3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
b'MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Isomerase
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
2YY6A 1L7MA 1Z4PX 1S2OA 1Z88A 2C8KA 1U2SA 2ZXEA 2B8EA 3N1UA 4Y2PA 2C9MA 5FP0A 3OCUA 2GHTA 2P27A 4Y2QA 4UASA 2JARA 4BNDA 4YIKA 4BBJA 4EX6A 5E0OA 4NABA 4O8CA 1NRWA 2OYCA 1SU4A 2QYHA 5AM0A 2NYVA 1O03A 4DW8A 2GO7A 5T41A 3R09A 2CFTA 1N9KA 4HGRA 2WFAA 2WF7A 2BDEA 4C4TA 3W5AA 1J97A 5AI5A 1RLOA 4YCNA 5AW9A 4F72A 3L8GA 3WKDA 2C8LA 3FPSA 3KC2A 3QX7A 2I34A 5AVZA 3U7FB 3KZXA 5AM3A 1L7NA 5ALMA 4KN8A 3M9LA 2IOFK 2ZG6A 1XVIA 4KNVA 4YIHA 2FPXA 4I9FA 5ALEA 3BA6A 3ZI4A 1RLTA 3WGVA 1RQNA 1L8LA 1RLMA 3VAYA 3AR4A 2YBDA 2EATA 2JGAA 2P69A 3A3YA 3QGMA 4CE6A 1Z5UA 3E58A 2YJ4A 2GMWA 4L6CA 1QYIA 1TE2A 3TLMA 2HI0A 2D2VA 3KOOA 4KNWA 4ZEWA 3ESRA 1CQZA 2FPSA 4BEWA 1IWOA 3UMCA 5ALUA 4UM5A 4Y2JA 3UMBA 2HEGA 4CF5A 2RBKA 3ZWDA 3N07A 4ZEXA 4AS2A 3U7HB 3QU2A 5AKZA 3DAOA 1Z4IA 3PGLA 4I9GA 4EELA 5AW4A 2AGVA 4HGOA 4XOUA 4BEVA 3ZWKA 4YCMA 3RF6A 3ZTYA 4BX0A 2IOFA 1NNLA 1QQ7A 1Q91A 2OBBA 3OTQA 4Y2RA 3NANA 5AVYA 2NO5A 5AVTA 1T5TA 3WK6A 3F9RA 2B30A 3WKBA 3W5BA 3QLEA 1L7OA 3U7EB 1ZD2P 3WK9A 4XPZA 5IT4A 1VJ5A 1QH9A 1RKQA 3L1UA 2WF5A 3DV9A 1J8DA 1SWVA 2Q5EA 2FDRA 2G06A 3WKEA 3FVVA 2FI1A 5ALTA 1MH9A 1ZRNA 3J7TA 4UMVA 4AS3A 4BNDB 1KYTA 1QQ6A 3U26A 4Y2XA 2JAUA 3DNPA 1RRCA 1ZD3A 4FE3A 3HLTA 4HGNA 4EX7A 5ALRA 3QU4A 5AM1A 2B1QA 2BDUA 5AVRA 2FPWA 4DCCA 1EK2A 3OCVA 2NO4A 4OFZA 3PGVA 2B8JA 2YFYA 5AK4A 3ZX4A 3SLRA 1TJ4A 4UW9A 2YJ3A 3ZVLA 4B6JA 2HF2A 3I1YA 2WF6A 1O08A 2RARA 3M1YA 3IRUA 3EPRA 3NRJA 2DQSA 5A3SA 4UMDA 5A3QA 4EEKA 2PKEA 1ZOLA 2HHLA 4AP9A 5AKGA 2BY4A 3GYGA 3L8HA 5AVWA 3OCXA 2YMQA 1U2TA 2R8XA 3A1EA 4BKMA 4UMFA 5AKLA 2Q4TA 3N8GA 2W11A 2G80A 3ZUPA 3N5KA 3FM9A 2R8EA 3L0CA 3EF1A 3E8MA 5IT0A 4UAVA 5ALOA 5ALQA 3MN1A 3SMVA 3NALA 1Z4OA 1ZD5A 4UATA 5ALGA 2MU1A 3A1CA 4EENA 1X42A 2P9JA 2B0CA 2AMYA 3ED5A 4DWOA 3ZVNA 1RKVA 1QQ5A 2C4NA 5AI0A 3S6JA 1YS9A 5ALNA 1ZJJA 1RMQA 4C4RA 1VJRA 1XP5A 1LTQA 1L7PA 2HOQA 3IJ5A 3UM9A 5ALIA 1Q92A 4KX3A 1RC8A 5ALVA 3KDPA 2ODAA 3L8EA 3L0YA 4G63A 1YV9A 1K1EA 5ALXA 2I33A 4KYTA 3ZW7A 4CF4A 5AM5A 2HO4A 5AICA 1Z4QA 1U02A 2HSZA 4L6AA 3WK7A 1Z5GA 5AI8A 2O2XA 3AR8A 4BX3A 5AK3A 4E88A 3AR5A 4GIBA 5AIBA 5JJBA 2W43A 2ZBGA 2IYEA 3EF0A 5AI6A 5AKXA 2FUCA 4NV0A 2Q4RA 5AW0A 1RMYA 5AK5A 2YJ6A 3A1DA 1Z4MA 1Y8AA 5AVUA 2WF8A 4Y2SA 2I7DA 4KX5A 3L0BA 4MWOA 3U13A 2HF7A 3I76A 3B9RA 4CNQA 3CZ4A 3EWIA 5AW3A 3QU5A 1L6RA 3FZQA 5ALJA 3KBBA 3SHQA 4HGPA 1YJ5A 3E84A 4G9BA 3UMGA 5AKIA 3MPOA 4NWIA 2RB5A 3QUBA 2GHQA 5ALLA 2WHEA 2R8ZA 2G08A 4RETA 3OCYA 2EARA 3L7YA 3BWVA 1U7PA 3NAMA 5AVVA 3ET4A 3P96A 5AI4A 2MU2A 3AR3A 3B8EA 3L1VA 1RPZA 2YN4A 2CN1A 5AW8A 3ET5A 3D6JA 4L57A 4XQ0A 3AR6A 3WKAA 2ZBFA 4RESA 2YMLA 2HCFA 2HX1A 2FUEA 2ZBEA 3L8FA 4OCZA 3KD3A 5AKJA 2FPUA 2WM8A 1LVHA 2P11A 3FPBA 3ONNA 4YGYA 1Z4NA 2FPRA 4QQFA 2JAWA 3NASA 2G1AA 2EAUA 4UARA 2MSNA 2G09A 3AR7A 1AQ6A 5ALFA 3CNHA 2OM6A 1RMTA 3ZTWA 4EZEA 4GXTA 2GFHA 3W5DA 3ZX5A 3W5CA 1WPGA 2IOHA 3AR9A 1T9ZA 1S8OA 3QU9A 5AKHA 1TJ3A 1VFPA 1FEZA 3OPXA 2R8YA 3N28A 2PR7A 3R9KA 1L8OA 1ZRMA 3OCWA 3WGUA 2IA5A 3WK8A 2CFSA 1Z4JA 2JAOA 2W4MA 4F71A 5AKEA 4DFDA 2B1RA 2G0AA 2VKQA 2ZBDA 1YMQA 2AH5A 3ZU6A 3RFUA 4NAVA 1RDFA 3I6BA 4Y2UA 5ALSA 4ZEVA 3I28A 2ZOSA 5AW6A 3QU7A 2O9JA 2AUTA 1PW5A 1JUDA 4IFTA 3SD7A 4JB3A 1Z4KA 2X4DA 3WK4A 2YJ5A 1T5SA 2CFRA 5ALPA 5AK6A 5ALWA 3DDHA 4HYTA 1WR8A 4UM7A 4MUMA 4QJBA 3R4CA 5AW7A 2YMPA 5AIAA 1ZD4A 2C88A 4CF3A 3QUQA 5AKKA 1XPJA 4H1WA 3PCTA 5AI9A 3OCZA 5AW2A 5ALHA 5AM4A 3U7GA 5AKYA 4XE5A 5ALZA 5AM2A 1CR6A 5AHXA 5AVSA 3NUQA 1WVIA 5AESA 5AW1A 3WKCA 2I54A 4HAIA 3NIWA 3FGOA 4NFLA 3ESQA 3B9BA 3MC1A 4OD0A 5A3RA 2G07A 1EK1A 1SWWA 4UMEA 5IS2A 3MMZA 3IB6A 2RAVA 4J03A 1RQLA 3QYPA 3SF0A 2PQ0A 3AR2A 3HYCA 4Y3UA 3L5KA 1U7OA 3QNMA 4HGQA 4BX2A 3ZVMA 2OA0A 1TA0A 1YNSA 1NF2A 3QUTA 4JDPA 2YMMA 2QLTA 2WF9A 5ALKA 5AVQA 1TJ5A 5AVXA 4PNHA 1N8NA 3PDWA 4UU1A 3U19A 5AW5A 1WZCA 1F5SA 3SKYA 4FFDA 3QXGA 3K1ZA 4YCLA 4C4SA 5ALDA 1Z4LA 4UAUA 4IG4A 4FYPA 3WK5A 2I6XA 4Y2YA 1RKUA 4Y2TA 4Y2VA 4J2TA 3SKXA 5ALYA 3QUCA 4UU0A 4YH1A 2HDOA 4OHFA 2FEAA 2B82A 2I55A 4BYGA 1YDFA 3E81A 1ZS9A
chains in the Genus database with same CATH superfamily
1P0FA 1IK4A 3AG5A 2DULA 3DMDA 2DWUA 4ME6A 3PIRA 1CJTC 4KLIA 2PVCA 3SYRA 3K9WA 5DYYA 4QXAA 1JIVA 3C1OA 3FWZA 4WEQA 2I29A 2GSWA 5DGHA 1JS1X 4OJ6A 1A8PA 4OJQA 3ME5A 1E1YA 1SQ5A 3FUTA 4F86A 1AUQA 4P3KA 4FNAA 3M3HA 1UODA 2CLOB 2PX4A 4YP0A 3IEIA 4V1CB 4YK7A 2PLNA 3CG0A 3T3MB 2HDNB 2A9RA 2J9YB 5HR7A 1EK6A 4BFXA 5DBHX 1SIBE 4LTNA 3V7WA 2HHSA 1CP3A 2AWNA 3M6KA 3O8NA 2XY4A 4R2HA 4JQZA 1CRXA 3DEJA 1XZCA 1UK7A 3OQVA 3UG7A 4XPIA 1U99A 3OAAD 4R05A 2IOFA 2CNBA 1XCBA 2B30A 2QR5A 3QTBA 2RKWA 3TAHA 1Q7BA 4QQNA 3NYRA 5DP2A 1I51A 1U7UA 1ML3A 1HFKA 3W1WA 5CAEA 4LGVA 3FVVA 4AUMA 4J0QA 4J91A 3HNOA 4M76B 1XFAA 3HVRA 1A9YA 4PHTA 9ICBA 3GBSA 3TTSA 4M53A 3N2GB 2PMEA 4PPGA 2QRVA 3LAWA 4ZCPA 1SVIA 3ZKWA 2AC7A 2OMKA 2BGUA 4WBSA 1DDGA 4HP8A 3HB5X 4MV0A 2CD7A 1E2FA 4DHEA 1IM5A 4P53A 5F51A 2HJRA 1JBEA 3GARA 3HKCA 4O3PA 3RRYA 2PA0A 2AQKA 1FZTA 2FMFA 1JJIA 1O8CA 1W4ZA 2RH5A 3IJEB 2JHFA 4I4TB 5J40A 3QZ8A 4NCAA 1J1UA 4XJXA 2COUA 1Q84A 4N48A 3RIHA 5JYEA 4FX5A 1L2TA 2VTVA 4DTCA 1Q1NA 1FIQA 1M7BA 4XDGA 4DY6A 4PNZA 3ZNQA 1OJLA 3GUUA 3N8DA 3RSGA 4R1UA 2QNIA 4JUZA 2GWSA 1AKYA 4ICIA 3B5EA 3ET4A 1YSCA 4J3FA 1E1MA 1SHJA 4CMKA 2CMDA 3R4VA 2C57A 2G40A 2JKVA 2LW7A 2PY6A 4ZAVA 1R10A 2JBAB 8ICKA 2HZBA 1FFWA 1ZWLA 3MXTA 2F4VB 1JPUA 4MQUA 4CFSA 3EZ2A 3DH0A 1E4VA 2W37A 4QOHA 2O7RA 1XO0A 2ZVPX 3ORHA 4AAYA 4DV0B 3O8DA 4L50A 4LOHA 2JHGA 3FTDA 3UCEA 1SCQA 1ECFA 4UFNA 1YOVA 3A0RB 4CM9D 1JMSA 4S04A 1ZNYA 1M2WA 1DI0A 2ONKA 4BEJA 1R8YA 4AS1A 2IODA 4HVLA 5FFFA 1IJBA 3RVLA 3PNPA 1MOZA 2MMGA 1H42A 2LNDA 2ZU6A 3BBLA 1W46A 3N0VA 3RAPR 1CUXA 4FXPA 5JC1A 3TQIA 2AOVA 2W04A 3HPQA 4DLGA 1E5LA 5KREA 5LMZA 1M73E 1FA9A 4RV5A 1N5DA 1X14A 1ST3A 4C7MA 3TUIC 5E4JA 1G59A 5CBKA 1Y6FA 2JGIA 3IMCA 4OQLA 3WYGA 4BWVA 3LS2A 4FDAA 2XGPA 3R6WA 1ZK3A 2BFEA 4ZT6A 2YV5A 3TZBA 4TLDA 3MAAC 2F1RA 2IPOA 1H22A 5DRTA 4DMKA 4AX4A 3AVXA 3FPJA 1OIVA 3QXGA 3PGA1 3OA0A 3CURA 4RPJA 3KJGA 3HABA 2JZCA 4HG2A 2Y9UA 4F4JA 3ZCUA 5CIYA 5CG2A 2E4UA 3PLNA 5DBFA 2IS1A 3NVKI 2XSZD 2EKPA 3UAXA 4DIEA 4I2VA 3W8DA 1N5XA 4JJ4A 1P6QA 4X3PA 3ABRB 3HXPA 1O95A 2RD2A 1LLCA 1AM4D 5KSOA 2A2ZA 4AL4A 4QIHA 1DPGA 2H1CA 3RBEA 1YR8A 3KZXA 1FJXA 3RH6A 1SV4A 4TOIA 4MR8B 2ENUA 3H65A 3RJMA 1OA0A 2IXFA 2BFAA 2LTAA 5U4XA 1FSFA 5AUPB 1WSAA 2ZQ5A 1GUYA 1C4XA 4P3NA 1E1RA 3UMCA 4N7MA 4I1SA 1N0UA 1RE0A 1H2RS 3UMBA 2BM1A 2CF5A 1GUAA 3RTCA 4JCCA 4ACAA 5DBOA 5M29A 1PUJA 1PVQA 1F6WA 1NNLA 2O6HA 1Y3BE 4FEGA 4F5PA 4MMXB 3OTQA 1GHTA 1ESEA 1VL2A 4B75A 1SG0A 3PGJA 5BV7A 1A69A 3NFYA 2AXNA 1SIUA 3L41A 4P0TA 3LT0A 1XZ8A 2OHHA 3LUCA 3UJ8A 4E21A 4XIGS 1H6DA 3F6RA 2G82A 5DGIA 2Q3LA 4W5RA 3RTEA 1L5YA 3OT1A 5DBAA 1C3OB 1RRCA 2C7OA 3WG9A 2O2ZA 4AN0A 4GC5A 4TKMA 5DWQA 1G3IA 3DLAA 2JGDB 5FWXA 4ABTA 4PPNA 5CDSA 3C4VA 1U8TA 4P0PB 2PT6A 2J6IA 5E2AA 3SQOA 1O94D 2YQ5A 2WKSA 2EFYA 2C29D 5K0CA 3JQGB 1Y1RA 5CX1A 2B98A 4FS1A 1SR8A 2XCIA 3O75A 2X5XA 2KJ8A 1Q6YA 3I1JA 1EI9A 5EN4A 4KIJA 5L4NA 2H08A 2ZBVA 3TPZA 4PEVA 4JLUA 1Z25A 1R5JA 4WBNB 3CIOA 3PDIA 5TJ9A 5A06A 3BRWA 3GFRA 2F3PA 2KJQA 2DY0A 4U7WA 4J7AA 1WXQA 3T9AA 4JEMA 4GSYA 4QDOA 1CUZA 4DIMA 2B92A 2Y0EA 4JI0B 2BEJA 4EGAA 4HKTA 3AW9A 5HCIA 1DXOA 5AVUA 2HF7A 5ALJA 5HUJA 3KYBA 1Y4DE 4RE6A 4DLRA 4Q0MA 1O4VA 4J90A 1VOTA 2LGJA 3OEYA 1C9DB 4O3FA 3L7YA 3C16C 4XJSA 4R71A 1O5TA 8ICUA 1NIJA 6PFKA 1KVUA 1D1SA 4K8OA 3W2GA 3JYHA 1E3WB 5K09A 2GK7A 1KKXA 1L7DA 2FZWA 4TRMA 4B2LA 3BE4A 1CEQA 4H3VA 3ZCTA 4IL6U 5BN3B 1JR4A 1Y5RA 1R0XA 4G67A 4TTJA 3AEKA 4U9IS 2KG5A 7ICLA 5ERXA 3HV2A 5CDFE 1VFPA 3OPXA 1MV5A 5K0EA 3N28A 4EY3A 1PR4A 1ZRMA 4Z4FA 1SBIA 2XHZA 4EW2A 2VBIA 4RVHA 1SZCA 5IH7A 4O4JF 4ATNA 1YT3A 2GK6A 1MJNA 4P33A 5B12A 1RPTA 2FMTA 5FEUA 4FKMA 3ESBA 1FBNA 5MGNA 1A76A 1KZ7B 5IPFA 5HOQA 3DE1X 3TQFA 1NKCA 5AM2A 1JFLA 2EZ4A 4CKYA 1COKA 1Q6ZA 5IZCC 2ON6A 3R3JA 5FNZA 1GLVA 3M3PA 2HJ9A 3LQ2A 1SZPA 3IAXA 2V7WA 2NVUA 3UJAA 3NDJA 4DB4A 4YRLA 4NNOA 2WF9A 3TDKA 5BSHA 4BLUA 1E6KA 3E05A 3ENKA 5IKXA 1M8JA 1EFRD 3F0TA 4DJFC 4R51A 1SKWA 4X6XA 1MA7A 3M83A 5GONB 1F06A 3BS5B 1S2OA 3SR4A 1QCCA 4FFRA 1QUFA 2XXAA 1CUYA 3FFXA 1W0KA 2J3JA 2YL2A 4P7JA 1ORDA 1U7HA 1E6UA 1HUZA 4D81A 1RLIA 2CXNA 1E2EA 1HSZA 3O0FA 3L93A 1RPJA 2X0EA 1P9RA 4X00A 1PK1A 1Y7LA 1N4AA 3USES 1F8UA 3G2MA 4HLUA 2QXUA 3UAZA 5HKOA 1REQA 1ESCA 5EERA 3IBFA 1UQVA 3RV4A 3QGMA 8ICBA 2WWIA 1U81A 1OXVA 2KZZA 3IUNA 4OUDB 1D9ZA 2LXNA 5FADA 5ALUA 2W9BB 1YZQA 3HO6A 3ZHYA 4ZEXA 4WNYA 1VHTA 2ZJFA 2UXCB 4G5XA 3BXOA 3PJFA 4CMGA 3R3HA 3DW3X 2PSJA 2CV2A 3U3ZA 3KPUA 4XQ8A 5SYMA 5JDCC 5BYAA 4PTZA 3HKBB 2XCRB 1G5FA 5G4LA 2AWOA 4ENWA 1ZD2P 4D9FA 4XDHA 4BMSA 2BN4A 1IXZA 3DZCA 5JTTA 2A1JB 1G17A 3ZBTA 4NCHA 3A06A 1C7IA 3ETHA 4RQ0A 3DC7A 3G68A 4QPDA 3CHYA 1IN1A 5BXQC 4GYYA 3BK1A 4MQEB 3WB9A 3WMEA 4JXKA 5BNTA 4QYIB 3EMKA 1WBDA 4DFJA 4HEA1 4LMPA 2VF2A 4ZT2A 1BWPA 3FR8A 4WADA 4COKA 2YXPX 3H17A 1JI0A 3RSQA 4OM8A 5AVOA 3ASYA 4MO9A 3HCRA 1PL0A 3NVVA 2NO6A 4A8JB 1MOPA 4C0JA 1YCDA 3EYAA 2V9CA 2QHXA 3PTAA 3E8XA 1E79A 3RVBA 1B93A 5DNVA 3GWZA 3C3XA 3AJ8A 4DQVA 1VLMA 3PUKA 3ITNA 1R5BA 2I7XA 3CNOA 1X9XA 2UYGA 5K4LA 1C30B 2Y1KA 2CXRA 3TPFA 2HMVA 3EC1A 3MAGA 3P27A 1A2KC 2IZ5A 1QSGA 3B53X 2CXSA 3VZPA 1YL6A 1DBPA 1U7PA 1G8YA 1J0XO 3PW7A 1RPZA 2PUDA 5TR9A 1GT91 2A4MA 1QLJA 3DDZX 4MGHA 4IGKA 2RAFA 4K46A 4AJIA 4YDQA 2CNLA 3KU4A 1KAGA 1SIJA 4RO0A 2VH5R 2C7GA 2JHAA 3ABQB 1HRKA 1IPHA 3U7IA 3BL5A 4LDZA 8ICAA 2IYUA 4HDSB 2JEGA 4PY2A 4JGBA 4AULA 2RDMA 1S8OA 4FMCB 4RZSA 3GFFA 2V6MA 4C7BA 3S2ZA 3V9AA 4NK4A 4OMFG 2IA5A 3WK8A 5KWJA 1QC5A 3K9BA 4MRMA 5H70A 1KFCB 5K3DA 1YOBA 3OT5A 3FNBA 1WY7A 1E0SA 5HG0A 4FHDA 3MGVA 4CUJA 5EKTA 1K5PA 4GHWA 3VU0A 3DJYA 1JFVA 2OK7A 5HIAA 4JB3A 1BMDA 2KWIA 1KQGA 1SXGA 1SCKA 3G0DA 1RD4A 3L8ZA 1OZFA 3VR6D 4BB0A 2P9FA 4C0BA 1SA0B 1EFUA 2PBRA 1GEEA 3IAEA 4FZRA 4W1QA 3K0KA 5CAEB 4J7UA 4J94A 2ARKA 4IICA 4JI3B 1LBIA 1AQJA 3EUWA 9LDTA 1E1LA 8OHMA 1CPYA 7MDHA 5TVKA 3QV2A 4K6FA 2LM1A 2C5FA 4TTVA 2GOYA 1EFHA 2JEFA 3WL3A 4M8NE 3UWSA 2E37A 3WRYC 1YRAA 4KLLA 1U3DA 1V9PA 4LHWA 1JKFA 2VZEA 4U7PB 5HOEA 3DOCA 2E1EA 3IE0A 3MOGA 4EY7A 1KFDA 3ZYZA 5J0PA 3UJCA 3Q5DA 5JSHA 3G9XA 2PGDA 1U47A 5E1DA 2X2PA 2ZYVX 3CTPA 3A4IA 1XZHA 5KFIA 1UPBA 2NZWA 1JLMA 4N7BA 2D62A 1YBMA 1O9BA 4OHUA 3U6KA 4WZBE 1N2CE 3P94A 4O1MA 3BZBA 1E5DA 5BP7A 3KZ1E 5J2HA 2VWHA 4KXVA 4IJKA 1YHZA 1XRRA 3SXUA 4S1PA 3IUBA 3OE7A 4PPXA 4EGJA 5SY6A 2XZLA 2JGAA 2IZ1A 3WDLA 2PZMA 2BI7A 3S7ZA 4GD3Q 1WBBA 3ICEA 4EJSC 1MD9A 4GKKB 3WYCA 4OY3A 1RWQA 4ZVLA 3STXA 2L18A 4EELA 5KQLA 3DWGA 1F3OA 4MLPA 5I8WA 1BQ4A 3KVOA 5A4IS 3R3UA 4ZT5A 7GPBA 2IY9A 1UXGA 2W4IA 3NHBA 1FYXA 2NXJA 2BQ3A 4AQDA 3H5LA 2HH9A 3GJ3A 4IDBA 4ED0A 3CZQA 4N39A 3ZWWA 2XTMA 3TRIA 5C7OO 3ZVKA 4DSOA 5COQA 2QP9X 3FETA 4BUJA 3GRCA 4TWIA 1TKBA 3ZHSA 3KJIA 3X2EA 4R41A 2B7BA 3LQRA 5C7IO 9ICTA 1QG4A 3E0QA 3BQ0A 1C80A 1LBHA 2YFYA 1EP2B 1VKZA 2QM7A 2FW7A 1LBQA 1SO8A 3HRKA 2AVNA 2P68A 2VJNA 1L3SA 1EP1B 5HRAA 2A78A 4QT0A 1HDXA 2ZIAA 1RRGA 4P4TA 5KSPA 1NUQA 3LKBA 1L1QA 3BMXA 3D5QA 5DSTA 4ZXPA 3CVOA 1KH1A 3BD7A 3H6KA 3CW2A 2Q3BA 3W2TA 4HQLA 2QP3A 3TR0A 4BWYA 4C88A 3FN4A 2JFNA 4FKZA 2FZCA 2GPBA 3NH6A 1P8AA 3P9RA 1J9GA 1E2GA 4XXHA 5SZIA 3Q6IA 4M8KA 2YN0A 2GUWA 2M9MA 1KI1A 2BFEB 3M33A 1JE1A 4R2JA 4PGHA 2O5RA 5AK3A 4XB2A 2UZ3A 4PXSA 2FR1A 1B3BA 2FUG6 3CR3C 1JX6A 2Q27A 1N9ZA 4GECA 3V4OA 1FLAA 5LDHA 3GFVA 1C1YA 1JHQA 1RCTE 5CNMA 2PDAA 5KL8B 4IDCA 1T4DA 4I2DA 4JYMA 4H1VA 4EG7A 4LA4A 1U0RA 3MTIA 1U3GA 4BV9A 4Z4GA 2E8NA 1RQXA 2V7BA 3ZZMA 4IIXA 1G3RA 1EX9A 1D5WA 4MUHA 2A5FA 4DEYA 2EZTA 3QBTA 5J58A 4BO1A 1KIMA 2FPRA 3R23A 4M1WA 4B3XA 1N75A 2VYVA 4J3NA 4GOKA 5JYBA 3CWZA 3GF4A 2QMEA 3L0IB 4Q37A 5F77A 1Y80A 1EZZA 4E4RA 1GZ5A 1C1DA 4PLYA 3LUGA 5CLQA 2GXQA 1MAAA 2BEUB 4FLFA 4LZZA 4MTCA 2BJWA 4H2DA 3HMQA 2FRDC 1UKAA 4HYTA 3AKYA 4WCFA 4I1UA 3WI7A 4DA7A 2FPIA 2P9HA 2CMKA 3O9ZA 5AI9A 2VBFA 4B76A 1JEOA 3OX3A 4Z53A 3T54A 5EJAA 5CW2A 3JPOA 3P9XA 4UTPA 1R50A 3K5HA 2GKGA 2AI2A 3M6ZA 3DDWA 1MBZA 1RXSA 2FWIA 3SV4A 1N8NA 3H2SA 3IR6A 3KT0A 1XHFA 4DVJA 4KXWA 4DMHA 1USKA 4CM8A 4BFWA 2FAXA 2QRPA 4HPJB 4ON9A 3H6GA 4RD2A 5CX1B 3AFGA 4CL8A 1JEAA 5BOLA 1B23P 4UBCA 2ZT6A 2RHMA 2G9NA 1JL3A 1F51E 3SAHA 4BNDA 3D59A 1R0RE 3PDIB 4MVJF 4F1WA 4TUPA 1MQ8B 4QWBA 1N32B 1HE4A 1NJ8A 4FYKA 3FYDA 1T9BA 1U0EA 1D4FA 5T4FA 2C8LA 1GA1A 1NKTA 1AUXA 4RFLA 1Z5VA 5KAPA 2CKDA 3NHAA 1G7CA 1I24A 4LY3A 1M1YE 3OH8A 3V4LA 2IH5A 3R0VA 3A4LA 3BORA 4NULA 3ESYA 2Z2YA 3HVUA 4JVMA 2FWPA 1IBLB 3MK31 1JG7A 4CLOA 1JMKC 4MWZA 3PGLA 3IUPA 5IFLA 4I6EA 1V97A 3DMYA 4DQUA 4AP5A 1FMTA 1ECJA 4OHXA 4E2YA 4YRDA 1UADA 3DTVB 3FYHA 4YI5A 1T5TA 3ECCA 5ISMA 5KKCA 3KTAA 3KQLA 5A4KA 5IT4A 1VL8A 4RTNA 4U5XA 1SG6A 5KVVA 4OX9B 4UCQA 5EXTA 4QWCA 2OCIA 1KWGA 3AEKB 4DRZA 3Q6MA 4WLUA 4CM5A 3CNQS 4GRIA 5JD5A 2YX1A 4E5VA 3RBAA 2IY7A 2O8NA 2BFCA 4AVYA 3UJNA 2PGLA 3IXMA 4JC4A 3A05A 3UK0A 3OOWA 3MB8A 2NO7A 2PKCA 4PRKA 1WXHA 3ZVLA 2H59A 4CL3A 2BHSA 1SUFA 4DSUA 5F1OA 2ZS8A 1YHNA 2EKQA 1EFKA 2LPEA 2RI6A 9ICOA 2HREA 1S3FA 1U9CA 3DFZA 4XA5A 1QQBA 2ZSEA 2P2YA 2D4AA 3ZY5A 5J0WA 2IVZA 4HY3A 4TQRA 2ASEA 3NCHA 3PD7A 1ZQIA 1SD5A 4LWZA 2R6ZA 4YEDA 4KFSA 1LTQA 4EYSA 2DWCA 4F3YA 2ZYSA 2NACA 3K5IA 1JB1A 3OSPA 3VVBA 1KF0A 1YE5A 2NVUB 3JV7A 3LWBA 1WMEA 4Z9AA 2ZT7A 4OO3A 1POWA 2NV3A 4ZODA 2BGMA 4YJ3B 1UT5A 1QYVA 5KFKA 1J7KA 4XIYA 2BPOA 2PMDA 2FUCA 1S3IA 2D1QA 4JB2A 5EJIA 1TM2A 3GLIE 3DE2X 2HCBA 1OB5A 3MUFA 5JJ5A 2Z2KA 2YYSA 3VBCA 2H92A 1GG5A 2XEDA 3LZCA 3C5FA 1TM5E 2G1KA 3AKZA 1AA9A 1QHIA 1LV5A 4EPVA 1VLQA 1E6LA 1UJMA 2ZTCA 4I50A 4GBMA 3ELWA 3NASA 4C0LA 1C1XB 1PK1B 2GK3A 4C0HA 1SXJE 4E1AA 3T5KA 3ZTWA 2FSGA 2P3QA 3MJVA 4X93A 3NT4A 3ZZ1A 7ADHA 4MROA 1SVLA 2IHKA 3RI3A 4DV7B 3COWA 2ZRGA 4M0FA 1E3EA 3NO4A 3L18A 5BQOA 4N9QA 1PR9A 1R12A 3O1LA 2XOXA 1J8QA 4EFKA 1QE3A 2PL1A 5IT5A 5PGMA 3KAKA 5CRIA 3T0IA 1J23A 2Y0DA 4P34A 3RB3A 1XJ5A 4Q02A 4OGGA 1CBUA 1UMCA 2ZSIA 2ABWA 4FCWA 3D6AA 2WZBA 4MUGA 1AUOA 3TACB 2Y71A 1KQ3A 3WO0A 1CZOA 4NSNA 2X1HA 3KK0A 3RF9A 2WHRA 3I4CA 1N1GA 4UB4A 4DLSA 3RJKA 3FOFC 2PNJA 4JS0A 4LYGA 3DOFA 1E2DA 5THXA 5JXGA 1F0KA 4OSOA 3WVNA 4AY3A 5REQA 2XYRA 4LHEA 4MTLA 2BMWA 3SF0A 4B35A 3R8FA 4MIYA 4IINA 4X94A 4TYMA 2RG7A 4R65A 5C31A 4ZTZB 3T3HA 3OC6A 2P6OA 2E87A 3ZE2B 1Z4LA 3FW1A 2GRJA 4BNWA 3MFYA 3H9EO 4KLNA 4UU0A 3INRA 3RRNA 3NBZC 3MGCA 3K0CA 4CM4A 4KQFA 4TTIA 2FE4A 4HDAA 2BHLA 4BUCA 2QE6A 5TJHA 3HYSA 5GTDA 1TFUA 1D2HA 1T36A 3QOYA 1QG6A 4YRBA 3KC2A 1U2DC 2K8AA 3FB1A 1XVIA 4LOLA 4B43A 1YU6A 4CT4B 5LQJA 2HPVA 4WKCA 1DO8A 1P7YA 4PYKA 2R7KA 1P72A 2X0DA 3T9DA 1BZYA 1E3IA 1QRDA 4F6CA 1ZQSA 3VJKA 3TVTA 2HDWA 4F2DA 5KFJA 1ARZA 1AK9A 2OC9A 5FLYA 1E92A 1VHDA 4PGQA 1UBHS 5JPIA 3B1FA 3N0WA 2AGVA 5HGJA 3B3AA 3HYRA 4F6LA 1NNI1 2BZSA 2P5SA 4QOIA 1ZCFA 2WAQC 2IJGX 1D9XA 3PNMA 3P4XA 1X0VA 3RAGA 4CIYA 1ZQYA 2DPXA 1E2KA 3M2PA 5ECDA 1DINA 3GRKA 1K6IA 2VYNA 2VPYA 3VX4A 1MN6A 1S97A 4X7PA 4AS3A 2QDXA 3VR5H 1C2YA 3NH9A 3GLFA 2IT1A 4QWDA 4XX0A 3PQEA 3Q3VA 3BJYA 3DF9A 1D07A 3RVJA 4E3WA 1KKLA 4YASA 1OI7A 2YFHA 1U80A 3G6YA 2KOBA 3C5VA 3THOA 3NS7A 5ERGB 4HPXB 1PUZA 3PQ2A 3O8BA 4J2OA 2YRXA 1SL1A 4AKHA 3GFOA 4FLEA 5KU7A 3HVIA 4F1KA 3JARA 1Y89A 2WILA 2DWOA 2EG5A 4KRYA 5IHPA 3N8KA 5JMTA 3R6TA 4D9EA 1IJFA 2GGSA 3H5OA 2NIPA 4JVOA 1CEYA 4HYQA 3T1VA 5LQAA 2A1IA 1UZNA 3JAMA 4PO3X 4C4AA 5D3MA 3KHHA 1WXWA 4GRAA 2NAPA 1JMVA 1FUEA 4IRXA 3RRZA 5AK5A 3MZ0A 3JATB 4QUAA 5JALA 4OL0A 2Q0QA 3AEYA 2WAMA 1L6RA 2Q9AA 2GKOA 2V5UA 1BXKA 3I61A 4AKTA 3HCWA 1NK5A 3ANMA 2IFTA 2V3VA 4ZZ2A 1KFEB 3VZRA 4RELA 4NVRA 2BUCA 4V3CA 5LQCA 3OTGA 2JFWA 4E15A 1VE1A 3JD3A 2BGKA 2XUKA 4D46A 3O84A 2RIRA 3S8YA 1MVOA 5YASA 1JA1A 1RQ2A 2IX3A 2O0LA 3ICVA 4DJAA 4QPNA 3ZE8A 3SXUB 2PZAA 4EMUA 1YCGA 1CWUA 5AOBA 1FQWA 2VJLA 1QUEA 2BFNA 4OVKA 1B7GO 4AKSA 3U3MA 3TOCA 1P1IA 3O9VA 4EK9A 2HBMA 2EZZA 4GP7A 1T9GS 4C29A 1PJLA 5HIIA 1X92A 2CEAA 2KX7A 4PYOA 4TL7A 5JFGA 4Z5XA 2QN8A 4CVNA 5EA2A 3SAJA 3EXG1 1I33A 1T5SA 5CM2Z 2OSBA 2HU8A 4C0AC 3BH0A 5KSZA 4NOJA 1ZN2A 5BQXA 2EJUA 1Z7EA 2NQTA 1EFLA 2LDBA 2OMEA 1GRVA 5IJ0A 2HDHA 1E77A 3DVSX 4B9MA 5EEGA 1LS1A 3OPYI 1E5QA 1OH6A 1AB6A 4V0RA 1O96A 4G0ZA 5DLPA 4RGVA 4QUGA 4EMTA 1NY6A 1KFTA 3E35A 1ZEJA 2ZUTA 1SKUA 3R5JA 4BBAA 3KYIB 4FYPA 3OQNA 3W06A 2AJLI 2Z83A 3IVXA 1ZY2A 3VH3A 3ETEA 3IEPA 1ZG3A 1U0SY 2EJTA 2OZEA 4GC6A 2YXEA 3BEOA 2GZDA 2D13A 5BUSA 4QFBA 1L5MA 1XA0A 5LXTA 5GV8A 2FK7A 3WJ2A 3WC4A 1ZJNA 4YXJA 5ALMA 3ML1A 3DPSA 4CL2A 1QV6A 4D0LB 4UAZA 1SKSA 1KAQA 3LYAA 5DN6D 4XYBA 4AJ1A 3H5RA 3D2CA 1OWPA 1NQOA 2XIQA 4Y1FA 4MVJA 1GYPA 5FOQA 4I27A 3PSTA 3CRQA 2X13A 1LDGA 1V16B 3OFJA 3VHXA 4S2EA 1PL7A 4HNQA 1ZO8A 4MH0R 3DWFA 3OP4A 2OO7A 1FF9A 4H0CA 5K3FA 1DKRA 2WLSA 4U0KA 1T4MA 4DLKA 2ZWIA 4CEJA 1D9DA 8MHTA 4UTVA 1ZI8A 2IU4A 4RKFA 3LO8A 1ML4A 3A3NA 4D02A 3QOFA 4DV5B 1FYEA 4XLZA 2P3SA 1NKSA 5KOHA 3JQFC 5KOIA 1ZN9A 4M1MA 2RGEA 9LDBA 3ESDA 5BNIA 1VJ1A 1XQ6A 4P4UA 2FVYA 2QZ9A 4LK3A 3TANA 3A7EA 3AX6A 1AKUA 3NLLA 1IG3A 3O94A 4QM7A 1OI3A 4BY9E 4WCFB 2WJZB 1QCYA 2YNMA 5EWGA 1E2JA 1SHZA 4UNSA 2FRXA 2G4VA 3HGQA 1F5NA 3T4EA 4O4JB 1E2LA 2J30A 2D06A 4LRSB 4O4IF 4D8VA 4YFYA 1KXZA 1J2UA 1KBZA 4YN4A 1L7PA 3QFHA 3DZIA 3R24A 4B82A 2Z7JA 4L3VA 4BP9A 4YT8A 2QAGA 1C14A 1YDMA 1KEJA 2WRZA 5HS6A 1KDHA 1FNSA 4HRAA 1MZVA 2ZRAA 4W9RA 1Z4MA 4RFSB 3S27A 1V6CA 1IAQA 3G6XA 1ZVQA 4WLNA 4YDHB 4PC1A 4AYBF 3UMGA 3WGJA 4KE8A 3I9NA 4LCEA 3QTLA 4BTLA 2D3TA 1FQJA 3IP5A 4I9UA 4YDRA 4ZU1X 3HVHA 5KT3A 8ICOA 4UB3A 4QQRA 3I3SR 3NV9A 1NNUA 2J45A 1A9XB 1Q1QA 1EFAA 2GZ2A 1JSLA 3K9HA 3T9EA 2OM6A 4R66A 1DLIA 3RIMA 3OCJA 4CKWA 3W2IA 2VBGA 3T94A 4JLJA 4WLOA 1QBGA 4FK8A 5L3SB 9ATCA 4S35A 4ND7A 1U8XX 3OLYA 4CLOB 4DFDA 4IIBA 5KMGA 3LC0A 3SDSA 4UU7A 5JDIC 5CT9A 3CLRD 4PZUA 3DAHA 3GIJA 1OWNA 2GCNA 3D7RA 1WVMA 1MJGM 5GZ6A 4IGFA 3JQ8A 3BTSA 3KTAB 3DAYA 4G65A 4F84A 4AURA 1AGXA 3DP9A 4LF8B 2LM4A 3KS9A 2WNIA 4ZPJA 1FLDA 4D3ZA 2R5FA 2YASA 3LPDA 4FOPA 2HBZA 4IS7A 1W48A 5BWMA 3U0VA 1W4AA 3PX0A 2KFNA 1WD5A 5KVAA 5HGXA 1GL6A 3GPIA 4B34A 4KPUB 3B6JA 4MW7A 3HH8A 3GRVA 1MGOA 4IVRA 1KA9H 4FFDA 2AW5A 2W2LA 1D3AA 3HFGA 3GQVA 3UYKA 1NQVA 1PJ3A 4RZHA 1DKUA 3RGGA 1F48A 4HFRA 3RW9A 3Q9LA 4EL5A 3W4KA 1PHRA 4JQCA 4YR3A 1YU9A 7REQB 1T15A 3HSKA 4LRWA 2IYZA 2UZAA 3AZPA 4M7WA 5EC8A 4CKXA 5KUTA 1Z6QA 2A19A 2G5PA 3T5HA 4DBLC 2PKRA 4D99A 1RAEA 4M9QA 3HKZF 3QEBZ 3PFWO 2ZE8A 4G0VA 2H5LA 1P6UA 2Q29A 3UA3A 5JASA 4OU4A 1E96A 3HJAA 1Z7WA 5BSRA 1LY1A 1NPYA 4A0RA 1DKOA 2WM9B 4M9RA 4L6CA 2J09A 1JSCA 3KVVA 3V4VB 3VTAA 3U16A 4TTTS 4R8KA 3M6UA 4JKIA 3PUXA 1PZGA 2Y0PA 4QO8A 2Z5LA 3SENA 4WI1A 4B3IA 5C4IA 2GYUA 4DARA 3RHFA 1CU1A 1G6HA 9ICXA 5DQGA 2R8KA 1DJLA 3QEAZ 3F9RA 3HLKA 2HQRA 3K70C 4RK1A 3D02A 4TKVB 2EIHA 4NCXA 3FSGD 5KKNB 3I2YX 3PX3A 2TMGA 4MR9A 2O4UX 4LVSA 5ALTA 1JZTA 4M0AA 3ZIAD 3TQ1A 3LPAA 1PGPA 2Z09A 4EEYA 3VPXA 1OYYA 1AQLA 4ESOA 5CVEA 2UUAB 1YC2A 1BD3A 2YOGA 4O59O 2W70A 3KALA 1S3GA 3CUWA 1UMCB 1QFMA 1N6NA 5BYJA 2W2KA 2B1IA 4S1TA 5KWVA 1QP0A 2ZXIA 1LDMA 4FHGA 5I5EA 2FUG1 4KDEA 1LF0A 5I45A 2ZIVA 4Z49A 3WQBA 2JH3A 3OLXA 5CYGA 1LPOA 3IAHA 1U0GA 3AEXA 3E8MA 5LIRA 4E2XA 3EWAA 2IW1A 9ICVA 3KWFA 4RY0A 1RPLA 8ICHA 5B1EA 4Q21A 4GMFA 1EE1A 1QBKC 4KO2S 2O19A 3RC1A 2P6UA 1RC8A 1PT5A 4RPIA 4EGSA 1A4UA 3DNMA 2ZT8A 4L6AA 2F1JA 4QULA 5ECWA 1KP9A 3ID6C 4JD5A 3FYUC 3VX3A 3QU5A 2Y2UA 4DKXA 4BLWA 1EB8A 2RG1A 3OY7A 3IAAA 1XC7A 2BOVA 3JASB 5K2OA 1PJ4A 4KLOA 2QTRA 2OY0A 2I6UA 4U2KA 1FFUA 3EXHC 3NAQA 1U04A 1NFFA 5DN9A 3T5LA 4U02A 3DXZA 4RESA 1P2FA 2FR8C 4HH4A 1SBQA 3NTUA 3PUYA 2IHUA 4BEBA 3RK4A 2J7KA 3O83A 4RKYA 2OOSA 1CQIA 1H94A 1JI7A 1WSDA 1TK9A 3RSCA 4DANA 2JRLA 1ZM7A 1ULUA 2IH2A 1T2AA 2XVMA 1P1BA 4AICA 1JPJA 1TECE 4WXMA 1RJEA 3DVRX 3GJ8A 4ZYTA 4I4NA 1JEDA 1RIIA 2WAOA 1TVKB 4PYQA 1XTPA 5BPCA 4KYUA 4DQSA 3I6BA 2HBRA 2P2CA 2O9JA 1A8UA 2EC5A 4FHZA 2DU8A 3BWYA 3NG1A 3FPAA 4KLFA 2PH7A 3EXG2 1MENA 4KMOA 3B9PA 2NSHA 4I2CA 1XPJA 3VYRB 4RAQA 4DCOA 1P2TA 5T14A 1AA6A 4F96A 2O8DB 4BNMA 1R0YA 1LPMA 3C23A 1T5DX 2IRWA 2PGAA 2ZAIA 1YZNA 5LCXA 4F46A 3UHOA 1IM8A 4HNRA 5JU6A 4A1FA 3G1WA 2VH2A 2XXBA 1Z0UA 1TAGA 5JSKA 1XG5A 2D2IA 4HF7A 2ALJA 4G41A 3R76A 2JA1A 3LBAA 4HQRA 5JAMA 1OYVA 1U5BA 3HE3A 4PXYA 3T35A 4YJKA 2W6PA 1JW9B 3ESZA 3WGQA 2I7TA 3M1LA 2NYUA 2R6HA 2R66A 1ZVMA 4B47A 3KKKA 5JRTA 2FGKA 2FSUA 5DP1A 4TQUS 1JHRA 3J81A 5LJIA 2PL3A 3WV5A 2R65A 3IV6A 5TMPA 4AMGA 1M0WA 2VJAA 3KYJB 3NRZA 1MO3A 2XCPA 3UENA 4UHBA 1C0EA 2ECOA 1UBMS 1IOWA 4YJDA 4BKUA 3V00A 1J56A 5L1JA 4CV0A 2ESEA 4K5QA 1IN5A 1BNCA 2OCAA 4PHPA 4QGBA 4KO4S 3VKFA 4QZEA 1IYZA 4PC3A 4G1UC 2FG7C 5CG1A 1G63A 1WRBA 3ZU2A 1KDOA 2WF5A 4W7HA 1ZIPA 1TZBA 4YLYA 1RZTA 5H81A 3FDFA 2OXRA 3C98A 5DLYA 3RTAA 4D44A 3A4TA 5A2QA 4OA8A 5CLJA 1GPNA 5F35A 1TQHA 1SULA 4OHBA 1I2AA 4EYIB 3EUB2 5FXMA 3PQDA 2V7PA 5J2BA 4M9UA 1Z8HA 3OQIA 3MCWA 2WA2A 5KCMA 3GU3A 1QO9A 1NK9A 1DTWB 2TECE 1H93A 4IXTA 3G49A 3HKDA 1LV8A 1M1UA 3C39A 4UAVA 2ZE5A 1UK9A 2EX4A 2JHCA 1RXYA 3JQ7B 4ZGBA 3E2IA 2ZB3A 5IJ0B 3GIIA 1DAMA 1A72A 1Q3UA 3L49A 2Z98A 2GM9A 1H2FA 2FSFA 1N92A 1DG9A 5KG7A 3ADCA 1I7SB 4JL8A 1BH2A 5KNIA 3DYIA 2CMHA 4CN9A 3H5WA 3WK7A 5H68A 4EJ0A 4G23A 4JYAB 4GXNA 4RZQA 4O4IA 3WWCA 4K4IA 2WB1F 4J8PA 5ANRB 2QR2A 3Q2OA 4D3SA 4ZDJA 5EFZA 2OCEA 1C8VB 4QFDA 2FZ5A 2XUPA 4R31A 3M8RA 2ACWA 1ICEA 1ZX1A 3OPYB 1X6IA 3UXNA 1OX4B 5KFQA 5KT4A 5TISU 3X1XA 1QIEA 3DW1X 1RHJA 3L6DA 5DDIP 4MWSA 2HSEA 3HY3A 3Q7TA 4KSYA 1YONA 4JBXA 1YRLA 2D1RA 421PA 1P1FA 2PJRA 1IXKA 3RRGA 2DPHA 4LG1A 2QSUA 2OORC 5LP6A 4PZYA 1NKVA 1YMQA 2GPWA 2ZJ8A 1Y34E 3RHZA 5K3FB 1XZJA 1Q3TA 3BKXA 4EQ6B 4CEJB 1TU4A 2Y67A 5FBLB 1C5KA 4D3YA 5BQFA 4Q9DA 3WWOA 2FWRA 1XO1A 1ZIYA 3GRAA 2EFGA 1WHSA 2CUKA 2IUTA 3WGGA 2VLIA 4F7WA 2F17A 5KT2A 1U8CB 4WKBA 2E4YA 1OH5A 4UAJA 2E5WA 2EEPA 1LPPA 5HKKA 5J0RA 1SK8A 3NRBA 5EIOA 3HJTA 1TUGA 5KOHB 5HTOA 3IAUA 3FC4A 1DJOA 4AJPA 1Z1BA 3HYCA 4K0KB 3HO8A 4C7VA 4DLTA 1KI7A 4NESA 1Y3DE 4N49A 3IVCA 3AUYA 8ICMA 1RRFA 5DK4A 1IN8A 1UPCA 1NM5C 2X2EA 3OLQA 1EJBA 5C0YA 2D5LA 3K5WA 4NBWA 5IAGA 5JS1A 2O0JA 1SVOA 4TXJA 3OD1A 1FVFA 1I3MA 3OCUA 3AEQB 3I09A 4JLAA 4EUHA 1B1CA 3H0RB 1GPWB 3IQXA 1KS2A 4NENA 1CNFA 1H9BA 4UOEA 3TFRA 1AKEA 2TMKA 4DCTA 1EWRA 3A31A 2NZVG 3AHHA 4E6EA 1DTSA 2E7ZA 1DWUA 3ZBQA 1HFJA 4BS9A 4MMZB 3QWIA 3S1SA 2OQ2A 1A4RA 3AR4A 4NM2A 4B7ZA 1HNNA 4BN0A 4QO7A 4CCWA 1Y6GA 2FPSA 4N12A 5JHGB 2JFBA 4Y2JA 3PWZA 1QG0A 2VWQA 3DAPA 4RIGA 3FE2A 2GDJA 1TQ8A 1ECGA 5K5EA 2X1LA 4F3KA 4Q9IA 4XGNA 2AOUA 1K8QA 2DQNB 5IAEA 5JO9A 4P5DA 3R8XA 1CNEA 1IEQA 1DEKA 2C9ZA 2VSFA 3SZGA 3VKUA 3QUAA 5GV7A 4A6PA 1YRQA 1MG0A 2ZYRA 5BVGA 1J42A 4I50F 5HQJA 4BGVA 2F76X 1QVAA 2R18A 2XVXA 4BIMA 3GL9A 4M0EA 3A9CA 3SSOA 5EHNA 5EUCA 2XVZA 4Y1GA 1FPMA 1U9YA 4YCCA 1KSPA 3CISA 2C3MA 4KMUA 1K89A 1H4SA 1L5WA 1WUDA 4TT8A 3SC4A 5KQRA 4ZTBA 5JXIA 2JH1A 4MWCA 4I3FA 1GTVA 3EDRA 1GILA 2N1MA 3JQ8B 3N5KA 2AGQA 1FSGA 4E12A 3EF1A 4G5GA 1B0ZA 3UJ7A 3BGDA 5LMCA 3A1CA 1YB2A 2W6MA 1GFZA 4HNVA 3RUAA 3CLHA 4XPIB 3PNCA 4ED7A 4KQJA 5FI0B 4L02A 3D1LA 3K1TA 3CLTD 4Y2HA 5AM5A 2W93A 4KYIB 3E53A 2OH2A 2WSYB 3E9DA 2DPIA 4B3GA 1Q44A 5DU2A 1XJQA 4URHA 4BCBA 2CVFA 4FDLA 2GZMA 2HUPA 1X8JA 4Q9JA 3URMA 3I76A 4HI0E 3GFTA 1SVWA 4HWGA 3TXAA 1KOGA 1G98A 5JLAA 4DLYA 1JVSA 2FQQA 2B34A 1PTJC 4CHGA 1M5RA 3B8EA 5C52B 2NNLD 1SKYB 2P90A 1SUIA 2BDPA 1E1NA 3HYNA 1SC6A 4UHJA 1MAHA 3RIGA 4DSFA 2QRVB 3RAXA 2VJPA 4K1LA 3AOGA 2AF3C 3ZKWB 4ZYUA 4ZVUA 1M72A 4B3FX 1R0ZA 1T8UA 3DLPX 3TRKA 1LI4A 1CY6A 4GYWA 1MX3A 4RTSA 3EEFA 1HE5A 3HKCB 4PBSA 2Y1IA 3D0KA 1OQAA 3TTXA 2ERYA 4KXUA 2F48A 1E2PA 4OLBA 1AC5A 2IBKA 4BNGA 1DSSG 5KOJA 2KICA 121PA 4U2FA 2V55B 1KJ9A 5GJBA 4MP8A 3ICXA 4JB8A 3UPQA 4WECA 2XQKA 5E8RA 2XW6A 4C6TA 3ROQA 1AVTA 3FR7A 2YVUA 4JZKA 1X1AA 3RADC 4YV1A 2IEYA 2WAAA 1WY5A 4IDNA 4O5KA 3QX8A 2J85A 3VH1A 3RR7A 1JT9A 4A2PA 2ECFA 2E4VA 2XTAA 2FP3A 4LXYA 4RMIA 4GP6A 2NG1A 4F5EA 2BDTA 2J6UA 2PGJA 1Q1EA 1YNSA 2DQ4A 3W5HA 1T8SA 2PD6A 5EPOA 3AZQA 2W2KB 2X8BA 1O0CA 3CPHA 1F20A 3PW0A 5KYGA 2ZIVB 5K8IA 4CM1A 3A4VA 2Z9BA 3OQJA 1YOVB 4XW2A 3OPMA 1TC2A 4D9BA 4TYYA 2V96A 4NBNA 1H6BA 2W2OA 3GO4A 4YAEA 4JELA 2W6ZA 2DMRA 2XB9A 1UKYA 1LK5A 3ENQA 3V1UA 3THWA 1J90A 1J8FA 4K1XA 2VCEA 1X9MA 2H00A 2BT4A 4EYKA 1XRJA 4IJVA 1XTBA 1ZQKA 2HWYA 2L17A 4H08A 3E9QA 3FDXA 5AYVA 4EP1A 5BR8B 3RB6A 5I9MA 1OVMA 2R86A 5HK8A 4RC9A 5CK5A 3OAAA 1IUOA 2DBVO 2P2ZA 3IDOA 3DZHA 4QXRA 1Z0JA 1TK2A 4PAQA 1KI6A 5LBTA 1J9ZA 4RQ6A 2K2WA 3OEED 3HVJA 5KSWB 1DFIA 2XJ4A 2VC2B 2O2HA 4DQRA 3W0LB 5DHRA 4MP6A 5JPCA 5IIOA 3SJUA 3OM0A 1X7GA 3GOQA 4IP0A 3ORFA 4L15A 5DNWA 4P81A 1XZEA 2KM1A 1CQIB 4ZP1A 5KQGA 2AG6A 4X91A 1XTIA 2FDRA 4IO1A 4JEUA 3FWPA 3TEFA 4FB5A 4UB6U 2J6BA 3E9EA 2VPPA 4NTZA 2BFOA 2X0FA 5DBCA 4A9AA 1KQQA 5H3HA 4G37A 3JPNA 5B3KA 5L1IA 3ANNA 1LU9A 4YECA 2RARA 1MTOA 4JSRA 3PGMA 5A3QA 1XKTA 2UU9B 3UXOA 3H9BA 4MGZR 2ZM5A 1WCIA 6Q21A 3IIMA 4TPKA 1WWUA 4BNYA 5EMNA 3ZXXA 2G5IB 4NH4A 4XARA 2DUYA 4TSRA 2BGTA 1U3UA 1Q7TA 3W77A 1N33B 4LE1A 3UOGA 3RTDA 4PGYA 4R1MA 1SRRA 2F1IA 4DIFA 3WBJA 3PI7A 2EAPA 4TUYA 3M81A 2PT5A 2FSSA 1VKNA 2C2WA 3FUCA 3C7CB 1GAQA 1Z5NA 3WNBA 4J9QA 4O6VA 2X3FA 2MAXA 4EI9A 4UCFA 3QG1A 1IN4A 2X5OA 1TUBA 3IULA 4FZ3A 3OT1B 4NYIQ 2I8AA 3SSAA 3OCYA 4RS3A 2IXTA 1X9GA 3JZIA 3FMIA 5FWXB 4ZI5A 1CUWA 1QHXA 4HYEA 1Q3HA 4CM9A 1MABA 3I45A 4TMFA 1AQYA 3H16A 5LXTF 1VHWA 4HO1X 2YFKA 4YYZA 1S4QA 1XJWA 1YMVA 1E9AA 3PJGA 4WVFA 3F2CA 3DULA 3BXEA 2MWMA 1XN1A 1P0IA 1O3YA 3Q7PA 2VZLA 5CLFA 5CFZA 2NLOA 3P7MA 3WGUA 5L8VA 1J2MA 2PUVA 1IV8A 1U28A 3NMUF 1X1EA 2XMPA 1BGXT 1ZA2A 2WJ4A 3T7EA 4PTYA 1U31A 2XIJA 3QSYA 1ACJA 2RGXA 5ENZA 2WJYA 3PC8C 1KFJB 4I2JA 2GYYA 2YQ4A 4QNLA 1C7QA 1FUKA 2UUCB 5LB2A 1PJBA 2FA9A 1CR6A 3SAFA 5EJ2A 3SPXA 5EESA 4I3HA 1DCKA 3C24A 4O4LA 4DCGA 2WQ7A 4Q1EA 2VN8A 4CETA 4JUFA 3CF0A 3GJSA 1OZHA 4ETNA 2ODBA 3OJFA 1NZJA 5IABA 3TK1A 4RMHA 2XSZA 1X87A 1MQ3A 4BPRA 2A6PA 3F7TA 2YV1A 1FIUA 4Q44A 3CKKA 1J24A 3SS9X 5L6MB 2QIOA 4C20A 3V3KA 3ZQJA 4U2EA 3PEVA 4LXIA 2BKEA 2Y9PB 1N1EA 2ZJ3A 3OY2A 1SPBS 1PVDA 3KPJA 5KL1B 1RKXA 2Y92A 4HAVA 3EXAA 1BVHA 1E69A 3G8AA 1F38A 1PWEA 3MBKA 1MU0A 5ILOA 1HE1C 2X58A 2ZWAA 3DGEC 2CE7A 2X1MA 3LYUA 3DXXA 4OXKA 3C1AA 1DUVG 1A1SA 1QQTA 5I5GA 2IYWA 4AW9A 4O4IB 1R4AA 1FRNA 3Q0IA 4O33A 4RVNA 4TV9A 4RQTA 2I7VA 1GCOA 3T5GA 4DLWA 2O8FA 3C8UA 3PSHA 4EG6A 1PAUA 1DKQA 2JR5A 1G5HA 2H11A 4BNZA 1WCYA 3WOVA 2BD0A 4PQRA 3R40A 2VTDA 4CWAA 4RV4A 1PK9A 2REOA 2LYBA 1T8EA 4HHEA 2RK3A 4TLBA 3VTKA 1UXIA 4BLTA 4GR9A 3KQKA 5FBKA 2OWEA 3KSUA 3W5SA 1VJ5A 5A0LA 3L7OA 5T4BA 2EAOA 3E7DA 4RZXA 3F9IA 3Q1KA 1ESNA 3HFJA 1YWGO 2XXAB 2ONJA 1KHTA 1O94A 4MKXA 2O52A 3PSIA 3VDXA 5JC8A 4ISCA 2QUHA 4N5HX 4HH0A 4JI1B 5ER9A 1K4KA 1ODFA 5LP6B 1L7VC 4MKIA 2J7PD 4LNAA 2FGJA 4IOLA 2H5XA 1ESMA 4RNDB 4AK9A 3MA0A 4YFKA 3RT9A 4PRYA 1VYTA 1RXWA 1DIRA 1RC1A 2ZUWA 3ZXUB 1WKCA 4IV5A 2TMDA 5A1JA 1REQB 4UTNA 2RJOA 4G1BA 4RCZA 3L8HA 4YY3B 2NOAA 2G63A 3NWEA 4IFIA 3DE6X 2JI4A 3MWKA 3U6BA 2Q07A 5ALQA 1UJCA 1U9IC 4UUPA 5DM70 4PZCA 1W4CA 1C3VA 1IHOA 2VP4A 2F8TA 1KEWA 3AFMA 4RTOA 4TXLA 5B6PA 4GMXA 2G72A 1V7ZA 3R41A 2BSAA 1BROA 3O8LA 4KYTA 1WO8A 1CZLA 4MUFA 1FYVA 4XIFA 3KL4A 3ABSB 1T1JA 5J0XA 4EY5A 1OVGA 3VZDA 3ISTA 4RDIA 3PUJA 1T0BA 2VDUE 1PJCA 3CZ4A 1IJKA 2O7VA 3V55A 1KRXA 1IHYA 4L85A 3WMFA 3S7TA 2MU2A 6REQA 4KI7A 4CIBA 4FDMA 1Y88A 4TS3A 3O47A 3CCBA 2I4TA 1Z33A 4L57A 1X7ZA 3OMLA 3FCYA 4NENB 4N40A 5IH3A 3EAFA 2OFFA 4L16A 4QZAA 1ZA1A 3TNLA 2HJWA 2F55A 5TMBA 4C2AA 4G9GA 3ZKAA 3AKCA 4K6CA 4DR6B 3TLBA 1T2FA 3MJHA 2X8AA 3T4PA 2F3UA 3AB8A 4NHOA 3MHTA 1U11A 2G0AA 3F2BA 5FI3A 4EBBA 2HWWA 3L82B 4PQYA 2NZ2A 3I28A 4OQEA 4G4JA 2MA1A 2AOUB 4PSCA 3V6MA 2V74B 3PR2B 5I6DA 2HB6A 1KMQA 521PA 1KSJA 5DQIA 1XVLA 1O97C 3L4BC 3IQZA 3HEBA 4WXHA 2PD3A 2Z3VA 4JROA 4M86A 1QKIA 1WR8A 2O8CA 5BVGB 2R1ZA 4LZJA 1OX6A 1YK1A 3JVUA 4TURA 3FAZA 2QENA 1VP3A 3KEMA 4YP3A 3M4XA 3ZLTA 1QSSA 4KQIA 4URVR 4DDTA 1PK7A 1EFRA 4DSAA 4HB3A 4IM7A 5DYTA 3M9MB 3LQYA 3F67A 3B6KA 2NXEA 1O77A 1V85A 2I5HA 1AY0A 2BHRA 4TL8A 3TLKA 5AXCA 4WKGA 4LXHA 3VNVA 3R3VA 3AV3A 3AGQA 2WVJA 4BGEA 1Z7GA 2KK0A 1SUBA 4CNBA 2P1DA 1Z2CA 4W7IA 4ZYXA 3D6UA 2G88A 4O5CA 1NHGA 4DBVO 4N5DA 3NRJA 4PIPA 4N01A 2DFVA 1FXWA 4F2RA 4OFBA 1QIHA 2X0RA 2BMVA 1QC5B 4WFQA 4MRMB 4WX2B 4GWKA 5ICMA 1BJKA 3PL1A 1LB2B 4L07A 1QIDA 1N9KA 3QY9A 2BPCA 2GCOA 1UXOA 2Q2VA 4MA0A 3V8RA 1JA9A 4KLEA 2Q5QA 1DRVA 4WDQA 4HDMA 4P93A 3L7NA 3DFUA 2ZTDA 3I05A 3WQRA 1CUDA 2IZ6A 4OP1A 1ZIXA 1MDBA 3FJ1A 1XEAA 2CSUA 5GADl 3EPJA 1N0IA 3REQA 1HLDA 1G3UA 1XAGA 1MVLA 1NNEA 2V59A 3FMPB 3NATA 1N8TA 1JU3A 3ZJUA 4ZT3A 1US8A 4NYMQ 3ND5A 3BL8A 4UUBA 3FUUA 4DQQA 3SOPA 3ZWCA 2QRKA 5AVTA 4P5PA 1KJ8A 4DR7B 4DMMA 5FBQB 1Q57A 2P9QA 1RRPA 1GTJ1 1U9ZA 2I6GA 3PR4A 3HBNA 2PIDA 4PLWA 1Z34A 2BCVA 4KJXA 3HQ4O 4D74A 1MW9X 2ZI7A 1JQ5A 3FVWA 2WD7A 1ZD3A 4CMIA 4OHVA 3R7LA 2W7OA 2RKOA 1DMSA 1JHXA 4EW6A 1JXQA 3OCVA 3MLAA 3DEZA 3ESXA 3LY8A 5KOJB 1ZH2A 1J25A 2C00A 1O08A 1T91A 4NRDA 1EZ4A 1QZUA 1Q2UA 4DCVA 1PQPA 1UDAA 2OAQ1 2YRFA 3R0ZA 4IGEA 4AYXA 1EVLA 3QOWA 1U1FA 1BKYA 4KXQA 3BMCA 1SC9A 4LTMA 1PE0A 4LISA 4P6VF 5T7BA 2VP0A 3GGPA 1ZJ4A 4MGYR 1G5RA 3WRVA 5IARA 2WYUA 2VSYA 4M83A 1JXAA 3IP3A 3N53A 1TPYA 4FYMA 4A26A 2DXIA 5HZGA 5BRAA 2HO4A 4JBIA 4PAWA 2JJ1D 3S2YA 4GLBA 1ZQPA 3OZBA 4EA6A 1VMEA 1V48A 3H6HA 4UPEA 2P0YA 5JS2A 1YZTA 2EQBA 3FZQA 5EKUA 2Q0SA 3KZMA 4F2HA 4KI0A 2WJ6A 3IKLA 4YAWA 4MCJA 5LLSA 3GDHA 4QHSA 3DZFA 4MAFA 4Y6LA 2C2XA 2DYKA 4J29A 2P66A 3D6JA 3GPCA 3NHZA 1KEEA 2BFFA 1JKXA 3WYEA 3PNBA 4X54A 2BGGA 2GEKA 4MVJI 1ADFA 4I2BA 2J31A 2GN4A 3OPNA 2BH2A 3QLVC 2HEIA 2I2XB 3RAQA 4BBPA 3IKJA 2J0QA 4PC6A 1MB4A 3C8MA 1OI2A 4PX3A 2XE4A 3VR6A 3DF7A 3GY0A 1YVUA 1P62B 2FJPA 7ICPA 2C7PA 1QTNA 2RHJA 3C5GA 2RSLA 1QB8A 3D6VA 4ZEVA 4MUEA 4MWGA 1SC3A 5LZ2A 4FEAA 3WS7A 1QHEA 4C4PA 2DRIA 3N75A 1EXVA 1VPEA 2WT4A 2KBFA 1YF3A 1UDWA 1QK5A 2ZRCA 1KMIY 1VYVA 2UXBB 3LOQA 1NUPA 1NBMD 1L4MA 1U7XA 3TNJA 5H9WA 1LKYA 5DV9A 1KMHA 1JN0A 2E48A 4GDFA 4EGCB 4NKRA 4A8TA 4HTFA 5JJLA 3V33A 3ZS8A 3J7AC 1PZNA 4OJTA 5DTQA 2QZJA 4Q16A 4HNHA 3D3EA 2VP5A 4LSGA 1QHNA 3LZ6A 1J00A 5EJMA 1VCHA 1JAXA 3SBEA 1JX4A 4UJ3A 1VI2A 4M1SA 2PH1A 3LECA 1ZONA 1RYRA 2UXDB 2OCPA 1YJAA 4HLQB 1LEHA 4FW9A 3HO1A 3HEMA 3IUJA 1WCIB 2IIVA 1E1QD 4IQ0A 5DHTA 2IE8A 3OECA 1NN1A 1C1DB 4G0PA 1GLGA 4G9EA 1UOQA 3I64A 4PGXA 3TJZA 1X6JA 3VHRA 3SHFA 1MQSA 1E8NA 2CFTA 3A0HU 5CPBA 2WF7A 1P4AA 1N5KA 1X3SA 1HH4A 4RJKA 4D5GA 4F4FA 4BNJA 2VUSA 1P7DA 1T10A 5AVZA 5AM3A 3V9PA 1VCIA 3OOYA 3H13A 1EGAA 2FPIB 3E8SA 1R64A 2M6SA 4XUSA 1E7RA 7MHTA 3A6KA 5EZ5A 2R2AA 1TUBB 3KCNA 5GM1A 5GGYA 4RA6A 3MUOA 2D1YA 3A2NA 1OZ0A 4FYWA 1V38A 4OXRA 2AFHA 2GD1O 2O2CA 3VR2D 1QYRA 1Z4IA 3JQ9C 3ZUGA 3UJDA 2RK4A 1HSOA 4B3TB 1MABB 3TSWA 2YV3A 1P17A 4GMDA 5EWEA 1OAAA 4RTQA 3IM1A 1JYSA 4CM8B 3AH8A 4KOAA 1LQUA 5J2IA 4IRMA 1HYQA 1U98A 2O2YA 1DDIA 3PC3A 1K1QA 2BQUA 2QZSA 5I47A 2FLKA 2G06A 5L7YA 3GB9A 1U7TA 4NP6A 1D2AA 4BNDB 1QZTA 4J0IA 3IEMA 2BPGA 4DRYA 3ICCA 1W8DA 1ZLYA 5LP6F 2GM5A 3OESA 3FLAA 4OAQA 1U2QA 5KEIA 4WXEA 5CP8A 4TZTA 2HY7A 1HZZC 3KFUF 4YMUA 5AKGA 4W1SA 2WFLA 2BFWA 1YVDA 1KBUA 4JT4A 3FCEA 3N7RC 2EL9A 4AXXA 3OZUA 4F3TA 4E0BA 3IOEA 4JJKA 1CI4A 3QIAA 3G0OA 1GGHA 5HTKA 1P45A 3TNYA 5K01A 4TVKA 3JQQA 1PO7A 5LL6P 5FT9A 4LV8B 1UWVA 3GUCA 3NBMA 3B3FA 3KSMA 4Y6OA 1JILA 1PZHA 3BSWA 3PJEA 4KQMA 1NE2A 3C70A 3TLGA 3PJRA 4WWHA 3NRCA 2B5WA 2YWRA 3QVGA 2QXTA 4GWLA 5JROA 2ICAA 5JO0A 3DKVA 3DEYX 1KPIA 2C5BA 1YJ5A 1SOVA 4B4DA 4NLBA 2BFCB 1NUSA 1FMLA 2NQ2C 3BXGA 4NLZA 4H1TA 1RWKA 3BMQA 1RYNA 4J49A 4EHIA 3B7WA 3ZQKA 1P73A 2WM8A 1I3KA 3CUEF 2Q49A 4B8WA 1N7IA 1GZVA 1P0CA 5KNCH 3TSYA 5E4YA 1XCPA 3V2GA 3SLGA 2VS1A 4R1OA 5KJFA 3U31A 4FCTA 1UP7A 3MGBA 4TV9B 5KWSA 1W5AA 1GITA 5G5HA 4B09A 2O8FB 4I29A 2ZS9A 1RSZA 4DC1A 3BF7A 3DVQX 3GUYA 4DQIA 1ZXLA 2OYSA 1FFAA 3K0BA 4AG5A 5ICEA 1O4WA 3DL4A 2R62A 3QE2A 4DEXA 2CCKA 2V4ZA 5TDHA 3L6BA 4Q66C 1JJFA 2M1XA 3N7AA 3G1TA 3NEJA 5AFSA 3LVWA 1FL9A 5GOZA 2JZOA 2X22A 2CYBA 2PUFA 2O2JA 3BD8A 3C6KA 2E4ZA 3GEIA 3ER8A 4UJ5A 1VCNA 4QZDA 2QA5A 1MORA 3L7KA 3A6HA 2H7YA 3TLYA 1MQAA 5DHUA 4I50B 1RXCA 1LRLA 5JRZA 1AHHA 5CXSA 1SQSA 2LBPA 1F2VA 1F5SA 3RSFA 3U49A 1THTA 3ETGA 3H4VA 3B70A 4CLHA 2X41A 3ESCA 3E9ZA 3TJMA 1ZETA 2I6XA 2K4HA 2JPDA 2N46A 3UHJA 1RXVA 4X7RA 2VNAA 2D6FA 3ZV6A 2AC4A 1JWAB 2HHCA 4ZCQA 4ER3A 3CXUA 5FDFA 1TLTA 1XPUA 5L4LA 5SYAA 2AW3A 2PSEA 2K5UA 3QG5A 2QPOA 4PZPA 4HL6A 5JOQA 3WHKA 4KLJA 3AILA 4DMGA 3Q6NA 3O5AA 3LYSA 3TN7A 4QWEA 3H4BA 2I34A 3EDOA 2YHBA 4BWGA 1SAYA 2VNHA 3D6MA 3Q8RB 4NECA 3DL7A 3I9OA 2Q8NA 1U9JA 4OI0A 1A50B 4MYHA 3AG6A 1DBVO 1R9NA 1NG9A 4DCUA 1Q14A 3PFFA 5REQB 1ISRA 1V1MA 1H8HD 3B3QA 1Z37A 1V5GA 2BR5A 4KHPB 2O50A 2IEGA 2JAQA 6REQB 5HF9A 1BRMA 4LY0A 3B51X 2DOKA 2I6FA 1T4CA 2C31A 3SZUA 4QZFA 2H5EA 2CL6X 4YI3A 2ZT5A 3OJEA 4O8ZA 4CM4B 1AMOA 2NVOA 5EUMA 1V1JA 3IKMB 4EHFA 4UQLA 8ICSA 4YRNA 3W2HA 1TEXA 1QTRA 5K0NA 3PS9A 1DBQA 2QTCA 3G2OA 1WKBA 3AF3A 1T36B 1H05A 1QAQA 2E55A 1QTMA 1WXDA 4GZMA 3G13A 2VTBA 1WSBA 2MR5A 1H5QA 4UDNA 4LC0A 2UV8A 3SDBA 4CFYA 2DQSA 1UDBA 3UMSA 2XMGA 1D04A 4B7XA 2R8XA 1T24A 3LGSA 4I1IA 4R1QA 4C04A 4IYJA 3IGFA 2YIMA 1GPLA 2NYRA 4P7GA 3SC3A 1A82A 1OXXK 5GIPE 4MV1A 4X3OA 4LRQA 2D0PB 4G5QA 2EAMA 1QZ3A 3MCAA 2XGMA 1B42A 4S0ZA 4J16C 2H0QA 4AY5A 1A2OA 3G6VA 3HP4A 4UHCA 3WBBA 3JPPA 5TT1A 2OAP1 3LY7A 1SGWA 2XZDA 1WETA 2VJ5A 3H0LB 1NZPA 3NYQA 4HRXA 3OIGA 4FN5A 3TSOA 3VNQA 4R68A 4EJ2A 2C0PA 2HR1A 2A1TR 4PSUA 4Z0TA 2Q6VA 3RLFA 1M2FA 2GTIA 5HILA 2QN9A 3DYVA 3EODA 2VSQA 4IX9A 1A8IA 4CNQA 3OO1A 3GLFB 2H9YA 2R6AA 4XX0B 3R7DA 3K5PA 5CFOA 4Z86A 3RUFA 3FPLA 5JV5A 5EQFA 4KRXA 1MA3A 5E4FA 5FO1A 1RIFA 4B3BA 1E0AA 3ACBA 1RACA 3UOAB 4EHHA 4N76A 2HA7A 1DQPA 3LVRE 3Q9NA 5HM6A 4CZ2A 1VI6A 3LC2O 2GEVA 1UBFA 3GWGA 4OJYA 2ZIGA 2PBLA 4DDWA 3JARB 4BQFA 1Y42X 3QJYA 4KYVA 1RYEA 4XVRA 2WG0A 1DIBA 3JD0A 4TRNA 1OE0A 2XKBA 3EFBA 3REQB 5IN4A 4UTOA 4IRCA 2BW0A 3KXDA 1RI3A 4P1ZA 2PL9A 1AZTA 1YI1A 2Y27A 1NOJA 5D3MB 1E7WA 1KYYA 1ZWKA 5J1SB 3V8QA 2HLHA 3G0CA 3ZLJA 2QZZA 2YWXA 1UEXC 2IP2A 2M1ZA 3AJRA 1RYMA 2K8BB 2AK3A 3S8EA 3D9QX 4C1BA 3A6LA 1T2DA 2IS6A 4DM4A 3TTYA 1V35A 4Q3LA 3KJZA 1FU7A 1ISFA 4Z1MD 2C5SA 4LN1A 1MB3A 2H8KA 3OTWA 1XQ1A 3GJXC 4I6JA 4PYLA 1BWQA 1NZBA 1H66A 2HADA 1UPAA 2XB8A 2H0RA 1SWWA 3ASUA 4Z9XA 5SZHB 3OIYA 4ZOBA 1X15A 3QKWA 1ZNQO 1Q21A 1GDHA 4F5QA 5AVQA 5FAKA 4QBIA 3CH7A 1QOQB 1TF2A 3IRVA 4YCLA 1G3MA 3VNAA 1DAHA 2FN7A 5F2OA 2YUTA 3SLKA 4TXNA 3O0DA 3CZCA 2I6SA 1P5RA 2QX7A 1MCZA 2AOWA 3BMCB 2C8KA 4IJQA 2B37A 3TX2A 1WX1A 1E61A 4G5RA 1QAMA 1R5NA 2E6UX 3EVFA 2R00A 2HT6A 4JC0A 2ZP1A 5DLQC 3E5RA 4LF6B 3UCFA 4UHDA 4TUYF 2VDOB 1X1RA 1YZFA 3JYLA 3KPWA 2QU8A 4BO0A 3P9IA 3HT3A 2OVBA 4RWEA 4KN9S 3D8RA 4MKZA 1W5SA 2GS9A 3IIKA 5E7IA 2H9AA 4L9SA 2PKQO 4AD8A 1M2EA 3KT8A 1O96B 1N2GA 3LSYA 1UPUA 3GVIA 1QTIA 3KLBA 2ZULA 2B9EA 3S8MA 4GOXA 3DV2A 3N6RA 3CVVA 1NJGA 1L3VA 4RL4A 3AI3A 2CL0X 2YVAA 3D7KA 1V96A 2QYSA 1KEEB 4E22A 4JL6A 3M3DA 1FFDA 5EVCA 3F3YA 1C29B 3HUUA 4PG8A 4DQKA 1Z29A 4RQ5A 4AN1A 3WGZA 4QECA 4DEZA 2P4HX 3C87A 4OYYA 1Q19A 1SKYE 1PBTA 3EHEA 1LWOA 4Y2XA 5EUBA 2QMOA 2F3NA 3AMVA 3F3KA 3K96A 5LXTB 3UVEA 4EATA 3RANA 4ZH4A 2JZBA 2FOLA 4QXQA 3U7QA 5LQMA 3LV8A 1E6WA 2TYSB 3K6JA 4ENTA 3E9NA 2PKEA 3SC2A 4M88A 4A0SA 1D2EA 3V8BA 4OXQA 4MFFA 1L7AA 5A0FA 2IYNA 3O03A 3VHXB 4OQPA 3NALA 1SV0A 1BAPA 1TVEA 3JSAA 4EHLA 1ONPA 3UANA 1DKPA 1KTQA 3U4AA 3L8DA 4JEHA 3FOEC 4HTFB 2R1VA 2HOQA 1K8RA 4LNUA 4LBWA 2OPHA 2PMZC 4O4LF 5C1PA 4Y1RA 1QX4A 2XQFA 3WGHA 5EZYA 5C18A 1RYFA 1OFUX 4LYJA 4NCKA 5CFRA 1AV7A 3SJ7A 1ZM3A 1KR5A 1Z08A 4DA4A 1UMDA 1U5CA 2QX6A 3QYFA 1Y8AA 1UBGA 5DYGA 4Z4IA 3VR1A 4EG1A 4IDHA 1XEWY 5AW3A 3DLIA 2WUFA 4CG1A 3MHPA 4UTXA 3UTCA 1QF6A 2IUFA 1HV8A 2PBZA 3OM1A 4PS0A 1UZLA 3FMVA 4UUAA 4PLZA 3INYA 3PSFA 3G82C 3KOMA 1NMXA 5J2AA 4QX6A 4PLTA 1AS2A 2DM6A 4AZWA 4CHTA 1PWZA 1YS2X 3CKMA 3FI9A 4G1CA 3PJDA 3MR6A 4NMXB 2IBSA 3E5MA 1X39A 4UEOA 1TUIA 2VHVA 3B20A 5KTTA 3TAXA 5E7MA 4QZHA 1K8YB 1M74A 3GP8A 3FMGA 3AUKA 3L6RA 2AXTU 5KYVA 4FMDF 3SICE 1GKKA 1WPGA 4Q6WA 5DGXA 4ZKDA 1ISPA 4R5MA 3HBFA 4P3PA 1XC9A 2QPLA 4ED8A 2MSEB 1NX9A 2H8GA 3D5EA 4TV9F 1Z63A 2J6TA 4OOFA 4MUIA 5IJ9A 2G3YA 2UVDA 3V34A 1K6XA 2AFHB 2XUGA 1NSFA 5CFMA 1H0RA 3L6UA 2QTZA 1KI8A 1QNLA 1YFZA 4KFUA 5CA1A 4AIIA 3OQBA 2QAGB 3EDYA 1JUDA 5HR5A 4IFTA 1NDQA 4YS6A 3M2TA 1F60A 2JIPA 5AK6A 3Q8SB 4I2AA 3I23A 2J0SA 4IRUB 5T3UA 2AOXA 3HYTA 1LI5A 1H9AA 5AKKA 4JV5B 1N6OA 4CQLA 3D2QA 4Z9YA 2NSYA 4MZDA 2JK0A 2XBLA 1Z74A 2ODEA 4AJ9A 1O0SA 4R1PA 3OIUA 1D6MA 2D8MA 2QV7A 3FLMA 1I10A 2PFNA 2WT8A 1T0UA 5MN6A 1IQRA 2J3KA 3ZH9B 4QZIA 4CKWB 4FSXA 3IBCA 3CUSA 2YY6A 3I34X 4YT2A 1QFYA 3N1UA 4RADA 5DN6A 2G6TA 4Y2QA 1Y7TA 2SECE 3DAGA 5KMGB 1SBNE 2EFCB 4EB3A 2B8TA 5JSYA 3ZE1B 2JJQA 3NKLA 4I4CA 3ZGYA 3L4EA 4F4HA 4NY1A 4TUQA 2GLXA 5AI5A 4Z7JA 4TZ0A 3ZS9A 2XGSA 1TA9A 1OTHA 2XMRA 2PZJA 4YVZA 4DFPA 4BVKA 2ZRLA 5EEHA 1MV8A 4CIAA 6CHYA 2BGWA 2CRXA 4KXNA 3T7AA 4URFA 1K6EA 3OD5A 3ZOKA 2F90A 9ICPA 3QPAA 4YRCA 2BJVA 5LDDC 1CC1S 3MPUA 3KLOA 1R4MA 4MPPA 2HSWA 4Y6QA 2C5AA 1II0A 3BJIC 2AU0A 1RPAA 3G5MA 4RXUA 2ACKA 3SS7X 1GCAA 2IYQA 4Q4AA 4TVBA 4FM9A 3WYNA 1IY8A 3IERA 2PO5A 3CUVA 3U09A 1QX3A 3R0QA 5AH0A 4A03A 2FKNA 4O29A 2FWJA 1GFIA 4FX2A 4S24A 1Z18A 1H38A 4OFZA 1E9DA 3IPRA 3ACDA 2F3SA 3STWA 5IM5A 3BHNA 4ZQCB 2FR0A 2FPKA 1G4AE 2DB3A 3NETA 2E18A 4Q18A 4Q8FA 4J0EA 3H4MA 4RJJA 1GA6A 2NO0A 4LBVA 3IQGX 3O6VA 1L4EA 2JGKA 1L0BA 3U48A 3L6OO 3H11A 3D54D 4DC9A 1DC7A 1RMQA 5GOTA 3K73O 4R3NA 2RGNC 5K3SA 3VNUA 4WN3A 4ND2A 3BYZA 2F9LA 3AU2A 1TLFA 2GM4A 2CD9A 4XQ9A 2V9PA 1ZUNA 4U7FA 4JUDX 4EJMA 1Z5GA 3AR8A 4DNFA 5C1OA 1PEDA 3IL2A 4KK3A 3LFHA 3GCWA 1IBRA 2GEDA 5CVTA 4J1TC 4ONEA 5CPFA 3RAJA 3LA6A 2PXHA 4MR9B 4D9IA 5DHPA 4KPYA 2WVAA 4YMOA 3S40A 3WWEA 1Q1BA 3GELA 4DLAA 2C04A 4I99A 4POOA 1I7QB 4HGPA 3RJGA 3QUBA 2EVWX 3C3CA 1LZKA 1FXWF 1SJ9A 1H1DA 4FMPA 2K6GA 1U2GA 4YJHA 5CDTA 2Q62A 2FPUA 2OG1A 2QTLA 2E85A 1T1IA 4PGGA 4NZZA 4IFBA 2VK2A 3AMZA 4QYWA 1RS0A 3ADKA 4BJ1A 1GY8A 2QMYA 3DMGA 4R9RA 2O05A 3D6FA 3KFVA 4WBXC 5AKHA 3EA5A 2FFAA 2ZJ5A 3F8TA 4DXAA 5EKDA 3EIHA 3G7SA 4X92A 3UIEA 5NULA 2FE1A 2HHJA 1TJYA 2XIDA 3VPBA 1EM6A 4LZNA 2P2DA 3RYCA 2B20A 2SKDA 3JPTA 3GRFA 3V42A 3IQFA 4FDVA 5DNEA 3RFXA 3PUWA 1F14A 1CY8A 1T4CB 4L7VA 3KKMA 4DF8A 5FUMA 2FXIA 3WLFA 1L7XA 4OJLA 4RHFA 4GLOA 3P8ZA 4I5FA 2EBUA 1RQRA 4EB0A 1CJBA 5DT9A 2ZR7A 3RRXA 1SQ6A 1V41E 1EVIA 5HQTA 2H54A 3HGTA 2JLAA 3HHEA 4WOPA 2ZSDA 4E14A 5H5JA 2VTBB 1TJ5A 5LLTA 1Y5LA 1Z3EB 4MS3A 2J9FA 4ARCA 4JSYA 5F3XB 5KNBH 1NUAA 3RAFC 4XTCS 1E0KA 3MGKA 2I62A 2DBYA 3RC9A 5CLHA 2P30A 2F7SA 1DAKA 4W5TA 1QDUA 4S12A 3P5SA 2XT0A 2NYVA 1O7JA 1KSGA 2EV9A 4QVIA 5KFYA 2PYDA 4CI0B 5HA5A 5JCOC 3E7XA 3F8WA 3V7KA 3JWHA 4XSVA 2NU8A 4FS3A 5FTWA 4KMOB 1T35A 3JQBC 4GGOA 3W79A 1LJUA 1RQNA 3L2OB 4BC1A 4IIHA 3JAKA 3E58A 1Z07A 3PI6A 2YJ4A 1N5WA 3NUZA 2X23A 2QUKA 1ZQWA 4X61A 4JT2A 2KE7A 1JAYA 1RAHA 3FSGA 3AQ4A 4C0QC 1C4WA 3HWTA 1QO0D 1I7DA 3L0ZA 3ZIAA 2UVRA 4XWGA 2OBMA 3BREA 4QDZA 3QEKA 3WAKA 4B5LA 4PQFA 1QRRA 1GUBA 4Q1DA 2IBMA 4MS1A 3D2AA 2YIVX 3L1UA 1D0SA 4M6WA 1KEVA 2NSDA 1U5BB 4ZJZA 5AWFC 2OFPA 1KR2A 1NUHA 5JHHB 4OKSA 4E5PA 3AVUA 2EKZA 3AJ9A 1WTAA 2FI1A 5INTA 1SH7A 3CZAA 1FUYB 3SM9A 3CB2A 2VUUA 4PPQA 1A88A 2MR6A 1DX9A 2PX5A 4G5FA 4U7TB 2R6JA 2RFLA 3SBOA 2QLNA 2RGUA 1U0JA 4DGQA 1Z2DA 4KK4A 1YFJA 1R6DA 2VQEB 4A92A 1WLYA 1UL1X 1DRGA 3OEHD 1T26A 4HMOA 1L5VA 2GNPA 1GNSA 1OBVA 2H18A 5BN5A 2C22A 2ZJ6A 1YDEA 3PDJA 1SKRA 1YJQA 1MRSA 4GOMD 2OILA 5KG5A 3KTDA 4ITUA 3WL4A 4QOJA 5ADUS 3I30X 4OMUA 2QYOA 4EVQA 4KV7A 3KU1A 2Q5JA 2AJ8A 4H4EA 5BUZA 4G84A 2ID8A 2A94A 2H65A 2FMXA 1ZXIA 2V7QD 4F8RA 4A27A 3K4QA 4KV9A 2I7DA 4P92A 5EGNA 1YBFA 1FK8A 3FWKA 4K9OA 1X40A 3T5CA 2DFLA 4NZNA 4IG9A 5KTNA 2HAEA 3CRXA 4DLEA 2P2GA 3OIDA 3AHDA 3NOOA 3OQIB 1ZQOA 1ZCJA 2YJTD 5JAPA 5AKJA 3LRPA 4K6HA 1L4KA 4B44A 2OLKA 4IQUA 3TJRA 4UUQA 1B76A 1H6AA 1V4VA 2JASA 2J3MA 4QGFA 1C9NA 4ZQIA 3HKDB 2RI0A 1ZYQA 1SPXA 4Q1VA 3DE3X 4I2NA 1CR1A 4QD3A 4FNOA 3TBHA 2PR7A 3GNQA 2NZXA 3T5PA 1W59A 4F4ZA 5EFOA 2O0KA 4MAMA 3HJFA 4MVCA 2W90A 2PRJA 1ZAYA 3ICWA 5A7HA 4LJYA 1YL7A 3L92A 4U2BA 3D1VA 4K86A 2PX3A 3TSCA 2IYFA 5EIFA 2HRDA 2B21A 4TV8A 3W6OA 2CL5A 5CXXA 3LOUA 2ZUEA 2C88A 4MGEA 5L4SA 3HB4X 1NR7A 3OX4A 2E0IA 3R5HA 2IKQA 1Q0UA 2HVIA 1JJ7A 4FT2A 3ECAA 4ARZA 1RT9A 1CHNA 4JWMA 4ODIA 3RVOA 1YKSA 5JAIA 3JPYA 1E1KA