1UA0A

Aminofluorene dna adduct at the pre-insertion site of a dna polymerase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua0A01
4LSNA 3L8BA 1SKWA 4KKOA 1KFTA 1ZQFA 5IIMA 2ZJ5A 3QEBZ 3NHGA 5KFBA 2E6LA 4B3OA 1TAQA 4Y1CA 9ICEA 4FLTA 4MF2A 4CJUA 1IH7A 2HHTA 1K1QA 2OZMA 3KKSA 4PWDA 1ZQTA 2NRXA 4DQQA 9ICXA 1BCOA 1NKBA 4NYFA 4GXJA 3GDXA 1BGXT 2YKMA 1ZQOA 3T5KA 3ZDCA 2JEGA 7ICLA 2VA2A 2KN7A 4QWAA 3RJJA 3AO5A 5HRPA 3CFRA 3V81A 3UIQA 2PFNA 4CJVA 3O3GA 4KTQA 1GOAA 1KLMA 3ISNC 3NFAA 4CGIA 4B9SA 5D3GA 5DQHA 3AV9A 3V1QA 4RPYA 3TAMA 4CF0A 7ICHA 3SI8A 1HRHA 2R7YA 1ZQAA 3UQ2A 3O4NA 2KFNA 4AHTA 3RB0A 2Y1IA 3O3FA 4P4MA 4B8CA 4M2YA 4E1NA 1HQUA 1ZQXA 4OKEA 7ICFA 3ISCA 8ICOA 1SKRA 4J9RA 1K6YA 5J2CA 3N4MB 4I29A 1RBTA 1ZQBA 1S9FA 7ICOA 4YR3A 2DPIA 3OYNA 3K59A 4KAZA 3QETA 4NLGA 2IHNA 1Z25A 2R8GA 5J2BA 4EP4A 1HMVA 1CEZA 4JS5A 5DKWA 3PW7A 4YXMA 2J6UA 9ICIA 4FM2A 1RXWA 1IKWA 3RH5A 1S0OA 3V7JA 3MGHA 3LP3A 1BPXA 2A1RA 1NK5A 3MXJA 4PGYA 3TAQA 2B5JA 3L2QA 3VA3A 2XO7A 2BQ3A 4FJGA 4QZ8A 3QLHA 4OLAA 7ICVA 4E7JA 1WCNA 3NGZA 4KFBA 2NRVA 2BPCA 4TURA 9ICPA 3DOKA 1ZQUA 3VA0A 1DTQA 4E7HA 1WAFA 1WLJA 5J2IA 3LAKA 4DTRA 3RJEA 1VK0A 3EY1A 3ZD8A 3DYAA 4R64A 4M9JA 3NF9A 1NK0A 4M3ZA 4TSXA 3GIKA 1XSLA 3C6TA 4Z6CA 2BHNA 3ZDBA 5E41A 1T4GA 2BQRA 2ISOA 4YFKA 2BKEA 5L1IA 4RT2A 2GBZA 3B6OA 4E7KA 3ZSVA 4I2PA 2XCPA 5EOZA 1NK7A 8ICVA 1PZNA 4CJLA 1XO1A 4F4WA 4JWNA 3VQCA 4E19A 3CFOA 1VRUA 3F9KA 3VQEA 3TAPA 5IIJA 4PHDA 4I2AA 5KFNA 3QINA 1U9LA 4UBBA 3ZSYA 4Z4GA 1JIHA 1QS4A 2AGPA 4BDZA 1EXNA 4RUAA 4GVMA 3SUOA 2G8HA 3HP6A 3AVIA 1D9DA 4NXZA 4IQVA 3G0ZA 2PZSA 3OYJA 3QEVA 4PUOA 4ED0A 5J0TA 2J6SA 4FLXA 5J2PA 3T5LA 4B08A 4J9PA 1S9GA 2MUTA 1YTUA 2EX3A 3TAFA 4CIEA 4DOAA 4ELUA 1VSJA 3THVA 3HVTA 1K1SA 5KFJA 3QERA 5HHHA 1RTDA 4ID5A 4DTNA 4QZ9A 3M9OB 3PW2A 4OPKA 3G6VA 4E7IA 1JMSA 3EW9A 2ITGA 3PMNA 5CY4A 4BE1A 2XHBA 5KG5A 5HROA 2HHVA 4ED2A 1U04A 1JLFA 4O3QA 4YP3A 1U45A 3KHLA 4NM2A 2RPIA 1NJWA 3AUOA 3VQBA 5KFQA 4UAZA 3VQ4A 2IBKA 1F21A 2B4JA 4DQIA 1S6QA 1TVAA 4ID1A 3SQ1A 5DG8A 3PX0A 4R65A 5JUMA 4FO6A 2YNHA 5KG1A 5C24A 2C22A 3DRPA 4M6WB 4KPYA 4UB4A 3NDKA 4H4MA 4DTXA 4I9LA 4UB1A 5C42A 1KDHA 3V1OA 3GQCA 3HT3A 2AQ0A 2XC9A 1MQ3A 4N5SA 2HMIA 1RTIA 4F8RA 1RT1A 2Z1HA 3MXIA 4M3YA 5KG0A 3ZT2A 5J2DA 4F92B 4TQSA 5JS2A 1CZ9A 1KVAA 3ZDEA 4Z0UA 1RT7A 4I2JA 3E2EA 1VSKA 4NCBA 5KFDA 2X6NA 5DBAA 4IFYA 1WSEA 1ZQCA 3JSMA 2NRTA 3H8WA 2E6MA 1VSLA 3NE6A 1IM4A 3CFPA 1C6VA 4FBTA 2BCRA 3HVRA 3EYZA 1J5OA 3QE9Y 3KHGA 3V9UA 4FJKA 1DTTA 2W8KA 1ASUA 3C95A 4DTPA 2O4GA 2HHSA 1RCHA 5KT5A 3HPOA 4DQRA 3QEPA 1NOYA 3PMLA 5J2GA 2ZQBA 3VQPA 2ZE2A 5J0SA 2YKNA 5KFVA 1L3TA 5HHIA 3AVHA 4DL6A 1VSIA 1LWEA 3TAGA 1KFDA 4DSIA 4RQ5A 4QWBA 1ZQPA 1KRPA 3KTQA 3AO3A 4O9MA 4FJJA 1BHLA 2BDPA 3HW8A 5KFIA 3K5OA 1EKEA 1XC9A 1B92A 5CHGA 1BQNA 2D0BA 3K2PA 4E1MA 8ICKA 1SUQA 4BDPA 3QZ7A 4IRKA 2BCQA 1UAXA 2R8IA 3RAXA 4R8UB 1BIZA 1JKHA 4CHYA 3OJUA 4CECA 8ICSA 4RUCA 2AQ4A 3RR7A 1Z00A 4ECTA 1NOZA 4CJ4A 3KK1A 4XA5A 3NTUA 5J2MA 1ITGA 8ICTA 4DS4A 1NK8A 1J53A 3ZSQA 3AU2A 2QXFA 4JUZA 4CJ3A 4W5NA 3WNFA 1RILA 5DBCA 3BGRA 5J2QA 4FJ5A 3HK2A 4O44A 3QESA 1BQMA 5FDLA 3DRSA 2HVHA 5IIKA 3DLKA 4ECXA 4DS5A 1TGOA 2W9MA 9ICFA 2MAXA 4CIFA 4O5KA 3OGUA 1I39A 2YNFA 4UB5A 4FK2A 5SWMA 5KFEA 4O55A 3PX6A 3OYIA 2JEFA 3A2FA 3QNNA 2ZTDA 2WOMA 1CXUA 4I27A 4AHUA 5DLGA 3PR5B 3PW5A 4RNNA 3RAQA 1C0TA 4IKFA 3C1ZA 4IQTA 5KFTA 3SPZA 1S0MA 5EWFA 3IHQB 1UT8A 4CEBA 5KFSA 3TWHA 3DRRA 4OPJA 2KFZA 4KITB 1RZTA 3AVNA 3PNCA 3HYFA 4M0AA 1FKPA 3AVCA 3HPGA 4MQ3A 3H4DA 1JXLA 4NLZA 5CYQA 3LDSA 3V6HA 1KSPA 2X78A 4RG8A 4KTWA 4K4IA 3K5NA 4QZCA 5KFAA 1RTHA 3AVMA 3ALYA 4OJRA 4M3WA 3MECA 4NCGA 5DDYA 1QTMA 4ZH4A 4UAYA 4O3RA 2EHGA 5KRSA 2I1QA 4QZHA 5KFKA 4F2SA 1ZQSA 2JZBA 2PY5A 4QAGA 4BWJA 8ICHA 4M9GA 1RBRA 1UA0A 4F5PA 1A76A 2I5JA 9ICGA 2DTUA 1LB2B 3CG7A 2FMPA 4Y1DA 1QE1A 4DSFA 7ICUA 3KK3A 5EWGA 2FLNA 4QZBA 2PYLA 3GIMA 9ICCA 4O3SA 3RJGA 4HVJA 3AVBA 1HYVA 1XHXA 3AU6A 5CR0A 4DSLA 1QLNA 1RDAA 3OYBA 3SUNA 1I3AA 1YTAA 4PHEA 3DLRA 3RBDA 4KRFA 2FMSA 3PO5A 4F91B 3H4BA 2B21A 3EPIA 3LK9A 4IQWA 2YV0X 2FC0A 1VSHA 3PVXA 4DFKA 1KFSA 1O1WA 4CJSA 1WN7A 5KG2A 4CHZA 3H8JA 4R63A 4AILC 3I0RA 3TANA 4Z4FA 4FZZA 3G6XA 4F4ZA 3LWLA 5CP2A 3HL8A 4EP5A 3FYHA 8ICEA 3BQTA 2GUIA 4J9OA 1UOCA 4Z6EA 1CZBA 4CEQA 9ICSA 5HRNA 1TKZA 4LSLA 4FM1A 4LD0A 4FS2A 4CGDA 1XHZA 4Q8FA 2ETJA 5DGBA 2VG6A 5IILA 4N41A 3GIJA 3V6DA 4N56A 4F5QA 2G8IA 3V1RA 7ICRA 3T5HA 2I9GA 1LV5A 5J2AA 4YVZA 2P5GA 4DSJA 1ZQDA 1MQ2A 4HHTA 1WSHA 3DLEA 4E0DA 2F1JA 3E01A 5FROA 3Q8RB 4CHQA 2P5OA 4C8KA 5KT3A 5BOMA 4DQPA 5KFGA 3C2MA 4JRQA 1RXVA 3H8SA 4P2HA 3O4QA 1TK5A 2ZJ8A 4PHPA 3MAQA 2D0AA 1JL1A 3BQ1A 4GC6A 4O3PA 3AVAA 2ASJA 1B43A 4QZIA 4C8OA 1ZQMA 1VSDA 2W9BB 2G8WA 3IAYA 5IIOA 1RBSA 3OY9A 4GLXA 2V9WA 1KCFA 1X9MA 1C1AA 1MC8A 4CESA 3KHHA 3L2VA 4F93B 2JZBB 4DF8A 3ZCMA 4Q8EA 1X1PA 3TAEA 2IS3A 4BDYA 1LW0A 4HUFA 2FLLA 1QHTA 2YNIA 4KV8A 1KLNA 4DTUA 5DB7A 3L3VA 3OYLA 1JLGA 4RQ4A 2IC3A 4FLVA 4ECZA 4FLUA 1LAVA 5K14A 5L9XA 4M3TA 3TARA 1T7PA 1W0HA 5KFFA 3LPTA 4KHNA 3IS9A 4CK2A 4IG3A 3Q8LA 2BCVA 2PI4A 4FJ8A 2Q0ZX 2MUTB 4ZTFA 1FK9A 1T03A 2PFOA 3ZDAA 4I2EA 2ZUBA 3KLEA 4W5TA 1B22A 3QO9A 4FLYA 4K8ZA 5HMLA 1C1CA 3MABA 3MDAA 4FYDA 4MFBA 4R5PA 4QZEA 3AVKA 4M47A 3IM1A 4DTOA 1HNIA 4I2FA 4ZTJA 3P83D 1BVSA 1Q9XA 4KLQA 8ICWA 8ICIA 3O3HA 4B9NA 4Z4CA 2BPFA 2HVIA 9ICTA 4CEZA 1LAWA 1ZQQA 2GV9A 5C25A 1ZQVA 4O4GA 2RDJA 4O0JA 5J0QA 3MGIA 3MR5A 4I2BA 3K5MA 3T1AA 2DPJA 4ELVA 3I8DA 1TAUA 4IFVA 5KFPA 1RT3A 2PYJA 2V4RA 2XGQA 1CLQA 3VQQA 3HM9A 4KHYA 4RQ6A 3ZT1A 4C8LA 4TUQA 3DLHA 3C21A 2FPKA 4LY7A 2BQUA 4DQSA 1REVA 4CJWA 3MR3A 3MEEA 4W5OA 2QKKA 3OYAA 4P4PA 3OYCA 1JLCA 5HLFA 3NGIA 4IDKA 5HNKA 4BGDA 2J6TA 2YHBA 4YN4A 2Q3SA 1IO2A 2HNYA 5J0RA 3AO4A 4FJLA 4K8XA 1MSWD 2ZJAA 4IBNA 2HNDA 4KLHA 4DU3A 4FZXC 4DU4A 1RDDA 3KKRA 2OZSA 3KHRA 5J2KA 2BPGA 5KG4A 4FJ9A 3QZ8A 1TK0A 1A77A 4G3IA 4FM0A 1ZJMA 1RT6A 3MR6A 3V9ZA 1ZQRA 2W9AA 3BQ2A 3AVJA 4DFJA 1TFRA 3NAEA 3ZDDA 5JS1A 2KQ2A 1Q8IA 1ZETA 8ICFA 4RW4A 1ZQEA 3RB3A 2KZMA 3M8PA 4I7FA 2AJQA 3OS0A 4FK0A 4KHWA 4O3OA 2XY8A 4ZHRA 2G8FA 3HPHA 8ICMA 1RBUA 4B9TA 3KLFA 1R0AA 1BISA 5KFWA 3U6FA 4GMJB 4UQGA 3U3YA 1RYSA 1NKCA 3NH2A 1WSIA 5DLFA 1VRTA 4F3TA 3ZSOA 5SZTA 4JRPA 1BPDA 4RW9A 3Q8KA 4UB3A 1ZBLA 3SPYA 1UWBA 4DFMA 4LH5A 3M9MB 1ZJNA 1ZQYA 2P1JA 1KVBA 5D49A 5KFRA 3OYGA 5KFHA 1A5WA 4FK4A 7ICMA 3RBEA 4C8MA 5DDMA 4OLBA 1J54A 4KLMA 4K4GA 3VQ7A 4BXOB 8ICBA 3RH6A 4FJ7A 4CJKA 4ECUA 3MXMA 3LALA 4FJNA 4YD2A 4RW8A 2OPPA 1W9HA 3FDSA 4QZDA 1NK6A 8ICGA 3L2WA 2H5XA 2Y1JA 1SV5A 1TKDA 4BE2A 3SV4A 8ICQA 3GILA 4E7LA 2AU0A 4J9QA 4CF8A 2DFEA 3CYMA 3RR8A 8ICLA 4M41A 3QEXA 4PHAA 4YMOA 4PGXA 2RN2A 4Z4IA 1TVRA 4PY5A 1ZQGA 3KLGA 1Z00B 1S0VA 3UXOA 4RW6A 4CGGA 4RU9A 1RT2A 3NCIA 4JV1A 4OKJA 1XWLA 4QZAA 1HYZA 1Y88A 9ICRA 1NJYA 1XU4A 3RMCA 4AHVA 3QEAZ 2XY6A 4RPZA 4KLEA 4FJXA 1NOMA 2BGGA 1V9PA 4MF8A 1NKEA 1RTJA 5CWRA 4DLEA 2F96A 8ICPA 2XY5A 3HSTB 4KLLA 2DFHA 4KHQA 1BL3A 9ICUA 2A1JB 2UVRA 4OKKA 3AA2A 4N47A 4J2EA 1DGSA 4F5RA 1WAJA 1U49A 3TFRA 5KT4A 4M3RA 4N76A 2DFFA 2ZTEA 5KFLA 1S97A 1JLAA 4R66A 3SUQA 4DTMA 3RJIA 3DLBA 2HHXA 4CGJA 4IRDA 3NF8A 2P6RA 4O0IA 2HHQA 1L3SA 1N6QA 9ICMA 4FCYA 3L2UA 4RQ8A 3B0XA 3HJFA 3ITHA 4MFAA 1FKOA 3RH4A 4EBDA 4CIGA 4AHSA 3L3UA 4ECQA 1BPBA 3T5JA 2ATLA 3SI6A 4QOZB 3ZSXA 3TI0A 4YFUA 1N48A 7ICSA 1N5YA 3KJVA 4CJ5A 3D0PA 3SQ2A 4KTZA 4F50A 3TQ1A 4RZRA 2D5RA 4DFPA 2IDOA 4KHSA 4ECRA 5J2EA 3ETLA 3RWUA 3OHAA 1HQEA 5EU7A 2E4LA 2IOCA 4KLFA 1JL2A 4K4HA 3OS2A 4AHRA 2XY7A 5CJ7A 2DY4A 2OPQA 1DLOA 3C1YA 3SQ0A 1L3VA 3QIPA 2NUBA 2FBXA 5I42A 4YNQA 1B9DA 2B6AA 3T19A 1SL1A 1B9FA 4Z4EA 4DL7A 2ASDA 4CGHA 2HB5A 4IQUA 4Q43A 5KG7A 4JS4A 4MEXA 3ISBA 3HP9A 4M6WA 4IR9A 2O4IA 3K58A 4DOCA 1COOA 4GW6A 3RB4A 2ISPA 4LVSA 4CF1A 3OYMA 3S9HA 4FLWA 4CJPA 5L1LA 4HUGA 4RT3A 3V9WA 4ECYA 4WE1A 3V72A 4YMNA 2XGPA 2OYQA 4OVLA 5KFCA 1T05A 2DFLA 3S3NA 1C7YA 3ORYA 3EWAA 4DO9A 4J9MA 5J0XA 4AHCA 1ZQKA 4W5QA 2C2EA 3KD1E 3WNHA 4QCLA 1WSFA 4O5EA 2OA8A 1ZBIA 9ICHA 5HP1A 3M8SA 2W8LA 4FJIA 7ICNA 1RYRA 3NH0A 2IAJA 4BWMA 3VQ8A 4YQWA 4XQ8A 2F1IA 3AVGA 3QEIA 3UXNA 2ATQA 4PH5A 3OHBA 1HUOA 2HW3A 4CEDA 4CEFA 2YNGA 5J2JA 3C2LA 5HP4A 1A5VA 2JEJA 2FBVA 5J0UA 4B8AB 4M3XA 3LP0A 3HXMA 3B6PA 5DB6A 4CEAA 2BGWA 2VWJA 5DQGA 4ICLA 5J0WA 4CJTA 2W9BA 4B9MA 2FPMA 7ICEA 1ZQLA 4CHNA 1XI1A 2F8TA 2NRZA 4KLJA 3V7KA 2FMQA 1CXQA 4J9NA 4J2BA 1ZQWA 1LW2A 1S76D 4CJFA 4CEOA 2IGIA 4CJRA 3N97B 4FJHA 3RJKA 4CK1A 8ICYA 2M9NA 3S3OA 3C6UA 4CFCA 4UAWA 3RTVA 4ED7A 3JYTA 3LP2A 2HHUA 3NH1A 3HX0A 4H4OA 4DF4A 4DWIA 1QSSA 5KT2A 4MFCA 2OPSA 3Q8SB 3GV7B 4NY8A 1HJPA 3C5FA 3ISDA 1JXBA 1T8EA 1ASWA 1NJXA 9ICOA 1Q9YA 4BXOA 4DSKA 5J1EA 5FRMA 4YXJA 1IKYA 1WSJA 4E89A 4HUEA 1JLBA 4QW9A 2NRWA 3V9XA 4RQ0A 3KK2A 4I2GA 2R8JA 3IG1A 1L3UA 3MFHA 5KFOA 1S9EA 2A1SA 4I2HA 3M8QA 2HNZA 5DGAA 1BCMA 4C8NA 4EBCA 4RNMA 1CUKA 4RQ7A 3KLHA 3RRGA 4ED6A 4JWMA 4I9QA 1X9SA 1TK8A 1EX4A 1S0NA 3V6JA 1ZQHA 4HCCA 3C94A 4ED3A 2P66A 4B9VA 5F9NA 3OYEA 1BI4A 3RMBA 5J0OA 2ZUCA 3PW0A 4CERA 5KRTA 4M9HA 5F9LA 5DQIA 4CF9A 3LAMA 4KB1A 4ELTA 1U48A 3PY8A 3NF7A 4XUSA 3K4GA 3ZSZA 2R8HA 1X9WA 3KD5E 2RKIA 1HYSA 3QIOA 1WSGA 4CK3A 9ICLA 4H8KA 2VG7A 4IRCA 2XCAA 2KTQA 3MR2A 3PO4A 4Z6FA 2BCSA 2QK9A 5I3UA 1D9FA 2KZZA 5D46A 4PA1A 1SKSA 2P51A 1ZQIA 3QEWA 4F4YA 4ECVA 4DU1A 5KFXA 4G1QA 3DM2A 2Z1GA 3PR4A 2VA3A 3TR8A 5C5JA 3LP1A 1JLQA 3UPQA 1ZBHA 1JLEA 3OSNA 3F73A 4FW2A 2YHAA 5L1JA 4M42A 4NLNA 3RMDA 4ECWA 2FBTA 5HMMA 4J9KA 4I2CA 4KLDA 3TABA 2D0CA 3MEDA 3C2KA 3LANA 3P5JA 5BOLA 3RB6A 3KLIA 4DL4A 3ZT4A 2Z1JA 4X5VA 4CCHA 3V9SA 3VQ5A 3VQ6A 4NCAA 5J2FA 3SNNA 4CJEA 5KG6A 1G15A 3WNGA 3PX4A 4OGEA 1XSPA 4O5CA 1TKTA 3LPUA 1EXQA 1JN3A 4M45A 4JV0A 3RRHA 5KGXA 1HPZA 4F3OA 5DG7A 2C28A 4W5RA 4RW7A 4KLOA 4KLSA 3L2RA 4DOBA 2W42A 3BJYA 1UA1A 4RNOA 2X6SA 1TV6A 4QW8A 3EPGA 1U47A 4HTUA 5T7BA 4DL3A 4F5OA 1RBVA 4FLZA 4GXKA 1S1XA 4CGFA 4FVMA 3AA5X 2HHWA 8ICAA 3NBPA 2GWSA 4EEYA 8ICUA 4GXIA 4KI4A 3GV5B 3Q8MA 4BE0A 3OJSA 2IA6A 4YMMA 3Q8PB 4HCBA 4NM1A 5CYMA 3MDCA 1ZQJA 1GOBA 1NK4A 4DTSA 4XIUA 2IHMA 7ICTA 8ICNA 1GOCA 2Z1IA 5KFZA 3UXPA 2PFQA 4TQRA 2XRIA 4F4XA 4P4OA 4XRHA 3CQ8A 4HYKA 1D5AA 3V4IA 8ICZA 2ALZA 2FLPA 2ZD1A 3MBYA 7ICPA 3ZD9A 3V7LA 1KTQA 3SZ2A 8ICCA 3SJJA 4MEYA 1S77D 4KLUA 3WNEA 2C2DA 2VANA 5KFUA 3NGYA 3OYFA 3S3MA 1XSNA 4I2IA 4EZ9A 1MU2A 4LH4A 4DTJA 5CB1A 3DLGA 2ZUDA 4M3UA 4DMNA 4YG2A 1X2IA 4CE9A 4CJQA 3GFKB 1ZBFA 2VG5A 3ZT0A 1IG9A 9ICQA 1HNVA 4QZFA 1TL1A 2PI5A 2KW4A 9ICVA 3DMJA 4RQ3A 4DL5A 3OVNA 4DEZA 3K75D 2W9CA 5KGWA 3HO1A 5KFMA 4IG0A 9ICNA 4B9UA 5HRRA 5DMRA 4FS1A 5KG3A 2LSNA 4J2AA 1BI4B 9ICBA 2G8KA 3ASMA 3NF6A 3AA4A 3DI6A 1QSYA 4I2DA 3UQ0A 4CFBA 4Q0BA 2AGOA 4CHOA 4KN4A 3TFSA 4OGCA 3AVFA 4M04A 4RPXA 2F8SA 3VQ9A 3B0YA 1C0UA 2AGQA 4I2QA 1WCLA 1UT5A 9ICWA 3CM5A 4FBUA 3MFIA 1SL2A 4O5BA 1ZQZA 5DK5A 3M9NB 2X74A 1WNSA 1S1WA 3FFIA 4KLTA 2FPLA 1S10A 1S5JA 3KIOA 3MEGA 4J9SA 4KMUA 1AROP 8ICXA 2UVWA 4BACA 5DB8A 5KFYA 1Z26A 3U3GA 1D8LA 2C2RA 1T3NA 1TV9A 3Q8QB 3SCXA 1YVUA 1FXXA 2OPRA 7ICJA 3JPQA 3GV8B 4KLGA 4EYIB 2VWKA 3JPRA 1ZBUA 5BPCA 2LYHA 3JPSA 2RF2A 2ZTCA 3DOLA 2UVUA 1L5UA 1BIUA 4Q45A 9ICAA 7ICIA 3ZSWA 9ICKA 4FW1A 4PQUA 5DB9A 7ICQA 1IKVA 4R8UA 3BDPA 2P6UA 1ZYQA 4DSEA 1BPYA 4YR0A 3OYHA 5KT6A 3C5GA 3K57A 2G8UA 3SQ4A 7ICKA 4DL2A 1RT5A 1Z3EB 4LZDA 2R8KA 4TUPA 8ICRA 4NLKA 4JV2A 1NJZA 3NGDA 5KI6A 3JPNA 4I28A 5TZVA 1Y97A 3VQDA 3I0SA 3PUFA 2UVVA 4EBEA 4ED1A 2RDIA 5EWEA 3G6YA 2VA8A 3RMAA 4AH9A 5J2NA 4YR2A 4IR1A 4ECSA 4ED8A 1NK9A 4JK1A 1SL0A 1KEJA 4GC7A 4EYHB 1S1VA 3HWTA 1S1TA 1RNHA 4TUSA 7ICGA 4YD1A 4DG1A 4KREA 1IXRA 4M9NA 1ZQNA 3AA3A 4KO0A 4CEEA 4KB0A 1J9AA 3LZJA 4FXDA 4Z4HA 3SV3A 1C0MA 1HUZA 1N56A 3JPPA 3P1GA 5L1KA 2JEIA 4B9LA 4QZGA 3K5LA 5FRNA 2ASLA 2BANA 4J2DA 5J0YA 4UB2A 3JPOA 1RDBA 4KHUA 2PXIA 3VN5A 2WONA 5CZ2A 5IIIA 1JX4A 4RQ1A 1LWFA 2FBYA 3H7IA 3T3FA 3AVLA 1YT3A 4F2RA 2W9CB 3RJFA 4CHPA 3ZSRA 2V4QA 3LWMA 4F5NA 3H08A 4Z6DA 4DLGA 1VSFA 5HBMA 3VQAA 4FJMA 2G8VA 4CFDA 3CM6A 5KT7A 1SZPA 2BCUA 3IRXA 4Q44A 1TL3A 3AO2A 5D4BA 4RQ2A 4JLHA 4LZGA 2F1HA 1RPLA 5DG9A 4UBCA 1VSMA 4FZYA 3JPTA 2JGUA 4CF2A 1KVCA 2JLEA 4O3NA 3V6KA 4F4KA 5J29A 1VSEA 1U4BA 3OS1A 4M9LA 3AO1A 4YCXA 3M8RA 3SYZA 1D8YA 3BQ0A 1A5XA 1BPZA 5CZ1A 4PGQA 2BR0A 1TKXA 3ZT3A 4PPXA 2BE2A 2PFPA 2KZ3A 4KN7A 1RT4A 1LWCA 5HRSA 1QSLA 3QNOA 4NYNA 4QWDA 4E3SA 5J2HA 2WTFA 4KLIA 1ASVA 1JXEA 2QKBA 1HJRA 1DOQA 1QQCA 4EZ6A 3LZIA 1EETA 3H40A 3C23A 4J9LA 3OSPA 4L8RB 5CA7A 1BPEA 1IKXA 9ICJA 5DBBA 3GIIA 1S1UA 3G10A 3SUPA 2OWOA 1EP4A 5IINA 1XS9D 4QWEA 3EZ5A 3OYDA 5KTQA 4QWCA 1S6PA 3RJHA 4CFAA 4KI6A 5J0PA 2A1JA 3PV8A 3PW4A 3LDAA 1H38A 1C1BA 4MFFA 2IMWP 3ULDA 1RDCA 8ICJA 4Q5VA 3D45A 3OYKA
chains in the Genus database with same CATH superfamily
2QRRA 1SKWA 3D2EB 4OI1A 4WBFA 4AE5A 1CJKA 4NOHA 4H0VB 1S4EA 4Y1CA 1XK8A 4NLUA 4CJUA 2V63A 2OZMA 3GYXB 3EEQA 1ATRA 3F2DA 4PWDA 1ZQTA 2BH1A 3TVKA 1BCOA 1IKYB 3BM7A 2CQ2A 3AJDA 4GXJA 2Z58B 2YKMA 1ZQOA 2QMWA 2KN7A 1U0SA 5A76A 3I8BA 2GNKA 3VMFB 2PFNA 3O3GA 5ALNA 3FCHA 1S99A 3IFEA 4CGIA 2F9JA 2VDHA 3R5AA 3AV9A 2RQMA 2OFHX 2YMQA 1VR6A 2EEYA 4IEIA 4CF0A 5EHHA 3C6UB 4Y2SA 4IH6A 3UQ2A 5H2FU 3LP1B 5SUHA 3F44A 5J2MB 4EENA 2J0XA 3QAEA 4DV6F 2YKAA 3KVGA 1N52B 7ICFA 1GLDG 3ISCA 4BC3A 1SKRA 1SJ4P 2DB1A 3N4MB 4JMUA 3ISND 7ICOA 2MQOA 3KWGA 2K4EA 2DPIA 3OYNA 4KAZA 1KEKA 3D0GE 1KN5A 1BO5O 3OR1B 4F4AA 2OTJS 2CZ4A 2CGJA 2YNGB 3R3LA 4EP4A 1SJ3P 2VFUA 3PW7A 4YXMA 2J6UA 9ICIA 1WI6A 2VGNA 4P7VA 2Q31A 4L73A 2IAJB 4OI4A 5CR4A 4X4PA 4OQJA 1PJ6A 1QAJA 2O8FB 3HFZB 2A1RA 2DJWA 3VEWA 2JGAA 2GO7A 2GHWA 1B99A 4PGYA 1ZRNA 2VF3A 3MF5A 4E7JA 2IJNA 1WCNA 2A18A 5HMWA 3IKMA 3GG4A 1YSJA 1ZQUA 3CPEA 3VA0A 3GLJA 3GOIA 4E7HA 1WAFA 5J2IA 1WC1A 3ZD8A 4CLSA 4GKJJ 3E9OA 1Q81O 4M9JA 4BR2A 5CA5A 4LF4F 4QS9A 3GIKA 2K4HA 1E6VB 4YY3J 1YVNA 3MEEB 1NI3A 2BQRA 2HF3A 2WFAA 2GMJA 5FLXU 5KOWA 3C7NA 3SFUA 3B6OA 1WTBA 4CYUB 2BZFA 5EOZA 2M88A 1PZNA 4CJLA 2QL9B 1R6VA 4F4WA 5HR7A 3UFCX 5IM0A 4E19A 4KC5A 3EGNA 3B54A 1BU6O 2V4JA 1UPMB 3F9KA 1CRXA 2RVJA 2C3OA 1UW9A 3TAPA 1N5YB 2B4UA 1U1PA 4JB8B 4Z4GA 2HHHF 1JIHA 3DLJA 1QS4A 4ANEA 4BDZA 3NNCA 4EAHD 3SUOA 2G8HA 2VONA 1DRZA 1UEKA 3FJ2A 4IQVA 1RTZA 4NLOA 1SV0C 2GVZA 4BC4A 3OYJA 3GZ7A 3QEVA 1V4SA 4RR5A 4CT9A 3NGRA 4FLXA 3QUTA 1Z4NA 4A8OA 4RU2A 1ZS6A 2JRSA 1U8SA 3UKRB 4J9PA 2ZKTA 4J03A 1YTUA 2DR6A 3D6JA 1P1LA 2GV1A 2EX3A 1PKUA 5IWAJ 4PYDA 1K1SA 2K2PA 3PSIA 4DR2F 1GXUA 4AYBF 4LFAF 1X3NA 1K9MO 2VFTA 3G6VA 1TTHB 2KG1A 4E7IA 3PMNA 4IKAA 5KG5A 5M1KA 4WPAA 5J2PB 1U45A 3AUOA 3MN6A 1NB7A 1EKRA 4C11A 3VQ4A 1GXTA 3TJ9A 1FFUA 2HKEA 1F21A 3A4TA 2Q0UA 2CRLA 3KG1A 2ZBRA 1TVAA 2VODA 4FWSA 5DG8A 3FQKA 5CD4A 4R65A 3L5KA 2YNHA 4A59A 2LM1A 2YWWA 5IQQA 2FVRA 1HLUA 4U7UK 2EAMA 2OEHA 4IO1A 1DQ9A 4R0JA 2VQEK 5DM6L 1MQ3A 4N5SA 1YJWS 5KL1B 1RTIA 3VF6A 4C0BA 2DO4A 1ZH5A 3D2FB 1QVFR 4DR6K 4M3YA 3ZT2A 5J2DA 3NG8A 1CZ9A 3VAGA 4BC2A 1RFQA 1N34J 1E6VA 4M7XA 3NCRA 1VSKA 1X9JA 1H2TZ 4USHA 5AQWA 1EKSA 4WP9A 1HPMA 2J7UA 1O51A 5CZXA 1LQ9A 4DHVA 1RA7A 1HLWA 4MT1A 3S6EA 4K4WA 3MI7X 3H8WA 4L3QA 1VSLA 2BCRA 3D2EA 2B0CA 3M7DA 3EYZA 4JK8A 4K4YA 4KSEB 3KHGA 5ALWA 2GFFA 4OYPA 3R9LA 3HPOA 5DJBA 2HK3A 4YHHK 4CM0A 3PMLA 2GWJA 2UZAA 1WUAA 1R8AA 1GO3F 3M05A 5E84A 4WF9L 2GIQA 3A8IA 1NB2A 1FNMA 5ALQA 2EI5A 4M1KA 4RNFA 3ZX3A 4P6QA 5H9FJ 1RP5A 4QWBA 2DRDA 3BH7B 3KJNB 3HFVA 3VZIA 1LW0B 3IWXA 4LF7F 4ZK7M 2O8EA 2BDPA 5KFIA 2ES6A 3UI3A 3SK3A 3MCMA 1YGYA 3NAHA 2D0BA 2KHQA 1RAIB 3AXKA 1SUQA 2A3ZA 1WWHA 3W3DA 5GTIU 4XO0A 4R8UB 4KPCA 1TKXB 2NCKL 8ICSA 3RR7A 4ECTA 3GSIA 5DDQC 1AQ6A 1Y4ZB 3QUBA 5J2MA 3TTCA 2UP1A 1ITGA 4DS4A 2AX0A 2EK6A 3AU2A 3NRWA 1WOPA 2UU9K 4FJ5A 1FRIA 3AD9C 3CCRS 5IT9Y 3HK2A 4ZPAA 2CWXA 4O44A 1NMEB 4A8WA 5FDLA 3DLEB 2F7TA 5IIKA 1LK7A 3BF1A 1TGOA 2W9MA 2D4WA 1MDUB 3IRWP 2XMTA 4ILHA 4P73A 3NOGA 3CCMN 3MOJB 2OMOA 4FK2A 5KFEA 2DO0A 2MZQA 4O55A 3PX6A 2JEFA 3A2FA 2ZTDA 3G4SS 3NBPB 3VETA 4Y2PA 3V5RA 5H1SV 3M2RA 2VG6B 3GU0A 4UUWA 4HT5A 2EAOA 4DX7A 3PR5B 5AQYA 2EBGA 1NSKL 3PW5A 3NVMA 3KWMA 3RAQA 5CHIA 4TYAA 3M3ZA 1R6YA 2KJVA 3BB5A 3L0QA 2K7JA 2DGZA 3VV2B 1UZHA 3AVNA 4R5PB 4OZJA 1VJQA 1DZ5A 3HPGA 4DX8H 3T1YF 1R0AB 4K41A 3ZZOA 3H4DA 4GKKF 4LRCA 3L4IA 4RG8A 4K4IA 3K5NA 5AQNA 3S41A 1S6UA 1HBUB 3J7AN 4AT1B 1K5OA 2AHOB 2HVEA 4UAYA 4F2SA 4W90B 3FKBA 4X62K 2D3O1 3I96A 5HL7L 1ZQSA 2PY5A 3UB5A 3DDIA 1E4GT 4QAGA 1Q4RA 8ICHA 1JRPA 3ETRA 1RBRA 1UA0A 1KQFB 1WB9A 3D6FB 5GIOA 4F5PA 1A76A 4F26A 1XNRJ 3RBZA 3KK3A 4HL9A 3ED5A 2D0PA 2MQNA 2E2OA 2PYLA 4ZJOA 2LVWA 3K8VA 3AVBA 4YOWA 3WQTA 1EO1A 5AHXA 3MM7A 3HKZF 5CR0A 2QLTA 1QLNA 1RDAA 3OYBA 4MK7A 2ZH5A 3SUNA 1YJ9S 4J5OA 3HHLB 3BS7A 3CC2S 3RBDA 4I67A 1SXEA 4NLQA 3PO5A 3S01A 2Q0RA 1G1XA 3ZFVA 4IQWA 1RABB 4CNYA 5LM7E 2N4CA 1V6HA 1TMMA 3MECB 1O1WA 1WKLA 2LFVA 5AKGA 1K44A 1SPBP 1NU0A 4PG8A 1T94A 2EPIA 2W54A 1B7FA 5A8WB 4AILC 3CJCA 1D9AA 2OHDA 3TANA 4NLBA 4Z4FA 2UXDK 2Q2RA 2E1ZA 3ATUA 3NY0A 5A8KA 1NPPA 3FYHA 3P5TL 2C2OB 1UOCA 1XBWA 1XN9A 5CXTA 1F2GA 1OIAA 5AZJA 4EELA 3C19A 9ICSA 1U2CA 4DFDA 4O0NA 2O8DB 4DV1J 3QT6A 1N0UA 4FM1A 4LD0A 1RQLA 3GL1A 2E1PA 1XHZA 2B8QA 1M5OC 4Q8FA 1FW6A 4CDGA 5IILA 4N41A 3GIJA 3MCNA 1SQKA 2EFGA 4F5QA 4KH4A 1RQNA 3V1RA 4ZPDA 2I9GA 1LV5A 1RAEB 2LHTA 2DQNB 4YVZA 2UUAF 4DSJA 2HURA 3SDEA 2DT9A 4F3MA 4E0DA 5B08A 2CJKA 3L7PA 5FROA 3BBCA 3BGRB 4C1NK 2CADA 3CD5A 4CHQA 2EG1A 4X62F 2CQCA 5GAGU 3EUB2 3Q83A 1Y00A 2ZJ8A 4PHPA 1S72N 4DPXA 1MWKA 3KK1B 2D0AA 2YMMA 1VLBA 4Z94A 4AL5A 1SZ2A 3MDFA 3O3LA 4QZIA 4C8OA 1GNKA 2LA6A 4USTA 1A6LA 3IAYA 5IIOA 4C4SA 1YJ7A 4ICLB 3OY9A 4DR5J 3DNCA 2CZ9A 3JTPA 1T9WA 2H51B 4CESA 4AQYJ 5GAHP 1VIOA 4YMEA 2JZBB 3U9DA 1PGZA 3GG1A 5ETKA 2IS3A 4BDYA 5ALOA 3ID6A 4I56A 1SH3A 1QVFM 4H03B 3AJ2A 3ET6A 4OL8A 5DB7A 3L3VA 2ZM6F 4FPIA 2E44A 4RQ4A 4B1YB 4FLUA 1GLEG 3L09A 2D7SA 4Y2MA 2Y9HA 3CD7A 1KKHA 4CK2A 1RAJA 4ETZA 1ATSA 5I3PA 4FJ8A 2V7ZA 5AK4A 1T03A 4JI4J 3ZDAA 3CIZA 1JNZB 1FJGJ 3B9JA 5ALZA 4IQXA 4K8ZA 1S1WB 4FYDA 3AVKA 4M47A 3IM1A 1MMDA 5D77A 1HNIA 5IWAF 4ZTJA 3F0NA 3AARA 4CLWA 3GJRB 1FD8A 3O3HA 3RSEB 1QAXA 2IPOB 3FC9A 1YXQA 2HVIA 9ICTA 1LAWA 1WEXA 2GV9A 1YDLA 4ZCKA 3CJ7A 3MGIA 3EXYA 4X4RA 5BRDA 1TAUA 5J1EB 5KFPA 5LY3A 2RHFA 4IG0B 2PYJA 2OLWA 4HTLA 4DR5F 4AL7A 2YNFB 2N3LA 1RI7A 1ZAXA 4TUQA 2WAQD 3GJSB 1IBLJ 2G0JA 4HLBA 2IOHA 4H4OB 2HZVA 2LMRA 3IP4B 2O1PA 3DRYA 4DQSA 4C98A 4TU9A 4LQ3A 4OX9K 2B4VA 3MEEA 2B9YA 3GE1A 4ISFA 4W5OA 1F60B 2E9TA 1K0TA 4WK1A 4IDKA 4O8KA 2MJUA 4BGDA 3MM7B 2OTJN 2J6TA 2YHBA 4K5SA 1KKXA 2IDEA 2Q3SA 4PL7A 2HNYA 5J0RA 1R7IA 5AQIA 3W3SA 4M8LA 5GAEU 1MSWD 5JICA 2HI0A 4NEYA 3RF9A 4FZXC 2ZBQA 4UUXA 1ATNA 1RDDA 4LMZA 5A6WA 5J2KA 3IC1A 1H3DA 2AWZA 4FJ9A 4ZVUB 1FXDA 4WP3A 1RT6A 4C6AA 2IYGA 2M7SA 3AVJA 2LQJA 3T1HF 2KQ2A 2HVZA 4PXEA 4FVCA 1WDTA 3JQJA 2XB2D 4USVA 4RW4A 3RB3A 3OS0A 2QA1A 3HPHA 8ICMA 2WBRA 4B9TA 3KLFA 1R0AA 2ZIVB 4YDUC 4PQAA 4GMJB 4UQGA 2XMJA 1NKCA 1WSIA 1VRTA 4L75A 5L9NA 2RD5C 4JRPA 2CZVC 3Q8KA 3TO8A 3SPYA 3ZI4A 1UWBA 1RA6A 1YBUA 3M8QB 2VQEF 4ISGA 1BA1A 4TU8A 1KVBA 5KFRA 3QJJA 4ZCLA 3GB0A 4QQBA 1P7DA 5FD1A 3ETMA 3R1LA 1CVJA 4B1VA 3ZC4A 2L3MA 2H3EB 4WIIA 2NZ4A 1RDRA 2GJIA 1F9FA 3HDSA 4RW8A 4ZVPB 3CB4A 2M3DA 2OPPA 3CMQA 5AQMA 3FDSA 1HNWJ 8ICGA 2H9ZA 1SV5A 5HAOA 5AM3A 4IL6U 4YDUA 2UXDJ 4BY9C 4J9QA 4OX9F 3CYMA 3RR8A 4YMOA 5KPRA 3I9V9 1TVRA 2KE7A 1CZAN 4FYXB 2AEMA 1S0VA 2CH5A 5F3XB 2PN6A 4E98A 5HI7A 2FHMA 1S72S 3DOMB 2QMUB 2F4VF 3MM5B 4JV1A 4OKJA 2EKYA 2R2UA 1HYZA 3OTEA 2Z0GA 2ZHBA 3TZYA 5AK5A 1N8RT 4KLEA 4BRHA 1BMQB 3GFHA 4ZOHC 1V9PA 4MF8A 1NKEA 1OQ6A 3EGVA 2EQYA 2HS3A 4OI2A 1RAAB 8ICPA 2F96A 2F2AB 5ALSA 2UVRA 2B43A 3AA2A 3RU0A 2YHYA 4N47A 1WAJA 2GVDB 3TFRA 1O8BA 2C2ZB 3MZIA 2YQ3A 4LBIA 1GX5A 3KMQA 4B1UB 4JKGB 4CF5A 3FBBA 5MAOA 2EKNA 4YB7A 4R66A 3VR1A 1R0CB 1HBOA 2CRXA 5HQLA 1N32F 5EX3A 2HHXA 3ULEA 5MLCQ 1BY9A 4DU7A 3OL6A 3PACA 1MWQA 5HANA 3MM5A 3IN5A 3PZPA 4CZFA 1S22A 2W25A 3ITHA 4MFAA 2A1BA 3WUHA 3SI6A 4QOZB 1X4GA 2EBEA 4A2AA 3KFWX 1N48A 2DITA 3QU4A 3FMWA 1X0PA 2XWYA 3VPZA 3W8GA 4FWQA 5GMEA 2DGWA 4RZRA 3UVJA 3AQPA 2ZH8A 2D5RA 2IDOA 4EX7A 1VCTA 3PHTA 2ITMA 2Q36A 3QU2A 2E4LA 3ZX0A 3R7NB 4BC5A 4AHRA 3BV8A 3ZTPA 1XMQK 3DJCA 3PM9A 4NV0A 3C1YA 4K43A 4I1TA 2NUBA 1WG8A 1ZZNA 3HCXA 2RRBA 3PSFA 4DXLA 2KVQE 1B9FA 4DL7A 2GIFA 3DHWC 2BDUA 3OTOF 4IFEA 4IQUA 3WK7A 3WXIA 1IJJA 4Q43A 4OX9J 4Z7CA 4A62A 2O4IA 1MA9B 3K58A 1Q46A 4CLFA 3PKYA 3RB4A 4GW6A 2ISPA 1Z4UA 4CF1A 1RISA 2V2ZA 3OYMA 3S9HA 4FLWA 1WC5A 2H5IB 1QHAA 4WE1A 3V72A 4B3MK 4NE9C 4C11B 5KFCA 1T05A 1V5VA 4DPUA 4UY8T 2XO6A 2XSJA 2MKSA 3GJTB 3LM9A 2E66A 1RAHB 2VC0A 4AHCA 3JAMO 2IIRA 2IJRA 2C2EA 4JI7F 1Q81T 3KD1E 4QCLA 2OA8A 1KBRA 2XG8A 5LJ5Y 2VBZA 3D6HB 2MU2A 3Q23A 1ZBIA 5HP1A 1NGEA 3I56S 2Y8WA 4FJIA 2V9KA 4MO4A 4IG3B 1Q86T 4I7FB 2W2OP 4Y6IA 3BKFA 2ALYB 3UXNA 2CYYA 4FPRA 5F3ZA 3OHBA 4R25A 1TUYA 1FF2A 3BYRA 2JEJA 1F5BA 4OYWA 3BR8A 3GE9A 4DCPB 4OJGA 1BHNA 1L7PA 2KXFA 5A2QU 1Q82O 1FXRA 4KX3A 2B9EA 1FX4A 2VWJA 4OJOA 4ICLA 2GVZB 3OBWA 4JI5K 4RX6A 4BBYA 2FPMA 2K7KA 4CHNA 3IM9A 2QGFB 1TMJA 2CPHA 1VQMS 4HH1A 3DDHA 2XLIA 4J9NA 4UTGA 5EX0A 1LW2A 1S76D 3T1HJ 4AQYF 3CJ5A 3EE8A 2P9KA 2KHDA 3CCQS 3JSRA 1FJEB 3PHEA 1XUPO 4CK1A 8ICYA 3S3OA 1RKJA 3RTVA 3A5OC 3LP2A 4EIAA 3U8XA 2ZJQL 1RAOA 4NL9A 4H4OA 1QCKA 1QSSA 2RDDA 5HVFA 4NI2B 2LBOA 1DGJA 1HKGA 3Q8SB 2O66A 5HBMB 1N60A 1JXBA 1HQEB 3IBFB 2CG8A 1NJXA 5AR0A 4BJQA 4FE3A 4DSKA 3US5A 3HD1A 2P35A 4IFVB 5FRMA 5IC6B 1WKKA 4J9VA 2O8CB 4E89A 1ESVA 4DCCA 2LQ9A 3BSAA 2I2YA 3KJVB 4LF6J 2RS2A 2G13A 2KVIA 4QZVB 1Y3KA 5F8GA 2ZJPQ 2C3UA 3RUBL 2OANA 1QDUB 5DDOC 4BRDA 5DGAA 5JU5A 4B17A 4ZLLA 2ESEA 4EBCA 2YTUA 2ZOGA 4RQ7A 3QB0A 4JWMA 3LPEA 2NQPA 1RWUA 5A8KB 2P6SA 2HFZA 3V6JA 3EXCX 5F9NA 4CT8A 5HQ8A 1G6BA 3H46O 3AD7C 4CERA 5KRTA 4DV4K 4CF3A 5LSOA 3CTRA 5DQIA 1NU4A 4CF9A 2KFYA 2F3NA 3LAMA 1R8CA 1U48A 4DV3F 4LQ9A 3DMJB 3MTJA 4R79A 1VQ6S 5F0XA 3K4GA 1HYSA 1OSCA 3GG0A 4GFJA 2ZH6A 1FCAA 2CQ1A 5GINA 4MKAA 2E2NA 4H8KA 5CCLA 3PJXA 2ATCB 2KTQA 3MR2A 3PO4A 3HSCA 3RW7A 3MD3A 4N8OA 4AQYK 2ZDPA 1XR6A 4O8UA 5D46A 4PA1A 3O9QA 5LMUF 2V6AA 3QEWA 3EVMA 5CAAA 3WU2U 1TL7B 2VBWA 5ALFA 4G1QA 3G82B 3EZUA 3J7YP 2ZOMA 5EE0A 5KOXA 4ERDA 4GKKJ 3TR8A 1DJ0A 5C5JA 3UCZP 4O23A 3UPQA 3AAWB 1ZBHA 1E3MA 3EE3A 4BVOA 4PL8A 2ZBPA 2ZOFA 1I94K 4M42A 4M94A 1VQ4N 4NLNA 1N8RO 4LR8A 2VFVA 4J9KA 4PG5A 1HNXF 3I56N 1IBKF 5LMNK 1RBLA 2Q66A 2P5VA 2D1CA 3V9SA 3LDPA 4DV5K 3EN9A 2K8BB 4NCAA 5J2FA 3SNNA 4LF8F 1WWUA 1Q8LA 1TQLA 2A3JA 3GCWP 3SBMA 3VAHA 1S6OA 2HFNA 5A0YB 4IOBA 3M6ZA 4DV7J 4PXCA 1EXQA 3K89A 2WSEC 5KGXA 3AOBA 4U8VA 4F3OA 2YQ0A 4RW7A 2XWXA 3KK7A 2W42A 2UUCF 3TUPA 4KO0B 3BJYA 3D7EO 1NGGA 4NLTA 3SMSA 4A46A 4HTUA 4F5OA 3MUMP 2OSQA 1IG6A 3NAIA 3AA5X 2CQ3A 3MMAB 2GX9A 3NBPA 2MKYA 2HQFA 4GXIA 3HI9A 3GV5B 2PMZF 4EU0A 1FKAF 1AFIA 3Q8MA 3OJSA 2KRRA 4V19J 2HOEA 3OUYA 4CJ7A 3Q8PB 2K8GA 1VQMN 1IQZA 4ATNA 4G9BA 1NK4A 3ALRA 2IHMA 5KFZA 4U7UD 5H9FK 3G8SA 2XRIA 1Q79A 3P38A 3MM8B 1D5AA 1TYQA 3I55N 3NVZA 1V3SA 1S7IA 5AJ3F 2Y9UA 3MBYA 7ICPA 2N82B 1HR0J 1PK1B 5FPMA 2NO5A 2RE2A 8ICCA 3UD5A 1LWXA 4KLUA 3LPYA 5KFUA 3HKWA 4JI6J 3EM1A 1GLFO 3OYFA 3S3MA 5I3UB 1KOOA 4GO7X 2B56A 4EZ9A 1N32K 1HI0P 2A6MA 1X2IA 2DNOA 2DKZA 2FJEB 4CLUA 3PYGA 2HWHA 1ZBFA 2VG5A 3HVWA 1VQLN 2PI5A 3EDRB 3BY5A 2ILZA 2KW4A 4RQ3A 4B9UA 1U1KA 4WKYA 2MLXA 4EEKA 4NLYA 4FOIA 3ZZZA 4O3MA 3NF6A 3AA4A 2Q6CA 4K42A 4I2DA 3L9ZA 2FHJD 3UQ0A 1M5KC 4LUBA 3TFSA 3MM9B 2PE8A 1JCGA 1F3FA 1VFJA 3N4PA 4I2QA 1WCLA 2XQCA 2HRYA 4X66K 3CM5A 2A1AA 4O5BA 3R2CJ 2BJ8A 3CDBA 5IFMA 3M9NB 4WFYA 2KEYA 5E26A 1WNSA 4WFNL 3P31A 3FFIA 5LT5A 2FJBB 4FZLA 2ZM6J 3BGOP 1JLBB 2VIHA 3L6QA 1FI4A 2YXLA 3WQPA 1XEZA 3PFEA 2HSEB 5KFYA 1Y5NB 3U3GA 1ZTWA 2CA9A 2HHHK 3DXKA 4C9DA 3ZTOA 1BQMB 1TV9A 3ZX2A 2FGOA 4CWBA 3FCWA 5JXSA 5TISU 4EYIB 1XQSC 2CJ9A 3EGWB 4JV5J 3JPSA 2MSTA 1B0TA 3DOLA 4WTOB 1BIUA 9ICAA 2E5HA 3CJ1A 4FW1A 3BR9A 4PQUA 4X66F 2IVNA 1VQ4S 4WJBA 3I55S 1YF5L 4R8UA 4G1QB 4GVBA 1YZ6A 1S5ZA 3U7JA 4AXIA 3OYHA 4Y3CA 4ZITA 2BA9A 1SS6A 3Q8VA 3K57A 1WORA 2KKPA 2E3TA 1BQNB 1OMSA 3QWPA 1RT5A 5HROB 2FZKB 3LDQA 3QAUA 8ICRA 2DKXA 4NLKA 2VFSA 1NZ8A 3JPNA 4I28A 3W5ZA 4KRWA 3CCQN 1URNA 4U67L 2ZJRQ 4WCEL 3PUFA 3J7YI 2UVVA 3VEVA 5AT1B 2VA8A 4J90A 3RMAA 2DH8A 1VI7A 4XH5A 4KT0C 4IEEA 3UKRA 2V68A 1KEJA 4EYHB 3BDEA 2OH2A 4PZOA 2CG4A 1S1TA 1T95A 4FXVA 3M8ZA 3AA3A 5L1MA 3KNAA 4CEEA 1N5SA 3GPAA 3MCSA 2DTJA 3SIPB 1C0MA 1P9YA 3FM9A 1WOOA 2VBXA 2XMMA 4JI8J 3NNHA 5L1KA 5E3PA 3O0FA 1RDBA 3JPOA 2ASMA 4YHHF 3VN5A 5CZ2A 4I4BA 3EGZA 1QUVA 4JI0F 3H7IA 1RBAA 4BQLA 3UNGC 5AKYA 1L8OA 1N36K 2KN4A 4BGAA 4LFAK 4K2JA 2V4QA 4TN2A 4MMOA 1N36J 3ZZTA 2E5LK 3J80Y 8RUCA 3WX8A 1B4FA 1VSFA 3F5EA 3SCIE 3VQAA 2G8VA 3KZXA 1KC8T 3CM6A 5KT7A 1SZPA 1W26A 5D4BA 4RQ2A 2MA1A 2F1HA 4F36A 3A0IX 1RPLA 2F65A 3DRSB 4DR5K 6AT1B 4UBCA 4FZYA 3SQIA 3JPTA 1ZA1B 1Z05A 2I6WA 4E1JA 3V6KA 4ZJQA 4ZPTR 3QSIA 1W2IA 3M8RA 2XIDA 5F41A 1BPZA 4PGQA 2QLJB 1SCJB 1T44A 2PFPA 3WXJA 5B0FA 2R7UA 4WFAL 3QNOA 4IS7A 2E7XA 5ALLA 3TACB 4KFBB 1UZDA 2DNNA 4E3SA 5J2HA 1YAGA 1ASVA 3H59A 2MKHA 3WKEA 2CVEA 2O67A 4V19S 1K8AO 3QU5A 3QMLA 3I4PA 1JJ2R 3H40A 5DBBA 4ZCIA 3SUPA 2OWOA 5IINA 1NRKA 1XS9D 3GSDA 1RDUA 4LF2A 1S6PA 3RJHA 2GQQA 5ALMA 4WTYA 1TE2A 5M1OA 3UCGA 2A1JA 3PV8A 3QICA 2JWKA 2OTLN 1C1BA 2HG4A 1UKUA 8ICJA 4ER8A 2CQIA 5CHCB 4Q5VA 1DTTB 1FKPB 2L5YA 1KFTA 3CCSN 4DOZA 4DR2K 4M5DA 1WF2A 5AE3A 2V5HG 2WZ1A 4B3OA 5GIPA 4DV0F 3UDCA 1C0TB 9ICEA 1JJHA 4FLTA 2CPZA 2E2QA 3L7UA 1IH7A 2HHTA 4UQTA 4ZVOB 1K1QA 5GMDA 1D8ZA 2CKWA 3OTBA 4DR3K 3LVVA 4DQQA 9ICXA 2BRLA 3HHLD 1RHJB 3SQGB 2BM1A 3GDXA 1BGXT 3O44A 4X84A 3T5KA 3ZDCA 2JEGA 3CC7N 4NLVA 3VF0B 3CXCR 2AD9A 3HI0A 1D09B 3A3NB 4CJVA 3TOQA 4QOTA 1GOAA 1KLMA 3ISNC 3LDOA 3C7NB 4WFAQ 2JMGA 2ZF5O 3AFGA 2YJEA 3V1QA 3TAMA 1OUQA 4DX5A 3UVJB 2DXEA 2PGCA 1JCEA 2QA4N 2W01A 1ZQAA 4PL2A 3O3FA 1KVKA 3DRPB 3W63A 3THWB 2NYHA 3UDLA 4K4SA 3O2IA 1P1TA 8ICOA 4J9RA 2I6XA 3MMCB 1S7HA 4I29A 1RBTA 1YZ7A 3C0BA 4QIEA 5BPMA 1ZM4A 4NB4A 2E1EA 4C97A 1YHQN 1FDDA 1RHKB 2G9OA 3QETA 4NLGA 2FVCA 2IHNA 4KGZB 2YX8A 4FWOA 4LF4K 1X4AA 5FPDA 1OH6A 4CRJA 4QU7A 1CEZA 5DKWA 2JWNA 3J81O 1RXWA 1IKWA 2CPFA 2P8IA 3LL3A 3R5GA 3MGHA 5L38A 5EVZA 1BPXA 1NK5A 2K1RB 4PJ0U 3MXJA 1Y5LB 2VPYB 4X65F 2B5JA 3RZAA 3VA3A 2YCHA 5G5GA 2IVPA 3OL9A 2BQ3A 4G6VB 1T05B 7ICVA 5K8PA 1PYOB 4I64A 2EWSA 4TURA 3DOKA 2LEPA 3WX4A 3H3OB 2WF5A 1WLJA 3LA0A 4A8SA 3EY1A 4CQ1A 4K50A 4CTAB 1TVRB 4NYPA 2VKZG 3CO0P 3H0PA 1N33J 4TSXA 1RT7B 4WU3A 4F0HA 2WF9A 4Z6CA 4H0YB 3ZDBA 1KW4A 3W1YC 5I42B 3MN9A 2BKEA 4Y2CA 4RT2A 1X6IA 1S4FA 1NK7A 1WC4A 2GOLA 4WFBL 4USWA 5AQRA 2UXBJ 3VQCA 3WEEB 4ACOA 1VRUA 2G2YA 4E8UA 3OBIA 1U1RA 3VQEA 4H4MB 5IIJA 1YK9A 5AI8A 4PHDA 1HJOA 5E3AA 3QGHA 3TQEA 4DZ6A 4I2AA 3JB9k 1FFVA 1U9LA 4UBBA 4MKBA 2AGPA 5C24B 3TVYA 2W7AA 1EXNA 4X4VA 1KBUA 3M1FA 3AM9A 3HP6A 1VDVA 3AVIA 4NXZA 5CYJA 1PAEX 4ETXA 2PZSA 4JI0J 4ED0A 4KGXB 4WWSA 5HMZA 1IJEB 3CCJS 4LF9K 1S1VB 3HJEA 3ID8A 4LF8K 2DR7A 1WJ9A 4H5VA 3CNQP 1IM6A 2ZIUA 1XMQF 1JMTA 5AZIB 1BNPA 2BMBA 4ELUA 1VSJA 3HVTA 1A0PA 4QPTA 3CJSA 3E3XA 2C3PA 1RTDA 2G09A 4DTNA 3M9OB 2FLOA 5L39A 3PW2A 1FE0A 3LGHA 4B3RK 1JMSA 2DGSA 2ZWPA 2YQEA 1JLFA 4O3QA 4NM2A 1NJWA 1RAGB 4UB8U 3ZZRA 2DVIA 1EWQA 2COLA 4I6AA 1J6ZA 3MMCA 2DIUA 2CFXA 5JJBA 1Y64A 1LOUA 1RT4B 1S6QA 2AJ0A 1XR7A 1FTCA 2E1RA 2R7VA 3PX0A 5K8NA 4F71A 4B3TK 3SCLE 3VCBA 2QA4S 4Y0FA 1KHWA 3DRPA 3VEYA 3VEOA 2BJ1A 1DARA 4UB4A 3NDKA 4P75A 4H4MA 3CNHA 5C42A 1Q95G 1WF1A 2D1KA 2V94A 5D3GB 5ALPA 2ABYA 4X66J 2IVOA 2OAUA 4GKJF 2HMIA 4KBOA 4US8A 4RJVA 3K5PA 3IUCA 5EE9A 3HX9A 1KXPA 4J37A 4ILGB 3ZTRA 1M1HA 1UEVA 5HJXA 1RT7A 2VJ4A 4I2JA 3OW2M 5LXYA 3A13A 4FWPA 4OFZA 4EHTA 2HFOA 3ADAC 3QUCA 3KOOA 1H2VZ 5D0EA 1ZQCA 1N6QB 2NRTA 2GTDA 4OJ6A 3FR0A 4M5DB 2MZ1A 1IR0A 2DY9A 3QLHB 3CMEN 1VRTB 2B4PA 2WSFC 2HMPA 3V9UA 1DTTA 4ZVHA 4KGKA 3O9SA 4NASA 3IRUA 3VQTA 1RCHA 4Y0WA 2YHWA 5A8RB 5KT5A 1NOYA 3VAKA 2JHEA 5KFVA 3BKTA 2BKOA 5AQHA 3TEHB 4DL6A 1VSIA 1ELOA 2WK4A 2CDQA 1MROB 3TAGA 2OHFA 1AFJA 2RMLA 3MEKA 4DR3F 4HEA9 4TVAB 4RWWA 1BHLA 1RWOB 3CC7S 2BM0A 5EGYA 3JTNA 1SV4A 3UCUP 3JSYA 2DHHA 5CHGA 8ICKA 1OYDA 2MQLA 2R3VA 3QDKA 3CCMS 5IS2A 2BCQA 2LEBA 1Z1VA 2R8IA 1BIZA 3CJKA 2HNYB 3CWJA 3MOZA 3WXKA 1UJ6A 1Z00A 4FWLA 2E8OA 4XA5A 1Z4OA 2CQ0A 4ZJLA 2VHGA 2E2PA 3SENA 3ZSQA 3P49B 4W5NA 3H90A 4A8YA 4GY2B 5J2QA 5IT9O 4NO7A 3HSJA 1FJ7A 3CP8A 4DV0J 2HVHA 3DLKA 3K0SA 4ECXA 4GMKA 3SDEB 1KLMB 4YY3K 3D2WA 3OL7A 4O5KA 2YKQA 4ZVSB 1KAZA 3H1VX 2ZH4A 2YNFA 4UB5A 2KKZA 4JKHA 3BPSP 5ETTA 5SWMA 3HZ6A 4L72B 2R7RA 3QNNA 3AGRA 3DGVA 5F8JA 1VQ9N 4ZPCA 3BBBA 1CXUA 3A5MC 4D3HA 5DLGA 4UOGA 1UMJA 1ZAVA 2IRYA 1QAYA 2QTWA 3ETOA 3THXB 1TV6B 4BR0A 5C25B 2AP6A 1UQVA 4HI1A 1NDCA 2O8DA 1C0TA 1KQKA 5AQZA 3ZO7A 4IKFA 2ZWOA 4CEBA 5KFSA 3DRRB 2GUPA 1OY9A 1PC5A 2KFZA 5DZ6A 1VBZA 2EDUA 1OH5A 1UJ5A 2N7CA 4MFBB 4JNEA 3HYFA 1S1TB 3AVCA 3M30A 5GADP 3PG9A 2HS4A 2X1BA 2W3SA 4NLCA 2KXNB 1KVIA 4KTWA 2NS1B 4Y2RA 1ZOTA 3OW2R 1X5SA 2AF6A 3G2XA 3MECA 4IOXA 4JI1J 2KJ9A 5B0AA 4O3RA 5J8YA 1M1KO 1YBTA 2XICA 2JZBA 4FPBA 2U2FA 1YJRA 4J7CA 2I5JA 3P45B 9ICGA 1LB2B 3CG7A 3SD7A 3UDVA 4DSFA 2BE7D 3FZ2A 3K9JA 4OZ5A 3GIMA 9ICCA 4DMZA 4O3SA 2OI2A 2W43A 2HAFA 3M6WA 1QZ6A 3ATVA 4RQNA 1VBYA 1D4XA 4JI7J 1YTAA 2KSOA 1K9MT 3J8AA 3UPFA 4PHEA 3OHRA 3JTOA 5F8NA 4F91B 4WF9Q 2QWQA 2B21A 3EPIA 1H1VA 4IOAL 1Y11A 1VS3A 2FC0A 5KPZA 4KJIA 5ADXH 4ZPWR 1Y5IB 3CCTA 1NNDA 1WN7A 2LYVA 4Y2VA 2D3OR 4W98A 4BVPA 3I0RA 3Q2TC 1HBMB 3SQOP 3TR5A 1LOTB 2MGZB 4OJHA 2LKZA 2DKOB 1ZBSA 4RKUC 3G6XA 3VTIA 2OKQA 3LWLA 5E33A 4DPWA 3M2VB 2V67A 4G1IA 4LIWA 2R42A 3HL8A 1XQIA 4EP5A 2GUIA 2E1MC 3CCLS 1UVNA 4FWKA 5B5EU 1CZBA 3W61A 1M1GA 1TKZA 3CCUS 4LSLA 4Q0BB 4C0OC 2LM4A 3W2VB 4CGDA 1VQON 2WBMA 2VFRA 1W97L 5ALIA 5DGBA 3BP8A 1VQPN 1IUJA 2AYBA 4KYZA 1X6JA 4RBTA 2WW4A 3VAIA 2P9NB 4RTFD 4B3SJ 3Q7CA 2CPIA 2W11A 5A2QO 1FERA 2DBBA 4ILMA 1FNOA 3N5BA 1WSHA 3MEDB 2F1JA 3FZKA 4USJC 3E01A 2FYXA 5B7WA 4OHXA 2G2OA 2EFNA 2AEJA 4OZNA 3Q8RB 2NLXA 2PBDA 5LOQA 1FVQA 4F3QA 2SXLA 2JXJA 4PG7A 1VLYA 2GMHA 3MD1A 2FVPA 3O4QA 2FI1A 5M2UA 3OLBA 4GC6A 1VSDA 2G8WA 5THWA 4YY3F 2V9WA 4BRIA 3GFYA 1X9MA 4FF3A 1MC8A 2VCPA 3KHHA 3PTWA 1VBXA 1DAXA 3MXHP 3RYLA 3EJMA 3TAEA 4HUFA 2FLLA 3L7OA 2YNIA 2O01C 1QHTA 5AE1A 1KLNA 4DTUA 2KT5A 2UUCK 1NDPA 3OYLA 1JLGA 3D3CJ 4FLVA 3K1RB 2GHPA 2C2MB 5L9XA 1HBUA 2JSXA 2VKQA 3LPTA 2Q1LA 3IS9A 1SQEA 3T1HK 2BXJA 4L6V3 2MUTB 3LO3A 4ZTFA 5DM6Q 4I2EA 2ZUBA 1TP7A 3FEXB 4W5TA 2E7WA 2EG2A 4FLYA 3MABA 1NZBA 3M1VA 1CULA 4R5PA 4QZEA 2KXHA 3FK4A 4DTOA 2IA0A 4L74A 1BVSA 8ICWA 1IBKK 2HNZB 3WKDA 4MDAA 1HNXK 2JFDA 4CEZA 1ZQVA 1YRXA 4O4GA 3LYSA 3N4QA 5J0QA 2MY8A 4DBQA 1KWMA 4WIQA 4I2BA 4YN3B 1QZ5A 3JSBA 5AFUA 3Q8YA 3T1AA 1ZM9A 4ELVA 2QARB 4JI6F 1YJ9N 1YG0A 3JXOA 2V4RA 2XGQA 3HM9A 5E5NA 4C8LA 2P9EA 3O9RA 1OQ3A 3D2FA 4LF5J 4DV2J 2D6FC 5AI6A 4BUGA 2BQUA 2FE9A 2HSZA 3CO9A 2FJXA 3V2UC 3BS5B 2AYGA 1C2PA 4CDIA 2VKRA 5IC4B 3NGUA 4FKYA 4OYMA 2Z57B 5HNKA 2G07A 3CCZA 2EVZA 3PXGa 3MCAB 1IO2A 4E2FB 3D1HA 3AO4A 4FJLA 4K8XA 1VAZA 5F2RA 4LBPA 2J9EA 3WK8A 1QE1B 4IBNA 4DU3A 2WHOA 4AM6A 4DU4A 3OQ2A 3QIDA 3KHRA 4JI3F 4BGBA 3W0LA 1X8DA 3QZ8A 1TK0A 5BPLA 1VQ7N 2UU9J 4I0WA 2APOA 2DNZA 1ZQRA 1OVYA 2H5EA 5AKLA 5KAIU 4BRPA 4DFJA 1KNZA 4N8NA 4B3TF 3TADC 2VC1A 1IIPA 1KQGB 1ZETA 3MUVP 3THYA 4ZMMA 3BSOA 1ZQEA 3M8PA 4ES1A 4YOUA 4PRFA 4ZHRA 3M6VA 3CJTA 3H7HB 5DO2A 1DXSA 3KLVA 1HI8A 2JDJA 4JK9A 2H3FA 1LXNA 2K89A 3HLUA 3E51A 4ZVQB 2IHR1 4NXMF 1BISA 2I0XA 1H73A 1FDNA 1C20A 2HBRB 5H1SQ 5SZTA 3UM9A 4CZIA 4MYTA 2G0IA 1ZBLA 2WAQF 4DFMA 3M9MB 2HFVA 3MPYA 1ZJNA 3VALA 1AB8A 4BRAA 1N34K 1CJUA 2I38A 1L7MA 3IO1A 1A5WA 7ICMA 1XMQJ 1CJTA 5F8IA 4EGLA 2QLFB 2PEHA 2HCFA 2I1RA 1FJGK 3T1YJ 4OLBA 1VQ8N 2Z56B 2AZ3A 4KLMA 1X5PA 2EZZA 2K8AA 1AYEA 3VQ7A 8ICBA 3RH6A 3TADA 1MWMA 1WG1A 3LALA 3AXMA 1X31C 2ROGA 2FB0A 4CYUA 3TA2A 4QYRA 3OVBA 1CJVB 4AP9A 2FD2A 1NK6A 5ALTA 2H4YB 1KQSM 4NEZA 2Y1JA 1TKDA 5J2QB 3O1BA 3SV4A 2XMKA 8ICQA 2DFEA 3A8KA 4MN4C 3QEXA 4Z4IA 3HHLC 2KK0A 2BV3A 2XYHB 5I9EB 3DYAB 1Z00B 3DM2B 1RSCA 5K8MA 5IXUA 5AXNA 1SJRA 3HOTA 2UUBK 4Y2JA 4WJ3B 4QZAA 4TXSA 9ICRA 1NJYA 2B8PA 3RMCA 3ENVA 4AHVA 2D74B 4FJXA 4RO0A 1NOMA 1HI1A 1DEJA 5HJYA 2ASOA 1GMWD 4F0MA 5ITHA 1MWYA 2CNNB 2UUTA 4JKEA 2N3OA 5LJVA 2O8FA 2DFHA 4KHQA 1BL3A 4OJ1A 1SB6A 3LDLA 4OKKA 3KZIU 3FLCO 2XZTB 4BRKA 2HQIA 4GNIA 4PZVA 4N76A 2KT3A 1RG6A 3BBFA 3CJ2A 5DM7L 1B0PA 5DDPC 2ZTEA 5AXLA 4AF1A 2W1BA 4FNHA 3IG8A 3HKZD 3U27A 1PIEA 1VJWA 3G4SN 3SUQA 2MKCA 2O6KA 4DTMA 3RJIA 3DLBA 1WWVA 2KJ8A 4CGJA 4CO4A 5ALXA 2IDLA 3NF8A 4GV6A 2AKWB 1XNQK 2UXCK 1L3SA 4WE1B 2XLJA 1Q16B 1N6QA 2J76E 1F0MA 1UTAA 9ICMA 2QC3A 3L2UA 4RQ8A 3B0XA 3HJFA 5D0HA 4OLPA 1G99A 3RBXA 3BYPA 5AM1A 5DS7A 4AHSA 3NLCA 3L3UA 4ECQA 1BPBA 2ATLA 4USAA 1RWXB 3ZSXA 2Z30B 4YFUA 4I6MA 7ICSA 2FZGB 5GVQA 3KJVA 4CJ5A 1S8OA 1I94F 3BS5A 2M4MA 4DFPA 4ECRA 2V4JB 5LJWA 5J2EA 2L48A 5EU7A 2DGOA 2H4WB 2IOCA 4KLFA 1JL2A 3OS2A 1P8GA 2DY4A 2QWLA 2GIRA 2G06A 4AM7A 3LP2B 2FC9A 2FBXA 3H5YA 1L8LA 4YOVA 1ROFA 2WF7A 4K0KF 4C0ZA 3T19A 1SL1A 2ASDA 1KTVA 3TZXA 2BTFA 3TU5A 1UHUA 5AI4A 5KG7A 3UR0A 4JS4A 4MEXA 1X9XA 3ISBA 3HP9A 1XJWB 3BH6B 3WXLA 4O4GB 4DOCA 4GO5X 1NJIT 3HVAA 4JP8A 2K4PA 4LVSA 1MN8A 2DRBA 1Q5VA 2RQ4A 3RGIA 3V9WA 3I9ZA 4ECYA 3AB4B 4YMNA 2XGPA 4IXCA 4OVLA 2ZIWA 2DFLA 3S3NA 4YDXA 4DO9A 3ELHA 2JHDA 3ENOA 4J9MA 2ASYA 4NXNJ 2AT1B 1ZQKA 3PIPL 1SQGA 2DR9A 2Y0SD 2EFOA 3KLEB 4FOEA 2F7VA 2EANA 3NASA 1JUDA 4YORA 1XMBA 4BWMA 4YQWA 2F1IA 3AVGA 2J9DA 4ZLNA 1HUOA 2QMXA 4QIGA 4K7QA 5J2JA 3C6HA 4X4NA 2WW8A 2IM1A 3CRXA 2DIVA 2HIYA 2KMDA 3FNNA 4B8AB 1N5WA 1WHVA 3HXMA 2XSJB 1YI2N 2BGWA 4OX7A 3H45C 2M8HA 2XMUA 5CEHA 3LF0A 2LI6A 2QYCA 5J0WA 1D1UA 1ZM2A 4FWNA 2D3ZA 2F8TA 4KLJA 5F8LA 4U95A 4J2BA 2GW8A 5B0BA 4ANDA 2GMLA 4CJFA 1RU1A 3CCVN 4FFDA 1RWNB 5B0CA 3N97B 3CXCM 1AW0A 4GV9A 1NAQA 1GXLA 3ZZPA 4KX5A 4CFCA 3E01B 4UAWA 4OYAA 5F8MA 3JYTA 3GCXP 2HHPA 3NH1A 2OSRA 5AKXA 4FF4A 5KT2A 4MFCA 3VERA 4WKRA 4NY8A 1HJPA 3ISDA 2VOPA 2HQ3A 1ASWA 4TYBA 1H7XA 2P9NA 3P96A 1VHXA 4DHYA 2HPUA 5GAGP 3TNVA 1IKYA 2B7CB 4JYAF 4HUEA 1JLBA 4WP8A 2NRWA 1U2FA 3KK2A 1N5TA 4I2GA 2XI9A 3QBXA 3MFHA 2J4RA 5KFOA 2A1SA 4DN9A 4UOFA 1SZHA 2HNZA 2KI2A 2CQHA 2C1EB 3DOKB 4C8NA 4I2QB 4CLZA 1UVJA 4YB5A 4ED6A 4I9QA 2H65B 4FDFA 3BEGB 5C7PA 1RWVB 1RDWX 4FZNA 4CO3A 2P66A 4FO0A 3TX0A 3DI6B 1SV0A 2VDIA 1YUWA 4NXNF 4LF7K 3PEHA 4CF4A 4F0KA 4MH8A 3QRPA 3D0IE 1T9VA 4HAIA 3R6GB 2PMWA 4NRTA 1HD1A 1PVRA 1SXDA 3KD5E 2RKIA 3S8SA 3H1QA 5E7OB 4FKXA 4CZCA 2GWKA 2OD4A 3W60A 2Z4PA 4CRXA 1VQ7S 3D9BA 1OW5A 3BPDA 4Z6FA 2BCSA 2QK9A 1R8HA 3VGLA 3U1NA 3FEZA 1NDLA 1FT8A 4F4YA 2HNDB 4HT7A 2ADBA 1Z2ZA 5LMNF 3JXUA 4BR9A 3DLLL 2Z1GA 5D6GA 3PR4A 2NPIA 2OD6A 2DHGA 3EZOA 1ICEB 4ZVTB 3NKYA 2ZNYA 1ZC6A 3OSNA 3NMAA 5L1JA 3KOAA 3X1LB 4OZ1A 4ECWA 1W7WA 2FJDB 2OPRB 1SV5B 4CZGA 4I2CA 3CJ8A 3PNIA 3TABA 3MEDA 1Y7PA 5DZ7A 3C2KA 5I3QA 1FJCA 2QXLA 2ZBIA 3HT0A 2A40A 2VGMA 3OUYB 2VQEJ 3PFOA 4PPDA 3VQ6A 4DV7F 4OJLA 2RRDA 4CJEA 5KG6A 1LWFB 1K0VA 4OGEA 1XSPA 4X65K 5E3QA 3D2NA 2WONB 4OIXA 2Y8YA 2HQCA 3LPUA 5K5MA 3RRHA 4CO5A 4Y34A 3A5NC 3HILA 4RW7B 3J81Y 4DOBA 1HPZB 2HBMA 2G0CA 1S5LU 2FGCA 3MURP 1UA1A 4RNOA 1GH8A 2QA4G 2XTJP 4DV3J 2X6SA 5AXKA 3EPGA 3M2VA 4DL3A 4A5AA 4GXKA 4FVMA 4OCZA 4ZP6A 1FWLA 4KHPJ 2GWSA 5AI0A 5CQGA 8ICUA 1R31A 1KS2A 1NBWA 2BJEA 2P9LB 4J8FA 4CZLA 2RE1A 3LVWA 5EX5A 4HCBA 5CYMA 3MDCA 4IZ9A 1ZQJA 1M5HA 2OP5A 2V69A 1X66A 4ZVGA 2BABA 3CERA 1NSAA 5LMUJ 3E8OA 2ZH7A 3WK9A 3AHPA 5CE3A 6FD1A 2XHCA 5D4OA 1G2EA 3CQ8A 4HYKA 3R1HA 2EAPA 1M5SA 3TTDA 3DGPA 4M5LA 4BX9C 3CE8A 4FPAA 2ZFHA 4DR4F 1K8KA 3EUNA 3SZ2A 5A2QY 1XMOJ 1PC4A 2M0GB 3VWSA 4LSZB 1S77D 3QQCD 3WNEA 2C2DA 1SQFA 1H2UX 4K2XA 3T6BA 2PAVA 2V7YA 3NGYA 1XSNA 2UV8G 1MU2A 2VJVA 5HLFB 4LH4A 4DTJA 1DY3A 1VRQC 2FZCB 3CCVS 2ZITA 2HAIA 5AKKA 3AQOA 1GLBG 1DHMA 2GGPB 5HVGA 4YDDB 1IG9A 1Q3UA 3QNWB 4X64F 1HNVA 1WF0A 4LFCF 3N28A 3OVNA 2M52A 3SFGA 4RWTA 2KYXA 4KQZA 5DMRA 1WI8A 1T3QA 4C3MA 5KG3A 3C16B 1X40A 3QJLA 2G8KA 3EDQB 3ASMA 1QSYA 1HD0A 3NXZA 5K4LA 2VIXA 2AJFE 5JRTA 3HHDA 3VQ9A 1X5TA 4K59A 1UT5A 3C6AA 5BR8J 2UV8A 1XNQF 4DR1J 3MFIA 4F7VA 1SL2A 3BO4A 3AA9A 5DK5A 1VHIA 2JZ5A 1VQ6N 1S1WA 1VK8A 2IVYA 2W4PA 4KLTA 2FPLA 3FBEA 1S5JA 1YRUA 2E1FA 1B0XA 2D41A 2XYPB 4IWVA 2F4FA 4HVZA 3MEGA 2NXEA 2QEXS 3OTQA 1OY8A 5IV3A 1Z26A 2BJ9A 1D8LA 2AZ1A 3IDWA 1T3NA 4JV5F 1T9UA 2N4DA 2BOAA 3SCXA 1WD6A 1V5IB 3BZQA 4K4UA 5C42B 3TA0A 7ICJA 4RBVA 1J5EF 3M8WA 4KLGA 1BOTO 3J7ZO 2FHKA 3ZZ0A 2ZWHA 2LYHA 1LW2B 3HM8A 4ZIWA 3ZNJ1 3ZSWA 1Q3VA 9ICKA 5AQTA 3U4LA 4UW9A 3SXLA 1JKHB 3BDPA 2N7YA 1SXLA 4AUKA 3IGNA 4QIFA 2M8DB 1ZD4A 4P71A 4L76A 1KD1O 1HFEL 3R3TA 1TU0B 3ENAA 1V3ZA 1B0VA 1H7WA 1CI4A 4TUPA 2EWHA 3EO3A 4JV2A 5KI6A 1L3KA 3B6BA 1XNQJ 4EK2A 1RLCL 1Y97A 4ID5B 1WSRA 3VQDA 1VHFA 3I0SA 4TLRA 5E3RA 4EO8A 3HVTB 1MN9A 1HBNB 1NSPA 4EBEA 3G6YA 4HR2A 1HNZF 3IAS9 4AH9A 5J2NA 4MIAA 2V8GA 3UD4P 4QYZJ 4UOCA 4IR1A 1ZM3A 4ECSA 1FEEA 1R8BA 5HK4A 3W2WB 3KNGA 1A7GE 1S1VA 4P7TA 1HKAA 4TUSA 2J8AA 7ICGA 4L3KA 1DFDA 3K2YA 4DG1A 4KREA 1QQOA 2QIFA 4P74A 2YQ1A 1NZPA 3AQFA 2KIWA 1J9AA 3LZJA 3MPUB 1HUZA 1C0UB 3DXBA 4IFYB 1N56A 4CO2A 3AMZA 1UVMA 2ZJPL 2JEIA 3K5LA 3PSTA 2IRUA 2ASLA 2B9XA 2NXUA 2K3IA 4N77A 3SR6A 2WONA 4BRLA 3K7RA 4QPXA 3ILOA 1LWFA 2W2QP 4F25A 3H6EA 4QS8A 1YT3A 1RHMB 4C4RA 4JB3A 4CHPA 1NSQA 4LRDA 3H08A 3WEEA 2J7KA 4DLGA 3TUIC 4KR0B 4FJMA 4CFDA 1T6CA 4Q44A 1TL3A 3AO2A 4OPHA 5AFUH 4XDCA 2E7VA 4WQ4A 5H9EJ 3KUHA 5AJ3J 3QGGA 5L8RC 4OX8A 2KM8C 1RWWB 2G5HB 1VSMA 2CN1A 3NRBA 3NS5A 4O3NA 4MIWA 2Q4TA 2MQMA 3CPWM 2ZC3A 1SIWB 4M9LA 3AO1A 4YCXA 3GIRA 3C8YA 1A5XA 2IRXA 1EX8A 2BR0A 2GC8A 1TKXA 3ZT3A 2BE2A 4CD1A 4CLYA 1G7CB 2KZ3A 1RT4A 5CH7B 5TKYA 4DV3K 4JKAA 1QD1A 1SVDA 4ZP8A 3G25A 2QKBA 1HJRA 2YY6A 2WFBA 1QQ6A 3MM8A 1DOQA 2K1RA 3T69A 1BPEA 1IKXA 4DV1F 2W2NP 3GIIA 3KDOA 1RTDB 1S1UA 1BC6A 1HNZK 2R9LA 1IKWB 4NLRA 3KD3A 3N6MA 4KI6A 4WQ4C 4WK3A 3CDUA 3LDAA 3O80A 2QT7A 2J9CA 4MFFA 2MDAA 3HFKA 3ULDA 7AT1B 1RDCA 2DISA 3R5DA 4XDDA 4X4TA 3H42A 2UXDF 2RJZA 3D45A 4H5NA 3W9JA 3L8BA 2ACYA 2X7IA 4G9ZA 1HWJA 4OYZA 3H2VE 1ZQFA 4B1ZA 3CDEA 1MMLA 1IBKJ 1DGKN 4OJ5A 2NUHA 3NCPA 3FZHA 1CSJA 1KOHA 2HBKA 4CZJA 2N1RA 3R7BB 2VICA 1VQNN 5A0YA 3CQYA 4ZA1A 2RLTA 4OD0A 4KGVB 1FNXH 4TLQA 2QO3A 1NKBA 4CNZA 3W62A 1FA0A 3O1WA 3VGKA 3OPKA 3OTCA 7ICLA 4X4OA 2XHWA 4C3KA 4QWAA 1Z1BA 3AO5A 5HRPA 3MDQA 3V81A 3UIQA 4M95A 3NFAA 2CVIA 5CABA 3QT7A 5DQHA 4CLKA 3KXDA 4RPYA 3SQGA 3CC4S 3SI8A 4JOUA 1HRHA 5HMXA 1TL4A 4DV6J 4BROA 2V2KA 4AHTA 3RB0A 3AAQA 3EKUA 4B8CA 3WK6A 2F9TA 2YNHB 4PWUA 3KZBA 3D6MB 4LF7J 2EFQA 1OVQA 4X64J 1HQUA 5FJ4A 5BR8K 1ZQXA 5L46A 4OKEA 5J2CA 1E4FT 3VGSA 5J1NA 1ZQBA 1S9FA 4YR3A 4FXWA 4EMDA 2ZZTA 1Z25A 1JLAB 2E9RX 2VG7B 1ZBTA 1B3TA 3C3LA 5J2BA 4RLEA 3OFHA 2IVMA 2V34A 4UT4A 5HR6A 4JS5A 2QFIA 3B8HA 1S6PB 4FM2A 4OHZA 1U0HA 1BNOA 2WVEA 1QM9A 3V7JA 2KJ5A 3LP3A 2J0SD 2ZE2B 3I5CA 3ENHA 3L4BC 4WFNQ 2ZZNA 2Y0SF 4ILLA 3GP9A 1FJGF 1FWPA 4FJGA 1BWFO 3MX5A 3NGZA 4KFBA 2NRVA 2DGTA 4AL6A 1N34F 2BPCA 3CQXA 3OR2B 1KR4A 9ICPA 1TR0A 4BQZA 3LAKA 4DTRA 1VK0A 2KKHA 2FSKA 3DYAA 3KLGB 2L9NA 4R64A 2QYGA 3ZNUA 4Y2UA 3THWA 1WACA 3P3DA 1NK0A 1RM6C 1XSLA 4CM2A 2DHXA 2O8CA 3T7ZA 2BHNA 5E41A 2YBVA 4YFKA 1VIXA 4PXDA 5L1IA 2I7PA 4P0PB 2V50A 2GBZA 1RACB 2BW7A 3CIPA 4U7BA 4I2PA 8ICVA 3NVYA 4G65A 2FHOB 1XO1A 3UR3C 1F2HA 2DY1A 3CFOA 4BRMA 4MK8A 2P9CA 3D1QA 3S6JA 3C28A 2QN6B 1U2VA 5HOOA 3PCOB 3F5TA 4RUAA 4GVMA 4J91A 4H0TB 4HI2A 2RIJA 3RSEA 3SMZA 4U96A 1D9DA 1JROA 4DUYF 4CBXA 1M0SA 4M5NA 3G0ZA 2VJUA 4PUOA 5J0TA 1N88A 3AT1B 1JB0C 2PSZA 5J2PA 1WC3A 3T5LA 1XO0A 4HH0A 3VVTA 1RKIA 3DEEA 1YJVA 1NBEB 3LW5C 2EFPA 1S9GA 2H5JB 1P8ZA 4MAKA 3IR6B 3TAFA 2Q79A 3M2UB 4CIEA 4DOAA 5LMNJ 3NVKA 3THVA 2YN4A 4F67A 3QERA 3AOCA 2A0FB 4OI3A 4KV8B 4QZ9A 4MLEA 3A8YA 1ZRMA 3D66A 3D7SB 1HW8A 5CY4A 3OTOJ 2VD3A 1GLAG 5HROA 2HHVA 1U04A 5AQOA 3CF5L 1KL9A 3P6YC 2DL0A 3KHLA 1RQ0A 1D3WA 4UZBA 3VQBA 1YJWN 5KFQA 4RUBA 1KAYA 1HHSA 5F0WA 1RT2B 2E9ZA 4EX6A 1GMUA 5HQMA 2YMPA 4ID1A 1SC1B 2NPFA 1R8PA 5JUMA 5K8OA 4FO6A 5F0UA 9ATCB 3DOLB 2O3DA 3FRYA 5AQGA 4B1XB 4PG4A 3G71S 1BWVA 4DTXA 4F04B 1KDHA 3V1OA 4LRBA 2EK1A 3ULHA 4QIWD 3O6WA 3HT3A 2XC9A 2KNJA 3F2KA 4NWIA 1WOQA 2W40A 3K8WA 4I2PB 3MXIA 2UUWA 4FP9A 4F92B 5AJ3K 5JS2A 3BREA 4AXJA 1KVAA 3ZDEA 3RG6A 5ETLA 2W41A 5JMVA 4CE6A 3D0HE 3H0LB 3THPA 4LT6A 3BUZB 2ZH3A 2GEMA 3MCOA 4P2FA 2XMAA 2X6NA 5DBAA 4B3SF 2XZDB 5D8HB 1WSEA 2G2ZA 1UJ4A 3CD6S 2MTLA 2E6MA 3KKFA 1NGHA 1IM4A 3QJPA 3BGUA 3MMBB