1ZOLA

Native beta-pgm
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1zolA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zolA01
2WM8A 4HGRA 2YMLA 5E0OA 5AIBA 3EPRA 3ED5A 2FEAA 4PNHA 2YJ3A 3NRJA 2WF7A 3WGUA 3IJ5A 4CF5A 3ZW7A 1QQ6A 1NF2A 4CNQA 5AKEA 3OCXA 3KZXA 5AK3A 5AW6A 2I6XA 3N5KA 3E81A 1ZRMA 4Y2VA 1CR6A 2FUEA 4CE6A 3AR4A 5AVRA 3U19A 4I9GA 1VFPA 3FVVA 1RQLA 3R4CA 3L1VA 2ZOSA 2G07A 2P27A 3NALA 2GMWA 1Z4PX 2CFRA 4E88A 1ZRNA 4J03A 1Z4QA 5FP0A 3U7FB 1J97A 2PKEA 4UMFA 3FPBA 2ZBEA 5ALRA 4BEWA 1JUDA 3L8GA 4UM7A 5AW0A 5AKHA 4C4RA 1L8LA 2NYVA 3A1CA 3WK5A 3ONNA 1L8OA 3E8MA 1Z4IA 3U13A 3I76A 3B9BA 2R8YA 2B82A 4O8CA 4Y2XA 4Y2JA 3BWVA 3QUBA 2CFSA 3SF0A 3OTQA 5AW3A 4G9BA 1WR8A 2G1AA 2IOFA 4BX3A 3QU2A 1RPZA 4FYPA 2JGAA 2FPUA 5AI8A 4HGPA 3ESRA 3AR9A 2B8JA 2DQSA 2MSNA 5A3RA 5ALMA 4XQ0A 3W5AA 3L8EA 3ZWDA 4DWOA 1YNSA 1YDFA 3CNHA 2FPWA 4KX5A 3E58A 3KOOA 4YH1A 3QXGA 1ZD5A 4EZEA 3L1UA 4MUMA 2HOQA 3NIWA 2YJ5A 4L57A 1Z88A 3MC1A 5JJBA 3AR5A 3ET4A 1Q91A 4AP9A 5ALGA 4AS2A 3IRUA 3SLRA 1U02A 5AHXA 3ZTWA 3ZVLA 2GFHA 2P9JA 3L0BA 3ZTYA 2B0CA 1L7MA 3AR3A 4Y2QA 4HAIA 1RC8A 4UATA 3U7HB 1TA0A 1KYTA 2R8ZA 5ALVA 2OM6A 2I33A 4NV0A 3I6BA 1SWWA 3QU7A 2WF8A 3U7GA 2W43A 5ALYA 1Z4MA 2JAOA 3R9KA 3SHQA 4MWOA 5ALEA 5AVSA 2MU2A 1TJ4A 4ZEXA 1XP5A 2O9JA 3WK8A 1U7OA 3L0YA 3I28A 1U7PA 4UARA 3QLEA 3L5KA 3L7YA 3TLMA 3WK9A 5AW5A 2HSZA 3SKXA 3OCUA 4BX2A 3OCYA 5AM0A 4AS3A 1LVHA 3E84A 2OBBA 2FDRA 3IB6A 2NO5A 1EK1A 4CF4A 2C8LA 5AW7A 1L7OA 5A3QA 2C4NA 2GHTA 3KDPA 4KX3A 4UU0A 2O2XA 5IT4A 5AICA 4L6CA 5T41A 1Y8AA 3CZ4A 4IG4A 4XE5A 2VKQA 5AI6A 4Y3UA 1Z4OA 3WK4A 4UMEA 4YCMA 2QYHA 2BY4A 3EF0A 2G06A 5ALJA 2ZBGA 3AR2A 5AVVA 5AKJA 2IOHA 1QYIA 4RESA 4EELA 3DV9A 1WVIA 1QQ7A 4B6JA 3SD7A 1PW5A 2HX1A 3L8HA 2MU1A 4UAVA 2ZXEA 3B8EA 3N28A 1VJRA 5ALZA 2G80A 2I7DA 1QQ5A 4G63A 3QUTA 2G0AA 2FPXA 4HYTA 5ALQA 1T9ZA 4OCZA 1RKUA 4BYGA 5ALIA 1RRCA 2RB5A 3QX7A 4KNVA 1Z4KA 3WKDA 5AW9A 5AM4A 2ZBDA 2BDUA 2HF7A 1T5TA 3U7EB 3GYGA 4GIBA 5ALPA 4EENA 4YCLA 3N07A 3NAMA 1U2SA 5AVWA 3MMZA 3WKBA 1TE2A 4UAUA 5AKIA 2C9MA 3NUQA 4NWIA 2HI0A 3FZQA 2YMMA 2YJ6A 1FEZA 1U2TA 1Z4JA 5A3SA 2AGVA 4UW9A 3UMBA 2OA0A 1X42A 2EARA 2CN1A 3FGOA 3QU9A 3WGVA 2YJ4A 5AKXA 4Y2YA 2GO7A 2HHLA 1XPJA 2HDOA 1Q92A 3A3YA 2AMYA 2FPRA 3J7TA 4OD0A 2YMPA 5AKKA 2B8EA 1AQ6A 4JDPA 2ZG6A 3ZWKA 4OFZA 1ZD2P 3UMCA 3AR6A 2WHEA 4UMDA 5AM2A 4UASA 2HEGA 4RETA 1LTQA 3OCWA 5AVTA 3QUQA 1L6RA 2G09A 4C4SA 1Z4NA 3NANA 2FI1A 3M1YA 4Y2RA 4QJBA 4UU1A 4NAVA 4UMVA 3ZUPA 2HF2A 3WKCA 1N9KA 1RKQA 2AH5A 2R8XA 2YY6A 3QUCA 4BEVA 3L0CA 3ZI4A 4BKMA 1RMTA 3P96A 3WKAA 1NNLA 1NRWA 2Q4RA 1RLMA 4ZEVA 1YMQA 4QQFA 3PGVA 2BDEA 4YIHA 5AK6A 2WFAA 5AM3A 1VJ5A 1F5SA 1TJ3A 3VAYA 2I54A 3QYPA 2JAUA 2JAWA 5AI5A 3FPSA 5AW1A 2I55A 3W5BA 1IWOA 2PQ0A 4ZEWA 3B9RA 5AW4A 3KBBA 5AW8A 3MN1A 3AR7A 1ZS9A 2G08A 2W11A 4Y2SA 3S6JA 4C4TA 4H1WA 5AKZA 2W4MA 2OYCA 3OCZA 1EK2A 4F72A 2HCFA 5AIAA 4Y2UA 4XOUA 5AVZA 2NO4A 1YV9A 2RAVA 1S8OA 5AVYA 2YN4A 5ALLA 4BBJA 3L8FA 1ZOLA 4KN8A 1Z4LA 3EWIA 2EAUA 3ET5A 3FM9A 3ZX5A 5AI4A 3ZU6A 4EEKA 2B1QA 3A1DA 4GXTA 3QNMA 5AI0A 5ALSA 5ALNA 5AKGA 2IOFK 3BA6A 3WK6A 5ALXA 3WKEA 3R09A 3ESQA 3DNPA 4DW8A 2RBKA 2FPSA 2IYEA 3RFUA 4BNDA 4CF3A 4IFTA 5ALOA 1TJ5A 3OCVA 2P11A 3EF1A 2C8KA 5AVUA 3PGLA 1L7NA 1SU4A 3NASA 1ZD4A 3SMVA 3I1YA 1O08A 5AKYA 4EX7A 4BNDB 4FE3A 2FUCA 1J8DA 2D2VA 4NFLA 1QH9A 1RLOA 1RDFA 4Y2PA 1N8NA 2EATA 4HGOA 3QU5A 1RQNA 2PR7A 4OHFA 2ZBFA 3ZX4A 2GHQA 4Y2TA 5ALWA 4YCNA 1WPGA 2CFTA 3W5CA 3HLTA 2I34A 1Z5UA 1L7PA 1K1EA 5IT0A 2QLTA 4FFDA 2P69A 2WF5A 2R8EA 1YS9A 1Z5GA 3W5DA 4F71A 2RARA 3MPOA 2JARA 5ALUA 3A1EA 1RMYA 3UM9A 4YGYA 4BX0A 4DCCA 5AVXA 1ZD3A 3PDWA 3ZVMA 5AKLA 5AM1A 4EX6A 3PCTA 5ALHA 3AR8A 5AK4A 1O03A 5ALDA 5AESA 3F9RA 1MH9A 3RF6A 4UM5A 1XVIA 2X4DA 4XPZA 4HGNA 4HGQA 1WZCA 4JB3A 2B1RA 3WK7A 5AK5A 5ALKA 2WF6A 1RMQA 2ODAA 5ALFA 2C88A 2YBDA 4DFDA 3SKYA 2WF9A 2YMQA 3KC2A 3HYCA 5ALTA 2HO4A 1YJ5A 3N8GA 4NABA 4KYTA 5IS2A 1CQZA 3M9LA 1RKVA 2Q4TA 1T5SA 3UMGA 1SWVA 3KD3A 3DAOA 4L6AA 3QGMA 2Q5EA 3U26A 1S2OA 2YFYA 2B30A 2AUTA 4YIKA 2IA5A 3K1ZA 5AVQA 4I9FA 5AM5A 3DDHA 3OPXA 3D6JA 1ZJJA 4J2TA 1RLTA 3N1UA 4KNWA 5AW2A 3ZVNA 3QU4A 5AI9A
chains in the Genus database with same CATH superfamily
2ZU0C 1QGUA 4LBVA 2OSVA 4XTRA 3QVSA 2G63A 4BJHB 2C82A 2C2WA 1NN0A 3UWKA 4C7JA 4PVCA 1L8XA 4Y6QA 4P4GA 4LBWA 4UUOA 5J2DA 4P22A 4P2BA 3C23A 4AMUA 5C81A 5AOVA 5FWDA 2VYVD 3O74A 4QYSA 2GZ2A 5CLIA 2LPEA 1O9BA 4NXMB 3ZY3A 2EC5A 2VCHA 4ESOA 3KQUA 4RY9A 4EHDA 3LX5A 3HA3A 1ZR4A 1XQYA 2FF5A 1Z8HA 5DTRA 1WHTB 1FVFA 3HZZA 4G9BA 1WCWA 3IVCA 3AR9A 4FMDB 5CIWA 2VWPA 3PCRB 2MDTA 3NAGA 1KDVA 3L41A 3VOTA 3CNHA 2C9ZA 5DI3B 3PFKA 3C8UA 4B7CA 3EVFA 3B7PA 3D0OA 3NIWA 2A3VA 1SRQA 5JJ5A 3SYNA 5WRFA 4IICA 1Z36A 3H75A 1Z75A 2PXCA 4DWVA 4ED7A 3AEYA 4ILKA 3ECSA 2Q4OA 3HGMA 3KYDB 3HKEA 1UBTS 4MWDA 4N0EA 4W7SA 3VU9A 2BF4A 3Q9UA 3L0SA 4JJ6A 3RVPA 2X6TA 1AX9A 1RZ3A 4CMAA 4NV0A 3A70A 5CM2Z 3HBMA 4PYRA 5KC9A 2IYTA 1C3JA 1SZDA 4EI8A 3OUUA 2Y1LA 2GM3A 2X8AA 5ICMA 1A8PA 1SC4A 2C5EA 3B6KA 1QSLA 2XT6A 4NENA 3B2EA 5AJYA 2O8BA 1ZQTA 3U7QA 5EPEA 1TA9A 2EJVA 3WHIA 4ZI7F 4B87A 1OYWA 1XA4A 2JH9A 1PT9A 1N7HA 1R6TA 2AWNA 4CODB 1JH9A 4F9GA 2ZVQX 1ZD1A 2XKKA 3LO8A 1PFUA 2F17A 3ZLJA 2P3QA 3VYRB 1NMXA 1RKUA 5KU1A 4DOCA 1GKYA 4Y0AA 1BPEA 2W9MA 2IUUA 4S0XA 1U8AA 1RS0A 3U7EB 2VN8A 2J32A 3PZPA 1TD1A 2J4FA 2AKYA 1S1CA 3WRXA 1ETUA 3DE2X 1EFRD 2BAGA 1M2VB 4ZVUA 5L3ZA 5BRNA 1M2FA 5EGNA 5J5CA 4BMSA 3A2MA 2AMYA 2OQRA 2UVQA 3BCHA 1F44A 3RFVA 3G8DA 3GRUA 3WJ7A 1V96A 3AVXA 3F73A 2ATCA 3EVDA 2HJWA 3A37A 5FTMA 1OAOC 1I9GA 4R40A 3D4PA 1A1VA 1FFAA 4B76A 2HHQA 3JD0A 4X41A 5CB0A 3HC7A 3QFFA 3QYPA 2RDJA 1GPLA 1FTNA 1GVHA 4JUBA 1Z63A 3R1IA 3II6X 1GFIA 3PFNA 5EJFA 5KFJA 2KW5A 4U7GA 4ZT3A 2FW7A 1FUUA 4MDHA 4WL0A 2KFZA 2VLBA 4GXTA 1DP4A 2HSGA 3SFVA 1AZTA 3MFQA 3HS3A 5CMLA 1VXRA 4E33A 4BNDA 3ZZ0A 1JDTA 4TKUA 4MRRA 2A9VA 1NX9A 1PJ2A 1YZLA 4PNZA 3EQ6A 4RTRA 3NAQA 1H1LB 5DX0A 2B4TO 2PEZA 4AG6A 5DP2A 1ZIXA 3HFGA 1O5TA 4EUKA 1Y82A 1HURA 4BEBA 4I55B 1NK6A 4MAFA 1GSAA 3QXJA 2CSXA 4B35A 2AYYA 1KORA 2AOWA 4BX0A 3PHLA 3GZTB 1DIAA 3NDRA 5JLAA 4A0FA 1PRYA 3CT6A 5AK4A 2PIAA 1G9TA 1P4HA 4OL9A 4XPZA 2WAAA 3WK7A 2QLNA 4QXQA 1R4AA 2Q6KA 4KXXA 4AULA 1AXEA 2MCFA 1T6XA 4B9UA 3PEUA 3DZ8A 3T9EA 3STVA 2PU7A 2VDJA 4UQPA 5JWRA 2VH5R 2OBFA 3KS9A 4GXRA 3C6MA 4UVEA 3ZWYA 1N78A 1Z7YA 4PGAA 1XPRA 4J94A 5F4ZA 3LRXA 4MUHA 3ITKA 4ED3A 4MVXA 3GCGA 4E31A 1P9NA 4P4PA 3KZCA 2HCRA 1N7IA 1DKOA 3DKPA 4ZV7A 2ECPA 1VFPA 5M2QA 1UKBA 4PINA 4W5TA 1UPAA 1CY7A 4AJNA 4RHEA 1FSZA 3U49A 4FNOA 1Z16A 5J2CA 5DQHA 5ULLA 1NXWA 1WDLA 2KFNA 4YMLA 3NHKA 4D4GA 1QV7A 3HFJA 2W37A 3Q2KA 1XWLA 5CLFA 2EFEB 3CLTD 4FYPA 3JATA 3AUAA 4A36A 3OHAA 2E49A 4I2HA 2ZT7A 4JI6B 4UB2A 4BBAA 3S0JA 2W8KA 3TADC 3RYCB 3WL8A 3G0GA 4IEFB 4NS4A 2NVOA 3B6EA 1GPDG 5JANA 2VHUA 3Q8PB 3WSTA 1I6MA 4P93A 3A10A 3CMCO 3JVDA 3VH1A 5A02A 3HVUA 2EBWA 4LMAA 5JJIA 3OLCX 2H1IA 3JWHA 4IS3A 2I91A 4ZVQA 1U7OA 3L46A 3RSCA 1ISHA 1HOTA 5IIIA 1T0PA 1X8KA 3RAGA 3E84A 3IIKA 5CYPA 1NBEA 4MGIR 2W70A 3CF4G 2HLDA 1S96A 2VP4A 3EPKA 4X95A 1YQXA 4CRXA 1VIMA 4G1UC 3K8ZA 2IV2X 1T6NA 4C7ZA 5KFDA 4X8HA 2IZ1A 3QE4A 5KNDA 3H4DA 3K0CC 1GA4A 1ZUHA 4WZAB 2PXHA 3IKTA 4M1OA 2O8FB 2RGYA 2ZB8A 5TNXA 3NEYA 3T4EA 4QWAA 1BGXT 4HNQA 3P1JA 3IALA 1MDBA 4G0MA 4IDFA 1EK0A 4S35A 1C3XA 4IMPA 1E77A 5FI0B 3B7GA 1HDRA 4RPXA 2VEOA 3MTDA 4X6XA 1FEZA 1LKZA 5C5EA 1SHUX 1US8A 2KJ9A 1Y5MA 2HLNA 3MT0A 1DLIA 1SU8A 4L2IB 1V2HE 2ZIUA 3JPPA 3DOHA 2EJUA 2RKBA 1ISMA 7ICQA 2J9FA 4YMTA 4X1YB 4JYMA 2D6FA 3V4RA 4RM3A 2V4RA 4ZODA 5FWXB 5HJ7A 3ZUGA 3U62A 3GFGA 3NAZA 3A6JA 1WWVA 4RK6A 4J49A 4UTOA 5EIWA 1LFDB 4HYKA 3RS9A 1JILA 2YJTD 5AW4A 2OO5A 4WBNF 2QD5A 1Q77A 4TT8A 2BTQB 2CL0X 1CEEA 3TNJA 4K9RA 2HRRA 2YN4A 3OLZA 1F14A 2XC9A 2RGXA 4NE2A 2O5CA 3ZDBA 1S9FA 1P5ZB 4Q1BA 4DV4B 4IRXA 2AD5A 4EF6A 4EEKA 2N9UA 3SG0A 2H2AA 3AB8A 3K9QO 1CW2B 3NXSA 4NBNA 1WETA 1E8MA 1ZMTA 2O59A 1ATIA 4L7VA 4PC7A 5T8KA 3B53X 4P58A 5IN4A 3KBOA 4C78A 4Q3NA 1CUBA 1LX7A 5DISB 5BO5A 1Y4AE 3RAFC 1E6MA 4MQ4A 5ITWA 2FZKA 3FD8A 3AIOA 1YK1A 5CTJA 2ILVA 1EP3B 5FBQB 4CKWA 5CG1A 2HA5A 4TN1A 3W9SA 4L5YA 4Q9HA 3C5EA 5CM8B 4DIEA 2FZEA 3O91A 3SE7A 3UGKA 3CH5A 3A04A 3CF4A 1EUZA 4M60A 1Z1BA 4QTTB 1W0CA 3OZVA 5JARA 4P0PB 3BGSA 3BHJA 1A9YA 2IDJA 2OCXA 2DTXA 2FSSA 1UFKA 3E48A 3PFFA 2J09A 3MIIA 3CH7A 3PQEA 4YLGA 2CE7A 3IG8A 3Q8SB 1SUBA 3MF4A 4QFDA 4ARSA 3IBGA 3MJEA 3ZWVA 3NS1A 1WW3A 3KHUA 3NIBA 4HWGA 1JEQA 4N7JA 1P6QA 3L77A 3H5VA 4X8MA 2PRIA 3V4SA 3PPXA 1F7UA 2PFSA 2BPOA 1GRVA 1TADA 1SKMA 3L4JA 1VCMA 3EZYA 3MJRA 3DCIA 3IQXA 2BGWA 3ZJTA 2Y2VA 2ZBPA 2A0KA 5GIPE 1SKYB 3TLJA 3LY9A 2MR5A 5FUVA 1XRSB 4HDQB 4DILA 4MRAA 3FSGA 2W6PA 1SBHA 4KLZA 9ICCA 2FTKE 1YONA 1ZESA 3RC7A 3RVLA 3N7TA 3D3WA 3CF6R 4G4JA 5F64A 3IC5A 1DG9A 3EVZA 3H0CA 4C7OA 5K6AA 4R9VA 3S27A 4W7HA 2PGJA 2FPWA 5JZ9A 3ZI0A 1SVUA 4CKBA 1P72A 3NWEA 1M2OA 1A6SA 5H68A 3JTMA 4CQMA 3VZPA 5JI2E 1M1XB 4ZAZA 2O2HA 4K05A 4MRNA 3AR3A 3FXAA 4DLAA 1G21A 2BHSA 5ADHA 3I6BA 3PRKE 1GLVA 1U7HA 4LJ9A 1K89A 2HA0A 4LJSA 2NT4A 3Q85A 4L76A 4UBNA 4JVOA 1TDJA 5DBIA 2AFHE 3TN7A 4F5EA 1L4UA 2REOA 1EE1A 2GN0A 5KT3A 4CM8B 1I32A 2Y4OA 4K9SA 4CI0B 4QJ3A 3IOBA 4JASB 1OFHA 4L6IA 4UDOA 4RM2A 4I4TA 4EUSA 4W5HA 4A9AA 5IYZA 3STXA 1GADO 2GYWA 2XCPA 3JASA 2D4HA 1CUAA 4M0LA 4UMEA 3OE4A 4C21A 2PAFA 4RORA 2OR3A 3E18A 1EFVB 1JYEA 4KE7A 2FSGA 2XF8A 1C7EA 1NJ5A 5TRTA 4KXQA 2XGPA 1QYXA 5BN3A 1JWLA 1J1IA 4P6VF 4JLJA 4C1BA 5JD3A 3TIFA 3LA6A 3AVTA 5LP6C 3RUCA 1FZTA 5L9XA 4IF6A 1P8JA 3ROTA 2Z9CA 2ZPUA 3BD6A 2ZUFA 3R74A 3CXRA 3QHAA 2YINC 2BGTA 1Z0IA 1KIFA 1Q1ZA 1P7PA 5LIPA 4IRCA 2HDOA 2OC9A 4H7EA 3ST7A 1G6HA 1T1JA 3WMEA 4CV1A 1P77A 4HPXB 3EWNA 2YR0A 4ZGWA 2IK8A 1GCGA 1Z1VA 1OUMA 2KYRA 1RZRA 3PPVA 2WRZA 4DJEC 3TQQA 4CV3A 4MVJP 2ECKA 3J80A 4CT5A 4C0BA 1JKFA 1P45A 3W9UA 1AGYA 1JJFA 3NO4A 1KDPA 1V47A 4RS4A 1DBRA 4YONB 5AD1A 2D3DA 1A72A 5JECA 1T9DA 3EMVA 3MB8A 4PFSA 5ELXA 1YHNA 4TLLB 5FOTA 2BEVA 2J31A 2OHJA 4RMJA 3M5DA 4UDNA 3MDAA 3M4JA 2JAXA 4XWWA 5KL1B 1RYBA 3D6MA 2DUUA 1RQNA 3K1TA 4KFRA 2C5AA 5A7FA 3C3XA 4H08A 2O23A 4UD6A 3WNBA 2X6QA 3I04A 1ONSA 4A73A 5C52B 1DJLA 2JHGA 2P67A 5LP6F 2C59A 4FO6A 1Z5GA 1WU8A 1IJFA 5BVHA 2Z2ZA 1XBTA 4KQFA 2ONJA 4OQZA 3UYLA 3I32A 3BE5A 5D85A 5JDCA 2WJWA 4GXQA 4CEJA 1KDRA 3H2ZA 4DUGA 2YRXA 1YZHA 3LIPA 3E70C 4DDHA 3CA8A 5C35A 1MN8A 1SG6A 1N77A 1MABA 1WW2A 4HVTA 2VPXA 4FMCF 2IHNA 2GHRA 2XZLA 4TRRA 3DV0B 3OWXA 2ENWA 3LT4A 3AN1A 2QXTA 2C4HA 3RBEA 1GZVA 4GC6A 4BNYA 1WUKS 2YWRA 3MWLA 4WNAA 1YFZA 2DPLA 5AK3A 3KUUA 3AJ9A 4ZYLA 4UQLA 1IN6A 5AVRA 3R5HA 1MCZA 2P27A 4FWIB 4QVKA 3FI0A 5L6LB 3F8TA 4GI7A 5KPJA 1YVEI 3OX4A 3M6UA 4UM7A 4G5YA 4E0BA 2IX9A 1YJXA 4NICA 2GFQA 3WGIA 3G7NA 9ICNA 3L4EA 2EWWA 1WQ1R 3PKIA 3PUWA 1TT7A 4KVFA 5DWDA 5KVCA 2G9ZA 5HR7A 3COZA 4RKRA 2J5QA 1BRTA 4KQKA 3GGCA 2QEQA 2HV9A 3GWZA 3GPDG 2PH7A 2V96A 3WU2U 3DYBA 2C5GA 3SLRA 5A9TA 3ZWMA 1SV0A 4D9GA 5JD5A 2IHVA 1SEPA 1X7YA 2W0SA 4FYWA 4TZ6A 2HXSA 3MWDA 4PICA 4JVMA 4I9NA 4OIFA 3T7JA 2HLDD 5J0YA 3B5IA 4BO3A 2XVMA 2Q45A 4EJSA 2ZI5A 5EXDA 4ARCA 1TEVA 5F1OA 5H8WA 1ORVA 2AZXA 4OB6A 3N2IA 1EUCB 2VBCA 4JROA 5AW5A 4EBEA 4WADA 5KNDD 1MHTA 3CPEA 1L7OA 4Q4DA 1XZEA 3CH4B 4BFZA 2PK3A 1VCOA 4N9QA 4NATA 2XIJA 3WWDA 4HH4A 4MQLA 5FUMA 4UDYX 3WNCA 4JITA 5KOHA 5ES3A 4DADA 2GAOA 5CFPA 3KQVA 4TUYF 5KG4A 1RXIA 4R2LA 4P2GA 3GQBA 4EEYA 4IR9A 2ZYGA 2OD2A 3DVAA 3HXMA 1QS0B 1YAHA 3QE3A 4RQTA 2XBMA 3VYUB 1Y5IA 2IEIA 3RTEA 3I5AA 1ZGBA 3TLGB 3IKMB 2PS9A 2QLJA 5JQGF 2DHEA 4B8ZA 1WL8A 3DBRA 3TJMA 4D3ZA 1P6XA 1K8XB 3CTMA 1OAKA 3CVYA 3GJYA 3NDBB 4KKVA 3SHWA 4MAMA 3K4QA 3QKUA 1Z2CA 2BFDA 1CKEA 3CUVA 5ERYA 4QO8A 2PXXA 2QZ9A 5LYJA 2ZB2A 4QEZA 3C29A 3UJ6A 1QIJA 2CUNA 2CZGA 2LHTA 2XY7A 2W2XA 1J25A 4MS3A 4Q4HA 3RI3A 1Y37A 4KLEA 5FJJA 4L4UA 4RZHA 3LVBA 2PV0A 5KG1A 3I72A 3SICE 1THMA 3GC6A 2O20A 4FINA 3GP5A 2CNKA 2A5GA 1VKRA 3PUYA 1V7QA 3GZNA 4XQEA 4FYXA 4DM3A 3TARA 3NWPA 2RHRA 3HJAA 1P73A 3CUTA 4KR7A 3V8PA 4BMDA 4DNOA 5DG7A 1CY8A 2YW9A 3CZPA 1F2TB 3RADC 3F96A 3KOUA 2IVFA 3WYGA 2IOFK 4KLHA 3HUTA 3T5LA 4F4ZA 1K8YB 2E3JA 1WZUA 1JIIA 1RFGE 3AHDA 3WWCA 1GL3A 3BF7A 3DBHB 4KQEA 3CEHA 1M0WA 1TVAA 4IXNA 4HATA 4WMLA 3VXKA 1RWMA 3W8NA 4AY6A 2CHQA 4CQNA 1RRFA 3M5PA 2QT1A 5A06A 3ZZUA 2LYAA 2HL6A 2BFFB 4BNUA 2AR7A 3I5UA 1AQYA 2QR5A 1T0IA 5HKBA 4LF8B 1J09A 4TKLA 1YJAA 2PAAA 3J81j 4H4DA 3ZIUA 1E2FA 5BN4B 3KR2A 2QX8A 4DJTA 2OWDA 3TDKA 1PR1A 3C4VA 5EWEA 1VPLA 1CDEA 1XUOA 4ECTA 3V33A 4BEJA 1NVFA 2ZSDA 2CB9A 2G4CA 3PC2A 4C03A 4LXQA 3A7DA 3U26A 4WK2B 1K97A 2VT3A 5AVQA 4OMCA 2IEGA 4L8GA 4F9FA 1BHO1 1BE1A 1JA1A 1TKBA 5C53B 1UFOA 2XMSA 4MYRA 3WRVA 2QTVA 2HUPA 3SWWA 4ID9A 4C7KA 3N59A 1QRSA 4ALMA 2BFMA 1K08A 3N6RA 1ECPA 3FSGD 3FVWA 3WY9A 2RKWA 4YFKA 2O14A 4E32A 1VYHA 4E88A 3FOBA 1UM9B 1MP0A 1N8KA 1P1HA 4NNJA 4C0AC 3EISA 4P3XA 2EJTA 1NUUA 3FOAA 5DRYA 5H80A 1XMSA 5HOEA 2ZIGA 7ICUA 2W58A 3STHA 1GG2A 1OZAA 1XZCA 1XXHA 3ZGXA 4R54A 2FSFA 4CQMD 2NP7A 1K5GA 9ICLA 2I1VB 4MCJA 3PNQA 4ARZA 3EC2A 2P77A 1M6HA 4JL5A 3F2VA 5EWGA 3ZK9A 5EZSA 3WLPA 4G0UA 1NZDA 2GVNA 3RIYA 4QTZA 3KQTA 5CH3A 2QK4A 4DLSA 1AGNA 4ZCTA 3H1TA 4D82A 3K9GA 2V58A 5BNIA 3PEYA 4Y2QA 1YT3A 4ZOLB 1RXSA 1BW9B 3UGQA 4LC0A 4DMHA 2Q9CA 3M82A 3C45A 4UNSA 1FSGA 3ROGA 1A9OA 2GEJA 2VXBA 1JH8A 5B55A 1HSZA 4V0SA 3OZRA 4O4LA 4PGHA 3T4UA 5EHXA 2P65A 3F7MA 1YTLA 2WPDA 2Y1JA 2ECOA 3IDOA 5B2FA 3VBCA 2BN4A 1PFKA 2G67A 5FTNA 2XNHA 2FHPA 2Y3IA 4YRAA 3HCOA 4Q45A 2HNAA 4CKXA 8ICBA 4R3NA 4FSHA 1SBNE 2IDMA 4AN1A 5I4IA 3PT5A 1NRIA 3BTOA 1X94A 3Q41A 1T6YA 4FDMA 2KE5A 3AY0A 1RJ9B 1SELA 4F4FA 2AOTB 1Z3IX 1CEZA 3BSWA 3FKQA 1CUWA 5E9JA 2GAJA 1TQ2A 3N07A 2XWBF 3ZVRA 1UJ6A 3ODPA 4QUBA 3KD2A 1KHTA 4NJ8A 3RKUA 2WJZB 3RVDA 2VZEA 1E62A 2H4FA 1QXSA 1DXOA 2HWKA 3D1LA 3DZHA 1RZRD 4I2DA 1XKXA 4RA9B 3UHPA 2X7HA 4MKZA 1PWEA 3H4VA 3WIBA 5IAKA 2HA2A 3QV2A 3OECA 4IRMA 3GFBA 5I01A 4OFZA 1U48A 2QLBA 4PYMA 1GCAA 3B89A 1RG6A 1DPFA 2M9MA 2LDXA 2ZJAA 3GLTA 3FDZB 3HZOA 2GXAA 1N3BA 4ZMBA 4PHCA 4X92A 1D2NA 4XVUA 2I7CA 4GX5A 3V72A 7MHTA 4PC2A 2DECA 4M9RA 3RT7A 2XLCA 1F5SA 3UGTA 3TAPA 3PVCA 3GLHA 5GZ3A 5H3CA 2H0QA 7AT1A 2ZBVA 2C4TA 3GT3A 1YGYA 4RIHA 3OPYB 4B80A 3I4FA 2ZJ0A 3GMTA 4OLJA 3ZY6A 5EJAA 1TL7C 2X4IA 1Q0PA 5IKPA 3MJVA 4X5OA 4FP9A 3PNLA 4KUGA 4DLKA 2NYUA 2KPOA 1MW8X 1XNSA 3CCBA 3I2HA 3GVIA 2VZ9A 4ZKEA 4ECVA 4WBSA 1GAJA 1RE0A 2G1UA 3K09A 4TRMA 4RY0A 4UM9B 4L74A 2ISOA 1JR4A 4DUGD 3C6XA 2DPIA 2GZMA 3AF1A 3CN9A 3C6BA 1YQWA 2WWXA 3BL6A 4CEIB 3EC1A 5KG2A 1MAAA 4QIHA 4AJKA 1KPGA 3WDLA 1MO5A 3T9CA 1FYDA 1P0FA 3P0HA 2DWCA 3HR7A 1TECE 5JZMA 2W9BA 5IAAA 1ZFNA 1UK9A 3R5TA 7REQA 3UMSA 4MUXA 3AFGA 4DNQA 4IILA 3O8OB 3IQIX 3G1UA 3PQ2A 1SQFA 4OH1A 3ETCA 2NX2A 3DLHA 3EAFA 3QIAA 3EDCA 2CL5A 1XLTA 3AXTA 2GETA 1NOMA 5C8YB 1W9HA 4WZBB 8ICSA 4XB6B 2PLWA 1Q57A 5HZMA 3T61A 3FMVA 4L73A 3U19A 5DQGA 1T5BA 3A0RB 3D8TA 5KG5A 1DU4A 2IFTA 4QECA 4CMCA 3B9JA 4F5WA 3KEQA 2OZPA 4LV8B 1HKUA 4CCAA 3KSRA 5DEOA 1XTIA 3L4BA 3NHJA 4F45A 3ONNA 1N1EA 4BLWA 7ICEA 2P1ZA 4PGMA 4ELTA 3R4VA 2K2QB 3QU2A 4MRSA 1Y8QA 3FI9A 2WNSA 1MO4A 1ZI9A 5HUJA 2O48X 3OAAD 4DREA 4EIWA 4R2XA 2X2EA 5JSQA 1Y1LA 3H9GA 1LCIA 2Q1XA 2B92A 4Y6GB 3R9IA 4YP0A 1RM3A 3F6PA 4ENSA 1JU3A 3WB1A 4CLHA 3JQ7B 3RJHA 3VNBA 4IV5A 1E2LA 3CO5A 3HKBA 3GILA 3PR2B 2UXCB 2R6R1 2G40A 3JVVA 3U37A 2B4AA 2GM5A 3HKDB 5K6RA 3K70C 2ZLBA 3HT3A 2ZCJA 3O38A 1J70A 2Z2XA 1D9ZA 5GV8A 8ICJA 1WRBA 2GHTA 3R0JA 3M70A 3VR6H 3U9TA 4R8RA 2ATLA 2WHRA 3ZZTA 3K2EA 2ZTMA 3BKXA 5CEJA 2FQYA 2RJOA 5CDYA 2UYOA 4O4HA 1REQA 3ZXYA 2YFHA 3H2IA 2I7DA 1WXXA 2OAEA 2YHAA 4HNUA 2AZMA 4MA0A 4HWKA 2B7LA 2VPPA 4NLNA 1I3NA 2HF7A 4I5GA 3WVNA 2J3QA 3UFXA 3LQQA 3ZV7A 3KKKA 5K0BA 2JATA 1OIWA 2X1LA 4Z8XA 3HX0A 2WY2D 2C7VA 3VZQA 1S2GA 2YYSA 2PX2A 1PR4A 2CK3D 1Q92A 1AH2A 1H2EA 1XCMA 3PJDA 5BOSA 2IUFA 4HX9A 4WNIA 1ZQYA 1W93A 2BQUA 1HY3A 4L28A 2F7SA 4AI6A 1FXWA 2H2DA 1YB2A 2GLUA 2FK7A 2ZM5A 3CNBA 2YZ2A 4DV1B 5ENVA 5AH0A 4YQEA 2YWDA 2XW6A 1Q7GA 3LKZA 5BWNA 4PRYA 4W5OA 1QORA 2GD2A 4C4TA 4JHLA 3HSSA 2KKPA 1N6RA 1IVSA 3VZSA 2VAMA 2V0NA 5KWIA 3MMNA 1NR1A 4J2OA 3CVWA 2ZWAA 2JR5A 3I3SR 3BK7A 4EGJA 4LDNA 3RSOA 2Q3BA 5JS8A 4YJ2B 1SL2A 4M86A 3CY6A 1A4UA 1E3WA 4Y1FA 2FE1A 3IULA 5C18A 3JTEA 3OIDA 4JEHA 2JZBA 2BGJA 1DCMA 3L7DA 5B66U 2Q3MA 1EJ2A 1DADA 3SHOA 1TRHA 5J0TA 4MPTA 3Q3CA 4RD2A 3QBTA 1G2PA 1ZQAA 1KZ9A 3EIWA 3F9RA 2BEUB 1L5UA 3TQ1A 3FVQA 5A2QA 4ZCRA 5H0IA 2WWYA 2ASLA 4CF6A 3F6RA 3PFGA 2NUPB 1FTGA 3IDFA 3K94A 5KWJA 4EPWA 2G25A 5LP1A 5I7AA 3RTGA 3COYA 2V9WA 1I3MA 5JWHA 2YQ5A 1FVOA 3MD0A 4B73A 3MHPA 2XIQA 5DZSA 1ZGCA 4GFDA 3RFXA 3V4VB 3HG7A 5EA2A 3OF3A 2V45A 5AKEA 3VVBA 2JKYA 4JV1A 2OVFA 4FSXA 5F51A 4E12A 4CTKA 2H06A 3K5PA 1R1DA 3DTYA 4BRWA 5JYBA 4HL6A 4IH9A 4RPGA 5KFWA 3A1FA 3I0MA 1YS1X 2X2PA 4L78A 2EFGA 3TVTA 3R3JA 4FYVA 4OOEA 4D43A 4QTUB 5DYYA 5CB8A 1EDOA 4M6WB 3NBMA 2GAAA 3HTXA 4HEA6 3IUSA 3H7IA 1V3TA 1NF9A 4DLVA 2UZAA 2BFBB 3OJCA 4LTMA 2Q21A 2IZ5A 2ID4A 2J0UA 3BMCB 2DPHA 3ZTWA 2V7BA 2COUA 1K3FA 3NWOA 4GP7A 5KREA 2BH9A 2MSLA 3IGFA 3D54D 1E6UA 4B8YA 2B0JA 4MITA 2J08A 4MIEA 1Q50A 3IXQA 9ICHA 4NU8X 5I47A 1EQUA 4LYHA 3W2HA 1JQBA 4AU1A 5E2IA 5K03A 1HRDA 1GN8A 4D57A 2OBBA 3RQSA 1TKDA 4OGGA 1C8LA 4Q9KA 1EFDN 4XDZA 1QJ4A 1SIWA 1LPOA 3H0KA 3Q10A 4WKGA 3DFMA 1MT3A 4IFEA 4H60A 2WHXA 3IE1A 2LYBA 3Q88A 4KLQA 1G5PA 4GPIB 1DAHA 1XMVA 2QZPA 5E8RA 2BR3A 1XCGB 3KJEA 4HI0E 1V1RB 5H1YA 5BR4A 4HYTA 1T9ZA 1XELA 1Y3AA 4RD0A 4H7JA 3NVKI 4K6GA 4G86A 1TB4A 4XRRA 2YXEA 4LE1A 2R4QA 3FZYA 5AVWA 3HLYA 4CKYA 4BQIA 1ZI6A 4N5MA 2CMHA 4LJ6A 1IBKB 5BOLA 3MSXA 1FQKA 4WKBA 2XUAA 2C5FA 1AMOA 3EJ6A 2C2KA 2KQUA 2HBZA 4JQCA 2ZREA 3RYIA 3RVSA 2ZE7A 3HO8A 2VWGA 1Z45A 3MRTA 4YHHB 1SC1A 1WMBA 4DC9A 1TUGA 4IFBA 1QRDA 4B3IA 4F4CA 1S76D 2NO1A 5JD4A 2XKAA 3SIPA 3PNPA 3GZFA 3SS8A 4I1UA 4PQRA 2FN8A 4H35A 4QU8A 4GBED 2PWBA 4Q4AA 2B6HA 4Q8FA 1T0HB 1QHEA 4QREA 4AKIA 4DUZB 4A2PA 2HTFA 1H42A 4AC9A 4E13A 1CJKC 1L5ZA 2XDWA 4ISCA 5L4LA 3T5GA 4XGIA 3W04A 4XJXA 3DE4X 4QYWA 1XRPA 1IZZA 4MMYB 4HDNA 3NCTA 1HMPA 2IYYA 3M33A 1N8TA 1QGED 3QJYA 3ESQA 1BKSB 3QM1A 4NDNE 1A1SA 1N62A 2OLJA 4MWTA 1DVRA 4BGEA 4P4UA 2DPJA 2XUJA 3IP9A 1SB3C 1HYEA 1YBFA 2HWYA 2YV5A 4EPRA 4Y6OA 1UJCA 2VAPA 3QWHA 1HDYA 1PR3A 2BI7A 2P69A 3GJTA 5EMJA 2FDCA 2IE0A 2Z1NA 3CRXA 1KGDA 4P7JA 4OHOA 4X7BA 3GUYA 3RS2A 4I50F 1EVQA 4UTVA 1RHJA 1XZQA 3FNIA 1O03A 1VJ1A 1J0EA 4R1PA 3IQEA 3F6EX 3O8RA 1ODFA 4PYLA 4NYJQ 4YN4A 4YA6A 4PRZA 4MHVA 3SNKA 2J9GA 4JYBA 5JFOA 3HYNA 2R8KA 1XNGA 2C1XA 5DF1A 3X1YA 1XPOA 2ZYSA 4I66A 5IEJA 4MTLA 3LUGA 1NW5A 4RZXA 1QKKA 3OQJA 4D97A 2DE0X 3S2EA 4C0LA 2YMLA 2W9CB 1LV8A 4X20A 1RQXA 1M7BA 2GS9A 1QSGA 2C83A 4UBKA 4YUXA 3EPJA 1JYSA 1W59A 1T3QA 1G1MA 3INRA 4Y2VA 4EHKA 1L5QA 1GCUA 1OYYA 4XR4A 2PGNA 2W9XA 3ZWPA 1VGRA 1T24A 4RQUA 5K9ZA 3FFTA 2O0HA 2ZRMA 3NM4A 5TQ0B 3B9PA 1EHIA 3DKKA 3T41A 2P9FA 5HILA 3LBYA 1Z0DA 1B3RA 4CL8A 5I5EA 1NJYA 3A14A 3CKYA 5C4IA 3QXGA 3L1UA 5D1HA 4E07A 3MBKA 2GN1A 3V7WA 2C2HA 3QH4A 3KXDA 4RQAA 4AP9A 5ALGA 1SURA 3G6KA 5EZYF 3DW1X 3IYLW 1ZIDA 3DZIA 3BBLA 3M3DA 1B23P 3N76A 1LPPA 3LHKA 3SPXA 1L7VC 2H3QA 2O6KA 4UNIA 5EJ5A 3M5CA 3M83A 3PE6A 1BVHA 2O2EA 3L3BA 3MUNA 5I9LA 2Q6LA 4I7EA 3ZCUA 5BT9A 5IVIA 2UUCB 5JBQA 4GGOA 4QPDA 1WW8A 5KT2A 2XLBA 4GHWA 1LKYB 1EK1A 2XTNA 4OHCA 3M4NA 2X0IA 1Q7RA 1U0BB 1N2BA 5KI6A 4W8GA 1G7TA 4H3HB 2V8OA 4L0DA 2PANA 3ROKA 3Q3HA 2Z6AA 5JY1A 3R76A 2PWPA 4B3RB 1ZWLA 3MUFA 4GQAA 2VTEA 3VR5A 3FDIA 4DIUA 1RRCA 4YR9A 5JHHB 5GGYA 3WOVA 1I6LA 4MWGA 3FR7A 1JHXA 2FWRA 2ZRIA 1FFVA 3KQNA 4IJUA 5AUOB 1HT0A 2FPMA 4Q43A 1OVMA 5ICSA 4JYPA 2C7PA 4FX5A 2OGUA 5FH9A 3IEIA 2Q6TA 3ZYCA 4YTEA 4YT2A 4V1CA 4QOEA 2IPNA 3WS7A 3QUQA 1I5RA 4R98A 3HKCB 1AC5A 1E0SA 1E94E 1M6VA 4BE9A 2FZCA 2AI2A 4G8DA 4BFXA 2EJWA 2HN9A 4OLBA 1NIPA 4GPAA 3DL0A 1NI4A 4I1PA 4C43A 4LWQA 4WBXC 2I54A 1YF3A 1O4VA 4R64A 4AJ1A 2XJ4A 3TR5A 5HF9A 4DDTA 4EGAA 1KIMA 4UBMA 5C5DA 4L5AA 2QLMA 4NLCA 1BX3A 3GD7A 2ZYAA 5JSYA 2CVPA 2IOQA 1SU6A 3O4HA 3SZMA 5JQWA 2VNAA 2G5TA 2OBLA 2R8PA 4QXAA 1QRUA 2P11A 4DFMA 1CSEE 4DA8A 3MZ0A 2GVZC 1YB6A 3ADPA 1WVMA 2GYVA 4JBLA 2C3UA 1UUFA 1XB2A 5IIKA 3CP8A 3H87A 1SJ9A 1GPKA 3EYZA 3P20A 3ELWA 4R1QA 5TVGA 3GT4A 4WKPA 2QMOA 3UM9A 4F86A 3DKIA 3R6LA 1Z5VA 4F5PA 2B8TA 2IKQA 3QHPA 3Q98A 3Q8XB 4YP1A 2XVXA 2JJ1A 3FNHA 3E05A 5G53C 1KK1A 4P53A 3ROMA 4RPZA 1XEAA 2ZCVA 4KYTA 3M9LA 5K3DA 1S77D 4AJIA 5CU7A 1IHYA 2PLRA 3A4IA 4B3TB 1UBKS 5JOQA 1Z5NA 2AYXA 3RS0A 2K4EA 2HIMA 2VHQA 5CG2A 3IBSA 3Q1LA 5AIBA 1E1MA 1FDWA 3T1NA 1SZHA 1U9ZA 1USWA 1V39A 1SXJA 5BSEA 2PFGA 5DRTA 2O1XA 4G36A 3H84A 4DRYA 4F4DA 3I9MA 3QZ7A 1AJEA 1L3BA 3TFQA 2JFFA 1P7WA 4MYDA 4CIBA 3HNOA 4X84A 2QARA 1ORTA 3I1IA 1KGSA 4PXYA 4NBUA 4MARA 3TL6A 2RGBA 1F0MA 3RTAA 4O3SA 4Y2XA 5CA0B 4HUQB 1CUHA 1DOZA 1WR8A 3OT5A 1ILWA 3VBEA 2DPMA 1MG5A 2FLNA 1S6YA 4RUCA 1KI9A 5J4YA 2Q0QA 1LBHA 3C14C 4G2NA 4KAXA 2Z57A 3DEEA 2XMDA 3RYFA 1J4AA 1XJWA 1YR2A 4U5XA 5CIYA 4PR3A 2FZGA 1CUEA 1WBBA 4CTMA 3CLUD 3PF8A 2JLXA 4IGEA 2K7FA 3Q3EA 5IJ9A 1SZCA 5LNK6 5ALVA 2JS7A 5GONB 1FLNA 3V8EA 4X1OA 5HQTA 2XUFA 3L0YA 5IINA 4LY0A 1M83A 2Q29A 2ZR0A 2VQ3A 5K4GA 4RQ0A 5TQ2A 3T7IA 2RK3A 3MINA 1UH5A 1C9MA 2AG5A 2AA3A 1YBVA 3FPFA 3LK7A 2UUOA 2QXUA 2IXAA 1QP7A 2J9XB 3O92A 4UTXA 2FGKA 4WDRA 5J63A 4AG3A 3MJDA 3SLKA 5J23A 3KSZO 1JTEA 3GLGB 4UTRA 4PS1A 4ED1A 4DV6B 3AM4A 2XADA 4AJOA 1KNQA 2ES4A 2X86A 4ADSG 1WXWA 3GRCA 3TE6A 4J29A 1QF7A 4Y1RB 3V8MA 2XQKA 5IHXA 2C2MA 3BZBA 4IHJF 2QJTA 3I8OA 2CVZA 1JV2B 1AS0A 1U3WA 3PV0A 4PHEA 1Q1AA 4NOKA 1YUNA 4NPCA 5DGCA 1R9NA 5DBCA 5A3SA 1DDGA 4BWYA 3DF9A 4TUQA 3H9JA 5JMTA 4HZUA 4YJ3A 1XPJA 4JBXA 3MM4A 4JWMA 5C5IA 3CW8X 3HDTA 4NDAA 1SXQA 4WWHA 3L6DA 5DK4A 5K3CA 3WNZA 3BRQA 4AZ0A 3SEIA 1DKRA 1C3EA 3KR9A 2YY6A 3IXMA 3ZI4A 5HFAA 4DSJA 4IOJA 4K9QA 1XZMA 1IM4A 4AY3A 4GKBA 1F8YA 5ITZA 1DX9A 1V48A 1SCNE 1EESA 3RRGA 4KLTA 3IFSA 1BEUB 1ZEJA 2W4MA 4F72A 4RGQA 5D8DA 3EIFA 4TXHA 4GC5A 4G24A 1A0PA 1E7SA 2PMZC 5AWFC 1RW4A 1M34B 2WTMA 3X1MA 5CR9A 2DSNA 4GBGA 1O96A 3ONFA 2X77A 1JIVA 2JGEA 2YXNA 3CXUA 4LGYA 4B6SA 4KH1A 2D62A 2AZ4A 3B6JA 2RDIA 1PZNA 2ACKA 3CJRA 1R3UA 2RHHA 1RDFA 5AYVA 2XD4A 1GPYA 1IV8A 5HJ2A 1FC0A 2HTEA 5GJCA 4XSHA 2RGRA 1FIQA 2IF2A 4ZAWA 2CFTA 4IMIB 2GVDC 3M9OB 2QTMA 4F71A 5IJXA 3K32A 5GAJA 3ZVMA 4QL3A 3VKHA 5A0TA 4CU2A 5IARA 3AR8A 4O4JF 4GUDA 1QOZA 4EHAA 5FAXA 3VX4A 3GGDA 1DOQA 5LWHA 5EWJA 5EXSA 2A88A 1ZXIA 3LQKA 3DZDA 4YFVA 3IDSA 2EZYA 3BFJA 3VH4A 2NTEA 1KO4A 4I9FA 3QBJA 3WADA 1PZHA 5IT9A 5FPYA 1FUYB 3AI2A 2VFAA 1DIGA 1RPAA 3R41A 5D6OA 4EARA 2X0NA 5EKDA 2QQGA 4AWAA 2H1OA 3BXEA 1UOEA 1QLHA 1V37A 1WNTA 2AQHA 5DCUA 5DNAA 4KPEC 3B70A 2JGKA 1UJ4A 4XVHA 1S0UA 2OKGA 3WQHA 1R6UA 1D1PA 2C0CA 4C20A 2PMZF 2H57A 1PVPA 3OOSA 3QVWA 4EHHA 4AYBF 5J8YA 1TTTA 3RU7A 2YVAA 4YV1A 5I51A 3HNRA 3PKJA 4Q15A 2BPGA 4IIHA 4L4RA 2IITA 2FMXA 1FFUA 3EYWA 1XRNA 3PL1A 3HRIA 3C2LA 2FSVA 5KDOA 4Q37A 1KEZA 3C41J 3F49S 5LOVA 5EXEA 4FGSA 1M2NA 5BR8B 1JDPA 4PLHA 1RZTA 4W8OA 1EJ0A 4PG4A 4YUYA 4JI1B 3BICA 1O7JA 3CNNA 3VPDA 4I36A 4RV4A 5J1TB 2XMQA 3AT1A 3IEKA 2WJAA 3ETLA 2DWUA 2AFIB 4P0TA 3KEGA 4OAOA 1JSZA 4B44A 4X00A 3TSAA 4F3TA 1WHSA 1YRWA 3VR5D 4GECA 1EVLA 1X13A 3GPCA 3CBGA 1GARA 1D7AA 4G0ZA 1KFTA 1CU1A 1Z2PX 1R0LA 3LL4A 4DV3B 1BS1A 3L6RA 1GR1A 4JUZA 1QQAA 1QCZA 4AMZA 3AW8A 4PHAA 1J5PA 3O1JC 2AZDA 3KKMA 2ANBA 1VHDA 3PX4A 1QIEA 3IE2A 3CGGA 4CJXA 4OGFA 1FP4A 3FNBA 4IS7A 4J2HA 4V3BA 4DCOA 2Q6OA 1DOAA 3TRFA 4XIJA 4MROA 4YMWA 3RABA 3NKLA 4HYQA 1U2SA 2DY0A 4MQEA 4JEUA 3WKBA 4BV3A 3STUA 2YVLA 2NU7A 2GN8A 4XIIA 3O4RA 4RL4A 2P30A 1P1KA 1T1IA 2FX5A 4ACAA 1CVIA 2W6OA 3QLVA 1JIHA 3GR6A 4M47A 2ISSD 3V7NA 3NHRA 1LXCA 2I2WA 2KI5A 3C48A 4O4IF 4CMIA 2JJQA 1G63A 3N7AA 3QF4B 1JHUA 4E5PA 1GCOA 4KITB 1BFUA 4B1FA 4LNAA 3KUCA 2X9NA 1MJ5A 4ELUA 1N2JA 3NYQA 1YMQA 3NHMA 1JTVA 1UIMA 5E6UA 5BNFA 1OE0A 1B22A 3CEMA 5FOVA 2NRXA 1G8AA 4C7VA 4LHYA 2AE1A 4RW0A 5CD1A 3IV7A 3OQIB 2D8CA 4RVNA 3SI7A 4N3GA 2M6KA 4US2R 2XCTB 1V4NA 1P0CA 3BQ7A 1RLIA 4Q3AA 3QNMA 5AI0A 2C7QA 3G5UA 4PZEA 1UA0A 2D1QA 1VYTA 4I2NA 2OCBA 1Z35A 4MR7B 1DC8A 3DMPA 4Z6EA 4E11A 3MBYA 1P91A 1NP7A 5KG6A 1J2MA 5EERA 2D7CA 4MVYA 1UJ5A 2EXXA 2OUIA 1BKYA 2EZTA 3FMOB 5AMXA 2JJ1D 1Q6YA 5GJVC 3CKLA 3GLIA 3BMQB 2KS6A 3U3RA 4ZTZB 1FL9A 5DVZA 4D56A 3THYA 3NYIA 2IBSA 1E5TA 4EL0A 4DMCA 2KMLA 1I2MA 2N42A 2Q5FA 1XQ1A 3CUSA 1WZ2A 1ZGGA 1E3LA 2I62A 1G3MA 3A6FA 3CNQS 2JEFA 3VTAA 2W04A 4WFIA 4LCEA 3KKEA 1ENOA 5FOQA 2IPXA 1KDTA 1PN3A 3OAAA 3TZ6A 1GGKA 4FE4A 1J33A 4Q1CA 2HJSA 1SXJD 2PT9A 2OH2A 2ZPTX 1W96A 3T7AA 1VC2A 2XCQA 4H0NA 5HYVA 2TS1A 1NK7A 1ZQDA 2PXAA 5EVJA 5F5LA 3GDHA 4HDCA 3A9UA 3K6JA 1NF2A 4IIJA 2PH1A 4MA4A 5GQSA 2O3UA 4C04A 3ZE6A 3MOSA 1CR6A 4EB8A 4IR1A 1UPUA 3COPA 9ABPA 1RI1A 1IYZA 1Y8RA 2XKBA 2QZZA 4I46A 4BBPA 4FFBB 4ZO4A 3RSQA 821PA 3WK5A 3H05A 2PBFA 2CBGA 1JHAA 3DBOB 3B2QA 1TFRA 4A3SA 4YYZA 1XS9D 1ID8A 4UHBA 5GGXA 4ZVMA 1RI3A 5BQ5A 1UKEA 3VR1A 2DWQA 5A3JA 2FWPA 4NPHA 1I1QB 1XHLA 4NS1A 1AKQA 2J3HA 5JD6A 3UNXA 3PQDA 1PR0A 2EV9A 4WTOA 1E9EA 2HM7A 4UUAA 4OBXA 1OMOA 3NRZA 2PYZA 3C28A 1RC8A 2ZI6A 5CGZA 4UU8A 2XUIA 4MKHA 2DTEA 1ZHFA 2JA1A 7ICIA 1W5EA 2BPFA 3B1YA 2CK3A 1TTHA 1N2IA 2QTBA 3GG9A 4RHTA 1Y4SA 4JI8B 3S1AB 4GDFA 3PWKA 2ZW9A 2JL1A 4U0KA 1Z4OA 3FCUB 8ICYA 5HHHA 1N32B 4BTLA 1P4AA 1S7CA 1I14A 3DC7A 4JJFA 1WXQA 2O8VA 4BO4A 2ZQZA 2ZANA 1QGOA 1KRWA 1SG9A 3UTCA 4K88A 5BYAA 3VHLB 4QUAA 3HMKA 2XCOA 2WDPA 3QX7A 3TKAA 3LP6A 4R2IA 4RE6A 4H7PA 3BGDA 3DG9A 3FPJA 3AB3A 3HJEA 1G5HA 4BQFA 4EENA 1KO7A 2E3TA 2JGFA 5TQJA 2YYYA 1KEEB 1GZ7A 3FG9A 2EARA 1E3DA 1IUKA 1X77A 5F98A 5CNMA 4MCHA 4M46A 3KG2A 2L42A 1UODA 3KAPA 1SD5A 2WZCA 1H3FA 1Z12A 3WNDA 3ZU3A 4ZCLA 4QJIA 4D74A 1NIJA 5L6MB 4ZVOA 3OIGA 4KLOA 4B32A 3PNYA 5E1MA 3QKIA 2GDZA 1SUSA 4IPTA 2WD9A 1GU7A 1DRWA 1P2BA 4B9AA 4QLAA 3RTVA 2VRWA 3UBMA 3ZGLA 5AQ1A 2D2FA 2G9UA 1YOVA 5LZ8A 3AUKA 5TMEA 5A6VA 3W9YA 2F3NA 3W7BA 4AK9A 1UZAA 3IAM6 1AQNA 4RQ5A 1WKBA 5KWVA 1O94D 5AK0A 1CUUA 1ZH6A 3HB4X 5GM2A 3WIVA 2JD1A 4J9NA 1A9XB 4N5NA 3JU3A 2V59A 4TRJA 3UWOA 3INNA 1DBPA 3IAEA 2HSJA 5IF3A 4EG8A 2AWOA 1QZ3A 1Y6ZA 3AEQB 4CI9A 3KQSA 5AVUA 1N8SA 3Q3IA 1YQDA 4GNKA 4NLKA 1DG3A 2YHSA 2FUG6 4U7WA 3FTDA 4F5DA 2W2QA 4MVJD 4J4TA 1TUIA 3BIWA 4XUEA 3NH9A 1IXRC 1WPGA 1PYDA 4PRLA 1JDVA 2OGTA 5CP2A 4YECA 5AXBA 5HRUA 4K6OA 2Y1OA 1ZN2A 2Z0MA 4RQ6A 3K6RA 2DETA 1OR8A 3PW2A 3PCTA 4IP0A 3VYWA 2PQ2A 2OHOA 1SO8A 5EQFA 5K0ZA 2P9ZA 4JB3A 4OTZA 1BFDA 5TARA 3GAAA 4AZ3B 4JC0A 3ZY5A 1E2MA 1Q7BA 2MJLA 5ELLA 1DQZA 1LTHR 4TUSA 5J47A 4NG5A 3I6MA 3WBJA 1CYDA 3SBEA 5A9SB 2AOXA 4N6GA 3KWMA 1DCTA 5FPTA 2RGDA 5DHUA 1J24A 2H3HA 2IGTA 3PIDA 3OJOA 4M1YA 4Q16A 3AF3A 1GL7A 3CZAA 1T5OA 1THTA 5A4JA 5JDIC 3BMXA 4II3A 4WOJA 2JIPA 2EAMA 3QEAZ 2GMWA 5L3SB 3ILXA 3A2NA 3ZCTA 2DUMA 3ME5A 4TV9B 3A4MA 1FIUA 1YE8A 4JD5A 4OG2A 3JVUA 4I3HA 2RAUA 2WP8J 2H59A 1NK0A 2R8GA 1LDBA 4R66A 3K70B 5LMCA 1OBOA 4M04A 1G5FA 4FB5A 3RH0A 4DSLA 2HHVA 1Q1QA 4YD2A 2B8WA 1N2CE 1XI2A 3H8MA 1OH7A 3KEOA 4LOAA 2B4QA 5DTIA 2MRLA 3L02A 1VL5A 1TCUA 4JL6A 2H3VA 1YIAA 2IUSA 4II2A 2C61A 5B4TA 4JYZA 1X9SA 2DPXA 1DC5A 2OC4A 3VO9A 2YFQA 4MO9A 4NG4A 1PX2A 3DE1X 2HHHB 4XA5A 2IU4A 2C0QA 4Q3EA 1NGSA 1IIBA 3SV4A 1VMAA 3EXG2 4TXMA 1IHPA 4CIWA 2E37A 4HV4A 3RM3A 4DJFC 4G0YA 5KAPA 2IOHA 4EELA 3IUJA 4R8UB 5JZSA 4B6JA 4NBLA 1D7OA 1CC1S 2OXCA 3NOOA 4Q9JA 4JEMA 3A7EA 5JXWA 1NE7A 5ICCA 2QY6A 3QUAA 1Z4KA 1F17A 3IQWA 5FPQA 4FFVA 9ICTA 1ECJA 3SQNA 1DC3A 4LOHA 3GFVA 2OVBA 3GG2A 4RFSA 2PLNA 3IEXA 3BMOA 1NHGA 4FPXA 1XKTA 1O6CA 1TUEA 2X0DA 5DNWA 4EH1A 2ZCUA 1KJQA 3ND5A 2IHBA 4M0FA 4PHTA 1N9GA 4LYGA 3AR6A 2F3TA 1Q0SA 3QW4B 4C4SA 4KQIA 3UV3A 2GF2A 1MOSA 3IVGA 4E22A 2XZDA 1ZQ1C 4ODIA 3C24A 1ZK2A 1Y7IA 4UNQA 4PLCA 4J1NA 5E1OA 2FWBA 3C6YA 4I9UA 4RTNA 2YNMA 4BC0A 4IW3B 5HR5A 1V97A 2K5UA 4Y2UA 4OMUA 3KJHA 1ECLA 4H27A 5F9MA 2IY9A 4ZT6A 3JAMA 4B7UA 1X1QA 2NU8B 4ANFA 4OX9Y 1YZFA 3QOYA 1J2TA 5IIJA 3M34A 3D2QA 4FOTA 3F2CA 3Q0IA 1NTRA 4YYEA 3HP7A 4ECRA 3V42A 3CX3A 1VCIA 3KL4A 1ZI8A 3IT3A 4OHFA 5FOSA 3VISA 1X1EA 1YVRA 4IIBA 1UT8A 4PC3A 1Y7TA 3F6CA 3GJXC 2JARA 1OB5A 1KTIA 5F52A 2V6IA 3S8EA 4TLCA 2UV8A 2NZYA 4KRFA 2Z5LA 2VIIA 1P0IA 1VI6A 1IJKA 4EGQA 4JV2A 1E1KA 2A30A 2ZKIA 3TQCA 1N25A 3KYIB 3U3DA 3EVCA 4E70A 3UCFA 1AKWA 4LECA 4AQYB 3FH0A 4BNHA 3U4MA 4WY8A 2GPSA 5DLGA 3GF4A 3LLCA 4AMVA 1BS2A 1O6ZA 5GZ6A 4PVDA 1YJCA 1Z68A 2GFIA 2MYPA 4IMJB 4M7PA 4FFLA 3EGWA 3G5TA 3UZUA 3AR4A 1DFIA 2QL5A 1KSHA 3KDSE 1EXMA 2F3RA 4OV6B 1CR2A 2GBFA 4YP6A 3HFRA 1S0MA 3CURA 3HY3A 4ZCPA 3ISVA 3W6PA 1R37A 1FDIA 4EYIB 1K1QA 1KY4A 2OORC 2WTFA 1BXKA 4REQB 5LA6A 521PA 3SIRA 3CFYA 4U2EA 4GZ3A 3L8EA 2XICA 3SJCA 2CSUA 1IVYA 2XNDA 1PL0A 1V8DA 3AHGA 1S4QA 5F2OA 4CIDA 3G0HA 3LLVA 4JENA 3A6DA 2NN3C 2CB0A 4H7FA 2QKQA 1JR3A 4RH3A 2P40A 4PX2A 4RPCA 4S24A 2AJCA 2ZROA 1BG6A 3OKCA 5AQEA 4OXQA 4K03A 3WLLA 2XUQA 5LXTA 4CGZA 1U1DA 5DX1A 3X1DA 4YJGB 4I1OA 2ORVA 3I28A 3K9WA 3ZY4A 3AETB 2WMDA 4DSTA 2Q1YA 2QB0B 5HF6A 3I30X 1U98A 1VLMA 5HXAA 1WLYA 4B3JA 3QWAA 2MOKA 2PJZA 1CE8B 4B45A 4JQZA 2GASA 2OD9A 1Z6GA 4PHGA 1IEQA 5BV0A 4QGAA 1OUQA 5T4BA 4FW8A 1RFLA 1X6VA 4HC4A 3ZWOA 2EIXA 3HHEA 3NLLA 3AM9A 3ACDA 3PDIA 3OP1A 5CDFE 1FLDA 4D8VA 2EDCA 5I3CA 1ZQOA 2Q3LA 1XL0A 2BEWB 2Z09A 1ICIA 4X97A 1TFUA 4ZI7B 3IRVA 3AWDA 3VOBA 4EZIA 2OXOA 2QRLA 1P5RA 1J99A 1A9ZA 4FEGA 2YJZA 2B36A 4P7KA 1QH1A 2YMPA 5NLLA 1AQ6A 2ZUTA 4UMDA 2UVDA 1FNBA 3FR8A 5ECDA 2UDPA 4D8YA 2G09A 3CSSA 2GKGA 1ENYA 2EHJA 2IYWA 5K8JB 4URVR 4I8DA 5AVOA 2Q5HA 2W2LA 1RJGA 1TJPB 2WE7A 2XE7A 3WKAA 1KKUA 1E89A 4AS1A 4F11A 2VHZA 2RRDA 3AVUA 3K0HA 3E35A 1SC6A 3TJRA 4JR2A 5LM3A 5LWQA 2IY7A 1DAKA 3CRW1 1TMKA 4BVGA 1GP2A 5J2JA 1GXSA 4H1VA 1WXDA 3G0IA 1G8SA 1NHWA 3DD5A 4OQYA 3UQZA 1QGDA 3DTNA 3GRRA 2BUBA 2OUKA 4IDQA 2NMVA 5JCOA 3TDNA 3SOPA 2GLTA 3Q7QA 5IWAB 4YBZA 2LCFA 3O8LA 2H5EA 1F3LA 4HRYA 4R2MA 1Y63A 2H0RA 1GPUA 1W4BA 5KOYA 2WIGA 3MD9A 1KU0A 4NBTA 1KAEA 4JJEA 2O7VA 3W2EA 1T9KA 2H5JA 1X92A 4I6EA 3NIFB 1V9SA 4O2AF 3TPZA 2WF5A 2JXJA 1YHYA 4DV5B 1XF9A 1P2UA 2RHTA 4A8HA 5EFZA 1JJAA 4DR7B 4XSVA 2AN4A 1WULS 2B21A 4KZKA 1QUFA 1KEUA 1H93A 4NCNA 4HDKA 9ICIA 1WWKA 4OU4A 4RA6B 2JCYA 4HADA 3F2IA 4M9NA 4C14A 3PHJA 5FL3A 1WCLA 4YV2A 3CPJB 2JBWA 3DEAA 4RADA 2OY0A 3OT1A 3FLAA 3F0TA 4TT3A 2YFYA 2A5FA 3ER9A 3PXDA 2QW0X 1V25A 1V7ZA 2C00A 2YQ4A 4ZDIA 4GYWA 3MWKA 2IHUA 1XDDA 3F5EA 1A0OA 3RBZA 4MYCA 1EZ1A 3BWCA 3LCJA 1C0PA 2YUIA 3UFBA 3B1JA 4TTVA 5BYBA 4QWDA 1Z6AA 2AJDA 1Q8KA 2F8KA 3G2JA 3DCYA 3HMQA 4UQOA 4GI1A 3WAJA 2WMYA 3DMNA 3RFFA 5GVSA 4YC7A 4G5HA 1IBMB 1Z4PX 2NZVG 1G2IA 1ACMA 1UDCA 2AVDA 2XCLA 4BNWA 1KYXA 1KO5A 4ABTA 3JRNA 1UZLA 2NYVA 3TAUA 3MMSA 1F6BA 1GO3F 4WLNA 5FL7A 3UVEA 3TNLA 2P4HX 4O8CA 2MSCB 4YAIA 1SBZA 2AN1A 2CFSA 5LJIA 5HE8A 1NX6A 4DMFA 4FOOA 2J85A 4OATA 3N2GB 3B5JA 1L5VA 2JFVA 3Q12A 3QXCA 1U28C 1JSXA 2L19A 1X9HA 1WD7A 3D5QA 5EZQA 4QZIA 4MQBA 2AOUB 3CUKA 1GM5A 4MULA 2R8ZA 1GV0A 2XB9A 4LMRA 2H7CA 3GMSA 4UTNA 2D2XA 1Y6JA 4UNRA 2VXCA 4B31A 1EGVB 4RD3A 1U0EA 1I7QB 4NMXB 1Z6QA 1W9MA 4UUNA 1KZ7B 1NBME 4EZ9A 1K88A 3VR2A 4HUTA 3RIEA 4LC9A 3OEHA 2VG8A 3WLKX 4MCAA 2XCRB 3HN7A 4OBWA 1TYDE 5J2UF 3HCWA 3AEUA 5IDVA 3R2JA 4PGGA 3KT8A 4YRTA 2ACWA 2BI4A 5TF0A 4QW8A 2XIDA 4N40A 3BQ9A 1BWPA 4PTLA 3BD8A 3WICA 2ICAA 4A6EA 2JA2A 5H9WA 4N6NA 2J1LA 4GZ5A 4Z7OB 2O2IA 1OHHA 1D8TA 4ZVSA 1E4EB 4P4NA 5IBQA 3VO8A 3WL7A 2G83A 3FMIA 2VI5A 1N34B 3PNBA 1R5NA 2YN0A 4FKZA 2E5LB 2M1XA 3RUIA 5TEWA 3P0EA 4YY3B 3RNLA 9ICXA 3E22A 1N7JA 4BJ3A 4NK4A 3RVRA 3LVQE 3VO1A 1ZQLA 5KFUA 5KYYA 4HLCA 3I4CA 2W98A 2ZSJA 4IHKA 4L5JA 4HSGA 4RETA 4KH0A 2YNMD 2R7NA 2PQMA 3OH8A 4DPMA 1UJMA 3ESCA 2YQZA 5FB3A 2AK3A 2Q4RA 4LK2A 4QFMA 3EFBA 2EL9A 2JASA 2GK6A 3BFXA 1QX3A 1ZN8A 5CXUA 4ALKA 3ER8A 3JAKA 1RTTA 2W11A 2I80A 3QYFA 2NQ2C 4JK1A 3RFTA 5AKZA 3RAJA 3RVQA 3T9AA 4LHZA 4RXMA 4JFRA 2NO7A 2XAUA 3ZBPA 3L8FA 3EOBI 5AFSA 1G18A 3N0XA 4MSUA 3KIPA 4PLPA 3PI6A 3FWKA 3LKVA 5KFQA 1YRBA 1F4PA 1CF9A 3B1KA 1CQJB 3PNSA 1XCOA 3HVKA 2W2KA 2PRZA 1F4VA 3EBLA 1LW7A 3P0JA 3JWEA 3VSCA 4HLUC 1JR6A 1CS4C 4QBFA 1E0JA 5C34B 4WBNB 6PFKA 4BLUA 5JSZB 2OAP1 5IDYA 1TQ6A 4YCAA 4CT0A 1FP6A 1DIRA 2QP9X 2D1SA 2FR8A 5BV2P 1KYVA 3PDWA 3ZBTA 4CDRA 2ZIAA 1T8SA 2JDID 2FN9A 2A5JA 3Q40A 5CLQA 1LWNA 4UM5A 3AJDA 2OEHA 5EKUA 5K99A 2NXCA 1SRRA 2TMKA 1NLZA 2D1YA 5KCMA 4TWIA 5KAMA 2C3PA 3U4HA 1LGYA 2O3JA 3S7ZA 3BZCA 4J9RA 3HN2A 1FZQA 3QXSA 1UDAA 2W6QA 4TQSA 3H86A 1R50A 4JI3B 3DDHA 2DBYA 4EMSA 1ZJJA 1C3OB 3T6KA 1ONPA 4Q02A 4DARA 1AO3A 1Q16A 4PYOA 1XZHA 3B0YA 3PNOA 4P81A 4ZJPA 4TL9A 1KS9A 2BBWA 5KFNA 3JR3A 3SS9X 3UKJA 5JUMA 4AD8A 5IULC 1II0A 5FLEX 4EI9A 2VTBA 1YZTA 3SU8A 4K86A 4JS0A 1BDIA 5SZKB 4ECYA 2I71A 2PZJA 5JNTA 4BNFA 2RKOA 3VPSA 5AOBA 4BFYA 4NNOA 4E1BA 3AHCA 5ISMA 2XNDD 2XB8A 1E1CB 4XVRA 1WEHA 1CVLA 4HDSA 1THZA 3I76A 1YFJA 3H18A 4RIIA 4Y2JA 2HCJB 4CRWB 1JR3D 3QVGB 3HPOA 3INGA 2Z5GA 3ZJYA 4MPPA 3HR4A 2OO3A 4EZEA 3SN6A 4HTFA 3X44A 3R3HA 1X7ZA 2CCJA 4PAOA 2YIDA 2Q5JA 4FLFA 4KQ1A 3SOZA 2BP7A 3LUDA 1Z62A 4MV0A 2IU3A 1V26A 1SKUA 3KWFA 4ECZA 1UJ2A 3NM5A 4L75A 1B1AA 4IDBA 2Z98A 2GAFA 3F3SA 4PLVA 1A4IA 1SVWA 2H3IA 4BMXA 2JAOA 1OGYA 1SY7A 3RNOA 3N75A 5DBFA 3FLBA 3VV3A 1D6MA 1X7XA 4NLBA 5CA7A 3M49A 1K3UB 1YDGA 1SKBA 1VP3A 1H5QA 4YP5A 3PMNA 2OCPA 4O4JB 1DK2A 1NVUQ 1VDZA 3BS5A 5KX5F 1YR7A 4A1OA 3ASYA 4DEXA 3CBQA 5CX1B 4RFLA 4BKOA 1U2QA 3MERA 2E82A 3O4VA 2NSHA 1EXWA 4LF6B 3EXIA 3JX9A 1XMPA 4D3XA 3AFOA 2JD0A 3MMPA 3IOMA 3TD9A 1PK1B 3Q7SA 1G5TA 4ZN6A 1ULHA 1HE3A 1FQJA 4LJ4A 1PQPA 4ENWA 2V6MA 1WSAA 2Q3FA 3WMWA 1VA5A 3RJTA 3I6ZA 1GGJA 2DSTA 4XIFA 3BBPA 4WFQA 5DO9A 3HJUA 3WGVA 1KSGA 1P7ZA 1N2GA 2W2LD 3L7KA 4NZNA 3HEMA 5A5EA 1XLUA 2I4NA 1TAHA 1I4OA 2TECE 5AKKA 4R65A 1ZNWA 3UMCA 2REXB 2H17A 3E0QA 1EFAA 4LZOA 2DU8A 1PZXA 2A0WA 4CN9A 5A62A 2VNHA 1QYWA 3V8NA 4LQLA 4ZEVA 4F85A 5DW3A 4ASUA 1NPTO 1RC1A 4QGSA 2ZSHA 4RU9A 4HP8A 3GUHA 4ND2A 2FOXA 3RK1A 2D7DA 1K4KA 1CJVC 2H1WA 2HSWA 4RJKA 3OD5A 4C7BA 4AF8A 2VEDA 2YTZA 2WIFA 4MUNA 5B3JC 5AVZA 2GRJA 3GROA 5IJAA 4EKIA 2MYNA 2QRMA 3PPIA 4QUKA 4MR9A 3WLIA 4OK3A 4DLXA 1KEPA 1ZVJA 5FADA 1H1DA 1RJEA 4GH5A 4L8VA 2H1VA 3AG5A 4RKEA 4KLFA 4IUYA 4KR0A 2A1JB 3NIDB 3LOPA 1M1YE 1DBSA 4MJXA 2B83A 3OZIA 3I04M 1ZK3A 4DMUB 1ECBA 2XOEA 1U45A 2F9FA 3ZGVA 4YAKA 4Y0NA 1NM5A 2VF5X 1I10A 3TJZA 2UUPA 4KXYA 1CCWA 3E9EA 5IUNC 1YS9A 2IL1A 5REQA 2AG8A 3L79A 2GCOA 3DO6A 3IAXA 2H2GA 4TT3D 5A5DA 4J76A 1R3DA 1M1UA 5DW0A 4R7ZA 5BOMA 3DXXA 3PLAE 1DXHA 5CW1A 3I0NA 4OK6A 1EM8A 2OWOA 5G3ZA 3QUSA 1EUQA 1CIJA 4BTEA 4NLLA 4Z9BA 2BQ3A 1Z0FA 2OOSA 2H6EA 1XIVA 3ESBA 1IRIA 3RAQA 1DK3A 3QLTA 4TMVA 3C5GA 4P7GA 5DM2A 1N9ZA 3I0ZA 3PVXA 3SF8A 5JLJA 3UV6A 2C9DA 3PT9A 1XYGA 2ZIVA 2R8HA 5LP6B 4K9DA 4FCVA 1CLEA 3ENVA 4YAJA 3GGJA 1Z2NX 5ESRA 1AHIA 4B6GA 5EIBC 4NCKA 3U4GA 2O7RA 5FL7D 4MVJG 3AM3A 3DLTA 2WD8A 1T3GA 4UTZA 1DELA 4W1SA 5DCLA 2XYQA 1XTBA 1TM3E 1TKRA 4HDMA 3LVVA 4I8IA 3Q3VA 1UK7A 1JUDA 1PFGA 4FMCB 4A8JA 2Q3EA 1VIVA 1G7CA 4LZPA 5KFSA 2K60A 4EA6A 2UZ1B 3N8IA 1PCXA 2X3UA 2IOFA 3T0GA 4C6HA 2AV6A 1SOVA 3MW8A 4DWOA 1ZSVA 4GOLD 2BHRA 4PCAA 2F1HA 3KOOA 2QJOA 3ORQA 3O3MB 2J07A 3A06A 5EJ9A 3AU6A 4EY6A 4LZGA 3ET4A 1SIOA 4ND4A 2GI4A 1NT2A 5KFAA 2HDHA 4BWFB 2NPIA 3MRXA 2F43A 3VR2D 2GM9A 1W4ZA 3U7HB 1KYTA 3WHLA 2OM6A 1ZJ5A 3OEHD 4EQ6A 2NSJA 1OBVA 4U39A 3RUAA 1XSPA 1T4DA 4WNYA 4ESEA 4JA0A 3TAQA 2YV2A 1TJ4A 3EDMA 5EIXA 1ZQNA 2C99A 3NHZA 4LXUA 2O8EA 4TTPA 1HEYA 1GZDA 1DRJA 1AF4A 3E4DA 3W6OA 2R66A 2D8AA 1BOOA 4OJPA 2QU7A 4QEDA 1YQ9A 1OHHD 1OXTA 2KJ5A 1NYRA 1GTJ1 3UF0A 2XF2A 2J7PA 4AYBC 1CZRA 4Q7QA 5KYXA 1EGQA 3E3NA 2VNJA 1MQ8B 1QJCA 1PDOA 5ALQA 3TAHA 3HN6A 5IW8A 3RRYA 4ZV4A 1EVJA 5FF9A 4DLUA 4NF2A 2CJPA 5E3HA 3QEOA 1O94A 4GE3A 3W5JA 5KFOA 1S3SA 1ADYA 4ZWNA 1VB3A 2A0FA 1TEHA 1Z34A 2H7VA 3EE6A 3OJWA 2FAXA 5C4MA 1AGPA 2OA0A 2FPIA 5LFAA 4GX0A 3HJGA 5DBOA 2Y68A 2AYZA 4U9UA 4A91A 2VK1A 3EWAA 3W9BA 2B8EA 4TUYB 3D02A 5JJCA 3SX0A 2JHFA 4IY1A 2WSBA 4MVJA 2UVPA 1ZIOA 1UFQA 3OCWA 4K28A 3HDHA 2HA7A 1NJ1A 3VDRA 1MJFA 4OQNA 2J5KA 5B6PA 4ND6A 1K27A 2XPCA 3SR6A 3UJ9A 3RROA 5HE9A 5JQGB 3IVRA 2DLCX 1R5OA 4RNCA 1SOWA 2X4GA 1VJ5A 1W5TA 4XPIA 3IKJA 1ZH4A 4WV3A 1YBMA 2K8BB 3R9XA 4ZTBA 3OPVA 3NHBA 5NULA 4OI4A 4OO1J 4WESB 2NO4A 2NTJA 2DQ4A 5EPUA 1QYCA 3C1ZA 2GCIA 3N3BC 4ZARA 1GNSA 3OA2A 5JAHA 2CBZA 3LBHA 4ND7A 5DI9A 1WABA 1YQEA 4WPGA 5LL6P 2WSYB 2HMAA 1H2AS 3EFOB 8ICFA 4OJYA 1OF1A 3ZDQA 1RYZA 2K4PA 4R1TA 3ICXA 2VNKA 3P26A 5HBRA 1YVDA 3O1LA 2GJSA 4DY4A 2CKDA 3OM9A 4MZDA 1RXWA 4G4SO 4IDOA 1LF5A 3E5RA 3DLAA 2PXIA 1QAQA 2QLTA 3GLKA 1VL0A 3R6WA 2QTNA 3GLRA 5EE3A 4MQMA 4I6GA 1CNFA 1RI4A 3I53A 1JXMA 4JU9A 3UMVA 4QULA 2ZEJA 5JRZA 4CGYA 1GYPA 1VCNA 1RNLA 1NBIA 2X5JO 1MAUA 1HKHA 4F4XA 3RS5A 5H3HA 5I9SA 5IIOA 2D5BA 1LK7A 3I9NA 2O3QA 4PSVA 3IOEA 1BRMA 2V1UA 2F76X 1MEJA 2EL7A 2WOOA 1GWNA 3GCDA 1KZHA 1DRGA 2IS1A 3H16A 4NL9A 3TZKA 4XM2A 1JKJA 4OBBA 3N1UA 4C6TB 1PJBA 3D4LA 3RUPA 1H2WA 3BQ0A 5ICEA 1TQDA 2CMGA 4CFYA 2VBFA 3EPGA 1YRQA 1E79A 2CLCX 3IV6A 2ZRPA 2R79A 1E5QA 4DAOA 2XXAA 1E9AA 4OB8A 1XCBA 5C8DA 3PEEA 3EJWA 1IEXA 2Z8ZA 4UBOA 5CW2A 2J6UA 4BX9C 1OXXK 5LLSA 3G2IA 4IO0A 5I9IA 2XUHA 3O21A 3OX3A 4M0AA 1GGMA 3MELA 2UZ4A 1R0ZA 2YV4A 5D84A 3KLOA 2K89A 3HB5X 4IYRA 1XQWA 2NPFA 3E61A 3FZEA 2FY8A 1ZUNB 1OH8A 2GCPA 1JKMA 4LGVA 3CW9A 2GBLA 4LNHA 1X6JA 2YOFA 4XB1A 2HZ7A 4O0IA 2PX5A 1NQ5A 2JCSA 3VKUA 5FNVA 2Z2KA 4C0KA 2Y1DA 1U2DC 2XR1A 2YCLA 4G89A 3W06A 1J2EA 1Q74A 2W6NA 4QDTA 4EZBA 1KAQA 4J6FA 1KJYA 1W5AA 4KN4A 3PR1A 1KK3A 4IR7A 3CJTA 5B2ZA 1INLA 4CR7A 4FN4A 3DEJA 4Q7LA 2PKXA 5D00A 3WBFA 4LMPA 4IAOA 5DULA 4ENTA 4RDHA 3KJFA 4RHUA 5KSPA 1Z7EA 2EKZA 2WKRA 3JZFA 1VOTA 2Q1WA 4JX8A 3GVHA 4ZCMA 4QYIB 2N1MA 1EFCA 5E2BA 3A2KA 2XSZA 2YY7A 5K20A 1K06A 3NJ4A 1TO2E 3M7IA 3GLFA 3FOZA 2RGNA 4CYMA 4I2IA 1XEXB 2R1TB 4HK4A 2P79A 3SR0A 2B5WA 3U0BA 1GSOA 3NGMA 2QN3A 4F6CA 4KNVA 2GNAA 5HM6A 5I7VA 2OV6A 4B6EA 4YMSA 1WOMA 3U80A 1NJZA 2YJ6A 2GAIA 4JJAA 4MLPA 3UMBA 3K2IA 3I64A 2F2AB 4UHDA 2Y1IA 1TRKA 2NZWA 1NF3A 1MVNA 3MFIA 2A9FA 4ZEOA 1VLLA 3KQKA 4ASUD 4IGAA 5HQ3A 4LDRA 3W5VA 5KNIA 4KO3S 5IDQA 4MMZB 1YASA 5P21A 3ZBUA 3QFTA 2E48A 1S2LA 4J75A 1XSNA 5D3MB 3VHXA 3MFYA 3NETA 3WP1B 3PQ7A 4GPEA 3IAFA 3VHRA 3DGEC 3UTDA 2PKQP 5JPIA 2I55A 2AHOA 3T7CA 4AUEA 2NPOA 4N3NA 1JXAA 1YA6A 4LX0A 3QG1A 1YV9A 1W47A 1TW3A 2RGCA 3NC0C 2AKEA 4BBJA 1SCUB 1G6KA 4XX1A 4KPUA 5AI4A 2B1QA 1C41A 1WPRA 5EIAA 4Q4JB 2D0OB 5K0TA 3FYUC 1NFQA 1MKYA 1GZSA 3G2LA 3VI3B 2EEPA 1CUYA 3T7TA 4C3OB 1KHHA 5D01A 1K5HA 1ZM4A 2E55A 1PKEA 3FTQA 3PR5B 2YICA 4AZTA 2PUTA 2FMKA 5JMWA 4WJLA 4RAOA 3EPHA 1OLXB 1H0KA 2PCLA 4D9EA 1C8BA 1IMOA 2ZRQA 4L9RA 4F6LA 2BHNA 4E5VA 3F1KA 1GGHA 3E7PA 3GIMA 1XU9A 3KHLA 5G0VA 4DBLE 4J3JA 3U5ZB 1B93A 3W2FA 4Q05A 1SVKA 2WEKA 3A1VA 4R71A 3JY6A 1SAYA 4HTAA 2Y05A 1O97C 4OMDA 4MW6A 2YRWA 4EPXA 4DR6B 4ZGBA 5FFFA 3DJYA 2G17A 1R4ZA 1VLHA 3OZCA 1SBYA 1A27A 4K9MA 2VDLB 2IIQA 2EZUA 2O3TA 1N5DA 5JROA 3RG2A 2NV3A 3ZDDA 3DWGA 2GZAA 4DO9A 4P5PA 4L50A 2VTDA 4LYFA 2GR9A 1C7IA 2J5RA 1L4LA 4Z5XA 1WCIB 2AX3A 4V3CA 1PJQA 1G55A 4NIMA 1ULSA 5K3FA 3KR1A 3L1VA 2PZAA 3ICPA 1FJXA 3A3KA 1UDBA 1J97A 5JBNA 1GZUA 3M3PA 5DGHA 5K0EA 4H9GA 4I6JA 5DIZA 4GLOA 1LU9A 1ZQPA 1L5MA 3MWEA 2FVXA 2JCXA 3K0FA 3L7LA 1X2BA 3VZBA 3JQQA 4X1IA 4OQLA 3K5WA 3I2FA 2GN6A 4C29A 3PQ3A 4B9NA 1B8VA 2G6TA 4ZHQF 4QWBA 4H6PA 4Z1MD 4JB0A 3SIWA 3P9YA 3H3XA 1HZZC 1I7SB 1GG8A 4B3SB 1NPYA 4B2YA 5KS2A 4Q66C 1S5LU 2QMUA 3D1VA 1EEHA 3TG8A 4M0PA 3GJ8A 1VG9B 4N6OA 2XMGA 4DT1A 4HAXA 4QVIA 4M9LA 4CZ2A 4GF5A 2FLWA 5EP2A 1JHMA 1MT0A 3UJDA 1XZPA 2PZEA 3SAFA 2JLBA 4QJ4A 4GBJA 2J7PD 3SSOA 2EQ5A 3LDHA 3E7WA 4QDKA 5COQA 5EKTA 4JHXA 2FFJA 3EA5A 3BCRA 2Q4EA 1YB5A 3JD4A 3C85A 2OECA 3LHDA 2XQFA 3VRHA 1UZUA 3C8ZA 1I1OA 5FA5A 4FZ5A 4C7YA 1YMVA 2HRDA 2FCRA 2O0KA 4UAVA 4M1ZA 4B4WA 3G8BA 3RDPA 3QY0A 4NFYA 2ZRCA 3ZV5A 5KT7A 5KQLA 5CCBA 2GXQA 4OHMA 1L7AA 3LX6A 4INZA 5H59A 1VM6A 2QJFA 2Z6QA 2W54A 5BW8A 2HA6A 3PJGA 1SK9A 4AB1A 4QOJA 3E4CA 5D5QA 2FH5B 3TQSA 3I9V1 3H2HA 4PN7A 2VJYA 4B4UA 2R11A 3GDFA 3PSFA 4V2UA 3DE0X 4QHSA 3KZNA 4OD0A 2BH2A 5JTIA 3TSWA 3CKKA 1PJTA 3W7VA 4L27A 3TNFA 3AERA 2F59A 3CQ9A 2HEGA 1NN3A 4ZO9A 2B1IA 4I28A 4D02A 2DR3A 2UUBB 3FUVA 1ZM2A 3L0CA 4YO8A 3JQPA 8ADHA 1RLMA 2ZT6A 1ZDMA 4U8GA 1QIGA 4RTPA 2AQ0A 4ZOBA 8ATCA 2BLLA 1ODJA 2FSHA 1X86B 1Z8NA 3AIKA 3U7JA 4MHOA 1EK2A 1B8NA 1V95A 5HK8A 1NJXA 3CLSD 2I65A 4W7IA 2HJGA 3DMFA 3E1SA 2X8WA 3NX4A 4FWTA 2QTRA 4MR8A 2OV3A 2Y0EA 2FMIA 2OCGA 3A28A 3C6ZA 4QDUA 2PI4A 5IH3A 4IXTA 3R7DA 2EP7A 1O9HA 5E3JA 3GO4A 3RV3A 1WX1A 3IUQA 4EKNB 1MFZA