4DSEA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dseA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dseA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dseA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dseA01
3G6YA 1UA1A 9ICSA 4FJNA 1FKPA 2RF2A 5L1IA 3OHAA 2W9BB 5EWEA 4B8AB 3WNFA 4EEYA 2HVIA 4M2YA 2RN2A 3HPHA 1NK5A 1FXXA 4J9KA 1IKYA 4F5QA 3QLHA 5HBMA 4FJ7A 4KLJA 1ZQVA 3V9WA 4YD1A 1WCNA 5KG4A 1RTHA 4PH5A 3MXIA 2B4JA 5DB8A 3QINA 1S1WA 2AQ4A 4B9UA 4DFKA 5KT5A 3OSPA 2OPPA 4CGGA 2IHNA 4O3SA 4CIEA 2ISOA 5FDLA 3RAQA 2F96A 4EBEA 3QERA 4CF0A 4O3QA 1EETA 1U47A 1ASWA 3MR5A 2X78A 5J2DA 5CJ7A 2JEJA 2NRVA 2YNHA 3VQBA 4YXMA 1WSIA 1ZJMA 1ZQRA 4I9LA 4FZYA 1VRUA 3H7IA 1DTQA 4O44A 4HUGA 7ICEA 5BPCA 2YNIA 1NOYA 1IG9A 5C25A 2Q3SA 1IXRA 3U3YA 1B9FA 1TVAA 1W0HA 1VSIA 4CJTA 3DLRA 4ZTFA 1X2IA 5CYMA 4MEYA 3EWAA 3AO3A 3SZ2A 4MQ3A 4FS1A 5DGAA 5DKWA 3G6VA 8ICLA 2X6NA 3NF7A 3RJHA 2AGOA 3RB0A 9ICJA 1RTIA 4HHTA 3SPYA 3OYCA 2WTFA 3QIPA 3V9SA 2G8IA 1CUKA 3B6PA 2I1QA 4LSLA 1I39A 5CR0A 1S1TA 4DLGA 1ZQYA 7ICPA 1C0TA 2BQ3A 3VA3A 1RXWA 2R8HA 3QEAZ 3BGRA 4EBDA 4Y1CA 1S6PA 4PWDA 5DDMA 3ETLA 3K58A 5KGXA 3SCXA 1XC9A 3HYFA 4CEZA 3RBEA 4UQGA 3QEIA 2RDJA 1RDAA 2D5RA 1JLBA 4DL2A 4GXKA 1ZQCA 3KKRA 3PY8A 3NH1A 3SQ1A 1BVSA 1RBVA 1T7PA 4JWNA 1EXQA 4M9GA 1I3AA 2PY5A 4RW7A 2F1IA 5KFJA 2X74A 1S9FA 4QZDA 1VRTA 3AVLA 4RQ3A 2BE2A 3DOLA 4J9MA 5DG7A 4KLQA 4BXOB 1QQCA 1SKRA 4CECA 2P6RA 3LDAA 5KFPA 4Z4CA 4UBCA 4QWDA 4YMOA 4O5BA 1XSPA 4RT3A 1S5JA 4TUPA 4XIUA 3KJVA 3TFRA 3KLEA 1NK0A 3BQ0A 2ASJA 2HHUA 5KFWA 3VQDA 4GXIA 1WAFA 1WN7A 9ICHA 4E7HA 2GWSA 1NK4A 5KG6A 4JV0A 1ZYQA 4YD2A 3OYEA 2BHNA 2KW4A 4E19A 4QZHA 3MR3A 3AU2A 1LW0A 3DLKA 4QZCA 2ALZA 1UT8A 1IKVA 3E01A 1BHLA 4GXJA 3LPTA 4IG3A 4DTXA 1ZQXA 5KFNA 5JUMA 1V9PA 3MR6A 4BXOA 7ICRA 4F5OA 3Q8LA 5J29A 3TFSA 3OJSA 3SV4A 3F9KA 1RYRA 2BPGA 2VWKA 4CGFA 1C0UA 1XU4A 2FMPA 2ITGA 3RB3A 4KHSA 3OYKA 2ZTCA 4KLSA 3RJJA 3PX4A 4ED7A 2FC0A 5KFEA 5I3UA 8ICHA 5J0WA 4DG1A 4F91B 4KO0A 3DI6A 2FLPA 3AVHA 4YP3A 3CYMA 2XY8A 3ZT2A 3SQ4A 1ZBIA 1JL2A 4PHPA 3GILA 3C5FA 2H5XA 4DL6A 1VSKA 3RMAA 2BCSA 1MQ2A 2NUBA 3M9MB 4C8MA 3GDXA 4KITB 1SUQA 5KFYA 5DBAA 2V4RA 4G3IA 5DLFA 3BQTA 3PW2A 1BISA 4M47A 4F3OA 1ZQNA 3PX0A 4ECZA 2ZTDA 5HRRA 1TK8A 4YN4A 2FPKA 2ZJ5A 4RZRA 3A2FA 4OVLA 5KI6A 1ZQEA 4BE2A 3KK1A 5KFUA 4Z6FA 4FO6A 2FBTA 4O3PA 3K75D 4EP5A 4RUCA 8ICRA 4M9NA 3MECA 4K8ZA 4KLDA 5J0OA 5KFHA 3RJFA 3V1RA 3KTQA 1ZQGA 1IO2A 3ZSVA 5J0YA 4O55A 4MFCA 3ALYA 2YNGA 4UB5A 3LPUA 3OS1A 1HNIA 2VA3A 1VSMA 5DK5A 2HNDA 3NGIA 4Z0UA 1QTMA 2FBYA 4R64A 3SNNA 1U4BA 4F5PA 5J0SA 3ZT0A 5J2CA 4QWCA 8ICQA 3ZT4A 3AVNA 2UVVA 9ICIA 1CXUA 3SUOA 2E6MA 4O5KA 1DGSA 3I0RA 4B9VA 4I2AA 3O4NA 2C22A 3S3MA 2A1RA 2BGWA 1TKDA 1EP4A 2D0AA 4DQRA 1ZQHA 4B9NA 3CFPA 3N97B 2VWJA 2IC3A 2NRZA 4AHVA 1ZQMA 4DTUA 2G8VA 2X6SA 1NOMA 3C23A 4X5VA 3ISCA 3BJYA 1BPXA 5KFAA 4Q0BA 4FJHA 4RU9A 2Z1GA 3MABA 5J2AA 1ZQJA 2W9AA 3IAYA 1ZJNA 3VQ6A 5KRTA 2HHSA 3V9XA 4RG8A 1GOBA 8ICSA 4F2SA 4KLGA 8ICCA 3DLGA 4NLKA 5J2PA 3GQCA 2V4QA 5KRSA 3GIMA 4Q5VA 4J9PA 3H4BA 2JEIA 3GV7B 1SZPA 3HO1A 1W9HA 2XC9A 4Q45A 1C0MA 2HNYA 3K5OA 1QSLA 1UWBA 2KZ3A 3TI0A 4ELUA 4F4WA 7ICIA 5J0QA 4F2RA 4B08A 4ECUA 4IBNA 3JPNA 5KFXA 2IBKA 4QWEA 4ELTA 3PR5B 4YFUA 4UAZA 1JLCA 3KLFA 5KFGA 1KLMA 4KI4A 1TV9A 4GC7A 5EOZA 3OY9A 4O0JA 2ZJ8A 4IKFA 1TAQA 1S1XA 2W42A 4IRCA 1TL3A 5J2FA 4DO9A 3SYZA 3CQ8A 4JRPA 5D3GA 1ZBHA 2B21A 4Z4EA 5IIIA 1SKWA 4F4KA 4KHNA 5DB6A 3IRXA 4HUEA 2C2RA 2P66A 3KLIA 4B8CA 2IAJA 1RT2A 1BPZA 5KT2A 2GV9A 4FLYA 4KPYA 1PZNA 3LWLA 3LALA 1NJXA 4CF2A 3RH6A 4QZFA 1NKBA 1NKCA 1T03A 7ICTA 1DTTA 4R65A 4DOAA 4O4GA 9ICVA 4P4OA 3LAMA 5L1LA 3AVKA 2C2DA 4LSNA 1Y88A 3ZCMA 4DU4A 4H8KA 4FYDA 4YG2A 4EYIB 4ED3A 4IG0A 2GBZA 4GMJB 2W8KA 4OLBA 1KTQA 4BDPA 4TUSA 2YKMA 4B9MA 4ZTJA 3ORYA 2VANA 9ICFA 2ATQA 2OZMA 4HYKA 7ICOA 3WNHA 4NXZA 8ICBA 4RW9A 4CEBA 3PW7A 2JEFA 3KD5E 1LWFA 9ICBA 4DFMA 2AU0A 1KVCA 3AA4A 4ED2A 3VQ4A 1A5XA 1RT3A 4H4MA 4CHPA 1S77D 3C21A 1KFDA 3UPQA 4DQQA 3C6TA 1ZQZA 1BPDA 4RNNA 2ZUCA 3ZD9A 1ZQLA 4FJLA 3QEBZ 4I2HA 2HHTA 3G10A 2VG6A 4RW6A 3EYZA 4CJEA 1RBRA 4MFBA 2BKEA 3Q8RB 1QHTA 3JYTA 1ZQAA 1ZQDA 3C1YA 1NJYA 4UB4A 4O0IA 1VK0A 5IIKA 1RDBA 3OYLA 4KHWA 1JXLA 3VQ5A 4FJ9A 1Q9YA 2JEGA 4K4GA 2GUIA 1JXEA 2BDPA 4DFPA 3OJUA 4OLAA 4HCCA 5K14A 1NKEA 4ECYA 1ZQOA 4I2CA 5DQIA 4I2IA 3UQ2A 4N41A 3JPQA 4TQSA 4FLTA 3KKSA 4CJKA 1UT5A 3QETA 1RT6A 2YNFA 3HVTA 4W5QA 3JPTA 2R8IA 5FROA 4F3TA 3JPOA 4CJRA 3EPIA 7ICKA 3S3NA 3PW4A 3OYHA 4CGIA 3S3OA 4I29A 4FK2A 8ICMA 3ZSYA 3TANA 2P51A 2F8TA 2EHGA 2P5OA 1LAVA 2Z1IA 2HHVA 1KSPA 1B92A 8ICNA 2KZZA 3V6JA 4ELVA 4F5NA 4R5PA 1S1UA 4KAZA 4IDKA 5IINA 3RH4A 4DOCA 3RJGA 2A1SA 4RQ0A 5HMMA 3D0PA 1RILA 3HPGA 4BWJA 3AVBA 4DF8A 4KREA 4C8LA 3RTVA 4CJUA 1KVAA 5HRSA 4E7JA 5J0TA 4B9LA 1UA0A 3Q8KA 1BIZA 3NTUA 3QIOA 4KLLA 2AQ0A 3PUFA 4DS4A 2XCPA 2AGQA 4CEAA 4FK0A 9ICCA 1Z25A 3TQ1A 3RJIA 3QNOA 2B5JA 2W8LA 3KHLA 5HP4A 4ECQA 5J2HA 1J54A 4H4OA 2XY5A 1BL3A 1G15A 3VN5A 3L2VA 1RTDA 3KHHA 2Y1JA 4P4MA 1YTUA 3ZDAA 1EKEA 2J6UA 3C2KA 4TSXA 3QEWA 3P83D 3QNNA 1U9LA 2BCQA 1JKHA 9ICTA 2FPMA 4KKOA 4JK1A 1XSLA 1RDDA 4IRKA 1QLNA 3RMCA 4CFCA 4JRQA 2OZSA 3ZSZA 1U04A 5J0UA 2FLLA 1RT7A 1D8LA 3IG1A 1QSSA 4P4PA 5L1KA 3L3VA 1A76A 7ICVA 4F4XA 3T5JA 4AILC 3MGIA 1VSLA 1WSJA 4CEOA 1RT5A 4O9MA 3OHBA 3DRSA 4KN4A 4M3UA 2AGPA 4NYNA 2PI5A 4GC6A 1L3SA 3KHGA 4E7KA 3MGHA 5F9LA 3AO5A 4AHTA 4DTMA 2G8FA 4O3OA 2J6SA 3EZ5A 4PA1A 1H38A 4CJ4A 3HT3A 2R8GA 4CJFA 2OWOA 2IHMA 2F8SA 5DBCA 5KFMA 3O3HA 3PVXA 3G6XA 1BQNA 5KG3A 4IFYA 3QZ7A 2WONA 1HQUA 3V81A 3AVMA 4KRFA 5KG2A 2ZE2A 3T5LA 4CEFA 2C28A 2C2EA 2YKNA 4JV1A 3P1GA 1VSHA 3PNCA 3UXNA 3FFIA 3AO2A 4J2DA 3SQ0A 1JIHA 3ZSRA 3T3FA 1CZ9A 3QZ8A 3ZSXA 3M9NB 2Z1JA 1L3UA 4M9JA 4ICLA 1N56A 5FRNA 4I27A 5KFRA 4AHCA 3P5JA 2VA2A 4M9LA 4FVMA 4IFVA 4N76A 3LANA 2IOCA 4DSIA 3SJJA 2DFFA 4NLZA 4WE1A 3SQ2A 3LP1A 1HNVA 2XGPA 3SPZA 4M3WA 5J0RA 1VSEA 3AV9A 4BACA 3KK3A 4F50A 2VG5A 3NGYA 4KHQA 1A5VA 1S9GA 3LAKA 3Q8MA 3MXMA 4CGDA 1XS9D 1EXNA 4YR2A 4ZH4A 7ICJA 1DLOA 3OGUA 4OKJA 3TAMA 3NDKA 2UVRA 4CCHA 1ZQWA 3V72A 4NM1A 3C94A 4Y1DA 4DL4A 3MXJA 5J1EA 3ZDDA 3LK9A 4KN7A 1UOCA 8ICIA 1XSNA 2PFNA 1SL1A 2PYLA 3DLEA 1HMVA 4DTSA 1WNSA 3VQEA 3ITHA 4OJRA 4KTQA 2XGQA 3QO9A 1RZTA 4FJIA 4BDYA 4E1MA 3C2LA 3NBPA 1RTJA 1BPEA 5KFCA 4RQ8A 3V7JA 5HMLA 1ZQFA 3ZT1A 3CM6A 4I28A 1WSGA 2FBVA 1NK7A 4PGYA 3KLHA 1K1SA 4M04A 2PI4A 1RXVA 1RT1A 3HL8A 1VSDA 4W5OA 2ASLA 2NRXA 4F4ZA 1BCMA 3HM9A 4RW8A 1C1CA 4UB1A 5KG5A 1X9WA 4MFFA 2QKKA 1HPZA 3NHGA 5HHIA 1D8YA 1ZQKA 2I5JA 3EY1A 4QCLA 1TAUA 8ICZA 2KN7A 1QE1A 1K1QA 4LVSA 2XY6A 4P2HA 2HW3A 3ZT3A 5CYQA 4Q8EA 4R8UB 5J2JA 7ICMA 1S0NA 1WAJA 3C1ZA 1BIUA 4YR0A 4FZZA 4DS5A 1TK5A 3RJEA 4IQVA 1U49A 4CJLA 2OYQA 4HTUA 4XQ8A 1JLAA 1HYVA 4BE1A 5KTQA 3MBYA 5CA7A 3OSNA 4YQWA 3MDAA 1Y97A 4DU1A 2LYHA 4NCBA 1NK8A 5BOLA 3TAEA 4J9QA 4E0DA 4FLVA 4JLHA 3Q8PB 4JWMA 3GIJA 5J2KA 4O5EA 4BWMA 1REVA 4DFJA 1HRHA 4CGHA 4XUSA 4CF9A 3QEVA 1ASUA 3UIQA 3AU6A 3ASMA 3TAPA 2BCVA 2I9GA 4YMMA 2KFZA 4E7LA 3JSMA 2HB5A 4IR9A 4OPJA 2IGIA 1RBSA 4R8UA 3VA0A 3C6UA 1UAXA 4FXDA 2YV0X 1C1BA 3IM1A 4UAYA 2UVUA 5C42A 4LD0A 1JLFA 4CEDA 1ZQBA 3BQ2A 3UXOA 1D9FA 3MEGA 2NRWA 4PGQA 4QZEA 4CEQA 3CFRA 3V6HA 8ICPA 3ZSQA 2DFLA 2PFPA 4F4YA 3HK2A 1BGXT 3VQAA 1X1PA 4YXJA 4KMUA 1RBUA 4GLXA 3QE9Y 3NFAA 1YT3A 2F1JA 2QK9A 4QWBA 4EBCA 3V4IA 9ICNA 3D45A 4RUAA 4JS5A 4YMNA 4RW4A 5SZTA 5IIJA 4BDZA 4PHDA 5KT7A 1XWLA 4F92B 1MU2A 4CF8A 3O4QA 1JXBA 4RQ7A 1ZQIA 4DL7A 4FJ5A 4IRDA 4J9LA 1F21A 5DQGA 5L9XA 2FLNA 1MC8A 2FPLA 1ZQUA 5HRPA 5I42A 1EX4A 7ICGA 2PFQA 2E4LA 1ZBLA 2DFEA 3O3GA 1CZBA 5KG7A 4C8OA 1S0VA 4N56A 4DMNA 2IMWP 5IIMA 3DOKA 4ECXA 3ZDEA 2IS3A 2JGUA 7ICNA 4Z6EA 3HJFA 1WSHA 2R8JA 1RCHA 2DTUA 3V1OA 1WLJA 4E1NA 4DLEA 3NH2A 2KTQA 3AVGA 4W5TA 4UB2A 2W9CA 3M8RA 4M3YA 5F9NA 4FM1A 3K4GA 5KFTA 3MFIA 2XO7A 3ISDA 3OYBA 4NCGA 4PGXA 3TABA 1KVBA 4KLEA 3OYGA 3PMLA 1HUOA 2P1JA 1GOCA 1XI1A 2OA8A 4IQTA 3RR7A 5KGWA 4HUFA 4FJJA 2RDIA 5EWGA 3PV8A 5J2EA 3NF6A 4RQ5A 4DTJA 3VQ7A 3K5LA 1HJPA 4JV2A 4FLWA 1AROP 4E89A 2BQUA 2HHWA 2HVHA 5J2IA 3KIOA 1CLQA 4MF2A 5KFIA 1S9EA 2V9WA 2M9NA 4ECWA 2D0BA 3U6FA 9ICGA 1TGOA 4UAWA 5C24A 4M6WA 5KT4A 4CIFA 2FMSA 1MQ3A 3UQ0A 4CEEA 3T5KA 1ZQSA 1ZQTA 8ICTA 4YR3A 4KLTA 4I7FA 4Z4HA 3AVAA 4KLMA 1T4GA 3HX0A 2ZJAA 5KT6A 1L3TA 2ZUDA 4QW9A 3TARA 7ICLA 3K2PA 1IKWA 2XHBA 4W5RA 4FS2A 4DSFA 5DG9A 1C7YA 4ID1A 3V7KA 4CFAA 3KLGA 4DEZA 1GOAA 4DTRA 2O4IA 8ICAA 4NY8A 4CGJA 3V6KA 4ED1A 2JZBB 4Q8FA 3DM2A 2ZUBA 4YVZA 3LZJA 1LV5A 2DPJA 1ITGA 1J9AA 5DG8A 5CWRA 1Z3EB 1S97A 3HW8A 2G8HA 3RMDA 4HCBA 4Z6DA 2PZSA 3RRGA 5J2NA 2Y1IA 4DSJA 4QW8A 3M8QA 2DY4A 3L2QA 3MEEA 1T05A 1DOQA 5HROA 1VSJA 2QKBA 2E6LA 1LWEA 1NOZA 4QAGA 8ICVA 4UB3A 3AO1A 3THVA 4M9HA 1RPLA 7ICQA 5DGBA 3I8DA 1ZQQA 4QZ9A 5KFFA 4RQ1A 3AVCA 3NF9A 5DQHA 3E2EA 4ED0A 4YCXA 1NK6A 4K8XA 2JZBA 4EP4A 4FZXC 4QOZB 3TAGA 3F73A 5KFLA 4EZ9A 4J2EA 3ZD8A 2W9BA 2BPCA 4TURA 3LDSA 7ICSA 4FJKA 3HSTB 4ECVA 4F5RA 3V9UA 5DMRA 4OGEA 8ICGA 3H40A 3IS9A 5HP1A 2MAXA 5J2QA 3L2WA 1ZBUA 3WNEA 1ZQPA 2RKIA 1RDCA 4F8RA 2FBXA 4DSKA 2AJQA 3RMBA 3ISBA 5JS2A 4NLGA 2ASDA 3MAQA 3EW9A 4N47A 4PUOA 2ISPA 1S0MA 3C95A 4JS4A 5IIOA 1S0OA 4CF1A 1HYZA 4O5CA 1T3NA 4FLUA 2KFNA 4RQ6A 3LWMA 4DQIA 4EYHB 2QXFA 4OKKA 2F1HA 4ECRA 4CHQA 3NGZA 4I9QA 3VQ8A 4CJ5A 1WSEA 4FW2A 4M3RA 4Q44A 2HHQA 2PFOA 4I2EA 4CESA 4KTZA 4DSLA 3HP6A 4ED6A 1YVUA 3AO4A 2Z1HA 4AH9A 9ICQA 3T5HA 1B22A 8ICOA 1TK0A 1HUZA 1MSWD 5HRNA 4IR1A 1T8EA 4QZGA 5CP2A 3OS0A 3RWUA 3M8PA 1S6QA 2PXIA 5D49A 3OVNA 4RT2A 9ICUA 3RR8A 4Z4GA 3MFHA 3B0XA 4KLIA 2XY7A 4KLFA 9ICEA 3LP3A 4DF4A 3GV8B 3VQCA 1VSFA 3H8WA 4YNQA 1IKXA 2P5GA 3VQ9A 3DYAA 4K4IA 4PHAA 1ZETA 9ICXA 3L2RA 2ZD1A 1SL0A 1Z26A 4CJ3A 4M3TA 2DFHA 4MFAA 3OYJA 3L3UA 3OYFA 4CIGA 1YTAA 5C5JA 1N5YA 3ZSWA 5KFSA 1WSFA 4DWIA 4W5NA 1FK9A 3H8SA 1KEJA 3NGDA 3PO5A 1Q9XA 4KHYA 4KLOA 3ULDA 4R66A 4OPKA 4C8NA 4ECSA 3AVFA 3RJKA 5L1JA 8ICUA 3RB6A 5IILA 5JS1A 4J9OA 4M3XA 8ICJA 4CJQA 5J2BA 4XA5A 3AA3A 5SWMA 2BCRA 3HVRA 4QZAA 3EPGA 3PX6A 2JLEA 3UXPA 4FJGA 2ZTEA 3K5NA 3FDSA 2HHXA 4JUZA 3DMJA 4LZDA 3NF8A 1L5UA 9ICLA 1X9MA 1B9DA 2W9MA 4B9TA 5CZ1A 2VA8A 1N48A 9ICKA 1S10A 3JPSA 3CM5A 3NE6A 3GFKB 4PHEA 1TKXA 4EZ6A 3PW0A 4CHNA 1S76D 1NJWA 2HNZA 3PW5A 4DL5A 2NRTA 4AHRA 1JLGA 2ETJA 4I2FA 3SUQA 1SL2A 2BR0A 9ICPA 3HXMA 9ICMA 3DLHA 4Z4IA 4FCYA 2DPIA 3RRHA 3T1AA 3QEPA 2BGGA 3G0ZA 3TR8A 4RPYA 3SI8A 1Z00B 3M9OB 5J2GA 4BGDA 3V9ZA 1RT4A 4PQUA 1JX4A 5KFQA 1CEZA 1Q8IA 2KQ2A 4FJXA 3OYIA 3S9HA 1HQEA 2ATLA 4R63A 4N5SA 1XHXA 4KLHA 4CK2A 2FMQA 3TAQA 3LZIA 3AA2A 1FKOA 2MUTB 1D9DA 3K59A 5EWFA 3DLBA 4RNOA 2D0CA 9ICAA 8ICWA 4ED8A 1TFRA 1IM4A 2UVWA 5DDYA 4YFKA 3K5MA 3ZDCA 4J2AA 4I2GA 3OYDA 5DLGA 5DBBA 4M3ZA 1BPBA 4QZIA 5KFDA 1LB2B 4RNMA 3C2MA 4F93B 5EU7A 3VQPA 1S1VA 1Z00A 5FRMA 1HYSA 2Q0ZX 4ID5A 5KFOA 4NYFA 3HPOA 3NCIA 3OS2A 1KFSA 4DTNA 3OYAA 1BI4B 3GV5B 7ICHA 1X9SA 2B6AA 1C1AA 3KK2A 4DOBA 8ICYA 5D4BA 4M42A 1A77A 3H8JA 3NH0A 1KDHA 4IQUA 1LAWA 1XO1A 2MUTA 3WNGA 3CFOA 4I2PA 1ASVA 1NK9A 4J9SA 3GIKA 1LWCA 3K57A 5KG0A 3AA5X 3VQQA 3DRPA 3I0SA 3L2UA 7ICUA 3KD1E 4DQPA 4B9SA 4CJSA 7ICFA 4DTOA 1R0AA 1BCOA 3HP9A 5CHGA 4LH4A 3C5GA 4KHUA 4DQSA 9ICWA 1TKZA 4OGCA 1BPYA 4J2BA 4B3OA 2YHBA 3Q8SB 9ICOA 3ISNC 4QZ8A 3TWHA 3RBDA 3JPRA 1BI4A 3TAFA 4KB1A 3NAEA 1RBTA 2J6TA 3JPPA 1KFTA 4CK1A 3IHQB 8ICFA 5J2MA 4ZHRA 8ICXA 1JLEA 1BQMA 3H4DA 2ZQBA 4GVMA 2G8KA 3SI6A 5KT3A 5DB7A 2R8KA 2XCAA 1QS4A 3RAXA 1IH7A 4FM2A 3DRRA 4AHSA 2BPFA 3M8SA 4RPXA 4Q43A 4DSEA 1TV6A 4FW1A 1L3VA 9ICRA 4FBUA 2O4GA 2P6UA 5HLFA 2RPIA 2G8UA 2HMIA 3FYHA 3Q8QB 3GIIA 4FLZA 4KI6A 1JL1A 3QESA 4CE9A 3LP0A 4M0AA 3CG7A 1TL1A 1SKSA 2OPSA 4AHUA 4LY7A 2EX3A 1TKTA 3OYNA 4I2QA 5J0XA 4NCAA 1U48A 3ZDBA 3MEDA 4KB0A 4CJPA 2W9CB 4E7IA 3BDPA 4K4HA 3RH5A 2OPQA 4CJVA 5D46A 1C6VA 1WCLA 4LZGA 2PYJA 4TUQA 4C8KA 4CK3A 1KRPA 1O1WA 1SV5A 4RQ4A 4RPZA 1D5AA 3ZSOA 4ECTA 4GW6A 1KLNA 5KFBA 3V1QA 3RB4A 3PR4A 1QSYA 4KV8A 1COOA 1TVRA 1JN3A 3LP2A 1RYSA 1HJRA 3OYMA 2WOMA 4FJMA 2IA6A 4PY5A 1ZBFA 2XRIA 4CFBA 3U3GA 4I2BA 5KFZA 3SV3A 4L8RB 3PO4A 4I2JA 3SUPA 4M6WB 5DB9A 4DL3A 2YHAA 2IDOA 3PMNA 4HVJA 5TZVA 4Z4FA 4FK4A 4J9NA 3SUNA 3L8BA 1A5WA 2OPRA 1XHZA 4IQWA 3B0YA 4FLXA 4BE0A 5CB1A 4FM0A 3N4MB 1RNHA 3H08A 5CY4A 4CHZA 4J9RA 4LH5A 4E3SA 5E41A 3MDCA 1U45A 4DTPA 5HNKA 3MR2A 4TQRA 2G8WA 3B6OA 4PPXA 3V7LA 4KLUA 2KZMA 5J0PA 3HWTA 5KG1A 3AVIA 2BANA 4MF8A 2A1JB 5KFKA 4CHYA 4MEXA 1N6QA 1JLQA 5T7BA 3V6DA 2R7YA 4CFDA 4OKEA 1J53A 4O3RA 3AVJA 8ICEA 4O3NA 1JMSA 3BQ1A 8ICKA 4CJWA 1NJZA 2VG7A 5CZ2A 5BOMA 3AUOA 4FBTA 4QZBA 5KFVA 4NM2A 1J5OA 3T19A 1CXQA 5HHHA 4UBBA 4G1QA 4RQ2A 2BCUA 4KTWA 4M45A 4KFBA 4DU3A 4FJ8A 4XRHA 3O3FA 3QEXA 1K6YA 4I2DA 1LW2A 4Z6CA 4QWAA 4CERA 1KCFA 3KHRA 2BQRA 1B43A 2A1JA 4NLNA 2LSNA 4CHOA 4M41A
chains in the Genus database with same CATH superfamily
1UA1A 3ONNA 5EWEA 1KQQA 4P2XA 3WNFA 1I94F 3BEGB 4DR5F 3B4DA 1YSJA 1ZPVA 3J8AA 1FDNA 1NK5A 3UN5A 3EO3A 3OD2A 1IKYA 1DTQB 1MMDA 2XYHB 2E1EA 3M2RA 2XZTB 3BYRA 2B4JA 3MXIA 1S6UA 3R1HA 3QINA 3PLAA 5HR6A 2QA4N 1KBRA 1SZHA 1F0MA 5KT5A 3GFXA 4OYWA 1M1KO 4NXNF 4CZHA 2GQQA 1TFYA 3RAQA 4XDCA 4EBEA 1HD0A 3QERA 1UKUA 3CI5A 5F0XA 3J81Y 3CIZA 2FJAB 1R8BA 3F44A 5CJ7A 5H2FU 1WF1A 3WC0A 2W2NP 3W9HA 4LSLB 3AB2B 4YXMA 4A62A 5M1FA 3C46A 3BB5A 4C0BA 1ZQRA 3UQSA 2CNOB 1X5TA 3VVTA 4O44A 2PMZC 3W2WB 1FRIA 1FWLA 4BRFA 2LQBA 2KXNB 3J7ZO 4CJTA 1QZ6A 1IBKF 3NUQA 5CYMA 3EWAA 5FIIA 3FKBA 4CVNE 1WBDA 1VK3A 4MQ3A 2YN4A 1JLBB 1IBLF 2X6NA 2AGOA 5AM1A 4L3QA 2D1KA 2E8OA 5D77A 2V4JA 3SPYA 4CYUA 1UFKA 3OYCA 5D0HA 2PN6A 2G8IA 1CUKA 2H3EB 2V2KA 2ZZMA 3B82A 4IXCA 1GEHA 3CQXA 3MCNA 2QA4S 4DLGA 7ICPA 1N5YB 4TN2A 3R2CJ 1C0TA 2IY5B 4LBPA 4ZDNA 1QAJA 1B7FA 4NLVA 1U0HA 4EX6A 4PEOA 2B0CA 5E79U 3L4PA 2MQPA 2L9WA 2NXNA 4M5IA 3NLCA 4BRPA 2G0CA 5JXSA 2MZTA 4Z2XA 1XUPO 3RBEA 3G87A 4Y3CA 4FL9A 2HZCA 4PPZA 2RDJA 2O8BB 2RDDA 1DK2A 1RAGB 1QQMA 3WZ0A 3PY8A 2LLZA 4JKDA 3C2PA 3IBCB 1T7PA 4JWNA 4LT6A 3EXCX 4MKVA 4RW7A 4BR9A 2ZDPA 2HFUA 3E01B 4QZDA 1U6BA 4MLEA 4RQ3A 2BE2A 4LF9F 3DOLA 4J9MA 1X4AA 1CJKA 4KLQA 1SKRA 4GKKJ 3LDAA 3UDLA 5LMUF 2DKXA 4RQMA 4QWDA 5IFMA 4DCJB 3LDOA 1XSPA 1S5JA 1B3TA 3TFRA 3OT9A 3Q8YA 2BM0A 3E0FA 5C2FA 2JRSA 1E6YB 1G2EA 5KFWA 5E0OA 3VQDA 2HF3A 1FI4A 2E5JA 2PE8A 2DR8A 5KG6A 3DI6B 2YWWA 4YD2A 2HQCA 2G5IB 3HHLA 2KW4A 4E19A 4QZHA 1NDCA 1MMLA 3A3OB 1RAAB 4GXJA 1BHLA 4PKDB 5CD4H 4BXOA 7ICRA 4F5OA 5AKJA 1YIJN 2KYXA 3LUYA 1T9XA 3M1VA 3GG1A 2MA1A 4K8RA 2BPGA 2VWKA 3GPAA 2NXJA 1C0UA 2ITGA 2FY1A 3TP2A 2W1BA 3RB3A 3OYKA 3D3CJ 3HVAA 5KFEA 3NS5A 3KK1B 3JTOA 4DG1A 1Q7YO 4KO0A 4P0PB 3D6JA 4MKYA 1WUAA 1JCFA 4CLUA 3ZC4A 1RTZA 3U1MA 2ZWPA 3SQ4A 1NDPA 1JJHA 4PHPA 2D9PA 4JI8J 2AJFE 4ZS6A 4DL6A 2BCSA 2CXYA 3CC7N 2YNGB 2WZ1A 4FWSA 4ANEA 5IM0B 4WF9L 1WC6A 2OSQA 3MC1A 1YBAA 4ZKAA 1YJNN 3I76A 5DBAA 4G3IA 5DLFA 4FF4A 4JI2K 3G8QA 5HMXA 4I67A 3PX0A 1QJHA 5ETMA 2FVQA 2HBQB 2HVDA 2FPKA 2P35A 4XTTA 3SCLE 2IHR1 4KB7A 1Y11A 2H48B 3DRPB 3CO9A 1HIYA 4K59A 5KI6A 1ZQEA 2FZKB 5KFUA 4BX9C 3I0RB 4FO6A 3E66A 2DH9A 2D69A 1EP4B 4CTAA 1YIJS 5F1XA 3K75D 3TZWA 3KDNA 4X4NA 2OD4A 4KLDA 5KFHA 2UUTA 3PYEA 3FZBA 4ZVPB 3PSPA 4MFCA 5FPEA 3NNAA 2CJKA 4BR5A 4UB5A 3OS1A 2V8PA 3EGWB 3IA0A 4BG8A 3OUYA 1URRA 2F1FA 1VSMA 2HNDA 4TLRA 1BQMB 1T0TV 1N32F 1U4BA 4V19X 5J0SA 3ZXWA 4QWCA 2RU9A 3ZT4A 2LMRA 3W0LA 4O5KA 3M3ZA 2DHSA 3CC7S 3DXKB 4I2AA 4M5HA 3FGUA 3O1LA 2NXCA 4C3KA 1YJNS 3S3MA 2KD1A 2BGWA 1ZQHA 4B9NA 1WWVA 1UWBB 2IC3A 1WOPA 4AHVA 1SV0A 2H3IA 2X6SA 3U26A 1HWJA 2YJFA 4ZVQB 1KN5A 1LEOA 2MQNA 5A0YB 3KG4A 5E3QA 3G8TA 2Z1GA 3MABA 1KLMB 4Q2LA 2Y9TA 2RUGA 2R3VA 3IAYA 3QATA 1ZJNA 5AM4A 4JI7K 5ETQA 3VQ6A 3W62A 1A7GE 4OLOA 4HDHA 2Z30B 4R0EA 3E9LA 3GYXB 3BZCA 1FVSA 1YJRA 5GMEA 3OTEA 3T9ZA 5GAEI 2V4QA 5KRSA 4J9PA 2E2QA 3ZYYX 3VHQA 3GV7B 5EN1A 2XNQA 1EO1A 5K9FA 4Q45A 2HNYA 1RU2A 3FZFA 2L3MA 4F4WA 1UL3A 4RTFD 5J0QA 2MQQA 3AQPA 3H45C 2IRUA 1T9WA 4QWEA 1JLCA 3GJSB 4DCHA 2VF3A 3D66A 4G65A 2GJ2A 3JAMO 4KI4A 4IG0B 4EIAA 5L39A 4CT8A 2NUUG 2POKA 2BTFA 1NLKL 3OY9A 4CLFA 1TAQA 2KJWA 2ZBRA 3EGZA 1QVGM 4IRCA 5D3GA 3D2EB 1ZBHA 4Z4EA 4Z37A 5GADP 4JI6F 5C12A 2DO0A 4US8A 5B0CA 1AT1B 2MZJA 4H0YB 1NNEA 2P66A 3KLIA 5HQLA 4DHVA 4B8CA 3DEEA 4KMOB 1VBKA 4DPUA 2QTWA 3ELHA 2UUWA 1HFEL 3KFWX 3MOZA 4LF6F 2ZKUA 3B8AX 4BC5A 2VL1A 3LALA 2RHQB 1NKBA 3CCRS 4O4GA 2K8BB 4FNIA 1PK3A 3KUEA 2C2DA 2V67A 4LSNA 4DU4A 4H8KA 4FYDA 2D3ZA 4CRJA 4EYIB 5GAGI 2GBZA 2W8KA 1VI7A 2HQGA 5CH7B 1UFWA 1SV4A 2A6OA 4B9MA 4IC9A 4PRFA 4DFDA 1N33K 1SQFA 4IJAA 4LF1A 3O3LA 5A8WB 3U9DA 2XYGB 1RAIB 3ED5A 2CNLB 1M5KC 2DH8A 4DUTA 1LWFA 4DFMA 2DGZA 2AU0A 2KL8A 5AE3A 4ED2A 1ZM3A 3VQ4A 3DN9A 3M30B 1F2HA 1RT3A 2EC2A 1HQ2A 2RE1A 3W2VA 5K14B 4LFAJ 1U02A 3AARA 1S7HA 1DZ5A 1FEEA 1ZQZA 1WB9A 2ZUCA 3H5XA 1K0VA 1QQ5A 3V4MA 2HHTA 3G10A 2VG6A 4KH4A 3TA0A 5FPDA 1OY6A 4CJEA 1XIQA 4C4WA 1ZQAA 3MPWA 3C6AA 4PL8A 1XMQK 4LSZB 4FZVA 4UB4A 1FNOA 2B43A 4ZPVR 5DJBA 1M5HA 2V8VA 4NLSA 2QFJA 1IKYB 1VK0A 5IIKA 3ISZA 2YQEA 2RB7A 4KHWA 4FFDA 3VQ5A 3NMRA 4LF4F 3Q24A 4X4SA 1G99A 1Q9YA 2XSFA 5D4OA 2GCFA 2EZYA 2BDPA 2LFVA 4HCCA 1NKEA 1Q78A 4R5PB 1ZQOA 2OGUA 5D78A 4YB1P 2YX6A 5DQIA 5M1QA 2ZGYA 3UQ2A 3HM8A 4K7QA 1HLWA 4XO0A 1FDBA 2RLTA 1S49A 4ZLLA 3HVTA 1KOHA 3D5MA 4F3TA 2DL0A 1N54B 4CLLA 3LDLA 5LJ5Y 7ICKA 3S3NA 4DR2F 3OYHA 5AI5A 1M5VC 4AL7A 3HILA 1EQMA 4CGIA 3S3OA 2KN4A 3D6TB 1HBMB 1RGIA 4QYZJ 4P75A 3BSAA 8ICMA 3TANA 2P51A 5AIAA 1LAVA 1UVNA 2Z1IA 2HHVA 1S22A 4CF5A 4DUZJ 2IMOA 4OFZA 2NSCA 4NLBA 1Z1BA 1RTDB 2L41A 3FVYA 2NRRA 3OVBA 1ZD4A 1N4LA 1ATNA 2V4JB 4BRNA 3RJGA 4ZPAA 3M8YA 4HL9A 4BWJA 3CERA 3AVBA 4KKOB 4KREA 1HNXJ 2A6MA 3L3FX 3IBPA 3UE5A 2L08A 2A1AA 1RT7B 1ZD5A 1UA0A 3Q8KA 1M0SA 4CLWA 1F60B 1Y3KA 3PUFA 2LQ8A 2P6TA 4DS4A 3TVKA 3VALA 3UFCX 4CEAA 3DRSB 3RJIA 4NJ8A 4LC9B 2B5JA 2Y8WA 3BS7A 2WF8A 3GTYX 1J54A 1BL3A 1G15A 3DOMA 3KHHA 2LP4A 5K8NA 3WXLA 1NLVA 1NZPA 2J6UA 4F4AA 4RUHA 4B3TK 2HZAA 3KJFB 4TSXA 3QEWA 3QNNA 2D41A 9ICTA 2FPMA 3WK8A 1SIZA 2NYHA 2EXUA 5IT9U 5AI0A 3QFHA 3WEEA 1U8SA 2MPUA 3QU5A 4BS2A 3ZSZA 2ZM6J 1HQUB 1ZOTA 5CZXA 3VGLA 2AZ1A 3BV8A 2AXTU 4NWIA 5C2DA 5L1KA 1A76A 4F4XA 3T5JA 2CPZA 2XMAA 3MGIA 1VSLA 3CD5A 4CEOA 3SAFA 1PCAA 4YOTA 1Z4OA 2ZITA 2HQFA 2PI5A 2R7TA 1F5CA 4HT7A 5F9LA 3SMSA 4E8UA 1X7VA 2RILA 3EZ5A 3P39A 4PA1A 1H38A 3DDKA 4B3MF 4ANDA 4NLPA 1RHKB 2XTJP 3PVXA 1BQNA 3ILLA 4K0KJ 4YDUA 2GWKA 2VQFK 1PBUA 4IOBA 2NPFA 3R5JB 3V81A 2FY8A 1S9GB 2ZE2A 2IVMA 3BKTA 4QIGA 4W90B 4JB8B 4YORA 4HDGA 4WZQA 2C2EA 4OHVA 3P1GA 3PNCA 3N7RC 1DLOB 2VUGA 3AO2A 3VAHA 3O1WA 3MM6B 3R6GB 3EKSA 2GX9A 4B9QA 1CZ9A 2QLBB 3M9NB 2PO4A 2QYGA 4AFFA 1AFJA 3DLLL 3M1YA 1XMOK 4NX9A 5FRNA 2W11A 4I27A 4CQ1A 4FWMA 2YKAA 2VA2A 4IFVA 3LANA 3SJJA 1S8OA 4DV1K 1V4SA 4HLBA 3IWLA 1OIAA 3SQ2A 3DLEB 3NCRA 2PMWA 1HNVA 3BH6B 5J0RA 2KHCA 4F50A 4LFCK 1Y00A 2YHYA 3QBXA 3QO9B 3LAKA 2D74B 2GNKA 1WF0A 5AI4A 1GFWB 4DB3A 4M5NA 1EXNA 1RWWB 2DGUA 4JOUA 3WXKA 2JSXA 3OGUA 3ONQA 3NDKA 1JNRB 2GW8A 1HUXA 1TUGB 3V72A 4DL4A 2MKHA 2LQJA 5AKZA 3CJ0A 3LK9A 1UHUA 4FDFA 8ICIA 5KAFU 1XSNA 4CLSA 1N62A 1FEZA 4CT9A 2WF5A 2C2OB 3VQEA 4DV6F 1QE1B 4OJRA 4MO5A 2E1FA 1BUXA 3OUYB 1W97L 3HSJA 4BDYA 4JI1F 1SKUB 4E1MA 4Z7CA 3LDNA 5KFCA 5G4DA 1V5VA 3PNIA 3TX0A 3ZT1A 2W6KA 3CM6A 1KONA 1IR1A 5JU5A 1W26A 4ID8A 2CPHA 3VAIA 1RT1A 1JLAB 3BR9A 2PA3A 1BD6A 1DXSA 3NAIA 2VFTA 3TSPA 3T41A 3GBTA 4WCEL 3DGVA 1C1CA 4UB1A 2IC3B 4MFFA 1UJ4A 4GVBA 2QKKA 1RHMB 3NHGA 3OL8A 3GB0A 1REVB 1VQ5N 2YH0A 4QCLA 3R3LA 3T7ZA 3C28A 5C2GA 5CYQA 3JSMB 1CI4A 3Q89A 5F2RA 7ICMA 1UW4A 4CIOA 4URSA 4FZZA 1EARA 1C1BB 1UTAA 3THTA 4UY8O 4DV5K 1S59A 1J5EK 4BE1A 2LPEA 5KTQA 2I5HA 3UKUB 3F53A 3MF5A 2E3TA 2G08A 3VR1A 4JWMA 1Q1KA 1RWKB 4CGHA 5HK4A 3ASMA 4J9VA 2BCVA 1HBOA 3M6UA 3OTCA 2LEAA 4E7LA 4LF8J 4R8UA 3DU6A 3RAMA 3CGIA 2Y3YA 3PYDA 1J27A 3KWGA 3IM1A 5IC4B 4BRHA 4UAYA 2UVUA 4JYAK 5BPLA 4KBIA 4CEDA 1ZQBA 1VQ5S 3MEGA 4MYUA 2GC8A 4PGQA 4MK9A 2VH7A 3V6HA 8ICPA 4ZPCA 1BGXT 4CO5A 4K4YA 2VOOA 4YXJA 3VMFB 3HD1A 1Q0NA 2OH2A 3THYA 1IR2A 3EDQB 3W9JA 2QK9A 3HHDA 4EGLA 3V4IA 2MKJA 4O4GB 4YY3K 4A8MP 3IP4B 4YB7A 1DARA 3D45A 5K8OA 4RUAA 2J4RA 1I3OB 3J7A1 4YMNA 5I3PA 5ALPA 4BDZA 4P7VA 3CWJA 3B78A 4BRAA 2GZOA 4BC4A 1MU2A 4CF8A 3BY5A 5AFUA 4USKA 4USIA 4EX7A 4ZJQA 4RQ7A 1WWUA 1ZQIA 4FSVA 1VDHA 3R9KA 1LWFB 3QMQA 1F21A 4WQ5A 5L9XA 4NCGB 1GK8A 2CGKA 3KUGA 1EX4A 3BS5B 7ICGA 2J7KA 3VCDA 4WP8A 1RHRB 2DFEA 3A8KA 4PQAA 4C8OA 1ZM9A 2OP5A 1S0VA 5AZJA 2VG6B 5IIMA 4NA3A 2ZUAA 2KP7A 4ECXA 3ZDEA 7ICNA 1NEEA 3L7PA 2F8LA 2YX4A 4ES1A 4CBWA 1N2XA 5ALJA 4PXBA 3L7UA 2Y0BB 2ZHOA 3NH2A 4UF4A 1R27B 2KK0A 1KHVA 2IFXA 3M8RA 4DR4J 3K4GA 5KFTA 5CQGA 5T14A 2KNJA 2XO7A 2CJXB 2QT7A 3OYBA 2QFIA 1NU4A 3SDEB 3D9BA 1KVBA 1HHQA 2QEXN 2P1JA 4H5RA 1GOCA 1QVGR 3W9IA 3RR7A 3ZETB 2MLXA 3AQEA 1N63A 1IXKA 2EDUA 2Q0UA 4MLHA 1OMSA 4HUFA 4TY9A 5EWGA 2YB1A 4RQ5A 3QJJA 1HJPA 4JV2A 2RMLA 4FLWA 1QVFM 3J81U 4ZCKA 1QDUB 2IM0A 5CCMA 1I94K 3UMGA 4DR5K 3PRVA 3KG1A 3KIOA 3SEOA 1IV0A 2V9WA 2M9NA 4ECWA 2UXBF 2VD3A 5ALXA 4RBVA 1MQ3A 2GHWA 2V69A 4AQYF 4BGBA 4YR3A 4NLRA 1GT8A 4I7FA 3CCEN 2VKZG 4Z4HA 3CCJS 4QU7A 1OY8A 4JI2J 1T4GA 4RPFA 3ULHA 4PWWA 2ZJAA 1L3TA 4NXNK 1N60A 5I3QA 3UNGC 7ICLA 3QT6A 4FS2A 2ABYA 2AJ1A 1E4GT 1OXJA 2A3JA 3V7KA 1M90O 1M5SA 3VGMA 3SFGA 4CH7A 3H0PA 4OV6A 4YVZA 4A8FA 2QEXS 1Z2LA 3NAHA 3MAAB 2B4UA 2CH6A 2G8HA 1VJQA 2DISA 4Z6DA 2VPZB 2MJUA 4DSJA 5MLCV 2QI2A 2OAUA 4P2MA 2BUNA 4DPYA 1ULRA 3IS9B 1T05A 1IBKK 2OUGA 1DOQA 1H2UX 3M8ZA 4K4ZA 2RKIB 1YG0A 1VSJA 5LJVA 4A8XA 2QKBA 2QV6A 3JAMY 1S48A 1NH7A 4CNYA 2GLEA 3A5MC 1MROB 3DOMB 1BC6A 1IBLK 4PWUA 5B0DA 1NOZA 1F2GA 3LA0A 4UB3A 2XYPB 1RPLA 5DGBA 1ZQQA 3DLJA 4PUOB 2D3UA 1DKGD 3R6LB 2ROPA 3AVCA 5AKXA 3IG8A 3E2EA 1OO0B 4ED0A 1OKJA 3L4QA 4TNOA 4JHDA 2KG0A 3CCES 3MMAB 2P9UA 1XNRF 3G9CA 3F73A 2VJ4A 2XMUA 5ALFA 2ZNYA 3CUNA 2CPRA 3ZD8A 1SH2A 2BPCA 3R9PA 5KPRA 3VGUA 3HSTB 1FXLA 1LOTB 1VBXA 2F44A 3CJBA 3H40A 2B8QA 4F8RA 2XI9A 4DR7F 1K8KA 4BC3A 3TU5A 2E1PA 1P6TA 4JI7J 3GWCA 3OW2R 3EZWA 2R7UA 5TISU 2DB1A 3ENAA 3R6MA 2CJQA 2ISPA 1S0MA 1VQPN 4JS4A 1BQNB 1S0OA 3MX2A 2KVSA 5ITHA 4LF9K 1D09B 4CO3A 1NNLA 1N34J 2LEBA 2RVJA 3ILOA 2MHNA 3OL9A 1F9EB 5LMUK 4EYHB 4ECRA 2BJEA 4I9QA 3NVKA 2B7CB 4CJ5A 2R18A 3B54A 2XEXA 4GNIA 1Q46A 1OY9A 1VRQC 2NREA 4M3RA 2HHQA 4I2EA 4KGMA 4KC5A 3HP6A 2YVSA 3JSBA 3CT9A 2O01C 4ZOHC 4ILRA 3QGPA 2E5LF 5BYSA 4LRAA 3FGVA 1GMVA 2YHXA 1FK9B 1RQLA 5HRNA 4IR1A 4OJHA 2Q31A 3RWUA 3ZTRA 3M8PA 5EXWA 1MMNA 2W24A 3CO0P 1ZS6A 1F9FA 2B51A 4ZVSB 2FVSA 3D0IE 1CZAN 3OA9A 2QB0B 3VQCA 4MJKA 2P5GA 4F9OA 4OZ0A 5EX5A 4J7CA 1U0SA 3OL7A 4DX6A 1CC7A 4WF9Q 4K4IA 3IAM9 3L2RA 2ZD1A 1Z26A 3CD6N 1QHAA 4JEPA 1VIXA 1BE4A 1VQPS 5M2RA 4HKQA 5C0YA 3SQGB 4CM0A 3LOUA 2QA4G 1SVDA 1YJUA 1WSFA 1TKXB 4DCOB 4KH0B 1HBNA 2HNZB 5GAEP 3PO5A 1FJEB 1N33J 2HZVA 1CPZA 3QWUA 1FW6A 3AVFA 3CC2N 2DNNA 3F9MA 4UT4A 4J9OA 1JUDA 4XA5A 1D8BA 3HVRA 1Q8LA 3HFKA 4XH1A 3TO8A 2CJAA 2J0SD 2LECA 3WXIA 3A4TA 4FJGA 4PQUB 5B09A 4UAUA 3NF8A 9ICLA 3AD9C 2DR6A 4A2BA 1B9DA 3C7NA 1N48A 9ICKA 3HI0A 5FLXY 5F8NA 1J2MA 3NE6A 3PDNA 3GFKB 1XMQJ 4NOHA 2ZWHA 2DIUA 2CAJA 1H73A 2XWXA 2MZRA 1C1CB 4AHRA 2ETJA 3SEIA 4GVBB 9ICPA 4H0XB 4DPOA 3CD6S 4LREA 3ID6A 2EWHA 2DPIA 2P9LA 3SBTA 2AH5A 2P9SB 1YTYA 3TVYA 1KKHA 1S1VB 4KJIA 2VU5A 3V9ZA 1N32K 1RT4A 5GAGP 3CPWM 5H1SQ 4GO7X 1P7DA 1KHWA 5IQQA 5KFQA 2KVCA 5B8HA 3OYIA 3UWTA 1T95A 3S9HA 1HQEA 3KK2B 3CC2S 1FHTA 2YWFA 3KG0A 3AA2A 1FKOA 1D9DA 1P8ZA 1J2NA 1FJGF 4WQ4A 8ICWA 1PVRA 5ALHA 3KWMA 2DYAA 1NH8A 3OBWA 2QJ3A 2F65A 2HBMA 2VZ9A 1YI2N 2G2OA 3H5SA 4YFKA 2CNKB 4IDHA 3N79A 3B8HA 2CQHA 2RQMA 2HBJA 3I55N 5DLGA 1PKUA 1HBOB 5KFDA 2XS5A 2IRYA 4IS7A 4DKWA 3TKAA 1H7XA 3EE3A 2Q0ZX 4ID5A 4PG7A 4NYFA 2KYZA 2D6FC 1HX1A 2DHHA 1FE4A 1VBYA 1KFSA 2HEKA 4DTNA 1ZD3A 3TTDA 1C1AA 3U27A 5I9EB 5D4BA 3W5ZA 3NH0A 1KDHA 1XO1A 5J2MB 2WB1D 4A8WA 2AKWB 3KZBA 3WNGA 3CFOA 4I2PA 3UNYA 5AQUA 3W63A 5KG0A 5HL7L 4ZP6A 3VQQA 3IR6B 3BF4A 3IBWA 2KJ8A 4BC9A 2V7YA 1Q3VA 7ICUA 3KD1E 1R0AA 2W41A 2O8EA 1NNDA 3HP9A 2RH3A 4LH4A 3BEXA 3KJNB 4X62F 4ENOA 4DQSA 3AHPA 3LPEA 2WUSA 1BPYA 1XK8A 3N6MA 1RSCA 4I6WA 3NAEA 1FFSB 1RBTA 1MU2B 1YI2S 2V8DA 4D3HA 4CK1A 4JI6K 4B3TJ 3IHQB 2BZ2A 4ZHRA 3I55S 1JLEA 3TVZA 3BGOP 3F5AA 5KT3A 2HVZA 1RWNB 1H2TZ 2XCAA 1U2FA 1X0FA 4RWWA 4LF6K 3G8SA 2FYXA 3DRRA 4KX3A 3M8SA 1UETA 2E8NA 1B70B 4FW1A 9ICRA 2ESEA 3VWSA 5AZJB 4FLZA 4KI6A 1FRKA 1PILA 1JL1A 1TVRB 1VOMA 5LM7E 3QESA 2ZUGA 3LP2B 4J90A 3S01A 4CE9A 1QM9A 2Q66A 1CRXA 1SKSA 1NGEA 1CLFA 1TKTA 4I2QA 2HRYA 2ILYA 1Y9OA 2HG4A 4OD0A 2VODA 5J0XA 2LU1A 2RT3A 3MEDA 4E2FB 3BDPA 1O5JA 5AIBA 3RH5A 4K4HA 4CJVA 4DUYF 1WCLA 4ETZA 2HOEA 2OPRB 4C8KA 2DNRA 1B0VA 1SV5A 4GW6A 3IR5B 2FQQB 4ZPWR 4FKXA 2MRLA 4U7CA 2Q3PA 3PR4A 1QSYA 1COOA 4NEZA 2P9KA 5ALGA 1JN3A 1HJRA 1RWXB 1EAYC 2K3KA 4DV7F 1QAXA 1N5XA 1XMOJ 2BANB 4X64J 1N8RO 4I2BA 2WSEC 1JLQB 3IFEA 4I2JA 1RKIA 5GADU 3V6DB 4DV1J 1GNKA 3PIPL 2V2VA 4HVJA 4LF4K 4J9NA 4DBQA 4CI6A 1HWIA 4PXCA 1XHZA 4I7FB 2ZZTA 1SH3A 3B0YA 4LFCJ 1MN9A 5IV4A 1FTRA 3F2KA 1YBTA 4JI0F 2VQEF 4R0JA 3H08A 4I56A 4OYBA 1K47A 3CDEA 4J9RA 1N5SA 4K42A 3CMQA 5E41A 4CLPA 4TKTA 2JX2A 3GE1A 1XR5A 2H1YA 2QTDA 2G8WA 4A8SA 3V7LA 4KLUA 2FVPA 2QMXA 2AJ4A 1RWUA 5J0PA 2R9LA 2W2QP 5KG1A 2F9TA 2ZFHA 5ETRA 4DR2K 4MF8A 2ZC3A 2A1JB 5KFKA 3EVOA 5LSLA 3BO4A 4CHYA 3R5GA 2YWKA 3G82B 1KL9A 2R7YA 1FKPB 4CLKA 4CFDA 3NVZA 4CO2A 4O3RA 2G13A 1PYOB 2YMLA 4CLZA 3VAFA 4L3KA 8ICKA 3DHXA 2FJ6A 2MKIA 3FFKB 1UEKA 2P9NB 4FBTA 3AL0B 4Y2KA 3K2YA 1J5OA 1RTHB 1A0OB 1X4FA 4G1QA 2I38A 2IRXA 1W25A 1T02A 3ETOA 4F02A 2F7TA 3QEXA 5MAOA 3SBGA 2E8PA 3H98A 1MWQA 1XQSC 4QWAA 1JQGA 1HKCA 4FWKA 2BQRA 1B43A 4NLNA 4EMDA 2LSNA 4PL7A 1O8BA 3AMZA 3GCWP 4FJNA 1UEUA 1QUVA 1ACMB 2HURA 4NWBA 4B8AB 2X1AA 5HAOA 4EEYA 4OJ1A 4BHQA 2L48A 3HCXA 4M2YA 4Y2VA 3U7JA 1IJFB 1QVFR 5K8MA 4F04B 3VF6A 1IJEB 3EL2A 4J9KA 2A42A 4HACA 3QLHA 5C25B 4FJ7A 3FMWA 2FDNA 2XVTA 5KG4A 3A8IA 4CZEA 3CCQN 2BVZA 2QARB 1IBCB 3D2FA 4L74A 3H20A 4DV5J 2OPPA 4N77A 1J5EJ 2KI2A 1H1VA 5FDLA 4DCCA 5FD1A 3Q8UA 1RTIB 1EETA 4A8KA 2BX6A 1ASWA 9ATCB 5J2DA 3CHWA 3C6HA 4M63A 4RNHA 2NRVA 2RRNA 2YNHA 3FZ2A 3TSUA 2HBZB 1ZJMA 2RP5A 2EG2A 4FZYA 1PVPA 5JICA 1VRUA 4HUGA 2IOFK 4IH7A 3QU4A 2YNIA 5LOQA 4OJOA 3U3YA 4GKJF 4B3MK 4JYAJ 3DLLQ 1VSIA 2AX1A 4EHUA 5DGAA 3RJHA 9ICJA 4OI4A 3MWBA 2WTFA 3QIPA 3V9SA 3CJSA 2V34A 2VOPA 3GLJA 2VPYB 2HHHF 1DGKN 2MSNA 5IS2A 1EQYA 1I39A 5CR0A 4WJ3B 1ZQYA 4MO4A 4Y65A 3FBEA 4I69A 3DXMA 4NYZA 2F4VF 3BGRA 2NNWA 2X51A 3KJVB 1NHVA 5JVGL 1HR0F 3QFWA 5KGXA 1NGAA 3QBWA 2DD8S 1XC9A 3HYFA 4BR4A 4CEZA 4OI2A 3KBBA 1GXLA 4UQGA 3QEIA 3I4PA 2MSSA 2L9DA 1G3OA 7FD1A 2KKPA 2ES6A 4CDIA 1EXQA 3DLKB 2PY5A 2F1IA 4JKEA 3I5BA 5KFJA 3TJAA 1IKVB 1S9FA 4M7YA 2O8DA 2Q6CA 3L3CA 1VRTA 4IG3B 3W64A 5DG7A 2KSOA 4LF7F 4OI0A 1QQCA 4C4TA 1HI8A 4Z4CA 1RUSA 4O5BA 4RT3A 3BUZB 4TUPA 3QYPA 4RWXA 2ZF5O 3FC4A 3C65A 4XH5A 3POTA 1Q95G 4FWLA 4H4KC 2IIHA 1AZSA 9ICHA 2EKYA 4DV6K 1NK4A 3JXUA 1ZYQA 2CZ9A 3EVWA 3OYEA 1OSDA 3TR5A 4U7UD 2ZVSA 2K06A 4OYPA 4JI1K 4GO5X 4QZCA 1UT8A 3LH2S 2YQ0A 3HVWA 4BCAA 3LPTA 4DTXA 4KT0C 3DKDA 5JUMA 1WWHA 1SUQB 3AFGA 5J29A 3TFSA 1YJVA 3K8WA 3OJSA 4QS8A 2KMDA 2UP1A 1LK5A 1RYRA 1I94J 2A19A 1VHFA 4DR5J 1XU4A 2FMPA 1T9VA 5AE1A 3HOSA 2HBLA 3RJJA 2RJZA 2FC0A 1JJ2M 3FMBA 5I3UA 4JKBA 1RHUB 2WB1C 2OYYA 1JK9B 2GFFA 5IWAJ 1GQEA 4YP3A 3AVHA 2LHTA 2J9CA 2WBMA 4ID5B 2ZIVB 1PYSB 2H5XA 1VSKA 3RMAA 3ETMA 1HNWJ 1MQ2A 1FXDA 3TNVA 3M9MB 4C8MA 4LF5F 1P90A 5KFYA 2V4RA 4MDBA 2A2CA 3BQTA 3PW2A 1HNIB 1BISA 2VJ5A 3ZX0A 3IWXA 1WSRA 4GRSA 2M0GB 2UYTA 5G0RB 1G7CB 3L09A 1TK8A 1FEHA 2PD1A 1BXNA 4YN4A 4ZN1A 4NE9C 3A2FA 5HVFA 4OVLA 5AQHA 2W25A 3AY9A 1PYTA 1R0AB 2OFHX 2FBTA 4USJC 4O3PA 2XS7A 3MR7A 4EP5A 1IBKJ 1OW5A 3MECA 4K8ZA 1PUZA 2IA0A 3WHIA 3KTQA 2RQKA 5HI7A 3KDOA 3EKUA 2OHDA 4OZNA 3ALYA 1IBLJ 2DK2A 3LPUA 5F41A 2UV8G 2ROGA 5B0BA 1YXQA 4AD6A 2YWHA 4R64A 4ZN3A 3ZT0A 1O03A 5J2CA 8ICQA 3ATUA 3AVNA 2K4EA 1VLOA 1VR6A 4Q7AA 5TKWA 1S5LU 3DLGB 9ICIA 1CXUA 3SUOA 2WBNA 3CPWR 4C4RA 4G9ZA 1APSA 1S12A 3ZLJA 1DGSA 2G2YA 3MZIA 3CJ7A 2C22A 2M4MA 3O4NA 2FGCA 3QFUA 1RB0A 2A1RA 1KD1T 2D0AA 3UI3A 2EEYA 3CFPA 3T6JA 2VWJA 1U6FA 2E29A 4DV0F 4CNQA 3OTBA 1NOMA 2HWHA 1TKTB 1OSCA 4OLPA 2CGJA 3VESA 1U2VA 1BPXA 2BEFA 4Q0BA 5ETLA 3KLFB 5BN8A 5GIPA 4RU9A 3MEDB 2EK6A 4BVPA 2W9AA 1UPMB 1ILYA 1S1XB 1LFPA 3CJ5A 4LF9J 5KAIU 2NLWA 8ICSA 2LI6A 4F2SA 4KLGA 8ICCA 2ZH8A 1ZTTA 5LMUJ 4BG9A 5JMVA 2V7ZA 2RNEA 1CQNA 2MYFA 3JQMA 2AIRB 1SZPA 3NGSA 3HO1A 2BYCA 4NXMF 4R25A 1KOOA 1WC0A 1C0MA 2W40A 3FAHA 2DKOB 2QSWA 1CJUA 4ED4A 4FZNA 2UUBF 4P0QA 4ED5A 4LQ3A 2BXJA 4YFUA 4UAZA 1YRXA 2HSEB 3I32A 1TV9A 4EK2A 3LTOA 4NMLA 2E7XA 3GZ7A 1XR6A 1ITPA 3P5BP 2E1AA 3SYZA 4FVCA 3A8EA 5HANA 2D1CA 3OBIA 2L5YA 1SKWA 4KHNA 2WRMA 3F41A 4QU6A 4WIQA 3LGMA 4HTIA 4FWRA 1SQGA 2IAJA 1BPZA 2R2RA 5KT2A 4F72A 2CQ0A 1VYAA 2R42A 2OEKA 4FLYA 1PZNA 2FGOA 1NJXA 4CF2A 3RH6A 2O6KA 5A0LA 1WC3A 1U2CA 7ICTA 1DTTA 3A5LC 3GL1A 3C6TB 3LAMA 2CQBA 2EI5A 3AVKA 1OH6A 1Y88A 3QGGA 2R2SA 4YG2A 2UXBK 4GMJB 1M6YA 1P9YA 4K25A 4OLBA 1X66A 3MCSA 1S99A 2KG1A 4BDPA 1DY3A 4AQYK 4TUSA 2M88A 3HFZB 1RBLA 1RDUA 1U1MA 3OLBA 1N52B 3HDSA 1RWVB 1RU1A 3EN9A 5BREA 1V9OA 4RW9A 3MMCB 2R7QA 9ICBA 3JAMU 1RLDA 2C3PA 1CULA 1OUQA 4AL6A 2VIXA 4C6AA 2CGLA 4H4MA 1S77D 4U95A 3CP8A 4DV2F 5F3TA 2H3VA 2G09A 3WKAA 1UEVA 1M1GA 4RNNA 3ZD9A 3AN1A 1ZQLA 2R7XA 4FJLA 5JJBA 1L7NA 4RW6A 2GMHA 4USTA 1ZAVA 3S41A 1NCLA 3HSCA 3JYTA 1QHTA 3IUCA 3C1YA 5HSPA 1A6LA 4O0IA 5ALSA 3HHEA 3H1QA 1Z1VA 3O9UA 4C7ZA 3THXA 3AB4B 1N32J 2GO9A 4H03B 1JXLA 2I7NA 1UMJA 3V2UC 4FJ9A 1P8GA 5U47A 2FVRA 4L75A 3IP0A 3RZAA 2JEGA 2C42A 1VS3A 3I5CA 4KHMA 1JXEA 3D2FB 4DFPA 2KHVA 2VYPA 3BF1A 5DDPC 1T11A 4OLAA 4A48A 3DCAA 2OPPB 2O66A 2KOBA 1AFIA 4I2CA 1KAXA 1XNRK 4BRCA 2XZDB 3JPQA 4ILJA 2BM1A 2JOQA 3KKSA 4CJKA 3QETA 5AK5A 2OHFA 1RT6A 2E5HA 2FJDB 1K8AT 3M6VA 2KB2A 5TKYA 3JPOA 4EI2A 2MEWA 3LQVA 3L7OA 4JI4F 3PW4A 3MEKA 1VRUB 1YJWN 3WC2A 1T9UA 4DR7K 3WK9A 1WHYA 2AW0A 3ZI4A 2NO4A 2XS2A 2P5OA 2IDEA 1QTNB 2O67A 2F8EX 3ENOA 2KZZA 1X4CA 2Y0SF 3V6JA 2CWXA 1S1UA 2LXUA 4HHJA 5D15A 3IM9A 2CG8A 1UJ5A 2VWBA 1X4BA 5IINA 3RH4A 4IZ9A 3D2QA 4M1KA 4QIWD 3ZZOA 4IO1A 3HPGA 1JKHB 3OV7A 3H3NO 5ALIA 2P9PA 4CJUA 5HRSA 2WF7A 2RQ4A 3TPQA 4C4SA 3QIOA 3NTUA 4EFAC 2AQ0A 3KNAA 2E5LK 1FRLA 4BR7A 1K9MO 1RBOB 3K1RB 2D8CA 3H25A 4EU0A 3HKWA 3NASA 2M8HA 2EFNA 2PMHA 3L4BC 2W8LA 2N7YA 5HP4A 4JI6J 3SCJE 4US9A 3W3DA 4XH4A 4ECQA 5J2HA 4H4OA 2XY5A 3EM1A 3MUVP 3L2VA 1YTUA 3E1YA 3ZDAA 2LMIA 2CFXA 1YJWS 3C2KA 2Z8QA 2WAQD 2ADCA 3P83D 5KL8B 3U1NA 1U9LA 4BLGA 3C29A 1RDDA 1ROFA 3CJ3A 1VRTB 2ZIWA 2LXFA 1QLNA 3RMCA 4CFCA 4D3GA 4QR0A 4JRQA 2OZSA 3DGPB 5BR8J 1IM6A 2WONB 2QL9B 4KHPF 1D8LA 2F5GA 3IG1A 4Y28C 1QSSA 2YKNB 3L3VA 2ZOFA 4HTJA 5FLXU 3VZIA 4FVUA 4AILC 1RT5A 3OHBA 3NRWA 2A40A 4LUBA 2JHEA 4X65J 4NV0A 2W4PA 1L3SA 3IC1A 3SD7A 4E7KA 3HX9A 4DTMA 2G8FA 2EANA 1AZSB 2GA7A 3FUYA 3ZZTA 4ICLB 1TUUA 3HT3A 2R8GA 3MM8A 2IHMA 2F8SA 3PJ9A 3L95X 5H9FK 2HAFA 1RYUA 2N7CA 4OYZA 4IFYA 3QZ7A 5ALZA 3KK3B 2VG5B 4KRFA 3T5LA 1MDUB 2W04A 2OEHA 2OCEA 3BZQA 3FFIA 4BGAA 2GO7A 1R43A 4XPCA 2ODGA 2XWYA 3US5A 2EBGA 3ZSXA 4KGXB 3T69A 1L3UA 4LF4J 3M2UB 3HSDA 2HRTA 3CJRA 3HSZA 3MMVA 4ZIWA 3P5JA 4NA1A 4M9LA 4N76A 2IOCA 4ZCMA 4DSIA 5AZIA 4X4QA 2DFFA 2ZXHA 4WFNL 4WE1A 1YKWA 2QL5B 3LP1A 4Y2IA 5HMYA 1GLDG 2QO3A 3SPZA 3D6MB 4OV1A 3KLVA 3ITHB 3IMXA 3P4UB 1A5VA 1R59O 2GJFA 2GJIA 2VFUA 4CBXA 3QUQA 1XBWA 1RTJB 5ADXA 1XS9D 1FJGK 1D8ZA 3EX7B 5GAEU 4LF2A 2E44A 4DR2J 2HGNA 4U7BA 2UVRA 2LA6A 2HS3A 2QA1A 3TA2A 1P9QC 3KLHB 1FA0A 2F9DA 3R5CA 5HL7Q 4DV3F 3G25A 4BQLA 3FK4A 2WW8A 3NVYA 1UCNA 1GH8A 4KN7A 1UOCA 3DXBA 2PFNA 4A8EA 1JJ4A 4TY8A 1SL1A 5LSOA 4WKRA 1HMVA 4HTLA 4DTSA 3QNMA 3IR7B 4PG5A 1R31A 3TJ8A 1Y5IB 2XGQA 1K44A 4B6JA 3JSYA 2PAVA 2E9ZA 5E33A 4J8FA 1Y5NB 3NBPA 1BPEA 2CQ1A 4PL1A 2G0JA 3LYSA 2GGPB 4I28A 2QIFA 1WSGA 2FBVA 1NK7A 1ESVA 3JQJA 2HWTA 3O9QA 4FF2A 1EWQA 1VSDA 2XZWA 3QB0A 4C8YA 1BWFO 3HM9A 2VFRA 4RW8A 5K8PA 1QQOA 3U4LA 1CJTA 5KG5A 1BLUA 3T1HJ 2XB2D 3P45B 1R8PA 2ZGZA 4WTYA 5GAGU 5KOXA 2I5JA 1U2VB 2Z2ZA 1K1QA 4LVSA 5B5EU 2LXIA 1NZ8A 2HW3A 1JJ2R 1ZZFA 4PXEA 2UXDK 3C6UB 1BIUA 4YR0A 4DS5A 2RHSB 4FOIA 2YCHA 5DETA 1RLCL 2YKOA 1TK5A 2EH9A 3RJEA 4IQVA 1ZTWA 3W3SA 2CQCA 1X4EA 2N3LA 2JLFA 3HMJG 4HTUA 4YB5A 1FTCA 3AOBA 3H46O 3MBYA 3K89A 1HARA 1Y97A 2RE2A 3VF2A 3NNCA 1ZBSA 3MUTP 4TU9A 4E0DA 4HR2A 4BWMA 1HRHA 4XUSA 1ASUA 4IOAL 3D7SB 2C2NA 5ALQA 3TAPA 2QWRA 2FZGB 4YMMA 2YH1A 4B3MJ 2HB5A 4CZIA 2IGIA 4RW4B 1YVNA 4DUYK 4FXDA 4H5VA 3MN9A 3PIPQ 3N7PD 1RADB 1NPPA 5C42A 2VGNA 4YDDB 1JLFA 3GU3A 2QKQA 3BQ2A 4QR1A 5DM6L 1D9FA 1C20A 1XMBA 3Q8VA 3ZSQA 2DFLA 4IFEA 4YUDA 4LR8A 3VQAA 3MMJA 3J7AP 1CS4A 3THPA 2F77X 5GINA 1RBUA 2A6AA 4GLXA 4O5FA 1EJ7L 1IG6A 4DV7K 1RDFA 1UAWA 1JROA 4EAHD 2OI2A 5ADXH 1ZBTA 3JTPA 1KS2A 1RAJA 3BBBA 1OVYA 2GVDB 3AAQA 4JS5A 4EO8A 2XICA 3MM5A 3D2WA 4CF4A 3N4PA 5SZTA 5AICA 3TUJC 4OJPA 3QBCA 4PHDA 5BRFA 3H2LA 3KKFA 2W7AA 3H5UA 1RK8A 4JI0K 1RHJB 1UZHA 2VQEK 4N8NA 2ZXIA 2BJ1A 1NM2A 4Y2SA 2J8AA 3NS1A 3A5NC 2KRRA 4OPAA 5DQGA 2KV2A 1X5SA 1YX2A 3WQTA 3J7YP 2LEPA 4DN9A 2HQDA 1ZQUA 5I42A 2E4LA 2PFQA 3TZYA 4AYBD 4HVZA 1ZBLA 5GAHI 1NO8A 1CZBA 5KG7A 2DRAA 3NCQA 3MGVA 4RW6B 2IMWP 1NG9A 1N5QA 2V8GA 3WIVA 2KKHA 3BN7A 2CZ4A 2AF6A 3AGRA 4DV6J 5FP0A 2W3SA 4PG4A 4CH1A 3SFUA 3CB4A 5C24B 5D4NA 4X2BA 3VGSA 4JI1J 2UUCF 2XBPA 1MA9B 2W9CA 4KY3A 4M3YA 1WKLA 4FM1A 2QLTA 1ZC6A 2ACMA 1QQ6A 2F7VA 3ISDA 4OI1A 1O13A 4CF3A 2G4BA 4PGXA 1NJIO 4PAAA 4K0KF 2XLKA 4IH5A 5E3PA 3NVWA 5KGWA 1NMNA 1PK1A 1IKWB 5A2QY 3G96A 3NKYA 5IV3A 3NF6A 4DTJA 3VQ7A 3HKZF 1X5PA 1RT6B 1HBUB 1UVLA 5BRDA 3KKAC 2D0PA 2BQUA 1YJ9N 5F8JA 5JVHL 1Z19A 5J2IA 3S8SA 1CLQA 1ZA1B 2D3O1 2XMVA 2D0BA 1L3KA 3U6FA 2NXUA 9ICGA 3I8BA 3IGVA 2EZZA 2XO6A 5KT4A 2XLJA 4NLQA 1YLXA 2UU9F 1NGFA 4NLDA 1WNEA 1RWPB 1ZQSA 1WKJA 3THWB 5ETNA 4PPDA 3KD3A 1X5OA 1GMWA 2RSQA 3MDQA 1XQIA 5HROB 3SCKE 3HX0A 4I0WA 1S1UB 2ZUDA 4H0VB 3K0JA 4OJ3A 4MTPA 1LWEB 3K2PA 3B6BA 2LM1A 5AE2A 1U6ZA 3SAHA 3H1VX 4DSFA 1BA0A 3KOAA 2WVBA 3R1XA 3JS6A 1YAGA 4DEZA 1X31C 4DTRA 2DHXA 2O4IA 8ICAA 4NY8A 3M2VA 1PJ6A 2VPXB 2P9PB 5E26A 3SMPA 4ED1A 2JZBB 3DM2A 1OVQA 3C14A 3ZEUA 3R7BB 2DPJA 1ITGA 1FNXH 1J9AA 3KOOA 4A4JA 3HW8A 3I87A 4ZPBA 4HCBA 2Y1IA 4QW8A 4ISFA 2DY4A 4C1NK 4GKJK 2RHKA 4IO9L 1OJ4A 1GTHA 3W65A 5IT9O 3B4MA 3MEEA 5JVGQ 5J2QB 4CLYA 1U1QA 2HLUA 2Q4TA 1YJ9S 2H3QA 3MM9A 5ELZA 4K2JA 2YJEA 1L8OA 3QAEA 1GLJO 2OLWA 4M9HA 2J7UA 5B66U 7ICQA 1YZ6A 4QZ9A 2PDAA 4FF1A 4KHRA 4MK7A 3NF9A 5DQHA 2YXLA 2HHHK 3BSNA 8AT1B 1NK6A 4GY2B 1R6VA 1H0HB 1YBUA 1U1KA 5KFLA 1VQKN 2A10A 4EZ9A 1IBMF 3HJVA 4J2EA 3WXJA 4EELA 2F4VK 2W9BA 1SJ4P 1RT5B 3IKMA 4ECVA 4F5RA 1FO1A 4QOTA 1HR0K 3MURP 5HP1A 2MAXA 1L8LA 1BNOA 3L2WA 4FZMA 1UFLA 1JB0C 2KT2A 2M70A 2BJ7A 2VDIA 2ZBIA 2FHMA 3FBFA 3AOAA 2ZJPL 1NHUA 1VQMN 1IR0A 2HSTA 3EW9A 3OR2A 4N47A 2JV3A 1AYEA 4A8OA 3C8YA 4FLUA 4LF7K 3U8XA 1D1UA 5DM7L 3LWMA 4DQIA 1ZA2B 1VQ4N 2KG5A 1VQNN 1E6VA 2ZBPA 2IVPA 3N4WA 4DI6A 2K60A 4FW2A 3CCLN 4Q44A 1TL5A 3AT1B 2PGCA 2G0AA 4DSLA 2ZC4A 2CPFA 2Z1HA 3R1LA 3T5HA 3OXGA 1K73O 5EUHA 1B22A 4NI2B 3BREA 2V2ZA 4C3MA 1UVIA 1QH9A 3VCBA 4KE5A 3CNQP 4LF8F 5CP2A 1V5IB 3OS0A 2W54A 1VQKS 2PXIA 3OVNA 5D49A 4RT2A 3SLCA 3ILIA 4Y2XA 1T9TA 2ALYB 3NG8A 3LP3A 9ICEA 3GV8B 3H8WA 4YNQA 3DYAA 4WBFA 4OHXA 4CZFA 2Q0RA 4PHAA 2CXEA 1VQMS 4MFAA 2VJUA 3L3UA 3C15A 5DZ7A 1YTAA 1TL7B 2WHOA 1M1KT 1FJCA 5KFSA 2JC1A 4DR1J 4DWIA 4W5NA 2DUYA 1VC0A 2OANA 4KHYA 4AQYJ 1EX8A 2QE5A 4HWIA 2C3OA 2DNMA 1VQ4S 4RBUA 4R66A 4M8LA 2V63A 4F3QA 2JNJA 7FDRA 3EVMA 4ISEA 3RJKA 3CCLS 8ICUA 4FWOA 5E7OB 1VLYA 1FFGB 4LF5K 3M6ZA 3LL3A 1EKSA 3ZTSA 3AA3A 4QZAA 1DGJA 3PX6A 3IN5A 3NBPB 3UXPA 4QIWF 4NYOA 2ZTEA 4C2MA 3J7ZT 5AQPA 1FVQA 3DMJA 1PAUB 2RHFA 3MM7B 1L5UA 1X9MA 5CZ1A 2YI1A 4Y2MA 1S10A 2R7RA 3JPSA 4QS9A 1KVIA 1TMJA 4DR6J 4PHEA 3UMCA 4EZ6A 3PW0A 1G1XA 4Y00A 3BPDA 3PW5A 3A3PB 4DL5A 3CJ4A 3QSIA 4LIWA 4ATNA 2NRTA 2HMPA 1CJTB 1JLGA 4I2FA 1SL2A 2Q36A 3HXMA 4WZMA 1LKZA 4Z94A 2I5JB 4LBHA 2HGMA 3QEPA 3BBCA 3N5BA 5AKYA 1A6SA 3TR8A 4RPYA 1Z00B 1HYSB 2AYGA 2WAQF 5J2GA 5E3CA 1LK7A 4DR4F 3ZO7A 3ENQA 1HHTP 1JX4A 3EMTA 1SJ3P 2ZHAA 1Q8IA 2KQ2A 4KQZA 1HLUA 2B6AB 1XNRJ 4R63A 2FMQA 3LZIA 3WKDA 4HH0A 5AJ3F 2JL9A 2MUTB 5EWFA 3GR1A 2D9OA 2O1PA 3DLBA 2D0CA 2JJ4D 3J80O 2JZ5A 9ICAA 2AYEA 1LWCB 1TFRA 3Q7CA 2YY6A 2NCKL 4DV0K 2UVWA 5DDYA 3ZZZA 2A0FB 2K89A 3L5KA 3I0SB 4NZ0A 3ZDCA 3M32A 2KJ5A 3OYDA 5DBBA 3QGHA 1BPBA 5D0GA 4KH1B 1E3MA 3GMGA 4RNMA 2YPYA 3C2MA 4J5OA 3VQPA 3WK7A 3AJDA 4Y2PA 4JI3F 4B3OB 4PZOA 1BWEA 3OS2A 1IJJA 4KRWA 3HRGA 2JWKA 1X9SA 5C15A 1JLFB 8ICYA 3BF3A 4M42A 1A77A 2DR7A 3S1TA 1OS5A 5AKIA 1FD8A 5ALMA 1LVHA 5B0FA 3PHTA 1NK9A 5AI9A 4J9SA 4L72B 4NXMK 3AA5X 2YKQA 1KC8O 1TMMA 4OYAA 1U7LA 3WBZA 2AX0A 3L2UA 3N5FA 1TV6B 2E5LJ 4B1YB 2UUBK 4IL6U 2DEIA 1JCEA 3ENWA 3MTJA 1JALA 2BRLA 4KHUA 4JD2A 3MD3A 1TKZA 1AXQA 3LP0B 2GVZA 1N0VC 4QZ8A 3RBDA 2HPUA 3JPRA 1JI7A 1BI4A 3BGLA 3M05A 2J6TA 4LRBA 1KFTA 1WUUA 4LRFA 5GVQA 2O8CB 1Q7YT 1RHQB 2UXCF 1QCKA 3H4DA 2OPQB 2H54B 5BPMA 3NGKA 2R8KA 3ZFVA 1NZAA 4K4XA 1QS4A 2KXHA 5J8YC 4AHSA 3EXYA 2BPFA 5I42B 3OTDA 1C4AA 2FHJD 3QXGA 2X1FA 1MN7A 3QT7A 2UV8A 2P9EA 2P6UA 1DURA 5HLFA 2HOFA 3A0IX 5T7LA 2HMIA 3DJCA 2G8UA 2OSRA 3GIIA 2RS8A 1PVQA 1WG4A 6FD1A 2GQ2A 1OYEA 2ASYA 3QIDA 4YB6A 3R8EA 4M0AA 2WOMB 2OPSA 2GIFA 4USHA 1CBKA 3ET6B 2GEMA 1FWKA 2BOAA 4NRUA 2V52B 3ZDBA 4E98A 3W5XA 4KB0A 4CJPA 1ICEB 2MLZA 2E1CA 2W9CB 3EUNA 2ZIUA 3H0LB 1C6VA 3AOCA 4M5GA 4OJ5A 4WPAA 4OHWA 3ICLA 4QJVA 1KRPA 2KICA 1F6TA 1O1WA 3DDNA 1KLNA 1XO0A 5KFBA 4P73A 4DV2K 3GE9A 3V1QA 1PK1B 3RB4A 2CQPA 1S7IA 4KV8A 1N34F 3GG4A 3DXSX 2DJWA 4F0HA 1M1HA 1XNSA 1JRPA 1UCVA 3BS9A 5EVZA 2DGQA 4FJMA 2IA6A 3P38A 4PY5A 1ZBFA 3JQKA 4IQMA 3MCPA 2XRIA 5KFZA 1H6KX 3EGNA 3D1HA 4DL3A 2YHAA 2B0GA 4Z4FA 5ETSA 4FK4A 3KK7A 2ZH1A 4CRXA 2XSJA 1GLLO 3E9PA 3NMUA 4FYYB 4TU7A 2K4IA 5AQLA 3FNNA 5ALWA 5B0GA 1N0UA 4FLXA 1PG5B 3SQOP 3N4MB 1RNHA 4O8UA 1YQHA 5CY4A 4JI5J 1O51A 3M1FA 4LH5A 4E3SA 2ZH9A 1RABB 2DTJA 2ERRA 1FCAA 5F8MA 4FWNA 3TJ9A 4DTPA 1VK8A 4KFBB 1B0XA 3H0MB 4TQRA 3B6OA 4YOWA 3M2VB 3TWZA 2PIIA 4YHHF 3F56A 2JC0A 4YS2A 4JI4K 3AVIA 4NPOA 3ZEUB 1GLCG 1KKXA 4NASA 1N6QA 1UP1A 1H2VZ 4NZ7A 4W98A 4JV5F 1BQXA 1F3FA 3D3BJ 1U1RA 1NMDA 3MEEB 2NV3A 3BQ1A 4CJWA 1NJZA 4JI8K 2VG7A 2WVEA 1OQ3A 5CZ2A 4J91A 4QZBA 1RA7A 3M2RB 2GAHC 3H7HB 2AA4A 3HFVA 2CVEA 4MK8A 5M1OA 4DU3A 2W43A 4DPWA 4FJ8A 3KNGA 5ETOA 5HQ8A 2DY9A 4I2DA 2XULA 1LW2A 4NMXA 2U2FA 3CCMN 4O8KA 3D0GE 4BREA 3KHRA 4OX9F 1SB3C 1FFWB 4X62J 4CHOA 3G6YA 9ICSA 2RF2A 2QWMA 5A6WA 3PFEA 2W9BB 2BJ3A 3UD5A 1Q8BA 3BDEA 1SJ1A 3ENVA 3DRYA 1Q86O 1X0PA 2HVIA 4MHVA 2RN2A 5EX3A 3HPHA 2YQ3A 1GXUA 1YHQN 2H5JB 1ZRNA 3OW2M 5BR9A 1PAEX 2HI0A 4O44B 4USUA 3K7RA 3TUPA 4F5QA 5HBMA 4KLJA 3WIUA 3V9WA 1WCNA 5BXIA 4NB4A 4QJFB 3UN3A 1T6CA 2QN6B 3D7EO 1S1WA 1WC1A 2PA8D 2AQ4A 4B9UA 3VQSA 5CYMB 1LWXA 3ENHA 1V3ZA 1PJ7A 4CGGA 5KOWA 1TELA 4O3SA 4AYBF 4CF0A 4O3QA 4MKAA 1U47A 3OFFA 4KHPK 2NPIA 4CYUB 3MR5A 3HZEA 1E6VB 4K4SA 2JEJA 1KBUA 5AXMA 1VJ5A 3TADC 4I6YA 3MPVA 4WP3A 4I9LA 3WK4A 4ZLPA 2M8DB 1VJWA 2P5VA 1C0TB 1TL4A 3H7IA 1DTQA 3K9KA 4OI3A 3CCMS 1U0HB 2X7IA 1NOYA 2HGLA 1IG9A 5KPZA 1Z1ZA 1COKA 3QPIA 1B9FA 3O5TB 4NL9C 1SWWA 1W0HA 4IYQA 3DLRA 4MEYA 3AO3A 3SZ2A 4CLTA 4FS1A 3PEJA 8ICLA 3NF7A 4WFNQ 3R9LA 3RB0A 1YHQS 4G6VB 1PC5A 1UVMA 1N5WA 3GYGA 4LFBF 4HHTA 5AM0A 1SIWB 2KDOA 5IC6B 5HVHA 3B6PA 4DV7J 4RW7B 2ATCB 3M6KA 3CD0A 2G07A 2I1QA 4LSLA 2BE2B 3DOLB 3IRUA 3C15B 1XNQF 1CJKB 3HHNB 2BQ3A 3QJLA 1RA6A 3W2WA 3VA3A 2V9KA 1RXWA 5IT4A 3BKFA 4A61A 1Q3UA 3QEAZ 5AQYA 2DRDA 1EKRA 4MYTA 5DDMA 2ZZNA 3PEHA 2FJEB 3WKCA 4N8OA 5AQQA 3FEYB 1NI3A 3E58A 2BACA 2VQEJ 4YOVA 4CGZA 4ISGA 3CIPA 1NBEB 2D5RA 1JLBA 4DL2A 4LVOP 3BO2A 2K3IA 4GXKA 3KKRA 4C0ZA 3HHLB 2Q79A 1BVSA 1I3AA 4M9GA 2X74A 3AVLA 5LMNF 1GTEA 1MLAA 4BXOB 2ZH5A 1SC1B 2CQGA 2P6RA 3HZGA 4DV3K 3F2BA 1VQON 4I68A 4Y2AA 1TTHB 4BC7A 3M1VB 4IEIA 1RM6C 4XIUA 2PFDA 1Q82O 4USAA 4ZVGA 2P8IA 4C7YA 1C0UB 2YMPA 4C48A 3KLEA 1NK0A 5ETTA 3UDCA 1FE0A 2ASJA 4HH1A 2O8BA 4GXIA 2K8GA 1WAFA 3CULA 1NRKA 4DG1B 4KO0B 4E7HA 2JVRA 1ATRA 2M9KA 1SB6A 3GFZA 1FESA 3OPXA 3AU2A 4V19J 4UOGA 2ALZA 1P1LA 1HNZJ 1HIWA 2C3MA 3E01A 2VCPA 2IJNA 3KFUF 3MR6A 2Q1NA 4LRCA 3Q8LA 1S6OA 1U26A 3QX7A 5BYRA 4P2FA 4DU8A 2ACYA 2HFZA 1FRHA 3SV4A 3ZZYA 3K17A 2QZ8A 4CGFA 1V6HA 2F76X 3C19A 1V38A 3D68A 3SSQA 4KLSA 3PX4A 4RNFA 8ICHA 3M32B 5J0WA 4U96A 1U1LA 2OTJN 4P6QA 1WC4A 3R2DJ 3DI6A 4X64F 2FLPA 5GAHP 4CTAB 2QGFB 2XY8A