1COKA

Structure of the c-terminal domain of p73
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords PROTEIN (SECOND SPLICE VARIANT P73)
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1cokA00
1F0MA 4PZOA 1X9XA 2LPEA 2QARB 3BQ7A 4IS7A 2KE7A 1DXSA 2F8KA 2E8PA 2L5YA 2JV3A 5KNIA 2D3DA 2KMDA 2GLEA 2F3NA 4RQMA 1SXEA 3TACB 3K1RB 2ES6A 3BS7A 2EAMA 5JRTA 1JI7A 2QB0A 5J8YC 3TADC 1X66A 2DKXA 1B4FA 3H8MA 2ESEA 1PK1B 2Y9TA 1SXDA 3IDWA 2DKZA 2QARA 1B0XA 2Y9UA 1SGGA 4MHVA 2KSOB 2EAOA 1WWVA 1SV4A 1COKA 1UCVA 1Z1VA 3TADA 1V38A 2KSOA 1PK3A 2EANA 3BS5B 2QKQA 3KKAC 2YTUA 1KW4A 2E8MA 2DL0A 1LKYB 2D8CA 2K60A 2E8OA 1V85A 1UQVA 2EAPA 2FE9A 4RQNA 2KIVA 2QB0B 3KKAA 2K4PA 2QB1A 4NJ8A 3SEIA 2F44A 4PZNA 1X40A 1RG6A 2E8NA 3SENA 5JTIA 5L1MA 3HILA 5J8YA 1SV0A 1SV0C 4NL9A 2B6GA 1OXJA 3BS5A 5JU5A 1WWUA 2KG5A 1LKYA 2LMRA 4NL9C 5F3XB 1PK1A 1OW5A
chains in the Genus database with same CATH superfamily
1F0MA 4PZOA 4JV0A 4O5KA 5DBBA 4MFAA 3HRDD 3NVWA 4ED7A 2C2DA 4DF4A 1QSLA 5DG9A 1VLBA 2ZIUB 1NI3A 2W3SA 1L5UA 2G06A 1WCLA 3JPPA 2HHWA 3WKBA 1FO4A 5KFRA 1B4FA 2K8AA 4DEZA 1Z00A 3T5LA 4J9PA 5ALDA 2Y1JA 2P66A 3N7SC 8ICLA 4MHVA 4CF5A 2AHOB 2HW3A 4RPYA 3AL0B 4BUGA 3I1YA 1S9FA 1PK3A 3KHGA 4BDPA 9ICMA 3M9NB 4GC6A 3BS5B 5KFYA 1M6YA 1FFUA 2W9BA 3RF9A 4KMUA 1QH9A 4CE6A 9ICVA 1T3QA 3WU2U 5J0WA 2JEGA 1LB2B 4Y2VA 1TAUA 4Y2JA 2FE9A 4FZMA 2C28A 4B6JA 4UBBA 1D9DA 1WYGA 2KJ9A 2W11A 3IRUA 3ZDBA 2QB1A 4NJ8A 2PI4A 3ISDA 5ALNA 4ECVA 2CN1A 5KFBA 3RB3A 4PPXA 5B66U 7ICNA 4F3OA 3WKDA 1ZQEA 3CRXA 3SD7A 2W9BB 2KICA 4JK1A 1XNSA 7ICIA 1RYRA 2B6GA 4J03A 1B22A 1T3NA 5J2FA 2MUTA 3GFKB 1ZD4A 4F4KA 3SAFA 2E5SA 4UAWA 2E1FA 3A0HU 1GO3F 4FBTA 3H8SA 3Q8KA 3GDXA 2PFPA 1D8BA 1UHUA 4C8LA 1AROP 4KX5A 2D3DA 1Q3UA 2AGOA 4QZAA 2R8IA 1NK6A 1SL0A 1WUDA 3TACB 2I9GA 1ZQZA 4IC9A 2J6TA 1SIJA 4KLIA 1X66A 8ICXA 4FZNA 5CP2A 5AIAA 2OYYA 3M9OB 4MF2A 1NNLA 4YMOA 4F2RA 2AU0A 5J2JA 2H3ZA 3PO4A 2DKZA 2LYHA 4Z6FA 1T94A 4BJQA 5EWGA 4ELTA 1CI4A 1SV4A 2ZG6A 3GV5B 8ICFA 1ZQGA 2YN4A 1BNPA 5AI8A 3TADA 3PW7A 5IILA 5AK4A 3C29A 1S0NA 3WKCA 3PW5A 2R8JA 3AMZA 1S10A 4GXJA 2YX8A 1LVHA 4DL2A 8ICOA 4QZFA 5AKGA 2E8OA 4FE3A 1COOA 4UATA 4IQTA 2KP7A 1A77A 4EBDA 4YVZA 3UMGA 5DLGA 3GIMA 1A76A 5DGBA 2K4PA 2HHVA 4C4RA 2W3RA 5KFJA 3PNCA 1ZYQA 8ICUA 1MC8A 4B9TA 3TARA 9ICRA 5KFZA 1IV8A 1SKRA 3PSFA 1ZQHA 5KT4A 5KT6A 2O6KA 5J29A 3MFIA 2KFZA 3Q8PB 5F3XB 4UQGA 2HHQA 3SAHA 2MA1A 5EWEA 4NLCA 4PL2A 2P6UA 5ALSA 4YD1A 4EYIB 3OSPA 3RB0A 4IR1A 1BGXT 1QQ6A 3SZ2A 3I28A 2F8KA 2E8PA 4J9LA 3Q8MA 4DS5A 2YY6A 4QZ9A 2HCFA 4G3IA 2DF4B 4BWJA 3ICXA 5AKIA 4R65A 2H3QA 2QB0A 4M9NA 4RNOA 4I2FA 3RRHA 1XS9D 4F93B 1N63A 5CB1A 4J9QA 2IHNA 4DFDA 3RR7A 3QU4A 2I1QA 5J2CA 2BPFA 4C7ZA 3QUTA 8ICKA 3H4BA 5GTHU 5HHHA 3GV7B 2ASDA 4C8KA 2WFAA 3O0FA 1KDHA 2VIXA 5FP0A 2W9CB 1ED1A 4RNMA 3OHBA 5KFQA 3GIIA 3BQTA 4EEYA 1KW4A 4Y2XA 1S97A 4M6WA 5KT2A 4ZH4A 4UB8U 4PGXA 4KLGA 2GH1A 1NJXA 3V6KA 1CRXA 3SEIA 4M04A 3E0FA 2ZXHA 3MDAA 2R8KA 2JH7A 1KEJA 1ZQWA 1QCKA 7ICMA 5ALIA 3AU6A 4PHAA 5DBAA 5ALLA 4DL7A 4Q44A 4CNQA 3PW0A 3UMBA 5E79U 5KFDA 2NO4A 2JEJA 2ISOA 5L1IA 3TQ1A 1Q8KA 1XWLA 4P4OA 2DFLA 2N1RA 3WK5A 3D2SA 5KG0A 2G08A 4F4WA 1Z3EB 5KFLA 4I2JA 5KG5A 2DPJA 4QW9A 4PJ0U 2JV3A 7ICPA 4GFJA 2ES6A 2KZMA 3UMCA 4DQSA 4ECWA 1TE2A 2HBKA 4GLXA 3QUQA 1IXRA 4DFKA 1U45A 1JX4A 1NKBA 1QTMA 1KQQA 3BZKA 1NZPA 1NJYA 2JXJA 2KSOA 3JPNA 2V4RA 2JZBA 2HOFA 4YR3A 7ICGA 3NASA 1KL9A 3RFAA 1N60A 3RH5A 2YB1A 3RBEA 4O5EA 1RQLA 1S0MA 5CWRA 2E8MA 4M47A 1LKYB 1UQVA 3RAQA 4OD0A 3QX7A 1Q46A 8ICIA 5CJ7A 2EZZA 2W8LA 3F2CA 2ZJ8A 4J9KA 7ICEA 4DL4A 1N5WA 4FZLA 2PKEA 4NLGA 4C8OA 2RHFA 4LVSA 2BHNA 4YCXA 2AQ4A 2R8HA 4I29A 2GWSA 1ZJNA 1XC9A 8ICHA 3NVZA 3R9KA 5L1KA 4TQSA 4KLLA 3RJIA 4B9UA 3PSIA 3C2MA 2QLTA 2Y0SF 2NRZA 1ZQRA 5IIOA 2Q4TA 8ICWA 4G9BA 4R8UB 5L1JA 2UVUA 2RQ5A 2XIDA 1OW5A 3OGUA 5J0OA 5KAFU 8ICVA 4DSJA 4ICAA 2XICA 5J0YA 5DQIA 3M8SA 4F2SA 9ICQA 3M9MB 3GV8B 5F9LA 1ZQCA 2FDRA 3GIJA 4I2HA 2JEFA 2VANA 2ZJ5A 3F2BA 4ED2A 4LZGA 3IDWA 4OO1J 3OHAA 5ALMA 4X5VA 2KKPA 3T5JA 3GU3A 4B9NA 1B0XA 2XY7A 5AI0A 4EENA 3UQ2A 4I2CA 4R8UA 2W7OA 1KFSA 3FC4A 2K8CB 1XU4A 4NM2A 3QUBA 3N97B 1ZD5A 4YG2A 1UPHA 3WK4A 4USAA 2HBLA 4Q45A 3QE9Y 2PXIA 1C7YA 4DL5A 4GIBA 5AM1A 2HI0A 5ALJA 1Y88A 2OH2A 2YB4A 5AKKA 2KVCA 4ECSA 2UVVA 4DS4A 1ZQVA 1NZBA 2WAQF 3ISBA 2I5HA 2KNJA 5DB7A 3ALRA 4LJXA 5DB8A 1HJPA 5AM5A 3RAXA 4OCZA 4KLOA 2XCPA 2ZIUA 1SV0C 5AKZA 3IN5A 5KG6A 2F8LA 3EYZA 1HUOA 2W7PA 3JPOA 5JU5A 1L6NA 4Y2YA 2KG5A 1ZJMA 2LMRA 3DEEA 4YXJA 4F5RA 1PK1A 4KLDA 2YQEA 3RJGA 2LM4A 2JH1A 1ZQKA 2JZBB 2K8BB 2OXOA 4KTQA 1UT8A 4RQ3A 5KG3A 3WK7A 3UM9A 2GLEA 4M9HA 4AYBC 1JI7A 2A1JA 2FJ6A 4R64A 5CEHA 3WK6A 5KG2A 4DLEA 2NO5A 4NWIA 2WB1F 4DSFA 3ZD9A 2VKQA 2KEYA 2NRTA 2ZIWA 2EAOA 1WWVA 2NRXA 1ZOLA 2VA2A 5AIBA 1WG8A 2LHTA 2KKVA 9ICGA 3E58A 3PW4A 3CNHA 2YMLA 2YMPA 3MDCA 4C8MA 5ALZA 3JPRA 2W43A 2XCAA 3Q8LA 2AGQA 2DBYA 7ICFA 3VC8A 4Y2TA 1HEKA 2ZXIA 2LM1A 2M9NA 2RDIA 2LI6A 2W54A 4UB2A 2ZUDA 3T5HA 2VA8A 2IOHA 3C1YA 1XO0A 3KKAA 3NRZA 5ALOA 2BCSA 4FFDA 4JWMA 4MFCA 1JALA 4PHEA 3J81j 4FS2A 2UVWA 2BCQA 4PGQA 2RRDA 3M6KA 1K5OA 2EQYA 2E1EA 5L1MA 3KHHA 4NXZA 4P0QB 4M9LA 4CGZA 2OHFA 3GQCA 1V97A 4YMNA 1UA0A 1T4GA 4ECQA 5AKXA 4O3RA 1B43A 7ICKA 4QWEA 2XVTA 1UA1A 8ICJA 4PHDA 5JUMA 2XC9A 4IS7A 3LWMA 9ICLA 5BOLA 2IHMA 4F5QA 2L5YA 3LVWA 2P6RA 3PSTA 1RDFA 2W9MA 1EXNA 1O03A 2H3VA 4RQ4A 4BGDA 4EBCA 9ICTA 2I6XA 8ICGA 5AM2A 2ZIVB 1PK1B 4C4TA 4UAZA 5KFGA 3L3FX 5GTIU 1SB3C 4I28A 5ALGA 1S0VA 2DUYA 4F71A 4JB3A 4O3SA 5DB6A 5KFHA 5J0SA 3ETRA 4YN4A 3C5GA 3H40A 2W9CA 4O5CA 2PMZC 1NK9A 1ZQJA 4DFPA 3OTQA 2EANA 3IP4B 2ASLA 4E0DA 3B9JA 5J2AA 4CRXA 2ZTCA 5HP4A 5IIJA 4C0ZA 3C2KA 4UB5A 5KFWA 2JMGA 3MFHA 5ALTA 3V7LA 1D9FA 5KFIA 3AEVA 3FM9A 4ELUA 3IV6A 3CYMA 5DB9A 3JPQA 1ZQ1C 3DV9A 3IHQB 2F2AB 4Q8FA 3NTUA 1RXVA 4O3OA 1OXJA 2MSNA 4KN4A 1QQ7A 1WWUA 1L3TA 1LKYA 4ECZA 5ALUA 4NL9C 1Z4OA 3QZ8A 3JPTA 4F5PA 1JIHA 4ZOHC 5J2DA 1IIPA 2IOFA 4F5OA 2VJ5A 2LPEA 2WF9A 2DWQA 1U9LA 1Z19A 2HBJA 4RPZA 4IRCA 5EWFA 1ZD3A 4RQ8A 3KZIU 4B9LA 4UAYA 1BPYA 5ALKA 3UXOA 5J2IA 1KRPA 1NJZA 1ZQXA 1SXEA 4QWCA 1BPEA 5EE0A 3SYZA 2KJ5A 4DL6A 3T79A 3SV3A 8ICQA 2K4HA 4KX3A 4C8NA 3D2NA 1D8YA 1WCNA 7ICVA 5B5EU 4IQWA 3N7RC 2BQ3A 1MN8A 1SZHA 2F76X 1YT3A 4RQ0A 4DCCA 1KKXA 1PUZA 1XSPA 1TK0A 2AH5A 4DQPA 2Y1IA 4US8A 5AI6A 3FDSA 3E2EA 2OM6A 5KFVA 3V7KA 4MEYA 3MR3A 1ZQAA 4F4XA 2AGPA 2W9AA 5KFKA 5G5GA 5ALFA 2PI5A 3WKEA 3Q8QB 3BQ1A 5ALEA 3RTVA 1J2NA 3D2QA 1KFTA 2A1AA 3SV4A 1BPXA 3F5EA 2F1HA 5DQGA 2C2RA 1T8EA 1ZD2P 5TISU 5CHGA 4BXOB 1BVSA 4U6PA 5DDMA 4CDGA 4PZNA 4BX9C 4YD2A 4Y2UA 5EE9A 9ICSA 2IBKA 2XO7A 4F4YA 3B0YA 3PX4A 4PHPA 5J8YA 2M0NA 1NKCA 2VA3A 1BNOA 2ODGA 3G6YA 4MFFA 3RH6A 1BPDA 4DLGA 3CP8A 4MF8A 2FLPA 2BCUA 1FEZA 2PFOA 2G0AA 3LK9A 5DDYA 1KTQA 2Z7JA 1ZQTA 4O9MA 3JPSA 3ZDEA 2WF7A 1NK8A 2KE7A 5AM4A 1TVAA 1KBUA 4KN7A 4I27A 1X9WA 4I2IA 5KNIA 3NS1A 4QZEA 4B9SA 4QZDA 2FMQA 3MC1A 2EAMA 4TQRA 2A19A 4F92B 5CRXA 5ALYA 3LDAA 2DKXA 3NRWA 2WF5A 3H8MA 5KT3A 3H8WA 2F77X 7ICQA 3TFRA 3RJFA 4XQ8A 2K4EA 5KFTA 8ICEA 4M6WB 1S8OA 1XSLA 5KFCA 3SAGA 2ASJA 2FPKA 4DSLA 8ICCA 2OCEA 1Z1VA 5DKWA 4Q8EA 3PR4A 1XSNA 2KIWA 4RQ7A 3BZCA 4CF3A 3TI0A 3PX6A 3V72A 1HUZA 1MSWD 4UB6U 4YXMA 1Q3VA 4DWIA 7ICHA 1BPBA 1QQ5A 1ZRNA 1ZQYA 8ICTA 4KMOB 2JR5A 5KL1B 1N48A 2KIVA 2QB0B 4K4GA 9ICJA 2V9WA 1P7DA 2BQRA 1TAMA 3QU7A 5J0RA 4XA5A 2PFNA 4HAIA 4Y2SA 2WHEA 1U49A 4US9A 1SV0A 3PY8A 4WJ3B 2FPMA 5AKJA 4I2DA 5HMLA 2AJQA 4U7CA 4B9MA 4PH5A 4DSEA 8ICNA 4DOCA 3QEBZ 2G5IB 3PO5A 5C5JA 3AQFA 3QU9A 5J2HA 2DGZA 4DOAA 1CEZA 4EZ9A 5L9XA 5F9NA 3TAPA 8ICPA 3EPGA 4AYBF 3QU2A 1L3SA 1KFDA 4RUCA 4QJFB 3NVYA 3C5FA 1DK2A 1ZQOA 5AM3A 1L7NA 3U26A 4K4IA 4ECXA 3OJSA 4A8EA 4ECTA 3T3FA 3MGVA 4UB4A 4ECYA 4KLTA 4PL1A 2R18A 5AKLA 2FLNA 2KFNA 2LYAA 5KTQA 4TURA 4C80A 3A0BU 1J2MA 3UPQA 5J2GA 1QLNA 4RNNA 3DDHA 4KLQA 1V38A 7ICUA 1TAQA 4KITB 3IG8A 4R63A 1L8LA 3KHRA 3C2LA 2HHTA 3QYPA 2QKQA 3F5AA 3AQEA 4IR9A 5KFEA 2BDUA 2P35A 5EE3A 8ICYA 4Z6CA 1FIQA 3MR6A 4J9NA 5KFPA 3ISCA 4R66A 1T7PA 3KHLA 1YZ7A 3KTQA 4P4MA 3V6HA 5ALHA 5D49A 4B9VA 3C28A 4FO6A 1JXLA 3SENA 2Q0ZX 5JTIA 3KFUF 4EELA 3HILA 5G5HA 8ICAA 4EX6A 2NRWA 3HJEA 1KLNA 4O3MA 4O3PA 1Z1BA 1U4BA 4I2AA 3SI8A 3KZXA 1N56A 3AU2A 4DQIA 2KV2A 4C7YA 2G5HB 3OSNA 2YMQA 1OUQA 3QUCA 1NJWA 4IRKA 4BXOA 1ZETA 3TFSA 9ICKA 2B0CA 4EX7A 2HDOA 5TZVA 3H4DA 2NYVA 4RUAA 3ONNA 5EOZA 3AN1A 4CCHA 5BPCA 5KFSA 2B21A 3RJJA 5AK5A 5A0LA 5AI9A 1L8OA 4RQMA 5AI5A 5BOMA 3BS7A 2KOBA 5KAIU 8ICBA 2R8GA 4OJ6A 4F50A 1SKWA 4ED8A 5HR7A 4OJPA 5DQHA 3QXGA 8ICRA 1DK3A 5AKHA 3RJEA 5ALVA 5J0TA 3ED5A 1S5LU 1X42A 2KVSA 5KFXA 1O08A 2C22A 2BKEA 2EZYA 2ZIXA 5L1LA 1QSSA 3G6VA 1N5XA 1L7PA 4O0IA 4Y2PA 5KFMA 5CA7A 3S6JA 3OPXA 1S76D 3HX0A 4P2HA 5KT7A 3PV8A 5D4BA 4Y2QA 2YMMA 2CRXA 1RYSA 4K4HA 1H38A 4OJOA 2WF8A 4UARA 1VDVA 3L5KA 2H3IA 4JV1A 5IINA 4I2GA 2KN7A 4YR2A 2D6FC 2HSZA 2FMSA 2BPCA 3HW8A 1X40A 5KL8B 3VCBA 3EUB2 7ICSA 2KJ8A 5IIMA 4IQVA 4J9OA 4NL9A 3V7JA 4UBCA 4KLHA 4QWBA 2XY6A 4TUPA 1X2IA 5AICA 1RPLA 1L3UA 2NRVA 5KG1A 3ZDAA 2CPRA 3RB4A 3H7IA 5AHXA 4Z6EA 1TFRA 2IA6A 2W04A 4CF4A 2G09A 4J9SA 4M0AA 1RQNA 8ICZA 4O3NA 3IM1A 4RPXA 3KBBA 3GILA 2ESEA 4DFMA 1ZQSA 2DPIA 4KLJA 1SXDA 4QWDA 4QZHA 5DBCA 2HBMA 1SGGA 1ZQQA 1X6JA 3BJYA 3ZDDA 2PMZF 1AQ6A 3C23A 7ICOA 4TUSA 4EYHB 4NLNA 2A3VA 9ICAA 1S0OA 1RZTA 3H8JA 1X6IA 5D46A 2HHSA 3KKAC 5J0QA 2CXYA 3WK9A 2K60A 4YFKA 1S77D 3MABA 1U47A 4AP9A 1ZXIA 4ED6A 1PVPA 2WAQC 5KFUA 4I2BA 9ICFA 1RXWA 1F44A 2F44A 4RT2A 1C20A 3UQ0A 4HYKA 4XRHA 3F53A 3BQ0A 5T14A 4Z6DA 1A6SA 3BS5A 1ZQMA 3HKZF 3T5KA 4F4ZA 2JEIA 4EBEA 3RRGA 4IRDA 3PVXA 4P4PA 2IMWP 1X9SA 4KLMA 5KFFA 3BQ7A 2MU2A 5IIIA 3LWLA 4DSIA 3GIKA 4OJ5A 3ZI4A 5ALQA 2XI9A 3RB6A 3CW2C 3ETLA 4NV0A 4DOBA 4RQ5A 4RQ2A 3PR5B 3K1RB 5IIKA 4JUZA 4QZBA 4M2YA 3C1ZA 2C2EA 3HP6A 1UT5A 5J8YC 3PMNA 9ICEA 2WF6A 3TADC 4OJLA 2J6UA 1RYUA 2ISPA 2Y9TA 4IQUA 2HHXA 2JGAA 1N61A 5ALRA 3TKAA 4NM1A 8ICMA 5J0UA 2HOQA 5KG4A 4C4SA 2GO7A 1COKA 2HOIA 3K4GA 2EDUA 8ICSA 9ICXA 3MBYA 3MGIA 9ICNA 2Y0SC 3RH4A 3H0RB 1BPZA 3RJKA 4DO9A 1CUKA 1MA7A 2BPGA 3OJUA 2WB1C 1QSYA 4Y2RA 4NLZA 3MR2A 2XGQA 1TKDA 3BDPA 4KLUA 1SZPA 4NLBA 1F5SA 2WTFA 5C0YA 4DL3A 3EW9A 2EH9A 2GOLA 4QZCA 2KZZA 3FYHA 1DOQA 3LVVA 2LKYA 4DSKA 4P0PB 1XO1A 9ICIA 2AXTU 3PMLA 3Q8RB 4GXKA 3LYSA 2KTQA 2W03A 1ZQLA 4EEKA 2RLTA 2ZIVA 5J2KA 5KT5A 5HHIA 2KZ3A 1NK5A 1A0PA 3UXNA 1JXEA 2H3FA 1DGSA 1X9XA 1DGJA 7ICTA 1JROA 1TK5A 2BDPA 3M6ZA 2ATLA 2J6SA 1RM6C 2MRLA 3QZ7A 1ZQIA 2KMDA 2RP5A 3G6XA 3M1YA 2K4IA 1ZQNA 2IOFK 1X9MA 4O3QA 1ZQDA 3FAHA 4JMUA 1KN5A 1IM4A 2NV3A 1SKSA 1ECWA 2E3TA 2EZXA 4RT3A 2G07A 4J9RA 4QNLA 4IL6U 4QIWF 1SL2A 3AUOA 3Q8SB 2MAXA 1N62A 2HVIA 4EZ6A 1N2XA 4RQ1A 2XGPA 1UCVA 1SL1A 1SWWA 2JRZA 4QW8A 9ICHA 2ZTDA 3QU5A 2BCRA 4YR0A 5DGAA 3HPOA 3K1ZA 3N4MB 5HMMA 2V4QA 4RQ6A 1JN3A 1PVRA 2RDJA 5J2BA 2D8CA 1NOMA 1ZQPA 1V85A 1D8LA 4LZDA 4YQWA 4KLEA 7ICLA 1Z4NA 2A1JB 4GXIA 3GZFA 2K89A 4I2EA 2ZIXB 2E8NA 1NK7A 3M8RA 3TAQA 3WKAA 1NK4A 1L7OA 3H0MB 2W8KA 2PFQA 3QEAZ 4RZRA 3EPIA 2BR0A 1DRGA 4ELVA 4YMMA 2H5XA 7ICJA 3L4PA 1L7MA 1MQ3A 2F1JA 5DLFA 3K75D 3QNMA 4ECRA 2FLLA 2QARB 9ICCA 3RR8A 1DXSA 4DQQA 3PX0A 2ZTEA 3BQ2A 2ZUCA 3ZD8A 4P0PA 4ECUA 2JHDA 4QZ8A 5ALWA 2F3NA 2KK0A 1TK8A 9ICOA 3THVA 7ICRA 3ORYA 9ICUA 2FMPA 4MEXA 5CR0A 4DFJA 1SWVA 4P0QA 4XUSA 2LBOA 1U48A 3KD3A 2QARA 5HNKA 4UAVA 3SQIA 2LYBA 4NLKA 4M9GA 1NKEA 3HKZC 3MR5A 4QIWC 9ICBA 3PSPA 5K4LA 3NGDA 3D6JA 2W55A 3ZDCA 3WK8A 2DL0A 3NVVA 4DQRA 2MUTB 5AK3A 1V9PA 2EAPA 4F91B 1PZNA 1K1SA 1JRPA 4UW9A 4DF8A 4ED3A 1ZRMA 1URJA 2ZIWB 1HIWA 1NK0A 4QZGA 3H0LB 4GC7A 4YP3A 4UB3A 1RG6A 4Q43A 1JMSA 4J9MA 1LV5A 5J0PA 5ALPA 3PZPA 1MQ2A 4JV2A 3RBDA 3EZ5A 2BCVA 5AKYA 2KHQA 4QWAA 4JWNA 2OWOA 4FS1A 1ZQFA 3KOOA 1K1QA 1VJ5A 3UXPA 2BGWA 4UASA 5J0XA 2OEHA 2FPLA 5DG8A 5JRTA 9ICWA 2F1IA 4UB1A 5KG7A 5AM0A 4F8RA 4KLFA 1ZQUA 5J2EA 2HHUA 3IG5A 2ZJAA 2Y9UA 5DG7A 2KSOB 3C21A 4QZIA 1TV9A 2DQNB 1JUDA 4RU9A 5ALXA 3TANA 1FFVA 2FI1A 2AQ0A 4F72A 5AKEA 5HR6A 9ICPA 3B0XA 2BZFA 2YTUA 3SR6A 3AM9A 2HMXA 3NUQA 2VJ4A 5EE1A 3SMVA 4RQNA 2ZUBA 2KD1A 4ED1A 4ED0A 1L3VA 3F2DA 3HWTA 2ALZA 3RJHA 5KFNA 1PVQA 5KFOA 4FBUA 3PW2A 2HVHA 2BQUA 3V6JA 1Z00B 3I76A 5KFAA 1KSPA 3MGHA 4TUQA 5AK6A 4KLSA 2KHVA 4M9JA 4UAUA 2XY5A 3M7DA 3N28A 5AI4A 4BWMA 4F5NA 3N7PD 5H2FU 2UVRA 1ZQBA 1YZ6A 4PGYA 3HT3A 3EWAA 4NY8A 1IG6A 4ACOA 1J97A
chains in the Genus database with same CATH topology
1F0MA 4PZOA 1X9XA 2LPEA 2QARB 3BQ7A 4IS7A 2KE7A 1DXSA 2F8KA 2E8PA 2L5YA 2JV3A 5KNIA 2D3DA 2KMDA 2GLEA 2F3NA 4RQMA 1SXEA 3TACB 3K1RB 2ES6A 3BS7A 2EAMA 5JRTA 1JI7A 2QB0A 5J8YC 3TADC 1X66A 2DKXA 1B4FA 3H8MA 2ESEA 1PK1B 2Y9TA 1SXDA 3IDWA 2DKZA 2QARA 1B0XA 2Y9UA 1SGGA 4MHVA 2KSOB 2EAOA 1WWVA 1SV4A 1COKA 1UCVA 1Z1VA 3TADA 1V38A 2KSOA 1PK3A 2EANA 3BS5B 2QKQA 3KKAC 2YTUA 1KW4A 2E8MA 2DL0A 1LKYB 2D8CA 2K60A 2E8OA 1V85A 1UQVA 2EAPA 2FE9A 4RQNA 2KIVA 2QB0B 3KKAA 2K4PA 2QB1A 4NJ8A 3SEIA 2F44A 4PZNA 1X40A 1RG6A 2E8NA 3SENA 5JTIA 5L1MA 3HILA 5J8YA 1SV0A 1SV0C 4NL9A 2B6GA 1OXJA 3BS5A 5JU5A 1WWUA 2KG5A 1LKYA 2LMRA 4NL9C 5F3XB 1PK1A 1OW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0M A;  4PZO A;  1X9X A;  2LPE A;  2QAR B;  3BQ7 A;  4IS7 A;  2KE7 A;  1DXS A;  2F8K A;  2E8P A;  2L5Y A;  2JV3 A;  5KNI A;  2D3D A;  2KMD A;  2GLE A;  2F3N A;  4RQM A;  1SXE A;  3TAC B;  3K1R B;  2ES6 A;  3BS7 A;  2EAM A;  5JRT A;  1JI7 A;  2QB0 A;  5J8Y C;  3TAD C;  1X66 A;  2DKX A;  1B4F A;  3H8M A;  2ESE A;  1PK1 B;  2Y9T A;  1SXD A;  3IDW A;  2DKZ A;  2QAR A;  1B0X A;  2Y9U A;  1SGG A;  4MHV A;  2KSO B;  2EAO A;  1WWV A;  1SV4 A;  1COK A;  1UCV A;  1Z1V A;  3TAD A;  1V38 A;  2KSO A;  1PK3 A;  2EAN A;  3BS5 B;  2QKQ A;  3KKA C;  2YTU A;  1KW4 A;  2E8M A;  2DL0 A;  1LKY B;  2D8C A;  2K60 A;  2E8O A;  1V85 A;  1UQV A;  2EAP A;  2FE9 A;  4RQN A;  2KIV A;  2QB0 B;  3KKA A;  2K4P A;  2QB1 A;  4NJ8 A;  3SEI A;  2F44 A;  4PZN A;  1X40 A;  1RG6 A;  2E8N A;  3SEN A;  5JTI A;  5L1M A;  3HIL A;  5J8Y A;  1SV0 A;  1SV0 C;  4NL9 A;  2B6G A;  1OXJ A;  3BS5 A;  5JU5 A;  1WWU A;  2KG5 A;  1LKY A;  2LMR A;  4NL9 C;  5F3X B;  1PK1 A;  1OW5 A; 
#chains in the Genus database with same CATH topology
 1F0M A;  4PZO A;  4JV0 A;  4O5K A;  5DBB A;  4MFA A;  3HRD D;  3NVW A;  4ED7 A;  2C2D A;  4DF4 A;  1QSL A;  5DG9 A;  1VLB A;  2ZIU B;  1NI3 A;  2W3S A;  1L5U A;  2G06 A;  1WCL A;  3JPP A;  2HHW A;  3WKB A;  1FO4 A;  5KFR A;  1B4F A;  2K8A A;  4DEZ A;  1Z00 A;  3T5L A;  4J9P A;  5ALD A;  2Y1J A;  2P66 A;  3N7S C;  8ICL A;  4MHV A;  4CF5 A;  2AHO B;  2HW3 A;  4RPY A;  3AL0 B;  4BUG A;  3I1Y A;  1S9F A;  1PK3 A;  3KHG A;  4BDP A;  9ICM A;  3M9N B;  4GC6 A;  3BS5 B;  5KFY A;  1M6Y A;  1FFU A;  2W9B A;  3RF9 A;  4KMU A;  1QH9 A;  4CE6 A;  9ICV A;  1T3Q A;  3WU2 U;  5J0W A;  2JEG A;  1LB2 B;  4Y2V A;  1TAU A;  4Y2J A;  2FE9 A;  4FZM A;  2C28 A;  4B6J A;  4UBB A;  1D9D A;  1WYG A;  2KJ9 A;  2W11 A;  3IRU A;  3ZDB A;  2QB1 A;  4NJ8 A;  2PI4 A;  3ISD A;  5ALN A;  4ECV A;  2CN1 A;  5KFB A;  3RB3 A;  4PPX A;  5B66 U;  7ICN A;  4F3O A;  3WKD A;  1ZQE A;  3CRX A;  3SD7 A;  2W9B B;  2KIC A;  4JK1 A;  1XNS A;  7ICI A;  1RYR A;  2B6G A;  4J03 A;  1B22 A;  1T3N A;  5J2F A;  2MUT A;  3GFK B;  1ZD4 A;  4F4K A;  3SAF A;  2E5S A;  4UAW A;  2E1F A;  3A0H U;  1GO3 F;  4FBT A;  3H8S A;  3Q8K A;  3GDX A;  2PFP A;  1D8B A;  1UHU A;  4C8L A;  1ARO P;  4KX5 A;  2D3D A;  1Q3U A;  2AGO A;  4QZA A;  2R8I A;  1NK6 A;  1SL0 A;  1WUD A;  3TAC B;  2I9G A;  1ZQZ A;  4IC9 A;  2J6T A;  1SIJ A;  4KLI A;  1X66 A;  8ICX A;  4FZN A;  5CP2 A;  5AIA A;  2OYY A;  3M9O B;  4MF2 A;  1NNL A;  4YMO A;  4F2R A;  2AU0 A;  5J2J A;  2H3Z A;  3PO4 A;  2DKZ A;  2LYH A;  4Z6F A;  1T94 A;  4BJQ A;  5EWG A;  4ELT A;  1CI4 A;  1SV4 A;  2ZG6 A;  3GV5 B;  8ICF A;  1ZQG A;  2YN4 A;  1BNP A;  5AI8 A;  3TAD A;  3PW7 A;  5IIL A;  5AK4 A;  3C29 A;  1S0N A;  3WKC A;  3PW5 A;  2R8J A;  3AMZ A;  1S10 A;  4GXJ A;  2YX8 A;  1LVH A;  4DL2 A;  8ICO A;  4QZF A;  5AKG A;  2E8O A;  4FE3 A;  1COO A;  4UAT A;  4IQT A;  2KP7 A;  1A77 A;  4EBD A;  4YVZ A;  3UMG A;  5DLG A;  3GIM A;  1A76 A;  5DGB A;  2K4P A;  2HHV A;  4C4R A;  2W3R A;  5KFJ A;  3PNC A;  1ZYQ A;  8ICU A;  1MC8 A;  4B9T A;  3TAR A;  9ICR A;  5KFZ A;  1IV8 A;  1SKR A;  3PSF A;  1ZQH A;  5KT4 A;  5KT6 A;  2O6K A;  5J29 A;  3MFI A;  2KFZ A;  3Q8P B;  5F3X B;  4UQG A;  2HHQ A;  3SAH A;  2MA1 A;  5EWE A;  4NLC A;  4PL2 A;  2P6U A;  5ALS A;  4YD1 A;  4EYI B;  3OSP A;  3RB0 A;  4IR1 A;  1BGX T;  1QQ6 A;  3SZ2 A;  3I28 A;  2F8K A;  2E8P A;  4J9L A;  3Q8M A;  4DS5 A;  2YY6 A;  4QZ9 A;  2HCF A;  4G3I A;  2DF4 B;  4BWJ A;  3ICX A;  5AKI A;  4R65 A;  2H3Q A;  2QB0 A;  4M9N A;  4RNO A;  4I2F A;  3RRH A;  1XS9 D;  4F93 B;  1N63 A;  5CB1 A;  4J9Q A;  2IHN A;  4DFD A;  3RR7 A;  3QU4 A;  2I1Q A;  5J2C A;  2BPF A;  4C7Z A;  3QUT A;  8ICK A;  3H4B A;  5GTH U;  5HHH A;  3GV7 B;  2ASD A;  4C8K A;  2WFA A;  3O0F A;  1KDH A;  2VIX A;  5FP0 A;  2W9C B;  1ED1 A;  4RNM A;  3OHB A;  5KFQ A;  3GII A;  3BQT A;  4EEY A;  1KW4 A;  4Y2X A;  1S97 A;  4M6W A;  5KT2 A;  4ZH4 A;  4UB8 U;  4PGX A;  4KLG A;  2GH1 A;  1NJX A;  3V6K A;  1CRX A;  3SEI A;  4M04 A;  3E0F A;  2ZXH A;  3MDA A;  2R8K A;  2JH7 A;  1KEJ A;  1ZQW A;  1QCK A;  7ICM A;  5ALI A;  3AU6 A;  4PHA A;  5DBA A;  5ALL A;  4DL7 A;  4Q44 A;  4CNQ A;  3PW0 A;  3UMB A;  5E79 U;  5KFD A;  2NO4 A;  2JEJ A;  2ISO A;  5L1I A;  3TQ1 A;  1Q8K A;  1XWL A;  4P4O A;  2DFL A;  2N1R A;  3WK5 A;  3D2S A;  5KG0 A;  2G08 A;  4F4W A;  1Z3E B;  5KFL A;  4I2J A;  5KG5 A;  2DPJ A;  4QW9 A;  4PJ0 U;  2JV3 A;  7ICP A;  4GFJ A;  2ES6 A;  2KZM A;  3UMC A;  4DQS A;  4ECW A;  1TE2 A;  2HBK A;  4GLX A;  3QUQ A;  1IXR A;  4DFK A;  1U45 A;  1JX4 A;  1NKB A;  1QTM A;  1KQQ A;  3BZK A;  1NZP A;  1NJY A;  2JXJ A;  2KSO A;  3JPN A;  2V4R A;  2JZB A;  2HOF A;  4YR3 A;  7ICG A;  3NAS A;  1KL9 A;  3RFA A;  1N60 A;  3RH5 A;  2YB1 A;  3RBE A;  4O5E A;  1RQL A;  1S0M A;  5CWR A;  2E8M A;  4M47 A;  1LKY B;  1UQV A;  3RAQ A;  4OD0 A;  3QX7 A;  1Q46 A;  8ICI A;  5CJ7 A;  2EZZ A;  2W8L A;  3F2C A;  2ZJ8 A;  4J9K A;  7ICE A;  4DL4 A;  1N5W A;  4FZL A;  2PKE A;  4NLG A;  4C8O A;  2RHF A;  4LVS A;  2BHN A;  4YCX A;  2AQ4 A;  2R8H A;  4I29 A;  2GWS A;  1ZJN A;  1XC9 A;  8ICH A;  3NVZ A;  3R9K A;  5L1K A;  4TQS A;  4KLL A;  3RJI A;  4B9U A;  3PSI A;  3C2M A;  2QLT A;  2Y0S F;  2NRZ A;  1ZQR A;  5IIO A;  2Q4T A;  8ICW A;  4G9B A;  4R8U B;  5L1J A;  2UVU A;  2RQ5 A;  2XID A;  1OW5 A;  3OGU A;  5J0O A;  5KAF U;  8ICV A;  4DSJ A;  4ICA A;  2XIC A;  5J0Y A;  5DQI A;  3M8S A;  4F2S A;  9ICQ A;  3M9M B;  3GV8 B;  5F9L A;  1ZQC A;  2FDR A;  3GIJ A;  4I2H A;  2JEF A;  2VAN A;  2ZJ5 A;  3F2B A;  4ED2 A;  4LZG A;  3IDW A;  4OO1 J;  3OHA A;  5ALM A;  4X5V A;  2KKP A;  3T5J A;  3GU3 A;  4B9N A;  1B0X A;  2XY7 A;  5AI0 A;  4EEN A;  3UQ2 A;  4I2C A;  4R8U A;  2W7O A;  1KFS A;  3FC4 A;  2K8C B;  1XU4 A;  4NM2 A;  3QUB A;  3N97 B;  1ZD5 A;  4YG2 A;  1UPH A;  3WK4 A;  4USA A;  2HBL A;  4Q45 A;  3QE9 Y;  2PXI A;  1C7Y A;  4DL5 A;  4GIB A;  5AM1 A;  2HI0 A;  5ALJ A;  1Y88 A;  2OH2 A;  2YB4 A;  5AKK A;  2KVC A;  4ECS A;  2UVV A;  4DS4 A;  1ZQV A;  1NZB A;  2WAQ F;  3ISB A;  2I5H A;  2KNJ A;  5DB7 A;  3ALR A;  4LJX A;  5DB8 A;  1HJP A;  5AM5 A;  3RAX A;  4OCZ A;  4KLO A;  2XCP A;  2ZIU A;  1SV0 C;  5AKZ A;  3IN5 A;  5KG6 A;  2F8L A;  3EYZ A;  1HUO A;  2W7P A;  3JPO A;  5JU5 A;  1L6N A;  4Y2Y A;  2KG5 A;  1ZJM A;  2LMR A;  3DEE A;  4YXJ A;  4F5R A;  1PK1 A;  4KLD A;  2YQE A;  3RJG A;  2LM4 A;  2JH1 A;  1ZQK A;  2JZB B;  2K8B B;  2OXO A;  4KTQ A;  1UT8 A;  4RQ3 A;  5KG3 A;  3WK7 A;  3UM9 A;  2GLE A;  4M9H A;  4AYB C;  1JI7 A;  2A1J A;  2FJ6 A;  4R64 A;  5CEH A;  3WK6 A;  5KG2 A;  4DLE A;  2NO5 A;  4NWI A;  2WB1 F;  4DSF A;  3ZD9 A;  2VKQ A;  2KEY A;  2NRT A;  2ZIW A;  2EAO A;  1WWV A;  2NRX A;  1ZOL A;  2VA2 A;  5AIB A;  1WG8 A;  2LHT A;  2KKV A;  9ICG A;  3E58 A;  3PW4 A;  3CNH A;  2YML A;  2YMP A;  3MDC A;  4C8M A;  5ALZ A;  3JPR A;  2W43 A;  2XCA A;  3Q8L A;  2AGQ A;  2DBY A;  7ICF A;  3VC8 A;  4Y2T A;  1HEK A;  2ZXI A;  2LM1 A;  2M9N A;  2RDI A;  2LI6 A;  2W54 A;  4UB2 A;  2ZUD A;  3T5H A;  2VA8 A;  2IOH A;  3C1Y A;  1XO0 A;  3KKA A;  3NRZ A;  5ALO A;  2BCS A;  4FFD A;  4JWM A;  4MFC A;  1JAL A;  4PHE A;  3J81 j;  4FS2 A;  2UVW A;  2BCQ A;  4PGQ A;  2RRD A;  3M6K A;  1K5O A;  2EQY A;  2E1E A;  5L1M A;  3KHH A;  4NXZ A;  4P0Q B;  4M9L A;  4CGZ A;  2OHF A;  3GQC A;  1V97 A;  4YMN A;  1UA0 A;  1T4G A;  4ECQ A;  5AKX A;  4O3R A;  1B43 A;  7ICK A;  4QWE A;  2XVT A;  1UA1 A;  8ICJ A;  4PHD A;  5JUM A;  2XC9 A;  4IS7 A;  3LWM A;  9ICL A;  5BOL A;  2IHM A;  4F5Q A;  2L5Y A;  3LVW A;  2P6R A;  3PST A;  1RDF A;  2W9M A;  1EXN A;  1O03 A;  2H3V A;  4RQ4 A;  4BGD A;  4EBC A;  9ICT A;  2I6X A;  8ICG A;  5AM2 A;  2ZIV B;  1PK1 B;  4C4T A;  4UAZ A;  5KFG A;  3L3F X;  5GTI U;  1SB3 C;  4I28 A;  5ALG A;  1S0V A;  2DUY A;  4F71 A;  4JB3 A;  4O3S A;  5DB6 A;  5KFH A;  5J0S A;  3ETR A;  4YN4 A;  3C5G A;  3H40 A;  2W9C A;  4O5C A;  2PMZ C;  1NK9 A;  1ZQJ A;  4DFP A;  3OTQ A;  2EAN A;  3IP4 B;  2ASL A;  4E0D A;  3B9J A;  5J2A A;  4CRX A;  2ZTC A;  5HP4 A;  5IIJ A;  4C0Z A;  3C2K A;  4UB5 A;  5KFW A;  2JMG A;  3MFH A;  5ALT A;  3V7L A;  1D9F A;  5KFI A;  3AEV A;  3FM9 A;  4ELU A;  3IV6 A;  3CYM A;  5DB9 A;  3JPQ A;  1ZQ1 C;  3DV9 A;  3IHQ B;  2F2A B;  4Q8F A;  3NTU A;  1RXV A;  4O3O A;  1OXJ A;  2MSN A;  4KN4 A;  1QQ7 A;  1WWU A;  1L3T A;  1LKY A;  4ECZ A;  5ALU A;  4NL9 C;  1Z4O A;  3QZ8 A;  3JPT A;  4F5P A;  1JIH A;  4ZOH C;  5J2D A;  1IIP A;  2IOF A;  4F5O A;  2VJ5 A;  2LPE A;  2WF9 A;  2DWQ A;  1U9L A;  1Z19 A;  2HBJ A;  4RPZ A;  4IRC A;  5EWF A;  1ZD3 A;  4RQ8 A;  3KZI U;  4B9L A;  4UAY A;  1BPY A;  5ALK A;  3UXO A;  5J2I A;  1KRP A;  1NJZ A;  1ZQX A;  1SXE A;  4QWC A;  1BPE A;  5EE0 A;  3SYZ A;  2KJ5 A;  4DL6 A;  3T79 A;  3SV3 A;  8ICQ A;  2K4H A;  4KX3 A;  4C8N A;  3D2N A;  1D8Y A;  1WCN A;  7ICV A;  5B5E U;  4IQW A;  3N7R C;  2BQ3 A;  1MN8 A;  1SZH A;  2F76 X;  1YT3 A;  4RQ0 A;  4DCC A;  1KKX A;  1PUZ A;  1XSP A;  1TK0 A;  2AH5 A;  4DQP A;  2Y1I A;  4US8 A;  5AI6 A;  3FDS A;  3E2E A;  2OM6 A;  5KFV A;  3V7K A;  4MEY A;  3MR3 A;  1ZQA A;  4F4X A;  2AGP A;  2W9A A;  5KFK A;  5G5G A;  5ALF A;  2PI5 A;  3WKE A;  3Q8Q B;  3BQ1 A;  5ALE A;  3RTV A;  1J2N A;  3D2Q A;  1KFT A;  2A1A A;  3SV4 A;  1BPX A;  3F5E A;  2F1H A;  5DQG A;  2C2R A;  1T8E A;  1ZD2 P;  5TIS U;  5CHG A;  4BXO B;  1BVS A;  4U6P A;  5DDM A;  4CDG A;  4PZN A;  4BX9 C;  4YD2 A;  4Y2U A;  5EE9 A;  9ICS A;  2IBK A;  2XO7 A;  4F4Y A;  3B0Y A;  3PX4 A;  4PHP A;  5J8Y A;  2M0N A;  1NKC A;  2VA3 A;  1BNO A;  2ODG A;  3G6Y A;  4MFF A;  3RH6 A;  1BPD A;  4DLG A;  3CP8 A;  4MF8 A;  2FLP A;  2BCU A;  1FEZ A;  2PFO A;  2G0A A;  3LK9 A;  5DDY A;  1KTQ A;  2Z7J A;  1ZQT A;  4O9M A;  3JPS A;  3ZDE A;  2WF7 A;  1NK8 A;  2KE7 A;  5AM4 A;  1TVA A;  1KBU A;  4KN7 A;  4I27 A;  1X9W A;  4I2I A;  5KNI A;  3NS1 A;  4QZE A;  4B9S A;  4QZD A;  2FMQ A;  3MC1 A;  2EAM A;  4TQR A;  2A19 A;  4F92 B;  5CRX A;  5ALY A;  3LDA A;  2DKX A;  3NRW A;  2WF5 A;  3H8M A;  5KT3 A;  3H8W A;  2F77 X;  7ICQ A;  3TFR A;  3RJF A;  4XQ8 A;  2K4E A;  5KFT A;  8ICE A;  4M6W B;  1S8O A;  1XSL A;  5KFC A;  3SAG A;  2ASJ A;  2FPK A;  4DSL A;  8ICC A;  2OCE A;  1Z1V A;  5DKW A;  4Q8E A;  3PR4 A;  1XSN A;  2KIW A;  4RQ7 A;  3BZC A;  4CF3 A;  3TI0 A;  3PX6 A;  3V72 A;  1HUZ A;  1MSW D;  4UB6 U;  4YXM A;  1Q3V A;  4DWI A;  7ICH A;  1BPB A;  1QQ5 A;  1ZRN A;  1ZQY A;  8ICT A;  4KMO B;  2JR5 A;  5KL1 B;  1N48 A;  2KIV A;  2QB0 B;  4K4G A;  9ICJ A;  2V9W A;  1P7D A;  2BQR A;  1TAM A;  3QU7 A;  5J0R A;  4XA5 A;  2PFN A;  4HAI A;  4Y2S A;  2WHE A;  1U49 A;  4US9 A;  1SV0 A;  3PY8 A;  4WJ3 B;  2FPM A;  5AKJ A;  4I2D A;  5HML A;  2AJQ A;  4U7C A;  4B9M A;  4PH5 A;  4DSE A;  8ICN A;  4DOC A;  3QEB Z;  2G5I B;  3PO5 A;  5C5J A;  3AQF A;  3QU9 A;  5J2H A;  2DGZ A;  4DOA A;  1CEZ A;  4EZ9 A;  5L9X A;  5F9N A;  3TAP A;  8ICP A;  3EPG A;  4AYB F;  3QU2 A;  1L3S A;  1KFD A;  4RUC A;  4QJF B;  3NVY A;  3C5F A;  1DK2 A;  1ZQO A;  5AM3 A;  1L7N A;  3U26 A;  4K4I A;  4ECX A;  3OJS A;  4A8E A;  4ECT A;  3T3F A;  3MGV A;  4UB4 A;  4ECY A;  4KLT A;  4PL1 A;  2R18 A;  5AKL A;  2FLN A;  2KFN A;  2LYA A;  5KTQ A;  4TUR A;  4C80 A;  3A0B U;  1J2M A;  3UPQ A;  5J2G A;  1QLN A;  4RNN A;  3DDH A;  4KLQ A;  1V38 A;  7ICU A;  1TAQ A;  4KIT B;  3IG8 A;  4R63 A;  1L8L A;  3KHR A;  3C2L A;  2HHT A;  3QYP A;  2QKQ A;  3F5A A;  3AQE A;  4IR9 A;  5KFE A;  2BDU A;  2P35 A;  5EE3 A;  8ICY A;  4Z6C A;  1FIQ A;  3MR6 A;  4J9N A;  5KFP A;  3ISC A;  4R66 A;  1T7P A;  3KHL A;  1YZ7 A;  3KTQ A;  4P4M A;  3V6H A;  5ALH A;  5D49 A;  4B9V A;  3C28 A;  4FO6 A;  1JXL A;  3SEN A;  2Q0Z X;  5JTI A;  3KFU F;  4EEL A;  3HIL A;  5G5H A;  8ICA A;  4EX6 A;  2NRW A;  3HJE A;  1KLN A;  4O3M A;  4O3P A;  1Z1B A;  1U4B A;  4I2A A;  3SI8 A;  3KZX A;  1N56 A;  3AU2 A;  4DQI A;  2KV2 A;  4C7Y A;  2G5H B;  3OSN A;  2YMQ A;  1OUQ A;  3QUC A;  1NJW A;  4IRK A;  4BXO A;  1ZET A;  3TFS A;  9ICK A;  2B0C A;  4EX7 A;  2HDO A;  5TZV A;  3H4D A;  2NYV A;  4RUA A;  3ONN A;  5EOZ A;  3AN1 A;  4CCH A;  5BPC A;  5KFS A;  2B21 A;  3RJJ A;  5AK5 A;  5A0L A;  5AI9 A;  1L8O A;  4RQM A;  5AI5 A;  5BOM A;  3BS7 A;  2KOB A;  5KAI U;  8ICB A;  2R8G A;  4OJ6 A;  4F50 A;  1SKW A;  4ED8 A;  5HR7 A;  4OJP A;  5DQH A;  3QXG A;  8ICR A;  1DK3 A;  5AKH A;  3RJE A;  5ALV A;  5J0T A;  3ED5 A;  1S5L U;  1X42 A;  2KVS A;  5KFX A;  1O08 A;  2C22 A;  2BKE A;  2EZY A;  2ZIX A;  5L1L A;  1QSS A;  3G6V A;  1N5X A;  1L7P A;  4O0I A;  4Y2P A;  5KFM A;  5CA7 A;  3S6J A;  3OPX A;  1S76 D;  3HX0 A;  4P2H A;  5KT7 A;  3PV8 A;  5D4B A;  4Y2Q A;  2YMM A;  2CRX A;  1RYS A;  4K4H A;  1H38 A;  4OJO A;  2WF8 A;  4UAR A;  1VDV A;  3L5K A;  2H3I A;  4JV1 A;  5IIN A;  4I2G A;  2KN7 A;  4YR2 A;  2D6F C;  2HSZ A;  2FMS A;  2BPC A;  3HW8 A;  1X40 A;  5KL8 B;  3VCB A;  3EUB 2;  7ICS A;  2KJ8 A;  5IIM A;  4IQV A;  4J9O A;  4NL9 A;  3V7J A;  4UBC A;  4KLH A;  4QWB A;  2XY6 A;  4TUP A;  1X2I A;  5AIC A;  1RPL A;  1L3U A;  2NRV A;  5KG1 A;  3ZDA A;  2CPR A;  3RB4 A;  3H7I A;  5AHX A;  4Z6E A;  1TFR A;  2IA6 A;  2W04 A;  4CF4 A;  2G09 A;  4J9S A;  4M0A A;  1RQN A;  8ICZ A;  4O3N A;  3IM1 A;  4RPX A;  3KBB A;  3GIL A;  2ESE A;  4DFM A;  1ZQS A;  2DPI A;  4KLJ A;  1SXD A;  4QWD A;  4QZH A;  5DBC A;  2HBM A;  1SGG A;  1ZQQ A;  1X6J A;  3BJY A;  3ZDD A;  2PMZ F;  1AQ6 A;  3C23 A;  7ICO A;  4TUS A;  4EYH B;  4NLN A;  2A3V A;  9ICA A;  1S0O A;  1RZT A;  3H8J A;  1X6I A;  5D46 A;  2HHS A;  3KKA C;  5J0Q A;  2CXY A;  3WK9 A;  2K60 A;  4YFK A;  1S77 D;  3MAB A;  1U47 A;  4AP9 A;  1ZXI A;  4ED6 A;  1PVP A;  2WAQ C;  5KFU A;  4I2B A;  9ICF A;  1RXW A;  1F44 A;  2F44 A;  4RT2 A;  1C20 A;  3UQ0 A;  4HYK A;  4XRH A;  3F53 A;  3BQ0 A;  5T14 A;  4Z6D A;  1A6S A;  3BS5 A;  1ZQM A;  3HKZ F;  3T5K A;  4F4Z A;  2JEI A;  4EBE A;  3RRG A;  4IRD A;  3PVX A;  4P4P A;  2IMW P;  1X9S A;  4KLM A;  5KFF A;  3BQ7 A;  2MU2 A;  5III A;  3LWL A;  4DSI A;  3GIK A;  4OJ5 A;  3ZI4 A;  5ALQ A;  2XI9 A;  3RB6 A;  3CW2 C;  3ETL A;  4NV0 A;  4DOB A;  4RQ5 A;  4RQ2 A;  3PR5 B;  3K1R B;  5IIK A;  4JUZ A;  4QZB A;  4M2Y A;  3C1Z A;  2C2E A;  3HP6 A;  1UT5 A;  5J8Y C;  3PMN A;  9ICE A;  2WF6 A;  3TAD C;  4OJL A;  2J6U A;  1RYU A;  2ISP A;  2Y9T A;  4IQU A;  2HHX A;  2JGA A;  1N61 A;  5ALR A;  3TKA A;  4NM1 A;  8ICM A;  5J0U A;  2HOQ A;  5KG4 A;  4C4S A;  2GO7 A;  1COK A;  2HOI A;  3K4G A;  2EDU A;  8ICS A;  9ICX A;  3MBY A;  3MGI A;  9ICN A;  2Y0S C;  3RH4 A;  3H0R B;  1BPZ A;  3RJK A;  4DO9 A;  1CUK A;  1MA7 A;  2BPG A;  3OJU A;  2WB1 C;  1QSY A;  4Y2R A;  4NLZ A;  3MR2 A;  2XGQ A;  1TKD A;  3BDP A;  4KLU A;  1SZP A;  4NLB A;  1F5S A;  2WTF A;  5C0Y A;  4DL3 A;  3EW9 A;  2EH9 A;  2GOL A;  4QZC A;  2KZZ A;  3FYH A;  1DOQ A;  3LVV A;  2LKY A;  4DSK A;  4P0P B;  1XO1 A;  9ICI A;  2AXT U;  3PML A;  3Q8R B;  4GXK A;  3LYS A;  2KTQ A;  2W03 A;  1ZQL A;  4EEK A;  2RLT A;  2ZIV A;  5J2K A;  5KT5 A;  5HHI A;  2KZ3 A;  1NK5 A;  1A0P A;  3UXN A;  1JXE A;  2H3F A;  1DGS A;  1X9X A;  1DGJ A;  7ICT A;  1JRO A;  1TK5 A;  2BDP A;  3M6Z A;  2ATL A;  2J6S A;  1RM6 C;  2MRL A;  3QZ7 A;  1ZQI A;  2KMD A;  2RP5 A;  3G6X A;  3M1Y A;  2K4I A;  1ZQN A;  2IOF K;  1X9M A;  4O3Q A;  1ZQD A;  3FAH A;  4JMU A;  1KN5 A;  1IM4 A;  2NV3 A;  1SKS A;  1ECW A;  2E3T A;  2EZX A;  4RT3 A;  2G07 A;  4J9R A;  4QNL A;  4IL6 U;  4QIW F;  1SL2 A;  3AUO A;  3Q8S B;  2MAX A;  1N62 A;  2HVI A;  4EZ6 A;  1N2X A;  4RQ1 A;  2XGP A;  1UCV A;  1SL1 A;  1SWW A;  2JRZ A;  4QW8 A;  9ICH A;  2ZTD A;  3QU5 A;  2BCR A;  4YR0 A;  5DGA A;  3HPO A;  3K1Z A;  3N4M B;  5HMM A;  2V4Q A;  4RQ6 A;  1JN3 A;  1PVR A;  2RDJ A;  5J2B A;  2D8C A;  1NOM A;  1ZQP A;  1V85 A;  1D8L A;  4LZD A;  4YQW A;  4KLE A;  7ICL A;  1Z4N A;  2A1J B;  4GXI A;  3GZF A;  2K89 A;  4I2E A;  2ZIX B;  2E8N A;  1NK7 A;  3M8R A;  3TAQ A;  3WKA A;  1NK4 A;  1L7O A;  3H0M B;  2W8K A;  2PFQ A;  3QEA Z;  4RZR A;  3EPI A;  2BR0 A;  1DRG A;  4ELV A;  4YMM A;  2H5X A;  7ICJ A;  3L4P A;  1L7M A;  1MQ3 A;  2F1J A;  5DLF A;  3K75 D;  3QNM A;  4ECR A;  2FLL A;  2QAR B;  9ICC A;  3RR8 A;  1DXS A;  4DQQ A;  3PX0 A;  2ZTE A;  3BQ2 A;  2ZUC A;  3ZD8 A;  4P0P A;  4ECU A;  2JHD A;  4QZ8 A;  5ALW A;  2F3N A;  2KK0 A;  1TK8 A;  9ICO A;  3THV A;  7ICR A;  3ORY A;  9ICU A;  2FMP A;  4MEX A;  5CR0 A;  4DFJ A;  1SWV A;  4P0Q A;  4XUS A;  2LBO A;  1U48 A;  3KD3 A;  2QAR A;  5HNK A;  4UAV A;  3SQI A;  2LYB A;  4NLK A;  4M9G A;  1NKE A;  3HKZ C;  3MR5 A;  4QIW C;  9ICB A;  3PSP A;  5K4L A;  3NGD A;  3D6J A;  2W55 A;  3ZDC A;  3WK8 A;  2DL0 A;  3NVV A;  4DQR A;  2MUT B;  5AK3 A;  1V9P A;  2EAP A;  4F91 B;  1PZN A;  1K1S A;  1JRP A;  4UW9 A;  4DF8 A;  4ED3 A;  1ZRM A;  1URJ A;  2ZIW B;  1HIW A;  1NK0 A;  4QZG A;  3H0L B;  4GC7 A;  4YP3 A;  4UB3 A;  1RG6 A;  4Q43 A;  1JMS A;  4J9M A;  1LV5 A;  5J0P A;  5ALP A;  3PZP A;  1MQ2 A;  4JV2 A;  3RBD A;  3EZ5 A;  2BCV A;  5AKY A;  2KHQ A;  4QWA A;  4JWN A;  2OWO A;  4FS1 A;  1ZQF A;  3KOO A;  1K1Q A;  1VJ5 A;  3UXP A;  2BGW A;  4UAS A;  5J0X A;  2OEH A;  2FPL A;  5DG8 A;  5JRT A;  9ICW A;  2F1I A;  4UB1 A;  5KG7 A;  5AM0 A;  4F8R A;  4KLF A;  1ZQU A;  5J2E A;  2HHU A;  3IG5 A;  2ZJA A;  2Y9U A;  5DG7 A;  2KSO B;  3C21 A;  4QZI A;  1TV9 A;  2DQN B;  1JUD A;  4RU9 A;  5ALX A;  3TAN A;  1FFV A;  2FI1 A;  2AQ0 A;  4F72 A;  5AKE A;  5HR6 A;  9ICP A;  3B0X A;  2BZF A;  2YTU A;  3SR6 A;  3AM9 A;  2HMX A;  3NUQ A;  2VJ4 A;  5EE1 A;  3SMV A;  4RQN A;  2ZUB A;  2KD1 A;  4ED1 A;  4ED0 A;  1L3V A;  3F2D A;  3HWT A;  2ALZ A;  3RJH A;  5KFN A;  1PVQ A;  5KFO A;  4FBU A;  3PW2 A;  2HVH A;  2BQU A;  3V6J A;  1Z00 B;  3I76 A;  5KFA A;  1KSP A;  3MGH A;  4TUQ A;  5AK6 A;  4KLS A;  2KHV A;  4M9J A;  4UAU A;  2XY5 A;  3M7D A;  3N28 A;  5AI4 A;  4BWM A;  4F5N A;  3N7P D;  5H2F U;  2UVR A;  1ZQB A;  1YZ6 A;  4PGY A;  3HT3 A;  3EWA A;  4NY8 A;  1IG6 A;  4ACO A;  1J97 A; 
#chains in the Genus database with same CATH homology
 1F0M A;  4PZO A;  1X9X A;  2LPE A;  2QAR B;  3BQ7 A;  4IS7 A;  2KE7 A;  1DXS A;  2F8K A;  2E8P A;  2L5Y A;  2JV3 A;  5KNI A;  2D3D A;  2KMD A;  2GLE A;  2F3N A;  4RQM A;  1SXE A;  3TAC B;  3K1R B;  2ES6 A;  3BS7 A;  2EAM A;  5JRT A;  1JI7 A;  2QB0 A;  5J8Y C;  3TAD C;  1X66 A;  2DKX A;  1B4F A;  3H8M A;  2ESE A;  1PK1 B;  2Y9T A;  1SXD A;  3IDW A;  2DKZ A;  2QAR A;  1B0X A;  2Y9U A;  1SGG A;  4MHV A;  2KSO B;  2EAO A;  1WWV A;  1SV4 A;  1COK A;  1UCV A;  1Z1V A;  3TAD A;  1V38 A;  2KSO A;  1PK3 A;  2EAN A;  3BS5 B;  2QKQ A;  3KKA C;  2YTU A;  1KW4 A;  2E8M A;  2DL0 A;  1LKY B;  2D8C A;  2K60 A;  2E8O A;  1V85 A;  1UQV A;  2EAP A;  2FE9 A;  4RQN A;  2KIV A;  2QB0 B;  3KKA A;  2K4P A;  2QB1 A;  4NJ8 A;  3SEI A;  2F44 A;  4PZN A;  1X40 A;  1RG6 A;  2E8N A;  3SEN A;  5JTI A;  5L1M A;  3HIL A;  5J8Y A;  1SV0 A;  1SV0 C;  4NL9 A;  2B6G A;  1OXJ A;  3BS5 A;  5JU5 A;  1WWU A;  2KG5 A;  1LKY A;  2LMR A;  4NL9 C;  5F3X B;  1PK1 A;  1OW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...