3WU2U

Crystal structure analysis of photosystem ii complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 32
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3wu2U01
4PJ0U 5TISU 5B66U 5GTIU 1S5LU 2AXTU 5GTHU 5E79U 3WU2U 2DUYA 4UB6U 3KZIU 5KAFU 3A0HU 5B5EU 3A0BU 4IL6U 4UB8U 5H2FU 5KAIU
chains in the Genus database with same CATH superfamily
2A19A 5AKGA 5KFIA 4G3IA 2M9NA 3JPTA 2M0NA 4QW8A 4IRKA 4NLBA 2OXOA 4X5VA 4QZHA 4Y2XA 2JXJA 5KG4A 3NVVA 1L7MA 5KT2A 4C8KA 5G5GA 2F77X 3RJKA 3D2NA 3MR6A 5AM5A 1Q8KA 2ATLA 2UVWA 3H8WA 4PPXA 2PFNA 4KITB 1QSSA 1ZQFA 4XA5A 4US8A 3C5GA 2MAXA 1XS9D 2W9AA 2W3SA 1LVHA 3LVVA 3M6ZA 5F9LA 3MR3A 7ICQA 4NLGA 4GC7A 2W9BA 3GQCA 2JR5A 1N2XA 1F5SA 3RJHA 2FLLA 3JPRA 1JRPA 1XWLA 1ZQUA 4LJXA 9ICTA 3WKEA 2IOFA 9ICWA 4RPXA 1WWUA 1ZD2P 5J8YC 1B22A 5J2HA 4J9OA 3PX6A 1JXEA 1V9PA 4C8NA 3WK8A 9ICXA 3ORYA 1FIQA 3QU9A 2K4HA 4UAWA 2C22A 1CUKA 3CYMA 4O5KA 1BPXA 1K5OA 1U47A 3ZDBA 1JIHA 2ESEA 2XO7A 2F3NA 4P4OA 4Y2RA 3SQIA 3SI8A 2Q0ZX 2ZTDA 1Y88A 1NZBA 2RDJA 4IS7A 4Q43A 3PVXA 5DQGA 3FC4A 4DFKA 1ZQMA 3TFRA 2PMZF 8ICSA 3U26A 4M9JA 1D9FA 4CF5A 2LI6A 2HHTA 2ISPA 4NXZA 1N62A 2PFOA 1BGXT 4DOBA 2XCAA 5ALTA 3H0MB 2I1QA 3PZPA 5KT7A 5L1IA 5EE9A 5AIBA 2W54A 2F8LA 4UAYA 4P0PA 3UM9A 3D2SA 4RQ2A 4J9NA 1ZD5A 1ZQVA 3PX4A 4R8UA 3RJGA 5JRTA 3ZDEA 1L5UA 5IIMA 5ALGA 4YN4A 2V4QA 3F5EA 2ZJ8A 2LYBA 4QZBA 4DQQA 2KG5A 4I2JA 2JGAA 2K8BB 2KN7A 2IOFK 2KK0A 5HHIA 4J9LA 2O6KA 4I2AA 2WB1C 1RPLA 2EANA 3MFIA 1YZ6A 2NRWA 2IA6A 1KSPA 1CEZA 7ICKA 2JRZA 4RQ7A 5J0XA 2WF8A 2BCQA 2YMLA 4F4WA 4AYBF 1SL1A 3MBYA 4FBUA 4IR9A 5KFQA 2KJ9A 2R8HA 1NK6A 5JUMA 1MC8A 5KFOA 1NJYA 3PSIA 5J2JA 3WK4A 2E5SA 3RB6A 3V6JA 2DL0A 4RUCA 4DF8A 2BCRA 9ICCA 1SGGA 2HOFA 2BGWA 4QNLA 1ZQOA 4Y2TA 5ALJA 1EXNA 2G0AA 3GZFA 4AP9A 2JH1A 4JUZA 2MA1A 1ZQDA 2DQNB 2C2EA 2PKEA 3QU2A 4QW9A 3AUOA 8ICKA 3RJJA 1A77A 3AL0B 4QWAA 4B9MA 9ICGA 5ALHA 3L3FX 2KZ3A 4EEKA 5KG6A 4EYIB 4CRXA 5J0WA 1KBUA 1S76D 3SAHA 3MC1A 2KOBA 3JPQA 4BJQA 1QQ5A 3NVYA 1KRPA 5ALFA 4J03A 2YTUA 2EH9A 5DKWA 1X9SA 1ZQAA 5KFEA 2CXYA 3K75D 3J81j 5DBBA 5DG7A 1BPDA 1QQ7A 2GH1A 3Q8SB 4MHVA 4ZOHC 4QZDA 4FO6A 4PZNA 1QLNA 2OYYA 3PX0A 2BPGA 2LYHA 5DG8A 2QB0B 4P0QB 4Z6DA 1RQNA 4RZRA 4PL1A 2K8AA 3PMNA 4I2BA 1NJXA 5J2FA 3H8JA 1OUQA 1L3UA 3F5AA 4A8EA 4Z6FA 5KFKA 1RYRA 3SV4A 3N97B 2J6SA 4DFPA 4O3NA 3MGHA 4YR3A 1ZQEA 2YX8A 3EYZA 5KFZA 3A0HU 5J29A 5J2BA 3OGUA 3NS1A 2HVIA 1N5XA 2XI9A 5KG1A 5L1JA 1TVAA 5KNIA 5JU5A 1TK8A 4KLTA 5KFYA 3OJUA 3PW4A 5AI5A 4YG2A 8ICOA 4DQRA 4OD0A 4OCZA 2Y9TA 1ZQJA 2JV3A 2N1RA 4ED7A 4DLEA 9ICLA 2H3FA 3A0BU 9ICFA 3OTQA 4ECQA 3BDPA 5AICA 4PGXA 2ZIWA 7ICJA 4DL6A 3UMBA 5KFDA 7ICPA 2RHFA 3RR8A 5ALLA 2QARB 1S0NA 4RQ6A 3AMZA 2I9GA 5HP4A 8ICTA 2HHQA 2JZBB 3KZIU 1XO1A 2YY6A 2UVRA 1KTQA 1NK0A 2A1AA 2RP5A 2HOIA 4ECUA 3Q8KA 4ICAA 1SZPA 4UASA 2KD1A 2KZMA 4F3OA 4YD2A 4MFFA 3AM9A 3GU3A 3BS7A 4ECTA 3RBDA 1L3SA 4M9GA 3PR5B 4M47A 1XSNA 1SXEA 2I5HA 4KN7A 2G5HB 3GFKB 3BZCA 4DL3A 4F50A 3M7DA 2C2DA 2NV3A 1Z00B 5EOZA 1WYGA 1RYSA 2LHTA 2FPMA 1B0XA 5C0YA 2AQ0A 2E8OA 1H38A 4BGDA 4CE6A 5KT6A 1VDVA 1ZYQA 3WKCA 4DFJA 1U4BA 5ALZA 3H0RB 1KQQA 5J2GA 4GXKA 1SL0A 7ICGA 3KHRA 4EELA 2CN1A 5KFTA 5DLFA 2UVVA 2ZTCA 3O0FA 1TK5A 4TURA 1B4FA 4DSLA 4M04A 8ICQA 5J2KA 1ZQNA 2KV2A 5EWGA 5DB9A 4O0IA 4RPYA 5KFSA 4QZ8A 4F2RA 3WU2U 5KFNA 4OJ6A 3QZ8A 4TQSA 2LM4A 4JB3A 2VJ4A 3QYPA 4DSEA 9ICJA 2YQEA 1KEJA 3C2KA 1BNPA 1ZOLA 1TAUA 4I29A 3PW7A 2Y1IA 4NWIA 4FZNA 3OHBA 4FE3A 5KFMA 3SAFA 5AK6A 3IP4B 3WKBA 4NLZA 1TAQA 2J6UA 5AI8A 2UVUA 4Q8FA 2K8CB 4DOCA 2NYVA 2ZG6A 5CP2A 4EEYA 2E3TA 2XICA 3FYHA 3M9NB 3OSNA 7ICVA 4EBDA 3GDXA 3T5JA 1ZJMA 1QSYA 2HMXA 4I2GA 1P7DA 4F93B 2IOHA 4ECSA 4EYHB 5AM0A 4DS4A 4GXIA 2FLNA 2IHMA 2EAPA 1URJA 9ICSA 3C21A 1KW4A 3C28A 5KAFU 8ICNA 3UQ2A 1NK4A 4DSKA 8ICPA 1TFRA 2E8MA 4PGYA 1LKYB 1V38A 2ZIVA 9ICPA 1UA1A 1D8YA 2KFZA 4YCXA 1FFUA 1Q3UA 3BS5A 9ICNA 4UB2A 2F44A 2WF6A 2H3ZA 4RT3A 1NK9A 4M9HA 1GO3F 4NJ8A 1YT3A 2MSNA 1KLNA 3BQTA 1N56A 1L8LA 1N60A 3IHQB 5EE1A 5KFUA 4QZCA 8ICAA 4KN4A 3H0LB 4Z6CA 1ZQRA 3KOOA 5J2CA 4JV0A 4DS5A 4IQWA 4KX5A 4PHDA 3LYSA 3V6KA 5JTIA 4RU9A 3T5HA 5KFRA 4XUSA 3M9OB 4IQTA 3C5FA 4KX3A 2XY6A 1MSWD 3KBBA 2NRTA 2YMPA 2W8KA 1T8EA 3WK5A 4JWMA 3PO5A 3F2DA 4KLGA 2ODGA 4J9QA 1CRXA 4RNNA 4O9MA 4UB6U 4IC9A 5EWEA 2AGPA 2HW3A 2W9CA 2XGQA 1IXRA 3QUBA 4B9LA 3WK9A 2AH5A 2QB0A 4P0QA 4DL5A 4YMNA 4ED2A 2HHVA 3KD3A 2E1FA 2E1EA 2KEYA 4IQVA 4DF4A 3ED5A 3IM1A 3BQ1A 1LB2B 2FMPA 4XRHA 2EZYA 7ICMA 1QH9A 4DCCA 2FLPA 3FAHA 2OM6A 3RJIA 2VKQA 5ALMA 1F44A 3VCBA 8ICZA 1S9FA 3LWMA 2KMDA 3M9MB 5AKYA 1RYUA 4MF2A 3R9KA 1F0MA 3C23A 3PW0A 3MDCA 5J0OA 1DGSA 1KL9A 3TACB 2H3IA 7ICEA 3HJEA 3V7LA 5BPCA 3UXPA 5CR0A 4DSFA 3HWTA 2ZIXB 8ICMA 2BQ3A 1M6YA 2QB1A 2HHUA 2DPJA 3V7KA 3PV8A 2K89A 7ICFA 1Z19A 1PUZA 2GO7A 2BPCA 8ICYA 2EZXA 3PR4A 2QKQA 3RB4A 5J2IA 5IIKA 2JZBA 1N61A 2DUYA 4UB1A 1LV5A 2BPFA 1ZJNA 5AKHA 4EZ6A 1DOQA 2W7OA 3ALRA 2BDUA 4KLFA 2LPEA 1JROA 3WKDA 5AM2A 4CF4A 3CNHA 3LDAA 4CCHA 3MABA 5J0PA 3EPIA 2WF5A 4PGQA 4OJOA 5CEHA 2BQRA 3WK7A 4M9NA 3EZ5A 2I6XA 5CHGA 4K4IA 3F2CA 1O03A 4DSJA 2K4IA 3ZDAA 1NJZA 2EDUA 2PFPA 1Z00A 2HBMA 5DGBA 4LZGA 1FEZA 3M1YA 1RQLA 1J2MA 5AKJA 4C7YA 2KKPA 5A0LA 2BR0A 4C0ZA 2W43A 4P4PA 1ZQQA 2JEGA 3T79A 3MFHA 9ICMA 2RLTA 3L5KA 2WTFA 1T94A 2EAOA 3NUQA 2OCEA 1UQVA 8ICJA 3RRHA 3RB3A 3E0FA 2ES6A 5IIOA 4ZH4A 1NI3A 4KMUA 5L1MA 2HVHA 1ZXIA 1KDHA 5ALUA 2FPLA 2WB1F 3C1YA 5KFHA 3BJYA 5CRXA 2OEHA 2GLEA 2AU0A 4GXJA 3JPNA 5KG2A 2PXIA 1IIPA 1L8OA 4QZEA 8ICCA 1L3TA 3NVZA 4BXOB 5KT4A 4DL2A 2WF7A 4I2FA 3T5LA 5AKZA 2KZZA 3ISDA 3H4BA 4TQRA 5J0UA 3I76A 5KT3A 1UPHA 1AROP 2G08A 4J9KA 1U48A 7ICNA 2LM1A 1PVPA 5HNKA 8ICGA 4NL9A 3TFSA 1QSLA 3HILA 4RQMA 5ALVA 2G09A 5EWFA 4RNOA 2FI1A 4B9NA 4PZOA 5L9XA 4JK1A 1Z4OA 4KLDA 2HBJA 1X6IA 4PL2A 3Q8LA 4Q44A 4MFCA 2W9BB 1RXVA 2BCUA 3EW9A 2A1JB 2OH2A 3THVA 2VA2A 1T3QA 5GTIU 4UBBA 5IILA 2F8KA 1Z1BA 4K4GA 5KG7A 2JEJA 4UAZA 8ICXA 1BPYA 2F1HA 1JN3A 3G6VA 3K1RB 1AQ6A 2YB4A 4QZAA 4PHEA 5CWRA 4DQPA 2YN4A 5DBAA 1A6SA 3NRWA 4QZ9A 5KFBA 2HBLA 1OW5A 3GIJA 5GTHU 5E79U 4M6WB 3B0XA 1T7PA 5AI6A 2P66A 4TUQA 2MU2A 3G6YA 1X6JA 1UT5A 2ZUDA 2FJ6A 5EE3A 1WUDA 1X9MA 2ASJA 4ECXA 4KLQA 3OSPA 2F1JA 3ISBA 4Q45A 4C8LA 1PZNA 3RAQA 4KLHA 2IBKA 3KKAA 5TZVA 1XSLA 5EE0A 1ECWA 4I2IA 8ICBA 1TKDA 5ALYA 4DL7A 5KTQA 3GIKA 2W3RA 2W9MA 4O5EA 3SR6A 1SB3C 1JMSA 4O3MA 5F9NA 2DWQA 4YP3A 4QWCA 5J2AA 4ELTA 2XY5A 1ZQHA 4FZMA 2ALZA 2VIXA 4FBTA 4J9SA 1D9DA 4ECZA 4B9SA 2Y0SC 1NK7A 2YMQA 4P0PB 4YVZA 2WAQC 5ALXA 2NRVA 4PHAA 4G9BA 1L6NA 3HPOA 3V72A 4EX6A 2JHDA 3PW2A 7ICTA 2H3QA 4EBCA 3V6HA 9ICQA 4QWBA 1S10A 4I2EA 3PMLA 4R63A 3PO4A 2JEIA 1SKWA 4JV1A 5CB1A 3H8SA 4KLLA 2MUTB 4UB4A 1ZQXA 5IIIA 1ZETA 2D6FC 3H8MA 2ZJAA 4US9A 2G06A 2ASLA 1KKXA 4CF3A 4RUAA 1MN8A 3TADA 3BQ0A 4ECWA 5CA7A 5AKXA 1HUZA 5J0QA 2Y9UA 3KHLA 4YR0A 2EZZA 2QLTA 2Y0SF 2HDOA 3KZXA 2R8GA 2R8KA 1KFSA 3SMVA 1BPZA 2ISOA 2HCFA 9ICOA 3SENA 4LVSA 2W04A 2ASDA 4JMUA 1RDFA 4UB8U 4HYKA 1XNSA 8ICVA 3ONNA 1ZQPA 5ALPA 4RQ5A 3RBEA 4XQ8A 4RNMA 2ZIXA 5KL1B 2IHNA 1T3NA 3QU7A 5KG5A 4OJPA 3C2MA 2WFAA 4DL4A 4OJLA 3HKZC 4EZ9A 3K4GA 1IM4A 4OO1J 1SV0A 5KFPA 2OHFA 1RZTA 2PFQA 2Q4TA 1S5LU 9ICEA 5HMMA 1B43A 8ICFA 5DQIA 4MEYA 4BWMA 3QU4A 3RH4A 3NASA 3T5KA 4YMMA 5AM3A 4I28A 4TUSA 3H4DA 5HR7A 5AI4A 3IN5A 1D8BA 1MQ3A 1J97A 4DQIA 3B9JA 1HJPA 4UBCA 5D4BA 5AK4A 3QNMA 4UARA 2DF4B 4BUGA 1V97A 2F1IA 3GIIA 3HKZF 4NL9C 4KLUA 4UAVA 2J6TA 1IG6A 2Y1JA 4QWDA 4B9TA 2W8LA 1COOA 4R66A 5AK5A 3PW5A 5KG0A 2FE9A 2FMQA 3C2LA 2AGQA 1WCLA 1NNLA 2C2RA 1JALA 3ZD8A 5DDMA 3MDAA 4B9VA 3JPPA 5ALQA 3M8RA 2XY7A 5ALEA 2E8PA 2RDIA 3CP8A 2HBKA 4C8OA 1PK1B 4UQGA 2EQYA 5D46A 5KFJA 4EX7A 8ICLA 3OPXA 2KJ5A 3FDSA 2G07A 4C80A 1X42A 2L5YA 5IINA 7ICLA 2JH7A 5J0YA 4O5CA 2KHQA 5ALIA 4KLOA 2KTQA 4P4MA 3HX0A 2B0CA 2V4RA 3ETRA 3K1ZA 4QZFA 3RJEA 3QUTA 2DKZA 3AN1A 1T4GA 2W55A 2D3DA 2ZTEA 4BXOA 7ICOA 2ZIWB 4YMOA 5DB6A 1CI4A 1Z1VA 4ED8A 3QE9Y 1UCVA 3MR2A 3QU5A 1QTMA 3BQ2A 4P2HA 1ZQ1C 3Q8RB 2HSZA 2R8IA 3IDWA 3UXOA 4YFKA 2A3VA 2W11A 2XVTA 2FMSA 4RQ1A 3KKAC 2DKXA 3SEIA 4Z6EA 1HEKA 7ICRA 4YXMA 4LZDA 1Q3VA 3RRGA 2HOQA 5KFGA 7ICHA 2CPRA 4R64A 4WJ3B 5G5HA 1NJWA 4ACOA 1TE2A 3BQ7A 4UW9A 2ZUCA 5FP0A 5T14A 4F4KA 1YZ7A 2KKVA 5DGAA 8ICUA 5AKIA 4J9MA 4FS2A 2AQ4A 2A1JA 4IQUA 1VLBA 4ED3A 2NO4A 4F92B 9ICHA 2B6GA 1COKA 1N5WA 3ICXA 2BZFA 4DOAA 2KICA 1DRGA 2BCVA 2ZUBA 3C29A 5KFVA 5HMLA 3I28A 4CDGA 2PMZC 3N7SC 1SXDA 4F72A 4QIWC 4GIBA 3M6KA 3GV5B 5AKEA 1SV4A 3UXNA 3PNCA 9ICVA 4USAA 3TKAA 2RQ5A 4DFMA 4M6WA 1S0MA 5DB7A 4ED1A 1DK3A 2JEFA 4BWJA 5DG9A 2K4PA 3TADC 2HHWA 3BZKA 4TUPA 1A0PA 1ZQZA 4UB5A 1WCNA 5AI9A 4IL6U 4Y2SA 4F5QA 7ICUA 1V85A 1PVRA 1L7OA 2YB1A 2OWOA 1SIJA 2QARA 5HR6A 1J2NA 2EAMA 5J2EA 4CGZA 4QZIA 1FO4A 9ICBA 4QIWF 3WKAA 5ALKA 3D6JA 8ICHA 4YR2A 1KFTA 4Y2YA 3AEVA 1ZQSA 5D49A 4EBEA 4GC6A 1ZQLA 3HP6A 1UA0A 2ZIUB 2W7PA 4KLJA 2FPKA 4AYBC 3N28A 4B6JA 1SKSA 2AHOB 4RQ8A 2P6RA 2BQUA 5AKKA 2WHEA 1SV0C 3H40A 1K1SA 2KFNA 3LK9A 1MQ2A 3M8SA 4GLXA 4CNQA 4EENA 1RG6A 2DFLA 5KAIU 2KVCA 5B66U 1ZQBA 1JXLA 1ZRMA 5KFAA 5KFLA 3HW8A 2MUTA 1D8LA 4O3OA 4RQ0A 5ALNA 1SZHA 1DGJA 1N48A 4RT2A 1ZQWA 1WG8A 2XC9A 1BVSA 3N7RC 3FM9A 4KMOB 4KLSA 3AU2A 4FZLA 1IV8A 3AQEA 2ZIVB 5KFFA 5KL8B 3BS5B 4PH5A 1C7YA 4DEZA 3NGDA 3SAGA 4DLGA 3SV3A 4I2DA 4Y2PA 3LVWA 5AI0A 3LWLA 4F91B 5K4LA 4BX9C 4Y2UA 4I27A 8ICIA 3UMCA 3Q8MA 3RFAA 3D2QA 2KSOB 4YD1A 2R8JA 3V7JA 2WF9A 2YMMA 3CRXA 9ICAA 2KJ8A 1XO0A 4NY8A 1JI7A 4UB3A 4F4YA 3ZD9A 5IIJA 3UMGA 3QZ7A 2K60A 1NK5A 4BDPA 4U7CA 4Y2JA 3H7IA 3GV7B 4DQSA 2BCSA 2K4EA 5AK3A 3QXGA 2BDPA 2PI5A 4MFAA 5BOLA 2P6UA 1UT8A 3E58A 1SL2A 3B0YA 3IG5A 5J0TA 2BKEA 3GV8B 2LKYA 3RJFA 5DB8A 4KTQA 1S0OA 4UAUA 3EWAA 1RM6C 2KVSA 3E2EA 1S77D 3TI0A 2R18A 3G6XA 1S8OA 2LMRA 4RPZA 4C4SA 1C20A 4Y2QA 3GILA 1TK0A 4QJFB 4DSIA 5L1KA 2W9CB 4NLNA 9ICIA 1HUOA 4QWEA 2XIDA 2P35A 4ECVA 3T3FA 1ZQYA 1X9XA 2VJ5A 5ALSA 3KTQA 5F3XB 3F2BA 3AQFA 3QUQA 1KFDA 2KIWA 1LKYA 1ED1A 5DBCA 3EPGA 3PSPA 3KHGA 1RXWA 3DEEA 3WK6A 4ECRA 3QEBZ 5HHHA 4O3PA 3UQ0A 4NLCA 4Q8EA 3TARA 3JPSA 4F4XA 4IRDA 4RQ4A 2G5IB 4F71A 9ICUA 2F76X 1JX4A 4C4RA 1L3VA 1ZQTA 4C8MA 4YXJA 1BPBA 3F53A 3MR5A 1ZD4A 4GFJA 1TAMA 2VANA 3Q8QB 3SZ2A 1PK1A 8ICRA 1U45A 4O3QA 3TQ1A 1FFVA 2ZJ5A 4F4ZA 5KT5A 4RQNA 2XGPA 1ZQIA 9ICRA 1SWVA 4DO9A 1S97A 2C28A 1S0VA 4YQWA 1OXJA 3JPOA 4I2CA 1VJ5A 2ZXHA 4ECYA 1Q46A 3NVWA 3CW2C 4O3SA 2HHXA 3PSFA 3TAQA 5H2FU 4NV0A 4J9RA 2HI0A 3TANA 2AJQA 2GOLA 1A76A 5TISU 1PK3A 3ETLA 4IRCA 3S6JA 4C7ZA 4C4TA 5AM1A 2AXTU 1WWVA 3AU6A 3OJSA 2H3VA 3VC8A 1ZD3A 4QZGA 2KP7A 4M9LA 4DWIA 4B9UA 3N7PD 5KFCA 2VA8A 4FFDA 4R8UB 7ICSA 1X9WA 4NM2A 2NRZA 4NLKA 3ISCA 4UATA 2W03A 5J8YA 3MGIA 5AHXA 2DPIA 5J0SA 4FS1A 3NRZA 4DFDA 1SWWA 3N4MB 3RAXA 4RQ3A 1X66A 4HAIA 5AIAA 4JWNA 4J9PA 3EUB2 3QUCA 1SKRA 4JV2A 2KNJA 3RH5A 5ALDA 1U49A 1DXSA 1QQ6A 1NK8A 2PI4A 5KG3A 3ZI4A 4ELVA 1QCKA 2MRLA 2WAQF 4M2YA 1PVQA 3L4PA 3SYZA 5AM4A 5DDYA 3DDHA 3ZDDA 4O3RA 2DGZA 4ED0A 3KHHA 4OJ5A 2D8CA 4IR1A 8ICEA 2E8NA 4ED6A 5AKLA 3RB0A 5ALRA 5C5JA 2XCPA 3OHAA 2BHNA 2GWSA 4KLMA 2ZXIA 5J0RA 3RH6A 3IV6A 3NTUA 4E0DA 4MF8A 1ZQGA 3QEAZ 4F5NA 3RF9A 1XU4A 3Q8PB 5ALOA 3IRUA 1O08A 1ZQCA 2NRXA 1BNOA 5DLGA 3SD7A 1X2IA 1NOMA 1Z3EB 5BOMA 1BPEA 2B21A 1UHUA 3HRDD 2ZIUA 3PY8A 1NKBA 3RTVA 4F5OA 5KFWA 4Y2VA 3QX7A 1TV9A 4KLIA 2Z7JA 4ELUA 1K1QA 1KN5A 3HT3A 5DQHA 2NO5A 1MA7A 5CJ7A 1Z4NA 9ICKA 1L7PA 2AGOA 1DK2A 5B5EU 5J2DA 2KE7A 1XSPA 2LBOA 3TAPA 1JUDA 5ALWA 3MGVA 4U6PA 4R65A 3GIMA 4PJ0U 2HHSA 2DBYA 3C1ZA 1L7NA 4M0AA 3DV9A 4K4HA 1U9LA 4KLEA 4F5PA 8ICWA 1ZRNA 4PHPA 1NKCA 7ICIA 5L1LA 4NM1A 4F8RA 3PSTA 2KHVA 2H5XA 3KFUF 1N63A 1NKEA 2V9WA 2LYAA 2CRXA 2F2AB 4MEXA 3UPQA 5KFXA 1XC9A 2VA3A 4F5RA 2JMGA 1NZPA 2KIVA 1ZQKA 2RRDA 4I2HA 2FDRA 3ZDCA 1X40A 1HIWA 3IG8A 2KSOA 3RR7A 3I1YA 4F2SA 2IMWP
chains in the Genus database with same CATH topology
4PJ0U 5TISU 5B66U 5GTIU 1S5LU 2AXTU 5GTHU 5E79U 3WU2U 2DUYA 4UB6U 3KZIU 5KAFU 3A0HU 5B5EU 3A0BU 4IL6U 4UB8U 5H2FU 5KAIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 U;  5TIS U;  5B66 U;  5GTI U;  1S5L U;  2AXT U;  5GTH U;  5E79 U;  3WU2 U;  2DUY A;  4UB6 U;  3KZI U;  5KAF U;  3A0H U;  5B5E U;  3A0B U;  4IL6 U;  4UB8 U;  5H2F U;  5KAI U; 
#chains in the Genus database with same CATH topology
 2A19 A;  5AKG A;  5KFI A;  4G3I A;  2M9N A;  3JPT A;  2M0N A;  4QW8 A;  4IRK A;  4NLB A;  2OXO A;  4X5V A;  4QZH A;  4Y2X A;  2JXJ A;  5KG4 A;  3NVV A;  1L7M A;  5KT2 A;  4C8K A;  5G5G A;  2F77 X;  3RJK A;  3D2N A;  3MR6 A;  5AM5 A;  1Q8K A;  2ATL A;  2UVW A;  3H8W A;  4PPX A;  2PFN A;  4KIT B;  1QSS A;  1ZQF A;  4XA5 A;  4US8 A;  3C5G A;  2MAX A;  1XS9 D;  2W9A A;  2W3S A;  1LVH A;  3LVV A;  3M6Z A;  5F9L A;  3MR3 A;  7ICQ A;  4NLG A;  4GC7 A;  2W9B A;  3GQC A;  2JR5 A;  1N2X A;  1F5S A;  3RJH A;  2FLL A;  3JPR A;  1JRP A;  1XWL A;  1ZQU A;  4LJX A;  9ICT A;  3WKE A;  2IOF A;  9ICW A;  4RPX A;  1WWU A;  1ZD2 P;  5J8Y C;  1B22 A;  5J2H A;  4J9O A;  3PX6 A;  1JXE A;  1V9P A;  4C8N A;  3WK8 A;  9ICX A;  3ORY A;  1FIQ A;  3QU9 A;  2K4H A;  4UAW A;  2C22 A;  1CUK A;  3CYM A;  4O5K A;  1BPX A;  1K5O A;  1U47 A;  3ZDB A;  1JIH A;  2ESE A;  2XO7 A;  2F3N A;  4P4O A;  4Y2R A;  3SQI A;  3SI8 A;  2Q0Z X;  2ZTD A;  1Y88 A;  1NZB A;  2RDJ A;  4IS7 A;  4Q43 A;  3PVX A;  5DQG A;  3FC4 A;  4DFK A;  1ZQM A;  3TFR A;  2PMZ F;  8ICS A;  3U26 A;  4M9J A;  1D9F A;  4CF5 A;  2LI6 A;  2HHT A;  2ISP A;  4NXZ A;  1N62 A;  2PFO A;  1BGX T;  4DOB A;  2XCA A;  5ALT A;  3H0M B;  2I1Q A;  3PZP A;  5KT7 A;  5L1I A;  5EE9 A;  5AIB A;  2W54 A;  2F8L A;  4UAY A;  4P0P A;  3UM9 A;  3D2S A;  4RQ2 A;  4J9N A;  1ZD5 A;  1ZQV A;  3PX4 A;  4R8U A;  3RJG A;  5JRT A;  3ZDE A;  1L5U A;  5IIM A;  5ALG A;  4YN4 A;  2V4Q A;  3F5E A;  2ZJ8 A;  2LYB A;  4QZB A;  4DQQ A;  2KG5 A;  4I2J A;  2JGA A;  2K8B B;  2KN7 A;  2IOF K;  2KK0 A;  5HHI A;  4J9L A;  2O6K A;  4I2A A;  2WB1 C;  1RPL A;  2EAN A;  3MFI A;  1YZ6 A;  2NRW A;  2IA6 A;  1KSP A;  1CEZ A;  7ICK A;  2JRZ A;  4RQ7 A;  5J0X A;  2WF8 A;  2BCQ A;  2YML A;  4F4W A;  4AYB F;  1SL1 A;  3MBY A;  4FBU A;  4IR9 A;  5KFQ A;  2KJ9 A;  2R8H A;  1NK6 A;  5JUM A;  1MC8 A;  5KFO A;  1NJY A;  3PSI A;  5J2J A;  3WK4 A;  2E5S A;  3RB6 A;  3V6J A;  2DL0 A;  4RUC A;  4DF8 A;  2BCR A;  9ICC A;  1SGG A;  2HOF A;  2BGW A;  4QNL A;  1ZQO A;  4Y2T A;  5ALJ A;  1EXN A;  2G0A A;  3GZF A;  4AP9 A;  2JH1 A;  4JUZ A;  2MA1 A;  1ZQD A;  2DQN B;  2C2E A;  2PKE A;  3QU2 A;  4QW9 A;  3AUO A;  8ICK A;  3RJJ A;  1A77 A;  3AL0 B;  4QWA A;  4B9M A;  9ICG A;  5ALH A;  3L3F X;  2KZ3 A;  4EEK A;  5KG6 A;  4EYI B;  4CRX A;  5J0W A;  1KBU A;  1S76 D;  3SAH A;  3MC1 A;  2KOB A;  3JPQ A;  4BJQ A;  1QQ5 A;  3NVY A;  1KRP A;  5ALF A;  4J03 A;  2YTU A;  2EH9 A;  5DKW A;  1X9S A;  1ZQA A;  5KFE A;  2CXY A;  3K75 D;  3J81 j;  5DBB A;  5DG7 A;  1BPD A;  1QQ7 A;  2GH1 A;  3Q8S B;  4MHV A;  4ZOH C;  4QZD A;  4FO6 A;  4PZN A;  1QLN A;  2OYY A;  3PX0 A;  2BPG A;  2LYH A;  5DG8 A;  2QB0 B;  4P0Q B;  4Z6D A;  1RQN A;  4RZR A;  4PL1 A;  2K8A A;  3PMN A;  4I2B A;  1NJX A;  5J2F A;  3H8J A;  1OUQ A;  1L3U A;  3F5A A;  4A8E A;  4Z6F A;  5KFK A;  1RYR A;  3SV4 A;  3N97 B;  2J6S A;  4DFP A;  4O3N A;  3MGH A;  4YR3 A;  1ZQE A;  2YX8 A;  3EYZ A;  5KFZ A;  3A0H U;  5J29 A;  5J2B A;  3OGU A;  3NS1 A;  2HVI A;  1N5X A;  2XI9 A;  5KG1 A;  5L1J A;  1TVA A;  5KNI A;  5JU5 A;  1TK8 A;  4KLT A;  5KFY A;  3OJU A;  3PW4 A;  5AI5 A;  4YG2 A;  8ICO A;  4DQR A;  4OD0 A;  4OCZ A;  2Y9T A;  1ZQJ A;  2JV3 A;  2N1R A;  4ED7 A;  4DLE A;  9ICL A;  2H3F A;  3A0B U;  9ICF A;  3OTQ A;  4ECQ A;  3BDP A;  5AIC A;  4PGX A;  2ZIW A;  7ICJ A;  4DL6 A;  3UMB A;  5KFD A;  7ICP A;  2RHF A;  3RR8 A;  5ALL A;  2QAR B;  1S0N A;  4RQ6 A;  3AMZ A;  2I9G A;  5HP4 A;  8ICT A;  2HHQ A;  2JZB B;  3KZI U;  1XO1 A;  2YY6 A;  2UVR A;  1KTQ A;  1NK0 A;  2A1A A;  2RP5 A;  2HOI A;  4ECU A;  3Q8K A;  4ICA A;  1SZP A;  4UAS A;  2KD1 A;  2KZM A;  4F3O A;  4YD2 A;  4MFF A;  3AM9 A;  3GU3 A;  3BS7 A;  4ECT A;  3RBD A;  1L3S A;  4M9G A;  3PR5 B;  4M47 A;  1XSN A;  1SXE A;  2I5H A;  4KN7 A;  2G5H B;  3GFK B;  3BZC A;  4DL3 A;  4F50 A;  3M7D A;  2C2D A;  2NV3 A;  1Z00 B;  5EOZ A;  1WYG A;  1RYS A;  2LHT A;  2FPM A;  1B0X A;  5C0Y A;  2AQ0 A;  2E8O A;  1H38 A;  4BGD A;  4CE6 A;  5KT6 A;  1VDV A;  1ZYQ A;  3WKC A;  4DFJ A;  1U4B A;  5ALZ A;  3H0R B;  1KQQ A;  5J2G A;  4GXK A;  1SL0 A;  7ICG A;  3KHR A;  4EEL A;  2CN1 A;  5KFT A;  5DLF A;  2UVV A;  2ZTC A;  3O0F A;  1TK5 A;  4TUR A;  1B4F A;  4DSL A;  4M04 A;  8ICQ A;  5J2K A;  1ZQN A;  2KV2 A;  5EWG A;  5DB9 A;  4O0I A;  4RPY A;  5KFS A;  4QZ8 A;  4F2R A;  3WU2 U;  5KFN A;  4OJ6 A;  3QZ8 A;  4TQS A;  2LM4 A;  4JB3 A;  2VJ4 A;  3QYP A;  4DSE A;  9ICJ A;  2YQE A;  1KEJ A;  3C2K A;  1BNP A;  1ZOL A;  1TAU A;  4I29 A;  3PW7 A;  2Y1I A;  4NWI A;  4FZN A;  3OHB A;  4FE3 A;  5KFM A;  3SAF A;  5AK6 A;  3IP4 B;  3WKB A;  4NLZ A;  1TAQ A;  2J6U A;  5AI8 A;  2UVU A;  4Q8F A;  2K8C B;  4DOC A;  2NYV A;  2ZG6 A;  5CP2 A;  4EEY A;  2E3T A;  2XIC A;  3FYH A;  3M9N B;  3OSN A;  7ICV A;  4EBD A;  3GDX A;  3T5J A;  1ZJM A;  1QSY A;  2HMX A;  4I2G A;  1P7D A;  4F93 B;  2IOH A;  4ECS A;  4EYH B;  5AM0 A;  4DS4 A;  4GXI A;  2FLN A;  2IHM A;  2EAP A;  1URJ A;  9ICS A;  3C21 A;  1KW4 A;  3C28 A;  5KAF U;  8ICN A;  3UQ2 A;  1NK4 A;  4DSK A;  8ICP A;  1TFR A;  2E8M A;  4PGY A;  1LKY B;  1V38 A;  2ZIV A;  9ICP A;  1UA1 A;  1D8Y A;  2KFZ A;  4YCX A;  1FFU A;  1Q3U A;  3BS5 A;  9ICN A;  4UB2 A;  2F44 A;  2WF6 A;  2H3Z A;  4RT3 A;  1NK9 A;  4M9H A;  1GO3 F;  4NJ8 A;  1YT3 A;  2MSN A;  1KLN A;  3BQT A;  1N56 A;  1L8L A;  1N60 A;  3IHQ B;  5EE1 A;  5KFU A;  4QZC A;  8ICA A;  4KN4 A;  3H0L B;  4Z6C A;  1ZQR A;  3KOO A;  5J2C A;  4JV0 A;  4DS5 A;  4IQW A;  4KX5 A;  4PHD A;  3LYS A;  3V6K A;  5JTI A;  4RU9 A;  3T5H A;  5KFR A;  4XUS A;  3M9O B;  4IQT A;  3C5F A;  4KX3 A;  2XY6 A;  1MSW D;  3KBB A;  2NRT A;  2YMP A;  2W8K A;  1T8E A;  3WK5 A;  4JWM A;  3PO5 A;  3F2D A;  4KLG A;  2ODG A;  4J9Q A;  1CRX A;  4RNN A;  4O9M A;  4UB6 U;  4IC9 A;  5EWE A;  2AGP A;  2HW3 A;  2W9C A;  2XGQ A;  1IXR A;  3QUB A;  4B9L A;  3WK9 A;  2AH5 A;  2QB0 A;  4P0Q A;  4DL5 A;  4YMN A;  4ED2 A;  2HHV A;  3KD3 A;  2E1F A;  2E1E A;  2KEY A;  4IQV A;  4DF4 A;  3ED5 A;  3IM1 A;  3BQ1 A;  1LB2 B;  2FMP A;  4XRH A;  2EZY A;  7ICM A;  1QH9 A;  4DCC A;  2FLP A;  3FAH A;  2OM6 A;  3RJI A;  2VKQ A;  5ALM A;  1F44 A;  3VCB A;  8ICZ A;  1S9F A;  3LWM A;  2KMD A;  3M9M B;  5AKY A;  1RYU A;  4MF2 A;  3R9K A;  1F0M A;  3C23 A;  3PW0 A;  3MDC A;  5J0O A;  1DGS A;  1KL9 A;  3TAC B;  2H3I A;  7ICE A;  3HJE A;  3V7L A;  5BPC A;  3UXP A;  5CR0 A;  4DSF A;  3HWT A;  2ZIX B;  8ICM A;  2BQ3 A;  1M6Y A;  2QB1 A;  2HHU A;  2DPJ A;  3V7K A;  3PV8 A;  2K89 A;  7ICF A;  1Z19 A;  1PUZ A;  2GO7 A;  2BPC A;  8ICY A;  2EZX A;  3PR4 A;  2QKQ A;  3RB4 A;  5J2I A;  5IIK A;  2JZB A;  1N61 A;  2DUY A;  4UB1 A;  1LV5 A;  2BPF A;  1ZJN A;  5AKH A;  4EZ6 A;  1DOQ A;  2W7O A;  3ALR A;  2BDU A;  4KLF A;  2LPE A;  1JRO A;  3WKD A;  5AM2 A;  4CF4 A;  3CNH A;  3LDA A;  4CCH A;  3MAB A;  5J0P A;  3EPI A;  2WF5 A;  4PGQ A;  4OJO A;  5CEH A;  2BQR A;  3WK7 A;  4M9N A;  3EZ5 A;  2I6X A;  5CHG A;  4K4I A;  3F2C A;  1O03 A;  4DSJ A;  2K4I A;  3ZDA A;  1NJZ A;  2EDU A;  2PFP A;  1Z00 A;  2HBM A;  5DGB A;  4LZG A;  1FEZ A;  3M1Y A;  1RQL A;  1J2M A;  5AKJ A;  4C7Y A;  2KKP A;  5A0L A;  2BR0 A;  4C0Z A;  2W43 A;  4P4P A;  1ZQQ A;  2JEG A;  3T79 A;  3MFH A;  9ICM A;  2RLT A;  3L5K A;  2WTF A;  1T94 A;  2EAO A;  3NUQ A;  2OCE A;  1UQV A;  8ICJ A;  3RRH A;  3RB3 A;  3E0F A;  2ES6 A;  5IIO A;  4ZH4 A;  1NI3 A;  4KMU A;  5L1M A;  2HVH A;  1ZXI A;  1KDH A;  5ALU A;  2FPL A;  2WB1 F;  3C1Y A;  5KFH A;  3BJY A;  5CRX A;  2OEH A;  2GLE A;  2AU0 A;  4GXJ A;  3JPN A;  5KG2 A;  2PXI A;  1IIP A;  1L8O A;  4QZE A;  8ICC A;  1L3T A;  3NVZ A;  4BXO B;  5KT4 A;  4DL2 A;  2WF7 A;  4I2F A;  3T5L A;  5AKZ A;  2KZZ A;  3ISD A;  3H4B A;  4TQR A;  5J0U A;  3I76 A;  5KT3 A;  1UPH A;  1ARO P;  2G08 A;  4J9K A;  1U48 A;  7ICN A;  2LM1 A;  1PVP A;  5HNK A;  8ICG A;  4NL9 A;  3TFS A;  1QSL A;  3HIL A;  4RQM A;  5ALV A;  2G09 A;  5EWF A;  4RNO A;  2FI1 A;  4B9N A;  4PZO A;  5L9X A;  4JK1 A;  1Z4O A;  4KLD A;  2HBJ A;  1X6I A;  4PL2 A;  3Q8L A;  4Q44 A;  4MFC A;  2W9B B;  1RXV A;  2BCU A;  3EW9 A;  2A1J B;  2OH2 A;  3THV A;  2VA2 A;  1T3Q A;  5GTI U;  4UBB A;  5IIL A;  2F8K A;  1Z1B A;  4K4G A;  5KG7 A;  2JEJ A;  4UAZ A;  8ICX A;  1BPY A;  2F1H A;  1JN3 A;  3G6V A;  3K1R B;  1AQ6 A;  2YB4 A;  4QZA A;  4PHE A;  5CWR A;  4DQP A;  2YN4 A;  5DBA A;  1A6S A;  3NRW A;  4QZ9 A;  5KFB A;  2HBL A;  1OW5 A;  3GIJ A;  5GTH U;  5E79 U;  4M6W B;  3B0X A;  1T7P A;  5AI6 A;  2P66 A;  4TUQ A;  2MU2 A;  3G6Y A;  1X6J A;  1UT5 A;  2ZUD A;  2FJ6 A;  5EE3 A;  1WUD A;  1X9M A;  2ASJ A;  4ECX A;  4KLQ A;  3OSP A;  2F1J A;  3ISB A;  4Q45 A;  4C8L A;  1PZN A;  3RAQ A;  4KLH A;  2IBK A;  3KKA A;  5TZV A;  1XSL A;  5EE0 A;  1ECW A;  4I2I A;  8ICB A;  1TKD A;  5ALY A;  4DL7 A;  5KTQ A;  3GIK A;  2W3R A;  2W9M A;  4O5E A;  3SR6 A;  1SB3 C;  1JMS A;  4O3M A;  5F9N A;  2DWQ A;  4YP3 A;  4QWC A;  5J2A A;  4ELT A;  2XY5 A;  1ZQH A;  4FZM A;  2ALZ A;  2VIX A;  4FBT A;  4J9S A;  1D9D A;  4ECZ A;  4B9S A;  2Y0S C;  1NK7 A;  2YMQ A;  4P0P B;  4YVZ A;  2WAQ C;  5ALX A;  2NRV A;  4PHA A;  4G9B A;  1L6N A;  3HPO A;  3V72 A;  4EX6 A;  2JHD A;  3PW2 A;  7ICT A;  2H3Q A;  4EBC A;  3V6H A;  9ICQ A;  4QWB A;  1S10 A;  4I2E A;  3PML A;  4R63 A;  3PO4 A;  2JEI A;  1SKW A;  4JV1 A;  5CB1 A;  3H8S A;  4KLL A;  2MUT B;  4UB4 A;  1ZQX A;  5III A;  1ZET A;  2D6F C;  3H8M A;  2ZJA A;  4US9 A;  2G06 A;  2ASL A;  1KKX A;  4CF3 A;  4RUA A;  1MN8 A;  3TAD A;  3BQ0 A;  4ECW A;  5CA7 A;  5AKX A;  1HUZ A;  5J0Q A;  2Y9U A;  3KHL A;  4YR0 A;  2EZZ A;  2QLT A;  2Y0S F;  2HDO A;  3KZX A;  2R8G A;  2R8K A;  1KFS A;  3SMV A;  1BPZ A;  2ISO A;  2HCF A;  9ICO A;  3SEN A;  4LVS A;  2W04 A;  2ASD A;  4JMU A;  1RDF A;  4UB8 U;  4HYK A;  1XNS A;  8ICV A;  3ONN A;  1ZQP A;  5ALP A;  4RQ5 A;  3RBE A;  4XQ8 A;  4RNM A;  2ZIX A;  5KL1 B;  2IHN A;  1T3N A;  3QU7 A;  5KG5 A;  4OJP A;  3C2M A;  2WFA A;  4DL4 A;  4OJL A;  3HKZ C;  4EZ9 A;  3K4G A;  1IM4 A;  4OO1 J;  1SV0 A;  5KFP A;  2OHF A;  1RZT A;  2PFQ A;  2Q4T A;  1S5L U;  9ICE A;  5HMM A;  1B43 A;  8ICF A;  5DQI A;  4MEY A;  4BWM A;  3QU4 A;  3RH4 A;  3NAS A;  3T5K A;  4YMM A;  5AM3 A;  4I28 A;  4TUS A;  3H4D A;  5HR7 A;  5AI4 A;  3IN5 A;  1D8B A;  1MQ3 A;  1J97 A;  4DQI A;  3B9J A;  1HJP A;  4UBC A;  5D4B A;  5AK4 A;  3QNM A;  4UAR A;  2DF4 B;  4BUG A;  1V97 A;  2F1I A;  3GII A;  3HKZ F;  4NL9 C;  4KLU A;  4UAV A;  2J6T A;  1IG6 A;  2Y1J A;  4QWD A;  4B9T A;  2W8L A;  1COO A;  4R66 A;  5AK5 A;  3PW5 A;  5KG0 A;  2FE9 A;  2FMQ A;  3C2L A;  2AGQ A;  1WCL A;  1NNL A;  2C2R A;  1JAL A;  3ZD8 A;  5DDM A;  3MDA A;  4B9V A;  3JPP A;  5ALQ A;  3M8R A;  2XY7 A;  5ALE A;  2E8P A;  2RDI A;  3CP8 A;  2HBK A;  4C8O A;  1PK1 B;  4UQG A;  2EQY A;  5D46 A;  5KFJ A;  4EX7 A;  8ICL A;  3OPX A;  2KJ5 A;  3FDS A;  2G07 A;  4C80 A;  1X42 A;  2L5Y A;  5IIN A;  7ICL A;  2JH7 A;  5J0Y A;  4O5C A;  2KHQ A;  5ALI A;  4KLO A;  2KTQ A;  4P4M A;  3HX0 A;  2B0C A;  2V4R A;  3ETR A;  3K1Z A;  4QZF A;  3RJE A;  3QUT A;  2DKZ A;  3AN1 A;  1T4G A;  2W55 A;  2D3D A;  2ZTE A;  4BXO A;  7ICO A;  2ZIW B;  4YMO A;  5DB6 A;  1CI4 A;  1Z1V A;  4ED8 A;  3QE9 Y;  1UCV A;  3MR2 A;  3QU5 A;  1QTM A;  3BQ2 A;  4P2H A;  1ZQ1 C;  3Q8R B;  2HSZ A;  2R8I A;  3IDW A;  3UXO A;  4YFK A;  2A3V A;  2W11 A;  2XVT A;  2FMS A;  4RQ1 A;  3KKA C;  2DKX A;  3SEI A;  4Z6E A;  1HEK A;  7ICR A;  4YXM A;  4LZD A;  1Q3V A;  3RRG A;  2HOQ A;  5KFG A;  7ICH A;  2CPR A;  4R64 A;  4WJ3 B;  5G5H A;  1NJW A;  4ACO A;  1TE2 A;  3BQ7 A;  4UW9 A;  2ZUC A;  5FP0 A;  5T14 A;  4F4K A;  1YZ7 A;  2KKV A;  5DGA A;  8ICU A;  5AKI A;  4J9M A;  4FS2 A;  2AQ4 A;  2A1J A;  4IQU A;  1VLB A;  4ED3 A;  2NO4 A;  4F92 B;  9ICH A;  2B6G A;  1COK A;  1N5W A;  3ICX A;  2BZF A;  4DOA A;  2KIC A;  1DRG A;  2BCV A;  2ZUB A;  3C29 A;  5KFV A;  5HML A;  3I28 A;  4CDG A;  2PMZ C;  3N7S C;  1SXD A;  4F72 A;  4QIW C;  4GIB A;  3M6K A;  3GV5 B;  5AKE A;  1SV4 A;  3UXN A;  3PNC A;  9ICV A;  4USA A;  3TKA A;  2RQ5 A;  4DFM A;  4M6W A;  1S0M A;  5DB7 A;  4ED1 A;  1DK3 A;  2JEF A;  4BWJ A;  5DG9 A;  2K4P A;  3TAD C;  2HHW A;  3BZK A;  4TUP A;  1A0P A;  1ZQZ A;  4UB5 A;  1WCN A;  5AI9 A;  4IL6 U;  4Y2S A;  4F5Q A;  7ICU A;  1V85 A;  1PVR A;  1L7O A;  2YB1 A;  2OWO A;  1SIJ A;  2QAR A;  5HR6 A;  1J2N A;  2EAM A;  5J2E A;  4CGZ A;  4QZI A;  1FO4 A;  9ICB A;  4QIW F;  3WKA A;  5ALK A;  3D6J A;  8ICH A;  4YR2 A;  1KFT A;  4Y2Y A;  3AEV A;  1ZQS A;  5D49 A;  4EBE A;  4GC6 A;  1ZQL A;  3HP6 A;  1UA0 A;  2ZIU B;  2W7P A;  4KLJ A;  2FPK A;  4AYB C;  3N28 A;  4B6J A;  1SKS A;  2AHO B;  4RQ8 A;  2P6R A;  2BQU A;  5AKK A;  2WHE A;  1SV0 C;  3H40 A;  1K1S A;  2KFN A;  3LK9 A;  1MQ2 A;  3M8S A;  4GLX A;  4CNQ A;  4EEN A;  1RG6 A;  2DFL A;  5KAI U;  2KVC A;  5B66 U;  1ZQB A;  1JXL A;  1ZRM A;  5KFA A;  5KFL A;  3HW8 A;  2MUT A;  1D8L A;  4O3O A;  4RQ0 A;  5ALN A;  1SZH A;  1DGJ A;  1N48 A;  4RT2 A;  1ZQW A;  1WG8 A;  2XC9 A;  1BVS A;  3N7R C;  3FM9 A;  4KMO B;  4KLS A;  3AU2 A;  4FZL A;  1IV8 A;  3AQE A;  2ZIV B;  5KFF A;  5KL8 B;  3BS5 B;  4PH5 A;  1C7Y A;  4DEZ A;  3NGD A;  3SAG A;  4DLG A;  3SV3 A;  4I2D A;  4Y2P A;  3LVW A;  5AI0 A;  3LWL A;  4F91 B;  5K4L A;  4BX9 C;  4Y2U A;  4I27 A;  8ICI A;  3UMC A;  3Q8M A;  3RFA A;  3D2Q A;  2KSO B;  4YD1 A;  2R8J A;  3V7J A;  2WF9 A;  2YMM A;  3CRX A;  9ICA A;  2KJ8 A;  1XO0 A;  4NY8 A;  1JI7 A;  4UB3 A;  4F4Y A;  3ZD9 A;  5IIJ A;  3UMG A;  3QZ7 A;  2K60 A;  1NK5 A;  4BDP A;  4U7C A;  4Y2J A;  3H7I A;  3GV7 B;  4DQS A;  2BCS A;  2K4E A;  5AK3 A;  3QXG A;  2BDP A;  2PI5 A;  4MFA A;  5BOL A;  2P6U A;  1UT8 A;  3E58 A;  1SL2 A;  3B0Y A;  3IG5 A;  5J0T A;  2BKE A;  3GV8 B;  2LKY A;  3RJF A;  5DB8 A;  4KTQ A;  1S0O A;  4UAU A;  3EWA A;  1RM6 C;  2KVS A;  3E2E A;  1S77 D;  3TI0 A;  2R18 A;  3G6X A;  1S8O A;  2LMR A;  4RPZ A;  4C4S A;  1C20 A;  4Y2Q A;  3GIL A;  1TK0 A;  4QJF B;  4DSI A;  5L1K A;  2W9C B;  4NLN A;  9ICI A;  1HUO A;  4QWE A;  2XID A;  2P35 A;  4ECV A;  3T3F A;  1ZQY A;  1X9X A;  2VJ5 A;  5ALS A;  3KTQ A;  5F3X B;  3F2B A;  3AQF A;  3QUQ A;  1KFD A;  2KIW A;  1LKY A;  1ED1 A;  5DBC A;  3EPG A;  3PSP A;  3KHG A;  1RXW A;  3DEE A;  3WK6 A;  4ECR A;  3QEB Z;  5HHH A;  4O3P A;  3UQ0 A;  4NLC A;  4Q8E A;  3TAR A;  3JPS A;  4F4X A;  4IRD A;  4RQ4 A;  2G5I B;  4F71 A;  9ICU A;  2F76 X;  1JX4 A;  4C4R A;  1L3V A;  1ZQT A;  4C8M A;  4YXJ A;  1BPB A;  3F53 A;  3MR5 A;  1ZD4 A;  4GFJ A;  1TAM A;  2VAN A;  3Q8Q B;  3SZ2 A;  1PK1 A;  8ICR A;  1U45 A;  4O3Q A;  3TQ1 A;  1FFV A;  2ZJ5 A;  4F4Z A;  5KT5 A;  4RQN A;  2XGP A;  1ZQI A;  9ICR A;  1SWV A;  4DO9 A;  1S97 A;  2C28 A;  1S0V A;  4YQW A;  1OXJ A;  3JPO A;  4I2C A;  1VJ5 A;  2ZXH A;  4ECY A;  1Q46 A;  3NVW A;  3CW2 C;  4O3S A;  2HHX A;  3PSF A;  3TAQ A;  5H2F U;  4NV0 A;  4J9R A;  2HI0 A;  3TAN A;  2AJQ A;  2GOL A;  1A76 A;  5TIS U;  1PK3 A;  3ETL A;  4IRC A;  3S6J A;  4C7Z A;  4C4T A;  5AM1 A;  2AXT U;  1WWV A;  3AU6 A;  3OJS A;  2H3V A;  3VC8 A;  1ZD3 A;  4QZG A;  2KP7 A;  4M9L A;  4DWI A;  4B9U A;  3N7P D;  5KFC A;  2VA8 A;  4FFD A;  4R8U B;  7ICS A;  1X9W A;  4NM2 A;  2NRZ A;  4NLK A;  3ISC A;  4UAT A;  2W03 A;  5J8Y A;  3MGI A;  5AHX A;  2DPI A;  5J0S A;  4FS1 A;  3NRZ A;  4DFD A;  1SWW A;  3N4M B;  3RAX A;  4RQ3 A;  1X66 A;  4HAI A;  5AIA A;  4JWN A;  4J9P A;  3EUB 2;  3QUC A;  1SKR A;  4JV2 A;  2KNJ A;  3RH5 A;  5ALD A;  1U49 A;  1DXS A;  1QQ6 A;  1NK8 A;  2PI4 A;  5KG3 A;  3ZI4 A;  4ELV A;  1QCK A;  2MRL A;  2WAQ F;  4M2Y A;  1PVQ A;  3L4P A;  3SYZ A;  5AM4 A;  5DDY A;  3DDH A;  3ZDD A;  4O3R A;  2DGZ A;  4ED0 A;  3KHH A;  4OJ5 A;  2D8C A;  4IR1 A;  8ICE A;  2E8N A;  4ED6 A;  5AKL A;  3RB0 A;  5ALR A;  5C5J A;  2XCP A;  3OHA A;  2BHN A;  2GWS A;  4KLM A;  2ZXI A;  5J0R A;  3RH6 A;  3IV6 A;  3NTU A;  4E0D A;  4MF8 A;  1ZQG A;  3QEA Z;  4F5N A;  3RF9 A;  1XU4 A;  3Q8P B;  5ALO A;  3IRU A;  1O08 A;  1ZQC A;  2NRX A;  1BNO A;  5DLG A;  3SD7 A;  1X2I A;  1NOM A;  1Z3E B;  5BOM A;  1BPE A;  2B21 A;  1UHU A;  3HRD D;  2ZIU A;  3PY8 A;  1NKB A;  3RTV A;  4F5O A;  5KFW A;  4Y2V A;  3QX7 A;  1TV9 A;  4KLI A;  2Z7J A;  4ELU A;  1K1Q A;  1KN5 A;  3HT3 A;  5DQH A;  2NO5 A;  1MA7 A;  5CJ7 A;  1Z4N A;  9ICK A;  1L7P A;  2AGO A;  1DK2 A;  5B5E U;  5J2D A;  2KE7 A;  1XSP A;  2LBO A;  3TAP A;  1JUD A;  5ALW A;  3MGV A;  4U6P A;  4R65 A;  3GIM A;  4PJ0 U;  2HHS A;  2DBY A;  3C1Z A;  1L7N A;  4M0A A;  3DV9 A;  4K4H A;  1U9L A;  4KLE A;  4F5P A;  8ICW A;  1ZRN A;  4PHP A;  1NKC A;  7ICI A;  5L1L A;  4NM1 A;  4F8R A;  3PST A;  2KHV A;  2H5X A;  3KFU F;  1N63 A;  1NKE A;  2V9W A;  2LYA A;  2CRX A;  2F2A B;  4MEX A;  3UPQ A;  5KFX A;  1XC9 A;  2VA3 A;  4F5R A;  2JMG A;  1NZP A;  2KIV A;  1ZQK A;  2RRD A;  4I2H A;  2FDR A;  3ZDC A;  1X40 A;  1HIW A;  3IG8 A;  2KSO A;  3RR7 A;  3I1Y A;  4F2S A;  2IMW P; 
#chains in the Genus database with same CATH homology
 4PJ0 U;  5TIS U;  5B66 U;  5GTI U;  1S5L U;  2AXT U;  5GTH U;  5E79 U;  3WU2 U;  2DUY A;  4UB6 U;  3KZI U;  5KAF U;  3A0H U;  5B5E U;  3A0B U;  4IL6 U;  4UB8 U;  5H2F U;  5KAI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...