1UA0A

Aminofluorene dna adduct at the pre-insertion site of a dna polymerase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua0A01
1XWLA 3ZDDA 5EWGA 5FDLA 5D49A 3PY8A 5FRMA 2PY5A 3HPOA 4F91B 1T8EA 3RWUA 4KHWA 9ICMA 3OS0A 4L8RB 4DU4A 3C21A 1J5OA 4QZ8A 1KFDA 5EWEA 3N97B 3PW4A 1JLFA 2P5GA 1SZPA 1TL3A 4Q45A 2FLPA 4AHCA 3FYHA 4KLMA 3OYFA 4ZTFA 1T7PA 3M8SA 5DG7A 3PMLA 2HB5A 4UBCA 3RH5A 2HNZA 2HHSA 3LWMA 3HSTB 3V7JA 2W9CB 3AUOA 3V9XA 4RT3A 1SKRA 3LDAA 3QEAZ 3MECA 1JLGA 2KZMA 4B8AB 2F96A 4YVZA 1TL1A 5DB7A 1R0AA 2IGIA 4OGEA 4ZHRA 3F73A 4RPYA 4DQRA 4B9TA 3I0SA 3V1RA 3SUNA 4HCBA 4RQ4A 3JYTA 2WTFA 3NDKA 4W5TA 4E1MA 5J2GA 5DBAA 4YD1A 1RILA 1YTAA 3C5GA 3KLGA 3SUPA 4QZHA 3Q8RB 5CYQA 2BDPA 3NF7A 3PR4A 4J2EA 1NOMA 1GOAA 4ED1A 4DO9A 1XS9D 1N48A 4KO0A 2ZJ8A 3ZSZA 4ECWA 3LP0A 3S9HA 2ITGA 1JLQA 5KT5A 4RQ8A 3LWLA 3L3UA 3MR2A 2PFOA 3TFSA 3AVKA 5KI6A 1QQCA 4JWMA 3AO3A 5DQHA 3BDPA 2FBYA 2ISOA 3KHHA 2PYLA 4F50A 4J9RA 4RQ2A 3MR3A 3L2UA 4N56A 1T4GA 5J2DA 2VA2A 1A5XA 2JGUA 1WN7A 4YXMA 1SKSA 5KG5A 1J9AA 5CHGA 4G3IA 4ECSA 2FLLA 3U3YA 3QNNA 2R7YA 4M42A 1A77A 2KZZA 5L1KA 1KVBA 2A1RA 1RBRA 3LALA 4ELVA 4KLLA 2FPMA 4PHAA 2R8GA 4I2CA 3FFIA 3HO1A 3SI6A 5DBCA 4KLOA 4YMNA 1RT7A 1KEJA 3RH6A 5JUMA 4E7HA 1TVRA 2PZSA 4IR1A 5C42A 4RNNA 1IKYA 4EBCA 4RUAA 4I2HA 2XHBA 4C8OA 4BDYA 4DTMA 3V7LA 8ICUA 1EETA 3V6KA 4ECUA 3H40A 1UT8A 4YR2A 2G8FA 1JL1A 3G6XA 4B08A 1XHZA 3K75D 3K57A 3KK3A 2YKNA 3MEGA 3RJFA 1YVUA 3VQAA 3TR8A 3PNCA 5JS2A 3OSNA 4ECXA 4DQQA 4CF8A 4FLTA 3AO2A 2OPRA 4CJEA 3OJUA 3OYIA 3RB3A 4OGCA 5K14A 3M9NB 3GIMA 4NLNA 4I29A 4DFPA 3SPYA 2HHUA 3RJGA 4OKJA 4ED3A 3AVBA 5KFAA 4P4PA 3BQ2A 8ICAA 3SQ2A 1BPBA 5E41A 1JLAA 4NXZA 9ICFA 2FBXA 3NF9A 4DSIA 4R64A 4MF2A 2C2EA 4O3PA 1WSGA 1RTJA 5J0PA 3UPQA 5KGXA 2W9BB 2BQRA 3OYDA 5I3UA 2P1JA 4CEOA 4GXIA 1TK0A 4FJMA 4I7FA 4ED6A 3MBYA 5HRNA 7ICUA 4DFKA 1J53A 5D4BA 2Q0ZX 2DFEA 1S1XA 2B21A 1TGOA 3QEWA 3ZDCA 4IR9A 4FM0A 2HMIA 1RT1A 1SV5A 5DLFA 4KKOA 4FLUA 4N47A 4CIGA 1ZQEA 3QLHA 4DTRA 9ICGA 4M6WA 3UXPA 1KVCA 1RTDA 4C8KA 4FM1A 3OYJA 1Z00A 1ZJNA 3MFHA 1JLEA 3M9OB 4KLHA 4M04A 2E6MA 4I9LA 7ICFA 1WSHA 1TK5A 2P66A 4UAZA 4B9SA 3RR8A 3V4IA 3LP3A 1ZQFA 1UWBA 4PHEA 1U4BA 1TKDA 1VSKA 3NGYA 1ZQZA 4P2HA 4CHPA 2WOMA 4QZCA 2VG5A 5KGWA 1NK6A 5HBMA 3VQ9A 2YNGA 4ECQA 4LSLA 3ZSXA 3NHGA 4PQUA 4FVMA 1J54A 4IFYA 2X78A 1WSFA 2ZQBA 4AHTA 1ZQCA 3UXNA 4F5PA 4NM2A 1REVA 1LV5A 3TAPA 4FBUA 1ZQAA 2IS3A 4TUPA 4XRHA 4IQWA 3ISBA 4Z4EA 4FLVA 1IXRA 1Z00B 2BR0A 2YHAA 4O5BA 5TZVA 3UIQA 4F3OA 2H5XA 1YTUA 1KFSA 3TAGA 4QOZB 4OPKA 1BPEA 1WCNA 4ECTA 5J2MA 4CF1A 1NK0A 4QCLA 3ZCMA 2XY8A 3MXIA 3P5JA 5F9NA 4F5QA 5DQGA 5CB1A 3DI6A 4FJ5A 3O4NA 2IOCA 3H08A 4LZGA 4OPJA 2BCVA 1IKWA 1T03A 3VQ8A 5HLFA 3OYBA 5KFJA 4MFBA 4FZXC 3RAXA 3ISCA 3ISDA 3Q8PB 1MSWD 1JLCA 4CJTA 1BVSA 4F5RA 4HYKA 2C2DA 4CJSA 4M3UA 4M9NA 3DLEA 2AQ0A 3U3GA 3RJEA 3TANA 1ZQVA 2FMPA 4CK3A 1ZBHA 1X2IA 3RH4A 4WE1A 3ZDEA 2P6RA 3VQEA 4YNQA 1Z3EB 5DK5A 5J0YA 3T5JA 4KHNA 4RU9A 1W9HA 4M3WA 3RMAA 9ICKA 9ICVA 3VQ4A 3DLRA 4RW4A 1CUKA 4AHRA 4CHZA 1SKWA 5CJ7A 8ICIA 4FK4A 2W8LA 5DGAA 3ITHA 3SJJA 1B9DA 3TI0A 4UQGA 4KI6A 4K8ZA 2I1QA 4DOCA 1KTQA 4H4OA 2JEIA 3AVLA 4NLKA 4CIEA 1RNHA 4EYIB 2AJQA 3H8SA 5DQIA 2ASLA 4ED0A 4KLUA 9ICCA 1RZTA 2BANA 5KFQA 4M9LA 2D5RA 2OPPA 4KTQA 3V1OA 1U49A 3MDCA 4CERA 3ALYA 4Q5VA 4QZIA 4Z6EA 4ECYA 3PW2A 5CZ1A 2UVRA 1QHTA 1ZQYA 2YNIA 1BPZA 5CWRA 1UOCA 3KD1E 4J9LA 1L3VA 3PW0A 2EHGA 3L8BA 1S97A 3JPTA 1LAWA 4DF4A 4YG2A 3E01A 1ZQGA 1HNVA 4I2GA 4KAZA 2FPLA 8ICBA 1BCOA 1L3TA 4ELTA 3SYZA 4M3XA 1B22A 4F5NA 4FW2A 5KRSA 3V81A 3VA3A 5KFCA 5KFHA 2HHTA 2DPJA 4TUQA 1FK9A 1D9DA 3CG7A 4B8CA 1BI4A 2PFQA 4EYHB 3DLGA 3MEEA 4E7KA 2ISPA 3L2WA 4AHVA 4DMNA 2VWJA 4KB0A 5CY4A 3B0YA 3DYAA 3MGIA 3TABA 4JRQA 1ZQXA 3RJJA 4R65A 8ICZA 3RMCA 3VQCA 5HMMA 4MQ3A 4ED8A 4CIFA 4QWBA 3K5OA 3VQ5A 2F8SA 1ZQLA 2J6TA 4Z6DA 4B9MA 2YHBA 4B9UA 1K1SA 8ICYA 2YV0X 1A5WA 3K5LA 4CEQA 2YKMA 1TAUA 1HYZA 4W5NA 3GIJA 1C1BA 5KFPA 3QZ7A 3RB4A 8ICOA 4UBBA 8ICRA 3G6VA 4DTOA 2W9BA 2ZUCA 3K58A 5J2CA 4KI4A 4K4IA 4DG1A 3VQPA 3V7KA 5DDYA 3OYEA 3SZ2A 4DLEA 4AHSA 4W5OA 4YMMA 2W9AA 1A5VA 4CHQA 3MABA 3DMJA 5KFRA 4IDKA 3HYFA 2AGQA 3NGDA 4BDPA 3OS1A 4RQ5A 2NRXA 1KFTA 4KITB 3V9SA 1S1WA 5F9LA 4CGDA 3RMDA 3LPTA 5KG1A 4R66A 1X1PA 4J2AA 1BPYA 4Q8FA 5DMRA 4JV2A 1VSLA 5J2IA 9ICUA 4E7LA 5SZTA 3T5KA 2GUIA 1XO1A 4O3QA 1RDCA 3C1ZA 5J2JA 3RBDA 1T3NA 5C25A 2XY7A 3AVAA 2F1IA 4J9NA 1W0HA 4JK1A 2A1JB 2KN7A 3QIOA 1Z26A 4OVLA 2KW4A 4TURA 4KTWA 4YR0A 3EPGA 3EWAA 3PX4A 1K1QA 1WLJA 1RT2A 3EY1A 5D3GA 3G10A 3ZSOA 3KIOA 5T7BA 5HRPA 1I3AA 3JPQA 4KLJA 2J6UA 2I9GA 2YNFA 3HVRA 5J2NA 9ICXA 2DFHA 3SPZA 5L1LA 2BPGA 3OHAA 4XIUA 1WAJA 4E19A 4RQ0A 8ICEA 1ASUA 4PA1A 5J0SA 5J29A 3QERA 2RKIA 2BPFA 4OLBA 4TSXA 2XRIA 4O44A 5HMLA 4F92B 2RDJA 1KDHA 1LAVA 1XC9A 1BPXA 2P5OA 5J1EA 2VA3A 1IM4A 4ED2A 4YFUA 4PGYA 1TKZA 1L5UA 4FBTA 4DQPA 2AU0A 1HYSA 3Q8KA 2HHWA 3BJYA 4IRCA 3PW5A 1EXQA 1UT5A 3QIPA 3AVMA 2BQUA 4DSLA 4Z0UA 3LAKA 3L2VA 5KFSA 3Q8QB 1AROP 2ASDA 4CF9A 1TK8A 3JPOA 7ICLA 1NK7A 1COOA 4YXJA 2A1SA 9ICQA 3KD5E 1QTMA 4QWCA 3AO5A 7ICHA 2BQ3A 5IIIA 2JZBA 4CEDA 3NCIA 3RAQA 2F1HA 3BGRA 5IIJA 1GOBA 4RPZA 3KLEA 3PV8A 3LZIA 1X9MA 1S9GA 7ICTA 5BOLA 8ICQA 2RPIA 3PMNA 5HRRA 2ASJA 4RQ6A 3KK2A 8ICMA 1QSYA 5J2FA 4XA5A 2C2RA 1S77D 1CXQA 2PYJA 4EEYA 1X9WA 2QXFA 4IG3A 3DLHA 1KCFA 4CJ5A 4CESA 4EZ9A 3MDAA 1X9SA 1S1VA 2HHQA 5BOMA 1ZBUA 1CEZA 3ZT1A 1B92A 4BWMA 3DRPA 1RDBA 1Q9XA 4KLIA 9ICOA 2ATLA 9ICBA 4G1QA 5J0XA 1NKCA 3H7IA 4NY8A 1S1TA 2VG6A 1MC8A 3NH2A 1BIUA 3P83D 1ZBFA 1XSNA 4CGJA 3G6YA 3GFKB 3HPGA 3ZSWA 1NK9A 4QZ9A 4CECA 3JPRA 2IHMA 4DWIA 1FXXA 3GDXA 4KLEA 4TQRA 7ICSA 4CJUA 4YN4A 3QINA 5KRTA 1C1CA 2BGWA 4ID5A 1HQUA 5KT3A 5HP1A 3CFOA 4I2DA 2BE2A 1F21A 1S0NA 9ICEA 4H4MA 4OLAA 4HUGA 2MUTB 4NCAA 4BXOB 1CLQA 4BDZA 1TV9A 2X74A 3ZSYA 5L9XA 4HUEA 5DB9A 2DTUA 5J0OA 4R63A 4CJLA 4GLXA 3KJVA 3M9MB 1HRHA 2E4LA 1WSEA 5KG7A 3IS9A 1S0OA 4DL6A 4ZTJA 4I2FA 1Y97A 4F5OA 5KT2A 3RB0A 4FXDA 3PVXA 1Y88A 7ICJA 1ZQBA 3GIKA 5J2EA 4DTJA 9ICRA 4F2RA 1DTTA 4DFMA 3DOLA 3AO4A 3C6UA 4F4KA 4NCGA 4QZGA 1BPDA 4MF8A 5DB6A 4UB5A 1RBUA 1TKXA 5KFUA 1ZQPA 3T5HA 3T19A 2A1JA 4CFBA 1ZQSA 4FYDA 4JWNA 2W9MA 2B6AA 3EPIA 4CJKA 4QWDA 4CHYA 4DTNA 4J9QA 5KFIA 8ICLA 2RN2A 3KHGA 4DTUA 3VQQA 4E3SA 2BPCA 2R8KA 3SI8A 2D0CA 4M3ZA 7ICPA 3PUFA 1BGXT 3V6JA 3AVNA 4DLGA 4M41A 1ZQIA 1IKXA 4DL2A 1XU4A 1D9FA 1G15A 4I2QA 3OYGA 5HP4A 2DPIA 1HNIA 4CJPA 1NOZA 5DB8A 4K4GA 3GQCA 3LDSA 1MQ3A 1RCHA 4UB4A 4F4ZA 3OJSA 1RT4A 4I2EA 5KG3A 1RTIA 1YT3A 3AVGA 4BWJA 4PWDA 3RR7A 9ICHA 1S76D 2IC3A 2GWSA 4HTUA 1MQ2A 5J2KA 1C7YA 1RBVA 2HNYA 3JPNA 1XSLA 1EXNA 4M9GA 1ZQDA 1BIZA 4C8MA 3ETLA 4GC7A 4BE2A 4RNMA 4F4YA 1ZQOA 1Q9YA 4QAGA 1QS4A 5KFTA 4QW8A 2IAJA 4BGDA 4N41A 3LK9A 2F1JA 1ASWA 3MR5A 1NOYA 4O0JA 2OZMA 4FCYA 2J6SA 4F93B 4NYFA 3C6TA 5KFFA 1ZQNA 4DSFA 2KQ2A 4JUZA 1KLNA 3IRXA 4KLQA 4F2SA 2X6SA 4YFKA 3NBPA 4IRDA 4AHUA 4FO6A 5BPCA 2EX3A 4CEFA 2Z1HA 3GILA 5KFXA 4Z4FA 1GOCA 5KT4A 2M9NA 3I0RA 1JN3A 2MAXA 3H8WA 3DLBA 2D0BA 3Q8LA 4CF0A 1K6YA 3SQ4A 1C6VA 3UQ0A 4RQ7A 3AA5X 2D0AA 3S3OA 1VSMA 4CJ4A 1NJWA 2MUTA 5DG8A 3C2MA 4DL3A 1VK0A 4I2AA 1NKEA 3C1YA 2OA8A 1KRPA 2DFLA 4KLFA 2IHNA 3RJIA 2XGPA 4OKKA 4HVJA 4OKEA 3JPPA 4CGHA 2ALZA 3HW8A 4FZZA 1A76A 4YQWA 3A2FA 3ASMA 4DFJA 1LWEA 4Z4GA 1JIHA 4BACA 4KLGA 1RBTA 2IDOA 1Z25A 3S3NA 4JLHA 3QETA 5KFNA 4RW6A 3B6OA 2XY5A 1I39A 1LWFA 4FK2A 4J2BA 4DQIA 3NH1A 3H4BA 3MEDA 1CZ9A 3QO9A 2ZUDA 4DSJA 1NJYA 3LPUA 2VWKA 3SQ1A 3AVJA 4FS1A 3ZSQA 3QEIA 8ICCA 4DL4A 4DEZA 3THVA 1CZBA 4FJHA 1LW0A 4AH9A 5KFDA 4J9SA 1O1WA 4LH5A 4ZH4A 3KKRA 5J2HA 7ICKA 1LW2A 4DTPA 1S5JA 5HNKA 2HW3A 3AA2A 5J2QA 1VSIA 3IM1A 3O3HA 4B9LA 1ZQQA 4MFCA 1IG9A 3T3FA 2KFNA 5KG0A 1HYVA 3O3GA 1KLMA 4R8UA 3TAEA 4Z4IA 4IBNA 4PY5A 1DLOA 3LZJA 4LD0A 7ICIA 4CF2A 4CGIA 4O3RA 3NAEA 4RQ3A 4Q0BA 4IQVA 5KFYA 1NJXA 1SL0A 2IA6A 4E7JA 2QK9A 3RJHA 3KLIA 4I9QA 4YCXA 3T1AA 1T05A 4CGFA 2R8JA 4YD2A 5CZ2A 9ICLA 4ICLA 3SQ0A 4NM1A 4M47A 4TQSA 2XCPA 2O4GA 3AVCA 3RJKA 1C0MA 2OYQA 5D46A 3NTUA 3OHBA 5C24A 3K5MA 3OYHA 4CK2A 4FJ8A 1RYRA 2ZJAA 3ZDAA 2JEFA 7ICMA 3TAMA 2JZBB 3KHLA 3NH0A 3C5FA 2LYHA 2FPKA 1N56A 2E6LA 3AVHA 4QZFA 1U04A 4CHNA 3C95A 3GV5B 1UAXA 4LH4A 2OPQA 4IQUA 4EP5A 4UB2A 4CE9A 3AV9A 1S0MA 1TVAA 4RW8A 1QE1A 4QWAA 3CQ8A 4I2PA 3SNNA 4ECVA 4DS4A 1ZQJA 1WCLA 5KFZA 4B9VA 4MFAA 4DQSA 3OSPA 1JKHA 3O4QA 5KFWA 1IKVA 4QZBA 2JEGA 5J2PA 3BQTA 1JX4A 4PH5A 4CJFA 4F3TA 1S6QA 5KTQA 1ZETA 3AA4A 2KTQA 2FBVA 2XO7A 3ISNC 4MEXA 9ICAA 4NCBA 4M2YA 3M8RA 1JXLA 4CK1A 1WAFA 1B43A 1H38A 5L1IA 5HHHA 5KFBA 3KLFA 4PGXA 3MAQA 2Z1JA 4LVSA 4M9JA 8ICPA 3DM2A 3SV4A 3MFIA 7ICGA 3CM6A 5IIOA 4BXOA 4KHYA 4I28A 3H8JA 1QLNA 2ZTEA 4RG8A 2ATQA 1KSPA 4JV1A 5I42A 4Y1CA 4DL7A 4H8KA 3UXOA 5DGBA 1RXWA 2UVWA 5C5JA 2HNDA 4GVMA 1MU2A 1NK4A 1U9LA 1N5YA 3AU6A 3EYZA 3QZ8A 1NKBA 3OVNA 4F4WA 4EZ6A 2AQ4A 4FJNA 5DKWA 4RZRA 5KFLA 2NUBA 3F9KA 4AILC 1JLBA 4UAWA 4NLGA 4EP4A 2ZD1A 3HX0A 1QSSA 3LAMA 3HT3A 4FJXA 1U47A 3E2EA 8ICGA 3P1GA 4O55A 5FROA 1S10A 4QZAA 1VRTA 3V6DA 5KG6A 1SL2A 3OYCA 3OYKA 1JXBA 1HJRA 4J2DA 5J0TA 4YR3A 2XY6A 3JSMA 1HJPA 3KTQA 8ICTA 3DRSA 1VSEA 2W8KA 5SWMA 3MGHA 4QWEA 9ICNA 3V9ZA 3LP1A 1JMSA 4EBEA 1S9FA 3MXMA 3HJFA 5CYMA 4HHTA 5HRSA 2ZTCA 3H4DA 3SUOA 1VSDA 2FC0A 4ED7A 1UA1A 3VN5A 4PHPA 4FJGA 1DOQA 4KV8A 3ZT4A 1BHLA 1JXEA 2FBTA 2Z1GA 1BQNA 2BCUA 4IKFA 3AVFA 3TAFA 4CEBA 3MR6A 4K4HA 2V4RA 5IILA 2ZJ5A 4MEYA 4CFDA 4KMUA 7ICEA 1XSPA 4KLSA 3V9WA 1RYSA 5KFEA 3TQ1A 3B0XA 4UAYA 3UQ2A 4YP3A 4QW9A 3QEXA 5DBBA 4Z6FA 5KG4A 4M9HA 3DRRA 8ICWA 4CJ3A 7ICRA 3VQBA 3PX6A 1ZQKA 1IH7A 3V1QA 3QE9Y 3HK2A 1LB2B 4O0IA 3VA0A 3M8QA 1L3SA 3PX0A 4Z4CA 4I27A 4DOAA 4FW1A 1RXVA 4CGGA 4CCHA 4R5PA 2BCRA 4JS4A 2X6NA 2WONA 5J2AA 2OZSA 2PXIA 4GC6A 1DTQA 4FJLA 4IRKA 4O4GA 1C0TA 3OYNA 1HUZA 7ICQA 4EBDA 1N6QA 3RRGA 2OWOA 1HQEA 5JS1A 3G0ZA 2YNHA 4GXJA 5DLGA 4BE0A 4RNOA 3ZDBA 3QNOA 5CR0A 3OGUA 2VANA 1BQMA 2BCQA 3I8DA 2G8WA 3L3VA 5KFMA 3OY9A 4Q43A 2HVIA 3ULDA 3KK1A 4C8LA 3AVIA 3QESA 4KHUA 4QZDA 3Q8MA 4IFVA 4KLTA 4KLDA 1TKTA 4J9MA 2AGOA 1ZYQA 4P4OA 2P51A 5KFGA 4IG0A 3V6HA 4DSKA 4RW7A 4RPXA 3TAQA 4JRPA 4XQ8A 4Z4HA 3VQ6A 1RT6A 2V9WA 4FLXA 2XGQA 9ICJA 2VA8A 3OS2A 2KFZA 2C22A 5KT7A 4MFFA 1VSJA 1D8LA 3RBEA 3PW7A 4J9OA 7ICVA 3HL8A 1BISA 4CEAA 2FMQA 3Q8SB 1RDAA 4O5EA 4M3YA 2G8VA 5J0UA 3ZD9A 1TAQA 1D5AA 1S1UA 4ECRA 4M0AA 4KN7A 1ZBIA 3N4MB 7ICNA 2F8TA 3OYLA 4GMJB 3BQ0A 3HP9A 3LANA 1UA0A 4PGQA 4ECZA 3OYAA 1CXUA 1TFRA 4F4XA 4NYNA 4E89A 3K2PA 4M6WB 5HHIA 1RBSA 1JL2A 5J0WA 2FLNA 4BE1A 3SUQA 5DG9A 3NF8A 1ZQWA 3ZSVA 3JPSA 2FMSA 1Q8IA 1ZJMA 4CJQA 4X5VA 5CA7A 3EW9A 4O3SA 4J9PA 4O5KA 4FLWA 4R8UB 4DSEA 2DY4A 3ZD8A 1HUOA 4KHSA 2V4QA 2GV9A 5IIKA 1XHXA 7ICOA 4P4MA 4HCCA 4LY7A 1RPLA 4O3NA 1ZQUA 5KFVA 3NE6A 4Y1DA 1WSIA 2R8IA 3TWHA 4DTSA 5FRNA 2NRWA 3NGIA 4DU1A 3ZSRA 4E1NA 1DGSA 3DLKA 3K5NA 4I2JA 3RRHA 4KPYA 2R8HA 3V72A 3C2KA 4KHQA 3QEBZ 3O3FA 3V9UA 2HHXA 4O9MA 4UB3A 1VSHA 4CJWA 2XCAA 8ICVA 2AGPA 4J9KA 2JEJA 3PO4A 5J2BA 1ZQMA 3RMBA 4OJRA 4B9NA 2P6UA 8ICSA 4RW9A 1VRUA 4TUSA 2BCSA 2OPSA 4CEZA 4KN4A 3ZT2A 8ICNA 1U48A 2B4JA 1NJZA 4DTXA 4C8NA 3GIIA 3IAYA 3L2RA 3T5LA 2O4IA 5J0RA 1ZQHA 3CYMA 3WNEA 4DF8A 1ITGA 4HUFA 1WSJA 1L3UA 2PFPA 4CJVA 2I5JA 5IINA 4PPXA 1EX4A 5DDMA 3TFRA 4ELUA 4RQ1A 2ZE2A 3HXMA 1V9PA 1ZQTA 2IBKA 3M8PA 3AO1A 1LWCA 4GW6A 4Q8EA 1B9FA 3CM5A 4O3OA 8ICKA 4YMOA 2Z1IA 4FJ7A 4DL5A 4K8XA 3K59A 3RTVA 2C28A 2VG7A 1KVAA 2B5JA 3IG1A 4N76A 3CFRA 4N5SA 2DFFA 3C2LA 2KZ3A 5CP2A 3GV7B 3AU2A 3WNGA 2RF2A 4W5QA 2G8UA 3IHQB 3NGZA 4B3OA 4I2BA 4KFBA 3RB6A 3CFPA 2BGGA 3C94A 1D8YA 5KFKA 1SL1A 1XI1A 3HP6A 2W42A 4Q44A 2NRTA 4Z6CA 2G8KA 4DOBA 2UVUA 4NLZA 3ZT3A 3VQDA 1HPZA 3GV8B 1RT5A 4CJRA 3WNHA 3HVTA 2PFNA 1BCMA 4E0DA 4JS5A 2IMWP 4FLZA 2ETJA 3ORYA 3VQ7A 4FLYA 4FJJA 9ICSA 3U6FA 1TV6A 4CHOA 5L1JA 8ICXA 4ID1A 4LZDA 3NFAA 5EOZA 2XC9A 1RT3A 1FKOA 1NK5A 4IQTA 2LSNA 3WNFA 3PO5A 1ZQRA 2NRVA 4LSNA 5J0QA 2GBZA 4F8RA 4DS5A 3FDSA 1IO2A 2QKKA 2Y1JA 3K4GA 2Y1IA 8ICFA 5KT6A 9ICIA 3EZ5A 4FJ9A 4RUCA 2BHNA 3AA3A 2HHVA 3HPHA 1C1AA 1ASVA 1BL3A 3KKSA 4PHDA 1S0VA 5HROA 3KLHA 1RTHA 4M3RA 1NK8A 4JV0A 4E7IA 3PR5B 2ZUBA 4KTZA 4FZYA 1SUQA 2ZTDA 4O5CA 1HMVA 3DOKA 4RT2A 1QSLA 4FS2A 4KRFA 4M3TA 5KG2A 3B6PA 1FKPA 2PI4A 3QEPA 4FJIA 4QZEA 1EP4A 4I2IA 1PZNA 4DU3A 2Q3SA 9ICPA 2BKEA 3HWTA 3MXJA 4FK0A 2QKBA 5IIMA 5EU7A 2JLEA 5EWFA 4KREA 1RDDA 3D45A 1WNSA 1S6PA 3NF6A 4M45A 4PUOA 2UVVA 1BI4B 3KHRA 3LP2A 2HVHA 1S9EA 4CEEA 3TARA 3OYMA 3BQ1A 1ZBLA 9ICWA 2G8IA 4W5RA 2PI5A 4CFAA 3ZT0A 4FJKA 1C0UA 1U45A 3HM9A 3S3MA 2NRZA 4GXKA 2RDIA 3C23A 4FM2A 3D0PA 4KB1A 4XUSA 3SV3A 1EKEA 4UB1A 9ICTA 1VSFA 2G8HA 8ICJA 3L2QA 2W9CA 3QEVA 4CFCA 5KFOA 8ICHA 3SCXA
chains in the Genus database with same CATH superfamily
5EWGA 2PMHA 2X1FA 1JCGA 1FO4A 3HPOA 1R8PA 5DDPC 4PG4A 3LVVA 9ICMA 4ILRA 2IJRA 2MKKA 2CUYA 1J5OA 2YY3A 1JLFA 3M3ZA 1AUSL 5J2MB 4DPWA 1FRLA 2R7XA 3JQMA 4KLMA 1BE4A 1D1UA 2ATCB 2CAJA 2DHSA 1HNWK 4M5LA 1T7PA 3HSGA 2HF3A 5A0YB 4C4SA 4JKFA 5M2PA 4F25A 3V9XA 1TYQA 2AJ0A 1SKRA 3QEAZ 3ZTQA 2V2KA 3GL1A 1JLGA 2R7TA 2F96A 2ZF5O 3WXLA 2O8BB 2BMBA 3ZFVA 5DB7A 3CCLN 1NPKA 2M0GB 3AQFA 3QRQA 3SUNA 4HCBA 3BS5A 1SZHA 1MN7A 4E1MA 5DBAA 2DF4B 5J2GA 4JV5K 4FYVB 1WUUA 4LF8K 2OPQB 4LF1A 3NF7A 2H3VA 5AI5A 4C0ZA 2HK2A 4ISFA 2GEMA 1LWXA 3LH2S 2RH3A 1GOAA 5DO2A 4DO9A 4ILLA 5AFUH 2ZJ8A 2RMLA 3ZSZA 2LEBA 3LP0A 2AYGA 3S9HA 4ZCKA 2AYBA 3CP8A 4AM6A 4JI5F 3LWLA 3GMGA 2OKQA 4NA3A 2PFOA 3AVKA 2AF6A 4KGMA 1TTHB 2MPUA 4JWMA 2ISOA 2GOLA 4M8LA 1HNXF 2WFAA 4RQ2A 2OD6A 2PAVA 5AE3A 3CHWA 2OTJS 2PEHA 1RT1B 1NO8A 4NRUA 3AY9A 1A5XA 2I7PA 1MA7A 2KKPA 3BS7A 2ZE2B 3QGGA 3ZZZA 2WK4A 5ALXA 3FC4A 2D74B 2E5SA 5AJ3F 1J5EK 1P90A 1S7HA 3C65A 1PAUB 4P72A 4LBHA 2A3JA 4OYPA 3HULA 3D2FB 2MY7A 3LALA 1YJ9S 3KDOA 5GADU 3RH6A 2QMUB 5C42A 4RNNA 5AKHA 4RUAA 4C8OA 1XQSC 3V7LA 4LSLB 2HBQB 1VDVA 4ECUA 2QFJA 2W25A 4DR6J 2YN4A 1UT8A 1TL4A 2NRHA 1C4AA 1J5EF 5AJ3K 4AP9A 3G6XA 3UKUB 4MN4C 2L08A 5AXKA 1XHZA 3PSTA 1ZXOA 2J8SA 3M6KA 5CD4H 1FJGJ 3MEGA 3RJFA 3UNGC 3M1VB 3SDEB 3QX7A 3OSNA 3F9MA 1HNXK 3QU5A 2XMTA 3J81O 4FLTA 3CCJN 5GAHU 3RB3A 3GIMA 4KBIA 1UEVA 3DN9A 4OHZA 5FPMA 3R5AA 2F5GA 3RJGA 4A8XA 4OKJA 2RQKA 3AVBA 4P4PA 2HSZA 2E5HA 9ICFA 2FBXA 4XH4A 4R64A 1KD1O 1L8LA 3PYFA 3KWIA 4O3PA 3UPQA 1KKXA 2ADCA 4JI3F 5KGXA 2BQRA 2OUGA 4B1WB 1S4EA 4LFBK 2DUYA 3NWRA 4MIAA 4FJMA 7ICUA 3PYEA 4M94A 4OJPA 5A8KB 5E3AA 1J53A 3QT6A 4NLCA 5D4BA 2Q0ZX 3QXGA 3HFVA 2LYVA 4FM0A 1RT1A 4CH0S 3JQJA 4MLEA 1OXJA 4KKOA 2AIRB 2VOOA 3QLHA 2CJYB 9ICGA 1FJGK 4Y00A 4M6WA 1RTDB 2EPIA 3M8YA 4EX6A 3OYJA 5B08A 5MLCQ 2DKXA 3UVJA 4M04A 2CG8A 1OVQA 3R5DA 1RQNA 2CPXA 7ICFA 1WSHA 3E8OA 3OBWA 1WC4A 1RT7B 4B9SA 3D6FB 1ZC6A 3RRKA 3KG1A 3LP3A 1U4BA 1TKDA 3AB4B 3H8MA 5BRHA 3QAEA 3T6BA 1WWVA 1V6HA 4OYZA 1PYSB 2AA4A 4LSLA 1YJ7A 1FTCA 3DOLB 3HRGA 4FVMA 4DV3K 4IFYA 3KUEA 5D78A 4M5MA 3QICA 2EANA 2ZQBA 2I1RA 4YS2A 4FPBA 2QO3A 1P9QC 3D6TB 4FBUA 1ZQAA 5GAGI 2AT1B 1QAIA 2K8CB 4A5BA 4KY3A 2KH9A 1N5XA 3ISBA 4I6WA 4PCQA 4USUA 3FBCA 3U9ZA 3SMZA 1GTEA 4CO2A 3G82A 1OH7A 1KFSA 2UUCJ 3N0VA 3TUPA 1NRKA 3H3OB 4QOZB 1WCNA 4NRTA 4J03A 4Y2QA 2QL7B 2YKOA 4QCLA 2YWGA 1NB2A 2RU3A 3PJXA 2XY8A 4DCHA 1GX6A 3TR5A 2GWKA 3H08A 2BCVA 3GU3A 2DWQA 1LKYA 2O1PA 2CGJA 1Y9OA 1JUDA 4JI6K 3ISCA 5ALEA 1MSWD 1UW4A 4A47A 3LPEA 1ZBTA 3OXFA 1TL1B 4M3UA 5H2FU 5BYSA 4C9DA 4C1NI 3KJFB 3H45C 3MMCA 3RH4A 4LRCA 4WE1A 2OO4A 3GBTA 2AV5A 1MW7A 2AEMA 4A2AA 5DK5A 4JI2F 1RYUA 3KLGB 1WSRA 3CPWR 3LM2A 3S8SA 5ADXA 4XEIA 2YHYA 2HAFA 4ERDA 3VQ4A 4CHZA 4WKRA 4AHRA 1FDDA 3E66A 5CJ7A 3L4PA 8ICIA 3PFEA 2M4MA 3F2CA 4FK4A 3ITHA 5IQQA 3EN9A 3M2RB 1T3QA 1VC6A 4M5IA 4K8ZA 3PEHA 3U1NA 2I1QA 2DY1A 4NLKA 4OYMA 4CIEA 3R3TA 1RNHA 4EYIB 2AJQA 3MWTA 1RAAB 4Y2UA 3HD1A 2WB1F 5DQIA 3NGTA 9ICCA 2FDNA 1I5OB 4O44B 3EGVA 1K73O 5KFQA 4M9LA 1DRGA 2NXJA 3O1BA 1B0VA 1VIXA 1ZOLA 4NI2A 3MOJB 4CERA 2V8GA 1OWXA 2UVRA 1SIWB 4ZPAA 4NB4A 4DL0C 5CWRA 1UOCA 1LFWA 4J9LA 1L3VA 2ADBA 3E01B 4DF4A 4YG2A 3PCOB 1HNVA 4KAZA 2FPLA 3UKRB 1BCOA 4L76A 1HKGA 4BC5A 3Q0AA 1L3TA 2H3ZA 4OJLA 4ELTA 3HT0A 4X65K 3SYZA 2ZG6A 1ZTWA 4FW2A 1W2IA 5KFCA 1NI3A 2CJQA 1QJHA 1ZD3A 2YB4A 4BX9C 2DPJA 4TUQA 3CERA 3RGIA 3NWGA 3UR0A 4IOCQ 4E7KA 3L2WA 4AHVA 4DMNA 4C1NK 1XERA 3SR6A 1WF0A 2UU9K 3K9JA 4DV1J 3MGIA 2XMKA 3TABA 3OR2A 5F0WA 2LU2A 1ZQXA 1NHVA 4WK3A 4CLPA 3LQVA 8ICZA 1NJIT 2PDAA 2GVZB 4C0HA 4D3GA 2OANA 3SMPA 5C12A 2HWHA 2J6TA 1UPPA 3DOMA 1T11A 2BBEA 1HMVB 1NGHA 1K1SA 1Y11A 1TAUA 1HYZA 4W5NA 3B8HA 1Y5NB 5KFPA 2KDOA 2YNFB 3IP0A 1A0OB 4UW2A 1VQ9N 1WTFA 5HOOA 5J2CA 4I2PB 4DG1A 3N5FA 3V7KA 1TL7B 2V50A 2G4BA 4DLEA 2IPOB 3ZZUA 4W5OA 3ALRA 4OYAA 2WBMA 5J1PA 1CC7A 3HYFA 2AGQA 1Q4RA 3GWCA 2P9NB 5GAHP 3DC2A 4RQ5A 4KITB 1S1WA 4U67L 3RMDA 3I33A 2C3YA 2W4CA 3PM9A 1X1PA 2EEYA 4Q8FA 1WOPA 4EHUA 4JV2A 1VSLA 4HLBA 3IDHA 4LF9F 3GZ7A 3HZ6A 2KHOA 2VL1A 1XO1A 3KLFB 3Q24A 1RDCA 4HH1A 4DX6A 5CR4A 1RU1A 3C1ZA 2RQCA 4Y2RA 4M63C 4ER8A 2XY7A 1X31C 5AI6A 4J9NA 3HRDD 2A1JB 3FSIA 2KN7A 3QIOA 3H7HB 3HHLB 3LM9A 4C0BA 2KW4A 2QL9B 3B78A 4KTWA 1OO0B 4YR0A 2C3PA 3CJTA 1K1QA 4EIAA 1IKVB 4NLWA 5D3GA 3S6EA 2EKNA 2YMMA 3E1YA 3ADAC 1WEXA 5T7BA 3IG5A 2J6UA 3W62A 2BX6A 3TA2A 3OVSA 4X2BA 4DKWA 3CUNA 2IFXA 3CMAS 2ERRA 3NAIA 1NPRA 3ISND 2BPGA 3C16A 2RRBA 2QYCA 2MZJA 4RQ0A 4USJC 4J90A 2ZIUB 2H9ZA 3NMRA 1WKJA 2ROEA 3NL0A 2VONA 4DUZF 1HIWA 2XRIA 2CWKA 2IHR1 4O44A 4F92B 2BKOA 1TUUA 1S57A 2P5OA 4EMDA 1VQ6S 4ED2A 4U7CA 4YFUA 5IXUA 3CIZA 4FBTA 3ZX2A 4CYUA 1HYSA 2HGNA 1TQLA 4KH5A 5E0OA 4JKDA 2YKQA 1APSA 3P39A 3QIPA 1EXQA 4OHYA 3IN5A 4LF6J 3Q8QB 1VQLN 1E4GT 1GTHA 2OYYA 3BKFA 4DV2K 3THXA 2QV6A 4J9VA 1L3KA 3FVYA 3A5NC 3OW2M 3JPOA 4MYTA 3E51A 2H51B 7ICLA 1F44A 3Q83A 5ALUA 3CC2S 5F3XB 2HVEA 1MWQA 4EK2A 2DXEA 2UUBJ 3ED5A 1QTMA 1VQPN 4JEPA 4EUVA 1RWXB 1XTZA 2C3OA 5IC6B 1XJWB 1KQSM 3SQGB 5F8HA 3PYDA 4NYPA 1Q82O 3RAQA 4NLTA 5E79U 4HEA9 3PV8A 2UU9J 1X9MA 3HHLD 3MAAA 4IH5A 4MK7A 7ICTA 2Y0SD 1QZ6A 2GAHC 3A4TA 4YOUA 3MM5B 5IT4A 3VAJA 4OYXA 2P9SB 2HSTA 5GAEU 8ICMA 1IG8A 4Y2JA 5J2FA 3PACA 4AF1A 3MWPA 3MGJA 1YHQS 2C2RA 1KNZA 1ZOTA 3O9UA 4WQ5A 2QT7A 1X9WA 4NLQA 3U4LA 4CJ5A 4DV6K 4AQYF 2D69A 3MDAA 1X9SA 2X1GA 1AFIA 2HHQA 3DYAB 1EP4B 4BQZA 1B92A 3M30B 4ZVOB 9ICOA 4G1QA 1R6VA 2J4RA 3AJDA 3BB5A 1MC8A 1DQ8A 3A8IA 1E6VA 1BIUA 1ZBFA 3G6YA 4KO0B 3HPGA 3BBBA 4QZ9A 2IHMA 2K4PA 4DWIA 4PXEA 2DR5A 3KK1B 5KRTA 3AJ1A 1LW2B 1O08A 3U9DA 2RE1A 3TQEA 3MMAA 2CDQA 4OLAA 4NCAA 3MM7A 2BOAA 2CQ2A 2D3ZA 1UHUA 2W54A 2DTUA 5J0OA 3AD9C 4R63A 5D6GA 2BTFA 4LBIA 2D41A 2JVOA 2E8MA 2YX8A 4CGZA 3KJVA 4DUZK 3M9MB 1IBKK 1SCJB 3SENA 4KR0B 1LKYB 4I2FA 4LF6F 1Y97A 5HSPA 1TV6B 3J80Y 4DTJA 9ICRA 1XR7A 2IM2A 1N6QB 5F8GA 3DOLA 3AO4A 3HJVA 2IRUA 3ZTSA 4MF8A 3HLUA 1W97L 5DB6A 1V5VA 3DRRB 2P9UB 4UB5A 5GAEP 3CC4N 1ZQPA 4OV6A 3JSBA 3ZZOA 4B3OB 4CFBA 2NO4A 1SQFA 4CF4A 4JWNA 2B6AA 3M05A 3EPIA 1IXKA 3CJ7A 5AXMA 4J9QA 8ICLA 2KHQA 3HSCA 5AKEA 4DPOA 2R8KA 3NMUA 3ID6A 2Q2RA 7ICPA 1GLDG 3PUFA 4TVAB 3NVZA 4M41A 3R7NB 1MWKA 4TU9A 3K8WA 4X4QA 3UCZP 5HP4A 1HNIA 3L0QA 3DXMA 3V4IB 5LT5A 4DR6K 3IFRA 5GTIU 2N4CA 3BH7B 1Y00A 2WF9A 1CULB 2D8CA 4L73A 3WK9A 4UB4A 4F4ZA 1JQGA 1Q5VA 4CZMA 2AX0A 1RTIA 1YT3A 5KG3A 4X65J 2HGMA 1OS5A 3QJJA 1MQ2A 2NYHA 5K5MA 1QDUB 2HNYA 2A10A 5CCLA 2V7ZA 2WOMB 2MXYA 4JYAK 4PL7A 3CJ3A 3GONA 4RNMA 4IOAQ 2YKNB 2KJWA 3KG0A 3AAWB 1VRUB 3SBMA 3D3CJ 4N8NA 2WW8A 4QW8A 2IAJA 1U6FA 4PL8A 2ESEA 2DK2A 1VQ8S 5H9EJ 2F1JA 4NASA 1SKUB 4ZVPB 3C7NA 4O0JA 4Y3CA 3ZZTA 2J6SA 5M1PA 1C4CA 4NLSA 4DSFA 4JUZA 1KLNA 2CQ1A 3IRXA 3C15B 4GVBA 5D0EA 4BRMA 2X6SA 1FVSA 1B64A 4YFKA 2XMWA 3NBPA 2G2ZA 4NXNJ 5B5EU 2Z1HA 3DGPB 4Z4FA 3KFWX 3I0RA 3F56A 3H8WA 3LP2B 1JCFA 4KH4A 1YI2N 3OLAA 4CVNE 4CI0B 4TY8B 3MI7X 2D0AA 1PUZA 1VSMA 1N0UA 2HPUA 4CRXA 3NS7B 3TO8A 1S4FA 1HNZK 4ZOHC 4DL3A 1VK0A 3HD2A 1FFSB 4DQ8A 2IHNA 2LA4A 4BHQA 3CJAA 3J80O 3RJIA 1KQFB 2MKIA 2H3GX 4JYAJ 5ALPA 5AQNA 2ES6A 1A76A 1MLAA 3DOMB 3FBBA 1HX1A 4NLXA 3EKSA 4DFJA 2ZM6K 4HI1A 1JIHA 4Z4GA 1OY8A 2KVQE 3JS9A 3VAGA 5BJRA 4TLRA 4UF4A 1Z25A 3S3NA 2LYAA 2GO7A 3B6OA 1TL3B 2XY5A 1I39A 2QB0B 2G13A 4OYIA 5THWA 4J2BA 4DQIA 4DMZA 1YJRA 2KYXA 4DV4J 3H4BA 3A0HU 1CZ9A 1WC5A 3UDCA 2RHFA 4DSJA 1NJYA 3O5TB 3AVJA 3BN7A 3ZX3A 1C2PA 1CZBA 3BKTA 1S9GB 4Y28C 1LW0A 4AH9A 5KFDA 3QYYA 3GG0A 4HAIA 3ATUA 3MPVA 3DKDA 2CPFA 4P0QB 1RK8A 2HW3A 2I5JB 3RU0A 3HSDA 1M5PC 3AA2A 1VSIA 3O3HA 2G07A 3T1HK 1AQ6A 4B9QA 1ROFA 5BYQA 3F5TA 5KG0A 2DR8A 1HYVA 2WBNA 1JNRB 2LXFA 1FERA 1KLMA 2HBMA 4DR5J 3J7ZO 4R8UA 4K59A 4IBNA 4PY5A 4A8QA 3LZJA 7ICIA 2BUPA 3WKAA 3CCMS 3CIPA 2W7OA 4ZDNA 4O3RA 4R5PB 2FF3B 4YOWA 4X66K 3JQKA 2NPIA 2WONB 3PKMA 4GKKK 2PIIA 1NJXA 2J9DE 4DV7J 2RB7A 3RJHA 4DUYK 2R8JA 1H7XA 3SK3A 3RBZA 2KG0A 3BPDA 1NBWA 4TQSA 3VCDA 1C0MA 3CD5A 2XLIA 3L9ZA 2QW9A 4NEYA 1U2CA 1RYRA 1FK9B 2OTLN 4PKHA 7ICMA 5LSOA 3S41A 3VEYA 3JAMY 4DHVA 2QWRA 3OV7A 4CHNA 1IBMK 2LQJA 3C95A 2X3DA 1EQYA 4X64F 2DTJA 2WC9A 4ILMA 2I9SA 4GO5X 3BO3A 2A5XA 3EVMA 3AXMA 3AV9A 4WYLA 2XMAA 4H0XB 1CPZA 3NXZA 5DJBA 2CADA 2QARB 1QE1A 3SNNA 4ECVA 1ZQJA 3I31A 4AL6A 4B9VA 4MFAA 4DQSA 1QD1A 4RCHA 5KFWA 3ETRA 4JAXA 5D0RA 2EFNA 2RQ4A 1ZM2A 1B7FA 4CJFA 3KKFA 5AQLA 1F0XA 1Q7LB 2MKSA 4F3TA 5KTQA 3POTA 4P6QA 3LGHA 4LJXA 5J1NA 3ISNC 2E1ZA 5D4LA 1RQ0A 1JJ2R 1HNXJ 4OHXA 1EQMA 3AMZA 4LF6K 1JXLA 4CK1A 4CZIA 1H38A 5L1IA 5DDQC 4PQAA 2EWHA 5G5HA 5KFBA 2DBYA 1N62A 1CJVA 4USWA 1XNSA 5KNIA 2IVYA 7ICGA 5IIOA 4BXOA 1S79A 4ZP6A 3H8JA 4WZQA 1QLNA 2ZTEA 1DQAA 1KSPA 1T9UA 4JV1A 5I42A 2O8DB 4DL7A 2F7TA 1WHWA 5DGBA 5C5JA 3JB9k 2NXNA 1N5YA 4GMKA 3QZ8A 1X8DA 1NBEB 4CI6A 5KAFU 1LFPA 5KFLA 3F9KA 5AQSA 4AILC 4RWWA 3CCZA 3IR7B 3NNAA 2KXHA 3MCOA 2V0NA 1EHWA 3EM1A 4QIWD 1U47A 1IBKJ 4QU6A 4PABA 1QVFR 2Q0RA 1B4FA 5FROA 2ZJRL 5ETVA 4QZAA 1VRTA 4OI2A 4Y2MA 3OYCA 2HVDA 1JXBA 4J2DA 2YWWA 4YR3A 3R1LA 2JWKA 1HPMA 2MLXA 3P4UB 1VSEA 3UCGA 2BE7D 9ICNA 2V34A 2UUWA 3CQXA 3TWZA 1UCNA 3JTNA 4EBEA 1S9FA 2H5JB 1PO6A 3KOOA 2B8QA 2GV1A 3HJFA 4DCJB 3HVTB 5HRSA 3MM5A 3H4DA 1U02A 2CQIA 3R1HA 4ZP7A 3AY0A 3H2LA 2B3TB 2VIHA 4DOZA 1DOQA 2QARA 5AKGA 4IDHA 3MPUB 4FP9A 4ZIWA 5AI8A 3AFGA 2EH9A 2MYFA 3CNQP 2FBTA 2Z1GA 2VF3A 2BOPA 2BCUA 3IC1A 3M32B 2HOFA 3AVFA 3TAFA 4P7TA 4K4HA 3BPSP 2A1AA 3TP2A 5CZVA 4BS2A 7ICEA 4QS9A 2DO0A 4ZK7M 3V9WA 1RYSA 5HR6A 4OJOA 5KFEA 3B0XA 3UQ2A 2LBOA 2AMCB 2ZBIA 4CNQA 5DBBA 1FVQA 3N6MA 2RDDA 2D1KA 4M9HA 1CJVB 1FRXA 3BEGB 4M95A 8ICWA 1RDWX 7ICRA 4FWPA 4K42A 3VQBA 4CJ3A 3PX6A 1ZQKA 3MM6B 2XLKA 3K89A 3TYTA 2GJ2A 5AM5A 1LB2B 3VA0A 4V1Ak 2KVSA 3D2SA 1N5VA 4X4OA 1IBMJ 3PHTA 1RXVA 3S01A 4U7UD 2Y1LB 5CABA 8ATCB 3NVYA 4TU8A 2P9IB 1T03B 2X6NA 3N4QA 5J2AA 1WC6A 3BGFA 3V81B 2PA8D 4IG3B 3CNHA 1WC0A 2AP1A 4HVZA 4OPAA 5EE3A 3GZFA 2NXUA 5A8KA 2QLWA 3BSOA 3OYNA 1HUZA 1FKAF 1N6QA 2OWOA 5ALGA 4GXJA 1KKHA 1YJWS 5CR0A 5J2QB 4YOYA 2JZ5A 3OGUA 1RU2A 4HR2A 2W03A 1GMVA 3FKBA 4BR5A 4B3RJ 5KFMA 3HHDA 3OY9A 5TISU 3ULEA 2QMWA 4KLTA 2Y0BB 4P4OA 3SCLE 5KOXA 2KK0A 4C3MA 2AWZA 4EEKA 2AKWB 1NDPA 5EX5A 3UVJB 1HNZJ 4EHTA 4LF7J 3Q23A 1VQ8N 4FLXA 2C22A 1OYEA 3SXLA 4FWRA 3RBEA 3WZ0A 5LMUK 2FMQA 3P8BB 3UDEA 2N7YA 2VKRA 1YJTA 5BXIA 2V8VA 1V38A 3KMQA 3P3DA 5E84A 3VESA 4JK7A 3ZD9A 1TAQA 1JROA 2YWFA 1KC8O 4KN7A 4CJ7A 4HTIA 1AXQA 2P9NA 2F8TA 3OYLA 1Q79A 4JI2J 3BQ0A 1RDFA 1XK8A 2J9CA 5BR8K 3HP9A 2O8FB 4NL5A 1H2VZ 5ETPA 1HL6A 2BW7A 4ECZA 3OYAA 4NYNA 3NKYA 3IMQJ 4M6WB 5L46A 1HUXA 1QVGM 5BYRA 1YSJA 2FLNA 1CJKB 3ZSVA 4R0JA 4ZKAA 4DV0K 4X5VA 4HKQA 5CA7A 3NNHA 4NMXA 2VASA 3N4PA 1LXNA 1HUOA 5AIBA 4TXSA 2A6OA 4LY7A 5LJ3Y 4H03B 1RT2B 4Y1DA 5MAOA 2E9TA 2NRWA 2B4UA 2EK1A 4N8OA 3N5BA 4E1NA 3OPKA 1A6LA 1KBRA 1NLVA 5LJ5Y 4BRLA 3VEXA 4FYWB 3G6ES 4I2JA 1VI7A 2F77X 4RBVA 2FJWA 3C2KA 1R0CB 3O3FA 1FD2A 3IBPA 1M6YA 3CRXA 4EI2A 5ELZA 4LVNP 2GJFA 2J9DA 4O9MA 1VS3A 3TA0A 2L5YA 2XCAA 3DU6A 1RA6A 3BY5A 5B66U 2AGPA 4J9KA 4FWMA 1ZQMA 1YRTA 1IWGA 4B9NA 2XZDB 3G2XA 2OPSA 5HROB 2VGMA 1U48A 5E7OB 2IBOA 3C8YA 4BRIA 4DTXA 2BKNA 4C3LA 4RWTA 4C8NA 3GIIA 3IAYA 3QJPA 4DF8A 1RHQB 5J1EB 3ITHB 2L9DA 1GLFO 5KPTA 1TKZB 5IINA 4PPXA 1NGFA 1FEHA 2K89A 1NAQA 1XBWA 3R2DJ 3G82B 1BQNB 1NHUA 4DI6A 2KSOB 3F0NA 2IBKA 3M8PA 4FWQA 3HHKA 1TE2A 3I4PA 2D3UA 3JS6A 2VQEJ 2W41A 3NS1A 2MQ8A 2W3SA 1BO5O 3SQIA 3A12A 3CSKA 3L4QA 4JI7F 2E8NA 2Z1IA 5DETA 1HLWA 4DL5A 4K8XA 1DKGD 2C28A 5IT9Y 2VG7A 2OHDA 3KXDA 1WEZA 2B5JA 5A8RB 2VQFF 2OI2A 4N5SA 4YOTA 5F8JA 2C2NA 1FIQA 2OEHA 3GV7B 2V4JB 3W0LA 3NGZA 1JCEA 2E2QA 2C2MB 4KFBA 1N32F 2E5JA 1QQ5A 3W65A 1SL1A 1X9JA 4KIAA 1VJ5A 3LTOA 5ALOA 4JI3J 2NRTA 2K3IA 3QMLA 2G8KA 2AX1A 2UVUA 3AQOA 3GV8B 1RT5A 3WNHA 4UT4A 4JS5A 2IMWP 2PBDA 2ETJA 3ORYA 3UPFA 1TV6A 1X3NA 2FUG9 4R79A 4MLHA 1RQLA 2CIMA 5ALWA 4ID8A 2KP7A 2V2QA 3J7Z5 3WNFA 2IVFB 1RWPB 3CPWM 2NRVA 3FDSA 3AGKA 5HBMB 2MKCA 2Y1JA 4ZVGA 8ICFA 2IOFA 5KT6A 1XNRK 1U1QA 2YMPA 3CT9A 2ZUAA 3IFEA 3HSZA 1C1AA 3VEVA 2G0JA 1ASVA 1BL3A 1SZ2A 3MN6A 4PHDA 5AQTA 1D9AA 4WFYA 2L41A 5L39A 4E7IA 2Y0SF 4Q2LA 4OHWA 3M6ZA 3SD7A 5C7PA 1RAGB 4LF2A 4IOCL 2PI4A 3TPQA 4USAA 4FJIA 2ILYA 3RYLA 2RHQB 3P96A 3UMGA 1QE1B 1PKUA 2BKEA 2UUTA 4MDAA 3HWTA 4F0HA 4V19J 4K4WA 3TVKA 5EU7A 2B56A 1RBAA 2JLEA 3FAHA 2V2VA 2ZWHA 4RNHA 3CJ4A 4M45A 2QA4G 3BP8A 5A2QO 4ZS6A 3VQTA 1Q0NA 4KGVB 2MQQA 3NVVA 5IM0A 2E1FA 2RHSB 4IQXA 1WHYA 4GV6A 1U1PA 3C3LA 3VAMA 1VQ7S 4FM2A 1RB0A 4CLTA 1SWWA 1EKEA 2H3QA 4FOEA 8ICJA 5AQXA 4CFCA 1TMMA 5KFOA 4GKJJ 2QWQA 4PL1A 3VETA 2C3MA 3GR0A 5GVQA 1XWLA 1WTBA 3ZDDA 1B0PA 3J8AA 2X51A 3QFUA 3LP1B 1HBMA 2OP5A 2PY5A 3DM2B 2RE2A 2QLTA 3W3DA 4KHWA 3OS0A 4DU4A 3BKUA 2W1BA 1OVYA 3A3NB 2LVWA 4Y34A 2PMZD 2WAQF 3N97B 2DCUB 2P5GA 2UUBK 4Q45A 4Z7CA 4IOAL 2A0FB 3TSQA 3C15A 5AKZA 2U1AA 4UARA 2R2RA 4CZCA 3SIPB 1M1HA 3CCSS 2DGWA 4X4VA 4PHTX 1V3SA 1VRTB 3RH5A 2F8EX 3HSTB 4A8MP 3AUOA 2NRRA 4H0YB 1RE1B 5EE9A 2MDAA 4OFZA 3MECA 3R7SB 2ZIUA 1ZM4A 2KZMA 5IWAJ 5CZXA 3LGNA 2NXCA 2IGIA 4OGEA 4ZHRA 3NUQA 4RPYA 2YI1A 3I0SA 2R2UA 4CP5A 3NDKA 1ZZFA 4M5HA 5LXRA 3C5GA 3PXGa 3PJ9A 3CW2C 3Q8RB 2BDPA 1YJNS 3CQYA 2RRDA 3WQPA 5A6PA 3T1YJ 4DXLA 3WK8A 3DI6B 1XS9D 2HMPA 3DFEA 4AXIA 1QQ7A 2ALYB 1JLQB 1CJUA 4F71A 4RQ8A 5CH7B 3MR2A 5F0XA 2C2OB 2QM1A 4K4YA 4B6JA 5KI6A 2EI5A 2VKZG 1JLBB 3CCVS 2FQQB 5H1SV 3AO3A 3M2VA 4USKA 2J76E 2PYLA 2PSZA 2KKZA 4JK9A 3L2UA 3MX2A 4N56A 4WQ5C 2MKYA 4FOIA 4CBWA 3BN4A 1UFKA 1FX4A 3H5XA 3I82A 2DISA 4WP9A 4WFAL 3W7BA 5KL1B 5AHXA 5AKIA 1SKSA 3MXHP 1S72N 3N79A 4TU7A 1SC1B 3L5KA 3D6RA 4G3IA 3W1YC 3IBWA 1KD1T 1GLJO 2HGLA 4DV1F 1KVBA 1RBRA 4X4PA 5M2RA 4KLLA 2FPMA 5EE0A 4PHAA 4I2CA 3FFIA 3HO1A 1RT3B 1D3WA 4DR6F 1P27B 1XC3A 2CRXA 4K2JA 2PZSA 4JI7J 2HBYB 4M5DB 1FJ7A 4U6PA 2YPZA 1J6ZA 3RJMB 1EETA 3V6KA 4G9BA 2GELA 4H5VA 4Y2SA 2UXBK 3UWTA 2G8FA 2F8MA 4K5SA 1JL1A 1WBBA 4B08A 1O13A 3LP0B 3MMAB 1NM2A 3NS6A 4QIWC 3MCSA 2IA0A 3OTCA 4X66F 3W9IA 3PNCA 5ETKA 5JS2A 4CF8A 3WXIA 2PEBA 2OPRA 2IOFK 3OJUA 3OYIA 1ZTTA 5K14A 4MKYA 2CA9A 4NLNA 1FXDA 2W4PA 2EBEA 4DHYA 3MC1A 4KQZA 2VFTA 5KFAA 4RPFA 8ICAA 1HW9A 3CCLS 5E41A 3SQ2A 3DHWC 3PZPA 3NF9A 3K1RB 3MHYA 1Z6RA 4MF2A 4KHPF 2I0XA 2M5YA 2E1MC 1K8KA 5LMNK 3E9PA 3QFWA 1U6ZA 5E3CA 1X5TA 3OYDA 2VHGA 2P1JA 3D2EA 4CEOA 2XI3A 2K1RB 5A0LA 1XR6A 3SJHA 1NDCA 4ED6A 3A13A 2OEJA 2P9LA 4JKCA 1VQ4N 5HRNA 3F5EA 4ENOA 2MTLA 3QIDA 2Q66A 1WHVA 2QIFA 4IYQA 4RLEA 1NNEA 2QB1A 2DFEA 3WXMB 2B21A 2XWXA 3ZDCA 5DLFA 2IYGA 2XICA 3MM9A 4X62K 3AXKA 4KHPJ 1KVCA 3HJEA 4C8KA 3G8QA 4A8KA 4B02A 5FJ4A 1Z00A 1D8BA 4FZNA 3MFHA 2MHEA 4O0NA 4I9LA 3PSIA 4BC4A 2KIWA 4RUBA 3A5OC 1YITS 3DXMB 1ZQFA 2ZIXA 2OCEA 1Y3KA 2E8OA 4NXMJ 4LF5F 1ZQZA 2WOMA 1R89A 5DZ6A 1NEEA 5KGWA 1NK6A 2EZZA 1SJ1A 1HI0P 2RQ5A 3IM9A 2A6AA 4CM2A 3BYRA 1J54A 2X78A 4X4RA 1JJHA 1ZQCA 3B6BA 4UZCA 4AHTA 4F5PA 4L3NA 4CT8A 3TAPA 1YZ6A 3C66A 3UD4P 2JDJA 4IQWA 2RIJA 2KHDA 2A3ZA 4Z4EA 1IXRA 2B9YA 3UIQA 4F3OA 4DR5K 4JB8B 4XPCA 4C48A 1YTUA 4DZ6A 3BV8A 2I6WA 4OPKA 4B3MK 2ZH3A 1V4SA 5T7LB 2H1YA 4ECTA 4IH7A 1NK0A 2IVOA 3ZCMA 3EICA 1OMSA 5F9NA 1BHNA 3QLHB 2IOCA 2F9JA 4OPJA 3WIUA 1GMUA 1IKWA 2B4PA 5GTHU 3OYBA 4WU3A 2WB4A 3LPYA 1SV0C 3FGVA 3FZHA 4JKEA 3Q8PB 1JLCA 3F5AA 3DLGB 1ZQ1C 2E5LJ 1BVSA 1K73T 4HYKA 2C2DA 3OUYB 5BPLA 4RR5A 2ZBRA 4FDFA 4WQ4C 4F3QA 1NMNA 4M9NA 2JX2A 1RCOB 4QZVB 3MCMA 4JD2B 4CK3A 2QSFA 3CDBA 1IR0A 2MGZA 4ZLJA 3HVAA 1Y64A 3FUYA 3ZDEA 1N36J 2P6RA 2EZXA 4AXJA 2QXLA 3O80A 5AK3A 1KDNA 5J0YA 4G65A 5H9FJ 1RGVA 2YX4A 4I68A 2GC8A 4M1KA 1RABB 4QS7A 1REGX 4ACOA 1GXTA 3ZLJA 1HD1A 3TZWA 2K8AA 4G1IA 2W8LA 4Y65A 1M5SA 3SJJA 3QIPB 4US8A 2Z2YB 2EKYA 3D3BJ 5CQGA 1S12A 1UVJA 5BRFA 3TZXA 3EXYA 2L9NA 1LK7A 4DOCA 3CCUS 4GVBB 4H4OA 3K0SA 5GADP 3WK4A 3PSPA 2XBPA 3Q2SC 3RSEB 3HVWA 3UFCX 2FVPA 3W66A 8AT1B 2I8EA 1T02A 3UN5A 2H3EB 4KLUA 1W2BR 1HWLA 4X64K 5AZJB 4WFAQ 2IVMA 1XMBA 3LDPA 4O5FA 3V1OA 1U49A 3ZX0A 2MY8A 3D6MB 4Q5VA 3ALYA 3D28A 3PW2A 1VQMN 1S6OA 1ZM3A 4WFNQ 2O67A 4JN4A 3PW0A 3L8BA 4NWBA 1T44A 2P9SA 2DL0A 4PL2A 4I2GA 3CCSN 1N34K 1TL5A 4BRPA 2IIHA 1PSDA 3CDEA 3EO3A 4M3XA 4F5NA 3ETMA 2P9CA 3BZCA 2PE8A 3V81A 4F0MA 2O8FA 1A9NB 2GJIA 2HHTA 4H0VB 1FK9A 2EG2A 1I94F 2LQBA 3DLGA 4YOXA 2ISPA 1G2EA 2VWJA 3HKWA 2Q3PA 1OKJA 2WSFC 5CY4A 5AQWA 3T1HF 1CLFA 2LFVA 1WUDA 3SSQA 3RJJA 1NLKL 2COLA 4R65A 4Q7AA 1I94J 3VQCA 3O2IA 3AQEA 2VBZA 2CH5A 4C7QA 1V97A 2Y1RI 1ZQLA 1ACMB 1BXNA 1B3TA 4J7CA 4B9MA 4B9UA 8ICYA 4CE6A 3F41A 1VLOA 2N4DA 3QZ7A 2WVFA 4UBBA 2CJBA 3BS5B 3G6VA 2W9BA 1PILA 5LOQA 3CXCR 2M8HA 1WF2A 3CDWA 4IO1A 1J27A 5DDYA 3OYEA 3TU5A 4AHSA 4YMMA 2CZ4A 1W26A 3MABA 3HHLC 3RF9A 5KFRA 1X40A 4PXDA 5GINA 1T6CA 1Q53A 5U47A 4BDPA 3OS1A 4P0PB 3P5TL 5F9LA 4FNHA 2VICA 3LPTA 4DUYJ 1S6PB 3D6JA 2XZWA 5DMRA 4E8UA 3VOVA 1U6BA 3JTPA 2GFFA 9ICUA 2FGCA 4E7LA 2RF2B 3N01A 1XNQJ 1HJOA 2UP1A 2CDRB 3MMJA 5J2JA 4RNFA 1D0EA 1T3NA 3CO0P 2AP6A 5ETMA 3AVAA 1W0HA 2MRLA 5I9EB 4JK1A 2JLGA 4C11A 1Z26A 2JV3A 4BRNA 4TURA 1UETA 2YWHA 1U1RA 2GZOA 1DBDA 3PX4A 4K4XA 1RT2A 3EY1A 3G10A 4C98A 4PG6A 3MEKA 4YMEA 4LR7A 1JRPA 2M0NA 2JL9A 5HRPA 1XNRJ 2VJUA 3MWBA 3PIOL 3JSRA 1NDKA 2KI2A 3JPQA 2NSCA 2VB6A 1Q86T 2YNFA 2ROPA 2YWEA 3FCHA 4K5RA 3G8SA 1RTIB 4MO5A 1KHVA 9ICXA 3T9NA 3O5BA 1COKA 2QLXA 4WQ4A 2HZCA 1LWFB 2A42A 1WI8A 2W2OP 2FHOB 4QOTA 3OHAA 3H0RB 3KLEB 4XIUA 1WAJA 3CETA 3E3XA 1NNLA 3GJRB 2E88A 2OMOA 1PJ7A 2D3DA 2V94A 4USMA 4ID5B 2CPEA 5GAEI 1EQ0A 4TSXA 2QA4N 2DNGA 5HMLA 3EDQB 4DCPB 4IS7A 4Z2XA 1XC9A 1BPXA 3CCUN 5J1EA 1VQPS 1VQNS 4X84A 2VA3A 1IM4A 4NLVA 1TKZA 2ASYA 4J37A 1MWYA 3FRZA 3Q8KA 2B4VA 2ZC4A 3MCNA 2HHWA 3BJYA 3H2VE 4IRCA 3BQ7A 3PW5A 5FP0A 1NGCA 1UT5A 3DXBA 3AVMA 4DSLA 1IUJA 1U0HA 3FQLA 4QPTA 4Z0UA 3LAKA 3L2VA 5KFSA 1H2UX 3FLCO 1KOHA 2ASDA 2J0WA 1URJA 4RKUC 2OSRA 4DPUA 3JSYA 2B5JB 5A8RA 1PYTA 4YXJA 4CQ1A 4LF7K 4G1PA 4W92B 2CN1A 4IL6U 2G5IB 2AJ4A 2GWJA 2JZBA 4CEDA 3D6HB 3BGRA 3SMVA 4FVCA 3WEEB 3LZIA 1SC6A 3ICXA 3MUVP 1BA1A 4F0KA 2FYXA 3NGUA 5AQJA 4C2MA 5BOLA 1QHAA 3PMNA 2HK3A 1HWUA 3DJCA 3ZZYA 5J8YA 3EJMA 3GFYA 3NRBA 3KWGA 1QSYA 2AYMA 1S77D 5BR8J 1OUQA 4UZBA 1TMJA 4EEYA 1J5OB 4FKYA 1IBKF 4OJHA 4NLDA 2YQEA 5BOMA 1ZBUA 4X4NA 1WEYA 1F3VA 4NXNF 3THWB 5HMXA 4LF7F 1RDBA 4C0OC 1X5SA 1NKCA 2ZDPA 3AD7C 2VG6A 3CF5L 3H98A 3P83D 4P52A 1DARA 3OQ2A 2CYYA 2G2YA 4OL8A 4C4TA 2RHKA 3PFOA 1KAYA 5KQ8A 4KLEA 2GX8A 2BJ1A 1RI7A 4CJUA 1VYAA 3PIPL 4ID5A 1JALA 4UTGA 5HP1A 4I2DA 2PFUA 2BJ7A 2QWMA 1CLQA 2YB1A 3AN1A 2DNYA 2RNEA 2G08A 3ZSYA 2DHGA 3CDUA 2E1CA 1N52B 4LJMA 4HUEA 2PMZF 1HD0A 2CXEA 1G7CB 1C0FA 2QA4S 4GLXA 3CEDA 2DB1A 3N28A 1RT4B 3B54A 2GCFA 2HHHJ 5KG7A 3IS9A 2GMLA 4A2BA 4QYZJ 3T41A 2ZJQL 4ITSA 4KMOB 4CTAA 4ZVEA 2G0IA 2WF8A 5J2EA 2ZZMA 3IBCB 4UAVA 3WK7A 2Z0GA 3M6WA 1S6QB 3G71S 4F4KA 2XHWA 4NCGA 5LJWA 1BPDA 2XMMA 1NZBA 1YKWA 5JVGL 3CC7N 1L6NA 4B1YB 3EL2A 1T95A 3T5HA 2OM6A 4LR8A 3BSAA 2BVZA 1ZQSA 4Y2AA 3QT5A 4CJKA 3X1LB 2R9LA 4A46A 1R27B 4HH0A 1EX8A 2RN2A 3KHGA 3OFFA 2ASPA 2EC0A 2BPCA 3NY0A 2AD9A 4BRDA 1ED1A 3N7PD 3V6JA 3AVNA 1HWIA 4ZHRB 1IKXA 3DXSX 3ISZA 1XU4A 4IDKB 1RJJA 1G15A 4KE5A 3IDWA 1TELA 3OYGA 2DPIA 3W63A 1KR4A 5DB8A 4BVOA 2QTDA 1MQ3A 4X4SA 4YB6A 1RCHA 4B1XB 1X7VA 3OJSA 2F7VA 2N1RA 5CXTA 4BROA 3A5LC 1FESA 1HQEB 5BPMA 1LOTB 2GWSA 2KKHA 1S5ZA 4PQUB 2XYPB 1DZ5A 2QI2A 5J2KA 1Q3VA 2ZOFA 3D9BA 3ETLA 4GC7A 2XZTB 2ZXHA 4F4YA 4FE3A 3M1VA 1ZQOA 4ZJLA 2A1BA 3ZYYX 4NYZA 2OZMA 4FCYA 2AJ2A 3DOKB 1P8GA 4EX7A 2GNKA 5KFFA 3BGRB 1NJIO 1CC8A 4D3HA 5FPNA 4E1JA 3AHPA 2OEKA 5F1XA 4KLQA 1CQMA 4AFFA 3OTBA 1SS6A 1B0XA 2OFGX 4AHUA 2KB2A 1MA9B 2F9TA 2CPRA 2YXLA 4CEFA 3D2WA 2BM0A 5KT4A 1GOCA 1JN3A 2G1HA 2D0BA 3Q8LA 4BREA 2LLZA 2FVCA 3AA5X 6AT1B 4YDUA 4P9SA 3KUHA 4WU2A 4CJ4A 1NG9A 4HTJA 3EGWB 1NGJA 5DG8A 3C2MA 4I2AA 1N32K 1NSKL 1OY6A 3KZIU 2OA8A 1KRPA 2DFLA 4RW9B 1Y5IB 4OKKA 4HVJA 1FXLA 3CULA 1UWAA 3JPPA 4KGXB 1U2FA 2KXNB 3HW8A 1GLCG 1VCTA 5D3GB 2KNJA 2CQDA 1NDLA 3V4MA 4URSA 2FVSA 3CC2N 4ZPDA 2IDOA 1P7DA 1N54B 1SH0A 4OV1A 2H4WB 4ZVHA 1HWJA 4QJFB 1VQLS 3DLKB 4FK2A 4ILJA 3KMSA 2A3VA 4LF4F 1X3MA 2ZUDA 2HQFA 3LPUA 2VWKA 3NCRA 3ZSQA 8ICCA 3THVA 4P0PA 4MAKA 3PKYA 3DGPA 1O1WA 2KEYA 2O8EA 1S3XA 4LH5A 1N33J 3AJ2A 3AODA 1SB3C 1RHKB 4DTPA 1VISA 4KH1B 3P45B 5HNKA 3QUQA 4NE9C 4B3TF 3R6LB 2MU2A 5IV3A 4B9LA 2VPXB 5FLXY 4MFCA 2KJ5A 1IG9A 1QVFM 1KTVA 3OTOF 1F9HA 5IOLA 4Z4IA 3EGNA 1DLOA 4HWIA 1MROB 5ALFA 2Q31A 4RTFD 5ALIA 1ZD4A 1YWXA 3NBPB 4IQVA 1RCXB 2IA6A 5ETTA 5TKWA 4I9QA 2VBYA 4ZP9A 1RDUA 3H0LB 3M5RA 3BH6B 4GVLA 5HL7Q 4NLPA 4J9UE 3VHQA 3D1QA 4M47A 2AZ1A 2A19A 3RJKA 2OYQA 5D46A 4P0QA 3K5MA 3OHBA 5C24A 3HM8A 2JH3A 4HTLA 3U1MA 4OI3A 1YJUA 3TAMA 4PAAA 4UOFA 3KHLA 4OYWA 2E8AA 5C2DA 1KVKA 3C5FA 2LYHA 3DRSB 3FSYA 1N56A 4LC9B 2W7AA 3ENOA 3GV5B 2HDOA 1T9XA 2OPQA 4H0TB 4F9OA 2F4FA 5ALVA 4IQUA 3SEOA 4UB2A 2QLBB 2E2NA 2E7WA 1S0MA 1EO1A 3UE5A 1XQIA 4H4MB 3IKMA 4YY3K 3GR1A 1S49A 3CQ8A 4O8UA 1YF5L 1JLFB 1OYDA 4KV8B 4P74A 2ZIXB 1WCLA 1U0HB 5KFZA 1UVKA 2R7VA 2CQCA 3OSPA 3ZXWA 2QEXN 3G8TA 4QZBA 2JEGA 3MF5A 5J2PA 3ENVA 3O8MA 5D4OA 4CLUA 4PH5A 3O6QA 3OT9A 2VBWA 1S9EB 1VC0A 1YIJS 4WF9L 2JVRA 1E6YA 1RTHB 3K17A 4EGLA 2FBVA 2KRRA 4QR1A 2DT9A 4ZPTR 4NCBA 3AT1B 3F44A 3M8RA 1WAFA 3J7ZT 3C28A 4UY85 4RU2A 4WYBA 1F5CA 4DR3F 1F60B 4PGXA 3MAQA 3R1XA 4CZLA 1AA1B 2Z1JA 4M9JA 8ICPA 4C7ZA 1MNEA 3DM2A 2ZC3A 4P2XA 5DDOC 4LUBA 4KHYA 1BU6O 2ACYA 2B43A 4RG8A 2IM3A 2UV8G 4OPHA 4Y2IA 1HHSA 4Y1CA 1UVMA 1X5OA 4NX9A 1RWMB 1RXWA 2UVWA 5H9EK 2HNDA 1U9LA 3O8WA 3MAHA 4J5OA 3EYZA 1NKBA 5EHHA 5DKWA 2NUBA 4PG5A 1RTJB 1T3VA 1SJRA 2D4WA 1JLBA 2H48B 4NLGA 3HX0A 1QSSA 4FJXA 4ZVTB 3W64A 2ZEJA 4AQYJ 3QFPA 3E2EA 1YJ9N 3OUYA 2F65A 3V6DA 2K2PA 4NXNK 2AJFE 1BY9A 3CB4A 2YHXA 1OH8A 1OQ6A 4IEIA 1VAZA 2KM8B 3MGHA 4QWEA 4K7QA 2B6AB 3V9ZA 2Z8QA 3TSUA 4TY9A 5AKKA 5CYMA 2DITA 1M90T 2P5VA 3KOAA 3FGUA 2FC0A 4UW9A 2OXOA 3W2VB 1UA1A 1FE0A 2JFDA 3DLLL 3Q7BA 1UEUA 1B70B 3L7UA 4WJ3B 2QLFB 3L3CA 3ZT4A 1H1VA 1NGIA 4CRJA 2ZUGA 1TL7A 3MCPA 5ALYA 4DBQA 4IKFA 1FE4A 2K4HA 1XMQF 2UXBF 3QYPA 3ONQA 5AXNA 4CFDA 3TUZC 2KG5A 1FJGF 2FZKB 4XPEA 3QT7A 3EEQA 3OL9A 3TQ1A 1IN0A 3FJ2A 1WC3A 4YP3A 2J7WA 4QW9A 2ZM6J 4A48A 1VJQA 2GLEA 3LDNA 4BQLA 5HP1B 5AQFA 4Z6FA 5KG4A 3DRRA 3ETOA 2UUAK 5ALRA 4DR1K 2UUCF 4YB5A 4DR4F 4MIWA 3QE9Y 3IRXB 4A8EA 2E1AA 2R7WA 4O0IA 2WVEA 1HARA 3FEZA 2XSJA 5HQLA 3M8QB 2UXDJ 1B0TA 3O9SA 4Z4CA 3JXOA 4CGGA 4CCHA 1Q81T 1RSCA 9RUBA 2BCRA 2ZZNA 1GLLO 1QCKA 3IS9B 5AK4A 1CSJA 5ITHA 2V8DA 3GFHA 1RHJB 5DS7A 3C6AA 2JC0A 1DTQA 4IRKA 2R42A 4M7XA 2E7VA 1C0TA 2NNWA 5AQGA 4EBDA 3RRGA 1HQEA 3O6WA 5JS1A 3G0ZA 4RNOA 4NCGB 3QNOA 4DPXA 2Q79A 1Q3UA 1Y7PA 3U1LA 1CULA 2VANA 2BCQA 5HVFA 3ZETB 4EELA 2BABA 3ULDA 2HRYA 2E29A 4C8LA 3AVIA 4AM7A 3BBFA 4IFVA 4J9MA 2AHOB 1KC8T 5KFGA 2RUSA 3V6HA 3J7YU 4RPXA 2XS5A 1K5OA 3LUYA 4Z4HA 4FFDA 2V9WA 4UASA 1OSCA 3OS2A 3CMES 2HZAA 3A3OB 5KT7A 4MFFA 2PMZC 2UUAJ 3EWGA 1VSJA 1D8LA 1C1BB 2OPRB 1FDAA 3RBXA 4J9OA 5JVHQ 5ETOA 1QQMA 3KLVA 1KHWA 1BISA 1VQMS 2EW9A 3Q8SB 3BEXA 4PWUA 4O5EA 1KOOA 3O9RA 2HLTA 4I67A 4UQTA 1SJ4P 1D5AA 4M0AA 1IQTA 4FZMA 1N5SA 3CJ9A 1N60A 3OTQA 1MMDA 1ZBIA 3JAMO 3A5MC 3N4MB 7ICNA 4GMJB 4M5GA 2VUGA 3C6UB 2IM1A 4YHHK 4PGQA 2HFOA 1CXUA 4K4SA 3WKCA 2B7CB 1JL2A 2UUBF 4HDGA 4Y2TA 4BE1A 2CVIA 2HMIB 3MUMP 2FMSA 5ALSA 2EQYA 5A6WA 3T9ZA 1N36F 4CJQA 3EW9A 2X1BA 5LL6Z 3O1LA 1WORA 3WKDA 4O5KA 4FLWA 3M1FA 1SV0A 2V4QA 1VOMA 2ZNZA 7ICOA 4QIGA 2V52B 5AR0A 4HCCA 4QR0A 1ZQUA 1WSIA 2EFVA 2Y8YA 5HVHA 4K0KK 5B0BA 4QBUA 3DLKA 3MOZA 3T79A 2CQ4A 5E3RA 4KPYA 4F3MA 5ALDA 1PCAA 1RG6A 3OL8A 4BR9A 3C19A 4LIWA 4DX5A 4I56A 3BSCA 2AZ3A 3J81U 2AW0A 3GFZA 5J2BA 1J5EJ 2IIRA 4OJRA 2CPJA 4PZNA 3CIMA 4RW9A 2I2YA 2FF6A 4CEZA 3D2NA 4BRHA 1SQKA 1R8HA 3L2RA 3D66A 4F72A 5C2CA 1ITGA 2P2CB 2PFPA 1SXEA 1TAMA 2WCXA 1IM6A 4NLUA 2I5JA 3W5XA 4A62A 1YZ7A 2ZE2A 3MDQA 2KFYA 2MQLA 5I3QA 4GW6A 2BXJA 1K0TA 5AJ3J 1L8OA 5EXWA 5AE1A 2HBZB 5H1SQ 3CM5A 3UKRA 3ZETA 4YHHF 3VF6A 4PUOB 3P6YC 3MMVA 4IKAA 2OFHX 3P5BP 3IG1A 5LY3A 5BRDA 3NOCA 3CFRA 3QBXA 3C2LA 2QYGA 5CP2A 2KE7A 3F2KA 3VEWA 3AU2A 3WNGA 2G8UA 4W5QA 1T0TV 2E1PA 1T3OA 4B3OA 5AKLA 3QU7A 2Y3YA 1FKPB 3CFPA 3C94A 2ZKUA 2E8PA 2KV2A 2YX6A 4C3KA 4Z6CA 4DOBA 1HBUB 4NLZA 3HHEA 1BCMA 1XMOJ 2DVIA 3TNVA 4FJJA 2B0CA 2C2KB 4ID1A 1BNPA 3SBGA 2CQ3A 4C4WA 1RT3A 1FKOA 1X66A 1NK5A 1VHXA 2LA6A 3G9CA 2M8DB 5J0QA 1GO3F 3QU9A 2H4YB 1WC1A 3HOSA 2HRTA 4NLRA 5HQMA 2QKKA 3CJRA 4US9A 1ATRA 2G9OA 1IIPA 1Z4NA 9ICIA 1FRIA 4DV6J 4DR7K 1HKAA 2LEPA 1Q5YA 3ZTPA 3CJ2A 1Q46A 1S22A 4RUCA 2A2CA 3OBIA 2BHNA 4P2SA 3AA3A 4FWNA 4FYXB 5L8RC 4IUFA 3TAMB 4MK9A 3CPEA 4WWSA 1S0VA 2ZH4A 5HROA 4M3RA 1V3ZA 2GS8A 5CHIA 4JV0A 1AZSB 1T9WA 1V85A 3B9JA 2Q0UA 2ITMA 4KTZA 4FZYA 4B3RK 1SUQA 4DR7F 1HMVA 1ATNA 5E26A 4JNEA 4KRFA 5DRKA 5ALHA 4M3TA 1P1LA 2W55A 3BO4A 4JI8J 1JJ2M 2VC0A 3GSDA 1GEHA 4JI6F 2ZBCA 4FPAA 5ALTA 1FA0A 2JOQA 2Q3SA 1NGEA 3L4IA 9ICPA 5A8WB 3CI5A 2QKBA 5IIMA 2YQ1A 3VALA 4OZLA 1B7YB 4IFYB 2JR5A 1YG0A 1S6PA 3UQSA 3NF6A 4PUOA 1BI4B 3LP2A 2HVHA 1S9EA 2VG7B 5CD4A 1UJ5A 3BQ1A 1XMQK 1F1BB 2BUNA 4IG0B 4RW7B 4ZVQB 2P9LB 3SFGA 2XWYA 2M2BA 3ZT0A 5D77A 4FJKA 2NRZA 1UMJA 4L3QA 2ASOA 1VK3A 2DH9A 4KH6A 3HI0A 3SV3A 2JC1A 2GTDA 2W9CA 4O8KA 4HHUA 2UXCK 2DNMA 8ICHA 2DGOA 3CJBA 4AL5A 4DV3F 4WP3A 5AE2A 2WB1C 1Q8KA 3PY8A 4UOHA 4DV0F 5E3QA 4F91B 1RXOB 1T8EA 4ZLLA 4L8RB 2DHHA 2P9IA 3C21A 3OBYA 1KFDA 1KQSR 2CJAA 3I87A 3C29A 1TL3A 1HYSB 4WFBQ 4KJIA 2FLPA 3FYHA 5CHCB 4ZTFA 3MPWA 2Q6BA 4FPIA 2P9GA 3WXJA 3M8SA 2Z30B 2PA3A 3PMLA 1ZXIA 4UBCA 1BMQB 2HNZA 2M52A 1YAGA 5LMNF 5F41A 1OH6A 1W7WA 4GV9A 1WG8A 3OL7A 3LDAA 2XSFA 4KHPK 3H8YA 3VGMA 2YY6A 3VTIA 1TL1A 3AGRA 4HT7A 2M88A 3F73A 1YGYA 5LXYA 1KAZA 3V1RA 3ZI4A 3DNCA 1GAOA 2B4OA 2WTFA 4W5TA 3FZLA 1U1MA 4YD1A 3HHNB 1UWBB 3VAIA 2VODA 3WK6A 4JP8A 4CLWA 3KLGA 3SUPA 5CYQA 2BRKA 1VQ7N 1PAEX 2LHTA 1Q8BA 2YNIB 4AQYK 2UV8A 4DV6F 3PR4A 5B0CA 4CF3A 1Z1BA 2PFFB 1IBLK 3VENA 1YLXA 3HZGA 5D0HA 3CJ0A 1N48A 2ZGYA 4KO0A 1LVHA 1HBNA 3AA8A 5IWAF 1UVNA 1TUGB 5K8MA 2GVDA 3CD0A 4BCAA 4DR2K 4NXMK 1X42A 2HAIA 3TFSA 1X0FA 1QQCA 1AZSA 3BDPA 2FBYA 3IXQA 1I6JA 1EAYC 2DRAA 1RWNB 2NLXA 1T4GA 3CMAN 2MLZA 1YI2S 1EARA 2JGUA 2DGXA 4J91A 1H72C 4XO0A 1YXQA 3A8YA 2QX0A 2XI9A 5KG5A 2HQDA 5KAIU 5CHGA 2W2MP 2XG8A 3OTDA 3U3YA 1N33F 4M42A 1A77A 2KZZA 3G96A 3T1HJ 3IR6B 3UCUP 4FWKA 3HFKA 1VBXA 4A8WA 3KVGA 4EAHD 2ZD1B 5J2NB 5DBCA 1PK1B 4YMNA 1KEJA 4XAKA 4E7HA 2VFRA 1RDRA 1TVRA 5JMNA 1YUWA 2KOBA 3NGSA 3PRVA 3O3LA 1IKYA 4I2HA 4BDYA 4DTMA 8ICUA 3MD3A 5J8YC 1XEZA 3H40A 1E6VB 1YTYA 4IJNA 2E2OA 3K75D 4WCEQ 2XYHB 5M2UA 3KK3A 2XQCA 1YVUA 4TLQA 3GJSB 2GVZA 3FSXA 3SDEA 4AYBD 4DQQA 3ID8A 3M2VB 1S8OA 3AAQA 4A4JA 3OD2A 3DXKB 5K20B 1LNQA 4X64J 4M5KA 3C6TB 2WFBA 1CJKA 5T14A 4OZ5A 1NSAA 3IV6A 2HHUA 3G87A 1A6SA 3GP9A 3NASA 5JXSA 1S59A 5AK6A 4WTOB 2HQGA 1BPBA 1JLAA 3QWPA 2BYCA 4ZPBA 1LWCB 4DSIA 3FZMA 3M8PB 1G1XA 1F2HA 4L3KA 2YMQA 2IY5B 2DBBA 1WSGA 5J0PA 2X1AA 1H6KX 2DH7A 2Z2LA 5IT0A 2DPNA 2NZ4A 1REVB 2VGNA 5I3UA 3BR9A 3SCJE 3NRZA 1WG5A 4JV5F 1U2RA 5LMUJ 4ZVFA 3QRRA 3FBFA 4BR0A 2OEMA 1TK0A 2XYGB 1S1WB 3CJ8A 5F2RA 3MMBB 2HOQA 5AQVA 4HACB 3DAWA 3M8ZA 2MLYA 3TEHB 3CCEN 4JV5J 4KAIA 1S1XA 3QEWA 1OSDA 2HMIA 3SQOP 1SV5A 2EG1A 1SJ3P 2NCKL 4FZLA 5BREA 4HHHA 1ZQEA 4DTRA 5AQRA 3UXPA 1RWOB 2V8PA 3MM8B 1RTDA 3X3UA 2ACMA 2J0XA 5LM7E 5G0RB 3M9OB 4KLHA 1HBNB 2E6MA 3CJSA 1TK5A 2KMDA 2P66A 1DURA 4JI0J 3RR8A 1T6DA 4R0EA 3V4IA 1FWLA 2M7SA 1FF2A 1UWBA 3D67A 2PT0A 3FFKB 2Y0SC 3N6LA 2XNQA 1VSKA 3NGYA 2G2OA 3MD1A 5AT1B 5HBMA 3VQ9A 2YNGA 4LIRA 3ZSXA 2ZH8A 1IWAA 1Y5LB 4PQUA 4AYBC 4UATA 3I55N 3P31A 2AJ1A 2IJNA 4FF2A 1K8KB 5KPRA 2MMYA 1WSFA 5FLXO 4NEZA 1RWUA 2KICA 1LV5A 3FNNA 1HIYA 2K3KA 4KRWA 1ZD5A 4L75A 1C1CB 3G4SN