3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
2RAVA 3EF0A 4CF3A 4UMEA 2B8EA 1QYIA 3QUTA 5AESA 3EF1A 5ALNA 2AUTA 4BX3A 5ALPA 3WGVA 1Z4KA 2MU2A 5ALUA 2WF5A 2P9JA 5ALEA 4KX3A 3S6JA 2AGVA 1N8NA 4YIHA 2ZBDA 3IRUA 4Y2UA 5AKEA 1ZRNA 3OTQA 3SLRA 3FVVA 1ZJJA 2G06A 3M9LA 3OCYA 4ZEWA 5AI6A 3RFUA 5AKKA 1J8DA 1Z4LA 4Y3UA 1RDFA 2CN1A 2EARA 5ALSA 3SHQA 4KNVA 5AM4A 1WPGA 2I55A 3P96A 2CFTA 4EX7A 4C4SA 3A3YA 1TE2A 3IB6A 2OM6A 4YCLA 4Y2XA 2ZBGA 4YGYA 1Z5GA 4YCNA 5AVQA 3AR8A 3QLEA 3NANA 5AKLA 5AI9A 3OCZA 5AIBA 2PKEA 1O08A 3QXGA 3SMVA 3VAYA 2HX1A 3ZI4A 2FPUA 4UMVA 3QU7A 3PGLA 3BA6A 2HDOA 2CFSA 2I34A 1Z4NA 3MC1A 1J97A 3E8MA 3KDPA 1X42A 3ZTYA 1YDFA 5ALYA 2AMYA 5ALTA 3AR3A 2ZBFA 2YJ5A 3ZVNA 3QUBA 2EATA 2YBDA 2B82A 3AR5A 3N8GA 3ET4A 5AW1A 2BY4A 2GFHA 3ZTWA 4CF5A 5AW6A 2C8KA 1RPZA 1XVIA 3QU5A 4UAVA 1RLMA 1Z4MA 4BX2A 2WFAA 5A3QA 3B9BA 4OD0A 5AI8A 2HEGA 4UAUA 3DV9A 2ZXEA 4Y2SA 4IFTA 2HF2A 2YMPA 1EK2A 2WF7A 3W5AA 2HO4A 1Z4PX 2JAWA 3A1EA 1ZRMA 5AW7A 3ZWKA 4L57A 2W43A 4HGQA 1RKUA 5AM3A 3NRJA 2I54A 5AVXA 4CNQA 5ALWA 2B8JA 4H1WA 3KOOA 2Q4TA 4YIKA 2OA0A 2MU1A 3W5DA 3FPBA 4C4TA 3E58A 4XQ0A 1RMTA 5E0OA 5AIAA 3QYPA 5AKIA 1S2OA 2Q4RA 5T41A 1LTQA 4DWOA 4J03A 1Z4JA 4CF4A 4OFZA 4Y2VA 1Z5UA 1QQ7A 2G0AA 4OHFA 2B1QA 4QQFA 2ZG6A 2W11A 3KBBA 3WK6A 3AR2A 4J2TA 4G63A 4KN8A 1RKQA 4F71A 2NO5A 1VFPA 3QNMA 1YV9A 1XPJA 3QU4A 1ZD2P 1Z88A 3UMBA 3KZXA 3M1YA 3L1UA 1RKVA 3W5BA 3L0BA 4UMDA 2BDUA 4KX5A 5AVSA 1RQNA 4UMFA 3WK7A 2B1RA 3WK8A 2YY6A 3NUQA 1U2TA 2HOQA 3ZUPA 4XE5A 5AKZA 3ZVLA 2YFYA 5ALOA 1U7OA 2CFRA 1EK1A 1WVIA 2ZBEA 2JGAA 1Z4IA 5ALLA 4BYGA 2I7DA 5ALXA 1Z4OA 1Q92A 2DQSA 2B30A 2WF8A 1YNSA 5AK5A 3A1DA 1QH9A 4BNDA 1IWOA 2O2XA 4Y2JA 1AQ6A 2HF7A 3I6BA 2G07A 3SD7A 4EENA 3ESRA 3L8HA 1ZD3A 4EZEA 2JARA 4FFDA 3ET5A 3NIWA 3DAOA 4GXTA 4XPZA 3CNHA 2FI1A 3WK9A 4DCCA 3OPXA 2I33A 1SU4A 4BNDB 5IS2A 4HYTA 5A3RA 3CZ4A 4Y2RA 1T9ZA 1T5TA 2RBKA 1QQ6A 1TJ4A 4NV0A 3WKDA 2AH5A 3A1CA 5AKGA 2IOFK 5ALFA 3SF0A 4UM5A 3N28A 1L7OA 3KD3A 2HI0A 4HGRA 5ALKA 2C9MA 1N9KA 3KC2A 4HGNA 4Y2PA 4C4RA 2IOHA 2FUCA 1SWWA 1NRWA 2P69A 3PGVA 3U26A 4FE3A 1L7PA 3WGUA 4KYTA 1FEZA 3HLTA 3D6JA 4L6CA 2X4DA 1YS9A 4GIBA 3WKAA 3DNPA 2FDRA 3U7GA 3QUCA 5AW3A 4HGPA 3MPOA 2MSNA 3R4CA 1O03A 2GHTA 5AW8A 5AW4A 2G08A 3R09A 1SWVA 1ZD5A 4YCMA 3UMCA 4MUMA 4JDPA 3QGMA 1WZCA 3HYCA 4UU0A 1ZOLA 3EPRA 5AK4A 4Y2YA 1L7NA 4AP9A 2ZOSA 4JB3A 4DW8A 5ALGA 2WF6A 3SKXA 3QX7A 2RARA 3IJ5A 1YJ5A 1TJ5A 1RMYA 3U13A 2R8XA 3E81A 2C4NA 1PW5A 3L0CA 5AVWA 5JJBA 3OCUA 2OYCA 5AICA 4ZEVA 3OCWA 3B9RA 2G09A 1RMQA 3PCTA 4ZEXA 3WKEA 2EAUA 5ALMA 3EWIA 4UW9A 4I9FA 1L6RA 3QUQA 5FP0A 5AM2A 2C8LA 2YMQA 2YN4A 4Y2QA 5ALZA 3GYGA 2IYEA 3I76A 3AR6A 1RRCA 4BEWA 2JAOA 1Q91A 3ESQA 4RESA 4F72A 4CE6A 1RC8A 1VJRA 4UARA 2VKQA 5AVUA 2QYHA 1L7MA 2IA5A 4B6JA 3W5CA 5AI5A 1KYTA 3AR7A 4L6AA 3U7HB 4IG4A 4UU1A 2QLTA 1CR6A 1NNLA 2FPRA 3UM9A 2BDEA 3U7EB 4PNHA 3N5KA 1TA0A 3AR9A 1U02A 2W4MA 4KNWA 5AW5A 4DFDA 2GMWA 3N07A 2ODAA 5AW2A 5AVZA 4O8CA 2NO4A 3L1VA 5AKJA 5AKYA 4XOUA 5ALRA 4BBJA 2WHEA 2YJ4A 4EX6A 1NF2A 1U2SA 1QQ5A 2YMMA 5ALIA 4UATA 4I9GA 5AM1A 3FPSA 3FZQA 3ZW7A 2G1AA 4E88A 3WK4A 5ALJA 5AVVA 4NABA 4OCZA 1L8OA 2OBBA 2GHQA 4EELA 1K1EA 2HCFA 2RB5A 3L5KA 2I6XA 1T5SA 3QU2A 3ZVMA 5AW9A 3L8GA 3PDWA 3F9RA 1ZD4A 4MWOA 1RQLA 5AM5A 4HAIA 2P27A 3UMGA 2YMLA 1JUDA 5AM0A 2P11A 2NYVA 3TLMA 2WF9A 1RLOA 3J7TA 2JAUA 1MH9A 2IOFA 1LVHA 3ZWDA 2YJ3A 3I28A 3NALA 3BWVA 3AR4A 4BEVA 4RETA 3WKBA 1L8LA 1TJ3A 1ZS9A 1XP5A 3WK5A 5AK6A 5IT0A 3U7FB 5IT4A 4AS3A 5AI0A 4AS2A 5AKXA 3L8EA 3L8FA 3SKYA 5AVRA 4BKMA 4NWIA 3FM9A 3NASA 2Q5EA 2HHLA 3N1UA 1CQZA 4EEKA 2WM8A 1YMQA 1VJ5A 4HGOA 2FEAA 3R9KA 3ZX5A 4FYPA 2YJ6A 5AI4A 5AVTA 4NAVA 3QU9A 3K1ZA 2R8EA 1U7PA 4Y2TA 4BX0A 1WR8A 4QJBA 2O9JA 3MMZA 5ALDA 3B8EA 3ONNA 3E84A 3NAMA 4UM7A 2GO7A 5AHXA 5AKHA 4YH1A 2HSZA 4NFLA 2B0CA 5ALQA 2FUEA 2R8YA 3L0YA 3RF6A 5AVYA 3WKCA 2FPWA 2PQ0A 3U19A 1RLTA 5ALVA 2R8ZA 3DDHA 2PR7A 5AK3A 3ED5A 2G80A 3ZU6A 2D2VA 2FPXA 3L7YA 3I1YA 1Z4QA 2FPSA 1Y8AA 5AW0A 3OCXA 1S8OA 1F5SA 5ALHA 3FGOA 5A3SA 3MN1A 2C88A 4UASA 4G9BA 3OCVA 3ZX4A
chains in the Genus database with same CATH superfamily
2IZZA 1SBYA 2A0XA 3JZAA 4NP6A 2C2ZA 2E3JA 2R96A 3LMKA 3CEAA 3HGMA 2XZPA 4DIMA 3EF1A 1N2HA 2AUTA 5ALPA 2H29A 3NTLA 3D7RA 3CPEA 1L1RA 1W5EA 4JJEA 4RTKA 4OI1A 3TAXA 5ALUA 1UXKA 4ZA2A 4JYPA 4QBTA 1JBQA 1WWVA 2VHZA 4OJOA 2P0EA 2PZEA 3ZHQA 2EGGA 1SUCA 3MFYA 1JWLA 3REFA 2ESRA 1SOMA 2Q6KA 3AKCA 3GLVA 3K73O 4HWRA 3RD5A 5IJZA 3V3KA 2AX4A 2AT1A 5DBCA 1WMFA 4KBYA 2BLNA 2M6RA 4QQKA 1E3QA 1GZ4A 1SNYA 4MLCA 2I76A 4RNDB 5CM8B 5EIAA 1SB8A 2PWBA 4JT9A 3PC2A 1MFZA 3PJDA 4JOCA 2JK0A 3CWCA 4X8HA 4ZEWA 1T2DA 5FOWA 4FGWA 3K0FA 4MZXA 1B1AA 3LQ2A 1D8BA 4OQQA 2DXIA 4IDPA 4PEVA 2OCKA 1ZL2A 5ICCA 4YD2A 3I62A 2JATA 4QLOA 3PDIB 3SR6A 2Y0EA 4KQWA 1U3TA 2WSBA 1FP4A 3CFYA 1Y34E 2P8JA 2Q2QA 2UAGA 5UKDA 1QG2A 3VU8A 3PBKA 1IG6A 1FK8A 3WO0A 5IG2A 4QE3A 2EFYA 1L8QA 2A1TR 4R7TA 3HILA 5KOHB 1Y98A 2WYIA 1BKDR 4I4TF 4JQOA 4QYTA 4BCDA 3VZPA 4Z0PA 1L1FA 3AR8A 3QLEA 4OO1J 4ABYA 1DT5A 3KCNA 4KLCA 2NUPB 4IXTA 5GINE 1JRLA 1KJ9A 3E5HA 2A1TS 3GT4A 3E5NA 2GETA 3S2SA 1RCFA 1B1CA 1J9GA 1ELOA 1V3QE 1IZYA 2GUWA 2G9QA 2DFDA 1XF9A 2VXOA 3HKEA 4G37A 4TKZA 3ZQ4A 2I9KA 3DYVA 3MGBA 1GTSA 3IMFA 4Z6EA 2GEVA 1CQIA 1FFXA 3D8SA 4QG7A 2MR5A 1P9LA 3KOUA 4GDFA 1S01A 4HDKB 4OQNA 3EY4A 2ZYTX 3HB7A 5ALYA 4K6OA 4LKOA 4EP1A 3KQTA 4BKOA 2O6LA 1X39A 3AXSA 5JZVA 4R8MA 1JFVA 2C5GA 2VH2A 2H18A 4CM1A 4KO4S 4OBEA 5C2JB 3BD8A 5LLDA 1AO3A 4DV4B 4KQHA 4Z9AA 3BTSA 2EP7A 2BUAA 1YKSA 1CQPA 1TQHA 3JAKB 3O4JA 4M7OA 5K3FA 1DGQA 3T5TA 4H08A 1CHNA 1P5HA 1TU4A 4ENUA 4RXUA 1IN4A 1CNFA 3FVQA 5LMCA 2QTWB 1RQXA 1RWXA 5DT9A 3EYZA 4MYSA 3FOFC 3U4QA 2WTNA 2DFPA 4KLEA 5AXBA 1GN8A 3OJ0A 2QTMA 2RDMA 2K6GA 3N2EA 3RSZA 4OD0A 2FLPA 3I1FA 3LTEA 1SCUA 4UAUA 3DP7A 1B6GA 4D0LB 3OPVA 5ES4B 2XIDA 2ISQA 3T4UA 3L4EA 1PJTA 1Y7PA 3JATB 4TTRA 4I2EA 1DTEA 3S2FA 4ANFA 5AW7A 1P33A 4TVKA 2JDID 2R6AA 4GLLA 3IQHX 3KUUA 4AYTA 2IYPA 2DHQA 2OO5A 4PAOA 5ICFA 4CNQA 2D6FC 2JRCA 4PFQA 1SCUB 1HE4A 2ZBPA 1LGYA 3DL2A 3OJFA 1XCPA 2PIDA 2W3RA 1TK9A 3GXOA 2CJXA 1XXHE 3FWYA 4IIXA 4M9LA 9ICIA 1D1TA 1U7UA 2O14A 3UT5B 1SBQA 4PCUA 4CLHA 5DXFA 1HYHA 1I7NA 1MQ9A 5AIAA 1W76A 5K0GA 1TD9A 1JG6A 2V4ZA 2XWQA 3A9TA 4BFZA 3RBDA 3N4MB 3A2KA 2Q4RA 2B21A 1O96B 4AI6A 3M7DA 2Q5FA 3FNFA 1IHOA 3FWZA 3S28A 1CZNA 4AT1A 1S0VA 4AJEA 4H31A 1SCBA 3E7PA 3OEHD 2QBYA 4QATA 3E27A 3PKZA 4JEIA 5K0NA 4C7KA 3KBBA 2XB9A 2IH4A 1UWLA 2GJ9A 4P83A 1ZNZA 4G63A 5FLKA 4I8IA 2QX4A 2V9ZA 4TN5A 4F5ZA 3M6LA 1H2FA 4DLTA 4MJXA 1IPHA 2QN6A 4UB2A 1NMSA 2CL6X 3L06A 3EBOA 1QAQA 1WZIA 1TV9A 3JCZA 1JILA 3TX2A 1TLFA 4XCXA 3AHHA 4K81B 4NU0A 4RNNA 2ANBA 2BBTA 4R05A 1RHUA 5H68A 1JS1X 5DEIA 2D2FA 1OPXA 5EJ6A 1WWUA 1GRRA 2Q2WA 3CT6A 4M1ZA 1N1MA 4FYIA 5BT9A 5B1IA 4W82A 4CM4A 3EG9A 1QE0A 3OJLA 4E0DA 1EFLA 2Y1GA 2W9XA 4FQ8A 3SIXA 5GADl 1UBUS 5J4HA 2IUYA 3MJVA 4ZC1A 1ZWKA 4CT5A 4DR3B 3NUQA 3T3NA 1WHTA 2C9CA 3GJSA 4EG4A 4Y1GA 1XCJA 1WE2A 1XG5A 2WAAA 3TFOA 2VJ4A 2JCYA 3DNMA 2B9VA 5HOEA 3GJ5A 3WL8A 4HBZA 3LXRA 2MT9A 4KMOA 2Z3WA 4H9GA 4U2GA 1X6JA 3FPFA 2RK4A 3NFRA 4PE5B 4ALJA 2YS7A 1OYOA 4WACA 1C3OA 3SEFA 2ZBEA 1VI6A 1BG6A 1LK0A 1R5NA 4PQGA 1EFPB 3L7BA 4BYGA 3G13A 4H3VA 1BZYA 1RWVA 1UKEA 5KTYA 1TA9A 1UOOA 2V7WA 4MSUA 3DE7X 1PWXA 1SGGA 2REXB 2ZJ1A 3CNLA 1C3EA 3ZGXA 4EIWA 1PYGA 1B26A 4KXFB 2AR7A 4DCNA 1XALA 2Z6VA 2I9PA 3L3BA 1H2HA 2J8ZA 1AURA 3U5TA 4P4SA 4P98A 3QFFA 4R9NA 2ZIWA 1WXWA 4G07A 4U4AA 4YCBA 2Y0DA 4OLFA 3KIPA 2GF0A 4ZN6A 4R6XA 1SKMA 1SB3C 2JI6A 2WIAA 2WKSA 1MU0A 1C9DB 2MYUA 4P31A 1NVVR 2CFIA 1PUJA 1N5RA 2FI1A 1QRTA 4QZEA 3UGJA 2X1LA 1T3QA 1C14A 1UEJA 5CA1A 2DFTA 1GAWA 1RWNA 4K3VA 3RAJA 4NU6A 4W4TA 3S2ZA 1J5XA 2OYYA 1JZQA 3EFOA 4BMDA 3FF1A 1F0MA 5CDTA 1U9IA 2PSEA 1VLQA 1XP8A 2P3OA 3G2MA 3H2YA 5AKGA 3ANNA 1PQ4A 2WV7A 1L1QA 1W44A 3Q3JB 3HGQA 2DUNA 5C0OE 4DNXA 5KWSA 3OQBA 4U9UA 2QORA 2R1VA 3LGSA 4DIDA 4ZU6X 3EEYA 3OZXA 5JXIA 2F6RA 5DKFA 1H1DA 4I50B 4OBXA 3AIMA 1JVSA 2A3NA 2Y92A 4HUTA 2E5SA 4YMMA 7ICIA 3G2NA 3C41J 5KSOA 2X5NA 4JGGA 4ZQHA 4YUVA 3WR5A 3ZWCA 3WTCA 3LV8A 1DQYA 5EHQA 3QI7A 1KI8A 2L69A 4OJLA 2ODQA 4P81A 5TQVA 1CEYA 4KRYA 2QL9A 4IIJF 4XRHA 1KZYC 5HMLA 2OHGA 2QYOA 3G8AA 3KRTA 3BCHA 3CW8X 2ZRMA 4I50A 3OMLA 5ICEA 1T9GS 4MR7A 1IRXA 1M7BA 3HJBA 1NLUA 1PW7A 2N1MA 5J2BA 3C23A 2QD3A 3DFMA 3KQPA 4J0EA 2ZU0C 1ORRA 1XKQA 5EZYF 2B5VA 2XCIA 2J3JA 5DBGA 3FPEA 1VE3A 3WMWA 4ZJYA 2DFKB 3SC3A 4WXHA 1SOVA 1TADA 3F74A 3OM9A 4D9CA 3AEVA 3M4XA 5MDHA 4QW8A 1YFZA 2Q6IA 4MGEA 4XFDA 4F38A 3FR7A 4NOLA 2I71A 1ETUA 1Q0QA 2EHJA 3MGKA 2ZWMA 4JDPA 4TS9A 4GE0A 3OMXA 1UP4A 1V5GA 2ZZNA 1V38A 4HWTA 1HZZC 2DQYA 4LOLA 2IFTA 3A6GA 5EIFA 3FSGD 1E4OA 4JUDX 2I4TA 2X8JA 3EVBA 5EJFA 1L5OA 1N5LA 5GIOE 3KSBC 3QX7A 2WJ4A 4DANA 4GR4A 2F3PA 2DUWA 5JD5A 4UOQA 2EXXA 3SEZA 4CEJA 4PZUA 3GLSA 5JMWA 5IJXA 2D4AA 1DG9A 1QSGA 4MCIA 1S10A 2NUTB 5K3CA 4ZEXA 1FFAA 3QJYA 4X66B 4NQZA 4TSFD 3VNBA 4LF7B 3EWIA 4MUBA 4NBVA 2YXDA 1AS2A 2IYYA 5ED0A 1B42A 4QJ4A 1K5PA 1JHQA 4LPKA 5DNAA 3UJPA 3NFYA 5AM2A 9MHTA 5H9VA 1KY4A 1IN8A 3A70A 3O8BA 3C6XA 2OZVA 3DZIA 2ODPA 3QVWA 1SUAA 2CF6A 4RIFA 4Q4HA 4KREA 3O8RA 4OG2A 1RRCA 5K4LA 3VH2A 4BJ6A 3EZLA 5HM8A 2AEEA 2A9QA 1DWUA 4TX1A 5EXEA 3ESQA 3DE3X 2CJWA 4OP3A 4R0VA 5DGDA 1TUBA 3TDKA 2I7VA 4ESHA 2PPVA 2C1XA 2HQRA 3N87A 3EUEA 3O84A 2BFCA 1PR0A 1QB8A 2JGNA 3G49A 3LY7A 3P9YA 4IVQA 1FNSA 4L2IB 2BJHA 3IT1A 4IDFA 3W5CA 1OWOA 1GXSA 2K7FA 4UBCA 1G18A 1K2WA 3PPYA 4JY7A 2IC5A 3KHTA 4WCFA 1RYBA 3ITDA 4O4IA 4C3OB 1NW7A 2A5JA 4ZZ0A 3D0QA 5KOYA 2C58A 3UW3A 2RH5A 4OFBA 3AM5A 3VR3A 3EARA 4UHBA 1P2TA 1V3VA 3IBYA 4MK4A 1B14A 4NEGA 3CGWA 5AVZA 3EQ2A 3ITNA 4J43A 3BIJA 4YT4A 5C5DA 1JHDA 1S7CA 2PX6A 1J2RA 4RACA 5HGXA 4PNZA 4E2YA 3KWJA 3GLQA 1D1QA 4AUNA 1XXHA 4IRUB 3KYJB 2BZGA 4UATA 3Q3CA 4TRNA 3CA8A 1XEWY 4MS4A 2WYHA 4W5JA 2OHVA 4C80A 1DBIA 4LI3X 4OQPA 1EKXA 2K4IA 5KB3A 3OZBA 2EEPA 2ECQA 2QPAA 2UYGA 2FV8A 3C8DA 3IR7A 2QAGB 4X7PA 2PRSA 2M6KA 1AH2A 1VL6A 4GSYA 4P4MA 2F2AB 2V4MA 2OBFA 5FBZA 5AQ1A 3KJGA 4MVCA 4RPKA 3ZZMA 4OI2A 5C7YA 1EU1A 2WHQA 4IBOA 4NJMA 4QM7A 4CVNA 3D8BA 3CZMA 1V1RA 3ZGZA 1R3UA 4EJMA 4Q6WA 4WAUA 3DAFA 1IATA 4TRRA 5T3YA 4R3NA 1F12A 1FMTA 2H16A 4C8KA 3C3PA 3U3ZA 4EPVA 2XRMA 1SL0A 2G17A 1H2WA 1JMSA 5AM0A 2XAAA 2FRDA 1E4YA 3QKWA 4X60A 1R6AA 4FPXA 2BFEB 2WF9A 3AUUA 4P08A 3CCFA 1DX4A 4WBSA 1T1GA 4ERXA 1K8RA 4WA7A 1UDCA 2B4KA 2HLPA 4FR5A 1BXRA 4MMZB 3M5PA 4I0WB 5JVDB 2TMYA 3LP6A 2XX3A 4J1TC 4I08A 5FUMA 5J0OA 1X38A 4YD1A 1TQ8A 3H11A 1MBZA 3LPMA 4GI3A 5CX1B 2I7XA 1M34A 1XLUA 1RPTA 3HHEA 1IBCA 4MV6A 3ASVA 4YCDA 4OB7A 4AS3A 5AI0A 2FVYA 3NGMA 3BH0A 4RH3A 3TGLA 2C4WA 4JLWA 3BJEA 4ZV9A 4F2SA 4KLTA 3VBCA 4BKMA 1PN3A 3C1ZA 3MDAA 1SRRA 1Z62A 3OEWA 1YR9A 3HI6A 3E9RA 4HQNA 5JCOC 5J2TA 4JJ6A 1EFRA 3ZXYA 3SX2A 3QV1A 3NUZA 3WGTA 4CKBB 3HDHA 5IVDA 4B84A 4B2YA 2HAEA 4I2GA 3WGZA 3VH3A 3ZZNA 3TNYA 3NDIA 2O3JA 1D03A 2HNAA 3ANXA 4X63A 3RU7A 3TTWA 4ARIA 4NBRA 4MA5A 1V8OA 1N2JA 3V7FA 1KZ9A 3MT8A 4FKZA 5K4GA 4UAWA 1R9NA 4BQQA 3V7LA 1OGIA 4D4KA 3K5PA 1AKTA 1N6IA 2EL9A 3EXG1 3E6AA 3I6QA 1XZGA 3KQNA 9ICWA 3F46A 2QUKA 3GFVA 2H4WA 4L50A 2NV2B 3W4IA 2X77A 2YOHA 2IF2A 3ZZUA 4UTVA 2OOKA 1ZA1A 2B8TA 4Y6QA 1VMIA 5A5DA 5L4LA 1VYVA 2VG8A 3CUWA 3BIWA 4OV6B 4YX9A 1RZUA 4I4IA 3WC4A 2X2FA 5BW6B 1EBBA 1Z07A 3H5OA 5AKHA 4GMHA 2P9FA 1V5EA 4ND5A 4DV6B 1QFXA 3ON5A 4P54A 3WBBA 3QWIA 4ECRA 1AHPA 5A5VA 1TI7A 2DWCA 2WFLA 4Q3LA 1PR1A 3THRA 1HK7A 4TZKA 2V7QD 4ZHQB 1H6AA 1GKLA 3C5EA 3DUWA 2OBNA 3A27A 3QY9A 4D42A 1YAJA 3VNUA 1GXSB 5AJYA 3SGLA 1SU7A 3WISA 1Q7CA 2BSAA 4N4AA 5K2OA 3RARA 3BE6A 1D0VA 2I2WA 4AZWA 3WWDA 4RPCA 4WLOA 4ZYZA 4RABA 3DTVB 3IB3A 3KR0A 3LPDA 1Q21A 9ICUA 3LHIA 2B69A 3LC7O 2KBFA 4ND3A 1Y3IA 3M2PA 4UNQA 2D2VA 3FPLA 4K2AA 2C28A 4LHZA 4AJ9A 3TNFA 5FA6A 2A35A 3PVCA 5EE9A 2FPSA 4FNOA 4GI1A 4RD1A 1N78A 3OT5A 4MW9A 2WA1A 4OHPA 4RF3A 4DDUA 3EXEA 2QL7A 2QRPA 3HCFA 4ZCMA 1HLFA 1WTCA 3PUVA 1NM5A 3HV0A 2Z4RA 5DLPA 4A8TA 1A0PA 3C6BA 3KBOA 2A2ZA 4KH1A 1N7GA 4LZOA 4D0RA 5CJ7A 1MIOA 4ECWA 4U8GA 3HJHA 3D6TB 2C1ZA 3VSEA 3QOFA 3CPSA 4M9JA 5AOAA 5F76A 1DIHA 2ETVA 4G85A 5I8PA 5AESA 1QYIA 4WLNA 3W1VA 4G81A 3AXTA 1UCFA 3JR7A 1XTRA 2W8BB 1ZSVA 3C6QA 2F1HA 1E1KA 4QZFA 5D00A 3HB5X 1THZA 1QKKA 1HYEA 4LMRA 2Q6TA 1G2IA 5ALEA 3QIVA 1ZQMA 2OKGA 1NN5A 4I4CA 2P65A 4UEOA 2OXIA 4RT3A 4YEDA 3ROEA 1QNFA 2OAP1 3EASA 4LW8A 2HZBA 4TUYA 3AOEC 2DR2A 1ONOA 8ICWA 1CRZA 4GMFA 5G0SA 5EKTA 1U5BB 4BAUA 3PZPA 2CGEA 3JZFA 4LI0A 4OREX 4AJ2A 2IPAB 3H8SA 1IY2A 1G2OA 5LYJF 2JLZA 4O1IA 3OM8A 1AUOA 1SVMA 2OL4A 1Z4LA 4N3BA 4U2FA 3RFXA 3UJ3X 5JRDS 3RJHA 1D1PA 4C7XA 1MVOA 4EG8A 1DLIA 3LHKA 4I3FA 4IICA 1JHOA 5ER9A 5I9IA 2FG6C 4QUIA 1LNQA 3ICQB 4B3GA 5G0WA 3P96A 3ZY2A 4DRXA 1IZ9A 3AUSA 4FN4A 1NN1A 4OMUA 4J2OA 3AL3A 1T2AA 2WUGA 4O5OA 2K4MA 4EW1A 5MFZA 4BNHA 3G7UA 4IGEA 3GRFA 4OHWA 3BHIA 1XQVA 2IHVA 3E9DA 4M21A 1GFWA 4QARA 1N92A 4N5LA 1H5NA 4KLHA 2RDIA 4NG4A 1OA0A 5CW2A 4B73A 3BICA 2PEZA 2O6KA 1W581 4DC0A 4D96A 3PSIA 1B6RA 2SBTA 4U6PA 2NVOA 2KEYA 5IYZF 3KTDA 1QH8A 3LUJA 4LZJA 3TQRA 4EJSB 5G1NA 4KN5A 1HM5A 2PL3A 3UKJA 4AJJA 1DTSA 1Q1QA 4C08A 2AN5A 3DAHA 3GILA 1U8ZA 4Y6GB 4HAVA 3DZCA 5B2ZA 4QDXA 1PZGA 3FX2A 3G0IA 4IDDA 2WU3A 3HKBA 3SXJA 5B58C 4Z1OA 3C8ZA 4F3NA 3ANYB 5HFNA 2XB8A 3AU9A 4ID3A 3RJFA 4RLHA 1UBHS 2XTAA 3G9XA 1XHLA 1NBEA 2BKVA 3IOBA 3TOSA 5C1OA 3GI1A 4YAUA 1UQTA 5BSMA 3BWYA 1NYLA 3BJMA 3P5SA 2W4IA 5ECGC 1ODCA 3G0GA 3V4FA 1AK1A 3MTBA 3LD9A 3PHJA 3GGOA 4BWGA 3Q87B 1DXOA 1JVBA 1FP1D 3AR5A 3N8GA 4B87A 2OBMA 5F3RA 3KSZO 4N0PA 1SXPA 1BQEA 1GUYA 2CLLB 4YR9A 1DO2A 3CB4A 3LCVB 4DDHA 3VDNB 5DSTA 2XRZA 3A05A 2D7CA 4MUKA 1Z0DA 3AOEA 1C1YA 5DHSA 4DABA 3LOPA 4PLYA 2FN3A 1EGMB 1FRNA 3OPNA 3D3KA 3D0OA 2BMWA 7ICJA 2VH1A 5E9JA 3KLOA 4LJ8A 4FN5A 4QHYA 1HDRA 3ABZA 1D6MA 3DWEX 2ST1A 3B9BA 2F8TA 1LQUA 3JASB 3D8HA 2VDUE 3LM8A 5FWDA 1FPMA 2ASVA 2DPGA 3UG6A 2C2DA 1Q5PA 1JDSA 5C8VA 4GGPA 4H3KB 5KNIA 2QJTA 3X1WA 3WSTA 3KKQA 3GEHA 4EW2A 4KR2A 1PAUA 1E6CA 2Y99A 4LHXA 2VPPA 2CUKA 2JAHA 2Q9UA 7ICHA 3LRTA 3NIFB 3LPCA 3Q85A 3TANA 1V9SA 4TKMA 5E7JA 4CLDA 4NLCA 1I3CA 1CEQA 3IIMA 1X9IA 3GLGB 3WRWA 2P2YA 5LP6A 1RRVA 1YS6A 1U0SY 2P1RA 2QXYA 1T0IA 2QUHA 3SZGA 4N40A 3LSYA 2NLOA 3D2SA 5FFFA 4J9QA 1UBCA 2AE1A 3D2LA 5EHIA 3TRKA 1Z5WA 1GYRA 2YV4A 4B6RA 1T5HX 4PPFA 4QGAA 1B8VA 4U2DA 1Y3BE 5FHRA 3TEJA 1JAYA 3IEUA 2OCGA 4K9MA 3M4YA 2WAYA 4ZQFA 1E3TA 1R0CA 3EVGA 3ZDYB 4D0NA 4DL4A 4BQEA 3UQYS 3I01A 3STYA 5F52A 5HKOA 4KK3A 3IC5A 2Y77A 2O7RA 2OHFA 5IINA 5KFVA 2C4MA 2VA2A 2PRYA 1FOEB 2H0QA 2WNIA 1GVNB 5J0QA 2P5TB 2WTFA 1K7EB 2Q0QA 2G0AA 2OYSA 4ED3A 2QD4A 3FH0A 2BGWA 1SK9A 3OQIB 3IE0A 1TUEA 1WQ3A 4JOQA 1SUPA 3TQ1A 2MSKA 3KYBA 4H0NA 1LLFA 3EXIA 4A27A 1Y4SA 3PR4A 1LDMA 2C9DA 2O3RA 3DMPA 2VNKA 3FHLA 4DL6A 1JDTA 2FZ4A 2GN8A 2PBRA 1DB3A 2J3DA 4K6FA 2OK7A 4OGLA 3V8EA 2ZIUA 1TVKA 5BV1A 1V4BA 5ECWA 3A28A 4D4LA 2V9PA 2VXCA 5LJIA 3J81j 5JXHA 2ZSJA 2A9JA 5EWMB 5JNTA 1FYEA 5EEGA 1ECJA 2LE0A 4G0ZA 3I9LA 3M1YA 1CSEE 2G4LA 3QLTA 1P74A 2DLNA 4KTVE 4C5BA 2O8CB 3PXXA 1VKZA 5BORA 2IQIA 4FCTA 4G0WA 1P6QA 3PX2A 2ZE8A 4A0FA 5K6TA 1JB9A 3QVMA 5T6BA 2JLYA 4DA4A 1X40A 1Y6ZA 3BMNA 1R8JA 5E9AA 2ZROA 1WW2A 4UBJA 3GH1A 2P6PA 1R5BA 3RH6A 3HBMA 2N0SA 5DMHA 1KARA 5FFNA 3N58A 3Q0EA 5BN5B 4EKIA 4PZYA 5KFPA 1L7RA 4OM8A 1E7RA 5E6UA 5EJIA 5DDYA 4YS6A 5DU2A 4QEKA 3LUCA 2QRGA 1DJOA 3O2NA 2YASA 5AQEA 3WYBA 1I4OA 4E03A 3MR2A 3QMPA 3GLGE 1WUTA 4FB5A 3EPLA 1JPVA 1N5XA 4B40A 1P2VA 1QHNA 3SDBA 2IHZA 2C96A 4RFVA 1OYWA 2VDRB 3UJBA 4QZIA 5DHUA 4K4GA 1PZNA 3RSFA 3M49A 5ADVA 2QRNA 1ZO8A 3HU3A 4HI0E 3A0RB 4YBRA 1YZUA 5CAEB 5LR6A 2VEOA 3L7KA 4N18A 1U0EA 3CLUC 4R2XA 4OHXA 1J2MA 2O8EA 3VR6D 1EMDA 1ZJMA 3GFPA 4C0JA 4BGEA 1I5EA 4UVEA 1UAAA 1QYCA 1Z17A 2X15A 1MEJA 1ZX1A 5DQHA 1VTKA 4FFPA 1XC9A 4FT2A 2Z09A 4DCCA 4BE7B 3DZFA 4EUEA 3IOEA 4FIDA 2ZITA 5JROA 1MJGA 1QUFA 1IJFA 2XGGA 3JALB 4GHWA 2C2KA 3R4VA 4TLBA 1YUBA 3UY4A 3HBLA 3ZVRA 4PFKA 5A3RA 5CVVA 2TS1A 5CVJA 2AXTU 2XADA 3RRFA 2ZR7A 1NF8A 1F2TB 1MB3A 2VHYA 4BNVA 4IHKA 1QSSA 2F1KA 4JENA 1XEFA 4CKEB 4QO8A 1YCFA 5JTUA 3TW8B 2B7LA 3GFKB 1M67A 5ALFA 1SBCA 2QP3A 4M87A 4NBUA 1UKAA 2V4RA 3URKA 5D85A 4AYXA 4IEIA 4UCWA 3K70D 2W2XA 3C1YA 1SVKA 4KO1S 5FBKA 4BMZA 1HE3A 3P9SA 2XMZA 4ELUA 2QW1A 3JPOA 1K66A 1WZEA 2ORIA 3A6JA 3CNBA 3KG2A 3R3UA 2ALZA 1VCHA 3A6KA 4KMSA 2ODEA 5CPFA 1SBIA 3K0SA 3TAUA 3N6VA 2J7PA 5BRAA 3TW8A 4PGFA 1T13A 4JBLA 1KW4A 2IQ5A 4GPBA 1RRPA 4Z4HA 5EHZA 2WVGA 3D5TA 1FU8A 1OAAA 5JAZA 3LYLA 3JQBA 4QOIA 3TLXA 4M83A 3D5EA 5DE3A 5K8JB 4OPMA 5K4AA 5HCUA 3OQMA 3IUMA 1XZDA 3K05A 4F8JA 1Q7RA 1UJ2A 2WWWA 5KG6A 4MF8A 3HR4A 1E5XA 1E8MA 3MPOA 3O7MA 4MVJM 2KLBA 5E1OA 3VOBA 4GP7A 1U3VA 1GG8A 4HH4A 4H18A 1HE1C 4G0OA 5TT0A 3GIKA 3M6XA 3PZBA 4AMZA 1J24A 1ODKA 1PFWA 4N3NA 2Y1WA 4HD8A 4R7GA 4DY4A 1CJTC 1GTL1 4TUPA 3DF9A 3I5UA 2BEJA 3L7AA 1WXQA 2YJNA 2OV6A 4L9WA 1YK0A 2QTRA 5HOQA 3ADBA 2AB0A 2J5RA 3LDHA 4JOSA 2AHOA 4UHFA 3TXYA 1FBNA 3VDQA 2JKVA 4JBIA 3NM5A 1ND5A 2I5PO 4LJ9A 1GDDA 1EAYA 1SVIA 2J09A 3KJEA 3HVUA 1Y4ZA 3IQEA 1Z6AA 1ACMA 3DWGA 1O77A 2BPOA 2R7KA 2IOQA 3EXAA 2NV0A 3X1KA 4ZT4A 3D4OA 4HEA6 2Z3VA 4HCJA 4BLOA 3IAS1 2Q3MA 2C7RA 4YAOA 2BR4A 2LKYA 1J39A 2C07A 5LA6F 2P2DA 4CDGA 2E8MA 3VBEA 2C3YA 4HLDA 4EMSA 3V2HA 4FHCA 2PMDA 2KKPA 1F8YA 3G3EA 3EGVA 4S24A 1VBKA 5BSGA 3DPIA 2C5HA 4KQXA 3U4CA 3I30X 4BO3A 3TYXA 2CJFA 2ZUUA 4J9MA 1ZK2A 3UPTA 3O8OA 5IKXA 1Y1RA 1E20A 1G0NA 4A73A 4BMOB 4EI8A 4AM8A 5T7BA 3K0BA 2A3RA 2H6EA 2TECE 3CUTA 4FGKA 2KJQA 1NU6A 4JUBA 4HAWA 1FNDA 2OGSA 3PUZA 5AJUA 4HVLA 1I2ZA 5KNCH 1QKIA 3ETLA 3BVPA 3PNMA 3F47A 4MDFA 2E4UA 2R2AA 4NMLA 5LQUA 4QIWF 1PT8A 3DLCA 1Z6TA 4AY2A 4HQKA 4A0GA 1P39A 3KT0A 4X41A 1RXSA 1DUIA 5AI5A 1GR1A 3P0HA 5K3BA 1Y81A 1DEXA 1QO0D 2FMXA 1CR6A 2Z43A 3NBKA 1T4MA 4OKSA 4Z99A 4FCWA 3HBAA 3OZRA 5F7XA 4KN7A 3ZXUB 4DLZA 4EUHA 1DTWB 1L5YA 5FWXA 2IYTA 2VWHA 2V8BA 2UUCB 1WL8A 1XNHA 3K0FB 4YV0A 4ZYUA 4KW7A 1U5AA 1Z29A 1EHIA 2VK2A 1KFSA 1BD4A 3MDCA 4XOUA 3H1AA 4LJSA 1NJFA 4MUFA 5HCNA 3ZJ5A 2V1UA 1RYRA 3KT8A 4I50F 3E9EA 4NARA 2J0UB 1R9GA 3L82B 4S1PA 5FEUA 3NWOA 3U3RA 3OWOA 4PNPA 2IA6A 4X00A 5FPTA 1R6VA 2GESA 3OIFA 5HQ3A 5AVVA 1NAHA 3I5MA 4JUIA 3O8QB 1C50A 5REQB 2WWRA 4XX0B 3DCNA 3HABA 3T9AA 1TT5A 1NJ1A 3PFNA 4HB4A 1QVRA 3AUJB 3FTNA 4JBNA 2J0UA 1C4KA 1E2HA 5JAHA 1EG2A 3U0VA 3ETDA 1O6GA 1N7JA 3V1MA 3PRJA 3L8GA 5AW9A 3F9RA 2J07A 5HQ3B 4RKWA 3D2NA 3B0YA 3JQAA 1XFDA 4KXXA 3KKAA 4N9WA 1E1LA 1U7XA 1XDWA 4R81A 3BQ2A 1FE8A 3RVOA 1NVWQ 4AMGA 4F5NA 1E2MA 1HLGA 2JAUA 2N46A 5FPKA 5DLQC 4ZYLA 2IOFA 1XGKA 2ECKA 3HACA 4EYSA 4RVGA 1Z63A 1I4EB 3K9CA 3ROPA 2B4AA 3WHLA 5HSGA 3OHMA 4L3OA 1ZMBA 1MT0A 5IJ0B 5HIMA 4Z4QA 1OT3A 3MJSA 2ZJFA 1L7EA 3HV2A 3E9MA 4XJTA 3JAKA 1XP5A 4Y1RA 4RZRA 4TTTS 3JVUA 4RQ1A 1IXSB 3TLZA 4WY2A 4IUCS 5ESRA 4BFLA 4X1IB 2AIRA 5C1IA 1WCIA 1KY5A 3IPXA 3QFRA 4M1MA 2YTZA 2R1VB 2DLCX 1DJNA 3WQHA 1R4MA 5MGBA 1YZQA 3C2MA 2FW8A 3L02A 3M1AA 3I01M 5DW0A 3MJDA 3AL2A 4I4LA 1IQ0A 2QSJA 4TMTA 4IS3A 4WE3A 4V1CA 1JL3A 3NBYC 1CQZA 2GZAA 2WABA 3AI2A 5J0SA 3GY0A 5J2TF 4X1IA 2RAFA 2YHAA 4WV3A 1SHJA 2NU8B 4YXWD 2PLAA 2IH2A 1T4CA 4M99A 3ECAA 4YRSA 5H8WA 3VKUA 2O0HA 2X13A 3GN2A 4YRFA 5IEJA 1ADJA 2QEQA 1X7XB 3O75A 3KOWA 5HK8A 5DTRA 1MQ8B 2YFKA 3JARA 4LQ4A 3W5JA 2KNJA 1LZKA 4KE9A 2B2XA 1IN6A 1R4NA 1RQRA 1CP2A 3FHCB 3EGWA 2NU8A 1T8PA 4TYWA 2HADA 1DBRA 2HFJA 5J2UA 2HMUA 1T4CB 1YZVA 3FROA 1TECE 2QD5A 3A6EA 3DL7A 1L7VC 2ARKA 1NVBA 3LVVA 1XL1A 4KAFA 1Z22A 2JNWA 3TVYA 4CQNA 3HEAA 2XOEA 3PFGA 2LM1A 4ADSG 2O0JA 3K1TA 3ULKA 3VX3A 1ZA2A 1ZQUA 4WN3A 4HLCA 3KKAC 2PIAA 1IHYA 3L40A 3RF6A 4CLXA 2FRDC 4CTMA 1H2YA 4AG6A 1UMBA 3QFHA 3I6IA 2Y93A 3CRQA 4CCYB 3Q8SB 2G1PA 4ZAVA 1T43A 1G5TA 4LDJA 2FDCA 1VPVA 1OWMA 2OLKA 3WU2U 2UYYA 4EPRA 4F3CA 4E14A 1U2GC 1E1RA 5DLYA 1W4BA 1SN7A 3NEYA 3IUNA 3H87A 2BMFA 3K0KA 5D1NA 5AK3A 1PT7A 2NTJA 2AFVA 4WXYB 3N8HA 1BCRB 5EP4A 2RGAA 3OICA 1P29A 2AJBA 1GGNA 2AEFA 2GFQA 4KK4A 3L7YA 5DTJA 1KP2A 2A5FA 2E2WA 3KAJA 4HR7A 1NXPA 1JI7A 2E6KA 3NOQA 3S68A 1MTZA 2EJWA 8ICPA 5KG3A 1Y3HA 2QY9A 2X2OA 5EI5A 1IEVA 2TYSB 2ZSDA 5EJ4A 1I7QB 1U45A 1TMYA 4IXDA 4UASA 3CX4A 3NORA 3T5KA 4PL1A 1YK1A 3MPUA 4RMJA 3L8MA 3VX4A 5J2IA 1DX9A 1RFLA 3K9WA 4CM4B 3O2JA 4UVHA 1ZM9A 2YUIA 3W79A 5EPOA 5HG0A 2D59A 3QUTA 5INTA 4LOJA 1X7WB 1XEWX 3LWLA 3OJOA 4IQTA 4MKHA 3WGVA 3T9BA 4KHZA 1A4UA 4QQFA 3V1YA 1VLBA 2HHWA 1BC5A 1CR1A 1KYIA 3DTYA 4C7ZA 1GPAA 1RXEA 1XEXB 3BOSA 4DLLA 3QKSB 4Q9KA 5LBIA 4G4SP 5K8LA 4G0NA 1RYMA 1ZONA 2RK6A 4RDXA 3C39A 4O4IB 3RF7A 2XMCA 4ED8A 2V98A 1Z2OX 1VLJA 1UFVA 3GGJA 3AIIA 2AVNA 3NEPX 1KI4A 4M0EA 1CJVC 3WIVA 4JN6B 1GDHA 3B1XA 2QTVB 4TUYF 5AOVA 2YVLA 2CLDX 2C0CA 5KQRA 1VLHA 2BEUA 2FLWA 4Y3UA 4CL0A 2F3TA 3N8KA 4D9FA 4DQ0A 2AG5A 4ZCTA 5J43A 4HDMB 5KTNA 1CYEA 4LJKA 1X2IA 1JLMA 1N36B 5CFMA 2IPOA 1NE7A 2ZIEA 1VRWA 3R41A 1QSLA 1P81A 2ZE6A 1E5LA 1N6NA 1NE2A 3WFJA 2KWIA 3CRRA 1OSNA 4FMCB 1WOMA 3UEOA 1U2GA 3ROTA 3U81A 4BFUA 2X4LA 4JLVA 4C0WA 4CJXA 3DE1X 3R3WA 1PBTA 5JV5A 4J4HA 3UFXB 1PDOA 1YGYA 3FD8A 4IOLA 1U47A 1P4GA 4OXIA 3FCSB 2BDPA 3IODA 1QGUA 2H8GA 4R8RA 1XRQA 5TMDA 4JP3A 4OJ6A 3N2KB 5DISB 2WUWE 5A6SA 4LZDA 4QXRA 1UEIA 1T8RA 3EFOB 4W9NA 1U04A 2E1PA 1LI4A 3GEMA 4CGZA 1UOPA 1XKLA 4HRAA 1GITA 2W2PA 1MA0A 4RQ4A 2IXAA 4ER7A 4PYJA 3COJA 3H8JA 5CUQA 2ZI4A 3TZ6A 4LX8A 3AO0B 3TJMA 3A26A 2CDCA 3REGA 1HEKA 2B7BA 3MHTA 2FR8A 1QIHA 4NATA 3MJCA 4LX0A 3UXEA 5JHHB 5K8CA 2H00A 5HS6A 5ICSA 1GPWB 2H9AA 3R0XA 3W1EA 2D00A 5BVHA 3B3GA 1KI6A 3RTBA 4ESEA 2WKPA 4EATA 2Y1KA 2YBDA 3UWPA 2SECE 4E21A 1GA1A 5HEKA 4ZCRA 3ACBA 3ZBTA 3WDMA 2XYQA 1IVYA 3WWZA 2J5XA 4C0QC 2BGTA 3GDGA 3I8XA 1NRJB 1KL7A 4FR0A 4J1NA 3R7BA 5KSWB 4MRPA 4CF5A 3SJ7A 1DPFA 1F1JA 1YJAA 2JXJA 3FWNA 4J0KA 1F3OA 3OTGA 4M1SA 4YJKA 2IZ6A 2Q62A 3I2FA 1Z7WA 3ENNA 2AQIA 3JD3A 1NXVA 4IHJF 4LJYA 3VRHA 2BMDA 4IWXA 3JAMA 3K0CA 5L53A 3TZLA 4HLUC 5CXXA 4DRYA 2QNRA 3H2JA 5AXCA 1FC0A 2OQVA 3Q2KA 3T38A 5FV4A 4IFTA 1XZIA 2H1WA 4KIGA 3Q8XB 4G8DA 4GX1A 3SI7A 4E11A 1C80A 3ICWA 4UQPA 1Z7GA 3RYHA 1RJDA 2HNBA 3B60A 2JANA 2WVHA 3F0TA 5CDGA 5HHTA 3GAFA 5K0TA 1AMUA 1ZK1A 1NKBA 1B2LA 3B3JA 1CF2O 4EB0A 4B9LA 4O3MA 4EHHA 1J90A 3NRJA 5I8WA 4FXOA 4XWAA 5BUSA 1PVDA 5LD2C 1IQRA 1GRQA 3HCBA 2DPIA 2R8PA 5DG7A 4GECA 4FHZA 4XQGA 5H59A 3CNNA 2PK3A 3FYSA 1ABFA 1A5BB 1R0BA 1HEIA 3BQMB 3FPBA 3IQFA 4MRRA 4MV1A 2JFNA 5COAA 2ZWIA 5KAPA 1WU8A 3KZ1E 4NLKA 4J94A 2DL0A 1XJQA 3INNA 3SHTA 2CNWD 3T35A 4E3WA 2ZI9A 3IFSA 5IM5A 1SQGA 4JI5B 4JUAA 3DEJA 5I7FA 4DWOA 3PNCA 1GL7A 1E9SA 2I8CA 2Q5HA 2ZE5A 3FPJA 4QDJA 3D7LA 3KKZA 1N0IA 4QGBA 2FSVC 3GFTA 2NVUB 4OHFA 2QL6A 3LA8A 1U4BA 1IG3A 5HX7A 2ZG6A 4ZI7A 5DASA 4RJIA 2EBHX 5EVCA 1P62B 1ZJWA 1NZFA 3DTVA 2QB0A 4FOPA 4EY8A 1XRJA 2A1IA 2NTEA 4RS3A 1RLUA 4TROA 4JL8A 3NRZA 3PVXA 1XIVA 4DTCA 2JLWA 5K8VA 1EXWA 2PYDA 2ZVQX 1ZQDA 2GCPA 4GZ3A 3CYFA 2WWFA 2I6FA 1V47A 3BK7A 1BRMA 3ZNPA 3BWXA 3PE4A 2QM3A 2NTNA 2P9GA 3EHDA 3WI7A 4ATNA 1VL0A 5LP1A 3SZ2A 1A1VA 2BDUA 3P27A 5T8KA 2FP4B 1VDVA 2R00C 3QYJA 3Q41A 3PSAA 5EN4A 5AT1A 3FN4A 2WW8A 2Y3IA 3Q1LA 1QGUB 1BN7A 1SBNE 4AWXA 4HMQA 1AG9A 4CM5A 1NVDA 1EZ4A 2ODBA 3ENQA 5BN3A 1AUVA 5F21A 3I64A 4DL2A 1N7IA 1W19A 4B83A 2JFUA 4QWCA 2O57A 3ZVLA 4ENRA 1IB6A 1WCV1 4I2CA 5KFOA 1YMVA 1ZK0A 4FCVA 2WJVA 2V0CA 4NE9A 4RK5A 4TTAA 5TGDA 3JD1A 4DMMA 4YMTA 5IH7A 1S9DA 2VJLA 1D4OA 3OESA 4ACBA 1YZ6A 2OXRA 2I22A 3IA7A 4UBIA 4IRXA 2P66A 1SUIA 2QQGA 3HBFA 3KLNA 5I4BA 3P9XA 2HU7A 2NACA 4WK2B 2VA9A 1ZH4A 3I39X 1EQAA 3BFXA 3C5WP 4HADA 4FIZA 4A9AA 1LKZA 3BZBA 2VDJA 2HU5A 4WNCA 1ZBQA 5F12A 5PGMA 3SG0A 3ZV6A 2PTHA 4G09A 1L5HB 2OZLB 3O8NA 2QU8A 4E12A 2NRXA 5K3AA 3TTXA 2C7VA 4C7MA 5K09A 4GPAA 1NP7A 3NIWA 1EX7A 2MYNA 2QKYA 2MHCA 3OFJA 3U7IA 5L3VA 3GZTB 4D3XA 5KG4A 1NZJA 2I4RA 2QWXA 4MOWA 1WF3A 3I2GA 4D9HA 2AR9A 4P32A 3WADA 4WGFA 16PKA 1S2DA 2YV1A 3GLRA 2XVZA 2XWJI 4Y7DA 4I6GA 3TG8A 4XVRA 3K09C 3VKHA 3OJSA 3MZ0A 5BRNA 2NSDA 4R65A 4QWEA 1KK2A 2YYYA 3DOCA 2OMKA 3KKOA 2R60A 3TS1A 2O4CA 4F1JA 2OK8A 3OF3A 2XIJA 2ZRIA 3L2OB 1F6BA 3P2KA 1X1SA 4XIJA 2VT7A 2R18A 4J4TA 4X64B 4F5DA 2JJ1D 1ZQZA 1OX4B 1T2NA 4C1BA 2PKQO 3OG9A 2WUVA 2IHBA 2IYOA 2AYZA 4PAWA 4QTZA 1OPRA 4ZO7A 4FZ5A 4RU9A 4WLVA 5EWFA 4CT4B 2R8GA 4EJ0A 4ZYYA 1ATIA 4JI4B 3V2GA 4DG9A 4KYIB 4PRLA 4LJ7A 4R2WA 5KFSA 5CGQB 5CVUA 1EUDB 4C2UA 1Z2NX 2REBA 3DHVA 4O4LF 3D6JA 4DSNA 4RMGA 3RYFB 3B1KA 3NKLA 5B4UA 1IAVA 2QUIA 4GYYA 3QUCA 4RK0A 2Y1OA 5TQ0B 4QFMA 3DLHA 1P9RA 4TS1A 2EWMA 3OFNA 3RKUA 2PVCA 3EVAA 4RQUA 2XITA 3M2TA 2ZULA 3FTQA 4MB2A 3KV1A 4CGYA 5EP3A 4R16A 2C3OA 2NVUA 4GQBA 1PG2A 1X92A 1Z7YA 2G08A 1UJBA 4NNJA 2PBFA 4Z4CA 3UJAA 4H6PA 3ANLA 3LH5A 1C7ZA 4HAXA 4HL6A 3DV2A 1Q44A 2BCQA 4R54A 3QGMA 1WZCA 1YDGA 4RE6A 4D44A 4HV4A 2ODTX 5JVDF 1JT2A 3KWMA 5AHKA 1USUA 5AK4A 2PUVA 1C9MA 1VP9A 1ZM3A 5SY9A 3UWMA 4OSOA 2OAQ1 2PX5A 1C7EA 1SD5A 4DLPA 4DMRA 4JB3A 4Z6CA 4QICA 4C8LA 4DW8A 3ZJ4A 2WF6A 2PD3A 1D2RA 1CUXA 1PG0A 5DT2A 1RMYA 3L07A 3TW0A 4H7IA 2HTEA 4BO0A 1DIBA 2XY4A 4MS1A 5F33A 2AFIE 1C0IA 1I5RA 2ZWVA 4YV7A 2VFAA 1QYWA 1V8FA 2H3VA 2ZYHA 4TKVB 2E3TA 3DCYA 1MRZA 2R48A 4B33A 5EWLA 4C0KA 4EG1A 5IX8A 1NY5A 5F3XB 3AJAA 5KTKA 2VRCD 2XE8A 1IK6A 2XNHA 4Y2QA 1WSWA 4MUJA 1NPYA 3KOXA 3OZAA 5IUNC 5KSYA 3NWBA 3A9RA 4DMLA 1LSJA 4U2KA 1SKRA 1F60A 1R8YA 1XTVA 2FEKA 3SN6A 2XD9A 1TTHA 1R16A 4EM6A 1ZGGA 3K9LA 1YO6A 3EF3A 4C5AA 1H5QA 3WLNA 3O94A 1CY2A 4KWEA 3N7PD 4B8YA 4DBVO 1ZINA 3GFGA 4KJZA 1XF1A 3IDSA 4EA8A 4F4JA 1RJ9A 1RWMA 3H2SA 4P0QB 1DBPA 4F4ZA 1ABEA 2X4GA 3ISJA 4K05A 4CUJA 2AK2A 3B89A 5IJ9A 3OIYA 1NW4A 3LIPA 2MDTA 2EFGA 5HS4A 1L7MA 3DZJA 1KKXA 1NJSA 1G3UA 2MSDB 2XODA 3X2EA 2PO7A 3AESB 1SXJA 5CMLA 5BSRA 4CLEA 1S89A 1DRWA 1SULA 2FUNB 2O5EA 3UK7A 4GVXA 1AKQA 2KSOA 4BVBA 2C99A 1XYYA 3B5JA 4KQFA 3OC6A 4OYLA 1M75A 3BIOA 4PO9A 4KSCA 2H4HA 4GXIA 1GCUA 2YWXA 1E9RA 3H9EO 4KNWA 1J8FA 2QJWA 3N07A 1X0VA 2ODAA 3IAEA 4L5CA 5AW2A 1ZQAA 2OKCA 3M6WA 1KDPA 1KFJB 1VCIA 4HS4A 2IUUA 5FEMA 1QYXA 2Z98A 3ZJVA 4YDSA 3L7NA 5CFPA 1YD7A 4V3BA 2H7YA 4FGUA 3NHRA 4W1RA 5CB4B 4WCFC 3STVA 2BHSA 3G9TA 3UPQA 5BW5A 2XXAA 4Q01A 5EL0A 3CF4A 1IUOA 2Q6OA 2FVXA 5I45A 1BE8A 2VA3A 1MAWA 6ABPA 3M6UA 4E46A 4M47A 2G5IB 4MEYA 5E79U 1O9HA 4HOYA 2ZTLA 3FCYA 3JQ8B 4KOAA 2FQ1A 4E15A 3KHLA 1R8QA 3SK0A 4MW7A 2HLHA 2YFQA 4AICA 3M3PA 2HTFA 2GK3A 2SCUA 2GN0A 4N5HX 4XYMA 1Q46A 4BQIA 4EHDA 3UANA 1HDEA 4Q4CA 5B1HA 2FWNA 4FUTA 4I3GA 1YB6A 2QM0A 1UM8A 5GONA 1KY2A 3U2QA 2NXJA 1JU3A 4WI1A 2EP8A 4K9QA 4XYBA 5NLLA 4UB8U 2MINB 2V7GA 1C7JA 2H1VA 2PGIA 4OSEA 4U6QA 4IQWA 1IOVA 4F96A 5JJLA 5CPBA 2RGNA 3V80A 4MW4A 3QX8A 3RIMA 2PMEA 5JPIA 1K06A 2ZSAA 4DSEA 4BEVA 3IV6A 3FNQA 4MCAA 4UAGA 1FLAA 5HF5A 2X1VA 4RVCA 4UBBA 4Z8YA 3FZNA 1SXJC 2FW1A 4E5PA 4OQMA 2POCA 1NVEA 2H4XA 2ATEA 4PGMA 2NGRA 2XVMA 2ZANA 3T7AA 5DB4A 5JMPA 2B99A 2P79A 3DT8A 3LT2A 4DSZA 4E7PA 2W2MA 4NXMB 2HHTA 4QWAA 1N9ZA 3HN6A 5D4BA 3JPNA 1RLJA 2RJ3A 4NWIA 4HRXA 1WRBA 3VPAA 4F4HA 2QUAA 2Q5EA 1NQOA 2REOA 3RCBA 4M9GA 3EMBA 5HFAA 1EP2B 3DLPX 3UVEA 3QVLA 3THWA 2C3PA 4AUEA 1UBRS 2HMSA 3BORA 3WGJA 2WA2A 2NO6A 2H1HA 3GCGA 3KJZA 5L95A 3OEED 1RAIA 2P0YA 3TLCA 4JL5A 3PW2A 1ISPA 1KC3A 4ETMA 1N34B 1S2NA 2WHPB 2XE4A 4B74A 5JCPA 4ZOCA 3T7RA 1M66A 1E6WA 4NZMA 4N8DA 4MVJA 4CEHB 4TTQA 4UUBA 2YRFA 1P2SA 1ZQYA 2R8EA 3GEBA 1ZP6A 2RB4A 3VU3A 3HBJA 5IYZA 4B47A 3IP7A 4P86A 1RI5A 3VO1A 5HYVA 2JFZA 5C5IA 1RABA 2VF2A 4H15A 2ATLA 1KEUA 3C29A 3MLAA 1VBMA 2WJHA 4G8BA 1TEZA 2HIHA 2UZ3A 4FYXA 4P1ZA 1ZNQO 3LF1A 3WGKA 4NCNA 4AMYA 1BJKA 4N3AA 1RPLA 2PWAA 1W46A 4Y1EA 5C81A 2P5YA 4DEZA 2R6R1 4MWTA 4D8UA 5CFRA 1RXVA 3EE6A 4LNUA 4FOTA 4O0MA 2FMTA 1RM5A 3HNPA 3W3AD 1E0KA 2R7LA 2LP4Y 3IUPA 4MB0A 5GJCA 1GTJ1 2JI4A 3AQIA 4RUKA 2L2QA 4WZAB 3AESA 3HX0A 1QOZA 1WDWB 2RGNC 5JDCC 3TACB 5AFSA 1RLTA 2AN3A 5DH9A 3BBPA 3GRPA 3M3DA 3UJ6A 3C3XA 1X1CA 3C7DB 4KFSA 4OOEA 2Y9UA 2GCOB 4BZZA 4DZRA 2R8ZA 2AKYA 1ZQRA 3MUNA 3ZE6A 1DNPA 4NJ8A 1XNSA 3A7EA 1N63A 5K0ZA 1MZPA 2UDPA 3RUCA 3K32A 1EGAA 3PJGA 4YMOA 2D7DA 2YIDA 4PZAA 3EUB2 1EGHA 2HUPA 3KHGA 1Z4QA 3O1HB 2BCEA 4QSMA 2VP0A 5LBTA 3HDQA 4L3WA 3QE4A 4CQLA 5B1EA 1E7SA 2K4HA 3GOHA 4UULA 3MVEA 2HREA 1XWLA 1BXKA 1LDNA 1I3OA 1ECCA 1ZY2A 4S12A 5K45A 1YAHA 3S7TA 5IW8A 3C3CA 2Q9CA 3VA7A 1Z8FA 3ESAA 5LSAA 5TR9A 4KIJA 4A0QA 4OYRA 3HE3A 2QTFA 4OK6A 3QMWA 4JB8A 5IHPA 1QP0A 3A4TA 2QTAA 2CDAA 1B74A 1F8FA 3D2AA 4BNMA 3VCBA 3C2LA 2QTCA 5J23A 1UZNA 3BDPA 3IVAA 2Y4NA 2VZ0A 1FYXA 3L4PA 3GCZA 3ZI7A 3ZWMA 1XRRA 4C87A 2NT3A 4DOBA 1XZEA 2FEMA 2GXSA 4BRZA 1Y9EA 1L4YA 5A2QA 3EIWA 4C3ZA 1IQUA 4KX3A 3SE0A 3G9UA 1X66A 1N8NA 2DPLA 2ZJ2A 3LO5A 2B92A 3PTZA 4TWJA 4H7KA 2MRLA 5AKEA 2QE6A 4Y9RA 3BRWA 3I04A 2VRWA 1NG9A 5L6MB 3N8DA 3G0DA 2Q2VA 2BKEA 3FVVA 1PE0A 1AA9A 1U8TA 5IXSA 3ZG6A 5KTRA 3A6PC 2PLFA 4AKHA 1XU4A 1U9YA 5H02A 1PNOA 2YVQA 4LMPA 4CZ2A 1Q84A 2WJ3A 4LHSA 5BQXA 4F91B 1RM6C 2FSPA 1GPUA 1XZMA 3O93A 5I9BA 7ICMA 2JHCA 1E6KA 2G7ZA 3ZOKA 4F12A 4W1QA 4U7TB 4HQOA 5IUJC 4XYGA 1E89A 3ZCSA 5DTIA 1L5UA 4FBTA 3B6EA 1JE1A 3B78A 1Q8KA 1JFFB 4CTKA 2Y1DA 1P0CA 1SG6A 5IRCD 4YR3A 2HM7A 4NK4A 4XDZA 3SJBA 4B46A 4GFDA 1YIAA 2IV2X 5BV7A 3ICXA 3JQFC 5I7SA 2KN7A 1D7OA 4AJPA 4YCLA 2LYHA 2XUOA 3BH7A 1FXWA 3GD5A 2HGZA 1LDYA 1OFIA 3KSMA 4GP9A 4PC2A 4UB1A 4W1PA 3RHTA 3ISTA 4I81A 5M2QA 3LLVA 1F9AA 4Z0NA 4JR0A 1T8UA 1XRSB 3NHJA 1N3IA 2CB9A 4EFKA 4AO6A 3V2UA 5D5HA 2YW9A 4AJ4A 4G23A 5KT7A 5GOZA 1MX3A 4K6MA 5C3UA 4ZZ1A 1B22A 3UWSA 1NX6A 4DFJA 3AV3A 3H40A 1CZHA 1Z5ZA 1ZKMA 1D2EA 3F3SA 3FPAA 3L0DA 4G5SA 2C03A 3KP1A 4NCXA 3CVWA 2E49A 3C3EA 4PVDA 5DPMA 5J2UB 3GEGA 2YV5A 4DMFA 4MW5A 1RPAA 4P0PB 4MX8A 2PUGA 4ESVA 3BMCA 4BO4A 2GVDC 4O5KA 5L1KA 4Q3KA 2YQ4A 5LPNA 2NXEA 1Q7BA 1YHYA 1LRKA 1Z82A 2V1XA 4XLLA 4MQ5A 1OT5A 1T6NA 4EW6A 4WN9B 4LF8B 3H0KA 2A5GA 3CZPA 4C0LA 5KG0A 1N2GA 3HN7A 4WKOA 4RM3A 4CDRA 3DKRA 5EJEA 3QHQA 3ZTWA 3RSGA 4XEHA 4E1AA 3ZY4A 3QU5A 4MV5A 1FDIA 3M33A 4TT3A 3LKDA 2QN2A 3ZLUA 1QS0B 4ZGGA 4RTJA 1S7GA 1BHSA 4ECAA 4IHJA 3WQRA 3LSTA 2QSUA 2Y6VA 821PA 1FB5A 3O92A 3TZQA 3HO1A 1M7HA 1LI7A 2FUG1 5FIUA 1NPDA 1VLLA 3PUIA 9ICCA 1FXSA 5ILQA 3UGTA 3DOJA 5LB4A 2O2DA 2OXTA 4IAOA 5D7BA 3I9JA 2CLFB 3DMHA 2FFBA 4IINA 2IYZA 2Q1XA 4HGQA 4JT4A 4L57A 5LD2B 3UUEA 1QTNA 2HPVA 4H7PA 3ZDZB 3ZDAA 1QBGA 1X1AA 3HXTA 4RL4A 3U3MA 3G7NA 1RKXA 1AQJA 5H83A 5HQJA 1T3LA 3KOOA 2JRLA 1UBGA 3PZRA 4EA6A 2C4TA 4M3NA 3OBIA 2Z1DA 3RRYA 1YC5A 1UC8A 4P7JA 2XZLA 4NV1A 3Q3HA 2MU1A 2KJ8A 4H3SA 4OM7A 1VIYA 1FUIA 2C5LA 4MVYA 4Q4AB 1YUNA 3S5UA 3DWFA 1ZNXA 1DC3A 3KQWA 4NNPA 1RMTA 1ZOPA 4NFHA 5E1BA 4EUNA 1P0FA 5LZ7A 3RIXA 2VEDA 1JHYA 2B94A 1B73A 5K9ZA 4L1KA 3FYUC 3PGXA 4N5MA 2FMIA 4WOCA 4O2BB 2AOTA 3DOEA 3V7YA 1KHTA 1PZHA 2QTHA 2ZLBA 1KK0A 3K1JA 4XUCA 3MCVA 1A9XB 1EFUA 1BU8A 3SAJA 1E8DA 5J0WA 4PQRA 4QNNA 2XUAA 4YUZA 2B3DA 4MB6A 2Q99A 4DV7B 3IIKA 3VISA 1I1OA 3AHCA 3D6NB 3DXFA 1UWCA 3DR3A 4JQCA 2MUTA 4L07A 2ZPTX 4AMUA 4YLGA 3TIGA 1HMYA 3UPDA 5IK2A 1ZAYA 1IUPA 5H16A 5JNSA 2YRXA 3DBOB 3M3HA 3M8RA 1O97C 2WAQF 2YL2A 1OC4A 1NHWA 2G04A 2R5WA 8ICVA 2G5PA 3HC7A 2INGX 3CNOA 3MFQA 1HKUA 3JASA 4E4RA 1J2NA 3FMOB 2OYRA 4M37A 3C1AA 1N2CA 5B30A 1RXYA 5F5LA 1Z33A 1H85A 1SUWA 1RM0A 4JKIA 3KQMA 3WJ2A 2V54A 3RVPA 1QDEA 3CE9A 4UMFA 3UXHA 1XROA 3TLBA 3TMYA 1BGXT 2WSMA 2PE5A 2XA2A 3WLQA 2WZQA 1XN4A 4YJ2F 1ZW1A 2IU3A 2VPZA 1NBOA 2H5XA 1R0LA 4K4HA 4XPIB 3RHZA 2YXPX 4GYKA 3UYLA 3IQDB 3EA5A 2NVWA 4QBHA 1IE3A 1K5GA 5TNXA 2DFVA 2VSNA 3FYTA 4WA8A 4RJKA 4OQLA 1PDWA 2PL9A 4CM8B 2KM1A 1M5TA 1DO8A 1X87A 3EZNA 3F3MA 3JV7A 4LVUA 4MW6A 5DN6A 6REQB 2DQSA 4NY1A 4RULA 3PUHA 2NU9A 1C29B 1C1HA 1E9FA 5J2JA 1OFGA 5E6SB 3IMEA 5IDYA 2XYRA 3EODA 5BOVA 4J0QA 4FMCF 3D43A 3HLKA 2PA3A 1QIJA 3NBUA 4FMDF 2V6BA 5FI3A 4U7DA 4OHOA 1GT6A 4CL2A 2ONZA 3P2MA 4ZXFA 2I87A 1WDMA 2D0IA 2F8MA 4L3VA 4U02A 1Z6YA 4HWPA 2FN7A 3PC8A 3PQ7A 3CG0A 2YB4A 3THYA 4DLSA 2X0RA 2YZ7A 4XLTA 1NJGA 4BWVA 3QOWA 3RUDA 1LK5A 1EG7A 1KQGA 1E4VA 2E1RA 4I4TA 4YMVA 3D3QA 5A5EA 3HTXA 1KETA 4JC0A 3GWGA 4PSUA 5C8YF 1N6HA 4YFYA 2P4QA 3CT4A 4AQ7A 1OXTA 1JAXA 4RTOA 1UJCA 1ODFA 2QNBA 2YHIB 1CZOA 4PGYA 3AYXB 4LOIA 1LBSA 4DQKA 4DOCA 2H11A 3Q8MA 1WB5A 4BPRA 4EGAA 3HQ4O 4JUCA 2RCYA 4YQEA 3RWOA 1FP7A 4R1PA 1IN1A 5JLAA 1E0AA 2VLBA 3SZ3A 1FNMA 4EB8A 4C4RA 4MJ7A 3IVCA 1E61A 3KR1A 2XY7A 1QV7A 2PX2A 3QF4A 1M1UA 3Q7IA 1NT4A 1KEJA 1UXOA 1Z25A 2A92A 3OCJA 4JYAB 2QIOA 3D0RA 5KU1A 4DSUA 1ENZA 5KDLA 3STTA 1L4BA 4LC0A 4BE4A 4RAQA 2JF0A 3C0KA 4BLRA 1W2HA 2FDRA 4NYIQ 4KLUA 3SE7A 3TI7A 3SJUA 3IX7A 1J33A 1B16A 3PYMA 1F8XA 1CJBA 5JWRA 1EFVB 2O3TA 2GHTA 3C7AA 3KDSE 3WL5A 1L5ZA 1G7RA 3SS7X 3WLFA 1IULA 4JSRA 2H5LA 3UATA 2IZOA 1SWVA 3BTOA 3TDNA 4BIMA 3SZOA 4CIXA 1XCMA 3WYCA 4YCMA 3PE6A 1EVLA 3LFTA 3W9BA 3U09A 1Z13A 3HBNA 3AF1A 3B3QA 3PDJA 1E2UA 1KVRA 4FKBA 4RPHA 1Q74A 3RC8A 5BMOA 1H2XA 2J0SA 1RAEA 2VDLB 3F9IA 1AHNA 1JMYA 1RIFA 2OG1A 3KVVA 2WB2A 3ZKAA 2BMVA 4OHCA 1CUIA 2G8LA 1ZITA 3RBEA 4C0XA 4WVLA 3RDPA 1KN5A 1Q0SA 4IKOA 1ORHA 5AVWA 5JLJA 3V8RA 1AKWA 4DCGA 3OOYA 2OYCA 4B4DA 3GP5A 4DQXA 4EMBA 1P1HA 3I6ZA 4FOOA 5CNMA 1Z7EA 4G9EA 3VOAA 1ZQ9A 1CZKA 3GELA 4L5YA 3H6KA 3KZCA 3TOZA 3WGYA 5H80A 3GFFA 1X70A 5J0XA 1FZQA 3HG7A 4QM6A 2RMKA 3DH0A 4C07A 3PWKA 3AVOA 4GWKA 3TIXB 4K0KB 1IRIA 1P17A 5I51A 2NU7A 3OFND 4XDHA 4CODB 4DLRA 2AK3A 3QOYA 3UHJA 4UD6A 3OO0A 4C6RA 4FWTA 2HJ9A 3A9SA 5DBAA 3B53X 3KOYA 4FT4A 4MUYA 4RJ2A 4V0MA 5FO1A 1HXHA 1OXUA 3HEBA 1QTRA 3KYCB 2C5SA 3K0AB 2CUTA 3LQRA 4NS1A 1KSGA 3AFMA 5BOSB 3CSUA 1R12A 2JEFA 2OVBA 1KDZA 1Q2UA 3PG5A 5FDFA 1RR6A 5EQFA 5EIXA 1U3CA 4ECSA 1Q3VA 3V5NA 1ZUWA 1NRIA 5HBGA 4CMBA 3RNLA 2ZTVA 1T4DA 1QH1B 2ZT6A 4FHEA 4K9PA 3ZLVA 4BNNA 4RY0A 4UNRA 1FW8A 1M1NB 4LZPA 2A14A 3QVTA 3V7WA 3EVEA 4D9BA 4BX9A 5KFCA 3DF7A 1ULAA 2WT4A 2ZRAA 4L6AA 1BJRE 3WQSB 5LZ8A 2GZ2A 3AF0A 2V74B 3HKDA 3CJQA 3GRCA 3UOGA 3WXBA 1I10A 3WYAA 5C7LO 4UTNA 4HNRA 3EWAA 3D2CA 2C3MA 4U5XA 4B4OA 1T2FA 2AHOB 1WEKA 1ZJZA 2C61A 5AW5A 1C7QA 2MSLA 1Y6RA 3WLMA 3THYB 4P3PA 4D2IA 3DBLA 3IKTA 1T5IA 4Q16A 3KZIU 2I2XB 1THTA 3WDSA 4TRMA 4OYHA 5ALRA 3M9NB 2YJ4A 5C46F 1E6MA 1AUXA 4LXYA 4F3OA 5FBQB 3TBKA 5DTEA 1QQ5A 4DF4A 4EFLA 3ZHRA 1OTYA 2H1IA 1JDUA 1Q17A 2WTAA 2X1MA 3FPSA 4GGOA 1BQ4A 4FOLA 5KJ1A 4GX2A 1SCNE 2AN4A 2EIHA 4OB8A 3FYCA 5ARBA 3FIJA 2LM4A 2WUDA 3GUVA 4PG5A 1AY0A 5DM1A 3AZQA 3M8KA 3CMMA 2GPYA 2QE7D 3D64A 3KB2A 4DYHA 2HA6A 5L40A 1EDDA 3O3MB 4K5QA 4P2HA 1M2OB 1K6IA 4IR1A 1PL8A 2E9SA 3AZOA 4XGIA 2BFEA 4TLCA 3OC0A 3ESBA 1T9DA 3E18A 3ALRA 1YR2A 4KXYA 1JTEA 3GIDA 1I51A 3HPOA 1Z39A 3AQFA 1Q22A 1TIKA 3AI3A 1KIAA 3IPLA 4MR9A 1GGJA 2IDZA 1WB4A 1L4FA 3C4QA 3HDTA 5DBBA 4O5EA 4HH3C 3KQHA 1JUDA 1IFXA 5K2MA 4C0SA 4IJ6A 3T5CA 3K6RA 4NAHA 3RTGA 4EWLA 1ONBA 4LXQA 1O0BA 4BWFB 1FS4A 3EG5A 2HF9A 4IP0A 5BVHB 3OGUA 2BZSA 2JZOA 4LJ5A 2IY8A 2KK0A 4R1UA 2V55B 3ZIDA 4LE0A 4DQPA 4NXNB 1XTZA 5FL7D 1SD2A 4XCQA 1ZS9A 2FKAA 3A11A 3WJ7A 4B6PA 5KKCA 2QVZX 1J8MF 3GK3A 1V8DA 1FFWA 4G84A 4KODA 5DHAA 3RRXA 1LPBB 1JVNA 1NMQA 2PJDA 3KPVA 3UJCA 2VAWA 1JPJA 5B12A 1WZNA 3CZAA 3T9DA 3L8EA 3F2BA 4ZJUA 2TMKA 3FLBA 3K53A 2FP3A 4P33A 1X13A 3ETRA 1NLYA 3ROKA 4HMOA 1MX5A 1EFKA 3K1AA 3NBMA 2REQA 2BGLA 3HYTA 4XH9B 1N3YA 4G0XA 1QVZA 1OUMA 1OX4A 1YRQA 3MILA 2EBWA 1UWKA 1VL5A 3UGQA 1EZZA 1JXQA 2EKZA 2C83A 4IJQA 3RF9A 1ZCAA 1W94A 3NVZA 2AZMA 1B0AA 3VPSA 3SENA 4C2BA 3RAXA 3V4SA 5BMVF 5KOJB 4OU4A 1XD2B 4QT0A 3UW1A 1Z5OA 1RWKA 2JZNA 3HCDA 3LP8A 4GKVA 4C20A 2UYCA 1P2DA 2Z6UA 4CG1A 1KZ1A 2FN4A 4PZLA 3H5LA 1TAMA 3VKVA 4YMHA 1WP4A 1HDOA 4II7A 3WYGA 2RE8A 1IDOA 1L5FA 3VVBA 2WFLB 5IKMA 1GQOA 2YINC 1HR0B 2E4ZA 4BMSA 1YOBA 1W8IA 3FCUB 1B8OA 1QKJA 1YRBA 1NQUA 2HRBA 3IAHA 5FBWB 4BV2A 4UB5A 1X0XA 3FUTA 3HWSA 2J59A 1MXFA 4YRNA 3SC6A 2X1HA 2XKKA 4GVLA 3GAMA 4PJ0U 1IXRC 1A4RA 2KB0A 4DQVA 2XCUA 3MQ2A 1UKBA 2A1AA 3CRVA 3MTQA 4GZ6A 2FN9A 3KWLA 3HSSA 1UR5A 2R4UA 4H6VA 4YXFA 2R8OA 5LOVB 1E2QA 1D5CA 4WKPA 3NOVA 4GBED 5F9MA 4CMIB 4D8YA 4DNPA 3MEQA 3EN0A 5BNFA 3WGLA 2W04A 4URWR 3BS5A 1LFDB 2FQXA 3WSWA 5BPHA 4TMXA 5FNVF 5A02A 3HKDB 4LJ4A 4F2DA 4URXR 1PTJA 2I6UA 1H9CA 4UZFA 1AKMA 1T6YA 4DA6A 5K6AA 2WFZA 3WLSA 4ZQBA 5DI9A 4V0ME 2QAIA 1C0PA 4NCBA 1A8UA 1GPJA 1NWCA 4UTXA 1EQUA 1NDUA 3OD1A 4S3MA 5E6RA 2V6FA 2HHUA 1CJUC 1PL0A 4UXIA 5TZVA 3A0BU 4ZOLB 2QR3A 2WG2A 3MTDA 4R9SA 5TX7A 3BB4A 2E21A 2GKGA 3QHPA 4CKXA 1QGAA 2JEYA 2PVPA 3TQTA 3VC7A 5IC5A 2JFGA 4L15A 3ECSA 4KL8S 1P7VA 4H7DA 4JLJA 3OCVA 4UHDA 3E2MA 2RAVA 1RP7A 4E2ZA 3MJEA 1EESA 1V97A 2RG1A 4MUIA 5TGZA 4GC6A 1PFQA 2AXPA 2DWOA 5L1MA 1ST2A 4M89A 2JFBA 1LA2A 4WXEA 2WMOB 4BX3A 1R8SA 2VYVD 1LV8A 3MIZA 5MN5A 1QB7A 1AN9A 5KFYA 2IH5A 2O8DA 2JPDA 2HHVA 4WNYA 2P9JA 4XR4A 3I92A 5JXJA 3RYCB 3NJRA 4CDNA 2VBCA 4I8XA 2J6CA 1C9EA 3LBIA 3PC3A 4YIHA 2J9YB 1P0QA 2ZBDA 2ILVA 1SXQA 5KUTA 1LC3A 4W7SA 5I5GA 1XZNA 3PMLA 2FGKA 4P3KA 5CJJA 1T3NA 5KNBA 1FSPA 1VECA 1KJYA 4JA0A 4XW2A 3M9LA 3RFUA 1LPMA 1QR2A 2H1FA 3W8RA 1TUGA 1SQSA 4JS0A 4KBGA 4Z4GA 2ZKIA 4BO8A 2PAFA 3EGOA 2AJLI 1PK9A 5ALSA 5C4GB 2GS9A 2WSSA 3K5HA 3NV7A 3WMGA 1WPGA 2PD4A 2R79A 4Y9TA 1EVYA 4M9NA 2NP7A 7ICLA 2CFTA 2PFOA 1P7ZA 1YBAA 3WIUA 4EX7A 5CX1A 1FBTA 2IUTA 1Z0KA 3T5GA 4BUCA 2DPHA 1WXEA 4JDUA 4XSGA 3DFUA 1TVMA 4P3OA 4M0LA 1TE2A 3T3DA 8ADHA 3DGFC 5EJ9A 4JV5B 1XTBA 4QSHA 1NQ5A 4PPGA 3EIEA 3OKFA 1Z5GA 1JNXX 1O87A 2IY7A 3GJYA 3ROGA 1CUEA 1ENYA 4G1VA 1EUQA 2QPTA 1ORIA 1RYDA 2GZ1A 1JH8A 2COEA 2ZB8A 4HEHA 3BK1A 4HNHA 3SWWA 4TZ0A 3R3YA 4OO3A 1U2EA 2X0NA 4DMHA 5K6RA 4BKQA 1EK6A 1Z5VA 4QU9A 1T4GA 2Q5OA 4RHYA 2ZZMA 4BJ1A 2RGYA 1XVLA 3BA6A 1LNZA 4LWOA 4YT8A 1E64A 1E79A 2I34A 1GZUA 3UYKA 3AVXA 4P9NA 4PSKA 1NBIA 2RAUA 4Z9YA 1MSWD 1WKBA 3DE5X 4PYKA 2WZDA 3CEPB 4GLOA 2PU7A 4N9QA 2UZIR 4ZDIA 1H1TA 3MM4A 4Q34A 1P2GA 2CBZA 2O8NA 2WM9B 4J6FA 1SUFA 2XRYA 4Q5IA 3O0FA 2ZBFA 3OU6A 1CUVA 1QLWA 1YUMA 2JAQA 2VP5A 3BERA 3QUBA 4W9NC 3UV3A 1DELA 4Z4EA 4NBWA 2DBZA 4C4OA 4RDCA 2K8CB 2H0RA 1NW3A 3AN1A 3ET4A 1M3SA 3NEAA 3TXAA 3X1ZA 5A3VA 4L8FA 8GPBA 1ZESA 3V8PA 4QPZA 3Q2IA 2WB1C 1ZMRA 3PQ8A 1ND6A 4BFWA 3OZVA 3E2EA 4UDOA 3OPYB 2FE1A 5KTTA 4I46A 3O90A 5BQFA 2XUZA 3JQEA 1KYXA 1RYNA 4NM1A 4I2FA 1ZBDA 3NTQA 5FADA 4B6QA 3SY8A 1OF1A 5BWBA 1MAVA 1ZH0A 2EAPA 1NSFA 3Q11A 2G6TA 5DNCA 5F2NA 1E1NA 3H8MA 5DV9A 5DTMA 4ETIA 4XVHA 1PKEA 5JOQA 3QXJA 2HHSA 4IDQA 2C92A 4PBTA 3UHAA 2PYZA 4Y6PA 3O9MA 4KQEA 3DV9A 2Q6LA 1JLSA 1VA5A 3BQ0A 4ROSA 5JR3A 1A2KC 2HO4A 5KMGA 2CVHA 3BGIA 1NWHA 1N6RA 1PQUA 1XZCA 2QQ5A 3OO1A 2QZ4A 3O47A 3OZSA 3ZWKA 4IDGA 3HXPA 3L49A 3GPCA 5AM3A 1KGDA 3QLUC 3PQ6A 3QXCA 1EFHA 3JPYA 4H0FA 4HDSA 4C2AA 1AQLA 3VR6A 2LD4A 5ECDA 4X91A 5B1SA 2E18A 1GTMA 1SZJG 1UJ6A 3VXKA 4XWYA 1CIJA 2ZS8A 4QHTA 4JSYA 5JARA 1PNTA 3LUKA 3ASUA 4YIKA 2PFKA 1UDRA 2FYTA 3NGXA 1PK3A 1L9KA 1YMUA 4Q12A 3MQFA 5FX2A 1XLTC 2WWYA 3PTAA 1GJRA 1QJCA 3ZE7A 2IT1A 2OC4A 2PSJA 3LKZA 4PLVA 1OGYA 3I2IA 4I1SA 4IO1A 3SKVA 5IIKA 5I01A 1JHXA 3H5AA 4DA9A 3N7RC 2W83A 1P3DA 5ILOA 2VQFB 2FPKA 2UZ1B 3QBTA 4X5VA 3BXEA 3JU3A 4NPCA 3NMUF 1YOVA 2UKDA 4Q7EA 1UMCA 2VUSA 4MROA 4ZEMA 1ICIA 1R7RA 4MVJD 3LQYA 2QROA 4U0KA 1FUYB 1ESEA 3FDJA 3HJNA 4UU8A 4B71A 4E2FA 5FWYA 3RADC 5IT9A 3HP7A 5GP1A 3OKCA 4LIPD 4OQXA 3AVYA 3AJRA 1NW8A 1SU8A 2DECA 2H54A 3EDQA 1JIVA 3C4JA 1QZZA 1ESDA 1LDEA 3C7CB 2H65A 3GT0A 3O21A 1YACA 3O8LA 3I4LA 2BKXA 2VNAA 5IT5A 3JZDA 3D6UA 3MT9A 1UFQA 3ZDXB 1VZ3A 3DO8A 1NR7A 1U2ZA 3T9FA 5HHIA 4EECA 4UM8B 2AZXA 3WHIA 1UBEA 4HF7A 3MRTA 4AN0A 4BVAA 2Z2ZA 3K6JA 5EEHA 3R3SA 1IWBB 2ZRBA 1RWWA 1QF7A 2IZ7A 3WZ2A 2YY6A 2I66A 5IVHA 4I1OA 4JLOA 1VYTA 3TLJA 3HWRA 2XNJA 3AIOA 1DQNA 4XE5A 2XCTB 4ED2A 1P2BA 3I9OA 5CLHA 4RTPA 5ALOA 5D3QA 1OIWA 1I8TA 1RRGA 4L9SA 1J0XO 1XMIA 1WHSA 2KX7A 3B1FA 1PNRA 3U6BA 2JGAA 5ALLA 1KS2A 4FP9A 5JSZA 1BMDA 4BNFA 1Z3IX 3LQ1A 2HSEA 2R00A 1EH5A 2AVDA 4CTJA 5DGIA 5TB5A 1AD2A 3QFSA 1P1JA 2FPGB 3W2IA 3H5VA 3WGMA 1NVUQ 5SZHB 3MSXA 5CBPA 1ZG3A 6Q21A 3BE8A 1Q14A 2BDTA 3AHFA 2WLSA 1XK6A 3EDMA 1P31A 1VIDA 5EFZA 5IXJA 3ISDA 2G07A 4S1OA 2PKXA 4ZPJA 4CV3A 5JSZB 3RJGA 3ESRA 1ZD3A 4RZ3A 4Z9BA 4NOMA 5DQGA 1OXKB 4LDNA 4EZEA 2GXAA 5DW3A 2ZXHA 3OLCX 1H8ED 4D43A 1PS9A 1WZ2A 4LVCA 1G66A 3PIRA 4D8XA 2Q6VA 3FGPA 5FUVA 2WJWA 4UXHA 3UAYA 1DRUA 3WBFA 2ZM5A 1KJ8A 8ICUA 2ZBRA 2PFNA 4Y2RA 3LUHA 3RTEA 1NOKA 3S40A 2OH2A 1KNQA 2HL6A 2JFYA 3NUGA 2RBKA 3U3DA 3G6KA 1QQ6A 3QG5A 5DFAA 3M5DA 1E9EA 1JLLA 2X8WA 4U8HA 2HCJB 5I7VA 2X58A 2DVMA 1Q19A 1O5OA 2QVLA 1A5TA 4OQYA 2VJ5A 2HOFA 5EMMA 2YUTA 4FGZA 3NWPA 1EM8B 3T9CA 3UJ9A 2I67A 1R9MA 4DJEC 1D6SA 1GPLA 4CF7A 3UG7A 3FFAA 1ZMOA 1Y1LA 5CTJA