1UA0A

Aminofluorene dna adduct at the pre-insertion site of a dna polymerase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
b'AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua0A01
1NK7A 2D0BA 1DOQA 1NKCA 4KB1A 1HMVA 4J2BA 1JMSA 5E41A 1UWBA 3RMDA 4O3NA 4DL4A 1S1XA 3NH0A 1VK0A 5CB1A 2P66A 4W5NA 4DTMA 5D46A 4K4GA 4DWIA 1BISA 1VSEA 5D4BA 1RTHA 2RN2A 3K59A 3S3OA 5KFRA 4FK0A 8ICAA 1B92A 4KHNA 8ICFA 3THVA 2Y1JA 1BCMA 3V72A 2JEFA 4QAGA 5J2QA 3UXPA 2ASJA 4PHEA 1T3NA 4EEYA 4BXOA 4P4PA 2OPRA 4FXDA 4JUZA 2W8LA 3V1RA 3OYBA 2OYQA 1RDBA 7ICMA 5FRNA 3C6TA 3ISNC 3F73A 1WCLA 4RPYA 2BCUA 3LANA 1D8LA 3C5FA 4FM2A 4DL7A 2I5JA 4KLEA 4PH5A 2XCPA 9ICMA 2OZSA 3JPSA 2W8KA 4FW2A 4FJMA 2ZD1A 3GV5B 3RRHA 1RBUA 5DLFA 3QZ8A 3BQTA 2OPQA 4AH9A 4Z4CA 3NGYA 3QNNA 4YQWA 1RTIA 4KLMA 2ZUBA 7ICNA 3RJKA 1YT3A 4ECYA 3L8BA 1TV9A 3LAKA 4CFAA 1RT4A 2KFZA 4IFVA 2HHWA 4YXMA 1MQ2A 2QKBA 9ICSA 2XY5A 3M8QA 4LSNA 3HWTA 3PX4A 1B43A 5KFBA 5KFUA 4DEZA 4H8KA 4X5VA 1Z00A 3AU2A 4CEOA 3S3MA 1HQUA 3ALYA 3ZSVA 1C1CA 4GW6A 4AHSA 3QEVA 3IHQB 9ICIA 3ZSRA 3OJUA 2G8KA 1ZQMA 5F9LA 5HP1A 5KG4A 3QEBZ 1BPEA 5J29A 2W9MA 5KFSA 3TAPA 3RH5A 4E1NA 4QZDA 5KI6A 3K5LA 4PGQA 1U9LA 4B9MA 3NE6A 1JXEA 8ICTA 4F5NA 3KLGA 3K5NA 1NK9A 4RNOA 1XSNA 2Z1IA 2IDOA 3M8SA 2NRWA 4O5EA 1S9FA 1X2IA 4GMJB 2EHGA 5C25A 1KLMA 4M6WB 5KFOA 3V7LA 3TAMA 1NKEA 5IIOA 1S5JA 7ICJA 2IA6A 2RF2A 2GUIA 4ZTJA 4FJLA 4CF0A 4BACA 3NF9A 7ICLA 3OYJA 5DGBA 4BWJA 3TAFA 1WSEA 4B9SA 4CHOA 3MR6A 4AHRA 4CFCA 5DB6A 3OGUA 5DQHA 1YTAA 4LSLA 4QW9A 1XS9D 5KT3A 2C2EA 3TQ1A 4F92B 3SQ4A 7ICOA 4RQ1A 3T5KA 3GDXA 2FMQA 1ZQNA 4RQ0A 4Q43A 3K75D 2UVRA 4MEYA 4ED3A 4Z4GA 2C2DA 4QZAA 8ICBA 4PY5A 4N47A 1ZQFA 8ICXA 1SKWA 2J6TA 3KD5E 4HUEA 4B9LA 4DTRA 2XY6A 5CYQA 3HL8A 3V9UA 4KLDA 5J0WA 4CJEA 7ICEA 4IG0A 4FZYA 4UBCA 5DGAA 1NK0A 4M47A 3JPTA 1BGXT 1RT1A 1C0UA 3NH2A 4DG1A 1J5OA 5DB7A 2R8KA 3L2UA 4FLWA 4FJKA 3KJVA 2OPSA 4RU9A 5DMRA 4FJGA 2J6UA 1KRPA 3Q8QB 3SPYA 3ISDA 3P83D 1ZQUA 2HHUA 2PXIA 2ITGA 3KHGA 3OYDA 4Q45A 2KZMA 5KFDA 9ICJA 3SUOA 3T5JA 1ZQDA 2H5XA 1N56A 1S1VA 4CK3A 3HVTA 3OS2A 4DS5A 4R63A 2R8HA 4Z4IA 2FLNA 3V6JA 3LP2A 4KB0A 3VQ8A 4TUSA 2GV9A 4J9LA 3SV3A 3HX0A 1HNIA 1S97A 4M3XA 2R8JA 7ICRA 4CK1A 1WCNA 4DFJA 2O4IA 3SZ2A 4CJVA 1TK8A 4FCYA 8ICHA 3VN5A 2W9BB 4CGHA 3C94A 3LP3A 5D49A 7ICQA 3L3VA 1ZETA 3BDPA 2FPKA 4KO0A 2PFQA 4OKKA 1JLQA 4M9HA 5F9NA 3V7JA 2R8GA 3Q8MA 4ECZA 1A5XA 1TKTA 5KFKA 4O5KA 3QEPA 2KTQA 4M3ZA 2F8TA 1BI4A 4EZ6A 1RBSA 3T3FA 2ZQBA 2OA8A 2D0CA 1ZQBA 4O3PA 4M9GA 1NJZA 9ICPA 1GOBA 4PQUA 2JZBB 2HB5A 4JS4A 4KREA 8ICPA 1DTQA 3V9XA 2HVHA 1A5VA 1L5UA 5KT5A 3EZ5A 3KTQA 4JV0A 3TI0A 4E7IA 4J9SA 1BIUA 3O4NA 5J1EA 3MABA 3C2LA 3CFOA 5KFHA 4TQRA 3G6VA 4P4MA 3MDAA 3RJFA 4JRPA 3G6YA 4ECSA 1I3AA 4DQRA 2BQRA 4IR9A 3M8RA 4DU1A 4DTSA 2JLEA 2W9CB 4DF4A 3H40A 4EBDA 3DMJA 3LDSA 1WSIA 2E6LA 3AV9A 3WNFA 3HVRA 4K4IA 5KFAA 4RQ4A 1VSDA 3GV7B 3QERA 1MU2A 2ASLA 3CM6A 1QSYA 4JK1A 4FVMA 2B4JA 4EYHB 5J2FA 1ZQRA 1HUZA 2ISPA 5J2AA 4YP3A 4HTUA 5DB9A 3MXJA 5CY4A 2KN7A 5HBMA 4CJTA 1QSSA 1QHTA 4YG2A 4YMMA 3LALA 1X9WA 4NLGA 1RTDA 2G8WA 1D5AA 2V4RA 4DTUA 5J2MA 2ISOA 5KG7A 3LAMA 5J2HA 4FBUA 3AVHA 2DFEA 1CUKA 3RBDA 3P5JA 2FLLA 3OY9A 4O9MA 4O4GA 3AO5A 4OPJA 4FLTA 3C1YA 3QEIA 3MFHA 1RZTA 4DL3A 1KVCA 5HRSA 4C8MA 4M3RA 3OYFA 5HNKA 4J2DA 3ZT0A 4O5BA 3SQ2A 3GIMA 3OHAA 4Z6EA 2HVIA 4RG8A 4CIGA 4ECVA 4RW6A 2BQUA 3TAQA 1HJPA 2YV0X 4IQUA 4M45A 4CEAA 3H7IA 4HCBA 3C2MA 2P5GA 5CYMA 2DFLA 2AU0A 2PFNA 1WN7A 2G8UA 3JPOA 4I2EA 4M04A 3AVGA 5J2NA 1SL2A 2VG5A 1XSPA 2OWOA 4FYDA 5CJ7A 4E1MA 1ZQXA 5L1LA 1AROP 5KFPA 1XU4A 4EP5A 4AHTA 2Z1JA 3VQBA 1RT3A 4O0IA 1RDDA 3AVLA 3H8WA 2F1HA 3OYCA 4N76A 2E6MA 2YKMA 1D9DA 3AO1A 4NLZA 3OVNA 4GVMA 3N97B 2ZJAA 4BE2A 1EX4A 2IGIA 3BJYA 3Q8RB 4W5TA 3V6HA 4QWCA 8ICKA 3RAQA 3IG1A 5EU7A 2BGGA 1ZQZA 2YNGA 4CEQA 4CESA 3RTVA 4FLXA 4CJLA 2IMWP 4UAYA 3LWMA 3EPIA 4QWBA 2F8SA 2VG6A 1KVBA 5SZTA 4B8AB 1NK5A 3KLHA 3PW2A 2QKKA 5KFIA 9ICWA 3IM1A 4E3SA 3IS9A 4M6WA 4Z4FA 4UAWA 2Q0ZX 2Q3SA 3MXMA 4CGIA 4YFKA 2YNIA 4RW9A 7ICVA 2O4GA 3AA3A 4LD0A 4KLLA 2UVWA 1WSGA 2KZ3A 3AVJA 1NOYA 4B3OA 1S6PA 3I8DA 1F21A 2IOCA 2IAJA 3NBPA 3D0PA 1IKVA 3OYIA 4J9RA 4IQWA 1IKWA 4Z6DA 1N6QA 1XWLA 5C24A 2BHNA 3AVNA 3RH4A 5KFEA 2AQ0A 1T03A 1JKHA 4KLGA 4LY7A 1KFTA 4DTNA 4M3YA 5C42A 4OJRA 1TVAA 2QXFA 4TURA 4FM1A 3ZT1A 2D0AA 3OYGA 5KRSA 3V1OA 4J9KA 9ICCA 5KFNA 4KLJA 5J0OA 4F5OA 4ED8A 1S9GA 1LB2B 3LWLA 3ZD8A 1Y97A 4YN4A 5KFLA 4QWDA 4NCBA 4YVZA 1EXNA 8ICIA 2ATLA 4KLSA 3V7KA 3VQEA 9ICEA 3VQ4A 4Z4HA 3O3GA 2FBXA 2BPFA 9ICHA 1L3VA 1RDAA 4BWMA 4IG3A 3SUPA 4RUAA 4E7HA 5CA7A 3LPUA 4NXZA 3NHGA 7ICKA 3NGDA 4DFMA 4CJ5A 3LPTA 3GV8B 4I29A 5EWGA 3I0SA 4F2SA 2B6AA 5KGXA 4M41A 1G15A 4CJ3A 1S0OA 3VQ6A 1LW0A 4QZ8A 3IRXA 2AGPA 3AA4A 4CERA 4DMNA 3O4QA 5KG3A 1RYSA 2IC3A 4GLXA 1CXQA 2BQ3A 1NJXA 3PW5A 3ZCMA 4FJHA 3L2VA 8ICGA 3QEAZ 2ZTCA 4F3TA 2PI4A 2XY7A 2W9BA 4J9NA 1S76D 1U04A 3RR7A 2GBZA 4I2QA 4IRDA 4Z6FA 1TVRA 4CF1A 1SL1A 2KFNA 5KFFA 4CEEA 5T7BA 1Y88A 1L3SA 4ID5A 3HPOA 4YR3A 4ED2A 1RT5A 1ZQGA 4M3WA 5DKWA 4ED1A 1VSHA 3ISBA 4F93B 3JYTA 4YXJA 3ZD9A 2HW3A 3RWUA 4KLFA 3RMBA 4JS5A 1ZQWA 3SPZA 3GIKA 7ICHA 4KTQA 2JZBA 1HPZA 1UAXA 5J0YA 1SKRA 4XIUA 3RB4A 5BPCA 8ICUA 4N56A 3DLHA 3I0RA 9ICQA 5EOZA 1S6QA 3NF6A 4I27A 3G10A 3MXIA 1WNSA 4KHSA 4IQTA 4DU3A 2W9CA 3RMCA 4R66A 7ICIA 2FMSA 1ZQOA 1QQCA 1RBVA 4CJPA 3UXOA 2R7YA 5KT2A 1IH7A 2PYJA 3PV8A 2ZTDA 3UPQA 4BDZA 5KFGA 1C1AA 4FLVA 1HYVA 3RB3A 4F4XA 4IRKA 4Q8EA 2DFHA 2RKIA 4FK4A 3GIJA 4DSJA 5IIKA 3C2KA 4KV8A 4LVSA 4DU4A 3LK9A 5KFWA 2HMIA 2XY8A 4J9OA 1NK4A 4TQSA 3KLEA 3AUOA 4KLUA 3O3FA 1S0VA 4FJ5A 4EBCA 4RUCA 3V6KA 2X78A 3CFPA 3QEWA 1HYSA 2XGPA 4JWMA 5IILA 4O5CA 3NAEA 5FROA 3HJFA 2HHQA 1SL0A 4M0AA 2G8IA 4MF8A 2FC0A 3RH6A 1UT8A 3WNEA 2Z1GA 3HP9A 4G1QA 5DK5A 1V9PA 2C2RA 2LSNA 3PR5B 4ED7A 1ZQCA 5HLFA 2R8IA 4IRCA 2NRXA 3NGIA 2D5RA 1SZPA 5DG9A 5CZ1A 2ALZA 4I2PA 2VA2A 1KEJA 5KT6A 3ISCA 4BGDA 3OSNA 8ICYA 8ICLA 1SKSA 9ICNA 5SWMA 2G8HA 4O3SA 2QK9A 4O3RA 1KVAA 1IXRA 4B9UA 4YR2A 4CF2A 4FJ7A 3HSTB 3V81A 2BPGA 1YVUA 2E4LA 4J2AA 3ZT3A 1FXXA 1QSLA 1U49A 3MGHA 5KFCA 5J2DA 8ICRA 3QIPA 4CF9A 3TWHA 4OVLA 1D9FA 3UXNA 3DRSA 1JLFA 2VA8A 1BHLA 2NRZA 3KK2A 4KTWA 3RJJA 4PUOA 4PHDA 3AA2A 4HUFA 3RJHA 4GXIA 2BCQA 1Q9XA 1RT7A 4I2JA 1D8YA 4G3IA 4YCXA 4DLEA 4KRFA 1RBRA 3MDCA 1LV5A 2A1JB 4MF2A 3D45A 4I28A 4M3TA 1ZJNA 1X9MA 4MFFA 4RNNA 3PO4A 5KT7A 5L1JA 1ZQQA 4K8XA 2ZJ5A 5KTQA 4YMNA 3B6PA 4RW4A 1TK5A 4Z4EA 2B21A 7ICUA 4I2HA 3O3HA 4E89A 2IHNA 4O55A 3C5GA 4BE1A 4CJFA 4FLYA 4KLTA 3Q8PB 4DSKA 5KRTA 2JEIA 2YNHA 4OLAA 2AGOA 4CFBA 2FPMA 4OGEA 3ZSWA 3EYZA 3UIQA 3KD1E 2DPIA 3AVMA 1FK9A 5JS1A 1S1WA 4GC6A 4UQGA 4I2CA 4CJKA 5HRRA 4W5QA 5I3UA 1DGSA 4Q8FA 1NK8A 1C6VA 3V9ZA 1RCHA 1BPDA 5IIMA 4ECTA 2LYHA 4CJSA 3S3NA 1VSIA 3U3YA 1ZBFA 5J2JA 4RQ3A 4RNMA 1JX4A 9ICUA 4CHZA 3L2WA 4UB5A 1S77D 4ICLA 3MR3A 2EX3A 3VQCA 3MFIA 8ICQA 4NYFA 3QO9A 1XO1A 1B9DA 4KMUA 1EETA 2ZE2A 4FJIA 4C8KA 5IINA 4YFUA 4I2DA 4PA1A 4DQQA 3ZDDA 1QLNA 1X9SA 1CXUA 4AHCA 4FZZA 4B9NA 1GOCA 3VQ5A 3AO2A 3KLFA 4BE0A 4W5RA 2XC9A 4OLBA 1ZQKA 1B22A 4F50A 1BVSA 4OGCA 2P5OA 5DLGA 1UA0A 4TUQA 1ZQPA 4M9JA 1VRTA 1JLCA 5IIIA 1WSHA 4YMOA 5KG1A 2IS3A 4TSXA 4R8UA 4CGGA 5KFTA 2DY4A 3MECA 4DLGA 2A1RA 2Y1IA 2OZMA 1KFSA 3DI6A 3MEGA 4UBBA 4UB4A 4CHNA 1KSPA 2AQ4A 4RZRA 5C5JA 3P1GA 4ED0A 3ORYA 3AVAA 2XGQA 3ETLA 4RQ8A 4ELVA 1ASWA 5HMMA 1UT5A 3HT3A 3PNCA 1WSJA 4ELUA 2JEGA 3WNHA 1QTMA 4AHVA 1SV5A 4YR0A 3DRPA 1ZBHA 4QWAA 3ZT2A 4F2RA 4FS1A 1BQNA 4L8RB 3KIOA 1LAWA 4CGFA 4IQVA 3MEDA 3PX6A 1U4BA 4XQ8A 7ICTA 2P1JA 3S9HA 2VWKA 3VQPA 1UOCA 1IKYA 4FJ8A 9ICOA 3V9SA 4HHTA 3SYZA 4QW8A 5HP4A 4YD1A 4KHWA 4LH5A 3OHBA 4ELTA 1W9HA 2ZJ8A 1VSJA 5DB8A 4CGJA 4N41A 4F8RA 5KFXA 4Z6CA 3U3GA 1L3UA 2DFFA 4DL5A 2ASDA 5J2CA 3CM5A 4DL6A 3K5MA 4KTZA 3QINA 2HNZA 1N5YA 1S0NA 4NM1A 8ICWA 3B0YA 4J9MA 3FFIA 4DTOA 4KI4A 5J0QA 1MSWD 4CF8A 4CIFA 3TABA 3DLEA 1JLEA 3K4GA 3PW7A 2P6UA 1NOZA 3PX0A 3OYAA 3NCIA 5KG6A 1HNVA 1JXBA 3SQ0A 3RJIA 1JXLA 4F4WA 4HVJA 2G8VA 1TL3A 4QZCA 2WTFA 3C23A 4QZ9A 3N4MB 3L2QA 4QWEA 4YD2A 4F5PA 2HNYA 5TZVA 3MBYA 2A1SA 2OPPA 3DLRA 1ZQVA 4B08A 1JL2A 2ZUDA 4Y1DA 1DLOA 1S10A 3H8JA 3ZDBA 4CE9A 5J0XA 4CHYA 3K2PA 5CR0A 3U6FA 2F1IA 4GXJA 4XA5A 2RDJA 3PW0A 3OYLA 3V4IA 3PVXA 3V6DA 4E0DA 3H4BA 4KHUA 3AO4A 4HUGA 3QLHA 5HHIA 3MGIA 1NKBA 4XUSA 1Z26A 5J2BA 4B9TA 1ZBUA 4JV1A 4CK2A 1RTJA 5KGWA 3H08A 1T4GA 5J2EA 3RJGA 3VA0A 2BDPA 3FYHA 4FJXA 4NLKA 5KG5A 4RT2A 3G0ZA 3TFRA 3SI6A 2VWJA 5DBAA 4F5RA 2FBVA 2YKNA 1PZNA 3V1QA 3G6XA 4ED6A 4RT3A 2M9NA 3CG7A 4DSLA 4I2IA 4R65A 3SJJA 4ECWA 2BCSA 3MEEA 1ITGA 2WOMA 2VG7A 4IFYA 1ZQEA 1T05A 5DG8A 4RQ2A 4DTPA 4F4ZA 4MFCA 4MFBA 4KITB 1TV6A 1BIZA 1RPLA 9ICTA 4CJQA 3KKSA 3M8PA 4KHYA 8ICEA 3A2FA 5KFVA 3CFRA 4KPYA 3ZDAA 3K5OA 1CEZA 1TL1A 5KFJA 2IBKA 3GILA 2A1JA 3DM2A 3DLKA 1C0MA 4GC7A 4R8UB 5D3GA 3GFKB 1J54A 4QZBA 4YNQA 3ZSZA 1UA1A 3M9MB 3NF7A 4KFBA 3IAYA 1S9EA 1BPBA 4JV2A 3ZSXA 1I39A 1KDHA 2BCRA 1VRUA 4FJ9A 4Q5VA 1C0TA 4KLQA 4E19A 1Z25A 4NM2A 4F4YA 4KAZA 3RJEA 1BL3A 1W0HA 7ICPA 3VA3A 2F96A 4QOZB 3AVKA 4Z0UA 1C7YA 1BCOA 1BQMA 4DL2A 2GWSA 1GOAA 1TAUA 4FZXC 4IDKA 4KHQA 4ECRA 4QZGA 1IO2A 3ZDCA 2ZTEA 3DLGA 1T8EA 4KLOA 5HHHA 5DQIA 1ZQSA 1X1PA 3Q8SB 4R5PA 4LZGA 4R64A 4F4KA 2BGWA 1RT6A 3NH1A 3NDKA 4DQIA 1NOMA 5CHGA 4F3OA 1VSKA 4EP4A 3RBEA 3TFSA 2MUTA 4HYKA 3OSPA 3T5LA 2PI5A 3ZSYA 1FKPA 3EW9A 4H4MA 4NLNA 1BPYA 2YNFA 3FDSA 2XO7A 1H38A 4CEBA 2JGUA 1XHZA 9ICVA 3VQDA 1JN3A 4GXKA 3EY1A 1IM4A 3QNOA 4KI6A 1JIHA 4HCCA 3PR4A 4O44A 3MR5A 1Q9YA 1HQEA 4KKOA 2WONA 4E7JA 4I2AA 2ZUCA 3NGZA 1IG9A 3OJSA 1REVA 4QZFA 3RMAA 4H4OA 3JPQA 9ICKA 3AVIA 2BKEA 5DDYA 1ZQTA 3PMLA 4OKEA 3ITHA 4I2FA 9ICBA 1HJRA 4AILC 3SQ1A 5L1IA 4KN7A 1CLQA 5J0RA 4C8LA 3QESA 3TAGA 4F91B 5I42A 3C21A 2W9AA 4CEFA 5JS2A 3LP1A 3L2RA 4DOBA 3WNGA 1HYZA 5DBBA 3SUNA 2PFPA 2PY5A 1NK6A 4NY8A 1ZQHA 3OYMA 3Q8KA 3UQ0A 3ULDA 4NCGA 5CZ2A 4WE1A 3AU6A 2J6SA 2P51A 4UB3A 4DQSA 4MEXA 2V4QA 1QS4A 1WLJA 9ICRA 4J2EA 5KFQA 1Z3EB 5KFZA 1XC9A 2HHVA 2NRTA 1C1BA 4PGYA 1NJYA 1TAQA 2C22A 5HRPA 3HP6A 4IKFA 2FPLA 1EP4A 1ASUA 3TR8A 2I1QA 3GIIA 4CGDA 3RB0A 1O1WA 4RW8A 4I2GA 3AA5X 5HRNA 4E7LA 3DRRA 3BQ2A 1COOA 3ZDEA 1LAVA 3QEXA 1ZQYA 5HMLA 3QZ7A 4QZHA 3KLIA 4E7KA 3VQ9A 4P2HA 1A77A 3HYFA 1CZBA 8ICJA 4M42A 3T5HA 2V9WA 4DFPA 3M9NB 3QETA 3JPPA 3F9KA 4DOCA 2IHMA 1S1UA 1B9FA 3MR2A 4MQ3A 3RB6A 1TK0A 4EZ9A 5CWRA 5J2KA 5FDLA 3AO3A 3NFAA 2JEJA 7ICSA 3PMNA 3HPGA 3ZSQA 1HUOA 4PWDA 4M9NA 3PUFA 4QZEA 3SCXA 2G8FA 3OS1A 4FO6A 2PFOA 2YHBA 1K1QA 5CP2A 2UVVA 8ICVA 1ZJMA 4M9LA 2F1JA 4DOAA 2PZSA 3B0XA 4FJJA 1J9AA 2DTUA 4CJWA 3TANA 9ICAA 7ICGA 4CJ4A 4CJRA 4RQ7A 8ICNA 2VA3A 1MQ3A 4AHUA 1KCFA 3HW8A 3HM9A 4FM0A 1CZ9A 3OYKA 4ZTFA 2ATQA 4BXOB 3NF8A 3Q8LA 3EWAA 1WAFA 4IR1A 3LZJA 3JPNA 3K57A 2AGQA 3ZSOA 3DOLA 3C6UA 1U48A 3BQ1A 1RILA 1TGOA 1YTUA 4RPZA 1VSMA 4ID1A 4B9VA 3T1AA 1XI1A 1K1SA 1R0AA 5KT4A 4DSEA 3SUQA 8ICSA 1FKOA 1T7PA 5J2IA 4KLIA 2FMPA 1TKXA 1HRHA 4EYIB 3DYAA 2C28A 4UAZA 3HO1A 3JSMA 1KTQA 5J0PA 3QIOA 1BPZA 1A76A 3V9WA 3C95A 2FLPA 1S1TA 3MAQA 9ICXA 3PO5A 1J53A 9ICFA 8ICMA 3K58A 1IKXA 5J2PA 3CQ8A 5DDMA 1LWEA 3RAXA 2NUBA 8ICOA 1RYRA 2DPJA 2MUTB 3HK2A 4DF8A 4Q0BA 4DQPA 2HHSA 4CFDA 3VQ7A 4I9QA 1TFRA 2XHBA 1Z00B 4UB2A 4F5QA 4DFKA 4OPKA 3TAEA 4I7FA 4JRQA 4J9PA 1L3TA 3SV4A 4NYNA 3DLBA 3CYMA 4W5OA 9ICLA 2ETJA 4RW7A 2HHXA 5IIJA 4Q44A 1JLAA 1RXWA 3VQQA 1XHXA 4N5SA 3HXMA 2Z1HA 1LW2A 3B6OA 5J0UA 2X74A 3KK1A 3PW4A 1U47A 5EWFA 3AVBA 4K8ZA 5K14A 1NJWA 1LWCA 1JL1A 4QCLA 4DS4A 3E2EA 4CHQA 4M2YA 4JLHA 4ECXA 1ZBIA 5BOMA 1RBTA 3H4DA 1WSFA 3C1ZA 3BGRA 2XRIA 3AVFA 4CCHA 4LH4A 5J0TA 4XRHA 1XSLA 1DTTA 3T19A 3HPHA 2RDIA 3RR8A 2AJQA 2W42A 3L3UA 2MAXA 2UVUA 5KFMA 3KKRA 4CHPA 4C8OA 4PPXA 3RRGA 5HROA 3LZIA 2RPIA 1ZQLA 8ICCA 2X6NA 5DG7A 2BPCA 1TKDA 4OKJA 3NTUA 4ECUA 1EXQA 4IBNA 1LWFA 4RPXA 1VSFA 4NCAA 3KHRA 2B5JA 3KHHA 5DBCA 2FBTA 1ASVA 4DSFA 4DTJA 4DO9A 4FLZA 4FBTA 1S0MA 4QZIA 1RDCA 1ZQIA 3KHLA 4CJUA 1RT2A 5FRMA 3UQ2A 4ZH4A 3E01A 5L1KA 4K4HA 4O3QA 1ZBLA 4Y1CA 7ICFA 4CEDA 1ZQJA 3LDAA 4KN4A 3AVCA 3SI8A 2PYLA 5J2GA 3OYNA 1N48A 4FK2A 4ZHRA 5KG2A 4PHAA 3M9OB 1VSLA 2BE2A 5L9XA 4PGXA 4O3OA 1ZQAA 2HNDA 2XCAA 1TKZA 3H8SA 3OS0A 4BDPA 2P6RA 2HHTA 1K6YA 3GQCA 2BR0A 4UB1A 3EPGA 2KQ2A 3JPRA 3KK3A 1BPXA 4FS2A 4FJNA 4MFAA 3OYHA 5BOLA 5EWEA 4RQ6A 4I2BA 4P4OA 2BCVA 3OYEA 2X6SA 1Q8IA 4DSIA 4CIEA 1RNHA 4ECQA 2VANA 4KLHA 2KZZA 4JWNA 3DOKA 4DTXA 4C8NA 5JUMA 1KLNA 1MC8A 1KFDA 4O0JA 1A5WA 5DQGA 1WAJA 1RXVA 4J9QA 4EBEA 5J0SA 1EKEA 2FBYA 2I9GA 5KG0A 4I9LA 4FLUA 4M3UA 4TUPA 3ZT4A 4LZDA 4PHPA 3QE9Y 9ICGA 2KW4A 3LP0A 1JLBA 5KFYA 3ASMA 2YHAA 1U45A 4B8CA 1QE1A 4CECA 3TARA 8ICZA 2BANA 3VQAA 4RQ5A 1SUQA 1BI4B 4CEZA 3BQ0A 1JLGA 1ZYQA 2NRVA 3SNNA 4BDYA 4FW1A 3PY8A
chains in the Genus database with same CATH superfamily
3MF5A 3R8EA 3JS9A 5ALUA 2V2ZA 5BYRA 4DUYF 1N8RO 5E41A 2UU9K 2NYIA 8AT1B 2WAQC 2EFNA 5GAGP 2EAOA 4DL4A 1JK9B 4O8UA 5HQMA 1XMQF 1VK0A 1LK5A 2JVOA 2P66A 4W5NA 4EWTA 4B9QA 2CPZA 2QC3A 5B8HA 2JSXA 5AQXA 2DL0A 1FVQA 2RN2A 4JI4J 3SFGA 5KFRA 2M4MA 3VEZA 1B92A 1JI7A 1WHYA 1NDCA 3THVA 5E3PA 4Q2MA 3VGLA 3V72A 4DV5J 1DEJA 5CA5A 1KXPA 2JEFA 4ZVQB 1AB8A 4P2SA 3KK7A 3DRYA 4PHEA 1T3NA 4UAUA 1XTZA 2P9NA 2XI3A 2CQPA 4CZIA 1C0FA 3Q83A 3ISZA 2GH1A 3ETRA 1N5QA 3NVWA 3BGRB 1Y7PA 2QA4N 7ICMA 5D0EA 4K41A 2KRRA 5JVGL 3C6TA 3PZPA 3WK6A 2F8MA 2BX6A 1WCLA 3GJRB 4RPYA 2BCUA 3MM8B 2IJNA 1I1GA 2XMUA 4PH5A 3KUGA 9ICMA 4FW2A 2ZD1A 5HROB 2W2NP 1RBUA 5A6WA 4ES3A 1NI3A 4ILLA 3BQTA 2OPQA 4Z4CA 3NGYA 4YQWA 2RSQA 4KLMA 5AXNA 3FZKA 3RJKA 5KOWA 5LJ5Y 4ECYA 3LAKA 4CFAA 4C4SA 5A8WA 1NNLA 4DPWA 2XY5A 4USAA 1YKWA 1DQAA 2KNJA 3TR5A 3PSIA 1NDLA 4Y2QA 4JI8J 3HHLC 2KM8B 3AAQA 2RHQB 2YBVA 2XIDA 4ED4A 3A5NC 5MAOA 3G9CA 2JFDA 4OZ3A 3CF5Q 1S99A 2V50A 5ADZA 3N4PA 3HFKA 3Q23A 2G8KA 1ZQMA 3FRZA 3OTQA 1U26A 2E2PA 1ZXOA 3Q7BA 5J29A 2W9MA 2OSRA 2N3LA 3TAPA 2P8IA 4E1NA 2CQ1A 4F3QA 3CCWA 3P4IA 4UZCA 2ZJRQ 1JXEA 2G06A 4I6YA 4F5NA 3NE6A 2R7RA 1UCNA 3TUJC 2I5HA 3K5NA 1YVFA 2QWLA 1NK9A 1XSNA 2IDOA 2XLJA 3M8SA 5GIOA 4EEKA 1S9FA 2W2OP 1T9XA 3KLHB 1X2IA 3O8MA 2FDNA 2JL9A 2Y0SD 2EHGA 3O44A 5AQZA 2JMGA 1DRGA 4PG8A 1KLMA 4ED5A 3EVWA 5KFOA 3TAMA 1NKEA 1LXNA 4DR3F 2E1FA 1RHRB 1MWQA 5ALJA 2YNIB 3VTIA 2J5AA 2KKHA 4XTTA 4PL1A 5DGBA 4MKBA 3MZIA 3CCVN 4CHOA 2F8LA 3MR6A 3OGUA 3C66A 2HMXA 5IXUA 4QW9A 2HOEA 4CDIA 2C2EA 2MU2A 5CCMA 3MCSA 3T5KA 2FMQA 4ZP7A 3OLBA 1R8HA 2VF3A 3K75D 2UVRA 4JV5J 4W92B 4QZAA 8ICXA 2AF6A 2HHHK 4JI7J 3WQUA 5ALFA 5AXLA 2UUAJ 2XYPB 4B3MK 2D69A 3GMGA 1CS4B 1NEEA 1I5OB 5J0WA 2CPEA 3DDKA 2B8QA 4CJEA 4JHDB 4FZYA 1LFWA 2OCEA 4ZK7M 1NK0A 2ZIVA 1BGXT 3NH2A 1SGGA 5DB7A 4BVPA 3BPSP 4OPAA 2MY7A 2XMJA 4V1Ak 1Z6RA 4FJKA 1VYAA 3KJVA 2P9LA 3F56A 5AM4A 1VAZA 3ALRA 5M1KA 2D74B 2J6UA 4IG3B 2ERRA 3AJDA 3VGMA 2RD5C 2MQMA 4X66F 4JK9A 4LF8F 1VMBA 2C3UA 2PGCA 2GQQA 2V63A 1N56A 4NZ6A 2E2OA 1NMNA 4UW2A 1FRLA 4DS5A 4R63A 2HIYA 2FLNA 3W2WB 3V6JA 1LW0B 4QIGA 5AJ3F 4L74A 1TTHB 1UTAA 3SV3A 4G9ZA 2AJ4A 1HKAA 2KJ9A 4OI1A 4YN3B 1KQSR 3G96A 3GG4A 1WCNA 5I4MA 3SZ2A 1VQ5N 1YITN 5F41A 4H0VB 3EVOA 8ICHA 3VGKA 2W41A 5D49A 1ZETA 4IJAA 4KO0A 1YX2A 1XMBA 3HVAA 2R8GA 2CWKA 4ECZA 1A5XA 5ALLA 2FJVA 4OHXA 4NLBA 1WKJA 3X1LB 3LTOA 5A8WB 4M9GA 1EB0A 2RNEA 3H20A 1NJZA 3NOGA 4KRWA 3NGKA 3P39A 3PLAA 1GOBA 2WVBA 1MW7A 1DTQA 3V9XA 3FZHA 2HRUA 5E7OB 1WTFA 1A5VA 3M1FA 3FLCO 3TI0A 1EARA 2HLTA 1BIUA 3I0RB 5J1EA 2GUPA 4LRCA 4TQRA 4ZIVA 4B3TF 1NHKL 2BQRA 1I51B 4DQ8A 2JLEA 2E1CA 1B3TA 4DR5K 4ETZA 3DMJA 3LDSA 1IIPA 4X4OA 2V9KA 3OR1A 4LBPA 2MKHA 4DOZA 2XSJA 3KWMA 1QSYA 2DKOB 4FVMA 2G0IA 2AT1B 4YP3A 1M5PC 2KDOA 3IR7B 5CY4A 2KG0A 2WB1D 5HBMA 1KAYA 1QSSA 1QHTA 1ZPWX 1PJ7A 1X9WA 3R2DJ 1NPPA 2FVRA 2G8WA 1KLMB 3KLEB 5KG7A 4P0QA 5J2HA 4FBUA 3AVHA 3I96A 3P5JA 2FLLA 3EM1A 1HNWK 3WKEA 4OPJA 4L76A 3ED5A 3QEIA 1HKGA 2KRBA 1N34J 1P9QC 4B1ZA 2R2TA 4NLOA 4FF2A 3H2VE 4G1QB 1Q81O 2Q3PA 2A40A 4O5BA 1RWVB 3SQ2A 3IA0A 3FBCA 4CE6A 5FPMA 4CIGA 2I6WA 4ECVA 4I2PB 2BQUA 5B0AA 3TAQA 1VQNN 5J8YA 1JROA 1HJPA 2PFDA 4IQUA 3BN7A 2IBOA 3K0JA 4DV1J 4OI6A 3GYNA 1FE0A 2AU0A 5M2PA 2OAUA 4F72A 4FSVA 1Q86O 2D3UA 3K89A 3FQLA 4OI2A 4PQAA 3G6ES 3RZAA 5L1LA 2ZOGA 3TP2A 1AROP 1SV0A 2P9KB 2QEXS 4AHTA 2ZIVB 2WBMA 2DKZA 1RT3A 3AVLA 3H8WA 1DJ0A 4N76A 1D9DA 3AO1A 3OVNA 1F3VA 3N97B 3KJVB 1JLFB 3B8AX 3PEJA 3CJAA 2OXOA 2ROGA 3D5MA 3NGRA 3KK2B 4QWCA 1UCVA 5F1XA 8RUCA 4PUOB 1CULB 4A8WA 2QWMA 2IMWP 4UAYA 3LWMA 2DXDA 2VG6A 2OLWA 3N7SC 3K17A 2AW0A 4CNQA 2O8BA 3IM1A 4E3SA 2GC8A 4Z4FA 3CQYA 1NCLA 4EHTA 2H9ZA 4CGIA 5ALMA 5LOQA 7ICVA 4UB6U 2WHOA 2BZ2A 1RBAA 2UVWA 4KH1B 3CCMS 4IH5A 3H2LA 4Y3CA 4B3OA 4TN2A 1HNZK 3I8DA 3ILIA 5HANA 3VEYA 2IOCA 2IAJA 3C14A 1NGAA 4CWBA 1IKVA 4JKGA 3QBXA 2O8FA 4LF8K 1N6QA 2ZM6J 1S1WB 3FZLA 3N6MA 1F5CA 4O3MA 3UDCA 3CQXA 2OJ3A 2DY9A 4JKCA 4KLGA 1KFTA 4QR1A 1Q3VA 4M3YA 1TVAA 4JKEA 3NS1A 3ZT1A 3OYGA 3PFOA 1ZPVA 2PBDA 1IG6A 3MMBB 4EX6A 4TY8A 3A5MC 4F5OA 2J4RA 4U7BA 4ED8A 4WBFA 2GO7A 1NDPA 2HSTA 2HRYA 2MKYA 2M3DA 1XNSA 4JKHA 3QO9B 2ATLA 2DRAA 3FCWA 4DCJB 4Z4HA 5ALRA 3M7VA 2FBXA 3QFUA 1RDAA 3DWLA 3I4HX 2NSBA 5CA7A 4C7QA 1GMWD 2W43A 1YGYA 3ENVA 2K8CB 1RDUA 4NXZA 4BY9C 2DR9A 3NHGA 1GMWA 5ALNA 3NGDA 4DFMA 1GLEG 1VRTB 4LREA 1GFWB 2B6AA 4BG9A 4BRDA 4QZ8A 4WYBA 5THWA 1FVSA 3O4QA 4OJOA 2LQ5A 4GKJJ 4GLXA 1CXQA 2AMCB 2RUSA 1UW4A 5JVHL 1IJEB 5A8RA 1KL9A 1OH5A 2MRLA 2ZTCA 4P0QB 5AE2A 1WEZA 2NSCA 4J9NA 1S76D 2QI2A 1U04A 1O0PA 3RR7A 3G25A 2GQCA 3QU2A 2KFNA 4CEEA 5T7BA 1VQMS 2UXBJ 1L3SA 1H7XA 3BREA 3SEIA 4YR3A 2MTLA 4ED2A 5GMKa 2K8GA 1ZQGA 2LQ9A 4DUZJ 4ED1A 4HDHA 3IWXA 3KYLA 3JYTA 1B4SA 4KLFA 3O0FA 3CJSA 4NE9C 4AQYK 3R6GB 1COKA 1HPZA 1IKYB 1FDBA 2GAGC 5J0YA 4XIUA 2PMHA 1X4FA 3D3BJ 3RB4A 4NPOA 1UEUA 1B99A 4ZDNA 5B0DA 1F44A 4I27A 2GFFA 4JI2F 1B64A 1FERA 1OPIA 4KHSA 4Z7YA 2B9EA 4R66A 2Y8YA 4B1XB 3JQKA 4B3SF 4DR4K 4Y2CA 3FFIB 3FZ2A 2M70A 3D2QA 3HOTA 3CJKA 3BSAA 4PG5A 3RB3A 4IRKA 1OUQA 1FD8A 2VG6B 2DFHA 1Y10A 3GIJA 2OFHX 3OA9A 3ENQA 4H0XB 1KBRA 3LK9A 5KFWA 2HMIA 2O8BB 2XY8A 2QFJA 1NK4A 2KG5A 3AUOA 3O3FA 1C0GA 4FJ5A 4EBCA 2DNLA 4P72A 2DH7A 1U6ZA 1NGFA 3CFPA 2I0XA 3G82A 3QU7A 2YQEA 4FZMA 3KG0A 2QXLA 2HNYB 4OX9J 5IILA 1OS5A 2V8PA 3F53A 4H0PA 3FSYA 3OFEA 2FHMA 2HHQA 3BUZB 4A48A 2G8IA 3UVJA 3MN9A 1L3KA 2Z1GA 2RAQA 1HJOA 3WNEA 2IAJB 5DK5A 3AOBA 4ZVFA 7FDRA 3PR5B 2FYXA 4AUKA 5HLFA 1WOPA 1XR7A 4BVOA 1SQGA 2ZBPA 2HCFA 1H6KX 1N8RT 4JD2B 3ZTSA 1RU1A 3U7JA 4BC5A 4YOUA 1ZOLA 4LF9K 2AWZA 5SWMA 2HVZA 4NRTA 3T6JA 2MKKA 3CDUA 1KVAA 2ABYA 2QT7A 1UFLA 4YR2A 2A3VA 4PYDA 2FY1A 2BOPA 3KDNA 3SQIA 4OYAA 3CJ2A 2BPGA 4U9RA 3WT0A 1JNRB 3WK8A 4PRFA 2ZNZA 3ZT3A 1U49A 1KN5A 5KFCA 4ZJLA 3QRRA 3IBWA 3MDQA 1GK8A 2O8EA 1Q18A 2AV5A 1RAFB 1D9FA 2BUNA 4C1NI 1R8BA 3UXNA 3AQPA 2KKZA 3DRSA 4DPYA 2KHCA 6FD1A 1NSPA 4RLEA 1BHLA 1PVPA 3MEEB 2CDRB 4OIXA 4QU7A 3QXGA 2VG7B 1KQSM 4KTWA 5GADP 3DKDA 4PHDA 4HUFA 4NEYA 4NMLA 1OMSA 2MYFA 2VH7A 1NXIA 3TX0A 1Q9XA 4LF4K 4OYOA 1QQOA 4DLEA 2F3NA 2B6AB 2VQFF 2F40A 3AB4B 3DLKB 1OSCA 3EGZA 4DN9A 3W2VA 1QVGR 5EE0A 3DU6A 4MFFA 3PO4A 2OH2A 3CJ8A 2HS4A 5KT7A 3B6PA 5GAGU 4RW4A 2B4UA 7ICUA 1JJ2R 3FR0A 4Z4EA 3O3HA 1B7YB 4KFBB 4O55A 1VQ9S 4O5FA 3D54A 4CJFA 1CLFA 1HD1A 1M0SA 3HI0A 4DSKA 2LA6A 1T44A 3MM5B 1Q8BA 3AOCA 2V7YA 4DMZA 4FKYA 4KHMA 5JS1A 3AJ2A 2QO3A 4EK2A 3T1YK 1DQ9A 2P9EA 4UQGA 1I94K 2APOA 2NXUA 1BQMB 5HRRA 4W5QA 2RS8A 2PA3A 1NK8A 1C6VA 3OTDA 3V9ZA 2Z8QA 1RCHA 4NXNJ 1VSIA 1ZBFA 4RQ3A 9ICUA 3L2WA 2FHOB 4UB5A 1S77D 2E44A 4X4VA 5HSPA 1WNEA 4JYAF 2ZH8A 4KT0C 4ILJA 5E3CA 4ZVOB 2MJUA 1DK3A 2GWJA 4C8KA 1FFVA 1TAMA 1QQ7A 3FBFA 2ZBIA 4DQQA 3ZDDA 2QV6A 2YHWA 1KQFB 3W5YA 3VQ5A 2MGZB 2D3O1 1RGVA 4W5RA 4OLBA 3F5AA 3PYFA 4F50A 4MKVA 2F4VK 1ZRNA 4QJVA 2A3JA 1UA0A 1SH2A 1YRXA 2DHGA 2A2CA 2MZTA 1HQEB 3Q24A 4KKOB 2WONB 3HOSA 4DPOA 2AA4A 2IS3A 3MAAB 1L7MA 4WQ4A 1KR4A 1ZD5A 1UEVA 3CDBA 2FC9A 4UTGA 2PMZF 1VBZA 2E8AA 5AQQA 3A0BU 1YVNA 4TYAA 5I42B 3AVAA 2XGQA 3I33A 4ELVA 3JSYA 4USJC 1WWUA 1UT5A 1X7VA 3CCUN 3SCJE 1G99A 1WSJA 2J7UA 4Y2JA 3IG8A 4YR0A 3AY0A 3GJQB 4F2RA 1IR2A 1J97A 1BQNA 3TEGA 1FIQA 4DV3J 2QN6B 1WHWA 1LAWA 4IQVA 2W7OA 1UVNA 1W7WA 5AKYA 3LL3A 7ICTA 2P1JA 1V3RA 3VWSA 2CQ0A 2V2KA 2K3IA 1BA0A 3MMAB 2Y8WA 4HHTA 3DGPB 2UUCJ 4JEPA 2D1KA 3DRRB 4YD1A 3I55S 2OTJN 1X42A 4JAXA 3AY9A 4N41A 4F8RA 2H4WB 2ESEA 1L3UA 3ZNJ1 4DL5A 2DFFA 4DR1J 3M30A 3D2EA 3TVZA 2FC8A 4DL6A 4FZVA 4OHZA 4DBQA 2FQQB 4CM0A 2H4YB 3PG9A 3H0RB 1YRUA 2V8VA 2VBZA 3DRSB 4LFCK 5GTHU 4CLWA 3FEYB 3NNCA 3MPWA 4X64F 3NWGA 2AEJA 4CIFA 4CQ1A 3L95X 4QZVB 3DLEA 4WP3A 2O8DB 2DGQA 4MHVA 2HQIA 3U1LA 2ZH7A 5ALXA 1VQ6S 1N36F 2PAVA 2RIJA 2VICA 3HULA 5KG6A 3WK4A 5B5EU 5AQLA 3RJIA 1JXLA 3W65A 2UXDJ 2OFGX 3C23A 4A61A 3N4MB 2X1FA 4F5PA 2OPPA 4B08A 3NVKA 1KVJA 4LFAK 2EAPA 1JL2A 2RHFA 3AQFA 1EHWA 4ES2A 4GKKK 4RBTA 3R9PA 2K60A 3H8JA 4CHYA 3CD6S 4EMDA 2NPFA 1NGHA 3U6FA 3V4IA 2YVSA 3V6DA 1TU0B 5D77A 3HZEA 4KHUA 2EC2A 3OR2A 5HHIA 5JTIA 3CD7A 1UFKA 2EW9A 1Z26A 1R0AB 4LF1A 2QGFB 1XNQF 1Q4RA 5AK5A 3UCUP 2DK2A 3H08A 4PKDB 1YXQA 5J2EA 4NL9C 3RJGA 2BDPA 3PSFA 4FJXA 2E5LK 1V85A 2YQ1A 3QFWA 3JSMB 5KG5A 4RT2A 3CDWA 1RK8A 3CCEN 2FBVA 2YKNA 4TY9A 1NUEA 4X65F 3G6XA 1KVIA 2E2QA 3TTDA 3CG7A 4R65A 1PJ6A 3SJJA 2ZH5A 2WOMA 1GX6A 3UKUA 1ZQEA 2DXFA 4QYRA 4KITB 3OW2R 5LJVA 1PG5B 4CJQA 3KKSA 3WK7A 8ICEA 4KHYA 2Q43A 4KPYA 3A8YA 4I7FB 1CEZA 1TL1A 3IRWP 2DNGA 2F7VA 5HR7A 4RW7B 2HGNA 2A1JA 1PGZA 5IQ6A 4GC7A 3DXMA 4DUYJ 4FF4A 3GFKB 5IOLA 2WSFC 2VCPA 1D9AA 3ZSZA 1MDUB 1QAYA 2BACA 4USWA 3KK1B 2DVIA 1XMQJ 3S01A 4CLFA 1S9EA 1YBUA 3D2FA 5AKHA 2B43A 3ZSXA 4MK8A 2G5IB 2EI5A 4FJ9A 1RWNB 4KLQA 2G2ZA 2H54B 4QS9A 1W0HA 1Y3KA 3VA3A 1R0CB 1DXSA 2M7SA 2F96A 1HR0K 2XICA 3QT8A 2CJBA 1Q78A 3NL0A 1ZA2B 3ZZZA 2E8MA 4BRKA 3QYPA 2IOFK 4ZS6A 2AX1A 1FD2A 2W1BA 5CHIA 3ULEB 3VF4A 4BRAA 1Q86T 1P1LA 4RL1A 1IO2A 3WXMB 3EKUA 3DLGA 3D3CJ 3H7HB 4RJVA 5AQWA 2YY6A 4KLOA 4WK1A 1NBWA 5A6PA 5D0RA 3Q8SB 4R5PA 1FFUA 1O13A 4LZGA 2VOPA 2CQBA 1Z2LA 1VQ5S 1D3WA 1YITS 2K1RB 3PRDA 1VSKA 1KHVA 1WEYA 5LXYA 4LFBK 3O4WA 5F8MA 2KFYA 4J03A 3TOQA 3D2EB 1FRIA 1BPYA 4FWMA 4JKAA 2DNPA 1H38A 1U1QA 5BR8K 1T9WA 3VQDA 3EY1A 2V8DA 4RBVA 4KI6A 4B17A 4L3QA 4YS2A 3MR5A 2WAQF 1GXUA 3MMVA 4I6AA 1IBMK 2HQ3A 1SKUB 2BTFA 3IBCB 1IG9A 1CZAN 1FJ7A 3AD7C 1NPRA 3M6KA 3J7AN 1P9YA 1UVLA 4DXLA 1CVJA 3QDKA 2BA9A 5L1IA 3W7BA 4C8LA 3TAGA 4EGLA 2RQMA 2XTJP 4PEOA 4CEFA 3LP1A 4C0HA 1WUAA 3DXKB 5CD4H 4CZMA 1VIOA 2LM1A 1EAYC 4BR0A 3VMFB 3ZX3A 1UMJA 4PZNA 5E2QA 1YZ7A 4DZDA 3EE8A 2YKOA 2GCFA 3UQ0A 2CJQA 5FPNA 5CZ2A 4X64K 1K8KA 4WE1A 1WOOA 3AU6A 2J6SA 4A8EA 3MWPA 2V4QA 1MG7A 2EBEA 1X4HA 5TKWA 4AF1A 4IOCL 3B4DA 3V4IB 1Z3EB 2W54A 2E1AA 4IO9L 3BR8A 3V6DB 4PGYA 3WEEB 4WF9L 1WC1A 1YJWN 3OR2B 3FC4A 3UI3A 3HP6A 4IKFA 4OV1A 4DR6K 1PAUB 1TE2A 3O1LA 3M05A 4JI1K 1N33K 3R5DA 3RB0A 4RW8A 1MROB 2V67A 1WJ9A 5ALGA 3POTB 4DR3J 1H98A 2R9LA 3QEXA 4J5OA 3QZ7A 1TFYA 1KS2A 1PC5A 4QZHA 2LYBA 2ZG6A 3C28A 2HSEB 3KLIA 2ZC4A 3VQ9A 4A8XA 2ACYA 3HYFA 8ICJA 4J9UE 3D66A 3H6EA 5M1PA 1SUQB 2V9WA 1VQ4N 3GR1A 2J76E 4DOCA 5KPRA 4N77A 4RNHA 1B9FA 4K4TA 2D3OR 1K8AT 2GAHC 3W0LA 2WOMB 2G0JA 3THYB 2Z7JA 2A19A 5J2KA 3AO3A 2GWKA 2JEJA 4K50A 3FQKA 3HPGA 1HUOA 4KBOA 4M9NA 1TL1B 2ADBA 3SCXA 2G8FA 2GX8A 1B4FA 2HBYB 4K4YA 1K1QA 1TL7B 5CP2A 5DM6L 3DXMB 4XK8C 1BQXA 3DFEA 2MZQA 2DTUA 1J9AA 4B3RF 2P9IA 4NV0A 1HBNA 3WBZA 5J2QB 4CJRA 2VA3A 3K8WA 4P74A 4AHUA 3D2FB 1QVFR 4FM0A 1CZ9A 3OYKA 5T41A 3NF8A 3EZOA 3IR5B 3BB5A 4CF4A 2OPRB 4X66J 1XR6A 4V19X 3ZSOA 3DOLA 5T7LB 5CD4A 4LF8J 3BO3A 1YTUA 4PXCA 2E20A 1UWAA 3QMLA 4ID1A 3T1AA 2KXNB 4OZ0A 4LVNP 5KT4A 4DSEA 1S6UA 4BRPA 5J2IA 5AJ3J 2I5JB 1H2TZ 2FMPA 2A41A 3GLJA 4EYIB 2C28A 4UAZA 2YN4A 1KTQA 3QIOA 3DLGB 1T3VA 1ZM3A 3V9WA 1RWMB 4HACB 1UZHA 3DC2A 1SJFA 9ICFA 5F0WA 1W7AA 4ZJQA 2QIFA 1IKXA 1RTIB 2RU9A 4X4SA 1AZSB 3CQ8A 3KZBA 2F8EX 8ICOA 1RE1B 2XMAA 2E5GA 2LP4A 2DBBA 1FXDA 5ALQA 4LSNB 2ZBQA 4Q0BA 3O9QA 4WFAL 3VQ7A 3EGVA 3Q7CA 2XLIA 1Q8KA 2XHBA 3O1WA 1Z00B 2PKEA 1XJWB 4UB2A 2K3KA 4WXOA 4DV0F 4DU7A 3SXLA 3TJAA 2E1ZA 1L3TA 3SV4A 3DLBA 4W5OA 2V2VA 4AT1B 2GTDA 3N4QA 4ES1A 2QWQA 2HHXA 1JLAA 2DD8S 3VQQA 1MMDA 5EE9A 4BQZA 2UXCF 5J0UA 2MKCA 3L4QA 1OY6A 1HBUB 1VCTA 3U1MA 2ZJPQ 4BRQA 1U47A 4H4KA 1F0XA 5K14A 4B3TJ 3HFZB 1Z4UA 1NJWA 1F9HA 1WWHA 2Z30B 1QCKA 3E2EA 4CBUA 3WKCA 5IM0A 4M2YA 4JLHA 4I0WA 3MPVA 5EVZA 1VQSA 1RBTA 2DEJA 2DF4B 4KY3A 4HHHA 4FWPA 1FDDA 5GAEP 4CCHA 3CMEN 4LH4A 2JRSA 2VHGA 1ZXIA 1K8KB 3ENAA 1RAIB 4QQBA 3RR8A 2OGUA 2MAXA 1ZH5A 2EWSA 2AJ1A 1RCOB 3O9SA 5H1SV 3DXBA 4NXMK 1Q0NA 2IFXA 3FMWA 2VDHA 4J37A 3C7NB 2D9PA 3RRGA 3BH6B 4USIA 4LBHA 1H7WA 3D0HE 2IVOA 2HBKA 1U2RA 4OI3A 1Z1ZA 4QJFB 5B08A 2MB0B 3IKMA 4DUTA 3FSIA 4ECUA 5KL1B 4FL9A 4IBNA 3NUQA 5DBCA 2FBTA 3KLIB 1W26A 1F9FA 2E7VA 3S1TA 1M5OC 1U0HA 4QZIA 1ZQIA 5I9EB 4IFEA 5KAKA 5CE3A 2CAJA 4ZH4A 3E01A 4K4HA 2NZ4A 4PJ0U 1G7CB 4IG0B 4CLLA 1QH9A 2WVDA 3MDFA 3LDAA 3SI8A 3OHRA 3WK5A 5J2GA 3FC9A 2WFBA 1N48A 3IDHA 4FK2A 1J5OB 1MMNA 2YKAA 3M9OB 4ZMMA 2R7UA 3BGFA 9ATCB 4AL5A 1ZQAA 3EO3A 2XCAA 3NS7B 1VISA 3NMRA 2HEKA 1B0PA 4OJLA 4W90B 2KI2A 2BR0A 3EPGA 4AYBC 2B56A 2P9IB 4KB7A 1BPXA 5ADXH 1HBNB 4U6PA 3RAMA 4K0KF 1S1VB 1ZM9A 1KBUA 4WZQA 1BWFO 1FHTA 3NMAA 4P4OA 2IVPA 3HBTA 3C15A 1GXLA 3LP2B 3OYEA 1O08A 1Q8IA 5GADU 4CIEA 1UW9A 1JRPA 4CIOA 4ECQA 2VANA 3DOKA 2VGMA 2B4OA 3DOLB 1KLNA 1MC8A 2QRRA 3RBXA 3UE5A 4RUBA 1KAXA 5GAGI 2KH9A 4KH4A 4I9LA 4PHTX 3ZT4A 4HWIA 4LZDA 4PHPA 3QE9Y 3LP0A 1N32K 1VLYA 4EENA 4HTIA 1QE1A 3AXKA 3TARA 5AE1A 8ICZA 1RABB 4FZLA 1CQMA 3KMSA 5A0LA 3VQAA 2BJDA 1BI4B 1ZA1B 3NP5A 3C65A 1D4XA 3PY8A 3A3OB 3O9UA 1NK7A 2I1RA 2CG8A 1KD1O 4JI4F 4KB1A 2CNNB 1HMVA 4J2BA 3P38A 1WBBA 3RMDA 1ESVA 2KKPA 2GELA 4FWQA 2CWXA 3N9UC 1H1VA 3CDAA 5D46A 5AE3A 2KN4A 3ZETB 3GCXP 2P35A 1VSEA 7AT1B 1KWMA 4U7CA 3HD2A 3NAIA 5DDPC 1Q79A 3CHWA 1JLAB 4EHUA 3S3OA 4P6QA 1XEZA 4FK0A 3BYPA 4UUXA 3BSCA 3OFHA 3N6NA 2BM0A 3HHNB 3DXSX 2OKQA 2B7BB 4BRHA 2W2QP 3SFUA 3GL1A 4QYZK 4DI6A 1MU2B 2VC1A 2GQ2A 3MMCA 3T1HK 1NB7A 1OSDA 2ASJA 5JLHA 4EEYA 2FHKA 5U47A 1RHUB 2EG1A 3E9PA 2H3FA 3CC7S 1DGJA 1UJ4A 3KUHA 4JUZA 1VI7A 3V1RA 1V9OA 3HZGA 4FYYB 1IBKK 5FRNA 2C1EB 5ADXA 3ISNC 1WELA 2GW8A 1RQNA 2IRUA 4O4GB 3CF5L 3IWNC 4FM2A 4KLEA 5BR9A 5D0HA 2W8KA 1DKGD 4FJMA 2EWHA 3SD7A 3RRHA 4JOUA 5HMZA 4R0JA 3QZ8A 2F8HA 1NZPA 1Z19A 1DRZA 1Q53A 1SJ3P 5BYQA 2NUUG 5CZXA 4FPAA 4ZN1A 2HZCA 2ZJRL 4YHHK 2GGPB 3HTVA 4IFVA 4LF6F 2HHWA 1J2MA 1WHXA 2EEYA 4JI5F 2KHOA 3R7NB 3M8QA 3HWTA 2ZUAA 1B43A 4E1JA 5KFBA 2IYIA 4H8KA 1RM6C 4UQTA 3QB0A 5J2NB 3S3MA 3E01B 3ALYA 1BWVA 2A1AA 4AHSA 1CRXA 3JQJA 2E88A 4CT8A 2PD1A 3ZSRA 3OJUA 2ZNYA 3N7PD 1JQGA 3HX9A 4WFNQ 4DJBA 3QEBZ 3AQOA 2E1YA 3RH5A 4JI2J 2ZIUA 1OVYA 3EUNA 2EC0A 3K5LA 4PGQA 3TO8A 2YNGB 1U9LA 3SMSA 2WAQD 1Z1VA 2VB6A 3KLGA 2RRAA 4B3SJ 2H3ZA 2VFSA 2NRWA 3U9ZA 2BEFA 4CTAA 1SAZA 4C6AA 3KWGA 3WZ0A 2RDDA 2MHEA 4M6WB 3GU0A 3WXKA 3A5LC 2RF2A 4ZTJA 4QR2A 4L72B 5A0YB 1U2VA 4RKUC 1SC6A 2YB4A 3OYJA 4BWJA 4H5WA 2L48A 1HFEL 1S6PB 2KVSA 4Q7AA 4CFCA 2X3GA 5DQHA 4USMA 1YTAA 4X62F 1XS9D 5KT3A 1WG4A 3M6XA 3TZZA 3TQ1A 4JK7A 3RW6A 2SXLA 3SQ4A 4K0KK 4A2AA 2PA8D 1ZQNA 1X9XA 2HOIA 4MEYA 1T03B 1JKHB 5E5NA 8ICBA 4CVNE 3ZZTA 2X1AA 3FCHA 5DZ7A 2V52B 2R42A 4B9LA 3OL8A 2XY6A 1XMOK 3M8ZA 5AQKA 3HL8A 5ETSA 3HZ6A 1HMVB 4KLDA 4K5SA 1S9GB 4YY3F 3ZEUB 4H0TB 4M5DA 4ZVRB 3KVGA 2NREA 1C0UA 2IRYA 4DG1A 4NYPA 4FYWB 2OELA 5FIIA 4P75A 4FLWA 3N5FA 3VERA 4H03B 1F2GA 5DMRA 4UARA 4OYZA 4DN0A 3SPYA 3M2RA 3ISDA 1ZQUA 4ERDA 4XAKA 3KHGA 3HHLD 4CO0A 4Q45A 1M5HA 2KZMA 2VJ5A 9ICJA 3TRGA 2BJ1A 4RWTA 2QLXA 3HHLA 3T5JA 4CK3A 3P45B 1L7PA 3OS2A 3OLAA 3UCZP 4OHVA 4TVAB 4NYZA 2HWIA 3RG6A 1BUXA 1VQKS 2CGKA 3IRXB 5A8KB 3VQ8A 4TUSA 2GV9A 4MTPA 3PM9A 2HQGA 3HX0A 2HFUA 4M3XA 5F3ZA 4CLYA 1FTCA 2ZZMA 4TXSA 4FCYA 2VQFJ 3DRXA 2QWPA 1QQNA 3QX7A 4CGHA 3NY0A 3I56S 1LVHA 2GX9A 4C4TA 2PFQA 1JLQA 3BS5A 5F9NA 2DGOA 3V7JA 3JSBA 3Q8MA 2BVZA 2CIMA 1O03A 1HHQA 1TKTA 3QEPA 3QSYB 2F8TA 1D0EA 1VHXA 2WSEC 3T3FA 2HZAA 2ZQBA 2OA8A 3L6QA 4WCEQ 5T14A 2D0CA 1ZQBA 2YJEA 1J5EK 1BA1A 2N4DA 4HTLA 3VENA 2V34A 5ALPA 2RVJA 1YTYA 4F7VA 4NLCA 4K5RA 4PQUA 2HB5A 2JNJA 4JS4A 8ICPA 4KREA 5HK4A 3M8QB 1S22A 4GVBB 3EZ5A 3LPEA 2KJ8A 4E7IA 4J9SA 5FLXU 1VDHA 3MABA 3CFOA 3G6VA 4P0PA 5HR6A 3MDAA 1HBOA 1Q46A 3TJ8A 1I3AA 4A4JA 1FJCA 1WWVA 3EDQB 2W9CB 4OQJA 5AHXA 4DF4A 3OBIA 4EBDA 4Q2LA 3TQEA 3ZZYA 3WNFA 1CBKA 3HVRA 4JYAJ 1NSQA 1ELOA 1WBDA 4UATA 3QERA 4F02A 4XPEA 3CM6A 1IUJA 3GDQA 2P9GA 4JI5K 2ZIUB 1X4GA 5J2FA 1ZQRA 2ISPA 2B4VA 4HTUA 1AUDA 2MQOA 1R7IA 5M1NA 3D6FB 4Z37A 2E1PA 5LMUK 4CJTA 1YLXA 4YG2A 4MK7A 3VEXA 2QA4G 3LALA 2ZVSA 2E9RX 4KV8B 4H0OA 1RTDA 3PKYA 3LVWA 2KXHA 3CCRS 3OXGA 2HURA 1Q1KA 4DTUA 4CT9A 2JC0A 4PWWA 3BP8A 4A2BA 4QU6A 1CUKA 5FLXY 2RF2B 3OY9A 4O9MA 1JB0C 4ZPCA 3AO5A 1HYSB 3T9ZA 4I6MA 4B1VA 5D4NA 2ASYA 1J2VA 3LQVA 4IJNA 3PFEA 1RZTA 5HRSA 4YMEA 2YPZA 4Y65A 2FY8A 4ZP8A 4M3RA 2KOBA 2F4FA 5HNKA 2F5GA 1SXEA 2GLEA 1PAEX 3H3NO 2DR8A 1X0FA 1MWMA 3QAEA 4JNEA 4WPAA 2F1FA 4CLPA 1VQOS 2EPIA 3VETA 5B0BA 4E8UA 3MGVA 4NLVA 2YV0X 3NGTA 2NYHA 2OHDA 4M45A 4CEAA 3GFZA 5CYMA 2PFNA 4WIQA 3JPOA 3HSJA 3AGRA 4LR7A 2E2NA 4M04A 3AVGA 1RYUA 3NRZA 1RAEB 3NAHA 5BYSA 4FN5A 2Q0RA 2VG5A 4UF4A 4FYDA 2HBLA 2ZIXB 3V81B 4YOVA 2ZH3A 1YIJS 4DPUA 1XU4A 4EP5A 5AKXA 3PIOQ 2F1HA 2FF3B 1GX5A 2YKMA 4CYUB 1HWIA 3O5BA 4YDXA 4CRJA 2HF3A 8ICKA 5M1QA 5AT1B 3RAQA 3IG1A 5AQGA 3J7AP 1FJEB 2F8SA 4QWBA 1A9NB 1RT7B 2CXEA 4IQMA 1XQSC 1WOQA 5KFIA 1NLVA 4X64J 4BCAA 2AZ3A 2WF6A 1FJGF 2AXTU 4RW9A 4C23A 1N36J 4LD0A 4KLLA 2CJKA 1R6YA 3PEHA 3CC2N 2QSFA 4WYLA 4DV6K 1QQMA 1F21A 2VBWA 2C3PA 4USUA 3NBPA 3D0PA 3GSIA 3OYIA 4J9RA 1IKWA 1FK9B 3THXB 1VLOA 1FRJA 5C24A 1WOSA 4Y2RA 3AVNA 1TKTB 2BJ3A 2QTDA 3CE8A 2JLFA 3FFKB 3JS6A 5C42A 2K8BB 2QXFA 4TURA 2D0AA 2C3MA 5KRSA 4ZOSA 3SLCA 2LXIA 3GZFA 1BHNA 1U1PA 4KLJA 5LJWA 3MEKA 5F3XB 5ALHA 4Y2VA 2HFVA 4KH0B 3LWLA 4OZ1A 3ZD8A 5KFLA 3G71S 5DZ6A 4NCBA 1EETB 4IEIA 1CQNA 3B8HA 5DDRC 9ICEA 3VQ4A 2W4DA 3O3GA 4WFZA 9ICHA 3I6PA 4I69A 3CPWR 2VWBA 3C19A 2YMQA 4WTYA 3KLFB 3LPUA 2AKWB 4LF7K 3MGJA 4X65J 4GVLA 1VQ8S 1VGYA 4CJ5A 4MIWA 3GE1A 4F2SA 2VQEF 1NNEA 4M41A 1G15A 1S0OA 1NGIA 3MECB 2WC9A 2P6TA 5K8MA 1CJUA 2VFTA 4OZJA 5E3QA 1ZAWA 2IJRA 3ZCMA 4FJHA 3SQGA 2ILYA 1SVDA 3L4BC 8ICGA 3QEAZ 4F3TA 2XY7A 2W9BA 3UMBA 3NNHA 1NGBA 4E2FB 4I2QA 2I6XA 4IRDA 2Z57B 4KMOB 1TVRA 4CF1A 1SL1A 1Y88A 3RRKA 4ID5A 3EL2A 3GG0A 2VV5A 2CQ3A 1RT5A 3DRPB 4M3WA 1XQIA 5DKWA 1VSHA 1T9TA 5AQYA 1HW8A 3MUVP 5HI7A 4F93B 4YXJA 3ZD9A 4U7UD 3RMBA 5AQOA 1LWXA 4JS5A 4WKRA 3SPZA 4JBCA 3J81j 3GIKA 3CCLS 2JZBA 2H1YA 2IIHA 2Q66A 1U02A 2CZ4A 1UAXA 5GAEU 2VYPA 3VVUA 2GVZA 2VJVA 3AMZA 5CYMB 5BPCA 1BXNA 3OVAA 3QIDA 2AP1A 5L1MA 5EOZA 4HR2A 3FZMA 1S6QA 2XQCA 2W4PA 3G10A 1CJVA 5F8HA 4WWSA 1SS6A 4DV4K 7ICIA 1ZQOA 4ACOA 1WACA 1QQCA 4M63C 1RBVA 2QMUB 2QB1A 2Q1NA 3THWB 4CJPA 3UXOA 2XMVA 3ZFVA 2PYJA 1FT8A 2OIHA 2ZTDA 3UPQA 3AARA 2L9NA 2KJVA 4OJHA 5KFGA 4FLVA 1JLEB 1IWAA 2YQ3A 2YTCA 5K20B 1HWLA 2RKIA 3Q86A 4DSJA 5IIKA 3ONQA 4FWOA 3NASA 1HNVB 2RQCA 2CRLA 2F7TA 3ZZPA 1S0VA 2I9SA 1FF2A 1NDKA 1TL3B 4J90A 3D1QA 1HKBA 5F2RA 3A5OC 1J2NA 3CJ1A 4O5CA 3MCNA 5FROA 1KQGB 3FCVA 1BLUA 4M7XA 1SL0A 5IFMA 3T6BA 1NWKA 3F2BA 4PG4A 1SIJA 1V9PA 1BG3A 4BREA 4ED7A 3LYSA 5IC6B 5B0GA 2BJ7A 2NRXA 2CADA 2LYAA 1YBTA 2D5RA 4MT1A 5ETRA 1KD1T 5CZ1A 5GADI 4C3MA 5EE1A 3GZ7A 5KT6A 1NGJA 2KG1A 1YDLA 3ZNUA 1BE4A 4QIEA 2YWEA 3R8YA 2F77X 2EKNA 5BREA 4CF2A 3MCMA 2LECA 1RG6A 1FXXA 3MGHA 4C8ZA 5J2DA 2NO4A 1FNXH 3QIPA 3M2UA 4CF9A 4C7ZA 4OVLA 3VAMA 4M5NA 1OWXA 2LI6A 3E0FA 2VA8A 3WQPA 2V7ZA 2NRZA 5GIPA 1HIYA 2IM0A 1C4CA 4BJQA 1IBLK 4C7YA 2X1GA 5DM7Q 1D8YA 3W3SA 2BBEA 4G3IA 3SDEA 1LV5A 3U02A 2PMZC 4M3TA 2QA1A 1CJUB 1ZQQA 4JK8A 5KTQA 4YMNA 1YI2S 1S3XA 1DK2A 1YK9A 2B21A 4JI0K 4OZLA 2NR0A 2YWGA 3FJ2A 4MKYA 2RS2A 1AFJA 4FLYA 3SCIE 3Q8PB 2CZ9A 5KRTA 2JEIA 1QZ6A 2OEMA 1S6OA 2BYCA 4OLAA 4ZP9A 4CFBA 4OGEA 5ALTA 3EYZA 4B3RJ 1Z05A 1TVRB 3KD1E 3QU5A 5KAIU 2DPIA 4OV6A 4ID5B 4ZLLA 2VQEK 3GYXB 3MUTP 4CJKA 2UU9F 2DGVA 3SAGA 5AQIA 4LUBA 1CC7A 5D8HB 3F2DA 1W2BR 4IDKB 1BPDA 3TACB 4Y2XA 4ECTA 4CJSA 3S3NA 3U3YA 1KC8O 1F6TA 1N5SA 4RNMA 3H90A 3DDNA 4CHZA 5J1NA 2E29A 4ICLA 3MR3A 2GVZB 3LOUA 4HEA9 2E7XA 3VQCA 3L3FX 3MFIA 1SIZA 4A8FA 5KNIA 3PTWA 1EWQA 4KMUA 2ZE2A 1NHVA 4DPXA 4C11B 1RWWB 4M5IA 5IINA 3QGGA 5K8NA 1CJVB 5LT5A 2EANA 1FKPB 2P6SA 4FZZA 2KJ5A 3MR7A 1GOCA 4LF5K 1S5LU 4K4XA 1TYQB 4N7TA 1RWXB 5ALEA 1ZQKA 2HK2A 1BVSA 1ZD3A 4TUQA 3IM8A 1J6ZA 4IYQA 4NLPA 1NU4A 3IMXA 4QYZJ 2YWKA 4YMOA 1HW9A 2MDAA 2LDIA 1N54B 5KFTA 3L9ZA 4CGGA 3G8QA 4H4OB 5L8RC 2CPXA 3DI6A 3MEGA 4UBBA 1MNEA 3ITHB 1NH7A 1SB3C 3VQSA 4DV0J 4RZRA 5C5JA 1ICEB 4ED0A 4IWVA 2F76X 3M3ZA 1IBKJ 2YHXA 3TZWA 2B9YA 5D78A 2E1EA 1U7LA 1ASWA 5HMMA 2UXCJ 2OYYA 3HT3A 1IVZA 3T79A 2WSCC 4NCGB 3WNHA 5L38A 3W66A 1X6IA 1SV5A 3SCKE 3J7Z5 4QWAA 2NXNA 3TA0A 3VF0B 4FS1A 5AK3A 1RADB 5EN1A 2GIQA 3VGSA 3J81O 3R5AA 5I3QA 3RU0A 2ZBCA 3DOMB 3SBMA 2M8DB 3EN9A 1HQ2A 2GHWA 4OJPA 2VWKA 4UZBA 1UOCA 4WXWA 3E1YA 4K4SA 1VBXA 9ICOA 2WVFA 3V9SA 3MI7X 3L7OA 3SYZA 4QW8A 4KHWA 1NG9A 3C16A 3VEVA 3MC1A 1FDNA 1V5IB 2C3YA 4A46A 5DB8A 4CGJA 5GAHP 3BGUA 4Z6CA 1M5KC 1KQQA 2YWWA 5J2CA 3CM5A 1XNRK 3QIPB 4KTZA 3M2UB 2QMWA 4P2MA 1RZMA 3HMJG 4OLOA 2P9SA 1QQ6A 1FRXA 4NWBA 1S0NA 8ICWA 3B0YA 2JLGA 2G2YA 4DTOA 3EMTA 5H9EJ 4FYXB 5AZJB 1MSWD 4X4NA 3I5AA 1E6VA 1YJNN 4ANCA 3TABA 1ITPA 3KZIU 3K4GA 3W3DA 3R9LA 1B0VA 3NLCA 3SDEB 3GWCA 3OYAA 3FZFA 5AI0A 3NCIA 2BKPA 3IGNA 3T41A 2K4PA 1ACMB 4DCHA 2G8VA 2WTFA 3ZTPA 2DO0A 2ALYB 3L2QA 5TZVA 2VJ4A 3DLRA 2ZUDA 1YG0A 5B0CA 1DLOA 2B4PA 1S10A 4CE9A 3E9OA 3K2PA 5HVFA 5F0XA 4I64A 3FGUA 2F1IA 4GXJA 5FD1A 3CTRA 2RDJA 3MM7A 3KLVA 2HHHF 3ET6B 3PVXA 3H4BA 2ZBRA 4B3MF 4K0KJ 2JWNA 1VC0A 3AO4A 3UO0A 1NKBA 4XUSA 2XYGB 3J7A1 3MX5A 5J2BA 4LJMA 1QTNB 3CIMA 1RTJA 2QJ3A 2BW2A 3IWLA 1T4GA 1V5VA 2RHSB 3VA0A 3A3NB 2D1CA 1ZD2P 3DYAB 1X5SA 1N0VC 1LNQA 1TQLA 2CPJA 2RU3A 5AI4A 2CZVC 1XMOJ 2Q97A 1AW0A 4C4RA 4ICLB 1DQ8A 3G0ZA 3TFRA 1RDRA 5DBAA 4F5RA 2CQHA 4ED6A 1LWEB 2AYBA 1YJ9S 4RT3A 4C80A 4I2IA 4F04B 4RQMA 5H1SQ 1DARA 1X60A 1HBMB 4IFYA 3RW7A 1T05A 3W61A 5DG8A 4O0NA 3CETA 4F4ZA 1NBEB 1VHIA 4MFBA 2FDRA 3A12A 2CPIA 1RPLA 3M8PA 2JR5A 4ZP6A 5KFVA 3FUYA 2VKZG 3CFRA 4L75A 4ITSA 2IBKA 3ZO7A 3NS5A 1C0MA 3K0SA 2G13A 5D3GA 1YJUA 5HJYA 3WKBA 1NRKA 1IWGA 3TNVA 3TSPA 1LW2B 1UA1A 1QAJA 3NF7A 1QDUB 1RHJB 3IAYA 4AYBF 4WP8A 2E9ZA 2ZHOA 1LWCB 2C2KB 2Z2MA 2BCRA 1VRUA 1UETA 4Q5VA 1C0TA 5AZIA 2J0XA 1K0VA 4E19A 2CJ9A 4CI0B 3QGHA 2NNWA 3DDIA 7ICPA 1QAXA 2DYAA 1NMEB 2N7CA 3AVKA 4KGZB 1WC0A 2WF9A 4Z0UA 1C7YA 2G9OA 4DL2A 2GWSA 1GOAA 3QRPA 3W64A 3F5EA 5CQGA 1BY9A 4ECRA 1VJWA 3EE3A 2ZTEA 2G2OA 3KHYA 4YUDA 4P73A 4DR5F 2HOFA 3N79A 3NRWA 4R64A 1RT6A 2LQ8A 3EZWA 4PKIA 3C16B 2WHEA 2ZH6A 4F3OA 3RBEA 4URSA 4YB6A 4IOXA 3OSPA 2MUTA 2I2YA 2J8SA 3T5LA 1QJHA 3CRXA 1HKCA 4NLNA 2YNFA 4RPFA 3U4LA 2MZSA 4I4BA 9ICVA 1N0UA 1U2CA 2HSZA 1IM4A 1EQMA 1WF1A 4OX6A 1URNA 4KIAA 4O44A 3GJSB 4NL9A 1MLAA 1Q9YA 4Y2SA 1E6VB 4LF6J 4I2AA 2ZUCA 5MLCV 4JI5J 1FTRA 1REVA 3H0PA 3BV8A 1HNWF 4C98A 1ZQTA 4OKEA 2DY1A 3SQ1A 3K5PA 4FWRA 5J0RA 3SENA 4JI3K 2V8GA 3O80A 2ZH2A 3C21A 5JS2A 1VDVA 2ACMA 1VC5A 1EX8A 3FM9A 5DBBA 2Z58B 3SUNA 2PFPA 2QB0A 3H42A 5ETQA 1ZQHA 2ROEA 1EQ0A 3H25A 2BOAA 2CJYB 3UCGA 2KMDA 4WFYA 3QBWA 3KOAA 5CRXA 3CUNA 1SI9A 4ZCLA 4CD1A 9ICRA 4JI6F 4J2EA 3US5A 2MLXA 2HHVA 2NRTA 5ALVA 1C1BA 1ZBTA 1M90T 3O08A 1OW5A 1NJYA 2GVDB 1GLDG 2Y1LB 2C22A 5E26A 2JDJA 2OM6A 1EP4A 3SBGA 4TYBA 3HT0A 4MMOA 3GIIA 2EZXA 3ZDEA 1ZQYA 4DU8A 1AXQA 4KC5A 5HMLA 1SQKA 4NYOA 4M8LA 3MMJA 4ZKAA 3NEKA 4DV2K 2JJ4D 1CZBA 3QAUA 1WF2A 3T5HA 2VPWB 4D3HA 1KVKA 4DV7K 1JLGB 3CVKA 1XUPO 5F8JA 3QETA 1CI4A 4OZ2A 3JPPA 2CYYA 3F9KA 2LBOA 4X62J 2OI2A 1S1UA 3J7YP 1RCXB 3GE9A 2HAIA 4P10A 1TK0A 4EZ9A 2LMRA 3BEXA 3UFCX 5FDLA 1QY7A 1NGEA 1CJKA 4BR4A 2M9KA 7ICSA 1N52B 1ZD4A 1FX2A 4A5BA 3A8EA 3L4PA 1NGCA 4PWDA 1L6NA 4QZEA 3O3LA 3IBPA 1NMDA 2YHBA 8ICVA 1ZJMA 4DOAA 3CNHA 1HNZF 1QHAA 3NMUA 3B0XA 4YY3J 5AICA 2AIRB 1N5XA 2V4JA 4CJWA 4DV5K 5AQFA 3NVVA 2M0GB 2W03A 3TANA 4BROA 3O1BA 2QA2A 4CJ4A 3HKZF 3PKMA 2W7AA 1KCFA 3HW8A 2NXEA 4OLPA 2UV8A 2LA4A 1FRHA 1Y3JA 2P9NB 1O51A 5H2FU 4NX9A 1WAFA 4ZLNA 3EVMA 5IZHA 3CJ3A 2AGQA 3C6UA 1U48A 3BQ1A 4WYWA 2DISA 4DX8H 1RILA 3C6TB 1TGOA 2AJ2A 1VSMA 3CWJA 1K1SA 3BBBA 8ICSA 2F63A 1T7PA 2XB2D 4Y2AA 1N5TA 1H0HB 1KDNA 1SC4B 3R5GA 4K59A 1TKXA 2ASMA 4K4WA 3QWPA 3M6VA 1ZS6A 1HRHA 3P31A 1U1NA 2ZD1B 1U6FA 2Y9HA 2CFXA 1T3OA 1H73A 3KG1A 1BPZA 1S1TA 2ZHAA 9ICXA 4PYAA 2OPQB 5E33A 1ZQ1C 1J53A 1YJ7A 3CC2S 2DUYA 5J2PA 2HS3A 2PC6A 3AQEA 3PDNA 3AOAA 2NUBA 1S7HA 3OUYA 2WF7A 2MUTB 1UL3A 1YWXA 4WU2A 1BOTO 2HHSA 4JI8K 4CO5A 1PYOB 4I9QA 2PEBA 4V19J 4DL0C 2YX1A 2CNOB 3CIPA 1LXJA 5JMVA 4DHYA 3J80U 5GAEI 4DFKA 3PSTA 4JRQA 4UOFA 5E3RA 5ALSA 2K4IA 3CYMA 9ICLA 3G4SS 2D9OA 5IIJA 4Q44A 1NZBA 3M32A 4B02A 1DBDA 4XDDA 3MN7A 1PK1A 3HXMA 2Z1HA 4ATNA 3QPIA 3GPAA 5LL6Z 4EFHA 2A6OA 4KBIA 1GQEA 1M5VC 1X66A 4IZ9A 4CHQA 3O6QA 3UM9A 3T69A 4H5NA 3KFUF 1ZBIA 4ILRA 2B7CB 1U24A 3KJNB 3C1ZA 3D1OA 1K44A 4AQYF 5IQQA 1HLWA 2DB1A 6FDRA 1JWWA 1SWVA 1DTTA 3EXYA 3T19A 5AK6A 1RFQA 3BKTA 4OPHA 3L3UA 3TAMB 2W40A 2UVUA 1NJIO 3ZXWA 1C1BB 1HA1A 3KKRA 4CHPA 4MN4C 5A2QO 2O8CA 4ZVEA 2IHR1 2NRHA 3F0NA 1SJ1A 4M5LA 2W25A 2IPOB 1VQ7N 4KGVB 1IN0A 3HF5A 8ICCA 4KSEB 2X6NA 3J81U 3GOIA 1YZ6A 2YQ0A 4QS8A 3FMBA 3FK4A 4OKJA 1EXQA 4DR4F 4YDUC 4RPXA 3JAMO 4NCAA 3KHRA 2B5JA 3KKAC 3W8PA 4JV5K 3R1LA 2YX4A 3MWBA 4BR2A 2QLTA 1M1HA 1S0MA 1RDCA 2DNYA 3QFPA 4JI6K 3DN9A 2UUAK 2GJ2A 2B51A 3TKAA 5L1KA 2BH1A 2KV2A 5D6GA 1YHQS 2LKYA 1ZBLA 1QUPA 5ALKA 2JHDA 5FJ4A 4Y1CA 7ICFA 2BJEA 4CEDA 4WFBQ 1HLUA 1JJHA 1Y5IB 2RQ4A 2K4HA 3TWZA 3OYNA 2AEFA 1U1MA 1EJ7L 2XWYA 4ILGB 4EIAA 4ZHRA 1QQ5A 5D4OA 2C2MB 2P9LB 2BE2A 5L9XA 2QLBB 1HX1A 2HNDA 1ZC6A 1VIXA 1TKZA 3RGIA 1UVJA 3OS0A 2P6RA 3J81Y 3MOZA 1JNZB 2DJWA 4UB1A 2KE7A 3IC1A 2KQ2A 4IS7A 4MFAA 4FPIA 3NCPA 4RQ6A 2ZXHA 2YWFA 1GEHA 2R7VA 1IR0A 2B0GA 3S6EA 2X6SA 5H9FJ 4DSIA 4LF9F 3E66A 1Q16B 1RAJA 3C6UB 1KC8T 4CGZA 4QS7A 1KFDA 1FESA 4QNLA 4I56A 4PZOA 2RB7A 4NOHA 2ZWPA 4DX5A 1WAJA 2RRNA 4W98A 4Y34A 1GXTA 5KG0A 4CLZA 3ATVA 4Y0WA 4M3UA 5ELZA 2LLZA 2YH1A 4KO0B 1NGDA 1ZTTA 1FJGJ 1E6YA 1JLBA 5KFYA 4TU9A 3WHIA 2YHAA 1VHFA 4NLDA 4CECA 1WKKA 5LL6d 5C0YA 4FPRA 1Q7YO 3F41A 2NRVA 4D3GA 4LF4F 4B1WB 5HATA 2M88A 3TU5A 2HBQB 3I87A 2PEHA 4ZVPB 1DTQB 4FE3A 1UWBA 1XIQA 5AR0A 5J1EB 1S1XA 4FP9A 4F26A 2FJWA 4NLQA 4K4GA 4DWIA 1Y64A 3AAPA 1BISA 4TU8A 4IH6A 1RTHA 3K2YA 2JVRA 8ICAA 5KOXA 3DMJB 2QL5B 2HFOA 4KHNA 8ICFA 3OD2A 3OR1B 3KKFA 2Y1JA 1BCMA 1GH8A 2KEYA 2E3TA 2XSJB 1SC3B 2Z0GA 5AKIA 5ETKA 1Q5VA 5AQHA 3UXPA 3T1YF 2Q6BA 2QLWA 4PL7A 1K8AO 1Z4OA 4NZ7A 3RFAA 3KD3A 1I94F 4BXOA 2RH3A 2KJWA 1YBAA 2V6AA 4DCPB 5HBMB 4P4PA 4DDFA 4FXDA 2DNRA 2K8AA 2HFNA 4PG6A 2OYQA 3H2UB 4KR0B 3WXIA 5K4LA 1ZM2A 2VQEJ 2OEJA 4MDBA 3WX8A 5AQSA 3LANA 4U8YA 1WYGA 4C1NK 4AYBD 3MCOA 3G6EN 4DL7A 4U95A 2AYEA 5ALWA 3ETMA 2XCPA 3HRGA 1N34K 2QEXN 3I76A 3R1XA 3GV5B 4DCOB 5DLFA 2IA0A 3P5BP 2Q1LA 2E1RA 4FFDA 1SXDA 2F4VF 7ICNA 1GO3F 4IXCA 2BE7D 1TV9A 3HLUA 2YTUA 2ZWOA 3EEQA 4DV1K 3VGTA 4WFXA 3PX4A 5F8NA 1U2FA 2P9UA 2NXCA 3Q2SC 4X5VA 4HLBA 3HSGA 3ZZRA 2Q0UA 4CEOA 3UR3C 1HQUA 2U2FA 3VAJA 4I67A 4CNZA 2ZH1A 3ZSVA 1C1CA 4BS2A 3SMPA 2R2SA 2WBRA 2NLXA 3BKFA 9ICIA 1RT3B 2WF8A 1YF5L 2R18A 5HP1A 5KG4A 2DBYA 2BE2B 1Y11A 2IVMA 2UV8G 1RDWX 5KFSA 2HNDB 3ZI4A 1A6LA 4QZDA 5GAHU 3ILOA 1TKZB 1D8BA 1YSJA 1TL5A 3MPDA 2W7PA 4URQU 3ENHA 4B9MA 1AT1B 1AQ6A 3CJTA 1O8BA 1P8GA 4S0MA 1C2PA 3NNAA 5EOYA 2GOLA 4OJ6A 2FJXA 3LDOA 4Y2PA 5C25A 3UDLA 1EIYB 1S5JA 7ICJA 2DRBA 3OTOK 4BRGA 4BBYA 5AQUA 2ZIWA 4CF0A 4BACA 3NF9A 1WKLA 4DHVA 3D7EO 7ICLA 1FE4A 2EFVA 2EQYA 2AJFE 3TAFA 1WSEA 2R7OA 3MK6A 1S4FA 4Z94A 4B3OB 3PACA 5DB6A 3C14B 2QSWA 5TISU 2O5DA 3GBTA 1IKVB 4JKGB 2ZM6K 2O8FB 4PZVA 3CERA 4F92B 1N6QB 4QIVA 4RQ1A 4LFCF 4WJ3B 4G6VB 4R79A 4RQ0A 4OYXA 4Q43A 4GIBA 4YDDB 2IDLA 3ISND 3EJMA 1H72C 4NEZA 1ZQFA 4BX9C 1SKWA 4HAIA 2J6TA 5AI8A 5K5MA 3CCQS 2RMLA 2YX6A 3KD5E 4HUEA 4TY8B 3WUHA 4F4AA 3A0HU 2EFOA 7ICEA 5DETA 2XMWA 5G4DA 3G2XA 4UBCA 3R6LB 4M47A 1VQYA 4GO7X 3JPTA 1RT1A 4IO9Q 1W2IA 2WBNA 2QE5A 4LQ9A 3M5RA 5IT4A 2EVZA 2OPSA 4RU9A 2DTJA 3G8TA 1RWUA 4LFAF 4C2MA 4FJGA 1OIAA 1KRPA 4GKKF 3P83D 2ZOMA 3HHEA 1KNZA 2HHUA 1VQMN 3C2PA 5AKGA 2ITGA 2W4CA 3PRBA 5KFDA 4OI4A 2CKWA 4H5RA 3CMAN 2H5XA 1IJFB 4A62A 4IL6U 3ENWA 3HVTA 2EH9A 1KN6A 4CDGA 3UR0A 2W01A 4ZLJA 3QU9A 3WIVA 4BGBA 5F8IA 4KB0A 1S12A 2MKIA 1RSCA 4GKJK 4J9LA 3M2VA 3VV2B 2BV3A