4LJXA

Crystal structure of an at-rich interactive domain-containing protein 3a (arid3a) from homo sapiens at 2.21 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
122
structure length
122
Chain Sequence
WTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords AT-rich interactive domain-containing protein 3A
publication title Crystal structure of an AT-rich interactive domain-containing protein 3A (ARID3A) from Homo sapiens at 2.21 A resolution
rcsb
source organism Homo sapiens
total genus 36
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 4ljxA00
2EQYA 2EH9A 2JRZA 5CEHA 2LI6A 2RQ5A 2JXJA 1KN5A 2CXYA 2YQEA 2OEHA 1RYUA 1KQQA 1C20A 2KK0A 2LM1A 4LJXA 1IG6A 5K4LA 1KKXA
chains in the Genus database with same CATH superfamily
4BGDA 5HNKA 5CEHA 4FFDA 2HHVA 2ZIVB 2JZBA 5AKKA 3CRXA 5HMLA 4O3SA 4QW9A 3BDPA 3AEVA 1HEKA 4CDGA 3RBEA 2KE7A 2KJ8A 3G6XA 1T94A 1UCVA 3BQ1A 2XY5A 3GU3A 4Q8EA 4DSKA 1KFTA 4K4IA 4KTQA 2MA1A 2KOBA 2HHWA 2R8IA 3QUCA 1M6YA 1ZQRA 5AK3A 5KFOA 4NLCA 4F50A 5AI8A 4EEYA 2KKPA 5ALEA 2F8LA 3M6ZA 3ISCA 1JALA 1ZQBA 4ZOHC 1PVRA 4PGYA 2M9NA 5AKLA 4F91B 5J0PA 2ZJAA 3M6KA 3ETLA 5CWRA 2JXJA 1SGGA 4XUSA 4ZH4A 3Q8MA 4O5CA 4F3OA 4GIBA 4FBTA 3H0MB 3MDAA 2AGPA 1S97A 2ISOA 4DQPA 4B9LA 4K4HA 3GQCA 5TZVA 1KL9A 4FS1A 2MSNA 4E0DA 3NTUA 1ZJNA 5L9XA 5L1KA 1DRGA 1TAUA 1O03A 1Z1BA 3VCBA 5GTIU 3UM9A 4PZOA 1RXWA 2EAOA 4KMOB 5ALZA 2HMXA 2R8HA 1ZQUA 5CHGA 3OHBA 1PK3A 2FJ6A 1IIPA 3NUQA 4DCCA 3H4DA 5EE0A 1JRPA 3PO4A 3BS5B 2F44A 2G09A 2C2RA 2F77X 3FC4A 4QWBA 2PFNA 2KTQA 1K1QA 3OPXA 3EZ5A 4YMNA 2FLLA 4NLBA 4IQUA 5KFXA 3KHLA 1A76A 2AQ4A 3Q8LA 5AK4A 4QZFA 1TAQA 2JEGA 4EZ9A 2K8BB 1NK6A 2NO5A 7ICFA 5KL8B 3RAXA 5AM2A 5KTQA 1BVSA 3PV8A 2KZ3A 4FZLA 4EX6A 3V6KA 1RDFA 5GTHU 3ISDA 4TUPA 3D2SA 3KHGA 2ZIWA 2KN7A 2XGPA 1SWWA 1U4BA 4R65A 2W9CB 2I6XA 2FDRA 3F2CA 1L3SA 1X9XA 2E8OA 2W7OA 4JK1A 3PVXA 3JPRA 1L5UA 4QWDA 1ZQNA 1XSPA 1Z3EB 2WTFA 4QZDA 4RQNA 2KEYA 1MN8A 4GXIA 4Q43A 2KFNA 1F44A 3V6HA 7ICHA 1Q46A 2YB1A 5HHHA 1NJYA 7ICEA 3T5HA 1ZQWA 4C8KA 2IMWP 4RQ2A 1N61A 2NV3A 1ZQDA 5KFVA 3IHQB 3SENA 3HT3A 3J81j 4Y2RA 3FAHA 1NK7A 4F5RA 1NJWA 1N60A 4IR1A 2W03A 3HJEA 4Y2SA 3IG8A 4KITB 4Y2YA 4ECRA 2PI4A 1WYGA 1A77A 1ZQPA 1JUDA 3RJFA 3WK4A 2LM1A 4UAUA 2K4EA 4I27A 4I2HA 2WAQF 4KLUA 3N7SC 1NK4A 4DSJA 3LWMA 4QWAA 1SL2A 4YVZA 7ICSA 3QZ7A 1OUQA 2HBMA 5JUMA 5C5JA 1D8LA 2FE9A 5H2FU 1ZD4A 2DUYA 3OGUA 3IM1A 4ECTA 2ZJ5A 4I2AA 2RDIA 4YMOA 4DSIA 5DGBA 4KN7A 4O3NA 3SAFA 4RQ5A 4OD0A 1S0MA 1VDVA 4BJQA 4DL4A 2FMPA 7ICUA 2H3IA 4F4KA 3TARA 4M9JA 3UQ0A 3E2EA 1YZ7A 3K1ZA 5J2FA 4CGZA 5IILA 2WAQC 1HJPA 3AN1A 1ZQHA 3N7PD 5DLFA 4O3MA 3ISBA 4J9SA 8ICCA 3TAPA 5AKZA 3WK9A 4KLHA 3RB4A 4KLQA 4EBCA 2PKEA 2HBJA 4EYHB 1UPHA 5ALMA 2OEHA 4F4WA 4NM1A 1ED1A 3V7LA 3WKEA 4O0IA 2P35A 2CN1A 2HBKA 4MEYA 4DSEA 5EWFA 1BNOA 2ZG6A 2Y1IA 3UMBA 1DGSA 2H3ZA 1XWLA 4DQSA 1WCNA 4QZ9A 2HOFA 1UQVA 1ZJMA 3CYMA 1JX4A 3JPNA 2JH1A 1NKBA 4ED6A 2BDPA 4Q44A 4C0ZA 4U7CA 2HHTA 2JGAA 1L7PA 2VA2A 7ICOA 8ICFA 1SWVA 4PHPA 1OW5A 2EZYA 1WWUA 2KHQA 1AROP 3C2KA 2PFPA 1X9SA 5G5GA 5IINA 3QU9A 5KFSA 3DDHA 4RPYA 3ONNA 1IG6A 4QZBA 2RDJA 3QEAZ 3C1ZA 2IBKA 3QUTA 2A19A 1DXSA 2BCQA 5J0SA 2VIXA 2XY7A 5J2EA 2KG5A 1TKDA 2W9BA 3IP4B 2XY6A 3JPSA 5IIOA 4M6WA 3ICXA 4R63A 1ECWA 5ALFA 4PHDA 5AM5A 1BPXA 1FEZA 2W9BB 1KSPA 3SAGA 8ICZA 2DFLA 2WF5A 2A1JB 4M6WB 2LM4A 4RQ4A 2LI6A 4TQRA 4OJLA 5E79U 1CRXA 4QZAA 3KKAC 1TK5A 3QU5A 8ICOA 3BJYA 3DEEA 2ZIUB 4IS7A 9ICVA 4KLLA 4KN4A 2YMQA 2QB1A 1C20A 5KFPA 2BCSA 2E8MA 2YMLA 1NK0A 1NI3A 3QU4A 3PX4A 1BPBA 1KKXA 5A0LA 3PZPA 4IL6U 3KZXA 2WFAA 2JEJA 9ICJA 7ICPA 4DFKA 2FLNA 2NRZA 5KFGA 3OJSA 3OTQA 1KDHA 4I29A 3MFIA 3MABA 3PX0A 4XQ8A 1NK9A 1TFRA 1X2IA 2HOQA 5AIBA 4I2DA 1VLBA 8ICAA 4CF5A 2NRXA 4NM2A 3NGDA 8ICQA 4F4ZA 2B6GA 1ZQVA 2G07A 3ZD9A 4C7ZA 4MF2A 3QU2A 4CRXA 5EE3A 3UPQA 4ECQA 2QARB 3A0BU 4DL6A 3RB0A 1X9MA 5KG0A 2K4IA 2DL0A 2HI0A 2NRWA 3KD3A 4US8A 2C22A 1XNSA 3N7RC 5KFDA 2B21A 9ICTA 4I2EA 1XC9A 4UATA 3UQ2A 7ICMA 2W54A 5AKGA 9ICQA 3AQEA 3B0YA 1U47A 4UB5A 3C23A 5J0XA 2BQUA 3H8SA 2PI5A 5BOLA 1ZQQA 2AHOB 8ICKA 3M9NB 4NL9C 4P0PA 5CRXA 2W9AA 4KLEA 2N1RA 2F2AB 3SD7A 4NXZA 4YP3A 1X40A 4EZ6A 5ALTA 3HILA 1EXNA 2KV2A 5KFHA 1U45A 2KVSA 1LKYB 4RU9A 1SZPA 5J2DA 8ICLA 4RUCA 1XSNA 3THVA 1T3NA 4Z6CA 2JMGA 5D46A 2VKQA 4F4XA 5KFNA 2BCVA 4EBEA 5T14A 3RJKA 1SV4A 8ICMA 9ICFA 3NRZA 4NY8A 4UASA 1RXVA 5AICA 1Z4OA 4DFMA 3SI8A 3Q8RB 2UVWA 1T7PA 3DV9A 7ICGA 4R66A 1L3UA 1FIQA 3G6YA 1T4GA 3PW7A 3PSTA 5KG4A 4NLKA 2F1HA 1SB3C 2FMSA 1ZQSA 3ZDDA 2JZBB 4QZHA 2F1IA 2HW3A 1S0OA 2YB4A 3EWAA 2DWQA 2LBOA 2R8JA 4BDPA 5ALRA 2I1QA 4GXKA 3QUQA 4Z6EA 3EUB2 5KAFU 1Z00A 4LZGA 1KFDA 8ICPA 4QZCA 1D8BA 3RJHA 4P2HA 4G3IA 3M1YA 2E5SA 2C28A 1ZOLA 3RH6A 1SKSA 4QWEA 4O3PA 1RG6A 1Z00B 4KMUA 4RQ6A 3HP6A 2MAXA 4YD1A 2YN4A 1Q3UA 3HKZF 2D8CA 3T5KA 4MEXA 4J9MA 3HX0A 5KG7A 4B9TA 2HHXA 3RH4A 2FPKA 5KFFA 3H8WA 3QEBZ 3SQIA 2Y1JA 1UA1A 5CP2A 1DK2A 2ZTCA 2IOFK 2Y9TA 8ICXA 3K4GA 1NOMA 3ZDBA 2DKZA 4O3QA 1LB2B 4UAWA 3JPQA 2DKXA 3QYPA 1S8OA 1X42A 4JUZA 2WF7A 3RRHA 3HKZC 2Q0ZX 3KFUF 3UMGA 2R8GA 1DOQA 9ICHA 3AM9A 4YG2A 4UB4A 1N63A 5ALPA 1S0NA 2FLPA 5DQHA 4F5NA 2K60A 3IRUA 4M9GA 1WUDA 5AI4A 2NRTA 1J97A 1F0MA 8ICHA 3TKAA 9ICWA 3SV4A 1TAMA 5DB9A 3D2QA 4ACOA 1PZNA 3GZFA 1TVAA 1RQNA 5DDMA 7ICVA 5B5EU 4USAA 1QQ5A 3PW4A 1NJXA 2KP7A 4Y2JA 3F2DA 4LZDA 2ZIXA 2R8KA 1S0VA 3WK6A 3N28A 1T8EA 2CXYA 3PSFA 4KLTA 3LWLA 3C1YA 3MDCA 8ICWA 5ALNA 8ICSA 1XO1A 1SV0C 4P4OA 4UB6U 3HRDD 2P66A 2ZIWB 2KMDA 3QXGA 5AKXA 5KT3A 1JXEA 1XU4A 4EELA 2JRZA 1SXDA 3TADC 5KFEA 3WK8A 5KFKA 3C2LA 4RNNA 9ICRA 2I9GA 8ICJA 5CR0A 1V85A 3A0HU 3NS1A 1S5LU 4F93B 1QCKA 3KHRA 4FS2A 1QTMA 3K1RB 4BXOA 3IG5A 2XO7A 3SEIA 2V4QA 4FBUA 4RNOA 3LK9A 4DL2A 4ECUA 5DBAA 1JROA 3ETRA 1X9WA 4ELUA 3NVWA 4Q8FA 4BXOB 4JV0A 3CP8A 4GLXA 5KT5A 2XICA 3GV8B 2KK0A 3GILA 1N5WA 4DOBA 2ZUDA 3RRGA 4ECVA 4PGQA 4EX7A 4C8NA 3S6JA 1WWVA 2BPCA 1P7DA 3CNHA 4UAVA 3I1YA 5ALUA 3WK5A 4F5OA 5F3XB 4DF8A 7ICQA 2OWOA 1ZQYA 2PFOA 3FYHA 3MGVA 5J2JA 4YN4A 5KFCA 5DGAA 1L7MA 3G6VA 3QU7A 4Q45A 3LDAA 3RR8A 4AYBF 4EYIB 2V4RA 2G06A 1D9FA 2MUTA 2OH2A 5AI6A 2K8AA 2H3QA 4YXJA 2UVVA 4BWJA 5AK5A 1FO4A 2DPIA 4KLSA 4C4SA 5AKHA 1LV5A 4KLJA 2HVIA 2HBLA 2HHSA 1N5XA 4C8OA 1UHUA 4PGXA 2P6RA 4KLGA 2DGZA 1QSSA 1B22A 2B0CA 2BPGA 3H0LB 2W7PA 3F53A 4IRDA 1JMSA 2ALZA 5KT6A 4DQQA 3KKAA 4UBCA 2AQ0A 5L1MA 2G08A 3H8JA 4JB3A 2JEFA 4U6PA 4AYBC 5AM1A 4I2JA 3EYZA 4Y2UA 4EENA 1ZD3A 2AGQA 3RB3A 5KT7A 3Q8PB 2RQ5A 8ICRA 1K5OA 1ZQMA 5B66U 2AH5A 4ED1A 3PY8A 4R8UA 2G5HB 5DKWA 1MA7A 3KHHA 8ICUA 2E1FA 4QZIA 2FMQA 1PK1A 1L8LA 2HDOA 1ZQAA 3SV3A 5DG7A 2D3DA 2F76X 7ICIA 2VA8A 5J0TA 2AU0A 4US9A 5KFIA 2BZFA 3ZI4A 1Z19A 1Z4NA 9ICPA 2W3RA 1ZQKA 3D2NA 5DG9A 2L5YA 1RM6C 2PFQA 2ZXHA 3F5AA 2E8NA 4IQTA 3C29A 3O0FA 9ICBA 9ICNA 3EW9A 2NO4A 2ZUCA 2ESEA 1NNLA 2KFZA 3RH5A 4YXMA 4B9SA 1XO0A 2KSOA 3PR5B 3AL0B 3PX6A 3SR6A 1F5SA 2ASDA 4RZRA 1ZQEA 2E1EA 3B9JA 4UAZA 4DLEA 9ICAA 4DQIA 5L1IA 1QLNA 4P0QA 2LYAA 4RQ3A 2RLTA 2YY6A 5DQGA 2AGOA 3T3FA 4J9QA 3IDWA 3GIJA 4NL9A 1ZQIA 4Z6DA 3LVWA 4RT2A 4P4PA 3HPOA 1T3QA 2BQRA 3E0FA 2CRXA 2A3VA 1ZQZA 1COKA 4DFJA 5F9LA 2WHEA 2XCAA 5IIIA 4J9RA 4GFJA 5ALWA 4DF4A 5F9NA 4FO6A 5L1JA 4NJ8A 1BPZA 1NKEA 5AKEA 1BPYA 1X6IA 1BPDA 3TAQA 4FZMA 2Y9UA 1YT3A 2W3SA 1ZXIA 2XC9A 5KFLA 4J9NA 4C80A 9ICXA 2LYHA 4YMMA 9ICCA 4OJPA 4QJFB 1ZD2P 4EBDA 2ZTEA 2J6SA 3OSNA 2A1AA 3PW2A 3TI0A 8ICIA 1NK5A 3PR4A 3L5KA 1L8OA 4EEKA 1J2MA 5KFRA 5EWEA 2WF6A 3PMNA 8ICNA 3OHAA 4OJ5A 2KJ9A 4RPZA 2FPLA 5AM0A 2Q4TA 4O3OA 1AQ6A 3V6JA 5FP0A 4JWNA 5AK6A 5J29A 7ICKA 2VJ5A 3FM9A 1ZQGA 5ALHA 4BX9C 1QSYA 4M0AA 3TFSA 4DOAA 1LVHA 4YR3A 3ALRA 4Y2PA 1TE2A 2LKYA 3SMVA 1DGJA 2IHMA 4DL3A 4ECZA 3KBBA 4UB2A 5KG2A 1BNPA 5KFMA 1NKCA 1KRPA 1ZQ1C 4RPXA 2R18A 3RFAA 5BOMA 2BCRA 3ED5A 5KG5A 4P0PB 3I28A 5DB6A 1ZQTA 3M9MB 2EH9A 5TISU 1L7NA 1K1SA 1IV8A 2DF4B 4DQRA 2KZMA 2YTUA 2HOIA 1XSLA 2I5HA 5HP4A 1WG8A 4I2CA 4YFKA 5AHXA 3F2BA 2XIDA 1VJ5A 2ATLA 2EANA 5DLGA 2BPFA 2F8KA 3V7JA 5BPCA 3GV5B 3JPPA 2QB0A 4CF3A 5J0YA 4MF8A 4DS5A 3N4MB 5ALJA 4J9LA 5AI5A 1YZ6A 3C2MA 1KW4A 2ZIVA 4ED8A 5EE9A 1J2NA 3NVYA 2HCFA 4YR0A 3GIIA 4DSLA 2JHDA 5KFWA 5KT2A 1C7YA 3MR2A 4K4GA 4QZ8A 3E58A 3HWTA 4M9LA 4CF4A 3MR3A 3M7DA 1D9DA 3H0RB 2G5IB 4HYKA 1Z1VA 1OXJA 2ZJ8A 5JU5A 3BZKA 4OCZA 2EZXA 1HUOA 2J6UA 5KFJA 2UVRA 4UB3A 4FZNA 2AJQA 2V9WA 1COOA 3QNMA 4O5EA 2OYYA 2C2EA 2HHUA 3UXPA 3WKDA 3QE9Y 1B4FA 1X6JA 5KL1B 1Q8KA 2GLEA 5J8YC 5KT4A 4ECSA 1ZQJA 1FFVA 4FE3A 9ICKA 2RRDA 4JV1A 2LYBA 4KX5A 4ED2A 2O6KA 1JN3A 3D6JA 1QSLA 2YQEA 2F1JA 3ZDCA 1RZTA 3M8RA 1ZQOA 2Y0SF 2LMRA 4MHVA 3QX7A 1JXLA 1SV0A 1L3TA 4UAYA 2EAMA 5CB1A 5DB7A 3RAQA 7ICNA 1UA0A 5IIKA 3ZD8A 2XGQA 3Q8QB 1TV9A 1L6NA 2IOHA 3TADA 4NLZA 3AQFA 8ICBA 2UVUA 1SIJA 4M2YA 3BQ0A 4B9VA 2EDUA 4F5QA 5DBBA 4ED0A 4PH5A 4I2GA 3N97B 1N2XA 2ZUBA 3BS7A 3UXOA 4OJOA 9ICOA 3H40A 1XS9D 1FFUA 2F3NA 4UW9A 1CUKA 2D6FC 4F2SA 9ICUA 2Y0SC 2PMZF 5KFUA 1QQ6A 2JV3A 2NRVA 3BS5A 3RF9A 4DSFA 5ALQA 4YD2A 2G0AA 2HVHA 2QLTA 4MFCA 1L7OA 1IXRA 4I2IA 4CCHA 4A8EA 1SKRA 3GIMA 3M9OB 9ICSA 1NJZA 5J2KA 5G5HA 2VJ4A 4HAIA 8ICTA 2DQNB 5JRTA 4B9UA 3WK7A 3R9KA 4Z6FA 3MR5A 4YCXA 4O3RA 3NRWA 3ORYA 1MC8A 3RTVA 4GC7A 3GFKB 4XA5A 4M04A 4F2RA 2BDUA 2K4PA 4QWCA 3HW8A 4F5PA 2BHNA 2PMZC 2OCEA 4BUGA 2C2DA 3BQ7A 1S10A 5J0WA 4KLDA 4KLFA 4UB8U 2BR0A 4CE6A 4TUSA 3ZDAA 1RYUA 4OJ6A 1S9FA 3L3FX 4B9NA 2WB1F 5AI9A 5AKYA 3C5GA 2FI1A 2K8CB 3H7IA 4J03A 5ALOA 4F92B 2W9CA 2ZIXB 1Y88A 3MGIA 5DBCA 2KNJA 3JPOA 4Y2TA 4RQ7A 4TUQA 5ALXA 2CPRA 4ECYA 4KLOA 2RP5A 4I28A 3U26A 2H5XA 1KQQA 1SL1A 1H38A 1RQLA 4ECXA 1ZRMA 5K4LA 3EPIA 5J2BA 4GC6A 4DWIA 4DS4A 3TANA 4MFAA 1WCLA 4RQ0A 2EAPA 3Q8SB 4RT3A 3NASA 3WKAA 2WF9A 3T79A 5DQIA 2E3TA 2WB1C 3WKCA 4IRKA 1CI4A 9ICLA 4F71A 2KJ5A 4DL7A 1S77D 2YX8A 3F5EA 2W55A 4C7YA 8ICVA 4Y2QA 4PPXA 1IM4A 1KBUA 4RQ1A 3IN5A 2BGWA 4LVSA 4DLGA 4JMUA 4M9NA 1A0PA 3MC1A 2P6UA 1HIWA 2KKVA 2H3VA 4ECWA 4F72A 2XCPA 3TFRA 4IQWA 2OHFA 5KFZA 1V97A 4M47A 2IOFA 2EZZA 5JTIA 3RJGA 4C4TA 2H3FA 5ALSA 3MFHA 2LHTA 1TK0A 7ICRA 4ELVA 3V72A 1RYRA 1NZPA 4UB1A 5AIAA 4C8MA 2GOLA 1KN5A 4UBBA 1ZD5A 2W8KA 2BQ3A 4QNLA 2QKQA 5ALKA 1QQ7A 5J2GA 4PHEA 2W43A 2M0NA 4NWIA 3B0XA 2MUTB 3SZ2A 2EQYA 3OSPA 4XRHA 3H8MA 8ICGA 3C5FA 1HUZA 4UQGA 5CA7A 3M8SA 4PZNA 5J0RA 1NZBA 4TURA 3K75D 5AM4A 2JH7A 3LVVA 5IIJA 1BPEA 2LPEA 4MFFA 3PW0A 1KEJA 4PHAA 4QW8A 3T5LA 3RJIA 4F4YA 9ICMA 5J2AA 2KICA 1SZHA 1ZETA 5J2IA 2GO7A 5J0QA 5KNIA 3TACB 8ICYA 4GXJA 5J2CA 3PMLA 4AP9A 3LYSA 3MBYA 2HSZA 1CEZA 5KFAA 4IQVA 2XVTA 3ZDEA 4OO1J 5CJ7A 1ZQLA 1SKWA 1NK8A 2J6TA 2MRLA 4O5KA 4NLGA 4R8UB 1RPLA 3FDSA 4ICAA 5L1LA 4DFDA 5KG3A 3RBDA 1PUZA 4DOCA 1N62A 1PK1B 2RHFA 2ES6A 4RQ8A 3PSPA 5IIMA 3MGHA 2ZXIA 1MQ2A 4BWMA 3EPGA 3GV7B 9ICEA 1QH9A 5ALLA 5KFYA 5J0UA 4YR2A 2W8LA 4IR9A 3T5JA 4YQWA 3WKBA 2XI9A 2ASLA 4DFPA 5C0YA 7ICTA 2AXTU 1KLNA 2KHVA 1UT5A 5ALGA 2W9MA 4DL5A 4R64A 1JI7A 4LJXA 3RR7A 2K4HA 5D4BA 9ICGA 2WF8A 3SAHA 4IC9A 2ODGA 2KSOB 3AU2A 1KFSA 2FPMA 2KVCA 2VANA 2A1JA 4RQMA 5EE1A 1B43A 2KD1A 2HHQA 3TQ1A 2Z7JA 2JR5A 1MSWD 3RJEA 4PL1A 1ZQXA 4P0QB 2ASJA 2DBYA 4G9BA 2ZIUA 3BQ2A 1PVQA 1S76D 5KFTA 4Y2XA 5KG6A 5KAIU 3RB6A 4NV0A 4P4MA 1U48A 4C4RA 4NLNA 3GDXA 3I76A 5J2HA 3AMZA 2DPJA 4I2BA 4I2FA 5KFQA 4UARA 2ISPA 4QIWF 4DEZA 1Q3VA 1GO3F 3H4BA 2OXOA 9ICIA 4ED7A 3UXNA 3BZCA 1B0XA 4Y2VA 4B6JA 1D8YA 2GWSA 4JV2A 4PL2A 4KX3A 2GH1A 5DDYA 4PJ0U 2KIWA 3NVVA 4QZEA 3JPTA 1ZYQA 1TK8A 3NVZA 1O08A 5KG1A 3RJJA 3V7KA 4X5VA 3BQTA 5AKJA 2KZZA 5ALIA 2JEIA 1V9PA 5ALVA 2VA3A 2QARA 4O9MA 8ICEA 5ALDA 5HMMA 5EOZA 4ELTA 3GIKA 5HHIA 1KTQA 1U49A 3PSIA 1N48A 2K89A 5DB8A 4QIWC 1MQ3A 4B9MA 3WU2U 1N56A 7ICLA 1ZRNA 4M9HA 5AI0A 2E8PA 1ZQFA 2W04A 2NYVA 2PXIA 4F8RA 3VC8A 1U9LA 5D49A 5KFBA 4KLIA 3KTQA 3AUOA 4J9PA 2YMPA 5J8YA 2KIVA 2IHNA 3PNCA 1X66A 5HR7A 3KZIU 1L3VA 1BGXT 3QUBA 1DK3A 3UMCA 4KLMA 5EWGA 2ZTDA 1UT8A 4ED3A 2BCUA 1JIHA 1A6SA 2IA6A 5ALYA 5AM3A 1URJA 3PO5A 3KOOA 4RNMA 2MU2A 7ICJA 3Q8KA 1LKYA 5DG8A 4J9KA 3OJUA 4JWMA 1V38A 3IV6A 1ZQCA 1PVPA 4DO9A 5AKIA 3SYZA 3C21A 3AU6A 4RUAA 5J0OA 4IRCA 4QZGA 3PW5A 2OM6A 5HR6A 4TQSA 3MR6A 4C8LA 2YMMA 3QZ8A 4CNQA 2BKEA 3CW2C 3L4PA 4J9OA 2QB0B 1SXEA 1SL0A 1RYSA 4WJ3B 3C28A 2W11A
chains in the Genus database with same CATH topology
2EQYA 2EH9A 2JRZA 5CEHA 2LI6A 2RQ5A 2JXJA 1KN5A 2CXYA 2YQEA 2OEHA 1RYUA 1KQQA 1C20A 2KK0A 2LM1A 4LJXA 1IG6A 5K4LA 1KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  2EH9 A;  2JRZ A;  5CEH A;  2LI6 A;  2RQ5 A;  2JXJ A;  1KN5 A;  2CXY A;  2YQE A;  2OEH A;  1RYU A;  1KQQ A;  1C20 A;  2KK0 A;  2LM1 A;  4LJX A;  1IG6 A;  5K4L A;  1KKX A; 
#chains in the Genus database with same CATH topology
 4BGD A;  5HNK A;  5CEH A;  4FFD A;  2HHV A;  2ZIV B;  2JZB A;  5AKK A;  3CRX A;  5HML A;  4O3S A;  4QW9 A;  3BDP A;  3AEV A;  1HEK A;  4CDG A;  3RBE A;  2KE7 A;  2KJ8 A;  3G6X A;  1T94 A;  1UCV A;  3BQ1 A;  2XY5 A;  3GU3 A;  4Q8E A;  4DSK A;  1KFT A;  4K4I A;  4KTQ A;  2MA1 A;  2KOB A;  2HHW A;  2R8I A;  3QUC A;  1M6Y A;  1ZQR A;  5AK3 A;  5KFO A;  4NLC A;  4F50 A;  5AI8 A;  4EEY A;  2KKP A;  5ALE A;  2F8L A;  3M6Z A;  3ISC A;  1JAL A;  1ZQB A;  4ZOH C;  1PVR A;  4PGY A;  2M9N A;  5AKL A;  4F91 B;  5J0P A;  2ZJA A;  3M6K A;  3ETL A;  5CWR A;  2JXJ A;  1SGG A;  4XUS A;  4ZH4 A;  3Q8M A;  4O5C A;  4F3O A;  4GIB A;  4FBT A;  3H0M B;  3MDA A;  2AGP A;  1S97 A;  2ISO A;  4DQP A;  4B9L A;  4K4H A;  3GQC A;  5TZV A;  1KL9 A;  4FS1 A;  2MSN A;  4E0D A;  3NTU A;  1ZJN A;  5L9X A;  5L1K A;  1DRG A;  1TAU A;  1O03 A;  1Z1B A;  3VCB A;  5GTI U;  3UM9 A;  4PZO A;  1RXW A;  2EAO A;  4KMO B;  5ALZ A;  2HMX A;  2R8H A;  1ZQU A;  5CHG A;  3OHB A;  1PK3 A;  2FJ6 A;  1IIP A;  3NUQ A;  4DCC A;  3H4D A;  5EE0 A;  1JRP A;  3PO4 A;  3BS5 B;  2F44 A;  2G09 A;  2C2R A;  2F77 X;  3FC4 A;  4QWB A;  2PFN A;  2KTQ A;  1K1Q A;  3OPX A;  3EZ5 A;  4YMN A;  2FLL A;  4NLB A;  4IQU A;  5KFX A;  3KHL A;  1A76 A;  2AQ4 A;  3Q8L A;  5AK4 A;  4QZF A;  1TAQ A;  2JEG A;  4EZ9 A;  2K8B B;  1NK6 A;  2NO5 A;  7ICF A;  5KL8 B;  3RAX A;  5AM2 A;  5KTQ A;  1BVS A;  3PV8 A;  2KZ3 A;  4FZL A;  4EX6 A;  3V6K A;  1RDF A;  5GTH U;  3ISD A;  4TUP A;  3D2S A;  3KHG A;  2ZIW A;  2KN7 A;  2XGP A;  1SWW A;  1U4B A;  4R65 A;  2W9C B;  2I6X A;  2FDR A;  3F2C A;  1L3S A;  1X9X A;  2E8O A;  2W7O A;  4JK1 A;  3PVX A;  3JPR A;  1L5U A;  4QWD A;  1ZQN A;  1XSP A;  1Z3E B;  2WTF A;  4QZD A;  4RQN A;  2KEY A;  1MN8 A;  4GXI A;  4Q43 A;  2KFN A;  1F44 A;  3V6H A;  7ICH A;  1Q46 A;  2YB1 A;  5HHH A;  1NJY A;  7ICE A;  3T5H A;  1ZQW A;  4C8K A;  2IMW P;  4RQ2 A;  1N61 A;  2NV3 A;  1ZQD A;  5KFV A;  3IHQ B;  3SEN A;  3HT3 A;  3J81 j;  4Y2R A;  3FAH A;  1NK7 A;  4F5R A;  1NJW A;  1N60 A;  4IR1 A;  2W03 A;  3HJE A;  4Y2S A;  3IG8 A;  4KIT B;  4Y2Y A;  4ECR A;  2PI4 A;  1WYG A;  1A77 A;  1ZQP A;  1JUD A;  3RJF A;  3WK4 A;  2LM1 A;  4UAU A;  2K4E A;  4I27 A;  4I2H A;  2WAQ F;  4KLU A;  3N7S C;  1NK4 A;  4DSJ A;  3LWM A;  4QWA A;  1SL2 A;  4YVZ A;  7ICS A;  3QZ7 A;  1OUQ A;  2HBM A;  5JUM A;  5C5J A;  1D8L A;  2FE9 A;  5H2F U;  1ZD4 A;  2DUY A;  3OGU A;  3IM1 A;  4ECT A;  2ZJ5 A;  4I2A A;  2RDI A;  4YMO A;  4DSI A;  5DGB A;  4KN7 A;  4O3N A;  3SAF A;  4RQ5 A;  4OD0 A;  1S0M A;  1VDV A;  4BJQ A;  4DL4 A;  2FMP A;  7ICU A;  2H3I A;  4F4K A;  3TAR A;  4M9J A;  3UQ0 A;  3E2E A;  1YZ7 A;  3K1Z A;  5J2F A;  4CGZ A;  5IIL A;  2WAQ C;  1HJP A;  3AN1 A;  1ZQH A;  3N7P D;  5DLF A;  4O3M A;  3ISB A;  4J9S A;  8ICC A;  3TAP A;  5AKZ A;  3WK9 A;  4KLH A;  3RB4 A;  4KLQ A;  4EBC A;  2PKE A;  2HBJ A;  4EYH B;  1UPH A;  5ALM A;  2OEH A;  4F4W A;  4NM1 A;  1ED1 A;  3V7L A;  3WKE A;  4O0I A;  2P35 A;  2CN1 A;  2HBK A;  4MEY A;  4DSE A;  5EWF A;  1BNO A;  2ZG6 A;  2Y1I A;  3UMB A;  1DGS A;  2H3Z A;  1XWL A;  4DQS A;  1WCN A;  4QZ9 A;  2HOF A;  1UQV A;  1ZJM A;  3CYM A;  1JX4 A;  3JPN A;  2JH1 A;  1NKB A;  4ED6 A;  2BDP A;  4Q44 A;  4C0Z A;  4U7C A;  2HHT A;  2JGA A;  1L7P A;  2VA2 A;  7ICO A;  8ICF A;  1SWV A;  4PHP A;  1OW5 A;  2EZY A;  1WWU A;  2KHQ A;  1ARO P;  3C2K A;  2PFP A;  1X9S A;  5G5G A;  5IIN A;  3QU9 A;  5KFS A;  3DDH A;  4RPY A;  3ONN A;  1IG6 A;  4QZB A;  2RDJ A;  3QEA Z;  3C1Z A;  2IBK A;  3QUT A;  2A19 A;  1DXS A;  2BCQ A;  5J0S A;  2VIX A;  2XY7 A;  5J2E A;  2KG5 A;  1TKD A;  2W9B A;  3IP4 B;  2XY6 A;  3JPS A;  5IIO A;  4M6W A;  3ICX A;  4R63 A;  1ECW A;  5ALF A;  4PHD A;  5AM5 A;  1BPX A;  1FEZ A;  2W9B B;  1KSP A;  3SAG A;  8ICZ A;  2DFL A;  2WF5 A;  2A1J B;  4M6W B;  2LM4 A;  4RQ4 A;  2LI6 A;  4TQR A;  4OJL A;  5E79 U;  1CRX A;  4QZA A;  3KKA C;  1TK5 A;  3QU5 A;  8ICO A;  3BJY A;  3DEE A;  2ZIU B;  4IS7 A;  9ICV A;  4KLL A;  4KN4 A;  2YMQ A;  2QB1 A;  1C20 A;  5KFP A;  2BCS A;  2E8M A;  2YML A;  1NK0 A;  1NI3 A;  3QU4 A;  3PX4 A;  1BPB A;  1KKX A;  5A0L A;  3PZP A;  4IL6 U;  3KZX A;  2WFA A;  2JEJ A;  9ICJ A;  7ICP A;  4DFK A;  2FLN A;  2NRZ A;  5KFG A;  3OJS A;  3OTQ A;  1KDH A;  4I29 A;  3MFI A;  3MAB A;  3PX0 A;  4XQ8 A;  1NK9 A;  1TFR A;  1X2I A;  2HOQ A;  5AIB A;  4I2D A;  1VLB A;  8ICA A;  4CF5 A;  2NRX A;  4NM2 A;  3NGD A;  8ICQ A;  4F4Z A;  2B6G A;  1ZQV A;  2G07 A;  3ZD9 A;  4C7Z A;  4MF2 A;  3QU2 A;  4CRX A;  5EE3 A;  3UPQ A;  4ECQ A;  2QAR B;  3A0B U;  4DL6 A;  3RB0 A;  1X9M A;  5KG0 A;  2K4I A;  2DL0 A;  2HI0 A;  2NRW A;  3KD3 A;  4US8 A;  2C22 A;  1XNS A;  3N7R C;  5KFD A;  2B21 A;  9ICT A;  4I2E A;  1XC9 A;  4UAT A;  3UQ2 A;  7ICM A;  2W54 A;  5AKG A;  9ICQ A;  3AQE A;  3B0Y A;  1U47 A;  4UB5 A;  3C23 A;  5J0X A;  2BQU A;  3H8S A;  2PI5 A;  5BOL A;  1ZQQ A;  2AHO B;  8ICK A;  3M9N B;  4NL9 C;  4P0P A;  5CRX A;  2W9A A;  4KLE A;  2N1R A;  2F2A B;  3SD7 A;  4NXZ A;  4YP3 A;  1X40 A;  4EZ6 A;  5ALT A;  3HIL A;  1EXN A;  2KV2 A;  5KFH A;  1U45 A;  2KVS A;  1LKY B;  4RU9 A;  1SZP A;  5J2D A;  8ICL A;  4RUC A;  1XSN A;  3THV A;  1T3N A;  4Z6C A;  2JMG A;  5D46 A;  2VKQ A;  4F4X A;  5KFN A;  2BCV A;  4EBE A;  5T14 A;  3RJK A;  1SV4 A;  8ICM A;  9ICF A;  3NRZ A;  4NY8 A;  4UAS A;  1RXV A;  5AIC A;  1Z4O A;  4DFM A;  3SI8 A;  3Q8R B;  2UVW A;  1T7P A;  3DV9 A;  7ICG A;  4R66 A;  1L3U A;  1FIQ A;  3G6Y A;  1T4G A;  3PW7 A;  3PST A;  5KG4 A;  4NLK A;  2F1H A;  1SB3 C;  2FMS A;  1ZQS A;  3ZDD A;  2JZB B;  4QZH A;  2F1I A;  2HW3 A;  1S0O A;  2YB4 A;  3EWA A;  2DWQ A;  2LBO A;  2R8J A;  4BDP A;  5ALR A;  2I1Q A;  4GXK A;  3QUQ A;  4Z6E A;  3EUB 2;  5KAF U;  1Z00 A;  4LZG A;  1KFD A;  8ICP A;  4QZC A;  1D8B A;  3RJH A;  4P2H A;  4G3I A;  3M1Y A;  2E5S A;  2C28 A;  1ZOL A;  3RH6 A;  1SKS A;  4QWE A;  4O3P A;  1RG6 A;  1Z00 B;  4KMU A;  4RQ6 A;  3HP6 A;  2MAX A;  4YD1 A;  2YN4 A;  1Q3U A;  3HKZ F;  2D8C A;  3T5K A;  4MEX A;  4J9M A;  3HX0 A;  5KG7 A;  4B9T A;  2HHX A;  3RH4 A;  2FPK A;  5KFF A;  3H8W A;  3QEB Z;  3SQI A;  2Y1J A;  1UA1 A;  5CP2 A;  1DK2 A;  2ZTC A;  2IOF K;  2Y9T A;  8ICX A;  3K4G A;  1NOM A;  3ZDB A;  2DKZ A;  4O3Q A;  1LB2 B;  4UAW A;  3JPQ A;  2DKX A;  3QYP A;  1S8O A;  1X42 A;  4JUZ A;  2WF7 A;  3RRH A;  3HKZ C;  2Q0Z X;  3KFU F;  3UMG A;  2R8G A;  1DOQ A;  9ICH A;  3AM9 A;  4YG2 A;  4UB4 A;  1N63 A;  5ALP A;  1S0N A;  2FLP A;  5DQH A;  4F5N A;  2K60 A;  3IRU A;  4M9G A;  1WUD A;  5AI4 A;  2NRT A;  1J97 A;  1F0M A;  8ICH A;  3TKA A;  9ICW A;  3SV4 A;  1TAM A;  5DB9 A;  3D2Q A;  4ACO A;  1PZN A;  3GZF A;  1TVA A;  1RQN A;  5DDM A;  7ICV A;  5B5E U;  4USA A;  1QQ5 A;  3PW4 A;  1NJX A;  2KP7 A;  4Y2J A;  3F2D A;  4LZD A;  2ZIX A;  2R8K A;  1S0V A;  3WK6 A;  3N28 A;  1T8E A;  2CXY A;  3PSF A;  4KLT A;  3LWL A;  3C1Y A;  3MDC A;  8ICW A;  5ALN A;  8ICS A;  1XO1 A;  1SV0 C;  4P4O A;  4UB6 U;  3HRD D;  2P66 A;  2ZIW B;  2KMD A;  3QXG A;  5AKX A;  5KT3 A;  1JXE A;  1XU4 A;  4EEL A;  2JRZ A;  1SXD A;  3TAD C;  5KFE A;  3WK8 A;  5KFK A;  3C2L A;  4RNN A;  9ICR A;  2I9G A;  8ICJ A;  5CR0 A;  1V85 A;  3A0H U;  3NS1 A;  1S5L U;  4F93 B;  1QCK A;  3KHR A;  4FS2 A;  1QTM A;  3K1R B;  4BXO A;  3IG5 A;  2XO7 A;  3SEI A;  2V4Q A;  4FBU A;  4RNO A;  3LK9 A;  4DL2 A;  4ECU A;  5DBA A;  1JRO A;  3ETR A;  1X9W A;  4ELU A;  3NVW A;  4Q8F A;  4BXO B;  4JV0 A;  3CP8 A;  4GLX A;  5KT5 A;  2XIC A;  3GV8 B;  2KK0 A;  3GIL A;  1N5W A;  4DOB A;  2ZUD A;  3RRG A;  4ECV A;  4PGQ A;  4EX7 A;  4C8N A;  3S6J A;  1WWV A;  2BPC A;  1P7D A;  3CNH A;  4UAV A;  3I1Y A;  5ALU A;  3WK5 A;  4F5O A;  5F3X B;  4DF8 A;  7ICQ A;  2OWO A;  1ZQY A;  2PFO A;  3FYH A;  3MGV A;  5J2J A;  4YN4 A;  5KFC A;  5DGA A;  1L7M A;  3G6V A;  3QU7 A;  4Q45 A;  3LDA A;  3RR8 A;  4AYB F;  4EYI B;  2V4R A;  2G06 A;  1D9F A;  2MUT A;  2OH2 A;  5AI6 A;  2K8A A;  2H3Q A;  4YXJ A;  2UVV A;  4BWJ A;  5AK5 A;  1FO4 A;  2DPI A;  4KLS A;  4C4S A;  5AKH A;  1LV5 A;  4KLJ A;  2HVI A;  2HBL A;  2HHS A;  1N5X A;  4C8O A;  1UHU A;  4PGX A;  2P6R A;  4KLG A;  2DGZ A;  1QSS A;  1B22 A;  2B0C A;  2BPG A;  3H0L B;  2W7P A;  3F53 A;  4IRD A;  1JMS A;  2ALZ A;  5KT6 A;  4DQQ A;  3KKA A;  4UBC A;  2AQ0 A;  5L1M A;  2G08 A;  3H8J A;  4JB3 A;  2JEF A;  4U6P A;  4AYB C;  5AM1 A;  4I2J A;  3EYZ A;  4Y2U A;  4EEN A;  1ZD3 A;  2AGQ A;  3RB3 A;  5KT7 A;  3Q8P B;  2RQ5 A;  8ICR A;  1K5O A;  1ZQM A;  5B66 U;  2AH5 A;  4ED1 A;  3PY8 A;  4R8U A;  2G5H B;  5DKW A;  1MA7 A;  3KHH A;  8ICU A;  2E1F A;  4QZI A;  2FMQ A;  1PK1 A;  1L8L A;  2HDO A;  1ZQA A;  3SV3 A;  5DG7 A;  2D3D A;  2F76 X;  7ICI A;  2VA8 A;  5J0T A;  2AU0 A;  4US9 A;  5KFI A;  2BZF A;  3ZI4 A;  1Z19 A;  1Z4N A;  9ICP A;  2W3R A;  1ZQK A;  3D2N A;  5DG9 A;  2L5Y A;  1RM6 C;  2PFQ A;  2ZXH A;  3F5A A;  2E8N A;  4IQT A;  3C29 A;  3O0F A;  9ICB A;  9ICN A;  3EW9 A;  2NO4 A;  2ZUC A;  2ESE A;  1NNL A;  2KFZ A;  3RH5 A;  4YXM A;  4B9S A;  1XO0 A;  2KSO A;  3PR5 B;  3AL0 B;  3PX6 A;  3SR6 A;  1F5S A;  2ASD A;  4RZR A;  1ZQE A;  2E1E A;  3B9J A;  4UAZ A;  4DLE A;  9ICA A;  4DQI A;  5L1I A;  1QLN A;  4P0Q A;  2LYA A;  4RQ3 A;  2RLT A;  2YY6 A;  5DQG A;  2AGO A;  3T3F A;  4J9Q A;  3IDW A;  3GIJ A;  4NL9 A;  1ZQI A;  4Z6D A;  3LVW A;  4RT2 A;  4P4P A;  3HPO A;  1T3Q A;  2BQR A;  3E0F A;  2CRX A;  2A3V A;  1ZQZ A;  1COK A;  4DFJ A;  5F9L A;  2WHE A;  2XCA A;  5III A;  4J9R A;  4GFJ A;  5ALW A;  4DF4 A;  5F9N A;  4FO6 A;  5L1J A;  4NJ8 A;  1BPZ A;  1NKE A;  5AKE A;  1BPY A;  1X6I A;  1BPD A;  3TAQ A;  4FZM A;  2Y9U A;  1YT3 A;  2W3S A;  1ZXI A;  2XC9 A;  5KFL A;  4J9N A;  4C80 A;  9ICX A;  2LYH A;  4YMM A;  9ICC A;  4OJP A;  4QJF B;  1ZD2 P;  4EBD A;  2ZTE A;  2J6S A;  3OSN A;  2A1A A;  3PW2 A;  3TI0 A;  8ICI A;  1NK5 A;  3PR4 A;  3L5K A;  1L8O A;  4EEK A;  1J2M A;  5KFR A;  5EWE A;  2WF6 A;  3PMN A;  8ICN A;  3OHA A;  4OJ5 A;  2KJ9 A;  4RPZ A;  2FPL A;  5AM0 A;  2Q4T A;  4O3O A;  1AQ6 A;  3V6J A;  5FP0 A;  4JWN A;  5AK6 A;  5J29 A;  7ICK A;  2VJ5 A;  3FM9 A;  1ZQG A;  5ALH A;  4BX9 C;  1QSY A;  4M0A A;  3TFS A;  4DOA A;  1LVH A;  4YR3 A;  3ALR A;  4Y2P A;  1TE2 A;  2LKY A;  3SMV A;  1DGJ A;  2IHM A;  4DL3 A;  4ECZ A;  3KBB A;  4UB2 A;  5KG2 A;  1BNP A;  5KFM A;  1NKC A;  1KRP A;  1ZQ1 C;  4RPX A;  2R18 A;  3RFA A;  5BOM A;  2BCR A;  3ED5 A;  5KG5 A;  4P0P B;  3I28 A;  5DB6 A;  1ZQT A;  3M9M B;  2EH9 A;  5TIS U;  1L7N A;  1K1S A;  1IV8 A;  2DF4 B;  4DQR A;  2KZM A;  2YTU A;  2HOI A;  1XSL A;  2I5H A;  5HP4 A;  1WG8 A;  4I2C A;  4YFK A;  5AHX A;  3F2B A;  2XID A;  1VJ5 A;  2ATL A;  2EAN A;  5DLG A;  2BPF A;  2F8K A;  3V7J A;  5BPC A;  3GV5 B;  3JPP A;  2QB0 A;  4CF3 A;  5J0Y A;  4MF8 A;  4DS5 A;  3N4M B;  5ALJ A;  4J9L A;  5AI5 A;  1YZ6 A;  3C2M A;  1KW4 A;  2ZIV A;  4ED8 A;  5EE9 A;  1J2N A;  3NVY A;  2HCF A;  4YR0 A;  3GII A;  4DSL A;  2JHD A;  5KFW A;  5KT2 A;  1C7Y A;  3MR2 A;  4K4G A;  4QZ8 A;  3E58 A;  3HWT A;  4M9L A;  4CF4 A;  3MR3 A;  3M7D A;  1D9D A;  3H0R B;  2G5I B;  4HYK A;  1Z1V A;  1OXJ A;  2ZJ8 A;  5JU5 A;  3BZK A;  4OCZ A;  2EZX A;  1HUO A;  2J6U A;  5KFJ A;  2UVR A;  4UB3 A;  4FZN A;  2AJQ A;  2V9W A;  1COO A;  3QNM A;  4O5E A;  2OYY A;  2C2E A;  2HHU A;  3UXP A;  3WKD A;  3QE9 Y;  1B4F A;  1X6J A;  5KL1 B;  1Q8K A;  2GLE A;  5J8Y C;  5KT4 A;  4ECS A;  1ZQJ A;  1FFV A;  4FE3 A;  9ICK A;  2RRD A;  4JV1 A;  2LYB A;  4KX5 A;  4ED2 A;  2O6K A;  1JN3 A;  3D6J A;  1QSL A;  2YQE A;  2F1J A;  3ZDC A;  1RZT A;  3M8R A;  1ZQO A;  2Y0S F;  2LMR A;  4MHV A;  3QX7 A;  1JXL A;  1SV0 A;  1L3T A;  4UAY A;  2EAM A;  5CB1 A;  5DB7 A;  3RAQ A;  7ICN A;  1UA0 A;  5IIK A;  3ZD8 A;  2XGQ A;  3Q8Q B;  1TV9 A;  1L6N A;  2IOH A;  3TAD A;  4NLZ A;  3AQF A;  8ICB A;  2UVU A;  1SIJ A;  4M2Y A;  3BQ0 A;  4B9V A;  2EDU A;  4F5Q A;  5DBB A;  4ED0 A;  4PH5 A;  4I2G A;  3N97 B;  1N2X A;  2ZUB A;  3BS7 A;  3UXO A;  4OJO A;  9ICO A;  3H40 A;  1XS9 D;  1FFU A;  2F3N A;  4UW9 A;  1CUK A;  2D6F C;  4F2S A;  9ICU A;  2Y0S C;  2PMZ F;  5KFU A;  1QQ6 A;  2JV3 A;  2NRV A;  3BS5 A;  3RF9 A;  4DSF A;  5ALQ A;  4YD2 A;  2G0A A;  2HVH A;  2QLT A;  4MFC A;  1L7O A;  1IXR A;  4I2I A;  4CCH A;  4A8E A;  1SKR A;  3GIM A;  3M9O B;  9ICS A;  1NJZ A;  5J2K A;  5G5H A;  2VJ4 A;  4HAI A;  8ICT A;  2DQN B;  5JRT A;  4B9U A;  3WK7 A;  3R9K A;  4Z6F A;  3MR5 A;  4YCX A;  4O3R A;  3NRW A;  3ORY A;  1MC8 A;  3RTV A;  4GC7 A;  3GFK B;  4XA5 A;  4M04 A;  4F2R A;  2BDU A;  2K4P A;  4QWC A;  3HW8 A;  4F5P A;  2BHN A;  2PMZ C;  2OCE A;  4BUG A;  2C2D A;  3BQ7 A;  1S10 A;  5J0W A;  4KLD A;  4KLF A;  4UB8 U;  2BR0 A;  4CE6 A;  4TUS A;  3ZDA A;  1RYU A;  4OJ6 A;  1S9F A;  3L3F X;  4B9N A;  2WB1 F;  5AI9 A;  5AKY A;  3C5G A;  2FI1 A;  2K8C B;  3H7I A;  4J03 A;  5ALO A;  4F92 B;  2W9C A;  2ZIX B;  1Y88 A;  3MGI A;  5DBC A;  2KNJ A;  3JPO A;  4Y2T A;  4RQ7 A;  4TUQ A;  5ALX A;  2CPR A;  4ECY A;  4KLO A;  2RP5 A;  4I28 A;  3U26 A;  2H5X A;  1KQQ A;  1SL1 A;  1H38 A;  1RQL A;  4ECX A;  1ZRM A;  5K4L A;  3EPI A;  5J2B A;  4GC6 A;  4DWI A;  4DS4 A;  3TAN A;  4MFA A;  1WCL A;  4RQ0 A;  2EAP A;  3Q8S B;  4RT3 A;  3NAS A;  3WKA A;  2WF9 A;  3T79 A;  5DQI A;  2E3T A;  2WB1 C;  3WKC A;  4IRK A;  1CI4 A;  9ICL A;  4F71 A;  2KJ5 A;  4DL7 A;  1S77 D;  2YX8 A;  3F5E A;  2W55 A;  4C7Y A;  8ICV A;  4Y2Q A;  4PPX A;  1IM4 A;  1KBU A;  4RQ1 A;  3IN5 A;  2BGW A;  4LVS A;  4DLG A;  4JMU A;  4M9N A;  1A0P A;  3MC1 A;  2P6U A;  1HIW A;  2KKV A;  2H3V A;  4ECW A;  4F72 A;  2XCP A;  3TFR A;  4IQW A;  2OHF A;  5KFZ A;  1V97 A;  4M47 A;  2IOF A;  2EZZ A;  5JTI A;  3RJG A;  4C4T A;  2H3F A;  5ALS A;  3MFH A;  2LHT A;  1TK0 A;  7ICR A;  4ELV A;  3V72 A;  1RYR A;  1NZP A;  4UB1 A;  5AIA A;  4C8M A;  2GOL A;  1KN5 A;  4UBB A;  1ZD5 A;  2W8K A;  2BQ3 A;  4QNL A;  2QKQ A;  5ALK A;  1QQ7 A;  5J2G A;  4PHE A;  2W43 A;  2M0N A;  4NWI A;  3B0X A;  2MUT B;  3SZ2 A;  2EQY A;  3OSP A;  4XRH A;  3H8M A;  8ICG A;  3C5F A;  1HUZ A;  4UQG A;  5CA7 A;  3M8S A;  4PZN A;  5J0R A;  1NZB A;  4TUR A;  3K75 D;  5AM4 A;  2JH7 A;  3LVV A;  5IIJ A;  1BPE A;  2LPE A;  4MFF A;  3PW0 A;  1KEJ A;  4PHA A;  4QW8 A;  3T5L A;  3RJI A;  4F4Y A;  9ICM A;  5J2A A;  2KIC A;  1SZH A;  1ZET A;  5J2I A;  2GO7 A;  5J0Q A;  5KNI A;  3TAC B;  8ICY A;  4GXJ A;  5J2C A;  3PML A;  4AP9 A;  3LYS A;  3MBY A;  2HSZ A;  1CEZ A;  5KFA A;  4IQV A;  2XVT A;  3ZDE A;  4OO1 J;  5CJ7 A;  1ZQL A;  1SKW A;  1NK8 A;  2J6T A;  2MRL A;  4O5K A;  4NLG A;  4R8U B;  1RPL A;  3FDS A;  4ICA A;  5L1L A;  4DFD A;  5KG3 A;  3RBD A;  1PUZ A;  4DOC A;  1N62 A;  1PK1 B;  2RHF A;  2ES6 A;  4RQ8 A;  3PSP A;  5IIM A;  3MGH A;  2ZXI A;  1MQ2 A;  4BWM A;  3EPG A;  3GV7 B;  9ICE A;  1QH9 A;  5ALL A;  5KFY A;  5J0U A;  4YR2 A;  2W8L A;  4IR9 A;  3T5J A;  4YQW A;  3WKB A;  2XI9 A;  2ASL A;  4DFP A;  5C0Y A;  7ICT A;  2AXT U;  1KLN A;  2KHV A;  1UT5 A;  5ALG A;  2W9M A;  4DL5 A;  4R64 A;  1JI7 A;  4LJX A;  3RR7 A;  2K4H A;  5D4B A;  9ICG A;  2WF8 A;  3SAH A;  4IC9 A;  2ODG A;  2KSO B;  3AU2 A;  1KFS A;  2FPM A;  2KVC A;  2VAN A;  2A1J A;  4RQM A;  5EE1 A;  1B43 A;  2KD1 A;  2HHQ A;  3TQ1 A;  2Z7J A;  2JR5 A;  1MSW D;  3RJE A;  4PL1 A;  1ZQX A;  4P0Q B;  2ASJ A;  2DBY A;  4G9B A;  2ZIU A;  3BQ2 A;  1PVQ A;  1S76 D;  5KFT A;  4Y2X A;  5KG6 A;  5KAI U;  3RB6 A;  4NV0 A;  4P4M A;  1U48 A;  4C4R A;  4NLN A;  3GDX A;  3I76 A;  5J2H A;  3AMZ A;  2DPJ A;  4I2B A;  4I2F A;  5KFQ A;  4UAR A;  2ISP A;  4QIW F;  4DEZ A;  1Q3V A;  1GO3 F;  3H4B A;  2OXO A;  9ICI A;  4ED7 A;  3UXN A;  3BZC A;  1B0X A;  4Y2V A;  4B6J A;  1D8Y A;  2GWS A;  4JV2 A;  4PL2 A;  4KX3 A;  2GH1 A;  5DDY A;  4PJ0 U;  2KIW A;  3NVV A;  4QZE A;  3JPT A;  1ZYQ A;  1TK8 A;  3NVZ A;  1O08 A;  5KG1 A;  3RJJ A;  3V7K A;  4X5V A;  3BQT A;  5AKJ A;  2KZZ A;  5ALI A;  2JEI A;  1V9P A;  5ALV A;  2VA3 A;  2QAR A;  4O9M A;  8ICE A;  5ALD A;  5HMM A;  5EOZ A;  4ELT A;  3GIK A;  5HHI A;  1KTQ A;  1U49 A;  3PSI A;  1N48 A;  2K89 A;  5DB8 A;  4QIW C;  1MQ3 A;  4B9M A;  3WU2 U;  1N56 A;  7ICL A;  1ZRN A;  4M9H A;  5AI0 A;  2E8P A;  1ZQF A;  2W04 A;  2NYV A;  2PXI A;  4F8R A;  3VC8 A;  1U9L A;  5D49 A;  5KFB A;  4KLI A;  3KTQ A;  3AUO A;  4J9P A;  2YMP A;  5J8Y A;  2KIV A;  2IHN A;  3PNC A;  1X66 A;  5HR7 A;  3KZI U;  1L3V A;  1BGX T;  3QUB A;  1DK3 A;  3UMC A;  4KLM A;  5EWG A;  2ZTD A;  1UT8 A;  4ED3 A;  2BCU A;  1JIH A;  1A6S A;  2IA6 A;  5ALY A;  5AM3 A;  1URJ A;  3PO5 A;  3KOO A;  4RNM A;  2MU2 A;  7ICJ A;  3Q8K A;  1LKY A;  5DG8 A;  4J9K A;  3OJU A;  4JWM A;  1V38 A;  3IV6 A;  1ZQC A;  1PVP A;  4DO9 A;  5AKI A;  3SYZ A;  3C21 A;  3AU6 A;  4RUA A;  5J0O A;  4IRC A;  4QZG A;  3PW5 A;  2OM6 A;  5HR6 A;  4TQS A;  3MR6 A;  4C8L A;  2YMM A;  3QZ8 A;  4CNQ A;  2BKE A;  3CW2 C;  3L4P A;  4J9O A;  2QB0 B;  1SXE A;  1SL0 A;  1RYS A;  4WJ3 B;  3C28 A;  2W11 A; 
#chains in the Genus database with same CATH homology
 2EQY A;  2EH9 A;  2JRZ A;  5CEH A;  2LI6 A;  2RQ5 A;  2JXJ A;  1KN5 A;  2CXY A;  2YQE A;  2OEH A;  1RYU A;  1KQQ A;  1C20 A;  2KK0 A;  2LM1 A;  4LJX A;  1IG6 A;  5K4L A;  1KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...