 1SXDA 2K4PA 1RG6A 4RQNA 5JRTA 2DKZA 1SV0C 4PZNA 1LKYB 1UCVA 4PZOA 3BS7A 3SENA 2QB0B 2EAOA 3IDWA 2DL0A 1Z1VA 5F3XB 2LMRA 1WWVA 2EANA 1X9XA 3TADA 1DXSA 2F3NA 2GLEA 1WWUA 2QKQA 1F0MA 5KNIA 1X66A 1UQVA 3BS5B 1COKA 2QARA 2D3DA 2K60A 5JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKA C;  2YTU A;  2E8M A;  2D8C A;  2B6G A;  2EAM A;  2KSO A;  2LPE A;  4NL9 A;  2QAR B;  2E8P A;  1OW5 A;  3H8M A;  1JI7 A;  2EAP A;  2L5Y A;  2KE7 A;  2Y9U A;  1B4F A;  1KW4 A;  1X40 A;  2E8O A;  4RQM A;  5L1M A;  4NL9 C;  2ESE A;  3SEI A;  1OXJ A;  1SXE A;  1SV0 A;  2QB1 A;  5J8Y C;  2KSO B;  1PK3 A;  2KG5 A;  2F8K A;  2E8N A;  1PK1 B;  2KMD A;  1V85 A;  3HIL A;  4NJ8 A;  2QB0 A;  1V38 A;  1LKY A;  2F44 A;  4MHV A;  3KKA A;  4IS7 A;  2JV3 A;  3TAD C;  2FE9 A;  1SGG A;  3TAC B;  2KIV A;  5J8Y A;  1SV4 A;  3BS5 A;  1PK1 A;  1B0X A;  2Y9T A;  5JTI A;  2DKX A;  3BQ7 A;  2ES6 A;  3K1R B;  1SXD A;  2K4P A;  1RG6 A;  4RQN A;  5JRT A;  2DKZ A;  1SV0 C;  4PZN A;  1LKY B;  1UCV A;  4PZO A;  3BS7 A;  3SEN A;  2QB0 B;  2EAO A;  3IDW A;  2DL0 A;  1Z1V A;  5F3X B;  2LMR A;  1WWV A;  2EAN A;  1X9X A;  3TAD A;  1DXS A;  2F3N A;  2GLE A;  1WWU A;  2QKQ A;  1F0M A;  5KNI A;  1X66 A;  1UQV A;  3BS5 B;  1COK A;  2QAR A;  2D3D A;  2K60 A;  5JU5 A; 
#chains in the Genus database with same CATH topology
 1HUO A;  4DL5 A;  1L3V A;  1RQN A;  2D8C A;  3T79 A;  4P0Q A;  4B9M A;  4BJQ A;  5KFG A;  3WK8 A;  1RYS A;  1FEZ A;  2QAR B;  4F92 B;  1T3N A;  2ASL A;  5ALM A;  4DSJ A;  1IIP A;  2L5Y A;  4FZL A;  3UXO A;  2K89 A;  5AKY A;  4DOA A;  5KFP A;  1NJW A;  2DBY A;  1X9W A;  1MSW D;  5III A;  4YXJ A;  3C2M A;  3BQ0 A;  4Z6F A;  5E79 U;  2HVI A;  5HHI A;  2QLT A;  2F1H A;  5FP0 A;  3HW8 A;  3Q8R B;  4KTQ A;  4NLK A;  4YG2 A;  5ALF A;  1NKE A;  2MAX A;  4CE6 A;  4NJ8 A;  3JPT A;  3RJE A;  2JH7 A;  1U47 A;  4YR2 A;  1ZQC A;  4WJ3 B;  3TFR A;  3R9K A;  3TAC B;  1PUZ A;  5TZV A;  4KLQ A;  3BZC A;  3RH4 A;  1A77 A;  2K4H A;  4O3Q A;  2ZTE A;  2FPK A;  1SKW A;  1LVH A;  3HT3 A;  3PW2 A;  1ZQR A;  5KG7 A;  4QWB A;  3M8R A;  3RRH A;  1N5W A;  2W9C B;  4GXI A;  3EW9 A;  3SV3 A;  4FZN A;  3Q8M A;  1N56 A;  1Z00 A;  1V97 A;  1MQ3 A;  4MEY A;  4ED7 A;  8ICH A;  2H5X A;  2ZTC A;  4DO9 A;  5KFZ A;  4BXO B;  3N97 B;  5EE9 A;  5ALV A;  1QQ7 A;  9ICI A;  2ZUC A;  2KKP A;  2JEJ A;  2FJ6 A;  5ALI A;  2K60 A;  3QE9 Y;  5AM5 A;  1D9F A;  1Z1B A;  5KFJ A;  5D46 A;  4DL4 A;  3WKB A;  5ALU A;  3D2Q A;  3UXP A;  7ICO A;  2XID A;  3SQI A;  3RJH A;  2HSZ A;  4DFM A;  2NRV A;  3C2L A;  2KZ3 A;  4ECZ A;  2G07 A;  1RM6 C;  1D8L A;  3AUO A;  1KQQ A;  5KFL A;  5ALQ A;  8ICY A;  4F93 B;  1ZD3 A;  2RLT A;  2XCP A;  4UAS A;  9ICA A;  2G0A A;  4ACO A;  2XCA A;  2IOH A;  4KLD A;  4RQ2 A;  1QH9 A;  4I2C A;  2VJ4 A;  3LK9 A;  1J2M A;  2H3Q A;  4Y2V A;  4I27 A;  2YN4 A;  2KP7 A;  4IS7 A;  9ICV A;  1TAU A;  5ALL A;  1K5O A;  4TUR A;  3AL0 B;  4P0P B;  1ZQJ A;  3F2D A;  4PHD A;  9ICJ A;  4DSI A;  5AK6 A;  3QU7 A;  3SEN A;  4MEX A;  2W54 A;  7ICQ A;  4RQ6 A;  4KLU A;  4PHP A;  1D8B A;  3QU5 A;  4B9S A;  3UQ2 A;  4DL6 A;  3MFI A;  2LYH A;  3GIK A;  4J9P A;  2JEG A;  5ALR A;  8ICR A;  1RPL A;  2AQ0 A;  3BQT A;  3RBD A;  3GIJ A;  3G6V A;  1BPX A;  2VA3 A;  3JPP A;  5DB8 A;  3M9M B;  4DFD A;  1QSY A;  5IIJ A;  1Q3U A;  3WU2 U;  2ZIV B;  1UHU A;  1Q46 A;  1OW5 A;  3FAH A;  1ZQI A;  8ICT A;  2W11 A;  1TK5 A;  1N5X A;  3PO5 A;  4UAU A;  3ZI4 A;  5DBC A;  2Y9U A;  5KFU A;  2BDP A;  2KHQ A;  5DB9 A;  2MUT A;  2IOF K;  5DBA A;  1BVS A;  3PSP A;  4OD0 A;  1KTQ A;  2ESE A;  4EZ9 A;  5AKX A;  3BQ2 A;  3TQ1 A;  5KFF A;  2WF5 A;  1TE2 A;  4F4X A;  8ICI A;  5J2C A;  4Q8E A;  8ICL A;  2KZM A;  2MA1 A;  2P6U A;  9ICW A;  2Q4T A;  2JZB A;  3H8W A;  1ECW A;  3QU9 A;  4NM1 A;  5KL8 B;  3Q8K A;  2JR5 A;  3KHG A;  1DGJ A;  4O3R A;  2R18 A;  4ED6 A;  1N48 A;  2IBK A;  1TAM A;  2PI5 A;  4G3I A;  2K4P A;  1JX4 A;  3H4B A;  3F53 A;  4P4P A;  4MFC A;  3NVW A;  1NNL A;  1J97 A;  2KIC A;  4CF4 A;  3PX0 A;  3UQ0 A;  2LYA A;  2FLL A;  3IDW A;  4O3O A;  1SKS A;  1UT5 A;  1X2I A;  3NVY A;  4C4S A;  5AK3 A;  5F3X B;  1WWV A;  2AU0 A;  3GFK B;  5KG3 A;  3CYM A;  9ICP A;  5KAF U;  4RPY A;  4F8R A;  4NWI A;  2D3D A;  3KZI U;  5KFH A;  4TQS A;  1BPB A;  4M0A A;  4YFK A;  2KFN A;  2VKQ A;  2MUT B;  1ZJM A;  3PW5 A;  3T5J A;  3RB3 A;  2BDU A;  5HML A;  5JUM A;  3ZDB A;  5EWG A;  3LVV A;  4ED8 A;  3ICX A;  1XO0 A;  4UAY A;  1MA7 A;  4GLX A;  1COO A;  1B4F A;  4PGX A;  4KLS A;  5KT7 A;  4EX7 A;  2RQ5 A;  2W7O A;  5KFE A;  4DQI A;  4HAI A;  4DQP A;  1ZYQ A;  2PXI A;  5KFQ A;  1XC9 A;  1LV5 A;  4CDG A;  4R64 A;  4DS5 A;  2BHN A;  2OXO A;  4ECR A;  4UB3 A;  3H40 A;  4ICA A;  1U9L A;  2YB4 A;  1ZQM A;  3AEV A;  2W55 A;  2BPC A;  3H0R B;  1D9D A;  4R66 A;  1J2N A;  2RDJ A;  2UVV A;  3QU4 A;  2JH1 A;  2J6T A;  1L7O A;  3NVV A;  5CJ7 A;  3SD7 A;  4NLB A;  1IM4 A;  4RNN A;  1SXD A;  4PPX A;  3PR4 A;  2DKZ A;  3E2E A;  4F5N A;  1S97 A;  1C20 A;  3KHH A;  1K1S A;  3ETR A;  2WF7 A;  2QB0 B;  1Q8K A;  1U45 A;  2XI9 A;  3AU2 A;  3PR5 B;  1X6I A;  3TAQ A;  4J9K A;  3QEA Z;  2Z7J A;  5KFM A;  4USA A;  4O3S A;  2EAN A;  1X9X A;  2IOF A;  2DUY A;  4P0Q B;  1UQV A;  2DF4 B;  4RQ4 A;  2PMZ C;  3QUQ A;  2ZTD A;  3RB0 A;  2W43 A;  2XY5 A;  5KG6 A;  2JGA A;  4NXZ A;  2CN1 A;  4US9 A;  5DQG A;  2VA8 A;  4NL9 A;  4M6W A;  3UMC A;  2HDO A;  2W8L A;  4ECY A;  1T94 A;  1NK6 A;  3PY8 A;  4M9H A;  5KFW A;  1YZ6 A;  4PGQ A;  1ZQO A;  2ZUD A;  5AKL A;  1KW4 A;  4F5R A;  4GC7 A;  2DGZ A;  1ZOL A;  7ICK A;  3F2B A;  2GH1 A;  4ECX A;  5EE0 A;  1SV0 A;  3PW4 A;  1VDV A;  1ZET A;  1UPH A;  2W7P A;  4J9M A;  2RRD A;  5KG0 A;  5J0T A;  5KT4 A;  3HIL A;  5AM4 A;  1LKY A;  3K75 D;  5ALX A;  4ECQ A;  2WF9 A;  5KAI U;  1FIQ A;  4QZ9 A;  3MBY A;  2Y1J A;  3D2N A;  4I2A A;  4B9T A;  3FC4 A;  1XNS A;  3EZ5 A;  2W9C A;  4DLE A;  4ZH4 A;  5DDM A;  4FS2 A;  5KG2 A;  5AI8 A;  2ZJA A;  3OGU A;  4RU9 A;  2PFO A;  1RG6 A;  1S9F A;  4FS1 A;  5EWE A;  4PZN A;  4FO6 A;  3RJG A;  5L1I A;  2XO7 A;  2HOQ A;  2UVU A;  4IQW A;  4RQ5 A;  5AKJ A;  1ZQZ A;  1Z4O A;  1ZRM A;  4Z6D A;  3L3F X;  5KFS A;  7ICV A;  8ICZ A;  3NVZ A;  3OJS A;  2NRX A;  4QZ8 A;  1KL9 A;  3JPS A;  9ICF A;  2K8B B;  1L8L A;  5ALE A;  4UAV A;  3EYZ A;  1ZXI A;  3WKA A;  1HJP A;  3MGH A;  1N2X A;  1N61 A;  4DFP A;  2W9B A;  3JPR A;  1DRG A;  8ICG A;  3IN5 A;  4KLI A;  1HUZ A;  4MF2 A;  5DG8 A;  3RJK A;  5J29 A;  5AIB A;  1U49 A;  9ICK A;  1L7M A;  9ICG A;  1JMS A;  2BKE A;  3RBE A;  5IIM A;  4US8 A;  2PFN A;  2HHV A;  2XY7 A;  3BJY A;  5AI5 A;  1VJ5 A;  4C4T A;  3MGI A;  4QWC A;  4ECW A;  2BPG A;  4J9L A;  5AK4 A;  4P4O A;  2E8O A;  2VAN A;  2AQ4 A;  4KN7 A;  5J8Y C;  2FI1 A;  1PK3 A;  1XU4 A;  1KN5 A;  2RDI A;  1U48 A;  1RXW A;  2PKE A;  4QNL A;  2FLP A;  2QB0 A;  4DSL A;  5DB6 A;  2PMZ F;  4F4Y A;  3C5G A;  3UXN A;  9ICM A;  2ZXI A;  5J0X A;  2HHW A;  3TAP A;  4JWM A;  1SIJ A;  2ZIU A;  5J8Y A;  1NK8 A;  5JTI A;  5HNK A;  2XY6 A;  2KZZ A;  2ISP A;  4FBT A;  5J2H A;  3RJJ A;  2NO5 A;  5JRT A;  3GZF A;  3HJE A;  4XUS A;  5CEH A;  4FE3 A;  1UCV A;  4QWD A;  4Y2U A;  4I2I A;  8ICO A;  4F91 B;  3GV7 B;  2OM6 A;  3QUT A;  1XO1 A;  1DK2 A;  4KLJ A;  4M04 A;  3V72 A;  1KFD A;  1PVR A;  2KVS A;  1BPE A;  5DGB A;  2WTF A;  3B0X A;  2I6X A;  8ICK A;  1SL0 A;  3ISD A;  2DPJ A;  5HR7 A;  4B6J A;  1QSL A;  5CB1 A;  7ICN A;  1L3T A;  1T4G A;  4R63 A;  1RXV A;  5ALZ A;  4QWA A;  5KFC A;  1JRO A;  4KLE A;  2LPE A;  3PMN A;  5ALJ A;  3PX4 A;  3WKD A;  4Y2S A;  2WB1 C;  3Q8P B;  2YML A;  5J2D A;  2OH2 A;  4I2H A;  1KRP A;  2BCV A;  3QNM A;  5AKE A;  2JZB B;  4DOB A;  3M9O B;  3TKA A;  1IXR A;  2DFL A;  4NL9 C;  5CP2 A;  1URJ A;  3VC8 A;  2MSN A;  1NJX A;  3RB6 A;  2K4E A;  1S0N A;  4CNQ A;  4MF8 A;  1NZB A;  7ICR A;  3N7R C;  2AGP A;  2F8K A;  2ZUB A;  1CI4 A;  5HHH A;  1XSN A;  2F44 A;  4EBE A;  1X9S A;  3AQF A;  5AIC A;  3PO4 A;  2HOF A;  3M6K A;  4I2D A;  3RJF A;  4IR9 A;  1ZQL A;  5J2K A;  3GIL A;  3ZD8 A;  3B9J A;  1KKX A;  4YQW A;  3BS5 A;  5IIN A;  7ICJ A;  3GII A;  4GIB A;  4EYI B;  2AGQ A;  2KJ9 A;  1SZH A;  5IIO A;  2OHF A;  5KG4 A;  3HWT A;  3QU2 A;  2ZIV A;  1ZQF A;  2RP5 A;  3IG5 A;  1ZQX A;  2OEH A;  4ED0 A;  3C21 A;  1N60 A;  4K4G A;  1KFS A;  2IHM A;  2QKQ A;  1XSL A;  5F9N A;  4QZH A;  1L7P A;  3T5K A;  2PFP A;  1ARO P;  2QAR A;  4OJ6 A;  1S0M A;  1WCL A;  2ZJ5 A;  5KFX A;  4IQT A;  3HPO A;  1L8O A;  2DPI A;  1Z00 B;  4C0Z A;  2FDR A;  4RPX A;  4C7Z A;  2WF6 A;  2B6G A;  3RRG A;  3L4P A;  2H3F A;  4BWJ A;  1ZD4 A;  5J2J A;  5G5G A;  3OJU A;  4RT2 A;  5DBB A;  3WK4 A;  3V7J A;  2C2R A;  5J0W A;  4B9V A;  1ZQY A;  4R8U B;  3NRW A;  2V4R A;  2P6R A;  2W3S A;  5KFK A;  2G09 A;  1X40 A;  2W9B B;  1TV9 A;  4F4W A;  4NY8 A;  2V9W A;  3NRZ A;  3KOO A;  5DKW A;  1OXJ A;  4QZF A;  2KSO B;  5HP4 A;  4RUA A;  3AQE A;  3ZDA A;  2XC9 A;  3OTQ A;  2KMD A;  3ORY A;  1V85 A;  4X5V A;  3GV5 B;  3KKA A;  5AKZ A;  2JHD A;  2G5I B;  3SV4 A;  3F5E A;  2AJQ A;  1Z3E B;  1L7N A;  5DDY A;  5H2F U;  4FZM A;  3IP4 B;  4F4Z A;  1ZQP A;  4O3P A;  5J0O A;  2ZIX B;  1JRP A;  4BXO A;  1V9P A;  1S76 D;  4Q8F A;  2ISO A;  4XA5 A;  3RB4 A;  3QX7 A;  1WCN A;  2BCR A;  4JK1 A;  4PJ0 U;  4YD1 A;  4NM2 A;  3PW0 A;  5AKK A;  2B21 A;  4CGZ A;  3BZK A;  3HP6 A;  4QIW F;  2A1J B;  4RZR A;  4PL1 A;  3UMB A;  1SL2 A;  1X42 A;  4EBC A;  5ALN A;  4B9U A;  4QZA A;  2ZIW A;  1NKB A;  4C8L A;  3GIM A;  5JU5 A;  9ICB A;  2CXY A;  2HHS A;  4IR1 A;  1WG8 A;  4KLG A;  3EWA A;  3ETL A;  4J9N A;  2C2E A;  3RAQ A;  9ICC A;  5EE1 A;  3RH6 A;  3IG8 A;  1SKR A;  3RH5 A;  3KD3 A;  4J9S A;  5DLG A;  3MDA A;  4CF3 A;  3N28 A;  1SWW A;  4PHA A;  2VA2 A;  4I2G A;  4F71 A;  2JEI A;  8ICX A;  4I2E A;  2YY6 A;  5HR6 A;  2R8J A;  8ICS A;  2EQY A;  1TVA A;  2HI0 A;  4F5Q A;  2JV3 A;  3AU6 A;  4DF8 A;  3KTQ A;  2VJ5 A;  4IRD A;  2YMM A;  2H3V A;  4EX6 A;  4FFD A;  1S8O A;  3D6J A;  4DLG A;  7ICL A;  2NRW A;  3DV9 A;  4ED3 A;  1ZQK A;  5J0U A;  4YP3 A;  3L5K A;  4QZI A;  5GTI U;  1JN3 A;  5KFT A;  4RQN A;  5DLF A;  1SV0 C;  3LVW A;  1XS9 D;  9ICL A;  4DEZ A;  4UB4 A;  5AKI A;  2F8L A;  4BDP A;  5EWF A;  1ZRN A;  3TI0 A;  3OHA A;  4I2B A;  1Z1V A;  3T5H A;  3QZ7 A;  1S5L U;  2BZF A;  2LMR A;  5KFB A;  4R65 A;  3GQC A;  5K4L A;  3UMG A;  2YQE A;  4CCH A;  1B43 A;  2IA6 A;  4EYH B;  1H38 A;  3M9N B;  5ALG A;  3QUB A;  1QLN A;  2JMG A;  4DCC A;  4C7Y A;  4C8N A;  3UM9 A;  3M6Z A;  3HRD D;  4ED1 A;  3SZ2 A;  4IRC A;  2E3T A;  5L9X A;  5C5J A;  3V7L A;  2FMS A;  3PX6 A;  2AGO A;  2XGP A;  1X9M A;  4CF5 A;  2MU2 A;  4I29 A;  2KOB A;  5KFR A;  1ZQN A;  1ZQG A;  2V4Q A;  1PVP A;  1VLB A;  1KLN A;  5ALW A;  3V6J A;  1Y88 A;  3U26 A;  4RQM A;  4AYB F;  2LI6 A;  2K8A A;  4TQR A;  2FMQ A;  4Y2Y A;  4RUC A;  5AI6 A;  5KFN A;  4ECT A;  1GO3 F;  5TIS U;  2J6U A;  4FBU A;  3VCB A;  2KNJ A;  3MC1 A;  2LM4 A;  2BCU A;  4QZG A;  9ICH A;  1MC8 A;  5DB7 A;  3IHQ B;  4GFJ A;  3FYH A;  1F5S A;  2HOI A;  4DQS A;  2C28 A;  1Q3V A;  4F2R A;  2Y0S C;  1JXE A;  2VIX A;  3C28 A;  2FE9 A;  2HMX A;  2KJ5 A;  3F5A A;  2AHO B;  2KJ8 A;  4MFF A;  3PML A;  4YXM A;  1TKD A;  2W8K A;  3H8J A;  1TK0 A;  4NLC A;  3ZDE A;  2P66 A;  4PH5 A;  1IG6 A;  5CHG A;  4OCZ A;  2KN7 A;  2R8H A;  4C80 A;  4QW8 A;  4OJL A;  4OJP A;  2RHF A;  2D6F C;  4Y2P A;  2HHX A;  4UBB A;  1JUD A;  4GC6 A;  4XQ8 A;  2HBK A;  1X6J A;  1ZQS A;  1FO4 A;  2G06 A;  5ALO A;  5CA7 A;  3FDS A;  4O3M A;  4ED2 A;  3V6K A;  2BQR A;  2KEY A;  3RF9 A;  1RYR A;  1DXS A;  1PVQ A;  5KT5 A;  4E0D A;  5GTH U;  2F77 X;  3NS1 A;  3E58 A;  4I2F A;  3A0B U;  1BNP A;  5J2E A;  5AIA A;  2BCS A;  1F44 A;  4G9B A;  4Y2T A;  3AM9 A;  2E8P A;  2WAQ F;  1T3Q A;  1ZJN A;  4LZD A;  4EBD A;  2F1I A;  2EAP A;  4Z6E A;  2KE7 A;  2ZJ8 A;  3DDH A;  1SB3 C;  2MRL A;  5B66 U;  4UB6 U;  9ICX A;  3H8S A;  3ZDD A;  9ICS A;  3ISC A;  3ALR A;  3C5F A;  4Y2Q A;  4P2H A;  3RR8 A;  2K8C B;  4JV0 A;  9ICT A;  2QB1 A;  1JIH A;  4NLN A;  4M9N A;  2BR0 A;  9ICQ A;  2E8N A;  4IQU A;  4DL7 A;  1BPY A;  1PK1 B;  4KN4 A;  2EDU A;  4U7C A;  2ODG A;  3QZ8 A;  1ZQA A;  3OSN A;  3HX0 A;  3KBB A;  3GV8 B;  3G6Y A;  3LWM A;  3JPO A;  2KHV A;  3TAD C;  3T5L A;  2KIV A;  1K1Q A;  1UT8 A;  1SV4 A;  1ZQD A;  4DF4 A;  1NJY A;  1B0X A;  1ZQV A;  1T7P A;  2DKX A;  4O5K A;  4DQR A;  4RQ7 A;  4MFA A;  2I9G A;  3RFA A;  7ICF A;  1CUK A;  4Y2J A;  5J0Y A;  4KLF A;  4PZO A;  3LDA A;  4J9O A;  2EAO A;  5ALH A;  4IL6 U;  2F2A B;  4K4H A;  2UVR A;  1RQL A;  1MN8 A;  2NV3 A;  4R8U A;  2LM1 A;  4Y2R A;  5B5E U;  5DQI A;  2I1Q A;  2WHE A;  4QZD A;  2E5S A;  2YB1 A;  3OHB A;  2YTU A;  1YZ7 A;  3CP8 A;  1XSP A;  3EPG A;  4QZE A;  4PL2 A;  1SL1 A;  4O9M A;  4ELU A;  2OYY A;  4F72 A;  1TFR A;  5KL1 B;  4M9G A;  3I1Y A;  2DWQ A;  3MR3 A;  2EH9 A;  4OJ5 A;  4RNM A;  5KT6 A;  4DSF A;  4EEL A;  5AI4 A;  4DFJ A;  4PHE A;  5J0P A;  4C8M A;  8ICP A;  1ZQ1 C;  9ICO A;  1B22 A;  3QYP A;  7ICS A;  5ALT A;  2HBM A;  3KHL A;  4UB1 A;  1ZQB A;  1SZP A;  3ISB A;  2N1R A;  5ALS A;  9ICU A;  2NO4 A;  2KG5 A;  3PW7 A;  1L5U A;  4ECS A;  8ICE A;  2FPM A;  1NK9 A;  1BNO A;  1WUD A;  4NLG A;  1V38 A;  2NRZ A;  2ALZ A;  2C22 A;  2KD1 A;  5L1K A;  1SGG A;  3SR6 A;  3WK9 A;  4DSE A;  3CRX A;  5EE3 A;  3WK6 A;  4ZOH C;  3SMV A;  1L6N A;  3K1R B;  4C4R A;  1RZT A;  2KV2 A;  3E0F A;  1UA0 A;  3TAN A;  4BWM A;  2F1J A;  3T3F A;  5J2I A;  2WAQ C;  2PFQ A;  4A8E A;  5KT3 A;  1S0O A;  3J81 j;  4M9L A;  2W9A A;  5F9L A;  7ICH A;  9ICR A;  2LKY A;  4HYK A;  8ICM A;  9ICE A;  2PI4 A;  3O0F A;  5CR0 A;  2GO7 A;  4YMO A;  2CPR A;  3IM1 A;  2M9N A;  4M2Y A;  7ICE A;  7ICP A;  3BS5 B;  1COK A;  5IIL A;  1DK3 A;  1NZP A;  2B0C A;  3PST A;  1KEJ A;  5ALD A;  3ZD9 A;  3PZP A;  3D2S A;  3C2K A;  2A3V A;  2AXT U;  4KMO B;  3KHR A;  1O08 A;  3N7S C;  2Q0Z X;  4M9J A;  3WKE A;  3MR6 A;  2M0N A;  4I2J A;  2LHT A;  1JI7 A;  1LB2 B;  5J0S A;  5AKG A;  3NTU A;  4ELV A;  3FM9 A;  5BOM A;  4M47 A;  5L1M A;  3ZDC A;  5AKH A;  4DSK A;  5AM0 A;  7ICI A;  3SEI A;  5D49 A;  1SXE A;  4NLZ A;  2EZX A;  2YMP A;  1N63 A;  4DWI A;  1HIW A;  3Q8S B;  2W03 A;  2JXJ A;  4EEY A;  1A6S A;  4KX3 A;  1MQ2 A;  1DOQ A;  4RNO A;  2JRZ A;  1KBU A;  3UPQ A;  4QWE A;  1IV8 A;  3S6J A;  4KLL A;  3NAS A;  2AH5 A;  4RQ3 A;  5IIK A;  5KT2 A;  5CRX A;  2ATL A;  2KIW A;  3JPN A;  3H7I A;  5A0L A;  5ALP A;  5AI9 A;  4YN4 A;  1NK4 A;  5J2G A;  4RQ1 A;  4TUQ A;  3LYS A;  3KFU F;  4NV0 A;  2ASJ A;  3ED5 A;  2KVC A;  5AM3 A;  5DQH A;  5AHX A;  4Y2X A;  3HKZ F;  1JAL A;  1NK7 A;  2XGQ A;  3KZX A;  4BX9 C;  2LBO A;  3A0H U;  4J03 A;  3C1Z A;  2DL0 A;  4J9Q A;  3RR7 A;  4Q43 A;  1HEK A;  3I76 A;  2FPL A;  3CNH A;  8ICB A;  1L3U A;  2CRX A;  4EZ6 A;  5KNI A;  1X66 A;  2G5H B;  4O5E A;  3SAF A;  5KFI A;  4KLH A;  4AYB C;  1U4B A;  3IV6 A;  3ONN A;  3AMZ A;  4U6P A;  3PVX A;  3SAH A;  4YMM A;  3HKZ C;  5J0R A;  4RPZ A;  4F4K A;  2IMW P;  4UAW A;  3GU3 A;  2JEF A;  3OSP A;  2FLN A;  4F5P A;  4GXJ A;  2ZIW B;  1C7Y A;  1CRX A;  3Q8L A;  4UB8 U;  2NYV A;  4CRX A;  5BPC A;  2C2D A;  5CWR A;  5DGA A;  4AP9 A;  4YR0 A;  4P4M A;  4J9R A;  1S77 D;  2KK0 A;  2XIC A;  4IC9 A;  5L1L A;  1XWL A;  3DEE A;  5KG5 A;  2ASD A;  2HCF A;  2HBJ A;  4YVZ A;  2HVH A;  4IRK A;  8ICF A;  3G6X A;  1ZQH A;  1RDF A;  4MHV A;  2I5H A;  2W9M A;  4YD2 A;  8ICC A;  2KFZ A;  1QQ5 A;  2EZZ A;  5AM1 A;  2K4I A;  4Z6C A;  4UB5 A;  2BQ3 A;  4KLO A;  1LKY B;  3B0Y A;  3BS7 A;  3NUQ A;  1FFU A;  4OJO A;  3SYZ A;  2P35 A;  4Q45 A;  1CEZ A;  1QSS A;  4K4I A;  2KTQ A;  2J6S A;  4DOC A;  4EEK A;  3F2C A;  5J2F A;  2YMQ A;  4M6W B;  3MDC A;  3IRU A;  2F3N A;  4C8O A;  5ALK A;  1S0V A;  4F5O A;  4O5C A;  9ICN A;  2GWS A;  1A0P A;  3V7K A;  3WK5 A;  4RQ0 A;  2W04 A;  2WF8 A;  3K1Z A;  2Y1I A;  4YCX A;  1PZN A;  2ZXH A;  4F50 A;  4JB3 A;  3KKA C;  3MR2 A;  2H3I A;  4UAR A;  4YMN A;  3MR5 A;  2EAM A;  1SWV A;  2KSO A;  4BUG A;  1ZD5 A;  2YX8 A;  4UQG A;  4QW9 A;  4UAT A;  4TUS A;  1ZQQ A;  4KLT A;  3H8M A;  1TAQ A;  3TAR A;  3C1Y A;  2O6K A;  5AK5 A;  4JMU A;  2HHU A;  1S10 A;  1EXN A;  2R8K A;  2HHT A;  1QCK A;  1D8Y A;  5EOZ A;  4KIT B;  2GOL A;  4LJX A;  5KTQ A;  2IHN A;  3BQ1 A;  2W3R A;  4TUP A;  3CW2 C;  1WYG A;  5KFA A;  4UW9 A;  3H4D A;  3C23 A;  3PNC A;  3M8S A;  4DL3 A;  1TK8 A;  5AM2 A;  2HHQ A;  4JWN A;  2ZIX A;  4QZC A;  2Y0S F;  4P0P A;  4I28 A;  1ZQT A;  4EEN A;  8ICV A;  1UA1 A;  4B9N A;  1NJZ A;  7ICU A;  3RJI A;  1NK0 A;  3RAX A;  1KSP A;  2Y9T A;  8ICU A;  5ALY A;  1ZQW A;  3H0M B;  8ICA A;  1ED1 A;  5KFD A;  2R8I A;  4BGD A;  4DS4 A;  3C29 A;  2BQU A;  1JXL A;  3MGV A;  5J2A A;  4RQ8 A;  2F76 X;  8ICQ A;  2ZIU B;  5T14 A;  4XRH A;  2R8G A;  3BDP A;  1N62 A;  1NI3 A;  4LVS A;  1OUQ A;  4UBC A;  8ICJ A;  4B9L A;  4PGY A;  2A1A A;  3K4G A;  1FFV A;  2WFA A;  3MFH A;  4YR3 A;  4F2S A;  8ICW A;  5J0Q A;  3TAD A;  2GLE A;  1DGS A;  1BGX T;  5KFO A;  4JV1 A;  1ZD2 P;  3AN1 A;  1BPD A;  3EUB 2;  1BPZ A;  2G08 A;  1YT3 A;  3M7D A;  1KFT A;  2E8M A;  3WK7 A;  4KLM A;  1A76 A;  4GXK A;  2OCE A;  5DG7 A;  5C0Y A;  1AQ6 A;  4UAZ A;  4RT3 A;  3GDX A;  3THV A;  3EPI A;  4O3N A;  3RTV A;  4C8K A;  3N4M B;  5HMM A;  2LYB A;  1NKC A;  5G5H A;  4DFK A;  1NOM A;  3QXG A;  5AI0 A;  1RYU A;  4OO1 J;  1QQ6 A;  1ZQE A;  4JV2 A;  3M1Y A;  1T8E A;  3WKC A;  2E1E A;  2HBL A;  5BOL A;  3PSI A;  5DG9 A;  3MAB A;  7ICG A;  1O03 A;  2UVW A;  3H0L B;  1NK5 A;  4F3O A;  4DQQ A;  5L1J A;  1QTM A;  2DQN B;  2A1J A;  4KMU A;  1Z4N A;  4QIW C;  4Q44 A;  4DL2 A;  3NGD A;  2NRT A;  3PV8 A;  4LZG A;  1PK1 A;  3QUC A;  3BQ7 A;  2ES6 A;  4ELT A;  7ICM A;  3N7P D;  3Q8Q B;  2EZY A;  5KFY A;  2H3Z A;  2WB1 F;  2XVT A;  2A19 A;  2HW3 A;  5D4B A;  3V6H A;  5KFV A;  5J2B A;  4ECV A;  2BPF A;  3SI8 A;  3I28 A;  2BGW A;  1L3S A;  4O0I A;  1ZQU A;  3PSF A;  5KG1 A;  3JPQ A;  2BCQ A;  2ZG6 A;  4IQV A;  3SAG A;  1WWU A;  1F0M A;  2KKV A;  3TFS A;  4QJF B;  4UB2 A;  4KX5 A;  2FMP A;  8ICN A;  1Z19 A;  2OWO A;  4QZB A;  3OPX A;  4JUZ A;  7ICT A;  1P7D A;  3QEB Z;  4ECU A;  3LWL A;  2E1F A;  1KDH A;  1M6Y A; 
#chains in the Genus database with same CATH homology
 3KKA C;  2YTU A;  2E8M A;  2D8C A;  2B6G A;  2EAM A;  2KSO A;  2LPE A;  4NL9 A;  2QAR B;  2E8P A;  1OW5 A;  3H8M A;  1JI7 A;  2EAP A;  2L5Y A;  2KE7 A;  2Y9U A;  1B4F A;  1KW4 A;  1X40 A;  2E8O A;  4RQM A;  5L1M A;  4NL9 C;  2ESE A;  3SEI A;  1OXJ A;  1SXE A;  1SV0 A;  2QB1 A;  5J8Y C;  2KSO B;  1PK3 A;  2KG5 A;  2F8K A;  2E8N A;  1PK1 B;  2KMD A;  1V85 A;  3HIL A;  4NJ8 A;  2QB0 A;  1V38 A;  1LKY A;  2F44 A;  4MHV A;  3KKA A;  4IS7 A;  2JV3 A;  3TAD C;  2FE9 A;  1SGG A;  3TAC B;  2KIV A;  5J8Y A;  1SV4 A;  3BS5 A;  1PK1 A;  1B0X A;  2Y9T A;  5JTI A;  2DKX A;  3BQ7 A;  2ES6 A;  3K1R B;  1SXD A;  2K4P A;  1RG6 A;  4RQN A;  5JRT A;  2DKZ A;  1SV0 C;  4PZN A;  1LKY B;  1UCV A;  4PZO A;  3BS7 A;  3SEN A;  2QB0 B;  2EAO A;  3IDW A;  2DL0 A;  1Z1V A;  5F3X B;  2LMR A;  1WWV A;  2EAN A;  1X9X A;  3TAD A;  1DXS A;  2F3N A;  2GLE A;  1WWU A;  2QKQ A;  1F0M A;  5KNI A;  1X66 A;  1UQV A;  3BS5 B;  1COK A;  2QAR A;  2D3D A;  2K60 A;  5JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...