3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
4C4SA 4MWOA 5AM3A 2HSZA 5ALUA 2B82A 2YJ4A 4RETA 4BX3A 2I54A 4XPZA 1YV9A 1RKVA 2IOFA 4EX7A 1YNSA 1CR6A 4BEVA 2WM8A 3WK6A 3FPBA 1Z5UA 2ZBDA 3W5BA 3IJ5A 3SD7A 3ZX5A 1RQLA 2CFTA 4HYTA 3ZWKA 2B1RA 1QYIA 3U19A 1NRWA 4PNHA 2FPWA 2ZBFA 1TE2A 3U26A 1N9KA 3A1CA 1T5SA 4FYPA 4IG4A 2RBKA 5AM5A 5AVSA 1RKUA 3QGMA 5ALRA 3U7HB 2GO7A 2PR7A 3L5KA 1Z88A 2QYHA 3L0BA 2IA5A 5AI6A 5AW2A 1LVHA 3U7FB 1RLTA 3QYPA 3OCUA 1SWVA 2YMQA 5AW3A 1TJ5A 5AKGA 4NAVA 3FM9A 3QUTA 3WGUA 2ZXEA 3W5CA 3NASA 1WVIA 4BX0A 3K1ZA 2JAUA 4BX2A 5AW9A 5AW0A 1KYTA 2W11A 2G08A 1T9ZA 1U7PA 2HEGA 3NANA 1Z4JA 3SF0A 5ALVA 3ZX4A 3IRUA 3DAOA 5AI4A 1MH9A 4RESA 5IT4A 4B6JA 3QNMA 4AS2A 3QU9A 2IOHA 3TLMA 2I7DA 2B30A 5AKXA 1L7MA 4NFLA 5AVZA 4ZEVA 2HX1A 2PKEA 5AI0A 5AKYA 2P27A 2R8XA 5AVWA 2FPSA 4UW9A 2EATA 3KZXA 4HGNA 3VAYA 3MC1A 1L8OA 3QU5A 3B9RA 4BEWA 1QQ5A 1Z4KA 3OCXA 3AR7A 5ALXA 1Z4MA 3WK7A 4IFTA 2WF8A 3ED5A 1U2TA 2JARA 1Z4OA 4YIHA 4QQFA 1K1EA 2B0CA 2C4NA 2WHEA 1J97A 5ALSA 4O8CA 3AR2A 3UMBA 3PDWA 4CE6A 4UMFA 2GMWA 3KBBA 4DFDA 4Y2QA 5ALMA 4CF3A 4F72A 3ZVMA 5ALIA 4KN8A 1Q92A 4Y2VA 1L8LA 2P9JA 3L1VA 3R09A 3E84A 1EK1A 4BKMA 2GFHA 3ZVNA 1IWOA 5AW5A 1T5TA 5AKKA 5ALNA 3W5DA 3OCVA 2OA0A 3W5AA 2ZOSA 3WK4A 3L0CA 3CZ4A 3WKAA 1N8NA 3QU4A 2W43A 1X42A 2WF5A 2YMLA 5ALZA 3ET4A 2RAVA 4UAUA 4OHFA 2AUTA 1SWWA 1ZD2P 5AKHA 3KDPA 3QLEA 3CNHA 2G0AA 4CNQA 2B1QA 3M9LA 3MPOA 4HGRA 5ALJA 4GXTA 2GHQA 4UARA 3EF0A 2NO5A 4NV0A 5ALGA 3WKBA 5ALWA 2AGVA 3PGLA 2X4DA 5AM2A 4XE5A 5IT0A 4EENA 2HOQA 4L6CA 4UU0A 3L0YA 2W4MA 1TJ3A 2YN4A 3QX7A 4KNWA 3AR6A 3UM9A 1TJ4A 3N07A 2WF9A 4DWOA 1RDFA 4Y2UA 3QXGA 3ONNA 3FPSA 4HGPA 1ZD4A 5ALFA 3E81A 1RKQA 5ALLA 3A1EA 4UMEA 3AR5A 5AVVA 4HGOA 3SHQA 1Z4NA 5AK6A 2I34A 5ALDA 5ALOA 1Y8AA 2C88A 2C8KA 4YCMA 2HO4A 3ZW7A 3DV9A 4BNDB 2HF2A 3ZU6A 1RMQA 1JUDA 3ZI4A 1YS9A 1ZJJA 3EPRA 2JAOA 2Q4RA 4YIKA 3L7YA 4UASA 2MU1A 2Q4TA 3E8MA 4KYTA 3FZQA 2ODAA 3ZUPA 2YFYA 4Y3UA 5AW6A 1WPGA 2R8YA 5AVYA 2CFSA 1QQ7A 2YMPA 3ESRA 1S8OA 1ZD5A 3I6BA 2AMYA 4AP9A 4EELA 3UMGA 3OCWA 2OYCA 1J8DA 4H1WA 1ZRMA 2FUCA 4JDPA 3ESQA 5ALHA 2R8EA 4KX5A 4KNVA 3NUQA 3OCZA 2YY6A 1ZD3A 2MSNA 4E88A 2QLTA 5ALEA 4BNDA 4CF5A 2FPXA 4DW8A 4FE3A 4J2TA 2YMMA 5AHXA 5AI5A 1NF2A 4EX6A 2YBDA 3J7TA 3M1YA 2HDOA 3AR8A 2EARA 3A3YA 3DNPA 1Z4PX 1RPZA 1U2SA 3FGOA 5A3RA 5ALYA 2G07A 3U13A 3U7EB 3P96A 2FPRA 1NNLA 3B9BA 2FDRA 3E58A 2CFRA 1RLMA 4FFDA 1O08A 5FP0A 1RMYA 2O2XA 1VJ5A 2G06A 2G1AA 3WK8A 4HAIA 5AVXA 2Q5EA 5AVRA 2HI0A 1RMTA 5AIAA 1RC8A 4XQ0A 3QUCA 1Z5GA 1L6RA 1VJRA 1ZOLA 5AESA 3EWIA 5AKJA 3L1UA 1Z4IA 5A3QA 2ZG6A 2C8LA 3IB6A 3SKYA 3R4CA 4YH1A 1XPJA 2IYEA 2OBBA 5AK4A 2FUEA 2IOFK 4Y2XA 5AI9A 1F5SA 3ZTYA 5AICA 1WR8A 4Y2TA 3KOOA 2CN1A 4L6AA 5AW1A 3AR3A 5ALTA 5AW7A 4G9BA 4Y2SA 2HF7A 3R9KA 5AM0A 1U7OA 2FEAA 4I9GA 3RFUA 1RLOA 4KX3A 3NAMA 4UMDA 3KD3A 5AM4A 3L8GA 1RRCA 3EF1A 4ZEWA 5AW4A 2O9JA 4MUMA 2GHTA 2YJ6A 2B8EA 4NWIA 5ALKA 1FEZA 2RB5A 1CQZA 5AIBA 2VKQA 3WKCA 2WF6A 5ALPA 3ZVLA 4UATA 2JGAA 4BYGA 3QU2A 4I9FA 3RF6A 2YJ5A 3OTQA 3FVVA 5AKLA 3SKXA 5AK3A 3NIWA 3QUQA 3B8EA 1XVIA 1XP5A 2RARA 3I76A 3BA6A 3ET5A 5AKEA 2HHLA 2B8JA 2DQSA 3AR9A 3N8GA 1LTQA 4YCLA 2OM6A 3U7GA 3HLTA 2YJ3A 2I55A 4Y2YA 4ZEXA 3WK5A 1RQNA 3QU7A 4C4RA 2FPUA 3OPXA 3BWVA 3DDHA 4GIBA 5AVUA 2BDUA 3F9RA 4EEKA 1ZRNA 1S2OA 4Y2RA 3S6JA 1WZCA 2D2VA 3QUBA 5AKZA 1QQ6A 5AM1A 3I28A 1TA0A 3N28A 4NABA 4G63A 5T41A 3SLRA 3UMCA 5AW8A 2ZBGA 2HCFA 1Q91A 3MN1A 2G80A 1QH9A 4F71A 3PCTA 1L7PA 1L7NA 4OFZA 4UAVA 3WKEA 2G09A 2WF7A 4HGQA 4BBJA 1YDFA 4UM7A 2AH5A 2I6XA 5AVQA 3NALA 4YGYA 2BDEA 5JJBA 4YCNA 2EAUA 3L8HA 1PW5A 1EK2A 5AK5A 2P11A 4J03A 2FI1A 3L8FA 2ZBEA 3PGVA 2R8ZA 2MU2A 4OD0A 2I33A 4C4TA 4XOUA 2BY4A 2PQ0A 3SMVA 5ALQA 1U02A 4UM5A 3A1DA 3D6JA 1Z4LA 5IS2A 3NRJA 3WK9A 3L8EA 3ZWDA 2NO4A 4OCZA 2WFAA 4DCCA 1SU4A 4UMVA 2JAWA 5A3SA 4Y2JA 4EZEA 2P69A 1O03A 3KC2A 4QJBA 5AI8A 5E0OA 3MMZA 3GYGA 4L57A 5AKIA 2C9MA 1YMQA 1VFPA 4JB3A 3WKDA 3N1UA 3HYCA 3OCYA 3N5KA 2NYVA 3I1YA 1AQ6A 3AR4A 1L7OA 4Y2PA 4AS3A 1ZS9A 1Z4QA 5AVTA 3ZTWA 3WGVA 4CF4A 1YJ5A 4UU1A
chains in the Genus database with same CATH superfamily
2DVMA 1W9MA 2XQIA 1Z1BA 3HR8A 3RAXA 3EF3A 2DLNA 3BL6A 3QMMA 5HM8A 2YX8A 4EG4A 1W94A 4U6QA 1YQTA 1M8FA 3OZCA 1XKLA 3KT0A 4AX8A 4I3FA 1QHXA 2MSKA 2DZDA 1J25A 4XR4A 1XZQA 4PS0A 1CR6A 5KVQA 1TVMA 5BORA 2WM8A 4TWRA 4MVXA 3EQ8A 4KWIA 3ZJYA 1YZ3A 3PV8A 2VA3A 2XZDA 1NK7A 1M1NB 5C8ZA 3T3PB 1RQLA 5HKBA 5HR7A 1ZH6A 1H5UA 1DIBA 1M6VA 2VCHA 4L4XA 4M49A 4EOGA 1KI6A 5HGJA 4CIBA 2ICAA 1NP3A 1QCCA 1U2ZA 2B7BA 3T1VA 2GO1A 3L4EA 3EMDA 3I9KA 3MRXA 2ZUSA 1IHOA 4O4LA 4XKJA 5B3JA 2B20A 1SPBS 4Z3DA 3RK0A 3WA6A 4NTZA 5BR8B 2M1XA 3P0IA 4F5RA 1XP8A 3VYRB 1N7HA 3G2NA 2IVZA 1NV9A 5JS2A 3N3BC 1M8GA 4D57A 3H0KA 2CLMB 3DLIA 2Q5QA 1N56A 4MKRA 5B3AA 3EGIA 4RIHA 3I8SA 4JJGA 1MB4A 3Q7IA 3JRWA 5CT9A 3AKZA 1GG9A 1NXOA 1FUKA 2IRWA 3GUHA 4HEA1 5GZ1A 4Z4FA 5J2AA 2GF9A 4A1FA 1CX9B 1XRSB 2MR5A 1TJ5A 3EVEA 3R3SA 4P7JA 4Z6DA 1F12A 4NAVA 4IKOA 3M5PA 2AYYA 1YUNA 3BTSA 4G4SO 1KSGA 1II0A 1ZIOA 3FMPB 3IXMA 1UAAA 3EZ7A 1B3BA 5HMLA 1A9ZA 2NLOA 3HJAA 4LYJA 1F7UA 4PCVA 1XD8A 4BUCA 4DA0A 3KJIA 5HHIA 5KQRA 4OIFA 1RBQA 2OYSA 3EMBA 1VBNA 1OV4A 4P4TA 5IKOA 1JFTA 1WVGA 2YC2C 2DPJA 3QV1A 4WK0B 3Q12A 4N54A 4JQCA 2HEGA 4C0QC 5HRCA 2I3DA 2CHFA 4KQJA 3QVLA 3RTGA 1C8KA 2CCJA 2PFKA 5TARA 4ZVNA 2FQYA 1HFEL 1KZYC 2DFVA 4Q48A 2OLKA 3ANLA 5FPSA 2RGRA 4QOSA 1OSNA 1X7XB 1AHHA 1M8KA 1XVUA 3AGQA 4DF8A 2FW8A 2ZPTX 4J9OA 1VHQA 1FDRA 5DQGA 3A06A 3ESZA 1QIDA 3TB4A 4UVHA 3H0RB 1QFZA 2ZYIA 3UGJA 2GN9A 3BCSA 3ENZA 1XMJA 1G21A 2AQ8A 4UBOA 5LMNB 1W8DA 3VM6A 1WL8A 2X14A 2IOHA 3PC6A 4L4ZA 1I0IA 2DERA 1BE8A 1ZXXA 3EVTA 3UICA 3RT9A 3IAXA 2FSUA 1NLMA 4P80A 4LF4B 1QB8A 2O3RA 3K16A 1WV1A 1N9ZA 1W0JD 1Y1PA 2QW1A 3VYUB 3U7RA 1Z33A 1JDTA 1SVNA 3M1AA 1MRZA 3QZ7A 4WGGA 1XKQA 4YJHB 1R9GA 3KQYA 4FMPA 5KIAA 2GKSA 3VU9A 5AHOA 4LNHA 1M34E 4EF5A 3HRKA 1K8XB 2AC2A 8ICSA 1U0FA 1UT5A 4F91B 1V7ZA 3IEIA 3RTAA 3UJBA 1EBFA 1I2BA 1OFHA 1Z4KA 5CEEA 2I66A 3Q6MA 4I50A 1BH2A 1H66A 3KL4A 5ALXA 1T2DA 4KQFA 1D6JA 1FQKA 5KC8A 1OQAA 3E3NA 3L43A 2JEZA 3EIOA 1EFPB 3LXUX 4QQFA 4YIHA 4BAUA 1GUYA 2KBEA 2QPOA 2VP0A 3OIDA 2B0CA 5DB8A 4ZI7F 3MFHA 1RYMA 5I7UA 1MZPA 1UXJA 1R16A 3AESA 4X41A 5HOQA 2R7KA 2YL2A 5IJ0B 1DBSA 1TAHA 3PNLA 1OXMA 3L9XA 2QI9F 4JZKA 3D8BA 5F3RA 5NLLA 3VMFA 4UAJA 1M0EA 5JD4A 3U48A 2X5OA 3KZNA 2VJAA 3E84A 4BKMA 3KXKA 2R6R1 4LMRA 1QB7A 9ICMA 4JYPA 4ATNA 4DCJA 3SE0A 5HQTA 1YKSA 3LY7A 3WV4A 4LKOA 5CT4A 1XHLA 4OJ6A 3KL2A 3PQ8A 1F2VA 4K7JA 4MQBA 4C9BA 3O2QB 3LGAA 2V96A 4KQGA 4N49A 1WCIB 2V7EA 3E5HA 5DISB 3TZ6A 1TIPA 4YGXB 4ECEA 1N2IA 5KT5A 8ICLA 3L7BA 4DNPA 2B92A 3BIFA 3AP2A 3OMLA 4KLCA 2RI6A 4RD2A 5IBPA 2C7RA 2AE2A 4R41A 1PJLA 2OESA 4YP0A 1UZNA 4UEOA 3I2YX 4ZQHA 4PTYA 3V2GA 1W0JA 1A0OA 1CUJA 3PDCA 2NV0A 3QLEA 4XIIA 3UIEA 2FHPA 2FMIA 2RHMA 1ZJ6A 1WMEA 3WXBA 1CZUA 3NEJA 3DOIA 3EBOA 1ZSYA 3I01M 2QY6A 2JANA 3LUAA 4LGMA 4O1IA 3UA4A 4CT0A 2QU8A 3U3JA 3QRWA 1JHYA 2CNWA 4CZ2A 3FOFC 4A8JB 1FJ2A 1AK1A 1I2DA 2JLRA 3HB0A 3Q7PA 4TKZA 1WG8A 3D8TA 3LH5A 3PB3A 4UPVA 3WKBA 3LFHA 3WL4A 2PAFA 5AHRA 4W9RA 2WE8A 3UAXA 3WJ1A 3ZIUA 5KDDA 4IIUA 1JDJA 1XRJA 2EIXA 2NV2B 3GLKA 4GUDA 1IPFA 2I6TA 4PAGA 4UFNA 5DFAA 1KW4A 2VWGA 2EOAA 1PZGA 2JZNA 5I7VA 3ZHYA 1GTRA 2FRVA 3AV3A 4TZ0A 4BE9A 1XCBA 1G5QA 4EZBA 2KHQA 1E9FA 1P33A 2VH5R 3LYUA 5HKKD 5TMPA 2VTDA 5IDYA 2XD9A 5IW8A 1MB2A 2FKNA 4B32A 3SHFA 1UT6A 4P35A 4C01A 1X9IA 2BDPA 1XTJA 2F7SA 1VKZA 1GL3A 3B51X 3SZRA 3TCXB 2BBOA 2I78A 4RS3A 3WMEA 1XF1A 5DXAA 2NU6B 4IVQA 3KQPA 2LM4A 4FSHA 5ADWA 3HU2A 2I34A 1UOPA 3PC8C 4B6QA 3BKWA 5CH5A 2XITA 1SC1A 1L5GB 3WJAA 1ULUA 1U3CA 4DOCA 2XGSA 4DWIA 2VIIA 3WX0A 4F4FA 4C7BA 6GPBA 1SOWA 9ICFA 4IZ6A 1AM4D 1N33B 4R8UB 3TLXA 3OZWA 4AJPA 5KKNB 1BKDR 2Q3MA 4L73A 3DT6A 4MRRA 4CKEA 3W8DA 1A2OA 4FM9A 4Y1RA 4JUDX 5DSXA 1ARZA 2XGGA 3LO8A 4CLHA 1BMDA 1V3QE 1ZAKA 4ZT4A 4DV4B 5KJEA 3PHJA 1UFVA 2GZ3A 3GAMA 2ZCJA 1EK6A 2WWHA 3C70A 3QG1A 5G3ZA 3DLCA 5T4HA 2KMDA 1GKLA 1GLVA 3GIMA 1MO5A 4JWNA 2EEPA 2OCYC 1E63A 3O7WA 4NECA 3WQQA 5BYAA 1ZN9A 5F7XA 2QB0B 1Z29A 2YWGA 3D0QA 4ZAGA 2VC2B 3QVWA 2CJXA 4URHA 5A9RA 5KFNA 2JIPA 3HMKA 1J8DA 2F1OA 3P7MA 2PGNA 5GP1A 2H4ZA 4Q4JA 4C4PA 2CUZA 2UVPB 3CJQA 3AI3A 4PYNA 1R6TA 1UBNA 3NUQA 2FSSA 2J48A 3AHGA 2FZ4A 5KYXA 1WCWA 4G56A 1WQ1R 2WMOB 4IDHA 4HAUA 3H17A 3VHXB 3KOYA 4JB2A 1NBAA 4JAVC 4BO0A 4FE3A 1WJGA 2O3SA 3LVVA 1Y8QB 1R0WA 2WK1A 5HIIA 3ZHSA 2UVPA 2V4UA 2V6IA 3TINA 1X39A 2HEIA 4EFMA 3M1YA 2B6HA 2WJVA 3HVHA 3DZ8A 3TNDA 5CB0A 2VTBA 3UQ2A 3QFRA 4YJ2F 1OAOA 3QLJA 1C8BA 1D0VA 3HHEA 3K1AA 3BH7A 5D87A 3L7KA 3VNQA 4CLOB 1FIUA 2NVBA 4C06A 1U49A 1OFVA 3Q15C 1J2NA 1MW9X 1N2CA 1NK5A 1DZ3A 3BXEA 4RK7A 2V9PA 1WCIA 2BFCB 1KSPA 1O89A 1QIFA 1QPBA 4FR0A 4CN8A 3IX7A 3TQQA 4I50F 1CQWA 1KR2A 2NSJA 2WUGA 3GMIA 2WV7A 1L3UA 1PJ4A 4G5YA 4S1WA 5IBQA 4ZIRB 4GC7A 1UWVA 2VDOB 3I4CA 2HHUA 3LC0A 5HZGA 2F1IA 3FFBA 4BP1A 1X8JA 3OC0A 5HMMA 5TQ2B 1JHXA 1Z0JA 1OZFA 3MWJA 4Z99A 3FOZA 2XI4A 2ZT6A 5BSGA 2XUZA 2DBYA 4G5FA 4BFXA 2HU5A 1WWKA 1ZOPA 3WZ2A 5AVRA 3LX8A 2IS4A 1EDZA 2FJ0A 2Q6LA 1DIGA 1XG5A 1B15A 3RSZA 4HLUA 3I2GA 5HP4A 1Z5GA 4AQDA 5ESDA 4MUFA 4GI7A 5HCUA 1ZCAA 1L1RA 1YRYE 3DLAA 3USZA 5BUQA 1GTJ1 1V35A 1KEWA 2LIPA 1E94E 4QDOA 2R2GA 1J0DA 3I0ZA 5TPZD 1PLJA 1XAIA 2YZ2A 4UBJA 5BW6B 1YHNA 4EW2A 1DVRA 3MQFA 5KNBD 2OP1A 2IYEA 2FPGA 3RTVA 4XGRA 5AK4A 1NMZA 1DIHA 2HK6A 2V7PA 2ZYGA 4UNNA 2V7QD 3EZGA 4RKRA 2ZR8A 3I42A 5BR4A 3FBGA 1UCVA 3FBWA 3K09C 4OEHA 3THRA 5HEKA 1IY9A 5F73A 3RYIA 4DUPA 1E2BA 5FI5A 5DLEA 2REQB 4IWNA 2CN1A 3M34A 3LXRA 4K03A 1RG6A 3HXQA 1G2IA 1V3UA 4NDZA 5DTJA 4EY7A 5JSZA 1E7MA 1RLOA 4KX3A 1ENPA 4CETA 3G17A 2ZP1A 1H38A 3OY7A 1EM8A 3UG7A 2NO1A 2P9GA 1K8QA 3JVUA 1E7SA 4ZEWA 1N2JA 2VG8A 1YIAA 1O58A 1T4BA 2DL0A 2VVTA 3ANSA 4RQ4A 5JT1A 1T7PA 1ZAYA 4GU5A 2ECOA 5A0FA 2JHAA 2IIBA 2X58A 2BCGY 3IAUA 2R3SA 1QYRA 3K20A 4FMCB 4PX9A 3DMDA 5F2OA 4QGSA 3PLAE 3I5MA 1HXHA 3BIXA 4CM8B 1BWRA 1D7AA 1G41A 1EVQA 1MB0A 3KQKA 1X7ZB 2W70A 3DYVA 2HU8A 2KSQA 2VQDA 1E1LA 2HQBA 3EXFB 1KO4A 3K9NA 3NAGA 4E30A 1TUBB 3LJKA 3QUQA 2OTCA 3ET5A 4JEIA 4QQ8A 5FO0A 4DNQA 4X44A 2XVYA 2IUFA 1G6OA 2VL7A 4J4TA 4NEGA 3FYDA 3WQHA 3OZIA 3STWA 2GEJA 3OE7A 3S1SA 2IIQA 2WA1A 3OU6A 3VNVA 1ATIA 5CNJA 3KLNA 3LM8A 2G63A 3DFUA 3VVCA 4E3WA 2QUIA 4PIMA 1NG9A 5BQFA 5E6SB 3RB4A 1UA1A 4MMXB 1NMEA 4XUEA 3T4EA 3K4QA 4IMPA 5EXDA 1MIOB 1E1YA 2WHYA 3GRZA 1S2OA 3NDRA 4FEAA 4BJ1A 4IL6U 4JMUA 1I4TD 1MJFA 1ODKA 1YOBA 5I4CA 1WB5A 5DNDA 5BNZA 1AURA 3PIIA 4BKUA 2ZYAA 2CW5A 4O3MA 4YAOA 1G2PA 3TR0A 3X1ZA 2FZWA 1AS0A 3FUTA 1QQ6A 1BC5A 1H2EA 1QG0A 3OLCX 4JA0A 4DLRA 1NR5A 2WUFA 2XH8A 1ZNWA 2EBWA 4N41A 3TPFA 1FSPA 4EUSA 4A8JA 1KY4A 1CUYA 1BEZA 1BXKA 1Z2PX 4E2FA 1LSJA 2R1UA 1YRBA 2FSVA 1F4LA 1P73A 1Q91A 1UQTA 2PYDA 2XHZA 2W37A 3KPWA 3UOAB 1ZI8A 3LL4A 4JQYA 5G1NA 1NBWB 4MYTA 2YDYA 3UWDA 3HRHA 3N6VA 1QGDA 2GAIA 4IIJF 4IY1A 3QE4A 3OIWA 4UCXA 5IBRA 3IE1A 4MDEA 2YINC 4AZSA 3VI3B 3WAGA 4PLWA 4X3CA 1SOAA 4YO7A 3BG5A 3W5UA 4BIMA 4C0ZA 4CVNA 3HXMA 3ROPA 4QHTA 1D03A 4FNAA 2V4RA 2G5GX 3KB2A 3G8YA 2BDEA 4GOJA 4JP1A 4YGYA 5EKDA 4YCNA 4JYAB 1M76A 1WQ4A 1G55A 1CT9A 3D9QX 2WWGA 3DO5A 1V7PC 3KQSA 3KTAA 3L8HA 3QFSA 1TGYA 1E2GA 4M1MA 4R1TA 3U9TA 4A9AA 5HBGA 4BTVA 2OB1A 5INTA 3K6SB 1TTTA 2J6HA 4QDKA 2W9BA 1AE1A 3ZDZB 2C2KA 2I33A 1RPTA 4CM6A 3VNUA 4AG6A 3OT1A 2PQ0A 4UE2A 3PMNA 4CRXA 3O8LA 4ZAWA 4HL6A 3H4TA 2E18A 3T7CA 1IOVA 1Y37A 4J16C 5AQEA 3UJDA 1QRUA 3EUEA 3CEJA 3LXMA 2NZUG 3W5IA 1LRKA 3Q10A 4J7XA 4LJXA 3JQEA 3MD9A 5ED4A 4NYIQ 4G1EB 3HKCA 1ISMA 3GRUA 3FPEA 4Z8YA 3E3AA 1EJ0A 4NCIA 2ZUUA 2ZRKA 3H11B 4H31A 3SIPA 4DIOA 2JZBA 1SC3A 3H9JA 3QI2A 3OX2A 8LDHA 3ELWA 1P5RA 1A6SA 2TMGA 3N87A 4O4JA 1O87A 5KJ6A 4JKIA 1CZKA 1NXSA 3QEOA 4Z51A 4N0PA 2YS7A 4W4TA 2BOVA 2C1XA 1IRXA 1T94A 3GAFA 3HNRA 4PLTA 4RHEA 2G1JA 3E9YA 5PNTA 1X0XA 4ZC1A 1G6KA 3WKDA 4MYHA 3W5SA 3IT1A 2N47A 1T24A 3M6LA 5ECWA 3DXXA 1E1NA 1PX0A 3K35A 4Y1FA 2KJQA 3QA9A 3RADC 1WW8A 2FMUA 5GV8A 1UOOA 1WCYA 4P82A 3U4AA 5JJ5A 4G5OA 1BA3A 2FV8A 4PSAA 4BTLA 3G2HA 4TYYA 4DLKA 4FO6A 1U3GA 3SVZA 4RQ6A 5H7XA 5JD3A 3GP8A 9LDTA 1Z5NA 3V72A 3L7JA 3K71B 3WYNA 2I9KA 4IIDA 4L3OA 1KR5A 2WJ3A 2AXQA 2P2SA 3ROMA 4A8EA 1DUVG 3PTAA 1WSBA 2Y27A 5ALUA 2YY7A 3PSHA 5JRJA 4C5CA 5ENVA 5EIXA 1NMYA 1PEKE 1QH1B 4PCUA 4KP7A 3GMDA 1WSDA 3NVMB 5JVDF 2ASDA 1QLHA 1TXGA 2PU5A 2RJ3A 1Z5UA 3DDNA 1D2CA 2P41A 2VAPA 2YHSA 2ROQA 3NHFA 3Q0IA 4OVKA 4UDNA 5HQ3A 2XWPA 5KX5B 2B4KA 3B2NA 4HH4A 1UBJS 4C5AA 3HCFA 2O8BB 2BHLA 1E62A 4PIVA 3QQPA 1SUIA 5E9WA 4BVKA 1O2DA 4GF5A 3SDZA 3HZRA 2A7QA 5JNSA 1Y4DE 1RXCA 2O5CA 1E79D 1T2FA 4FFPA 6PFKA 4AG3A 2VWPA 4JX9A 4PFSA 5EMHA 3AOGA 5IF9A 5CIYA 3RJMA 4LHEA 1XGKA 2Y77A 1DBQA 4UUBA 1A77A 2PJZA 3FLBA 1D5CA 2ZULA 3RSQA 2OD9A 1RAGA 2LYAA 3LQKA 4B9EA 2X8WA 1KVTA 3A1NA 3HCCA 1ZM7A 4JR0A 2VF4X 4ZJUA 3KRTA 3DT8A 5JROA 4YMHA 1P1RA 3GUZA 4DLNA 1JDUA 1N7IA 1KRHA 1XAGA 1PNQA 2EYUA 1SWVA 2GEFA 2QQ0A 2I2CA 4MQMA 4MAMA 3RSGA 5T4EA 1GPKA 3WGUA 2FGKA 1HY3A 4KQ6A 3A2MA 4TYWA 2Z2ZA 3BREA 4WKPA 3LC1O 5GTHU 1ZIXA 2VA8A 1QBKC 1Z8FA 2PSEA 3EXEA 4HAWA 2NU7B 1HH4A 3NBYC 1GNVA 3H1TA 4BX2A 4BO8A 2B8NA 3NKVA 8ICUA 3LK6A 3N05A 4XFDA 3A11A 4NU6A 3GLFA 3RAFC 1ISJA 3M6KA 3GJSA 3EE6A 5LLSA 3BGIA 4MRPA 1Q0PA 3MMXA 1PFVA 4ZI7A 2W98A 5NULA 4KI0A 2IE8A 4DMLA 4J9SA 1I4WA 8ICVA 1VP9A 3NANA 2Z2KA 1ZN2A 4UZSA 4C6TB 1OD6A 1R88A 3GC6A 1XLWA 5DT9A 7ICNA 3MS7A 2XIJA 4QG3A 1LWOA 2FZKA 2Z2JA 4GPTA 2PFQA 3HSSA 4RSRA 1SVSA 1MH9A 5LOVA 4MRNA 3PQEA 3PR3A 4TYQA 3II6X 4XSVA 5BN5B 2H9AA 2WSIA 3MGAA 1DC6A 2GCGA 4BWMA 1PUIA 2Z56A 4B44A 4DXAA 3TRHA 4CQMA 1I6LA 3LY9A 1A5ZA 4L51A 4OSEA 3TUIC 2G4VA 1QE0A 4WUVA 4KFCA 1DTEA 1T3LA 2XEXA 2EJUA 1NI5A 1TIBA 2GZAA 4OTZA 2IPXA 4ZTBA 1R0RE 4P3XA 1UBTS 2I2DA 1OC2A 1RXIA 4DDKA 5EXXA 2AGPA 4KDFA 4RZUA 1KQ3A 2K4IA 4BLOA 5AVWA 3RHSA 3DMYA 1KJQA 3CEAA 5E2BA 4F8RA 4EW6A 4MA4A 4C3OB 4EGAA 3OTHA 5JTIA 5J2UF 2XKKA 2XA1A 2YRWA 4WZAA 1G8GA 4D8WA 1LXCA 3EUAA 1F1JA 1D9ZA 3FNHA 1ZY2A 2HHJA 2VJPA 2NXNA 1SEPA 3R6DA 2W2MA 2G72A 2VUIB 4DR6B 4BVGA 2LM1A 4E5DA 4BV2A 3K5PA 3QJ5A 5SYMA 2BLLA 1D04A 2VEDA 3C29A 2COUA 2D5LA 4LSGA 3AU6A 1K2WA 2JFXA 1ZQOA 5GVRA 5GM1A 4AQYB 1DBWA 3I9FA 3ESDA 2P0AA 4HMPA 3W5VA 5L3QA 1CF4A 4DZRA 4TKUB 3R41A 4MKXA 2J85A 5J2TA 3AR2A 2TMDA 3PS9A 4PICA 1CS4C 2XYVA 4ZAZA 5HSGA 5JAPA 1YQDA 2VZ8A 2NZXA 1NKCA 4ZVUA 4PJ0U 2ES4A 5TY0A 3V9AA 3O8OB 4H7HA 1VJ0A 4PX3A 1GNQA 1H9AA 5LYJB 3O92A 5F64A 5EVJA 3GQCA 2OE2A 3VPCA 2Y0SF 1IWOA 1EUYA 4EARA 3CNBA 4CM4B 3W5DA 2PS3A 2GZMA 2CF5A 1MAWA 3CLSC 1LFDB 1V96A 1SBQA 1WTAA 2H1VA 2X86A 3C3BA 2DHEA 4ALLA 1CUEA 2GM3A 2F3PA 1C0PA 2AB0A 1PR0A 1RTKA 3GJ0A 4IHJA 5BOVA 4UNRA 2ODBA 1VI6A 2L17A 5AUQA 1XEWY 3Q3VA 4K6KA 2DLDA 2PSDA 3FFXA 4KQWA 4G65A 1FDTA 3PUIA 2VQEB 2C2HA 3UB3A 5EUMA 3ZJVA 3NP7A 2L42A 4LOJA 8ICEA 1ZQFA 1FFAA 3GUYA 3KDPA 3CNHA 2DTDA 3B1JA 4QFMA 3JZFA 2JH3A 3MCAA 1KMHB 3IPCA 2Z8ZA 3KQMA 1IDN1 5DBFA 1KRXA 2ASJA 2PS9A 1EP3B 3EH2A 3T9FA 1WUKS 4Z2AA 4HOYA 3RYFA 1LKYA 1HJPA 4UARA 4L0CA 4OI2A 2G36A 3FPJA 1SXQA 3OPYA 2YBEA 1V9SA 2YQ5A 2E6UX 5ALWA 4IV0A 5H4GA 3UOWA 3SWWA 1J90A 3JQCA 5K3FA 3PVSA 4NCKA 3V1KA 3B89A 4UU0A 5BNTA 1QAMA 2R8HA 2X77A 2QVXX 3GCXA 3L6DA 4YJHA 4GXRA 3M3DA 3CVUA 1LCIA 4JX8A 2Q50A 3CURA 2XGQA 1DO2A 1UDAA 3DJFA 2MMGA 5DBAA 1NUPA 4FYYA 2ZQYA 4ZI5A 3FTNA 3HLKA 4EFLA 2V03A 3B3FA 2JHGA 5CXQA 1GAEO 3LCVB 3A1FA 3WHIA 4RTKA 4DILA 4AKHA 3BD7A 3D4OA 4FVTA 4O2BF 4HUQB 3E81A 4YRAA 3UPUA 1XRQA 4NZOA 5KO2A 5DU2A 3VJRA 3OJWA 3UMJA 3SHQA 3MUOA 3KXDA 2DQZA 3D6NB 3V7YA 2WICA 4HZIA 4L8VA 1JV2B 4BX8A 1BTOA 1XZEA 3EX7C 5ALDA 5ALOA 1EQAA 1PCXA 4GRIA 1AQJA 2YS6A 1MXFA 4YCMA 5KOHA 1UIRA 4KO8A 4DV7B 4EECA 1AQNA 5LL6P 2WWVD 3ZE0B 1PJCA 3DAPA 1YA6A 2DU8A 2NSDA 4L0QA 2UUBB 2DT5A 4ZCLA 1IHPA 3OU7A 1LTKA 3IQZA 3JATB 4B6SA 4MP3A 4YRPA 3VVMA 3SEIA 3V4RA 3G7SA 3IODA 4B80A 5DNCA 3SQXA 3FMOB 5HG0A 4Z1MA 5CDGA 1DKLA 3V7UA 5AVYA 1W5AA 4PH5A 4O5AA 1CY1A 4X64B 4OHWA 2FSGA 1MX3A 5J43A 4QZVA 2HT1A 1P0IA 3SZOA 1KFEB 1COKA 3SPXA 1OR8A 1ECFA 4EELA 1CYDA 2L18A 3BAFA 3EY9A 2OGZA 3UMGA 1XTTA 2DKOA 3A9VA 3IBTA 3JQGA 4N82A 5F52A 3VR6H 4CG0A 3D2SA 4HYYA 4A16A 4GVLA 4ACBA 3UNXA 4B2PA 3AVXA 5ERGB 3AUTA 1JHAA 2FUCA 2A1AA 4W5NA 2R8EA 3MWDB 1J0XO 1AF4A 2IW1A 3JQAB 3MJ4A 4BL5A 3IOCA 4O2AB 5BUSA 2HL6A 3L4PA 3IKLA 4H0FA 1YOVA 4MPDA 4NOKA 1JJFA 1N7JA 1NNI1 3DTTA 5EWMB 1W25A 2ALJA 1ZGHA 4N3AA 1ZOOA 4OKSA 4WKBA 5DNAA 2O8EB 4JYMA 1NOIA 1XRNA 4P0QB 4ER3A 3AYZB 3RROA 3EC2A 4AJJA 1NJGA 1QK3A 3IALA 2PMEA 5F3DA 2H54A 1GN9A 5IEBA 1QJ4A 5KI6A 5CM9C 1S1MA 4X3PA 5MDHA 3IGFA 2SECE 1EUQA 1X13A 4YJ2A 3UFXA 1CJSA 3IQXA 1IJEA 1JKXA 4A4DA 4DJDC 3EZYA 1K4KA 3I2HA 4C05A 3G6VA 2HA2A 4TV8F 4YPVA 1NPTO 1WXDA 3DCNA 1L5OA 2HA0A 3ORRA 1FNCA 2Q2WA 4ON9A 3AJAA 1ZONA 4RPJA 3V1LA 1DC7A 1H9BA 2Q9BA 4I4TF 2OHJA 1MG5A 3O2SB 2CFRA 1E2HA 3RT7A 4AJ4A 3ZK7A 3BD8A 1D9XA 2APJA 1U9CA 3KD2A 2X0IA 1O08A 5C7LO 1IBSA 2C58A 3KR0A 1PTKA 1R64A 2NO9A 4QPJC 4YP7A 1RLJA 4Q05A 1V16B 3H2YA 1AKMA 2V4MA 3KYCB 3OA2A 4OA5A 4WCFB 1PZNA 1UXGA 2JNWA 4UE6A 2P9BA 2JJ8A 2HMAA 4O2AA 4NBSA 2Q5EA 3ZE7A 2Z58A 1DG3A 1HE8B 4HWPA 3MGIA 2D1QA 3HN7A 3AEYA 4FYXA 3SXJA 1N5MA 4JLOA 1WMAA 3WSWA 5J2GA 1CEEA 4HVLA 5JDCC 1KDYA 4O63O 2FP4A 1PS8A 3GP5A 2YVAA 3KU4A 1I3NA 3WYBA 1RWKA 2W03A 4MTCA 4MV4A 2E8NA 4KLQA 1LQUA 2WTAA 5L3ZA 1AZTA 5FH9A 3O47A 3ZDXB 3DOHA 2GPNA 1VPEA 4QZAA 2X13A 3V1NA 4WNYA 3BVPA 3H9BA 4K26A 4CMCA 1U94A 5LYYA 2AR0A 1DWPA 3HJRA 2OSVA 3FI0A 5BXQC 4KQKA 3DYBA 1F2DA 2F1KA 3JW8A 4GWGA 4X1KA 3UJ7A 3N0RA 2XCIA 5FOQA 3M6UA 2IYVA 1T6YA 3G3EA 4MLZA 4DRXB 1MOQA 5AICA 4LOIA 2ZJ0A 1CR4A 2QGNA 4R3WA 3LDAA 4DM4A 1XLVA 4UCQA 1B0PA 3HSKA 3UHOA 4URUR 5M04A 1HKHA 3HXLA 4LOHA 3TM5A 4BBZA 2OPBA 2PKQP 4IUDS 3IDAA 5K05A 5KU1A 4BLRA 1L8AA 1WCV1 1FYDA 1Q0LA 4IZOA 2ILVA 2OAGA 2QM8A 5EZSA 1JBKA 2GN2A 3IULA 5FB3A 4J3NA 3HR4A 3T5GA 5JWRA 4D9HA 3TOCA 1GAXA 2EXXA 1NJSA 2YWFA 5H4HA 3HJEA 5BSUA 4UMDA 5BXYA 4G0UA 1XNGA 2DPXA 2FF7A 2ZSHA 3KQWA 5AW4A 4RDIA 2BWJA 4G2NA 3EPLA 4ITUA 4IILA 4MUMA 5L4LA 3FI9A 4PG6A 3AEVA 2ZIWA 2D4AA 1RM3A 3OD5A 1CY8A 4BCBA 3AKCA 1ENZA 1VCIA 1EP9A 1KARA 4WLOA 2IU0A 5TLSA 3WGHA 3WYEA 1YVUA 1M2KA 5J23A 2J9RA 4Q3KA 3G2MA 1IY0A 2JGNA 5FA6A 2ORWA 1G5FA 1Y7TA 5KVVA 5LP6B 5FUVA 3U31A 1JFSA 3IN5A 2VPIA 2VPYA 4DUYB 2DUJA 2VJLA 3AUFA 4NRDA 2RONA 2P7HA 3G7UA 2IMWP 1CR0A 3HN2A 3BWEA 5EIAA 4DLLA 1JXQA 3W4IA 3D8NA 1X7DA 3B8EA 3PC3A 2AI2A 5KFVA 2RARA 4OM8A 2IY7A 4ETNA 1SXPA 3A10A 1FPQA 4LPKA 3OJSA 4JLDA 2WWFA 1TLLA 2WV9A 3JQGB 4IUBS 1W2HA 4XUCA 5A05A 4HUJA 1DOZA 5JH7A 4GSYA 3KAQA 1XQVA 4IAOA 4WEQA 3H84A 3WRVA 5I4BA 3DVAA 3W7VA 4B6EA 2JASA 5KNBA 2WEKA 3KU1A 4IDAA 2Z8YM 3FGZA 4D5GA 3BWVA 5FWYA 4LE2A 2PMZC 4GPD1 3TPCA 5E1BA 8ICNA 4LFBB 4GMKA 2H57A 1KJJA 4XGQA 4Y2RA 5K8LA 2BM9A 3B85A 3ZZMA 1DRWA 1XQ9A 1SO8A 3E53A 2ZJBA 3Q72A 2JH9A 3QYFA 4DEZA 2YDXA 2IEGA 5KYYA 2O6LA 4D43A 1KTIA 3AQEA 2QEQA 1TA0A 3QM1A 3R0XA 4KWEA 4O0MA 4QDZA 2KZ3A 5HVNA 3PVXA 3DUWA 3N0VA 4JJ8A 1CIPA 2Y0PA 5TS2A 3GV7B 1OY1A 2C9OA 3IJRA 3RJGA 1FSGA 4QC2A 1IVSA 4DV6B 2UYCA 1JGTA 1PQYA 1K9VF 2CY0A 2FLKA 2X8AA 3A6KA 4URFA 2VP2A 4P4UA 3MLEA 3QIVA 1VOTA 2P9TA 1Z07A 2C61A 5LPNA 1FFXA 5BN3B 4HDNB 4JLMA 4PHGA 4IH4A 2IHZA 3HWSA 1EQ2A 2A9QA 4U2FA 4YRBA 2LR0A 4MEBA 3OSPA 5FUBA 3W9SA 2EBUA 2C42A 2OGWA 3BEDA 3N2ZB 4UU8A 2P1ZA 4E0DA 1A7UA 4KMRA 4ZI3A 4JYCA 1H22A 2H1WA 5JS8A 3JVIA 1CDEA 1JI0A 3K72B 2W9CA 3AILA 4HWTA 1L5HB 3CWZA 4IQ0A 1P1FA 1QG4A 1PFKA 2G1KA 3WBBA 1U2PA 3MILA 5ICFA 5KREA 1EK2A 2JG3A 3LP6A 3IMGA 1PJBA 5D2CA 3HJUA 3WIBA 4RA6B 3BSFA 2H92A 4DXDA 2FFHA 3GDGA 1ZD8A 5EOVA 4NHOA 2HTFA 2Q3FA 2IS2A 1QFJA 3BYZA 4QREA 3ULKA 1NLYA 1ADBA 2Q1UA 2CZCA 2OC4A 4R9RA 2XRZA 3Q9SA 5IWCA 1KY3A 1U7TA 4FYIA 1A8PA 3GA0A 1Y3HA 4UZFA 1VI5A 5L7WA 1GWNA 1NWHA 4RPIA 3R0VA 1FFWA 1OXVA 5BQPA 3CO0S 4X94A 3IUYA 3VU8A 4PG8A 5KNLA 1JFRA 2PRYA 4JC0A 4F50A 4FXPA 5KJFA 1X1CA 4Y2JA 1TKBA 3Q8RB 1KTVA 4ND3A 5A3SA 1TAQA 2QZZA 1GUFA 4Q43A 5BWOA 4K4GA 3HBFA 3EGCA 5BW5A 4WNAA 1RSZA 2AYZA 5DN6D 5KFRA 1JZQA 4G5GA 2P2ZA 3NETA 3I92A 1ILEA 1WD5A 3GRVA 1MO4A 3MWEA 4PSUA 4CIAA 1Z2NX 2I1LA 2C59A 1PT9A 3CH7A 1VZ3A 3FXAA 3OT4A 5I5GA 3M8KA 3W05A 2QB1A 3OQOA 5TQJA 1U7UA 4ZT2A 2UDPA 1TQ6A 3HJGA 3PXGA 4MUGA 4QOJA 1DS6A 5JSKA 2HJ9A 5KWJA 5ADUS 5LSAA 4K28A 3LYHA 1C9KA 3I1YA 1CNFA 2HU2A 4FEYA 2DFTA 1TMOA 3DL4A 4O4IA 1CRPA 1SOVA 5CCXA 5BOLA 4PINA 3ZVKA 4D9MA 5FWXB 1Y5LA 3LZ6A 1I2CA 5G0SA 3QTTA 1VRCA 2XJ9A 1D8LA 1QWSA 1L3CA 2WG1A 3L0DA 5CGQB 3V4SA 4OJPA 1KFBB 1WZIA 3EOZA 1YJ5A 2ZAGA 3PV0A 1WTCA 4K3UA 4RADA 9ICIA 2P9EA 4C4SA 2HMVA 3TTXA 2R00C 1ESMA 4ZRDA 2CDAA 2K2WA 2VDNB 3CB2A 2XA9A 3PNCA 2JK0A 3AHJA 3JSAA 3ETHA 2PSJA 3OQJA 2FMFA 3OZXA 4GI5A 4W7SA 1YV9A 4XFKA 3UEOA 1ZWLA 4OP1A 3RU7A 2VHJA 5J4YA 5G5HA 3DCIA 3Q0TA 1JKJB 1BW9A 1IM2A 3NHAA 4WNIA 2JD0A 1EVZA 1KZ4A 3P9PA 4MGKR 3IDSA 4Q1FA 1TQ8A 4N18A 5EZYA 4YUZA 4I5FA 4RHTA 2HQOA 1Z12A 2ZIGA 4WFQA 5KKAA 2R7NA 2EW2A 1K06A 2R8IA 2B1RA 2ODPA 4HWKA 5E9JA 4CM9A 5L51A 1GCGA 3LK7A 4PYOA 1B1AA 1C4WA 2PRZA 1XDZA 4K8OA 4PNHA 1AGPA 1TE2A 3A1CA 1F1BA 1KDOA 2ZBFA 3KZMA 4H60A 4DNOA 5B6PA 2C4UA 4D80A 3J81k 3QVGB 3P4XA 3F49S 1ZRHA 1U80A 5EJEA 2N42A 2E1FA 5AM5A 2IEDA 4F3NA 4FGKA 1BCSA 5A3VA 3WQBA 4AUKA 4LJ4A 3EIXA 3FPHA 1I36A 1MNAA 3K9QO 1ZH8A 1P5HA 3WTBA 3HUUA 1QIKA 3O31A 4L02A 3T3NA 1EEHA 2Q5IA 3G1WA 2XNKA 5KG4A 3KFLA 1EEXB 2J08A 3G8DA 2YMQA 3PHCA 5AW3A 4H0CA 4LRWA 2FRXA 4UNIA 2H5IA 1YR7A 3QUTA 3D3EA 2ZT7A 5E4FA 3UJCA 1ZBDA 2CLOB 4BU0A 1N5RA 3EIHA 3IT0A 4K9MA 4NJEA 3UQ0A 1Q5PA 4TN5A 4U7GA 5EMJA 3THYA 4WOJA 3RO7A 1K1SA 4J9KA 1C7RA 1QZXA 4L22A 4OBWA 3FAKA 1MAAA 2G76A 5CVCA 2GPSA 4FKBA 4P4NA 2NZWA 3LNTA 5F9MA 2GBGA 3A1UA 5HF5A 3S99A 3UGQA 5C5CA 2KOBA 5IPFA 1KOGA 3NKFA 5AJWA 3K09A 2HA3A 1OB5A 3KB6A 3QXHA 2ZGVA 3N2NA 3DNMA 4M0PA 3I64A 4NESA 1L5HA 2YWCA 1TL7C 2XE8A 3DZHA 3R3XA 3FA2A 1FP7A 1TM3E 3EEOA 4FP9A 1GYPA 1GFIA 2HCRA 1R6XA 5AI4A 5D85A 3M8SA 3SR0A 2G4CA 1H1TA 1L6IA 3H11A 1OXXK 2LKCA 1YJ8A 1PZXA 1M9NA 3X1KA 5D49A 3CRZA 3AUAA 3K8YA 5MHTA 4QM6A 2WD9A 4AO7A 4H59A 1FW6A 1CKEA 5BMOA 1NKTA 1EX1A 4RHXA 1GZVA 5COBA 4YREA 4NFLA 1DBPA 3TZEA 1LDBA 2ZRDA 1ADCA 3H7AA 1G8AA 3MTAA 3PR4A 4I66A 1YE5A 5AVJA 3DE4X 3EYAA 2TMYA 2PMZF 2JFQA 1HT2E 3AF4A 5C0YA 4EYHB 1PN3A 2X0JA 5KWSA 1O7JA 2P9CA 4UHKA 3NTQA 3QMWA 1WX1A 3WL5A 1QQ5A 3L7NA 4ZYUA 1MEJA 1YZGA 2PI5A 5TISU 3KEOA 3NIFB 2CNKA 4QYMA 3T7AA 1TMGE 3AR7A 4NPCA 3DKRA 4BNZA 3L8MA 4YB8A 1BROA 1TM2A 2DFDA 5SICE 2UAGA 1G9XA 2NUTB 3O8BA 4FPXA 3RCBA 3BE8A 1E2KA 4IH1A 3G6WA 4L9AA 4OQQA 2ONKA 1PUZA 3FHCB 3OJ0A 3KSAC 4LK3A 1PUJA 3CP8A 1WY5A 3OTWA 2WHEA 1BJTA 4GG1A 3B1FA 5EZQA 2W8ZA 3CXUA 4GBJA 4F8EA 5BV0A 1C9EA 1JFLA 1IEWA 1RKBA 3AFIA 1CVRA 2PFSA 3PDIB 2QN2A 4RK4A 2I2FA 4GR4A 3DDOA 3DG9A 4TXMA 4EY4A 4CE6A 4MQEB 4UMFA 4LJ5A 3C48A 4M7PA 1PYOA 4FILA 2X5KO 4GSKA 4DMFA 4LZAA 5ALIA 1ZJ4A 3BTOA 4KR6A 2HJHA 3DD1A 4YAJA 2DUMA 2O14A 3R09A 4RFVA 5CVTA 5THKA 4H1WA 3VZBA 1OYOA 5ALNA 5FF9A 2HZBA 1VJDA 1C14A 2CVZA 1NKSA 4I1UA 1AG9A 3EC1A 3HU5A 1VLQA 3C8UA 2ADFA 1NM5A 1JL3A 1PT8A 2PYZA 3CZ4A 3HKEA 3DXZA 3I8OA 3WLNA 1W6UA 4S1PA 2E85A 4OJKA 2CK3D 3I58A 5H8WA 3QU4A 5E6SA 4BNVA 5A6VA 1BXZA 4CV1A 1P2DA 2OV2A 4X61A 1JH8A 3QBVA 5HA5A 3PGXA 4R51A 4ALIA 3DPSA 1Z56C 1UQVA 3VR3A 3ZU4A 2F3NA 1D4ZA 5LQMA 1RBYA 3M83A 4HGRA 1OUMA 2YIMA 3MSXA 1TF7A 3PVCA 1EZZA 4DT1A 3O90A 4R8LA 4UXJA 3EF0A 4J91A 5IK2D 3BXZA 4GR5A 4JJKA 1EQUA 1ZQ1A 2CLIB 2WFLA 1FQWA 1OWOA 4PGFA 3B1VA 1R8SA 2HIAA 1TPZA 3IE2A 4COOA 4L6CA 3N4MB 2VA9A 1MBZA 5IAEA 3TK1A 4OV6B 1K0UA 4RW0A 1QOPB 3VV3A 5FBZA 3W3AD 5KG2A 4ZT6A 2ETVA 2QB5A 1VCOA 2WJIA 1KVUA 3M9WA 1VBKA 4H15A 4PGMA 1SBTA 3U7QA 1QIGA 5KJCA 4ONEA 4WT7A 2EBHX 5KFLA 3N74A 1AUVA 3P2OA 3L77A 5GMOA 3ROXA 4IIJB 3ZV6A 4DSOA 2J6CA 3UXHA 5EVCA 2HRRA 5CG2A 1KBOA 2KP7A 5JADA 3KT8A 3I5AA 4QLBA 1F9EA 3H2GA 4LOKA 1QTIA 1QONA 2IYAA 2VYVD 1B73A 4HGOA 2AFVA 1PGNA 3C3JA 2CPRA 4MLPA 1KOFA 1O3YA 5E6RB 3TE6A 4LDPA 3DV9A 3PX2A 1MGPA 4JJFA 2HPHA 3G0DA 4JJAA 5DLDA 5T64A 3RANA 1NXQA 1RMQA 1YS9A 2QTTA 3B20A 2JAOA 4FGUA 2WT4A 3E22B 4PY2A 2PDAA 4K9LA 1V26A 4YVZA 3STXA 4ZYWA 5HQ3B 4OG2A 1Z19A 2NYAA 1BOFA 2CVOA 4I2JA 2HGSA 3LF1A 2QLFA 3G5AA 1X8LA 5E6RA 3D2QA 1RJ9B 3E9EA 4DCGA 5CVJA 3ZUPA 4Y3UA 1Q7EA 1AO0A 4DQLA 4LZJA 1UMDA 2H3HA 2GGSA 5C52B 3AX6A 5F1KA 1KI3A 3RREA 2VDVE 4CL0A 1UXHA 1XDGA 3BIOA 1CQJB 3JD0A 3W06A 3KE8A 2NX2A 3FSRA 5BY2A 1CLEA 4RCYA 2OBMA 4KEAA 1S8OA 3GGGA 5DNUA 2AMYA 5I6DA 1Z6ZA 4LF8B 2IX9A 2LYHA 1PTJA 3CUYA 3N97B 2R4UA 1MO2A 3FWZA 3OCWA 4F6RB 4H9GA 4MHTA 5EQDA 3USES 5D1HA 4UB5A 2O8CB 4FC7A 3HU1A 3WLRA 3ESQA 5IULC 1I3LA 2P2LA 1WMSA 1SHLA 2X5XA 2G5TA 3O93A 3BCHA 1EU1A 2V97A 3BSWA 1GLGA 1HEYA 4QQRA 4QYIA 2Q1WA 3HDTA 4MUJA 3SBDA 3T7TA 5C9ZA 5KAFU 4UE3S 1G4UR 2WWTA 3B9PA 4D26A 3O0FA 3OPYB 2FPOA 3UA3A 1MOPA 1MN6A 2AU0A 5IAGA 5KAIU 5F9NA 1H8EA 2QX4A 2NQ8A 4TWBA 3N8NA 4U63A 4UREA 1OLSB 2J67A 1SURA 4JEHA 4YT5A 2HAEA 2PL3A 2VQ3A 1ST2A 3AXTA 4QUBA 4PR3A 2WSSD 4LOLA 4TROA 3O1HB 7ABPA 2VDWB 4B35A 2DG2A 2H7YA 4Y18A 9ICLA 1JIUA 1HZZC 1VMIA 2G4LA 4BECA 2E8MA 1C1XB 1SKYE 1UBGA 2PGOA 3FKQA 5ECDA 4TS4A 5ICMA 1AKUA 3MGVA 2CNLA 2Y92A 3OJLA 4WD3A 3MJEA 2NO0A 3SC2A 3TX6A 4CYMA 4IX1A 5IZCC 1NW5A 5ALYA 1JA0A 1CW2B 3DFFA 3H6KA 4OHPA 3P96A 1PJAA 5IYZF 4FFRA 1E8MA 1ONNA 4GLFA 2WTUA 1NJXA 2D00A 4LCBA 4EHKA 1E1QD 1JVSA 3C5GA 3DHEA 1GFWA 2CLEB 1RVDA 3OZFA 4AZ0B 1XRRA 2H1OA 2QT1A 3WIOA 2GFIA 4AYTA 1FXWF 2NPIA 2Y0DA 5BNIA 2R65A 1J09A 2P35A 3OQMA 1TC2A 4S1TA 3BZCA 4B8WA 4MUYA 3U4GA 4QEZA 5J0QA 4ENVA 2VK8A 2XVTA 3OZVA 4BFTA 4YFYA 8ICHA 2FR8C 3X43A 1W4AA 4XLZA 3LPLA 2KIWA 2DUNA 2QN1A 2NIPA 1M67A 1ZQZA 4DF3A 1KRWA 2FMXA 3HT3A 2PTGA 4QOHA 4M0FA 2MCFA 5KNDA 2ZI5A 3MYRA 3BS5A 2ZUCA 1KI1A 1OBFO 1GTG1 3QUCA 5IIJA 3E9ZA 4I8DA 4XQ0A 4O5CA 5EIBD 1X7WA 1BFKA 1ZMRA 3RJHA 2H2GA 3BWBA 4DSLA 4KGXA 4XYBA 2VXCA 3S2IA 2PUHA 2PGLA 4WBNF 1TKAA 3CLSD 5KYKA 1KWGA 2RH4A 4X8MA 2ZG6A 2FZEA 3IB6A 4WUTA 2GK4A 2BHTA 3D7NA 4P4MA 1I6WA 1TTPB 5JZOA 2ZUWA 3VUEA 1UC4B 4FKZA 4TQUS 4FWTA 2XMCA 4A8JC 1A9QA 3HP6A 2FUEA 2TS1A 2W71A 3GBVA 1U2GA 2GUGA 4G5HA 1F5SA 1JKMA 5JO0A 4CKEB 2IUEA 3K70C 4MJ7A 4RX1A 3WLJA 4HATA 3CRVA 3DKPA 1TK0A 4NEQA 5DNVA 3B9QA 3T99A 4BMCA 1NU6A 2IP4A 3F0TA 4EMTA 3VZDA 2QJTA 2WQ6A 3DTVB 4M88A 3PYXA 3EZ2A 1KEJA 1DBIA 1AA6A 3G0HA 2H2IA 2IYZA 4GPZA 2B5VA 2HBMA 2PSHA 2VHUA 5JY6A 4WE3A 2HBLA 4EHHA 3VC8A 3GPBA 4NH0A 5A4KA 4MW9A 4LGYA 3WL3A 1NVBA 5E6UA 2B8EA 5KSZA 4Q9LA 2LPEA 3GV0A 3ID6C 4CIDA 2BKUA 4G0VA 1MC5A 1UKYA 3RH0A 5BVHA 1IM8A 3ZQUA 2NV3A 1PBTA 1Q74A 1QHNA 3PNYA 3QLTA 5A6SA 2NM0A 2ZI4A 2OCEA 3TANA 2AC4A 4NP6A 1AHPA 4JI2B 3R77A 2ODTX 3EEQA 3H0MB 2PBZA 3B7WA 4YMOA 3GWGA 2JI4A 2P30A 3I4LA 5CX1B 3SI8A 1EHCA 1XR3A 1W75A 1SG0A 2AKAB 2C3PA 2Y68A 3D6TB 2W5UA 4Z8XA 4CLOA 3JCZA 4C21A 3C39A 1H2ZA 1FFHA 1JU9A 2GD0A 2LNDA 2O8DA 3T1HB 1D9DA 4M1WA 2B8JA 4TTSA 1H4SA 3FZGA 3AR9A 3WRYA 1C1YA 3UV3A 1BAPA 2A84A 4YCLA 2XB6A 1A9XA 1S4QA 2BMDA 1JU3A 2AYXA 2XQVA 2C4WA 4F5ZA 1N5OX 2FLPA 2HLPA 4Q7EA 1FDIA 1GPDG 2NO7A 1KKXA 4GC5A 2P68A 1KO1A 4PGXA 1YONA 3TI0A 2B2CA 2XUGA 1S0OA 1IHUA 3CZAA 3QK7A 4X1IA 3U17A 4DXHA 3ASZA 2GSWA 5BVGA 5C7OO 2BMVA 2ZDQA 1TCCA 2C8JA 2FEXA 3PC2A 4KXXA 2UUAB 3S7ZA 1WZCA 3RABA 3U56A 2MYUA 2F48A 2IQ5A 4LF7B 5CVUA 1RI4A 1ZPDA 5EESA 5EIFA 1OWMA 2JCYA 4UB4A 1EESA 2OCXA 3ZE1B 4H77A 3F2CA 3H99A 4G0XA 4N8SA 4PG4A 5EXPA 1UDCA 4C0AC 2JA2A 5KYXB 9ICRA 4RPYA 1XF9A 4PGYA 2G28A 2ACVA 3HFJA 1TD1A 4LI3X 1BNPA 1RW4A 1E9DA 1WHSB 3DGFC 4KDEA 4MGHA 5JEDA 4TQGA 1GQSA 2DR3A 1XB2A 4PQEA 5FAKA 4O25A 4FMDB 3RJZA 2AE1A 1XWWA 4OFZA 3L4KA 1BJRE 1RQRA 2HSGA 2AIRA 2XZTA 4U2CA 4GXIA 1D2HA 1HEUA 1W52X 2WSBA 3JPWA 4KUHA 4AKEA 4F3YA 5LOVB 4AS1A 2O54A 4JBIA 2I6XA 1I0LA 1YO6A 4G0ZA 5DTQA 3C4JA 1CRQA 2R5FA 3L04A 5P21A 3UC9A 4KLUA 4IIEA 4OU5A 2W9XA 2H29A 2ZYUX 3KJFA 2QT0A 4J03A 4Y1RB 3UJAA 4EKIA 3SF8A 3NRZA 3HFRA 2NN3C 3WC4A 1QKKA 4CM5A 3U61B 4C4TA 1W76A 1JI7A 4YRCA 2BY4A 1Y7LA 4QXRA 2GEDA 5JSFA 3GLQA 1M73E 4ARUA 3HL4A 3UBMA 3L05A 4C0HA 4JXZA 4B3IA 3FY4A 1AC5A 1NPDA 1MQ8B 1VL0A 3O4FA 2H6EA 1SEVA 8MHTA 5AJVB 2VXBA 7ICJA 4DSEA 5KT4A 1IIRA 1N6NA 1XRPA 2HLDD 4TKLA 3NNDA 3HILA 1BS9A 3T1OA 1N92A 1C1HA 2JAWA 2I0FA 2R1TB 3O4RA 4MPJA 5CT5A 5HILA 2OOSA 3WGQA 4TQSA 1EFPA 4H1TA 4W5WA 1UFRA 3DFKA 4IJKA 5E0OA 4EA7A 1W4RA 1GPH1 4WXYB 3V00A 1M2OB 2V7XA 3U7JA 2GM9A 4CLXA 3AFMA 4YQFA 1EHYA 5HK9A 1OBHA 4YV2A 3KT6A 1V8OA 1JT2A 2PX5A 3T3HA 4MDFA 3MJVA 2HSDA 3RYCA 1EPUA 1II8B 5JNRA 1S89A 1YMUA 5LUAA 3UXNA 2FUNB 2IPOA 1U8CB 1XQXA 4PFKA 4KAXA 4AZVA 2GA8A 1FRNA 1QSGA 4EJSA 3A6PC 3LUCA 4LVUA 3BF8A 3LQYA 3PNMA 4KTVE 1RCUA 4PXYA 4YP1A 4Z7NB 4V1CB 1I7NA 3OM0A 1HYHA 5GVSA 1R0KA 1YC5A 2I6QA 1BOOA 3SG0A 4A2WA 5IUJC 1XL0A 2BJWA 4X0EA 3R8FA 5KL1B 1SU8A 3VZQA 4CG1A 5AVOA 5HJEA 4TYMA 5DNEA 4Z0TA 3SIRA 4DV3B 4A0QA 2OLJA 1U1DA 2AG8A 2HY7A 5CB6A 2WTXA 1JXLA 4RETA 1DJOA 4HLCA 5EPEA 1ZQLA 3W79A 1A04A 2VWQA 4WN9B 4JC8A 1P74A 1THTA 4OGGA 3L6EA 4O4LF 1Q3UA 2QU7A 1U9IC 3TLZA 4BYMA 1DJPA 2JLCA 3TL6A 3I34X 4GX2A 3RJ5A 3UUWA 1SM4A 3S0JA 1Q1QA 3CZ9A 5L1JA 1W36C 5T14A 2KQUA 4MV9A 3VH3A 1U3VA 3LKDA 4OHBA 1DO8A 1H2XA 1I10A 1VHDA 2EBFX 1JIHA 1U98A 4XYGA 2IXEA 1YDGA 1EVYA 2QD1A 1PG5A 3CF0A 3QY0A 1OJLA 4LFCB 4D99A 3LUGA 2P2YA 2WTNA 5F35A 1L7RA 3UK0A 2D1FA 4Q0MA 3MQ2A 5CMLA 2QARA 1PR9A 3ADBA 2PGXA 1ML4A 1JP7A 1RBZA 2AXPA 2GSDA 2JIBA 5K45A 2QTNA 2TRSB 2QROA 4R2MA 3VKVA 2OBXA 2Y1JA 1VM6A 4TMKA 3TBKA 1RABA 3BZKA 1PFQA 3ZEIA 4KB5A 4DIUA 1XEXB 2CHVA 2G7MC 3JASA 1BFDA 1JG1A 3SS7X 4AKIA 1CEXA 2FN8A 4LXXA 2I3AA 3OTGA 5K4GA 5JUWA 1IBCA 1XDWA 2CF6A 3COWA 3IKVA 1WCXA 2QSJA 4FYVA 4TUYA 5EP1A 4B6OA 5KQSA 2ECQA 1R7RA 1ULSA 5JPIA 4JI7B 4EBBA 2W42A 1VHTA 2BI8A 3Q2IA 4OJMX 3E9NA 3CXRA 1N0IA 4QYIB 3DLBA 1XZKA 2ZIUA 3L5OA 1C1DA 2OQ2A 4HPWA 4YDHB 4EA8A 4L2IB 2QR2A 3ZY4A 2V9ZA 3F74A 5KHLB 3K2BA 3PYLA 2Y1XA 3ZCXA 4V3BA 1HORA 1Y1RA 2CXUA 1G21B 3ITNA 4BXOB 1L5MA 1ZM9A 1AVTA 1SVKA 3EVZA 2W2XA 4MR8B 3IHTA 5E7QA 1SZCA 2I1QA 1X2BA 1TQDA 3A9CA 3NUGA 3VO9A 1WP4A 4QELA 4CFSA 3FETA 5BRAA 2RBGA 4I6GA 4LYEA 4EQZA 1R3UA 2JBWA 5IT4A 1OYWA 2IT1A 2MIIA 3K9WA 1XZMA 4NH4A 4DANA 1GHTA 7ICQA 3PFBA 4COKA 5HRUA 5B57C 3OZGA 5J2BA 2P78A 4LJ6A 3ACCA 1VP3A 3FUWA 2GZDA 3LZCA 5JCXA 2YV2A 3IMKA 4G0OA 3HYRA 2QVYX 1L7MA 4J1TA 2QJFA 2R6ZA 1VKRA 3CUWA 4RABA 2X7JA 4X54A 1HFKA 1AKVA 4KE9A 3HMQA 1EDDA 2CT8A 3LVWA 3EGEA 2HX1A 2KHZA 1O5TA 2W4QA 1IEXA 2FZVA 3LGXA 4TUYB 3LUDA 4I4NA 1YZHA 4V03A 3V46A 3PZPA 2UZIR 3PPXA 3UK1A 4YR7A 3VKUA 1BH6A 4DBLE 5ICEA 1OREA 4UUAA 4KVAA 4QOIA 1FU8A 3CUVA 4L7QA 1MIOA 2BUAA 4JLUA 1FFGA 2C84A 3NBZC 3OCXA 5FA8A 3WWDA 1FFDA 2VHEA 5BQOA 1LW6E 5TR9A 1O6CA 1V4NA 4CKWB 3PI7A 4CTOA 4EG5A 4NK4A 5LU8A 3CUSA 4TTIA 4KQIA 5DB4A 1L5WA 4RK1A 3HKEB 4LXYA 4W82A 4J9NA 4H18A 2EGHA 3K2IA 1CJMA 5LMZA 1EHIA 1LRLA 3QWHA 4PONA 1MOSA 1A1VA 3CHYA 2YNMD 3NT5A 4BTEA 1K5GA 1K8ZB 2VSQA 4RK0A 5GJCA 4DVGA 2RGXA 3HB1A 3QPWA 1TQ4A 2Q7OE 4Q00A 2QQ5A 2DSNA 4R0MA 2W6ZA 4O4LB 2W6PA 4KLMA 1A1SA 3M6FA 4D0RA 4F2HA 1KKLA 4NZPA 5KOHB 3U1BA 2ZRQA 3HP4A 3KP1A 4FZJA 4OOEA 4CJXA 3ICQB 1NI3A 4CCHA 2Z04A 3G6KA 4Z49A 3KVNA 3H19A 4QZFA 2TSYB 4GEKA 2VEOA 3PICA 4B5KA 5K3EA 4U6SA 1NZBA 1LF5A 3C7TA 2RFLA 4FX2A 5D3QA 5E4TA 2GLXA 5JATA 1V38A 3DJYA 4TTRA 3T7IA 1KTQA 2RMKA 4IYJA 4DMCA 1N5XA 5HZHA 4DLUA 4ZTZB 2CD9A 3JARB 5D1NA 1HRKA 3TQRA 3K8ZA 1YUBA 1QAQA 9ICNA 2PXIA 1PJSA 1XZ8A 3MT0A 2WF5A 4FD2A 2WU3A 5KSYA 1ZUHA 5G02A 3RKUA 5T67A 2BM1A 2CXTA 2JAHA 2GYYA 2RDMA 5BPCA 4XI9A 2A9JA 2CNDA 2VHWA 1AT1A 1EFRD 2Z0MA 5K51A 1GD1O 4F85A 1LUAA 4KLTA 2ZTLA 5ALJA 3A3KA 4D2IA 5J4KA 4GP6A 3L1IA 2GLUA 5AJZA 1NN0A 3OSNA 3FZEA 1X2EA 1Y6QA 2YWXA 4RV5A 1ZSVA 3RFCA 2E4YA 3T0FA 3WZLA 1YZNA 2EH9A 4KLHA 1R4MB 1R8QA 2A9KA 2Z1NA 2VDMB 1SD5A 3L7LA 4PPGA 4Q01A 4U6PA 5AM2A 1ZQHA 4XE5A 2A1UA 4PO1A 3R75A 2FW1A 1Q1AA 4I3HA 5J5CA 1AY0A 1L8QA 4R1MA 1OWLA 5T8KC 7ICRA 4BUJA 4IINA 3VCBA 3AUJB 4I99A 4N3CA 4YLEA 1W2GA 1CVIA 1J33A 2I9GA 2MSDB 1FU7A 2EEZA 4DWOA 2R1ZA 3B0YA 2EQBA 4QSMA 1F51E 3QXGA 1RP1A 4I55B 3VR4H 3ZW8A 1S0NA 2ZU6A 1RZVA 3CCBA 3STVA 4GI3A 4XSGA 2PY6A 2MYPA 4G01B 3A1EA 1KIFA 1WV0A 4KGDA 4OYHA 5G53C 1MN8A 3V7JA 1KZGB 2P2DA 3E3OA 1V7QA 3IQIX 3EPPA 1LPMA 4Z4CA 3I9NA 1ZLXA 1FVXA 2HF2A 4AJKA 4PSVA 4D4GA 2J3HA 3NEYA 4IS2A 1ZVJA 3LT4A 1JLRA 1U99A 1BYIA 1PR5A 3QOYA 4NYIR 4PLZA 3S2FA 4JBNA 5CYFA 4RA9A 3EDQA 3QFHA 5L7TA 2VP9A 2EIHA 1JIVA 1KYZA 3SQLA 2AF4C 4HTFA 1JDVA 3QKUA 3NUZA 2XT9A 3VNAA 2FRDA 4HP8A 4V2UA 4IDOA 2QVGA 6AT1A 4M9ZA 4TV8A 1QQ7A 3HKZF 3FG9A 5I7RA 1UINA 2J1LA 4Q1EA 2GBCA 3LK9A 4QYSA 1KEEA 5G0WA 4B9NA 2JHDA 4DABA 2HXGA 1UBMS 1U5AA 1XYVA 1PQWA 2AA3A 4I55A 3PQCA 4X93A 4RQ3A 1PR6A 3JQBA 4QICA 4ROSA 1OH7A 2CXNA 4UQGA 2IEAA 4KX5A 2G9RA 4P54A 4KYIB 2XSZA 2B94A 2EFGA 2R7AA 5E2AA 2CXYA 2CC2A 4N0EA 4ZK2A 5K8UA 4KIWA 1RC1A 2HHSA 2UZ1A 4G1MB 3BSYA 2D7JA 3F2IA 4KUGA 1DEKA 1RYDA 2CCGA 2QUHA 4M6WB 2OHOA 5J5AA 3TAXA 4JVSB 2V8OA 3DYIA 4A2QA 3OCCA 4BX9C 3ROTA 1K6EA 2CL0X 1HV8A 5LZ2A 4DWVA 1TPYA 3DOCA 4YP6A 1Y98A 1GRCA 2VNJA 2OFWA 4DS4A 1CUDA 2J4DA 1Z4PX 2R1TA 4GM0A 3M9NB 2KPOA 3PXUA 1U2SA 3LG2A 1M66A 1UXKA 2HGZA 4IC9A 2W7PA 5LQJA 1K4YA 4U2KA 2PNFA 2QLBA 4IVRA 4OLAA 3PT9A 5KFHA 2WTBA 3B9BA 3U40A 3RVSA 1FYVA 2D5AA 2D1RA 4RO0A 2VDUE 2UVQA 3DC7A 3F8SA 3HXPA 1F44A 2A1JB 1TO1E 1BRMA 1KBUA 3EISA 3MINA 3OIFA 1ACMA 2I4IA 4HF7A 3GY0A 1P4GA 2D7CA 2J6UA 1NXVA 2JCVA 1GY8A 4OBXA 4TT3D 3L49A 3H8WA 4PS1A 4B34A 3COYA 2XCQA 2CMDA 2BGRA 4F4HA 5FYQA 3HSYA 5CD9A 1N62A 1RADA 2NUPB 1MQ3A 4DLEA 1ISFA 1DFIA 5CDYA 3AVQA 3ZJ4A 3WGNA 2C31A 3AFOA 2WMNB 3K0SA 3HLYA 3ZD9A 1PZEA 1U6JA 5FTLA 5FUQA 1E2JA 4LX0A 4RVFA 5FWYB 3A31A 3L1UA 4K1LA 2PUAA 1IAQA 1WP9A 3C4QA 1LJLA 3L4JA 4Q02A 3MGGA 3GVPA 3R4CA 1OF1A 3LIPA 3BMNB 3FJOA 1F6WA 3GD5A 2QTAA 5D46A 2YASA 4MHOA 2JZOA 1RI1A 3DNFA 5EC8A 2M6KA 2BKLA 1M2NA 3V6JA 2WZBA 3CF4G 2IV7A 5FBQB 5KSWB 4Y2TA 4MI9A 4DOMA 5ILGA 3ESYA 2V1UA 3ZCUA 4Y2SA 4EZ9A 1AKYA 1T5IA 1XT6A 2H1CA 3BDIA 1XTKA 2QTRA 3ESXA 1RIFA 4IEFB 3NHRA 4G0MA 1QMGA 3A0RB 3HTXA 1EIWA 3UGTA 3NAMA 3TRDA 1B0UA 4MDYA 4LNUB 1HL7A 4XJVA 4EGFA 4JFAA 4JT8A 5C32A 1C9DB 3RR2A 3EIWA 3HO6A 3UWOA 4B6GA 2R6AA 3GEGA 1GSOA 1GUZA 3PY8A 3H1BA 3OI7A 3I9V6 1A9XB 3TZKA 3C16C 5LMCA 3DBOB 1IN4A 1N2EA 1AMUA 4B43A 1G59A 3BD6A 2RB5A 2K60A 3CF4A 5AIBA 4QZDA 2P8JA 1IK6A 3CSUA 3OAAD 3TOZA 4H16A 4B5LA 3S5UA 3JPSA 2LKDA 3A2LA 2B4RO 3NH6A 3NYIA 5K6AC 4DMHA 5MGNA 4OOFA 3JPNA 3SAGA 4DBLC 3FOCA 4DY6A 5DM0A 4ECZA 2ZDGA 2H8KA 2RHGB 2A19A 1DUIA 3BJZA 2FN4A 5EOZA 1TYEB 5EJFA 4RTLA 3W3AH 1Z2CA 2G0NA 3RPEA 2G25A 2IELA 4H35A 3ZCSA 4BFWA 1QANA 1KVRA 3H5AA 3LV8A 3M5CA 3MA0A 3O3NB 1PZMA 3A1TA 1DUSA 1U65A 2CLKB 3GPCA 3P2YA 4KXYA 2NPFA 4H7IA 3UPDA 4GKJB 3LUBA 4TKVA 4IX9A 1L4LA 2FDCA 2WWIA 1KRPA 3C3PA 1IV8A 1J6UA 4ENTA 2L5YA 1LQ2A 2ZT5A 2BHSA 1OFTA 1Z6AA 2ZRCA 3MOIA 1W2WB 4HMQA 5FLYA 3OPXA 2QNBA 3ZWCA 5BWMA 4YFKA 2ZRJA 3BXHA 3DDHA 4GIBA 2XNHA 3D5QA 4MS1A 4YT2A 1M6HA 5IKPA 2IYPA 3MFQA 3KJZA 4UTVA 3VKWA 1VPLA 4RHYA 3DTNA 1F8FA 4AN4A 4UAYA 3JZMA 1Q46A 5FBKA 3CB4A 1POWA 1QGOA 3CSSA 2HLHA 2O0HA 3OPYI 3N2EA 3V7NA 3W1VA 4QBKA 4YRMA 3RGGA 3LYLA 2E55A 3JAWB 4IGFA 1IJBA 4QTUB 1FNMA 4UJ3A 1OWNA 4XX1A 4CV2A 3N28A 3IE0A 3O75A 4WCFA 4Y30A 1EBBA 1GAQA 4Y9DA 4ECVA 3TI7A 5CH3A 4EHDA 2ALZA 3I4FA 3K9CA 4MVWA 5FNVB 3CR3C 3JYLA 2R86A 1K0FA 3M3PA 3AKDA 2G5PA 1SVWA 5D86A 3ERCA 1VLMA 4JEMA 2V54A 4FIDA 3PUHA 1JAXA 2RK4A 1KH3A 2VRCD 2QZJA 3GLTA 3K9HA 4HDAA 4CCYA 2W48A 1O95A 4Q15A 3VGJA 2SKDA 3RH4A 2HM7A 2QP3A 5JS7A 1WSWA 1Q3VA 1Z2OX 4JGGA 5LDHA 2B7CA 3VI4B 5GJWC 3UCEA 3W2FA 3JWPA 4EG8A 3LY8A 1IXRA 5CA1F 1L5SA 1CZOA 4YRRA 4E7OA 1EDOA 1UP7A 1IXKA 1LLUA 1M6YA 5AK5A 3L4BC 3NC1C 1LDNA 2W3RA 1K27A 3H4BA 2IEYA 1COWD 4JI5B 1E6KA 4TTTS 3ZGVA 2GJ8A 4F8YA 2XOEA 4B1FA 1QU2A 1M2JA 1IOWA 2JKZA 1RT9A 3STTA 4C3VA 2IYRA 1DFHA 4ND2A 3KNZA 1JLSA 2EDAA 1RWPA 3ABSB 1GKIA 1G63A 4JUZA 3GFOA 4ED1A 4JJEA 4V0QA 4DTIA 2HBYA 1ZCJA 1FLNA 3ELUA 1L7VC 1TD9A 4C0SA 3RFAA 3GXBA 3STYA 1ZQJA 3ABOB 1JIXA 4N6OA 3RBDA 3NWPA 4ETIA 2VZ0A 5EN4A 1NU8A 1IRIA 4O3SA 5CHYA 1X9XA 2D7DA 5DWVA 4TZ6A 2FP4B 2C3OA 3HKBA 3KYDB 4Y9RA 4BFVA 4PRKA 3LQ4A 5IARA 4C6HA 1KVQA 1RQGA 3VR5H 1EUZA 4K40A 1EUCA 3ND6A 5EIBC 1S76D 1B14A 1NX6A 2VAXA 1A2KC 4OIMA 1Z06A 2IU6A 5KNCA 6REQA 1LLCA 2XY7A 1C3LA 1CRLA 3NJ4A 4I5EA 4P7KA 3S44A 4D9IA 4ZI2A 1DOQA 1KYQA 1YOVB 4EPVA 5HKLA 1GZ4A 2HRZA 1GADO 4N01A 1YQWA 2OO5A 4WDQA 1VHJA 4V38A 4DCTA 1NYLA 3TRIA 1XSEA 5GZ6A 4O5OA 2BI7A 2JKVA 1NZPA 3ZTWA 1F7VA 3L7CA 3PLNA 2YC4C 1DWOA 3ONVA 4UCWA 4RT2A 1XFAA 2OV3A 2VTEA 1JG2A 3MD0A 3PXCX 4KE8A 3QVJA 4CTMA 4X65B 5LZ5A 2SCUA 4F3TA 4F3OA 3HBNA 4J0CA 1A8UA 3IT3A 2FX5A 2CL5A 9ICTA 3E5MA 4P31A 2RKOA 4YJGA 3RAQA 1JHRA 3AUUA 3TLEA 4DVJA 1H5QA 2HN9A 2A67A 3B3QA 4C0BA 4E0BA 4B76A 2HUPA 4X60A 4FD3A 5LZ9A 5K3DA 2AN9A 3PR2B 4HDOB 3A27A 4ZGGA 2F76X 2UKDA 4CGYA 3HZOA 4NLCA 4AMVA 2Y1LA 4EHBA 5HUHA 2ZVQX 1BIFA 3BBLA 4I2CA 4ECUA 1A50B 4CEHA 3LY5A 2F64A 4B9UA 3B1KA 2C97A 4YP3A 2X9NA 2JRZA 1ABEA 1C7FA 4PLPA 2WVHA 2O8FA 3RVBA 1QPZA 1Q0TA 1ZMBA 2RBKA 5I48A 1K68A 1HSOA 1D6SA 2R47A 1VPWA 4IF6A 4O4JF 4FFVA 3BB4A 1Z88A 3QVUA 4QM7A 1IY1A 3MRVA 4RNOA 1HQYE 1R50A 3B6EA 2NUAB 1O97C 2ZRLA 2ZSIA 2YY5A 2Q9UA 4HRVA 5DRTA 5GJVC 5TQ0A 2IBKA 1ETUA 1FLVA 3GVIA 5K3OA 5LQSA 3TD2A 5IC5A 1ZR2A 3D1JA 4CHTA 1VE5A 3KVVA 1VYTA 2GTPA 2PH7A 1MC4A 3REFA 3HKDB 3KWLA 2C2DA 1QIHA 2ZBPA 3F8WA 5FNVA 4QKQA 2OD7A 2ONCA 1FRQA 4FCCA 4NATA 4XQ8A 4IHKA 4MW7A 4BLSA 3Q8SB 1X92A 4PQFA 2FPPB 4J9QA 3QENA 4ND5A 2EKZA 2VJMA 2CHUA 4I36A 4OATA 2PT9A 1U9JA 4EJMA 5FV4A 3E4CA 4KIJA 6ABPA 4Z4HA 1JT9A 2H08A 3O03A 3LF2A 4XGKA 4L5CA 3S8EA 2E8OA 4P83A 1J5PA 4D8VA 5K4LA 3K3PA 2Q5JA 5LU9A 1Q7GA 3DMNA 1X8XA 3DONA 1DGSA 5IMBA 1A5BB 1FUUA 3L84A 2EP7A 4ELVA 4XWYA 5LCXA 4JXXA 3OBBA 3OX4A 3FHTA 4E5PA 5DGTA 3SZ3A 2J3KA 3P0FA 5KWVA 1A4IA 1OH6A 1Q0RA 4BV9A 3KYIB 4D97A 1BE0A 2HR1A 4LVNA 5E1OA 2QIOA 2C7PA 4TPKA 3FYTA 2PHZA 1PFYA 3EA0A 1U0GA 2VN8A 3SM3A 3TNLA 1P2VA 3O9ZA 3RG2A 1D1QA 1OLUA 3CT4A 4MO2A 4PPQA 1ZQQA 1TGVA 4RBNA 1OGJA 4MUHA 4W1QA 4ARZA 4QECA 3KDAA 3E7DA 4HCJA 4BP9A 3VFDA 4BNGA 3O8NA 1Q7RA 2ZJ6A 4MP8A 3RYCB 1D2GA 5AI0A 5AKYA 2JGJA 4M0CA 3KUDA 3PC7A 5JC8A 3FH0A 2IU3A 4MITA 3JPRA 3F6BX 4CFZA 1NC1A 2II6A 1W7AA 4M9XA 5B1IA 3GLRA 3K4GA 3NGXA 4EA6A 2CXRA 4Z7OB 3GUUA 2Q46A 4GNKA 1N6HA 5SV2A 4Z7QB 5IVPA 1DX9A 4WVFA 4G1FA 2OKCA 2WIFA 4LWZA 3ZJ5A 4EUHA 3GEHA 1ZUIA 4N9QA 4QD3A 1E1RA 2I4NA 4LYFA 3V6KA 2ZIEA 4TYPA 3VTZA 3OQPA 2WT9A 1ZJZA 4W1RA 3L6OO 2JJ2D 1CF2O 4DBVO 2UYGA 2PXAA 4RDXA 1R74A 1ZMTA 1Y3FE 2FKAA 2DBRA 1ZRSA 1MF7A 3UMBA 3DQZA 1N2HA 2PPVA 4NNPA 4RPKA 4WY8A 3CRRA 4YCSA 4LFAB 4YAGA 5F3XB 3NI2A 4JLPA 1I4LD 2Z3WA 3WIUA 3NS7A 2P4UA 3NU1A 1YI1A 1V9PA 3ZD8A 2A58A 3K4HA 2WAMA 3ICPA 1AUPA 4QNMA 4Z9AA 3UH1A 4AY5A 4Q6WA 5DB7A 2Z1MA 2DLCX 2IS6A 3OCVA 2FUKA 1QNFA 2WINI 3G9UA 3SR6A 4UHBA 4DC1A 4H3VA 5L1KA 3GFKB 2RHOA 2DBZA 4E08A 1TFUA 3OLZA 1DE0A 5T6MA 4BN5A 2AVDA 2Z8YA 1NFFA 4USAA 1NFRA 2IUTA 4RXMA 4AB1A 4XX0B 3AUOA 1QK5A 1Z2AA 3DMTA 5JQGF 1CJBA 4KXMA 4OHFA 1C1XA 4PN7A 1O94A 4Y6GB 2KBFA 3BFKA 2EFCB 4C0XA 2V0GA 1YR8A 5TDHA 4AC9A 4B83A 4C6TA 3LUKA 4UCFA 4S2UA 4Z2YA 3OUZA 2O2GA 1C30A 1GTL1 1DB3A 1R5NA 3LHSA 1S0MA 1N0VC 4X5VA 3ONDA 2V98A 3PCRB 3H97A 3QKTA 4GR9A 4I2AA 2FOIA 3ZWBA 4YG2A 1JDNA 2XPCA 3F5SA 3LDFA 3EY4A 4KXQA 1IONA 2WIJA 3KQTA 3WLMA 3FMVA 4OO1J 4Q4JB 2D2IA 3BFPA 3E6AA 4Q19A 2P4SA 4P7BA 3HPQA 5CGZA 4ANFA 4DCSA 1EXWA 2ASEA 4WOCA 3BJIC 4HEHA 4V0MA 3VH4A 4GXQA 1G4AE 2VJBA 2B6NA 2K4EA 2RQ5A 3DFMA 3LSTA 5J8YC 4OREX 5EP4A 1UKEA 1J1UA 4FFBA 1KS2A 2AQ0A 2JW5A 2Z08A 1KNQA 5E2IA 5HCIA 4B47A 4B9LA 2A5JA 4E12A 3CY6A 1BS1A 4UMEA 3O94A 1TC1A 3AR5A 3HO1A 1KK0A 2YV5A 1EFKA 2EZ8A 4NCNA 5K0BA 3KPYA 3E2MA 3MAAC 5HE9A 4QUAA 1ZZGA 4I2FA 2IHKA 4IM7A 4WBNB 4GDMA 1ZW6A 1WDTA 4RQNA 1SQGA 1T3GA 2BDTA 3A25A 4IOKA 3LDUA 4DB4A 2IHJA 5KSPA 3DEYX 3GH3A 3ZY2A 2VP3A 1XN4A 4K9RA 3ZV3A 3ZE2B 1AZLA 2ZROA 3BD9A 4GGPA 5DPMA 3TO5A 2OCGA 2Y6UA 4A0GA 4CMJA 3A26A 2XMSA 3H0EA 4NENA 3CZRA 4ER7A 1P4SA 2YW9A 5B6JA 4BHTA 1W93A 1WXWA 2AJTA 3B52X 5TVKA 1SV0A 1CQPA 1E92A 1I1HA 4M3NA 3C6BA 5FUWA 3RWMB 3GEPA 1TVEA 5AWFC 3AH8A 8ICMA 1GAJA 4C78A 2WFMA 2A0KA 4WK4B 4AP9A 4G0YA 5IH7A 1K63A 4JV2A 1YKGA 5FOXA 1U11A 1U8UA 2W6OA 2BBWA 4IIJA 3AM4A 5DYTA 2V7UA 5KPDA 5J2JA 4ISCA 1JEAA 1XA0A 2CGEA 4BQEA 4QVIA 3V7LA 4NZ9A 3OLQA 1C4KA 2OCPA 5EE0A 3VKGA 2V7TA 3PEWA 4HNVA 1NLZA 3LT2A 2I8AA 1TA9A 2HHAA