1ZOLA

Native beta-pgm
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1zolA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zolA01
5AM1A 4PNHA 4DCCA 5AHXA 3HLTA 4Y2QA 5AVVA 5AW9A 2FEAA 5AW6A 2YY6A 3NAMA 2G80A 5AI9A 5AW1A 1Z4LA 3GYGA 3S6JA 4BX2A 5ALFA 1Z4MA 4XQ0A 3IJ5A 2FPSA 2ZOSA 4EX7A 1J8DA 1U7PA 2FUCA 3W5DA 3AR7A 5ALHA 2DQSA 5AI5A 2R8ZA 3OCUA 1TJ4A 4Y3UA 2I55A 5A3RA 3ZX5A 3E8MA 3KZXA 3QNMA 5ALPA 3FM9A 3ET5A 1RDFA 2IA5A 2HDOA 5AVTA 2JARA 5AKXA 2Q5EA 1Z5UA 3B9BA 2C8LA 4YCLA 2G06A 3AR6A 4DWOA 1ZRMA 4KYTA 3A1EA 2ZBGA 2ODAA 1U02A 4C4TA 3EPRA 2GHQA 3U7FB 1O03A 5FP0A 3QUBA 2P9JA 3QUQA 5AVRA 5AI6A 3SF0A 3ZWDA 1Z4IA 4UM5A 4XE5A 4CF4A 1NRWA 3WK8A 3NANA 2AGVA 3N1UA 1EK2A 3U7HB 5ALIA 3AR8A 3NASA 2CFTA 3L8GA 1QQ6A 3RFUA 1Z4QA 3ZVNA 1ZD5A 3M1YA 4OHFA 4YH1A 2RB5A 5AI0A 2YJ4A 3FPBA 4AS3A 2HSZA 4NABA 4KX5A 1Z5GA 4F72A 1S2OA 3MN1A 2I54A 4QQFA 2EAUA 3FVVA 4NWIA 4UMEA 2R8YA 3W5AA 3A1CA 2CN1A 4BNDB 5AVQA 3MMZA 4HGRA 4UASA 3CZ4A 2YMLA 1N9KA 4YIHA 2W43A 2YJ6A 2AMYA 1VJRA 3WK6A 4E88A 2C4NA 3PDWA 3NIWA 3QLEA 3OPXA 3IRUA 4HGQA 1RLTA 3AR5A 3SMVA 4Y2RA 1Z4JA 1YNSA 3ESRA 2IOFA 2WF6A 4AS2A 1RMTA 5AW2A 2X4DA 4B6JA 3NRJA 1U2TA 4Y2YA 3QU4A 1AQ6A 1XP5A 3EWIA 3QU5A 5AKLA 1YDFA 2FPUA 4Y2UA 4HGNA 3CNHA 2WHEA 3ET4A 3QGMA 2WM8A 1RMQA 3FGOA 3L0BA 1CR6A 2P27A 3DAOA 3KC2A 4ZEWA 3U26A 4L6CA 5ALDA 2PQ0A 2GO7A 1PW5A 2G08A 3DV9A 3QU9A 3R09A 3OCXA 3P96A 1NF2A 4C4RA 3WGUA 2YBDA 3EF1A 3UM9A 3PGLA 4UAUA 5AM3A 2FUEA 2HEGA 1ZS9A 2PKEA 3QUTA 1T5SA 1RLOA 3ZW7A 4XOUA 2G09A 4BX0A 5AW0A 4BNDA 3ESQA 4J03A 5ALVA 1KYTA 3WK9A 2Q4TA 1WVIA 3ZX4A 3I76A 1YJ5A 3ZVLA 5ALNA 3WKAA 3E84A 1NNLA 2I34A 5AKJA 4BKMA 1Z4PX 4EENA 3RF6A 2RAVA 2FPRA 5AKYA 2FI1A 2MSNA 2GHTA 4HAIA 4QJBA 4KN8A 2G0AA 1TA0A 2HOQA 2ZBDA 4H1WA 5ALTA 4KNWA 2W11A 4Y2PA 2FPXA 3E81A 5ALLA 5A3SA 1ZRNA 2WF8A 3NUQA 4CE6A 5AKIA 3B8EA 1ZOLA 3NALA 4AP9A 5ALSA 4JDPA 5AKKA 1RLMA 5AVYA 3QUCA 3AR3A 3MC1A 3QYPA 4Y2XA 3SLRA 4OCZA 4UM7A 3ZWKA 5ALRA 5ALXA 5AKHA 2OA0A 1QYIA 1YS9A 5ALYA 5IS2A 2R8XA 2HF7A 3L8HA 4JB3A 1SWWA 1L7PA 3A3YA 5AESA 5AW4A 4I9FA 2PR7A 1U7OA 4L57A 4OD0A 3N5KA 4YCNA 1LVHA 2OM6A 5AM4A 2WF5A 3QU7A 1RMYA 1LTQA 2C8KA 2R8EA 3WGVA 4UMFA 2O9JA 1N8NA 5AK3A 1TJ5A 2YMPA 2B8JA 4BEVA 5AVUA 3ZI4A 3L8EA 2B82A 3L1VA 2BDEA 4Y2VA 3ZVMA 2B1QA 3QX7A 4YIKA 2NO4A 3TLMA 2MU1A 4FYPA 2QLTA 1L8LA 3AR4A 3OCVA 3SKYA 5AVWA 2C88A 3WKBA 2I6XA 5AKEA 4CF3A 2RARA 2B8EA 4RETA 1J97A 3B9RA 3OTQA 4Y2JA 2RBKA 5A3QA 1Z4KA 1U2SA 4UU1A 2YFYA 5AW8A 1ZD4A 2HCFA 3WK7A 5JJBA 2WF9A 3WK4A 3WKEA 2HI0A 2CFRA 3IB6A 4MUMA 4KNVA 4CF5A 5ALEA 4UATA 3QXGA 2WFAA 4ZEXA 2IOFK 2WF7A 1WZCA 4OFZA 3UMBA 4G63A 2ZG6A 3L8FA 1L6RA 1L8OA 1L7NA 1YV9A 4NV0A 3SKXA 5AW7A 5AW3A 2GMWA 1QQ5A 1RKUA 1RQNA 3K1ZA 4HYTA 2B1RA 1Z4NA 2JGAA 3AR9A 4EX6A 3OCYA 3N07A 1Q92A 4GXTA 2C9MA 3SHQA 5AK4A 2YN4A 1EK1A 2ZBEA 2OBBA 3ZUPA 1T5TA 1XPJA 4DW8A 4FE3A 5AKGA 1YMQA 2G1AA 3EF0A 1TE2A 4MWOA 3M9LA 1VFPA 3ONNA 4O8CA 3W5BA 1RRCA 1L7MA 3F9RA 3OCWA 3I28A 5ALZA 3BWVA 3BA6A 5AW5A 2I33A 2GFHA 4HGOA 2JAOA 2QYHA 1WR8A 3WKDA 3DNPA 2JAUA 4Y2SA 5AK5A 2NO5A 3ED5A 3UMCA 4C4SA 3VAYA 1O08A 2W4MA 2P69A 4HGPA 3OCZA 5AVSA 1S8OA 5ALKA 5AI4A 5AVZA 3W5CA 3ZU6A 5IT0A 3KD3A 2OYCA 5AM5A 3KOOA 2BDUA 2P11A 2EARA 4F71A 3A1DA 2O2XA 1RKVA 2FPWA 1VJ5A 1JUDA 2YMQA 4UARA 4GIBA 3WK5A 4L6AA 3AR2A 4EEKA 2HF2A 4CNQA 4UAVA 3DDHA 4BYGA 1K1EA 1CQZA 1RPZA 1L7OA 1Q91A 1T9ZA 3L1UA 3D6JA 1IWOA 3KDPA 2YJ5A 3U7GA 4BEWA 2HX1A 2D2VA 2CFSA 2VKQA 5AKZA 5AIAA 5AM0A 3L5KA 1RC8A 4YGYA 3L0YA 2YJ3A 5T41A 1Y8AA 3N8GA 2BY4A 2ZXEA 3L0CA 4G9BA 3E58A 2HHLA 2NYVA 4IG4A 1X42A 5ALJA 4J2TA 4UU0A 3U19A 5E0OA 1RKQA 3ZTWA 4EZEA 2MU2A 2B0CA 3SD7A 4FFDA 3KBBA 3U7EB 5ALOA 2IOHA 4NFLA 2I7DA 5ALGA 3UMGA 1Z88A 4DFDA 4UMDA 1QQ7A 4EELA 1ZJJA 4UW9A 1TJ3A 4BBJA 3FPSA 4YCMA 5ALMA 4UMVA 5AK6A 3QU2A 4KX3A 1XVIA 4XPZA 5AIBA 3WKCA 5AI8A 4IFTA 2Q4RA 5ALUA 3J7TA 5IT4A 3L7YA 3R4CA 2HO4A 2AH5A 2JAWA 3I6BA 5AM2A 2EATA 2FDRA 1F5SA 1Z4OA 2YMMA 4ZEVA 3FZQA 1WPGA 2AUTA 5AICA 3PCTA 2IYEA 3ZTYA 5AVXA 1ZD2P 4I9GA 1QH9A 5ALWA 2G07A 3HYCA 3PGVA 3N28A 1FEZA 3U13A 3R9KA 2B30A 1SWVA 2ZBFA 1MH9A 3MPOA 4BX3A 4Y2TA 1RQLA 4NAVA 4RESA 3I1YA 1SU4A 5ALQA 1ZD3A
chains in the Genus database with same CATH superfamily
2W2MA 4F4JA 2Q6LA 5AHXA 1WTAA 1X15A 5H80A 3M6ZA 4C3UA 2GRJA 3SYMA 5JQGB 5BSUA 5A2QA 2B61A 2NO9A 3IDZA 2LYBA 3ND5A 2YY6A 4RXUA 4TV9A 3UOWA 1TVKA 4EVSA 3CPEA 1GU7A 4G85A 5JVDB 3LLVA 2EW8A 1SVMA 3NC4A 5GZ6A 2ASLA 1TM3E 2NADA 5KNLA 4LE1A 1IG6A 2RONA 5EQJB 1IPHA 3H04A 1Z4LA 4DFKA 3DE3X 3GYGA 1SBCA 4BLTA 1ZH4A 1HI9A 1OXXK 1NTRA 4EO9A 1UP4A 1Z83A 4WOBA 3SDZA 3ZJVA 1NN0A 5ALFA 1AURA 2XQVA 1W4BA 3GEPA 4R8LA 5D1HA 3IJ5A 3ROEA 1JFLA 1NVWQ 1TQ2A 4PG8A 1TQDA 2CHVA 3PQ7A 2WJ6A 4UZFA 3ROGA 2BQUA 3V1LA 1DQSA 2KP7A 1V1JA 4G4GA 3BGOS 4FDUA 2W9CA 4IDCA 4IJMA 3RRXA 2H51A 4B6PA 5EEGA 5HTOA 1AHNA 3L07A 4JODA 1NRIA 2OUKA 2I55A 2FJPA 2O4UX 5ELXA 1YB2A 1CUBA 3E8MA 3H05A 4RL4A 3SICE 2P8JA 3FM9A 3ET5A 4CKWB 3H5RA 4UUAA 5C8XA 3OOSA 3W9SA 2V6IA 4F4WA 1XZBA 3DXXA 3FHLA 1N0VC 3DWGA 3R0XA 4PPFA 4PS0A 3DVQX 5AD1A 1ZRMA 1PR4A 4BN0A 3ZOKA 1U2DA 2IHYA 1IONA 2ZBGA 4CM8B 1HNZB 3RB4A 3S28A 3HY4A 3BIJA 4A82A 3ZZ0A 1C0LA 2QB5A 3PIRA 4RJTA 1NQUA 2VC2B 1A6SA 2PTHA 1JMSA 4Y1RA 4AIIA 5EESA 1PUXA 3RJ9A 2QHXA 2YZ7A 4F6RA 1Q3KA 1QHIA 1I3CA 4Q3DA 1N3LA 1E6CA 3OD5A 4XE5A 5BQOA 4CN9A 3IDWA 1HTWA 2OV8A 5IKPA 3VOBA 3WK8A 1L1EA 5G0UA 2FWAA 3PC8A 4IL5A 1DWUA 4Y8VA 5JSQA 5E3JA 1PNQA 2H65A 3SVLA 1Q17A 3FWNA 4LJ8A 4ZQEA 5HQ3B 4PRKA 1N2XA 2IU3A 3QSYA 2OORA 2BH2A 2PS9A 4Z6EA 4DLAA 4MDEA 5JTUA 3NVWA 3T0FA 5FNZA 3ZTTA 4EMTA 1SV4A 2YDXA 5EOZA 2IHNA 1VE3A 2QW0X 2RH8A 3K4QA 2R47A 3HN6A 3LT0A 4LOIA 3UKJA 3VR6A 4GFJA 4B47A 2CLIB 5CVVA 3PPVA 3DZDA 1TQHA 2FLVA 4HYQA 1HWYA 1CHNA 2ICAA 4PNEA 4EZ6A 3S2EA 3U3ZA 5ED4A 3LW8A 3E9NA 3LHIA 2PUFA 3JVIA 3GV8B 1YZHA 2FY8A 2I54A 3G2PA 4QNMA 5DBIA 4K1XA 1UEXC 2IYNA 3M4XA 3P32A 4Q7KA 4UMEA 4BO3A 3FWHA 3JD1A 2WHPB 4OHYA 2QX6A 1YUNA 4BAZA 2R0QC 4R81A 2CV2A 1X9XA 1CEZA 5CEJA 2WR8A 1VMDA 3DWFA 2FETA 1PYGA 1G17A 1ZG3A 3S2UA 1DE0A 3CM0A 5DGXA 1KDVA 4C6HA 5J0RA 3TECE 3LBHA 2Q29A 3KVYA 3VMMA 5JZMA 2QQ5A 3KHSA 1DLIA 1IDOA 1EVJA 1QF9A 1R0XA 1TU3A 2ORVA 2YNMC 3A3NA 3LY8A 1U1GA 1ZI6A 2H7YA 2ZJOA 3OVMA 2D4AA 4NMLA 5KOJA 4BPBA 3L3FX 2KBEA 2Q5IA 2X0JA 5AXCA 2H1OA 4M88A 4ECXA 2JI6A 2Z1DA 1WCLA 2FJ0A 3BF7A 2EP5A 1VKJA 3ESRA 5TT1A 8ICUA 2M2IA 3NZEA 4YCXA 5COQA 1PL8A 2ZYDA 1JDPA 5FWDA 4WE3A 5A9RA 5EIXA 4ARCA 3CB2A 3K96A 3T1OA 1FYXA 4X63A 5FQOA 5BUZA 4GYWA 4WZBA 3UFXA 3OZRA 3RC8A 2WZBA 3HCAA 2BEUA 1N77A 2QRJA 1NVEA 2BFDB 5EQTA 1K6XA 3TX6A 4YP5A 2TS1A 3AILA 4YT5A 1LKYA 5I8PA 4HXEB 3OJ0A 1CR6A 5IASA 1RAEA 4HQFA 2PX4A 3EXHC 1OFUX 2E6UX 2HNKA 2OK8A 1ULHA 2YFQA 4ZEWA 1KOLA 1NLUA 4WV3A 1FJ2A 5TMBA 4Q16A 3T12A 3HPRA 2GO7A 3PWKA 3B38A 1GTMA 3BWXA 3F7NA 3EIEA 3QXCA 4BQEA 3RAGA 4AO6A 4CKWA 4PZAA 1CUYA 1I0IA 3SS7X 2HHWA 1RNLA 5HDBB 3G6YA 2IDJA 2ZAOA 3KFXA 5TARA 5JXIA 4DS5A 4TURA 3L41A 2AQ4A 4RSHA 3GFGA 3T54A 2UDPA 1HT1E 1Y80A 4D8TA 3DEHA 3SBDA 4I2EA 1TUIA 4HC4A 4JC4A 3W2TA 4ZYLA 1G6Q1 2YC4C 3H9CA 2CYAA 2PKEA 1JH9A 1T5SA 2G7ZA 3QUSA 4LJKA 4BQSA 3QA9A 1U7XA 2PUHA 5GZ1A 3IEVA 1JBEA 3K0AA 1SBTA 3I6MA 1TZCA 1P62B 4UTNA 2PD4A 5F9HA 5TF4A 1U7ZA 5TMDA 4ACAA 4KHZA 1Z7EA 1EYZA 3FPGA 1NUTA 1UT6A 3WK9A 4F2SA 2DPJA 1VXOA 3A26A 2GM9A 4YCBA 1YJ5A 3GBVA 3DAPA 1GPBA 3Q72A 4RTSA 2P6NA 1S96A 3TQHA 2ZR0A 1OXKB 3CVJA 3KKQA 1K3UB 1QTIA 2CNWA 3M34A 4TXHA 4DCTA 1JEDA 1DOQA 3RPEA 3MWGA 1XO0A 3WSVA 3QJGA 4YMMA 2HK8A 4OXYA 4GC5A 1THZA 2GBFA 2NAFA 2VG8A 4CKCB 1NYQA 2X9NA 3FPAA 3C39A 3DF7A 3WGQA 3JR3A 4ENRA 1JIUA 3VR3D 3B9QA 3LX8A 1DHRA 1C7JA 1GU1A 1Y5MA 4KN8A 1CW2B 1K92A 2EC5A 1H2EA 3AW9A 3A3PA 3JSXA 4H1WA 2G5GX 1Y1LA 2J45A 3EIOA 1V85A 2IBMA 1IZ0A 1YU9A 1J5EB 1ISMA 1GR1A 5GJBA 5A02A 3TSAA 4Z54A 1CY0A 3D3EA 5BSVA 1Z13A 3FNGA 4K86A 3FMFA 2H06A 3I2HA 1VE7A 1Z73A 3JQFA 3KYCA 4QULA 4RDHA 5JEDA 1VHWA 2AFRA 2WEKA 2BE7A 4ZVSA 1I24A 4OYRA 4O3OA 1FYVA 1ELOA 4HP8A 5HF5A 2ACWA 2V6FA 4H6VA 4IQTA 1YJCA 3OBIA 5CDFE 2FLPA 3JSAA 2J0SA 3ISBA 4IHJF 3TIFA 2IPNA 3CS3A 1KK2A 3PHCA 2HNBA 4XDYA 4IZ6A 1Q7RA 2B94A 3IMFA 4JKOA 1VHQA 1KZ1A 4NKRA 1U2EA 4HQ6A 3O2QB 3V1MA 2ERXA 4OLJA 4UM7A 1BX3A 3IIKA 3KPVA 3QSGA 4HNQA 1KTIA 2QJRA 2FZKA 2OC4A 1L0BA 3IALA 3BGSA 4NMWA 1M6YA 5EFOA 1K0UA 2WG0A 5HUQA 3PVZA 4HS4A 1TF7A 1HKUA 3GLHB 1QIKA 2C59A 2MSLA 4C7YA 2EAOA 1B2RA 3CWZA 3OQPA 4UJ3A 4WKPA 3UK7A 5AW4A 3VQTA 3K70D 1NVAA 4QYIB 4S1NA 5A05A 2HQRA 5K7SA 4ZOAA 2OESA 3GGJA 1ZONA 3RRNA 4MQFB 3QPWA 4L4YA 1QIMA 2XNCA 2VA9A 3F2BA 1XDBA 3WO1A 3W1EA 3WGVA 2ZLBA 1N0WA 4UMFA 3K8YA 1KNXA 2FPIB 1H93A 1GGMA 2J8ZA 3KR9A 4MQUA 4RHEA 4HD8A 1XPRA 3NWEA 3IHLA 5C5EA 5AVUA 1U0RA 2VXYA 1WXEA 1RYZA 3KU4A 1IM2A 9ICFA 4KIFA 3NV9A 1WWKA 5IILA 4M0DA 1RSZA 4QFDA 4CMEC 3TACB 2R97A 4EJMA 2JCVA 5HW0A 1DX9A 3JQ8B 2A35A 1GSOA 2ZRNA 3OCVA 1FY2A 4LJ9A 3M5CA 4KQ1A 4MV4A 3SYNA 5IIJA 1X1AA 1O58A 4CVNA 1BFUA 1DIGA 2OY0A 3VYVA 1G66A 2BHSA 1PWHA 2F9LA 3N86A 4P5EA 5CDTA 4H4CA 4YDQA 3EZXA 3NFRA 3ODGA 3C8ZA 4X1IB 5AR1A 4N47A 4BFTA 1Y6JA 2C2KA 2OXTA 3RRZA 1ZK2A 2CE2X 3NO4A 4YJ2B 1OYVA 2AQHA 1BIFA 3ABOB 2CY0A 2BR5A 4WUVA 4LWQA 5EIOA 1HE2A 1W5TA 2BTEA 1AUOA 4DBVO 4NG4A 5CH3A 5K8IA 2NTJA 5AW8A 4XX1A 1SUAA 3VPCA 3VR4H 3X1ZA 1FDOA 3D5EA 3F96A 3BQ0A 7ICQA 2O05A 1WZUA 3WLSA 1G4HA 4QNRA 5J5VA 4C4OA 5EJ8A 2RGRA 2PCLA 2L0XA 3CUTA 1O97D 2IS4A 4V03A 3NEAA 5HA5A 3TD9A 2EXXA 1DBWA 1CY1A 2C95A 1Q84A 2NTYC 3S40A 4YVFA 4YYEA 1Q1AA 4TUPA 4FKMA 2QN7A 3DZIA 1UWCA 1CVIA 1P1JA 1JU9A 3WZMA 4HDSB 1JT9A 3Q3JB 1E64A 3UYLA 3T3FA 1KTQA 1H22A 4HYTA 1J25A 4DKJA 2P30A 5K0EA 1SN7A 2WWYA 3OESA 3N07A 3IEPA 5ILGA 1JI3A 1Q92A 2RJOA 1YHYA 3CPJB 3ZDAA 1QM5A 3E7DA 3ROZA 3SHQA 1XDUA 1TIPA 4UAZA 1KP3A 2PV7A 4IR7A 4J0IA 2XO7A 4I3HA 5TZVA 3ZHCA 3E3OA 5AKGA 3B82A 3H16A 1JHOA 3NHFA 3DR3A 2H4XA 4YJKA 3EF0A 3RUDA 1YFJA 1IULA 4K40A 2RJNA 1ZIYA 4MRMB 1KY2A 3KKAC 4UB1A 4O8CA 2VK1A 4ETNA 2IYYA 3R9WA 1EDDA 3PHBE 1NC3A 2BVNA 2Y2VA 3A4YA 3OE4A 3I05A 3LC1O 4ZI2A 1SZJG 2FK8A 2Y1EA 4IIDA 3J81k 1QGED 3NS7A 2DHQA 3C3KA 1KEJA 4FONA 3HL4A 1PZHA 5GWXA 3GUUA 3KD2A 2WAXA 1CJMA 1FFAA 2C2YA 4N5DA 4TQ9A 5HR7A 2QYHA 3JAMA 3CRQA 3F8SA 4Z4HA 3Q1LA 4GMFA 1RJEA 4AUEA 5F2KA 4EF5A 3TKYA 2X8BA 4G89A 2PL3A 2BBSA 3ESXA 1LJLA 1QSYA 1LLQA 2Z9CA 3FVRA 5A5DA 5JSHA 3UMCA 1CZNA 4MDFA 2W2XA 1ULSA 3T3DA 4BOYA 5LOVB 1ITZA 2R1VA 1SHTX 3RSZA 4AN0A 3UC5A 3AQEA 3L7AA 1ZH2A 3SX0A 16PKA 5LP6C 2KHZA 1K63A 2ZIUB 1XN1A 3PTLA 2ATXA 5TLSA 6NULA 3RNOA 1II0A 2O06A 4XIJA 4DEYA 1EIWA 3FCYA 3NDBB 3KHLA 4GG1A 1TMYA 3GNQA 3UHJA 3QM1A 1S0MA 2RP5A 1JECA 3IVCA 1T9AA 2ISCA 2IYLD 2XVXA 3A1DA 3C5EA 3HRKA 3ORSA 4DILA 1BMFD 4YPOA 1V5WA 1VJ5A 1MPTA 3FUCA 3R6WA 4TRMA 5KTMA 4KQ2A 2QR2A 2XUGA 3A27A 4L5YA 3N2GA 4GYYA 4RH1A 1SCUB 3V34A 1Y8RB 4I4IA 4GIBA 1Y5RA 1NVKA 4JITA 4EB8A 3Q6MA 3COYA 2XNDD 2NX2A 3O03A 2QMYA 4RZXA 3N3AC 1XJQA 1GUBA 2F3RA 1WVMA 4TQRA 1S6YA 3HABA 4JNKA 4ZAFA 3TRIA 4AJKA 3VJLA 1JFFB 3LMKA 4NJEA 1CQZA 4YXWD 1RYDA 3T0IA 1DJOA 3HBAA 3L1UA 4UE6A 2I8CA 2Z5VA 5EMJA 3B6IA 4PHFA 1NI4A 2Z95A 3VU8A 2HR1A 3NRCA 1UBFA 4GEGA 4INJA 4QPCA 4IIHA 3TZ6A 1JHUA 1W59A 2PI5A 2AEEA 2PS1A 4RM2A 4Z4QA 4GP6A 2IA6A 1MO4A 3W5JA 1OFIA 2XKAA 5EJ5A 1KQFA 2JZNA 1OIXA 5TPZD 3IVAA 3CGWA 3F3YA 3L8DA 4ZZ3A 1RP1A 4O3MA 1BKYA 1CD5A 1E79D 1SD2A 2HM7A 4OGLA 1LI4A 4B3GA 3V6JA 1TAGA 2E85A 2PD6A 3H1TA 1T94A 2H17A 4POAA 3CZ5A 1CP3A 5BQPA 3U49A 4W5TA 1T9GS 1Z0FA 4R8KA 1QG2A 2KSQA 4PLPA 1AIPA 5ESDA 2VF4X 3UB4A 5HK9A 1SUFA 5IZCA 5CGQB 4UB4A 4BCCA 2PX8A 2XEXA 3PEYA 2VJCA 1L5SA 5BUQA 3FYUB 4B3DA 5H7XA 4DLPA 1DPGA 1UQVA 3U7EB 4O4LB 2CLSA 4MW5A 3ZN2A 5IK2A 2W03A 2JFVA 3M1IA 4NFLA 1GXSB 2DH5A 1QAQA 2VIXA 1ACMA 3K1YA 4EB6B 3MCZA 1X0VA 1YZYA 4QZVA 1GO2A 1KH1A 1Z88A 1TLFA 5CM9C 1B43A 4KFCA 3PQ3A 2LCFA 3NBKA 3AHGA 4FOTA 4EELA 1UBUS 2RGCA 2VDPB 3OHPA 3SYLA 1R6UA 3GVIA 1IU9A 2ZSAA 3FPSA 3HZRA 1PKEA 1ZNYA 4XJTA 3M6MD 4BGVA 4XRHA 4HB0A 2O1XA 4JEUA 4KO8A 5DM0A 3RU2A 3JWJA 1U8EA 2YWHA 4FI3F 2VDJA 2VT3A 4TWAA 4XAQA 3AFOA 2FGKA 4QU8A 5IT4A 2J32A 4GWGA 2FN9A 3HCFA 1U7DA 4OFWA 5A1JA 4Q15A 5B3JA 3AGPA 2O3RA 1N9GA 3AVWA 3FZQA 3CF4G 3M49A 3V00A 3TWOA 5CH8A 5HF8A 3JTMA 1DCFA 1EG2A 4TTPA 2CLCX 5GOTA 1IXRA 3OU6A 1U45A 2BI7A 1XZGA 4Z9BA 1AD2A 3PR2B 5AVXA 3QFTA 1CJUC 4IUYA 4WXRA 5I9MA 5LPNA 4QUIA 3WLJA 4DLEA 2QKYA 5DJ5A 1RM3A 5HGXA 1OR8A 3SIXA 2Z6UA 4ALMA 1A95A 3WRVA 4D81A 4U7HA 1NKTA 3AHDA 6GPBA 1DNPA 4Q8FA 3D9QX 4Q1VA 2H54A 2WSYB 2Y9MB 3GJ8A 2XYQA 4DO9A 3F67A 3I8SA 2VEDA 3NATA 1RQ7A 2QLNA 1WRBA 1ONOA 2X40A 3K09C 3KDSE 4P4UA 4YACA 3S70A 1ZKMA 3WIDA 3TO5A 1WD5A 4BJ5A 4A0HA 4TL9A 3RVNA 4Q9KA 3UJAA 3EGWA 1F7VA 5EC8A 1XEXA 1ZZGA 2PMBA 4TZTA 2HYDA 3G89A 1Z0AA 3I3OA 1TGVA 5AK0A 1H0KA 5KX5A 5KPJA 2MSKA 3ZK9A 2MJLA 3JASA 2BEUB 1KHHA 1BVSA 1RI2A 3N05A 2PO7A 5A6SB 2BSXA 4K7JA 1P0FA 3LUHA 4L0DA 4N9WA 5KOHB 3G8YA 2XNSA 5EIBC 4M9NA 2PBFA 1JJFA 4BVGA 4BV8A 2LUOA 5B4TA 2FZLA 4LXHA 4F5ZA 3PXUA 2IPAB 3GG2A 4MWSA 4R0NA 5KUTA 3FJOA 4MR8B 4YALA 3FI0A 3OT4A 3GILA 2PZKA 3F6PA 4HNHA 5AI5A 2AQIA 3BERA 4CDNA 1GOTA 2PMWB 4QUBA 4XDZA 3S44A 2XR1A 5AJUA 5KDOA 2GKOA 3E53A 5E1DA 2PD3A 1WYGA 2WJHA 2QPOA 1JAXA 1VYVA 1W94A 2Q1XA 3BAFA 5C5CA 2ZBVA 1DEKA 1B0ZA 1YKFA 3I3SR 4QU0A 7ICTA 1GL7A 2G36A 1KAMA 2YQZA 2W98A 5EYPB 2HCTA 3VSBA 1AV7A 4UKDA 3WGMA 1KMCA 4ARIA 2OFPA 1D1QA 1W5SA 1ZEJA 3GEDA 1VIYA 5FBLB 3V5NA 5C7OO 3LOUA 3VUEA 3Q7IA 1JDJA 3RU9A 1ZXBA 1X2IA 3D6FA 4HX2A 1SQ0A 1I3KA 2HFJA 4H4DA 2C04A 3C2LA 2IK8A 3F71A 4WASA 2RH4A 2XLBA 1KC3A 5L3RA 3B9JA 4GPEA 4OQXA 1X77A 3UAXA 4IH9A 2NZ8A 4N7RA 4KRFA 3BGWA 3KFLA 1JG7A 1JIHA 1YBHA 4M21A 1ZM4A 1EK2A 1ST2A 3BMNB 4U2BA 3U7HB 2VRCA 3BMQB 4H1HA 5JH7A 5REQB 5C32A 1EE1A 3L8GA 4DYHA 5J58A 3FAKA 4QDKA 4QOEA 1GM5A 3C15C 2ZDGA 1KEZA 1E3MA 1DAMA 2XZPA 3MELA 1PWYE 3NHUA 2Q49A 5EYPA 1ZD5A 4MVJM 4EBDA 5FLKA 4ZVQA 1EA7A 2XSZA 1DRVA 4G9GA 4IGFA 3BH7A 1B6SA 3E7XA 1JR2A 5AI0A 1V5FA 1U0TA 4NZNA 1KSPA 2XKBA 4E6PA 1AUPA 1TVEA 5T6BA 1WEHA 3FWYA 3OZXA 3NS1A 4HWPA 5FUQA 4DLLA 2BQ3A 2GBCA 3K8OE 3N0VA 4BB5A 2GI4A 1MAWA 4LS3A 4RKEA 1SU6A 3MINB 4OU4A 2GGSA 2J41A 1MT0A 2CHQA 3CUEF 1F6DA 3TW6A 1T3ZA 1VIAA 2DC1A 1Y1QA 2AWNA 4V3BA 4B3JA 3MFIA 2CMKA 3OTGA 1JFFA 2B1JA 5A0LA 1QCDA 1Y33E 2W43A 2PLWA 2W0SA 2Z1NA 1JKMA 3TANA 2Q62A 5D7BA 4DDVA 2GXAA 1F0KA 1ZXLA 4BIIA 1OXTA 1VJRA 3HKCA 2P90A 3KKMA 1RHQA 1LBTA 2ZRHA 3IP8A 4GW3A 3NIWA 4KWIA 1Z08A 4D99A 1B8VA 2D2XA 4J9QA 2REOA 4US2R 5JANA 3EZ6A 1VKOA 5G4KB 5GADl 1O6FA 3OQJA 1RW4A 4QW8A 2IDMA 3PRJA 4KIWA 1CJKC 1R4NB 1RMTA 4W8OA 3HJRA 2P2ZA 1C4XA 2HZ7A 3C3YA 4RF2A 4CL2A 5IDQA 3B36A 2ZI3A 4YVZA 3FZYA 4GI5A 3NRJA 4QARA 3FOFC 2XCUA 1JXMA 2YXDA 3OIUA 1M6NA 4MRPA 1Z00B 4K9NA 2AGQA 2CYCA 2NSLA 4KDRA 2IUFA 3JATB 4EGAA 5HMMA 4HX9A 1JG2A 3IQXA 3RHTA 1L4NA 4L5IA 5H16A 3UKDA 4DV5B 1K27A 1A76A 2OKGA 3MRVA 3GLGA 4WNYA 4JI8B 4XCVA 1KEPA 1Y6QA 2I7TA 4H1VA 4JI3B 2YDYA 3VZPA 1NRXA 3K4PA 2O20A 1UPFA 2P27A 2QUZA 1FSSA 4P7KA 4DWIA 2E0IA 3H0EA 3P19A 4ZOBA 2O0LA 4BLUA 5CURA 3U26A 1KZYC 3F97A 2A94A 2FOLA 1QVVA 4ND2A 4HATA 4NDNE 3HBMA 4EGJA 3MGHA 1D1PA 3E1GA 1V8BA 3BZUA 3F2CA 1M6VA 2G08A 4JK1A 2F8SA 9ICJA 2QR3A 4FO6A 1U9IC 3CH4B 2FDXA 3L7LA 5CB6A 3QU9A 5GONA 3ZXSA 5F78A 5LZ4A 4NARA 1GPNA 4Q9AA 4KIJA 1MRNA 3KAKA 4YRNA 5HIJA 1P19A 1UPAA 2QVXX 1GPJA 2CC2A 3L6RA 4QQ8A 4RF3A 3U37A 5FLXA 1LEHA 1U3WA 1ZIXA 4C0ZA 4B4VA 1HUQA 5HVNA 2UVDA 2OHFA 3C6MA 1NN1A 2OV2A 1ZK3A 4ELVA 3ADOA 2IIPA 4UQGA 3OTHA 5E4JA 5I01A 2O3JA 1RI5A 4HR7A 1UKCA 4I8DA 1XVVA 3FTPA 1UEIA 5DNDA 4JROA 4QJIA 3VYUB 3U3DA 5DN6A 3KR0A 3OLCX 7ICMA 3C2KA 3G5UA 4DQRA 2E2WA 3ESQA 3OP4A 4P54A 2WJ4A 3AHCA 1PV4A 2XVZA 3OQNA 1XZJA 3IQFA 1EP2B 2GTIA 1P5JA 3QY9A 4XJSA 4R69A 2K2WA 4XGIA 2DL0A 3I76A 1KO7A 2R2GA 3FNIA 2GKGA 2V4QA 4J1SA 3VJKA 4HQRA 2VTBA 2ACKA 2FW9A 3F5QA 5A62A 4ZVVA 3E84A 4WECA 1EMDA 2B98A 1Z4PX 2L2QA 2YVLA 4EENA 1ZM2A 4OSOA 8ATCA 2FOXA 1Z3EB 1BCSB 5F33A 2KYRA 2Z56A 3PFFA 4PPYA 4XTCS 3VISA 3LM8A 4ZAWA 4ZCRA 4KR6A 4L95C 3RVDA 2O2YA 1UP7A 1XTUA 3GJXC 3HSKA 4FVTA 4KSBA 4AUNA 2CGEA 2EJBA 4XARA 5FBHA 3AESB 2BZ0A 4RFVA 1FTYA 4HKTA 3X1DA 1NDUA 4TN1A 3CVWA 4IXMA 2NRVA 3MT8A 1C30B 2ZYSA 3T7EA 5KAIU 3BRCA 4H6XA 5A6SA 2EX1A 2BFWA 1HEYA 3L8ZA 2K5UA 4EG7A 5AJVB 3T5KA 2EVWX 3BFKA 2HMUA 2ZUVA 2CUTA 3GFRA 4D41A 4YMOA 1IM4A 4AP9A 1JFRA 2QMOA 1QHFA 3DCYA 4PLWA 5TEWA 1DZ3A 2WJZB 4LPSA 4UNSA 1P1FA 4C30A 4CETA 1KRXA 1NMQA 1RCUA 2CXSA 4M0PA 4NZYA 4UTXA 1RWBA 2WFZA 5HFAA 3TTWA 3WGLA 4CQMA 5CXQA 1GJRA 1QH0A 1OKKD 1KZ4A 2EBUA 4U4AA 3RU3A 3TUJC 3SG0A 4DPMA 5KTOA 2ID9A 3DEYX 5EXTA 2X9GA 4GO1A 4DWVA 1Y1TA 3KCNA 1NSFA 4M36A 1ZUIA 2XQKA 1T6BY 1JLRA 3B3AA 1WB4A 2P1ZA 4YMTA 2OPBA 3MTJA 2ZI6A 2B3DA 4OGFA 3L8HA 1UZAA 1WSBA 3AUYA 4LY3A 4MKFA 4NEQA 4RZ2A 2VHCA 2XMPA 4TL6A 1VLZA 4E3WA 5AESA 3DLBA 3GOHA 2OXCA 3PSPA 3EPJA 2WUVA 3PQ8A 2LBPA 3EZ9A 3IUYA 2G1JA 4KBYA 4MW7A 4TN5A 4BMNA 2XUKA 1XO1A 1OV6A 2XY5A 1JDSA 1FQWA 1M2HA 3DTVB 4CU5A 3OSPA 3N8KA 1S0OA 4L9WA 4DABA 3K9LA 3TR6A 3GIDA 4ELTA 2Y0EA 3L1VA 3R7SA 4F5QA 1RQXA 4QGHA 4R5MA 1V6SA 1IZ7A 5IT9A 4WY8A 2H59A 3OF3A 4HLCA 4LXYA 1OH8A 8ICSA 1O4VA 1ZY2A 3RV3A 3O4RA 1J8QA 1H9AA 3E4DA 3OECA 2D1YA 2VSOA 5LVAA 1JYSA 1EE9A 3GUVA 5E9JA 1HX7A 3AEXA 3EJWA 3MFQA 3HI4A 4TV9F 4S1TA 1EP9A 3LV8A 1C2TA 2ORIA 4DQKA 1SUEA 2ZZKA 3OFJA 5JDCA 2D5AA 2PMFA 5A4JA 5JV5A 2ECOA 1DRKA 3USES 5CFQA 2E8PA 2IELA 5KBYA 4Y2JA 4JUIA 5FA5A 4BE9A 1JROA 1NDHA 2H0QA 4G1MB 4RVCA 1ONPA 3R7DA 1G38A 4MJXA 2WINI 2OYYA 2R48A 1V45E 1YRLA 1QZZA 4ER5A 2IS6A 1V41E 2W6ZA 1P1KA 3WC4A 5DB8A 4Y6RA 3SYTA 3OEYA 3REOA 3RGWS 1YVUA 4KVAA 4AYTA 4MRSA 3PRKE 1U1CA 5TJHA 3TXYA 3TLGA 3LRPA 1WZCA 4TYQA 4GECA 5IUKC 4E2WA 2CJWB 2E5LB 2E55A 3NW9A 4OPMA 5AOBA 3PJFA 1QQTA 3IBTA 5DU2A 2HOIA 2AV6A 2VLIA 4LJ4A 2CL6X 1U1EA 2EP8A 4B32A 1J0CA 4MUNA 4HVLA 3O8NA 1AF4A 2CB9A 3RT7A 2JGAA 2RGNA 4M4SA 3IESA 1HFJA 2EZUA 2VNSA 1NE2A 2CBGA 3OCYA 2OXRA 2V98A 3SLKA 3HCDA 2C0QA 5DEIA 2OQVA 5FIUA 2NTVA 1BW9B 5CGZA 1YZ6A 2CXOA 1KJZA 4MHTA 2FQWA 4P86A 3ZGLA 1RYBA 4DJJA 4LGVA 2FRXA 1DI0A 3WIUA 1O94A 1XPJA 4RHFA 1C1XB 1NR1A 3KLBA 4DW8A 5L51A 1QU2A 3L1HA 2ZIGA 5EZQA 1XU7A 2DECA 2NAPA 2VATA 3DCNA 3QWIA 4BATA 3ZY3A 4EW6A 3NKFA 2ZYUX 1J49A 3KYBA 2GUWA 1MGPA 4IXWA 2DFKB 4Q01A 4RZSA 4TLDA 2EBWA 3K4GA 3PJGA 1E6KA 4PGXA 2MT9A 1ULAA 4G8JA 4D92A 1DGQA 1FSGA 1D7OA 2H3QA 4NM2A 1GQSA 4PZPA 3F49S 3AW8A 2XGSA 4QHSA 3VV2A 4B3CA 5JCZA 1PL7A 4XYGA 5JQGF 5AOCA 4W1QA 5D5HA 4EATA 1V7CA 2CT8A 4I46A 1L7DA 4X3OA 2W8ZA 5TPZA 4OJMX 4RMNA 4F4KA 4F1KA 4H7PA 2XOKD 1IN7A 2HKIA 3ED1A 4DDKA 3GV5B 1UM8A 4GXNA 3F53A 3G6XA 1XK6A 2R6HA 3E9RA 3E3LA 2IY7A 1Y4DE 3PKZA 1XELA 3GFKB 2PG3A 4G2NA 4FMCB 3ZGYA 5CFZA 1J8FA 1PG0A 4QPNA 2HMWA 2VWPA 2P69A 1N5DA 4Q9LA 5JIBA 5BXYA 4LMBA 4OLBA 2KK0A 4IGAA 2V65A 4QKQA 5IT0A 4EZ9A 4LZGA 3QW4B 1RYFA 4RO0A 1JXLA 4EAAA 2DJIA 1KDRA 2X8JB 3BH0A 1TZJA 4U2GA 4YMVA 1L4EA 2RH5A 3NOOA 4CG0A 1N2EA 1T43A 2QTBA 1EFKA 2XB9A 1FDUA 4ZVTA 4FHGA 4Q24A 1EX1A 4BHTA 1UBCA 4F56A 2BKUA 4MPJA 2CUZA 2Z30A 5HHTA 5BYBA 1NW6A 3O95A 3GHYA 4IHJA 4INZA 2IV2X 3E8SA 1OH5A 3T5JA 3BJYA 1XDWA 2P7HA 3OZBA 3GIWA 4XOIA 4DDMA 1Z0KA 1Y5LA 5GM1A 4D9BA 5I9BA 3DMTA 3Q9UA 4Q1DA 1PJZA 2C99A 1G6OA 2HHJA 5JQGA 2P75A 1CZUA 4FB5A 3ISDA 1T4GA 3JRXA 3B2QA 3BIXA 3DDHA 1L6NA 1MRSA 1B7GO 4L8YA 5IC6A 4D97A 5E2BA 3H5AA 2IUUA 5BR1A 4E2XA 2UZ4A 5EMLA 3ROKA 1SHKA 3SR6A 1Z8NA 3BQ7A 1E3LA 3C5VA 3W9YA 4WRRA 3AFHA 1QFXA 2G5IB 2IZ7A 9ICTA 2QW1A 4FNOA 4OF4A 2FF5A 3L1IA 5G41A 1V8DA 2ETXA 5LR6A 4AX8A 2VJMB 4B4OA 1J2NA 2PKCA 3IAS6 4L8LA 5DTMA 2PPLA 1YJQA 2OCPA 2XGPA 1N6NA 1XSPA 1UC8A 1Z39A 2FFHA 2GNOA 3NBAA 5COAA 3MWJA 4DC9A 2WMYA 2Q7DA 1IOVA 1Z6QA 2OCAA 1SBHA 2CCKA 2F4NA 1MNAA 2E4AA 2NWQA 2QZJA 3ADKA 3ADCA 5IHPA 3O74A 3DE6X 1YJBA 3JD0A 3CVYA 3E3AA 2AX4A 3GPIA 4BJHB 1EZ4A 3HN7A 2EGGA 1RWNA 2Q9UA 2ZKLA 9ICNA 4PFQA 5KYVA 3D4PA 4JI6B 1PJTA 2C5GA 1SHZA 3ELDA 3HJGA 4HDRA 4TUYF 5EFZA 4B31A 2H52A 4QIHA 4DR4B 3BHIA 4M0EA 1U4SA 2C82A 3P2JA 5C8YF 5KFEA 2HA5A 5KFWA 2Q28A 5IEJA 2X5NA 3IEXA 3ACCA 4MI1A 3WLMA 4EMUA 5J4HA 2K2QB 5DX8A 3WFZA 3C7TA 3OEEA 1QTMA 3SVZA 3KSAC 4TLBA 1JW9B 2C00A 4ZHQB 2J07A 2W8KA 3DPIA 1WKBA 3L4JA 1CU1A 1OY1A 1OQAA 5IAEA 4C76A 3MB8A 4PAMA 3UN1A 5A0TA 2HHHB 5CFPA 2PUEA 2KHQA 1XALA 4RVGA 4Z6DA 2BGWA 1NQWA 1QJ4A 3HDVA 4UZSA 3GU3A 1J0BA 1P7WA 2NUBA 2C3UA 4BLSA 1KARA 8ICYA 4HDNA 3VDQA 4RPIA 3GRVA 3HW8A 3R4CA 1GL3A 2HO4A 3I6BA 5AM2A 3H97A 4I2GA 3K15A 3PHLA 2J3DA 2VHZA 3HKBB 1Z4OA 5TX7A 3NXSA 2AUTA 4Z6FA 4RIHA 5JR3A 3T5GA 1SCJA 1IZYA 4TZ6A 1AKUA 1C4OA 2DFPA 4JB8A 4Q3CA 3T79A 3RVJA 1QDLB 2W2LD 2KQUA 4UB3A 2D8MA 3EUAA 4JKIA 3I6ZA 4MW0A 2JZBB 2JL1A 4KXWA 1KP2A 5FBKA 3BXHA 4PYMA 4RM3A 2BGTA 1Q77A 5G40A 3VKFA 3R9KA 4EYKA 3EY9A 5CXUA 3GHHA 4CM9D 2I6UA 5KDDA 3GX1A 3K8QA 2MSWA 3DE7X 3E5HA 4LHZA 4YJFB 3WNVA 1TIKA 1ZYQA 1W1UA 3IDQA 1U1FA 3O1IC 4N82A 8ICHA 1ZJ5A 3DHNA 1U99A 4MWZA 4NJ8A 5DW3A 2JIPA 4P82A 1GU0A 2B3TA 3M33A 3T7AA 5EUMA 3B48A 2H2AA 2Q8PA 5BN4B 4EKGA 5KG3A 4M22A 4BO9A 2X9VA 4G1CA 5DBGA 3UENA 2OKCA 3UJCA 5C7IO 2M32A 1ENYA 2NUAA 4E2ZA 1Z47A 1C8KA 1HBJA 2QLLA 2X0NA 4UHBA 2XRZA 2WWIA 4HHEA 2XA2A 3UAGA 2CLHB 1XUOA 2VDQB 4JASB 3ANYB 1KU6A 3T9AA 4M9XA 1ANKA 1C14A 2MIIA 2QIPA 4CKBB 3ANNA 2W90A 3PW7A 4FTWA 3UFBA 2O8CB 5JJLA 3E70C 2QM7A 4BP9A 4EO4A 3CRRA 3KPYA 3F4KA 4G24A 4OJYA 4QYTA 3SEZA 3SQMA 5BV8A 1HLGA 4FQ5A 2FUG1 3DYVA 3PUVA 4NP6A 3TRKA 3KWFA 2DQSA 3IBCA 3KKLA 5JI2E 1E96A 1FJGB 2A2ZA 1HEKA 1OGJA 2DXIA 2BEVA 1Z07A 2C9CA 2Q3LA 3AU8A 7ICIA 2MYTA 3E6AA 1EHIA 3EVNA 4NFHA 1GGNA 4ED2A 2FG7C 1F8YA 1Y1PA 3OHBA 5CLLA 4MCHA 1PZMA 4K2AA 121PA 1SO8A 2R8KA 3LKBA 4UUOA 3TH5A 4MHSA 4NY8A 1R5NA 5L1LA 1Z5UA 2OBNA 5JZSA 4BLOA 5FNVA 4WBNF 2PGOA 1XN4A 1E1NA 2G06A 3JWHA 5CW1A 3UJ3X 1JA9A 2BFDA 3KPUA 1D8AA 3ZNNA 2WG1A 2F1IA 4CMBA 2FWBA 1FRQA 5ITVA 4OJKA 5HUHA 3C45A 4LOLA 3RVRA 1KI4A 1U02A 4C4TA 2VNIA 3EGDB 4EW2A 4C0QC 2K4IA 1B42A 3CKLA 4AFNA 4BVLA 1BPZA 2VXOA 3U7FB 2OWEA 5KYWB 3R41A 2R62A 3PC6A 3RTEA 3SF0A 4WFIA 4G5OA 3OFKA 2JLBA 1FFWA 4PAWA 4WSOA 1MR3F 4GNRA 1BG6A 3DW1X 1O6BA 4M9JA 5ED0A 3N7SC 3SSMA 5JCXA 1QLJA 2C7PA 1L3TA 2WC1A 3S1LA 5KINB 2DB3A 3WGYA 4PAOA 1Z28A 4I8XA 2OHVA 4I3GA 3LQFA 4F4ZA 4KMOB 2C4TA 4G3XA 4YRRA 3RSQA 4B75A 2Q27A 4A8JB 5JBIA 3UK2A 3KJIA 4KXMA 4N7JA 2IP1A 4YMHA 5H1YA 4D3ZA 1G8SA 3SJCA 3O1JC 1M8FA 9ABPA 4JYZA 4OK6A 2I80A 3KTOA 3RRFA 4PZUA 5BQXA 8ICJA 1C3OB 1N9GB 4HZIA 5F2EA 4TTVA 4AS3A 1FS6A 2I99A 3OHSX 3PR1A 4M37A 1JVSA 1GZ3A 4X6YA 1Y6FA 4EPVA 4E4RA 1VDVA 1EDBA 3PHIA 4FKBA 1CUWA 4AJ4A 4MB0A 1BXRB 5DYNA 2XXAB 2JH8A 4EY8A 1QPZA 2KVCA 1LWNA 2WJ3A 2XGOA 3ZEAA 4UTVA 1EUDA 4BRZA 5P8WA 5J4VA 5T8KC 2HPAA 4KXVA 1DUSA 1XBTA 4PANA 4G01B 4WX2B 4HT3B 4WZAB 2GARA 2PK3A 2G76A 3SXUB 3DWIA 3RR7A 4Q1AA 3TQQA 4X64B 5BV7A 4NX2A 3UHOA 4RULA 3RAFC 2R44A 3KZVA 4FKZA 4PHHA 4E5VA 3ADBA 3RLFA 4BCDA 5IUJC 4X6LA 3AM5A 4KN6A 1EX9A 2G83A 2XMRA 5I7FA 3GLGE 4FBLA 5IKEA 1NHWA 2FPPB 4YCCA 4IZIA 4P22A 3IRUA 2E5WA 1ESMA 3K1AB 3PVCA 1KH2A 3EZGA 1X2EA 3QZUA 4HFJA 4AX4A 4ZIRB 3AL0C 4K0KB 4FYYA 1SM4A 3KZMA 3OPQA 4H2DA 1M7GA 1N0UA 1QBKC 5LFAA 4F4FA 1BNPA 3T9CA 4U63A 1QWSA 2GPNA 1A5TA 1FP2A 2EYQA 2BP7B 3WMRA 4EEZA 2ZYTX 3KPJA 4O3NA 1N25A 1V6AA 3OQBA 1Z0DA 2EGHA 2OCXA 1JWBB 1VG8A 5AKLA 1O9HA 1YDFA 2QP9X 3EWIA 3IP3A 4FHEA 1ZD1A 4LJ6A 4MGEA 4IWXA 3KVRA 3P20A 4RWZA 4HUJA 2XTMA 2WM8A 3N3BC 4HPJB 2WTMA 1FSZA 1PJ2A 2Q45A 2JCBA 4FYJA 1F8GA 1YQUA 2DWPA 3C87A 4JB0A 4ZALA 2HBYA 3ZHTA 3LK6A 4F6CA 4ZPXA 1NW8A 2RHTA 4WESA 2J48A 5HNKA 3H8JA 1IJFA 1S4QA 1KAHA 2HDWA 4MJ7A 1JVNA 3WYNA 4AULA 4EHHA 5FTMA 2VPPA 3KEMA 4R9RA 2Q2QA 1XJ0A 3I9NA 4EY5A 5IWCA 3TNYA 1S2DA 2Y1JA 1DTWA 5HS6A 1T6NA 1YMUA 5AJWA 2NVWA 1PV1A 5DBEX 5C4IA 5JCJD 4EUSA 1YL7A 4D9HA 1ZN7A 2A1IA 1KEEB 1MABA 3JARB 4WGFA 5ESXA 1MJGM 4WCFB 4J1TC 2YZGA 4QOFA 1CEYA 1XD9A 2PWAA 2XI9A 5AMXA 4L2IB 4F3OA 3U17A 2I66A 1SUCA 3VV3A 2EYUA 2F59A 4OHZA 3OCJA 3RREA 3R0IA 4BNDA 2C84A 4NAHA 3U4GA 2A0FA 3UHAA 3TDNA 1Z7YA 2GDZA 4KQ6A 4AZ0A 1BD4A 4JJFA 4B8YA 1G8KA 5JAHA 4XR9A 3LRXA 4FM9A 1XNGA 4UM8B 2Q4TA 3E61A 2RB4A 3A2KA 3WBJA 1YE8A 3GB9A 2JZOA 3FR7A 3QX9A 4DUGD 2I5HA 1HMPA 3N4MB 1RM5A 2C3OA 2ZJAA 2GJSA 2AFHE 3WKAA 2IXTA 2VH1A 4MI3A 3BSSA 3VR5H 1YRBA 4B5KA 4K3UA 2HWWA 4F4HA 2QG6A 4RSRA 4D98A 4A16A 5FI3A 4IFBA 4Q47A 4ZGGA 1QCKA 1K98A 2P62A 1WUDA 2FPRA 1KI3A 2OZPA 3BYZA 1OC2A 1RCFA 1JDBB 2G28A 2NM0A 2P9CA 2KMDA 4IXNA 5ITZA 4KPYA 4WCFA 2CLFB 2QRMA 5GOZA 4OM8A 3ZE2B 3ZV6A 3ANSA 4ZV7A 2QNRA 3LWLA 2PXAA 3MT0A 4JLPA 4DANA 5ILOA 4OUDB 1OXSC 4KNWA 9ICAA 3SQLA 1Z5VA 2Q5HA 4PRZA 1IJBA 2H48A 4YT4A 4ZYVA 2IOQA 3GLFA 1OIVA 4RPZA 1SV0C 2JJMA 3DKRA 1EK0A 4W5WA 4NBWA 1EDOA 1RCTE 3OLVA 4EFDA 5DM60 4F7DA 3UVEA 5I4IA 4CF6A 4JDPA 2Z08A 1TPZA 3S99A 3TJMA 4L8VA 1GILA 1UT8A 4OFXA 3V8NA 1M2VB 3TOVA 3WLEA 5K0JA 4ENVA 1BTOA 1YUBA 5K1ZA 4A0QA 1N1DA 1ZSVA 1BPDA 3R40A 4YMSA 1OIWA 1WKVA 1KHTA 4MWBA 4IDPA 1MB3A 1BKSB 4PX3A 1T3LA 4TXJA 4AZ3A 4OCZA 1QO0A 2LE0A 3MCTA 3IEMA 2JCGA 4YLEA 1BPBA 1ZQFA 1P6XA 4J0KA 5KOJB 4X00A 5FPYA 1B0PA 4CM3A 5LIRA 3U1VA 3L40A 1AC5A 2NXCA 3O7WA 4MW9A 1OXMA 1HURA 4QWWA 2G72A 4EPRA 3D0KA 1T6YA 2N1MA 3WNZA 4A26A 1VHTA 2CLEB 2GXQA 4OD0A 4G41A 4MV8A 5LB2A 1QB7A 4LDAA 2XX3A 2M98A 2J33A 1NJ6A 5CWRA 1LTHR 2O7VA 3TTYA 3ROPA 5HMLA 3WWCA 2BELA 3Q8SB 3MQFA 2HLDA 5K4AA 9ICIA 3FGPA 3TW8B 4YV1A 3UXOA 1Q20A 3EVFA 3NRBA 3LY9A 4JUBA 3R3YA 2J9GA 4RANA 5KVCA 4G5QA 1C5KA 2GN8A 3RFVA 2DYKA 4HUQA 1U3FA 2CZGA 1Y7TA 4J4HA 4Q12A 4GE3A 1SRQA 5G02A 3ZZNA 1L7XA 2V45A 1O1YA 4C7XA 2BDEA 3VR5D 2JEJA 3RHZA 2ZUDA 3I04A 3INGA 3O73A 3QX7A 1MQAA 2M9NA 3O4HA 2W7TA 2WICA 3OY7A 5DYWA 1I7PA 3VR6H 1C7FA 1VB3A 2B4TO 3PUZA 5JC1A 5SYAA 2G71A 4F1JA 3DAHA 3EGVA 3MHTA 4NYIQ 4LXUA 2J3KA 2F8MA 3EBPA 4FBMA 4PZLA 4BTLA 3QPUA 4NQZA 4EG0A 2WJWA 3BT7A 1EXNA 3QMPA 3SBXA 2JLUA 1E3JA 2QF7A 2JBAB 4M1KA 4TS4A 2IYSA 1JLLB 2W6JD 2YH2A 4IS7A 3IELA 4KE7A 1IHPA 1TKRA 5BRAA 3JYOA 2Y27A 3EY4A 1UM9A 3DW3X 2CMFA 4MFAA 4Y1EA 1P2TA 4FWIB 1ZD4A 3BD8A 1DZIA 3I9MA 1G55A 3X0DA 4ZCTA 3A31A 1A7JA 4NG5A 4KPFC 1QHXA 4DLTA 4RTNA 4O4JB 1QGUA 3M8RA 3UHPA 3KDAA 4MMXB 1Z5NA 1I1HA 2QTMA 1PG5A 4NATA 4ONEA 2I87A 5DXJA 3VHQA 2A4KA 3SJZA 4BYMA 9ICMA 1RVV1 5LYYA 2GCIA 1WCV1 2IC5A 3OZGA 4MWGA 1HZZA 3RVPA 4C2UA 3BILA 3TQSA 1GDDA 5JECA 1SXHA 3LPDA 2XCRB 4C7MA 5J3JA 3BTUA 4EA7A 3T9BA 1G21E 3M6FA 2YV3A 4OQ4A 2GDJA 4EX6A 3D81A 3GT0A 4N5MA 5B7GA 1CQWA 2GAIA 2VHVA 2YC2C 3BKWA 3HA5A 4WFJA 4GXTA 2QZZA 2XJ4A 3U4AA 4P38A 3VC2A 4ZFNA 4UUBA 5AUOB 4OFBA 1DL5A 4QHTA 1GSHA 2W4IA 2O8DA 3L7DA 1JTVA 1MVNA 3AI3A 1CI4A 1GN9A 2H57A 3D3QA 3LXXA 3RYFA 1T6XA 1ZCJA 1ZOSA 5DYIA 2QRVB 2P2CA 4E12A 2KB0A 3PMNA 1OYYA 4EJSC 2C2GA 3UJ9A 3MA0A 5KG6A 3CJTA 2CLLB 1J9EA 2CZCA 3HKDB 3QI7A 4G0OA 2CSUA 4JEHA 1M2GA 1FYFA 1JG1A 4CLRB 3LK9A 1DKRA 1I6WA 3CVUA 1UKVY 2EDAA 2YTZA 4MOWA 1NK0A 1VI5A 1VHJA 2ADFA 1GGEA 1ZP6A 2I33A 1BDMA 2C29D 2VUSA 3P0HA 3KXPA 3H4VA 4HGOA 3IXQA 2YW2A 3ENVA 5GV7A 1N2ZA 1I6MA 5DTEA 8ICWA 3PX0A 3DMHA 3L8MA 4LY6A 2WY2D 2GVZC 5BYJA 2XEDA 2ZXIA 4EQZA 3C21A 1LK0A 1MG5A 3RR8A 1Z56C 2NU7B 2ZUCA 1P1HA 3LT1A 3DBHA 2JLYA 3UPQA 2NU9B 4N7MA 3OSUA 4QUHA 3M1LA 3QWBA 4GDMA 4PSVA 3LTEA 1WPRA 1ZVQA 3T6KA 3RYFB 3QJYA 2XGGA 4EABA 1X7XA 3A32A 5HIAA 2JI8A 2OL4A 4BC0A 1R5OA 1EGQA 2H2IA 1YZNA 2NSJA 5BN4A 5BSGA 3OBBA 4QA9A 1Z12A 2VRBA 3TOCA 3WB0A 1NP3A 3ILXA 3ZHZA 1GZ5A 1TVAA 2ALJA 2XA1A 2JF0A 3B3JA 2HRBA 3FNEA 4QUDA 2LR0A 3H4DA 5CBPB 4R71A 4M46A 1UF9A 2PJZA 4RW0A 3K92A 5BVHB 4BMCA 3L0IB 4H31A 3FPFA 1RZTA 1EVQA 5JXHA 3CC8A 4TLMB 4KGZA 5DGHA 3ANXA 4ZANA 1M7BA 3DBIA 3WQBA 3KSUA 1E8NA 2X86A 1GGFA 5JRZA 5J47A 3HNOA 5DLGA 1P4AA 2ZJBA 3N87A 3ST7A 4COOA 4ZTUB 1OW5A 1A2KC 3QFSA 4GSYA 3AOEA 3GCDA 2EZ4A 2PLNA 4IDEA 1U2GC 4YO8A 5DN6D 2DWCA 4FEYA 2RHGB 2JGMA 4IV0A 1UXJA 1T1RA 2P9GA 2J7PA 4BECA 1D2NA 3MMSA 5C81A 3KDPA 3VNUA 1H94A 3VO2A 1J5XA 1IHOA 1K2VN 2P2SA 3H83A 4OGWA 3VPHA 4CNBA 1RJ9B 1RI1A 1E32A 1SXJE 3KT6A 1OI3A 2R8HA 1VLHA 1AKMA 1G16A 2G0TA 2JLAA 2W58A 3F4LA 3FH0A 4JY7A 2IZ6A 4O1IA 3AL0B 4IIXA 1D6JA 1EK6A 3HR7A 3GIJA 1E58A 2W2LA 4GZ6A 4J91A 2VVTA 4XASA 1OXJA 2E18A 5KYUB 2FNAA 4KXFB 4RZUA 1T2AA 4DDUA 5CIYA 4IF4A 4OJTA 1LQUA 1SU8A 5L4NA 1SZDA 3M70A 2Q6IA 4DWWA 4PSUA 2BSQA 2BUAA 2H3ZA 4AYBC 1SY7A 3EVGA 2PNFA 3E9DA 3Q2KA 4JVOA 2JFQA 3RD5A 3RK1A 3TMAA 3MGBA 2JDID 3U19A 1Q0ZA 2BCJQ 4PG5A 4UDYX 2WP0A 2UZAA 2GCNA 4LVOA 4KLEA 1U9YA 2IYOA 4DAEA 3AKYA 3S8EA 2Y67A 5B64A 1R5BA 3H2YA 4BX9C 1SOUA 4C0WA 4EG8A 4Z1MD 2PUGA 1YZVA 3GD5A 1MC1A 4FFDA 3COVA 3MS2A 4BMDA 5KNDH 4Q7MB 2WJYA 2IHTA 2QRLA 3WLIA 2B5VA 4B7XA 2P8SA 3JQCA 3EBOA 2FV8A 1VPEA 3VZRA 4IMIB 3UV7A 5C8ZA 1H2RS 5KTSA 4B7CA 1U3TA 2NRZA 1PJ8A 5IF3A 2IHZA 1AN0A 3LZDA 5G0SA 3LUDA 3CRXA 2AHOA 3DP7A 1C9YA 4RTQA 1K7FB 3QU2A 4CLOA 2Z2KA 4XPZA 1XVIA 4BVHA 2PRYA 3EE6A 3RBAA 3ZDDA 4AJOA 1RWPA 4B9AA 3TL3A 2H92A 3A0BU 3THSA 5DNAA 2C07A 3BRWD 5HQTA 3RDPA 5JD5A 1GKIA 5DB6A 2JAWA 1G7SA 4IQ0A 2VQSA 4QIWF 3AY0A 5LWHA 1CERA 3IE0A 1XWLA 3HRIA 3QWAA 3EGOA 4TMXA 3GZJA 4KAFA 1F44A 3TDMA 5AUNB 3Q3EA 1WUKS 3N53A 4ECEA 1ECCA 1K97A 4JR1A 5JADA 5KKCA 2UKDA 4ED6A 4I1PA 4F93B 1JQDA 3RS0A 1ORVA 4EVRA 2X8LA 4A36A 5JJIA 2JFFA 3RIXA 3SY8A 3RSGA 1MA7A 3QG5A 4HLDA 4DPLA 2UZIR 2GEVA 4HMOA 2QQEA 4GKVA 1G21A 1RJFA 1KAGA 9ICVA 3CEMA 2B30A 4RHYA 2FXVA 3PXEA 4PQYA 4W99A 1YB4A 1Z2AA 5EMHA 4W1RA 3JQEA 4BMSA 3PJRA 3CSUA 4PL2A 1UWKA 2AB0A 5CT5A 3B8HA 1MLDA 2YIJA 3QWFA 2CCJA 5B57C 4AWBA 3BRWA 4PIPA 1Y7PA 3A6HA 2LRHA 1ZD3A 3AZQA 1UDCA 3WMEA 2A4MA 2X0FA 3DDUA 2Q3EA 2HDNB 4HNGA 1VPWA 2FWIA 4FCTA 1BGVA 2Q5OA 1Y3BE 1WA5A 3OLWA 1OBFO 2PSDA 1L5RA 2XVTA 3QKIA 5AH0A 5CB4B 1YTUA 2V4UA 2WWWA 2AOUB 2XQJA 1Z8DA 1USIA 5LQNA 1KR5A 5H4GA 1Y9ZA 1LRJA 2G67A 4DV3B 4X8MA 1TYCA 4C20A 4V1CB 4C7OB 2O8EA 3UAYA 1H8HD 2P5SA 4TVBA 3TZHA 1GRNA 5CLFA 9ICUA 3Q7QA 5LWQA 3V4SA 3LYHA 1B73A 1KDOA 2VDWB 5AJYA 3V8BA 3VVLA 2OAQ1 4QZ9A 1X9SA 1HE8B 3W5DA 3QFRA 7REQA 4OO1J 5B66U 2QTLA 3E7WA 1B93A 3FDXA 3BORA 3IG8A 1YVPA 2DP4E 2WUDA 3P2YA 4KO2S 4R8UA 2O0HA 1NOJA 2C9DA 5B4VA 1Z0IA 1NBMA 3JZFA 4JGIA 1E1MA 3G2IA 4E07A 3NAGA 2QB0B 1KY4A 4E3ZA 5I8WA 5KSWB 1IQRA 3DOUA 1A72A 4MGKR 4U8HA 5ISMA 1UPBA 1W8IA 5D46A 3DDCA 2DBRA 3MJ4A 3MTQA 3OF2A 3U39A 4YCLA 3IPXA 2PU7A 3CF0A 4IHQA 3MGAA 1OBCA 1UPCA 1E5XA 4K9PA 2VTEA 4Q1EA 2P0EA 3H2JA 3R6LA 3T5CA 3VPBA 5J2UA 1PAUA 1E2HA 1ZNZA 2Q5JA 4FGJA 4ZQFA 4BO6A 4C7KA 1K6IA 3VYWA 5HZKA 1IOLA 4Y2GA 2EIHA 4V0RA 5FP0A 3PEVA 5IW8A 3RJ5A 5EE1A 1GLVA 1ADJA 2GBIA 5B58C 5JZBA 3X43A 3MCVA 4C43A 1G8GA 3NHYA 4P4OA 3C8MA 4QIWC 3JYNA 1QG0A 1X6JA 5ALIA 2IPLA 2NU9A 1J23A 4FD2A 2Z58A 3AR8A 4KKXB 3VJMA 4CT0A 3C23A 4NL4H 2VWQA 2HV9A 1JHZA 1A04A 3AKCA 3JWEA 3TZEA 5ITZB 2JGDA 5DSXA 1KDYA 4JUZA 4RQAA 2I4IA 4JL8A 1GR0A 3AIOA 1C3OA 3ER6A 3PQ2A 4OGKA 4IJWA 5GP1A 4QXRA 2ZUUA 1V7ZA 2DQYA 3RAPR 1UH5A 1N6PA 2O7NA 2WIDA 3EZ2A 1JX6A 2ZI4A 3AUTA 2QUBA 1X9WA 2I2XB 4MV6A 2O3SA 1E2JA 3KQSA 4IUDS 4CKYA 1YBAA 4LX0A 2ZBQA 3BS5A 5ARCA 5CB4A 3N2NA 4X85A 4QPDA 5EWFA 1HTTA 2EFJA 2Q3CA 4GC6A 1OF1A 4ND4A 5IDXA 3PDHA 5SZJA 1ZRHA 1QRSA 2C2OA 4B6GA 1RWQA 5J0YA 4JJEA 1FP6A 3BXGA 1SXPA 3W5AA 1ISRA 3T61A 1GA1A 1E2LA 1SOMA 1Z0UA 4B4KA 3AJ8A 1JS1X 1LQ2A 4C0HA 1P60A 4CMJA 2LGJA 3IUQA 3PE4A 5CEFA 1G20E 5C8YB 5D3KA 4YA6A 5H9VA 1MEJA 2K4PA 2QTCA 3HU1A 1TO2E 4B6RA 2CJFA 3F7TA 4EW3A 1YAHA 1JAYA 2QMZA 2ZIFA 1OAOC 2ID4A 4GF5A 4KFRA 3O3NB 1KGDA 3GAAA 4JH0A 2ZS7A 1QHYA 2XVAA 4KMMA 3TIGA 2RGXA 1G8AA 3EEBA 3QVWA 3GVPA 1OE0A 4OHPA 4QATA 2A9JA 3AERB 3HVJA 1PFQA 5GINE 1C8VB 1T3QA 4LCEA 2G9NA 1NP7A 1JP7A 3RS7A 3FPCA 4WOKA 4L8GA 3VDXA 3P26A 5BRJA 1Y9AA 3RAEC 5JAOA 5FUWA 1BPEA 1U0OC 3NJRA 4KMRA 3N8DA 1Z45A 2Y1CA 4L72A 4NLKA 2VH5R 2EQBA 4FC7A 5CNKA 3PFNA 4F2RA 3OE5A 3SAHA 4ZDJA 4RTOA 1ZLYA 1Y34E 3ET4A 3IBYA 3RJJA 2IEIA 1JHRA 1H66A 2DFTA 4P4NA 4B7AA 2QG4A 4OHRA 5B5SA 5E9WA 2HBLA 4QWMA 2Z43A 3PYXA 3FNBA 3KUCA 1SC3A 1C7EA 4MW1A 5CJ2A 1ZNWA 3WNCA 4XGQA 3TI7A 4KDFA 2YJGA 2D0OB 2WJGA 3CVXA 1U8ZA 2NYRA 1A7UA 5DCYA 5BPCA 1J42A 1N75A 1GYPA 3AUFA 4QUEA 1DTEA 3SVTA 4QZDA 4UCFA 2J5KA 4C4RA 3RIMA 4UXIA 4J49A 2P4UA 3QKRB 2UVRA 2DQ4A 2WWGA 5IVDA 2J6CA 3LP8A 1J2YA 1UKZA 3GDGA 2GX6A 4FSDA 4LDJA 2PRSA 1K3FA 3B89A 3RFCA 4D9KA 4IC9A 3CLVA 2CNOA 1FDTA 1KPIA 2PAAA 2Z8XA 1ZGJA 4OM7A 2BW0A 3E9QA 2CDAA 4I6GA 3CZCA 1E8MA 1QGUB 3Q8QB 1N3BA 1GKLA 3ZWQA 5DYTA 1ONSA 4JLUA 3RT1A 4DXAA 1GAQA 1XF1A 2IU6A 3VPDA 2OOKA 4DL9A 3M9NB 4R1MA 5JASA 1XMSA 1PO7A 4US9A 2H2WA 4YBRA 1YU6A 4HI0E 5K3CA 5TS2A 1COWD 3SBOA 2JLVA 2CEKA 3G0HA 3J7AC 1KZGB 1OZHA 1NN5A 4C08A 2RRDA 2X42A 1V97A 4GXJA 4FMCF 1A3CA 5ALNA 2IPMA 2IYQA 4LWZA 3DXFA 1NNLA 2NMVA 5FAKA 3VR2D 1Q7GA 2E3JA 3PPYA 4JYCA 4Q19A 4ZA2A 4YRFA 2GTHA 2KS6A 3NDRA 2QN3A 4TV8B 1C9MA 5E6SB 1YOBA 1PDVA 4KWHA 4RJKA 5BN3A 3HCPA 4C7BA 3RF9A 1EB8A 2V6JA 2GF2A 1WF6A 4BLRA 5LMNB 2WJVA 4FFLA 4QZHA 3SN6A 4ESVA 3KE9A 3FDZB 4CKXA 5HKBA 4JLAA 2Y9PB 5FOWA 3W9BA 1TVKB 2AS0A 3FPHA 1NURA 2W6OA 3V8MA 4QJ4A 4A03A 2APJA 5ALTA 3BWBA 1PYOA 1M34B 3LF2A 1IOWA 4KSYA 3OSZA 4F8EA 4FR5A 1ZQZA 1W88B 4P81A 1OA1A 2HT1A 1TUBA 3IHKA 4C1NA 1RZRA 1AS3A 3GJ6A 5LQJA 3NALA 3OOHA 2LCQA 3LVQE 1DO8A 3PEFA 4Y98A 2C3MA 4AKHA 1PVOA 3T4UA 3FJ1A 1G2IA 1QG4A 4GDFA 2HMXA 4PHGA 4TYWA 2EP7A 4A91A 4MR9B 1Z5OA 2H6EA 5EIBD 3SPXA 1DQZA 1QMPA 5EL0A 4RUCA 2JIZA 2X3UA 4LSMA 4BLVA 4BRSA 4Y2XA 3G9TA 2REBA 3OX2A 5AWFC 4C87A 5DGAA 2BP7A 3DE0X 1UR5A 3B78A 4INAA 2OA0A 1UL1X 1K86A 2F90A 1V6CA 2E1FA 5H68A 4BAGA 3N2KA 2JATA 3OZIA 1U2GA 5DKFA 2FJ6A 5BPHA 1NA5A 2J3IA 1V38A 4DLGA 4EGCB 2Y9UA 2VBIA 3QEMB 1P4SA 4MO9A 1ZUNA 4G86A 4GQIA 5DN9A 2ZB2A 1FTWA 5KNCA 3LLSA 3RJTA 1SKRA 2EEPA 5FWXA 3SZRA 2JBWA 3VGJA 1P9WA 2IOYA 4EL5A 4C3ZA 4DBLE 1EKXA 1NUHA 3JQ7A 2CNBA 3QLVA 1F48A 4PE5B 5AK3A 1CB7A 2ZIAA 9ICPA 1TJ5A 2ZE7A 1E92A 2MR5A 3ZI4A 1RLJA 1ES9A 1G9TA 3DOCA 4YFVA 4LE0A 3VNQA 4YRPA 2R8RA 4UQPA 3SDSA 3CGGA 3CLRC 4N49A 2B1QA 2YRWA 2NN3C 4DPKA 1YZ7A 4KLJA 4RK6A 3BB1A 4S0XA 2VQ3A 1UA1A 3QEKA 2QLTA 1F2DA 2X3YA 3QELA 3SKYA 2WUEA 1GG5A 1H3EA 4I1VA 4TWRA 8MHTA 4Q43A 1VMKA 3WKBA 2XSZD 4YAIA 5JNVA 1U8YA 3AIKA 4NL9A 1ARZA 3VNSA 3HPOA 5FBZA 5DTIA 1N6IA 3FBGA 2RK6A 1PS0A 3WLPA 7ABPA 3I5XA 1BQ3A 5KFTA 2D1SA 2A9QA 3FOAA 2W9MA 3ND9A 1S5LU 5JW6A 1Z6ZA 3OQVA 3U7IA 4YR2A 3TPFA 5DNYB 4C0AC 4JV0A 4NLNA 2IEDA 1GKUB 1X0XA 1A9OA 3D1JA 4DIKA 4YY3B 1G9XA 1FU7A 4QQKA 4LSGA 3LAWA 5DOVA 3T5PA 1T1SA 2B99A 2RGYA 4HDSA 5J2DA 4EJSA 1XMXA 5L7TA 4CRXA 1EWTA 4X44A 4DXHA 1EXWA 2ZBPA 2ZAIA 5KG4A 2VT6A 3N8NA 3R0VA 1J56A 3D64A 3DJFA 5F3DA 5AW7A 1TEXA 3O94A 4FGKA 1Z82A 1TXGA 4NCHA 4Z1OA 1VLVA 3K1ZA 2Q1YA 3AUKA 3DHVA 3AH8A 2YCBA 2XD9A 4X7RA 2QGNA 3DVRX 2YHIA 2YZNA 1N2OA 5F7ZA 1DO0A 4JCOA 3TS1A 4DCGA 3CX4A 4JFAA 3WDMA 4DNFA 5LDGA 1AF7A 3M6LA 3H13A 3PEUA 2XRYA 4DSFA 1G5FA 3NKVA 3R0ZA 1DIAA 4YJGB 5IULC 2AYXA 1RHJA 5JD4A 3RBXA 2ZSHA 1Y82A 3NPMA 1XRMA 4QTUB 2DLNA 4RK4A 9LDBA 1RPNA 3E0XA 3GVCA 4JIGA 3EEQA 1N5LA 2VCEA 3C24A 1UAGA 4GSKA 5NLLA 3OU2A 4X7PA 3T3EA 3OFND 1BDHA 9ICGA 2QTAA 2GT1A 3WWDA 3W5BA 1K0FA 2QX8A 5CYPA 5WRFA 3KWJA 3U9LA 2QE7A 4C88A 1FXWF 1MEEA 1NJ1A 4FEGA 1W36B 4LHYA 2FUNB 4V2IA 3SOZA 1JPJA 3F6BX 3GAZA 4O3FA 1JH8A 1CUDA 1YVDA 4BNVA 2YWRA 1LPBB 1A2BA 3AXTA 3NTOA 2HXSA 5H83A 4XKJA 2WIBA 1AHHA 2Y93A 4FIDA 3H17A 4P08A 3LDHA 3R3JA 4RS4A 4Q93A 3DQPA 2Z2JA 3DOOA 3DTTA 4DC0A 1ISSA 3VX3A 2WVJA 1U9JA 1R12A 1I2BA 3E7FA 3M9XA 2X1MA 3CBGA 3DEZA 3KPWA 1XRPA 4RQBA 1Z0ZA 2HU8A 2WSSA 4RE5A 5E2AA 5JUMA 3VKUA 4PHEA 1TQ4A 5KNDA 1Q6ZA 3ZQ4A 4J16C 4OHWA 2PRKA 1U0SY 2NU8B 4BKOA 1S2LA 1UPHA 3WBKA 2NYAA 2QMQA 2IH4A 4WK4B 1CF4A 3NQ41 2OYCA 1U2PA 1YMVA 3OICA 3PIDA 4J3JA 4WI1A 5C3UA 3TW8A 5J23A 2WB2A 2WB1F 5J2BA 4X45A 1G5IA 2QM3A 2FWNA 1U0LA 4K8OA 4BO4A 1AUVA 4DSUA 2I9GA 2W2PA 3STYA 5KSZA 2Y71A 2VP5A 1QSGA 2CXQA 3F5FA 2ODGA 3QEOA 1CZRA 2BAGA 4LWPA 2QL6A 3RSHA 4YQEA 2MTBA 2ZWIA 3FPEA 2ZBRA 5K0NA 4UARA 2KNJA 1N62A 4HZUB 5CX4A 3UPDA 1GZ7A 3V7YA 1OUQA 1SUPA 2NGRA 3OX3A 2BFMA 1OROA 1QC5B 4B82A 4F8RA 1U98A 4QAQA 3TB6A 2W9XA 1WCXA 5F9MA 5THQA 1VCOA 2VDWA 3HADA 1IXKA 1JR3E 5JPCA 5D3ZA 1P4HA 4HB2A 2VA2A 3GLIE 3MRSA 2W83A 3INNA 4KMSA 4DF4A 4G5XA 5SY6A 3SHWA 3UB3A 1TDJA 3UJ6A 2XTJA 4EZIA 4LSWA 3EFHA 1IWOA 4TLEA 2JH1A 1F5NA 3JQ8A 2OC9A 2YJ5A 2IYTA 1T3SA 1PWZA 1UP6A 2HX1A 4LXTA 3MLAA 4BEWA 3ACBA 2ORYA 5I3ZA 1V48A 5BW5A 2XWPA 1DCKA 1HDEA 2ROQA 5IPFA 3WQRA 1G19A 2EZZA 2FH5B 3P9PA 4F6LA 1D6MA 1HXHA 1SVLA 1YRQA 2RHWA 4P5PA 1PTKA 3PUJA 1JI7A 4GP9A 3DKKA 4J0HA 4RD1A 4AG5A 3ZWBA 4O02B 4BQFA 4Q4JB 4DL7A 3KG2A 3K1JA 3R7LA 3B3FA 1TW2A 3D6HA 3MWEA 1TMOA 1PLJA 4KLIA 3RBVA 2PA3A 3WVNA 2OEPA 1C2YA 1E5QA 2ZJZA 3L6DA 3AETB 1JKJB 2RKBA 3GFOA 4OX9B 5H5JA 4PHCA 1P5FA 3W2GA 2II6A 1GXSA 3T5TA 3UAVA 3I53A 2VJPA 2P6RA 3L46A 2XUIA 2ZU6A 4KN7A 1COKA 3EAFA 3SBEA 5AVKA 3TLGB 3WNQA 1DGSA 3STTA 5A06A 2AN4A 4ZTZB 3HEAA 4WCFC 2ZFUA 1SUDA 2Q9BA 1P2UA 1QIJA 3CEHA 3LQKA 1PJQA 5EXDA 5LU9A 3ZK8A 1ECFA 3N2ZB 1V3UA 3EA5A 1JQ5A 3K1TA 2I6QA 2PO5A 1I7DA 2V96A 2CXHA 3JAWB 2HBMA 4KXUA 5G1PA 4EHKA 1XR3A 4I81A 4FWTA 2OH2A 1OT3A 3IT0A 5FNVB 1RYRA 1L4BA 3TTTA 2AHOB 4Q7QA 4DV1B 4BFXA 3CB4A 1ZR4A 1GG9A 4X9XA 1IUKA 4ZCMA 2D1QA 2C77A 3PF8A 5AK6A 3NHRA 5JH7B 2C22A 3HBNA 3WLAA 1LBEA 1S1CA 4IG9A 3IAAA 4LW8A 4ETMA 4GPBA 3J7TA 2VQEB 2L19A 4QXOA 1A71A 4AJHA 1XXLA 5DG7A 2XYGA 5KQRA 5F9NA 1YS1X 3A1UA 4KN9S 3UG7A 6CHYA 3VH1A 2P5UA 1GQYA 3O47A 4D1YA 1QHNA 4PHPA 1IQPA 1N5JA 4D96A 7ICFA 3P9RA 3KSDO 4AYWA 4LF9B 2H5LA 4YCDA 4BVAA 1XVTA 1ECJA 4U7DA 3VAZA 4Y1RB 4F6RB 5TXGA 2M9MA 4KBFA 3IODA 5ALWA 5EGNA 3FLEA 1UK8A 4HV4A 3JAWA 4AK9A 1UFQA 2BM0A 1IHUA 1UA0A 1JLSA 2ZJ1A 2HIMA 2ZBFA 3SHTA 4RTJA 2FPMA 1E2GA 2ADMA 1ADFA 1QGAA 1FX0A 3F6SA 2HAEA 1RADA 3L7MA 3OZDA 4JQCA 4F97A 1YDWA 4LYFA 2GZMA 2IYUA 3TVYA 4IS2A 3KAPA 4LF7B 3A3KA 3TAQA 4ZQCB 2X8JA 4JENA 1W34A 4NPCA 4JBIA 4HAYA 2G1PA 4ZZ0A 4GMDA 3Q9LA 2BIFA 1LA2A 1WBJB 3AP2A 5IVIA 3RO7A 1KQ3A 3FCEA 1RLUA 2J7KA 2Q4OA 2OB1A 1DT5A 4I2JA 5A4MS 1E3TA 4NBRA 1PX0A 3C0KA 3RUIA 4QW9A 5AW1A 1L7QA 4RQ7A 5EXPA 3VDMA 5BORA 5AP9A 4HL6A 2GD2A 1JX4A 5FO0A 2V58A 4KYIB 2Z8YA 4ER6A 3G5MA 5GIOE 2VAWA 4JC5A 3T0GA 4EO7A 3W6NA 3QG1A 1TLLA 1IJKA 2BFNA 2DJ5A 4DUZB 3VVMA 1Z4MA 4QFCA 4F3KA 2ECKA 3AF1A 3AC0A 3AYZB 3DDOA 3N2EA 4ZCQA 2ZK7A 5DWDA 1PNRA 5DHSA 5FORA 3IBGA 3HR4A 3OWOA 1PEDA 3REFA 1PNVA 3WQHA 3OPVA 3VBCA 2QTHA 4HY3A 4ZU1X 4DJDC 3D4OA 4JBGA 3HBFA 2XZLA 3C3JA 4R8UB 2QVZX 3L93A 2IDKA 2WVHA 4G56A 4RUAA 1QV7A 2BGNA 4LFCB 3R7WA 5L1MA 3D6AA 4PPQA 1TIBA 1TMGE 1KMNA 1EFUA 3PBKA 5A3RA 3ZX5A 2OB2A 1BX0A 5ALPA 4U2KA 4EJ0A 3TAUA 3AUJB 2Q21A 3W8EA 4QJ3A 5AVTA 5JLJA 2JARA 5K6RA 3C97A 4OY3A 1Z1VA 3QTLA 2YIDA 2H1CA 2CSXA 1WB5A 3T3MB 3SI8A 4MI9A 1EDZA 4QWBA 2WT8A 1UBSB 4FLMA 5C7LO 4I9NA 3LQRA 4RDCA 1YXMA 4IS3A 3ZWMA 421PA 3KQNA 1PVRA 5BT9A 1XXHA 2ECQA 2VHYA 1OU4A 1I4WA 1Q7BA 3EVZA 1WBBA 4A9AA 4PG4A 1ADGA 4NYIR 4OI1A 1X9IA 4GRAA 1XG5A 3HG7A 3PLRA 4Q1FA 5IIKA 521PA 5FA6A 3A58B 3GWGA 2IX9A 4H27A 4N5IX 4W7IA 1KI7A 1EGVB 1PVVA 4P35A 4X24A 2BR4A 4AD8A 1YA4A 4CLXA 3TLKA 3ZZ1A 3CPSA 2PT6A 1QRUA 2NO6A 1JZSA 1W0JA 4WOPA 3LUPA 1KYQA 1NU6A 3G9QA 3OZWA 4QWCA 5FD8A 4WINA 1VZ3A 3KLOA 3UXHA 4DYDA 5FOTA 2ZUSA 2E1RA 3LH5A 4BO2A 1O8BA 3ZVNA 4C80A 2A30A 3HHEA 3A4NA 1T1JA 1L1QA 1X8XA 2RH9B 4ACOA 1CRXA 2GZSA 3Q2OA 4G23A 2WTBA 4JQZA 4FUTA 4JGGA 4QTXA 5L4LA 2YJ4A 1ZMTA 2XMSA 3ETHA 4L73A 1D8LA 4WLEA 5B30A 4EWLA 2ESEA 5G4KA 5DLFA 5A9SB 5JYDA 4MX8A 4DCVA 2IS1A 2OILA 3SAFA 2PQ2A 3N8HA 1D4OA 4B45A 3O9MA 1V39A 4PXAA 1YQGA 3ZY2A 4B8ZA 4F72A 3NJ4A 2ZPAA 5HOEA 3ABRB 1OBHA 1YVRA 1J99A 3DLCA 2GAOA 2DFLA 1RXCA 1UWLA 1NLMA 2YVKA 1TJPB 3B1JA 3I9V6 1MB9A 3K31A 4GGMX 2X2FA 1BQEA 3IQGX 4OA5A 3IVMA 2CXTA 4RA6A 3VR6D 5KT7A 1LKYB 2G63A 5BMVF 3AEVA 3V55A 3GLFB 4DUYB 3KYIB 1FTNA 2JKYA 2JMGA 4UBLA 3T1TA 4DOCA 4K2HA 2QN1A 1B1AA 4AI6A 3MG9A 3FBWA 1PFKA 2QIOA 3E3NA 3K9WA 4XVRA 4TTTS 4EVQA 3ZWNA 3IHQB 2HRDA 2O8FA 4C0BA 3AEKB 1X8LA 4MHOA 4BO8A 4DSNA 4W6ZA 3M7IA 4B40A 4TMTA 1Z6YA 4ZKEA 1BYIA 1YNSA 3FHJA 3ZV4A 4QVKA 2OAP1 5KTQA 9LDTA 3KQLA 4MS3A 1KAEA 1T15A 1U81A 4FR2A 5KTYA 3DC2A 4B6JA 2YASA 3MCAA 1FFXB 1VBNA 4KQMA 4N7BA 5EE3A 4KLUA 1C81A 3GRCA 3GL9A 4OAOA 2D5BA 5A4DA 4JLWA 3RCBA 1GY8A 4K9LA 4E5KA 2W2VA 3ICWA 1NM5A 3UCFA 2HPVA 4PLTA 5SY4A 4O2RA 2KJ8A 3L0BA 4CL0A 1R4AA 1FFDA 3HRHA 3PENA 3QH4A 4D4KA 3R3VA 2XB4A 3PYLA 1YK1A 4IR1A 1HE1C 2EJVA 4J3FA 1ML4A 1UDRA 3M4YA 4O4LA 3ZVKA 2HO5A 4YUYA 4M6WB 5ALDA 4G0UA 3AUSA 1VG0B 4HMPA 5I7HA 5KWIA 3KTAA 4U2CA 2AX3A 2KICA 4MIKA 1EP3B 3NGXA 5DLYA 3TJRA 4OK3A 4W6QA 2NP6A 5FHRA 5FFFA 3HJEA 4Y18A 3FLAA 4Q4DA 5FPKA 1DC6A 1QJCA 1SG0A 1BHO1 3OPYI 2RHOA 2Z3ZA 5K0GA 3TOSA 2XBMA 4IIBA 3PX2A 4BO0A