1ZOLA

Native beta-pgm
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1zolA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zolA01
2ZG6A 1RMQA 1NF2A 1XPJA 4KX5A 4DW8A 5AW1A 3EPRA 2BDUA 2P11A 2HSZA 4XOUA 5AKLA 3UMBA 3KOOA 4NFLA 5AKJA 3R4CA 1WR8A 4GXTA 1L6RA 5AIAA 3I76A 5ALQA 3SD7A 1QH9A 1RRCA 5A3QA 2HCFA 5ALTA 3QLEA 4BX2A 4HYTA 2C8KA 4CNQA 2GMWA 5AVXA 5AW3A 2WF6A 1YMQA 4C4SA 2MU1A 3ZUPA 3FGOA 4JDPA 2Q5EA 3AR8A 3ZVLA 1ZD3A 4HAIA 2Q4TA 4NV0A 5AVQA 4DWOA 2YY6A 1QQ7A 1K1EA 2G0AA 3KBBA 3ZW7A 3WGVA 2ODAA 3QGMA 2C4NA 4YIKA 1TA0A 2B0CA 4IG4A 2WF7A 1Z4PX 3E84A 1L8OA 3N1UA 1WVIA 1QYIA 1RQLA 4ZEVA 3KZXA 1L8LA 4H1WA 5AVUA 1U7PA 2Q4RA 3P96A 1ZOLA 4BNDA 1S8OA 2WF5A 4CF5A 3ZTYA 3L0CA 1U2TA 2YJ4A 3ZVNA 3AR9A 4KNVA 3NANA 2G08A 4YIHA 2NO4A 1ZD4A 5ALPA 2GO7A 3QU4A 3QU2A 3OCZA 3WGUA 2HDOA 3KD3A 3N5KA 2R8EA 1Z4QA 3GYGA 4HGNA 3FM9A 3U7FB 2HF2A 4FYPA 3ESRA 5IS2A 3WKAA 2R8ZA 5AK4A 3RFUA 4GIBA 3AR7A 3QU7A 2EATA 2IA5A 2YJ6A 3DAOA 1ZRNA 2IYEA 3MPOA 1L7OA 1YNSA 4RETA 2YMMA 5AICA 4KYTA 2PKEA 4QQFA 2W43A 2ZBEA 5AM3A 1X42A 1QQ5A 1RKUA 2RB5A 2ZBGA 5AKEA 3ET5A 4MUMA 3L7YA 2IOFA 2JAUA 1U02A 3L0YA 4JB3A 1WZCA 5ALFA 4Y2TA 3DDHA 2B8JA 1SWWA 1YDFA 5ALLA 2P69A 4L6CA 1ZD2P 2JAOA 2YBDA 3RF6A 3FZQA 2ZBFA 1PW5A 5ALNA 3QUQA 2AGVA 1YV9A 3EF1A 3MMZA 3SKYA 2YN4A 2D2VA 4FFDA 3FVVA 3PDWA 3UMCA 5AW8A 1QQ6A 3UMGA 2FUEA 2FPSA 3SLRA 3A1EA 3QNMA 3I6BA 3IJ5A 2FPRA 3MC1A 4F72A 3AR6A 4NABA 4HGPA 2I33A 3QU9A 3AR2A 5A3SA 1Q91A 3QXGA 5ALRA 5AW7A 2RAVA 4AS2A 4ZEWA 1Z88A 3ED5A 4RESA 4MWOA 2R8XA 1RC8A 1RLMA 1Z4KA 4O8CA 3L8FA 4DFDA 3DNPA 4YCLA 3WKBA 5FP0A 1N9KA 4XE5A 2WHEA 1RMTA 2OBBA 3EF0A 2R8YA 4Y2QA 4BNDB 3DV9A 2W4MA 1VJ5A 3L1VA 4UM5A 3AR3A 3U7GA 3ZVMA 2B82A 4UAUA 3I1YA 1ZS9A 4YGYA 5AVYA 4NWIA 5AM4A 3W5AA 1S2OA 2NO5A 1TE2A 2GHTA 5AI5A 5ALJA 3SMVA 5AI8A 3ZX4A 3QU5A 3A1DA 2WFAA 1YJ5A 3PCTA 3BWVA 4BKMA 5ALVA 2CFRA 1J8DA 2CFSA 3L5KA 3NALA 2MU2A 2MSNA 2YFYA 3L8EA 4UMVA 3OTQA 5AK6A 2AUTA 3R9KA 1RLOA 2O2XA 2ZOSA 3QYPA 4G9BA 5ALIA 3N28A 3N07A 5ALMA 3E81A 2WF8A 2EAUA 4J2TA 4UMEA 5AW2A 2WF9A 5AKYA 1KYTA 1Q92A 5ALKA 3OCYA 3PGLA 1T9ZA 1Z4NA 2I54A 2PQ0A 4FE3A 3K1ZA 4UAVA 2ZXEA 5T41A 1NRWA 2YMLA 1T5TA 5ALOA 1AQ6A 3MN1A 1Z4OA 1TJ4A 2BDEA 3L8GA 1RKQA 4BX3A 5AI4A 4XPZA 1JUDA 5ALDA 2HHLA 1Z4JA 2P27A 3U19A 3L0BA 2G1AA 2GHQA 4Y2VA 3D6JA 2I34A 3QUTA 1TJ3A 5ALSA 3L1UA 4Y2PA 4BBJA 2C9MA 3ZWKA 2HX1A 3WK4A 2EARA 1Z5UA 5AW9A 4Y2RA 3CNHA 2B1RA 5AVWA 4EX7A 2G80A 2W11A 4BEVA 1L7MA 1Y8AA 1EK2A 1ZRMA 1EK1A 1J97A 3OCUA 1N8NA 2YMQA 5AVTA 3ZU6A 4BX0A 3PGVA 1L7NA 2G09A 4HGRA 2YJ5A 2FEAA 2FDRA 1ZJJA 2RBKA 3ZI4A 2ZBDA 4L57A 3U26A 3WK5A 2G06A 3J7TA 5AVVA 2YMPA 3L8HA 3E58A 4IFTA 5AKZA 4OD0A 3OPXA 3WKEA 3SF0A 1IWOA 4I9FA 4KX3A 4NAVA 5AVSA 2C8LA 4KN8A 3I28A 5IT4A 2B1QA 3W5CA 4E88A 1T5SA 4OHFA 3ZWDA 3WKCA 3A1CA 1TJ5A 2YJ3A 4OFZA 5AW6A 5ALXA 4UATA 4HGQA 1MH9A 2IOHA 4I9GA 2NYVA 5AI0A 2RARA 5ALHA 2CFTA 2OA0A 3WK8A 3NIWA 5IT0A 4UU1A 3WK9A 1RPZA 4YCMA 2FPXA 3KDPA 5ALYA 4DCCA 1Z4IA 2DQSA 1U7OA 3E8MA 3B9RA 1LTQA 2B8EA 2BY4A 3U7HB 3W5DA 3AR5A 1O03A 4AP9A 1RDFA 3ONNA 3WK6A 4Y2XA 4UMFA 3OCVA 2O9JA 1VFPA 3OCWA 1L7PA 3BA6A 3SHQA 5AKGA 5AK3A 5AKXA 2AH5A 1RLTA 3B8EA 3FPBA 4CF4A 3S6JA 1WPGA 3M1YA 3U7EB 4KNWA 3NASA 2WM8A 4QJBA 2QLTA 2C88A 4UU0A 1RQNA 5ALEA 4XQ0A 2B30A 2JARA 2X4DA 4UW9A 5A3RA 2I6XA 5AM0A 3NRJA 4G63A 3IRUA 5AIBA 3EWIA 2VKQA 3KC2A 5AW4A 1O08A 2JAWA 4Y2SA 3HLTA 5AVZA 1CQZA 5AW0A 5ALWA 2AMYA 5AI6A 1CR6A 4EEKA 1Z4MA 1RKVA 2HOQA 4UM7A 3B9BA 5AVRA 4YCNA 2HI0A 3CZ4A 3F9RA 2FPWA 2G07A 3R09A 2HF7A 4EZEA 5AKIA 4Y2UA 5JJBA 1F5SA 3VAYA 1ZD5A 4YH1A 5ALUA 1VJRA 4Y3UA 4OCZA 4Y2YA 4BEWA 1LVHA 5AW5A 4C4RA 3UM9A 2GFHA 3ZX5A 4UASA 1RMYA 4L6AA 3A3YA 4PNHA 4F71A 4HGOA 4B6JA 1XVIA 4UMDA 4UARA 1Z5GA 2OYCA 3QX7A 3N8GA 5E0OA 5ALGA 5ALZA 3TLMA 2CN1A 1U2SA 2QYHA 1SU4A 3HYCA 5AESA 5AM5A 4ZEXA 2I55A 4CE6A 3W5BA 4Y2JA 5AM2A 2FPUA 4AS3A 3U13A 5AI9A 3WKDA 3ESQA 4BYGA 4EX6A 2IOFK 1FEZA 2PR7A 2P9JA 4EELA 3NUQA 5AHXA 5AK5A 3IB6A 3NAMA 4CF3A 1YS9A 2OM6A 1XP5A 5AM1A 1NNLA 2I7DA 4EENA 2JGAA 2FUCA 3QUBA 1SWVA 3QUCA 5AKKA 3SKXA 2FI1A 3ET4A 3OCXA 5AKHA 4J03A 3M9LA 3AR4A 4C4TA 1Z4LA 3ZTWA 2HO4A 3WK7A 2HEGA 3FPSA
chains in the Genus database with same CATH superfamily
4Q8FA 5J2TF 3AEQA 2QWXA 1YACA 3EFBA 2C2EA 4DG9A 4QZBA 2H3EA 5KKNB 4E46A 4BHTA 2IY7A 3U44B 4QUJA 3EZXA 4D0NA 4UUNA 4Y6SA 1SU6A 3IO5A 4KPEC 1KI1A 3LGAA 5AJXA 4CDRA 4C6HA 4MYHA 1LFAA 1G16A 4RGYA 3HXMA 4IDOA 1OWMA 1L8OA 1BS9A 1YE8A 1G8GA 1G2PA 2XW6A 3H5LA 3CFYA 1Z74A 5G1NA 1KMHA 1DRGA 4HGZA 4E4RA 3A1NA 4HLCA 4PSAA 4BMDA 3SVLA 2JIRA 3SU8A 3O4JA 3Q3VA 3RUCA 2DFKB 3KCNA 1HE5A 2FMXA 2DY0A 2AJDA 4M9QA 5I4KA 1T91A 3HP1A 3K5WA 5J3JA 5J0WA 4C07A 4P4PA 5HOQA 1NYRA 4URHA 4BGIA 1L4UA 4EUNA 5KT7A 3ITEA 4ENTA 3FZEA 3T3EA 4LQDA 2J3DA 5COBA 1KVRA 3Q3IA 2GM5A 4URVR 3TARA 4P98A 2QTWB 3TTXA 1R0YA 1YRYE 3ZCVA 5TGZA 5DNUA 2W42A 1CQIA 1Y7IA 2BR0A 3EK2A 2D8CA 3DP7A 4ZN6A 3WGIA 3AR2A 3CKYA 5HVNA 2QB0A 1W85A 3KB6A 5LP6C 4EG7A 1E3WA 2AKEA 3TXAA 4FXPA 4RCZA 2KWIA 3N53A 1ABFA 4J16C 4MV4A 3LKDA 4XVUA 4BZQA 2C5BA 5KO2A 4XDGA 3TL2A 2ZJZA 2PGIA 4N5LA 2G1KA 5AI8A 3ABQB 2G04A 3ZWCA 1KH2A 3GT4A 5EC8A 2O2GA 3W7VA 3OIYA 4A7PA 3JASB 2PQ0A 4MKRA 5LIRA 4Q4LA 2TMDA 1D7AA 1Y8CA 1TK9A 2V7QD 2YXPX 4DN6A 1K63A 1HDEA 2G88A 3FNQA 4CGZA 7ABPA 4TMZA 1ND5A 3LWNA 4GMHA 3K53A 3CRXA 2J3JA 5DT9A 1GZ4A 1PDWA 4I4CA 4RZ2A 2CL5A 2X14A 5CD9A 4EZ9A 3KSDO 4YP3A 1DRUA 5D3MA 5JXJA 4EKNB 4DLBA 1B16A 1AS2A 5LXTF 3QKRB 4HFMA 4BJ5A 4OFZA 3QZ8A 1TM1E 4EMBA 3RV3A 5AI0A 2WJ4A 4WJ3B 4YPVA 4QSMA 2QL6A 3QOXA 5ARCA 1XNJA 1C9NA 1PEAA 1VKZA 1VLJA 3AR5A 5CGZA 2R4UA 5KREA 3B7WA 1ZQOA 3CT4A 1E4VA 1SMKA 1FP4A 5MN5A 5JRDS 2E1RA 3L4BA 2QTZA 4BLPA 2A1UA 2BLNA 3HLTA 1A04A 5ALWA 4L16A 3UV6A 3NDRA 4EG0A 2CFCA 5JC8A 4XIIA 4UVHA 2VRCA 4Q3NA 1GNLA 3P2YA 1T8SA 2OHOA 3JAKA 3KXDA 4RF4A 4GW3A 2HR1A 3KTAB 2ATIA 1WMDA 5DIZA 2VJMB 1P31A 2Z8XA 2NNLD 1OIWA 1A4RA 3EIXA 3WNDA 1D2GA 1K9VF 1W48A 2RJ3A 3VPCA 3MQ4A 3FUTA 3WLPA 2ZSKA 1ISSA 3G2QA 4IJUA 1CUYA 4KN6A 2OBMA 4B71A 4PSDA 1R7RA 2CMGA 1SD2A 3FCCA 3ORSA 3Q7EA 1K6XA 3ZWWA 3UK1A 4TOIA 3KKKA 3TRKA 4ALIA 4MLCA 1P7VA 3T4EA 4MUFA 1ZH8A 4YECA 3LV8A 1OLOA 3PGJA 5K0LA 3UBTA 1R8SA 5TY0A 4LF8B 4QEKA 3EDYA 2HRBA 1GZ5A 4NXNB 4X45A 3GOHA 3ED1A 4G0MA 2G28A 1E61A 2OMKA 1PE0A 3DLAA 3G79A 3D5EA 5EXTA 4YV1A 4B3MB 5KFWA 1CY8A 5LR6A 3GGOA 2WVGA 2HMSA 2Q46A 4G4IA 1Z6TA 1CB7A 3IQXA 3Q10A 1C50A 1U9JA 3DKPA 2IEYA 1K5GA 1Z7BA 4GOJA 3UXEA 1AKRA 4EQ6A 2BCQA 5L4NA 3F5MA 1VIDA 5TEWA 2VJLA 3DE3X 2AFIB 2Z95A 1E1MA 1JHRA 1HDRA 1DIAA 1JJ7A 2X0IA 2FSVC 3NRWA 4RMJA 3RLFA 3H5AA 3QEAZ 3ETJA 3IBYA 3PCXA 2ORIA 2ZDGA 3TQSA 3GO4A 1WEHA 1EDZA 3PQDA 4UHBA 1QCDA 4XWWA 1NIJA 3M7DA 2PR2A 2PZMA 1ZQRA 2INGX 4NZ9A 4G5RA 3NBAA 5DSZA 2X6QA 4BMVA 4FU0A 2NZJA 4EECA 1WDWB 2D1TA 3KELA 3A0BU 8ICAA 5SZIA 4O0MA 1NGSA 1CY1A 1DP4A 4O2RA 2ZVJA 2R6HA 4I4TF 3FPAA 4A0FA 3L49A 1Z5WA 4KLNA 2ID8A 1BCRA 1XSEA 2FWIA 3R9KA 3UK7A 2ZKLA 5C7IO 1WHTB 1SR8A 2JH8A 4UTXA 2X41A 2B94A 1CZRA 2GN1A 4C29A 4G23A 4F4HA 1K6JA 2A5GA 3JWJA 2ASEA 3H1EA 1KXZA 4RDXA 1O95D 4LJ5A 5C4GB 2B8NA 2CZQA 3A11A 3IURA 2ZSDA 3H2SA 5FFMA 3O1LA 1GCIA 3K6SA 3AIKA 3T5HA 3DFFA 2ZRHA 2V7GA 4TTVA 5IASA 2A3RA 3U17A 1XLWA 2ZIUB 2Q0HA 1DJLA 4FC7A 3KOYA 2ZR0A 3DHWC 1IXKA 1K92A 2JRZA 3N5CA 5JLJA 1NXPA 2P7IA 3EGVA 1YU9A 2JIZD 3D8BA 4UTNA 2PFSA 3KBOA 1XALA 3MWJA 3LK7A 3H0EA 2ZE6A 1MOSA 1DLIA 1M66A 1VMIA 1FRVA 1KFSA 1FQWA 4B7ZA 4X54A 5EUMA 1XZCA 3ASVA 5FF9A 3LVQE 5E1BA 2I03A 2DC1A 1CYDA 4BMSA 4IXMA 3BZBA 4P3OA 4GI2A 5T4HA 4KBFA 7ICGA 2WYUA 1IB0A 4Z9BA 2HWWA 2FRXA 5HG0A 1FUIA 4PCVA 4TT3D 3WADA 4ZOAA 1WBJB 4OHVA 1D6MA 3LS2A 1BN7A 3OLYA 2JVKA 1ZMOA 4Z6FA 5M29A 3A6JA 3DULA 1GXSB 4FR5A 3GMTA 3QSGA 3HYCA 3NR2A 2O0LA 1UBTS 4C2BA 4M8IA 3UEOA 4C0XA 2V6IA 3R9IA 2O8VA 1CUBA 4O25A 3AEQB 3QVLA 2YV3A 3JVDA 3VI4B 4EG5A 2ZIXA 2O14A 3ADKA 2FUCA 3D7LA 2GEJA 5B1YA 2QZ4A 4P3KA 3W8EA 2Z2YA 5IUKC 2REQA 5ECYA 4BEJA 3N8KA 5FIUA 4ZV9A 2OV6A 2AF4C 1DEKA 1E1YA 4GKKB 5TJHA 3HS3A 3JQEA 2CLEB 1KMIY 2VDKB 1N75A 3Q2KA 4WINA 2NSJA 3KQOA 5IVHA 1KMHB 2O1EA 2I2BA 3U09A 4JVSB 1I1HA 2JH9A 4F1KA 2HA5A 5CYPA 1Z7WA 4NZYA 3TTWA 1IY0A 1S0VA 121PA 4QXRA 3SCZA 3QHQA 1QYIA 4LFCB 1Y7LA 3UV3A 5EHQA 4QGHA 4IXDA 3QVMA 4PSCA 1DAKA 4M0KA 2VNHA 1ZXLA 1BVYF 5IAAA 1FNDA 5KAMA 3G2KA 4C14A 3PW2A 5BSMA 1BWPA 3GRUA 4NCIA 3TRJA 4KLHA 5K3EA 3F71A 3U9TA 5JZSA 3W04A 3O03A 3RTAA 2WKPA 4GR9A 2CV2A 4IFBA 8GPBA 1EK6A 3F1KA 1CRPA 5KFYA 3NGDA 2QORA 1CQIB 1M2NA 1FFYA 4B48A 2PVPA 1ZQDA 3KFLA 5HR7A 3OO0A 5JQGA 4KFSA 3LSYA 4NJ8A 3LYAA 1W85B 1E3WB 1QYDA 3PDWA 4ND7A 3SKVA 4NJEA 3B48A 1UBFA 2LBPA 3HCBA 2VQEB 5JCOC 1S5PA 3VDMA 3IBFA 4X1YB 4HQOA 1ODLA 1ZQXA 1NW3A 3KWMA 4F2PA 1OPXA 4NCAA 1ZQFA 1QYWA 3QV2A 4TUPA 4F6RA 4YCBA 4Q9NA 3RAGA 4DXAA 1E7WA 2YHUA 3VRHA 4J16A 1F0YA 2WSSD 3N75A 2H9YA 3GFBA 3KZVA 1ZZEA 4LJ4A 1J6UA 2E5FA 1T1IA 1XQ1A 5FORA 3TTVA 3H75A 3H99A 5J2UA 3UMFA 2K7ZA 2C5FA 3R7NA 4CQJA 4MWDA 3N07A 1XQXA 1C20A 4XW2A 3GEPA 3EPKA 4C03A 1C7IA 5G0VA 1H93A 3C6MA 4H7FA 4BNWA 1VDVA 5EJGA 1NVDA 4QPJC 2ZRBA 2K8AA 5TJ9A 5EYPA 1FVHA 2LVBA 1WIWA 3U1VA 3FOAA 4F4KA 4LYYA 1UBMS 4M9XA 4AXBA 1U80A 3TM4A 5D3MB 5CCBA 4FD3A 4GKVA 1LZLA 4G0VA 4ENVA 1A9OA 5AVTA 4MWEA 3IJRA 1ANKA 4BWVA 4CUKA 5CTAA 2RBKA 4RHTA 2EQ5A 1KRWA 2JGIA 3K70C 1NZFA 1IK4A 2B1QA 3JPSA 4E31A 5T4FA 2ZSEA 2KZMA 3MTEA 2H1LA 1ZUD1 5A6SB 1FP4B 1VXRA 1UJ2A 2P6RA 4YCMA 4HBZA 1TQHA 4RELA 1AKMA 4D42A 2A1UB 4JBLA 1NK8A 4HO1X 5KFIA 1P2VA 5AK3A 5KNBA 4RPCA 3QIAA 2AI1A 1V38A 1P60A 4R2JA 2GWHA 3N6XA 5DNEA 4BQIA 3FMPB 4LDQA 3UC5A 4M1MA 1RI4A 4GPD1 1JR4A 2XGQA 1N2EA 1VHTA 1HE4A 4FYJA 5LBIA 3JAKB 1UAYA 2IKSA 3AG5A 1M7HA 5KNDD 1ECJA 1T2UA 9ICXA 3IQGX 4GM4A 5CG1A 2CVFA 3SHOA 3CUTA 4ZAFA 1GTRA 1N3YA 1YQTA 2XSZD 4A0HA 3A3YA 4UJ3A 2IZ1A 1E5QA 3CGWA 4HNQA 4D8VA 1P0FA 4IF6A 1K4MA 2BUAA 2Y1IA 3QPWA 5DX1A 3PC2A 4U7FA 3GLFA 2FJ6A 2H4ZA 3HACA 4KVGA 3ZD9A 2KIWA 1NHGA 1DRWA 2KZZA 3ZQ4A 2D2XA 3FSJX 4IH1A 3ET4A 1G8PA 4OVKA 5EP1A 4KR9A 1FRZA 4FHDA 2J87A 4DF3A 4LVCA 1DARA 4W9NC 2AX3A 5J0OA 1UDCA 2C94A 4DO9A 2EH9A 4BTLA 1EK5A 3D3WA 5BSEA 3HPQA 3WDMA 4GLFA 1M8GA 3N0RA 2JB9A 4RORA 2WTEA 4DIKA 4CLRB 1Z0UA 4AD8A 4AL4A 1JI0A 3ONDA 4II7A 2PJZA 1I4LD 3M6MD 1UOPA 4EQ6B 2B1IA 1GL3A 1T24A 2J6HA 2DL0A 1OZFA 1Z9BA 3FF1A 3A9TA 3DL2A 3T15A 4X00A 1BEZA 1C5KA 3OOWA 2XR1A 2XI9A 2HREA 2FA9A 1HUZA 2NYUA 2ZPAA 7ICPA 4CNBA 4J0KA 2BEJA 3ZHQA 2QY6A 2FLWA 2HRZA 2QARA 4QIWF 1NQXA 3MBIA 3S2ZA 1JHMA 1V95A 3C7KA 3LX8A 4BVKA 1KDHA 2BWJA 2FMSA 4G36A 2IZ6A 1DTWB 1NL3A 2ZJ7A 1WV1A 4X6YA 2NSLA 9ICWA 3TLCA 4OK3A 2DPMA 5SZJA 1K97A 2FSVA 3GRPA 2P69A 3CVWA 2LW7A 4U6QA 3FUVA 3B6EA 5BWMA 3T7EA 3GJRA 1FX0A 5CIYA 3P19A 3WRYA 4ICIA 3ZDBA 1G8AA 2RHFA 4O4IB 3F5SA 4Z0HO 4H1HA 1NMQA 3AP3A 2IUFA 4WOJA 3G8AA 4JX8A 5K0BA 5GV7A 4WGFA 1KI9A 5DYIA 4KSBA 1BCRB 2HBZA 1I30A 4DR1B 2FE1A 5I4CA 1TK2A 4FNGA 4QIHA 4UQPA 4F4DA 3WGOA 3R2JA 4M7PA 3WMEA 3NPMA 1MO5A 1EM6A 2G77B 3Q8KA 5L7WA 1OTHA 1AXGA 3RTBA 2NXWA 2AG8A 3C15C 5U4XA 5LZ8A 4DCOA 3GXOA 1IM8A 1G6KA 1NKCA 2AQ8A 2NVUB 1WXXA 3WMRA 4DUYB 2BCSA 3JD4A 5K6RA 1T3SA 2UYOA 3W3AH 1W5TA 2AOWA 5EJEA 1LWOA 3A05A 4K8OA 1D2AA 4GC6A 1TJ3A 1W1IA 3K6SB 3ZWKA 1NK0A 1P8AA 2H1IA 2CEKA 4MW2A 1M0EA 1HF3A 1ST3A 4J6FA 2BMJA 2P66A 3O93A 5JY1A 3ZI4A 3ZDFA 1R0RE 5K51A 2PJRA 2APJA 4GVPA 3WB0A 1NBMA 3K8ZA 1T5IA 4UB6U 1XC9A 3OVMA 5JHHB 2AVDA 5JXGA 3N8NA 1ORDA 2JLWA 3ZCTA 5DE3A 4LX8A 3OP1A 4Z4GA 4WKGA 2MR5A 3OQNA 3DO5A 2B83A 3QE2A 3HBFA 4MW1A 4DC0A 3COZA 3OIDA 4X1KA 4NZNA 1YS4A 1DT5A 3LDFA 2OPBA 5K0FA 4ZQIA 2F9MA 3JARA 1Z0DA 1U8AA 1NUPA 2ZWOA 1KK0A 1W6UA 1WD7A 4CI0B 4BKUA 3EW7A 1W52X 4FFBA 1P1KA 1VIMA 4BQNA 3DSRA 3L93A 4LDRA 2DFTA 1ZLXA 1R27A 5EESA 4LF5B 1KYIA 1BVRA 3CN7A 1Y8QA 4NCBA 2FPWA 3RVRA 3HNRA 3GEDA 3P52A 3IP9A 2MHCA 4CKCA 2KEYA 3KETA 4GSLA 4EJ0A 1B7GO 1JEQA 5WRFA 5KTYA 5AMXA 1QP7A 2FU5C 5KNCD 2ZIXB 3PIRA 3KKMA 4O6VA 1QHHA 1SB3C 4DDMA 3OZBA 2FZEA 2CRXA 3PXUA 1MTOA 5CB4B 2F8TA 3WKDA 1D0SA 4W9RA 2REQB 2I29A 1IOZA 4EBEA 2GCNA 4Q9HA 2J6SA 4HB3A 4EI9A 3SX4A 3EYWA 4O4HF 3A10A 3CVJA 1JQJC 4R1MA 5IJZA 2RI1A 3HCAA 1XZAA 2C07A 1V2GA 3QKSA 3GUYA 1WBBA 4M6WA 1BMFA 2I7XA 3O1JC 4GR5A 1N5JA 3H4VA 2JVIA 5AT1A 4F84A 2DEUA 3LDHA 4J2OA 1ZQ1C 4A82A 2QKQA 3O8BA 5JPIA 1X1QA 8ICKA 3SD7A 1JKIA 3ADPA 3DO8A 4GP7A 3C8HA 2O05A 5CJJA 4MF8A 1ZW1A 1XTVA 5TF0A 1P0IA 4DQXA 1QLJA 4DOCA 5JZOA 2P5YA 1YGPA 4YVZA 4INAA 3ZW7A 1N5RA 4JL5A 5FLYA 1V5GA 3K92A 3N2EA 3UJCA 4RNMA 1D9FA 3DCJA 3NTXA 2VUUA 3LOQA 2B5OA 5C81A 2ZB3A 3F78A 3MM4A 4BNDA 3QYJA 2BL4A 1QHIA 1JXEA 3E9DA 1CR4A 4H15A 1FYFA 2A9RA 3QX8A 2JS7A 4B7AA 2HRDA 4O4LF 3VR5H 3IULA 2C5LA 1A50B 1T6ZA 5FO1A 4ONEA 1M0SA 5JQGB 2LR0A 4HGNA 2ZW9A 3TEMA 1TRKA 4DA4A 2Z0MA 1ZRNA 1NU6A 1SBYA 1TM3E 1ZESA 1RWQA 4K2HA 2PKEA 3H4IA 3MR6A 1ZIXA 2K2WA 2JAUA 3TQOA 3A70A 1Z8NA 5ISMA 1IDN1 2GGSA 1TM7E 3LO5A 1YAHA 1AVTA 1WP4A 1Y5RA 4DY4A 2PX8A 1DOZA 4FXOA 2FPSA 2Z1NA 1KDZA 2CJXA 3I6BA 3IJ5A 5DLYA 2TRSB 2ZJFA 4ZT3A 1AS3A 1VE6A 2Q3EA 4RESA 3RG2A 2XQVA 2H65A 3GUZA 2G5CA 2DHEA 1DIOB 4YQZA 3MELA 3ZH2A 2WHEA 4LWOA 5J2UB 2IYNA 3U6BA 1PEDA 4MQBA 2ZUEA 2C2RA 4HEA6 3BQ7A 2VBGA 4J07A 3ZVKA 5E7IA 4K05A 5FBVB 2O52A 4QG7A 2OG1A 2IPNA 4I2EA 4JQYA 5KHOC 4I9HA 2LD4A 1RQPA 1OA1A 1G291 3DOHA 2O2XA 1XR3A 5EYPB 4MWZA 2WF9A 1Y3CE 4Q4JA 1VI5A 2VJ4A 3U2QA 2W6PA 4NBSA 2KZ3A 3OU2A 5ADVA 3ZD8A 5L1IA 2OGZA 4K9PA 3OQ1A 3H5OA 3RUDA 1GFSA 4RSHA 1Q44A 3WXBA 1ZSYA 2WWTA 2AEEA 3K35A 1Z5UA 1G5FA 3A4TA 4PYQA 4KHPB 3QELA 5IW8A 2HIAA 2IBSA 3WICA 3L06A 3FUCA 4JUFA 3H9UA 4F3OA 3K15A 3L9XA 4LWQA 1SD1A 2RGYA 3LHFA 3FSEA 5AQ1A 1BKYA 1T5SA 2GS9A 3ZCXA 3ZWDA 1C2TA 3A1CA 3RYIB 1T2AA 5DLQC 1L5QA 3CX7A 1NF8A 3WL7A 1Z2DA 5A0TA 4MEAA 3SBEA 4JV0A 3X1XA 1PFYA 5D7NA 3K96A 1G21A 3GHYA 1YE5A 2P1DA 4UB4A 4JOQA 1C14A 4WLUA 1L5NA 1E5TA 1RLTA 1NX6A 5AJWA 3SDSA 3JQGA 2RHGB 3KYJB 4EAAA 4ZHQF 2G72A 5GONF 1BKSB 2YDYA 3MUNA 3PQ3A 4AZVA 5KFRA 3TZEA 4QRHA 1BS2A 4BO9A 4KTVE 4EO4A 1AB6A 1U7HA 1N8KA 4UM7A 3UGJA 1I6LA 3F9RA 5I7OA 5IK2A 2F8LA 2JFOA 3IUEA 5ALUA 4XX0A 3C24A 5EZYA 3EZ5A 3GLFB 5C52B 4MI6A 3K9FC 3QH4A 4BNXA 4DL3A 2OYCA 1F4LA 3SZGA 2RKWA 7ICVA 3GJ4A 4F4FA 4LXUA 5KUTA 3OMLA 1L0BA 1SIUA 1R6UA 3S2SA 2WAAA 4D7AA 1CJUC 4OJPA 1C8BA 2XCLA 3RAJA 2H2AA 2Q7DA 4LNHA 5KWIA 1N5KA 3SC4A 3EPJA 1U9YA 3I9FA 3PRJA 1L7XA 1A9ZA 2DB3A 3AOGA 2VWPA 5L4SA 4U4AA 5DG9A 3W8DA 2RCNA 4QZDA 2R7MA 3TI7A 3PITA 3D3WB 3ST7A 2ZCUA 4QWCA 2HDNB 3JRNA 1QCZA 1U8TA 2OHXA 1N2CA 1NP6A 4W9NA 3AEYA 4Q3DA 1KN5A 3HP4A 3PA8A 3UCXA 3AJDA 2F44A 2PRJA 2A9QA 3DCYA 4W63A 2ISOA 4AKSA 3FGOA 1UZAA 3AEXA 2YOFA 4LJYA 2YY6A 1DWQA 3PKJA 1HE2A 1ZMRA 5DM1A 2OC4A 4NVRA 1GKLA 1AGYA 4DMRA 3IAAA 3PA6A 4Z5XA 4F04A 4KMSA 4UULA 5EZQA 2H3IA 3H83A 2QARB 3FMGA 3IBSA 1I1OA 3ID6C 5EJ7A 4MUYA 2IFTA 1PR3A 4IX9A 4RBNA 2R751 3H4TA 3U39A 3EIUA 5JHGB 5BMVF 4TXJA 1KF0A 4ZU1X 1FX0B 5J2CA 3JASA 3B3GA 5AKEA 3DS8A 1T5DX 1YKSA 2XTZA 2G8LA 3GZFA 3TFRA 3FKJA 1KQFA 2JJ1D 3IAS1 3FDIA 4B74A 4UCXA 3C4QA 1BNPA 3G02A 5DTMA 2J5BA 4B9EA 2JLAA 2QVBA 2XE6A 2F90A 1K8ZB 1Q0SA 5ETJA 2XADA 3HY6A 2E5WA 4BNKA 2YVKA 5DSXA 1U9CA 2DFDA 4YMNA 4OLHA 3WWYA 4P5DA 4R1QA 1O9BA 5D86A 4PZPA 4RPHA 1VMKA 2HA7A 3GLRA 3N8IA 3OEHD 2VHXA 5DYYA 4DE5A 1KARA 1DCKA 1Z4KA 3O21A 5B1EA 1Q3UA 4ME6A 3FPFA 3A2NA 2WILA 3HJUA 3PC8A 5EJAA 1XVVA 2HQSA 1E0KA 1GKYA 3ADBA 3DV2A 2L82A 1XWLA 2FZVA 4Q4CA 2IE8A 3L8MA 2ZS7A 3L4BC 1QDUA 3PT9A 3THRA 3I83A 1HG1A 3EQ6A 3QYPA 4ZI7A 2PWZA 2Y0PA 2DH6A 3RJKA 2C9BA 1ETUA 1SUIA 1ORWA 1RSZA 4TTIA 1NRWA 4PN3A 5BW5A 4ZT6A 3DMFA 1I9CA 3KPWA 3IVCA 3B13B 4ZGBA 5G0TA 4UQLA 4F5YA 1T2DA 2D00A 1N3IA 1SHTX 2DH5A 1KJNA 4CM9A 2H2HA 1TAGA 3RJTA 1POXA 3LMKA 5CDFE 2QZSA 1T0JB 3ANXA 3P9KA 4B8ZA 2P65A 2VXCA 4B6EA 3QKWA 5L40A 1DIBA 5B6JA 3E3NA 3FWPA 5CX4A 5J0YA 4ZPXA 3TD2A 3KZOA 1JDPA 1M0TA 2ES6A 1X9HA 3LZDA 2XUHA 3L4PA 2JI8A 4X1KB 2HZBA 5I8ZA 1JJBA 2OR3A 4J9RA 5B58T 1PSWA 2R68A 4KO3S 3JARB 2QE7A 3QLVC 1T1JA 3SP1A 2P1ZA 4W8OA 3SIRA 1SQSA 1FMLA 1HT2E 3S29A 5AKGA 1DAIA 4RQBA 1Y8QB 3FPBA 4GYJA 2Q5LA 1AQYA 1DAGA 4CKCB 1FNMA 3FOWA 3PZBA 1V1RA 2QPLA 3ZXSA 2D0OB 1JEQB 3QI7A 2PBZA 4KPGA 5F77A 4LOLA 3PHIA 2LKDA 4H77A 2WD9A 1VBKA 3R3VA 2QW1A 2ZBRA 3EGIA 1ODSA 3ELYA 4EATA 1PGPA 3N97B 1IQ0A 1GL9B 2JJYA 4LMAA 4TSFA 1U2EA 3DEZA 4YXFA 1H0HA 2P2DA 1R3UA 3LOUA 4UPEA 4BWMA 3QKSB 5AI9A 3AB3A 3D4BA 4M6WB 3HQ4O 3HNOA 4W7SA 3FWKA 4CTKA 2NM0A 3RTDA 2JLXA 1GRNA 2XNCA 3R1IA 1NQAO 3OC0A 5E9WA 5KFAA 3K6KA 3OFKA 4NOKA 2VJBA 2X0JA 1NI5A 5CLIA 1GZSA 1J1IA 1NR5A 1RMQA 3ZDCA 3VPAA 2TS1A 2AS0A 4RK1A 3HWWA 3KPYA 4EB0A 5AVKA 3WB1A 4F4YA 5CH5A 5K3CA 1U0OC 4XYBA 3K75D 3B1ZA 1LPBB 1EDDA 4F91B 3UJ9A 1M2OB 4LOHA 2Q4TA 1GQ2A 3Q41A 1KEWA 4HVTA 1DUVG 2QNIA 4B7XA 5JCZA 1IN7A 4IG4A 5CITA 1FQOA 3DE2X 1QU3A 1TYBE 2ONZA 3MABA 1WSBA 5KYYA 4NHOA 2H3HA 3IDFA 1LX7A 3MF4A 1Y7TA 3KUXA 5FBLB 2IYAA 4E03A 4CLXA 2L69A 5KSOA 3WHPA 3Q72A 3ISVA 1V6AA 4DHWA 2H11A 2IPLA 5AXAA 4TXMA 4IDQA 3EDRA 5AJZA 3TEFA 3P97A 3ENNA 2VK8A 1AU9A 1J2TA 1E9CA 1O5TA 4F5ZA 3QMPA 1L5OA 2OP0A 4KRGA 4C7KA 1WXGA 3I30X 3CLRD 2REBA 4K9NA 5JSQA 4BAZA 4P80A 1OA0A 5ALNA 3MMZA 3IDQA 1Y3HA 4BAUA 2JD1A 3FMVA 1GG9A 4HUQB 3AC0A 5IZCC 3VPSA 4N40A 3MTAA 5DLGA 4NECA 3DOOA 3KNZA 1JDBB 5JALA 3RF7A 2VHYA 3AFIA 4DMKA 5DHSA 1RXYA 3ROFA 3AUUA 2A7XA 3C3JA 3O7WA 2JLBA 4LTNA 4ED8A 3MFHA 5F5LA 3CF6R 3AM3A 2LPMA 3M8SA 3PX4A 1S0MA 1M2HA 3KRTA 4W5HA 2OXRA 1PFUA 1T9GR 4B3JA 1SUFA 4CYMA 4ANFA 4R2KA 3KFUF 3KXKA 1QPGA 4TT8A 3D6MA 4CR8A 2Q2VA 4K81B 4OX9B 1IBRA 5EMMA 4LOJA 3PQ6A 3LL4A 5JQWA 1Y1LA 3R41A 3CEHA 3LKVA 3G85A 4M83A 3SYKA 2D5IA 5JTIA 3KHUA 4OFWA 4BFYA 2PZLA 2Z08A 3HCFA 5AVWA 2VHCA 2O5EA 3RHFA 2FV8A 3V1NA 1FFUA 2ZJ6A 4LCEA 3LM8A 4OQQA 1PYDA 3UTDA 2ECKA 3NEPX 3BJZA 3BMXA 3SIPA 4IIVA 1H9BA 1H69A 1QE5A 1YF3A 4F3TA 2CHUA 1G21B 2B92A 1UHUA 2Y1EA 4QNLA 5JD3A 3IQHX 2OLEA 3LPCA 2WU1A 4JVLA 1PG2A 3FROA 1C0EA 3JQGB 3ROMA 2PTHA 1NAHA 1YR7A 2WT9A 4W9MC 2V74B 3L7NA 2DQSA 4RABA 4MUBA 4DB2A 4Z51A 5JAUA 3ZV5A 4DFKA 3JWPA 1UP7A 5AHRA 4RPGA 9ICPA 2HK9A 3GLTA 3NBZC 2G5HB 5TMEA 1WPGA 1T3NA 4BLTA 3NASA 4XX0B 5EZYB 2IHVA 1EK0A 4PO1A 2K60A 4Q3AA 4EZBA 2Y0DA 4D96A 3PX3A 2Q0XA 1JYFA 1U4NA 4C8KA 2KW5A 3F4BA 4LDJA 5DG8A 3B6JA 5IJ9A 3SX0A 3SQOA 1VGRA 4ZANA 4BLQA 1QV9A 2CYBA 1W0JA 2IX9A 1ATIA 3IUQA 3OE1A 3CRZA 1EAYA 4Z2AA 4HGOA 3EVGA 1SCQA 1GRQA 3AUXA 1N77A 4FYYA 1U2SA 2C2BA 3T4UA 3EAQA 4C5AA 4AURA 1DBIA 5DQHA 4R2IA 3PNQA 4LZZA 5BV7A 1N2CB 5G02A 3SLKA 2QSUA 1RPAA 1QZZA 3GDOA 1TKRA 2EJVA 2I99A 4DMMA 1NXSA 1SCBA 4GC5A 4EKYA 3VHQA 4BATA 4I66A 3U4AA 2PX0A 5JS1A 4REQA 2E0IA 1QHXA 3D8HA 4FZVA 3VHRA 4YI3A 2UU9B 4HX9A 2VPTA 4H0FA 3RH4A 1VBFA 4CNQA 4B9MA 1E20A 2I7TA 1NVGA 4GZMA 4GG1A 3ZDXB 2PAFA 1KOFA 4IH9A 1Z5OA 3OZVA 2XVXA 1CZLA 2IZ5A 4X1YA 1A7UA 2V97A 4DJAA 1UXOA 2WYOA 3GEGA 2N75A 2H3ZA 4DS5A 4JNKA 3KAQA 2JK1A 3AEUA 3TFSA 4Q93A 2ZUWA 2PY6A 5DP1A 4BV9A 5EIAA 2LYBA 4DA9A 1JTEA 2HBRA 2PRIA 5LSAA 1U47A 4YMUA 4FK8A 4EY3A 2I4TA 2WMNB 1AA6A 1UBGA 4RJIA 4K8RB 2PZ8A 2AOTA 3K1JA 5GWXA 2IOFA 3LVWA 5GJCA 5J0UA 5K0SA 2VPPA 2PT9A 3WA7A 2H9AA 5HFNA 4JLVA 5MFPA 4DCPA 1XCBA 2WB4A 5HKOA 3K9GA 2VXYA 1HSOA 4GGOA 2PN1A 1LNSA 1Z68A 1IU9A 2CSUA 4YWHA 1CZHA 2JGEA 2LNDA 1WQ3A 1X9GA 3KT0A 3WBBA 4WA7A 1H9CA 1IZZA 5C1DA 4ZA2A 2R79A 3HPRA 1NYTA 1WLSA 7ICIA 4I2VA 2P79A 4X8MA 4ASUA 4JBWA 3EWNA 3MAGA 4C20A 4US9A 4NYJQ 2VNKA 3ZKAA 3A4IA 3CX6A 3A3OA 3KFXA 1NZPA 3JQBC 3A9CA 4ZI7B 4QGAA 2QUKA 3VUFA 4LZGA 1KC1A 2HTEA 3K73O 5A6SA 3Q5GA 1FTSA 3BWEA 5EOVA 4L02A 4D4HA 2I78A 2GBFA 1T10A 3QE9Y 2D54A 4ILEA 3DR5A 3TQ1A 1URPA 2J3QA 3AYZB 1YHZA 4BO2A 2MINA 4DXDA 1C3OA 2AMLA 4DIUA 1DEAA 3G9ZA 2E37A 4JB2A 1I5EA 1T6BY 4BX3A 4E11A 2P5SA 8ICTA 3D6JA 5F64A 1WQ1R 3H9EO 2IHJA 5BVGA 3FCUB 2ACVA 4ZAVA 1P7CA 1XQVA 2UKDA 2WYIA 1GTG1 3S5UA 3LF1A 1X7DA 2NADA 2Y99A 2JGNA 4IHJA 3PGVA 2KJ5A 1A3CA 3PHLA 4RGBA 4MAMA 2PH1A 2J6UA 3LQFA 5EI5A 4ALNA 2ZT7A 5C1IA 4DIOA 4AS1A 3OZXA 1YBFA 2ADFA 5DB7A 2Z6QA 5EQTA 1KJJA 4X61A 3EOAI 5D49A 2CE2X 5GZ3A 1G17A 1P0MA 4BO4A 5ILOA 4Z6KA 4DCCA 4OAOA 3RS5A 3QLVA 2A19A 1V1RB 4B4DA 3V4OA 4OOFA 3E48A 3PNSA 2IHBA 2AUNA 1N7IA 2YJTD 4TMFA 4X60A 3S6JA 2I71A 2AI3A 1F0NA 3F97A 4RVFA 1A4XA 2JMGA 4CUJA 2AJTA 3BMNA 4LYEA 2ISQA 5DJ5A 4NBWA 3FB4A 4U2BA 2ONCA 2CXUA 4AF7A 4EZEA 2H92A 3V55A 2EXXA 2E4WA 3T7AA 4EG1A 1ZX1A 3ZIUA 3CZMA 4A2WA 2VIXA 5CHGA 2PFKA 1J33A 4CLRA 4E5UA 2GXUA 4KO1S 3JD1A 4MUEA 3NBKA 3TRHA 1Y5NA 3TLMA 2RDMA 4HXYA 2R44A 5BR1A 2W8KA 2J0SA 2IXAA 1C4WA 4C7VA 4XB1A 3KSUA 3QMVA 3U4HA 1SO8A 1GUFA 5L1MA 1KQOA 2KMLA 4WN3A 4WVFA 2DPLA 2B3DA 2ZTVA 4B9TA 3SC3A 2IEAA 2W7PA 5DN6A 1VG0B 1E0JA 4IS3A 3PFGA 1E1NA 3ECSA 3WYEA 5FD8A 3WRYC 3GT0A 1DTWA 2R85A 3OQJA 3DZFA 2Y9PB 1WOMA 4ENSA 2QDKA 4ZCPA 2Q1SA 2JK0A 5KYYB 4RWEA 4MV6A 3ICVA 4JK3A 2P9BA 5BR8B 2Q2NA 2ETVA 1NYLA 4O4IA 1AO0A 1FMCA 2W2OA 1H42A 4NTZA 1DOQA 4FUQA 3MTBA 3VJRA 4PTYA 4ER6A 2QUZA 3JPYA 3MBYA 2FOXA 4BS9A 3LCCA 1ZQKA 8ICQA 1RWKA 1DE0A 5G3YA 5KJFA 2W4IA 3H6HA 5HEKA 2XZLA 4ZVSA 3WV5A 4BV8A 5LMZA 1XRJA 1XMXA 4WT7A 1VRWA 3ZWMA 3L1IA 4MW7A 2UDPA 3AVYA 3PTLA 4BRWA 4Y18A 2QM7A 2CD7A 1Y1RA 2ZZMA 5CFPA 3G9XA 4YUZA 1MX1A 5T3UA 2NVUA 1CEXA 4MDEA 1ICEA 4CM3A 3I5UA 1Q0HA 4XD2A 4JI0B 1CQPA 2C5HA 1HZJA 1PJZA 2QPOA 5ENDA 3CRQA 4JKOA 5J2GA 3Q2OA 3IQFA 5ERYA 1J20A 4LY9A 2RJNA 4KBGA 2PWBA 3WGTA 1P9WA 5IZCA 1YAJA 3D81A 3NDIA 3LBAA 4IRKA 4EJFA 1L8QA 1W75A 4E94A 1BE0A 1Z25A 3L7AA 2QR2A 1MHPA 4E1VA 2A58A 4V2UA 1T8RA 4AJ2A 1CY2A 2O06A 5LDGA 3ETDA 2R25B 2BGKA 1YBVA 5DYTA 3HVJA 3CW2C 2JFBA 3RAEC 4BJ1A 1QGAA 4CR6A 2LGJA 1N6HA 4F5PA 5FWAA 3SICE 4BP1A 2VRBA 1ZJZA 2HMXA 1V43A 2ASVA 2CHGA 1ENPA 4LDAA 3W1VA 2IGBA 5I3ZA 3T9AA 1ISIA 1XLTC 4BVBA 2Z4SA 1UP6A 1QVAA 2VC2B 3BN3A 3EGDA 3T7IA 3T3IA 4O29A 4JLUA 4I6EA 3BD7A 4NSNA 2CNWD 4XH9B 4ZAZA 1T9BA 3X2SA 4HAYA 3WLTA 2BGRA 2NV2B 1SU8A 5LKRA 2EZ4A 2H06A 4COKA 2C8JA 4OIMA 5JEEA 2AV6A 1DG3A 1EZ1A 2EHDA 2IHUA 5JU5A 3KYCA 1Z0IA 1ZYUA 4LF9B 4H0NA 4HQLA 4YUVA 4JJEA 3BAZA 3I8OA 4RTKA 3GROA 4CTOA 1EG7A 3LQ2A 1K3UB 1M83A 4H3KB 1Z13A 4L15A 5CXSA 3HUFA 4KLFA 1Y4UA 2A5FA 4L8VA 5CB4A 2XQKA 5JNWA 4HGQA 1J0BA 1O1YA 1GSOA 3A4NA 5DDYA 2GF2A 5L7TA 2VDPB 1OSNA 3MEQA 4ARIA 1EYZA 2ZU0C 1D1TA 4QW8A 4ZOBA 5ICFA 3JYQA 3K2IA 2XWJI 4BRUA 5AKXA 5IJ9B 3PGA1 2C7PA 8ICBA 2D62A 3NVMB 3MOSA 3KEQA 4PHCA 5EKTA 3S3TA 5AM0A 2OCGA 4G63A 5FWNA 2RHOA 2ZSAA 4KFTA 1QWSA 4BLRA 3I6IA 2YXBA 2RFLA 1NJWA 3KXLA 1QG0A 5CP2A 3N0VA 1TKDA 1PP4A 1GP2A 4CFZA 2WVJA 4QJ5A 5EWLA 2IUUA 1V7PC 1JPVA 1X7HA 2C78A 1IATA 3TVTA 1ZICA 4I9UA 1PL0A 3HJBA 4LYHA 4REQB 4BLSA 4QU9A 4I1OA 5EXDA 1CNMA 1GPUA 4DVGA 5IT5A 3TDMA 5EZSA 3OQPA 1VPLA 3IP8A 2CPRA 5GV8A 1C9YA 2EW1A 3L5OA 2ZI5A 3PY8A 5DQIA 1G9TA 1NLFA 2NUAA 3ICEA 2MJLA 1ZIYA 2HHVA 3H0LB 1V45E 4YMLA 3TLKA 3BM5A 2X1LA 3QLEA 1NK4A 4PX2A 3OY7A 4YRFA 1DFIA 4KRYA 5KCZA 3LC0A 5BV1A 3AEUB 4LGCA 1LSJA 7GPBA 1Y6GA 8MHTA 2ZBVA 4N65A 5C1PA 3N1UA 1WVIA 3K9HA 4ZEVA 1YQDA 1JDBC 3DAPA 5ITWA 3SXUA 4YRQA 5SY6A 3KZIU 2XECA 4RQ6A 1KMCA 1ULZA 2VBCA 5JMTA 3LQKA 3PFBA 2C20A 3IUMA 3UATA 1QTIA 3S2EA 2F76X 5HX7A 1MHTA 3G0OA 3SYLA 1VCIA 4LC1A 4HLNA 2GZ2A 4BBZA 2AOTB 1YRWA 2GAOA 3LY7A 4R6WA 1PS8A 4FBGA 4KXWA 1DFGA 1M8PA 3FDSA 4BGVA 1H1DA 1HEIA 3IHQB 2EEPA 2AGPA 2GZHA 1AUOA 3OX4A 1XOIA 1HMYA 2WJAA 3VYVA 1IC6A 3HXTA 4DBVO 2AR7A 1W25A 1MAAA 2QN6A 4CM5A 5ITSA 4QWWA 4ESHA 1KAGA 1JMKC 3B1JA 5IM4A 1ZJNA 1CJKC 4HMOA 3CW9A 2BMAA 1SBIA 1E89A 5DXAA 2M2IA 1ECGA 1TM2A 3NBUA 1OVMA 3OF2A 4HATA 2DJ5A 2P4UA 5GZ6A 2AG5A 1TIBA 5ER6A 2ZI6A 3EY4A 3MLAA 2X4GA 3GNLA 3L3BA 4M1TA 3H04A 1X7GA 2OBBA 3FOEC 3HB0A 4DAEA 4JC5A 4IF4A 5TDHA 4LY0A 2BGWA 1ZQMA 2ST1A 3JQBA 2WWWA 3PKIA 1CX9B 2MINB 2WU3A 3RYIA 5ALJA 1C3OB 1G7TA 3L7OA 4PWYA 2NRXA 3I2GA 1SUCA 3I9LA 1B26A 2TSYB 4TLDA 1KEUA 5AKYA 1FP6A 1Y37A 3USZA 3FA2A 5BVGB 3D2SA 3LHIA 3JV7A 4LJKA 3ZHVA 5IKEA 4MGZR 1NXWA 2MOKA 2BDEA 4QTZA 1E1QD 1OJ7A 4AJIA 2HHCA 2A86A 5ESRA 1UINA 3ZVRA 4IHJB 1NY6A 2FSFA 3FSGA 5FRDA 5LN1A 1PJSA 1JN3A 3PSAA 4Z4EA 1FF9A 3H13A 4E5NA 3W2IA 1T8WA 3R3WA 3ENVA 2FEPA 5DBGA 1YFKA 4RJKA 1Q50A 4BO6A 1ZJJA 1YRQA 5EWMA 2WYWA 2Z9DA 4CHTA 3S81A 4NAVA 2LWIA 4A03A 3OZSA 3HBLA 5D8DA 2J31A 5CFLA 2VXOA 1ZO8A 4CG1A 3GBVA 1ISFA 1YZLA 1VLQA 3Q0EA 2EFGA 1SCUA 4IHKA 1F2VA 4TRJA 5BSKA 2A6PA 4MARA 1U8CB 3BMNB 3UMJA 1LBQA 4TV8F 3EA5A 2H18A 4LXGA 5A1JA 3D3JA 4AFNA 3U37A 1P1IA 2CYCA 1EFHA 1C7FA 4KVFA 4AG3A 4EW2A 1ZJ6A 3C6QA 1I3LA 3TDKA 2XCUA 4XJSA 3AU2A 4Q21A 4JI8B 3WIVA 1AM4D 3L7DA 3WZLA 4DBLC 4BZXA 4RU1A 3ZWYA 4LXIA 1XVAA 4C4RA 4G01B 1OV6A 1SB9A 1IEVA 1W0CA 3COSA 4CKEA 2OBFA 1Q22A 3UXMA 4DC1A 4L6IA 5IDXA 4DEXA 1Q74A 2E6KA 4WJZA 1UA0A 2HV8A 3W90A 3HKCA 1CEEA 4QNNA 3R7LA 3MS2A 1KNXA 4P33A 4Z3KA 2QB5A 1NOKA 3PO4A 2PSSA 2YXDA 1SWVA 1M2FA 2XUKA 5DBBA 1NRXA 2FCAA 1V16A 1JYSA 2CDAA 2GEBA 5BT9A 4LE1A 1TO6A 2FHSA 1JR2A 4XWOA 4DJDC 3RWMB 4GOLD 4C0AC 4M88A 4MVJD 1LSOA 1BGXT 3V97A 1A9QA 1BNOA 5AKJA 2QM0A 1Q2XA 1RM6C 3PC8C 5K8CA 4DV2B 1BD3A 4QREA 4RJTA 3HDTA 1C7JA 2BFEB 2FFRA 5BNZA 2EL7A 4Q4DA 4BDSA 3RSSA 1JA1A 3BL5A 2X0EA 1XCGB 1KFTA 1KFKB 3PWZA 4TS1A 5BNWA 3LQRA 8ICRA 3RD5A 3V8VA 1TT7A 2IXDA 5IN5A 3ZBTA 4KREA 1EDEA 2ZSHA 5DXJA 1TUIA 4G0XA 1NN0A 2BN4A 4UUQA 5J1SB 3M5CA 3B51X 4E7PA 2EF0A 4Y2TA 1HT3A 3AF4A 2A9JA 4G5HA 2DUMA 1VCMA 3MBKA 1MA7A 3OLZA 1J5PA 1U9ZA 1Z8FA 4PHFA 4MB0A 4PRLA 1DV1A 3GG9A 3T1OA 3OHMA 1JSXA 2GEKA 3JXEA 1C3VA 4RLFA 1KY5A 2D59A 4P4TA 4IUCS 2R1ZA 1YZVA 1N0HA 2W4MA 4Z2YA 4YMIA 3IR7A 1Z26A 4CTMA 4TXLA 3H7IA 3EWAA 3CW2A 1NT4A 3EGDB 2PFOA 1CUGA 1XTIA 2BSQA 1W44A 2P91A 3A3PA 3UG6A 1TFRA 1T4MA 2ZRDA 4J9NA 2E1PA 4EUSA 5EWFA 1XLTA 2ZXEA 1G9SA 3KJXA 3GV7B 2VJPA 4KUHA 3N3AC 4OQDA 3FRHA 3KYCB 2EW2A 2BJVA 3HEMA 1WB9A 5E1DA 3EOBI 2NACA 3PQEA 3GP8A 1SXEA 3K31A 5GM1A 3F9IA 4U9HS 2NT3A 4Q3KA 1ENOA 1KSPA 1N1MA 2W70A 3F8SA 5I51A 3RARA 1NRIA 3EDOA 1MU0A 4JT4A 3ZZ1A 1XTQA 2VA8A 3RROA 3LVBA 4D92A 2AOUA 5F12A 2IS6A 3FLMA 3PNPA 1Q83A 4GAEA 4JT9A 1COOA 4PY2A 1U0SY 1Q1NA 1TYCA 2YYZA 2D5AA 1PS9A 5KFBA 4II2A 4ZAGA 1DKQA 3MD0A 1P1FA 3H87A 4WBNF 4XUDA 1F8FA 1RWWA 3RT7A 4PYOA 4PN7A 2E3JA 2OGSA 3H8SA 4CUZA 3GH3A 1EUCA 1EVZA 3GJ3A 3ITDA 3U9LA 2G6TA 3PPIA 2FN3A 4E2ZA 4BQEA 3Q8PB 4KG7A 3KAPA 1QFMA 3GJZA 1C0KA 2ORVA 3OT5A 1XYYA 2GVDC 1D2CA 1MSWD 5HHTA 1M2OA 1C9DB 1KGSA 3H5VA 5EWLB 5KTTA 4YYEA 5LMUB 2C7BA 4NCJA 2RGXA 3GX1A 3R7DA 3GN2A 1QE3A 3WLQA 2G3YA 4PAQA 3EEOA 2Z8YM 3CLUC 2J5KA 3U3RA 4O2BA 1X6IA 4QYIB 4BIIA 3PW7A 4ZAWA 5C5EA 2Z9BA 3GRFA 3O31A 1NMYA 2R2AA 2WJPA 3WQBA 5EP3A 2BCEA 2NUAB 2X40A 5CBKA 2ZRLA 3DDCA 3RQIA 1P4GA 1KY2A 1YL5A 3SHWA 5IVPA 4N82A 4ED1A 4E22A 2OHFA 5JAOA 5JSYA 4WV3A 4IL5A 4B8YA 3SXUB 4ZH4A 2GRUA 2R65A 1JIHA 1BQ4A 3HO6A 3ZY4A 4HUQA 2Q5IA 2WNHA 3NVKI 1YS1X 1SXJC 1JU3A 2PZGA 3WLKX 4UPVA 1QIKA 4FFOA 4RK7A 3AFHA 2DQ4A 2PZBA 4C0ZA 1QPBA 2W0MA 4EL5A 3H1FA 2JFXA 3NO4A 1QYXA 1X1SA 2BGJA 4GZ6A 2BMFA 4NBVA 2HF9A 3AW9A 2PQMA 3OFVA 4YMWA 1GV1A 2AXPA 3NHAA 1GT6A 4IJ5A 4LSGA 1LLDA 4M86A 5F4ZA 1MB2A 4YG2A 3QXHA 2R86A 4N4AA 1B1CA 1GD1O 4OHZA 1YU6A 2CHFA 1X1EA 2GJKA 2FSHA 3P0IA 4KQWA 3TOCA 1SCIA 1ZGBA 3FAHA 1T4DA 4U3JA 1N7GA 4HRVA 3U7IA 5HMLA 4LHSA 1WY5A 3UWMA 2HBJA 2C5SA 3R76A 1NUQA 4FDVA 4GI3A 4RK6A 4ZVMA 5SY4A 1AHPA 2YUTA 1MORA 4TS3A 3FPKA 2HPVA 3GJ0A 2A78A 1OUMA 3OUTA 2FDXA 3OZFA 2XUFA 1Q91A 2D0PB 5F76A 3VKGA 2X8AA 2E55A 1ONOA 4NY1A 3K0KA 5JTTA 3PF9A 3KV1A 5F3RA 5JS2A 4QLBA 4NOMA 1ML4A 4UPDA 1EJ2A 4UAUA 4NF2A 4BPBA 2IHKA 4NL9C 1P2GA 3DFKA 1CP2A 1BEEA 4QZAA 1VYTA 4MVJF 4XB6B 4ACBA 2EX1A 4BNIA 2MSNA 3KEFA 4IDHA 1QQTA 2G9ZA 5CUQA 5E8RA 1QORA 1ADCA 3PEEA 2XMBA 4QU5A 4IQ4A 4XDZA 5ALOA 3KXIA 1OW5A 3FWZA 4JLPA 1NA5A 1VYVA 2YW2A 1KJIA 1NE7A 1YQEA 1OREA 4WW0A 4QELA 4WZZA 4LJ6A 3L0ZA 5AJYA 5EWMB 5G2OA 2H4WA 4Y2RA 1GN9A 2QTFA 4AMBA 2OTCA 1J07A 3IJEB 1PUIA 2I6FA 4W1QA 2A4KA 4F3NA 4BX0A 2JFZA 2WOOA 1T5OA 2ZSIA 3NJ4A 1I10A 2JH7A 1SCUB 5KG3A 2Q0QA 2BUCA 1NNEA 2FQYA 4BNHA 2FPOA 2OCXA 4A2CA 4NBNA 4QQ8A 3LUJA 3GFTA 2FZGA 4YRNA 2HU2A 3FVTA 3M9NB 4XYEA 1MAHA 1N7JA 4MUJA 4B9UA 3JQ9C 5KFUA 3CNBA 4L51A 5B5EU 3OCVA 1IQPA 3EIOA 4DCGA 1JG3A 4FMCB 4JYPA 3VVLA 5DTEA 4EG8A 5FBZA 2XMRA 4K87A 4X0EA 3V80A 1XK7A 3UFXA 5H9VA 4WBSA 2VSOA 3VZRA 1FJ2A 1VKJA 3FOZA 4CKEB 2LIPA 1T13A 1KO4A 1U0JA 2GBLA 1ZZGA 4Q15A 4BMCA 4HL6A 1QZUA 2G4VA 3HKCB 2Q99A 2Y4NA 3NGMA 3MFIA 2FMKA 1GA4A 4TRNA 4DSNA 4M36A 1UCVA 4IWYA 3B9QA 4MRSA 3V7YA 1XVIA 1H2ZA 5CR0A 5AJUA 2BTQA 3JZIA 1GHTA 1V16B 2ZB2A 1DC4A 5FWDA 1NK9A 1DXQA 3E9QA 3HL4A 1D4ZA 3REQA 3BX1A 3ADDA 3BTOA 5ES3A 1TCUA 1JNYA 3C29A 4PXYA 4HNAB 1F48A 3TZCA 1JSCA 5EQDA 3CR7A 2F4VB 1WO8A 5KOHA 2QTGA 3TS1A 2WM9B 4MLDA 4G4SP 3LI2A 2C99A 3RAPR 1L7RA 3B53X 1P7PA 5GQSA 3RVQA 4ZK6A 5DXFA 3OU6A 1MW9X 3BH0A 4HEQA 3GL9A 3GELA 3VUEA 4UCFA 3MJHA 2DUUA 2R8JA 4G26A 2JLCA 1YQWA 4PW0A 2WDZA 5DFAA 8ICPA 3BKWA 1BE8A 3HZOA 2QN2A 1M54A 3G5LA 3SQMA 3DDSA 1NIPA 1G8JA 4DMCA 1P7WA 3NKVA 4N54A 5A71A 2YYAA 2XUJA 3D1LA 2ZSFA 1MA3A 5IHPA 5C3UA 3QU2A 4IUDS 2JDIA 2XNJA 4AX8A 4UQGA 4M8NE 3S7ZA 1E9SA 2NTYC 3MA0A 3IVRA 3GNQA 2IV7A 3RSHA 2WUFA 3NDJA 3P5SA 1R4AA 2C54A 3FOCA 2CLLB 1P5ZB 3OQIA 4HFNA 2BGMA 1NXOA 3W9UA 3DLBA 3JVUA 3U49A 2R97A 3OEYA 1N0WA 2ZR7A 4NCKA 3PFCA 3I5AA 3TXYA 2CJWB 2G71A 4I2DA 3WL4A 1PR2A 1V3UA 4WDQA 2H57A 3Q1KA 4IRMA 4TKZA 1U4SA 1RLIA 3GLFE 2DRIA 1T26A 3RSGA 1YVPA 9ICHA 4Z9AA 4QOIA 3C3BA 2DBYA 1XA0A 4LC9A 1R10A 4EGCB 1J8MF 4M0FA 1AUVA 5FR1A 3FDFA 1JFLA 1JSRA 7ICRA 5I8PA 1I2DA 4Q3EA 3MJFA 3ZWXA 4Z6CA 5FUWA 1XTPA 1NW5A 4CMJA 4WKOA 3VSCA 3RU9A 4NZOA 4WASA 4U39A 1SK9A 3PE6A 4AKGA 1SXPA 3EN0A 2ZOSA 5ALIA 5CWRA 4BNTA 2IYSA 1G7SA 5CT6A 3FMIA 1JIQA 1PJ8A 2PZFA 4BDPA 4L9SA 3SZ2A 4URYR 3WRXA 5KTOA 3TFQA 5JVDF 3PX2A 4NG4A 4ETWA 4D44A 1TMOA 1FMTA 4N7MA 4IJMA 2EKLA 4N5NA 2F3SA 5D85A 3A6LA 1HKUA 3NOQA 2K87A 4U0JA 4HQNA 3MHTA 4Q1VA 2Y0EA 2AOUB 2Z83A 2D3TA 4ISBA 5FOTA 3LQ4A 2QJFA 2FSPA 3ZBPA 2O54A 5E38A 2NXJA 3GWGA 2FZWA 2JFGA 1MUUA 1RYUA 2VWGA 2WTFA 3EZGA 4MHTA 1D2RA 3H2ZA 1QTNA 1E3DA 3K72B 1U2PA 2FZ5A 3TXXA 1XKTA 5UKDA 4EY5A 1V7ZA 4EM6A 3LPNA 1N5MA 1EUCB 3H7AA 1V35A 2GEFA 2JW5A 1A0PA 2BFAA 4PQGA 1V6CA 2NPFA 3H3FA 2ZUFA 4UW9A 1M1XB 5DLPA 2ZPUA 1AQUA 2PT5A 4I3FA 1USIA 4OL9A 4E33A 3PHBE 4O2BB 1WA5A 1NJ2A 1Z19A 2XVAA 2M6RA 4IR1A 4L7VA 3EEQA 2ZRPA 4QBIA 2JGRA 1FW8A 4B09A 2P9TA 1EJ6A 4LJSA 4CQMD 2Y2UA 1GU1A 2LHTA 3OURA 1KDTA 4G67A 2GPNA 3EISA 3L2OB 1WXQA 4RE6A 2I55A 2IVZA 5IKOA 3WYDA 1BGVA 2J7PD 5B2EA 5JBNA 4C21A 5BXYA 3RFFA 1TUGA 1MJGM 5KYVA 1NNLA 4YVFA 1JQLB 3A6KA 4V1CA 1MGPA 1MF7A 2AN9A 1Y6QA 3HVIA 1NVEA 3FTCA 4UHKA 5F9MA 4MINA 1NATA 1OLXA 3UAWA 1WR8A 1ZOPA 5E4YA 1NXTA 3B89A 2WF6A 2WTUA 3IAXA 5HFJA 1XJ5A 2G0AA 5TMDA 1NBME 1Z47A 4DSEA 3JWEA 4YCCA 3RRBA 2IHZA 1SXJA 2FQWA 5BOLA 2XD4A 2ZTLA 5KHLB 2B5VA 4KV9A 4LAFA 4J0GA 3VNAA 2WF5A 3OTGA 1YWGO 4B47A 2YIDA 1EUQA 1VI6A 2XMPA 3OCCA 1SJ9A 4GO1A 1NV9A 4WEQA 3I04M 4DCMA 2JVJA 3U60B 4U3JB 2CVHA 4AYBC 3ESRA 3G5AA 1PZNA 1TTTA 1SKSA 1NR7A 3CEMA 4GSKA 5HJEA 3ZY6A 3DMYA 5FB3A 1X42A 4PE5B 1W88B 3FLBA 3C48A 1S0UA 5G4LA 1MW8X 4EGQA 1F3OA 3D1VA 1KTQA 3H0KA 4ZJPA 1H8HA 4FS8A 4ZGWA 2LZ0A 1NP7A 4CL0A 1THTA 3LX4A 4V02A 5DIFA 4AKEA 2NZVG 3TK1A 1H05A 3K9QO 5HQJA 3ELDA 2M6SA 3QXGA 2POCA 3W4IA 3OJSA 1RPTA 1SZPA 5EJIA 4L8GA 2BDTA 4AJOA 4P0PA 4O33A 4MUKA 4U9UA 2O0KA 5FV4A 1GM5A 1TW3A 4ECQA 1TLTA 2NO5A 2QY9A 4NL9A 1JL3A 3HJNA 3ZHYA 1LBIA 1AJEA 1JA0A 4R9VA 2CFRA 1WD5A 3ACDA 3CTPA 2OK8A 4DVJA 4KPFC 2BTEA 2ZZNA 1E62A 5J59A 3V7LA 5EP4A 4OU5A 3DOFA 1UMBA 3GOQA 3WTCA 5HUJA 2B2NA 4OJQA 5IBCA 4DQIA 2RHBA 3CJTA 4MZDA 4FD2A 1VSTA 4GX1A 1EQ2A 1K7EB 4KXFB 2PX2A 4JBIA 3UICA 4DMHA 3D6HA 4GLJA 3JQCA 3PKZA 2VQ6A 5I7VA 3CLSD 3QWIA 2HPZA 2ID9A 1T35A 5KNBH 1OU4A 2V7UA 1E8DA 2F2TA 1RCTE 1JDJA 1EK2A 1V5IA 1SBCA 4D46A 4XQCA 1TQ6A 3T5TA 2G9QA 1SAYA 3TLXA 3RRMA 3L6EA 2BI4A 1KZ9A 1HDXA 2DWQA 4L57A 3V4ZA 4J4BA 4CKZA 4L5YA 2ZUTA 1GPJA 1XJQA 4LYDA 4M3NA 4YJHB 1NPDA 3HUDA 1NG9A 1QFXA 4RPLA 1W8DA 4FFRA 3ZY2A 2EBFX 3LWBA 4OP3A 2JI4A 2XNHA 2X4IA 1KP3A 5GAJA 4AM8A 2GI4A 4A36A 3UFXB 5DMXA 1AQLA 2X1VA 3NI2A 3B5EA 3JQ9A 3MJEA 4DMGA 3ZW9A 4QPZA 1IXRA 4QECA 2X8JA 5IUNC 3PR3A 1VE7A 2TMKA 2YKGA 3A27A 2C7VA 1J9GA 3GQCA 1UIRA 4TKLA 2Z5FA 2B30A 3DKKA 3KR9A 1FFCA 1TEHA 1XD8A 2XGMA 5FTNA 4ILKA 3BULA 1OC4A 4MRPA 1T3QA 1GTL1 4YAGA 2BTQB 4QWAA 3A4YA 4WCDA 1T25A 4CV1A 2Z58A 2ODEA 3DAGA 1MPXA 4D0LB 3K4GA 2RP5A 3REQB 3OOSA 1N1EA 5E0OA 4AVYA 1I1QB 4DV5B 2YV4A 2DHCA 3DZHA 4D97A 2PWYA 3WLNA 5KOHB 4ZMSA 5BWLA 2DQKA 3M83A 4XX1A 1G6Q1 2GARA 3D8SA 2BH2A 4OSEA 5CM8B 1D2MA 1C3XA 5I7FA 1JXOA 1JA9A 1Q3HA 4E5MA 3H19A 3BEDA 4RPJA 3WAJA 3OUUA 1C1XB 3JQPA 3VGPA 4U8HA 2I76A 5JNTA 2C3OA 3Q9SA 4B3BA 3VH3A 4A26A 3RUAA 1LDGA 2XNDD 4Q1DA 4FMDF 5AW3A 3KQUA 1QIFA 3LUGA 1EVLA 5IEBA 3I2JA 4Q9KA 3AH8A 1TQ2A 1HYQA 4XVRA 4IDNA 4M55A 4RH1A 3VVMA 3I6QA 2MSDB 4FQ5A 4UVDA 1ORVA 3PO5A 2RAUA 5CH8A 5D3KA 5LZ7A 4UHJA 3L0CA 2XEXA 4KVZA 4Z53A 1CDOA 4BNYA 3AVWA 3KAJA 1XTRA 4YP0A 3OQIB 2BI8A 3IMEA 4JP8A 1OV4A 1OW3B 4HKTA 2OFXA 1VI2A 2O7QA 4HTFA 1XN4A 2YX8A 3NRBA 4QTTB 2IYEA 3NHPA 3CVOA 3T0IA 4C0SA 1C0PA 5C1BA 3OD5A 5IINA 3SFZA 2IBMA 3RFVA 4TVKA 2GAJA 2HMTA 1UWLA 2Z98A 3O91A 3V7WA 3FLEA 3ZWQA 1YC2A 2AGVA 4DUPA 1CUKA 5AYVA 2DLDA 2HQ1A 3PT5A 3KTDA 4HV4A 1G5RA 3H9QA 4HTAA 1WMEA 1Z56C 1M2JA 4OHXA 2PO7A 5J2FA 2B4YA 4QUAA 1P1CA 2QZ9A 5CHYA 2OPHA 5FP0A 2HH9A 1QYCA 2BBTA 3D6VA 2WEKA 2VP2A 4RKEA 4YK7A 2QL9A 3P0EA 4P54A 1THGA 1T4CA 1HY3A 2GPAA 4B33A 5HR6A 5AI5A 4D8UA 3ASZA 4GPBA 2GN4A 3FX2A 5HP4A 4P0TA 2H4XA 2AWNA 1D6JA 3KR0A 2CFOA 1IYZA 1BMDA 1FVOA 2QE6A 2NSYA 3N28A 3VKVA 1ZUWA 5BPFA 1AKNA 4WXEA 3SBDA 3BH6A 3B5JA 2H5IA 1ZM9A 5KNIA 3DXYA 2FPGA 4BLWA 4FEYA 1IN8A 2ZTEA 5FPTA 3U19A 4FYKA 2FMPA 4J91A 3RC3A 1SZHA 4DBLE 1E63A 3GFGA 1W8IA 3U5ZB 2XZPA 1GU7A 3OMXA 5CBPA 3I52A 3URKA 3DCNA 3T9FA 2PSJA 4MB6A 4RJ2A 4GF5A 3G9UA 1UZUA 1Q1GA 4ETIA 1E1CA 1S2NA 3IPCA 2ISSD 7MDHA 3O8LA 2W9CA 2J9YB 1CULC 2C2YA 1CF4A 5K45A 3DHVA 1JQDA 4MJ7A 4PHGA 4GOXA 3RVOA 1UQVA 1F7VA 1UADA 3L4EA 2ID7A 1E2EA 4YHHB 1W0KA 2FPXA 2H1CA 2ZTDA 1E9FA 3E8MA 1FFDA 3L82B 3ONNA 3TLGA 3QV1A 5KX5B 2CDCA 1I6MA 1GNVA 5TQVA 4WXMA 4G56A 4L0DA 1V4NA 1VHLA 7ICTA 1RQNA 3TB6A 1TDJA 5JCJD 4NDNE 3IRUA 1LK7A 1NKTA 4DYVA 2X9LA 4NE7A 3MWYW 2AMYA 1XX6A 4RVGA 5EJ4A 3L92A 5KG7A 1JDUA 1VJRA 2BFEA 2HK6A 2P4HX 3VNVA 4JX9A 2GFHA 2OESA 4ZOQI 4QICA 1PQYA 1RZVA 1IULA 5CDHA 7ICNA 3T41A 5TSDA 1EP1B 4OLJA 1PWXA 4V1CB 3OY2A 4QOSA 1CJCA 1QQAA 2IP4A 4BVAA 4ER3A 3M4ZA 4MJLA 2ZB7A 2GHIA 3JALA 1X0VA 3C3MA 1OLXB 2Z5LA 5GIOE 3O4FA 3LC2O 2D0DA 3KSZO 3N39C 3WWOA 2GXAA 4Q7JB 3DAFA 4IJ6A 4WMLA 2C2MA 3ABRB 3CE9A 3D59A 3HCEA 4TL8A 4CLHA 4HLDA 1XBTA 3UY4A 4UB2A 4TWAA 2XB8A 1DNPA 1HFKA 1SXJB 2HCFA 4N9WA 3DL4A 1D9XA 5DMHA 2MU1A 3BTSA 2K4PA 3SVZA 2F7SA 4WFIA 4P3NA 1PVDA 5BSWA 3T5GA 3AVTA 1GKUB 4R8VA 3KYIB 4XD7A 8ICUA 3L6UA 3MMXA 3RYCB 3ETRA 1JI7A 3V3KA 1T6YA 1USKA 3JTMA 3Q8SB 1I9GA 3EMVA 3HFJA 1D09A 1J2MA 1PNRA 1HDCA 1MQ8B 2YS7A 1ZD4A 4CL8A 3AW8A 3A8TA 4I81A 2BSAA 4PFSA 2HJRA 3VJLA 1X3LA 3EASA 3RKSA 1C7RA 1M75A 1FIUA 4F5RA 5JRZA 4KGZA 2VP9A 5EJ8A 2D7DA 2VJKA 5ITVA 2W03A 1L4HA 3V2UA 3WWCA 3DGFC 3TCNA 2FAXA 2PT6A 1U48A 1QIMA 6GPBA 2WB1C 2GZSA 3LWDA 3N2GB 3ERCA 4P2GA 1J0AA 2X2FA 2PZAA 1XNRB 5E79U 1F9EA 3WDKA 4C0BA 4ZVQA 1PK8A 4R9SA 3W7BA 2QUJA 2H7XA 2EZZA 1PVRA 1K2WA 3KSMA 3O8OA 2DWOA 2X9NA 4P0PB 4RTMA 2UZAA 5A06A 2H00A 2RAVA 2EV9A 3COJA 2D5CA 4EY7A 3GRAA 3OKFA 3DMNA 4MAAA 4WKPA 4EGFA 4OXKA 1UXJA 2V9CA 4FP9A 4YXWD 3T34A 1FDUA 5KSYA 1UMBB 2AFIE 1UBCA 4D4LA 3TYXA 5HWSA 1RAGA 3RSLA 4AY6A 4WWHA 4EYQA 1RTKA 4FN4A 3SY8A 5CU7A 3ZV7A 2WLSA 1A97A 1X9SA 3ILSA 2Q4OA 3NUZA 1LS6A 5EHGA 1EWKA 3J81k 3JYNA 4LIPD 2YMLA 4EB3A 1SL2A 4EF4A 1ULSA 4L9AA 2E2WA 3AIOA 3DNFA 2A33A 1PWZA 3AFNA 2J85A 1J5EB 3MOGA 4IDBA 2JFVA 4YMSA 1NVVR 4ECAA 4ND3A 1HJPA 4YY3B 3M9XA 3VC3A 1A5AB 4NPAA 3NWBA 1Y1PA 3UJNA 4XUGB 2WJHA 4YYZA 2MSCB 3IVAA 4M1WA 5KU1A 2I2FA 1KAHA 4QYIA 4CV3A 5B64A 4E88A 5LU8A 1LC3A 4R40A 2X8JB 1D8YA 4P2BA 1G9XA 2ZJOA 3DW3X 1THZA 1WTAA 1NUTA 3OHSX 1CF2O 1LVUA 2RJOA 1L7PA 1II0A 3LVVA 4MVXA 3FR8A 4KEAA 4KLUA 1VE5A 4YUWA 4OATA 2PFPA 1QKKA 4JJ4A 2A0XA 1EI9A 5HS6A 1FDIA 1SBHA 3IBTA 2WT8A 4KQKA 3PXDA 3L43A 1IAQA 5J0PA 1QOPB 1HO3A 1REQA 1OI3A 2W54A 4OGKA 1BPYA 3OBIA 1QFZA 1CJSA 3ECCA 2AW5A 2HZ7A 5KOIA 1YHNA 4V0QA 1WJGA 1Y0BA 3BTUA 1IOVA 1DJMA 4EYHB 1C3JA 3MR5A 3CUKA 3MT8A 5KINB 2PXAA 5G3ZA 1DAMA 1JP7A 3USCS 3IPAA 1RAAA 2UV8A 3FJYA 1J8YF 3HI4A 1DQPA 4E5PA 2DF8A 3EXIA 3W2EA 2J6TA 2QQ5A 4US0R 2OM6A 1NONA 4AG6A 2YQEA 5FAXA 1MX3A 3T5LA 2NO7A 4R2WA 5EE1A 2QNRA 1OJLA 2I7CA 4FW9A 1ZI6A 4Q05A 3HB5X 4MV5A 3L0DA 3FN4A 3E5RA 3SYZA 4M46A 3LY8A 4ACAA 1TF5A 4QBGB 3ZHXA 3OE7D 3W05A 1CFJA 2YRFA 3Q7PA 3GUUA 1GZHB 5FTJA 4G97A 3IAFA 1AGNA 1RJ9A 2WMYA 3I9V6 4HS4A 1SRRA 2YWHA 2HD4A 4JMLA 3WE7A 3EIFA 8ATCA 4Q44A 3RBEA 4X8LA 4RA9B 1SVSA 2CUNA 1XA3A 1JR3A 1P9RA 1WMAA 2VWHA 5EERA 2P9HA 3R0VA 3FNEA 1OFHA 2BFBA 1QR6A 1NBAA 2Q4RA 3FYDA 1T5HX 3IDAA 4HTFB 1Q12A 3L0PA 1UOOA 4O3NA 2WP0A 4DLAA 1X9XA 4U2EA 4ND5A 5HF5A 3CEPB 4DZRA 5A4MS 1UT5A 4XQEA 1N62A 4TLLB 5IVDA 1C29B 1W2WB 4MIOA 2AC2A 2NO6A 4FLEA 5CR9A 1XLVA 5HDBB 3QBJA 4IQ0A 4EJ2A 2Q4BA 2EBHX 3ZR4B 3W2TA 5F73A 4E5SA 2XIJA 1KJ8A 4TV9A 2FFAA 1U45A 3TOXA 1DEHA 5CRXA 2Q1XA 3MMNA 4KIWA 2BKEA 3O26A 4BLUA 4QZHA 3EG9A 3QE3A 4TZTA 2W8BA 3QTLA 1XU9A 1QSLA 4WADA 3IELA 1GPYA 4GM0A 4J9QA 3S99A 1RBYA 3IA7A 1I36A 2V1XA 1T4CB 4BX8A 3S40A 3SM9A 3KLBA 2WINI 4LDZA 2R6R1 1W2GA 2XF2A 2GJ4A 2PD6A 1CJTC 3KG2A 5KVQA 4YCLA 3JW8A 1R9GA 1NWCA 1WU8A 3TACB 1MNQA 3UCEA 1K2VN 4HF7A 1YDGA 2HPAA 2GZ3A 1J22A 3SMQA 1W1UA 4J7AA 1OGYA 4QYSA 2FPGB 4ZV7A 2AQ0A 4EAQA 2Y9UA 1XF1A 1RLOA 4KK4A 4NV1A 1QFJA 3UA3A 4XWGA 2GBLC 3I53A 3STTA 1QH1A 4UDXX 5L9XA 3PDUA 3SZOA 5BP7A 2DYKA 1UBEA 5CBPB 4YJ2A 3HKZC 4FHCA 3RJIA 4Y2VA 1Y5IA 4AQYB 1A5SB 1E1CB 3AI3A 1LI4A 2AHRA 4CT5A 3UGQA 2W9CB 1W5BA 4YP7A 2P1RA 1W30A 2P3OA 2Q9UA 3W6NA 5DKWA 5M2QA 1NBEA 5ESXA 4C0QC 5BN1A 2GPYA 3A9RA 2N46A 3WB2A 1SOAA 3NWEA 2WJZB 1E2QA 2HLPA 1VJCA 3ZLJA 3L8HA 1HLGA 1KQQA 1VCHA 5CJ2A 3DH0A 5HHHA 3OLWA 2CLOB 3TLGB 4IL6U 3HP6A 1LK5A 5LZ9A 5FYQA 2IW3A 3C41J 3E7PA 3JY6A 3SI8A 1EXNA 2A5YB 1QIJA 1MC8A 4QATA 5KVSA 2Q8QA 2BY4A 2FW8A 1U99A 3IMKA 5CTJA 4HNAA 3L6DA 2ILTA 5J9FA 2Y9MB 1MEOA 5HM8A 5E6RA 4HB4A 4R8UA 4U63A 2CNOA 4HX2A 1PJCA 2GX6A 1R0KA 4PVCA 4YGXB 1VPVA 4PX9A 3I9JA 3THYA 3ZCUA 4DM4A 2GF0A 4MV9A 4D8TA 4A6XA 3VVCA 2KS6A 2NVWA 3F2VA 2QJRA 4KZKA 4ITRC 3OQBA 3FH0A 2OO7A 1QG6A 2UZ1A 3JALB 4X7PA 3CBGA 5B4UA 4MVWA 1GNRA 4X66B 2Q1UA 3RF9A 4OI4A 4AULA 3OCJA 1B43A 2YY7A 4L5AA 3SAGA 4GFDA 4FILA 1UL1X 3GPLA 2UUBB 4WVLA 5KYXA 3DLPX 1FU4A 2NO9A 2YXNA 5H4GA 1E3QA 4WOCA 2F17A 4I99A 4K88A 1XTZA 1JH8A 4XWAA 1UJBA 2RIRA 1CJVC 3H2KA 3I5YA 1AUQA 1N2SA 4FMPA 4R0NA 3CLTD 3FYTA 1E2KA 2IP2A 2H4HA 3NLLA 3BRWA 3HDVA 1OT5A 3F53A 4IICA 4BFLA 2CJWA 3AL0B 4HQ6A 1LJLA 4F7DA 4QQRA 3TAHA 2HU5A 4ZYZA 3I37X 2NGRA 4OHOA 4EO9A 1OMOA 1H94A 2HTFA 3NEAA 4KIUA 2O8CA 1STOA 5AVUA 4C7OA 2F3UA 2PS9A 3OI7A 1YB2A 1N6LA 4KYVA 1PJLA 4I19A 4N0PA 3UFBA 1G66A 2HNAA 3GIWA 1HLDA 3AF0A 2HBYA 1UDRA 2A9PA 3SK0A 4MP8A 4ARCA 3WRXC 4P1ZA 4FYMA 4TRMA 3IHTA 5AK4A 4YWJA 4F38A 4F2SA 3LDGA 2Q6IA 2W6JA 4ER7A 3TQIA 5BWOA 2XX3A 4U7JA 1B8NA 5IKXA 4JOCA 1RBZA 3HU3A 2HYDA 2ZSUA 5HQTA 3O8OB 4DBZA 4LOAA 3OJWA 1NJSA 3UWOA 1TQ4A 2JNWA 5CNKA 2XKAA 3A1WA 2OCBA 4D9CA 1GYRA 1YOBA 1Y6RA 1NK7A 1VLVA 3C7TA 4DMFA 3I58A 1VL6A 1IY1A 3U56A 3H5RA 3ER9A 4ECWA 1FS4A 4XIJA 1W35A 2A88A 5A5VA 3THXB 4ZVUA 4QUGA 1RAFA 2Y6UA 4EPXA 1LW7A 3IV9A 3F74A 5H9WA 1A95A 2JFQA 4MEJA 3CUVA 2CLDX 1N9KA 5A4JA 1EGQA 5BPHA 5LZ2A 1DJOA 4MV7A 4R4JA 5JS6A 5BY2A 4EF6A 4DV0B 3RJZA 4KSCA 1QGYA 4UUOA 4NOLA 5CA0A 1PR6A 5CCXA 1H6DA 7AT1A 2NXNA 2H1RA 5A6VA 4X7MA 1KDOA 4FCVA 4B43A 3R40A 4IVNA 3PXBA 5TZVA 1VE3A 3SYMA 3E2IA 1UJ4A 1YIAA 5KHAA 3HZZA 1GCOA 2I67A 3SS7X 1NVWQ 1SKAA 1AD2A 3N7UA 1FFGA 3B2NA 3IIIA 4OI0A 5KMGA 3R6DA 4S24A 2QBYA 2HBKA 2PZKA 2WNIA 1OI2A 1HTBA 3U3OA 2IOYA 2IELA 3QITA 1XUOA 4N03A 1BIFA 2KKPA 3RK4A 3LLMA 3E03A 4R3UC 2PX5A 5F1PA 5BNIA 3RG8A 2JRCA 3TUZC 3VR2A 2X8BA 4I08A 3AQFA 5M34A 4DG5A 2ZI4A 1Y63A 1E2LA 3WKCA 1T3LA 5KT5A 1YHYA 5BQXA 4JI6B 5DOVA 3S0JA 2BFMA 1TLFA 4IZ6A 1IXYA 1E2UA 3Q3GE 3FOBA 4LGYA 4GZ5A 1F0KA 1QK5A 1REQB 1KIAA 4Q5IA 1PJTA 1DGQA 1E6EA 1RM0A 1GFWA 3V1YA 5KVVA 1N2HA 1N63A 4LX0A 3KHGA 3RS0A 2NZYA 4RCVA 5B58C 2UYGA 4U2FA 1U7ZA 1WLYA 3EZ6A 5AVRA 1TVAA 4OO1J 5DI9A 3T54A 5JJBA 2JLVA 4C08A 4WAUA 2V55B 3GCXA 3WWDA 3LECA 4Q3OA 4TTSA 1RXWA 1PFQA 4ZQBA 1A71A 4UREA 3EXIB 1JIIA 3NDBB 4HRYA 4Z8XA 4EI2A 3CLKA 4L0MA 1M7GA 2P40A 4KH0A 4XUCA 1S9HA 4MFAA 3COWA 2Z3WA