4DSEA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dseA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dseA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dseA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dseA01
2MAXA 2GBZA 2E6MA 2AU0A 4KLDA 4F5NA 3C1ZA 3MAQA 4AH9A 2XO7A 3PX4A 9ICXA 5J2QA 3HWTA 1C1CA 3VA0A 3SPYA 5DK5A 3DLKA 3EW9A 2JLEA 5KFEA 3C2KA 4NCAA 3LAKA 4B3OA 3GQCA 3LAMA 2D0AA 1ZQYA 3SUQA 1JIHA 5IILA 3PX0A 4PHPA 1TAQA 4DL4A 3QERA 4FLWA 4I29A 3O3HA 2ASDA 1T03A 4AHSA 4E1NA 4MFAA 3T5JA 3CG7A 4KMUA 3AA4A 4B9TA 4QZ8A 3MDAA 4P4MA 4OPKA 4RUCA 1KFTA 2BR0A 2P51A 3RRGA 1HUOA 1NK0A 1C0MA 3F73A 5KFBA 4MFCA 1SL1A 1BPZA 3NHGA 3NF8A 4OLAA 4F92B 4CJ3A 5SZTA 4KLUA 3QEXA 1YT3A 1XWLA 1F21A 3KLGA 1I39A 2JEJA 4ELVA 1D9FA 4KRFA 2BQUA 4YP3A 3LZIA 3RMDA 3MR5A 2GV9A 1B43A 3K4GA 3JPRA 4JLHA 1ZQOA 4O3OA 3JPSA 1XSLA 2A1JB 3OYLA 2MUTB 3SUNA 1LAWA 4DS5A 5KRTA 4DTJA 5J2CA 1NK8A 4W5NA 3L2RA 4Q44A 2LSNA 2YHAA 3ZT2A 5T7BA 3O4QA 3H4BA 2I9GA 2FPMA 7ICFA 2R8KA 2Z1GA 4CERA 4O3NA 3BQ2A 4JWMA 1FXXA 1LWCA 2DFEA 4ECQA 3KK2A 1ASWA 5KT6A 5L9XA 3ZDDA 2ZJ5A 1ZQEA 2UVUA 1KFDA 3M8SA 3G10A 4J9LA 1D5AA 4OKKA 1ZQRA 2VA2A 4YXMA 2RF2A 4ZTJA 2FLNA 4ELUA 3WNEA 4ID5A 4E7IA 4DFPA 4J9RA 4YVZA 1NKBA 3OYGA 3MFHA 5DGAA 3UQ0A 4ECSA 4LH4A 4O4GA 3Q8PB 4ED0A 4GLXA 3OGUA 1VSFA 3N4MB 3KLFA 9ICGA 4ELTA 5KRSA 1BCMA 4G1QA 1RBVA 3V1RA 1Q9XA 5DGBA 4N47A 1X2IA 2YNHA 4ED3A 1L3VA 1CZ9A 4Z6CA 4R63A 3RJGA 3SV4A 3C2MA 2A1JA 1S6QA 1UT8A 4RQ6A 1WCLA 4DSEA 1C6VA 4KTZA 4CEEA 3UXPA 1Z3EB 3PR4A 3KHLA 4QZ9A 4F5QA 2IC3A 4H8KA 4BGDA 4M47A 5J0SA 3AO3A 1ZJNA 2ZQBA 5I3UA 2RPIA 5HRNA 3L2VA 2HHUA 3PUFA 1JX4A 4QAGA 1MQ2A 1NK9A 2HNDA 4CHYA 3DI6A 3SQ4A 4FM1A 3ZSXA 3UPQA 3EZ5A 3AA3A 2V9WA 1XHZA 4I7FA 9ICLA 3RMAA 3THVA 1NK6A 2WONA 4FJXA 4Y1CA 4M04A 4IDKA 4OLBA 1LW2A 3HPGA 4I9QA 3QEBZ 2OWOA 1KEJA 4FJHA 3M9MB 1HNIA 4RQ2A 3SPZA 2G8IA 2OPRA 5DLFA 3PW5A 2QK9A 8ICPA 9ICPA 4O3SA 4FJKA 4CJPA 3LZJA 4QZCA 3ZDBA 3HW8A 1DTQA 1CEZA 3ZT4A 4F5PA 4CGIA 2XGPA 4Q8FA 5KI6A 7ICNA 2BCQA 3RAQA 3LPTA 4I2PA 4TUQA 3VQ4A 9ICAA 1K6YA 4M9HA 4CK1A 5IIKA 3UIQA 3EY1A 5KG7A 2A1SA 1IKVA 4K8XA 4Z4EA 1U48A 3DOLA 4BE1A 2VANA 3KKRA 4Z6FA 4F4YA 2HHSA 3PO5A 1IKYA 1RT2A 1RBSA 1DGSA 1ASUA 2P1JA 4I2IA 8ICRA 3NBPA 3QLHA 3KTQA 4CHPA 3RH5A 7ICMA 3DM2A 2BGGA 3BQ1A 4F5OA 2HHTA 1IKXA 2AJQA 5J0RA 4QWEA 4LVSA 4AHRA 4M3UA 4J9OA 1Z00A 2HNYA 1HPZA 2E6LA 2G8FA 4QWAA 4CGFA 2EX3A 3JPQA 4OGEA 4LSNA 2X74A 2BHNA 2JEIA 2KZZA 3KK3A 1QQCA 1NJZA 3LP1A 2P5OA 4KO0A 3AO2A 1TFRA 1ZQIA 4FM0A 1BCOA 4C8OA 4CJUA 5CJ7A 4YMMA 1BPXA 5J0UA 5J2IA 4EP5A 5J0OA 2ALZA 4CGGA 5DB6A 3AVFA 1X9SA 4BE2A 4F91B 4ECXA 1EXQA 4DQPA 3HP9A 4NLNA 3NGYA 3MEEA 3OYKA 4CK2A 4JUZA 1WLJA 3HPOA 4ZHRA 9ICHA 5J0TA 2Z1IA 5KT5A 4JRPA 1A5XA 4DOCA 2D0CA 2ZUBA 3MDCA 3QEIA 2XRIA 1JLQA 2AGPA 4B9VA 3LDSA 2PY5A 7ICPA 3AA5X 1RTDA 3OYHA 9ICBA 3H7IA 1FKOA 2E4LA 4DEZA 3UQ2A 5KG3A 3AVLA 4FJJA 4DQRA 4AHCA 4OGCA 2UVVA 1ZQBA 4Q8EA 4L8RB 9ICVA 1IM4A 4KKOA 4GXIA 4Z4CA 3IG1A 5BPCA 3DLBA 2ISOA 2C22A 4IG0A 2W9MA 3RR7A 1S1WA 5DQIA 4KB1A 1BVSA 5J0QA 3HXMA 4TQSA 1SL0A 4CJEA 4BDPA 2W42A 3RMCA 4DQSA 2B6AA 1BISA 3TAGA 3SNNA 3OYFA 4ECTA 1TVAA 3LALA 2FBXA 3ZCMA 3Q8MA 2I1QA 3T3FA 2IAJA 4CF8A 1S0MA 3ZDCA 4YNQA 4DTPA 3PMNA 4M9GA 5DB8A 3NAEA 4CE9A 3OYDA 4PY5A 2HHXA 4F4WA 2J6SA 1NOMA 5EWEA 4DOBA 2ZTCA 5DDMA 4R65A 2FBYA 5CB1A 4CIGA 5IIJA 8ICUA 4ZH4A 3DRPA 4O9MA 1VSJA 4KN7A 4QWCA 3BQTA 4YQWA 3H8JA 2AGQA 3G6YA 2MUTA 4NXZA 4LZGA 3MXMA 4KHYA 3TAEA 4FZXC 2AGOA 4YR2A 3LANA 3CQ8A 5J2MA 5KFMA 1ZQJA 3V7LA 1RBTA 3NGIA 4F3TA 4DF4A 2JZBA 2BCVA 3M8PA 4PPXA 1DTTA 3F9KA 2IBKA 4R5PA 1RDDA 2JGUA 2OZMA 4FLYA 2OA8A 4PA1A 2W9CA 1BGXT 4ECYA 4I2DA 1B9DA 2PI5A 4BDYA 4CF0A 5BOMA 2BCRA 7ICLA 4C8KA 4KLJA 3K58A 4O5CA 1KVCA 5IIMA 4I2FA 4K4IA 5HHIA 3Q8SB 5D46A 3KHHA 1T7PA 3EYZA 4B08A 4ED1A 4E3SA 7ICOA 2VWJA 4DU4A 3AUOA 3AVCA 3PR5B 4WE1A 3O3FA 3NF7A 4EBDA 4HCBA 1ITGA 3CM5A 3MXIA 3ISBA 9ICCA 1N6QA 5EOZA 4DG1A 2FPLA 4E7KA 1TV9A 3H8SA 4J9NA 1U47A 1CXUA 5KFCA 1QLNA 1S6PA 4DL3A 4BACA 1WSHA 3JSMA 4B9NA 4I28A 1S0VA 3NTUA 4JK1A 4NCGA 4GC6A 4KLOA 4DTUA 1VSMA 1MU2A 2HHVA 1ZETA 3IM1A 3OYNA 4E7JA 5C25A 1RT7A 4DTRA 4O3QA 1RYRA 1N5YA 4BDZA 1TKTA 1VSKA 1TL1A 4CEBA 5CR0A 5DQHA 1HQUA 2F1HA 1W9HA 3NE6A 5HMLA 4F5RA 4W5QA 3PW4A 4UQGA 1NJYA 2A1RA 1NOZA 3D0PA 1VSIA 4PWDA 3TANA 4RNNA 4DL6A 3MFIA 5D3GA 2ASLA 4O44A 4ECZA 3I0RA 1D9DA 3QO9A 2Q3SA 4KAZA 5DG7A 7ICRA 4KHUA 3EPGA 4DS4A 3M9NB 5J29A 4I2AA 1WAFA 3Q8KA 1ZQAA 3P5JA 5KT7A 1RT1A 4EYHB 1BPBA 4OVLA 8ICTA 5CWRA 8ICKA 3Q8RB 3O4NA 1CUKA 4RQ7A 3V6DA 3S9HA 5J2NA 3HP6A 1HYVA 1GOBA 4O3RA 4FJ7A 3C5FA 5J2PA 1EP4A 4CECA 1ZBUA 3UXOA 4YMNA 4KV8A 1S1UA 1ZQCA 4Z4HA 5CYMA 5J2BA 3C6UA 4QZHA 2FC0A 3T5LA 5KFNA 3OVNA 2P6RA 9ICEA 2EHGA 2BGWA 3T5KA 4N41A 4DL7A 2KFNA 3CFPA 5KFOA 4RW8A 2YKMA 3V72A 1KTQA 5KFVA 3OJSA 4CFDA 5KT2A 3OJUA 4DSJA 4FO6A 3H4DA 1QTMA 2R7YA 3O3GA 2QXFA 2DPIA 5SWMA 2GUIA 3AVGA 9ICMA 1A76A 4CJFA 1LV5A 4KLGA 4NCBA 5HRPA 4RQ1A 4PUOA 1SZPA 3C23A 1CZBA 4E7HA 3MABA 1WSEA 4GC7A 4NM1A 4ECVA 3QINA 3DYAA 4I2GA 1VSEA 9ICTA 1RTJA 2ZE2A 4MEXA 3LWLA 1L5UA 9ICFA 2I5JA 1LWEA 3QETA 3VQ7A 3VQBA 2W9BB 4Y1DA 3WNGA 4FM2A 4ZTFA 3IS9A 3KD1E 3AVMA 3AVJA 4RG8A 2Y1JA 3T1AA 3BQ0A 4DFJA 4KLMA 2VG7A 3VQDA 4KHQA 4EYIB 5TZVA 4QOZB 4Z6DA 3C1YA 1QSYA 2ITGA 1J5OA 4N5SA 8ICEA 4N76A 4CHZA 2B4JA 4CCHA 3NFAA 4C8LA 3M9OB 4IRKA 4QZGA 2P6UA 1SKWA 5J2GA 1X9WA 1HNVA 5DDYA 1HRHA 3MGIA 5E41A 1XI1A 8ICXA 2RDJA 3NGZA 4YR3A 4DLGA 4RW6A 4CEZA 4DSLA 4FXDA 2DPJA 1WAJA 1L3UA 4YD1A 5HP1A 3LDAA 3ZD9A 3ULDA 3S3MA 2X6NA 5KG4A 4DQQA 5DB9A 4F93B 1WCNA 4DTXA 3DMJA 1C7YA 4UBBA 4UBCA 4O55A 3DLEA 3TARA 1L3SA 4DU1A 2BQRA 2VA3A 3RB6A 1RT3A 3K5OA 4ICLA 4J2BA 4OPJA 2YV0X 2VA8A 2C2EA 5FRNA 4XQ8A 4DL5A 3RB3A 1S10A 4AILC 3QZ8A 5KT4A 1ZBLA 4CGDA 4RW7A 5KFGA 1C1BA 5KFTA 8ICVA 3KLHA 5J0YA 5KFKA 3OYJA 4PQUA 3B6OA 1VSHA 3C5GA 3TFRA 4O5BA 3PW7A 3EPIA 1I3AA 2XY8A 4F4KA 1TK5A 4YG2A 4DOAA 3QIPA 1QS4A 4CHNA 4EBCA 4RU9A 3LP2A 2P66A 1WSIA 2YKNA 1RT4A 1UA1A 1BPYA 4DFMA 1DLOA 1WSJA 5EU7A 1J53A 3AO4A 4DF8A 2BPGA 4KLFA 4P4PA 2FMSA 1W0HA 5L1LA 3RJJA 4ECUA 4H4OA 1B9FA 5IIIA 4KHWA 3HVRA 4GVMA 4B9UA 4UB4A 5KFFA 3SCXA 4FBUA 5FDLA 5CP2A 4Z4GA 1NKCA 4M3RA 1ZQSA 4I2EA 3M8RA 3GILA 3TR8A 3E2EA 3V1QA 3RMBA 4R8UB 4FVMA 2ZTEA 3H08A 3PX6A 2G8HA 1BQNA 4RW4A 4M3ZA 2DY4A 3V7KA 4RT2A 3SV3A 1ZQZA 3V1OA 1S76D 3K5MA 3V9UA 4DLEA 2ATQA 5HP4A 4HUGA 4RZRA 4RT3A 2QKKA 4DFKA 5KFYA 3FDSA 3LPUA 4MF2A 4M9LA 4F2SA 1ZQMA 5F9LA 1KLNA 3PNCA 9ICNA 1HJPA 3SYZA 5J2HA 1BPDA 1NK5A 1ZQDA 1JKHA 1C0TA 2F8TA 7ICQA 1RBRA 3AVNA 2J6TA 1WSGA 5J2AA 4RQ8A 2XGQA 4KPYA 4HUFA 2HMIA 4BXOB 1JN3A 5C42A 1SKRA 4KTWA 3MR6A 3GDXA 4PHAA 1HJRA 3OYAA 4NY8A 3WNFA 1YVUA 5DQGA 2G8UA 1IKWA 1BHLA 4DU3A 3AO1A 4P4OA 3SQ2A 4UAZA 4FJMA 4R66A 4B9SA 3AVAA 4M3WA 3ISNC 1X1PA 1VSDA 9ICRA 1S97A 5DKWA 3VQ5A 4B9LA 4TSXA 3OYBA 1JLGA 1KRPA 5L1JA 4NLGA 4KN4A 8ICIA 2WTFA 2O4IA 4FJ8A 4GXJA 4M6WB 2ISPA 4RQ4A 4XRHA 4CJKA 4QZIA 3DLHA 2GWSA 1J54A 3BGRA 3OSNA 3ALYA 3TAPA 3QNOA 4TUPA 4ED8A 9ICWA 7ICKA 2B5JA 1NOYA 3OHAA 1XSPA 4UB5A 4FJNA 3MEGA 2HB5A 4GW6A 5HMMA 1IH7A 4CJSA 4M9JA 4M3TA 3L2QA 1LWFA 8ICMA 3PVXA 2OZSA 8ICLA 4B8AB 4KLHA 3QE9Y 1S9EA 2XY6A 4N56A 5EWFA 3VN5A 7ICSA 2IOCA 3QESA 5DBCA 4UB2A 2FLLA 1RXVA 3RJHA 2V4QA 2H5XA 4MFFA 4KITB 3ISDA 1RXWA 4FJGA 1S0OA 3PW2A 3FFIA 3PY8A 3T19A 1BL3A 2XCAA 3TQ1A 1RT5A 1C0UA 1RDAA 3KIOA 1A77A 4IRDA 3L8BA 4R8UA 1R0AA 2PXIA 4DSKA 1WN7A 4C8NA 2IS3A 4DTMA 3AU6A 1RDBA 1QE1A 4G3IA 1TKXA 2FPKA 5IIOA 1S0NA 1S9GA 3UXNA 1ZQLA 1VK0A 3NF6A 2R8JA 1JLAA 1JXEA 5CZ2A 3N97B 4EZ6A 4EZ9A 4YFUA 1SKSA 4NM2A 1AROP 4KHNA 1UA0A 1S1XA 3ZSYA 1K1QA 2PYJA 1JLEA 3C2LA 2BCUA 4M42A 4CJRA 3BJYA 1G15A 4M45A 9ICQA 2NUBA 1WSFA 3SUOA 3HO1A 4LD0A 2KQ2A 4KB0A 1JXBA 1UT5A 4J9PA 3E01A 1KDHA 1REVA 2W9CB 3V6KA 4I27A 5JS2A 4FCYA 2PFOA 4DO9A 4FZZA 1D8YA 3HL8A 1VRUA 3V6HA 5CA7A 3JPTA 5KFUA 1U4BA 3KHRA 5D49A 2G8KA 5DG9A 2YNIA 4QZDA 3PMLA 4PHDA 5DLGA 3VQ9A 9ICIA 2ETJA 4UAWA 1XSNA 3ZSRA 2KW4A 4FBTA 4IG3A 3TAQA 2V4RA 1RZTA 7ICVA 1TK0A 2NRZA 4RPYA 2IHNA 4KLEA 3S3NA 3AVBA 3CM6A 2XY5A 4EEYA 2XC9A 4DTOA 3B6PA 4KLSA 4YFKA 3CFOA 3HYFA 3V81A 2FMPA 4DSFA 3DLGA 5BOLA 4RNOA 2PFNA 4HUEA 2ZUDA 3DRSA 1FK9A 3PW0A 1TL3A 4GMJB 5I42A 3SZ2A 3U3YA 4I9LA 2YHBA 2W8KA 5C24A 8ICCA 2BE2A 5KTQA 4QW9A 4CJWA 3QNNA 1BIZA 5CY4A 5DB7A 4F50A 1ZQQA 5KFZA 4BWMA 1XC9A 2PYLA 3Q8QB 2XCPA 1UWBA 2JEFA 8ICSA 4IRCA 1JL1A 2ZJ8A 4NYFA 4CEDA 2F1JA 1LAVA 5KFDA 2F1IA 1B92A 4Z0UA 4RNMA 4PGYA 2KN7A 4CJ5A 4JRQA 4HVJA 4E7LA 3JPNA 3DOKA 1BPEA 1LW0A 3JPPA 1S9FA 3ZT0A 2ATLA 1UOCA 8ICNA 3TAMA 4QCLA 4ED7A 4DQIA 4AHTA 4CEFA 3K75D 4CIEA 5KG2A 8ICGA 3ZSZA 3AU2A 5KFHA 2XY7A 3GFKB 2YNFA 1KSPA 7ICGA 2W9AA 4IQTA 2Z1JA 3SQ1A 1T05A 4Z6EA 1NJWA 2ZTDA 4FJ9A 4FLZA 1MC8A 1HYZA 5KFIA 4DTSA 4FK4A 3S3OA 4CEQA 1ZBFA 3ZSQA 4EBEA 3IHQB 4J9MA 3QIOA 1ZBHA 2BKEA 1NK7A 4AHUA 3K59A 4M3XA 1JLCA 1S77D 1RT6A 4W5OA 4DWIA 3ZSOA 1L3TA 3IAYA 3AVIA 4KFBA 2OPQA 4IR9A 1Z25A 2PFQA 3JPOA 1FKPA 5KFRA 4HYKA 1H38A 1YTAA 7ICJA 3V9ZA 1GOAA 4BXOA 4FJ5A 4JS4A 3K5NA 4QZEA 3DLRA 2DTUA 1WNSA 4KLQA 2IHMA 4FW1A 4CJVA 1O1WA 1LB2B 3K57A 2M9NA 2YNGA 4I2HA 3V9XA 2OPPA 3C94A 3RBEA 1XO1A 5J2DA 1QSSA 4W5TA 9ICOA 3L2WA 4KLIA 3RAXA 4CF9A 3NCIA 2BCSA 4JV2A 1HYSA 4JV0A 2HVHA 4KLTA 1KCFA 4Q43A 2C2DA 1ZQGA 4QW8A 5KFWA 3RWUA 2RDIA 2W9BA 2HHWA 3K2PA 1ZQFA 2RKIA 8ICOA 1EXNA 4K4GA 3OS0A 3V4IA 3OY9A 2R8HA 3B0XA 4F4ZA 5FROA 1ZQXA 1HMVA 1RTIA 4XIUA 1MSWD 1EX4A 2BANA 4FK0A 1J9AA 3P83D 1TVRA 4ED6A 1JL2A 1Z26A 3C95A 4H4MA 3RBDA 9ICUA 4KREA 1U9LA 4QZBA 5IINA 1EETA 4QZAA 3T5HA 3WNHA 1ASVA 4RUAA 4CEAA 2QKBA 4CHQA 4GXKA 4PH5A 5CZ1A 1KLMA 5KG0A 3ETLA 2B21A 2D5RA 3KK1A 1ZQTA 3AO5A 4CF2A 5JS1A 1ZQHA 3L3UA 3RB4A 4CFBA 3ASMA 3ISCA 7ICIA 2IA6A 4F4XA 5D4BA 2HHQA 5EWGA 1T3NA 3CFRA 4Z4FA 4TURA 4Q0BA 4DMNA 2BPCA 5HHHA 1XS9D 3FYHA 4KI4A 1BQMA 4MQ3A 3GV7B 1NK4A 1N56A 2HNZA 3JYTA 1PZNA 4CGJA 2D0BA 3HT3A 3U6FA 2P5GA 5CYQA 3KKSA 7ICUA 3ZT1A 4MF8A 5KT3A 5J0PA 4J9KA 3Q8LA 4Q5VA 5J0XA 2NRTA 4I2JA 1A5VA 1ZQPA 1Z00B 2J6UA 7ICHA 3VQ6A 4UB1A 1TGOA 1Q8IA 2FLPA 3ZDEA 4IFYA 5DMRA 4O5EA 4P2HA 5KGWA 3SJJA 1C1AA 4CJLA 4FLVA 1A5WA 4CGHA 2O4GA 3RH6A 5KFJA 3OHBA 4KLLA 8ICHA 3SUPA 4F8RA 4IKFA 3KLIA 4IQVA 2ASJA 2IGIA 4K8ZA 4O0IA 4CIFA 3RJKA 2R8GA 3RJFA 3VQAA 3NDKA 1S1TA 3SI8A 3ZT3A 4CEOA 3LWMA 1JLFA 2FBTA 1KFSA 5HRSA 2C2RA 3D45A 4IBNA 2Z1HA 4UAYA 1T8EA 4PGXA 2JEGA 3RTVA 2VG6A 1QSLA 1KVBA 3LP0A 3CYMA 2WOMA 4FJLA 2ZUCA 3TI0A 2KZMA 3AVHA 1BI4B 4E89A 4FZYA 3I8DA 4CF1A 3U3GA 3KD5E 1HQEA 3GV5B 4O3PA 3ORYA 3NH2A 5HROA 3PV8A 2C28A 1T4GA 2FMQA 3TAFA 5DG8A 4LSLA 4FLUA 4HTUA 3L3VA 1ZJMA 4QWDA 3OS1A 2Q0ZX 3RR8A 1U04A 4FLXA 5J2JA 1ZBIA 1ZYQA 4M0AA 3KHGA 4KHSA 1TKDA 1NJXA 3DRRA 3VQ8A 4CFCA 1TKZA 4DTNA 3TABA 1S1VA 3GIMA 3SI6A 4B8CA 1IG9A 3VQPA 4YD2A 3MBYA 1JXLA 2DFLA 2ZJAA 3TWHA 5L1KA 1SV5A 4FS1A 4M41A 3NH1A 7ICEA 1Q9YA 4YMOA 2G8WA 4J9SA 2HW3A 2F96A 5JUMA 4LZDA 4FK2A 3NH0A 4IQWA 4Q45A 2NRWA 4M9NA 1HUZA 1K1SA 4TUSA 3SQ0A 5DBAA 4CJ4A 3QEAZ 1TV6A 2BDPA 4LY7A 3RB0A 2LYHA 3G6VA 4K4HA 3G0ZA 4DL2A 4I2BA 2XHBA 5DBBA 1U45A 3PO4A 5HLFA 4O5KA 2X6SA 5HRRA 3QEVA 4CHOA 3M8QA 8ICWA 3KJVA 5K14A 3OYMA 4RPXA 4RQ3A 4ECRA 5C5JA 2VWKA 3RRHA 1CXQA 4RQ0A 4NYNA 3ZDAA 3ZSVA 4CK3A 4HHTA 4J2DA 2Y1IA 3ITHA 3HM9A 1TAUA 4I2CA 1BIUA 4E0DA 4IQUA 3A2FA 3VQQA 5J2EA 3GIIA 4PGQA 3RJEA 4PHEA 3VQCA 4CJQA 3RJIA 2BPFA 1CLQA 5CHGA 2OPSA 4UB3A 1ZQVA 3MEDA 1ZQKA 2IMWP 3HSTB 3GIJA 3TFSA 2FBVA 3H8WA 1TK8A 3LP3A 3BDPA 1D8LA 4DSIA 2JZBB 1KVAA 4AHVA 7ICTA 4LH5A 4YR0A 1IO2A 4FJIA 4M6WA 3V6JA 5HNKA 1RILA 4R64A 1YTUA 1RBUA 3GIKA 3V9WA 1JLBA 4YXJA 4FW2A 4YCXA 5KG6A 1Y88A 4RW9A 4QWBA 4CESA 1X9MA 2KFZA 1EKEA 3H40A 4KTQA 5KGXA 2PZSA 4J2AA 2G8VA 2W8LA 1VSLA 1SL2A 4FLTA 4ID1A 9ICKA 5KFAA 2DFHA 4BE0A 1MQ3A 3MR2A 3K5LA 4IR1A 4E1MA 1XU4A 4OJRA 5L1IA 3QEPA 9ICJA 8ICAA 1RTHA 4F3OA 4JWNA 4NLKA 1RCHA 5HBMA 2PFPA 8ICQA 2AQ4A 4MEYA 2NRXA 4NLZA 3HPHA 1SUQA 4M3YA 4F2RA 2X78A 5J0WA 1U49A 3OSPA 2PI4A 3IRXA 8ICFA 3P1GA 4RPZA 4CFAA 4CJTA 3MGHA 1GOCA 3B0YA 1NKEA 3V7JA 3C6TA 1DOQA 2UVRA 1IXRA 2RN2A 4B9MA 1XHXA 3I0SA 4J9QA 3NF9A 4KI6A 8ICYA 2DFFA 3LK9A 1JMSA 3OYCA 4FYDA 3KLEA 2HVIA 4Z4IA 5KFPA 3MXJA 3OYIA 3QZ7A 1N48A 1BI4A 1UAXA 2KTQA 3AVKA 3C21A 3VQEA 2UVWA 5KG5A 2BQ3A 3MECA 3AA2A 4ECWA 1ZQUA 5KFQA 3EWAA 4E19A 2OYQA 3L2UA 4TQRA 4BWJA 2F8SA 1B22A 8ICJA 3OYEA 2VG5A 4M2YA 4C8MA 1VRTA 4MFBA 4HCCA 1V9PA 3HVTA 4IFVA 5KFLA 5J1EA 3HJFA 3AV9A 4JV1A 1COOA 3HK2A 2R8IA 5J2FA 3G6XA 2KZ3A 4YN4A 2NRVA 3RH4A 3NGDA 9ICSA 4W5RA 1S5JA 4XA5A 1ZQWA 4OKEA 1QHTA 4J2EA 1RPLA 1RYSA 4RQ5A 4ED2A 8ICZA 3HX0A 4OKJA 3VA3A 5J2KA 2ZD1A 3GV8B 4I2QA 3ZSWA 1RDCA 2AQ0A 3OS2A 4JS5A 3MR3A 5FRMA 1RNHA 4XUSA 5KFXA 4QZFA 4FS2A 4X5VA 1Y97A 3V9SA 5KFSA 8ICBA 5KG1A 1ZQNA 2IDOA 5F9NA 3QEWA 4EP4A 4O0JA 3ZD8A
chains in the Genus database with same CATH superfamily
3AB2B 2AU0A 4F5NA 3MAQA 3HWTA 4DR6F 4X4PA 5DK5A 3DLKA 2JLEA 3DXMB 1VQKS 4QPXA 5KFEA 4CD1A 1JJ2R 3Q2TC 4JI3F 4NCAA 4H5RA 4B3OA 3LAMA 3SUQA 3QSYB 1R3NA 2ZIVB 5IILA 4PHPA 2ZH8A 2VUGA 4FLWA 5HO4A 4LFAF 3O3HA 2ASDA 4FZLA 4MFAA 3T5JA 2HFSA 3AA4A 3MOZA 4P4MA 3NGTA 4RUCA 1UPPA 1YJ9S 2BR0A 2R2SA 1HUOA 3LVWA 3F73A 1TUVA 5KFBA 1Q5YA 2QL9B 4DV2J 3IP0A 1JXVA 3JTOA 5SZTA 1SIZA 1WWHA 3QEXA 1R8AA 1YT3A 1W2IA 2Y1RI 5ALNA 2RS8A 1QUVA 1SS6A 3EGZA 1B64A 2BQUA 1EKSA 4YP3A 3LZIA 4IO9Q 3AN1A 3N6MA 4H0TB 1YK9A 3MM5A 4RW9B 2L9NA 3EZUA 3JPSA 1BG3A 1SUQB 4RWWA 4LREA 1S6QB 3OYLA 2WAQD 4DS5A 5J2CA 1ULRA 4W5NA 1UVKA 3H4BA 2D8CA 3OTCA 7ICFA 4K25A 4O3NA 2ACYA 2IFXA 2C3MA 2PBDA 4JWMA 1KNZA 1FXXA 4ECQA 2P9UA 5KT6A 1F3FA 2MQPA 4DQ8A 1ZQEA 1MA9B 2QYGA 4DV0K 4OKKA 4ALZA 3BZCA 3GL1A 2LU1A 2VA2A 4AFFA 2RF2A 3D54A 4KH1B 5CHCB 3RGIA 2YWFA 3WNEA 2PE8A 1RT3B 3CCMS 4DR3K 4DFPA 5A6PA 2ZNZA 2C2OB 5J8YC 4LH4A 5B0EA 4ELTA 2G09A 4A4JA 1XMOK 1PYTA 1BUPA 1RBVA 3V1RA 4DHYA 5DGBA 4N47A 2LMIA 4KHPJ 1Y9OA 4WFAL 3ATVA 3ET6B 4CF3A 4ED3A 1CJVA 3RJGA 4XPEA 4B3MF 3SV4A 3ZZYA 2E7VA 4DR6J 1UT8A 2J5AA 1V85A 1YLXA 5DM7L 1VRQC 1S1UB 3PR4A 4F5QA 4BGDA 5AQJA 5J0SA 2ZQBA 1A7GE 2ZDOA 2F2AB 1Z2ZA 5K5MA 2GCFA 3QWPA 2HHUA 2FSKA 5A2QU 4I6MA 4CHYA 2D7SA 4FM1A 3JAMY 1GXTA 4NLRA 3EZ5A 2Z58B 2VC1A 4Y00A 2E2QA 4I7FA 1K73T 1QE1B 3NMAA 2IIHA 1RAFB 2H5JB 2WONA 4ZITA 4Y1CA 2CG4A 4WBFA 3I0RB 3HPGA 2HBQB 1X0PA 3VEYA 4KGZB 1CS4B 1M90T 2CNLB 2KKHA 2CQPA 4WYWA 3P5BP 3EN9A 3UFCX 2RB7A 4PKGA 2IM1A 2H9ZA 1YUWA 4FJKA 4CJPA 3NL0A 4C3KA 3G8SA 2MY8A 4F5PA 3QFUA 3QGHA 2MHEA 4MN4C 2XGPA 1OY9A 3QT5A 4PXBA 1N8RT 4Q8FA 7ICNA 2DHSA 1Z05A 2OTJN 2D3DA 2D3O1 3KFUF 3U4LA 4CK1A 4NXNK 4WU2A 3PEJA 4IEIA 2MZSA 1D9AA 5KG7A 1IKVA 2E9TA 1U48A 4EK2A 1KD1T 4Z6FA 2HHSA 3PO5A 2WBNA 3C28A 3TEHB 1RBSA 1VMBA 3VQTA 2OLWA 2K60A 2XWYA 4FWSA 1KR4A 4EGLA 3RH5A 3ILLA 7ICMA 5AQIA 3BQ1A 2Y3YA 4F5OA 5GAEI 1MW7A 4N8OA 2DJWA 2KDOA 5TKWA 3BO2A 3TNVA 4LVSA 4LBHA 4BBYA 1HNXJ 3E1YA 2HNYA 2IRXA 2M9KA 5AQSA 1T9VA 2E6LA 2FPHX 4CM2A 1VIOA 5ETSA 2F77X 2UXBF 1RADB 1LQ9A 3KK3A 1XQIA 3MN5A 3BF4A 1QQCA 2JV3A 1DRGA 2P5OA 1ZA1B 4CH1A 3AO2A 2H4YB 3GSIA 5B0GA 2Z7JA 2F63A 4YOVA 2LVWA 1BCOA 1KXPA 4C8OA 5KPRA 3WKCA 5J2IA 4C0OC 5J0OA 1XNSA 2ALZA 2HWTA 4MK9A 5DB6A 3D6TB 3HKZF 1X9SA 1Z2LA 4BE2A 2YQ0A 3JSBA 4X4VA 3IFRA 4GVBA 1BA0A 2ZH3A 4NLNA 1EIYB 2CXEA 4ICAA 2YKPA 5D0RA 3AGRA 4A57A 1F5BA 3QRPA 4QR0A 1YBUA 2G2ZA 4B9VA 4D3GA 1QM9A 1XNRF 1KVKA 2DGQA 1RTDA 3OYHA 3A3OB 2ZBCA 4OX9J 2M52A 3H7IA 2E4LA 4DEZA 2UUCK 3UW1A 3AVLA 2IRYA 2ZVIA 4DQRA 2YI1A 2MZRA 3KWIA 2VFSA 1ZQBA 5EDWA 3R9LA 2YMPA 4TKTA 3HKZC 4L8RB 2DL0A 2W2QP 4KKOA 1NDKA 4RBVA 5JMVA 3ZO7A 3DLBA 1W7AA 2C22A 2DR6A 3NOCA 4Z37A 4JKGA 1RT5B 2YX6A 5DQIA 4H03B 5J0QA 3OXFA 4BDPA 3I82A 6AT1B 4DQSA 2RIJA 1X5TA 3TAGA 3BR8A 3G71S 3QUQA 3HI0A 4ZCLA 1F9EB 4ECTA 1NDCA 2FBXA 2QL5B 2B0CA 2I1QA 2ZHOA 5AQRA 3T3FA 1URRA 3PM9A 1ZBSA 1S0MA 3ZDCA 4UT4A 2O66A 3MM8B 4J03A 2QO3A 4K5SA 5FLXO 3NAEA 4M5LA 3IWXA 3SJHA 4EELA 4I2PB 2J6SA 3T1HK 2YN4A 5DDMA 5D4NA 4R65A 1XMQJ 3VZHA 5CB1A 3ZTOA 3DLLL 1VISA 4B9QA 2VFUA 3DRPA 4KN7A 1KN6A 3N7PD 3BQTA 4K4SA 4YQWA 1U7LA 4OYPA 3H8JA 3QXGA 3BH6B 2DBYA 2MUTA 1IBMF 2AKWB 4NCGB 4LZGA 3TAEA 4FKXA 2MQMA 4DV6F 3MPDA 1B0TA 1YJNS 2ASPA 3V7LA 3BGOP 1FFUA 2E1AA 4DF4A 2OSQA 3NNCA 3R1LA 3M1YA 3NVWA 4JYAK 2E5IA 4FWMA 2E8NA 2BM0A 3AOAA 4YOUA 1RDDA 4F72A 4FLYA 2ZIVA 2AYGA 4PA1A 1BGXT 2IJFA 2PI5A 5ALZA 2GOLA 1X3MA 5HBMB 5ETPA 4I2FA 1VQ7N 4MAKA 1XNRJ 2CVEA 5HHIA 3NWRA 3HSCA 2JRSA 3EYZA 3QMLA 1OVYA 2ZEJA 1B7YB 4WE1A 5ALLA 1FF2A 5CABA 2J7UA 3EZWA 4Y6IA 1OS5A 2A2DA 3SDEA 1TV9A 4FN5A 2HIQA 4H5WA 4ES2A 1CXUA 1YITS 4X62J 1QLNA 4L72B 4DL3A 2Y1LB 2QTWA 4KGXB 3GG1A 4B9NA 3NTUA 2HGNA 4GC6A 1FWKA 1VSMA 5AQUA 3OYNA 4E7JA 1MMDA 3UO0A 1RYRA 4P7TA 2IRUA 1RG6A 4OI0A 2P9NB 2CA9A 5CR0A 3IAM9 2ACMA 2LA6A 1W9HA 4K5RA 4LF7K 5HMLA 4F5RA 3N01A 4W5QA 1RLDA 1NOZA 2Q3PA 2LXFA 1WWUA 4PWDA 5U47A 3GCWP 2LDIA 4DL6A 3MFIA 4CO3A 4PL2A 2E29A 2Z2MA 3T9NA 4ECZA 3THWA 4YB1P 3QO9A 4OYBA 2QFIA 3CJCA 3H0RB 2R3VA 2HZVA 4LFCJ 1PBUA 1VDHA 3EPGA 4DG1B 3RBZA 5J29A 4I2AA 4OJ6A 4OVLA 1Q7YT 3GZ7A 5CWRA 1AZSB 2IOHA 3Q8RB 3RBXA 2ZITA 3V6DA 5EOYA 2J9DA 1NM2A 3QGIA 3UXOA 1S1UA 3L7UA 2W55A 1ZQCA 3TEGA 2ZBIA 1RWXB 3HJEA 3C6UA 4QZHA 2FC0A 3T5LA 5KFNA 4D3HA 1Q1KA 3UN2A 2BGWA 4PG6A 2KFNA 3CFPA 5DDRC 4Y34A 1J5OB 2QA4G 3BUZB 5F8HA 2LQJA 1U2VB 3KUEA 3TRGA 2A41A 4CBWA 3P31A 4C1NK 1ZRMA 2CAJA 4B02A 4JAXA 1WG4A 5SWMA 9ICMA 3M3ZA 1A76A 5BPNA 2ZF5O 1YJWS 5DM7Q 3IR5B 4ZJOA 4E8UA 2PIIA 4ZK7M 2WVEA 1K0VA 4E2FB 3DYAA 2ZE2A 1GXLA 2EW9A 4DZDA 1LWEA 2GQQA 2LHTA 2HS0A 3BV8A 3J7AP 3WNGA 2CVIA 3BREA 3CCLS 3T1AA 4CM0A 1AUSL 2YKQA 4XH5A 3IG1B 1BY9A 5J2PB 3J7ZT 1YVNA 4QOZB 1HW9A 3NVKA 4MKVA 1V5IB 2ITGA 1OYDA 2RKIB 4A8FA 2NQPA 8ICEA 5EN1A 4C8LA 1RHMB 4MJKA 1O08A 5J2GA 5DDYA 2W01A 3MGIA 1CQMA 4UOHA 3AXKA 1NO8A 4J9UE 3RW7A 4OYXA 8ICXA 2RDJA 3NGZA 1ZPWX 4YR3A 4DR1J 3SBGA 3OXLA 4DLGA 3SR6A 3TUIC 2DNPA 4UY8T 3Q7BA 2ADBA 1Y3JA 1VJWA 2VPZB 3NG8A 2MSNA 4DTXA 2GH1A 4UBBA 4UBCA 1Y0HA 3D1QA 3K0SA 3TARA 1YJVA 1G6BA 3Q89A 4M95A 4OPJA 4EU0A 4BRLA 2ZH5A 1BU6O 5KPTA 3EE9A 4GV6A 2YHWA 3MM6B 2AA4A 2ZKTA 5FRNA 4DL5A 1Q86O 3OD2A 5G5GA 4K0KF 1RDFA 2IVOA 3CEDA 5HR7A 1HEKA 4CGDA 1SJQA 4RW7A 3CDUA 5E3PA 1RABB 5KFTA 8ICVA 1R8CA 2P5VA 3D3CJ 3CXCR 1VSHA 2QMWA 1ZD3A 3PW7A 3D0IE 1I3AA 4YG2A 3D2EB 1C0TB 5AE1A 1UHUA 4CHNA 4RU9A 3LP2A 4PL8A 2ZJRQ 1RT4A 2HDOA 3WKEA 4DFMA 2V2ZA 3BO4A 4O3MA 3A5LC 3ZZUA 3MN6A 1O8BA 5L1LA 2GC8A 2I6XA 4OLOA 4ZPWR 5F8GA 4ES3A 1JALA 1RKJA 1NGJA 4JI8K 5ALOA 1HNZJ 2UXBK 3TR5A 2P9SB 3H7HB 2FTRA 7FD1A 2PN6A 5FDLA 2FY1A 2GW8A 1NKCA 4B3SK 1UMJA 3V1QA 3E2EA 3RMBA 3GCXP 1W7WA 4R8UB 3H08A 4Z7YA 3QUBA 1BQNA 1N0UA 3V7KA 1FRMA 2R7OA 1QQOA 3K1RB 1IBLF 1IKXB 3V1OA 2YWGA 3HD1A 3B78A 2N1RA 4YY3J 4HUGA 1ECWA 1VC5A 4RZRA 2QWOA 2BE9B 1GLEG 2OEHA 2QKKA 3OTQA 2IJRA 4DFKA 5KFYA 2LM1A 3FDSA 4M9LA 2ROEA 3WDOA 5F9LA 2UXDJ 3SMZA 3PNCA 9ICNA 3ED5A 3W64A 1HJPA 3P49B 2VODA 2HCFA 1JKHA 1KQSR 5GADP 3D7EO 1DT9A 2F8TA 3MPWA 3NGKA 1H73A 3HOSA 2K8GA 4NEZA 4IOAL 4RQ8A 4BQLA 4NLUA 3DDKA 5E26A 4B3OB 3MR6A 1DURA 4OYOA 1G1XA 4PXDA 1T03B 3HLUA 3A4TA 4BRGA 4USTA 1RAHB 2ZZMA 5DQGA 2K2PA 2G8UA 2FZCB 3PACA 3WEEA 1IKWA 1HFEL 5CCMA 4P72A 5D78A 4R66A 2PMHA 3T1YK 5AM1A 4M3WA 2HWIA 2POKA 1VSDA 3R2CJ 2FY8A 3H25A 2GVDB 1XBWA 3O9UA 3VQ5A 4B9LA 4PG7A 1JLQB 2GUPA 4H5TA 3OW2M 1KRPA 4DR1F 1WUDA 5L1JA 1FKPB 4KN4A 3FE1A 2E20A 4OPAA 3J7YU 2WTFA 2GO7A 4UZBA 1U2FA 1HJOA 4JI1F 1ELOA 3BR9A 2QWPA 2ISPA 4RQ4A 2UYTA 2CPHA 5AKEA 3UKUB 4JI2F 4FZMA 4NXNJ 3GG0A 1LCUA 4LVOP 4ZVTB 2BMBA 1VK3A 2RAQA 1D3WA 1NJIT 2GWSA 4JBCA 3WX4A 1FNMA 1EETB 2HRYA 1YZ7A 3TAPA 3W2VA 4WXWA 2KHQA 4ED8A 9ICWA 3M6VA 4USVA 1S1WB 4KAIA 3M1VA 1YAGA 4XEIA 3QMQA 3O8MA 4P0PA 4P52A 3ONQA 3L2QA 2XSJB 2W2OP 1R8HA 1T02A 2OZSA 3O9QA 3LP0B 3B8HA 1U6FA 1ZM3A 3MCMA 5JTIA 2DNHA 1NGEA 3J81O 4I56A 5D15A 3GR0A 1DQ9A 1XNQK 3ILJA 1GTHA 2BZ2A 1VBZA 2J7KA 3VN5A 7ICSA 3IBPA 1K47A 4F25A 3WK5A 3SD7A 3CC4S 1RBOB 2DNYA 2P9UB 3N4PA 2AJ0A 2QSFA 1OPZA 3H3OB 1SKUB 1Q7YO 4ZCMA 3LDPA 2GQ2A 3FFIA 2GO9A 2H51B 3T19A 1T9TA 1H2UX 3CIPA 2VZ9A 2DEJA 4YB6A 3VEOA 2HI0A 5HVGA 4A8OA 3N6LA 2PXIA 3OBWA 4C8NA 4A8YA 2IS3A 3AU6A 3L4QA 2G9OA 4A48A 4G3IA 3TZZA 1HWUA 3HCXA 3ZYYX 2RJZA 1IN0A 5IIOA 3DGPB 3ENVA 2PA3A 3HM8A 4ZP6A 2UXDF 1ZQLA 1VK0A 3BN4A 2DUYA 2WFAA 4V19S 5E2QA 4CJ7A 3AB4B 4X2BA 1BWEA 1JXEA 5CZ2A 3TTDA 2AMCB 2FDRA 4EZ6A 1KEKA 1FRLA 4I6MB 3SMPA 4NM2A 5L1MA 3C14B 3CCZA 3CJ0A 4OI3A 1UA0A 3H6EA 3ZSYA 1K1QA 1Y5IB 1MWKA 3ELHA 4CBUA 1NMEB 2WBRA 3R1HA 1OKJA 2JVOA 2G0AA 1S72S 4Y2CA 2H3QA 3SCJE 1WSFA 3HO1A 2F9TA 1UT5A 4JB3A 4I64A 1REVA 5AIBA 3N5FA 3U1LA 4FCYA 2R7VA 2YWHA 4FZZA 5BR9A 5G5HA 1VRUA 4N7TA 2U1AA 3V6HA 1NDPA 4O5FA 3L7PA 3HF5A 4CWBA 5ALRA 2UV8A 3KNGA 2VHGA 4BX9C 2ZIUA 5DG9A 4QZDA 3GLJA 4DBQA 2KW4A 2YWEA 4OL8A 4PZOA 1RZTA 7ICVA 2NRZA 4RPYA 2JLFA 4KLEA 4ZIWA 3S3NA 2XY5A 4Z7CA 2XC9A 5CR4A 4WYLA 3IM9A 3ICXA 4KLSA 3FMWA 4G1PA 2E7XA 2YH1A 2CG8A 2W43A 2FMPA 3BQ7A 3TZYA 3NCQA 5JMNA 4TY8A 2VD3A 2W6KA 2PFNA 2ZUDA 3ATUA 3DRSA 1U1RA 4HH0A 3FGUA 2EZXA 1GX6A 2VCPA 3IMQJ 3EVMA 4QW9A 3Q7CA 5KQ8A 1YJ7A 5CY4A 2ZH2A 1ZQQA 1S7IA 3Q8QB 2XCPA 1JCEA 2JEFA 2CPXA 1E3MA 4IRCA 1JL1A 2ZJ8A 2F1IA 1B92A 3KKFA 1K0TA 4RNMA 2KN7A 2IVNA 4JRQA 4NPOA 2FYXA 4DJBA 5AKIA 1BPEA 1Q86T 2BJ9A 1JJ4A 3MEKA 1SIJA 3CI5A 4J90A 4JHDB 8ICNA 1AA1B 4QCLA 3FGVA 4DQIA 2DRAA 2HPUA 3QDKA 2C2ZB 3WBZA 1X4BA 2AT1B 4KMOB 5KG2A 8ICGA 2JSXA 2XY7A 5AXLA 3FQLA 3ZLJA 7ICGA 1G3OA 3R8EA 4IQTA 2VC0A 2ZJPQ 3BSOA 4H0VB 3CF5Q 1PUZA 4LF9F 4CO0A 4UAVA 2GLEA 4PZVA 1T05A 4A8QA 1N5SA 3ZC4A 4FLZA 4FK4A 2OIHA 3M6XA 1B0VA 5C2CA 2ZGZA 3QIOA 1ZBHA 1Z1VA 2A6AA 3TACB 3H45C 1HLWA 2BJ1A 2BM1A 1JUDA 3WIVA 5AKJA 1RT6A 4ZVEA 4CBXA 4W5OA 1X4DA 4JHDA 2IM2A 3AVIA 2HQGA 2XB2D 1RU2A 4HHHA 3ISND 5F0WA 2PFQA 1NMNA 4B3TK 4R79A 3K0JA 5KFRA 3VHQA 4FF3A 2IDLA 1H38A 1IBLK 1SGGA 2MB0B 3K5NA 1DY3A 4ZLJA 4FW1A 3VWSA 2DXDA 4I2HA 5AXMA 2YTCA 1RACB 2LYAA 3LQVA 1XO1A 5J2DA 4DUTA 5HVHA 4W5TA 9ICOA 4LF8K 2NS1B 3RAXA 4CF9A 2BCSA 1HYSA 4JV0A 3ID6A 3A8YA 4KLTA 3H1QA 3RWUA 2W9BA 2HHWA 4PQAA 1URNA 3CJ1A 1HI0P 1EQYA 2AJ4A 4K4GA 3V4IA 2R8HA 4GO7X 2KKZA 1ZQXA 1HMVA 1PCAA 1WF2A 4RQMA 1FFGB 4Y2AA 3H3NO 2AIRB 2YTUA 1EX8A 1LK5A 3OL8A 4KH0B 1JCFA 4FK0A 4B3RJ 1J9AA 3JQKA 1JL2A 1Y3KA 1T3VA 1BD6A 1PYOB 3J7YI 5A8RB 4DV0F 9ICUA 3O1BA 2OPQB 4IKAA 4DPYA 4QZAA 3BS5A 1P27B 4CEAA 3EDRB 3T1HF 1F2GA 1FE0A 3NNAA 3ETLA 5AK6A 3KK1A 4GRSA 1ZQTA 5GINA 2VJUA 4KRWA 2F44A 3VF0B 3RB4A 2F5GA 3C0BA 3KJVB 3PJ9A 1QVFR 3ISCA 3BYRA 7ICIA 1MROB 5D4BA 5A8WB 1Q78A 2UU9J 1GH8A 3W9IA 5EWGA 1U1PA 4UASA 4FF2A 4Z4FA 4LMZA 1VRTB 3PYFA 1P90A 4Y2UA 5HHHA 1XS9D 1CJTA 3GV7B 1OH6A 1PZNA 2XYHB 2D0BA 2QWMA 2C3PA 2P5GA 5KT3A 3FLCO 2HURA 2BV3A 2VG6B 1QAIA 5AKYA 4Q5VA 4I2JA 2QLWA 4URGA 3VQ6A 2JC0A 3TQEA 3IGNA 3SAFA 1TGOA 2YY6A 4IFYA 1FO1A 4ZLPA 4BUGA 3AOBA 1FJGK 1A5WA 4GNIA 2FVCA 5HQ8A 4CGHA 2DKZA 2O4GA 5KFJA 3HHKA 4XTTA 8ICHA 5C25B 1RDWX 4F8RA 2CQDA 4IKFA 2ASJA 2HVDA 2B8QA 3W2VB 4K8ZA 4G9BA 2QFJA 5D4OA 3G4SN 3RJFA 2BZFA 3NDKA 3ZT3A 3SDEB 1VQPN 4FP9A 1FFVA 3G6ES 4MKAA 4BVOA 4MO5A 1SH2A 5B5EU 2OMOA 2LI6A 2VG6A 1QSLA 3LP0A 2DQNB 2WOMA 4FJLA 2W04A 2BRLA 1XO0A 1X3NA 4CLSA 1VQON 4ZP8A 2P9CA 4E89A 2JMGA 5HLFB 1HQEA 4ANEA 3GV5B 4H4OB 3ORYA 4CZCA 3UDVA 2HMIB 3PV8A 3BF3A 3BBBA 4CQ1A 4HTUA 3H2VE 3FM9A 1I51B 1TL3B 1WORA 3CCUS 5CHIA 4FLXA 5J2JA 1ZBIA 4P0QB 4M0AA 5CAAA 4JI2K 3M8ZA 5BN9A 4CZHA 1R0AB 4DV2K 4TY9A 2HBYB 3MBYA 3KG4A 3CCSS 2HFZA 3OT9A 3NLCA 4X66K 4ZPDA 4JKFA 7ICEA 3RSEA 4YMOA 5B0AA 5AM4A 2B9YA 2HW3A 1UWBB 1ZA2B 5JUMA 2VBWA 4FK2A 3NH0A 1KL9A 4TVAB 4IUFA 4FPAA 3HILA 1X31C 2B9XA 2H5EA 2JHEA 2EPIA 4AP9A 4CJ4A 3M8YA 2BDPA 4LY7A 2E1RA 1SWWA 1S48A 4GKKF 2XS7A 3IS9B 4DL2A 4I2BA 1U1MA 1E6YA 1R27B 1Q4RA 3QEVA 4CHOA 4V1Ak 1REVB 3HTVA 3OYMA 1C1CB 5C5JA 2VWKA 4J2DA 2Y1IA 4DV0J 2M0GB 2DGUA 2KT3A 4DR3F 1SPBP 1HBOB 4CJQA 2ZIWB 4IO1A 2SXLA 3VZIA 4OD0A 1YJRA 1ZQKA 5K8OA 3HSTB 3GIJA 1ZAWA 3TFSA 3MTKA 4X4OA 4QU7A 2FBVA 1CJKA 3O08A 2G07A 1TK8A 1B7FA 4BR2A 3HJVA 1KVAA 1FWLA 4X64J 3ID8A 1NAQA 2MTLA 4LH5A 2EC0A 3MUVP 3CO0P 4ZOSA 2G4BA 4DV6J 1I94K 5FP0A 3QFHA 2MKYA 3UKRB 2X1FA 1HBNB 3W7BA 3GIKA 3HZEA 3V9WA 3K89A 4YXJA 1WEZA 4YCXA 2XLKA 1Y88A 4KY3A 3LUYA 3DDNA 5AI9A 4PHTX 5ALHA 5H1SV 4F26A 1X9MA 1N88A 1SXLA 4WFYA 2XS5A 3H40A 1N5TA 1J5EJ 2PT0A 5KGXA 3PFOA 1WG1A 3M1FA 2W8LA 3CJSA 9ICKA 2DFHA 1LVHA 1CJKB 3F9MA 4TU7A 2AYBA 3T1YJ 1S79A 1XU4A 4PG5A 4J91A 2O8BA 2OANA 9ICJA 5HBMA 2PFPA 2AQ4A 2LU2A 2DR9A 3I32A 2RDDA 4U67Q 3HPHA 1SUQA 5CEHA 4M3YA 2X78A 1VR6A 1Y5LB 2PI4A 3IRXA 1U1QA 3P1GA 4RPZA 3U1NA 4CFAA 4NYZA 3ZXWA 1LFPA 4YOEA 1NKEA 2VDIA 3V7JA 3KVGA 2WAQC 2UVRA 1UFLA 1KAXA 5C2GA 4KI6A 3I0SA 3OYCA 3LK9A 1FFSB 2GNKA 2LEBA 2HVIA 4ANCA 4AF1A 2V8PA 2EI5A 1LOTB 4G1QB 2KTQA 3L5KA 5FJ4A 2YNHB 2BQ3A 4JI1J 1TUUA 4FZVA 4DPWA 2VBXA 5T7LB 2OYQA 3L2UA 4DR2K 5IT9U 3W8GA 4Q2MA 2DGSA 4XDCA 3R7BB 4IQMA 2A10A 2VG5A 1NZ8A 1PYSB 2AJ2A 1V9PA 1ZTWA 4C3MA 2VH7A 3HVTA 4IFVA 5KFLA 3POTB 3HJFA 2GGPB 1O03A 5AIAA 2VF3A 3W2WB 2FHOB 1FD8A 1D0EA 2R8IA 2IVFB 5J2FA 1U26A 4QR2A 5LJWA 4YN4A 3DLGB 4W5RA 3PYEA 3ZZ0A 2LEAA 1ZQWA 3EXCX 5J8YA 1VQOS 3CIZA 2WK4A 4OI4A 8ICZA 3DCAA 2ZD1A 3H8YA 1GLAG 2MRLA 5HL7Q 4I2QA 3CJBA 1RDCA 4JS5A 5FRMA 4U7UD 5CXTA 3IBWA 1T9YA 2DNOA 1Y97A 2GTDA 2CQGA 5KFSA 2H1YA 2HQCA 3CCMN 3QEWA 4O0JA 3ZD8A 1JKHB 1XJWB 4BRAA 1VQPS 3G4SS 2GBZA 3C1ZA 2KO1A 1UTAA 3KLVA 2XO7A 3PX4A 9ICXA 1C20A 1D8BA 4P6QA 2KEYA 3FZMA 3CULA 4BC9A 2NRHA 2FSNA 3LAKA 1LEOA 3GQCA 1ZQYA 4G65A 1I1GA 2P9LA 4DL4A 4CO1A 1T03A 1IQZA 1J97A 4L3QA 2W2MP 4I69A 2Q4TA 4B9TA 1AB8A 3SCKE 1M5SA 1VK8A 2P51A 4IZ9A 1S8OA 1FKOB 3VGMA 2K4IA 1SL1A 3VAGA 5EVZA 1L6NA 3AD7C 3TA2A 4I6WA 3D67A 3NF8A 1XMQK 4LRFA 2YQ3A 4ID5B 4CJ3A 3DDHA 5ITHA 1F21A 1MDUB 2J9EA 4HH1A 4DX7A 3MPUB 5C10A 2LLZA 2JEJA 4ELVA 3B6BA 1KWMA 4X84A 4E98A 3OLBA 3VC8A 1NGIA 2VB6A 2MLXA 3RMDA 3MR5A 4FPBA 1RTJB 3VPZA 5DDPC 1OH7A 2QX0A 4O3OA 4JI4K 2A1JB 3OFGA 4YOYA 5KRTA 3UDCA 1FRIA 1WWVA 4Q44A 2CPFA 3KMQA 4OO1J 3TWZA 2I9GA 2Z1GA 3BQ2A 5HP1B 1NWKA 4X65K 4WZQA 1FFWB 3PIOQ 2EEYA 2C3OA 1LWCA 2XNQA 4FWLA 2V68A 5L9XA 2QA4N 2UVUA 1RAOA 3M8SA 4A5BA 4AYBC 4B3MK 1VBYA 4NMXA 4YXMA 4ZTJA 2KJ8A 4ELUA 4FKYA 2B9WA 2W3RA 2FQQB 2AP1A 5AJ3F 2GELA 1WUUA 3I76A 1NKBA 4OI1A 4DV7F 1F9FA 3I0SB 5DGAA 3LDNA 4O4GA 3QB0A 4ED0A 4GLXA 3OGUA 4WQ5C 4US9A 4RCHA 1Q9XA 2D9OA 1Y11A 2CRLA 1X2IA 4TU8A 4NMLA 1GLJO 1X4EA 4QIWC 2QG9B 3CJ2A 4Z6CA 2UV8G 3U8XA 2QC3A 3OTDA 2NV3A 5FLXY 1VQMS 4LRAA 2QLBB 3RUBL 4RQ6A 1WCLA 3CMAN 3LGNA 4KTZA 2ADCA 5SUHA 2FIUA 3CJRA 4H8KA 2R7XA 1WEXA 1ZJNA 2KYXA 2E5HA 5HRNA 2XEXA 2ZHBA 2A6OA 4MDBA 3L2VA 3PUFA 2ZIXA 1JX4A 4QIVA 4C0BA 2QLXA 4NLXA 1MQ2A 3DOLB 2Q79A 2HNDA 5AQFA 5HSPA 1S7HA 2XQCA 3UPQA 3AA3A 1IJEB 1X4HA 1XHZA 9ICLA 3RMAA 5THWA 3FZLA 2KJ9A 4RNHA 4FPRA 5GMDA 2V8GA 2L9WA 4IDKA 4JI7K 5JJBA 4QIWD 3FSIA 3QEBZ 4MKBA 2AWZA 1IR1A 5GVQA 3NMRA 1KEJA 1FVQA 1OY8A 3M9MB 4JI5K 4FOEA 1FO4A 1F0XA 2HFOA 2P9KA 2QLJB 4ZCIA 2Z56B 4ZN3A 4CP5A 4Y28C 3M8WA 2IDEA 1CJVB 5DLFA 4K0KK 9ICPA 3LZJA 4QZCA 1F2HA 2KRRA 4CGIA 4EI2A 4JP8A 2CZ4A 4ETXA 5KI6A 2EFPA 2BCQA 3D28A 1NPRA 4I2PA 3LPTA 4TUQA 9ICAA 2MMYA 2ZZNA 4M9HA 3JQJA 5IIKA 3UIQA 4JI6K 4BR4A 1CQNA 4I67A 2A1SA 4BE1A 3KKRA 4NZ7A 2ASMA 1VQLN 4F4YA 3A12A 5AR0A 1L8OA 1NXIA 4LC9B 2P9KB 2Z8QA 4LF2A 2ZIUB 1RAEB 1WHYA 1ZC6A 2ZOMA 4OJOA 1F44A 2D41A 1MN7A 3THYA 2AJQA 4QWEA 1U6ZA 4AHRA 1YWXA 2OSRA 2G8FA 2K06A 4CGFA 4WP9A 1YG0A 5IWAK 1NNDA 2JEIA 2KZZA 2FI1A 5DETA 2LKYA 1TFRA 4CLTA 1KOOA 3DHWC 4IS7A 3CWJA 2V4JA 3D4JA 3JTPA 4CJUA 1TUWA 4EP5A 1LKZA 2EBEA 3DRRB 1HLUA 2VDHA 4CGGA 4OI2A 4JK8A 1JK9B 3GE9A 2Q0UA 3M05A 4DQPA 3AQPA 3HP9A 2P35A 3OYKA 5BR8F 1KQKA 4DR6K 3CETA 2V52B 1RWMB 3HPOA 1H7WA 4ZHRA 2MKCA 1J5EF 4K4VA 5KT5A 3CD7A 3I33A 1TKZB 2MQQA 4ZVSB 5M1PA 4G6VB 4M8LA 1TL5A 2HQDA 2D0CA 2DF4B 2ZUBA 1W25A 3QEIA 2AGPA 3M7DA 2FLOA 4CDIA 2PY5A 2KFYA 5IOLA 1HPMA 4EX7A 2F4VK 3TAMB 2NO5A 1FJGJ 2KYZA 1YZ6A 5AE3A 5KG3A 2UP1A 2YX4A 4AHCA 5ALYA 2EVZA 3MTJA 2JNJA 4V19X 1VQKN 4GVBB 1HKCA 2EFGA 2PGCA 1A0OB 3WZ0A 3QBXA 4Z4CA 4NASA 1V97A 2ISOA 4BC3A 2W9MA 3RR7A 1S1WA 1CC8A 2XVTA 2CQ2A 2UXDK 3GSDA 3CT9A 4KB1A 3BSNA 5F3ZA 4TQSA 1SL0A 5AXKA 2W42A 4KSEB 3TTCA 2K1RA 3RMCA 3A0BU 2B6AA 1RT6B 1BISA 4DCPB 3SNNA 2CFXA 2V51B 5EUHA 3F2CA 3C2PA 4Q7AA 8ATCB 1TVAA 1PC4A 3HVAA 1OPIA 4CF8A 1RWUA 1UAWA 4CO2A 3DJCA 1X4FA 1AUDA 2L48A 3Q8VA 4IDHA 1IBKJ 3CJAA 1GTEA 4CE9A 2QWLA 2NPFA 1S12A 3ZNUA 1VYAA 1UZHA 2L41A 1V38A 1M5PC 3OUYA 4FZNA 8ICUA 2HFUA 4JV5K 4GIBA 3ITHB 5D6GA 4YS2A 4QWCA 2CPZA 3CCES 1A6SA 2ZIWA 1G7CB 3LA0A 4KHYA 4FZXC 3HHLC 4OJ1A 2OEJA 3CQ8A 3GJRB 5J2MA 4Q0BB 4AE5A 5KFMA 4BG8A 2JZ5A 1ZQJA 2F76X 3WHIA 3FBCA 3WKAA 3V5RA 3NGIA 2YH0A 1NGHA 5HL7L 5B7WA 1DTTA 3T9ZA 4UOGA 1FERA 5ADXH 1SVDA 5C15A 3F9KA 2IBKA 2OZMA 1NBWA 4KIAA 2W9CA 4WFAQ 3MAAA 3MMJA 3ZTRA 1B9DA 1NB7A 1YSJA 7ICLA 2ZOGA 3K58A 4GO5X 1T3QA 3UKUA 4K4IA 3THWB 2PFDA 3IR6B 1T7PA 5AQKA 1SJRA 5JVGQ 1QQ7A 4ED1A 4ILJA 2HK2A 1BQNB 3DRPB 4DUYF 2GAHC 4JI8J 3PG9A 3AVCA 2W4DA 1PK1A 3NF7A 3L95X 1N6QA 1ZZFA 3H8SA 5KFCA 3PFEA 5C12A 4M5DB 1PIEA 2PDAA 1VQ9S 3JSMA 4I28A 2KP7A 1D8ZA 4JK1A 1UJ4A 5ALIA 1SWVA 1NZPA 4DTUA 2RS2A 1F3VA 4XAKA 1ZETA 1FA0A 4DV6K 3GJSB 3CIMA 2XG8A 3OVAA 4OZLA 3VF6A 4QBUA 3CPWM 2GHPA 4O3QA 2J0QD 2VWBA 5GAHI 4IH7A 4NRTA 4F3MA 3HHLB 1YJUA 2H4WB 4CEBA 1KDNA 1NBEB 2P2CB 2DH8A 2D1CA 1NJYA 5IQQA 1VSIA 3LVVA 2GIFA 3N9UC 5D3GA 2ASLA 3KUGA 2XI9A 4CLYA 3O9RA 1LW2B 3JSMB 2NLXA 4KAZA 3VR1A 3TVZA 5DG7A 1OW5A 2ZHAA 2KVIA 7ICRA 3B82A 3BP8A 3O4WA 5BREA 3M9NB 3DLKB 2CQ3A 1VI7A 2OPRB 2JH3A 1T0TV 3P5JA 2E1EA 1RT1A 2MZQA 4KR0B 3QUCA 3UMGA 5DO2A 8ICTA 4FWRA 1HKBA 2XHWA 3T1HJ 1UFKA 8ICKA 3BGUA 3H0PA 2DGOA 3J80Y 4CD3A 4RQ7A 5J2NA 1HYVA 4HI2A 4RKUC 1XUPO 2NRRA 3O9SA 5IT9O 3FNNA 3CJQA 4JI8F 2EFOA 3CD6N 3G8TA 4YMNA 4KV8A 4P10A 5A8KA 4LF6J 4L74A 4UOFA 4NI2B 2ESEA 3BSAA 4YHHF 3WK6A 2IVPA 4LSNB 4B1VA 4JI1K 3BEXA 5EHHA 2EHGA 4UB6U 4N41A 4DL7A 4P0QA 2E1PA 1KBRA 3MDFA 2H3GX 1T3OA 2YKMA 3V72A 1EQMA 4CFDA 1Q0NA 2YHXA 3MM5B 2RLTA 1NGFA 4DSJA 2LP4A 4JEPA 1Q79A 2UUBJ 2R7YA 4IL6U 2VG7B 2VOOA 4N8NA 3MDQA 2DPIA 2Q6CA 5DZ7A 1RYUA 3F5TA 4KLGA 4LJXA 2OI2A 1W2BR 4USAA 1OIAA 2VIHA 1XNRK 1ROFA 1VQ9N 4RNFA 2HK3A 3A5NC 2V0NA 1U0HA 4X4UA 3R6MA 4I2GA 3NS7B 4AYBD 2WZ1A 4NWIA 1RTJA 3CW2C 1XNQF 2I5JA 3E0FA 4CZJA 5AI4A 2CQBA 1TFYA 3V4MA 1EWQA 1RWNB 2DH9A 3QIDA 3VETA 3VQBA 2W9BB 4Y1DA 2CDRB 4ZTFA 3KD1E 3IS9A 5B0DA 5CD4H 4RG8A 1S99A 3FEYB 4DFJA 4L73A 4WFZA 2JFDA 1PVRA 4KLMA 1ZM2A 2VG7A 1F9HA 3D3BJ 3I56N 4ZMMA 3C1YA 4OZ3A 1QSYA 4ENOA 3EO3A 4YHHK 1LWCB 1IR2A 2E5LJ 3MAHA 4CHZA 3M9OB 3R3LA 4QZGA 4FYXB 4FF1A 2E2NA 5BN8A 1X9WA 1HNVA 1J2VA 2HSEB 2VFVA 1FXRA 1XQSC 3LDOA 1IXKA 4J9VA 3FZHA 4FXDA 1V3RA 4DSLA 1PK1B 2DPJA 1WAJA 1L3UA 2Y8WA 5AFUA 5HP1A 4EX6A 4NLPA 3LDAA 3ZD9A 2QWQA 3T79A 1NGGA 3ULDA 2X6NA 5KG4A 4DQQA 5IV4A 5ALSA 1R43A 3ULHA 2ZE2B 1C7YA 3A5OC 2E2OA 2ZUGA 3A3NB 2ILZA 1P6TA 4L3NA 3HOTA 2LBOA 4DU1A 1VBXA 2H5IB 2B4PA 1FXDA 3P39A 1YKWA 2KVQE 3RB6A 3K5OA 2E66A 2HYIB 2KT5A 2CNOB 4M7YA 4YORA 2XI3A 2BJ8A 4HTIA 4C4WA 2YV0X 3C15A 5I3PA 3RB3A 4LF5J 2RRDA 2IC3B 1S10A 1FRKA 4BRHA 4LIWA 1ZBLA 4XH4A 2D0PA 5ETNA 2ODGA 1FVSA 5AQYA 2OTLS 3KLHA 3EX7B 1L8LA 3BDEA 4RWXA 3B6OA 3C5GA 2DNQA 2L3MA 3TFRA 3QNWB 4O5BA 2BABA 2EKNA 2XY8A 4LF9K 2MJUA 4DOAA 3HDSA 1IVZA 2F8LA 1JNRB 3QO9B 3QIPA 4CZFA 1QS4A 1WSIA 4IOXA 1Y00A 1WB9A 2ZM6F 2WSEC 2KHDA 3MXHP 2H3ZA 1S4FA 2FMSA 1W0HA 3VOVA 4H4OA 2BKPA 1B9FA 5IIIA 4KHWA 2B6GA 4WZMA 4GVMA 4B9UA 3QSIA 2ITMA 4FBUA 4C9DA 4DUZK 1FRHA 3JAMU 1XC3A 5HMZA 5EX3A 1R8PA 1AFIA 3LM2A 4B3TF 2F9JA 5TKYA 2IA0A 3LH2S 2L9DA 4RBUA 2ZZTA 4FVMA 2CN1A 1RCXB 2RUGA 2W24A 1M6YA 1HNWF 1S76D 3K5MA 4CO4A 4DLEA 2ATQA 3CCRN 5CD4A 3JQMA 3L4IA 2AEFA 4RT3A 4F0MA 1BNPA 3LPUA 4MF2A 5LMNF 5T14A 4PKHA 4F2SA 2RUSA 1RT4B 5J2HA 1BPDA 1NK5A 3G9CA 4LF7F 3EVWA 2QRRA 2EFNA 1I6JA 5LM7E 4P9SA 3BS5B 1Q8LA 3VGKA 3NXZA 3T6JA 3AVNA 3CCJN 3HHNB 3NKYA 2DISA 4OHXA 4KPYA 5M1KA 4HUFA 3Q8UA 3QAEA 2ZBQA 2X7IA 3THTA 5K8NA 1HJRA 5F0XA 5GAEU 2DNKA 3H46O 1YVUA 1VRUB 5BR8K 3UD5A 2MQNA 5H9FK 4P4OA 3U9ZA 3SQ2A 4UW2A 3AVAA 2PFUA 3J7Z5 2A3VA 1L7MA 3MCSA 2WC9A 1S97A 5A76A 5DKWA 3DMJB 5ETKA 3BO3A 4RJVA 2ZBRA 4NZ0A 1CS4A 2Z30B 2J76E 1SQEA 8ICIA 2BE2B 1PO6A 1LKYA 3GFYA 4WF9Q 3TP2A 1SV4A 1U25A 3GG4A 3SBMA 4XRHA 4LF8F 2QYCA 4ILRA 4CJKA 3TVKA 4MK7A 3G8QA 1HBNA 3H5YA 5JU5A 1J54A 5KPZA 4F36A 1YQHA 3JB9k 4TUPA 7ICKA 2CJBA 3HSDA 2XZTB 2AHOB 1QQMA 1N5WA 3P38A 2M70A 1NLKL 5A2QY 4FJNA 2RQCA 2FHKA 5HMMA 2LMRA 4MTPA 3PYDA 1U8WA 1V9OA 8ICMA 1WHWA 1DARA 2G1DA 4B8AB 3QE9Y 1NJIO 4JI7J 1TFWA 4J37A 3HHEA 4JI2J 1CVJA 4P2MA 4WJBA 3MM8A 1HL6A 2ZC4A 5C2DA 2RH3A 4LR7A 3MCAB 3PSIA 3ENHA 3S6EA 1YI2N 4MT1A 4UB2A 2FLLA 4OZ5A 1RXVA 1RXOB 4XPCA 3FC4A 4MFFA 4ITSA 3QIPB 3PY8A 3KLEB 3I5AA 4PXEA 3CJTA 1VDVA 2HIYA 1BL3A 2XCAA 4HACA 4YOTA 1MLAA 2HS4A 3KIOA 4IRDA 3M6WA 1R0AA 4DSKA 1FDNA 1WN7A 4C48A 3E01B 4JI6J 1B99A 5AK4A 2WVFA 3D2FA 5HR6A 5ADXA 3FAHA 2FPKA 5CYQB 3UXNA 1QQNA 3NF6A 2R8JA 4ZPCA 1Q18A 3CDAA 5ALJA 2MSTA 3ZEUA 3N97B 1SKSA 2VJ5A 2M4MA 3ISZA 4PRFA 2ASYA 2R7RA 2PYJA 3ENOA 4CLLA 1JLEA 4OLPA 4UUWA 2BCUA 4M42A 4CJRA 4EMDA 2UUCF 2BJ3A 3VALA 3D6MB 4M45A 3TU5A 3SLCA 3QX7A 1BO5O 9ICQA 2G5IB 5AKLA 3HRGA 1SXEA 4NXMK 2KQ2A 1VQNS 2FGOA 2X1BA 4KB0A 1JXBA 2DYAA 1P9QC 4J9PA 3E01A 1KDHA 3M8QB 2W9CB 4UF4A 5KQDA 3O0FA 4IO9L 1BNOA 5ELZA 4X64K 4DR5J 5CA7A 2V9KA 3JPTA 5KFUA 1U4BA 5ALQA 3CHWA 3GP9A 5F3XB 3TJ9A 5LJVA 4CZLA 1U6BA 5ETOA 4PHDA 1SAZA 5DLGA 3F44A 4NWBA 4M5GA 2UUBF 3VQ9A 2ETJA 1XSNA 3SMVA 1NHUA 1YIJN 3TYTA 3TAQA 4NLQA 4QNLA 4C2MA 2DGVA 2K4PA 3W1YC 5G0RA 2ZDPA 3D6RA 3AVBA 3CM6A 5AXNA 4EEYA 2ASOA 3IKMA 1WC0A 4DTOA 4USJC 3BS9A 3CFOA 3HYFA 5K8PA 4BC7A 4HHJA 1VJ5A 3UE2A 2Q31A 3B4MA 2ZH4A 3VAMA 4WIIA 5BOLA 4L6V3 4C11A 2B5JB 2HBKA 5C24A 2BE2A 4BRNA 3CQXA 3MWBA 4JI4F 1RWKB 4LRDA 5DB7A 5KFZA 2PYLA 1G4CA 4Z94A 4TNOA 7AT1B 1U02A 3O1WA 3J80O 3LPYA 4BHQA 2Q43A 1DLOB 1LAVA 1IUJA 4CRJA 3FZFA 1N60A 1DKGD 4US8A 1KKXA 4E7LA 1RJJA 3DOKA 2RHFA 3JPPA 1RA6A 1S9FA 3ZZZA 2BVZA 2KVCA 5BJRA 2VASA 4NLWA 4BCAA 3K75D 5K14B 1TR0A 3B4DA 3U9DA 1UCNA 1IBKK 1BDGA 3AU2A 2W3SA 3V81B 3SSRA 2V67A 2LQ8A 5HJXA 2Z1JA 1NHKL 3FZ2A 3BKTA 4C8YA 3MECB 2GVZA 2Y9HA 1ILYA 1VQNN 4USMA 1MC8A 4U9RA 4DTSA 4BR7A 4CZKA 4EBEA 1S9GB 2OGUA 3R2DJ 1NK7A 3K59A 3M7VA 2EC2A 1T6DA 4M3XA 5L8RC 4KHRA 5CA5A 3CCSN 2LECA 2O01C 4DR5F 5AQMA 5E33A 3VGVA 2OPQA 2KG5A 2OFHX 2QTDA 1FKPA 2BOPA 3KZXA 4HYKA 2QW9A 2B4OA 5C2FA 1YTAA 5A8KB 3V9ZA 1GOAA 4BXOA 4FJ5A 1FJGF 4JS4A 2QV6A 2YY3A 3DLRA 2DTUA 4KLQA 2F3NA 1O1WA 1CI4A 4U6PA 3P5TL 4J8FA 1WF1A 1APSA 3WQTA 2B6AB 2OPPA 2YKMB 3C94A 3MMAA 3RBEA 4ZVQB 1QSSA 4OPHA 1RWWB 2F4FA 3L2WA 2F8HA 4KLIA 4DPUA 3NCIA 2FJBB 3ZI4A 5B0FA 3WQPA 2HVHA 2C2DA 3W62A 1L7NA 4QW8A 3QT7A 3U02A 5JXSA 3AAQA 3S7RA 5D3GB 2XSJA 2HLTA 5IT9Y 4EIAA 1SZHA 4DV4J 2XI2A 2QMXA 1RTIA 2MQ8A 1AFJA 1FEEA 3GFZA 2PD1A 1MSWD 3HULA 4CH0S 4FL9A 3F0NA 3ICLA 1SIWB 2UUTA 3RSEB 1ACMB 1XMOJ 5A0YA 4H4MA 3R7NB 3Q0AA 3GYXB 2WF6A 3AD9C 3UVJA 3QQCD 5HANA 1DQ8A 4KREA 3K2YA 3CVKA 5IINA 5F8IA 1CULB 2ZWHA 1QAYA 3T5HA 1QCKA 2GJFA 3MUTP 4RUAA 3J80U 1ASVA 2QKBA 3KJQB 2WUSA 4CHQA 1IBCB 4PH5A 5CZ1A 3IRUA 2DR8A 3O8WA 5GAGU 1N32J 3ZZPA 4JI7F 3LYSA 2FHJD 4IOBA 4LBIA 5BXIA 3BM7A 3DOMB 2KG1A 2EK1A 2HHHK 3MAAB 1S9EB 3CFRA 4AXJA 4A61A 2DGTA 4Q0BA 1FHTA 3VGLA 4DMNA 5AKKA 3B54A 4KI4A 4JKCA 4NLBA 3VAHA 4EUVA 1UVIA 4PL7A 3JYTA 5M2RA 3HT3A 3O9TA 3U6FA 5LXRA 2YMQA 2KXNB 3U26A 1TP7A 3HVWA 4MF8A 1M5HA 2GX8A 4LFBK 4UARA 2NRTA 2WF8A 2J6UA 7ICHA 3BF1A 4ICLB 5DMRA 2AX0A 1XMBA 3VEXA 4KB7A 2XS2A 3JXUA 1K44A 5GIOA 1OYEA 2DB1A 1N63A 2E1FA 1MU2B 3QU4A 5GTIU 1X4AA 2WFBA 3RZAA 1FEZA 2YWKA 2FUG9 4O0IA 4CIFA 5IFMA 1P1LA 1GMWD 5BPMA 3VQAA 2O8FA 4PWWA 1IKVB 3PSPA 3DFEA 4FPIA 3D45A 2UUBK 3KDNA 1HQUB 4M5NA 4FNIA 5LSRA 3OTOF 4PGXA 2JEGA 3RTVA 2CXYA 3VF2A 1COKA 4FFDA 4ED4A 3CYMA 3WUHA 4W98A 3ALRA 3AVHA 3P3DA 3EE3A 1KOHA 3UI3A 2XO6A 2YNGB 2E5GA 4Y2PA 3R1XA 5EX5A 5DG8A 4NX9A 4FLUA 1ZH5A 1ITPA 3L3VA 1WJ9A 2WVCA 3CCUN 2Q0ZX 2IMOA 2MGZA 5AKHA 3KHGA 1YJWN 1TKDA 1NJXA 3DRRA 2KHOA 2J0SD 1TKZA 1WOPA 3N4WA 1HI1A 1RM6C 5ETTA 1IG9A 4FVUA 2ALYB 2NXUA 2RHQB 1MMNA 1TKXB 4B3SF 1JXLA 2ZJAA 5CYMB 4URQU 2NPIA 4ILHA 1JROA 3NH1A 1VQ8N 2QE5A 3L3FX 1WD6A 1HYSB 1D1UA 2YX8A 5EY4A 3T1YF 2F96A 3IMXA 4WPAA 4LZDA 2EBGA 2KSOB 5A6WA 4EWTA 4IQWA 4Q45A 2PMZF 3GE1A 1GQEA 4C98A 2HBMA 4JYAF 3SQOP 3UQSA 5EE1A 2U2FA 3N79A 2LYHA 3G0ZA 3D7SB 2RMLA 2V94A 2XHBA 3PDNA 1PGZA 1VCTA 4FF4A 4O5KA 2HVEA 5FD1A 1T05B 2X6SA 1ZTTA 2EXUA 2OEKA 3M8QA 4Y2VA 8ICWA 3M2RA 4DX5A 2D3UA 3RRHA 3DYAB 1CXQA 4NYNA 4HHTA 2GQCA 2XMKA 3ITHA 3HM9A 4I2CA 3VCDA 4IQUA 2NYIA 3TVYA 5J2EA 4BG9A 3R5GA 2DR7A 3EKSA 4LF5K 4LF6F 1CLQA 2VPYB 4PG4A 3O1LA 3BZQA 1PAEX 3LDLA 2JZBB 1X40A 5ADZA 2OD4A 1M1KT 3KK7A 4AHVA 3WK9A 5C7PA 4ZLNA 1U8SA 1KQSM 4M6WA 4FJIA 1RILA 3NVVA 2B4VA 2XBPA 2HOFA 5LOQA 4HTLA 1IBMJ 5JVGL 1BUXA 2V50A 1JNZB 3JYTB 1JLBA 2VQFF 5L9NA 2XIDA 2GX9A 2BYCA 3EUB2 2NXCA 1XMQF 1V6HA 1EKEA 1RSCA 1WG8A 3IC1A 5ALGA 2EQYA 4DV3J 1K9MT 1SL2A 3N0VA 1GLBG 3BY5A 5HI7A 4DI6A 1GK8A 3IGVA 1E6VA 3K5LA 2E9ZA 3UM9A 1W26A 4DV1J 5H9EK 4IR1A 4F67A 4BC2A 2HAIA 3VCBA 5L1IA 3QEPA 4NLKA 3IWNC 8ICQA 2MKSA 4MEYA 3WEEB 2YPYA 3N7SC 2FVRA 2YBVA 4DV7J 3KFWX 4U8YA 4DR2F 3M6GA 4QQBA 5M1QA 2DD8S 3OSPA 3ETRA 2HF4A 3AJ2A 4H5VA 4CJTA 5ALXA 2CPRA 1SJ1A 3DKDA 1GOCA 1NSQA 3B0YA 3G86A 3UN5A 1EARA 4J9QA 4FYDA 8ICYA 3MX2A 4JKBA 3KLEA 2PC6A 4Z4IA 3MXJA 3QZ7A 3D0HE 1UPMB 1LNQA 4K0KJ 4MYTA 4CDGA 3VQEA 5KG5A 5KAFU 3DU5A 2HS3A 3MECA 4L3KA 4K50A 3ULEA 1UP1A 3NAHA 3NGSA 4F02A 4E19A 1T95A 1KLMB 3Q23A 2D0OA 3C7NB 4TQRA 4FYWB 4MIWA 4OYMA 1GMUA 1U2RA 3NEKA 4AM6A 2HNZB 1P1TA 4LIRA 2A18A 2MGZB 5AZIB 3M1VB 3GFXA 5B08A 4U8VA 3PZPA 4FSVA 4JD2B 5LT5A 2KV2A 1RAAB 1W2BM 4B3RF 1FTRA 2X3GA 1GT8A 4NB4A 4X62K 3MD3A 3I87A 3EKUA 5MLCV 2DXEA 4CF4A 3VTHA 2F4VJ 3QRQA 4YDUC 4X4TA 2DCUB 3KD3A 4DR7K 3G6XA 2KZ3A 9ICSA 1S5JA 3HSGA 4OKEA 4J2EA 1RYSA 5E3CA 4RQ5A 4MO4A 1XR6A 4FWKA 2R2RA 3PRDA 3GV8B 1NU0A 3CC4N 4HT7A 4H0OA 2AYMA 3ZSWA 3KLIB 3K7RA 3OS2A 1ATRA 1RNHA 2NZCA 4X5VA 3C6HA 2VBZA 3V9SA 1OJ4A 5KG1A 2W7AA 1SJ4P 4EP4A 3F5AA 3GU0A 2MAXA 3VAFA 2LDYA 2O67A 4AH9A 5J2QA 1C1CA 1DTQB 1ZXIA 3SPYA 3AD8C 3UN3A 5AQNA 3C2KA 3OPKA 4NI2A 2Q97A 3BB5A 1T6CA 2D0AA 1WOSA 3PX0A 3GBTA 3QERA 3VMFB 3VTIA 3ZEUB 1LW0B 4E1NA 3W65A 3CG7A 4KMUA 1FDDA 5DM6L 2WB1F 4NXMJ 4OPKA 1KFTA 4USHA 2CYYA 3RRGA 1Q16B 2OTLN 1NCLA 1NK0A 3LW5C 1C0MA 1HBUB 4MFCA 3BYPA 3E8OA 3NHGA 4F92B 4JV5J 4KLUA 1I3OB 4KHMA 2GVDA 3D1HA 3M6ZA 1I39A 5CH7B 3UCGA 4KGVB 3MMCB 1NSPA 1B43A 2H3FA 3MCNA 3JPRA 2RP5A 1EQ0A 4G9ZA 1XSLA 2Z0GA 2A3ZA 3JS6A 2MUTB 2BJEA 2XSFA 3G82B 1E4FT 2QWRA 2KICA 4WYBA 2G1HA 2RT3A 3ZT2A 3O4QA 3E51A 2R8KA 4CERA 2BTFA 3CDWA 2V34A 4GV3A 1CSJA 3DLJA 1RHUB 1Z1BA 3TJAA 3ZTQA 1NGDA 2GMHA 2DFEA 1ICEB 1ASWA 3DGVA 3FCWA 5F8MA 3UWTA 3MMVA 2GIRA 1D5AA 3GJTB 3KK3B 2AV5A 3MM7B 2FLNA 2F7TA 4JI0J 4A8XA 1HHSA 2WTUA 2XICA 4YVZA 4DX8H 2GFFA 1U0SA 3UQ0A 5AK3A 1NM1A 1HMVB 1JLCB 1S1TB 2BUPA 2YQEA 3NP5A 4PJ0U 3KLFA 5KRSA 2JR5A 2EANA 4G1QA 3D0GE 3VENA 4ETZA 2J8SA 3SAGA 3W9HA 2YNHA 1Y10A 3VV2B 2DKOB 1L3VA 2R7QA 3Q22A 3RFAA 1YHQN 1YDLA 1WC5A 3KBBA 3D2NA 3VGSA 5AI8A 4F3QA 4E1JA 1S6QA 2CJAA 1N5QA 4DSEA 2GA7A 2XZWA 1NI3A 1C6VA 2QB0A 2XMTA 4DCOB 4X62F 1Z3EB 3KHLA 4QZ9A 2IBOA 2IC3A 3AO3A 3ENBA 4QS8A 2KXHA 1SH3A 2A0FB 1N32F 1WNEA 2O3DA 4WCEL 3M6KA 1Q7LB 3HZ6A 3H8MA 1R59O 4KKOB 3SQ4A 3A1YG 5AQVA 3SSSA 1XIQA 1Z4OA 2B4UA 4DU8A 1B70B 2VV5A 2V9WA 1U09A 3THVA 2AX1A 4C4SA 1NK6A 4BLGA 2CQIA 2AF6A 1S4EA 4M04A 4X4NA 4X4RA 3D2EA 4PABA 4HTJA 1HNIA 2E3TA 4RQ2A 1UQVA 2QWNA 8RUCA 4RU2A 1RISA 5D4LA 2CJKA 2YHYA 2M8DB 5AICA 3ZDBA 3ZZRA 3WXLA 3ZT4A 4LF6K 4WQ4C 5LSOA 2BW7A 2XHCA 2I6WA 5RUBA 3RAQA 2HOEA 2RVJA 3UCUP 2QA1A 3AOCA 3VQ4A 4NYPA 4JI4J 3A0HU 1S22A 2DVIA 3EY1A 4K8XA 3NMUA 5DZ6A 2HOQA 3DOLA 1Q8KA 4QIGA 2VANA 2I2YA 4YOXA 1VJQA 1IKYA 5LXYA 4ZVHA 1LWFB 4OHZA 1RT2A 3MMBA 1FW6A 1DGSA 1LFWA 1ASUA 2P1JA 4I2IA 3DHXA 2IVMA 3KTQA 4CHPA 1ZQ1C 3UB5A 1X4GA 1BWFO 3DM2A 2VQFK 3MEEB 2HHTA 2R2UA 5LMUK 5J0RA 3CCVN 1QAJA 2KLAA 3PLAA 1F5AA 5EX0A 4QWAA 2N4DA 2R7TA 3GTYX 3JPQA 2KXFA 4OGEA 2CPIA 1PKUA 1OQ3A 4JI0F 2BHNA 4PYDA 1T11A 1GLCG 1FDAA 3L4BC 4NEYA 1NJZA 2QXLA 1ZQIA 4FM0A 4ISGA 5ALUA 2CJQA 5CJ7A 1HHTP 3U27A 4YMMA 5J0UA 1AT1B 3W3SA 2A40A 4DZ6A 3AVFA 4YHHJ 1JMTA 4F91B 4ECXA 5T41A 1EXQA 5B8HA 3MEEA 2HZAA 4CK2A 1IKWB 4ZP7A 1WLJA 2P6SA 9ICHA 4P2SA 2VBYA 2Z1IA 3WIUA 4JRPA 1NUEA 2LCWA 1WDDA 1S6UA 1U1LA 1A5XA 3DXKA 2D4WA 2V5HG 4LFBJ 4DOCA 5CCLA 1FDBA 2FZKB