1UA0A

Aminofluorene dna adduct at the pre-insertion site of a dna polymerase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua0A01
3QE9Y 4O3NA 4NLNA 2IHNA 5FROA 3TAQA 3RB6A 3LAKA 2R8GA 2HW3A 3RB3A 3T5HA 1PZNA 2J6TA 1IKYA 4CGFA 4KLUA 3M9NB 1ZQKA 3BJYA 4FLXA 4M45A 3KK1A 4ID5A 1HMVA 1REVA 3SPZA 3SNNA 4DTSA 2C2EA 3AU2A 3IM1A 2BANA 3QZ7A 4CGIA 2OPSA 5J0XA 4MF2A 1ZQRA 4RW9A 4UAYA 2B5JA 4CESA 1CLQA 3FFIA 1NJXA 3AVMA 5L1IA 3U6FA 2R8HA 5J0SA 2V4QA 4G3IA 3AVNA 2G8KA 3T1AA 4ELTA 3OYMA 1IO2A 3KD5E 4ECWA 3VQ4A 2C2DA 3M9OB 3O3HA 4CJSA 2XGPA 4FJ9A 4IR1A 1F21A 2HHWA 1B9DA 9ICJA 4FS1A 3K4GA 3C2MA 1C0TA 1WSEA 2HB5A 1EETA 1ZBFA 4Q5VA 4ECRA 1ZQPA 4MFFA 2J6UA 4EP4A 5HROA 3HL8A 1TAQA 2UVUA 7ICKA 3I8DA 4ECZA 5J2NA 3AUOA 4GC6A 2BCRA 3ISDA 1FK9A 9ICFA 4PPXA 4B08A 1CUKA 4ED1A 1RT3A 4IR9A 4J9KA 2R8JA 1WLJA 1S0MA 7ICRA 1MU2A 3B0YA 3AU6A 4EEYA 1ZQXA 3NHGA 5HRRA 4BE1A 2BQ3A 2ASJA 2ZUBA 2IAJA 4BXOA 2D0AA 4RQ2A 3C21A 4RQ1A 3HXMA 3EW9A 4LVSA 8ICWA 1BIZA 2F8TA 2HHUA 2O4IA 3RJIA 5DK5A 1RDDA 3HP9A 1KFSA 3D0PA 1RTHA 1HUOA 2FPKA 4N5SA 2RN2A 1DLOA 3DLEA 4EP5A 3NGDA 5HRPA 5DG8A 3K5NA 5CWRA 3ZDCA 3G10A 3CQ8A 3AVJA 1C1CA 3PR4A 2NRXA 8ICVA 1EXQA 8ICCA 4IQTA 3HK2A 4I7FA 4QZ9A 2W9AA 3P5JA 4J2EA 4UB1A 3GIJA 3DI6A 4FK4A 4KB1A 4DL2A 1JLGA 4Z4HA 3RRHA 2V4RA 1U47A 1VRUA 4PA1A 3GV8B 8ICEA 1GOCA 4AHSA 2DTUA 4CGJA 1JL1A 2I1QA 3U3YA 1ZQOA 3OS1A 3ALYA 5KFOA 3SYZA 1ZQBA 4AH9A 3LZJA 2WTFA 4OJRA 4PHPA 3EZ5A 4F2RA 4DU3A 4FJKA 1S10A 3MR3A 4AHVA 2Z1JA 1S1UA 4HHTA 3T5KA 2FMSA 2GBZA 3HPOA 3V1RA 1YT3A 4E3SA 3S3NA 4ED0A 4IG3A 1VSFA 4OPJA 1RDAA 3JPSA 1TAUA 3QO9A 4LZGA 1HJPA 5KG7A 1T7PA 4F8RA 1ASWA 4PY5A 3QERA 5J0OA 3OYJA 1ZQDA 1T03A 5CYQA 3AO1A 2OWOA 2W9CB 1D5AA 4FBUA 4R8UA 1ZETA 4W5OA 2FLNA 2NRTA 4OKKA 1LV5A 3O4QA 4LH4A 3ZT2A 4CEOA 4OVLA 1ZQCA 5DBCA 2FLPA 5KFKA 8ICPA 3M8RA 4M9JA 2VA8A 4J9SA 4IQUA 1HNVA 2IC3A 3WNHA 4BDZA 5C5JA 9ICWA 2NUBA 4UB5A 3IS9A 4DOAA 4TQSA 1JL2A 2ATLA 4B9SA 3C2LA 3PMLA 3PX6A 4KV8A 4CEEA 2YNIA 4XIUA 4ECTA 4CJQA 8ICOA 3H40A 4CE9A 4CJWA 3MR5A 2KFZA 3WNFA 3MR6A 5J2GA 3RBDA 5EWFA 3S3MA 2VA3A 1RYSA 3LAMA 8ICSA 1JKHA 1XHXA 4TSXA 4KRFA 3UIQA 4KLEA 1QSYA 4CHYA 2X6SA 4YP3A 4LY7A 2BR0A 3CFPA 5KFBA 7ICVA 2KN7A 2BQRA 4I28A 4F5PA 4I2HA 3SPYA 3SUNA 2GUIA 4C8KA 5D4BA 3TABA 1NOYA 4F4KA 2G8FA 1ZQJA 7ICFA 4QZIA 3ITHA 5KG4A 4CJTA 5J2KA 4FJIA 3G6YA 7ICUA 4FXDA 1BPDA 3MAQA 3P1GA 3QIPA 5J2FA 4QOZB 2UVVA 2DFEA 1XS9D 2OPPA 3AO5A 3JPQA 2JEGA 4ECUA 5D3GA 1N56A 1W0HA 4ZTJA 1LAWA 4M3WA 5J2PA 2ZQBA 8ICYA 3DLBA 5KFIA 4KAZA 1S97A 2XY7A 4DQRA 3AVIA 8ICUA 1VSIA 3RAXA 1WAFA 4XQ8A 1A5XA 3AVFA 2R8IA 3OS0A 2Q3SA 3MXJA 4CECA 3EWAA 3UXOA 4O44A 1EP4A 3V6DA 4FK2A 5F9NA 3DOLA 3L3VA 4O9MA 3RJEA 3VA3A 1S9FA 4RQ6A 2BCUA 2IGIA 3GFKB 5KRTA 3D45A 2YHBA 4R63A 4F5RA 8ICBA 1CZ9A 1TV6A 1U4BA 3SQ1A 3OYBA 4DL5A 4YQWA 2BE2A 4YD2A 3VQBA 4KLTA 2JEJA 4IG0A 1H38A 2ATQA 3CM5A 2OPRA 3RB4A 3LP1A 4HUEA 1S9EA 2B4JA 5TZVA 1KVBA 3CFRA 1LW0A 2Z1GA 2FBTA 4O5BA 4UB3A 5KFZA 2F1IA 4I2FA 3IAYA 1Y97A 2HHXA 2D5RA 4ED8A 2KZMA 2PXIA 4CHOA 4CK3A 1J5OA 3V9SA 3S9HA 1ZQWA 4M3XA 9ICKA 3OGUA 9ICBA 4EYIB 5KFYA 4DO9A 1JLEA 3K5LA 3JPOA 2ZTDA 4KHYA 4BACA 1K6YA 4CHPA 1QHTA 4DOCA 2DFHA 5IILA 1NJWA 5L1LA 4AHCA 9ICMA 3MABA 3OHBA 2AQ4A 1DGSA 9ICTA 4CIEA 4CJFA 1KLNA 1KTQA 1YVUA 1JXBA 3GILA 3C2KA 1D9DA 1EX4A 4M9LA 2Y1IA 1S0NA 2GV9A 4AHTA 3HO1A 3QLHA 3QEPA 5I42A 4RG8A 1A77A 4ZHRA 4Z4FA 5D49A 2ZTCA 4BDPA 3NTUA 1NOZA 1TKTA 4QZDA 2DPIA 4LSLA 1Y88A 5DLFA 4CHZA 4B9NA 3L8BA 3OHAA 1L3VA 8ICLA 2FBVA 3B0XA 5J0RA 4RQ3A 3RJJA 3TAEA 5KFEA 3H4BA 4M9GA 1ZBUA 4AHUA 1RPLA 3VQ6A 4KO0A 2BCSA 2PI5A 4YXJA 4C8OA 1ZQHA 3AO3A 2D0CA 2XY6A 3NDKA 4B9UA 5L1KA 1KCFA 1S1VA 3AA4A 3RJFA 2YKNA 4CERA 4YMOA 4O4GA 1S77D 2KFNA 1ZJNA 3OY9A 4PH5A 1RZTA 9ICNA 3K5OA 5EOZA 4GVMA 4N56A 9ICHA 8ICTA 4AHRA 3BGRA 1JLCA 3UQ2A 4BGDA 4RQ7A 3Q8PB 3OYIA 4MFCA 2RKIA 4M04A 3F73A 4DSIA 9ICLA 2MUTA 2ZJ5A 7ICQA 2G8HA 5DQGA 4FJXA 1C0MA 1S1TA 2G8WA 4FK0A 4FJGA 3SQ4A 4I29A 4DTNA 5KI6A 2I5JA 5IIIA 5KFNA 2OZSA 2YHAA 2B6AA 4DTOA 3N97B 2VA2A 1KLMA 2BQUA 1ZBIA 5KT6A 1ZQZA 4PGYA 3JPNA 8ICAA 4YNQA 1ZQMA 4Z6EA 1UT5A 4RT3A 1Q9YA 4RUAA 3PY8A 4DTXA 4M0AA 4CHQA 2YNHA 1W9HA 1ZQQA 1NK8A 1S5JA 2UVWA 2YNFA 3B6OA 4YR2A 5DB9A 3TQ1A 4QW8A 2X6NA 4Q8FA 3DLKA 2ZJ8A 3KK3A 5L1JA 1B9FA 3C6TA 4R64A 4KLOA 3MXIA 1XSPA 4FLVA 1DTTA 4P4MA 3ULDA 2RPIA 1CXUA 2F8SA 1SL0A 4M42A 3L3UA 1TV9A 3FYHA 3H8WA 4ICLA 2P6UA 1C7YA 1VSDA 5BPCA 3HX0A 1KSPA 4GXIA 3LP2A 1SV5A 5KFJA 3ETLA 5DB7A 3O3GA 3LDSA 3DRPA 1TKDA 3ZD9A 1WN7A 3PW0A 4W5NA 5HRSA 1L3SA 1EKEA 3HWTA 4P2HA 2PFQA 4HYKA 5KFTA 4I2QA 1HJRA 4LSNA 1MC8A 3DRSA 2XHBA 4KREA 3V7LA 3QEWA 2XGQA 3ZDEA 1UA0A 2VWKA 3MFHA 3DLRA 3DYAA 3VQEA 1ZYQA 3KLGA 5KG6A 4DTRA 4ECVA 5HHHA 2HHQA 2P1JA 1JMSA 1QTMA 7ICNA 2BGWA 5KFQA 3NAEA 4DSLA 3KKRA 3RR8A 4KHWA 2A1JB 2GWSA 2J6SA 3QINA 3H7IA 1RBUA 3MBYA 3SUQA 2IA6A 3NE6A 3MDAA 1IG9A 3ZSZA 1WSJA 3BQ2A 5CB1A 1N5YA 2Q0ZX 3RR7A 3KLEA 3BQTA 2WONA 1HQEA 1NK9A 4P4PA 4J9RA 1RXVA 1BVSA 1GOBA 1TL3A 3KD1E 4O0JA 4PQUA 3RWUA 3TR8A 3L2WA 4YXMA 4E7KA 2ISOA 3VQ8A 1JIHA 3WNEA 3K59A 1BI4B 4YD1A 3H08A 3OYHA 4E7LA 1VSEA 9ICOA 1LAVA 4I27A 1BI4A 3H8SA 2HVHA 2PYJA 4M3RA 3RJKA 3PX4A 4OGEA 3ISBA 3OYEA 4B9TA 3OYGA 5DB6A 4E7IA 3QEIA 1UWBA 3V7KA 5DMRA 3KHHA 2FMQA 1QLNA 3OVNA 3IHQB 4P4OA 2RDJA 4YCXA 2OA8A 1ZQNA 5JUMA 4KN4A 4CF2A 2G8UA 2ETJA 4RUCA 4NCAA 1J9AA 1UOCA 4Z0UA 2F1JA 9ICVA 1C1BA 3I0RA 2YNGA 1Q9XA 1BPZA 3C94A 3V6HA 4WE1A 4ECXA 4YMMA 3QZ8A 1KVAA 5D46A 4KFBA 1U49A 4O3RA 8ICZA 3M8PA 4KLSA 3ZT3A 4RNNA 1Z25A 4DEZA 3AA5X 1BIUA 2G8VA 1YTAA 4JRPA 2W42A 3VQ5A 7ICOA 5IINA 2FPMA 4G1QA 4HTUA 4MF8A 1NKEA 3F9KA 2Z1IA 4NYFA 3KHGA 1JLBA 4F4ZA 4CJRA 2DFFA 4CF0A 5J0TA 3MGHA 1ZQYA 3SQ0A 3NBPA 4IKFA 5KFUA 2KZ3A 3H4DA 2W9CA 1HUZA 3NCIA 4CJVA 4Z6FA 2BGGA 5CP2A 1RXWA 3LDAA 4N76A 4PHAA 3Q8LA 5C24A 3QEVA 2W8KA 2BCQA 4QZ8A 2JLEA 1ASUA 4PWDA 2Z1HA 1FKOA 5CY4A 4BE2A 5J0PA 4DFPA 2E6LA 4TUSA 5FDLA 3QEXA 1CEZA 3RMAA 2C28A 1BQMA 1NKBA 3I0SA 3L2QA 1HYSA 4CEBA 3EPGA 5J29A 4B9LA 1HPZA 1X9WA 1ZQGA 4O55A 4EZ9A 2LSNA 4K8ZA 1NKCA 1SL2A 2XCPA 8ICXA 3LANA 3RTVA 3VQ7A 3PX0A 1Z00B 4KLJA 2X78A 1BHLA 9ICIA 1C6VA 4K8XA 2XY5A 3JSMA 2BKEA 1Z00A 5DGBA 9ICAA 4UQGA 3PMNA 4IRCA 4RZRA 4UB2A 4RPZA 1MSWD 4FZYA 1K1SA 4JV2A 4B9MA 2ZTEA 3LK9A 4ECYA 3M8QA 4YN4A 4IBNA 1U45A 4CGGA 3TAPA 4E1NA 3N4MB 2BPGA 1KEJA 5C25A 1DTQA 1RDCA 8ICQA 3OYAA 4QZGA 4I2BA 4FLTA 4RW7A 4DFKA 1D9FA 1NK4A 3NGYA 4QAGA 5SZTA 4QZCA 3V9XA 4J9QA 4JV1A 5J0YA 2XC9A 3ORYA 1EXNA 5DB8A 3RH4A 1MQ3A 4RNMA 3E2EA 4GW6A 3L2VA 2QKKA 3S3OA 4M3UA 1UT8A 4XUSA 3ISNC 5FRMA 5CJ7A 4QZHA 2BHNA 3TFSA 9ICSA 3NF7A 3UXNA 4DSFA 1RT7A 4M3ZA 3SJJA 3LP0A 2HNZA 1MQ2A 2P5GA 2ZJAA 4C8LA 4NLGA 4MFAA 4K4IA 4FM2A 1ASVA 2KTQA 1QE1A 3PUFA 4NXZA 4Q44A 5DGAA 4O5EA 3Q8MA 4DWIA 3KHRA 4NLKA 4JS5A 4KLFA 1WSGA 5HP1A 3MEGA 4JS4A 3C1YA 5J2DA 2O4GA 4JV0A 1S9GA 1LB2B 3VQAA 4GXKA 4CF9A 5KG0A 4O3SA 1XWLA 2AGQA 3KLIA 1NK0A 1ZBHA 1D8YA 8ICGA 4CF1A 3V1QA 4CEQA 2BPCA 3DOKA 1WNSA 4EBDA 4NCBA 5CZ1A 3NF6A 3C1ZA 5KFVA 1ZQIA 4KN7A 4NLZA 4Z4CA 4EBCA 3JPPA 8ICIA 2PFNA 4CJLA 1I39A 4Z4GA 4KB0A 4BE0A 3M8SA 4CJKA 1S0OA 1ZQLA 3OYNA 5J2AA 2JZBB 3VA0A 5J2JA 4MQ3A 4DOBA 5HMLA 4Q43A 2ASLA 4HVJA 3QNNA 4YR0A 3UQ0A 1JXLA 3NH2A 4CJUA 2XO7A 5I3UA 3CFOA 3NF9A 5E41A 4I9LA 4NCGA 4PGXA 4KHSA 4ED2A 4OKEA 4B8CA 2OYQA 3ASMA 4DU4A 3Q8QB 3ZDBA 2BCVA 4FYDA 4AILC 3JPRA 4BWJA 3VQPA 4ZH4A 9ICXA 2HHTA 4YFKA 4J9PA 3HVRA 1S0VA 3QEBZ 4DSKA 3GIMA 4B8AB 5CZ2A 4X5VA 3ZSXA 2IMWP 1T05A 4MEXA 4IFYA 3ZSQA 3NH0A 3B6PA 2RF2A 3OJUA 5DDMA 1U04A 3GV7B 4QWBA 3ZD8A 3SUPA 4O3OA 4FJ5A 1CXQA 2JEFA 3ZT4A 4LH5A 3V72A 4QW9A 4JK1A 2ALZA 3RH5A 3C5FA 4CIFA 3THVA 3T19A 2W9BB 3FDSA 3PVXA 4JWNA 4KTQA 1TGOA 3MGIA 1NK7A 2ITGA 3QESA 2W9BA 3SV4A 4CGHA 4ECSA 1N6QA 4CGDA 1FXXA 1HNIA 1IXRA 4DLEA 2A1SA 5CHGA 3V81A 4C8NA 5J2QA 5IIJA 2FPLA 4MFBA 2ZD1A 4Z4IA 1RYRA 4KLDA 1BPYA 1QQCA 4CHNA 3TAFA 4DQPA 4RQ8A 1Z3EB 1U9LA 1TL1A 2DFLA 4TQRA 4J9OA 1X9MA 1D8LA 5KFAA 1V9PA 3LWLA 2IOCA 4FZXC 3G0ZA 2QK9A 4O3QA 4E89A 2ISPA 4IRDA 4M9NA 4R65A 1RBTA 5KT3A 2D0BA 2DY4A 3Q8KA 4CEAA 3OYDA 5KTQA 4JLHA 1U48A 2P5OA 3DLGA 5KFCA 4KI6A 1XC9A 3VN5A 1L3TA 1JLQA 4F92B 1RT1A 5KT4A 4JWMA 3QETA 3SZ2A 5J0QA 2E6MA 4CFDA 5EWEA 1ZJMA 4E7JA 1C1AA 3TWHA 4E19A 3GQCA 3ZSYA 4M6WB 4B9VA 4DFMA 4NY8A 4GC7A 5KFFA 2NRWA 3TANA 4CFCA 3A2FA 4M6WA 1TK5A 3HVTA 4L8RB 9ICEA 4FW1A 5HMMA 3IG1A 5DBBA 4F5OA 4DG1A 4RPYA 2PYLA 4FLWA 5FRNA 3ZT1A 1T3NA 3PW4A 5EU7A 2VG5A 3ZSRA 5KFRA 1S76D 1WSHA 4OPKA 1VSHA 3PW7A 4MEYA 4QZBA 5HBMA 4IDKA 1Z26A 5T7BA 1SZPA 5KT5A 3PW5A 1X2IA 4ELVA 1KRPA 2VANA 1N48A 3AA3A 1VSMA 4HUFA 1BQNA 3WNGA 1KDHA 4DL7A 1Q8IA 3SQ2A 1BISA 7ICPA 4PUOA 2UVRA 4QWAA 4O5CA 3MFIA 3QNOA 3V1OA 1RDBA 4OGCA 4RU9A 1ZQSA 4IFVA 4J9NA 4CK1A 1QSLA 2H5XA 3OSPA 3AVKA 3H8JA 5IIOA 1NJZA 2IS3A 3VQQA 4Z6DA 4DL4A 3AV9A 4RW6A 4C8MA 4DL6A 1TFRA 4FJNA 3EYZA 2ASDA 4CJ4A 1ZQFA 5HP4A 4FLUA 4RPXA 1KFTA 4HCBA 5DBAA 1IH7A 1S1XA 2PFPA 5JS2A 4DTUA 3L2UA 4FW2A 8ICRA 2ZUCA 1VRTA 3G6XA 4I2DA 3C23A 1RILA 9ICRA 3V7JA 4R66A 5C42A 3LP3A 3IRXA 5KGWA 4KLMA 4I2PA 1JLAA 2B21A 2VWJA 4DSJA 4ID1A 5HLFA 2ZE2A 4Y1DA 4H4MA 3GIIA 4CFBA 1NJYA 1G15A 2IHMA 2HNYA 3PO4A 3RMDA 1RTJA 4RW8A 4KHQA 2A1JA 1LWCA 7ICHA 4W5TA 2FC0A 5F9LA 4QWDA 4CEDA 4Z6CA 1BCOA 1RTIA 1BL3A 4BXOB 3PNCA 3KIOA 3DMJA 3HSTB 4FJHA 4KHUA 4F91B 5KFSA 3OYCA 1C0UA 3AVCA 4FLZA 5J0WA 4DMNA 4PHEA 3TI0A 3OYFA 4DSEA 4KLQA 5KT2A 2P6RA 3ZDDA 4FS2A 4XA5A 3HT3A 5KRSA 5CA7A 4FVMA 7ICLA 1HYZA 3T3FA 3CM6A 5CR0A 3ZDAA 2X74A 4KITB 1LWFA 3T5JA 5J2IA 1QSSA 1NK5A 3C95A 7ICEA 3NGZA 2M9NA 5EWGA 3PV8A 2HNDA 3KLFA 1UA1A 4ED7A 3ZSOA 5DQHA 1WSIA 4CEFA 4KKOA 7ICSA 4ZTFA 3RJHA 3SI8A 1BPXA 3HM9A 1VSKA 4FM0A 4UBCA 2JGUA 4TUPA 3UPQA 3LALA 4UAZA 4KI4A 1RBVA 3KTQA 4K4GA 1IKXA 1HYVA 4J2AA 5DLGA 4W5QA 3HW8A 4J2BA 1TKXA 1IKWA 3K57A 2V9WA 4RQ5A 1TK8A 1HRHA 3G6VA 1IKVA 4EBEA 1CZBA 1RT5A 1VSJA 1COOA 4F50A 1X1PA 3MEDA 3BQ1A 5JS1A 2MAXA 5DDYA 5BOLA 4M3TA 1AROP 3RJGA 4KMUA 1JXEA 4DTMA 5J2EA 1ZQUA 4Y1CA 5J0UA 4YR3A 1IM4A 3JYTA 3HJFA 4DF8A 5HNKA 2A1RA 4R8UB 4BDYA 5J1EA 4OLAA 1LW2A 2AGOA 1QS4A 3O3FA 4OLBA 4O0IA 2OZMA 3UXPA 4FM1A 4CF8A 5BOMA 1A5WA 2LYHA 1TKZA 5DG9A 1XU4A 3TAGA 3OYKA 2PFOA 4GXJA 1S6QA 3VQCA 4F4WA 4R5PA 4CJPA 4F3OA 1BPEA 1SKWA 3PR5B 1WCNA 2VG6A 2KQ2A 4FCYA 3AO4A 3AVHA 4I9QA 4I2EA 5KFLA 3GV5B 3AA2A 3K5MA 4TUQA 3NF8A 4Z4EA 4DL3A 4QWCA 2G8IA 3BQ0A 4FBTA 8ICNA 4FJJA 4FZZA 1XSNA 2QXFA 3C6UA 2I9GA 1T4GA 4E1MA 3NFAA 5KFGA 4QZEA 4W5RA 3GIKA 4XRHA 3PW2A 4F93B 2P66A 4Q45A 8ICHA 1L3UA 2QKBA 8ICFA 4OKJA 4I2IA 4BWMA 3SI6A 1SUQA 1K1QA 3HP6A 1RNHA 4M3YA 4H8KA 3K58A 2YV0X 3V6JA 4KTZA 1BPBA 3OSNA 4F4XA 4H4OA 1KFDA 3M9MB 4F4YA 4J9MA 1YTUA 4FJ8A 5KFPA 2KZZA 5SWMA 4DTPA 2AQ0A 2R7YA 4F5NA 5KGXA 1X9SA 9ICQA 8ICJA 3OJSA 4DFJA 4RQ0A 4M9HA 1BCMA 3GDXA 2FBXA 4M2YA 1XHZA 4CJ3A 3O4NA 4FLYA 1LWEA 3T5LA 9ICCA 3P83D 3HPGA 3V4IA 4I2JA 4DQIA 9ICUA 3LPTA 1RBSA 1J53A 1FKPA 3SCXA 4N47A 4JUZA 4IQWA 4CJEA 4ED3A 5KG5A 5KG1A 5IIKA 1SKSA 4DQSA 2YKMA 3JPTA 3KLHA 4KLGA 3RMCA 4RQ4A 2WOMA 4HUGA 1ZQTA 4RT2A 3V9UA 4DTJA 3ZSWA 1ITGA 3K75D 3U3GA 2XY8A 4FJ7A 3C5GA 2OPQA 3OYLA 1S1WA 1GOAA 7ICJA 4RW4A 2BPFA 4CJ5A 4M47A 4RNOA 2C2RA 4KPYA 5IIMA 1S6PA 3QIOA 3DM2A 3OS2A 4HCCA 2XCAA 1ZQAA 3RRGA 3ZT0A 4IQVA 3TARA 1XO1A 2DPJA 5KFDA 4UBBA 7ICIA 3V9WA 3ISCA 1A76A 5KFMA 4CK2A 1RT6A 2EX3A 1TVAA 1O1WA 4O5KA 1TVRA 4LD0A 2JZBA 5KFHA 2FBYA 1VK0A 1BGXT 2IDOA 4IRKA 2RDIA 5KG3A 4UB4A 4EZ6A 3VQ9A 3SUOA 3QEAZ 3MECA 1KVCA 4I2AA 3EY1A 2AGPA 4KLHA 2F96A 4DQQA 3V6KA 3AVLA 3TAMA 2HHVA 3E01A 2AJQA 7ICMA 9ICPA 2EHGA 3BDPA 4UAWA 2PY5A 3HYFA 2NRVA 8ICMA 4E7HA 4JRQA 4DS5A 5HHIA 3CYMA 3KK2A 5J2BA 8ICKA 1ZQVA 1TK0A 1UAXA 5CYMA 4M41A 4CEZA 3LZIA 3CG7A 1WSFA 3VQDA 1NOMA 3PO5A 4ED6A 1I3AA 1VSLA 7ICGA 4YMNA 2ZUDA 3AVGA 5KG2A 2E4LA 4EYHB 4FJLA 1SKRA 2HMIA 2C22A 2AU0A 3AO2A 4CFAA 4CIGA 3RMBA 3ZCMA 1WAJA 3KKSA 3NH1A 2W9MA 3DLHA 3EPIA 1WCLA 5DQIA 4QCLA 4YFUA 3RAQA 3MEEA 5HRNA 1RCHA 3AVAA 4YG2A 3MDCA 4Q8EA 4KHNA 4PHDA 3RBEA 9ICGA 1T8EA 4QWEA 4CCHA 4FO6A 1DOQA 5J2CA 4GLXA 7ICTA 1ZBLA 2Y1JA 4PGQA 4Q0BA 1B92A 4I2GA 4J2DA 5KFXA 5L9XA 4NM2A 2HVIA 3RB0A 4QZFA 5K14A 4F3TA 4KLLA 4DU1A 4N41A 1L5UA 3DRRA 1B22A 5KT7A 4J9LA 2R8KA 3KHLA 3NGIA 2VG7A 2W8LA 4O3PA 1JN3A 3Q8RB 5DG7A 4FJMA 1HQUA 2XRIA 3RH6A 4KTWA 4GMJB 1R0AA 4NM1A 3KJVA 4F2SA 2FLLA 4ECQA 4I2CA 4E0DA 2IBKA 2MUTB 4TURA 4DS4A 4ELUA 1JLFA 1ZQEA 3MXMA 5KFWA 2HHSA 1J54A 3AVBA 1NK6A 1JX4A 3LWMA 2PI4A 3HPHA 1A5VA 1SL1A 4LZDA 5DKWA 2F1HA 3SV3A 4DF4A 3LPUA 3K2PA 2FMPA 4QZAA 1B43A 4F5QA 2NRZA 1RTDA 2PZSA 1RT2A 5J2MA 2BDPA 1RT4A 3MR2A 3Q8SB 5J2HA 4K4HA 2P51A 4DLGA 4B3OA 3TFRA 1XSLA 3ZSVA 3V9ZA 2JEIA 1RBRA 3L2RA 1XI1A 2KW4A 4YVZA 4NYNA 4KLIA
chains in the Genus database with same CATH superfamily
4O3NA 2E2QA 1OVQA 4OJ6A 4ID5B 1HMVB 1DTTB 2P5VA 2K7KA 1NJIT 3ZYYX 2BANB 2YMMA 4ZS6A 4ID5A 1HMVA 3ZZYA 3C3LA 3I33A 3L7UA 3FFIB 2B4OA 3AU2A 2R7WA 3HSZA 4HTIA 2XNQA 2BANA 3QZ7A 2OPSA 4MF2A 1UPHA 2F4VK 2JWNA 2R7QA 1CLQA 3FFIA 1U6BA 2JXJA 4FF4A 1NJXA 1QVGR 3AAQA 3CCUS 3AVMA 4UTGA 1NSAA 5L1IA 4JMUA 2FGCA 5TKWA 3A1YG 2HFZA 3JB9k 4UOFA 4QBUA 2XS5A 3OYMA 1AUDA 2C2DA 3M9OB 2ZH4A 1AFIA 3VGKA 1EETB 2XGPA 4EUVA 4CJSA 2ZOMA 4P75A 2P9SA 1F44A 5KPRA 2CNOB 3CNHA 1EETA 4CLSA 1VCTA 2F2AB 4BR9A 3GYNA 3MK6A 1TAQA 1KS2A 3J81j 3BM7A 2AYGA 2FF6A 4H4KA 2ALYB 2CQBA 1PO6A 4IR9A 1RWPB 2R42A 4MTPA 1IWGA 3SJHA 4YN3B 5EE1A 4RU2A 2WSFC 4I64A 3NHGA 5HRRA 3KLEB 1FEZA 1K8AT 2NREA 2ZUBA 2EANA 2KLAA 2JOQA 4EU0A 1N33J 2Y1RI 2ZVIA 4KHPJ 2HHHJ 4AYBD 2F8TA 2HHUA 1SH2A 3CD0A 2P9EA 1RDDA 2EBEA 4A48A 4JI7F 4N5SA 2RN2A 3R9LA 3KLVA 4DUTA 2IM1A 3IRWP 1YWXA 2GGPB 3AODA 5IT9Y 3NGDA 4ISFA 5CWRA 2MJUA 1UEVA 1IQZA 2GGPA 1QQ6A 4JI5F 3CQ8A 3AVJA 3PR4A 2NRXA 1HKBA 2QO3A 2ZXIA 3FK4A 1JLGB 3CW2C 4J2EA 2GNKA 2GO7A 4H5TA 2JLFA 1JLGA 5AQYA 2FHMA 1X4FA 2DTUA 8ICEA 2IOHA 5IM0B 5F3ZA 2HF3A 5D4LA 3SFGA 2NLWA 1OS5A 1CBKA 5IM0A 3O1LA 4DV4K 1ZQBA 4L72B 1S79A 4FVUA 3DV9A 4FJKA 1X4BA 3UDEA 4AHVA 2B8QA 4HHTA 2W40A 2GBZA 4FNIA 3HMJG 4E3SA 3I8BA 3S3NA 1BY9A 4OPJA 3JPSA 1TAUA 1HJPA 4MKAA 1T7PA 4F8RA 3E9OA 2K8AA 4PY5A 1B99A 3OYJA 1ZQDA 2CRLA 2UXDK 4BY9C 4Y2TA 2I38A 4IKAA 2H5JB 1ZETA 4W5OA 2B43A 2EG1A 1F6TA 3AEVA 5AI9A 3K89A 4LH4A 1V38A 5HR7A 4LF9F 4P52A 1SZHA 3BZQA 1HNVB 4CEOA 5B0EA 1BE4A 1VQ7N 5KFKA 8ICPA 3B4DA 2MQPA 3EM1A 1PVRA 4EGLA 4O3MA 1HNVA 3QNWB 4R79A 2IC3A 1RHUB 5FD1A 1C4CA 1ZTTA 3EN9A 4DR6F 5BRHA 2NUBA 1FNXH 3NG8A 2YTCA 1DQ8A 2ATLA 4BQZA 2EFGA 3TOQA 3PMLA 2C3YA 2W4CA 2ZITA 2GX8A 4QU7A 4CEEA 3AQEA 4CJQA 3R3TA 1RWUA 8ICOA 5ETPA 5JU5A 5EWFA 2VA3A 1RYSA 2D7SA 3LAMA 3A5MC 2EAPA 2F8KA 4TSXA 2HGLA 3UIQA 4ZP7A 1UEUA 4LJMA 3E66A 2BR0A 4DOZA 2O66A 1T9TA 4F3QA 3CFPA 4TN2A 2ZM6K 4W4MA 4P6QA 2WRMA 1FJGF 3PYEA 4RW7B 1ZM9A 4I2HA 3D6MB 3QX7A 1I5OB 2E5HA 3QIPB 1NOYA 4F4KA 3DWLA 2G8FA 1KL9A 1ZQJA 4F0HA 4WQ5C 1DXSA 3G6YA 1AT1B 7ICUA 1VJWA 4DR2K 1BUPA 1JCFA 2O6KA 3QIPA 5J2FA 2CN1A 2E9TA 2ZJQQ 2YTUA 5E3RA 2WBMA 2HS3A 4KRWA 2DFEA 5MLCQ 5J2PB 3H5SA 2OPPA 4CM2A 1DK2A 1N56A 2K1RA 4DX8H 3NGTA 1W0HA 2BTFA 2DCUB 1LAWA 3EUB2 5J2PA 1ZPWX 4DV0J 3V4MA 4DU8A 4BRMA 3CGIA 1RABB 4U67L 4PRFA 1VSIA 3WEEA 1YIJN 1A5XA 3GSDA 4NMXA 4R0EA 5AKKA 4U6PA 3AVFA 3OS0A 3M2RB 4V19S 5C0YA 3FJ2A 3L3VA 3MF5A 4M63C 5AI6A 4NOHA 3M2RA 2KXHA 4CO1A 1ZOLA 4MAKA 3FC4A 3MCPA 2V94A 5KRTA 3ILIA 1QAXA 3DHWC 1D8BA 2V2VA 4TKTA 1UQVA 3POTB 4KQZA 1NU4A 5ALLA 1FWPA 4IG0B 3KOOA 2BE2A 2HQFA 4CZGA 4YD2A 2IYGA 3LP1B 3POTA 4JKDA 3E1YA 4IG0A 1HD0A 4WF9L 1NB7A 2HBYB 2ATQA 1YHQS 4FWNA 3FEYB 3LP1A 3KOAA 4PAAA 2F9DA 5TZVA 3EMTA 2E1RA 5H1SQ 1YJVA 4IXCA 2Z1GA 2AJ1A 2F5GA 1NNEA 4O5BA 1FVQA 2F1IA 2O67A 4I2FA 1Y97A 2HHXA 5C2CA 4OJPA 1SZ2A 3V9SA 1LXJA 3S9HA 4LF5J 2DGOA 3M4XA 1VBZA 1SC3B 4EELA 4FVCA 2AT1B 2LA6A 1YJWN 4G1PA 4DV4J 2NCKL 3CCEN 1PC4A 4GKKJ 3D2SA 2XMKA 4GV6A 4LFCJ 5ALFA 1RHKB 5L1LA 2P9UB 2CAJA 3I55S 4CIEA 3BBBA 2P9UA 2B51A 1JXBA 3C2KA 2RF2B 3AOAA 3QLHB 1TUGB 1OO0B 4M9LA 4ZHRB 2XM3A 2AD9A 4CVNE 3HO1A 3QLHA 3M6XA 4LSLB 4BG8A 1XR5A 4RG8A 4ZHRA 5AQWA 4BDPA 4EX7A 3WKBA 3NTUA 1F3FA 2DPIA 4LSLA 4N77A 2APOA 1Y5IB 8ICLA 4DV7J 4RQ3A 5IC6B 3H4BA 1GO3F 1HNIB 4AHUA 1RPLA 4IUFA 1IIPA 1WOPA 1MROA 1GQEA 4DCJB 2KV2A 4QIGA 1QVFM 4X62F 1ZQHA 2D0CA 1HNWJ 2AX1A 3GZ7A 5L1KA 3QUBA 1X60A 1TL1B 2HAFA 2P9GA 2WSCC 4YMOA 1QQ7A 1WDTA 3R27A 2UUAJ 4JI3K 2I2YA 1N36F 4LF6J 3OY9A 9ICNA 5GTHU 3K5OA 5EOZA 2J0QD 3CDBA 2QLTA 4Q2LA 3IBFB 4AHRA 3IC1A 1KONA 3EUNA 3UQ2A 3Q8PB 2OH2A 3GCWP 1BXNA 1WC1A 4M04A 2ZIWA 4K25A 2QWLA 3HHLC 3FZMA 2G8HA 4OYPA 3MX2A 5DQGA 4FJXA 2DNNA 2HZCA 3SQ4A 4I29A 4F25A 3M1YA 3O80A 3EGZA 2O01C 3TUPA 3EO3A 1BQXA 5KFNA 5LMUK 4LBPA 4DR7J 2Y8WA 3N97B 1M1GA 1RLCL 5I9EB 1LFWA 2DRBA 4YB5A 4OPAA 4J5OA 4PGYA 2AH5A 4Z6EA 4CE6A 1CC7A 2I6XA 4I4BA 2D3DA 2VG5B 1NGGA 1OPIA 4WK3A 1R8HA 2RHQB 4N8OA 2CH5A 2PEHA 3O6QA 3SQOP 2JWLA 3R1HA 5JVHL 1ITPA 5IWAF 3PRVA 4YR2A 4DV1K 3DLKA 2PC6A 4BC2A 5BREA 4KLOA 3PJXA 1XSPA 4HI2A 4DR5J 1SS6A 1WF2A 3G86A 1YZ6A 1YVFA 1CXUA 2WFBA 2X1GA 1CJUB 4M42A 4ZJOA 1TV9A 3FYHA 4ZIWA 2P6UA 1C7YA 2YQ3A 4JV5F 5FLXU 5BPCA 2E66A 3GYXB 1CJUA 3SAHA 3LP2A 1Z4NA 5TISU 1FWKA 1GAOA 3ETLA 3P96A 3LDSA 3NRBA 3PW0A 4LSNB 1P90A 5HRSA 1Q82O 2ZBRA 5LMNK 3CJKB 1R6YA 2HFVA 1GLFO 4HYKA 1XNQK 4BGBA 3A8JA 1HJRA 1MN8A 2KIVA 4LSNA 1WTFA 3CJKA 4DCPB 2QMWA 1TQLA 2I9SA 4WFAL 2XHBA 4JI6F 1NJIO 4CLUA 3V7LA 3Q8UA 2R9LA 2HK2A 1UA0A 1CULA 2EG2A 5G0RB 3OFHA 2LVWA 1YX2A 4WFBL 2OEHA 3FZBA 5KG6A 1ZAVA 2IVYA 5G0RA 5HHHA 1JJ2R 5AM4A 2AYEA 5CR4A 1HWLA 4BUGA 3U8XA 4RW8B 3DRXA 3T1YK 2UUBK 3KKRA 5AQUA 2DJWA 2HWIA 2JH7A 2XMTA 3MCMA 1RBUA 2MSTA 4JI2K 4A8WA 3S1TA 1WSJA 5IT9U 4ANCA 1BO5O 2NS1B 4PG7A 5CB1A 3PYFA 5AI0A 2E2OA 4DMZA 4J9RA 2KJ8A 5F8LA 4O0JA 1RWOB 3L2WA 2K3KA 3HLUA 3TZXA 2ZFHA 3K59A 2I5HA 3WNEA 5CYJA 2F4VF 3ENOA 4NLVA 1GMWD 2HRYA 1VSEA 9ICOA 2YWFA 1JWWA 4M5LA 2F9WA 5F1XA 4I27A 2H54B 1F0XA 2OANA 5GAEI 1UWBB 1I1GA 3HBTA 3N4PA 1VRQC 3OYGA 3J7YU 3QEIA 1UWBA 3QFWA 4J37A 2FMQA 1QLNA 2GIRA 3OVNA 2IRYA 3NCPA 3G8QA 4KKOB 5JUMA 4KN4A 3FZLA 2G0CA 1HW8A 4RUCA 1B0TA 1Y5LB 1UOCA 3ZXWA 4GKJK 3D2FB 2D1KA 4CJ7A 3AMZA 3V6HA 3LQVA 4WXWA 3QZ8A 4CLYA 2CJAA 1U49A 1E6YB 5D78A 4MKVA 8ICZA 4KLSA 3O5TB 2WAQC 2CNKB 4CD3A 1F5SA 3AA5X 3FRZA 3GONA 2HWTA 1BIUA 3D3CJ 1YTAA 4FP9A 2QG9B 2W42A 3VQ5A 5IINA 3M7VA 1IBLK 1AQ6A 3FAHA 4CF0A 3NLCA 2DQNB 4X4QA 5D8HB 1NPPA 1YZ7A 1ZQYA 1FE4A 3TEGA 3H4DA 2BX6A 2P35A 2FJAB 2UUCK 5CP2A 4NL9C 1WEXA 3Q8LA 2EI5A 2KJVA 4QZ8A 5AKZA 1FKOA 5J0PA 3THTA 1J5EJ 2QRRA 4DI6A 3QEXA 2DGUA 2C28A 3I0SA 3G4SS 3EPGA 5B0GA 4IFEA 2ZC4A 2IYIA 1U09A 2EZXA 4EZ9A 2LSNA 1JXVA 4K8ZA 3CCZA 1SL2A 2CG4A 3ONNA 3IBPA 5JLFA 2XCPA 1RWMB 3RTVA 1Z00B 4KLJA 2X78A 1W97L 4O23A 4XH4A 4Q7AA 2XY5A 3OR1B 3CPEA 1Z00A 4OQJA 1GMWA 4UQGA 3M8QB 3OR1A 4NLXA 2FSJA 3DLLQ 4JV2A 2MGZA 4B9MA 3LK9A 3M8QA 4YN4A 2B56A 4ZVRB 4PKIA 3NNAA 5BPMA 4OV6A 1IJEB 2MA1A 2SXLA 4UARA 2DR8A 4PZOA 1T9XA 4C9DA 4I2BA 1RAEB 4DFKA 2N7YA 3K5PA 1KVJA 4QAGA 5HO4A 4J9QA 4F26A 3TZZA 1NZ8A 4ZP9A 2Q2RA 4NB4A 2VDIA 5C15A 3HFKA 2PO4A 2UXDF 3CETA 1EXNA 3RH4A 3JSRA 2M0NA 3TTDA 3VF2A 3O9RA 3AOCA 3L2VA 4B3RJ 1NU0A 3S3OA 1S49A 2PA3A 4M3UA 3ISNC 2QKQA 5KOXA 5CJ7A 2BHNA 2HNZB 3C2PA 2R2SA 1JROA 1Q3VA 1ATRA 2LMRA 4BRAA 4ZPTR 4X66F 2K8BB 2HNZA 2ZJAA 3LDLA 1FERA 4ZITA 2KB2A 4M7XA 2MPUA 4NWIA 2E5IA 2BJEA 3IWLA 5HP1B 4NXZA 1SQGA 5L8RC 5ALIA 3Q8MA 3J80O 1SJ1A 1S5LU 1Q7YO 4JS5A 4KLFA 5HP1A 2RS2A 1A7GE 4JI2J 4PKHA 5LL6d 3C1YA 5J2DA 2HQGA 2O4GA 5HOOA 2MLYA 3D54A 1X6JA 1UJ4A 3ZNUA 3VQAA 4CF9A 5KG0A 2DHXA 3LM9A 1XWLA 2E1ZA 3TADA 1Z4UA 2R7XA 2AGQA 4XPCA 4WK1A 3CJ7A 3FZ2A 4XH1A 1NK0A 1O51A 2V2QA 1ZBHA 1D8YA 3OUYB 4CRJA 1IBKF 2F65A 4L3NA 3GP9A 3OUYA 1QY7A 1U6ZA 4OYAA 2ZM6F 3ET6B 3TUIC 1ZQIA 4KN7A 4NLZA 3UN2A 4EBCA 3CJTA 3KZBA 2HPUA 4U7BA 8ICIA 3O44A 4CJLA 3UDLA 3W2VB 1WSRA 1ZC6A 4KB0A 3CB4A 3CSKA 1H6KX 4LFBF 3UD4P 3NVZA 2JZBB 3W2VA 1S72N 3OTQA 1K8KB 4DR2F 2K2PA 2KICA 2ASLA 3UQ0A 1JXLA 5KAIU 3N6LA 2KJ5A 1K8KA 3NF9A 4OI0A 1EAYC 3KVGA 3RW7A 4GKJJ 3CIPA 1FW6A 4BS2A 3DCAA 4KHSA 2BRKA 4OKEA 2MQLA 2OYQA 1F3VA 3Q8QB 4X4SA 1B0PA 4B6JA 2XZWA 2AJ4A 1SCJB 4K4SA 3VEYA 2HHTA 4YFKA 2KJ9A 4J9PA 4CZIA 2RIJA 4RNFA 2LXUA 1VQ8S 4BRFA 2OLWA 4B8AB 4X5VA 2BJDA 1UCNA 1CPZA 3CCMS 3ZSQA 1U2FA 3OJUA 1ZM3A 1U04A 3RJMB 2F4FA 2ZH1A 4O3OA 3UNYA 2HQIA 4ENOA 3V72A 4QW9A 2A42A 2QB0A 4H0YB 1UP1A 3CPWM 3THVA 4OLPA 2W9BB 1HNZF 1AYEA 5ETKA 4KTQA 2PMHA 2DXEA 3VGTA 3PACA 3KZIU 2ZIUB 4C3MA 2ILYA 3QESA 3IWNC 2W9BA 3ATUA 4MFBB 1FXXA 1IXRA 1EQ0A 2ZIUA 1QQOA 3MAHA 5IIJA 4MFBA 2A1AA 4NA3A 2KKHA 4Z4IA 3JAMU 1X4CA 4YS2A 4OD0A 3C28A 2UXCK 1BPYA 2YX1A 2DFLA 4J9OA 1NRKA 1D8LA 4LR9A 1V9PA 3E0FA 3GSIA 4RTFD 5AXKA 4O3QA 2KHCA 5FPMA 1RXOB 4E89A 5AE3A 4IRDA 4DR1J 4PL2A 3OVAA 2MSSA 2PDAA 2V9KA 1UCVA 2D0BA 2RP5A 2KHQA 3BGLA 2XS2A 2ZNZA 1JLQB 3OTDA 2W2MP 3DLGA 1XC9A 3DN9A 1JLQA 3GFYA 3JSYA 1ZA2B 2Z2ZA 3TVKA 3AD9C 2HOQA 1OPZA 3SZ2A 5ALEA 4CYUA 2FY8A 1C1AA 4GVBB 3UFCX 1YJNS 3J80Y 3TRGA 4E19A 4DFMA 3HVTB 1IJJA 2A6AA 3ILLA 1NO8A 3NOGA 2YPYA 5G5GA 1J2VA 5KFFA 3IG1B 1YRTA 4GVBA 4XTTA 2Z30B 4C7YA 3HVTA 1ACMB 4C23A 1UFKA 1IXKA 2LHTA 3IG1A 4RBUA 3CTRA 5DBBA 5FRNA 3BGFA 4KB7A 3W63A 5HBMB 3UN5A 2D0PA 4FYXB 2J76E 3AFGA 2HQDA 1COKA 2IVNA 3DGVA 3BF1A 1BQNB 5HBMA 5F8NA 2AP6A 3UKUB 5T7BA 3CJ0A 3PSIA 2H3IA 4PUOB 3CJ2A 3UM9A 2ZXHA 1VSMA 3AD7C 1BQNA 2WW4A 3UKUA 4DL7A 1D4XA 2ZBCA 4TLQA 3TEHB 7ICPA 4PUOA 2V7ZA 3I87A 1RDBA 2N82B 4RU9A 1ZQSA 4J9NA 3AGKA 1NSQA 4YY3K 4JI3F 2AEFA 1PJ7A 2MY8A 4KH1B 3OSPA 3WC0A 3AVKA 4X4PA 2FJEB 5AJ3J 2IS3A 4DL4A 2ZIXB 3AV9A 2JLGA 1TFRA 3PSTA 2ASDA 3S6JA 4CJ4A 2ZIXA 4FLUA 1FT8A 3I5AA 1KFTA 5L38A 4K4XA 1NBEB 4F4AA 1VRTB 5HATA 4MKYA 4M94A 3ENWA 3OL9A 3IMXA 3L2UA 1XNSA 2ZUCA 5HLFB 1VRTA 3WKCA 3V7JA 5C42A 3LP3A 2MSNA 1NHUA 3QFPA 1SVDA 3DJCA 3MN7A 2QA1A 2VWJA 1UPMB 4H4MB 5HLFA 5LMUF 3HI0A 1B0XA 4NYZA 5J2NB 3MUMP 4H4MA 1RTJB 4CFBA 3G82B 2LKYA 1G15A 1CVJA 3PG9A 1RTJA 4KHQA 3FC9A 3G82A 1Q86T 1EZZB 2VZ9A 3CWJA 1XMOJ 4CEDA 3DMJB 3PIPL 1SH3A 1RTIA 1BL3A 1C0UB 3CCJS 2E1AA 4BXOB 3PNCA 3DMJA 2KG0A 4FJHA 8AT1B 1OQ3A 4KJIA 2A40A 2PFUA 4F91B 4KHUA 1J97A 4JD2B 1C0UA 3AVCA 3K17A 5J0WA 3W9HA 2F8MA 4P72A 3BDEA 4OJLA 4PG6A 3L95X 3VAFA 2YXLA 4DSEA 2DTJA 3DAWA 5KT2A 2MKIA 4B3MJ 4JD2A 1PUZA 5A8RB 4XA5A 2MQ8A 1HD1A 1LWFB 4JK9A 4LIWA 1U1KA 5A8RA 3IXQA 1KN5A 3KUGA 2VOOA 4KITB 1LWFA 3DXMA 2QMUB 3SQIA 1XNQF 5AQIA 2MZSA 1Z1ZA 3EEQA 5DDOC 2ZJRL 2X3DA 2DH8A 7ICEA 3NGZA 2J8SA 1DEJA 3EZOA 1NH7A 1FTRA 1ZAWA 5BR8J 2YB1A 4GO5X 3VAIA 3SI8A 1BPXA 3ICXA 1BNOA 1PC5A 4P0PA 2CQ1A 2VF3A 3ETOA 3LALA 4UAZA 3MCAB 4F71A 1IKWB 4DKWA 3KTQA 4CLTA 4J2AA 1NXIA 1WF0A 4A61A 2CPJA 1IKVB 3M2VB 3HW8A 4J2BA 3T1YF 2UUBF 4K50A 1IKWA 1N5VA 1JJCB 4ES1A 4RQ5A 3G6VA 1IKVA 2DNQA 4CNZA 1PG5B 2CQ3A 3KKAA 4IG3B 4OZ0A 1VSJA 1COOA 1RWKB 5BYQA 1XQSC 2B6GA 1K9MT 4MLEA 2ZBQA 3VZIA 5DDYA 5BOLA 1AROP 3RJGA 1JXEA 5CYQB 2FUG9 1RAIB 3IMQJ 2A1RA 3UDVA 3AAPA 2CQDA 4M5NA 4BDYA 2R3VA 3MM6B 4RO0A 4CH7A 1QS4A 3W9JA 2Y8YA 1AXQA 3MM6A 4CF8A 4YOXA 3UB5A 2C42A 3CJSA 1XU4A 2LU1A 1H2UX 3OYKA 1J2NA 4NZ6A 4F4WA 3VQCA 2HF4A 5AM0A 5HI7A 4CZFA 1WD6A 1WCNA 3AVHA 4KC5A 3C6UB 4I2EA 5KFLA 2J9DA 4TUQA 4IH7A 4FJJA 4BRGA 3H0MB 3QBXA 3C6UA 2E3TA 1VQMS 4URSA 1S7IA 4JN4A 5E2QA 1U2VB 1JKHB 2OFHX 4OHYA 1RKJA 1K44A 4Q45A 3W3DA 1R8AA 1P8ZA 4TY9A 1L3UA 4OZ5A 3H8YA 3HD2A 5DM7Q 2Q6BA 5A2QU 2QKBA 1U2VA 3L3FX 3TTCA 1SUQA 1K1QA 4M3YA 2GW8A 1UJ6A 3U26A 4NL5A 3V6JA 2DT9A 1IBLF 3OSNA 4H4OA 4FDFA 5E3PA 2ZGYA 5KFPA 3HKZF 3Q8YA 1SJQA 2VH7A 2AQ0A 2R7YA 4GNIA 5KGXA 4C4WA 2DY1A 2LQJA 4DFJA 4RQ0A 3KMSA 4M9HA 3GDXA 2V6AA 4URGA 1B70B 1U02A 1N5TA 1VQ5N 1G1XA 1KDNA 4NZ0A 4DUZF 1U1OA 3P83D 3R1XA 1FKPB 4I2JA 3CO0P 4WFNL 3W7BA 3LPTA 1U1MA 4C11A 2GMJA 5AM5A 3SCJE 1RBSA 1H0HB 5AKJA 1RCXB 1FKPA 5M1NA 3SCXA 4N47A 4JUZA 4YOYA 1DQ9A 4ED3A 5KG5A 4NV0A 2MKKA 3J7ZT 1OXJA 5KG1A 2W24A 1L7PA 3MPDA 2BZFA 4EI2A 3VEWA 3JPTA 4IOCL 4KLGA 5EDWA 3HT0A 5A6WA 4KBOA 3NVWA 4O44B 2LU2A 5BRDA 1KBRA 4ZVPB 2LM1A 3HRGA 4RT2A 4B02A 3V9UA 2F9TA 3H0PA 3K75D 2QYCA 1KC8T 4OJGA 5HVFA 2OPQA 3OL8A 2DGWA 2P8IA 4RW4A 4JI1J 4ETXA 4NXNJ 2HBMA 5F0WA 5CXTA 3VEZA 4ZLNA 1SAZA 2C2RA 4KPYA 5IIMA 5GAEP 3QIOA 2ZNYA 1TUVA 3RRGA 4IQVA 2XNRA 3TTFA 2CPDA 3ENAA 2J0XA 3TARA 2R2UA 3VGSA 4UBBA 2FSNA 4ANEA 2OAUA 1ZTWA 3NP5A 4MO4A 1A76A 3OTBA 5KFMA 4OV1A 2GQ2A 1O1WA 3MECB 4P2MA 4JYAJ 4LUBA 5GADI 4CF4A 2FBYA 1OH7A 3CO9A 4I56A 2HBJA 2RDIA 4UB4A 1XIQA 4EZ6A 2DL0A 1HHQA 2QEXN 3MECA 3H5YA 2QLXA 2JMGA 2M8DB 3N0VA 5B08A 3HSGA 4KLHA 3M8ZA 3V6KA 4MK7A 3AVLA 2KU7A 2XI2A 1NHVA 2IVMA 3TA0A 3NAHA 4KX3A 2UUTA 3WQTA 4UAWA 5T7LB 3UR3C 3HYFA 5AK4A 3IWXA 2F7VA 3CDWA 8ICMA 1OSCA 2GHVC 1X5OA 3CI5A 5T7LA 3CIZA 4IDHA 5HHIA 5EXWA 3CYMA 2OMLA 4DL0C 4FWMA 5J2BA 1ZQVA 2GHWA 4PYDA 4DV3K 2RU3A 2XYGB 2DEJA 1DZ5A 4M41A 2E8NA 2WVFA 3LZIA 4AUKA 2ZKUA 2DBBA 1LNQA 2GJIA 5FPNA 5FIIA 2AW0A 1I3AA 4F36A 4USTA 4DUYJ 3D6JA 1VSLA 3H6EA 4EMDA 7ICGA 1VR6A 2FTRA 4YMNA 2M9KA 3ONQA 3UDCA 2VQFK 5KG2A 2G13A 1SKRA 1MWYA 2HSTA 1X31C 3FEZA 3NH1A 1TMMA 4JBCA 8ATCB 4USAA 4QCLA 4CTAB 1QVFR 3MDCA 1Q81T 3S6EA 3RBEA 1HIYA 4CTAA 2A18A 9ICGA 2HAIA 1T9UA 3NEKA 5B09A 2BBEA 2DYAA 7ICTA 3VMFB 1ZBLA 2Y1JA 4PGQA 1U25A 3CCLS 1CZAN 1B92A 2CZ4A 5L9XA 3F2CA 3DRRB 2RRNA 4PR6A 5CAAA 4QZFA 4F3TA 4XDCA 4C8ZA 4N41A 3DRRA 2RSQA 2WB1F 1R0AB 3US5A 3J80U 1S99A 2ZOFA 4O3PA 4LVNP 3Q8RB 5AZJA 4C3KA 1R0AA 1SH0A 2CWKA 2KJWA 4I2CA 1BC6A 4E0DA 2IBKA 1ZM2A 1N4LA 1CJKB 1MDUB 3D6TB 4FWSA 3IR6B 5GVQA 1RHMB 4TURA 5AQPA 4ZA1A 3MXMA 3OPXA 5KFWA 2HHSA 2YKAA 3AVBA 1NK6A 1JX4A 2PI4A 5ALYA 2QFIA 3WZ0A 1SL1A 3WBZA 4K0KK 1CS4B 2F1HA 3NAIA 3W5ZA 2E5LJ 3K2PA 3KZXA 4QZAA 4F5QA 2PZSA 2OI2A 3Q8SB 5J2HA 2P51A 3ZFVA 3TFRA 2CPIA 4P9SA 3Q2SC 2YNHB 3E51A 1GTHA 3G71S 4MO5A 1Z1BA 2FI1A 1RBRA 3CCUN 1XI1A 4KT0C 2YQEA 3SQGB 1DBDA 4H0TB 3BO2A 3C65A 2UU9K 2IHNA 4ZPVR 5FROA 3TAQA 3LAKA 2UXCF 2R8GA 2HW3A 3SQGA 5KPZA 1PZNA 3AA8A 4KLUA 5HQ8A 2L48A 3R3LA 4DPOA 1FX2A 2DNMA 1REVA 4RW9B 4CZMA 2QLFB 3CJ5A 3W9IA 5F8MA 1NHKL 4CGIA 2I7NA 5J0XA 4YEAA 3WDOA 4RW9A 1SV5B 4UAYA 2A1BA 3KWGA 4CESA 1H7WA 4WU3A 3C66A 2DH7A 3A0HU 4H0XB 3C19A 2V4QA 1GXTA 3BH6B 3TKAA 3T1AA 2MZ1A 4ELTA 4ZCMA 1IO2A 1C0TB 3FGUA 4LRBA 2ODGA 4BC7A 3PIOL 3EDQB 2YX7A 4DV6F 4ILLA 3K4GA 1C0TA 4IH6A 3MPUB 4FF3A 4Q5VA 3OFFA 3MWBA 4QU6A 5D4PA 3LUYA 5HROA 4RX6A 2HLTA 1FK9B 3R2CJ 2WVDA 1JMTA 1RT3B 1Q4RA 3MN5A 4GC6A 5ALXA 3ISDA 1FK9A 1WYGA 2V4JB 1CUKA 1RT3A 1MU2B 2R8JA 2LP4A 2WB1D 2OTJS 2E1YA 4RUHA 3BF4A 2Y1LB 2HVEA 2D3ZA 1MU2A 1JK9B 2A3VA 4EEYA 2QZ8A 5GINA 1ZQXA 1RP5A 3B4MA 4B3SJ 2MU2A 4NYOA 3H20A 1M5OC 1RAOA 2CWXA 4RQ2A 3C21A 1YJRA 3EW9A 1RTHB 4DU7A 5B0CA 3SENA 2DPNA 4LVSA 1KXPA 1XO0A 3RJIA 2RVJA 5AXLA 4YY3F 4LR7A 4TU9A 2CUYA 4PKGA 1KFSA 2QT7A 3DLEB 3MHYA 1RTHA 1HUOA 3QMQA 5AQNA 4NYPA 3DLEA 4U8VA 5G4DA 2MXYA 2VU5A 2VFTA 4I7FB 2PN6A 3ZDCA 2BUNA 1HARA 1C1CA 8ICVA 3HI9A 2CQIA 1NGAA 4IQTA 4I7FA 4QZ9A 2NZ4A 3I32A 1S3XA 1U1QA 4DL2A 2VPXB 4AHSA 1DRZA 4C1NK 2L9WA 3GBTA 4B3TF 2I1QA 4USVA 1PYSB 2QV6A 1NAQA 3ALYA 1WHVA 2NXCA 7FDRA 3LZJA 2AA4A 5ALPA 4M5MA 5LOQA 4OJRA 4PHPA 2A2DA 2RB7A 4CO5A 4KGZB 4DU3A 4TYBA 1Q5YA 4L6V3 4NJ8A 2ERRA 4QJVA 3MDQA 3HPOA 4ZKAA 3G6ES 1VSFA 2X1AA 3LOUA 5EUHA 1RDAA 2NRHA 3GFXA 1M6YA 3CQYA 2LEPA 3QERA 5J0OA 4FZLA 4CT8A 3MMBB 4MIAA 2P9CA 3AO1A 2AJFE 2MKCA 2W9CB 2J9EA 4FBUA 1MLAA 4R8UA 3MMBA 3CJ8A 1N62A 1UFLA 4OKKA 2MDAA 3O4QA 1KN6A 1K0TA 1GLEG 2KD1A 1ZQCA 4USUA 4JNEA 1BQMB 2BA9A 2MKSA 3M8RA 4M9JA 4WIQA 2Q1NA 4J9SA 3IS9B 5DM6L 2FD2A 4BDZA 4WXOA 5C5JA 4KX5A 1ATSA 9ICWA 5HL7Q 4GKKF 1QZ5A 3IS9A 3R7NB 4OJOA 4OL8A 1QTNB 1SIWB 3PX6A 3NVKA 2YNIA 2JR5A 4ECTA 4E98A 1NUEA 3DU5A 3FMBA 4CJWA 2KFZA 5HJYA 1D3WA 5J2GA 3LH2S 5AKGA 8ICSA 4EEKA 3L4IA 4B9QA 4CHYA 2R7UA 4YP3A 1FRMA 5LSOA 1MWMA 5C25B 3CJBA 3MMCB 4AFFA 5KFBA 2FDRA 2BDUA 4A8YA 3ULHA 4K41A 1WWHA 1PILA 4I28A 4F5PA 3MMCA 1P9YA 2W11A 2J8AA 4CGZA 3SUNA 1N60A 5A0LA 3TABA 4DV5K 1VBKA 1SQFA 3QGGA 2R2RA 7ICFA 1OSDA 5KG4A 4CJTA 5J2KA 3CT9A 4WYWA 3EX7B 3OTOK 3TA1A 3P1GA 1RQ0A 2AJ2A 4YDXA 4NLSA 1ELOA 2UZAA 2GTDA 1WKKA 4K4YA 1VQSA 2B9EA 3NXZA 2JNJA 3CMQA 1XS9D 3E3XA 3AO5A 3SDEA 2JEGA 2HQCA 1UVJA 1T3QA 4DZ6A 2JH3A 3GJTB 1DK3A 4Y2VA 3TJ9A 1W2IA 8ICYA 1HR0J 3DLBA 2P9KB 1GMVA 2XY7A 3MGVA 8ICUA 3PTWA 5ITHA 1WOSA 1WAFA 3CXCM 3DOLB 2P9KA 1YHQN 3MXJA 3UXOA 5F9NA 3DOLA 4O9MA 1M1HA 3NY0A 3RJEA 3A5LC 3OBWA 1IM6A 4RQ6A 3P49B 3G87A 3SLCA 3D45A 4LF7K 2YHBA 1URRA 4OI6A 8ICBA 3JXOA 1TV6A 5J1PA 4NRTA 2LPEA 1Z6RA 3SQ1A 2BYCA 3MAAB 4F04B 3OYBA 4DL5A 4OYMA 2OPRB 3J7ZO 5T14A 4JI4K 2QARB 2V51B 4KLTA 3NWRA 3O9UA 3MAAA 3CM5A 2OPRA 3BS5A 2QARA 4I0WA 3RB4A 2KFYA 1K73O 3GIRA 2YKQA 1XMBA 4ZVSB 1YI2S 4HUEA 4ES3A 3I55N 4CF5A 4PZNA 3CFRA 3B54A 1LW0A 4WTYA 3GU0A 2FBTA 4DV2K 4OZLA 3VHQA 1J5OB 2DNHA 2FXUA 4BRDA 4ED8A 4CHOA 1EO1A 3RSEB 1J5OA 2DITA 4NCGB 1ZQWA 2EKNA 4ZPCA 1FVSA 2DGQA 4EYIB 3RSEA 4DO9A 2O8CB 3JPOA 2ZOGA 2DNYA 2IPOB 2EDUA 4AP9A 4A2AA 4I6AA 1PJ6A 1MWQA 3ED5A 9ICMA 3ZZPA 1DGSA 9ICTA 4ACOA 3GPAA 1L6NA 3PNIA 4IFYB 5C2DA 2HSZA 3EICA 3GILA 2WVCA 2Y9UA 3IUCA 1D9DA 1FE0A 4LF4J 1EX4A 4AHTA 1UKUA 1NZAA 3CPWR 3DHXA 3L8BA 1ZD3A 3CD5A 3OHAA 2VGNA 4FOIA 2CA9A 2EFNA 2FBVA 3B0XA 3D4JA 3GE9A 5J0RA 3RJJA 2ROGA 4KO0B 4XPEA 2V2KA 2RQMA 4WP8A 4YOWA 2O8BB 3PFEA 5J2QB 4KO0A 1E3MA 1GFWB 5TKYA 2LEAA 2BCSA 2ZD1B 1P8GA 1S1VB 4YXJA 3BBCA 2UXBJ 4C8OA 4JI0K 2OCEA 2XY6A 3A13A 4KH6A 2MZTA 3I6PA 4B9UA 1VLOA 1KCFA 1S1VA 3AA4A 3RJFA 4I69A 3CD6S 1ZJNA 3CCTA 1M90O 2WVBA 4KGVB 1FI4A 4GVMA 4N56A 4KYZA 8ICTA 1JLCB 2QM1A 1Q3UA 3A8YA 1HKAA 2YMLA 5AZIB 1EX8A 4ED4A 3PYGA 1JLCA 4JHDB 4BGDA 4RQ7A 3NMUA 1RAFB 5AZIA 3P45B 1L7OA 3F73A 4JHDA 1S1TB 4IOAQ 4DV3F 3BUZB 2ZJ5A 7ICQA 1YJ7A 2IIHA 3I56S 1TUUA 1S1TA 2LLZA 4GFJA 2HHPA 4FJGA 2PBDA 3FE1A 3CC4S 1WI6A 3HTVA 2ROPA 5D0EA 1Q8BA 2OZSA 5HMZA 2VQFF 3LPYA 5ALWA 1GXUA 2BQUA 3HHEA 1TELA 5KT6A 4NRUA 3TX0A 2Z58B 2LCWA 1OMSA 4USMA 4YNQA 3F56A 1ZQMA 1UT5A 3H5XA 3CCVS 3GJRB 2QWPA 4RUAA 4IC9A 3PY8A 4DTXA 2Y0SF 4MIWA 1KAXA 1W9HA 1VQOS 3KK3B 1V85A 3D1HA 1ZQQA 3C6TB 5DB9A 1V9OA 2X6NA 3KK3A 2RHFA 4R64A 3C6TA 4FLVA 1CJTA 4ICLB 4P4MA 1JCGA 2RPIA 2VC0A 2YN4A 3PXGa 2E8MA 4ICLA 5AT1B 1VSDA 3HX0A 4RW6B 3M6GA 3CERA 4JI7K 5KFJA 3H2UB 1LCUA 3DRPA 4Y2UA 4W5NA 4LF7J 2NV3A 2UUWA 4JI5K 2DR6A 2RRDA 1Q78A 4BHQA 1NPRA 3RG6A 2ZWHA 3DYAB 4M5HA 4RQNA 4PG4A 2YVSA 5KOWA 1A0OB 2VFRA 3KLGB 1GXLA 4UUXA 3KG1A 3IRXB 4I2PB 3LA0A 3DYAA 4K0KF 3D1QA 1Z19A 3KLGA 1VQ4S 3T7ZA 2VJ4A 1B0VA 2GVDB 3PZPA 1LVHA 2IFXA 3D6FB 1JMSA 1QTMA 4MN4C 2GVDA 4J03A 3H25A 4DSLA 3WIVA 2OJ3A 4KHWA 2GWSA 2J6SA 3MBYA 1VC5A 3NE6A 3MDAA 5DDRC 2E20A 3ZSZA 3UKRB 2B9YA 2PSZA 3ZEUA 3BQ2A 5G5HA 2HGNA 1HQEB 4RL1A 2QTWA 2VFSA 4LF8J 1TL3B 4P2SA 4HDHA 2HOIA 4XDDA 4C3LA 1HQEA 2LBOA 4P4PA 2EFOA 1RXVA 1BVSA 2QWNA 1B3TA 1TL3A 3F2BA 3C16B 4PQUA 2BM1A 3TR8A 4FZMA 4MK8A 2PMZF 3LGHA 3VQ8A 4GRSA 3JS9A 1FTCA 4QOTA 2IMOA 1R31A 2CYYA 3OYHA 2GMLA 4CLPA 4C0BA 3J7Z5 4F67A 3KHYA 3H8SA 1A9NB 4OGEA 1RAJA 1CC8A 3OYEA 2Y0SD 4AQYJ 1XQIA 4E7IA 5JTIA 5DMRA 2WC9A 1NG9A 3IHQB 3OD2A 1NLVA 4HR2A 2YNGB 4CF2A 1QQ5A 2G8UA 1PAUB 1J9AA 1CG2A 1YJ9S 5HMYA 9ICVA 3ADAC 5D4OA 2YNGA 1HBOB 1Q9XA 4IZ9A 2XI3A 1BWVA 5F3XB 1T6CA 3FQKA 3R9KA 1HBOA 1NGHA 2QLJB 5F8IA 4KGMA 5K8NA 1XNRK 4G65A 3MEKA 1F9EB 1JLBB 2CPXA 1RGIA 2VODA 7ICOA 4CZCA 1R27B 1Q8LA 4MF8A 5ALHA 1VK3A 3G4SN 2Z1IA 3DDIA 1JLBA 4NYFA 4ZCIA 3NBPB 2DFFA 1FJGK 1TMJA 3MGHA 1H98A 3VAGA 1SWWA 1BOTO 4QYZK 4XEIA 3NBPA 4IKFA 5KFUA 4Q2MA 2NYVA 4Z37A 1GLAG 4NEYA 2DHSA 4Z6FA 4OYZA 3LDAA 1LW2B 4N76A 4PHAA 1PBUA 4U67Q 3QEVA 1KOOA 2DRDA 4DPUA 1DGJA 2JLEA 2BCQA 1Z05A 2CIMA 3EKUA 2FVQA 1KBUA 4LRCA 2O5DA 2Z1HA 1YG0A 3O1BA 1HPZB 4IO1A 4DFPA 2E6LA 4CBUA 4ZOHC 4MMOA 5J29A 1HPZA 1ZQGA 2I7PA 2KM8B 2H5EA 1RAGB 1U0SA 1IVZA 4WQ4A 8ICXA 3TSPA 3VQ7A 3PX0A 5BN9A 2ZH7A 2QIFA 3LYSA 9ICIA 3H45C 2B0CA 4U96A 5DGBA 4FWKA 9ICAA 3AXKA 4Y2KA 1RWNB 2RMLA 2EZZA 4WF9Q 1X0PA 4RPZA 1R0BG 1FFUA 2PMZD 2E1PA 3SCLE 3ZZUA 4E1NA 3N4MB 2BPGA 1KEJA 2FE9A 2CPHA 2W2NP 3FFKB 2L9DA 1WUAA 4JI7J 4FLTA 2VBXA 1FA0A 3ID8A 5SZTA 3UE5A 4DR3F 1KQGB 3EVMA 2ZGZA 3BB5A 2RNEA 4EK2A 1VC6A 3E2EA 4GW6A 1UT8A 2F44A 4WFYA 5FRMA 3F0NA 4CBWA 9ICSA 1WKJA 4TU8A 3NF7A 4FPIA 3UXNA 2VUGA 2CJ9A 1RT7A 4M3ZA 5CQGA 3LP0A 3SSQA 1FXRA 3SEIA 4DHYA 5EX5A 5AQVA 3CJRA 3VAKA 3X1LB 3K9KA 1U2CA 2CG8A 4PL1A 3KHRA 3N4WA 2YWKA 3B82A 3FSYA 5KQDA 3C15B 5AQSA 4JV0A 1X5SA 3KLIB 1IJFB 4DN0A 1LB2B 2QXLA 4GXKA 4IQXA 4O3SA 3I9ZA 4LVOP 2WHOA 3C15A 3KLIA 2FF3B 5MAOA 1SIJA 1P6TA 2L41A 3MMVA 3AB2B 5HL7L 2ZJPL 4LRFA 1WBBA 1S6PB 1WNSA 4EBDA 5M2UA 3HKZC 1XK8A 5A8KB 1VK8A 5E0OA 5KFVA 4DCCA 2ZH8A 4BRKA 5A8KA 3JPPA 2ASMA 1I39A 2XHCA 4CJKA 1S0OA 3AARA 2NR0A 2CJYB 3MMAB 4DV5F 4KH5A 5J2AA 1TVRB 4LF9J 1SJ3P 3VOVA 1REGX 3VA0A 4ZVTB 1VQ8N 4DOBA 2K7JA 3OTOF 1NSPA 3MMAA 3CCMN 1HUXA 5ETRA 2Q66A 4X62K 4CJUA 2XO7A 2Y0BB 3LDOA 1GLBG 3M8WA 2OEJA 4DR6J 2NPFA 2NZCA 2JSXA 4PGXA 3H5UA 4ZLJA 3EE8A 1ZD4A 4ED2A 2VGMA 5C12A 2W2PP 1N36K 3WK5A 5I3PA 4H03B 2DF4B 3ZDBA 2BCVA 4U7UD 3BR9A 1RQNA 5K20B 4ZH4A 5AJ3F 1HKCA 1S0VA 2AX0A 1BDGA 3VERA 3GIMA 5CZ2A 3ZSXA 5AKHA 1S6OA 3UCUP 1SGGA 2X1FA 1FO1A 3N7RC 2BJ8A 3ZD8A 2BH1A 1Y7PA 4QYRA 1HI0P 2ZZNA 1HJOA 1CXQA 4BR2A 4TY8B 4CO3A 3VESA 1RCOB 1HA1A 4LH5A 2W54A 4JK1A 5JVHQ 2ALZA 4QYZJ 3C5FA 2YX8A 5IOLA 4OMFG 3T19A 2DKZA 1N6QB 1U7LA 1N52B 1TGOA 1O03A 3DDKA 1NK7A 3U1NA 5D0GA 4EIAA 2HRUA 1N6QA 1WG5A 4CGDA 1S57A 4WPAA 1AZSB 2H4YB 1XMQF 2EEYA 4C8NA 2B7CB 2VQEF 2RT3A 4P7TA 4JKHA 1AZSA 5IWAK 4KLDA 1QQCA 5F2RA 4CHNA 4UAVA 1GLDG 2IJNA 4FZVA 1WC5A 3BSNA 1NMNA 4L73A 3LWLA 1CI4A 3G0ZA 1YJNN 2EVZA 1RFQA 1TL7B 2ZF5O 3T6JA 2YQ1A 1RWXB 1YK9A 1NNDA 5AK6A 4V1Ak 4BVPA 4WFAQ 4JV5K 1RBTA 1TL7A 4BJQA 3SMVA 4HI1A 1HQUB 2WF7A 4FO0A 1N5XA 5KTQA 3NS6A 1N8RO 1R89A 2Y9HA 1H73A 4WFBQ 1YRXA 4TNOA 5B0AA 2HFSA 4JWMA 2EK6A 1SC1B 1RHQB 2EFQA 5J0QA 2E6MA 2YMQA 5EWEA 5CZVA 3EGNA 2NXEA 2DGZA 2R7TA 4AYBF 1AUSL 1F9FA 2W2QP 4NY8A 3SBTA 3IAS9 4ZN1A 5LJ3Y 5BR8F 1Y11A 3NVVA 3TANA 3A2FA 4CWBA 5L46A 1RTDB 3IR7B 2NXNA 2FHOB 2YI1A 3D2NA 1NZPA 2IJRA 4F5OA 4RPYA 1UVMA 2PYLA 5JLHA 3ZT1A 2XG8A 3BGOP 4LFAK 2QGFB 3PW7A 4QIWD 4MEYA 4QZBA 3CJ4A 4QZVB 3PW5A 4ELVA 4MKBA 3RAMA 2QFJA 1YF5L 3PRDA 4JI0F 4ZLPA 3BSCA 1Q82T 3AA3A 5KAKA 1BISA 3H90A 4CH1A 2UVRA 3QJJA 1WWVA 4PZVA 1URNA 2GWKA 2G06A 5CZXA 3BPDA 3WU2U 1CLFA 2W3RA 1GK8A 3CMAS 1UW4A 2OPSB 3TYTA 1Z1VA 1NJZA 1NMDA 3VQQA 4Z6DA 4C8MA 3SCIE 3VAMA 2HBKA 3MM8B 7FD1A 3OVSA 2FZCB 2DRAA 3PLAA 3A0BU 1ZQFA 2V67A 4UZBA 2K4IA 2Z57B 3MM8A 4HCBA 4C2MA 1RAAB 5DBAA 2HK3A 2GX9A 2HBLA 2BOPA 2JFDA 5ADXH 3UCGA 2WBRA 1YAGA 4AM6A 4BREA 4OYOA 1FFGB 2P9SB 4MDAA 4DTUA 1JLAB 2RRAA 5DDPC 2DBYA 3C23A 1RILA 3CCJN 9ICRA 3D68A 2JH1A 4HHJA 1JLAA 1UETA 4ID1A 5C2GA 2NYHA 1XR7A 2HNYB 4Y1DA 1LOUA 2W04A 4IOAL 1QQMA 1HI1A 4X62J 2DO0A 3WIUA 2HNYA 1C0GA 2A1JA 1LWCA 4Y2PA 3AN1A 7ICHA 4PWWA 3CJQA 4W5TA 2XMAA 2MTLA 2YHYA 3AL0B 2B0GA 3GYGA 5EHHA 2HWHA 2MYFA 3DLJA 5B0FA 3BQ7A 2OD6A 3L6QA 2KXFA 5KFSA 1FJEB 2AKWB 2RDDA 1HFEL 1YXQA 3ENBA 4ISEA 1FJ7A 4BRQA 4KLQA 4DR4K 4FS2A 1EWQA 4X64J 3HT3A 5KRSA 5AFUH 1DT9A 2R7SA 3R5CA 2MQMA 3WHIA 1UAWA 1L8OA 4K5SA 2I0XA 2X74A 3EZWA 2DR9A 2N3LA 3VGMA 5D0RA 1YUWA 5J2IA 3MGJA 1QSSA 2HNDB 3CDEA 3KLFB 3VEOA 2LMIA 2YHWA 2OSRA 5EWGA 2CPYA 2HNDA 3KLFA 4ED7A 5DQHA 3IP4B 4ZTFA 3S7RA 1N2XA 3NKYA 3DOMB 2GC8A 4R0JA 4IS7A 2VV5A 2JGUA 1EARA 3D2EB 4ZMMA 3SBGA 1SJFA 3F9MA 3UPQA 3DOMA 3RYLA 4KI4A 1S6UA 3T1HK 4K4GA 1IKXA 3GWCA 1HYVA 3D2EA 4ATNA 3R7SB 3AHPA 4PABA 4A5BA 3A12A 4R25A 1RT5B 5BXIA 3K57A 2E9RX 2V9WA 2ATCB 1TK8A 4ZVGA 3EKSA 3CQXA 1N32K 3THXA 1RT5A 3I82A 3ZX2A 3THWB 1X1PA 4JV5J 2VB6A 2HIQA 5ALOA 3MM5B 3BQ1A 5JS1A 2CXEA 3THWA 3J7YI 3WX4A 3BYPA 1H3DA 5H9EJ 2MZRA 1EQMA 3MM5A 1ZQUA 5J0UA 4YR3A 3JYTA 3HJFA 3CCWA 3TZWA 4A62A 2IIRA 4OLAA 1VQMN 4BRNA 2CJQA 4JI6J 1RYUA 5HAOA 2GMHA 2LYHA 1R6VA 1LWXA 4R5PB 4ITSA 2W7AA 3TAGA 2J5AA 5CE3A 4CO0A 1YJTA 2VG6B 2PFOA 3HJVA 3MMJA 4X66K 3GOIA 4R5PA 2IC3B 1QAYA 4CJPA 3IM9A 2DH9A 1XR6A 3PR5B 1Q5VA 2VG6A 4Y00A 1T3OA 4FWRA 4FCYA 2NQPA 2W01A 4I9QA 3AD8C 1WNEA 3GV5B 5BR9A 2WTUA 3BQ0A 8ICNA 1XSNA 1DARA 3ZI4A 2QXFA 4IOBA 2YMPA 3ENHA 1T4GA 2ZWPA 4HHUA 2A19A 3L3CA 3I1YA 4XRHA 3DU6A 3AXMA 3QFUA 4F93B 5KL1B 4A8EA 2CZVC 3QUTA 4CZJA 1XNRF 4I1TA 8ICFA 3NRWA 3QMLA 4OKJA 4BWMA 5BPNA 1KKXA 3SI6A 1T6DA 3HP6A 1RNHA 2HFUA 4H8KA 1IBKK 2WB4A 2AYBA 1BA1A 3CDUA 1BPBA 4F4XA 2QA4S 4A5AA 2F4VJ 3F44A 5SWMA 4DTPA 2EQYA 2K60A 2QYGA 9ICQA 1MA9B 2WF6A 4BRLA 1RLDA 1LWEB 4LFBK 2M52A 2IY5B 1Q7YT 2FBXA 4BGAA 2HBRB 2FDNA 1F5CA 1LWEA 3NS1A 3T5LA 2C3MA 1U0HA 2OPPB 2CH6A 1F60B 1KD1T 1IBMF 1MWKA 3KD3A 2K1RB 4ZK7M 2KKVA 4U95A 2RHSB 9ICUA 4C7QA 2EWSA 2WMMA 4H5NA 1KR4A 4IQWA 4CJEA 5JMVA 2WOMB 3WEEB 4AL7A 2AEJA 1SQEA 3DFEA 3RMCA 3FEXB 2YKOA 4RQ4A 1LKZA 3DRYA 2GIFA 7AT1B 2WOMA 1Z2LA 4HUGA 3TVYA 4P0QA 4ZOSA 1L7MA 4DTJA 2OKQA 2U1AA 4DPWA 3U3GA 2XY8A 4OZ2A 3AJ2A 3OYLA 2I6WA 4LF1A 3OXGA 4M5JA 1GOAA 5AQLA 4GIBA 4CJ5A 3FZKA 2NZTA 4K4WA 2WF5A 4RNOA 1Q7LB 4NMLA 2FJBB 3B8AX 4HCCA 5J8YA 2AEMA 2BE2B 2GAHC 3D0IE 4BLGA 1ZZFA 4F3MA 1F5AA 2E5LF 4BBYA 1XO1A 1HNZK 4F9OA 3NGRA 5HJXA 5HQLA 4QR1A 1H2TZ 1RT6A 5IC4B 4LRDA 2EX3A 4IOXA 3S41A 4RPFA 4CNQA 5IT4A 1Q8KA 3CCRS 1VK0A 3W5YA 4IRKA 3QAEA 3KG4A 5KG3A 3BBFA 3MCSA 3VQ9A 4I2AA 2AGPA 5EX3A 2EFVA 2E8AA 2F96A 3EXYA 2HHVA 2BKPA 3KK2B 2YHXA 4NZ7A 3PSPA 3MUTP 4DS5A 2HDOA 3TA2A 5CYMB 3KK2A 1FNOA 8ICKA 3JTNA 2ZZMA 1JRPA 1TK0A 3CEDA 1UAXA 2P9PB 5CYMA 3P39A 3QYYA 3D7SB 4ZN3A 2P2CB 1NOMA 3FNNA 4NPOA 2P9PA 4ED6A 4MYUA 1NDCA 3CCLN 3MCNA 3U27A 1WORA 3AVGA 2QL7B 3DKDA 2HMIA 3AO2A 4CFAA 2KVIA 1KAZA 1WAJA 4X4TA 2UXDJ 2RJZA 3DLHA 4JOUA 3EPIA 4OJ1A 2M8HA 2E29A 3LPEA 3IRUA 3AVAA 2CJBA 3FBCA 4YG2A 4Q8EA 1MROB 4C97A 2D69A 1X9JA 1C0FA 4Y28C 2VICA 4I2GA 1XN9A 4J2DA 5K14B 5AE2A 3KJNB 4NM2A 4WJ3B 4RWTA 2H3ZA 4EAHD 2KH9A 4TLRA 2VG7B 5K14A 4F0KA 1B22A 3QNMA 3LL3A 3R8EA 4J9LA 2R8KA 2VG7A 4CI0B 3KJVB 4PHTX 2W8LA 3QICA 1JN3A 4NM1A 3KJVA 4M5IA 4F2SA 1SIZA 4ECQA 1JLFB 4PL7A 2ZIWB 1VQ6S 3IR5B 3F2DA 3G71N 2F9JA 1D8ZA 4IEEA 1R8CA 3IGVA 1JLFA 3J81O 4UW2A 1IBKJ 4CLWA 3OTCA 3QRPA 4BVOA 3A5OC 1IWAA 2RAQA 3CD7A 1AB8A 2ZM6J 2MB0B 2O8FB 2Q1LA 2GV1A 5DKWA 5J2MB 2D1CA 3LPUA 2VCPA 2O8FA 2R4FA 3PIPQ 1VI7A 1RT2A 5J2MA 1LXNA 2ASPA 4Z94A 3MR2A 2QJ3A 2IDLA 1D1UA 3G25A 4DR2J 3A3NB 3GLJA 4OJ3A 3OXFA 1QAIA 4Y6IA 2MKJA 2M70A 2F76X 5M1QA 1D09B 4FSVA 3SK3A 3UW1A 3H0LB 3DLKB 4KLIA 5IQQA 4E1JA 5LL6Z 4NLNA 5H1SV 3HHKA 3RB3A 3KK1B 3P31A 2J6TA 5ALNA 4OX9F 3FLCO 3M9NB 1ZQKA 3JTPA 1Y0HA 4FLXA 1FFSB 4M45A 3KK1A 3SPZA 3SNNA 1X0FA 2XTJP 3BEGB 2C2EA 2ZJRQ 4A59A 3IM1A 3HOSA 4DPXA 2Q31A 4FWLA 3LP2B 4FWOA 3N9UC 2B5JA 1RAHB 3BN7A 3U6FA 2R8HA 4WQ4C 2ZH6A 5J0SA 2QSFA 2KM8C 3K1ZA 1SV0C 3SD7A 2G8KA 4ISGA 2OTJN 3P38A 2YY3A 4ECWA 3S01A 3OPKA 3BN4A 5GAHI 1NGEA 1F21A 4HEA9 1B9DA 9ICJA 1WG4A 4FS1A 1C4AA 3C2MA 1CULB 1NGJA 1Y10A 3MD3A 1ZBFA 4EX6A 4ECRA 3CUNA 3ILOA 3B9JA 5AI8A 4DPYA 2J6UA 1E6VB 3A8EA 3HL8A 3TU5A 2UVUA 1GLLO 3I8DA 4ECZA 1JJ2M 2VJUA 1TFYA 5E79U 1E6VA 4ZCKA 2BCRA 2CQ2A 1NM1A 4ILJA 4KPCA 9ICFA 2FJXA 2HFNA 2V7YA 3ZTOA 1N34K 1EJ7L 3C14B 3IFEA 1UHUA 3M30A 1S0MA 4LFAF 3ISZA 2IAJB 5GAGU 2WAQF 3C14A 4NWBA 3D7EO 4BE1A 1VYAA 1SC6A 2BQ3A 2B8PA 2IAJA 3D3BJ 2G07A 1B64A 1HNXK 3RBXA 3UO0A 4NXMF 4RQ1A 1BUXA 4Z2XA 3HXMA 2E88A 4GV9A 3MOZA 4ZPBA 8ICWA 5DK5A 3CJAA 3HP9A 1DAXA 1RISA 4FXVA 2FPKA 2H5IB 3MUVP 1D0EA 1FDDA 4WIIA 3M05A 3FM9A 4EP5A 4YORA 2M0GB 1KNZA 2WK4A 1VQLS 4YHHK 2O8EA 2YWEA 2IA0A 3I9V9 8ICCA 2PE8A 2ZBIA 3LGNA 1NGFA 2KVQE 2VBZA 3QPIA 3P5JA 4CZEA 4UB1A 3GIJA 3DI6A 3G6EN 5EE3A 3OW2R 1RDWX 4Z4HA 2V4RA 1U47A 1VRUA 4PA1A 1GOCA 2V8GA 4CGJA 1HR0F 4A4JA 1JL1A 1X4AA 1LFPA 1ZQOA 4ZPWR 5KFOA 3J81Y 3ULEB 3SYZA 4A8FA 4P73A 4AH9A 3N7SC 4B17A 3UWTA 1UJ5A 2ZHOA 3EZ5A 2YB4A 4M5DB 5AI5A 4UT4A 3ULEA 1VLBA 5A0YB 2FJ6A 3OBIA 4MT1A 4M5DA 1S1UA 1HBNB 3PKYA 1FX4A 5A0YA 1YT3A 1M1KT 4XH5A 1T3VA 1HBNA 4JI3J 3OVBA 1C20A 2QA4G 4LZGA 5KG7A 2PMZC 2E1MC 4H5WA 2ASYA 3FCWA 5A8WB 1ASWA 2A10A 4IO9L 2Q4TA 3BZCA 1BU6O 2G0JA 5A8WA 4WFNQ 1RK8A 2PKEA 2H3VA 4DR4F 4FPBA 3R97A 2QLBB 2FLNA 2UV8G 5L1MA 4IOCQ 1SXLA 1NNLA 1FKOB 2JVRA 2DY9A 1I94K 2CJXB 5M1FA 5EN1A 3IGNA 3TVZA 1YVNA 1X5PA 4DUZK 2G09A 3I0SB 5DBCA 4OYXA 2FLPA 5LMUJ 2VA8A 5HSPA 4IQUA 4MYTA 3WNHA 3KJQB 4C8YA 2FQQB 4KV8B 4G9ZA 2WAQD 3BKUA 3QWPA 2YH0A 2FHJD 1OWXA 3I4HX 2NO5A 1MA7A 5H9FK 4H0OA 4KV8A 4PYAA 2KKPA 4NEZA 1ESVA 4CE9A 4BR0A 1OKJA 5B0BA 4IQMA 4DV1J 3T1HF 4X65K 1HLWA 2BEFA 3RBDA 1PYTA 1LKYB 5JICA 3AH6A 3S3MA 1WG1A 4YB1P 1SXDA 3VEVA 1XHXA 1YGYA 2MGZB