1COKA

Structure of the c-terminal domain of p73
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords PROTEIN (SECOND SPLICE VARIANT P73)
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1cokA00
2QB0B 1SV0C 2QARB 2KIVA 2D3DA 1LKYB 1JI7A 2LPEA 2EANA 2L5YA 2KSOA 2YTUA 1B0XA 5J8YC 5JTIA 3SENA 3BS7A 2KMDA 2GLEA 2K4PA 3K1RB 1WWVA 1KW4A 1OW5A 1LKYA 2ES6A 2JV3A 4RQNA 1UQVA 5KNIA 2KG5A 1SGGA 3H8MA 2E8PA 3TADC 3BS5A 1F0MA 1WWUA 1X66A 1PK3A 2DKZA 4NL9C 5F3XB 2KE7A 2QB1A 4PZNA 1Z1VA 1V38A 1SXDA 2EAPA 2KSOB 1X9XA 3TACB 3BS5B 2D8CA 2ESEA 3KKAA 1SXEA 2F8KA 1B4FA 1X40A 2FE9A 3SEIA 2DKXA 2QB0A 4MHVA 2EAMA 4NJ8A 3IDWA 2QARA 4RQMA 2E8NA 3HILA 2EAOA 1PK1B 2K60A 2Y9TA 2F3NA 2B6GA 2QKQA 1SV0A 2Y9UA 1UCVA 1COKA 4NL9A 5JRTA 1DXSA 1SV4A 5JU5A 1V85A 2DL0A 2F44A 1PK1A 1RG6A 4IS7A 5L1MA 1OXJA 2E8MA 2E8OA 3BQ7A 2LMRA 5J8YA 3KKAC 4PZOA 3TADA
chains in the Genus database with same CATH superfamily
3PV8A 2PFOA 3VC8A 3JPTA 1U49A 1SL1A 1HUOA 1Q46A 3H4BA 1CUKA 3TARA 1MQ2A 2K4EA 1ZD4A 4QWBA 2NRTA 2YMQA 1T7PA 2HOQA 3ICXA 4O3PA 5KT4A 2WAQC 9ICKA 4O3QA 2YB1A 1N60A 2LYBA 4U6PA 2ZIWB 2G08A 5DBCA 3WKBA 5CB1A 4YMMA 1LKYA 4QIWC 4OJ6A 1SIJA 4UW9A 5CHGA 2HHTA 5IIOA 3WKAA 2PFQA 4NM2A 3PW4A 2KIWA 5ALTA 4DS4A 5EWEA 4CE6A 3O0FA 5ALFA 4XRHA 4RPYA 4TURA 4EYIB 4I27A 3GDXA 3SV4A 5DLGA 1IG6A 1IV8A 2ZJAA 2ZIVA 3Q8LA 2D8CA 1SB3C 4Z6FA 3PR4A 4DS5A 1NI3A 5AIAA 3OHBA 1C7YA 4DL6A 3HPOA 1UA1A 5KFMA 1RYUA 3C1ZA 3CW2C 4US8A 1D9DA 2KTQA 5HNKA 3MR5A 4F4WA 2BCUA 2RDIA 3ETLA 2P66A 2AXTU 2EH9A 4RQMA 5J0RA 4LZGA 8ICNA 2KV2A 4NLKA 4QZ8A 5L1LA 1PK1B 2ZIWA 2JMGA 4YMNA 4EX7A 3JPPA 2KZZA 2W9BB 3ZD8A 1HIWA 2KJ5A 4F5RA 4I2CA 4Y2XA 4O3RA 4OD0A 1B43A 1FFUA 1PVRA 5C5JA 4AYBF 5J2GA 3H0RB 2ZJ5A 4GC7A 5ALQA 2W03A 4NV0A 2H3IA 3I76A 8ICLA 4YG2A 2HBMA 2F77X 2KVSA 3IV6A 9ICSA 2QB0B 1ZQCA 5IIIA 3SAGA 2RQ5A 2XIDA 4K4IA 1N63A 7ICJA 5KTQA 1JUDA 5CEHA 4KLIA 5EE1A 3RTVA 2BCVA 4M47A 2YN4A 2NRXA 2LPEA 3MR3A 9ICEA 4DQRA 4Q8FA 2KSOA 3EUB2 1JXEA 3ED5A 1NZBA 2IOFA 4USAA 3AU2A 2W9AA 4YQWA 2BKEA 3OJSA 2AJQA 1KTQA 1WG8A 4O5KA 2W8LA 1KQQA 2KN7A 5F9LA 4R8UB 4ECZA 2WTFA 1NK0A 3Q8MA 2LYAA 4UATA 4O0IA 4M9JA 1RDFA 3THVA 4BGDA 3RB4A 4TUQA 5AM5A 9ICOA 3J81j 3K75D 3PW2A 3FC4A 4ICAA 1UHUA 2K4HA 2JEJA 9ICVA 2DKXA 3N4MB 9ICPA 4F2SA 3L5KA 4K4GA 7ICVA 1NKBA 5DG8A 9ICRA 3TAPA 4IQVA 2E8NA 3HILA 5B66U 1Q3UA 5KFHA 3MFHA 5KT2A 2AU0A 5ALUA 4UAZA 4ECTA 1KEJA 2HHUA 1SWWA 5KG6A 3G6XA 4QZDA 3M8SA 4RUAA 1T3QA 3LK9A 1NK6A 3DEEA 1L3VA 4XQ8A 2PFPA 1IIPA 4BJQA 4DQIA 4F5NA 1QCKA 5KFSA 3AL0B 1S10A 2DQNB 4F93B 1KFDA 1ZQZA 4RPXA 4F4ZA 4MFCA 4ECYA 3MR6A 4PH5A 3EZ5A 5ALKA 3I28A 4RQ0A 3TFRA 4JWNA 5DQIA 1F5SA 2W43A 5CA7A 5J0TA 2GLEA 1ED1A 1WWVA 2FDRA 2UVWA 5KG2A 4ED7A 8ICGA 2BDUA 2UVUA 4OCZA 3HW8A 5ALVA 4CGZA 4UB6U 4YVZA 3EW9A 5KNIA 1N61A 3FYHA 2R18A 1NJZA 1D9FA 4QZEA 4ECWA 5KL1B 3G6VA 1Z1VA 4NLNA 1EXNA 1X9XA 2RLTA 3QU9A 4IR1A 3AQEA 3D6JA 1BPYA 5DB8A 2ZTEA 2NRVA 4QNLA 1YT3A 1T94A 3WK9A 5KFVA 3MDAA 4PHPA 4M9LA 2JR5A 4RU9A 4ELVA 4ELUA 3QXGA 4B9TA 3RJKA 2EAOA 2C22A 5DBAA 1ZRMA 3PO4A 3KHHA 2K4IA 4B9LA 3V7JA 1J2MA 4P4PA 3GIIA 5IIMA 3AU6A 5JRTA 1SV4A 5EE0A 3HP6A 4FBTA 5CR0A 3T3FA 1HEKA 2E5SA 3PSPA 5KT5A 4OJLA 2ZIUB 4M9GA 2HBKA 8ICOA 3KKAC 2RP5A 3UM9A 8ICQA 2JGAA 2P35A 2GWSA 1ZQIA 1D8YA 5ALMA 5ALYA 2AHOB 1QQ5A 4Y2QA 4ECSA 4YMOA 4IRDA 1L7MA 2V9WA 5AKEA 1TE2A 2D3DA 3HX0A 4B9MA 2WF6A 2WB1C 5J0OA 3SYZA 3H0MB 2L5YA 4YN4A 4ED1A 5ALRA 1S0NA 4DL4A 4I2EA 2KZMA 3CYMA 4F72A 3K1RB 1PVQA 3UXPA 1J97A 2BQRA 2LM1A 2PMZF 4KLHA 4YFKA 2ZUBA 3PY8A 3ONNA 5EE9A 3H4DA 3HT3A 3E0FA 4DL7A 4RNMA 5F3XB 3SAHA 1N62A 5J2BA 5EWFA 3WK7A 3GIJA 2H5XA 5J0XA 1B4FA 4DQSA 3B0YA 3FAHA 1DGSA 5DG9A 1ZQAA 2JXJA 2ZXIA 2ISPA 9ICQA 2FLNA 2J6SA 2CPRA 4CNQA 5DDMA 2A3VA 4UB3A 4F3OA 4YXMA 2Y9TA 3UMGA 9ICGA 4ZOHC 2B0CA 2BR0A 5ALJA 1FFVA 3M8RA 4G3IA 3WU2U 4C7YA 2XGQA 3NVWA 3H8WA 5L1KA 4IQUA 5DGBA 4AYBC 3ISCA 5AM1A 4J9NA 2NO5A 2KHVA 2WB1F 5DB9A 2F76X 3SV3A 5KT6A 1XNSA 4I2DA 4KLOA 5DDYA 2NRWA 3QUQA 2PKEA 4ELTA 1O03A 1QSSA 1L6NA 2WHEA 2YMPA 2BCSA 5KFOA 8ICTA 4CCHA 1WUDA 5HR6A 3Q8KA 5HHHA 4BXOA 8ICYA 2PMZC 5HMMA 2Y0SC 3SENA 4U7CA 5KG1A 3BS7A 3T5HA 4OO1J 1DRGA 2HVHA 2HHQA 5KFBA 3RBDA 3B9JA 3BQTA 4PL1A 1SKWA 1UT8A 3I1YA 5J0YA 2EZZA 1XO0A 4BWJA 4X5VA 5ALGA 1JROA 1NK4A 1XO1A 4Y2UA 4KLSA 4GFJA 4B9NA 3SD7A 4QW8A 3TADC 5KFDA 1NJXA 2DKZA 2WF7A 2QLTA 3QUTA 4B6JA 3WKDA 3EPIA 4P2HA 2KOBA 3WK8A 4YCXA 1QQ6A 4MF2A 3BS5B 4RT2A 4Q45A 4PHEA 2ZIXA 3VCBA 3ZDBA 1SXEA 4I2JA 8ICBA 5AK4A 1L3UA 3CNHA 2EQYA 3LWLA 1QLNA 1DGJA 1QH9A 2MUTA 3SEIA 4QWDA 1ZQUA 4F8RA 2AQ0A 1U47A 2HHVA 1Z4OA 5AK3A 4KLEA 4M6WA 3V6JA 2R8KA 4P0QB 2DGZA 2WF8A 4KLQA 5DB6A 4R63A 4HAIA 4DL2A 2G0AA 1KFSA 4LVSA 4GXKA 1A77A 4I28A 3V7LA 3AEVA 1UPHA 2ASJA 5AI9A 4MEXA 5AI0A 3KZIU 4PGYA 2E1FA 2IOHA 3NVVA 5AI4A 1A76A 3M9OB 4IC9A 4QZAA 1JIHA 2OYYA 2ZUDA 1B22A 5G5GA 1ZJNA 3U26A 3JPNA 4UAWA 4QZBA 4EBDA 4NLZA 1RZTA 2HHSA 2NV3A 2GO7A 1LKYB 3WK6A 3NASA 5KAFU 4IRCA 4BDPA 4I29A 2NYVA 3R9KA 4QZHA 4C8NA 3HKZF 4M9NA 1N56A 4ED8A 2K4PA 4UBCA 3FDSA 4O3NA 5J2CA 8ICMA 2F1HA 2ES6A 4DOCA 4C8MA 4FFDA 3PW7A 5L1JA 1T4GA 4C4RA 5AI8A 2C28A 1VDVA 5IINA 1ZRNA 4B9SA 4ED2A 1ZQWA 2LKYA 5BOLA 3H40A 1PK3A 4NL9C 1Z4NA 3NRWA 3RR7A 4PPXA 2KE7A 1V38A 3IG8A 3JPSA 8ICWA 2ESEA 4DWIA 3GV5B 2FE9A 4XA5A 4ECQA 1SKRA 3PW5A 2KVCA 3ZDAA 2DF4B 5AKIA 4ED0A 5KT3A 4B9VA 3ISBA 2FPKA 2F3NA 5J0PA 2B6GA 2Y0SF 5L9XA 1JRPA 2F1IA 2KP7A 3IRUA 3OSPA 4KX3A 4Y2SA 1RG6A 1A6SA 4JB3A 7ICSA 3TAQA 4FE3A 3PO5A 3Q8PB 7ICRA 2ATLA 3KBBA 8ICJA 4O5CA 4F5QA 1BGXT 1VJ5A 3T5KA 3RAXA 2ASLA 1L5UA 1BNOA 3V6KA 4R66A 4GIBA 4UASA 4PGXA 2JEGA 1UA0A 1MA7A 2ASDA 1L3SA 1QQ7A 2R8HA 3F5AA 1ZJMA 4DL5A 1Q8KA 2BPCA 4KLLA 4RQNA 7ICEA 4C8KA 3RR8A 4I2HA 1Z3EB 3C2MA 4ACOA 1BPBA 2H3FA 5AI5A 2XC9A 4DF4A 2C2RA 7ICKA 1S5LU 1XSLA 8ICAA 5G5HA 2IBKA 1LB2B 3RJFA 2F8KA 5J29A 1NK7A 1L7OA 3L4PA 1TAUA 4KLDA 4FZMA 9ICWA 4MHVA 3N7PD 4QZIA 2ISOA 2QARA 2AH5A 5BPCA 1Z1BA 3RF9A 1MQ3A 2K60A 1U4BA 1UCVA 3HKZC 1Z00B 3H8JA 7ICPA 3UMCA 1SL2A 2I9GA 2OWOA 2E1EA 2OXOA 4M9HA 1S9FA 2HCFA 1RXWA 5AM4A 4RQ2A 2DPJA 3HWTA 1TK8A 4KLTA 4YR3A 3UXOA 4Q44A 4QWCA 4J9KA 2P6UA 4I2GA 5HR7A 1X42A 4C4TA 2FMSA 5AM3A 1HUZA 3MR2A 4GXJA 3AN1A 5H2FU 2BHNA 1ZQBA 5AKYA 3A0BU 3T5LA 3LYSA 4KLMA 3N28A 9ICCA 4RQ6A 4RNOA 2FLLA 1FEZA 2JH1A 3RH6A 2W04A 1ZOLA 4DL3A 1YZ6A 3H8MA 2UVVA 8ICSA 2ZIVB 1NNLA 3C5FA 2K89A 1ZQKA 4UB4A 2FLPA 3TKAA 1BPXA 2BZFA 4DLGA 3SMVA 4KN4A 4FS1A 4EX6A 3NS1A 1NJYA 3UXNA 2JEFA 1NJWA 4DCCA 4R8UA 3C1YA 3DDHA 5J0SA 3WKCA 1ZQFA 4Q8EA 4DQPA 5EWGA 1PUZA 1NK9A 3OGUA 3IHQB 4R64A 1DXSA 1TV9A 5DQHA 7ICQA 4C4SA 2CXYA 1UT5A 7ICTA 5DBBA 5AIBA 3OSNA 3V6HA 3ISDA 4DOBA 9ICNA 1ZQEA 5K4LA 4J9LA 4YR2A 3QU4A 1ZD5A 1ZQOA 4F5OA 8ICIA 3MGIA 2IOFK 5IIKA 2OHFA 2R8IA 5J2HA 3M7DA 2Q4TA 4IR9A 2VANA 3KOOA 1KSPA 2YTUA 1TAQA 5J8YC 3OJUA 1CRXA 1S97A 1XSNA 2MRLA 2AGQA 1PVPA 4KLUA 4C8LA 3H0LB 4UBBA 1K1QA 5DG7A 3PR5B 2WAQF 2VA2A 1X6IA 2UVRA 4UAYA 1MN8A 2OM6A 2Z7JA 1L7PA 5J0QA 1ZYQA 2FI1A 4NLGA 1NK8A 4QIWF 4EENA 1WWUA 1BNPA 8ICVA 4O3SA 4O3MA 2DWQA 4RQ8A 2QB1A 4DFKA 3S6JA 4PGQA 3K1ZA 1VLBA 4DEZA 3RJIA 4DSLA 2KNJA 1BPEA 5GTHU 2VJ5A 4DSJA 2W7OA 3LWMA 2HHWA 5KFNA 2XCPA 1QSLA 4P0QA 3RBEA 4DSFA 2G09A 3KHLA 4HYKA 1U45A 3QZ8A 4KMOB 1HJPA 3V7KA 5KFIA 4Y2JA 3QNMA 1NKEA 3BJYA 2IHNA 3BZKA 4I2IA 5KFQA 5JU5A 4UB1A 2DL0A 4IS7A 1X9MA 5KG3A 4GC6A 3H7IA 2ZJ8A 1RXVA 1K5OA 1OXJA 3EYZA 1SZHA 2W9BA 1DOQA 3F2BA 3NUQA 4DOAA 3RB6A 5D46A 2N1RA 9ICUA 4IRKA 3KTQA 3GFKB 1JI7A 1MSWD 3JPQA 3GV8B 2KFNA 5AKLA 2KZ3A 1H38A 5EE3A 8ICFA 1COOA 1ZQJA 7ICFA 2HI0A 3QEAZ 5JTIA 2W9CA 1U9LA 4C8OA 4JV1A 2AGPA 4Y2YA 2XVTA 1T3NA 1RYSA 4FZLA 4KLGA 5JUMA 4NLBA 4CF4A 2JV3A 3NTUA 5F9NA 2PI4A 2YMMA 2IMWP 3PSTA 4UAUA 7ICOA 2A1JB 2NRZA 4FS2A 3BDPA 1PZNA 3RRGA 2XY7A 1A0PA 4DFDA 1ZQLA 2R8GA 3OTQA 1SXDA 5GTIU 4E0DA 5J2EA 4XUSA 4B9UA 1NOMA 4MF8A 2M9NA 1NKCA 8ICZA 4TQRA 2JHDA 1SWVA 4RQ7A 5KFJA 3PMLA 4F92B 3A0HU 4UAVA 1N5WA 3MDCA 2FMPA 3GU3A 1O08A 5KL8B 3PNCA 3Q8SB 3PX0A 4YD1A 4EBCA 1SZPA 5KFCA 1S76D 4AP9A 5IILA 9ICLA 4I2BA 5KFAA 4NL9A 5KFEA 1QSYA 8ICUA 1RQLA 3AUOA 4QZ9A 4G9BA 5CJ7A 5KG4A 8ICHA 3MGVA 2E8OA 1BPZA 5HP4A 3PSFA 4EZ9A 1Z19A 2R8JA 2XY5A 1X2IA 3EWAA 1SV0C 2VA8A 2Y1JA 3N7RC 3KHRA 4J9MA 4M04A 2HOIA 5AI6A 4O3OA 5ALHA 2PI5A 2BCRA 2AQ4A 7ICIA 5DQGA 2LM4A 1KDHA 4C80A 4F50A 1CEZA 1ECWA 3L3FX 3MABA 1S0VA 2I1QA 1D8LA 2KKPA 5KFRA 2XGPA 3M6ZA 1KW4A 3F5EA 1S0MA 1OW5A 4C7ZA 2WFAA 4US9A 5TZVA 1TVAA 4MEYA 5KFYA 2KG5A 3KFUF 1SGGA 2FJ6A 5DB7A 2BPGA 3GV7B 9ICHA 2H3QA 5ALOA 4TUSA 4CDGA 3TQ1A 2ZUCA 2BGWA 1M6YA 4Q43A 2ZIUA 4MFFA 1K1SA 4TUPA 3HJEA 3F2CA 2EAPA 2G07A 5AKKA 3WK4A 1XSPA 4QZCA 2E3TA 2VA3A 3NVZA 9ICFA 2WF5A 4DSKA 3KKAA 1N5XA 4EEYA 2W8KA 4YD2A 2I6XA 1IXRA 2LHTA 5DGAA 8ICCA 4PHDA 2IHMA 4J9OA 4O5EA 2EAMA 5J2KA 3SAFA 4EEKA 5TISU 1XU4A 2DFLA 3ZDDA 3QUCA 4DFJA 1COKA 5ALNA 5J2AA 3OPXA 2W7PA 1CI4A 3K4GA 4DLEA 2W3SA 2ZXHA 4QWAA 2O6KA 3QUBA 2BDPA 4ECRA 4NWIA 2LMRA 4JV0A 2HOFA 5ALWA 2KHQA 4J9RA 3PVXA 3UMBA 1ZQ1C 3F2DA 4QZFA 4F4YA 3RAQA 5KT7A 1NZPA 4DFMA 2HHXA 3T79A 5B5EU 3H8SA 4UB5A 2GH1A 1N48A 5AM2A 4EELA 4NXZA 1FO4A 2A1AA 1TAMA 8ICXA 5J0UA 2MUTB 3IG5A 9ICXA 3GQCA 3IM1A 5EOZA 3QEBZ 1TKDA 1AQ6A 2K8AA 2K8BB 3QU7A 1ZQRA 5A0LA 1F44A 3TANA 3D2QA 3BS5A 4JMUA 2G5HB 2JH7A 3GIMA 4KLFA 1LVHA 5BOMA 3M9NB 3LDAA 5D49A 4QZGA 3TACB 3PX6A 2HW3A 1X6JA 4ED3A 4RQ3A 3TFSA 2FMQA 3QYPA 4A8EA 4EYHB 5KFLA 1X40A 2HDOA 2WF9A 1RYRA 4LZDA 4UB8U 8ICKA 2C2DA 3GIKA 1KL9A 4NJ8A 4RNNA 4CF5A 5C0YA 4BWMA 1XWLA 2JZBB 3JPRA 3FM9A 2KEYA 2B21A 5D4BA 3PSIA 1N2XA 4DO9A 1ZQDA 5FP0A 1QTMA 4P0PA 5AICA 2MA1A 2Q0ZX 3N97B 3GZFA 4MFAA 1DK2A 3RFAA 5ALSA 7ICGA 4F2RA 4KN7A 3IP4B 1U48A 2CN1A 1ZQVA 5AKGA 2PFNA 3EPGA 2DUYA 8ICEA 4OJ5A 2ZIXB 1V97A 3SQIA 1MC8A 4F71A 3B0XA 2G5IB 2A19A 4RQ5A 1KFTA 3D2NA 4PHAA 2YQEA 1P7DA 1DK3A 5AM0A 5AKXA 2KMDA 3RH5A 3QX7A 4C0ZA 4M6WB 2W11A 5KAIU 2RDJA 4CF3A 5ALXA 2RHFA 4FO6A 5KG5A 3M9MB 1SKSA 4JK1A 4FBUA 1X9WA 1ZQPA 3E2EA 3RJGA 3C5GA 4DFPA 3C23A 5KG0A 7ICUA 3GILA 5E79U 2K8CB 2H3VA 2F1JA 2NO4A 4UB2A 4QW9A 3IN5A 1ZQYA 2KD1A 2KJ8A 2LBOA 4YXJA 2PXIA 2KKVA 4IQTA 5AK6A 2EZYA 4OJOA 3RB0A 1ZETA 1JXLA 2LI6A 2Y1IA 7ICHA 4PJ0U 2J6UA 3CP8A 2XCAA 2BPFA 4KMUA 1ZD2P 2ODGA 4P0PB 1KN5A 1S8OA 3PW0A 1ZQHA 2HSZA 4YR0A 2MU2A 1RQNA 4RQ1A 2ALZA 5J2FA 2XICA 1ZQTA 2GOLA 1Z00A 4F5PA 2IA6A 3BQ7A 3C21A 5J8YA 3CRXA 5ALIA 7ICLA 4YP3A 2V4RA 1BPDA 2FPLA 4ECXA 3WK5A 2HBJA 2QARB 5KFPA 2CRXA 5DLFA 4LJXA 5KFFA 5ALPA 2W54A 2EANA 2EZXA 4Y2RA 2XO7A 2DPIA 4O9MA 4Y2PA 2OEHA 1Y88A 3ETRA 4QJFB 4J03A 3G6YA 4PL2A 5KFTA 4P4MA 2ZTDA 3BZCA 1BVSA 4Y2VA 3E58A 4I2AA 4NM1A 1V9PA 3KHGA 1ZQGA 4ZH4A 2XY6A 1UQVA 5KFWA 2KICA 4Z6DA 1X66A 5KFKA 5J2DA 1L3TA 3QZ7A 3DV9A 3QU2A 3KZXA 2XI9A 3KD3A 4GLXA 4DF8A 3SZ2A 3ZDCA 1NK5A 5DKWA 3QU5A 1C20A 1URJA 4CRXA 4DSEA 3C2KA 4KTQA 3MFIA 9ICTA 3JPOA 9ICMA 4RUCA 2I5HA 2OCEA 4P4OA 5CRXA 1FIQA 3C29A 4OJPA 4Z6CA 3C2LA 1RPLA 3NRZA 2FPMA 3NVYA 5KFGA 4JWMA 4ECUA 5KFXA 2YX8A 1WYGA 2F44A 1PK1A 3ZDEA 2MAXA 4KX5A 2A1JA 3RJEA 2OH2A 5L1IA 1S77D 4UQGA 2JZBA 2H3ZA 4DSIA 4J9QA 2KIVA 2VIXA 2W9MA 2C2EA 9ICBA 5AK5A 4BXOB 3T5JA 4JUZA 5ALZA 3Q8RB 2D6FC 1ZQMA 3RJJA 1TK5A 3ORYA 3SI8A 1RM6C 1WCNA 3V72A 8ICRA 5J2JA 1JMSA 3LVVA 5ALDA 3ZI4A 2ZTCA 5ALLA 3OHAA 3ALRA 3RRHA 2YY6A 1D8BA 1S0OA 4TQSA 1JALA 4F91B 2E8PA 7ICNA 2HVIA 3C28A 1F0MA 4F4KA 4FZNA 3PZPA 2HBLA 3SR6A 2RRDA 1L8OA 2JRZA 3RH4A 1ZQSA 2M0NA 2AGOA 4IQWA 2G06A 1WCLA 3PMNA 4J9PA 3RJHA 2F8LA 2YMLA 2P6RA 3MC1A 2BQUA 1KKXA 5J2IA 9ICAA 1KBUA 5KFUA 2BCQA 4RT3A 3IDWA 5KG7A 1LV5A 4NLCA 4UARA 1J2NA 2KK0A 2QKQA 1SV0A 1L8LA 3Q8QB 1XC9A 3MBYA 3RB3A 5J0WA 2LYHA 3BQ0A 3AMZA 4ED6A 4NY8A 2HMXA 4RZRA 2DBYA 2EDUA 5T14A 4PZOA 2V4QA 3AQFA 1TFRA 2BQ3A 1JX4A 3UPQA 4F4XA 2YB4A 4BX9C 4RQ4A 2MSNA 2KJ9A 4ECVA 3BQ1A 1ZD3A 1AROP 2ZG6A 2VKQA 3BQ2A 1B0XA 4Z6EA 4M0AA 3ZD9A 3LVWA 3AM9A 4DQQA 2J6TA 3MGHA 3UQ0A 3NGDA 9ICIA 1KLNA 1X9SA 2W55A 2VJ4A 3WKEA 1GO3F 3HRDD 4GXIA 1ZQQA 1OUQA 4KLJA 2JEIA 3UQ2A 4JV2A 4PZNA 4J9SA 1SL0A 4EBEA 9ICJA 1JN3A 2KSOB 5HMLA 7ICMA 1IM4A 4KITB 3F53A 5ALEA 5AKHA 1T8EA 5CWRA 1KRPA 2QB0A 3N7SC 3PX4A 1Q3VA 4RPZA 2F2AB 5AKJA 2KFZA 4Y2TA 4IL6U 2Y9UA 2W9CB 1TK0A 4K4HA 1YZ7A 5AHXA 4M2YA 4EZ6A 1L7NA 5KFZA 3M6KA 3TI0A 1ZQXA 5CP2A 1V85A 5HHIA 4QWEA 5IIJA 4I2FA 8ICPA 4R65A 5L1MA 4WJ3B 3QE9Y 2E8MA 3M1YA 1XS9D 4BUGA 1ZQNA 2W3RA 3D2SA 1ZXIA 5AKZA 3TADA
chains in the Genus database with same CATH topology
2QB0B 1SV0C 2QARB 2KIVA 2D3DA 1LKYB 1JI7A 2LPEA 2EANA 2L5YA 2KSOA 2YTUA 1B0XA 5J8YC 5JTIA 3SENA 3BS7A 2KMDA 2GLEA 2K4PA 3K1RB 1WWVA 1KW4A 1OW5A 1LKYA 2ES6A 2JV3A 4RQNA 1UQVA 5KNIA 2KG5A 1SGGA 3H8MA 2E8PA 3TADC 3BS5A 1F0MA 1WWUA 1X66A 1PK3A 2DKZA 4NL9C 5F3XB 2KE7A 2QB1A 4PZNA 1Z1VA 1V38A 1SXDA 2EAPA 2KSOB 1X9XA 3TACB 3BS5B 2D8CA 2ESEA 3KKAA 1SXEA 2F8KA 1B4FA 1X40A 2FE9A 3SEIA 2DKXA 2QB0A 4MHVA 2EAMA 4NJ8A 3IDWA 2QARA 4RQMA 2E8NA 3HILA 2EAOA 1PK1B 2K60A 2Y9TA 2F3NA 2B6GA 2QKQA 1SV0A 2Y9UA 1UCVA 1COKA 4NL9A 5JRTA 1DXSA 1SV4A 5JU5A 1V85A 2DL0A 2F44A 1PK1A 1RG6A 4IS7A 5L1MA 1OXJA 2E8MA 2E8OA 3BQ7A 2LMRA 5J8YA 3KKAC 4PZOA 3TADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  1SV0 C;  2QAR B;  2KIV A;  2D3D A;  1LKY B;  1JI7 A;  2LPE A;  2EAN A;  2L5Y A;  2KSO A;  2YTU A;  1B0X A;  5J8Y C;  5JTI A;  3SEN A;  3BS7 A;  2KMD A;  2GLE A;  2K4P A;  3K1R B;  1WWV A;  1KW4 A;  1OW5 A;  1LKY A;  2ES6 A;  2JV3 A;  4RQN A;  1UQV A;  5KNI A;  2KG5 A;  1SGG A;  3H8M A;  2E8P A;  3TAD C;  3BS5 A;  1F0M A;  1WWU A;  1X66 A;  1PK3 A;  2DKZ A;  4NL9 C;  5F3X B;  2KE7 A;  2QB1 A;  4PZN A;  1Z1V A;  1V38 A;  1SXD A;  2EAP A;  2KSO B;  1X9X A;  3TAC B;  3BS5 B;  2D8C A;  2ESE A;  3KKA A;  1SXE A;  2F8K A;  1B4F A;  1X40 A;  2FE9 A;  3SEI A;  2DKX A;  2QB0 A;  4MHV A;  2EAM A;  4NJ8 A;  3IDW A;  2QAR A;  4RQM A;  2E8N A;  3HIL A;  2EAO A;  1PK1 B;  2K60 A;  2Y9T A;  2F3N A;  2B6G A;  2QKQ A;  1SV0 A;  2Y9U A;  1UCV A;  1COK A;  4NL9 A;  5JRT A;  1DXS A;  1SV4 A;  5JU5 A;  1V85 A;  2DL0 A;  2F44 A;  1PK1 A;  1RG6 A;  4IS7 A;  5L1M A;  1OXJ A;  2E8M A;  2E8O A;  3BQ7 A;  2LMR A;  5J8Y A;  3KKA C;  4PZO A;  3TAD A; 
#chains in the Genus database with same CATH topology
 3PV8 A;  2PFO A;  3VC8 A;  3JPT A;  1U49 A;  1SL1 A;  1HUO A;  1Q46 A;  3H4B A;  1CUK A;  3TAR A;  1MQ2 A;  2K4E A;  1ZD4 A;  4QWB A;  2NRT A;  2YMQ A;  1T7P A;  2HOQ A;  3ICX A;  4O3P A;  5KT4 A;  2WAQ C;  9ICK A;  4O3Q A;  2YB1 A;  1N60 A;  2LYB A;  4U6P A;  2ZIW B;  2G08 A;  5DBC A;  3WKB A;  5CB1 A;  4YMM A;  1LKY A;  4QIW C;  4OJ6 A;  1SIJ A;  4UW9 A;  5CHG A;  2HHT A;  5IIO A;  3WKA A;  2PFQ A;  4NM2 A;  3PW4 A;  2KIW A;  5ALT A;  4DS4 A;  5EWE A;  4CE6 A;  3O0F A;  5ALF A;  4XRH A;  4RPY A;  4TUR A;  4EYI B;  4I27 A;  3GDX A;  3SV4 A;  5DLG A;  1IG6 A;  1IV8 A;  2ZJA A;  2ZIV A;  3Q8L A;  2D8C A;  1SB3 C;  4Z6F A;  3PR4 A;  4DS5 A;  1NI3 A;  5AIA A;  3OHB A;  1C7Y A;  4DL6 A;  3HPO A;  1UA1 A;  5KFM A;  1RYU A;  3C1Z A;  3CW2 C;  4US8 A;  1D9D A;  2KTQ A;  5HNK A;  3MR5 A;  4F4W A;  2BCU A;  2RDI A;  3ETL A;  2P66 A;  2AXT U;  2EH9 A;  4RQM A;  5J0R A;  4LZG A;  8ICN A;  2KV2 A;  4NLK A;  4QZ8 A;  5L1L A;  1PK1 B;  2ZIW A;  2JMG A;  4YMN A;  4EX7 A;  3JPP A;  2KZZ A;  2W9B B;  3ZD8 A;  1HIW A;  2KJ5 A;  4F5R A;  4I2C A;  4Y2X A;  4O3R A;  4OD0 A;  1B43 A;  1FFU A;  1PVR A;  5C5J A;  4AYB F;  5J2G A;  3H0R B;  2ZJ5 A;  4GC7 A;  5ALQ A;  2W03 A;  4NV0 A;  2H3I A;  3I76 A;  8ICL A;  4YG2 A;  2HBM A;  2F77 X;  2KVS A;  3IV6 A;  9ICS A;  2QB0 B;  1ZQC A;  5III A;  3SAG A;  2RQ5 A;  2XID A;  4K4I A;  1N63 A;  7ICJ A;  5KTQ A;  1JUD A;  5CEH A;  4KLI A;  5EE1 A;  3RTV A;  2BCV A;  4M47 A;  2YN4 A;  2NRX A;  2LPE A;  3MR3 A;  9ICE A;  4DQR A;  4Q8F A;  2KSO A;  3EUB 2;  1JXE A;  3ED5 A;  1NZB A;  2IOF A;  4USA A;  3AU2 A;  2W9A A;  4YQW A;  2BKE A;  3OJS A;  2AJQ A;  1KTQ A;  1WG8 A;  4O5K A;  2W8L A;  1KQQ A;  2KN7 A;  5F9L A;  4R8U B;  4ECZ A;  2WTF A;  1NK0 A;  3Q8M A;  2LYA A;  4UAT A;  4O0I A;  4M9J A;  1RDF A;  3THV A;  4BGD A;  3RB4 A;  4TUQ A;  5AM5 A;  9ICO A;  3J81 j;  3K75 D;  3PW2 A;  3FC4 A;  4ICA A;  1UHU A;  2K4H A;  2JEJ A;  9ICV A;  2DKX A;  3N4M B;  9ICP A;  4F2S A;  3L5K A;  4K4G A;  7ICV A;  1NKB A;  5DG8 A;  9ICR A;  3TAP A;  4IQV A;  2E8N A;  3HIL A;  5B66 U;  1Q3U A;  5KFH A;  3MFH A;  5KT2 A;  2AU0 A;  5ALU A;  4UAZ A;  4ECT A;  1KEJ A;  2HHU A;  1SWW A;  5KG6 A;  3G6X A;  4QZD A;  3M8S A;  4RUA A;  1T3Q A;  3LK9 A;  1NK6 A;  3DEE A;  1L3V A;  4XQ8 A;  2PFP A;  1IIP A;  4BJQ A;  4DQI A;  4F5N A;  1QCK A;  5KFS A;  3AL0 B;  1S10 A;  2DQN B;  4F93 B;  1KFD A;  1ZQZ A;  4RPX A;  4F4Z A;  4MFC A;  4ECY A;  3MR6 A;  4PH5 A;  3EZ5 A;  5ALK A;  3I28 A;  4RQ0 A;  3TFR A;  4JWN A;  5DQI A;  1F5S A;  2W43 A;  5CA7 A;  5J0T A;  2GLE A;  1ED1 A;  1WWV A;  2FDR A;  2UVW A;  5KG2 A;  4ED7 A;  8ICG A;  2BDU A;  2UVU A;  4OCZ A;  3HW8 A;  5ALV A;  4CGZ A;  4UB6 U;  4YVZ A;  3EW9 A;  5KNI A;  1N61 A;  3FYH A;  2R18 A;  1NJZ A;  1D9F A;  4QZE A;  4ECW A;  5KL1 B;  3G6V A;  1Z1V A;  4NLN A;  1EXN A;  1X9X A;  2RLT A;  3QU9 A;  4IR1 A;  3AQE A;  3D6J A;  1BPY A;  5DB8 A;  2ZTE A;  2NRV A;  4QNL A;  1YT3 A;  1T94 A;  3WK9 A;  5KFV A;  3MDA A;  4PHP A;  4M9L A;  2JR5 A;  4RU9 A;  4ELV A;  4ELU A;  3QXG A;  4B9T A;  3RJK A;  2EAO A;  2C22 A;  5DBA A;  1ZRM A;  3PO4 A;  3KHH A;  2K4I A;  4B9L A;  3V7J A;  1J2M A;  4P4P A;  3GII A;  5IIM A;  3AU6 A;  5JRT A;  1SV4 A;  5EE0 A;  3HP6 A;  4FBT A;  5CR0 A;  3T3F A;  1HEK A;  2E5S A;  3PSP A;  5KT5 A;  4OJL A;  2ZIU B;  4M9G A;  2HBK A;  8ICO A;  3KKA C;  2RP5 A;  3UM9 A;  8ICQ A;  2JGA A;  2P35 A;  2GWS A;  1ZQI A;  1D8Y A;  5ALM A;  5ALY A;  2AHO B;  1QQ5 A;  4Y2Q A;  4ECS A;  4YMO A;  4IRD A;  1L7M A;  2V9W A;  5AKE A;  1TE2 A;  2D3D A;  3HX0 A;  4B9M A;  2WF6 A;  2WB1 C;  5J0O A;  3SYZ A;  3H0M B;  2L5Y A;  4YN4 A;  4ED1 A;  5ALR A;  1S0N A;  4DL4 A;  4I2E A;  2KZM A;  3CYM A;  4F72 A;  3K1R B;  1PVQ A;  3UXP A;  1J97 A;  2BQR A;  2LM1 A;  2PMZ F;  4KLH A;  4YFK A;  2ZUB A;  3PY8 A;  3ONN A;  5EE9 A;  3H4D A;  3HT3 A;  3E0F A;  4DL7 A;  4RNM A;  5F3X B;  3SAH A;  1N62 A;  5J2B A;  5EWF A;  3WK7 A;  3GIJ A;  2H5X A;  5J0X A;  1B4F A;  4DQS A;  3B0Y A;  3FAH A;  1DGS A;  5DG9 A;  1ZQA A;  2JXJ A;  2ZXI A;  2ISP A;  9ICQ A;  2FLN A;  2J6S A;  2CPR A;  4CNQ A;  5DDM A;  2A3V A;  4UB3 A;  4F3O A;  4YXM A;  2Y9T A;  3UMG A;  9ICG A;  4ZOH C;  2B0C A;  2BR0 A;  5ALJ A;  1FFV A;  3M8R A;  4G3I A;  3WU2 U;  4C7Y A;  2XGQ A;  3NVW A;  3H8W A;  5L1K A;  4IQU A;  5DGB A;  4AYB C;  3ISC A;  5AM1 A;  4J9N A;  2NO5 A;  2KHV A;  2WB1 F;  5DB9 A;  2F76 X;  3SV3 A;  5KT6 A;  1XNS A;  4I2D A;  4KLO A;  5DDY A;  2NRW A;  3QUQ A;  2PKE A;  4ELT A;  1O03 A;  1QSS A;  1L6N A;  2WHE A;  2YMP A;  2BCS A;  5KFO A;  8ICT A;  4CCH A;  1WUD A;  5HR6 A;  3Q8K A;  5HHH A;  4BXO A;  8ICY A;  2PMZ C;  5HMM A;  2Y0S C;  3SEN A;  4U7C A;  5KG1 A;  3BS7 A;  3T5H A;  4OO1 J;  1DRG A;  2HVH A;  2HHQ A;  5KFB A;  3RBD A;  3B9J A;  3BQT A;  4PL1 A;  1SKW A;  1UT8 A;  3I1Y A;  5J0Y A;  2EZZ A;  1XO0 A;  4BWJ A;  4X5V A;  5ALG A;  1JRO A;  1NK4 A;  1XO1 A;  4Y2U A;  4KLS A;  4GFJ A;  4B9N A;  3SD7 A;  4QW8 A;  3TAD C;  5KFD A;  1NJX A;  2DKZ A;  2WF7 A;  2QLT A;  3QUT A;  4B6J A;  3WKD A;  3EPI A;  4P2H A;  2KOB A;  3WK8 A;  4YCX A;  1QQ6 A;  4MF2 A;  3BS5 B;  4RT2 A;  4Q45 A;  4PHE A;  2ZIX A;  3VCB A;  3ZDB A;  1SXE A;  4I2J A;  8ICB A;  5AK4 A;  1L3U A;  3CNH A;  2EQY A;  3LWL A;  1QLN A;  1DGJ A;  1QH9 A;  2MUT A;  3SEI A;  4QWD A;  1ZQU A;  4F8R A;  2AQ0 A;  1U47 A;  2HHV A;  1Z4O A;  5AK3 A;  4KLE A;  4M6W A;  3V6J A;  2R8K A;  4P0Q B;  2DGZ A;  2WF8 A;  4KLQ A;  5DB6 A;  4R63 A;  4HAI A;  4DL2 A;  2G0A A;  1KFS A;  4LVS A;  4GXK A;  1A77 A;  4I28 A;  3V7L A;  3AEV A;  1UPH A;  2ASJ A;  5AI9 A;  4MEX A;  5AI0 A;  3KZI U;  4PGY A;  2E1F A;  2IOH A;  3NVV A;  5AI4 A;  1A76 A;  3M9O B;  4IC9 A;  4QZA A;  1JIH A;  2OYY A;  2ZUD A;  1B22 A;  5G5G A;  1ZJN A;  3U26 A;  3JPN A;  4UAW A;  4QZB A;  4EBD A;  4NLZ A;  1RZT A;  2HHS A;  2NV3 A;  2GO7 A;  1LKY B;  3WK6 A;  3NAS A;  5KAF U;  4IRC A;  4BDP A;  4I29 A;  2NYV A;  3R9K A;  4QZH A;  4C8N A;  3HKZ F;  4M9N A;  1N56 A;  4ED8 A;  2K4P A;  4UBC A;  3FDS A;  4O3N A;  5J2C A;  8ICM A;  2F1H A;  2ES6 A;  4DOC A;  4C8M A;  4FFD A;  3PW7 A;  5L1J A;  1T4G A;  4C4R A;  5AI8 A;  2C28 A;  1VDV A;  5IIN A;  1ZRN A;  4B9S A;  4ED2 A;  1ZQW A;  2LKY A;  5BOL A;  3H40 A;  1PK3 A;  4NL9 C;  1Z4N A;  3NRW A;  3RR7 A;  4PPX A;  2KE7 A;  1V38 A;  3IG8 A;  3JPS A;  8ICW A;  2ESE A;  4DWI A;  3GV5 B;  2FE9 A;  4XA5 A;  4ECQ A;  1SKR A;  3PW5 A;  2KVC A;  3ZDA A;  2DF4 B;  5AKI A;  4ED0 A;  5KT3 A;  4B9V A;  3ISB A;  2FPK A;  2F3N A;  5J0P A;  2B6G A;  2Y0S F;  5L9X A;  1JRP A;  2F1I A;  2KP7 A;  3IRU A;  3OSP A;  4KX3 A;  4Y2S A;  1RG6 A;  1A6S A;  4JB3 A;  7ICS A;  3TAQ A;  4FE3 A;  3PO5 A;  3Q8P B;  7ICR A;  2ATL A;  3KBB A;  8ICJ A;  4O5C A;  4F5Q A;  1BGX T;  1VJ5 A;  3T5K A;  3RAX A;  2ASL A;  1L5U A;  1BNO A;  3V6K A;  4R66 A;  4GIB A;  4UAS A;  4PGX A;  2JEG A;  1UA0 A;  1MA7 A;  2ASD A;  1L3S A;  1QQ7 A;  2R8H A;  3F5A A;  1ZJM A;  4DL5 A;  1Q8K A;  2BPC A;  4KLL A;  4RQN A;  7ICE A;  4C8K A;  3RR8 A;  4I2H A;  1Z3E B;  3C2M A;  4ACO A;  1BPB A;  2H3F A;  5AI5 A;  2XC9 A;  4DF4 A;  2C2R A;  7ICK A;  1S5L U;  1XSL A;  8ICA A;  5G5H A;  2IBK A;  1LB2 B;  3RJF A;  2F8K A;  5J29 A;  1NK7 A;  1L7O A;  3L4P A;  1TAU A;  4KLD A;  4FZM A;  9ICW A;  4MHV A;  3N7P D;  4QZI A;  2ISO A;  2QAR A;  2AH5 A;  5BPC A;  1Z1B A;  3RF9 A;  1MQ3 A;  2K60 A;  1U4B A;  1UCV A;  3HKZ C;  1Z00 B;  3H8J A;  7ICP A;  3UMC A;  1SL2 A;  2I9G A;  2OWO A;  2E1E A;  2OXO A;  4M9H A;  1S9F A;  2HCF A;  1RXW A;  5AM4 A;  4RQ2 A;  2DPJ A;  3HWT A;  1TK8 A;  4KLT A;  4YR3 A;  3UXO A;  4Q44 A;  4QWC A;  4J9K A;  2P6U A;  4I2G A;  5HR7 A;  1X42 A;  4C4T A;  2FMS A;  5AM3 A;  1HUZ A;  3MR2 A;  4GXJ A;  3AN1 A;  5H2F U;  2BHN A;  1ZQB A;  5AKY A;  3A0B U;  3T5L A;  3LYS A;  4KLM A;  3N28 A;  9ICC A;  4RQ6 A;  4RNO A;  2FLL A;  1FEZ A;  2JH1 A;  3RH6 A;  2W04 A;  1ZOL A;  4DL3 A;  1YZ6 A;  3H8M A;  2UVV A;  8ICS A;  2ZIV B;  1NNL A;  3C5F A;  2K89 A;  1ZQK A;  4UB4 A;  2FLP A;  3TKA A;  1BPX A;  2BZF A;  4DLG A;  3SMV A;  4KN4 A;  4FS1 A;  4EX6 A;  3NS1 A;  1NJY A;  3UXN A;  2JEF A;  1NJW A;  4DCC A;  4R8U A;  3C1Y A;  3DDH A;  5J0S A;  3WKC A;  1ZQF A;  4Q8E A;  4DQP A;  5EWG A;  1PUZ A;  1NK9 A;  3OGU A;  3IHQ B;  4R64 A;  1DXS A;  1TV9 A;  5DQH A;  7ICQ A;  4C4S A;  2CXY A;  1UT5 A;  7ICT A;  5DBB A;  5AIB A;  3OSN A;  3V6H A;  3ISD A;  4DOB A;  9ICN A;  1ZQE A;  5K4L A;  4J9L A;  4YR2 A;  3QU4 A;  1ZD5 A;  1ZQO A;  4F5O A;  8ICI A;  3MGI A;  2IOF K;  5IIK A;  2OHF A;  2R8I A;  5J2H A;  3M7D A;  2Q4T A;  4IR9 A;  2VAN A;  3KOO A;  1KSP A;  2YTU A;  1TAQ A;  5J8Y C;  3OJU A;  1CRX A;  1S97 A;  1XSN A;  2MRL A;  2AGQ A;  1PVP A;  4KLU A;  4C8L A;  3H0L B;  4UBB A;  1K1Q A;  5DG7 A;  3PR5 B;  2WAQ F;  2VA2 A;  1X6I A;  2UVR A;  4UAY A;  1MN8 A;  2OM6 A;  2Z7J A;  1L7P A;  5J0Q A;  1ZYQ A;  2FI1 A;  4NLG A;  1NK8 A;  4QIW F;  4EEN A;  1WWU A;  1BNP A;  8ICV A;  4O3S A;  4O3M A;  2DWQ A;  4RQ8 A;  2QB1 A;  4DFK A;  3S6J A;  4PGQ A;  3K1Z A;  1VLB A;  4DEZ A;  3RJI A;  4DSL A;  2KNJ A;  1BPE A;  5GTH U;  2VJ5 A;  4DSJ A;  2W7O A;  3LWM A;  2HHW A;  5KFN A;  2XCP A;  1QSL A;  4P0Q A;  3RBE A;  4DSF A;  2G09 A;  3KHL A;  4HYK A;  1U45 A;  3QZ8 A;  4KMO B;  1HJP A;  3V7K A;  5KFI A;  4Y2J A;  3QNM A;  1NKE A;  3BJY A;  2IHN A;  3BZK A;  4I2I A;  5KFQ A;  5JU5 A;  4UB1 A;  2DL0 A;  4IS7 A;  1X9M A;  5KG3 A;  4GC6 A;  3H7I A;  2ZJ8 A;  1RXV A;  1K5O A;  1OXJ A;  3EYZ A;  1SZH A;  2W9B A;  1DOQ A;  3F2B A;  3NUQ A;  4DOA A;  3RB6 A;  5D46 A;  2N1R A;  9ICU A;  4IRK A;  3KTQ A;  3GFK B;  1JI7 A;  1MSW D;  3JPQ A;  3GV8 B;  2KFN A;  5AKL A;  2KZ3 A;  1H38 A;  5EE3 A;  8ICF A;  1COO A;  1ZQJ A;  7ICF A;  2HI0 A;  3QEA Z;  5JTI A;  2W9C A;  1U9L A;  4C8O A;  4JV1 A;  2AGP A;  4Y2Y A;  2XVT A;  1T3N A;  1RYS A;  4FZL A;  4KLG A;  5JUM A;  4NLB A;  4CF4 A;  2JV3 A;  3NTU A;  5F9N A;  2PI4 A;  2YMM A;  2IMW P;  3PST A;  4UAU A;  7ICO A;  2A1J B;  2NRZ A;  4FS2 A;  3BDP A;  1PZN A;  3RRG A;  2XY7 A;  1A0P A;  4DFD A;  1ZQL A;  2R8G A;  3OTQ A;  1SXD A;  5GTI U;  4E0D A;  5J2E A;  4XUS A;  4B9U A;  1NOM A;  4MF8 A;  2M9N A;  1NKC A;  8ICZ A;  4TQR A;  2JHD A;  1SWV A;  4RQ7 A;  5KFJ A;  3PML A;  4F92 B;  3A0H U;  4UAV A;  1N5W A;  3MDC A;  2FMP A;  3GU3 A;  1O08 A;  5KL8 B;  3PNC A;  3Q8S B;  3PX0 A;  4YD1 A;  4EBC A;  1SZP A;  5KFC A;  1S76 D;  4AP9 A;  5IIL A;  9ICL A;  4I2B A;  5KFA A;  4NL9 A;  5KFE A;  1QSY A;  8ICU A;  1RQL A;  3AUO A;  4QZ9 A;  4G9B A;  5CJ7 A;  5KG4 A;  8ICH A;  3MGV A;  2E8O A;  1BPZ A;  5HP4 A;  3PSF A;  4EZ9 A;  1Z19 A;  2R8J A;  2XY5 A;  1X2I A;  3EWA A;  1SV0 C;  2VA8 A;  2Y1J A;  3N7R C;  3KHR A;  4J9M A;  4M04 A;  2HOI A;  5AI6 A;  4O3O A;  5ALH A;  2PI5 A;  2BCR A;  2AQ4 A;  7ICI A;  5DQG A;  2LM4 A;  1KDH A;  4C80 A;  4F50 A;  1CEZ A;  1ECW A;  3L3F X;  3MAB A;  1S0V A;  2I1Q A;  1D8L A;  2KKP A;  5KFR A;  2XGP A;  3M6Z A;  1KW4 A;  3F5E A;  1S0M A;  1OW5 A;  4C7Z A;  2WFA A;  4US9 A;  5TZV A;  1TVA A;  4MEY A;  5KFY A;  2KG5 A;  3KFU F;  1SGG A;  2FJ6 A;  5DB7 A;  2BPG A;  3GV7 B;  9ICH A;  2H3Q A;  5ALO A;  4TUS A;  4CDG A;  3TQ1 A;  2ZUC A;  2BGW A;  1M6Y A;  4Q43 A;  2ZIU A;  4MFF A;  1K1S A;  4TUP A;  3HJE A;  3F2C A;  2EAP A;  2G07 A;  5AKK A;  3WK4 A;  1XSP A;  4QZC A;  2E3T A;  2VA3 A;  3NVZ A;  9ICF A;  2WF5 A;  4DSK A;  3KKA A;  1N5X A;  4EEY A;  2W8K A;  4YD2 A;  2I6X A;  1IXR A;  2LHT A;  5DGA A;  8ICC A;  4PHD A;  2IHM A;  4J9O A;  4O5E A;  2EAM A;  5J2K A;  3SAF A;  4EEK A;  5TIS U;  1XU4 A;  2DFL A;  3ZDD A;  3QUC A;  4DFJ A;  1COK A;  5ALN A;  5J2A A;  3OPX A;  2W7P A;  1CI4 A;  3K4G A;  4DLE A;  2W3S A;  2ZXH A;  4QWA A;  2O6K A;  3QUB A;  2BDP A;  4ECR A;  4NWI A;  2LMR A;  4JV0 A;  2HOF A;  5ALW A;  2KHQ A;  4J9R A;  3PVX A;  3UMB A;  1ZQ1 C;  3F2D A;  4QZF A;  4F4Y A;  3RAQ A;  5KT7 A;  1NZP A;  4DFM A;  2HHX A;  3T79 A;  5B5E U;  3H8S A;  4UB5 A;  2GH1 A;  1N48 A;  5AM2 A;  4EEL A;  4NXZ A;  1FO4 A;  2A1A A;  1TAM A;  8ICX A;  5J0U A;  2MUT B;  3IG5 A;  9ICX A;  3GQC A;  3IM1 A;  5EOZ A;  3QEB Z;  1TKD A;  1AQ6 A;  2K8A A;  2K8B B;  3QU7 A;  1ZQR A;  5A0L A;  1F44 A;  3TAN A;  3D2Q A;  3BS5 A;  4JMU A;  2G5H B;  2JH7 A;  3GIM A;  4KLF A;  1LVH A;  5BOM A;  3M9N B;  3LDA A;  5D49 A;  4QZG A;  3TAC B;  3PX6 A;  2HW3 A;  1X6J A;  4ED3 A;  4RQ3 A;  3TFS A;  2FMQ A;  3QYP A;  4A8E A;  4EYH B;  5KFL A;  1X40 A;  2HDO A;  2WF9 A;  1RYR A;  4LZD A;  4UB8 U;  8ICK A;  2C2D A;  3GIK A;  1KL9 A;  4NJ8 A;  4RNN A;  4CF5 A;  5C0Y A;  4BWM A;  1XWL A;  2JZB B;  3JPR A;  3FM9 A;  2KEY A;  2B21 A;  5D4B A;  3PSI A;  1N2X A;  4DO9 A;  1ZQD A;  5FP0 A;  1QTM A;  4P0P A;  5AIC A;  2MA1 A;  2Q0Z X;  3N97 B;  3GZF A;  4MFA A;  1DK2 A;  3RFA A;  5ALS A;  7ICG A;  4F2R A;  4KN7 A;  3IP4 B;  1U48 A;  2CN1 A;  1ZQV A;  5AKG A;  2PFN A;  3EPG A;  2DUY A;  8ICE A;  4OJ5 A;  2ZIX B;  1V97 A;  3SQI A;  1MC8 A;  4F71 A;  3B0X A;  2G5I B;  2A19 A;  4RQ5 A;  1KFT A;  3D2N A;  4PHA A;  2YQE A;  1P7D A;  1DK3 A;  5AM0 A;  5AKX A;  2KMD A;  3RH5 A;  3QX7 A;  4C0Z A;  4M6W B;  2W11 A;  5KAI U;  2RDJ A;  4CF3 A;  5ALX A;  2RHF A;  4FO6 A;  5KG5 A;  3M9M B;  1SKS A;  4JK1 A;  4FBU A;  1X9W A;  1ZQP A;  3E2E A;  3RJG A;  3C5G A;  4DFP A;  3C23 A;  5KG0 A;  7ICU A;  3GIL A;  5E79 U;  2K8C B;  2H3V A;  2F1J A;  2NO4 A;  4UB2 A;  4QW9 A;  3IN5 A;  1ZQY A;  2KD1 A;  2KJ8 A;  2LBO A;  4YXJ A;  2PXI A;  2KKV A;  4IQT A;  5AK6 A;  2EZY A;  4OJO A;  3RB0 A;  1ZET A;  1JXL A;  2LI6 A;  2Y1I A;  7ICH A;  4PJ0 U;  2J6U A;  3CP8 A;  2XCA A;  2BPF A;  4KMU A;  1ZD2 P;  2ODG A;  4P0P B;  1KN5 A;  1S8O A;  3PW0 A;  1ZQH A;  2HSZ A;  4YR0 A;  2MU2 A;  1RQN A;  4RQ1 A;  2ALZ A;  5J2F A;  2XIC A;  1ZQT A;  2GOL A;  1Z00 A;  4F5P A;  2IA6 A;  3BQ7 A;  3C21 A;  5J8Y A;  3CRX A;  5ALI A;  7ICL A;  4YP3 A;  2V4R A;  1BPD A;  2FPL A;  4ECX A;  3WK5 A;  2HBJ A;  2QAR B;  5KFP A;  2CRX A;  5DLF A;  4LJX A;  5KFF A;  5ALP A;  2W54 A;  2EAN A;  2EZX A;  4Y2R A;  2XO7 A;  2DPI A;  4O9M A;  4Y2P A;  2OEH A;  1Y88 A;  3ETR A;  4QJF B;  4J03 A;  3G6Y A;  4PL2 A;  5KFT A;  4P4M A;  2ZTD A;  3BZC A;  1BVS A;  4Y2V A;  3E58 A;  4I2A A;  4NM1 A;  1V9P A;  3KHG A;  1ZQG A;  4ZH4 A;  2XY6 A;  1UQV A;  5KFW A;  2KIC A;  4Z6D A;  1X66 A;  5KFK A;  5J2D A;  1L3T A;  3QZ7 A;  3DV9 A;  3QU2 A;  3KZX A;  2XI9 A;  3KD3 A;  4GLX A;  4DF8 A;  3SZ2 A;  3ZDC A;  1NK5 A;  5DKW A;  3QU5 A;  1C20 A;  1URJ A;  4CRX A;  4DSE A;  3C2K A;  4KTQ A;  3MFI A;  9ICT A;  3JPO A;  9ICM A;  4RUC A;  2I5H A;  2OCE A;  4P4O A;  5CRX A;  1FIQ A;  3C29 A;  4OJP A;  4Z6C A;  3C2L A;  1RPL A;  3NRZ A;  2FPM A;  3NVY A;  5KFG A;  4JWM A;  4ECU A;  5KFX A;  2YX8 A;  1WYG A;  2F44 A;  1PK1 A;  3ZDE A;  2MAX A;  4KX5 A;  2A1J A;  3RJE A;  2OH2 A;  5L1I A;  1S77 D;  4UQG A;  2JZB A;  2H3Z A;  4DSI A;  4J9Q A;  2KIV A;  2VIX A;  2W9M A;  2C2E A;  9ICB A;  5AK5 A;  4BXO B;  3T5J A;  4JUZ A;  5ALZ A;  3Q8R B;  2D6F C;  1ZQM A;  3RJJ A;  1TK5 A;  3ORY A;  3SI8 A;  1RM6 C;  1WCN A;  3V72 A;  8ICR A;  5J2J A;  1JMS A;  3LVV A;  5ALD A;  3ZI4 A;  2ZTC A;  5ALL A;  3OHA A;  3ALR A;  3RRH A;  2YY6 A;  1D8B A;  1S0O A;  4TQS A;  1JAL A;  4F91 B;  2E8P A;  7ICN A;  2HVI A;  3C28 A;  1F0M A;  4F4K A;  4FZN A;  3PZP A;  2HBL A;  3SR6 A;  2RRD A;  1L8O A;  2JRZ A;  3RH4 A;  1ZQS A;  2M0N A;  2AGO A;  4IQW A;  2G06 A;  1WCL A;  3PMN A;  4J9P A;  3RJH A;  2F8L A;  2YML A;  2P6R A;  3MC1 A;  2BQU A;  1KKX A;  5J2I A;  9ICA A;  1KBU A;  5KFU A;  2BCQ A;  4RT3 A;  3IDW A;  5KG7 A;  1LV5 A;  4NLC A;  4UAR A;  1J2N A;  2KK0 A;  2QKQ A;  1SV0 A;  1L8L A;  3Q8Q B;  1XC9 A;  3MBY A;  3RB3 A;  5J0W A;  2LYH A;  3BQ0 A;  3AMZ A;  4ED6 A;  4NY8 A;  2HMX A;  4RZR A;  2DBY A;  2EDU A;  5T14 A;  4PZO A;  2V4Q A;  3AQF A;  1TFR A;  2BQ3 A;  1JX4 A;  3UPQ A;  4F4X A;  2YB4 A;  4BX9 C;  4RQ4 A;  2MSN A;  2KJ9 A;  4ECV A;  3BQ1 A;  1ZD3 A;  1ARO P;  2ZG6 A;  2VKQ A;  3BQ2 A;  1B0X A;  4Z6E A;  4M0A A;  3ZD9 A;  3LVW A;  3AM9 A;  4DQQ A;  2J6T A;  3MGH A;  3UQ0 A;  3NGD A;  9ICI A;  1KLN A;  1X9S A;  2W55 A;  2VJ4 A;  3WKE A;  1GO3 F;  3HRD D;  4GXI A;  1ZQQ A;  1OUQ A;  4KLJ A;  2JEI A;  3UQ2 A;  4JV2 A;  4PZN A;  4J9S A;  1SL0 A;  4EBE A;  9ICJ A;  1JN3 A;  2KSO B;  5HML A;  7ICM A;  1IM4 A;  4KIT B;  3F53 A;  5ALE A;  5AKH A;  1T8E A;  5CWR A;  1KRP A;  2QB0 A;  3N7S C;  3PX4 A;  1Q3V A;  4RPZ A;  2F2A B;  5AKJ A;  2KFZ A;  4Y2T A;  4IL6 U;  2Y9U A;  2W9C B;  1TK0 A;  4K4H A;  1YZ7 A;  5AHX A;  4M2Y A;  4EZ6 A;  1L7N A;  5KFZ A;  3M6K A;  3TI0 A;  1ZQX A;  5CP2 A;  1V85 A;  5HHI A;  4QWE A;  5IIJ A;  4I2F A;  8ICP A;  4R65 A;  5L1M A;  4WJ3 B;  3QE9 Y;  2E8M A;  3M1Y A;  1XS9 D;  4BUG A;  1ZQN A;  2W3R A;  3D2S A;  1ZXI A;  5AKZ A;  3TAD A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  1SV0 C;  2QAR B;  2KIV A;  2D3D A;  1LKY B;  1JI7 A;  2LPE A;  2EAN A;  2L5Y A;  2KSO A;  2YTU A;  1B0X A;  5J8Y C;  5JTI A;  3SEN A;  3BS7 A;  2KMD A;  2GLE A;  2K4P A;  3K1R B;  1WWV A;  1KW4 A;  1OW5 A;  1LKY A;  2ES6 A;  2JV3 A;  4RQN A;  1UQV A;  5KNI A;  2KG5 A;  1SGG A;  3H8M A;  2E8P A;  3TAD C;  3BS5 A;  1F0M A;  1WWU A;  1X66 A;  1PK3 A;  2DKZ A;  4NL9 C;  5F3X B;  2KE7 A;  2QB1 A;  4PZN A;  1Z1V A;  1V38 A;  1SXD A;  2EAP A;  2KSO B;  1X9X A;  3TAC B;  3BS5 B;  2D8C A;  2ESE A;  3KKA A;  1SXE A;  2F8K A;  1B4F A;  1X40 A;  2FE9 A;  3SEI A;  2DKX A;  2QB0 A;  4MHV A;  2EAM A;  4NJ8 A;  3IDW A;  2QAR A;  4RQM A;  2E8N A;  3HIL A;  2EAO A;  1PK1 B;  2K60 A;  2Y9T A;  2F3N A;  2B6G A;  2QKQ A;  1SV0 A;  2Y9U A;  1UCV A;  1COK A;  4NL9 A;  5JRT A;  1DXS A;  1SV4 A;  5JU5 A;  1V85 A;  2DL0 A;  2F44 A;  1PK1 A;  1RG6 A;  4IS7 A;  5L1M A;  1OXJ A;  2E8M A;  2E8O A;  3BQ7 A;  2LMR A;  5J8Y A;  3KKA C;  4PZO A;  3TAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...