4DSEA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dseA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dseA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dseA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dseA01
3AVMA 2ASDA 5KFNA 4DS4A 4DOCA 3RJJA 3HJFA 3T5HA 3PW0A 4IQUA 5J0RA 3VA0A 4DTNA 3JPQA 3JPSA 3DLRA 3VQDA 5FRMA 4UBCA 1RT3A 4M04A 1BPEA 3ZT3A 3TFSA 2OZMA 4KLSA 4CHZA 1U4BA 2Q0ZX 3VQ9A 5C25A 1N6QA 4NLGA 3QINA 3MR2A 4M9JA 1JLGA 2BPFA 2B4JA 1HNVA 4JV1A 3K59A 4J2AA 2RDIA 4BXOB 4I2PA 1ZQBA 3GDXA 2XY7A 2PFOA 1NK4A 4M3WA 4RNOA 4F5NA 4CEOA 3OYKA 1V9PA 1TAQA 3ZSQA 4LSNA 4JWNA 3QE9Y 4ELTA 3WNFA 5D46A 3LPTA 3L2VA 2J6SA 2NRZA 3V1RA 3PMLA 1U9LA 4G1QA 4E1NA 1QLNA 3EZ5A 4CJQA 4OJRA 2AGOA 2X74A 4NLKA 2LSNA 8ICEA 5KFSA 3NCIA 3V7LA 4I2BA 4M6WA 3WNEA 4PGYA 3H4BA 1NJXA 4DSJA 1S9EA 3MGIA 2OPRA 2WTFA 2B21A 3LZIA 2AGQA 4FLZA 9ICJA 4FJMA 4PPXA 1L3VA 4DFPA 1T03A 1BHLA 4RQ8A 3OHBA 5L9XA 1X9MA 4FJXA 4ID5A 4O5CA 4CJVA 5J2IA 3F73A 3SPYA 4QWDA 4DTJA 9ICUA 4I27A 3PX6A 4KTZA 5DB8A 4GXKA 4FJLA 4QWCA 4XQ8A 4CK2A 1RT7A 4CEQA 3NAEA 5KFHA 5KG1A 4ECUA 3C1ZA 4Z6DA 2V9WA 1GOAA 2RPIA 3THVA 1B9FA 5KFYA 2JEGA 7ICFA 2Z1JA 3H8JA 3GV8B 4BWMA 2OZSA 3NGZA 4KLEA 4FK0A 5J2HA 4ED7A 3HX0A 8ICZA 1QS4A 5DB7A 4FJNA 3PV8A 2FBYA 1B43A 5IINA 3UXPA 3M9MB 5J29A 1WAJA 3JPOA 4DFJA 2IA6A 4M6WB 1NK5A 3DLBA 4PHEA 4QW9A 5D49A 3V9XA 4FO6A 1RBSA 1L3UA 3OYJA 1SZPA 3LZJA 4O3QA 4LY7A 3HSTB 1BPYA 3AA5X 3NBPA 2V4QA 4N76A 4GLXA 4FLTA 1RT6A 4FJ7A 4YMNA 4DOBA 4KMUA 1K6YA 4RPYA 4YP3A 4F4YA 2IAJA 5J2MA 1ZJMA 2ZE2A 4NCBA 2ATQA 3LANA 1NOYA 4M41A 4CHQA 5KG2A 4Z4CA 5J2PA 4IBNA 3HVTA 1VSHA 3SUPA 2UVVA 5J0XA 7ICNA 3H8SA 4QWBA 5D3GA 3LP3A 5KFMA 2G8WA 4L8RB 1VSEA 3NE6A 3MEEA 3CM5A 4UB5A 3RBEA 2ALZA 2A1JB 2BCRA 3ZSRA 3HO1A 2YNIA 2E6LA 9ICVA 5J2NA 3VN5A 2QKBA 2FMPA 1VSKA 5J0OA 2X6SA 4CIEA 2PXIA 5EWFA 5DQHA 4O0IA 3C23A 4OPKA 1LWFA 2ZQBA 4UAWA 1BPZA 4IQTA 1D9DA 3CFPA 2HNYA 3IRXA 4ECWA 1QSSA 2IGIA 4RW8A 1IKWA 4DO9A 2DTUA 3MAQA 3AA3A 9ICQA 3ZSOA 1R0AA 4IR9A 1L3TA 5IIJA 1BI4A 4F91B 3C6UA 1XC9A 1S1VA 5KT2A 1CLQA 1F21A 2MUTB 4RPZA 4CECA 5DLGA 4DTPA 3LAKA 3MR5A 3OYDA 5CYQA 5DGBA 5KT5A 5KGWA 1KVAA 3SUQA 4I28A 1ZQOA 3AVNA 2NRVA 1HUZA 1ASWA 1RBRA 4RW9A 1HJPA 1ZQGA 5KI6A 4JRQA 5JUMA 4CCHA 5DG9A 3ISCA 4B9NA 1Z26A 2OA8A 3OYIA 4W5QA 3C2LA 3K5OA 4CIFA 4CFDA 4KPYA 2VG7A 3PR5B 3NH0A 2ISPA 1L3SA 4DFKA 1T7PA 4DL3A 3GIMA 1N56A 1YTUA 3SV4A 3QEIA 1RDBA 4DQRA 1TKTA 3SQ0A 4R8UB 3KLHA 4W5OA 4RQ6A 5HMLA 5FROA 8ICAA 3JPPA 1TK5A 4DSLA 1FKOA 3T19A 3I0SA 1D8YA 1WSIA 1HPZA 4KREA 2NRWA 1KFSA 3WNHA 1Z00A 2JZBB 4KLTA 4B9VA 4K8XA 1NOMA 5DLFA 2OPSA 7ICHA 3L8BA 3V9UA 4ECSA 4FZXC 1C6VA 4O5EA 2ZJAA 4J9KA 4ECQA 4IG0A 3KK3A 1DOQA 9ICBA 1NJWA 1VSLA 4J9OA 4QZ9A 5KG7A 3KK1A 1RXVA 2HVIA 4CF2A 4JV2A 3SJJA 1ZBUA 4KLJA 4BDYA 3RMBA 3ZSXA 1VSFA 5HP4A 2W8KA 1ZQZA 2VA2A 9ICAA 3RWUA 2BGWA 7ICQA 3QEVA 4FK4A 4P4PA 3M9NB 2ZTEA 1WCLA 1S97A 5C24A 3OHAA 3TR8A 4CGGA 3KD5E 4ED6A 3NGIA 2FC0A 4Y1CA 5J2CA 2AU0A 3RJGA 4GW6A 3IHQB 4Y1DA 5KT4A 5J2BA 4BXOA 2JEIA 5J2DA 3HPOA 1RPLA 4RQ4A 4DFMA 3AVIA 3HL8A 3RB3A 1W0HA 2KZMA 4CF1A 5IIIA 2IBKA 4KHSA 3D45A 3AO4A 5CZ1A 3MECA 5J0SA 4M9LA 5CWRA 4QWAA 4M3RA 4ED2A 3VQ5A 3GV7B 4N5SA 4O3OA 4B9UA 4YFUA 3HVRA 2FBTA 2V4RA 4CIGA 2R7YA 3V6HA 1ZQXA 2C2EA 1J54A 4DU1A 7ICVA 1ZQTA 4YXJA 3JPTA 1JKHA 4CEAA 3NF7A 4W5RA 1S10A 5DBAA 1NJYA 3PW7A 4J2EA 4AHSA 4H8KA 3QEWA 3PNCA 3AUOA 1BIZA 2E4LA 3VQ8A 3KK2A 2E6MA 3ISBA 3AVBA 1VSJA 2KFNA 1ZQJA 1UT5A 1VSMA 4ECYA 5IIKA 3Q8MA 1KLNA 3VQ4A 1CEZA 4CGHA 5KT7A 1S0OA 4F5PA 2JEFA 1U04A 4TSXA 2H5XA 3JPRA 3L2WA 4AHTA 2C28A 3VQQA 3GIIA 3K5NA 4Q5VA 2ZTDA 5KFTA 3ZDAA 1C1CA 8ICXA 4QZCA 1C0TA 4XRHA 1RBTA 2DY4A 2PI5A 3RB0A 3QEAZ 1D5AA 4JLHA 2R8IA 3PUFA 2W9MA 5CHGA 2F96A 2FBXA 1NKCA 3CQ8A 3ORYA 2IOCA 3NDKA 4ED8A 3OYMA 3DLHA 3OVNA 5KFRA 2VG5A 5T7BA 4LZDA 1HYSA 3B6PA 4MEYA 4JRPA 4DL5A 2RDJA 2HNDA 4LD0A 4F3TA 4B9TA 4YMMA 2G8FA 3UXNA 3NH1A 1RYRA 1NJZA 3HYFA 4FJHA 4FBUA 2G8UA 1XSNA 4IRDA 1XSPA 4MQ3A 1IH7A 3RMAA 1ASVA 3QESA 3PW4A 1ZQQA 4DTOA 8ICHA 9ICLA 3CFRA 3AVJA 3MBYA 4FJIA 2PFPA 3S9HA 3QZ8A 2AGPA 1HNIA 2YNGA 3P83D 3HXMA 2OPPA 4R8UA 2I9GA 1FXXA 4ED0A 1ZQLA 5CYMA 5EWGA 4N56A 9ICCA 4P4MA 4O55A 2AJQA 4HCCA 3TI0A 4UBBA 3UPQA 4LH5A 3LP1A 4FVMA 3L2QA 2HW3A 4O3SA 5DG7A 2LYHA 1DTTA 3EY1A 1ZQEA 1A5WA 2BHNA 5HP1A 3QEBZ 1TKZA 4B9LA 2HNZA 3GFKB 5EOZA 5I3UA 4ZH4A 1REVA 2YHBA 4B8AB 3NF6A 5J0YA 2GUIA 1BCMA 5K14A 3MXMA 2G8IA 4J9PA 2W42A 3K4GA 5J2KA 1NKEA 2IC3A 5TZVA 3LP2A 5HHIA 3PX0A 8ICPA 2KTQA 3DMJA 4QWEA 4RW4A 2R8KA 3G10A 3IM1A 2GWSA 2KN7A 4CJUA 3BQ1A 2YV0X 5KFOA 3E01A 3RR7A 3BJYA 3DLKA 3UQ0A 1KCFA 1ZQDA 3LALA 1Y88A 3V7JA 1I39A 2W8LA 3ZCMA 1C1BA 4FS1A 3KJVA 4PGXA 4AHVA 1BQMA 1S77D 8ICCA 3B0YA 1TAUA 1EX4A 4KI4A 2O4IA 1LAVA 3K5LA 1BL3A 3Q8PB 4PHDA 2W9CA 1MSWD 2R8JA 4NCAA 5DBBA 1KFDA 1ITGA 3EYZA 3CFOA 5KGXA 3RH5A 5IIMA 1CZ9A 1EETA 4RG8A 4F2SA 4RT2A 5BOMA 1ZQKA 3SUOA 3HP9A 7ICRA 2I5JA 1UA0A 5HROA 1ZQMA 4CJTA 3ITHA 3VQAA 5D4BA 3V4IA 4KLGA 3OSNA 4DTXA 1XU4A 2ZUDA 5KT3A 2F8SA 4KHWA 5KTQA 1LWEA 3Q8SB 3M8RA 4RQ2A 3K75D 4DSIA 4KFBA 1BISA 4EYIB 4YCXA 3MDCA 1KTQA 1VRUA 3AA2A 3RB6A 3OYAA 4J2BA 3NFAA 3I8DA 4CHOA 3K5MA 3BGRA 4RW6A 3IG1A 1U48A 3HPHA 2OPQA 4EBEA 4RZRA 1IG9A 1LAWA 3P1GA 1J5OA 1TL3A 1WSGA 4DOAA 4G3IA 3AO5A 1IM4A 5KFEA 3Q8KA 4MEXA 4KHUA 4M3TA 1GOCA 1Q9XA 1QSYA 4M3ZA 3AVAA 3P5JA 2BCQA 4EZ9A 3ALYA 4Z6FA 4Z0UA 3ZSWA 2FMSA 3I0RA 2XHBA 4EEYA 7ICIA 1QE1A 3IAYA 2R8HA 2DFHA 9ICFA 3ZD9A 4Q43A 4Z6CA 2DFLA 1UAXA 3T5JA 1U47A 1RNHA 3C95A 4I2EA 4BDPA 3V1QA 3DYAA 1HQEA 3ZDCA 3MDAA 4NYFA 2ISOA 1EKEA 4F4KA 8ICBA 4DTRA 4YN4A 2WOMA 4B8CA 8ICYA 1TL1A 1HUOA 4JK1A 2G8VA 2BCVA 4KLFA 2HVHA 3NH2A 5L1LA 4E7HA 1AROP 3MEDA 3UIQA 3VQ6A 2D5RA 3H7IA 4Q45A 3K57A 4F8RA 4EYHB 1ZQVA 2B5JA 2ZJ8A 4M2YA 4Z4IA 1NK9A 1DTQA 2VWJA 2BPCA 5HRRA 2IMWP 3AO2A 4KLQA 1EXQA 3AV9A 4AH9A 1W9HA 4CJ4A 2BQUA 3T5KA 5HMMA 1ZQNA 2FPLA 4PWDA 5KRSA 1VRTA 1C7YA 4Z4HA 5J0TA 4RW7A 3IS9A 3C21A 4YNQA 4Q8EA 3CYMA 3AO1A 2AQ4A 2PI4A 4O4GA 4PGQA 3RJEA 1JN3A 2P6RA 1JLBA 4CJPA 3QEPA 3OYFA 4Z4EA 1S9GA 3PW5A 3NF9A 4UB2A 3C5GA 1ZETA 5KFIA 2BQRA 7ICSA 4QZFA 1WN7A 4W5TA 1JLEA 4TURA 2JEJA 3HT3A 3OY9A 4Q8FA 3S3MA 5CR0A 5L1JA 2PYLA 2DPJA 4KAZA 4ECRA 2NUBA 2GV9A 3RJHA 1K1SA 8ICTA 4RU9A 3OYGA 5KFLA 4M0AA 3QLHA 4FW2A 2BR0A 3OS0A 4UB3A 1BIUA 4J9NA 4OKEA 3AU2A 4O5KA 3S3OA 4DQIA 4MFAA 3KD1E 3U3YA 3SQ1A 4Q44A 8ICSA 2XY6A 4O0JA 1K1QA 4H4MA 1ZBLA 1JX4A 4F5QA 4FZYA 3ZT0A 4Q0BA 1IO2A 1MC8A 5KFAA 4ID1A 1Z3EB 3DLEA 1A76A 4YR0A 5E41A 4FM2A 4ZTJA 1KEJA 2W9CB 9ICGA 1SKRA 1DGSA 3O3GA 4QZEA 3GQCA 4I2AA 4F5RA 3F9KA 4LSLA 4DSKA 5KG5A 4QZAA 3KLFA 5HHHA 3RR8A 3ETLA 2Y1JA 4PA1A 1RYSA 3RAQA 4FZZA 5KFUA 1C0MA 1X1PA 3QZ7A 4CFCA 2PY5A 3ZT4A 1UA1A 4UAZA 1RTJA 4JS5A 4KB1A 4ECVA 4B3OA 3V9ZA 4QAGA 1ZQAA 3OYBA 4CHYA 4R65A 2C2DA 1ZQIA 4B9SA 5DB9A 3DLGA 4R66A 3L3VA 4NY8A 3SYZA 2UVWA 3MGHA 1RDDA 3QEXA 2A1RA 9ICTA 4J9LA 4KLLA 3K58A 4QZHA 4M3YA 9ICXA 4AHRA 7ICEA 2OYQA 4IDKA 4BGDA 4OKJA 4CK1A 2G8KA 1XHXA 5J2FA 7ICGA 4DL7A 4DQQA 3NGYA 3OGUA 5CZ2A 4DTMA 3H4DA 4YVZA 3FDSA 4FK2A 4EBDA 5DGAA 3HWTA 3NHGA 5HRPA 3D0PA 3HM9A 4ELVA 3JYTA 4OGCA 4KB0A 4CGJA 4CK3A 5DDYA 3OYHA 4RQ7A 5J2EA 1Q9YA 4OLAA 3V1OA 3G6YA 3TAMA 2KW4A 5CY4A 2HHVA 3LAMA 5J2GA 7ICJA 3QO9A 4ICLA 4IQWA 2HHUA 4ZHRA 1CUKA 3RRGA 1SKSA 2WONA 4J9SA 2XY5A 1NK7A 1ZQWA 3KHHA 4R63A 4HYKA 5SWMA 4HUEA 2KZ3A 5J1EA 3KHGA 1UWBA 1TKXA 4DF4A 1U45A 1J53A 4KHQA 8ICFA 3RJFA 1ZQHA 4O3RA 4FJ9A 1HYZA 2VA8A 2IDOA 4O3NA 1N48A 3KTQA 2KFZA 3BQ0A 2XGQA 5DK5A 2FLPA 3TARA 4BE1A 3AU6A 1HMVA 3C94A 1RBVA 4O44A 2BKEA 1SL2A 2ZUBA 5CP2A 4OKKA 3RMDA 2B6AA 1B22A 5J0QA 3MXJA 5HRNA 2KZZA 5KFPA 3M8SA 4RQ1A 2FMQA 2BE2A 4FXDA 4NM2A 1L5UA 3N97B 4GC7A 1QHTA 2XCPA 4TQRA 3RMCA 1SL1A 3EW9A 7ICKA 1S76D 1Q8IA 5EWEA 4N41A 4E7IA 3TWHA 1XI1A 1SL0A 9ICOA 3QIOA 3PW2A 3RB4A 3V9WA 2ASJA 3V6JA 8ICLA 4O3PA 4XUSA 4KLUA 4PHAA 3ASMA 4OVLA 2HHXA 1KFTA 4FYDA 4AHCA 2BCUA 3LP0A 2QKKA 1LB2B 2DPIA 2ITGA 5I42A 2BANA 4CJ5A 3JSMA 3HW8A 1XWLA 2UVUA 1NKBA 4I9LA 2QK9A 3KLEA 4NCGA 2RF2A 3ISNC 2HMIA 2ZUCA 3TAQA 5DMRA 1T3NA 8ICRA 3BDPA 3LDSA 4KTWA 4CERA 3GV5B 3G6VA 5KG0A 3EPGA 4FCYA 1BQNA 2A1JA 3OJSA 5BOLA 4CFAA 4HHTA 3GIJA 3OSPA 1S6QA 1NK0A 4UQGA 2UVRA 1BCOA 4UB1A 9ICMA 8ICNA 3LK9A 3UXOA 1MQ2A 4DL2A 9ICPA 3KLIA 1ZQUA 3QNOA 3ZT1A 4CEDA 5KFJA 5EU7A 4RQ3A 4I2FA 4J9RA 1RTHA 2BQ3A 5L1IA 4YG2A 4GVMA 4LH4A 4I9QA 9ICEA 4XIUA 4P4OA 4J2DA 4YR3A 5JS1A 4O9MA 3M9OB 4ECXA 3GIKA 4B9MA 4F4WA 4LVSA 1TKDA 1WSJA 3T1AA 4CJ3A 4CEEA 3RJIA 3UQ2A 4CJKA 5L1KA 1SKWA 4RNMA 3LWLA 4IQVA 2C22A 5DG8A 2BPGA 3ZT2A 4Z6EA 4FS2A 1RBUA 4B08A 4IFYA 4E7JA 4C8KA 3PVXA 2M9NA 7ICTA 3TQ1A 3FYHA 1S0MA 3OYCA 4CE9A 4FJ8A 4C8OA 2F8TA 1CXQA 1BVSA 5KFVA 4CEBA 2X78A 4DLGA 3SNNA 4E0DA 2D0AA 9ICSA 1QQCA 2ASLA 4KLDA 3KKSA 1WAFA 4NLNA 1KSPA 1WSHA 2W9BA 1TK8A 3DOLA 1FK9A 5KFQA 1FKPA 1HRHA 4KRFA 1RDAA 3HK2A 4KN4A 2A1SA 9ICKA 2XCAA 4KHYA 4OPJA 1WSFA 1RT2A 4GMJB 1BGXT 4CEZA 1Y97A 1RTDA 4E89A 4HUFA 4FJJA 1ZQPA 4FM1A 2YNHA 1WNSA 1ZBFA 3ZD8A 5J0PA 3MABA 3V72A 2PFQA 1S0NA 1RTIA 3NGDA 2FPMA 3T5LA 5J0UA 4YD2A 4DG1A 7ICOA 4GC6A 4PQUA 3HP6A 3PR4A 2HHWA 3H08A 2HHTA 5HNKA 1S9FA 1SV5A 4F4ZA 7ICMA 4RQ5A 4C8LA 4KLOA 4FJKA 2FBVA 5KG3A 1KRPA 2EHGA 4HTUA 8ICKA 2GBZA 1ZBHA 4M42A 5DKWA 4YQWA 4KLMA 3V81A 4CF9A 5C5JA 4Z4GA 4JWMA 9ICWA 5KFGA 4KV8A 4CJRA 5HLFA 1LW0A 1BPBA 1COOA 4NXZA 5KFWA 1S1XA 4JV0A 1JXLA 3Q8QB 4C8NA 2Y1IA 3BQTA 2NRXA 3U6FA 4QZIA 5C42A 4YFKA 3V6KA 4F92B 1C0UA 3EPIA 1YVUA 5F9LA 4KKOA 4YD1A 1UT8A 3OYLA 5KFKA 1T4GA 9ICIA 2HHQA 3H8WA 5KG6A 1GOBA 4HUGA 8ICGA 1JXEA 4TQSA 4FLWA 2P66A 5HBMA 3AVLA 7ICPA 5JS2A 4OLBA 4OGEA 4BE2A 4JS4A 5KFXA 3RTVA 2P51A 3MR3A 4IG3A 1HJRA 4F4XA 3B6OA 3VQEA 5KFDA 4CJWA 4CJFA 4R64A 1JLAA 4F2RA 2ETJA 3L3UA 1KDHA 1WCNA 4MFFA 1S0VA 1IKXA 5J0WA 4EP5A 8ICMA 2JZBA 3TAGA 2BGGA 2EX3A 2QXFA 1MQ3A 1QTMA 4N47A 4IR1A 1X2IA 2W9AA 3LPUA 5FRNA 4TUSA 3PX4A 1ZBIA 5FDLA 1H38A 4CGDA 2FLLA 2AQ0A 4QOZB 4K4GA 3OYEA 3M8QA 1O1WA 2HHSA 4FJGA 4GXIA 3RJKA 3T3FA 2PZSA 3RH6A 3KHLA 4I29A 1KVCA 2R8GA 3PO4A 4NM1A 3DRRA 5DB6A 8ICOA 1QSLA 1S1WA 4ECZA 2ZJ5A 4FLYA 4M45A 9ICNA 2Z1IA 4FBTA 3O3HA 1D9FA 2O4GA 1RILA 4E7KA 2PFNA 3TAEA 3ZSZA 3MXIA 4CF8A 5BPCA 3V6DA 4PH5A 4DU3A 1NK6A 4QZBA 3TFRA 3C2KA 4CESA 4MF2A 2FLNA 4MF8A 4I2IA 4M3XA 4QW8A 1X9SA 2X6NA 7ICLA 3KKRA 3ZDEA 2Z1GA 4FLUA 1LW2A 5CB1A 1U49A 2FPKA 4F50A 1X9WA 3Q8RB 1JL1A 1Z00B 4DQPA 1DLOA 4R5PA 3OS1A 3E2EA 3K2PA 5J2AA 1LV5A 8ICWA 8ICQA 1JIHA 4QCLA 8ICVA 4DTUA 3RBDA 4DSFA 3LDAA 3NTUA 3AA4A 1BI4B 2P1JA 3AVGA 4F3OA 3VQPA 5KFZA 1VSDA 3SUNA 3HPGA 3RH4A 5CA7A 2I1QA 3RRHA 1Z25A 4M9GA 3QNNA 2F1IA 2ATLA 4PHPA 4CHNA 3O4NA 4JUZA 4QZGA 3VQCA 2RN2A 1MU2A 4O5BA 2VWKA 5J2JA 1ZQSA 1KLMA 4KN7A 4PY5A 3AVHA 3S3NA 4C8MA 4XA5A 3B0XA 4RUAA 1YTAA 4FLVA 4KI6A 1CXUA 4KO0A 3QETA 3BQ2A 1XS9D 4I2CA 1ZQFA 4TUPA 2MAXA 4FJ5A 4F93B 2XC9A 1ZYQA 2KQ2A 2Q3SA 2BDPA 2YNFA 3CG7A 3VQBA 3TAPA 1B9DA 4J9QA 2VA3A 9ICHA 4CF0A 1RDCA 4DLEA 2VANA 1RCHA 3TABA 3KLGA 4BDZA 1JXBA 5KT6A 4ED3A 4IRCA 4RQ0A 1S1UA 4YXMA 3L2RA 1JLQA 2DFFA 1RXWA 1ZQYA 3C6TA 4FLXA 3CM6A 4CJEA 1IXRA 3VA3A 4MFBA 4DMNA 3ZDDA 2RKIA 4I2JA 2IS3A 4WE1A 4W5NA 4KHNA 3DRSA 3QIPA 4HCBA 1RT4A 1JLFA 1IKYA 3JPNA 4PUOA 3ISDA 3MR6A 1ZJNA 7ICUA 1D8LA 4YMOA 1SUQA 8ICUA 2XO7A 1A5VA 2YKNA 3RAXA 2F1HA 4BE0A 3WNGA 3OS2A 1HQUA 1NK8A 5DDMA 1BPXA 1TVRA 1G15A 4DF8A 4TUQA 5KFBA 3TAFA 5IIOA 3C1YA 4ECTA 4E3SA 2P5GA 4UB4A 4DSEA 2J6UA 4CJSA 4NLZA 5F9NA 3O3FA 4P2HA 4F5OA 3MFHA 3ULDA 2IHMA 1ZQRA 2J6TA 1S1TA 4M3UA 2XY8A 1I3AA 5CJ7A 4IRKA 1TK0A 1RT1A 4I7FA 3DRPA 1KVBA 2XGPA 2NRTA 1UOCA 4LZGA 5J2QA 1VK0A 4DTSA 2ZD1A 3G0ZA 3NF8A 4H4OA 4I2HA 1S6PA 2W9BB 1XO1A 2PYJA 1TFRA 4RT3A 4FW1A 3PO5A 3ZSYA 1WSEA 2D0CA 4BWJA 3ZSVA 2DFEA 1XHZA 3V7KA 1JL2A 4RPXA 4DL4A 2IHNA 1EXNA 3DM2A 5IILA 3MEGA 2VG6A 1N5YA 3SI6A 3C2MA 4DS5A 3AVCA 4CJLA 5DQIA 4IKFA 3SPZA 4QZ8A 9ICRA 2ZTCA 1A77A 1NOZA 1S5JA 5KG4A 4EZ6A 4MFCA 4QZDA 1T05A 4CEFA 3GILA 1T8EA 2G8HA 1TGOA 4I2DA 4UAYA 4M47A 4HVJA 4ELUA 4KLIA 1JLCA 4CGIA 2BCSA 3M8PA 4DEZA 2MUTA 5DBCA 4KLHA 1JMSA 4BACA 1RZTA 3QERA 2JLEA 3C5FA 4EP4A 1TV6A 4CGFA 3MFIA 4YR2A 3SI8A 5KFCA 4E19A 3LWMA 2OWOA 3AVKA 1B92A 2P5OA 3DI6A 4ZTFA 3N4MB 4FM0A 4DU4A 3AO3A 2HB5A 3Q8LA 3OYNA 3EWAA 4M9NA 2P6UA 3SZ2A 3G6XA 1IKVA 1RT5A 3ZDBA 2C2RA 3U3GA 1ASUA 3AVFA 4EBCA 1LWCA 5DQGA 3FFIA 1VSIA 1A5XA 8ICJA 3V9SA 4RUCA 4Z4FA 4J9MA 4CFBA 3VQ7A 2F1JA 3H40A 3OJUA 4I2GA 3PY8A 4K4IA 3PMNA 4DL6A 3DOKA 3O4QA 4K8ZA 1ZQCA 3KHRA 3SQ2A 4NYNA 4M9HA 8ICIA 1BPDA 4DQSA 3L2UA 4DWIA 2JGUA 4X5VA 1TV9A 5KRTA 4IFVA 4GXJA 5HRSA 4K4HA 1WLJA 1J9AA 2Z1HA 1CZBA 3SCXA 4RNNA 4KTQA 3A2FA 4E1MA 1C1AA 3SV3A 3SQ4A 5SZTA 2XRIA 4CHPA 4KITB 4ED1A 1XSLA 2YKMA 1EP4A 4E7LA 1YT3A 1HYVA 1TVAA 5KFFA 3KIOA 1PZNA 3TANA 2D0BA 2YHAA 4I2QA 4AHUA 4AILC
chains in the Genus database with same CATH superfamily
2VDIA 3NUQA 1QHAA 3GLJA 4RCHA 1HNZF 4DX5A 2VODA 3RJJA 3DXKA 4LR9A 4YMEA 1M1KO 2VF3A 3T5HA 3M6XA 4URQU 3HSZA 2QSFA 3J80U 4DV5J 4C98A 2VWBA 3ZT3A 1N33K 2ZIXA 2OPPB 2QLWA 3LF0A 1B7YB 5BR8J 1U0HA 4NLGA 3QLHB 3QINA 4DV3K 1UTAA 3B82A 1BHNA 1PJ6A 1FKAF 4J2AA 4RR5A 3AJ1A 3Q86A 2NCKL 2E20A 4BXOB 1PK1B 1T95A 2ITMA 2HI0A 1ZQBA 3GDXA 3IGVA 5C42B 4BRAA 1NK4A 4RNOA 1LOTB 4B1ZA 2RE2A 2W6LA 1JJ4A 5KOWA 2AJ1A 1WWUA 1FKPB 1HQ2A 2EAMA 4LSNA 3CWJA 1HFEL 1P7DA 4JWNA 2OAUA 4ELTA 4OZ5A 1NU0A 3WNFA 3SBMA 2ILZA 1ITPA 4NXMK 3V1RA 3R7BB 4DU8A 5K14B 2FHKA 2BE2B 3EZ5A 2IVYA 1T9WA 3D2FB 2AGOA 2X74A 1N63A 1WHWA 4NLKA 3D2SA 3LDPA 3NCIA 2QA4S 5ALJA 3T6JA 4M6WA 4PGYA 3H4BA 1NJXA 4DSJA 3BR8A 4OHZA 1H72C 4PWUA 1S9EA 4WP9A 1TTHB 3CJBA 3QFPA 4F3QA 4PPXA 1XNRF 3R5GA 1BO5O 4DFPA 4MT1A 3OHBA 1BHLA 5L9XA 2CQ1A 4PG7A 4Y2RA 2FJXA 4ID5A 2CQGA 3AODA 4W92B 1WOOA 4DTJA 3FBFA 1ATRA 4QWCA 4XQ8A 5AM5A 5DRKA 3MM9B 4I64A 2ASOA 4LF6K 1Q81O 1R8AA 1QUPA 4ID8A 4OLPA 1HLUA 3C1ZA 2ZJQQ 4U67Q 3E3XA 4Z6DA 1JRPA 5F41A 1B9FA 4QQBA 2W3RA 3RVCA 4DUZK 4NLWA 1SIJA 3ALRA 2QRRA 3H5YA 1HW9A 2RRNA 2GUPA 1TYQB 3PV8A 3TJ8A 2FBYA 4USHA 3M9MB 5BREA 1XNQK 3JPOA 4DFJA 1NK5A 3D6FB 4OJGA 4IOCL 2BYCA 2R7XA 3NVVA 3D2FA 2UXBK 2DRDA 2UV8A 3H59A 2ZHBA 4QJFB 2DNYA 2NXEA 1BWFO 5D3GB 3NVMA 3O9QA 2QMUB 2J0WA 5D4LA 3DXBA 4KMUA 1OS5A 4RPYA 1G6BA 4RPFA 3FC4A 2KG1A 6FD1A 3UB5A 4F4YA 2IAJA 1ZJMA 2DHSA 1ILYA 1NOYA 4M41A 5KG2A 4Z4CA 4ZJLA 2L9WA 3D0IE 2EK6A 2E1PA 1Q5VA 2JVOA 1VSHA 3SUPA 4QWBA 4OFZA 3WU2U 2G8WA 4FZNA 2ZF5O 1ZZNA 3QRPA 1VSEA 3NE6A 4P10A 2W03A 2A1JB 3VQTA 2HG4A 2A10A 3KFWX 4RLEA 2LEAA 2WVCA 2V5HG 4LFBF 1GNKA 3VN5A 4IO1A 4CNQA 1G1XA 2D0OA 3PJXA 4F0MA 2FZKB 4WFZA 4OPKA 4MK7A 4DXLA 3IV6A 1MLAA 2AIRB 3EVMA 2K8BB 4ECWA 4RW8A 4HDHA 3BF4A 3MAQA 4YN3B 1VQ4N 2KHOA 4Z94A 4HT5A 4KX3A 2ABYA 1SH0A 1K9MO 1L3TA 4PKDB 3CJ0A 2G2OA 1BI4A 2XYHB 5ALOA 1XC9A 5KT2A 2WAQF 2J7KA 1MWKA 1KC8T 4JI6K 3WIUA 1M5SA 4DTPA 2B4OA 3FMWA 2Y8YA 4KH1B 3LAKA 4JI0F 3FSIA 5DGBA 3PRDA 3O6WA 2J7WA 2WSCC 2DNLA 2KNJA 2X51A 5KGWA 3I56N 1GT8A 4I28A 2RAQA 3GR1A 1RU1A 1ASWA 1VK3A 4XK8C 4B3MF 4RW9A 1NGGA 4U95A 1ZQGA 4UY8T 2OTJN 3RSEB 2ZH4A 3H5SA 5MLCV 1UETA 5HAOA 5LJ5Y 2I0XA 4BCAA 4FYXB 2M7SA 1TAMA 1RQ0A 5FLXO 1QAIA 3H2LA 4DB3A 3NH0A 5CRXA 3WK8A 1WBBA 3DI6B 3K9JA 5AZJA 3SV4A 3F56A 3UM9A 2FJDB 1N5TA 2AJFE 4BRGA 1FFGB 1RE1B 3KLHA 4W5OA 4RQ6A 4H4KA 5K8MA 2FSKA 2DXDA 1P6TA 3J80O 4UOFA 2WW8A 3FM9A 2QA4G 4TXSA 1UP1A 3T19A 3I0SA 2ZC4A 2GELA 1D8YA 1MW7A 1RGVA 3ICLA 3F9MA 4BBYA 4FNIA 3UWTA 1WSIA 5I9EB 5HMYA 2NRWA 2WONB 2P9LA 4MKAA 3WNHA 3I9V9 4ZHRB 1IKWB 2QA4N 2I1RA 4B9VA 1ZPWX 3DXMB 3L8BA 3V9UA 2NXNA 5AKEA 3KK3A 3WK9A 3QJJA 4TYBA 1QE1B 1VQPS 2PDAA 5K4LA 3KK1A 1XK8A 3SJJA 2V52B 4I2QB 2BJEA 5I3PA 2VBZA 4KLJA 4BDYA 3RMBA 2GMHA 1FHTA 3OXLA 3LM9A 3I5CA 2Q2RA 3ENOA 2VCPA 3KKAA 7ICQA 1N5SA 5IT4A 1HUXA 4ZP6A 5HMWA 4JI6J 1A7GE 5JVHQ 5JICA 1NMEB 3TR8A 2DCUB 3KD5E 2XS2A 3ZI4A 3VAGA 5G5GA 4GKKJ 4Y1CA 2AU0A 3TA2A 4GW6A 1VDVA 1T44A 3C8YA 5KT4A 3HOSA 5J2BA 1MMNA 4ZOSA 2JEIA 1RT1B 3I87A 2D3UA 3AARA 3CQYA 1N33F 4MKYA 3JTPA 4CBUA 5J0SA 2H4WB 2CVIA 2CYYA 2I8EA 4ED2A 2QGFB 4QU7A 3CCSN 3BBCA 3BKTA 4QIWF 4B9UA 2J0SD 4JOUA 2VQFF 4CIGA 2VV5A 2IYGA 1J54A 3JTNA 4JK9A 4B3TF 4FF1A 4OHWA 2H48B 4ILGB 1S10A 2GZOA 4PUOB 2UUBF 4J2EA 4AHSA 1Y10A 3PNCA 1BIZA 3B4MA 4N77A 2QMWA 3OUYA 1HNXK 2HWTA 4DQ8A 5B5EU 1UT5A 2WB1F 1RTZA 5IIKA 3NCQA 4X4PA 1V4SA 4ZK7M 2MSNA 1SH2A 1CEZA 4DR1F 1RQLA 3H3NO 2HGLA 4DFDA 1LK5A 1PILA 1ZBTA 2CPYA 4UOHA 3JTOA 1F0MA 5G0RB 2HNDB 3CF5Q 2KSOA 3G86A 3K5NA 3CF5L 2ZTDA 1C1CA 2ESEA 2BTFA 5AQGA 2HZCA 4HEA9 1PCAA 2DY4A 4O4GB 1NNEA 2PI5A 2KV2A 1EO1A 3RB0A 2V69A 3THTA 3JYTB 4JLHA 1IBMK 2BV3A 2W9MA 5CHGA 5AZIA 1NKCA 1PYSB 3JS6A 3CQ8A 3VZIA 4X4TA 3G8QA 1RT5B 1FD8A 5T7BA 5CCMA 1HYSA 4HAIA 4MEYA 3SBGA 3CC4N 3QSYB 5M1NA 2HNDA 2K4PA 1YJ7A 4JI2K 4JI5J 4YMMA 2G8FA 3UXNA 5EVZA 1RYRA 4IRDA 4WYWA 3NNHA 4DV0K 3M8QB 4FZVA 3RMAA 2AZ3A 1YUWA 1ASVA 3QESA 2GO7A 4AYBC 1RAIB 2YNHB 1JJ2R 1K44A 8ICHA 4MMOA 4KGMA 4NYPA 2R7UA 3MBYA 3OUYB 2HBZB 1YX2A 1V38A 2AGPA 3HXMA 3H0LB 1NO8A 4EHTA 1FXXA 5ALYA 4B3RF 5EWGA 4AD6A 3IMQJ 4N56A 4B3TK 3L09A 4BLGA 4FWPA 4EIAA 4X4OA 4TU9A 1KD1T 3L2QA 3WQTA 4G1IA 3KJNB 1T3VA 2E5GA 2HW3A 5DG7A 1ZQEA 1RWOB 3HBTA 5CD4H 5TKYA 1SB3C 3QEBZ 1TKZA 3AL0B 4B9LA 2JL9A 4DR6F 4CW7B 3GFZA 4DR2K 5EOZA 3PTWA 3NAHA 4A5BA 3T1HF 5LL6d 3AOCA 4UTGA 5K14A 1BCMA 5HMXA 1ZD4A 2NPFA 2G8IA 1A0PA 5J2KA 3LP2A 2YXLA 4IFEA 4JI5F 3VAMA 3DMJA 3UKUA 3WXKA 4QWEA 4RW4A 5TISU 3AA9A 3G10A 3ZX3A 3IM1A 2KN7A 3CO9A 1OSDA 4CJUA 3BQ1A 4WK3A 5ADXA 3PIPL 2JLGA 4JI1K 4KV8B 3MCAB 1ZQDA 3ETMA 1OSCA 1TFYA 3C6AA 2CFXA 3ONNA 1RTJB 4PGXA 2IVMA 1HI8A 1X4AA 1RAAB 2Q97A 1YJNN 1TAUA 4PWWA 1EX4A 2O4IA 1BQNB 2KJ5A 1LAVA 3K5LA 1BL3A 1H2UX 2FJBB 4OJ5A 2W9CA 5AIAA 1I94K 4NCAA 3KDNA 1KFDA 1B99A 3FC9A 4PL1A 3QICA 2H3GX 3OLBA 3EYZA 3RH5A 4Q0BB 5B0GA 1EETA 4RG8A 2VICA 3T1YK 5BOMA 1ZQKA 4C48A 3BPSP 3MMAB 4ITSA 2WVBA 3M7DA 2RNEA 3W64A 2BANB 4CJTA 2OEKA 3ITHA 5DJBA 2MGZB 1VS3A 3LP0B 3N5FA 4YDUA 3MN9A 1XU4A 2ZUDA 2WBRA 3PIPQ 4PHTX 5DZ6A 1VQ9N 1LWEA 2FUG9 1RT7B 4MHVA 3D6JA 1K9MT 1XNRJ 1WTFA 4KFBA 1BISA 4V19J 4A8WA 3RB6A 5AQUA 1GLDG 3NFAA 3I8DA 4J2BA 3EJMA 4RW6A 2HSTA 2HHHK 2R7OA 1S5LU 2GIQA 2WVEA 1HNWJ 1IG9A 3CJ8A 3KUHA 1HBUA 2XQCA 1WSGA 4PPDA 2YPZA 2V7ZA 1IJFB 3ENWA 4M3TA 3K1RB 4YY3K 1Q9XA 1QSYA 8AT1B 1HR0J 3AVAA 1VQ6S 4QS7A 5HOOA 2DVIA 9RUBA 4EZ9A 4OQJA 3ALYA 2D9OA 1H74A 3H1VX 1Q7YO 2FMSA 2RD5C 3TUZC 1EQ0A 5THWA 1Q7YT 1SAZA 1HBUB 3HI9A 9ICFA 4Q43A 2DFLA 3BYRA 1U47A 3VMFB 3C95A 4ILMA 2POKA 4OYOA 5AM3A 1HLWA 4NYFA 5IT9O 2XZWA 3WZ0A 5BR8F 1TL1A 1HUOA 2G8VA 5FDLB 1XBWA 3VEVA 2FSNA 1CBKA 4KHPJ 3UIQA 3MMAA 1D9AA 2FYXA 2ZIVA 3ZZRA 1ZQVA 3TKAA 2ZJ8A 4M2YA 4Z4IA 1VHFA 1DTQA 2BPCA 3BEGB 2IHR1 5HRRA 3LM2A 2ZH8A 1EXQA 1H0HB 5CA5A 1S99A 4AH9A 3QFWA 2BQUA 2YPYA 3UDCA 1WC0A 2JWNA 4PWDA 4H4MB 1VRTA 4Z4HA 1AZSB 1W7WA 4KH4A 3MDFA 4XPEA 2RQKA 4ISGA 2H3FA 4PGQA 4CJPA 3OYFA 2ZOGA 2GAHC 3FRZA 3DFEA 4FKYA 1IQZA 2KT3A 3NF9A 4UB2A 2OCEA 3GG0A 1D1UA 3F2KA 3P38A 2BQRA 1EZZB 2GVDB 5HJYA 3QPIA 5CCLA 1VBXA 2VPYB 1QH9A 1JLEA 5ETNA 3OY9A 3MCMA 2MZTA 3LP2B 2KFYA 5CHIA 2NUBA 3BZCA 2FF6A 2GV9A 3RJHA 1G4CA 2DYAA 4M0AA 4U96A 1RWWB 3QLHA 3NNCA 3OS0A 3ZTSA 1BIUA 4J9NA 4OKEA 3VF6A 3AU2A 1ZM4A 2M8DB 3N9UC 1X5TA 5B08A 5HI7A 3OQ2A 2KOBA 3KYLA 2B43A 3ZZYA 1JX4A 2NNWA 4Q0BA 1IO2A 5IZHA 3DRXA 3KMSA 1JLAB 1Z3EB 2DY1A 1TYQA 3IMXA 5E41A 4BRQA 4ZTJA 4RNHA 1KEJA 2W9CB 1X4CA 2O8EA 4F5RA 3Q23A 3ETLA 4HACA 3GCXP 4NXMF 4PZNA 1IKYB 2YX7A 3ZFVA 1C0MA 4CFCA 3BO4A 1YHQN 3ZT4A 3N4PA 5JVHL 4C0BA 2ZGZA 4JS5A 4B3OA 3EO3A 1ZQAA 3PG9A 4USAA 1VYAA 1CPZA 4TLQA 3DLGA 2ROPA 3WIVA 3BM7A 9ICTA 3EGVA 3KLGB 4L3KA 2OMOA 3AD8C 4QIWD 1Q79A 9ICXA 7ICEA 5AQYA 4OYPA 5B66U 1RM6C 2KJ9A 3OGUA 5MAOA 1FW6A 4DTMA 3SFUA 3FDSA 4NO7A 5DGAA 1VCTA 2R7QA 3NHGA 5B0BA 2R7WA 2YMLA 1P27B 2CIMA 5IQQA 2FDNA 3PM9A 3SMPA 1E4FT 4OGCA 4Y2KA 4AP9A 3SFGA 3EKUA 4Y2UA 3KK1B 4RQ7A 2GO8A 1Q9YA 1F3VA 1VBKA 3DRYA 2DKOB 3V1OA 3H0RB 1YBAA 1XERA 4OX9K 2HHVA 4LSNB 1RLCL 4M5LA 5CYQB 3M6UA 1TL4A 2ZBRA 4ICLA 4IQWA 4ZLJA 4AFFA 1N32J 1F5AA 4CDIA 2WONA 4CT9A 5M2UA 1J2VA 1PC5A 4WIQA 3SCIE 5IV4A 2IDLA 1F2HA 1KL9A 1NK7A 4DR2J 1V5VA 2W41A 4X84A 2NLXA 2F7TA 4BVPA 2YQEA 4C4RA 2UUTA 5K8OA 1GMWD 1NPRA 4WK1A 4MKVA 4E2FB 3OL8A 2PA8D 4NLSA 3KG4A 2IDOA 1U1PA 1O51A 3D6RA 1N48A 2KFZA 2EVZA 2LU1A 2E5JA 1ZBSA 3TARA 1HMVA 2QWMA 1W2IA 3MMCA 3NGSA 4O44A 2BKEA 3IAM9 1QAYA 1VGYA 1FXLA 4MDBA 4OKKA 3H3OB 5EDWA 2EFGA 1U1LA 3L4QA 3PXGa 4C97A 1DFDA 5HRNA 4BUGA 3QWUA 1NMDA 4USWA 5AQRA 4ZP9A 4AYBD 3AY0A 1YKWA 1HA1A 4GC7A 1ZC6A 1HIYA 3RMCA 4IJAA 3J80Y 1XNSA 1NZBA 4LBHA 5EWEA 4N41A 1KW4A 4EUVA 1UFKA 3T1YJ 3VTIA 2E2QA 1SBRA 4JI7F 3QIOA 3PW2A 4JKCA 3C6UB 2F9JA 2ASJA 4O3PA 1XMOF 4OVLA 1KFTA 4NEYA 4LFCJ 4ZIWA 2W7PA 2BCUA 4CGZA 3IM9A 5GIOA 4YY3J 2IMOA 2AJ2A 2RQMA 3NS7B 3JSMA 4HH1A 3MPUB 3ZNJ1 1S48A 2UVUA 3EGNA 3EMTA 4JYAK 5ALZA 2NO4A 4TLRA 3SQGA 2MKKA 1QM9A 4A8KA 3KLEA 5F8GA 4NCGA 2ACMA 3OBYA 4I69A 2RF2A 4P0PA 2XSFA 3TAQA 1ZD5A 5DMRA 2EZXA 4WPAA 3LDSA 3O1WA 2E44A 4QIFA 3THXB 3GV5B 3G6VA 2LYAA 3WKBA 2XWXA 5ALKA 1CS4B 1PVRA 4OYXA 3OTQA 1OW5A 2A1JA 2LQJA 2EBGA 5AK4A 2WUSA 4ZKAA 4Y65A 3OSPA 8ICNA 3CC4S 3LK9A 3CDEA 2QO3A 3LW5C 4FWLA 4K42A 4ZP8A 4PZVA 3MXHP 2YH1A 1FEZA 4CEDA 5KFJA 5DDRC 4A8EA 4J9RA 1RTHA 4YG2A 3CJ2A 2D7SA 4G9ZA 1DLOB 1SC4B 2L3MA 4YR3A 4A8OA 4OZLA 4OJ1A 3GIKA 1T05B 4LVSA 5E79U 2HQFA 3T1AA 2E1RA 4CJ3A 1NGIA 4CJKA 2ROGA 5L1KA 1SKWA 2VJUA 4RNMA 1Q8KA 1Y3JA 3OD2A 2NPIA 2DL0A 4LRBA 4FS2A 4IS7A 2DNPA 4E7JA 3S8SA 5G4DA 1BG3A 3SCLE 1F3FA 3MD1A 1C0TB 3FYHA 1HL6A 3MM7A 5ADXH 1P8GA 2QL7B 1BVSA 3CSKA 2A6OA 2X78A 2EZZA 2HPUA 5KOXA 3R1HA 1AUDA 4AYBF 4XDCA 1WSHA 3A12A 2H3IA 3FZHA 4FXVA 1FK9A 1MN9A 4DR1J 3Q7CA 4IKAA 3IA0A 3BO2A 3WKEA 1RDAA 4HVZA 2ZG6A 2CQ3A 1M6YA 5D4OA 1WSFA 1RT2A 1BGXT 2JMGA 2VBYA 1MA7A 1U1MA 1PAEX 2HVEA 2Z56B 4HUFA 2FPHX 5ALMA 1ZQPA 4G65A 4FM1A 1N6QB 2UUBJ 3IWNC 2KVSA 1N34J 4ATNA 1OO0B 3CCJN 5J0PA 2N82B 2LKZA 1NZAA 4RW8B 5AXKA 2DITA 3S01A 5AZJB 1IUJA 3T5LA 4U7UD 1XMQF 3W61A 4ETXA 4P71A 4DZDA 2HHWA 4ZLPA 4ZN1A 3OTBA 4F4ZA 4KYZA 4RQ5A 5HO4A 5HBMB 4FJKA 4X66F 1RHJB 2XMJA 3R8EA 5DM7Q 2CH6A 5KAKA 5GVQA 1YAGA 3D5MA 5DKWA 5K20B 3V81A 4CF9A 2NXCA 1GO3F 4Z4GA 1C4AA 2OEJA 3WXLA 5KFGA 5HLFA 4CJRA 2CH5A 1LW0A 3QGPA 1COOA 3CCMS 3FCHA 3F5EA 3O3LA 2YWGA 1FVSA 4CYUB 1XR6A 2E9ZA 2PE8A 3O4WA 4Y2AA 4FL9A 3E1YA 2K4EA 1C0UA 3DLGB 1NHUA 1YVUA 3H6EA 3CMAN 4JKFA 5LXRA 4KKOA 4DX7A 3H8WA 3CDUA 2OSRA 8ICGA 4TQSA 2M8HA 1N5QA 5AXLA 5JVGL 2OP5A 2V0NA 2V94A 4OGEA 3O08A 1JKHB 4IG3A 2GHWA 3HFKA 3VQEA 5KFDA 3IRWP 3SQIA 1VJWA 5K9FA 2ETJA 2YKNB 4MFFA 4GRSA 1S0VA 3G4SN 2FGOA 1K73T 2D6FC 2AYBA 2ZIVB 2JC1A 4ZVRB 1KQSM 2RHQB 3RU0A 3MEEB 3GE9A 4A57A 4U67L 3UCZP 1X2IA 3DKDA 4WYBA 5FRNA 2AMCB 1Q78A 1ZBIA 2ZIWB 2Z2YB 1H38A 1RTDB 1SZ2A 1IBKK 3PFOA 4K4GA 4QOZB 2IDEA 3C19A 3KNGA 1GQEA 1UQVA 2DH7A 4IO9Q 4GVLA 1NRKA 1RWMB 3L7OA 1FRKA 3OR1A 2YH0A 5ALVA 1C20A 1KEKA 3TVZA 1E3MA 4I29A 2QLFB 4NV0A 3PO4A 3DRRA 5AJ3K 2CZVC 4M63A 2PIIA 1S1WA 2MKHA 4ECZA 4A2AA 4FLYA 2JHEA 4M45A 3L4IA 3O3HA 4JD2B 3WX4A 3VWSA 2DUYA 2KYXA 1L7OA 1K73O 2XMAA 4DV7K 3TZXA 4NASA 3R9KA 4WKYA 1YIJN 3ZEUB 4DU3A 4CESA 3GR0A 2PMZC 4M3XA 4QW8A 1MA9B 7ICLA 3ZDEA 3PNIA 4FLUA 2HWHA 1LW2A 2EZYA 4URGA 4JI5K 4K50A 4R5PA 3WQPA 5B09A 8ICQA 2GEMA 3U7JA 4DTUA 3CMQA 3NTUA 3AA4A 4B3RK 2YBVA 2J0QD 3SUNA 4USIA 1TP7A 3EE3A 1U6BA 5CA7A 1GLFO 3HHNB 3GU0A 4CLLA 3CC7N 1Z25A 2QL5B 3H25A 3FAHA 2IY5B 2F1IA 1B7FA 2DIUA 4NA3A 3G6ES 4BR2A 2HOQA 4CHNA 1TL7B 2F8LA 2LQ9A 3IBCB 2C3OA 2CPIA 4KN7A 1X40A 4KI6A 1CXUA 4KO0A 4BR9A 1DARA 1BNPA 3BQ2A 1RAJA 3OV7A 2Z30B 3NP5A 4I2CA 1JI7A 1ZQFA 1HW8A 2MAXA 3NLCA 3P96A 4F93B 2F9DA 3GDQA 4CZKA 2C2ZB 3VQBA 1WEXA 2VA3A 1R8BA 2AKWB 2P6TA 4QZVB 2H5IB 3PLAA 3UKUB 1FF2A 1H2VZ 5K5MA 4P75A 1U1KA 1NDPA 2K4IA 5KT6A 4WF9Q 1Y64A 3N28A 4UY85 4DCOB 1JLQA 3G6EN 1S1VB 1GLEG 3BN4A 3C6TA 4QJVA 1NI3A 4FLXA 3RZAA 1ICEB 4DMNA 4I2JA 4WZMA 3DRSA 7FDRA 1MWMA 4HCBA 5GMEA 1JLFA 3HHLD 5M1KA 3ISDA 2BJ1A 2IVOA 8ICUA 5AXMA 4ANEA 4CNYA 2OTLN 2YKNA 3RAXA 1Z1ZA 1GMUA 3WNGA 3LYSA 2VH7A 3HHLB 4DV4F 1HQUA 1K8KA 4DG1B 2QEXN 4W4MA 3KZIU 1Q3UA 3C1YA 4ECTA 3EWGA 1BC6A 4UB4A 3PCOB 4O8UA 4QIWC 2J6UA 3QMQA 2FD2A 1HNZK 2L48A 5M2RA 1EJ7L 3MFHA 2J76E 3ULDA 4YS2A 2BJ3A 4E8UA 4KX5A 3MX5A 3RJMB 1VQ5N 1S1TA 4M3UA 5CJ7A 3Q8UA 4Y0FA 5ALIA 2B51A 4KKOB 5F3TA 4I7FA 2WB1D 3DRPA 1KVBA 2XGPA 4ED5A 1IBLF 3WDOA 3MCPA 2LBOA 2DT9A 4EO8A 2HS3A 1XN9A 3KWIA 4OPAA 4H4OA 4ACOA 1S6PA 1GAOA 1XO1A 4J7CA 1OMSA 1TFRA 2IPOB 2VFRA 2ZBCA 4ED4A 4FW1A 3PO5A 2ZITA 4FOEA 1NGBA 2DFEA 1U25A 3OVSA 4LF7J 2R7SA 2VG6A 5ETMA 3K9KA 3C2MA 3AVCA 5DQIA 1WHXA 4IKFA 3O9SA 2ASMA 1W97L 4PQUB 4QZ8A 2XHCA 4MFCA 1L7MA 1GX5A 3QIDA 2YKAA 4IOBA 1S72N 1PJ5A 5EUHA 4ZDNA 3AN1A 1Q53A 1HHTP 4QBUA 4OZ3A 5CH7B 4UOGA 4KLIA 1HNIB 3TO8A 5KQDA 2KHDA 4DEZA 2MUTA 5DBCA 1FTRA 3OL7A 4BACA 5LL6Z 2CG4A 1ZA1B 4EP4A 3MFIA 4BGBA 2ALYB 3SI8A 3ITHB 2Q0UA 4IEIA 4CP5A 1TKTB 4DV1F 3B9JA 1UW9A 1OJ4A 5E5NA 1FJGF 3RRKA 2WF7A 1FK9B 2JVRA 1DK3A 4DU4A 3AO3A 1NB7A 3AB4B 3POTB 4FYWB 2U1AA 1VQMN 3H5UA 1SV0C 1IBCB 3UE5A 3SZ2A 1IKVA 4LF8K 1KONA 2YX4A 1ASUA 3ONQA 5DQGA 1VSIA 3G8SA 3GG4A 1N2XA 3OL9A 3BKUA 1RAFB 3GWCA 5F8MA 5A8WB 2HSEB 1TUUA 3ZZUA 3VQ7A 2ATCB 3PY8A 4K4IA 4DL6A 2WCXA 2YHYA 4I6MB 3DOKA 5D0GA 3SSSA 1S5ZA 4K8ZA 1ZQCA 3V2UC 2VPWB 4NYNA 1R43A 4B3MJ 4M9HA 2Q4TA 5IOLA 1RB0A 1X4FA 4BRHA 3M2VB 4DWIA 2JGUA 1E6VB 1QJHA 1K8AO 5AT1B 3CCSS 2MLYA 4BRNA 2WF6A 3N0VA 4ZVOB 4EENA 2KVQE 2R3VA 3ZC4A 4IH7A 2CPJA 4ALZA 1MG7A 3SCXA 2B9EA 4RNNA 3PYGA 4E1MA 1RI7A 3M2UA 3UN2A 1NPKA 3SQ4A 4CHPA 2BZ2A 3A0HU 1ZAWA 2E1ZA 3F5TA 1HYVA 5KFFA 4AE5A 1PZNA 3M32A 2D0BA 1URRA 1XR7A 3C28A 4I2QA 2D3OR 1U7LA 4EEKA 4AILC 4FPRA 2C2MB 1WKLA 1IBMF 5KFNA 3DLEB 1X5SA 4DS4A 4DOCA 2VQFK 3BBFA 1DJ0A 3BGUA 3HJFA 2KHQA 4IQUA 3SQOP 3MAHA 2O5DA 3VQDA 4WCEQ 4ZJOA 1BPEA 3M32B 1NBEB 2DR6A 4A5AA 3TFSA 4KLSA 4CHZA 1U4BA 2FC8A 2Q0ZX 5C25A 3VQ9A 2A5XA 3MR2A 1JLGA 2B4JA 3UR3C 1HNVA 4NA1A 2VASA 3NASA 4JV1A 3AT1B 4M5MA 2F1FA 4I2PA 2XY7A 2PFOA 4M3WA 1YJWS 2KKHA 5J2MB 4CEOA 3OYKA 1V9PA 2E1MC 3M8WA 3NS5A 4DPWA 3ZSQA 3MM8A 1CSJA 3QE9Y 5IM0B 3LPTA 4CZEA 4NZ0A 4FYYB 3DHXA 4AM7A 1QLNA 2ZKTA 2VGNA 3U8XA 4JI1J 2M0NA 4CJQA 4QIGA 4OJRA 3ULEB 1MWQA 4OI4A 2OEMA 4Y2VA 2LU2A 1M5HA 1HNWF 3WNEA 2KIWA 1HWKA 1JJ2M 3MGIA 2IOFA 4RW9B 3T1YF 1NHKL 4WJBA 3QJLA 3KK3B 5IM0A 9ICJA 4FJMA 2D3ZA 1L3VA 5G0RA 1YXQA 1KN5A 5EXWA 1LKYB 3TVYA 1FRXA 3OBWA 1IJJA 3SSQA 1DY3A 4CJVA 2AW0A 1ZRNA 3R9PA 2BACA 2OD4A 5J2IA 3F73A 3SPYA 9ICUA 5LXYA 5F0XA 5DB8A 1T0TV 2BABA 4ZCLA 2IM2A 1EKSA 3NAEA 1S7HA 4MAKA 2VOOA 3FZ2A 1COKA 2W2OP 5H9EJ 4YDDB 2JZ5A 4JI1F 1TZ0A 4AL7A 4CLPA 2HS0A 3VAKA 1BUPA 4Y2IA 2EXUA 2DGTA 3TX0A 3FVYA 4NRTA 3UO0A 2W7AA 4FK0A 4KLEA 3CUNA 2QW9A 5J2HA 2CUYA 2O8FB 4LF5J 2W2QP 2G0CA 1QS4A 4FJNA 2FHMA 1B43A 2YVSA 5J29A 4EU0A 1WAJA 2MQQA 2BVZA 4WIIA 3DLBA 3AMZA 3BO3A 5LMNF 1YF5L 4ZVQB 1TE2A 4QW9A 2ASYA 5JVGQ 3V9XA 2E88A 1D0EA 2D0PA 1RBSA 1ATSA 3MMBB 5KQ8A 2HFOA 4DR2F 1L3UA 1BNOA 4O3QA 4LY7A 5AK3A 3FGUA 3KJFB 1N52B 3IBFB 4CLFA 3CCQN 1RT6A 4FJ7A 4DCHA 4KJIA 4PYDA 3R5JB 4YP3A 3TEHB 1N60A 2DGWA 2H5EA 1Q95G 3LL3A 2AYGA 3LANA 1S22A 4NLPA 5J2PA 4CHQA 4WP3A 4LF4F 3O9TA 4FWMA 4X4RA 4C3KA 5J0XA 1BUXA 4H03B 3D2EA 3SDEA 4L8RB 4YHHJ 1QVFM 1X31C 2DHXA 4UB5A 4RQNA 3TSQA 3RBEA 3BGLA 2CRXA 1RWVB 5A6PA 4A8YA 3HO1A 1UCNA 2YNIA 1REGX 7FD1A 3M2RA 1RGIA 5J2NA 2FMPA 1XNRK 1UVKA 2NRHA 5AM0A 1IWGA 2ZDPA 1J5EK 2PXIA 2GV1A 1LWFB 1NWKA 4CO2A 1YG0A 1S72S 2H3QA 4US8A 2VPXB 4NPOA 4IQTA 1D9DA 4B3SF 5GIPA 3SIPB 4NA2A 4CRJA 3ILLA 1NAQA 2DR9A 1R0AA 2NZCA 4LVNP 4IR9A 3OW2R 2P9NB 3AAQA 3DOMA 1C0FA 2YY6A 4OV1A 1WF0A 3U26A 4X64K 3M2VA 4WFAQ 3MR5A 5CYQA 4CZFA 3LQVA 5KT5A 2IC3B 5LSRA 1KVAA 2HHHJ 1YVNA 1ZQOA 2DQNB 2LYBA 4NWIA 3QDKA 2DH9A 5AKLA 3CJ3A 1QUVA 4JRQA 5JUMA 4F7VA 1DGJA 1HNXF 3ISCA 3G2XA 1Z26A 2OA8A 3HZEA 5MLCQ 3MEGB 4DR4F 2GGPA 2Y0BB 2E5HA 3C16A 3MCOA 1U2RA 4CFDA 2ZIUB 2B7CB 5F0WA 2D3DA 5ALFA 1OVQA 4OV6A 3LPYA 4CZMA 4PPZA 5ALDA 4DFKA 4DL3A 3BQ7A 4H4OB 3Q2SC 3GIMA 2HRUA 1N56A 2RH3A 1R6YA 3QEIA 4JI3F 1RDBA 2FJAB 1TKTA 4XEIA 3UMGA 1UVJA 2IVNA 2YWKA 4OZNA 3HLUA 1CVJA 1FKOA 2YTCA 2WRMA 2QWNA 3A8YA 3BGFA 1HPZA 2XI3A 4KREA 2ZBPA 1KFSA 2CPHA 1UFWA 2G5IB 4R5PB 2G4BA 1NOMA 3G71N 4BRCA 2LPEA 7ICHA 1UJ4A 2RQ5A 4O5EA 2ZJAA 4IG0A 4ECQA 5EX3A 2IRUA 1DOQA 4E98A 2P9EA 5KG7A 3MTKA 1R6VA 1ZM2A 5C2CA 2VG7B 5BYQA 2ZNYA 4NLTA 1ZBUA 2OFHX 5CR4A 2F9WA 1VSFA 5HP4A 3JQJA 1IVZA 2VA2A 3RWUA 4GV3A 2B9YA 3MUVP 3QEVA 3W2WA 4P4PA 2W2MP 3M9NB 3DRRB 1WCLA 2PGCA 2E2PA 2QWRA 3OHAA 3GZFA 2BRKA 2QB1A 4CGGA 1WSRA 2X1BA 4ED6A 2B0CA 3HX9A 1UEUA 3ZTPA 1R0CB 2PEBA 1DEJA 2KG5A 3TA1A 1I5OB 2A19A 4BC7A 4P72A 4NMXA 1FCAA 3HPOA 4DFMA 4RQ4A 2JGAA 2OI2A 3AVIA 3L7UA 3RB3A 2CNNB 4KH5A 1W0HA 2KZMA 5AQWA 5KL1B 4X66J 1FERA 5CZ1A 3MECA 2UUBK 2AEFA 5CWRA 3D1QA 3TWZA 3U27A 4M3RA 3T7ZA 1Y5NB 4FPAA 1OY8A 3HVRA 2DHGA 2FBTA 2V4RA 2HRTA 3U1MA 3V6HA 5LMNJ 1ZQXA 4DU1A 2UXCF 1ZQTA 4YXJA 3CP8A 1PG5B 2YY3A 4W5RA 5DBAA 3W3DA 3PW7A 4LFAF 2E5LF 1J2NA 3AUOA 2E4LA 3DWLA 3HJVA 5CYJA 3AVBA 2KFNA 3K1ZA 5EE9A 2O8DA 1VSMA 2CQPA 3Q8MA 2V8PA 3JQKA 1BWEA 4FXWA 4CGHA 1RKIA 2HVDA 4RW4B 4C2MA 1ELOA 3JPRA 4F72A 4FF2A 3N7PD 3GJRB 2KM8B 4K4SA 3VQQA 3GIIA 4JI0J 4MO5A 5ETSA 4F67A 4Q5VA 3OT9A 4JYAF 3PIOL 2XM3A 1HPMA 1RA7A 1X0FA 3KVGA 2R8IA 3FMBA 4FWKA 3P6YC 3H1QA 2F96A 2FBXA 3ORYA 2DD8S 3ZTQA 2VQEK 3DLHA 3OVNA 5KFRA 2M4MA 4LZDA 3THPA 4JRPA 2RDJA 4LD0A 4F3TA 4B9TA 1OXJA 3NH1A 3KUEA 5AQSA 3HYFA 4FJHA 5A0LA 2F44A 2XWYA 1XSPA 4MQ3A 4HI1A 3FLCO 4LFBK 4IL6U 1IH7A 2YKQA 4UZBA 4FVCA 5J1EB 1CG2A 4ZVSB 4UT4A 4DTOA 4DU7A 9ICLA 3ELHA 1ULRA 7AT1B 3NGRA 3QBWA 4FJIA 3P83D 4GVBB 2OPPA 4R8UA 3Q8VA 2RHKA 2CPEA 2QJ3A 1ZQLA 2D9PA 4M1KA 3CCLN 5IXUA 2ZM6F 2A6MA 1HBNA 1U0SA 2V9KA 1M5OC 3N6NA 4MIAA 3TI0A 3UPQA 4LH5A 4FVMA 3OHRA 2RRAA 3VPZA 5ETKA 1O03A 2HSZA 4JB8B 4O3SA 5AZIB 2LYHA 1DTTA 3EY1A 1HHQA 5HP1A 3CJ5A 1FRHA 3HOTA 2F8MA 1D8BA 4JD2A 4B8AB 2MKJA 4KE5A 1RUSA 2VJ4A 5J0YA 3FGVA 3MXMA 3R1LA 4OD0A 4C23A 3D2WA 1RA6A 2A6AA 3D28A 2ZD1B 3BGRB 3PX0A 2DBYA 1VQ8S 2R8KA 2YHXA 2OEHA 1YJRA 5KFOA 5BRDA 3E01A 5HLFB 1YRTA 1FIQA 3BJYA 2JHDA 3UQ0A 4F25A 1RT6B 4KRWA 3LALA 3V7JA 2XMWA 4X62F 2RRDA 1S77D 3JSBA 4KI4A 1KVKA 3Q8PB 4TY8B 1YJWN 3UVJB 4JEPA 4HH0A 1MSWD 4LF4K 1CC8A 3SCJE 2J9CA 3AM9A 3JB9k 5IIMA 1Q16B 4F36A 3TJ9A 4RT2A 3IGNA 1AXQA 3SUOA 1JQGA 2W6KA 7ICRA 1Z6RA 3CD6S 4K0KJ 1Q3VA 4LR8A 3HD1A 4OZ0A 2HURA 1P1LA 3L6QA 5JTIA 3QGIA 4DTXA 2YWFA 4OX8A 5A0YA 2XULA 2UUWA 3WXIA 1YZ7A 2YMQA 2QMXA 2PBDA 4J8FA 3ZXWA 1U2CA 2IIRA 2J5AA 3HZGA 1KQQA 4YCXA 4IH6A 1KTQA 5AE2A 3M1VA 1HNWK 1NH8A 3BGRA 3R5CA 4AQYJ 4EMDA 2OPQA 3I5BA 3WC2A 1HWJA 1TL3A 1J5OA 3HZ6A 4G3IA 2MY7A 3D67A 2FDRA 3Q8KA 1Y9OA 1JMTA 2MLXA 4KHUA 1WUDA 2KKZA 4M3ZA 2BCQA 4M5JA 4ZCIA 2HGNA 3ULEA 4DV4J 4KHRA 1WHVA 1E6YB 4Z6FA 1QD1A 2HRYA 3ILOA 4EEYA 7ICIA 1QE1A 1RZMA 3CDBA 4QYZK 2DFHA 3ZD9A 4CZGA 8ATCB 4QS8A 1HBNB 4ZP7A 1RNHA 4I2EA 3RUBL 3TP2A 2VQFJ 3DLLL 3VENA 4X62K 2PFUA 2HLUA 2GQCA 4NLBA 3ZDCA 3MDAA 2JRSA 1TMMA 1EKEA 4F4KA 1Q82T 2UZAA 2E66A 4B8CA 4UATA 4JK1A 4PEOA 2Q36A 2BCVA 4KLFA 4Z37A 4ILRA 1IBLJ 5L1LA 4E7HA 5DM6L 1RDRA 1F9FA 1BLUA 1AROP 1IXKA 1OKJA 3H7IA 4Q45A 4F8RA 2ZJRL 1SC1B 4CO5A 2RUSA 2W7OA 1GLAG 2DNMA 4B3SJ 2IMWP 2CJYB 3TYTA 4W90B 4KLQA 4CJ4A 2FE9A 5HMMA 2BM1A 2F4VF 5ETRA 5KRSA 3VGKA 4RW7A 4YNQA 3SEOA 2PI4A 4YEAA 3NOGA 3EKSA 1JLBA 4Z4EA 1X4DA 3PW5A 1S79A 4Y3CA 2MQ8A 3A5NC 1ZETA 1ATNA 5HL7L 7ICSA 4QZFA 1WN7A 4E1JA 1XQSC 4TURA 1F5SA 3KHYA 4Q8FA 3H0PA 2NREA 2DPJA 4KAZA 4ECRA 4FVUA 2L41A 3RG6A 2J8AA 5CABA 4DR4J 3OYGA 5KFLA 3BB5A 3KDOA 1JLBB 4K4ZA 2BR0A 3EDRB 5ALGA 4OX9F 4DHYA 4MFAA 4RO0A 3ADAC 3U3YA 3SQ1A 2WF8A 1SJFA 2P9KA 5BRFA 1ZBLA 4FZYA 2Z4PA 3M6ZA 2P9IA 1NDKA 5LJVA 4WQ5A 4FO0A 4FM2A 1X4GA 2DR7A 9ICGA 3KLEB 2O8FA 3CIMA 1EWQA 3O3GA 4K4TA 4X64F 3F9KA 3DXMA 5KG5A 5HHHA 1N33J 3UNYA 3WKAA 2CVEA 2HS4A 2I38A 2G1DA 2FVCA 3CCWA 2WAQC 5CD4A 3RAQA 4FZZA 2FGCA 1M0SA 4DV3J 3J7YP 3EUB2 4GKKF 2D1CA 2G07A 4Z7YA 2MSTA 4UAZA 4OYAA 2IJFA 4NI2A 1SWWA 1HKAA 4K8RA 2KRRA 4H0OA 2YJFA 1NGAA 2W04A 4K4VA 1RHUB 2KJWA 2UVWA 3MEKA 4XPCA 3QEXA 2HQCA 3K8VA 1X4EA 4J9LA 2CNLB 2LP4A 1DRZA 1X9XA 3M6KA 2XMMA 2IAJB 1H6KX 4CQ1A 3PEHA 4M3YA 2ZKUA 3T1HK 4BGDA 1L8LA 2GMLA 4OKJA 3QSIA 1OPZA 2G8KA 2DKXA 4C1NI 1VOMA 4WFBL 3CT9A 5CZ2A 2C1EB 4YVZA 3TADA 3H46O 3HWTA 2DCLA 2DR8A 4BR5A 3R97A 3GJSB 1VQ5S 2W2NP 4OX9J 4OLAA 1SJQA 1GK8A 1CI4A 3G6YA 5A2QY 3DEEA 2KW4A 1TL7A 3MMJA 3MM8B 3AD9C 7ICJA 3M05A 1K47A 2RB7A 2HHUA 1VRUB 3HHLC 1NGHA 4NEZA 5F8HA 1H7XA 1CUKA 1EX8A 4X4UA 4TNOA 3VAHA 1O08A 3L3FX 1ZQWA 4R63A 3BZQA 4HUEA 4LRCA 4FZLA 3LDOA 2F8KA 1UWBA 6FDRA 4PG5A 4QPTA 3R1XA 2V67A 1T11A 1MDUB 1TKXA 2OO4A 5J1NA 2BUNA 4MK9A 3RJFA 3IRXB 1NDLA 2N7CA 5JJBA 3KWGA 4FJ9A 2VA8A 2AP1A 3DOLB 4NLYA 2GCFA 1UVNA 4CZIA 3BQ0A 2M70A 4OYIA 1HKGA 5DK5A 1I1GA 2DNOA 1CJUA 4PJ0U 3MHYA 3AU6A 4CZJA 3UCUP 3HSJA 1SL2A 5CP2A 1NLKL 4CZHA 3CIZA 1WORA 2B6AA 4FSVA 2KT2A 3RBXA 2KXHA 3TZZA 3MECB 5KFPA 4C3LA 3TR5A 1RAOA 1FWLA 4RQ1A 4NLDA 1QVFR 1U6ZA 4NM2A 1J97A 3J81j 3SMVA 4OYBA 1OVYA 5H2FU 1ZM9A 4IFVB 3IG8A 3MWTA 1S6PB 2ZVSA 2Q79A 2ZWOA 4DBQA 2LEBA 1UZHA 2E7VA 2QA1A 5AM4A 1KHWA 1VQYA 3R6MA 3ZZ0A 3TWHA 2BXJA 3IG5A 3HKWA 1XI1A 9ICOA 2AX1A 2BX6A 5IV3A 8ICLA 2N7YA 2D41A 4A61A 4XUSA 5KAIU 4AHCA 3TZWA 4IDHA 3NBPB 3LO3A 1LB2B 2DPIA 8RUCA 4CJ5A 1VQOS 3F2DA 3HW8A 2QTWA 2APOA 3KLFB 3J81Y 5ALUA 3IM8A 2KVIA 1NKBA 4F02A 1VQON 1EARA 4K25A 2QK9A 4GIBA 3A8IA 3ISNC 4DN0A 5JMNA 1SJ3P 1M1HA 3R9LA 1NJIO 8ICRA 2ZHAA 1W26A 4P74A 3BDPA 3NMUA 3GTYX 3EPGA 3M30A 1F9HA 1BQNA 4A46A 3OJSA 5BOLA 1HR0K 3C14A 4UQGA 3VC8A 1BCOA 5E33A 1N88A 1RYUA 4DL2A 9ICPA 4DV1J 5AQNA 1ZQUA 4PQAA 3ZT1A 4JI8K 1HI0P 2QE5A 4Y2QA 5L1IA 2BQ3A 2GJFA 4FOIA 1B64A 5JS1A 4O9MA 4B9MA 4OI3A 2HFVA 4Y00A 3DU5A 3W60A 1BDGA 1TKDA 2DNKA 3BKFA 4CEEA 2W1BA 3RJIA 3IP0A 2XMKA 2OPRB 3LWLA 5IC4B 5DG8A 2JH3A 3MOJB 2VG6B 4K5SA 4IJNA 1RBUA 1BY9A 1IIPA 3E9PA 3VV2B 3TPQA 3PVXA 2M9NA 4IZ9A 1X4BA 4V1Ak 4CI6A 1UEVA 3OYCA 3FBBA 4FJ8A 2F8TA 4I68A 2UUCF 1CXQA 1S1WB 5AQZA 1A9NB 4JV5F 4E0DA 1NEEA 3S6EA 4KLDA 2I2YA 4NLNA 2KVCA 2YX8A 1KSPA 1CQNA 3DNCA 4DI6A 1TK8A 4XH1A 3DOLA 3PYFA 4JKBA 3BSNA 5AICA 1X60A 3HK2A 1TKXB 4P0QA 4FYVB 5AKGA 4I7FB 5GAHU 4KHYA 1LXNA 4GMJB 1FFUA 2ZIWA 1RTDA 4E89A 2ZC3A 2VFTA 4DV7F 4H0TB 1N5VA 3VVTA 1VC0A 2YNHA 4KSEB 4LR7A 4DMZA 2G2ZA 1ZBFA 5EX5A 1A6SA 4JYAJ 1AUSL 5M1FA 4OI0A 3MABA 2PFQA 2OMLA 3Q8YA 1WELA 2DGUA 1S0NA 2IJNA 1RTIA 4F9OA 2FPMA 5HJXA 1T03B 1IKXB 3DV9A 2FB0A 4LRDA 5L8RC 1UL3A 1KKXA 5GTIU 4GC6A 1UJ5A 2ZEJA 5HNKA 3ETOA 1S9FA 4YB1P 7ICMA 4C8LA 4BVOA 4KLOA 4X4VA 3BS7A 1V97A 2BOAA 2GAGC 2R2SA 2FBVA 2N4DA 1KBRA 4IO8A 5KG3A 2PAVA 2E9TA 2FF3B 4HTUA 1W7AA 1UVMA 4X2BA 4YQWA 1TUGB 2G13A 4P2XA 1MROB 3O5TB 5C5JA 2NSBA 4ZPTR 5LY3A 4U9RA 9ICWA 1SI9A 1D8ZA 4DL0C 5KFWA 4NXZA 1S1XA 1U09A 3AAWB 4C8NA 4BS2A 2WAQD 1DHMA 2Y1IA 1WDDA 3BQTA 2NRXA 2QXLA 3U6FA 4QZIA 4YFKA 3V6KA 2DKZA 3PSIA 5C24B 4F92B 2OHDA 3E0FA 2HHPA 4WFXA 1T4GA 1VIOA 3OR2B 2DEJA 3NVWA 4C9DA 1GOBA 1AW0A 3ZO7A 2LQBA 5HR6A 5HROB 2FVSA 2MZQA 5ETVA 3AD7C 3AGRA 3UN5A 5GMDA 3AVLA 2P9PA 3SMSA 1EETB 2E9RX 4DCJB 5KFXA 3RTVA 3MR3A 2KIVA 1QQOA 2YX6A 1FI4A 4R64A 3O0FA 2BUPA 3W62A 1VDHA 4CLUA 2JWLA 3UDLA 2A40A 4DV5K 2B6GA 4EP5A 8ICMA 3PSTA 2CNKB 2EH9A 5BRHA 2ZM6K 2XMUA 1FVQA 3ATUA 4LREA 3SENA 1UWBB 2W9AA 5KPRA 3MN7A 2HQDA 3VEXA 1TV6B 3SDEB 5JMVA 5A76A 3PX4A 1VQMS 4HKQA 3C15B 3KD3A 2QLJB 2FXUA 2F65A 3M8QA 4FJGA 2XZDB 5HSPA 4ISFA 4FPIA 1X8DA 4NXMJ 3T9NA 2GIFA 4BRIA 8ICOA 4CO4A 2O8CB 1Z4OA 5IFMA 4IQXA 2ZJ5A 2QTDA 1HR0F 1LCUA 3PYEA 1JCGA 3MGJA 4A48A 2PFNA 3S1TA 4XH4A 3MF5A 3JAMO 4U7UK 4OHXA 3FFIB 4DX8H 5BPCA 4ZPDA 2MRLA 3PZPA 4V19X 4PH5A 2FVRA 2HHHF 4QZBA 3MMCB 4ISEA 1K0TA 4P9SA 3EEQA 1LKZA 1X9SA 1L7PA 1F1BB 3KLVA 1M90O 4C11A 2Z1GA 1R89A 2GJ2A 2MQMA 1YK9A 1U49A 3HM8A 4F50A 1X9WA 5EGYA 1Z00B 4JKAA 3OS1A 1Q8LA 5J2AA 3PHTA 5AFUH 1JIHA 2HOIA 3F0NA 4PG8A 8ICVA 2AZ1A 4LQ9A 3DOMB 2E8OA 4GO7X 3JXUA 4YHHK 2OYYA 2LCWA 2P1JA 3AVGA 2VJVA 4F3OA 1EB0A 2R9LA 5C25B 2WOMB 1YHQS 2FJ6A 3I4PA 4MJKA 3QNNA 1LOUA 5T7LB 4PHPA 3RW7A 3O4NA 1O0PA 3CE8A 3VQCA 4KB7A 2VJ5A 1GXLA 2HEKA 4CF4A 2RN2A 4BJQA 1MU2A 2CPXA 1ZQSA 4HHJA 4DR7K 1NSQA 3V6DB 4F3MA 3FQLA 4DV0J 3SJHA 4C8MA 4XA5A 1SQEA 1FXDA 5J2NB 3M7VA 3QJPA 3EVWA 3PSFA 3TX8A 1M5KC 4TUPA 4FJ5A 5I42B 3AEVA 2BDPA 4WZQA 4C4WA 4FWNA 3TAPA 5AI0A 1FDAA 1TL3B 2CGJA 2QWOA 2Q43A 3CIPA 3TTDA 4CO3A 4URSA 1FT8A 5IT9Y 3IBWA 2QV6A 2XSJA 9ICHA 1PGZA 4CF0A 5HN0A 1GX6A 2PA3A 1FO4A 1VK8A 2LDYA 2VPZB 4RL1A 4BDZA 3L2RA 4YXMA 2EFQA 2O3DA 2R7RA 2DFFA 3VEZA 2HGMA 1LW0B 2CN1A 4I6MA 4EAHD 2LKYA 2HOFA 3LGHA 4B3OB 1S6QB 2FHJA 2JR5A 1U1RA 2O01C 2RKIA 1N5WA 1HX1A 2HMXA 1IQTA 4DV1K 3MMBA 3QIPA 1RT4A 3MR6A 1URNA 4YMOA 2V7YA 1SUQA 3DLJA 4LSLB 2GHPA 4LMZA 2XO7A 1EIYB 2F1HA 4YOXA 3FKBA 1NK8A 4JI3K 4A8FA 4GNIA 3B6BA 3POTA 2N3LA 1G15A 4TUQA 2CA9A 1HEKA 9ATCB 5E84A 1S4EA 4I6AA 1VQ6N 4RU2A 5CAAA 4NLZA 4P2HA 1YZ6A 4DX6A 2BRLA 4P7TA 2W43A 1Q4RA 4UY8O 2IHMA 2H3VA 5FPMA 2J6TA 2A18A 3OR2A 1I3AA 4TU8A 4JI7J 4ZVFA 5H9EK 3MWPA 4QS9A 3S7RA 3H20A 3SAFA 3M6VA 2HZAA 5L9NA 2NXUA 2W2PP 3X1LB 3ZETB 2NRTA 4DUYF 4UUXA 3TZYA 2ZHOA 4DTSA 2ZD1A 3G0ZA 2WBMA 3PKYA 3NF8A 2W9BB 1D09B 1WTBA 1B0XA 1FRLA 1MROA 2C3UA 3N6LA 5IT0A 1GLCG 5AM2A 4QR1A 3V7KA 4RPXA 5DDOC 5KPTA 1WI6A 2J9DA 3K2YA 3NNAA 2QI2A 3D66A 3DM2A 2YB4A 4DV4K 5IILA 4GV9A 1LK7A 4JKEA 5ALPA 4PYAA 3SPZA 2YX1A 5IWAJ 4F26A 2E5IA 2BJ9A 3IDHA 2EG2A 3LTOA 1T05A 2OPSB 4B3SK 1P9YA 3GILA 2G8HA 1S6OA 2CWKA 3THYB 1TGOA 1NH7A 5E3PA 3ETRA 3L4PA 3OVAA 1RTHB 1JLCA 3BV8A 2RHFA 2X7IA 4B6JA 2GS8A 2JLEA 2AH5A 1CRXA 1TV6A 4WXOA 4RTFD 2K4HA 4DV5F 2BKOA 3NG8A 1MN8A 4E19A 4WQ4A 3KZBA 3AJ2A 4BR4A 2CJBA 1T9VA 1RAGB 3MK6A 2EAOA 2LA6A 3N4MB 1GMVA 2HB5A 1TVRB 3OYNA 3HT0A 2MLZA 2NZTA 3J7A1 4CLSA 5D6GA 4NLQA 3J81O 2E5SA 3VAFA 3D68A 2C2RA 3N4QA 3AVFA 1LWCA 2ASPA 4TY8A 5B7WA 3A3PB 3HDSA 2V8DA 1L3KA 3DRSB 2KG0A 4ZVUB 1WG4A 2ZJPL 2F1JA 3RSEA 1PBAA 3PMNA 5JRTA 4C3MA 1WKJA 3O4QA 1V3RA 2UXCJ 2IOHA 3CCLS 1BPDA 5FP0A 5AQPA 2HK3A 2OHFA 2NLWA 3GIRA 4X5VA 1TV9A 2ZFHA 4GXJA 4K4HA 4JK8A 3W2WB 2Z1HA 4K2JA 4CO0A 1CZBA 4LFBJ 3KUGA 5EE3A 2HQGA 4RJVA 2UV8G 5SZTA 2MGZA 4V19S 1PVPA 2OD6A 5ITHA 5AFUA 1XSLA 1EP4A 2ZOMA 1YT3A 1JCEA 2F3NA 2NS1B 4EX7A 5C2FA 3TANA 4RWTA 4NB4A 3WKDA 2ZDOA 4IO9L 2CG8A 3R6LB 5LMNK 1YITS 4CBXA 3HHDA 1EKRA 3ZNUA 2MXYA 3PW0A 1DTQB 5J0RA 3JPQA 3W8PA 3WX8A 4EI2A 3VGVA 3HSDA 5FRMA 1DAXA 4M04A 3H8MA 4CLKA 1UAWA 2HOEA 2CKWA 2DHAA 3TUPA 1OIAA 3I6PA 4M9JA 2BPFA 4BC5A 4ANDA 3OTOF 4F0KA 1XTZA 3K59A 2AYMA 3UNGC 2KT5A 1ZPVA 2RDIA 5DM7L 4Y6IA 3F2BA 1V4TA 4P0QB 1VMBA 1W2BR 5C0YA 4F5NA 1F2GA 4Y2PA 2YTUA 5D0HA 3MX2A 3J7AP 1ZTTA 2QA2A 3DCAA 5D46A 3HJEA 4CH0S 4CT8A 1RKJA 2J6SA 2NRZA 3PMLA 2CNOB 3M3ZA 4E1NA 2VD3A 2KP7A 2DGSA 2RS8A 2LSNA 2ZWPA 5F0UA 4KO0B 2Q1NA 4Y2JA 3V7LA 4I2BA 5BN8A 1SXDA 2O8BB 2OPRA 2JC0A 3ZX2A 3EUNA 3LZIA 4OYWA 1XIQA 1K5OA 3CPWR 1Y7PA 1I94J 3VOVA 3UPFA 1PC4A 3CC7S 2I7NA 5AHXA 1GLLO 3S6JA 3NL0A 4EK2A 4QWDA 4DV2K 3CERA 4I27A 3PX6A 4K5RA 1VHIA 5C12A 4FJLA 2H9ZA 5BYRA 3HKZD 1OH8A 1RT7A 3A3NB 2FLOA 3KLIB 3HFVA 4CEQA 2F40A 3WHIA 1R0AB 3D6TB 5ETQA 2ZIXB 3NMAA 2V9WA 1GOAA 2PN6A 2L08A 1U24A 2I5JB 3M30B 4NRUA 4LFAK 7ICFA 5IWAF 1VLBA 1LW2B 2QB0B 3NGZA 3HVWA 1YJVA 1ZZFA 4ED7A 8ICZA 3NRWA 4CTAA 3HHLA 3P4IA 2K2PA 3C0BA 2UU9K 4HWIA 1XMBA 3V4MA 4M6WB 4DUYK 4ZVTB 2H3EB 2X1AA 4US9A 5ELZA 4FO6A 2W55A 3MI7X 3QRRA 4QR0A 2UXBF 2WVFA 5E3QA 1SC3B 1M5PC 1H7WA 2HF3A 4H5TA 3NBPA 3HSTB 3U9ZA 1U6FA 4PXEA 2WZ1A 1KQSR 4N76A 2Z57B 1N36F 1Y11A 4GLXA 4YMNA 4DOBA 3BH6B 2HBMA 2DISA 3JS9A 2CADA 3NGUA 4B3TJ 3H8YA 2N3OA 1AFIA 3WC0A 1T3OA 5SUHA 1ZA2B 4CLWA 4X4QA 4USTA 2UVVA 4ZMMA 2HIYA 2KLAA 2DGVA 3MEEA 5A8RA 3CM5A 3I82A 2HBRB 2BCRA 1SVDA 1AFJA 2GMJA 3N01A 4KMOB 5J0OA 3SD7A 3IR5B 3SXLA 4CIEA 2G1HA 2JSXA 2ZH1A 3VAJA 2I5HA 2FHOB 1V5IB 3C23A 4IG0B 1P90A 3MM5A 1LWFA 3KFUF 4LF7F 1BPZA 3FZMA 1S57A 2VDHA 3IRXA 3QYPA 1FRMA 4DO9A 3QIPB 4GY2B 1YBTA 3AA3A 3ZSOA 1M1GA 2ES6A 1VQSA 3R3LA 4F91B 1MWYA 4KAIA 3RBZA 5AI6A 3C6UA 1S59A 4X64J 2YWEA 4OO1J 2E2NA 5DLGA 2P9UB 1HJOA 2C2KB 4KY3A 2KJ8A 1FE0A 3H45C 4O8KA 4L76A 3OFGA 2UXCK 3OYDA 2LM1A 5HQ8A 3MCNA 1RABB 4PXDA 3G25A 3WK6A 3AVNA 2NRVA 1HUZA 4B1XB 1S9GB 3K8WA 1PK3A 4LUBA 2EFPA 1RBRA 2IVFB 1H1VA 1VRQC 5KI6A 1O13A 4HTLA 1IV8A 4CCHA 5DG9A 2E3TA 5JLFA 1RADB 5C7PA 3FCWA 2G2YA 4RUHA 3MTJA 3O9UA 4CF3A 1UPHA 3PR5B 4HL9A 3CTRA 3VHQA 3GP9A 2ISPA 1L3SA 2F2AB 1C1CB 1EHWA 3AHPA 4OIXA 2YQ3A 3I5AA 1KAZA 3DDIA 1Q0NA 1T7PA