2KNJA

Nmr structure of microplusin a antimicrobial peptide from rhipicephalus (boophilus) microplus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
HHQELCTKGDDALVTELECIRLRISPETNAAFDNAVQQLNCLNRACAYRKMCATNNLEQAMSVYFTNEQIKEIHDAATACDPEAHHEHDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Microplusin preprotein
publication title Structure and mode of action of microplusin, a copper II-chelating antimicrobial peptide from the cattle tick Rhipicephalus (Boophilus) microplus.
pubmed doi rcsb
source organism Rhipicephalus microplus
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.440 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2knjA00
2KNJA
chains in the Genus database with same CATH superfamily
1RG6A 4C8KA 4CRXA 3S6JA 3LK9A 4Y2VA 3ISDA 2KKPA 4PL1A 1U49A 1HEKA 5AK3A 1RZTA 5J0RA 5KFGA 2W9CA 3UMBA 2JH1A 2L5YA 4IR9A 3Q8QB 4Z6FA 1ZYQA 4IQWA 1PZNA 1Z19A 4I2IA 2YMLA 4KN7A 2R8JA 1XS9D 5KG3A 1D8YA 5DLGA 1NJWA 4B9SA 1KKXA 5ALSA 4TURA 3JPQA 4PPXA 4HYKA 4KN4A 4DFDA 3TI0A 8ICOA 4F93B 2ZIUB 2NV3A 1F44A 3UXNA 5IIOA 2E1EA 3ZDEA 4Z6EA 3WKCA 1NJZA 2ZIVA 7ICPA 2WB1C 1TKDA 2C28A 3C29A 3PX0A 3K1ZA 5ALLA 3TFRA 4JWMA 2W9BA 4BWJA 5AK6A 1Q46A 2G0AA 1B4FA 2AGOA 1L6NA 3KHGA 4MEYA 2YB4A 4GFJA 2HHUA 1SB3C 5ALEA 4MF2A 4C8MA 2HSZA 4KLEA 4GXJA 5EWEA 3F2BA 4DF4A 5AM3A 4G3IA 1FO4A 5D4BA 2KVCA 3OJSA 1NK5A 1PUZA 3J81j 3NUQA 2F76X 2NO4A 5F9NA 5CHGA 2KP7A 3JPPA 4O9MA 7ICKA 3T5HA 2HHTA 3IN5A 3SZ2A 1MSWD 2EAOA 1LVHA 3NASA 5DDMA 2HMXA 4PGQA 2MA1A 2KKVA 3T3FA 3TACB 3AUOA 1YZ7A 4MFAA 5ALVA 4C4SA 3ETRA 1LKYA 4EYIB 3AMZA 1HJPA 2JMGA 1IG6A 1L7NA 3WKBA 2AU0A 1TAMA 2W7OA 4K4HA 3PR4A 4R66A 2FJ6A 4RT3A 1SGGA 3PW2A 4DQSA 3D6JA 5HP4A 1S5LU 1SZPA 2ZIWA 4UAYA 1AQ6A 2EH9A 5AKKA 2R8IA 4PHEA 1T94A 2NYVA 4DL7A 2G5IB 2W7PA 5AI6A 3BQ1A 4UARA 1J2NA 2E3TA 5HHHA 4MHVA 1VDVA 3MGIA 2UVVA 8ICEA 2YTUA 1X6JA 3GQCA 5IIKA 3UMGA 1ZQIA 2KG5A 4RUAA 3MDAA 4KMUA 8ICMA 2F1JA 5KT2A 2LMRA 4J03A 5J2FA 2VJ4A 4R8UB 5BOMA 2BCQA 1JALA 2F44A 3L5KA 4C8OA 3BS5B 4KMOB 5KFFA 2P6RA 5ALQA 5IIIA 3GILA 3IP4B 2OXOA 3OJUA 1N5XA 4U6PA 4QJFB 1TAUA 1N2XA 2ZUBA 2H3VA 1ZQBA 2Y9TA 4YQWA 5ALXA 2ASDA 7ICFA 4FS2A 4I2EA 2W9BB 1D9DA 1KRPA 5JU5A 3PSTA 2HHXA 5CB1A 2BCUA 1A0PA 5DBCA 3NVWA 3RRGA 1ZQVA 2AJQA 4ED8A 1S77D 1V38A 9ICSA 1XO1A 4PHDA 3DEEA 1TK0A 2Y0SF 5L9XA 1NZPA 3N4MB 9ICNA 2ZIXB 4KLUA 2FPLA 2GH1A 1DGSA 3AM9A 2I6XA 2A19A 4P0PA 1BPYA 2JZBB 4LVSA 3LVWA 1XSNA 8ICUA 3BQ7A 2IBKA 4OO1J 5BOLA 2KE7A 3ALRA 3RF9A 1AROP 4MFFA 3MR2A 4QZAA 3BJYA 1FFVA 2E8NA 3ORYA 3BQTA 2W8KA 3RH4A 1BPDA 4RQ3A 4GXIA 4DSJA 2HBJA 3H8WA 5C5JA 1ZD5A 3U26A 3C28A 8ICVA 1TV9A 7ICQA 1X42A 4OJPA 5HHIA 1JRPA 4ICAA 4EEYA 2J6SA 3IV6A 4AYBC 5AKXA 1D8LA 2MRLA 2NRXA 9ICVA 1O08A 4IC9A 5AHXA 3QUBA 3LDAA 1S0OA 5H2FU 3JPOA 3KFUF 1JUDA 2MUTB 4P0QA 1DXSA 4NL9A 4QZDA 4R65A 2LM1A 1YZ6A 2JEIA 1KEJA 2WFAA 4NJ8A 3RR7A 3HRDD 5KG6A 1RQLA 4O3SA 2DPIA 2CPRA 3DV9A 4F71A 1SXEA 4KX5A 1JI7A 3PW5A 5KFXA 2B6GA 3OSNA 3R9KA 3MGHA 4C4RA 5F9LA 1XC9A 4HAIA 3PMNA 2XCAA 9ICGA 3QZ7A 4E0DA 8ICFA 3KKAA 2RRDA 4B9VA 2YY6A 7ICVA 4XUSA 4F91B 3NS1A 5KFPA 5G5GA 8ICNA 5AM4A 4IRCA 1S0MA 1ZD2P 3HKZC 4ECZA 1L5UA 1Q3UA 3LVVA 1MQ3A 2UVWA 2W55A 1ZQWA 2YMPA 4DL3A 3AU6A 4QZGA 1HIWA 7ICSA 3PMLA 1CEZA 2F77X 2HOQA 1T3NA 3IDWA 4Q45A 1CI4A 4UB2A 4RQ2A 1WCLA 4UW9A 2FDRA 2QLTA 4UB8U 5DBBA 1XWLA 3SV3A 4C4TA 3SEIA 1QCKA 2PKEA 4R64A 4EYHB 2ASJA 1HUZA 4O0IA 3C21A 2DWQA 3SI8A 1N48A 4O5EA 3IM1A 3OSPA 2BPCA 2OWOA 2RLTA 1QSLA 5KFWA 2HBMA 5J2DA 5ALPA 7ICLA 3MR3A 3C2MA 4J9OA 3PW4A 5AKEA 4M6WA 3GIKA 4RQ1A 9ICWA 3M9OB 2VIXA 5KFNA 1Q8KA 3ZDAA 3PW7A 4F92B 5J2AA 3WK5A 3T5JA 3EPGA 5DQIA 3C1ZA 3B0YA 2VA2A 2HHSA 4K4GA 2KK0A 2QB0B 1NK7A 1NNLA 2AQ0A 3HJEA 2ES6A 2F2AB 1SKRA 1UCVA 9ICUA 8ICCA 2KSOA 4J9MA 1NOMA 2KFZA 4B6JA 4DSLA 2H3IA 4GIBA 4YP3A 2C2RA 4DL6A 5KG7A 3CYMA 3GIIA 5DQHA 3NVZA 2HHWA 4NWIA 1ZQJA 4UAVA 3KBBA 1NKCA 4KLMA 5KT7A 1OW5A 2DPJA 1X9SA 3MFHA 1WG8A 4KLDA 3EZ5A 1ZXIA 4ECUA 4I2AA 1DGJA 2DQNB 2R8HA 5AI5A 5DG8A 4ZH4A 1QQ6A 2VANA 1K1SA 1ZRMA 2WB1F 4NLCA 4YD2A 2KNJA 4O3OA 4QWCA 2ZJ8A 5CJ7A 3CRXA 1KN5A 4DQIA 4LJXA 1SKSA 1EXNA 2BZFA 4J9NA 5AKJA 4PGXA 4TQSA 3T79A 7ICEA 4ZOHC 2ISOA 2AXTU 4CNQA 4F4XA 2XY7A 1S0NA 3EW9A 2F1IA 1BVSA 1DK3A 5ALHA 1QQ5A 9ICTA 2I1QA 4YMNA 3HW8A 2LYAA 3MR6A 5KFSA 2OCEA 4OCZA 4F2RA 2FLPA 3D2QA 2RHFA 4GLXA 1Y88A 2PMZF 4Y2XA 1U4BA 2KV2A 5AKYA 1GO3F 4I28A 4LZGA 3RAQA 8ICSA 5L1JA 5CEHA 2WF6A 4RQ0A 4M6WB 2NO5A 3H8MA 3I28A 5AM0A 5EE0A 4NL9C 2W03A 3M7DA 2WF8A 3FAHA 4OJ6A 4RT2A 5DB6A 8ICBA 3MR5A 1X40A 3MBYA 5L1KA 1SL1A 1J97A 2Q4TA 2JXJA 3UQ2A 5KT4A 5KFHA 3RBEA 1ZQZA 5AKGA 1X9MA 2XGPA 5KFYA 4EBEA 2J6UA 4KLOA 1VJ5A 3KKAC 3IRUA 1NZBA 2OEHA 2Y1JA 3KTQA 3RB0A 2A1AA 4RU9A 5ALFA 2FMPA 5D49A 3TARA 8ICYA 2XY6A 4PL2A 1O03A 1U45A 9ICHA 2ZTCA 1ZD3A 5B5EU 4UAZA 5J2CA 1DK2A 5ALKA 3H8SA 3N7PD 9ICMA 3GZFA 4QZIA 4RQMA 3KZXA 1SIJA 5DG7A 4Y2QA 3V6KA 4QZCA 1B0XA 3ETLA 5AK5A 5KFOA 2KIVA 4O3PA 4YR3A 2AQ4A 3ZDCA 1FFUA 1BNOA 4CF3A 4O5CA 4XA5A 5J2EA 5KFCA 1L8OA 4Q44A 5KFVA 4TUPA 3RBDA 3V7KA 8ICKA 3ZD9A 2ZTDA 4EX6A 5JTIA 4B9LA 4NV0A 3T5LA 9ICIA 1COOA 4BGDA 3GV7B 4JWNA 4F4KA 1Z00A 3SV4A 5IIJA 3Q8RB 1TE2A 2PFPA 3SAHA 2A3VA 5DG9A 2GOLA 4DOBA 2W9AA 1OXJA 1N56A 2K8AA 3KD3A 1L7PA 4DLEA 5KT3A 3QU5A 2VA3A 4O3MA 1JN3A 2XI9A 3RRHA 4R63A 1L3UA 5J2HA 3KHHA 2KFNA 5AI4A 4C8LA 4P4MA 4QIWC 1ZQFA 1Z4OA 4PGYA 7ICMA 2E5SA 1IM4A 3HPOA 4DS4A 2D6FC 9ICKA 3G6XA 4RQ4A 5HR6A 4FE3A 1RXVA 9ICOA 3M8SA 1ZQCA 3BQ0A 3RB4A 1KDHA 4UB5A 2F8LA 4AYBF 3WKDA 4F5QA 2HHQA 2K4HA 2LKYA 5EE9A 3NGDA 3F53A 4OJOA 4RQ7A 4CF5A 2QKQA 4RUCA 3WU2U 3DDHA 3PSIA 4WJ3B 4UBBA 2FLLA 5EWGA 2A1JA 2DGZA 4F8RA 2EDUA 3PV8A 5KFDA 4BWMA 2K8BB 1KW4A 3AEVA 1F5SA 3Q8LA 4ED1A 2E1FA 2W9CB 1FIQA 3PR5B 4BUGA 3B0XA 5JUMA 2Z7JA 5EE1A 3V6HA 4YMOA 4QW9A 3MDCA 2ESEA 4F3OA 1F0MA 4O5KA 8ICLA 3H4BA 3RR8A 4FFDA 1ZQNA 4P2HA 3BZCA 2BCRA 4EX7A 3V72A 1UA0A 2JEJA 1QSSA 3QNMA 2AHOB 3RB6A 3QXGA 1V9PA 7ICRA 2ZIVB 3KZIU 3ED5A 2ZJ5A 4QZ8A 4NLKA 2V9WA 4M9JA 4XRHA 4RQNA 4B9TA 5KG5A 2E8OA 4USAA 2ASLA 1UT5A 4U7CA 1SWWA 4NLGA 9ICQA 2XICA 3N7SC 3D2NA 4DF8A 5KFTA 5ALDA 4Y2RA 5BPCA 3LYSA 3N28A 2WTFA 3M1YA 4NLZA 4J9RA 2BDPA 3MGVA 2G5HB 4M9LA 5AM5A 2EQYA 4KX3A 5AM2A 2VKQA 3QZ8A 2DKXA 1C20A 1SZHA 4ELTA 1ZQPA 3M6KA 2FLNA 2HW3A 4DSEA 9ICAA 4M9HA 1ZQRA 4UQGA 2AGPA 3F2DA 2FMQA 3C5GA 5J0UA 4FBUA 3PY8A 9ICBA 2IOHA 2JHDA 4IQTA 1LKYB 1RDFA 5HNKA 3HT3A 1NK9A 3M8RA 1MN8A 2JGAA 3T5KA 4A8EA 2F3NA 2J6TA 3ZDDA 2ZIWB 4F5NA 3ZD8A 4BJQA 4FZLA 2Y1IA 2LHTA 5KT6A 2NRZA 4Q8EA 2ZUDA 3F5AA 1NK4A 3PO4A 2C2EA 1PVQA 4IR1A 1X2IA 4NM2A 4ED0A 5GTIU 3Q8PB 2WF5A 3OTQA 3HWTA 1SKWA 2HVHA 1KL9A 1ZETA 1URJA 3ICXA 4GC7A 2NRTA 4DQQA 3ISBA 1TVAA 4DFMA 2BCSA 1QH9A 4TUQA 1L3TA 2HI0A 3AU2A 2WAQC 1JXLA 1H38A 1S76D 4CCHA 2PFOA 4I2DA 4DLGA 2QARA 2PFNA 2G09A 2VJ5A 2YMQA 1JIHA 2ZUCA 5ALNA 4B9UA 2HBLA 4ED3A 3PW0A 1RM6C 3F5EA 4QZHA 3SD7A 4RPZA 2XC9A 4PH5A 1ZQTA 1NK0A 5J2JA 3PSFA 2XCPA 4JB3A 4I2FA 2OH2A 3K75D 3MC1A 9ICCA 3UMCA 4QZFA 8ICAA 1JMSA 4P0PB 2P6UA 3QU2A 3G6YA 1KBUA 1ZQLA 4DL5A 4QWDA 1PVRA 1WYGA 5GTHU 3PNCA 2BKEA 3SENA 4DEZA 1TFRA 2HOIA 5JRTA 2ZJAA 3KHLA 2H5XA 4PHPA 8ICIA 4YCXA 3RTVA 4KLHA 3Q8SB 3HX0A 4NM1A 5IINA 4UAWA 2YX8A 5ALZA 2AH5A 5DBAA 1NKEA 4F5RA 3I1YA 3M6ZA 3V7LA 4K4IA 4BXOA 4I2BA 4RPXA 4KLQA 2B21A 3SAFA 4J9KA 2RDJA 4KLGA 5AI0A 3H0LB 4DSFA 2IHNA 2JRZA 2P66A 5J0PA 3BZKA 5ALTA 5ALWA 2MSNA 5KT5A 1UQVA 5J0SA 4YFKA 2UVRA 4P0QB 1PK3A 3ISCA 1DOQA 3CP8A 4J9SA 5KFQA 5CR0A 4CF4A 3LWLA 2CXYA 1DRGA 2W8LA 5L1LA 1FEZA 5AKLA 4QZBA 5J29A 4Y2SA 3HILA 8ICRA 2P35A 1BGXT 3Q8KA 1TK5A 2W04A 4PJ0U 4DO9A 1L3VA 9ICLA 3H40A 2EAPA 3BS7A 3GIMA 3MFIA 2O6KA 1D9FA 2ISPA 4DL2A 1RPLA 5ALYA 4Y2TA 1NKBA 4IL6U 3H8JA 4F5OA 2BDUA 5CRXA 1QSYA 1NI3A 1UHUA 3LWMA 3IG5A 3NTUA 2HOFA 3E58A 3V7JA 4QIWF 8ICTA 3NRZA 2BCVA 4QZ9A 2GWSA 1T3QA 4JV2A 4QW8A 2WHEA 5KFAA 3RH6A 5KFRA 1SV4A 3AQEA 4PHAA 1NJXA 5DQGA 2RQ5A 5DKWA 3JPTA 3KHRA 4TUSA 4FBTA 1A76A 2KJ5A 4PZOA 5KFUA 1A77A 2ZIUA 1ZJNA 2B0CA 3UM9A 4ECWA 1IIPA 4Y2UA 3EUB2 3M9NB 2PI5A 3C2KA 2KVSA 4RQ5A 2XY5A 1U48A 3SQIA 3RB3A 3A0BU 1X9XA 3L3FX 3OHBA 2IOFK 2OM6A 3E0FA 1UA1A 4P4OA 3RJJA 5J0XA 1RQNA 5KFIA 3C2LA 1WWVA 2OYYA 4RPYA 4FS1A 4UAUA 7ICIA 2KSOB 2H3FA 5KFMA 2K4IA 3FYHA 2IMWP 3QUCA 2KMDA 2KHQA 4F5PA 5B66U 1N60A 4JMUA 5DB7A 1M6YA 8ICHA 2W9MA 3K4GA 2EZXA 4DFPA 1XNSA 8ICGA 2EAMA 3EYZA 4RQ6A 1SV0C 4KLLA 1V85A 3FM9A 1KFTA 4I2JA 1BPXA 2K60A 3NVVA 1YT3A 2KN7A 3GV5B 4NLNA 5J0OA 2ZXIA 4FZMA 3SR6A 2XO7A 5KG2A 1RYRA 1N61A 5HR7A 1L7MA 2ALZA 3RJEA 4YXMA 5KG4A 1C7YA 1MA7A 1KLNA 4EZ6A 1COKA 2FPMA 5DLFA 1QQ7A 4QWEA 4DQRA 1RXWA 3WK8A 1RYSA 2YQEA 3JPSA 3RFAA 1TAQA 1PVPA 1SL0A 9ICJA 3AL0B 4I29A 1K5OA 1WWUA 3GFKB 1ZQAA 1ECWA 2R8KA 3PO5A 4EBCA 7ICHA 4GXKA 7ICOA 2BQRA 4KITB 4UB1A 4IRDA 1A6SA 4R8UA 1BNPA 4DS5A 3E2EA 5L1MA 3CNHA 3BS5A 3JPNA 4UB4A 1T8EA 2K4PA 5KG0A 3N97B 4MF8A 3BQ2A 3ZDBA 3N7RC 2QB1A 1Z3EB 7ICJA 3QEBZ 4O3QA 5F3XB 5L1IA 2EZYA 3A0HU 2F8KA 2K8CB 2G07A 3O0FA 2Y9UA 2DKZA 4Z6CA 2IOFA 3TQ1A 3UQ0A 1ZQXA 5C0YA 2BQUA 2FPKA 1U9LA 1UT8A 4DOCA 3UPQA 4XQ8A 1ZQQA 3FC4A 4MEXA 2IA6A 2DFLA 2D8CA 4DL4A 1XO0A 3IHQB 1L7OA 2YMMA 4O3NA 2VA8A 2ZIXA 4C8NA 3PVXA 2I5HA 5KAIU 5J8YC 3WK9A 1NJYA 3TANA 5D46A 3QUTA 1X6IA 2LI6A 2JZBA 2DL0A 1XSPA 1LV5A 4DSKA 2H3ZA 3Q8MA 5EE3A 4YG2A 4YD1A 1S10A 2F1HA 2Q0ZX 1KQQA 5AIBA 4B9NA 7ICTA 4UBCA 2PMZC 3I76A 3GV8B 3WK4A 1IV8A 3ZI4A 1ZQGA 2YN4A 1ZQSA 1ZOLA 2IHMA 4C7ZA 5J2BA 4JV1A 2WAQF 2N1RA 8ICQA 4ECTA 4QWBA 1Q3VA 2KJ9A 5ALOA 2PI4A 3AN1A 2JR5A 1SXDA 2EZZA 3HKZF 1BPZA 4M9GA 2DF4B 5DDYA 5J0WA 4ECVA 5G5HA 3OGUA 2MUTA 2EANA 4IQUA 4DFKA 1MQ2A 1X66A 2KJ8A 2JEFA 4LZDA 2C2DA 3RJFA 3C1YA 1Z00B 5TZVA 2BPFA 3WK6A 3HP6A 2KZMA 3L4PA 2ZG6A 2HCFA 3UXPA 5K4LA 2GLEA 5ALMA 4KLTA 4OJLA 2DBYA 5AKZA 5IIMA 1WUDA 5DB9A 3WKEA 4EZ9A 1B22A 8ICZA 4FO6A 2W43A 1WCNA 2KOBA 2XIDA 3PX6A 5A0LA 2NRVA 3ONNA 1QTMA 5CWRA 1K1QA 2KD1A 4ECYA 1NK6A 2ZXHA 5J0YA 3SMVA 3GU3A 3H7IA 2GO7A 4F4ZA 5DB8A 2KZZA 3BDPA 4IRKA 2KTQA 4QWAA 2MU2A 3CW2C 2UVUA 5KFKA 4UB6U 1B43A 4J9PA 4M04A 3JPRA 5KFJA 4C0ZA 5KAFU 4ED6A 1TK8A 2A1JB 1ZQUA 5KFBA 2MAXA 4YR0A 2FMSA 4Q43A 5KL1B 2ODGA 2ATLA 5TISU 2K4EA 1HUOA 4DSIA 4QNLA 4ELUA 3WK7A 3VC8A 3TADA 2OHFA 3OHAA 5ALIA 2CRXA 1XU4A 2KZ3A 4J9QA 3M9MB 2R18A 2RP5A 1Z4NA 4DWIA 5AICA 1L3SA 1ZQ1C 5AI8A 3PSPA 2QB0A 1SWVA 2KIWA 4CGZA 4F4WA 4YXJA 5ALJA 5J2GA 5DGBA 3K1RB 1ZD4A 1IXRA 1KTQA 1ZQDA 4KTQA 1ZJMA 4Y2YA 2NRWA 4EELA 3NVYA 4KLSA 1ZQKA 2G08A 2BQ3A 3C23A 4Z6DA 4UB3A 4IS7A 1U47A 4MFCA 4ELVA 4OD0A 4IQVA 4AP9A 4KLJA 3RAXA 1N5WA 2W54A 3F2CA 1RYUA 4I2GA 2LYHA 4M0AA 8ICJA 1ZRNA 4B9MA 4OJ5A 8ICPA 2JH7A 4F2SA 1S9FA 1KFDA 5HMLA 5KG1A 4KLFA 3QX7A 5DGAA 1XSLA 4F4YA 3QU7A 1SV0A 5KNIA 1T4GA 4X5VA 3GIJA 2K89A 2R8GA 1ZQHA 3H0RB 3WKAA 4I2CA 5AIAA 5J2IA 1VLBA 5KFZA 1N63A 2KICA 3EWAA 5J2KA 4BDPA 1X9WA 1ZQMA 1S97A 3RJHA 1UPHA 2YB1A 4G9BA 1J2MA 3KOOA 1ZQYA 1V97A 5CA7A 3QEAZ 1S8OA 9ICXA 4JK1A 4DOAA 4RNMA 3D2SA 1N62A 4FZNA 2JEGA 1JX4A 2W3RA 2M9NA 2BR0A 3FDSA 1ZQEA 5FP0A 4M2YA 2FI1A 2XGQA 3UXOA 1D8BA 2I9GA 5AKIA 1KSPA 4F50A 2HHVA 2M0NA 4I2HA 4PZNA 4ECXA 2LPEA 4CE6A 3QUQA 5AKHA 1PK1A 2C22A 2FE9A 2WF7A 4DFJA 2Y0SC 4JUZA 3PX4A 4RQ8A 1KFSA 4KLIA 5AI9A 3V6JA 4ED7A 4TQRA 1CRXA 1T7PA 3H4DA 4US8A 4DCCA 2PFQA 4ED2A 4NY8A 3RH5A 1BPEA 5ALGA 5ALUA 3QE9Y 2W3SA 2ZTEA 8ICXA 1LB2B 2V4QA 5EOZA 4ECRA 4UASA 3TAQA 3RJIA 3QYPA 1ED1A 4M47A 4ECQA 2KEYA 4YMMA 3G6VA 2HDOA 7ICGA 5CP2A 5J8YA 4O3RA 3TKAA 3H0MB 1Z1BA 4CDGA 3AQFA 2QARB 4GC6A 3MABA 2LM4A 2XVTA 2BHNA 4YVZA 1CUKA 2LBOA 4RNNA 3IG8A 2W11A 5IILA 4F72A 3PZPA 2DUYA 2CN1A 2BGWA 3TAPA 1ZQOA 2HBKA 3NRWA 4NLBA 4M9NA 1Z1VA 3SAGA 3TADC 1JXEA 4UATA 3GDXA 2D3DA 2JV3A 3QU4A 4US9A 3C5FA 3RJGA 8ICWA 2E8PA 1SL2A 4RNOA 2AGQA 2LYBA 9ICEA 5E79U 4EBDA 1L8LA 4EEKA 1JROA 5T14A 5AK4A 5KTQA 9ICFA 3QU9A 2KHVA 5KFEA 4C80A 7ICNA 2RDIA 4NXZA 4ECSA 4I27A 9ICPA 4BXOB 4BX9C 3RJKA 2H3QA 4P4PA 4Q8FA 4DQPA 4EENA 3B9JA 5EWFA 3THVA 4ACOA 1S0VA 1P7DA 2E8MA 4YN4A 4Y2JA 4J9LA 5KL8B 4JV0A 4QZEA 3OPXA 1PK1B 3EPIA 5HMMA 5ALRA 2V4RA 7ICUA 4RZRA 5KFLA 3VCBA 2BPGA 1QLNA 1OUQA 2WF9A 1BPBA 9ICRA 4Y2PA 4YR2A 3TFSA 5J0QA 2HVIA 4C7YA 2G06A 1MC8A 2PXIA 3SYZA 5AM1A 5J0TA 1NK8A
chains in the Genus database with same CATH topology
2Q4TA 3IG8A 3PSTA 3F5AA 1ECWA 2K4EA 1IIPA 1Q3VA 2KJ9A 3NUQA 1A0PA 2F76X 4QIWC 4CRXA 3PZPA 3SAFA 4QNLA 1PVQA 2CN1A 2RRDA 2KKPA 2ZIVB 4PL1A 3IN5A 3VC8A 1HEKA 2E5SA 3H0LB 4FZNA 3D2SA 2D6FC 2HMXA 2HBKA 3DEEA 3NRWA 3HKZF 2Y0SF 4NLBA 3SQIA 2CRXA 5HR6A 1A6SA 2MA1A 2DF4B 2ZIXB 2KKVA 3L3FX 2JH1A 2GH1A 3SAGA 4FE3A 1NZBA 2DQNB 4P0PA 2OM6A 2R18A 3E0FA 2RP5A 1URJA 2WB1F 3HKZC 3ICXA 4NLCA 2KNJA 4U7CA 3LVVA 1Q3UA 4P0QB 2KJ8A 1ZQ1C 2JMGA 2F8LA 3LVWA 3PSPA 1Z19A 1D8BA 1HIWA 3CP8A 4AYBF 2XICA 3N7RC 3N7SC 2LYBA 3D2NA 4PL2A 2OYYA 1DRGA 2F77X 2K4HA 2KIWA 1TAMA 2HOQA 3CRXA 2LKYA 2WAQF 4CGZA 4OO1J 2M0NA 2W7OA 5T14A 3ALRA 2WAQC 3RF9A 2K8CB 2G07A 3F53A 4OJOA 3O0FA 3T79A 3LYSA 2YB1A 2H3FA 2KHVA 2K4IA 2ZG6A 2ZIWA 2W04A 2G09A 3PSIA 2VJ5A 3N7PD 3MGVA 2G5HB 3GZFA 4WJ3B 1T94A 3KZXA 2G5IB 4KX3A 2VKQA 2HBLA 2W7PA 2ZIUB 5C0YA 2DGZA 2KHQA 2NV3A 1F44A 2Y0SC 4OJLA 2E1EA 2HBMA 3F5EA 2G08A 4BX9C 1SZHA 2HBJA 1WUDA 4JMUA 3C28A 3M6KA 1CRXA 2H3QA 2ZIVA 4NWIA 2K8BB 2WB1C 2BDUA 1XO0A 4OJPA 1XNSA 5CRXA 4ICAA 2LYAA 3PSFA 2VIXA 4ACOA 3IG5A 2KOBA 2XI9A 4AYBC 2XIDA 3F2DA 2VJ4A 2ZIXA 2E1FA 1P7DA 2HOFA 2OH2A 2MRLA 3C29A 3K1ZA 3F2CA 5A0LA 4QIWF 5KL8B 4IC9A 3OPXA 3D2QA 1YT3A 2RHFA 3KFUF 4P0PB 2JHDA 4OJ5A 4KMOB 3M6ZA 3ONNA 4NV0A 2JH7A 4BUGA 2ZXIA 4P0QA 4FZMA 2PMZF 1ED1A 2KD1A 2Z7JA 2KV2A 2H3ZA 1GO3F 2G0AA 3IP4B 3VCBA 1KBUA 5HR7A 2KEYA 2ZXHA 2OXOA 1PVRA 2JGAA 1L6NA 3SMVA 3GU3A 3AQEA 4A8EA 2F2AB 2YB4A 3SAHA 4U6PA 4QJFB 4GFJA 1MA7A 2A3VA 2PMZC 2H3VA 2K89A 2CPRA 2HOIA 1OUQA 2GOLA 3H0RB 2W03A 3M7DA 4KX5A 3H0MB 4OJ6A 1Z1BA 4CDGA 3AQFA 2ZIWB 2KICA 2H3IA 2K8AA 2KJ5A 2XVTA 4C0ZA 3RFAA 3F2BA 2G06A 2YX8A 1PVPA 4BJQA 4FZLA 3AL0B 2ZIUA 3CYMA 1UPHA 4O3MA 2KVCA 2LHTA 2N1RA 2LBOA 5KL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNJ A; 
#chains in the Genus database with same CATH topology
 1RG6 A;  4C8K A;  4CRX A;  3S6J A;  3LK9 A;  4Y2V A;  3ISD A;  2KKP A;  4PL1 A;  1U49 A;  1HEK A;  5AK3 A;  1RZT A;  5J0R A;  5KFG A;  2W9C A;  3UMB A;  2JH1 A;  2L5Y A;  4IR9 A;  3Q8Q B;  4Z6F A;  1ZYQ A;  4IQW A;  1PZN A;  1Z19 A;  4I2I A;  2YML A;  4KN7 A;  2R8J A;  1XS9 D;  5KG3 A;  1D8Y A;  5DLG A;  1NJW A;  4B9S A;  1KKX A;  5ALS A;  4TUR A;  3JPQ A;  4PPX A;  4HYK A;  4KN4 A;  4DFD A;  3TI0 A;  8ICO A;  4F93 B;  2ZIU B;  2NV3 A;  1F44 A;  3UXN A;  5IIO A;  2E1E A;  3ZDE A;  4Z6E A;  3WKC A;  1NJZ A;  2ZIV A;  7ICP A;  2WB1 C;  1TKD A;  2C28 A;  3C29 A;  3PX0 A;  3K1Z A;  5ALL A;  3TFR A;  4JWM A;  2W9B A;  4BWJ A;  5AK6 A;  1Q46 A;  2G0A A;  1B4F A;  2AGO A;  1L6N A;  3KHG A;  4MEY A;  2YB4 A;  4GFJ A;  2HHU A;  1SB3 C;  5ALE A;  4MF2 A;  4C8M A;  2HSZ A;  4KLE A;  4GXJ A;  5EWE A;  3F2B A;  4DF4 A;  5AM3 A;  4G3I A;  1FO4 A;  5D4B A;  2KVC A;  3OJS A;  1NK5 A;  1PUZ A;  3J81 j;  3NUQ A;  2F76 X;  2NO4 A;  5F9N A;  5CHG A;  2KP7 A;  3JPP A;  4O9M A;  7ICK A;  3T5H A;  2HHT A;  3IN5 A;  3SZ2 A;  1MSW D;  2EAO A;  1LVH A;  3NAS A;  5DDM A;  2HMX A;  4PGQ A;  2MA1 A;  2KKV A;  3T3F A;  3TAC B;  3AUO A;  1YZ7 A;  4MFA A;  5ALV A;  4C4S A;  3ETR A;  1LKY A;  4EYI B;  3AMZ A;  1HJP A;  2JMG A;  1IG6 A;  1L7N A;  3WKB A;  2AU0 A;  1TAM A;  2W7O A;  4K4H A;  3PR4 A;  4R66 A;  2FJ6 A;  4RT3 A;  1SGG A;  3PW2 A;  4DQS A;  3D6J A;  5HP4 A;  1S5L U;  1SZP A;  2ZIW A;  4UAY A;  1AQ6 A;  2EH9 A;  5AKK A;  2R8I A;  4PHE A;  1T94 A;  2NYV A;  4DL7 A;  2G5I B;  2W7P A;  5AI6 A;  3BQ1 A;  4UAR A;  1J2N A;  2E3T A;  5HHH A;  4MHV A;  1VDV A;  3MGI A;  2UVV A;  8ICE A;  2YTU A;  1X6J A;  3GQC A;  5IIK A;  3UMG A;  1ZQI A;  2KG5 A;  4RUA A;  3MDA A;  4KMU A;  8ICM A;  2F1J A;  5KT2 A;  2LMR A;  4J03 A;  5J2F A;  2VJ4 A;  4R8U B;  5BOM A;  2BCQ A;  1JAL A;  2F44 A;  3L5K A;  4C8O A;  3BS5 B;  4KMO B;  5KFF A;  2P6R A;  5ALQ A;  5III A;  3GIL A;  3IP4 B;  2OXO A;  3OJU A;  1N5X A;  4U6P A;  4QJF B;  1TAU A;  1N2X A;  2ZUB A;  2H3V A;  1ZQB A;  2Y9T A;  4YQW A;  5ALX A;  2ASD A;  7ICF A;  4FS2 A;  4I2E A;  2W9B B;  1D9D A;  1KRP A;  5JU5 A;  3PST A;  2HHX A;  5CB1 A;  2BCU A;  1A0P A;  5DBC A;  3NVW A;  3RRG A;  1ZQV A;  2AJQ A;  4ED8 A;  1S77 D;  1V38 A;  9ICS A;  1XO1 A;  4PHD A;  3DEE A;  1TK0 A;  2Y0S F;  5L9X A;  1NZP A;  3N4M B;  9ICN A;  2ZIX B;  4KLU A;  2FPL A;  2GH1 A;  1DGS A;  3AM9 A;  2I6X A;  2A19 A;  4P0P A;  1BPY A;  2JZB B;  4LVS A;  3LVW A;  1XSN A;  8ICU A;  3BQ7 A;  2IBK A;  4OO1 J;  5BOL A;  2KE7 A;  3ALR A;  3RF9 A;  1ARO P;  4MFF A;  3MR2 A;  4QZA A;  3BJY A;  1FFV A;  2E8N A;  3ORY A;  3BQT A;  2W8K A;  3RH4 A;  1BPD A;  4RQ3 A;  4GXI A;  4DSJ A;  2HBJ A;  3H8W A;  5C5J A;  1ZD5 A;  3U26 A;  3C28 A;  8ICV A;  1TV9 A;  7ICQ A;  1X42 A;  4OJP A;  5HHI A;  1JRP A;  4ICA A;  4EEY A;  2J6S A;  3IV6 A;  4AYB C;  5AKX A;  1D8L A;  2MRL A;  2NRX A;  9ICV A;  1O08 A;  4IC9 A;  5AHX A;  3QUB A;  3LDA A;  1S0O A;  5H2F U;  3JPO A;  3KFU F;  1JUD A;  2MUT B;  4P0Q A;  1DXS A;  4NL9 A;  4QZD A;  4R65 A;  2LM1 A;  1YZ6 A;  2JEI A;  1KEJ A;  2WFA A;  4NJ8 A;  3RR7 A;  3HRD D;  5KG6 A;  1RQL A;  4O3S A;  2DPI A;  2CPR A;  3DV9 A;  4F71 A;  1SXE A;  4KX5 A;  1JI7 A;  3PW5 A;  5KFX A;  2B6G A;  3OSN A;  3R9K A;  3MGH A;  4C4R A;  5F9L A;  1XC9 A;  4HAI A;  3PMN A;  2XCA A;  9ICG A;  3QZ7 A;  4E0D A;  8ICF A;  3KKA A;  2RRD A;  4B9V A;  2YY6 A;  7ICV A;  4XUS A;  4F91 B;  3NS1 A;  5KFP A;  5G5G A;  8ICN A;  5AM4 A;  4IRC A;  1S0M A;  1ZD2 P;  3HKZ C;  4ECZ A;  1L5U A;  1Q3U A;  3LVV A;  1MQ3 A;  2UVW A;  2W55 A;  1ZQW A;  2YMP A;  4DL3 A;  3AU6 A;  4QZG A;  1HIW A;  7ICS A;  3PML A;  1CEZ A;  2F77 X;  2HOQ A;  1T3N A;  3IDW A;  4Q45 A;  1CI4 A;  4UB2 A;  4RQ2 A;  1WCL A;  4UW9 A;  2FDR A;  2QLT A;  4UB8 U;  5DBB A;  1XWL A;  3SV3 A;  4C4T A;  3SEI A;  1QCK A;  2PKE A;  4R64 A;  4EYH B;  2ASJ A;  1HUZ A;  4O0I A;  3C21 A;  2DWQ A;  3SI8 A;  1N48 A;  4O5E A;  3IM1 A;  3OSP A;  2BPC A;  2OWO A;  2RLT A;  1QSL A;  5KFW A;  2HBM A;  5J2D A;  5ALP A;  7ICL A;  3MR3 A;  3C2M A;  4J9O A;  3PW4 A;  5AKE A;  4M6W A;  3GIK A;  4RQ1 A;  9ICW A;  3M9O B;  2VIX A;  5KFN A;  1Q8K A;  3ZDA A;  3PW7 A;  4F92 B;  5J2A A;  3WK5 A;  3T5J A;  3EPG A;  5DQI A;  3C1Z A;  3B0Y A;  2VA2 A;  2HHS A;  4K4G A;  2KK0 A;  2QB0 B;  1NK7 A;  1NNL A;  2AQ0 A;  3HJE A;  2ES6 A;  2F2A B;  1SKR A;  1UCV A;  9ICU A;  8ICC A;  2KSO A;  4J9M A;  1NOM A;  2KFZ A;  4B6J A;  4DSL A;  2H3I A;  4GIB A;  4YP3 A;  2C2R A;  4DL6 A;  5KG7 A;  3CYM A;  3GII A;  5DQH A;  3NVZ A;  2HHW A;  4NWI A;  1ZQJ A;  4UAV A;  3KBB A;  1NKC A;  4KLM A;  5KT7 A;  1OW5 A;  2DPJ A;  1X9S A;  3MFH A;  1WG8 A;  4KLD A;  3EZ5 A;  1ZXI A;  4ECU A;  4I2A A;  1DGJ A;  2DQN B;  2R8H A;  5AI5 A;  5DG8 A;  4ZH4 A;  1QQ6 A;  2VAN A;  1K1S A;  1ZRM A;  2WB1 F;  4NLC A;  4YD2 A;  2KNJ A;  4O3O A;  4QWC A;  2ZJ8 A;  5CJ7 A;  3CRX A;  1KN5 A;  4DQI A;  4LJX A;  1SKS A;  1EXN A;  2BZF A;  4J9N A;  5AKJ A;  4PGX A;  4TQS A;  3T79 A;  7ICE A;  4ZOH C;  2ISO A;  2AXT U;  4CNQ A;  4F4X A;  2XY7 A;  1S0N A;  3EW9 A;  2F1I A;  1BVS A;  1DK3 A;  5ALH A;  1QQ5 A;  9ICT A;  2I1Q A;  4YMN A;  3HW8 A;  2LYA A;  3MR6 A;  5KFS A;  2OCE A;  4OCZ A;  4F2R A;  2FLP A;  3D2Q A;  2RHF A;  4GLX A;  1Y88 A;  2PMZ F;  4Y2X A;  1U4B A;  2KV2 A;  5AKY A;  1GO3 F;  4I28 A;  4LZG A;  3RAQ A;  8ICS A;  5L1J A;  5CEH A;  2WF6 A;  4RQ0 A;  4M6W B;  2NO5 A;  3H8M A;  3I28 A;  5AM0 A;  5EE0 A;  4NL9 C;  2W03 A;  3M7D A;  2WF8 A;  3FAH A;  4OJ6 A;  4RT2 A;  5DB6 A;  8ICB A;  3MR5 A;  1X40 A;  3MBY A;  5L1K A;  1SL1 A;  1J97 A;  2Q4T A;  2JXJ A;  3UQ2 A;  5KT4 A;  5KFH A;  3RBE A;  1ZQZ A;  5AKG A;  1X9M A;  2XGP A;  5KFY A;  4EBE A;  2J6U A;  4KLO A;  1VJ5 A;  3KKA C;  3IRU A;  1NZB A;  2OEH A;  2Y1J A;  3KTQ A;  3RB0 A;  2A1A A;  4RU9 A;  5ALF A;  2FMP A;  5D49 A;  3TAR A;  8ICY A;  2XY6 A;  4PL2 A;  1O03 A;  1U45 A;  9ICH A;  2ZTC A;  1ZD3 A;  5B5E U;  4UAZ A;  5J2C A;  1DK2 A;  5ALK A;  3H8S A;  3N7P D;  9ICM A;  3GZF A;  4QZI A;  4RQM A;  3KZX A;  1SIJ A;  5DG7 A;  4Y2Q A;  3V6K A;  4QZC A;  1B0X A;  3ETL A;  5AK5 A;  5KFO A;  2KIV A;  4O3P A;  4YR3 A;  2AQ4 A;  3ZDC A;  1FFU A;  1BNO A;  4CF3 A;  4O5C A;  4XA5 A;  5J2E A;  5KFC A;  1L8O A;  4Q44 A;  5KFV A;  4TUP A;  3RBD A;  3V7K A;  8ICK A;  3ZD9 A;  2ZTD A;  4EX6 A;  5JTI A;  4B9L A;  4NV0 A;  3T5L A;  9ICI A;  1COO A;  4BGD A;  3GV7 B;  4JWN A;  4F4K A;  1Z00 A;  3SV4 A;  5IIJ A;  3Q8R B;  1TE2 A;  2PFP A;  3SAH A;  2A3V A;  5DG9 A;  2GOL A;  4DOB A;  2W9A A;  1OXJ A;  1N56 A;  2K8A A;  3KD3 A;  1L7P A;  4DLE A;  5KT3 A;  3QU5 A;  2VA3 A;  4O3M A;  1JN3 A;  2XI9 A;  3RRH A;  4R63 A;  1L3U A;  5J2H A;  3KHH A;  2KFN A;  5AI4 A;  4C8L A;  4P4M A;  4QIW C;  1ZQF A;  1Z4O A;  4PGY A;  7ICM A;  2E5S A;  1IM4 A;  3HPO A;  4DS4 A;  2D6F C;  9ICK A;  3G6X A;  4RQ4 A;  5HR6 A;  4FE3 A;  1RXV A;  9ICO A;  3M8S A;  1ZQC A;  3BQ0 A;  3RB4 A;  1KDH A;  4UB5 A;  2F8L A;  4AYB F;  3WKD A;  4F5Q A;  2HHQ A;  2K4H A;  2LKY A;  5EE9 A;  3NGD A;  3F53 A;  4OJO A;  4RQ7 A;  4CF5 A;  2QKQ A;  4RUC A;  3WU2 U;  3DDH A;  3PSI A;  4WJ3 B;  4UBB A;  2FLL A;  5EWG A;  2A1J A;  2DGZ A;  4F8R A;  2EDU A;  3PV8 A;  5KFD A;  4BWM A;  2K8B B;  1KW4 A;  3AEV A;  1F5S A;  3Q8L A;  4ED1 A;  2E1F A;  2W9C B;  1FIQ A;  3PR5 B;  4BUG A;  3B0X A;  5JUM A;  2Z7J A;  5EE1 A;  3V6H A;  4YMO A;  4QW9 A;  3MDC A;  2ESE A;  4F3O A;  1F0M A;  4O5K A;  8ICL A;  3H4B A;  3RR8 A;  4FFD A;  1ZQN A;  4P2H A;  3BZC A;  2BCR A;  4EX7 A;  3V72 A;  1UA0 A;  2JEJ A;  1QSS A;  3QNM A;  2AHO B;  3RB6 A;  3QXG A;  1V9P A;  7ICR A;  2ZIV B;  3KZI U;  3ED5 A;  2ZJ5 A;  4QZ8 A;  4NLK A;  2V9W A;  4M9J A;  4XRH A;  4RQN A;  4B9T A;  5KG5 A;  2E8O A;  4USA A;  2ASL A;  1UT5 A;  4U7C A;  1SWW A;  4NLG A;  9ICQ A;  2XIC A;  3N7S C;  3D2N A;  4DF8 A;  5KFT A;  5ALD A;  4Y2R A;  5BPC A;  3LYS A;  3N28 A;  2WTF A;  3M1Y A;  4NLZ A;  4J9R A;  2BDP A;  3MGV A;  2G5H B;  4M9L A;  5AM5 A;  2EQY A;  4KX3 A;  5AM2 A;  2VKQ A;  3QZ8 A;  2DKX A;  1C20 A;  1SZH A;  4ELT A;  1ZQP A;  3M6K A;  2FLN A;  2HW3 A;  4DSE A;  9ICA A;  4M9H A;  1ZQR A;  4UQG A;  2AGP A;  3F2D A;  2FMQ A;  3C5G A;  5J0U A;  4FBU A;  3PY8 A;  9ICB A;  2IOH A;  2JHD A;  4IQT A;  1LKY B;  1RDF A;  5HNK A;  3HT3 A;  1NK9 A;  3M8R A;  1MN8 A;  2JGA A;  3T5K A;  4A8E A;  2F3N A;  2J6T A;  3ZDD A;  2ZIW B;  4F5N A;  3ZD8 A;  4BJQ A;  4FZL A;  2Y1I A;  2LHT A;  5KT6 A;  2NRZ A;  4Q8E A;  2ZUD A;  3F5A A;  1NK4 A;  3PO4 A;  2C2E A;  1PVQ A;  4IR1 A;  1X2I A;  4NM2 A;  4ED0 A;  5GTI U;  3Q8P B;  2WF5 A;  3OTQ A;  3HWT A;  1SKW A;  2HVH A;  1KL9 A;  1ZET A;  1URJ A;  3ICX A;  4GC7 A;  2NRT A;  4DQQ A;  3ISB A;  1TVA A;  4DFM A;  2BCS A;  1QH9 A;  4TUQ A;  1L3T A;  2HI0 A;  3AU2 A;  2WAQ C;  1JXL A;  1H38 A;  1S76 D;  4CCH A;  2PFO A;  4I2D A;  4DLG A;  2QAR A;  2PFN A;  2G09 A;  2VJ5 A;  2YMQ A;  1JIH A;  2ZUC A;  5ALN A;  4B9U A;  2HBL A;  4ED3 A;  3PW0 A;  1RM6 C;  3F5E A;  4QZH A;  3SD7 A;  4RPZ A;  2XC9 A;  4PH5 A;  1ZQT A;  1NK0 A;  5J2J A;  3PSF A;  2XCP A;  4JB3 A;  4I2F A;  2OH2 A;  3K75 D;  3MC1 A;  9ICC A;  3UMC A;  4QZF A;  8ICA A;  1JMS A;  4P0P B;  2P6U A;  3QU2 A;  3G6Y A;  1KBU A;  1ZQL A;  4DL5 A;  4QWD A;  1PVR A;  1WYG A;  5GTH U;  3PNC A;  2BKE A;  3SEN A;  4DEZ A;  1TFR A;  2HOI A;  5JRT A;  2ZJA A;  3KHL A;  2H5X A;  4PHP A;  8ICI A;  4YCX A;  3RTV A;  4KLH A;  3Q8S B;  3HX0 A;  4NM1 A;  5IIN A;  4UAW A;  2YX8 A;  5ALZ A;  2AH5 A;  5DBA A;  1NKE A;  4F5R A;  3I1Y A;  3M6Z A;  3V7L A;  4K4I A;  4BXO A;  4I2B A;  4RPX A;  4KLQ A;  2B21 A;  3SAF A;  4J9K A;  2RDJ A;  4KLG A;  5AI0 A;  3H0L B;  4DSF A;  2IHN A;  2JRZ A;  2P66 A;  5J0P A;  3BZK A;  5ALT A;  5ALW A;  2MSN A;  5KT5 A;  1UQV A;  5J0S A;  4YFK A;  2UVR A;  4P0Q B;  1PK3 A;  3ISC A;  1DOQ A;  3CP8 A;  4J9S A;  5KFQ A;  5CR0 A;  4CF4 A;  3LWL A;  2CXY A;  1DRG A;  2W8L A;  5L1L A;  1FEZ A;  5AKL A;  4QZB A;  5J29 A;  4Y2S A;  3HIL A;  8ICR A;  2P35 A;  1BGX T;  3Q8K A;  1TK5 A;  2W04 A;  4PJ0 U;  4DO9 A;  1L3V A;  9ICL A;  3H40 A;  2EAP A;  3BS7 A;  3GIM A;  3MFI A;  2O6K A;  1D9F A;  2ISP A;  4DL2 A;  1RPL A;  5ALY A;  4Y2T A;  1NKB A;  4IL6 U;  3H8J A;  4F5O A;  2BDU A;  5CRX A;  1QSY A;  1NI3 A;  1UHU A;  3LWM A;  3IG5 A;  3NTU A;  2HOF A;  3E58 A;  3V7J A;  4QIW F;  8ICT A;  3NRZ A;  2BCV A;  4QZ9 A;  2GWS A;  1T3Q A;  4JV2 A;  4QW8 A;  2WHE A;  5KFA A;  3RH6 A;  5KFR A;  1SV4 A;  3AQE A;  4PHA A;  1NJX A;  5DQG A;  2RQ5 A;  5DKW A;  3JPT A;  3KHR A;  4TUS A;  4FBT A;  1A76 A;  2KJ5 A;  4PZO A;  5KFU A;  1A77 A;  2ZIU A;  1ZJN A;  2B0C A;  3UM9 A;  4ECW A;  1IIP A;  4Y2U A;  3EUB 2;  3M9N B;  2PI5 A;  3C2K A;  2KVS A;  4RQ5 A;  2XY5 A;  1U48 A;  3SQI A;  3RB3 A;  3A0B U;  1X9X A;  3L3F X;  3OHB A;  2IOF K;  2OM6 A;  3E0F A;  1UA1 A;  4P4O A;  3RJJ A;  5J0X A;  1RQN A;  5KFI A;  3C2L A;  1WWV A;  2OYY A;  4RPY A;  4FS1 A;  4UAU A;  7ICI A;  2KSO B;  2H3F A;  5KFM A;  2K4I A;  3FYH A;  2IMW P;  3QUC A;  2KMD A;  2KHQ A;  4F5P A;  5B66 U;  1N60 A;  4JMU A;  5DB7 A;  1M6Y A;  8ICH A;  2W9M A;  3K4G A;  2EZX A;  4DFP A;  1XNS A;  8ICG A;  2EAM A;  3EYZ A;  4RQ6 A;  1SV0 C;  4KLL A;  1V85 A;  3FM9 A;  1KFT A;  4I2J A;  1BPX A;  2K60 A;  3NVV A;  1YT3 A;  2KN7 A;  3GV5 B;  4NLN A;  5J0O A;  2ZXI A;  4FZM A;  3SR6 A;  2XO7 A;  5KG2 A;  1RYR A;  1N61 A;  5HR7 A;  1L7M A;  2ALZ A;  3RJE A;  4YXM A;  5KG4 A;  1C7Y A;  1MA7 A;  1KLN A;  4EZ6 A;  1COK A;  2FPM A;  5DLF A;  1QQ7 A;  4QWE A;  4DQR A;  1RXW A;  3WK8 A;  1RYS A;  2YQE A;  3JPS A;  3RFA A;  1TAQ A;  1PVP A;  1SL0 A;  9ICJ A;  3AL0 B;  4I29 A;  1K5O A;  1WWU A;  3GFK B;  1ZQA A;  1ECW A;  2R8K A;  3PO5 A;  4EBC A;  7ICH A;  4GXK A;  7ICO A;  2BQR A;  4KIT B;  4UB1 A;  4IRD A;  1A6S A;  4R8U A;  1BNP A;  4DS5 A;  3E2E A;  5L1M A;  3CNH A;  3BS5 A;  3JPN A;  4UB4 A;  1T8E A;  2K4P A;  5KG0 A;  3N97 B;  4MF8 A;  3BQ2 A;  3ZDB A;  3N7R C;  2QB1 A;  1Z3E B;  7ICJ A;  3QEB Z;  4O3Q A;  5F3X B;  5L1I A;  2EZY A;  3A0H U;  2F8K A;  2K8C B;  2G07 A;  3O0F A;  2Y9U A;  2DKZ A;  4Z6C A;  2IOF A;  3TQ1 A;  3UQ0 A;  1ZQX A;  5C0Y A;  2BQU A;  2FPK A;  1U9L A;  1UT8 A;  4DOC A;  3UPQ A;  4XQ8 A;  1ZQQ A;  3FC4 A;  4MEX A;  2IA6 A;  2DFL A;  2D8C A;  4DL4 A;  1XO0 A;  3IHQ B;  1L7O A;  2YMM A;  4O3N A;  2VA8 A;  2ZIX A;  4C8N A;  3PVX A;  2I5H A;  5KAI U;  5J8Y C;  3WK9 A;  1NJY A;  3TAN A;  5D46 A;  3QUT A;  1X6I A;  2LI6 A;  2JZB A;  2DL0 A;  1XSP A;  1LV5 A;  4DSK A;  2H3Z A;  3Q8M A;  5EE3 A;  4YG2 A;  4YD1 A;  1S10 A;  2F1H A;  2Q0Z X;  1KQQ A;  5AIB A;  4B9N A;  7ICT A;  4UBC A;  2PMZ C;  3I76 A;  3GV8 B;  3WK4 A;  1IV8 A;  3ZI4 A;  1ZQG A;  2YN4 A;  1ZQS A;  1ZOL A;  2IHM A;  4C7Z A;  5J2B A;  4JV1 A;  2WAQ F;  2N1R A;  8ICQ A;  4ECT A;  4QWB A;  1Q3V A;  2KJ9 A;  5ALO A;  2PI4 A;  3AN1 A;  2JR5 A;  1SXD A;  2EZZ A;  3HKZ F;  1BPZ A;  4M9G A;  2DF4 B;  5DDY A;  5J0W A;  4ECV A;  5G5H A;  3OGU A;  2MUT A;  2EAN A;  4IQU A;  4DFK A;  1MQ2 A;  1X66 A;  2KJ8 A;  2JEF A;  4LZD A;  2C2D A;  3RJF A;  3C1Y A;  1Z00 B;  5TZV A;  2BPF A;  3WK6 A;  3HP6 A;  2KZM A;  3L4P A;  2ZG6 A;  2HCF A;  3UXP A;  5K4L A;  2GLE A;  5ALM A;  4KLT A;  4OJL A;  2DBY A;  5AKZ A;  5IIM A;  1WUD A;  5DB9 A;  3WKE A;  4EZ9 A;  1B22 A;  8ICZ A;  4FO6 A;  2W43 A;  1WCN A;  2KOB A;  2XID A;  3PX6 A;  5A0L A;  2NRV A;  3ONN A;  1QTM A;  5CWR A;  1K1Q A;  2KD1 A;  4ECY A;  1NK6 A;  2ZXH A;  5J0Y A;  3SMV A;  3GU3 A;  3H7I A;  2GO7 A;  4F4Z A;  5DB8 A;  2KZZ A;  3BDP A;  4IRK A;  2KTQ A;  4QWA A;  2MU2 A;  3CW2 C;  2UVU A;  5KFK A;  4UB6 U;  1B43 A;  4J9P A;  4M04 A;  3JPR A;  5KFJ A;  4C0Z A;  5KAF U;  4ED6 A;  1TK8 A;  2A1J B;  1ZQU A;  5KFB A;  2MAX A;  4YR0 A;  2FMS A;  4Q43 A;  5KL1 B;  2ODG A;  2ATL A;  5TIS U;  2K4E A;  1HUO A;  4DSI A;  4QNL A;  4ELU A;  3WK7 A;  3VC8 A;  3TAD A;  2OHF A;  3OHA A;  5ALI A;  2CRX A;  1XU4 A;  2KZ3 A;  4J9Q A;  3M9M B;  2R18 A;  2RP5 A;  1Z4N A;  4DWI A;  5AIC A;  1L3S A;  1ZQ1 C;  5AI8 A;  3PSP A;  2QB0 A;  1SWV A;  2KIW A;  4CGZ A;  4F4W A;  4YXJ A;  5ALJ A;  5J2G A;  5DGB A;  3K1R B;  1ZD4 A;  1IXR A;  1KTQ A;  1ZQD A;  4KTQ A;  1ZJM A;  4Y2Y A;  2NRW A;  4EEL A;  3NVY A;  4KLS A;  1ZQK A;  2G08 A;  2BQ3 A;  3C23 A;  4Z6D A;  4UB3 A;  4IS7 A;  1U47 A;  4MFC A;  4ELV A;  4OD0 A;  4IQV A;  4AP9 A;  4KLJ A;  3RAX A;  1N5W A;  2W54 A;  3F2C A;  1RYU A;  4I2G A;  2LYH A;  4M0A A;  8ICJ A;  1ZRN A;  4B9M A;  4OJ5 A;  8ICP A;  2JH7 A;  4F2S A;  1S9F A;  1KFD A;  5HML A;  5KG1 A;  4KLF A;  3QX7 A;  5DGA A;  1XSL A;  4F4Y A;  3QU7 A;  1SV0 A;  5KNI A;  1T4G A;  4X5V A;  3GIJ A;  2K89 A;  2R8G A;  1ZQH A;  3H0R B;  3WKA A;  4I2C A;  5AIA A;  5J2I A;  1VLB A;  5KFZ A;  1N63 A;  2KIC A;  3EWA A;  5J2K A;  4BDP A;  1X9W A;  1ZQM A;  1S97 A;  3RJH A;  1UPH A;  2YB1 A;  4G9B A;  1J2M A;  3KOO A;  1ZQY A;  1V97 A;  5CA7 A;  3QEA Z;  1S8O A;  9ICX A;  4JK1 A;  4DOA A;  4RNM A;  3D2S A;  1N62 A;  4FZN A;  2JEG A;  1JX4 A;  2W3R A;  2M9N A;  2BR0 A;  3FDS A;  1ZQE A;  5FP0 A;  4M2Y A;  2FI1 A;  2XGQ A;  3UXO A;  1D8B A;  2I9G A;  5AKI A;  1KSP A;  4F50 A;  2HHV A;  2M0N A;  4I2H A;  4PZN A;  4ECX A;  2LPE A;  4CE6 A;  3QUQ A;  5AKH A;  1PK1 A;  2C22 A;  2FE9 A;  2WF7 A;  4DFJ A;  2Y0S C;  4JUZ A;  3PX4 A;  4RQ8 A;  1KFS A;  4KLI A;  5AI9 A;  3V6J A;  4ED7 A;  4TQR A;  1CRX A;  1T7P A;  3H4D A;  4US8 A;  4DCC A;  2PFQ A;  4ED2 A;  4NY8 A;  3RH5 A;  1BPE A;  5ALG A;  5ALU A;  3QE9 Y;  2W3S A;  2ZTE A;  8ICX A;  1LB2 B;  2V4Q A;  5EOZ A;  4ECR A;  4UAS A;  3TAQ A;  3RJI A;  3QYP A;  1ED1 A;  4M47 A;  4ECQ A;  2KEY A;  4YMM A;  3G6V A;  2HDO A;  7ICG A;  5CP2 A;  5J8Y A;  4O3R A;  3TKA A;  3H0M B;  1Z1B A;  4CDG A;  3AQF A;  2QAR B;  4GC6 A;  3MAB A;  2LM4 A;  2XVT A;  2BHN A;  4YVZ A;  1CUK A;  2LBO A;  4RNN A;  3IG8 A;  2W11 A;  5IIL A;  4F72 A;  3PZP A;  2DUY A;  2CN1 A;  2BGW A;  3TAP A;  1ZQO A;  2HBK A;  3NRW A;  4NLB A;  4M9N A;  1Z1V A;  3SAG A;  3TAD C;  1JXE A;  4UAT A;  3GDX A;  2D3D A;  2JV3 A;  3QU4 A;  4US9 A;  3C5F A;  3RJG A;  8ICW A;  2E8P A;  1SL2 A;  4RNO A;  2AGQ A;  2LYB A;  9ICE A;  5E79 U;  4EBD A;  1L8L A;  4EEK A;  1JRO A;  5T14 A;  5AK4 A;  5KTQ A;  9ICF A;  3QU9 A;  2KHV A;  5KFE A;  4C80 A;  7ICN A;  2RDI A;  4NXZ A;  4ECS A;  4I27 A;  9ICP A;  4BXO B;  4BX9 C;  3RJK A;  2H3Q A;  4P4P A;  4Q8F A;  4DQP A;  4EEN A;  3B9J A;  5EWF A;  3THV A;  4ACO A;  1S0V A;  1P7D A;  2E8M A;  4YN4 A;  4Y2J A;  4J9L A;  5KL8 B;  4JV0 A;  4QZE A;  3OPX A;  1PK1 B;  3EPI A;  5HMM A;  5ALR A;  2V4R A;  7ICU A;  4RZR A;  5KFL A;  3VCB A;  2BPG A;  1QLN A;  1OUQ A;  2WF9 A;  1BPB A;  9ICR A;  4Y2P A;  4YR2 A;  3TFS A;  5J0Q A;  2HVI A;  4C7Y A;  2G06 A;  1MC8 A;  2PXI A;  3SYZ A;  5AM1 A;  5J0T A;  1NK8 A; 
#chains in the Genus database with same CATH homology
 2Q4T A;  3IG8 A;  3PST A;  3F5A A;  1ECW A;  2K4E A;  1IIP A;  1Q3V A;  2KJ9 A;  3NUQ A;  1A0P A;  2F76 X;  4QIW C;  4CRX A;  3PZP A;  3SAF A;  4QNL A;  1PVQ A;  2CN1 A;  2RRD A;  2KKP A;  2ZIV B;  4PL1 A;  3IN5 A;  3VC8 A;  1HEK A;  2E5S A;  3H0L B;  4FZN A;  3D2S A;  2D6F C;  2HMX A;  2HBK A;  3DEE A;  3NRW A;  3HKZ F;  2Y0S F;  4NLB A;  3SQI A;  2CRX A;  5HR6 A;  1A6S A;  2MA1 A;  2DF4 B;  2ZIX B;  2KKV A;  3L3F X;  2JH1 A;  2GH1 A;  3SAG A;  4FE3 A;  1NZB A;  2DQN B;  4P0P A;  2OM6 A;  2R18 A;  3E0F A;  2RP5 A;  1URJ A;  2WB1 F;  3HKZ C;  3ICX A;  4NLC A;  2KNJ A;  4U7C A;  3LVV A;  1Q3U A;  4P0Q B;  2KJ8 A;  1ZQ1 C;  2JMG A;  2F8L A;  3LVW A;  3PSP A;  1Z19 A;  1D8B A;  1HIW A;  3CP8 A;  4AYB F;  2XIC A;  3N7R C;  3N7S C;  2LYB A;  3D2N A;  4PL2 A;  2OYY A;  1DRG A;  2F77 X;  2K4H A;  2KIW A;  1TAM A;  2HOQ A;  3CRX A;  2LKY A;  2WAQ F;  4CGZ A;  4OO1 J;  2M0N A;  2W7O A;  5T14 A;  3ALR A;  2WAQ C;  3RF9 A;  2K8C B;  2G07 A;  3F53 A;  4OJO A;  3O0F A;  3T79 A;  3LYS A;  2YB1 A;  2H3F A;  2KHV A;  2K4I A;  2ZG6 A;  2ZIW A;  2W04 A;  2G09 A;  3PSI A;  2VJ5 A;  3N7P D;  3MGV A;  2G5H B;  3GZF A;  4WJ3 B;  1T94 A;  3KZX A;  2G5I B;  4KX3 A;  2VKQ A;  2HBL A;  2W7P A;  2ZIU B;  5C0Y A;  2DGZ A;  2KHQ A;  2NV3 A;  1F44 A;  2Y0S C;  4OJL A;  2E1E A;  2HBM A;  3F5E A;  2G08 A;  4BX9 C;  1SZH A;  2HBJ A;  1WUD A;  4JMU A;  3C28 A;  3M6K A;  1CRX A;  2H3Q A;  2ZIV A;  4NWI A;  2K8B B;  2WB1 C;  2BDU A;  1XO0 A;  4OJP A;  1XNS A;  5CRX A;  4ICA A;  2LYA A;  3PSF A;  2VIX A;  4ACO A;  3IG5 A;  2KOB A;  2XI9 A;  4AYB C;  2XID A;  3F2D A;  2VJ4 A;  2ZIX A;  2E1F A;  1P7D A;  2HOF A;  2OH2 A;  2MRL A;  3C29 A;  3K1Z A;  3F2C A;  5A0L A;  4QIW F;  5KL8 B;  4IC9 A;  3OPX A;  3D2Q A;  1YT3 A;  2RHF A;  3KFU F;  4P0P B;  2JHD A;  4OJ5 A;  4KMO B;  3M6Z A;  3ONN A;  4NV0 A;  2JH7 A;  4BUG A;  2ZXI A;  4P0Q A;  4FZM A;  2PMZ F;  1ED1 A;  2KD1 A;  2Z7J A;  2KV2 A;  2H3Z A;  1GO3 F;  2G0A A;  3IP4 B;  3VCB A;  1KBU A;  5HR7 A;  2KEY A;  2ZXH A;  2OXO A;  1PVR A;  2JGA A;  1L6N A;  3SMV A;  3GU3 A;  3AQE A;  4A8E A;  2F2A B;  2YB4 A;  3SAH A;  4U6P A;  4QJF B;  4GFJ A;  1MA7 A;  2A3V A;  2PMZ C;  2H3V A;  2K89 A;  2CPR A;  2HOI A;  1OUQ A;  2GOL A;  3H0R B;  2W03 A;  3M7D A;  4KX5 A;  3H0M B;  4OJ6 A;  1Z1B A;  4CDG A;  3AQF A;  2ZIW B;  2KIC A;  2H3I A;  2K8A A;  2KJ5 A;  2XVT A;  4C0Z A;  3RFA A;  3F2B A;  2G06 A;  2YX8 A;  1PVP A;  4BJQ A;  4FZL A;  3AL0 B;  2ZIU A;  3CYM A;  1UPH A;  4O3M A;  2KVC A;  2LHT A;  2N1R A;  2LBO A;  5KL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...