1ZOLA

Native beta-pgm
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
publication title Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis
pubmed doi rcsb
source organism Lactococcus lactis
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1zolA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zolA01
5AICA 3FPSA 3CNHA 2NO4A 4HGQA 2ZBDA 4L6CA 1TJ5A 4KYTA 1Y8AA 2IOFK 2YJ5A 4UAVA 4OFZA 3AR7A 4FFDA 1ZOLA 4EENA 4KNWA 2EAUA 3NRJA 5AIAA 1Z4LA 4HGNA 1RKUA 4HGPA 1U2TA 2HI0A 2FEAA 1Q92A 5ALSA 1YS9A 2ZBGA 1WPGA 4Y2SA 5AW0A 2R8EA 3I6BA 4UMVA 1RMQA 4CF3A 3SLRA 5ALGA 3W5DA 3B9RA 2GHTA 3EPRA 1ZD5A 1L8LA 1S2OA 3U7EB 1U2SA 2B82A 1XP5A 3M9LA 3U7HB 2I6XA 4UAUA 5AM4A 3KZXA 5AI9A 4OHFA 3WKBA 1F5SA 3K1ZA 2ZBFA 5AM5A 2NYVA 5ALJA 3U13A 2AGVA 1RRCA 3AR4A 1Z4KA 3B8EA 5AKHA 4IFTA 5ALRA 5IT0A 2FUEA 2QLTA 1L7NA 1T5TA 1O03A 4XE5A 3CZ4A 2WF6A 3L8GA 1ZD4A 3QU7A 5AKZA 2VKQA 3QU9A 1QQ5A 4NAVA 4BX0A 2CFRA 5ALKA 3A1CA 5AW7A 4KX3A 1XPJA 4G63A 4HAIA 5AK3A 1EK2A 4KX5A 2WF8A 4AP9A 2C8KA 3ZVMA 2HCFA 2PR7A 5AVQA 2ZXEA 1RMTA 3R4CA 4Y2UA 1NRWA 3ZVNA 3FM9A 3E58A 1JUDA 5A3SA 5AVVA 2CN1A 2G08A 4UARA 5AM1A 4F71A 1EK1A 1LTQA 3FVVA 5AM3A 2RARA 4KNVA 3ZUPA 2DQSA 1QYIA 3OCUA 1U02A 2W43A 1TJ4A 4BX2A 1L7OA 3BA6A 3QUQA 3MMZA 3ONNA 5AKLA 1ZJJA 2R8XA 3AR2A 3IB6A 4EELA 3S6JA 5A3RA 2OM6A 5AW6A 4UMFA 4L6AA 2FPWA 3M1YA 3L0BA 4YIHA 2GFHA 3EWIA 3L7YA 3SF0A 1T9ZA 2WF5A 5ALZA 4YIKA 1J8DA 4BBJA 3WGVA 3KBBA 2Q5EA 3AR9A 5IS2A 1T5SA 3NUQA 3ED5A 3AR6A 3ET5A 2IOFA 3NANA 2HOQA 2YMPA 3N07A 4UMDA 4J2TA 3SHQA 5ALNA 2B0CA 2JGAA 2Q4RA 4YCNA 4EX6A 1YDFA 4UU1A 3WK5A 4GIBA 5AW4A 2P11A 2ODAA 3UMGA 3A1EA 4Y2RA 4CNQA 5AI8A 1RQNA 2ZOSA 4C4SA 4ZEXA 1RQLA 2R8YA 3W5AA 1WR8A 2HHLA 3I1YA 3MC1A 2IOHA 1Z4JA 4MWOA 4CE6A 1RPZA 3SMVA 3WKEA 4UASA 3EF1A 3D6JA 4Y2TA 5AI0A 3R9KA 2YY6A 1J97A 2WF9A 4BNDA 3NALA 3FZQA 5ALDA 1KYTA 2D2VA 1CR6A 2R8ZA 1Z5GA 3GYGA 3WK7A 1RC8A 1YJ5A 4AS2A 3AR8A 4HYTA 1Z4OA 2PKEA 2RAVA 5ALOA 1X42A 1S8OA 1ZS9A 2MU1A 1XVIA 1Z4PX 2ZG6A 3EF0A 2G07A 1Z88A 2FI1A 4UW9A 4AS3A 4BX3A 1RLMA 3UMCA 2B1RA 1L7MA 2P27A 4C4TA 1L6RA 2W11A 2O9JA 4DFDA 3OCWA 4CF4A 4Y2PA 4JB3A 4DCCA 1WZCA 5ALIA 3NIWA 4NABA 4HGRA 5AVXA 3NAMA 3IRUA 1WVIA 2BDEA 1RLOA 5AVTA 1Z4IA 3QUCA 1N8NA 4XPZA 4BNDB 2C9MA 2NO5A 4Y3UA 3QLEA 1NNLA 2W4MA 4UU0A 3QXGA 2HO4A 3ZWDA 3OCZA 1Z5UA 4Y2XA 1U7OA 1ZRMA 4EEKA 5ALVA 2IA5A 5A3QA 4FYPA 3E8MA 5ALPA 2JARA 3DAOA 3L5KA 3L1VA 3N5KA 3QX7A 2RBKA 3I76A 1SWWA 2FDRA 5AW3A 3QUTA 3L1UA 2YMLA 3U26A 4YCLA 5AI5A 3UMBA 3OCXA 3ZVLA 4RETA 1RKVA 5AKEA 1YMQA 2B1QA 4Y2YA 2OYCA 1ZD3A 3A3YA 4H1WA 4YH1A 2YBDA 2YJ3A 3SKYA 3FGOA 3BWVA 3WK4A 4GXTA 5AKJA 5ALEA 3WKDA 4QQFA 1YNSA 2QYHA 3ZW7A 3OTQA 1Q91A 1Z4NA 3VAYA 2YMQA 3L8HA 3QUBA 5AK6A 3QGMA 3ZWKA 5AKYA 1L7PA 4J03A 1YV9A 5AW2A 4DWOA 1QQ7A 3DV9A 2ZBEA 2HX1A 4B6JA 5AKXA 4XOUA 2EATA 2FPXA 1SU4A 4BKMA 2C8LA 3A1DA 5AK5A 3WGUA 4UATA 4UMEA 5AM0A 3KC2A 5E0OA 2JAUA 5AVWA 3N28A 5AVZA 3ZI4A 5ALFA 2HF7A 2YN4A 2RB5A 1Z4QA 2P9JA 5AVRA 3N1UA 2CFSA 4ZEWA 3W5BA 3KD3A 1RDFA 3QU5A 3PGLA 3UM9A 3R09A 1CQZA 1MH9A 3OCVA 4RESA 2IYEA 3WK6A 2G09A 3E84A 2HDOA 1LVHA 2GO7A 1AQ6A 4XQ0A 2BY4A 4NV0A 2HEGA 1L8OA 3ZX4A 4YCMA 2WFAA 5ALXA 4Y2QA 3AR5A 1TA0A 2G06A 3QU2A 2B8JA 4EX7A 4BYGA 3QNMA 2AMYA 3SD7A 2C4NA 1K1EA 3ET4A 4PNHA 2B30A 4O8CA 1ZRNA 2MSNA 1RMYA 2G0AA 3IJ5A 1N9KA 2FPSA 2OA0A 3SKXA 3QYPA 5ALUA 3N8GA 3NASA 2GHQA 5AHXA 3OPXA 1SWVA 2OBBA 1NF2A 1RKQA 2EARA 2Q4TA 4NFLA 2FUCA 4NWIA 3B9BA 2P69A 4E88A 4G9BA 3J7TA 2JAWA 3P96A 4ZEVA 3OCYA 3DDHA 2WM8A 3L0YA 4BEVA 5ALLA 2GMWA 5AW5A 3RFUA 1Z4MA 4F72A 2I34A 3ZU6A 1VJ5A 3DNPA 3F9RA 2AH5A 3WK8A 2MU2A 1RLTA 5AW1A 1ZD2P 5AVUA 1FEZA 5AIBA 2YJ4A 2PQ0A 4CF5A 5ALTA 5ALYA 5ALMA 3PDWA 4KN8A 2BDUA 3E81A 1PW5A 5AM2A 2YJ6A 4BEWA 4EZEA 4I9FA 2FPUA 4OCZA 5AKGA 4UM5A 3ZTWA 4L57A 5AK4A 3MPOA 3HLTA 3U7GA 5FP0A 3L0CA 1VJRA 4OD0A 3U7FB 2I54A 2AUTA 4MUMA 1U7PA 3ZX5A 4UM7A 3FPBA 2G1AA 1QH9A 3ESRA 3MN1A 5ALQA 2JAOA 3ESQA 3RF6A 4C4RA 2HF2A 1QQ6A 3U19A 2WF7A 1IWOA 5JJBA 2B8EA 3ZTYA 5AW9A 3W5CA 2I33A 1TJ3A 3QU4A 5AKKA 4JDPA 2O2XA 3WK9A 2G80A 3I28A 5AVYA 4IG4A 2CFTA 3AR3A 4HGOA 4YGYA 5AI4A 5AI6A 3PCTA 3WKCA 4Y2VA 5AKIA 4Y2JA 2YFYA 2I7DA 5ALWA 1VFPA 3KDPA 5IT4A 5ALHA 2C88A 5T41A 3HYCA 1O08A 3L8FA 2HSZA 3KOOA 4FE3A 4DW8A 4I9GA 3PGVA 2I55A 5AESA 5AVSA 2YMMA 3TLMA 1TE2A 3L8EA 5AW8A 2X4DA 2WHEA 3WKAA 4QJBA 2FPRA
chains in the Genus database with same CATH superfamily
3KBOA 3LNCA 1TFRA 4BU0A 1B76A 1DCKA 3PUIA 3EDCA 4JJEA 4ZDIA 3T5LA 2GM3A 1E5XA 3BZBA 2JK1A 2AFIB 4G5SA 2DR3A 1RQGA 4B73A 1F12A 5DWDA 3D2SA 5A6VA 1Q12A 1E6KA 2GD1O 3U7QB 4ZZ0A 3KJQA 2JFZA 3HY4A 4Z2AA 3EEQA 2R1TA 3CLVA 5HJEA 5MGBA 2GD2A 4GZMA 5KYGA 1OBVA 3TM5A 2ZYIA 4WNCA 4QU9A 1E1RA 3EUEA 1JJAA 2WUEA 1RW4A 4UHHA 4DSKA 3TVDA 5KQGA 4N8SA 4WZBA 1N3BA 2WE8A 3RRZA 5AVQA 2OCDA 4D4JA 4QREA 3BH0A 3ZNOA 3OM9A 2FB9A 3PW7A 4ZANA 4BNGA 1W5EA 1G5PA 3MTGA 2ZJ0A 1XTJA 1Z15A 5IUNC 4ND6A 2QBYA 4WVFA 3ZGZA 4G2TA 3GN1A 3BS4A 3NBKA 3EVCA 2HTEA 2JAPA 1IFXA 3IN5A 4IDAA 2QVLA 3SHQA 3JPTA 4Q4CA 4ETWA 1ZGBA 4MX8A 4A4DA 1T5HX 3NWPA 4X65B 1MABB 4XR9A 1SXJE 1RQNA 5DCWA 1I36A 5EL0A 2Y77A 2PSFA 2QDXA 3D3KA 8ICCA 5IIIA 2EGGA 4XB2A 4B2IA 4IDEA 2YXBA 3E7XA 4LJ6A 4YRLA 1U0NA 2JLZA 4EZ6A 1Z5VA 3UAGA 4QXPA 7ICOA 1W0KA 3HDYA 4RTOA 2BRUA 5LQMA 3Q3CA 3BTSA 2V59A 1BMQA 4D02A 4CKBB 3ZTTA 5L3VA 1AQLA 4G5FA 3CZQA 3T7JA 3O1HB 2F2TA 4BBPA 2RH5A 4QPNA 2JCXA 3IILA 4P3NA 3E8MA 3A1SA 3JPPA 2JS7A 1RKXA 4MIKA 3UPUA 5LP6B 1X1QA 2VH2A 3ZK7A 1DDGA 2A30A 4YRNA 5CJPA 4EF5A 2WSSA 1K2VN 4JI6B 2FWNA 3FZYA 4WKBA 2XUAA 3QMMA 1OT5A 4QU0A 3IIIA 1MOZA 3VAYA 2FQ1A 3PA6A 5C7YA 5HQ3B 4EHNA 1C7FA 4CL3A 2ECFA 2IKSA 2PZFA 2EKQA 2CXNA 3NORA 4JLJA 1QFYA 3EDRA 2I5PO 3X1XA 4JLDA 5FPYA 4L5CA 2WW8A 5JRZA 3DM5A 4PO1A 4HAYA 1SPBS 2WAMA 4S04A 1VSUA 3D8UA 3UXEA 2GN4A 3AXTA 1DO0A 1QRTA 4Z0PA 3K9FC 1TZBA 3SXUA 5FAXA 3WB0A 3DCYA 2HHXA 1T1GA 3Q8QB 3KQUA 2QQEA 3SYNA 1ZK4A 1XL1A 4LEIA 3IMEA 2WIJA 2Z6VA 2PZLA 3ZDDA 2A58A 3F5QA 1DFIA 3KQSA 1YZFA 4IIEA 3EGOA 5JZSA 4D57A 4BZQA 2GA9A 5HKKD 1V7CA 4FCWA 3Q5GA 4CTJA 1LRJA 4KXNA 2QL5A 3T6KA 1OLSA 4ECYA 2P5SA 1SOMA 4UUOA 1UJBA 4FHEA 4EG3A 4PAGA 1DWQA 2XCSB 4LZOA 4MTCA 1HM5A 2YIDA 2H2WA 5DM1A 4U2DA 1FDWA 5F7ZA 3H4TA 4BU1A 1ZJ5A 1Z74A 1E2UA 2WJAA 2ZTHA 4UDOA 5JEEA 4BX8A 5KOIA 3TJMA 3Q15C 5DYYA 3HN6A 3TCNA 3K09A 2OO7A 3ZTYA 1ST2A 4WJZA 4O4HA 1WCLA 1XXHB 2BTQA 4UB2A 4P54A 4CMAA 4IMJB 1YFKA 1T9HA 4HN9A 3D4LA 2PLWA 1VE9A 1OYOA 4UNPA 3VYUB 3WLHA 2XZLA 4F0JA 2NQ8A 4DLEA 2BQRA 3SVLA 4GD3Q 5I9LA 1K08A 1YXMA 3NHKA 1SR8A 2IOFK 1RXWA 1N2SA 4A0GA 5IDQA 2HK7A 3SAFA 3IKVA 3BSYA 2WIKA 1RXSA 2ZTEA 2O3UA 3PL1A 4WLVA 3E9CA 1EXNA 2JZBA 4PO3X 5BN4B 2CBGA 4P0QB 8ICXA 3VV3A 3RKRA 3CUEF 1PYOA 3B1YA 3U13A 2NUPA 3INTA 4ZYYA 1Z33A 4K6HA 3ES9A 1U9YA 2G1JA 1QKIA 4BBAA 4UAJA 3FTFA 3JRXA 2WF6A 3C5CA 5LNK6 1H2ZA 1EVQA 4FB4A 5KC9A 3IXQA 1FNMA 2GAOA 2HPHA 4HPXB 3KKAC 2ZXEA 1PVOA 8ICWA 1A27A 3FMGA 3DMPA 4BQRA 4R64A 1CS0A 2FLNA 3BMXA 2IYXA 1QYRA 2VPTA 5KTYA 2DKXA 1K5GA 1JKJB 3MRVA 1WVGA 4FZLA 3PNSA 1EKXA 4YACA 2ZIUB 1ZJJA 2ZIVB 2H9IA 3RVDA 1DKNA 3PDIA 2CXPA 3IOMA 3ZLTA 1E2EA 1XTPA 4RELA 3AILA 4IOMA 3UAYA 3HDQA 1IPHA 3HXTA 1QXSA 1KRPA 2Y6UA 3SE7A 3NHBA 2D62A 3F8TA 3WGIA 2HHLA 2OC9A 3N0TA 1IDOA 2BSQA 5CR0A 1FS6A 1FVOA 2BEVA 1IY1A 4V2UA 5DHFA 1VKJA 1ZL2A 1ZUWA 4HLCA 5I8ZA 3EF0A 2ZUEA 5BR1A 3TRDA 3TE6A 4YT2A 1T15A 1X1SA 3TEMA 5J8YA 5KVSA 3RUHA 4FCVA 1HYBA 3H5IA 5ALIA 4JQYA 2JJ1D 1QC5B 2J7PD 4FSXA 2VK2A 2Y99A 4NFHA 1VE3A 4Y1GA 2JV3A 1EFRD 4O4JF 4MWCA 2J9XB 1U0TA 4YRTA 3I9JA 3A04A 2E87A 1XBTA 3IAEA 4RNCA 2WABA 3ZVLA 3R1IA 4EQZA 4Y8VA 5EPOA 3EDQA 2CWWA 3R9XA 1U7TA 3DKRA 4QAJA 4QC2A 6REQB 5AKJA 1ODSA 3GLGB 1C9MA 3KYDA 4P80A 3TDMA 3L8HA 1EQUA 1IQUA 4AY3A 1ECWA 3PNKA 2HK6A 2QT0A 4MS3A 1N9GB 3JWEA 3KB2A 3U5ZB 4BNXA 4H2DA 3D6UA 4BJ1A 1RWVA 4DLRA 2VRCD 2HNAA 1A77A 4DV6B 4RTMA 3A4LA 2A19A 3D7SA 5KEIA 5ICMA 4Q1CA 2ZXFA 4LDJA 1XVVA 3T5BA 1T3NA 2HQOA 4LJ4A 1JSXA 4AX8A 1YNOA 3G02A 3C7CB 1E6UA 3OP4A 1M33A 1I33A 4C4ZA 1CJUC 2AGPA 4O9MA 3L0PA 3FNQA 4HH1A 1OPRA 1OCEA 1LD3A 1T36B 3GLSA 1OKKA 5AW5A 4IMPA 1KAHA 2AR0A 3L4KA 1UJ4A 4KQJA 4YONB 2GEFA 2HA0A 3E81A 1BA3A 1ZEMA 4PJ0U 1WXFA 5EIBC 1DAMA 4GMDA 4DEZA 5KWVA 2JDIA 4RL6A 1TK9A 4EAAA 4Z51A 1QOZA 3NHAA 3WLLA 2XWSA 4MHOA 1Q22A 2YYZA 2VDWA 3AM4A 2H1IA 3C5FA 4G0XA 2JZOA 4X8LA 3W5CA 4NULA 1AB5A 2GJ4A 1T1RA 5I7UA 3PG5A 4J7XA 4YRAA 1K7YA 3A0RB 2RHJA 4GDMA 4IX1A 3MS2A 4B6PA 5CLIA 1KN5A 3TDNA 3V1LA 1Z00A 4EFNA 3KOOA 1NUAA 1F4PA 8ABPA 2ZIAA 3LL4A 4I2FA 2BLNA 4JASB 1P1HA 2YJNA 1HNNA 4TT3A 2F8MA 3F5FA 2PFNA 2GA8A 1M6NA 5H1YA 3RB8A 3HXQA 1VDMA 2JHCA 4HZGA 5EHQA 2VUHB 2R2AA 4OQPA 2ZTMA 2CT8A 3AIIA 3NHMA 3B70A 2H4HA 2WT9A 1VCHA 4MXDA 3TH5A 2VQEB 2FUNB 1KEEA 3VOBA 3VBCA 2XD4A 3OICA 3VNUA 5NULA 3ZDCA 4EY6A 5A04A 2O8VA 3L7KA 3UENA 1DEOA 3HU3A 4P81A 4AY4A 3H8WA 5MN6A 2GNAA 4U9HS 3BWDD 4TLEA 3FPHA 2VATA 4QD3A 4C8MA 4ANFA 1NRWA 5IAEA 2GPAA 3HDVA 3FDXA 4YUWA 4JC8A 5GV7A 1G4UR 4TT8A 3EY9A 4JC0A 2BKEA 3ON5A 1TO2E 2ZXIA 2C9OA 4E0DA 1X9IA 1XG5A 2ZTVA 4AN4A 4JQCA 1GU1A 3VVBA 4KVZA 3UIEA 2UZ0A 2J9GA 2JCSA 3EWIA 5BOLA 3P9YA 4HY3A 3B1FA 3AR9A 1WF6A 3GG9A 2JRCA 1VKHA 4ZAZA 5EJ6A 3NTUA 4LI3X 2VT6A 4BFLA 2FMSA 3L7CA 1MG0A 4G5OA 1G6KA 3EISA 5FTMA 3T9BA 4O2AF 2DRIA 2RLTA 3EHEA 4M9SA 2GPWA 2XNDA 1B6TA 4GVXA 1GAQA 2M9MA 1ZI9A 2BGRA 3EOZA 3QOYA 4BMSA 4WJKB 2M6LA 2QY9A 3K92A 1G8SA 3B6JA 2MWMA 2GYYA 2E8PA 3JWPA 5EP4A 2XDYA 2Q9BA 3P2JA 2VHEA 2P2CA 1KKUA 4J9OA 1MIOA 1OY1A 1RWBA 4EQ6B 2CJPA 4EH1A 4RKFA 3NR2A 5EKDA 1TYDE 2BUCA 3NVDA 2OXEA 3WFIA 5B12A 2W8KA 1CCWA 1UHUA 3L1VA 4N5NA 1P9RA 2PUDA 1X8JA 4DARA 2H06A 4RQ7A 4PBRA 1NF8A 1C0LA 2LCIA 3BEOA 1II8A 2C7PA 1SHJA 1A4UA 2VJBA 1YULA 2JFBA 2IHVA 4D0LB 3N7UA 2AEEA 2LDXA 1NDQA 1Q7BA 3VVLA 5FLYA 1R0XA 4EBCA 3IQGX 4DXDA 2LIVA 1W1WA 1G6HA 4WLEA 3WLKX 1P7WA 1KOLA 3QWBA 3B7PA 3P9CA 4RY2A 5BSMA 5TR9A 3D0RA 1KOJA 5EC8A 4CCYA 3W7AA 3OJ0A 1CJKC 2GI4A 9ABPA 2EVWX 2VBIA 4H9GA 1BPEA 4OV6B 2R1VB 2CDCA 4OJ5A 2TYSB 3UAZA 1OBHA 4LNUB 4HFMA 4HLUC 1GUZA 1QLHA 2WOOA 4BMNA 2GO1A 4ZV9A 2FVYA 1QHNA 2X0IA 2DWOA 6Q21A 4BKPA 4HD8A 1OVGA 3GLQA 4RMIA 3GMTA 3JU3A 3O92A 4KMSA 5TQ0B 2JEGA 1YACA 3ND5A 3H6GA 4IQ0A 5CUQA 1FRVA 1K68A 2X8BA 3FJOA 5EQDA 5J5CA 5J5VA 1W5AA 5JG7A 1ODIA 5CB4A 3E35A 1N2OA 3WJ1A 3OX3A 4L5YA 3M49A 2G80A 3A1WA 4DF4A 4DIUA 2LRHA 4MQEB 1XRPA 4GC7A 3O2JA 3IEXA 1YS1X 4WE3A 4PBSA 3DVAA 4TLLB 4HTFB 1NKSA 5TE9A 4PG8A 1W34A 4QXAA 2O1WA 1NE7A 3SEIA 5EE1A 3LDGA 4ZEMA 4EHBA 2KMDA 1S97A 2B1GA 3IVMA 3QUAA 2W70A 5EIHA 4UMVA 3VR6D 5JSUA 2FQWA 6YASA 4TMYA 4EI2A 2Q3HA 2WUDA 5JZOA 4XWYA 1QIKA 1JN0A 5C53B 1UFVA 4IGIA 2NPIA 3UTCA 8ICBA 2GCOB 4J07A 1QPGA 1U8ZA 3LWDA 2VJOA 1NBAA 2OVBA 2MR5A 1KU0A 1RE1A 4DC0A 4JB2A 3V3KA 4WERA 5K6TA 1XVAA 3LUPA 3AEVA 1XWIA 3GHYA 3VUFA 3CKKA 1EK6A 1BEZA 2N47A 4E30A 2O8EA 5EG5A 3ZCSA 4DNPA 5M5BA 2OO3A 2K4PA 1SZHA 1OU0A 4J3JA 1ZH2A 1SVKA 3D0KA 1YR1A 5A3JA 3R7WB 4M7PA 2W43A 4ND3A 4Q1BA 3G9TA 1TT7A 2W58A 1EGVB 3OPYB 3L7OA 1RXCA 4US9A 2H18A 3PVXA 2B69A 1G21A 1ESZA 1PEAA 2HJGA 1N36B 1JHZA 4BUZA 3MCVA 3GIKA 3KFXA 2K5UA 4J1TC 3UCXA 3MRTA 4CMIB 3TIGA 3DTVA 5EXTA 1HLFA 3UMGA 1FFCA 1JFVA 2K7ZA 3ZVKA 3TTXA 1YJ8A 2IOHA 1O97D 3V2UA 3A3PA 2NM0A 3G0DA 3NHLA 1L4GA 4FKMA 2Q0ZX 1E2KA 4BJ6A 2RHLA 1T2CA 1KPIA 2Z43A 5I7FA 5K09A 1I9CA 4DLAA 1CUDA 3SR4A 2WJ3A 5JAPA 1UM9B 1BE1A 1E9AA 1YSCA 1JKFA 4BLVA 3W9YA 3FKSA 2RIPA 3T54A 3G23A 1ZCFA 4XM1A 4B9SA 2KSOA 4DQLA 3EXHC 2VPYA 2BGKA 3U81A 1L7AA 2FRVA 4YI5A 1GSHA 3BXHA 4F60A 3MJHA 3IUYA 3SFTA 2WKSA 3WRVA 5K3OA 3ZHOA 4PZNA 2C28A 3RYHB 1K8YB 2DF8A 3UMBA 2I6FA 1OHHA 4YDHB 4ZJZA 2Q41A 1E9VA 1G5TA 5B1IA 2MCFA 3I2GA 1NVWQ 2VZLA 3LX5A 2VUIB 1BN6A 4QOIA 1FTNA 4RADA 1EUDA 5DLYA 1CZKA 4NEHB 4CL2A 3EGWA 5DNYB 4EI7A 2IBSA 1QR2A 2E55A 1LRKA 1ZQHA 1HG1A 3V4VB 3AB8A 3T3PB 3PXAA 2R4TA 2Z1DA 5TT1A 4FBGA 3A4MA 5ALFA 1G7CA 3WL7A 5MF6A 4JVOA 4XWOA 1UCVA 1KRHA 2Q0SA 2EJVA 3OT5A 3RC3A 1W5TA 4HQOA 4KWEA 5J40A 3EE6A 2IQIA 4KUEA 5IAGA 2ZSKA 3IV6A 2FFQA 3KTFA 1TU3A 3AUXA 1OPXA 4KH1A 3REGA 4Z3DA 4UM9D 2VS1A 4W5RA 2J9YB 2OCAA 1E0JA 1Z4MA 4XLTA 1IL0A 1TJNA 1L6NA 4R6XA 2AH5A 5F7JA 2PLAA 4RVUA 2H0AA 3EA5A 3V8BA 2CMGA 1BHO1 2KHVA 4JJFA 1KBOA 1MX9A 3B1WA 3ETGA 1IOLA 4RHTA 1V16A 1WLYA 1EVKA 4ED1A 4GYJA 2IXGA 1SKYB 2LVBA 1I3MA 3B3JA 4AD8A 4MUMA 1ENZA 1EM6A 5TS2A 3FD8A 4NCXA 4QUDA 3ESRA 3F6RA 2FHPA 3SJ7A 5B2FA 3W06A 2GNOA 3A0UA 5BR7A 4LJ7A 1U0HC 1NZDA 2BF7A 3FOEC 5EEGA 2WHQA 2UYQA 3PUXA 1A69A 2QI9C 4WD3A 3WHKA 1GLNA 5GADl 3NGXA 3DBHA 1PR9A 2DUJA 2VJ5A 5T41A 1I5EA 4IYRA 4I9GA 5BYKA 4B3DA 2O2YA 1JMVA 5TPZA 5JHHB 1ZINA 3EQ6A 2RBGA 3AFGA 3E23A 2JIBA 5LMCA 1PHPA 2ZRGA 4J4TA 4P7GA 4N39A 3A6PC 3TS1A 4WJLA 5A05A 4JB8A 5IIJA 4DL9A 1EAYA 3D2BA 4G01B 5TLSA 2PSSA 4F5NA 4GRIA 1GPYA 5AM4A 2C94A 4MF2A 2UYHA 4LG1A 1E1MA 3NKLA 3A2NA 4PW0A 1Z37A 4N8DA 2QLTA 1S01A 4QG7A 1M2NA 2W9BA 4CR8A 4NBWA 4M53A 1C8LA 2W42A 3D3WB 4O63O 4D8YA 4O3RA 3TPFA 2HUNA 1F1JA 3VPGA 3LT0A 3SBOA 5A4MS 2WJGA 4ED0A 2VSNA 4R9UC 3RVBA 5C4GB 2AQHA 1P2FA 2Z57A 1DX6A 5DBBA 4ZRMA 7ICRA 4EVSA 2R8KA 1ZK1A 1SCKA 5AM3A 3DMHA 4FXOA 4GM0A 4F84A 4FXPA 1HFJA 5BT8A 4RHFA 3E03A 4NOMA 1FA9A 2DPXA 8ICZA 2WICA 1PUXA 5DGXA 5CFMA 3E22B 1ZK3A 3SV3A 1E60A 3S70A 4UXIA 2JKVA 6AT1A 1S8AA 1EXVA 3HU2A 3QKRB 2CEAA 2H2DA 2X0JA 2BONA 5HM6A 3GIWA 3DBLA 2P0EA 2DQNB 5FOSA 1S76D 1KEVA 5CGQB 3RADC 1TT5B 2CDBA 1XWFA 2C7BA 3ZDQA 4CIAA 3PWTA 1DCMA 3GRKA 1TKAA 4RH0A 2JIZD 2ZJ4A 1KSFX 3UK1A 4ME6A 5BNZA 2O3TA 2V03A 4GX2A 5CIQA 4LWOA 3ZV5A 4U5QA 3MPUA 1LF0A 1WP9A 1E98A 2Z83A 2FETA 2PI4A 1CQJB 4ZP1A 2OLKA 1MZVA 3LFUA 1WSAA 2UXCB 5H83A 3RWBA 3QXGA 3W05A 2WWHA 3WIBA 1PT9A 3CU5A 2YWRA 1C9JA 3VC7A 5LBUA 3UWSA 3B36A 4NC9A 1DGJA 5B36A 3PSAA 4W5JA 3K96A 5DM70 3QENA 4NICA 4P4PA 5JDCC 5F52A 3JYLA 2HCTA 2WHRA 2X7HA 1Z82A 3R0ZA 3SNHA 2ECOA 1KJWA 4BLUA 4E3ZA 1HQCA 2A6PA 5EHNA 1C81A 4AU1A 3PDJA 2RKWA 4BNJA 3P52A 2A57A 3HUFA 4L8FA 1QMGA 2HHCA 5FUXA 3SDZA 3WX0A 4P33A 4UEQA 4LXIA 1R10A 4F2RA 2GUGA 2HCBA 3RJJA 3FWNA 3FN4A 3PE3A 3ZE0B 1T9DA 3QBJA 2F67A 5DLFA 2ODPA 4ITVA 2A84A 4NBNA 1T9GS 2GDJA 2HU5A 4KL8S 1DAFA 2PXXA 5H8WA 2X14A 1KFKB 1KO7A 4HB2A 4YJ2B 4E5YA 4EUSA 4EY8A 3AJEA 1V3UA 3AFHA 1Z47A 2CGEA 4UB6U 3MTBA 2YVUA 1IG0A 4LF7B 4GEGA 4F72A 5DNEA 3I6YA 2VYNA 2BM1A 2O7RA 2FH5B 4DT1A 3MERA 2PFOA 4KQWA 2IYRA 4ZVUA 3ND6A 8LDHA 5HMMA 1XZ8A 1R0YA 4ER0A 1M1YB 3P71T 4R1UA 1SIOA 3A9WA 1WZ2A 4BWYA 1PFYA 1GQRA 2PVSA 1V7QA 3P2YA 2ZM5A 4BC1A 2E9SA 4RQ0A 5B4UA 5LYJA 4BUGA 3GEPA 2W6OA 3JQGA 2HYIC 3WKCA 4PHDA 2YBEA 3DBIA 4H7IA 3AJAA 1KMMA 4PHCA 2FZ5A 2VP2A 3QVTA 2HL6A 1Q11A 2C4HA 3H0EA 4DA6A 3LK6A 1YZTA 5HG0A 4M1TA 3LLVA 5KFYA 2I3BA 2JANA 4XTRA 1QOQB 3NYIA 2P41A 2KICA 5IEJA 3VHXB 2Z56A 3IEMA 4PYOA 4FI3F 1GA6A 4QDOA 2WYIA 5E7QA 4GF5A 4IDHA 4BP1A 3DWFA 4BX0A 5LZ2A 4ZXFA 1P72A 4LHYA 3VOAA 2H5EA 1I7DA 1JUDA 4FBUA 3VC8A 1L4HA 2EDUA 1BE8A 3HO1A 1YFLA 3DTTA 5JZMA 4GWLA 3B20A 3K31A 1JAIA 1PT7A 3ZZ1A 2TMDA 3I5UA 1KVSA 3B53X 5GONF 2GVDC 4URZR 3IHLA 2YMPA 4MOWA 1L3CA 2DKFA 1XLTA 1YDFA 3EASA 3TL3A 3GGDA 3OA2A 3CLTC 4LTDA 4ZT6A 2HD4A 3RS9A 2CUNA 2GKGA 3D8RA 1A9ZA 3ITEA 2RKOA 4XX0B 1ZM9A 3LHIA 4EARA 4LJYA 3FCYA 4HEQA 4I2EA 5HFJA 2AFHE 3ZH2A 3QUSA 4DDVA 3O94A 4Q66C 2QRHA 2VP0A 5CX1B 3GPDG 2KLBA 4ZOLF 3AEKB 1C7IA 4RDIA 2XRYA 1QPBA 3ZZUA 4AKEA 5D5PA 3FKJA 3M8SA 1RZVA 3OEHD 3HJCA 4ZMSA 1TQ4A 2I4RA 4YN3A 1K66A 3PFKA 4WCVA 1II0A 3U80A 3OCZA 4NJEA 4U9UA 3SV4A 4DLPA 5GVRA 2JARA 4KBGA 2R6ZA 3ASYA 5B6JA 2BPCA 4PAOA 2UU9B 2K6GA 3CE9A 3CNLA 4I2DA 4I1UA 1NJ5A 4P4TA 3I5MA 3IJPA 4HEA6 3TB4A 1KI1A 2O1XA 2XTJA 3AFMA 4OJNA 4XUGB 3G2JA 3ESBA 1LJUA 2G9QA 3V8PA 5LQRA 4HLDA 1GQSA 3A06A 2RIRA 1ORIA 4WNYA 1EESA 2XLBA 3PGMA 3B2QA 1K5DA 3JX9A 5FA6A 2IPNA 3NU1A 5IJXA 1Y4UA 3UM9A 1XF1A 7GPBA 1BS2A 5EP1A 1BVYF 2CNLA 2ZYTX 3OQIB 1DXOA 4ZZIA 2ZSIA 2QTMA 4ZD6A 3NYQA 2QP4A 3N97B 2X6RA 1I0ZA 1YJAA 4WBSA 1NOJA 3Q6IA 4FYIA 3VNQA 2GPYA 2CBXA 1KL7A 1TA9A 2BFDB 3BFVA 4O4JA 1X6IA 2GLXA 2CPRA 2Q2QA 1XL0A 3SM9A 4C4XA 3HGMA 3T5TA 4J9KA 1QNFA 2CC2A 4CXMA 5DCUA 4DV5B 3NIFB 1W25A 3GJTA 3G5TA 3D64A 3A14A 3GGJA 4RA9B 5FFMA 2A9VA 2JZNA 4EKYA 2V1XA 4KJXA 4YRZA 4AZ3B 1BRMA 3ENKA 2LI6A 4Q9LA 4Q4AA 4FT2A 1RLJA 3O8OB 4S1TA 3Q5EA 4XB1A 1N75A 3OI7A 5AI6A 5JUWA 3OPMA 4CRWB 5IT4A 2F00A 2P66A 4YUXA 1O08A 5EJMA 2R0QC 5P8WA 1G8JA 1WSBA 3FLMA 3H4MA 4YMGA 5KFKA 1QONA 4YXWA 2V3VA 5CA1A 4MP6A 4UHCA 4GE0A 2EDCA 3E7FA 4YD1A 3KAKA 1G2IA 1NDUA 4DQDA 3ENZA 4UFNA 4QODA 3SP1A 3AKYA 4LC9A 1MU0A 4KW7A 4D6XA 2P3OA 4GKJB 4TXNA 2PMEA 1FYVA 5J0QA 1ZW6A 5LQUA 2PUAA 1X9WA 4E11A 1GM5A 2W8ZA 2IV7A 4NMXB 2MSCB 3PNVA 2BGUA 5JQGB 1U3WA 2IH2A 4WXEA 1Z0ZA 3QU9A 1FDRA 3CUTA 3HUEA 4D45A 5IVIA 3EN0A 1TCAA 3SHWA 1JPVA 1IVSA 5J4YA 1A8HA 3T3FA 3IDAA 1X2EA 1JT9A 2O8DB 1QQBA 5JC1A 4YRBA 3RAXA 2IYLD 2WIGA 5HPYB 1QYIA 4XEHA 5FNVF 3H86A 3QRWA 2R6CA 3S6JA 1RC0A 5HZKA 5HHIA 3R0VA 5EQFA 3FF1A 2N46A 3A1FA 1YQTA 2H1WA 2C92A 2CDAA 5KX5F 3EWAA 4GI5A 3I83A 1SL1A 2XITA 1DINA 3PFBA 1G4HA 4F50A 4X7BA 3GAMA 2ACKA 1NJ2A 1PTJC 2P3SA 4MWOA 4JMUA 2KJ9A 4RGYA 3ROEA 8ICAA 2V7GA 3IE1A 1F51E 3GILA 4BO4A 1ISPA 5KSOA 2WJYA 3HHPA 3KLPX 4ZZ2A 5ILGA 4XOIA 3ZD8A 2FI1A 4H1VA 4A26A 4GMFA 1KRXA 1TLFA 1PX0A 1HEYA 4DUPA 2YV5A 3ROFA 3IHWA 5TX7A 1L6RA 4MYTA 5LU9A 2NRZA 4HNRA 3G9QA 3KYCA 3KWMA 2R79A 1QE0A 5TMDA 4D0NA 4TQGA 2ATEA 4DKJA 2REXB 3K8QA 1SXJC 4U8HA 3H4IA 4BNWA 2IHBA 1H3FA 4YRCA 2DHCA 2YRWA 2LXNA 2CV0A 1AGRA 1RZUA 4U0KA 1UKCA 3N7TA 5TIIA 1KKLA 2QL6A 1NN0A 2A9QA 1KFDA 1DRUA 3AVXA 1BKYA 4B45A 1Q3KA 4I8IA 3STUA 1TADA 1KJYA 3KU4A 4FHDA 4O2AA 1ZJ4A 4MDFA 1Z2PX 2DSTA 1Z5WA 2GYUA 4DG8A 3NV9A 3K3PA 4X1KB 2I1WA 4QM7A 3I92A 1N0UA 3BE4A 4US8A 2WHPB 3B6EA 4KYVA 1HLPA 5EKSA 1AIPA 3Q7EA 3M4YA 1PWZA 3T3IA 4P92A 5ADWA 1Q21A 3L04A 3JD4A 4M9NA 1JFFA 3W2HA 3GELA 4PO8A 3CW2A 4MYHA 4UE6A 4FS8A 3CCCA 3KELA 4L50A 1Z36A 2WWRA 3LWBA 3PK0A 4WCDA 3UWMA 1T4CB 2E3TA 2NU8B 1HTBA 4PYNA 4OQQA 1BFDA 1E9CA 4MR8A 3LDHA 2JVKA 2VTBA 4PM4A 4PPGA 2JH1A 5ELXA 2BDUA 2VPQA 2CMFA 4JUCA 1X3SA 2ZBVA 3HR8A 5KDOA 4UBOA 4RULA 2O48X 5FDFA 2JJYA 2QRLA 2VSOA 4CLRB 3NH9A 3P9RA 2X1MA 2QUZA 1DC3A 2VK8A 1P5JA 1S10A 3PX6A 4MHTA 4EP1A 4H4EA 5FTWA 1TW3A 2G8NA 4K81B 3C43A 1TV9A 3HZHA 1HRKA 3B1ZA 3QEMB 2PI5A 3QVKA 3OZUA 1C4OA 3OJLA 4LCBA 2YINC 4YTEA 2HRBA 1MO2A 3OETA 3KVOA 4ZICA 1PFUA 1EP1B 3ZY6A 1DUIA 4Y9UA 3ICQB 3SOPA 3RJTA 3CH6A 4J29A 1KH2A 1DXQA 2IS4A 1J1UA 2QVXX 2ES4A 2ZLBA 2V7PA 2QXUA 2C4VA 2HADA 8ICSA 4Y6GB 1HJPA 1XN1A 1GCUA 1H22A 2E5SA 3PYLA 2GRUA 3OMLA 1ZD5A 1BTOA 4GXKA 4GRDA 3JVDA 4UAUA 2RGBA 2PVPA 3K1JA 4YRPA 2PCJA 1Z4KA 3B5IA 2PSJA 2OORC 2XMCA 5AUPB 4M8IA 4J3NA 1J23A 2RJNA 2C8KA 5BSTA 4R71A 5JV5A 4XGNA 4EAQA 4UNNA 3GH1A 4LOIA 1K2WA 1XPRA 2VZ0A 5A3SA 1FJGB 2YTUA 4DA4A 1ILEA 2F9FA 1MX5A 3OZXA 4FBTA 4K8OA 3VM6A 1HDOA 1R0RE 1M2GA 3NOOA 2HJSA 3LF1A 4I5GA 3MMZA 1KAEA 3BGWA 2VXYA 1ES9A 3HBNA 1GFZA 3A36A 3RUPA 2PDAA 3JQBA 4LHSA 2FR1A 1N7JA 3SF0A 5CT9A 4WKPA 4B9EA 2D3WA 2ZT8A 1XQ6A 4YCSA 3PJFA 2HJRA 9ICCA 4LJ9A 3DE3X 4C5AA 4HNTA 1Z2CA 2CDNA 4GMGA 4K4HA 4D3SA 2Y1GA 1MJGM 4QAQA 4Y9SA 3I2IA 9ICSA 1VYHA 3O7MA 3KPVA 4O5EA 4COKA 2Q0QA 4MWDA 1ZM3A 4JGIA 1ABFA 2W2LA 1TQ8A 4BVAA 1MOQA 4EHKA 1ZWLA 3YASA 2ZAOA 3PX4A 5DOVA 4S2EA 3DZJA 5BWMA 1L5LA 4NRDA 3RT9A 1DBSA 5BUSA 2Z9BA 5JVDF 4CUKA 4OQFA 1NNLA 4B1FA 1KZ4A 1ZI8A 1F8YA 5EI5A 2E6UX 4E1VA 5TXGA 3BZUA 3WWOA 2J32A 2G6BA 1IZZA 5WRFA 2R8OA 3G59A 3TAUA 2GPBA 2CHUA 2W2QA 4RPJA 1WUHS 3MF4A 1QGDA 4G0YA 5K5EA 3HDHA 5DLGA 4TYPA 4WDRA 4HMOA 4B7XA 1X14A 1SB3C 4F9EA 4RD0A 1P5HA 4LHEA 1H38A 2C2GA 4KU4A 5DSXA 2PUHA 2WT4A 1VLLA 5AVRA 1US8B 2RG7A 2HDOA 1CQIA 1T13A 1VG9B 1NBEA 3RS5A 1M10A 2I6TA 5LQSA 5KOJA 4BYGA 5A2QA 3NETA 1X38A 4L51A 2ATCA 2ZB2A 4FINA 2FY8A 3E1SA 3ISJA 3IG5A 1JB1A 3LYSA 4G9BA 2NUTB 5U4XA 1IWPB 4BEJA 2N3ZA 3KEQA 3ZUGA 1JDTA 1OAOA 2PA3A 3P9PA 3EFOB 4U7CA 1IXRA 1JPUA 2NRVA 2ZUTA 2UZ3A 1RLIA 3UAVA 5EJ7A 2BI8A 1TD9A 1JIQA 4JVLA 1CC1S 5J2EA 3ZTWA 4FNMA 3NVZA 1SXQA 4DLKA 5G4KA 5BV7A 1JE0A 3QV2A 5E1OA 1N60A 5FJJA 2OFXA 3HJTA 2G3YA 4ND8A 1LJLA 1HTTA 2IF0A 1C0KA 2GN0A 2DBVO 2EQ5A 4MROA 4NENA 5K6RA 3C6KA 3WKAA 4ZKDA 3GAFA 4W5OA 4D9FA 2EFHB 2YKGA 2XMSA 2IU0A 4OJOA 3IPXA 4ECUA 2KI5A 1IONA 4EYGA 1BXRB 1FUYB 4OU5A 2CBZA 4REQB 5AXDA 4CQMA 4HNGA 4OHOA 2G8LA 1WDMA 2OZLA 3EC2A 4H3SA 3W4KA 3MEQA 4UUQA 4ESOA 4XIGS 3ZQ4A 3U4DA 3T5DA 3H9UA 3N8IA 2OQVA 4X8OA 4OUKX 3QFSA 1DEHA 5D3ZA 4QXRA 4XIJA 2M6RA 4DSNA 3PSPA 1NSYA 3EGXB 2QS9A 4KLIA 2ALJA 1I24A 4U7HA 2BI7A 3GP3A 1YR2A 4N18A 2XKKA 1IOVA 2GTPA 1ZJZA 1FNCA 2P0YA 3ZZNA 5U9CA 2WU1A 3RS0A 4LXXA 1MJHA 2BKAA 1WHTB 4ND1A 1DKMA 2W3RA 1E8NA 4FS2A 4LMBA 3LX8A 4WCFA 1IM5A 1AG9A 1Z0IA 2PQ6A 1X7XB 3U4QA 3KOXA 1MHPA 1Z0AA 4O1HA 4GOND 3Q0IA 3ROXA 4IGFA 3FMFA 2V4UA 2R96A 2IXBA 4ECXA 1Z34A 1TDJA 1GTJ1 1UMBB 3ZQUA 4C01A 1U6IA 5D6NA 1TK5A 3F1KA 1FP2A 1CJCA 1JXOA 1KGDA 3OTWA 3NALA 1NBOA 4C0KA 2Y6VA 5T64A 5J0OA 3NQ41 3OY2A 3FYHA 2N42A 1QGED 4YRDA 3E3AA 1QB8A 1NI4A 1I1OA 3DLCA 3CMCO 4QOHA 1LV5A 2IHJA 4ZT7A 2CRXA 1Q0RA 1C0IA 3BZCA 1CSEE 3SS9X 1BHQ1 1WCNA 2BH2A 5TARA 1Y1LA 2D0OB 1SQ6A 1KDOA 2XYRA 3N5KA 2E4AA 4AY2A 5B3JA 4GZ5A 1I3CA 1EM8A 1YZ3A 4RCZA 1WUKS 3PFNA 1KPHA 1QYWA 1CPYA 1MEJA 4WX2B 1CUGA 1Y42X 4NEGA 1XMSA 5L40A 4B79A 2RH9B 4DADA 2IUFA 4LWQA 3L6OO 4ZVRA 4S0XA 4D81A 4JLOA 4LF4B 7ICSA 1VL0A 1NM5C 3C21A 2XGSA 5CDGA 3T7CA 1Z0UA 4G07A 3VR3A 1KIMA 1THMA 2QJFA 3WG9A 3GEEA 3JASB 1P5ZB 3ZHZA 4PCVA 1Z0SA 1FF9A 2O2GA 3BMCA 2PFSA 5AHKA 1GPUA 3CIOA 3TO5A 4EUNA 4J0HA 2IE0A 1TJYA 1TFUA 3AF6A 2DERA 1A9XB 4YHHB 1LTKA 1DWUA 2WIDA 4PN7A 5F7OA 2H31A 1NV9A 1VMAA 5E6UA 2LKDA 3W7VA 3ZU6A 1SPXA 1PK3A 5JNSA 2ONJA 1FDIA 4KAJA 3M6MD 2IMWP 3G88A 5H0IA 5FFFA 1X0XA 4MDHA 3KXIA 5KWEA 4CLEA 1JR2A 1KMHA 2LYBA 4FIZA 1K1SA 3CIFA 3LIPA 1NZJA 1NP7A 3NC1C 2PL5A 3SC2A 1G59A 4N3AA 1FSFA 4HB4A 2RHCA 3K2EA 1VCIA 3L0ZA 3OH8A 5LQNA 1UKVY 2I1VB 3OM8A 4E7PA 3Q7PA 4LJXA 2M0NA 2KX7A 4M46A 1NKTA 4P98A 2AD1A 4F1KA 4R7GA 4D44A 3K0FA 3GLIA 4UBNA 3TZBA 2BN4A 2BR5A 3UW1A 1G8YA 1KEPA 4S1VA 4TYMA 4ED7A 1UMKA 4C7ZA 1ZJMA 3S55A 3TOZA 4NL4H 4DILA 4KO2S 4K0RA 1MAVA 1SVUA 5UKDA 1Y7HA 3T3OA 3GDHA 3EXIB 3M9WA 3EZ9A 5FF9A 1VHQA 1YS9A 2FKAA 4AK9A 3OJSA 3AG6A 1QUFA 3FF4A 2KZ3A 3A1TA 4A92A 4GU5A 4GM4A 3GRUA 5IAJA 5BMOA 4PZAA 2IHNA 3LUFA 3NT4A 2BCUA 4IJKA 1MG5A 2BUAA 1ZL0A 5IT5A 2Y1JA 3PQCA 8OHMA 1J06A 4GXRA 1QVWA 3TTUA 4XFJA 4I4IA 4TVBA 2ODWA 3K2IA 1NONA 2ZZMA 3NCTA 2P2LA 2R1UA 2G28A 2PX6A 1V5EA 3AP1A 5J0XA 1SKAA 3T0IA 1P81A 3FNHA 5KHOC 4INPA 2D7DA 3NYRA 1UKYA 3JQ8B 5L1MA 1KDHA 1NMSA 3KKOA 2KBFA 4UAYA 1BGVA 4L28A 1OTYA 4IMIB 1JHPA 2YQEA 3K72B 2YC2C 3DLTA 4O3OA 1Q46A 1IATA 2PT6A 1FU8A 4XM0A 4IJQA 4L3WA 4DUYB 2WQ6A 3F8SA 4MV3A 2XCLA 4UMFA 5EPUA 4L6AA 4RHEA 1WWKA 2FQQA 2ZZNA 3OIYA 2GBCA 2QTNA 3LO8A 2HHSA 4MUBA 3W77A 1IQPA 4BB0A 3LQRA 1QAQA 5BQFA 1Y8QA 4S1PA 1N2JA 2J5XA 4MYUA 4IWXA 1ZLYA 5LMZA 2PKQP 3RI3A 3ZKWB 2O8NA 4O8ZA 4UEJA 3W1VA 4A2WA 4JLMA 4K28A 1JJBA 1KXJA 2BBSA 2WJPA 2CWDA 1JZTA 4W7HA 4LTNA 3B0YA 2Z5LA 3QNUA 2CHQA 1HDZA 4PGHA 3WL3A 1H8EA 4TSFD 3VZBA 2P75A 1NU6A 3CVOA 5FTKA 2XT9A 4MGZR 4UXHA 1PD0A 5I4BA 2PAAA 3EIUA 4BO5A 1OA0A 2IZ5A 2PUVA 3A6EA 4ZAVA 2QY6A 5J63A 5D2CA 3A3KA 4NMHA 5AK0A 1UXGA 5JH7B 2IZ6A 1QM5A 3I58A 2XY6A 2C2MA 1NBHA 7ICGA 3S2IA 1SULA 1CZRA 3RVPA 3RLIA 3AVPA 5KJCA 1E5VA 2NSYA 4KQ6A 1RE0A 4RTSA 2GASA 4RKRA 3CRRA 3HMKA 3HJFA 4JR1A 3WLQA 3RS4A 1BS9A 5GONA 1ZGZA 4BFXA 3S27A 4E46A 1U28C 1UP6A 2J4FA 3BXEA 1KR5A 4YUVA 2ZSJA 1PDOA 4LAFA 4P0TA 1WUDA 1M2KA 1H5UA 3AGPA 1VGQA 3EXG2 1YZGA 4OO3A 2A78A 1OASA 4A0RA 1CTQA 5BMVA 2JGLA 1TQHA 1HT3A 2C7VA 4MV0A 5T67A 5AJYA 4C7VA 2NUAA 1QP4A 1PWEA 2ONZA 1C2YA 3UKDA 3OT4A 1H9CA 2K4MA 1CQPA 3ZLJA 2LCQA 1ISJA 2V6MA 1IUNA 2EJCA 3DONA 1GJRA 3ZX4A 2NVUB 1Y6RA 4BDPA 5EWMA 1FMCA 4L7VA 5JS1A 2WAYA 4GOJA 3ZDEA 2M1ZA 3JQEA 3SXPA 1K92A 3C85A 5CFQA 3LCMA 3IAM6 3F7TA 3S8MA 3I5YA 5TVGA 1CJVC 2DU8A 2D7JA 2HMUA 1FSGA 2FRDC 1DJOA 5D86A 3BRWA 4LXGA 5IEBA 4DVJA 4GUDA 2I65A 5ALTA 3OJCA 4DXAA 3RARA 1UJCA 2VRBA 1KMIY 3CKYA 3L8CA 2IC5A 1VIAA 2ZBUA 4JZKA 4MVJM 4DSFA 3EZNA 4YR0A 1X1DA 5AQEA 9ICVA 3QH4A 2F3UA 2HF2A 1ZQCA 2B0JA 2KFZA 3QJ5A 1S2DA 3HCCA 1XD2A 1L7RA 3DHYA 1JPJA 3QVLA 4KSYA 2FZVA 1ECBA 2DHQA 1GT6A 3AGQA 1J1IA 3IODA 4EHDA 1U2DC 4MEXA 3VPCA 1UBFA 5EMKA 2KNJA 1TAGA 2RMKA 3KZCA 3RAPR 3AERB 3BJRA 2YNMC 2R65A 1K6XA 1B4FA 1R12A 1XTIA 4PSCA 2B78A 1O0BA 4BC0A 3AR7A 1S3FA 3KPYA 3LLCA 1YIDA 2YYSA 2RAPA 1V43A 2ZXUA 1X8XA 2ZJ5A 4OHZA 1Q0UA 3TOVA 3OZIA 1CLUA 1XJWA 4X7PA 1IOZA 3KDAA 4MVJP 5SICE 3UJ6A 2J3KA 1X6VA 4A6EA 4Y98A 4H35A 4Z4EA 4DSTA 5J59A 1MO6A 3DV0B 5J2AA 2AZ4A 1T0IA 2LZ0A 4M36A 2D4AA 3W5HA 3HY6A 2HXSA 1EH5A 3IDQA 4N8EA 4J7AA 1UZMA 4FWIB 1CYEA 1WXGA 3L7AA 2YYYA 3HP4A 4TUYA 5I9BA 5JW6A 3H2ZA 1JAZA 2O0HA 4L3OA 2QJRA 2ZRFA 1TUBB 3GNSA 3MWJA 1UAGA 1ZIYA 2J3LA 1ZJWA 3EPKA 4MI1A 2VHZA 2ZTSA 4NATA 4BWVA 4CQLB 2M6SA 1Z6TA 4C04A 4E2FA 4R8UA 5H3CA 2O5RA 5LOVA 2XCRB 1FUIA 3EXHB 3WGYA 3AESB 4X41A 1GQYA 2QK4A 3G0GA 4UZSA 5JO0A 2XB6A 4YX9A 2ZSUA 4QGAA 3CNEA 1Y1PA 4OXYA 4BWFB 5E2AA 5JATA 1T9BA 1SGGA 1N6NA 4OBEA 1L5VA 1GUBA 4ZVPA 4HRYA 3FAZA 4BKOA 2H85A 2QLMA 2W2KB 9ICPA 2NU9B 4D8WA 4LQLA 2BGTA 1M1NA 4BECA 1C3VA 3ADDA 4GE3A 3FUTA 5ALOA 2DH5A 2GN9A 3W7BA 1QK4A 1DQSA 2RK3A 3FWYA 1XAHA 4XIYA 4B9LA 5M29A 1DIHA 4RZ3A 1FP4B 4YI3A 3LPLA 3SSOA 1V97A 1U8FO 1SD5A 4BP8A 3BE5A 1KFJB 3QUCA 3EF3A 4LWZA 4LFCB 1D04A 3MUEA 4JWMA 2AFVA 4HX2A 2Q7OE 5JT1A 1D6JA 2HO5A 2X42A 3DAGA 3ABOB 3EIFA 1EE2A 4KC0A 2HCJB 1NLZA 5TEVA 4GPIB 2O4CA 1B7GO 9ICHA 3ESXA 1QP0A 1TM7E 1Z06A 3W04A 4G4JA 4E31A 5DGHA 2JLVA 5HIJA 4UHJA 4C7KA 3MTQA 5CAEA 1YRBA 1K8XB 3OSZA 3L05A 3C6BA 4DZRA 3COVA 4F3YA 3N1UA 2RP5A 3AVUA 2ZR8A 2VIXA 3FYTA 3GGGA 2UAGA 2OZVA 2WFLA 1UPHA 4IRXA 5KHAA 3DWGA 4BPRA 1TA0A 1SHKA 2L82A 5I3ZA 4ECWA 3CHYA 4URFA 1KK3A 1DK2A 4HQNA 5DE3A 5LWQA 3ET4A 1MMFB 1P29A 1CEQA 5TQ2A 1AZTA 1U7XA 2OZPA 3LHSA 4GGPA 1T8EA 3TLXA 1M75A 1LK5A 3RSCA 3HWX1 4BEVA 4IHAA 4K1LA 2FUKA 1YRWA 1RYBA 4M1EA 2H8KA 1V95A 1JDJA 3NTQA 4IQGA 3IO5A 1WHSA 4AJHA 1CNFA 2Z1NA 4EPWA 4B46A 3R6DA 1CDDA 1R3UA 4CEIA 5IVHA 2WIAA 1YASA 1GPJA 4LBYA 3R76A 3DT8A 2CHFA 3WAGA 5F77A 2P3LA 1UMCB 2F8KA 4V03A 3W4JA 2I33A 2YJGA 4MZXA 2HMVA 4F5PA 2PXCA 3E27A 4YJDA 2C9ZA 2QQ0A 7ADHA 2KJ8A 5EWLA 2C1EA 4D79A 4KNYA 2VAMA 4I4NA 4DDTA 3UK0A 4C0XA 4YV1A 1JHYA 1OWMA 5KFCA 3NH6A 1YFZA 1GCGA 3U40A 1Z0KA 4ZO6A 3IVXA 4LPSA 3WYFA 1Z75A 3D8SA 3CUVA 4P4SB 2A1AA 2HI0A 2FEAA 4HXEB 3KFLA 4BX9C 2AZMA 2Q46A 3HA5A 2PYDA 1QO0A 2O6KA 4HMPA 1ZC4A 1ABEA 1UDCA 3FGNA 3BX1A 4ZZ1A 3G6WA 4B4WA 3WNDA 5DHQA 1G8PA 3G2NA 5CCBA 3UFXB 4PXSA 4Q9JA 1JAXA 3T3EA 4IH4A 1QLWA 2PGAA 4OL0A 4CN9A 5JJKA 3QU7A 5FRDA 5FKJA 3W9BA 4RQ5A 2R6FA 3CEPB 3THWB 5FR1A 4HYYA 2GSWA 4GVLA 4KFSA 1UAAA 3ZZMA 2SECE 1O6ZA 5JXHA 4V0QA 5I8PA 5T8KA 2HWYA 1G8AA 2QENA 1K7SN 2J48A 1RQXA 4DIKA 2CUTA 4PPQA 3IEKA 2HB6A 2HA5A 4XVHA 5J2FA 3RU3A 1RPTA 2O14A 3CZAA 4WQMA 5BNTA 1ZUIA 4Z6EA 4LI0A 1F2VA 3DR5A 5DB7A 4WOPA 1JROA 5EZYF 4LCJA 2JH9A 1LF5A 1SCQA 3AJ8A 4YHBA 2C7GA 4MQ6A 4PY2A 3FNIA 3MLBA 1YC2A 2C7RA 4DRXB 4P35A 4F3CA 1Z6AA 4P3OA 5KYWA 1GD1O 3QSYA 4W1RA 4PLTA 2A1JB 2Y0BA 3GEBA 1OT3A 4Y7CA 5IJWA 1ZQRA 1RXIA 5JYDA 4FC7A 5BWNA 2BHLA 2PKCA 4XTCS 3TAPA 1SCIA 3R8XA 3GJ5A 3HSSA 2VSXA 4DQVA 3HKDA 3MGAA 1BWSA 4LFAB 2PKEA 1DBRA 2CV1A 2OBNA 1CYDA 3CZCA 4DMMA 1P8AA 1OA1A 3S81A 4FTWA 2ZWPA 4YCCA 2ZTCA 2PLFA 2P3QA 2TMGA 3CGGA 4B6SA 7ICNA 3ADBA 4FDAA 4ARZB 3AO0B 3LQYA 1TCBA 4MR7B 2BMVA 3HL4A 2Q3MA 3HYLA 5B2ZA 3CEHA 1SQ5A 1NW3A 2AQ0A 3BAFA 4DSAA 1Y3AA 2PV7A 2NU6A 3DBOB 3C7TA 1U8TA 3C3WA 5I48A 3ANLA 1JW9B 1PAUA 1VBKA 3PE6A 1XO0A 3TZLA 1XCPA 4O5KA 2GS9A 2AC4A 3LVQE 1ND6A 2X76A 1G291 3DV9A 1R9NA 2HW8A 3HE3A 4UATA 3M33A 3F2CA 3D8BA 1NAHA 1UZLA 5EVCA 3AUAA 2JHFA 5DNWA 2ANCA 5A5DA 1DAGA 3HR4A 3VPSA 4OM8A 2LKCA 1Q20A 3Q12A 3K0CC 1ITZA 5DULA 1AHPA 1HOXA 3HJBA 5KVCA 3DBVO 4TUPA 2CYAA 2I4MA 2IBMA 1WMFA 1ZCZA 2AMYA 4MKIA 4ED9A 1Y63A 3N7PD 5KBYA 5ALUA 4GSYA 3RB4A 4QZFA 1YTUA 3T5HA 3IRVA 4DR1B 2ZIEA 5KOYA 3TXXA 5K3FA 3IX7A 1S5PA 3GEHA 1SUIA 3WDLA 4L15A 3ICVA 1WW8A 4UCXA 3BHIA 2VQDA 4RNDB 4AY5A 1T0UA 3T7EA 4RFSA 2GZRA 2NVWA 2YJ6A 1WF3A 1TZ2A 3C2QA 1R4NB 4QSHA 2QUHA 3IULA 3IV9A 3DXZA 3I6ZA 1ZIXA 2PV0A 4QZ9A 2WAAA 2VZ9A 1AS2A 3G7SA 4LA4A 1WP4A 2X3UA 3AM5A 1QLJA 5IVKA 5C3UA 1PJ4A 3QWAA 3IPLA 5A2GA 7ICMA 3Q1KA 4WNAA 5AH0A 3RKUA 3QOWA 4RWEA 5LMUB 2GH1A 2NV0A 4YK7A 3TXAA 3W8FA 4FLMA 5HE9A 2A5LA 2C5AA 1KDRA 4RHXA 2VA2A 1H0KA 2X8AA 3B5JA 8GPBA 2KPOA 1RYFA 4YCBA 3UQYS 2G5TA 1U3TA 4OQZA 4ND5A 2VDJA 4ZCSA 4HT3B 3KSAC 4MWZA 3GFPA 2GTHA 4X62B 5C1DA 2RH8A 4J0QA 3AEUB 1J8MF 1L0BA 4FFOA 3UKOA 1K27A 4BNMA 3F90A 2REBA 1OW3B 2ZVQX 8ICJA 3TINA 2EIXA 3QJYA 4IKEA 4WADA 1JJVA 2XIQA 3KVNA 2X41A 1MAWA 2YTZA 2FKNA 2Q5IA 3E18A 2EGUA 5FPTA 1O58A 4FUQA 4NZNA 5EE5B 3HK2A 1I2BA 3MYRA 1TZMA 1QV7A 1L5ZA 1Z35A 2AGVA 2XVMA 5H3LA 2QTCA 3DQZA 4RH1A 2NU7B 1P5FA 3QELA 2F1IA 3CLTD 2H2FA 2WWTA 5KVAA 3BN3A 3ITKA 5GVSA 2PGXA 5G0WA 3NP7A 3R8FA 1B15A 1HF3A 2ODEA 5JSZA 5IK2D 4FFRA 3RTCA 3LMKA 1PRYA 4X45A 4TTIA 2Y0DA 2REQA 4N1AA 3GXOA 2O2JA 3MWKA 2AA3A 4Z4GA 5FEUA 4YEDA 3KPWA 2RHOA 4A0FA 1QVZA 4XRHA 4X8MA 3SC4A 1J1ZA 2XSZD 3ZE9A 2I7TA 2ZT5A 3VNRA 3QF7A 1U5BB 3GJRA 4CW7A 4JJZA 3B0XA 4I9UA 2Q4BA 1M6YA 3AVQA 2I6GA 1MIHA 1MO5A 1M2FA 1LU9A 5ESWA 3LXMA 3CLSD 2C04A 2ZYHA 4PSKA 3IAAA 1F6DA 2WOJA 3I1YA 2IYZA 3GFFA 5KT2A 1VOTA 4BO7A 2JGJA 4L9WA 2DPJA 2DP4E 1ELOA 1TUGA 3V6JA 4Z54A 4A82A 2RK4A 5KWIA 4LZJA 4REOA 1UT8A 1JEJA 1VJTA 1BW9A 5EYPB 3OESA 4UB8U 1QHFA 5D5HA 5EJAA 1AGYA 4ZCIA 4V3BA 2QL7A 3K15A 1V8DA 4OJYA 4AP5A 3R7LA 5AVTA 2NXJA 5JC8A 1GFIA 4E51A 4KXXA 4KREA 1E1CA 1QGUB 4C0HA 2IW3A 4ACAA 3FTEA 5SYNA 4JGGA 2VPZA 5K0BA 4QZEA 2YYAA 4JB0A 4DIMA 2V9CA 2E1FA 3PEWA 1SMKA 2YIJA 1UXJA 3HDTA 1T6NA 3FYUC 1FE8A 1CR2A 5J2GA 1OW5A 1N6IA 4RJLA 2AKAB 1T0HB 2P30A 2ACWA 2BF4A 3CNQS 4I1OA 2J6SA 5HILA 1MQAA 2RGNC 2XY5A 1P3DA 4W5QA 3L2OB 2HLHA 2IP1A 1DO8A 2K4IA 1A0OA 3UCFA 3BQNB 4BCDA 2O8FA 3K1AA 2NP7A 3IMCA 3IBGA 2WNHA 2RRDA 2FWJA 2XCAA 2WP0A 1YTLA 4CR7A 1NFQA 3W5BA 2HRQA 3V97A 3REFA 1N5KA 1T34A 1LS1A 4NH0A 1OR8A 3PQEA 2HK8A 5B6PA 3CQ9A 4Q00A 1TYCA 1E1QD 4YJ2F 3PGKA 1IM4A 4TUQA 5DN6A 4Q4HB 5HDBB 2BD0A 4OPMA 4EZIA 5CLLA 3O8LA 4AJ1A 4PTZA 3PRJA 5CVEA 2XE6A 1Y9ZA 1APBA 4GKKB 1CVRA 4TL8A 3P20A 3C98A 1XWLA 2DPHA 4L5IA 2RCNA 5I01A 1F4LA 2Q4DA 1NR7A 3ENVA 2KFNA 3C2LA 2IP2A 3ZQ6A 2GERA 2X9VA 3TWOA 1E79D 3I37X 1AMUA 3V7LA 5AM2A 4EG8A 3DL2A 5EZ5A 1LBQA 4ED2A 2B8NA 3NW9A 1VJRA 3G6YA 3TKLA 1D0VA 5KO2A 4C0JA 5B1EA 5HOEA 3SMQA 1AS3A 2WF7A 4IR7A 4KMOB 2EV9A 5CFZA 4HDQB 4PV7A 1AHHA 4D8VA 1Z7YA 2JL1A 1B2LA 1PZEA 1GHTA 2ASVA 2GEKA 4IIJB 5CVUA 5BSRA 3VNAA 4KFTA 5HKKA 5ILQA 1MNAA 3JVIA 2IPXA 1TEXA 1R4AA 1E1NA 3EXAA 2OAP1 1DRJA 4LECA 2OG1A 4GT1A 2C9DA 1IBRA 2XA2A 4LOLA 4RZUA 4A3SA 3E53A 3AB7A 4AJLA 4QYIA 1B42A 1PBNA 2ZJBA 4MW7A 1WPRA 3RJ9A 2X2FA 2J9FB 2Z08A 1ZH4A 5I7WA 2DQYA 4KRXA 2C2RA 1CZNA 3IQZA 1BNCA 2V3CC 4DEYA 2ZIWB 3BICA 7ICQA 1ZQYA 3QKUA 4FBLA 1QQ5A 4R1TA 1M73E 3DB2A 1AKTA 2VJPA 2C5SA 2CF5A 1TTHA 4CTKA 2W0SA 5BQ5A 1HE2A 1A88A 1D2NA 4WK0B 1R50A 5ENZA 2INGX 4OF4A 3JPNA 1R16A 1J56A 2A4MA 1VMEA 2IHYA 1C50A 5LUAA 5D84A 3AUTA 4L0QA 2M9NA 1ML4A 3OF3A 1JJIA 1POWA 4BFZA 4X20B 1HL7A 2YS6A 5LZ8A 2D5LA 2DUYA 1XMOB 2P9EA 4B8ZA 1NIJA 2BP7B 3SQNA 1QS0A 1TF2A 4XAQA 2WDZA 1IK6A 4F2GA 2NVOA 4NONA 1YZ7A 1TI7A 3C3JA 5I4IA 1SXJB 3RWOA 1KZ6A 3CWQA 3MC1A 4B87A 3O91A 1TTTA 4EUFA 1L7EA 2LGJA 3WS7A 1QTMA 4CKEB 4TLMB 2WF9A 4XFKA 4LV6A 5DK6A 2X2EA 1T2FA 3F5MA 3EEOA 1WZEA 3MJTA 4ICIA 4M1ZA 4F4HA 1WPXA 1CQXA 4NJMA 1DTWB 1GNTA 4JOQA 3BHJA 3AF1A 2AIRA 3FUUA 1A8IA 2ZJOA 1GL7A 1N78A 2HWKA 3ENNA 1F0NA 3IDSA 4OAOA 1TVCA 3IP5A 1Y8CA 1WNFA 1A7UA 4PHAA 1LBEA 1MKYA 3DMNA 4EO9A 3U4MA 3ZD6A 1FX0B 1JALA 3B6ZA 2FGKA 2PX0A 1FYWA 3F53A 3MJFA 4M55A 3BBPA 3NYWA 1LTHR 3ZBQA 4R8SA 4G37A 3C45A 1CY4A 1ZICA 2WJJA 3TUIC 4UTVA 4QGGA 3RTAA 4RV5A 4KACA 3REQA 3FNRA 1QYCA 2L42A 1N2XA 2D6FC 2GXQA 4IY1A 1VCMA 5HCIA 4UVHA 3RASA 5HRAA 2ZWAA 1UP7A 5AKXA 4C7BA 4JJ4A 2SKCA 3UB3A 1B23P 3AH8A 3GJZA 4Y6LA 3O8BA 3DTYA 2VQ6A 2JAUA 1LI7A 3AP3A 3A9TA 4G5QA 3HCAA 4JNKA 3RGWS 4DPLA 2G4CA 1OFUX 1MUUA 3KP1A 4B71A 4AYBF 2J7PA 5G3YA 1JXQA 4U3JA 3ZBPA 1KH3A 3RJMA 4KN9S 4Q15A 3DH0A 1ZK0A 1EFRA 3ER8A 4RNMA 2JI7A 3F5EA 3WRYC 4ZQBA 3D6HA 3H9BA 4O2LA 4WY8A 2FX3A 3N8GA 2JGDB 4LGVA 10MHA 3QFCA 4NWIA 5HYVA 2FFRA 5KFQA 1RAIA 3RVLA 1VYTA 1FRQA 1IC6A 3WGKA 4QYWA 5JCOC 1C14A 4UUPA 4RZSA 5M34A 4W7IA 3OF2A 3G2QA 4YAOA 2VQ3A 4DMGA 3FLBA 2HKIA 4JLPA 4ZVOA 3UYLA 5L3SA 5FBZA 3HV0A 2MJLA 3DUFA 3IIMA 2VRCA 4Z7JA 4K9OA 3QXHA 3A6HA 2YJTD 5JSYA 1JH8A 1XB2A 2YN2A 2Z6UA 1ZM2A 1XCMA 2FN8A 1MDBA 1MRSA 2AI3A 3GNQA 3RVSA 4CKXA 4XGQA 5A06A 3V48A 3GJYA 2AMLA 5AUOB 2GKSA 4NP6A 4QYTA 1HI9A 4OKSA 3KYIB 3U4HA 2PUJA 4FMBB 1VBNA 5AICA 4MI3A 1LQUA 4AL4A 2FPLA 4R6WA 4KFCA 4BTVA 2ZCVA 1FDTA 4L78A 4C6TA 3NRJA 5KFVA 4B82A 4WOKA 1I7QB 2ZUWA 3BGOS 1SV0A 1M8KA 3GCGA 3BWYA 1E0SA 3C15C 3MWDA 1GPNA 2QRVA 2W6QA 2QSUA 4OJMX 4X9XA 4EPXA 1XJ0A 4URUR 3U5TA 9ICIA 2EFYA 1L4UA 2ZRCA 2VHJA 3LOQA 3AR4A 4IFTA 1Z5PA 2IY7A 4RJJA 5BW8A 4UVDA 2Q3CA 4EY5A 1GPKA 2AJCA 4N3BA 1WVMA 1NUPA 4AUKA 3K4PA 5HGJA 1OZGA 2YVKA 4KDCA 2ISOA 4QJIA 5JUMA 3D2AA 3IIEA 5EN4A 4JUDX 4KN6A 9ATCA 5BN5A 2JR5A 5GGYA 2BJVA 1D9ZA 4D42A 4HN4B 4I3HA 4KWHA 4X63A 2AJTA 1Y9JA 1SXIA 5K8IA 1LPOA 2C3PA 5JANA 4QW9A 2I29A 1AO0A 1IEQA 2VC2B 4MUEA 5BPHA 1OWNA 2FMFA 3IJEB 5IS2A 1KQPA 2JI6A 3AF3A 2ECPA 4ECEA 1JMYA 4ERXA 5G41A 4PTYA 1YBAA 2MINB 2D8CA 4I2BA 2DULA 4EYQA 2IIVA 1UJ5A 2P62A 2O3RA 5KT5A 1XZBA 4HYQA 4YMHA 4H08A 1E1LA 2DOKA 4QDUA 3CUKA 5A6SB 3DEJA 1X42A 1S8OA 2JCVA 4U2EA 1M6EX 4OIFA 3IMKA 3TSCA 4IR9A 2ZYSA 3U44A 2V5AA 4ARBA 4F4DA 3GZTB 1BJKA 5FO0A 1H6AA 2PFPA 2D00A 2C4KA 4N0DA 3ZQKA 1T2NA 5K8JB 2BFEB 5HF5A 4C6RA 1RCUA 1QRDA 4Z4QA 3QM1A 5K1ZA 5JPCA 1WDTA 4OA5A 4DJDC 5CDUA 4FKZA 4A8JA 3L3FX 1BWPA 3W90A 2VPPA 5KG5A 5E9AA 4TS1A 2PMBA 2BCVA 1XTQA 1RKBA 2AU0A 2HAEA 1WD5A 1LQ2A 4OREX 3Q98A 1ZGHA 1P45A 4Z8YA 5J0WA 4MLDA 1XE3A 1QQ7A 3THRA 4FYVA 4F3OA 5HTKA 4M7RA 1PJQA 4NE2A 5DTEA 3EDOA 5D3MB 3TFQA 4JI2B 4GW3A 4C03A 2P9TA 4CIBA 5K01A 3QXSA 3AF5A 1ZQXA 1ZQZA 2PT5A 4AT1A 2FJ6A 1V3QE 1N62A 3LKBA 3BS5A 3ETHA 2GO7A 1O5OA 3T4XA 3ZGYA 4YCMA 4E7OA 5HS6A 2PX2A 1T8PA 4BQNA 2CEKA 2KJ5A 5KINB 3FNFA 2CMDA 2IELA 3I9LA 1ZRNA 4MV7A 2BFBB 2AJ8A 5DHUA 2Q9AA 3J80A 4DR4B 1U8YA 4QNLA 1OFVA 4CWAA 1CUKA 2J6BA 3D3QA 2PD4A 5KYXB 1Z83A 1ZUNA 4QRDA 4DL2A 4CIYA 4ARIA 4CN8A 5CFNA 1Y6FA 2CK3A 1OF1A 4DMCA 2VOEA 1NBMD 3TANA 4FNGA 4C2UA 4QASA 5K4GA 2KSQA 3JATB 3K6RA 3RC1A 1PKXA 4WSOA 1E94E 4BNNA 3R4VA 1Z56C 3VU0A 4POOA 4LZGA 3EG9A 1IWOA 1FFSA 1X19A 4N6NA 2QTGA 1C20A 4X44A 1N33B 4OB6A 4LS3A 3ZDBA 4IF4A 1CZLA 1DG9A 4Y2VA 4DIEA 5EMHA 3RSHA 1R0BA 2PWBA 3IUEA 3L8EA 1KBZA 3SU8A 5TT0A 4KYUA 4RJTA 2GM9A 1GCOA 3BDVA 2PS0A 1QP7A 3PVZA 1DDOA 3HADA 4GR4A 2NTEA 3F3YA 3F47A 2DPIA 4K3VA 4I2CA 4E5DA 3KHSA 2JBHA 2KVCA 2IZ0A 2ZULA 2H2IA 4RTKA 2R8HA 2J07A 1EEHA 2L5YA 3HKCB 4RYDA 3AKEA 3PRHA 3TAXA 1TKRA 4YMOA 2BFAA 5LIPA 3UK2A 1YKSA 1B6RA 5EWEA 1W47A 3UHPA 3LCRA 1NASA 4M0LA 3E3MA 4JT4A 3BH7A 3O9VA 4IIDA 3DBRB 4INJA 2FMPA 1IJKA 1QIDA 3GUHA 1L7NA 2J85A 3ZXXA 3PD0A 4J91A 3V00A 4XYEA 2X15A 1MC5A 3LW8A 3H9QA 1E6EA 2EYQA 2OGZA 2I6UA 1ECLA 2FJUA 3L1KA 3ZEIA 1K0FA 2SNIE 3TARA 5LP6F 3KKEA 2R00C 2PU5A 5AVVA 1QX4A 2R8GA 2DETA 3MQ4A 2NAPA 1ZW1A 4DQRA 4L16A 1BPBA 4OXKA 5CH8A 1N3YA 1U2RA 2XUFA 4B3BA 3RTBA 5ESRA 3WRXC 2QTZA 2FLPA 3S4YA 4JVNA 2DECA 1KF0A 2P90A 3VR6A 5DVZA 4F5OA 2YRFA 1GAWA 3KBBA 1ND5A 1KVUA 4WWHA 4OSEA 5ALNA 5JO9A 2QTVB 3HPQA 4OQNA 5FUYA 5EIBD 3GDGA 4EEXA 1UWCA 5DKWA 3T79A 4ML3A 1RQ7A 4DQPA 2XYHA 2D59A 1P6XA 2OUIA 1X1RA 5DWQA 1YQ9A 1ZQTA 2C8JA 5L4SA 1H6BA 2EGHA 3NPMA 1HLDA 2I8CA 1O77A 2JFFA 1PWXA 4BKUA 4XM2A 2D2IA 2X8JA 5E1DA 1KEJA 2JFUA 4D3YA 5AOAA 1B3RA 4AQDA 2R85A 3NHSA 3ZZ0A 3UW3A 3MR3A 2GHRA 4M37A 3STYA 1OXKB 1PGNA 3NWOA 4DC9A 2Z98A 2GRJA 4B4VA 2JI4A 1U8UA 4L73A 4PCUA 2NNWB 3MG9A 3ZWDA 3EMBA 3GBSA 1TM2A 3TI0A 4OI4A 2JJMA 1M34A 5E4JA 4YREA 3UXYA 1BDIA 4O5OA 3WSTA 3SQXA 4JQOA 4MEBA 4FJ0A 1JB9A 3RS2A 2Y1KA 2NZWA 2Q21A 4BIMA 4W5HA 4YBZA 4L08A 1SQ0A 2FN3A 2R9VA 3QV1A 1VCNA 1M6WA 1BSVA 1XF9A 3ZE7A 1B6GA 3DMYA 5KOHB 2FU5C 3VDNB 3K71B 2A1UB 3QKIA 1DOHA 2XDQB 1TVKA 1J2UA 4ZEWA 1N61A 3H8MA 1KO8A 2E0IA 3DDZX 1CQZA 1LWOA 3NOXA 1FTQA 1PHRA 4CMCA 1UXKA 1E1KA 3AJRA 3L49A 2A0WA 4RK1A 4LY3A 3ZJUA 4IDBA 4QIWF 9ICTA 3QPAA 4DA9A 1B4DA 2R6R1 5JWHA 2GHQA 3H9EO 5DYNA 3TQSA 5BRJA 3JQFC 1S4MA 2UZ4A 4JR0A 2J3JA 5LUBA 5TV2A 2XMQA 1ZD2P 4Q16A 1GQQA 2OEHA 5B1YA 3SZOA 1PK7A 1O9HA 3TUZC 2LM4A 2ONKA 1ZQJA 1LJ8A 1G20E 1XPUA 2AMFA 4RWZA 5TS3A 3S2SA 1NSTA 3GROA 4H59A 4IJVA 4N47A 1U0LA 4C4RA 4INOA 3GLFE 2JEFA 4EVQA 4D9NA 2P5TB 4RIEA 4G0VA 3H97A 3QBTA 3QU4A 3HM2A 1X2BA 1YCFA 5EMMA 4IYJA 3FTQA 1WB5A 1SRQA 3ZIUA 2W48A 5ALWA 1U1EA 2VR1A 1SCJA 3T4UA 3U2QA 4B6EA 3PSFA 3OE1A 4G36A 1A98A 1X7WB 3VTKA 2Z8YA 2WYWA 3WE7A 3ZJ5A 1JHUA 5GM2A 4RLSA 1EJ2A 3ZU4A 2GHTA 4NOLA 2ZUDA 4E22A 3RB0A 5LMNB 1AK2A 2NYVA 4HR7A 4G25A 4J0CA 2FUEA 3V8EA 1XXLA 2A2ZA 2G5CA 4DJ5X 2ISPA 4DS3A 1FFHA 4GX5A 2HRRA 1RU3A 5JAMA 2HCFA 1J0XO 2FSFA 1OYWA 2TECE 2M98A 4G23A 3KLMX 4QYSA 1GA1A 3O84A 4YMSA 3KEFA 3PCRB 3CPJB 4DE5A 5LIRA 1H9AA 3IHKA 3R8CA 5C4IA 4K86A 1RJWA 5DEIA 4X95A 4OLFA 2IDJA 1EZ1A 2IDZA 4XGIA 2VO1A 1VL1A 4NCNA 2Y9MB 3S1LA 2C00A 3VHLB 1Q1EA 3WJ2A 2JAHA 2J0UA 5JZBA 3AM3A 4UCFA 1IY9A 3VKHA 4M0EA 4WKGA 1SU8A 2QZJA 1PDVA 1ARZA 3WK5A 4MZDA 5FWYA 3LWZA 5FHRA 3WVNA 3QVGA 2FXVA 3DAPA 1P1KA 4J9SA 2Q28A 4LY6A 2VNAA 1IPFA 1VHTA 5JCXA 4ZIRA 3BJEA 4JU9A 1J0DA 4GSLA 4ZOLA 2PJRA 4TVKA 4QUAA 3ZVRA 4PYKA 1VI6A 1KDVA 2WVGA 1FFXA 4QGFA 3BQ9A 1ZQUA 1JPNA 4QGSA 3GMSA 3G3EA 1JV2B 1IHPA 5SZIA 4Q05A 1PJTA 4AMBA 4W5WA 4DR2B 4GNRA 3FGZA 2JLQA 4OHCA 1W4BA 2XGOA 4ALLA 3IP1A 3HPOA 1BS1A 4OIMA 5FBQB 2I2AA 5K0ZA 3M6KA 3FY4A 1NVUQ 3NBFA 2GETA 1DQPA 4FYKA 3MTAA 1J22A 2NNLD 1OAKA 3CTPA 1BVHA 5KTTA 1V5IA 3GLRA 2YBDA 3BL6A 2FRXA 1BDHA 4BNZA 1HUZA 4MVYA 1CZOA 3LT4A 1TZKA 3AMZA 2QYHA 2FPGA 4KDEA 2R1ZA 2BEWB 1XZDA 4ZVQA 3V7NA 5E8RA 3HJUA 3ZHRA 4ZCLA 4RSRA 3JALA 2VCHA 3DCNA 4AICA 5IIKA 2CB0A 4WXYB 3FHOA 3UH1A 3AEZA 3M70A 4Q1DA 2PMCA 4IFBA 4EJMA 2PKRA 2D0PB 3OOWA 4AJOA 2OBXA 3ASVA 3I23A 1K5OA 3VTFA 2NPFA 4QWAA 1UQVA 1QYDA 2X4LA 2B8JA 2Q5LA 1UOEA 4JU8A 3L6BA 2EJTA 3VR0A 1QTRA 3LXXA 3TZEA 1ATIA 3W8DA 1H1LA 1V6SA 5IYZB 4NX2A 1D9XA 3AFOA 4RNNA 3B9BA 1T4GA 3UV3A 3DEZA 3OF5A 3SQDA 4KITB 3OT1B 1YDHA 3MGBA 2I34A 1U2GA 2J1LA 1DAHA 1PS8A 4DA8A 3AETB 1ADBA 3F2IA 4R2IA 1Q6ZA 2VP4A 4DANA 2IVZA 4EPRA 2EKBA 1QCCA 4MRRA 5G2OA 4GPBA 1QTNA 3COSA 5C8ZA 1HSOA 2WWVD 3WBBA 3JYNA 2Z5GA 1KZYC 4TMTA 1XZKA 4XKJA 1G16A 4P31A 3L4BC 1AXRA 4EFMA 4A6DA 2NXNA 3AIOA 4QZCA 3CG0A 4BVJA 2PAFA 3L8FA 4KYIB 5EE9A 3D31A 4RQ8A 2XX3A 5BVGA 2ERYA 1SU7A 2NO4A 2EZXA 4CF7A 3P94A 4PYMA 4L6CA 2V7QA 1M2OA 2OT3B 2BDPA 1F06A 1ULSA 2EAUA 2FPPB 1ODFA 3RUAA 2DL0A 5KG6A 2Z8ZA 3KETA 4DS4A 4BQSA 2YS7A 3QW2A 1E2LA 3ZU5A 4E33A 2IZ1A 3IKTA 1ZQDA 5B4TA 1R0SA 1S9HA 3AB3A 4Q44A 7ICFA 2VKTA 4AVYA 5KG4A 3EB9A 4QUEA 1JA0A 3Q7QA 2NOAA 3KALA 4JI8B 2ZGVA 3ITNA 4EGFA 3O4HA 2YN0A 1DZIA 4JYMA 2ZQZA 4AP9A 5FNVA 3H40A 5BV8A 1QO9A 1EK1A 2FTKE 2IZOA 1I7NA 1J5PA 4LF8B 1NZPA 1TJ4A 2FSGA 2ZUFA 1PD1A 4GDFA 3CPSA 4JY7A 5KX5A 4H3VA 3GUYA 4PSUA 2BKLA 3VPBA 1A5SB 3ONVA 2YZGA 5KQLA 1UXHA 1JP7A 2R8JA 3IT1A 3Q40A 4E6EA 1BMFD 1VG8A 3SS7X 3ET5A 3P2EA 2C2HA 4OHUA 3KTOA 3VDQA 5AW4A 4W5NA 5BSEA 4XWWA 3DFUA 1FU7A 4TRNA 3SK0A 4I28A 3NNSA 5C18A 1EFPB 2B8WA 2DB3A 5C5JA 2X1HA 2VRWA 3MCZA 3FHJA 4URVR 3P32A 5JCJD 3AYXB 1PYGA 5DM4A 1LKYB 2JEJA 2IDMA 1F44A 4B3TB 2V6IA 4QZ8A 4BXOB 1NURA 4P0PA 3NVMB 4UHBA 4D80A 1GQOA 5JH7F 4F6CA 2YL2A 2C9MA 3PPYA 3ABSB 5AVKA 1U8XX 1J8VA 4GGOA 4C4PA 2BWJA 1T6BY 2OCKA 4B9AA 3V1MA 1P39A 5LXTB 4ZOAA 1Z0DA 4B2LA 4MKFA 4PZ0A 1VKRA 1TAMA 2AQIA 3HN7A 1YQGA 2IS1A 2J4CA 5F9HA 2WJ4A 4YP3A 3LBFA 4DIFA 2HBRA 1UBKS 2B9EA 5AW2A 4DLZA 4MJ7A 3IUSA 3H11B 4EW6A 3EMDA 3F3KA 2PXAA 2PGLA 1A2KC 2XA1A 1UA1A 1BCRB 5AK5A 2B36A 3N8KA 3F6PA 3IOCA 4DM4A 4XI9A 3OMXA 1M3SA 2YWGA 2X9GA 2EDAA 3C8MA 3UPTA 1CERA 3TEJA 3OEHA 2I4IA 4GL2A 4W8HA 5DI3B 5FL7D 4JAVC 4Q7QA 2BY4A 1VSVA 2H4ZA 1E7QA 3H1TA 4EL0A 4Q9AA 2RQ5A 2DWPA 4HDAA 1KAQA 1PT5A 5FYDA 4ZVVA 4E1BA 2QB0A 3CSUA 1FYFA 1NY6A 1YZ6A 4JXZA 1YB4A 3N6VA 2E4VA 1W88B 2AD5A 3HBLA 4P4LA 4TVSA 4JEIA 2QMYA 5MN5A 2W71A 2MU2A 4A2QA 5AW1A 4H3HB 2JGKA 1E64A 1E3WA 3L01A 4DB4A 5K0GA 1AKMA 4G4IA 3HKEB 5BXQC 1MT0A 1L7VC 3FZNA 1JIIA 3RHSA 4YT8A 1TX4B 2ZSDA 3R74A 2JC3A 1CI4A 2I5HA 3MN1A 1R6VA 2P9BA 3OJUA 3R44A 5L95A 2R8BA 1KU6A 4JDPA 3VSDA 8ICMA 1QZZA 1KYVA 4PPYA 1DPFA 4RTLA 1BPDA 5FA8A 2QMQA 3CMMA 3V34A 4KGDA 1BX3A 5IPFA