4LJXA

Crystal structure of an at-rich interactive domain-containing protein 3a (arid3a) from homo sapiens at 2.21 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
122
structure length
122
Chain Sequence
WTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AT-rich interactive domain-containing protein 3A
publication title Crystal structure of an AT-rich interactive domain-containing protein 3A (ARID3A) from Homo sapiens at 2.21 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 4ljxA00
1KQQA 1KKXA 1RYUA 5CEHA 1KN5A 2EQYA 5K4LA 2RQ5A 1IG6A 4LJXA 2LI6A 2EH9A 1C20A 2JXJA 2CXYA 2KK0A 2LM1A 2OEHA 2YQEA 2JRZA
chains in the Genus database with same CATH superfamily
4EEKA 2G08A 5CEHA 4YQWA 2DPIA 9ICHA 1NKBA 1U9LA 1S8OA 2OHFA 4KLJA 4Z6CA 4IQUA 1NI3A 5HMMA 4CF3A 1WYGA 4NLNA 5DDYA 3HJEA 3MR2A 3UMCA 5AM2A 5DBBA 4UAZA 1ZQCA 5ALQA 3CP8A 4EBDA 2BPCA 4DSIA 2ES6A 1ZQSA 3JPPA 3EWAA 2ZIXB 1S5LU 2NO5A 2QB0A 2BQRA 2WF8A 3UMGA 1UA1A 4F93B 1ZQKA 4UW9A 3SR6A 4ECXA 2XI9A 4US8A 1OUQA 4UB6U 3HWTA 1MSWD 1DGJA 2HHUA 1IV8A 3FC4A 3TQ1A 7ICKA 8ICNA 4QWDA 4KN4A 1X9SA 1U47A 3ICXA 5DBAA 2CPRA 2K8AA 2KVCA 3ORYA 1AQ6A 2HBLA 1V9PA 4UAVA 4KLMA 4O0IA 4ELUA 2EANA 5KFUA 1NZBA 5KAIU 2RDJA 4MFFA 2W03A 2FMSA 3HRDD 1ZJMA 3B9JA 7ICMA 4OJPA 1P7DA 3V72A 3EUB2 3QE9Y 2XY7A 3R9KA 1KDHA 2BCRA 2BCQA 1ZQVA 4QZ9A 3ZDAA 3M1YA 1A6SA 3M9NB 3PNCA 5IIMA 1S0VA 4I2DA 1QSYA 5KG6A 3V7KA 3KHHA 1S0MA 3RJJA 4FBTA 2HBMA 2R8KA 1FFVA 2OM6A 5J2BA 1U45A 1NJZA 5AKEA 3QYPA 4QZGA 4DFJA 4ELTA 4HAIA 5ALTA 1IXRA 1TFRA 1JIHA 2A1JA 2NRXA 1JXEA 5DG7A 1N63A 4FE3A 3LVWA 2FMQA 2PFNA 2OEHA 4DL4A 4RT3A 3JPNA 3K1RB 4I2FA 3V7LA 4CRXA 1ZQLA 2B21A 1VJ5A 1XO1A 4F5PA 4JV0A 3WK4A 1UCVA 3HX0A 1URJA 2LI6A 2KKVA 1TAQA 2RHFA 1ZD3A 4EYHB 3C2MA 3PX6A 5AK6A 3NVVA 5CJ7A 2G5IB 3PX4A 1HJPA 8ICPA 2ZTCA 4UB8U 4FFDA 3NRWA 4OJ6A 4I2BA 1OXJA 2F77X 3S6JA 2BQ3A 2HBJA 4UB1A 1J2NA 5EWGA 1JX4A 3MC1A 5CA7A 1ZQFA 5DG8A 2GLEA 4ELVA 2ZXIA 4R66A 1SXDA 5DKWA 5ALFA 2Z7JA 4PHAA 4P0PA 1L3TA 4NLCA 2C28A 2W3SA 4QW9A 4RZRA 5FP0A 3GIKA 8ICOA 3OSPA 3Q8KA 1FEZA 5KFNA 3JPSA 1LV5A 3T79A 5J2DA 5CRXA 7ICJA 5ALOA 2NRWA 4RUCA 3CYMA 3Q8RB 5AI5A 4Y2VA 4O9MA 4P4OA 3N7RC 5KFXA 8ICLA 1WWVA 4O5CA 1ZQOA 4UARA 3IV6A 5A0LA 4C0ZA 4DL5A 1SWVA 1D8BA 4KLUA 2HVHA 5T14A 3K4GA 3F2BA 4M47A 2EAPA 3WK5A 1NOMA 3MFHA 3RJHA 1NK5A 3RAXA 4M6WA 3H8SA 4LZGA 1XNSA 3GILA 2VKQA 3PR4A 1AROP 3RFAA 9ICUA 2BGWA 8ICJA 2FE9A 3O0FA 4DLEA 5L1JA 2KP7A 2KZ3A 4I2IA 4I29A 4M04A 1WUDA 2BPFA 4UATA 3BS5A 2XCAA 2HHSA 2M9NA 1QQ7A 5GTIU 1MA7A 4TUQA 3FAHA 4F92B 2UVVA 4KLOA 1UA0A 3RR7A 5ALUA 4F4YA 3K1ZA 2YMLA 2QB0B 3IN5A 2WB1F 4OJOA 3D6JA 1SKSA 1F0MA 3N28A 5KG1A 4KLEA 2K4IA 2OCEA 3BQ0A 5AK4A 3UXOA 2P6UA 3BQ2A 3UQ0A 5AIBA 2E1FA 4UASA 2FPMA 7ICHA 2LPEA 1X6JA 8ICEA 4NLKA 3ISBA 2HHVA 2F1IA 4M9JA 2KVSA 3LWLA 4Y2PA 5DG9A 3T3FA 1J97A 3QUCA 5J0OA 4PHDA 3QUBA 3L4PA 2Q0ZX 3UXPA 2KHQA 2DFLA 5AICA 5KT2A 8ICKA 5HHIA 1U49A 4BDPA 2EAOA 4BGDA 2JH1A 3QUTA 3I1YA 5TZVA 3OGUA 2W55A 4KLTA 2ZJ5A 1IIPA 5B66U 3SYZA 2ZUBA 3N4MB 5IINA 3AUOA 1RM6C 2WFAA 3NUQA 8ICYA 1V97A 2OH2A 4F2SA 5ALMA 4LVSA 4CF5A 1XC9A 3SAGA 4PL2A 1NK8A 9ICXA 2AGQA 2A1JB 2FJ6A 2P6RA 2K8BB 4FBUA 5CB1A 5J0SA 1TKDA 8ICTA 3SAFA 3AU2A 4EZ9A 5ALPA 4DL2A 5KFEA 9ICMA 4IR1A 4EZ6A 1ZETA 5CP2A 4UAWA 3RJFA 1KEJA 3MABA 4YR0A 2KKPA 3H0MB 1GO3F 4GIBA 5ALVA 1CI4A 3PSIA 4YMMA 1HUZA 4OCZA 1TK0A 4R65A 3M6KA 3RRHA 2DBYA 5AKKA 1SL0A 2HBKA 4A8EA 4UB3A 1XSLA 3RH4A 5ALZA 2VJ5A 4PGQA 2BHNA 2VA8A 5KFFA 3PW5A 3GV7B 5E79U 2QLTA 3RB3A 5KG3A 4IRKA 2F2AB 3TAPA 4O3PA 8ICAA 2PMZF 3KHRA 1UT8A 9ICCA 3V6HA 5AKLA 3ZDCA 5BOLA 4DL6A 1PVPA 2DPJA 5J0RA 3BDPA 2LMRA 2DKZA 4P0PB 4RQ7A 2Y1JA 4XQ8A 8ICCA 2JV3A 2DUYA 3OJSA 2DF4B 1WWUA 7ICEA 1ZQAA 5J8YC 3KHLA 1DK3A 5KFLA 5J0UA 4Y2XA 3M9MB 4C8NA 1QQ6A 5KFDA 3MFIA 1Z00A 2GH1A 4RQ3A 3FDSA 1VDVA 3MGIA 4EX7A 8ICIA 3ZDDA 2IBKA 2XGQA 5KFMA 3K75D 2KD1A 4USAA 5JU5A 2B6GA 5ALHA 3RBDA 2G0AA 1RQNA 4M6WB 2RP5A 5ALYA 1X6IA 3NRZA 5ALNA 1Z1VA 5CR0A 3GQCA 4GXIA 2E8OA 4QIWC 1N62A 3I76A 3SD7A 1C7YA 2PXIA 4FZLA 4YP3A 8ICVA 2KMDA 2W43A 1ZQIA 3H8MA 5KT5A 4C8LA 3RBEA 3EZ5A 5ALXA 1ZYQA 3UMBA 1ZXIA 4O3RA 9ICQA 3NTUA 3RAQA 3BS5B 2KG5A 3AQFA 2Q4TA 1Z3EB 3F5EA 5KFRA 4DL3A 3V7JA 2YX8A 2LHTA 5JUMA 2ZUDA 2F76X 3M8RA 3V6KA 2KZMA 9ICVA 2D3DA 3V6JA 5AIAA 1KQQA 1SL1A 4O5EA 1ZQWA 3TKAA 3HKZF 4PPXA 3ISCA 3Q8PB 1KLNA 1Z4OA 2XY5A 5F9LA 2HOFA 4TUPA 3DDHA 7ICIA 1XSPA 3PW7A 1ZQXA 3PR5B 2IHMA 1L5UA 2O6KA 5HHHA 4UB5A 3RJIA 2JHDA 3IRUA 1JMSA 5AI8A 1SZPA 1SXEA 2H5XA 1S77D 4IR9A 2LYAA 1QLNA 5HR6A 2XO7A 5CWRA 3MGHA 2ZIVA 2ZJ8A 1S0OA 3T5LA 5J2KA 1ZQZA 2J6SA 4ECTA 4DWIA 4O5KA 5KT3A 5DB6A 4RQNA 4PZNA 5AKJA 1HEKA 3H8JA 1MQ2A 3QXGA 4IL6U 1IG6A 2VJ4A 3RJGA 2KV2A 2FLLA 4NWIA 5H2FU 5ALLA 4QZEA 3D2QA 4RUAA 4KLGA 4F4KA 4PL1A 5J0PA 4RQ2A 4PGXA 4DS5A 3FM9A 4QZAA 2KJ9A 5DGBA 9ICFA 4JWNA 3OJUA 1ZQBA 4GC7A 4KX3A 5DQHA 1O03A 3C5GA 1PK1A 1QH9A 5HP4A 8ICWA 4OJLA 2KFZA 9ICAA 2W11A 5AHXA 2HHWA 2YTUA 4B6JA 2WAQC 4YN4A 4JV1A 1V85A 3C21A 4F5QA 2WHEA 1T3QA 5EE1A 4M0AA 4DSJA 4F5RA 1BPYA 1NK4A 3SEIA 1KRPA 3B0XA 3H8WA 5KT7A 3JPQA 5AM0A 2F8KA 1X66A 3A0BU 1BPEA 4GFJA 4RT2A 9ICKA 4PHPA 1T94A 1PVQA 4MHVA 2KNJA 4Q43A 4B9UA 5G5GA 5D49A 8ICZA 1K1QA 4AYBF 9ICTA 5EE0A 2HI0A 3T5HA 2ZJAA 5J8YA 1RPLA 3WK8A 2JEJA 1DXSA 2ZIUA 5J2HA 1T3NA 2KSOA 3QEBZ 1ZOLA 5DB9A 2YQEA 1PK3A 4YXJA 1DOQA 2UVWA 3IG8A 1X42A 2DKXA 2K89A 1RXVA 3NVWA 4F91B 3HT3A 4LJXA 4F4WA 7ICGA 3GU3A 2DQNB 4NLGA 4MF2A 3U26A 1D8LA 4OJ5A 3F2CA 1Z00B 4PGYA 2UVUA 1BVSA 2Y1IA 4BX9C 4FS2A 2XC9A 2F1JA 2FLPA 2H3FA 4YXMA 3MR5A 3SZ2A 2ASLA 1T4GA 2RQ5A 3QU9A 3SI8A 2BQUA 4F2RA 4ACOA 2GOLA 3E2EA 3SMVA 3QNMA 4C4RA 4ED3A 4ECQA 3QU5A 5J0XA 1DRGA 4B9NA 2NRTA 3KD3A 2R8HA 4LZDA 3PX0A 1KTQA 3SV4A 2R8GA 2WF6A 9ICLA 3RTVA 4QWCA 4MF8A 2FPLA 5IIKA 4CNQA 4QZBA 4XUSA 8ICMA 4YMNA 4M9NA 4KLIA 5KFSA 3CRXA 2JRZA 4DCCA 4Q8EA 2M0NA 2VA2A 1HUOA 2W8KA 8ICGA 4TQSA 1YZ6A 3OHAA 1QSSA 2A19A 5L9XA 1JN3A 4RNMA 3AQEA 5J2EA 5KFPA 4O3MA 9ICRA 2ZG6A 3AMZA 1ZQPA 3RJKA 9ICPA 2IOFK 2MA1A 4QZHA 1U48A 1D9FA 3C1YA 2ZTEA 3ED5A 3AL0B 4OO1J 4RNNA 2QKQA 1XO0A 5KFTA 4F5NA 3HILA 1X9XA 1SV0C 2NO4A 4B9VA 4ED2A 2MUTA 3EPIA 1JI7A 4QZFA 3EPGA 3H4BA 4QZ8A 9ICJA 5KFKA 1O08A 2JEFA 4Y2QA 4ECZA 4I28A 3ETRA 1KW4A 3CNHA 2ZIVB 4P4PA 4PHEA 1WG8A 1FO4A 1ZQYA 5KFQA 3QZ8A 3GIIA 1KSPA 3NASA 4GC6A 3NGDA 5EE3A 3RB6A 4F50A 2YB1A 4CF4A 3C23A 2HSZA 2QARA 3EYZA 3PY8A 4YVZA 7ICFA 1PUZA 5AI0A 7ICNA 4X5VA 2FI1A 3KTQA 5KAFU 2AGOA 5KG4A 3KHGA 4YR3A 5HNKA 1N2XA 5AKXA 2G06A 5KG0A 2ZTDA 5D4BA 1YT3A 3OPXA 1PK1B 1LKYA 3E58A 1Z1BA 2LM1A 4CE6A 1JUDA 3VCBA 2C2RA 5EOZA 2GWSA 7ICPA 5J2AA 1KN5A 2Y9UA 4M9LA 2EAMA 4U6PA 5ALSA 3HPOA 4EYIB 3HW8A 3TAQA 2AQ0A 5EWEA 2WF7A 1N61A 1BGXT 3H40A 3GFKB 3C28A 4I27A 2E3TA 1TK5A 4Y2SA 2JZBA 7ICTA 4C7YA 2C2DA 4P0QA 1H38A 4F72A 2HHXA 4RQ6A 2PFOA 4YFKA 2D6FC 2Y0SF 3RJEA 5C5JA 1MQ3A 4IQVA 2K4HA 2F44A 2YMPA 4K4GA 4YG2A 2ZIUB 4FS1A 2ISPA 1L7PA 2J6TA 2KSOB 5K4LA 1ED1A 2DWQA 4YR2A 1SWWA 3ZI4A 2ESEA 9ICSA 2W54A 3WKAA 2ZIWA 4DO9A 4AP9A 1L7OA 3J81j 2CRXA 2ZUCA 1NJYA 2H3QA 1WCNA 5DB8A 3JPRA 1NK7A 4P2HA 2PFPA 3LYSA 1S0NA 2WF9A 1F44A 4CCHA 4US9A 1L8OA 4C8OA 1C20A 1V38A 3H0LB 3AU6A 2LKYA 3D2NA 5KFHA 5AI9A 4XRHA 5AKYA 5DQIA 3G6XA 2F1HA 4DF4A 3M6ZA 3L5KA 4ED7A 4KLLA 4J9MA 3F5AA 4F3OA 1D8YA 4R64A 4Z6DA 2XICA 4ECWA 4TQRA 2R8JA 5CHGA 1Q3UA 4QW8A 3SV3A 5J2CA 4P4MA 2KIVA 4DFDA 4UAYA 4R63A 4J9SA 3KFUF 5J0YA 2K4EA 2H3VA 4BWMA 1CUKA 2HW3A 1ZQUA 3PSFA 5C0YA 5L1KA 1LVHA 5KT4A 3WK7A 5KFCA 7ICVA 4EENA 4F4XA 3GDXA 5HR7A 4Q8FA 3LDAA 4I2AA 2W8LA 5L1MA 3JPTA 4GXKA 3GV8B 4DFKA 4J9LA 3PVXA 5F9NA 2KFNA 5AM5A 2XCPA 2YMMA 3UQ2A 1SV0A 4BXOA 3A0HU 3L3FX 1XS9D 4Z6FA 2ISOA 1JXLA 2BR0A 1B4FA 3KZIU 3LWMA 4Y2YA 3AN1A 3RH6A 4QWEA 5KT6A 5J0WA 1SKWA 2N1RA 2C22A 5KFBA 4O3QA 1NKCA 4RQ1A 5D46A 3Q8LA 4B9SA 2MUTB 2LBOA 3C5FA 4KMUA 4J9KA 2IHNA 3IM1A 3TARA 2HVIA 4KLHA 1KFTA 4FO6A 1NZPA 1A76A 4NV0A 2FLNA 4J9PA 4E0DA 2RLTA 1F5SA 1S10A 1L7NA 1NK6A 1Z19A 4J9OA 3OTQA 5AK5A 2JGAA 2W9CA 4C8KA 3T5JA 3MR6A 4YD2A 5J2FA 5KG2A 4EEYA 4JV2A 1N5WA 4M9HA 3PO5A 5J2IA 2QARB 3QX7A 4Q45A 1VLBA 2W9BA 3ETLA 2K4PA 2V9WA 3WK6A 2DL0A 4OD0A 4DOCA 1KFDA 1ZRMA 3QU4A 4M9GA 4B9LA 2I6XA 1RYRA 2BCVA 1LKYB 4RPZA 1COKA 1T7PA 1JRPA 2MU2A 7ICRA 4DL7A 4EX6A 4YMOA 3SENA 2PMZC 2AXTU 1L3SA 1N60A 4UB2A 7ICLA 5ALIA 4DSEA 4IQWA 2EQYA 2Y9TA 2DGZA 1BPBA 4M2YA 9ICGA 4QWAA 1COOA 2NRVA 2WTFA 2ALZA 2AGPA 2JZBB 2P66A 4RPXA 2NV3A 4P0QB 1Y88A 2YB4A 4NJ8A 3D2SA 4GXJA 4UQGA 1N5XA 4EELA 2D8CA 1PVRA 4RQMA 1ZQNA 1IM4A 2A1AA 3KOOA 9ICBA 1X40A 4I2HA 2QB1A 1TE2A 5DBCA 5BOMA 2H3ZA 4J03A 5KG7A 4Y2JA 1S9FA 1QTMA 8ICRA 7ICUA 5ALKA 5ALWA 4NLBA 4RQ4A 1RDFA 5IILA 1RYUA 1N48A 3UXNA 2E8NA 3IHQB 2ZIWB 2A3VA 4RU9A 7ICOA 8ICUA 1XU4A 4QWBA 3PMNA 2OXOA 1N56A 5ALRA 4PH5A 3NVYA 4C4TA 2BCUA 3EW9A 2KICA 2HOIA 4KLQA 1KL9A 1L7MA 5ALDA 5ALJA 1UQVA 3C2LA 4DS4A 4I2JA 5KG5A 2FDRA 1XSNA 3M9OB 4C4SA 3Q8SB 4DF8A 5GTHU 1NNLA 2F8LA 8ICXA 2V4RA 4EBCA 5J0TA 3ONNA 5KL8B 4J9NA 2BDUA 1SIJA 7ICSA 2RRDA 3HKZC 1ZQ1C 5KFZA 4HYKA 2KJ8A 2WF5A 2JEGA 4MFAA 3RF9A 4ZH4A 4YD1A 4DQSA 1ZQHA 2PI5A 4JMUA 3SQIA 3C1ZA 4UB4A 1BPDA 2E1EA 8ICSA 4KMOB 4KTQA 4R8UA 1DGSA 3GV5B 3NVZA 1BPZA 3TADC 2LM4A 1ZD2P 5KFVA 5AKIA 4DQIA 1B0XA 2C2EA 3PO4A 5KFWA 3SAHA 1PZNA 1KFSA 3N7SC 2E5SA 3PV8A 1OW5A 1BNOA 2KOBA 3CW2C 3KKAC 4RNOA 1TAMA 2EZZA 2W3RA 1DK2A 2KEYA 4IC9A 3RB4A 2YMQA 2B0CA 3DV9A 1FFUA 3G6YA 3I28A 4BXOB 2JH7A 4F4ZA 2HDOA 3VC8A 4Y2RA 1ZQRA 3GZFA 2ODGA 3WKEA 1QQ5A 3Q8MA 2FPKA 4NLZA 2HCFA 5J0QA 4ECUA 3AEVA 3IDWA 2PI4A 2AQ4A 2VIXA 3UM9A 1RZTA 5KL1B 4J9RA 2PFQA 4UBBA 4FZMA 5AI6A 2VA3A 4DSFA 4NM1A 4K4HA 4G9BA 4JWMA 2NYVA 4CDGA 3UPQA 5JRTA 4F5OA 4BWJA 1ZQMA 4I2GA 1X9MA 2W9AA 3E0FA 4QZCA 4Y2UA 5ALEA 4DQPA 2ASJA 2LYBA 5DGAA 1ZQJA 1NJWA 2IOHA 2KJ5A 3MR3A 2W9CB 2JXJA 4BUGA 4KX5A 3ALRA 4Q44A 4ECSA 4RQ5A 3Q8QB 4C80A 2W9BB 4IS7A 2G07A 3FYHA 1BPXA 2MSNA 4B9MA 2KIWA 4ECYA 5DLFA 2G5HB 4G3IA 1Q8KA 4KN7A 3PSTA 2G09A 3WKCA 3TI0A 2J6UA 4ED0A 1U4BA 1JALA 4TURA 4XA5A 4KLSA 1BNPA 4RPYA 4AYBC 3N97B 3G6VA 2EZXA 2E8MA 1Q3VA 3PSPA 1T8EA 3C2KA 4WJ3B 3B0YA 4DSKA 5BPCA 5KFJA 3AM9A 4DLGA 3PW0A 2I9GA 2F3NA 2CN1A 3BZKA 5AKZA 4C8MA 4O3OA 3KZXA 2XIDA 3TFSA 2NRZA 5AM3A 4DFPA 5IIJA 4KITB 1ZQTA 4IRDA 4Z6EA 2BZFA 3BQ1A 1ZJNA 1ZQEA 3BQTA 2PKEA 3GIMA 1MC8A 1TAUA 1X2IA 4KLFA 3ISDA 4QJFB 3C29A 4JB3A 4QZDA 2UVRA 1RXWA 2L5YA 5L1LA 2KE7A 3M8SA 3M7DA 2HHQA 4QNLA 1K1SA 1SB3C 4J9QA 4JUZA 5J2JA 1TV9A 1FIQA 1XWLA 3LK9A 3F2DA 5DQGA 4FZNA 1ZD4A 5AI4A 2JR5A 2KN7A 1EXNA 4RQ8A 3WU2U 5KTQA 5DB7A 3TFRA 1A77A 1D9DA 4UBCA 3MDCA 4UAUA 2W04A 4NL9C 1SV4A 4PJ0U 2OWOA 4U7CA 2OYYA 4O3NA 1J2MA 4B9TA 2ATLA 3RB0A 2XVTA 5G5HA 4JK1A 3TANA 2ZIXA 1SL2A 5AM4A 1S97A 1A0PA 2YY6A 4CGZA 1SGGA 3PW4A 4IRCA 3N7PD 2LYHA 2YN4A 5EWFA 4TUSA 4QIWF 4BJQA 4GLXA 2ASDA 2KHVA 3PZPA 3TADA 3DEEA 1ZD5A 8ICBA 3IG5A 9ICNA 1LB2B 5TISU 4DSLA 1ZRNA 4DQQA 1WCLA 5ALGA 3KKAA 2KZZA 8ICQA 3HP6A 2BKEA 1RQLA 4R8UB 4ED8A 2KTQA 5B5EU 1S76D 7ICQA 2MRLA 3IP4B 2FMPA 3OSNA 1TVAA 1ZQQA 2EH9A 2W7PA 2HOQA 4DFMA 1NK0A 3QUQA 3BJYA 4F8RA 2CXYA 2E8PA 3ZD9A 3MDAA 3T5KA 9ICWA 4QZIA 4MFCA 5IIIA 1SKRA 3WKDA 8ICHA 3RRGA 2IMWP 4ECVA 1ECWA 3MGVA 2BCSA 2MAXA 3GIJA 5KFIA 4F71A 2GO7A 2WB1C 4NM2A 2EDUA 2P35A 3KBBA 4MEXA 1UHUA 4MEYA 3ZD8A 1L6NA 5EE9A 4RQ0A 8ICFA 3RH5A 1JROA 1K5OA 1B43A 3ZDBA 1NK9A 2JMGA 1SZHA 2HMXA 2XGPA 5AM1A 1UT5A 5AK3A 3PW2A 5F3XB 2XY6A 4YCXA 2R18A 4KLDA 4ED6A 5J2GA 5L1IA 4EBEA 1M6YA 3H4DA 1KKXA 2AH5A 4NY8A 2K60A 1B22A 2IA6A 4C7ZA 4DEZA 3MBYA 1L8LA 1CRXA 4PZOA 2R8IA 5J29A 2JEIA 4DOAA 1KBUA 1RYSA 5KFAA 2ZXHA 2BDPA 1RG6A 3BQ7A 3OHBA 2RDIA 5KFOA 2WAQF 3PMLA 1ZQDA 4DQRA 3BS7A 5HMLA 1MN8A 1QSLA 4I2EA 1NJXA 1ZQGA 5DLGA 3QZ7A 2Y0SC 3NS1A 1X9WA 3WKBA 5AKGA 1L3UA 4ED1A 4O3SA 5DDMA 2H3IA 2HHTA 4DOBA 4K4IA 2IOFA 2AU0A 4ICAA 5IIOA 3LVVA 3WK9A 9ICIA 4ZOHC 3QEAZ 5KNIA 3ZDEA 2I1QA 1NKEA 2AHOB 5KFYA 1TK8A 2W9MA 2V4QA 2AJQA 4I2CA 2KK0A 1Z4NA 2BPGA 3BZCA 2VANA 1HIWA 1L3VA 2EZYA 2K8CB 1CEZA 3TACB 4IQTA 3H7IA 9ICEA 1QCKA 3JPOA 2W7OA 1YZ7A 1UPHA 4ECRA 4Y2TA 5JTIA 3QU2A 3QU7A 3H0RB 3F53A 2I5HA 4NL9A 4NXZA 9ICOA 3RR8A 1Q46A 5KFGA 5AKHA 3THVA
chains in the Genus database with same CATH topology
1KQQA 1KKXA 1RYUA 5CEHA 1KN5A 2EQYA 5K4LA 2RQ5A 1IG6A 4LJXA 2LI6A 2EH9A 1C20A 2JXJA 2CXYA 2KK0A 2LM1A 2OEHA 2YQEA 2JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQQ A;  1KKX A;  1RYU A;  5CEH A;  1KN5 A;  2EQY A;  5K4L A;  2RQ5 A;  1IG6 A;  4LJX A;  2LI6 A;  2EH9 A;  1C20 A;  2JXJ A;  2CXY A;  2KK0 A;  2LM1 A;  2OEH A;  2YQE A;  2JRZ A; 
#chains in the Genus database with same CATH topology
 4EEK A;  2G08 A;  5CEH A;  4YQW A;  2DPI A;  9ICH A;  1NKB A;  1U9L A;  1S8O A;  2OHF A;  4KLJ A;  4Z6C A;  4IQU A;  1NI3 A;  5HMM A;  4CF3 A;  1WYG A;  4NLN A;  5DDY A;  3HJE A;  3MR2 A;  3UMC A;  5AM2 A;  5DBB A;  4UAZ A;  1ZQC A;  5ALQ A;  3CP8 A;  4EBD A;  2BPC A;  4DSI A;  2ES6 A;  1ZQS A;  3JPP A;  3EWA A;  2ZIX B;  1S5L U;  2NO5 A;  2QB0 A;  2BQR A;  2WF8 A;  3UMG A;  1UA1 A;  4F93 B;  1ZQK A;  4UW9 A;  3SR6 A;  4ECX A;  2XI9 A;  4US8 A;  1OUQ A;  4UB6 U;  3HWT A;  1MSW D;  1DGJ A;  2HHU A;  1IV8 A;  3FC4 A;  3TQ1 A;  7ICK A;  8ICN A;  4QWD A;  4KN4 A;  1X9S A;  1U47 A;  3ICX A;  5DBA A;  2CPR A;  2K8A A;  2KVC A;  3ORY A;  1AQ6 A;  2HBL A;  1V9P A;  4UAV A;  4KLM A;  4O0I A;  4ELU A;  2EAN A;  5KFU A;  1NZB A;  5KAI U;  2RDJ A;  4MFF A;  2W03 A;  2FMS A;  3HRD D;  1ZJM A;  3B9J A;  7ICM A;  4OJP A;  1P7D A;  3V72 A;  3EUB 2;  3QE9 Y;  2XY7 A;  3R9K A;  1KDH A;  2BCR A;  2BCQ A;  1ZQV A;  4QZ9 A;  3ZDA A;  3M1Y A;  1A6S A;  3M9N B;  3PNC A;  5IIM A;  1S0V A;  4I2D A;  1QSY A;  5KG6 A;  3V7K A;  3KHH A;  1S0M A;  3RJJ A;  4FBT A;  2HBM A;  2R8K A;  1FFV A;  2OM6 A;  5J2B A;  1U45 A;  1NJZ A;  5AKE A;  3QYP A;  4QZG A;  4DFJ A;  4ELT A;  4HAI A;  5ALT A;  1IXR A;  1TFR A;  1JIH A;  2A1J A;  2NRX A;  1JXE A;  5DG7 A;  1N63 A;  4FE3 A;  3LVW A;  2FMQ A;  2PFN A;  2OEH A;  4DL4 A;  4RT3 A;  3JPN A;  3K1R B;  4I2F A;  3V7L A;  4CRX A;  1ZQL A;  2B21 A;  1VJ5 A;  1XO1 A;  4F5P A;  4JV0 A;  3WK4 A;  1UCV A;  3HX0 A;  1URJ A;  2LI6 A;  2KKV A;  1TAQ A;  2RHF A;  1ZD3 A;  4EYH B;  3C2M A;  3PX6 A;  5AK6 A;  3NVV A;  5CJ7 A;  2G5I B;  3PX4 A;  1HJP A;  8ICP A;  2ZTC A;  4UB8 U;  4FFD A;  3NRW A;  4OJ6 A;  4I2B A;  1OXJ A;  2F77 X;  3S6J A;  2BQ3 A;  2HBJ A;  4UB1 A;  1J2N A;  5EWG A;  1JX4 A;  3MC1 A;  5CA7 A;  1ZQF A;  5DG8 A;  2GLE A;  4ELV A;  2ZXI A;  4R66 A;  1SXD A;  5DKW A;  5ALF A;  2Z7J A;  4PHA A;  4P0P A;  1L3T A;  4NLC A;  2C28 A;  2W3S A;  4QW9 A;  4RZR A;  5FP0 A;  3GIK A;  8ICO A;  3OSP A;  3Q8K A;  1FEZ A;  5KFN A;  3JPS A;  1LV5 A;  3T79 A;  5J2D A;  5CRX A;  7ICJ A;  5ALO A;  2NRW A;  4RUC A;  3CYM A;  3Q8R B;  5AI5 A;  4Y2V A;  4O9M A;  4P4O A;  3N7R C;  5KFX A;  8ICL A;  1WWV A;  4O5C A;  1ZQO A;  4UAR A;  3IV6 A;  5A0L A;  4C0Z A;  4DL5 A;  1SWV A;  1D8B A;  4KLU A;  2HVH A;  5T14 A;  3K4G A;  3F2B A;  4M47 A;  2EAP A;  3WK5 A;  1NOM A;  3MFH A;  3RJH A;  1NK5 A;  3RAX A;  4M6W A;  3H8S A;  4LZG A;  1XNS A;  3GIL A;  2VKQ A;  3PR4 A;  1ARO P;  3RFA A;  9ICU A;  2BGW A;  8ICJ A;  2FE9 A;  3O0F A;  4DLE A;  5L1J A;  2KP7 A;  2KZ3 A;  4I2I A;  4I29 A;  4M04 A;  1WUD A;  2BPF A;  4UAT A;  3BS5 A;  2XCA A;  2HHS A;  2M9N A;  1QQ7 A;  5GTI U;  1MA7 A;  4TUQ A;  3FAH A;  4F92 B;  2UVV A;  4KLO A;  1UA0 A;  3RR7 A;  5ALU A;  4F4Y A;  3K1Z A;  2YML A;  2QB0 B;  3IN5 A;  2WB1 F;  4OJO A;  3D6J A;  1SKS A;  1F0M A;  3N28 A;  5KG1 A;  4KLE A;  2K4I A;  2OCE A;  3BQ0 A;  5AK4 A;  3UXO A;  2P6U A;  3BQ2 A;  3UQ0 A;  5AIB A;  2E1F A;  4UAS A;  2FPM A;  7ICH A;  2LPE A;  1X6J A;  8ICE A;  4NLK A;  3ISB A;  2HHV A;  2F1I A;  4M9J A;  2KVS A;  3LWL A;  4Y2P A;  5DG9 A;  3T3F A;  1J97 A;  3QUC A;  5J0O A;  4PHD A;  3QUB A;  3L4P A;  2Q0Z X;  3UXP A;  2KHQ A;  2DFL A;  5AIC A;  5KT2 A;  8ICK A;  5HHI A;  1U49 A;  4BDP A;  2EAO A;  4BGD A;  2JH1 A;  3QUT A;  3I1Y A;  5TZV A;  3OGU A;  2W55 A;  4KLT A;  2ZJ5 A;  1IIP A;  5B66 U;  3SYZ A;  2ZUB A;  3N4M B;  5IIN A;  3AUO A;  1RM6 C;  2WFA A;  3NUQ A;  8ICY A;  1V97 A;  2OH2 A;  4F2S A;  5ALM A;  4LVS A;  4CF5 A;  1XC9 A;  3SAG A;  4PL2 A;  1NK8 A;  9ICX A;  2AGQ A;  2A1J B;  2FJ6 A;  2P6R A;  2K8B B;  4FBU A;  5CB1 A;  5J0S A;  1TKD A;  8ICT A;  3SAF A;  3AU2 A;  4EZ9 A;  5ALP A;  4DL2 A;  5KFE A;  9ICM A;  4IR1 A;  4EZ6 A;  1ZET A;  5CP2 A;  4UAW A;  3RJF A;  1KEJ A;  3MAB A;  4YR0 A;  2KKP A;  3H0M B;  1GO3 F;  4GIB A;  5ALV A;  1CI4 A;  3PSI A;  4YMM A;  1HUZ A;  4OCZ A;  1TK0 A;  4R65 A;  3M6K A;  3RRH A;  2DBY A;  5AKK A;  1SL0 A;  2HBK A;  4A8E A;  4UB3 A;  1XSL A;  3RH4 A;  5ALZ A;  2VJ5 A;  4PGQ A;  2BHN A;  2VA8 A;  5KFF A;  3PW5 A;  3GV7 B;  5E79 U;  2QLT A;  3RB3 A;  5KG3 A;  4IRK A;  2F2A B;  3TAP A;  4O3P A;  8ICA A;  2PMZ F;  3KHR A;  1UT8 A;  9ICC A;  3V6H A;  5AKL A;  3ZDC A;  5BOL A;  4DL6 A;  1PVP A;  2DPJ A;  5J0R A;  3BDP A;  2LMR A;  2DKZ A;  4P0P B;  4RQ7 A;  2Y1J A;  4XQ8 A;  8ICC A;  2JV3 A;  2DUY A;  3OJS A;  2DF4 B;  1WWU A;  7ICE A;  1ZQA A;  5J8Y C;  3KHL A;  1DK3 A;  5KFL A;  5J0U A;  4Y2X A;  3M9M B;  4C8N A;  1QQ6 A;  5KFD A;  3MFI A;  1Z00 A;  2GH1 A;  4RQ3 A;  3FDS A;  1VDV A;  3MGI A;  4EX7 A;  8ICI A;  3ZDD A;  2IBK A;  2XGQ A;  5KFM A;  3K75 D;  2KD1 A;  4USA A;  5JU5 A;  2B6G A;  5ALH A;  3RBD A;  2G0A A;  1RQN A;  4M6W B;  2RP5 A;  5ALY A;  1X6I A;  3NRZ A;  5ALN A;  1Z1V A;  5CR0 A;  3GQC A;  4GXI A;  2E8O A;  4QIW C;  1N62 A;  3I76 A;  3SD7 A;  1C7Y A;  2PXI A;  4FZL A;  4YP3 A;  8ICV A;  2KMD A;  2W43 A;  1ZQI A;  3H8M A;  5KT5 A;  4C8L A;  3RBE A;  3EZ5 A;  5ALX A;  1ZYQ A;  3UMB A;  1ZXI A;  4O3R A;  9ICQ A;  3NTU A;  3RAQ A;  3BS5 B;  2KG5 A;  3AQF A;  2Q4T A;  1Z3E B;  3F5E A;  5KFR A;  4DL3 A;  3V7J A;  2YX8 A;  2LHT A;  5JUM A;  2ZUD A;  2F76 X;  3M8R A;  3V6K A;  2KZM A;  9ICV A;  2D3D A;  3V6J A;  5AIA A;  1KQQ A;  1SL1 A;  4O5E A;  1ZQW A;  3TKA A;  3HKZ F;  4PPX A;  3ISC A;  3Q8P B;  1KLN A;  1Z4O A;  2XY5 A;  5F9L A;  2HOF A;  4TUP A;  3DDH A;  7ICI A;  1XSP A;  3PW7 A;  1ZQX A;  3PR5 B;  2IHM A;  1L5U A;  2O6K A;  5HHH A;  4UB5 A;  3RJI A;  2JHD A;  3IRU A;  1JMS A;  5AI8 A;  1SZP A;  1SXE A;  2H5X A;  1S77 D;  4IR9 A;  2LYA A;  1QLN A;  5HR6 A;  2XO7 A;  5CWR A;  3MGH A;  2ZIV A;  2ZJ8 A;  1S0O A;  3T5L A;  5J2K A;  1ZQZ A;  2J6S A;  4ECT A;  4DWI A;  4O5K A;  5KT3 A;  5DB6 A;  4RQN A;  4PZN A;  5AKJ A;  1HEK A;  3H8J A;  1MQ2 A;  3QXG A;  4IL6 U;  1IG6 A;  2VJ4 A;  3RJG A;  2KV2 A;  2FLL A;  4NWI A;  5H2F U;  5ALL A;  4QZE A;  3D2Q A;  4RUA A;  4KLG A;  4F4K A;  4PL1 A;  5J0P A;  4RQ2 A;  4PGX A;  4DS5 A;  3FM9 A;  4QZA A;  2KJ9 A;  5DGB A;  9ICF A;  4JWN A;  3OJU A;  1ZQB A;  4GC7 A;  4KX3 A;  5DQH A;  1O03 A;  3C5G A;  1PK1 A;  1QH9 A;  5HP4 A;  8ICW A;  4OJL A;  2KFZ A;  9ICA A;  2W11 A;  5AHX A;  2HHW A;  2YTU A;  4B6J A;  2WAQ C;  4YN4 A;  4JV1 A;  1V85 A;  3C21 A;  4F5Q A;  2WHE A;  1T3Q A;  5EE1 A;  4M0A A;  4DSJ A;  4F5R A;  1BPY A;  1NK4 A;  3SEI A;  1KRP A;  3B0X A;  3H8W A;  5KT7 A;  3JPQ A;  5AM0 A;  2F8K A;  1X66 A;  3A0B U;  1BPE A;  4GFJ A;  4RT2 A;  9ICK A;  4PHP A;  1T94 A;  1PVQ A;  4MHV A;  2KNJ A;  4Q43 A;  4B9U A;  5G5G A;  5D49 A;  8ICZ A;  1K1Q A;  4AYB F;  9ICT A;  5EE0 A;  2HI0 A;  3T5H A;  2ZJA A;  5J8Y A;  1RPL A;  3WK8 A;  2JEJ A;  1DXS A;  2ZIU A;  5J2H A;  1T3N A;  2KSO A;  3QEB Z;  1ZOL A;  5DB9 A;  2YQE A;  1PK3 A;  4YXJ A;  1DOQ A;  2UVW A;  3IG8 A;  1X42 A;  2DKX A;  2K89 A;  1RXV A;  3NVW A;  4F91 B;  3HT3 A;  4LJX A;  4F4W A;  7ICG A;  3GU3 A;  2DQN B;  4NLG A;  4MF2 A;  3U26 A;  1D8L A;  4OJ5 A;  3F2C A;  1Z00 B;  4PGY A;  2UVU A;  1BVS A;  2Y1I A;  4BX9 C;  4FS2 A;  2XC9 A;  2F1J A;  2FLP A;  2H3F A;  4YXM A;  3MR5 A;  3SZ2 A;  2ASL A;  1T4G A;  2RQ5 A;  3QU9 A;  3SI8 A;  2BQU A;  4F2R A;  4ACO A;  2GOL A;  3E2E A;  3SMV A;  3QNM A;  4C4R A;  4ED3 A;  4ECQ A;  3QU5 A;  5J0X A;  1DRG A;  4B9N A;  2NRT A;  3KD3 A;  2R8H A;  4LZD A;  3PX0 A;  1KTQ A;  3SV4 A;  2R8G A;  2WF6 A;  9ICL A;  3RTV A;  4QWC A;  4MF8 A;  2FPL A;  5IIK A;  4CNQ A;  4QZB A;  4XUS A;  8ICM A;  4YMN A;  4M9N A;  4KLI A;  5KFS A;  3CRX A;  2JRZ A;  4DCC A;  4Q8E A;  2M0N A;  2VA2 A;  1HUO A;  2W8K A;  8ICG A;  4TQS A;  1YZ6 A;  3OHA A;  1QSS A;  2A19 A;  5L9X A;  1JN3 A;  4RNM A;  3AQE A;  5J2E A;  5KFP A;  4O3M A;  9ICR A;  2ZG6 A;  3AMZ A;  1ZQP A;  3RJK A;  9ICP A;  2IOF K;  2MA1 A;  4QZH A;  1U48 A;  1D9F A;  3C1Y A;  2ZTE A;  3ED5 A;  3AL0 B;  4OO1 J;  4RNN A;  2QKQ A;  1XO0 A;  5KFT A;  4F5N A;  3HIL A;  1X9X A;  1SV0 C;  2NO4 A;  4B9V A;  4ED2 A;  2MUT A;  3EPI A;  1JI7 A;  4QZF A;  3EPG A;  3H4B A;  4QZ8 A;  9ICJ A;  5KFK A;  1O08 A;  2JEF A;  4Y2Q A;  4ECZ A;  4I28 A;  3ETR A;  1KW4 A;  3CNH A;  2ZIV B;  4P4P A;  4PHE A;  1WG8 A;  1FO4 A;  1ZQY A;  5KFQ A;  3QZ8 A;  3GII A;  1KSP A;  3NAS A;  4GC6 A;  3NGD A;  5EE3 A;  3RB6 A;  4F50 A;  2YB1 A;  4CF4 A;  3C23 A;  2HSZ A;  2QAR A;  3EYZ A;  3PY8 A;  4YVZ A;  7ICF A;  1PUZ A;  5AI0 A;  7ICN A;  4X5V A;  2FI1 A;  3KTQ A;  5KAF U;  2AGO A;  5KG4 A;  3KHG A;  4YR3 A;  5HNK A;  1N2X A;  5AKX A;  2G06 A;  5KG0 A;  2ZTD A;  5D4B A;  1YT3 A;  3OPX A;  1PK1 B;  1LKY A;  3E58 A;  1Z1B A;  2LM1 A;  4CE6 A;  1JUD A;  3VCB A;  2C2R A;  5EOZ A;  2GWS A;  7ICP A;  5J2A A;  1KN5 A;  2Y9U A;  4M9L A;  2EAM A;  4U6P A;  5ALS A;  3HPO A;  4EYI B;  3HW8 A;  3TAQ A;  2AQ0 A;  5EWE A;  2WF7 A;  1N61 A;  1BGX T;  3H40 A;  3GFK B;  3C28 A;  4I27 A;  2E3T A;  1TK5 A;  4Y2S A;  2JZB A;  7ICT A;  4C7Y A;  2C2D A;  4P0Q A;  1H38 A;  4F72 A;  2HHX A;  4RQ6 A;  2PFO A;  4YFK A;  2D6F C;  2Y0S F;  3RJE A;  5C5J A;  1MQ3 A;  4IQV A;  2K4H A;  2F44 A;  2YMP A;  4K4G A;  4YG2 A;  2ZIU B;  4FS1 A;  2ISP A;  1L7P A;  2J6T A;  2KSO B;  5K4L A;  1ED1 A;  2DWQ A;  4YR2 A;  1SWW A;  3ZI4 A;  2ESE A;  9ICS A;  2W54 A;  3WKA A;  2ZIW A;  4DO9 A;  4AP9 A;  1L7O A;  3J81 j;  2CRX A;  2ZUC A;  1NJY A;  2H3Q A;  1WCN A;  5DB8 A;  3JPR A;  1NK7 A;  4P2H A;  2PFP A;  3LYS A;  1S0N A;  2WF9 A;  1F44 A;  4CCH A;  4US9 A;  1L8O A;  4C8O A;  1C20 A;  1V38 A;  3H0L B;  3AU6 A;  2LKY A;  3D2N A;  5KFH A;  5AI9 A;  4XRH A;  5AKY A;  5DQI A;  3G6X A;  2F1H A;  4DF4 A;  3M6Z A;  3L5K A;  4ED7 A;  4KLL A;  4J9M A;  3F5A A;  4F3O A;  1D8Y A;  4R64 A;  4Z6D A;  2XIC A;  4ECW A;  4TQR A;  2R8J A;  5CHG A;  1Q3U A;  4QW8 A;  3SV3 A;  5J2C A;  4P4M A;  2KIV A;  4DFD A;  4UAY A;  4R63 A;  4J9S A;  3KFU F;  5J0Y A;  2K4E A;  2H3V A;  4BWM A;  1CUK A;  2HW3 A;  1ZQU A;  3PSF A;  5C0Y A;  5L1K A;  1LVH A;  5KT4 A;  3WK7 A;  5KFC A;  7ICV A;  4EEN A;  4F4X A;  3GDX A;  5HR7 A;  4Q8F A;  3LDA A;  4I2A A;  2W8L A;  5L1M A;  3JPT A;  4GXK A;  3GV8 B;  4DFK A;  4J9L A;  3PVX A;  5F9N A;  2KFN A;  5AM5 A;  2XCP A;  2YMM A;  3UQ2 A;  1SV0 A;  4BXO A;  3A0H U;  3L3F X;  1XS9 D;  4Z6F A;  2ISO A;  1JXL A;  2BR0 A;  1B4F A;  3KZI U;  3LWM A;  4Y2Y A;  3AN1 A;  3RH6 A;  4QWE A;  5KT6 A;  5J0W A;  1SKW A;  2N1R A;  2C22 A;  5KFB A;  4O3Q A;  1NKC A;  4RQ1 A;  5D46 A;  3Q8L A;  4B9S A;  2MUT B;  2LBO A;  3C5F A;  4KMU A;  4J9K A;  2IHN A;  3IM1 A;  3TAR A;  2HVI A;  4KLH A;  1KFT A;  4FO6 A;  1NZP A;  1A76 A;  4NV0 A;  2FLN A;  4J9P A;  4E0D A;  2RLT A;  1F5S A;  1S10 A;  1L7N A;  1NK6 A;  1Z19 A;  4J9O A;  3OTQ A;  5AK5 A;  2JGA A;  2W9C A;  4C8K A;  3T5J A;  3MR6 A;  4YD2 A;  5J2F A;  5KG2 A;  4EEY A;  4JV2 A;  1N5W A;  4M9H A;  3PO5 A;  5J2I A;  2QAR B;  3QX7 A;  4Q45 A;  1VLB A;  2W9B A;  3ETL A;  2K4P A;  2V9W A;  3WK6 A;  2DL0 A;  4OD0 A;  4DOC A;  1KFD A;  1ZRM A;  3QU4 A;  4M9G A;  4B9L A;  2I6X A;  1RYR A;  2BCV A;  1LKY B;  4RPZ A;  1COK A;  1T7P A;  1JRP A;  2MU2 A;  7ICR A;  4DL7 A;  4EX6 A;  4YMO A;  3SEN A;  2PMZ C;  2AXT U;  1L3S A;  1N60 A;  4UB2 A;  7ICL A;  5ALI A;  4DSE A;  4IQW A;  2EQY A;  2Y9T A;  2DGZ A;  1BPB A;  4M2Y A;  9ICG A;  4QWA A;  1COO A;  2NRV A;  2WTF A;  2ALZ A;  2AGP A;  2JZB B;  2P66 A;  4RPX A;  2NV3 A;  4P0Q B;  1Y88 A;  2YB4 A;  4NJ8 A;  3D2S A;  4GXJ A;  4UQG A;  1N5X A;  4EEL A;  2D8C A;  1PVR A;  4RQM A;  1ZQN A;  1IM4 A;  2A1A A;  3KOO A;  9ICB A;  1X40 A;  4I2H A;  2QB1 A;  1TE2 A;  5DBC A;  5BOM A;  2H3Z A;  4J03 A;  5KG7 A;  4Y2J A;  1S9F A;  1QTM A;  8ICR A;  7ICU A;  5ALK A;  5ALW A;  4NLB A;  4RQ4 A;  1RDF A;  5IIL A;  1RYU A;  1N48 A;  3UXN A;  2E8N A;  3IHQ B;  2ZIW B;  2A3V A;  4RU9 A;  7ICO A;  8ICU A;  1XU4 A;  4QWB A;  3PMN A;  2OXO A;  1N56 A;  5ALR A;  4PH5 A;  3NVY A;  4C4T A;  2BCU A;  3EW9 A;  2KIC A;  2HOI A;  4KLQ A;  1KL9 A;  1L7M A;  5ALD A;  5ALJ A;  1UQV A;  3C2L A;  4DS4 A;  4I2J A;  5KG5 A;  2FDR A;  1XSN A;  3M9O B;  4C4S A;  3Q8S B;  4DF8 A;  5GTH U;  1NNL A;  2F8L A;  8ICX A;  2V4R A;  4EBC A;  5J0T A;  3ONN A;  5KL8 B;  4J9N A;  2BDU A;  1SIJ A;  7ICS A;  2RRD A;  3HKZ C;  1ZQ1 C;  5KFZ A;  4HYK A;  2KJ8 A;  2WF5 A;  2JEG A;  4MFA A;  3RF9 A;  4ZH4 A;  4YD1 A;  4DQS A;  1ZQH A;  2PI5 A;  4JMU A;  3SQI A;  3C1Z A;  4UB4 A;  1BPD A;  2E1E A;  8ICS A;  4KMO B;  4KTQ A;  4R8U A;  1DGS A;  3GV5 B;  3NVZ A;  1BPZ A;  3TAD C;  2LM4 A;  1ZD2 P;  5KFV A;  5AKI A;  4DQI A;  1B0X A;  2C2E A;  3PO4 A;  5KFW A;  3SAH A;  1PZN A;  1KFS A;  3N7S C;  2E5S A;  3PV8 A;  1OW5 A;  1BNO A;  2KOB A;  3CW2 C;  3KKA C;  4RNO A;  1TAM A;  2EZZ A;  2W3R A;  1DK2 A;  2KEY A;  4IC9 A;  3RB4 A;  2YMQ A;  2B0C A;  3DV9 A;  1FFU A;  3G6Y A;  3I28 A;  4BXO B;  2JH7 A;  4F4Z A;  2HDO A;  3VC8 A;  4Y2R A;  1ZQR A;  3GZF A;  2ODG A;  3WKE A;  1QQ5 A;  3Q8M A;  2FPK A;  4NLZ A;  2HCF A;  5J0Q A;  4ECU A;  3AEV A;  3IDW A;  2PI4 A;  2AQ4 A;  2VIX A;  3UM9 A;  1RZT A;  5KL1 B;  4J9R A;  2PFQ A;  4UBB A;  4FZM A;  5AI6 A;  2VA3 A;  4DSF A;  4NM1 A;  4K4H A;  4G9B A;  4JWM A;  2NYV A;  4CDG A;  3UPQ A;  5JRT A;  4F5O A;  4BWJ A;  1ZQM A;  4I2G A;  1X9M A;  2W9A A;  3E0F A;  4QZC A;  4Y2U A;  5ALE A;  4DQP A;  2ASJ A;  2LYB A;  5DGA A;  1ZQJ A;  1NJW A;  2IOH A;  2KJ5 A;  3MR3 A;  2W9C B;  2JXJ A;  4BUG A;  4KX5 A;  3ALR A;  4Q44 A;  4ECS A;  4RQ5 A;  3Q8Q B;  4C80 A;  2W9B B;  4IS7 A;  2G07 A;  3FYH A;  1BPX A;  2MSN A;  4B9M A;  2KIW A;  4ECY A;  5DLF A;  2G5H B;  4G3I A;  1Q8K A;  4KN7 A;  3PST A;  2G09 A;  3WKC A;  3TI0 A;  2J6U A;  4ED0 A;  1U4B A;  1JAL A;  4TUR A;  4XA5 A;  4KLS A;  1BNP A;  4RPY A;  4AYB C;  3N97 B;  3G6V A;  2EZX A;  2E8M A;  1Q3V A;  3PSP A;  1T8E A;  3C2K A;  4WJ3 B;  3B0Y A;  4DSK A;  5BPC A;  5KFJ A;  3AM9 A;  4DLG A;  3PW0 A;  2I9G A;  2F3N A;  2CN1 A;  3BZK A;  5AKZ A;  4C8M A;  4O3O A;  3KZX A;  2XID A;  3TFS A;  2NRZ A;  5AM3 A;  4DFP A;  5IIJ A;  4KIT B;  1ZQT A;  4IRD A;  4Z6E A;  2BZF A;  3BQ1 A;  1ZJN A;  1ZQE A;  3BQT A;  2PKE A;  3GIM A;  1MC8 A;  1TAU A;  1X2I A;  4KLF A;  3ISD A;  4QJF B;  3C29 A;  4JB3 A;  4QZD A;  2UVR A;  1RXW A;  2L5Y A;  5L1L A;  2KE7 A;  3M8S A;  3M7D A;  2HHQ A;  4QNL A;  1K1S A;  1SB3 C;  4J9Q A;  4JUZ A;  5J2J A;  1TV9 A;  1FIQ A;  1XWL A;  3LK9 A;  3F2D A;  5DQG A;  4FZN A;  1ZD4 A;  5AI4 A;  2JR5 A;  2KN7 A;  1EXN A;  4RQ8 A;  3WU2 U;  5KTQ A;  5DB7 A;  3TFR A;  1A77 A;  1D9D A;  4UBC A;  3MDC A;  4UAU A;  2W04 A;  4NL9 C;  1SV4 A;  4PJ0 U;  2OWO A;  4U7C A;  2OYY A;  4O3N A;  1J2M A;  4B9T A;  2ATL A;  3RB0 A;  2XVT A;  5G5H A;  4JK1 A;  3TAN A;  2ZIX A;  1SL2 A;  5AM4 A;  1S97 A;  1A0P A;  2YY6 A;  4CGZ A;  1SGG A;  3PW4 A;  4IRC A;  3N7P D;  2LYH A;  2YN4 A;  5EWF A;  4TUS A;  4QIW F;  4BJQ A;  4GLX A;  2ASD A;  2KHV A;  3PZP A;  3TAD A;  3DEE A;  1ZD5 A;  8ICB A;  3IG5 A;  9ICN A;  1LB2 B;  5TIS U;  4DSL A;  1ZRN A;  4DQQ A;  1WCL A;  5ALG A;  3KKA A;  2KZZ A;  8ICQ A;  3HP6 A;  2BKE A;  1RQL A;  4R8U B;  4ED8 A;  2KTQ A;  5B5E U;  1S76 D;  7ICQ A;  2MRL A;  3IP4 B;  2FMP A;  3OSN A;  1TVA A;  1ZQQ A;  2EH9 A;  2W7P A;  2HOQ A;  4DFM A;  1NK0 A;  3QUQ A;  3BJY A;  4F8R A;  2CXY A;  2E8P A;  3ZD9 A;  3MDA A;  3T5K A;  9ICW A;  4QZI A;  4MFC A;  5III A;  1SKR A;  3WKD A;  8ICH A;  3RRG A;  2IMW P;  4ECV A;  1ECW A;  3MGV A;  2BCS A;  2MAX A;  3GIJ A;  5KFI A;  4F71 A;  2GO7 A;  2WB1 C;  4NM2 A;  2EDU A;  2P35 A;  3KBB A;  4MEX A;  1UHU A;  4MEY A;  3ZD8 A;  1L6N A;  5EE9 A;  4RQ0 A;  8ICF A;  3RH5 A;  1JRO A;  1K5O A;  1B43 A;  3ZDB A;  1NK9 A;  2JMG A;  1SZH A;  2HMX A;  2XGP A;  5AM1 A;  1UT5 A;  5AK3 A;  3PW2 A;  5F3X B;  2XY6 A;  4YCX A;  2R18 A;  4KLD A;  4ED6 A;  5J2G A;  5L1I A;  4EBE A;  1M6Y A;  3H4D A;  1KKX A;  2AH5 A;  4NY8 A;  2K60 A;  1B22 A;  2IA6 A;  4C7Z A;  4DEZ A;  3MBY A;  1L8L A;  1CRX A;  4PZO A;  2R8I A;  5J29 A;  2JEI A;  4DOA A;  1KBU A;  1RYS A;  5KFA A;  2ZXH A;  2BDP A;  1RG6 A;  3BQ7 A;  3OHB A;  2RDI A;  5KFO A;  2WAQ F;  3PML A;  1ZQD A;  4DQR A;  3BS7 A;  5HML A;  1MN8 A;  1QSL A;  4I2E A;  1NJX A;  1ZQG A;  5DLG A;  3QZ7 A;  2Y0S C;  3NS1 A;  1X9W A;  3WKB A;  5AKG A;  1L3U A;  4ED1 A;  4O3S A;  5DDM A;  2H3I A;  2HHT A;  4DOB A;  4K4I A;  2IOF A;  2AU0 A;  4ICA A;  5IIO A;  3LVV A;  3WK9 A;  9ICI A;  4ZOH C;  3QEA Z;  5KNI A;  3ZDE A;  2I1Q A;  1NKE A;  2AHO B;  5KFY A;  1TK8 A;  2W9M A;  2V4Q A;  2AJQ A;  4I2C A;  2KK0 A;  1Z4N A;  2BPG A;  3BZC A;  2VAN A;  1HIW A;  1L3V A;  2EZY A;  2K8C B;  1CEZ A;  3TAC B;  4IQT A;  3H7I A;  9ICE A;  1QCK A;  3JPO A;  2W7O A;  1YZ7 A;  1UPH A;  4ECR A;  4Y2T A;  5JTI A;  3QU2 A;  3QU7 A;  3H0R B;  3F53 A;  2I5H A;  4NL9 A;  4NXZ A;  9ICO A;  3RR8 A;  1Q46 A;  5KFG A;  5AKH A;  3THV A; 
#chains in the Genus database with same CATH homology
 1KQQ A;  1KKX A;  1RYU A;  5CEH A;  1KN5 A;  2EQY A;  5K4L A;  2RQ5 A;  1IG6 A;  4LJX A;  2LI6 A;  2EH9 A;  1C20 A;  2JXJ A;  2CXY A;  2KK0 A;  2LM1 A;  2OEH A;  2YQE A;  2JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...