3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Isomerase
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
1Z4IA 3QLEA 5ALPA 5ALUA 2P69A 4OHFA 1RMTA 5AVZA 3FM9A 3CNHA 4C4SA 3FZQA 4AS3A 1AQ6A 2ZG6A 3KBBA 4KNVA 3SLRA 2I6XA 3KC2A 3OCVA 4DCCA 2JARA 4DWOA 3W5AA 2R8YA 4Y2VA 2PR7A 5ALXA 1RKQA 3WK6A 3DNPA 3L8EA 4IG4A 4GIBA 3KDPA 5ALZA 5AVYA 5AVWA 4Y2SA 4OD0A 4Y3UA 3A1EA 3GYGA 1Z4PX 1Z4OA 1L7OA 3L1UA 3E8MA 2YJ3A 1U02A 3I28A 3I76A 3N07A 3WK8A 3MMZA 2NO5A 4JDPA 1YV9A 2B30A 5ALLA 5ALWA 3UM9A 2BDUA 4FYPA 5ALRA 2AGVA 3QXGA 3ET5A 3M9LA 1S8OA 3ZX4A 4BNDB 4EZEA 5ALTA 2I7DA 4I9FA 4UMDA 2CFTA 3WKEA 4CNQA 3WKCA 3NUQA 4UASA 5AI4A 4HGPA 2NYVA 4G9BA 3OTQA 4F71A 2IYEA 3AR6A 3E84A 3QU4A 2ZOSA 4CF3A 4HGNA 2D2VA 1TJ4A 4XE5A 2PKEA 2G09A 4E88A 1ZRMA 2HF7A 2ZXEA 4UMFA 2P27A 2RBKA 2VKQA 1VJ5A 5ALQA 4BNDA 4DFDA 2C4NA 1JUDA 2W11A 5AVQA 1MH9A 2G0AA 4QQFA 1WR8A 5E0OA 1N9KA 2G80A 4BX3A 2HI0A 4UU1A 2P11A 4AS2A 1RLTA 3ZWKA 5ALHA 5ALGA 1IWOA 3I1YA 1Z4QA 1XVIA 1XP5A 3ESRA 3K1ZA 2EARA 1EK1A 3OCZA 3NAMA 1LVHA 2FUCA 4B6JA 1EK2A 5AESA 1Q91A 5AM5A 1Z4KA 3FGOA 4IFTA 2WF5A 1SU4A 2FPXA 2OBBA 1RC8A 3QU5A 2AMYA 4EELA 1QQ6A 5AICA 5ALEA 1YMQA 5AIBA 3R4CA 3AR8A 3PCTA 3QUQA 3R09A 1RKUA 2ODAA 3J7TA 2YN4A 2IA5A 2FI1A 5ALSA 2MU1A 4G63A 5AVRA 3QU7A 4JB3A 2YJ4A 1K1EA 2ZBGA 2OYCA 5FP0A 3OCWA 4QJBA 5IT4A 1Z88A 5JJBA 2YMQA 5ALVA 3SD7A 3PDWA 4UM7A 1T5TA 3WKBA 3NANA 3F9RA 2GMWA 1WPGA 1L8LA 3NRJA 3HYCA 4L6CA 3A1DA 2YJ6A 1F5SA 1RQLA 5AHXA 1U2TA 5A3SA 4H1WA 3ZTYA 5AVTA 4MWOA 3IB6A 3NASA 1RLOA 2CFRA 4ZEXA 5AW7A 5AKYA 2CN1A 3N1UA 2PQ0A 3W5CA 1J97A 3ZX5A 3U7GA 4J2TA 5AW2A 4NFLA 2EATA 1VJRA 4BX2A 3A3YA 5AW9A 1TJ5A 2C9MA 3QYPA 3KD3A 3BWVA 5AK4A 2GHTA 3ZVNA 1YDFA 3SKYA 5AK5A 3UMCA 2WF7A 2WF8A 3ZI4A 4ZEVA 2MSNA 4YCNA 4Y2UA 3KOOA 4HGOA 1U2SA 3AR5A 3IRUA 5AW6A 2B1QA 3U7HB 1YJ5A 5AKEA 2ZBEA 3PGVA 5AM4A 4EENA 2OM6A 4RESA 3U13A 2HEGA 1CR6A 3DV9A 4YIHA 5IS2A 4Y2QA 3L0BA 3N5KA 4FFDA 4C4RA 2I55A 2W43A 3FVVA 5AK3A 4EEKA 1LTQA 3L0YA 4NWIA 4UMEA 3U7FB 1T9ZA 5T41A 3QUCA 2B0CA 1ZD3A 1RLMA 1Z4JA 3EF1A 3L0CA 4XPZA 3UMBA 5AIAA 4CF4A 2HHLA 4BYGA 3WK7A 2C88A 5ALNA 3N28A 4NAVA 1X42A 5AW8A 2G06A 3RF6A 4Y2TA 2GHQA 4PNHA 1RDFA 1L8OA 1RKVA 2HDOA 3WKAA 1NRWA 3NIWA 3UMGA 3E81A 3ZU6A 2B8JA 2G07A 1SWWA 4FE3A 4KX5A 4Y2JA 3W5BA 1WVIA 4AP9A 4Y2PA 4CF5A 1KYTA 3QU9A 4UARA 3MC1A 3PGLA 3E58A 3L5KA 3TLMA 2R8EA 2I33A 4OFZA 3EPRA 5AW4A 5ALKA 2HF2A 2IOFK 3L8HA 3ZWDA 5A3RA 2YMLA 4BKMA 2YFYA 4CE6A 2RB5A 3SMVA 3KZXA 4MUMA 2YMMA 4Y2YA 2FEAA 3OCYA 3AR9A 4O8CA 3QU2A 1L6RA 2HCFA 4UAVA 2MU2A 2R8ZA 2BDEA 3U19A 3U26A 2G1AA 2HO4A 1O03A 1ZOLA 1Q92A 2FDRA 4XOUA 1T5SA 2FPWA 1SWVA 1Z5UA 3OCXA 2AH5A 4HGRA 4KN8A 3R9KA 3B8EA 2FPUA 2O2XA 4I9GA 4J03A 1ZS9A 1RMYA 2IOHA 5ALYA 1YNSA 1YS9A 4YIKA 1RRCA 2B1RA 3B9BA 4RETA 1FEZA 5AW3A 5ALMA 5AI8A 1QH9A 4KX3A 4YCMA 5AW0A 3WK9A 5ALOA 4UM5A 5A3QA 3SHQA 5AK6A 1ZD5A 3EWIA 4KYTA 2RARA 2JAOA 3AR4A 1VFPA 5AI0A 3AR3A 4HYTA 2QLTA 2P9JA 4L57A 2FPSA 1RQNA 3ET4A 4OCZA 2WHEA 5AKJA 3ZVLA 3HLTA 5AVSA 3B9RA 1CQZA 1Z5GA 2HX1A 3D6JA 5AM0A 4F72A 2NO4A 2YJ5A 2C8KA 3L8FA 3FPBA 2HSZA 4HAIA 1Y8AA 5AM3A 2R8XA 4YH1A 5ALIA 4YGYA 1U7PA 2JAWA 4NABA 3WK4A 2G08A 4KNWA 5AI6A 3QX7A 4DW8A 2AUTA 1NF2A 4C4TA 5AKGA 2Q4RA 4BX0A 1L7MA 5AVUA 3SF0A 1N8NA 1L7NA 3ZTWA 3U7EB 4UMVA 4L6AA 3WGVA 4BEWA 2OA0A 2I54A 2ZBDA 1Z4MA 3I6BA 5IT0A 3VAYA 1O08A 3QUTA 5AKXA 3S6JA 3ZVMA 2YMPA 4BEVA 1ZRNA 3OPXA 4Y2RA 5AW1A 1J8DA 1TE2A 2Q4TA 2B82A 2Q5EA 1TJ3A 3P96A 3L8GA 2RAVA 1NNLA 5ALFA 3ZW7A 3ONNA 3RFUA 4UAUA 2WF6A 1QQ5A 3A1CA 3DAOA 3W5DA 2YY6A 5AM2A 3NALA 4YCLA 3N8GA 3CZ4A 2WF9A 4GXTA 3EF0A 4UU0A 5AKIA 2DQSA 3MN1A 3SKXA 5AW5A 3WK5A 3QGMA 1L7PA 5ALJA 4XQ0A 1S2OA 5AKLA 2I34A 4UATA 4NV0A 3AR7A 5AVVA 2GO7A 4BBJA 1TA0A 3WKDA 1XPJA 1WZCA 2EAUA 2WM8A 3QNMA 1Z4NA 2BY4A 5AI5A 1ZD4A 2FUEA 4UW9A 1PW5A 2W4MA 4EX6A 2C8LA 2B8EA 2JAUA 2X4DA 3MPOA 3WGUA 2HOQA 3AR2A 4Y2XA 2CFSA 5AVXA 2QYHA 4ZEWA 3L7YA 2IOFA 2YBDA 3FPSA 3ZUPA 3DDHA 4HGQA 5AKKA 2O9JA 5AKHA 2ZBFA 5ALDA 3ED5A 1ZD2P 2WFAA 1RMQA 1U7OA 2JGAA 3L1VA 3ESQA 1ZJJA 5AI9A 5AKZA 3OCUA 1RPZA 2GFHA 3QUBA 2FPRA 1QYIA 4EX7A 1QQ7A 3M1YA 1Z4LA 5AM1A 3IJ5A 3BA6A
chains in the Genus database with same CATH superfamily
4DT1A 3C1UA 3Q0EA 4ND4A 2QL7A 3CNHA 4UEWA 3RC1A 2NU9B 4ND1A 4CM6A 5C31A 2JGRA 1SZHA 1NXPA 1WDWB 3NIBA 2IWHA 1ZLXA 2VHJA 4B47A 3FHTA 4ARIA 4BKQA 5HNKA 3S8MA 1J06A 1KJWA 3BM5A 4NVRA 3EBLA 1BS1A 3NU1A 3H1EA 3M83A 1ODKA 3Q2OA 3K0BA 4Q03A 3WKCA 2LCFA 7ICEA 4EY6A 2I0FA 1TCBA 4E0BA 2QRQA 2Z5FA 4D2IA 5MHTA 5JJKA 3EYWA 4J94A 4KRXA 3W6PA 2FOLA 5TXGA 1DQPA 1IM4A 1LVUA 5CLLA 2RHFA 4Q3CA 4DL2A 1MD9A 2O20A 4E21A 4FGJA 2EARA 2W04A 3N8HA 4CIVA 5HXAA 3QLJA 3FCCA 1I6LA 4B73A 4Y0VA 4IILA 4C0LA 1FYFA 3MXOA 4XJTA 5BW5A 4ZDIA 1V97A 1H1DA 3RIEA 4BTEA 1E9AA 4LC1A 1GNPA 4UEQA 1HIWA 1J9ZA 4KO4S 4RGVA 2BQ3A 2EJCA 1YJQA 4GPIB 4G5YA 4HMPA 4BNJA 3Q7IA 1R4NA 3CLTD 4C0ZA 4PO9A 2VCHA 5KYVA 4FQ7A 2Y67A 1IY9A 3N0RA 1NE7A 4IZOA 4HLUA 1AHPA 1X6JA 2D2IA 2PRIA 1OAOA 2D3WA 1G3RA 1TEVA 3D7RA 3KQTA 3GUHA 1T0BA 1SJ9A 4W5RA 2XODA 1OLSA 4BMCA 3SWWA 2JVIA 2XTAA 3T5PA 4YRBA 3EF1A 1XZEA 4HPJB 4OBWA 4AUEA 2I2CA 2B6NA 3VJRA 1RDFA 3A4MA 3MMNA 4LWZA 3B52X 4LNUA 3AVXA 2CHQA 4X1YA 3FLAA 1Q83A 5HCUA 2IH2A 4FFWA 3ZD8A 1YOBA 4I0WB 4LEIA 2MDTA 2REXB 2W9CA 2GBLA 1IAQA 3EC2A 3NEPX 4I66A 3RAPR 4RNDB 1NK0A 1SL0A 1XHEA 1RSZA 4BVFA 2WWYA 4C0AC 1ZCBA 2DQZA 3SYZA 1PT8A 4X8LA 5ERGB 3TW8A 4FGUA 4X44A 5HX7A 3DFKA 2CMDA 5FPPA 4ZI7F 4B2LA 5CJPA 3DVRX 9ABPA 1ZVJA 3WFZA 5ERYA 4MQEB 2WAQF 3CR8A 4GYKA 1M2FA 1R8JA 1VL6A 3GFSA 2PH3A 2XUIA 1Y6GA 1ZN2A 4MA5A 4TKZA 4KXLA 3ZE2B 2BCGY 3OOSA 5EXTA 3ALRA 2Q45A 4RMNA 3IHLA 3IOCA 1JFTA 4C5BA 5JQWA 3L6CA 4MYCA 4D3FA 4D0NA 2J6SA 2J9ZB 3ACCA 4IO1A 3P0EA 3TECE 3GFFA 3NTOA 1K6EA 3M0EA 4ILEA 2HRRA 1TFUA 4JP8A 3E2IA 3HBJA 3N8GA 3H86A 5GV8A 5IUNC 4RQ7A 2KS6A 1ORWA 4RE6A 4N3AA 5EJFA 5FTMA 4C0WA 5ER6A 1PO7A 3QWHA 4IIHA 2WM8A 1E2UA 1L5KA 2QX7A 3JS5A 2O0KA 1NRXA 3NBYC 4Q9KA 1X8KA 1QJCA 4D9KA 1CJUC 4JLPA 3NWPA 2XE4A 4B6QA 3WMWA 2UAGA 1ONBA 2XT0A 1X77A 4PSDA 3SNHA 1XEFA 3T61A 1I5OA 5JSFA 5A62A 2GEUA 3C41J 3RC9A 4AT1A 3VPHA 1SKYB 4F04A 3B53X 4RVCA 1CJVC 4BQNA 4RVOA 5F9HA 2D00A 5LQCA 1UPXA 3RDPA 3X1JA 3V8MA 2ZT7A 1XL1A 3RS5A 5EJ8A 1I7LA 3U9TA 4DJEC 3H2IA 1LJLA 1Z00B 1IB0A 5KG6A 1MO4A 2RHJA 1GAQA 3DO6A 1SEPA 1W96A 5HWSA 4X5OA 3SEIA 2PGIA 2O0JA 3OTQA 3I9V1 4FZJA 2YZNA 4K86A 2WWXA 3O8CA 5HUQA 3IIJA 3HBNA 3WDKA 2GPAA 4NYIR 3KALA 1W0KD 4MYSA 4BNDA 5K01A 5HDBB 4EW3A 2VJQA 4Z4EA 2PUTA 4RPYA 2IS2A 4MB2A 4IJQA 1XP5A 4P1ZA 1X38A 5FBLB 2P6PA 3PNYA 1CX9B 3SFTA 3HA3A 1H66A 2FG7C 1A5SB 4QTZA 1W0KA 4FYJA 5AIBA 2PJZA 1Z2PX 3JASA 4M60A 4TTIA 3CUYA 4XOIA 3EGCA 7MDHA 3MABA 3HCAA 4DADA 2C84A 2KKPA 1P3JA 3LV8A 1TK8A 1TCUA 4TM7A 3AP2A 1Z7YA 3SAFA 4FYMA 1ZMOA 2CT8A 1B8NA 1ZQHA 1TAMA 4MW5A 4DA4A 4NARA 3DEKA 4JLJA 1Z08A 1ONOA 2H7VA 1LBEA 3T5HA 3WLFA 3ONDA 4PYQA 4XX0A 4R3WA 3DMRA 4Q05A 3FPGA 8GPBA 3VTAA 2BEWB 3EPGA 3TFWA 3FUTA 5B6IA 3TR5A 4BNMA 4AZ0A 3PNQA 5B64A 3DKIA 4QG3A 4HEJA 4QHSA 2JFVA 2QMUA 1WXHA 4KN9S 1EXNA 1M72A 1SIOA 5BVHA 4KYVA 4DWWA 3W05A 3CV3A 3VZCA 3WOHA 1WPRA 4OGFA 4JK1A 1GKLA 4I8XA 4UTNA 4NNJA 2Q3BA 4LXTA 4XVQA 3DBHB 3O3MB 5H4HA 3ZI7A 4OA8A 5AXBA 4BFSA 3V7JA 4DBVO 1EFDN 1WWUA 2IYLD 3DEJA 5DHQA 4S0ZA 5IWCA 1M1NB 4PHDA 2FR0A 4B46A 1J7KA 2ST1A 6REQA 2W90A 1QH9A 3PV0A 4P38A 4KUHA 4ER6A 2VTDA 2PXCA 2V4QA 1C9EA 2WHYA 3ET4A 1VL5A 5BN3A 4FMBB 3FSEA 1LV7A 4KFCA 1KWKA 2C8KA 1Y8AA 1C1YA 1P0FA 2O2ZA 3MUFA 2UUCB 5ALIA 1YH3A 2LHTA 3UHFA 4W82A 3HB5X 1F5NA 1QRSA 1KSFX 4C4TA 3HU2A 5AVUA 2C4KA 3ENZA 1Y6QA 3N2GA 4R9RA 3CH5A 5B1DA 1Q19A 5K1ZA 3FHOA 5HKAA 4OB6A 5E38A 2FVYA 5JXIA 1E6UA 5BPFA 2Q1SA 5CCDA 3H8WA 2FXVA 3GJ6A 4FSHA 1NUUA 3CZ4A 1QGUB 3NT2A 1GR0A 1L5GB 3LUJA 1K2VN 1QGZA 1H0RA 4EO7A 2UYOA 3E7FA 4PX9A 2BJHA 5HM8A 4YRCA 3FTEA 1BKDR 2QLJA 4JYAB 4S35A 2QUKA 2M0NA 3LHKA 2W7PA 4YRFA 1DG9A 4IXTA 4QUIA 4H0NA 3L8YA 5BMVA 2BJVA 3A1WA 3OCJA 4QT4A 1DAIA 1DAKA 1E1MA 4G26A 4KODA 2V4MA 4JB8A 7YASA 3JQ6A 3E5MA 1E0SA 1N0IA 5EZ6B 3OUTA 3LCUA 2YVUA 1Q0ZA 3W9BA 2CPRA 1OCEA 2XT6A 2RGYA 1JXQA 3RTEA 3OQNA 5C1PA 4L5CA 5L3QB 5C5JA 4EAQA 4PNEA 2YV1A 1IHDA 5AVWA 2VHQA 4BRSA 4DJ5X 5J0OA 1N0WA 1UBEA 2CHFA 4RCYA 1F20A 3T4PA 1PR2A 3ICVA 2Q49A 4LY3A 1EGQA 3UM9A 3SS9X 5CB8A 4RD4A 4FOLA 1EXVA 1WCWA 1KYXA 3T1NA 1PJQA 2I66A 2PVCA 3BMQB 4A2WA 1OBVA 2C2BA 1GQ2A 5JYEA 5EJAA 3QXCA 4ZH4A 4DJDC 2G80A 2BMEA 2H4WA 4OQDA 3CT6A 2XY5A 4JFRA 4ZYLA 3EIEA 3COSA 4F1WA 3GFVA 2R5FA 4RVFA 1C30A 1Z25A 5EZSA 5EPEA 4F3OA 5FNVB 1H23A 4L4YA 2VK8A 4LF8B 4L9AA 4EGSA 1ABFA 3MAJA 2WU4A 2O3UA 2WOJA 1NJZA 1PT7A 4LF5B 3TOSA 3B36A 4YMGA 2XDQB 2AXQA 3LVVA 4KKVA 4WBNA 2NQ8A 2I4OA 2H2GA 2X0KA 2C28A 1NVMB 4K6FA 3F4LA 2PUEA 3L07A 1JF8A 1F38A 2E87A 1DQZA 1CERA 1VIMA 4PTZA 4TS4A 2IOQA 4M38A 1HF3A 4G9GA 1V71A 1YAJA 4ZCMA 3NM6B 3GDXA 1UJ6A 5HTKA 4C8KA 5IMBA 3KVNA 3N59A 2WAAA 3MJCA 3TTSA 2BKVA 2FE1A 4KVAA 3QPWA 4TKVB 4I2HA 1R66A 5L3RA 3UVEA 2FWBA 2Z8XA 1FFHA 4I55B 1SUIA 3MGGA 5IXJA 2DU8A 4CEJB 1A9XB 4NHEA 3JQGB 1JXOA 3ESAA 3T1QA 3HGQA 5A3RA 1CUKA 2FPIB 3SHTA 4DNPA 5BQXA 2YFYA 4Y1RB 4DYHA 1EXWA 2ATIA 4Z9YA 4GX2A 3QITA 1JDPA 3PX7A 5T4HA 3QZ8A 2FPWA 1PR6A 2WAQC 4AIRA 2E9SA 3CONA 1SL2A 1TZMA 4OJ6A 4B17A 2PX3A 4L0CA 1JFLA 3F5QA 3FHJA 2FOXA 1W88B 5AXDA 4ZT3A 5C0YA 4M0UA 1SKAA 2FW8A 2FCRA 4G89A 4QBTA 1U1IA 3ETJA 3U3RA 5B1IA 2W9XA 1SCQA 3NM4A 4RDIA 2GF2A 1ULBA 2WSMA 4QO7A 3F5EA 5LJIA 3QWBA 1NX9A 3DE5X 3I8SA 3DEIA 3VXKA 3T9DA 3R3VA 1ZGCA 1DLIA 3KKAC 3BB1A 3VAYA 1T1JA 2PUAA 2P9GA 2FMHA 1IMOA 1LLQA 3CZRA 3D2CA 3QVKA 1VSBA 2EZ9A 3UPDA 1Q7GA 2TMDA 1QU3A 3H9EO 5EXSA 2HU5A 3ZBUA 4OGWA 3MUEA 2KBEA 2BZFA 1RAHA 1GPUA 2D1QA 4K2HA 3FUVA 5LP6A 1TC1A 4KLUA 1NR1A 1Z0UA 1A8HA 1O9BA 5MDHA 1PFYA 721PA 1X6VA 2HOFA 3H4MA 2I8CA 5EHGA 1ZCZA 2J3EA 3M1AA 3RV4A 1ECCA 4BB9A 2X1VA 3ONWA 3ZW9A 1TKAA 4KI0A 5JNVA 4RIIA 4W5OA 4D9CA 3F1KA 4PLVA 2IF2A 3NXKA 1YS6A 2A94A 1WPXA 3V8RA 4IRDA 5ALPA 4IJ5A 3O3CA 3TRJA 1TKBA 3H18A 3MWGA 2OD2A 5DRYA 4CT4B 1ZMTA 4MMYB 2XEDA 3GJ5A 3JPOA 2ZLBA 4WOJA 5ALXA 2WWIA 5F12A 1QIFA 4I36A 4OXKA 4P3KA 3F4KA 1AZSC 3FOAA 2R11A 1ZY2A 1NSTA 1WQ1R 2OENG 4MKGA 3EMBA 4RMJA 2QOEA 4L3OA 3UXYA 2HD4A 2B7BA 9ICLA 4AZWA 4TLBA 4ON9A 1V9SA 4ZO7A 1SUFA 1EIZA 3K2BA 1FNMA 2K4HA 3K1AA 4LMAA 4NCIA 3VC7A 1TLFA 4QBHA 1W5AA 3UEOA 4AUNA 1DOQA 2WSBA 5FWYB 1BPEA 1HKHA 4WXRA 4AS2A 4F46A 5EC8A 2GBIA 3THOA 1QRDA 4DWJA 1U8XX 3GFQA 4PQYA 5HKOA 4BAGA 2JK1A 2VG8A 3J80A 2QMEA 5HPYB 4N49A 4EWLA 2VKTA 2BCVA 4F60A 2FLLA 3E0XA 4UAGA 4KLGA 3T3FA 3WL8A 2OCEA 3G9XA 3UN1A 4KQ9A 2R84A 4CLOB 1D1QA 4S1PA 3HEBA 3I45A 4Q02A 5BW8A 1KIFA 3IUYA 4OXQA 3W9UA 1AMUA 1X7XB 3VR6D 1C50A 1SKUA 3S0JA 3TXYA 4V1CI 1BXKA 5CDFE 5AYVA 5JI3E 3QBDA 5BWOA 1U2SA 5AQ1A 1PX2A 3ZV6A 1K8ZB 1LLUA 4KIFA 4RNOA 3BMNB 3O2JA 8ICUA 1Y80A 4X6UA 2LKCA 3FLMA 1LY1A 4XIFA 3VR6A 2IA6A 2ZANA 9ICGA 2AN9A 3R77A 4I50B 1G2OA 2HMXA 2W9BA 4B6SA 1PDOA 1JZQA 2OC9A 3PVCA 4F4UA 3LY9A 4EUEA 4U6QA 1IIBA 5CEFA 3HLKA 4UCWA 3E58A 4E08A 1N56A 5KTMA 4YR9A 1UXOA 3Q11A 2BFFB 2V9PA 4OJTA 3G85A 5KYXA 3OQIB 3VSCA 1QV9A 2GA9A 3M8KA 1UJ4A 2ZB3A 3ZVRA 4RLQA 1YB2A 4PWYA 4YUVA 2ZAOA 4J0EA 2B69A 4FHEA 3FKSD 2EANA 3KKPA 1NKBA 3WDMA 3IXLA 3L8DA 1PTJC 3OIDA 1IQ0A 1U0JA 3ZCQA 4N5DA 5AW3A 4UM5A 2NVWA 3DO8A 4G85A 3ESDA 1N7HA 3CIOA 3QRWA 3FKSA 4BV9A 2WVHA 4KDRA 4HNGA 5IG2A 4XVUA 4O0MA 3DDCA 5FCDA 1IV8A 2Z43A 3L7KA 4WZBA 3O2SB 1QTQA 3AKYA 2PUCA 1KF0A 4LYYA 2VCYA 2Q4EA 5C4IA 2O07A 2E5WA 4C87A 3QVTA 3C3MA 1NLZA 4EJSB 4I29A 4C30A 4O8ZA 1EUQA 1V6SA 4KVGA 3L8GA 4JLSA 1Q1QA 4L76A 2DHCA 4PANA 4EUFA 4XRHA 1C7ZA 3ZHUA 3KYDA 4MLDA 3ZDQA 4F56A 4MVJE 2VH1A 4DCVA 1U9ZA 3RUFA 2C7RA 2X14A 4NOKA 1V3TA 3UMSA 3OJWA 4QNNA 5B66U 4RTKA 5JSYA 3SXUB 3FNQA 4RC9A 4ZIRA 2CNOA 2OLEA 1RZRD 2PGAA 1PFUA 2WU0A 3VR1A 4ND8A 3PWSA 5JY6A 2WM3A 4ECWA 1QBKC 3GN2A 2I6GA 2GFQA 3MCVA 1KK2A 4O33A 1RZRA 2W4IA 1ZUNB 5EIWA 3IAAA 1SQGA 2UU9B 2FEXA 2VQ6A 4K26A 3PW4A 3TAQA 4LSGA 2D7CA 3D1JA 1BYIA 2H7XA 1RVV1 2O5CA 3W5UA 3CB4A 1QO0D 4RQ8A 3ZBQA 1V8ZA 2DUWA 1U2GA 2UVPA 3DUWA 2HQ1A 4JMUA 2G5IB 3N8DA 2R00C 4XQEA 1BS2A 1MP0A 1LDNA 3OJFA 1RRVA 4KQEA 3ESYA 3OZUA 3WLIA 2WDPA 3H2ZA 2BCJQ 4CNQA 1TK0A 1FNCA 1QO0A 3GJZA 1H4QA 1AQUA 3KAPA 1TJ4A 1L4BA 1VG1A 2PJUA 4M54A 4MUYA 2I4NA 1EWRA 1Z18A 2H3HA 2GN8A 4CL0A 1CZNA 3HZRA 1PFGA 4JBXA 1L5HA 1NNI1 4NJMB 4DILA 1P73A 1IWOA 2QJFA 5BMOA 3BMCB 4DL9A 4KZPA 3RC7A 1NJ8A 5MN5A 4AKTA 4B44A 3KVYA 4UFOA 1EBFA 4L9WA 2WWRA 4MR7B 1ZAYA 1QRAA 1Y1QA 1RRGA 3PNLA 3M70A 1WXWA 3Q5GA 4EJ2A 1YD7A 4D02A 3FWYA 1EZZA 1GGMA 2KW5A 3C2MA 3EQ8A 5C8VA 1V37A 1UCFA 3HKEA 5IEJA 1WL8A 4HLCA 1AB6A 2FMTA 2JKVA 1V26A 4TXJA 4AICA 1W581 3P0FA 2L5YA 1B93A 2QUZA 2VHZA 2MTBA 3L84A 3IB6A 3JR3A 4HDMA 1DRUA 3MINB 4GICA 5JWOA 3C5FA 4IQWA 4UNRA 3DNMA 1ZJ4A 2B20A 3B9QA 3GJSA 4DQKA 4JEHA 2XJ4A 4MV5A 1H4TA 2E2WA 4I2NA 4BJHB 3G2PA 3BHIA 2F43B 2H85A 2OESA 4M36A 1TZ2A 4PYOA 1P9NA 2NPIA 1JDBB 4RAQA 5HILA 2A78A 3OE1A 1P3Y1 2QBYB 4LXHA 3H1PA 5AW6A 3U16A 1JEOA 3EVCA 5KSYA 1TPYA 4D9GA 3TLEA 5DBFA 1G60A 4ESHA 2A9QA 2DPHA 1KEJA 3L0YA 2JD1A 3D7MA 3TLCA 1XSEA 1JFFB 1LLCA 2EIHA 4KV7A 2XZPA 3TOZA 1MOPA 1X39A 2HBQA 1L8OA 1P6UA 3MIIA 2Q0XA 5C18A 1TCVA 1SHTX 1DDIA 4XDGA 1YUMA 5HJ7A 3UA4A 3ZV4A 4TRMA 1WHSB 3HVUA 3M89A 4I28A 4GXJA 2MSCB 3I04M 1YU6A 3I23A 1XE3A 2WVGA 4J4BA 4I2GA 4ZQCB 1OWNA 3B3QA 3ANLA 5K9ZA 2YXLA 5E0KB 3A4NA 4R0MA 5J2KA 4X20A 1UBNA 2R79A 2QD2A 4XLZA 3ZV5A 1H69A 3QA9A 3AJ9A 4J7AA 3B9BA 1Q15A 1QK4A 5CUQA 4LJ8A 3BK2A 1T10A 3WICA 2GPTA 1FW6A 3HLTA 4IQVA 2JFGA 2YN2A 2G3YA 1B1CA 2AX3A 4V0RA 2P5YA 1LK5A 1XMPA 1U31A 1QB7A 2A14A 2ZZMA 3BA1A 3GLSA 5JC8A 5C35A 4WFQA 1JNXX 4OHRA 2ZTHA 1EUYA 4MVYA 1E0DA 3O0TA 3L43A 4GG1A 4QQ8A 4I5FA 1OWOA 2E4XA 4A3SA 5CPFA 2WHPA 4DV2B 4M8SA 3PSPA 1BIFA 4FZ5A 1TA9A 4XUGB 5DHAA 4C08A 2F8SA 4CEHB 1TQ2A 1V7CA 3OJLA 4KN4A 3UCXA 5E3JA 4A0SA 3C2KA 2CYCA 4MPTA 3THXA 2QUAA 2A9RA 1V6CA 5AI5A 3RR8A 4R2WA 3FDZA 1G8GA 3VNQA 1WWKA 4RF5A 3D3KA 3EZ5A 4EZIA 2Q3MA 3FDIA 3VYUB 2QVGA 4V1CB 4QYIA 3AETB 1S5LU 1NV9A 1N78A 3OSUA 4IAOA 4FT2A 1EAMA 2J6UA 4HX2A 4YR7A 3KWFA 4Y2GA 3PTLA 1P7VA 3OEHD 3JQ9C 5C3MA 3G7NA 4RM2A 3RF9A 4F4IA 3V1UA 1LKYA 1ZQZA 3OCVA 4FCCA 4LVNA 2EFDB 3IP5A 5H8WA 1QZ3A 1NF9A 2XIQA 4D25A 2I03A 3VV2A 4LJXA 4G41A 3KQPA 2VNIA 4W7IA 1K9VF 2B5OA 1KU6A 5LB2A 2HOIA 2WJGA 5BN4B 3OEHA 2XDAA 4QZVA 1IXRC 2YZ2A 4RPZA 1R7RA 1G2PA 3RBDA 2QN1A 3H87A 2HU7A 2R44A 1EFRD 2EWWA 2ZAIA 4G8BA 4QDZA 4EUHA 3TNYA 5BMVF 3KQKA 1DLJA 1M34B 3IELA 2C9OA 1YCDA 4HDOB 2HCJB 2WIDA 4GVPA 4JU9A 5JJLA 1F48A 4MGKR 5E0OA 2FZVA 1Z83A 4X94A 2XUPA 4IEIA 5DSXA 3AOEA 3C3AA 5TNXA 2OSBA 3RT1A 4RHXA 1E4OA 3IDSA 3NTLA 2J7KA 2RAFA 1ODSA 2OEPA 1KS9A 3O91A 5LQRA 3LDAA 1W5SA 4L4XA 3Q8PB 2XCOA 3I73A 4A23A 3GQCA 1BHJA 1F2UA 4ZYWA 1OFGA 1XWLA 3P0RA 3EDRA 4JFAA 3UXOA 2H07A 3CO0S 2C97A 3VU9A 1Z1BA 3BK7A 4LGMA 1PJ2A 1C7EA 1Q11A 3OY2A 5G53C 1VZ2A 1BZYA 2WEKA 4HS4A 4NJOA 3ZY2A 4M0AA 3AF3A 4RV4A 1E3TA 5CR9A 5T3YA 1NYLA 4UM9D 2EATA 4HH4A 2JIRA 5DOVA 1FMFA 1KZHA 2R8OA 1XU7A 2ICAA 4UUAA 1KDYA 1LVGA 3C5EA 4QYMA 5MFPA 4OU5A 2JLWA 4DR2B 2NSYA 3RC8A 5JW6A 3PR2B 3R74A 1XXHB 2RGBA 1ISGA 2AFHB 3LS2A 3JZDA 2XTMA 4XGQA 4M76B 4UUPA 1FUIA 4AJPA 4WUVA 1Q0LA 5JO0A 3ABOB 5C8DA 3HWWA 3BS5B 3JVEA 1N6RA 3MJTA 4YMVA 3ZDRA 2NNLD 3Q3JB 1N5OX 3BSFA 3UMMA 1R8XA 2ZIGA 3FPLA 4HLUC 1XDUA 3KG2A 5D7BA 3SMVA 1OAOC 3H5WA 2RK6A 2WSLA 4TKUB 5I4IA 1RHMA 1S97A 1ZQ1A 4WBNF 4UNQA 1VE7A 3STYA 2PFGA 1IPFA 3CLTC 5HGJA 4GOJA 2J0EA 4DVJA 3U26A 1HYHA 3VI3B 1LX7A 4FWTA 1AHNA 2JGDB 1BQEA 4IFIA 1PL7A 1CF4A 2Y1WA 3R40A 5LXTB 2NUTA 5AVSA 1NMSA 2HX1A 3B3FA 1FNSA 3DOCA 2GBLC 1SK8A 3RO7A 5EUQB 4PSKA 1OI4A 2N46A 4QPDA 4UFNA 4X84A 4KITB 3TL2A 4W9NA 4W6QA 4D9FA 1D7OA 4ED9A 2GB4A 2OA0A 2H1VA 1VTKA 1OYWA 3CW9A 5ECWA 5AW1A 3LOQA 3W8DA 5IIIA 1ML3A 3PX0A 1NNLA 5A7GA 2W0MA 4XDHA 4RIFA 2VPXA 1QLJA 4P32A 3PV8A 4K81B 4WASA 2BGJA 1PBTA 1WSBA 2HUNA 3I1JA 3P19A 1D8BA 4TL9A 5FHRA 4X1IB 5JWRA 4YJFB 4EJMA 3L7CA 2PPVA 2GR9A 2JAUA 4FS2A 1JLHA 3QMWA 2AHRA 1RJ9A 2HXGA 2GK4A 2RKBA 9ATCA 1AURA 5B57C 3GXOA 2RRDA 3QUBA 4N03A 3AIMA 4RKRA 1V95A 4M9HA 4AX8A 1Z2OX 2J3QA 4U6NA 3H84A 4QZFA 4KR3A 1JEAA 5I45A 1BPYA 5NLLA 4Y2HA 3JYOA 2PFKA 5DW0A 1XC7A 5JSHA 3WGJA 3QG1A 4FZMA 4YAFA 1Z4OA 1KZ1A 2WJIA 2Q50A 4C8MA 1PK1A 5IABA 3WMXA 4CIBA 5LP6F 3IUBA 3UPTA 2VYQA 2EV9A 5GV7A 1T9CA 2W9MA 3GK3A 3OJOA 4CMKA 1YGYA 5ERXA 4LXIA 3QM1A 4KLMA 4AMZA 1O57A 1V2GA 3VYVA 1OBCA 3KHUA 4ADSG 3M9OB 2KHVA 1OYOA 1UP6A 1WM1A 1JUDA 5A9SA 1WE2A 2I2AA 3AUOA 2LP4Y 4KOAA 5JZOA 4RK4A 1W2GA 2XCAA 4L73A 2O8EA 1UKEA 5EKDA 1G21E 1XTZA 4NCXA 3NBFA 1Q0HA 1JJAA 4XYMA 3PXDA 1YWGO 3L8MA 2ZYWX 4TKMA 1RXIA 2G9RA 3QUQA 3LPLA 4ZCTA 1RKUA 4JOQA 3CRQA 4EHAA 3EHEA 1PE0A 2X8LA 3PFFA 3BCUA 4GUAA 3T7SA 4JIMA 5FBKA 1KDOA 4V03A 4QWAA 2LI6A 4ZVKA 5CYPA 1EXDA 5GVRA 3PUJA 2G4VA 2N1BA 4NU0A 4BX2A 3A32A 5EZYB 1XZQA 1H3EA 1AKTA 1GTVA 2IVFA 1IEWA 1HDEA 5DLQC 3U4QB 2QAIA 5TC4A 4WN3A 3KJFA 4XUCA 3EDYA 1IB6A 1JQAA 4CM8B 3N2KB 4C7OA 1GUZA 3UMVA 3F47A 3T34A 4O0IA 1ZD3A 3RRXA 2VOEA 1Y5RA 5KHLB 2V7VA 1M7GA 4L7VA 4IKEA 2QG4A 2VYND 2PGJA 3FBTA 3N6XA 2YX8A 1DKQA 4OKIA 5EMKA 4I27A 5HIKA 1LA2A 3GVHA 3STUA 1A9PA 3EN0A 2G77B 1RM4A 1XKLA 3OIGA 1DQRA 5ELLA 1DUIA 4F4WA 2AMFA 3F3YA 3SF8B 3WJ7A 5D86A 1Q7TA 4HFJA 4IS7A 3DYVA 1DIHA 3O26A 5C53B 2XGGA 1GGFA 2FQXA 3BDIA 4QQNA 4ER5A 2B3DA 3KDAA 3DWGA 1BEUB 5CB0A 5ULLA 3COPA 1IXRA 1OA0A 2XUOA 4QAJA 5T7BA 4FBGA 4Q4HA 5AI8A 3KU1A 3T9EA 1TZJA 2DFDA 3AUSA 2C5HA 3QX9A 2IU6A 4W6ZA 4JV2A 3AF0A 4DEZA 1R6XA 2RBGA 4Y1EA 1GAWA 5TQ0A 2R8GA 1L7EA 3G2LA 2IPAB 4TWIA 3PENA 4MW4A 3A28A 3EFHA 2ENWA 4XRGA 3GRYA 5IT0A 1ISIA 3HDJA 3LP8A 4QU8A 3LPCA 3ID6C 5C0OE 1HGXA 2AQ4A 1EX7A 1FA9A 4BO0A 2Y1IA 1Q1BA 1THZA 3GZJA 1I4LD 3KE8A 2M6LA 3BIJA 4CQJA 2W8BB 4Q3DA 1QGYA 3R3XA 5JV5A 1Y34E 2GEVA 3NC0C 1DXYA 4M9LA 2AOVA 1VBMA 6AT1A 3Q40A 821PA 2I3DA 2ZEJA 3E8XA 2AN3A 5J0RA 4ZVRA 2QX9A 5JROA 4KN5A 2P2CA 1QORA 2VRNA 4H1HA 1UMDA 4DIUA 1REQB 3FPSA 2DPIA 4ECRA 2REBA 3RAJA 1EQ2A 1UKVY 4P7JA 4MWTA 1PS9A 4CFSA 5KFIA 4ERXA 2QB1A 1D07A 2D7JA 3DLTA 2JH8A 1FBTA 9LDBA 3EFOB 4L5BA 4UNSA 4MA0A 5C7IO 1NLYA 3LK7A 2YL2A 2V98A 4DAOA 4E7PA 1XT6A 3CWCA 4US8A 2E6KA 2PU5A 4EMUA 3O0DA 1X1TA 1R4AA 1UAGA 4C4ZA 1D3AA 4YONB 3UIEA 1CJSA 3MTAA 1ESCA 3D4OA 3EXHA 2F1KA 2OR3A 5CBPA 4WZAE 2XJ9A 1ML4A 4NCHA 2VOJA 2Z1DA 1PR3A 3K70D 3AL0B 1CUWA 1ZH2A 4DF3A 4YASA 4IR7A 3L8CA 1KI1A 2Q3HA 2ZUSA 4NHOA 1EVZA 3NOQA 4FZVA 4WKBA 1TEXA 4MQFA 4BO6A 4YAOA 3WWOA 3E15A 4DFKA 1JKJB 3ZGXA 2VRCD 3LUFA 3N05A 4ME6A 1R27A 3RRBA 3HY3A 3IIEA 2EGHA 4ELVA 3UMYA 1ONNA 1BD3A 4LDRA 1CI4A 2AZXA 4N18A 5ECGC 2AK3A 2XVZA 3WJAA 3HA2A 1LW7A 4DCNA 1FMJA 4TMXA 3GGGA 2OBYA 3QEAZ 5BPCA 2VRCA 3PPVA 5LR6A 3VR5H 1FUKA 2XQGA 1Z74A 3WYBA 2GK3A 4MGYR 4J3FA 3UJ8A 4LDAA 5I4BA 3KVVA 2B9VA 1JIQA 3K1TA 4O2BF 5TVKA 3WNZA 3GGJA 1XMIA 4UZEA 4PCAA 3E2EA 1APBA 4KLJA 2XTNA 4GVXA 1OZFA 4KYIB 4U9HS 5ARBA 4XCVA 1BX1A 1X1QA 3KT8A 3ZXIA 3A3YA 5ECDA 3HTXA 3PHIA 3G2QA 1W29A 1Z5WA 3ZGLA 1INLA 4RHTA 2Y93A 3T94A 4BJ1A 3C23A 2YY7A 4RXUA 1E5TA 2O4CA 4KWHA 3KJGA 3UWOA 1P5FA 2OQ2A 4OUDA 1CEZA 1KAGA 4A5SA 4TWZA 3JSXA 2Z5LA 1TJNA 4RA9A 3A05A 3ZU6A 4O5CA 3PX2A 3ASYA 4HTAA 2OV3A 4GF5A 5F64A 1JWBB 1XZJA 4F2RA 4EI9A 3EULA 3TQQA 5L1LA 4AP6A 3V4FA 5G41A 2Q1WA 5JFOA 4NY8A 1ZC4A 2DFTA 3LBFA 4IQ4A 4C6HA 4JL8A 3Q2KA 4Y7CA 1ND6A 3K7EA 4RMGA 2J3HA 4XLLA 4YMUA 3SE0A 3WQBA 4ENUA 3UMJA 3ZNQA 3U09A 4TLCA 4J9MA 4LRYA 4P83A 3T1OA 2V45A 1CYDA 5GADl 2FOIA 1FP2A 3BQMB 4BV2A 1FUUA 4EKGA 3U5ZB 4BB5A 3ZK7A 4UB3A 4BNHA 4C7YA 2AG1A 1ZQLA 5EIXA 5CDTA 2ZJ1A 3QX3A 1II8A 1Z15A 4R9NA 1MJGA 2N3ZA 3H1AA 4IVPA 4JKOA 4G4IA 3RS3A 1QSYA 2G70A 3DLIA 5HIIA 4RT2A 3C7CB 3WLQA 2XCTB 3B8HA 5H7XA 1M1UA 5ALJA 2UZ3A 5C8YB 4YAKA 5J2UA 4K3UA 1E5XA 4S1OA 5KMGB 4PLZA 1MQ2A 4YPVA 3INYA 3ISDA 2HA6A 4PZCA 3PE4A 2W0SA 4II2A 1TNDA 4ARSA 1E2JA 1G6HA 2SHKA 2ZJ6A 1DL5A 4XR4A 4LZNA 2B2CA 4HGQA 5AKKA 1GZ3A 3BZWA 5FO0A 4RDHA 5IDVA 2A67A 1BVHA 1YQTA 2O59A 4M46A 2IEDA 3BQTA 1WF3A 1Y1PA 1Y7HA 2LE0A 2QDXA 4O1MA 1XPOA 2C5GA 4QFDA 1IZ8A 4YJ2A 2X19A 3HBAA 7ICUA 1SC6A 5LP6C 1N60A 3CURA 3DNPA 2JFZA 1C9NA 1ZQDA 1GCIA 2DR3A 4IHKA 2D8MA 4OP3A 2PO7A 1DEXA 3T5GA 1VB3A 1TM7E 2NPOA 1ZYUA 2BEJA 1J25A 2DULA 4CKWB 1GPAA 2KHQA 4ZGGA 4RIGA 2CJPA 5KG4A 2AXEA 5FB3A 5BV2P 3BPSA 3GRUA 4MRRA 4NBKA 3GPCA 4IQ8A 3GFOA 2PEZA 5JMOA 4MWSA 2PZBA 3M5DA 3KUKA 2AXNA 1E3JA 3PNVA 1EGHA 5ITVA 9ICCA 2ZIXA 7ICVA 5JRDS 3Q41A 1J21A 2IP4A 3GEIA 1FS6A 5EE5B 3EH2A 4Y9DA 1T4CA 3Q9SA 3L92A 1KQPA 2UYGA 3UOWA 2XNCA 1JHDA 3LYAA 5LKAA 4OQYA 3SJBA 4BU0A 2BEUB 1W44A 2C1EA 5I3CA 1NXXA 3OH8A 4ZT7A 3Q6NA 4DXHA 3OLQA 2AJLI 4BLQA 2ZRLA 1Q14A 1PJAA 4ZHSA 4UVIA 2JLZA 3D3WB 4PV7A 2H2FA 2MSEB 3I6QA 2NO0A 1E4EB 1QX3A 1IONA 3ADOA 3D6VA 2ZR7A 5HZGA 3ZD7A 1EDDA 1MEOA 2J9YB 4G65A 4FFBB 1EJ0A 2QT0A 2OK8A 2V5UA 3IDOA 3SEZA 2P79A 2Y6UA 4YJGB 5DXFA 4EY7A 4HGZA 1K3UB 3P71T 2Y27A 4EO9A 1WABA 4CV3A 3CJRA 2FSSA 4PGXA 1GEGA 4HYYA 1NLFA 4R1NA 3I61A 3COJA 5M34A 1S02A 3AI3A 3UHOA 2C3UA 5JECA 2PUWA 2Q7OE 1SC3A 4NAVA 3JY6A 2QMQA 1H0HA 8ICEA 1Y9EA 3BGVA 1AK9A 1CHDA 3VJLA 2DSTA 1HDYA 3ZKWB 1DT5A 2YMLA 2GCOB 1ZK4A 2AE1A 2C29D 1SOMA 1DKPA 5BSMA 1K7CA 4CKBA 4CTKA 5EOVA 3M7DA 3IO3A 3CR7A 2Z8YA 3KSDO 4MPJA 2RHBA 3TXAA 3WLMA 2IW1A 3CRNA 3NM5A 2MSLA 2BBSA 4U7HA 2YB1A 4RO0A 1ZN8A 5JO9A 1FEZA 1WB5A 1JEQA 2GOYA 4ZJUA 4JWTA 1RQGA 1GZVA 1XAHA 2OORA 4AY2A 1HNWB 3I4LA 5JSKA 3A3PA 4EBEA 3NWOA 1Y6JA 3WHLA 4F72A 4CMCA 2X76A 2QTNA 3QVOA 2HQOA 2VUSA 1IG0A 4HTFB 3EPLA 2R87A 3T1YB 2QJRA 1GNTA 1VPLA 3ULKA 1IEQA 5KAFU 2FWNA 1SELA 2XDWA 3SS7X 3JQRA 1BJTA 2VDRB 2DAPA 3FYDA 1LBTA 3ZS8A 5J5AA 3GP3A 4FSXA 1RPLA 3TLJA 5KFRA 1KBUA 5BORA 3PCRB 1SBQA 3OFJA 1P9LA 2XUGA 2WWWA 1ISHA 4L28A 3MT8A 1MV8A 5D4BA 4ARCA 3PPWA 4Z9FA 3EQ7A 2Z4RA 1ZFNA 1TA0A 5KI6A 3D5QA 3WR5A 2R9VA 4QHTA 2YNMD 1ZD4A 3QLTA 1PW5A 3KQMA 3E8SA 2QQFA 3CRXA 1UZAA 1N1DA 3BXXA 1CQJB 5KFNA 1EVLA 2GVDC 1HE4A 4GBED 2ASDA 2PMFA 1HQYE 3ZYCA 2VWPA 1NJSA 3V80A 2AXTU 4H15A 2XECA 1G5FA 1IL0A 3PEFA 5FLKA 2YNMA 1JN0A 3GPBA 3MGBA 3TQOA 1XVUA 1K3FA 3T5DA 1A04A 2AWOA 1TQ8A 3NO4A 4YXFA 1FX1A 3AUFA 1UMBA 4IINA 1C81A 1NN5A 2ZIUA 2WSIA 3PCXA 1W25A 2GWHA 3SYNA 1M8JA 1T5HX 4YRIA 3ZWPA 4RJIA 1DP4A 4X85A 4FD3A 2ZB8A 2CBXA 1EFUA 1S0UA 5JAUA 3OZCA 5DRTA 4PBSA 3EMVA 3HM9A 3D4LA 3GA0A 1T8RA 4DQSA 4G9BA 4GI3A 3Q8KA 3D1LA 3E84A 2FUG6 5KFBA 2FU5C 4O29A 2PX2A 2XMGA 1MUUA 3W8FA 2BKLA 4MW2A 3UO8B 3DE3X 2DKZA 5DLGA 4JI7B 3ZHXA 4ODIA 3TINA 5D3ZA 3RHSA 4YPFA 1U2GC 1XA0A 3CZPA 3OCZA 1ZCJA 2XE8A 2FEMA 4IRXA 1RJGA 1I3LA 2F90A 2JLCA 2PZMA 3MIZA 2AZTA 3S3TA 1DMRA 1CUYA 2QTWB 3MG9A 2ILTA 2EJWA 3IOBA 4KO1S 4EVRA 2CJWA 1M8PA 3PNSA 4G01B 4IHJB 3HHEA 3FN4A 3LUAA 5H5JA 2QW0X 2DCMA 1XR3A 4KWEA 4N6OA 3MDAA 3E7DA 5A3SA 2CFRA 4HEHA 3CH4B 4IR1A 3K0KA 5H3CA 3I3SR 2YUTA 3UHAA 4MRMA 4ZMSA 3RJHA 3EGXB 2VDNB 5EP1A 5DYYA 1JR2A 3CUWA 3NDPA 4RFSB 2E18A 3MHTA 4ZU3A 3ZGYA 2XNKA 3FNEA 2L17A 3NH9A 3AZQA 1BPBA 1J70A 1ZR4A 1JE1A 2B0CA 5JCJD 3PIDA 4M9UA 3HO1A 2XYHA 1XO1A 2ZB4A 1OYVA 1VKOA 5EJ6A 1K9SA 2PNJA 4EG1A 1X7ZA 2O7RA 3C6BA 3ZDAA 4CIYA 4MRSA 4BVGA 4L22A 3R0JA 4JELA 3E5HA 2B1IA 5THKA 5KYYA 2RB5A 4JUCA 1N1EA 5FL3A 4ECQA 3IBTA 3CX6A 2XY7A 1Y8CA 3LX8A 1CZHA 4KXVA 4LPSA 1FDWA 2RK4A 3LPAA 3LCVB 4GT1A 2NZWA 1GY8A 4BPRA 4YJHB 4OOFA 1H3NA 3TMAA 2P4HX 3C16C 4K8OA 5K09A 1RAGA 2FWAA 1IVYA 4X71A 3ZDEA 3MGKA 1W8DA 5DH9A 3AHHA 3THSA 2A4KA 2R8XA 3GLTA 2ZJAA 3QX7A 5GZ3A 1P31A 1RFGE 4EY5A 3NX4A 1L7MA 3G0GA 1UPTA 4JWMA 4EW1A 4I2JA 1U5BB 1JKMA 4HFRA 4UCXA 1O08A 1F0MA 3ZHYA 2ZJ4A 3DT8A 2Y66A 5I9NA 3P96A 4F2WA 2JGIA 1K88A 5K8UA 1X1RA 4M7OA 2ODBA 3DW3X 1PK7A 5TY0A 1XX6A 1QE0A 3TSCA 2O8FB 4HQ6A 1TK2A 1V5FA 4C80A 3UK1A 3ETEA 4RT3A 1H8ED 3CNLA 4F5EA 3MOGA 2BHLA 1LQTA 5KYWA 5CTAA 3CUSA 2WYIA 4JI8B 5HGXA 2ZI7A 5IAAA 2ERXA 2A58A 5JD3A 5JZBA 3F5MA 4WNCA 3PUKA 4RK0A 1FUEA 3QOWA 1LDMA 1YS2X 1H8EA 1U1DA 2V7XA 3NB0A 4AYXA 2R7LA 4HDNA 3F2IA 3Q3CA 3NBUA 2HFKA 3RVNA 5DYIA 1BE8A 2B8TA 2LPMA 3I53A 3ITEA 3BQ7A 3NBKA 3C6ZA 5AK0A 2EBHX 5BR8B 5TGTA 1UBJS 1J8VA 3VAAA 4DDTA 5DBGA 4DOMA 2X6TA 1ZC3A 3L7NA 1A8UA 1G20B 3K5WA 2B2XA 1U8ZA 2GQ0A 1FSSA 1GTZA 2W2KA 3VNUA 5JAIA 1BH6A 5ALRA 3ZCRA 1M2NA 2BTEA 5BVGB 2ADFA 1IM8A 1H1LA 4X54A 4B2YA 3ETGA 4JXXA 2NZ8A 4B9NA 5EXEA 5DK6A 1VYTA 1WCNA 2RHGB 3GJYA 3VU1A 3KYBA 2CCGA 1TJYA 2BFEB 3ANSA 4UMFA 4EYHB 3P2MA 3A4VA 2GK7A 1FU4A 5KX5B 4H16A 1I4EB 4PZYA 3RU3A 2FFBA 4AJEA 4YRZA 1R88A 4G1BA 1LVHA 3GLGA 1R5JA 1KMNA 9ICHA 1GAEO 3OMXA 4XQCA 3UF0A 3M34A 2NX2A 2W2LD 2PX5A 3TG8A 2AKEA 3AR8A 3WSVA 3NETA 2Z6VA 1IWBB 1MVOA 1U90A 4AMYA 5IC6A 1N5IA 4WOBA 4PIPA 1Q1AA 1V96A 4MDFA 1R2QA 1JTFA 2J0UA 2QP3A 4FZ3A 4RHEA 16PKA 3BXHA 1TLTA 4OL0A 4KO2S 2W2LA 4DZRA 1N6LA 3AOEC 1J97A 3IILA 2XXAA 4E1AA 2XUZA 3IULA 1E3DA 1UL1X 3FGPA 3WIUA 5KL1B 3T7DA 3V1KA 3OZAA 3H42B 1YUNA 3I0NA 2AGOA 4FUTA 1Z6ZA 3COVA 2YHUA 1LBSA 3AJRA 5J2BA 1GLNA 1LD3A 1B41A 4GOND 5GP1A 3ZBPA 4FNGA 5DN6D 2P0AA 1AZLA 5FJJA 5DWVA 4DEXA 2OAQ1 4M8IA 3K9GA 2NU8A 3VZDA 4D4GA 1O9GA 3O03A 1L1RA 3GRVA 3F8WA 2XWSA 3RF6A 1J1IA 5EJ9A 3CEAA 3SIPA 1M1YA 1CY8A 4C6RA 3T3IA 3ANNA 2ZIVA 4LYAA 2GN0A 1DAGA 1MA7A 5BQFA 5I8ZA 3OZSA 2KLBA 3K1YA 4IX1A 5DN6A 4OFZA 4LJ5A 1ZZEA 4NBNA 2KZZA 2HWXA 2YMMA 5E9QA 2OILA 3C74A 4F38A 1RPNA 4L8LA 4MYTA 2B2NA 4ECUA 2JA1A 1TYCA 5A02A 4DN6A 3UQ2A 2ISQA 3BGOS 3DTVD 3N2EA 4ARZA 2BFDA 3OZTA 4MCJA 4EHJA 1RMYA 4C3VA 1G8PA 1KKLA 2O50A 3LQFA 1J09A 4NYMR 5DGDA 5IJ0A 1I4DD 3QVGA 5HDQA 5C1DA 4HYTA 5T4FA 1FNBA 4FO6A 3SI7A 4QL3A 3OAAD 3E5NA 5HCIA 1N9GA 2F77X 4HHEA 1NE2A 3DTVA 1X9IA 2HJVA 1OA1A 2QPAA 4WK2B 4M8NE 4TQUS 4X5VA 2BFBA 1ZQ1C 2IHNA 1DC6A 1KERA 2VDLB 4NG5A 5IH3A 1JALA 2P66A 3RB3A 2O6LA 1MC5A 3ZYZA 3V7NA 3OAAA 4EGFA 1CQIB 4D0RA 2SKDA 4RMHA 5GJWC 1EPUA 2IHBA 5IMSA 2FK8A 1MPXA 3RFUA 1F9EA 3AINA 2QAJA 3V72A 1LB2B 3DAOA 4Q18A 5K51A 4LMPA 2E55A 4EUNA 5IINA 5EQJB 4TVOA 2DJ5A 1ST3A 4DIFA 1C1HA 4II3A 2FP4B 5JCOA 3AR7A 5GVSA 3TIFA 2XZDA 3GLHE 4HADA 4Y8VA 4HNRA 1FXWA 4R2IA 3MGAA 3PDHA 3AEUA 1HETA 4HN9A 4W9NC 1C1XB 3H19A 1FXUA 2REQB 4WLFA 3WB1A 4F45A 3FOWA 2XA9A 3D6TB 3CZ9A 2NZVG 2QT9A 4DOBA 1WMSA 1VJCA 2CJYA 5CAEA 2ZBVA 3TI0A 1NJ6A 1JU9A 1X80B 2YASA 2J41A 4WCDA 3EUAA 4MVCA 3A14A 4OHVA 4CIDA 3QBVA 1KDPA 4Z1OA 2QZSA 2C4UA 4S1VA 2ZAGA 1OMOA 4ENQA 1CUEA 5JD4A 4PLTA 2I4LA 3WGQA 2YH2A 3HYRA 5ALZA 1FFXB 1E3WA 4HC4A 2YHIA 3KPVA 4DR7B 3FYSA 3JVUA 2LW7A 2DR2A 1JMSA 4MRPA 4HXGA 1E7YA 5LQDA 5J2UF 3NVZA 3RVOA 4V24A 5FI3A 2QLNA 2OCDA 1ZLYA 1EFCA 3VC1A 3QPDA 1ZQVA 5LZ2A 5D3QA 1L5WA 2PGDA 1X2BA 4O5OA 4EZBA 3CUUA 3SX4A 5DNVA 3PUHA 5FWAA 1Q20A 4QT0A 1SN7A 4ZRMA 4CCHA 3AT1A 5JAHA 5DFAA 4KIWA 2GZ2A 1AV6A 1HJPA 2FFQA 2R7AA 2C5LA 3ZR4B 2MUTA 4YRLA 2Q6LA 1WP9A 1YA6A 4MVJH 2HBMA 3DCYA 3HY6A 3T95A 4JLNA 2PBLA 3D6HA 1GHTA 4JENA 3UG6A 1SU8A 3ND7A 1Y37A 2YV2A 2ZUWA 1JWLA 2PSEA 2C1ZA 2J67A 4FXPA 4KC0A 3AEKA 5BNZA 3BILA 1HYQA 3VX4A 4K9RA 1M54A 2G7MC 4IBOA 3OQMA 3KQLA 3BSSA 4R16A 2VRWA 4FR5A 3PW0A 4F96A 3F2CA 3NFRA 4RHUA 4DLYA 3V6KA 2IEBA 4N4AA 1AQNA 5E4TA 5AIAA 1OXMA 2AFIE 3H99A 1HT1E 1X42A 1JILA 1NAIA 4DUZB 2Z95A 3R2JA 1BE0A 3KJHA 2IS6A 4Z4GA 3BIFA 4MQLA 3M3HA 3NATA 4EO4A 1FMCA 5DE3A 2WVAA 4UNNA 1E77A 2GS9A 4JN6B 3CCCA 3N4MB 4KW7A 2J6BA 4A0QA 3FTDA 1DHTA 1US8B 2JFXA 1N2SA 3D2QA 3DZGA 3F7MA 4J3JA 3PUZA 1OY1A 1D2NA 1GPKA 3GVIA 1J0CA 1W9MA 2ZSDA 2Z6QA 3PLAE 5JANA 2O1XA 1XMOB 3X1MA 3OC6A 4ZZ3A 3KQWA 2OCGA 4RQ6A 5B1YA 5JOQA 3ACBA 2R1TA 2QVCA 2ZIEA 4I81A 4BTLA 1R0LA 3TB6A 3ROKA 3ZVLA 3QVLA 3Q6IA 2YICA 1SZJG 3SZ3A 3TMYA 5DX8A 4I3FA 1IJKA 2F00A 3WGIA 1Y88A 221PA 1P17A 4NABA 4B7AA 3GRPA 4FBUA 1S2NA 5A1TA 2AW5A 1TM4E 1Y8ZA 1RRFA 1DXSA 1JKIA 1E61A 4A9AA 4XWOA 4EKIA 4BEVA 3RJMA 2DL0A 4D3XA 4XIJA 3R0ZA 3DZBA 3ND8A 1GDDA 5IRCD 1V48A 5BOSB 3G2IA 2K5UA 3GGCA 3LWMA 5IYZA 1Q44A 2WJYA 3CCBA 1E63A 1SXEA 3O4IA 4U7CA 4Y6PA 1K6JA 1ZGBA 5E4YA 1SVWA 2ALJA 2PD6A 2VH5R 1G0OA 1QVZA 4MS1A 4KLHA 2GWSA 3S1SA 3ZVKA 1EFRA 1JPNA 3N7SC 5TGDA 5F7OA 1VBNA 4BO2A 3PA6A 4RTLA 3EQ6A 3GHYA 4YAWA 4TKLA 1P4AA 2R8HA 4FZLA 1KFSA 1XROA 3FCEA 2Q6KA 4AQ7A 1NW7A 1ZNXA 5GIOE 2D1YA 3ZXSA 4RY0A 1FS4A 5AI9A 1VL8A 4EX7A 1J99A 4RQ4A 4I5GA 2F9FA 4HZGA 5F5LA 4XWTA 1NKTA 5E6RA 4AMBA 1HDOA 4QQKA 4JUZA 1RXEA 3I09A 3D0RA 4KNVA 3SLRA 3FW1A 3DPUA 3ROFA 4I2AA 4WWHA 4QUBA 5E1MA 1M6NA 3HI6A 3I1IA 2YWDA 2K8BB 3A6JA 1RJEA 3G0IA 3OUZA 4Y2SA 3OC0A 2B8WA 2CL5A 4DAEA 3JQ8B 3B89A 3M6FA 3LW7A 3PGMA 3MWEA 3JD2A 2E4ZA 3IV9A 1S8OA 4AZ3A 4YLEA 1YQWA 2WLSA 3WKEA 3HL0A 1A0PA 5KFEA 2QLLA 3BH6A 4RXMA 4Q9IA 2RK3A 5B1SA 1CS0A 5SY9A 4XE5A 3EZ6A 3BS7A 2CBZA 3FOEC 1ZQQA 4CCSA 3PEEA 2JH1A 1PZMA 1U8UA 3KXKA 1QYVA 2AGQA 4N0DA 5TMDA 3HO6A 4RACA 3HJFA 1A6SA 3CW2A 4JJEA 4B71A 2O06A 1U11A 1JXLA 3SSAA 3EXHC 4LIPD 3C2QA 3RIGA 1Z2EA 1G59A 3R09A 5FD8A 1T9GS 1P5JA 4Q37A 4JI5B 5AVRA 3JPRA 2C9BA 4WVFA 3OD5A 4PAOA 1G19A 2FZKA 5DHFA 2PGXA 3GIDA 1RXYA 1A8SA 4GZ6A 2LMRA 4FTWA 4KWIA 1GPJA 4EKYA 1TMOA 4L3VA 4WXHA 3TCNA 3K70C 3HVJA 3V55A 1XAJA 4WCVA 1GV0A 2QTTA 4NDZA 1TK3A 5JUMA 2A59A 2V7WA 4MSUA 1YDFA 3BK1A 1N4DA 3WBFA 4L4ZA 3Q3HA 1DRWA 4KE9A 1NFFA 4IZIA 2QIOA 1UBMS 2JBWA 2HHWA 3N5KA 4Z51A 4IW3B 5AK3A 4TQRA 5GGXA 1YVUA 4DR6B 1PVPA 1MO3A 4NIMA 3N76A 2PHZA 1MIHA 1CJKC 3DDWA 3LT5A 4JOCA 2X41A 3PJEA 3O92A 3W5BA 5FX2A 5D1NA 4I14A 4U2GA 2XMDA 4U2BA 3HSSA 3QOXA 3X3HA 3FPCA 4RXTA 5K20A 1AKMA 4LDPA 2FEAA 2P2NA 4MTCA 3I72A 2MU2A 4YXMA 1KPHA 3BTOA 1W0JD 4GOKA 2ODPA 4LCJA 4FFPA 4FNAA 3IKJA 4NCBA 1E5DA 3SZGA 4NMXB 1W59A 4LXXA 4ZVSA 3EMKA 5KTOA 1L8AA 4H17A 2J45A 4BFWA 4B7ZA 3GV0A 4GWGA 2QG9A 3HB1A 4KAFA 2ERCA 3KV1A 1W0JA 3TNJA 5WRFA 2VHEA 2ODTX 4BNZA 1U2QA 2JFOA 2DX7A 2FZGA 4GBGA 4ITUA 1F51E 2D5CA 3DTNA 5I7UA 4DIMA 2Z5VA 3DCIA 1R5BA 4BEWA 3VSDA 3DOHA 1FYVA 4Y6SA 3QUTA 4BP9A 4B3DA 4ZCRA 4HPWA 5E7QA 5HMLA 1H0KA 1YTUA 2IODA 4IEFB 2AOUA 3NHFA 1QP0A 1OYYA 1XEXA 3SJUA 4KLTA 4Z86A 3KBOA 3LXMA 3LA6A 1L5ZA 4U7TB 4B34A 3K0AA 3SGLA 2XUKA 1QIDA 1DO2A 5B3JA 1CNEA 4K88A 4Z9XA 2QRLA 1C8LA 5J2AA 3CO5A 5DDIP 3EXIB 4KHPB 1BH2A 3THWB 9ICQA 3CNOA 4Q48A 4L02A 2E0IA 3TQCA 3DEEA 1FSGA 4KIJA 2X0EA 2JLAA 3ZHVA 1OF1A 1W85A 2ZRCA 4Y9UA 4CIXA 1B16A 2OVBA 2CNBA 1JTVA 5JCXA 2V6MA 2A5DA 2HV8A 4TRJA 3OM8A 421PA 5I01A 4YRGA 4MF8A 2PVPA 6YASA 3ZS9A 5COQA 2X0FA 2POCA 4K6HA 2INGX 4Z6CA 5LD2B 2ID7A 2IMWP 5FTWA 2RH8A 2JJQA 3CVUA 3IBSA 4WMLA 3QELB 4FGWA 3VH3A 2WIBA 1KFEB 1ZA1A 2HPZA 3MR5A 3EGVA 3T8YA 1Z16A 3E4CA 4DLUA 1NY6A 2ZRQA 2VANA 1AKYA 4DSIA 1EDZA 2I91A 1TVAA 1KI4A 3GD5A 2RBKA 3F5DA 4X9XA 3JPQA 2BP7A 2AZDA 4BE7B 2YWXA 4CM9D 3GB9A 1WUKS 2PMBA 4XRRA 1L9XA 1XDZA 2D3DA 3FDXA 3OLCX 1GJRA 2Z08A 3A1UA 3G5AA 1BN7A 3EXEB 4C29A 2FMIA 3QFSA 1UBHS 1WRBA 4KBGA 1BVSA 1X9HA 2VYNA 3KEQA 5EMHA 1WPQA 4PHHA 3SC2A 1EEXB 2C61A 1QU2A 4XB6B 4CM9A 5I7WA 3QZUA 2G17A 4EK9A 1AO3A 3IDFA 1XLVA 2YMQA 1MX3A 4DCGA 1BCSA 3WL6A 4EHNA 5TS2A 1H3FA 1XCGB 1CUSA 4H1WA 3O3OB 2XHZA 2YIVX 1EM6A 2J1LA 2COUA 5KJ1A 2I2WA 2AOXA 2JRCA 2C9MA 4JH0A 3BJYA 3FCSB 3AP3A 1KSJA 3U9LA 3KHRA 4KPUA 4I1UA 4ZQBA 4F9FA 1YZLA 3RFFA 3HKCB 4RF2A 1NZDA 5C37A 1IAVA 3BD9A 2Z6AA 2X86A 5DGBA 4C1BA 3GAMA 4AQYB 2QJWA 2Q5IA 1Y81A 1N34B 2IYAA 1PUIA 1KO7A 1OGIA 3FTQA 4KLSA 4ZEMA 1D9ZA 2HRZA 4TV9B 4DJTA 4O4IB 1QGED 5D7NA 2BI7A 1CCWA 5U4QA 4QXPA 3F97A 2AMLA 2H4FA 3DMGA 1RCUA 4LF6B 4E7OA 3ZV3A 4KSBA 4RVNA 4WEQA 1SO8A 4TYWA 3VNRA 3PR5B 5IU6A 2AL7A 2DPJA 4RKEA 2P6RA 1Y8QA 2OXTA 4N7RA 1PHPA 2ZSFA 2HCFA 3MILA 1XCMA 3Q87B 1O97D 3DGEC 3U7QB 2VTBA 1T5SA 4DKXA 5EGNA 2H1OA 4TURA 5FFMA 2JPDA 1HZZC 3IQWA 3AUKA 4J16A 2OZKA 4MFFA 2DH5A 1V8PA 5DT2A 4HH1A 2HDNB 3AR4A 1NVUQ 3HYNA 1BO6A 2ON6A 1DAHA 1AS3A 5CBKA 4MJ3A 4I4TA 4MW9A 2VK2A 4ZO9A 1Y7PA 1DX6A 2FETA 3EGDB 3N86A 4GI5A 1E59A 4QEKA 3QF4B 4BX0A 4J8PA 2JVJA 1YQ9A 4UC0A 3ZWMA 2CC2A 1JG4A 4JJAA 1QX4A 4QIWF 2LKYA 3TL6A 4HVCA 5TMEA 1Q3KA 1ZUIA 5HRUA 1M8GA 1U3GA 5CMLA 2BFAA 2OORC 4R8KA 1DAMA 1EKXA 1PHRA 4JBWA 1XXLA 2HRCA 1SUWA 3QKRA 4MIEA 1P1FA 4N5IX 2BTOA 3QHAA 5KFXA 5L1JA 4UQPA 1ZQTA 4BCBA 1YBVA 1DJMA 1LDGA 2P4QA 6Q21A 5B58T 2R6HA 4PS1A 2RLTA 2C4TA 3GQVA 5HOEA 2R8PA 2ZYTX 5GTIU 2DERA 2I7TA 6ABPA 2YBDA 2ZUCA 3O4JA 3MSCA 1HEIA 3A9UA 4LJRA 3R6TA 1DO8A 4JX8A 2BPOA 1KL7A 4P4NA 4ZJZA 4BNKA 1EP1B 2OCBA 2FMXA 3V7UA 3R9XA 1JR3E 3RYIA 1GLVA 3GNSA 4FHFA 1VFNA 2ZROA 4HAXA 4BP8A 1AKNA 4YDQA 3AI1A 4IGIA 3FLEA 4RZ2A 1A1VA 4IF4A 2IS1A 2TMYA 4LZAA 3ZQ6A 1Y4ZA 1AB5A 2O2JA 4KR0A 1SXJD 3HCWA 4BNWA 5K5EA 3U0BA 2G25A 3ZW8A 1L7OA 1XV5A 3IKTA 4X62B 4Q3OA 2LBOA 4G2NA 5F33A 3I0MA 2B30A 4J0QA 4CQMD 2PSHA 2WYHA 4YQFA 3AFNA 4MVJM 1FXWF 2YWRA 2Z2ZA 3PD7A 2YNMC 2GETA 1SXJA 3B5IA 2K60A 4DLZA 4L8WB 3V6JA 3GRRA 1ZSNA 3MWDB 8ICZA 3C1YA 4D9JA 1CBUA 4CQMA 3AUAA 4GP9A 1YZNA 3NHKA 3DAFA 4GMFA 4MGZR 1IJFA 2JLUA 1KZGB 2ZR0A 3K1ZA 3A2LA 3JYLA 4MV8A 1LRLA 3OX3A 2HIAA 6LDHA 4D56A 1P18A 5FA6A 1FNDA 4HDRA 2C83A 2HZ7A 1YRQA 1GL7A 3EVTA 4QNRA 5A0LA 2I80A 4B8YA 1DBSA 2CNNA 4LWPA 4JJ7A 4Q93A 4M9CA 3HB7A 1Z88A 2CCJA 2O0HA 2HH9A 3GVPA 3KFXA 3DFFA 3NASA 1RLOA 2Z0MA 4ZEXA 4CHTA 5AW7A 3O4GA 2GF0A 1KK3A 3HVHA 3GLFA 3RFAA 1XCLA 4IG9A 3AHJA 4Q7KA 1S8NA 3RSCA 5HF8A 4TWAA 1RRKA 4GSYA 1KYYA 3HE3A 3DDZX 3O0FA 4WKOA 5AM4A 5LNK1 4B35A 1YDMA 1W46A 1ESDA 3U7FB 1O95D 1EIWA 4F06A 4Q39A 4RH1A 3BT7A 3QPAA 4XYGA 1J0EA 3RSOA 3BXEA 1NVDA 3PXXA 3RIHA 1T2AA 4CU2A 4TZ0A 4DBLC 1HG1A 1O95A 1EVQA 2CL6X 3PHGA 5G1PA 3F3KA 4LKOA 1Q3UA 4YN4A 3E82A 4OG2A 3NUGA 4G0WA 2PMWB 2Q3JA 3MBYA 3S1AA 4BMZA 4ELTA 4KHZA 1EDBA 5BSGA 3IC5A 4HAWA 1GNVA 2AVDA 2B1RA 3EUEA 3U49A 1E8DA 2F1JA 5ALOA 2PJDA 3H4DA 1B4FA 2WQZA 3AR3A 3G0CA 2WAYA 2FNAA 3MSXA 1CQZA 3DVQX 4DSUA 4BQFA 2X9GA 1Q1GA 3KTAB 2PGNA 4YALA 3UYLA 1W36D 3II6X 2RHCA 1NF2A 1QIKA 2FWPA 3AB8A 1L3CA 3HRIA 4HB4A 3TDKA 4UBOA 2Y0CA 1QC5A 2XQFA 5AKXA 2VDWB 3K0FB 3B20A 2FK7A 2YS6A 1YMVA 1F0YA 4L6IA 4Z9BA 1HY3A 4XEHA 3HWTA 2YWFA 3Q3VA 3T5JA 3QKUA 5SV2A 3ZWBA 1PYOA 3GDGA 5G5HA 4IXMA 1T5IA 5LJLA 1JHOA 1NJGA 4WX2B 2FSVA 3V1YA 2J5BA 5CB6A 4IJWA 3KOZA 3NAZA 4D8WA 1GRVA 1W4LA 2ASJA 1GRNA 1VQ1A 5HE8A 2MYNA 4MARA 1YT5A 5LA6A 4QUJA 1JDNA 1QPGA 1I33A 1BRMA 3JALA 3EC1A 1DT3A 4CHGA 2P4SA 1T3SA 2VJNA 1H2XA 2NWQA 4C6TA 3UGKA 4BO5A 4A0HA 3UJNA 5EIBD 1F06A 3SNKA 1EI9A 4Y2VA 4JP1A 4Y9TA 3D7KA 2CV1A 5LBIA 1ISFA 4GIBA 4EG6A 3FD8A 3K5PA 9ICEA 1HORA 2AQKA 3MGVA 3ANXA 4URUR 5IVDA 1HMPA 2XB4A 2GN9A 3PG5A 4QJ3A 3JD0A 4EW6A 2NU9A 2BDUA 1K6IA 3TD9A 4ZZIA 3PLRA 1PWEA 4AW9A 1LFDB 2J4DA 1L4NA 3B78A 4HGPA 4GXQA 1HLGA 1TKDA 1GZUA 3DC7A 4F84A 2ZOSA 4ES6A 5JD5A 5CCXA 4MHSA 2VSNA 3WBBA 2NP7A 3IURA 4EI8A 3Q3GE 2HGZA 1HZZA 3T9BA 2RE8A 4RL6A 2QLFA 1XNJA 3D8UA 1KK1A 1QHYA 1D0IA 2YVKA 4UU1A 2REOA 2I9PA 1XZHA 4KLCA 1BDBA 4ZZ0A 2P6UA 3EODA 4JI2B 2D59A 4MO2A 1Q91A 3IP9A 1T6BY 3BE5A 1HMYA 2IYVA 5C1IA 4RV5A 1Y89A 4B6FA 2LNDA 1MGPA 3WWZA 3RAGA 4DY4A 3J7TA 4MRVA 4BMOB 4BMPB 4US0R 2WWGA 5FTLA 5UKDA 2QT1A 1QRRA 3BFVA 4BNUA 4ID3A 3PUVA 1QHGA 4KE7A 2C07A 3DLPX 4MUJA 2QZ4A 2A1JA 2QRNA 2G9VA 5EJMA 5M2QA 2BCUA 3PO5A 2OAEA 3JV7A 3S2YA 3H0RB 1XWWA 4NFLA 1P0IA 4DYDA 2G71A 3MOSA 4N0EA 4DHWA 3SZLA 2DKXA 1EFLA 4AY5A 3PD0A 3AM1A 1N2BA 1KVSA 5SZIA 1E3QA 4UM8B 3EF3A 1M5TA 1R9NA 2HLNA 1G8MA 1DFIA 4XPZA 3TCXB 2BEVB 2D7DA 4RMIA 3N28A 4CDNA 7ADHA 4YFKA 3O93A 1RKVA 3PC4A 4CM4A 3BEOA 1VMKA 2HT6A 1DOHA 4W99A 1I7QB 2R8EA 2WIFA 2X2OA 1L4FA 2G9ZA 1OZAA 4DA8A 9MHTA 3S27A 3S8YA 2Z2IA 3ZLTA 1EX1A 2FSFA 1U8CB 4B9UA 1QCCA 1HQKA 4NZ9A 5DGHA 3ZTTA 1E3IA 4IVNA 3BGDA 2NXNA 1PX0A 1I3CA 2PY6A 1SIJA 3RTGA 4MS4B 2ZTMA 5EEHA 1JQLB 5DNUA 1KY3A 3L1JA 4OHXA 4I1OA 1RYZA 2DPLA 4OQPA 4ZYUA 5AI0A 4AJIA 4AKGA 2VL7A 5DXAA 3HPOA 3HJHA 1QMPA 5DLPA 4QIWC 4R1TA 3ZY6A 2OK7A 4F5YA 1HFEL 1K4MA 2K7ZA 2JLYA 1VDMA 2JCSA 2OT3B 3PC8A 2Y92A 1G8JA 2JHGA 1N92A 4MQEA 4BQPA 1URPA 4DZTA 2PX6A 3VAZA 3EXFB 4G07A 3TTXA 3AQ4A 4URWR 5KTRA 1Q22A 1SIWA 3H1BA 4Q00A 2WTXA 3BUSA 2Q27A 1OZ0A 2F6RA 1KEKA 1SBCA 3QEMB 5HF9A 4J3NA 3DV0B 5BV7A 1TKCA 5CFMA 3LW8A 1M7HA 3SV4A 1JG1A 2C8LA 2FFHA 4G84A 2CDCA 1ZDMA 4RQTA 1JLRA 2IV2X 1SUCA 4A2QA 3Q7RA 1YB1A 3S2IA 4HFMA 3L4EA 4ND3A 3U1TA 2YCBA 3O1LA 1UDRA 4UXJA 3HJCA 4RNMA 1IATA 2Y1XA 5HFAA 1AKQA 1LTHR 2YQEA 2WFAA 1QQAA 5DTIA 5AKZA 3QEOA 1ZGZA 5AFSA 1U3WA 4E5PA 2K4IA 4UVHA 2GDZA 4LTMA 1FB5A 5JCOC 5TISU 3DL2A 2LDBA 3BB3A 3D4BA 3B2NA 2DKNA 3KDSE 3HXQA 3N2NA 1KLNA 2TSYB 3A1EA 2K6GA 2O8CB 1UDCA 2I62A 1T9HA 2VK1A 2YHSA 1SKMA 1HL3A 2JEJA 2NO5A 5FLYA 3NBQA 4O0LA 3T0GA 5JTUA 2IZ0A 1G4HA 3HCDA 4UASA 3IB3A 1P74A 4O3OA 2LBPA 1FRFS 1ULHA 1ZQAA 1YIAA 2RBEA 4EG5A 1DDGA 3EAFA 1H85A 4F3TA 4QDUA 4F8EA 3KLBA 5KCZA 1DFGA 4BDTA 4NBSA 3GMTA 4EOGA 4P36A 1BDHA 3DFIA 1CY4A 2FPPB 2ISOA 1RTTA 1UOPA 5L51A 3VOBA 1V9LA 2IYZA 2PR2A 4ZTZB 1IVNA 1FJHA 2HHQA 5JCJA 5E9WA 4IFTA 1IBCA 3OECA 1YA8A 3O21A 4HDQB 1SC4A 1W49A 1CRWG 2CXOA 2GESA 2R6DA 4G2TA 4P33A 1ORTA 5KYGA 1N2CE 4JBYA 3PPIA 2FJ6A 4ROSA 4AECA 2KE5A 4DF4A 1EU1A 2LIVA 4JCOA 2YWEA 1CNFA 3JQPA 5HZKA 2X1HA 2CZCA 5J9FA 3F7NA 1RBQA 3C3XA 2IU3A 2O2SA 3WGNA 4K7JA 1U0GA 1VJRA 1R0RE 3K9QO 2IHJA 1ZQKA 1FF9A 1DOZA 3ZVNA 1UKBA 3W6UA 4FMDB 4MW0A 1X2EA 1TVCA 2Q3CA 1SVKA 2GEKA 1RI2A 1WBBA 1CR6A 3M6KA 1RCTE 1JIVA 4ML3A 3JVIA 3A6HA 5CYOA 2IQIA 3FA2A 3KWJA 4HNQA 3R3HA 3NNNA 4GPBA 4L50A 4LV5B 1AH2A 1GZ5A 3OJEA 4FOPA 3UJHA 4JDUA 3E9RA 2R8RA 4HK4A 4P22A 4HSGA 4PZUA 1X7WB 1EXMA 1QMGA 2A86A 3TVYA 3RU7A 2PVSA 1RYUA 3IQDB 2YZMA 2ETVA 3HZHA 3PGKA 1YZKA 3A1FA 2NUAA 2VP9A 1QG4A 4UJ5A 4J03A 2PRZA 3B2QA 4DQLA 4NM1A 2GWRA 4YD1A 4MP6A 3BEDA 2VATA 3DBHA 4J49A 3BAZA 2Q2OA 4QULA 2PJRA 5IX8A 3EDMA 3G2HA 1H8HD 2QB5A 1C7FA 2MSWA 3DVAA 1XZLA 5G3YA 3K9FC 3L8FA 2ZIWB 4PG6A 1HLFA 3N2LA 2A1TS 4E2WA 2D0IA 1A2OA 2VSYA 4K40A 5IBQA 1YFKA 2ZUDA 4NYIQ 4PYJA 3SQIA 1M6YA 3DEZA 5DNDA 3PC6A 1H8HA 3ABSB 5PNTA 2H4XA 3DCNA 1Y82A 1AQLA 4LSWA 4KLRA 3VVCA 3EZGA 2OFPA 5K05A 5F78A 1ZJWA 1F0KA 4PNZA 3HJBA 2G6TA 1UKYA 3GZTB 1X9XA 2DUJA 2NRVA 1JHMA 3ABZA 4UB8U 1CUDA 4R1OA 4EATA 2ZRDA 1R4ZA 2C42A 3K4QA 3KAJA 2W4MA 1E7RA 3OZEA 1NQAO 3PHCA 4I4TF 2GUGA 4PHFA 4E5VA 5KOYA 2DR0A 3NBXX 1BU8A 3MJ4A 2AHOA 3I5AA 4YP3A 1ADBA 3NTUA 4XGKA 4H60A 2UUOA 3ZBTA 4KSCA 4FW8A 4BWFB 7ICTA 1U7OA 2DTDA 3L0SA 3TPFA 3GMIA 1NOJA 3LBYA 2NO7A 4J0JA 4KO8A 1K7FB 3BRQA 1CTQA 1ZISA 1JQEA 3LWZA 1PD1A 2GEBA 3ABRB 3NV7A 3LLSA 3RJTA 3SIXA 2JARA 4EKDA 5ED0A 4DMRA 4X60A 2DUNA 4UHKA 3C3EA 4EHLA 3Q8WA 1OSNA 2YJ3A 1LX6A 2WIGA 3MAGA 2TRSB 4DFPA 2HADA 3L0ZA 2W93A 1H5QA 3ET5A 2DLCX 2HHCA 5L3QA 2F4NA 3ICOA 1GA4A 3PXAA 3A36A 1MRZA 3GR6A 3PE3A 3RKSA 2ZT5A 3NHPA 3JQDA 4E88A 3CVVA 1O5IA 2IXBA 3IV6A 1IZ7A 4BLOA 1QRUA 2PRKA 1NJ1A 3KJNA 2QZ9A 2QROA 1OBHA 5JAPA 3C8HA 4I5EA 2CXQA 1BKSB 3C43A 1WXGA 3BMQA 2EZ4A 1FP4B 3PKJA 1DB3A 4RCVA 4Z6EA 1YZ3A 5FV4A 4F12A 3U81A 1G55A 3Q8QB 4INPA 2XRFA 1LSOA 3M6XA 4TSRA 3OM9A 1OXBB 4R0VA 1H22A 3L06A 4KLFA 4G63A 4C06A 3H5RA 4CG1A 3CE9A 1ZXXA 2PTHA 4HB0A 3H16A 3OTOB 4Z0TA 5BUQA 1T43A 3F9RA 1C80A 5CVJA 5DWDA 5KB3A 1N6NA 1GNRA 3HJNA 4LDNA 3NVYA 4GMDA 4BBPA 4MZXA 1KQ3A 1SOWA 3OX4A 3VSAA 1KI2A 3CW2C 1CUAA 1YIOA 3N74A 3CLHA 3FPEA 3AVPA 1ZMRA 2XUHA 2DE0X 4U2EA 2FZ5A 2XDQA 4WY5A 4XPIA 3U7HB 4C0HA 4PYMA 1IHYA 1NRIA 4TYYA 4QM7A 2HEGA 1UDWA 3GLQA 1UA0A 5KYKA 3UJ6A 2I22A 2VQEB 2VDQB 5DOZA 1YJAA 2WIJA 3PEVA 4C4PA 1OTHA 1O89A 3H97A 1SUDA 4QEDA 4WK6A 2EBWA 2JEFA 3UQ0A 5CFZA 2X7XA 4OY3A 2G07A 3DULA 3REFA 4OLBA 4W8HA 2FRXA 4B8WA 3CSUA 3PQ7A 5HRCA 4TUPA 1UFQA 4P2GA 5C7LO 4ALNA 3FUXA 4TKVA 3ZK8A 1I7PA 1S3SA 1PZXA 3VJKA 3HLYA 3ABQB 4I55A 1F3OA 1Y3FE 3IVRA 4UAYA 5HUJA 1UK6A 3C7DB 5KFJA 4DSZA 2HBJA 3ZCUA 1A9XA 3JQGA 3RT7A 1R74A 1J2NA 1KU0A 4S2EA 3F6RA 1X87A 2APJA 4Y1RA 1XCBA 3ZE8A 2WD9A 2BQUA 2QUBA 3PQ5A 4JLBA 5LQKA 1RHUA 1SRRA 1F3LA 2H17A 5KAIU 4GX1A 3NVMB 4IV0A 1HI9A 4FZRA 1YFZA 1CUVA 3QE4A 3LM8A 4DHEA 2M9NA 1Z5GA 1PQ4A 1BPXA 3SDZA 3V32A 4WXEA 1W48A 2PZLA 3GDFA 2A4MA 4LJ6A 4ETNA 2YJZA 1A27A 2ZPUA 1W88A 4IIEA 3M4YA 1ZQ9A 1ZUWA 1SA0B 1U3TA 3LOUA 3ZCPA 1KQOA 1G6Q1 4LVCA 4P0TA 1M9NA 2PZGA 1COKA 3AEXA 2WJAA 3P2OA 1E6LA 3RTVA 1BAPA 4A0RA 4J7CA 5BWLA 1Y0BA 2C82A 5T6BA 1N4AA 1CF2O 5DNWA 2VP4A 2ZE5A 4ER7A 4PVDA 1U45A 4ED6A 3AEZA 3OE7D 4R1LA 1WZNA 4N54A 1BS9A 1C2YA 2DLNA 2X4GA 4KCGA 5BWBA 5EXXA 1F7VA 3IUPA 4H4EA 5FORA 3R0QA 4EX6A 9LDTA 3SOZA 2X3YA 3HUTA 1Z1VA 1TUBB 4YJ2F 2BISA 1PVOA 1FIUA 1U63A 4UEOA 2OEHA 4WTOA 2PUHA 3FMIA 5HQ3B 1NG9A 3H2JA 5JATA 4CF6A 2YYSA 4ZXPA 1K8RA 1ZD2P 2YC2C 3OE7A 4GZLA 1ZKMA 1JIIA 2XD9A 4FWBA 2W6ZA 2IL1A 2BEKA 2R4TA 1F2TB 2PFQA 2OFWA 3W77A 1Z63A 1W94A 1BWPA 4AS1A 5B3JC 2J87A 2ZYIA 2M6SA 4NEHB 2OM2A 5J2EA 1J2TA 4AJNA 2D2XA 1D5WA 4KBYA 1XUOA 4LCEA 1ZH6A 2EQ5A 3V97A 5KTNA </