1COKA

Structure of the c-terminal domain of p73
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PROTEIN (SECOND SPLICE VARIANT P73)
publication title Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1cokA00
3H8MA 3BS7A 1COKA 2B6GA 2KMDA 2Y9TA 2KSOA 2EAOA 1F0MA 1OW5A 3BS5A 1X40A 1B4FA 3TACB 4MHVA 1UQVA 4PZOA 2ESEA 2LMRA 1DXSA 1B0XA 2F44A 2K60A 3SEIA 3BS5B 1OXJA 2KG5A 2D8CA 5J8YC 2DL0A 2QARA 1SV0C 1X66A 2JV3A 2K4PA 4IS7A 2E8NA 3KKAC 2L5YA 1KW4A 2KIVA 2QARB 5F3XB 2E8OA 1V38A 5JRTA 1SXDA 1SV4A 2QB1A 1WWVA 1UCVA 1PK3A 2KSOB 2EAPA 3TADC 3HILA 2GLEA 3K1RB 5J8YA 1SV0A 2D3DA 2F3NA 1JI7A 3KKAA 1PK1A 5JU5A 4PZNA 2EANA 4NL9C 3BQ7A 1WWUA 2Y9UA 2E8PA 2F8KA 1PK1B 2E8MA 3IDWA 5JTIA 5L1MA 2KE7A 1SGGA 2LPEA 2FE9A 3TADA 2ES6A 1Z1VA 4RQNA 1RG6A 2EAMA 1X9XA 2YTUA 1LKYA 1SXEA 2QKQA 2DKXA 4NJ8A 2QB0A 5KNIA 4NL9A 3SENA 1V85A 1LKYB 2DKZA 2QB0B 4RQMA
chains in the Genus database with same CATH superfamily
4YFKA 1U48A 4BXOA 1D9DA 2ISPA 5CP2A 1ZQHA 3RR8A 1MN8A 3C5FA 2WF5A 2W9BB 1ZQQA 2C22A 3M9MB 1Z1BA 3LYSA 2PFOA 5KG7A 1ZQGA 3N28A 3SAGA 2ESEA 2F8LA 2F44A 4F5NA 3J81j 9ICPA 3F53A 8ICXA 5KG0A 2QARA 2KVSA 1UA1A 3IG5A 3O0FA 3TFSA 4CRXA 3H8JA 1JMSA 7ICUA 2JZBA 4DLGA 4P4PA 2FPKA 5AKXA 2KHQA 3K75D 4FBUA 3JPOA 1ZJMA 1BPXA 3KFUF 5DB6A 9ICXA 2FMPA 4F91B 4GLXA 9ICJA 5FP0A 3MDAA 4ED6A 3I28A 4IR9A 2OH2A 8ICYA 2V4QA 3MR5A 4QW9A 3K1RB 4XRHA 1NZBA 4RQ5A 4IRDA 2PI4A 1JI7A 2A3VA 5KFNA 5J2IA 1Q3VA 1DGSA 3AQEA 4QZAA 2AGQA 9ICGA 1WWUA 1ECWA 3V7LA 2XIDA 4C8NA 7ICOA 1QSLA 3TAQA 3SD7A 2F8KA 4I2JA 3NS1A 4F50A 1IG6A 4U7CA 4RNOA 4ELVA 3C5GA 1T3QA 3TANA 2FPMA 1QQ6A 2DWQA 3QX7A 4QZGA 3RBDA 9ICKA 1CRXA 5ALLA 3Q8PB 3OSNA 3H8SA 5AM4A 4DL2A 4O3NA 5G5HA 4F72A 3PV8A 3H40A 3C21A 3TQ1A 2M9NA 4ED1A 3TFRA 4EZ9A 4PGXA 4RQMA 1RYSA 2A19A 2YB1A 5KAFU 2JEFA 4M04A 3JPQA 2K4IA 3UQ0A 2HDOA 2PKEA 5D46A 1C20A 3UXPA 1NK4A 3RAXA 1UPHA 2G06A 3BQ1A 1ZQMA 3TAPA 2PI5A 5ALMA 1UQVA 3KZIU 5AI4A 5EE3A 5DBAA 2JGAA 4KX3A 4ECWA 2IHMA 2DUYA 4R8UB 7ICJA 1JX4A 2HW3A 5AM1A 2WF8A 3V6JA 4F4KA 3Q8LA 4MFAA 2CRXA 1C7YA 4QZ9A 4BGDA 3PMNA 5DDMA 2QARB 3H7IA 4UASA 4KLFA 1HJPA 2ATLA 4EBDA 3RRGA 4RT2A 4US9A 4PHPA 2JZBB 3CP8A 3K1ZA 2LYHA 4M9NA 1WCNA 2ZIWA 3HPOA 2BGWA 8ICIA 2LI6A 1ZQSA 1A77A 4OO1J 2G5HB 2ZG6A 4J9QA 4F5RA 4FS2A 2C2EA 1X9SA 2C28A 1L7OA 4EYIB 4PZNA 1KSPA 1RYUA 2NRXA 4YQWA 3AL0B 4MEYA 5AM3A 4KTQA 3MFIA 7ICIA 1ZQBA 2NRZA 3C23A 3S6JA 5ALNA 2CN1A 1UHUA 2HSZA 5AHXA 4F71A 1SKSA 9ICIA 5F9LA 4EENA 5L1JA 4KLEA 3MC1A 4OCZA 2PMZC 5IIOA 5KFCA 2G07A 3ZDBA 3OJSA 4BX9C 2R8JA 1FO4A 4O3PA 3M6KA 4GXIA 2KN7A 4I28A 4EBEA 4BWMA 1N5WA 3RH6A 9ICNA 4C80A 5J2EA 5DB7A 4MFFA 5L1LA 2PFPA 2ZIXA 1MQ2A 2ZIVA 1WG8A 2KG5A 1S5LU 1NJXA 2YMQA 5CJ7A 2HVHA 2XO7A 2AH5A 2FPLA 2Z7JA 1WYGA 4ED0A 3HJEA 1SZPA 3T5JA 4Z6EA 3CYMA 2IOHA 3D2SA 4UAUA 4Z6FA 2WB1C 1TV9A 2O6KA 1TK8A 1NKEA 2R8KA 2HOQA 7ICRA 7ICSA 4UB3A 4RPXA 3HILA 2G5IB 5J8YA 2WAQC 5DLGA 2F3NA 5J2DA 4NV0A 1FIQA 1UA0A 5KT5A 1PK1A 1JN3A 4FO6A 5ALKA 5BOLA 3QUBA 1SIJA 8ICRA 1XO1A 3QZ7A 4F5OA 4JV0A 1N61A 2P66A 3HX0A 5EWEA 7ICQA 1L8OA 2HBKA 3JPSA 3Q8QB 1RG6A 2UVWA 5B66U 4OJOA 4OJ6A 4QWBA 3E2EA 4NJ8A 3V7JA 1BPYA 5CHGA 5AM0A 2W03A 2ZUCA 4O5EA 1NKCA 1T7PA 2KZ3A 8ICGA 5HMLA 1Q46A 3DV9A 2JXJA 3BS7A 4B9VA 3LVVA 1Q3UA 3PW0A 4YMOA 3MBYA 3PX6A 2WFAA 7ICGA 1ZXIA 4KITB 3N4MB 5KT7A 2ZTCA 2Y1IA 1URJA 8ICCA 5HP4A 1NK5A 2JEJA 5J0YA 7ICTA 5J2FA 4J9PA 2E3TA 3MGIA 2KP7A 3THVA 4P0QA 2K4PA 5KFBA 4MF2A 4F4ZA 1D8BA 3KKAC 1KFTA 4Y2XA 1XSPA 3UMCA 2KZZA 2M0NA 1LVHA 1T3NA 4YXJA 5E79U 4WJ3B 9ICFA 5IIIA 5EOZA 3AM9A 1JROA 5KG1A 5KFOA 1CEZA 2ZTEA 3BJYA 2BPCA 3KHHA 3HP6A 2JEIA 3F2BA 4R65A 1ZQEA 4K4GA 2LYBA 3KOOA 4QIWC 4RT3A 1XWLA 5KFDA 3MABA 8ICSA 3PR4A 1PK1B 1ZQRA 8ICNA 1BPBA 5D4BA 4DSIA 3SYZA 4NLKA 2JH1A 1Z00A 5AKIA 4DSJA 2KICA 5ALGA 5KAIU 3QU5A 2Y1JA 5J0PA 2IOFA 4O5KA 4P0PB 3T5KA 5B5EU 5ALSA 4DSKA 3KZXA 5GTIU 3ZD8A 3I1YA 2DKZA 4DFDA 4IQUA 4R66A 4ECUA 4GC6A 5ALQA 4IQTA 4DF8A 1QLNA 3KHRA 1ZQPA 3C29A 4MEXA 1H38A 1ZD3A 4Q45A 2FDRA 2DF4B 1B0XA 4KLIA 4DQSA 2BHNA 1ZQVA 3LDAA 2DL0A 2EDUA 3E58A 1MSWD 4EYHB 2ZUBA 8ICLA 2NRVA 4IS7A 3LVWA 4JK1A 1ZD2P 3WKBA 3GQCA 2FLNA 1L6NA 5ALXA 5AKEA 5TZVA 1EXNA 1ZQYA 4GFJA 2KV2A 5ALJA 5J0UA 4QZCA 3Q8SB 2YMPA 4JWMA 1UCVA 2R8HA 3HKZC 3HWTA 1BPDA 4F2SA 4KMUA 3RB6A 4OJ5A 2I6XA 2XGQA 2F1HA 3F2CA 2HHTA 3RB0A 4KLQA 1S0NA 4CF4A 3ISDA 4KLHA 8ICFA 1RXWA 1NK6A 3WK7A 1SKRA 4RQ1A 1ZRMA 4LJXA 3BQ7A 4KLUA 2NRWA 3PSIA 2UVUA 1RQLA 4PHAA 5DQHA 1Z4NA 4DQIA 3IM1A 4BUGA 5AI9A 4BJQA 2HMXA 5KG6A 3RB4A 1V9PA 2I5HA 3JPPA 3WK8A 3SAHA 3RB3A 2A1JA 5AK3A 4GXJA 2ES6A 3BZKA 3OTQA 4RQNA 2OYYA 3PNCA 3NVZA 1VJ5A 3I76A 1TFRA 5AIAA 4C7ZA 1TAMA 1T4GA 2JHDA 2B0CA 4C4SA 2ZJ5A 3ONNA 4YCXA 5JUMA 4GXKA 3M8RA 5K4LA 4ECZA 5ALHA 3NASA 4TURA 3RJGA 4B6JA 1JXLA 4B9NA 4QZ8A 4Y2TA 5J0OA 2B6GA 2J6TA 2BPGA 4CDGA 1ZQCA 3C2MA 5D49A 3PX4A 1JALA 1J2MA 2G0AA 4NY8A 1NNLA 1YZ6A 4NWIA 5GTHU 1PUZA 3RAQA 1YT3A 2JV3A 4ZOHC 5IIMA 3H4BA 8ICWA 4UB1A 2F1JA 2L5YA 2KIVA 4C8LA 4K4HA 4JUZA 4YD2A 3RJFA 1PK3A 3DDHA 4O9MA 3IP4B 3FC4A 3OPXA 5CA7A 2W11A 1XC9A 2W9CB 1F44A 5J2CA 4GIBA 4C0ZA 5J0RA 4NL9C 2I1QA 5KFWA 3Q8KA 1TAUA 4O3MA 4Y2PA 4XQ8A 2Y9UA 4CF5A 2W8KA 1L3TA 1HUOA 2LKYA 3QNMA 8ICQA 4DQPA 8ICBA 2ALZA 1ED1A 2BCUA 5ALRA 3SI8A 2Y0SF 4O5CA 4LZDA 5KFMA 2MA1A 4EEKA 2ZXIA 3C1YA 4YD1A 2KVCA 3RJKA 3ZD9A 2PFNA 2W04A 2FLLA 2B21A 2KSOA 5KFIA 3NVWA 1S0MA 4J9RA 1NI3A 3KD3A 3GDXA 2F77X 2RDIA 4UB4A 3F2DA 5L1IA 1VLBA 4ECTA 5DG7A 2AJQA 1KKXA 5DQIA 2KOBA 1D8LA 3BQ2A 4X5VA 2HHXA 4J9NA 3M1YA 2AQ0A 4CF3A 4FS1A 2F1IA 2V4RA 4ELUA 5CEHA 4DL7A 3EPIA 2YX8A 5DB8A 2XY6A 3IHQB 4BXOB 4M0AA 4CE6A 4FZMA 2EH9A 3TADC 3B9JA 2LYAA 4FZLA 4EX6A 5DBCA 2JMGA 4IC9A 3KKAA 3U26A 3T5LA 4BWJA 2IHNA 2J6UA 3A0BU 5KFHA 5KTQA 3F5EA 3WKCA 3OHBA 4QZHA 1TE2A 2OEHA 1UT8A 4RPZA 1IM4A 2YQEA 4IQVA 4PGYA 3MGHA 2KFNA 1HIWA 3UMBA 4PHEA 4I2FA 9ICWA 2BCVA 3WU2U 1X2IA 3N7RC 4TUSA 9ICTA 4J9LA 3AUOA 1PVQA 2WHEA 9ICHA 4Q8EA 2OXOA 2H3VA 8ICHA 3H0RB 5KFJA 2Q0ZX 4UAVA 5CB1A 4LVSA 3OSPA 2XC9A 2ASDA 1ZRNA 5AI6A 1RZTA 3BS5A 4O3OA 9ICEA 3WK4A 3BZCA 9ICRA 5KT2A 1OXJA 1F5SA 5J0TA 2V9WA 3M6ZA 4US8A 2OHFA 2UVVA 4DFPA 3GILA 4GC7A 1SV0C 2JR5A 1N62A 3B0XA 1KW4A 2AQ4A 1B43A 4ED7A 3GV5B 4C4TA 2E8OA 5ALOA 2Q4TA 2AGOA 2XCAA 4R64A 2WF9A 1WWVA 3SV3A 5AIBA 1WUDA 2ODGA 4RPYA 3SZ2A 5ALUA 5J2BA 2VA3A 4DEZA 5H2FU 2W3RA 9ICQA 3UXNA 1QSSA 2KIWA 5KT6A 2UVRA 3JPTA 3C2LA 4I2HA 1SL0A 4I2IA 2XICA 3IRUA 4I2DA 5JTIA 5F9NA 5ALFA 1N56A 3CRXA 1TVAA 2W9AA 4J9KA 1X9XA 1LKYA 2AXTU 2KHVA 1B22A 2ZIWB 5KNIA 3ORYA 4YN4A 4TUQA 5KG2A 1ZQFA 2R8GA 2WF7A 1KDHA 1RDFA 5KFLA 2MUTA 2HI0A 3M9NB 1BNOA 2BCSA 2PMZF 1OUQA 2E5SA 5HHIA 1SB3C 2Y9TA 1N63A 4RQ3A 9ICBA 2VKQA 4RQ7A 3G6VA 4FBTA 1DXSA 5KG3A 3BS5B 9ICSA 9ICCA 2YB4A 4Y2UA 4DL3A 4ECRA 1TAQA 5J29A 1NK0A 3NUQA 9ICLA 4NLCA 2YMMA 1ZQAA 2P6UA 1L3VA 3RF9A 3ZDEA 4NLBA 2XCPA 1S77D 5C5JA 1T8EA 4F8RA 2HVIA 2FJ6A 2BQUA 4M9JA 4ECSA 2RRDA 3NVYA 7ICPA 3RH5A 3NTUA 4YVZA 3PW7A 4LZGA 4KLGA 4O3QA 2IMWP 4PL1A 1QSYA 2ZIXB 2D3DA 1N2XA 2W54A 3QYPA 1S97A 3RH4A 2WB1F 1ZQIA 4G9BA 1KFDA 4QZBA 2ZIVB 4F3OA 4UB6U 3N7SC 5JU5A 3MR2A 4PJ0U 5AKLA 7ICFA 1NOMA 2WAQF 2BCRA 2FLPA 7ICKA 3PW2A 2GOLA 2VIXA 5KFRA 4Q43A 1FEZA 4DL4A 5DGBA 4Y2JA 5DDYA 5KFXA 3D2NA 4JV2A 4C4RA 2AGPA 4BDPA 2VJ5A 1D8YA 2PFQA 4JB3A 1SZHA 2QB0A 4J9SA 4NL9A 3SENA 2H3IA 1ZOLA 3AMZA 1Q8KA 1LKYB 1N60A 4QZIA 5EWFA 4YMMA 3SR6A 3PW5A 2BPFA 4UW9A 2DFLA 4PH5A 4NM2A 2HOFA 2DPJA 1SWWA 4I2GA 3M8SA 1WCLA 5J2HA 3ZDCA 1ZQJA 5KFGA 4B9LA 4YR2A 4YR0A 2NV3A 2NYVA 1NK7A 1DRGA 1QTMA 1TK0A 2LMRA 5A0LA 2ASLA 3WK9A 4C7YA 2FMQA 1RM6C 2EZXA 2ZXHA 8ICUA 1ZQNA 3T3FA 5EE0A 4QWAA 1NJWA 2E8NA 3NVVA 3EZ5A 3GIKA 3JPRA 4AYBF 3PVXA 1BNPA 2ZJAA 4ZH4A 1NKBA 4ELTA 2W3SA 2XGPA 8ICAA 5EWGA 1S8OA 2W55A 3ED5A 4UB8U 3V72A 1ZQKA 4PPXA 1QQ5A 3QU7A 1JRPA 3PO5A 5KFYA 1RQNA 5ALZA 8ICTA 1O03A 1MA7A 2BDPA 3BQTA 3MR3A 4DF4A 4Q44A 2GH1A 1AQ6A 4P0QB 4EELA 3AU6A 4RNNA 2KD1A 2H3QA 1Y88A 3AQFA 4RU9A 4DSLA 3V6KA 2BR0A 3RJHA 2W9BA 4I2AA 2VA8A 3L5KA 5KG4A 3K4GA 3FDSA 1PVRA 3RTVA 1SWVA 3TADA 4QIWF 4Y2YA 3UM9A 4RQ8A 5HR6A 3TKAA 1SXEA 3MDCA 1K1QA 2R18A 4UAWA 3M9OB 2DKXA 5KL1B 5DQGA 3FAHA 5J0QA 1V85A 9ICVA 1XSNA 3GZFA 1FFUA 5AK4A 3OJUA 3C28A 2GWSA 2QB0B 4DSEA 5J0SA 3PW4A 1COKA 4F4YA 4B9SA 2KMDA 1COOA 5EE1A 1F0MA 3WKDA 1JIHA 2OCEA 2NO5A 3A0HU 3TACB 1Z00B 4ICAA 4PZOA 4NM1A 3AEVA 3SEIA 1VDVA 4QZFA 5KFAA 3SAFA 3UQ2A 4IR1A 3ISBA 1CI4A 2OWOA 5ALDA 4DLEA 3SV4A 5AI5A 2FI1A 2BDUA 4O3RA 2EZZA 5DKWA 5J0XA 1X42A 5KFPA 4Y2SA 2MSNA 2RQ5A 4UAZA 4ECVA 3PSTA 1MC8A 4EBCA 2EAPA 4CGZA 2GO7A 5C0YA 1SV0A 4C8KA 4KLLA 4KN4A 2DPIA 1U47A 3PO4A 5CWRA 5AKHA 3PMLA 1JXEA 4NLNA 1X6JA 5CRXA 2HHSA 4Z6DA 3T5HA 1QH9A 2ZIUA 2KEYA 1JUDA 2BZFA 3NRWA 4RQ6A 2FE9A 2YY6A 2D6FC 2JRZA 1KEJA 4DL5A 1Z1VA 4DQQA 4KLJA 3G6XA 3H8WA 3MR6A 3UPQA 4J9MA 4JV1A 3HRDD 4R8UA 7ICMA 1UT5A 4Y2RA 5AI8A 4HAIA 3IN5A 1HUZA 2C2DA 1K1SA 2BQ3A 3IV6A 3QUQA 1ZQWA 9ICOA 2IBKA 4Y2QA 4J03A 3QEAZ 4DO9A 3EUB2 5KFSA 4ED3A 5KFQA 2A1JB 4MHVA 3EW9A 1O08A 4EX7A 3GIIA 4QW8A 4E0DA 1SL2A 1ZETA 5EE9A 2WTFA 4O0IA 4ED2A 2ZJ8A 3TI0A 4ECXA 4TUPA 3L3FX 5CR0A 4DOBA 3BQ0A 1XU4A 1IV8A 5KL8B 3WKEA 2RLTA 1ZQDA 3WKAA 5AM2A 2GLEA 2KKVA 2J6SA 1L3UA 3ALRA 3WK5A 1L7MA 5ALVA 5BOMA 1X6IA 4DFJA 3GV7B 3E0FA 5IINA 1ZJNA 4YXMA 3GIJA 2I9GA 5J0WA 2K4HA 7ICEA 3M7DA 1N5XA 2ZIUB 2EAMA 8ICVA 1KN5A 4RQ0A 1LB2B 4USAA 4B9MA 5TISU 1PZNA 3AN1A 5AK6A 2YN4A 3SMVA 2HOIA 5AICA 1ZD4A 5KFUA 2W8LA 3KHGA 5J2KA 3AU2A 1ZQZA 1J97A 1D9FA 3PZPA 1A6SA 4ACOA 4YG2A 3UXOA 5DGAA 5DB9A 1OW5A 2DBYA 1B4FA 2WF6A 1NZPA 2FMSA 1XNSA 4KMOB 3ETLA 1KRPA 4DOAA 3D2QA 1ZQTA 4U6PA 4KLSA 2N1RA 4KLOA 4UB5A 4DFKA 2DGZA 2MAXA 5G5GA 2KKPA 3VCBA 4QZDA 3WK6A 4DS4A 2G08A 3RJIA 2KJ9A 1V38A 1Z4OA 4PGQA 2H3FA 5L9XA 3GIMA 1X9MA 2XY7A 2KSOB 4F4WA 5KFVA 4FFDA 3RJJA 1S0OA 3H0MB 4NXZA 1RXVA 1ZQLA 5KFEA 3EYZA 2KZMA 2K8BB 1L3SA 1S10A 8ICKA 2ZUDA 1CUKA 3BDPA 4HYKA 2CPRA 1ZQXA 3EWAA 3QUTA 1L8LA 1AROP 4F5PA 2RDJA 4DQRA 2RP5A 4OJLA 8ICOA 1QCKA 3OHAA 4DOCA 4F93B 2AU0A 2C2RA 7ICLA 2YTUA 4P4OA 5ALEA 2VANA 1U4BA 1KL9A 4M47A 4P2HA 4I2CA 5ALWA 5KT4A 4PL2A 3PX0A 3DEEA 1NK9A 3C1ZA 1T94A 3V7KA 4RQ2A 3GV8B 5J2JA 2LM4A 2KJ5A 4P4MA 1J2NA 3V6HA 4B9UA 1U9LA 4UQGA 2P35A 1DK3A 1RYRA 5IILA 5KG5A 2H5XA 1V97A 2XY5A 5KFKA 4UAYA 4JWNA 1KLNA 5KFFA 4EEYA 2HCFA 3FYHA 2MRLA 3QE9Y 2D8CA 4MF8A 4FZNA 5BPCA 5KFZA 4DFMA 4ECYA 1A0PA 1N48A 5ALTA 3KTQA 3MGVA 4Q8FA 1SXDA 5AKKA 1S9FA 3HW8A 1NJYA 5HHHA 4OD0A 8ICJA 3ICXA 4JMUA 5AI0A 1M6YA 4OJPA 4TQSA 3RJEA 1BPZA 5AKYA 2G09A 4P0PA 3PSPA 4I2EA 1KBUA 7ICHA 4DCCA 5HMMA 5AKZA 4K4IA 4C8MA 5ALIA 3KBBA 1SKWA 4I29A 4DS5A 5AM5A 4UBCA 4I2BA 4TQRA 1XSLA 2NRTA 3EPGA 2F76X 3FM9A 3IDWA 3QUCA 2RHFA 1U49A 2W9MA 1IXRA 2LPEA 4KN7A 4Y2VA 4YR3A 5AKGA 1MQ3A 3D6JA 3Q8RB 1KFSA 2EQYA 3LWLA 2VA2A 2H3ZA 3VC8A 3CNHA 3UMGA 3IG8A 2W43A 3ZDDA 2QKQA 2QLTA 3GU3A 1BPEA 4G3IA 3KHLA 9ICUA 3B0YA 4RUAA 1PVPA 8ICZA 4AYBC 3H0LB 3RR7A 4KLMA 5L1KA 4UB2A 4YP3A 1LV5A 1S76D 2LBOA 4R63A 2K89A 3N7PD 3SQIA 2EAOA 2IA6A 4F92B 1KTQA 4F2RA 5J2GA 1X40A 1A76A 1L5UA 2R8IA 1U45A 1BGXT 2IOFK 2DQNB 4I27A 5AKJA 2HHWA 4QJFB 1Z19A 5ALYA 4DWIA 4M6WA 2LHTA 3C2KA 5DLFA 4QZEA 3QU2A 1ZQOA 3L4PA 3RBEA 3Q8MA 3ZI4A 1X66A 4KLDA 4M9HA 4DSFA 1KQQA 2ISOA 1BVSA 2P6RA 3ZDAA 5F3XB 3LK9A 2MUTB 1HEKA 5DG8A 4CCHA 2QB1A 3CW2C 1SL1A 3G6YA 8ICMA 1P7DA 4M2YA 4KX5A 2YMLA 1TKDA 3PR5B 3H4DA 5IIKA 4UARA 3PY8A 5KT3A 2W7PA 5T14A 8ICPA 2HHVA 2E8PA 5DG9A 1K5OA 4PHDA 2BCQA 2E8MA 2W7OA 5L1MA 2KE7A 4Z6CA 1SGGA 2HBMA 1L7NA 2EZYA 2K8AA 3QZ8A 2XI9A 1DK2A 5HNKA 5ALPA 1ZD5A 2A1AA 2KTQA 4ECQA 4CNQA 3NGDA 3ISCA 5KFTA 4IQWA 2E1EA 2JH7A 2KNJA 2MU2A 4XUSA 4IRCA 3H8MA 1RPLA 4NLGA 4QNLA 4B9TA 4ED8A 1Z3EB 3GFKB 1X9WA 4MFCA 8ICEA 5IIJA 2ZTDA 3F5AA 4RUCA 1DOQA 5HR7A 2KJ8A 4RNMA 2BQRA 2ASJA 2BKEA 1L7PA 5J2AA 2W9CA 1XS9D 2K60A 7ICNA 1YZ7A 4M9GA 9ICAA 5J8YC 1TK5A 4QWCA 4UBBA 4UATA 4M6WB 2KK0A 3HT3A 4F4XA 1ZQUA 2F2AB 2CXYA 3N97B 4NLZA 2NO4A 3R9KA 5JRTA 2XVTA 1SV4A 3NRZA 4A8EA 2E1FA 2AHOB 3RRHA 3JPNA 4RZRA 1IIPA 4F5QA 3QU9A 4O3SA 4AP9A 3MFHA 4FE3A 4EZ6A 3QU4A 3RFAA 1DGJA 2VJ4A 1GO3F 1ZQ1C 4IL6U 1FFVA 2EANA 1S0VA 1NK8A 4C8OA 4KLTA 2K4EA 7ICVA 4IRKA 1QQ7A 4YMNA 2HHUA 1NJZA 3QXGA 3ETRA 4J9OA 5AK5A 4M9LA 2KFZA 3LWMA 2Y0SC 2LM1A 3QEBZ 4QWDA 3HKZF 3OGUA 3T79A 2HBJA 4DL6A 2JEGA 1ZYQA 5DBBA 2OM6A 3PSFA 9ICMA 2HBLA 4QWEA 4RQ4A 2K8CB 3TARA 1XO0A 4XA5A 2HHQA 2PXIA
chains in the Genus database with same CATH topology
3H8MA 3BS7A 1COKA 2B6GA 2KMDA 2Y9TA 2KSOA 2EAOA 1F0MA 1OW5A 3BS5A 1X40A 1B4FA 3TACB 4MHVA 1UQVA 4PZOA 2ESEA 2LMRA 1DXSA 1B0XA 2F44A 2K60A 3SEIA 3BS5B 1OXJA 2KG5A 2D8CA 5J8YC 2DL0A 2QARA 1SV0C 1X66A 2JV3A 2K4PA 4IS7A 2E8NA 3KKAC 2L5YA 1KW4A 2KIVA 2QARB 5F3XB 2E8OA 1V38A 5JRTA 1SXDA 1SV4A 2QB1A 1WWVA 1UCVA 1PK3A 2KSOB 2EAPA 3TADC 3HILA 2GLEA 3K1RB 5J8YA 1SV0A 2D3DA 2F3NA 1JI7A 3KKAA 1PK1A 5JU5A 4PZNA 2EANA 4NL9C 3BQ7A 1WWUA 2Y9UA 2E8PA 2F8KA 1PK1B 2E8MA 3IDWA 5JTIA 5L1MA 2KE7A 1SGGA 2LPEA 2FE9A 3TADA 2ES6A 1Z1VA 4RQNA 1RG6A 2EAMA 1X9XA 2YTUA 1LKYA 1SXEA 2QKQA 2DKXA 4NJ8A 2QB0A 5KNIA 4NL9A 3SENA 1V85A 1LKYB 2DKZA 2QB0B 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8M A;  3BS7 A;  1COK A;  2B6G A;  2KMD A;  2Y9T A;  2KSO A;  2EAO A;  1F0M A;  1OW5 A;  3BS5 A;  1X40 A;  1B4F A;  3TAC B;  4MHV A;  1UQV A;  4PZO A;  2ESE A;  2LMR A;  1DXS A;  1B0X A;  2F44 A;  2K60 A;  3SEI A;  3BS5 B;  1OXJ A;  2KG5 A;  2D8C A;  5J8Y C;  2DL0 A;  2QAR A;  1SV0 C;  1X66 A;  2JV3 A;  2K4P A;  4IS7 A;  2E8N A;  3KKA C;  2L5Y A;  1KW4 A;  2KIV A;  2QAR B;  5F3X B;  2E8O A;  1V38 A;  5JRT A;  1SXD A;  1SV4 A;  2QB1 A;  1WWV A;  1UCV A;  1PK3 A;  2KSO B;  2EAP A;  3TAD C;  3HIL A;  2GLE A;  3K1R B;  5J8Y A;  1SV0 A;  2D3D A;  2F3N A;  1JI7 A;  3KKA A;  1PK1 A;  5JU5 A;  4PZN A;  2EAN A;  4NL9 C;  3BQ7 A;  1WWU A;  2Y9U A;  2E8P A;  2F8K A;  1PK1 B;  2E8M A;  3IDW A;  5JTI A;  5L1M A;  2KE7 A;  1SGG A;  2LPE A;  2FE9 A;  3TAD A;  2ES6 A;  1Z1V A;  4RQN A;  1RG6 A;  2EAM A;  1X9X A;  2YTU A;  1LKY A;  1SXE A;  2QKQ A;  2DKX A;  4NJ8 A;  2QB0 A;  5KNI A;  4NL9 A;  3SEN A;  1V85 A;  1LKY B;  2DKZ A;  2QB0 B;  4RQM A; 
#chains in the Genus database with same CATH topology
 4YFK A;  1U48 A;  4BXO A;  1D9D A;  2ISP A;  5CP2 A;  1ZQH A;  3RR8 A;  1MN8 A;  3C5F A;  2WF5 A;  2W9B B;  1ZQQ A;  2C22 A;  3M9M B;  1Z1B A;  3LYS A;  2PFO A;  5KG7 A;  1ZQG A;  3N28 A;  3SAG A;  2ESE A;  2F8L A;  2F44 A;  4F5N A;  3J81 j;  9ICP A;  3F53 A;  8ICX A;  5KG0 A;  2QAR A;  2KVS A;  1UA1 A;  3IG5 A;  3O0F A;  3TFS A;  4CRX A;  3H8J A;  1JMS A;  7ICU A;  2JZB A;  4DLG A;  4P4P A;  2FPK A;  5AKX A;  2KHQ A;  3K75 D;  4FBU A;  3JPO A;  1ZJM A;  1BPX A;  3KFU F;  5DB6 A;  9ICX A;  2FMP A;  4F91 B;  4GLX A;  9ICJ A;  5FP0 A;  3MDA A;  4ED6 A;  3I28 A;  4IR9 A;  2OH2 A;  8ICY A;  2V4Q A;  3MR5 A;  4QW9 A;  3K1R B;  4XRH A;  1NZB A;  4RQ5 A;  4IRD A;  2PI4 A;  1JI7 A;  2A3V A;  5KFN A;  5J2I A;  1Q3V A;  1DGS A;  3AQE A;  4QZA A;  2AGQ A;  9ICG A;  1WWU A;  1ECW A;  3V7L A;  2XID A;  4C8N A;  7ICO A;  1QSL A;  3TAQ A;  3SD7 A;  2F8K A;  4I2J A;  3NS1 A;  4F50 A;  1IG6 A;  4U7C A;  4RNO A;  4ELV A;  3C5G A;  1T3Q A;  3TAN A;  2FPM A;  1QQ6 A;  2DWQ A;  3QX7 A;  4QZG A;  3RBD A;  9ICK A;  1CRX A;  5ALL A;  3Q8P B;  3OSN A;  3H8S A;  5AM4 A;  4DL2 A;  4O3N A;  5G5H A;  4F72 A;  3PV8 A;  3H40 A;  3C21 A;  3TQ1 A;  2M9N A;  4ED1 A;  3TFR A;  4EZ9 A;  4PGX A;  4RQM A;  1RYS A;  2A19 A;  2YB1 A;  5KAF U;  2JEF A;  4M04 A;  3JPQ A;  2K4I A;  3UQ0 A;  2HDO A;  2PKE A;  5D46 A;  1C20 A;  3UXP A;  1NK4 A;  3RAX A;  1UPH A;  2G06 A;  3BQ1 A;  1ZQM A;  3TAP A;  2PI5 A;  5ALM A;  1UQV A;  3KZI U;  5AI4 A;  5EE3 A;  5DBA A;  2JGA A;  4KX3 A;  4ECW A;  2IHM A;  2DUY A;  4R8U B;  7ICJ A;  1JX4 A;  2HW3 A;  5AM1 A;  2WF8 A;  3V6J A;  4F4K A;  3Q8L A;  4MFA A;  2CRX A;  1C7Y A;  4QZ9 A;  4BGD A;  3PMN A;  5DDM A;  2QAR B;  3H7I A;  4UAS A;  4KLF A;  1HJP A;  2ATL A;  4EBD A;  3RRG A;  4RT2 A;  4US9 A;  4PHP A;  2JZB B;  3CP8 A;  3K1Z A;  2LYH A;  4M9N A;  1WCN A;  2ZIW A;  3HPO A;  2BGW A;  8ICI A;  2LI6 A;  1ZQS A;  1A77 A;  4OO1 J;  2G5H B;  2ZG6 A;  4J9Q A;  4F5R A;  4FS2 A;  2C2E A;  1X9S A;  2C28 A;  1L7O A;  4EYI B;  4PZN A;  1KSP A;  1RYU A;  2NRX A;  4YQW A;  3AL0 B;  4MEY A;  5AM3 A;  4KTQ A;  3MFI A;  7ICI A;  1ZQB A;  2NRZ A;  3C23 A;  3S6J A;  5ALN A;  2CN1 A;  1UHU A;  2HSZ A;  5AHX A;  4F71 A;  1SKS A;  9ICI A;  5F9L A;  4EEN A;  5L1J A;  4KLE A;  3MC1 A;  4OCZ A;  2PMZ C;  5IIO A;  5KFC A;  2G07 A;  3ZDB A;  3OJS A;  4BX9 C;  2R8J A;  1FO4 A;  4O3P A;  3M6K A;  4GXI A;  2KN7 A;  4I28 A;  4EBE A;  4BWM A;  1N5W A;  3RH6 A;  9ICN A;  4C80 A;  5J2E A;  5DB7 A;  4MFF A;  5L1L A;  2PFP A;  2ZIX A;  1MQ2 A;  2ZIV A;  1WG8 A;  2KG5 A;  1S5L U;  1NJX A;  2YMQ A;  5CJ7 A;  2HVH A;  2XO7 A;  2AH5 A;  2FPL A;  2Z7J A;  1WYG A;  4ED0 A;  3HJE A;  1SZP A;  3T5J A;  4Z6E A;  3CYM A;  2IOH A;  3D2S A;  4UAU A;  4Z6F A;  2WB1 C;  1TV9 A;  2O6K A;  1TK8 A;  1NKE A;  2R8K A;  2HOQ A;  7ICR A;  7ICS A;  4UB3 A;  4RPX A;  3HIL A;  2G5I B;  5J8Y A;  2WAQ C;  5DLG A;  2F3N A;  5J2D A;  4NV0 A;  1FIQ A;  1UA0 A;  5KT5 A;  1PK1 A;  1JN3 A;  4FO6 A;  5ALK A;  5BOL A;  3QUB A;  1SIJ A;  8ICR A;  1XO1 A;  3QZ7 A;  4F5O A;  4JV0 A;  1N61 A;  2P66 A;  3HX0 A;  5EWE A;  7ICQ A;  1L8O A;  2HBK A;  3JPS A;  3Q8Q B;  1RG6 A;  2UVW A;  5B66 U;  4OJO A;  4OJ6 A;  4QWB A;  3E2E A;  4NJ8 A;  3V7J A;  1BPY A;  5CHG A;  5AM0 A;  2W03 A;  2ZUC A;  4O5E A;  1NKC A;  1T7P A;  2KZ3 A;  8ICG A;  5HML A;  1Q46 A;  3DV9 A;  2JXJ A;  3BS7 A;  4B9V A;  3LVV A;  1Q3U A;  3PW0 A;  4YMO A;  3MBY A;  3PX6 A;  2WFA A;  7ICG A;  1ZXI A;  4KIT B;  3N4M B;  5KT7 A;  2ZTC A;  2Y1I A;  1URJ A;  8ICC A;  5HP4 A;  1NK5 A;  2JEJ A;  5J0Y A;  7ICT A;  5J2F A;  4J9P A;  2E3T A;  3MGI A;  2KP7 A;  3THV A;  4P0Q A;  2K4P A;  5KFB A;  4MF2 A;  4F4Z A;  1D8B A;  3KKA C;  1KFT A;  4Y2X A;  1XSP A;  3UMC A;  2KZZ A;  2M0N A;  1LVH A;  1T3N A;  4YXJ A;  5E79 U;  4WJ3 B;  9ICF A;  5III A;  5EOZ A;  3AM9 A;  1JRO A;  5KG1 A;  5KFO A;  1CEZ A;  2ZTE A;  3BJY A;  2BPC A;  3KHH A;  3HP6 A;  2JEI A;  3F2B A;  4R65 A;  1ZQE A;  4K4G A;  2LYB A;  3KOO A;  4QIW C;  4RT3 A;  1XWL A;  5KFD A;  3MAB A;  8ICS A;  3PR4 A;  1PK1 B;  1ZQR A;  8ICN A;  1BPB A;  5D4B A;  4DSI A;  3SYZ A;  4NLK A;  2JH1 A;  1Z00 A;  5AKI A;  4DSJ A;  2KIC A;  5ALG A;  5KAI U;  3QU5 A;  2Y1J A;  5J0P A;  2IOF A;  4O5K A;  4P0P B;  3T5K A;  5B5E U;  5ALS A;  4DSK A;  3KZX A;  5GTI U;  3ZD8 A;  3I1Y A;  2DKZ A;  4DFD A;  4IQU A;  4R66 A;  4ECU A;  4GC6 A;  5ALQ A;  4IQT A;  4DF8 A;  1QLN A;  3KHR A;  1ZQP A;  3C29 A;  4MEX A;  1H38 A;  1ZD3 A;  4Q45 A;  2FDR A;  2DF4 B;  1B0X A;  4KLI A;  4DQS A;  2BHN A;  1ZQV A;  3LDA A;  2DL0 A;  2EDU A;  3E58 A;  1MSW D;  4EYH B;  2ZUB A;  8ICL A;  2NRV A;  4IS7 A;  3LVW A;  4JK1 A;  1ZD2 P;  3WKB A;  3GQC A;  2FLN A;  1L6N A;  5ALX A;  5AKE A;  5TZV A;  1EXN A;  1ZQY A;  4GFJ A;  2KV2 A;  5ALJ A;  5J0U A;  4QZC A;  3Q8S B;  2YMP A;  4JWM A;  1UCV A;  2R8H A;  3HKZ C;  3HWT A;  1BPD A;  4F2S A;  4KMU A;  3RB6 A;  4OJ5 A;  2I6X A;  2XGQ A;  2F1H A;  3F2C A;  2HHT A;  3RB0 A;  4KLQ A;  1S0N A;  4CF4 A;  3ISD A;  4KLH A;  8ICF A;  1RXW A;  1NK6 A;  3WK7 A;  1SKR A;  4RQ1 A;  1ZRM A;  4LJX A;  3BQ7 A;  4KLU A;  2NRW A;  3PSI A;  2UVU A;  1RQL A;  4PHA A;  5DQH A;  1Z4N A;  4DQI A;  3IM1 A;  4BUG A;  5AI9 A;  4BJQ A;  2HMX A;  5KG6 A;  3RB4 A;  1V9P A;  2I5H A;  3JPP A;  3WK8 A;  3SAH A;  3RB3 A;  2A1J A;  5AK3 A;  4GXJ A;  2ES6 A;  3BZK A;  3OTQ A;  4RQN A;  2OYY A;  3PNC A;  3NVZ A;  1VJ5 A;  3I76 A;  1TFR A;  5AIA A;  4C7Z A;  1TAM A;  1T4G A;  2JHD A;  2B0C A;  4C4S A;  2ZJ5 A;  3ONN A;  4YCX A;  5JUM A;  4GXK A;  3M8R A;  5K4L A;  4ECZ A;  5ALH A;  3NAS A;  4TUR A;  3RJG A;  4B6J A;  1JXL A;  4B9N A;  4QZ8 A;  4Y2T A;  5J0O A;  2B6G A;  2J6T A;  2BPG A;  4CDG A;  1ZQC A;  3C2M A;  5D49 A;  3PX4 A;  1JAL A;  1J2M A;  2G0A A;  4NY8 A;  1NNL A;  1YZ6 A;  4NWI A;  5GTH U;  1PUZ A;  3RAQ A;  1YT3 A;  2JV3 A;  4ZOH C;  5IIM A;  3H4B A;  8ICW A;  4UB1 A;  2F1J A;  2L5Y A;  2KIV A;  4C8L A;  4K4H A;  4JUZ A;  4YD2 A;  3RJF A;  1PK3 A;  3DDH A;  4O9M A;  3IP4 B;  3FC4 A;  3OPX A;  5CA7 A;  2W11 A;  1XC9 A;  2W9C B;  1F44 A;  5J2C A;  4GIB A;  4C0Z A;  5J0R A;  4NL9 C;  2I1Q A;  5KFW A;  3Q8K A;  1TAU A;  4O3M A;  4Y2P A;  4XQ8 A;  2Y9U A;  4CF5 A;  2W8K A;  1L3T A;  1HUO A;  2LKY A;  3QNM A;  8ICQ A;  4DQP A;  8ICB A;  2ALZ A;  1ED1 A;  2BCU A;  5ALR A;  3SI8 A;  2Y0S F;  4O5C A;  4LZD A;  5KFM A;  2MA1 A;  4EEK A;  2ZXI A;  3C1Y A;  4YD1 A;  2KVC A;  3RJK A;  3ZD9 A;  2PFN A;  2W04 A;  2FLL A;  2B21 A;  2KSO A;  5KFI A;  3NVW A;  1S0M A;  4J9R A;  1NI3 A;  3KD3 A;  3GDX A;  2F77 X;  2RDI A;  4UB4 A;  3F2D A;  5L1I A;  1VLB A;  4ECT A;  5DG7 A;  2AJQ A;  1KKX A;  5DQI A;  2KOB A;  1D8L A;  3BQ2 A;  4X5V A;  2HHX A;  4J9N A;  3M1Y A;  2AQ0 A;  4CF3 A;  4FS1 A;  2F1I A;  2V4R A;  4ELU A;  5CEH A;  4DL7 A;  3EPI A;  2YX8 A;  5DB8 A;  2XY6 A;  3IHQ B;  4BXO B;  4M0A A;  4CE6 A;  4FZM A;  2EH9 A;  3TAD C;  3B9J A;  2LYA A;  4FZL A;  4EX6 A;  5DBC A;  2JMG A;  4IC9 A;  3KKA A;  3U26 A;  3T5L A;  4BWJ A;  2IHN A;  2J6U A;  3A0B U;  5KFH A;  5KTQ A;  3F5E A;  3WKC A;  3OHB A;  4QZH A;  1TE2 A;  2OEH A;  1UT8 A;  4RPZ A;  1IM4 A;  2YQE A;  4IQV A;  4PGY A;  3MGH A;  2KFN A;  1HIW A;  3UMB A;  4PHE A;  4I2F A;  9ICW A;  2BCV A;  3WU2 U;  1X2I A;  3N7R C;  4TUS A;  9ICT A;  4J9L A;  3AUO A;  1PVQ A;  2WHE A;  9ICH A;  4Q8E A;  2OXO A;  2H3V A;  8ICH A;  3H0R B;  5KFJ A;  2Q0Z X;  4UAV A;  5CB1 A;  4LVS A;  3OSP A;  2XC9 A;  2ASD A;  1ZRN A;  5AI6 A;  1RZT A;  3BS5 A;  4O3O A;  9ICE A;  3WK4 A;  3BZC A;  9ICR A;  5KT2 A;  1OXJ A;  1F5S A;  5J0T A;  2V9W A;  3M6Z A;  4US8 A;  2OHF A;  2UVV A;  4DFP A;  3GIL A;  4GC7 A;  1SV0 C;  2JR5 A;  1N62 A;  3B0X A;  1KW4 A;  2AQ4 A;  1B43 A;  4ED7 A;  3GV5 B;  4C4T A;  2E8O A;  5ALO A;  2Q4T A;  2AGO A;  2XCA A;  4R64 A;  2WF9 A;  1WWV A;  3SV3 A;  5AIB A;  1WUD A;  2ODG A;  4RPY A;  3SZ2 A;  5ALU A;  5J2B A;  2VA3 A;  4DEZ A;  5H2F U;  2W3R A;  9ICQ A;  3UXN A;  1QSS A;  2KIW A;  5KT6 A;  2UVR A;  3JPT A;  3C2L A;  4I2H A;  1SL0 A;  4I2I A;  2XIC A;  3IRU A;  4I2D A;  5JTI A;  5F9N A;  5ALF A;  1N56 A;  3CRX A;  1TVA A;  2W9A A;  4J9K A;  1X9X A;  1LKY A;  2AXT U;  2KHV A;  1B22 A;  2ZIW B;  5KNI A;  3ORY A;  4YN4 A;  4TUQ A;  5KG2 A;  1ZQF A;  2R8G A;  2WF7 A;  1KDH A;  1RDF A;  5KFL A;  2MUT A;  2HI0 A;  3M9N B;  1BNO A;  2BCS A;  2PMZ F;  1OUQ A;  2E5S A;  5HHI A;  1SB3 C;  2Y9T A;  1N63 A;  4RQ3 A;  9ICB A;  2VKQ A;  4RQ7 A;  3G6V A;  4FBT A;  1DXS A;  5KG3 A;  3BS5 B;  9ICS A;  9ICC A;  2YB4 A;  4Y2U A;  4DL3 A;  4ECR A;  1TAQ A;  5J29 A;  1NK0 A;  3NUQ A;  9ICL A;  4NLC A;  2YMM A;  1ZQA A;  2P6U A;  1L3V A;  3RF9 A;  3ZDE A;  4NLB A;  2XCP A;  1S77 D;  5C5J A;  1T8E A;  4F8R A;  2HVI A;  2FJ6 A;  2BQU A;  4M9J A;  4ECS A;  2RRD A;  3NVY A;  7ICP A;  3RH5 A;  3NTU A;  4YVZ A;  3PW7 A;  4LZG A;  4KLG A;  4O3Q A;  2IMW P;  4PL1 A;  1QSY A;  2ZIX B;  2D3D A;  1N2X A;  2W54 A;  3QYP A;  1S97 A;  3RH4 A;  2WB1 F;  1ZQI A;  4G9B A;  1KFD A;  4QZB A;  2ZIV B;  4F3O A;  4UB6 U;  3N7S C;  5JU5 A;  3MR2 A;  4PJ0 U;  5AKL A;  7ICF A;  1NOM A;  2WAQ F;  2BCR A;  2FLP A;  7ICK A;  3PW2 A;  2GOL A;  2VIX A;  5KFR A;  4Q43 A;  1FEZ A;  4DL4 A;  5DGB A;  4Y2J A;  5DDY A;  5KFX A;  3D2N A;  4JV2 A;  4C4R A;  2AGP A;  4BDP A;  2VJ5 A;  1D8Y A;  2PFQ A;  4JB3 A;  1SZH A;  2QB0 A;  4J9S A;  4NL9 A;  3SEN A;  2H3I A;  1ZOL A;  3AMZ A;  1Q8K A;  1LKY B;  1N60 A;  4QZI A;  5EWF A;  4YMM A;  3SR6 A;  3PW5 A;  2BPF A;  4UW9 A;  2DFL A;  4PH5 A;  4NM2 A;  2HOF A;  2DPJ A;  1SWW A;  4I2G A;  3M8S A;  1WCL A;  5J2H A;  3ZDC A;  1ZQJ A;  5KFG A;  4B9L A;  4YR2 A;  4YR0 A;  2NV3 A;  2NYV A;  1NK7 A;  1DRG A;  1QTM A;  1TK0 A;  2LMR A;  5A0L A;  2ASL A;  3WK9 A;  4C7Y A;  2FMQ A;  1RM6 C;  2EZX A;  2ZXH A;  8ICU A;  1ZQN A;  3T3F A;  5EE0 A;  4QWA A;  1NJW A;  2E8N A;  3NVV A;  3EZ5 A;  3GIK A;  3JPR A;  4AYB F;  3PVX A;  1BNP A;  2ZJA A;  4ZH4 A;  1NKB A;  4ELT A;  2W3S A;  2XGP A;  8ICA A;  5EWG A;  1S8O A;  2W55 A;  3ED5 A;  4UB8 U;  3V72 A;  1ZQK A;  4PPX A;  1QQ5 A;  3QU7 A;  1JRP A;  3PO5 A;  5KFY A;  1RQN A;  5ALZ A;  8ICT A;  1O03 A;  1MA7 A;  2BDP A;  3BQT A;  3MR3 A;  4DF4 A;  4Q44 A;  2GH1 A;  1AQ6 A;  4P0Q B;  4EEL A;  3AU6 A;  4RNN A;  2KD1 A;  2H3Q A;  1Y88 A;  3AQF A;  4RU9 A;  4DSL A;  3V6K A;  2BR0 A;  3RJH A;  2W9B A;  4I2A A;  2VA8 A;  3L5K A;  5KG4 A;  3K4G A;  3FDS A;  1PVR A;  3RTV A;  1SWV A;  3TAD A;  4QIW F;  4Y2Y A;  3UM9 A;  4RQ8 A;  5HR6 A;  3TKA A;  1SXE A;  3MDC A;  1K1Q A;  2R18 A;  4UAW A;  3M9O B;  2DKX A;  5KL1 B;  5DQG A;  3FAH A;  5J0Q A;  1V85 A;  9ICV A;  1XSN A;  3GZF A;  1FFU A;  5AK4 A;  3OJU A;  3C28 A;  2GWS A;  2QB0 B;  4DSE A;  5J0S A;  3PW4 A;  1COK A;  4F4Y A;  4B9S A;  2KMD A;  1COO A;  5EE1 A;  1F0M A;  3WKD A;  1JIH A;  2OCE A;  2NO5 A;  3A0H U;  3TAC B;  1Z00 B;  4ICA A;  4PZO A;  4NM1 A;  3AEV A;  3SEI A;  1VDV A;  4QZF A;  5KFA A;  3SAF A;  3UQ2 A;  4IR1 A;  3ISB A;  1CI4 A;  2OWO A;  5ALD A;  4DLE A;  3SV4 A;  5AI5 A;  2FI1 A;  2BDU A;  4O3R A;  2EZZ A;  5DKW A;  5J0X A;  1X42 A;  5KFP A;  4Y2S A;  2MSN A;  2RQ5 A;  4UAZ A;  4ECV A;  3PST A;  1MC8 A;  4EBC A;  2EAP A;  4CGZ A;  2GO7 A;  5C0Y A;  1SV0 A;  4C8K A;  4KLL A;  4KN4 A;  2DPI A;  1U47 A;  3PO4 A;  5CWR A;  5AKH A;  3PML A;  1JXE A;  4NLN A;  1X6J A;  5CRX A;  2HHS A;  4Z6D A;  3T5H A;  1QH9 A;  2ZIU A;  2KEY A;  1JUD A;  2BZF A;  3NRW A;  4RQ6 A;  2FE9 A;  2YY6 A;  2D6F C;  2JRZ A;  1KEJ A;  4DL5 A;  1Z1V A;  4DQQ A;  4KLJ A;  3G6X A;  3H8W A;  3MR6 A;  3UPQ A;  4J9M A;  4JV1 A;  3HRD D;  4R8U A;  7ICM A;  1UT5 A;  4Y2R A;  5AI8 A;  4HAI A;  3IN5 A;  1HUZ A;  2C2D A;  1K1S A;  2BQ3 A;  3IV6 A;  3QUQ A;  1ZQW A;  9ICO A;  2IBK A;  4Y2Q A;  4J03 A;  3QEA Z;  4DO9 A;  3EUB 2;  5KFS A;  4ED3 A;  5KFQ A;  2A1J B;  4MHV A;  3EW9 A;  1O08 A;  4EX7 A;  3GII A;  4QW8 A;  4E0D A;  1SL2 A;  1ZET A;  5EE9 A;  2WTF A;  4O0I A;  4ED2 A;  2ZJ8 A;  3TI0 A;  4ECX A;  4TUP A;  3L3F X;  5CR0 A;  4DOB A;  3BQ0 A;  1XU4 A;  1IV8 A;  5KL8 B;  3WKE A;  2RLT A;  1ZQD A;  3WKA A;  5AM2 A;  2GLE A;  2KKV A;  2J6S A;  1L3U A;  3ALR A;  3WK5 A;  1L7M A;  5ALV A;  5BOM A;  1X6I A;  4DFJ A;  3GV7 B;  3E0F A;  5IIN A;  1ZJN A;  4YXM A;  3GIJ A;  2I9G A;  5J0W A;  2K4H A;  7ICE A;  3M7D A;  1N5X A;  2ZIU B;  2EAM A;  8ICV A;  1KN5 A;  4RQ0 A;  1LB2 B;  4USA A;  4B9M A;  5TIS U;  1PZN A;  3AN1 A;  5AK6 A;  2YN4 A;  3SMV A;  2HOI A;  5AIC A;  1ZD4 A;  5KFU A;  2W8L A;  3KHG A;  5J2K A;  3AU2 A;  1ZQZ A;  1J97 A;  1D9F A;  3PZP A;  1A6S A;  4ACO A;  4YG2 A;  3UXO A;  5DGA A;  5DB9 A;  1OW5 A;  2DBY A;  1B4F A;  2WF6 A;  1NZP A;  2FMS A;  1XNS A;  4KMO B;  3ETL A;  1KRP A;  4DOA A;  3D2Q A;  1ZQT A;  4U6P A;  4KLS A;  2N1R A;  4KLO A;  4UB5 A;  4DFK A;  2DGZ A;  2MAX A;  5G5G A;  2KKP A;  3VCB A;  4QZD A;  3WK6 A;  4DS4 A;  2G08 A;  3RJI A;  2KJ9 A;  1V38 A;  1Z4O A;  4PGQ A;  2H3F A;  5L9X A;  3GIM A;  1X9M A;  2XY7 A;  2KSO B;  4F4W A;  5KFV A;  4FFD A;  3RJJ A;  1S0O A;  3H0M B;  4NXZ A;  1RXV A;  1ZQL A;  5KFE A;  3EYZ A;  2KZM A;  2K8B B;  1L3S A;  1S10 A;  8ICK A;  2ZUD A;  1CUK A;  3BDP A;  4HYK A;  2CPR A;  1ZQX A;  3EWA A;  3QUT A;  1L8L A;  1ARO P;  4F5P A;  2RDJ A;  4DQR A;  2RP5 A;  4OJL A;  8ICO A;  1QCK A;  3OHA A;  4DOC A;  4F93 B;  2AU0 A;  2C2R A;  7ICL A;  2YTU A;  4P4O A;  5ALE A;  2VAN A;  1U4B A;  1KL9 A;  4M47 A;  4P2H A;  4I2C A;  5ALW A;  5KT4 A;  4PL2 A;  3PX0 A;  3DEE A;  1NK9 A;  3C1Z A;  1T94 A;  3V7K A;  4RQ2 A;  3GV8 B;  5J2J A;  2LM4 A;  2KJ5 A;  4P4M A;  1J2N A;  3V6H A;  4B9U A;  1U9L A;  4UQG A;  2P35 A;  1DK3 A;  1RYR A;  5IIL A;  5KG5 A;  2H5X A;  1V97 A;  2XY5 A;  5KFK A;  4UAY A;  4JWN A;  1KLN A;  5KFF A;  4EEY A;  2HCF A;  3FYH A;  2MRL A;  3QE9 Y;  2D8C A;  4MF8 A;  4FZN A;  5BPC A;  5KFZ A;  4DFM A;  4ECY A;  1A0P A;  1N48 A;  5ALT A;  3KTQ A;  3MGV A;  4Q8F A;  1SXD A;  5AKK A;  1S9F A;  3HW8 A;  1NJY A;  5HHH A;  4OD0 A;  8ICJ A;  3ICX A;  4JMU A;  5AI0 A;  1M6Y A;  4OJP A;  4TQS A;  3RJE A;  1BPZ A;  5AKY A;  2G09 A;  4P0P A;  3PSP A;  4I2E A;  1KBU A;  7ICH A;  4DCC A;  5HMM A;  5AKZ A;  4K4I A;  4C8M A;  5ALI A;  3KBB A;  1SKW A;  4I29 A;  4DS5 A;  5AM5 A;  4UBC A;  4I2B A;  4TQR A;  1XSL A;  2NRT A;  3EPG A;  2F76 X;  3FM9 A;  3IDW A;  3QUC A;  2RHF A;  1U49 A;  2W9M A;  1IXR A;  2LPE A;  4KN7 A;  4Y2V A;  4YR3 A;  5AKG A;  1MQ3 A;  3D6J A;  3Q8R B;  1KFS A;  2EQY A;  3LWL A;  2VA2 A;  2H3Z A;  3VC8 A;  3CNH A;  3UMG A;  3IG8 A;  2W43 A;  3ZDD A;  2QKQ A;  2QLT A;  3GU3 A;  1BPE A;  4G3I A;  3KHL A;  9ICU A;  3B0Y A;  4RUA A;  1PVP A;  8ICZ A;  4AYB C;  3H0L B;  3RR7 A;  4KLM A;  5L1K A;  4UB2 A;  4YP3 A;  1LV5 A;  1S76 D;  2LBO A;  4R63 A;  2K89 A;  3N7P D;  3SQI A;  2EAO A;  2IA6 A;  4F92 B;  1KTQ A;  4F2R A;  5J2G A;  1X40 A;  1A76 A;  1L5U A;  2R8I A;  1U45 A;  1BGX T;  2IOF K;  2DQN B;  4I27 A;  5AKJ A;  2HHW A;  4QJF B;  1Z19 A;  5ALY A;  4DWI A;  4M6W A;  2LHT A;  3C2K A;  5DLF A;  4QZE A;  3QU2 A;  1ZQO A;  3L4P A;  3RBE A;  3Q8M A;  3ZI4 A;  1X66 A;  4KLD A;  4M9H A;  4DSF A;  1KQQ A;  2ISO A;  1BVS A;  2P6R A;  3ZDA A;  5F3X B;  3LK9 A;  2MUT B;  1HEK A;  5DG8 A;  4CCH A;  2QB1 A;  3CW2 C;  1SL1 A;  3G6Y A;  8ICM A;  1P7D A;  4M2Y A;  4KX5 A;  2YML A;  1TKD A;  3PR5 B;  3H4D A;  5IIK A;  4UAR A;  3PY8 A;  5KT3 A;  2W7P A;  5T14 A;  8ICP A;  2HHV A;  2E8P A;  5DG9 A;  1K5O A;  4PHD A;  2BCQ A;  2E8M A;  2W7O A;  5L1M A;  2KE7 A;  4Z6C A;  1SGG A;  2HBM A;  1L7N A;  2EZY A;  2K8A A;  3QZ8 A;  2XI9 A;  1DK2 A;  5HNK A;  5ALP A;  1ZD5 A;  2A1A A;  2KTQ A;  4ECQ A;  4CNQ A;  3NGD A;  3ISC A;  5KFT A;  4IQW A;  2E1E A;  2JH7 A;  2KNJ A;  2MU2 A;  4XUS A;  4IRC A;  3H8M A;  1RPL A;  4NLG A;  4QNL A;  4B9T A;  4ED8 A;  1Z3E B;  3GFK B;  1X9W A;  4MFC A;  8ICE A;  5IIJ A;  2ZTD A;  3F5A A;  4RUC A;  1DOQ A;  5HR7 A;  2KJ8 A;  4RNM A;  2BQR A;  2ASJ A;  2BKE A;  1L7P A;  5J2A A;  2W9C A;  1XS9 D;  2K60 A;  7ICN A;  1YZ7 A;  4M9G A;  9ICA A;  5J8Y C;  1TK5 A;  4QWC A;  4UBB A;  4UAT A;  4M6W B;  2KK0 A;  3HT3 A;  4F4X A;  1ZQU A;  2F2A B;  2CXY A;  3N97 B;  4NLZ A;  2NO4 A;  3R9K A;  5JRT A;  2XVT A;  1SV4 A;  3NRZ A;  4A8E A;  2E1F A;  2AHO B;  3RRH A;  3JPN A;  4RZR A;  1IIP A;  4F5Q A;  3QU9 A;  4O3S A;  4AP9 A;  3MFH A;  4FE3 A;  4EZ6 A;  3QU4 A;  3RFA A;  1DGJ A;  2VJ4 A;  1GO3 F;  1ZQ1 C;  4IL6 U;  1FFV A;  2EAN A;  1S0V A;  1NK8 A;  4C8O A;  4KLT A;  2K4E A;  7ICV A;  4IRK A;  1QQ7 A;  4YMN A;  2HHU A;  1NJZ A;  3QXG A;  3ETR A;  4J9O A;  5AK5 A;  4M9L A;  2KFZ A;  3LWM A;  2Y0S C;  2LM1 A;  3QEB Z;  4QWD A;  3HKZ F;  3OGU A;  3T79 A;  2HBJ A;  4DL6 A;  2JEG A;  1ZYQ A;  5DBB A;  2OM6 A;  3PSF A;  9ICM A;  2HBL A;  4QWE A;  4RQ4 A;  2K8C B;  3TAR A;  1XO0 A;  4XA5 A;  2HHQ A;  2PXI A; 
#chains in the Genus database with same CATH homology
 3H8M A;  3BS7 A;  1COK A;  2B6G A;  2KMD A;  2Y9T A;  2KSO A;  2EAO A;  1F0M A;  1OW5 A;  3BS5 A;  1X40 A;  1B4F A;  3TAC B;  4MHV A;  1UQV A;  4PZO A;  2ESE A;  2LMR A;  1DXS A;  1B0X A;  2F44 A;  2K60 A;  3SEI A;  3BS5 B;  1OXJ A;  2KG5 A;  2D8C A;  5J8Y C;  2DL0 A;  2QAR A;  1SV0 C;  1X66 A;  2JV3 A;  2K4P A;  4IS7 A;  2E8N A;  3KKA C;  2L5Y A;  1KW4 A;  2KIV A;  2QAR B;  5F3X B;  2E8O A;  1V38 A;  5JRT A;  1SXD A;  1SV4 A;  2QB1 A;  1WWV A;  1UCV A;  1PK3 A;  2KSO B;  2EAP A;  3TAD C;  3HIL A;  2GLE A;  3K1R B;  5J8Y A;  1SV0 A;  2D3D A;  2F3N A;  1JI7 A;  3KKA A;  1PK1 A;  5JU5 A;  4PZN A;  2EAN A;  4NL9 C;  3BQ7 A;  1WWU A;  2Y9U A;  2E8P A;  2F8K A;  1PK1 B;  2E8M A;  3IDW A;  5JTI A;  5L1M A;  2KE7 A;  1SGG A;  2LPE A;  2FE9 A;  3TAD A;  2ES6 A;  1Z1V A;  4RQN A;  1RG6 A;  2EAM A;  1X9X A;  2YTU A;  1LKY A;  1SXE A;  2QKQ A;  2DKX A;  4NJ8 A;  2QB0 A;  5KNI A;  4NL9 A;  3SEN A;  1V85 A;  1LKY B;  2DKZ A;  2QB0 B;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...