2QARA

Structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
ASIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQRPGGGGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 19
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qarA00
2F44A 5KNIA 2KSOA 4PZOA 4IS7A 5JRTA 4MHVA 4RQMA 1OXJA 2DKXA 1V38A 2D8CA 2KSOB 4NL9A 2QARB 4NL9C 1LKYA 1PK3A 1SV4A 1SV0C 2KG5A 5F3XB 1F0MA 2QKQA 1X9XA 2LMRA 2E8OA 4NJ8A 2E8MA 3KKAA 1LKYB 5L1MA 2FE9A 2EAMA 2QARA 2D3DA 3H8MA 2K60A 2EANA 2E8NA 3TACB 5J8YA 2Y9TA 5JU5A 5JTIA 2DL0A 1UQVA 1DXSA 4RQNA 1WWVA 2KIVA 2YTUA 3KKAC 1COKA 2GLEA 3BS7A 2ESEA 1X66A 2L5YA 2F8KA 2JV3A 4PZNA 1V85A 1JI7A 3SENA 1OW5A 2LPEA 2K4PA 1X40A 1Z1VA 1SGGA 5J8YC 3TADA 1PK1A 2KE7A 3TADC 3BS5A 2QB0B 2E8PA 2KMDA 3SEIA 3IDWA 1PK1B 1B4FA 2ES6A 3BS5B 3K1RB 2EAPA 3BQ7A 1WWUA 2EAOA 2Y9UA 1B0XA 2DKZA 1KW4A 2F3NA 1SV0A 2QB0A 2QB1A 1SXDA 1RG6A 2B6GA 1UCVA 1SXEA 3HILA
chains in the Genus database with same CATH superfamily
9ICCA 4IL6U 2D6FC 4FBUA 4ECQA 5AKYA 5JRTA 4MFFA 2AQ4A 4YCXA 4M0AA 2HHWA 3R9KA 1BPBA 4R66A 8ICKA 1D8YA 5HR6A 2KSOB 1V9PA 1K1QA 4TURA 4GIBA 3RB0A 3WKCA 5DG9A 1NK7A 4ED8A 5KFKA 3SZ2A 3KHRA 3JPSA 1D9FA 1N63A 8ICNA 2JZBB 3WK9A 5KFCA 4DOCA 4RNMA 4ED1A 1TK8A 8ICPA 1JN3A 4EYIB 1N62A 4PHDA 4RNOA 1DK3A 3ORYA 2ALZA 3QX7A 3JPOA 3QXGA 5KFTA 1JIHA 5KTQA 2DBYA 5J2BA 1B43A 2VKQA 1X42A 1TAUA 5KFUA 3IP4B 5TISU 1WWVA 3RH6A 5AM3A 5KT3A 1NJXA 3ONNA 3JPQA 5AK5A 2MSNA 2H5XA 8ICJA 3TAQA 2I5HA 4P4OA 4R63A 1FIQA 3TFSA 2PXIA 3T5HA 1UT5A 2W9MA 1AQ6A 2XI9A 2LPEA 3RJHA 4M9NA 1HIWA 3GIKA 2HHSA 3IDWA 4KLHA 2KN7A 2A1JB 1U9LA 2HSZA 3NVZA 9ICBA 2IHMA 4Y2RA 3KHGA 4F3OA 4YMMA 3DDHA 2IOHA 3V6HA 5KFQA 2G5IB 1ED1A 2FPLA 5ALUA 1TVAA 5HHHA 3N4MB 5KFDA 2FLLA 1ZQNA 3F5AA 5J0UA 2F1IA 9ICJA 3THVA 1XSPA 1D8BA 5HMLA 4QWEA 5IIJA 8ICEA 2FDRA 4FFDA 4TUQA 2BDUA 4QZ9A 4QW9A 5K4LA 3GILA 5HP4A 2KG5A 1X9XA 2HBLA 4KX3A 1ZQEA 2AHOB 2ZIWB 3C2LA 3PW4A 3QU4A 4C7ZA 1L3VA 2GWSA 2JEFA 2W3SA 3L3FX 5KFJA 2KNJA 2Y1JA 4O5CA 4O3PA 4IRKA 3NRZA 2NYVA 8ICOA 1S0MA 2HHXA 1KFTA 3QYPA 4EBEA 1Y88A 2MA1A 4EX7A 4B9UA 1LB2B 3TQ1A 2K8AA 3B0XA 4AYBC 5DB7A 4I2IA 1L8LA 2RQ5A 4QZAA 8ICTA 2KIWA 3UXNA 4ED2A 2YB1A 2F77X 2M9NA 5KFNA 3KHLA 1T94A 2IA6A 2F8KA 5KFGA 5AKEA 1NK8A 1TK0A 3N7SC 1TAQA 2DPIA 3I76A 2EH9A 4Y2UA 1SGGA 4EBCA 3BS5A 2QB0B 2IOFA 1KLNA 2FPMA 1WCNA 3PX4A 1MC8A 3H7IA 5KG5A 3DV9A 2I1QA 2YB4A 3JPPA 2JMGA 4KN4A 5BOMA 4PJ0U 4C8OA 4DFPA 3QZ8A 2G0AA 1X9SA 2HHQA 3N7PD 5ALKA 2UVUA 3WK4A 5AKJA 4DFKA 5BOLA 2OYYA 3BQ1A 4QZEA 1BNPA 5KFFA 1L3TA 5ALEA 3WKBA 1X9WA 2WAQF 1RYUA 3GIIA 5J0TA 4F71A 1ZQ1C 1JALA 4P2HA 5EWEA 3H4DA 2E8MA 1T3QA 3OGUA 5AI9A 2FE9A 4I27A 2EAMA 5DLFA 2LHTA 5ALMA 1SIJA 3V7LA 4I29A 5KFEA 1YZ6A 2E8NA 2ZTDA 5DDYA 2LM4A 2H3FA 5KFAA 1QSLA 2ATLA 5JUMA 4ED3A 5CP2A 2YTUA 2UVRA 2ZJ8A 3VC8A 2W7PA 1WUDA 1PVQA 3ZDCA 4BWJA 4ECXA 4KLIA 7ICRA 1EXNA 1SL1A 2AXTU 3UXPA 4Q8FA 4Y2YA 3GU3A 1HUOA 4O9MA 1ZQWA 5TZVA 2HCFA 2NRTA 3TADC 1JRPA 7ICVA 2H3ZA 2BCUA 4PHPA 2VJ5A 4O5KA 2PFQA 5EWGA 2RLTA 4J9LA 3IG8A 5ALTA 5ALNA 3C1YA 4ECUA 1B0XA 1SB3C 4BXOA 5H2FU 2G06A 3G6XA 4FO6A 4I2AA 3KOOA 4NLGA 4DSFA 4CDGA 3RJEA 3TKAA 3ZDEA 3UQ0A 1RM6C 4YMNA 2KSOA 3MGHA 3VCBA 3M7DA 4RQ1A 5KFRA 1WYGA 2LI6A 2YMMA 3T5LA 1GO3F 5KFYA 4HYKA 3SV3A 2HMXA 1ZD4A 2AGOA 7ICGA 3KKAA 1LKYB 4IQVA 2VANA 2FMPA 3RH4A 4JV1A 4O3NA 2JEIA 3EYZA 4EBDA 5ALYA 4PGQA 3CYMA 4AP9A 4CF5A 3TACB 3KTQA 2GO7A 2VA2A 5KFLA 4QZFA 1KFSA 2PFPA 4OD0A 1S5LU 2DGZA 1JX4A 5KG2A 3UMBA 5ALPA 1X2IA 1TKDA 5CHGA 4ELVA 9ICXA 3BS7A 4JV0A 2WF9A 2HBJA 8ICBA 1ZQBA 4Z6DA 4LZDA 1F5SA 3WK7A 2XGPA 2J6SA 3HP6A 3AU6A 3PY8A 3V72A 1Z00B 1QSSA 1KKXA 3EZ5A 3LVWA 1IXRA 2J6TA 3C23A 1UPHA 1D8LA 2HHTA 7ICLA 3MGIA 1ZQIA 2CN1A 4DL3A 4KMUA 4UW9A 4QJFB 2W9CB 4M04A 4JB3A 3GV5B 4U7CA 3SQIA 1NKBA 1MSWD 3EUB2 1ZQZA 3GDXA 3PMNA 1DRGA 2MRLA 4JWMA 1ECWA 1SV0A 4EX6A 2DQNB 2XICA 1TV9A 3HX0A 1UCVA 2LKYA 1Z3EB 4YD1A 2IMWP 3N28A 2W9BB 1N56A 4MHVA 2JH7A 1J97A 1K5OA 5KT2A 2C2DA 4F92B 2WHEA 1ZRNA 1CUKA 2HVHA 1VJ5A 3MDAA 1PK3A 5GTHU 5AK4A 5AKGA 2OM6A 1MQ3A 2ISPA 4M9HA 4O0IA 2NRWA 5AKXA 5EE9A 3OHBA 4PL1A 3AUOA 4G3IA 1CI4A 3T3FA 1VLBA 2JR5A 3RJKA 5CRXA 3SAFA 5KG0A 2HDOA 2W55A 4GFJA 3WKDA 5AI0A 4M9LA 1UQVA 3SR6A 3QE9Y 4ECRA 4RQNA 4TUSA 5AIAA 2C2RA 3H8WA 2LYHA 2KJ9A 4QZBA 2ZIVB 2VA8A 4OCZA 4C8NA 3IHQB 1KTQA 4F8RA 2KVSA 2PFNA 3SENA 5GTIU 8ICAA 5DG7A 4KLSA 2Q4TA 3HPOA 3H8SA 4I2JA 1NZPA 3FYHA 4KLEA 2ZJAA 3GV8B 4YXJA 3GIMA 2C28A 1A0PA 4ECSA 3WK6A 5F9LA 3QEBZ 1KW4A 7ICIA 1TK5A 3PZPA 3ZD9A 4DQQA 4DQPA 1P7DA 3UM9A 4UB8U 2FMSA 1XC9A 2NRZA 3LYSA 3HILA 5KFMA 5J0QA 3WKAA 4KN7A 4PZOA 4MEYA 3NVYA 2KHQA 3RB6A 4Q45A 4G9BA 2C22A 3Q8SB 3RB3A 2WB1F 1UHUA 3SAGA 2QARB 9ICSA 4M6WA 2A19A 1SL2A 4JV2A 4CGZA 3CP8A 1ZXIA 2OH2A 4GXJA 4NJ8A 4RUCA 2YMPA 3IM1A 5C5JA 2KP7A 5L1MA 4QWAA 3Q8RB 2CRXA 4I2CA 4P0QA 2G08A 2FMQA 2K89A 2BCQA 3TARA 1ZD5A 1DGJA 3M8SA 4C8KA 2XVTA 3G6YA 8ICFA 7ICTA 3SD7A 4BXOB 2W04A 3NS1A 5J2DA 1KQQA 2HBMA 2KIVA 3ZD8A 3UPQA 2WAQC 4NLNA 2NRXA 3GFKB 5L1LA 5KFOA 2JEGA 4ECVA 1XU4A 2ASDA 2JV3A 5KFVA 3GZFA 1DK2A 2BGWA 2K4PA 5HR7A 4RQ6A 4KX5A 2KE7A 3C1ZA 5AKHA 2KMDA 1HJPA 3EPGA 3NVVA 2DUYA 1DGSA 4OJPA 8ICVA 4P0PA 3Q8KA 2ES6A 3K1RB 1F44A 8ICCA 1IV8A 2LYBA 3RR8A 2KK0A 3AQFA 2QB1A 3PMLA 1DOQA 1SXDA 4B9LA 5ALIA 4PGYA 5BPCA 4KLDA 5J2FA 3LVVA 5KNIA 3MR2A 2UVVA 4QZGA 4RZRA 1PZNA 4XQ8A 1Z19A 4RPYA 4NLBA 2D8CA 2ASJA 4FBTA 8ICRA 1ZQYA 2BCRA 4U6PA 4IC9A 5CB1A 1LKYA 2JH1A 5ALOA 2ODGA 2PKEA 3F5EA 3PX0A 4J9KA 2E8OA 7ICJA 3QU5A 1IIPA 4YQWA 3I28A 4MFAA 1ZYQA 1BVSA 1ZQHA 4MF8A 5J2GA 3RJIA 5ALRA 1KBUA 4QZHA 4NM1A 4FZNA 5KFIA 4KITB 4F5OA 1NJZA 5JU5A 5KFHA 2KZ3A 2E3TA 3LK9A 2XC9A 3JPNA 5CEHA 5J2AA 1NK6A 3LWMA 2MUTB 1ZOLA 1JXLA 3QUCA 1YZ7A 2LYAA 2XCPA 2G07A 4DSLA 4KLLA 2QLTA 4YFKA 1JI7A 2W11A 5KG4A 5KT6A 1ZQGA 2E1EA 3MDCA 5AI8A 1Z1VA 2W9CA 3MABA 1QLNA 2KKPA 4RQ0A 5DBAA 5D4BA 4UAUA 1JXEA 2AH5A 2WFAA 3MBYA 4UASA 5CWRA 3UXOA 3Q8MA 9ICEA 3RAQA 5J0RA 1ZQUA 5FP0A 4QZDA 1XO0A 1C7YA 3FAHA 4YR0A 4RUAA 2W9BA 5DGBA 9ICOA 1ZQMA 4OJ5A 1QCKA 3MFIA 1RZTA 2EDUA 2JEJA 5C0YA 2ZXHA 4C8MA 1L3SA 8ICZA 5AM1A 3ZDDA 4NL9A 2K8BB 2BPGA 5DQIA 4KLJA 2XY5A 5AKLA 9ICKA 5G5GA 2YMLA 4Y2QA 1FFVA 3KD3A 4UAVA 1RXVA 1NNLA 3JPRA 3BJYA 3H40A 4IRDA 2XGQA 2KJ5A 3GV7B 4KLMA 5HMMA 3TFRA 2E5SA 2IBKA 4F5QA 3RF9A 5ALHA 2G5HB 4I2HA 5G5HA 2KZMA 4DOAA 4Z6CA 2P35A 5HHIA 1Z4NA 3HT3A 1BPZA 3RR7A 4KLQA 4C7YA 9ICAA 4J9NA 4R8UA 4GC7A 3GIJA 1N60A 4OO1J 2IHNA 3ZDAA 2BR0A 2ESEA 5J29A 3FC4A 2ZIUA 7ICPA 2JGAA 1V97A 1ZQRA 4PZNA 4C4SA 5KFPA 4Y2VA 1OW5A 3ISCA 3OSNA 4ZOHC 1A6SA 4ACOA 2E1FA 3RH5A 2AJQA 3GQCA 2AQ0A 4DL4A 1PK1B 1N48A 2EZZA 5J2JA 3UQ2A 3MR6A 3C28A 3CW2C 3V6KA 2DPJA 4QWCA 2F3NA 3QUTA 4F5NA 1ZQOA 1ZQQA 1IM4A 3A0BU 1U48A 1XO1A 4DFDA 3KZIU 2BDPA 1NK4A 2FLNA 4FS1A 5IIIA 5ALFA 4Z6FA 4KLFA 4HAIA 1JMSA 3PX6A 2NO4A 2DKXA 3BQTA 4YVZA 4QWDA 4DLGA 4BGDA 1KFDA 2XIDA 1SL0A 4Y2TA 4CNQA 5F3XB 4DQIA 1HUZA 3O0FA 4KLGA 3T79A 2I9GA 3MR5A 5AICA 1NZBA 1BGXT 1X6IA 2HI0A 4XRHA 3I1YA 9ICHA 1T4GA 1LV5A 3TI0A 4IR1A 2JZBA 4F93B 1S76D 9ICGA 2DF4B 3BQ2A 3IN5A 2ZG6A 2WB1C 5AKKA 5J0SA 2R8IA 3F2BA 5KFBA 4OJ6A 4KTQA 2BPCA 4RNNA 5AM0A 2R8KA 2WF6A 4QWBA 2PI5A 2L5YA 4GXKA 8ICSA 4ICAA 4C8LA 2AGPA 4PHAA 5F9NA 2R8GA 1X6JA 4BDPA 4LZGA 3QU7A 2KFZA 2KHVA 1FO4A 3BQ0A 3FDSA 4EYHB 3ETLA 3MC1A 2ZXIA 3OTQA 3M8RA 1ZD2P 4O3OA 1PUZA 5B66U 3RJJA 4M2YA 5A0LA 2ISOA 1QH9A 2MAXA 2KJ8A 1U49A 2A1JA 4NXZA 4DQRA 4YR3A 3B0YA 5AM4A 4J9QA 2BHNA 3LWLA 3E58A 3BZKA 4MFCA 2KZZA 2W54A 3F2CA 2W9AA 4QIWF 9ICLA 5AK3A 1NK5A 4O3RA 2HHVA 1KL9A 3ETRA 5KT4A 4EENA 4C80A 7ICMA 4X5VA 1BPEA 3M6KA 8ICMA 4BX9C 4IR9A 4EEKA 3WK5A 4J9MA 8ICGA 4UAYA 3ICXA 4BWMA 1CRXA 4BJQA 8ICLA 1SZPA 2K4IA 2MUTA 2OWOA 4QZ8A 5EOZA 2RP5A 2YQEA 2FJ6A 4ED7A 2ZIWA 4DEZA 4ECWA 4I2FA 4M47A 2XCAA 4Q44A 4QW8A 4GC6A 5DB9A 3T5KA 4F91B 3V7KA 4P4PA 3QZ7A 2P6RA 2H3VA 5AM5A 1SWWA 3AN1A 2FLPA 1RQLA 4DQSA 2XY7A 1NI3A 1KRPA 1HEKA 1S0NA 1J2NA 5J8YC 4RQ5A 1ZQTA 2VJ4A 3K1ZA 3RB4A 3NASA 4C4RA 2CXYA 4DS4A 3NGDA 5DG8A 5KFSA 5DQGA 3FM9A 1ZJMA 1B4FA 3HWTA 2EAPA 3BQ7A 2O6KA 3G6VA 5IIOA 2Y0SF 4EELA 5T14A 3QU2A 1XSLA 3PW5A 9ICWA 7ICOA 2GOLA 2QB0A 3WKEA 2EQYA 5B5EU 1S0OA 4MF2A 4DL5A 2JHDA 2K4EA 1QQ5A 3DEEA 4I2DA 5J0WA 3IG5A 4DSIA 2WF7A 4TUPA 4DL7A 2VIXA 3BZCA 4M9JA 4QNLA 2ZIXB 3H0RB 4NLCA 2PFOA 3ISBA 4UATA 1F0MA 5ALDA 3PSTA 4DS5A 4PPXA 4YXMA 5ALGA 9ICNA 1ZQXA 1T8EA 1ZQLA 2HOIA 1K1SA 1PVPA 5AIBA 3H8MA 1MQ2A 1VDVA 2BQUA 4JMUA 4ELUA 1KSPA 3E2EA 4FZMA 2HOFA 3ALRA 1BNOA 4K4HA 2PMZF 3RTVA 1BPXA 1JUDA 3K4GA 3IRUA 4EEYA 1V85A 3PO5A 4F4ZA 1MA7A 1A77A 1PK1A 1XSNA 4CRXA 1ZQDA 3KFUF 2YMQA 2KVCA 3PO4A 4F2SA 4RQ2A 5J0PA 3EPIA 4RQ7A 5KL8B 3HW8A 5ALWA 5DB8A 1BPYA 1RDFA 4Y2PA 7ICNA 4RPZA 4IQUA 1NJWA 3Q8QB 4DWIA 2OHFA 1S0VA 2AGQA 2G09A 7ICHA 9ICTA 1T3NA 1N5WA 5D49A 4PGXA 2BZFA 4CCHA 8ICWA 4US8A 4UAWA 3E0FA 1ZQVA 2N1RA 2R8JA 3ZDBA 4C0ZA 4O3SA 3KBBA 1S77D 3U26A 3TAPA 4I2GA 4RQMA 1ZRMA 4RPXA 1TAMA 2A3VA 9ICRA 2BQRA 4BUGA 2WF5A 3D6JA 4ZH4A 4F50A 2RDJA 3QUQA 4UBCA 4NY8A 1L8OA 2UVWA 3LDAA 4A8EA 4DLEA 2DWQA 2HW3A 2C2EA 4J03A 3C5FA 2LBOA 1ZQFA 3Q8PB 2K8CB 2HVIA 1WG8A 2EANA 3PR4A 3M9MB 1QQ6A 2Y9TA 5J0OA 3PNCA 2DL0A 4IQTA 5KFZA 2YY6A 5ALJA 1RQNA 3RRHA 3L5KA 4E0DA 3AMZA 3ED5A 5KAFU 4I2EA 8ICUA 1C20A 4YN4A 1O08A 1N5XA 3H8JA 3EW9A 5KG6A 5HNKA 4Q8EA 7ICFA 1WCLA 3PVXA 2VA3A 3WU2U 7ICEA 4OJOA 2FPKA 4R64A 4EZ6A 2GH1A 1X40A 3K75D 2YN4A 4F5PA 3OSPA 3CRXA 2KICA 4Y2JA 1A76A 5IILA 3M6ZA 1S10A 2KKVA 4B9VA 1Z00A 2HBKA 3QU9A 5J2KA 4F4WA 4Z6EA 3M1YA 1IG6A 4ECYA 2W7OA 1NK0A 3F2DA 3WK8A 4PL2A 5DGAA 3AQEA 3PW7A 2F76X 2F44A 4UB3A 5DBBA 5KL1B 4F2RA 4R65A 1N61A 2EZXA 2XY6A 4F4KA 4ED6A 3RAXA 1ZQCA 1L3UA 1V38A 3RRGA 3UMGA 3HKZF 5J2HA 8ICQA 4CE6A 3QNMA 3F53A 3JPTA 1S97A 2ZUCA 2LMRA 3UMCA 4TQSA 2HOQA 2BPFA 2F1JA 9ICQA 5AK6A 5E79U 4DSJA 4F4XA 1T7PA 3OJSA 2KV2A 3H0MB 7ICKA 2F8LA 2XO7A 2JXJA 1SKRA 1H38A 3AL0B 4B9SA 2Z7JA 1ZQJA 4O3QA 4YR2A 4YD2A 1QSYA 3NRWA 2FI1A 5KAIU 4QIWC 3V7JA 2H3QA 1X66A 2LM1A 4ED0A 1ZD3A 5KFXA 2AU0A 3NTUA 1PVRA 3TADA 2ZIVA 2E8PA 4DO9A 4NWIA 4NM2A 3RBDA 1KEJA 2W03A 1N2XA 2F2AB 1J2MA 5AM2A 1L7OA 5J2CA 2DKZA 4JUZA 3BDPA 4QZIA 1TFRA 5DQHA 1Q46A 4F72A 4WJ3B 2WF8A 2OEHA 4NLZA 4M6WB 1XWLA 1X9MA 1Z4OA 3D2QA 5AI6A 5J0YA 3T5JA 3HRDD 2JRZA 4UQGA 1UT8A 2ZIXA 1RYSA 2Q0ZX 4P0QB 4C4TA 3MFHA 4IRCA 5KG3A 3AEVA 4NL9C 3NUQA 4F5RA 3Q8LA 9ICVA 3J81j 4P4MA 1SKSA 4MEXA 2BQ3A 1L7MA 5KG1A 5DLGA 1Q8KA 2Y0SC 1NOMA 2KTQA 4B9TA 2HHUA 3C5GA 2QARA 1KN5A 1ZQAA 4K4GA 2K60A 3SI8A 2RHFA 4DOBA 3NVWA 1ZQKA 4J9SA 1BPDA 3PSPA 3OPXA 3SV4A 2ASLA 9ICIA 2R8HA 1OUQA 5EE3A 3M9OB 1SWVA 4LJXA 9ICPA 3HJEA 4YMOA 3QEAZ 4JWNA 2GLEA 1RYRA 1ZQSA 2DFLA 7ICUA 3PR5B 5ALSA 1M6YA 1U4BA 2IOFK 4P0PB 2J6UA 3H0LB 1AROP 3C2MA 4UAZA 1L6NA 3MR3A 4UB2A 2Y1IA 1RPLA 4PHEA 1D9DA 2ZTCA 3OJUA 3C21A 5J2IA 2NV3A 4US9A 2W8KA 5D46A 2A1AA 2V9WA 1WWUA 2ZJ5A 2R18A 5CJ7A 2Y9UA 5L9XA 5KG7A 2PMZC 1O03A 3RBEA 4FZLA 5EE1A 1QTMA 4DFMA 3ISDA 4KMOB 1L7PA 2B6GA 1COOA 3RJGA 4DF8A 1URJA 4FE3A 1UA1A 1RXWA 1NKEA 3TANA 2P66A 3D2SA 5AI4A 4GXIA 8ICXA 3PW0A 2W43A 3PSIA 3KZXA 4UB4A 4AYBF 1SKWA 4DL2A 2P6UA 1SV4A 4XUSA 1UA0A 4RQ8A 4IQWA 1L7NA 3PV8A 3SAHA 5ALVA 2ZUBA 4KLUA 4PH5A 3KHHA 2RRDA 2KEYA 4M9GA 5KFWA 1B22A 1YT3A 1QQ7A 1U45A 4KLOA 3B9JA 2WTFA 3MGVA 4UB1A 5AI5A 1XNSA 2W8LA 5J8YA 4EZ9A 5J2EA 1Q3VA 1NJYA 5IINA 2OCEA 5DBCA 3KKAC 4I28A 3QUBA 5L1KA 4FS2A 9ICFA 3RJFA 4I2BA 4LVSA 1SZHA 1NKCA 2M0NA 8ICYA 4Y2SA 4B9NA 4RU9A 2PI4A 2KFNA 4RT2A 5ALZA 1ZQPA 3IV6A 4K4IA 4UBBA 1ZJNA 5KT5A 3SEIA 4O3MA 3ZI4A 2B0CA 2F1HA 2CPRA 3BS5B 5AKZA 4DF4A 2EAOA 4YP3A 1S9FA 4NV0A 3L4PA 1ZETA 4USAA 2W3RA 2K4HA 1NK9A 4Y2XA 2V4RA 4J9RA 4DL6A 2ZTEA 5AHXA 9ICUA 4B6JA 1SXEA 1FEZA 4CF3A 2BCSA 4CF4A 4GLXA 5L1JA 4YG2A 2V4QA 4IS7A 8ICIA 2EZYA 1JROA 1OXJA 5DKWA 4DCCA 2NRVA 4RQ4A 4F4YA 3SMVA 5AKIA 1S8OA 3SYZA 1Z1BA 4DSKA 4ELTA 5EWFA 2NO5A 4XA5A 1SV0C 2QKQA 3D2NA 3EWAA 4TQRA 3N7RC 4UB6U 5CR0A 9ICMA 3N97B 4R8UB 4J9PA 4ECZA 2MU2A 2D3DA 3OHAA 5ALXA 3PSFA 5DDMA 2B21A 2H3IA 2ZIUB 8ICHA 5L1IA 5JTIA 4J9OA 3H4BA 2ZUDA 1FFUA 3RFAA 3V6JA 1DXSA 4UB5A 5IIMA 3HKZC 3S6JA 3C29A 1COKA 2KOBA 3AM9A 4RT3A 2BKEA 3M9NB 4DFJA 2OXOA 7ICSA 2RDIA 5J0XA 1MN8A 1LVHA 5EE0A 5KT7A 5IIKA 1XS9D 4DSEA 3C2KA 5ALLA 4JK1A 5CA7A 4KLTA 4ECTA 1KDHA 4O5EA 4QZCA 3AU2A 4NLKA 1TE2A 4Q43A 7ICQA 3PW2A 5ALQA 2I6XA 5DB6A 1CEZA 2KD1A 2BCVA 3CNHA 4UARA 1L5UA 2YX8A 4RQ3A 1RG6A 1Q3UA 4OJLA 4B9MA 3A0HU 1U47A
chains in the Genus database with same CATH topology
2F44A 5KNIA 2KSOA 4PZOA 4IS7A 5JRTA 4MHVA 4RQMA 1OXJA 2DKXA 1V38A 2D8CA 2KSOB 4NL9A 2QARB 4NL9C 1LKYA 1PK3A 1SV4A 1SV0C 2KG5A 5F3XB 1F0MA 2QKQA 1X9XA 2LMRA 2E8OA 4NJ8A 2E8MA 3KKAA 1LKYB 5L1MA 2FE9A 2EAMA 2QARA 2D3DA 3H8MA 2K60A 2EANA 2E8NA 3TACB 5J8YA 2Y9TA 5JU5A 5JTIA 2DL0A 1UQVA 1DXSA 4RQNA 1WWVA 2KIVA 2YTUA 3KKAC 1COKA 2GLEA 3BS7A 2ESEA 1X66A 2L5YA 2F8KA 2JV3A 4PZNA 1V85A 1JI7A 3SENA 1OW5A 2LPEA 2K4PA 1X40A 1Z1VA 1SGGA 5J8YC 3TADA 1PK1A 2KE7A 3TADC 3BS5A 2QB0B 2E8PA 2KMDA 3SEIA 3IDWA 1PK1B 1B4FA 2ES6A 3BS5B 3K1RB 2EAPA 3BQ7A 1WWUA 2EAOA 2Y9UA 1B0XA 2DKZA 1KW4A 2F3NA 1SV0A 2QB0A 2QB1A 1SXDA 1RG6A 2B6GA 1UCVA 1SXEA 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F44 A;  5KNI A;  2KSO A;  4PZO A;  4IS7 A;  5JRT A;  4MHV A;  4RQM A;  1OXJ A;  2DKX A;  1V38 A;  2D8C A;  2KSO B;  4NL9 A;  2QAR B;  4NL9 C;  1LKY A;  1PK3 A;  1SV4 A;  1SV0 C;  2KG5 A;  5F3X B;  1F0M A;  2QKQ A;  1X9X A;  2LMR A;  2E8O A;  4NJ8 A;  2E8M A;  3KKA A;  1LKY B;  5L1M A;  2FE9 A;  2EAM A;  2QAR A;  2D3D A;  3H8M A;  2K60 A;  2EAN A;  2E8N A;  3TAC B;  5J8Y A;  2Y9T A;  5JU5 A;  5JTI A;  2DL0 A;  1UQV A;  1DXS A;  4RQN A;  1WWV A;  2KIV A;  2YTU A;  3KKA C;  1COK A;  2GLE A;  3BS7 A;  2ESE A;  1X66 A;  2L5Y A;  2F8K A;  2JV3 A;  4PZN A;  1V85 A;  1JI7 A;  3SEN A;  1OW5 A;  2LPE A;  2K4P A;  1X40 A;  1Z1V A;  1SGG A;  5J8Y C;  3TAD A;  1PK1 A;  2KE7 A;  3TAD C;  3BS5 A;  2QB0 B;  2E8P A;  2KMD A;  3SEI A;  3IDW A;  1PK1 B;  1B4F A;  2ES6 A;  3BS5 B;  3K1R B;  2EAP A;  3BQ7 A;  1WWU A;  2EAO A;  2Y9U A;  1B0X A;  2DKZ A;  1KW4 A;  2F3N A;  1SV0 A;  2QB0 A;  2QB1 A;  1SXD A;  1RG6 A;  2B6G A;  1UCV A;  1SXE A;  3HIL A; 
#chains in the Genus database with same CATH topology
 9ICC A;  4IL6 U;  2D6F C;  4FBU A;  4ECQ A;  5AKY A;  5JRT A;  4MFF A;  2AQ4 A;  4YCX A;  4M0A A;  2HHW A;  3R9K A;  1BPB A;  4R66 A;  8ICK A;  1D8Y A;  5HR6 A;  2KSO B;  1V9P A;  1K1Q A;  4TUR A;  4GIB A;  3RB0 A;  3WKC A;  5DG9 A;  1NK7 A;  4ED8 A;  5KFK A;  3SZ2 A;  3KHR A;  3JPS A;  1D9F A;  1N63 A;  8ICN A;  2JZB B;  3WK9 A;  5KFC A;  4DOC A;  4RNM A;  4ED1 A;  1TK8 A;  8ICP A;  1JN3 A;  4EYI B;  1N62 A;  4PHD A;  4RNO A;  1DK3 A;  3ORY A;  2ALZ A;  3QX7 A;  3JPO A;  3QXG A;  5KFT A;  1JIH A;  5KTQ A;  2DBY A;  5J2B A;  1B43 A;  2VKQ A;  1X42 A;  1TAU A;  5KFU A;  3IP4 B;  5TIS U;  1WWV A;  3RH6 A;  5AM3 A;  5KT3 A;  1NJX A;  3ONN A;  3JPQ A;  5AK5 A;  2MSN A;  2H5X A;  8ICJ A;  3TAQ A;  2I5H A;  4P4O A;  4R63 A;  1FIQ A;  3TFS A;  2PXI A;  3T5H A;  1UT5 A;  2W9M A;  1AQ6 A;  2XI9 A;  2LPE A;  3RJH A;  4M9N A;  1HIW A;  3GIK A;  2HHS A;  3IDW A;  4KLH A;  2KN7 A;  2A1J B;  1U9L A;  2HSZ A;  3NVZ A;  9ICB A;  2IHM A;  4Y2R A;  3KHG A;  4F3O A;  4YMM A;  3DDH A;  2IOH A;  3V6H A;  5KFQ A;  2G5I B;  1ED1 A;  2FPL A;  5ALU A;  1TVA A;  5HHH A;  3N4M B;  5KFD A;  2FLL A;  1ZQN A;  3F5A A;  5J0U A;  2F1I A;  9ICJ A;  3THV A;  1XSP A;  1D8B A;  5HML A;  4QWE A;  5IIJ A;  8ICE A;  2FDR A;  4FFD A;  4TUQ A;  2BDU A;  4QZ9 A;  4QW9 A;  5K4L A;  3GIL A;  5HP4 A;  2KG5 A;  1X9X A;  2HBL A;  4KX3 A;  1ZQE A;  2AHO B;  2ZIW B;  3C2L A;  3PW4 A;  3QU4 A;  4C7Z A;  1L3V A;  2GWS A;  2JEF A;  2W3S A;  3L3F X;  5KFJ A;  2KNJ A;  2Y1J A;  4O5C A;  4O3P A;  4IRK A;  3NRZ A;  2NYV A;  8ICO A;  1S0M A;  2HHX A;  1KFT A;  3QYP A;  4EBE A;  1Y88 A;  2MA1 A;  4EX7 A;  4B9U A;  1LB2 B;  3TQ1 A;  2K8A A;  3B0X A;  4AYB C;  5DB7 A;  4I2I A;  1L8L A;  2RQ5 A;  4QZA A;  8ICT A;  2KIW A;  3UXN A;  4ED2 A;  2YB1 A;  2F77 X;  2M9N A;  5KFN A;  3KHL A;  1T94 A;  2IA6 A;  2F8K A;  5KFG A;  5AKE A;  1NK8 A;  1TK0 A;  3N7S C;  1TAQ A;  2DPI A;  3I76 A;  2EH9 A;  4Y2U A;  1SGG A;  4EBC A;  3BS5 A;  2QB0 B;  2IOF A;  1KLN A;  2FPM A;  1WCN A;  3PX4 A;  1MC8 A;  3H7I A;  5KG5 A;  3DV9 A;  2I1Q A;  2YB4 A;  3JPP A;  2JMG A;  4KN4 A;  5BOM A;  4PJ0 U;  4C8O A;  4DFP A;  3QZ8 A;  2G0A A;  1X9S A;  2HHQ A;  3N7P D;  5ALK A;  2UVU A;  3WK4 A;  5AKJ A;  4DFK A;  5BOL A;  2OYY A;  3BQ1 A;  4QZE A;  1BNP A;  5KFF A;  1L3T A;  5ALE A;  3WKB A;  1X9W A;  2WAQ F;  1RYU A;  3GII A;  5J0T A;  4F71 A;  1ZQ1 C;  1JAL A;  4P2H A;  5EWE A;  3H4D A;  2E8M A;  1T3Q A;  3OGU A;  5AI9 A;  2FE9 A;  4I27 A;  2EAM A;  5DLF A;  2LHT A;  5ALM A;  1SIJ A;  3V7L A;  4I29 A;  5KFE A;  1YZ6 A;  2E8N A;  2ZTD A;  5DDY A;  2LM4 A;  2H3F A;  5KFA A;  1QSL A;  2ATL A;  5JUM A;  4ED3 A;  5CP2 A;  2YTU A;  2UVR A;  2ZJ8 A;  3VC8 A;  2W7P A;  1WUD A;  1PVQ A;  3ZDC A;  4BWJ A;  4ECX A;  4KLI A;  7ICR A;  1EXN A;  1SL1 A;  2AXT U;  3UXP A;  4Q8F A;  4Y2Y A;  3GU3 A;  1HUO A;  4O9M A;  1ZQW A;  5TZV A;  2HCF A;  2NRT A;  3TAD C;  1JRP A;  7ICV A;  2H3Z A;  2BCU A;  4PHP A;  2VJ5 A;  4O5K A;  2PFQ A;  5EWG A;  2RLT A;  4J9L A;  3IG8 A;  5ALT A;  5ALN A;  3C1Y A;  4ECU A;  1B0X A;  1SB3 C;  4BXO A;  5H2F U;  2G06 A;  3G6X A;  4FO6 A;  4I2A A;  3KOO A;  4NLG A;  4DSF A;  4CDG A;  3RJE A;  3TKA A;  3ZDE A;  3UQ0 A;  1RM6 C;  4YMN A;  2KSO A;  3MGH A;  3VCB A;  3M7D A;  4RQ1 A;  5KFR A;  1WYG A;  2LI6 A;  2YMM A;  3T5L A;  1GO3 F;  5KFY A;  4HYK A;  3SV3 A;  2HMX A;  1ZD4 A;  2AGO A;  7ICG A;  3KKA A;  1LKY B;  4IQV A;  2VAN A;  2FMP A;  3RH4 A;  4JV1 A;  4O3N A;  2JEI A;  3EYZ A;  4EBD A;  5ALY A;  4PGQ A;  3CYM A;  4AP9 A;  4CF5 A;  3TAC B;  3KTQ A;  2GO7 A;  2VA2 A;  5KFL A;  4QZF A;  1KFS A;  2PFP A;  4OD0 A;  1S5L U;  2DGZ A;  1JX4 A;  5KG2 A;  3UMB A;  5ALP A;  1X2I A;  1TKD A;  5CHG A;  4ELV A;  9ICX A;  3BS7 A;  4JV0 A;  2WF9 A;  2HBJ A;  8ICB A;  1ZQB A;  4Z6D A;  4LZD A;  1F5S A;  3WK7 A;  2XGP A;  2J6S A;  3HP6 A;  3AU6 A;  3PY8 A;  3V72 A;  1Z00 B;  1QSS A;  1KKX A;  3EZ5 A;  3LVW A;  1IXR A;  2J6T A;  3C23 A;  1UPH A;  1D8L A;  2HHT A;  7ICL A;  3MGI A;  1ZQI A;  2CN1 A;  4DL3 A;  4KMU A;  4UW9 A;  4QJF B;  2W9C B;  4M04 A;  4JB3 A;  3GV5 B;  4U7C A;  3SQI A;  1NKB A;  1MSW D;  3EUB 2;  1ZQZ A;  3GDX A;  3PMN A;  1DRG A;  2MRL A;  4JWM A;  1ECW A;  1SV0 A;  4EX6 A;  2DQN B;  2XIC A;  1TV9 A;  3HX0 A;  1UCV A;  2LKY A;  1Z3E B;  4YD1 A;  2IMW P;  3N28 A;  2W9B B;  1N56 A;  4MHV A;  2JH7 A;  1J97 A;  1K5O A;  5KT2 A;  2C2D A;  4F92 B;  2WHE A;  1ZRN A;  1CUK A;  2HVH A;  1VJ5 A;  3MDA A;  1PK3 A;  5GTH U;  5AK4 A;  5AKG A;  2OM6 A;  1MQ3 A;  2ISP A;  4M9H A;  4O0I A;  2NRW A;  5AKX A;  5EE9 A;  3OHB A;  4PL1 A;  3AUO A;  4G3I A;  1CI4 A;  3T3F A;  1VLB A;  2JR5 A;  3RJK A;  5CRX A;  3SAF A;  5KG0 A;  2HDO A;  2W55 A;  4GFJ A;  3WKD A;  5AI0 A;  4M9L A;  1UQV A;  3SR6 A;  3QE9 Y;  4ECR A;  4RQN A;  4TUS A;  5AIA A;  2C2R A;  3H8W A;  2LYH A;  2KJ9 A;  4QZB A;  2ZIV B;  2VA8 A;  4OCZ A;  4C8N A;  3IHQ B;  1KTQ A;  4F8R A;  2KVS A;  2PFN A;  3SEN A;  5GTI U;  8ICA A;  5DG7 A;  4KLS A;  2Q4T A;  3HPO A;  3H8S A;  4I2J A;  1NZP A;  3FYH A;  4KLE A;  2ZJA A;  3GV8 B;  4YXJ A;  3GIM A;  2C28 A;  1A0P A;  4ECS A;  3WK6 A;  5F9L A;  3QEB Z;  1KW4 A;  7ICI A;  1TK5 A;  3PZP A;  3ZD9 A;  4DQQ A;  4DQP A;  1P7D A;  3UM9 A;  4UB8 U;  2FMS A;  1XC9 A;  2NRZ A;  3LYS A;  3HIL A;  5KFM A;  5J0Q A;  3WKA A;  4KN7 A;  4PZO A;  4MEY A;  3NVY A;  2KHQ A;  3RB6 A;  4Q45 A;  4G9B A;  2C22 A;  3Q8S B;  3RB3 A;  2WB1 F;  1UHU A;  3SAG A;  2QAR B;  9ICS A;  4M6W A;  2A19 A;  1SL2 A;  4JV2 A;  4CGZ A;  3CP8 A;  1ZXI A;  2OH2 A;  4GXJ A;  4NJ8 A;  4RUC A;  2YMP A;  3IM1 A;  5C5J A;  2KP7 A;  5L1M A;  4QWA A;  3Q8R B;  2CRX A;  4I2C A;  4P0Q A;  2G08 A;  2FMQ A;  2K89 A;  2BCQ A;  3TAR A;  1ZD5 A;  1DGJ A;  3M8S A;  4C8K A;  2XVT A;  3G6Y A;  8ICF A;  7ICT A;  3SD7 A;  4BXO B;  2W04 A;  3NS1 A;  5J2D A;  1KQQ A;  2HBM A;  2KIV A;  3ZD8 A;  3UPQ A;  2WAQ C;  4NLN A;  2NRX A;  3GFK B;  5L1L A;  5KFO A;  2JEG A;  4ECV A;  1XU4 A;  2ASD A;  2JV3 A;  5KFV A;  3GZF A;  1DK2 A;  2BGW A;  2K4P A;  5HR7 A;  4RQ6 A;  4KX5 A;  2KE7 A;  3C1Z A;  5AKH A;  2KMD A;  1HJP A;  3EPG A;  3NVV A;  2DUY A;  1DGS A;  4OJP A;  8ICV A;  4P0P A;  3Q8K A;  2ES6 A;  3K1R B;  1F44 A;  8ICC A;  1IV8 A;  2LYB A;  3RR8 A;  2KK0 A;  3AQF A;  2QB1 A;  3PML A;  1DOQ A;  1SXD A;  4B9L A;  5ALI A;  4PGY A;  5BPC A;  4KLD A;  5J2F A;  3LVV A;  5KNI A;  3MR2 A;  2UVV A;  4QZG A;  4RZR A;  1PZN A;  4XQ8 A;  1Z19 A;  4RPY A;  4NLB A;  2D8C A;  2ASJ A;  4FBT A;  8ICR A;  1ZQY A;  2BCR A;  4U6P A;  4IC9 A;  5CB1 A;  1LKY A;  2JH1 A;  5ALO A;  2ODG A;  2PKE A;  3F5E A;  3PX0 A;  4J9K A;  2E8O A;  7ICJ A;  3QU5 A;  1IIP A;  4YQW A;  3I28 A;  4MFA A;  1ZYQ A;  1BVS A;  1ZQH A;  4MF8 A;  5J2G A;  3RJI A;  5ALR A;  1KBU A;  4QZH A;  4NM1 A;  4FZN A;  5KFI A;  4KIT B;  4F5O A;  1NJZ A;  5JU5 A;  5KFH A;  2KZ3 A;  2E3T A;  3LK9 A;  2XC9 A;  3JPN A;  5CEH A;  5J2A A;  1NK6 A;  3LWM A;  2MUT B;  1ZOL A;  1JXL A;  3QUC A;  1YZ7 A;  2LYA A;  2XCP A;  2G07 A;  4DSL A;  4KLL A;  2QLT A;  4YFK A;  1JI7 A;  2W11 A;  5KG4 A;  5KT6 A;  1ZQG A;  2E1E A;  3MDC A;  5AI8 A;  1Z1V A;  2W9C A;  3MAB A;  1QLN A;  2KKP A;  4RQ0 A;  5DBA A;  5D4B A;  4UAU A;  1JXE A;  2AH5 A;  2WFA A;  3MBY A;  4UAS A;  5CWR A;  3UXO A;  3Q8M A;  9ICE A;  3RAQ A;  5J0R A;  1ZQU A;  5FP0 A;  4QZD A;  1XO0 A;  1C7Y A;  3FAH A;  4YR0 A;  4RUA A;  2W9B A;  5DGB A;  9ICO A;  1ZQM A;  4OJ5 A;  1QCK A;  3MFI A;  1RZT A;  2EDU A;  2JEJ A;  5C0Y A;  2ZXH A;  4C8M A;  1L3S A;  8ICZ A;  5AM1 A;  3ZDD A;  4NL9 A;  2K8B B;  2BPG A;  5DQI A;  4KLJ A;  2XY5 A;  5AKL A;  9ICK A;  5G5G A;  2YML A;  4Y2Q A;  1FFV A;  3KD3 A;  4UAV A;  1RXV A;  1NNL A;  3JPR A;  3BJY A;  3H40 A;  4IRD A;  2XGQ A;  2KJ5 A;  3GV7 B;  4KLM A;  5HMM A;  3TFR A;  2E5S A;  2IBK A;  4F5Q A;  3RF9 A;  5ALH A;  2G5H B;  4I2H A;  5G5H A;  2KZM A;  4DOA A;  4Z6C A;  2P35 A;  5HHI A;  1Z4N A;  3HT3 A;  1BPZ A;  3RR7 A;  4KLQ A;  4C7Y A;  9ICA A;  4J9N A;  4R8U A;  4GC7 A;  3GIJ A;  1N60 A;  4OO1 J;  2IHN A;  3ZDA A;  2BR0 A;  2ESE A;  5J29 A;  3FC4 A;  2ZIU A;  7ICP A;  2JGA A;  1V97 A;  1ZQR A;  4PZN A;  4C4S A;  5KFP A;  4Y2V A;  1OW5 A;  3ISC A;  3OSN A;  4ZOH C;  1A6S A;  4ACO A;  2E1F A;  3RH5 A;  2AJQ A;  3GQC A;  2AQ0 A;  4DL4 A;  1PK1 B;  1N48 A;  2EZZ A;  5J2J A;  3UQ2 A;  3MR6 A;  3C28 A;  3CW2 C;  3V6K A;  2DPJ A;  4QWC A;  2F3N A;  3QUT A;  4F5N A;  1ZQO A;  1ZQQ A;  1IM4 A;  3A0B U;  1U48 A;  1XO1 A;  4DFD A;  3KZI U;  2BDP A;  1NK4 A;  2FLN A;  4FS1 A;  5III A;  5ALF A;  4Z6F A;  4KLF A;  4HAI A;  1JMS A;  3PX6 A;  2NO4 A;  2DKX A;  3BQT A;  4YVZ A;  4QWD A;  4DLG A;  4BGD A;  1KFD A;  2XID A;  1SL0 A;  4Y2T A;  4CNQ A;  5F3X B;  4DQI A;  1HUZ A;  3O0F A;  4KLG A;  3T79 A;  2I9G A;  3MR5 A;  5AIC A;  1NZB A;  1BGX T;  1X6I A;  2HI0 A;  4XRH A;  3I1Y A;  9ICH A;  1T4G A;  1LV5 A;  3TI0 A;  4IR1 A;  2JZB A;  4F93 B;  1S76 D;  9ICG A;  2DF4 B;  3BQ2 A;  3IN5 A;  2ZG6 A;  2WB1 C;  5AKK A;  5J0S A;  2R8I A;  3F2B A;  5KFB A;  4OJ6 A;  4KTQ A;  2BPC A;  4RNN A;  5AM0 A;  2R8K A;  2WF6 A;  4QWB A;  2PI5 A;  2L5Y A;  4GXK A;  8ICS A;  4ICA A;  4C8L A;  2AGP A;  4PHA A;  5F9N A;  2R8G A;  1X6J A;  4BDP A;  4LZG A;  3QU7 A;  2KFZ A;  2KHV A;  1FO4 A;  3BQ0 A;  3FDS A;  4EYH B;  3ETL A;  3MC1 A;  2ZXI A;  3OTQ A;  3M8R A;  1ZD2 P;  4O3O A;  1PUZ A;  5B66 U;  3RJJ A;  4M2Y A;  5A0L A;  2ISO A;  1QH9 A;  2MAX A;  2KJ8 A;  1U49 A;  2A1J A;  4NXZ A;  4DQR A;  4YR3 A;  3B0Y A;  5AM4 A;  4J9Q A;  2BHN A;  3LWL A;  3E58 A;  3BZK A;  4MFC A;  2KZZ A;  2W54 A;  3F2C A;  2W9A A;  4QIW F;  9ICL A;  5AK3 A;  1NK5 A;  4O3R A;  2HHV A;  1KL9 A;  3ETR A;  5KT4 A;  4EEN A;  4C80 A;  7ICM A;  4X5V A;  1BPE A;  3M6K A;  8ICM A;  4BX9 C;  4IR9 A;  4EEK A;  3WK5 A;  4J9M A;  8ICG A;  4UAY A;  3ICX A;  4BWM A;  1CRX A;  4BJQ A;  8ICL A;  1SZP A;  2K4I A;  2MUT A;  2OWO A;  4QZ8 A;  5EOZ A;  2RP5 A;  2YQE A;  2FJ6 A;  4ED7 A;  2ZIW A;  4DEZ A;  4ECW A;  4I2F A;  4M47 A;  2XCA A;  4Q44 A;  4QW8 A;  4GC6 A;  5DB9 A;  3T5K A;  4F91 B;  3V7K A;  4P4P A;  3QZ7 A;  2P6R A;  2H3V A;  5AM5 A;  1SWW A;  3AN1 A;  2FLP A;  1RQL A;  4DQS A;  2XY7 A;  1NI3 A;  1KRP A;  1HEK A;  1S0N A;  1J2N A;  5J8Y C;  4RQ5 A;  1ZQT A;  2VJ4 A;  3K1Z A;  3RB4 A;  3NAS A;  4C4R A;  2CXY A;  4DS4 A;  3NGD A;  5DG8 A;  5KFS A;  5DQG A;  3FM9 A;  1ZJM A;  1B4F A;  3HWT A;  2EAP A;  3BQ7 A;  2O6K A;  3G6V A;  5IIO A;  2Y0S F;  4EEL A;  5T14 A;  3QU2 A;  1XSL A;  3PW5 A;  9ICW A;  7ICO A;  2GOL A;  2QB0 A;  3WKE A;  2EQY A;  5B5E U;  1S0O A;  4MF2 A;  4DL5 A;  2JHD A;  2K4E A;  1QQ5 A;  3DEE A;  4I2D A;  5J0W A;  3IG5 A;  4DSI A;  2WF7 A;  4TUP A;  4DL7 A;  2VIX A;  3BZC A;  4M9J A;  4QNL A;  2ZIX B;  3H0R B;  4NLC A;  2PFO A;  3ISB A;  4UAT A;  1F0M A;  5ALD A;  3PST A;  4DS5 A;  4PPX A;  4YXM A;  5ALG A;  9ICN A;  1ZQX A;  1T8E A;  1ZQL A;  2HOI A;  1K1S A;  1PVP A;  5AIB A;  3H8M A;  1MQ2 A;  1VDV A;  2BQU A;  4JMU A;  4ELU A;  1KSP A;  3E2E A;  4FZM A;  2HOF A;  3ALR A;  1BNO A;  4K4H A;  2PMZ F;  3RTV A;  1BPX A;  1JUD A;  3K4G A;  3IRU A;  4EEY A;  1V85 A;  3PO5 A;  4F4Z A;  1MA7 A;  1A77 A;  1PK1 A;  1XSN A;  4CRX A;  1ZQD A;  3KFU F;  2YMQ A;  2KVC A;  3PO4 A;  4F2S A;  4RQ2 A;  5J0P A;  3EPI A;  4RQ7 A;  5KL8 B;  3HW8 A;  5ALW A;  5DB8 A;  1BPY A;  1RDF A;  4Y2P A;  7ICN A;  4RPZ A;  4IQU A;  1NJW A;  3Q8Q B;  4DWI A;  2OHF A;  1S0V A;  2AGQ A;  2G09 A;  7ICH A;  9ICT A;  1T3N A;  1N5W A;  5D49 A;  4PGX A;  2BZF A;  4CCH A;  8ICW A;  4US8 A;  4UAW A;  3E0F A;  1ZQV A;  2N1R A;  2R8J A;  3ZDB A;  4C0Z A;  4O3S A;  3KBB A;  1S77 D;  3U26 A;  3TAP A;  4I2G A;  4RQM A;  1ZRM A;  4RPX A;  1TAM A;  2A3V A;  9ICR A;  2BQR A;  4BUG A;  2WF5 A;  3D6J A;  4ZH4 A;  4F50 A;  2RDJ A;  3QUQ A;  4UBC A;  4NY8 A;  1L8O A;  2UVW A;  3LDA A;  4A8E A;  4DLE A;  2DWQ A;  2HW3 A;  2C2E A;  4J03 A;  3C5F A;  2LBO A;  1ZQF A;  3Q8P B;  2K8C B;  2HVI A;  1WG8 A;  2EAN A;  3PR4 A;  3M9M B;  1QQ6 A;  2Y9T A;  5J0O A;  3PNC A;  2DL0 A;  4IQT A;  5KFZ A;  2YY6 A;  5ALJ A;  1RQN A;  3RRH A;  3L5K A;  4E0D A;  3AMZ A;  3ED5 A;  5KAF U;  4I2E A;  8ICU A;  1C20 A;  4YN4 A;  1O08 A;  1N5X A;  3H8J A;  3EW9 A;  5KG6 A;  5HNK A;  4Q8E A;  7ICF A;  1WCL A;  3PVX A;  2VA3 A;  3WU2 U;  7ICE A;  4OJO A;  2FPK A;  4R64 A;  4EZ6 A;  2GH1 A;  1X40 A;  3K75 D;  2YN4 A;  4F5P A;  3OSP A;  3CRX A;  2KIC A;  4Y2J A;  1A76 A;  5IIL A;  3M6Z A;  1S10 A;  2KKV A;  4B9V A;  1Z00 A;  2HBK A;  3QU9 A;  5J2K A;  4F4W A;  4Z6E A;  3M1Y A;  1IG6 A;  4ECY A;  2W7O A;  1NK0 A;  3F2D A;  3WK8 A;  4PL2 A;  5DGA A;  3AQE A;  3PW7 A;  2F76 X;  2F44 A;  4UB3 A;  5DBB A;  5KL1 B;  4F2R A;  4R65 A;  1N61 A;  2EZX A;  2XY6 A;  4F4K A;  4ED6 A;  3RAX A;  1ZQC A;  1L3U A;  1V38 A;  3RRG A;  3UMG A;  3HKZ F;  5J2H A;  8ICQ A;  4CE6 A;  3QNM A;  3F53 A;  3JPT A;  1S97 A;  2ZUC A;  2LMR A;  3UMC A;  4TQS A;  2HOQ A;  2BPF A;  2F1J A;  9ICQ A;  5AK6 A;  5E79 U;  4DSJ A;  4F4X A;  1T7P A;  3OJS A;  2KV2 A;  3H0M B;  7ICK A;  2F8L A;  2XO7 A;  2JXJ A;  1SKR A;  1H38 A;  3AL0 B;  4B9S A;  2Z7J A;  1ZQJ A;  4O3Q A;  4YR2 A;  4YD2 A;  1QSY A;  3NRW A;  2FI1 A;  5KAI U;  4QIW C;  3V7J A;  2H3Q A;  1X66 A;  2LM1 A;  4ED0 A;  1ZD3 A;  5KFX A;  2AU0 A;  3NTU A;  1PVR A;  3TAD A;  2ZIV A;  2E8P A;  4DO9 A;  4NWI A;  4NM2 A;  3RBD A;  1KEJ A;  2W03 A;  1N2X A;  2F2A B;  1J2M A;  5AM2 A;  1L7O A;  5J2C A;  2DKZ A;  4JUZ A;  3BDP A;  4QZI A;  1TFR A;  5DQH A;  1Q46 A;  4F72 A;  4WJ3 B;  2WF8 A;  2OEH A;  4NLZ A;  4M6W B;  1XWL A;  1X9M A;  1Z4O A;  3D2Q A;  5AI6 A;  5J0Y A;  3T5J A;  3HRD D;  2JRZ A;  4UQG A;  1UT8 A;  2ZIX A;  1RYS A;  2Q0Z X;  4P0Q B;  4C4T A;  3MFH A;  4IRC A;  5KG3 A;  3AEV A;  4NL9 C;  3NUQ A;  4F5R A;  3Q8L A;  9ICV A;  3J81 j;  4P4M A;  1SKS A;  4MEX A;  2BQ3 A;  1L7M A;  5KG1 A;  5DLG A;  1Q8K A;  2Y0S C;  1NOM A;  2KTQ A;  4B9T A;  2HHU A;  3C5G A;  2QAR A;  1KN5 A;  1ZQA A;  4K4G A;  2K60 A;  3SI8 A;  2RHF A;  4DOB A;  3NVW A;  1ZQK A;  4J9S A;  1BPD A;  3PSP A;  3OPX A;  3SV4 A;  2ASL A;  9ICI A;  2R8H A;  1OUQ A;  5EE3 A;  3M9O B;  1SWV A;  4LJX A;  9ICP A;  3HJE A;  4YMO A;  3QEA Z;  4JWN A;  2GLE A;  1RYR A;  1ZQS A;  2DFL A;  7ICU A;  3PR5 B;  5ALS A;  1M6Y A;  1U4B A;  2IOF K;  4P0P B;  2J6U A;  3H0L B;  1ARO P;  3C2M A;  4UAZ A;  1L6N A;  3MR3 A;  4UB2 A;  2Y1I A;  1RPL A;  4PHE A;  1D9D A;  2ZTC A;  3OJU A;  3C21 A;  5J2I A;  2NV3 A;  4US9 A;  2W8K A;  5D46 A;  2A1A A;  2V9W A;  1WWU A;  2ZJ5 A;  2R18 A;  5CJ7 A;  2Y9U A;  5L9X A;  5KG7 A;  2PMZ C;  1O03 A;  3RBE A;  4FZL A;  5EE1 A;  1QTM A;  4DFM A;  3ISD A;  4KMO B;  1L7P A;  2B6G A;  1COO A;  3RJG A;  4DF8 A;  1URJ A;  4FE3 A;  1UA1 A;  1RXW A;  1NKE A;  3TAN A;  2P66 A;  3D2S A;  5AI4 A;  4GXI A;  8ICX A;  3PW0 A;  2W43 A;  3PSI A;  3KZX A;  4UB4 A;  4AYB F;  1SKW A;  4DL2 A;  2P6U A;  1SV4 A;  4XUS A;  1UA0 A;  4RQ8 A;  4IQW A;  1L7N A;  3PV8 A;  3SAH A;  5ALV A;  2ZUB A;  4KLU A;  4PH5 A;  3KHH A;  2RRD A;  2KEY A;  4M9G A;  5KFW A;  1B22 A;  1YT3 A;  1QQ7 A;  1U45 A;  4KLO A;  3B9J A;  2WTF A;  3MGV A;  4UB1 A;  5AI5 A;  1XNS A;  2W8L A;  5J8Y A;  4EZ9 A;  5J2E A;  1Q3V A;  1NJY A;  5IIN A;  2OCE A;  5DBC A;  3KKA C;  4I28 A;  3QUB A;  5L1K A;  4FS2 A;  9ICF A;  3RJF A;  4I2B A;  4LVS A;  1SZH A;  1NKC A;  2M0N A;  8ICY A;  4Y2S A;  4B9N A;  4RU9 A;  2PI4 A;  2KFN A;  4RT2 A;  5ALZ A;  1ZQP A;  3IV6 A;  4K4I A;  4UBB A;  1ZJN A;  5KT5 A;  3SEI A;  4O3M A;  3ZI4 A;  2B0C A;  2F1H A;  2CPR A;  3BS5 B;  5AKZ A;  4DF4 A;  2EAO A;  4YP3 A;  1S9F A;  4NV0 A;  3L4P A;  1ZET A;  4USA A;  2W3R A;  2K4H A;  1NK9 A;  4Y2X A;  2V4R A;  4J9R A;  4DL6 A;  2ZTE A;  5AHX A;  9ICU A;  4B6J A;  1SXE A;  1FEZ A;  4CF3 A;  2BCS A;  4CF4 A;  4GLX A;  5L1J A;  4YG2 A;  2V4Q A;  4IS7 A;  8ICI A;  2EZY A;  1JRO A;  1OXJ A;  5DKW A;  4DCC A;  2NRV A;  4RQ4 A;  4F4Y A;  3SMV A;  5AKI A;  1S8O A;  3SYZ A;  1Z1B A;  4DSK A;  4ELT A;  5EWF A;  2NO5 A;  4XA5 A;  1SV0 C;  2QKQ A;  3D2N A;  3EWA A;  4TQR A;  3N7R C;  4UB6 U;  5CR0 A;  9ICM A;  3N97 B;  4R8U B;  4J9P A;  4ECZ A;  2MU2 A;  2D3D A;  3OHA A;  5ALX A;  3PSF A;  5DDM A;  2B21 A;  2H3I A;  2ZIU B;  8ICH A;  5L1I A;  5JTI A;  4J9O A;  3H4B A;  2ZUD A;  1FFU A;  3RFA A;  3V6J A;  1DXS A;  4UB5 A;  5IIM A;  3HKZ C;  3S6J A;  3C29 A;  1COK A;  2KOB A;  3AM9 A;  4RT3 A;  2BKE A;  3M9N B;  4DFJ A;  2OXO A;  7ICS A;  2RDI A;  5J0X A;  1MN8 A;  1LVH A;  5EE0 A;  5KT7 A;  5IIK A;  1XS9 D;  4DSE A;  3C2K A;  5ALL A;  4JK1 A;  5CA7 A;  4KLT A;  4ECT A;  1KDH A;  4O5E A;  4QZC A;  3AU2 A;  4NLK A;  1TE2 A;  4Q43 A;  7ICQ A;  3PW2 A;  5ALQ A;  2I6X A;  5DB6 A;  1CEZ A;  2KD1 A;  2BCV A;  3CNH A;  4UAR A;  1L5U A;  2YX8 A;  4RQ3 A;  1RG6 A;  1Q3U A;  4OJL A;  4B9M A;  3A0H U;  1U47 A; 
#chains in the Genus database with same CATH homology
 2F44 A;  5KNI A;  2KSO A;  4PZO A;  4IS7 A;  5JRT A;  4MHV A;  4RQM A;  1OXJ A;  2DKX A;  1V38 A;  2D8C A;  2KSO B;  4NL9 A;  2QAR B;  4NL9 C;  1LKY A;  1PK3 A;  1SV4 A;  1SV0 C;  2KG5 A;  5F3X B;  1F0M A;  2QKQ A;  1X9X A;  2LMR A;  2E8O A;  4NJ8 A;  2E8M A;  3KKA A;  1LKY B;  5L1M A;  2FE9 A;  2EAM A;  2QAR A;  2D3D A;  3H8M A;  2K60 A;  2EAN A;  2E8N A;  3TAC B;  5J8Y A;  2Y9T A;  5JU5 A;  5JTI A;  2DL0 A;  1UQV A;  1DXS A;  4RQN A;  1WWV A;  2KIV A;  2YTU A;  3KKA C;  1COK A;  2GLE A;  3BS7 A;  2ESE A;  1X66 A;  2L5Y A;  2F8K A;  2JV3 A;  4PZN A;  1V85 A;  1JI7 A;  3SEN A;  1OW5 A;  2LPE A;  2K4P A;  1X40 A;  1Z1V A;  1SGG A;  5J8Y C;  3TAD A;  1PK1 A;  2KE7 A;  3TAD C;  3BS5 A;  2QB0 B;  2E8P A;  2KMD A;  3SEI A;  3IDW A;  1PK1 B;  1B4F A;  2ES6 A;  3BS5 B;  3K1R B;  2EAP A;  3BQ7 A;  1WWU A;  2EAO A;  2Y9U A;  1B0X A;  2DKZ A;  1KW4 A;  2F3N A;  1SV0 A;  2QB0 A;  2QB1 A;  1SXD A;  1RG6 A;  2B6G A;  1UCV A;  1SXE A;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...