3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
4EEKA 3EF0A 2MSNA 1Z4LA 3QU4A 3WKCA 4BNDA 2OBBA 3P96A 1Z4MA 4EX7A 3U7GA 2P9JA 3I76A 2EAUA 2MU1A 2Q4RA 4MUMA 3L0CA 4NFLA 4GIBA 3U7HB 1WPGA 3SMVA 1J8DA 1TJ4A 2B8EA 2RARA 3NALA 2HEGA 4HGOA 3QU7A 3ESRA 5AVVA 4HGRA 1U2TA 4JB3A 4UMEA 3MMZA 2C88A 1J97A 3AR5A 2I34A 2R8EA 1ZOLA 3KDPA 5JJBA 3DNPA 1U2SA 5AK4A 3WKDA 1QYIA 3QLEA 1MH9A 3QUTA 1T5SA 1RKUA 4BBJA 3SHQA 2FPRA 2NYVA 4IFTA 1S8OA 4KN8A 2FUEA 4I9GA 2ZBGA 3FGOA 3PGLA 5AVZA 1ZD2P 1SWWA 1Z5UA 4RESA 3WK4A 3QU2A 3WK6A 3K1ZA 2OA0A 4NWIA 3OPXA 3SD7A 2ZBEA 3MN1A 5A3RA 1ZJJA 2C4NA 2G08A 3UMCA 4FE3A 4AP9A 2W11A 5AW1A 2Q5EA 4L6CA 4HGQA 4NABA 2CFSA 2YMMA 4EENA 2YJ3A 5AM5A 1IWOA 5A3SA 2JAUA 4BX0A 2ODAA 4C4RA 3QU9A 3AR4A 4YCLA 5ALJA 1YV9A 2AUTA 1YJ5A 3FM9A 3B9BA 3OCWA 2MU2A 3S6JA 5AVYA 1L7OA 3L8FA 3WGVA 3RF6A 2RAVA 1XVIA 5AI4A 1QH9A 2ZBDA 3SF0A 4KNWA 2RBKA 1ZD5A 2W43A 2B1RA 2YJ4A 2G80A 5E0OA 4G63A 4CF5A 5ALSA 2G09A 3L8EA 4UARA 1K1EA 2WF9A 5AIBA 4Y2PA 5ALEA 3N07A 1RQLA 3NAMA 1CQZA 3L5KA 4BX3A 5AW4A 2I54A 3KBBA 4XQ0A 4L6AA 4C4TA 1NF2A 5AKGA 4QJBA 3I6BA 2CN1A 3SKXA 2WF8A 3WK5A 2C8KA 5AKEA 4Y2YA 1XP5A 2R8ZA 3J7TA 3AR8A 4UMDA 4Y2QA 4UMVA 5AKYA 1RLTA 1TA0A 5IT0A 5AHXA 4I9FA 3CNHA 5AVXA 2WF6A 3IJ5A 3QUCA 2WFAA 2GHTA 2BY4A 3NUQA 4UMFA 4DCCA 3B9RA 2PR7A 4CF4A 3PGVA 4OCZA 4HAIA 5ALFA 3AR9A 2OYCA 3ZX5A 3QUBA 3PDWA 3DAOA 3OTQA 2GHQA 4AS3A 3IB6A 3ZTWA 1CR6A 3NASA 2YJ5A 5AVTA 1Z4QA 2C9MA 3UMGA 4J2TA 2YMLA 1RLOA 1L7MA 2YMPA 3OCXA 2QLTA 3WK9A 4PNHA 4BKMA 3BWVA 4MWOA 4XOUA 5AVSA 1RQNA 3WK8A 3M1YA 4OD0A 1JUDA 3DV9A 1TE2A 3B8EA 3DDHA 2RB5A 1Z4PX 1SU4A 2HHLA 2C8LA 4O8CA 5AESA 1WR8A 4KX3A 3ZVMA 5ALQA 3BA6A 3OCVA 3W5CA 1L7PA 3WKAA 2WF5A 3U7EB 1Z88A 4UU1A 3KD3A 1Z4OA 2P11A 4HGPA 3QXGA 3MPOA 5AW9A 5ALMA 5ALHA 5AKLA 1ZD3A 5AI0A 1X42A 3AR2A 1RPZA 5FP0A 2EATA 1LVHA 5ALPA 5AW0A 3U26A 4UU0A 3QX7A 1T5TA 3ED5A 4L57A 4YGYA 1ZRMA 4UAUA 2YN4A 3AR7A 4DWOA 5AM1A 3WK7A 1NRWA 3NRJA 2CFRA 2FPUA 4DW8A 1Z4NA 4YIKA 1EK2A 4YH1A 2G1AA 2QYHA 4B6JA 3ZI4A 4IG4A 4AS2A 3ESQA 1Z4IA 1AQ6A 3EPRA 3ET4A 4E88A 4ZEVA 4YCNA 3L0BA 2HCFA 5AI6A 3N28A 5ALDA 2G07A 5AICA 1XPJA 4Y2TA 1S2OA 3QGMA 3E84A 5AM0A 3MC1A 3A1EA 3U19A 5AK6A 3I28A 3ZVLA 2JAWA 1SWVA 1RMTA 3UMBA 3QNMA 3HLTA 3R09A 1VFPA 2P69A 4BEVA 1TJ5A 2ZXEA 4XE5A 2WM8A 3ZW7A 2FDRA 1WZCA 3N1UA 4Y2SA 4KYTA 3HYCA 2YJ6A 2R8XA 4HYTA 3EWIA 3OCUA 5AW5A 3L8HA 4EZEA 1Z4KA 5A3QA 3F9RA 4BNDB 2DQSA 3ZUPA 3ET5A 5ALOA 2I7DA 3I1YA 5AW2A 5ALRA 3IRUA 2IOHA 4EX6A 5ALXA 1Z4JA 3L1UA 2AGVA 2B0CA 1QQ5A 5IT4A 1LTQA 1Z5GA 3A1DA 1RKVA 2G0AA 2HO4A 5ALNA 5ALKA 2P27A 5AKJA 2BDEA 5ALYA 3W5AA 5AKHA 2YBDA 5AM2A 5AVWA 1RC8A 1Y8AA 3R4CA 5AKXA 3WKEA 2IOFK 1U7PA 3KC2A 5ALGA 5ALVA 3L7YA 1YDFA 5AW6A 5AK5A 4C4SA 1ZRNA 3N5KA 3W5DA 1WVIA 5AK3A 3ZTYA 4EELA 1T9ZA 2VKQA 4GXTA 2WHEA 5ALTA 3A3YA 5IS2A 1VJRA 5ALUA 4CF3A 5AIAA 2PKEA 3D6JA 2YFYA 2JARA 3VAYA 5AW3A 4QQFA 2AMYA 2WF7A 4ZEXA 3ZWKA 3SKYA 1TJ3A 4CNQA 1EK1A 2AH5A 2X4DA 3W5BA 2HF2A 4Y2XA 5ALIA 1NNLA 2EARA 2HF7A 4F71A 2IA5A 2O9JA 4Y2VA 4FFDA 2W4MA 2HDOA 3EF1A 1FEZA 3CZ4A 2FPSA 5AKZA 3WGUA 5AW7A 2HOQA 2GO7A 5AI9A 3R9KA 1L7NA 1N8NA 2JGAA 2ZOSA 3WKBA 4UM5A 4KX5A 2HI0A 2I55A 1RMYA 5AKKA 3AR3A 4RETA 3L0YA 3OCZA 4UW9A 3NIWA 1RMQA 4CE6A 1L8OA 4YIHA 4ZEWA 1L8LA 1KYTA 2R8YA 5ALLA 3ZX4A 1O08A 3N8GA 3U13A 2FUCA 2YMQA 3KZXA 5AVRA 1N9KA 1Q91A 4NAVA 5AI8A 2OM6A 5ALZA 2YY6A 1ZD4A 4J03A 3ZVNA 3L1VA 5AI5A 2O2XA 4Y2UA 3RFUA 4UAVA 3AR6A 2PQ0A 2Q4TA 5AW8A 3PCTA 3FVVA 3QYPA 5AM4A 3ZWDA 2B8JA 1YMQA 3NANA 1L6RA 4FYPA 3M9LA 3TLMA 3FPBA 4BX2A 2NO5A 3A1CA 1QQ6A 2B1QA 4OHFA 1RKQA 4OFZA 2B30A 4JDPA 4Y2JA 3FPSA 4BYGA 4F72A 1ZS9A 1Q92A 1YS9A 4KNVA 2I33A 1RLMA 2IOFA 4G9BA 2I6XA 4UM7A 2NO4A 4DFDA 2JAOA 3E8MA 3ONNA 3OCYA 3SLRA 4H1WA 2GFHA 3KOOA 2B82A 1RRCA 5T41A 3FZQA 4Y3UA 2FEAA 4NV0A 1O03A 2CFTA 1U7OA 1PW5A 2BDUA 2G06A 4BEWA 2HX1A 5AM3A 2FPXA 2IYEA 3E58A 3QU5A 2GMWA 5AVUA 3L8GA 3GYGA 4YCMA 4Y2RA 3ZU6A 5ALWA 4UASA 2FPWA 1YNSA 1RDFA 3QUQA 1F5SA 3UM9A 2HSZA 2ZG6A 4XPZA 4UATA 1U02A 3U7FB 1VJ5A 4HGNA 3E81A 2ZBFA 5AVQA 1QQ7A 2FI1A 2D2VA 5AKIA
chains in the Genus database with same CATH superfamily
4OX9B 2GM5A 421PA 3SHFA 4EF6A 1RXYA 3LWDA 3P2EA 2ETXA 3R8XA 5C81A 1OB2A 4PSVA 3RBZA 4P7FA 1N1EA 3HR7A 4JJ8A 1TKDA 1R0KA 2ZYIA 2W2KA 1LPNA 3M6UA 4HGRA 1BHJA 2CD9A 1R0SA 1JPNA 1K4KA 1XEWX 5F3WB 1JZQA 4D3DA 1SKWA 1IL0A 3EG9B 3VU9B 3GLGA 4B3GA 3T0GA 1PJ3A 4MKZA 5J1SB 5EZYF 2A84A 1TLLA 1FDRA 1A4UA 2Z4SA 5E6UA 2KE7A 4H4CA 4YDHB 2AUTA 5LP6B 4HWPA 3ESCA 4PC7A 5L45A 4GOKA 2R6ZA 5BSKA 3AFGA 1EQ2A 4ALIA 8ICQA 3OU7A 1UBNA 5HR6A 3HADA 1R4MB 2X6RA 3O2JA 4EVQA 1RQLA 1XTKA 3ZIAA 3NPMA 5DTQA 5C5JA 1BHSA 4B6PA 3C3YA 1PK8A 2IEYA 1GA4A 1YHZA 2JK1A 3K0EA 2KM1A 3G2OA 1K08A 2E1EA 1GYQA 3IS3A 3PIDA 2ZTDA 2HL6A 1NTRA 1G8GA 1Z0UA 1NI4A 5FBZA 4ZT6A 2XUDA 4RVCA 3G0OA 5CITA 3L6EA 2GWRA 3BE5A 2CLCX 5AVTA 4DOMA 5LYJF 4CMEC 3SQWA 3EARA 3MILA 1RHKA 4DMUB 4C0SA 1ZN2A 1OMOA 2NV6A 4UQGA 1SZDA 1IATA 4B75A 3ITNA 3RU7A 2FPIA 1SQGA 2C5BA 4D9GA 3F6CA 2QM8A 2NVUB 3WWZA 3JZDA 1NJ5A 2GASA 2MYPA 2C3YA 4GLJA 1ICIA 3V8PA 1SXHA 4BS9A 3CLRD 1OFVA 4ZREA 3A31A 4BFYA 1T1JA 4GC7A 4E07A 3QGMA 4BU0A 3MC1A 1BGVA 4KWCA 4BIMA 2V7PA 1ZIOA 2R6JA 5DV9A 3HLTA 2CLIB 3BS5B 4C7KA 2EVWX 1GVHA 4W5OA 5C4MA 4A73A 1ZD9A 2ZTCA 5L3QB 1TVAA 3PHHA 3CVVA 5DMXA 3KYIB 2V97A 2JZBB 1GV0A 2CJXA 1C30B 4XDZA 1EXWA 3AHFA 3QKUA 2V7TA 3C2QA 3NQ41 1PUZA 5J2HA 1QJCA 4LCEA 7ICHA 2DUYA 2BEUA 4RVHA 2GNAA 4TTTS 2V65A 2ZRAA 3KHKA 4D4LA 3CZMA 1N57A 5K8IA 1Q14A 4P81A 1ZRNA 3DEHA 1HLGA 4LCJA 5M7EA 3IP4B 3AOGA 3W5DA 5F7OA 3OEEA 4L6IA 3GRRA 2KVSA 3HRHA 4KMRA 1JB1A 5JLAA 1R6DA 4GXIA 2ATLA 4G37A 4DO9A 3H2SA 5KEIA 1TXGA 4OBWA 2NQTA 3PDIB 2F59A 5KNCH 1RAAA 2H7CA 1A7JA 4CN8A 4JXJA 2H8GA 2MJLA 4XQCA 2DULA 1TYEB 1JIIA 4BQFA 2QUZA 3VYVA 4PGYA 1P91A 4QRHA 2MSCB 4YIHA 3GNTA 4EFLA 4JROA 3G5TA 4LE2A 3QYJA 1DK2A 1X9IA 1MB0A 4AQYB 3DEIA 1R8JA 1CQJB 4M7PA 3ZQKA 3HR4A 2VH2A 3GJ6A 4X95A 1TFUA 3LT5A 2PZ8A 1EEHA 1SXEA 4EATA 1AKTA 2DMRA 4S1PA 4UVDA 4KVAA 4BLOA 1G2PA 2P9GA 4XUCA 5CDGA 3GRYA 1YDHA 2C8JA 4L0QA 3C3WA 9ICLA 3CE6A 1D5CA 3CZCA 4YG2A 5AVUA 2L17A 4RVUA 1ILWA 1KP3A 4WNIA 1KBOA 1Z0IA 3UWPA 3WB2A 3FNBA 4Q01A 4KR9A 1WCV1 3UMJA 2NUBA 1ZGAA 4IQWA 1K6IA 2ZYDA 4P0PA 1F8FA 2XNSA 1KORA 4EEKA 1UKYA 4HNUA 2F3PA 4NEQA 1DCTA 2H9YA 4HH3C 4M9CA 3C7DB 3ZHZA 1L3TA 5J2TB 4YYZA 2GK6A 4LC0A 2BE7A 3IKJA 4D44A 4B3RB 2OCPA 5IHPA 4NV1A 1QFSA 4H7KA 2EQYA 2PLRA 3D3JA 4XWWA 2I4LA 3F3KA 1KY2A 3IQIX 1JKJA 4GPD1 3HSYA 1TL7C 1T0HB 5KYYA 3C3EA 4LJKA 2WWWA 5F9LA 3DYVA 1CJUC 4MLCA 4ROTA 1BCRB 4ZZ1A 2W7TA 2KSOA 2GPBA 5KJ6A 3CX7A 1K86A 1NASA 4LDJA 5ABPA 5AOVA 4DIOA 3S7TA 3E70C 3T5AA 1U8CB 3ZHYA 3QY0A 1SXGA 5LMCA 3ABRB 5HCIA 4Q4HB 4QZ9A 1P1FA 4Q48A 3QUSA 1S5LU 1UBLS 1X1SA 4MWTA 4DREA 1GNLA 3VZRA 4OQPA 2D06A 2PSJA 4R8VA 1JB9A 2VRCA 4ZH4A 4Z0NA 3CF2A 3IVMA 1T4DA 4BKQA 3G8DA 3EVFA 4PIPA 1V9CA 3KQQA 4MW9A 4QODA 5B6PA 1KOJA 4W7IA 1DAMA 2W2VA 3UB3A 4PVDA 4RTSA 2OSVA 4KXNA 1DQPA 2WF5A 1CV2A 4JX8A 2G1PA 4ZHQB 5B1HA 1P0FA 4ZCMA 5D2CA 3IEUA 3AR7A 4TWJA 3SVLA 4AIIA 2C4WA 2CLOB 1Z15A 5F52A 3D5EA 4HY3A 2AR0A 3OPQA 4AS2A 4EGCB 3LDGA 1U47A 4MYDA 1XP8A 3H4IA 4KR6A 3UT5B 2ZRHA 3KOUA 4DDTA 1X74A 1VPVA 3N2ZB 4DR1B 4E6EA 5IYZB 3OZEA 3K1RB 1DNPA 1RFGE 1J2YA 3UENA 4QVKA 4M55A 3AL0C 5CVCA 1N2EA 3FJYA 5BT9A 1OC4A 1EK0A 5K6AC 3FIJA 5BRNA 4Z1OA 4G9GA 4QO7A 4URUR 4K88A 4FOSA 2PUFA 3SK0A 4DSIA 2ZIZA 1BNOA 5CCEA 4Y0NA 2ADOA 4LXXA 4DNOA 4FMCF 4QDKA 1P4GA 1TM4E 2DR3A 2H31A 3WYNA 1MN6A 4BJHB 2CJWA 2EDAA 4FBGA 4IKEA 3ULKA 1YDWA 4JLOA 2H51A 3UMRA 1GSIA 5AW3A 1UFRA 5KPJA 1VLLA 1Y6QA 1QYCA 2OCBA 4YFYA 4DG5A 3A11A 1I0IA 3GEMA 1QBGA 5REQB 5JC8A 2KHZA 3V5NA 2JD0A 4ND7A 1J21A 1EP9A 2YXLA 2JH8A 2ZB3A 4ENUA 2HSJA 1I36A 3P2KA 1ISGA 4IHKA 4XW2A 1QHEA 4F2GA 1Y7TA 4J2HA 1TAGA 2VDRB 2IF2A 3EULA 3SY8A 1D5WA 4P32A 4CW7A 4D9IA 5TQ0B 1UC5B 2YY6A 1GCOA 2JAHA 1OHHD 3KAQA 3G6VA 4QM6A 3I9LA 4AM8A 3FTFA 3PGJA 4W6ZA 1LKYA 4FOPA 4DG9A 1E94E 4KV9A 3SJUA 1YF3A 4FYPA 1ONBA 5TJHA 1C7YA 2KIWA 4RXMA 4HRVA 2X3YA 4NF2A 4OG2A 2D1SA 1DKRA 4TVKA 1KFJB 3ZQ4A 3AOEC 1UBCA 2GD2A 5BQXA 4GVLA 2DPJA 4M76B 1S7GA 1YRYE 5IJ9A 3FCOA 3SC2B 3KP1A 1RRCA 1JQ5A 1AV7A 4KQGA 1K5OA 2PQ2A 1V37A 3ITDA 5ELXA 3KCNA 1QK4A 2BDUA 3NDRA 3JX9A 3DO5A 2NTNA 4RGQA 3TIVA 4PC1A 2QPTA 4U2DA 3WLAA 5IH3A 4PBSA 3L5OA 4CT4B 4AKTA 4P4PA 3ILSA 3ER8A 5IP5A 3HO1A 4KIJA 3MJSA 5EE1A 3AINA 3ND6A 4U63A 1D9ZA 5IJ0A 2YN2A 2P9EA 2G0TA 3SMQA 1N3IA 5KNLA 2TMDA 3FBWA 2EDCA 2UZ3A 5T3YA 4GR4A 3K6RA 2OGUA 4XYGA 3RGGA 4GPAA 3NFRA 4PC6A 4Z51A 1XXHA 3TTTA 1BWSA 5JCPA 1SOMA 5G3YA 3GFFA 4O1IA 3S2GA 5D3ZA 2BP7A 2IMWP 4HGQA 1SV0C 3ZHUA 3CNQS 2ZSIA 4MQMA 3PENA 2EV9A 3OCWA 1SM4A 2MSKA 2D1YA 1ISIA 3G13A 3OM1A 3VYSB 3M6IA 1AUXA 5TX7A 3RJJA 4ZO4A 4IAOA 4BP3A 5AIBA 2FN4A 1A69A 1GGFA 4N41A 1FSZA 3VGPA 2HBRA 4RCYA 4RMHA 2VOJA 3E1KA 5BN1A 1B4FA 2Y3IA 3S2EA 1AB5A 4DAEA 2GHTA 5KJFA 1DT5A 4GH5A 2V1XA 1XWIA 3M81A 4HS4A 3ZW8A 1VHTA 3VYRB 1AROP 1E1RA 5BV8A 1XLVA 2XUOA 1J8QA 2CNBA 3UYLA 1DC4A 2YJ5A 2C0PA 2OYYA 1GEEA 1J5XA 2I9PA 4Q9LA 4F5DA 1QOPB 5JDCC 4AMYA 3E2PA 2HA4A 1AKNA 3C3CA 3WLQA 4DDHA 1C7IA 2EAPA 4CDGA 3PPIA 3WKAA 5H3HA 4J1TC 4WLVA 3C5WP 1YZKA 4PNZA 5B2EA 221PA 1FNSA 1CDOA 5EP4A 1BH6A 1K1QA 1WZ2A 1UOPA 2FLPA 1XNRB 1TZJA 1V7CA 4PCAA 4K6HA 1Z45A 4YIKA 3IFSA 1ZIYA 2CW5A 3R9WA 1FUIA 1ZQDA 1KBUA 1AT1A 3LPAA 2B98A 3O8NA 3X2SA 2O59A 3C3XA 3GPIA 5LD2B 1FRNA 3L1JA 4MUJA 4DLVA 5AK6A 5HQJA 1IUNA 4PTYA 4TVOA 1XRLA 3U3ZA 3RFVA 4P4LA 3ICCA 1DC8A 4WY8A 4LF6B 2XJ4A 2NTVA 1UJBA 3RAEC 4LEIA 3D43A 2ZTEA 3OX4A 4U6NA 3ZDYB 3A9SA 1KI2A 4E12A 4D4HA 4RQ1A 1U9YA 3QOFA 3L7LA 4IJUA 3IUJA 3ROGA 5A62A 2IEZA 3HN2A 3ROZA 4US1R 2PANA 4PZAA 4RUCA 5JSQA 1XGKA 2UVQA 3WI7A 4X7RA 4CNQA 4JMLA 4HNGA 4FHZA 4Y2XA 4AJJA 3VYWA 2IH2A 3DTVB 4JH0A 2GPJA 2UYQA 2YC4C 4XJSA 5FWYB 5IMSA 4NL9C 3CLRC 7ICIA 4GOMD 2H5IA 3AXSA 1W1IA 1LLDA 3VU3A 4EA9A 1U5BA 1XTSA 1ZIDA 2QTZA 4F9EA 3D4OA 3ZJ4A 1W2HA 3EH2A 3LUCA 1O96A 3HJCA 2H57A 3LHFA 1IU9A 3K0HA 4P31A 3T4UA 5BN4A 4G1MB 4YUXA 3LDHA 1OW3B 3OHPA 4FGUA 1NNEA 2I33A 4YJHB 3JRWA 3G88A 4W7HA 5CA1F 2BH2A 4OA5A 3E8MA 2FSUA 4RDHA 1A9PA 3PW0A 1SR8A 4K1XA 3FDJA 1KWGA 1QYWA 1EFKA 4UHBA 1H9AA 4JGGA 4BNTA 3QP9A 3HJNA 1N2IA 1U02A 1R4MA 1O6FA 4DY6A 3ZWXA 2YICA 3OJOA 1HT3A 4V0ME 4JZKA 3VC1A 2VUUA 2FB9A 4MYSA 2AFHB 5C5CA 1XRJA 3EZ6A 1N2ZA 2ALZA 5KAMA 3IURA 1K3TA 1NYRA 3R0JA 2HEGA 2NRZA 3N9IA 2IUFA 4FWBA 3DDNA 4IQTA 4EKYA 1Q17A 1FVHA 2FWRA 1T5DX 1USVA 1U80A 4HNTA 1DSSG 5FV4A 5F1PA 5AW1A 5LB2A 4AQ7A 3GCXA 1XMJA 3QVTA 2VJQA 3GP8A 3FOBA 1VMIA 3VHLB 1YJ5A 4E6PA 1GUYA 4CQMD 4ED0A 2BHTA 2NVUA 3ZXIA 5DQIA 4RPKA 1P8AA 1M0TA 4PFSA 4JQOA 3HSSA 1I51A 1DAPA 1QRDA 1GO3F 4B85A 1SKYE 4L85A 2PZLA 4DRXA 2P90A 4W4TA 3JPRA 2RBGA 2ZJ2A 1JHPA 3SHOA 4JVMA 1FLDA 3F1KA 5BQPA 1MB9A 4YJFA 1AKUA 5KKNB 2JFGA 1YJAA 2YW2A 1NN3A 1MOZA 2C5LA 3FPAA 1NKCA 4N6OA 2BY4A 2O8EA 2Y0BA 1FOEB 4JOSA 1D6SA 3C5FA 5DCYA 5G02A 3AR9A 2FZ4A 5TR9A 3DV0A 1N8TA 2QM0A 3K3PA 3M1AA 1V35A 2BI4A 5MFPA 2CVOA 2OENG 3KQNA 2HREA 4PHTA 4UEOA 2XRYA 2QRVA 2WOJA 3DV9A 1DWQA 2AFIB 2VDVE 4Q16A 1IPHA 2JFYA 4FU0A 4RM2A 8AT1A 3D81A 1XTUA 1JIXA 3RU9A 2FFQA 3FDFA 1EVIA 1HT1E 1NXVA 3Q3JB 4JNCA 4BQQA 3I83A 5JXJA 4PHPA 1BN7A 2QIPA 2WVAA 1CJVC 1T3ZA 4L0MA 1C0IA 4ZEOA 1PE0A 1W47A 2FEWB 3E3AA 4ZEMA 1EP1B 2FLLA 2BSXA 3GPBA 5TNXA 2DPLA 3Q8LA 1ZHOA 5D3KA 8ICWA 9ICPA 3BKXA 4WDRA 1KI8A 1YASA 4HBGA 3OZBA 3F5DA 4A1OA 5AVKA 3OIGA 4EI8A 4HCJA 2WABA 1J1ZA 1GDHA 2CV2A 3BH0A 1WCNA 3F4LA 2HMVA 2DPMA 2GN1A 4ABTA 3EZNA 2NP7A 4NMLA 5IF3A 2GFIA 3EPPA 3ZE8A 3HA5A 4JOCA 3KVRA 3D6HA 1NLYA 3ONWA 2Q3CA 4UFNA 3KQYA 3JRNA 1V16A 4MLZA 1GDDA 5FEMA 4CMKA 3ZYCA 5COQA 1FB5A 4G0QA 2IHUA 3BTUA 5EPOA 1V39A 5E4JA 3QVOA 4YQZA 3EGOA 3RRMA 4DLUA 1N5LA 1TMKA 3ZDQA 1F20A 5AW7A 2IIPA 1PLKA 3MJ4A 3RYFB 4D9HA 2IW1A 2Q07A 2UVUA 2QG9A 4O2LA 3FWKA 3LLUA 4UQPA 1G5QA 1H8HD 5FFMA 2C03A 1BNPA 3OJ0A 4QW8A 1BC5A 3N2LA 4KREA 4HDKA 2QBYB 2KB0A 3WMEA 4QU5A 4NMHA 3SR4A 4PR3A 4JXZA 5JSFA 5EP3A 4MV5A 2PO5A 4Q03A 1P7YA 2LWIA 4YJ3F 5ARCA 2IHKA 1WULS 4JLVA 5FPTA 3QF4A 2RH8A 4UD2A 4TV9A 1SXIA 4F5WA 3KFLA 4D02A 1N48A 2V5AA 2A0WA 5TPWA 2GPWA 1MOSA 2ZTLA 5JTIA 2XY5A 4GXRA 1LX6A 2I2FA 2X7HA 2OESA 4MPDA 1CS0A 4NR0A 3OA0A 4ZVTA 5IC6A 1JF8A 2CEAA 1NV9A 1Y9ZA 4HNVA 1GVNB 3PYLA 4L0DA 2A92A 2XCAA 4A6DA 1E8MA 2P9JA 4RV4A 4MVJE 1J5PA 3O93A 3PHLA 3HA2A 1HA3A 1CY0A 2XMGA 5H4GA 1A9TA 3INRA 5CM9C 2HMTA 3AUFA 3MMZA 9ICWA 1T3SA 3BH6A 3HWSA 1M7BA 4I9GA 1VPEA 3BBPA 3RK1A 2GHIA 3WK6A 4EG1A 1XDWA 1KMCA 5EQJB 1ZJJA 4YT2A 4MFCA 1H2ZA 2C2ZA 3L84A 2CFSA 3DM5A 2CNOA 1Z36A 4MO2A 2D5CA 3RJ5A 4UE3S 5ALJA 1JU9A 1ZA2A 1P0CA 1DLIA 3ZHRA 4BY9E 1FYFA 4AZTA 3FSGA 2P6NA 4HDCA 1KH2A 1HO3A 2PRKA 2AGPA 1QFJA 2VDWB 1XZLA 4FHDA 1ATIA 1GXSB 3GX1A 2GLTA 3JARA 3EG5A 4LI0A 4YUWA 1VL0A 2AF4C 1RAFA 3FUVA 5F7ZA 1P9RA 1YHYA 3B1JA 1ZEJA 1KR5A 5AKEA 2JIOA 2XNJA 4JSYA 4Y67A 3SZRA 3IP3A 3ISDA 1PZXA 2I2DA 4N76A 4FR0A 2VP6A 2BTOA 2PMBA 3DAOA 4P3YA 1H4SA 2JFHA 3B6JA 3ESDA 1QHSA 2GXQA 1L7MA 4EJSC 4DVJA 2WUEA 3IIIA 4O3NA 4KQMA 4N0MA 2A0FA 3DDHA 3AKDA 4ZOCA 3IT2A 3WL7A 5KYWA 1QB7A 5FL3A 1P18A 1TJPB 4XVQA 2OVFA 2WB1F 2XEDA 3BWMA 3SF8A 4XM0A 4GUDA 4FM9A 4LI3X 4G4SP 4BP8A 2B9VA 1T8EA 1SJ9A 4KE7A 4JC0A 2V74B 4LDAA 3PSFA 3WFIA 4KXWA 3DPSA 5JQWA 2Z1DA 5LOVB 3R5XA 3L7CA 4YRBA 3G1TA 4MKGA 5TQVA 2XRMA 1ISPA 4HZUA 4DCGA 4QM7A 1W5AA 5TQ0A 3HYCA 4YRDA 3RODA 4MF2A 5CT4A 4IM7A 2E4ZA 1HYBA 3F3SA 1I3KA 1ZAYA 4OB7A 1KNXA 1M54A 5CX1B 2I7XA 2K4PA 4M9HA 5KNDD 1S0NA 2NU8B 2J08A 1R18A 8ICTA 3C6ZA 2ZRGA 3IEIA 3UB4A 3VV2A 3UJNA 4LWOA 3OFVA 1U7TA 5IBCA 1IQRA 2WTAA 4Q8FA 4X00A 3LUPA 2BR5A 1EWYA 1I33A 4Q93A 1C81A 5TLSA 1KRXA 3QKRB 4WINA 1BCSA 3SKYA 4BFCA 2XSZD 2HWUA 2HF2A 3L1HA 4XZ3A 5AHKA 2DE0X 4LRTB 2ZTVA 3T1QA 3CZ4A 2HBJA 1A5SB 2H65A 3F0TA 1NONA 3ADOA 1XOIA 2Q5HA 1W49A 1Z8DA 3NIFB 2B3DA 3GD5A 3RGWS 1L8OA 5CGZA 4BC0A 1H2BA 5C1BA 3I09A 1X15A 3RSQA 4OQNA 1VQ1A 3L1VA 3WSTA 2HZ7A 2O14A 3DBVO 2O1WA 1MGOA 3LLCA 2A4KA 3DE1X 1T25A 3SE0A 4OHFA 3DOJA 5GJCA 3WMRA 2IPOA 1XO0A 5KVQA 4OQMA 3WGKA 4M54A 1QHIA 2X8WA 1BDBA 4A1FA 2GVNA 2WE7A 4AVYA 3EZLA 4C0QC 1MW9X 5IVKA 3QEJA 1WXWA 3M0EA 4B7AA 4C0XA 2AW5A 2PE5A 3OPYB 2AW3A 3FRIA 3C3KA 3NXKA 2X41A 4US0R 1JN0A 2C95A 3S1AA 3NTXA 4EY4A 4BO6A 5BSVA 1OU0A 5YASA 3BQ0A 2YWCA 4OQ4A 1KPIA 4IMRA 2NM0A 4WLUA 4F4HA 4TMTA 3TRIA 2JA2A 4FO6A 3KSUA 2ZYWX 2Q46A 1I10A 4D0GA 3IVCA 3GHYA 1W6UA 2H1RA 3QSGA 4B71A 1U2SA 4BVFA 4O4HB 2DHEA 1GGVA 1JQ3A 3OU2A 3FR8A 4R9NA 2Y1IA 5EKDA 1OV4A 4OXRA 2Z9DA 5FOUA 1NBAA 4ON9A 2DKFA 3LXUX 2BFCB 5C34B 1S4QA 3GPLA 4GKKB 3DCNA 2Z5LA 3C29A 4UUQA 2JMGA 4DQUA 1QLNA 4YLEA 3MTBA 3V7UA 2GD0A 2VPIA 1O6GA 2KI5A 4B9LA 4EUFA 3MD0A 5C32A 4ODIA 1X0XA 5GZ1A 1WM1A 2NTJA 2WD8A 2BBTA 4PCLA 4LA4A 1ADFA 4L4UA 3HV2A 2CF6A 1L4EA 3FRJA 4BUZA 1MAUA 1H0SA 1UXHA 2XMZA 3PTLA 4G81A 4TUQA 3AB8A 4MGIR 3PPXA 2V3VA 2QY9A 1LB1B 2NU7B 4L73A 2GN2A 2C84A 3V4SA 1UEIA 2GZMA 2I3GA 1XQXA 4YNBA 2FMTA 4GXJA 3OTQA 4UAGA 1GPYA 5I8WA 1NG1A 2PZMA 4BXOB 2OCDA 5KBYA 3MCTA 1YZ7A 5CIQA 3OQVA 1OLUB 3E0QA 3SCZA 3A0HU 3WBKA 4Q9AA 4C7MA 1OUMA 3D8UA 5IG2A 3VU8A 3LCCA 3F5QA 1SU4A 5CIWA 4NBRA 3ZVMA 4GOND 2AZDA 3U7EB 3K9HA 4D8VA 3VISA 3OHBA 3RTEA 1Z8NA 4NPCA 3IEMA 3N6RA 2OXCA 4HQRA 4DW8A 1VA5A 1G0NA 2H7XA 4BUGA 3TX6A 1E9CA 2CVZA 2EGHA 3N6XA 5DCUA 1V0JA 4FHFA 4LV8B 4M0DA 3QELB 3IP6A 2X5JO 2BFPA 4CCHA 4JBLA 4RVNA 2GK4A 4NHOA 2P2YA 3OECA 1OXBB 1YFZA 5KG1A 3W5UA 2C28A 3HPQA 4ZJZA 3IHKA 3UF0A 1U0LA 3BJIC 3EWIA 3B53X 3BTSA 1Q19A 2QP4A 3ZE9A 4U9UA 5ESDA 3KT0A 4LXUA 3FPLA 2JKYA 2H3EA 1WAMA 4FDLA 3IUNA 1Q7CA 2BCEA 4K6OA 4LJ8A 2J6SA 2EX0A 3TACB 5LL6P 1Y5IA 1BE8A 3BZBA 2ORWA 4I5DA 4NENB 3A10A 3PUYA 5PGMA 3FPEA 4BN5A 3G2QA 3HP4A 4DL2A 4U0KA 2Z3VA 3FRHA 1ZQGA 4HX2A 2WHEA 3A3YA 1LVGA 3N2KA 3CCCA 4N8DA 4W1RA 3SZOA 1UM9B 4LF8B 3SDBA 3EF1A 1BGXT 3ZDCA 1JDTA 4UTZA 3NHMA 3R3HA 3TB4A 1YXMA 4CZ2A 4EW2A 7ICFA 4AJ2A 3RFXA 4FTWA 4ZEWA 4J3FA 1MA0A 3ELUA 5D00A 3E6AA 5TQ2A 4Q24A 4M1ZA 3GD7A 4R98A 3CE9A 2IXDA 1Q91A 2QMYA 2IZ5A 1ZM9A 1ESCA 1U6KA 4MCHA 4MUXA 2J0QA 1JSRA 3X1XA 3QXSA 4W5HA 3M5CA 2QXUA 2AXQA 1H66A 1P2GA 1EDOA 1UMCB 4WZAE 1OBCA 4R1QA 1AHIA 2Q8PA 2NXNA 1NBME 1UEXC 2WTXA 1RWQA 2K4EA 4HDSB 3N0TA 4MVJP 7ICKA 1P19A 5A0VA 1Q3VA 3AFOA 4FI3C 1I1QB 4LZWA 4KLLA 2CEKA 3DCIA 2WZCA 2ZG6A 3VR0A 2OFFA 1AGXA 1Y42X 1MX3A 2TMYA 3LXXA 2GAOA 4BMNA 2A5DA 4N03A 1BPDA 2I2XB 4MDFA 1DGSA 4D80A 1B7GO 2QYSA 1U04A 1EA7A 2QA5A 7ICRA 3E1GA 2FPLA 1NOKA 3GRZA 1TJ4A 1NC1A 1C50A 2AX4A 5DSXA 3UQ0A 3LQ2A 3FE2A 2WWIA 2P0AA 1TF7A 5KTPA 3CRRA 4C7XA 2G70A 1ZD2P 1ND6A 5EJ9A 5KJCA 1GLVA 1N7GA 3M1IA 3OOSA 4IXMA 5F76A 1R1DA 3WX0A 1LUAA 3Q15C 4H7HA 4KAAA 2R47A 4I1PA 3IOYA 4PAOA 4EKNB 2MA1A 2XA9A 3PRYA 1FW8A 3MTIA 1V8ZA 3VDMA 1VJ1A 3AU2A 4NMXB 1UPBA 4RZRA 4JBNA 1GAXA 1H69A 2XIDA 2XQFA 3O8OA 2QUBA 3PPYA 4TRMA 2WV7A 3ZDZB 1MO6A 3MWEB 2A33A 3ZNQA 1QO9A 4KPUB 1W76A 1R5OA 2QVCA 2WHPA 1II9A 2XA2A 2JAQA 3UUFA 2ODQA 1T6XA 2JFQA 1D0IA 4AF8A 1XTIA 3V8MA 4XDYA 3IULA 2V4QA 3HJFA 2V7GA 4DEVA 3EVCA 5GJWC 4FBLA 1DOHA 2UYGA 1KDOA 3IPYA 2M6KA 4UB6U 1GR1A 5JMTA 5CT8A 3SAFA 1MJ5A 3W90A 4EY5A 5LB4A 3CW8X 4KMUA 3TAPA 2F77X 6ADHA 2WKWA 1QCDA 2PGJA 5DLYA 1NBIA 3HVUA 4JJ6A 5KG4A 4L8YA 2RDJA 2CUTA 1ZGZA 2C2XA 2CBZA 2AZXA 2K7ZA 5K9ZA 3PFGA 3RVMA 5FUQA 4KAFA 5BNIA 2GZAA 3E8SA 3UJ3X 1GLNA 3JTMA 5BQ5A 2H9IA 1KOLA 4UBIA 1L5UA 3IBSA 4QPPA 4FZJA 3DZCA 3I8XA 1ID1A 2UYOA 2D7DA 2JGJA 1HKHA 1M2VB 4Q21A 4QJIA 1K8ZB 4PU0A 1S3FA 3ZDFA 3HYNA 4DSLA 4BGIA 1GTMA 2LR0A 5BN3A 1A0PA 4OFWA 4PY2A 4K6MA 3TLAA 2ARKA 4JVLA 3IMKA 1YRQA 1BPEA 2BOVA 3OWHA 1RLIA 4IH1A 1AMNA 1NL3A 4XKJA 4DMLA 3VSCA 1ZQUA 4ZMRA 3I4CA 1XHFA 4JJAA 4N9WA 3ZE6A 1WUTA 5JI3E 1QV9A 2WYVA 2GK7A 1H6DA 5CYOA 1OH6A 1BDIA 1CUJA 2HW3A 4OM7A 1W5TA 4L2IB 7MHTA 2HXYA 3DONA 4I8IA 3PPWA 3ZVNA 1ZCAA 4J2OA 4IRKA 2ZXIA 4WOBA 1SVKA 1AG9A 3PQDA 5E2IA 1J2NA 4IXWA 3W9UA 3KIPA 4OFZA 1QZTA 1LJLA 4CV1A 1EJ0A 2Y99A 1UQVA 3F98A 3KSMA 2F1JA 1NP7A 2F44A 3OT5A 2KHQA 2IBMA 4P7BA 3FFAA 3MYYA 2A1AA 2ZRQA 1L2TA 2CYBA 5TZVA 2VHZA 3CLKA 2PH3A 4PZ9A 2AXEA 4UCXA 2KD1A 5A0LA 2Y4NA 3ROTA 1J1IA 2VDPB 1N6IA 2IYWA 3OQNA 4LJRA 4D9NA 2CHEA 4RF3A 2VPYA 4R8UA 3P9YA 3NT4A 1KJIA 1N9GB 3DLBA 4LGCA 5FYQA 3KRTA 4R69A 2VNSA 1P81A 1DO2A 1I32A 1IRXA 4D9MA 3JZAA 4R1SA 2R751 4D8UA 4BAUA 4TTVA 1X7WA 5K05A 5KTRA 3PVZA 1SZJG 4ZODA 3QUTA 2F9FA 4MV9A 3VNUA 1N7HA 2W3RA 1PN3A 2QN1A 4PSCA 4WK4B 3BMCB 1JHMA 2CNNA 1RBMA 3KYCA 1OXMA 3Q41A 4TS9A 3LWZA 2Z30A 4LQ4A 4IDAA 2YJ3A 3I5UA 3F5SA 3VJLA 4EQ6B 4PAWA 2RGEA 4PPYA 1OV6A 4WBNF 4RCVA 3TFWA 2R62A 1ZQ9A 4TLLB 2P65A 5FULA 4IRCA 4BKOA 2GCPA 3N4MB 3KQLA 3MCWA 3ES9A 1BRMA 1ZWLA 1V4NA 4YMSA 5DWQA 2FSSA 1Y7IA 7ICUA 4FILA 5J1TB 3VO2A 3O4RA 1DRUA 5AKGA 2C8KA 1RXEA 2PA0A 2XICA 2CNKA 4B45A 1UBJS 5HRUA 1D03A 1F14A 4Z4HA 4ZZIA 4KGXA 4J3JA 2DTXA 1ODJA 4GI7A 4C0JA 3R7NA 3L6CA 5KOIA 3WP1B 3FIUA 4NLBA 5JARA 1SZCA 3IHQB 3QZUA 1E2BA 1XCLA 4W1SA 3THSA 3VZCA 1X13A 4CMCA 2KNJA 2R8BA 4GT1A 1L5GB 4J9LA 3MGVA 2XVZA 4MRVA 3ZGYA 4RLFA 2GF2A 5FAXA 3EVTA 4QO8A 4MWOA 3T52A 3ZIAD 4F7DA 1ZL2A 1TE2A 5FL7A 4RXUA 3E5RA 3C1OA 3K0AA 1JLKA 4ASUA 4MH0R 4GP6A 4AMZA 4UUPA 4ED8A 1Y5MA 5FPKA 1RIIA 4TN5A 4IR9A 4TS4A 5A9TA 2FWPA 3K30A 1XLWA 3J81k 2GZ2A 3A9CA 3RC2A 2G1AA 3L4BA 1SBIA 5C8XA 1XEFA 5LKAA 1OXXK 1DJNA 4V0NA 1OYYA 3NI2A 4LZGA 3HG7A 4E88A 3O8RA 3L0BA 5ITVA 3MXOA 5EJMA 2HC9A 5HKAA 4CG0A 3ONFA 5BWMA 4AKHA 1DQSA 1ZHFA 3QVKA 2BFDA 3DKPA 2ZS8A 3EEOA 1NZPA 1T4GA 4E7PA 1A04A 1UMDB 2X76A 4GLXA 4DOBA 2J3QA 4W6QA 5B1YA 3D8HA 3P20A 4D3ZA 4PX2A 1P7PA 2O57A 4DWVA 2QLLA 1GPLA 4IXDA 1CJSA 4RL4A 5HTOA 1UANA 4OFBA 1O77A 4ZIRB 2FRDC 3CPHA 5COBA 1UKEA 4P5EA 1YBAA 1YTUA 4C6HA 3TW4A 4PZYA 2XV1A 4K6FA 4F9FA 1UPXA 4QSMA 1J24A 3K9WA 1WMEA 4JGBA 3AG6A 5EP2A 3ZY5A 2BGNA 4EELA 1TQ4A 2X0IA 2OFPA 1QO0A 5ALUA 2YFYA 4D3SA 4FGJA 1SXJB 4PLVA 1XZNA 4IR7A 1JBQA 3ZVKA 3PSHA 3QEMB 4QARA 3OPYA 3EIOA 4UHDA 1WBDA 2VCHA 1VJCA 2UUOA 4KPGA 1W73A 2GDZA 3GXBA 1Z6TA 5AI9A 3I2FA 1WJGA 4RFSB 5KTTA 1E63A 4Q44A 3I62A 1TCVA 1Z39A 4KLOA 3QBVA 5KTQA 4NM2A 2X1VA 3AY7A 2LI6A 2R2AA 3WISA 1EDEA 1WF6A 4LSZA 4H4DA 2BKUA 3BWEA 1X39A 3ZDAA 2WAQC 5AVRA 3DL0A 2C5AA 4U7CA 5B53A 3A2MA 3HKEA 1BEEA 4DG8A 4LGVA 3OEED 3FF4A 3FUTA 5FBWB 3I4FA 1Z6ZA 2QD1A 3RJFA 2JD2A 1R6XA 2IF0A 1EUQA 2PMEA 4Z99A 4F7WA 4HP8A 4EMSA 3BQ1A 4MUFA 3C70A 1HFEL 2JGDA 3S2UA 3UA4A 1XNSA 1AF4A 4YR9A 4IDCA 3B1FA 3UMFA 1QKKA 3LY7A 4P3NA 2BFCA 5GIPE 1WLYA 1KYZA 3GEDA 2FEAA 3WGLA 3GRUA 3AQIA 2V5VA 1KJJA 1G5FA 1E2NA 3DOEA 4PHDA 1O57A 5G0TA 1EDZA 2PS0A 4UZEA 4EP1A 2F64A 1Q7BA 4NECA 2R1UA 1ZQFA 5JS2A 4O4IB 2AHRA 4J0KA 3C39A 1ZEMA 3UGJA 2Z4RA 2QD3A 2ZRJA 1AIPA 2FFJA 2JRCA 3HBLA 2PSHA 1J97A 1XQWA 3N3BC 3FLAA 1KAHA 2GZDA 2WJZB 3QBJA 4OGLA 5JU6A 3PJGA 1RKUA 2G4VA 4BXOA 4JA0A 3M83A 3FYUC 4LRQA 4NLLA 3HYSA 4M9LA 4AG5A 4Y6GB 3QPUA 4LHZA 5G0WA 1Z7EA 2WA1A 2GLXA 5FUXA 1QFYA 4FYWA 1YONA 4D4JA 1HLPA 2ADMA 4UNPA 4PCVA 2DR0A 4YHHB 4WJ3B 2Q0ZX 2JZCA 3SSNA 5H2FU 4RAOA 2BEWA 4G4JA 2H9AA 4GI5A 4AD8A 2A7XA 1YS2X 4HQ0A 3CLSD 2WP8J 4XPIA 4LTNA 1V1MB 4BNXA 5L3RA 4PRKA 1B74A 3GOHA 5C3UA 1H0KA 2ZI9A 3FGZA 3JD3A 2WYWA 1JIKA 1KFCB 4FUQA 3NETA 1SC1A 4Z7JA 1QG6A 1UCFA 1FDSA 3GU3A 1I2BA 4CM8A 1YQUA 4XYMA 2FW8A 5CLGA 1MIOA 1MJHA 4RJIA 3AJEA 2OFOA 3SJBA 2D5BA 4MCJA 1PVPA 3INNA 2IY9A 3WYGA 1X9GA 3JQ9A 3ZJVA 1UF9A 1HDYA 1H22A 1Q15A 6YASA 2XGOA 3M1YA 5BXQC 4G5OA 4GKBA 121PA 1E3IA 4I2JA 2YYAA 3K4HA 1CEYA 3R8CA 1EUDA 3FZGA 4B5LA 5KVVA 5KS2A 2BPFA 1WF3A 4UTNA 1T2EA 3FUUA 4LOLA 4DIUA 3RBXA 2E4UA 1Q3UA 3F9CA 1UM9A 5EHIA 5F78A 4ZAWA 4PPGA 4XRRA 1BDJA 3USCS 1H2FA 4R3NA 3EOZA 5A02A 1BQEA 3ET4A 2VRCD 3OMLA 1Y5NA 3ZCSA 4OHZA 2OCKA 2GERA 4P82A 1GD1O 3WIOA 3DDUA 1XNQB 2V6BA 2FF5A 1MGPA 3VDQA 4FJ1A 4KRGA 2VP5A 2XVAA 1AA9A 2BE9A 2OXFA 2X8BA 3FH0A 2PFNA 3MHPA 4HH4A 2HWWA 3BRWA 1BX1A 4QFDA 4ZQEA 1G8FA 3HZZA 4EYSA 2GHRA 2HZBA 1JH9A 2ATIA 2PMDA 4D3FA 4B4OA 4L9RA 4HDMA 4MV4A 3HO8A 4MRRA 5G1PA 4MP6A 1OPRA 2I1WA 3ZUGA 2PUJA 2REQA 3R9XA 3C6BA 5ALVA 2QIOA 4LF7B 1MN8A 3OQPA 3PFNA 4Z4EA 4HZGA 4YUZA 4HQFA 1MC1A 1AXGA 3BEOA 1IBRA 1QCCA 4AO7A 3K8ZA 4PXAA 4DLKA 1CERA 4I9NA 3ESAA 5C8YB 3EXHA 3EXIB 3LSTA 4XOIA 2BKVA 2HT6A 3KR1A 1DQRA 2D2EA 2BSAA 2AMVA 2GF9A 1EWKA 4RMIA 4MA0A 1PT8A 3P4XA 3IIMA 3RC7A 2CPRA 4X1IB 2B4YA 4QUDA 1Q1BA 3IQGX 1RYHA 1CULC 5JNRA 3BHNA 4X45A 2Z4TA 4F4FA 4ZK6A 5KYGA 4HXEB 2PUHA 1OWLA 3LFUA 2QS9A 3SSOA 5BO5A 3GLHA 2P5UA 2IOFA 3PCXA 4ITUA 2P6RA 3RSSA 2WI8A 1G5PA 4JQCA 1NE7A 1JLLA 3U5ZB 4X8HA 4RTJA 9LDBA 4YECA 2E7ZA 1U9ZA 2AZ4A 4ARCA 2BZ1A 3NOOA 4BEWA 1JE1A 5EUBA 4D96A 3WGMA 1XZFA 3DE4X 4A23A 4O59O 1OOEA 3IDWA 4O2AF 4IS3A 3BRCA 2RHHA 3CZPA 3SAJA 5AHWA 1P60A 3NHKA 1XNJA 4KRYA 4US9A 1TO1E 4ZPJA 4RK1A 4WEOA 1BVHA 1XUOA 2PZBA 3M4XA 9ICSA 5COAA 1UBFA 4PV7A 2DOKA 4PAMA 1YR8A 3RH4A 2Q3EA 5KX5B 4DZZA 2B83A 4R6WA 4AZ0A 3WGZA 4KZKA 5JAPA 1T5SA 2QARB 3U0VA 3BJRA 5CNJA 2V4ZA 1RYYA 3TEMA 2PN1A 4LY9A 4ECZA 5E4FA 4O0IA 5EE5B 3HFJA 1ND5A 3K8YA 1PBTA 5BW8A 4CLOB 4FC6A 1QM5A 4KQXA 2WWRA 3QU9A 1XX6A 4QUEA 2JDIA 1IQUA 4FXPA 1B14A 5IJXA 3ZZ1A 4FZ5A 3L6OO 2QT1A 3E5MA 2XGQA 1EFTA 3FMOB 4W9NA 3VC3A 3RF9A 5K8LA 2O7RA 2YJ4A 4AY6A 4K9LA 4EZBA 2POQX 1Y7LA 3PDJA 2WNIA 2JFFA 2NQ8A 2OQVA 3G9XA 1ZQ1A 4M0CA 1VSUA 4RVDA 3TZHA 4OV6B 1FDOA 1VIVA 2KX7A 1E1MA 3RIXA 2D0DA 2ZI6A 2QJTA 3FCEA 5AKYA 1X7XB 2HA7A 4EYHB 2V7XA 2J3EA 4RABA 7ICGA 3DHEA 3E9ZA 3EVNA 3SU8A 4KQHA 9ICRA 1W4AA 5J2BA 1TTHA 1VCMA 3U09A 1P9WA 3MINB 5B37A 1WUIS 5HCUA 1I14A 1CUZA 4TMWA 1MDFA 1KAEA 4CFZA 1B8UA 2TSYB 1LI5A 4OBXA 3KWJA 4QXRA 3NYQA 2Y1GA 3L79A 4LDNA 1DFGA 3VHXA 1WCLA 1XVVA 5IVPA 4D92A 2OG1A 1E6CA 2ZP1A 5JSUA 1XN4A 5A7GA 3BA1A 4O4JB 1I4TD 3PXEA 5BPFA 3SYZA 1NLZA 4C3VA 3LK7A 2Q9BA 1VA4A 3J81j 1E1RD 3R6LA 1TJNA 2PUEA 2IZOA 4R0MA 3BZKA 4DQVA 2MMCA 1RR6A 2JLQA 1E9DA 5J4HA 3KZIU 3EEBA 2Q6LA 5LLSA 3V46A 3EG9A 5JEDA 2PL5A 3MWLA 5TT1A 3VU9A 3KFUF 13PKA 1WUKS 4Z6DA 1O7JA 4FDVA 2CBXA 3AVOA 4HPJB 2MHCA 1T1SA 4F8RA 2GEUA 1EINA 4NCXA 1CZLA 4BLVA 3X43A 4UAZA 1XZBA 1GU7A 3A4NA 2IOHA 2SKDA 1EZ1A 2QSJA 3ZXUB 4LBYA 5LP6A 5DIFA 4BMZA 2P2DA 3OTHA 2VJBA 3VOTA 1HORA 1TQ8A 3IRVA 3UH1A 1PVOA 4RHTA 2A9QA 2EJCA 5AVWA 4P4MA 5TXGA 4IMPA 2QYTA 1XZCA 3L7YA 2XUJA 5EMMA 4ZV4A 2LHTA 3I6YA 1QHXA 2NRWA 3W9BA 2PKEA 1UFVA 3KHTA 1U7HA 3ORQA 1JFSA 4PRZA 2IA5A 1LF5A 2HDOA 2WVJA 3S99A 2C2WA 3SZUA 1S2DA 4FIZA 3B6ZA 3ZCUA 1DEHA 4YI3A 1ICEA 3QENA 2ZRLA 4ZZ0A 3UWSA 2WILA 1N9GA 2H1IA 2VVTA 5FO1A 5J5AA 3WLKX 4M1TA 3DEKA 1KYTA 1L7VC 3V2HA 3E9EA 1P9OA 3LRXA 3MWJA 2GAJA 2VJ5A 2JEZA 3A4LA 3SS8A 1S4MA 4IRUB 2PQ0A 4LJLA 2Z98A 1E9BA 3VOSA 1NXQA 1QIMA 2N1MA 3TLMA 4QOGA 4L1KA 3TFOA 4JDPA 1KK3A 3UFBA 2G1UA 3KT6A 3RC3A 4IL5A 1LLFA 5ICGA 4PGAA 1NVDA 5CDTA 3RB4A 5KHLB 4H7DA 2XT0A 4OH7A 4WXYB 4DQLA 3PEEA 1SQ5A 3FBGA 1RD4A 3AI1A 9ATCA 1ZR4A 2QL9A 2JLSA 1EP3B 3HXOA 3F9IA 4WXPA 1Z33A 5EZ5A 2UUCB 2JLBA 1RDFA 1L5WA 3JYNA 4QYMA 2D0IA 1A88A 3IAEA 4MV1A 3BD9A 1LU9A 1VKJA 3BS5A 1DQYA 1U7DA 4ICAA 2GTPA 3RUHA 5MN5A 3QU4A 2XMQA 3WKCA 1DOQA 1GKKA 5L3QA 2BAGA 1JKIA 2JZBA 1C30A 2QM3A 2C7PA 3LC0A 2X1MA 5T4BA 1SL0A 1C4XA 4XWGA 3A4MA 1THGA 2P35A 5IDYA 4Q0MA 1Q0PA 3S4YA 5BT8A 4HUTA 4BLQA 5SY4A 3IV7A 1Z56C 1WVMA 5K4LA 1TLFA 4Y9TA 2LPEA 1VYHA 2QRKA 3CBQA 4Z6CA 2ODAA 3PDIA 3U7JA 1JHOA 3RRYA 3GIWA 4YJKA 1R5NA 3LY8A 4HQOA 4E94A 2CVPA 3GARA 1N2HA 2XBMA 5B4VA 2OHOA 5JT1A 2P9FA 2IE8A 1HDRA 1KFDA 2C1ZA 3U49A 4ZVLA 2VK1A 3AFMA 4FYKA 2XMCA 1JDZA 3D8NA 2HAEA 1CQJA 3MFQA 1Y7HA 1ONSA 3TD2A 5C31A 3QEKA 4QAQA 3EWNA 1OFUX 1X1RA 4DANA 2HXSA 3VO8A 3X1KA 2IX9A 2IITA 2YZKA 4WA7A 3G6YA 3D31A 1KSPA 2YHIB 4LN1A 2AJTA 2PXIA 4ZTUB 3VR4A 4J2TA 5GJBA 4INOA 3BS7A 1BMTA 1PLLA 5CFZA 1M3SA 4XOUA 3DMGA 2FZVA 5FTMA 1QTQA 1JUDA 2IHYA 4L5JA 3NB0A 4AJHA 5JHHB 1F1JA 3IKTA 4LDRA 4AB1A 5CTJA 3CH7A 3TWOA 2YZ7A 3GJ0A 4HL6A 3AVWA 2ZR0A 5KDLA 1WPRA 2ZYSA 1EWTA 3VNSA 2FW1A 4NPHA 3UAZA 1SXJA 3QEMA 4RNDB 3S5UA 3QJGA 2IUUA 4EA8A 5J2TA 1MVOA 4LZDA 1DXHA 1CQIB 4DLNA 1C9EA 5DKWA 5CD9A 3CLSC 1K92A 1SBCA 1K88A 2GFQA 3PHBE 4Q18A 2ZATA 5BXYA 1G3IA 1AB6A 2GEKA 1G21E 2ZTHA 1Q0SA 1WZCA 1VIMA 2YJ6A 3OCUA 2PVSA 3IE1A 4C9BA 1AKEA 4IRMA 2FEXA 1GPDG 3UBMA 3VH2A 1BCRA 3BL8A 2GLEA 4I5FA 4I5GA 1KQNA 2JBAB 5HIKA 1DELA 5CRIA 4COOA 1N8SA 2E4WA 1AV6A 4H6PA 3TPFA 4M1OA 4YRNA 3OPYI 4ND8B 1DG9A 4BFSA 5LQAA 1GG5A 2BCJQ 4XDHA 2VKQA 1NUUA 3ROXA 4ZO7A 2AHOB 1C3JA 1M2EA 1U2GA 4Q4HA 2I3ZA 1BKSB 2EIXA 4OIFA 2ACWA 5FI1B 4Y2VA 1TA9A 1DV2A 4YWJA 1Y4UA 2DZDA 4C7BA 3ABSB 4E5DA 3FUCA 3AR3A 2AXPA 3PZRA 2F3TA 5U4XA 3D4PA 3KPUA 1WLSA 5CA0B 4ZYYA 1HUZA 4F6RB 3PY8A 4Q7EA 3P45A 5L4LA 5KOYA 4P5PA 3ZU2A 1Q50A 3KDAA 2PZGA 3GLFE 2OL4A 4Y7CA 1I7QB 3PR4A 3ZHCA 4YP9A 2QNRA 4OUKX 1O58A 4E5UA 3HSKA 4RC9A 4ZHQA 3QPAA 3PR5B 1EBBA 4EOGA 4R0VA 3P26A 2A3NA 4Q7QA 3EZ7A 1WIWA 1J49A 4E30A 3W5VA 1CG6A 3NTLA 3A6KA 3TTYA 1P62B 2ZYHA 3IB3A 4RIEA 1NQVA 1Q1GA 1A7KA 3GIKA 3UT5A 4G5QA 1ZZEA 4RE5A 2P78A 1L5YA 1RTKA 5IYZA 4WTOA 3K5HA 1E4YA 3VKFA 1VJ5A 3KYJB 3TDMA 4BZXA 2CL7X 1CP3A 2ZTMA 1Z29A 1C9DB 3L49A 1JWAB 2II6A 5IIMA 5C0YA 3X1WA 4DQXA 3G49A 2BFNA 5MF6A 3EDOA 2GBFA 4RXTA 4J0CA 1UFKA 2B9EA 3AV3A 3N8NA 4QIWC 3HDHA 4MUKA 3CVYA 3P94A 1E3DA 2QPLA 3LTNC 2J4DA 1CNMA 3LOUA 3C98A 4NLCA 2GEVA 1G19A 3RB0A 4WXEA 3KJQA 3SHVA 4FCCA 2EW1A 4B3FX 4OJLA 1ZNYA 4DSNA 4FR5A 5A7FA 2EERA 3VDXA 5BRAA 3WAGA 4KCGA 3BT7A 3K4PA 2JH7A 1GQRA 2HGSA 2X5KO 4R2WA 5HWSA 1YV9A 3NHPA 2GZ3A 4V39A 5REQA 1IRIA 1MX5A 1CF2O 2O8DB 4JI2B 4RK5A 1X77A 4KSBA 3WHIA 4F50A 4BDSA 1E7QA 2HN9A 4NC9A 2J3DA 2VWQA 3RR7A 1JFVA 3THOA 5FUVA 1ULSA 5CB4F 3KXIA 4QAJA 2AGQA 1B8OA 3SKXA 1Z74A 4PRLA 2NGRA 3ND7A 2Z6VA 3AF0A 1KMIY 5B66U 4ZI2A 1FYVA 1KYVA 2AOWA 2QB1A 2OCIA 3G2HA 1IN7A 4RCZA 1NT2A 4NLKA 4PS1A 4GQIA 4EG5A 6Q21A 2FXIA 1TFRA 4NCAA 4MYTA 1PYOA 4XIGS 3RUPA 1C2TA 1GYPA 5CVTA 3SC2A 1PEYA 3FSGD 4EL5A 2WRZA 3U61B 2RDMA 4Q37A 2WW8A 3WLNA 3EPKA 4JJ4A 3EK2A 2JANA 3PFWO 2ZFUA 4XAQA 3N0WA 3ZEAA 4YXWA 1UBOS 2IYFA 5JROA 4E2XA 1MRSA 5GGXA 1ZNWA 3B85A 5DLFA 3CKMA 4YS6A 3C21A 4ETMA 3OC0A 5JCOA 3ACDA 1LVUA 1YT3A 2AS0A 5J0TA 3ZBPA 1EWRA 2GF0A 3TSAA 1UDAA 2Q9UA 4UB3A 3MT0A 2OAQ1 4ALNA 4F5NA 4YR0A 1YUNA 4JMUA 2O0MA 1ESNA 3UMBA 2AEEA 4N8EA 1B0UA 1S3GA 3PO4A 1Z1VA 2HRRA 3I92A 4MP8A 1SPBS 4PYRA 5CDFE 3G8YA 3CF4G 3N8DA 3C3BA 2O1SA 1LNZA 1NBOA 3FVRA 3LKBA 1XSNA 1D6NA 2BDEA 5CFNA 3W5AA 1JQKA 4YPVA 4V0QA 4G26A 3VO1A 1U7PA 3ZU4A 1UDWA 3VPCA 5K3DA 4NP6A 2PMZF 5DLQC 5TV2A 1WCIB 4GNRA 1MZPA 1D0SA 3IKMB 1P2DA 3SC3A 5KQGA 1G7TA 1WE2A 1YGYA 3EVDA 1IWBB 4RY2A 1HWYA 4TSKA 4RNOA 6CHYA 2HHHB 1A5TA 2V9PA 3V8VA 4Y6SA 1GQ2A 3OX1A 3DDWA 9ICIA 5LA6F 2XDAA 5H0IA 5AKZA 3A1UA 5I7WA 2RK4A 4L07A 3RIYA 3A06A 3NC4A 1MD9A 4YCXA 1Y1SA 3LVVA 4ZALA 3PEWA 1ENOA 4HAZA 4J91A 1J2JA 1FP4B 4YFKA 4EKGA 5KSWB 4JP3A 2QARA 3L7NA 1U8AA 3AHJA 4YXFA 4U7JA 4JK3A 3A14A 4LY3A 1SC4A 2QXTA 4KWEA 1NHWA 5CH5A 2EP5A 4MYHA 3IUQA 3CWQA 2PKYX 4M1MA 1H2HA 4UU8A 1UAYA 2BM1A 1YUBA 5DGHA 1XWFA 2LYHA 1EB9A 4INZA 4Q43A 4W9NC 4LJSA 3U4CA 4IILA 1BVUA 3DZKA 2UVVA 3F2DA 3LCRA 2O3SA 4A6EA 4D0RA 5LDGA 3H0EA 4P1ZA 1P75A 1TRHA 2BGTA 1U4OA 4OHKA 2QW8A 4MGHA 9ICKA 2B3TA 4EYQA 4RIIA 4ED7A 1JPUA 1B22A 1R6TA 3AM9A 1ZI8A 2I5PO 4MVCA 2AIRA 1KDPA 2HF9A 2H18A 3KR0A 2YXDA 1T3GA 3MINA 1ZH4A 3R5SA 2WJPA 1LW7A 3KBOA 1JLHA 4NOLA 1OKKA 1XZIA 3UV6A 4KLZA 1SHLA 4AK9A 4FX5A 5B7GA 2RGWA 4FYXA 1GZDA 3U81A 1RKXA 2FMPA 3D3WB 1E6UA 3TUJC 3BJZA 2R1VB 5LVAA 3PHIA 2ZKLA 1MZVA 2ZVPX 1D4FA 1Y3FE 4O4JA 2X2PA 3DTVA 4S05A 1MC8A 1SGGA 3NTVA 4RS4A 5LMNB 4KN6A 1WDKA 5FWYA 3DKIA 5HUQA 2KZZA 3MG9A 2YYYA 2H85A 4JS0A 2FKNA 3D0OA 1U7XA 1XAHA 1NJYA 3K35A 1P0PA 4TUYF 5KZMB 1PQUA 1KE1A 4E5KA 3NOQA 4LHVA 3CLVA 3CX6A 4IWNA 2DFNA 5AVXA 3ORRA 3ESXA 3K4QA 2BV3A 4MR8B 4YJHA 4IHJB 2VTKA 1I1OA 3PGVA 2HSDA 4PZZA 2EG9A 4DQSA 3OA2A 1VDVA 5DGXA 4H7EA 2JEOA 4PG4A 4UBCA 1NSYA 1C2YA 1JR2A 2QLTA 3IAUA 1IBMB 3KHGA 2BUCA 2JFPA 1L7BA 1ZRSA 3JRXA 3NGXA 5A5VA 4AUEA 1V26A 1QU2A 3FF1A 1HKUA 2XY7A 1CXZA 1X42A 2WP0A 4GMXA 1E2MA 3D5TA 3F97A 5D01A 1MP0A 1RYRA 2AFHA 2FPUA 1OROA 2YJGA 1N6HA 1TNDA 1JEQB 1EUCB 2C7BA 2W9MA 3WAKA 1YU6A 1JJ7A 4N54A 1H1TA 4C3ZA 5EHZA 2QB5A 1JSCA 4PX3A 3ZVLA 3UXHA 2A14A 2WD7B 1TO6A 2ZLBA 1VIYA 3CO5A 3G5UA 1G5HA 1Z0ZA 5DTIA 4RY8A 4NK4A 4DCTA 3O2QB 3ZS9A 1R9GA 1YE5A 1USIA 4HV4A 3K32A 2P2GA 2QG6A 2R6GA 5FR1A 3PNQA 1CUWA 5HF5A 1NT4A 3OQOA 3ZWCA 4EGAA 4EYIB 1E1QA 5DSZA 4O3RA 1RQ2A 4YEDA 3VAZA 2IPAB 4U9HS 1WUHS 2AK3A 1NUQA 4C4SA 5HW0A 3HABA 3NBYC 3M6KA 5HZKA 4YV2A 3EVZA 2JCSA 4GXTA 1VG8A 4O3FA 1K7SN 1QH1B 3AUYA 2IVFA 2O0LA 4CRWB 1CEZA 4HEHA 4BFXA 4GLBA 3ZCVA 4XYEA 2VPTA 3KK0A 1Z5OA 1XC7A 4WOKA 2XYGA 4BU1A 2P4QA 4Q9DA 2FW6A 1Q1NA 2C7GA 4RANA 3KEMA 4R2KA 2R8YA 4MRAA 3KAPA 4MGZR 3GQVA 1K9SA 2O07A 1IG3A 4IF6A 1N2BA 3A6JA 3PRKE 2X14A 2AFIA 2WWFA 3HW8A 5FAKA 2B4KA 3OFSA 4XLTA 2P40A 4RZXA 2RHGB 1Z47A 2BFEB 5GMOA 2EFDB 2Q1WA 1IB0A 2C78A 1XZDA 4DFDA 2PH7A 4RQ2A 2YV4A 3KTQA 1CEQA 2LIPA 3M6FA 1C8LA 1MFZA 2PBLA 4IINA 3EQ2A 3RK0A 4CMHA 5HMMA 3CEMA 1BRTA 2YUTA 2Q3DA 1SRRA 1AOXA 4RADA 4N7JA 4JITA 3CTMA 4IJKA 5HX7A 2WAXA 3OC6A 1Q1EA 3K0FB 1Y1LA 2X0EA 3WZMA 1LX7A 4I6GA 5DRYA 1AZTA 5LCXA 1HQCA 2FHSA 5F4ZA 3X2EA 2ZDGA 4WECA 1TMGE 1PR5A 5CB0A 1IBLB 1F2DA 1SGWA 2LP4Y 3TR6A 3LAWA 3QV2A 2Y27A 1E60A 3KE9A 5KQLA 2ERYA 3C6KA 2W7PA 3LJKA 4Z7QB 2WKQA 2B94A 4DL4A 5JJCA 3RYFA 4Y6QA 4TKZA 1IHOA 4RWZA 1AMUA 2FLWA 3B9QA 2NU9B 5J2AA 4M8KA 4MYCA 1JHZA 3IUSA 4EEZA 4I50F 1RWXA 2IXAA 3GLGE 3EHEA 3ZNOA 2C2MA 1RM4A 5KFFA 2GJSA 3Q9UA 5JAMA 1ETHA 3CX3A 2QBYA 2J9ZB 2EL7A 1TA0A 3GRFA 3SI7A 1SVMA 4BUCA 3I23A 3Q9NA 4QWBA 4IICA 3QWHA 2UVDA 1ZSYA 1EDBA 4QOSA 5DGDA 5BUSA 4KLTA 1QB8A 4RACA 2HNKA 3OAAA 2R6FA 5BURA 5LXTB 4OCZA 5AUQA 1PQPA 1Z2AA 3QE9Y 3P2JA 2GHQA 4UXJA 4J16A 3TRFA 4BAGA 2EGUA 1ADYA 3UAOA 3THVA 4B0PA 3LBAA 1AUOA 5K0LA 4OD0A 3P52A 3NC0C 2UAGA 2BQ3A 3IV9A 4DTCA 5BR4A 3K2QA 5EFOA 5A0TA 3T7JA 4X44A 3ICPA 4I66A 4G24A 1MXFA 1Y5RA 1U2GC 2R85A 2QY6A 3HB9A 3VR6A 3QMMA 3DKKA 3PF8A 1T9CA 2E5WA 4ZCPA 3BQNB 3ELYA 1ZC3A 1EB8A 1Y4SA 4OYRA 1NURA 1H2EA 1V1JA 3K15A 4OSPA 4C08A 5CDHA 4EO9A 4Y2TA 1NIPA 5CA0A 1UT5A 1L8XA 4F6RA 3BQTA 3BYZA 3OE4A 3T95A 1KDHA 1VKHA 4F2RA 1AE1A 3K73O 3VVMA 4XVRA 1U7WA 3F1LA 2OOKA 3M8KA 3F9RA 5EHGA 2E2WA 4PSKA 4FB4A 1BJKA 1B15A 3G5MA 4ZOLB 2HRCA 3TZLA 3PX6A 1QQ5A 4C4AA 3ZCPA 3ICEA 2CLEB 4GBGA 1ZISA 4RO0A 1LPMA 3RT7A 4DAOA 2VDWA 1GXSA 1EFUA 3H7IA 2G6TA 1DJMA 2AEFA 3VVLA 3OGUA 3NHFA 1K4MA 4EUSA 9ICJA 3AM1A 1O0CA 1UODA 4C80A 1V38A 1IAVA 3TFQA 1XA3A 4J0FA 5ALIA 5AD1A 4G89A 2XMBA 4XRGA 4LPKA 1QIIA 2AQIA 3R7DA 2XY4A 2PYDA 3PT9A 3P9QA 5K6TA 5JZVA 1RT9A 3W2IA 3FKQA 3LCJA 3PFHA 2OAGA 2J45A 3KTAB 2YMQA 4RY0A 2OM6A 3AFNA 5EXSA 4Q3BA 3AWIA 4YX9A 2JH1A 1NOMA 4R63A 3FVVA 2Q2VA 5JS8A 3W2TA 1QGDA 4ZJYA 1ODIA 3FJ1A 1J8FA 1KP2A 3R0QA 1S2GA 2XTAA 4RT2A 2KBEA 3IDSA 3F2BA 4MPRA 1RE0A 3FPHA 1NNSA 5CA7A 1UZUA 1FU7A 7ICEA 5CH8A 3I12A 4MQBA 3EX7C 1KJQA 4XWTA 2VATA 1SB9A 2O8DA 2Q3FA 3TW8B 4O3OA 1YZ3A 5JRDS 1Z63A 1J06A 3IALA 2JASA 4CQLB 1NKVA 5CCXA 5LOVA 2G8NA 3FCSB 3IPXA 5ERYA 1EXVA 4S3MA 4GC6A 5J2EA 3JPTA 2W8BB 4KH1A 3HYLA 1VI2A 4O1HA 4DM3A 1G3RA 1RPTA 4I1IA 5LDHA 5CX1A 4MUMA 1JNXX 3FMGA 3ADDA 1WB6A 4H6WA 2NU8A 3F78A 1KTIA 1QSSA 2YDYA 4BZPA 1DAKA 3EH1A 1XIVA 1DL5A 1HY3A 4HEA1 5FR2A 8ICZA 2F4NA 4BBJA 4LJ7A 5FLEX 4YASA 3LHDA 4TQGA 2VJOA 2VHTA 3I9V6 1VPLA 4FGKA 3QKRA 1XG5A 1M2GA 2H4ZA 3C6MA 2AX3A 3ACBA 4DCJA 3RHSA 2X0RA 3LRPA 1VPWA 2ZI5A 2AJDA 2VA8A 1M0SA 4I99A 3VR3A 2WAAA 1F12A 3WWYA 2CMDA 2CYAA 4P4NA 4RS3A 1MQ8B 1JFRA 1YR6A 3VZPA 3HS3A 5FKJA 1ZCZA 4GOXA 4TV8F 2Z5GA 3NM6B 1XDDA 1E9RA 3PCRB 4Q7KA 3Q7EA 3STWA 2QLMA 5AW4A 3GT7A 3TMKA 4YJ2F 2BMWA 4LZZA 5IJWA 1EX1A 1VGVA 1TPZA 5A4MS 2PK3A 3V42A 3K9LA 4M0FA 4AJLA 2FN7A 1K2VN 4LV6A 2QE6A 3GILA 3UO8B 1GQOA 2OYRA 2EKZA 4DJ5X 2WLTA 2ZAYA 3R9IA 3GG9A 1P3Y1 2A9PA 3AK4A 1PR6A 3GFKB 5GY7A 5L1LA 4QDJA 3IP9A 2R18A 3RFCA 4MWEA 4R71A 5KYKA 1G8SA 1ZQTA 1V2GA 3NGLA 4YO7A 3RS2A 5K3AA 4B4VA 1FLNA 2EBWA 3TQ1A 2B6NA 3T7KA 4YO8A 4AS1A 3U26A 2CV0A 3OZVA 1KDZA 1H42A 2PZEA 2QYHA 2B8WA 1P1RA 4WSOA 2A3RA 4CTNA 2H1VA 4QZEA 4OU4A 5BSMA 1I6WA 4C2TA 3LKZA 1X1CA 2Y0DA 4O4HA 4F3KA 3N39C 1WS6A 4DOCA 1LB2B 1AUPA 1PGPA 2GEDA 5TMPA 3IDQA 1WHTB 5FL7D 2VH5R 2ISSD 2JHAA 3OEHA 3A7EA 3P0IA 3C28A 4ASUD 4HTAA 4DBZA 1Z4KA 1FP4A 3N8IA 1BE6A 3RC9A 4CRXA 2O1XA 5TMBA 4II3A 2IS4A 3P1JA 2ODEA 3PNLA 4QBGB 2YS7A 1F2VA 3D6MA 4QYIB 2R60A 3IDAA 1UBMS 4JKOA 3A2NA 3S0JA 3UKJA 1CYEA 1UQRA 2HBYA 4OHOA 3BC1A 1EFRA 2F1KA 2V98A 3DE6X 4BZQA 3GIDA 4X63A 3NS1A 3T7SA 4E03A 3ZWPA 1PW7A 1CX9B 2PJDA 4F9TA 1S9DA 2PZAA 2JD1A 3RG8A 2AC2A 3NIDB 2ZJZA 2QTGA 5DG9A 3KAKA 3EN0A 2IODA 2DY1A 5JIBA 2NU7A 3DBHB 4QBIA 1GU0A 4WJKB 5E4TA 1ELOA 1NG9A 3GLVA 2FRXA 4XD2A 4PINA 4G2NA 2FW9A 3F67A 1P4HA 2ZUWA 4NE7A 4AUMA 2A0XA 4KUHA 2BTEA 2NNLD 1OFGA 1OLUA 1QONA 4GKVA 2Y0EA 3LT0A 2QEQA 1D8BA 4AMVA 2BM8A 2XQKA 1QO0D 1A77A 2JJ8A 3PEFA 1KH1A 1L8AA 4H7JA 4NYMR 1RKQA 1PJ4A 1KMHB 2R6HA 5JANA 3P4YA 4QDXA 2R7LA 1AU9A 1ZC4A 2EBFX 1K5PA 2R1VA 3R6DA 4E2WA 4QVIA 1NW7A 4JQZA 5DBIA 1YQ9A 5HVNA 3A0UA 4D82A 3D0KA 4H1HA 3BRQA 4K6GA 3GMTA 3DLAA 3QELA 3QU5A 4ESHA 1CKEA 4JN6B 1ADJA 4JENA 3PLNA 1JQDA 4MR7B 3JVEA 2EFHB 4UE6A 2J3LA 4B9NA 4GGMX 1T3QA 3HCOA 1G20B 4R16A 2J87A 4UNRA 5CVUA 2F55A 3AM4A 3DMPA 4G5XA 3WL5A 2NOAA 1K6MA 1IQ0A 1H3FA 1U8ZA 2B8EA 5KFMA 4QUHA 3UT6A 3NEPX 4UB2A 4NENA 2C88A 5BW4A 1KRWA 1OAAA 2RE8A 5AK4A 2H7VA 2E1RA 3SBEA 4KN8A 1ZOOA 3F74A 2BWJA 1YC2A 3PJDA 5HXAA 2ZWMA 4AO6A 1L8QA 4EK9A 5J63A 5L1JA 2EGGA 4L6CA 4A92A 4U7TB 5JBQA 2CB0A 1RBQA 1WL8A 3PUHA 2WZQA 3EMVA 5CB6A 4CTMA 1I13A 5AI4A 3BFJA 4BTEA 1WKVA 1XXHE 4MW1A 4QOEA 4PLGA 1ZNZA 3FTCA 4URYR 1F6BA 1BIFA 4FT2A 4BV8A 4LC1A 4KQJA 5CURA 1CUIA 4H6XA 2I67A 4KO2S 4EY8A 3A0BU 4NZPA 1Z3CA 2W6OA 4WRRA 5IT0A 1NI3A 2FGJA 1S76D 3GLHE 2AB0A 2WKSA 2JKZA 1UMCA 1I7DA 1OBFO 4DA7A 1T8SA 4YAKA 4U02A 3ZLVA 4RDXA 2AQKA 1ENZA 1VZ2A 3VJKA 1U0BB 4MAAA 4HDSA 1Q2UA 2GUWA 3DEFA 4OYLA 3N58A 2EG5A 1AD2A 3S44A 4LBWA 2LD4A 4DS4A 4M53A 2BCQA 5KB3A 2O8CB 4DJTA 1QPGA 2ODPA 3H9BA 1QK3A 3GGDA 3MGCA 5DN6A 4F2SA 1WW3A 4R9VA 1O3YA 4FGWA 3AXTA 1KH3A 4Z9BA 4I2HA 1XDGA 3EA5A 2R5WA 2NZJA 4DR2B 2QRZA 1I7PA 2XYPA 3CUYA 3HYRA 1GRVA 1POXA 2RH9B 1VJDA 2AF3C 5C1OA 1ONNA 3DOCA 4REOA 4Z6FA 5BVGB 4Z6EA 2DBRA 2VP4A 1PEKE 1GQSA 4KTTE 2WYIA 3GEIA 4EKDA 4J4TA 1UZLA 4H3SA 3A9VA 3ROKA 4JI8B 1DJQA 2BFEA 2J48A 2HFKA 3SIPA 4DSAA 2AG8A 3NUZA 3IHLA 4F4XA 3CKLA 1AA6A 3BFVA 4RIHA 4YBZA 5EJ5A 4BRZA 3MWEA 4B35A 3KKAA 3V7WA 2CMFA 4TZKA 1IULA 4KPUA 2P68A 2AI3A 2A4MA 1IUOA 4CL3A 5HJ2A 3LQRA 3UV3A 3EFEA 4TL7A 3BRWD 4PO3X 2B35A 2NVOA 3TRKA 3QHQA 3ZZMA 2IPXA 3GR6A 4KBGA 1F4VA 3U3OA 3IBYA 3LYSA 4I7EA 1Z2EA 3MAGA 1CQWA 4OLBA 5TGTA 4UQOA 4YXJA 1TCBA 2JVKA 1VTKA 4JJGA 3V4LA 3O75A 1P2SA 2JFWA 3MYRA 2ZYTX 4PN3A 2O2XA 2F62A 1PK1B 4C7ZA 2I1VB 3PA6A 1JTVA 2HB6A 5J59A 1RIFA 3F6EX 2COKA 1AHNA 5DI3B 1VL6A 3F47A 3RJIA 2W9AA 3IUMA 3HVJA 1C1HA 3SENA 4DSJA 2JAOA 2HHTA 3DH0A 3ELDA 4QXMA 1EHCA 1Y80A 4CKYA 5DHRA 1R2QA 2Q4BA 1TO2E 5CW1A 2QJRA 3H3FA 1COZA 3KZ1E 1IOVA 3Q5DA 2PUVA 3T0IA 2ZSUA 3KZNA 5CXXA 4MQ6A 3OQ1A 4KYVA 4A2WA 1KZ6A 4M36A 4HNRA 4MKHA 1CY8A 4YJDA 4L75A 1C4WA 2OZPA 4GQBA 1M2VA 1ZSVA 1NUTA 4IP0A 2ZSBA 3PXAA 1S10A 5IRCD 1KW4A 4KLEA 3T7EA 1UR5A 5HOQA 3FVWA 4X7BA 5JVDB 5EC8A 3TBKA 4IFTA 1PQYA 2VAVA 5IU6A 3EZFA 2YHSA 1ZQLA 4RORA 1ZJ4A 4QZIA 1VGQA 3BGIA 2WT8A 4QUBA 5CHYA 2PXHA 1SG9A 1Z34A 4W7SA 3EPIA 1QRUA 1U2ZA 4B3JA 1SUBA 1DWPA 3C6QA 2AUNA 5ESWA 4ONEA 4GMFA 2FP3A 1L5VA 2EKQA 4I55F 5E1MA 4N3GA 5GPBA 1BZYA 4MWCA 1XO1A 1RHRA 2ZYAA 4L2IA 1QK5A 2WAYA 4BFUA 3DVQX 4GOOD 2NLOA 1XVTA 3F5FA 1Q2XA 2QSUA 2A30A 4W82A 1QMPA 4Q6WA 1G1MA 2V58A 3VR1A 1U2RA 3IXLA 2YFHA 3PS9A 3B2EA 1PS0A 1Q74A 4RX1A 1VBFA 2OPHA 1I0LA 4R1UA 2WKPA 3CEHA 3EGDB 1T9GR 1EJ2A 1DOAA 2JLCA 2JDID 2NSYA 4L5YA 4DZTA 2IEAA 3SS9X 4XVUA 4ZANA 5BR8B 4HZIA 3IERA 5AMXA 3E4DA 2IYXA 2FG6C 4P3KA 2KHVA 4L78A 3RABA 2AEJA 3FI9A 5DP1A 2O6LA 4PLYA 5K0JA 3T7TA 2B2NA 3BGWA 3KV1A 3MCVA 1L7PA 3UMMA 4ZDJA 2CDCA 1F0YA 4ZO8A 3NX4A 3MR6A 4PPQA 1UPAA 5AI0A 2H3FA 5E6RB 4L9WA 2QDXA 3G85A 3TL3A 2VAWA 2XR1A 1PFYA 2C9BA 2D8CA 1RXCA 1NW8A 4JV1A 1UADA 4CG3A 3TRJA 3ITEA 4G0OA 1DO0A 4J1QA 1L5OA 4X3PA 4RK6A 4RQ5A 5HKOA 3EYAA 1BKDR 3DVAB 1XZJA 5A1JA 2KJQA 3GFOA 2Z04A 1SK9A 3BMCA 4ZDWA 3MNFA 3GI1A 4H15A 4O4LF 4HRXA 5GTHU 3U56A 2CGEA 1PUIA 5F64A 4DUYB 4M0EA 4DQQA 5EQDA 1QDUA 4EQ6A 3ORYA 6LDHA 1UDCA 2R68A 3DLIA 3FMVA 4RQUA 2G0AA 2L18A 3FA2A 3JV7A 4BDTA 4PS0A 1DG3A 1YB1A 4FDAA 4S1OA 2A8YA 4GL4A 4R8SA 3RJGA 3A6ZA 1C29B 5B6IA 1HI9A 1LQUA 5BWLA 3M5PA 2V96A 4MYUA 1E1NA 1B1AA 5DM60 3DDOA 2YZ2A 5ANRB 2O7NA 4DYDA 1JYFA 4G84A 2GO7A 3OQMA 5DB4A 1WNFA 5BNZA 5KKCA 1ZOIA 1A4RA 3KPJA 2ZDHA 3DZFA 4OXKA 4XIJA 3P2IA 1CRZA 5DNYB 2JB9A 4WBSA 1JIQA 1D3AA 5K20A 1KQOA 3USES 2G5IB 3MBYA 1WSAA 3I30X 4ER0A 3NRZA 4KLNA 5H80A 3L41A 2PX2A 5CXUA 1IHXA 4FCTA 4Y1GA 4RK0A 2LCQA 3AJAA 4GZMA 1M75A 3GA5A 3IJEB 7ICTA 4HDRB 3UHJA 2F8LA 1FFGA 2R65A 3M6ZA 2P4EA 1QNLA 4HAXA 5JQGF 1IUPA 1OYVA 2HQ1A 2BGLA 1C9JA 3L4BC 1IY0A 2M32A 1XZPA 4CPDA 3MB5A 1QHNA 2Y92A 5DNAA 1N3BA 4K9DA 4BQNA 3H5IA 1QYVA 1OLOA 4QQKA 3JS5A 3L8DA 2BKLA 1PFWA 1PR3A 1CUKA 1GY8A 3NTUA 2X4LA 1UMDA 1PG0A 1DKLA 4JHXA 4YMOA 1G291 4Q9NA 1C1XB 3P0JA 2JGLA 3T06B 1M2OB 8ICAA 4WKCA 5DB7A 3ENNA 2CMGA 2MU1A 1PL6A 2BBSA 3OJUA 3IQZA 4ZIRA 4LUCA 2QAGB 5A5GA 3QU7A 3LC7O 4Y18A 2PFPA 2Y9MB 3PNPA 3I2JA 1N92A 2ZPTX 3FNEA 4C4PA 1M5RA 2J09A 4MDYA 3V34A 3WNDA 1K7EB 3FOAA 5K03A 1Z5UA 3DE2X 1ZX1A 3HFGA 1PJTA 1Y1TA 2GLUA 2FN3A 1DBPA 3PP8A 2J9GA 2DG2A 4E11A 1N5DA 3UHOA 3HDQA 3JQCA 2ORIA 1K63A 1MJNA 2XYHA 1NWCA 5EFZA 4LKOA 3ZHQA 1ZBDA 4RFSA 4GE3A 3NYIA 4B9MA 4X0EA 3QPBA 3W8EA 3A32A 4CIXA 3W5IA 2PYZA 2CDBA 2JFXA 3BIFA 3S70A 2NADA 4WQMA 2WJVA 2FOXA 3ISTA 1YMUA 4JB0A 5DM2A 4M8LA 2UUBB 3B82A 4B79A 1WHTA 1E8NA 1I6LA 1A9XB 1KU0A 5CTAA 1DFHA 4A7PA 4S12A 4HYEA 1W87A 1I4LD 3IMEA 3RVLA 1N5MA 2PCJA 3QVMA 4R40A 4L72A 1DVRA 4PL1A 2BZGA 2VK8A 3PK0A 4Z0PA 3HR8A 5KVSA 2Q4OA 721PA 1B41A 4KHZA 3RH6A 1P1BA 4RF4A 2FFHA 3JVUA 2AUMA 4A26A 1FRZA 4BGEA 4DHEA 4YONB 3D7RA 1J9ZA 1G8AA 5JFTA 5G40A 4KVZA 1NVBA 4M2LA 3ILYA 3R76A 1N2OA 1F3OA 4BQOA 1YRHA 2ZIUB 3R6WA 2LIVA 4O4IA 3IEVA 2P6UA 2DUWA 4G5HA 3VR2A 2AI1A 3LPLA 3CZRA 3AO0B 1RZ3A 3LVRE 4LE0A 4O33A 3TLZA 4R68A 1N7IA 2Z83A 3VR4D 4CLRB 4M9RA 2GBPA 3ZZ0A 4RK7A 3MS7A 3A1EA 1HDGO 3B2NA 3N76A 1E2PA 4BWYA 3QNWA 1AS2A 2C29D 1M74A 4KQCA 4XE5A 4UTXA 5K0ZA 4KYTA 1NW3A 1X1EA 4NFYA