1ZOLA

Native beta-pgm
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1zolA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zolA01
3U26A 3RF6A 1JUDA 4QJBA 3B9BA 3SKYA 4BKMA 3SKXA 4CF3A 5IS2A 3M1YA 3QX7A 4L57A 3ED5A 5AI0A 1RQNA 3WKBA 5AW9A 3IJ5A 3QU9A 5ALOA 3QUBA 1ZRNA 3FM9A 5AICA 2HSZA 1SU4A 1TJ4A 4HYTA 3SLRA 2RARA 3N1UA 1O08A 2Q5EA 3IRUA 1RMQA 4HGPA 4C4TA 5AW6A 2G1AA 5AM1A 3W5DA 3CNHA 1RKQA 1RPZA 3F9RA 2WFAA 1Z88A 4XOUA 2CFSA 3A3YA 2IOFA 2QLTA 2JGAA 2JAUA 1LTQA 3OCWA 4F72A 3ZWKA 4BBJA 1QQ5A 3FPBA 4EZEA 5AVTA 1SWWA 3WKCA 1TJ3A 4BX3A 5AK5A 5AW8A 3QU5A 5AK3A 2RBKA 3L1VA 1FEZA 2G80A 5ALDA 3NIWA 3CZ4A 3R9KA 2RAVA 1L6RA 1L8LA 3E8MA 5AKZA 3WK9A 3AR7A 4OFZA 2B82A 2FUEA 2ZG6A 3L8FA 2AUTA 3QGMA 2G09A 3IB6A 5AW3A 1L7MA 3DDHA 2O9JA 4Y2XA 4BEVA 2B8JA 3MN1A 2C88A 2YMMA 1YJ5A 4J2TA 1U7PA 3QYPA 2EAUA 5ALQA 2FDRA 1U2TA 4EEKA 2CN1A 2BDUA 3ZI4A 3KZXA 2I6XA 4NV0A 4HGOA 3ZVLA 3A1DA 4Y2UA 3UM9A 3WGUA 1VJRA 2FPUA 3UMGA 1Z5UA 3OCUA 1KYTA 5ALTA 4BX0A 1RKUA 2OA0A 2O2XA 2I54A 1ZJJA 4AP9A 1ZD2P 3QXGA 2OBBA 2C8KA 5AK4A 3OPXA 4EX7A 4Y2VA 2YJ3A 4GIBA 4NAVA 3ONNA 4FYPA 4JDPA 3FZQA 4E88A 3ZTYA 5AW4A 3KOOA 1EK2A 2ZOSA 1YDFA 5AW2A 2OYCA 2FUCA 2P9JA 4I9GA 3QUTA 1TE2A 3QUCA 1TJ5A 3WK5A 1ZOLA 4FFDA 4DCCA 2YJ6A 3TLMA 2X4DA 3N07A 3ESRA 1Z5GA 2WF5A 4BX2A 3U13A 5AI8A 1WPGA 5FP0A 3SD7A 4H1WA 4EELA 5AKYA 3EPRA 4CF4A 1IWOA 3NUQA 2NYVA 3E58A 3ET5A 3QU7A 2OM6A 1PW5A 2WM8A 3L5KA 3A1EA 5ALPA 3DV9A 5AHXA 2GO7A 2NO4A 5ALKA 4NWIA 2WF8A 3K1ZA 3U7FB 1QQ7A 2B0CA 2EATA 2YMLA 3FVVA 5AKKA 2CFRA 4B6JA 3AR4A 3ZX5A 3L7YA 1WZCA 4Y2TA 3NANA 5AM3A 1RLTA 2MSNA 3PDWA 5AK6A 5AW5A 4AS3A 1Z4MA 2HHLA 4HAIA 3QLEA 4XPZA 1VJ5A 2R8XA 3W5BA 2WF7A 2BDEA 3EF0A 3NRJA 3OCZA 4EX6A 4ZEXA 2YMQA 1N8NA 5AKXA 2GHQA 5ALRA 3AR2A 3UMCA 4ZEWA 3I1YA 3MPOA 2G07A 3OCXA 4UU1A 1QQ6A 1Z4IA 1L8OA 2I55A 5AVWA 1Q92A 2HDOA 5ALUA 2CFTA 3PCTA 5AVVA 5AIBA 3N28A 3OTQA 1U7OA 2RB5A 1L7PA 4EENA 3I76A 3R4CA 4KN8A 5IT4A 4Y2RA 5ALNA 4YH1A 1QYIA 3U7GA 1F5SA 2HEGA 2JAOA 3BA6A 1CQZA 4ZEVA 2YBDA 2B8EA 4BNDA 5AIAA 1RMTA 1T9ZA 3R09A 4YIHA 4YCMA 2NO5A 2I7DA 4CF5A 2ODAA 2R8EA 2C8LA 1Z4LA 2FPSA 4DWOA 3KC2A 4YCLA 3EWIA 3L8GA 4G63A 4J03A 1WR8A 1RLMA 4UM7A 5AI5A 3L0CA 3BWVA 3L1UA 3U7EB 1Z4JA 3KD3A 4G9BA 2DQSA 3S6JA 3HYCA 2ZBEA 1EK1A 3FPSA 2FPXA 2GMWA 4RETA 2AMYA 5AKHA 4UASA 1J8DA 4HGRA 5A3RA 2YMPA 4FE3A 5AW0A 5ALXA 3FGOA 4AS2A 4L6CA 5AVQA 3OCYA 4I9FA 4UMVA 4JB3A 3ZTWA 2Q4RA 4YCNA 3ZUPA 3DAOA 1NNLA 1MH9A 4CNQA 3L0BA 5ALGA 3WK8A 1XVIA 5IT0A 2ZBGA 3KDPA 2HOQA 1WVIA 4KYTA 1YMQA 4KNWA 3SHQA 3AR6A 3QU4A 2B1QA 1QH9A 4MUMA 3UMBA 2WF6A 2YY6A 2PKEA 4MWOA 2IOHA 1J97A 3WKAA 2G0AA 5AI6A 4KX5A 5AW1A 2AH5A 2ZBDA 4Y3UA 4L6AA 1L7NA 1U02A 3HLTA 1XPJA 4UM5A 4C4SA 2YN4A 3PGLA 3N5KA 3RFUA 1U2SA 3AR5A 3P96A 2YFYA 3I28A 4RESA 1T5SA 5AVSA 4DW8A 2IYEA 3WGVA 1T5TA 3W5AA 3D6JA 3WK4A 2HO4A 2FEAA 1ZS9A 1Z4QA 3L0YA 3E84A 5AVZA 3ZX4A 1ZD5A 1YNSA 1RMYA 5ALIA 3QNMA 4QQFA 2JARA 3WKEA 4UMFA 5AKLA 1TA0A 1CR6A 1YV9A 2AGVA 1Z4KA 1Y8AA 2C4NA 4F71A 4XQ0A 2R8YA 3J7TA 3A1CA 5ALMA 2VKQA 1ZD4A 1N9KA 3SMVA 1ZRMA 2HX1A 2YJ5A 2W11A 1L7OA 3N8GA 3AR3A 3VAYA 1Z4NA 3B9RA 4Y2PA 1NRWA 3AR8A 1O03A 5ALSA 5AVUA 5ALVA 1Z4OA 2HI0A 4DFDA 1Z4PX 5ALHA 1RC8A 3WK7A 3MC1A 3EF1A 4IFTA 1NF2A 4KX3A 5A3SA 2P27A 4UAVA 3WK6A 2ZXEA 2G08A 3ESQA 5ALWA 2PQ0A 1RQLA 3NASA 3ZU6A 2GHTA 3W5CA 5AI9A 5AKIA 3L8EA 1X42A 5ALFA 4IG4A 5AM0A 2R8ZA 2WF9A 1RRCA 1VFPA 3GYGA 3QU2A 4GXTA 2JAWA 4UMEA 5AW7A 2WHEA 1ZD3A 5AVRA 4NABA 3B8EA 2ZBFA 1S2OA 3SF0A 4Y2YA 1RLOA 4UATA 4C4RA 4KNVA 4UW9A 4Y2JA 1RKVA 5E0OA 2QYHA 3L8HA 3NAMA 5AVXA 2W43A 5ALZA 2MU1A 2W4MA 2HF7A 5AKGA 1S8OA 4UMDA 4BNDB 2PR7A 5T41A 3WKDA 4CE6A 2I34A 4YGYA 1RDFA 1K1EA 1AQ6A 4NFLA 2B30A 2C9MA 2IOFK 4Y2SA 2FPRA 2FI1A 3ET4A 4YIKA 4XE5A 4BYGA 3I6BA 5ALYA 3E81A 3U19A 5AVYA 2FPWA 5AM4A 5AM5A 4UU0A 3KBBA 4OD0A 3ZVNA 3AR9A 2Q4TA 1YS9A 4PNHA 3DNPA 4O8CA 4OHFA 2YJ4A 5JJBA 3NALA 3M9LA 4HGQA 2I33A 2MU2A 5AI4A 5ALJA 2D2VA 2BY4A 3U7HB 2IA5A 3PGVA 3MMZA 2P11A 2HCFA 4Y2QA 5AKJA 2EARA 3OCVA 2P69A 3ZW7A 5AM2A 4OCZA 4HGNA 5AKEA 5ALEA 2HF2A 3ZVMA 1SWVA 4BEWA 2GFHA 3ZWDA 1Q91A 5AESA 2B1RA 4UARA 5ALLA 1XP5A 2G06A 5A3QA 4UAUA 1LVHA 3QUQA
chains in the Genus database with same CATH superfamily
1XSNA 3UG7A 4C0WA 3I0ZA 1CNMA 3OKCA 1XG5A 2AMLA 3SKXA 5ECGC 1T25A 5HJ5A 5L95A 3M1YA 3RB6A 1PJSA 4IV0A 3OF2A 3F5AA 2XLCA 2Z2JA 4HQLA 1LV5A 4KPUA 4L57A 1UOOA 4LC9A 3F2CA 4JCOA 1HWYA 5DN6A 3QU9A 3RVDA 1Q11A 16PKA 4DSZA 4WKGA 2OC9A 1G7TA 1TQHA 2FEXA 4L8VA 4QZDA 2JI8A 3BDPA 5J2UB 5EE1A 4X5VA 3LUAA 1N1DA 3DAFA 3P9SA 4OIMA 4UQGA 2FSVC 3Q9NA 3ENQA 4NSNA 3THWB 4C4TA 1IZ7A 1WTAA 2XE8A 4EHFA 1PYGA 1GPH1 1UQVA 2X19A 2G1AA 2C0CA 2ACWA 2JRZA 1P29A 1B8PA 4II3A 5C0OE 3KKAA 1W29A 3A0HU 4IHKA 4R2LA 4ACAA 5KDLA 3WG9A 1QV6A 3EPIA 2PWYA 2WBLC 2R6AA 3LDAA 3IVAA 3VX4A 7MDHA 1W93A 3AQEA 4O5AA 3HJFA 5K4LA 2BFBA 2GAOA 4QSMA 4YFKA 4UNSA 1UFVA 4YCJA 4N0PA 3LUBA 3S81A 3VO2A 4N8EA 3BWXA 5TMPA 3FHLA 4DHWA 1GKLA 4K2AA 4S1OA 1Z63A 4NBLA 2JNWA 3PE3A 5JRZA 3ADCA 1LPBB 5LB4A 5AK3A 2ESEA 1ZL0A 2HDNB 1XYYA 1GDHA 3G3EA 1AKUA 1HOTA 1F12A 1KDPA 4YUVA 4ZOEA 2BI8A 3IX7A 3VR3D 4F8YA 1FZTA 3DBIA 3IEPA 3N8NA 5IEBA 2ZANA 3DTVA 2GCOB 3NIWA 5G1PA 1G63A 4NBKA 4GXIA 2PNFA 4H1VA 4DIBA 4LTDA 2I2DA 2H2FA 1OPXA 1QB7A 3DE6X 1ZUNA 2A0FA 2XZPA 3A4TA 3R3ZA 4OQNA 4WA7A 1JJ7A 5TQ2B 3OLVA 5KC8A 3DVQX 2O2DA 1VBKA 1E6MA 3NJ4A 2J7PD 3TTTA 2JC3A 2G09A 1RYBA 3KKAC 4NDZA 2R6GA 3GJQA 1B2LA 1QFZA 1Z56C 3R3HA 4HNQA 4I4TA 4KQIA 3U3RA 2HTFA 1HG1A 3DOIA 3N6VA 4PTZA 4X95A 3ZE1B 4EVIA 3PSTA 1U2GC 2JFQA 2Y1JA 1OI7A 2ZU0C 1O9HA 4Q03A 5U1PA 1QX4A 1SOUA 4IHJF 3RU2A 1YK0A 3GEDA 4B34A 4ZJYA 3BAZA 4TMVA 5TEVA 2ZE5A 2HU2A 1WP4A 4LJ7A 4UUOA 2FVYA 1EINA 4K28A 2A1UA 2UVQA 4MVJH 4O63O 1UADA 4M8LA 5F52A 3C7CB 1GQFA 4TSFA 2I6XA 2QXTA 4C1NA 2DR0A 3UMSA 5DBOA 4Z4CA 1HZZA 1AMNA 5J23A 3MRXA 4P58A 4Q0MA 3DAHA 3NEAA 3PW0A 1HNNA 1ZQRA 3B1WA 5IUJC 5HUHA 3N0XA 4EMBA 3QPWA 1Z5UA 4C8OA 1DQSA 3SEQA 1ZQCA 1XO0A 4EKEA 4S05A 3MOIA 2OA0A 2IH4A 3EQ6A 2ZE8A 3W78A 5CD1A 4TXJA 2UYHA 9ICOA 2EBHX 3EOBI 1XC9A 3I72A 2DFNA 3L07A 4LNHA 1F6WA 3I5XA 4KHPB 3N4MB 1PEDA 1EX1A 1TMGE 2KVSA 3KZKA 4E70A 5C7YA 3E9RA 4FYPA 1ECLA 1JEDA 3QHQA 4W8OA 4O2AA 4B73A 2K87A 1SV4A 4UB8U 1K2WA 2GI4A 2C3YA 4H4DA 4GLLA 2TMDA 1S4MA 3H5RA 2MOKA 2XYPA 1EU1A 5FPPA 4D99A 5ILQA 2PLFA 4XPIA 1RXVA 4GOOD 3ZTYA 3R0IA 5K7SA 4IJ5A 5J4HA 4QUEA 4L8GA 4D41A 4QZVA 1DWQA 4U9HS 1C7YA 1I4DD 4QJ5A 4DMKA 2DBYA 1D4AA 3PQ2A 3CH4B 1JDBB 3D4BA 2I5HA 1H69A 4N12A 1DKNA 1DTSA 3MR5A 3QH4A 2GB4A 2V8OA 1Q44A 4R16A 3MCUA 1Z0ZA 4ZH4A 3AUFA 1G8HA 1JXAA 2VAMA 3IP1A 3UAOA 1MV8A 1RI5A 4QQRA 1SIBE 1A5TA 2NNWB 2C04A 2RG1A 2NADA 1L5LA 2HU7A 2QMUA 4Q4HA 1KHTA 2BCUA 1A7JA 1KFJB 4HLUC 4HEQA 1FTQA 4W8GA 3U13A 3I8OA 1RQGA 1P4AA 1MFZA 1VG0B 5AKYA 1S3GA 5EJ7A 2IEIA 2NYVA 1WD5A 3IP5A 3RS8A 2R1TB 4FHDA 4JY7A 2IV7A 3GAMA 2NYUA 5CA1B 2PLNA 1S2IA 3UJ9A 4MWEA 5FA5A 1PZMA 2ZSDA 4DLSA 1H93A 4FC7A 1NP6A 5KT4A 5GVSA 2WTXA 4H1UA 5F1KA 5CX1A 4F4ZA 3T3NA 4JA0A 4GKVA 4BMPB 4D56A 2FE9A 2J08A 5JSFA 1UFKA 4RT3A 2CLKB 2ISSD 4Q3BA 3EEOA 2X7JA 1YTLA 5A7FA 1KH1A 1R8YA 2CJFA 4U2FA 1DS6A 3H4VA 2BPFA 2YZ7A 1PJZA 4G2NA 4RYLA 2B1IA 2O06A 4IS2A 1E98A 3P0FA 5EHNA 2V54A 2J32A 2GA8A 1N7IA 4H2DA 4NFHA 1G20A 4L1KA 3LX8A 3M83A 4JDUA 5EHXA 4MVJE 5E1BA 4QDJA 3V9PA 2OFWA 1M5TA 4L7QA 4M7RA 3UTDA 1RYHA 2HA0A 4EY7A 2WJAA 4HDOB 4OAOA 3W5BA 2PKCA 3B2NA 2FW7A 3OMXA 4X85A 3VHLB 3WSTA 3ZX5A 1CR0A 2CNKA 2IZ7A 3L0DA 1P9LA 2D5LA 2VSNA 3OCZA 4I50A 5LDDC 1MQAA 3N2NA 1QTRA 1U99A 3HXTA 2GCOA 2W70A 3P9YA 4FP9A 1DTEA 4H0FA 2QRLA 4INAA 4IUDS 4J0IA 3SFTA 3TNDA 7ICEA 3GAZA 3PEVA 1JVNA 4ERXA 4E30A 4FBLA 4LF5B 5TMBA 3CX8A 4UBKA 1DV1A 2GBFA 2GZHA 3ID6C 2BGNA 4Y6SA 3O95A 3F6YA 4G6ZA 3S5JA 5IZCC 2H18A 2EW1A 3K8YA 2XUQA 3LZCA 4OP2A 3C1UA 4NNJA 1QB8A 4LTNA 4U5XA 5DDIP 2AJDA 1NXSA 5HOQA 1L8OA 3VOBA 2ZWAA 4I4TF 5DOZA 3D0RA 1UMBA 1J33A 1G9TA 4I6EA 5AJHA 2G82A 1X8LA 4I4TB 2KZZA 1O95A 2KHZA 4DSNA 1GZVA 1LUAA 3IDWA 3DNMA 4A26A 2R5FA 5JH7F 5JJIA 4R64A 3GYBA 1W52X 1YO6A 4Y2RA 4MUJA 2ZUEA 1SJ9A 2A9OA 2ERYA 4MQMA 5DBIA 7MHTA 2CHUA 1TZCA 3CO0S 3FWKA 4TMKA 2JAOA 3BFXA 1G7SA 3QVTA 1C7QA 4BNDA 4DOMA 3DUFB 4CIBA 1A04A 3W90A 4BV2A 2CSUA 3IQHX 1E2IA 3AQIA 1YQUA 4IYRA 4LZOA 3RH4A 5BYJA 5DX8A 1KJZA 4L5IA 3KTQA 1QG0A 1NY5A 1PD1A 2R8EA 3WWDA 3JQBA 1JDPA 3Q2KA 1P7VA 5K0EA 5J2DA 3PSAA 3S27A 1QOQB 3UPDA 1BDHA 4IMPA 4R81A 5IXJA 4GPTA 2W8BA 1OKKA 3T41A 3WB0A 3G6VA 2IYTA 2LKCA 3AIMA 2EQ5A 1W85A 4RHTA 3FSGA 2KPOA 3GCWA 5EXDA 5EZYB 1H38A 2YWBA 3F3KA 2H4JA 3QVXA 4RJKA 3RPEA 2VANA 1A5ZA 2I6TA 4M9NA 2ZUWA 4JGIA 4LVUA 4ZXFA 4D3YA 1F0MA 4M37A 5CB0A 3MR6A 3PUWA 4BB0A 1FLVA 2MDTA 3PWTA 1JJVA 4UHKA 5EHZA 1CZHA 5H4GA 4O2LA 1D7AA 4YJFA 4YASA 3MD0A 5BPFA 5E8JA 4OI0A 1PFGA 2AS0A 1J2RA 4R83A 2ECPA 2KB0A 3H4BA 4F3OA 1O2DA 2Y6UA 4LFBB 2Q3CA 2J0UB 5B6PA 3AP2A 3ND7A 4AULA 2FGKA 3HY4A 3QWHA 3HNOA 3OURA 1WCXA 2HWXA 5D7NA 3R8XA 1FFCA 2VNAA 4GT1A 3LF2A 4OHVA 3OP4A 2NUAB 3ACBA 1C7EA 2NZXA 1U5AA 5ALGA 5KC9A 4HK4A 3HFRA 3NYWA 2H1FA 1EFRA 1LVGA 1MBZA 1C9KA 2FPGB 2X9LA 2YC4C 4DFPA 4DL5A 3SFZA 1VTKA 3BRCA 4FLMA 1HLGA 4LSMA 2K8BB 3OQMA 4HZGA 2PBFA 1L4GA 2XCUA 4KX5A 3BXOA 1GDDA 2PGXA 4G5OA 4HXGA 4LHYA 4AZTA 2DTEA 1FRVA 4AO6A 4BLVA 2RCYA 1L7AA 4QATA 3RRXA 1LB2B 1EFCA 1GFWA 1LEHA 2I1WA 1USVA 3NG1A 4V38A 4AX4A 2NTJA 3KOWA 3RFUA 4EPYA 3AKDA 3HHEA 4G0OA 5KT2A 4RNOA 1VL1A 4N9QA 3LQQA 4MFCA 2C5HA 1EUZA 3F53A 3QTLA 4J9NA 3FMVA 4FI3F 4RFSA 5CGQB 4CMKA 1ZSVA 1ZVQA 3IHQB 4RZXA 1CLUA 1I1NA 1JQ3A 2W6OA 1KYVA 2OO7A 1QHFA 2F3TA 3LFHA 2ZROA 4QYSA 1W1WA 5KTRA 1I7QB 3GLGA 3K94A 1M2VB 2AX4A 2R8BA 5K3FB 3D1VA 4WLVA 4PYRA 2XCPA 1WDLA 4UDOA 1ETHA 4K86A 3G9UA 2IRWA 4G1MB 4XCXA 4BRSA 5BSHA 2J5QA 4RKYA 4ZO4A 3I2JA 1BZYA 1TA0A 3UENA 1CR6A 1Z0JA 3JQFA 5DLFA 3H86A 1PSWA 2OG1A 4IIHA 8ICRA 2ZJ8A 4WI1A 2YWXA 1VZ3A 1MO3A 5MDHA 2YY5A 4FT4A 4PYKA 4MIEA 1RI4A 5CXXA 4C0XA 1H1DA 4OB6A 2E4UA 5E9WA 4AIIA 5A02A 2QB0B 4ADSG 2DR3A 1MHPA 1AG9A 1BTOA 3HY6A 2YHIB 4LW8A 4UNIA 4DJAA 5BUZA 4D9GA 2QD4A 4C7OB 1PL0A 1NTOA 1QKIA 1W48A 2LCQA 5DWVA 5DNVA 2KVCA 3JQEA 3ZQ4A 1EVZA 2VJOA 4N4AA 3WA7A 1N3LA 4XVQA 4KQEA 4MR9B 2JA2A 3C4QA 2O8EB 5MN5A 3LPMA 9ICQA 4PR0A 4D3DA 3PEWA 4IFTA 4K03A 5TS2A 3AY0A 1JHZA 4J7UA 4QWMA 2FRVA 5AWFC 2R8IA 3WK6A 1ZLXA 1ZUWA 4XYBA 1D8AA 3WLPA 4CT5A 4URUR 3RROA 4DR7B 2V9WA 3T4EA 1A27A 3K4PA 2O0JA 2I0FA 5A6VA 2HV8A 1M2GA 4K4GA 1FSFA 4BWFB 4I66A 1O5TA 3NEPX 1NVMB 3NB0A 1YB2A 3U3OA 1YZVA 2Q62A 3KJNA 1TKCA 2PKRA 5DSZA 3UK2A 1WQ4A 4IG4A 3DJFA 1LLCA 1AX9A 1NX9A 2ILTA 3WMWA 4TYWA 2Z56A 2A78A 4TV8B 4YRRA 1IN1A 2EX4A 3O3NB 1E2GA 3ORFA 4BWJA 1OZFA 2XGPA 4XYEA 5CH3A 5IJ0B 2E18A 2YDYA 2X6QA 1GGKA 3GFVA 1W8IA 2FOIA 3E1SA 4FDLA 4TKVB 3V4ZA 4C0ZA 4X92A 3ESAA 4Z0HO 3QOWA 3CR3C 2WD8A 1Z38A 3MWJA 3WHKA 1EGHA 1FDVA 1U3DA 3CE9A 4JQYA 1F5NA 4PX2A 4TL7A 3SE7A 1W75A 3AX6A 3AM4A 3CC8A 3DXFA 1B93A 1NF8A 2Z5VA 3CIOA 3JQ7A 3K1TA 1VL8A 1Z1BA 3MS2A 3OH8A 1T43A 4AUKA 5JG7A 4PNEA 3TQ1A 2HF8A 2KD1A 4C7ZA 1DFGA 2A30A 1SHUX 3H1GA 4YNBA 2H1LA 4HUQA 4BO7A 1XTKA 1KN5A 4A8EA 2V55B 3Q0TA 4QREA 1RYSA 4S12A 2UU9B 4NENA 4JV2A 3EA4A 2AQIA 5KFVA 3SR6A 1XNJA 4G36A 5HDQA 3WB9A 4UW9A 2HYIC 3DDWA 1V16A 3FPGA 4RABA 4C7JA 4Y2JA 2I03A 4FNGA 2QYHA 3VSEA 4KE6A 3E2IA 1KP2A 5IYZB 4KPEC 4CGZA 1TO1E 3GH3A 4X94A 4C0AC 1CLEA 1KFCB 1S2DA 1ISPA 3MRVA 4TUQA 5F35A 1T4BA 3QELA 1GA4A 3HVJA 1KMHB 1G4UR 4EFMA 3G7NA 4IJWA 1W9MA 2HOIA 1V7QA 1N6LA 2VTDA 3I2FA 4GMXA 4POAA 5AUOB 1K1EA 1O97C 2X0NA 4F9TA 1BN7A 1GNTA 2ACEA 3E5HA 2ZXHA 2O7RA 4WJLA 2GPBA 4Z2YA 3VR3A 4BYGA 3DTVD 4LSWA 1HLFA 2AV6A 5ARDA 3EY9A 3WXMA 4R6XA 2E4AA 2XT6A 2HHQA 4URHA 3P9PA 4F12A 8GPBA 5I4KA 2Z98A 2ECOA 4RLHA 9ICSA 1SKRA 4OHPA 4ZQCB 1X6JA 1TYCA 4DO9A 4A7PA 4LOIA 1SL1A 3AYZB 3L0ZA 4P4SB 1TQDA 1ULUA 2MHCA 5KVCA 2HA7A 3ZLBA 1H0KA 5JJBA 1XMSA 3C29A 2PCLA 3F5MA 4HGQA 2I33A 1G8YA 2CCJA 1CPYA 3RSQA 5F5LA 1NBIA 1VKZA 3BTUA 1AD2A 5DYIA 4XSHA 4TUYB 1OH6A 4LC1A 5DH9A 1AV7A 3OQ1A 2P5YA 5A7HA 3KCQA 1NBAA 3LPAA 4AP5A 2VBGA 2I2XB 1EYZA 4X84A 1GR1A 4GMHA 4N40A 3HWTA 1BROA 4HNSA 2ES4A 2VWGA 1BWPA 3AINA 1P2BA 4KBFA 3R2JA 4JLJA 2QZJA 1LPPA 2P1ZA 2JA1A 3B6IA 3TTUA 3KALA 3E2MA 4D8WA 4DQKA 4Z7QB 2Q5HA 3BEDA 1V11B 3HI6A 4OYHA 5DW0A 4I28A 5JNUA 4CV2A 4B45A 3I37X 5C80A 5TDHA 3V1KA 3PNBA 621PA 4IDGA 3OJEA 5DYWA 4BKMA 1ZL2A 4J7XA 4IQTA 2BHRA 2OHOA 2F44A 1UBOS 4YDSA 5E3HA 1WCYA 1N0UA 5H9WA 3VJKA 1XV5A 4UXIA 5C35A 1JW9B 1M6HA 4F3CA 1PK8A 3AHGA 1QONA 3D7NA 3RBEA 5B2ZA 1QWSA 3VNQA 2DWUA 3Q8RB 4MV9A 3AHFA 2EWVA 4FJ1A 1AZLA 4N3CA 4A27A 4MRRA 1U3WA 5IVHA 5LC1A 4IHJA 2QXYA 3PSFA 3RFAA 1X40A 1QCKA 1CUUA 1Z00A 1KGSA 5H82A 3RJ5A 4BDPA 1MC8A 4IXTA 4X62B 3LQ2A 4NBVA 1YVEI 4YFYA 4PN7A 2PT7A 1XCJA 4OQPA 2JEJA 5JSUA 2EWMA 3MJTA 2PRZA 1E9RA 6Q21A 4LF4B 4ZCTA 3RCBA 2BFPA 3BWCA 1QHIA 4BQPA 3OJCA 3VR6H 3L93A 3ZUGA 4LKRA 5HXAA 1CU1A 5JYEA 2PT6A 4JJIA 1I94B 1TIBA 4YP0A 4G4JA 4OXKA 3EMVA 1CY7A 3LA8A 4H7HA 4C4PA 1O8BA 4I55A 1NY6A 3DMGA 1IIPA 4N3AA 3C5CA 3F5FA 5TEWA 1QFYA 1SRQA 1WO8A 1KNQA 2HBRA 3BFVA 3I2YX 5AJWA 3PO5A 3H11B 4AECA 1IV8A 1BCRA 4GQAA 5G4KB 5EJ6A 4ZCRA 3OSPA 2ZJBA 3PQCA 4LHEA 2WMDA 3GRKA 4P6VF 1PT7A 4PZDA 3IJEB 3WFZA 2FQYA 1JLSA 1AKVA 2NT4A 2ZWPA 4EYSA 1O97D 3A11A 2VYND 2WYWA 3MJEA 3U80A 5JEEA 3JWJA 1T2FA 2NZWA 2KEYA 1NZBA 1PFYA 1K75A 1SVSA 5U4QA 3TKYA 1EJ0A 5J0YA 3WOVA 2ZUFA 5I9NA 2Y71A 4JOQA 1KY4A 3E9QA 4F5YA 1AM4D 4QXOA 4XB2A 4TZ0A 3PJDA 1BXRA 1DBIA 1TMOA 3I64A 2C7GA 3QI7A 4DLWA 1Z3CA 4Q7LA 4O2BA 1OWLA 4MO9A 2EEZA 3SZOA 1SXDA 1C8BA 2JFUA 4GLFA 4YMTA 3V48A 1GVHA 1JHPA 2B2NA 3K5IA 3C3JA 3FI0A 4I4IA 4MS3B 4OK6A 3KKPA 4PX3A 3MXTA 1F51E 3ZD8A 2FR1A 5DASA 5ES3A 1PNOA 3NP9A 1BU8A 1CIVA 3OLYA 2F67A 1XI2A 4P7KA 5ALQA 3SEFA 3I9MA 5C37A 1MQ2A 4HUJA 2DPHA 4DT1B 1BCSB 2XGSA 4OATA 2QMEA 4CODB 4DWVA 3AEVA 5HYVA 1K6JA 1TO6A 1NT2A 2FZLA 3WSWA 3SEIA 4RJIA 1XWLA 5FT9A 1B43A 4M2YA 4RXUA 4ETWA 2FPUA 4PL2A 4JASB 5CH8A 4R2WA 3U4QB 1K5DA 1XEWX 2V1UA 1XTQA 2NVBA 2ASEA 2AI3A 4NAHA 4UBMA 4EJ2A 5GQSA 2J3MA 4B4VA 2F3RA 3MSXA 5REQB 1U3TA 2VP3A 2B69A 3IDOA 3NYIA 1FMLA 3ORYA 3CCBA 3ZU4A 4EX7A 4BV9A 5BNTA 5I8WA 2HO5A 2O0LA 2IF0A 4NAVA 3FDZA 3T7KA 1C7IA 1LB1B 4LE1A 2AZ4A 2KX7A 2GBLA 2DX7A 2OXEA 1FF9A 1LZLA 1O95D 4G85A 4JT4A 4J43A 1U3GA 4RLQA 3TXAA 1ZIXA 4WBSA 3LF1A 4Z2AA 3VJMA 5HPYB 1GITA 3B9QA 3UIEA 1I36A 5AOVA 4OBXA 2W2PA 4KP7A 1R74A 3NCHA 1EK2A 3DE1X 2JVIA 2ZT8A 4B3IA 2WQ7A 1L4UA 3NRCA 3V2IA 3PNMA 2HJ9A 3F7NA 4KI7A 1Z6GA 4K8OA 1AN0A 2ZQ5A 4H0CA 2GF2A 5ECWA 1ZCZA 2B98A 2EBUA 2V6JA 1UA0A 2JRCA 1X7DA 2BKXA 3QV1A 3RT1A 5M2QA 5CVVA 3SX4A 4K9OA 4AZ3B 4UQLA 4DQ0A 1EGQA 5H70A 1FDTA 5KNBA 4O4JA 2G5CA 4YRGA 4B0OA 2F76X 1T91A 2DY0A 2ZB8A 1FU7A 2G1JA 9ICWA 1P7ZA 1W34A 4RZ3A 1PAUA 1DJOA 1EM8A 3FCYA 5JTUA 3WRVA 5DTQA 1HRDA 1Y42X 1D7OA 1M6WA 2IY9A 2BGRA 1NJFA 1O3YA 5IX8A 5F1OA 3DOOA 1GGNA 1SD2A 2OTCA 3KXKA 2P2CA 5DTJA 4D0RA 2ACVA 2QT0A 3Q0IA 5C1DA 3KT0A 2WM8A 4C03A 2OCYC 2P0AA 3GMIA 1NR7A 4DA4A 1DKPA 2IH2A 2GO7A 2QUIA 4C8LA 2OV4A 1EVEA 3ZDCA 3LX5A 4QBIA 2D00A 2PA0A 1XDGA 3VVLA 3LVFO 1A5AB 4TLCA 5BV8A 3PGMA 5KFHA 1H94A 3HZZA 1J8QA 4KUEA 4TLBA 4GC9A 5EJMA 3X3HA 4EW6A 2HU5A 2NGRA 2PZAA 3OLWA 4CIDA 4D80A 3PL1A 2EKLA 1FSSA 1WB4A 2JFOA 1JQBA 4MGYR 4LNUA 4PEVA 1G9XA 3P9KA 5EXXA 1BOFA 5F3RA 4QWDA 2VLBA 5LMZA 5HQ3A 3DVRX 3K5PA 4S1NA 4LXIA 3MWEA 3GIKA 2JPDA 3AU6A 5ED0A 3PHHA 3SFVA 1C1XB 1KZ7B 4FR0A 2IXBA 5CNMA 4ZQHA 4XPZA 4US2R 1CUCA 1QH1B 4JNKA 4OQDA 3ADKA 1YBHA 1PCXA 4REQB 2NO9A 4BMYA 4F9EA 2I3DA 2D1QA 2HH9A 3H18A 4IXWA 1NK4A 1DG1G 1EFUA 4AP6A 3C41J 5IK2D 1JROA 2ZYHA 1M67A 5KU7A 1TK0A 3JZDA 3PFFA 3Q8PB 9ICPA 1E99A 1P7DA 1TEHA 2ATIA 2C42A 3M6WA 3L1HA 3OUTA 4ZOCA 3ZWPA 4MCAA 3GHYA 4MQFB 4EA9A 4KAFA 1E6LA 3VRHA 1KP9A 1R0ZA 4IM7A 3PGJA 4Q7EA 1YHYA 2PRIA 3CNLA 4BB9A 2OPBA 2PTGA 3UJPA 4H9GA 5EMMA 3IVXA 4DMRA 1PQ4A 1KO7A 2CUTA 3LC2O 1DDGA 1V8PA 2M6LA 3TM4A 4UU1A 2O1SA 3QQ5A 2AYZA 3DKPA 3FYSA 4YDQA 2ST1A 121PA 4ZDJA 1HUOA 1CWUA 3HKBA 2F90A 2XB9A 4BNNA 1JBEA 1ECPA 2BJHA 2DPLA 5JDIA 4NCBA 4UBJA 3MABA 2C96A 2JZCA 4DEXA 1RYNA 1OZAA 4BWVA 2UXDB 4B9VA 1LK0A 2VPTA 2YVKA 3MHPA 2M6KA 2VOJA 5C8YF 5AXCA 4GKJB 3D6UA 3MZ0A 2VI5A 3FTEA 1YOBA 3L1KA 2XQVA 3Q5DA 3UQZA 5KWSA 4J1TC 1AHIA 1ST2A 5JNVA 2VJKA 2ZI6A 2LHTA 5CP2A 1AUQA 2H0QA 3DL4A 3R09A 3WHIA 3VV2A 3CLUD 1N5OX 4RT2A 1I3LA 1VXRA 2B5OA 2QRUA 1RE0A 3BXZA 1HSOA 3E5NA 4QZHA 4KV9A 4CM6A 4LY6A 4FCTA 4LRXA 3AZOA 1FOEB 2LR0A 4DWOA 4AKGA 1X2BA 1M1ZA 4KVGA 2GXUA 3IUQA 1MO2A 4HDAA 3BJZA 4F46A 1CY1A 4WGGA 1ZQGA 1NBOA 2IHTA 2V7BA 1RYFA 1WR8A 3N97B 3KO8A 2YWDA 3ORHA 4TSRA 2AR0A 2LRHA 4OUKX 2WB2A 2CNDA 4LZGA 3ENZA 4FMCB 4IIBA 5L40A 9ICXA 3D2AA 2QRJA 4JP8A 5JC1A 2KW5A 3KD3A 1PWYE 4G9BA 2FSHA 5FWXA 3GV5B 1VKNA 3E0QA 2WB4A 3UF0A 1LPSA 4OK5A 1WXGA 1RXEA 3AUTA 3U4HA 2C0PA 1P4GA 2ZRJA 4MGZR 5J5CA 4B2PA 1RACA 1QS0B 1Z2EA 4YLGA 2ZI9A 3IULA 2RONA 4XIFA 4D4LA 5DLDA 4B43A 5HZMA 3LLUA 5HZHA 1XK7A 2RDMA 2W9CA 1TK8A 1FTYA 2QMYA 3KJZA 3PA6A 3ANMA 1CFJA 5HUQA 3JRXA 1CVLA 5CA7A 5DNUA 3B3JA 3OT4A 3D6MA 3ZDQA 4KGDA 3C98A 1NNLA 4OJLA 3H87A 4UM9D 4WRRA 3WLKX 1IJKA 1U98A 1W5AA 4EEYA 1CUVA 3A6GA 3M89A 4ECVA 3KHGA 2P41A 1ZM2A 3USCS 1VPVA 3H6HA 2LKDA 2FJ6A 4JBWA 1UWVA 3LBAA 3AF0A 3ZCSA 2VUSA 4ZI3A 2B1QA 4ZHQA 4ZODA 4HAZA 2JJ1D 2XGJA 5JANA 2BRUC 2IZZA 4JJFA 4MWOA 2YXPX 4FCWA 1O96A 5L45A 2CJWB 2C5FA 1Q21A 2GHRA 1LU9A 5AW1A 1PLKA 1NJZA 3HCDA 4K6OA 5IJAA 1DJQA 2D4AA 2ZREA 5FBRB 5H81A 4N76A 4G1UC 3KU4A 1L7NA 3C14C 1B76A 5HR5A 4HYKA 3GRUA 1AK2A 3I4CA 4M0FA 1ATIA 1G6OA 1VBFA 3NHZA 1Q6YA 4C4SA 1YCDA 5DNWA 4ZYWA 1JQLB 4MTCA 1II9A 2RMKA 1XLTC 3LX6A 4XWYA 2PX5A 5D51S 5I9MA 7ICOA 3EWSA 5T4BA 2IW1A 1ZJWA 3DZIA 2ECKA 4YT8A 2VTEA 5B53A 3CNQS 3QPCA 3MWYW 1T5TA 5C31A 3FDXA 3JV7A 3WISA 1BQ4A 2JJ2D 4RGVA 3WO1A 1C3OB 3EZLA 2Q1XA 4FMCF 4GI7A 1LXCA 2YUTA 3DG9A 3RC2A 5IJ9A 4PHCA 3A7DA 2HJVA 4EI2A 3FFXA 4P33A 1X6VA 5GTHU 1ZW6A 4B3CA 4GP7A 4AURA 1HNWB 1ZXIA 5C4IA 5GIOE 3JYQA 4D46A 4E7OA 1YTUA 3VVCA 3FKSA 4HPXB 5A7GA 4UULA 1BCRB 2GVNA 3DCNA 2HHUA 1CS4C 4P36A 1JF8A 2HPVA 4WIAA 4KPUB 4DZTA 5KQSA 2HB6A 4OREX 4DWWA 3CLUC 1NMYA 1H1LA 1LI7A 1VLBA 1E5DA 2JLQA 3HGQA 1X3LA 4L0CA 4JB0A 5I01A 3DLIA 3E82A 4U6QA 3KQTA 1NR1A 3EQ9A 1P4RA 3KXLA 3FGZA 3PDIB 1Z45A 1SKUA 4JK3A 4K6GA 4U7JA 1GQ2A 1CUHA 1KF0A 4BX8A 5B1YA 3JWEA 1VMKA 3AJDA 3F74A 1Z4PX 4CMEC 4RY0A 5KFGA 5K0TA 1GNQA 3MC1A 1LDNA 1SKYB 5KFWA 1NF2A 3RADC 2LIVA 5J0UA 3K20A 4LMAA 1X13A 5BMVB 2ZIUA 4XM1A 4FFPA 1KI8A 1V9SA 1MF7A 1Y8RB 3GZTB 5LZ9A 4XUSA 4A1OA 1J2UA 3OFSA 8ICNA 3JD1A 4E46A 2ZIVB 1HFEL 3M6IA 5FUWA 1I24A 1IAVA 2WEKA 3T1NA 4KQHA 3C3MA 4WDRA 2C2YA 2HIAA 3DKVA 5K6AA 2GRUA 2Y1KA 4F2DA 4RULA 1Z0FA 1YVRA 3GJ8A 4KH0A 1NK0A 1E4VA 1FUEA 2C3PA 4DY4A 2WT9A 4X61A 4MITA 3MGVA 1JHOA 4D2IA 3BKXA 4RQ8A 4PAOA 1KYIA 1SPXA 1WSWA 2Y4OA 3RKUA 4EYKA 3HTXA 4GXTA 1WEHA 1EQUA 2XUOA 3CLTD 3UGQA 4FSXA 3T7IA 1WRBA 1ZVJA 3CN9A 1QGUA 1Z13A 4LY9A 4RVFA 4PXSA 4D8UA 4PTLA 2GH1A 1GNPA 2F8MA 1FUYB 1PJCA 4KXQA 4XH9B 5C5JA 1ESMA 1EFVB 5IDYA 5E4JA 4KO1S 1T3QA 4G07A 1X9WA 1I2MA 4Q3LA 4AJIA 4LGVA 3KPVA 2OWEA 1PIWA 4QLAA 4HLDA 2XVMA 2ZBFA 3LY7A 4YD2A 1IIRA 1VHJA 4F4HA 4ONEA 2PZJA 4O2AF 3VDXA 1P0QA 5A4DA 2YZKA 3NVAA 4C4RA 2HRDA 4LJ8A 5M04A 4CIYA 2ADMA 1YS4A 4G5HA 2ESRA 1YCFA 2CLOB 4IAOA 4NHOA 4CM3A 3VPAA 1Q2XA 2C61A 4RH1A 2GN4A 2PUWA 2VCYA 1ODJA 3I12A 1QKJA 3CLKA 3MGHA 4M9RA 4DT1A 4UMDA 4IEEA 1SD1A 2DQNB 2QKYA 4WZAA 2GK4A 1NQOA 1R0LA 3WU2U 2R8KA 2Q0HA 3E8SA 4Y2SA 4KQFA 5NLLA 4YLYA 2FI1A 4ER7A 2C98A 4FWTA 4CMIA 2BCRA 1U1DA 1ZD9A 1DBPA 3NDPA 1MX9A 5JCJD 1SBQA 4M76B 3W8FA 2BE7A 1RHMA 2KHVA 1Y1KE 2CJYA 2O6HA 2FPWA 4NM1A 3MM4A 5D49A 1JYEA 2OBLA 1DXOA 3OPYA 4JLWA 3UC5A 4I1VA 4D4KA 2ZIEA 4D8XA 5LN1A 1JTVA 2QIOA 3USZA 2HJRA 2JKZA 1RYEA 3AM9A 3M6UA 1T1SA 3HYSA 3MWFA 1XPOA 1I6KA 1LWOA 3WNBA 4F9GA 1PS0A 1K5GA 4Z1OA 2VTBA 1L5SA 3IAS1 4MVJF 1PJTA 1DC3A 4FYHA 2D2VA 2EFDB 2GUWA 2D1RA 4PHGA 4UCXA 5I9LA 3PMNA 1E3DA 3BTVA 1NUQA 4GVPA 7ICQA 1R10A 1IN5A 5EA2A 3WJAA 1S2NA 2BEUA 3T3DA 2GEKA 1SOWA 2EARA 3GFBA 3JQFC 4IUYA 4JEIA 4LNAA 4MKGA 5IJZA 1PBTA 3MBYA 1UBFA 4LNUB 4CCYA 3OTIA 3JSXA 4KYIB 4L4UA 3RC1A 4ZEOA 5C8ZA 5I4IA 2HDWA 2H5IA 2RIPA 5ELLA 2H16A 4WFKA 4DDWA 4C08A 4KN7A 2JI4A 3K9WA 3ZWNA 4MEYA 2XY4A 1RNLA 1T3TA 1XP5A 1SXPA 4B4OA 3EOZA 2R7LA 2Q2NA 4OH7A 1C1XA 2D0DA 3QYJA 3HJUA 2BLLA 2OG2A 3FPSA 2Q9CA 2W6NA 3O90A 4KVZA 2X5OA 1PKEA 5D2CA 5T67A 2PZGA 3CRVA 3PC4A 1G0NA 2MR5A 3MUOA 4KLUA 1WF6A 2I4LA 3LTNC 4ASUD 4Q12A 1TAMA 2I6FA 1MIOA 1DPGA 3M34A 5JBQA 4U2GA 2ZYDA 4GXJA 1E63A 1H1LB 1RAIA 3PG5A 4A03A 2P8SA 3IJ5A 4RTRA 2ET6A 5ALOA 1JDZA 4G5QA 3X2FA 5JMTA 1KERA 4MP6A 3CR7A 4MPDA 4KMOB 1I7SB 1SA0A 2VBFA 1G59A 4KREA 1F2TA 2VOEA 2Z1MA 2W9BA 3CLTC 3JATB 3CVXA 1M0EA 1GEEA 1RHRA 1U8CB 1M9NA 4TWJA 4KN9S 3VH1A 4C7XA 1U8TA 3FRHA 3AUAA 3FHOA 4HGPA 1UMDB 3ROMA 1D6MA 3WLLA 4EY6A 3JPPA 1C0EA 1WUIS 2LE0A 3ETEA 4KQ9A 4NL4H 3U37A 1BEEA 3ZGYA 4IH1A 1A5SB 1KO5A 1V2GA 5E4YA 5TPZD 2Q46A 3ZDXB 3EXHB 3SHVA 1E58A 4DA0A 4QBKA 2WSSA 4UVHA 3CPHA 5EHQA 1Y8RA 1Z6YA 1GY8A 3WP1B 2DH6A 2DVMA 1LPAB 4XWOA 2YRWA 3ZWKA 1LRKA 3A25A 4KGVA 5C0YA 4AYWA 2DYKA 4QO8A 5JAUA 4LZPA 5KHOC 3KQWA 7ICGA 1TT5A 721PA 1YQEA 1NZJA 2RBKA 1BRMA 1VG8A 2FQ1A 2YJZA 4NLCA 4ERNA 4EVSA 2EZUA 3FYDA 8ICLA 4DJ5X 3E48A 1GTL1 3CEMA 4ZVOA 5DGXA 3FROA 4XR4A 3S2IA 3WNZA 3IUSA 4BNMA 5E7QA 4DCPA 2PJDA 1QTNA 3T6KA 1PEAA 3Q8LA 3C1ZA 2XMCA 3WGHA 1GU1A 3KJXA 3ITKA 3TLGA 1XDSA 5CPFA 3AG5A 4S1TA 1NXOA 3ZY5A 1LV7A 1W0KD 2Z2IA 3IIKA 4ESOA 1PRYA 2PT5A 3FPJA 4KUHA 1TB4A 4RSHA 3SZRA 2PXHA 4OJMX 5LUBA 1SXGA 2EZYA 2K8CB 1YR6A 3QUAA 1KEWA 4IS3A 1C0IA 5AW3A 2D2XA 1A95A 1YONA 2RI0A 2CL5A 4IDCA 3PFGA 1E6EA 1WCWA 2DKNA 2HLDA 2ONJA 1JJFA 1E1YA 3BZBA 4UEJA 4F2WA 2C88A 4HMQA 2KMDA 4QWWA 4RVGA 1BRTA 1YJ5A 3LXMA 2XB8A 4UHHA 2REXB 3R75A 4FFVA 3NV7A 4IVRA 4QGHA 1YRQA 3EE6A 2O2EA 1Z8FA 2V4QA 4EEKA 1KL7A 1X92A 3LY5A 3Q8WA 5SICE 2Y6VA 3VSAA 4EG3A 3KZXA 4TYNA 2VQFB 4GC7A 3G0IA 2H5EA 4G0NA 2GAFA 2JIQA 5JY1A 3VHXA 2RJNA 5KINB 2A9KA 3A6EA 5K3BA 4TZ6A 2KQUA 5KTTA 3OLZA 2X8WA 4XWAA 2PM8A 1DI0A 2PQMA 1Z47A 3AGPA 1M7GA 2DKFA 5JTTA 4B9SA 1U47A 2M32A 3PSHA 4FHEA 3H9BA 2ZU6A 3PUJA 4D0GA 5JECA 2UUAB 3MTDA 1K6MA 5J0WA 4OHXA 5JCOC 2FP4A 4OJKA 2LUOA 3TEMA 3TOVA 5C2JB 1DCFA 3AYXB 4IKPA 1LDBA 2ORIA 1K5OA 2ZJ3A 2I2WA 2ILVA 3CF4A 2FPOA 4BXOB 5EKTA 5IANA 1HKHA 4G89A 5EJFA 4BLRA 3STHA 2ATLA 3FMGA 2BFFB 4CDGA 1X7YA 4G41A 1Y34E 3JQPA 2QDKA 1X7XB 1KGDA 3O8NA 4JZYA 4NNOA 1MC1A 1FDWA 1P2GA 4X1YA 4CL2A 4OX9B 3ILXA 2I67A 4P2BA 4BFVA 3PDCA 4QULA 4UFPA 1ZJ5A 4JUDX 3C39A 3D2CA 4J9QA 2OHHA 5KYTA 3KOOA 4YT4A 4E7PA 3MJDA 1E1DA 4RNNA 1UPAA 2YYAA 2QSYA 3A28A 5EMNA 4KIGA 2WKPA 4ZQFA 1TA9A 2HK8A 1BW9B 4DV1B 2J0UA 3HT3A 1JXLA 2WG1A 3QUCA 1CYEA 4DSEA 3AM1A 3TLMA 3JVUA 3R76A 4GDMA 1W6UA 1JJBA 2Z83A 3HP6A 3OEED 2JG3A 2GEJA 3L7DA 3NW9A 1Z5GA 2J3LA 2WF5A 2CXXA 5FBQB 2NVWA 3T0FA 5KSYA 2O2GA 2OV2A 4WN9A 5TPWB 3NHLA 5JJKA 3N3AC 4P35A 3ZYCA 1S8FA 3PPYA 5AK0A 5BQOA 1KXJA 4CMBA 5A9SB 4M47A 3ROTA 5JZMA 5CIWA 2X2EA 1SXEA 4OFWA 1SA0B 1OZHA 2RKWA 3K6KA 1B8VA 5A1TA 4NZYA 1CYDA 3OJWA 1PZEA 2QLNA 1B26A 2IC5A 3OZIA 4IXDA 1YI8A 3IPXA 3OP1A 1I3OA 4RSGA 1VPLA 4YQWA 4RK5A 2OV8A 2ZT5A 1NYRA 2D7JA 3THWA 1E3LA 3CF4G 3HN7A 2V98A 3U1BA 2FZ5A 3B3GA 3Q3HA 4B6JA 1IDOA 3WB2A 4QZCA 2AHOA 2PGOA 2BKUA 1THGA 1EXVA 1JDJA 5EKSA 4HV4A 5BV1A 3FRIA 3NANA 3ZBUA 5AM3A 1DEKA 2EJCA 2WG0A 2EERA 3EPKA 2QX4A 3K0KA 1M10A 4O1MA 2OPHA 3PLAE 3I45A 5TRTA 2Q8NA 2H4ZA 5EZYF 1XB2A 2VCEA 1N48A 4TYQA 1XNRB 4KPFC 1T13A 3RYTC 1XQWA 1VJ5A 5DI9A 1KC3A 1F3LA 1PJBA 1SCJA 2I4NA 2YZGA 3DP9A 1ZQTA 1HRKA 4BJHB 4DC0A 1FP7A 3FWHA 1A4RA 3NRJA 4D98A 4EZ9A 2BEJA 3OZTA 4ECEA 2CHEA 1V9PA 2FPIB 2NZYA 4Q02A 5DBEX 1SVUA 3G9QA 3HU1A 3TRFA 1J0DA 3TQIA 3AB3A 4UQPA 5HS6A 2AMJA 1JN0A 2OZEA 5BPHA 3A6HA 2X9NA 4EZIA 2F64A 1N3IA 1DOZA 1XN4A 4MLPA 1N5IA 3ZPXA 1UR5A 4B74A 2GPYA 1W7AA 1KRWA 4C7OA 5GJVC 4ZEWA 2G07A 2XEDA 1YR2A 4GR9A 1QH0A 4C80A 4ZOLA 1AQJA 2A3RA 4ZO7A 5ILGA 2ZJ7A 3VO9A 2WHQA 3DT6A 3EGVA 2VHZA 3HDYA 3HKDA 2N47A 4FFLA 4PU0A 4MR9A 2DERA 2Z6QA 2QJFA 4HDSA 4MUEA 2VYQA 5P8WA 3AEQA 4Y6QA 5L8VA 4P08A 4ZAZA 4F6LA 1QIIA 1YMUA 1RC0A 4EP1A 3C24A 5KQLA 4WZZA 1F5SA 4JV5B 1IXYA 1V6SA 5C4GB 3G68A 1CKEA 1OBVA 1PQWA 4YCDA 4D96A 1NKSA 4YQFA 1T2CA 5LOVA 5LDHA 4XA8A 4D3ZA 3AFMA 3NRBA 2JK0A 1LJLA 5CNKA 1D04A 4PE5B 1NW4A 3SQMA 4KK4A 4QNNA 4TV8A 1RVV1 4LBWA 1K86A 2O8DA 4JL6A 4CF5A 2JGNA 5I8ZA 3S2GA 5IJ0A 2P5SA 2XMDA 4AB1A 3KC2A 1QR2A 1W36B 2ZI5A 4KQMA 1DHRA 2WMOB 2EHJA 4XDYA 4OHCA 3GT7A 2P2GA 1MAVA 4UM7A 2I3ZA 5K4AA 1QIMA 2ODPA 4NCNA 3RFTA 4AO7A 8ICXA 3ZHQA 1NLMA 4B9MA 3FMIA 1XAIA 4WNCA 1HNXB 3RIHA 1QYDA 1UM8A 3ANXA 1Q14A 5FHRA 2O8FB 4X1YB 2PSEA 1SEPA 3AEUA 4BTLA 3G0CA 2GKSA 3JAKA 2IWHA 2OVFA 4H6PA 3SBOA 2P3SA 2BUCA 5KTPA 2VJBA 1WB6A 3ESCA 2KKPA 3CEAA 3GOQA 4EABA 4RQUA 3O21A 4R1SA 5L7YA 1UBMS 1CULC 4R8UA 4OLBA 1Q1BA 2W2LA 2B3TA 1JT9A 2JS7A 3LLSA 1Z68A 1Z73A 3CG4A 3QFRA 4INJA 3EXIA 1XQYA 4M46A 4OXXA 1KZGB 2NG1A 4RH3A 5AJYA 3CRNA 4B31A 4N5DA 5KMGB 4DWIA 1EZ1A 4GG1A 4BOYA 3SX2A 2N46A 3U3JA 4CNQA 4MTLA 1RSZA 4DIOA 3R5HA 3VSBA 4Q34A 5BW5A 1SUSA 4LJYA 3TAPA 1B0ZA 1F8YA 1PUXA 1R4AA 1WHSA 4UUAA 4ZRMA 1WNTA 5DN9A 2K2WA 2QN7A 4MR7A 1MVOA 3N2KA 5CLJA 1BXZA 1L7BA 1MOZA 3E9NA 4CZ2A 2W2LD 2C7PA 1OFUA 1SHLA 4RJ2A 2I7TA 2E8PA 1Q2UA 5AI6A 2JIRA 4YR2A 4FDAA 4JBYA 2C2RA 3E7DA 3A4NA 2VP2A 2ZBDA 1NXVA 3FZEA 5C1PA 2YNMA 3SZLA 4MRMB 4PPXA 4M9QA 2HWUA 1VJTA 2WZQA 3HB0A 3KKLA 1ZC4A 4DC1A 3FB4A 2KBFA 3F6SA 2YFYA 1I3CA 1OZ0A 4FS3A 1I5EA 2GK7A 4PRYA 3RJHA 3W8DA 1PQYA 4C88A 3BK2A 3WMEA 5F5XA 1YUNA 3T7CA 4O3SA 1F06A 1XU7A 1HI9A 3TZCA 3NHMA 1IB0A 2XY7A 2XVZA 4A2WA 4B3GA 1CRLA 4OXRA 3U44A 3T7SA 1EVJA 4PFKA 1OGYA 4J3NA 5LNK6 1OXMA 3I01M 3QKSA 3KE9A 4EJMA 4YS6A 2ZS9A 4W5RA 2Q28A 3DMPA 1SUEA 3WZLA 5T57A 2R86A 2G5IB 4TOIA 3WL6A 1YFJA 3PQ3A 4ZI5A 4UZEA 1PEKE 3SR4A 4LMBA 1W30A 2AGVA 3SBDA 1PR1A 2QY6A 3A6FA 2YWRA 1YGPA 2CMDA 2I4MA 4YR9A 1RPJA 1OI2A 2XCIA 2ZB3A 3L7IA 1NIPA 1M8JA 4J0DA 1B15A 4O4LA 1T3NA 1C7ZA 4YAGA 3WWEA 7ICIA 1F38A 1NUAA 3A4YA 5CPBA 2O1EA 4F4FA 3LY9A 3S29A 5IBQA 4ZT5A 4CF7A 3S68A 5DNEA 3THYB 2G4VA 1CQIB 1AKNA 3AR8A 4IFIA 2IHYA 2WY2D 4F7WA 4XDZA 5JCZA 4JZKA 5DOVA 4YRIA 5JD4A 4RKFA 4HO1X 2NMVA 4WKBA 5H3CA 2BTOA 3AFGA 3LWMA 4DSUA 3ZNNA 4QDKA 3LYLA 3STWA 3I6MA 1LW6E 2C31A 2ORED 2I1QA 1JXQA 2AJ8A 3H1BA 4IBOA 1GPUA 4YP1A 1SH7A 3TRKA 1RWPA 1X1TA 4R7GA 3RBXA 3NASA 4Y6LA 2C2WA 3V7YA 2I91A 2YINC 5K0ZA 4OYLA 3VCBA 4OJYA 3OU6A 4LMPA 5JSKA 5GTDA 5A4IS 3VHXB 4OH1A 1FP4A 3T06B 3E3AA 1CUIA 2CHVA 3SYKA 3PSIA 2FOLA 4CCAA 1X1AA 4Q1FA 2NVOA 2F8TA 4XGIA 5FQNA 1U2DC 4S2UA 2KLHA 4JBHA 2ZPTX 2H48A 1G5IA 4XDGA 4LF6B 1YBMA 4M9CA 3CNNA 3IEUA 1ZQYA 4H4EA 3GC6A 4O2RA 3UEOA 4P1ZA 5CLGA 2EZTA 2VA3A 4R40A 3TSYA 2BQUA 1W5SA 3MGCA 2B1GA 1ZD3A 2FVXA 4C30A 1A4XA 2ZIFA 3SAJA 2O2IA 1KFBB 2H1WA 3FWYA 1MOPA 1V8BA 1L7XA 3CHYA 3LLCA 1JB9A 4NMHA 5EZYA 5FTJA 3VAAA 2O8CA 2J5RA 3HXKA 3MRSA 4B44A 5C8VA 3RVPA 3GVHA 1C0LA 4LRUA 4RIIA 4YLEA 4EB0A 4Q7JB 1TKBA 4ZKEA 3DWEX 2R84A 3F9IA 5JD5A 1R5BA 4WZBA 2JLVA 1HDIA 3DMTA 1E7SA 5EWLA 4OV6B 3ZXYA 1E89A 4EYQA 5LFAA 2ZCJA 5KNBH 2EGGA 1ZG3A 2GT1A 3AIIA 1HYQA 3TX2A 1VE6A 1REQB 4RKEA 2PSSA 2PK3A 5DWDA 2ZXFA 1R8JA 5ALZA 3KZ1E 5IBCA 5JVDF 1GNRA 4K0KB 1LFDB 3SJZA 4P34A 4EGCB 2BEWB 1VLMA 1Y1PA 1NU6A 3WKDA 3KXIA 3EPHA 3PXDA 5AOCA 5IZ4A 1P1KA 1WSAA 2JFVA 3M6AA 4FS2A 3HPOA 2GHIA 2IP2A 1DU4A 1NQXA 3ET4A 4G26A 4LRQA 4TQGA 2JHPA 1MP0A 4C4YA 1EDEA 1ZD1A 2HBKA 3UQ2A 2G71A 3PUHA 3PVXA 4YCSA 2J09A 3UK6A 3BBPA 3S40A 5KSWB 3OOEA 4W5QA 4OD0A 1ND6A 5A04A 4CDRA 4OMUA 4B7AA 1LV8A 5ELMA 3JQ9A 3BWYA 3DCYA 2PXCA 3H1PA 4LEIA 2PL3A 4MW1A 6NULA 4G4SO 3WL5A 1N2CB 1MA0A 4OQQA 3PXXA 3QSGA 1M74A 1G21B 2PHZA 3QFFA 5K8IA 5AI4A 2JD0A 3A6ZA 4HZUB 7ADHA 2IA5A 3HYRA 4OJTA 4BJ3A 2ATXA 3GD7A 1QFJA 3QOXA 1KIMA 1XZAA 3F2VA 4CQLB 1FFEA 2LV8A 4TRMA 4WLUA 1EXWA 2VPZA 2DOKA 1MDFA 4KSCA 3QVJA 3ZWBA 1NT4A 3QOFA 3RYHB 4GZMA 4L51A 5J29A 5KVQA 2A5JA 1MB3A 1W47A 3VO8A 3WAKA 4QLBA 3O4GA 1V4NA 1NFRA 4OHKA 2A0YA 1T36B 4MXDA 3UVEA 3OA0A 4UARA 4F4CA 5ALLA 5EJ8A 4IGIA 2YWEA 4CIVA 4PN3A 2G06A 3LWDA 1G5QA 3PUIA 4AZWA 4LVSA 1IHPA 4TLDA 3BSWA 2QR3A 3LBIA 3HM9A 3RKRA 3U3DA 4TTTS 1GT6A 2ZTUA 4HSGA 4QGFA 3RF6A 5HHHA 1AURA 4C2BA 2PD3A 1VL6A 1YDGA 5DLGA 1EFLA 1THZA 3BXFA 4FYXA 3EBPA 3EG9A 2FPIA 1UJ2A 3GUCA 1P91A 5DT9A 2WW8A 4HXFB 2X22A 3IDFA 2BBOA 1ZBDA 4BVBA 2QB0A 2Q3MA 1R9NA 3FWNA 5J2CA 2DBZA 3JQ6A 4E14A 2DPIA 2HSZA 1GKKA 2VPIA 4URYR 4AM8A 1QQTA 4RUCA 3HNPA 2HA6A 1L4HA 1RMQA 1UKVY 2E85A 5FUMA 1WHTB 3D5TA 3IKJA 1TCAA 5L9XA 4BVAA 4FGZA 1V5IA 3C4VA 1EK0A 4DUPA 1N6RA 1NBWB 1Y0BA 2IELA 2ZQZA 3B82A 3ZEAA 1RPZA 2ODWA 2ZIXB 3KVYA 2O20A 3OFJA 1SBYA 2FMIA 1PS8A 2B99A 3P27A 2JAUA 3HZHA 3CRXA 4NZPA 3GPDG 4PGHA 4WUVA 4YRSA 5ICMA 4AC9A 3JU3A 1SFRA 3EEBA 1J23A 3RF9A 4MF8A 5J1TB 1GU0A 4P3XA 2AX3A 4QTUB 1RRGA 4E0BA 3GA5A 4FYWA 1IZZA 3E2EA 1SXJA 3K15A 3M33A 3QYFA 5HBGA 2C84A 3AF6A 3C87A 4P54A 9ICBA 3V8MA 5JD3A 1FEZA 2G80A 4PBRA 4HWPA 4LSZA 4ETNA 2WZCA 3FPLA 4LVNA 1XFAA 4G86A 5BQPA 2FWJA 1LKYA 4YPOA 3JPOA 2WSYB 1M6NA 421PA 4X7PA 3K75D 2E8NA 1FBTA 4FK8A 4R66A 1N7JA 1PVDA 4V02A 3KHRA 2A0XA 1UDAA 1ZPDA 1JKXA 2ORVA 2X5NA 2WK1A 3L5OA 1XSEA 2A0WA 4RENA 4HXYA 1ESZA 1L4KA 1QGED 2EIHA 3V4VB 1G19A 2F6RA 3QGMA 5F51A 4MR8A 3HU2A 3BQ0A 4HUQB 4DDTA 4ROSA 3SYNA 1XF9A 1Q17A 3B1ZA 5H9VA 5CJ7A 5BWNA 2WZBA 3V6JA 1NDHA 2Y1GA 3KRTA 1TK2A 3SYRA 8ICTA 4UUNA 4ZVQA 5EQFA 2B8JA 2WNSA 3OIWA 1RM4A 1T3ZA 1HURA 2H54A 4QYWA 1IQUA 4XCVA 3WLNA 4F3RA 2PNJA 3UAWA 1EWYA 1GGVA 3HUFA 3E3MA 3EZ7A 3ZD7A 4EUEA 5MN4A 3L7JA 3ZI4A 2V65A 2J41A 4FQ7A 4L27A 4V2UA 3MA0A 3PRYA 3B9PA 2HLNA 1QV7A 4YTEA 5G4LA 1N2XA 2PLRA 5KBYA 5J8YC 1T2EA 3KL4A 4YQYA 1N61A 3VPBA 1A2OA 2DU8A 1MRZA 4Q45A 2W2OA 3SC2A 2LM4A 5MHTA 1U3CA 2XXBA 4L76A 5A5EA 1V97A 2DG2A 1J22A 2C59A 3L06A 4RF2A 4HEJA 4C4ZA 4WK6A 4EG8A 3P26A 3DM5A 4Y9UA 5HRCA 5I7HA 5K2OA 5J0OA 4JBLA 4R2JA 2W6PA 4W4TA 1RP7A 5SV2A 4MSUA 2KOBA 4B6RA 5JADA 3DZJA 4HDRB 3PIDA 1VGQA 4P3KA 3O4JA 2JJYA 2OCGA 1I6WA 3I30X 2WWWA 3DBHA 4W99A 4A0SA 1ECCA 3NOVA 3RYCA 4S0ZA 5EIAA 4X54A 2L19A 1BMDA 4GIBA 3ESZA 1N25A 3HB1A 3PE4A 5DTIA 4IMIB 4UOQA 1Q1QA 3QBDA 3TAXA 3AT1A 1PK3A 1IDN1 2H63A 1Z7BA 3WXBA 3DD1A 3LWZA 1TM5E 5KAFU 2XVAA 4G9EA 5HZGA 3EA0A 3Q2OA 4JJAA 4QHSA 2PU7A 4DR5B 4S0XA 4YAOA 3NH6A 5KO2A 4LGYA 2C1ZA 1UEIA 1YDFA 1KE1A 1EAYA 4F50A 3B7GA 1JYFA 1U9ZA 3PBKA 4MP3A 5H80A 1H5QA 1ONBA 1FVFA 5F23A 4PLFA 1FFWA 2MYUA 3AK4A 3GP5A 4E5KA 3D3WB 2KI5A 2YV1A 3O84A 1Y6JA 2FH5B 5D3ZA 3WLAA 3W3ZB 2XZTA 3P45A 3RO7A 4UOZA 1LDGA 3GBPA 4PBSA 1ZQBA 4WERA 4QGBA 1X1RA 5DBCA 2ZWMA 4M83A 4RPZA 2BLNA 4KSYA 5HCNA 1YFLA 4R2KA 1B3RA 1S2LA 1JSXA 2JGLA 2DBQA 2Z2YA 4I1YA 4K6MA 4N1AA 3SJUA 4BNIA 1N7HA 3JPQA 1GPYA 3QRWA 2ZR9A 4I46A 3S70A 4OJ5A 3HUUA 2F3UA 1ENPA 3E9EA 4X6YA 3RUEA 2B4RO 4C1BA 2OM6A 1NI5A 1Z2OX 1R0SA 2GLTA 2O8VA 1P5HA 5H3HA 1ZA2A 4Y2GA 4J0JA 5ITSA 2NXWA 1SK9A 3F7MA 3RUFA 3D7LA 3L8YA 5D3QA 3TNFA 1QP0A 1YL6A 2W71A 4IINA 1R8SA 1JBQA 3HXLA 3F47A 1MAHA 5CLHA 2WKWA 4NWIA 1ZKDA 2OE2A 3RH5A 2WJWA 4PTYA 1TD1A 3AHCA 3L7CA 5HIAA 4B48A 3DV0B 1XCMA 3FVVA 3CIFA 4M0LA 1RWWA 2PRJA 5DIFA 3GILA 3AR4A 1H2XA 1WSDA 2B25A 2ZTCA 1PSDA 1VCIA 4L15A 1K8RA 4IXNA 2IVFA 3GRCA 1FBNA 2NSDA 2B61A 1RLTA 2Y76A 4ZVSA 3EPLA 4JD5A 5ERGB 2WWVD 1H8HD 3LQ4A 1D0SA 3AUOA 1IYZA 2FQXA 3F90A 3OJOA 1NN5A 1NXTA 4HRAA 3GNQA 4IYJA 4H27A 4LWZA 1KKUA 1XTIA 4Q5IA 1EWTA 5HHIA 2LBOA 2OEPA 5IIOA 3EUFA 2WAYA 2RHLA 3NT2A 1K63A 2ENUA 3UHOA 1TF2A 3UAZA 2CXNA 1OF1A 5LU9A 1GAJA 2FFHA 2P5UA 4HYYA 2ZXIA 2R4TA 1KFDA 1LK5A 3EAGA 3PK0A 4J94A 5LBTA 1BMQA 2BFCA 4ED7A 3EPPA 2ID7A 4XARA 5CNIA 5KG4A 3I2GA 4JLMA 5ANRB 5JQGF 2PGNA 1QVWA 1XCPA 1PGQA 4S04A 1PR6A 4LDRA 3FOCA 4QLOA 4C20A 1SQ0A 2MYPA 3HO6A 3ZZMA 3CF0A 3BEOA 3CH7A 3LNCA 3SJBA 3JPNA 1YB5A 3CRMA 5EP1A 4KWTA 2RHGB 3MMSA 1WWUA 1YZNA 3ZY3A 3AR2A 5KFKA 1O6FA 1EP2B 1KZ6A 3AEZA 4EO9A 4EOGA 1P2SA 3EB9A 3RE1A 2V6GA 3JQ7B 4PLZA 2WWRA 3OI7A 4QXRA 3TX6A 3EGCA 4L8YA 4LDQA 4MJ7A 4N01A 2Q4EA 3FCCA 1CRXA 2QHXA 3C8UA 3E7FA 4PV7A 2NZ8A 3CB4A 1VE1A 821PA 3VZPA 4DPLA 3TRIA 1JMSA 2HC9A 2VXBA 1BXGA 2HWKA 9ATCA 1MAAA 1VP3A 2YCBA 4YO7A 4EIWA 1YQDA 2W42A 1HF3A 3G17A 5KFCA 1Z6XA 4BFLA 4KLEA 3I9V1 3N5CA 4D3FA 1QYIA 4DV7B 1WQ1R 2PYIA 4F97A 2HMSA 4PPGA 2JZBA 1YZYA 2PSHA 1DT3A 3QPUA 4MLCA 3W7BA 1HK7A 3BTOA 3QEOA 3I5UA 5E2AA 4KR9A 2QF7A 4TN5A 2EX0A 2IYFA 1NBEA 1XEFA 3RJJA 1HYHA 5DB9A 1Q6ZA 4FFBB 3RODA 4BJ6A 5CTAA 4DL3A 2X3UA 2C2EA 2R68A 4BMXA 2OP1A 3CXUA 4HD8A 3AJEA 3UAXA 3FX2A 2JFFA 3CX7A 4KFUA 1RZRA 1RJGA 4FILA 3OIVA 1JQEA 2VZ8A 3PL5A 1L3CA 2X0IA 4J9MA 3L1IA 2EH9A 3EWIA 5HCIA 2AK3A 4E08A 1B2RA 4J16A 5BWLA 2JB9A 3CGGA 3GAFA 4C76A 3WYNA 1ZM3A 5THXA 1RLMA 5A0LA 1FTSA 1NAHA 1ZJ6A 1QLNA 3WGQA 4QOSA 3NMUF 1XBTA 5K0JA 2CV1A 2I65A 2W2KA 2Q4BA 3C4JA 3N05A 2R96A 3GG9A 3S6JA 1M54A 1N2CA 2V6FA 3M6FA 5JZVA 3HHPA 4MVYA 3DR5A 5KFBA 1X7HA 3N0RA 2A7XA 4KV7A 5G2OA 2H7YA 4MW0A 1OUQA 1UHUA 1XS9D 3FZNA 1FQJA 1P2FA 2BONA 2R6HA 3IT3A 2IZ6A 3MOGA 4D6PA 5KVSA 3LC1O 2D4HA 5TIIA 2H31A 1JVBA 1PE0A 1JLRA 1V45E 3RAFC 5IF3A 2NRVA 3NRWA 1MPTA 3ENVA 1ADBA 4H1HA 5LYJF 2G4LA 1VHLA 3GPIA 1YSCA 1A9YA 1OFGA 3OCYA 3N2EA 5EXSA 3B8HA 3QE0A 1V7CA 2EC5A 4CTMA 1HEIA 4O3OA 3ABQB 2EHDA 5FLEX 4YCNA 3THXA 4BFCA 4LXHA 2VSFA 4R84A 3V72A 5CVJA 4N0QA 4CKCA 2QZPA 1P19A 3D2QA 3IAUA 1FSGA 2I6GA 1Z5OA 2JGFA 2WIGA 2W7PA 3WSVA 3NHUA 1T26A 5JS8A 3BIOA 4MQEB 2P6UA 3HWX1 4Q9KA 4C01A 1SQ5A 3N2GB 3EXFA 2Q0ZX 1W35A 2DAPA 2RFLA 4UAWA 1IVYA 2BM9A 3TDMA 4C4AA 2MJLA 4BGDA 4OO1J 1EGAA 3KR0A 1XO1A 1X7YB 4ENTA 2H2WA 4YUYA 4NOLA 1G66A 2H4YA 2P91A 4U8HA 1BA2A 1CT9A 1I2BA 1U3VA 2W8LA 1Q8KA 4KLIA 3DTYA 4WDQA 2HMWA 2IBMA 1XDWA 4D4MA 5IJWA 4KPYA 3K71B 1RR6A 4GUAA 3V97A 2FN4A 2WLSA 4QNLA 4I8XA 4DL9A 5IM4F 5KG1A 3DOUA 1GZ3A 2HIMA 3FFTA 2VJDA 5EY5B 5LNK1 1V6AA 3IQFA 2E5SA 3V4OA 1Z00B 5KL1B 1Z35A 4JI4B 4MICA 1XP8A 5CA1F 3AJ9A 1PNRA 4CKXA 4GFJA 1C8LA 2IYEA 4MMXB 2IGTA 3SVZA 3WK4A 3ER6A 3ASYA 3GELA 4EUKA 4BY9E 3ZGZA 3G1TA 3OA2A 3ZE2B 1Z4QA 1E3SA 4MWDA 3A8TA 1WV1A 2J07A 2NVUB 3CM0A 3MRTA 4Y98A 2XY5A 1ACMA 5LZ8A 3L02A 2CXYA 2MIIA 3HRIA 2JAPA 4XASA 4EJSC 3PNKA 1E6UA 4DSKA 4PSVA 2D59A 5AKLA 5TPWA 3QHAA 4WFJA 2BFCB 4QPZA 3S7TA 3GIIA 4X7RA 1JI7A 3LK9A 2Q0QA 3DW3X 2QU7A 1KLNA 3IH5A 4RUKA 1W581 4G65A 1SIUA 3MDCA 1TQ6A 3AF3A 1PQPA 1RAGA 4GM0A 4I7EA 1ULTA 1L8QA 2F1KA 3NBYC 4RVDA 1R5NA 4R2XA 3LHIA 4F5ZA 5F78A 3T79A 3LP8A 4IOKA 1L1RA 5LQRA 2ZUBA 3D43A 4URVR 3R7AA 4BKUA 1KOLA 4Z4GA 4NH4A 1V8ZA 5CNJA 5D1NA 1IBKB 3O4RA 1BFDA 2WSSD 1D09A 2VP6A 3RS2A 1ZD4A 1RIFA 3TL2A 4C04A 2W9BB 4D6XA 5FKJA 3HK2A 4OF4A 4P0PB 1L7OA 2O3UA 3VJLA 2VR1A 2I3GA 1TD9A 3GJZA 2XY6A 5B36A 2W7OA 2HI0A 1CY6A 1M1YA 2DHRA 2GEUA 4UB4A 1S10A 1IK6A 1Z6TA 2ZI4A 3OTWA 2J6UA 4V0SA 4YQEA 3WNDA 3FY4A 2YWHA 4DG8A 5KOJB 1U49A 2MT9A 3FYCA 3IPYA 4L4ZA 1N2BA 5DP1A 5EIFA 4N5LA 1HDOA 2J3QA 1CXZA 3RU9A 4EKNB 4G23A 4MZXA 4PCVA 3Q11A 3JTMA 1JDBC 4DQLA 2CXUA 1TVKB 2NXEA 2IA6A 2XMGA 4YACA 4CEHB 4H7EA 3L18A 3L8EA 1UAYA 1N5RA 3JQRA 3PENA 5A0TA 4EGSA 5K0NA 3DBRA 3R20A 1TT5B 1UKZA 4P80A 3AV0B 4W5OA 3TLXA 2PH5A 2V3CC 3QVVA 2LNDA 1Y7TA 2YHUA 3AXTA 5L3RA 4ANFA 5EKUA 4FR2A 4L5BA 3BRQA 1RYYA 4MVJD 4M6WB 3GUHA 4YMGA 5GV8A 2WMNB 4DPKA 4D9EA 3G2HA 1NFQA 4KLJA 3WRYC 2Z9BA 2XD4A 1BD3A 3HSYA 3O2NA 3W6PA 3UN1A 2A94A 2HQRA 5GONA 4G97A 2I9PA 1OLUA 4D4HA 4EEZA 4W5TA 4UTVA 3OTOB 3LO5A 4R3WA 1ESNA 2ZUUA 5FAKA 1IRXA 5T4HA 3TFOA 1F20A 4D81A 4Y2YA 3C2KA 3ZDYB 2B9EA 2I62A 1TTTA 5AQ1A 3BJEA 3THVA 3GDGA 4H0NA 2Z95A 4HAXA 4JR0A 4BUCA 1VB3A 1ZKMA 3ILHA 5AVXA 3M4XA 1GL7A 3L3BA 5IH3A 4AJ1A 4MYTA 5ARBA 4EY5A 2IHUA 3BQMB 4IZ6A 3TDNA 3D4LA 4Q1EA 1JL3A 3HN6A 3NWPA 3WGMA 1KFEB 3VOAA 3BD6A 2Q29A 1E2EA 3EVEA 3UFXB 1V41E 5HQTA 2G9ZA 5FPHA 4FCCA 2WJZB 4E09A 3EPJA 2C20A 1HDZA 3DVAB 3K8ZA 4II2A 5FWAA 1A9SA 3QV2A 1NXWA 5IARA 1P7YA 3PITA 4Q7MB 3UH0A 5MGBA 4PZLA 4TLLB 3T5BA 4KR6A 2C3OA 1L7VC 2FP4B 2FFAA 1BFUA 1MQ8B 2G1UA 4JLKA 2XUKA 4XTRA 1ZM4A 3EARA 1LY1A 3T5GA 3VSCA 3IHTA 1Z2CA 5A6SA 3QM1A 4EI7A 2Q4TA 1EUYA 2VHVA 3KHHA 2FMTA 2QTFA 5TX7A 1U7ZA 1TAUA 4JI6B 5IF9A 3RAXA 2YIMA 3NM4A 3O5AA 4Q01A 1OLXB 2IYPA 2QA5A 4JGGA 5GJCA 2CT8A 1IM2A 4C2AA 3M9LA 4F4KA 2X3FA 3CUUA 3HKZC 2AZDA 1ADCA 3HWWA 4RV5A 4B3RB 4AMVA 4B5KA 3RJTA 2HCFA 1WWVA 4Y2QA 2YXLA 3OZFA 4MJXA 4BNTA 3ZNPA 2JFHA 4JP5A 4BFTA 3D7KA 2WYOA 4TL9A 5AM2A 5ALEA 1MB0A 1R7RA 5KVVA 3NVMB 3E22B 3I4FA 2WFMA 3LBHA 3ZWDA 4ESVA 4OHRA 2P40A 3JY6A 3OIFA 4G2TA 1XAGA 4LOAA 3HABA 1GADO 1U4SA 5HKKA 5AJZA 4D42A 1SHTX 2O2CA 1CRWG 2QG9A 2J3JA 3NZEA 3QUQA 1PK9A 1AN9A 1NVWQ 1GQSA 2PD4A 2OGZA 4QD3A 1J0XO 2H1SA 1NW9B 1AUPA 5BSUA 1DO8A 1UANA 3KSUA 3NKFA 4MUNA 3TQQA 1D2AA 3P2EA 3STTA 1K0UA 2YJNA 3A4IA 4WK0B 1R15A 3TPFA 1W46A 3VI3B 4R0VA 3ED5A 4RD6A 1XN1A 4TT3D 2H1OA 4EW2A 4MV5A 1EVIA 2NU7B 4LYAA 4E5MA 5J2TA 1UC9A 2QVBA 4HAYA 2QGNA 1NE7A 2R6DA 3ETGA 3LA6A 1P72A 4Q4JA 3BBLA 4YROA 1C7JA 1CEXA 4BBZA 3E1KA 3TSZA 3PDIA 4FGWA 4A6DA 4FHFA 5JNLA 4BX9A 2FPPB 2M2IA 2NTNA 1AQYA 4KXXA 5JE8A 1TPYA 3LKZA 1E9VA 1B6TA 4MVWA 1ZIPA 2IIPA 3KB1A 4JFAA 3COYA 3D8BA 1QVRA 3FA2A 1RKQA 1EM6A 4TT3A 1PSZA 5CFMA 3HA3A 3LCVB 1UC4B 3TLJA 3W79A 4XI9A 3TZBA 1TTQB 3Q7TA 5BMVA 3NGLA 1EP9A 3BFJA 4MHSA 2XUAA 4COKA 1P7WA 4IIJA 2JGAA 1S7GA 4RVOA 2FW6A 3BHNA 2DPGA 2OBYA 2OLEA 3OM8A 1VSVA 1BVUA 3ZG6A 2QT9A 4DCJA 3WKCA 3EGXA 2WWTA 4GW3A 3U31A 3TLCA 1KKLA 4OQXA 3PPXA 5AW8A 3RBDA 2FZWA 1N5KA 4RBNA 4MYRA 2V4RA 1P17A 3KTDA 4HP8A 4KLRA 2Y0EA 4CR6A 4NLBA 1J24A 4JUIA 5HF6A 3UB4A 4F85A 3AERA 4PYLA 3LHDA 1LGYA 3CZ4A 3MGAA 3UWDA 1O94D 4EAAA 1EBUA 1PJ2A 1U0TA 2ZS7A 4GOLD 5T64A 4LFCB 1L7EA 2YHIA 3NTOA 3WLJA 3S0JA 3GP8A 1KJ8A 2PG3A 4EKIA 4JJ6A 4B85A 2VSYA 4PVCA 4D4IA 2FUEA 2OLKA 3LCUA 4JHLA 3R5KA 4XQ8A 4CM9D 3VU3A 4RLFA 2Q4DA 2A1AA 2OOSA 4R0NA 4AKIA 1BX1A 4LY3A 4OQZA 4TVKA 5KJCA 4RM3A 2YHAA 5G53C 3PMLA 4TMFA 3ON5A 2CCGA 2JFBA 4UFOA 5HJEA 3FUUA 4JOCA 2GPSA 1QE0A 3ETNA 3INYA 2JXJA 2PEZA 4Z5XA 2VQ3A 1GN9A 4JX9A 2JCYA 3ZHCA 3OF5A 4CUKA 1GRQA 5FNVF 2NSJA 4PGYA 4DIDA 4K3VA 1CC1S 1C5KA 2O0KA 2PSFA 3BAFA 2HU8A 3UJCA 1YZKA 3KSBC 1FX0B 4LJSA 2J7KA 4Q7QA 3PC2A 2EWWA 3A31A 4XRHA 4K5QA 1K92A 1JU4A 2G9RA 4F8RA 1E8DA 1PK1B 2QD5A 3CVJA 3QEMA 1V0JA 4GVLA 2XXJA 2E8OA 4HY3A 4JXJA 5TVKA 4PO9A 3TK1A 3TD2A 3F96A 4YK7A 1UXOA 4BWYA 1IJEA 1R2QA 2VDQB 5AR1A 3QLVC 2R0QC 1SIWA 4JL5A 2HPAA 3IJPA 1H2WA 2H17A 4PBTA 4YXWD 3ISTA 3G02A 4E1AA 1S76D 4KMRA 3OJ0A 4IFBA 1ITZA 3OPXA 4MWTA 4TXLA 4Z4QA 1CY8A 1D3AA 4QWBA 4QT4A 2D1YA 3GLIB 5KHAA 1N0IA 1V71A 3C3YA 1ZEJA 1USUA 4G5RA 5LLSA 4ALIA 3DC7A 4M1OA 4TTVA 4ABTA 5I47A 4RQ0A 5EWLB 3F49S 3ELDA 3QLTA 1H85A 3H83A 2PGIA 1U5BA 3PNCA 2AFHA 3FIUA 3GPBA 3K09A 2OV3A 3NBXX 3PEUA 4PM4A 1JEYB 2FF7A 3QEKA 1LSUA 1A9TA 3EFOB 3S2ZA 1EA7A 1ECGA 4I1RA 3W2IA 5AW2A 3MYRA 3N7PD 4DB2A 2I2CA 4OOFA 2DGZA 5U9CA 4D82A 2EG5A 2H3ZA 2I6QA 2GN0A 3U49A 2QJWA 3RSCA 2VA2A 3OHAA 2KIVA 5L1MA 1HQDA 1JQJC 1ULBA 3FOAA 3OD1A 1Y4AE 2FFJA 4NARA 2C2MA 1BJKA 4G56A 4BDSA 4DCCA 3ALRA 1LSJA 4JI1B 5KT3A 2Z1DA 3Q40A 2JIZA 3QJYA 4D0LB 3ZCPA 2DF4B 2QSJA 1Q3KA 2CW5A 2IX9A 4Z49A 3P0JA 4BNWA 2QQFA 3GLIA 8LDHA 1XDZA 5B12A 1Y89A 4LE2A 1JAYA 4MEAA 4ARCA 5FPKA 4A9AA 4C6TB 3FD8A 1DWPA 1NVVQ 3KEMA 5FXMA 4MK4A 3KFUF 1CEQA 4WNAB 3VVBA 3N7SC 4IQWA 1BVYF 4P4SA 1TYBE 2O5RA 3A1EA 4MCIA 2IXGA 4ENPA 2UVPA 3DZGA 3QX8A 3RS4A 3SVTA 3PSPA 2GZDA 3D5QA 3I42A 1L5VA 1JDNA 1E0DA 4K8RB 1JQAA 3KFXA 3VR2D 4WK2B 1QQ7A 3ZHBA 3F4LA 3PNSA 1K89A 2YMLA 4S2EA 3W77A 4CQLA 1BE6A 1DXSA 1JDUA 1WSBA 2BKAA 3IUBA 4MRPA 1OT3A 1QFMA 1RM3A 5J0TA 1VKOA 2BFWA 5JU6A 4QOGA 3VHRA 2F43B 1NOJA 2DSNA 2H3FA 2B4YA 1HPLA 2GM3A 2OR3A 4QYIA 3ZJ4A 4KLTA 4BFZA 4YAJA 3BOSA 1SC1A 5AK6A 4CLOB 3NBMA 1MMFB 5E2IA 2AW5A 3OE7D 3WLIA 1JNYA 1SCUB 1P1FA 5J5AA 2JL1A 3LQ1A 3KXDA 2BPOA 5EERA 5J0XA 1EHIA 1GZUA 5EE3A 2HHWA 1M1NA 1O5IA 1WMDA 2IYZA 1XMVA 2UVDA 3BA1A 8ICKA 4TL8A 1G9SA 3A1FA 3I6QA 4IJMA 4QWCA 2YV3A 1TLLA 3RD5A 1OIVA 2FWMX 3CH5A 4LJAA 2E4XA 4QE3A 4K0RA 4MQ6A 4U9UA 1Y3AA 4Y1RB 4YMWA 2OQVA 2PAFA 1IPEA 4M49A 2BCVA 2GCNA 2QS9A 3GNTA 5IZCA 3GFOA 1XVTA 3AL2A 1GTSA 1SXJC 5CFOA 1EQ2A 3ACCA 4W7IA 4EBBA 5K6TA 4AW9A 2QNRA 4RPIA 3EC7A 1URPA 4FE4A 2CMGA 1ECBA 1EAMA 2GHQA 2OCDA 7YASA 3B85A 2Q3BA 1WEKA 3GLFB 2PV7A 3F6CA 2RK4A 2I2BA 3FW1A 3RU3A 3OEHD 1XU9A 3TKAA 4JBXA 3O1IC 4E11A 2P77A 4ER0A 1CUKA 2EDAA 3T61A 3RBAA 1SG9A 3SNHA 3THYA 2PH1A 4MA4A 5J2KA 1OV4A 1G2IA 2NRWA 2ASJA 2KTQA 1ZQFA 3I9NA 4WZ6A 1N62A 1TTHA 3KR2A 1TFRA 4PZNA 1IXRC 1WB5A 3Q85A 4BUJA 3RYFA 2XMZA 1B16A 2ZYAA 4ARZB 1LF5A 4GMKA 4HQKA