4DSEA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dseA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dseA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dseA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dseA01
2AGQA 3RB3A 4CGGA 1MU2A 2VA2A 1IO2A 5KFHA 4AHTA 4DSIA 4BE2A 4Z4IA 4E0DA 4IFYA 1ZQEA 1RDBA 3PO4A 4O3RA 3B6OA 3ETLA 3KHGA 4J9RA 3MAQA 5L1LA 2NRTA 1S1XA 4MFFA 1WLJA 2F8TA 3OGUA 2HVHA 2A1SA 1U4BA 3CYMA 4F2SA 4IG0A 4H8KA 3KLFA 4IQTA 3V6KA 3SCXA 5DDMA 5C5JA 2ASJA 8ICGA 1N6QA 1C1AA 4ECSA 1QS4A 8ICZA 2IGIA 2OPPA 4ZTFA 2R8HA 1BPXA 5FRNA 3HYFA 2VG6A 4CJSA 2AU0A 3MR2A 5EOZA 3PMNA 1J9AA 2XY5A 3GDXA 1ZQZA 1BPYA 4B3OA 4YP3A 5SWMA 1NJXA 2BPFA 5FROA 4JK1A 5HBMA 1XWLA 5F9NA 1KSPA 3ISBA 2IA6A 5FDLA 1NK4A 3SV3A 1Y97A 8ICCA 4KRFA 3QZ7A 3MFHA 1TK0A 2P5OA 4QWBA 3VQ4A 1TL1A 4BE1A 1BPDA 5KFLA 3ALYA 3V72A 5HROA 5DB8A 4Q45A 1D8YA 3NF6A 3SUQA 1ZQAA 4OJRA 3K75D 9ICEA 3T19A 3V6JA 4M0AA 1A5WA 2XGQA 4NLZA 3LDSA 1L3UA 7ICVA 8ICPA 3RBDA 4DQRA 4CFBA 1JXBA 1HJPA 2PFOA 5DBAA 4YR0A 4M3TA 3UPQA 1HYVA 4ED8A 1T4GA 5J0PA 2W8LA 5L1IA 4DTUA 2UVRA 4RNOA 2HW3A 2FPLA 4FS1A 4M9GA 9ICGA 1RBVA 3AVHA 4F5PA 3KLHA 4PUOA 3LP0A 1S0VA 4CF1A 4ED7A 4J9QA 4NCGA 4FS2A 3QE9Y 4CJ5A 1YTUA 1CXUA 3PR4A 4DL4A 4FJ5A 4FZXC 2G8HA 5DQHA 3QEVA 4CCHA 1V9PA 4DF4A 4LZGA 4E7HA 3V7JA 2ASDA 4B8CA 1VK0A 7ICFA 4ID1A 2AQ4A 1X1PA 2QKKA 4R8UA 2J6SA 1WCLA 3C1ZA 4DSKA 1IKWA 3CFRA 3QESA 1KFSA 1QLNA 1ZQDA 2XY7A 4YFUA 4NCBA 2PYLA 4GXJA 2I5JA 4F91B 3Q8KA 1KCFA 5EU7A 4O5BA 4DFPA 3G10A 2A1RA 1RTHA 2FLNA 2BQUA 3AA4A 3VQEA 1D8LA 4J9SA 2VA8A 5J2JA 4CK1A 2PFQA 3F73A 3MR3A 2ATLA 4M3RA 3V9UA 2IDOA 1S0NA 2W42A 2IMWP 2HHTA 3MXMA 4K8ZA 3VQBA 3DLBA 2BQRA 3BGRA 2BANA 3N4MB 1UOCA 1WSJA 4Z6DA 3QLHA 1KFTA 3ZSZA 1D9FA 4DTNA 5K14A 4O3SA 3HXMA 2HNDA 1QSSA 1TKTA 5J0QA 4J2DA 3RB6A 3G6YA 2R8GA 5HMMA 3OJUA 3QEBZ 2KQ2A 4YD1A 4E1MA 2UVUA 3M8QA 3V1QA 3HP9A 1ZQIA 5DB7A 3SI8A 1BQMA 3O4QA 3ZSRA 2ZD1A 4CF0A 1NK0A 9ICIA 1JLEA 3ZSXA 2O4IA 1ASUA 5FRMA 2JEGA 5KT7A 4IQWA 3VN5A 4CJVA 4DTXA 1S9GA 3K59A 4Y1DA 3GQCA 2D0CA 1A76A 4TQRA 3BJYA 1NK7A 3OYAA 1WN7A 4EP5A 2YKNA 2JZBB 3S3MA 2RKIA 4UBBA 4KLQA 4KLHA 3LP1A 3PV8A 4F93B 3PR5B 4EZ9A 4TUSA 1IKYA 1ZQBA 2B4JA 3M8SA 1T7PA 3JYTA 2ZJ5A 4CJTA 2ZJ8A 1JN3A 4JUZA 1IH7A 4JS4A 3LPUA 2ZUBA 5HP1A 4W5RA 4DSFA 2C28A 1IKXA 2GUIA 4PHPA 3SQ2A 3IHQB 4RQ0A 1S9FA 2Z1HA 1XHZA 4Y1CA 4CEFA 4E7IA 5DQGA 1U45A 2Q3SA 1HYZA 3VQ6A 2B5JA 3MXJA 4GLXA 2LYHA 3V1RA 4RT3A 3LANA 3AVIA 3ISNC 4FK2A 1NJWA 3HP6A 3JPSA 5CY4A 2KFNA 1GOCA 2PI4A 3BQ0A 4M04A 4HUFA 5J2HA 3K5LA 2A1JA 4DU4A 1HNIA 4OKEA 3LAKA 1XS9D 4RQ2A 4BXOA 2MUTB 2ZJAA 5D46A 3ZSOA 1NOZA 1LWCA 4PHDA 1WSFA 4AH9A 3V9SA 3DI6A 4I27A 4QZHA 3BQ1A 3V7KA 3ISCA 1Z00B 3ZT1A 1BPBA 3H8WA 2W9BB 1SL1A 3QO9A 3B0XA 4FJJA 4CHYA 4MFCA 1Z25A 3QEAZ 5KRTA 9ICHA 4UB2A 4BGDA 3KIOA 3OYJA 3SUPA 3KKSA 4KLIA 1RT7A 2WOMA 3QZ8A 3JPQA 3RB0A 8ICNA 1RCHA 3C1YA 1T8EA 1REVA 5DK5A 1ZQMA 1FKPA 3DMJA 3RJHA 2X74A 2HHVA 4MFBA 4WE1A 4ECUA 1ZBLA 2D0AA 2I1QA 3UQ2A 4RG8A 5CB1A 1FKOA 3VQPA 2WONA 5KT4A 2C2RA 1TKXA 7ICIA 5J0UA 5IIKA 4OKJA 3ULDA 1CZ9A 2F96A 4Z4CA 1PZNA 4RQ5A 3PW0A 4NLGA 1WSHA 4DOAA 4IG3A 5KGWA 4PGYA 4CJUA 1JXEA 1WSGA 5KFTA 4BDZA 1BGXT 1MSWD 3T1AA 3AU2A 2VWJA 4NYNA 4DFJA 1RTDA 4YVZA 5J0SA 3C21A 2BCUA 3WNGA 4KHUA 3B6PA 2YV0X 4FJ9A 4LD0A 2QXFA 3QIPA 1S9EA 3EPGA 2F1JA 1ZBIA 1TK8A 4EYIB 1ZQYA 8ICLA 4FLUA 3DYAA 4PHAA 4ECYA 1B92A 2NUBA 2YHAA 2DFFA 1F21A 7ICHA 3AVBA 3EZ5A 1A5XA 4GC7A 1TAUA 1J5OA 4XIUA 4QZFA 1HNVA 3DRSA 4O5EA 4ECZA 2W9CA 1BIUA 3O3GA 1O1WA 3NH1A 3FFIA 3OYEA 3TI0A 4CEDA 3L2QA 5J29A 9ICFA 4FBUA 5KG3A 3PUFA 1S5JA 3PVXA 3V6HA 5CHGA 2OPRA 4RPYA 3BDPA 9ICUA 5JUMA 1KVBA 4RQ3A 4NM2A 4O3PA 4W5QA 3NHGA 3AVFA 3RBEA 3O3HA 4CIEA 4MF8A 4ELVA 3AUOA 4PH5A 1VRUA 3GIMA 8ICFA 3L3UA 3I0RA 1ZQRA 3DLKA 3Q8LA 4RT2A 1BI4A 2XY8A 3LZJA 3ZSYA 4M6WA 4CE9A 4QW9A 3ITHA 1RT5A 2AQ0A 3L3VA 4B9UA 4RU9A 1TKZA 3C6TA 3RMDA 5F9LA 8ICXA 4PGXA 2X6SA 1NK9A 2PFNA 1S10A 1XSLA 4C8MA 3LALA 2P6RA 4DL7A 2I9GA 1RBUA 4KTQA 1ZQKA 2XCAA 1L5UA 1QSYA 1DTTA 4QWAA 4OPKA 3VQCA 1U47A 4ZTJA 5KFXA 5KG0A 3O3FA 4ELTA 4DL3A 5CWRA 4Z4GA 2P1JA 5KFSA 3V6DA 2PFPA 2PXIA 4CJKA 3KLEA 1ZQCA 2G8VA 4M41A 2IS3A 4H4OA 1JL1A 5DGAA 3AU6A 4DLGA 4FK4A 5L1KA 1IXRA 5HHHA 3LP2A 4RW9A 1RDCA 3AO3A 3L2WA 4MFAA 5J2AA 3SQ0A 5KFKA 1Z3EB 4E7LA 1JLGA 2Q0ZX 3HX0A 4KFBA 2E6MA 5I42A 4Z4EA 5CA7A 4F8RA 3OYHA 1RT6A 4FJXA 4M9LA 7ICJA 2GWSA 3BQTA 2C2DA 2OPQA 4O4GA 4KI6A 3EW9A 1ZQQA 4DL2A 3AVAA 3S3OA 4JV0A 3GIKA 4UQGA 1S6QA 4KO0A 3ZD8A 3PW7A 4GC6A 4M3XA 2MAXA 4ECVA 4M9HA 2ASLA 5E41A 2KN7A 4K4GA 4YXJA 3Q8RB 1BPZA 1GOBA 3JPRA 2V4QA 5DBCA 4UAYA 5L9XA 2FMPA 4JWNA 4YNQA 1DGSA 9ICLA 5BPCA 3KHHA 4QWCA 7ICEA 3MABA 2IHMA 1BVSA 3MGIA 4FJIA 3HO1A 2JLEA 1VSEA 1C0UA 2KTQA 4QAGA 2DFEA 2FBVA 1UA1A 3OYIA 4DQIA 5KTQA 3UXPA 3RB4A 4F3OA 4ED1A 1JXLA 1I3AA 4TUPA 2E6LA 4Z6CA 5CYMA 3OHBA 3KHRA 4OKKA 3K57A 9ICCA 4UBCA 3OYBA 4EBCA 3O4NA 5KG4A 1NOYA 3GV7B 8ICJA 2ZTDA 4RUCA 1UA0A 4KLFA 1ZBHA 4BACA 3C95A 5KFNA 2ZTCA 3SPYA 2ZE2A 4G3IA 3NGIA 2G8UA 3T3FA 4CESA 1EETA 5BOLA 4OGEA 4XA5A 4O3QA 4RW4A 3TAMA 4I2DA 3ZDBA 1S77D 3HK2A 2VANA 1C0TA 4CEAA 4I28A 3UXNA 1TVRA 1R0AA 4KV8A 4FW2A 3SPZA 1A5VA 3DRPA 4NLNA 1C1BA 1J54A 1ZETA 4GW6A 1SKWA 5KGXA 3LK9A 2BCVA 4CGDA 4I2JA 3V9XA 3ZT3A 4KHNA 1S6PA 3P1GA 2YNIA 3KLGA 3TAGA 4KHYA 4HVJA 5J2PA 3NAEA 4CIGA 4YG2A 1U48A 3M8RA 4PY5A 4TUQA 3SNNA 4O3OA 4F4XA 4KITB 2F8SA 2LSNA 4FM2A 8ICMA 4FO6A 3AA3A 3OVNA 4LH4A 1VSKA 1S1WA 2WTFA 1SL2A 1LV5A 3B0YA 4B8AB 4CJPA 5KG6A 3C2KA 3GIIA 3LDAA 2BQ3A 2HHSA 2P5GA 2HVIA 3CM6A 2JEIA 4BDPA 1RPLA 1XO1A 3EYZA 4JS5A 4DTSA 5DQIA 3IAYA 4R5PA 2YNHA 9ICPA 1K6YA 3BQ2A 4KLEA 1MC8A 4XQ8A 4J9OA 4MQ3A 4DF8A 1KEJA 2OYQA 2F1IA 1SL0A 3WNEA 2HHQA 5HMLA 3K58A 2H5XA 4MF2A 5HNKA 1ZYQA 4F4YA 1ZQGA 3WNFA 2PY5A 4O3NA 2DPIA 1LW2A 4MEXA 2YKMA 4NLKA 2HHUA 1JLCA 4M42A 1C6VA 5EWEA 3CQ8A 4KLOA 1IM4A 4KLJA 4KPYA 4FZZA 3TANA 2W9MA 5CP2A 3OSPA 4DSLA 4FLWA 5HRPA 4N41A 3RJGA 4DFKA 4EBDA 1S97A 1X9SA 4B9LA 2G8KA 4I2QA 4I7FA 4K4IA 4FBTA 2OPSA 5JS2A 3SQ1A 4YFKA 3ZDCA 3NCIA 4Q0BA 4C8KA 5KRSA 3ZDAA 4DWIA 4JLHA 3HPOA 2F1HA 4EZ6A 1RBSA 4IBNA 1VSLA 3RTVA 3DM2A 1ZQNA 3KTQA 4DTPA 4DQQA 5HHIA 1L3TA 2NRVA 4W5NA 3RMBA 3K4GA 9ICRA 4IR1A 3C2MA 1K1QA 1A77A 4N76A 2ZQBA 4ED3A 3V9ZA 4QCLA 1ZQWA 3ZT2A 5J1EA 3L8BA 1T03A 4B9NA 9ICXA 4Q5VA 2RPIA 3ZSWA 4O0JA 4L8RB 4XRHA 1VSFA 1TK5A 4CIFA 1HUZA 4KLUA 1D5AA 4OPJA 2ZUDA 2NRZA 2G8IA 4M3ZA 2BPGA 2AJQA 3S9HA 4GXIA 2DFHA 3T5LA 2ISPA 3OYFA 9ICMA 3V7LA 8ICYA 1TAQA 4KREA 1TL3A 2JEFA 3TAEA 1J53A 1K1SA 1CUKA 4DQPA 7ICTA 2FC0A 4C8NA 4OGCA 4FLYA 3G6XA 4DFMA 4IRDA 2FBTA 1JLFA 4F5QA 5KFQA 3ASMA 4YR3A 3QEWA 1X2IA 3PX6A 3KJVA 9ICQA 1DTQA 4UB3A 1UAXA 5J2BA 2BR0A 2FPKA 9ICVA 4QZBA 4CGJA 1SKSA 9ICAA 5J2KA 3QEXA 3CM5A 3SUNA 3PW2A 1BIZA 7ICLA 3NFAA 4UB5A 4FJNA 3SYZA 1CZBA 3PW4A 3MDAA 4CJRA 4CGFA 5J2FA 3QERA 2FLLA 2IAJA 2IBKA 2B21A 1C0MA 4YD2A 1RBTA 3CG7A 4X5VA 1U04A 4J2AA 4I2AA 3L2UA 4BE0A 5DBBA 2BE2A 5DG7A 4DS5A 5HRNA 5HRRA 1B43A 4M9JA 1B22A 5CJ7A 3Q8PB 4W5OA 3H8SA 4CF8A 5KG1A 5CZ2A 4F4ZA 7ICMA 4N56A 1ITGA 2VG5A 4F2RA 3HVRA 5CZ1A 4HCCA 4FM0A 1ZBUA 9ICSA 4O5KA 1COOA 2PZSA 8ICVA 2M9NA 3AO2A 5DB9A 4KAZA 4CJLA 4ECXA 8ICBA 9ICJA 1RDAA 1NK8A 5KI6A 1BISA 1CXQA 3U3GA 4I9QA 3P83D 1ZQFA 4QZ9A 4CHNA 1S1UA 4DU1A 4I9LA 1VSMA 2C2EA 4K8XA 2Z1GA 4E7JA 2V4RA 4KLDA 1B9FA 2XRIA 4CHZA 1JLQA 3MEGA 1KDHA 4Z6EA 1BL3A 5D49A 5J0RA 4CHQA 2Z1JA 4FVMA 3TAFA 4LSLA 4JRPA 5DLFA 1ZQHA 2IHNA 1BPEA 3NF8A 3M9MB 7ICSA 1CLQA 5I3UA 7ICQA 3V4IA 3CFPA 1ASWA 4ECRA 3NF9A 3L2VA 5KG5A 1VRTA 2OWOA 4DLEA 3H8JA 3AA5X 1XSNA 3PNCA 1KVCA 3KLIA 3KD5E 3LP3A 4RQ8A 3AO4A 4IRCA 5J0OA 3U3YA 2GBZA 3HM9A 3PX4A 4DS4A 4CERA 4RW8A 3AA2A 4HUEA 2DY4A 5KG2A 2KZMA 1RTJA 4CEOA 4FJ8A 4QZEA 3LZIA 4ECQA 4KI4A 3RJIA 2OZSA 4FJHA 4J2BA 3L2RA 3HW8A 4KN4A 4R8UB 2UVVA 1BCMA 4PQUA 2JZBA 3I0SA 3AO1A 1G15A 4F5OA 1I39A 3MR6A 1DLOA 1WAJA 4GXKA 4IQUA 1JX4A 5KFUA 3RMCA 3RR7A 7ICNA 4M9NA 4HHTA 3C23A 3JPPA 1ZQTA 4NYFA 4IDKA 4DSJA 5KFIA 3NGYA 4NCAA 1HQEA 5DG9A 4O0IA 1ZQLA 4QZIA 1RDDA 3DOLA 4RZRA 4LY7A 2BPCA 4BWJA 3GV5B 8ICAA 4ID5A 1VSJA 3FDSA 4QOZB 1X9MA 3AO5A 4CF2A 2FMQA 5KFOA 4C8OA 1WSIA 3OYCA 4DTRA 5KT6A 1XI1A 4Z6FA 1RT3A 4I2BA 2ETJA 3KKRA 3V81A 4RW6A 1EKEA 4EP4A 5TZVA 1QHTA 3HPGA 4FM1A 4RUAA 4ED2A 4HYKA 4FJ7A 1TGOA 2DFLA 1C1CA 4CFCA 1Y88A 4NM1A 1YVUA 4NXZA 4O44A 3V9WA 3MEEA 3K5OA 2MUTA 1ASVA 2VA3A 3SI6A 1Z00A 4F5NA 2KFZA 4DOCA 4CK3A 2G8FA 5KFAA 4Q43A 2J6TA 2W9BA 2HNYA 2PI5A 4YCXA 1X9WA 7ICRA 1WAFA 4BDYA 3WNHA 4FK0A 2ATQA 1NJZA 3IG1A 3SV4A 4ECWA 3ORYA 3I8DA 2JEJA 3VQQA 3GIJA 3CFOA 3C5FA 4CECA 4ZH4A 5IIOA 4KLLA 3AVMA 4M3WA 2XC9A 3KK1A 5DKWA 7ICGA 3RJJA 5KFYA 3VQ7A 2W8KA 4O55A 4RNMA 4I2HA 1FK9A 1QE1A 4QZ8A 4FLVA 4IRKA 1RZTA 4P4MA 2GV9A 8ICQA 2JGUA 2UVWA 2BCRA 4F92B 3MFIA 4ED0A 2FLPA 8ICIA 8ICEA 4GMJB 4QW8A 1WNSA 1RILA 1NJYA 3LAMA 5KFRA 3TQ1A 3RJKA 2R8KA 3AVGA 4PA1A 4IR9A 9ICNA 3IS9A 3H4DA 5CYQA 3MBYA 4I2FA 4CFAA 1NKEA 4N5SA 5DB6A 3HT3A 4LSNA 3KK2A 1NK5A 1ZBFA 5EWFA 3TARA 2C22A 3NDKA 4P4OA 1EXNA 5J2IA 1RNHA 2G8WA 3A2FA 4KB1A 2B6AA 2BCSA 1CEZA 1Z26A 1XHXA 2P6UA 4CJQA 1Q8IA 2HHWA 1ZQOA 2A1JB 2EX3A 4LH5A 2FMSA 4CGHA 4BXOB 3JPOA 3EWAA 1BQNA 4DSEA 4CJEA 3OJSA 3ISDA 4OVLA 3MXIA 5HRSA 3KHLA 9ICTA 1HRHA 5J0WA 4KN7A 3RJEA 5BOMA 2XO7A 3HSTB 4E3SA 3QNNA 4QZAA 2X6NA 4MEYA 3OHAA 3TWHA 1ZQUA 1S0MA 5DLGA 3ZSQA 1HPZA 5C24A 3QEIA 2P51A 1LWFA 9ICWA 4KLGA 3H08A 8ICRA 4M3UA 5KFBA 3ZDDA 4FXDA 3OS0A 3KD1E 1QTMA 4FJGA 4JV1A 3VQDA 3IM1A 2IOCA 4AHRA 1GOAA 3UXOA 3JPTA 4I2PA 1S0OA 1RT2A 1EXQA 2BHNA 5L1JA 4GVMA 3NE6A 4CEZA 5J2NA 5KFVA 1XU4A 3VA3A 1Q9YA 3S3NA 2Y1JA 3AVJA 3D45A 1T05A 1QSLA 4NY8A 1LAVA 4FW1A 1WSEA 4PWDA 4OLBA 4FYDA 4CJ3A 4UAWA 5IINA 3NH0A 4KB0A 4F3TA 4Q8EA 2KW4A 4ELUA 4RQ6A 4DG1A 1IKVA 4E7KA 1JLAA 1JMSA 4IFVA 2J6UA 4IQVA 3EY1A 3RWUA 4YXMA 4KHWA 4I2EA 1UWBA 3LWLA 1HQUA 1HYSA 4ICLA 5KFWA 2DPJA 2Y1IA 3MDCA 3LPTA 1JL2A 4I2CA 4J9MA 3NGZA 5IILA 3ZT4A 1L3VA 8ICTA 2XY6A 1N5YA 4O9MA 2HHXA 4AHSA 3OYKA 3T5KA 4TSXA 1AROP 4PGQA 1NK6A 2W9CB 3VQ9A 3RJFA 1VSDA 4TURA 4XUSA 1FXXA 3TFRA 5KFPA 3RH4A 4HTUA 4M2YA 5IIMA 3OSNA 4CEEA 2Z1IA 1HJRA 4J2EA 1N56A 3KK3A 1RXWA 3NBPA 4RQ1A 1VSHA 3ZCMA 3PO5A 3MEDA 4I2GA 1TKDA 3G0ZA 3PY8A 4R66A 4UAZA 4B9TA 4J9LA 4UB1A 4J9NA 5J0YA 1LB2B 4N47A 4BWMA 1BI4B 5SZTA 3DLEA 1KVAA 4J9PA 3GILA 4M6WB 2BKEA 4JV2A 4RPXA 3E2EA 2KZZA 4PHEA 2D5RA 4DL5A 3OS2A 1ZJMA 3SUOA 1Q9XA 4CHPA 4E89A 5D3GA 4P2HA 2XHBA 3EPIA 3F9KA 1D9DA 3C2LA 1VSIA 5KFGA 3UQ0A 1W9HA 5J2GA 1MQ2A 2OZMA 4FJLA 1DOQA 1S76D 2BGGA 1S1TA 3V1OA 4KTZA 2V9WA 1RT4A 3SZ2A 1HUOA 4CFDA 2E4LA 4FCYA 4Z4FA 3PW5A 5JS1A 4RQ7A 8ICSA 4DMNA 1SV5A 4JWMA 5KFMA 9ICBA 3OYLA 4JRQA 4RNNA 3P5JA 2PYJA 4RPZA 3QIOA 4YN4A 4B9SA 4E1NA 4R65A 5J2DA 3VQ8A 4KLMA 4UB4A 2HNZA 1NKCA 4CGIA 3H7IA 3U6FA 1TV6A 1IG9A 3IRXA 4G1QA 3NGDA 3TFSA 3N97B 3TABA 3M9OB 4J9KA 5D4BA 5KFEA 2VWKA 5KFJA 3QNOA 4LZDA 3SJJA 5C25A 4DTOA 3HPHA 5J0XA 4B08A 4F50A 4CEBA 4KLSA 2QK9A 4F5RA 3RRGA 4KLTA 2ZUCA 2ISOA 3AV9A 3VQ5A 4Z4HA 4F4WA 3G6VA 4CJ4A 2IC3A 2BCQA 4M45A 2KZ3A 1BCOA 5J2EA 2R8IA 1EX4A 2FBXA 4FJMA 3OYDA 3VQAA 3DLGA 3OYNA 4DOBA 3DLHA 2RDJA 1XSPA 4K4HA 2RDIA 1NKBA 2W9AA 4YMMA 4EYHB 4YMNA 3NH2A 4FLTA 4AHCA 3RR8A 3TAPA 1JLBA 1TV9A 3GV8B 3OYGA 8ICKA 7ICPA 3NTUA 3QINA 1RBRA 2VG7A 2DTUA 3K2PA 3OYMA 2XCPA 8ICOA 4QWDA 4IKFA 3K5MA 8ICWA 5DGBA 1QQCA 3AVCA 4FJKA 2HMIA 5KFFA 5KT3A 9ICOA 3ZDEA 3HJFA 3T5JA 7ICKA 9ICKA 1ZQSA 1UT5A 3K5NA 5HP4A 4DO9A 2BGWA 4EEYA 1U49A 3RRHA 2P66A 1TFRA 4RW7A 1B9DA 1N48A 3JPNA 2FPMA 3VA0A 1T3NA 2EHGA 1JIHA 3OY9A 3QEPA 3GFKB 4KMUA 5IIJA 5CR0A 4DL6A 3H40A 4CJFA 4YR2A 4DQSA 7ICOA 4AHUA 3AVNA 4FLXA 4FZYA 3RMAA 1S1VA 4DTJA 4R64A 4RQ4A 2AGOA 2O4GA 1SZPA 2ZTEA 3HWTA 1JKHA 1W0HA 5C42A 1KRPA 3C5GA 2YNFA 5KFCA 1UT8A 3OS1A 5KFDA 7ICUA 4KHQA 1RT1A 4CF9A 2XGPA 3RH6A 1KTQA 3Q8MA 5DDYA 2YHBA 4B9MA 4QZDA 4OLAA 3TR8A 5KG7A 1C7YA 4ZHRA 3ZSVA 2R7YA 5DMRA 5J0TA 5J2QA 3ZD9A 5J2MA 3LWMA 3AVLA 3RAXA 2AGPA 1KLNA 3D0PA 1LW0A 4EBEA 4ED6A 3FYHA 4ECTA 4I2IA 4DEZA 1ZQXA 1LWEA 4CJWA 4Q8FA 1YT3A 4KHSA 4P4PA 3MR5A 4I29A 3THVA 3M9NB 1SKRA 5IIIA 2R8JA 1LAWA 3Q8SB 1HMVA 2HB5A 8ICUA 4HCBA 1H38A 4AHVA 4HUGA 4FLZA 3RH5A 1SUQA 3RAQA 3HVTA 2D0BA 1MQ3A 4B9VA 3M8PA 2NRWA 4C8LA 4KTWA 2ITGA 3MECA 4KKOA 2NRXA 3TAQA 2ALZA 8ICHA 4TQSA 4YQWA 4O5CA 4QZGA 4LVSA 2YNGA 4W5TA 3C6UA 5J2CA 3DLRA 1KFDA 5KT2A 4Z0UA 4CK2A 2X78A 5EWGA 1XC9A 4M3YA 4R63A 4DU3A 1NOMA 2RF2A 3PX0A 1WCNA 1RYSA 2OA8A 2FBYA 3HL8A 4QWEA 3QETA 3MGHA 5KT5A 1RXVA 3JSMA 4CEQA 4DTMA 1RTIA 3Q8QB 3DRRA 4CHOA 4M47A 3H4BA 4Q44A 3NF7A 4E19A 3E01A 1YTAA 1ZQJA 1BHLA 1U9LA 5KFZA 5HLFA 1EP4A 1ZQPA 2RN2A 1ZJNA 4PPXA 5T7BA 3PMLA 5DG8A 4YMOA 1L3SA 3T5HA 3DOKA 2BDPA 3C94A 1RYRA 3AVKA 3ZT0A 3UIQA 1ZQVA 2QKBA 1KLMA 3SQ4A 4H4MA 4AILC 1TVAA 4F4KA 4QZCA
chains in the Genus database with same CATH superfamily
2IJRA 1MU2A 5KFHA 4DSIA 4OJLA 1W2BR 4HVZA 1VDHA 2HLTA 3R27A 3ETLA 4J9RA 3MAQA 4R79A 3QGPA 1IN0A 3BN7A 2W2OP 3J7AP 3WXKA 1T03B 1IJFB 2VOPA 2F8TA 4EHUA 5CH7B 2RILA 4H8KA 4IQTA 3V6KA 3SCXA 5DDMA 2ASJA 2H3IA 2VYPA 4NRTA 1UVLA 3ZLJA 5AKJA 1BPXA 2KIWA 3I9V9 2C1EB 3M2RB 4JNEA 3VQTA 1OH7A 3MR2A 2P6SA 3CCSS 5EOZA 2QC3A 2QLBB 4QIEA 1BPYA 5TKWA 4ETXA 1FRJA 1TL3B 5ALRA 3MOZA 1XBWA 2QLJB 2O8EB 2ESEA 1QCKA 4P7TA 3IXQA 5HBMA 2V2ZA 3HHDA 1KSPA 3RW7A 3H0LB 2XLKA 1NK4A 3SV3A 1S7IA 2BXJA 4LF6F 2GELA 4JI1J 1CJKA 4QU7A 5T7LA 2G5IB 3O80A 3LDPA 4L3NA 2ZJPL 2P5OA 4QZVB 3VQ4A 2PMZC 2UU9F 2QA2A 1VISA 1NGAA 3D6HB 2LCWA 3SMZA 5KFLA 4Q45A 4DV0F 3MAHA 4CLWA 4C9DA 3VZHA 4FPRA 2XWYA 2FSJA 3V6JA 4M0AA 1A5WA 2HGLA 3NGRA 4MHVA 1NJIT 4AL6A 7ICVA 1WG8A 3DOMA 3RBDA 2CPEA 3Q8YA 3O0FA 1JXBA 3DXMA 3N6LA 1WBDA 4M3TA 5KOWA 2NRRA 2BE2B 3FC4A 4RNOA 5G0RB 3J7ZT 5IM0A 2O66A 3LP0A 3TVYA 4ED7A 4NCGA 3QE9Y 1CXUA 1TU0B 2KI2A 5DQHA 4GMKA 3QEVA 2CAJA 1P1TA 2EWHA 2ABYA 3V7JA 2E8OA 4UAVA 3R5GA 2ZG6A 2AQ4A 1N88A 3HHEA 1X1PA 2CA9A 1B0VA 1SIZA 1XNQJ 2N7CA 3W2VB 2CPXA 3C1ZA 4DSKA 1HW8A 1G99A 1Z4UA 4X4UA 1ZQDA 5IQ6A 2XY7A 4YFUA 3JXOA 3EWGA 2PYLA 4GXJA 1OSCA 4F91B 1KCFA 3RBXA 4DFPA 1FDNA 1S1UB 1ITPA 2WFAA 1FCAA 3AOAA 3WHIA 3WQTA 3MMBA 4OJ6A 3PHEA 4C4SA 2YMMA 2ZH2A 4AYBC 4J9VA 1U6FA 2VA8A 2VU5A 3F5EA 2A3JA 1JWWA 2W54A 3M8YA 1JK9B 2PFQA 3SQGB 3CC4N 2ATLA 5ADXH 2IDOA 2IMWP 4LSLB 2UUAF 7FDRA 1OYEA 4QBUA 3TOQA 3HHLD 2V5HG 4ES1A 3V4IB 3ZSZA 3CCRS 1RFQA 4O3SA 2PT0A 4OZ3A 1VIOA 3HFKA 3LM9A 3O08A 4CT9A 3G6YA 5HMMA 4YOEA 1H2VZ 4RBVA 2F8KA 4M7YA 1FJGJ 4K4WA 3F44A 1T9VA 4YD1A 4E1MA 2CKWA 2AP6A 1N61A 1ZQIA 3VF4A 5DB7A 4JKFA 3SI8A 3CDEA 2J9EA 3G4SS 2G13A 3R97A 2ZD1A 4CF0A 2MKYA 4FE3A 3CERA 3CIZA 2IJFA 4LQ3A 5KT7A 4CJVA 2DF4B 4JKHA 1QAJA 1S9GA 1DQ9A 3K59A 3VGLA 2DGWA 1A76A 4IJAA 1HKBA 4TQRA 1DRZA 4A8FA 1UJ4A 1IV8A 1WN7A 1PAUB 3KMSA 4EP5A 3FKBA 3HHLA 4PYAA 4QS7A 4PQUB 2JZBB 5CABA 5E79U 1VQ4S 3AGRA 1XMQJ 4KLHA 3MX2A 3D2EA 3ETOA 4MKBA 1SCJB 4LRAA 3MD1A 4EZ9A 4IDKB 1IKYA 4TNOA 1HQEB 2VFTA 2ZIXB 1U0HB 3DOLB 1IWGA 4WP8A 1Q7LB 2C42A 4JYAJ 3LPUA 4KX3A 2ZUBA 1VC6A 4W5RA 4DSFA 2EVZA 3EE8A 4IKAA 3IHQB 2Z1HA 1LCUA 3CXCM 3GYGA 3A5MC 2GQCA 1XHZA 4Y1CA 2U2FA 1EB0A 4CEFA 2B5JA 2MGZB 3TTFA 3MXJA 1PYSB 3HHKA 3M30A 4CD3A 2BM0A 2F8HA 2F5GA 4DV5K 4MH8A 3ISNC 5B0GA 3HP6A 4ZLLA 1SC4B 3M1VA 2GIQA 5FLXO 5J2HA 2V52B 3AY9A 1I94K 4RQ2A 2VZ9A 3A5LC 5IT0A 2MUTB 3LL3A 2VBYA 2MKSA 3ZSOA 1NOZA 4OJ1A 3V9SA 1K0VA 4I27A 4QZHA 3BQ1A 3CGIA 2P9PA 2HNYB 2BYCA 3B0XA 3EEQA 3EGWB 4CHYA 2O8DB 1VQ5N 4OL8A 5BREA 1Z25A 4IFYB 5IWAK 3GE9A 4OJHA 3VGVA 2VV5A 2HS4A 4BGDA 4YOWA 4DFDA 5E2QA 2QTDA 1IBCB 3ULEB 2K7JA 3PM9A 3QZ8A 3GBTA 2B3TB 4UATA 3D68A 2V8HA 1X9JA 4PKDB 3QAUA 5EHHA 4UOCA 2GC8A 4LF8K 3IUCA 3RJHA 3L95X 2E2OA 4PAAA 1RYUA 2D0AA 3UQ2A 4RG8A 3VENA 2HBJA 2DGZA 4OZNA 5KT4A 3TUPA 2C2RA 1E6VB 4LF9F 5IIKA 1IV0A 4A8EA 2F96A 4Z4CA 4OMFG 4RQ5A 3PW0A 3H42A 1DQAA 3AQOA 3UVJB 4LSNB 1FRHA 3M2UA 4IG3A 1PBUA 3TJAA 3BQ7A 3KK2B 5KGWA 4ISEA 4PGYA 4CJUA 5KFTA 1WSGA 1KQKA 4BDZA 1MSWD 1Q79A 2VWJA 4DR5K 1WKLA 3F2CA 2B9EA 2B6AB 5AK4A 4YVZA 5F1XA 1W26A 1JROA 4LD0A 4OV1A 4ZDNA 3CMAN 3EPGA 3CJ2A 1FWPA 3AA9A 1TK8A 4DV2F 1ZQYA 2E1YA 4B3RF 3GG4A 3CCLS 3DYAA 4PHAA 4KY3A 3O9RA 3TWZA 5LJVA 4HI1A 3QUTA 3IP0A 3AVBA 3EZ5A 2PFFB 2QM1A 1N5WA 5C2DA 2LDYA 1TAUA 4LF2A 4HI2A 4WFBQ 3N6NA 1QQMA 2AJ4A 4CO4A 4YY3F 1BIUA 3PRBA 3IG8A 3OYEA 3N28A 2FZGB 2DK2A 5J29A 5B66U 3V6HA 3ILIA 3BDPA 1RKIA 1WC4A 1VQMN 4O3PA 5ETNA 2OJ3A 2ZIVA 4BRDA 5DM6Q 4DV4J 3O3HA 4PZNA 4CIEA 1WWVA 2FD2A 2CN1A 4I2PB 3DKDA 3GIMA 8ICFA 4WK1A 1XJWB 1ZQRA 2XIDA 4C98A 2R2TA 4DV5J 5A2QO 3ZSYA 2ZH7A 2B4VA 4CE9A 2UXBF 2AQ0A 3HX9A 3OT9A 3JSYA 4DQ8A 2MJNA 2X6SA 1NWKA 3IGVA 2N3OA 1S10A 4ZMMA 3POTA 3BBFA 3BR9A 1RBUA 4CDGA 3D2SA 2HOFA 3QT8A 4DG1B 1ZQKA 2XCAA 1NDCA 4OYXA 1D8ZA 1U47A 1J97A 5KFXA 3IG5A 1SI9A 2LQ8A 3A5OC 1RTHB 4ELTA 2D3UA 2FJVA 2P1JA 1U2FA 3KJQB 2PFPA 2PXIA 4CJKA 4ICLB 1HHTP 3OXFA 2GCFA 8RUCA 1X5PA 4NLQA 3NVMA 5AZIB 4IOBA 1RADB 4M41A 1CJTB 1PC5A 3BO2A 4H4OA 2KM8B 2IHR1 5DGAA 2D69A 3OL7A 4AUKA 2A42A 2H4YB 1F5AA 2KT2A 4C7YA 2LQ9A 1IXRA 5KNIA 2V63A 5HHHA 2MKIA 2ZOFA 1RDCA 3AO3A 4JKEA 4MFAA 1TELA 4OJ5A 4LF8J 1WHVA 1JLGA 1IBMF 4PWWA 5I3QA 4TLRA 1OO0B 3HX0A 3FSIA 2V0NA 4EMDA 2RNEA 4C97A 2E6MA 5FLXY 3OW2M 5I42A 4K5RA 5CA7A 2V94A 3NBPB 5BPNA 4M9LA 2PE8A 5TKYA 2V8GA 4DV0K 3VGMA 3C7NB 2BJ3A 3W8PA 5A8KA 4BR7A 2C2DA 1KW4A 4O4GA 2Z0GA 5AE1A 4AD6A 2CJKA 3K1RB 1ZQQA 1ZAVA 2KYZA 2AX1A 2FGCA 1WWUA 2JL9A 1WUDA 4KO0A 4HKQA 4ZVPB 3T9NA 3BUZB 4GC6A 3CC2S 2Q66A 2YHYA 2MAXA 2KKZA 4ECVA 2JFDA 4MKVA 4B9QA 2ASLA 3P4IA 2R4FA 4CLKA 1A6SA 1BPZA 3HKZD 2CPZA 3JPRA 5DBCA 4UAYA 5L9XA 3TZZA 2KG1A 4URQU 1DGSA 9ICLA 2LXUA 3V4MA 1NGFA 3UCZP 1U0SA 1E4GT 2JRZA 1S1TB 4B3TK 2IHMA 4RU2A 1VLBA 2ZBPA 4TY8A 3HO1A 1S59A 1RWPB 1PUZA 3SBTA 1K8KB 5DM7L 5D15A 4YHHJ 5ELZA 1FRKA 2HRYA 1E3MA 5EX5A 1LFWA 2QSFA 4F3OA 2HNZB 1JXLA 1I3AA 5F3XB 5E26A 2YKOA 1B4SA 2D6FC 3OHBA 3KHRA 4G1QB 2RHSB 2ZM6J 1YJ9N 3OYBA 3WEEA 3MM6A 1NOYA 1WELA 2L08A 4WCEQ 4KLFA 5M1QA 3EVOA 2XHCA 4JI8K 5ALXA 1S79A 3NGIA 2K1RB 1U1PA 1EETA 1S77D 3ZDBA 3HK2A 3UNYA 4DI6A 1RI7A 3AXMA 3UXNA 1R0AA 5AQNA 3SPZA 2O8CB 2HURA 2GO9A 4I2JA 2MKCA 3FNNA 1S6PA 3P1GA 4KHNA 3TAGA 2VG7B 3OTEA 4MO4A 3G8QA 4TUQA 4ZA1A 4KITB 3E3XA 4RWXA 2HQDA 2PMZD 2X1FA 4LH4A 3C66A 1VSKA 1S1WA 2W7AA 4EFAC 3IN5A 5GADP 4B8AB 2DY1A 3C2KA 3MMAB 2RD5C 3LDAA 2HHSA 1B0XA 2I6WA 2CGLA 2HVIA 2JEIA 2O8FA 1X0FA 3N4PA 4R5PA 4C80A 1P6TA 2Y0SF 5F3ZA 3BQ2A 1MC8A 4RW7B 1Q4RA 2Z2MA 3OBIA 2F1IA 1VC5A 3WNEA 8AT1B 2PDAA 2E5GA 3FZLA 5A8WA 4PPDA 1ZYQA 4F4YA 2EQYA 4DV0J 3WNFA 4K4XA 2PY5A 4O3NA 3MCAB 4NLKA 2M4MA 5C42B 1RU1A 4JKGA 4KPYA 2BA9A 4PHTX 3TJ8A 4FZZA 1UFKA 2OM6A 4WTOB 4N41A 1RT1B 5HRPA 4FZLA 5IV4A 4DFKA 1S97A 4B9LA 2G8KA 3M6KA 5JS2A 5MLCQ 4V19X 4X64F 4PPZA 4ZN1A 2HQCA 4HWIA 2Z2ZA 3LYSA 4Q0BA 4NLBA 4C8KA 2UUBJ 4YB6A 4JLHA 4ZHRB 1NDPA 4O0NA 3HPOA 1BU6O 2P9LB 5J2QB 1VLYA 5B0EA 1IM6A 2Z57B 4B3TJ 4DTPA 1L3TA 4KHPF 3RMBA 5CCMA 3K4GA 1SH3A 2I1RA 4QIFA 5AQIA 2B4UA 2MQQA 3W3DA 4ED3A 4DR2J 3TA0A 4AYBD 1MN7A 3OD2A 5J1EA 3ZT2A 4CI6A 2EI5A 3L8BA 4B9NA 3HOTA 1Q5VA 2RPIA 2AWZA 1DEJA 3DAWA 4XRHA 3HVTB 1AW0A 2MLXA 1BWVA 4KLUA 4ICAA 4B3SJ 4OPJA 1QUPA 5ALLA 2ZUDA 3IBWA 2W2PP 5BRFA 4ZS6A 2BJDA 1AFIA 1UZHA 3UPFA 3CMES 3NP5A 1NHVA 3RBZA 3GL1A 2DFHA 1CRXA 3OYFA 3D9BA 2YNGB 1A0OB 3C6UB 8ICYA 4JI8J 3EKSA 3HI0A 3JAMO 4WTYA 2QEXN 1X6JA 4MK7A 1PK3A 4CLPA 5ETRA 3DGPA 3G6XA 1VQ8N 4LF9K 2F1FA 2GTDA 5C7PA 3WUHA 2FSNA 3QEWA 1UAXA 3MHYA 1EP4B 4RTFD 3B6BA 5AFUA 1BHNA 3TEGA 4RW9B 1BIZA 1S49A 5ALTA 1RDUA 3PW4A 1L6NA 3D7EO 4UY85 2RUSA 4EO8A 4CJRA 4UUXA 1MU2B 3D2WA 2FJEB 2LYVA 3IWNC 2IAJA 4DPYA 4B3RK 3WXMB 1FJEB 3NWRA 3PFOA 2VIHA 1RBTA 1NZPA 1N8RT 5F2RA 1KP6A 2W4CA 1S7HA 4OYAA 5FP0A 3BKUA 2BVZA 3D2FA 4RPFA 3SR6A 3DRXA 3AQEA 5HRNA 2K8BB 4Y2TA 5AQPA 3EDRB 1B43A 1HLUA 2CXEA 4YY3K 4M9JA 4CF8A 3ISND 2CQCA 4L74A 4N56A 1I3OB 4CM0A 2LLZA 4LF7F 4M63A 5AKZA 9ICSA 3BF1A 3E58A 2RMLA 3PCOB 4X65J 1ZBSA 5DB9A 1LXNA 2E1RA 1J5EK 5IS2A 5I4MA 3MMVA 1YJRA 2AX0A 4KAZA 5HBMB 4ECXA 4D3GA 4CJLA 3CMAS 2QJ3A 3VZIA 4QQBA 2ZC3A 3P83D 4CHNA 2LDIA 4DHVA 1VS3A 1CJKB 5JVGL 2IFXA 2Z1GA 5T7LB 4E7JA 2V4RA 2MQLA 1ZXOA 2K7KA 4KLDA 2ACYA 4WFAL 3R1XA 1Q7YO 4CZCA 4CP5A 3MEGA 4QYZJ 4USKA 4DPWA 1XTZA 4EUVA 2APOA 3SMPA 4CHQA 1ZD2P 2Z1JA 5LMUF 2DJWA 3HVAA 1XK8A 4MK8A 4GKJF 4U9RA 1V85A 1ZQHA 3NF8A 7ICSA 1CC7A 1EHWA 3HMJG 1VQMS 4HTLA 4X4NA 2IRXA 3DOMB 3T1YJ 3BEXA 1UPMB 4LRDA 2LP4A 4ECRA 2A18A 4JI6F 5KG5A 2WFBA 3DXMB 4DLEA 2NLWA 5JICA 1S72N 3PNCA 3MM7A 3N7SC 2CJXB 2LA6A 3KD5E 3PZPA 2ZDPA 2YX4A 2RE2A 5IM0B 4LF4J 1WKJA 4LBPA 1QZ6A 4DN0A 3LP0B 4IH6A 3U3YA 1S99A 4DS4A 4NCGB 1MA7A 2WB1D 4CERA 2OMLA 2POKA 3TNVA 3QUQA 1TUVA 2QYCA 4HUEA 1NMEB 2E1EA 2MZ1A 2VIXA 4YORA 4ECQA 4KI4A 3RJIA 2OZSA 4FJHA 5I3PA 3A8YA 4MIBA 3AO1A 3CD0A 4K0KF 2NXCA 4WJBA 5IC4B 3MR6A 2RH3A 2WBNA 4IQUA 1SJFA 1JX4A 5KFUA 1KEKA 3CIMA 1UHUA 1YKWA 4CO0A 1NHUA 4NYFA 1FFWB 1NG9A 4DSJA 1XR5A 5KFIA 3NGYA 4CYUA 5HVFA 1Q3VA 4NLOA 1T95A 2QWQA 4BWJA 4YB1P 2RUGA 4DR6J 3EUB2 3HZEA 1AXQA 3BGFA 3CJTA 3MMBB 1X9MA 3FFKB 1FI4A 3OYCA 1NU0A 5KT6A 2HVEA 1JQGA 4CZJA 3A8IA 1TUWA 2P9GA 3V81A 4GVEA 1AA1B 3WDOA 4ZVHA 2WSFC 3HZGA 5AFUH 2VQEF 5TZVA 1QHTA 5E33A 3H59A 3B4MA 3HPGA 4FM1A 5KQDA 1Y88A 4O44A 1YVUA 2GIRA 2Q36A 1NUEA 3TADA 1M5SA 1NPRA 1O8BA 1ASVA 2VA3A 3U9ZA 4FWPA 3M5RA 4DCHA 1HWUA 2PMWA 1J5EJ 3ZI4A 4CK3A 4F5NA 4DOCA 1DARA 1IQTA 2ZD1B 3D0GE 4PZVA 2LQBA 5J8YC 2PI5A 1S6OA 3GFHA 4FK0A 4A8XA 2Z30B 3H2UB 1S9GB 2IDEA 3R5JB 3ORYA 3K0JA 1U1LA 3CFOA 2PFUA 3BB5A 3AVMA 4A4JA 2ZBIA 3KK1A 1HD1A 5DKWA 3CPWM 1KQSM 3HHLB 1X40A 2JX2A 4AL5A 3RJJA 4RO0A 1VAZA 3J7Z5 4O55A 4Y2UA 4I2HA 2VKQA 2B56A 1WTBA 1N5TA 2PA3A 1QE1A 3D2EB 4H0YB 3T6BA 1RZTA 5EN1A 2DNHA 4F4AA 1IKYB 3QWPA 8ICQA 2JGUA 2UVWA 4F92B 4ED0A 1AT1B 8ICEA 1HNWF 4GMJB 3VEVA 3CJSA 1RAFB 3CCEN 5D8HB 2R7RA 2R8KA 4IR9A 3IS9A 4EK2A 2CVEA 1B70B 1EO1A 4RLEA 2IVNA 4X66F 1RQNA 1SWWA 1NK5A 2QFJA 3BO4A 2B5JB 1FRXA 3M30B 1GK8A 2HZVA 4DPXA 3A2FA 2KG5A 1CEZA 4A8SA 1Z26A 1RHRB 1XHXA 3M1VB 3R9PA 2P6UA 3SAFA 2HHWA 1B99A 1XMBA 1IUJA 2E7XA 5K20B 5B8HA 3GR1A 3KJNB 1QVGM 4CJEA 4DX5A 1FE4A 5HRSA 3KHLA 2HSEB 5BOMA 3HSTB 2P9PB 3PSFA 2A2DA 2AXTU 2KEYA 2O8BB 3TJ9A 4BX9C 2MTLA 5BR8K 3TWHA 4Y2XA 1HPZA 5C24A 3D6JA 1N34K 4NA3A 2ADBA 3AQPA 5ALHA 2P51A 1LWFA 3NY0A 3ZTSA 2E1MC 4KLGA 1NB2A 2VBZA 4M3UA 2M7SA 1ACMB 5GAEP 5KFBA 3F2KA 4K2XA 5B0DA 4A8QA 2GAHC 1FX4A 3D6MB 4WIIA 4X64K 2CNLB 1UEVA 2MHEA 3P96A 3WK5A 3E51A 1OH6A 3L3FX 4AHRA 2O01C 3UXOA 2NCKL 2DGVA 2FJAB 1S0OA 2P2CB 3R5DA 5AE3A 2BHNA 5L1JA 4P2FA 3NVZA 1WOOA 4GV6A 4KHPK 5DZ6A 4GV3A 5J2NA 3PJ9A 1SC3B 3QU2A 3VA3A 1Q9YA 1U6ZA 2ZH9A 1Q3UA 4JI5K 4FPIA 3PIPL 4JKCA 3D45A 5BN9A 1FIQA 3O6WA 1QSLA 3IWLA 1NGIA 4OLBA 1L8LA 3L5KA 2R3VA 3M2UB 4IG3B 3X1LB 3IRWP 4F3TA 2HSTA 2KW4A 3WX8A 5AI4A 4C4WA 1PAEX 2RQ5A 2FHOB 4MLHA 4PG7A 1JMSA 4IFVA 5IZHA 2NO5A 1QAYA 3MEKA 3EY1A 5HO4A 1UVIA 3WKAA 4KHWA 2WBMA 4I2EA 1UWBA 2IOHA 1KTVA 5AJ3J 5KFWA 2ZH8A 4FPBA 4B3MF 2KSOA 3BS7A 1X5TA 3DYAB 4OYMA 3LPTA 1JL2A 4I2CA 3HVWA 3MAAA 3I76A 2HS3A 2HHXA 4DR4F 4AHSA 8ATCB 3T5KA 3OYKA 3N5FA 2OMOA 2F9TA 1HWLA 2YH0A 3CC7S 3SK3A 5ALDA 4H5NA 4XUSA 2YB1A 3PSPA 1FXXA 2F9JA 3TFRA 4K4TA 4WFNQ 2HBMA 3CCUS 3RH4A 4CW7B 4J37A 5IIMA 1DKGD 3OSNA 4FWMA 2XLJA 3GIRA 2KP7A 4USVA 2JR5A 1RXWA 4DV3F 3W64A 2ZIVB 4I2GA 1N5SA 1RHQB 3IFEA 4HTIA 4H0VB 5D0RA 2HQIA 2HWHA 1LB2B 4FYYB 2A0FB 1Z19A 4L3QA 4OO1J 1COKA 5AQSA 4J9PA 2FVSA 5M1PA 2VBWA 1BO5O 2QO3A 4WIQA 2XBPA 4X4OA 1RGIA 1ZA2B 5GAEU 1Q9XA 3SSRA 3POTB 3N4QA 3BBBA 1E6YA 1VQ8S 4O8UA 3KKAC 5KFGA 1W9HA 1MQ2A 1OUQA 2BGGA 2X1GA 1Q95G 2ROGA 4OX6A 5BR8J 3H0PA 3L7UA 2VL1A 2E4LA 4FCYA 4B1ZA 4USHA 4RQ7A 8ICSA 3QMQA 1N34J 1SV5A 3HD2A 1AQ6A 2JLGA 1LOUA 2MSNA 3QBWA 4NXMJ 3P5JA 4F0HA 2KH9A 4KGMA 3FCWA 3N5BA 3J7YP 4YN4A 2AT1B 2D3OR 4E1NA 2HF4A 3VQ8A 2DXEA 2YXLA 4UB4A 4CBUA 2LEPA 3B4DA 4CGIA 3U6FA 5ALPA 1EQMA 3NGDA 3TFSA 4CTAA 1VC0A 1WUAA 3TABA 3M9OB 2J7UA 4WXOA 1KBUA 3PNIA 1JLGB 3DRYA 1HKGA 4X4VA 5HOOA 5C15A 3WT0A 4YOYA 5J0XA 4F50A 5I42B 3RRGA 1S8OA 4KLTA 2FUG9 2ISOA 3OPKA 3WX4A 4JI5J 3O3LA 2W03A 2IC3A 3ZEUA 2G0JA 5A8KB 5B08A 3OVAA 1V6HA 4O4GB 5J2EA 2R8IA 4ZPDA 3HKZF 2MHNA 3VQAA 3DLGA 2GHWA 5LMUK 5ETLA 1NKBA 3Q7BA 5FLXU 4GKJK 4YMMA 3QXGA 4AHCA 3RR8A 3AFGA 3HHNB 3OYGA 8ICKA 1O6XA 2MSSA 3GG1A 4JI6K 3QINA 3LH2S 2K8CB 2DNMA 3O9UA 3QJJA 2MQPA 1YHQN 2A6MA 2XCPA 5FPDA 2N4CA 2CNNB 2MRLA 2QN6B 1NSPA 2Q6BA 2XYHB 2KNJA 2LM4A 1BXNA 2BJ8A 5KFFA 2CQPA 3ZDEA 1MMNA 2C2KB 1ILYA 3T5JA 3THWA 4USTA 1HIWA 2OEMA 5C2CA 1RAIB 5HP4A 4ZN3A 4ES2A 5ETMA 1U49A 2CIMA 3DEEA 4FNIA 4TY8B 2V2VA 3R9KA 3JPNA 3TUZC 2EHGA 4K4SA 3KZBA 1R8PA 3QEPA 4K0KK 5AQTA 2W6KA 5EE0A 4DL6A 3H40A 4YR2A 2M8HA 5JLHA 3F5TA 3G2XA 4JK7A 4BC5A 5C2GA 3U9DA 4H0PA 2O4GA 5K8PA 1SZPA 3WEEB 2FI1A 2LEAA 3MM6B 1QHAA 3SENA 2HZAA 2IYIA 1KBRA 2YNFA 2UV8A 5GAHP 2F8LA 4GVBA 1F0XA 3OS1A 3VVUA 2W2QP 2DITA 1EETB 4LFBK 1RWMB 4IEEA 1I5OB 1NGHA 1KD1O 4ALZA 2KIVA 2VQEK 2CZ4A 1RLCL 1R0AB 2HVDA 3NL0A 1JCGA 2R7YA 2LMRA 5J0TA 3C15A 3ZD9A 2K89A 4JKDA 2QARA 2VJ4A 3RAXA 1S6PB 2MLZA 2M8DB 2O5DA 3PEHA 1OH5A 5B0BA 1LW0A 4EBEA 4ECTA 2ACMA 2M3DA 3DDIA 4I2IA 4FZMA 1LWEA 1JJ4A 3H0RB 5BRDA 2KYXA 4KHSA 4P4PA 1FE0A 1S1WB 2QL7B 1CVJA 3LGNA 4ID8A 2HB5A 8ICUA 3MM5A 4HCBA 4AHVA 3RH5A 2GZOA 3RAQA 4QIGA 1VQLS 4E2FB 2HDOA 2D0BA 2O8FB 4ERDA 1ATRA 4R5PB 3DDHA 2AJ0A 2L41A 3SSQA 4KTWA 4KKOA 2ITGA 3QGGA 2Y8YA 3O9QA 2LYAA 4YN3B 2KFYA 1ZS6A 1T9TA 3ET6A 3VESA 3O6QA 2F7VA 3UR0A 4YQWA 2C3UA 4PL1A 5J2CA 4HAIA 1S57A 2DISA 3W5YA 4N77A 5KT2A 4H0OA 1X4BA 5A8WB 2X78A 2KLAA 4CK2A 4OI0A 3PTWA 4M3YA 4R63A 2FZCB 1NOMA 2RF2A 2EBEA 2F4VF 3DLLQ 2LKZA 4ACOA 1RYSA 3A1YG 5G5HA 2JVOA 3BBCA 4GKJJ 4QWEA 4JKGB 5KT5A 4QR1A 1X66A 1NGBA 4N8NA 3J7AN 1AB8A 1IR2A 1F60B 4CHOA 1GX6A 3NF7A 4Q44A 2H3EB 3AB4B 4TYAA 2F76X 4WU3A 1WOQA 3I55N 2DNGA 1ZQPA 2FTRA 4X66K 2VCPA 3PMLA 2XZWA 4AYBF 1RYRA 2Z58B 4Q0BB 4DV6F 3UIQA 3ZTRA 4B17A 4J9UE 3FQKA 4ZPAA 4DR3J 4BRFA 3SQ4A 1RAAB 3U8XA 2YCHA 3J7A1 4QZCA 2R18A 5LXYA 2AGQA 5ETKA 4CGGA 2VA2A 2G9OA 4AXIA 4FYXB 3VHQA 5GAHU 4JEPA 2OEJA 3PO4A 3VAJA 4LFAF 2OUGA 1F9HA 2NRTA 3RG6A 2LPEA 5J1EB 1QQ5A 4C48A 1IBLK 1Y5LB 3RFAA 1K44A 4JBCA 4F2SA 4IG0A 2Y8WA 1REGX 4JI4K 4DV7F 3CCES 5ALKA 2YHWA 4ECSA 1QS4A 1RWKB 2CRLA 5M2UA 1APSA 3JS9A 4ZTFA 1GLFO 2QX0A 3GYNA 2VG6A 3PMNA 3GZ7A 5ALJA 4F9OA 4B3OA 4YP3A 4LFBJ 1U1NA 1NJXA 3T1HJ 2E1ZA 2JH1A 3IDWA 2BPFA 4RWWA 3FBEA 2HFOA 5AM1A 4Y2VA 2D7SA 1XWLA 3TX0A 2IY5B 3ISBA 5FDLA 2Y9HA 3VEOA 3DGPB 3FQLA 1ELOA 1NU4A 5HMXA 1VR6A 1NB7A 1TK0A 2GO7A 3PACA 2P9SA 2P5VA 1C4AA 2ZBRA 3I56S 3HSGA 3E9PA 4NLCA 4CZKA 2OELA 3NF6A 3SUQA 3K75D 9ICEA 2RT3A 4OD0A 3D0IE 2H3QA 3MDFA 4NLZA 2IAJB 3UCGA 4NXNF 4UQTA 5AQXA 8ICPA 4A2BA 4F72A 3CVKA 4CFBA 2YWFA 2CQ1A 2GAGC 2KXHA 3I82A 4DHYA 2AJFE 4ED8A 4DR4K 3D2FB 1R8BA 3H1QA 5L1IA 2ZBQA 2P9CA 3WKEA 4N8OA 1VI7A 1RBVA 3O1BA 4F5PA 4PUOA 1S0VA 4CJ5A 4FS2A 1F5CA 4IQMA 1YZ6A 4FJ5A 4FZXC 3SEIA 1RK8A 4H4KC 2LXIA 4E7HA 3O5TB 4EX7A 4C3LA 4DV3K 1RA7A 2GMJA 4ID1A 5ALEA 3IR6B 4R8UA 4CNQA 2JMGA 4UY8O 3H25A 3QESA 2AP1A 3UO0A 4NCBA 2X1BA 2XSFA 2NZ4A 4DPUA 4WQ5C 3VWSA 4O5BA 4YOXA 1R8CA 3E1YA 3P3DA 1BUXA 4JV5J 2BQUA 2DT9A 2R2RA 4FL9A 2IIRA 4J9SA 3NOCA 3MEGB 4ED5A 5LJ5Y 5HAOA 2F7TA 3TO8A 3SAGA 3F73A 1IBLJ 4M3RA 3V9UA 2AJ1A 2XTJP 3O1LA 2HHTA 3AD7C 4KMOB 3QFPA 1T11A 2RIJA 4CO2A 4EHTA 3DLBA 2JH3A 4JI4J 3BGRA 2GHVC 2VFUA 4ILRA 4FWLA 4US8A 2WB1F 1GO3F 2FZKB 2Q0RA 1TKTA 4J2DA 2R8GA 3OJUA 2KQ2A 3WKCA 3NNAA 4JI0F 2UVUA 1RA6A 3M8QA 3MM7B 2YKAA 1K5OA 2EBGA 3R1LA 1UVJA 5F0XA 4FVUA 9ICIA 2JEGA 4IQWA 1QY7A 1P8ZA 1GTHA 4M5KA 2FVQA 2WF8A 1NK7A 1KAZA 4F3MA 3AJ2A 1UEUA 3M05A 2AV5A 3NUQA 3ICXA 3U02A 3ENOA 3S3MA 1VMBA 3GFXA 3EX7B 4UBBA 4OHZA 4K41A 1ROFA 3KWGA 2I38A 3PV8A 3DDNA 2ES6A 2CQDA 1OIAA 4CYUB 4JI2F 2ZJ5A 4CJTA 2ZJ8A 4LR9A 1JN3A 1IH7A 3QU9A 3GR0A 3AAPA 2CZVC 1N36K 5D4NA 1I6JA 2D3ZA 5AQQA 1IKXA 3SQ2A 1HL6A 3RF9A 5AXKA 3T9ZA 3SMVA 2Q3SA 1FFVA 2DO4A 2OFHX 4KGVB 4RT3A 2NV3A 3BKFA 3QIDA 2RQCA 3ENVA 4HTJA 3BQ0A 3AOBA 4HUFA 4O44B 1NZBA 1HNIA 4OKEA 3UB5A 3DJCA 3LAKA 4ATNA 1IBKK 3GZFA 4PHDA 4AH9A 2J7KA 2NPFA 2P9KA 1CJVA 3DI6A 5BYRA 1TMJA 2RQ4A 2Q43A 5ETTA 4FJJA 1WSRA 1DQ8A 3CCJN 4LIWA 1GLDG 1UVNA 3ENBA 4KPCA 4IOXA 4UB2A 2WVEA 4XDDA 4LSZB 2WB4A 2ZC4A 2OIHA 1GX5A 3SUPA 2BW2A 1U1MA 4KLIA 3K9JA 3HTVA 3KK1B 3GU3A 3JPQA 3HULA 1PVQA 1QAIA 4PJ0U 5AKIA 2VJ5A 2NXJA 3CQXA 1M1KT 1REVA 1QE1B 4OJGA 5DK5A 2EKYA 4C8ZA 2RE1A 1ZQMA 3N01A 3DMJA 1LXJA 1AUDA 3LO3A 3UCUP 2CQ3A 4MFBA 1SQKA 3L9ZA 3ZZRA 3H5YA 3Q0AA 2DCLA 2IOFA 2QLTA 4NA1A 3KKAA 4YUDA 3HF5A 1TKXA 7ICIA 3B9JA 4OKJA 3IS9B 2RRBA 3ULDA 1CZ9A 5E0OA 2Q0UA 4P0PA 2YX6A 4ZCKA 5L8RC 4DOAA 1NJIO 3UNGC 3KDNA 1SB3C 1HBNA 1JXEA 2HWTA 1BC6A 1BGXT 1KN6A 2RU9A 3T1AA 3AU2A 2D4WA 4NYNA 4DFJA 2K4IA 2IRUA 3WNGA 4K5SA 3B6PA 1SH2A 1YBAA 4P9SA 4FJ9A 2GH1A 1S9EA 1XR7A 1ZBIA 2O67A 3S41A 3J7ZO 3A5NC 1JJ2M 3BN4A 4DN9A 4UT4A 1KNZA 3TZWA 2QLWA 4ECYA 4BBYA 2EZZA 3CJCA 7ICHA 2ZH3A 5M1OA 2F4VK 2Y0BB 2B8PA 1A5XA 4GC7A 4BROA 4BC7A 4XIUA 2QSWA 3L4IA 4QZFA 2XMJA 1HNVA 2DKOB 3DRSA 2KB2A 2K06A 1BWFO 4C0OC 1HPZB 5C24B 1O1WA 1PC4A 3FFIA 2WMMA 3M6GA 1LWFB 3TI0A 5AIBA 4AM7A 4Y28C 9ICFA 4FBUA 5KG3A 3PUFA 4JMUA 3PVXA 2V8VA 5CHGA 2KKPA 4JK8A 4GKKJ 5JUMA 1FRMA 1N36J 3BSCA 1KVBA 4NM2A 4MT1A 2HS0A 3DNCA 4PZOA 3CCMN 1KKXA 2DR9A 4OZ1A 4MF8A 5HJYA 4IO9Q 3M4XA 4DX6A 1XO0A 4WF9L 4C3KA 4NRUA 3I0RA 3OLAA 3DXBA 1MG7A 2XY8A 4M6WA 5J2NB 4QW9A 1NHKL 4LFAK 3L3VA 3C6TA 2IJNA 3W9JA 3R2CJ 1XSLA 1URRA 2QYGA 5B09A 1IBKJ 3G9CA 1SJQA 2IM3A 2J0QD 2I9GA 2RDDA 4KTQA 1KC8T 1L5UA 1DTTA 4QS9A 4OPKA 4IFVB 4Y2JA 4ZTJA 3NXZA 1OWXA 1HUXA 5KG0A 5BXIA 3BEGB 1QVGR 5CWRA 1TYQA 2DGOA 1UWBB 1RE1B 1Q78A 3ZTOA 5FPEA 1M1HA 1TZ0A 3TEHB 3MMCA 3AL0B 2KSOB 1DURA 2G8VA 2N7YA 3DGVA 1HARA 1VQ7N 2AYEA 4ER8A 1WHYA 1NRKA 1WI8A 3AU6A 3MWTA 1KQFB 4FK4A 1B3TA 4B1XB 3K7RA 3MAAB 1T6DA 3K8VA 1O5JA 3LP2A 5AI5A 2E5LJ 4OI2A 4QYRA 3CF5Q 5EVZA 4WK3A 3M8ZA 4E7LA 2YQEA 4JI1F 1OS5A 1JALA 1NSQA 1T3VA 1D0EA 2QMUB 3AD9C 4Z4EA 3THPA 4KGKA 3OYHA 1RT6A 4DDFA 4FJXA 3H3NO 3TR5A 4C23A 3UE5A 1KOHA 1SZ2A 4OYZA 3I1YA 4FN5A 4QR2A 4FF3A 4RBTA 4A8KA 2FHKA 2VODA 1FEZA 1UFWA 5JMVA 3BREA 1HWKA 4DL2A 2QWOA 4JV0A 5SUHA 2JFKA 1S6QA 2MZJA 2NYVA 5F8HA 1WF1A 4DU8A 4M3XA 3RU0A 3S6JA 1Y00A 4ISFA 4K4GA 3Q8RB 1E6YB 5KL8B 2FMPA 4JWNA 5GAEI 4YNQA 4UB8U 1YXQA 5HQ8A 3Q2TC 2YWGA 2HAIA 4RKUC 1Q1KA 4CLUA 2R7XA 4ILHA 3QT5A 1BVSA 3MGIA 1SV5B 4IC9A 3CIPA 1OW5A 2FBVA 1ZD3A 5CE3A 3OYIA 1Y3KA 1XNQF 3UXPA 3RB4A 2F65A 1X8DA 4TUPA 1U24A 5IV3A 2E6LA 2OKQA 5CCLA 3E9OA 4CTAB 4OI4A 1SB6A 4OKKA 4UBCA 4EBCA 4Y2SA 2XHWA 2CNOB 4CI0B 3GV7B 1NO8A 3D6FB 3ISZA 4IFEA 3C95A 3CHWA 3A8JA 1SC6A 1S5ZA 2VD3A 2ZE2A 3SPYA 4G3IA 2G8UA 1GMVA 4GY2B 3DXKA 3I5BA 5BOLA 4OGEA 2IC3B 3US5A 3ZEUB 4RW4A 1TUGB 4I2DA 4BQLA 2BRKA 5TISU 4CEAA 4JHDB 3QYYA 4FW2A 1XIQA 5ITHA 1J54A 1ZETA 1K0TA 2E5SA 1SKWA 1M5PC 3LK9A 3ZNUA 3V9XA 3ZT3A 1QUVA 4ANCA 4A57A 4I56A 5J2PA 1U26A 3NAEA 4YDUC 1Z6RA 4JI0K 4PY5A 2PSZA 1FJGF 3SNNA 4O3OA 1PJ5A 2ZJRQ 2LSNA 4FM2A 3AA3A 3L7OA 4LMZA 5FPMA 2D9PA 3THWB 3C28A 2NREA 1H2TZ 5AM2A 3HHLC 3EYZA 2YJEA 5AM3A 1LQ9A 5L46A 4DV1K 2CPJA 3D2QA 1FFGB 2DIUA 1WC1A 4MQ3A 3QGHA 5K4LA 2D0PA 2FJBB 1MDUB 1KEJA 2B9YA 2J9DE 2D9OA 1NNEA 1KOOA 2OD6A 4DB3A 3FJ2A 4CBXA 4MF2A 1VQPN 1XMQF 2H5JB 4NLUA 3C65A 4US9A 2GVZA 1YJWN 3JTPA 3M6UA 4Y34A 5LMNJ 3CD5A 2E66A 1LW2A 1QH9A 1ZM4A 4JI2K 4M42A 2E7VA 2VC1A 3ENQA 4JYAF 2YNFB 4KLOA 2M0NA 4GVBB 2KJ8A 4CO3A 1CJUB 3OSPA 4FLWA 2R7UA 4MKAA 3RJGA 5I9EB 4EBDA 2YY6A 2LI6A 2N1RA 2QA4G 3R8YA 2GQQA 3VF2A 4IOCL 2VICA 2NUHA 3ZDCA 2VPYB 2ZBCA 3QSYB 5HATA 4H54A 2CVIA 3UDLA 3ZDAA 2HFNA 4DWIA 3H5SA 1MLAA 4ZPVR 3C15B 2LEBA 1RWXB 1XERA 2LXFA 4CZMA 2W3RA 2QARB 1VBYA 2V7ZA 3DM2A 3KTQA 2M52A 5HHIA 1LW0B 2GFFA 4X62J 4W5NA 3CD6N 4EELA 1LWEB 4CZIA 3M32A 1K1QA 2ZXIA 1NXIA 3KOOA 4NYZA 4QCLA 1ZQWA 4PG5A 1I51B 3ZZ0A 3TZYA 3MM5B 5AK3A 2YWEA 3U7JA 1VSFA 1TK5A 2LM1A 1HUZA 2Y1LB 2F77X 4EU0A 2ASOA 4KKOB 2NRZA 3MN6A 2G8IA 2BPGA 2QLXA 3MUVP 4OV6A 3ET6B 3R9LA 2MPUA 3T5LA 9ICMA 3V7LA 2CQ4A 4YS2A 4CLTA 1BUPA 4ZVRB 2RF2B 2Q31A 1K1SA 3OTOK 4JI7K 3JQKA 4ZVFA 2P6TA 3FZFA 2MDAA 3CB4A 5RUBA 4ZKAA 4FO0A 2M70A 2CPYA 1VBXA 1JLFA 3HFVA 3BH7B 3KJVA 9ICQA 4PKHA 4UB3A 5J2BA 2BR0A 5ETPA 2FPKA 4QZBA 9ICAA 3QEXA 3CM5A 3SUNA 4P2MA 2QG9B 7ICLA 4XO0A 3NFAA 1U1KA 1VQNN 3F2DA 4PABA 4HDGA 4CLSA 2KHOA 3MDAA 1P9YA 3QERA 4B6JA 1WC5A 5KAIU 4MTPA 1AZSA 2WF5A 2IBKA 5H1SV 2HBLA 2B21A 4CQ1A 4CJ7A 4DV1J 2WZ1A 4Y2IA 1D4XA 1DFDA 4M95A 2CPRA 3NWGA 3CG7A 4X5VA 3Q8VA 5GAHI 3EZOA 4HL9A 3IKMA 3NRBA 2R7TA 5HRRA 4IG0B 2QA4N 1IXKA 3Q8PB 4W5OA 1Z2ZA 2VG6B 1VJ5A 3M6WA 1NBWA 3HSCA 2BM1A 4F2RA 5CZ1A 5AK5A 4FF4A 1ZBUA 1COOA 2QLFB 1JCFA 5BYQA 2EWSA 2PZSA 4B3OB 4DV4F 3AO2A 4ZLPA 2DKZA 2DGUA 3B54A 1XQIA 4OFZA 2UXDJ 2XI3A 1M5VC 2W2MP 1FNMA 9ICJA 2KHQA 1RDAA 5FDLB 3H3OB 3HM8A 1UZDA 4DV5F 5KI6A 1GXTA 1ZQFA 3EO3A 1WD6A 1H6KX 2OP5A 3JSBA 5K8OA 2R7QA 3ELHA 2PEBA 4QJFB 4KIAA 2P9SB 1HNXJ 2KVQE 2GGPA 2BBEA 3SEOA 2XRIA 2D0OA 1JLQA 1LKYA 2JJ4D 1SPBP 2J9DA 1KDHA 4DR1K 3KG4A 5ALQA 5HQMA 1BL3A 5CYJA 3JSRA 3CI5A 4EFHA 2E20A 2HYIB 3TAFA 4TU9A 4UB6U 4UY8T 4MAKA 3SDEA 3FZBA 4K59A 4OYBA 1CLQA 5I3UA 4XDCA 1CULA 1FDBA 1OJ4A 1VQKN 1URJA 5ALNA 4P2SA 4FVCA 3QFUA 1UAWA 2XLIA 5H9EJ 4I6YA 3ONQA 1FNXH 1VRTA 3L2VA 2GJIA 2OWOA 3H8JA 4CT8A 1MROA 1XSNA 3KLIA 2LHTA 3LP3A 3AO4A 3MN5A 4E98A 2LBOA 1NPKA 4CIOA 3CCQS 3QQCD 4LF8F 3C8YA 4PUOB 1LK5A 1YK9A 4U95A 5J0OA 4JI1K 2GBZA 3HM9A 3OTOJ 5A0LA 4JI7J 4RW8A 3AA2A 5JRTA 5ALMA 4OI1A 4CEOA 1SZHA 4KN4A 4R8UB 1RBOB 1BCMA 4GIBA 3NG8A 3HDSA 3I0SA 1G15A 4PCQA 3CJ9A 2MQNA 3W61A 1DLOA 4FYWB 2KRBA 3QSIA 3RMCA 7ICNA 3HFZB 5A76A 2YVSA 4M9NA 1ZQ1C 1IQZA 4OHYA 4HHTA 4LREA 4NCAA 4X84A 4O0IA 1ZQLA 4QZIA 1R3NA 2NUUG 4RZRA 2BPCA 3LF0A 2YH1A 4ID5A 2K3KA 3UMCA 1X42A 3UKRA 3TACB 1U2VA 3FDSA 2ZJQQ 1P27B 3LGHA 1NGJA 2KVIA 4Y6IA 3P6YC 3C29A 1YJNS 3VEXA 4P71A 2HBRB 2FSKA 1PSDA 2KVSA 3KKRA 2QA1A 2WVCA 4BC2A 5KL1B 1V4SA 4KBOA 3ZNJ1 3THYA 1R6YA 2QI2A 2FVCA 4BQZA 1FXRA 4B1WB 3BGRB 4O23A 1URNA 3RW6A 4P73A 5AKEA 4ED2A 4EIAA 1U6BA 1F5SA 2L3MA 2FDRA 2DFLA 1C1CA 4FWNA 3FAHA 4FYVB 1YI2S 1TKTB 4YHHF 1XNQK 3Q8UA 2MZSA 4OZ0A 1VBKA 2DKXA 2B43A 1FTRA 4FNHA 3M8QB 3FGUA 2HWIA 1Z00A 2ZM6F 2YI1A 3E0FA 2J6TA 5DJBA 4M5HA 3JTNA 1ULRA 7ICRA 1WAFA 4BDYA 1MWQA 3BYPA 2H5EA 3WQUA 2ATQA 1NJZA 1M1GA 3C6AA 5GAGP 3IG1A 3SV4A 4ECWA 4M5IA 4R0JA 3I8DA 4ZOSA 3VQQA 3GIJA 2JSXA 4M3WA 2WC9A 3KG0A 2WHEA 3QBXA 5KFYA 4ZVUB 2HBYB 2W8KA 3I31A 4RNMA 4KAIA 2RQMA 4P2XA 2VDHA 4KHMA 1FK9A 4DR1J 2J7WA 4MYUA 4A62A 2ZJPQ 4IRKA 3D3CJ 4H0XB 4KH6A 1I1GA 2VPZB 2GUPA 2A5XA 4WKRA 3WXIA 3TQ1A 2RU3A 1FJGK 5AXLA 2AZ1A 3RJKA 4ZCLA 4YOUA 3EMTA 1R89A 1IKXB 2DYAA 3HRDD 1PKUA 3F2BA 2YHXA 1NEEA 1ZBFA 4LJXA 1G6BA 3RUBL 3C16A 3NDKA 1EXNA 4MMOA 1RNHA 1N8RO 2FHJD 2HF3A 3BYRA 4KB1A 3C0BA 4IO8A 2DEIA 1WBBA 2EX3A 1HNIB 4CGHA 2VWBA 2DGQA 3JPOA 2QT7A 1VQ6S 1BQNA 4DSEA 3KZIU 1XMQK 1JNRB 3UN2A 2M2BA 3EICA 3PYFA 3MXIA 2P9KB 1CJVB 5J0WA 3DI6B 3RJEA 1HRHA 3MPYA 1OXJA 5E3QA 4BRPA 3ZETB 4E3SA 1F1BB 3AH6A 4QZAA 2FGOA 2X6NA 2WVBA 2DO0A 3Q83A 3C14A 4JYAK 4KGZB 4FPAA 2EFPA 2K2PA 1RQLA 3H08A 1ZPWX 3DLJA 5AI0A 2FHJA 1R8AA 2PEHA 3IDHA 3ZDDA 3Q89A 2HEKA 1FJCA 2XZTB 4QOTA 3Q22A 1N4LA 5ALIA 1REVB 3CETA 1YDLA 1W2BM 3HD1A 2UUBF 4OI6A 2IOCA 2RLTA 5AQVA 1EKSA 3DMJB 1GOAA 3JPTA 4MFBB 1RGVA 2FJDB 4P74A 4OHWA 4B3TF 4MYTA 4I6MA 3D4JA 2CPIA 4CEZA 5KFVA 3IM9A 1TKXB 5AKLA 3P45B 1RTZA 3TPQA 2Y1JA 4DR2F 1T05A 3CJ7A 1O13A 4NY8A 3VQSA 1YUWA 4P0PB 4PWDA 4FYDA 4CJ3A 5IINA 1YIJN 3JQMA 5CZXA 4MLEA 4E7KA 1JLAA 1MNEA 3DHWC 1RXOB 1BG3A 3VF0B 1VQ9S 3M7DA 4B3SF 2HMPA 4LBIA 2J6UA 4OIXA 1SXLA 3RWUA 5BJRA 4BVOA 1S9EB 4AXJA 4DZDA 2A6AA 1HQUA 1HYSA 1ATSA 2FB0A 3BSOA 1N63A 4JI8F 1G4CA 3FCHA 3OR1A 2H4WB 1NMDA 3ZT4A 2OO4A 4KGXB 1N5YA 2XY6A 4XAKA 3FRYA 3M8WA 1PIEA 3ENHA 2IVPA 3GFZA 1HNVB 3DRSB 4FOIA 4TSXA 3GMGA 1NK6A 3QJLA 4NL9C 3RJFA 4TURA 1RLDA 3FFIB 3NASA 2AEJA 4PKIA 2FXUA 1ZPVA 1RQ0A 4USIA 4QIWF 3W2WA 4HTUA 3QRPA 4USWA 2MJUA 3EN9A 2Z1IA 1HJRA 1Z2LA 3KK3A 4WYBA 5M1FA 2VH7A 1VSHA 3GJRB 4BR0A 3FM9A 2ZUGA 2PA8D 3PO5A 4BJQA 1V5VA 2MY7A 1LEOA 1RP5A 1BA0A 3RAMA 1TKDA 5AQUA 3RGIA 3G0ZA 4YDUA 1N5QA 4J9LA 4AQYK 4UB1A 5AE2A 3HILA 5J0YA 2VQFK 3I0RB 3N0VA 4U67L 4BWMA 4BUGA 3GCWP 3DLEA 3Q23A 3GILA 4M6WB 3EL2A 2BKEA 1GLCG 3TSUA 4RPXA 4CRXA 1UCVA 3C6TB 1YF5L 4DUZK 3OS2A 3M2RA 1OY9A 4NLTA 4CHPA 1JRPA 3UMBA 3D6TB 2XHBA 4NOHA 1Q5YA 4NA2A 2HQGA 1DTTB 4M63C 4FJLA 1K47A 1HPMA 1RSCA 3V1OA 2ZKUA 4KTZA 3PYGA 1YITS 1TYQB 3SZ2A 4CFDA 2ROEA 3ULHA 1S48A 4Z4FA 3PW5A 1PJ7A 4JWMA 5KFMA 3CRXA 3D1HA 3OYLA 4JRQA 2Z4PA 4X65F 4RPZA 2OEHA 2VGNA 4DV4K 3QIOA 5F8GA 2WTUA 3BSNA 1YJTA 1VQSA 4O5FA 1NKCA 4C1NK 4KBIA 4F7VA 1TV6A 1GLJO 3LP2B 4ZJLA 3IRXA 3M6VA 4PQAA 3FLCO 4ISGA 2PBDA 5KFJA 2CFXA 3QNOA 4LZDA 3SJJA 1IWAA 5C25A 4DTOA 2PD1A 3HPHA 2VC0A 1T3QA 3SLCA 1VOMA 2QK9A 4F5RA 3EDQB 3MPVA 1RT6B 4UASA 3BF3A 3G6VA 2UUCK 2BCQA 1MWZA 4M45A 2KZ3A 4CF4A 2D3DA 1Q16B 3OYNA 4DOBA 1BY9A 2RHKA 1IG6A 2DHSA 4OQJA 1EQYA 1T9YA 1VFJA 4K25A 4YOVA 1JI7A 2W25A 1ECWA 3R7SB 4C1NI 1JLBA 1VK3A 1TV9A 1S6QB 3PRVA 3W63A 3GV8B 4UW2A 3T1YF 1ESVA 5C12A 2FLOA 1RBRA 4USJC 2DTUA 2FPHX 3K2PA 3OYMA 4QWDA 2EH9A 2VOOA 2OTJS 3QATA 1YJVA 4LF4F 3ZTQA 9ICOA 1Q82T 1YSJA 4KT0C 1SAZA 1ZQSA 4XK8C 3K5NA 1Q53A 2YJFA 2P66A 2GO8A 2OEKA 5L38A 4FXVA 1B9DA 1N48A 2FPMA 5IC6B 1T3NA 3RYLA 2KT3A 3OY9A 2CJYB 1TE2A 3GFKB 3KWMA 4DQSA 7ICOA 5F8JA 1VQON 2OTLS 3RMAA 3MXHP 1UJ6A 2WB1C 4RQ4A 3FCVA 1K8AT 3OXGA 4DL0C 3ZX2A 4AQYJ 3IMXA 1PBAA 4V19S 3QU7A 5ETSA 2VQFJ 5FPNA 3C5GA 2D8CA 4DR6F 1DRGA 5KFCA 1UT8A 3UQSA 1FEHA 7ICUA 3R7BB 2RS8A 3FUYA 2ZE2B 2FIUA 2YTUA 2KRRA 4BRGA 4DUZJ 3DXKB 1Y5NB 2XS7A 2LQ5A 4RW4B 3RH6A 1KTQA 3Q8MA 2ZGZA 5DZ7A 1NSAA 2XMUA 3T6JA 4OLAA 3OQ2A 2E9TA 3N4WA 1C7YA 3SCLE 2G2ZA 3TADC 3H90A 4X4PA 4I68A 3SCJE 5ALFA 4YHHK 3AVLA 5J2PB 3H2LA 2MB0B 3G25A 5F8MA 1YBUA 4JI3K 4DUYJ 4Q8FA 3D66A 1YT3A 1RKJA 3MGVA 3SD7A 3MR5A 2J8SA 1SKUB 3QPIA 1V38A 1SKRA 1J5EF 2ZM6K 4A5BA 1LAWA 3GB0A 3Q8SB 2BKPA 4IH5A 3PXGa 4UUWA 3MI7X 3IBPA 3LVVA 1Z4OA 2A1AA 1MQ3A 3MM9A 4J7CA 1DGKN 4B9VA 3M8PA 2DR5A 2NRWA 4C8LA 4NJ8A 2ZZNA 3NRWA 3MECA 1YX2A 1QVFR 2NRXA 2W1BA 3PKYA 1R6VA 5EX0A 2Q4TA 4O5CA 3SQIA 3UN5A 1YJ7A 3Q86A 4DR7K 1RACB 1KFDA 2GVZB 3IM8A 1FFUA 5ALOA 1FD2A 4TU7A 2UUCJ 5E5NA 2XB2D 1WC0A 1LW2B 4OHVA 4C0HA 3H20A 4ENOA 1Y3JA 4LF1A 2ZHBA 1RG6A 4FKYA 3QETA 2P9NA 4CEQA 2MY8A 3Q8QB 2E1FA 5ALWA 4E19A 3IP4B 1BHLA 4RR5A 2CG4A 2JLFA 2LYBA 5HLFA 5JXSA 4YMOA 1L3SA 1UFLA 1SXEA 2NPIA 3C94A 3SXLA 2IOFK 3ZT0A 3FBFA 4OCZA 1ZQVA 4NLPA 3HCXA 4H4MA 1L7MA 2H65B 1IO2A 3WXJA 3DM2B 1YTYA 4AHTA 2KICA 1TUYA 1BE4A 2HLUA 4Z4IA 2OCEA 4E0DA 4IFYA 1ZQEA 3R2DJ 2N4DA 3R6GB 1N33F 3M32B 3M6ZA 3KHGA 5L1LA 2KJWA 5AKGA 4MFFA 1U1QA 4EEKA 4FZVA 3WC0A 4M5GA 3OGUA 2HVHA 3CYMA 5J1PA 5DM7Q 3EGZA 3KLFA 3TSQA 3FSXA 5C5JA 2JDJA 4AF1A 2YTCA 4ZPCA 2HIQA 1HNZK 5G4DA 8ICZA 4JK9A 2IGIA 5EGYA 1BOTO 1HR0J 3OVSA 2R8HA 2HHHJ 4U8YA 4CJSA 2AU0A 4BY9C 3BGUA 1P8GA 2Y9UA 4UARA 4MDBA 2XY5A 5L1MA 1T94A 2EAOA 2PGCA 2UUBK 5SWMA 1X9XA 4DJBA 2QGFB 2F40A 3OV7A 2L9WA 3ENAA 3CCSN 1RWVB 3KUGA 1JCEA 3G87A 2IA6A 4ZP6A 3AARA 8ICCA 3QICA 1JLFB 2WAQC 2DNZA 3VEWA 4DR2K 3KJVB 1T9UA 3CJQA 4I6WA 4QWBA 3NGTA 5EX3A 1AUSL 1NGCA 2B6GA 4Y65A 4M94A 4JI3J 1TL1A 3BS9A 4L73A 3ALYA 2E5IA 4NPOA 3IMQJ 1D8YA 4B3SK 4Y2YA 2XULA 3PYDA 3AODA 1ZQAA 4OJRA 3WQPA 3GCXP 2AYBA 2YMLA 3EUNA 4P7VA 4IYQA 2SXLA 5HMYA 1YRTA 5AJ3F 1AZSB 5HN0A 1N0UA 1X4FA 3EE3A 4Y2KA 4DQRA 2HIYA 1ZBTA 1H2UX 4YR0A 2BKNA 3UPQA 1HYVA 3CDAA 1Z05A 1T4GA 4DR7J 2W8LA 2KKVA 3NCPA 3LDLA 2JC0A 4DTUA 2GMLA 4TN2A 2HW3A 4USUA 4FS1A 3A8EA 1SWVA 1SJ4P 3DWLA 2EFQA 1KL9A 4CF1A 3HJEA 2ILYA 3KMQA 2J5AA 4KX5A 5AKXA 3QMLA 1X4DA 3IR5B 5THWA 3NNCA 4KB7A 4CCHA 1V9PA 2Y9TA 4LZGA 3QJPA 1R59O 1WF2A 2ASDA 1FEEA 3QAEA 1VK0A 7ICFA 2DHHA 1X31C 5GIOA 3ALRA 2J6SA 4CRJA 4BR5A 3CFRA 1QLNA 1WG1A 1EIYB 3EZWA 2BW7A 2E2QA 3VC8A 2R7VA 3G10A 1RTHA 2W2NP 2FLNA 4RNHA 3I5CA 2CWKA 3VQEA 1D8LA 4CE6A 3CC4S 2XICA 2GGPB 2BTFA 1JLQB 1LKYB 5J2JA 2BEFA 1NLVA 4H5VA 1JB0C 2W42A 1S0NA 2NYHA 2OHDA 4K8ZA 5BR8F 2BOPA 1VCTA 4RX6A 3SDEB 4NEZA 2BANA 3N4MB 1N34F 1UOCA 1WSJA 4RQMA 4Z6DA 1CULB 1HNZJ 2ZZTA 3QLHA 1KFTA 3O1WA 4NXMF 1D9FA 4X65K 5K14A 4DTNA 3HXMA 2HNDA 1QSSA 3GJTB 3G82A 3ILJA 1VRTB 4L76A 1MROB 2R42A 2IVYA 3WIVA 2JH7A 1HEKA 3CCRN 4G1IA 2QE5A 2EFVA 1BQMA 3O4QA 1F5BA 4FWQA 2RHQB 1UQVA 1NK0A 3CW2C 1JLEA 2CZ9A 1GMWA 2XS5A 2C2OB 1ASUA 4S0MA 4RW8B 4BRLA 4Y3CA 3SBGA 1HQ2A 5EE9A 2RHFA 4QYZK 4X4RA 1OKJA 3G4SN 3N79A