1UA0A

Aminofluorene dna adduct at the pre-insertion site of a dna polymerase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua0A01
2R8GA 3K5MA 3HYFA 3VQ7A 4FLXA 1BPBA 4J2AA 4GXJA 4QZGA 1G15A 5HNKA 2HVIA 4IDKA 3JPNA 1EX4A 3ZT0A 1FK9A 1JLBA 5J29A 2YKNA 3ZDBA 4R5PA 1ASWA 4EZ6A 4RT3A 4YD2A 5IINA 4YMNA 1RDDA 2P6UA 1ZETA 3OYIA 3G0ZA 4F5RA 2XGPA 5HP4A 1IM4A 1BL3A 5KFZA 3EW9A 4FJMA 4ED2A 4IQVA 4CJPA 9ICBA 3AUOA 8ICFA 3PW2A 5J2CA 2A1JB 4PHEA 4YQWA 4O0IA 1FKPA 3VQCA 1XS9D 2PFNA 3DLGA 4NY8A 5KFTA 5L1JA 3AVLA 4Q43A 3V9XA 4GC7A 4Y1DA 3DRSA 2VANA 2P1JA 1B43A 4FVMA 3MBYA 1QE1A 4LZDA 4K4HA 3FFIA 3DOLA 2G8KA 3C5GA 4F2SA 1K6YA 3NCIA 2IGIA 2O4GA 2XRIA 2BPGA 1A77A 4O9MA 4CF1A 5KFFA 3RJGA 5EU7A 2P5GA 3L3VA 4DSFA 4XRHA 1TV9A 1I3AA 3V6KA 1NJWA 4YCXA 1X9MA 3AO2A 1LB2B 1FKOA 1NJZA 1S1WA 3SI6A 3BQ2A 7ICTA 3H40A 7ICHA 3ULDA 3IS9A 1S9FA 4ELVA 1KDHA 5FRMA 3LPUA 1C1CA 4RNMA 3TFSA 1C0TA 2EX3A 2RPIA 3THVA 4LH4A 4CF9A 4B9NA 1JXBA 4E1MA 5HLFA 1UAXA 5CY4A 1TAUA 9ICKA 3MR2A 4BACA 1VSIA 4QZEA 4FLWA 2YNFA 4HUFA 4ECVA 3AVHA 4KLDA 2OPRA 7ICOA 4IFVA 4P2HA 3DLKA 4PHAA 5DMRA 3RJHA 1DOQA 1QSSA 4TURA 4IQTA 2IHNA 1S9EA 4UB5A 4O5EA 4I2FA 8ICSA 1TGOA 3M8QA 2XCPA 3HW8A 4DSIA 3GQCA 2BE2A 4CJFA 4I2CA 4ZH4A 1NOZA 4QWAA 5T7BA 3C21A 1C7YA 2F1JA 1T05A 2BCVA 4EBCA 2HVHA 3M9MB 4Q0BA 4ECQA 3H8SA 4DF4A 2HHUA 4GVMA 2IBKA 1S9GA 1ZQXA 2HHWA 3RMBA 2BCRA 1XI1A 2R8KA 4I9LA 2XGQA 1TK0A 2ZJ5A 3AA2A 1JXEA 3UXOA 4OLBA 3OHAA 5F9NA 4CGFA 1LWFA 3MABA 2A1RA 4QW8A 3C1YA 1WSGA 4B8CA 5D3GA 7ICRA 3OSPA 3MAQA 4P4OA 2Y1JA 1U48A 4FYDA 4KLEA 5DLGA 4M45A 3EPGA 3GV7B 4H4OA 4Z4IA 2HNDA 1RDBA 3QEXA 3NGIA 4BE1A 1XC9A 5DG7A 4IFYA 1L5UA 3AO3A 4IQWA 4QWBA 1TV6A 2Z1GA 3HPHA 3L3UA 1C1AA 5DB7A 2VWJA 2KZZA 4M9LA 3OS0A 5TZVA 9ICHA 2UVRA 1IH7A 9ICXA 4I29A 1ZQZA 3Q8MA 4CEAA 4EP4A 1ZJMA 2A1SA 4KLSA 3G6YA 4M47A 3KD1E 4RQ5A 4XQ8A 5KRSA 4FJGA 4DTMA 4HYKA 3NHGA 3RWUA 8ICUA 3B6OA 4MFBA 3M8RA 1SKWA 4KLLA 3ZT2A 4CJ5A 4KHYA 4EP5A 3F9KA 4UB1A 3V1OA 1BIUA 1TK5A 4FLVA 2KZMA 4EBEA 3QEAZ 1HUOA 4F91B 5J2KA 7ICJA 1ZQGA 5DG9A 4BXOB 4FS2A 1WSEA 1D8YA 5I3UA 1KVAA 4JUZA 4KITB 1B9FA 4FZYA 1WCLA 4NXZA 4O3PA 2KN7A 3AVIA 4M9GA 3JPOA 4F4XA 2WTFA 4N5SA 1TVAA 5KG6A 3OYAA 4KPYA 2PFOA 2VWKA 4Q8FA 2Z1IA 1ZQEA 3NF9A 1NOMA 4J2BA 5EWFA 2ZTEA 2D5RA 4CF2A 1J9AA 1VRUA 1RTJA 2PFQA 1CZ9A 3MR6A 4J9RA 5DKWA 2IAJA 4B08A 4JRPA 4C8MA 1LW0A 4RQ7A 3MEEA 4RQ8A 8ICGA 1IXRA 5DGBA 4KN4A 2XO7A 3OYLA 3MFIA 1WSHA 3RMDA 3L2UA 3TFRA 1S1VA 4FJHA 3PNCA 4DS4A 3ZSYA 8ICHA 1Z3EB 3C6TA 3PY8A 4W5TA 3AVFA 3KHLA 4CCHA 4ZTJA 4ZHRA 2ZE2A 5DQHA 1JLFA 3O3HA 4R8UB 4BGDA 3PUFA 4K4IA 1RYSA 5CP2A 1TKTA 4NCBA 3MXMA 1VSMA 3ISCA 1BPZA 4R64A 4ZTFA 4FK2A 1WSJA 2ITGA 3LZIA 1ZBUA 4B9SA 4QW9A 4CJ3A 2QKBA 4JWNA 1O1WA 4J9SA 3RH4A 1ZQNA 1RDAA 4KN7A 2GUIA 2PYLA 5J2PA 1Y88A 4DU4A 4B9UA 4ECZA 4FM1A 4AHVA 3LP1A 4JK1A 4O5CA 3KK3A 4CJWA 2OPSA 5CA7A 5HHIA 9ICVA 4CJUA 2MUTB 9ICEA 1DGSA 3NE6A 3HO1A 3VQEA 4QZIA 4Z4CA 3ZD9A 4I27A 5J0XA 3AVJA 5J2QA 1R0AA 4DL5A 4ED1A 3DYAA 1SL2A 4YXJA 3M9OB 1W0HA 1YT3A 9ICJA 3OYKA 3O3GA 3UQ0A 5KFGA 4XUSA 3L2QA 3DI6A 3B0XA 2FBYA 3OSNA 1KCFA 1X9WA 4RW9A 4DFPA 4E7HA 4KTWA 3H8WA 1CLQA 4DSKA 5HP1A 4MEYA 3NH0A 2FMPA 3OYNA 3SZ2A 5KG0A 3ZDCA 5J0TA 9ICSA 4KAZA 9ICUA 4RZRA 4M41A 1TVRA 2HNZA 8ICRA 3K5LA 1VSLA 1KLMA 2RKIA 4RPYA 1JLCA 4Z4HA 2IS3A 2KFZA 1VSDA 4FZXC 2I5JA 2FPKA 4KLOA 3MECA 5J0PA 3K57A 2GBZA 3QEVA 3M8PA 1RBTA 3IAYA 3AA4A 1VSKA 4RQ0A 4IRCA 1ZQHA 2AU0A 3ZDEA 4CFBA 4FW1A 4KHNA 1EP4A 3O3FA 3AVMA 9ICFA 1N6QA 3ASMA 4PGXA 5JS1A 4F5PA 1V9PA 1WCNA 4CK1A 8ICTA 4CESA 4CHOA 3VQBA 4W5RA 5KG2A 4KKOA 2JEJA 3AVGA 4CIFA 4E7JA 5J0SA 5JUMA 1RXWA 1L3UA 4KLFA 3RBEA 3PX0A 1T3NA 2ASJA 1C0MA 3C94A 3ZSZA 5KFLA 2ZTDA 4QAGA 4CJQA 4YVZA 2BQRA 2VA3A 1LW2A 4R65A 2G8FA 3S3MA 2BPFA 1NJYA 3LZJA 3SNNA 3QO9A 4FJ8A 3AU6A 4JRQA 5HMLA 5DLFA 1VSEA 2V4RA 2FBTA 8ICOA 3HWTA 1H38A 9ICOA 4NM2A 2Q3SA 3MFHA 4GW6A 3HVRA 4DSJA 4RNOA 2BPCA 4F50A 4ED7A 1BCMA 4JV2A 3GDXA 4E7KA 4PHPA 1RBUA 4PWDA 4DMNA 4FJ7A 3JPQA 4DFMA 4RW8A 4O3SA 4ICLA 5KT5A 1X2IA 4C8KA 4KRFA 3SCXA 4M3WA 3WNGA 2LYHA 2BDPA 3HXMA 2DFHA 3HP9A 3M9NB 4QZ8A 4LY7A 4TUQA 5EWGA 5KFMA 2M9NA 1BHLA 4GLXA 3H7IA 3AA3A 4GC6A 4FK0A 5KT6A 1HJPA 3OJSA 3BJYA 1T7PA 4QZAA 4N56A 4ID1A 2G8IA 4CEBA 1YTUA 4ELTA 1HRHA 5D46A 2FMSA 3UXPA 1YTAA 5DBAA 2PYJA 5J1EA 3IM1A 1S1UA 1J53A 4X5VA 2R8JA 3AV9A 3PMLA 4ECUA 9ICIA 4KHSA 2BANA 5KFEA 2FLLA 3PW7A 1ZQQA 3V6HA 4NLKA 5IIOA 1CXUA 9ICMA 1BPEA 4NLZA 4IR9A 5DBCA 3TAMA 1NK8A 4O4GA 2NRTA 4LSNA 4G3IA 3AVKA 4F3TA 1TL1A 3NF8A 1U47A 4CJRA 3RB4A 4RU9A 2Z1HA 3DLRA 5KFXA 5SWMA 3NF7A 4KLTA 1KTQA 2AGOA 3U3GA 3QERA 4QZCA 4ED8A 2W9CA 3G10A 3TAGA 2F96A 1T03A 3NBPA 4YFKA 3HK2A 5CR0A 3MDAA 1ZQSA 1CEZA 4RPXA 4FW2A 4O5KA 2DTUA 1JIHA 4I28A 3ZDAA 1QTMA 5KG7A 4HUGA 1DTTA 1JMSA 4RQ6A 4FJIA 1EKEA 4KMUA 8ICYA 9ICLA 1D9DA 1BCOA 1RT5A 5DBBA 2BGGA 3AVBA 3G6XA 2PY5A 1SKRA 7ICEA 3SV4A 4BDZA 2Z1JA 3CG7A 5JS2A 2DFLA 3LWMA 4M2YA 4CF0A 2WOMA 1X9SA 1HUZA 4RQ3A 4YR0A 4FJ5A 1Z00B 3RRGA 3OYDA 1JX4A 1S97A 3N97B 4O3OA 4KLGA 3BQ1A 4UB4A 4E89A 3TR8A 3AA5X 3V1RA 3S3OA 3PW5A 3QE9Y 1SV5A 3RRHA 2XY6A 3MR5A 4E7IA 2RF2A 2C2DA 2X74A 2JEGA 2Q0ZX 3S3NA 3QNOA 3WNFA 2BR0A 3L8BA 3LWLA 1UOCA 4I2GA 4QCLA 2FLNA 4ELUA 3HM9A 4CFAA 1AROP 3CM5A 4DU3A 3TANA 4N47A 3ZD8A 2NRVA 2HHQA 4UAYA 4YNQA 4HCCA 1NK0A 2KFNA 1ZQTA 4CIEA 7ICFA 3QEWA 4JWMA 5CJ7A 4M0AA 4BE0A 2ZD1A 2G8HA 2R8IA 5KFSA 4NYFA 4CHQA 1S1TA 1LAVA 3RTVA 2IOCA 4CEFA 1KLNA 8ICVA 4Z4FA 4OVLA 4Z0UA 2FPMA 3E01A 1GOBA 9ICCA 3V9UA 1Z25A 3NH1A 2IDOA 1L3VA 2FBXA 3Q8LA 4QWDA 3OY9A 5E41A 3HJFA 3K4GA 4ED0A 1DLOA 3QZ7A 2GV9A 5HRPA 3G6VA 3BQTA 3V4IA 1S0OA 4IR1A 3H08A 3DM2A 5IIJA 3HL8A 5KG4A 2R7YA 1MC8A 4KO0A 5DDYA 5CHGA 4JV1A 5J2NA 3TABA 5KG3A 3Q8KA 4FJXA 3KTQA 2H5XA 3ORYA 4IG0A 2YNIA 5BOMA 3AVAA 4KB0A 3ZSOA 3ZT1A 3EZ5A 4M04A 4B9VA 3RR7A 2G8UA 5J2FA 4UB3A 4E19A 4CGGA 3JPTA 5KT4A 4RQ4A 4LZGA 1RT3A 2BHNA 3ZSXA 2ZQBA 2G8VA 4TUPA 4CEDA 1S10A 3VA0A 3EPIA 3MDCA 4J9KA 2KW4A 2E4LA 1ZQBA 4F4ZA 4J9PA 4DWIA 4I2HA 9ICWA 4PGQA 3MR3A 3EYZA 4ED6A 1VSHA 3PO5A 4FM2A 2J6SA 1RNHA 3LPTA 3H4BA 1CZBA 2VG7A 4Z4GA 4AHCA 5KG1A 3L2WA 3HPOA 2RDIA 4KLJA 5J2AA 1Q8IA 1XHZA 1N5YA 1ZQWA 3GIJA 2BGWA 4O0JA 3K5OA 4DL2A 3PW4A 4DOBA 4KI4A 4RUCA 4I7FA 3V9SA 4CGIA 1RT6A 4ID5A 3NAEA 2QK9A 1TAQA 1IKWA 1VK0A 1TKXA 1ZBLA 4DQIA 5CYMA 4DF8A 3K59A 9ICAA 8ICNA 4MF2A 5DB9A 3PX6A 3DLHA 1S6PA 4LH5A 4LD0A 1RT4A 3RB6A 4KI6A 3ZSVA 4E3SA 4Z6EA 3SUPA 1U9LA 4P4PA 4FCYA 3ZCMA 3C23A 4O5BA 3LANA 1TFRA 1RT7A 5DK5A 1ASVA 1VRTA 4OKKA 3KHRA 4CHYA 1IG9A 2FC0A 5DG8A 5KFPA 4IRKA 1BISA 3DLBA 4KB1A 3KKRA 2AGQA 1T4GA 1QQCA 4KHWA 8ICPA 3TWHA 1RCHA 3T5KA 4H8KA 1ZQPA 2JZBA 3AVCA 4DG1A 4FO6A 4TQRA 2F1IA 5KG5A 3VA3A 3PMNA 1ZQKA 4RW6A 3QEBZ 3JYTA 1NK9A 4KHQA 7ICLA 4R66A 4J9MA 3QIOA 3GIIA 1C0UA 4OPJA 4F4KA 5J0QA 2P66A 4ECWA 1HQEA 3RAXA 1KFDA 4N76A 1KSPA 4I2DA 3LK9A 2YNHA 5C24A 3ISBA 5D49A 3NGYA 4AHUA 5BOLA 3KLFA 4HHTA 3C5FA 1ZQYA 3K75D 3SQ4A 3MGIA 3CQ8A 3OHBA 1NK7A 1SL0A 4CFCA 4FLYA 3VQ9A 3AVNA 4BDPA 1EETA 4Q5VA 4PH5A 2ZUCA 3KLEA 3RJIA 3P5JA 1BIZA 2IMWP 5L1IA 1COOA 5IIIA 2XC9A 3B0YA 4K8XA 4AHRA 3ZSQA 3MEDA 3I0RA 1BVSA 4F4YA 4CECA 2PZSA 1NOYA 4M6WA 1WN7A 3I8DA 8ICKA 2KZ3A 8ICBA 4DSEA 5J2DA 1JXLA 2FBVA 1QHTA 3VQAA 3LALA 4DQQA 4EEYA 3SJJA 4RNNA 4Q44A 3V7JA 3Q8PB 3RMAA 5KFCA 5L1LA 3L2VA 1TK8A 4FLTA 3LP2A 2QXFA 3VN5A 2LSNA 4CK2A 4NLNA 3RBDA 5KFAA 4KLHA 3QLHA 4CE9A 3V1QA 9ICNA 1JL2A 4I2EA 3T19A 5KFWA 4I2PA 5DQIA 5KRTA 4DU1A 4IQUA 5HRRA 3U3YA 4DTJA 2XY5A 3QNNA 2VA8A 5J2GA 1TL3A 5KFDA 4OGEA 3ZSWA 3RJKA 4IG3A 1B22A 2BCUA 2HHVA 2BKEA 5C5JA 4NCGA 1BQNA 3DOKA 3GV8B 2FPLA 2V4QA 3CYMA 2HW3A 1XWLA 2PXIA 2IA6A 5FROA 4AHTA 2FMQA 2HMIA 3P83D 3V9WA 2C2EA 3GIKA 4TSXA 1U04A 4TQSA 3LDAA 3C2MA 2OZSA 1KFTA 4CGDA 3MGHA 4PA1A 4JV0A 1LWEA 5DQGA 2EHGA 1ZYQA 3ZSRA 2BCQA 2NRXA 4DL6A 4O44A 1ZQVA 4DTOA 3ALYA 1S6QA 2XY7A 4MF8A 3IRXA 4YMOA 9ICPA 4ECRA 1VSJA 2W9CB 3UQ2A 3IHQB 1IKVA 7ICSA 1BGXT 1UT8A 3OJUA 3LAKA 3ETLA 4OGCA 4CJKA 1LV5A 4I2IA 1RILA 1JLAA 2YKMA 3NFAA 5CYQA 5J2HA 4E0DA 4J9OA 3T5LA 4PY5A 4KLIA 4GXKA 1RYRA 1KFSA 3CFRA 5KFNA 2XY8A 2FLPA 5DGAA 2HHXA 2GWSA 1W9HA 4R8UA 8ICMA 4DSLA 4C8NA 1T8EA 4OJRA 3ISDA 3WNHA 4CK3A 2OWOA 3V6JA 2P5OA 4ECXA 3QZ8A 3F73A 4RG8A 3PR5B 1B9DA 4DTRA 1Q9YA 1SZPA 1IKYA 2HNYA 1U49A 5KFQA 4DTNA 2W9BA 5CWRA 1S0VA 2QKKA 2IC3A 4M9JA 1A5VA 2YHAA 7ICIA 4M42A 3TAFA 4EYHB 3HSTB 5KI6A 2JGUA 5IIKA 1ZBIA 4FXDA 4BDYA 4QZHA 4M3ZA 4DTPA 3ITHA 1ITGA 3QETA 5L1KA 2UVWA 2X78A 2NUBA 9ICGA 3VQPA 3BDPA 2R8HA 1HNVA 4QWEA 4BE2A 2ZJAA 3GIMA 1L3TA 7ICQA 2UVUA 5KGWA 1ZQJA 3K58A 2W9AA 5KFIA 4CIGA 4FLUA 1HYSA 3NGDA 3SUQA 3KLIA 5J2BA 4O3RA 2E6LA 2RN2A 3IG1A 4DTXA 2BQ3A 1B92A 3GV5B 3SQ1A 4H4MA 5KFOA 2DFFA 1S1XA 4WE1A 1GOCA 3OVNA 2AQ4A 5J0YA 3KIOA 1WNSA 3TAQA 2WONA 5J2IA 4DQPA 3CM6A 2DY4A 1XSLA 4FJNA 3V7LA 4RUAA 4UAWA 1REVA 4GMJB 3HP6A 1WAJA 4FZZA 4MEXA 4QZ9A 3UXNA 4B9MA 2BCSA 2ATQA 8ICJA 3VQ6A 5I42A 3KD5E 2AGPA 1UA1A 1ZQCA 4CF8A 3JPRA 4M3RA 3K2PA 5CB1A 1K1QA 3SUNA 2B21A 4B9TA 3OS2A 5EWEA 1EXQA 5KFKA 4EYIB 5IILA 5IIMA 4FJ9A 3N4MB 1U45A 4DO9A 3ZT3A 4CJVA 2VG6A 4AHSA 1NJXA 4OKJA 4ECTA 2I9GA 3OYGA 1RXVA 8ICAA 4J2DA 1PZNA 3OS1A 5C25A 4M3UA 3RJEA 3ISNC 3S9HA 4J9QA 4TUSA 5HROA 4R63A 3C2KA 1N48A 1MQ2A 2P6RA 3KKSA 3RB0A 3VQQA 2XCAA 3V6DA 3SI8A 5KT7A 1U4BA 3QINA 3SPYA 5BPCA 3QIPA 4K8ZA 4AH9A 4JS4A 2B4JA 4CGJA 4Z6DA 5DB8A 1MU2A 4DLGA 4Z4EA 4IRDA 2ISOA 1F21A 4FLZA 4ECYA 4C8LA 1XHXA 3LP3A 4J9NA 4ECSA 4UBBA 2OYQA 1MSWD 3SV3A 4E1NA 1XO1A 1BPDA 5KT3A 3JPSA 3KHHA 2JLEA 3V9ZA 1S0MA 4QZFA 4B3OA 3OYJA 1HNIA 2C28A 1LWCA 3TQ1A 5CZ1A 8ICCA 1BPYA 1KVBA 2X6NA 4F5OA 1ZQFA 4DQSA 2VA2A 1JKHA 3D45A 4M9HA 4B8AB 1ZQMA 4CJLA 4N41A 1HQUA 3A2FA 3C95A 1QLNA 2DPIA 4F92B 2D0CA 1RPLA 4RPZA 1BI4A 4EBDA 3DRPA 3O4QA 2HHTA 2ZUBA 1CXQA 5J2JA 1S77D 4HCBA 3TARA 1RTHA 2KQ2A 1XSPA 4E7LA 3NDKA 3Q8QB 3RH5A 3VQ4A 3FDSA 4NCAA 4KV8A 1HMVA 5KTQA 3JSMA 4YFUA 1A5WA 3RB3A 4I2AA 1Z26A 7ICVA 5HBMA 4BWJA 2JZBB 4KREA 3RR8A 5J2MA 1XSNA 3NTUA 1SKSA 3I0SA 3EWAA 3D0PA 1RTDA 1YVUA 3C1ZA 2XHBA 4KTZA 2F8SA 4RW7A 4KTQA 4RW4A 2IHMA 1CUKA 2E6MA 3HVTA 2PFPA 2AJQA 3Q8RB 1BQMA 9ICRA 1Y97A 4F8RA 1WSIA 2JEIA 1RT1A 1ZQDA 3AO1A 4DEZA 1JN3A 3QEPA 4J2EA 4FJKA 4RQ1A 1RTIA 2NRZA 2ALZA 2A1JA 3KLHA 5J0WA 4M3YA 3Q8SB 3T3FA 3LP0A 4QZDA 4PGYA 3NF6A 2O4IA 1K1SA 4F3OA 2OZMA 7ICGA 4YR3A 4CJTA 4CFDA 3QESA 1QSYA 5L9XA 1C1BA 2F1HA 4UQGA 1NKCA 1RDCA 1KRPA 4OPKA 4MQ3A 1NK5A 4M6WB 4PHDA 1SL1A 4YN4A 5KFUA 3GILA 1UA0A 4CEEA 3B6PA 8ICLA 3DLEA 1HYZA 2YV0X 3CFPA 4KLUA 1QSLA 4Z6FA 4KLMA 1WLJA 4W5QA 4UAZA 1A5XA 4DOAA 1J54A 4CEZA 3OYHA 3BQ0A 2P51A 3PVXA 1ZJNA 3TI0A 2DFEA 5K14A 5FRNA 1ASUA 3KHGA 4CEOA 5KFJA 1RT2A 3WNEA 1FXXA 2HB5A 4CJEA 2OA8A 5KFRA 4NLGA 4FJJA 3TAEA 3UPQA 4DTUA 4F5QA 4OKEA 4DQRA 1QS4A 2BQUA 4KLQA 1TKZA 3O4NA 1KEJA 4I2QA 4RQ2A 2D0AA 2ASLA 4KHUA 2D0BA 1ZQOA 3LDSA 3OYEA 3SQ0A 3PW0A 9ICQA 4KFBA 4CEQA 3SQ2A 3E2EA 2ZUDA 1JL1A 4O3QA 3OYBA 1MQ3A 2VG5A 3OYMA 2J6TA 4XIUA 5KGXA 4MFFA 2B5JA 1UT5A 4O3NA 1S0NA 1Z00A 4JLHA 7ICPA 2OPPA 5DB6A 1Q9XA 1JLQA 3OYCA 3VQ5A 2UVVA 1VSFA 4PPXA 3KLGA 4DFKA 2C2RA 4QWCA 1NKBA 8ICQA 2ETJA 2JEFA 3AU2A 4PUOA 3RJJA 5SZTA 1D9FA 2DPJA 3T1AA 4F93B 3MXJA 4YG2A 5HRSA 1ZQLA 4F4WA 5HMMA 1ZBFA 7ICKA 3ZT4A 9ICTA 4CJ4A 3K5NA 1L3SA 4O55A 1S76D 2Y1IA 4FS1A 1LAWA 2X6SA 2YHBA 4CGHA 4I2BA 3HT3A 3RMCA 5D4BA 2KTQA 2W8LA 1WSFA 4Z6CA 3T5HA 2G8WA 3U6FA 2V9WA 1EXNA 3VQDA 1S5JA 2W42A 4M3TA 4CERA 4CHZA 4UB2A 3H4DA 3AO4A 5KFYA 4YP3A 4DL7A 1DTQA 5CZ2A 2W9BB 4G1QA 4HUEA 3HX0A 2C22A 3PV8A 1NKEA 4QZBA 1D8LA 4DL3A 2ATLA 2ASDA 4NYNA 3V81A 1IO2A 4FM0A 2J6UA 4K4GA 3HPGA 5KFHA 2OPQA 4CHNA 4YXMA 1TKDA 3NH2A 5J0UA 1NK4A 2ISPA 3EY1A 3AO5A 1WAFA 1I39A 4XA5A 3RAQA 5DDMA 3TAPA 4IBNA 1XU4A 5HHHA 5KFBA 3MEGA 4CHPA 1KVCA 3M8SA 1C6VA 1X1PA 5C42A 8ICEA 1RBRA 4B9LA 5KFVA 7ICNA 3VQ8A 3KK1A 2PI4A 5FDLA 3OYFA 3FYHA 4W5NA 1N56A 4PQUA 1NK6A 8ICXA 3T5JA 4YMMA 1UWBA 3ZDDA 4FK4A 1HJRA 3DRRA 4BXOA 2F8TA 1SUQA 4YR2A 1ZBHA 2ZJ8A 1BPXA 3NGZA 7ICMA 4DLEA 3PO4A 3SPZA 3V72A 4CJSA 3UIQA 2AQ0A 1RZTA 1JLEA 1HYVA 3JPPA 4J9LA 1RBSA 4Q8EA 1RBVA 5J2EA 3V7KA 4DL4A 4MFCA 5EOZA 1IKXA 4Q45A 1GOAA 4FJLA 1D5AA 4FBTA 8ICZA 1HPZA 5J0RA 2W9MA 4QOZB 4HTUA 4FBUA 1J5OA 3GFKB 4NM1A 4F2RA 3RJFA 1ZQRA 8ICIA 4M3XA 3LAMA 4UBCA 4LSLA 3C2LA 4BWMA 3KK2A 4M9NA 4DFJA 3BGRA 1ZQUA 3DMJA 2NRWA 3PR4A 5HRNA 4HVJA 1A76A 3C6UA 3KJVA 4RT2A 3L2RA 1JLGA 4OLAA 3SYZA 7ICUA 4LVSA 4MFAA 4C8OA 4L8RB 3QEIA 3RH6A 4GXIA 1ZQAA 2ZTCA 4DOCA 2MAXA 4I9QA 4IKFA 2RDJA 4P4MA 4ED3A 2W8KA 8ICWA 4JS5A 3P1GA 4AILC 3SUOA 4W5OA 5J0OA 4F5NA 3OGUA 5KT2A 1ZQIA 3PX4A 2YNGA 5F9LA 2HHSA 2PI5A 4EZ9A 2B6AA 3CFOA 3MXIA 4DTSA 4YD1A 4DS5A 1BI4B 2MUTA 4Y1CA 4I2JA 2I1QA 3H8JA
chains in the Genus database with same CATH superfamily
2HF4A 4A8KA 2RS8A 3HYFA 3J81j 1YJTA 3CCUN 2GLEA 1FXRA 4QZGA 2YXLA 2F3NA 4KRWA 2EBEA 5HBMB 4WZMA 2FUG9 1SJ4P 3MAAB 4IDKA 4DUYJ 3CD6S 3JPNA 5A0LA 1FK9A 5J2MB 5L39A 4TVAB 3F41A 5J29A 5EN1A 2ZD1B 2AEJA 1UAWA 2KM8B 5AKYA 4IQMA 4CF5A 3D2EA 1VQ8N 3K0JA 4RW7B 2GOLA 4LF6F 2DO4A 3AXMA 3HJVA 3FZ2A 3QGIA 2A41A 4NXMK 5HP4A 4KC5A 2AJ2A 4CTAB 2UUAF 5KFZA 3EW9A 2H65B 2J0WA 2AW0A 3BEGB 1GLCG 2WAQF 2P9IA 4USUA 2XZDB 1YRUA 1DLOB 2A1JB 4PHEA 4YQWA 2XI3A 4X66J 3VQCA 2R3VA 5JXSA 4NY8A 3FQKA 5A6WA 2YKPA 3MR7A 2AJ1A 2J8SA 3WK9A 3AVLA 4JEPA 3JS9A 1VQLS 4Q43A 4FPIA 4GC7A 5ALKA 1RCOB 3FE1A 4FF2A 1BD6A 3DRSA 2P1JA 1B43A 4B1WB 8RUCA 1OIAA 3FFIA 2JDJA 2G8KA 3CJ7A 2YX6A 2IGIA 2PIIA 4NA2A 2BPGA 4O9MA 5KFFA 4CZIA 3V2UC 2O66A 2DHXA 1HNWF 1PSDA 3L3VA 4DSFA 3ENQA 1I3AA 4DPXA 3AO2A 3ZZTA 1FKOA 4KHPJ 2BBEA 5A8KA 2OHFA 1WYGA 5D0HA 3BSAA 3SI6A 4CZKA 4TXSA 5B0EA 2JGAA 4RQMA 4JK9A 1I1GA 1KDHA 3WK4A 3CC4S 3LPUA 2MKHA 3B8AX 3CIMA 5K14B 2DTJA 3THVA 4X64J 3NVYA 4B9NA 1RT2B 4E1MA 1U02A 3CRXA 1Q1KA 4CLWA 3MR2A 1VSIA 4DPWA 2W3SA 4ECVA 2XTJP 1N5TA 2GHPA 3CJ2A 3CTRA 4P2HA 4PHAA 3WBZA 5LL6d 3MUVP 5DMRA 5CABA 1X4DA 4C0BA 5FP0A 4B6JA 4NZ7A 2G2YA 1QSSA 2E1FA 4I2QB 1JCGA 5AE2A 1ZRMA 4AQYF 3O1WA 1VLYA 3MCMA 4UB5A 4I2FA 2AV5A 3A3NB 3ZO7A 3SCIE 4DSIA 3GQCA 4CJFA 3JQJA 5T7BA 1BA0A 3IWLA 1RXOB 4FWNA 3QAUA 3FEYB 4GVMA 4DV6K 2O67A 2FJBB 4YS2A 3KLGB 3EKSA 4PKGA 3VVUA 4QOTA 2F4VJ 4I9LA 3QBCA 2MSSA 2QA4G 5HAOA 2ZJ5A 4PUOB 2KT2A 2I7PA 3N7RC 1JXEA 1V38A 3UXOA 2MZTA 1VBKA 4ATNA 2CG8A 1OJ4A 4CGFA 4R0JA 3CPWM 4C97A 5B0CA 3DLLL 2F9TA 1EQYA 3THXB 3FZBA 3JTNA 5D3GA 1YRXA 2EG1A 3MAQA 4QS8A 1IBLF 1BO5O 4FYDA 1KAYA 4GV3A 3MWTA 4TY9A 1KWMA 3GFXA 3HI0A 2YH1A 4F0KA 5GMKa 3H20A 3O9TA 2HFVA 5DG7A 2ZKUA 1T6DA 5IQQA 1Q95G 1L5UA 1TV6A 1EWQA 2WSFC 4DR4F 4BQZA 2MYFA 3BF4A 1BQXA 3CCES 4AL6A 2B4OA 4M1KA 2VC0A 4DPTA 3R3LA 3IKMA 4H0VB 1ZQZA 1NSAA 2O1PA 1UEVA 4ILLA 4R25A 5K9FA 4B1ZA 4OHVA 4ZCMA 3PYGA 3W60A 4RQ5A 3GFZA 5KRSA 3TZYA 1S12A 1ZC6A 2CQ0A 4DTMA 5I9EB 1RHQB 2V2ZA 1N88A 5HVGA 1SZ2A 5AQHA 3I87A 3B6OA 1AQ6A 3ILOA 5HQ8A 3G25A 1NO8A 1OMSA 2KJ9A 4Y2UA 4FLVA 5IWAJ 3QEAZ 5J2KA 1S22A 2IVFB 1VQ8S 1ZQGA 4DR6J 4NCGB 3JQMA 4BXOB 3DV9A 5ETVA 3OW2R 4MKAA 2UUAK 4WFBQ 4M9GA 4F4XA 5KNIA 5IV3A 3CF5L 2WTFA 4BC2A 4OLOA 2GUPA 3WXKA 3AT1B 5KG6A 1JLEB 2QG9B 4Z7YA 5DS7A 4YY3J 3LDOA 1JK9B 2ZOFA 3R3TA 3AM9A 2ZTEA 1VRUA 1HPZB 1UL3A 3TUIC 4M5MA 4AYBD 2PFQA 3EX7B 5DKWA 2IAJA 2H51B 1KKHA 4JRPA 2HBJA 2VJUA 3MEEA 2O8EB 2WHEA 4RQ8A 1S49A 2J7UA 3B82A 2XO7A 3MFIA 3RMDA 4UUXA 3KK2B 1JCFA 3EGNA 1V97A 3PNCA 8ICHA 1Z3EB 3C6TA 1HNZF 3CXCR 1NZAA 3KHLA 4ZHRA 3DLJA 2ZGZA 3SMSA 1JLFA 2HWTA 1ZAWA 2HBLA 4BGDA 1NHUA 5C15A 4NV0A 4K4IA 1SJRA 1RYSA 5BYSA 2C2KB 2HRYA 2FI1A 4NCBA 5HOOA 3MXMA 3GL1A 1F5BA 3CCSS 4C8YA 1D8BA 4ZTFA 4LJMA 3H3OB 1TZ0A 3QU2A 5IT9O 3HVWA 1RU2A 5CCLA 2ZH3A 2YNGB 2CQPA 1FX4A 1FJEB 4B3RJ 2UUBJ 2GUIA 5J2PA 3DXKB 2MZJA 4B9UA 2BOPA 2P9NA 3UMGA 3LP1A 4O5CA 3AFGA 2CQ1A 3T6BA 2VICA 5HHIA 9ICVA 4JI3J 3TADA 3M1VA 2E8OA 3MUTP 2FQQB 1Y00A 5AQJA 3U7JA 2VJVA 2DY9A 1WC3A 4WFZA 4Y2YA 5J2QA 2WRMA 4DL5A 1SL2A 2RHQB 4KAIA 1VQKN 1YJWS 4PABA 1N34J 2ILYA 1HNVB 1QVGR 4ZLPA 4ED4A 4U9RA 1KQFB 4K4UA 3F56A 2YKNB 5BRHA 1N36F 3UQ0A 3B0XA 2K2PA 3OSNA 2UP1A 1X9WA 1EARA 4RW9A 1R59O 4UZBA 2YHXA 4DV2J 2MPUA 3BYPA 3OYNA 2OSQA 4LRBA 1MWMA 5J0TA 4KAZA 4IOAQ 1RWOB 4WFAQ 1PJ5A 3BS9A 2HNZA 2AYMA 2IVMA 3SMZA 3GOIA 2B0CA 1NDPA 2LXFA 4LSZB 2KJWA 4WBFA 4F67A 1JLCA 3KZIU 1NGFA 3GE1A 1WF1A 4Z4HA 1S6OA 1NGAA 2DITA 3L09A 2C2OB 2IMOA 2IA0A 3H5UA 4ZVRB 3M8PA 3IAYA 5H9FK 4IRCA 4DR4K 4DU7A 2GJ2A 3ZDEA 4OJ3A 2ZHBA 1Q82O 2QB0B 1EP4A 4KT0C 3AVMA 9ICFA 3PIPQ 5D6GA 2DGTA 2M70A 3DFEA 2CNKB 2CWKA 2YPYA 3MCSA 4CESA 4CHOA 5BPNA 4QIVA 3QQCD 3V6DB 1C1CB 3LF0A 4E7JA 2DKOB 2DISA 1L3UA 1S7IA 4JOUA 1MU2B 1T3NA 2H3QA 2ASJA 3HHLB 3B9JA 2YNFB 4FOEA 2O8BA 1W97L 5KFLA 3H98A 3O5TB 2EBGA 3SBGA 5E33A 4I69A 1LW2A 3QFWA 3OD2A 2G8FA 2WF5A 2H5JB 3SNNA 3QO9A 2WFBA 3AU6A 3IFEA 2ZUAA 2K3KA 2V7ZA 5DLFA 1VSEA 4BRAA 2D3UA 3L4QA 4IO1A 1Q7LB 2FBTA 1APSA 2B4PA 3HWTA 2BE2B 2Q3SA 3VC8A 4FPRA 2BOAA 1BCMA 1HQUB 4ED7A 3J7Z5 3A3OB 2LQ9A 3NS7B 2HQ3A 2UU9K 2A0FB 1U1PA 4FFDA 4DJBA 3F53A 1RTHB 2GVDB 1NGEA 3OTOF 2GHVC 4PWDA 5E3RA 5AQPA 4CI0B 4FJ7A 4DFMA 2CG4A 4ICLA 1ITPA 5LT5A 5KT5A 3R5BA 5M2UA 4C8KA 1Q3VA 3M9NB 4C0OC 4I6AA 3WQUA 2A19A 4YOYA 3QWPA 5FLXY 2VFTA 5KFMA 4DXLA 1U1KA 3QRQA 1BHLA 4GLXA 2CPDA 4KIAA 3MF5A 2Y0SC 4ED5A 1H2TZ 1Z6RA 1ED1A 5IC6B 5KT6A 3OJSA 1HNZK 4RKUC 4DFDA 1WOSA 3DGVA 4CO1A 3D6FB 3QSIA 4DQ8A 3JB9k 2HOFA 2NZCA 2HNDB 5IFMA 2MLXA 1FDAA 4CEBA 1R6YA 3P96A 4ELTA 1YTUA 3OR1A 3I96A 2NO5A 2FMSA 3UXPA 3MM9B 4IFYB 5GAEI 1FD8A 1J53A 3ULHA 4K25A 3TU5A 4ECUA 2BANA 4MDAA 1CSJA 2HFUA 2IYGA 3BZKA 4BRKA 3POTA 3V6HA 4C4TA 4BX9C 1V4TA 4ZPDA 2O8DA 1NK8A 4MIWA 2NRTA 3QNMA 1RACB 3PTWA 4DR2J 3CPEA 1NU0A 4OFZA 3UVJB 4EK2A 2NQPA 4K4WA 4KLTA 2FGOA 2AGOA 3ENWA 3C8YA 4QZCA 4N77A 4OI2A 2PO4A 4YFKA 2VIXA 2ZH2A 1JJCB 4DV7K 2W03A 2OUGA 3NCRA 2FHJA 4NRTA 3LVWA 4QBUA 2OEHA 4HUGA 1DTTA 4KMUA 4LRDA 8ICYA 9ICLA 4UARA 1RT5A 3AVBA 3PACA 4Y0FA 3SV4A 1MNEA 4KFBB 2FSJA 1FWKA 2DFLA 3LWMA 2V94A 5GAGI 3PKYA 4C80A 1X9SA 1HUZA 2G13A 2LDIA 1Z00B 3RRGA 1WEYA 1S97A 3N97B 1VMBA 1E6YA 1LEOA 5BR9A 1CJVB 5AXMA 3UKUA 2P5VA 3L3CA 3ZYYX 3MR5A 5ETNA 3KUEA 2PA3A 2MQNA 3S3NA 3WNFA 2VU5A 3HSJA 4CDGA 3L8BA 2E5JA 1S1VB 4K50A 4ELUA 4CFAA 1VAZA 3FVYA 1HA1A 2M8DB 2NRVA 2HHQA 4UAYA 2ZE2B 2MY8A 2MY7A 1XMOK 3QBXA 1FHTA 3QEWA 1OYDA 4M0AA 2R8IA 4ICAA 5BYQA 2X3GA 3AODA 2B9WA 4PG7A 1YUWA 3IO1A 4DV4J 3RTVA 2HLTA 1KLNA 2E88A 4MN4C 5AZJA 4Z4FA 3AJDA 4Z0UA 4CW7B 2FPMA 3M6VA 4NI2B 4G1QB 1J5EJ 3E01A 2XSJB 4CBXA 1REGX 3EVOA 2OTLN 1TL7A 1Z25A 5M2RA 2W2PP 1XBWA 1SVDA 3Q22A 1L3VA 4I64A 2NYHA 3Q8LA 2E8NA 1R8PA 4KBIA 1G4CA 5ITHA 2DKZA 3MM5A 5HRPA 3R8YA 5M1QA 3DM2A 5KG4A 2GVZA 3ID6A 1T02A 1BC6A 4KO0A 2CNLB 4B3TF 4FJXA 3I9ZA 4YOXA 3GZ7A 1R0AB 5BOMA 3DYAB 3ZT1A 3AY0A 3EZ5A 4J90A 4B9VA 2Q0RA 4UB3A 3JPTA 4RQ4A 3TR5A 1RT3A 2BHNA 1P90A 1K47A 3I8BA 4JI1F 2M9KA 4DX8H 4TUPA 1K73O 3I9V9 3MDCA 2KW4A 5FDLB 4Q2LA 5F0XA 1ZQBA 3BR9A 2E2OA 2PAVA 2JWKA 4IEEA 5ALWA 4RNHA 5AT1B 2RP5A 4PGQA 5D0RA 2L5YA 2YQ3A 2V69A 5BPLA 4PJ0U 4WQ5C 2P9EA 4CI6A 3TEGA 2E5LF 2M88A 2JL9A 4MK9A 3H4BA 3CJRA 1F3VA 3PIPL 2VG7A 1NWKA 2J7WA 2ACMA 4M5DB 4OYXA 1U1LA 4MKVA 2QYGA 2RKIB 3DRYA 1N5YA 1ZQWA 3O3LA 4JI6J 2Z8QA 3K5OA 2H3ZA 1CJUB 1OUQA 1FJGF 4ZP8A 1M90O 1F5AA 4ZITA 1TAQA 3LO3A 1IKWA 4GO7X 4OZ5A 1ZBLA 2L41A 5CYMA 3QFPA 3Q86A 3K59A 2NO4A 3W7BA 4CLSA 2QA4S 4LRCA 4LH5A 4LD0A 1RT4A 2ITMA 3IRWP 4KI6A 1RAIB 3ZSVA 1DBDA 4WFYA 4B3MF 1XQSC 3ULEA 4PG5A 5J8YC 3OHRA 3HRDD 5DK5A 2FY8A 3THWA 5DG8A 3VTHA 4OJHA 3T1YF 2FY1A 2ESEA 5AI8A 3H0PA 3KJVB 2R2UA 4KHWA 1FRHA 8ICPA 3TWHA 2E5SA 1PYTA 3T5KA 2NLWA 4DR3J 3GU3A 4H8KA 1O8BA 3EGWB 5AK3A 1V3SA 1WUUA 5AQOA 5KG5A 1T9UA 1YBTA 2M52A 2A1BA 3PMNA 2ZC4A 1K0TA 2ODGA 3EL2A 1YZ7A 2FIUA 3WX4A 3M32A 5LJ3Y 2ZDPA 3K7RA 3GYNA 3QIOA 2W04A 2JJ4D 5J0QA 3C7NA 2P9UB 3EE8A 1HQEA 1KFDA 1L7PA 4LVOP 3MPUB 2RAQA 4N76A 1KSPA 4EFAC 2K4IA 1NLVA 3ISBA 3NGYA 4WXWA 3HZEA 2BEFA 4J91A 3HBTA 4F4AA 5JLFA 3SQ4A 1GLJO 2G08A 1RWUA 4CFCA 2OH2A 5GAHP 3VQ9A 3BBFA 2ZHAA 1V5IB 1BDGA 4JI2K 3VF0B 3RJIA 2P6SA 2FJXA 1COOA 3W5YA 5IIIA 4GKKF 4LF9F 1G99A 3B0YA 4BR9A 4AHRA 3NAIA 1U6BA 4M94A 3I0RA 3UE2A 2M7SA 2G06A 2AHOB 1U2RA 4CECA 5E0OA 1WN7A 3I8DA 2KZ3A 2VONA 8ICBA 4H4KA 2QMWA 3D2EB 1P7DA 4DSEA 4NXNF 4EAHD 1JXLA 2FBVA 1ATSA 1IBMF 4U8YA 1QHTA 3VQAA 3W63A 1RKIA 1OQ3A 4DQQA 4BREA 3SJJA 4M7XA 4YDDB 4Y2MA 3HD2A 5KFCA 4FLTA 2GX8A 3IG5A 4U7UK 2QXFA 4IJNA 3VN5A 4JV5F 1Q82T 4RWXA 4CK2A 3RBDA 5JU5A 1EQ0A 3V1QA 3PXGa 1JL2A 3M2RA 3UKRA 3R6GB 1G6BA 3U3YA 2XY5A 2QARA 2VA8A 5J1EB 1BWEA 1RG6A 1RP5A 1ZPVA 4OX9F 1B22A 2BCUA 1HW8A 1BQNA 2DGSA 2KXNB 3EUNA 5E26A 1LOTB 5AQXA 1FRXA 4LF4F 1XWLA 2IA6A 2WW8A 3KJFB 5FROA 4RBTA 4FF4A 2HMIA 3P83D 1CQMA 4FYYB 3CJCA 3GIKA 2H3FA 2RE1A 4OJGA 4LSNB 4CD3A 3AXKA 1XN9A 4PA1A 4V1Ak 1LWEA 2VDIA 5JRTA 5DQGA 1I3OB 5A8KB 2B9XA 4WKYA 3J80U 4B3TK 1V5VA 1S6QA 4BR0A 1WEZA 1R43A 1ROFA 3O44A 3O1LA 4JKHA 3HSCA 4WCEQ 4CM0A 3JXUA 3OJUA 3NBPB 1JLAA 4XAKA 1RDFA 4WKRA 2VFVA 4BGAA 4R0EA 4JI1K 3M2VA 4PY5A 2D3DA 3CDWA 2B6GA 1RYRA 2FLPA 2DH8A 4C7ZA 2HHXA 2IVPA 4A8MP 4R8UA 4B9QA 8ICMA 4DSLA 2HQCA 1T8EA 3WNHA 4K5RA 4ILGB 4PXCA 3V6JA 1OS5A 2QFIA 2BVZA 1GQEA 4RG8A 3AJ2A 3FCWA 2RU3A 4DTRA 2JNJA 1SZPA 3HD1A 1IV0A 2RIJA 1YTYA 4M9JA 2OI2A 3NMAA 1MN8A 1RWNB 7ICIA 2LP4A 5M1PA 1NB7A 5DZ7A 4IOXA 2EKNA 3W2WA 5KI6A 3SENA 3R5AA 2EFVA 4Y3CA 1RAEB 1YG0A 1NGHA 9ATCB 3ITHA 1OH6A 2H1YA 4CZCA 5L1KA 1X5TA 4WPAA 5D3GB 2WF6A 1XMBA 2NUBA 1NI3A 1NDLA 2QWMA 1S8OA 2V68A 3T1YK 1VQ9S 4FXWA 3OVSA 3NCQA 1Q3UA 5A2QO 3SUQA 4XH5A 4HKQA 3THYB 3N7SC 4OL8A 1X31C 5HMZA 4DTXA 4K4VA 2ROEA 2MTLA 5F3ZA 1SV4A 2JH3A 1Q8KA 1DK2A 3VWSA 1WC1A 4M5JA 1GOCA 3OVNA 2KVSA 2ATCB 3CPWR 2JWNA 4U7CA 4GKJJ 2F8KA 5D8HB 1XSLA 4EHUA 3V7LA 2RQCA 4ZVQB 2P9PB 3MTKA 2CAJA 1WAJA 2O5DA 3TYTA 3M2UA 8ICJA 1XMQF 1UA1A 1PAEX 2OLWA 3OBYA 1R8HA 4M3RA 4IG0B 1NCLA 3SUNA 3MMVA 3OS2A 4IO8A 4DL0C 4EYIB 1VISA 2YY6A 5D4LA 2B7CB 2FDNA 2W4PA 4CJVA 3CC7N 3TO8A 2U1AA 4LFCJ 4GKKK 4LF9K 4FWPA 5LXYA 1D3WA 4NLWA 1VQMN 2LDYA 5HROA 2G5HB 1TUGB 1MQ2A 2P6RA 5LMNK 4LR8A 3RB0A 3VQQA 3K0SA 3T1HJ 3SI8A 1N5SA 5KT7A 3QINA 4RLEA 1RAHB 1U2CA 5BPCA 3QIPA 4AH9A 4JS4A 1GTHA 4USVA 4PKDB 4DLGA 2BV3A 1Q86O 5AI0A 4LBPA 3MM6A 1F21A 2NSBA 1QJHA 3HKZC 3UR3C 4C8LA 3TA1A 3SD7A 1NNEA 1NLKL 3BZQA 2ASOA 3BH7B 3O80A 3JPSA 2CH6A 2KO1A 5ALPA 5CH7B 4GFJA 4DBQA 1TKXB 2XI9A 4ZA1A 1M5SA 1UJ6A 3QUCA 4OI0A 3GG0A 1JKHA 3D45A 3ZZZA 1L3KA 4B8AB 2R2RA 2XO6A 4LF4K 4NASA 3A2FA 1S72N 3C95A 1QLNA 2D0CA 2HHTA 4A46A 4P0PA 3Q8QB 2A3VA 3RH5A 2Z2LA 3C6TB 2VPZB 4KV8A 4XO0A 5KTQA 3AHPA 4A48A 5IOLA 1SC3B 4ZHRB 7ICVA 1YJNS 4QIEA 1JLFB 2JZBB 3OUYB 1W7WA 2GELA 4LRFA 3UCGA 1R3NA 2FE9A 3ZFVA 1N5XA 3CCMN 1XSNA 1AW0A 1SKSA 3QDKA 2FZCB 1XNQK 2VF3A 5B0BA 3JYTB 3D0PA 1QD1A 1RTDA 1CC7A 4UOCA 5K8MA 4XPEA 4DX6A 3OQ2A 1C0UB 1P8GA 4JKBA 4X62J 1CUKA 5K8OA 3RSEA 2F7TA 2PFPA 1VYAA 4CZFA 1BQMA 3X3UA 3GZFA 3B4MA 1XTZA 4XTTA 2DVIA 1M1GA 1Y97A 5DM6Q 1K73T 2JEIA 3EN9A 1R31A 2DRAA 1QVFM 2P9NB 5BN9A 3LP1B 1RTIA 4UAUA 1SQKA 2DHGA 4UB6U 4QZDA 4OYOA 4F3OA 4WJ3B 4PZOA 4H5RA 1QSYA 4P10A 1MMLA 2IOHA 2LCWA 3ICXA 5F8MA 2DBBA 1NKCA 4NLPA 3MEDB 5BPMA 2KYZA 2WF8A 4EGLA 4PHDA 1SL1A 5KFUA 4AD6A 2BM1A 2AZ1A 1UA0A 3MD3A 4CEEA 1M90T 4NPOA 4RW9B 3CFPA 2PT0A 1PK3A 4W5QA 1VK3A 2A3ZA 1A5XA 1RDUA 3MPDA 4BRGA 3DDHA 3BQ0A 1AA1B 2D41A 2PD1A 4I4BA 3KHGA 3S8SA 2BJ8A 3R5GA 3EZUA 3PG9A 4ILMA 4NLCA 5KFRA 3CCJN 4I2PB 1X4HA 3TAEA 4Y2VA 4FPBA 1RLDA 2CUYA 1VQOS 2W2MP 1VC5A 3C14A 1ICEB 4FSVA 4OKEA 3ZEUA 3LQVA 2BQUA 3DOKB 1TKZA 4DV1J 1S99A 4F26A 1KEJA 3WC0A 3U4LA 1Q78A 1HIWA 2JX2A 1KN5A 1NPKA 3LDSA 3SQ0A 3QSYB 2G4BA 3MPWA 4CEQA 2KG0A 3KWIA 2KHQA 5E3QA 2BUPA 2FF6A 1CJKB 1WWVA 1MQ3A 1O6XA 2PN6A 4XIUA 2C2ZB 2B5JA 4OHZA 1GLDG 5DB6A 2ZIWA 1Q9XA 1JLQA 1XMQK 1K8AO 3VQ5A 2UVVA 2E5GA 4DFKA 2JFKA 2XMJA 3IBCB 3CMQA 5C7PA 3DXMA 4F93B 5LMUK 3IAM9 3MUMP 4YG2A 3MXJA 5HRSA 2YKMB 1VQPN 4KGVB 5HMMA 4ISEA 1YHQN 1KOHA 3RFAA 9ICTA 1L3SA 5H9FJ 4QPTA 1VQMS 3QO9B 2YHBA 4F7VA 5D4BA 1SXDA 1GLLO 3LPEA 2W8LA 3A0HU 5HSPA 2LKZA 4IQXA 5I4MA 2G8WA 3G2XA 2W42A 1S5JA 4CERA 3MEKA 3ZZUA 3AO4A 5KFYA 1SIJA 1N32F 1IKYB 1U25A 2Z2YB 4Y0WA 1KKXA 2IC3B 3PSTA 1HR0J 3J8AA 1N52B 1D8LA 4ICLB 2B3TB 2J6UA 4K4GA 3U1MA 3HPGA 5AKZA 2OPQA 4K43A 4CHNA 4ZCIA 4YXMA 2JOQA 2KXFA 3NH2A 5J0UA 1NK4A 4CZMA 2ISPA 3TA0A 1S72S 3AO5A 4YOVA 2MU2A 4OYIA 3TAPA 4QR0A 3MEGA 4BC5A 3RRKA 2G0CA 1C6VA 4H0OA 2UU9J 4H0TB 1RK8A 2LPEA 3D7SB 5KFVA 3KLIB 3VQ8A 4LF7F 2HZCA 3J81O 3IA0A 3OYFA 3IG1B 1H2UX 5CHCB 4PQUA 3CCMS 1NK6A 2QM1A 4G9ZA 3ATVA 1QTNB 4YMMA 1VBXA 2E1EA 3EGVA 2Y0SD 2BANB 1SUQA 3VALA 2ZJ8A 1BPXA 3NP5A 4L75A 4DUYF 3LM2A 3QICA 5G5HA 2GQQA 3V5RA 3W3DA 3W8PA 3PO4A 4IOCQ 2O8DB 5I42B 3V72A 4Y65A 4CJSA 2YWKA 3KKFA 2R7WA 2F8LA 3U8XA 1WI8A 4FJLA 1YGYA 1FEHA 1D5AA 2W55A 5J0RA 2W9MA 2C3OA 4F9OA 2VG6B 1C2PA 4HTUA 4NLBA 1Z4OA 2PDAA 1PGZA 1HD0A 2RQKA 1J5OA 3KDOA 4X66F 5C25B 4P2XA 2P9SA 4F2RA 4UBCA 4LSLA 3C2LA 3E66A 4BWMA 4UOGA 1SH2A 3PRDA 3OFGA 1TMJA 4BR2A 4ZPAA 5HRNA 1S4EA 3SYZA 1RT5B 2WSCC 5H9EK 2DGUA 2KOBA 3RH6A 1ZQAA 4OO1J 2WF7A 1WHXA 4ED3A 1QM9A 2K7KA 3H90A 4P75A 8ICWA 3OTCA 4JS5A 4BROA 4KHPF 4B3OB 1LKYA 1HNIB 4MIAA 3MCAB 3TTCA 4JI5K 2G5IB 4OMFG 5KT2A 3PX4A 3D0IE 3PJWA 1E6YB 5F9LA 1YITS 3O8WA 4N8NA 3KG4A 5GAEP 1FRMA 4HH1A 4X64F 4DV7J 4FPAA 2GW8A 3CMEN 3ZTQA 1HWKA 3DOMB 2HBYB 1X6JA 1SJQA 3DRPB 2CZ4A 2VASA 2JZ5A 2Q0UA 2R7QA 2VOOA 1S79A 3FBCA 2VOPA 2NLXA 1SXEA 4FLXA 4J2AA 1FA0A 1KR4A 3FSIA 1G15A 5HNKA 2HVIA 2F3JA 2QTDA 4I0WA 1JLBA 2J9CA 4IUFA 5ALZA 2K4HA 3ZDBA 4XH1A 4R5PA 5HMXA 2CADA 2YX4A 4OI1A 2OHDA 4AUKA 1VQPS 3SSSA 2OSRA 3FC4A 4WFNQ 2CVEA 3OYIA 3G0ZA 3A13A 1VLBA 4FJMA 4YUDA 2ZBRA 3NXZA 4ED2A 3PJXA 2VUGA 3R5DA 3ATUA 2A2CA 4CJPA 9ICBA 2F4VF 1Z4NA 4DUTA 2NREA 3AUOA 3PW2A 1E6VA 4GO5X 4JNEA 3CJBA 4O0IA 3HRGA 3MM5B 5D4PA 2W54A 1AT1B 5KFTA 4PHTX 5L1JA 3DM2B 3ENBA 3QNWB 2VPXB 3H2UB 4KO0B 2DK2A 4IO9L 1GLAG 4FVMA 4K4HA 1FDDA 3DOLA 4WF9Q 3C5GA 3HILA 1Q86T 3NCIA 2OYYA 1EIYB 1TYQA 4CF1A 3VQTA 3QGGA 3RJGA 1WOPA 2P5GA 1FE0A 2E7XA 1TV9A 3V6KA 5JMNA 3DLEB 1X9MA 2W4CA 2C1EB 4IWVA 2K89A 4ZVUB 2QXLA 1YJ7A 3Q7BA 4CP5A 2BRKA 1EHWA 4DPOA 3JAMU 1BNOA 5MLCV 5FRMA 4RNMA 2VPWB 1HI1A 1QUPA 3TFSA 4OZ2A 1C0TA 5F0WA 5GIPA 2RHKA 5ADZA 4BACA 4QZEA 4FLWA 4IDHA 1QDUB 3RU0A 1QZ6A 4PL1A 2AX0A 4KLDA 2HBMA 7ICOA 4H54A 4HTJA 4LF7K 5ETRA 1K0VA 1WSRA 3UD3P 1CULB 4IQTA 4P71A 3VGSA 2UYTA 1IKWB 1PBAA 4U67Q 1XIQA 1TGOA 1BE4A 2XCPA 3HW8A 2BA9A 3I82A 4I2CA 1SJ1A 4DUYK 3MGJA 3D28A 5JMVA 1T05A 2XVTA 2BCVA 2J0XA 2HVHA 3K8WA 4Q0BA 2V4JA 4ECQA 5GAEU 4ZDNA 2MEWA 3P45B 4FO0A 1S9GA 2J8AA 1ZQXA 1T95A 4DR6F 2NNWA 3ZC4A 5A0YA 3D2NA 2XGQA 2J9DA 2EI5A 3KKAA 3JXOA 3OHAA 3N6MA 2KD1A 3D2FA 3MABA 2A1RA 4QW8A 4LMZA 2ZJRQ 1WSGA 3FJ2A 4UY8O 2KYXA 2Q6BA 3CJAA 4FXVA 1WTFA 3UNYA 2V2QA 1V3ZA 2K7JA 3OV7A 2QSFA 4M45A 3EPGA 4M5HA 3GV7B 4H4OA 4DB3A 2UXDK 3D3CJ 3H0LB 3WEEB 3G8TA 4H4KC 3ENAA 2C3UA 1XC9A 5ALLA 5KL8B 5AK6A 1VQ4N 3E9PA 4IQWA 3H2VE 1HPMA 2XWYA 1KNZA 2Z4PA 2AH5A 1Y0HA 4KHPK 2YQ1A 3P8BB 1RBLA 5DB7A 2VWJA 5AKEA 1OY9A 2CPZA 1U1RA 2VBXA 4M9LA 3M6GA 3OS0A 2ZM6F 5HANA 1ILYA 9ICHA 3I0RB 5ALXA 2DGXA 2C2NA 3K8VA 3CMES 3VGUA 5GAGU 5E5NA 2OANA 2A1SA 1DZ5A 3G6YA 2ZIUB 1CJTA 4OIXA 4M47A 3KD1E 4WYLA 2KNJA 2E5HA 5RUBA 2I7NA 4HYKA 2BUNA 4ZJLA 2KN4A 4B3RF 2UUBF 4KGZB 3NHGA 2QWQA 2B51A 1SKWA 5AQKA 3F9MA 5IXUA 4KHYA 4CF4A 4JI3F 4IYQA 2KFYA 4JI2J 4EP5A 2HBQB 3V1OA 1BIUA 1K8AT 3CCZA 4F91B 2QARB 3BGUA 1Q5YA 7ICJA 5EE1A 3VAGA 1UWBB 3CJ1A 4K2XA 1MN9A 4L6V3 5I3UA 3OFEA 3HHNB 4IZ9A 4KITB 1N34F 1B9FA 1WCLA 4NXZA 2PBDA 2CZVC 5D78A 2KN7A 2GEMA 2CNNB 2OGUA 1N54B 2IDLA 2BABA 2HMIB 3LDNA 3H45C 2F4VK 4N5SA 2PFOA 2VWKA 2AXTU 4DV2F 3NF9A 1CS4A 1WELA 4J2BA 5EWFA 2D5RA 4E1JA 2HBKA 4CF2A 3M3ZA 1CI4A 1RTJA 2PMZF 4DV0F 1CZ9A 4BG9A 4JD2B 2CPEA 5E7OB 4B08A 1N61A 3NAHA 2QEXS 1X9JA 1RU1A 3TFRA 2DNMA 3ZETB 4FJHA 3BGRB 2IM0A 4YDXA 2ES6A 3DMJB 3IM9A 3OL7A 2VFUA 2FXUA 4Z2XA 2ZXHA 1A6LA 5A8RB 4R8UB 2JLFA 3PUFA 4WK3A 3I55S 2LYAA 5ETPA 4EEKA 1JROA 2D4WA 1CQNA 2I5HA 1VSMA 3ISCA 1BPZA 4QPXA 3A1YG 2J76E 4RQNA 2Q6CA 2ZEJA 1ZBUA 2BYCA 3UM9A 4B9SA 1U1QA 3CJ8A 4JWNA 1O1WA 2WAQC 2IBOA 3GCWP 3IMQJ 3AQFA 4CF3A 4U95A 2GH1A 1Y88A 3R1LA 5GTHU 4FM1A 4AHVA 3E9LA 4JK1A 1FTCA 5G0RB 5ETQA 2OPSA 5CA7A 4CJUA 1IG6A 4CZEA 2BJDA 1SPBP 9ICEA 2D1CA 3HO1A 5FIIA 1U2VA 4BVPA 1OXJA 4QZIA 3ZD9A 5ALTA 1LKZA 5J0XA 2CVIA 4MT1A 1GMUA 3QXGA 3VOVA 5IWAK 4YXJA 5DRKA 1YRTA 3AD9C 2G2OA 4FKXA 2NXUA 4DR6K 5CCMA 3M9OB 1QCKA 1YT3A 4PZVA 5D0EA 3O3GA 2RQ4A 3OYKA 3L2QA 4XUSA 4EX7A 4AM6A 3R8EA 3WDOA 1KCFA 4ISGA 2AP1A 3PSPA 3FSYA 1CLQA 3F5AA 4DSKA 3N5FA 4E2FB 4MEYA 3W9JA 5HP1A 1ATRA 3NH0A 1VJ5A 1MA7A 2ZH4A 2IJNA 1EX8A 1VOMA 1IJFB 4YY3K 9ICSA 1GFWB 4M41A 1FKPB 1PVPA 2KMDA 3DLGB 8ICRA 3K5LA 3H3NO 1VSLA 1A6SA 4Y34A 2W11A 5AE3A 2FPHX 3AJ1A 2ZH7A 4ZLLA 1JJ4A 4FZXC 1VSDA 2I5JA 1W7AA 1HQ2A 1QE1B 4C23A 3MECA 2O8CA 3K57A 2GBZA 3QEVA 4FF1A 1VQNN 1RBTA 3M1FA 2XICA 3WIUA 1VSKA 4RQ0A 1WBDA 2QZ8A 1ZQHA 2CJ9A 2AU0A 4OHWA 3CXCM 2Q2RA 5HJYA 3CCVS 1WORA 4PGXA 1DARA 2Y9UA 3TKAA 5H1SV 4CK1A 4ZPBA 4C11B 3OPXA 2YWFA 2M4MA 1BWFO 3AAPA 3IS9B 1KOOA 4JI0J 5EDWA 3AVGA 2IJRA 3GSDA 3QIPB 3HZ6A 2Q36A 5JUMA 1RXWA 2HIYA 3RBEA 3T9ZA 4B3RK 2UUBK 4S0MA 4QAGA 2V67A 4CJQA 3AMZA 4NLVA 2D9OA 4IFVB 3DLKB 2VA3A 3D1OA 5GIOA 4JI3K 3M6KA 1NJYA 4DR2F 3LZJA 4FJ8A 1RWPB 5LSRA 2OO4A 1KVJA 1S48A 2UUWA 3O4WA 4M5GA 4CRJA 4ETZA 5DZ6A 3NVVA 3M8QB 1JKHB 2GFFA 3J7ZO 3FC9A 5HATA 2FDRA 4NM2A 1Z1VA 1N34K 5LMNJ 3HVRA 4RNOA 3D6JA 1ZD5A 3F44A 4I67A 3HKZD 3GDXA 4E7KA 4PHPA 1GMVA 2F9DA 1RM6C 4UTGA 2R4FA 1WACA 2F1FA 3B54A 3WK6A 3DN9A 3HHDA 1IQTA 1NH8A 1SH0A 1NAQA 2WUSA 4P2SA 1WC0A 2OKQA 1SJFA 3SCXA 2F63A 4DV3J 3FGVA 1ZZNA 2F4FA 4KH6A 3HP9A 5IS2A 2P9LB 1W2IA 5H2FU 3M4XA 1UCVA 1RTDB 1ZD4A 1OO0B 2M9NA 2QX0A 3DHXA 1X3MA 3H7IA 1ZA2B 1QAJA 3QJPA 1NGDA 2QFJA 4BGBA 1BQMB 2MQMA 3WZ0A 3BZCA 1FFGB 4B1YB 3ELHA 2OP5A 2MSNA 5F8JA 4N56A 2R2SA 4NLXA 3D6MB 2G8IA 2XYHB 4J8FA 2IPOB 1RTIB 2HOIA 2L48A 4CZHA 4H5NA 1VHFA 3N28A 1HARA 3R9LA 4WXOA 3HJEA 5DBAA 2H5EA 2BH1A 2QE5A 2FSNA 4OZJA 4USWA 1K8KA 3D54A 3KNGA 2QLTA 3O1BA 3L0QA 3FRZA 2HAFA 1XNQJ 2CJKA 1ATNA 3GJQB 4RJVA 1ACMB 2XLJA 2DD8S 1K5OA 1ZAVA 4YHHK 2ZGYA 4NLKA 4NEYA 9ICMA 4JI8K 4NLZA 1VBZA 4O4GA 4DV4F 3TVZA 1SJ3P 4BC4A 4Y2CA 1FDNA 2GMLA 3MMAB 3AVKA 3NOCA 2AYBA 4F3TA 1TL1A 4OYWA 4CJRA 2ALYB 2Z1HA 1J5EF 3DLRA 3C15B 5L46A 5KFXA 5SWMA 5ALIA 3S41A 3E58A 5B08A 1QQ7A 2LYVA 1WDTA 4UOHA 3GG1A 2ADBA 3QERA 2CGLA 4C4WA 4ED8A 4MFBB 1T03A 3WKAA 2WB1C 2FVPA 3CETA 1VQ6N 4UQTA 4RPXA 1AYEA 2N4DA 3NNHA 3EUB2 4O5KA 3C14B 2DTUA 1JIHA 3ZDAA 3UQSA 4CNYA 1PBUA 2LKYA 4JHDA 3NMUA 4FJIA 4RQ6A 1EKEA 4QNLA 1D9DA 2LFVA 1SKRA 2GNKA 3R2CJ 2Z1JA 3MMBB 4FWRA 1TFYA 5IT9Y 4NLDA 1QUVA 4UY8T 1DXSA 4C0ZA 2XM3A 4FJ5A 1B7YB 3QJLA 2AD9A 2ZF5O 5AXKA 3OYDA 2ZIWB 1JX4A 3SEOA 3VETA 1JLQB 4O3OA 1Y5LB 4UB4A 1WG5A 4E89A 3V1RA 1T9YA 2XY6A 1RZMA 4NOHA 2RF2A 2C2DA 3U9DA 2X74A 3GCXP 2Q0ZX 5FLXU 1BUXA 1VQNS 2HDOA 2ZBPA 2QLBB 1L6NA 2YBVA 3SCLE 4MLHA 4JI6F 2LEPA 4QCLA 1F9EB 2FLNA 1DQ9A 1RGVA 3HM9A 2GQ2A 3TANA 1PG5B 3GMGA 1IG8A 1FRKA 4PPZA 4URSA 2D6FC 2HFNA 3FZHA 2EAOA 1MROB 2IOFA 1NGGA 4BE0A 2GIFA 3NRBA 2G8HA 4CHQA 3UI3A 2XLIA 2YWWA 1HNWJ 5A8WA 1UZHA 3G8SA 3CT9A 1HKBA 4OVLA 2HAIA 9ICCA 3UR0A 4DR2K 2ZFHA 4P2FA 1T3OA 5E41A 4CO5A 3HJFA 3AN1A 3K4GA 2EH9A 4ED0A 3KK3B 4DR3F 2KIWA 2GV9A 3CDBA 2OPQB 3V4IA 1S0OA 4LR7A 1ZH5A 1W25A 2DR9A 4EWTA 5AJ3F 2N4CA 1MC8A 1NBWA 5HK4A 3C3LA 3IXQA 2P9KB 3N9UC 5J2NA 2QJ3A 1NDCA 2R18A 1DGKN 2H5XA 3ORYA 2V52B 4P0QA 2CN1A 3AVAA 2P2CB 1OH7A 3MAHA 4KB0A 4QIWF 3MEGB 4AQYJ 1TQLA 3ZSOA 4M04A 2K4PA 4RUHA 5J2FA 2KHVA 4E19A 3PLAA 4QYZJ 3QAEA 2Y0SF 4OCZA 3ZSXA 2ZQBA 4QIFA 4U7BA 1WDDA 5EXWA 3ZTPA 4C6AA 1U0HA 4F4ZA 5EY4A 4O23A 4DWIA 5CAAA 2FC8A 5JVHL 1R8BA 3DU6A 3W8GA 1FWPA 1GMWA 3MM7B 5JVGL 5KQ8A 4IJAA 3TTDA 1MG7A 3LPTA 4NA1A 1H72C 3KXDA 1CZBA 1TVRB 1U1NA 5M2PA 2I6WA 5AE1A 1O5JA 1X3NA 4DCPB 2RDIA 4KLJA 1IR0A 1YBAA 1Q8IA 3UWTA 2HQDA 3ETMA 3GIJA 2CH5A 2KHOA 3TA2A 3PW4A 2ZJQL 3V9SA 3AGRA 3CJSA 3MXHP 1A7GE 4ID5A 3IDHA 3NAEA 1O03A 5DM7L 2DJWA 5KOWA 3UW1A 4A5BA 1VK0A 1MMDA 2WBNA 1Z19A 4DQIA 9ICAA 4MF2A 4A47A 5BR8J 3DLHA 3N6NA 5C2CA 4UW9A 1S6PA 1BMQB 2YHYA 1EZZB 4WYWA 3SUPA 3H46O 4FCYA 3TSUA 2F77X 4KBOA 1AUDA 3LANA 1RT7A 1OKJA 1ASVA 4OKKA 3P31A 4OQJA 4ILRA 4IRKA 1T4GA 2EEYA 4DZ6A 3H0MB 3FZMA 2FHJD 1QQCA 1O08A 2KKVA 4D3GA 1R27B 4TQRA 3VA3A 1ZQKA 2AWZA 3C6HA 4KHQA 1HBNA 4LVNP 4KH4A 1VQ6S 3OTQA 4J9MA 3PZPA 2M2BA 1LKYB 2OXOA 2P66A 2GJFA 5AM3A 5LJWA 3RAXA 3PIOL 3IG8A 3LM9A 1WBBA 4MK7A 4I2DA 2R7SA 2BW7A 2DUYA 3SR6A 2Y9TA 3W62A 3KLFA 4TYAA 3C5FA 1ZQYA 2VBZA 3BSCA 1R0CB 1H73A 3HHKA 3K75D 4QJFB 3PNIA 3OHBA 2BDUA 3L4PA 1WTBA 3VEWA 1FVQA 2EW9A 3EZWA 1C0FA 5HR7A 2K1RB 3M7DA 3O9UA 3DHWC 3DLLQ 2CJXB 2NYVA 1BIZA 5L1IA 3TWZA 4A59A 2VJ5A 3ZSQA 4F4YA 1JLBB 3GBTA 2OD6A 1N33J 3NRZA 2B8PA 2C2MB 4JI5J 1RWVB 3CC4N 4Y2RA 3WKCA 4NLOA 1U8SA 4JI6K 4RNNA 1FFUA 1B0XA 4Q44A 3V7JA 5ELZA 5L1LA 3L2VA 3LP2A 1YQHA 3LDLA 1SZHA 4NLNA 4JKDA 3DAWA 1PUZA 1E6VB 4KLHA 3IUCA 2DT9A 1W2BM 2HEKA 2XMUA 1FX2A 5KRTA 4DU1A 3ZTOA 1J2MA 5H1SQ 4DTJA 1OVQA 2YWEA 2OFGX 2KSOA 5KFDA 5EVZA 3RJKA 3Q83A 1T11A 1XERA 2BKEA 1ULRA 4NB4A 1Z1BA 2FPLA 4FWQA 4ID8A 3AA9A 2EK6A 3IAS9 1EAYC 4USMA 1UW4A 3C2PA 4AHTA 2FVRA 2C2EA 4TSXA 2M0GB 4TQSA 4DV6F 4KH1B 3RUBL 2QLJB 4RU2A 3C2MA 2OZSA 3GB0A 2JRZA 2YMLA 3SCJE 4WP8A 3EE9A 4G65A 2DNQA 2BCQA 4DL6A 2X3DA 4O44A 4DTOA 5T41A 3WT0A 2PKEA 2V5HG 2CXYA 3FR0A 5KAFU 3IRXA 2RUSA 4QYRA 3PFEA 3I6PA 1UZDA 4HHHA 3SK3A 2W9CB 4K4SA 3IHQB 2WB4A 2YMQA 2B8QA 3LAKA 3ETLA 2QW9A 4OGCA 1LV5A 4CJKA 1RILA 1DJ0A 2XZWA 5AQMA 4HTIA 3KZXA 5CYQA 1J97A 2HKEA 3NFAA 5J2HA 3NOGA 4EO6A 4KLIA 3I56S 3CFRA 1RI7A 3CF5Q 1FFVA 4OLPA 4M5LA 2AEMA 2E8AA 4LBHA 2ZUGA 2VBYA 2V9KA 1S5LU 2U2FA 3OA9A 4C8NA 2D3OR 4EELA 2GAHC 3EICA 3KKAC 4LFCF 4NMLA 3P38A 4ECXA 3QZ8A 3CQYA 3PR5B 1B9DA 1E4FT 1T05B 1Q9YA 3ZZYA 4AM7A 4Q7AA 5KFQA 5EX5A 4DTNA 4Q0BB 2V4JB 2W9BA 3THPA 1IM6A 4DCCA 3ZX0A 5I3QA 4M42A 3QT6A 2J7KA 2ACYA 1S9GB 3T1HF 3CCEN 2DGVA 2JGUA 1AFIA 4C98A 2GMJA 2J0QD 5CD4H 1ZBIA 3H5YA 3VESA 3QMLA 4M3ZA 1JI7A 1RDWX 4CYUA 3QETA 3SCKE 2MQ8A 3CQXA 4C2MA 1D8ZA 4ERDA 1NUEA 9ICGA 4X4TA 3BDPA 1NGIA 1XNRK 1VFJA 2PEHA 4QWEA 2MJUA 1YXQA 5KGWA 3Q2SC 3K58A 2CQGA 5KFIA 1T9WA 1S1TB 5J2BA 2HK2A 4UF4A 4G1IA 1JCEA 3PEHA 4NYPA 1LOUA 4H4MA 5KFOA 1RUSA 4WE1A 3KIOA 3KUGA 1DRZA 5LOQA 1TUVA 4UAWA 4RUAA 2P9CA 4GMJB 3HP6A 1BY9A 1VJQA 4MEXA 3WK7A 3UXNA 4B9MA 1MMNA 2FGCA 1KD1T 1CZAN 2ATQA 5EOYA 4DR1J 2CRLA 1Y11A 5D4OA 2Q43A 2AGPA 1T94A 4YEAA 1U09A 3MM8B 2W7AA 2YNIB 3PHTA 2B21A 2Y1RI 2UXDJ 5IILA 5AQIA 4FJ9A 2VDHA 3ZT3A 2W6LA 3H0RB 3B6BA 4OKJA 2I9GA 3OYGA 1SCJB 3VZHA 3MMCA 2MZSA 1RXVA 8ICAA 4J2DA 1PZNA 4M3UA 3RJEA 3SMPA 1TUYA 2EZXA 3VEOA 4TUSA 3IP4B 4FOIA 4R63A 3C2KA 1N48A 4X65J 3ED5A 2B7BB 3GYGA 1UPHA 3C65A 2IVYA 3M30A 1FTRA 1IV8A 1U4BA 3SPYA 1UEUA 1HI0P 4CGJA 3CCSN 4CT9A 2MZ1A 4PPDA 4Z6DA 1HBUA 2KEYA 3DJCA 4IRDA 4Y2SA 2E44A 4HACA 4FLZA 5BREA 4NLTA 5HL7L 3ZNJ1 1XHXA 4J9NA 1RQLA 2GO9A 2VKZG 1VR6A 4W90B 4L3NA 4DX5A 2YX8A 1MSWD 4E1NA 2HOEA 1BPDA 4EX6A 3HSDA 4LF5J 3KG0A 3K9KA 2JLEA 3FCHA 4I1TA 1B0PA 3V9ZA 1S0MA 4QZFA 4QR2A 4I7FB 1RT6B 2FVCA 5CQGA 1RKJA 3CMAN 3OYJA 1J2NA 2KP7A 3TQ1A 2X6NA 2FJDB 5CZ1A 5AKXA 3SDEA 3M7VA 4DQSA 2VA2A 3D67A 4C4RA 4M9HA 1KW4A 3D2SA 3L5KA 3R7NB 5ALFA 4Y2TA 4JKGA 2DXDA 4CJLA 4F0HA 3QYYA 3KMQA 5FD1A 2VH7A 2HHHK 4RPZA 4QZVB 1BI4A 5AM1A 2ZUBA 1S77D 1YJWN 2KQ2A 1VRTB 4E7LA 3DDKA 1YAGA 3VQ4A 3FDSA 4M7YA 4XK8C 4YFUA 4WZQA 3BN7A 5HBMA 3MAAA 5AXNA 4BWJA 2ZC3A 4GKJK 5J2MA 4DG1B 4RR5A 2Y9HA 3IC1A 1NBEB 2YJEA 1YVUA 3C1ZA 2MKIA 3DDIA 2CQ2A 2F8SA 4RW7A 3A5OC 1JRPA 2IHMA 1SKUB 4MKBA 4TY8B 2E6MA 1NDKA 1YKWA 4UY85 5GVQA 2GHWA 2DNZA 9ICRA 4CTAA 2W41A 4F8RA 5AZIB 2YNHB 2W25A 5C24B 1B70B 2B4VA 1KL9A 1X4BA 1ZQDA 3QEPA 1D4XA 4KH0B 2A1JA 5J0WA 4MDBA 4TU8A 3B4DA 1JALA 3VAJA 1H3DA 3Q8SB 4ZPCA 2ZIXB 1GNKA 4LFCK 1U2VB 4CJTA 1EETB 2V51B 1NB2A 3KLEB 5L9XA 1UVKA 2W1BA 3C19A 4OJ5A 1KRPA 1FRLA 2OM6A 3T1HK 2BM0A 2VB6A 1WHWA 4M6WB 5J1PA 4YN4A 3GILA 1J2VA 2ZJPL 2YV0X 1QSLA 1A0OB 2M5YA 4UAZA 2ZBIA 2Q31A 1QH9A 1G2EA 4PEOA 3OYHA 2FZGB 1PYOB 5K14A 4PXEA 3Q7CA 1RT2A 3QLHB 3A3PB 4CJEA 2OA8A 1Q79A 2GV1A 5FPEA 3KJNB 4OHYA 3UPQA 1EB0A 4DTUA 4F5QA 1TL3B 3HDSA 4P52A 2AYGA 4DQRA 3IDWA 3N0VA 4BRFA 5E79U 4MH8A 4I2QA 3DEEA 3AGKA 4ACOA 1CC8A 3H59A 2R7TA 2K4EA 4ER8A 2ASLA 4ZPVR 2QLFB 3I31A 1UWAA 1ZQOA 2UU9F 1T9VA 4MO4A 2CQ4A 2UXBK 1ZBTA 5JLHA 4LF2A 1D1UA 3SQ2A 2NUUG 2ZUDA 2ZH1A 1YDLA 2MXYA 4HR2A 1UT5A 4O3NA 1SIZA 4JLHA 3G4SS 3IR7B 3OYCA 1Q5VA 4BRLA 1SV0A 4PPXA 3KLGA 2C2RA 2NRRA 3GJTB 2ETJA 4X62K 1HWLA 1BUPA 2CPHA 4FVUA 4PUOA 4HAIA 5SZTA 1D9FA 2OIHA 2V8GA 2NPIA 1ZQLA 2BMBA 2D3O1 7ICKA 3ZT4A 1U8WA 2RRNA 3K5NA 1HI8A 2BX6A 2Y1IA 4FS1A 1M1HA 3HKZF 2B9YA 3IMXA 2DB1A 4CGHA 4I2BA 3HT3A 1PILA 3RMCA 1X5SA 3J7AP 5A2QY 4CO0A 3BO4A 2MQOA 3SSRA 3Q2TC 4LT6A 2GAGC 2GIRA 4ZVHA 4JMUA 1U6ZA 2KDOA 1HHTP 1RLCL 4LC9B 3VGMA 2ASPA 1P6TA 4MYTA 1G3OA 2K3IA 2CQIA 4US9A 2C22A 1HX1A 3VVTA 1IIPA 3CMAS 4NYNA 1IO2A 3MD1A 3S01A 3PCOB 1TKDA 3D5MA 3NMRA 1Z2LA 3EY1A 3RAQA 3KOAA 5DDMA 3RW6A 2DGWA 3DU5A 4IBNA 5KFBA 2NXCA 1KVCA 1OSCA 3EE3A 3KLVA 1Z1ZA 3G8QA 4CM2A 2BZ2A 1IBKJ 1X1PA 3R27A 3E0FA 3QMQA 4DV1K 1HYSB 1RBRA 4B9LA 4DV7F 7ICNA 4K8RA 3O08A 2PI4A 3LW5C 4W5NA 4DR5K 4FVCA 1L7NA 3SAFA 3DGPB 3M8YA 1Y5NB 4NO7A 4USTA 1X9XA 1FXLA 3VEYA 1K8KB 1WUDA 4Y2AA 2WONB 1HJRA 4BXOA 3BBBA 3D0HE 1S6UA 2IM2A 4Y28C 3M6UA 4DLEA 2K06A 3NUQA 2VGNA 5L1MA 3HI9A 4G1PA 2AQ0A 1RZTA 1JLEA 1RBSA 4Q8EA 5J2EA 3OXFA 4QQBA 1BWVA 5AQUA 5ALVA 4FBTA 8ICZA 1HPZA 2GGPB 3SFUA 2WFAA 1BU6O 2QGFB 3GFKB 3I4PA 2O8EA 1ZQRA 8ICIA 4ZPWR 4ZN3A 1Q8LA 1J27A 3THTA 3KK2A 2RH3A 1BXNA 2X1AA 1XMOF 1ZQUA 5AICA 1UJ4A 4BC9A 2NRWA 3VGVA 4YHHJ 1KDNA 3C6UA 2ZNYA 4A57A 4RT2A 3L2RA 2O8FB 4JI8J 2OCEA 2A42A 1HR0K 1JLGA 4OLAA 2K60A 2CQ3A 2HVZA 4MFAA 4CLPA 4C8OA 4L8RB 3C29A 1VJWA 2CJYB 2ZTCA 1R6VA 2MAXA 4I9QA 2WB1D 3WXIA 2IVOA 2X1GA 5EX3A 5SUHA 2KICA 3P1GA 2ZIVA 1X4CA 2KLAA 1LK5A 5J0OA 3US5A 5AM5A 2YNGA 4DN9A 5ALNA 3FBFA 2KG5A 5B8HA 3HFVA 3D0GE 2HHSA 3GSIA 3DXKA 4EZ9A 4JV5J 3CFOA 3MXIA 5GMDA 4BRPA 2GTDA 4KMOB 1BA1A 2MRLA 2NR0A 4RO0A 5CXTA 2R8GA 2Q79A 3FZKA 3VQ7A 3R6MA 2KU7A 4GXJA 1HMVB 2A10A 2VQEJ 1T3QA 4CNQA 1MLAA 3WXLA 1BLUA 2IRUA 1V9OA 5AM0A 3EEQA 1EX4A 3ZT0A 1UEKA 2WK4A 3NVKA 2ZOGA 4CZGA 4F0MA 3KD3A 2YKNA 3TZXA 3I0SB 4BBYA 3HTVA 2XS7A 2LQ8A 5CZXA 4UASA 4RT3A 4EZ6A 4OI3A 2V8HA 4YD2A 5IINA 2XB2D 2QI2A 2RRDA 3HVTB 4BQLA 1ZM9A 4F5RA 4FWKA 2XGPA 2M8HA 5T14A 1IM4A 4NZ0A 3RW7A 4A8QA 5B7WA 1BL3A 1S4FA 1RT1B 5HN0A 3RBXA 1N4LA 4FWOA 8ICFA 2KHCA 5J2CA 2WSEC 1XS9D 2PFNA 5GTIU 1ELOA 2RS2A 3LP0B 1NPPA 3QJJA 4PWUA 3V9XA 2APOA 4CLLA 4Y1DA 2A18A 3KHYA 2VANA 3VEZA 4YOEA 4P0QB 1C1BB 3JS6A 3QFUA 2QA4N 4F2SA 1K6YA 2MGZA 2XRIA 2F8EX 1A77A 3W0LA 3ET6B 4IH7A 2QB0A 3P39A 1NJWA 1QQMA 2YB4A 1FKAF 1U0HB 1NJZA 1B0TA 1FERA 1M5KC 2V8PA 3MN7A 2BTFA 4WIQA 3H40A 3TEHB 2MKKA 1VI7A 2HGLA 1C1CA 4HLBA 2ZHOA 2EX3A 2DIVA 5CY4A 1BOTO 3HHLA 2YNFA 3HOSA 4P72A 3CD7A 1XQIA 3FUYA 2BW2A 5D4NA 1QAYA 4CD1A 4M8LA 3WK8A 1T9TA 2OMLA 3RJHA 2HSZA 2QB1A 1AXQA 2HF3A 1ZAXA 3EKUA 2ZKTA 4TURA 1WD6A 4ID5B 4URGA 1NZBA 1S9EA 4FN5A 2BE2A 1NOZA 3BM7A 2MQPA 3SBTA 2VG5B 5ALEA 4EBCA 4UAVA 2CWXA 2Y1LB 3AA8A 4JI2F 4JKCA 4PAAA 4HHUA 4J9VA 2OPPB 4F71A 4WWSA 1RT7B 3QYPA 1MN7A 3SEIA 2QTWA 5LSOA 2ZH6A 2HHWA 2BCRA 1XI1A 1N62A 2FF3B 2BKNA 5B5EU 3IGVA 1TK0A 3TP2A 4DCJB 5L38A 2QRRA 5ALOA 2LECA 5F9NA 1VHIA 5EHHA 3OBWA 4B8CA 9RUBA 7ICRA 4DR7K 5AKGA 2R7VA 3OSPA 4P4OA 1RYUA 5K20B 1XJWB 3KK7A 1EWRA 3W1YC 4LFAK 1U48A 2WCXA 4KLEA 2DKXA 2RD5C 3J81Y 5AIAA 4C4SA 4IH6A 6FD1A 2E2QA 1XO0A 2HNDA 2B0GA 2V50A 2DNPA 2BKOA 3W2VB 1RDBA 1RCXB 2HFSA 1RHMB 3NGIA 4BE1A 1DTQB 2W7OA 3MM9A 2AA4A 1ZM3A 4RWTA 4IFYA 3KUHA 4EIAA 3AO3A 3K1RB 4QWBA 3BF3A 2Z1GA 3HPHA 3L3UA 5BRDA 1LXJA 4KSEB 5KAKA 1ZQ1C 3ILJA 2CQHA 5AQNA 3V81B 1URRA 1RWXB 3I33A 2UVRA 4FYXB 2P6TA 5AQVA 3AQEA 5ETKA 3G87A 3Q8MA 4CEAA 4EP4A 4DU8A 1ZJMA 1T0TV 3ADAC 2DNOA 4NWIA 4XQ8A 1O0PA 1N8RO 4FJGA 3W5ZA 1X4GA 5K5MA 2G0JA 2BJ1A 5CD4A 1Q7YO 2C3MA 2VIHA 3RWUA 8ICUA 3LDQA 2Z0GA 3M8RA 1M5OC 1FESA 3CB4A 1NZ8A 4CJ5A 4LBIA 3ZZOA 5ADXA 4UB1A 2RU9A 3TJ8A 3H42A 1HUOA 2A6OA 1QAXA 4I6MA 4DN0A 1VIXA 3DRRB 2FVSA 4ES3A 3E3XA 1WSEA 3C6AA 5KPTA 5KQDA 3HZGA 4HHJA 4EUVA 4GMKA 2DGOA 4M5NA 3G71N 1FO1A 3HKWA 4JUZA 2AX1A 2XULA 4O3PA 3T9NA 4H03B 3JPOA 2QL9B 3PYEA 3CC2S 2XMKA 2YY3A 2EC0A 1OY8A 2UV8A 3EMTA