1COKA

Structure of the c-terminal domain of p73
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SECOND SPLICE VARIANT P73)
publication title Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1cokA00
1PK3A 1WWUA 2EAMA 3BS5B 2YTUA 2QB0A 1PK1B 5J8YA 2KG5A 2QARA 1V38A 2GLEA 2KSOB 3KKAC 1F0MA 1V85A 1LKYB 2ES6A 1Z1VA 2LMRA 3TADC 3SEIA 4MHVA 2EANA 2D3DA 3IDWA 2FE9A 1X40A 1SV4A 3SENA 2ESEA 3TACB 2K4PA 4NL9C 3KKAA 1WWVA 5JTIA 1OXJA 3HILA 3H8MA 1X66A 2E8MA 3TADA 1SXEA 1COKA 2JV3A 5KNIA 2QB0B 2F8KA 4IS7A 2L5YA 2QARB 2E8OA 2KMDA 5L1MA 1DXSA 4NL9A 1RG6A 2KIVA 1JI7A 3K1RB 2B6GA 1PK1A 1B0XA 2DKZA 1KW4A 2Y9UA 4RQMA 2QB1A 2EAOA 1LKYA 2KE7A 2E8NA 5JRTA 5F3XB 2F44A 1B4FA 1SV0A 4NJ8A 1SXDA 2E8PA 2LPEA 2QKQA 2K60A 5J8YC 3BS5A 1UCVA 5JU5A 2Y9TA 1SV0C 1UQVA 2EAPA 3BQ7A 1OW5A 4PZNA 3BS7A 1X9XA 2D8CA 2DKXA 2F3NA 2KSOA 4PZOA 2DL0A 1SGGA 4RQNA
chains in the Genus database with same CATH superfamily
4RT2A 3SI8A 4M9LA 9ICHA 3MC1A 4ECQA 2WB1C 5KG2A 1WUDA 3WKEA 4ED7A 1S9FA 1JX4A 5TZVA 2W9MA 2NRZA 2RDIA 1Q8KA 3PSFA 3C2LA 1VJ5A 4PHAA 1Z1VA 4FZMA 3PX6A 3HP6A 2HW3A 3EPGA 3RTVA 1BPYA 1D8YA 4ECTA 2KZ3A 2KFNA 4IR9A 4KLJA 7ICLA 3SAGA 4DL2A 5KG3A 3LWLA 1SV4A 1JIHA 4QZFA 5AM5A 4USAA 2ZIVB 2XGQA 4DFPA 4DF8A 8ICUA 4DL5A 9ICQA 4UAWA 5CEHA 2PFOA 3PR5B 2BQRA 1RQLA 3KOOA 2W8LA 3JPQA 8ICYA 5IIJA 2KIWA 4NL9A 3FM9A 2FMPA 3RJFA 1ZQLA 5J2GA 2Y1JA 5CP2A 4EELA 3CP8A 1DK2A 1VDVA 1WG8A 5KT3A 1QSYA 1XNSA 4UB5A 2G5IB 1Q3UA 3D2NA 4RQMA 3GIIA 2Y0SC 4DL4A 5KL8B 4G3IA 1L7MA 2VJ5A 2ODGA 3PO5A 2NO5A 3EYZA 2ZIXA 1QQ5A 2ZIUA 5KG5A 3MR2A 2HOFA 2FDRA 4KMOB 5AKYA 3SAHA 7ICVA 3C5GA 4Z6EA 2ISPA 3QZ7A 2GWSA 3FAHA 3H0LB 5ALXA 2BCVA 2ZUCA 4NLGA 4Y2TA 3AU6A 3ICXA 1C20A 3IRUA 3BQ0A 1L3TA 2HDOA 8ICIA 3RAXA 5KFAA 1J2MA 4UB1A 4OJOA 2ASJA 4Y2UA 4DO9A 1JALA 1NZBA 7ICJA 7ICIA 3PX0A 2ZIVA 2G06A 1U9LA 2HVHA 2K4IA 1D8LA 3T79A 4KLLA 4GC7A 4I2DA 5J2EA 2ALZA 3H0RB 1HUZA 4KTQA 4EENA 1Z4NA 4BDPA 8ICXA 2YX8A 3HILA 1TVAA 1YZ7A 4YCXA 5AKZA 2JEIA 4BXOA 5AI9A 1ZQEA 2FI1A 2JGAA 4QIWF 2NRWA 2NYVA 1S0VA 4M9JA 3L3FX 4J9PA 1MN8A 2KP7A 2DKZA 5KFZA 2XC9A 5G5HA 5HHHA 4DQIA 3TARA 4B9TA 2A1AA 3FDSA 3N7PD 3RJJA 4KLIA 4IL6U 1SB3C 5AK4A 4RPXA 7ICOA 9ICFA 5ALQA 5B66U 9ICXA 1ZQOA 8ICNA 3C2KA 3C2MA 3H7IA 4TQRA 5J0YA 2YB1A 5DQHA 1KDHA 4R63A 4ELUA 4PZOA 5AKLA 3RBEA 1QH9A 5DBAA 2WF6A 4JK1A 3C21A 2FPMA 2YTUA 3SAFA 2CN1A 2KG5A 2HBLA 1XSNA 5KFUA 4KLFA 4C4RA 5J0PA 2GLEA 3RF9A 1N2XA 1F0MA 4KLOA 1U47A 1K1SA 2W43A 5CR0A 4O5EA 1TE2A 1RDFA 2LI6A 9ICGA 4ED1A 2E5SA 4I2GA 4RUCA 1ZXIA 1RM6C 1PVRA 1NJZA 3JPOA 5FP0A 4RQ1A 1SXEA 5IIIA 4O9MA 4UQGA 4P0QA 3JPTA 4EX6A 4YMOA 3RR8A 4B9LA 3IM1A 1ZQAA 5B5EU 1LB2B 3M6ZA 3J81j 4UAUA 5HR6A 1KFDA 2H3QA 5AKHA 4F4ZA 2KIVA 1HJPA 2CRXA 3MDCA 2AGOA 9ICJA 4PGQA 2KZMA 2W9BA 2YB4A 2KICA 3BZCA 2N1RA 2YMPA 4RNMA 1Q3VA 2DWQA 3TKAA 5DBCA 2W3RA 5AKGA 2KV2A 2GO7A 3E58A 2KE7A 2H3ZA 4OJLA 5JRTA 2ZTCA 5KT5A 3VCBA 5KFOA 3WK7A 1ECWA 5ALKA 3AU2A 2Q0ZX 4OJPA 2KHQA 2IBKA 1V9PA 3BQ7A 3TQ1A 5EOZA 5J2KA 2VA8A 4F5OA 3N97B 2V4RA 9ICOA 5KFHA 1UT8A 4YVZA 3JPNA 3PZPA 3NGDA 9ICTA 2QARA 8ICTA 4ED6A 2XIDA 3NVZA 4ECZA 2I1QA 2KSOB 4I2BA 2H3FA 7ICKA 2OH2A 4DQSA 5ALLA 3V6HA 4F5NA 4PH5A 4KLGA 4UBCA 3IDWA 2XGPA 1JRPA 2G08A 4DLEA 4Y2VA 3PMLA 4CRXA 5DB7A 5DG8A 7ICQA 5KFXA 1COKA 3UQ0A 4LZGA 1QSSA 2ZG6A 1T94A 3ONNA 4RT3A 2HHVA 2JH1A 2BDUA 3T5LA 8ICAA 2AXTU 1S76D 3RB4A 1S0MA 3NUQA 3LWMA 8ICWA 3F2CA 5ALTA 4KITB 2AU0A 4IQUA 5KT7A 3R9KA 1NKEA 4CF3A 4KLQA 2XI9A 4P4MA 4QWCA 5E79U 2WAQF 1J2NA 2V9WA 1P7DA 1SZPA 2HBKA 3G6YA 5J2BA 4YP3A 4HAIA 1XS9D 3A0BU 4M6WA 2UVUA 4Y2QA 5DB9A 1OUQA 4KLUA 1FFUA 3Q8LA 2NO4A 4F72A 9ICMA 4NLNA 1JROA 2R8HA 1BPXA 4I2FA 4I29A 2NV3A 4XQ8A 5KFWA 2KSOA 5C0YA 5D4BA 2KOBA 3KFUF 3JPSA 4FS1A 1PK3A 2KJ8A 4IRKA 4FS2A 1N63A 1TAMA 5J0QA 1N61A 3RJIA 3QYPA 4J03A 1Q46A 7ICPA 4TUQA 2P6RA 4K4HA 3KHGA 5L1LA 4K4IA 5KT4A 1PVPA 5AI5A 2JZBB 1L3UA 3SEIA 1BPEA 4DQRA 4C0ZA 2W3SA 1BPDA 2A1JB 3TANA 4NLZA 5C5JA 5EE3A 5AM2A 1NK9A 4Y2XA 3U26A 4I2HA 4F3OA 2OYYA 5ALZA 8ICSA 3THVA 4QZBA 3H8MA 1JMSA 3G6VA 1X6IA 3OPXA 2GH1A 2F8KA 2BDPA 5ALPA 1BGXT 4UW9A 4P0PA 5J0UA 1Y88A 4GXKA 4Z6CA 2KJ9A 2OCEA 4US8A 4O3PA 2PI4A 3UXPA 3HX0A 4J9LA 2AH5A 4F93B 4CF4A 4DCCA 3KBBA 3UMGA 5A0LA 2F76X 4NXZA 1N5WA 4YD2A 5L1IA 8ICOA 4Q44A 1XSPA 1KEJA 5KG4A 3OJUA 5K4LA 4NJ8A 4FE3A 8ICFA 5J8YC 2O6KA 1ZQZA 2RHFA 4CGZA 4QZ8A 3PR4A 1X9WA 3H4BA 4M9NA 2G0AA 3AN1A 1VLBA 2ZXHA 4LVSA 3ZD9A 4TURA 5HP4A 1K1QA 4KX3A 4I2EA 3I76A 3LVWA 5KFGA 2KEYA 4UBBA 1ZQIA 4YR3A 1C7YA 4XA5A 2LM1A 1JXEA 4C8OA 4ACOA 1SZHA 2KD1A 2NRTA 2A1JA 4B9VA 3F5AA 3IV6A 5DLGA 4PHDA 2YMQA 3WU2U 9ICLA 4Q43A 3D2SA 5AIAA 8ICPA 2AHOB 2R18A 4DSFA 2DGZA 3N7RC 3PNCA 4TUSA 3RAQA 3TFSA 4DS4A 4CCHA 1TFRA 5KFTA 8ICKA 4ED3A 4NM2A 2ZIUB 3PSIA 3JPRA 2FLNA 2KTQA 4RUAA 2FE9A 1QSLA 4AP9A 5KG1A 4BJQA 1WWVA 3TADA 4QZCA 5J0XA 5KNIA 4KLTA 2JH7A 5EE1A 2KFZA 3HT3A 5AK3A 1Z1BA 4R66A 5KFCA 3NRZA 5F9NA 1JI7A 4PGYA 3V6JA 4AYBF 1EXNA 5EWEA 2H3IA 4QW8A 4O3NA 3F53A 9ICAA 5ALEA 1L5UA 4IR1A 2WB1F 4IQWA 4GLXA 1PVQA 1NK5A 1BNPA 5HMLA 3T5KA 4IQTA 1ZJNA 5GTIU 4CE6A 4LZDA 4KLSA 5AI0A 4BXOB 5ALFA 1ZQVA 1KRPA 2HHXA 5KT6A 1HUOA 3QU2A 2HHUA 5KFMA 1MQ2A 1X9XA 9ICCA 5KFSA 4RQ5A 4RQNA 3SMVA 2YQEA 5KFDA 4I27A 1S8OA 1IG6A 3WKDA 1FFVA 3T3FA 4C8KA 3F2BA 8ICHA 2BQ3A 2JXJA 1NKCA 1FO4A 4J9MA 3PSTA 3WK6A 2VJ4A 1A76A 4OO1J 4FZLA 3RJGA 2K8BB 4QZ9A 4MEXA 5L1KA 3TACB 7ICTA 1PZNA 3CW2C 2KNJA 1RYUA 4UARA 2H5XA 3BQTA 3E2EA 1X66A 4J9NA 2Y0SF 2BKEA 2JV3A 4DSKA 4YQWA 1ZQJA 4EYIB 3MFIA 1T3NA 2OXOA 3H0MB 4F91B 1F44A 1PK1A 4KLHA 4CF5A 3F5EA 4Y2JA 4QZIA 2DUYA 3GDXA 2BCRA 3SZ2A 1CUKA 3NTUA 4UB3A 3V7JA 7ICFA 1NOMA 2QB1A 3OJSA 7ICMA 1LKYA 3RBDA 3QNMA 2NRXA 3LK9A 4UB4A 4P2HA 2FPLA 2QKQA 1UCVA 2R8KA 4P0QB 1SV0C 2KN7A 5KFQA 4HYKA 1AQ6A 3QUQA 3C5FA 1L7PA 5AKJA 1O08A 1S77D 2WTFA 2J6UA 4GXJA 2DL0A 1HEKA 1QLNA 2W8KA 2IOFA 4PJ0U 4RQ2A 2W9BB 5DLFA 5KG0A 2KHVA 4MF8A 2VANA 3KKAC 1V85A 5CB1A 5ALHA 5KT2A 4KLMA 2A19A 2ES6A 2LMRA 4F50A 2BZFA 3HRDD 1S5LU 3LDAA 2K89A 2EANA 4Q8EA 4O5CA 3LYSA 4DWIA 3ISDA 2IHNA 4F4XA 5G5GA 2WF7A 4DFJA 5AI4A 9ICNA 4GIBA 5HHIA 4KX5A 5ALOA 9ICUA 1Z00A 5GTHU 3AUOA 1UA0A 4RPZA 3KZXA 2ZJ8A 3QUCA 3ZDBA 2HI0A 2V4QA 1A6SA 1QTMA 1S0NA 2QARB 1ZQYA 4ZH4A 4CDGA 2ISOA 5KFKA 1DGJA 5ALRA 2F1HA 2I9GA 5KL1B 2LYBA 3G6XA 2W54A 4UATA 3BZKA 2VA2A 2KK0A 5J29A 3K75D 5ALNA 4Y2YA 4JB3A 4IRDA 4F5PA 9ICBA 4R8UB 5DB6A 3HW8A 3UXNA 3O0FA 4FFDA 1SV0A 2PFQA 2LPEA 1NJYA 2ZJ5A 3AQFA 3QU7A 3A0HU 2JRZA 3GIJA 3GV8B 9ICPA 4YFKA 3HKZC 3GZFA 2ZTDA 4J9SA 5ALUA 3PW4A 4JV1A 4IC9A 1OW5A 3Q8KA 1ZQQA 3FYHA 5F9LA 1UT5A 3M9OB 2H3VA 1NNLA 1YT3A 2B0CA 2DBYA 5IIOA 3QX7A 5DG7A 4YXJA 1S10A 1XO1A 4LJXA 2BCQA 5ALDA 3PX4A 4JV2A 4MFAA 4IQVA 5L1JA 5AI6A 4KLDA 4PL1A 8ICRA 2KZZA 2P6UA 2UVVA 1Z4OA 4M6WB 3D6JA 8ICMA 2BQUA 3N7SC 1X2IA 9ICEA 3GFKB 1ZQKA 5AI8A 5DGBA 3MABA 2XICA 2ESEA 2BPCA 4EBCA 4QJFB 1TV9A 3AL0B 2FPKA 3L4PA 3MDAA 4NLCA 4F92B 1PUZA 3SV3A 1CI4A 1NK6A 4DOCA 2OWOA 3BJYA 4R8UA 1NK0A 1IXRA 2AGPA 4ED8A 2B6GA 4ELTA 1X6JA 2ZUBA 4PHEA 9ICIA 4E0DA 3WK4A 1NZPA 4ZOHC 8ICGA 8ICLA 8ICBA 5ALSA 7ICRA 2P35A 2EAOA 2JEJA 3UM9A 2LYHA 5ALIA 2XCPA 1YZ6A 4UB6U 3UXOA 1B4FA 4YR0A 3UMBA 2MRLA 4CNQA 4WJ3B 2BHNA 2FMQA 3OHAA 1N62A 4FO6A 3KHHA 2I6XA 5HMMA 4DSEA 3ZDCA 4P0PB 2XCAA 1KL9A 1RXVA 2C2EA 3PVXA 2F3NA 2XO7A 1NKBA 2ATLA 1FIQA 3OSNA 1XU4A 2G07A 4PGXA 4B6JA 4QWAA 1WWUA 2VA3A 2QB0A 2JHDA 2W7OA 4EEYA 2LBOA 4F4YA 3RH4A 3SQIA 8ICVA 1NK8A 2W9CB 3UMCA 1SWVA 1JN3A 4C8LA 3OGUA 1QCKA 3BDPA 1MC8A 4UAYA 2RP5A 3RB6A 1KLNA 4JWNA 2IA6A 2Q4TA 7ICUA 5DB8A 1TK0A 4R64A 2LM4A 4GC6A 2Y1IA 1B22A 8ICZA 2E3TA 3C23A 2KKPA 8ICJA 4JMUA 3M8RA 1DGSA 3CYMA 2EZZA 3NS1A 4RNOA 4UB8U 1BPBA 2WF8A 4QWDA 2KJ5A 5JTIA 2RQ5A 4DEZA 4DSIA 2ASLA 2C22A 1D9FA 2B21A 1ZOLA 4YD1A 2R8GA 3WK8A 5J0OA 1HIWA 4Y2RA 3AEVA 7ICGA 5KFIA 2HCFA 1DRGA 2E8OA 1BNOA 3AQEA 1X9MA 2VIXA 1U48A 5AICA 4R65A 3UQ2A 3EPIA 3ETLA 4DSLA 3I1YA 2DQNB 4O5KA 2BPGA 1T4GA 2WHEA 1KW4A 2HVIA 4M04A 4RPYA 5IILA 4B9UA 4C7YA 4RU9A 3ETRA 2F44A 3Q8SB 1ZQ1C 2KVSA 4I28A 2K60A 3QUTA 2JEFA 2Y9TA 5IIKA 1S0OA 1ZRMA 3SR6A 4U7CA 3MR3A 1COOA 2W9CA 4U6PA 4QWBA 2PFNA 3HPOA 2DKXA 5ALJA 1N56A 3Q8MA 2PMZC 2EH9A 1MQ3A 2C2RA 4G9BA 7ICHA 1RPLA 5DQGA 4O0IA 3V7KA 2F1IA 1V38A 2PFPA 1KSPA 2K8AA 5ALWA 3GIMA 1A77A 5IIMA 1LVHA 3MR6A 4YG2A 5J2HA 2C28A 5EE0A 5KG7A 4EYHB 4NV0A 4QZEA 4F5RA 2OM6A 3H40A 3WK5A 2RDJA 1L3SA 4Y2PA 4ECYA 2WF5A 3TAQA 4NL9C 4US9A 3QU9A 1KTQA 3M7DA 1ZD5A 3K1ZA 4BX9C 2XY6A 1RZTA 3PW2A 1V97A 4ECUA 4IS7A 4YN4A 4Q8FA 1TAUA 1L7OA 5KFYA 1AROP 5J2IA 3ZI4A 4YMMA 1CRXA 2NRVA 4UAZA 1M6YA 4KMUA 2KVCA 2JR5A 5AKXA 1L6NA 2PXIA 1QQ6A 2FMSA 1ZQHA 4NWIA 1TK8A 5KG6A 1WCNA 5H2FU 3CRXA 3RB3A 1SKRA 4BUGA 5AM4A 2E8PA 2YMMA 4M47A 5J0SA 2W9AA 3EUB2 3IG8A 4M9GA 4DOBA 2GOLA 1T8EA 3GILA 2HOIA 1ZQFA 4DL6A 2K4EA 2HBJA 5ALMA 4OJ6A 4PZNA 1H38A 4KLEA 5AK5A 1KFSA 1SGGA 5KFEA 5J2JA 7ICSA 3NVVA 2E1FA 1PK1B 5J8YA 5BOMA 3QEAZ 2KKVA 4PL2A 2RRDA 3V72A 5AKEA 4YXMA 5CHGA 1IV8A 3OSPA 1ZQRA 3RH5A 5ALYA 1LKYB 3RJHA 1XC9A 4NLKA 8ICEA 3PMNA 1S97A 1NI3A 4RQ3A 3PV8A 2YY6A 3SENA 5HNKA 5IINA 2UVRA 1NK7A 2DPIA 2W11A 3H8WA 3M8SA 4EX7A 2W04A 2PKEA 5EWGA 3RH6A 3OTQA 5DQIA 3RR7A 4M2YA 3V7LA 5L1MA 2ASDA 3ORYA 4O3RA 2HSZA 5KFRA 3SYZA 5J2AA 3VC8A 4DL7A 3SD7A 4C7ZA 2AQ0A 2DPJA 4Y2SA 4A8EA 4BWJA 2YMLA 2MU2A 4QZGA 1KKXA 4ECVA 3NASA 2ZUDA 5CRXA 5J2FA 2FLLA 5D49A 5KFFA 1Z00B 5J2CA 3DDHA 4B9NA 2F1JA 4QIWC 3B0XA 4I2AA 5AKIA 2IMWP 1ZD3A 4DFMA 4B9SA 1ZRNA 3HJEA 3GU3A 3WKBA 5BOLA 3C28A 1SIJA 5DGAA 2G5HB 4RZRA 2R8IA 2EAMA 1B43A 2WF9A 1N60A 1WYGA 1ZQMA 4ECSA 3M6KA 5DDMA 3H4DA 4MEYA 2W55A 1SL2A 1ZQSA 2ZTEA 5KAFU 2J6SA 3Q8RB 4O3QA 2K8CB 4DLGA 1ZQXA 3WKAA 5KTQA 2OEHA 3KTQA 2C2DA 3SV4A 1DOQA 1X40A 4PHPA 1D9DA 1ZD2P 4ECRA 1OXJA 4J9QA 1O03A 1IM4A 4DFKA 5ALVA 3QU5A 2AGQA 2ZIWB 5AHXA 3ISCA 1ZQGA 2HHTA 4BWMA 4FZNA 4Z6FA 3GV7B 2KMDA 1NJXA 3MR5A 3BQ2A 3K1RB 2PI5A 4OD0A 4QW9A 5CJ7A 4NY8A 2WFAA 2FLPA 4ECXA 4O3MA 2EQYA 8ICCA 2CXYA 4MFFA 3K4GA 3RRGA 3B9JA 5DBBA 3I28A 4ICAA 3ZDAA 2E8NA 4C4TA 1MSWD 4F2RA 2R8JA 3H8SA 1SXDA 1UHUA 1K5OA 3D2QA 2D6FC 1NJWA 1U4BA 3WKCA 1CEZA 7ICEA 3NVWA 4OCZA 4F71A 3B0YA 3RB0A 3BS7A 2LKYA 4IRCA 4F4KA 1ZD4A 2YN4A 4EBEA 4X5VA 3ZDDA 4B9MA 3UPQA 4K4GA 2IOHA 2DF4B 4C8MA 4C4SA 5AKKA 1KFTA 9ICRA 3KD3A 4YMNA 2W7PA 3FC4A 2MUTB 4OJ5A 4UB2A 2F2AB 4MHVA 3HWTA 4F4WA 4O3SA 4QNLA 2K4HA 3NVYA 2JMGA 3ZD8A 1XO0A 1KN5A 2ZIWA 1U49A 2DFLA 1TKDA 3IP4B 5KFBA 2XY7A 5CWRA 2EZYA 2M9NA 2K4PA 3KKAA 4JUZA 3DEEA 5DG9A 3RJKA 4NLBA 3F2DA 3T5HA 1GO3F 4F5QA 3TFRA 3MGIA 5KFLA 1N48A 2QB0B 3E0FA 1UA1A 3EW9A 3MGHA 3ISBA 2EDUA 2AQ4A 5T14A 2IOFK 2JEGA 3C1YA 5AK6A 3HKZF 2HHQA 3V6KA 2LYAA 1ZQWA 4GXIA 1L3VA 2ZXIA 4J9RA 2BCSA 1TAQA 4QZHA 2Y9UA 1L8LA 5KFNA 2RLTA 5AIBA 1KBUA 3EZ5A 1WCLA 3M1YA 1SWWA 4F2SA 1F5SA 3LVVA 1D8BA 4Q45A 3M9MB 3QZ8A 5L9XA 1KQQA 2Z7JA 3CNHA 3AMZA 4J9OA 1ZQPA 5ALGA 2XY5A 3PY8A 3IG5A 1RXWA 2AJQA 3MFHA 2F77X 3GV5B 2MUTA 3BS5B 2WAQC 1ZQBA 4YR2A 4RQ8A 3TI0A 3MGVA 3ZDEA 3BQ1A 2MAXA 2ZJAA 3ED5A 1L8OA 4KN4A 5AM0A 4UAVA 8ICQA 4UASA 3ALRA 4DSJA 9ICSA 1SKWA 3T5JA 1SL0A 4TUPA 4EEKA 9ICWA 3QUBA 2BPFA 2CPRA 3PSPA 4DS5A 1NK4A 2M0NA 3N28A 4EZ9A 3KZIU 1ZYQA 3QXGA 1ED1A 4ED2A 2L5YA 1IIPA 1URJA 4DF4A 2G09A 1ZQNA 1DXSA 3PW0A 1ZQTA 3IN5A 3AM9A 4C80A 3RRHA 4JWMA 1RQNA 2FJ6A 1T7PA 3JPPA 1Z3EB 5KFVA 4RQ6A 4EZ6A 1B0XA 5J0TA 3KHRA 2UVWA 4M0AA 4MFCA 1ZQUA 5KFJA 1SKSA 4RNNA 1TK5A 1X9SA 1QQ7A 4RQ4A 5F3XB 4KN7A 4PPXA 1SL1A 1L7NA 5J0WA 1ZJMA 4QZAA 2HMXA 4GFJA 3BS5A 4O3OA 5JU5A 4BGDA 4QWEA 1ZQCA 4MF2A 4C8NA 4EBDA 1UQVA 2J6TA 2EAPA 2HHSA 5AM3A 4TQSA 2HHWA 2BGWA 9ICKA 2D8CA 1Z19A 3TAPA 5KFPA 1JXLA 2QLTA 4XRHA 3KHLA 2VKQA 5HR7A 5J0RA 4Z6DA 3S6JA 3Q8QB 1XWLA 3MBYA 2XVTA 3C29A 3C1ZA 1FEZA 4RQ7A 3L5KA 4XUSA 3TADC 4I2IA 4DL3A 5CA7A 2MA1A 3RJEA 2I5HA 3GIKA 2D3DA 3N4MB 5DDYA 4M9HA 5BPCA 4P4PA 5TISU 2HOQA 5JUMA 1RYSA 3DV9A 4FBUA 3M9NB 4DQQA 2P66A 3RFAA 5DKWA 2E8MA 5KAIU 4DQPA 4P4OA 4RQ0A 2BR0A 4DOAA 2W03A 3NRWA 1XSLA 3OHBA 4I2JA 3Q8PB 1RG6A 3H8JA 3EWAA 4I2CA 1ZETA 1UPHA 3PW7A 5EE9A 9ICVA 4J9KA 1X42A 2IHMA 1LV5A 2BCUA 2PMZF 1T3QA 2LHTA 1ZQDA 3PO4A 4ELVA 2F8LA 5D46A 5EWFA 4F8RA 3QU4A 2EZXA 2JZBA 2E1EA 4FBTA 2OHFA 7ICNA 2HBMA 3QEBZ 4ED0A 3QE9Y 1A0PA 4QZDA 1DK3A 4DFDA 2A3VA 3GQCA 1BVSA 3PW5A 4ECWA 1MA7A 1RYRA 4JV0A 3WK9A 4AYBC 5AM1A 1JUDA 3IHQB 1N5XA 1BPZA 1J97A 2ZIXB 2MSNA 5J2DA 1U45A 4NM1A
chains in the Genus database with same CATH topology
1PK3A 1WWUA 2EAMA 3BS5B 2YTUA 2QB0A 1PK1B 5J8YA 2KG5A 2QARA 1V38A 2GLEA 2KSOB 3KKAC 1F0MA 1V85A 1LKYB 2ES6A 1Z1VA 2LMRA 3TADC 3SEIA 4MHVA 2EANA 2D3DA 3IDWA 2FE9A 1X40A 1SV4A 3SENA 2ESEA 3TACB 2K4PA 4NL9C 3KKAA 1WWVA 5JTIA 1OXJA 3HILA 3H8MA 1X66A 2E8MA 3TADA 1SXEA 1COKA 2JV3A 5KNIA 2QB0B 2F8KA 4IS7A 2L5YA 2QARB 2E8OA 2KMDA 5L1MA 1DXSA 4NL9A 1RG6A 2KIVA 1JI7A 3K1RB 2B6GA 1PK1A 1B0XA 2DKZA 1KW4A 2Y9UA 4RQMA 2QB1A 2EAOA 1LKYA 2KE7A 2E8NA 5JRTA 5F3XB 2F44A 1B4FA 1SV0A 4NJ8A 1SXDA 2E8PA 2LPEA 2QKQA 2K60A 5J8YC 3BS5A 1UCVA 5JU5A 2Y9TA 1SV0C 1UQVA 2EAPA 3BQ7A 1OW5A 4PZNA 3BS7A 1X9XA 2D8CA 2DKXA 2F3NA 2KSOA 4PZOA 2DL0A 1SGGA 4RQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK3 A;  1WWU A;  2EAM A;  3BS5 B;  2YTU A;  2QB0 A;  1PK1 B;  5J8Y A;  2KG5 A;  2QAR A;  1V38 A;  2GLE A;  2KSO B;  3KKA C;  1F0M A;  1V85 A;  1LKY B;  2ES6 A;  1Z1V A;  2LMR A;  3TAD C;  3SEI A;  4MHV A;  2EAN A;  2D3D A;  3IDW A;  2FE9 A;  1X40 A;  1SV4 A;  3SEN A;  2ESE A;  3TAC B;  2K4P A;  4NL9 C;  3KKA A;  1WWV A;  5JTI A;  1OXJ A;  3HIL A;  3H8M A;  1X66 A;  2E8M A;  3TAD A;  1SXE A;  1COK A;  2JV3 A;  5KNI A;  2QB0 B;  2F8K A;  4IS7 A;  2L5Y A;  2QAR B;  2E8O A;  2KMD A;  5L1M A;  1DXS A;  4NL9 A;  1RG6 A;  2KIV A;  1JI7 A;  3K1R B;  2B6G A;  1PK1 A;  1B0X A;  2DKZ A;  1KW4 A;  2Y9U A;  4RQM A;  2QB1 A;  2EAO A;  1LKY A;  2KE7 A;  2E8N A;  5JRT A;  5F3X B;  2F44 A;  1B4F A;  1SV0 A;  4NJ8 A;  1SXD A;  2E8P A;  2LPE A;  2QKQ A;  2K60 A;  5J8Y C;  3BS5 A;  1UCV A;  5JU5 A;  2Y9T A;  1SV0 C;  1UQV A;  2EAP A;  3BQ7 A;  1OW5 A;  4PZN A;  3BS7 A;  1X9X A;  2D8C A;  2DKX A;  2F3N A;  2KSO A;  4PZO A;  2DL0 A;  1SGG A;  4RQN A; 
#chains in the Genus database with same CATH topology
 4RT2 A;  3SI8 A;  4M9L A;  9ICH A;  3MC1 A;  4ECQ A;  2WB1 C;  5KG2 A;  1WUD A;  3WKE A;  4ED7 A;  1S9F A;  1JX4 A;  5TZV A;  2W9M A;  2NRZ A;  2RDI A;  1Q8K A;  3PSF A;  3C2L A;  1VJ5 A;  4PHA A;  1Z1V A;  4FZM A;  3PX6 A;  3HP6 A;  2HW3 A;  3EPG A;  3RTV A;  1BPY A;  1D8Y A;  4ECT A;  2KZ3 A;  2KFN A;  4IR9 A;  4KLJ A;  7ICL A;  3SAG A;  4DL2 A;  5KG3 A;  3LWL A;  1SV4 A;  1JIH A;  4QZF A;  5AM5 A;  4USA A;  2ZIV B;  2XGQ A;  4DFP A;  4DF8 A;  8ICU A;  4DL5 A;  9ICQ A;  4UAW A;  5CEH A;  2PFO A;  3PR5 B;  2BQR A;  1RQL A;  3KOO A;  2W8L A;  3JPQ A;  8ICY A;  5IIJ A;  2KIW A;  4NL9 A;  3FM9 A;  2FMP A;  3RJF A;  1ZQL A;  5J2G A;  2Y1J A;  5CP2 A;  4EEL A;  3CP8 A;  1DK2 A;  1VDV A;  1WG8 A;  5KT3 A;  1QSY A;  1XNS A;  4UB5 A;  2G5I B;  1Q3U A;  3D2N A;  4RQM A;  3GII A;  2Y0S C;  4DL4 A;  5KL8 B;  4G3I A;  1L7M A;  2VJ5 A;  2ODG A;  3PO5 A;  2NO5 A;  3EYZ A;  2ZIX A;  1QQ5 A;  2ZIU A;  5KG5 A;  3MR2 A;  2HOF A;  2FDR A;  4KMO B;  5AKY A;  3SAH A;  7ICV A;  3C5G A;  4Z6E A;  2ISP A;  3QZ7 A;  2GWS A;  3FAH A;  3H0L B;  5ALX A;  2BCV A;  2ZUC A;  4NLG A;  4Y2T A;  3AU6 A;  3ICX A;  1C20 A;  3IRU A;  3BQ0 A;  1L3T A;  2HDO A;  8ICI A;  3RAX A;  5KFA A;  1J2M A;  4UB1 A;  4OJO A;  2ASJ A;  4Y2U A;  4DO9 A;  1JAL A;  1NZB A;  7ICJ A;  7ICI A;  3PX0 A;  2ZIV A;  2G06 A;  1U9L A;  2HVH A;  2K4I A;  1D8L A;  3T79 A;  4KLL A;  4GC7 A;  4I2D A;  5J2E A;  2ALZ A;  3H0R B;  1HUZ A;  4KTQ A;  4EEN A;  1Z4N A;  4BDP A;  8ICX A;  2YX8 A;  3HIL A;  1TVA A;  1YZ7 A;  4YCX A;  5AKZ A;  2JEI A;  4BXO A;  5AI9 A;  1ZQE A;  2FI1 A;  2JGA A;  4QIW F;  2NRW A;  2NYV A;  1S0V A;  4M9J A;  3L3F X;  4J9P A;  1MN8 A;  2KP7 A;  2DKZ A;  5KFZ A;  2XC9 A;  5G5H A;  5HHH A;  4DQI A;  3TAR A;  4B9T A;  2A1A A;  3FDS A;  3N7P D;  3RJJ A;  4KLI A;  4IL6 U;  1SB3 C;  5AK4 A;  4RPX A;  7ICO A;  9ICF A;  5ALQ A;  5B66 U;  9ICX A;  1ZQO A;  8ICN A;  3C2K A;  3C2M A;  3H7I A;  4TQR A;  5J0Y A;  2YB1 A;  5DQH A;  1KDH A;  4R63 A;  4ELU A;  4PZO A;  5AKL A;  3RBE A;  1QH9 A;  5DBA A;  2WF6 A;  4JK1 A;  3C21 A;  2FPM A;  2YTU A;  3SAF A;  2CN1 A;  2KG5 A;  2HBL A;  1XSN A;  5KFU A;  4KLF A;  4C4R A;  5J0P A;  2GLE A;  3RF9 A;  1N2X A;  1F0M A;  4KLO A;  1U47 A;  1K1S A;  2W43 A;  5CR0 A;  4O5E A;  1TE2 A;  1RDF A;  2LI6 A;  9ICG A;  4ED1 A;  2E5S A;  4I2G A;  4RUC A;  1ZXI A;  1RM6 C;  1PVR A;  1NJZ A;  3JPO A;  5FP0 A;  4RQ1 A;  1SXE A;  5III A;  4O9M A;  4UQG A;  4P0Q A;  3JPT A;  4EX6 A;  4YMO A;  3RR8 A;  4B9L A;  3IM1 A;  1ZQA A;  5B5E U;  1LB2 B;  3M6Z A;  3J81 j;  4UAU A;  5HR6 A;  1KFD A;  2H3Q A;  5AKH A;  4F4Z A;  2KIV A;  1HJP A;  2CRX A;  3MDC A;  2AGO A;  9ICJ A;  4PGQ A;  2KZM A;  2W9B A;  2YB4 A;  2KIC A;  3BZC A;  2N1R A;  2YMP A;  4RNM A;  1Q3V A;  2DWQ A;  3TKA A;  5DBC A;  2W3R A;  5AKG A;  2KV2 A;  2GO7 A;  3E58 A;  2KE7 A;  2H3Z A;  4OJL A;  5JRT A;  2ZTC A;  5KT5 A;  3VCB A;  5KFO A;  3WK7 A;  1ECW A;  5ALK A;  3AU2 A;  2Q0Z X;  4OJP A;  2KHQ A;  2IBK A;  1V9P A;  3BQ7 A;  3TQ1 A;  5EOZ A;  5J2K A;  2VA8 A;  4F5O A;  3N97 B;  2V4R A;  9ICO A;  5KFH A;  1UT8 A;  4YVZ A;  3JPN A;  3PZP A;  3NGD A;  9ICT A;  2QAR A;  8ICT A;  4ED6 A;  2XID A;  3NVZ A;  4ECZ A;  2I1Q A;  2KSO B;  4I2B A;  2H3F A;  7ICK A;  2OH2 A;  4DQS A;  5ALL A;  3V6H A;  4F5N A;  4PH5 A;  4KLG A;  4UBC A;  3IDW A;  2XGP A;  1JRP A;  2G08 A;  4DLE A;  4Y2V A;  3PML A;  4CRX A;  5DB7 A;  5DG8 A;  7ICQ A;  5KFX A;  1COK A;  3UQ0 A;  4LZG A;  1QSS A;  2ZG6 A;  1T94 A;  3ONN A;  4RT3 A;  2HHV A;  2JH1 A;  2BDU A;  3T5L A;  8ICA A;  2AXT U;  1S76 D;  3RB4 A;  1S0M A;  3NUQ A;  3LWM A;  8ICW A;  3F2C A;  5ALT A;  4KIT B;  2AU0 A;  4IQU A;  5KT7 A;  3R9K A;  1NKE A;  4CF3 A;  4KLQ A;  2XI9 A;  4P4M A;  4QWC A;  5E79 U;  2WAQ F;  1J2N A;  2V9W A;  1P7D A;  1SZP A;  2HBK A;  3G6Y A;  5J2B A;  4YP3 A;  4HAI A;  1XS9 D;  3A0B U;  4M6W A;  2UVU A;  4Y2Q A;  5DB9 A;  1OUQ A;  4KLU A;  1FFU A;  3Q8L A;  2NO4 A;  4F72 A;  9ICM A;  4NLN A;  1JRO A;  2R8H A;  1BPX A;  4I2F A;  4I29 A;  2NV3 A;  4XQ8 A;  5KFW A;  2KSO A;  5C0Y A;  5D4B A;  2KOB A;  3KFU F;  3JPS A;  4FS1 A;  1PK3 A;  2KJ8 A;  4IRK A;  4FS2 A;  1N63 A;  1TAM A;  5J0Q A;  1N61 A;  3RJI A;  3QYP A;  4J03 A;  1Q46 A;  7ICP A;  4TUQ A;  2P6R A;  4K4H A;  3KHG A;  5L1L A;  4K4I A;  5KT4 A;  1PVP A;  5AI5 A;  2JZB B;  1L3U A;  3SEI A;  1BPE A;  4DQR A;  4C0Z A;  2W3S A;  1BPD A;  2A1J B;  3TAN A;  4NLZ A;  5C5J A;  5EE3 A;  5AM2 A;  1NK9 A;  4Y2X A;  3U26 A;  4I2H A;  4F3O A;  2OYY A;  5ALZ A;  8ICS A;  3THV A;  4QZB A;  3H8M A;  1JMS A;  3G6V A;  1X6I A;  3OPX A;  2GH1 A;  2F8K A;  2BDP A;  5ALP A;  1BGX T;  4UW9 A;  4P0P A;  5J0U A;  1Y88 A;  4GXK A;  4Z6C A;  2KJ9 A;  2OCE A;  4US8 A;  4O3P A;  2PI4 A;  3UXP A;  3HX0 A;  4J9L A;  2AH5 A;  4F93 B;  4CF4 A;  4DCC A;  3KBB A;  3UMG A;  5A0L A;  2F76 X;  4NXZ A;  1N5W A;  4YD2 A;  5L1I A;  8ICO A;  4Q44 A;  1XSP A;  1KEJ A;  5KG4 A;  3OJU A;  5K4L A;  4NJ8 A;  4FE3 A;  8ICF A;  5J8Y C;  2O6K A;  1ZQZ A;  2RHF A;  4CGZ A;  4QZ8 A;  3PR4 A;  1X9W A;  3H4B A;  4M9N A;  2G0A A;  3AN1 A;  1VLB A;  2ZXH A;  4LVS A;  3ZD9 A;  4TUR A;  5HP4 A;  1K1Q A;  4KX3 A;  4I2E A;  3I76 A;  3LVW A;  5KFG A;  2KEY A;  4UBB A;  1ZQI A;  4YR3 A;  1C7Y A;  4XA5 A;  2LM1 A;  1JXE A;  4C8O A;  4ACO A;  1SZH A;  2KD1 A;  2NRT A;  2A1J A;  4B9V A;  3F5A A;  3IV6 A;  5DLG A;  4PHD A;  2YMQ A;  3WU2 U;  9ICL A;  4Q43 A;  3D2S A;  5AIA A;  8ICP A;  2AHO B;  2R18 A;  4DSF A;  2DGZ A;  3N7R C;  3PNC A;  4TUS A;  3RAQ A;  3TFS A;  4DS4 A;  4CCH A;  1TFR A;  5KFT A;  8ICK A;  4ED3 A;  4NM2 A;  2ZIU B;  3PSI A;  3JPR A;  2FLN A;  2KTQ A;  4RUA A;  2FE9 A;  1QSL A;  4AP9 A;  5KG1 A;  4BJQ A;  1WWV A;  3TAD A;  4QZC A;  5J0X A;  5KNI A;  4KLT A;  2JH7 A;  5EE1 A;  2KFZ A;  3HT3 A;  5AK3 A;  1Z1B A;  4R66 A;  5KFC A;  3NRZ A;  5F9N A;  1JI7 A;  4PGY A;  3V6J A;  4AYB F;  1EXN A;  5EWE A;  2H3I A;  4QW8 A;  4O3N A;  3F53 A;  9ICA A;  5ALE A;  1L5U A;  4IR1 A;  2WB1 F;  4IQW A;  4GLX A;  1PVQ A;  1NK5 A;  1BNP A;  5HML A;  3T5K A;  4IQT A;  1ZJN A;  5GTI U;  4CE6 A;  4LZD A;  4KLS A;  5AI0 A;  4BXO B;  5ALF A;  1ZQV A;  1KRP A;  2HHX A;  5KT6 A;  1HUO A;  3QU2 A;  2HHU A;  5KFM A;  1MQ2 A;  1X9X A;  9ICC A;  5KFS A;  4RQ5 A;  4RQN A;  3SMV A;  2YQE A;  5KFD A;  4I27 A;  1S8O A;  1IG6 A;  3WKD A;  1FFV A;  3T3F A;  4C8K A;  3F2B A;  8ICH A;  2BQ3 A;  2JXJ A;  1NKC A;  1FO4 A;  4J9M A;  3PST A;  3WK6 A;  2VJ4 A;  1A76 A;  4OO1 J;  4FZL A;  3RJG A;  2K8B B;  4QZ9 A;  4MEX A;  5L1K A;  3TAC B;  7ICT A;  1PZN A;  3CW2 C;  2KNJ A;  1RYU A;  4UAR A;  2H5X A;  3BQT A;  3E2E A;  1X66 A;  4J9N A;  2Y0S F;  2BKE A;  2JV3 A;  4DSK A;  4YQW A;  1ZQJ A;  4EYI B;  3MFI A;  1T3N A;  2OXO A;  3H0M B;  4F91 B;  1F44 A;  1PK1 A;  4KLH A;  4CF5 A;  3F5E A;  4Y2J A;  4QZI A;  2DUY A;  3GDX A;  2BCR A;  3SZ2 A;  1CUK A;  3NTU A;  4UB3 A;  3V7J A;  7ICF A;  1NOM A;  2QB1 A;  3OJS A;  7ICM A;  1LKY A;  3RBD A;  3QNM A;  2NRX A;  3LK9 A;  4UB4 A;  4P2H A;  2FPL A;  2QKQ A;  1UCV A;  2R8K A;  4P0Q B;  1SV0 C;  2KN7 A;  5KFQ A;  4HYK A;  1AQ6 A;  3QUQ A;  3C5F A;  1L7P A;  5AKJ A;  1O08 A;  1S77 D;  2WTF A;  2J6U A;  4GXJ A;  2DL0 A;  1HEK A;  1QLN A;  2W8K A;  2IOF A;  4PJ0 U;  4RQ2 A;  2W9B B;  5DLF A;  5KG0 A;  2KHV A;  4MF8 A;  2VAN A;  3KKA C;  1V85 A;  5CB1 A;  5ALH A;  5KT2 A;  4KLM A;  2A19 A;  2ES6 A;  2LMR A;  4F50 A;  2BZF A;  3HRD D;  1S5L U;  3LDA A;  2K89 A;  2EAN A;  4Q8E A;  4O5C A;  3LYS A;  4DWI A;  3ISD A;  2IHN A;  4F4X A;  5G5G A;  2WF7 A;  4DFJ A;  5AI4 A;  9ICN A;  4GIB A;  5HHI A;  4KX5 A;  5ALO A;  9ICU A;  1Z00 A;  5GTH U;  3AUO A;  1UA0 A;  4RPZ A;  3KZX A;  2ZJ8 A;  3QUC A;  3ZDB A;  2HI0 A;  2V4Q A;  1A6S A;  1QTM A;  1S0N A;  2QAR B;  1ZQY A;  4ZH4 A;  4CDG A;  2ISO A;  5KFK A;  1DGJ A;  5ALR A;  2F1H A;  2I9G A;  5KL1 B;  2LYB A;  3G6X A;  2W54 A;  4UAT A;  3BZK A;  2VA2 A;  2KK0 A;  5J29 A;  3K75 D;  5ALN A;  4Y2Y A;  4JB3 A;  4IRD A;  4F5P A;  9ICB A;  4R8U B;  5DB6 A;  3HW8 A;  3UXN A;  3O0F A;  4FFD A;  1SV0 A;  2PFQ A;  2LPE A;  1NJY A;  2ZJ5 A;  3AQF A;  3QU7 A;  3A0H U;  2JRZ A;  3GIJ A;  3GV8 B;  9ICP A;  4YFK A;  3HKZ C;  3GZF A;  2ZTD A;  4J9S A;  5ALU A;  3PW4 A;  4JV1 A;  4IC9 A;  1OW5 A;  3Q8K A;  1ZQQ A;  3FYH A;  5F9L A;  1UT5 A;  3M9O B;  2H3V A;  1NNL A;  1YT3 A;  2B0C A;  2DBY A;  5IIO A;  3QX7 A;  5DG7 A;  4YXJ A;  1S10 A;  1XO1 A;  4LJX A;  2BCQ A;  5ALD A;  3PX4 A;  4JV2 A;  4MFA A;  4IQV A;  5L1J A;  5AI6 A;  4KLD A;  4PL1 A;  8ICR A;  2KZZ A;  2P6U A;  2UVV A;  1Z4O A;  4M6W B;  3D6J A;  8ICM A;  2BQU A;  3N7S C;  1X2I A;  9ICE A;  3GFK B;  1ZQK A;  5AI8 A;  5DGB A;  3MAB A;  2XIC A;  2ESE A;  2BPC A;  4EBC A;  4QJF B;  1TV9 A;  3AL0 B;  2FPK A;  3L4P A;  3MDA A;  4NLC A;  4F92 B;  1PUZ A;  3SV3 A;  1CI4 A;  1NK6 A;  4DOC A;  2OWO A;  3BJY A;  4R8U A;  1NK0 A;  1IXR A;  2AGP A;  4ED8 A;  2B6G A;  4ELT A;  1X6J A;  2ZUB A;  4PHE A;  9ICI A;  4E0D A;  3WK4 A;  1NZP A;  4ZOH C;  8ICG A;  8ICL A;  8ICB A;  5ALS A;  7ICR A;  2P35 A;  2EAO A;  2JEJ A;  3UM9 A;  2LYH A;  5ALI A;  2XCP A;  1YZ6 A;  4UB6 U;  3UXO A;  1B4F A;  4YR0 A;  3UMB A;  2MRL A;  4CNQ A;  4WJ3 B;  2BHN A;  2FMQ A;  3OHA A;  1N62 A;  4FO6 A;  3KHH A;  2I6X A;  5HMM A;  4DSE A;  3ZDC A;  4P0P B;  2XCA A;  1KL9 A;  1RXV A;  2C2E A;  3PVX A;  2F3N A;  2XO7 A;  1NKB A;  2ATL A;  1FIQ A;  3OSN A;  1XU4 A;  2G07 A;  4PGX A;  4B6J A;  4QWA A;  1WWU A;  2VA3 A;  2QB0 A;  2JHD A;  2W7O A;  4EEY A;  2LBO A;  4F4Y A;  3RH4 A;  3SQI A;  8ICV A;  1NK8 A;  2W9C B;  3UMC A;  1SWV A;  1JN3 A;  4C8L A;  3OGU A;  1QCK A;  3BDP A;  1MC8 A;  4UAY A;  2RP5 A;  3RB6 A;  1KLN A;  4JWN A;  2IA6 A;  2Q4T A;  7ICU A;  5DB8 A;  1TK0 A;  4R64 A;  2LM4 A;  4GC6 A;  2Y1I A;  1B22 A;  8ICZ A;  2E3T A;  3C23 A;  2KKP A;  8ICJ A;  4JMU A;  3M8R A;  1DGS A;  3CYM A;  2EZZ A;  3NS1 A;  4RNO A;  4UB8 U;  1BPB A;  2WF8 A;  4QWD A;  2KJ5 A;  5JTI A;  2RQ5 A;  4DEZ A;  4DSI A;  2ASL A;  2C22 A;  1D9F A;  2B21 A;  1ZOL A;  4YD1 A;  2R8G A;  3WK8 A;  5J0O A;  1HIW A;  4Y2R A;  3AEV A;  7ICG A;  5KFI A;  2HCF A;  1DRG A;  2E8O A;  1BNO A;  3AQE A;  1X9M A;  2VIX A;  1U48 A;  5AIC A;  4R65 A;  3UQ2 A;  3EPI A;  3ETL A;  4DSL A;  3I1Y A;  2DQN B;  4O5K A;  2BPG A;  1T4G A;  2WHE A;  1KW4 A;  2HVI A;  4M04 A;  4RPY A;  5IIL A;  4B9U A;  4C7Y A;  4RU9 A;  3ETR A;  2F44 A;  3Q8S B;  1ZQ1 C;  2KVS A;  4I28 A;  2K60 A;  3QUT A;  2JEF A;  2Y9T A;  5IIK A;  1S0O A;  1ZRM A;  3SR6 A;  4U7C A;  3MR3 A;  1COO A;  2W9C A;  4U6P A;  4QWB A;  2PFN A;  3HPO A;  2DKX A;  5ALJ A;  1N56 A;  3Q8M A;  2PMZ C;  2EH9 A;  1MQ3 A;  2C2R A;  4G9B A;  7ICH A;  1RPL A;  5DQG A;  4O0I A;  3V7K A;  2F1I A;  1V38 A;  2PFP A;  1KSP A;  2K8A A;  5ALW A;  3GIM A;  1A77 A;  5IIM A;  1LVH A;  3MR6 A;  4YG2 A;  5J2H A;  2C28 A;  5EE0 A;  5KG7 A;  4EYH B;  4NV0 A;  4QZE A;  4F5R A;  2OM6 A;  3H40 A;  3WK5 A;  2RDJ A;  1L3S A;  4Y2P A;  4ECY A;  2WF5 A;  3TAQ A;  4NL9 C;  4US9 A;  3QU9 A;  1KTQ A;  3M7D A;  1ZD5 A;  3K1Z A;  4BX9 C;  2XY6 A;  1RZT A;  3PW2 A;  1V97 A;  4ECU A;  4IS7 A;  4YN4 A;  4Q8F A;  1TAU A;  1L7O A;  5KFY A;  1ARO P;  5J2I A;  3ZI4 A;  4YMM A;  1CRX A;  2NRV A;  4UAZ A;  1M6Y A;  4KMU A;  2KVC A;  2JR5 A;  5AKX A;  1L6N A;  2PXI A;  1QQ6 A;  2FMS A;  1ZQH A;  4NWI A;  1TK8 A;  5KG6 A;  1WCN A;  5H2F U;  3CRX A;  3RB3 A;  1SKR A;  4BUG A;  5AM4 A;  2E8P A;  2YMM A;  4M47 A;  5J0S A;  2W9A A;  3EUB 2;  3IG8 A;  4M9G A;  4DOB A;  2GOL A;  1T8E A;  3GIL A;  2HOI A;  1ZQF A;  4DL6 A;  2K4E A;  2HBJ A;  5ALM A;  4OJ6 A;  4PZN A;  1H38 A;  4KLE A;  5AK5 A;  1KFS A;  1SGG A;  5KFE A;  5J2J A;  7ICS A;  3NVV A;  2E1F A;  1PK1 B;  5J8Y A;  5BOM A;  3QEA Z;  2KKV A;  4PL2 A;  2RRD A;  3V72 A;  5AKE A;  4YXM A;  5CHG A;  1IV8 A;  3OSP A;  1ZQR A;  3RH5 A;  5ALY A;  1LKY B;  3RJH A;  1XC9 A;  4NLK A;  8ICE A;  3PMN A;  1S97 A;  1NI3 A;  4RQ3 A;  3PV8 A;  2YY6 A;  3SEN A;  5HNK A;  5IIN A;  2UVR A;  1NK7 A;  2DPI A;  2W11 A;  3H8W A;  3M8S A;  4EX7 A;  2W04 A;  2PKE A;  5EWG A;  3RH6 A;  3OTQ A;  5DQI A;  3RR7 A;  4M2Y A;  3V7L A;  5L1M A;  2ASD A;  3ORY A;  4O3R A;  2HSZ A;  5KFR A;  3SYZ A;  5J2A A;  3VC8 A;  4DL7 A;  3SD7 A;  4C7Z A;  2AQ0 A;  2DPJ A;  4Y2S A;  4A8E A;  4BWJ A;  2YML A;  2MU2 A;  4QZG A;  1KKX A;  4ECV A;  3NAS A;  2ZUD A;  5CRX A;  5J2F A;  2FLL A;  5D49 A;  5KFF A;  1Z00 B;  5J2C A;  3DDH A;  4B9N A;  2F1J A;  4QIW C;  3B0X A;  4I2A A;  5AKI A;  2IMW P;  1ZD3 A;  4DFM A;  4B9S A;  1ZRN A;  3HJE A;  3GU3 A;  3WKB A;  5BOL A;  3C28 A;  1SIJ A;  5DGA A;  2G5H B;  4RZR A;  2R8I A;  2EAM A;  1B43 A;  2WF9 A;  1N60 A;  1WYG A;  1ZQM A;  4ECS A;  3M6K A;  5DDM A;  3H4D A;  4MEY A;  2W55 A;  1SL2 A;  1ZQS A;  2ZTE A;  5KAF U;  2J6S A;  3Q8R B;  4O3Q A;  2K8C B;  4DLG A;  1ZQX A;  3WKA A;  5KTQ A;  2OEH A;  3KTQ A;  2C2D A;  3SV4 A;  1DOQ A;  1X40 A;  4PHP A;  1D9D A;  1ZD2 P;  4ECR A;  1OXJ A;  4J9Q A;  1O03 A;  1IM4 A;  4DFK A;  5ALV A;  3QU5 A;  2AGQ A;  2ZIW B;  5AHX A;  3ISC A;  1ZQG A;  2HHT A;  4BWM A;  4FZN A;  4Z6F A;  3GV7 B;  2KMD A;  1NJX A;  3MR5 A;  3BQ2 A;  3K1R B;  2PI5 A;  4OD0 A;  4QW9 A;  5CJ7 A;  4NY8 A;  2WFA A;  2FLP A;  4ECX A;  4O3M A;  2EQY A;  8ICC A;  2CXY A;  4MFF A;  3K4G A;  3RRG A;  3B9J A;  5DBB A;  3I28 A;  4ICA A;  3ZDA A;  2E8N A;  4C4T A;  1MSW D;  4F2R A;  2R8J A;  3H8S A;  1SXD A;  1UHU A;  1K5O A;  3D2Q A;  2D6F C;  1NJW A;  1U4B A;  3WKC A;  1CEZ A;  7ICE A;  3NVW A;  4OCZ A;  4F71 A;  3B0Y A;  3RB0 A;  3BS7 A;  2LKY A;  4IRC A;  4F4K A;  1ZD4 A;  2YN4 A;  4EBE A;  4X5V A;  3ZDD A;  4B9M A;  3UPQ A;  4K4G A;  2IOH A;  2DF4 B;  4C8M A;  4C4S A;  5AKK A;  1KFT A;  9ICR A;  3KD3 A;  4YMN A;  2W7P A;  3FC4 A;  2MUT B;  4OJ5 A;  4UB2 A;  2F2A B;  4MHV A;  3HWT A;  4F4W A;  4O3S A;  4QNL A;  2K4H A;  3NVY A;  2JMG A;  3ZD8 A;  1XO0 A;  1KN5 A;  2ZIW A;  1U49 A;  2DFL A;  1TKD A;  3IP4 B;  5KFB A;  2XY7 A;  5CWR A;  2EZY A;  2M9N A;  2K4P A;  3KKA A;  4JUZ A;  3DEE A;  5DG9 A;  3RJK A;  4NLB A;  3F2D A;  3T5H A;  1GO3 F;  4F5Q A;  3TFR A;  3MGI A;  5KFL A;  1N48 A;  2QB0 B;  3E0F A;  1UA1 A;  3EW9 A;  3MGH A;  3ISB A;  2EDU A;  2AQ4 A;  5T14 A;  2IOF K;  2JEG A;  3C1Y A;  5AK6 A;  3HKZ F;  2HHQ A;  3V6K A;  2LYA A;  1ZQW A;  4GXI A;  1L3V A;  2ZXI A;  4J9R A;  2BCS A;  1TAQ A;  4QZH A;  2Y9U A;  1L8L A;  5KFN A;  2RLT A;  5AIB A;  1KBU A;  3EZ5 A;  1WCL A;  3M1Y A;  1SWW A;  4F2S A;  1F5S A;  3LVV A;  1D8B A;  4Q45 A;  3M9M B;  3QZ8 A;  5L9X A;  1KQQ A;  2Z7J A;  3CNH A;  3AMZ A;  4J9O A;  1ZQP A;  5ALG A;  2XY5 A;  3PY8 A;  3IG5 A;  1RXW A;  2AJQ A;  3MFH A;  2F77 X;  3GV5 B;  2MUT A;  3BS5 B;  2WAQ C;  1ZQB A;  4YR2 A;  4RQ8 A;  3TI0 A;  3MGV A;  3ZDE A;  3BQ1 A;  2MAX A;  2ZJA A;  3ED5 A;  1L8O A;  4KN4 A;  5AM0 A;  4UAV A;  8ICQ A;  4UAS A;  3ALR A;  4DSJ A;  9ICS A;  1SKW A;  3T5J A;  1SL0 A;  4TUP A;  4EEK A;  9ICW A;  3QUB A;  2BPF A;  2CPR A;  3PSP A;  4DS5 A;  1NK4 A;  2M0N A;  3N28 A;  4EZ9 A;  3KZI U;  1ZYQ A;  3QXG A;  1ED1 A;  4ED2 A;  2L5Y A;  1IIP A;  1URJ A;  4DF4 A;  2G09 A;  1ZQN A;  1DXS A;  3PW0 A;  1ZQT A;  3IN5 A;  3AM9 A;  4C80 A;  3RRH A;  4JWM A;  1RQN A;  2FJ6 A;  1T7P A;  3JPP A;  1Z3E B;  5KFV A;  4RQ6 A;  4EZ6 A;  1B0X A;  5J0T A;  3KHR A;  2UVW A;  4M0A A;  4MFC A;  1ZQU A;  5KFJ A;  1SKS A;  4RNN A;  1TK5 A;  1X9S A;  1QQ7 A;  4RQ4 A;  5F3X B;  4KN7 A;  4PPX A;  1SL1 A;  1L7N A;  5J0W A;  1ZJM A;  4QZA A;  2HMX A;  4GFJ A;  3BS5 A;  4O3O A;  5JU5 A;  4BGD A;  4QWE A;  1ZQC A;  4MF2 A;  4C8N A;  4EBD A;  1UQV A;  2J6T A;  2EAP A;  2HHS A;  5AM3 A;  4TQS A;  2HHW A;  2BGW A;  9ICK A;  2D8C A;  1Z19 A;  3TAP A;  5KFP A;  1JXL A;  2QLT A;  4XRH A;  3KHL A;  2VKQ A;  5HR7 A;  5J0R A;  4Z6D A;  3S6J A;  3Q8Q B;  1XWL A;  3MBY A;  2XVT A;  3C29 A;  3C1Z A;  1FEZ A;  4RQ7 A;  3L5K A;  4XUS A;  3TAD C;  4I2I A;  4DL3 A;  5CA7 A;  2MA1 A;  3RJE A;  2I5H A;  3GIK A;  2D3D A;  3N4M B;  5DDY A;  4M9H A;  5BPC A;  4P4P A;  5TIS U;  2HOQ A;  5JUM A;  1RYS A;  3DV9 A;  4FBU A;  3M9N B;  4DQQ A;  2P66 A;  3RFA A;  5DKW A;  2E8M A;  5KAI U;  4DQP A;  4P4O A;  4RQ0 A;  2BR0 A;  4DOA A;  2W03 A;  3NRW A;  1XSL A;  3OHB A;  4I2J A;  3Q8P B;  1RG6 A;  3H8J A;  3EWA A;  4I2C A;  1ZET A;  1UPH A;  3PW7 A;  5EE9 A;  9ICV A;  4J9K A;  1X42 A;  2IHM A;  1LV5 A;  2BCU A;  2PMZ F;  1T3Q A;  2LHT A;  1ZQD A;  3PO4 A;  4ELV A;  2F8L A;  5D46 A;  5EWF A;  4F8R A;  3QU4 A;  2EZX A;  2JZB A;  2E1E A;  4FBT A;  2OHF A;  7ICN A;  2HBM A;  3QEB Z;  4ED0 A;  3QE9 Y;  1A0P A;  4QZD A;  1DK3 A;  4DFD A;  2A3V A;  3GQC A;  1BVS A;  3PW5 A;  4ECW A;  1MA7 A;  1RYR A;  4JV0 A;  3WK9 A;  4AYB C;  5AM1 A;  1JUD A;  3IHQ B;  1N5X A;  1BPZ A;  1J97 A;  2ZIX B;  2MSN A;  5J2D A;  1U45 A;  4NM1 A; 
#chains in the Genus database with same CATH homology
 1PK3 A;  1WWU A;  2EAM A;  3BS5 B;  2YTU A;  2QB0 A;  1PK1 B;  5J8Y A;  2KG5 A;  2QAR A;  1V38 A;  2GLE A;  2KSO B;  3KKA C;  1F0M A;  1V85 A;  1LKY B;  2ES6 A;  1Z1V A;  2LMR A;  3TAD C;  3SEI A;  4MHV A;  2EAN A;  2D3D A;  3IDW A;  2FE9 A;  1X40 A;  1SV4 A;  3SEN A;  2ESE A;  3TAC B;  2K4P A;  4NL9 C;  3KKA A;  1WWV A;  5JTI A;  1OXJ A;  3HIL A;  3H8M A;  1X66 A;  2E8M A;  3TAD A;  1SXE A;  1COK A;  2JV3 A;  5KNI A;  2QB0 B;  2F8K A;  4IS7 A;  2L5Y A;  2QAR B;  2E8O A;  2KMD A;  5L1M A;  1DXS A;  4NL9 A;  1RG6 A;  2KIV A;  1JI7 A;  3K1R B;  2B6G A;  1PK1 A;  1B0X A;  2DKZ A;  1KW4 A;  2Y9U A;  4RQM A;  2QB1 A;  2EAO A;  1LKY A;  2KE7 A;  2E8N A;  5JRT A;  5F3X B;  2F44 A;  1B4F A;  1SV0 A;  4NJ8 A;  1SXD A;  2E8P A;  2LPE A;  2QKQ A;  2K60 A;  5J8Y C;  3BS5 A;  1UCV A;  5JU5 A;  2Y9T A;  1SV0 C;  1UQV A;  2EAP A;  3BQ7 A;  1OW5 A;  4PZN A;  3BS7 A;  1X9X A;  2D8C A;  2DKX A;  2F3N A;  2KSO A;  4PZO A;  2DL0 A;  1SGG A;  4RQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...