2QARA

Structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
ASIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQRPGGGGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qarA00
2B6GA 2DKZA 2KIVA 4RQMA 1SV4A 2GLEA 2JV3A 2KE7A 3BS5B 4NL9C 2Y9UA 2YTUA 3BS5A 2DKXA 5JU5A 3TACB 1Z1VA 2E8MA 4IS7A 5KNIA 2F44A 2ES6A 2F3NA 2Y9TA 2LMRA 1SV0C 2QARB 2K60A 2QARA 1V38A 2KG5A 4NL9A 2D8CA 1SXDA 1RG6A 1B0XA 2D3DA 2K4PA 3BQ7A 5L1MA 1SV0A 2E8NA 1V85A 2QB0B 3IDWA 1X40A 1DXSA 1X66A 2QB0A 3TADC 1X9XA 5J8YC 1UQVA 2LPEA 1SGGA 2QB1A 1LKYB 3SEIA 1LKYA 3SENA 2EAOA 3KKAC 2EAPA 4MHVA 2KSOB 1PK1B 3TADA 1PK3A 5JTIA 1B4FA 2KSOA 1PK1A 1OXJA 5J8YA 1F0MA 2F8KA 1KW4A 2L5YA 3HILA 2E8PA 2EANA 1UCVA 1WWUA 3KKAA 2E8OA 4PZOA 2ESEA 4NJ8A 2EAMA 2DL0A 2KMDA 1SXEA 3BS7A 5JRTA 1COKA 3H8MA 1WWVA 2FE9A 3K1RB 5F3XB 4RQNA 2QKQA 1OW5A 4PZNA 1JI7A
chains in the Genus database with same CATH superfamily
2RQ5A 9ICAA 1S0VA 3NVWA 2YMMA 3ETLA 1L3UA 3C5FA 2HOFA 2NV3A 2ASLA 2NYVA 2ZJAA 4O3PA 9ICOA 3PW5A 2BCUA 3C23A 4DFJA 4UAVA 5CR0A 4RU9A 5KG4A 2KG5A 4DSIA 1HIWA 1RYUA 4OJLA 2WF7A 2JHDA 3QU2A 1T7PA 3GQCA 5L1JA 3EPIA 1NK9A 4RNOA 2WF8A 2JGAA 2V4RA 3TADC 4O3NA 4F72A 3CYMA 1RYSA 3NRWA 4IR1A 3GIMA 1K1SA 2W9CA 2A1JB 3GU3A 3KHRA 1KFTA 3BQ2A 1N5WA 5FP0A 2KSOB 1PK3A 1X2IA 2OM6A 2HBLA 1F0MA 2Y1JA 3RAQA 2EZYA 3NUQA 4FZNA 5AK4A 1H38A 4QIWF 4XA5A 2BPGA 1HUZA 1KL9A 5L1KA 1TAMA 1Z19A 7ICVA 4NLGA 1L8OA 4ICAA 2KJ8A 3LVVA 5KFEA 1KN5A 2W04A 2AQ4A 5KFKA 1DK3A 5J0XA 9ICGA 5KG2A 3Q8KA 4OJ6A 4M6WA 5KFAA 4RZRA 2GLEA 3SI8A 5KG3A 2CPRA 4O0IA 4DQIA 3VC8A 2OEHA 5EWGA 3RB3A 4IRDA 4UBBA 4DL4A 3JPSA 3G6XA 4EZ6A 2W3RA 1ZQDA 4YMOA 1ZQAA 5EOZA 3R9KA 3WK6A 2R8HA 2PFQA 1V38A 1ZQLA 4OJPA 4TUQA 1NKEA 4USAA 4UATA 3OJSA 1JX4A 3OJUA 3BZCA 2DBYA 4C8LA 3PX6A 2ZIXA 3SMVA 3GIKA 1SL0A 4KITB 4EBCA 2HCFA 4MF8A 2OHFA 4LVSA 1X6JA 1SWVA 4I2DA 7ICIA 1VDVA 2WAQF 5D46A 2XGPA 4UAUA 2QB1A 4UAYA 2RHFA 8ICRA 3ONNA 2NRWA 4B9SA 4M2YA 2PFOA 1D9DA 4RQ2A 3E58A 1KSPA 2VJ4A 2VA2A 1S5LU 1KFSA 1ZQIA 5J8YA 3NGDA 4NLNA 1TE2A 4F50A 3TKAA 3ISBA 3H0LB 4O3MA 3EUB2 3OSPA 1QLNA 3U26A 5KT4A 3C21A 5J29A 4QWDA 1QTMA 3HWTA 2IA6A 2F8LA 1ZQFA 5J0UA 2HHSA 2RP5A 2P35A 4DL5A 5HR7A 8ICUA 3V6KA 3RAXA 3T5HA 5AM3A 4HAIA 5AI8A 4B9UA 5AICA 2VA3A 5KT5A 2YTUA 2ATLA 5L1IA 1S76D 2W8KA 4DSFA 4EZ9A 4CNQA 2FJ6A 7ICKA 1UA1A 5IILA 4KMOB 4DLEA 5KFCA 2Y9TA 2KZZA 4KLDA 4E0DA 1A77A 1WYGA 3TFSA 2KEYA 4A8EA 3UMCA 4EX7A 4IQVA 2D8CA 2JXJA 4RQ6A 1NK5A 2KK0A 5EWEA 9ICVA 1ZQPA 3JPQA 4F4YA 2ZJ5A 3N97B 1SV0A 8ICIA 4BUGA 8ICOA 1NK8A 2WAQC 1RPLA 3TARA 3C5GA 2V9WA 4M9JA 1JXEA 4YMNA 3LYSA 4F91B 4F5PA 4DO9A 2HDOA 2W9CB 4ECXA 3KHGA 3WKAA 3T79A 4F5RA 3Q8SB 2BGWA 2EAPA 1L7OA 4OJOA 2E3TA 5ALYA 3BQ1A 4F4ZA 5AM2A 2NRXA 5J2KA 4UW9A 3DDHA 1VJ5A 2LYAA 3F5EA 2MAXA 1JUDA 4QZIA 1ZQSA 3TAPA 2L5YA 3H40A 4MFFA 1T3QA 5KL1B 3RFAA 5DKWA 3QX7A 5ALSA 3SV3A 2MRLA 1QH9A 5ALWA 5DB8A 1SKRA 2FLPA 1SXEA 4KLHA 3WK8A 1UPHA 3JPNA 1ZQOA 5J2EA 3CP8A 4FO6A 4NLCA 3KBBA 1BPZA 5J2IA 2DKZA 4M6WB 1ZQCA 3V72A 4AYBF 4RQMA 8ICLA 4GC7A 1KBUA 3UMGA 4HYKA 2KJ9A 2F1IA 3H0RB 2C2DA 2J6TA 3H4BA 4KLQA 4UASA 4QZAA 1CRXA 1S10A 4K4IA 1ZQMA 2WF9A 1X9WA 2G07A 2ZTEA 4ELTA 3C2MA 4ECZA 3QU5A 3RH4A 5AKLA 1Z00A 4NL9A 1SB3C 4PPXA 2KHVA 3BQ7A 3UXNA 2G0AA 4ED8A 4DCCA 2MSNA 2ZIXB 4F2RA 2F1HA 4GFJA 4EBEA 1X40A 4I29A 1DXSA 3UXPA 3SAGA 4NM1A 5DLGA 3M8SA 2H5XA 3Q8MA 4WJ3B 3D2QA 1UT8A 2G06A 3HRDD 2B21A 4M9NA 2KFZA 3D2SA 1CI4A 4YXMA 1Q3VA 4PGYA 5F9NA 5F9LA 3LDAA 1T4GA 1DK2A 3CRXA 4QWBA 5KFJA 3RB4A 2VANA 4UB8U 2AQ0A 3RJGA 2HVIA 4BGDA 1WWUA 3ZDEA 4BXOA 3QYPA 1ZRNA 4QNLA 3IP4B 4MEXA 4DOBA 4F4KA 2KMDA 4M9GA 2E1EA 2OYYA 3L3FX 1Q8KA 2GOLA 5AKKA 3QU9A 2VKQA 3AM9A 1ZOLA 4PZNA 1ZQNA 2XCPA 2FPKA 2IOFA 3EYZA 1QCKA 2IBKA 4AYBC 1N5XA 2K8CB 3CW2C 4O5EA 1NOMA 5KFLA 2LYHA 2FPMA 4UB3A 7ICSA 3ETRA 3AQFA 2XIDA 3FC4A 5J0QA 5G5GA 3HW8A 1URJA 2WB1C 1BPDA 4K4GA 1MSWD 1UHUA 1NK6A 4O3RA 1XSLA 5IIJA 5AKYA 2OWOA 4J9LA 3T5JA 1BNPA 3C1ZA 4NV0A 1JIHA 4QZDA 3GV5B 1YZ7A 1V85A 2UVUA 4KLLA 2HHWA 5KFTA 4DSEA 3SR6A 4EENA 3ZD8A 2HHTA 4RNNA 2JH1A 2KKVA 4UARA 2LI6A 4UB6U 5DG9A 2K4IA 4YQWA 3QZ8A 1ZQTA 2PMZC 4RPZA 3RJEA 4KTQA 3KKAC 2G09A 4YG2A 9ICJA 4ED6A 2BKEA 2HI0A 3MGHA 4I2CA 1MN8A 3HKZC 3O0FA 3QZ7A 4I2HA 1PK1A 2OCEA 2NO4A 3IM1A 1RQNA 3PO5A 1X6IA 4J9PA 4DF8A 4PGQA 4ELUA 4F92B 3DEEA 5IIMA 1KRPA 2W7OA 5CB1A 2IHNA 4J9KA 2BCVA 5AKJA 4NJ8A 3MBYA 1ZQYA 2LM1A 5J0TA 2EAMA 3V7JA 3M6ZA 3N7RC 5KFOA 2Y0SC 5DQIA 1TK8A 8ICKA 1OW5A 1XWLA 4FFDA 8ICJA 2HSZA 4I2BA 4C80A 2ALZA 3KOOA 3H4DA 2AJQA 4RQ7A 4P4OA 1RDFA 2JV3A 4P2HA 4PL1A 4I28A 5ALTA 5KG0A 3G6VA 8ICFA 4TQRA 2KFNA 3UQ2A 2GO7A 3E2EA 2F44A 4DSLA 4ED2A 3DV9A 3RRHA 4C8NA 2HOIA 2BCQA 1Z00B 1LVHA 4DFMA 2WFAA 4JV1A 7ICMA 2RLTA 7ICJA 4I2IA 3IHQB 2PI4A 1S97A 3ICXA 2KVSA 2MUTB 5L1MA 2AXTU 4G3IA 5J0RA 2E8NA 1ZQWA 1Q3UA 1S0NA 2XC9A 3RF9A 4YN4A 4PL2A 3RJKA 4NM2A 1BPBA 3ZDBA 5KG5A 5GTIU 4UAWA 3WKCA 3KZXA 4QWEA 2P66A 2ISOA 4KLIA 4GIBA 5L9XA 4DWIA 1WUDA 2XO7A 1NJZA 4YFKA 9ICHA 2KP7A 3PSFA 2RRDA 1TVAA 9ICBA 2F2AB 4DOAA 2R8JA 1NZPA 3IV6A 1KLNA 4M0AA 3MR3A 4KN7A 1XC9A 5KFNA 4OCZA 3PR4A 1UCVA 4BXOB 3FDSA 4PHEA 1CEZA 1IM4A 3H0MB 2DUYA 2ISPA 7ICPA 1PVQA 4DL7A 3GDXA 1NK4A 2J6SA 3K1RB 3QUTA 3G6YA 2BPFA 4FBTA 2XY5A 3ZDCA 2W3SA 5ALPA 4TURA 4FZMA 2Q0ZX 5J2HA 3MFIA 1SV4A 5DBAA 2Y9UA 2BQRA 2DKXA 3PR5B 3LWMA 2C2RA 3TACB 4ED3A 1ZQUA 4IL6U 4IS7A 2A19A 2ZIVB 4M04A 4TQSA 9ICTA 2K89A 4Q45A 4RT2A 3F2BA 3ALRA 1D8LA 1S8OA 2YMQA 3AEVA 2M9NA 2KIWA 4C8KA 3H8SA 2KV2A 3GILA 2KKPA 4Y2XA 4ELVA 1Z3EB 3QU4A 3MDAA 5AM4A 5DB7A 1D8BA 2C28A 2GH1A 5DB6A 4DLGA 5J2DA 4RQ0A 2K4EA 1N60A 4F4WA 1CUKA 2LPEA 4PHAA 1SL1A 3T3FA 4ED7A 5D49A 1KQQA 3M9MB 3SAHA 1U4BA 4U6PA 8ICQA 4QZ8A 5CP2A 3TI0A 3AUOA 4DFDA 5AHXA 5ALVA 5KFVA 5B5EU 1PK1B 1B4FA 3EWAA 2ASJA 3EZ5A 3MFHA 2Y1IA 2H3FA 5ALNA 2P6UA 3HILA 4KLSA 3IG8A 1NJWA 3H8WA 4BWJA 1S0OA 1XSPA 5TZVA 3RJFA 1JMSA 4EBDA 5CA7A 3IG5A 4JMUA 5GTHU 1L6NA 4P4PA 2E5SA 3I1YA 3GIJA 3N7PD 3C29A 4Y2TA 4R66A 1D8YA 2YB4A 4QIWC 1RXVA 1JROA 1L3TA 5ALHA 1Q46A 5KFSA 8ICEA 5J0WA 2JMGA 1Z1VA 1B43A 5BOMA 5AIBA 3L5KA 4I2AA 4Z6CA 5KNIA 1FO4A 5L1LA 1BPXA 2A3VA 5ALFA 8ICTA 3RB0A 1PVPA 1S9FA 4B6JA 5EE1A 5KTQA 7ICEA 3THVA 1NK0A 3ZDDA 5KFFA 4JWMA 1SIJA 3F2DA 3PW7A 1ZQRA 3OPXA 3PW2A 5E79U 3SV4A 3NVZA 8ICZA 3NRZA 1T94A 4LJXA 4UBCA 8ICCA 1X66A 2QB0A 1BPYA 4R64A 1L3SA 2ZG6A 2H3VA 2OXOA 1IIPA 3N4MB 4IQUA 2P6RA 5KFPA 2KZMA 2ZIUA 3MR6A 3C28A 2CXYA 2H3ZA 3QUQA 3RTVA 4BX9C 4IQTA 2PKEA 3QNMA 5DQGA 3B9JA 2BCRA 5DGBA 3D6JA 4J9SA 4RQ8A 4DQPA 4PHDA 4ED1A 4O3OA 3KTQA 3AL0B 1ZQ1C 4XQ8A 4MEYA 4Z6EA 4ZH4A 3HT3A 2ZUDA 3PVXA 2IMWP 2JH7A 2W43A 5ALRA 3J81j 3OHBA 3MDCA 1T8EA 4PZOA 4GXIA 3PW4A 2DL0A 1XU4A 3RBEA 4EYHB 1MA7A 3M9OB 1FFVA 1L7NA 1ZD5A 5F3XB 4M9HA 2ZJ8A 3TQ1A 4ZOHC 4KN4A 2HW3A 1JALA 5ALMA 4FS2A 5AKXA 2MA1A 1OUQA 3BQTA 5HNKA 1Z4OA 3Q8QB 5JU5A 1ED1A 4PHPA 3ORYA 3LWLA 5AK3A 4Q43A 4NY8A 3ISCA 2F1JA 3N7SC 1VLBA 2QARA 1YT3A 3Q8RB 9ICCA 5AIAA 4PGXA 8ICXA 4PH5A 3OHAA 3S6JA 2J6UA 1X42A 9ICXA 2K4PA 9ICUA 4X5VA 9ICWA 2PI5A 1AQ6A 2WHEA 5KG1A 9ICIA 4QZEA 5J8YC 5EWFA 3MABA 4IR9A 4YR2A 4O5CA 2BPCA 2HVHA 3FAHA 2FMSA 2EAOA 5T14A 2RDJA 2MUTA 5ALIA 1BNOA 3BZKA 2ZXIA 5H2FU 3ZDAA 8ICHA 5KT7A 4LZGA 2A1AA 4J9NA 4YP3A 2E8PA 3TFRA 1C20A 2R8GA 4ECVA 1U47A 4GXJA 5DB9A 4EELA 5D4BA 3BS7A 4ECUA 3N28A 3H8MA 1DGSA 1WWVA 3RRGA 2QKQA 3Q8PB 4R63A 2HBJA 1XO1A 3ZI4A 3PV8A 2UVWA 2B6GA 4ECQA 5HR6A 1SKSA 2HHQA 1B22A 4RUCA 3GZFA 3OGUA 7ICFA 2EH9A 3AU2A 9ICSA 4R8UA 2XVTA 4NXZA 1J2NA 2XI9A 1SV0C 1UA0A 5CJ7A 3ED5A 5BPCA 4CF5A 1V9PA 5ALUA 3GIIA 2BQUA 4BDPA 3OSNA 4YCXA 3WK4A 4Q8FA 5TISU 1XNSA 2LBOA 3RR8A 2W03A 3GFKB 2QB0B 2ZIVA 5AI0A 4OJ5A 9ICFA 1N62A 4CF3A 5AI4A 4F5NA 5AKGA 2CN1A 2ODGA 2ZIUB 2KOBA 2W11A 2LYBA 2XGQA 4F3OA 4EX6A 2BHNA 5KAFU 3TADA 2H3IA 4Y2RA 3WKDA 2D6FC 4UB2A 1EXNA 3PSPA 9ICLA 1N61A 2K4HA 1ZQZA 4C7YA 1SZPA 4QW8A 4Y2YA 2ZUCA 2EANA 2JR5A 2BDUA 5AKEA 1QQ7A 5AK6A 3BJYA 5ALGA 1DOQA 5J2AA 2IHMA 2ZIWA 2YX8A 1MQ3A 4DQRA 5K4LA 5J0YA 1ZQKA 2ZTCA 4LZDA 1ZRMA 1MC8A 3PMNA 3PO4A 4CCHA 3QXGA 4JB3A 2KE7A 2YB1A 5DBBA 4NL9C 1JXLA 3K1ZA 7ICLA 1PVRA 1ZQBA 2CRXA 4C7ZA 2ES6A 2F3NA 2HBKA 2KHQA 2QARB 4QJFB 9ICKA 2ZUBA 4KLEA 2K60A 2W9MA 4QWAA 4C4SA 2NRZA 4B9LA 4I2JA 3UQ0A 1WCNA 4ECRA 2YY6A 4UB1A 5DDMA 3K75D 5KT3A 1SXDA 4DOCA 4YD1A 2F76X 7ICGA 2AGQA 4B9MA 2KZ3A 3C2KA 5AI6A 3NVYA 2H3QA 1F44A 2DF4B 5AM1A 2E1FA 2KNJA 3PMLA 8ICGA 2XCAA 1A76A 1QSYA 1QSLA 3KZIU 4Y2PA 5J2BA 2Q4TA 5C0YA 5KFIA 4US9A 4P0QA 5J2CA 3JPOA 2K8BB 3NVVA 5IINA 9ICRA 2I5HA 4B9NA 4JWNA 5ALEA 4JK1A 4KX5A 4RPXA 4DS4A 1RZTA 3PSIA 2DPIA 2BQ3A 2JZBA 4P4MA 1ZQHA 1XS9D 7ICOA 4J03A 1QQ6A 1L7PA 3AMZA 3F53A 5G5HA 5KFUA 4Q8EA 3F2CA 1U49A 4J9RA 2JEFA 3WK5A 4RT3A 5KG7A 2FMPA 1ECWA 4RQ3A 5J2FA 5JRTA 1COKA 1D9FA 1Y88A 4RNMA 2PFNA 4NLZA 2DGZA 4RQNA 2LKYA 3ZD9A 4DF4A 3C1YA 3GV8B 4IC9A 2HHUA 3F5AA 3M7DA 5IIOA 4IRCA 7ICUA 2WTFA 4CE6A 2KIVA 4KLOA 2VA8A 1DRGA 1KDHA 3NASA 3BS5A 1ZYQA 4TUPA 4R8UB 8ICPA 3RJIA 5KL8B 3RH5A 4DSJA 4FE3A 3JPRA 4C8MA 2LHTA 1J2MA 5CRXA 2Z7JA 1QSSA 4FS1A 1NK7A 4KLFA 3NS1A 1NKCA 5EE0A 2C22A 1TFRA 2AU0A 4RQ4A 1IXRA 2ZTDA 2PFPA 5IIKA 5AK5A 1UQVA 4TUSA 1SGGA 2HBMA 2JEGA 3CNHA 3K4GA 3MR2A 3LK9A 2KTQA 3LVWA 3SEIA 1LKYA 5HMMA 4O3QA 1PZNA 1RM6C 2N1RA 2WF6A 5ALQA 3AQEA 4MHVA 2AGPA 1ZQXA 5A0LA 4EEKA 2HHVA 4KMUA 5HP4A 2MU2A 1NNLA 1GO3F 4EEYA 1MQ2A 2ZIWB 2BR0A 1YZ6A 5KG6A 5J0PA 3QE9Y 3PY8A 4NLBA 1L8LA 3JPTA 1ZQGA 4OD0A 4MF2A 5JUMA 1ZETA 3RR7A 4Z6FA 5CHGA 2IOFK 4DSKA 2WF5A 1TKDA 1JN3A 4F4XA 5DG7A 4DEZA 1KFDA 5ALXA 5AM0A 4CGZA 1T3NA 3FYHA 2W54A 1L5UA 4FBUA 1BPEA 5KAIU 3VCBA 2K8AA 5KFGA 4YMMA 2LM4A 2FMQA 2KVCA 5KT2A 4CDGA 2ASDA 4B9TA 8ICSA 2W9BA 7ICRA 2FLNA 1ZD3A 2AH5A 4XUSA 2GWSA 2NO5A 1HEKA 2D3DA 8ICAA 5J0OA 1KTQA 4CRXA 4QZFA 7ICHA 2DQNB 2BZFA 1S77D 4UQGA 5B66U 3TANA 3HX0A 5DQHA 3PW0A 5HHHA 5KFMA 4P0QB 4UAZA 3WU2U 1ZXIA 4Y2UA 4KLJA 5AKZA 3WKEA 4F71A 4F8RA 4UB4A 2JZBB 5J2GA 1XO0A 5KFZA 3A0BU 1J97A 4GLXA 4US8A 3MGIA 4DL2A 1TAQA 4I2GA 2YMPA 4P0PA 4KLTA 2FPLA 3EPGA 2I1QA 1A6SA 5J0SA 2VJ5A 2DPJA 3NTUA 1U45A 4QZBA 4J9OA 4DL3A 5KFBA 3RBDA 4BWMA 1ZQEA 4YXJA 9ICQA 4AP9A 3B0XA 3HJEA 2QLTA 5ALKA 3KFUF 4QZHA 3QEAZ 9ICEA 2EQYA 3BS5B 1BVSA 2KD1A 1S0MA 8ICWA 1F5SA 9ICPA 4UB5A 3SD7A 2BDPA 2HOQA 4C0ZA 4DQSA 3M1YA 2E8MA 2OH2A 3V7KA 2G5IB 1N63A 5ALOA 1Z1BA 3SZ2A 2LMRA 1NKBA 2I6XA 4PJ0U 5HHIA 4EYIB 5EE9A 2V4QA 5EE3A 4DS5A 1B0XA 3BDPA 5DDYA 3WK7A 3QU7A 3Q8LA 3ISDA 1SWWA 3SYZA 1X9MA 3H8JA 4U7CA 5CWRA 3KHHA 1COOA 1K5OA 3M6KA 4M9LA 4F93B 3D2NA 4Q44A 2G5HB 3M8RA 4I27A 5KFXA 2EZZA 3UXOA 5KFDA 4JV2A 3B0YA 1C7YA 1LKYB 3SAFA 4F2SA 2YN4A 3SENA 4J9QA 1P7DA 5KFYA 5AKIA 4QZCA 4F5OA 1LV5A 3PSTA 1O03A 2R8KA 4BJQA 5JTIA 4RUAA 2XY7A 1KW4A 5KFQA 3OTQA 3H7IA 2HHXA 3IRUA 3HP6A 4FZLA 3KKAA 4YR3A 2HMXA 4QW9A 2JRZA 2JEJA 4KLGA 2FDRA 3V6JA 3UM9A 2FE9A 4ECSA 2YMLA 1Z4NA 4XRHA 1HUOA 3M9NB 2WB1F 5AKHA 3EW9A 1O08A 5ALLA 1TV9A 5DLFA 1ZD2P 5DG8A 1ZD4A 2EDUA 2RDIA 5ALDA 2F77X 4ECWA 8ICYA 4YVZA 2W7PA 3RJHA 4MFCA 3AU6A 4IQWA 3RH6A 2EZXA 1SKWA 1UT5A 5AI9A 2W9BB 5ALJA 3FM9A 3RB6A 1NZBA 7ICQA 4NLKA 1ZJMA 3WKBA 3UPQA 9ICMA 5DBCA 2PMZF 4G9BA 1QQ5A 4YR0A 1RYRA 1TAUA 5C5JA 3HKZF 1HJPA 3IDWA 2JEIA 1WG8A 3SQIA 1FEZA 2KJ5A 4KLUA 1WCLA 1FIQA 2UVRA 3BQ0A 2B0CA 2G08A 4DFKA 1TK0A 2R18A 9ICNA 4O9MA 3QUCA 5CEHA 3L4PA 1RXWA 2R8IA 2A1JA 8ICVA 4ECTA 2I9GA 2VIXA 1LB2B 3QEBZ 3PX0A 3MC1A 2KSOA 1N2XA 4NWIA 2Y0SF 4GXKA 3HPOA 5KFWA 3WK9A 4O5KA 3PNCA 3KHLA 4P0PB 5KFHA 2KICA 4KX3A 5ALZA 1JRPA 2W8LA 2E8OA 1X9SA 2BCSA 1N48A 4Y2JA 3C2LA 4DL6A 4ACOA 4J9MA 1NJYA 2M0NA 3I28A 2W55A 1JI7A 3MGVA 1FFUA 3V7LA 1ZJNA 4Y2QA 2UVVA 4YD2A 4K4HA 3E0FA 4B9VA 2C2EA 1U9LA 1PUZA 2DFLA 3IN5A 1BGXT 2FLLA 1NJXA 1NI3A 3JPPA 1IV8A 1ZQVA 1RQLA 3T5KA 2IOHA 4CF4A 4F5QA 4DQQA 3PX4A 2XICA 4Z6DA 5AI5A 4R65A 1ZQJA 2AHOB 7ICTA 1RG6A 5DGAA 8ICNA 4M47A 5KFRA 3PZPA 4QZ9A 4C4TA 4RPYA 4O3SA 2FI1A 1DGJA 1KKXA 5J2JA 4C8OA 3I76A 1X9XA 2DWQA 1N56A 1L3VA 3UMBA 4GC6A 7ICNA 1V97A 2KN7A 5KT6A 4KLMA 4ECYA 4MFAA 1IG6A 1A0PA 4QZGA 5IIIA 1SL2A 3T5LA 5AM5A 4IRKA 2W9AA 2ZXHA 1SZHA 3MR5A 2YQEA 2NRTA 1OXJA 2NRVA 3KD3A 4ED0A 3TAQA 5BOLA 2F8KA 1TK5A 1L7MA 4JUZA 1K1QA 2O6KA 4C4RA 1AROP 8ICBA 1U48A 4I2EA 4I2FA 4Y2SA 1ZQQA 3RJJA 2ESEA 4RQ5A 3A0HU 3GV7B 4QWCA 4JV0A 4RQ1A 2XY6A 1M6YA 3QUBA 4DFPA 1XSNA 3V6HA 1KEJA 4Y2VA 8ICMA 5HMLA 2PXIA 2AGOA 3AN1A 4OO1J
chains in the Genus database with same CATH topology
2B6GA 2DKZA 2KIVA 4RQMA 1SV4A 2GLEA 2JV3A 2KE7A 3BS5B 4NL9C 2Y9UA 2YTUA 3BS5A 2DKXA 5JU5A 3TACB 1Z1VA 2E8MA 4IS7A 5KNIA 2F44A 2ES6A 2F3NA 2Y9TA 2LMRA 1SV0C 2QARB 2K60A 2QARA 1V38A 2KG5A 4NL9A 2D8CA 1SXDA 1RG6A 1B0XA 2D3DA 2K4PA 3BQ7A 5L1MA 1SV0A 2E8NA 1V85A 2QB0B 3IDWA 1X40A 1DXSA 1X66A 2QB0A 3TADC 1X9XA 5J8YC 1UQVA 2LPEA 1SGGA 2QB1A 1LKYB 3SEIA 1LKYA 3SENA 2EAOA 3KKAC 2EAPA 4MHVA 2KSOB 1PK1B 3TADA 1PK3A 5JTIA 1B4FA 2KSOA 1PK1A 1OXJA 5J8YA 1F0MA 2F8KA 1KW4A 2L5YA 3HILA 2E8PA 2EANA 1UCVA 1WWUA 3KKAA 2E8OA 4PZOA 2ESEA 4NJ8A 2EAMA 2DL0A 2KMDA 1SXEA 3BS7A 5JRTA 1COKA 3H8MA 1WWVA 2FE9A 3K1RB 5F3XB 4RQNA 2QKQA 1OW5A 4PZNA 1JI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B6G A;  2DKZ A;  2KIV A;  4RQM A;  1SV4 A;  2GLE A;  2JV3 A;  2KE7 A;  3BS5 B;  4NL9 C;  2Y9U A;  2YTU A;  3BS5 A;  2DKX A;  5JU5 A;  3TAC B;  1Z1V A;  2E8M A;  4IS7 A;  5KNI A;  2F44 A;  2ES6 A;  2F3N A;  2Y9T A;  2LMR A;  1SV0 C;  2QAR B;  2K60 A;  2QAR A;  1V38 A;  2KG5 A;  4NL9 A;  2D8C A;  1SXD A;  1RG6 A;  1B0X A;  2D3D A;  2K4P A;  3BQ7 A;  5L1M A;  1SV0 A;  2E8N A;  1V85 A;  2QB0 B;  3IDW A;  1X40 A;  1DXS A;  1X66 A;  2QB0 A;  3TAD C;  1X9X A;  5J8Y C;  1UQV A;  2LPE A;  1SGG A;  2QB1 A;  1LKY B;  3SEI A;  1LKY A;  3SEN A;  2EAO A;  3KKA C;  2EAP A;  4MHV A;  2KSO B;  1PK1 B;  3TAD A;  1PK3 A;  5JTI A;  1B4F A;  2KSO A;  1PK1 A;  1OXJ A;  5J8Y A;  1F0M A;  2F8K A;  1KW4 A;  2L5Y A;  3HIL A;  2E8P A;  2EAN A;  1UCV A;  1WWU A;  3KKA A;  2E8O A;  4PZO A;  2ESE A;  4NJ8 A;  2EAM A;  2DL0 A;  2KMD A;  1SXE A;  3BS7 A;  5JRT A;  1COK A;  3H8M A;  1WWV A;  2FE9 A;  3K1R B;  5F3X B;  4RQN A;  2QKQ A;  1OW5 A;  4PZN A;  1JI7 A; 
#chains in the Genus database with same CATH topology
 2RQ5 A;  9ICA A;  1S0V A;  3NVW A;  2YMM A;  3ETL A;  1L3U A;  3C5F A;  2HOF A;  2NV3 A;  2ASL A;  2NYV A;  2ZJA A;  4O3P A;  9ICO A;  3PW5 A;  2BCU A;  3C23 A;  4DFJ A;  4UAV A;  5CR0 A;  4RU9 A;  5KG4 A;  2KG5 A;  4DSI A;  1HIW A;  1RYU A;  4OJL A;  2WF7 A;  2JHD A;  3QU2 A;  1T7P A;  3GQC A;  5L1J A;  3EPI A;  1NK9 A;  4RNO A;  2WF8 A;  2JGA A;  2V4R A;  3TAD C;  4O3N A;  4F72 A;  3CYM A;  1RYS A;  3NRW A;  4IR1 A;  3GIM A;  1K1S A;  2W9C A;  2A1J B;  3GU3 A;  3KHR A;  1KFT A;  3BQ2 A;  1N5W A;  5FP0 A;  2KSO B;  1PK3 A;  1X2I A;  2OM6 A;  2HBL A;  1F0M A;  2Y1J A;  3RAQ A;  2EZY A;  3NUQ A;  4FZN A;  5AK4 A;  1H38 A;  4QIW F;  4XA5 A;  2BPG A;  1HUZ A;  1KL9 A;  5L1K A;  1TAM A;  1Z19 A;  7ICV A;  4NLG A;  1L8O A;  4ICA A;  2KJ8 A;  3LVV A;  5KFE A;  1KN5 A;  2W04 A;  2AQ4 A;  5KFK A;  1DK3 A;  5J0X A;  9ICG A;  5KG2 A;  3Q8K A;  4OJ6 A;  4M6W A;  5KFA A;  4RZR A;  2GLE A;  3SI8 A;  5KG3 A;  2CPR A;  4O0I A;  4DQI A;  3VC8 A;  2OEH A;  5EWG A;  3RB3 A;  4IRD A;  4UBB A;  4DL4 A;  3JPS A;  3G6X A;  4EZ6 A;  2W3R A;  1ZQD A;  4YMO A;  1ZQA A;  5EOZ A;  3R9K A;  3WK6 A;  2R8H A;  2PFQ A;  1V38 A;  1ZQL A;  4OJP A;  4TUQ A;  1NKE A;  4USA A;  4UAT A;  3OJS A;  1JX4 A;  3OJU A;  3BZC A;  2DBY A;  4C8L A;  3PX6 A;  2ZIX A;  3SMV A;  3GIK A;  1SL0 A;  4KIT B;  4EBC A;  2HCF A;  4MF8 A;  2OHF A;  4LVS A;  1X6J A;  1SWV A;  4I2D A;  7ICI A;  1VDV A;  2WAQ F;  5D46 A;  2XGP A;  4UAU A;  2QB1 A;  4UAY A;  2RHF A;  8ICR A;  3ONN A;  2NRW A;  4B9S A;  4M2Y A;  2PFO A;  1D9D A;  4RQ2 A;  3E58 A;  1KSP A;  2VJ4 A;  2VA2 A;  1S5L U;  1KFS A;  1ZQI A;  5J8Y A;  3NGD A;  4NLN A;  1TE2 A;  4F50 A;  3TKA A;  3ISB A;  3H0L B;  4O3M A;  3EUB 2;  3OSP A;  1QLN A;  3U26 A;  5KT4 A;  3C21 A;  5J29 A;  4QWD A;  1QTM A;  3HWT A;  2IA6 A;  2F8L A;  1ZQF A;  5J0U A;  2HHS A;  2RP5 A;  2P35 A;  4DL5 A;  5HR7 A;  8ICU A;  3V6K A;  3RAX A;  3T5H A;  5AM3 A;  4HAI A;  5AI8 A;  4B9U A;  5AIC A;  2VA3 A;  5KT5 A;  2YTU A;  2ATL A;  5L1I A;  1S76 D;  2W8K A;  4DSF A;  4EZ9 A;  4CNQ A;  2FJ6 A;  7ICK A;  1UA1 A;  5IIL A;  4KMO B;  4DLE A;  5KFC A;  2Y9T A;  2KZZ A;  4KLD A;  4E0D A;  1A77 A;  1WYG A;  3TFS A;  2KEY A;  4A8E A;  3UMC A;  4EX7 A;  4IQV A;  2D8C A;  2JXJ A;  4RQ6 A;  1NK5 A;  2KK0 A;  5EWE A;  9ICV A;  1ZQP A;  3JPQ A;  4F4Y A;  2ZJ5 A;  3N97 B;  1SV0 A;  8ICI A;  4BUG A;  8ICO A;  1NK8 A;  2WAQ C;  1RPL A;  3TAR A;  3C5G A;  2V9W A;  4M9J A;  1JXE A;  4YMN A;  3LYS A;  4F91 B;  4F5P A;  4DO9 A;  2HDO A;  2W9C B;  4ECX A;  3KHG A;  3WKA A;  3T79 A;  4F5R A;  3Q8S B;  2BGW A;  2EAP A;  1L7O A;  4OJO A;  2E3T A;  5ALY A;  3BQ1 A;  4F4Z A;  5AM2 A;  2NRX A;  5J2K A;  4UW9 A;  3DDH A;  1VJ5 A;  2LYA A;  3F5E A;  2MAX A;  1JUD A;  4QZI A;  1ZQS A;  3TAP A;  2L5Y A;  3H40 A;  4MFF A;  1T3Q A;  5KL1 B;  3RFA A;  5DKW A;  3QX7 A;  5ALS A;  3SV3 A;  2MRL A;  1QH9 A;  5ALW A;  5DB8 A;  1SKR A;  2FLP A;  1SXE A;  4KLH A;  3WK8 A;  1UPH A;  3JPN A;  1ZQO A;  5J2E A;  3CP8 A;  4FO6 A;  4NLC A;  3KBB A;  1BPZ A;  5J2I A;  2DKZ A;  4M6W B;  1ZQC A;  3V72 A;  4AYB F;  4RQM A;  8ICL A;  4GC7 A;  1KBU A;  3UMG A;  4HYK A;  2KJ9 A;  2F1I A;  3H0R B;  2C2D A;  2J6T A;  3H4B A;  4KLQ A;  4UAS A;  4QZA A;  1CRX A;  1S10 A;  4K4I A;  1ZQM A;  2WF9 A;  1X9W A;  2G07 A;  2ZTE A;  4ELT A;  3C2M A;  4ECZ A;  3QU5 A;  3RH4 A;  5AKL A;  1Z00 A;  4NL9 A;  1SB3 C;  4PPX A;  2KHV A;  3BQ7 A;  3UXN A;  2G0A A;  4ED8 A;  4DCC A;  2MSN A;  2ZIX B;  4F2R A;  2F1H A;  4GFJ A;  4EBE A;  1X40 A;  4I29 A;  1DXS A;  3UXP A;  3SAG A;  4NM1 A;  5DLG A;  3M8S A;  2H5X A;  3Q8M A;  4WJ3 B;  3D2Q A;  1UT8 A;  2G06 A;  3HRD D;  2B21 A;  4M9N A;  2KFZ A;  3D2S A;  1CI4 A;  4YXM A;  1Q3V A;  4PGY A;  5F9N A;  5F9L A;  3LDA A;  1T4G A;  1DK2 A;  3CRX A;  4QWB A;  5KFJ A;  3RB4 A;  2VAN A;  4UB8 U;  2AQ0 A;  3RJG A;  2HVI A;  4BGD A;  1WWU A;  3ZDE A;  4BXO A;  3QYP A;  1ZRN A;  4QNL A;  3IP4 B;  4MEX A;  4DOB A;  4F4K A;  2KMD A;  4M9G A;  2E1E A;  2OYY A;  3L3F X;  1Q8K A;  2GOL A;  5AKK A;  3QU9 A;  2VKQ A;  3AM9 A;  1ZOL A;  4PZN A;  1ZQN A;  2XCP A;  2FPK A;  2IOF A;  3EYZ A;  1QCK A;  2IBK A;  4AYB C;  1N5X A;  2K8C B;  3CW2 C;  4O5E A;  1NOM A;  5KFL A;  2LYH A;  2FPM A;  4UB3 A;  7ICS A;  3ETR A;  3AQF A;  2XID A;  3FC4 A;  5J0Q A;  5G5G A;  3HW8 A;  1URJ A;  2WB1 C;  1BPD A;  4K4G A;  1MSW D;  1UHU A;  1NK6 A;  4O3R A;  1XSL A;  5IIJ A;  5AKY A;  2OWO A;  4J9L A;  3T5J A;  1BNP A;  3C1Z A;  4NV0 A;  1JIH A;  4QZD A;  3GV5 B;  1YZ7 A;  1V85 A;  2UVU A;  4KLL A;  2HHW A;  5KFT A;  4DSE A;  3SR6 A;  4EEN A;  3ZD8 A;  2HHT A;  4RNN A;  2JH1 A;  2KKV A;  4UAR A;  2LI6 A;  4UB6 U;  5DG9 A;  2K4I A;  4YQW A;  3QZ8 A;  1ZQT A;  2PMZ C;  4RPZ A;  3RJE A;  4KTQ A;  3KKA C;  2G09 A;  4YG2 A;  9ICJ A;  4ED6 A;  2BKE A;  2HI0 A;  3MGH A;  4I2C A;  1MN8 A;  3HKZ C;  3O0F A;  3QZ7 A;  4I2H A;  1PK1 A;  2OCE A;  2NO4 A;  3IM1 A;  1RQN A;  3PO5 A;  1X6I A;  4J9P A;  4DF8 A;  4PGQ A;  4ELU A;  4F92 B;  3DEE A;  5IIM A;  1KRP A;  2W7O A;  5CB1 A;  2IHN A;  4J9K A;  2BCV A;  5AKJ A;  4NJ8 A;  3MBY A;  1ZQY A;  2LM1 A;  5J0T A;  2EAM A;  3V7J A;  3M6Z A;  3N7R C;  5KFO A;  2Y0S C;  5DQI A;  1TK8 A;  8ICK A;  1OW5 A;  1XWL A;  4FFD A;  8ICJ A;  2HSZ A;  4I2B A;  4C80 A;  2ALZ A;  3KOO A;  3H4D A;  2AJQ A;  4RQ7 A;  4P4O A;  1RDF A;  2JV3 A;  4P2H A;  4PL1 A;  4I28 A;  5ALT A;  5KG0 A;  3G6V A;  8ICF A;  4TQR A;  2KFN A;  3UQ2 A;  2GO7 A;  3E2E A;  2F44 A;  4DSL A;  4ED2 A;  3DV9 A;  3RRH A;  4C8N A;  2HOI A;  2BCQ A;  1Z00 B;  1LVH A;  4DFM A;  2WFA A;  4JV1 A;  7ICM A;  2RLT A;  7ICJ A;  4I2I A;  3IHQ B;  2PI4 A;  1S97 A;  3ICX A;  2KVS A;  2MUT B;  5L1M A;  2AXT U;  4G3I A;  5J0R A;  2E8N A;  1ZQW A;  1Q3U A;  1S0N A;  2XC9 A;  3RF9 A;  4YN4 A;  4PL2 A;  3RJK A;  4NM2 A;  1BPB A;  3ZDB A;  5KG5 A;  5GTI U;  4UAW A;  3WKC A;  3KZX A;  4QWE A;  2P66 A;  2ISO A;  4KLI A;  4GIB A;  5L9X A;  4DWI A;  1WUD A;  2XO7 A;  1NJZ A;  4YFK A;  9ICH A;  2KP7 A;  3PSF A;  2RRD A;  1TVA A;  9ICB A;  2F2A B;  4DOA A;  2R8J A;  1NZP A;  3IV6 A;  1KLN A;  4M0A A;  3MR3 A;  4KN7 A;  1XC9 A;  5KFN A;  4OCZ A;  3PR4 A;  1UCV A;  4BXO B;  3FDS A;  4PHE A;  1CEZ A;  1IM4 A;  3H0M B;  2DUY A;  2ISP A;  7ICP A;  1PVQ A;  4DL7 A;  3GDX A;  1NK4 A;  2J6S A;  3K1R B;  3QUT A;  3G6Y A;  2BPF A;  4FBT A;  2XY5 A;  3ZDC A;  2W3S A;  5ALP A;  4TUR A;  4FZM A;  2Q0Z X;  5J2H A;  3MFI A;  1SV4 A;  5DBA A;  2Y9U A;  2BQR A;  2DKX A;  3PR5 B;  3LWM A;  2C2R A;  3TAC B;  4ED3 A;  1ZQU A;  4IL6 U;  4IS7 A;  2A19 A;  2ZIV B;  4M04 A;  4TQS A;  9ICT A;  2K89 A;  4Q45 A;  4RT2 A;  3F2B A;  3ALR A;  1D8L A;  1S8O A;  2YMQ A;  3AEV A;  2M9N A;  2KIW A;  4C8K A;  3H8S A;  2KV2 A;  3GIL A;  2KKP A;  4Y2X A;  4ELV A;  1Z3E B;  3QU4 A;  3MDA A;  5AM4 A;  5DB7 A;  1D8B A;  2C28 A;  2GH1 A;  5DB6 A;  4DLG A;  5J2D A;  4RQ0 A;  2K4E A;  1N60 A;  4F4W A;  1CUK A;  2LPE A;  4PHA A;  1SL1 A;  3T3F A;  4ED7 A;  5D49 A;  1KQQ A;  3M9M B;  3SAH A;  1U4B A;  4U6P A;  8ICQ A;  4QZ8 A;  5CP2 A;  3TI0 A;  3AUO A;  4DFD A;  5AHX A;  5ALV A;  5KFV A;  5B5E U;  1PK1 B;  1B4F A;  3EWA A;  2ASJ A;  3EZ5 A;  3MFH A;  2Y1I A;  2H3F A;  5ALN A;  2P6U A;  3HIL A;  4KLS A;  3IG8 A;  1NJW A;  3H8W A;  4BWJ A;  1S0O A;  1XSP A;  5TZV A;  3RJF A;  1JMS A;  4EBD A;  5CA7 A;  3IG5 A;  4JMU A;  5GTH U;  1L6N A;  4P4P A;  2E5S A;  3I1Y A;  3GIJ A;  3N7P D;  3C29 A;  4Y2T A;  4R66 A;  1D8Y A;  2YB4 A;  4QIW C;  1RXV A;  1JRO A;  1L3T A;  5ALH A;  1Q46 A;  5KFS A;  8ICE A;  5J0W A;  2JMG A;  1Z1V A;  1B43 A;  5BOM A;  5AIB A;  3L5K A;  4I2A A;  4Z6C A;  5KNI A;  1FO4 A;  5L1L A;  1BPX A;  2A3V A;  5ALF A;  8ICT A;  3RB0 A;  1PVP A;  1S9F A;  4B6J A;  5EE1 A;  5KTQ A;  7ICE A;  3THV A;  1NK0 A;  3ZDD A;  5KFF A;  4JWM A;  1SIJ A;  3F2D A;  3PW7 A;  1ZQR A;  3OPX A;  3PW2 A;  5E79 U;  3SV4 A;  3NVZ A;  8ICZ A;  3NRZ A;  1T94 A;  4LJX A;  4UBC A;  8ICC A;  1X66 A;  2QB0 A;  1BPY A;  4R64 A;  1L3S A;  2ZG6 A;  2H3V A;  2OXO A;  1IIP A;  3N4M B;  4IQU A;  2P6R A;  5KFP A;  2KZM A;  2ZIU A;  3MR6 A;  3C28 A;  2CXY A;  2H3Z A;  3QUQ A;  3RTV A;  4BX9 C;  4IQT A;  2PKE A;  3QNM A;  5DQG A;  3B9J A;  2BCR A;  5DGB A;  3D6J A;  4J9S A;  4RQ8 A;  4DQP A;  4PHD A;  4ED1 A;  4O3O A;  3KTQ A;  3AL0 B;  1ZQ1 C;  4XQ8 A;  4MEY A;  4Z6E A;  4ZH4 A;  3HT3 A;  2ZUD A;  3PVX A;  2IMW P;  2JH7 A;  2W43 A;  5ALR A;  3J81 j;  3OHB A;  3MDC A;  1T8E A;  4PZO A;  4GXI A;  3PW4 A;  2DL0 A;  1XU4 A;  3RBE A;  4EYH B;  1MA7 A;  3M9O B;  1FFV A;  1L7N A;  1ZD5 A;  5F3X B;  4M9H A;  2ZJ8 A;  3TQ1 A;  4ZOH C;  4KN4 A;  2HW3 A;  1JAL A;  5ALM A;  4FS2 A;  5AKX A;  2MA1 A;  1OUQ A;  3BQT A;  5HNK A;  1Z4O A;  3Q8Q B;  5JU5 A;  1ED1 A;  4PHP A;  3ORY A;  3LWL A;  5AK3 A;  4Q43 A;  4NY8 A;  3ISC A;  2F1J A;  3N7S C;  1VLB A;  2QAR A;  1YT3 A;  3Q8R B;  9ICC A;  5AIA A;  4PGX A;  8ICX A;  4PH5 A;  3OHA A;  3S6J A;  2J6U A;  1X42 A;  9ICX A;  2K4P A;  9ICU A;  4X5V A;  9ICW A;  2PI5 A;  1AQ6 A;  2WHE A;  5KG1 A;  9ICI A;  4QZE A;  5J8Y C;  5EWF A;  3MAB A;  4IR9 A;  4YR2 A;  4O5C A;  2BPC A;  2HVH A;  3FAH A;  2FMS A;  2EAO A;  5T14 A;  2RDJ A;  2MUT A;  5ALI A;  1BNO A;  3BZK A;  2ZXI A;  5H2F U;  3ZDA A;  8ICH A;  5KT7 A;  4LZG A;  2A1A A;  4J9N A;  4YP3 A;  2E8P A;  3TFR A;  1C20 A;  2R8G A;  4ECV A;  1U47 A;  4GXJ A;  5DB9 A;  4EEL A;  5D4B A;  3BS7 A;  4ECU A;  3N28 A;  3H8M A;  1DGS A;  1WWV A;  3RRG A;  2QKQ A;  3Q8P B;  4R63 A;  2HBJ A;  1XO1 A;  3ZI4 A;  3PV8 A;  2UVW A;  2B6G A;  4ECQ A;  5HR6 A;  1SKS A;  2HHQ A;  1B22 A;  4RUC A;  3GZF A;  3OGU A;  7ICF A;  2EH9 A;  3AU2 A;  9ICS A;  4R8U A;  2XVT A;  4NXZ A;  1J2N A;  2XI9 A;  1SV0 C;  1UA0 A;  5CJ7 A;  3ED5 A;  5BPC A;  4CF5 A;  1V9P A;  5ALU A;  3GII A;  2BQU A;  4BDP A;  3OSN A;  4YCX A;  3WK4 A;  4Q8F A;  5TIS U;  1XNS A;  2LBO A;  3RR8 A;  2W03 A;  3GFK B;  2QB0 B;  2ZIV A;  5AI0 A;  4OJ5 A;  9ICF A;  1N62 A;  4CF3 A;  5AI4 A;  4F5N A;  5AKG A;  2CN1 A;  2ODG A;  2ZIU B;  2KOB A;  2W11 A;  2LYB A;  2XGQ A;  4F3O A;  4EX6 A;  2BHN A;  5KAF U;  3TAD A;  2H3I A;  4Y2R A;  3WKD A;  2D6F C;  4UB2 A;  1EXN A;  3PSP A;  9ICL A;  1N61 A;  2K4H A;  1ZQZ A;  4C7Y A;  1SZP A;  4QW8 A;  4Y2Y A;  2ZUC A;  2EAN A;  2JR5 A;  2BDU A;  5AKE A;  1QQ7 A;  5AK6 A;  3BJY A;  5ALG A;  1DOQ A;  5J2A A;  2IHM A;  2ZIW A;  2YX8 A;  1MQ3 A;  4DQR A;  5K4L A;  5J0Y A;  1ZQK A;  2ZTC A;  4LZD A;  1ZRM A;  1MC8 A;  3PMN A;  3PO4 A;  4CCH A;  3QXG A;  4JB3 A;  2KE7 A;  2YB1 A;  5DBB A;  4NL9 C;  1JXL A;  3K1Z A;  7ICL A;  1PVR A;  1ZQB A;  2CRX A;  4C7Z A;  2ES6 A;  2F3N A;  2HBK A;  2KHQ A;  2QAR B;  4QJF B;  9ICK A;  2ZUB A;  4KLE A;  2K60 A;  2W9M A;  4QWA A;  4C4S A;  2NRZ A;  4B9L A;  4I2J A;  3UQ0 A;  1WCN A;  4ECR A;  2YY6 A;  4UB1 A;  5DDM A;  3K75 D;  5KT3 A;  1SXD A;  4DOC A;  4YD1 A;  2F76 X;  7ICG A;  2AGQ A;  4B9M A;  2KZ3 A;  3C2K A;  5AI6 A;  3NVY A;  2H3Q A;  1F44 A;  2DF4 B;  5AM1 A;  2E1F A;  2KNJ A;  3PML A;  8ICG A;  2XCA A;  1A76 A;  1QSY A;  1QSL A;  3KZI U;  4Y2P A;  5J2B A;  2Q4T A;  5C0Y A;  5KFI A;  4US9 A;  4P0Q A;  5J2C A;  3JPO A;  2K8B B;  3NVV A;  5IIN A;  9ICR A;  2I5H A;  4B9N A;  4JWN A;  5ALE A;  4JK1 A;  4KX5 A;  4RPX A;  4DS4 A;  1RZT A;  3PSI A;  2DPI A;  2BQ3 A;  2JZB A;  4P4M A;  1ZQH A;  1XS9 D;  7ICO A;  4J03 A;  1QQ6 A;  1L7P A;  3AMZ A;  3F53 A;  5G5H A;  5KFU A;  4Q8E A;  3F2C A;  1U49 A;  4J9R A;  2JEF A;  3WK5 A;  4RT3 A;  5KG7 A;  2FMP A;  1ECW A;  4RQ3 A;  5J2F A;  5JRT A;  1COK A;  1D9F A;  1Y88 A;  4RNM A;  2PFN A;  4NLZ A;  2DGZ A;  4RQN A;  2LKY A;  3ZD9 A;  4DF4 A;  3C1Y A;  3GV8 B;  4IC9 A;  2HHU A;  3F5A A;  3M7D A;  5IIO A;  4IRC A;  7ICU A;  2WTF A;  4CE6 A;  2KIV A;  4KLO A;  2VA8 A;  1DRG A;  1KDH A;  3NAS A;  3BS5 A;  1ZYQ A;  4TUP A;  4R8U B;  8ICP A;  3RJI A;  5KL8 B;  3RH5 A;  4DSJ A;  4FE3 A;  3JPR A;  4C8M A;  2LHT A;  1J2M A;  5CRX A;  2Z7J A;  1QSS A;  4FS1 A;  1NK7 A;  4KLF A;  3NS1 A;  1NKC A;  5EE0 A;  2C22 A;  1TFR A;  2AU0 A;  4RQ4 A;  1IXR A;  2ZTD A;  2PFP A;  5IIK A;  5AK5 A;  1UQV A;  4TUS A;  1SGG A;  2HBM A;  2JEG A;  3CNH A;  3K4G A;  3MR2 A;  3LK9 A;  2KTQ A;  3LVW A;  3SEI A;  1LKY A;  5HMM A;  4O3Q A;  1PZN A;  1RM6 C;  2N1R A;  2WF6 A;  5ALQ A;  3AQE A;  4MHV A;  2AGP A;  1ZQX A;  5A0L A;  4EEK A;  2HHV A;  4KMU A;  5HP4 A;  2MU2 A;  1NNL A;  1GO3 F;  4EEY A;  1MQ2 A;  2ZIW B;  2BR0 A;  1YZ6 A;  5KG6 A;  5J0P A;  3QE9 Y;  3PY8 A;  4NLB A;  1L8L A;  3JPT A;  1ZQG A;  4OD0 A;  4MF2 A;  5JUM A;  1ZET A;  3RR7 A;  4Z6F A;  5CHG A;  2IOF K;  4DSK A;  2WF5 A;  1TKD A;  1JN3 A;  4F4X A;  5DG7 A;  4DEZ A;  1KFD A;  5ALX A;  5AM0 A;  4CGZ A;  1T3N A;  3FYH A;  2W54 A;  1L5U A;  4FBU A;  1BPE A;  5KAI U;  3VCB A;  2K8A A;  5KFG A;  4YMM A;  2LM4 A;  2FMQ A;  2KVC A;  5KT2 A;  4CDG A;  2ASD A;  4B9T A;  8ICS A;  2W9B A;  7ICR A;  2FLN A;  1ZD3 A;  2AH5 A;  4XUS A;  2GWS A;  2NO5 A;  1HEK A;  2D3D A;  8ICA A;  5J0O A;  1KTQ A;  4CRX A;  4QZF A;  7ICH A;  2DQN B;  2BZF A;  1S77 D;  4UQG A;  5B66 U;  3TAN A;  3HX0 A;  5DQH A;  3PW0 A;  5HHH A;  5KFM A;  4P0Q B;  4UAZ A;  3WU2 U;  1ZXI A;  4Y2U A;  4KLJ A;  5AKZ A;  3WKE A;  4F71 A;  4F8R A;  4UB4 A;  2JZB B;  5J2G A;  1XO0 A;  5KFZ A;  3A0B U;  1J97 A;  4GLX A;  4US8 A;  3MGI A;  4DL2 A;  1TAQ A;  4I2G A;  2YMP A;  4P0P A;  4KLT A;  2FPL A;  3EPG A;  2I1Q A;  1A6S A;  5J0S A;  2VJ5 A;  2DPJ A;  3NTU A;  1U45 A;  4QZB A;  4J9O A;  4DL3 A;  5KFB A;  3RBD A;  4BWM A;  1ZQE A;  4YXJ A;  9ICQ A;  4AP9 A;  3B0X A;  3HJE A;  2QLT A;  5ALK A;  3KFU F;  4QZH A;  3QEA Z;  9ICE A;  2EQY A;  3BS5 B;  1BVS A;  2KD1 A;  1S0M A;  8ICW A;  1F5S A;  9ICP A;  4UB5 A;  3SD7 A;  2BDP A;  2HOQ A;  4C0Z A;  4DQS A;  3M1Y A;  2E8M A;  2OH2 A;  3V7K A;  2G5I B;  1N63 A;  5ALO A;  1Z1B A;  3SZ2 A;  2LMR A;  1NKB A;  2I6X A;  4PJ0 U;  5HHI A;  4EYI B;  5EE9 A;  2V4Q A;  5EE3 A;  4DS5 A;  1B0X A;  3BDP A;  5DDY A;  3WK7 A;  3QU7 A;  3Q8L A;  3ISD A;  1SWW A;  3SYZ A;  1X9M A;  3H8J A;  4U7C A;  5CWR A;  3KHH A;  1COO A;  1K5O A;  3M6K A;  4M9L A;  4F93 B;  3D2N A;  4Q44 A;  2G5H B;  3M8R A;  4I27 A;  5KFX A;  2EZZ A;  3UXO A;  5KFD A;  4JV2 A;  3B0Y A;  1C7Y A;  1LKY B;  3SAF A;  4F2S A;  2YN4 A;  3SEN A;  4J9Q A;  1P7D A;  5KFY A;  5AKI A;  4QZC A;  4F5O A;  1LV5 A;  3PST A;  1O03 A;  2R8K A;  4BJQ A;  5JTI A;  4RUA A;  2XY7 A;  1KW4 A;  5KFQ A;  3OTQ A;  3H7I A;  2HHX A;  3IRU A;  3HP6 A;  4FZL A;  3KKA A;  4YR3 A;  2HMX A;  4QW9 A;  2JRZ A;  2JEJ A;  4KLG A;  2FDR A;  3V6J A;  3UM9 A;  2FE9 A;  4ECS A;  2YML A;  1Z4N A;  4XRH A;  1HUO A;  3M9N B;  2WB1 F;  5AKH A;  3EW9 A;  1O08 A;  5ALL A;  1TV9 A;  5DLF A;  1ZD2 P;  5DG8 A;  1ZD4 A;  2EDU A;  2RDI A;  5ALD A;  2F77 X;  4ECW A;  8ICY A;  4YVZ A;  2W7P A;  3RJH A;  4MFC A;  3AU6 A;  4IQW A;  3RH6 A;  2EZX A;  1SKW A;  1UT5 A;  5AI9 A;  2W9B B;  5ALJ A;  3FM9 A;  3RB6 A;  1NZB A;  7ICQ A;  4NLK A;  1ZJM A;  3WKB A;  3UPQ A;  9ICM A;  5DBC A;  2PMZ F;  4G9B A;  1QQ5 A;  4YR0 A;  1RYR A;  1TAU A;  5C5J A;  3HKZ F;  1HJP A;  3IDW A;  2JEI A;  1WG8 A;  3SQI A;  1FEZ A;  2KJ5 A;  4KLU A;  1WCL A;  1FIQ A;  2UVR A;  3BQ0 A;  2B0C A;  2G08 A;  4DFK A;  1TK0 A;  2R18 A;  9ICN A;  4O9M A;  3QUC A;  5CEH A;  3L4P A;  1RXW A;  2R8I A;  2A1J A;  8ICV A;  4ECT A;  2I9G A;  2VIX A;  1LB2 B;  3QEB Z;  3PX0 A;  3MC1 A;  2KSO A;  1N2X A;  4NWI A;  2Y0S F;  4GXK A;  3HPO A;  5KFW A;  3WK9 A;  4O5K A;  3PNC A;  3KHL A;  4P0P B;  5KFH A;  2KIC A;  4KX3 A;  5ALZ A;  1JRP A;  2W8L A;  2E8O A;  1X9S A;  2BCS A;  1N48 A;  4Y2J A;  3C2L A;  4DL6 A;  4ACO A;  4J9M A;  1NJY A;  2M0N A;  3I28 A;  2W55 A;  1JI7 A;  3MGV A;  1FFU A;  3V7L A;  1ZJN A;  4Y2Q A;  2UVV A;  4YD2 A;  4K4H A;  3E0F A;  4B9V A;  2C2E A;  1U9L A;  1PUZ A;  2DFL A;  3IN5 A;  1BGX T;  2FLL A;  1NJX A;  1NI3 A;  3JPP A;  1IV8 A;  1ZQV A;  1RQL A;  3T5K A;  2IOH A;  4CF4 A;  4F5Q A;  4DQQ A;  3PX4 A;  2XIC A;  4Z6D A;  5AI5 A;  4R65 A;  1ZQJ A;  2AHO B;  7ICT A;  1RG6 A;  5DGA A;  8ICN A;  4M47 A;  5KFR A;  3PZP A;  4QZ9 A;  4C4T A;  4RPY A;  4O3S A;  2FI1 A;  1DGJ A;  1KKX A;  5J2J A;  4C8O A;  3I76 A;  1X9X A;  2DWQ A;  1N56 A;  1L3V A;  3UMB A;  4GC6 A;  7ICN A;  1V97 A;  2KN7 A;  5KT6 A;  4KLM A;  4ECY A;  4MFA A;  1IG6 A;  1A0P A;  4QZG A;  5III A;  1SL2 A;  3T5L A;  5AM5 A;  4IRK A;  2W9A A;  2ZXH A;  1SZH A;  3MR5 A;  2YQE A;  2NRT A;  1OXJ A;  2NRV A;  3KD3 A;  4ED0 A;  3TAQ A;  5BOL A;  2F8K A;  1TK5 A;  1L7M A;  4JUZ A;  1K1Q A;  2O6K A;  4C4R A;  1ARO P;  8ICB A;  1U48 A;  4I2E A;  4I2F A;  4Y2S A;  1ZQQ A;  3RJJ A;  2ESE A;  4RQ5 A;  3A0H U;  3GV7 B;  4QWC A;  4JV0 A;  4RQ1 A;  2XY6 A;  1M6Y A;  3QUB A;  4DFP A;  1XSN A;  3V6H A;  1KEJ A;  4Y2V A;  8ICM A;  5HML A;  2PXI A;  2AGO A;  3AN1 A;  4OO1 J; 
#chains in the Genus database with same CATH homology
 2B6G A;  2DKZ A;  2KIV A;  4RQM A;  1SV4 A;  2GLE A;  2JV3 A;  2KE7 A;  3BS5 B;  4NL9 C;  2Y9U A;  2YTU A;  3BS5 A;  2DKX A;  5JU5 A;  3TAC B;  1Z1V A;  2E8M A;  4IS7 A;  5KNI A;  2F44 A;  2ES6 A;  2F3N A;  2Y9T A;  2LMR A;  1SV0 C;  2QAR B;  2K60 A;  2QAR A;  1V38 A;  2KG5 A;  4NL9 A;  2D8C A;  1SXD A;  1RG6 A;  1B0X A;  2D3D A;  2K4P A;  3BQ7 A;  5L1M A;  1SV0 A;  2E8N A;  1V85 A;  2QB0 B;  3IDW A;  1X40 A;  1DXS A;  1X66 A;  2QB0 A;  3TAD C;  1X9X A;  5J8Y C;  1UQV A;  2LPE A;  1SGG A;  2QB1 A;  1LKY B;  3SEI A;  1LKY A;  3SEN A;  2EAO A;  3KKA C;  2EAP A;  4MHV A;  2KSO B;  1PK1 B;  3TAD A;  1PK3 A;  5JTI A;  1B4F A;  2KSO A;  1PK1 A;  1OXJ A;  5J8Y A;  1F0M A;  2F8K A;  1KW4 A;  2L5Y A;  3HIL A;  2E8P A;  2EAN A;  1UCV A;  1WWU A;  3KKA A;  2E8O A;  4PZO A;  2ESE A;  4NJ8 A;  2EAM A;  2DL0 A;  2KMD A;  1SXE A;  3BS7 A;  5JRT A;  1COK A;  3H8M A;  1WWV A;  2FE9 A;  3K1R B;  5F3X B;  4RQN A;  2QKQ A;  1OW5 A;  4PZN A;  1JI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...