1ZOLA

Native beta-pgm
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 72
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1zolA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zolA01
5AM4A 3N8GA 4HGOA 4HAIA 2B8JA 5AKXA 3VAYA 5AM3A 4L57A 4HGQA 3NIWA 4ZEWA 3M1YA 3OPXA 4IG4A 5AKLA 5AVYA 2YMQA 3ZWDA 3QUCA 3W5AA 4UMDA 1Z4KA 2HEGA 1ZJJA 1TJ4A 1QYIA 3SLRA 4Y2QA 1YJ5A 1WZCA 4UU1A 1WVIA 4HGRA 2W4MA 3ZVNA 1Z88A 5ALOA 3N07A 1Z4QA 5IT0A 4OCZA 2RBKA 3AR5A 1TE2A 3KBBA 1QQ6A 1SU4A 4BX3A 3ONNA 2C8KA 4I9GA 4Y2VA 1ZD2P 2R8EA 2MU2A 5ALXA 3ZTWA 5JJBA 4G9BA 4OHFA 1ZD3A 3L8FA 3M9LA 3L0YA 2HCFA 3WK8A 2G0AA 2JAUA 4ZEVA 5ALMA 2ZBFA 4GXTA 2O2XA 2Q4RA 4J2TA 4CNQA 3N1UA 3OCYA 5ALVA 2B30A 3U19A 4L6CA 3WKDA 3GYGA 4HYTA 4AP9A 3D6JA 2PQ0A 2IA5A 5AKHA 2Q5EA 5AKKA 1Z4NA 1RRCA 4B6JA 1RKVA 1N8NA 2OYCA 2C8LA 3AR7A 3QUBA 1XPJA 3OCUA 2C4NA 2I34A 2YBDA 2BDUA 2JAOA 3FM9A 3N28A 1TJ5A 1O08A 1PW5A 4UMFA 3QNMA 1LVHA 3U13A 2IYEA 1Z4LA 2YJ3A 3QUQA 1QH9A 1Z4OA 4YCLA 1Q91A 3PGLA 3OTQA 2QLTA 4XE5A 2B82A 4F71A 3W5CA 1YS9A 2WF6A 3UM9A 1O03A 4Y2XA 1Q92A 3ESRA 1YDFA 1YV9A 3QLEA 3F9RA 3MPOA 3U7EB 5AESA 2ZG6A 1IWOA 2YY6A 3ESQA 1QQ7A 3AR6A 4UU0A 4PNHA 2RAVA 1VFPA 3AR3A 3R09A 3SKYA 2I55A 3ZW7A 5ALUA 5AVSA 1SWVA 5AW7A 3ED5A 3NASA 3BWVA 3R9KA 2OM6A 1CQZA 3AR8A 3R4CA 2P27A 5ALZA 3KC2A 4KX3A 3WK4A 5ALWA 4CF4A 4RETA 4GIBA 4NV0A 2X4DA 5IS2A 4BNDB 1VJRA 3QXGA 1L8LA 4JB3A 4UM5A 1U02A 5ALKA 1L8OA 4CE6A 3SMVA 1T5SA 5AI9A 5AKEA 1U2TA 4F72A 3WGUA 4Y3UA 3UMBA 5AVQA 2DQSA 5AIAA 3WK9A 2HX1A 3NRJA 1RC8A 4Y2SA 1X42A 2WF5A 2AUTA 1CR6A 4Y2RA 3KD3A 5AKJA 3EF0A 3FPSA 5ALPA 5AVZA 4HGPA 3TLMA 3P96A 2BDEA 2VKQA 2OA0A 5AW8A 2WM8A 2JAWA 1RLTA 3L1UA 1YMQA 1Z4JA 1RLOA 2YFYA 3L7YA 3QGMA 2ZBDA 2G07A 5AW0A 5ALEA 4KN8A 3QYPA 5ALFA 4EELA 2FPRA 5A3RA 3A1CA 5AVVA 1ZD4A 3B9RA 5AVRA 2I6XA 1T5TA 3CZ4A 4YCMA 3MMZA 2HO4A 4UW9A 1U7PA 2MSNA 2YMMA 3AR2A 5AK4A 2R8ZA 4Y2TA 2I54A 4J03A 4QQFA 2IOFA 5AVWA 2G09A 3L8GA 4QJBA 2AGVA 1N9KA 1XVIA 4O8CA 1ZS9A 4C4SA 1L7MA 5ALRA 2CFTA 2HHLA 1TA0A 4I9FA 1YNSA 1ZD5A 4KNWA 5ALYA 3ZWKA 1RMYA 1Z4IA 2GHTA 2I7DA 1RDFA 4OD0A 4BEVA 4KYTA 2QYHA 5AKYA 1Z4PX 2HDOA 3FGOA 3FPBA 3W5BA 3K1ZA 1LTQA 3ZUPA 1RKQA 4NWIA 1RQNA 3ZU6A 5ALNA 3WKBA 3E81A 3OCVA 1RLMA 3IB6A 1Z5GA 4YH1A 2RB5A 2W11A 2HOQA 4FFDA 2JGAA 4YCNA 4BEWA 3IRUA 2FUCA 5A3QA 4BBJA 2ZBEA 3SF0A 2FUEA 3PCTA 1ZRMA 5AKGA 2O9JA 2YN4A 3S6JA 2HF7A 3AR4A 4OFZA 1L7PA 3CNHA 3MC1A 4FE3A 1VJ5A 4UMVA 3WGVA 2EARA 2PR7A 3FVVA 1Z5UA 3EF1A 4UMEA 3WKCA 5AI5A 1SWWA 1U2SA 3NUQA 3NALA 5T41A 1RPZA 2FEAA 2YJ6A 4DFDA 4BX2A 3PDWA 2FPWA 4XPZA 4MUMA 2YMLA 3E84A 2P69A 5AK5A 1J8DA 3WKAA 2G1AA 3EPRA 4BNDA 3I76A 1WR8A 2RARA 5AK6A 4UAVA 2BY4A 4G63A 5AM5A 4BKMA 2Q4TA 2CFSA 4C4RA 3A1EA 3L0CA 2EATA 2ODAA 5ALLA 4YIHA 4Y2UA 3KDPA 1FEZA 5AHXA 2ZBGA 3BA6A 5A3SA 2B1RA 2PKEA 1RKUA 3KOOA 5AKIA 3NANA 2IOFK 4YGYA 3IJ5A 2G06A 2CFRA 3DDHA 2YMPA 5AW5A 1S8OA 5AI6A 5AI8A 3L5KA 3ZTYA 2ZXEA 2GFHA 2NYVA 2P11A 2NO4A 4EENA 2G08A 5ALJA 3U7FB 2R8YA 2ZOSA 1RQLA 1F5SA 1NNLA 3OCZA 1TJ3A 1NF2A 5AW4A 2YJ4A 3KZXA 2AMYA 5AVTA 3U7GA 5AW6A 1J97A 5FP0A 2C88A 3N5KA 5ALGA 3RF6A 4EX6A 4KX5A 2HSZA 5AM0A 4L6AA 1L6RA 3L8HA 3HLTA 4YIKA 2OBBA 4EEKA 5AI0A 4Y2JA 4Y2YA 3OCXA 3QX7A 4IFTA 2FDRA 2WHEA 3ZI4A 2I33A 4AS2A 3DV9A 1ZRNA 2JARA 3A1DA 3QU7A 2HF2A 4NAVA 2NO5A 4BYGA 5AM1A 5AM2A 3J7TA 3B9BA 4DWOA 4HGNA 5AW2A 3UMGA 2D2VA 1WPGA 3QU2A 4DCCA 3OCWA 4NFLA 5AW9A 3DNPA 2P9JA 3RFUA 5AK3A 2R8XA 1ZOLA 2AH5A 3U7HB 5ALDA 4H1WA 3QUTA 3QU5A 2FPSA 3L8EA 1AQ6A 4DW8A 2CN1A 3HYCA 4NABA 3ZX5A 5AI4A 4JDPA 3L1VA 5AIBA 2WF9A 3FZQA 1QQ5A 1JUDA 3QU9A 5AW3A 3ZX4A 2WF8A 2GO7A 4UASA 5IT4A 1XP5A 3WK7A 4C4TA 4CF3A 3U26A 2C9MA 3ET4A 4EX7A 2B8EA 2B0CA 3SHQA 5ALHA 1T9ZA 2FPUA 4BX0A 3ZVMA 1Z4MA 3PGVA 4UAUA 4MWOA 5ALTA 4XOUA 5ALQA 1L7OA 3AR9A 4Y2PA 4UATA 3UMCA 1Y8AA 2WFAA 2GHQA 3DAOA 1EK1A 1EK2A 3SD7A 1MH9A 4UM7A 2WF7A 3B8EA 4FYPA 2HI0A 4CF5A 2W43A 3A3YA 3NAMA 3E58A 2MU1A 2FI1A 3WK5A 5ALSA 3I6BA 3EWIA 3L0BA 4AS3A 3W5DA 5ALIA 3E8MA 3SKXA 4XQ0A 2IOHA 2G80A 5AVXA 3WK6A 3ET5A 1RMQA 1NRWA 3I1YA 3QU4A 1S2OA 4RESA 1K1EA 2YJ5A 1KYTA 2GMWA 5AVUA 3ZVLA 2B1QA 4EZEA 1U7OA 5AICA 1L7NA 3I28A 5E0OA 3WKEA 4KNVA 2FPXA 5AW1A 5AKZA 1RMTA 2EAUA 4ZEXA 3MN1A 4E88A 4UARA
chains in the Genus database with same CATH superfamily
5HK9A 1SL2A 3OUTA 4I8XA 3SU8A 3WWYA 1NLUA 5DIFA 5EGNA 5AKXA 3GRYA 3U7RA 1AB6A 3KTDA 4ER3A 1P31A 4FZ3A 8ICWA 1OW3B 1WO8A 3OPMA 3LSTA 5DLYA 1XCLA 2XUIA 3TQOA 3U40A 2OECA 4LYJA 1FNMA 3H3JA 3WI7A 4HWPA 1QO0A 2G72A 2KHZA 2E5SA 2KBFA 2V3WA 1ODLA 3GZNB 3HFGA 4EF5A 5T4FA 4L0DA 1KXZA 4ENPA 1DKNA 3W5AA 1A50B 1TCUA 1VLLA 2HD4A 1Z4KA 4G0PA 4R6XA 4S12A 3L77A 2AOTB 1QF6A 3HDTA 3G9ZA 3IHKA 4M1EA 4MO2A 1X8KA 1UWVA 4IY1A 2E89A 3G8DA 4ECTA 1KRWA 2FW9A 2C84A 1KFBB 1Y8ZA 1Q3KA 2ANBA 2Y1EA 1LJUA 3VYUB 4N8SA 2PX0A 1KTQA 2D1TA 1XNGA 2BMAA 3RYFA 1M54A 1ZD1A 2PSHA 2VHJA 3MBOA 1E2JA 1JW9B 2I29A 4LRWA 4B6SA 1D6SA 2JIQA 2QTVA 2ZSAA 1OUQA 1RLIA 3AY6A 4JCCA 2D2EA 1QR2A 3LI2A 1L5LA 4FYHA 4DL6A 5FL3A 5C18A 4ZTZB 1K89A 1G19A 1BE1A 1I51A 2HJSA 1VECA 3BMNA 1TQDA 4KQIA 2PRJA 4PRLA 3L7NA 1F6DA 4R54A 1NATA 4F8YA 4DV0B 5T57A 4ND2A 2X4GA 4C8LA 3DM5A 3AFOA 4AZ3B 3TLEA 1M1ZA 4UB6U 5EFZA 1U8CB 2RMKA 1O97C 3T12A 2MCFA 1C3LA 1CETA 1VMEA 2D5CA 2PKRA 2QU7A 5CDTA 8ICMA 3M49A 3PCXA 1PJ8A 4EUFA 2P75A 4HDMA 4LWPA 1GFZA 1WM1A 2WJ6A 3W4IA 3ICVA 5EWMB 4YQFA 1EK6A 1SHTX 4LY3A 4L27A 1CUYA 2WY2D 3QVLA 3NCTA 4MCHA 1DX4A 5JSHA 5G4KA 4L9WA 2J3DA 3CC8A 4HDNB 3LO8A 4E5SA 1ZO8A 3RYCA 2Z5VA 3ITEA 1WXEA 3OKAA 3FW1A 5KFPA 1JFLA 3UO8B 3W7VA 2DY1A 4MUJA 4QYXA 3LW8A 4B6JA 1EI9A 4KLZA 1G5FA 4Z5XA 1T3HA 2XMSA 1GFSA 2C83A 2UVQA 1U3TA 2WWGA 2BLLA 5JRJA 5CDFE 4C7OA 3PR3A 4YCSA 1K1SA 1MAWA 3U3JA 4YPFA 1OH8A 1GRVA 3KLOA 3BGDA 4RVHA 1YVPA 2X2FA 1GPNA 1QMGA 2H2HA 5FNZA 1BVUA 2OTCA 2CDRA 4Y1EA 3E4CA 5JXHA 4CGYA 3ZLUA 2KIWA 1SXJC 3QJGA 5G1PA 2XMBA 3FYCA 3CVWA 3KCQA 4I28A 3SSOA 2JEYA 3UK2A 2H1FA 1S8NA 3DV2A 4EVIA 4R1MA 3I4FA 2FYTA 1ZW1A 1CUIA 2FFHA 4RWEA 4MUNA 1V95A 3SKVA 3VR1A 2B7LA 3C21A 1ZIPA 5LWQA 4EUEA 4YCLA 1Z2NX 4RQ5A 1ZZEA 2CCGA 2ZSJA 1EA5A 3GMIA 2AQKA 3B20A 2YY5A 3KIPA 2ETXA 5COBA 2BRUC 1UKAA 3CISA 1V5WA 1Y7HA 3QLEA 1LZKA 3E0XA 4NE2A 3MPOA 2O6LA 1CUSA 1ZD9A 4AYWA 1G21B 2VK2A 2ZKLA 4HLNA 3WL4A 3B70A 4DM3A 5AESA 5IWCA 3U6KA 3V7LA 2B3DA 8ICLA 2E4YA 2PA0A 3W05A 1E7QA 2PANA 2WI8A 1ZMBA 1XRPA 3A6KA 3PQEA 4UU0A 3R6GA 4XYBA 1NJYA 4RM3A 5TXGA 5F4BA 1I1HA 3GFPA 3IELA 2RKBA 3KB2A 4K28A 1ECCA 3DMPA 3GGCA 4LZZA 3AVUA 2ZVPX 4EA9A 5A2QA 4JLSA 4RYDA 5KVCA 4UBJA 1XJCA 3AVQA 5AJZA 2HK8A 2CBXA 3PXUA 4KPUB 3TW8B 5FWYB 3C87A 3TEFA 4UQPA 1AA9A 1WCLA 2IBKA 1M66A 1NDQA 2OM6A 3BWVA 3NRZA 3JS5A 3L8YA 5CJ2A 3JQGA 5KOHA 5BQOA 1V97A 4G23A 3THYB 1JLHA 1ILWA 1KI6A 3I2HA 4NFHA 5FYDA 2P2DA 3CJTA 3W3AH 3R7AA 1H8EA 2X4DA 3I6QA 3IIJA 3S8EA 2OZEA 4W99A 4M7PA 4F2DA 3QM1A 3DKIA 3DBLA 3N0RA 4AUMA 1J0CA 5LQCA 2G28A 4MYUA 5D51S 4F50A 5AI9A 2AF3C 2WG0A 3M5PA 1R9MA 2C1ZA 5BSTA 4DG8A 2VIXA 2J5KA 4CLOB 1UBKS 1CS4C 1H94A 3NYRA 2H4YA 5D4BA 1YBMA 2LNDA 2HA6A 1ZM3A 3ZYCA 2GJ9A 2FY8A 1M74A 3NRJA 4ZT4A 1MC8A 4D9FA 1U45A 2E7ZA 1X42A 2MJLA 3FHLA 3GILA 3H6GA 1M5UA 2AUTA 5JPCA 2HTEA 2YC2C 5CVVA 4QZFA 3U61B 1M1NA 3CE9A 3E82A 2O48X 1X80A 1PR9A 4P98A 3TTWA 4PX5A 1S8FA 1L7EA 4YDQA 3GLHE 1QK4A 5JIBA 3BFKA 3E8SA 2HLNA 3OFJA 3IIIA 4S3MA 2GJ4A 4RFVA 2PZBA 4X1OA 5HEKA 3L7KA 2OA0A 3VYVA 3MK31 4A0SA 2LTAA 1E9SA 3GO4A 5JS7A 1UODA 4UVIA 2O05A 3D8HA 4MEAA 5EP2A 5JLAA 3ORHA 1P0FA 3TEMA 1O94A 4IS7A 5KG7A 1PK1A 3ENNA 3U31A 1Z4JA 3KJXA 4F5DA 5LQRA 4DR7B 2R85A 2A9VA 4PLVA 2APJA 4ZIRA 2XC9A 2WJYA 3KZOA 4QBTA 4Y6OA 2PNJA 4INJA 4X1YB 3QYPA 1W76A 2REBA 4OSOA 4HB2A 5A3RA 1N0UA 3HY4A 4R2WA 2ZS7A 1W46A 4N54A 4PYNA 3WA6A 4H7IA 5HJ7A 2CLIB 5BVGA 2J9YB 5IJAA 2HXGA 1RYUA 1LZLA 1MNQA 3SHWA 1E6KA 5DCWA 3KKAC 4GU5A 4TKLA 5AT1A 2ZIFA 3ZE7A 4AJOA 1G3UA 1KE1A 1NVFA 1YRLA 1UDXA 2ALZA 2WZDA 3IP3A 3VDXA 1JRLA 5HFNA 3QE3A 4J9QA 1IN8A 4LC9A 4MYHA 4Q21A 2F4VB 1QE0A 4X60A 1CJCA 2IX3A 1I6MA 1NQAO 4LRYA 1MW8X 3LXMA 3L0ZA 1QV9A 2OBFA 2RGAA 1H22A 3JAWB 3HY3A 1U5AA 1CUEA 1V3VA 2G5HB 2W71A 4GO1A 4JVSB 2N42A 4MUAA 4RACA 4XD2A 1P44A 2J9GA 3TRIA 4B6GA 5KVVA 3U09A 1E7RA 4NF2A 3RWOA 3NDPA 2ZPUA 3L18A 2JH3A 2WB1C 2BFFB 2CFTA 3NU1A 1HDRA 3T7CA 3ZH9B 5DTIA 4DSTA 4BVBA 4GPTA 3TRFA 1IYZA 1GGMA 2GETA 4DCSA 4P31A 8ICNA 2W03A 1LCIA 3C3AA 4X3OA 1DO0A 4A8JA 2PL3A 4CL3A 1SCQA 3IEMA 5H2FU 2VCYA 3R9WA 1L5UA 5CJ7A 3BG5A 1FMFA 4PLTA 3L4BA 1ZQKA 2HY7A 3F2IA 1UPBA 4I4IA 4DV5B 1EB9A 1KXJA 3LAWA 5J23A 2FH5B 2ZU6A 2JRZA 2BQUA 4RQ2A 3LHFA 5IN5A 2V3VA 1Q0TA 4ECVA 1T4CB 1UZLA 3NRWA 2H59A 3EYAA 3RS9A 1QTIA 1RKQA 1TUEA 3TL3A 3X1MA 2FFRA 1ZJZA 3FD8A 4G1BA 4PVDA 2AWNA 1AG9A 4IQUA 1F3OA 1ZI9A 2JLAA 2ZXFA 3IPCA 3FSGA 1PEKE 1LY1A 4DLAA 4OJLA 5KVAA 3DFMA 4DJ5X 1ZQAA 5CFQA 1MF7A 2QSJA 3SBXA 1OW5A 4V0LA 1UJMA 4ZO4A 4KXQA 2CLHB 4F4HA 3MRXA 4JVLA 3KQTA 3RAFC 3EZNA 3RSZA 4ZOCA 3IRUA 2ADOA 1FYFA 2QSZA 2V7EA 4TMZA 5KYKA 3WLNA 4M8NE 1QYWA 3SF0A 4LZNA 4M87A 4MRRA 4PFQA 4LMRA 2WIKA 2P6OA 1GARA 4KLQA 2IX9A 4LRXA 4MQUA 1YOVA 3G2IA 4AO7A 8ICGA 1OROA 4Q8FA 2E6KA 4OFZA 2FK7A 2J3QA 5F3DA 3WNCA 2PUGA 1PLKA 3V6LA 2E5FA 3MJCA 4RNMA 2F17A 3GJ5A 2EARA 1MAAA 2PR7A 4UXJA 3KSAC 3TN7A 3CCFA 3FVVA 3I6IA 4X00A 3K16A 1O94D 1OFGA 3FWHA 5CVDA 3X0DA 4M8SA 2OFOA 3JAKA 5KMGA 1IIBA 2XUHA 3CEPB 3F90A 1PVPA 2C98A 4X94A 1UFRA 4GHWA 4ML3A 4TQUS 4HFJA 4F5WA 1PDVA 1JZTA 1V41E 2B34A 3H2YA 4BUJA 1HL7A 3G6VA 1JKFA 1IJBA 1MLDA 1HT1E 1HV8A 3PJFA 4MV3A 4WY8A 5AXCA 4DVGA 4J0JA 5J0UA 4QPPA 1IN7A 2FTKE 1QDLB 3BIOA 4PG6A 3H6HA 1CTQA 4Q7LA 4P1ZA 5IC5A 5DW0A 5AK6A 3FHJA 1Y5NA 5AM5A 1XYVA 4HSEA 1N2OA 4KEAA 4PC3A 3UWOA 4JWNA 3X3HA 1IIPA 4XRGA 3FOZA 5J4YA 5KBYA 2GK3A 1GCUA 5LJLA 3QK7A 1XWLA 2X7JA 4GGOA 4I6GA 3T7IA 5F2EA 5A0LA 4BNVA 1R8XA 2PD4A 1A2OA 1W9MA 3BA6A 3BCSA 3OBIA 4YWJA 1FS4A 2PL1A 1TUGA 1DPFA 2DFVA 2PX3A 3EVCA 3SJZA 1Q0QA 3DV0B 5PGMA 1TVAA 4HVLA 4X1KB 4A0GA 3F9CA 3K09C 1OZ0A 2XADA 2GX6A 4OP3A 1LPOA 2H4HA 2YMPA 2WHXA 3UXMA 3QPBA 3ZV4A 2IZ0A 4BCDA 1UC4B 3LLSA 3COWA 1T6XA 3ODGA 4R8UA 2O8CB 5HSGA 2VJPA 1XZKA 3USCS 2H1IA 4F4UA 2GN1A 2PXXA 1YIAA 4K4GA 3PFNA 3SV3A 1NR5A 3LV8A 3RVMA 3UMVA 1D2HA 3UJHA 1FDUA 2FPLA 2ZOSA 4BAZA 4BIIA 4YMGA 3OJLA 1KSGA 5HMLA 5JMPA 4MRAA 4ZK6A 2DY0A 1KR2A 2HRBA 1N3YA 5AW4A 1A1VA 4QOEA 2E1FA 4QDUA 5IIMA 1X87A 3SEQA 5FP0A 3SS7X 1J5EB 3K9LA 4FQ7A 3VR5D 9ICKA 3KB1A 4RPIA 3WAKA 5A7FA 1KDOA 1L6RA 1PCXA 2ZIEA 4I55F 5FIUA 1TU4A 4C08A 4Y2YA 3JD2A 2C3YA 2PMZF 4TUSA 2VWHA 2ZIAA 3DL4A 2FDRA 4CU2A 3WS7A 1E0AA 1UBGA 4GM4A 1J2UA 2Q6TA 2VIIA 3H9JA 1EP3B 3EUEA 1ZDMA 4EYGA 1ZR2A 4DEVA 1IBLB 2PUHA 1XIVA 2YJZA 1JTFA 8ICUA 2PUVA 4B8WA 4CVNA 3HCOA 3LP8A 2XD4A 1FRFS 3R7WB 1WQ1R 5KYUB 3DQQA 2X1LA 3LNTA 5AM2A 2OHXA 2N1MA 1UDWA 4TTTS 1KE2A 1FTGA 2QPOA 7ICOA 3UMGA 2C2XA 3Q11A 2XYPA 1E2MA 2XDYA 3K9NA 5CM9C 1Q0SA 1M75A 1LU9A 1PHPA 2GK4A 4IR1A 1G98A 4FNAA 4NJMB 4JLUA 3P9SA 5JCJA 4O8ZA 4BTVA 3OQ1A 4CUKA 2L69A 4XA5A 2XXAA 4MVJE 1RQ2A 3GT3A 2KE7A 2O0JA 2NRTA 8ICYA 1E1RD 3R7FA 2GCPA 3REQA 4HUTA 4KREA 4LF4B 2R1VA 4P0QB 5TZVA 3CO5A 2ZAIA 4YACA 3O0TA 5SY9A 3HK2A 2FGJA 4ICAA 2JANA 4NAUA 3QVGB 2Q6IA 4D0GA 1WAMA 4GP6A 2C3OA 3DMDA 3RFTA 3THWA 4HMPA 5EAIA 5KPDA 1CZHA 3NHPA 4YAFA 2QTCA 1U5BB 1AQ6A 2OXFA 4U3JB 2CMGA 3ISDA 4PTLA 1G20B 2VJLA 1ADBA 1U0GA 3D8RA 4G5QA 5TVKA 4C0AC 4Z53A 3UMFA 5JSYA 5EOZA 2BN4A 2KS6A 3VOTA 1ORVA 3ZIAA 2WUEA 3UOAB 3HWSA 5L3ZA 2IS6A 1R0LA 4HWRA 2H31A 3VZSA 3DL7A 3I73A 5BR7A 3IQHX 1CJMA 4ZCRA 1NLYA 4P80A 3GT0A 2QUHA 1GV1A 3AILA 2FMIA 2H65A 1NMSA 1O9BA 2PQ6A 2VQDA 3OOHA 4OMDA 5IAEA 3SIPA 4E30A 2I2BA 1J5PA 2XUFA 4LFCB 3H18A 3RFXA 1EVKA 1PEDA 1TUIA 3EAQA 2ZJAA 2VKTA 3D8BA 4EX7A 1NI3A 2VZEA 1QYDA 1FP4B 4YJHA 4DYDA 3I8OA 2HQOA 3OO0A 4FTWA 5EGSA 4ZAZA 3M6FA 3SHQA 3ZCVA 3DFKA 1ODKA 1KOFA 4BIMA 5JMTA 4B9VA 2X5XA 3OZ7A 4KLLA 1DBVO 1IHUA 2NX2A 3RRHA 3KWFA 4OXIA 3PMNA 1WBDA 4I8DA 1GKIA 4B44A 4F38A 3O9VA 1DGJA 5KTRA 2O59A 3ZG6A 1DFGA 3JARA 4ZTUB 4DL4A 4EG8A 2PX5A 2FKAA 1TRHA 2PKCA 2ZT6A 3BXEA 4QFBA 1CQJB 5DDYA 1FK8A 8ICXA 1F9EA 4KXNA 4AZ3A 3VVMA 3RLIA 3RVOA 4IDNA 2JEFA 3KHHA 3FOEC 4QIWF 1YU6A 4V1CB 4G09A 1MH1A 1Z7GA 4YR3A 4PSUA 5TR9A 2ZS8A 3UV3A 1TKCA 4JOSA 1QK5A 3OMLA 1E3TA 1KVUA 3BE4A 5JNSA 3GDOA 1K27A 1CEEA 5D7NA 2FETA 2PTGA 2G9UA 1TM5E 2FSHA 2YXPX 1N9GA 1V16A 2FUNB 2G6TA 3TXYA 1QHYA 4HT3B 1RCFA 2OHOA 2I4RA 3HVUA 5AVXA 4P08A 1W5SA 3K1TA 4YRJA 4WCDA 3G9QA 4IQ8A 4TL9A 4DTIA 4BMXA 4C8KA 2J5QA 2JIZA 3DVAB 2RKOA 1GLGA 5FF9A 2P90A 4DT1B 4FYYA 1GQSA 2ZRMA 2OXCA 1NVUQ 1K4YA 3BL5A 3BSFA 4FCTA 5AVKA 3WRVA 4B83A 1MORA 1F48A 3OFSA 3VMMA 3WKEA 2Y0SF 4LSZA 4C0JA 1X1TA 2C9DA 1ODIA 3GLSA 4NY1A 4XVCA 4UQLA 5KAMA 4A1OA 1WKVA 2E4WA 3A2NA 2ZITA 3L0DA 4X0EA 4Y9SA 5I9LA 4YJ2A 2QNRA 2X6TA 4GC5A 5F7ZA 3HTXA 4O5AA 4ED1A 2EJVA 3LVQE 4EGJA 2X77A 1O97D 2J6IA 2VPTA 3GT4A 1KJJA 4PNZA 4YJ3B 4ARZA 3VKGA 4DQKA 2BT4A 1W6RA 4H4EA 4ILKA 3RKRA 1IUNA 4ZEWA 1ZYQA 3B1WA 4FMCF 2P4QA 3HDVA 2H4JA 2ONCA 3AIOA 4HYQA 5DGAA 3QUCA 2XB6A 2QROA 2Z6UA 4UMDA 1FFXB 1KMHB 1QYIA 3M83A 4IJ6A 3KZVA 4YRSA 2K4MA 4Y2QA 4QGFA 4F4FA 2V4RA 3JD0A 2AOTA 1H1LB 4HGRA 1P1BA 2QTGA 2F1JA 2BPGA 1J2NA 9ICFA 1U6JA 2ARKA 4TXLA 5HKLA 4KQWA 4GDMA 3RANA 1PFUA 1N3BA 4NBLA 1NSYA 2CK3D 1BJTA 2M6SA 1AN0A 2WSLA 2ZSKA 1ZMXA 1N5JA 2IU6A 3CX4A 3D7KA 4RQ4A 2ASLA 1S3IA 1EB8A 4UB1A 1COKA 3HX0A 2ZIXB 4MKGA 1EG7A 4AULA 5DGIA 3CMCO 3GA5A 1Z1BA 4RHEA 5EJGA 1T9DA 3TLBA 4JOBA 5KOIA 1IUOA 3ICQB 2C97A 3CJRA 1QLNA 3VV2A 4PGGA 1HZZA 3EPIA 5HKOA 5JW6A 3IR6A 3KSRA 3L7IA 4Y9DA 2XO7A 1PWHA 3K15A 1XAHA 2OT3B 3WE7A 4TZ6A 5BV1A 3C6QA 1A88A 1BD3A 3BQNB 2AQ8A 2Y27A 4DADA 3CUUA 4JY7A 4DL7A 3TFQA 3V8QA 1G9XA 4QICA 2J9FA 2VTEA 4R5HA 2O5RA 4AYXA 3P9ZA 3F2BA 3OPYI 2BMEA 1HYBA 4MGIR 4RVSA 3I5YA 4YO7A 3ADCA 1ZGZA 5EOVA 3KQHA 1NW6A 3WLQA 1X8LA 2RRDA 1FU8A 2ZM5A 3JWGA 2I1LA 3AMZA 1Z3CA 1QVVA 1ADJA 2JAQA 2FQQA 1UAYA 1W59A 4L5AA 4D92A 2KSQA 2FN9A 4PZPA 3NDIA 1EQAA 5J8YC 5J0QA 1Z17A 4C0WA 1U65A 2B0JA 1E4EB 4A1FA 1YR8A 2W2VA 2W0SA 3S1SA 3GJXC 3D6JA 1M8GA 2QGZA 4XJTA 5D3MA 2WMYA 1ZC4A 2Z08A 4RPCA 4Z9AA 4CZ2A 2NADA 2ZUFA 1FW6A 4ED9A 1KK0A 1NOJA 3AGQA 4MYRA 2BMJA 2G0NA 4PXYA 3VX4A 2VYCA 1E8MA 2QQEA 1X14A 4D6PA 2ATVA 5HKBA 4KJXA 3IILA 4MWCA 2ECPA 3UGKA 3OA0A 3PI6A 1N8NA 3QLJA 5I4CA 1ND6A 5KFMA 4MPTA 4HYEA 3U4DA 1NKEA 2EW2A 3NHJA 2WUVA 3JR7A 3R5TA 4DG9A 4IOJA 4YNBA 2Q1UA 2YBDA 1SC1A 4MLZA 3C41J 5H02A 1S10A 1GAQA 1GTVA 1WDTA 4CIWA 1U31A 4DLZA 2H4FA 1TZBA 4JX9A 2G4CA 3SP1A 4D0RA 1HFKA 1ITZA 1X3SA 5DT9A 4FT4A 1J0AA 1ZG3A 3QNMA 2V6BA 4UMFA 5EXEA 3UWMA 4E0BA 4R0MA 1AQLA 1EINA 5LMZA 1C5KA 1Z08A 4RDCA 3LUKA 1QK3A 1USIA 3EGDA 3WB2A 1Z0KA 4TPKA 4C6HA 2A9KA 2EQ5A 3T52A 1NN3A 2Q50A 2BGLA 3LYHA 4ZANA 4F11A 1PJZA 2VXBA 1MHTA 3SEIA 2H9AA 4OAPA 5EKTA 3WGGA 1PP4A 1G6Q1 3W06A 1BVRA 1I3NA 2Y1WA 2K6GA 1RBQA 2V98A 3FNGA 5L4LA 1TQ2A 4JN6B 4G4IA 2H08A 1X1DA 4CN9A 2I2CA 2PT5A 3SX0A 1IEWA 1P0PA 1ZNWA 1ZK1A 3EVGA 4JLPA 3PB3A 3MB8A 2DH6A 2JK0A 4NCHA 3AQFA 1K3TA 2GASA 4Y6LA 4A9AA 4DV4B 1N33B 1UCVA 1TA4A 1TZJA 1XBTA 1X19A 2RDMA 3R3SA 1ZBDA 1CEXA 5DBOA 3KXLA 3ZK9A 4B6RA 4A36A 3ZGZA 2O06A 5CB4F 1SHZA 1VE9A 4BU1A 5KI6A 1MCZA 1XWFA 2GPJA 3HDJA 4NRDA 5GAJA 3ZW7A 4CM4B 4DRYA 1X0VA 5HW0A 1B4FA 2BHNA 4AWXA 1LH0A 3G68A 1Q1QA 2IPMA 1CZOA 4HNGA 4WZ6A 1D2MA 5L3QB 3ZDEA 4XZ3A 4BLQA 2JH1A 2PYIA 3BMOA 3TX6A 3EX7C 1HE5A 7ICEA 3FFBA 1PR6A 1ZP6A 4OJ6A 3K1AB 3GJRA 4RZUA 3KPYA 2ZTUA 4IIUA 4CG0A 4WADA 1I6WA 5I3ZA 5KKCA 4X84A 3WQQA 1FF9A 3DHVA 3WMRA 3ZWQA 1XG5A 4S0ZA 1LVUA 3BREA 4CI0B 3FAZA 1K6JA 1T0HB 4J9OA 1H3NA 1L9KA 3CF4G 2UUOA 5TNXA 5TQ0B 4D3FA 1IZYA 2JVJA 3B0XA 4ED7A 1FTWA 1L8OA 2IP4A 4KLFA 5FNVA 3OM0A 1ZC3A 4QXPA 1NJXA 1N8KA 2IF0A 1VRCA 1U3UA 2C5LA 2CXYA 4TRNA 3RF7A 5COAA 2OO3A 5AJTA 2VT3A 5LBUA 5J0XA 1Q20A 1D4AA 2GBGA 1V43A 2Q0HA 1XTSA 1H6DA 1T35A 3GFVA 2AW5A 4H7JA 4G5XA 2A1UB 3G2LA 3W8RA 4Z2AA 4Q3CA 3GLTA 1NUAA 1UC9A 5DG7A 3AYZB 1HR0B 1QHFA 5JNUA 1S7GA 3EF0A 1V5FA 2X2EA 4RELA 4DAOA 1NMZA 3CWQA 3GPCA 3ZVNA 4IQ4A 5J4KA 3P4UA 1JXAA 1QIKA 2CVHA 3LTNC 1YD7A 1ZM9A 4TV8B 1WQ4A 1T9KA 3NG1A 3P96A 3W3AA 3OM1A 4FR0A 2ERYA 1L3TA 4IIDA 1K9VF 4O1MA 4IVNA 5I9IA 2FGKA 1DEXA 1WB9A 3E53A 2WAYA 2DUUA 3DUFA 2QW8A 4UJ3A 5CFPA 2C7PA 3NETA 3PR1A 4PGHA 2X9GA 4BMVA 4MP6A 1RQXA 2Q41A 1RLOA 3L7YA 2I1QA 3AB8A 1XC7A 3QF4B 3HCPA 2B20A 4HOYA 4IMPA 2PLRA 3TKYA 1HLFA 3U4MA 1G20E 2XCTB 2QP4A 4EYEA 2ZWIA 1CRLA 3H75A 3PD0A 4EHFA 1B4DA 5KFLA 1OHHA 3QOFA 4JJZA 4JOCA 2ONJA 9ICHA 3QKWA 3UFBA 5AVRA 3GBVA 5TISU 3FOCA 4O08A 5I9MA 1XLUA 3EYWA 1UKEA 3Q5DA 3PHHA 4N1AA 2JCSA 3GQBA 4NHEA 3R3UA 3SHFA 2DPXA 2FN8A 4KIUA 4LOAA 4AQDA 1UQVA 4I08A 3C4JA 1E99A 3JPRA 1G7RA 1N25A 1SBHA 2AJLI 3COPA 1L5HB 1RXWA 3L0IB 1F0MA 2QX9A 3K35A 2IEZA 2O3UA 1EBFA 1NBWB 1P3JA 2EBWA 2WUFA 3A1SA 2VP5A 3D0KA 3MJRA 4ACAA 3CBGA 3AB7A 5KB3A 2DP4E 5KSOA 1N2EA 4DLWA 3N8HA 3U49A 4EHDA 5EJIA 3AVXA 2VWQA 1TYCA 2GARA 1P45A 1GSOA 5FQOA 4O1HA 3L8GA 1WPRA 1IMJA 2YCLA 1WF3A 5J40A 2FZWA 4F4ZA 1LBQA 1Y42X 2B94A 4M9NA 3TSAA 3UHAA 3AJAA 3E3MA 3C2KA 2VBFA 4MI6A 1VRWA 3MFIA 4WWHA 3SZOA 1A9OA 2VP4A 3GUZA 3ZVKA 2IHKA 3DE2X 4XCXA 1FLNA 3CUYA 2GF9A 1JRPA 2WLSA 4HX9A 5FOSA 4OJYA 5INTA 3RS4A 1YR2A 2R3SA 1YS6A 3B5JA 1XZDA 2D0OB 4OD0A 4RQMA 1JFFB 3LKZA 3MBKA 3NM5A 4L74A 3RT1A 4QM7A 1C8BA 1Z6TA 4DB4A 1DLIA 3OO1A 4DGSA 4B2YA 3S2YA 1ZK2A 2KBEA 4EG1A 1XV5A 3U7QB 1XZCA 4YI3A 2CE2X 4BEBA 4GZ3A 1KL7A 2EF0A 3WKBA 4XB6B 4RKYA 3U5ZB 1IQUA 4DF8A 1M10A 2DRIA 2D3TA 4Q01A 5ECDA 4DANA 3PXGA 1KJQA 5K01A 3SZ3A 2AEEA 4I29A 1CY7A 5LP6C 4BO5A 4DMRA 2W11A 4CQMB 5IDYA 5KHOC 1DZIA 1GILA 2JGAA 3DR5A 4L28A 4I46A 3JQAB 5EZYF 1N2IA 5F7JA 1A8QA 1D2AA 1KFCB 4R3WA 5LIRA 2RK3A 1ZXBA 4I4LA 1ED1A 1Q6YA 1TYBE 3UXOA 1KEZA 4R0NA 1PEAA 3UANA 4CMIA 2O8CA 3T35A 1OBFO 1WOYA 1R15A 2NAFA 1LPBB 1MO5A 3NTUA 1J56A 4J2HA 3R74A 3MC1A 3G23A 1FPQA 4DOAA 4CM5A 1BPDA 3SC3A 4F5RA 1E64A 3W5VA 1ZK3A 5DWQA 4S1NA 1DC7A 2Q7XA 2Q9UA 1EDOA 1DAFA 2BGRA 1GLNA 2FJPA 2H1CA 5JCJD 3BTVA 1YT5A 2HL6A 3AETB 3IN5A 3AVWA 2CYAA 3IE1A 3FA2A 1NJGA 3JD4A 4J0EA 4Q1CA 1N62A 1KJIA 5AK5A 1KMIY 4Q34A 3WKAA 5FPYA 3HJBA 3NTRA 5F3XB 1JXLA 3PUIA 1PS0A 2O2ZA 4BOYA 4ZHQF 3RHZA 3WBJA 1OLXB 1N5OX 1OOEA 4M0FA 3VI3B 2GILA 3EZ5A 2Y0EA 2R8GA 3NHSA 1B1CA 3DMGA 4R98A 4XKJA 5IHXA 1NUPA 4TX1A 4LJXA 4PZLA 2DKZA 3WMWA 2ISSD 2NYAA 2ZYIA 3E70C 4PCUA 5CT4A 1X94A 2FRXA 4ZOEA 1K97A 2EFEB 2DPYA 2A7XA 2EH9A 4GPEA 3QYAA 5CNIA 2ZW9A 4XRRA 3R7DA 1N78A 2VAMA 2DQNB 4D46A 4RF3A 3PDJA 2A9RA 3D3EA 1PR0A 4FEYA 3UYLA 1BDJA 4K9RA 1Z6GA 1RFLA 1O89A 5IINA 3ANYB 4H17A 4O4JF 3C1ZA 1JSLA 1JR6A 5JXJA 3IJ5A 4DV6B 2LM4A 1F60A 1T0JB 1WS6A 2BFMA 4GICA 1L9XA 2B2CA 3A1VA 1EGHA 2JGDA 5I01A 3MGHA 3UVEA 2DUMA 5AW5A 1E3EA 5ED4A 4HRVA 4V0OA 1Q2XA 1W25A 3TWOA 2FX3A 4E09A 2BGMA 3PX2A 4DJFC 3N97B 2ZXEA 4K9OA 5LLSA 1Q7RA 1PWEA 2NYVA 1J2RA 2BUCA 2EGGA 3NC4A 4PPGA 4PJ0U 3BZCA 1DOZA 2P11A 4FJ0A 4BUZA 4D8YA 4FCWA 1MABA 2G08A 2FU5C 2XZPA 4IRMA 4YK7A 3LX6A 4BLOA 2VRBA 3PX4A 4PC7A 3HWRA 5HTOA 2YXBA 4BPBA 4QGSA 5JR3A 3QEJA 5K3AA 2AN9A 5CDHA 1EM8A 3KZXA 2FZGA 1ESDA 3B78A 2WM9B 4J7AA 5CFRA 2ZCVA 1Q8KA 3OE7A 3UKOA 1GRQA 2VJYA 5ALGA 4DQLA 1T26A 1G42A 5FJJA 2RONA 4HGYA 4XWAA 3HKDA 2D2IA 4OQYA 3T6KA 4NLZA 3OZTA 3OQVA 3BKXA 3UG6A 3TSOA 4E4RA 3O2JA 4YMHA 4FX2A 3WMEA 1E1NA 4N8DA 2IXEA 3SSMA 2VF5X 4EW6A 2R60A 5KTTA 3ZKWB 1EUQA 4L4SA 1XTKA 5LYJF 1V9SA 4LX0A 3QU7A 1LWOA 3I23A 2X0KA 3RSHA 1A27A 1HF3A 4UD6A 1A7JA 4MINA 3RVDA 3GPIA 4TOIA 4EY7A 4DMGA 2JZBA 4R1OA 5AW2A 4F2SA 4J7CA 2QRKA 4DUZB 4YD1A 4UEWA 1UMBA 5JVDF 3CP8A 1GZHB 1OV6A 1YBFA 1GAXA 1VLVA 5GZ6A 4TLEA 1IOVA 2QENA 2Z2YA 3PQ3A 1PFKA 5J8YA 2ANCA 1KI8A 4ZT6A 4AKHA 2FJUA 1O6FA 4YJFA 1EG2A 4JLNA 3DNPA 4XX0A 3LCRA 2CW5A 4UJ5A 4YPVA 3BS7A 1C1HA 1I24A 1R8QA 3N7TA 4JHXA 4L76A 3HSSA 4FXOA 4YAUA 1CUUA 1YRHA 2QAJA 1HT0A 4TKUB 5BORA 1EDBA 3HWWA 4FLEA 4ODIA 1SXGA 1H5UA 1G5HA 5FLYA 3FYDA 3ZHUA 2QE7D 4RQ7A 1ZQYA 1BO6A 3OJUA 1CDZA 1Y3FE 2ZT5A 3FDIA 1GNQA 1QBKC 5HR7A 2AG8A 4ZVOA 1VHTA 2LCFA 1NTOA 1WEKA 3PUZA 4Q3DA 4Z9BA 3PF8A 2BH2A 3CLKA 2FEMA 3G85A 3K20A 1WD7A 1ZYUA 3FTQA 4XQ9A 3RROA 2BV3A 3T9BA 1ZCFA 5HQJA 2X23A 1BH6A 1FXWA 4LOJA 5CX4A 3WBFA 1IONA 2EZ9A 2PWAA 1L5QA 1CY6A 1CQIA 1XZMA 4IGAA 4RJ2A 1SY7A 2H5JA 5G5HA 1ZQBA 1PW7A 2WWVD 3BRQA 3RVNA 2BUAA 2GRUA 2ID8A 4EPYA 3JQFA 2GJAA 3FI0A 4LJAA 4Q7JB 3RBXA 3W4JA 3LQ1A 4I2FA 4JZKA 3ZDXB 1WHTB 3FMVA 2BCVA 2GBLC 1E2GA 4Z7JA 3DT6A 5FUVA 1UT6A 5ALHA 1J99A 3G9XA 5H5JA 2ZEJA 9ICWA 1PUXA 4FBGA 2IK8A 3RVLA 3OZRA 4KI7A 2KSOB 1DCMA 2JLZA 1U9IA 3QF7A 5BNFA 1Z0JA 3GROA 1U81A 1L5SA 2H2DA 2WUWE 3RTEA 4KG7A 1GT6A 4P5EA 3ZDRA 2PBLA 2BI4A 1Z73A 2GXSA 2NUPB 3TZCA 2C2EA 5BT8A 1EK2A 1EZZA 4UD2A 3F5EA 1B16A 2YHIA 3JX9A 1SUEA 2BTQA 2YH2A 3ASYA 3KV1A 4O3FA 1N57A 2GPSA 1CY8A 3PT9A 3R3JA 4K9MA 4XLZA 1FFGA 5IASA 2RAUA 5EMNA 4LBZA 2W43A 4MR8B 4XQGA 4AIIA 2N75A 4HX5A 1KI6B 2FCAA 3TGPA 1SKSA 1BOFA 1DBSA 2ZSIA 4PHTA 3WK5A 2OZLA 3EDYA 4FGUA 3IEPA 1UPAA 1MO6A 1WMFA 4RIHA 4XWYA 1XZ8A 4OHMA 1PE0A 4GVLA 2HGZA 4QWCA 1BW9A 2R8JA 1PT6A 3DAFA 3D8TA 5JH7F 2OD7A 1ZXLA 1DIOB 3W5DA 1R8SA 1GNVA 1BPBA 3N76A 4PU0A 2A4MA 5FTKA 3WK6A 2EZ4A 1Z6PA 4IIJA 1YHZA 4JT2A 3QU4A 3FZGA 2HCJB 4Z0TA 4ER6A 4F7DA 1QQAA 1I6KA 4LGVA 2LV8A 1RLJA 1BJRE 5CP2A 2W4QA 1LC3A 1SXHA 3ECSA 1U7OA 1C8VB 3N0TA 4FE4A 2ZE5A 4CEJB 1WUIS 3IKVA 4UEKA 1LC0A 3ROPA 4FBTA 3L7OA 4QPZA 1HQCA 1GG5A 1GTZA 2BFDA 1QQTA 1Z0AA 2O1WA 5BVHA 3P2YA 5JZSA 2O6HA 3S5UA 3M4YA 5EXXA 4ZD6A 2O3RA 3EPKA 2FUG6 5KKNB 4J6FA 3IEXA 4X1IB 1RM3A 4EI8A 2XLCA 3OM8A 4BVFA 2HWKA 5KG1A 2O6KA 1I36A 2OILA 2QZ4A 1UWKA 1GPWB 2FA9A 1VE1A 2GT1A 1QRRA 2C0CA 3CKKA 1S9FA 1QWOA 3OLWA 4UCFA 2IPXA 4CL2A 3L6EA 3T54A 2B1JA 5J2TA 2IH4A 2CGEA 3GGGA 3OPYA 1BQ4A 4GYKA 2LW7A 1ZD8A 1EFPB 3SDBA 5CHEA 1XTVA 3ITNA 4BV3A 4EPXA 3KHUA 4JJ8A 3T3OA 4C8OA 4I2GA 1DKPA 2JFVA 4P53A 3DD1A 3E5NA 3UY4A 3LGSA 1F4VA 4MRMA 3OE5A 2VAPA 1C9NA 3I5MA 3K0HA 2QUBA 4KMUA 3FCYA 3FJ1A 4OCZA 3ORRA 1DAPA 4Y30A 3V00A 3GFBA 3OZSA 4DQUA 1BWRA 5K4LA 3O74A 1GGHA 1HNZB 1QS0B 4PPFA 4I2VA 4PC2A 3KUXA 4P3XA 1ZSVA 4ZOAA 1XU9A 4II7A 4IL5A 2OCIA 3TJZA 3RYHA 1P2SA 2JBAA 2O0LA 2V7WA 2J6CA 3ZJYA 2G04A 1RM5A 2D5LA 4WZAE 3IP4B 4YB8A 3BHMA 5DK4A 5L6LB 2CVFA 1KKMA 1LDMA 2RJOA 3M3PA 4RA6B 4ZDJA 3LTEA 3VOSA 1RXCA 2AHOB 3GUCA 1E2BA 2G0AA 1UPHA 4M9UA 3VXKA 3SZUA 2Z1DA 4HXYA 4KR3A 2JLWA 1C7YA 2CZQA 1VTKA 2O8VA 1JDJA 3ROGA 4OVKA 5FWXA 1FFDA 3SJCA 3OCYA 2JCVA 3GVPA 3VBEA 5IJ0A 3CPJB 4IH9A 5L7WA 3O2NA 2PGJA 4IJ5A 2VA9A 4Q16A 3MYYA 1KFEB 1RBYA 4U6SA 5FLKA 5BUQA 3THVA 3V46A 4JD5A 2WIJA 3LA8A 5CT5A 2E8NA 3KE8A 1HURA 3ABQB 1WCIA 5GADl 4M0CA 5KYGA 3T5KA 1H5NA 3ORYA 1RRCA 3KR2A 2DOKA 2X5OA 2WQ6A 4P4PA 2ZAMA 1DJPA 3B5IA 5EIOA 4LQDA 5CW1A 5JUWA 4AJLA 1HIWA 1KOGA 1CF4A 4QJFB 4LTMA 1I3LA 2C4NA 1YWGO 2C03A 2J6UA 1OLUB 2JAOA 3O91A 2G1UA 3RNLA 4E5MA 4EI2A 1LDEA 3UWPA 2AZ4A 4EIWA 3GRRA 4W1RA 4M55A 2C5FA 5CYGA 1WCYA 2IXBA 3V48A 1R6XA 3OC0A 2ZYAA 4R9UC 1KJNA 3OZGA 5FL7D 2HJGA 2ZRCA 1DZ3A 2CVQA 3D2NA 3H11A 4GBED 1UBTS 2P62A 3OLQA 4HY3A 4JEHA 1ECPA 4FWTA 1JJVA 4UUAA 4ZCPA 1DT3A 2FDCA 1A0OA 1QNFA 3PJDA 1QHNA 4RTKA 3IAAA 2PRZA 4OQ4A 3MD9A 4Q1DA 2XUKA 1N56A 2PO7A 1DQRA 4RNOA 1SBTA 2AWOA 3ANMA 4X20B 1GFWA 2WWFA 1Q21A 3BWEA 2ZJ5A 3HB5X 2JFOA 3RW9A 5JAHA 4RV4A 3TLCA 5KNBD 1YIOA 3FIJA 3ZXIA 4Z4HA 1JSRA 3Q7TA 2OZKA 1E3SA 1SVNA 1P8JA 3E4DA 2QORA 2P3LA 3JVUA 4AQ7A 5T4BA 3VNBA 4DWJA 3AUYA 1SXJE 3BRCA 3E8XA 4PRZA 4WLVA 1UM8A 2WAXA 1OXSC 3A58B 3DNMA 3CH6A 3EZYA 5ESWA 2W6IA 3QA3E 1X2IA 4NJEB 5CDSA 1AROP 2DF4B 5KT7A 3PEEA 4BTEA 2ZUUA 4GLOA 5I7AA 1HTTA 2WMOB 3FLEA 3WYEA 5IVHA 4P3KA 4AXXA 3I52A 1DEAA 1T36A 1YZTA 5D84A 3UWDA 1XX6A 4D74A 3I5XA 3HKZC 1N3IA 3UKDA 3DNFA 3QVSA 3R20A 4WGGA 4RUCA 3VNVA 3L02A 8ICCA 1N2CE 1CQZA 3IV7A 3AZOA 3D2AA 4ENSA 2HHQA 3CF2A 2BIFA 3CZ5A 1DCKA 4CU5A 2R0QC 4KX3A 2W9BB 1CB7A 3BTSA 4KBGA 3PHGA 4Q4AB 3M5DA 4P4GA 4QPCA 4NXZA 2XNCA 2YRXA 1AMUA 4US8A 1EGAA 1P7PA 2RFLA 1C30A 3N75A 4IFEA 5JAZA 3RU9A 2H7CA 3OSZA 1PR2A 4C01A 3MGIA 1DQSA 1IEVA 3OZBA 4DR6B 2JJ8A 3WYGA 2YXNA 3FOBA 4PXAA 2YHIB 4LTDA 3QMVA 4BB9A 3EXG2 4IZ6A 3SQDA 3WMGA 1MX5A 1WZNA 2ZIWB 4QDZA 1ZUIA 2PM8A 2ZM6B 1XJWA 4F93B 1XEXB 4L8WB 4B34A 3IXMA 4R1NA 5ENZA 5CH5A 4UBIA 4TTVA 1QG4A 1M34A 3EAFA 3JW8A 1DG9A 3JYPA 4K9QA 3H9QA 2PWPA 4XDHA 3RGWS 1XEWX 2O20A 7REQA 5AKJA 5FOXA 1CFJA 2NVBA 1IN1A 3L8DA 4KQFA 2G71A 3N9IA 3DBVO 1N77A 1SRRA 4OSEA 3RVJA 4HAWA 3UH0A 1E9EA 2QK4A 3DWGA 1XQVA 3PPXA 1PT9A 3PS9A 2OZPA 3CLTD 3C1UA 4C5BA 1S02A 2WAAA 2CLKB 1BU5A 1RYSA 2PGXA 4XGKA 4AP6A 1B0UA 1NMXA 2ZTSA 1U8XX 3QKRB 4ABYA 4E2XA 1V35A 3B52X 3TLJA 1N6KA 1EVJA 1YMQA 1Q50A 4ZVUA 2QZ9A 1MXFA 1QHGA 621PA 1Y9EA 3MAAC 5K8CA 5L53A 2ZBVA 2YICA 2XYVA 4CTKA 2AUMA 4C4OA 4KSCA 3FVWA 3SENA 4WX2B 2RH5A 2VHWA 3VUFA 4HADA 2VBCA 3IE0A 1G2IA 2XV1A 2AMLA 1D04A 1ISSA 2HUNA 5CB4A 4KLGA 1NVWQ 3LPDA 5IYZA 2GBCA 4UB3A 5TE9A 1L3IA 1NRIA 2QI9C 2HMSA 4YCMA 2QIOA 3B6IA 2I2XB 1CE8B 2P7HA 4H3VA 1RHJA 3OMWA 5GIPE 2Q3CA 2Y8EA 3TJRA 1S2DA 3R0IA 1W36B 1WKCA 1JG7A 3NIGB 3NV9A 2ZTEA 4MW4A 1BCSB 2Y05A 4O29A 4ETIA 3PTZA 1M5TA 4L8LA 3FKSD 4BP1A 3KK0A 4R9SA 3DA8A 1DIBA 4QLAA 2FDXA 2OO5A 3CFYA 3FHOA 4L8VA 4N39A 1XQ1A 1FYVA 2HHLA 1TYEB 1D2CA 3IVGA 2RGEA 3I32A 4P2GA 4HQ6A 3EXEA 3NGMA 4F4IA 4YRZA 2YIMA 3ZWVA 1EXMA 5JNTA 3LWZA 3JQ7A 1JPVA 3OJWA 1C80A 1R0KA 2P7IA 2CFIA 3GUYA 3LT5A 4M0EA 1P33A 5DYNA 3V80A 5K8TA 3N8KA 3ZE2B 5FT9A 3QFCA 1U1GA 1ODFA 4GI5A 3DOEA 1AHIA 4G67A 1ZLXA 4N3NA 5KYWA 3HUUA 2JV3A 1DJQA 1G291 2VJMB 3G0DA 3H9GA 3TCKA 4D0SA 3RJKA 2F9LA 4P4SA 2P8JA 4JASB 3W78A 1QH8B 3FGOA 3JAKB 3FPBA 2W9AA 3RJHA 5FX2A 4TLMB 5LU8A 2ODBA 4YUZA 1JKJA 1GSHA 3O8OB 1FLDA 2E4AA 2ZI7A 4N5HX 5DNAA 3R77A 5T3UA 4Q4CA 1RAFA 1MD9A 2QXTA 4X45A 2EP7A 4M9QA 5F23A 4XSVA 1APBA 1ZN9A 3GD7A 3QOWA 4TM7A 3TW0A 5A3QA 2ZUWA 5KFYA 4K6MA 4UAGA 1JF8A 1YDWA 4WK2B 4BBJA 1KQQA 4FCCA 3AFMA 5DH9A 1C1XB 2P6MA 2BEWA 1GKLA 1P4JA 1I32A 4RZRA 2JFWA 4IOLA 2XBUA 3DHNA 5FCDA 2WSSA 4NCNA 2YDYA 3SVLA 2F44A 5EESA 4CMKA 3K6KA 2XBMA 3RS0A 1W4BA 4N5NA 1KERA 4WFKA 1R0ZA 1MW9X 2GBIA 1OTXA 2VDJA 2CMDA 2Z83A 4ALMA 4EMUA 1UXGA 1QZTA 3ELDA 3HKDB 3HGTA 3GGJA 3QELA 4GX2A 3UT5A 2Z95A 1VIYA 1II8B 2EIHA 1W9HA 2XVYA 3KJEA 3M9WA 4F96A 3AVTA 1TAMA 3OQIA 4DV1B 1X0XA 4EUHA 1R4ZA 4XYLA 5A62A 3RB6A 2J5BA 1KQGA 1ICEA 1R3DA 1YQ9A 4FOOA 2BY4A 3CG4A 4OHUA 3I09A 2I3ZA 3ITKA 4HNTA 4QEDA 2OVFA 3A9WA 3QOYA 4LF7B 3BMCA 2OCPA 3ZU4A 2ERXA 1AY0A 1IH8A 3GNTA 4B6EA 4URXR 3KEOA 4W8OA 1BX1A 2IUYA 4MEBA 2QJOA 4M7WA 3SOPA 3RRFA 4AO8A 5LVAA 1JEQA 9ICTA 4MDHA 4FDTA 2PZLA 1XSLA 1LTKA 1B26A 2B1RA 2QRJA 3MTEA 1OIWA 3C3DA 3O75A 5K9ZA 1KY2A 4JT4A 3T5MA 2V8OA 1E7YA 1XMJA 2FPOA 3BE8A 4BXOB 3DYBA 3VVCA 2VTBA 4RQ6A 4AZTA 1W1UA 1N5WA 1K5DA 9GPBA 4EHAA 4F60A 3ZV6A 5CX1B 4L9RA 4NK4A 3I2YX 2VNHA 1VP3A 1W4AA 3C97A 4JWKA 1ULSA 2QW1A 3I8SA 3PKZA 2Q5LA 3CUWA 2B6NA 4EI9A 3Q3JB 3AM1A 3CGGA 4E15A 2GSDA 1CVLA 1ESCA 3I05A 1U8TA 3G0BA 3RADC 3L7JA 1E60A 4DG5A 3IO3A 4P22A 3AOEC 3CN7A 4JBNA 4BWVA 3IBTA 4KPEC 1XMSA 4TTIA 4FX5A 4G86A 2X9QA 4KMRA 2W6JA 1I13A 4DSAA 3EC2A 1I4WA 1P75A 2OWEA 2Q1XA 3P94A 1NF8A 4PG8A 3ZY5A 5AVTA 3MOSA 3LWMA 1JALA 4H6WA 3MGAA 5KFRA 1YO6A 4KLTA 2LRHA 4G4GA 4PS1A 4ZOLA 1FRQA 4F04A 5IANA 4EX6A 5IWAB 5C52B 5KYYB 3L8HA 5B30A 1U2RA 2R8RA 3IUNA 1RI3A 1TT5B 1U0BB 4X8MA 5HTKA 4N0EA 4MS4B 2WHEA 2XUJA 5DCYA 4WXMA 5JHGB 5F9NA 4DPLA 2IP1A 2VS1A 4A91A 2A19A 1L5OA 3ANXA 3IPXA 1T2FA 1X13A 1JFFA 1M2KA 1U1IA 1V6CA 3H9UA 4DLVA 4F6CA 1DGSA 4KITB 1QH0A 3I2KA 3IQFA 2W42A 1FMLA 1VJGA 2C9ZA 3A28A 4NNPA 1JLRA 4KO8A 3VC7A 5JRDS 1L5WA 1PBNA 4N6NA 2V6GA 1UBUS 3KQQA 3COVA 2WOOA 5DBAA 2FPGA 4W5RA 2ZSFA 1OUMA 4DQ0A 2GZ2A 1Y3HA 2CDAA 4R7TA 3L7DA 3GV7B 5SICE 2YOHA 4AN4A 3TCXB 1LNQA 2E4ZA 5CB0A 4JEIA 5HMMA 4F3NA 3AEXA 3URMA 1KOJA 4KUGA 3ONWA 2B2XA 3PL1A 4FHEA 4MIOA 2QN7A 3OQIB 1VHJA 3S7ZA 5EJEA 3EIQA 1QH1A 3HKBB 4U7TB 4B46A 4DC9A 4B9LA 2P2NA 4FONA 1IXKA 1FTQA 2O23A 3NFYA 4JEMA 3U7HB 1AQJA 1AXEA 3U3DA 1GPJA 1NW5A 1Q7CA 5EYPA 4TLBA 5HBGA 1NZPA 1UDAA 1A2QA 5A3JA 1ZOPA 3D7LA 2RK4A 3B3GA 3UJAA 2XTJA 2QRLA 5IXJA 1C14A 2VNAA 3B2EA 1ESNA 1OXKB 1EHCA 1TVKA 4MP3A 5JCPA 1QE3A 5L51A 1GEGA 2G5CA 5JUMA 2A0YA 4YAWA 2A3VA 1ZITA 2BKUA 3PXBA 5JEDA 3BBPA 1T5HX 5BQ5A 3P8ZA 1X38A 2MIIA 2PYDA 5CLLA 4QNNA 2BBWA 3OCCA 1YC2A 4FZNA 2QSYA 4WFQA 4Y7DA 3VX3A 1GPYA 1MB3A 2O8BB 1UXKA 2GERA 2GXUA 3C3CA 4FHFA 3TFWA 1XA3A 3EZFA 4ZCMA 1KWGA 2ESRA 1LGYA 3OE1A 3DS8A 3GIWA 1RTKA 1VSTA 4EPTA 5IX8A 4MHTA 1B76A 1WZUA 2GEVA 2HADA 1ACLA 2YW2A 3DG9A 1JG2A 3Q7PA 2R751 4P4OA 4QZ8A 3CX7A 4N5IX 4F9TA 5DHUA 2WA2A 4IXTA 5TRTA 2WFAA 4C0KA 1DPGA 1IRXA 1E1QA 2JRLA 1PIWA 2RHRA 3DE0X 4MUYA 3Q5GA 1OT5A 2VSYA 3BHIA 4XIGS 5ITSA 1JZQA 3UXHA 4ZYTA 4HPXB 4BNMA 4PQFA 2PUJA 3I9KA 3W5UA 4Z1OA 4C7OB 4HQOA 4LEIA 3CZRA 6NULA 1MA0A 5L1KA 1EZ1A 2PGDA 3C7TA 3PVCA 3GAFA 5JS2A 1AGRA 4DWWA 1XNRB 1ZGCA 3QP9A 4NOLA 3PC8C 3EWIA 2A67A 2ZDGA 5JQGA 4CYMA 3K70B 4PW0A 4E94A 3SG0A 3T0FA 3IKMB 3EIFA 1N5XA 1FSFA 3SKXA 1Y6RA 2CUNA 2J0UA 2OQRA 2QTMA 4JV2A 1NQTA 3MWEA 4HAYA 4RGQA 1L4FA 5LUBA 3ISBA 4B75A 2D6FC 5I48A 2LWIA 1ZU5A 2I3BA 3EUWA 3HWTA 4KLMA 3SAHA 2P40A 3INGA 3N74A 3PNOA 4G8BA 4YUWA 4ESOA 4K1LA 4Z1MA 2I8AA 3EGOA 4HVAA 2COKA 1ZU4A 3SX2A 4FLFA 1A7AA 4I1UA 5E0OA 5A6SB 5JDCA 2WMDA 3RC8A 3AUJB 4EVQA 2KFNA 1YB4A 1A9PA 1H8HD 4KK4A 5JHHB 5KTMA 2EAUA 1A9TA 4C4AA 1CQWA 3QI7A 3UUGA 2W58A 4HGOA 3WMXA 3WU2U 1YK0A 2QYOA 3NIFB 1W47A 1H4QA 3H2JA 2WNSA 4TLDA 4ZYLA 3D2QA 1PL6A 1W34A 1YK1A 3KPJA 1DAMA 3H0CA 3L0OA 3NUGA 3IC5A 1GNSA 1SHJA 3MF4A 3LBIA 3L6BA 4M22A 2AGPA 1HKHA 1K66A 1XZNA 4AO6A 2LDXA 5HHIA 1NRJB 1G5QA 3N2GA 3FPHA 1F0YA 5AKLA 1Z0IA 4IUDS 2E8PA 5KG6A 2V5UA 3MGCA 4IHJF 1WCWA 2GAAA 3GVXA 3NAZA 3SLRA 4URWR 1K92A 3KQVA 1KC3A 3CCCA 2X14A 4UU1A 3RBAA 3MILA 1EEXB 3NBXX 3DT9A 1IK4A 1OKKA 3HA2A 3BJRA 4CEHA 1NJWA 2JD0A 4TXNA 4DLNA 5ALOA 721PA 4LN1A 3VKFA 5ITWA 3HXQA 1Z4QA 1LLDA 4TQRA 1JU4A 1VDVA 4QDOA 3IPYA 1Y89A 4BQFA 2W90A 3NYQA 1XMPA 4WXPA 4PAMA 1FRZA 1U99A 4OLAA 3PNPA 3RT9A 3F46A 2B6GA 3NM4A 3R8CA 1DWOA 3F5QA 5JCXA 4IC9A 1O0BA 4GUDA 4JQZA 1M2GA 1E77A 2W54A 4OMUA 4AQYB 3HU3A 5I6DA 2FMPA 2GA8A 4ECQA 4Q1EA 4D3DA 4EITA 4PHAA 2BCGY 3RO7A 3GNQA 3O6VA 4DQQA 3VV3A 5IC4A 1ZMTA 3X2FA 3AUTA 5JASA 3GWZA 1T94A 3G9TA 2ID4A 3ZTWA 3HN6A 1YF3A 7ICFA 1IB0A 1QX3A 3F0TA 2G1KA 5CLHA 5CB6A 5KVQA 4IYJA 1S3GA 4TTRA 4XWWA 4EWLA 1JXQA 4HHEA 3NOVA 5JMWA 5ALMA 2QL6A 4ALKA 1LEHA 1DC6A 3BM5A 3RAXA 5IVIA 3PBKA 2G1PA 4GSLA 1RU3A 1VPTA 4MLPA 4ZOBA 1V5GA 1ODSA 1AUOA 1E1KA 1ZM7A 4G0VA 3Q3VA 1MGPA 3ESXA 1R50A 2BW0A 2W2PA 2XA9A 2XNJA 1QFSA 3AKEA 1YZKA 3LVBA 4LZAA 4D81A 1VKHA 3GRPA 4Q4JB 4PLGA 3O8CA 3SOZA 3AM9A 3ACDA 1RWNA 3FETA 4RYLA 1R3UA 2A1JB 1EFHA 2Z09A 4WBNA 3STWA 3A6LA 1I7LA 3GEGA 1DBPA 1IULA 2HBYA 3R3ZA 4WOKA 3S2EA 1FE8A 2EDUA 4K81B 1TIPA 1N1EA 2ASJA 3J80A 4GM0A 4KO4S 4RY8A 4AJJA 5BOSA 3DHYA 3U0VA 3AR7A 5CU7A 4NBSA 4A6PA 4HVTA 1I1NA 4Q4AA 1NNEA 1E1CA 4B9NA 2CK3A 1JEEA 1CEYA 1V3QE 4Q4HB 3PC4A 5JSQA 3GUUA 2DZDA 1AHNA 1Q22A 3JZIA 5C32A 4ZT2A 2X41A 1R37A 2CHUA 5JAUA 5CR0A 3CSDA 3KHRA 3JQ6A 1VIAA 2GHIA 5HR6A 1B6RA 3HP7A 5CBPA 2FZ4A 3QXHA 2HA3A 2J6BA 3U13A 1S4MA 2GS9A 3VR4H 1XEXA 1E2FA 1G8SA 1X1AA 1FW8A 1Z4LA 3E5HA 4J7UA 5DT2A 3MELA 4LZOA 4C76A 1GLVA 5I45A 2WHRA 1YR9A 2HIMA 3FNEA 4EH1A 5F98A 1S3SA 3R5FA 4NCXA 1E79A 4R2JA 3VDNB 1F1JA 2Q27A 3D43A 2EP5A 3EDRA 5HZHA 1IZZA 5DWVA 2J9RA 3VZDA 4KAXA 1C1DB 2HRDA 3PK0A 1ZHOA 1WB4A 3C1YA 1QHXA 2H8KA 3EIUA 5KU7A 4CMCA 1AK2A 2OBXA 1ZJ6A 3BQTA 3NGDA 1KVSA 2G82A 2KICA 1BE0A 3AL2A 4AMVA 3IQDB 1GQQA 4TYQA 5G3ZA 3RFAA 1QCYA 3AEQB 1NXOA 1ABFA 3GJ7A 3K6RA 4V0NA 4X54A 5DHRA 4YV2A 3OICA 3UWKA 1VFPA 3HY6A 3TYXA 4QYIB 4YD2A 5IJ0B 1XQWA 4MFAA 3AT1A 4HAOA 1XQXA 4Q66C 3CLTC 3T34A 5ABPA 5MN4A 1GAWA 3ED5A 3EE6A 1CJSA 4PYJA 3A37A 2MMGA 5AXBA 3A9UA 5CLJA 3K1YA 4XM2A 4AN0A 4LMAA 4JC0A 1J06A 4B3DA 1BE8A 2EAPA 1HFWA 2HU2A 3OWXA 4N8EA 1ZUWA 1YB2A 1RPAA 4RA6A 4RLHA 3V4OA 5E95A 4V0RA 1U8FO 4ROTA 5CFOA 3D3JA 4DN6A 1U0LA 4IXDA 3CXUA 3QXGA 1PTJA 1O5IA 3LDFA 4YMMA 1IIRA 4JB3A 4X20A 5DX0A 2WICA 1DS6A 2HQBA 2QX8A 1LA2A 3AINA 4EKIA 4I2CA 2YCBA 3RHFA 2I7TA 3BIXA 3ZHZA 5KEIA 3EPHA 3RTVA 2W4IA 2OPBA 1GZ5A 1Y7IA 3HP1A 2PSFA 4BBPA 5JWHA 2KHQA 4J16A 4LXIA 8LDHA 3T5HA 1OLOA 2FE1A 1DXYA 2VDPB 3P4XA 3T61A 4EUSA 2XI4A 4MRMB 4ZMRA 5BUZA 4PHHA 1RC8A 3PQ6A 4E03A 1XROA 5GV7A 4NU5A 4ED2A 4Y2RA 3OTWA 5ITVA 1J2MA 1XNSA 2NN3C 4HDOB 2FWIA 4ED6A 1XMQB 1Z7YA 3KQPA 4IBOA 4KE9A 4MB2A 1YTUA 4FXPA 1BH2A 5ALPA 3LK9A 2E1RA 1E3IA 3H2BA 3M5CA 4LDZA 2F2AB 1GNRA 2HC9A 2ASDA 1D4OA 3K9GA 1MPXA 1C4XA 2BDEA 3D5TA 3PW0A 2YNMC 4JNCA 3TLMA 4NCKA 1G6HA 2JAWA 2Y6UA 2VT7A 4R69A 2YQZA 4RQNA 3KQMA 3MFQA 1R5JA 4TGLA 1AM4D 3V4PB 1H42A 1XHEA 2GNOA 4HJRA 4G9EA 2DJ5A 3TRJA 1PK8A 4KFSA 1Q7GA 2G07A 4PAGA 4I3HA 5LOVA 2GM4A 1QU2A 3B9QA 5ALFA 2UUAB 2BFDB 1W30A 1RWOA 2AV6A 4FW9A 4XASA 3B9RA 3EJWA 5C1BA 2D6FA 3FMPB 4LRTB 5F35A 2FP4B 2IW1A 2J3JA 4OI2A 1DKRA 3I62A 1LRLA 2EJBA 3L79A 1P29A 4QNMA 2PZKA 4Q9KA 3RUEA 4OJKA 1UZMA 4IP0A 4OA5A 3FMIA 2QLJA 1QIMA 1KO7A 2Z9BA 1LD3A 3TZHA 2P2ZA 3V1TC 2PN1A 4MTCA 4P0QA 3CZAA 4KXWA 4J03A 5FPPA 3FROA 4D9MA 3WA7A 4LF6B 3GZ4A 5GVSA 1J1ZA 5FULA 1X15A 2TMGA 6ABPA 2RH8A 3BB1A 2WJHA 3DVRX 2B4YA 4MVJF 1N2HA 1Q2UA 4K4IA 1RM4A 4MV1A 2ENWA 5IC6A 4B85A 5KSYA 5BOSB 3UG7A 2D1YA 2NTNA 1W1WA 4FGWA 2PVPA 3WLOA 1FQKA 1CZRA 3ETGA 2D1SA 5IKPA 3BXPA 3CU5A 3RV4A 2C5BA 2WKPA 1EJBA 3S28A 2WYWA 2J85A 4BO4A 1NG1A 2QXUA 1L4NA 1GL7A 1QP0A 2LIVA 2R00C 4I2JA 3AY0A 1J21A 2H1WA 5CHYA 4EM6A 5AQ1A 3IBGA 3Q9LA 4L3OA 5DN6A 4RV9A 1AQYA 1D9XA 2QZJA 3VTAA 2VA3A 2OHHA 2Z5GA 4F84A 5ECGC 4ZV4A 3EPLA 3RC3A 2V54A 4AF7A 2QL7A 2PVCA 3QKTA 4G36A 3U56A 4O0MA 2XQGA 1E1YA 3IB6A 4EJFA 4IHAA 3OPQA 2C92A 3REQB 5ADVA 2XOXA 2O19A 1RI4A 5TT1A 4REMA 3A3KA 4H7FA 5DXAA 1RVV1 1X1SA 2G40A 3SQXA 1PJCA 2FZKA 3LC2O 2QVLA 2HSGA 4L50A 4JMLA 4FFDA 1PGNA 1VCNA 3PE6A 5KIAA 2FSVA 2Z3WA 3FCAA 2WYOA 3IPRA 1G60A 2VRNA 2DB3A 4D7AA 3FFWA 1AQIA 3AESA 3S6JA 1IOZA 2AK3A 1NFFA 3N86A 5CYFA 1QMPA 3AF6A 4QUJA 3CNHA 3PO5A 1M6EX 1SUSA 1W6UA 5JADA 2GCOA 3NKLA 1OYVA 3P20A 1ECFA 1VE5A 4KN4A 1WWKA 2HA5A 2VL7A 2RB4A 3NTOA 5FTWA 5KFXA 2Y1JA 4Y18A 1N36B 3BERA 1UAGA 1MIOB 1RYNA 4HZIA 4MFCA 2YZMA 3M5WA 5BMVA 4DEZA 5FBLB 16PKA 2I6TA 4EI7A 3ASZA 3LYAA 4H0FA 2XD9A 4ND1A 2J0UB 4O3RA 4WXEA 4CIDA 1YRAA 3QX3A 4QZBA 1DVRA 1Y8CA 4JELA 2RHHA 1KR5A 3T9CA 1P9OA 4LHSA 4ZHSA 3BS5B 4MQ4A 3A9SA 4R7GA 1FS5A 1H1TA 1KRHA 4UAVA 3GN2A 4HEQA 2HHVA 1SCKA 2LIPA 3M8RA 3CUTA 2GN0A 3E15A 5H7XA 1ORDA 2QPTA 5U4QA 1IFXA 4ZGBA 2V4ZA 4UHCA 1SVLA 1NVVQ 2A1JA 9ICRA 1P77A 4OHCA 4YIHA 3E35A 1BJKA 1QVWA 1S5LU 1PO7A 2R6R1 4LDJA 5L9AA 5LP1A 5FI3A 3IUSA 3SE7A 1XD2B 3PUHA 4IXMA 5DM2A 3DEYX 5JECA 3O9MA 4AZ0A 1U2GA 1YH3A 2V55B 3RAEC 2AB0A 4OFWA 2I7VA 2JAXA 2R48A 4HRAA 4UNNA 5CIQA 3EZXA 4JJ4A 3RSOA 4EGCB 2XJ9A 2R11A 1Z9BA 4WJKB 4C22A 1PSDA 4FHGA 1V3UA 5HF6A 2OK8A 2OV4A 2P2SA 1G21E 2AFVA 3FX2A 2W48A 3DDHA 4H0NA 4MGEA 3T15A 1Y1TA 1U5CA 5CXUA 4CQMD 1NYTA 5IJ9A 3GBPA 5LPNA 1JDBB 1TYZA 4GI3A 4V24A 3Q8WA 2WIGA 4R1PA 5LFAA 1I1QB 4EDHA 3R23A 3T4PA 1TAUA 1JLSA 1JT2A 3KOWA 4Z8XA 3T9EA 1EQUA 2WU3A 1TK2A 4C6TB 2NO4A 2ZAOA 1G41A 4Z7OB 3IX7A 4EG4A 3MINB 1NVGA 3TK1A 1AKYA 3DMNA 4TL7A 2VHUA 1A0PA 2KEYA 1J49A 1E59A 1HLGA 1TJ3A 3I2JA 4N3CA 1TVKB 3V8BA 421PA 4BLPA 3O8NA 2IGTA 2BR0A 1FIQA 2AQHA 5KFGA 3EZLA 4PYKA 4U2DA 2O2IA 3ZXXA 3RVBA 3N5KA 4F8EA 2VRWA 3L43A 2RHBA 4ALLA 1O87A 5B37A 1GUBA 2OVBA 4E4YA 3J81A 2BJVA 3KXKA 1M0WA 4PZCA 2TS1A 4I36A 7ICHA 3OCXA 4EECA 3JATB 3DT8A 1EGMB 3K5IA 1Z37A 1KDTA 4LJ5A 3RFVA 2RD2A 4R16A 1ESEA 3IEUA 3HVRA 1RKXA 2IL1A 3ZNNA 4JENA 2D5AA 1V39A 3DV9A 1ZRNA 3BK2A 1AU9A 4HXEB 5C3MA 4TYNA 4LPKA 3QHAA 1BDIA 3ICEA 4O25A 1SZPA 1YB6A 3IDZA 2JXJA 4H7DA 4FS1A 2MINA 3R75A 2VTKA 4CG3A 2V74B 3ZHCA 4NS1A 3Q85A 1T8SA 3D5EA 5G53C 2W9MA 3TAQA 1EVYA 1Z12A 1C9DB 5G3YA 1GFIA 1HYQA 3ETCA 1M8KA 2BONA 2QMUA 2YBEA 3AEYA 3KYDB 3MERA 3M82A 4IIYA 4J29A 1NZBA 3EXHC 4ECXA 3USZA 3KALA 3QH4A 3JQDA 2P4HX 3C5WP 2BWJA 2G4VA 4OY3A 4NCAA 4EP1A 1OZGA 2VZLA 4BE9A 3FC4A 4ECZA 2P9JA 4KXYA 3U6BA 3QVKA 3G13A 4WK4B 4M9CA 1XRQA 4H4DA 3VAAA 5CEHA 4NLCA 1H93A 2ZP1A 2IZZA 4KGDA 3WJAA 4BVEA 3GPLA 2A3NA 1YRYE 3QUTA 4OG2A 1EVQA 1TJYA 2J7KA 3AQ4A 5EMLA 4DS3A 4QUIA 3JPOA 4H1TA 3HVIA 1T3QA 4R41A 5DMHA 4UE6A 5HOEA 1ZQ9A 3HYCA 1I4DD 4NABA 4QQRA 4KTQA 4BV9A 4BX8A 1TCAA 2QY9A 4OREX 3FI9A 4GP7A 2EG9A 2OFWA 1L8AA 3FZQA 3NR2A 1G0NA 5L3VA 2IYRA 3QTTA 2CJFA 4RD2A 3P9IA 1D9FA 1YNOA 3GAMA 3GX1A 3OEHA 5GZ3A 2EV9A 2BFEB 2R44A 1XP5A 3FPJA 3KJGA 2FOIA 5SY4A 3S1AA 4C4TA 1QKKA 2J33A 3HL4A 4PHDA 4RHCA 4QDXA 5BSGA 5DYTA 2JFPA 4HLQB 1XRLA 2BC9A 4U7HA 5ES3A 3QLTA 9ICNA 1MO4A 1TGYA 4HTFB 3EUB2 1ZSYA 5H3CA 4YRCA 2AOUA 4P7KA 2Z5FA 1JSZA 4FOTA 1F38A 1XTIA 4MS4A 4MWOA 4UHHA 4JSRA 5LM3A 4BUGA 5MGBA 5ALTA 3GMDA 5J2KA 5FBVB 4CRXA 1ZQJA 3GUHA 4KMSA 1VG9B 2WILA 1D0IA 2I3AA 2WJWA 2XYGA 1F0NA 1UFVA 3NTQA 4FT2A 4I5EA 1JL3A 4Y8VA 2PFOA 3LL7A 5EKXA 2GKSA 2YY7A 1XSEA 2XWQA 4LC0A 4HI0E 2OAEA 1JEQB 4X24A 3KQYA 2X3FA 2F3UA 1MH9A 1QE5A 3ROTA 3V34A 1KI3A 1JN0A 1N5IA 3TNFA 1J24A 2XGOA 1QSLA 3K70C 2WM3A 5BNWA 4CM3A 2R8IA 4NV3A 1XZLA 3RQIA 3WRWA 5LC1A 4IO1A 4CIYA 2FPMA 2YTUA 2ZIVA 2H16A 2PH7A 3BXFA 3OAAA 3DEHA 5I9TA 2VJBA 3CURA 5KFUA 2VCEA 3W9BA 4R3NA 5JSZA 2FMSA 2Y6VA 4WI1A 1LF5A 1CUXA 3E8MA 4GPZA 5K4HA 3EUAA 3AU6A 3C1OA 5EJ7A 4F4XA 4F2GA 1GDTA 2AJBA 1XNQB 4GAEA 3I1YA 2J09A 1XU7A 3NEYA 3U3XA 5CEFA 5HRCA 1Y7TA 5P8WA 4O5OA 1EDZA 2YYZA 3ACCA 3TANA 1KYTA 1CJKC 5AVUA 3RK0A 2CMHA 2XVZA 3PXEA 3N7AA 4QECA 1AKWA 3IVRA 1X2BA 3HZHA 1NK6A 1MEJA 5JNWA 3RJIA 1HYEA 2CLSA 1K6EA 3TIFA 4XSHA 5J58A 1WWUA 4EB6A 5AKZA 2HIGA 1XLVA 4RMHA 3PX6A 2NV3A 1BA2A 4WLNA 3SNKA 1SEVA 3HRKA 2X6RA 1NJZA 2ZUCA 1CHDA 1U8AA 4TSFA 5CNMA 5I5EA 2PX2A 1KW4A 1KFJB 1ZQWA 4UEQA 4W5TA 2PHZA 4FI3C 2GH1A 1AUVA 4PNPA 5B58C 2V0NA 4L57A 1MN8A 4CQMA 1CRPA 2MSWA 1U0FA 4RCVA 2VDLB 3RRBA 3SR0A 3G6YA 1W5EA 1CVIA 3H84A 1PK3A 1MTZA 3L0PA 3MGBA 4XPIB 5T3YA 4Y0AA 1TPYA 1WABA 1NBMA 3REFA 4C0BA 4ETNA 1V8BA 1SKAA 4PBSA 3WB9A 2QL5A 2I0FA 1NPYA 3O1LA 4RVGA 5CDYA 1U8UA 1F2DA 2F7SA 3VCBA 2OQ2A 2TYSB 1SXPA 2AJQA 3R9XB 1PX0A 3C6XA 1DKOA 2ODGA 3GG2A 4R9NA 5FA5A 2NO0A 2P2YA 5CGQB 4A3SA 3B6KA 2BBSA 4EBBA 3HR7A 1KY3A 1UBEA 4LZPA 4R5MA 3ZEAA 2D74A 1L4LA 4MZXA 4ZVLA 3R9IA 3UQYS 5B4UA 3MOIA 1K6IA 3TOXA 1PK9A 4XUCA 3JQBC 1GOTA 1E5VA 5L1LA 3AJRA 2Z5LA 3RD5A 3QPCA 5TQ2B 4H6PA 2MU2A 5ELXA 1USGA 1NKCA 1LBIA 1W29A 2C0QA 4RPHA 3UB2A 5K3DA 3M9LA 3IAS1 1KPGA 5K3SA 3VSDA 2J3IA 4R01A 4QZEA 1SXDA 2A57A 3QELB 5C8YA 4GBJA 3UT5B 4M46A 4Q3EA 2HSWA 4P92A 4ZI7F 3G0GA 4G3XA 1LKYA 3RC9A 4GWLA 5JANA 1TMOA 5EKSA 4JI7B 2FKNA 2PLWA 1FSPA 3OZXA 1YR3A 5KT5A 2FX2A 5TLSA 3FNFA 5G40A 4MJXA 4DDKA 2OC9A 3CEMA 4EBFA 2X2PA 1V1RB 1DQNA 3EVFA 3FDFA 2DFTA 2QMOA 3PPVA 1F2VA 1JBKA 1Z4NA 5ERXA 2HHHB 4PAWA 4QELA 2H11A 3NNNA 2YNMA 2XMRA 5C5EA 1O6ZA 1YGYA 4KMOB 1O4WA 1VI2A 4DLXA 4NI5A 1ZQNA 5TEVA 2RGYA 4EJ2A 1EX1A 3MHPA 3HFRA 2O8NA 4INPA 1UBJS 5KNBH 2Y99A 3KJNA 2J45A 4K0RA 4FSXA 2NG1A 3ZH2A 4FFWA 4GMGA 4CT5A 3LUDA 2NGRA 4JQCA 1Y34E 2OCBA 2ZE7A 3IS3A 1HG0A 1E3JA 2AI2A 4FVTA 1ZOSA 4K6HA 1JEOA 2QLBA 4KFRA 4NZNA 4A0QA 2OAP1 4RSGA 4X6UA 4JL5A 4YP9A 4M3NA 3IALA 1AJEA 4B3JA 4O4JA 1L4MA 2O57A 5E4YA 1VSBA 1L0BA 1N2XA 1AC5A 1M34B 2WAMA 4I9HA 3V8EA 4IHKA 1Y63A 2PJDA 1YFJA 2J0SA 1CBUA 1Z4OA 5IDWA 2EZZA 121PA 1ZK0A 4XIFA 3HHPA 3R6LA 1X7WB 4OL0A 4BNLA 5B7QA 4LISA 1KP9A 3RSFA 3JQCA 3WTBA 2IUEA 2CHFA 2F77X 3UUWA 4CLHA 2QKQA 5GTHU 2HJRA 2PLFA 2XQIA 1E1RA 5EP1A 5HBRA 1GYQA 2XMGA 4EBEA 1YDFA 1YV9A 1Z16A 2GSWA 1C30B 2ZFUA 3BORA 3GDFA 3LBYA 2VHZA 4YT5A 3WRXC 4B8ZA 1DWPA 2X58A 4RQ1A 3BGWA 3C5VA 3MD0A 1EK5A 1U4SA 1UM9A 4YMUA 2JR5A 2ATCA 1JKJB 3DAYA 1CUAA 3O8OA 3RYFB 1RADA 3WJ1A 1Z63A 4A73A 4I2HA 1IY1A 1J0EA 4NU6A 3VC3A 4JBYA 1XR3A 1FLVA 1PU2A 1JHQA 1SIBE 3DMRA 3ESAA 3W8NA 4UNRA 3LZDA 5G41A 3S55A 1WXQA 1NXPA 5KNIA 1VE3A 2JNWA 1IHPA 2ZYGA 3SLGA 1JA1A 4FO6A 4YMLA 2HT1A 3C3EA 3SEAA 2ZI3A 4IOMA 4JJ7A 1E0JA 4YRQA 3TDNA 2EQBA 1UBSB 3MTGA 2KE5A 2GPYA 1YKGA 3R4CA 2PQMA 4KXFB 1JHAA 3I72A 4U5XA 3RK1A 5IZCA 4DLKA 4RTNA 1P1HA 2PVSA 3PITA 1G8AA 5AYVA 3PFHA 5GONA 9MHTA 5CNKA 5LLDA 2FE4A 1LBSA 1B43A 1X1CA 4FYMA 3EFEA 4BNDB 3ZY6A 1IJFA 1DRJA 5EJFA 1QG0A 1X9IA 1LI4A 1NXVA 1GG2A 3OTGA 4D4MA 3PJRA 3MLBA 4J8PA 3Q7IA 5FOWA 1N34B 4BUCA 3BHNA 1E1MA 4DIOA 1K4MA 3UB4A 5SYMA 1DO2A 3HSKA 3DWIA 3EISA 3IR7A 3P9RA 1JIKA 3VR5H 2JH8A 4KACA 1YUNA 2I4TA 1VYVA 1ZICA 1ARZA 1ZLYA 5ITZA 4TQSA 1WLSA 2XVXA 1PYOA 5T67A 4I5DA 4JB0A 4BASA 1M6HA 4FGZA 2PA3A 3RUPA 3ZLVA 2XCAA 3HXOA 3LIIA 2WB4A 4PFKA 4BZQA 3ETEA 3H8MA 2RHMA 1GAEO 4HGPA