1COKA

Structure of the c-terminal domain of p73
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
b'YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SECOND SPLICE VARIANT P73)
publication title Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1cokA00
2EAPA 2EAOA 2KSOA 4NJ8A 2QB1A 3BQ7A 4PZOA 2E8NA 3TADC 1PK3A 3H8MA 1WWVA 1PK1A 4NL9A 2F44A 2D8CA 2QB0B 1SV0A 4NL9C 2Y9TA 3BS5A 4RQMA 1SV0C 2Y9UA 3SENA 1JI7A 3IDWA 1SGGA 5JTIA 5F3XB 3TADA 1SXEA 1X66A 3HILA 1F0MA 2DKZA 2QARB 1V38A 1B0XA 1LKYA 5KNIA 1UCVA 2GLEA 2KG5A 2LPEA 4RQNA 2KSOB 5L1MA 2FE9A 3K1RB 2E8PA 2LMRA 4PZNA 2QKQA 1RG6A 5JRTA 2D3DA 1WWUA 2K60A 1PK1B 4IS7A 2F8KA 5J8YC 1COKA 3KKAA 3TACB 1Z1VA 2KMDA 2ES6A 3BS5B 1X40A 5JU5A 2QARA 3KKAC 2EAMA 1OW5A 2E8OA 2KIVA 1OXJA 2KE7A 1UQVA 2ESEA 2QB0A 3BS7A 1SV4A 1V85A 1DXSA 4MHVA 2DL0A 5J8YA 2E8MA 2L5YA 1B4FA 3SEIA 2F3NA 2B6GA 2DKXA 1LKYB 1SXDA 2YTUA 2EANA 1KW4A 1X9XA 2JV3A 2K4PA
chains in the Genus database with same CATH superfamily
2O6KA 1ZQYA 2K89A 2EH9A 3KHGA 8ICIA 2NYVA 3KD3A 5KG7A 1RQNA 2EZXA 3K1ZA 3ICXA 4O3QA 1VLBA 2IBKA 8ICVA 4NLBA 3OGUA 3KHLA 1N5WA 3PX4A 5DB7A 2W9BB 3GV5B 4DSEA 5AM1A 2W9CA 3IRUA 4DEZA 7ICMA 2UVUA 2ZIUA 3QU5A 5KT4A 2HOQA 5JUMA 3SAFA 2KNJA 8ICEA 2WFAA 4DL6A 2DKZA 4X5VA 1XSPA 1V38A 4UAWA 1PVQA 4NLKA 2A3VA 3UXPA 2VIXA 2YB1A 3F5EA 4DF8A 4DSIA 2XCPA 2W8KA 1VJ5A 2LMRA 3AQFA 3C21A 1LB2B 2QKQA 3KZXA 5AKIA 4PH5A 3OTQA 4I27A 4IQVA 2ZTCA 1X6JA 4ECSA 3WK8A 1X9WA 4YQWA 1X40A 1ZYQA 5HHHA 1OUQA 4JV2A 2KKPA 2HCFA 9ICTA 2UVRA 5AM5A 1KSPA 2W9AA 3SMVA 3C1YA 1S76D 3V6HA 8ICMA 3WK9A 2E8MA 4FS2A 1B4FA 4DQQA 4YCXA 2BPFA 1FEZA 5KT6A 4B6JA 4F5NA 2HMXA 1BPDA 1HUZA 4UAZA 2B0CA 2MAXA 5J0YA 3GV7B 3H4DA 7ICGA 2P6UA 1T4GA 4ECWA 3RB6A 5GTIU 4WJ3B 3PMLA 4M6WB 4RT3A 4J9LA 2YQEA 4M9JA 1UHUA 2WHEA 1NJXA 1TK5A 3WKDA 4MFCA 2JH1A 3D2QA 1SGGA 1NOMA 1X66A 5J2AA 5J2GA 5FP0A 5AKJA 1Z3EB 5AI4A 4HAIA 2WF8A 1XSLA 4Y2PA 2AQ4A 2PKEA 3T3FA 4KX3A 5EOZA 1YZ6A 2PI4A 1WG8A 4RQ4A 1Q3UA 2AXTU 5CA7A 4DFJA 3PSTA 2V4RA 4DL7A 3LYSA 5HMLA 5J8YC 3NTUA 3NVZA 3IM1A 3GU3A 3BS5B 1U4BA 3M7DA 2JEFA 4JWNA 1U9LA 3PX0A 5J29A 2AJQA 4UW9A 2W8LA 1V85A 1L8LA 3N28A 1ZD3A 4EX6A 4I2BA 4KLUA 4US8A 1QSSA 5KFYA 1ED1A 1A77A 4UQGA 7ICJA 4C8MA 4J9QA 3H7IA 2YMLA 2PMZF 4QZAA 4FBUA 5KFEA 1X9XA 2DBYA 3G6YA 4BWJA 2ASJA 2RDIA 2I9GA 5ALMA 8ICPA 5H2FU 5ALEA 2C22A 7ICLA 3FAHA 3ZDDA 5EWGA 5ALDA 1KL9A 4KLEA 4F71A 5KG1A 3F53A 5J0RA 2KN7A 4K4IA 4TUQA 5T14A 4GXIA 2Y1IA 1M6YA 4U6PA 1S0NA 4Y2SA 1RDFA 5DG7A 3V6JA 1L7OA 1UA0A 4F4WA 2KJ9A 3PSPA 5F9LA 3B9JA 3MR2A 1K1SA 4O9MA 5AI6A 3QUQA 2KG5A 4FS1A 4QZBA 2ZIXA 2G08A 4G9BA 4XRHA 4R8UB 4KLFA 3T5JA 1J2NA 3PY8A 5B5EU 2E1FA 3SV4A 1ECWA 3MR5A 4KN7A 3EPIA 2FI1A 5DBAA 5KFRA 3M9NB 5AK5A 4P0PB 3PVXA 1ZQBA 1SB3C 3EZ5A 2Y1JA 4UB5A 1N2XA 4FO6A 4UB3A 2XY5A 1ZQGA 4QZIA 2I5HA 4KLTA 3TANA 3AM9A 2LBOA 3QU4A 4KLJA 4C8LA 7ICQA 4PHEA 3GFKB 4K4GA 2XY6A 1V97A 4ED8A 4CE6A 4UB1A 3OHBA 3AQEA 4UB8U 1P7DA 5L1LA 5ALGA 1Q3VA 1WCLA 5KG3A 2G06A 5J2DA 1X9MA 3H8JA 1ZQOA 4LZGA 1TE2A 3RB4A 3BJYA 3PSFA 4DSFA 5CRXA 1KDHA 4XA5A 2DFLA 4YR2A 4BDPA 4PHPA 5HNKA 3BQ2A 1QQ7A 2W7PA 2XVTA 4F3OA 4MEYA 2PMZC 4ECXA 2VA2A 2H3VA 5KT2A 1NKBA 9ICJA 5DGAA 4RQNA 2VA3A 4DSKA 1UT5A 3K1RB 4I2JA 8ICOA 2G0AA 1ZQFA 4KLMA 1T94A 4UAVA 2MRLA 5JRTA 2FPLA 5J0QA 4IS7A 3QYPA 5KFUA 2BDPA 4BUGA 2C2EA 2IOFA 2BGWA 4Y2JA 2ES6A 2JEGA 4PPXA 3B0XA 4MF2A 7ICNA 4Y2YA 1SV4A 2E3TA 4BXOA 2ZG6A 2FJ6A 2IHNA 1NJWA 2GWSA 3HT3A 3KHRA 1MA7A 3KTQA 3RR7A 2JZBB 1IM4A 3DV9A 1JROA 2ZIVA 5D49A 4Y2QA 4O5EA 8ICFA 2NRTA 3HWTA 2FLLA 5DBCA 2BCUA 4B9MA 1TFRA 1SKSA 2HHXA 2MSNA 1S0MA 2H3IA 1Z00A 2KSOA 4ED2A 2HBLA 4DFMA 2OH2A 2E8NA 3UMCA 1MQ3A 1JMSA 5AKHA 2XC9A 4J9RA 4AP9A 5AKZA 2R8HA 4YD2A 5IIOA 2Y9UA 3HKZF 5TISU 3GDXA 5ALRA 4ACOA 3ISDA 4RUCA 5KFMA 2R8GA 1U49A 3OPXA 2HVIA 3AN1A 3H4BA 2CPRA 1ZD5A 2XO7A 3SV3A 4YVZA 1AROP 1QSYA 4KLSA 3HPOA 3N97B 1ZQEA 4M9HA 2ZJ8A 5AM0A 4UAUA 3T79A 4RNOA 9ICHA 1H38A 2B21A 2NV3A 5DB6A 3ZDAA 4CF3A 3WK4A 2WF5A 3L4PA 2HVHA 4RQ0A 2AU0A 2JR5A 3TACB 2G5IB 3TARA 3QZ7A 1ZQUA 2K8CB 9ICMA 2A1JA 2K4HA 4M9LA 3RR8A 3E58A 2ZTDA 4XUSA 3K75D 2E8OA 3AU6A 3ZDBA 3L5KA 4TURA 5DLFA 2EZZA 1UPHA 2OYYA 3OJUA 4JUZA 2DWQA 3TFSA 2R8JA 1RM6C 4Q44A 1RXVA 4O3RA 4FFDA 4CF4A 1LKYB 4GC6A 1TVAA 4TUSA 2DPIA 4J9MA 4P0QB 4Q45A 4DCCA 2H5XA 2M0NA 4QZCA 2XGPA 1IIPA 2EAOA 3OJSA 2RDJA 4B9NA 4O5KA 3PMNA 4C0ZA 1Q46A 2IHMA 4B9TA 1IG6A 1ZQVA 2BCRA 2HHWA 4MEXA 1S0VA 3WKEA 4I2GA 4DOCA 3ZDCA 4KLOA 2QB0B 3F2CA 5ALPA 4NL9C 4UARA 3BZCA 5AHXA 1Z4NA 4ED3A 5J2BA 4Q8EA 2YB4A 1SZHA 1ZQZA 5G5GA 3TADA 5ALWA 1SXEA 5IINA 4CRXA 3ORYA 4RU9A 4RNMA 4DL3A 1ZD4A 2VJ5A 1S77D 3TAQA 1L5UA 3RBEA 2A19A 2AQ0A 5D46A 4F8RA 7ICFA 4RQ8A 3MGIA 4JWMA 4UASA 3NS1A 3B0YA 4EBDA 4I2FA 2DQNB 3SYZA 2YX8A 4C4TA 1J2MA 3CNHA 3CYMA 4ECTA 3TAPA 4USAA 5ALJA 2F76X 3V7JA 4KMOB 3D2SA 3G6XA 2W9CB 5KL1B 2UVWA 1S97A 2ZIUB 3ETRA 3E0FA 5ALNA 3C5FA 4DOAA 5L1KA 3LWLA 1JN3A 4UB4A 1OXJA 3ZD9A 1UQVA 5AK4A 4RUAA 2ZTEA 2PFOA 4KITB 4RPYA 1NZBA 2WAQF 3ETLA 5DBBA 4ELVA 1S0OA 3Q8MA 1TK0A 1BVSA 3SEIA 1F5SA 4JB3A 3QU7A 5AI0A 3UMBA 1L8OA 1GO3F 2XCAA 3NRWA 1FO4A 2R18A 1ZQCA 3JPNA 4KMUA 4U7CA 2QB1A 2WB1C 1CRXA 3GIKA 2OWOA 2W11A 3UQ0A 1S10A 1HIWA 3PW5A 1D9FA 1ZQQA 1KKXA 3KFUF 3JPTA 5KT5A 1ZRMA 2N1RA 4F50A 3UXOA 2GH1A 2RRDA 1B43A 2BCQA 4DOBA 9ICVA 4UB2A 1PVRA 2NRWA 4IRCA 4M6WA 4O5CA 4IL6U 2W7OA 1QSLA 1XC9A 3ALRA 1QH9A 3RB3A 1T7PA 2OEHA 1NK9A 5AIBA 2V9WA 3F2DA 3NVYA 5HR6A 4I2HA 3QEAZ 4PGQA 3C1ZA 5BOLA 2MA1A 1EXNA 4QWEA 5AI9A 2PFNA 4O3PA 9ICCA 3AUOA 1NNLA 3WU2U 2XIDA 9ICQA 4JK1A 4RQ7A 4Z6EA 2KJ5A 5K4LA 4QZ9A 4QWAA 2DGZA 3CP8A 3N7SC 2L5YA 5KG2A 1DK3A 2DKXA 1X6IA 3M1YA 1SZPA 7ICHA 4LZDA 3H40A 5AIAA 2KTQA 4EX7A 3VCBA 4KLHA 2ZIWA 5KFKA 3PV8A 1BPXA 5J2KA 5CR0A 7ICVA 2RP5A 3BQ0A 1NJZA 3WKCA 1J97A 4F5RA 5DG8A 2YY6A 4AYBF 4LJXA 4RNNA 2BQRA 9ICSA 4PZOA 4QWBA 4YMOA 1PK3A 4GXJA 3LK9A 1C7YA 4F5PA 9ICIA 3NGDA 2BPGA 5ALHA 2FPKA 2Y0SF 2KZMA 1JI7A 3DEEA 4F5OA 2DUYA 5ALOA 3G6VA 3IP4B 3T5KA 2WTFA 5F3XB 4B9LA 2OCEA 3A0BU 5IIMA 1N60A 4UBBA 2BPCA 3RJFA 4F4KA 1CUKA 1KQQA 4NM1A 5AKXA 3GIMA 2H3ZA 5L1IA 2AGPA 1UCVA 2MUTA 5J0UA 3LWMA 1FFVA 1MQ2A 4DS4A 1ZQTA 4UB6U 3F2BA 2NO5A 3RJHA 4ED7A 5EE0A 2BZFA 2KK0A 1K5OA 2RHFA 2F1JA 2NRVA 4PGXA 2P35A 2K60A 4I2DA 4KLIA 2G09A 3JPOA 4YFKA 4YR3A 5KG5A 1ZQNA 2I6XA 3I76A 3OHAA 4FZMA 2KICA 3KKAC 4UBCA 2KV2A 2JH7A 1ZJNA 3QU9A 3ZD8A 5DQHA 3M9OB 2ESEA 2R8KA 2RQ5A 4YG2A 3PO4A 4I28A 2EZYA 1SKRA 1JXLA 1KLNA 1ZQSA 1Q8KA 2AGOA 1NKEA 4YMMA 3D6JA 4TUPA 5BOMA 3RAXA 1TK8A 2ZIXB 5HHIA 2FMQA 3PR5B 4O3MA 5EWFA 2FLPA 4NLZA 4FE3A 2W3RA 3HW8A 3M8RA 3QUTA 4NJ8A 5EE1A 4LVSA 4F91B 1L3VA 9ICLA 1QTMA 4QIWF 3AU2A 4ED1A 1PK1A 4ZOHC 2C2DA 4NL9A 1S5LU 1DRGA 5J0WA 2D8CA 1QLNA 1BNPA 2Y9TA 3RRGA 1CI4A 5KG6A 5AKLA 4J9KA 3EPGA 8ICXA 3CW2C 5JTIA 3HX0A 2KZ3A 4BWMA 5KAFU 3THVA 3C2KA 4RZRA 2HBMA 4KTQA 4ECRA 5AK6A 4UATA 3V6KA 4C8KA 1SL1A 4Q8FA 1XNSA 2F2AB 5ALKA 1BPBA 1ZETA 4EZ9A 3IG8A 4DL2A 1RPLA 3GIIA 2GLEA 1XSNA 1RYRA 2LPEA 1ZQDA 3MABA 1Z1BA 1QQ5A 1SWVA 2XGQA 4QWCA 2ASLA 3QXGA 3GQCA 5KFJA 2KFZA 1T8EA 2P66A 4RQ2A 1T3QA 2F1IA 1A6SA 3RJGA 2KMDA 2IOHA 1OW5A 2NRZA 1L3TA 2HHVA 2KIVA 2H3QA 1VDVA 2LM4A 1WCNA 3BS7A 4MHVA 3LVWA 4ECQA 4NY8A 1Y88A 4O3OA 3EUB2 5IILA 3NVVA 4NM2A 1RYSA 3SAHA 9ICRA 3LVVA 4QZGA 2WF9A 4RPZA 4ZH4A 2LHTA 1DOQA 2ZXIA 1JRPA 2EAPA 1RQLA 4NWIA 2BR0A 3C2MA 2CXYA 4YXJA 3N7RC 5AK3A 3EYZA 2XY7A 1BPEA 2EDUA 4C7ZA 8ICKA 5DG9A 5AKEA 5KFBA 4EYIB 2ALZA 4P4PA 3AL0B 2AH5A 3ONNA 3RJEA 2J6SA 1X42A 4OCZA 1BPYA 4BXOB 4DQPA 3F5AA 3M9MB 3H0MB 3CRXA 1NK8A 1NK5A 5AI8A 5KAIU 2ZIVB 1ZQWA 3PW7A 5CP2A 9ICOA 4GC7A 1TAMA 1L3UA 3UPQA 5DQGA 3C2LA 3BDPA 1ZQAA 9ICNA 3ISCA 4YR0A 1Z00B 3ISBA 4ED6A 2KSOB 5KFFA 4MF8A 2KD1A 8ICTA 2FE9A 3NASA 8ICJA 2FPMA 1NKCA 4PZNA 3I1YA 3QE9Y 8ICAA 1ZD2P 3H0RB 4MFAA 3JPPA 4QJFB 3BQ1A 1JUDA 1ZQRA 3RH4A 4CNQA 4DLEA 3QEBZ 4M2YA 2HDOA 1U47A 1UA1A 4C80A 2BQ3A 1ZQKA 4Y2VA 1U45A 1B22A 3MGHA 3Q8SB 5J8YA 3RTVA 3R9KA 3MDAA 1DGJA 5J2FA 3V7LA 1NJYA 9ICXA 1PUZA 2EQYA 5IIKA 3RJIA 3FDSA 3MC1A 3VC8A 1N62A 4C4RA 4JMUA 2W03A 2HHUA 4YMNA 3TI0A 4GLXA 2Q4TA 1NK6A 1IXRA 4OD0A 3M6ZA 5HP4A 2HBJA 3BQ7A 2VJ4A 5C0YA 2IOFK 1XU4A 4R65A 2A1JB 1ZQMA 4ICAA 2KKVA 2XICA 5KFVA 5CB1A 4KLDA 2KFNA 4IRKA 1JIHA 5KFOA 2K4EA 1QCKA 3SQIA 3UQ2A 2GOLA 3SR6A 2ZUCA 3IDWA 5DB8A 3D2NA 4P2HA 3LDAA 4M0AA 1LVHA 2LYHA 5EE3A 5B66U 5KFCA 2QARB 5J0SA 2HHQA 2JEIA 3NVWA 5G5HA 5CWRA 5L1MA 2W43A 1ZXIA 2W9MA 2LKYA 5ALVA 4TQSA 2G5HB 5KT7A 3PR4A 1ZQXA 3M8SA 1X9SA 2D3DA 5E79U 1MSWD 2F8KA 4Z6FA 3KKAA 3TFRA 4B9SA 4B9UA 3RF9A 4C4SA 2W9BA 4PGYA 4KN4A 1KFDA 5CJ7A 3AEVA 4PJ0U 5ALSA 4EEKA 3MDCA 1TAUA 4DL5A 1KN5A 1ZOLA 4Y2XA 5J2IA 2KHQA 4IR1A 2XI9A 1JX4A 8ICYA 1N5XA 1SXDA 1ZQHA 2IMWP 2YTUA 3OSPA 3C28A 4QWDA 3QUCA 3HKZC 2OM6A 4IC9A 1DK2A 2BKEA 3IV6A 4CGZA 5J0OA 5F9NA 5J2CA 2HHSA 5J2JA 3Q8LA 4EBCA 4DQRA 5DLGA 3H0LB 3ZDEA 2F44A 3WK6A 4F5QA 3PW0A 4F93B 3FC4A 2W04A 2JRZA 2E1EA 4P4MA 7ICRA 1N63A 5J0TA 5KFXA 1SWWA 4DQIA 1X2IA 3KBBA 3TQ1A 4FZNA 8ICNA 1AQ6A 5ALQA 3HILA 1L7MA 3PNCA 3WKBA 4RQ1A 2YMPA 4KLGA 4GFJA 4B9VA 4KX5A 4BGDA 4DFPA 5KFNA 7ICOA 2E5SA 2BCVA 2HHTA 5AI5A 5J2EA 5J2HA 5KFHA 3UM9A 5KFZA 2R8IA 4EENA 1V9PA 2PXIA 1RXWA 1WWUA 2W55A 4KLQA 1JXEA 1YZ7A 2PI5A 5KL8B 4J03A 4MFFA 5ALLA 3PW4A 4F2RA 2ZJ5A 4NV0A 3RH6A 4JV0A 4CDGA 3ED5A 4OJPA 4ED0A 1KEJA 4FBTA 2ODGA 4Q43A 1L7NA 3RBDA 4OO1J 4PHDA 1KRPA 4JV1A 3T5HA 3IN5A 2KOBA 1BNOA 4IQUA 4DLGA 5KFWA 5TZVA 3QZ8A 3GZFA 4HYKA 2ZUDA 2VA8A 1NZPA 3V72A 3NRZA 2LYBA 4R64A 2YMQA 1MN8A 2F1HA 2W3SA 2DF4B 2JHDA 2IA6A 1Z19A 2K4IA 2Q0ZX 3FYHA 1S8OA 4F4YA 3SI8A 9ICAA 1YT3A 2AHOB 1MC8A 2OHFA 4EZ6A 2P6RA 2JGAA 1NK7A 4Y2TA 3C23A 3JPQA 3BS5A 2HOFA 2NRXA 1SV0C 4F4ZA 4US9A 2JEJA 5HR7A 5KTQA 4RQ5A 2D6FC 5A0LA 5AM2A 4NLCA 2CN1A 1NI3A 3KZIU 2LI6A 4I2AA 9ICWA 9ICPA 8ICRA 1HJPA 5DB9A 3IHQB 4IQTA 2ZIWB 5AM3A 4C7YA 4O3SA 1B0XA 7ICUA 4ELUA 3E2EA 1SL2A 4EELA 1IV8A 3WKAA 3SZ2A 4K4HA 2WAQC 3O0FA 1ZQJA 1ZRNA 3NUQA 4Z6CA 3GIJA 2FDRA 1COKA 2KZZA 1COOA 4DFDA 1TV9A 3QNMA 4QW9A 3PO5A 2K8BB 3EWAA 2EAMA 2F77X 2DPJA 7ICEA 4F4XA 4F2SA 2V4QA 2BHNA 4Z6DA 2AGQA 1SL0A 3RAQA 4ELTA 4ECZA 3N7PD 1HUOA 2J6TA 4ECYA 3H8SA 5L1JA 1N56A 2MUTB 8ICBA 1XO1A 3A0HU 2K4PA 3DDHA 4RQ6A 5AKYA 5KFGA 3J81j 1NK4A 5KFLA 4YD1A 4RQ3A 2FMSA 9ICEA 4EBEA 4O3NA 4ECUA 4YN4A 3MR6A 5ALIA 3TADC 4J9PA 7ICKA 8ICZA 4R8UA 4QZHA 8ICQA 2KJ8A 3BZKA 1WWVA 2FLNA 2JXJA 2MU2A 2Z7JA 5CEHA 2PFQA 2HOIA 2NO4A 1T3NA 4I2IA 4RQMA 4I2EA 4CF5A 1SKWA 4P0PA 4DWIA 2KP7A 3HRDD 7ICSA 2FMPA 4J9SA 3Q8KA 5KT3A 4YXMA 2J6UA 5J0XA 3SD7A 4E0DA 4RT2A 5KFTA 5GTHU 4QZEA 3PZPA 8ICSA 8ICCA 3FM9A 5BPCA 4J9OA 3RH5A 4DF4A 4G3IA 2WF6A 4QZ8A 4R63A 3GV8B 9ICBA 2M9NA 3T5LA 4DO9A 3KOOA 4YP3A 9ICUA 9ICKA 1PK1B 1N61A 5ALFA 3RB0A 3M6KA 5IIIA 4DS5A 1CEZA 5DGBA 3RFAA 5DDYA 4QZDA 3PW2A 1ZJMA 1KBUA 5AICA 2VANA 4M47A 2JMGA 3QU2A 1DGSA 1D8BA 2KE7A 2K8AA 3SAGA 1FFUA 5HMMA 5AKKA 1L6NA 4AYBC 4PHAA 1KFSA 8ICWA 2DL0A 3MR3A 1A0PA 1NK0A 4M9GA 1TKDA 1ZQ1C 7ICIA 2LYAA 4C8OA 3HP6A 3C5GA 1TAQA 3GILA 3WK7A 5AKGA 5IIJA 1Z4OA 2KEYA 2Y0SC 2KHVA 4OJLA 2KVCA 3QX7A 4Y2UA 4F72A 1QQ6A 5D4BA 5KFIA 3RJJA 3MGVA 5DKWA 1LV5A 3I28A 3PX6A 3UXNA 5KFPA 7ICPA 5KG4A 3H8MA 4IRDA 4CCHA 3U26A 1XO0A 1L7PA 2ZUBA 4I2CA 1UT8A 2HBKA 4M04A 1HEKA 1RYUA 3MBYA 4DFKA 4OJOA 2ISOA 4A8EA 4EYHB 3MFHA 8ICHA 1D9DA 9ICGA 1FIQA 1WUDA 4R66A 1D8YA 2JZBA 5L9XA 2RLTA 4FZLA 1F44A 1D8LA 5KNIA 4QZFA 2PFPA 1BPZA 1WYGA 5KG0A 3L3FX 3ZI4A 4GIBA 5ALYA 2QLTA 3N4MB 3UMGA 3K4GA 5J0PA 4O0IA 4RPXA 1RG6A 4M9NA 4DQSA 4BJQA 2HW3A 7ICTA 5EE9A 4IQWA 2HSZA 2ASDA 1Z1VA 3OSNA 2GO7A 3RJKA 5C5JA 5JU5A 4UAYA 5ALXA 2G07A 5KFDA 4PL1A 3JPRA 1XWLA 1S9FA 1O08A 4I29A 4DSJA 1U48A 2KVSA 2CRXA 4XQ8A 2YMMA 2ATLA 2OXOA 4C8NA 4QIWC 5ALZA 5ALTA 3HJEA 5KFSA 3RRHA 1KW4A 4KLLA 3Q8QB 1O03A 3IG5A 2BDUA 5DDMA 5EWEA 1PVPA 4DSLA 3BQTA 3MFIA 1N48A 2C2RA 3Q8RB 3KHHA 4EEYA 2BCSA 2W54A 1SIJA 4GXKA 4ECVA 2A1AA 4OJ5A 1SV0A 3PSIA 3Q8PB 2UVVA 3TKAA 3SENA 1BGXT 2VKQA 5AM4A 2WB1F 5CHGA 3QUBA 1F0MA 4OJ6A 2I1QA 3WK5A 2H3FA 4NLNA 3AMZA 5DQIA 2LM1A 1L3SA 2KIWA 1LKYA 1PZNA 1A76A 4P0QA 3C29A 8ICGA 2ZXHA 1C20A 4DL4A 4PL2A 2C28A 4F92B 2E8PA 4NLGA 2YN4A 1ZQLA 3S6JA 5KFAA 1ZQPA 4P4OA 1KTQA 3JPSA 3V7KA 1K1QA 1JALA 1KFTA 4NXZA 1URJA 2QARA 2ZJAA 4QNLA 2ISPA 2WF7A 9ICFA 8ICUA 1ZQIA 1RZTA 2QB0A 1DXSA 4BX9C 4Y2RA 3H8WA 1XS9D 5KFQA 4J9NA 2F3NA 2F8LA 2HI0A 4TQRA 2BQUA 3EW9A 2EANA 4IR9A 2JV3A 8ICLA 2B6GA 5ALUA 4QW8A
chains in the Genus database with same CATH topology
2EAPA 2EAOA 2KSOA 4NJ8A 2QB1A 3BQ7A 4PZOA 2E8NA 3TADC 1PK3A 3H8MA 1WWVA 1PK1A 4NL9A 2F44A 2D8CA 2QB0B 1SV0A 4NL9C 2Y9TA 3BS5A 4RQMA 1SV0C 2Y9UA 3SENA 1JI7A 3IDWA 1SGGA 5JTIA 5F3XB 3TADA 1SXEA 1X66A 3HILA 1F0MA 2DKZA 2QARB 1V38A 1B0XA 1LKYA 5KNIA 1UCVA 2GLEA 2KG5A 2LPEA 4RQNA 2KSOB 5L1MA 2FE9A 3K1RB 2E8PA 2LMRA 4PZNA 2QKQA 1RG6A 5JRTA 2D3DA 1WWUA 2K60A 1PK1B 4IS7A 2F8KA 5J8YC 1COKA 3KKAA 3TACB 1Z1VA 2KMDA 2ES6A 3BS5B 1X40A 5JU5A 2QARA 3KKAC 2EAMA 1OW5A 2E8OA 2KIVA 1OXJA 2KE7A 1UQVA 2ESEA 2QB0A 3BS7A 1SV4A 1V85A 1DXSA 4MHVA 2DL0A 5J8YA 2E8MA 2L5YA 1B4FA 3SEIA 2F3NA 2B6GA 2DKXA 1LKYB 1SXDA 2YTUA 2EANA 1KW4A 1X9XA 2JV3A 2K4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAP A;  2EAO A;  2KSO A;  4NJ8 A;  2QB1 A;  3BQ7 A;  4PZO A;  2E8N A;  3TAD C;  1PK3 A;  3H8M A;  1WWV A;  1PK1 A;  4NL9 A;  2F44 A;  2D8C A;  2QB0 B;  1SV0 A;  4NL9 C;  2Y9T A;  3BS5 A;  4RQM A;  1SV0 C;  2Y9U A;  3SEN A;  1JI7 A;  3IDW A;  1SGG A;  5JTI A;  5F3X B;  3TAD A;  1SXE A;  1X66 A;  3HIL A;  1F0M A;  2DKZ A;  2QAR B;  1V38 A;  1B0X A;  1LKY A;  5KNI A;  1UCV A;  2GLE A;  2KG5 A;  2LPE A;  4RQN A;  2KSO B;  5L1M A;  2FE9 A;  3K1R B;  2E8P A;  2LMR A;  4PZN A;  2QKQ A;  1RG6 A;  5JRT A;  2D3D A;  1WWU A;  2K60 A;  1PK1 B;  4IS7 A;  2F8K A;  5J8Y C;  1COK A;  3KKA A;  3TAC B;  1Z1V A;  2KMD A;  2ES6 A;  3BS5 B;  1X40 A;  5JU5 A;  2QAR A;  3KKA C;  2EAM A;  1OW5 A;  2E8O A;  2KIV A;  1OXJ A;  2KE7 A;  1UQV A;  2ESE A;  2QB0 A;  3BS7 A;  1SV4 A;  1V85 A;  1DXS A;  4MHV A;  2DL0 A;  5J8Y A;  2E8M A;  2L5Y A;  1B4F A;  3SEI A;  2F3N A;  2B6G A;  2DKX A;  1LKY B;  1SXD A;  2YTU A;  2EAN A;  1KW4 A;  1X9X A;  2JV3 A;  2K4P A; 
#chains in the Genus database with same CATH topology
 2O6K A;  1ZQY A;  2K89 A;  2EH9 A;  3KHG A;  8ICI A;  2NYV A;  3KD3 A;  5KG7 A;  1RQN A;  2EZX A;  3K1Z A;  3ICX A;  4O3Q A;  1VLB A;  2IBK A;  8ICV A;  4NLB A;  3OGU A;  3KHL A;  1N5W A;  3PX4 A;  5DB7 A;  2W9B B;  3GV5 B;  4DSE A;  5AM1 A;  2W9C A;  3IRU A;  4DEZ A;  7ICM A;  2UVU A;  2ZIU A;  3QU5 A;  5KT4 A;  2HOQ A;  5JUM A;  3SAF A;  2KNJ A;  8ICE A;  2WFA A;  4DL6 A;  2DKZ A;  4X5V A;  1XSP A;  1V38 A;  4UAW A;  1PVQ A;  4NLK A;  2A3V A;  3UXP A;  2VIX A;  2YB1 A;  3F5E A;  4DF8 A;  4DSI A;  2XCP A;  2W8K A;  1VJ5 A;  2LMR A;  3AQF A;  3C21 A;  1LB2 B;  2QKQ A;  3KZX A;  5AKI A;  4PH5 A;  3OTQ A;  4I27 A;  4IQV A;  2ZTC A;  1X6J A;  4ECS A;  3WK8 A;  1X9W A;  4YQW A;  1X40 A;  1ZYQ A;  5HHH A;  1OUQ A;  4JV2 A;  2KKP A;  2HCF A;  9ICT A;  2UVR A;  5AM5 A;  1KSP A;  2W9A A;  3SMV A;  3C1Y A;  1S76 D;  3V6H A;  8ICM A;  3WK9 A;  2E8M A;  4FS2 A;  1B4F A;  4DQQ A;  4YCX A;  2BPF A;  1FEZ A;  5KT6 A;  4B6J A;  4F5N A;  2HMX A;  1BPD A;  1HUZ A;  4UAZ A;  2B0C A;  2MAX A;  5J0Y A;  3GV7 B;  3H4D A;  7ICG A;  2P6U A;  1T4G A;  4ECW A;  3RB6 A;  5GTI U;  4WJ3 B;  3PML A;  4M6W B;  4RT3 A;  4J9L A;  2YQE A;  4M9J A;  1UHU A;  2WHE A;  1NJX A;  1TK5 A;  3WKD A;  4MFC A;  2JH1 A;  3D2Q A;  1SGG A;  1NOM A;  1X66 A;  5J2A A;  5J2G A;  5FP0 A;  5AKJ A;  1Z3E B;  5AI4 A;  4HAI A;  2WF8 A;  1XSL A;  4Y2P A;  2AQ4 A;  2PKE A;  3T3F A;  4KX3 A;  5EOZ A;  1YZ6 A;  2PI4 A;  1WG8 A;  4RQ4 A;  1Q3U A;  2AXT U;  5CA7 A;  4DFJ A;  3PST A;  2V4R A;  4DL7 A;  3LYS A;  5HML A;  5J8Y C;  3NTU A;  3NVZ A;  3IM1 A;  3GU3 A;  3BS5 B;  1U4B A;  3M7D A;  2JEF A;  4JWN A;  1U9L A;  3PX0 A;  5J29 A;  2AJQ A;  4UW9 A;  2W8L A;  1V85 A;  1L8L A;  3N28 A;  1ZD3 A;  4EX6 A;  4I2B A;  4KLU A;  4US8 A;  1QSS A;  5KFY A;  1ED1 A;  1A77 A;  4UQG A;  7ICJ A;  4C8M A;  4J9Q A;  3H7I A;  2YML A;  2PMZ F;  4QZA A;  4FBU A;  5KFE A;  1X9X A;  2DBY A;  3G6Y A;  4BWJ A;  2ASJ A;  2RDI A;  2I9G A;  5ALM A;  8ICP A;  5H2F U;  5ALE A;  2C22 A;  7ICL A;  3FAH A;  3ZDD A;  5EWG A;  5ALD A;  1KL9 A;  4KLE A;  4F71 A;  5KG1 A;  3F53 A;  5J0R A;  2KN7 A;  4K4I A;  4TUQ A;  5T14 A;  4GXI A;  2Y1I A;  1M6Y A;  4U6P A;  1S0N A;  4Y2S A;  1RDF A;  5DG7 A;  3V6J A;  1L7O A;  1UA0 A;  4F4W A;  2KJ9 A;  3PSP A;  5F9L A;  3B9J A;  3MR2 A;  1K1S A;  4O9M A;  5AI6 A;  3QUQ A;  2KG5 A;  4FS1 A;  4QZB A;  2ZIX A;  2G08 A;  4G9B A;  4XRH A;  4R8U B;  4KLF A;  3T5J A;  1J2N A;  3PY8 A;  5B5E U;  2E1F A;  3SV4 A;  1ECW A;  3MR5 A;  4KN7 A;  3EPI A;  2FI1 A;  5DBA A;  5KFR A;  3M9N B;  5AK5 A;  4P0P B;  3PVX A;  1ZQB A;  1SB3 C;  3EZ5 A;  2Y1J A;  4UB5 A;  1N2X A;  4FO6 A;  4UB3 A;  2XY5 A;  1ZQG A;  4QZI A;  2I5H A;  4KLT A;  3TAN A;  3AM9 A;  2LBO A;  3QU4 A;  4KLJ A;  4C8L A;  7ICQ A;  4PHE A;  3GFK B;  4K4G A;  2XY6 A;  1V97 A;  4ED8 A;  4CE6 A;  4UB1 A;  3OHB A;  3AQE A;  4UB8 U;  1P7D A;  5L1L A;  5ALG A;  1Q3V A;  1WCL A;  5KG3 A;  2G06 A;  5J2D A;  1X9M A;  3H8J A;  1ZQO A;  4LZG A;  1TE2 A;  3RB4 A;  3BJY A;  3PSF A;  4DSF A;  5CRX A;  1KDH A;  4XA5 A;  2DFL A;  4YR2 A;  4BDP A;  4PHP A;  5HNK A;  3BQ2 A;  1QQ7 A;  2W7P A;  2XVT A;  4F3O A;  4MEY A;  2PMZ C;  4ECX A;  2VA2 A;  2H3V A;  5KT2 A;  1NKB A;  9ICJ A;  5DGA A;  4RQN A;  2VA3 A;  4DSK A;  1UT5 A;  3K1R B;  4I2J A;  8ICO A;  2G0A A;  1ZQF A;  4KLM A;  1T94 A;  4UAV A;  2MRL A;  5JRT A;  2FPL A;  5J0Q A;  4IS7 A;  3QYP A;  5KFU A;  2BDP A;  4BUG A;  2C2E A;  2IOF A;  2BGW A;  4Y2J A;  2ES6 A;  2JEG A;  4PPX A;  3B0X A;  4MF2 A;  7ICN A;  4Y2Y A;  1SV4 A;  2E3T A;  4BXO A;  2ZG6 A;  2FJ6 A;  2IHN A;  1NJW A;  2GWS A;  3HT3 A;  3KHR A;  1MA7 A;  3KTQ A;  3RR7 A;  2JZB B;  1IM4 A;  3DV9 A;  1JRO A;  2ZIV A;  5D49 A;  4Y2Q A;  4O5E A;  8ICF A;  2NRT A;  3HWT A;  2FLL A;  5DBC A;  2BCU A;  4B9M A;  1TFR A;  1SKS A;  2HHX A;  2MSN A;  1S0M A;  2H3I A;  1Z00 A;  2KSO A;  4ED2 A;  2HBL A;  4DFM A;  2OH2 A;  2E8N A;  3UMC A;  1MQ3 A;  1JMS A;  5AKH A;  2XC9 A;  4J9R A;  4AP9 A;  5AKZ A;  2R8H A;  4YD2 A;  5IIO A;  2Y9U A;  3HKZ F;  5TIS U;  3GDX A;  5ALR A;  4ACO A;  3ISD A;  4RUC A;  5KFM A;  2R8G A;  1U49 A;  3OPX A;  2HVI A;  3AN1 A;  3H4B A;  2CPR A;  1ZD5 A;  2XO7 A;  3SV3 A;  4YVZ A;  1ARO P;  1QSY A;  4KLS A;  3HPO A;  3N97 B;  1ZQE A;  4M9H A;  2ZJ8 A;  5AM0 A;  4UAU A;  3T79 A;  4RNO A;  9ICH A;  1H38 A;  2B21 A;  2NV3 A;  5DB6 A;  3ZDA A;  4CF3 A;  3WK4 A;  2WF5 A;  3L4P A;  2HVH A;  4RQ0 A;  2AU0 A;  2JR5 A;  3TAC B;  2G5I B;  3TAR A;  3QZ7 A;  1ZQU A;  2K8C B;  9ICM A;  2A1J A;  2K4H A;  4M9L A;  3RR8 A;  3E58 A;  2ZTD A;  4XUS A;  3K75 D;  2E8O A;  3AU6 A;  3ZDB A;  3L5K A;  4TUR A;  5DLF A;  2EZZ A;  1UPH A;  2OYY A;  3OJU A;  4JUZ A;  2DWQ A;  3TFS A;  2R8J A;  1RM6 C;  4Q44 A;  1RXV A;  4O3R A;  4FFD A;  4CF4 A;  1LKY B;  4GC6 A;  1TVA A;  4TUS A;  2DPI A;  4J9M A;  4P0Q B;  4Q45 A;  4DCC A;  2H5X A;  2M0N A;  4QZC A;  2XGP A;  1IIP A;  2EAO A;  3OJS A;  2RDJ A;  4B9N A;  4O5K A;  3PMN A;  4C0Z A;  1Q46 A;  2IHM A;  4B9T A;  1IG6 A;  1ZQV A;  2BCR A;  2HHW A;  4MEX A;  1S0V A;  3WKE A;  4I2G A;  4DOC A;  3ZDC A;  4KLO A;  2QB0 B;  3F2C A;  5ALP A;  4NL9 C;  4UAR A;  3BZC A;  5AHX A;  1Z4N A;  4ED3 A;  5J2B A;  4Q8E A;  2YB4 A;  1SZH A;  1ZQZ A;  5G5G A;  3TAD A;  5ALW A;  1SXE A;  5IIN A;  4CRX A;  3ORY A;  4RU9 A;  4RNM A;  4DL3 A;  1ZD4 A;  2VJ5 A;  1S77 D;  3TAQ A;  1L5U A;  3RBE A;  2A19 A;  2AQ0 A;  5D46 A;  4F8R A;  7ICF A;  4RQ8 A;  3MGI A;  4JWM A;  4UAS A;  3NS1 A;  3B0Y A;  4EBD A;  4I2F A;  2DQN B;  3SYZ A;  2YX8 A;  4C4T A;  1J2M A;  3CNH A;  3CYM A;  4ECT A;  3TAP A;  4USA A;  5ALJ A;  2F76 X;  3V7J A;  4KMO B;  3D2S A;  3G6X A;  2W9C B;  5KL1 B;  2UVW A;  1S97 A;  2ZIU B;  3ETR A;  3E0F A;  5ALN A;  3C5F A;  4DOA A;  5L1K A;  3LWL A;  1JN3 A;  4UB4 A;  1OXJ A;  3ZD9 A;  1UQV A;  5AK4 A;  4RUA A;  2ZTE A;  2PFO A;  4KIT B;  4RPY A;  1NZB A;  2WAQ F;  3ETL A;  5DBB A;  4ELV A;  1S0O A;  3Q8M A;  1TK0 A;  1BVS A;  3SEI A;  1F5S A;  4JB3 A;  3QU7 A;  5AI0 A;  3UMB A;  1L8O A;  1GO3 F;  2XCA A;  3NRW A;  1FO4 A;  2R18 A;  1ZQC A;  3JPN A;  4KMU A;  4U7C A;  2QB1 A;  2WB1 C;  1CRX A;  3GIK A;  2OWO A;  2W11 A;  3UQ0 A;  1S10 A;  1HIW A;  3PW5 A;  1D9F A;  1ZQQ A;  1KKX A;  3KFU F;  3JPT A;  5KT5 A;  1ZRM A;  2N1R A;  4F50 A;  3UXO A;  2GH1 A;  2RRD A;  1B43 A;  2BCQ A;  4DOB A;  9ICV A;  4UB2 A;  1PVR A;  2NRW A;  4IRC A;  4M6W A;  4O5C A;  4IL6 U;  2W7O A;  1QSL A;  1XC9 A;  3ALR A;  1QH9 A;  3RB3 A;  1T7P A;  2OEH A;  1NK9 A;  5AIB A;  2V9W A;  3F2D A;  3NVY A;  5HR6 A;  4I2H A;  3QEA Z;  4PGQ A;  3C1Z A;  5BOL A;  2MA1 A;  1EXN A;  4QWE A;  5AI9 A;  2PFN A;  4O3P A;  9ICC A;  3AUO A;  1NNL A;  3WU2 U;  2XID A;  9ICQ A;  4JK1 A;  4RQ7 A;  4Z6E A;  2KJ5 A;  5K4L A;  4QZ9 A;  4QWA A;  2DGZ A;  3CP8 A;  3N7S C;  2L5Y A;  5KG2 A;  1DK3 A;  2DKX A;  1X6I A;  3M1Y A;  1SZP A;  7ICH A;  4LZD A;  3H40 A;  5AIA A;  2KTQ A;  4EX7 A;  3VCB A;  4KLH A;  2ZIW A;  5KFK A;  3PV8 A;  1BPX A;  5J2K A;  5CR0 A;  7ICV A;  2RP5 A;  3BQ0 A;  1NJZ A;  3WKC A;  1J97 A;  4F5R A;  5DG8 A;  2YY6 A;  4AYB F;  4LJX A;  4RNN A;  2BQR A;  9ICS A;  4PZO A;  4QWB A;  4YMO A;  1PK3 A;  4GXJ A;  3LK9 A;  1C7Y A;  4F5P A;  9ICI A;  3NGD A;  2BPG A;  5ALH A;  2FPK A;  2Y0S F;  2KZM A;  1JI7 A;  3DEE A;  4F5O A;  2DUY A;  5ALO A;  3G6V A;  3IP4 B;  3T5K A;  2WTF A;  5F3X B;  4B9L A;  2OCE A;  3A0B U;  5IIM A;  1N60 A;  4UBB A;  2BPC A;  3RJF A;  4F4K A;  1CUK A;  1KQQ A;  4NM1 A;  5AKX A;  3GIM A;  2H3Z A;  5L1I A;  2AGP A;  1UCV A;  2MUT A;  5J0U A;  3LWM A;  1FFV A;  1MQ2 A;  4DS4 A;  1ZQT A;  4UB6 U;  3F2B A;  2NO5 A;  3RJH A;  4ED7 A;  5EE0 A;  2BZF A;  2KK0 A;  1K5O A;  2RHF A;  2F1J A;  2NRV A;  4PGX A;  2P35 A;  2K60 A;  4I2D A;  4KLI A;  2G09 A;  3JPO A;  4YFK A;  4YR3 A;  5KG5 A;  1ZQN A;  2I6X A;  3I76 A;  3OHA A;  4FZM A;  2KIC A;  3KKA C;  4UBC A;  2KV2 A;  2JH7 A;  1ZJN A;  3QU9 A;  3ZD8 A;  5DQH A;  3M9O B;  2ESE A;  2R8K A;  2RQ5 A;  4YG2 A;  3PO4 A;  4I28 A;  2EZY A;  1SKR A;  1JXL A;  1KLN A;  1ZQS A;  1Q8K A;  2AGO A;  1NKE A;  4YMM A;  3D6J A;  4TUP A;  5BOM A;  3RAX A;  1TK8 A;  2ZIX B;  5HHI A;  2FMQ A;  3PR5 B;  4O3M A;  5EWF A;  2FLP A;  4NLZ A;  4FE3 A;  2W3R A;  3HW8 A;  3M8R A;  3QUT A;  4NJ8 A;  5EE1 A;  4LVS A;  4F91 B;  1L3V A;  9ICL A;  1QTM A;  4QIW F;  3AU2 A;  4ED1 A;  1PK1 A;  4ZOH C;  2C2D A;  4NL9 A;  1S5L U;  1DRG A;  5J0W A;  2D8C A;  1QLN A;  1BNP A;  2Y9T A;  3RRG A;  1CI4 A;  5KG6 A;  5AKL A;  4J9K A;  3EPG A;  8ICX A;  3CW2 C;  5JTI A;  3HX0 A;  2KZ3 A;  4BWM A;  5KAF U;  3THV A;  3C2K A;  4RZR A;  2HBM A;  4KTQ A;  4ECR A;  5AK6 A;  4UAT A;  3V6K A;  4C8K A;  1SL1 A;  4Q8F A;  1XNS A;  2F2A B;  5ALK A;  1BPB A;  1ZET A;  4EZ9 A;  3IG8 A;  4DL2 A;  1RPL A;  3GII A;  2GLE A;  1XSN A;  1RYR A;  2LPE A;  1ZQD A;  3MAB A;  1Z1B A;  1QQ5 A;  1SWV A;  2XGQ A;  4QWC A;  2ASL A;  3QXG A;  3GQC A;  5KFJ A;  2KFZ A;  1T8E A;  2P66 A;  4RQ2 A;  1T3Q A;  2F1I A;  1A6S A;  3RJG A;  2KMD A;  2IOH A;  1OW5 A;  2NRZ A;  1L3T A;  2HHV A;  2KIV A;  2H3Q A;  1VDV A;  2LM4 A;  1WCN A;  3BS7 A;  4MHV A;  3LVW A;  4ECQ A;  4NY8 A;  1Y88 A;  4O3O A;  3EUB 2;  5IIL A;  3NVV A;  4NM2 A;  1RYS A;  3SAH A;  9ICR A;  3LVV A;  4QZG A;  2WF9 A;  4RPZ A;  4ZH4 A;  2LHT A;  1DOQ A;  2ZXI A;  1JRP A;  2EAP A;  1RQL A;  4NWI A;  2BR0 A;  3C2M A;  2CXY A;  4YXJ A;  3N7R C;  5AK3 A;  3EYZ A;  2XY7 A;  1BPE A;  2EDU A;  4C7Z A;  8ICK A;  5DG9 A;  5AKE A;  5KFB A;  4EYI B;  2ALZ A;  4P4P A;  3AL0 B;  2AH5 A;  3ONN A;  3RJE A;  2J6S A;  1X42 A;  4OCZ A;  1BPY A;  4BXO B;  4DQP A;  3F5A A;  3M9M B;  3H0M B;  3CRX A;  1NK8 A;  1NK5 A;  5AI8 A;  5KAI U;  2ZIV B;  1ZQW A;  3PW7 A;  5CP2 A;  9ICO A;  4GC7 A;  1TAM A;  1L3U A;  3UPQ A;  5DQG A;  3C2L A;  3BDP A;  1ZQA A;  9ICN A;  3ISC A;  4YR0 A;  1Z00 B;  3ISB A;  4ED6 A;  2KSO B;  5KFF A;  4MF8 A;  2KD1 A;  8ICT A;  2FE9 A;  3NAS A;  8ICJ A;  2FPM A;  1NKC A;  4PZN A;  3I1Y A;  3QE9 Y;  8ICA A;  1ZD2 P;  3H0R B;  4MFA A;  3JPP A;  4QJF B;  3BQ1 A;  1JUD A;  1ZQR A;  3RH4 A;  4CNQ A;  4DLE A;  3QEB Z;  4M2Y A;  2HDO A;  1U47 A;  1UA1 A;  4C80 A;  2BQ3 A;  1ZQK A;  4Y2V A;  1U45 A;  1B22 A;  3MGH A;  3Q8S B;  5J8Y A;  3RTV A;  3R9K A;  3MDA A;  1DGJ A;  5J2F A;  3V7L A;  1NJY A;  9ICX A;  1PUZ A;  2EQY A;  5IIK A;  3RJI A;  3FDS A;  3MC1 A;  3VC8 A;  1N62 A;  4C4R A;  4JMU A;  2W03 A;  2HHU A;  4YMN A;  3TI0 A;  4GLX A;  2Q4T A;  1NK6 A;  1IXR A;  4OD0 A;  3M6Z A;  5HP4 A;  2HBJ A;  3BQ7 A;  2VJ4 A;  5C0Y A;  2IOF K;  1XU4 A;  4R65 A;  2A1J B;  1ZQM A;  4ICA A;  2KKV A;  2XIC A;  5KFV A;  5CB1 A;  4KLD A;  2KFN A;  4IRK A;  1JIH A;  5KFO A;  2K4E A;  1QCK A;  3SQI A;  3UQ2 A;  2GOL A;  3SR6 A;  2ZUC A;  3IDW A;  5DB8 A;  3D2N A;  4P2H A;  3LDA A;  4M0A A;  1LVH A;  2LYH A;  5EE3 A;  5B66 U;  5KFC A;  2QAR B;  5J0S A;  2HHQ A;  2JEI A;  3NVW A;  5G5H A;  5CWR A;  5L1M A;  2W43 A;  1ZXI A;  2W9M A;  2LKY A;  5ALV A;  4TQS A;  2G5H B;  5KT7 A;  3PR4 A;  1ZQX A;  3M8S A;  1X9S A;  2D3D A;  5E79 U;  1MSW D;  2F8K A;  4Z6F A;  3KKA A;  3TFR A;  4B9S A;  4B9U A;  3RF9 A;  4C4S A;  2W9B A;  4PGY A;  4KN4 A;  1KFD A;  5CJ7 A;  3AEV A;  4PJ0 U;  5ALS A;  4EEK A;  3MDC A;  1TAU A;  4DL5 A;  1KN5 A;  1ZOL A;  4Y2X A;  5J2I A;  2KHQ A;  4IR1 A;  2XI9 A;  1JX4 A;  8ICY A;  1N5X A;  1SXD A;  1ZQH A;  2IMW P;  2YTU A;  3OSP A;  3C28 A;  4QWD A;  3QUC A;  3HKZ C;  2OM6 A;  4IC9 A;  1DK2 A;  2BKE A;  3IV6 A;  4CGZ A;  5J0O A;  5F9N A;  5J2C A;  2HHS A;  5J2J A;  3Q8L A;  4EBC A;  4DQR A;  5DLG A;  3H0L B;  3ZDE A;  2F44 A;  3WK6 A;  4F5Q A;  3PW0 A;  4F93 B;  3FC4 A;  2W04 A;  2JRZ A;  2E1E A;  4P4M A;  7ICR A;  1N63 A;  5J0T A;  5KFX A;  1SWW A;  4DQI A;  1X2I A;  3KBB A;  3TQ1 A;  4FZN A;  8ICN A;  1AQ6 A;  5ALQ A;  3HIL A;  1L7M A;  3PNC A;  3WKB A;  4RQ1 A;  2YMP A;  4KLG A;  4GFJ A;  4B9V A;  4KX5 A;  4BGD A;  4DFP A;  5KFN A;  7ICO A;  2E5S A;  2BCV A;  2HHT A;  5AI5 A;  5J2E A;  5J2H A;  5KFH A;  3UM9 A;  5KFZ A;  2R8I A;  4EEN A;  1V9P A;  2PXI A;  1RXW A;  1WWU A;  2W55 A;  4KLQ A;  1JXE A;  1YZ7 A;  2PI5 A;  5KL8 B;  4J03 A;  4MFF A;  5ALL A;  3PW4 A;  4F2R A;  2ZJ5 A;  4NV0 A;  3RH6 A;  4JV0 A;  4CDG A;  3ED5 A;  4OJP A;  4ED0 A;  1KEJ A;  4FBT A;  2ODG A;  4Q43 A;  1L7N A;  3RBD A;  4OO1 J;  4PHD A;  1KRP A;  4JV1 A;  3T5H A;  3IN5 A;  2KOB A;  1BNO A;  4IQU A;  4DLG A;  5KFW A;  5TZV A;  3QZ8 A;  3GZF A;  4HYK A;  2ZUD A;  2VA8 A;  1NZP A;  3V72 A;  3NRZ A;  2LYB A;  4R64 A;  2YMQ A;  1MN8 A;  2F1H A;  2W3S A;  2DF4 B;  2JHD A;  2IA6 A;  1Z19 A;  2K4I A;  2Q0Z X;  3FYH A;  1S8O A;  4F4Y A;  3SI8 A;  9ICA A;  1YT3 A;  2AHO B;  1MC8 A;  2OHF A;  4EZ6 A;  2P6R A;  2JGA A;  1NK7 A;  4Y2T A;  3C23 A;  3JPQ A;  3BS5 A;  2HOF A;  2NRX A;  1SV0 C;  4F4Z A;  4US9 A;  2JEJ A;  5HR7 A;  5KTQ A;  4RQ5 A;  2D6F C;  5A0L A;  5AM2 A;  4NLC A;  2CN1 A;  1NI3 A;  3KZI U;  2LI6 A;  4I2A A;  9ICW A;  9ICP A;  8ICR A;  1HJP A;  5DB9 A;  3IHQ B;  4IQT A;  2ZIW B;  5AM3 A;  4C7Y A;  4O3S A;  1B0X A;  7ICU A;  4ELU A;  3E2E A;  1SL2 A;  4EEL A;  1IV8 A;  3WKA A;  3SZ2 A;  4K4H A;  2WAQ C;  3O0F A;  1ZQJ A;  1ZRN A;  3NUQ A;  4Z6C A;  3GIJ A;  2FDR A;  1COK A;  2KZZ A;  1COO A;  4DFD A;  1TV9 A;  3QNM A;  4QW9 A;  3PO5 A;  2K8B B;  3EWA A;  2EAM A;  2F77 X;  2DPJ A;  7ICE A;  4F4X A;  4F2S A;  2V4Q A;  2BHN A;  4Z6D A;  2AGQ A;  1SL0 A;  3RAQ A;  4ELT A;  4ECZ A;  3N7P D;  1HUO A;  2J6T A;  4ECY A;  3H8S A;  5L1J A;  1N56 A;  2MUT B;  8ICB A;  1XO1 A;  3A0H U;  2K4P A;  3DDH A;  4RQ6 A;  5AKY A;  5KFG A;  3J81 j;  1NK4 A;  5KFL A;  4YD1 A;  4RQ3 A;  2FMS A;  9ICE A;  4EBE A;  4O3N A;  4ECU A;  4YN4 A;  3MR6 A;  5ALI A;  3TAD C;  4J9P A;  7ICK A;  8ICZ A;  4R8U A;  4QZH A;  8ICQ A;  2KJ8 A;  3BZK A;  1WWV A;  2FLN A;  2JXJ A;  2MU2 A;  2Z7J A;  5CEH A;  2PFQ A;  2HOI A;  2NO4 A;  1T3N A;  4I2I A;  4RQM A;  4I2E A;  4CF5 A;  1SKW A;  4P0P A;  4DWI A;  2KP7 A;  3HRD D;  7ICS A;  2FMP A;  4J9S A;  3Q8K A;  5KT3 A;  4YXM A;  2J6U A;  5J0X A;  3SD7 A;  4E0D A;  4RT2 A;  5KFT A;  5GTH U;  4QZE A;  3PZP A;  8ICS A;  8ICC A;  3FM9 A;  5BPC A;  4J9O A;  3RH5 A;  4DF4 A;  4G3I A;  2WF6 A;  4QZ8 A;  4R63 A;  3GV8 B;  9ICB A;  2M9N A;  3T5L A;  4DO9 A;  3KOO A;  4YP3 A;  9ICU A;  9ICK A;  1PK1 B;  1N61 A;  5ALF A;  3RB0 A;  3M6K A;  5III A;  4DS5 A;  1CEZ A;  5DGB A;  3RFA A;  5DDY A;  4QZD A;  3PW2 A;  1ZJM A;  1KBU A;  5AIC A;  2VAN A;  4M47 A;  2JMG A;  3QU2 A;  1DGS A;  1D8B A;  2KE7 A;  2K8A A;  3SAG A;  1FFU A;  5HMM A;  5AKK A;  1L6N A;  4AYB C;  4PHA A;  1KFS A;  8ICW A;  2DL0 A;  3MR3 A;  1A0P A;  1NK0 A;  4M9G A;  1TKD A;  1ZQ1 C;  7ICI A;  2LYA A;  4C8O A;  3HP6 A;  3C5G A;  1TAQ A;  3GIL A;  3WK7 A;  5AKG A;  5IIJ A;  1Z4O A;  2KEY A;  2Y0S C;  2KHV A;  4OJL A;  2KVC A;  3QX7 A;  4Y2U A;  4F72 A;  1QQ6 A;  5D4B A;  5KFI A;  3RJJ A;  3MGV A;  5DKW A;  1LV5 A;  3I28 A;  3PX6 A;  3UXN A;  5KFP A;  7ICP A;  5KG4 A;  3H8M A;  4IRD A;  4CCH A;  3U26 A;  1XO0 A;  1L7P A;  2ZUB A;  4I2C A;  1UT8 A;  2HBK A;  4M04 A;  1HEK A;  1RYU A;  3MBY A;  4DFK A;  4OJO A;  2ISO A;  4A8E A;  4EYH B;  3MFH A;  8ICH A;  1D9D A;  9ICG A;  1FIQ A;  1WUD A;  4R66 A;  1D8Y A;  2JZB A;  5L9X A;  2RLT A;  4FZL A;  1F44 A;  1D8L A;  5KNI A;  4QZF A;  2PFP A;  1BPZ A;  1WYG A;  5KG0 A;  3L3F X;  3ZI4 A;  4GIB A;  5ALY A;  2QLT A;  3N4M B;  3UMG A;  3K4G A;  5J0P A;  4O0I A;  4RPX A;  1RG6 A;  4M9N A;  4DQS A;  4BJQ A;  2HW3 A;  7ICT A;  5EE9 A;  4IQW A;  2HSZ A;  2ASD A;  1Z1V A;  3OSN A;  2GO7 A;  3RJK A;  5C5J A;  5JU5 A;  4UAY A;  5ALX A;  2G07 A;  5KFD A;  4PL1 A;  3JPR A;  1XWL A;  1S9F A;  1O08 A;  4I29 A;  4DSJ A;  1U48 A;  2KVS A;  2CRX A;  4XQ8 A;  2YMM A;  2ATL A;  2OXO A;  4C8N A;  4QIW C;  5ALZ A;  5ALT A;  3HJE A;  5KFS A;  3RRH A;  1KW4 A;  4KLL A;  3Q8Q B;  1O03 A;  3IG5 A;  2BDU A;  5DDM A;  5EWE A;  1PVP A;  4DSL A;  3BQT A;  3MFI A;  1N48 A;  2C2R A;  3Q8R B;  3KHH A;  4EEY A;  2BCS A;  2W54 A;  1SIJ A;  4GXK A;  4ECV A;  2A1A A;  4OJ5 A;  1SV0 A;  3PSI A;  3Q8P B;  2UVV A;  3TKA A;  3SEN A;  1BGX T;  2VKQ A;  5AM4 A;  2WB1 F;  5CHG A;  3QUB A;  1F0M A;  4OJ6 A;  2I1Q A;  3WK5 A;  2H3F A;  4NLN A;  3AMZ A;  5DQI A;  2LM1 A;  1L3S A;  2KIW A;  1LKY A;  1PZN A;  1A76 A;  4P0Q A;  3C29 A;  8ICG A;  2ZXH A;  1C20 A;  4DL4 A;  4PL2 A;  2C28 A;  4F92 B;  2E8P A;  4NLG A;  2YN4 A;  1ZQL A;  3S6J A;  5KFA A;  1ZQP A;  4P4O A;  1KTQ A;  3JPS A;  3V7K A;  1K1Q A;  1JAL A;  1KFT A;  4NXZ A;  1URJ A;  2QAR A;  2ZJA A;  4QNL A;  2ISP A;  2WF7 A;  9ICF A;  8ICU A;  1ZQI A;  1RZT A;  2QB0 A;  1DXS A;  4BX9 C;  4Y2R A;  3H8W A;  1XS9 D;  5KFQ A;  4J9N A;  2F3N A;  2F8L A;  2HI0 A;  4TQR A;  2BQU A;  3EW9 A;  2EAN A;  4IR9 A;  2JV3 A;  8ICL A;  2B6G A;  5ALU A;  4QW8 A; 
#chains in the Genus database with same CATH homology
 2EAP A;  2EAO A;  2KSO A;  4NJ8 A;  2QB1 A;  3BQ7 A;  4PZO A;  2E8N A;  3TAD C;  1PK3 A;  3H8M A;  1WWV A;  1PK1 A;  4NL9 A;  2F44 A;  2D8C A;  2QB0 B;  1SV0 A;  4NL9 C;  2Y9T A;  3BS5 A;  4RQM A;  1SV0 C;  2Y9U A;  3SEN A;  1JI7 A;  3IDW A;  1SGG A;  5JTI A;  5F3X B;  3TAD A;  1SXE A;  1X66 A;  3HIL A;  1F0M A;  2DKZ A;  2QAR B;  1V38 A;  1B0X A;  1LKY A;  5KNI A;  1UCV A;  2GLE A;  2KG5 A;  2LPE A;  4RQN A;  2KSO B;  5L1M A;  2FE9 A;  3K1R B;  2E8P A;  2LMR A;  4PZN A;  2QKQ A;  1RG6 A;  5JRT A;  2D3D A;  1WWU A;  2K60 A;  1PK1 B;  4IS7 A;  2F8K A;  5J8Y C;  1COK A;  3KKA A;  3TAC B;  1Z1V A;  2KMD A;  2ES6 A;  3BS5 B;  1X40 A;  5JU5 A;  2QAR A;  3KKA C;  2EAM A;  1OW5 A;  2E8O A;  2KIV A;  1OXJ A;  2KE7 A;  1UQV A;  2ESE A;  2QB0 A;  3BS7 A;  1SV4 A;  1V85 A;  1DXS A;  4MHV A;  2DL0 A;  5J8Y A;  2E8M A;  2L5Y A;  1B4F A;  3SEI A;  2F3N A;  2B6G A;  2DKX A;  1LKY B;  1SXD A;  2YTU A;  2EAN A;  1KW4 A;  1X9X A;  2JV3 A;  2K4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...