3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Isomerase
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
1J8DA 1XP5A 1RPZA 1ZD2P 3AR5A 4Y2TA 1JUDA 5AK6A 2FPWA 2HO4A 4Y2JA 1TJ3A 2O2XA 2RBKA 3OCXA 2IA5A 5AW2A 3FPSA 3AR8A 2YY6A 1YV9A 1VJ5A 3NANA 3R4CA 2HOQA 2B1RA 2I34A 4G63A 1Z5GA 2B1QA 2YJ5A 1RLTA 3OCVA 1L7NA 3UMGA 4DFDA 3ZVNA 5AKXA 5ALJA 2CFTA 3I28A 2MU2A 5IT4A 3K1ZA 3ET4A 3KBBA 4L57A 2CFSA 4BEWA 3QU5A 2O9JA 3U7FB 2YFYA 5A3QA 5AW7A 1TJ5A 3U7EB 5AVUA 3SHQA 5AKYA 1RMQA 2YMPA 1Z4LA 2PR7A 5AKKA 3S6JA 4CE6A 2I54A 3TLMA 2OM6A 3FVVA 5AKJA 4KNWA 4BEVA 2P27A 1N9KA 2HSZA 3WK5A 3WK9A 3QGMA 1Z4MA 4AS3A 1RKQA 3PCTA 4YH1A 3KD3A 3ZU6A 4NFLA 3WK8A 3NASA 5AICA 4OCZA 5AVYA 5AW5A 3KDPA 3M1YA 5AK4A 3AR4A 2B30A 4F71A 4QQFA 5AVSA 3NIWA 1ZRMA 3M9LA 5AIAA 2JAUA 4BBJA 3U7GA 3R9KA 4UMDA 3OTQA 1SWWA 3L0CA 4YIKA 1Z4OA 5AKLA 3PGVA 5AI0A 1VFPA 3L0BA 2CFRA 4CF4A 3W5CA 3ZX4A 3N1UA 2ZXEA 1QH9A 2D2VA 3SD7A 4HGOA 4BX2A 1NF2A 5E0OA 3I6BA 3DV9A 4NV0A 4RETA 3WK6A 1K1EA 4O8CA 3IB6A 4I9FA 3ZI4A 3L8FA 2B82A 1Z4IA 1VJRA 4F72A 2YMMA 4C4RA 4HGPA 4MWOA 4NWIA 3OCZA 2QLTA 4UU1A 2CN1A 1L8OA 5AI5A 4UM5A 1O08A 2WF9A 4XQ0A 3OCYA 1QQ5A 2Q4RA 1KYTA 3FPBA 3ED5A 3IJ5A 1EK2A 2GFHA 3L8HA 3I1YA 3WKBA 3EPRA 3CNHA 3A1EA 3RF6A 4EEKA 2BDEA 3QX7A 1YS9A 1Z4KA 2NO4A 5ALGA 2HF2A 1S8OA 1WVIA 5AM0A 2B8JA 2AGVA 3P96A 4DWOA 3WKAA 5ALRA 4NAVA 2P9JA 3L1UA 5AW3A 5ALWA 3MPOA 4L6AA 3DAOA 4ZEVA 1ZS9A 5ALKA 2JGAA 1QQ6A 4BX0A 5AVTA 2HDOA 1SU4A 1Z4NA 5AKIA 2RAVA 5AVQA 2FUCA 4J03A 1LVHA 1AQ6A 5ALVA 2I7DA 4UW9A 3NAMA 1TJ4A 4MUMA 3VAYA 4KYTA 3N07A 2W43A 2GMWA 2WM8A 4EZEA 2YBDA 1Z5UA 2WFAA 1J97A 5ALHA 3IRUA 4Y2UA 2BDUA 3FM9A 3R09A 3N28A 5JJBA 5AHXA 3QU2A 1RLMA 2HHLA 1YJ5A 2C4NA 4HGQA 4Y2PA 5ALFA 2G06A 4Y2YA 4XOUA 2I33A 4AS2A 1RQNA 4XE5A 3N5KA 3PGLA 3WKCA 4HYTA 3D6JA 1L6RA 3GYGA 3U26A 2HX1A 2WHEA 5AI6A 2JAWA 1Y8AA 2C8KA 2MU1A 2FPXA 3WGVA 5A3RA 2YMLA 1NNLA 1Q92A 3ET5A 3ZWKA 3MC1A 5ALIA 1NRWA 3ESRA 4YCMA 2C88A 1T5SA 2JARA 3AR7A 3AR3A 2OBBA 3EF0A 2R8EA 4OD0A 5IS2A 4Y2RA 5AI4A 3HYCA 3WKEA 3N8GA 2YJ3A 4Y3UA 1X42A 4L6CA 5AKEA 2YMQA 2W4MA 3SLRA 4C4TA 4EX7A 3ZTWA 3QUCA 2WF5A 4UAUA 3L0YA 1RC8A 3E84A 4HGRA 3ZX5A 5AIBA 3HLTA 2IOFA 2C9MA 4EELA 2WF6A 5AM3A 2QYHA 1TA0A 3QUQA 1ZD5A 3ZTYA 4KX5A 2IOHA 2G1AA 3QU4A 4J2TA 5AVRA 4UASA 4FFDA 3AR9A 5AVVA 5AW1A 5AW6A 2AMYA 4CF5A 2FPRA 3DNPA 1QYIA 1Z4QA 2GHQA 1RLOA 2G80A 2B8EA 2RARA 3AR2A 2HI0A 5A3SA 2Q4TA 4HAIA 1RKVA 4AP9A 4FE3A 3L5KA 5AM5A 5ALSA 3PDWA 4DW8A 3ZW7A 4ZEWA 1SWVA 4CF3A 1T5TA 3B8EA 5ALDA 3ZWDA 1IWOA 4YCNA 4KX3A 1S2OA 4HGNA 3J7TA 3BA6A 4BYGA 5ALQA 1TE2A 3QNMA 3EF1A 4GIBA 2Q5EA 2G08A 5AKHA 5ALTA 2R8XA 3L8GA 4ZEXA 3U19A 3OCUA 3QLEA 2OYCA 1QQ7A 3I76A 2HEGA 2G09A 4E88A 2R8YA 2P69A 4BX3A 4G9BA 3QXGA 1RMYA 4BKMA 2IYEA 4OFZA 4YCLA 4FYPA 3KZXA 3W5BA 2B0CA 2HCFA 5ALEA 4CNQA 4IFTA 4RESA 5IT0A 5ALUA 4UU0A 3SF0A 2FPUA 2DQSA 4Y2XA 3B9RA 4GXTA 4UAVA 4BNDA 2G07A 3ZVMA 3NALA 3A1DA 5AM2A 4JDPA 2GO7A 3W5DA 3KOOA 5AM4A 4UMFA 2PKEA 2FUEA 4EX6A 1FEZA 2AH5A 3QU7A 1N8NA 1RQLA 2ZBFA 5AI8A 3KC2A 1YMQA 3WKDA 2FPSA 4DCCA 4B6JA 3W5AA 1L7PA 1WZCA 3QUTA 2PQ0A 3FZQA 1T9ZA 2MSNA 1U7OA 5AM1A 2YN4A 3UMBA 3E58A 2FI1A 1WPGA 2ZBEA 3ONNA 1ZJJA 5AW0A 5ALYA 1RRCA 1CQZA 4Y2VA 4OHFA 3QUBA 3UM9A 2ODAA 1XVIA 3WGUA 4KNVA 3WK7A 4Y2QA 1U7PA 4UATA 5AVWA 2ZG6A 1O03A 1XPJA 3BWVA 4PNHA 1Z4PX 2AUTA 5AK3A 4YGYA 1U2TA 3SKYA 3ESQA 3FGOA 1WR8A 5AVZA 1LTQA 2I6XA 3MMZA 4UMEA 5ALOA 5ALPA 4IG4A 5ALNA 3WK4A 5AKZA 3UMCA 1U2SA 2ZOSA 2RB5A 3NRJA 2FDRA 4I9GA 5ALXA 3NUQA 1ZOLA 5ALZA 1L7OA 1PW5A 2EARA 2OA0A 3SMVA 5ALLA 1L8LA 3QU9A 5AI9A 2WF7A 2C8LA 3AR6A 5AW9A 1RKUA 1YDFA 2BY4A 2ZBGA 3B9BA 2EATA 5FP0A 4BNDB 5AK5A 4Y2SA 1F5SA 5AW8A 2FEAA 3DDHA 2G0AA 1ZD4A 3EWIA 2EAUA 2NO5A 3E8MA 4UARA 4C4SA 3L8EA 5AVXA 2YJ6A 3SKXA 2X4DA 2I55A 3F9RA 5AKGA 4UMVA 3L1VA 1Q91A 3QYPA 2GHTA 4H1WA 1Z4JA 1MH9A 2ZBDA 1RMTA 2IOFK 5T41A 2WF8A 3ZVLA 2VKQA 3MN1A 4QJBA 1L7MA 3A3YA 4YIHA 4JB3A 4EENA 4UM7A 2P11A 3L7YA 4NABA 1U02A 2HF7A 3OPXA 5ALMA 2W11A 3E81A 4XPZA 1ZD3A 2YJ4A 5AESA 1YNSA 1EK1A 2JAOA 3U7HB 3CZ4A 5AW4A 1RDFA 2NYVA 3A1CA 3RFUA 1CR6A 3U13A 1ZRNA 1Z88A 4KN8A 3OCWA 3ZUPA 2R8ZA
chains in the Genus database with same CATH superfamily
1TKCA 1O89A 3B53X 5K5EA 3NLLA 2IYTA 3GT4A 4Y6SA 4XIYA 1UT5A 2WIBA 4UCXA 1P3Y1 4AXXA 1MB9A 2F77X 3VPFA 4GI5A 2ZM5A 1J6UA 3TS1A 1UJBA 4B9SA 3PSTA 4F2PA 5HKAA 3TLMA 4MVJG 1Z0DA 4DS4A 3TFSA 4D43A 2GM4A 1JROA 2CNWD 3C7DB 3WL7A 2IYLD 4V0RA 5JRJA 4N8DA 5ELMA 5C5JA 3AEKB 4FSHA 4TYYA 5DSXA 3VKVA 3P0IA 1K8XB 1AQUA 3ZWAA 3QMPA 5TJHA 1NF2A 3B89A 4G5GA 5LNK1 1RYBA 1KFDA 1AQYA 4YWHA 4F86A 3SS9X 5EG5A 3QWBA 2X3UA 1VHWA 4BE9A 2CLLB 4PX9A 4N5MA 1T1EA 4F4DA 3TAUA 5HUQA 3ECAA 3UAOA 4UNSA 3VFDA 1D2NA 4ITRC 1DJLA 1S8AA 3OIWA 4II7A 4QZVA 3BHIA 1NFRA 2PLWA 4XLZA 5IASA 1IXSB 3PJEA 8ICTA 1TF2A 1TO2E 1JKFA 4KO4S 1RAHA 4W9NC 2YJNA 3WWPA 2EGHA 1O0BA 3IAM1 3V5NA 1K6XA 1Z56C 3C29A 1LB2B 2ID8A 4XJSA 4RQMA 3IP7A 4AI6A 4YCBA 4QTXA 2AS0A 1D2HA 3GJ7A 2NTNA 2FLPA 1ULSA 5BR4A 2FGJA 1X1BA 2GN0A 3TVTA 1II8B 1BIFA 1T8UA 4FZNA 2AG1A 4I3GA 3ROTA 1CUCA 2PPLA 3JWEA 3RVOA 3AR3A 3OLQA 1NU8A 3I2FA 5LQUA 3FIUA 3ZK7A 5HG0A 5AKEA 3WNBA 4RXMA 4XSHA 1W8IA 5CUQA 1U0SY 5F51A 5T6MA 5AIBA 3AONB 3TRDA 2W2OA 4NZYA 4U2FA 3GXOA 2IDKA 5GGXA 2HMVA 1SVWA 4JSTA 2QD5A 3U4MA 1ZH0A 2ZWPA 2UVQA 2QZJA 4AP9A 2DPXA 4MW6A 2GI4A 2P2ZA 3A32A 3FDZA 3VHXB 2DHCA 4UUOA 2HQSA 3EF1A 5I7OA 2WU3A 3WQQA 1WEKA 2QOEA 4PL2A 2ZE7A 4Q01A 3MWKA 1D1SA 3AKYA 4RTLA 5H82A 4JUZA 2GOLA 1Z00A 5IINA 4I2FA 1I01A 1A5BB 3PUIA 1JZQA 1L8XA 4G09A 3A1DA 2VC2B 4JS0A 1SUIA 1F17A 4Y0VA 2JAXA 1C8VB 4FFVA 5J58A 2WHYA 4D9MA 4F4FA 1GIAA 2ZJ0A 3TD9A 4KR9A 4TMKA 5KDDA 3PJRA 3I9V1 3PF8A 5C1IA 5HE9A 1R6XA 5EWJB 3LQ1A 4R31A 1CY4A 2G72A 5F1PA 1IEQA 1WZNA 3Q9LA 3IHWA 1TAMA 3INNA 5AVZA 4GI7A 1J7JA 4XJTA 4AQDA 2NIPA 4BRZA 3WBJA 4C76A 4ZOAA 5B1YA 2PUDA 4GL2A 4QJFB 3GR6A 1LV7A 2QQ0A 4F3TA 1GXSA 4B76A 3KKNA 2EATA 4U6PA 5A4AA 3UXNA 4MI6A 2CFCA 1Z6YA 2XVYA 2CMGA 3NIBA 3T7AA 4F8YA 1L7QA 4R64A 4L08A 3WP1B 2GN9A 2PWYA 5JAPA 1U0NA 1UPTA 5ALMA 1PYGA 1TO1E 3I5XA 2CF5A 3O94A 2WJ6A 1E1QA 1YJ8A 4G84A 2WP8J 1JKJA 1SCQA 1V4VA 2A4MA 5GIPE 1HPLA 1MOSA 2EJCA 1ZSVA 4MCAA 2XE7A 4Q18A 2Y9UA 3RAGA 4CG0A 4YQFA 4K7JA 4IIJB 3FPSA 3DOJA 2QRMA 2AFHE 5DWQA 1XTRA 2XBLA 3IILA 2GLUA 3GMTA 2IC5A 7REQB 3A0RB 3W9BA 1EK0A 3VR3D 5K6TA 4B7ZA 5CNKA 3RH0A 2CUKA 2B0JA 1YJCA 2V7BA 4BVEA 4GDFA 2JFBA 3R44A 1V96A 2QU8A 1EB9A 1I94B 2F4VB 1E1YA 2YS6A 4PW0A 1EP1B 1WZUA 2X40A 1QRAA 2WAOA 4OFBA 3ZHBA 2PRZA 3WLAA 3NVVA 1AZTA 4R65A 4LDAA 1VJRA 1QC5A 3L4EA 4GLLA 3JALA 3IE0A 2PH7A 4EL0A 3HDTA 2QSYA 3W79A 4MDHA 2FWNA 3RHSA 4EMTA 5B53A 5HK8A 4CN9A 3N7AA 4EUKA 1YAJA 1XJ5A 4V2UA 1WW3A 2V0NA 5KNIA 2GCGA 4PRYA 4HTFA 2EDCA 3EMDA 4IP0A 3GAZA 1T5LA 1NY5A 5LD2C 3A36A 3UAXA 2XY7A 1BX3A 1AKRA 4A8JB 4KV9A 4U2CA 1OIWA 2PRJA 3M1AA 1MH1A 3N07A 3IPAA 4KLRA 1M2HA 2ODWA 2PGNA 3EQ7A 1JEAA 3C5EA 4XM1A 2K4IA 4KVGA 1AXGA 3VKFA 3SYZA 3JAWA 4ZV7A 1G291 5DI3A 3N7UA 3O21A 5I9BA 2H2DA 2FN8A 3AL0C 2OL4A 2VDKB 4QPZA 1ECGA 2YVQA 5JAQA 1M33A 4DEZA 5EXPA 3LVRE 3QSYA 1VMEA 2ZYWX 3BSFA 1E9BA 1NRWA 2HVHA 5HQ3B 1BWRA 1L3VA 2OV8A 5BORA 5CCEA 1UBLS 1L5MA 4G36A 1WB9A 3FROA 4QBKA 5DP1A 3JY6A 5T57A 3KU1A 1R0KA 2JLQA 3COJA 2H7XA 1X7ZB 1NVXQ 3ZKWA 3HJBA 3DFZA 3GVHA 1JE1A 2SICE 1UDWA 4RQ5A 1T5BA 2I8CA 4BIMA 4GAEA 3OTOB 2AMYA 4JNKA 3H0EA 3WVNA 3D4PA 2VZLA 1Z4QA 3GFGA 3KV3O 1K4MA 4HH1A 4ND8B 5KT4A 1L7RA 3G2JA 2FMSA 5KI6A 3C24A 2P0EA 5LCXA 2LKDA 1ZQWA 2WV7A 1K6EA 1MIOB 1C30A 2DH5A 3GNSA 4CL0A 5LP1A 1P6UA 2YC4C 3RFVA 3SS7X 4EJ2A 3MMXA 4GGMX 3FTPA 4YUVA 3AEXA 1UMDA 4DQKA 1G9XA 4I4IA 2ZDHA 5IT0A 1GZ5A 2IYQA 4GPZA 1LI7A 1KYXA 2PPVA 1YRQA 4NARA 3MOSA 1UM9B 4GX2A 5CFQA 3VR1A 4Z1MA 1LD3A 2PJZA 4Q8FA 1Y6RA 4KQGA 2Q3FA 1A4RA 3OQOA 4DNOA 8AT1A 2MAXA 1E96A 1T10A 4EG0A 4BCDA 3ONNA 3DZ8A 1LY1A 2PMDA 4F21A 3WK7A 3TL2A 1R0XA 1DKOA 3C0KA 4EKDA 2H3QA 1Y33E 3CMCO 5B36A 4B3TB 5E2BA 4LBZA 4ARIA 3O0DA 1XEXB 2CCJA 3ND5A 2FQQA 1EDEA 3DFKA 2QSZA 2R7NA 2RGUA 4F85A 4TQGA 2XEXA 3EDOA 3OBIA 5THKA 3HCFA 2UKDA 3QFTA 3PG5A 3R3ZA 4DQVA 4OJPA 4HXEB 3EWIA 4ZQHA 4C9BA 4DQLA 3RS7A 5DGIA 1QKKA 1IAVA 4PZLA 3ZY6A 1JDBC 2OGSA 4GVPA 3SYNA 2IOFK 1XA0A 1FMTA 2ECPA 4HRYA 4JB3A 4ELUA 5JEEA 2P9GA 2QV0A 2BGLA 4IWXA 3L7KA 2OB1A 4AMVA 4OGFA 2ZB2A 3HI6A 4BO5A 1C8BA 4QGSA 5DIZA 4HFMA 5JZMA 5FWNA 1W0JD 2YV2A 1LDBA 5HW0A 4RYDA 2IGTA 5DHAA 4TLEA 3ZWOA 4QTUB 4UNNA 4TRMA 4JR2A 3HB0A 3UMGA 1Y1LA 3ZVNA 1FYVA 5EINA 3CE6A 2V96A 3HY6A 5KG3A 1NF8A 2DQNB 1IWPB 2GSWA 2VVTA 4EG8A 1KEWA 1DLJA 5G0SA 2HLNA 5BSRA 2NAPA 3IV9A 2PG3A 2YIJA 4YHBA 4MUBA 4D56A 1Z2OX 2ZYSA 2H08A 2FLKA 3ETLA 4AQYB 3Q7PA 1Q7EA 4JDUA 4EZBA 2BZFA 4IWNA 2XCQA 4YIKA 4CM4B 3ZWWA 4MW0A 1GR0A 1CF2O 2R8RA 3AHCA 4EKIA 1PJTA 2J6BA 1E6WA 1SUPA 4F5OA 3V7JA 4NSNA 1QDLB 3SEQA 1UFVA 4Y2GA 2X4LA 1JHRA 5JS7A 4F96A 4J9NA 2NV3A 4OK5A 4DQQA 1UR5A 3S40A 4KZKA 2E1PA 1QAQA 4EW3A 1EJ6A 3R7WB 4NEQA 3R41A 4RV9A 5LLTA 3FPBA 1EXWA 1GFZA 3LUJA 3D2CA 1VPDA 3I1YA 4HNUA 5IKPA 1H4TA 2GRJA 2X6TA 4FYYA 1FA9A 3WKAA 2KV2A 1N75A 3JPOA 4I1OA 3AV3A 3WYBA 3WIOA 1WXHA 4QUIA 2QBYA 1G8AA 1AMUA 5I4KA 1PF7E 2Y4NA 1R6TA 1LNQA 2XQJA 1CTQA 3U80A 1V3TA 1Z12A 5HQJA 3LOUA 4N48A 3N0XA 4L9SA 2F43A 2XDWA 2I7XA 1KSJA 4HWPA 1CWUA 4DPMA 3LDAA 1NBOA 1PFWA 1YZHA 4QT0A 3BMQA 2O8DA 1IBSA 3HJTA 1JG3A 3DDWA 4CEJB 1M2GA 3OF5A 4BLPA 2H0AA 4DSLA 1QF7A 1ZOOA 1BWQA 3ORRA 2PUBA 4S0XA 3QE2A 5HOEA 4RUCA 1IZZA 3LX4A 5I8WA 5BWNA 3W8FA 3FPHA 2Y6VA 3DW3X 4I50A 4RY0A 1YZQA 1X9IA 3T3EA 4COKA 1U9ZA 2V7UA 4PXYA 2HN9A 3NC0C 1ZD5A 5BWMA 3OZDA 1G8MA 3WL3A 2D4HA 5ECYA 1P45A 1I6MA 3KZKA 3QIAA 2GHQA 4G5YA 3WYAA 1S02A 1J2YA 1LJUA 4GKKB 2OBFA 2H4XA 2HJWA 4OQQA 2Z5VA 5BN3A 1HIWA 3ALRA 4S1PA 4FFLA 5DX1A 3HSKA 4LF7B 2YB4A 1Q7CA 2N1RA 3OZWA 3NRCA 4CKWA 2E37A 5UKDA 1KK3A 3KYDA 3INGA 4WRRA 1SD2A 4FD2A 2VHYA 3TACB 1E3QA 1ZUWA 1E5LA 1T3QA 4YUZA 1T8SA 4KO3S 4HO1X 5JC1A 2POCA 2GPBA 4IQ4A 5B4TA 4P0QB 4MHTA 1E2UA 2BFFB 3KJIA 4JLOA 3SEAA 4G23A 3HEAA 2GFQA 2TECE 4RM3A 4E2ZA 2FWPA 3IV6A 1R9NA 3GFOA 2PX2A 1TZKA 1NN3A 2NZJA 1TT5A 3ORSA 2A3VA 4RU1A 1IBRA 3G9XA 4B3JA 1X66A 5DT2A 5AXAA 4K6OA 1DS6A 1TNDA 3AN1A 3EK2A 1V8OA 1OX4A 3ZE0B 3HKZF 4JFAA 3B36A 5JS2A 2JGRA 2JLZA 2I6XA 4Z4HA 3K53A 3Q4GA 2D06A 3HA7A 4UAGA 2WUVA 5PNTA 1S9FA 3VYSB 5CVDA 4AJJA 3LYAA 4HAYA 1E4EA 1DKUA 1CUZA 3O4GA 3UG7A 1K6JA 5C31A 2A6PA 4BVKA 2IXDA 1V26A 5IAGA 1XALA 5I45A 5JU6A 4WJKB 3P0RA 2ZSEA 1Z07A 4DRXB 3NVWA 1PDVA 1SC4A 1NURA 2FF7A 4RQ1A 5JSYA 3C3PA 1I9GA 1Q1GA 2O8NA 3QKTA 4NNJA 4RQUA 5AOVA 1DEXA 1JIVA 4O4HA 4LDJA 4N5NA 4E03A 4TMXA 3DMDA 5JFGA 2AQHA 4J1NA 1LK0A 3U3OA 4JGGA 2GRUA 4MR7A 3T54A 2Q0SA 4UTNA 5BWCA 4PYIA 3L40A 1BPZA 1QBKC 3IUMA 1JP7A 4ZO9A 2XI4A 5JH7A 1C9MA 2YOGA 4P4GA 3D4BA 4NENA 4HFJA 2FUG1 1IYZA 4UHJA 3DTYA 2MJLA 3DMTC 5DSZA 4MUXA 5TT0A 3DNFA 3CRXA 4CI0B 1XJCA 4TL6A 3AQEA 2Q9CA 2JHFA 1MT3A 4JYAB 1V4BA 4LJXA 3PZBA 3T1NA 5IU6A 1EUYA 2SHKA 5D3QA 5T4FA 1GTJ1 3JWIA 1HSOA 3PGVA 1M2FA 1YULA 2QG9A 4WBNF 2FPLA 4KW7A 1S2IA 3I04A 4PGGA 2XXJA 1Y7TA 2ADFA 3RBZA 2WWTA 1M7BA 2QT1A 4DHEA 4TS9A 3PDCA 4YXFA 3C1OA 1IJEA 3OTWA 3R6WA 4QLBA 4WBSA 2Z04A 3KQNA 2ZI9A 2HAEA 4HEHA 4RUAA 1BX0A 4TYNA 1SC6A 5EJ7A 1W44A 5DN6D 4HLQB 5CLQA 3T3PB 3A0UA 2QTVB 4N0PA 5KVCA 4LF8B 3NC4A 1G19A 1XIVA 2PUCA 3OWOA 1H1LA 5AVOA 1BOOA 1MGPA 5C81A 1A2QA 2J4CA 3WS7A 4RWZA 1EFCA 2OQIA 1TQ8A 2ID7A 4EKYA 1ECWA 4EVRA 4DSOA 1UQUA 1XC7A 1FFAA 1Z6QA 2WBLC 3ZHUA 1Y6QA 2BJWA 3K4HA 1QVVA 3GUUA 2I87A 5DGTA 3M0EA 4CEHA 3V9PA 4LS3A 3UK2A 5CK4A 4AF8A 1WABA 2GK4A 2NLOA 3DYBA 1Z0IA 4ALNA 3PD0A 3RUIA 1RHQA 3UBMA 2CXYA 1QGOA 1YS4A 3G8YA 1GAWA 2CLIB 1G6Q1 1Y82A 4C8MA 4UE2A 1Z13A 1U8EA 1DAEA 3AOGA 4MEAA 5CXQA 1A97A 1Z00B 3W04A 3DLHA 2WYUA 3PQ7A 3ERCA 3FG9A 3BIJA 1KO4A 3GZ4A 2I6UA 1P5RA 1D8LA 3R3WA 5BQ5A 4F8EA 1FFDA 4A0RA 1NI5A 4L50A 3AKDA 1FUKA 2DECA 1TVMA 2GM5A 2E3JA 4EVIA 3HADA 1S2NA 1RYNA 3REQA 4XGRA 2OHOA 1FNSA 4J9VA 4JLVA 4CLRA 2XEDA 4FMCF 4GZLA 3TW0A 5DN9A 1GD1O 4I4NA 1J2TA 2OFXA 4KIGA 2IWHA 1T5IA 2V4RA 3K0FB 3TEJA 4EX6A 2QMQA 2LCFA 4NY1A 5G1PA 4RQ4A 2FI1A 5KFIA 3SIXA 3RJEA 1KEEA 1XRRA 4ZGWA 8OHMA 1FDUA 2LPEA 4HZIA 3DXZA 1BVSA 4P0TA 5B1IA 1NIJA 1EP3B 3EVFA 3I0MA 4TTPA 2F76X 4I2NA 2ZOSA 1GGFA 4NBNA 5A5EA 4IC9A 1JEEA 3KWJA 4XKJA 1JFLA 4E7PA 3A3NA 1CX9B 4EPVA 2D8CA 3FKJA 1BGVA 1CRPA 1R0WA 2IV7A 3HJRA 5DI9A 1DKRA 1ID1A 3Q98A 3DKIA 4PSDA 3DXFA 4AJEA 1Y9EA 4K87A 3PV8A 3I61A 3MS4A 1UBGA 1NOMA 3AEKA 3MJCA 1FNMA 1NOKA 1SQ5A 3CUTA 3FKQA 2QDKA 2YC2C 1SIJA 2PO5A 1UP6A 2W83A 3IX7A 3KXPA 3MUNA 5JFTA 3VR5H 2P9EA 4IX9A 4L8FA 3JAMA 4GGPA 3UEOA 4DFDA 1LFAA 3O92A 3KR9A 2FX5A 2YTZA 5ITWA 2CXQA 4BEWA 5IJXA 3LDUA 3LWNA 1PK9A 4JKIA 3C1UA 3HGMA 3T12A 1FDIA 4RF3A 4PZDA 2BM8A 4G26A 1N63A 1VE9A 2QPLA 2ENUA 4WXYB 3IEUA 3K70C 2O2DA 2HRCA 4U8HA 3D7NA 4BBJA 4YJKA 4TMYA 3VJMA 3QEJA 1VYUA 4YPVA 1SOUA 2HA7A 3AWIA 1COWD 3AVOA 1OKKA 1PK3A 5A1JA 3Q7QA 2J45A 5I3CA 1C0LA 2K4HA 3VI3B 3SD7A 1I13A 4JLSA 2FWAA 3SQOA 1HE2A 4GDMA 3MGHA 2EH9A 4LDPA 2BFMA 2O2CA 1QHSA 8ICMA 2F1JA 4JENA 1IBCA 4Y9SA 2JG3A 4JP2A 5HGXA 1II8A 4K4IA 3T7RA 3OURA 3HEMA 2J6IA 4FFPA 2WWWA 4C2BA 3PXCX 9ICEA 1QUFA 1NU6A 4NAVA 2E48A 3HYTA 2XUAA 4INOA 1I14A 3RKUA 4CIVA 5ETJA 1ESEA 4BNNA 5DQIA 2QIOA 2YWBA 1YQ9A 2GD2A 5FOUA 1VRWA 4LXIA 4ASUA 1UBNA 3AP1A 4JL6A 2W8BB 4BO7A 3F1LA 5IVKA 3NVKI 2W00A 1ITZA 2W04A 7ICNA 3CPSA 5K7SA 2HX1A 3VHXA 4KBYA 3P0HA 1E1RA 3S27A 1TZJA 5KYWB 1Q7BA 2W7OA 1ISJA 4Q9KA 4U9HS 4EYKA 2G82A 1UOEA 2OGUA 3A4LA 3IV7A 3S5UA 3MS7A 4BQNA 3ER8A 2IYVA 2REXB 1H4QA 3AM9A 2QR5A 5K0BA 3H9BA 3GJQA 3T3DA 3AGPA 2YH2A 4WN9B 3KQTA 4N3BA 2AHRA 4K8OA 4B80A 3TD6A 4CKXA 3LLCA 3OJSA 4KB5A 4W5WA 5TQ2B 2I6SA 3H83A 1ZN9A 5B7QA 4UOQA 3AOEA 4W7IA 4C7YA 3TSWA 4EJ0A 2YOFA 2Z56A 3B8EA 2YIDA 9ICIA 5EWJA 2D8AA 1YBVA 5BQFA 1JU9A 3EISA 3UANA 2FZKA 1ECPA 3BQMB 5EPEA 1Z6ZA 5IEBA 3SEZA 2QYOA 2C58A 1FP4B 5HR6A 1Y5NA 1Z7EA 3EZ7A 3LBFA 2A9RA 4LV5B 1A95A 2YWCA 5KQGA 5C8YF 2SKDA 2V7VA 2UYHA 3D6TB 5EZYB 4X71A 3OJOA 1SB3C 4R83A 1G3UA 1J49A 4PPXA 3E7FA 4J0IA 3KLOA 2GF0A 4ZDIA 2R48A 2O5VA 1OH5A 5FB3A 3KB8A 4AN4A 1HMYA 3NMUF 1S0NA 4R5HA 4LZLA 4L4SA 2V59A 3WL8A 4RCVA 2HGSA 1VOTA 2V98A 2NXCA 1E9RA 2MYTA 2EG5A 4BJ5A 4B9TA 2H1RA 2WSBA 2WQ6A 3Q12A 1C3OB 3LC2O 2FN9A 2VDQB 3P0FA 1W4BA 5TARA 4DR5B 3N87A 4NNOA 2YNMA 4LJ8A 3CRRA 2O8VA 4FTWA 5AI9A 3SQWA 4IIJA 4G1EB 4CTJA 2GXAA 4PO1A 3VH1A 1J8QA 1XEWX 3CX6A 3AEVA 7REQA 1CB7A 1AM4D 2DMRA 3OTIA 4MF2A 3HA5A 4MYUA 3KETA 4MUKA 2KWIA 1TCAA 2R79A 1G8JA 2KW5A 5ERXA 2XB6A 1X1TA 2BUCA 3EF3A 2NO6A 3IOBA 1ZQJA 2BKLA 1ZNZA 4LAFA 1YE3A 4GPBA 2PGAA 5CXXA 4Z86A 4PZZA 4PZAA 2VRNA 3OMLA 3L6CA 4NU0A 4DWVA 1GLNA 2FPGB 2R7LA 4EG4A 1TUBB 4DV4B 2ZUTA 4GPTA 1UWKA 3AVWA 2H51A 5F5NA 4NX2A 1Z5WA 1R0ZA 4XYEA 4M1SA 2B9EA 3I8SA 4BP3A 1NJ5A 1YJQA 1D0IA 2HPZA 4B9MA 1OW3B 3MXOA 2EKDA 4QU9A 1DDGA 1RKQA 2Z43A 2IYWA 4NFLA 4OKIA 1IOZA 3M1YA 1MOPA 2Q3EA 3BGVA 4C07A 4EI7A 4QPDA 5F7JA 1L0BA 4FCCA 3NAGA 4A8JA 3BK2A 1J1ZA 4BUZA 4EG3A 4Q15A 4WMLA 5KREA 4N65A 4DA8A 3AP3A 3B5JA 5KFXA 2K5UA 1V39A 3E7PA 5KFDA 1UWVA 3GLQA 2ZJFA 2J3QA 2WF9A 1LVUA 1KYTA 3QVLA 3NHRA 4BFLA 2R1TB 4XA8A 2WIDA 2OCBA 2ACEA 5EQJB 4D4LA 3VR2D 3AUXA 5HQ3A 4K6HA 3ELWA 2FJPA 4GLJA 5H8WA 4JWTA 1VLBA 5IXSA 4Z0PA 3HUTA 1X7ZA 4P86A 4ZCPA 3OPVA 3RTDA 4DC0A 1COKA 2FEPA 4Y1EA 2PUJA 3U3ZA 5KO2A 3ZDFA 4U7CA 2OO3A 4S1TA 3PQCA 2JFYA 4PGFA 5DHPA 1GUFA 4U5XA 4DO9A 4Q3CA 4MKZA 4ND8A 2G06A 1NGSA 3TI0A 2J0QA 1UKCA 2FQXA 4WKOA 4CN8A 1MIOA 3NDPA 2QX9A 3SX2A 1L5YA 1KDPA 2KKVA 3MWJA 1C3LA 1R4NB 2RK3A 3WNZA 1E9AA 1VJTA 2QB0B 4FBTA 2E7ZA 4ALMA 2LUOA 1J33A 4OAQA 9ICFA 2X5NA 1UXKA 1UM9A 3WWYA 3ZE7A 3WWEA 4XQ8A 4LDRA 1U65A 2P9TA 4DLBA 1NYQA 2RD2A 1WULS 4BWMA 1Q11A 3RREA 2FRDC 4YD1A 5JNUA 3F5SA 4GLBA 5MFPA 1XU9A 3EWAA 3M5DA 4ZQIA 4EK9A 1ENPA 3W5IA 5SZJA 4WLNA 2D2EA 2AUNA 4EUSA 3N8NA 4DBZA 4MDYA 2WG2A 3VR6H 4U00A 3OM9A 1XEXA 3T5KA 1LW6E 2X76A 5LKRA 2XRFA 1ZWKA 1G9TA 3OG9A 3TSAA 1U3UA 1NVWQ 1YQQA 5C5DA 1DBIA 4KE8A 4PHCA 1GUBA 1OT3A 4MVJI 5LQRA 5J0QA 1S76D 2GBCA 1T91A 3SWWA 2P2CA 3W2TA 3D8NA 1LF0A 4B6PA 2WB2A 1O97D 1WL8A 2PSEA 4B82A 1Q83A 2H29A 4BB0A 1ZHHA 2FSFA 4Q03A 5JV5A 2WTMA 2RKWA 4IJUA 2LYBA 1J07A 1XPJA 2CV1A 2KIWA 1VKNA 1I80A 1XCMA 5EMHA 3G2IA 1O96B 1FXWF 3OQMA 1K4KA 2WJWA 2H4WA 1P7WA 3KZVA 1RXVA 5ALZA 4P3PA 1SCUB 1QDEA 4RH1A 1KH3A 2XGJA 1A98A 3C15C 3WV5A 4BKUA 5CDSA 3R5TA 4Q12A 3T1TA 3JW8A 2OCDA 3Q0IA 3W3AD 3IS3A 5CGQB 1B16A 1X7XB 3C7TA 3VXKA 3PVXA 3D1JA 4YI3A 3VJKA 4CXMA 4KLAA 5JSUA 1MB2A 4RVFA 2VDWB 2NO0A 1O4WA 4NLZA 2QPAA 4OL9A 5K09A 5F9FA 3LE8A 3NFRA 2FR8A 2ZTDA 3GGOA 5EMNA 4FHDA 3TADC 4CM4A 2FPKA 2ZWIA 5B6PA 4X00A 4BNWA 5I3ZA 4OJ6A 2X15A 1DIBA 3ZVKA 2FPWA 3KPJA 1UMBB 1SBIA 5HCIA 3AEQB 3MW8A 4JI2B 1PWHA 2H17A 3AH8A 3PO4A 2F8LA 2FG7C 4D41A 1ACJA 3TX2A 3R7WA 3E70C 2BM0A 4BL5A 4RGQA 1I9CA 4D8YA 2HIAA 3ZWCA 2X7JA 4QDXA 3CSUA 5IFLA 4JJ7A 1XYYA 3IFSA 1LX6A 7ICIA 4MRMB 2YXLA 1UP4A 4ETIA 2PSDA 4ZVLA 4IW3B 1XD8A 4JP3A 1LF5A 1T36B 3NUZA 1O6FA 1K97A 4N54A 4MVYA 2BCVA 1JN3A 2M9MA 3ZDDA 4H7PA 4KL8S 1MAWA 1CDOA 3IDOA 2P6OA 1KVSA 4H0FA 2JGEA 4P93A 3LWLA 2JJYA 2C4VA 4YMUA 4CEJA 4EH1A 1S89A 5JTIA 3O3OB 2ISPA 4RW0A 4B6SA 4QFCA 4KN9S 5I7UA 3EJWA 5BO5A 1QIKA 5TB5A 1JW9B 3K09A 1KMIY 3DS8A 1A4UA 4WKGA 1U2RA 3GLSA 3GZTB 1SV4A 1LI4A 1H2AS 1EFLA 4B9AA 2YFQA 1CEXA 1MA3A 4DKJA 1E3SA 1TLLA 3U4IA 3AW9A 3GRFA 2HYDA 4XCXA 2QTBA 4JLPA 1GP2A 2QXYA 4CMIA 2KX7A 1R66A 2GN6A 1VKJA 3UB3A 3LWZA 3HGTA 2ZAGA 3GEEA 2WUEA 3K0KA 5BYBA 3TTYA 4DREA 1B8UA 2GO1A 4P0QA 4UCFA 2BFFA 4B84A 1FP7A 1FQKA 2PE5A 5JANA 3R5XA 4RPYA 2K8BB 2Q99A 5EUBA 1G7CA 1T4CB 2NV2B 3RYIB 1XTKA 2WM2A 2PMKA 2OV3A 2EKLA 2BHLA 1NVVQ 4OUDB 4BEBA 4FOSA 2L69A 1OXSC 1UANA 5LP6C 1AUVA 1VSBA 2ZUUA 2IHMA 1RS0A 5ENVA 4YALA 3V2GA 1X13A 4DQSA 1BMFD 3WJ1A 4YXMA 1XE3A 4ECTA 5BSKA 1NJ6A 3QE3A 4FMPA 3K6RA 2D2IA 1U63A 3ONWA 4Q45A 3QVTA 1CZHA 4LHVA 4MVJP 3RVNA 3ZVMA 1V7ZA 1WCYA 4CI9A 4LOKA 2WVAA 2FA9A 2J6UA 3WU2U 4CL8A 1P7CA 2D3TA 2XYGA 4PAMA 1NXOA 3MSCA 4B3GA 5F4ZA 4IVPA 4KQHA 1EMDA 1DG1G 1CRWG 3H6KA 4BTVA 4NS4A 3U49A 1MSWD 5K8UA 1UOOA 3WQBA 4DRXA 2ZB3A 1HE5A 3T3OA 4QU8A 4U2EA 1RYHA 1CNMA 1NG1A 4ADSG 3EQ8A 4BJ6A 3KSUA 4Z4EA 3QBVA 1ATIA 5JNWA 2XX3A 4HN2A 1YS6A 5K51A 1PFQA 2OVFA 1RWNA 4KK3A 3OUUA 3BREA 2ZJ2A 4Q37A 3BA1A 1VG1A 1FDOA 3DPIA 3ZDCA 1I3OA 1K8QA 4DBVO 3N0TA 3H9EO 4LEIA 3EFBA 4IF6A 1U90A 4ZC8A 2A59A 1ZMXA 4QUDA 1GFWA 621PA 4PO3X 3UUFA 3NJRA 4LDNA 3EEIA 2QW8A 1EBFA 3OESA 4MQFB 1CLUA 4E08A 4GNRA 3M9OB 4YRPA 2HQOA 5CFOA 1L1FA 3SE0A 4RMHA 3OEWA 1X6VA 4AYBC 3P2OA 4J49A 3NJ4A 3KUKA 1Y3HA 3QVSA 2VDJA 3ZZMA 1Z88A 1OI4A 3HI4A 3SZUA 4BVHA 1BWSA 3GELA 4OHRA 3G1UA 4JP8A 2Q46A 4EYSA 4A8PA 2V9WA 1C2TA 1J20A 2ZJ6A 2R97A 4OI2A 2I3BA 3RO7A 3NTXA 2NW6A 1TXGA 2TMGA 4QG7A 4RA6B 3W05A 1YC2A 1N9GB 4DOCA 2QTVA 1HO3A 1CQJB 4BNFA 1SZDA 1N78A 5JPIA 4BFTA 3W6NA 1DIAA 3U16A 3LFHA 1KL7A 1CEEA 5GJVC 2JHPA 5TR9A 3KQMA 3A9WA 1K2VN 3SJAA 4CDMA 2QRUA 3OC0A 3SM9A 2ZSKA 1E7RA 4Z2YA 1RQPA 4ZQGA 2QJOA 2J5RA 4AP5A 4KDRA 2JNWA 3RU9A 5EJ5A 1E79A 5J1TB 4FMBB 1FX1A 5T14A 2PSFA 4RPIA 2LIPA 3AVVA 3IMCA 3PC6A 2HCRA 1XJ0A 3QELB 5IHXA 3H9QA 4MWBA 3MTDA 3CCBA 5A6VA 4KHZA 3KKLA 3ZCVA 3V46A 2EGUA 5BN1A 4RTMA 3L7JA 1KAHA 1H65A 3VTZA 1GG2A 1FNNA 3AETB 4CIDA 4L7QA 3HVHA 3G0HA 4IKOA 4AWBA 2Z2IA 3WG9A 3T7KA 2GX6A 3D5QA 3QPBA 3FYDA 4O3RA 5BUSA 1SXPA 1IQRA 1DCKA 2JH7A 3V7UA 1SUWA 4YXWD 3KSDO 3H42B 2JA2A 1PE0A 1X87A 4UJ5A 3SEFA 2WWFA 4Y2UA 1FIUA 4DDVA 4XYGA 3GRPA 1NFFA 3G8BA 4I2IA 3V6LA 1GZVA 1SXEA 4L2IB 4G1UC 2OKGA 2WP0A 4F5NA 2JFWA 3VR0A 2GDJA 2YMLA 3IOMA 1WDWB 1E7SA 2Q0ZX 3RSZA 5K3SA 4ED2A 1O6ZA 3HVKA 3EOAI 1V41E 1J2MA 3TLGB 1C1HA 1DBWA 3QEBZ 2IEYA 1NMXA 1UXJA 3SR4A 1FUYB 2WF5A 4YCXA 4RF5A 3CZ5A 6PFKA 3NATA 3PX3A 1GKUB 4Q9DA 3NEAA 1GARA 2IHNA 5ER9A 2KP7A 3L8CA 4PG8A 3VDRA 3K0FA 2XA2A 2N46A 4GM0A 2XTMA 4BNGA 1QJCA 4NI5A 3H5OA 4GM1A 2ETVA 3C4JA 4BPBA 4R1NA 3O9ZA 3HG7A 3GOHA 3U19A 4OXYA 1WS6A 1N9ZA 2EZ4A 4QYMA 1XHFA 1M8FA 1S4MA 3P0JA 3C5VA 4OFZA 1N33B 2HYIC 3I64A 1F8UA 1N6KA 1JWLA 3NT5A 2G07A 1ZI9A 3ZQKA 3MZ0A 2AD5A 3C8ZA 4YRSA 3KIPA 2CJFA 1KZ6A 2QL5A 3ZPXA 4JODA 4N39A 3RVKA 4OVKA 4PHEA 3LLMA 1MG5A 1OU4A 1UXIA 2JIZD 1J5PA 2W6ID 3CVXA 2P4HX 5HILA 1XC9A 1TMKA 2OAGA 3GEHA 3H97A 4J90A 1BMQA 4EVSA 4QWWA 2IHTA 4MYSA 3PY8A 5M29A 2XR1A 2A9OA 2OEPA 1NK0A 7ICEA 8ADHA 1A7JA 4CLEA 3QU9A 1J0EA 4C80A 2BCUA 3ZU3A 1W5EA 1AS0A 3BZCA 4O2AF 3ZH9B 3BHNA 4N41A 5DM1A 1P2TA 2P67A 3W1EA 1I1NA 1PV4A 5CM2Z 4MINA 1VMDA 4ZCLA 2XDQB 3IDSA 1O95A 2OWDA 4LJ6A 2WAMA 2WG1A 3K9CA 4HZGA 3T5CA 2HDWA 5LBUA 3ISTA 2VYVD 1AQJA 3ZD9A 5FWYB 1Z47A 2XCUA 2Q1XA 5BV1A 2I8AA 2JAHA 5HCNA 2G36A 3JQGB 4EB0A 1A4IA 3KSMA 1U0BB 5HA5A 2V9ZA 3FA2A 1TQDA 3UW3A 1ZD2P 1M0WA 4N7BA 3I42A 5B66U 5AK6A 2HF8A 1X7GA 4FLMA 5TPZD 3PVCA 4TTIA 2GZ3A 2Q45A 1MJFA 2H65A 1RLTA 1L5KA 1XELA 1IXRA 1XMSA 2VRBA 4C2TA 1YFKA 2G4VA 2POQX 1Z62A 5F9LA 3U7FB 3IKTA 3T94A 3SHQA 2RMKA 3Q3IA 3O8CA 3NP7A 3HFSA 3ISBA 1PCXA 5TS3A 1Y1KE 2JASA 2YXEA 1M1ZA 1V4NA 4QVKA 4TTSA 3NETA 4DDHA 2TMKA 2BH9A 4MUJA 3VNQA 2PUTA 3M4ZA 1VPEA 1K6MA 1TK9A 3GJ5A 5C4MA 4GVXA 2GNPA 2JIBA 5AO9A 3NPAA 1TYCA 3RU3A 2W8BA 2IEAA 3LCRA 2P78A 3EPJA 4KTTE 4QOJA 1BD4A 1DV1A 4FD3A 2A0KA 3DL4A 4JI1B 1JMYA 4FKBA 3HBLA 5KYWA 2IA6A 5AR1A 4M4SA 3THXB 3ZJ5A 2Z2XA 1ULBA 3LVBA 5FIUA 1VIYA 3LA8A 2IY9A 1L5QA 1NK8A 2YJTD 1JKIA 3KT8A 4B31A 5CDUA 4IS2A 2H2AA 4WNAA 3QX8A 3LLUA 4LRUA 5EN4A 1E92A 5TDHA 4LRTB 3SZGA 4O1HA 5IKMA 4WN9A 2XLBA 5A4IS 1K66A 1GZSA 1NN1A 1ISMA 1V5IA 3ZIUA 3D7SA 1AK9A 1JTVA 3H7IA 2D0IA 2GKOA 5TQ2A 3FM9A 3HKDB 4L8WB 1ZJ6A 2PVCA 4P6VF 1NZBA 4CR7A 4UTPA 5DBIA 4FYIA 4XE5A 1HF3A 4A3SA 2QN3A 2DWUA 3F2DA 2Q3BA 4XGKA 1NSYA 1H69A 1QP7A 4MQ5A 1M1YB 1KQGA 3ET5A 4IQ8A 4QM7A 5MN6A 2OESA 3QQ5A 1FBNA 2UXCB 4EM6A 4BWVA 1FP4A 3NNDA 1KBUA 1QG2A 4YT4A 5FULA 3MGVA 3K70D 2GOYA 1SHLA 3QENA 1ZQQA 3N59A 4UTRA 2C2XA 5EZYA 4B8ZA 2Q4BA 3G9ZA 1H9BA 3G5UA 4E0DA 1U28A 2M6RA 4H1VA 4ETMA 2KNJA 4HNGA 3D6FA 5CLLA 4OO1J 1MOQA 4GP6A 3S2YA 5KBYA 2VZEA 4EYHB 3L2OB 1FP2A 3UTCA 1Y3IA 1UFOA 1SBNE 3B6MA 4MR8B 4PYMA 4TLCA 1C3OA 2H2GA 1MAAA 4BKMA 5ECGC 4N40A 1WTAA 3UMFA 4Z1OA 3O47A 4CG2A 3GN2A 4KE9A 5EXTA 2VQSA 2HK8A 5JZ9A 4TL7A 2FZ5A 3W5DA 3EB9A 4LGVA 5ILQA 3LOQA 1RI2A 1S2GA 4OXKA 3WNDA 4YG2A 3UQYS 3SIWA 1W581 1ZIYA 4KXFB 3CH6A 2WFZA 5AUNB 1AUOA 1KQNA 4C6TB 3KVOA 3A06A 1MPXA 4RKYA 4UE3S 1ZU4A 2J9YB 1XTPA 5KG0A 5C7OO 1QPZA 2QE7D 3GI1A 4F5YA 5A9RA 4OI1A 3JQ6A 2GCNA 4RZQA 2HV9A 3KKZA 1ZOLA 4HGYA 2FPGA 1T1JA 1TUBA 1B4DA 3L77A 1ZD4A 1D5CA 1JF8A 4I5GA 1FS6A 5BQOA 1PAUA 1TQHA 3QHQA 2XCAA 3IP9A 1Q91A 1V8ZA 3KWMA 1F1JA 1D2AA 4HXGA 5IFKA 1ZGBA 3PTLA 3E2PA 2FV8A 3DM5A 4X97A 4L4UA 1W6UA 3PYXA 2AXTU 1BD3A 1TD1A 3SDBA 5DM60 3ESAA 1E2EA 2FFJA 4E4TA 3RAEC 1KKXA 4XUEA 3R6GA 1S6YA 1ODSA 2Y3IA 3ME5A 4XR9A 2QI9F 4F1KA 3ZU5A 1Y4ZA 5DHSA 2C4WA 1W5BA 1PZEA 3RFXA 1NMQA 4R1TA 4C0LA 2ZYGA 4P7FA 4S24A 2ZRIA 1S10A 1DFHA 2Y1OA 4DFJA 2OORA 1B1AA 5ENZA 1EH5A 2O9JA 5DX8A 4NBRA 1PGNA 2ZE8A 3GA5A 1RZRA 1HTWA 4P4NA 3F9IA 2R1TA 1WMFA 1L7EA 2YRWA 3DOHA 2HPAA 4K6KA 1GPWB 4M0CA 2VZ8A 4QASA 1ZQBA 2NRVA 1PVQA 3QVJA 3TTUA 3KXDA 1UIMA 2BEWB 2XUPA 4BMSA 1DJOA 4XIJA 3GF4A 4IL6U 1S7CA 1L9XA 2LCQA 1WBJB 2ZRHA 1X1AA 1KGDA 5JD3A 4Z6FA 3DZCA 1PG0A 5HWSA 4R69A 1T0JB 3DNMA 4IHAA 5BMVB 1V43A 5EE5B 2QZSA 3WHIA 3ZJYA 4QOIA 4E22A 4WNCA 5EWMB 4M8IA 2NO4A 5IP5A 1VJ1A 4MS1B 5DLEA 1R4NA 5GADl 2AMVA 2QB0A 4B81A 2BCEA 4R9NA 4CMIB 1AG9A 1I36A 1K5OA 3L7BA 3P2MA 1GSOA 1AXRA 3T7JA 2OQVA 2AW3A 2F9LA 2W6NA 2YBDA 5E7QA 5DGHA 4BV2A 1ZJZA 3IBCA 3QFRA 2FFBA 1F2VA 4EHDA 4NM1A 5G5HA 1MTOA 2HBRA 4Z54A 1UA0A 1J9EA 1T9AA 3MDAA 4XA5A 2UUOA 5A3RA 2EJVA 2JC3A 3OQPA 3OZGA 1K06A 3VHRA 5J2TF 3KR2A 1WKVA 3IDQA 1XNQB 2V6JA 5DH9A 4TKMA 2GLEA 1H3NA 3HP1A 4EFDA 1EXMA 3LF2A 1TA0A 4GOXA 2WWXA 5AHWA 3COSA 4WLEA 2VWHA 4WESB 1FDWA 3AR2A 2YUIA 3RC3A 3FN4A 1E5XA 4Q3AA 1EM6A 3VYUB 1C20A 4I4CA 2P4UA 4G8BA 3W8RA 5B1SA 2XDAA 1XUOA 2W70A 1TE2A 2KE5A 1Q15A 1FFEA 3LLSA 4NE9A 2PZEA 4G97A 4KC0A 3N0WA 1O96A 2JGMA 3G1TA 3N4MB 5MGBA 4Q82A 3ZW9A 2R5NA 4NLCA 3URKA 2EBUA 4AUEA 3I34X 5FA6A 3I9KA 1SCUA 4I1VA 1QXSA 2JJMA 1ZGZA 1XMVA 1MQSA 3IQIX 5HKOA 1OV6A 4AUNA 4RTJA 2HJ9A 3V2UA 3IAS1 4PSCA 4U63A 1JR2A 1QFZA 2B3TA 4OOFA 1X7XA 1TCVA 4QM6A 3LGSA 4EG1A 2VDWA 3DDSA 4BVFA 3I6MA 3L7IA 1T7PA 4RXTA 5FDFA 1JJBA 1XNGA 2AE2A 4R2IA 2BFAA 4XWGA 3IDFA 2Z7JA 3ZGZA 4NEHB 1KWGA 5KFMA 2UAGA 5CD1A 1QTNA 2JS7A 1L9KA 3RWBA 3RW9A 1R4MB 1N0VC 1UMBA 3VR4D 3AEQA 5ALLA 1JA0A 1IONA 5KNDH 3TTVA 2MSDB 4GFDA 2FZVA 2A0FA 1A71A 3N2LA 1ESNA 4E1AA 1GM5A 4BP9A 1SCAA 1D4FA 2ATCA 2ZCUA 2W2MA 4WZZA 4QPCA 1Q0LA 1LNZA 3PHHA 5DKWA 5A05A 1LI5A 5DGDA 4RBNA 2AJQA 3A6LA 1U02A 3NV7A 4RJ2A 1JDVA 4MRMA 1YL6A 3PT5A 3FAKA 4TTJA 2CYAA 2E1RA 1JR4A 3WWOA 1T36A 3IHQB 2Y05A 1H9CA 4HL6A 4PBSA 5E1OA 4N01A 4Y2JA 4IIVA 3W90A 2ZR9A 3HB9A 1F51E 2JXJA 5J40A 2Z95A 2LW7A 3SJBA 1LS1A 4G0XA 1X38A 4NNPA 3RTVA 3NTLA 2IK8A 2X8LA 2VT3A 1RCUA 3WK5A 4UXIA 3DEJA 4G85A 4YJGB 1NUHA 4IJQA 3CLRC 4UM9D 1GEEA 5E79U 3L7LA 3M9LA 5B30A 3OE5A 5KNCH 4V0SA 7ICVA 4MJ7A 3X44A 4K9SA 2BGUA 4A8JC 4HNHA 5IIKA 2XOEA 1IJKA 2BMVA 3E82A 5CTAA 5JAHA 3A9TA 2R11A 1MT0A 3DHWC 1NLFA 3CY6A 2GJ9A 1YT3A 1U7WA 1UKZA 1NQOA 2WU0A 1QYVA 3FI0A 3DVQX 2AN3A 2WKWA 2J67A 3P2YA 4HPJB 2XI9A 5CG2A 3CISA 2WPDD 1M2VB 2WOJA 1PYOA 3L4BA 1NDHA 1RD4A 2O05A 4O3SA 5FLXA 1OI2A 4M1ZA 3OCJA 2G9NA 2FWIA 3E3OA 3OIGA 3P71T 2ASLA 3WWDA 3LDFA 4K1XA 2IYRA 4UBBA 9ICJA 2EZUA 4KLGA 5F2EA 1Z2CA 4LZJA 2GJ8A 2B20A 4P3NA 2IW1A 1T4CA 2I2DA 5TT1A 3RYIA 3SI8A 3PCXA 1LBQA 3TR6A 4XQEA 1RAIA 3M9NB 1ACLA 4OUDA 2AQ4A 2HWXA 1P18A 1WCV1 4ED7A 1L7VC 4FDVA 3HRHA 1OGIA 3BERA 5HUHA 3L0YA 1PBTA 2XWJI 2FW9A 4UB5A 2C9MA 2IYXA 2TS1A 3I9LA 3K0HA 4DIBA 1B6TA 5C9ZA 4ZZ2A 4UPEA 3F5EA 3GMSA 5CYPA 4G0VA 2EDAA 4FYHA 1GL7A 1B41A 1YR1A 4HAIA 1WMDA 3O1LA 2P68A 2PGXA 2Q1WA 5JDCA 1SNYA 4KN5A 5CHYA 2RHJA 4PLFA 3QJ5A 3IUYA 4XUDA 5FI0B 1QRUA 4X66B 1HDRA 4FZMA 2VF8A 5HJ7A 3M9WA 1LK7A 3AFNA 5A0TA 3VVMA 2HCFA 5FBZA 2ZTLA 4HDMB 2CFIA 1E0AA 3IXQA 4PZ0A 4KSBA 1SCNE 3RVBA 1ZCJA 4JDPA 4RLFA 3UB2A 2R18A 1JLKA 4P80A 3B7PA 1TEXA 1ODTC 1ZD8A 3WJAA 5BT8A 4MQFA 6LDHA 4RWEA 1BXRB 2YN4A 2RGBA 5EKSA 1E9CA 5L9XA 6ABPA 3KAQA 3F2CA 4KNVA 3CT4A 1NV9A 5JO0A 6GPBA 1F44A 2ZI5A 1IHYA 2F3TA 2ZG6A 2XVXA 3LUDA 1ISPA 4FIDA 2G9VA 1E99A 3IC5A 3KCNA 2GGSA 4J0CA 2TRSB 3TARA 1YVDA 2JIOA 1PWXA 3LM8A 1OBOA 1OHHA 4C7JA 2P2DA 3BSYA 2WF7A 1WEHA 1BXKA 1TCUA 5IT9A 2QJTA 3GP5A 4GOND 3OZRA 3OQVA 4TM7A 2FWRA 1SR8A 4MRAA 4ZDKA 3HY4A 3WTCA 1XO1A 3JWGA 3OOSA 2ONKA 3AXSA 2D2FA 4RA6A 4A1FA 3DVLA 4FYXA 1UBTS 3B3FA 1N9GA 1K7CA 1CQJA 2D1TA 3DQPA 4KLNA 4ND6A 1PTJA 3I8OA 3KQVA 1RDFA 4GRAA 3Q8XB 4M47A 4B47A 5AXCA 4IEIA 4OQMA 3CPJB 521PA 3EYWA 1JI3A 3ER9A 2Q3CA 1Q46A 2XOXA 4H7DA 4ESOA 4HB0A 5EJ9A 3HJEA 3QELA 3D6AA 8ICUA 5IN5A 3HX0A 3ET4A 2AJLI 4OJQA 2CFSA 1X7HA 1RWOA 3CX4A 1M10A 2VJBA 3WDMA 1IOVA 5KNBD 3AZOA 4YYZA 3AETA 3QXCA 3WK8A 4I7EA 3I1JA 1S1MA 2H0QA 2XKBA 3L6BA 2X3FA 3BH0A 2NU8B 2AJCA 2BKEA 4MDFA 4JBHA 4CCSA 3FTEA 1NC3A 1GZDA 4WNAB 1QH9A 3KE8A 1WDLA 2JH9A 2XCTB 2OCGA 4W1SA 2DHRA 1HOTA 4DQXA 3KT6A 2HVIA 1YGYA 2NO1A 3G13A 2XAUA 2QIPA 2QRVB 2D4AA 2DERA 3DLAA 4H3SA 5TRTA 5T4EA 2ZIFA 4L2IA 3T7CA 2UVDA 121PA 1OLXB 3FDXA 2GFHA 1B42A 3DT9A 3HN7A 4A2PA 3QE4A 2MMGA 3OIFA 3HXLA 1OA0A 5L9AA 3TLGA 1GQRA 3RC9A 4YMTA 3BB4A 3UQZA 3H2GA 1SU4A 3CZQA 4ZOLF 1SZHA 1RWMA 2AX3A 2BFWA 1HY3A 4ZU6X 4F4IA 3K09C 2PQ6A 3RK0A 3LC1O 2I7DA 1ESZA 2BUBA 3OJFA 1D8AA 1RI1A 1U0HC 4KLJA 1U3FA 3MEQA 4D3XA 4HGQA 3KFXA 1H1TA 5GVSA 1UBUS 3DP7A 4PG4A 4HYTA 1CP3A 4AFNA 3PQ5A 3TPZA 5B3AA 1Y8AA 4YCJA 3WGVA 5JZOA 1HURA 4UEKA 1Y6FA 2BWJA 1SZJG 3MOIA 4P58A 1SOWA 3ROFA 3WLKX 2P91A 4JVLA 2IS2A 4K9OA 4EATA 1KYVA 3LG2A 3L9XA 3T9CA 4A4DA 1DIOB 3FRIA 1U0GA 1LWNA 4GRIA 1E1KA 4GPEA 4BRSA 5J0SA 4P53A 1S0MA 3P45A 3RVLA 1O6GA 2Y66A 4QBGB 1TZCA 4A73A 4J4BA 5K0JA 4JT8A 2NO9A 3NTVA 3RWOA 1WSWA 3SC4A 2D59A 2G5GX 5KOYA 4MVJD 4O4LF 3V7YA 3P5SA 1EGMB 4PLHA 1XRMA 1KDRA 2V03A 2QK4A 1GPNA 4D6YA 4X7MA 1ZJ4A 4G0OA 5DQHA 5KQSA 1OBCA 3IKLA 2E1FA 3E05A 2PMFA 2RRDA 3I6YA 4U7DA 1I5OA 3B6ZA 3L8ZA 1EVEA 2XDQA 3UPDA 5IUNC 3CEHA 1KW4A 4X3CA 4D46A 5BNWA 1QIFA 4OIMA 2IPAB 1I4TD 5FWYA 2CNBA 2ZPUA 3WC4A 4M7PA 3H1GA 3JQGA 1UQTA 1NATA 5TMDA 1C9NA 5TC4A 3C8MA 3WFIA 1I1OA 5AK3A 3SLKA 1DC4A 4URUR 1Y9ZA 4A82A 4I9GA 5H02A 4DMMA 2PUGA 4QOHA 4LJKA 4GYWA 5IDWA 3ADBA 2BY4A 3RVPA 5JADA 1J2EA 1NK7A 4FGKA 4KXXA 1W1IA 5DFAA 4P4OA 2OD7A 2X1LA 4M0EA 2I5PO 2CV0A 5CA0F 2ZBDA 2QT9A 4FS2A 3SSMA 3WQRA 4I5EA 3MN1A 2GA8A 1L4UA 5JY6A 2J6HA 2A0YA 5KFYA 3KUDA 2DKZA 2KJ9A 1R0BA 1YQWA 4ATNA 3Q88A 4M83A 4NG5A 4U2DA 3AR5A 4RIGA 2M6SA 2PFSA 3QZ7A 4OO3A 4PHPA 5LL6P 3GPDG 4I5DA 2AFIB 4Y6GB 1ADJA 2QR3A 2G25A 4ZEOA 2XYPA 4L75A 4I1SA 4QA9A 3WIDA 1R4ZA 1HM5A 1PL0A 3DH0A 4XUCA 1MRNA 4QFMA 4ZI7B 1KH1A 4ZDWA 5KYUB 4EY8A 3HSSA 3OKPA 4NLLA 3ITDA 5K3EA 3THXA 5K05A 3KD3A 1PS0A 2FRVA 2Q1SA 3K3PA 3VUFA 4QZIA 5A7FA 7ICUA 2RK4A 3R0IA 2RH8A 1KFEB 4MDEA 1F2UB 4QX6A 3ZVRA 1U3DA 3PENA 3L93A 3PVSA 5IJAA 2QP9X 1I10A 2E8PA 4LKOA 3FCXA 1SBHA 1CS0B 1MJNA 1DQNA 4PHHA 2KZZA 4MRNA 4HWGA 3K9GA 1TCCA 1YQGA 2BJHA 1M2JA 3HKDA 1TLTA 3GEPA 3LVWA 2DAPA 1OPXA 4G0MA 3DVRX 1RQ2A 1UAAA 3I2JA 3KBOA 4FOTA 1TKAA 2J3HA 4DHWA 4QFBA 1NZDA 3CVOA 3NWJA 1M1YA 1PDOA 1FO4A 3GHHA 1WAMA 4P54A 2PWAA 5K1ZA 3JYQA 2EERA 5ADHA 5HMLA 2W71A 3O9MA 4B3MB 1U7ZA 3RRFA 2I1VB 4L5JA 4GC6A 1AHIA 3ZY5A 1W4LA 3N3AC 1ZMRA 3IPCA 2JI9A 4QHTA 4FGJA 3E9RA 5FOTA 1A6SA 4H6WA 2HJSA 3GX1A 5I9SA 3LWMA 1N5XA 3EUB2 2NG1A 4XD7D 2G9RA 4GOJA 3P94A 1YZGA 2IHUA 3QWFA 1GAXA 5H3CA 3NIGB 1SKQA 3H75A 3SN6A 2H9YA 3MYRA 2CL6X 3FLBA 2A5JA 4IDOA 3C23A 3SV4A 3PKZA 3PQFA 3WJ2A 2G40A 1NVMB 1LV8A 3ESRA 1Z3IX 2AG5A 1T2EA 3EF0A 2CJPA 4MR8A 4IDCA 1QOPB 3EAQA 4FZJA 5EE3A 2HSWA 1Z68A 2DR3A 3D6MA 1DOQA 1QF6A 1ULTA 1J22A 3RB4A 1R8YA 4KGZA 4CT4B 4R6WA 3R9WA 5LOVA 2MSLA 2HWYA 3GO4A 4OA5A 4UASA 4PINA 2FPRA 4PZ9A 3DNPA 2RONA 3DVSX 3BL5A 1F4PA 2J6TA 1TM4E 4R0VA 3PXGA 4C6TA 1YL7A 3RKRA 1XWIA 3CVVA 4R9RA 2DWPA 2XT6A 3GRZA 5K8TA 3ITEA 4MVJM 4M0UA 4Y2HA 5DBBA 1T1SA 1XCPA 2CDNA 3TR5A 3GMDA 3FDJA 3LRTA 5JQWA 3ZK9A 1B0UA 4TSFA 2W6ZA 4KR0A 2J4FA 1ORWA 1JQ5A 2IXBA 1UBSB 3VTKA 3BMCB 1F06A 2LCIA 3KAJA 2OY0A 4UUAA 1PG2A 2ZRJA 3QWAA 3HJNA 2PXCA 3NO4A 3BDVA 3MBYA 2ZIUB 1AKMA 5GONF 2N1BA 3FPGA 4Z9FA 1Q1ZA 5CJ7A 3RUEA 3LPNA 4AY5A 2OLJA 2ZRLA 4K8RB 2WT4A 4R68A 1HDCA 3M49A 5KYVA 3A2LA 1JT2A 1OI3A 3VDNB 1R5JA 5CEEA 4ICAA 1WW2A 3B2QA 3FW1A 2O8CB 2D1FA 3QJGA 4B75A 2XNCA 1JZSA 1O95C 4O1IA 2PUVA 3EPGA 3TAQA 3MMSA 2L17A 3KELA 3FBWA 2BH2A 2VTKA 3PFCA 3B9JA 2NV0A 4NXNB 4FR5A 4GPAA 2I4LA 1DWQA 5H70A 3DVAB 4DB4A 4DXDA 1EX6A 2REOA 1W73A 5JJBA 1XP5A 1TQ6A 1ZH2A 1SIWA 3OFSA 3JRWA 2BEWA 3RBXA 3VDQA 2BE9A 3T3MB 3ADPA 4QWMA 1YFLA 4NCHA 1LKZA 5BYAA 3TEMA 5HTOA 2VBCA 5COQA 5KPJA 5BMVA 4CIBA 1WP4A 3VZQA 3QUAA 2EZTA 2O2ZA 1MO6A 1RMQA 4YP1A 2IUYA 4KNWA 1TYBE 1CZKA 4YCCA 1COZA 5EWMA 3L84A 4K6FA 2BV3A 2ZROA 1E2HA 2QQGA 3FIJA 4MS1A 5JAUA 2MT9A 3AR4A 1E59A 2O7RA 2WMYA 3SSAA 1XNSA 4AY2A 1DL5A 1E66A 1P29A 3IL2A 3H2JA 4DOMA 3D8UA 3DO6A 4PG6A 3SM3A 5B64A 2GK6A 4ZCQA 3BT7A 1NQVA 2JFZA 1BKSB 1E9DA 3UWSA 3OE7A 4IRKA 4HBZA 4I36A 2IODA 4LFAB 3HXKA 2PT5A 2J0SA 4PIPA 1Y5MA 1PI3A 2A58A 4R98A 3KYBA 3V4RA 4I9NA 3H4TA 5D3ZA 5KC8A 4AO6A 2A78A 4U2KA 3U6KA 2NSLA 2VNIA 4EEKA 1EAYA 2BDEA 4PSVA 4X5OA 5KG4A 1NHGA 2OFPA 2P6UA 3I8XA 4CMHA 1NXXA 3MTBA 2J1LA 2KEYA 3I83A 1T0UA 4G0NA 1Z5ZA 2HDOA 5EA2A 1X9WA 1QYXA 5JHHB 2ZK7A 2EJTA 3PJDA 5L53A 2FEOA 2XUOA 1EKXA 2YZNA 3PR2B 4Q00A 1UJ2A 3E15A 4JR1A 4UB4A 3R7DA 1VE3A 1RAFA 4YVZA 3AHEA 1OF1A 1U9CA 4LWPA 4WESA 1PVVA 3WYNA 4PYNA 1JSZA 4RXUA 3SQMA 1UKVY 3EDRA 5A9SA 1PLKA 1UFRA 2J07A 3PC4A 2PX6A 2JEIA 3L04A 2BF4A 5ALIA 1OWLA 3M9XA 4JBWA 2GEKA 4TUSA 4FFSA 4D02A 3WRXA 5KYNA 1ESDA 3C6MA 2JCXA 1IZ9A 2Q1TA 4GO1A 3K8YA 3QPWA 1EX1A 3U4GA 5FBKA 3ECSA 3UC5A 4UBIA 1G98A 2HR1A 3RJZA 4DTIA 1U28C 2B98A 2C2OA 1P1BA 1RLUA 2BPCA 1QIIA 4GC7A 3C1AA 3ZKAA 4YDHB 1KYIA 1Z3CA 3FCEA 1EP9A 4XD2A 4YAUA 1P3DA 2OSVA 3CVWA 4BDSA 1J39A 5DISB 1N0IA 5CIYA 3A7EA 4BYGA 8ICLA 7ICHA 4RLHA 1QS0B 4L07A 2QTWB 4DDMA 4B3IA 1KZGB 5HHTA 3VKGA 1R4MA 5L3QB 2QW1A 4EY6A 1U98A 1UDRA 2J0VA 4QJ4A 4HAXA 3B60A 1T26A 3E61A 1WXWA 5C5CA 2JD1A 4GVLA 5IUJC 4FMDB 4NV3A 1N62A 2QTMA 2IIVA 1Y6GA 4JYCA 1XF1A 3A28A 4MW7A 1U6IA 3CR3C 2H3ZA 3EUAA 1H4VB 1ICEA 5CP8A 4KFUA 2G8NA 3MRSA 2P4EA 3IVMA 5D7BA 1NT4A 3EOZA 3FFWA 5BNFA 3H18A 1ZVJA 2Y1JA 2NU7B 3GAAA 2ZZNA 4GE3A 1JDJA 3F2IA 1L3UA 3L0DA 7ICKA 5H9VA 3N7TA 2C3PA 4UUQA 1KERA 3DMRA 3TRHA 1OY1A 4X3OA 4KVZA 2YASA 4HK4A 4ZV4A 4YJGA 2B9VA 3FLMA 4FKZA 4HWSA 3N05A 1AD2A 3CSSA 2Z9BA 2UYOA 1SHJA 5CA1B 2QY6A 5B58T 5BYJA 2AF4C 4NLNA 3H2IA 3IQGX 1TJ3A 3COPA 1J0DA 2D00A 3NANA 2QVXX 4URWR 1ZQEA 5H81A 1OD6A 5DTEA 4GOMD 4HQOA 4Q0MA 4OFXA 4NMWA 3PYLA 5JWOA 3OZFA 1KOGA 3RR7A 5AHOA 1GRCA 2LDBA 2A1JB 2BM1A 4H35A 5DLPA 3KEOA 2C5HA 2B36A 1M2VA 3L18A 3KSRA 3BCSA 2PX5A 3HP6A 2HRRA 2QAIA 2H16A 2I1QA 2OXTA 1JDZA 1MZVA 3A8TA 2ZRQA 4OH7A 5FUXA 4I5IA 2ZXEA 3OLZA 1KY2A 4LQ4A 4OQLA 4Q66C 2GYVA 1N7IA 3HUUA 3FMVA 5DNDA 1U4BA 4LY0A 1GDDA 1M3SA 2IZ5A 1F3OA 5FO0A 4C22A 2XMDA 3T3FA 2FFHA 1UOQA 2WJHA 2CN1A 3VZDA 2YQ4A 4DKXA 3DR3A 9MHTA 5E6UB 4EA8A 1EK2A 1KQFA 2ZYIA 4O1MA 4RABA 1CNFA 2OWOA 4DXHA 2QN6A 2AZ4A 3RR8A 3FYCA 4XOIA 4IR9A 5THQA 5ESRA 3RLIA 3T9EA 3C2MA 2XQGA 4MAMA 3B6KA 4ZT4A 1YJXA 2O48X 5BURA 1R0YA 4DOBA 1TL7C 3FMOB 4Q3KA 4FC6A 1FFBA 1YU6A 3CTPA 1AHPA 2XWBF 4E15A 1E3LA 2LXNA 1DSSG 3CJTA 1SHUX 3OX3A 3H13A 2O06A 2RAPA 4MO2A 5BV7A 1U1CA 2AUMA 5FA8A 3RNLA 1L6RA 4LZZA 3W9SA 5AI6A 3MJDA 3U3KA 2YWXA 3FBTA 5GTHU 2V3VA 3KQQA 4MKFA 3DL2A 4GKBA 2AN4A 4YAEA 4WKCA 4C4TA 3G8CA 2GD6A 3CLRD 4FYWA 4BJ3A 3L4JA 1YRLA 5JQGB 4HDMA 2QNBA 4PCLA 4DL6A 4CFSA 3FMIA 1B8VA 3OT4A 4YQWA 2X5OA 3Q3JB 2MWMA 2JCVA 1DTEA 5FQNA 4ZYUA 5AW6A 3W2GA 2BM9A 4F4WA 4V38A 4XWOA 2X0DA 1BXRA 2R3SA 4F3RA 1FS5A 2VF7A 1UEJA 3NG1A 3FWKA 1QCYA 2Q7XA 4PGAA 2O4CA 4IUBS 1ZAYA 2PYIA 3I76A 3F6EX 3UGQA 4D0NA 5KG1A 4E12A 2H1OA 1I7NA 1VG8A 3H8MA 3CM0A 3QW2A 1QHHB 5KJCA 4C0KA 2ZRDA 4IDNA 2RP5A 3HS3A 1ZKDA 3BHJA 5LJLA 3PUYA 3HU1A 1JMKC 1WMAA 5CVUA 5IILA 1I8TA 5JATA 3LWDA 2RHLA 4DA7A 4L0CA 3W5AA 5J5AA 2RGCA 1WPGA 4QUGA 2HUNA 1DUIA 4HEA6 4IQTA 5C5EA 4TX1A 3IQWA 4Y2QA 4K88A 1RIFA 1T4MA 4X7BA 1ODIA 1QNFA 3AJ8A 3Q2OA 4RQAA 1WR8A 4YN3A 5GMOA 3WK4A 4DY4A 3R5FA 1AV7A 1G16A 4WKBA 4XVRA 4R5MA 3UT5B 4C7MA 3JTEA 3WGGA 4DSKA 5DJ5A 1NI4B 4QEDA 3QHAA 1SCIA 3G8DA 3LMKA 5BWBA 5HM8A 1P2SA 5AKGA 5J2EA 5I8ZA 1Y5RA 2ZTHA 3FH0A 1P60A 3PHGA 2IEGA 4IR7A 1V9CA 2QRLA 2UYGA 2DM6A 4RD4A 5CW2A 4KUGA 2XZTA 2JDIA 1H0RA 1FFWA 2VP2A 3FPEA 3QVXA 2JCSA 1U7XA 1CR6A 4X90A 2R8ZA 2NU8A 4C7XA 5A7HA 3QNUA 2HMAA 3TZ6A 4F2GA 3UYLA 2ZBUA 4GG1A 1CZRA 2ZREA 3FSGD 3RJGA 2GEVA 4JEMA 1V5FA 3BH6A 4EY4A 3CZMA 3UNXA 4MFCA 4KAJA 1WDTA 1KVRA 1N8KA 2C99A 4W8GA 5A04A 1IH8A 3RTGA 2QRVA 1DMRA 4AUMA 4KRFA 4HQKA 2AKYA 4LTDA 4KTQA 3L1KA 4PZCA 3OT1B 1OLXA 2P75A 2H1WA 2EDUA 2IHBA 3WK9A 1FMJA 3DE5X 5E3HA 4LOLA 1P6QA 3G0GA 2QX6A 4TT3D 4NU6A 1ND5A 4KOAA 1JYFA 1M1YE 4MQ6A 5JCOA 3EG9B 4IL5A 5HIIA 4BVBA 2ID9A 1GSIA 3N1UA 3U4HA 1D04A 1W2GA 4V39A 1NVKA 2LM1A 1CUKA 1FLAA 3O90A 3NEPX 1LEHA 5HIAA 2ZWAA 3A2MA 2VNAA 3ST7A 5DU2A 4I8XA 1ZNXA 5JTUA 2B1GA 1P7VA 2PT7A 4AMBA 3VOSA 1DQZA 4XVHA 4MTCA 1JJIA 2Q3MA 1P4GA 5JCXA 1XZDA 3IN5A 3GFBA 1LDNA 1VL0A 4BAGA 3L4BC 4RZIA 3ROXA 1VA5A 1AMNA 1NLUA 3UT0A 3RG2A 3O2QB 5H5JA 2D62A 4YPOA 5LOVB 1M7GA 4X45A 3F8WA 4KR6A 2ZAIA 4WLUA 1II9A 5CB4A 3CNLA 3U3RA 1I2DA 1KZHA 5AQ1A 5LYJF 3D59A 2IITA 4NBSA 5BR7A 5GJWC 3KZIU 1R9JA 3RH6A 5B3KA 1ND6A 3EXFB 4JAVC 5A3JA 2P9HA 1NV8A 2G28A 4TXNA 5MGNA 1ZC3A 4G1BA 4A6XA 1NNI1 3PKIA 4UEQA 4ZVPA 1Y3BE 1X1CA 1W0KA 3TCXB 1B3BA 3TUJC 4L74A 3JR7A 2XJ9A 2EYUA 2O2SA 2G83A 3JVIA 3KJQA 4ZOEA 1CJMA 1MQAA 1RWPA 2ZRGA 5KT5A 3NHLA 4FGLA 1JVSA 5I6DA 4UB2A 1XZHA 3QA9A 4J91A 1MX3A 1C7RA 1XB2A 2DUJA 4RFVA 1Y1QA 2UVVA 2MSWA 1H6BA 4E88A 3FNEA 2IS6A 2R8KA 5FTKA 2Z5LA 3GN1A 4KWTA 4QBFA 3OEHD 4E31A 3FDIA 3KQKA 4YDQA 4TLLB 1K7EB 2PFPA 1E8DA 2VDPB 3AEZA 1P19A 2OOKA 2FSPA 1Z8FA 2O7QA 2VLIA 4KH1A 1KQOA 2ODEA 1ZL2A 2CLCX 4LTNA 4MUYA 4AL4A 2AX4A 5AI8A 2NGRA 4KR2A 2ZRKA 2JVJA 4LJ4A 5EXSA 3U7IA 3FZEA 2EWWA 5DOZA 2VJDA 1U7PA 3DB2A 3KHTA 3GJ8A 5AVWA 5E38A 2W6JA 3MRTA 4EMBA 2AGOA 3OOYA 2QL6A 3MM4A 3C98A 5CA7A 2BI7A 2ZSJA 1RACA 4F8RA 3B1WA 1GGHA 3DW1X 3FYHA 1N5RA 4PFSA 1UCVA 2VUTA 1YD7A 3BD9A 1T94A 2AFIA 3VSBA 4RS4A 5FP0A 1B0ZA 5C1OA 4IGIA 1PT8A 1WJGA 4KLEA 1G5QA 4JYBA 3IO5A 5SICE 4RK0A 2VKTA 2KHZA 4ZI7A 2AN9A 3CPEA 5KYUA 3QTBA 1SHKA 2AZXA 3R7LA 2YWEA 4LYYA 3NBMA 3L0SA 9ICQA 4BE4A 2H5LA 5KDOA 4K0KB 1QGUA 4CM7A 4PGYA 1NIPA 2VS1A 1VSQA 1ZHFA 3IIJA 3OHPA 1PTJC 2VNJA 3EFHA 1F2UA 1KI7A 1YA6A 1DRVA 5B37A 3VC3A 3V7LA 1LPSA 2FN4A 3GL9A 2IELA 1PR0A 4KDCA 4XWAA 4CKYA 2FMHA 1CS0A 3WX0A 3NT2A 3EIOA 3KLMX 2CZGA 1K7XB 2I1LA 4PNEA 2A92A 2QG6A 2PZMA 2QNRA 3U7EB 4HLNA 1ZVKA 2EANA 4S1VA 2VF5X 4ZRNA 3QBDA 4CBVA 1UBJS 2LI6A 1EFUA 2JI8A 3HCNA 2G5PA 2I2CA 3F7MA 4BWFB 3WB9A 2C94A 4FI3F 4FUQA 3RFTA 1ECLA 1P1HA 1B6SA 5FR1A 1CY1A 5AVSA 1QIEA 5JXHA 3KQYA 3E4CA 3B12A 1VIAA 4ZJUA 4YBZA 3MG9A 3WICA 1YZFA 1NR1A 4FR0A 1MR3F 1U45A 2C5GA 1EU1A 5FBLB 2YRXA 2IP2A 4MS4B 3KQOA 5ITZB 4ZANA 1P73A 3E2IA 5BRJA 4C4RA 1VE5A 2JFXA 2J3DA 3L7DA 4ZGGA 2H7YA 5K3DA 2BKUA 2Z6VA 4J9OA 5KJ6A 5G0WA 3MA0A 3V6JA 1KBZA 3AOEC 3RF6A 5A9SB 2FZCA 1KU6A 2W0SA 5IWCA 2JF0A 3DGEC 4ECWA 4MQ4A 4NBKA 3VC7A 4TKUB 1UZLA 4GNKA 1QX4A 1W49A 1ZAKA 2QX8A 2P1DA 3GQVA 4Q3LA 1B2RA 4K40A 2PIDA 3K05A 1PD1A 4XSVA 5FPQA 2NQ8A 2WIAA 3HPRA 3M3PA 2VH5R 4BP1A 1C3JA 1IM5A 4BEJA 1L4YA 3ZWBA 3NOOA 2KBEA 4K9QA 2C77A 5KYKA 3GZNB 3OZCA 1IG6A 1ZQNA 3F4BA 3TNJA 3GDWA 4LJ7A 3F5MA 3GFFA 2RJNA 4TM8A 4DV7B 1RZUA 4F97A 1ESCA 3M8RA 2QNIA 4OAPA 2C00A 3DZJA 2SKEA 1GPKA 3BFJA 4IICA 1L7DA 5J0YA 4NFSA 2VJ5A 3BCHA 5KDLA 3GLUA 4RY8A 3HDYA 4KG7A 2YNMC 3BMCA 3STUA 3PQ6A 2QYHA 3P9SA 2E4YA 4KX5A 4UBMA 1HDEA 3P2KA 1FSFA 5HS6A 1NMEA 3O9VA 5CIWA 4IS7A 5REQB 4P35A 1GL9B 3D02A 3QPVA 3WSTA 1H1DA 4U0KA 4ZEWA 1JPNA 2VEOA 1SN7A 2ZIUA 3L9WA 4KX3A 3UUGA 3HMQA 4JBNA 4K6CA 1ZUIA 3E8SA 4RF2A 2B2CA 5A4MS 2YWDA 4KLCA 4FCVA 1NF9A 5DCLA 2ORYA 4X54A 2ZCJA 5K8CA 2HGZA 4K9PA 4D92A 4Z8YA 4UTOA 4R8KA 3I2HA 4A2QA 4UAVA 5IKOA 4DR3B 1VCNA 1GPH1 4D9KA 3RANA 3RODA 2I4NA 3AX6A 2P65A 3KWFA 3VO9A 3P2JA 4E46A 1NMZA 2HRDA 3VZSA 2F1RA 1Y80A 2HPVA 1VCOA 2O8CA 3DZHA 2AQKA 1HX7A 3C3BA 1X70A 3E48A 2WAYA 2B1JA 1E5DA 3NHUA 2XMBA 2I9GA 1JHAA 1WY7A 3BGDA 2XGMA 5U4QA 2PGIA 3D8TA 3E23A 3VC8A 3B5IA 1NZPA 4JMPA 3DVAA 2WM9B 1T3HA 1G7SA 1ZICA 2G8LA 1MB0A 3FCYA 4U39A 2PMCA 1D4ZA 1T2AA 1U2SA 1WMEA 2E3TA 3CUEF 2H4ZA 3REFA 2JCBA 4O08A 2DPLA 1CUWA 2H4YA 5BUQA 4ILKA 9ICHA 4Y2SA 3K1RB 3TDKA 2OP1A 3WIEA 4BO8A 2Y1CA 3F9RA 5FR2A 4TV8B 1BS1A 3Q3HA 2R60A 4ZXPA 3RHZA 4H0CA 1A8SA 4V1CB 2QWXA 3K0EA 3MCAA 2HF7A 1RXEA 2A0WA 1ZD3A 2EFYA 3CMMA 1I7DA 3O31A 2W6MA 3F1KA 4ZEMA 1TM2A 3L0OA 4NMXB 1RXWA 9ICTA 4EDFA 2WAXA 3DG9A 1GKLA 1IHDA 3FR7A 4ESVA 1HBJA 5C52B 4ZOBA 1XG5A 3RIHA 1ZQSA 4JXJA 1TADA 2KZ3A 1Q1NA 4GHWA 3MABA 1QFXA 1JAIA 3PNCA 4AJLA 2WICA 4X1YB 3TYXA 4UVGA 2VH2A 5IXYA 4QZ8A 4YR7A 1Y7IA 1IY1A 4KQ2A 2XBUA 3TOZA 1QV7A 3M82A 2HT6A 4RSMA 3AU6A 2E6UX 4US1R 1ZJWA 1ZCAA 3LD9A 4R2HA 3MT7A 4I9FA 3VRHA 2HLDA 4B7CA 5FV4A 4MWOA 3D2NA 8ICGA 1JSLA 3KHKA 4HVAA 4HTAA 4DV2B 2AI1A 2PAFA 3TNYA 2F2TA 4R8SA 3R7NA 1XMIA 3OX1A 4II3A 4D8WA 3IMKA 4Q6BA 3KSZO 5AW3A 4Q8EA 1IXYA 3G5MA 1T0HB 4JN6B 1QQ6A 1FL9A 4ED6A 1CDDA 4MLZA 2Q6IA 4CL3A 4E2FA 1OFHA 4QNMA 3TNDA 2ZB4A 4ALIA 4QQ8A 4DM7A 4F5ZA 4OJ5A 3RK4A 3UATA 3KKQA 2AGPA 4EHHA 1QGAA 1NQUA 1OW5A 4EF5A 4AX8A 2ZT8A 1OT5A 1DBQA 4XOUA 1FYEA 4UTVA 4RNOA 1S97A 3QKWA 1QRDA 3C2KA 1M34B 2X86A 3A6KA 4BLUA 1QS0A 1C9KA 2DGDA 1MMFB 4ILEA 2YN2A 1R15A 3VH4A 2KKPA 3CYMA 2EW8A 1R1DA 3OJXA 3RLFA 3C7KA 1NULA 5L3QA 3WO0A 3Q5GA 1U9YA 1MXFA 4NE7A 4ENSA 4IKEA 2AOXA 3F67A 1UBEA 2EWMA 1E2JA 5AVRA 2W4IA 5AVVA 3RD5A 4QGAA 4TKZA 5DK4A 3IIIA 1AKEA 1CR4A 2IXTA 2VBGA 4TUYB 1YGPA 5DYIA 1NKSA 1NP7A 3VDXA 1WQ1R 3MLEA 2EX0A 1D3AA 4D9EA 2VF2A 1YDWA 4MO9A 2WMOB 1EK6A 3K6JA 2FR8C 1RMYA 1GUDA 2ZAYA 2Z9CA 1K7YA 2F8MA 5HFNA 7ICRA 1GO3F 3OKCA 1QU2A 1HE8B 1TK8A 2NU7A 3EIHA 5DG9A 4ZHQF 5C1BA 4LMPA 1FFCA 3Q8RB 4PC1A 4RD3A 1N8NA 2Q6KA 1BSVA 1C7JA 1OYVA 4P5DA 3ZHRA 5E6RB 2GNAA 3JD4A 3CR8A 2B4TO 3D9QX 2XMRA 4Z1MD 5HNKA 4NESA 2JATA 1DDOA 3MTAA 2B7CA 1H6AA 4YJ2B 3L1IA 5CA1A 1WQ4A 3OZ7A 4IINA 3F3MA 5BSVA 3WLHA 2BGGA 4OLAA 1D2RA 1PR6A </