4DSEA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mg2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dseA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dseA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dseA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dseA01
4J9OA 2XCAA 2A1SA 4EZ9A 4QOZB 4CHQA 1RBSA 3H4DA 3AVLA 5KFWA 3V9WA 4R65A 3HYFA 2OPQA 4O4GA 3S3MA 4DMNA 1RT1A 1CEZA 1JLEA 1VSDA 4CHYA 5SZTA 2VANA 3M9MB 4O5KA 4KLUA 1MQ2A 4AH9A 3EWAA 3ETLA 1KVAA 2HHTA 5KFDA 2NRZA 2YNHA 3ISNC 3UQ2A 1U4BA 1A5VA 4CHOA 3ZSWA 1RBRA 4ECQA 5KRSA 1HPZA 4OKKA 4DFJA 4ECRA 3AVNA 3MXJA 4CJ4A 4CFDA 4CJ3A 4MF2A 4MQ3A 1LWCA 2PXIA 1J5OA 2DPIA 1ZQSA 4YG2A 4ED7A 2D5RA 3KHGA 4GC6A 4CJRA 3GIJA 4XA5A 4R5PA 2W9BB 4J2DA 3C95A 4ECSA 3VA3A 2F1IA 4F3TA 4LSLA 4Z4EA 5KFRA 3LZJA 4AHUA 2I1QA 9ICFA 2OZSA 1CLQA 4CF1A 1WLJA 4CJSA 2KZZA 3QEWA 8ICZA 2KW4A 2I5JA 1XWLA 4CHNA 4O3SA 1BPXA 8ICGA 3E01A 5SWMA 4PGYA 4EYHB 4YD2A 5KFMA 1KCFA 2FBTA 3HPHA 3H40A 1W9HA 1U49A 2YKMA 1ZJNA 3RH6A 2BPCA 2FMPA 4DFPA 9ICOA 1L3VA 5KFOA 3ZDCA 1Z00B 5J2DA 1WNSA 4C8LA 1UOCA 3H8SA 4IBNA 1D9DA 5HROA 1A5WA 5IIMA 5J2BA 8ICMA 4UB2A 2XY8A 3RBEA 4CJVA 3VQPA 3QZ7A 1Z00A 1XI1A 2ZJ5A 4CEAA 2FMQA 5CR0A 1HRHA 2P6UA 4RU9A 1HUOA 3L2QA 5KFBA 9ICMA 4I9LA 1XSNA 1ZQHA 4Q45A 4AILC 3TR8A 5J0WA 2PI4A 1ZQNA 2UVUA 3DLEA 1RTIA 3MGHA 3OJSA 2W9CA 4F5PA 3OHBA 3K75D 4GXKA 4OKEA 7ICNA 4DOAA 4LD0A 3L8BA 2AGOA 2X74A 2C2DA 2OPPA 3VQAA 5DQHA 4KLDA 3S9HA 4M41A 3VQCA 4BWJA 5DBCA 1HYVA 4MFAA 3LK9A 3C21A 5J2IA 4CEEA 4W5TA 3MXIA 4HUGA 4CGJA 3TAGA 4J2BA 4E1MA 3ULDA 3GV8B 3T3FA 3O4QA 3F9KA 4O3NA 5JUMA 3PX0A 1WSEA 5KFYA 5KFUA 4MEXA 2ZJ8A 4CHZA 4K4HA 9ICSA 4BXOA 3Q8LA 2GV9A 5HRPA 4FW1A 2XHBA 1RDDA 1HYSA 1S0NA 5HRNA 1NJXA 3HVTA 4Q8FA 4F4WA 4FZXC 3MFHA 2NUBA 9ICTA 4FJ5A 3TAQA 4F50A 2JEIA 5HHHA 2JLEA 5DK5A 1XS9D 2V4RA 1SKSA 5EWEA 5KGWA 1NKCA 3KHRA 3V1QA 3MBYA 3OYJA 2AQ0A 2P66A 4JWMA 2OA8A 3RH5A 1VSMA 1WCNA 4Q44A 4KTQA 3C2LA 5HBMA 4B9NA 3RJIA 4H4MA 1XSLA 2RKIA 4RUCA 5KFTA 4OGEA 4ZHRA 2BKEA 2J6SA 4FLUA 4J2EA 3KTQA 2W9AA 3HJFA 4KPYA 1HJPA 3WNGA 1ASWA 3BDPA 4IFYA 1Y88A 2BGGA 4I2BA 3OYCA 4P4MA 1LAWA 1HQEA 5FDLA 4RQ0A 1BPZA 1S1VA 1T03A 4RW8A 1S1UA 3OYEA 4FJIA 5DMRA 4DO9A 4DQSA 3OYAA 2YHAA 3AVAA 2FPLA 1Q9YA 3M9NB 2ASJA 3V6HA 4PPXA 1HNIA 4R63A 2ZUCA 3UIQA 3LP2A 2O4GA 1NK8A 3MDAA 3V1RA 4CJUA 5KG0A 4O55A 3DLHA 3SQ4A 1D5AA 2FLLA 1LWEA 9ICRA 1ZQZA 3GV5B 3JYTA 4CK3A 4QW9A 3ZSYA 4FBUA 3DRSA 3RH4A 5JS1A 1QTMA 4RW6A 1LAVA 3QO9A 2G8VA 3SUNA 3QNOA 3KK3A 4CJKA 4RQ8A 4ELUA 3T5HA 1XHXA 4CJEA 3UXPA 4KLMA 3L2WA 5DQGA 1LW2A 4F5QA 1QE1A 3GV7B 1RILA 4KKOA 4NCBA 5D4BA 4DF8A 4B3OA 1UA0A 2X78A 1TK5A 3PNCA 2DY4A 3C1ZA 3MEDA 3QEIA 2Y1IA 1WAJA 4R64A 4CGIA 4M3TA 1RBUA 3HP9A 4M9LA 1ZBUA 4IG3A 8ICTA 4KB0A 4KLOA 1DLOA 5CB1A 9ICJA 3MGIA 4TSXA 4M6WB 2ZQBA 3RJHA 3L2UA 4IRKA 2MAXA 3PR4A 5KGXA 4HVJA 4Z6FA 3AUOA 3LAMA 3LP1A 1K6YA 3M8QA 2DFEA 5J2PA 5DB6A 4IRCA 1KFTA 3CM5A 8ICJA 3H4BA 3HW8A 4MF8A 3G10A 4J2AA 1S6PA 2DTUA 4I2HA 7ICMA 3NDKA 4N56A 1Z26A 1S9GA 3VQ8A 4CIFA 1NKBA 4B08A 4I2CA 1C0MA 4RG8A 1TL3A 3Q8SB 3OS2A 2Z1HA 3RRGA 3RRHA 4IDKA 1IKVA 1QSLA 4YFKA 3K2PA 4NXZA 3SYZA 4Z4CA 1Z3EB 1DGSA 4QWBA 1CZ9A 1B9DA 4I9QA 1T7PA 3SCXA 3ISDA 4AHVA 5I3UA 4UB4A 1JLGA 3TQ1A 5BOMA 3BQTA 1S77D 3K58A 5J0XA 4RQ7A 4FJHA 1BPDA 2R8JA 1DTQA 4Z4IA 3K5NA 3QEVA 3S3OA 2XY7A 4F3OA 4NCAA 3IS9A 2R8HA 4F5NA 1UA1A 2FLPA 3AO5A 4PWDA 5KG3A 5J0YA 1YTAA 4KMUA 3GIMA 1C1BA 4W5QA 2IHNA 1RZTA 5D49A 9ICNA 1ZJMA 1VRUA 1ZQOA 2F96A 3SV4A 1KDHA 4BE2A 5DGAA 4FVMA 3NCIA 3GFKB 4KN4A 1K1QA 3V6KA 3RTVA 1RNHA 4OPKA 4DL2A 9ICAA 4CEBA 4CF2A 1VSKA 1WSIA 4QZCA 1JMSA 3L3VA 1JXLA 2LYHA 2NRXA 3KIOA 4RW4A 4UAYA 4R8UA 5DLFA 3SV3A 4RQ3A 3IHQB 3HPOA 5J0TA 3NGZA 4RZRA 2P5GA 4HCBA 5KT7A 2PFPA 8ICYA 1KVBA 5FROA 4LSNA 4OVLA 8ICAA 2ASLA 4NLZA 3JPNA 5CYQA 2DFLA 7ICSA 4IR9A 4W5OA 4KTZA 1N6QA 3PMLA 1SL1A 4NM2A 1S76D 4QAGA 4KLSA 3SPZA 4O3QA 4I2GA 3B0YA 4QZBA 3OS1A 1IKYA 4F4XA 2YNIA 4EYIB 2E6LA 1RXVA 4JRQA 1WN7A 7ICOA 1O1WA 2W8KA 5L1LA 4FJMA 8ICUA 1I39A 5KTQA 1RDCA 3DLRA 3AVFA 3DOLA 1WSGA 3LP0A 3SUOA 4PQUA 2WOMA 3RB6A 3KK1A 2HNZA 1WSHA 3PW2A 4JK1A 3KLEA 5DDMA 2IMWP 4YFUA 2XY5A 3RB4A 4ZTJA 4EBDA 3HM9A 3HXMA 3V7JA 3K5OA 2Z1GA 9ICXA 1JKHA 4RQ1A 4MFFA 4ELVA 3V9XA 4PGQA 3JPSA 4FK2A 1QSYA 2YKNA 1ZQTA 8ICXA 1ASUA 1WCLA 3UQ0A 4OLBA 3JPRA 3AVGA 4KHSA 4DQIA 4PGXA 7ICKA 4FJ7A 4DTSA 3PO4A 3ZT2A 2HVIA 3OYHA 2BQ3A 4IQVA 4RQ4A 5DG9A 2V9WA 5J2GA 3QLHA 4J9KA 2KZMA 2ZUBA 1XHZA 1X1PA 4WE1A 4KRFA 2Y1JA 1CUKA 8ICRA 1Z25A 4FLZA 2FBVA 3K5LA 4PUOA 8ICVA 4PA1A 5KG4A 1RT5A 2XC9A 3MR5A 2VG7A 4M47A 5D46A 3OYLA 1EKEA 4NLGA 4I2PA 4J9NA 3RR8A 4J9LA 3MXMA 3M9OB 3F73A 1TVRA 3QEBZ 3VQEA 3V6JA 4FLVA 4QZFA 1RT2A 4J9RA 4YR3A 3WNHA 2F1HA 3K5MA 3ZDAA 4FLTA 4ECTA 2BPFA 4KHQA 4KHNA 3HK2A 3JSMA 3CFPA 4RQ5A 1Q9XA 5KFQA 4M3WA 4KLTA 3PW5A 2FBXA 4DSIA 3VN5A 4EZ6A 3QETA 3IM1A 4QWAA 3PW4A 4NCGA 3H08A 5DG7A 3OJUA 2XCPA 4M42A 2W9CB 4GXJA 2IA6A 1TVAA 4KLHA 1BCMA 1Y97A 2BCSA 3NH1A 3MR3A 5C5JA 4CEZA 3C5GA 4HCCA 4HUFA 3EZ5A 2OWOA 3NFAA 4FS1A 2W8LA 3OYMA 4ZTFA 4KTWA 4DQQA 5CP2A 5IILA 1TKTA 2JZBB 3B6OA 9ICUA 4I2AA 4UB5A 3NF9A 2MUTA 3HPGA 4M3ZA 4YVZA 1RYRA 4IRDA 2YNGA 4ED3A 5L9XA 2ATLA 7ICHA 5KFKA 5KRTA 1EETA 3ZDBA 4CJWA 4KLLA 4M9JA 5FRMA 4TURA 1AROP 3LDSA 4O3RA 1XC9A 3AO2A 3O3FA 4C8OA 4YMNA 3Q8PB 4BWMA 4KLQA 1BQNA 4Y1CA 1ZBFA 4FYDA 4W5NA 5KI6A 8ICEA 5EOZA 1D8YA 3HWTA 3L2VA 5KFVA 5J2CA 3THVA 1ZQQA 4M9HA 2BDPA 4HUEA 1D9FA 1MC8A 3G6VA 1C0TA 1FKPA 5DBBA 3SQ2A 1JL1A 4UAZA 4GVMA 4DS4A 2GUIA 3AA3A 4CJFA 3QIPA 3VQDA 8ICKA 3JPPA 1CZBA 4MEYA 2YHBA 5C24A 2XO7A 3ZT0A 1X9WA 3Q8KA 2OZMA 1ZQVA 1H38A 4OPJA 2VG6A 2VG5A 1U9LA 3C2KA 2BQUA 2HHWA 4QZHA 4M9NA 4XIUA 4ED1A 1JLCA 4FJ9A 3GQCA 4DU3A 3AVMA 4TQRA 2Z1JA 3K57A 3UXNA 4B8CA 1QQCA 4O44A 1NK7A 2R8KA 4M3UA 3T1AA 4E1NA 4QZGA 5EWGA 4IG0A 5CA7A 3OGUA 4DL3A 3CG7A 3KJVA 4FBTA 1RTJA 4FJKA 5KFIA 4PHPA 2HNDA 1ZQRA 1C1CA 3PMNA 4J9SA 1BGXT 4KO0A 4MFBA 1SKWA 3V81A 3ZSZA 1UAXA 4P4OA 3NH0A 5CWRA 3AVKA 3T5LA 1TL1A 2BCUA 5HNKA 4IQTA 3BQ0A 2OPRA 3C6TA 3JPOA 4N76A 2GWSA 3RJJA 2AU0A 4Q43A 4R8UB 5J0SA 3KD5E 4YD1A 4DTMA 1BQMA 3C23A 8ICOA 3ZCMA 9ICIA 1JXBA 4M04A 4DSFA 5K14A 4E7JA 5CZ1A 4KHYA 4RNMA 1S9EA 4CEOA 4JV0A 2D0BA 4I2JA 2X6NA 3KD1E 1S0MA 3TWHA 3ZT3A 4GMJB 2R7YA 4DS5A 7ICGA 4B9SA 3CFRA 4CF9A 4QZIA 4I2QA 5J2HA 1X9MA 5CYMA 2BCVA 2KN7A 3AV9A 1SZPA 4DLEA 1BI4B 5J2EA 2ZTEA 4DG1A 3V1OA 2D0AA 3V7KA 3SUQA 4FJNA 3QNNA 3QESA 1N5YA 4M2YA 1NK6A 2A1JA 4QWDA 2H5XA 4QW8A 4E7HA 5HRSA 4JS4A 4FO6A 4LZDA 4GXIA 4LY7A 2F1JA 4E7LA 1L3TA 1KSPA 4FS2A 4OGCA 3KLGA 4AHTA 5DLGA 4AHCA 3PX6A 5DBAA 4YNQA 4CJLA 2OYQA 4PY5A 1VSEA 2BR0A 2B21A 2WTFA 3TFSA 3D0PA 3KLFA 3AA5X 2QK9A 1SL2A 5DGBA 4BXOB 5EU7A 4QWEA 1RT3A 4O3PA 4E3SA 1TKZA 3ZSOA 2KZ3A 1WSFA 5J2AA 2HHSA 5D3GA 3K4GA 2R8GA 1T05A 4DWIA 1BHLA 5C42A 3RMBA 4JRPA 4CJQA 4FJGA 3GDXA 4O0JA 2IGIA 3HVRA 1TKXA 4KN7A 3NGIA 2VA2A 4EBEA 4CJTA 4CEFA 3MECA 3AVBA 3HSTB 2VWJA 4DEZA 1HNVA 2P5OA 4JUZA 4CFCA 4OLAA 3RJEA 4EP4A 4DTXA 4CGGA 2G8IA 3U3YA 2HHXA 1RYSA 3NBPA 2PFOA 3NF6A 4FJ8A 4ZH4A 1HMVA 4H8KA 4KLIA 4DTPA 4F4YA 1FKOA 4Z4GA 4PHEA 1TKDA 3GIIA 2OPSA 3DOKA 4O5CA 2C22A 8ICNA 3TI0A 3TAPA 3B6PA 5HMLA 2VA3A 4QCLA 5J0QA 4B9TA 3OYNA 4CGHA 1VSFA 1U47A 5KFEA 4NYNA 4CIGA 4YN4A 3L3UA 1S1XA 1JIHA 2RN2A 1C6VA 9ICBA 1L5UA 3RMAA 4PHDA 2FPMA 1RBVA 4HTUA 2R8IA 5HLFA 2BCRA 4RW9A 1LWFA 1RBTA 1RT4A 3AVIA 2P6RA 3VQBA 3HL8A 4ECXA 4B9UA 5L1JA 4CGDA 4CFBA 8ICBA 4TUQA 5KFCA 4AHRA 5F9LA 2DFHA 4IQWA 8ICPA 3OYBA 3FDSA 3C2MA 4B9MA 3VQ5A 4ICLA 4X5VA 8ICFA 4M3XA 1EXNA 1T3NA 3LAKA 3UPQA 3LWLA 4XRHA 2GBZA 4RT3A 3ZT4A 4DOBA 1ZQLA 3M8RA 4BE1A 4E0DA 3JPQA 3RAXA 5CJ7A 3EPIA 2UVWA 4RNNA 4FM1A 1TAQA 3EY1A 4FZYA 4KLGA 3DLBA 1VRTA 1S5JA 4M45A 5J29A 3RR7A 3TARA 2ZTDA 4F4KA 4ED6A 3AU2A 1RT7A 5J0PA 4DL6A 3QEAZ 1XSPA 5KT4A 3G6YA 4C8NA 3CM6A 3TAEA 5J2NA 3SZ2A 1C0UA 3BJYA 2FPKA 4DTJA 2ZD1A 3SI6A 1IO2A 1KVCA 1MQ3A 1S0OA 2E6MA 4B8AB 1BVSA 4TUPA 4YMOA 2FBYA 4F92B 5J0RA 1ZQYA 2PY5A 5J0OA 1ZQGA 3RBDA 3OYDA 5KG5A 3I0SA 7ICQA 2O4IA 5EWFA 3N4MB 4YXJA 3C6UA 3NF8A 4KFBA 4PH5A 1NOYA 3LANA 3JPTA 2HHUA 3QIOA 4Q0BA 3TAFA 1ZQBA 1JN3A 4TQSA 1GOBA 1NJYA 2IHMA 3VQ4A 3Q8QB 1KTQA 3ZD8A 1CXQA 9ICHA 4DFMA 4NLNA 1EP4A 4G1QA 3RWUA 1B92A 1VSJA 3LPUA 4DL4A 3QEXA 3RMDA 3ZDDA 2RDJA 5KT6A 3VQQA 2G8FA 3E2EA 4LH5A 4BDZA 1ZBIA 1ZQIA 9ICPA 4J9MA 2J6TA 4AHSA 8ICCA 2JGUA 1ZBHA 1IM4A 4L8RB 3TANA 2JEFA 7ICTA 1WAFA 3TABA 4JWNA 2BCQA 4Z6EA 4UB1A 4KLEA 2PYLA 3T5JA 3DLGA 2P51A 4Y1DA 5TZVA 4P4PA 3KLHA 4CIEA 1RTHA 5KG6A 3ORYA 4K4IA 4KB1A 3IRXA 1BPEA 1NJZA 3RJFA 3U3GA 2BE2A 3D45A 1ZQDA 1U45A 1BPYA 4O9MA 1S6QA 4PHAA 2PFQA 1SV5A 4DLGA 2ZE2A 4BE0A 4O3OA 3QERA 5KFHA 2IBKA 4YR0A 3Q8MA 1JLAA 2Z1IA 2VWKA 2IOCA 3ITHA 3QEPA 3IAYA 5IIKA 4LVSA 1ZYQA 1IH7A 1IG9A 1TV6A 1NOMA 4O0IA 2NRTA 4DU1A 4F8RA 3NF7A 4UBCA 4DU4A 4IFVA 4Q5VA 4JLHA 5KT2A 2ZJAA 3VQ6A 2FC0A 4O5EA 2QXFA 4I27A 4RPXA 1IKWA 4YR2A 4MFCA 2F8SA 3WNFA 3KHHA 1BIUA 1J9AA 3ZSXA 1REVA 4W5RA 8ICQA 3BQ2A 3O3HA 4NM1A 1T4GA 8ICIA 4R66A 4HYKA 4KLJA 1JL2A 3NTUA 7ICVA 2XGPA 5L1KA 3KLIA 1KFDA 2ISPA 1DTTA 9ICKA 3QZ8A 3O4NA 2ZTCA 3BQ1A 2I9GA 2QKKA 2FLNA 3ALYA 4ELTA 7ICFA 2IDOA 3K59A 8ICHA 1V9PA 3AVJA 3DRRA 3MAQA 1ZQWA 5IIJA 7ICRA 4QWCA 1NK9A 5J2FA 3N97B 5KFAA 3OYFA 3ISCA 1ZQFA 3VA0A 1F21A 3C1YA 3OYKA 2UVRA 2JZBA 4CJPA 5F9NA 4KREA 5HHIA 4FM2A 1UT5A 4CEDA 4M0AA 4O5BA 2UVVA 4CK2A 4ECZA 3PVXA 4P2HA 4QZ8A 2BQRA 1EX4A 4DF4A 3ISBA 8ICLA 3P1GA 2B4JA 4DTNA 9ICWA 1RDAA 1KEJA 5KG1A 3SNNA 2C28A 1C7YA 1BCOA 3CQ8A 5J2QA 5IINA 4B9VA 1MSWD 3MABA 4DL7A 3SQ0A 1DOQA 2IS3A 3PW0A 1SUQA 3P5JA 4B9LA 3RMCA 1B43A 3VQ9A 3KK2A 5KT3A 5BPCA 3HP6A 2XRIA 1C1AA 1ZQUA 2V4QA 1S1WA 1ZQCA 1NKEA 2P1JA 4EEYA 4CK1A 3FYHA 5J0UA 3DYAA 1LV5A 3PR5B 4OJRA 3V7LA 1T8EA 2HVHA 1ZQAA 2W9MA 1UWBA 4CJ5A 3NGYA 3NE6A 4Q8EA 1QHTA 1U04A 1RPLA 3PUFA 3RB3A 7ICPA 2C2EA 3U6FA 1WSJA 4F2SA 1SKRA 3GILA 3SQ1A 4DSEA 7ICEA 1YT3A 3HO1A 3ZD9A 3PX4A 2NRVA 4QZ9A 1KFSA 1HYZA 2Q3SA 4RT2A 3NHGA 2AJQA 3V6DA 2EX3A 4JS5A 4DQPA 2G8KA 3V9ZA 2A1RA 3OHAA 4RPZA 3DLKA 5DB7A 2YV0X 5J2JA 4ED8A 2BPGA 4DOCA 2ATQA 1U48A 4I7FA 3Q8RB 5KFZA 1NK5A 4RW7A 4F91B 1S1TA 1TGOA 1W0HA 2HB5A 4CHPA 4HHTA 2M9NA 1ZQXA 4DQRA 4I2EA 3H8WA 2B5JA 3LPTA 4QZDA 1L3UA 3KKSA 3SPYA 2AQ4A 2G8UA 3BGRA 2PFNA 1QSSA 5IIOA 3DMJA 4G3IA 3SI8A 3DI6A 4FW2A 4F93B 1IKXA 1A5XA 3GIKA 5KFPA 3RB0A 4FJXA 2DPJA 3DM2A 1HQUA 3PO5A 4CF8A 4C8MA 1QLNA 5E41A 4KI4A 3MR2A 2WONA 1JXEA 3ZSVA 2BANA 2DFFA 4DTOA 1ITGA 5CHGA 4UQGA 4UAWA 3EYZA 4FLWA 2G8HA 1BIZA 1FK9A 2IAJA 4M9GA 1JLFA 5DKWA 4DTUA 4K8XA 4LH4A 4LZGA 3T5KA 3ZSRA 1ZQPA 4QZAA 1VK0A 2F8TA 4CCHA 4KHUA 2PI5A 4NY8A 1NOZA 2KFNA 4J9QA 3AU6A 2RF2A 3AA4A 2YNFA 2W42A 3AVHA 5DQIA 1J54A 4EP5A 2ETJA 1N48A 4GC7A 4Z4HA 3H8JA 2IC3A 2VA8A 4XUSA 2B6AA 4Z0UA 2X6SA 1X9SA 1ZQEA 3B0XA 8ICSA 3P83D 4TUSA 2HHQA 2LSNA 4RUAA 2ZUDA 4QZEA 8ICWA 3EW9A 4DSKA 3M8SA 5HP4A 1N56A 4ECUA 3CFOA 1YTUA 1ZQMA 4I2FA 1LW0A 1G15A 4Z6DA 5DB8A 3AO3A 1QS4A 3TFRA 2JEJA 4GLXA 3LWMA 3WNEA 3MDCA 4F5RA 1S97A 3V72A 5JS2A 5KFGA 1GOCA 4E19A 4KLFA 3QE9Y 5FRNA 5T7BA 1VSHA 4CECA 2KQ2A 3C94A 7ICLA 1VSIA 4NLKA 4DSJA 3OY9A 3SUPA 3TAMA 2A1JB 1BISA 1SL0A 2AGPA 4KI6A 5KFXA 3A2FA 1YVUA 4F5OA 1S0VA 4FCYA 3NH2A 3HX0A 4IQUA 4CF0A 1NK0A 3AVCA 3S3NA 5CY4A 4C8KA 4RQ2A 5BOLA 1A76A 7ICIA 3FFIA 9ICQA 2PYJA 5CZ2A 9ICEA 2G8WA 4I2DA 4YQWA 2JEGA 3OYGA 3SJJA 4I28A 4IR1A 4JV1A 4Z6CA 1NJWA 1TK8A 4XQ8A 1J53A 4CGFA 3I0RA 3AA2A 3KKRA 3NAEA 2HHVA 3ZSQA 4M3YA 1HJRA 2ISOA 1S10A 1B22A 1VSLA 3L2RA 1RT6A 2BGWA 2ITGA 3OVNA 2C2RA 4KAZA 1K1SA 1XU4A 3DRPA 2D0CA 2XGQA 4H4OA 1ASVA 4FK4A 4OKJA 5DDYA 4NYFA 3ZT1A 3PV8A 3HT3A 1UT8A 1ZQJA 4BGDA 4ECWA 4DL5A 3OYIA 7ICJA 4E7IA 4RNOA 1JLBA 1B9FA 3V4IA 1TFRA 2Q0ZX 3ASMA 1JX4A 1Q8IA 2HNYA 4M6WA 3MFIA 4RQ6A 4ED2A 3MEEA 2PZSA 5KFFA 1D8LA 1TAUA 5KG7A 5L1IA 5J2KA 1NK4A 4BACA 4YMMA 4J9PA 4YP3A 3C5FA 3G0ZA 5J2MA 4JV2A 5I42A 5J1EA 2NRWA 5KFLA 1ZQKA 4Z4FA 4FLYA 2QKBA 3OSPA 2EHGA 4BDPA 4IKFA 5IIIA 2ALZA 4ID1A 4FJJA 4I29A 4ECVA 4RPYA 2AGQA 3AO4A 1L3SA 1CXUA 4FK0A 5C25A 4K4GA 4CFAA 4E7KA 4GW6A 4CESA 2E4LA 4ECYA 4ID5A 2XY6A 4DTRA 3LP3A 4FZZA 3NGDA 3H7IA 2W9BA 1A77A 5KFNA 3CYMA 2MUTB 9ICLA 2KTQA 1X2IA 3MEGA 4KV8A 4F4ZA 4I2IA 1XO1A 1PZNA 9ICVA 1GOAA 4YCXA 3RJGA 1BI4A 3RAQA 1RDBA 2ASDA 1IXRA 4UB3A 1I3AA 1LB2B 1RXWA 1TV9A 3M8PA 4EBCA 3T19A 5KT5A 2RDIA 3AO1A 1R0AA 4E89A 4N41A 1JLQA 3IG1A 4CE9A 4FJLA 3EPGA 4ED0A 4M3RA 1ZBLA 4FXDA 3G6XA 5DG8A 2KFZA 3VQ7A 3LZIA 1KLMA 3V9UA 4FM0A 1FXXA 1MU2A 4UBBA 3V9SA 1BL3A 3LDAA 4YXMA 4DSLA 1KRPA 5HMMA 4BDYA 2HMIA 1RTDA 1COOA 3MR6A 1TK0A 5KG2A 2RPIA 5KFJA 1RCHA 4KITB 3QINA 3OS0A 2HW3A 4CEQA 3LALA 1BPBA 3KHLA 4N5SA 9ICCA 1KLNA 3OSNA 3UXOA 1S9FA 5DB9A 4KHWA 2J6UA 5HP1A 4K8ZA 2BHNA 5HRRA 7ICUA 5KFSA 3PW7A 3ZDEA 1HUZA 4N47A 3PY8A 4DFKA 2FMSA 3I8DA 3O3GA 3RJKA 4F2RA 4CERA 1ZETA 4FLXA 1EXQA 9ICGA
chains in the Genus database with same CATH superfamily
3D6HB 3PG9A 4AL6A 2A1SA 5GAGP 1R89A 1TYQA 1M5OC 2RRAA 5M2UA 2Q1NA 1LEOA 1GTEA 1N5QA 5FLXY 2HQCA 3T1YF 4O4GA 1VGYA 3S3MA 3WQTA 4DMNA 2UZAA 1CEZA 1JLEA 3KUHA 2ZH6A 5AJ3F 5HP1B 1VSDA 5CD4A 4DR2K 3HJEA 3TUZC 3EWAA 2HHTA 3DGPB 3H0RB 2O8EB 2NRZA 3DOLB 1TMMA 3D2WA 1IR2A 5KRSA 2CDQA 1VQMS 2CJBA 4DFJA 3AVNA 4CJ4A 3BH7B 1XNSA 3A0BU 4MQ3A 4GO7X 2OCEA 3EX7B 5KPTA 1VQPS 3WKCA 4DCCA 4YG2A 1BE4A 4Y2VA 1NGJA 4WXOA 3KHGA 4H5VA 4GC6A 5B0AA 3CPWR 4CJRA 1UEUA 1RISA 2E20A 4R5PA 2ZGYA 4LFCJ 1GEHA 4J2DA 2OH2A 4ECSA 4DV6J 2WBRA 3VGTA 1CS4A 2F1IA 3GP9A 4BRQA 4LSLA 3UQSA 3LZJA 4Q2MA 1WLJA 4CJSA 5B0BA 4DR6K 2KW4A 1FVQA 4CHNA 1XWLA 5B0DA 3SJHA 1BPXA 3E01A 2J0XA 2GJ2A 4PKGA 4EYHB 4YD2A 2FBTA 5GMKa 3HPHA 3H40A 1W9HA 1U49A 2YKMA 3JAMO 1ZJNA 3RH6A 4C97A 2ESEA 1R7IA 2FMPA 1L3VA 1ZM4A 3J7Z5 3JS9A 4NL9C 1WEZA 4IOXA 3FBBA 2Y8YA 1UOCA 4IOAQ 4X66K 4U7UK 3VEZA 1D9DA 3BY5A 2KIVA 2F9WA 5J2BA 4A8MP 3DOKB 2L9WA 5J8YC 3GZFA 1MN7A 3CIPA 4BRGA 2XY8A 3W9IA 5C24B 1RTJB 3VQPA 3L4IA 1Z00A 3G86A 2QLWA 4C8YA 2ZJ5A 4CEAA 5CR0A 3L2QA 2VFRA 3BO2A 3GDQA 4Q45A 1PBUA 5J0WA 4P2MA 4USUA 2PI4A 3IAM9 1ZQNA 2UVUA 2R7UA 4PWUA 3DXMB 2R7TA 2DCUB 3H5YA 3WEEB 3EICA 2GIQA 4HTIA 4LF6J 4DOAA 1TVRB 2HDOA 4IEIA 1U26A 5LJWA 2AGOA 2X74A 4BREA 2OPPA 4ZP9A 1UW4A 4M41A 5E3CA 1DAXA 4BWJA 2HQIA 3U1MA 4JYAF 2YNFB 2W3RA 2I38A 5J2IA 4CEEA 1BY9A 2UYTA 4DUYK 3TAGA 2HFOA 4RJVA 3ULDA 1GT8A 3C6TB 4O3NA 2MKHA 1WSEA 5KFYA 1YJ9S 2CGKA 4CHZA 1FTRA 1WBDA 3CJRA 2F65A 2VC1A 4OI4A 2UUBJ 4OPHA 1RDDA 3HVTA 2YH1A 2FI1A 3MFHA 4FYVB 3VR1A 9ICTA 3G87A 4FJ5A 2JEIA 3M2VA 4MDAA 4BC9A 5DK5A 3DXBA 1JCEA 1RXOB 3TPQA 5KGWA 3HILA 3T1HF 1S8OA 3V1QA 2IFXA 5C10A 2DXDA 1WC4A 3CE8A 2MZTA 4WQ4C 2AA4A 4JWMA 1EQMA 4KGZB 3RH5A 3TWZA 5BR8K 3BO3A 4B1VA 2UUCK 4EX6A 1HNWF 3A5OC 3M1YA 1JJHA 3E51A 5HBMA 1OPIA 4K50A 3BYPA 3UE2A 3BDEA 3RJIA 1RAFB 4KAIA 3US5A 2RKIA 5H2FU 4FP9A 3NVWA 2ADBA 3DXMA 2W9AA 3DDHA 3HJFA 2VQEJ 3TU5A 3WNGA 1N54B 2KI2A 3FSIA 1ASWA 1Y5IB 1I51B 2GQ2A 2UXBF 1SV5B 2DR6A 3RBXA 5JLHA 4P4MA 2F8LA 4ZJQA 2H3IA 2R7XA 3J81Y 1T03A 2E1FA 3F5TA 4B3TK 3D6RA 3OYEA 4Y2TA 3QXGA 2AZ1A 3WKDA 1BC6A 5ETKA 4OJOA 2ASJA 1CQMA 3KJQB 4GRSA 4DR3K 4CF3A 2KEYA 2ZUCA 3QDKA 2NRRA 3MN6A 3BZQA 5KG0A 4HHUA 4CP5A 1JJ2M 1U1MA 1D5AA 3H45C 3MX5A 2AJFE 5DZ7A 2HI0A 3CCQS 1O13A 1SZHA 4FE3A 2DNQA 2DQNB 1F6TA 3N79A 3KNAA 4KH5A 4RW6A 4M5JA 3QO9A 2YX7A 4CT8A 4CJKA 5GTIU 1QE1A 3GV7B 3NBPB 4AUKA 2XMAA 4C4SA 2FIUA 1ZC6A 1FWLA 3VAMA 4TU7A 3ZZYA 2DY4A 3M7DA 2HRUA 4R64A 5ETRA 1I6JA 2R7QA 3HP9A 4KLOA 5AKZA 2HBQB 2DO4A 5H9EJ 2ZQBA 2HNYB 2KO1A 2L48A 5HVHA 4OHXA 2MAXA 1Y10A 4B3RK 3LAMA 3AUOA 3LP1A 4CLWA 1K6YA 2DFEA 5J2PA 2DF4B 4EUVA 1KFTA 4RBVA 3RG6A 4HTJA 3GG1A 4TLRA 8ICJA 3M05A 4MF8A 3G10A 2F8MA 1S6PA 3NNHA 1TAMA 4N56A 1S9GA 2CQGA 2CG8A 1X0FA 2L41A 1BDGA 1SJFA 4H0TB 2GELA 5J1PA 3ZO7A 1PUZA 1NKBA 4I2CA 2V6AA 4RG8A 2JGAA 1TL3A 4JHDA 4JI6F 2E5LJ 4C48A 5CZVA 3EKSA 5IT4A 3H8YA 4OIXA 2GS8A 3K8VA 2LEPA 3F5AA 4BRPA 1RK8A 1T9TA 5F2RA 3H42A 3SBGA 4AHVA 5L1MA 3ZNUA 3D2EB 1KQKA 2U2FA 2EC2A 5J0XA 4RQ7A 3Q8YA 3SFUA 4DUYF 2KSOB 1U2RA 2B4VA 1VK3A 1LXNA 1RE1B 2J9DA 3P3DA 4CJ7A 4NCAA 2EPIA 3PSIA 2P35A 3IS9A 4PL1A 2R8HA 4ER8A 4X4SA 4PWDA 4B3OB 5KG3A 1NZBA 2XZDB 4V19S 2DIVA 3F9MA 2E1AA 1C1BA 4W5QA 4JV5J 5DDPC 5DM6Q 4H5WA 5GAHI 3FGUA 3IRXB 4NEYA 1LCUA 4FVMA 3NCIA 5FDLB 2OTLS 2BA9A 1OO0B 1C0FA 2XSFA 1HA1A 1FO4A 4CF2A 5C2CA 2PFFB 1JMSA 3L3VA 1RYUA 3N28A 4WQ5A 1JXLA 1Y9OA 3THWA 2NRXA 5KQ8A 3JXUA 2LP4A 3KIOA 4I2PB 3J7ZT 5EX5A 1V85A 4RQ3A 5J0TA 1H6KX 2IOFA 5KT7A 4ZJOA 3H6EA 4BCAA 5FROA 4LSNA 3J7YU 2JC0A 1N34K 2QW9A 2W2MP 4PHTX 3T41A 3Q24A 2ASLA 2W3SA 1HARA 3R6GB 4WXWA 1YJUA 2LU2A 2PMHA 3IFEA 4PYDA 2BZFA 2BJ8A 3IV6A 4TNOA 3MM8B 5IT9Y 1CJUA 1RT5B 1FEEA 1N6QA 2PEBA 4KLSA 4O3QA 3B0YA 3OS1A 3BUZB 2V94A 1X6IA 2VHGA 2E7WA 1RTHB 2W8KA 5L1LA 3OBIA 1KR4A 2IJRA 2JLGA 3AVFA 2QA4N 5ALPA 3DOLA 3LP0A 3FNNA 3MM7A 1WC3A 3RB6A 3OLAA 2LCWA 3W60A 3H7HB 2IMWP 4HACB 2LQ9A 2O3DA 1CC7A 1WI6A 1M5HA 4FWPA 1KD1T 4MMOA 2JSXA 2ZIUB 5ALYA 3O5TB 4MK8A 3QBWA 1WKJA 4L3QA 1NGHA 9ICXA 1OSDA 2V2QA 2G5IB 1JKHA 3P45B 1YVNA 2G9OA 2NRHA 3V9XA 4PGQA 4MTPA 3SMVA 1YQHA 3R7BB 4UOHA 1IKVB 1SJQA 2DL0A 4DX5A 3O4WA 4KHSA 3MMCB 1WKLA 4PGXA 1XR7A 2KDOA 3OXLA 2JRSA 4DFDA 1DRZA 3DAWA 2BOAA 3C66A 3VCBA 3H3OB 4HT5A 1VQ6N 2C2ZB 2YPZA 4LIWA 2YWKA 3C15A 1XHZA 1GFWB 4B3MK 2EFPA 2QLFB 2K8GA 4CWBA 1RWOB 5AHXA 4BRAA 2OD4A 4PA1A 3JSRA 3CJ4A 2XC9A 3MR5A 2VG7A 5D46A 4RW4B 2LMRA 3O8WA 2ZKTA 4BRHA 3CD6N 4J9LA 3OUYB 3MXMA 4WCEQ 2HWIA 3M9OB 3F73A 4KBIA 4NLYA 5IWAF 2WSCC 2CQIA 3NEKA 2PT0A 4DCHA 3CFPA 4RQ5A 5FPDA 5KFQA 4DN9A 4LF6F 2FBXA 3TZXA 1CQNA 2KJ8A 4QWAA 3GE1A 2ZE2B 4NCGA 2KYZA 3FEXB 3QX7A 3OJUA 2ZH9A 3M5RA 2IA6A 3DHXA 4EHUA 2YN4A 1U6FA 3NH1A 5C5JA 2BDUA 3HDSA 3LPYA 4HUFA 2O8EA 2VYPA 1WYGA 1EP4B 4KTWA 4DQQA 2ACYA 1UVMA 1HI0P 5IILA 1TKTA 4B3MF 2WUSA 4I2AA 4NASA 1OXJA 4UB5A 2MUTA 3M32A 3HPGA 5L9XA 2ATLA 4K8RA 2E2OA 3J8AA 7ICHA 2HIQA 3EUNA 3LGMA 2DNLA 4YDXA 2O6KA 3ZDBA 3OPXA 1X5TA 4MHVA 2ZUAA 1VC0A 2EWSA 1N4LA 4C3KA 4RKUC 1XC9A 1Y0HA 3AT1B 4LFAJ 3AO2A 2F8EX 1EHWA 4RNFA 3Q8PB 3I33A 2F77X 1F9EB 4CRXA 2HBYB 3AB2B 2UUAJ 4PQAA 8ICEA 4UATA 2GGPA 3LGHA 2AD9A 1S99A 5KFVA 1VIOA 5I3UB 1D9FA 1ZD2P 2JVOA 3G6VA 1C0TA 3RSEB 1FKPA 4C1NI 2QWOA 1T0TV 3HF5A 2P9KA 3LDOA 3R5JB 4DS4A 4PQUB 2Z58B 4CJFA 5F8NA 2IJNA 3IDWA 2ZH8A 4CZGA 3LF0A 4C98A 4U67L 4DN0A 1KD1O 3EE8A 2YHBA 4WQ4A 2Z30B 2KE7A 3GJTB 3HMJG 1ZQVA 4ILRA 2O8DB 4BR5A 1SI9A 3EVOA 4FWMA 2VG6A 1U9LA 4M9NA 1Y00A 2Q3PA 4FJ9A 3GQCA 3AVMA 4TQRA 2ZJRQ 4B8CA 3QICA 4O44A 2R8KA 1DFDA 4M3UA 3T1AA 2DNRA 1UL3A 1RAAB 5CA7A 1WG5A 1M5PC 1PILA 2QT7A 1RU1A 2JVRA 2ZZMA 4PHPA 1C1CA 4J9SA 3CCMN 1SKWA 3TAMB 2V4JB 4RNHA 1NDKA 3CJKB 1AFJA 4CD1A 3A13A 4Z94A 1TL1A 5HNKA 2HF4A 3BQ0A 2CJXB 3OL9A 5G5GA 3RJJA 4Q43A 4LF8F 1JK9B 2IRXA 2V2KA 2DK2A 1O8BA 1JXBA 2RE1A 5AI9A 2ALYB 5CZ1A 4KHYA 5G0RA 2CJ9A 4DPTA 3Q2TC 1Z1ZA 3DXSX 1GNKA 2M0GB 4EELA 4QJFB 5IXUA 2X6NA 1X66A 4GMJB 2B9WA 4DS5A 1S48A 1WF2A 5FPMA 3S01A 4Y6IA 3WK8A 3D6JA 4DR3J 1H2TZ 4I2QA 1X9MA 2HIYA 2ZJPL 1YK9A 4CH7A 4ID5B 3ILLA 1SZPA 1SC1B 1YUWA 4YS2A 3V1OA 4FJNA 3SUQA 4BQZA 2CPXA 4M2YA 3M6UA 3QRQA 4NJ8A 3HD2A 5M1OA 3D1QA 4FVCA 4DPWA 4FO6A 2C2MB 4LZDA 3WQPA 4XPEA 3DLJA 3E01B 3S6JA 1L3TA 1JCFA 2A3JA 3KLGA 4AHCA 1WEYA 3KK7A 3PX6A 2WVDA 5DBAA 5F0XA 4YNQA 2FJWA 2OYQA 4PY5A 2O01C 1H74A 2XICA 1VQ6S 4ZVEA 4NLVA 1CJKA 2WTFA 1S9GB 2JH7A 1SL2A 1RWUA 3GE9A 3KFWX 4QYZK 2V8VA 1HWUA 2N4DA 4E3SA 2KZ3A 3DM2B 3IR5B 1V6HA 1V5VA 4JI3K 2J7KA 4C7ZA 1QY7A 4AD6A 5LMUJ 1Q7YT 1TKXB 3K4GA 2PDAA 2K89A 3SQGA 2R8GA 1T05A 4DWIA 3FRZA 1YRUA 3F53A 2KH9A 1TZ0A 3HTVA 2G07A 2WCXA 1IBLK 2L9DA 4EBEA 1W7AA 3QUCA 3MECA 2A19A 2OGUA 4BC5A 1KNZA 2VWJA 2NLXA 2P5OA 2L9NA 4DTXA 5DZ6A 3WT0A 1RYSA 2R7RA 4P71A 1V5IB 3NBPA 1KBRA 4OI0A 4FJ8A 4ZH4A 5GVQA 3JQJA 2EAPA 1FKOA 2HMIB 1TYQB 1QAYA 1A6SA 1S3XA 2E5HA 5LJ5Y 3PKMA 3FZMA 3NS1A 3SDEA 3O1BA 2C22A 1ZOTA 1Q7YO 3FKBA 3TI0A 3TAPA 2OMOA 1NLVA 3GR0A 5HMLA 2VA3A 4IG3B 4B9TA 4I68A 1QUPA 5ADZA 4FDFA 1C6VA 9ICBA 2QMUB 4ZCLA 1L5UA 2FSJA 4PHDA 4C0BA 3FCHA 4U95A 5F8MA 4HTUA 4CBXA 4F0HA 4JV5F 3W5YA 2OXOA 2BCRA 4ZIVA 1OKJA 4CF5A 2YJEA 1LWFA 5L9NA 1RT4A 4XDCA 1RBTA 2XI2A 4YOUA 2M2BA 3VQBA 2ZM6K 4AF1A 4MK9A 4B9UA 1ZAWA 5L1JA 2XEXA 8ICBA 1YHQS 2O8DA 5KFCA 3J7AP 4AHRA 4RQMA 1A7GE 4DV0F 3ENVA 4DR5F 2DFHA 4IQWA 8ICPA 3OYBA 3FDSA 3C2MA 1QAIA 4ICLA 2ZDOA 1ZD5A 2CQ2A 4Y2IA 3D2SA 3UMCA 8ICFA 4DV1J 1T3NA 2P6TA 3LAKA 3W64A 2IIRA 4DOBA 3Q86A 3EXCX 2B51A 4X2BA 3KZIU 4E0DA 4LF8K 1C0TB 1YBTA 3JPQA 3TVZA 2UXDK 2E8OA 1S4FA 4FM1A 4QS8A 3ICXA 1DY3A 3VF0B 4BC2A 1S5JA 3NASA 8ATCB 4O5FA 1IIPA 1ECWA 4B3TF 4ED6A 1VHFA 4JOUA 1H98A 2D69A 1R8PA 2B3TB 4AL7A 1FJEB 2LI6A 1WOOA 5ALQA 3ZEUA 2LXUA 5KT4A 2NYHA 3G6YA 2R42A 4Y2XA 2A6AA 2I0XA 3CM6A 5CABA 3RGIA 3TAEA 4YEAA 1SGGA 2MZRA 2FPKA 1HL6A 1X9JA 1G3OA 2EFQA 1WUAA 4MN4C 1K44A 3ELHA 2CAJA 4RR5A 2A2DA 1KVCA 4FPIA 3FM9A 4B8AB 3DLKB 4NXNJ 5HVFA 1RQNA 1ZQYA 1W2BM 4ZDNA 2QC3A 4DUYJ 1T05B 5RUBA 1NM2A 3C6UA 5J1NA 3MAHA 2JR5A 3NF8A 3VZHA 3ILJA 4MT1A 2QZ8A 3HHLC 3I5BA 1MWKA 1BQNB 2DHHA 1ZQBA 5AI0A 3BGRB 2NZTA 3VQ4A 4CO3A 1KTQA 1UZHA 3D68A 5KQDA 4ZVSB 1CXQA 4JKHA 2BBEA 3GJSB 2KXNB 4WJ3B 4Y3CA 1EP4A 5HROB 4WP3A 4G1QA 3CQYA 3KLGB 1B92A 2XTJP 2LFVA 5T7LB 1M90O 3CJ8A 2ROPA 5AM3A 2RDJA 1H1VA 4LH5A 4NA3A 4DXLA 4QPTA 1T3OA 1ZAXA 4JI0F 1RACB 2E7VA 3MTJA 2AHOB 2KD1A 2VG7B 2JGUA 2H3VA 2VQEK 3HSZA 4L8RB 3TANA 3TTCA 4KLEA 2NS1B 3KLHA 1WDDA 1HHQA 3I31A 4A59A 3CTRA 1WC6A 1ZS6A 1ZQDA 1KHWA 4KPCA 2KG5A 2VICA 1G99A 4DB3A 4JI7F 1KDNA 4CRJA 1S6QA 2PFQA 1YG0A 1SV5A 4CLKA 1VQKN 4BE0A 1IWGA 2GCFA 3O1LA 5JU5A 4OI3A 5F41A 5KFHA 5CD4H 2HBMA 2XLJA 4K2XA 5IIKA 3K8WA 3TSPA 1N62A 2Q31A 1IG9A 3MPUB 4M5NA 2J4RA 2VG6B 4DR1J 2KU7A 3R2CJ 1YAGA 4ZVTB 5EHHA 4PG4A 4DU4A 4Q5VA 4OV1A 2OUGA 1JJCB 3U9DA 5FPEA 1VLBA 3MCAB 1Z4UA 2YJFA 3VQ6A 1YRXA 2FDRA 4OX9J 4K4VA 4Y2JA 2VUGA 1IKWA 4BVOA 4YR2A 4MFCA 2F8SA 5DS7A 4OI1A 2X1FA 5GADU 1BA0A 1REVA 4NLUA 3V81B 3BQ2A 4IOCQ 2F9TA 2YTCA 2YMPA 1F5AA 1JJ4A 5IQ6A 3ZEUB 4UOGA 2CQCA 5B0EA 3M30A 3KJVB 1XMQK 2YWFA 1FDNA 3ICLA 5L39A 1Q18A 3QWPA 1KFDA 1WWVA 4DQ8A 2HS4A 3K7RA 3O4NA 1B0VA 4LF7K 3BQ1A 2I9GA 2QKKA 4JKAA 2R7WA 1FDDA 3MPDA 5J2FA 5M2PA 3DLLQ 3M2VB 5KFAA 3OYFA 5AKGA 3CDUA 2JZBA 1EARA 3DRYA 5GIPA 3CXCM 4KC5A 4KREA 5HHIA 4A4JA 2KKVA 5K8MA 4ECZA 3MWPA 2V2VA 4P2HA 4JKFA 5ALDA 3AHPA 3JSYA 1AUDA 4DV4F 4DF4A 3ISBA 3BSAA 1OH6A 1NJIO 4NLCA 1KEJA 1HJOA 3JAMU 3SNNA 3AXKA 1N5YB 5HMXA 5CYMB 1C7YA 1LWEB 1BCOA 2VQFJ 4LRAA 4KH1B 5IINA 2IMOA 2RQ5A 1SUQA 3M4XA 3P5JA 4B9LA 1QQNA 1V4SA 3RMCA 5ALWA 3EVMA 4ZK7M 1B70B 2ZHBA 5F0WA 3HP6A 3DNCA 3CPWM 5KAFU 3U7JA 5DDQC 1ZBSA 4NMXA 2O8CA 1C1AA 1IKWB 2OO4A 4DPYA 2OSRA 1NKEA 3D0HE 1KQSM 2P1JA 2AJ0A 1JNRB 5J0UA 4DMZA 1LV5A 3S1TA 3IM8A 1PVRA 4OJRA 3THXA 2H5JB 3NGYA 3NE6A 1RPLA 1XIQA 4IZ9A 2B9EA 2YXLA 1RGVA 1WSJA 1R8HA 3TZYA 3NVKA 2FGOA 3CF5L 1SKRA 3CCVS 4BRCA 1KTVA 2X1GA 4DSEA 3GYGA 4MKAA 1TU0B 1RP5A 1KFSA 1TUVA 2Q3SA 5LY3A 2NO4A 4DQPA 5EN1A 3M8ZA 2A1RA 1DK2A 3D28A 4RPZA 3C6AA 4OLPA 5A8KB 3Q8RB 3EJMA 3KJNB 4F91B 4LUBA 4CHPA 1TGOA 3NAIA 1ZQXA 4H4OB 3CMAN 1VDVA 1DQ8A 3CHWA 2WMMA 4QPXA 2QLTA 1RA7A 3LPTA 1L3UA 5K5MA 2EXUA 3KKSA 1NMEB 4A47A 3BGRA 1MG7A 3CUNA 3W66A 2OKQA 5C12A 4FW2A 4F93B 1IKXA 2PA3A 3VF6A 3PYDA 1X4BA 4RPFA 3GIKA 4J90A 3FZLA 5KFPA 1OH8A 4CDIA 4CDGA 3N5BA 4FJXA 1TUUA 3MM7B 3LP0B 4KI4A 3WKBA 3KXDA 4TYAA 2WW8A 2H4WB 1TL7B 3ZSVA 3EZWA 1R59O 5CCLA 1ITGA 4URGA 3MEKA 3O1WA 4HR2A 1SBRA 1K8AO 1XMOK 2IAJA 1ZA1B 2Y9TA 5E79U 4M9GA 5DKWA 5ITHA 3KJFB 3D3CJ 3B54A 1WG1A 2FE9A 1WHVA 2CQDA 1RJJA 3DFEA 3J80O 4DHVA 5ETMA 1ZQPA 3DMJB 1BMQB 2G0CA 2KFNA 4UY8O 3AVHA 2BM0A 1T03B 4U7UD 2GFFA 1RB0A 3HOTA 1YITN 1Y7PA 2VIXA 2MA1A 4Z0UA 4K59A 4CE6A 1X9SA 3O9UA 4H5NA 5GADP 3LM9A 2YWWA 3E9OA 4USAA 5LMUF 4H0OA 1VRUB 2M52A 4DR7F 4WJBA 3I87A 1XNRF 3T9NA 3CFOA 2RAQA 4PWWA 3VTIA 2FUG9 2RE2A 2NPIA 2BUPA 2KHVA 3ENHA 4I2FA 3CJSA 2KN4A 1VC6A 5FPNA 2JEJA 2HQGA 3WNEA 4M7YA 1S97A 2ROGA 3OQ2A 4HI2A 5JS2A 5KFGA 3TYTA 1ACMB 3JTPA 4Z7YA 5GIOA 2Z2ZA 2DGUA 3TJAA 2A42A 1RCXB 7ICLA 1VSIA 2W41A 3WK7A 4NLKA 4MIBA 1Q4RA 3SUPA 5AE1A 4FNHA 4KI6A 2YKMB 1YVUA 5AM0A 3O08A 4MLHA 2G2ZA 4FCYA 3NH2A 3HX0A 1VQNN 4CF0A 1NK0A 2WAQC 2QLXA 3THTA 5AIAA 4C8KA 3W62A 2W6LA 5LJ3Y 4RQ2A 4WU3A 1HPZB 3CCMS 5CZXA 2IDEA 3NXZA 1GAOA 1PJ6A 7ICIA 5AQFA 1FX4A 1C1CB 1KQFB 5CHIA 2FLOA 1X4CA 4YB5A 4Y0FA 3OYGA 5HK4A 4I28A 4IR1A 4PL7A 3NGKA 4Z6CA 5CEHA 4A8OA 1FA0A 3MPVA 2OANA 2HHVA 4DR6F 3X3UA 1VQ9N 3V4MA 4CNYA 5D0GA 2ITGA 3OVNA 3VTHA 3D3BJ 1XU4A 3DRPA 2D0CA 2XGQA 3LH2S 1S72S 3OW2M 3QIDA 4WFAL 1ASVA 4EFHA 3K2YA 1NGEA 4FK4A 5D0RA 3QUQA 4H0PA 4OX7A 3HKZC 1UT8A 1ZQJA 1LWXA 1S7HA 3T6JA 2K06A 4ECWA 4Y2PA 3OYIA 4WK1A 1VQPN 4KIAA 3QAUA 4E7IA 3IM9A 4IQMA 5EE3A 3V4IA 1TFRA 1JX4A 3A8IA 4LC9B 2PZSA 1WC1A 2P9UB 4ZVPB 1TAUA 5L1IA 1QE1B 5J2KA 1NK4A 4YP3A 1ELOA 4O23A 3NL0A 4FOIA 3I1YA 3NCQA 2NRWA 1FNOA 1RBOB 5ALXA 3QU4A 2QKBA 3OSPA 5BYQA 4BDPA 3ZTSA 5IIIA 1NLKL 4I29A 4ECVA 2AGQA 3NVVA 1T6DA 1L3SA 2XI3A 2Y9HA 4DOZA 1F3FA 3R1HA 2DITA 4L73A 3W2WA 1JQGA 4ECYA 1UW9A 1VJWA 2B56A 3DU6A 5D4PA 5L8RC 2ZBPA 3W0LA 2HFZA 4OLOA 3VEVA 3ETOA 3LP3A 2DGWA 4RW7B 4EHTA 4RWTA 1Z4OA 3EKUA 4XO0A 3SLCA 4ZVGA 4B3SK 5AI4A 3AJDA 5DRKA 2MUTB 3LTOA 3HHEA 2KTQA 1X2IA 2I6WA 1SZ2A 4I2IA 2VPYB 1DT9A 2B43A 1D09B 2D3ZA 4YCXA 1NWKA 5A0YB 4UB3A 5EE0A 1I3AA 1TV9A 2QSWA 3T19A 2A41A 4KGXB 2DBBA 1IJJA 3IG1A 4CE9A 4FJLA 1VQ4N 3EPGA 4M3RA 1ZBLA 1IBKK 5AQXA 1W26A 4K4UA 2KKHA 5CQGA 2ASOA 4X4TA 2AZ3A 4KMOB 4BGAA 1FXXA 2P5VA 3V9SA 4OZ5A 2OTJS 5JMVA 4YXMA 1APSA 4ID8A 3JB9k 1COOA 2BE2B 3TEGA 4ES1A 4KITB 4OJLA 4A8EA 3SAHA 2DEJA 1YI2S 1T44A 4X4QA 2DNNA 2Z56B 3HD1A 3DV9A 5M1KA 3O9RA 1S9FA 5DB9A 4KHWA 1UZDA 2XG8A 5HP1A 4K8ZA 5HRRA 7ICUA 1MNEA 5KFSA 1HBNB 2XWYA 3DRRB 2OEHA 2RHSB 2IRUA 4IDKB 1PVPA 2O66A 2CQ0A 2P9LB 2GLEA 2LM4A 1XO0A 3O3GA 1QVFR 2BANB 1RAOA 3RJKA 4IG0B 9ICGA 1WEXA 1UJ6A 4L72B 2MZ1A 1U7LA 4V19X 3SBMA 3D5MA 1NGFA 3MN5A 4KSEB 4B3SF 3V9WA 4R65A 3R5DA 4OYAA 1OSCA 4ZPCA 2HHPA 1RT1A 2BJEA 4A8WA 3FSYA 1SS6A 2AJ2A 4KFBB 4CHYA 3O5BA 2VANA 1MWQA 3OTCA 3W8PA 1MQ2A 3KLEB 1NMNA 3MM8A 3MGJA 3ZETB 3ZTQA 5A2QY 1UFKA 1B4SA 5KOXA 1U4BA 1A5VA 2AIRB 4YHHF 3R1XA 4CHOA 3ZSWA 2JJ4D 4ECQA 1HPZA 1VJQA 5JVHQ 2VBZA 4DZDA 3MXJA 4CJ3A 4BR2A 3DHWC 4MH8A 4WKRA 3P5TL 4MF2A 1LWCA 2PXIA 3AQOA 4RCHA 4LF4J 3MOJB 3N7SC 3ULEA 2D5RA 3GTYX 3GIJA 4XA5A 4LVNP 1LWFB 1F0XA 3AXMA 5D0HA 4H5TA 2FSKA 3QBCA 1PGZA 5KFRA 9ICFA 1CLQA 4RW8B 3OBYA 3L5KA 3HHLD 2VD3A 5J8YA 2KZZA 3I55S 2GVDA 2YKPA 2W2NP 4O3SA 5GAGI 1VRQC 5SWMA 4HEA9 3UI3A 3I55N 4OZNA 5AKKA 5A0LA 4DFPA 4FWSA 4LF7F 3DOMB 3ZDCA 2NXUA 1Z00B 2YB4A 5J2DA 4WE1B 2D3O1 2BVZA 4ITSA 1WNSA 2YWGA 3H8SA 1T95A 4IBNA 1DXSA 2RRDA 1A5WA 5IIMA 4NE9C 2E8AA 3K1ZA 4OI6A 3B6BA 8ICMA 4Y2KA 5CE3A 3W5ZA 3ALRA 3QZ7A 3VGLA 1VLOA 4KO0B 1FE4A 1M0SA 4IS7A 1ITPA 4I9LA 1XSNA 2DRBA 1RCOB 2EAMA 4CLLA 2HBRB 5AE2A 1YRTA 1SV0C 2QJ3A 3DLEA 5AKIA 1RTIA 4TY8B 3IG8A 3UCZP 2UXCJ 3OJSA 3PHEA 1NGAA 2E9ZA 1Q3UA 2CPZA 1ZH5A 4ZLLA 3K75D 2FHJD 4OX8A 4B3RJ 3NVZA 4LD0A 3L8BA 2C2DA 1U2CA 2WVCA 4KGMA 4YN3B 2BJ1A 5DQHA 3VAIA 3QFHA 2H3GX 4Y65A 3VQCA 4K4XA 1PYTA 4YOEA 4B9QA 3UR0A 2G2OA 5DBCA 2WONB 1HNXJ 3UD5A 1LOTB 1B99A 3C21A 1EO1A 2GW8A 3TR5A 4J2BA 1PKUA 1X5SA 3KHYA 3GV8B 1OWXA 2IM3A 3T3FA 5JUMA 2XMTA 3KOOA 3G6ES 1CJVB 5E3PA 1PO6A 4NA1A 3UW1A 3FBCA 2ZJ8A 1P90A 1DJ0A 4EO6A 1HHTP 4K4HA 9ICSA 4BXOA 3Q8LA 1UTAA 2GV9A 2VFUA 1KWMA 4CH0S 4LIRA 3O2IA 1U6ZA 2NUBA 4LF2A 2FPHX 1RT7B 3TAQA 4CLTA 5C7PA 2JLEA 3QRRA 2V4RA 2F40A 1SKSA 3L9ZA 3D7EO 3MBYA 3OYJA 1SIJA 2ZJQL 3LDPA 3UN3A 1IBKF 2RMLA 3W2VA 3CDAA 2OMLA 2NPFA 4DV3F 2KVIA 4H4MA 1GXUA 5AQJA 4OGEA 3EZUA 3DGVA 2WF9A 4FLUA 4J2EA 3MMAA 4KPYA 4LRDA 2CQ1A 4F7VA 1Y88A 3QQCD 4I2BA 3NRWA 1N0UA 2E1MC 3AOBA 1VQLN 2DJWA 1LQ9A 3OYCA 2FVQA 1LAWA 2RQ4A 3MHYA 1B4FA 4UUXA 2GWKA 4FJIA 4RUHA 4DO9A 1KBUA 4DQSA 1YLXA 2YHAA 3OYAA 2G2YA 3BEGB 3CP8A 4YY3F 3V6HA 4LRFA 4PKDB 2DNHA 1P9YA 1MWYA 3MF5A 4OZLA 5ALEA 3PJ9A 3QFWA 5BPLA 2LA4A 1N5TA 3H20A 2FJAB 4PL8A 5JVHL 2FLLA 2UUAF 1M1KT 4OFZA 1S6UA 2HNDB 2K1RA 3F2DA 4KH4A 1URNA 1ZQZA 1R8CA 4QIFA 4CK3A 4QW9A 3HI0A 5MLCV 4FBUA 3QAEA 1ZXIA 3HI9A 5JS1A 5K9FA 3HKZF 1QTMA 2ZHAA 4H5RA 2WHOA 3EWGA 4NLWA 2P8IA 2CXYA 4Y28C 1FNXH 2JOQA 4RQ8A 3SBTA 3T5HA 1XHXA 4CJEA 2EBGA 4IO1A 3L2WA 4KKOA 2Z4PA 4BRFA 5D4BA 4DF8A 3CCZA 3CDBA 3E9LA 3ENAA 2M3DA 1UA0A 2X78A 2CGJA 3PNCA 3C1ZA 1FF2A 2WHEA 3QEIA 2BKNA 3I4HX 3NCRA 4M3TA 1RBUA 4X84A 2HAIA 4IG3A 1C4AA 3OT9A 1FKAF 5CB1A 1F0MA 9ICJA 2ZH2A 2R7SA 3MGIA 4M6WB 2YMMA 4FXVA 2LU1A 1NXIA 3TACB 3L2UA 4IRKA 2QA2A 3P4UB 2M8DB 5B5EU 1VQ9S 4ANCA 4LF6K 4C11A 2A5XA 1URJA 1HWKA 1N0VC 2Y0BB 4IRCA 2JNJA 3CM5A 2MXYA 4BR4A 1SWVA 4DV4J 2UXBK 4J2AA 3M6GA 1VQON 1WUDA 3BSOA 1FRMA 4M94A 1S79A 1V9OA 2NSBA 2K4PA 4BRNA 4ZVUB 1C0MA 1OH5A 3MDQA 1IN0A 1NO8A 4OZJA 2BW2A 2Z1HA 1IKVA 5TISU 2JFDA 4YFKA 3SYZA 1OJ4A 4QWBA 1DGSA 1CZ9A 4I9QA 3L4BC 3SCXA 2GH1A 1J6ZA 1JLGA 2PFUA 4P10A 3VGSA 3BQTA 3K5PA 1JKHB 1XK8A 1NNDA 1HKCA 4FJHA 1BPDA 2R8JA 2OHFA 3QEVA 1GMWA 4YY3J 2KICA 3MCOA 4F3OA 5DJBA 5IM0A 4JI7K 1D0EA 3VETA 4ACOA 1GO3F 1KLMB 4MYUA 3UD4P 4OX9F 1WF1A 1RZTA 1IBMK 2ZOMA 1RA6A 1AYEA 9ICNA 1U0SA 4BE2A 1N33J 1YZ6A 1SH0A 2JLFA 5DGAA 3GFKB 4FYXB 4RWWA 2G4BA 4UAUA 3RTVA 2JRZA 1FRJA 3THPA 1RNHA 3CIZA 4CEBA 2O8BB 1VSKA 1WSIA 5I4MA 1R0CB 4DV5F 3SK3A 2ASYA 5IM0B 4WWSA 2F8HA 2GIFA 1LK7A 4UAYA 3ZX0A 4R8UA 5DLFA 3SV3A 3OXFA 3N5FA 4C7YA 3HPOA 4DR7K 4JKGA 3MPWA 3C19A 2B9YA 3MPYA 3BM7A 3DN9A 4OVLA 2WFBA 4H4MB 3M6WA 1BUXA 2V34A 1X5PA 5CYQA 2VBWA 5EVZA 2HSTA 2DXEA 3PMLA 1HI8A 1RG6A 1S1XB 4QAGA 4NM2A 5G0RB 3ATUA 4I2GA 1QQMA 3CDEA 3Q83A 4O0NA 4USMA 2Y1LB 5KPRA 1O1WA 3GYXB 2Y8WA 3P38A 1RDCA 5KTQA 4DR5K 3SUOA 2HFVA 4K5RA 2F44A 4XH5A 1NPRA 3MEDB 1QQ6A 2HNZA 4FSVA 4BJQA 4FNIA 4LJXA 1H3DA 3IBCB 3WC0A 3R5AA 3DRPB 2YWEA 4YFUA 2XY5A 2F4VJ 5T41A 4Y2YA 2ZD1B 2KJ5A 3PRBA 3V7JA 3K5OA 1XNRJ 2CJAA 2RH3A 1YWXA 1SCJB 1WJ9A 2R9LA 2XSJA 2CFXA 2DT9A 2XMJA 3RSEA 3O44A 4W90B 3JPSA 5F3XB 4FK2A 3G4SN 1ZQTA 3PXGa 2I2YA 2ZM6F 1ASUA 1WCLA 2ZZNA 3UQ0A 2CQ3A 2AT1B 5JVGQ 3OL8A 4DQIA 1CULA 7ICKA 2ITMA 1YBUA 1UVJA 3PO4A 3TW0A 3ZT2A 2HVIA 2HVZA 4UF4A 2BQ3A 1LFPA 4JBCA 4RQ4A 5DG9A 5J2GA 3QLHA 3ED5A 3PYEA 5ALZA 2KZMA 4KRFA 1FKPB 5A6PA 2HFNA 1Z25A 4KT0C 4FLZA 5AQTA 1GK8A 2FBVA 3SQIA 3K5LA 2PD1A 1LW2B 8ICVA 1RT5A 3OYLA 3GOIA 4NLGA 2EZXA 4WTYA 5ETLA 3RR8A 3TADC 4J5OA 3HULA 5L38A 3FEYB 1DGKN 1YJ9N 2WB1C 1P7DA 2AF6A 1S6QB 4CZCA 4QZFA 3CJ7A 3WNHA 1BQXA 2F1HA 3K5MA 2B0GA 3FZBA 2ZWOA 3JSMA 2CXEA 2GMLA 4WTOB 1SXLA 2BTFA 4DSIA 1RSCA 2E5JA 3THWB 3SSRA 4EZ6A 1N60A 2C1EB 1E4GT 4M42A 4GXJA 1R0AB 1Y97A 4ZPAA 4TY9A 3MR3A 2OHDA 4CEZA 5BRDA 2FSNA 3C5GA 4HCCA 3Q0AA 3QT7A 3KMSA 4DV5J 2UU9K 3DLGB 4FS1A 2W8LA 2KP7A 4ZTFA 1JALA 5CP2A 4DI6A 3B6OA 9ICUA 3MCNA 3A8YA 2Q0RA 2F4VF 3RRKA 4M3ZA 3BH6B 2YQ0A 4CI0B 2YNGA 3AODA 2DNMA 2R2SA 5KFKA 2EZYA 4HI1A 4WF9Q 1KC8T 2LQJA 2XSJB 4PAAA 1AROP 3UDCA 2RB7A 3O3FA 1RZMA 4YMNA 2AV5A 4KQZA 3EO3A 1FXLA 2UUTA 2HBKA 5TKWA 4BWMA 4KLQA 4NLBA 2NO5A 5A0YA 3TX0A 5KI6A 1NSPA 3CETA 1D8YA 1M1GA 1NM1A 4JI0K 3MUTP 4OJ5A 1GLEG 3THVA 2KXFA 1ZQQA 4M9HA 5E7OB 2VG5B 4HUEA 1IBCB 3SCKE 1MC8A 5G5HA 1RT3B 2HHHF 2W2QP 4H4KA 2D9OA 3A1YG 5ETTA 4P72A 5E0OA 3EM1A 2QWMA 2RKIB 5AI8A 5B09A 3VF2A 3QIPA 1UMJA 2P9GA 4DX6A 1CZBA 2ZEJA 5HVGA 1R8AA 1YJWN 4X62F 4MEYA 2ATCB 3CCRS 1FCAA 3FEZA 3ZT0A 5A6WA 3ZX3A 1X9WA 4DPXA 2OZMA 5JICA 3KWGA 1H38A 5BR9A 1OYEA 3QT8A 3I56S 2VG5A 4XIUA 4ED1A 1JLCA 2KJVA 2MKJA 4FKYA 1TMJA 1KVIA 3K57A 4UARA 3Q8UA 4GIBA 2KHCA 3A8JA 3I5AA 1RQ0A 5EWGA 3CCSS 4DL3A 3NNAA 2C2OB 3L3FX 4J03A 2ODGA 2QEXS 4H4KC 3PMNA 3AGRA 1VISA 3HX9A 3AVKA 1TKZB 2OPRA 1RTIB 3C6TA 2GWSA 2JZ5A 2AU0A 4L3KA 4BRDA 3KD5E 5HLFB 1X3NA 4K0KF 3C23A 8ICOA 1OIAA 3MCPA 1FX2A 3FSXA 3THXB 4M04A 4DSFA 2GEMA 1IBLF 4E7JA 4LF9J 4CZKA 4ZPVR 1S9EA 4JV0A 3U27A 3BV8A 2BE9B 2D0BA 1WTFA 3HM8A 4B9SA 1SQGA 1P9QC 3BGFA 1XJWB 2UXDJ 2QX0A 1GLJO 1IG6A 3MMBB 5CYMA 3G96A 3LDNA 3CXCR 4IFEA 1JROA 2KN7A 2P9SB 2MJNA 3AV9A 1BI4B 4CO4A 4DG1A 2D0AA 3V7KA 3JSBA 2E5IA 2HOEA 2XLIA 4IOAL 1U24A 4YB7A 1N5YA 3AJ2A 2W6KA 1VLYA 5AQKA 3WU2U 4QW8A 1OUQA 1WHYA 5HRSA 3JTNA 3SXLA 1IV8A 5LMNF 4GXIA 2GWJA 5DM7Q 1N32K 5EGYA 2AP1A 4LY7A 2F1JA 1BOTO 3I4PA 2KLAA 1DHMA 2VASA 4P2XA 3NVMA 4IH5A 2WFAA 1KQQA 1FRLA 1HPMA 3TKAA 3WXMB 1BHNA 2Z2LA 2CH6A 3TFSA 3D0PA 4DKWA 3A0HU 5DGBA 3GB0A 1GXTA 1TKZA 4GVBA 1KW4A 3FQKA 5DO2A 2X1BA 1SJ1A 2RHFA 4CT9A 4K7QA 2GHVC 2OM6A 4IYQA 5AQZA 1CI4A 5BYSA 2ZWHA 1Q46A 3UD3P 5C42A 4Y00A 4JRPA 3KG0A 3HVRA 3BYRA 1J2NA 2VA2A 1TL3B 1RAGB 2M88A 1DARA 1N36J 3IA0A 1Q79A 3HSTB 2P6SA 4CFCA 3IG5A 4CVNE 2G8IA 2CNNB 3SAGA 3BS7A 2W04A 2OPQB 2YKAA 4P7VA 2E1CA 3NF6A 5A76A 1VBXA 4KLIA 1KQSR 4DTPA 4X65F 3CD5A 2YY6A 4WZQA 4Z4GA 2K8AA 4PHEA 1ATSA 3FQLA 2F4VK 2M7SA 4EENA 5EX3A 2OPSA 4O5CA 1HR0J 3H5SA 2JHDA 2W11A 3VERA 1U2VA 2AKWB 4OHZA 3CCJS 5C2DA 1X0PA 4CBUA 2AXTU 4QCLA 4YB1P 4M95A 1IM6A 3OTQA 2KG1A 1U47A 1E6VB 5KFEA 2BE7D 3UMBA 4QYZJ 2B8PA 3AOAA 3MM9B 1JIHA 2ILYA 3J7AN 1LOUA 4QOTA 4KX5A 1E6YA 3RMAA 1WI8A 4JKEA 2EEYA 4HL9A 1E3MA 3K89A 3PNIA 3D1OA 2G0JA 2AYBA 2Z8QA 3R9PA 3AOCA 4DR2J 4Z2XA 3OLBA 3HL8A 3EN9A 4CGDA 1RM6C 4C1NK 3BKTA 2VQFF 2WSEC 4HDGA 4FYYB 4X5VA 2EVZA 1DBDA 2AJ4A 4M3XA 2GZOA 1EXNA 4FWQA 4XRHA 4RT3A 1ZQLA 1G6BA 3KLHB 3K9KA 3M8RA 3C65A 1RHMB 4UQTA 4HHHA 1HNVB 3RAXA 1AXQA 1XUPO 3EPIA 4CO5A 2W25A 2UVWA 4RNNA 5FIIA 4M1KA 3E3XA 5JMNA 3EY1A 4ZCKA 7AT1B 5J29A 3RR7A 1Y11A 1NB2A 4AFFA 2ZTDA 2MQOA 4RO0A 4NLXA 2E44A 2E1YA 1LXJA 2OTJN 1BQMB 4I6WA 1JLGB 4DL6A 2WRMA 2LPEA 4QNLA 3CMAS 2V68A 2XZTB 1BUPA 2MLXA 1C0UA 4F02A 3B78A 3PRDA 3BJYA 3AA9A 2LA6A 1RFQA 3SI6A 1L8LA 3N0VA 4R79A 4CYUA 3MUMP 3QU2A 2CWXA 4HLBA 4BRMA 1AW0A 4I67A 1GX5A 1NH7A 4YMOA 2VBXA 2FBYA 4F92B 2E88A 5GTHU 2MPUA 2E1PA 3L4QA 2PY5A 3RBDA 3RW7A 5KG5A 2I8EA 5J2NB 2WSFC 2HFUA 1HR0F 5EWFA 4FPRA 3N4MB 1CZAN 7FD1A 2ZNZA 1QJHA 1NOYA 3JPTA 3QIOA 3A3PB 1Z19A 4Q0BA 4A48A 1SIZA 1GOBA 1NJYA 2R2RA 1BNPA 2IHMA 2N1RA 5LM7E 2FHKA 3ZD8A 4NEZA 2P9LA 3OL6A 1JI7A 3HSCA 2EI5A 2F7VA 4QR2A 4O4RA 2J7WA 1I3OB 1HNXF 1SQKA 4K43A 1VSJA 4DL4A 3GCXP 3QEXA 4F0MA 4OYIA 2RRBA 3CPEA 3HRGA 2G8FA 3CJ5A 2GX9A 1VQ5S 4BDZA 1ZQIA 2UXDF 4J9MA 3S7RA 2J6TA 2DNGA 3ILOA 3G8SA 1H0HB 3TP2A 1YXQA 4UASA 4X62J 7ICTA 1WAFA 2EKNA 3TABA 4JWNA 3C16B 4ZVRB 4Z6EA 4H54A 4QQBA 2PYLA 2GAHC 4DX8H 5TZVA 2QTWA 2A6MA 5AQIA 1NSQA 2Q36A 4EEKA 2O8CB 4K4IA 4KB1A 3IRXA 1KN6A 3H59A 1NJZA 2HOFA 2GQCA 3M7VA 3NS6A 2HCFA 2KVSA 3OTOK 3D45A 1SXDA 4CLYA 1U45A 3R1LA 1BPYA 4O9MA 4PHAA 1MMNA 2LYVA 2W4CA 2V8DA 3MURP 1RWVB 3CNHA 5AK3A 3GSIA 3MXHP 3Q8MA 3SD7A 3ZX2A 3PIPL 3CJ1A 4BG9A 3D2FB 1U1PA 2IOCA 3QEPA 1H73A 2EANA 3BPSP 1TV6A 4ZVHA 4NXMK 2J9EA 1RHKB 3THYB 4DU1A 4ISFA 3OR2B 2CYYA 3CD0A 2ZJAA 1E6VA 3BKUA 3W2VB 1JLCB 4DPOA 3P5BP 1IJEB 4ZHRB 1YDLA 3WNFA 3KHHA 1BIUA 3ZSXA 8ICQA 4LBPA 3QFUA 2QIFA 1FEHA 1NPKA 4R66A 2CJKA 4KLJA 3H2UB 3NTUA 7ICVA 2UUCF 1UETA 2CN1A 2DR9A 9ICKA 5ALJA 2ZTCA 1PSDA 5HMWA 2KHDA 2IDOA 4GY2B 1V9PA 4NYZA 4PPZA 5B0CA 3AVJA 4YORA 3MAQA 1JLFB 1NK9A 2GVZB 4LFCK 3N97B 1SV0A 3EVWA 3QWUA 2BUNA 2MQNA 4U96A 2DNYA 1F21A 3B8HA 3PLAA 3C1YA 2UVRA 5F9NA 2DO0A 3UKRB 2QARA 4JI4F 1UT5A 4FM2A 1YVFA 4ZCMA 4O5BA 2XBPA 4S0MA 3PVXA 2PKEA 5BXIA 4KRWA 3W8GA 1CJUB 4V1Ak 8ICLA 4DV2J 3P1GA 2VONA 2F3JA 5M1NA 9ICWA 1RDAA 2QM1A 3MAAB 2XZWA 5M1FA 1GQEA 4KY3A 2HZCA 2XYGB 5J2QA 4B9VA 5HATA 1MSWD 3SQ0A 3N6LA 2KRRA 3MM9A 4HT7A 1VMBA 3L7UA 1K0VA 3GFHA 3TJ8A 4QU7A 3DXKB 2C3YA 3CJQA 2HHHJ 4MKBA 5F1XA 5C0YA 5GMEA 2QLBB 5HMYA 2D3OR 4UB8U 5LXRA 2D0OA 4EEYA 2NCKL 3VHQA 4LF8J 3DYAA 2EK1A 3I96A 3TOQA 2XS7A 3CD6S 3CJ0A 2HVHA 1T8EA 1R43A 1UWBA 1PVQA 4Q8EA 3ZYYX 1CC8A 3PUFA 2YX8A 1LWCB 4I2QB 3OFHA 2D3DA 3FE1A 1OY6A 4LMZA 1FFGB 3LDLA 1WF0A 3PJXA 4H03B 3FJ2A 1VI7A 1YT3A 1FE0A 2K4IA 2NRVA 2MSSA 2VU5A 5AKYA 4RT2A 2KB2A 4WF9L 3V6DA 2IM2A 2G8KA 2I5JB 2XNQA 3BN4A 5DB7A 2YV0X 5J2JA 4DR5J 2M5YA 2ATQA 3KDNA 4PUOB 2M4MA 5D6GA 1RKJA 1W0HA 2HB5A 3H8WA 2B5JA 3UVJB 3M6KA 4PG6A 4JN4A 4ANDA 3ENWA 2XMKA 4QIWC 2AQ4A 2VQEF 1RADB 2O8FA 3HHLA 3VEXA 1VQ7S 3HBTA 2V8HA 5IIOA 2YWHA 4G3IA 3BO4A 1AQ6A 1A5XA 2A1AA 4NLRA 2KHQA 4NZ0A 4H0VB 5HOOA 5AE3A 3NOGA 4Q0BB 5AKLA 1W7WA 2Y3YA 3ZZUA 3OFFA 3IP0A 4GVBB 4KH6A 4OX9K 3M1VB 3TTDA 2GMJA 1X4GA 3LOUA 1JXEA 4IH6A 3T9ZA 3WXLA 3QU9A 1BU6O 4M7XA 4JHDB 1LFWA 2DGXA 5CHGA 1U09A 1IBLJ 1I94K 4FLWA 1M5SA 4JB8B 2K7JA 1BIZA 4LH4A 3QYPA 4LZGA 3T5KA 2W1BA 2UUWA 4QZAA 3HT0A 3Q8VA 4NY8A 3LUYA 2RHQB 2HLTA 3M32B 3AA4A 2W42A 3E0FA 3ISND 4KR0B 5BPMA 5DQIA 4LBIA 2W2OP 4KKOB 4EP5A 2ETJA 3W5XA 4MKVA 2QI2A 3K0SA 3H8JA 1G1XA 4DG1B 2B6AA 3L3CA 5ALLA 2ZKUA 4JKDA 1XMQJ 2F76X 1NBWA 4ZKAA 2HHQA 2LSNA 2NLWA 2ZUDA 2JHEA 2YH0A 2ILZA 5EDWA 4K0KJ 3LVVA 2LDYA 1K73T 3K0JA 1GMUA 1PAUB 3LW5C 3R5CA 5AKHA 3HZGA 4Z6DA 5DB8A 4LFBF 5KOWA 2Q43A 3FK4A 1SC4B 3IDHA 2WAQF 5AK6A 4OZ0A 5FRNA 5T7BA 4CECA 2MJUA 1MMLA 5EE9A 3OY9A 3T1YK 3FUYA 1UEKA 4HDHA 1SL0A 2DNZA 2H5EA 5KFXA 4F5OA 3PEHA 1RDUA 2QWLA 5AZJB 1WNEA 3AVCA 3S3NA 2VJUA 4WFNQ 4DU8A 4B3MJ 3E9PA 4WZMA 3IGNA 3ZZTA 3CJTA 3F0NA 2LVWA 9ICQA 4M5LA 5ADXH 3GZ7A 3FCVA 3KVGA 1LKYA 3WX4A 2QRRA 5A8RA 3RUBL 4YQWA 2JEGA 3SJJA 1Z2LA 4NZ7A 1NJWA 2GVDB 4B3TJ 4XQ8A 3NAEA 4JMUA 3ZSQA 4M3YA 1HBMA 5ALNA 4WFBQ 1RI7A 2HZAA 2ZG6A 3LPEA 3RAMA 2AYMA 2ZDPA 5A8WB 2DGTA 4XK8C 3VV2B 4H4OA 5AKEA 4OKJA 5DDYA 2LXIA 1S22A 1FRIA 3PV8A 3CJKA 3MEEB 3SSQA 5AKJA 1UPMB 2LEBA 4DL5A 4OL8A 3N7PD 4RNOA 1JLBA 1B9FA 1CULB 1KXPA 2Q0ZX 4MJKA 5KNIA 4M6WA 3MFIA 4RQ6A 4ED2A 1D8LA 5HSPA 4J9PA 3NWRA 3G0ZA 4TVAB 2N3LA 1GLLO 3ZETA 4J7CA 4DV1K 3BF3A 3MUVP 4EX7A 1DLOB 5KFLA 4X62K 2EQYA 1OY8A 2L08A 4FLYA 1P8GA 2YNGB 1ATNA 1RHRB 4PJ0U 3AJ1A 4WFXA 3SQOP 1WC5A 4TLQA 5EE1A 2KNJA 4PCQA 4E7KA 4GW6A 1QQ5A 2HK3A 2V7YA 1TL4A 1UP1A 1YIJN 3OW2R 3AN1A 1JCGA 4DR1K 1ED1A 4WPAA 4ZOSA 2PSZA 2WF7A 4J9UE 4D3HA 3H7IA 4W4MA 2W9BA 4I69A 4DV2F 4CD3A 5AFUA 3DDNA 3M3ZA 1XEZA 1XO1A 2D1CA 1GXLA 2D41A 1GOAA 2ASDA 3GIRA 2HYIB 2QMWA 1IXRA 2FJ6A 2CIMA 3NAHA 4EBCA 3L09A 2PMZF 2Y0SC 2RDIA 2NXJA 3U9ZA 4XTTA 2YX1A 3C14A 1SJRA 1OW5A 2CJYB 4ED0A 3HZ6A 2MYFA 4K5SA 2HURA 4LSLB 5DG8A 2KFZA 2IYGA 4PEOA 3CCLS 2IYIA 1PIEA 2E1RA 2EK6A 1NH8A 4X4UA 1KRPA 4B17A 2BH1A 3MR6A 5BRFA 5KG2A 1KAZA 1VQSA 5DETA 1RCHA 1VBKA 3UN2A 1VR6A 3OS0A 4RLEA 3SR6A 1S1WB 2DY1A 1P8ZA 1HNXK 4N5SA 4JI8F 2RLTA 2E8MA 2BM1A 3CCES 3OSNA 4WYWA 2ZM6J 2AYGA 2J6UA 1SQFA 2J0SD 3ZDEA 3G25A 4LFBJ 4FF1A 2OJ3A 3PY8A 4TXSA 2NYVA 3KD3A 2BJ7A 5LMNK 3TWHA 4F2RA 4KGVB 3CCUS 4CERA 3B82A 2FJEB 1MA9B 3ZFVA 1N5WA 4J9OA 2XCAA 5AXLA 4LF7J 2IAJB 4I56A 3V5RA 4K4TA 2GGPB 5KPZA 2DVIA 4CHQA 3J80U 4MFBB 4E2FB 1RBSA 3IWLA 2QB1A 5KFWA 5HJXA 3HYFA 4B6JA 3OTOF 4WBFA 1WWUA 3SENA 2B7CB 3WXJA 1ZM2A 5A8KA 3EGZA 4JK9A 1VQOS 2RD5C 5SZTA 3ENQA 4JD2B 4ZP7A 2QEXN 3QGPA 4AH9A 3ETLA 4DR3F 1VQMN 3CSKA 4FF4A 2G09A 1Y5LB 3ISNC 2YNHA 3BBBA 3UQ2A 2O5DA 3AMZA 3PFOA 1RBRA 3T69A 4OV6A 1VQLS 1RKIA 4OKKA 1VFJA 2XI9A 4ECRA 1HBOA 2F7TA 2ACMA 1URRA 4C0ZA 1PBAA 2KK0A 1C0UB 3FRYA 3F2KA 1J5OA 5A8RB 1ZQSA 1LKYB 4ZPTR 1KQGB 5HAOA 3NNCA 4YDUC 5AZIB 3ZLJA 2VKZG 2MGZB 1F5CA 3CMES 4QZVB 3C95A 3R9LA 2ZIVA 2RUGA 1Q78A 2HZVA 1DQAA 4Z4EA 4JI3J 4M5DA 4AHUA 2ZGZA 1XMOF 4CF1A 2CPEA 3FBFA 8ICZA 4CTAA 4UZBA 5H9FJ 1N6QB 2CPYA 8ICGA 3I56N 4C9DA 4ICLB 2LDIA 2ZJRL 1KAYA 5K14B 2BPCA 2AX1A 5HMZA 3MM6A 3HJVA 4C8LA 3OUYA 1TUWA 4EGLA 1NAQA 2NXEA 5HROA 3NMAA 2Q66A 1D4XA 4UB2A 3HKWA 5IZHA 2FJDB 4CJVA 3QUBA 3O8MA 2XB2D 4NL5A 1N52B 4X64F 1GLDG 2FMQA 2A0FB 1HRHA 4P7TA 5KFBA 9ICMA 2V5HG 1WSRA 1ZQHA 3TR8A 4YUDA 5E33A 4FWRA 2QB0B 3MGHA 3PKYA 4A5AA 2W9CA 4F5PA 3OHBA 4KBOA 4OKEA 4GXKA 2MZSA 3SDEB 3A5NC 1HMVB 3VQAA 3E58A 4ZIWA 1FKOB 4A62A 3WKAA 3DC2A 1HYVA 1CG2A 2HGNA 3KWMA 1CSJA 4W5TA 4PRFA 4CGJA 1D1UA 2HQ3A 2VQFK 5GAEI 4E1MA 3QB0A 3R9KA 5JJBA 5AQYA 3PX0A 2EW9A 5HN0A 3R8YA 2GO9A 2A10A 2VJ5A 5KFUA 1S72N 2UUAK 2AYEA 3KG1A 2QWRA 4NWIA 2XHBA 1HYSA 1S0NA 4W92B 1NJXA 1S57A 6FD1A 4F4WA 5ALIA 3RVCA 2HVDA 4F50A 4KE5A 3H5UA 3SIPB 2E5LK 2A2CA 3FLCO 1T9XA 3DLLL 3ZTRA 2ASMA 3CCWA 3KHRA 2MQLA 4FF2A 1Y3KA 1ZM9A 3FZHA 3CJBA 2AQ0A 1U8SA 3MX2A 3PIPQ 2P66A 2BZ2A 2OA8A 1SV4A 4F3MA 1VSMA 3WQUA 4ZP8A 1B3TA 2H3FA 1WKKA 2FZKB 3UKRA 2MY7A 4IFVB 1K9MT 1QHAA 4B9NA 1TL7A 4JKCA 1BA1A 3MM5B 4RUCA 1VHXA 1X7VA 4BS2A 4RUBA 3U1NA 3MGVA 5KFTA 2BKEA 5E2QA 5GINA 1HNIB 3KTQA 5JLFA 5IFMA 2IHR1 4V19J 3BDPA 1EB0A 2BGGA 1U6BA 3V6DB 3HFZB 2IC3B 4EAHD 2VPXB 1X4EA 4WK3A 2W4DA 1HQEA 3ADAC 3FZFA 5FDLA 4M63A 2R7OA 2KG0A 4IWVA 4PKIA 2O8BA 1NNEA 1S1UA 3CO0P 5LXYA 2HLUA 5U47A 4FVUA 3PCOB 4Y34A 4KX3A 3AVAA 2FPLA 4MYTA 4PPXA 2GC8A 4R63A 1N36F 1EX8A 1FD2A