4DSEA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dseA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dseA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dseA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dseA01
9ICLA 1KCFA 9ICMA 5CA7A 4FS2A 2D0AA 2FBYA 1XSNA 4QWAA 4QW9A 3UXNA 3T1AA 3MFIA 9ICXA 4IRCA 1ZBHA 5J2KA 1VSKA 4KLQA 3H8JA 4RPXA 1IKVA 4O9MA 4I2IA 2PFPA 3PW0A 1N56A 4J9RA 3CM5A 3QINA 5J29A 5HMLA 2DFLA 4KHNA 3GDXA 2QXFA 4DTXA 2AGOA 1K6YA 4CEDA 1NOZA 1K1QA 2W9MA 4AHVA 2Z1JA 4QZCA 3M8QA 1BL3A 4I7FA 4FJNA 4O5EA 2Z1HA 8ICYA 1JN3A 1NK8A 1Q9XA 3M8PA 2E4LA 2V9WA 3ZSOA 1BPEA 1U47A 3OYHA 3FYHA 1L3SA 4Y1CA 1RZTA 1VSLA 2HHUA 1QHTA 1U48A 3NE6A 4EBCA 3TAPA 4EBDA 4IFVA 4F5OA 3SUPA 9ICAA 4RW6A 4ED3A 3ZT2A 2W8KA 5KT6A 2B4JA 4C8NA 4XIUA 1FKOA 4Q45A 3QIPA 4FJIA 4E7KA 5I3UA 3OY9A 3P83D 7ICHA 2ZTEA 2IHMA 4EZ9A 4NXZA 5J2IA 4M9GA 4FLWA 3TAQA 2FMSA 4DTNA 3O4QA 2A1JA 2PZSA 4TUPA 4YFUA 4CEBA 3ETLA 1SKSA 3BDPA 4Q5VA 4YR2A 4G1QA 4YMOA 3NH0A 4M9JA 4KO0A 4QCLA 1S0NA 2IMWP 3HPOA 8ICLA 2NRVA 1X2IA 2XGQA 1N5YA 3QEBZ 1S1VA 3ZSYA 9ICTA 2HB5A 1I3AA 3AO2A 1TFRA 3ALYA 3AO1A 3AVMA 5CR0A 3UIQA 5KFOA 5DGBA 3RB6A 4O3QA 2XC9A 1IO2A 4RZRA 7ICNA 4J9OA 1TV6A 4RNNA 1RTHA 5L1KA 1KLNA 1SKWA 3AVBA 1BPYA 4GXIA 3RAQA 3JPPA 4R64A 1GOAA 4KLSA 4R8UB 1CZ9A 2C2RA 4MEYA 4QWDA 4PY5A 2ATQA 1LWEA 2EX3A 3L2RA 4KTZA 4QZEA 2XO7A 4CEQA 2KQ2A 3AA4A 2ISPA 7ICPA 1B9FA 4W5QA 3LPTA 3K5OA 1XI1A 1RBRA 2DPIA 5FROA 2AU0A 1S77D 4DQPA 3VQ5A 4TUQA 3MXIA 5J2NA 4ECRA 3QERA 3V9UA 1NK7A 3E2EA 4IBNA 3P1GA 1QTMA 5J0TA 2BCVA 3V1OA 4OPKA 7ICMA 8ICFA 4DTPA 3S3OA 3KK1A 4DFKA 3NF6A 8ICPA 1TKTA 5EOZA 1XU4A 1S97A 3TANA 3DYAA 1QLNA 4DL3A 2KN7A 2HW3A 5DK5A 1BCOA 1KSPA 5KFMA 4KLEA 4TQRA 2H5XA 3GV7B 1JLGA 8ICRA 4EP4A 1A5VA 5J2CA 5J2AA 3C5GA 3M9OB 1HYVA 4BDZA 3M9MB 1KVBA 1U45A 2AGQA 2HHSA 2R8KA 4RUCA 4E3SA 7ICSA 4NM2A 7ICJA 1TAQA 4MFAA 4ECVA 4I2GA 3UQ2A 3O3GA 4R66A 3SI6A 3OYMA 1NOYA 3VQ6A 2W42A 1J54A 4JS5A 5KG2A 4CGDA 4CK2A 1TK8A 1LW0A 1RDDA 4NY8A 3KLGA 3MR2A 4ED2A 4C8KA 5J2EA 5DGAA 4FLTA 4OVLA 4GVMA 3VQCA 4F3OA 5JS1A 2ITGA 3SPZA 1JX4A 4B9NA 3L2UA 1DGSA 1IH7A 4H4MA 5KI6A 4F50A 4I28A 9ICQA 2G8FA 3HM9A 5EWFA 9ICKA 3MXMA 3V1QA 5KFBA 3LP3A 2GUIA 4AHSA 1NK5A 5FDLA 2BCQA 1TK0A 5L1LA 3OYBA 4QZAA 4FK2A 4TQSA 3QESA 3FFIA 2FC0A 4P4MA 4YCXA 4EEYA 5KFIA 1XSPA 1O1WA 4GXKA 3DMJA 2J6UA 4O0JA 2FBXA 3T5HA 5IILA 3O3HA 4QZHA 2VWKA 4DL6A 1T05A 4ECYA 3PW2A 3AA5X 4KLDA 3OYFA 5DBBA 1XC9A 5J0WA 3L3VA 1ZQAA 1HMVA 1JKHA 2C2EA 4KTWA 4CF9A 5KFUA 5KRSA 3WNEA 4YD2A 3LWLA 4HHTA 2KZZA 3JPTA 4LD0A 4BDYA 1ZQKA 1JLFA 3PW7A 1IKXA 2FPKA 2RN2A 3PUFA 5KFJA 2KTQA 4ECXA 4N5SA 1ZQNA 2XCAA 1EKEA 8ICQA 4FZYA 3MECA 8ICKA 4ZTJA 3LZJA 1ZBUA 1J9AA 3HJFA 4JWNA 4FJ9A 4GC7A 4IRDA 2UVRA 2FPMA 7ICRA 2PI4A 2EHGA 1ZQHA 3MDCA 3C6TA 4CGHA 2Y1JA 2IAJA 4IFYA 3SQ2A 4HUGA 5J0YA 4M41A 3QNOA 4DSEA 2OWOA 1VSEA 4Z6DA 7ICFA 3A2FA 4C8LA 4C8OA 1FXXA 4TUSA 3SQ0A 3K58A 2R7YA 4FYDA 3L8BA 4M3TA 5HBMA 5HNKA 1ZQBA 1WSFA 3HL8A 3C2LA 1B22A 4J9PA 2YNIA 4BXOB 1ZETA 1AROP 1RT4A 5HMMA 9ICRA 4YR3A 3RJKA 3I0SA 1ZQUA 1ZBIA 3CM6A 4UB2A 3PX0A 5KFWA 4CIEA 3M9NB 3OYEA 1ZQYA 4BE2A 7ICKA 4CJPA 1HNIA 4NYNA 4E19A 3HVRA 4ICLA 3RB4A 1JLEA 1S1XA 2VG7A 3ASMA 5CYMA 3NTUA 1U4BA 3TFRA 3EYZA 9ICCA 3PVXA 2G8WA 1JXLA 3VN5A 4CJSA 1L3UA 2W9BA 3OSPA 2HHXA 4L8RB 1RTIA 4BE0A 1EX4A 3AVAA 4E7LA 4Q0BA 4QZGA 4O5CA 3AU2A 4O0IA 2ASJA 9ICPA 3O3FA 1S5JA 4YMNA 2BHNA 4KLTA 4IQVA 3QEIA 3QIOA 3C5FA 5KG4A 1LWFA 3ZSRA 2ETJA 3ZDAA 4RT2A 2UVUA 3HX0A 1RT7A 3ORYA 4JRQA 3M8RA 3PMNA 1MU2A 5DLGA 5DQGA 4YG2A 3DOLA 5IIKA 2JEGA 3T19A 1SL0A 4M9LA 2ZQBA 3MR5A 3VQQA 4KLHA 4CEEA 9ICEA 4GC6A 1XHXA 3V6HA 3S3MA 4K8ZA 3LDAA 1JXEA 2YHAA 4CJRA 1S0VA 5KFYA 4RQ2A 5KFZA 3VQPA 5SWMA 3CFRA 4FLUA 3KKRA 4FJGA 1U49A 4IQUA 4JRPA 1T8EA 3G6VA 3V7KA 3SUQA 2VANA 2FBVA 2KZ3A 2YNGA 4MQ3A 4DSKA 4CHYA 1S0MA 1W9HA 3MXJA 5J2MA 3DRSA 2JGUA 4I29A 2BPGA 3RBDA 3EPGA 4ELUA 9ICIA 3DLEA 4LY7A 4E0DA 3L2WA 3V6DA 4PHAA 1RNHA 4AILC 3DLGA 4KV8A 3NCIA 2VA2A 1WSHA 4EBEA 3D45A 3C95A 3T3FA 5KFHA 1U04A 5KT4A 4CJLA 1X9MA 4Z6FA 3V6KA 3ZCMA 1X9SA 1HRHA 3WNFA 2V4RA 3V72A 1N6QA 1A77A 1BVSA 4O3SA 4ZH4A 4KLMA 1QSSA 3WNHA 2B21A 3GIMA 1DLOA 4NCGA 1ZJMA 4IKFA 5D49A 4G3IA 3C1ZA 3QZ7A 3ZSZA 7ICQA 4M3RA 4DOAA 1UA0A 2R8IA 5DG7A 3LK9A 3JPRA 4LH5A 4GW6A 4ED1A 1ZQDA 2B5JA 1LWCA 4NYFA 3HT3A 4KHYA 9ICGA 2IGIA 1S1WA 4CFBA 3MAQA 4MF2A 4UBBA 3SCXA 2BPCA 1TKXA 4IR9A 2HMIA 5KFGA 2DTUA 5IINA 1SZPA 4B9TA 2V4QA 2M9NA 1BI4B 4FZXC 3NH2A 3KLHA 3H40A 4LZGA 8ICVA 4M3WA 3AVIA 4F5NA 5CY4A 3ZSXA 4M6WA 1ASVA 4RQ1A 1EETA 3GIIA 1VSJA 2P66A 4FO6A 3E01A 2PFOA 4E7HA 5KFVA 5HHIA 4FXDA 1XWLA 4I2FA 3QEWA 2JLEA 3CFPA 4DL5A 4QZBA 4FCYA 4ELTA 3B0YA 5IIOA 1VRUA 2G8UA 4KPYA 3I8DA 4M2YA 4KRFA 2F96A 1K1SA 5FRMA 3K75D 8ICWA 1ZYQA 2P6RA 3NF8A 4DSJA 4E1MA 3AA3A 3BQ2A 2C2DA 5EWEA 3ZSWA 3SQ1A 3UXOA 2WONA 4EYHB 4CJTA 2R8JA 3QE9Y 4GXJA 5KG5A 5F9NA 2KFNA 3TABA 4FJLA 4Z4EA 5IIJA 2DPJA 2XGPA 4MFCA 4PWDA 3RH6A 2B6AA 5J0UA 4NCBA 5KRTA 4Z4GA 5DG9A 1BPZA 1HYZA 8ICCA 4Z4CA 3RMAA 4I2BA 1C1CA 4DTSA 4XA5A 2YHBA 5BOMA 4CIFA 2JZBA 3V7LA 3OHAA 4FLVA 5HHHA 1B9DA 1KDHA 4RU9A 2ISOA 3V9WA 3QLHA 3SUNA 1T03A 1ZQGA 1ZQRA 3RJGA 4B08A 5JS2A 1ZQFA 2BE2A 4Q8EA 4OJRA 2ASLA 5J2QA 1RBSA 4FJ5A 1D8YA 3QO9A 4I2PA 1NOMA 2P51A 3RJIA 1ZQVA 4F92B 4Z0UA 3RB3A 3KJVA 3T5KA 4I2AA 3Q8MA 1WAJA 3RWUA 1WAFA 3ZT4A 8ICTA 4P2HA 4I2JA 1UAXA 4JWMA 1NKCA 3H4BA 4JLHA 2Z1IA 4RW4A 2HHWA 4E7JA 3K57A 1SKRA 1A76A 5HP4A 3MDAA 3ZT0A 4KHQA 4IG0A 5DKWA 3OYDA 2ATLA 3PX4A 4J2BA 3B0XA 4AH9A 3GV8B 1WCNA 4LZDA 3RB0A 4YQWA 3G0ZA 1ZQCA 3EZ5A 3FDSA 1KTQA 4KITB 4EYIB 4DL7A 1NK9A 3G6YA 1JL1A 1NK4A 5J1EA 3PMLA 2MAXA 3OYNA 4J9MA 1BQNA 2PYJA 1RBVA 4W5RA 2RPIA 2BDPA 2C28A 4ECTA 3GV5B 3TI0A 1WSGA 1J5OA 1DTTA 1ZQTA 1Z00B 5L1JA 3AVLA 2BCUA 4HUEA 3NH1A 2BGGA 5KT2A 4BXOA 2GV9A 4FVMA 1ZQSA 3VQBA 1RDAA 4F5RA 3PX6A 4DU1A 3RJHA 4B9UA 2P5OA 4CGGA 4OGEA 7ICEA 3ZT3A 3L2QA 4PPXA 1ASWA 4OLBA 8ICXA 2PXIA 2ZUDA 1C0MA 4JS4A 5K14A 5KTQA 4M45A 1RT5A 2QKBA 1ASUA 3HWTA 1S9FA 4YN4A 1A5XA 1ZQMA 2I1QA 2AGPA 3B6OA 2KW4A 4YXMA 4BACA 4UB1A 1WSEA 1SUQA 3DRRA 1IXRA 1S6PA 1SV5A 3JSMA 4RQ0A 3I0RA 1LAVA 1BGXT 3MABA 1KRPA 2Z1GA 2R8GA 3OJSA 4CEOA 4KLLA 4FM1A 4J9KA 3C94A 1BCMA 5C42A 2JEFA 4RNMA 4YR0A 4GLXA 4I9LA 2UVVA 1C0UA 3RH5A 1C7YA 3OYGA 1SL1A 3HVTA 1S1UA 1PZNA 5L1IA 3G10A 3NHGA 3SI8A 3JPSA 5KFCA 5JUMA 5DBCA 5TZVA 4M47A 4RW7A 5DMRA 3HPHA 3LANA 5D4BA 3AUOA 5CJ7A 1NJYA 4CGIA 3AVGA 7ICUA 1TKZA 3TR8A 5EU7A 1COOA 4X5VA 1ZQWA 3UPQA 3AVCA 4FJ7A 4I2CA 5BOLA 2FLLA 5J0SA 3KK3A 1EP4A 4CJ5A 1RYRA 1C0TA 1F21A 5J2FA 1LB2B 2HNZA 9ICOA 3KKSA 4B8CA 2F8TA 4F2SA 2XHBA 3KD5E 1S10A 4ED6A 1JLCA 4RG8A 3F9KA 4CF8A 4LVSA 3SPYA 4CF0A 5J0OA 3KHLA 4KLOA 1RXVA 5J2PA 3H8SA 2YNFA 2ZTCA 1B92A 4DLGA 1Z00A 3NGDA 3NGZA 5CZ1A 4QZ8A 2LYHA 4Y1DA 1CXUA 5KFPA 3VQ4A 4E89A 1S9GA 2HHTA 4CF2A 3ZT1A 5HRPA 4FJKA 4O3OA 5DB9A 2NRZA 4YD1A 1BIZA 2F1HA 4KTQA 4F4KA 4M3UA 3DLHA 2I5JA 4TURA 2OPSA 5EWGA 2W9CB 4DQIA 4P4PA 3C1YA 5J2GA 3PR4A 2YV0X 5KG0A 2OA8A 2O4GA 1HJPA 4AHCA 7ICTA 4RQ6A 1D9DA 1LV5A 2DY4A 1VSHA 5J2BA 4DL4A 1KFTA 1I39A 3ZSQA 2X78A 3NF9A 4LSNA 9ICWA 3VQ8A 2G8KA 3LP0A 4F93B 4F2RA 4ECUA 5L9XA 1YVUA 1Z25A 4FM2A 1S9EA 4QZFA 4QZ9A 4W5OA 4Z4FA 2W9CA 3TAEA 5J0PA 4RNOA 3KHRA 5KG7A 3Q8SB 3QNNA 3KTQA 4DMNA 3TAGA 4DLEA 1RILA 1RPLA 1V9PA 4DQRA 3VQEA 5E41A 1LW2A 3C21A 5DDYA 3ZD8A 2IBKA 1Q8IA 1S1TA 4NLKA 3QEXA 2P5GA 1S0OA 1L5UA 4CHNA 5C24A 5CWRA 2XY7A 3OGUA 2GBZA 4H8KA 4K8XA 4J2DA 5C5JA 4RQ7A 4PGXA 3P5JA 3TAMA 2VWJA 5KFSA 1REVA 3MFHA 2P6UA 8ICZA 1VSMA 4F8RA 1TL1A 5J2HA 1BPDA 2ZTDA 1ZQEA 4B8AB 4I9QA 3AO5A 2J6TA 4CHPA 4ED0A 3RMBA 2NUBA 1HNVA 2A1RA 4CHOA 4J9SA 2Q3SA 3RBEA 1NJZA 5KT7A 4CHZA 4RPZA 8ICGA 5FRNA 4F3TA 1NJWA 2BPFA 1UT8A 2F1IA 3AU6A 4CGJA 3RMCA 1RYSA 2NRWA 5CHGA 3IAYA 3TQ1A 1JIHA 4KLIA 4KLJA 3NGIA 4KLFA 1JLBA 1VSDA 3AA2A 4C8MA 2BQ3A 4MEXA 5HRSA 8ICBA 8ICEA 4DTOA 3DLBA 4DU4A 2ZJ8A 4M0AA 4KKOA 4K4IA 3V9SA 3AVJA 3KHHA 4M9NA 5KG1A 5T7BA 4KB1A 1WLJA 3VQDA 3C2MA 3U3GA 8ICMA 1T7PA 3NAEA 3RRGA 1BI4A 1VSIA 1TV9A 1S76D 1ZQXA 4FK0A 3VQ7A 4YP3A 1Y88A 4J2AA 1KFDA 4YNQA 3LAKA 5HROA 4LSLA 1D8LA 4DTRA 1CZBA 4IRKA 2PYLA 2FMQA 4DFJA 3F73A 3IHQB 3S9HA 5KT5A 1CUKA 4I2QA 4DTMA 2UVWA 4F4XA 2DFHA 3V81A 1NK6A 3GILA 1X1PA 3RJEA 2AQ0A 4O44A 3VA0A 4DEZA 4CJVA 3UXPA 1W0HA 3C2KA 1ZBFA 1D5AA 4I27A 3OS2A 2P1JA 3KIOA 4NM1A 3L2VA 4Z4IA 1RDCA 3MEDA 4KAZA 4PHDA 3HP9A 5C25A 4B9MA 4K4GA 1JMSA 4HYKA 4DFMA 4QWBA 2RF2A 3CG7A 4FJHA 4UBCA 1IM4A 4XQ8A 3CYMA 2PI5A 3V1RA 1HQUA 2F8SA 1UOCA 5D3GA 1RBUA 1C1AA 1UT5A 3C23A 3RAXA 3QEVA 1MC8A 2AQ4A 2ZUCA 4ELVA 1NK0A 1Z3EB 4CE9A 4DQQA 3ISNC 4FBTA 4M42A 4CIGA 2BR0A 4LH4A 1HUZA 3DRPA 1J53A 3IM1A 2RDJA 1A5WA 4CJWA 1ZQZA 4M04A 4F4WA 4MFBA 4E1NA 3ISDA 4FM0A 2OPPA 3V9ZA 2DFEA 4DG1A 3K5NA 4HUFA 4UB4A 2PFNA 3V7JA 4PHEA 5HRNA 4RQ8A 1BHLA 4IG3A 4PUOA 4JV2A 4IR1A 3Q8KA 1HPZA 4CFDA 2A1SA 2X74A 2NRTA 4W5NA 3O4NA 1KVCA 3BQ1A 1NKBA 1VSFA 1RDBA 3LZIA 2PY5A 3BQ0A 4DOCA 3NF7A 5KFAA 1RCHA 2AJQA 3TFSA 1CEZA 1HUOA 4CJKA 4RQ5A 4CJUA 4F5PA 1EXNA 5DDMA 4DTUA 4PH5A 1XS9D 2BCRA 3GFKB 4RQ4A 3QEPA 1ZJNA 3Q8QB 4Z6EA 3LWMA 5DB7A 2O4IA 3MR3A 4O3RA 3RJJA 4Q8FA 5CYQA 2XY6A 5KFQA 3MBYA 4DL2A 8ICIA 4NLNA 1ZBLA 9ICNA 1VRTA 4JUZA 4ECQA 3B6PA 4CESA 4ECWA 1TKDA 5KT3A 2JEIA 1QE1A 4CERA 4R8UA 1WSJA 4KI6A 4F5QA 4QAGA 1ZQLA 3LP1A 2MUTB 2W9AA 1TGOA 3WNGA 4BGDA 4B9VA 2BKEA 1G15A 1L3VA 5F9LA 9ICHA 1TAUA 2W8LA 1QS4A 3QETA 2BANA 3K4GA 1BPXA 1BISA 3DI6A 1LAWA 2NRXA 2KZMA 4QWEA 4OKKA 4AHTA 4FK4A 2OZMA 4O3PA 4ZTFA 4FLZA 3L3UA 2FLPA 4CFCA 3K5LA 4B9LA 4M6WB 4CJ3A 5SZTA 4FW2A 3SQ4A 3Q8RB 1D9FA 4JV1A 8ICAA 2G8IA 4KREA 4XUSA 3JPNA 3SJJA 3OYIA 4FS1A 4DSFA 3ISCA 3OJUA 3KLIA 3AVFA 2MUTA 1MQ2A 3RTVA 1FK9A 1XSLA 1N48A 5CB1A 3H8WA 3T5LA 4YXJA 4QW8A 3T5JA 2OPQA 4J2EA 4O3NA 4PQUA 2D5RA 4HCBA 4DQSA 4RW8A 4UAYA 4PA1A 5BPCA 3PNCA 5J2DA 9ICFA 2ALZA 2X6NA 4CHQA 3KHGA 2VG5A 4HVJA 2FMPA 3EY1A 4RPYA 1KEJA 3HXMA 5DB8A 4KMUA 4DTJA 3C6UA 4CEAA 5J0XA 3ZDCA 4DU3A 8ICHA 3GIJA 1TVAA 3M8SA 9ICBA 1BIUA 2BGWA 1ZQQA 4UB5A 1ZQIA 7ICLA 1DOQA 3LPUA 1UA1A 2YKMA 3HSTB 3DLRA 1RT1A 3MEEA 4F4YA 1BPBA 4CK3A 5KGXA 2ASDA 3SUOA 4CCHA 3HK2A 4I2HA 4DSIA 3VQAA 3OYAA 8ICJA 2D0CA 4Z4HA 5J0RA 4M3ZA 2GWSA 1YTUA 4FZZA 4PGYA 1Q9YA 3VA3A 1CXQA 2XY8A 3OYLA 4IQTA 4WE1A 3NGYA 5KG6A 2OZSA 3PV8A 1T4GA 4KHSA 1KLMA 4OLAA 7ICOA 3K59A 2LSNA 5HP1A 5HRRA 5DB6A 1MSWD 3IG1A 2G8HA 2X6SA 4KN7A 1RXWA 4N56A 1KVAA 4KHWA 8ICUA 3LP2A 3OYKA 1ZQOA 2XCPA 3LALA 3KLFA 4DOBA 1NKEA 2IDOA 4ECSA 4MFFA 2VA3A 3MGHA 4F4ZA 2PFQA 4FJXA 1KFSA 3ZDDA 2FPLA 2ZJAA 2IS3A 4FW1A 3GIKA 4R65A 4KLUA 2HVIA 3K2PA 3N4MB 3V9XA 4QOZB 4BWMA 4CFAA 4CK1A 2FBTA 3AVNA 3TARA 5KFKA 2XY5A 1ZQJA 3AVKA 3PR5B 3JYTA 4JK1A 4N76A 3SV3A 3OS1A 3ZDEA 5I42A 2BQUA 4EZ6A 4O5KA 3UQ0A 2ZD1A 1HQEA 5CP2A 1XHZA 3DOKA 2HVHA 3EWAA 1IKWA 1EXQA 3ISBA 2DFFA 1WNSA 3S3NA 3MEGA 4GMJB 4J9LA 3V4IA 4RUAA 2JZBB 4DWIA 5DQIA 3HPGA 3IRXA 3OVNA 4O55A 4RW9A 3RRHA 2A1JB 4FBUA 4HTUA 9ICUA 2HHQA 4AHUA 1JL2A 2ZUBA 5CZ2A 9ICVA 2KFZA 2F1JA 4ID5A 7ICVA 4KB0A 2HNYA 4KFBA 4MF8A 2E6LA 4YFKA 1ITGA 2Y1IA 3JPOA 4JV0A 5KFFA 7ICGA 9ICSA 1R0AA 4ZHRA 3OSNA 2YKNA 3IS9A 4I2DA 4OPJA 1SL2A 1BQMA 2G8VA 1JXBA 4H4OA 1TK5A 1GOBA 2BCSA 3BGRA 3AO4A 2BQRA 5KFNA 4ID1A 3ITHA 1Z26A 5KGWA 3RJFA 4CGFA 4CJFA 3RMDA 2I9GA 4XRHA 4R63A 4FJMA 4R5PA 7ICIA 3THVA 4J9QA 1C1BA 5KFRA 1VK0A 1RBTA 2ZJ5A 1RT6A 2WOMA 4PHPA 4QZIA 4KN4A 3SZ2A 3OS0A 4FLYA 2OYQA 5DBAA 3K5MA 3Q8LA 3NBPA 3JPQA 3QZ8A 1YT3A 3NDKA 4IQWA 5KG3A 4NLGA 2E6MA 3GQCA 4QWCA 3V6JA 4NCAA 4DS4A 1UWBA 4IDKA 4UQGA 2IC3A 1TVRA 1RT2A 2ZE2A 3CFOA 4B3OA 1DTQA 8ICSA 3N97B 3OYJA 1JLQA 5KFTA 3RR8A 1GOCA 4J9NA 4DO9A 3HYFA 5J2JA 4RT3A 4UAWA 4FJ8A 1H38A 3OHBA 3G6XA 3CQ8A 4DF8A 3SV4A 2OPRA 4Q44A 4DF4A 3LDSA 1JLAA 3H7IA 3ZD9A 4UB3A 2D0BA 4AHRA 4OGCA 2RDIA 3MGIA 2WTFA 1WN7A 4KI4A 2JEJA 4KLGA 4PGQA 5DG8A 5KFDA 3PW4A 4RQ3A 1T3NA 4CJEA 4YMMA 3U3YA 3Q8PB 1RTDA 3KD1E 3DM2A 3EW9A 1U9LA 4CECA 8ICOA 1X9WA 1IKYA 4M3XA 4O4GA 1FKPA 2YNHA 2QK9A 1MQ3A 2IHNA 4DS5A 4BWJA 3HO1A 1QSYA 3AV9A 5KFLA 4CEFA 4F91B 3QEAZ 4OKJA 1CLQA 4CEZA 4B9SA 1IG9A 8ICNA 2VG6A 2HNDA 4Q43A 4P4OA 3TAFA 3ZDBA 4DSLA 1C6VA 3LAMA 1TL3A 4FJJA 3BJYA 1L3TA 4BE1A 5J0QA 3U6FA 4EP5A 4W5TA 3D0PA 4CF1A 1S6QA 4HCCA 3PW5A 1ZQPA 3HW8A 1NJXA 4YVZA 1YTAA 4NLZA 4CJQA 4N41A 4TSXA 1QQCA 3DLKA 4I2EA 4M9HA 4E7IA 3OYCA 3KK2A 5IIMA 4KHUA 4N47A 2Q0ZX 4M3YA 2IA6A 3H4DA 5KFXA 5DLFA 4K4HA 3AO3A 2XRIA 3EPIA 9ICJA 4ED7A 3VQ9A 1WSIA 3TWHA 2QKKA 4ECZA 3KLEA 3RR7A 4OKEA 2IOCA 2C22A 3PY8A 3HP6A 4Z6CA 1QSLA 4BDPA 4FLXA 1RT3A 1WCLA 4UAZA 2VA8A 2HHVA 4O5BA 3H08A 3ZSVA 5IIIA 2RKIA 3ULDA 4DFPA 1XO1A 1Y97A 3SNNA 2FLNA 2W9BB 3NFAA 4QZDA 3PO4A 2R8HA 1B43A 3AVHA 3PO5A 2J6SA 4ED8A 5HLFA 5KFEA 3BQTA 1RTJA 3RH4A 1HYSA 3SYZA 3MR6A 4CJ4A 5DQHA 1HJRA 5D46A
chains in the Genus database with same CATH superfamily
3H46O 5M2UA 5E3QA 2DNMA 9ICLA 4R5PB 2BM1A 4Y2MA 4FS2A 2D9OA 3UXNA 4HACA 3KOOA 2YX4A 3BS9A 3PACA 3CDWA 2FVQA 1ZBHA 5J2KA 4ZPWR 4D3HA 2O8CA 2HAFA 5B66U 1NHKL 5IT9Y 2EAOA 4I2IA 4CDGA 2QWRA 4K0KK 1Q4RA 3PW0A 3CM5A 3LPEA 3PHTA 3QINA 5J29A 2DFLA 2YY6A 3M8YA 3ALRA 1K6YA 5BYRA 3W3DA 4CEDA 3HJEA 1UPMB 2FDNA 1NOZA 1K1QA 3C15A 1Q79A 4QZCA 3M8QA 4NJ8A 4ZVEA 1NU0A 4FJNA 2EZZA 2ZM6J 2AJFE 3GTYX 2ZOGA 1N32J 3EL2A 4UY85 4OZLA 2HAIA 2XYHB 2AV5A 2O8EA 1BPEA 1OMSA 4BS2A 2ZDOA 3FYHA 2WTUA 1L3SA 1GAOA 3NVWA 1WTFA 1TYQB 4WKYA 1U48A 4QR0A 3NE6A 3KMQA 4M5MA 3SUPA 4ED3A 3I82A 3ZT2A 2B4JA 1CS4B 3ETOA 1FKOA 3QIPA 4CI6A 4E7KA 7ICHA 2FYXA 2IHMA 3WKDA 4M9GA 1J5EF 3IWLA 3O4QA 2A1JA 2PZSA 3OV7A 4FWPA 2YB1A 4YFUA 2PA8D 1SKSA 1U7LA 4QIWC 2BM0A 3TSUA 4P52A 2XLJA 4QCLA 2IMWP 1Z1ZA 2O8FA 2IDEA 1N5YA 2JOQA 4QBUA 2V9KA 1I3AA 2OP5A 1TFRA 4W90B 3HOTA 1CJVA 3AO1A 5DGBA 3F2BA 2WUSA 3M8ZA 3P5BP 4TY8B 1FRLA 1IVZA 4O3QA 2XC9A 1LXNA 4RZRA 2UV8A 7ICNA 1HIYA 2J9CA 2D4WA 2CIMA 1RWPB 5L1KA 1C1CB 4LF4K 2OEHA 1GOAA 2GFFA 2NXUA 5KAKA 4KLSA 3W2VA 4X62J 4UUXA 1P9YA 2HVZA 2OPRB 3JAMO 4DV7K 4QWDA 1BLUA 1JNRB 5EGYA 3L2RA 4QZEA 4ILGB 4NI2A 2B43A 2ISPA 1OH5A 3CC4N 1QZ5A 1Y5IB 3T1HK 3T41A 4P2XA 1XI1A 4BR4A 5FROA 2AU0A 1ECWA 1QQ7A 3VQ5A 2RS8A 5J2NA 3V9UA 2Y0SF 3GFZA 3E2EA 1C0FA 4ZVHA 4DPWA 1WORA 1RAEB 4LF9K 2BABA 3AA8A 3CJ8A 4M5JA 3KK7A 1Q95G 4I6YA 1X31C 4B3MK 4DFKA 4V19J 2E1EA 4L3QA 3NF6A 1YJUA 2BYCA 1TKTA 3SCKE 3UW1A 1XU4A 5LMNJ 1QLNA 1NDPA 4PG7A 2KN7A 2QL7B 1CJTA 4X65J 2VJUA 3SMPA 5KFMA 3GV7B 4Z94A 2W24A 3ZTSA 2FVRA 3TZYA 2WF5A 1SV4A 4ZVGA 3NS1A 2APOA 1KVBA 3K2YA 1FK9B 1NHVA 7ICJA 3KLIB 3I76A 3G71S 2FIUA 1NOYA 2MQ8A 1J54A 2CUYA 5KG2A 4DV6K 4CK2A 1LW0A 4RBVA 5ALVA 4J7CA 1U1LA 1RDDA 2E66A 2D1KA 3KLGA 1HQUB 2OHFA 5J2EA 2DYAA 4HLBA 4A8WA 5DGAA 1OY8A 2BRKA 3R1LA 3VQCA 2V8GA 4HDHA 3SPZA 1U1RA 3CTRA 2IPOB 2HS3A 1XN9A 2JVOA 3ELHA 3K17A 4WJBA 4LIWA 8ATCB 2G8FA 3MXMA 1RHKB 4JI0F 1MWYA 4TVAB 4MJKA 1NBWA 2Q66A 3S6EA 7FDRA 1UVLA 2VASA 4PWWA 1Q81T 4YCXA 3EN9A 5KFIA 3QUQA 2O8FB 5C42B 4NLSA 3ULEB 2VWKA 3PW2A 3OYFA 2D41A 2V2ZA 1HMVA 4WXWA 4PL8A 1V97A 3Q83A 3CMAN 2D3ZA 3GFHA 3VVTA 1LKYA 4XO0A 5KRSA 2U2FA 1HA1A 2KZZA 3A8JA 2R2RA 5CAAA 3N4PA 2RN2A 3EVOA 2MKHA 1FFUA 5KFJA 3Q89A 2BRLA 1VK3A 3M7VA 3TTCA 3MECA 4ZLLA 5I9EB 5HN0A 3U4LA 3R9LA 4RUHA 5KNIA 2HQDA 4EHTA 3HJFA 2B7CB 5K14B 4IRDA 2UVRA 2F7VA 5GAGU 5EUHA 1NMDA 4IFYA 1RU1A 2H4YB 2QWOA 4Z6DA 1HW9A 5K8NA 1HMVB 4TUSA 3PYGA 2P9KA 3SQ0A 3D1HA 4IXCA 4QYZK 5HNKA 1ZQBA 8RUCA 1V5IB 5JICA 3M3ZA 2NUHA 1VR6A 4WFAL 2DY1A 1RT5B 2AHOB 4ZPAA 1NGIA 3I0SA 4LF7K 3OHRA 3MEDB 1ZBIA 3CM6A 1TMJA 4UB2A 4FP9A 2WK4A 5HJXA 2P9LB 2B56A 2YNGB 3CD7A 2L3MA 2HKEA 1ED1A 4UB8U 2MY8A 3RB4A 3CCLS 5CYMA 3F44A 1YBAA 3U1MA 4P7VA 2QWPA 3OR2A 3GIRA 4KE5A 4B3RJ 1P9QC 1L3UA 3OSPA 2HHXA 2BW2A 3NMUA 1EX4A 1FVSA 3MDQA 4DUYK 5JRTA 3EE8A 3W9IA 1VCTA 3CJCA 4O5CA 3AU2A 4JV5F 3F2DA 3O3FA 5F3XB 4UY8T 4IQVA 4LIRA 3QEIA 7AT1B 4JKEA 1YZ7A 3SSQA 3UD5A 5KG4A 5G5GA 3M6UA 4QYZJ 1N36J 3HX0A 3ORYA 1EQMA 4JI1F 3M8RA 2G13A 1EAYC 2ZJRQ 1XNRK 1X3MA 3DOLA 5AQYA 5T14A 2V8HA 1UJ5A 1IIPA 5DJBA 3UCGA 3VQQA 2MKKA 4ZPBA 2LCWA 2RILA 2QLWA 2KIVA 2Y9TA 4GC6A 3S3MA 4C3MA 5ALWA 4CH0S 2NREA 2YHAA 4CJRA 1S0VA 1VQ6N 3UN2A 2K4HA 5AKLA 1U49A 4IQUA 3MD1A 1UQVA 3D4JA 4KH0B 3V7KA 4MQ3A 2YNGA 1S0MA 2XG8A 4OV6A 3MXJA 3WIVA 3H3NO 3M32A 2XS2A 2JGUA 2ZH8A 3EPGA 4ELUA 1FEEA 3EGZA 2KKZA 1R3NA 3OLBA 1SH0A 1CZAN 3VEOA 3A5MC 3AY9A 1R6YA 5KFHA 3IAM9 4Y2YA 1DTTB 4KBOA 1J6ZA 1X9SA 4ZJOA 1HRHA 2QA1A 2V4RA 3V72A 3O5TB 3C14B 4ZH4A 3FZMA 3W2VB 2FJEB 1Q8BA 1U8SA 2VH7A 2ZHOA 3WKAA 4USKA 4FZMA 1ZJMA 2K4IA 3WHIA 3HSDA 2KFYA 4JI6J 4MDAA 3OVSA 2E1RA 1RE1B 3LTOA 3ZSZA 3OVAA 4M3RA 4DOAA 2R8IA 3LK9A 3JPRA 1HPMA 3CETA 5SUHA 4U7BA 4Y2XA 2AWZA 4ZCMA 4TLRA 2FB0A 1PC4A 3POTA 3O1LA 3SCXA 2BPCA 1TKXA 1NG9A 3NS6A 2E1ZA 4RLEA 3D2EA 4M7XA 2V34A 4FNIA 4PL1A 1T9YA 3EZOA 1OVQA 1UPPA 4F5NA 2BKNA 4CZKA 4BRQA 4O4GB 3GIIA 1VSJA 3M2UB 1TL7B 3PYEA 1DK2A 3HMJG 2FVSA 3CFPA 4DL5A 4QZBA 1D8BA 5F1XA 2VQEJ 1K8KB 4IWVA 4RJVA 1HHSA 1ZAVA 2VOOA 4GV3A 4F36A 3E0FA 4FZVA 2CRLA 4BRGA 4PYAA 3O9TA 1UAWA 3IG8A 5K8PA 3BO4A 1YX2A 2PFDA 4E1MA 3AA3A 3BQ2A 5F41A 5EWEA 3ZSWA 2W54A 8AT1B 2AYEA 2F1FA 3ATUA 4X2BA 4JYAJ 4OJGA 1ZPVA 3H2LA 5LXYA 5F9NA 1NGFA 4FYWB 1JLQB 3T6BA 2X7IA 2XGPA 1QVGR 5F0UA 3CJ5A 5ETLA 3DDIA 4IL6U 5KRTA 5AQPA 3EGNA 4Z4GA 5DG9A 2YQ0A 3VF6A 4LFBK 2AJ2A 1EP4B 2F40A 4C8YA 3MCAB 2LQ9A 2OTJS 1GLEG 1BA1A 4WF9Q 4KHPF 3GJTB 2F65A 2YHBA 2JZBA 3V7LA 3VAJA 5HHHA 5BYQA 3TTFA 3FCWA 4W92B 1XMQF 1KDHA 2B4PA 4FF1A 4BGAA 2OTJN 1NLVA 2IDLA 5LM7E 5JS2A 3SCJE 2BE2A 4Q8EA 1OXJA 2DR5A 5IM0B 1NDLA 1GTHA 1K73T 3RJIA 3HHDA 4O3MA 1MU2B 3J8AA 1QAIA 4UOHA 5LMNF 1RAIB 1WAFA 1K73O 2MLXA 3DRSB 3FCVA 1TZ0A 2LM1A 1X5PA 1UAXA 5B0AA 3C15B 4LF8F 2FF6A 3ET6A 3E51A 2IA0A 4LQ9A 2W1BA 1VQ4N 2QARA 3T9NA 4RW4A 4B17A 4OJ3A 4ZN1A 2K4EA 3K57A 5JMNA 1A76A 5HP4A 3J7AN 4I6MB 2HF4A 3O44A 3MDAA 3CCRN 4YY3F 4TYAA 3Q23A 3ZT0A 4KHQA 3OYDA 2WRMA 2QL9B 1ATNA 4M5NA 2M9KA 3D1QA 3BGOP 2D3O1 1E6YB 1IKXB 4YQWA 3EZ5A 3FRYA 3FDSA 4KITB 4EYIB 5J1EA 3DU6A 3OYNA 1L8LA 1S59A 4USIA 3CDUA 1GK8A 1RBVA 4WE1B 4W5RA 4K2XA 5KL8B 1FESA 1SIJA 2WW8A 4CLFA 1I94F 1N5VA 4PKDB 4OJ6A 1Z00B 1ZQTA 3LDLA 4HUEA 5KT2A 2B7BB 3O80A 1KQSR 4Q2MA 1SH3A 5L1MA 4NLTA 5H1SV 4NE9C 2ZZMA 4AYBC 4NXMF 3PX6A 4PABA 2EFPA 2KYZA 4DU1A 2QKQA 2EBGA 2P5OA 2DXDA 4P72A 4CP5A 2QYCA 2XNQA 1YJWS 3H59A 1E4FT 4OLBA 4A46A 3R2DJ 3RG6A 3W9JA 4MKBA 4JB8B 1J2MA 5AKZA 2YX8A 1XR5A 2QWQA 2GMHA 1C0MA 4JS4A 5LL6Z 3ZXWA 2CFXA 1UVJA 3A0HU 3QJJA 2HBQB 1OWXA 4M5KA 3JTOA 4YN4A 5HLFB 1ZQMA 3P45B 4OJOA 2AGPA 2BUNA 4NYOA 2KW4A 1M90T 1WI6A 2DGZA 1FRHA 4UB1A 1SUQA 2YKMB 3CJKA 4CH7A 2COLA 3AODA 2JSXA 3O9QA 3PJ9A 4IDHA 2QA4S 1TVRB 1IUJA 1VQON 3BSOA 1KRPA 1QM9A 2RLTA 4J9KA 3R9PA 5L8RC 3KUEA 3W5XA 4I9LA 4GLXA 2IYGA 4JKFA 3RH5A 3OYGA 3AARA 1SL1A 2QWNA 5BPNA 4NA3A 2DCLA 2O8CB 3NHGA 2BUPA 3N6NA 5TZVA 2GV1A 4M47A 1ZTTA 3CULA 2K1RB 2ILZA 2DR9A 1NJYA 2K8GA 1WOOA 4ERDA 7ICUA 4DKWA 4MIWA 2CPZA 3HSCA 1GFWB 1KEKA 3RRKA 3CCMS 4FJ7A 1UVNA 5J0SA 2QEXN 1O6XA 1C0TA 1F21A 3KJFB 4MKYA 3R6MA 5AQOA 1H0HB 4LF4F 1LB2B 5ALEA 2XHBA 3KD5E 2KICA 3TA0A 4ED6A 2GQQA 3D9BA 4JI7J 4RG8A 3F9KA 3G82B 4PG8A 4A8QA 5B0BA 3PDNA 2EZYA 4KLOA 3OVBA 3J7YI 5J2PA 3H8SA 2CQDA 3IMXA 4BRNA 4LR8A 3TVYA 2KHOA 3EJMA 3PIOQ 2HMPA 5KFPA 4U7UK 2QA4N 1J27A 3U1NA 3MMAA 2XLKA 3NCPA 4CF2A 1GEHA 5HMWA 3QT8A 4OX9J 5HRPA 4DR6J 1UZDA 1R31A 5C2GA 1MA9B 3V4MA 4AM6A 1HR0F 2NRZA 4F3QA 3PKMA 1SUQB 5ETVA 2F1HA 5HMZA 4KTQA 2I5JA 5BPLA 1WF0A 2OPSA 4QPTA 4BVPA 2W9CB 1NZBA 4DQIA 2P9UB 5JU5A 3G96A 3PR4A 2J4RA 4AQYK 2O4GA 3QFPA 5DDRC 1NSAA 7ICTA 4RQ6A 1G1XA 3M30A 5A6WA 3LP1B 1F2HA 5J2BA 4ZS6A 4IH5A 3GCWP 3D68A 2OELA 2HWHA 1RYUA 1KFTA 3ZSQA 4OI6A 1FJGK 1M5HA 3HKWA 3VEXA 2G8KA 4C1NI 2NSBA 1T44A 4F2RA 4H0XB 3UR0A 5L9XA 2H5IB 1YVUA 4FM2A 2RT3A 2J0XA 2QLFB 4QZ9A 1XIQA 2ZJQQ 2YWWA 1RKJA 3Q7CA 4Z4FA 4Y34A 2F63A 5J0PA 4FWMA 4UTGA 2G5HB 2I5JB 4DMNA 3G25A 1ZD3A 2YKOA 5B7WA 3R9KA 1O13A 2EWSA 3TA2A 3VQEA 4DCOB 2KE7A 3ZD8A 1VFJA 4A59A 2YMPA 2UXBF 4FO0A 3M6GA 2ACMA 1S1TA 4OYOA 4NLKA 2I38A 1R59O 4NB4A 2QO3A 4QYRA 4X66F 1HKGA 3OGUA 5EX3A 1D0EA 5E84A 2F5GA 1D9AA 4RQ7A 3QX7A 2MGZB 3EGWB 2HFOA 2B3TB 1T3QA 1S7HA 3J7ZT 4ZHRB 1NGDA 4JKHA 4CBUA 3MM6A 4OX7A 2P9CA 2QLBB 2Z0GA 3K9KA 2P6UA 8ICZA 3CJ9A 5K8OA 1VSMA 2XZWA 2ASMA 3D0HE 3BR9A 1BPDA 2ZTDA 1ZQEA 2AT1B 3UI3A 1FKAF 2DWQA 4OJ5A 2WONB 3RBEA 1XMOJ 4CHZA 1SCJB 4M5DA 3ISZA 3TUPA 3W8GA 2XZTB 3SQOP 1NJWA 3O1BA 2GIRA 2HCFA 3CDAA 2M0NA 1NHUA 1DKGD 2YKPA 4KLJA 5AI9A 4KLFA 5IT9O 5ALHA 1VSDA 2BE2B 5HRSA 1HNWJ 2H1YA 2DR8A 5E3PA 1H2TZ 2KB2A 2O1PA 4ZP6A 4WK3A 2HQFA 4DU4A 2V2QA 3AY0A 4K4IA 3KHHA 4M9NA 5KG1A 4M5GA 4KB1A 3DLGB 4KV8B 5K9FA 5ETSA 5AQQA 1VMBA 4G1QB 2MQOA 1PIEA 4CLKA 4JK7A 3ZLJA 1HNVB 1HWLA 4MK8A 3JQKA 3PJWA 4OIXA 1EIYB 3AAQA 1VLBA 4WQ5A 1KFDA 2HHHK 4YNQA 5HROA 4F0HA 4LSLA 2IJNA 1X4DA 1D8LA 1CZBA 2LMRA 2FHJD 1KOHA 3H3OB 5KT5A 1O8BA 1YJNS 2UVWA 4F4XA 5AJ3F 3OR2B 4PXDA 2D6FC 3RJEA 3VA0A 4DEZA 4C23A 3UXPA 1W0HA 2M5YA 3C2KA 1D5AA 4RW4B 2QYGA 4LRDA 2FI1A 4N77A 3FSIA 3MEDA 4GO7X 4KAZA 1FFGB 4PWUA 4H4MB 4B9MA 1QQMA 3FAHA 4HYKA 5K8MA 3JS6A 3CG7A 4OZ1A 5LJWA 1FI4A 4UBCA 1KQGB 2M4MA 1IJJA 5LJVA 4QS7A 1X4GA 4BQLA 2I8EA 1BO5O 1IR1A 5CXTA 1T9WA 3V1RA 1HQUA 5GIPA 5J2QB 3O9RA 1C1AA 3GCXP 3WK9A 2HLUA 2VC0A 1MC8A 2JHEA 3OL7A 3D0GE 4O8UA 1Z3EB 2EXUA 4UB6U 4DQQA 3ISNC 3SXLA 2PO4A 4CIGA 2BR0A 4LH4A 1J53A 2RDJA 2MDAA 4KH5A 3AN1A 1EB0A 4CZGA 5MAOA 2LVWA 5D0EA 4AQYF 1GLBG 3DWLA 2IMOA 2MJNA 3ISDA 3ENOA 4FM0A 1PVPA 3I5AA 4NL9A 2XI9A 3SCLE 1MDUB 4PHEA 3VQSA 3G2XA 3ADAC 4IG3A 3TRGA 1HPZA 2A1SA 4ILLA 3D5MA 3L4BC 2E88A 1BG3A 3RF9A 4B3MJ 2WF8A 1SV0C 5G0RA 3VOVA 3BF1A 3D2SA 1VSFA 3LZIA 3UDLA 3PSTA 4QR2A 5KFAA 2AJQA 1HUOA 1RACB 1S99A 1VQ4S 3I5CA 4F5PA 4PH5A 2MB0B 5GAEI 4RQ4A 3C14A 3FMWA 1ZJNA 3LWMA 2WBMA 2ZUGA 4WFNL 3DGVA 3N5BA 4H0TB 2QTDA 2IIRA 5CYQA 1ZA2B 2W43A 5EN1A 1SV0A 4DR7K 2GS8A 1X5OA 3N79A 3EXCX 4CESA 3RUBL 1GX5A 1WUAA 2C3MA 4CERA 1RCXB 2LQJA 1S1XB 2VG7B 4FPAA 2GVZB 2YTCA 2CGKA 2R7WA 1X5SA 1N60A 1TGOA 4EHUA 2MHNA 5E2QA 2Q1NA 1TAUA 3LOUA 2W8LA 1QAYA 3QETA 1JLGB 4U67Q 3CI5A 5BXIA 2CQHA 1LAWA 3DI6A 5AT1B 2JWNA 4CWBA 3C66A 2M8DB 1S4EA 1RADB 3AA9A 1U6BA 2CZ4A 2GGPA 4F0MA 1Y5NB 2OZMA 2VGMA 4O3PA 2C1EB 4Y2KA 3CJ2A 4FPRA 4CFCA 1I1GA 4LF6J 4OX8A 5SZTA 1RHMB 2LEPA 3Q8RB 1D9FA 4JV1A 8ICAA 3L09A 2NCKL 3QT6A 1VBXA 3LDNA 2ZUAA 2VD3A 3AVFA 2R7VA 3HM8A 3J7AP 4YDUA 1VQLN 1FX4A 1NMNA 1KR4A 1R7IA 3H8WA 3QXGA 3T5JA 1R0CB 4YHHJ 5DS7A 2J7UA 2AX0A 2EC2A 3CMEN 3ISND 2P9UA 4RW8A 2W03A 3NCQA 4UZCA 1G2EA 3PNCA 4DR5F 1VQNN 3KK1B 1S1UB 4C3LA 4H54A 2VG5A 4HVJA 2FMPA 4RPYA 1KEJA 2HDOA 3VGUA 3JXUA 1HKAA 1KDNA 2D3UA 5ETPA 8ICHA 4DU3A 1TVAA 9ICBA 1BIUA 4AL5A 3G6EN 1RDWX 1JKHB 2JH1A 1ZQIA 1Y0HA 3F5AA 2ADBA 7ICLA 3LVWA 3HSTB 1SJQA 3MEEA 1BPBA 3UE5A 3SUOA 4OFZA 4CO5A 4I2HA 4NRTA 4DSIA 3CCEN 2BZ2A 5EX5A 2WSFC 3OYAA 2D0CA 2BJ1A 4Z4HA 4YS2A 4FF3A 4H5NA 4P71A 5A2QO 4I56A 3DC2A 4PGYA 1Q9YA 2D8CA 2X51A 5CYMB 1JNZB 1KP6A 1CXQA 4WE1A 1TV6B 4JKBA 3FCHA 2ZH1A 3PV8A 1KLMA 5F8HA 2DISA 1F5SA 5HP1A 4HI1A 5HRRA 5DB6A 1M5VC 1RXWA 1L7OA 4KHWA 4FFDA 4CF3A 2NUUG 2MY7A 1QDUB 4DOBA 2ZIUB 1IJEB 3U1LA 2IDOA 4ECSA 3MMBB 2MSNA 1Y64A 3BSAA 2FPLA 1H2VZ 1XNRJ 1PK3A 4L75A 3N4MB 4QOZB 4LUBA 4TKTA 4PKGA 2FBTA 1KXPA 2GO9A 1U2VA 5FPMA 3HI9A 1ZQJA 3PR5B 1VQLS 4CNQA 5I42A 2BQUA 3L3FX 2DHHA 1SC3B 4C48A 1U0SA 5CP2A 2UUTA 4JI2J 1IQTA 1RHQB 1XHZA 2HVHA 4QU7A 3EWAA 4W4MA 3VENA 5H9FK 3ISBA 2DFFA 3E66A 2JH7A 4J9LA 1X60A 4DWIA 3T1HF 5A8KB 1HNXF 3E8OA 3WU2U 2GO8A 1WEZA 1C4AA 1HWIA 4C8ZA 4DR7F 1BQMB 5EY4A 4ZLJA 2KFZA 3ZTOA 1FRJA 7ICVA 3H42A 3VR1A 1RT4B 3Q8UA 4K42A 4KFBA 3N4QA 1A0OB 3H2VE 2QW9A 2RQ4A 1FXRA 4KGVB 2Y1IA 4JV0A 2J76E 4IOXA 3OSNA 2CJBA 5AZJB 5FLXY 2V0NA 3CB4A 1WSVA 4H4OA 1TK5A 1Q7YO 3BGRA 4K43A 4ID1A 2PKEA 2DHAA 4EX7A 4CJFA 2OCEA 3RJFA 2ZZNA 4CGFA 3RMDA 1URRA 1XMQJ 2W2QP 4XRHA 4R63A 4HHHA 5HR7A 1DBDA 1ESVA 2GELA 3AQOA 3LM9A 5AQSA 5AXMA 4YB6A 3THVA 2DD8S 1N61A 3WK6A 2KJ8A 1SIWB 1X4FA 2V6AA 1HNZK 4QZIA 4LFBF 4USHA 1BDGA 3OS0A 2IFXA 4GO5X 2C3YA 1GXTA 5AQXA 1CJKA 2DNLA 4PWDB 2GO7A 3NBPA 2CQCA 1YT3A 1P8ZA 4TLQA 2P9KB 4CI0B 4LFBJ 3CNQP 4NLGA 5AQWA 4QWCA 3KLEB 3V6JA 4NCAA 2QC3A 4DS4A 1V9OA 3IBCB 2B9XA 2IC3A 1TVRA 2E5JA 4A8SA 2KG1A 4BRHA 3OTOJ 2ZE2A 3KLVA 3CFOA 3JAMU 2QRRA 3J81Y 4WZMA 3DFEA 2Y1LB 3OYJA 4M63A 5KFTA 1NM2A 4J9NA 4QIVA 2EFNA 3SFUA 1O03A 3ETMA 3UM9A 2OHDA 3CQ8A 1T11A 2JGAA 2OPRA 2AEJA 3BQ7A 1DTQB 1RAHB 5AIBA 3IR6B 4CVNE 4XH1A 3D2WA 2W40A 2WTFA 4DHVA 2RQMA 2KYXA 3U3YA 3Q8PB 2JH3A 1HNXJ 1RTDA 2P9IA 3BGUA 8ICOA 4CZJA 3OXLA 1IKYA 3MCMA 3PNIA 5GAHU 4MN4C 3ZNJ1 4IZ9A 2YNHA 1UHUA 2QK9A 5ALOA 2IHNA 3VETA 4CD3A 2J8SA 4TNOA 1G7CB 1U2FA 3MPVA 2Q43A 2M7SA 3THTA 4CEFA 3FGVA 1YG0A 2A6OA 3QEAZ 3GSDA 2DXFA 3ENHA 3QU5A 1BQXA 3VF0B 2YWEA 1YBTA 5C24B 1ZC6A 2BJEA 1CPZA 4OYBA 4MMOA 4DSLA 1C6VA 2O8BB 4FWRA 3CCQN 1RABB 3IXQA 4FJJA 1L3TA 1IM6A 4JI0K 5AI5A 4DB3A 4PXEA 3F56A 4OLOA 4NXMK 2IJFA 5AQZA 4EP5A 4W5TA 1UFLA 1S6QA 1HBMA 1DXSA 1DURA 1NJXA 1YTAA 4NLZA 2NNWA 1N52B 3PG9A 3DLKA 1QQCA 4UOGA 4M9HA 1C1BB 4KHUA 2ZZTA 2E9TA 1K0VA 1AZSB 5AFUH 4M3YA 1BHNA 1T9UA 3C16A 5KFXA 1LKZA 3F41A 2UUCK 3EPIA 3VQ9A 2BA9A 2QLXA 3Q24A 2XI3A 3KLEA 2ZIVA 3PY8A 1R27B 4DZDA 3HP6A 5JXSA 1QSLA 1JJHA 2YNFB 1U6ZA 1RT3A 2HHVA 4C4TA 4O5BA 3PFOA 1NUEA 3VAGA 1XO1A 3J7A1 2CPXA 1SJ3P 1HLWA 3ID8A 2FZCB 1KHVA 2E8NA 1UWAA 2AZ1A 3RH4A 1HYSA 4HTLA 3RVCA 4ES2A 3M6WA 1N33J 1HJRA 1NI3A 1RLCL 2NO4A 2FJVA 9ICMA 4DR2F 3MZIA 4USMA 2MQQA 4DR4F 2UXBK 1XSNA 4QWAA 4QW9A 3T1AA 1IXKA 3H1VX 2F8EX 4IRCA 4KPCA 2YXLA 4WFBL 3F5TA 1IKVA 4FN5A 3RSEB 1Z05A 3CVKA 2FJWA 1WC5A 1BXNA 2PFPA 2X1AA 4K0KJ 3VHQA 1S79A 2QI2A 1GLCG 1EO1A 3MPWA 3GPAA 1N34J 2LM4A 3SAGA 2JC1A 1N0UA 2W4CA 1EKSA 3BKUA 3IGNA 3EWGA 1BL3A 4F0KA 3W5ZA 1HNZF 3M6VA 2NYHA 3P4IA 5AQHA 3GJQB 2Z1HA 1RWNB 3JTPA 4A5AA 3M5RA 5TKWA 3HT0A 3HHKA 3ZSOA 1VBYA 3P38A 2PD1A 1VDVA 2XI2A 3IS9B 5JVGL 4JI7F 3EX7B 1HWJA 2E1YA 3RJMB 4YMEA 3J80Y 4EBDA 2D69A 3ULHA 2AYMA 2W8KA 4LSLB 2AW0A 2QM1A 4BC3A 2YHXA 1X3NA 4J5OA 3ZC4A 3P83D 3OXFA 1Z4OA 1MNEA 3CJBA 4I69A 2Y9HA 4FLWA 3TAQA 2OMLA 3VF4A 1DARA 2QFIA 1XQIA 4TUPA 2JWLA 4B02A 1YJ7A 3R5BA 4K0KF 1YDLA 4P10A 4YMOA 4OYMA 3DRRB 2IRUA 3HPOA 5E33A 2HBLA 4TY9A 4WFXA 3JB9k 1X2IA 4JI8F 4DV3J 2XNRA 1K0TA 2HB5A 4B3TJ 3AVMA 4IJAA 5KFOA 3CPEA 4DV1J 2RVJA 3RB6A 5E26A 1P1TA 1ZQ1C 5D4OA 4W98A 4KC5A 4LRBA 3VCDA 1QJHA 3D2NA 1UVMA 4ZLPA 1KLNA 2X1GA 1BPYA 1DK3A 2C2RA 3CCQS 4PY5A 5IV4A 1U1NA 4DV1K 4KTZA 1PBUA 1Q82O 2ZJPL 4IEEA 1IR2A 4JKDA 2UXDJ 1PYSB 2F76X 2OPQB 4M5IA 2V67A 2V69A 3LPTA 3K5OA 1M6YA 3CJ0A 3KLFB 1RBRA 2DPIA 1FNOA 5GAGP 1GTEA 5JVGQ 4LVOP 3MXIA 4ECRA 4P2SA 3H45C 3NRZA 4KSEB 4CNZA 1NK7A 2AYBA 5TKYA 4AQYJ 5EE3A 3BH7B 2BCVA 4NXMJ 1URNA 3E9LA 4OPKA 2WB1F 4OX6A 2PAVA 7ICMA 4WU2A 4JI0J 3M30B 2A40A 5EOZA 3TANA 5CD4H 5LSLA 3QT5A 1RP5A 1NGEA 5DK5A 4Y65A 4YOUA 4TQRA 8ICRA 5B5EU 4EP4A 3CQXA 2FJXA 3RU0A 1B99A 4UARA 2LI6A 5L38A 4RWXA 2DT9A 4BDZA 2Q36A 3M9MB 4JHDA 2K7JA 1DT9A 2AGQA 2HHSA 1HFEL 2R8KA 5BPMA 2F9DA 4E3SA 1KD1O 4DUYF 3NMRA 1TAQA 4LQ3A 1Q81O 1WYGA 4R66A 5GADU 5FJ4A 3WK5A 3ZEUB 4LSZB 1HD1A 3MM5B 3FZLA 2LXIA 1WG1A 5KQ8A 1X0PA 4NY8A 3D2FB 1NWKA 2Y0SC 4RUBA 3MR2A 3MAAB 4C8KA 2F44A 4PG5A 2GWKA 4JI5K 3QBCA 2H3ZA 1R8PA 3MMJA 1RISA 4LC9B 1ATSA 2DRDA 4KH1B 1HKCA 2ITGA 1JX4A 1V85A 3L2UA 3OL9A 4PJ0U 1IH7A 3UKRB 1SWVA 4I28A 3LGMA 1XEZA 2QMXA 5EWFA 2JVRA 2E2NA 5J2MB 3V1QA 2XMMA 2I6XA 2ZBQA 3P3DA 4QIEA 5KFBA 3AFGA 1NK5A 3LGHA 4OHZA 4X65K 1NAQA 5ALZA 1TK0A 2MMYA 4YUDA 3OYBA 4QZAA 4FK2A 3M1VB 1KQQA 3FFIA 1L6NA 3I28A 1KBRA 2ZOFA 1O1WA 5ALFA 2YNIB 1VQ6S 4O23A 2J6UA 1FKPB 1UTAA 3O3HA 1HNWF 3AA5X 5J0WA 1JKHA 1SH2A 2C2EA 2KNJA 1MMNA 4LRFA 4KTWA 1F9HA 2E2QA 4CBWA 3EZWA 1XNQF 4ZDNA 2IHR1 3LWLA 4RKUC 4DUTA 4BDYA 1FE4A 3L6QA 2O66A 3NEKA 2FPKA 3UMGA 1WC3A 4WFBQ 3DAWA 1BU6O 2JR5A 2HZCA 1ZQNA 5AKIA 2MZTA 2XCAA 1EKEA 1X4EA 3TUIC 1ZTWA 4DR1K 1ZBUA 4JWNA 1Y3JA 4FJ9A 4GC7A 1I6JA 2GUPA 4HTJA 4I64A 4DI6A 5ALIA 1RBLA 1PC5A 2Y1JA 3KG0A 3UD3P 3CC7N 3SQ2A 5J0YA 3KLHB 1D8ZA 4P0PB 3QNOA 2OWOA 3BYRA 7ICFA 2VKZG 3A2FA 4C8LA 4C8OA 1FXXA 4HKQA 1GLDG 2R7YA 1XBWA 1MA7A 3L8BA 3IO1A 5HBMA 2ZBPA 3FEZA 4FZNA 3C2LA 1WNEA 4C11B 4J9PA 1ZETA 2KI2A 4ATNA 4KH4A 2B9EA 2A19A 3SEIA 5HMMA 3IN5A 2JX2A 3RJKA 2OSRA 2ZKUA 2RQ5A 1ZQUA 1S6OA 4PR6A 1RT6B 3UPFA 4JAXA 2GZOA 2LXFA 2BJ8A 4M94A 2ESEA 4MYTA 3OYEA 4H5TA 1FDBA 4P6QA 3O2IA 4JBCA 1AUDA 4WXOA 4E19A 3HVRA 4ZVPB 2W6LA 1U4BA 4I6WA 3EYZA 2QN6B 1OJ4A 1UPHA 2HBMA 3GJRB 2HFVA 3VN5A 1JWWA 2W9BA 4CJSA 4L8RB 1SJ1A 4LBHA 1RTIA 3KFUF 4BE0A 2HZVA 3QICA 3X3UA 3GL1A 3AVAA 2MLZA 9ICPA 4J9UE 5AQTA 1C0GA 1Q8LA 3ZI4A 2BKPA 1ILYA 1PUZA 2WFAA 4C80A 1SXEA 2CNOB 3FNNA 4EEKA 2R2SA 1D09B 1LWFA 3ZSRA 4EO6A 2ETJA 4RT2A 3MWPA 4V19X 3UDVA 1QAJA 1MU2A 2OUGA 4OPAA 1YRXA 4UY8O 3QNMA 1N33K 3T19A 1RHUB 3IRXB 1TUVA 4DPYA 5IM0A 3VEZA 3CCVN 2PMZD 3G8TA 3V6HA 4JI4J 4FSVA 2CQ2A 4PL7A 1LOUA 5AM4A 1KVJA 4JEPA 2AA4A 5A2QU 1NLKL 4A4JA 3WK4A 4MH8A 3G6VA 2BE9B 4DPTA 1Q5YA 3SUQA 2FBVA 2R7SA 2KZ3A 4RWWA 4DSKA 1DQAA 1N5TA 1TMMA 1N5SA 4NZ7A 1RFQA 4CHYA 3QYYA 1HLUA 3J81j 3NNHA 1U1QA 3N7RC 4LY7A 4JI5F 1RNHA 4AILC 2HQGA 5ETTA 3NCIA 2VA2A 2EH9A 2E7VA 1M1KO 1WSHA 1CG2A 3BREA 3K89A 3IRUA 3C95A 3AJ1A 4DV0K 2YQ3A 1FCAA 1ZH5A 2L5YA 4RR5A 3T3FA 1M90O 1U04A 1U1PA 3J7ZO 5AKEA 4Z6FA 1FRXA 2DO4A 3V2UC 3V6KA 1NEEA 1OYEA 2F7TA 1IBMJ 2L9NA 3MF5A 3THXA 3WNFA 3H8YA 3UR3C 4KLMA 2KEYA 3Q22A 3WNHA 2B21A 3GIMA 4PRFA 4ZPDA 2RB7A 4NCGA 1COKA 5KOXA 4IKFA 4CTAA 2PBDA 3T1YK 3THYB 4WFYA 3C1ZA 2E5SA 4US9A 3SK3A 1NGJA 5DG7A 4LH5A 3VZIA 3BF3A 2A2CA 2WAQD 4ICAA 5ALUA 1ZQDA 2B5JA 2XYGB 4LFCF 5D8HB 1QD1A 2IGIA 2NLWA 2Y9UA 3MAAA 2P9NA 4UBBA 2HMIA 1GMUA 3D2FA 3N0VA 4NYPA 1HBUA 4PPZA 4Y2QA 3JQJA 4P0PA 1FJEB 2GX9A 4LZGA 4M3WA 5AQMA 4FPIA 4OI4A 5CY4A 1VQ8N 2R2UA 4M6WA 3ZSXA 1Z4NA 2E7WA 3C6UB 2KRBA 2PFOA 1VLOA 1HW8A 4E7HA 5KFVA 1XWLA 3QEWA 3UVJB 4ELTA 2Y0SD 3HRGA 2RF2B 3WX8A 4I0WA 4KRFA 1DZ5A 3CJSA 5FRMA 5AKYA 3K75D 3E01B 3HHLD 1ZYQA 2E3TA 4PYDA 3IBPA 2Q2RA 3NF8A 1V38A 3VTHA 3TX8A 1H72C 3QFUA 3TOQA 2R8JA 2H5JB 2F9TA 5EXWA 5KG5A 4Z4EA 2IVFB 3NASA 5BRDA 2I5HA 4M95A 4MFCA 5HAOA 1CJKB 3ILJA 4CO0A 2RH3A 3M2VA 4NCBA 3AHPA 5AQFA 4A8MP 4WTOB 3MM7B 8ICCA 3RMAA 1P6TA 2ZH7A 4I2BA 1TUYA 1C1CA 2R7UA 4TU8A 4ALZA 2OIHA 4BQZA 4CIFA 1TL4A 4RWTA 4FLVA 5F8LA 4G9ZA 4MAKA 1B9DA 2CPDA 1NPRA 2ZH9A 1RJJA 3RZAA 1ZZNA 1V5VA 3V9WA 1T03A 3TUZC 2QTWA 1U1KA 3UKUA 2ZBIA 3TP2A 2H3GX 5AR0A 2ASLA 3MM8A 2H3VA 4A8EA 4KFBB 3G6ES 5E7OB 2VPWB 3QO9A 1NOMA 1P90A 2P51A 4CIOA 1ZQVA 3L4QA 4USAA 3RB3A 4OJHA 3K9JA 3TADC 3SIPB 2XEXA 2HNZB 3Q8MA 3QAEA 4NLOA 3VCBA 4P2HA 4I2JA 4H4OB 4ZMMA 3H5YA 2E7XA 1NKCA 3CCJS 1NPPA 4QIWF 4DL0C 4DR3F 2DR6A 2BJ3A 1K44A 2NRHA 4H5RA 1SKRA 4USJC 3H2UB 1Q53A 2QMWA 1Z1VA 1VRQC 4LF5K 2VKQA 5FD1A 2NS1B 2ATLA 3PX4A 4J2BA 1QQ5A 3GV8B 3R5JB 4LZDA 3O0FA 2VFTA 1Z1BA 1IG6A 1BWVA 2HGNA 4F26A 1SJRA 2HK3A 1NK9A 5IT4A 1XMQK 3G6YA 3FZBA 2FZKB 3NG8A 1RXOB 3PIOL 2ZIWB 3W65A 3LO3A 1E6VA 4ECTA 4F3MA 3GV5B 4DV3K 2W7OA 1DTTA 2LP4A 3OD2A 3AVLA 2QMUB 5GINA 5CA5A 3NH1A 1L3KA 2K8CB 2QIFA 2A6AA 2GV9A 2OGUA 3I96A 2MKSA 1UW9A 1QVFM 1KN5A 4F5RA 2R18A 4B9UA 4DHYA 4E8UA 4NXNF 3KVGA 4CGGA 4OGEA 3VESA 7ICEA 3ZT3A 4PPXA 1ASWA 8ICXA 4UOFA 4OZ3A 4GVBB 3DLLQ 3H0LB 4K4XA 4HT7A 1FJCA 1EARA 1F5AA 1REGX 4EIAA 1FTCA 1R6VA 5K14A 2XWXA 3MM8B 1F5CA 4M45A 2RRAA 2HOEA 4B3TK 1A5XA 3UMBA 1KOOA 5ADXA 2YQEA 5HR6A 3DRRA 1SQEA 1KLMB 3UN3A 5IQ6A 2K06A 2HRYA 1S6PA 3R5GA 3TVKA 4RQ0A 3I0RA 2DGVA 1IBMK 3TKAA 1Z19A 5HATA 2HBKA 5DETA 1BUXA 4CEOA 1OYDA 1VQSA 2CPRA 1GLFO 1MMDA 1E4GT 2UVVA 3HVTA 1S1UA 3TNVA 3TX0A 2NRRA 3SI8A 3OT9A 5KFCA 1VAZA 5JUMA 2FJBB 5DBCA 1MWQA 5THWA 5D4BA 5DM6L 4KGKA 5CJ7A 2LA4A 4CGIA 1WJ9A 4O8KA 1X9XA 5L39A 2ZH5A 2CRXA 4NPOA 2CGLA 3GU3A 3L0QA 4CRXA 2IM2A 1COOA 4WKRA 3EDRB 4QNLA 1ZQWA 3AVCA 4I2CA 3GB0A 3KK3A 3R5DA 4JI4K 2CZVC 1VLYA 2MSTA 3ITHB 3R6LB 3WKBA 2HNZA 9ICOA 4FXVA 3ZZ0A 2GNKA 4RQMA 4BR0A 3QU4A 1JLCA 2UUWA 5B0CA 4CF0A 5J0OA 3KHLA 3GE9A 4EU0A 2HRTA 4Y2AA 1RXVA 3D3BJ 1RA7A 1KWMA 4LF9F 2P35A 1IKYB 2LYHA 2R7QA 5AXKA 3EICA 3EUNA 2C2ZB 3MOZA 3VQ4A 3CJQA 2HHHJ 3OTQA 3MR7A 2KN4A 2XLIA 4AL6A 2KJ5A 2JRZA 4LF1A 3ONQA 5GADP 3MM9B 3W61A 2E2PA 1VI7A 4TURA 2HFUA 2GIFA 4WK1A 2OA8A 4BRFA 2W11A 4JV5J 4DR6F 1D9DA 2IVYA 2DCUB 3VGLA 3ET6B 3WC0A 4MO4A 1I39A 4B3RF 1HBOA 2ZDPA 1XJWB 3DLJA 5L9NA 4JI7K 3NF9A 5BR9A 4F93B 1RAJA 4ECUA 3R2CJ 3OBYA 4B9QA 1S9EA 1WBBA 2CQ0A 1U2RA 4OJLA 3IBWA 2KHDA 4W5OA 5IS2A 1VQMS 1TKZB 4E98A 2ATCB 2W9CA 2B0CA 2J7KA 3TAEA 3KHRA 4RNOA 2I2YA 3QNNA 2GLEA 4QZVB 5JTIA 4DLEA 2G4BA 1L7MA 2DNQA 4YN3B 4NL9C 3DXMA 5G5HA 1RPLA 1V9PA 1LW2A 2FD2A 3C21A 4CF5A 5HQLA 4MTPA 2VPYB 3Q8VA 1CJUB 2IBKA 3ONNA 4ETZA 2JLGA 2O8DA 2W25A 1L5UA 4QJFB 2ALYB 4LFAK 2KM8C 2G0IA 2GBZA 4H8KA 2BBEA 3GG1A 3NVZA 3TAMA 5KFSA 3TSQA 3NGUA 4XH4A 1DHMA 1RHJB 1DQ9A 2UUAJ 4A61A 4DUZK 5AE1A 4QJVA 1IKVB 4DV2F 1FJGF 4B8AB 2MEWA 4ED0A 1DY3A 3RMBA 2NUBA 4YORA 4KT0C 4HL9A 1XUPO 1NJZA 4Y2CA 5KT7A 1ACMB 2DGTA 2V51B 4F3TA 6AT1B 5AE3A 4BC2A 3VGSA 2F1IA 4B6JA 3EMTA 3HKZD 3ZFVA 2NRWA 2CDQA 1N6QB 1WG4A 1GNKA 2FZGB 1BUPA 3PEJA 4FWKA 4C8MA 4MEXA 3H5XA 2P6TA 8ICBA 1N54B 4IUFA 1Q3VA 2X3GA 3PRBA 4RW7B 3C0BA 3KJNB 2PFFB 3DLBA 1APSA 4DG1B 2ZJ8A 1WACA 3AD9C 5AFUA 3V9SA 3AVJA 4IQMA 1W7WA 4MYUA 1T7PA 4CF4A 3TW0A 2Z2MA 5DM7Q 2VPXB 3GZ7A 2FVCA 1VSIA 1S76D 1RU2A 2JXJA 1BQNB 4FK0A 3VQ7A 4YP3A 1LQ9A 3LAKA 4GVLA 3GYXB 2DGQA 1CS4A 3NS7B 3D1OA 4DTRA 1P8GA 4OJPA 2FHMA 3KKFA 2FMQA 3F73A 4KBIA 1RK8A 3DLKB 4PQAA 3TO8A 3P49B 3BUZB 4ID5B 3HX9A 5AKJA 2XMVA 3GBTA 3GILA 3RBZA 2AQ0A 2YY3A 3OW2R 2O01C 2F8HA 4CJVA 3HBTA 1ZBFA 3B6BA 3OS2A 3BO3A 3L2VA 2Y1RI 4ILRA 4CLUA 4YB5A 3C8YA 3QGHA 1RDCA 1X66A 4PHDA 2PC6A 3NRWA 3AEVA 1S49A 3W7BA 2N4CA 4DFMA 1RTJB 5AK4A 1Y5LB 3C7NB 4GY2B 2WSEC 3MN9A 4CT8A 1J97A 3OA9A 2EANA 3CF5Q 4CRJA 1CVJA 1TFWA 3O5BA 4ZCKA 4CYUA 3RAXA 1LNQA 2KJWA 3CCTA 1FFSB 2FC8A 3JSRA 4CE9A 2Q3PA 1E6VB 2IAJB 4M42A 4QQBA 3DRPA 2CPHA 4PZOA 1HNIB 1F44A 4QOTA 3K5PA 2UXDK 2DEIA 3PCOB 4CJWA 4M04A 4F4WA 4MFBA 2HF3A 1ZXIA 3O9UA 3AJ2A 1XNSA 5AXNA 3G8SA 4E1NA 2NO5A 4DV6F 4TN2A 1G3OA 2BOPA 3QRPA 2PFNA 3TTDA 4RQ8A 4PUOA 2MZ1A 3FFIB 2CYYA 2X74A 3IUCA 2UUAF 4UW2A 2AJ4A 3I55N 3O4NA 2ZHBA 3FGUA 1VQOS 2OTLN 3FRZA 1NZ8A 3BQ0A 1TL3B 4CZFA 1GQEA 1RCHA 4F25A 1CEZA 4NWIA 1VJQA 2AEMA 5DDMA 1WB9A 1SJ4P 3AJDA 5AKGA 3GFKB 1WKLA 3QEPA 2ZFHA 2KHCA 2XO6A 1WDTA 2BX6A 1N88A 2XY6A 5C2FA 3MBYA 1VRUB 3ZZTA 8ICIA 4NLNA 4KY3A 4WFAQ 5ALNA 4JUZA 4ECQA 1SC4B 3B6PA 4ECWA 5KT3A 2XS5A 2DTJA 4R8UA 2FF3B 2WFBA 1WSJA 4KI6A 4WBFA 2CJAA 4F5QA 4QAGA 2G2OA 1ZQLA 3N4WA 3WNGA 4JI5J 4BGDA 2RMLA 1L3VA 9ICHA 1J5EJ 2JL9A 2BANA 4DX7A 1BISA 2NRXA 4QWEA 3HULA 4OKKA 1T02A 3M2VB 4IH6A 4U8VA 4B3OB 4ZTFA 1ZA1B 2FLPA 2EDUA 2YWKA 3K5LA 2FLOA 1HUXA 3EDQB 3H90A 4CJ3A 3KUGA 1I51B 4C9DA 1F1BB 1YSJA 1T95A 2R7RA 1FFVA 3ISCA 4X4VA 3KLIA 3QT7A 2MUTA 1PG5B 3G71N 3RTVA 1FK9A 1XSLA 1N48A 4DR2K 2WVDA 1BD6A 5AQKA 5CB1A 3DXMB 4FWOA 2OPQA 4JI8J 4O3NA 2JFKA 4HCBA 3WXMB 3OFHA 3VVUA 2ODGA 4Q0BB 3HHLA 5BPCA 1YJRA 1Z2LA 9ICFA 2ALZA 1M5SA 5DO2A 2ZH4A 2X6NA 2J9EA 1TE2A 3HF5A 3BN7A 4WYBA 3UQSA 1NGGA 4DTJA 1C4CA 5B0EA 3D6HB 3ZDCA 1QVGM 2HYIB 3M8SA 5M1FA 3CJ4A 2UUBF 5CQGA 3BBBA 3JTNA 2GQ2A 2KO1A 2UUCF 4Y28C 2YKNB 3N01A 4GKJK 3WBZA 4BC9A 1JMTA 2DNNA 3LPUA 2YKMA 1RT1A 1U6FA 4CK3A 1YI2S 2W01A 2P2CB 2EG1A 3SD7A 3VQAA 3V5RA 2HSZA 2PN6A 4X4PA 8ICJA 3G82A 2UUCJ 5J0RA 4U96A 1B4FA 5ALDA 4M3ZA 1HR0K 3AOBA 4BJQA 1DGJA 1SPBP 4FZZA 2AIRB 4BREA 3DNCA 1SJFA 1UETA 3VA3A 2AX1A 5I4MA 3ZZRA 4X62K 2OZSA 1BMQB 1X4HA 2OFGX 3CJKB 4OLAA 7ICOA 3BY5A 2CNKB 2LSNA 3GE1A 2A6MA 1T6CA 1W2BR 4DR5K 4OYIA 2XSFA 1KVAA 1Q16B 3LP2A 3OYKA 1ZQOA 3I5BA 3KLFA 3K0SA 5HI7A 2NYVA 2LBOA 4B1WB 3MGHA 4F4ZA 5AI8A 5F8NA 3ZO7A 3ZDDA 1ZM9A 3AAPA 1Q5VA 4FW1A 2DNHA 2PDAA 4JI3F 3B4DA 2LFVA 4KLUA 2DL0A 2HVIA 3UN5A 3QRQA 3UWTA 3H8MA 3MWBA 2ILYA 4Z2XA 3QBXA 1R43A 4LFCK 4KGZB 2QWMA 4JK1A 3LGNA 3OS1A 3BB5A 4EZ6A 4DR3K 3CCUN 2CJYB 1VC5A 4OQJA 4NLQA 4JKCA 2H3FA 3DOKA 3BN4A 1EXQA 3A0BU 3MGJA 2DBBA 1J5EK 2ADCA 4OPHA 4TXSA 4KJIA 3MEGA 5JLFA 3V4IA 2XULA 3HD1A 3S41A 2O8EB 1KAYA 4C3KA 1L7PA 4O55A 5E0OA 2AF6A 3KNAA 2XMKA 1P1LA 1DRZA 4AHUA 3P96A 1JL2A 2N1RA 1JB0C 2G5IB 2WBRA 1QAXA 1QUVA 1JJ2M 4DN9A 4ACOA 4QPXA 3VMFB 4I6MA 1KAZA 4MF8A 2E6LA 3CO9A 3JPOA 2YKNA 2JJ4D 3G87A 3VEVA 2M3DA 3KZBA 2BCSA 4IO1A 1SXDA 2JNJA 5E3CA 1VQPS 3HSJA 2JV3A 2I9GA 4WFZA 4R5PA 2WW4A 3CIZA 3HLUA 1Q1KA 7ICIA 1MN9A 2ZBCA 2ZJ5A 1RT6A 4K4UA 5AQJA 2WOMA 3TEHB 4KN4A 4UOCA 1T9VA 3SZ2A 3CCWA 4FLYA 4DCJB 4EENA 5DBAA 4KX3A 1ELOA 4Y2IA 3SAFA 1SQFA 4FZLA 2Z2LA 3WEEA 5HVFA 2K89A 4QS8A 2GJFA 4IQWA 1IJFB 2N7YA 1AQ6A 1WSRA 4FNHA 5FP0A 5ALTA 4L76A 3VEYA 1UWBA 3EKUA 2P9SB 4K4YA 2L48A 4ZOSA 4UQGA 2KH9A 1VC6A 5E79U 4P2MA 4ER8A 5D4LA 4B3OA 3QJPA 1ZZFA 1DTQA 3R3TA 1UL3A 2FHKA 3VWSA 3QIDA 3KWIA 2KL8A 2J0WA 4FJ8A 4BRKA 3OHBA 4A47A 4DF8A 1VISA 1RQ0A 3H25A 1VQ9S 2G2ZA 1FO1A 4DF4A 3LDSA 1H2UX 1BWFO 1JLAA 3ZD9A 4G1IA 3MGIA 4HH1A 4OD0A 4K7QA 4KI4A 2JEJA 1K47A 3UB5A 4PGQA 4KHPK 2LDIA 3PW4A 4RQ3A 4N7TA 3VV2B 4CJEA 2XYPB 3J80U 5C10A 3R27A 1WDDA 5HANA 4CECA 5GADI 5HL7Q 2FJAB 4WP9A 1X9WA 5BR8J 4O4RA 3HFZB 1JJ4A 1EX8A 4O4GA 4JI3J 2FY8A 1TU0B 4PKHA 4BRPA 4DS5A 4BWJA 4N8NA 3AV9A 1PJ7A 3U27A 2E5GA 2MQNA 4F91B 2MZJA 2UXCF 2V2KA 4OKJA 4ZPCA 2FQQB 3DYAB 2IYIA 4DOZA 2QE5A 2OO4A 2VG6A 4Q43A 1NXIA 3TAFA 2PFUA 5CHCB 1VQKN 3LAMA 2M0GB 2WAQF 2W6KA 3BJYA 3C65A 4U7UD 4BUGA 2QJ3A 2KP7A 4XDCA 2ZWOA 3FZ2A 3W66A 4HCCA 4L74A 2ZH6A 5JMVA 4A2AA 4LR7A 3KLGB 4N41A 4URSA 3SMZA 1WEXA 2YWFA 1GX6A 1S9EB 2Q0ZX 1UP1A 4X4SA 3I4HX 3AB4B 5IOLA 5IXUA 4F04B 2CG8A 4K4HA 3AO3A 2XRIA 4ZITA 1FJGJ 3NVVA 2CH5A 3OBIA 1DRGA 3RR7A 2IOCA 3BS5B 3H0RB 1M1KT 4FLXA 3SCIE 2E5LF 4UAZA 1WWVA 3ZSVA 4FDFA 4CZIA 1CJTB 1FDNA 1KQFB 1YKWA 1Y97A 3SNNA 2FC9A 4DZ6A 3NFAA 4QZDA 3PO4A 2QSWA 2EG2A 3AVHA 4DDFA 3PO5A 3I33A 4P75A 5EE0A 2BEFA 3ZZZA 2Y8YA 3SYZA 2DUYA 3TZWA 3OLAA 5D46A 2DRBA 5ETKA 1X4BA 4WWSA 2E8AA 1EJ7L 4CO4A 3I9ZA 1KCFA 3MCSA 2D0AA 2FBYA 2RUSA 3I0RB 2PMHA 9ICXA 2R42A 3TJ8A 1R0AB 4LFAF 3BGLA 3SBMA 2MPUA 4X4TA 1VSKA 3H8JA 1A6LA 4USVA 4KRWA 5F3ZA 3DRXA 1N56A 3I31A 5HMLA 2KOBA 1XO0A 4ZJLA 3MM6B 2AGOA 4DTXA 4DV5K 2VBZA 3CCZA 1F60B 2W9MA 4AHVA 2E9RX 5K20B 3MUVP 4A8FA 2ZGYA 3KDNA 4O5EA 1WG8A 3KK3B 2JMGA 8ICYA 1JN3A 1NK8A 1Q9XA 3M8PA 3HZEA 4DV4J 2V9WA 3MGVA 2OEMA 2V5HG 4DX5A 1YF5L 3THWB 4Z37A 3OYHA 2ZD1B 1RZTA 5A8RA 2QFJA 2HHUA 5CH7B 1QHTA 3IKMA 2OD4A 2DK2A 2DY9A 4EBCA 2OPPB 3TAPA 3AOAA 4IFVA 4F5OA 9ICAA 4RW6A 3SJHA 5A8WA 3A3NB 2KJ9A 2E2OA 4C8NA 4XIUA 4Q45A 3OY9A 2XSJB 2ZTEA 2IC3B 4AF1A 4K2JA 4EZ9A 4NXZA 5ITHA 3MHYA 4MDBA 4DN0A 5J2IA 4I7FB 3A8EA 4JN4A 2FMSA 4F7VA 3N7PD 5I3UB 3IDHA 4CEBA 3BDPA 2XMUA 5IT0A 4Q5VA 5CZXA 3IR7B 4YR2A 1YTYA 3EE9A 4M9JA 5IZHA 8ICLA 2HVDA 1FX2A 3BM7A 5F8MA 3ZX2A 2NRVA 2CQGA 5CE3A 4YHHF 2CVEA 1SS6A 3QEBZ 1S1VA 3ZSYA 9ICTA 1X8DA 4HEA9 2VDIA 3AO2A 3ALYA 2ZJRL 3AH6A 1C20A 3UIQA 5CR0A 2A3ZA 2D0PA 1MLAA 3A8IA 1VJ5A 1IO2A 5C25B 1F3VA 4J9OA 2J9DE 4NLRA 4RNNA 4GXIA 3RAQA 4R64A 4BGBA 1F9EB 4UAVA 2G0CA 4R8UB 3CW2C 1M5KC 1CZ9A 4M8LA 3CC4S 3SLCA 4CLTA 3VAIA 1B64A 2F8LA 4MEYA 2W2PP 2E1CA 4NLXA 2LKZA 2EX3A 1X7VA 2KQ2A 4NMXA 4B1UB 2G1DA 7ICPA 2HSEB 1B9FA 4W5QA 4OZ5A 3WK7A 1UEUA 2E29A 5EVZA 5EHHA 5CYJA 1S77D 1X9JA 4TUQA 3QERA 1EWQA 3DLEB 3MDFA 2K4PA 3GOIA 2OTLS 3MTJA 4IBNA 1IG8A 5J0TA 3OTOF 4EMDA 2O8DB 2MZRA 1FFWB 3ULEA 3DEEA 2H3IA 8ICFA 4DTPA 4EFAC 4KKOB 3OQ2A 5DRKA 3R7SB 1S97A 3BPDA 2W3RA 3KJQB 3D7SB 3HVAA 2JDJA 1B3TA 2HW3A 2B51A 1BCOA 4KLEA 4MK9A 1GMWA 1CI4A 1JJ2R 4NA1A 3CGIA 1A5VA 5J2CA 4P73A 1I3OB 3C5GA 2QLJB 3SENA 3AQEA 3D6JA 3M9OB 1HYVA 3WQTA 3RGIA 3CUNA 3TQEA 1EWRA 4NM2A 4LF6K 5HMXA 2OAUA 2Q1LA 4MFAA 2A2DA 4I2GA 3PYDA 3UQ2A 3O3GA 3OYMA 3VQ6A 3CJAA 2W42A 4JS5A 1TK8A 5LY3A 2AP6A 5HQMA 1EQYA 1VHIA 2EVZA 2N3LA 4ISEA 1NB2A 4BVOA 5JVHL 1VQ8S 4F72A 4GVMA 3GR1A 2OYYA 1S48A 3U8XA 4B9NA 1JXVA 2HMXA 2HOQA 1DGSA 2BVZA 2VGNA 4F50A 2H9ZA 1U25A 4NZ0A 2F2AB 3HM9A 9ICKA 1AW0A 1BY9A 2VBYA 4ANEA 4BG9A 4DR7J 4DX8H 4CM2A 1QE1B 2GUIA 4FWNA 4N8OA 3VPZA 3S7RA 2P9EA 5L1LA 2QEXS 1RAFB 1HPZB 4TQSA 2ACYA 1KQSM 4P4MA 4EEYA 1K9MO 1XSPA 4NWBA 2FDRA 4GXKA 3MN6A 4OYWA 1RTZA 4DV2J 3BZCA 2FBXA 1TAMA 4QZHA 4DL6A 2XMWA 3JSYA 1B0PA 2VQFK 3WXLA 5DBBA 1XC9A 3L3VA 1ZQAA 2RD5C 4LSNB 3THYA 2P9SA 4CF9A 2H4WB 1IBKJ 3K8WA 1W7AA 3WNEA 3JPTA 3RFAA 4WYWA 5K5MA 4LD0A 1ZQKA 3PW7A 1IKXA 2CPIA 1K9MT 3PUFA 4N5SA 2YN4A 5LMUK 8ICQA 2IOHA 1OVYA 4ZTJA 3LZJA 5LMNK 4CT9A 2WF6A 3WXKA 2GJ2A 3GWCA 1J9AA