3FM9A

Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
MFKAVLFDLDGVITDPAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 65
structure length 220
sequence length 220
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3fm9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fm9A01
3HYCA 4YIHA 4Y2XA 3L8HA 3ZX5A 2B8EA 3IRUA 2AGVA 1LVHA 4EZEA 2WHEA 4I9FA 1RC8A 2P27A 3L8FA 5ALSA 2IOHA 1ZD3A 3M9LA 3QUCA 3FVVA 1VFPA 4GIBA 3L8EA 3U26A 2G06A 2BDEA 3QX7A 1RKQA 3B9BA 3P96A 3BA6A 2WF7A 4BX2A 1JUDA 4UARA 1RPZA 2Q5EA 4UATA 3NALA 2GFHA 3VAYA 1Z4MA 3QGMA 3N1UA 3PGVA 2HHLA 2HCFA 3WK9A 1J97A 4Y2UA 5ALGA 5AM3A 2JAUA 4KNVA 3DDHA 3OCVA 2MU1A 3PDWA 2R8XA 4YIKA 1ZD4A 3UMBA 2OYCA 2I33A 1Z4NA 2IOFK 3K1ZA 3EPRA 2HO4A 5FP0A 2DQSA 4JDPA 4BKMA 3HLTA 3RF6A 4CF3A 1Z5UA 2FPSA 2ODAA 1Z5GA 3OPXA 5A3QA 5AKKA 1U7OA 2JGAA 3S6JA 5AW5A 5AW8A 2YMQA 4Y2PA 4Y3UA 3WGUA 5AKHA 2G0AA 3NAMA 1QQ5A 5AVVA 4L6AA 2OA0A 1EK1A 2O2XA 4G63A 3L0CA 3ZVLA 3MC1A 4FFDA 4C4TA 1PW5A 3N07A 2YY6A 2MSNA 4F72A 3N5KA 3SLRA 3SHQA 3AR5A 4C4SA 2ZBEA 4HGRA 1U7PA 5ALNA 4UMEA 4UU1A 3TLMA 4BEVA 3PCTA 2GHQA 4XQ0A 3DV9A 1RLMA 1VJRA 3NUQA 1WVIA 2R8ZA 4C4RA 3L0YA 3U7GA 4CNQA 4O8CA 1Z4JA 1L7PA 5E0OA 2I6XA 2R8EA 4OFZA 2B82A 3ESQA 1TJ5A 2BDUA 2NO5A 1Z4PX 3SKXA 3ZUPA 5AKJA 3WK7A 1J8DA 4UM5A 5ALXA 3ZTYA 2PR7A 3IB6A 3KDPA 2QYHA 5A3RA 5AK4A 3RFUA 2P69A 2OM6A 4NAVA 1T5TA 4IG4A 4KNWA 2HDOA 3A1EA 1RRCA 2G08A 3ZU6A 4ZEXA 4KX3A 4KX5A 3ZW7A 3GYGA 2IYEA 5ALRA 3WKAA 3ONNA 4EELA 2HX1A 1NF2A 1Z4LA 4OD0A 2MU2A 1TJ3A 3L1VA 1LTQA 1XPJA 5ALTA 3W5DA 3AR3A 4HAIA 1U2TA 1K1EA 1SWVA 5AK3A 2ZBFA 1RMQA 2YMMA 2PQ0A 1RQLA 2RBKA 3OCXA 4RETA 4Y2JA 3NRJA 4UAUA 2JARA 2ZXEA 5ALZA 1L7OA 2R8YA 3CZ4A 2WF6A 3QUTA 3R9KA 1YV9A 3WK6A 3J7TA 1CQZA 1MH9A 1QYIA 1X42A 1XVIA 3A3YA 1KYTA 3L1UA 3W5CA 2C4NA 1RMTA 3SKYA 3OTQA 4NWIA 5ALDA 2FPWA 4BEWA 2FPUA 4CF5A 1YDFA 5AW1A 3ZVNA 5ALUA 5AVRA 3OCYA 4IFTA 4Y2QA 2WF5A 3ED5A 1Q91A 3E58A 5AK6A 3QU4A 2CFSA 1Z4IA 4OCZA 4QQFA 2YMLA 2B8JA 1YNSA 4ZEVA 2EARA 4BNDA 1Z4KA 3B8EA 4F71A 4YGYA 3QYPA 4CF4A 3AR4A 1TJ4A 4HGPA 2I55A 5AKLA 3AR8A 2FUEA 1L6RA 3AR7A 4OHFA 3NIWA 1YS9A 5AI6A 1RLOA 1TA0A 4ZEWA 3U7EB 4BNDB 3QLEA 2FI1A 4BX3A 4XPZA 3WGVA 2CFRA 2HOQA 3E8MA 4NABA 3NASA 2HEGA 2P11A 4UASA 2BY4A 1QH9A 3W5AA 2C8LA 4UAVA 2G09A 5JJBA 4JB3A 1T9ZA 4HGQA 4EX6A 5AM2A 2GHTA 2HF2A 1ZJJA 4UMDA 1U2SA 3W5BA 5AW0A 1O03A 2ZG6A 4UMFA 3AR6A 5ALWA 2B1RA 1QQ6A 3AR2A 2GMWA 5ALOA 3ET5A 5ALQA 5AI8A 1WR8A 4Y2TA 4EX7A 2AUTA 5AVXA 1F5SA 1N9KA 3UM9A 2YJ6A 1RKVA 1EK2A 2P9JA 2GO7A 3OCWA 5AI0A 3SF0A 3ET4A 1NRWA 5ALJA 3FZQA 3I1YA 3QXGA 2RARA 1ZRNA 2YJ3A 3EF0A 3MN1A 1RLTA 2WM8A 2B0CA 4EENA 3MMZA 3ESRA 4MWOA 2O9JA 1ZD2P 3QU9A 5AI5A 5AIAA 2AMYA 2JAOA 5AW6A 2WF8A 5AESA 2D2VA 4DCCA 5ALKA 3FM9A 2YBDA 1TE2A 3E84A 1NNLA 5AIBA 2C8KA 4NV0A 3FPBA 3ZI4A 5AM0A 3BWVA 1IWOA 2I7DA 2HI0A 2CFTA 2ZBGA 3NANA 1L8LA 2NO4A 4HGOA 1S8OA 3KOOA 1XP5A 3N8GA 4L6CA 3QU5A 3PGLA 4UW9A 2IOFA 3WKCA 2HSZA 4UMVA 1VJ5A 2NYVA 3R09A 1ZS9A 3L0BA 3ZWKA 5AM1A 2B30A 4AS3A 3SMVA 3ZTWA 2PKEA 2C88A 3WK8A 5AM5A 2OBBA 5ALHA 3L7YA 1Q92A 5A3SA 2WFAA 4KYTA 3UMGA 4Y2RA 4Y2YA 4QJBA 3ZVMA 4NFLA 5AVWA 5AICA 2RB5A 2I54A 5AW4A 2WF9A 4AS2A 4YCMA 3B9RA 3M1YA 4YH1A 4PNHA 3QUQA 2YN4A 3N28A 1YMQA 4DWOA 2W4MA 5AW3A 2AH5A 3L5KA 5ALPA 3I76A 3DNPA 4KN8A 4YCLA 3WK5A 2X4DA 3F9RA 4RESA 3EF1A 2YJ4A 3I28A 2FPRA 1L7MA 1U02A 3ZX4A 3OCUA 5AKYA 1L7NA 1FEZA 3UMCA 3QUBA 4GXTA 1L8OA 1WZCA 1Z88A 4DW8A 3KBBA 3WK4A 2G80A 1RQNA 3KC2A 5AKGA 4I9GA 1ZD5A 3WKDA 2G07A 1YJ5A 2FDRA 3R4CA 3U7HB 5ALIA 3QU7A 4UM7A 4BYGA 1ZRMA 3QU2A 4Y2SA 1CR6A 4H1WA 5AKZA 5AI9A 3KD3A 2YJ5A 2C9MA 3U19A 4UU0A 1Y8AA 3L8GA 4J03A 5IS2A 5IT0A 1ZOLA 1WPGA 5ALEA 2FEAA 2HF7A 3A1CA 5AVTA 1RMYA 4HGNA 5AW2A 2JAWA 5AK5A 2B1QA 5AVYA 5AVUA 3AR9A 3U13A 5AKEA 1Z4QA 4J2TA 4Y2VA 2EATA 5AKXA 2YMPA 4BBJA 5AW7A 4MUMA 5ALMA 5AHXA 5ALLA 1S2OA 5AW9A 3WKBA 2G1AA 2YFYA 1T5SA 5ALYA 4DFDA 3E81A 2W11A 3KZXA 4HYTA 3WKEA 5T41A 5AKIA 4EEKA 5ALVA 1SU4A 3FGOA 2W43A 4AP9A 3DAOA 3D6JA 5AI4A 2IA5A 3OCZA 2EAUA 2FPXA 2RAVA 4YCNA 4CE6A 3MPOA 4FE3A 1RDFA 2I34A 1QQ7A 3IJ5A 4L57A 2QLTA 2CN1A 1N8NA 1SWWA 1Z4OA 5AM4A 2FUCA 3A1DA 2ZBDA 2Q4RA 4FYPA 3U7FB 1AQ6A 4BX0A 2ZOSA 3ZWDA 1RKUA 3I6BA 5AVSA 5AVZA 2Q4TA 2VKQA 4XOUA 3EWIA 5AVQA 4G9BA 4E88A 3SD7A 5IT4A 3QNMA 3CNHA 5ALFA 4B6JA 1O08A 3FPSA 4XE5A
chains in the Genus database with same CATH superfamily
1YASA 3HDYA 4RPCA 5EE1A 5TS2A 4BIMA 5C2JB 3VNVA 2X9LA 3WDMA 4F4ZA 1TK9A 2EL7A 2FFBA 5BUSA 4D99A 1UPTA 1SV0A 1XTSA 3E3OA 4GDMA 1XLUA 3DBVO 4L5YA 1HE3A 4X7BA 3WFIA 3R3SA 1BH6A 1GZ4A 3T7SA 2AMJA 4ECWA 2SBTA 2EZXA 4BRUA 1GZUA 2IZ7A 3UCFA 4EPRA 2PGOA 1EFPA 2CDBA 4JC4A 4K8RB 1LNSA 2CD7A 5HUJA 1MCZA 1VP3A 1XD8A 2EW2A 3QELA 4JYBA 2JXJA 4QEKA 3QMVA 5KC8A 3T0GA 3E53A 4EW1A 4RJJA 5GM2A 3RQIA 3WQQA 3RTBA 2FN8A 4J1TC 2F2AB 3L8EA 4XX1A 4UOZA 5LU9A 4QWEA 4C5AA 1JH9A 2G06A 2EQAA 4OHPA 3P94A 4PRYA 1Z3EB 3DDCA 1YJAA 2VYFA 3LK9A 1VCMA 2P7IA 3GOHA 3TPCA 3U9SA 3VX4A 5LMUB 2O54A 1E1RD 3WLLA 1QH0A 2IGBA 3A1WA 1GAJA 4H3KB 3RHFA 5A4MS 3PUIA 1F1JA 2M9NA 2O1SA 4NDZA 5DT9A 5BRJA 1PHPA 5M04A 1F8FA 4UATA 4QZAA 5LKRA 3CUYA 4EMTA 2I2FA 1RZ3A 3BS5B 1T24A 2Y1LA 2ZULA 4YDSA 4C0XA 2J9FB 2VPYA 1X7WB 4CKWB 2CXNA 2FWIA 1KO5A 3VYSB 4CIAA 2AJCA 1F1BA 2X9QA 1Q7RA 1KIAA 3F6EX 3VDMA 3WX0A 5DFAA 5JS8A 1Y81A 4QU8A 3D7KA 3TS1A 3U9TA 4R6XA 4LFAB 3IEVA 3G2KA 3O2NA 2POCA 4GPAA 5DNWA 3RFFA 3OZTA 2JIDA 4ZYUA 3RJMA 2W70A 3RFCA 3NUGA 2D59A 3WOVA 5CNMA 2COEA 4IRCA 4WXRA 5KTOA 4B73A 3EIFA 3PGA1 4JGBA 4X5OA 4EUNA 4GKVA 4X41A 4Q1DA 4DHEA 1NIJA 2GBLC 2FSPA 1NOIA 2JFUA 4UHJA 1V5GA 1UMKA 4LSWA 4PZ9A 4RMHA 5EP3A 3GQVA 5MN4A 4KFUA 4GFDA 4XWYA 1R1DA 2QE6A 5DTIA 5DSTA 5MN5A 3DZDA 2VF7A 3CYMA 1VKNA 3IN5A 4XIFA 2E8MA 2G8NA 2X7HA 4XA5A 5LZ7A 3RROA 3EW7A 4EYQA 3PD0A 4JJ8A 1F6WA 4RZIA 5K0BA 1HBJA 3T5PA 2PS3A 4RK5A 3HXKA 4B3HA 4E31A 4I2NA 4Q48A 4FWIB 2X23A 2YY5A 1S10A 1Z06A 1JAIA 4PHEA 1GCAA 3BKXA 3PLRA 4IJWA 3ER9A 1MJGA 4AO8A 1SB3C 2KV2A 2NZ2A 4G0QA 3SLRA 2O2SA 3KQOA 2O8BB 2OBNA 4DLPA 4KE6A 1BCSB 1R16A 3EBOA 3L8ZA 1K5DA 4D2IA 3BWBA 4M9UA 4AJIA 4XQ0A 3WAGA 1G3MA 2ISOA 3DV9A 1AKVA 1B6GA 3N2EA 1S2GA 3QJ5A 1I1HA 4KLIA 2GPNA 1KORA 3BMOA 2XT6A 4ED8A 4B1FA 6ABPA 1G6Q1 2BEUB 2P9CA 4B6EA 2ZT6A 1SZPA 3KJZA 2I6XA 3QJGA 3D1JA 4JQCA 1KFCB 2QG4A 2J87A 5TQ2B 4WXPA 1IN1A 2FSVA 1UZAA 2XQIA 1APBA 4KMSA 3HR8A 3HXLA 4B46A 5JADA 1PNOA 2Q0QA 1ONNA 5I01A 1BWSA 5ALXA 4UM5A 5JHHB 3BL6A 2BEUA 2TECE 3L6EA 4UBJA 1EGAA 1G9TA 3D5TA 4HNSA 1UAYA 2HLNA 2OV4A 2ZREA 4NAVA 2E0IA 2WKQA 3GLHB 2A9OA 3AWIA 3BFJA 3EH2A 4RH0A 1XTTA 2FEPA 2IYXA 4KX5A 1ZEMA 1M1XB 2CBGA 4F5OA 3L1KA 5F3XB 4OL0A 5H8WA 1S9HA 4KFCA 1KEPA 4I0WB 8ICQA 4LGMA 4UE3S 4RD0A 2YL2A 1ZW6A 4ANFA 4B7CA 4BBPA 1Y6ZA 4K05A 1QP7A 1WA5A 4GNKA 2VPTA 4ZOLA 2JI6A 3LO5A 3W5DA 1K63A 4NCHA 1NT2A 3UAOA 5GTDA 2HHTA 1Z0JA 3EDQA 2QGZA 1X9XA 2PEZA 1JKJA 4W9MC 1E5DA 2IUTA 4I5IA 2ZRJA 4OATA 4E6PA 5FL7A 1WUIS 4HDCA 4MUEA 3RLIA 4A26A 4H6WA 2GAJA 4EYEA 1KOGA 3ZD8A 1O4VA 3FNEA 5J2TF 4QODA 4UEWA 2HU7A 5ALZA 1QANA 2MYPA 1FMJA 4WA7A 1J8MF 3PRKE 4I55A 2V7UA 4JVOA 1W4CA 4LBWA 4EUSA 2BGKA 2CDRA 3I32A 3ODPA 1GYQA 5J2GA 4HLUC 3CLUC 4CLDA 2NUPA 5C8ZA 1XD2B 3N4MB 4OXRA 2BI7A 4BAUA 4AI6A 4YDQA 1M67A 2XWSA 2XB2A 4EGJA 1AKYA 2PDAA 1TFRA 1B0AA 1CZNA 1HO3A 4Z4HA 2F2TA 2A92A 1R27A 1KK0A 4HD8A 3MBYA 1J0XO 1AT1A 2R1VA 4DLGA 2ACWA 4S35A 2B78A 4TT3D 3WIUA 1TU4A 2PXIA 1LJLA 3K0HA 3LLCA 3T1NA 2OGWA 2GLXA 5LQDA 3W4IA 2FJ6A 1Z5VA 4DFKA 4FDTA 4NBSA 1N6KA 3QXCA 3RBXA 5JQGA 4KLTA 1ZKDA 2D0PB 1QB8A 4WECA 1PO7A 2D5LA 3L7OA 1D5CA 4CLRB 3MAJA 3K0BA 2J08A 2M6KA 3Q8SB 4MKIA 5FYQA 3DBHB 121PA 1YDGA 3GFBA 1SXJD 1Q6YA 3LD9A 1OE0A 1L5LA 3EXEA 4DMUB 5IAAA 2NYUA 2JATA 1OB2A 4ENPA 2DYKA 3M3PA 1JB1A 5KFFA 3PGJA 3QWFA 1JG3A 5DQGA 2CDAA 2OBFA 3PPYA 4Q12A 1U3TA 2HJHA 5EUCA 3TRHA 4FQ5A 4G81A 1L6RA 1SA0A 1XWWA 1AKRA 1O8CA 1RLOA 3K0KA 1MRSA 1OTHA 3OUUA 5H5JA 4ZEWA 3EXEB 1CR2A 2JI8A 2YZKA 4ZH4A 1IN4A 3E7PA 4AO6A 1S7GA 4UEKA 3WAJA 2E1RA 3SK0A 2W2LA 5CLLA 2JFPA 3IBYA 5JO0A 5ELXA 3E3NA 4FOOA 3OI7A 4FNAA 3O9VA 4G67A 4C6TB 1D09A 1ZLYA 2FTKE 3FTFA 3I37X 5K3SA 3MFIA 2XUQA 4E2FA 1GPYA 3M4NA 4ZO8A 1YC2A 2VJBA 1VA5A 1EM8B 2HHUA 4P86A 4Q8FA 5J1SB 3ERCA 1GGNA 1PW7A 1IRXA 1DV2A 3IGFA 3K5WA 1V5IA 1FP4A 3KJHA 3OLZA 1RBMA 1L7DA 4KUEA 1T8SA 1YQUA 1ZCFA 5CEHA 4C0SA 1PT6A 2I22A 4LOIA 1WCWA 1NWCA 1R37A 1GGEA 2JEFA 1Z25A 4ZWNA 2GHTA 1F4VA 4E3WA 2X15A 1DQSA 3RABA 1JE1A 4P5DA 4QD3A 2Q6KA 3HKCB 5FORA 5F77A 1F06A 3NVMB 4TOIA 4D81A 3N7AA 2XZDA 1EWYA 4W7HA 2QRVA 2MOKA 3ZEIA 2AQ8A 2RBEA 4IIFA 4EY3A 3HP1A 4D8XA 3T7RA 1DIHA 3BN3A 3QVJA 5CURA 2GMWA 3RBAA 1GZDA 3NORA 3C8ZA 4FXPA 1G7RA 4LZNA 3W2TA 4BRWA 1WS6A 3NOVA 2JS7A 5KQLA 4J49A 9ICCA 4K81B 4V0KA 4Y9SA 3P9YA 1L4YA 5FR1A 2PFSA 1VYHA 1FF9A 4DABA 1M2EA 1XA4A 4FQ7A 3THSA 4WCFC 1EQ2A 1W4AA 3AF1A 3F2BA 4KLLA 3H2HA 3L0OA 4DL4A 3PIDA 4TSRA 2WZDA 3M82A 4Z54A 2R6DA 1F2TB 1GZVA 2WW8A 4JJGA 3SI7A 2P9JA 1L7RA 4YJ2B 4OB8A 4BDSA 5KFNA 2A9PA 5IULC 3CG4A 1NG9A 5AI0A 3QEBZ 1MTOA 3BBPA 3I62A 1NRWA 1GAEO 4PC2A 3IAS1 3I1YA 2RARA 4YV7A 4HI0E 4MOWA 5C9ZA 2PL9A 2H1FA 4GX5A 3TPZA 4QSHA 1U28C 4EG4A 1P8AA 4E14A 2BKVA 4RANA 2PYZA 3MMZA 2QN9A 4JOSA 4PXSA 4BQRA 4F6RA 2DPIA 3EPHA 3E5NA 1P0PA 4PPGA 5AIAA 2DG2A 2B2XA 3CUUA 3IOCA 1U9IA 3E4DA 3HCBA 3IDZA 1DAHA 1HDOA 1I2BA 1CF9A 1XVUA 4Z1OA 3PX2A 2G88A 4NQZA 5DI3A 1W7AA 1XMXA 4JJ7A 1G20B 1H65A 1TE2A 4NK4A 3ANTA 1WMBA 2JPDA 3E84A 4BNGA 5CFLA 4ALIA 1GNRA 1L6IA 1SCIA 1TRKA 1E2MA 4TQAA 2BCSA 3BWVA 3VYRB 1BVHA 1Z29A 3ND9A 2NQ8A 2W9XA 4KI7A 4UDOA 1IWPB 4HGOA 1S8OA 5CW1A 4BO7A 3WRYC 1G6HA 4JVLA 4NCIA 1YFLA 2G6TA 5TPZA 4KSBA 3DBRA 4QGFA 3SY8A 3LHFA 1XJWA 2KSOB 3G3EA 3ZLVA 3RC2A 3V2GA 1YRYE 1DCFA 5HKLA 1DKPA 2G6BA 5ER9A 1Y6JA 2RLTA 4EQZA 2Q5FA 2EP8A 1DO2A 3X1XA 4ALJA 3REFA 4IUBS 3ZGLA 4IDNA 4FWTA 4KN9S 1T8TA 2PGJA 1ZN2A 4EAAA 3FCSB 3INRA 2QTVA 1U99A 4GOND 5ALHA 1EUDA 4OKSA 1MF7A 1M0SA 2KQUA 3H11B 3O8CA 3OT1A 5LDHA 1S4MA 3FTCA 2MSWA 5KG1A 1GDDA 4AKEA 2QB0A 4PHAA 1GKIA 3A7EA 4WNAB 3T3GA 2Q1UA 4RHEA 4Y2YA 4QJBA 4C7XA 3IP7A 3O7MA 5FQOA 2HF9A 1GTRA 4D0RA 4R9SA 4Y6QA 5K2OA 5B3JC 4DQDA 1NK5A 4NPCA 5EJ7A 4AQ7A 1JDZA 4KO3S 4FZVA 2VYND 4V1CB 3DYBA 2YWDA 3QBJA 3CW2C 3ZNOA 1SAYA 1OLOA 1FY2A 2BFPA 2I3DA 4NY8A 3M81A 1V5EA 4GOXA 2QVZX 2VA9A 3NDJA 4IUCS 2J7PD 1DADA 3HQ4O 5EWJB 3RSHA 5K6AA 1SZDA 2X2EA 2FRXA 1XNSA 5DBCA 1M6WA 3KZMA 4IHJA 4QICA 1MZVA 4QSMA 4RLQA 4YP1A 3KZ1E 4MIOA 3AGQA 4NU6A 2JVKA 1N8SA 4O4JF 3O8DA 1YI8A 1JRLA 5H83A 3AVTA 3UAWA 2G76A 2FVYA 4ROSA 2M0NA 3B82A 4ON9A 1X2EA 4CKWA 1IXRC 1M7HA 5CVVA 2AN9A 5EMJA 3QSYA 4RSMA 4AZ0A 1O3YA 1E96A 2ZIWB 1POWA 1RI1A 4G1BA 4LN1A 3DE4X 2JB9A 2BHLA 3G88A 3N0RA 1GZ3A 2PIAA 1EDEA 1RFGE 2PKQO 3OCUA 5FBHA 2M1XA 3RJ9A 4P58A 4LZLA 3ZBTA 3ZH9B 4L5BA 4WEOA 3PGMA 3AP2A 1JDVA 4TX1A 3S2GA 1DBRA 2ZIAA 3G5TA 3BZBA 3TF5A 1HNZB 4ND8A 1CY8A 1US8A 1KVUA 4UNQA 1D0IA 4DV6B 4RVGA 4AYXA 5COAA 3IUJA 2G72A 1Q3HA 3UHAA 1ATIA 5J0QA 3JWGA 2HMUA 3LRTA 4W5OA 3T1HB 4TS4A 5I9LA 5HMLA 2A30A 2NU7A 5C3MA 1CB7A 1GKYA 2IHJA 4DJAA 5FRDA 1XU7A 2ZAGA 1FSFA 3SR6A 7ICTA 2GK7A 5K8CA 2UUBB 4ETNA 3KHRA 3TNDA 2R8RA 4GYJA 4LHZA 5JAUA 1YMVA 4QWBA 2PUJA 2HXYA 3FF4A 2E37A 3H4VA 3L05A 3ORFA 4U8GA 4X66B 2XVMA 5DLYA 5KG6A 1HDRA 1M34A 2NU7B 3FDIA 1XG5A 1BCRB 4BN0A 1UPAA 5E7QA 1QHYA 4BP3A 2D5CA 1X7XB 5I4CA 5IS2A 2ZKIA 3EHDA 5IT0A 4YRTA 5JECA 4ARAA 3LWLA 5GGXA 3HPOA 5CRXA 4XDGA 3DFKA 4BN4A 1LQ2A 2JLSA 2IEBA 3AUTA 3TI9A 3W8NA 5CT6A 2JFQA 2P1RA 3T34A 4D41A 2PS9A 1N2ZA 1K8QA 1P91A 1I1OA 5D7BA 1E32A 3ZHSA 2VATA 1DPFA 2AQIA 4LRTB 2BPGA 4MXDA 1T4CB 4RZSA 2WILA 3SYMA 3ZIAA 3KLPX 3USCS 4NEHB 1Y37A 4RF3A 3FPHA 1XROA 5ARDA 2NO1A 5KKNB 4JX8A 1RYRA 1AQIA 1T36A 3D7MA 3LXMA 3UJPA 3KFVA 4DFDA 3E81A 4KDRA 4YRRA 3PXCX 4BPRA 2J46A 1THTA 2I3GA 4CQMD 4ESEA 1USKA 2KKPA 9ICOA 1YAJA 3A9RA 1Q3KA 3REOA 4KLNA 3PX7A 4RJKA 5CIQA 3SWWA 1FFHA 1YL5A 3B12A 4DVGA 2W9CA 4FXOA 3SR0A 1J5PA 1YKGA 2XUPA 3A1SA 1PI3A 1NRJB 2FLVA 2DOKA 2H4ZA 3DT8A 4I8DA 3D6JA 1YZFA 4PAWA 3SIXA 3KQUA 4DL3A 2MSDB 4EKDA 1V3UA 4XB1A 5IC4A 2YXEA 6REQA 1UAAA 2YN2A 2YXNA 4RVCA 4AJ4A 3KIPA 1JAHA 3DO8A 1E2IA 1Z0ZA 4N5MA 1CUKA 2PGLA 2KP7A 5G5HA 1C9NA 1JJFA 1L7XA 2FW8A 2IYTA 5HR7A 4NBUA 4WVFA 1PJBA 2H4HA 5LOVA 4EVSA 4KMOA 3RU7A 4M36A 4TTIA 3THXA 1L4KA 2VYVD 4ZU1X 3DFUA 2YX1A 2B1IA 5BV7A 3HPQA 1DG1G 1MXHA 3B6KA 1MH1A 4OGLA 2A0XA 5F9HA 3OT5A 5GONA 3SOZA 5EKDA 1XOIA 4LYYA 1E7MA 2AC2A 2Y0EA 1M5UA 3CZMA 4XASA 5AJHA 3T9BA 1RZRA 1Q7BA 5JAIA 1XTQA 2N46A 3FOAA 2YQZA 3KPJA 4DJ5X 3A2MA 4FMDF 2VIXA 1ZITA 2MT9A 1DINA 3I5UA 3LCUA 4LJ7A 4RMNA 5JYBA 3CV3A 1N9GB 2QARA 1TYCA 2A84A 2IF0A 1CJKC 2WIAA 3ICWA 4ZVQA 4M7PA 4J1TA 4RTOA 4EWLA 4YY3B 3GV5B 3AFMA 4N5DA 4PQFA 5CVJA 4RTNA 4AQYB 3CCFA 3RR2A 4CDRA 3HXQA 3RSQA 1ARZA 5KFRA 4OJQA 1KAOA 2SKDA 3QFFA 3ZWPA 5L3VA 4IMIB 2IHZA 2QTHA 1DDGA 1RQGA 4WJ3B 2GI4A 2HU2A 5J2TB 4KVFA 1ISJA 3NGXA 3MABA 5FBWB 2A0WA 2O05A 1UZMA 1SURA 3KTFA 4DY4A 1WXXA 3W2EA 1QRUA 3MT7A 2VF2A 2DVMA 3P0JA 2O8BA 3RAQA 4UCQA 4XSVA 1GYPA 3ZHZA 2W98A 1KI4A 3GEEA 1TZMA 4KWIA 4URWR 1C8VB 1NL3A 5CTAA 5B58T 1GVHA 3GVPA 5JVDB 1KH2A 1LLFA 1QHFA 2ZT8A 2GCNA 4OB7A 1A9ZA 1W36D 1XVLA 1HLPA 1R9MA 3Q8RB 1ML4A 4KPGA 2XIJA 1BO6A 3P0EA 1CEZA 4ZAGA 3RDPA 4D8TA 3H99A 3T79A 3THYA 1D6MA 4UBBA 4KO4S 4M9LA 3BA6A 4BO8A 2WF7A 4DLWA 3PGXA 1RPZA 5TQ2A 3FFXA 3MGKA 5TE9A 2DHCA 1E0SA 4DA4A 2AZTA 2W6IA 1PTKA 2FOLA 3ITKA 4B74A 2W6QA 4B3SB 4J1QA 1N2SA 1EFTA 2AFIE 3F2DA 2VUSA 1D1QA 3PGVA 4PFSA 3H8MA 4BJ5A 2UV8A 5BN5A 4DIKA 1N60A 1DU4A 5ALGA 5AM3A 1IXSB 2WZCA 4XB6B 2B5WA 1KI7A 3O7WA 1M8PA 1MABA 2ZCUA 3ENNA 3ED1A 3LZ6A 3AF4A 1LV5A 4HUQA 4RF2A 4DXHA 1E1CB 4NIMA 3C5HA 5CBPB 3ELBA 3S44A 4GF5A 3F97A 1XAGA 1FXWF 2Z8YM 5AFSA 3K4GA 1KJNA 1TRHA 3K1ZA 1RRKA 2X22A 3THXB 3MD9A 1G5RA 3HY4A 1SULA 4WZBB 4W1PA 4F3OA 2DQSA 4GM4A 2PL1A 4TKMA 1XZAA 1YQGA 3QEOA 1MOZA 3TLYA 5A3QA 3KT3A 3C74A 2Q5IA 3FETA 1NK6A 4JITA 5A5VA 5DXJA 5K0LA 5BN3B 2J4CA 2VYCA 1IN5A 1JYFA 4IIXA 4CIWA 3QFRA 1DKLA 2GF0A 2FQ1A 3IALA 3AU8A 2GN2A 2VWGA 2JFXA 3B1XA 4LV6A 4M89A 1I3LA 3F8SA 1DJPA 3HBMA 5DO9A 3TTYA 2NVWA 1PEDA 4I2IA 4FFDA 5A5EA 1MA0A 2LCIA 1RCUA 4O4IA 3IKTA 2WJVA 3STXA 2E1EA 1R0CA 4C8LA 3C1UA 4N12A 4O5AA 5DP2A 4RAQA 1Y6RA 5DE3A 1SU7A 1OREA 3GGPA 4ME6A 4UC0A 4B3RB 2KZZA 3AUXA 2Q3MA 2QMQA 3JYLA 2AC4A 4JFRA 4NKRA 1O94C 4OI0A 3AEXA 1CRXA 2AJBA 2CHVA 1NMZA 1T2EA 1CNMA 1XEWY 1Y1RA 2ZXHA 5TQ0B 2CHQA 3R6LA 1XN1A 2CL6X 1MRZA 2H1OA 5EGSA 4H7EA 2JEYA 4FYIA 4IMPA 2YFQA 1YFJA 2ZWOA 1IEQA 3HWWA 5CD1A 3L79A 1L1FA 1U1CA 3GCDA 4HLCA 5A0LA 1H1LA 3M3HA 3HY6A 5A6SA 4MCJA 4S3MA 2R8ZA 4C4RA 9LDTA 1ZH6A 2A9VA 4WFKA 1QIJA 3C8MA 3ML1A 2WMDA 2P77A 3WLNA 1Y4AE 2VJLA 3A0UA 1ZHOA 4IZIA 1BE8A 2JGMA 2VDJA 3I1IA 3KTAB 5DB4A 1UT6A 5DZSA 4HZUA 3RT9A 1GZ5A 3LX4A 1JFSA 4LX0A 4GMXA 4RL6A 3FMOB 2QROA 2AN5A 1BDIA 2GH1A 2O14A 4V0QA 1H2AS 2P69A 3AQ4A 1XU4A 2FP4B 4OUDA 2V7PA 2YS7A 3CZRA 4OB6A 3BCHA 1U7DA 3T5AA 3TZLA 4MYRA 3MR3A 3HX0A 5KNIA 3KE8A 1G21A 1IE3A 4QVKA 5DVZA 4GLJA 3FNGA 1WTAA 5ALRA 2AWOA 1I2DA 1TO1E 1SXEA 2VYQA 1L4LA 3WHPA 4EHHA 4RT3A 5TY0A 3WBBA 1B15A 3A3PA 3RD5A 4TN1A 3P71T 4XJXA 1Z4LA 1QS0A 2QG6A 4R5HA 4FZNA 5ISMA 1XXHA 9ICJA 2XSZD 3FCUB 5K0SA 4RD2A 2IPXA 1ZQVA 2ZSAA 4NBNA 1FRZA 1GLNA 3CZPA 4ICIA 1K1EA 4ZVSA 4MJXA 2WWVD 2A59A 2JGDA 1S3SA 3E23A 4QE3A 4FJ1A 4R2HA 4NZ9A 1N3LA 2AJLI 4N47A 3Q8PB 1POXA 4Y0VA 2PT9A 2H7YA 1AO3A 3DOOA 1QPZA 1H2HA 5FYDA 2WC1A 7ICVA 2HREA 2OG2A 2WJ6A 3JR7A 1XZGA 3L8YA 4QYWA 5KNCH 1W75A 4CDNA 2IS2A 2VJMA 2WPDD 1L8XA 2BHRA 1T9GR 2PZLA 2VDRB 1AU9A 1FVXA 3I61A 3R5XA 2IOYA 3AY6A 4JWKA 4XGNA 3P97A 1QP8A 4IHAA 3ICEA 2EFEB 3AI2A 2HJVA 4RMGA 3C1OA 1YA8A 3KSMA 3UPDA 4WBNF 2IW1A 3GH3A 5TSDA 3OU7A 5L4SA 4DL7A 1EP9A 3PENA 6NULA 3ESYA 1QAOA 4LVNA 5JSUA 2BFEB 3AHJA 2BR0A 2Z56A 1Y5LA 2G1JA 1EGQA 2E4XA 1LSOA 1HXHA 1MQAA 2ZETA 1PK8A 3P2EA 3EQ8A 3D7RA 4LNHA 2Q9CA 3FX2A 3K0CA 2OXOA 2FHSA 4UU8A 3RVLA 3T9EA 5J5VA 3ROMA 2DUUA 3RSZA 2PLAA 2BGUA 2JR5A 1EG2A 5IABA 3MQ4A 4NATA 1KERA 3IBCA 3IKMB 1XEAA 3L8MA 5CT9A 4DLXA 2BGMA 4INPA 5E2AA 2ZUWA 3Q8XB 4YT5A 1FFVA 4CF4A 5SZKB 1L5MA 2ACEA 4G5YA 2CLLB 3ZZUA 1I9GA 3AR8A 1A82A 2FUEA 1EBBA 1X70A 1B73A 4TVOA 2GF9A 1EK6A 5KTSA 3X2EA 1EJ0A 2VXBA 1B26A 4QTTB 5FD8A 2C4WA 4YP5A 1JEEA 1HNWB 1O5IA 4UAWA 1Z1BA 2FB9A 2XUDA 3A9UA 3ANXA 3RTVA 1YT5A 3AKZA 3UW1A 1QJ4A 3FCAA 1ULTA 4AF7A 5M3BA 1CNEA 2R00A 1H2RS 5KYXA 3K6SA 2BY4A 2WMNB 2H54A 3HUEA 3NBMA 1KFTA 1XF1A 2PBZA 2YJZA 3BXHA 3KL2A 2FA9A 2ODNA 2HMXA 4RHUA 1H94A 1O58A 2PX2A 3A6ZA 4S1PA 3EXG1 1D9DA 4IQUA 2YRFA 4BO3A 4B3BA 5BYAA 3WYFA 3GLFE 4CFZA 1U1FA 2PFQA 3CSUA 3KQLA 3TX6A 2RKBA 3UWKA 1ZJJA 2WAXA 2WSMA 3HN6A 3LX8A 5JS6A 2GN8A 4EY6A 4UMDA 4DCUA 3LX5A 2XWQA 3JVIA 3LDHA 2FFQA 5EMKA 4KYVA 4BX9A 4EHFA 5B1EA 5HM6A 4EMSA 1N1EA 1K86A 2KYRA 2YHSA 1NIPA 3D59A 1G42A 1GOTA 2HZ7A 1OU0A 1SBCA 1XTJA 3R44A 4GMHA 4GM1A 5KDLA 3IOBA 2F67A 2PUBA 3CGWA 4C89A 2GN1A 5D1HA 4EMBA 5JCXA 4QU9A 3FLEA 3KALA 1E5TA 1QWSA 4Z9XA 1LQTA 1J06A 1IHYA 2QUIA 4CMJA 1JJIA 2YVLA 1CJCA 2GARA 3P0IA 3V1LA 3WTCA 2Y9TA 1L1QA 4TUSA 4DG9A 3VPFA 2QUZA 2PK3A 5F2KA 4YRGA 5ULLA 5KREA 2RD2A 1YO6A 1T0BA 5H0IA 3RC3A 1Z8FA 4AO7A 3IPXA 1NBMA 5L1MA 1XPRA 1W76A 5DSXA 5CCEA 2NO6A 3RF7A 3ZV3A 4K03A 2VH5R 3JX9A 1CY7A 2GCOB 7REQA 1V2GA 4CIYA 3H9QA 2QT9A 4UCFA 3VZRA 2AYZA 3MN1A 1P1RA 4PICA 4Q3DA 2DKXA 3AY3A 5BSUA 5A4FS 4RJIA 4P4NA 4XYMA 5DN6A 3BS4A 4TKUA 1SL2A 2LUOA 4XPIB 4HNHA 3K0AA 4EFMA 1OBHA 1ZD2P 5AI5A 1YB1A 2WUWE 2OESA 4HWPA 2FF7A 4MWDA 2YXDA 4W9NA 2UZIR 1ITZA 4YMLA 2AF3C 5IZCC 3T9CA 2VYVA 3ZLJA 2M9MA 3BFPA 3OLXA 1GN9A 1KZ7B 2R6GA 5LDDC 3WDLA 4M6WA 1RJEA 2C8KA 2X2FA 4QUJA 1HQYE 4ZZ1A 4FYYA 5AM0A 3Q7EA 4GOLD 2Y0SF 5J1TB 3HJFA 1OT5A 2Z98A 3ES9A 3TZCA 3V8NA 1L8LA 3J7AC 1R6AA 1ZFNA 2HHCA 2LXNA 4IQGA 4F8RA 3MRXA 4GICA 2P41A 3A11A 3ICCA 4DC1A 2XNCA 3NBAA 2WD9A 3BC1A 3L6DA 3H5TA 4OK6A 3IR6A 2L82A 5DNDA 3LDUA 1QSLA 4GKBA 3NO4A 4OBBA 1DJLA 4RZXA 3WDSA 3GFVA 3ZYCA 1ZQDA 2BCVA 2QP9X 4M1YA 3TW0A 4DCPA 1NAIA 1PZGA 4PAOA 3HP6A 1UK9A 2JIPA 3OF3A 2CT8A 2ZTCA 5LBUA 4YUZA 1N7JA 2DJIA 2FWBA 2QL5A 5G0WA 4ZJYA 1R3DA 3C3PA 5ENDA 1A7AA 5CEEA 2P3QA 3LCRA 3ZU4A 3K6KA 2R1TA 4P31A 1Z6XA 2X8BA 4MUIA 4MSUA 3GZFA 3RUDA 3EW9A 2H07A 1VJDA 3UC5A 1NLMA 3A0RB 1J2JA 1A5ZA 2O7SA 1QB7A 2XF2A 3ASUA 4B5LA 2BQRA 2CXPA 2Z5VA 5EE5B 1JMSA 2YJGA 4YCMA 3LECA 4BX8A 2CYAA 1WF6A 1FYFA 2J0VA 3RH6A 1J2TA 1OXVA 3JAKA 3MT0A 3IV6A 3DG9A 3R0IA 4WZBE 3T0IA 3ADCA 3QUQA 4ZIRB 1VA4A 4LNAA 4MVCA 2C97A 3K0FA 4Q93A 4F8JA 1DBVO 1P5RA 3CVVA 8ICSA 1GGFA 5B55A 4MAAA 2HXGA 3LQ2A 1JHQA 1SXGA 3CHYA 4AMGA 1PG5A 1SEVA 1BHQ1 2XD4A 1SCUB 4Q4AB 3ZU5A 1HFEL 3PW5A 4UB5A 1MX5A 3EULA 4DG8A 5TLSA 1NUQA 2OFFA 3DPIA 4ARUA 1NJSA 3H9BA 4LF8B 3ZS8A 3VSEA 4UAZA 4ARVA 5EZSA 2V74B 2FPGB 1JPJA 4DWJA 2NZXA 3BM5A 3ACCA 4FSDA 3CC8A 1JB9A 4E3ZA 4PHTA 5J0XA 1G5QA 2L18A 4XR4A 3WGGA 1EFKA 1QYVA 4ZKDA 2XO7A 1SG0A 4Q4CA 1U2DC 4DW8A 3MBOA 3RH5A 3DDUA 3PD7A 1NDHA 4X20A 4ZD6A 5DXFA 1Q7EA 3KBBA 1AKEA 3DV0B 1INLA 4IHJF 3H16A 2Y1JA 1C1DB 1VJ0A 2OP1A 4JCOA 1Z73A 5CNKA 8ICAA 5AJWA 1KJZA 2OQRA 3PPXA 1B8UA 1P4HA 3QPAA 4ACAA 4RVUA 5J2UF 3QKIA 2QLNA 3EGDB 2IU3A 4PYNA 4UM7A 2DPLA 2FE4A 2UUPA 2A35A 1V71A 4MP8A 5HGJA 2DLCX 1NDQA 4JXZA 3T4EA 2YJ5A 4OSOA 3VR5H 3L8GA 3RB0A 4ZZ3A 2R18A 4P4PA 2VP9A 1FDVA 1FS4A 4ZQBA 4O3PA 3AVWA 2X9NA 3GROA 1K7XB 3FZNA 5J40A 2HF7A 2HIAA 5DEOA 1JROA 2BMAA 2X8WA 3AR9A 2XMBA 4PHCA 1OWNA 1ZJYA 1NR1A 3IVXA 4ITRC 3B78A 3TWOA 4AWBA 1C3OB 2LWIA 5CW2A 2ZUBA 3VYTB 4CRWB 4L2IA 4R4JA 3VH3A 8GPBA 3FBGA 2PV0A 1Z1VA 3WBKA 3MJTA 2P90A 3AUOA 2OHFA 5ALLA 4QAQA 3OA0A 3VH4A 3W1WA 2GOLA 5I4IA 2CNNA 1E2JA 5IEJA 1CR4A 1DC3A 2XGSA 4KPYA 5F23A 5FAKA 3HUFA 4NE9A 4F93B 2O3QA 4Q4LA 3QW2A 4EKNB 2W11A 5ES4B 3OWOA 3R41A 2PXAA 3GLSA 3LX6A 2DULA 5CX4A 3MTQA 3N3BC 3PW2A 4FFSA 2ODGA 4HJRA 1UC4B 1JQJC 1BMDA 3E7XA 4MR7B 4ZODA 5ARCA 3AKEA 1EBUA 5TPZD 3UXMA 4AM8A 2DTXA 3LTNC 3N0TA 4WOKA 1QHHA 3OBBA 3JATA 4KAJA 3EN0A 1RACA 4I1OA 4EFLA 1XFDA 4GNRA 1CDDA 4YCXA 3FVWA 3GR6A 3MCTA 2AF4C 4MI6A 3JALA 4H7DA 2JLRA 2AN4A 1PDOA 4MUXA 1WU7A 2AN1A 5F78A 3L6BA 1GZHB 2ZTHA 3ISDA 1JDTA 4N54A 4PNPA 5FNVB 4A8HA 3HKZC 2EQYA 1O6GA 4L0QA 4N8EA 2IEDA 2NLOA 4ZXFA 3EC7A 4M9NA 1YRWA 3MW8A 4PFQA 3JARA 4R8UA 2JLBA 1VPLA 3KQHA 1MV5A 3MEQA 2Z08A 3O31A 4TPKA 4CQMA 2O8DB 2IYLD 4PLVA 2VKQA 4H18A 4DA6A 5LZ9A 4N76A 4RVOA 2Q9BA 5LKAA 3C2KA 2ZIXA 1I7QB 1ZZGA 2V1XA 4MIKA 2B98A 1L9KA 1U9LA 3M6XA 1FFSA 1HLGA 4GGOA 1CUAA 4E88A 1Q7CA 2YH2A 3OLQA 4R9UC 1KQNA 4F1KA 5ALFA 2JH3A 2V4UA 3OZRA 1LC3A 5BVGA 1AV6A 2HCBA 2FHPA 2HPVA 4IRDA 3FPEA 1YZGA 2DQNB 2BFDA 2VBIA 1LJUA 1E4YA 1LDGA 2JEOA 4NU0A 5T3UA 3VFDA 1JXLA 1W5FA 2HHWA 4UVGA 4RLHA 4A10A 4ZHQF 4RTPA 1JHDA 3L8HA 1J8YF 4K9LA 4XW2A 2J6SA 3MCAA 4IILA 4F9GA 4KP7A 2O8CA 1RAIA 1EU1A 7ADHA 1Y5MA 4EUHA 4RGYA 3PMNA 1CEXA 2BWJA 3OTIA 9GPBA 1CEQA 1MIOA 1OD6A 5EE9A 2EDAA 2VSYA 3A6LA 2CJWA 4LF9B 1OAOC 3ZVRA 4GXQA 1Q5PA 3DQZA 3CZ9A 5H70A 3QTLA 1UMDA 2WWTA 3IT3A 2AIRA 4M2YA 1PHRA 2C61A 2C5AA 2LR0A 5TVGA 1ZGAA 2QZ4A 2E5SA 3I92A 1D03A 4RH3A 2BDEA 2QP4A 1C7YA 1EVLA 3D6NB 3G82C 3NT2A 2SKCA 3QMWA 1T8UA 2PKRA 2FPPA 4KVGA 4XFJA 5FEMA 1U0NA 5I9MA 2HEIA 3W4JA 4J9RA 2RHTA 3VU9A 2D1RA 2HK8A 3LGAA 3K15A 1NUSA 1M10A 1JUDA 3GFFA 2ZSKA 5D5QA 3TSWA 4PPNA 5DQHA 3TIIA 3JQDA 1IC6A 3VAYA 3PJRA 2R5FA 3HJCA 4XQEA 4LE0A 1BXGA 3C3CA 3TEFA 4PYQA 4O29A 2QQ0A 2K8BB 1MO3A 5CJJA 3BMNA 3WI7A 5TMDA 3SYKA 1G5TA 2HCFA 1YC5A 1RYMA 3INGA 1KOJA 2MWMA 3OZWA 2IL1A 4HL6A 5G4KA 3V7WA 3DO5A 5C1OA 3BB3A 1R66A 4BTLA 1E1RA 4I50A 2ZYRA 3ZWNA 2Q2OA 1Z74A 4NPAA 5CR0A 3TPFA 4M37A 1CKEA 4K40A 4MGKR 5AMXA 4ND2A 4QT0A 2J9RA 4YIKA 3T4XA 3VZDA 3MF4A 2I33A 4RHFA 3W79A 1YIOA 3LBIA 4RQ7A 3EPRA 4EPWA 2VLBA 3QLUC 3RQSA 3LPMA 5IIMA 3NU1A 1NJZA 4HX2A 2YRXA 9ICXA 2AI2A 3ROZA 4E2YA 2FR8A 3F2VA 5NLLA 2CEAA 2WAQF 2VI5A 2CMKA 3O1IC 4A2PA 1NW6A 1P73A 1UK7A 4WV3A 5JBQA 4LF4B 1IBCA 1JZQA 5K0NA 4E0DA 1Y5IA 4MEXA 3SIRA 5DHSA 3MGVA 2FWAA 2GK4A 2H59A 3OIWA 3JV7A 4FEEA 4BBAA 5AVVA 2OA0A 1ZQGA 3DTVB 4BV8A 4BFLA 3KZCA 2ID7A 2DUMA 5BN5B 2C2EA 1D7AA 3BXOA 4HMOA 1DUSA 1PK9A 3MJSA 2FR8C 3MUNA 4EITA 4M2LA 5JS1A 2WWXA 3VR4H 4C4TA 5B5EU 1TAMA 1B93A 1L7BA 3D6UA 5E4JA 4YXWA 2C96A 3WIOA 3FWYA 4J9KA 2WK1A 4RLFA 3I0NA 2YDYA 4HYQA 3VAAA 3UJ9A 4U2GA 3VQTA 1R2QA 3EVEA 1W0CA 4DUGA 1X1TA 3HC7A 3PXEA 2AOWA 2QWXA 3B7GA 3TRFA 3L01A 3IP9A 2O2IA 3UV7A 3F49S 2G1UA 3IDWA 2Y1CA 5CPBA 4A92A 4MGZR 1XPOA 4HVAA 3ID6C 4DDKA 1R6DA 1PCXA 1W52X 1XEXB 1P9WA 5ICSA 1DIBA 4MIEA 3OZ7A 2C00A 4PAMA 4TMFA 1E66A 2HIMA 1HNXB 1KK3A 3U39A 4BTVA 5F2NA 2JLWA 1Q0TA 3KCQA 1F8UA 1Z00B 3ASYA 3R0VA 4O8CA 1AKWA 4R1NA 1JQBA 1IUPA 2BHSA 1FNNA 2IVZA 3KJQA 4YI5A 5EIAA 3TL3A 2PUHA 3TOSA 4CUZA 3EXAA 1TJ5A 3ZV5A 3HR7A 4JVMA 3LZCA 1NJ1A 4I4NA 5C8YA 3UJAA 3ZHYA 4M1QA 2H4YA 3UPTA 1IY0A 1PSDA 3UXHA 2FRVA 4M9JA 1IIRA 1LRKA 4KQ6A 2BEWB 1Q57A 5DCWA 3NH6A 4PPFA 4HO1X 3LO8A 3EA0A 2H1RA 3I2HA 1EMDA 3WLRA 2ENWA 3VBCA 4XI9A 4XKJA 4US8A 4EQ6B 1OT3A 1T1EA 3DJFA 3A1EA 3MRVA 3CSDA 3ZWXA 4RNDB 2YWEA 4Y9RA 3TYXA 3ZU6A 1KE1A 3IP3A 3UUGA 3SHTA 4AJ1A 1KIMA 1QGYA 1TO6A 1KEVA 2NO9A 3RNOA 2ZIVB 1CZLA 2LIVA 1U1IA 3C29A 3HKEA 3PHCA 4W5RA 5CVDA 3KLOA 2IEYA 1C29B 4KI0A 4KMUA 4TTAA 2PRYA 1WUTA 1W8DA 3EIQA 4H35A 4JKOA 4II3A 1CUWA 2BZGA 3AM9A 2BCUA 1GPLA 2O7VA 3CZAA 5L3QB 5BW4A 2ZTLA 2D74A 3ISJA 1OZAA 3C98A 6PFKA 2AWNA 2DUYA 1YS4A 2QTRA 4FKZA 1FFAA 2IDJA 4FONA 4PAQA 4QLAA 2INGX 4ZFNA 5BQXA 5IJZA 2RBKA 2GF2A 2XLBA 4DKJA 2G3YA 2WR8A 1OASA 1E2KA 2Z9BA 3IVRA 4HDOB 2JRZA 4IICA 1RZTA 4E5DA 2N42A 4ERXA 1QDLB 4RA9A 2V4QA 1W1WA 2JIBA 1K1QA 4NJMB 3H0KA 1JT9A 5BYJA 1OZFA 1E8MA 4OIFA 5GVRA 5AJYA 8ICOA 3UFXA 1EFVB 3ZDAA 1GTJ1 4S05A 1VG0B 4PLFA 5PGMA 1I10A 1OZ0A 2ZPAA 3C85A 1BTOA 4ZOEA 3S81A 1FXUA 4BU0A 1W36C 4C80A 1U5BA 1YVRA 3WIBA 1XJ0A 3GLKA 4C06A 1OBCA 1CULC 3VKWA 3I83A 2GZRA 4IF6A 5HXAA 3HN2A 2C8VA 3GOQA 1ULSA 2XOKD 2V96A 1DTWA 2V3VA 2VQ3A 1KEWA 3PFGA 4LZPA 4ABTA 2KNJA 4II2A 4PN7A 3OQMA 5ALUA 3PPVA 5A0VA 4KN4A 3QWBA 3UWDA 2FKAA 2GRUA 4FOSA 2CE2X 5C0OE 1LBIA 5IXSA 4NFYA 4V2UA 4WLVA 5I7EA 4A6XA 2UVVA 4DF3A 4X3OA 2F8KA 5EE0A 2DM6A 1QE0A 2X6TA 1HNNA 4ND4A 4QZDA 1KDOA 5EQFA 1DI0A 1CQJA 1SRQA 3A14A 3RUFA 1KH3A 3UJ3X 2WIJA 4B9MA 4A15A 2Q5OA 2Q99A 1G60A 2FPPB 2ZITA 3BB4A 3HFGA 2WSLA 4O4HF 3U4AA 1JIIA 1OLSB 4JIGA 2YZ2A 1PVOA 1E6CA 3F5EA 1TA0A 3N6XA 4LGYA 3WYCA 5K3BA 4RKYA 1AXGA 1QTIA 1EQUA 3LOPA 4JGGA 4OUDB 1OX4B 5BXQC 3G0BA 4I2HA 2CFRA 1WG8A 3QPUA 2C59A 4CLEA 3L02A 1ZL0A 3E8MA 4GXKA 2HA4A 2V97A 3NASA 1XSLA 1HWYA 2H2AA 2H7XA 4P3XA 1JZTA 2I4IA 4FDAA 5DRTA 1B0XA 1CZOA 3GP3A 4PX2A 2FMUA 1V8OA 2DCMA 4UASA 1KMNA 1RPLA 1QDEA 2X41A 3FPFA 4RUAA 5I9IA 1LX6A 1ISSA 1JBEA 1EVJA 2EV9A 2J6UA 3GYBA 4KWHA 4LJAA 4M9CA 4XUDA 1V1RA 4TWJA 2Z7JA 4DQSA 1XLVA 1NN3A 1QHGA 1Z13A 2R2AA 3OMXA 5BT8A 1DQYA 3TQRA 4D9KA 5AM2A 1A5BB 4LWPA 2Q45A 4O2BB 4DWVA 3LDFA 3RBDA 1JSZA 1WOYA 1Z16A 2O8EB 1TU3A 2ZSJA 4QJIA 4TXLA 4YAIA 3SQDA 5ALWA 5EXPA 2OECA 5BNFA 2HB6A 1C50A 1E1DA 3H8SA 3GAAA 3OX4A 2E8OA 1J56A 3ONWA 4N5HX 4QNRA 1MBZA 1CRLA 2VR1A 1ORRA 1N63A 1A96A 1K2WA 1P9OA 4NNJA 1COKA 4XSGA 1I4EB 5HEKA 3VU8A 3VYUB 4F60A 4R54A 5JXGA 3K6SB 4EDHA 4D3YA 2XQVA 4MB2A 5GGYA 3NZEA 5K4AA 1GEEA 3IKLA 1Y1LA 2Y0DA 4JV2A 3IELA 1SZJG 3OCWA 4MUFA 4OSEA 2HOFA 3JQ9A 3RU9A 2G4VA 4C08A 4BTEA 5J0PA 4GKKB 4ATNA 1I4OA 5KFCA 2J45A 3BD7A 4QPJC 4R1MA 1DELA 3FPLA 4A0SA 2W55A 1IIBA 4EENA 4HRAA 3U4GA 2R2GA 2P0AA 4HUQB 2NUPB 4OK5A 4D4HA 5JZVA 1UJCA 2Q41A 5TEWA 4CV2A 4JV0A 2AGOA 5JY6A 2OBMA 2C95A 5AW6A 3QKTA 5JNRA 3RRHA 2ZP1A 3DZFA 1C0KA 4MKHA 5DOZA 4JYAB 5KYXB 2JLZA 1H5UA 2VDNB 1K92A 3K4PA 3LP5A 3GUVA 3NIBA 1NVBA 1THGA 4NZOA 4O4LA 2A1UA 3W1VA 3R5HA 2I7VA 3OZIA 4LWOA 1JEYA 1EE2A 5KFWA 2XGOA 3MLAA 2ZSIA 1FRVA 1RRMA 3FPBA 4YMOA 2PRSA 3WFZA 4ZVVA 1PE0A 1ZK1A 2FPMA 4IKPA 2ZQYA 3P2MA 3C1TA 1WKVA 2Q1WA 3UF0A 3NKFA 4RD4A 1TLFA 2XA2A 3CTPA 1JEYB 1GV0A 4R1UA 1K5GA 3VC8A 3GPCA 4DXDA 3NH9A 2W3SA 1L4GA 1TZBA 3CIOA 4FVTA 1U1GA 1MHPA 5HS4A 3W9UA 3RIYA 3OPVA 4MUGA 1P44A 2Y0CA 3E9NA 4WT7A 5FUXA 3U3KA 1V8FA 4RU1A 4RKFA 3U80A 2NQTA 5DIZA 5B1YA 1HURA 4B2IA 4ZT6A 2W8LA 3OFVA 5M2QA 1U9JA 3B52X 2BFBA 5JCJD 1BX3A 1ZOSA 3L7YA 1H1TA 2FRDA 2ADMA 3C6BA 4G1VA 2BEVA 4REOA 2BGWA 5HK9A 4ZN6A 1H2ZA 1Y9JA 2ST1A 5BSRA 2HV8A 3F5MA 3RAJA 4K4GA 2LDBA 1DO8A 1RVV1 2OXEA 5EINA 4C0LA 1MTZA 5KL8B 2IXTA 4EG0A 2PCLA 1RAEA 1LSUA 3HDGA 2CV0A 2EANA 3GCGA 1NYRA 5CDHA 5KFTA 2ZUSA 4FDLA 4DGQA 4ELVA 2CNWA 2XCRB 1CUZA 2HBKA 1VKRA 3GAFA 3QOWA 2FRDC 4ZQFA 1JR6A 5DH9A 4C7OA 3OZXA 3PW4A 2H06A 4FFBB 5G1NA 1G5IA 1MVNA 5HE9A 4CM7A 4C0ZA 2W9CB 3STHA 4OQDA 2VUUA 5ARBA 4V0RA 4JYZA 1QHXA 3HNRA 2AFIA 2RHFA 4JNKA 3HU3A 2N75A 3RYCA 2ZYVX 4C7VA 2KJ5A 4LW8A 2QZZA 2WU8A 1V4VA 3UATA 4GL2A 3E22B 3VR3D 4G8JA 1GFZA 3BS5A 3CRW1 3I28A 2Y6UA 3GAZA 3LKZA 3A6FA 1KYWA 1PLJA 3BWYA 2PSFA 3U56A 2JGEA 3TTWA 3GEMA 3JD4A 3PFCA 5IKPA 3BL5A 3GWZA 4TZTA 1FUUA 4MLDA 1DIRA 2FQQA 5EJGA 4NYMQ 1WZCA 2EIXA 4ZI5A 1RU3A 3BXXA 4LWZA 3NWJA 3MWLA 1GPNA 4QM6A 4X7PA 1R4MA 4JT4A 2OKGA 3S4YA 1GKLA 2BDTA 5AKGA 1PFYA 2DLNA 5IILA 1L8AA 1GXSB 4G37A 2QF7A 3H5VA 4C3UA 3WKDA 1EB8A 3E9RA 3F3MA 5E6SB 1TUEA 2Z04A 2EFJA 2Y27A 2FDRA 4PG6A 5HBRA 3D2NA 1AQUA 5B1HA 2ZJ2A 4S24A 3DMDA 2J4DA 3FRHA 1UKYA 2QX4A 3EQ9A 2A19A 2XGJA 2UXCB 2EHJA 2V0CA 3N2NA 4RJ2A 5DYNA 5E3IA 5FO0A 5IVKA 3FDXA 2G63A 1KO8A 4GT1A 4BJ1A 1JG7A 3RAXA 1QR2A 1FQWA 4M0KA 3L7LA 4MCIA 4GLXA 5J43A 5IM4A 4Z4QA 1T8PA 2BZ0A 3CN7A 4OMFG 2QMYA 4NCNA 2OBXA 3TNYA 5LNK6 5TARA 5BSHA 3D4PA 4QOSA 1EFHA 3ORRA 4XZ3A 4DPMA 3TANA 2VPQA 2FDCA 2GZ1A 4TYNA 3VPCA 1RMYA 1L3IA 3R9XB 4PC3A 3EUAA 4N82A 2EBFX 2YASA 3K9GA 2ZSDA 1XVAA 1CP3A 2UYQA 3R8CA 1YBAA 4AY4A 3CQ9A 2QGFA 2CYBA 3ILXA 2PA3A 2AD1A 3O8RA 2V7QD 2W3RA 4AJEA 2KD1A 2IU0A 5H68A 3G2PA 1T2NA 3OSZA 4ZCMA 3I9V1 4DQKA 4K3UA 5GZ1A 1LLDA 2BZSA 3ELUA 3BMQA 1B6TA 4IYRA 5CCBA 1RHRA 1UJNA 3HYSA 2J32A 2PUTA 5IAOA 3PSAA 2WAYA 1WXIA 4MUYA 1OXBB 5E4TA 3T5DA 1QFZA 3LUKA 4FGWA 4EYGA 4NLZA 1G8MA 1T6XA 1WKCA 1LGYA 5EZQA 5T41A 1NK9A 4G41A 4DT1A 3GPLA 3GFQA 3H04A 4M0EA 5LQUA 1O9HA 3PICA 2MA1A 2QQ5A 1X77A 3LVRE 4PLZA 4DMLA 4ETWA 1C30B 2HNBA 3OCZA 3MD0A 4GXJA 3LDAA 2GPAA 2QJWA 3FCEA 3RIMA 2HFJA 2D3WA 4Q7QA 5ITZB 4KW7A 2ZPUA 1T6YA 3DLIA 1GZ7A 1VE5A 1DKUA 4ZOLB 1ZW1A 2I34A 5KFHA 1B0ZA 1PDVA 2BFFA 3I23A 1U9ZA 3QMPA 2QLTA 4UTOA 2R60A 4OJOA 2W6ZA 1GQQA 1SPBS 2QRUA 1XQXA 2ILTA 4YCSA 2QDKA 4DANA 5KCMA 2Y68A 2AFRA 3PTLA 4FCWA 4FYXA 5C7IO 5FF9A 2WSSD 5U4QA 4PG8A 1ZETA 5D7NA 1WSAA 3ESBA 3I6BA 3OX2A 4WZ6A 4Z7OB 4CHTA 2JLYA 5H3CA 2EFGA 1ND6A 1PEKE 1EGMB 3KLBA 1PX0A 3AY0A 3E7WA 5DASA 1JQDA 1M66A 2OT3B 1T1GA 3GLGB 2A33A 3LC2O 3VTFA 2X58A 5ERXA 1IV8A 1RHUA 3MJDA 3DEHA 4HQKA 1IY2A 1LPNA 2VWPA 1NSTA 5E4FA 4N7RA 4CKZA 2L19A 5MDHA 5DB8A 2BHTA 1Y8CA 3FPSA 3QXHA 3RC1A 1QG0A 1K4MA 2V6MA 4F5DA 2KSOA 4I5GA 3L0IB 2X8LA 1UQTA 1VYVA 1NBOA 4WESB 2Z2IA 3W8FA 4EJMA 2V9WA 2EC5A 4Y2XA 1YCGA 2XQJA 5LNK1 2CKDA 3GJ3A 3GDHA 5DGTA 5EMNA 5AD1A 2ACVA 4P93A 4JJEA 4RQ6A 1L4UA 1TJPB 3L8FA 4I81A 3V1NA 4YAGA 1P4AA 2GERA 3GJXC 1Z35A 2QGNA 2BEKA 3CUWA 5K2MA 4I4TA 2YB4A 3EPGA 1GG5A 2F3SA 4WIAA 3OT1B 5TB5A 3V2IA 4BVKA 1O8BA 5JQWA 2VK2A 4MRVA 3L06A 1EXWA 1WB6A 3L5OA 3PEVA 4KQHA 2JFHA 2WB1F 4UZFA 4GIBA 3QP9A 3NIDB 3FGZA 3U61B 2G8LA 4K3VA 4J0GA 3PE6A 5K3AA 4CTKA 5KNDA 4ZI7F 4WMLA 3V55A 4ZMSA 1ZH4A 4DV4B 4I4TB 9ICTA 3IP5A 3OEWA 1SG6A 2HSEA 2IA6A 1K7SN 1KI8A 1CRQA 1YRHA 2ALJA 2GZ2A 1YACA 2ARKA 2H65A 3GCZA 3OFKA 2J3IA 4DL2A 4CQLB 4MHTA 3SC6A 1HDXA 2I8LA 3NALA 4HLQB 3ETGA 4D74A 1DXQA 1YJQA 1DOQA 3L9WA 1Z2PX 3U3XA 3GMIA 4S1TA 5BW8A 1XXLA 2RKWA 4DSJA 1I33A 3OLVA 4MVJG 1JFRA 2I2XB 3ND7A 3N1UA 1DGQA 8ICPA 3Q7RA 1DAOA 2IIBA 3KYCA 3M7DA 4N9WA 5HG0A 2Y1GA 5B66U 3HABA 3LL7A 3TAXA 4F8YA 3CMCO 2LBOA 3DTTA 3MT9A 3L4KA 1YNOA 1JZSA 4UUQA 8ICXA 1M1YB 1P3JA 1EUCA 4OHZA 2E3TA 7ICLA 4C4XA 2DPGA 3FA2A 5FKJA 1ULHA 1C7ZA 3D31A 3FSGA 3OZSA 3TOZA 3W2HA 5KVVA 1RD4A 1OGJA 5KWSA 2AHOB 4EMUA 1OW5A 1QH1A 2HUNA 1J8VA 2F3NA 4NARA 1NM5A 2CSXA 2ETVA 1PN3A 2B4TO 4E6EA 5JC1A 3Q87B 1ZKMA 2B92A 4RK7A 2PH1A 2BFCA 3U7JA 4F9FA 1GQSA 1XD9A 4DLVA 4J0HA 5BUQA 2JGAA 2IZ6A 5COQA 4UJ3A 3NP9A 3ZQJA 1YDHA 4ECXA 2EX1A 4ZQCB 4DLEA 1V8ZA 3LZDA 1RM4A 3PKIA 4JLOA 4HB0A 5TF4A 1OH6A 3WYAA 2PFKA 3DB1A 4MUHA 4NJ8A 2OILA 3BE4A 2WRZA 3O4GA 4GPBA 4EW6A 3RG8A 1DKMA 2IHKA 4G3IA 4IDBA 3M9MB 4EJ2A 3FAHA 4ND3A 3IRVA 1Z07A 3IQWA 3K70C 4I1VA 3N07A 3MJHA 1GAWA 1K9VF 1FRQA 3WB0A 3PKJA 3ABOB 5GY7A 4GR9A 1H6DA 4ZGWA 2C7BA 2BBOA 4X9XA 2DSTA 5TJHA 3CLRC 2PT6A 3WJAA 5B6PA 4MHVA 3DFZA 2WVHA 1SVWA 5JHGB 5KTKA 2NXCA 3TECE 4Q4AA 3ZGXA 3WVNA 2FW6A 2GN0A 3PFKA 2R6AA 2VK4A 3KDAA 4QDKA 2MSLA 1Y1TA 3OQ6A 3AN1A 1NU6A 1I94B 5LP6A 2JFOA 2EP7A 3V7UA 1OX6A 2YNMC 3E82A 1L5GB 3RRGA 1HDYA 4L8GA 3TZHA 1DG9A 2AOUA 4CNQA 2O0JA 2ZYAA 3YASA 4BMYA 4BC1A 3IT1A 5F21A 2PPVA 3M6LA 5CAEB 4X64B 3OQNA 4IEEA 1EBFA 2CXHA 3HNPA 1XFAA 1EFLA 2JIOA 2YVUA 4GSLA 4WTOA 2Q49A 2OC9A 4WWHA 4BNWA 4PHGA 5LP6B 1H42A 2J0QA 2NU9B 3ZWQA 2XEDA 1XNRB 3PUHA 3VO9A 5KFYA 3S5UA 2IBKA 4IZOA 3WL3A 5IAJA 4DL6A 3RF9A 1ZESA 2AOUB 3ABRB 3C39A 3IB6A 4BGIA 1RHMA 2OQ2A 1OH7A 5A3RA 1U3VA 2ODBA 1XEFA 4ZVTA 1PBNA 3VHRA 2P2LA 4WCDA 4XX0A 1MAHA 2ID8A 2YHIB 4HWOA 4O5OA 1JVBA 2EGHA 4BMOB 3HH8A 1GPJA 1XQVA 3RS2A 1QVVA 2QR3A 1NY5A 4OL9A 4NOMA 4ZEXA 3RRMA 2BELA 3OF5A 4DGSA 1UEIA 1LDNA 1PUIA 3WKAA 2YVAA 3RVOA 4F85A 3BFVA 2VXYA 1FFCA 2JA2A 1Q3TA 2W5UA 2W8BA 3N87A 1SR8A 3RJTA 2JLVA 1ICEA 1UPCA 5IVIA 1ZINA 3NHPA 2E2WA 1QC5B 4AAYA 4C88A 4RW0A 5EJFA 3X1ZA 2QW1A 4LZZA 3FLMA 3JSXA 4WPGA 2RH5A 4G0UA 2C7VA 2PV7A 3CLVA 4M49A 1MT3A 2IGTA 1TVKA 5AK3A 1MIHA 2OG1A 1H2BA 1UM9A 4HDNA 4HEQA 2XHEA 1JIQA 3S1AB 2WJ4A 3QXJA 1Y6GA 2W0MA 1L5NA 3EF3A 1Y80A 3ZY3A 2VHXA 4PC7A 4M0DA 4DCNA 2YW9A 4TUPA 2ASDA 1PVPA 3L8CA 4JP5A 3W6OA 2Q9AA 2QT0A 4DMMA 2VHTA 1P7CA 1M73E 5JDCA 1DJQA 2WJHA 4QXRA 3MGGA 3LH5A 2PFOA 4HDQB 2AQ4A 4WZBA 2ZS8A 2A1AA 1CUDA 1OA0A 1UKZA 2XRMA 3H5IA 2RFLA 3ORQA 4LAFA 1W5BA 1V25A 3V1MA 2YIDA 5CA1B 5KO2A 5CWRA 5DHAA 2MMCA 3CNBA 1Q0RA 2QPTA 2VJQA 4QOFA 4AJPA 2EQBA 4FBMA 5JWRA 2BM1A 4LJRA 3LWMA 3E03A 4EG3A 4TTTS 2XJ9A 2ZWAA 3PR5B 1G7CA 1SC9A 1VLQA 2GCIA 3V4PB 3W1EA 3WE7A 4DPKA 1K68A 2WWIA 2VDMB 3W5SA 5T8KA 3LT2A 2WSBA 3BUSA 3A58B 4RGVA 1VHLA 2I6UA 4YONB 5AYVA 4B6GA 3O75A 2LCFA 3WMWA 1G9SA 3C28A 3H2BA 3TQIA 1Z2DA 3JQ7B 4GOOD 1SH7A 2CLDX 3F73A 1NUTA 1Z00A 3NNSA 3ISCA 4GH5A 2WJYA 3CUTA 3M7IA 2KI5A 3OMWA 3MOSA 2QR2A 2XRYA 2B0JA 3O90A 5TISU 2ZI4A 5F73A 3VPGA 4BMXA 5F98A 3ORSA 1P2UA 3GIKA 2HMAA 4NH0A 2QPAA 1DWQA 2L0XA 3QYPA 7ICJA 2BFAA 2JGJA 4L5JA 4AL4A 1BKSB 1ABFA 2RSLA 4XGIA 3CZCA 2PRZA 3DV2A 3EBPA 4FBGA 3COVA 4LFCB 4C01A 1YUMA 2XDAA 1PWXA 4H2DA 2BEWA 2F4NA 3DS8A 1VPWA 5FUQA 2WG0A 3G9ZA 1P3Y1 4AECA 5JD4A 3ODGA 4FK8A 4CTJA 1KRWA 2XCAA 4DUZB 3ITDA 3W4KA 2KZMA 3WGIA 4M46A 4ZQEA 4NXNB 4BZQA 2A86A 2HEGA 3FVRA 4C0WA 4UAYA 3G7NA 3AVYA 1DKNA 3I9LA 4DYHA 1OXXK 1GQOA 1EFRA 2YHAA 5CUQA 2OY0A 1N2CA 3U40A 3Q40A 3T95A 3HNOA 3K92A 4L0CA 3U1TA 1GEGA 3RB3A 3PWKA 2O4UX 2RH8A 1NJWA 4GE3A 4I4IA 4M8NE 4WLUA 2AUMA 1J8QA 2CL7X 3ZIUA 5F9NA 1NBEA 1A8HA 1W581 2BJVA 2X86A 3LBNA 1YOBA 4Q47A 3TFQA 5KSWB 1A8UA 3EG9A 3K5HA 2JHAA 4BUCA 4LZWA 4CV3A 2NP6A 2R25B 3F1KA 4LY3A 1PT7A 4XCQA 5L3ZA 3AILA 1TJNA 4IQ4A 2AJTA 2GN4A 3WRWA 5IRCD 1V11B 3P4UA 2HWWA 1BHJA 3KYDA 2XXBA 5KC9A 5KYYB 2NP7A 5EZYA 3MJFA 2NUBA 1L0BA 5F52A 3S70A 1W4RA 2Q2NA 2WOOA 3FVQA 2F64A 2REXB 5EHGA 3RVMA 1DQRA 3I52A 4D9JA 3KVYA 3K1YA 2YJ6A 4V0OA 2XKBA 1CF4A 4R2WA 4HDMA 3TKLA 2WZBA 1MO2A 3O03A 1WWUA 2H7CA 2QLJA 4N0DA 1C4KA 3JWEA 4TMYA 4TVBA 4Y0AA 1QRDA 1PJAA 3RJJA 3RM3A 4PN3A 2O8FB 1K66A 4EHLA 1ZRNA 3AVXA 1XYVA 2ZVQX 4KGVA 4MMXB 3WBJA 1RW4A 1CQXA 1S0OA 3IHWA 4N18A 1XQYA 4F0JA 1UPXA 1XCJA 2F3QA 4CU5A 5DM70 1PT9A 1CT9A 2OMEA 3JQBA 4PZUA 5JAZA 2PUFA 4GYYA 1SKMA 1WO8A 2GPJA 5T4EA 4I2JA 2WKRA 2JAOA 2IXFA 1XJQA 3S7ZA 3F96A 2RC6A 3ZCVA 3H86A 3B3AA 3TUJC 3NKVA 3KT0A 4P7GA 2J6HA 5BSWA 4BLOA 2A3VA 3IDAA 3SF8B 1BGXT 2G40A 2ZRMA 4BB5A 1S6YA 1DFHA 1FRFS 1JYEA 4I1YA 2ZBRA 4R2KA 1FP2A 4EL5A 1F8GA 1SHUX 3VO2A 4NP6A 1QO0A 4IJMA 2FDXA 5IVPA 1AGRA 3KEFA 5KAPA 4QUEA 4C4YA 1HV8A 4MQFA 4S1NA 1XZNA 1XZCA 4A5SA 4J76A 5TMBA 8ICJA 3QPBA 3II6X 4L8VA 4U02A 3SIWA 5HQ3A 1BG6A 3S7TA 1UBUS 5BRNA 2ZZMA 1GGJA 4R66A 1T2CA 3KOUA 5TV2A 1N7GA 3AI3A 2GFQA 3LQKA 3MJ4A 3WG9A 1TK3A 2HADA 3KWFA 4J0KA 4E2ZA 3NUZA 5E9WA 1VJ5A 2NYVA 1L5UA 4GFJA 1PTJA 2ODQA 2MUTB 4D43A 3D3KA 4PYIA 1R9GA 1IUNA 3KPVA 3MNFA 4GUAA 4N3GA 4NU8X 4AS3A 2OCDA 1UPUA 4JP2A 4ZCLA 1X19A 4HNTA 1GY8A 1OXTA 3IODA 3PSHA 4L50A 5EOVA 4DPLA 2ZZKA 1L1RA 4GI3A 5GM1A 4CT4B 2GZ3A 3H97A 5AVRA 1ODCA 1KEKA 4CEJB 4LOLA 1P80A 1BU5A 2C9DA 1W6RA 1V7PC 2I78A 1QFSA 2ZSUA 3EFEA 3GHHA 2ONZA 2GPWA 1NF8A 3AEZA 3FPKA 3LXUX 2ES4A 4IX1A 4IZ6A 3SJAA 3VOTA 2NRXA 1QVAA 4ERNA 5BMVA 2WB4A 5BNZA 3QG5A 1X9GA 4HB2A 5B3LA 4I50F 3KQMA 4DOCA 4S0XA 2DC1A 4YH1A 3WFJA 4PNHA 3PJGA 1BJTA 3O4FA 3TI7A 1YE8A 9MHTA 2O19A 2OZKA 1ZCAA 3VOAA 3DZ8A 1E0KA 3C3KA 4U2DA 3KOZA 4I4TF 5BPFA 4KFRA 3JWHA 5KG2A 2K2WA 1DPGA 2W4QA 4XUSA 4NJEB 3E70C 4PZCA 2RIPA 2G9NA 1A9XB 1YSCA 3KD2A 2HHQA 1M83A 1LH0A 1TUBA 2D13A 2EZ4A 4TZ0A 2YQEA 1RQ2A 2QIOA 2ZCVA 5FTWA 2O5CA 1PGOA 2LKCA 2RAFA 3G0DA 4GMFA 2GTHA 3MTJA 3CUKA 1G0OA 1KKLA 4COOA 1U2QA 3BJRA 1PD1A 2BL4A 3OM9A 4GXTA 1D3AA 1V9CA 3GFGA 3VTZA 4KH0A 1I0ZA 1YRQA 1X9HA 1ZN8A 10MHA 1T9HA 1EQAA 2Y0BA 1IAQA 2JZOA 3FAZA 1OFTA 2V0NA 4PL1A 3M83A 4G36A 5F35A 4X7MA 4URFA 1LVUA 1V26A 3KUKA 5LB4A 4G26A 1P33A 2HHHB 2A5LA 1VIDA 5DYGA 3DPUA 3NI2A 1T1RA 2GZDA 1P4RA 4P98A 5AVOA 1R4ZA 1IDN1 3E4CA 1H1DA 2WUVA 2X7XA 3WHIA 2HHJA 3WLIA 4JV5B 4EHIA 5J4VA 2C4HA 3G5LA 1NVKA 4A2WA 1S8NA 2RGXA 1R8YA 4H0NA 3REQB 9ATCA 2DR3A 4Q18A 1NVFA 4JIMA 2VKTA 2P6RA 4FNMA 4Z7QB 2O59A 3PXDA 4C8MA 4JCCA 2H4WA 4EJSA 4WEQA 2EF0A 1H8EA 1NW8A 3IOMA 4HBZA 3S68A 3U44B 1ZVMA 4BZZA 1NWHA 1P1KA 3JQPA 4RIHA 5E1MA 1UOQA 3RUAA 5FBVB 3H3XA 4J3JA 1WXHA 2ATXA 4R65A 1QBGA 1WY5A 3ZKWA 3NEJA 3FGNA 2FFRA 3FJ1A 2FZ4A 4H59A 1D4AA 4MW5A 4BFSA 1R0RE 1GPH1 3L4JA 2EATA 3ZY6A 2RHCA 4MARA 4LXHA 5REQB 1UC5B 2VH2A 5CLQA 4YMSA 3UENA 5AUQA 4B2YA 4JOCA 1QIIA 2WU1A 4ER0A 3UAGA 1YVUA 4P35A 1GP2A 2L5YA 4JXKA 1CLEA 3UOAB 2XODA 2VJAA 2DH6A 4FFLA 4IV8A 3UG7A 1V43A 4N7MA 5TMEA 2YYYA 1SG9A 1RC0A 1PQWA 2H00A 1A2OA 1BPEA 2RAUA 4EABA 4PQEA 1X0XA 2NSHA 3R6GA 3UMSA 4E1AA 1BJRE 3F1LA 1UFKA 1LSSA 4RMJA 5IH7A 3CEMA 3JD1A 3C7KA 3AKYA 3LT4A 5G4KB 2IA5A 1UQUA 1L5HB 1NKEA 3EEQA 5EA2A 2EAUA 4W7IA 4YRKA 2XWPA 4DUYB 3MSXA 2B69A 5BMOA 4YQFA 2C2KA 2ORYA 1D0SA 1N5JA 1UFVA 1C8KA 1Z7BA 5DNVA 3ZGOA 1VL0A 2BW0A 4R5MA 1T3GA 3HEMA 5B36A 1NF9A 4KJXA 1V37A 4MTCA 5FHRA 4AG5A 4NDAA 3VJRA 2IY9A 1ZUNB 3CLHA 3D2AA 5EIWA 1TEHA 2H2IA 2AOXA 2Q4RA 3Q7QA 1U2GC 3BHJA 5BWOA 5BV2P 4Z4FA 2KHZA 3ENWA 1LPSA 2QG9A 1N3IA 4Z6FA 2GD2A 2C9BA 1KLNA 3GRKA 3HFRA 3HG7A 4OV6B 3RLFA 3HT3A 4X24A 5D86A 4TWAA 4JQSA 3KJNA 4I55F 3R3JA 5FCDA 1WMSA 1PYDA 1J42A 2QAGB 4R2LA 5F3RA 1U1EA 3RAPR 1BPYA 4AURA 2PI4A 1VE9A 3DO6A 4HFMA 4KTQA 1T36B 2OORC 4BATA 4NULA 4FCCA 2OV8A 1FNBA 1N2OA 3MWEA 1EP1B 5U1PA 2OM2A 3U3MA 1LFDB 4RQ4A 3KELA 3QNMA 3NVAA 2MYUA 3TVDA 1QTNA 4FW8A 4P53A 4YAOA 4IDPA 1RABA 1DT5A 3U3OA 3V33A 4YUVA 1PJSA 1ZWKA 3DDSA 2C9ZA 4TTPA 2J09A 3ZQUA 2VEOA 3DDWA 4B6PA 2WAQC 4U3JA 3RI3A 3MIZA 4J0DA 3IRUA 1OJ7A 4KPUA 3EFBA 3IAM6 1VGQA 1J2EA 4G09A 4FS3A 5T4BA 3GLVA 3SDZA 3U3DA 4DIMA 5BMVB 3GJ4A 4BAGA 1UANA 4A6PA 4F12A 1M5RA 2CV2A 1ZQLA 1K6EA 3P9KA 3W2IA 4ENQA 1AS2A 3LG2A 3QE4A 2C92A 3WLFA 1LDMA 2ZTVA 4HLNA 4L85A 5TGTA 2BT4A 4RLSA 5BWMA 3QUCA 1KP3A 1ZG3A 2R84A 3AUAA 3FWZA 5DYYA 1SGWA 3MWKA 3AJDA 3OETA 4RD3A 4AXXA 3GIMA 4XQGA 2ZJ1A 1EVQA 1WTCA 5FQNA 5LYJB 2ZXUA 2QBYA 3U26A 3BQ7A 4YG2A 1PJ8A 4OP2A 4YDRA 5DTMA 1Y63A 1RWNA 3GFRA 4N5IX 1SQFA 1WW8A 4KN5A 4W8GA 1P2DA 5DYIA 5BWCA 5JSQA 4KRGA 3UT5A 2WG1A 1NJ8A 4B7AA 1ZC3A 3EZ7A 2FMKA 3DOJA 1BDMA 3EXIB 1IJEA 2MINA 4FD2A 3ROEA 3HYTA 3QE2A 3C6MA 3AYXB 3LQRA 5IX8A 4TKLA 1IUKA 3HJUA 5JI2E 3KSDO 3OJWA 1HL3A 1A3CA 5P8WA 4EI8A 3U3ZA 1VKOA 1F6DA 4UE2A 4C2AA 3QTBA 3FNBA 3PWZA 2YXPX 5A6VA 3M6IA 3L18A 3L9XA 3JAWA 5DGIA 5BXYA 3C97A 2DUWA 1IQRA 4B9LA 2UVRA 3N70A 5LYYA 2KIVA 5GONF 2IU6A 1ZQSA 1FMLA 3A6GA 3KAKA 3ETDA 3QITA 4X3CA 1WQ4A 2JAUA 3WLKX 2MTBA 3Q0EA 4WXEA 4AQDA 1IZ0A 3ANLA 4YO8A 4FDUA 4U39A 3WWEA 4BV9A 5KNDD 5HRAA 1SC6A 1K98A 1PL0A 2OAGA 2FF5A 3I9V6 4MCHA 1XWFA 3UUWA 5I6DA 5LOVF 4WN3A 4D96A 2WFMA 4RZRA 1MP0A 4NPHA 1YQQA 1JR3D 2HPAA 4LI0A 5ILOA 5EY5B 4C2BA 4YRSA 3BXEA 1TV9A 4HXEB 2R7AA 4JDPA 3QOFA 2CNBA 2FSHA 1XZJA 1Z5UA 2ET6A 3SQWA 3PV8A 1Z45A 3OY7A 3JATB 4F2GA 5E4YA 2FWPA 4IXTA 5AW8A 5KVAA 1Z3IX 2QD3A 4PIPA 4Y2PA 2WJPA 1NX6A 3GUZA 4PW0A 3WGUA 4RQ8A 1NOKA 3M1IA 4OA5A 5C8VA 1CUFA 1EEHA 1NBIA 5LP6C 2R8GA 3KQPA 3S2IA 1E2NA 1EDDA 1HGXA 3QV1A 1T1JA 3K9FC 3NV9A 2UZ0A 3GQBA 3GQCA 3AEQB 4XLTA 1JHVA 3HBFA 5F2EA 5KFZA 1IXKA 4EJFA 1Y3DE 1E3WA 2F59A 1EG7A 2GA8A 1AKNA 3H11A 5DPMA 3HYRA 3QV2A 4LTNA 2NT4A 4D8VA 2Q1SA 3KYDB 4L4UA 3STWA 2IODA 2PJZA 1XBTA 3OY2A 5F7JA 3V1UA 4H7IA 2IWHA 3AR5A 1X0VA 2XUKA 4HNVA 3D2LA 2I6FA 2W83A 3IA2A 2X6QA 2F1OA 2B8WA 4JP8A 5EYPA 5K8JB 4DR1B 4GDFA 2B36A 5JRJA 4UHCA 4RADA 5DHQA 2JGIA 1LEHA 2WV7A 1SUAA 2BZFA 1RTKA 2NG1A 3MWDA 4X61A 5BQPA 4PSAA 1B8OA 1KMIY 3DGFC 1KYZA 2VNIA 3PC2A 5J0OA 4EEYA 3A37A 5C32A 5I7FA 3DA8A 2NPIA 4L3OA 3U7GA 2BR3A 2POQX 3T9DA 1YVPA 2ECFA 1SELA 2GCPA 4K8OA 2GLTA 3MUOA 2VA3A 4GC6A 3HTXA 3ZDBA 4YRMA 2QB1A 4RV9A 3OLWA 1VLZA 3FFWA 4L15A 5DB9A 4Z6KA 3QX3A 3K09C 4TV9B 3SKXA 2BFWA 3TDMA 3ZWOA 4JI2B 1ACJA 1H2FA 1G8YA 2QYHA 1F17A 4FHGA 4S1WA 3GD7A 1W49A 5CFMA 5HKBA 5EJ6A 2W0SA 5GINE 3M33A 1O9BA 2ZIUA 3ZK9A 1NULA 2AXQA 1PVVA 1VRCA 3QEJA 4KL8S 3FG9A 1P5ZB 2IS6A 1RRCA 3NBUA 3VU1A 4EHKA 2Y76A 4I2DA 2O6HA 2PUGA 1VGVA 3X44A 5GIOE 1HT2E 1USIA 4GKAA 1L4NA 3K0FB 3X1MA 4LZGA 4EELA 4EF6A 2RC5A 5LP6F 4YR7A 3LRXA 2KLHA 1I7PA 2ZTDA 1R4NB 1TJ3A 2NVOA 2PVCA 2XDYA 1KJJA 2ZSFA 4XLLA 3UN1A 3BDPA 4OHOA 4K46A 4EY7A 5J4LA 3GLIA 4LHWA 1NVWQ 2I65A 2BTQB 2PUVA 3DM9B 4HAIA 4WK6A 5ENZA 5BW6B 4BRSA 2XE8A 5DLPA 3QA3E 1TTTA 5ICFA 4M54A 4RAOA 4NONA 4ZZ2A 2Z1MA 3TTUA 3C2QA 4ZO9A 5FFMA 4F3YA 2WKPA 2FP3A 2BGGA 3TK1A 1WCV1 4ID9A 3VGJA 4K26A 3AL3A 4HRYA 1H0KA 2R8YA 3PQCA 3FWHA 2Q5HA 2IYPA 3FUCA 2WF6A 2DBQA 3D5EA 3GB9A 3O1HB 2DFLA 2VDWA 1P72A 2ZUEA 3QYFA 4JT9A 1TKDA 1SCUA 2ZDHA 3Q3JB 1QKJA 2C4MA 4G5QA 4IIHA 5FIUA 3NEPX 3KV3O 5H7XA 1G55A 1TECE 3JXEA 1U11A 4X45A 1ZM9A 4KLSA 4HQNA 3I5YA 1ND5A 3T3FA 5IJ0B 3ETNA 2XUHA 2ZJYA 4HWGA 1VCHA 2FZ5A 1IPEA 4J9UE 2PMEA 1UBMS 4DM4A 4UM8B 1Q19A 3CNQS 2WYWA 1UT5A 1IEVA 4NWIA 2B2CA 1MQSA 4I50B 2FPUA 4CF5A 1WSBA 3G85A 3Q1LA 4NI5A 4Z6EA 3U1BA 4YJ2A 4JWTA 1AV7A 4X3PA 2TMGA 5B4TA 3PSIA 2RK6A 4KO2S 3G6VA 4L1KA 1ZMXA 1BA2A