3WU2U

Crystal structure analysis of photosystem ii complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 32
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3wu2U01
5KAIU 3A0BU 2DUYA 5E79U 5H2FU 2AXTU 4PJ0U 5GTHU 1S5LU 4UB8U 5KAFU 5B66U 5GTIU 3WU2U 5B5EU 4IL6U 3KZIU 5TISU 3A0HU 4UB6U
chains in the Genus database with same CATH superfamily
2IBKA 4M9JA 5BPCA 4UBCA 1L3TA 3RJFA 4UB3A 3BZKA 1B43A 4MF8A 3K1ZA 5J0OA 4CE6A 3C1ZA 3IG5A 4NM1A 1Z4OA 1NJWA 5AIBA 5D4BA 1YT3A 2OYYA 1ZQPA 1WWUA 4F2RA 4OJPA 4B9TA 1SZPA 5AK4A 3OHBA 2DFLA 4DQSA 3RJIA 3NVWA 4I2HA 1UQVA 3GV8B 4TURA 3NGDA 2JR5A 4J9RA 3H40A 3B0YA 5JRTA 2DWQA 4JMUA 4KLQA 5AHXA 4J9LA 5J0YA 5EWGA 4NL9A 4F72A 4HAIA 1SXDA 3ALRA 1L7MA 5ALFA 3F53A 3TKAA 4QZFA 4KLUA 5AIAA 7ICTA 5HNKA 4F5NA 1ZJMA 1ZQZA 2LPEA 3PO5A 2WFAA 3H0LB 1A76A 2PI5A 9ICTA 2MRLA 3H8MA 2DBYA 2K4EA 2MAXA 4O0IA 2JEGA 2V9WA 3PZPA 4C4SA 1ZQVA 2ZUDA 4FZMA 4DO9A 8ICCA 4F5OA 8ICUA 4M0AA 3L3FX 3A0BU 4MEXA 1UPHA 1JN3A 1J97A 1BPBA 3C1YA 4R65A 5KFKA 1T3QA 2HOQA 4P0PA 2ALZA 4B9VA 4UW9A 3BS5A 1S0VA 1KRPA 3F2CA 1N48A 2P35A 4QZAA 3PSFA 2ZG6A 2W7OA 2OHFA 1QQ6A 4USAA 2BCQA 2NRWA 4QWEA 1XSNA 1RXWA 3LWMA 1Z1VA 9ICNA 4RPYA 1JALA 3C5GA 4C7YA 3TACB 9ICXA 3OHAA 1MQ3A 1RG6A 3ETLA 2G06A 3RB6A 4OO1J 4DOCA 3SI8A 4ECYA 7ICKA 3ETRA 1V97A 5IIOA 3RR7A 2KJ5A 5ALGA 1L6NA 1JXLA 5KFIA 4F4ZA 1PVPA 3WKBA 3KHRA 1HJPA 2WAQC 7ICJA 4RQ7A 2F44A 9ICQA 2AH5A 2P6UA 5J2GA 4KLDA 1Z00A 3N28A 5KFHA 1D8BA 4EZ6A 1KQQA 1PK1B 5KG2A 2KKPA 4OJ5A 1TAUA 2D3DA 4Q43A 1CUKA 1ZXIA 1ZQFA 5ALLA 4G3IA 4M6WA 4DSEA 4DFJA 1U49A 4UB8U 4KLGA 4F93B 2KHVA 2F1HA 2W7PA 2C2RA 1MN8A 4DLGA 4ZOHC 7ICGA 4JV0A 1QCKA 2ZJ8A 2HOFA 2ZIVB 4NV0A 4PL1A 3MR3A 4QZDA 3WKCA 7ICHA 8ICGA 2KOBA 2BZFA 2OEHA 4DS4A 1TAMA 4A8EA 1Q3VA 4UAYA 4J03A 4ECXA 3MGIA 3CRXA 4QW9A 5TISU 4HYKA 2HI0A 4AP9A 2F77X 2YB1A 3M8RA 1JRPA 2W8LA 4M9GA 4RUAA 3PR5B 3C2MA 8ICIA 3NS1A 3RJGA 3GV5B 3JPSA 2HCFA 1KTQA 5AKGA 3N97B 3D2NA 8ICBA 2AQ4A 4ECTA 2G5HB 4QWDA 2IOHA 4KLEA 2FE9A 5ALWA 5KFAA 4CNQA 4YR3A 5L1JA 7ICMA 3HWTA 4DSKA 4O3PA 1TKDA 2HBMA 2NYVA 2OWOA 2ASLA 7ICSA 4F5PA 1BPYA 4C8NA 5HMLA 3SAGA 1F5SA 4RPXA 3KHGA 5KFYA 4JV2A 2BKEA 2BCVA 3F5EA 2HOIA 3D6JA 3BS7A 5EE3A 2M0NA 4KLFA 3KZXA 3NTUA 4ECRA 2DL0A 1ZOLA 5DDMA 4TUPA 9ICCA 5ALMA 2W3RA 4I2BA 3D2QA 5AI8A 3QU5A 3K4GA 1L8LA 3RRGA 2G5IB 2BHNA 5DLGA 4G9BA 4C7ZA 3H4DA 2UVWA 4I28A 3ICXA 1S8OA 3B9JA 5KG7A 4QIWF 3U26A 4FZLA 3IN5A 3PW2A 3C2KA 4DSIA 4JV1A 4J9QA 4C4RA 1L3SA 2Y9UA 2CN1A 1K1SA 3BQ1A 4Y2TA 4XUSA 1L7OA 5ALDA 2F3NA 3G6XA 4DL5A 4IQUA 5AKKA 3TADA 3JPRA 1SL1A 1F44A 2XIDA 4Q8FA 2HVHA 3T5JA 2W04A 4YR2A 5KG1A 3FDSA 2Q0ZX 3FAHA 3ZD9A 5HMMA 7ICEA 4UAWA 1UA0A 4TUSA 4QW8A 1CEZA 3IM1A 5IIKA 3MR5A 2PXIA 4O3QA 4C8MA 1HUZA 3CP8A 4DQRA 3KD3A 2K89A 3SMVA 4KLLA 2Y9TA 5BOLA 3BJYA 4NLZA 1NJYA 2QARA 3RTVA 1BPXA 2HHSA 5B5EU 5F3XB 2KEYA 3BQTA 5IIJA 4IQWA 5KFQA 2JV3A 3TARA 4MFCA 3KTQA 8ICEA 5KFNA 1L3VA 3QU4A 4RQ5A 5KFUA 4Y2VA 4Y2JA 2VJ4A 5AKEA 9ICUA 3FC4A 5CA7A 2IHNA 1YZ7A 2BCSA 4I2EA 2ISOA 2ZXHA 3NRWA 4BGDA 1NJXA 1DXSA 1NK7A 4Z6FA 1SB3C 2FJ6A 5DG8A 4Y2XA 4UAVA 2E1EA 2AXTU 5AM4A 3WKAA 4ACOA 1QTMA 3HPOA 4J9SA 1FFUA 5KFGA 1QSSA 5G5HA 5EOZA 4NLNA 4KLIA 1PK1A 4F5RA 1ZQMA 3N7SC 3H0RB 1X9SA 1OUQA 2Y1JA 2XY7A 2W55A 5C0YA 5KT7A 5ALZA 2NRXA 1ZQSA 1Z1BA 8ICWA 7ICRA 3VC8A 3SEIA 2ZIVA 3BQ7A 4LZDA 5KTQA 4P4OA 2ZIXB 3HILA 1Q8KA 5AI0A 4ED3A 1V85A 1NKCA 1DRGA 4P2HA 3NVVA 2LYBA 1Z19A 4QZGA 2EZXA 5DKWA 1NJZA 2F1JA 1QQ5A 4UB5A 1FO4A 1NNLA 1SWWA 2AHOB 3H8WA 1GO3F 3M6ZA 5AI5A 4F91B 4BX9C 4F92B 2L5YA 3T79A 1RXVA 1ZQDA 2HHQA 5DG9A 1ZQAA 2ATLA 3M9MB 5JUMA 2V4RA 3AU2A 4LVSA 4F4YA 4GFJA 4NJ8A 1U4BA 1RDFA 2J6TA 2FLPA 2H5XA 4DLEA 3ZDDA 2BGWA 2K4IA 4R64A 2G08A 2ZTCA 9ICJA 4NY8A 4RU9A 3RFAA 2IOFK 4XRHA 3IG8A 3PY8A 1SGGA 4BUGA 4FO6A 2I9GA 4PH5A 4YMMA 4YXJA 1KDHA 4DL7A 1ZRMA 4RQNA 1TK8A 1MQ2A 5ALNA 4B6JA 8ICZA 1QLNA 1N62A 2KZ3A 1LKYA 4O3RA 1ZYQA 4KLSA 3KKAA 4MFAA 8ICSA 5IIIA 2KJ8A 2ZJ5A 1WG8A 5DGBA 2GH1A 3UMGA 3H4BA 2E8MA 1FEZA 1X6IA 2XO7A 2N1RA 2XCAA 4PPXA 4QWCA 1S0MA 4RQ3A 4BWMA 4RNMA 2H3IA 4I2AA 3KOOA 3RJJA 3EYZA 2K8CB 3JPQA 1SV4A 1VLBA 5BOMA 9ICFA 9ICHA 1KKXA 4EBDA 3UQ0A 3ZDEA 4MEYA 2BCRA 2F2AB 2VA8A 3QEBZ 4DFMA 4Z6CA 4QZIA 3TAPA 3K75D 1J2MA 2R8HA 4RT3A 7ICVA 2HBJA 5JTIA 7ICUA 5DQHA 3PW5A 3L4PA 3UXNA 4JUZA 4F4XA 2DKZA 3OPXA 4PZNA 4BWJA 4Y2QA 4J9PA 1T7PA 2I6XA 1A0PA 2AU0A 4US9A 5J8YA 5KT2A 3OJSA 3EUB2 2UVRA 2YB4A 4QZEA 3CW2C 1V9PA 3HKZC 3N7RC 1ZRNA 2WAQF 4MFFA 4F8RA 5J2KA 3CYMA 5J0SA 5F9NA 1DOQA 2Y1IA 2KFNA 4FS1A 3QUTA 1M6YA 1VDVA 1TK5A 5KFXA 3GILA 5AKYA 3C21A 3H0MB 1S0OA 2ZIUB 5KFPA 5DB9A 7ICQA 3ZI4A 2NRTA 5EE0A 4P0QB 1KLNA 1SKSA 1L8OA 4RQ2A 1UA1A 3Q8PB 1Z4NA 4C0ZA 1AQ6A 2C2EA 4IQTA 4UB6U 3HJEA 1X2IA 7ICPA 1Y88A 2GOLA 2AGOA 1RYSA 2YX8A 1SWVA 4CGZA 2F76X 3V7JA 2MUTA 4FBTA 1NZBA 2FPMA 2KE7A 2FMQA 4EZ9A 3QUBA 4QZBA 1NK4A 4Y2PA 1N2XA 8ICMA 3A0HU 4YR0A 2IMWP 5J2IA 2PFNA 2EH9A 2XC9A 1DK2A 2JZBA 3MDCA 3Q8SB 3VCBA 2PKEA 4NLGA 2UVVA 1K1QA 3WK4A 1UT8A 2OXOA 3WKEA 2VANA 4FS2A 2LHTA 4I2IA 2I1QA 9ICSA 3PMLA 2QB0A 1NK8A 9ICWA 5H2FU 2HBKA 5KFOA 4EEKA 2E5SA 4QZCA 4GC6A 4DL2A 2NO4A 5AI4A 2D8CA 1S9FA 3F2DA 1XNSA 4RZRA 2BCUA 1WCNA 3SV3A 1BPZA 4KLOA 3GZFA 2FLLA 3LVWA 4R8UA 1L3UA 4FE3A 1ZQQA 5AKJA 4C8KA 2KIWA 8ICFA 4J9KA 5KFDA 5L1MA 2W03A 4GXKA 5C5JA 4IRKA 4ED2A 2EQYA 1KN5A 3UMCA 4O3MA 3WU2U 1U48A 4KITB 2BPFA 3GDXA 2LKYA 5DG7A 3QUCA 2XY5A 2WF6A 1L5UA 4DQPA 4NWIA 5ALJA 4PHEA 4EYIB 3UPQA 5KFRA 3N4MB 3J81j 5DQIA 1RQLA 3V7LA 5CB1A 5ALHA 1D8YA 4KN4A 5KNIA 3M6KA 5GTHU 4YQWA 1S77D 4YD2A 1Q46A 2KK0A 1SV0C 4DFDA 3KZIU 4LZGA 4Z6DA 5KT3A 3IV6A 2IA6A 2ASDA 1T94A 4ECVA 5TZVA 2R8KA 2BDUA 2C22A 3TFSA 4F50A 4LJXA 2K8AA 2KKVA 2P6RA 1O03A 3MABA 3UM9A 4UB4A 2EAPA 2DUYA 3Q8QB 1Z3EB 3QZ7A 5AKIA 3CNHA 2CXYA 1ZQNA 2DPJA 1ZQGA 2W9CB 2W3SA 2HBLA 2IOFA 8ICHA 2K8BB 4C80A 1WYGA 2YMLA 4I27A 1D9DA 1FIQA 4KX5A 4U7CA 2WB1C 1N5WA 4KLJA 5DB8A 1RQNA 2A1JB 2C28A 4PL2A 1ZQTA 5F9LA 4BXOB 2RRDA 2RP5A 2ZIWB 5J0PA 2HHWA 3PSIA 2KD1A 1Q3UA 2HHTA 1JXEA 3JPOA 3EPGA 1X9XA 3ISBA 4JWMA 4EBEA 3G6VA 2B6GA 5J0XA 5ALIA 3PV8A 4X5VA 1DGJA 5E79U 3GFKB 9ICPA 2ASJA 1S97A 4RQ8A 9ICVA 3GQCA 5AM5A 5KFVA 1BGXT 4DFPA 3TQ1A 7ICIA 3SD7A 9ICGA 8ICLA 3PX6A 1CI4A 5KFJA 4F2SA 5L9XA 2DF4B 4DWIA 2H3VA 5DLFA 2JMGA 3ISDA 2LM1A 1ZQOA 5CJ7A 5HR6A 2G0AA 3OSNA 5DBCA 2WF9A 1C7YA 2ZIUA 1ZQBA 3M8SA 3RAQA 5JU5A 1PVRA 3H7IA 3PW7A 2EAMA 4K4GA 3ISCA 1SZHA 2EANA 4B9LA 3KHLA 2YY6A 2QLTA 5AK6A 5KFTA 4M9NA 5AKHA 4FFDA 2EAOA 5ALQA 7ICNA 2ZTEA 2D6FC 1SKRA 2DGZA 3RH5A 4YN4A 5L1KA 4O3SA 3C29A 5KFLA 4PGYA 5KL1B 1NK0A 3KHHA 2JEFA 2KZMA 1KFDA 1U45A 1S0NA 4RQ6A 3QZ8A 1UT5A 4RUCA 4ECSA 3LYSA 3RRHA 2Y0SC 5AM2A 3PVXA 3TI0A 2HHUA 4PHPA 1UCVA 2WF7A 3ZDAA 1WUDA 4ED6A 4O5KA 3HT3A 4FBUA 2UVUA 3NUQA 4R63A 3T5KA 3GV7B 3FYHA 1J2NA 1TE2A 2H3FA 4F4KA 2HSZA 5KFWA 3PR4A 4RQ1A 3E58A 1TK0A 1COOA 4KTQA 1A6SA 2KSOB 2NRVA 4ECQA 3R9KA 5DQGA 1CRXA 5ALTA 3HP6A 4P0PB 2WTFA 1KEJA 1NZPA 3BS5B 2KMDA 4EENA 4NLBA 2PMZC 2E8NA 4UBBA 2XICA 3UXOA 1ZQIA 1BNOA 4KLTA 3Q8LA 5J0TA 2PI4A 1X6JA 5ALKA 4QWBA 9ICOA 1IV8A 3UMBA 3RBDA 3RH4A 2HW3A 2KN7A 4EBCA 1SL0A 2RQ5A 1RM6C 1ZETA 2XCPA 4F71A 2KVCA 2R18A 5G5GA 1BVSA 2R8GA 5AICA 2F8LA 2KJ9A 2A19A 4O3NA 2AGPA 1N63A 4EX7A 7ICLA 4UAZA 2YMPA 5DDYA 5AK3A 3SYZA 4AYBC 3WK9A 3MDAA 5ALVA 4ELTA 5ALUA 1LB2B 5J29A 3JPTA 2GO7A 4TQRA 9ICRA 1IXRA 3RB0A 5KT4A 2PFQA 4IS7A 4US8A 1IM4A 4I2GA 3PX0A 2VIXA 1VJ5A 1N56A 3QU7A 4IR1A 5KFZA 1MSWD 4M6WB 5EWEA 1TAQA 2JH1A 4O5EA 3DV9A 4OD0A 5KFBA 5KFSA 2BQ3A 2BR0A 5DB7A 4DQQA 1NKEA 3PX4A 5CHGA 3D2SA 2KIVA 5KAIU 5AKXA 1IG6A 3UXPA 3I1YA 2YMQA 9ICAA 2W9CA 4KMUA 1MA7A 4GLXA 4RNNA 3WKDA 1S10A 1T4GA 5J0WA 4DF8A 2FPLA 2H3QA 4IL6U 5AKZA 2W43A 2Q4TA 2VKQA 2KVSA 4JWNA 1KW4A 4YMNA 4QJFB 4BXOA 3L5KA 2BQRA 3PO4A 5ALEA 1NI3A 2ZTDA 1XO1A 4BJQA 2V4QA 4JK1A 3NASA 5ALPA 2W9MA 3V6KA 3LVVA 3QX7A 2F8KA 4K4IA 1TVAA 2K4PA 3N7PD 3JPPA 4IQVA 4B9SA 4CF3A 4YXMA 3RJKA 2I5HA 1U47A 4K4HA 2FMSA 4EYHB 4DSLA 3M7DA 3RB4A 9ICIA 3IDWA 8ICOA 8ICXA 1HIWA 2MSNA 5AI6A 3BQ2A 2EZYA 2W9AA 5K4LA 3QEAZ 4I2CA 3AN1A 1UHUA 4C4TA 4B9MA 4ICAA 4ECUA 4NL9C 8ICQA 4J9OA 3NVZA 2A1AA 2JXJA 1FFVA 2RHFA 5HR7A 4E0DA 2QKQA 2XY6A 1BPEA 2DKXA 4CCHA 4ECWA 3E0FA 2YMMA 2LM4A 1SIJA 5CP2A 5J2EA 4YMOA 3B0XA 2GWSA 5HHHA 3TANA 5IIMA 8ICYA 4TUQA 4PHDA 2OH2A 2RLTA 7ICOA 1KBUA 4M9LA 2H3ZA 4QZ9A 1N5XA 5D49A 1B0XA 3AM9A 4UARA 5IINA 3QU9A 2JEIA 3WK7A 2J6UA 7ICFA 4JB3A 4R66A 2KV2A 3K1RB 5EWFA 1RYUA 1ZQUA 1JI7A 1KFSA 3G6YA 4ED0A 5EE1A 1F0MA 4KLMA 1NK6A 1S76D 1XSLA 1SXEA 3C23A 4P4MA 3BZCA 2A3VA 5KL8B 3IHQB 4RQ4A 8ICAA 3RBEA 5KFFA 1ZD3A 2HVIA 1NKBA 2B0CA 4Q45A 5KT5A 5AKLA 3LWLA 2JH7A 4NLKA 4WJ3B 2OM6A 5KG4A 1TFRA 1ZQXA 2FDRA 2KSOA 3ZD8A 3T5LA 1ZQHA 4EX6A 3LK9A 2KNJA 1LVHA 4M9HA 1X40A 1XC9A 3MR2A 4F3OA 1KFTA 5L1IA 2QARB 5J0QA 4QNLA 4GC7A 3EWAA 3WK8A 2KFZA 2M9NA 4J9NA 2MU2A 2RDJA 1X42A 4DSFA 5KG3A 1ZD5A 3V6JA 3T5HA 2WF8A 1T3NA 3SR6A 5ALRA 4RNOA 2E3TA 1OW5A 2ZIXA 3OTQA 2WB1F 1KL9A 3MFHA 1DGSA 4MF2A 1ZQKA 5DB6A 3C28A 2RDIA 1N60A 1ZQ1C 3LDAA 5J2DA 5CRXA 3QYPA 3NVYA 2LYHA 2LBOA 3SZ2A 2VA2A 3DEEA 3IP4B 4PZOA 4P4PA 4O5CA 4EEYA 2HMXA 4ED1A 8ICNA 1O08A 1XWLA 4MHVA 4DF4A 4M47A 2ZUBA 2KP7A 9ICBA 4DQIA 1ED1A 2DPIA 1WCLA 3PSPA 5B66U 3SQIA 5CR0A 1NOMA 4QZHA 1ZD4A 1D8LA 2O6KA 2BPGA 4ELVA 1HUOA 4IRCA 1TV9A 3SAFA 3PNCA 1SL2A 5J2FA 1PUZA 4DCCA 2HHVA 2XVTA 2KICA 3Q8MA 2NO5A 2OCEA 4YD1A 3M1YA 1WWVA 5KFEA 2C2DA 2NV3A 5ALYA 2LI6A 2KHQA 4YP3A 4PGQA 3RJEA 1ZQWA 1ZQEA 5KAFU 2CPRA 4NLCA 1JX4A 2GLEA 4TQSA 1H38A 3QU2A 4DSJA 4YVZA 3F2BA 4OJLA 3OSPA 4DEZA 4RT2A 2VA3A 5KG6A 2K60A 1SV0A 2KZZA 1BNPA 1BPDA 2MA1A 3RF9A 1L7PA 2Y0SF 1RYRA 4DS5A 2K4HA 8ICRA 4Q8EA 3OGUA 4ED7A 3AUOA 3RH6A 2G09A 4O3OA 4Q44A 1URJA 5ALOA 4KN7A 2J6SA 1IIPA 5DBBA 2FPKA 1RPLA 5KG0A 4DL6A 4UATA 3TADC 4GXIA 5AM3A 3AQEA 5AK5A 1LKYB 1B4FA 2BDPA 2W8KA 1X66A 2P66A 2YTUA 3I76A 1V38A 8ICKA 5T14A 2PMZF 2W9BB 3DDHA 2E1FA 4UAUA 2HDOA 9ICLA 1ECWA 1XO0A 3IRUA 1X9MA 1ZQRA 3RJHA 1XS9D 3UQ2A 1RZTA 2NRZA 2BPCA 3C2LA 1QSLA 4PJ0U 4P0QA 3PMNA 2JHDA 1K5OA 3QE9Y 3ORYA 4I29A 1DK3A 2PFOA 3O0FA 3GIKA 2EDUA 5KG5A 2XI9A 4OJOA 4IR9A 4RQMA 5IILA 4KX3A 4ECZA 1COKA 3ZDBA 1B22A 2ZUCA 5J2BA 5J2CA 2F1IA 2KG5A 1D9FA 4AYBF 5A0LA 2G07A 2FLNA 3MBYA 4OCZA 1XU4A 2LMRA 4DL3A 5KT6A 3ED5A 3I28A 3PW4A 4J9MA 2XGQA 2R8JA 3SAHA 4F4WA 3KBBA 3T3FA 1U9LA 2AGQA 1SKWA 1T8EA 4Y2RA 4U6PA 2VJ5A 3KFUF 2Z7JA 3RB3A 2B21A 3S6JA 4DOAA 3NRZA 4Y2UA 2W11A 2YQEA 3EZ5A 3WK6A 4QZ8A 5HHIA 5AI9A 5J2AA 3M9OB 5CEHA 3OJUA 3EPIA 4PHAA 2R8IA 1X9WA 2FMPA 2JEJA 1OXJA 3AL0B 3TFRA 2MUTB 5KFMA 1QH9A 5ALSA 1P7DA 4C8LA 4RQ0A 2ES6A 3GU3A 3H8SA 8ICPA 4QWAA 1EXNA 1JIHA 4UQGA 2IHMA 4O9MA 3H8JA 3F5AA 4CDGA 3M9NB 2JZBB 4CRXA 4F5QA 1XSPA 1JROA 4UB2A 2ISPA 1A77A 1JUDA 5AM0A 4OJ6A 4QIWC 1ZQLA 5KFCA 3HRDD 3FM9A 1PK3A 2BQUA 4EELA 3GIIA 2WF5A 3PSTA 3EW9A 3MFIA 3RAXA 3AQFA 2WHEA 2ZXIA 2QB1A 2QB0B 4YCXA 5D46A 2ODGA 3QNMA 9ICMA 4I2DA 1ZQYA 5HP4A 1JMSA 8ICVA 4Y2SA 3V72A 1NK9A 4B9NA 2KTQA 2EZZA 4M04A 4UASA 3V7KA 4R8UB 4DFKA 3AU6A 4NM2A 3MGVA 4Z6EA 3HX0A 5L1LA 3PW0A 1C20A 1YZ6A 9ICEA 4KLHA 1L7NA 3HW8A 1Z00B 4M2YA 3E2EA 5J0UA 4ED8A 3AMZA 1N61A 2AQ0A 5EE9A 3HKZF 1LV5A 3QUQA 3MC1A 4IC9A 2FI1A 4PGXA 1AROP 3Q8KA 1MC8A 3JPNA 3ZDCA 5J2HA 4BDPA 3THVA 3KKAC 4CF4A 4XQ8A 5AM1A 5J2JA 1KSPA 5DBAA 4DOBA 4DL4A 3RR8A 4B9UA 1ZD2P 2E8PA 1ZJNA 1NK5A 2XGPA 3V6HA 4GIBA 2PFPA 2AJQA 5DGAA 2JRZA 4FZNA 3AEVA 8ICTA 4CF5A 2ESEA 2W54A 2CRXA 2DQNB 2A1JA 4ELUA 5CWRA 3ONNA 4UB1A 1QSYA 2ZIWA 3C5FA 1PVQA 5J0RA 2HHXA 2LYAA 4YFKA 5ALXA 5GTIU 3GIMA 3TAQA 2JGAA 4KMOB 3QXGA 1QQ7A 3MGHA 4NXZA 4C8OA 2YN4A 3WK5A 4RPZA 9ICKA 1PZNA 3SENA 3GIJA 5J8YC 4GXJA 4I2JA 4YG2A 1ZQJA 3MR6A 2E8OA 1ZQCA 4IRDA 4I2FA 3BQ0A 1S5LU 3SV4A 4Y2YA 2ZJAA 3BDPA 2W9BA 3Q8RB 1HEKA 8ICJA 5FP0A 4XA5A 4ZH4A
chains in the Genus database with same CATH topology
5KAIU 3A0BU 2DUYA 5E79U 5H2FU 2AXTU 4PJ0U 5GTHU 1S5LU 4UB8U 5KAFU 5B66U 5GTIU 3WU2U 5B5EU 4IL6U 3KZIU 5TISU 3A0HU 4UB6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI U;  3A0B U;  2DUY A;  5E79 U;  5H2F U;  2AXT U;  4PJ0 U;  5GTH U;  1S5L U;  4UB8 U;  5KAF U;  5B66 U;  5GTI U;  3WU2 U;  5B5E U;  4IL6 U;  3KZI U;  5TIS U;  3A0H U;  4UB6 U; 
#chains in the Genus database with same CATH topology
 2IBK A;  4M9J A;  5BPC A;  4UBC A;  1L3T A;  3RJF A;  4UB3 A;  3BZK A;  1B43 A;  4MF8 A;  3K1Z A;  5J0O A;  4CE6 A;  3C1Z A;  3IG5 A;  4NM1 A;  1Z4O A;  1NJW A;  5AIB A;  5D4B A;  1YT3 A;  2OYY A;  1ZQP A;  1WWU A;  4F2R A;  4OJP A;  4B9T A;  1SZP A;  5AK4 A;  3OHB A;  2DFL A;  4DQS A;  3RJI A;  3NVW A;  4I2H A;  1UQV A;  3GV8 B;  4TUR A;  3NGD A;  2JR5 A;  4J9R A;  3H40 A;  3B0Y A;  5JRT A;  2DWQ A;  4JMU A;  4KLQ A;  5AHX A;  4J9L A;  5J0Y A;  5EWG A;  4NL9 A;  4F72 A;  4HAI A;  1SXD A;  3ALR A;  1L7M A;  5ALF A;  3F53 A;  3TKA A;  4QZF A;  4KLU A;  5AIA A;  7ICT A;  5HNK A;  4F5N A;  1ZJM A;  1ZQZ A;  2LPE A;  3PO5 A;  2WFA A;  3H0L B;  1A76 A;  2PI5 A;  9ICT A;  2MRL A;  3H8M A;  2DBY A;  2K4E A;  2MAX A;  4O0I A;  2JEG A;  2V9W A;  3PZP A;  4C4S A;  1ZQV A;  2ZUD A;  4FZM A;  4DO9 A;  8ICC A;  4F5O A;  8ICU A;  4M0A A;  3L3F X;  3A0B U;  4MEX A;  1UPH A;  1JN3 A;  1J97 A;  1BPB A;  3C1Y A;  4R65 A;  5KFK A;  1T3Q A;  2HOQ A;  4P0P A;  2ALZ A;  4B9V A;  4UW9 A;  3BS5 A;  1S0V A;  1KRP A;  3F2C A;  1N48 A;  2P35 A;  4QZA A;  3PSF A;  2ZG6 A;  2W7O A;  2OHF A;  1QQ6 A;  4USA A;  2BCQ A;  2NRW A;  4QWE A;  1XSN A;  1RXW A;  3LWM A;  1Z1V A;  9ICN A;  4RPY A;  1JAL A;  3C5G A;  4C7Y A;  3TAC B;  9ICX A;  3OHA A;  1MQ3 A;  1RG6 A;  3ETL A;  2G06 A;  3RB6 A;  4OO1 J;  4DOC A;  3SI8 A;  4ECY A;  7ICK A;  3ETR A;  1V97 A;  5IIO A;  3RR7 A;  2KJ5 A;  5ALG A;  1L6N A;  1JXL A;  5KFI A;  4F4Z A;  1PVP A;  3WKB A;  3KHR A;  1HJP A;  2WAQ C;  7ICJ A;  4RQ7 A;  2F44 A;  9ICQ A;  2AH5 A;  2P6U A;  5J2G A;  4KLD A;  1Z00 A;  3N28 A;  5KFH A;  1D8B A;  4EZ6 A;  1KQQ A;  1PK1 B;  5KG2 A;  2KKP A;  4OJ5 A;  1TAU A;  2D3D A;  4Q43 A;  1CUK A;  1ZXI A;  1ZQF A;  5ALL A;  4G3I A;  4M6W A;  4DSE A;  4DFJ A;  1U49 A;  4UB8 U;  4KLG A;  4F93 B;  2KHV A;  2F1H A;  2W7P A;  2C2R A;  1MN8 A;  4DLG A;  4ZOH C;  7ICG A;  4JV0 A;  1QCK A;  2ZJ8 A;  2HOF A;  2ZIV B;  4NV0 A;  4PL1 A;  3MR3 A;  4QZD A;  3WKC A;  7ICH A;  8ICG A;  2KOB A;  2BZF A;  2OEH A;  4DS4 A;  1TAM A;  4A8E A;  1Q3V A;  4UAY A;  4J03 A;  4ECX A;  3MGI A;  3CRX A;  4QW9 A;  5TIS U;  4HYK A;  2HI0 A;  4AP9 A;  2F77 X;  2YB1 A;  3M8R A;  1JRP A;  2W8L A;  4M9G A;  4RUA A;  3PR5 B;  3C2M A;  8ICI A;  3NS1 A;  3RJG A;  3GV5 B;  3JPS A;  2HCF A;  1KTQ A;  5AKG A;  3N97 B;  3D2N A;  8ICB A;  2AQ4 A;  4ECT A;  2G5H B;  4QWD A;  2IOH A;  4KLE A;  2FE9 A;  5ALW A;  5KFA A;  4CNQ A;  4YR3 A;  5L1J A;  7ICM A;  3HWT A;  4DSK A;  4O3P A;  1TKD A;  2HBM A;  2NYV A;  2OWO A;  2ASL A;  7ICS A;  4F5P A;  1BPY A;  4C8N A;  5HML A;  3SAG A;  1F5S A;  4RPX A;  3KHG A;  5KFY A;  4JV2 A;  2BKE A;  2BCV A;  3F5E A;  2HOI A;  3D6J A;  3BS7 A;  5EE3 A;  2M0N A;  4KLF A;  3KZX A;  3NTU A;  4ECR A;  2DL0 A;  1ZOL A;  5DDM A;  4TUP A;  9ICC A;  5ALM A;  2W3R A;  4I2B A;  3D2Q A;  5AI8 A;  3QU5 A;  3K4G A;  1L8L A;  3RRG A;  2G5I B;  2BHN A;  5DLG A;  4G9B A;  4C7Z A;  3H4D A;  2UVW A;  4I28 A;  3ICX A;  1S8O A;  3B9J A;  5KG7 A;  4QIW F;  3U26 A;  4FZL A;  3IN5 A;  3PW2 A;  3C2K A;  4DSI A;  4JV1 A;  4J9Q A;  4C4R A;  1L3S A;  2Y9U A;  2CN1 A;  1K1S A;  3BQ1 A;  4Y2T A;  4XUS A;  1L7O A;  5ALD A;  2F3N A;  3G6X A;  4DL5 A;  4IQU A;  5AKK A;  3TAD A;  3JPR A;  1SL1 A;  1F44 A;  2XID A;  4Q8F A;  2HVH A;  3T5J A;  2W04 A;  4YR2 A;  5KG1 A;  3FDS A;  2Q0Z X;  3FAH A;  3ZD9 A;  5HMM A;  7ICE A;  4UAW A;  1UA0 A;  4TUS A;  4QW8 A;  1CEZ A;  3IM1 A;  5IIK A;  3MR5 A;  2PXI A;  4O3Q A;  4C8M A;  1HUZ A;  3CP8 A;  4DQR A;  3KD3 A;  2K89 A;  3SMV A;  4KLL A;  2Y9T A;  5BOL A;  3BJY A;  4NLZ A;  1NJY A;  2QAR A;  3RTV A;  1BPX A;  2HHS A;  5B5E U;  5F3X B;  2KEY A;  3BQT A;  5IIJ A;  4IQW A;  5KFQ A;  2JV3 A;  3TAR A;  4MFC A;  3KTQ A;  8ICE A;  5KFN A;  1L3V A;  3QU4 A;  4RQ5 A;  5KFU A;  4Y2V A;  4Y2J A;  2VJ4 A;  5AKE A;  9ICU A;  3FC4 A;  5CA7 A;  2IHN A;  1YZ7 A;  2BCS A;  4I2E A;  2ISO A;  2ZXH A;  3NRW A;  4BGD A;  1NJX A;  1DXS A;  1NK7 A;  4Z6F A;  1SB3 C;  2FJ6 A;  5DG8 A;  4Y2X A;  4UAV A;  2E1E A;  2AXT U;  5AM4 A;  3WKA A;  4ACO A;  1QTM A;  3HPO A;  4J9S A;  1FFU A;  5KFG A;  1QSS A;  5G5H A;  5EOZ A;  4NLN A;  4KLI A;  1PK1 A;  4F5R A;  1ZQM A;  3N7S C;  3H0R B;  1X9S A;  1OUQ A;  2Y1J A;  2XY7 A;  2W55 A;  5C0Y A;  5KT7 A;  5ALZ A;  2NRX A;  1ZQS A;  1Z1B A;  8ICW A;  7ICR A;  3VC8 A;  3SEI A;  2ZIV A;  3BQ7 A;  4LZD A;  5KTQ A;  4P4O A;  2ZIX B;  3HIL A;  1Q8K A;  5AI0 A;  4ED3 A;  1V85 A;  1NKC A;  1DRG A;  4P2H A;  3NVV A;  2LYB A;  1Z19 A;  4QZG A;  2EZX A;  5DKW A;  1NJZ A;  2F1J A;  1QQ5 A;  4UB5 A;  1FO4 A;  1NNL A;  1SWW A;  2AHO B;  3H8W A;  1GO3 F;  3M6Z A;  5AI5 A;  4F91 B;  4BX9 C;  4F92 B;  2L5Y A;  3T79 A;  1RXV A;  1ZQD A;  2HHQ A;  5DG9 A;  1ZQA A;  2ATL A;  3M9M B;  5JUM A;  2V4R A;  3AU2 A;  4LVS A;  4F4Y A;  4GFJ A;  4NJ8 A;  1U4B A;  1RDF A;  2J6T A;  2FLP A;  2H5X A;  4DLE A;  3ZDD A;  2BGW A;  2K4I A;  4R64 A;  2G08 A;  2ZTC A;  9ICJ A;  4NY8 A;  4RU9 A;  3RFA A;  2IOF K;  4XRH A;  3IG8 A;  3PY8 A;  1SGG A;  4BUG A;  4FO6 A;  2I9G A;  4PH5 A;  4YMM A;  4YXJ A;  1KDH A;  4DL7 A;  1ZRM A;  4RQN A;  1TK8 A;  1MQ2 A;  5ALN A;  4B6J A;  8ICZ A;  1QLN A;  1N62 A;  2KZ3 A;  1LKY A;  4O3R A;  1ZYQ A;  4KLS A;  3KKA A;  4MFA A;  8ICS A;  5III A;  2KJ8 A;  2ZJ5 A;  1WG8 A;  5DGB A;  2GH1 A;  3UMG A;  3H4B A;  2E8M A;  1FEZ A;  1X6I A;  2XO7 A;  2N1R A;  2XCA A;  4PPX A;  4QWC A;  1S0M A;  4RQ3 A;  4BWM A;  4RNM A;  2H3I A;  4I2A A;  3KOO A;  3RJJ A;  3EYZ A;  2K8C B;  3JPQ A;  1SV4 A;  1VLB A;  5BOM A;  9ICF A;  9ICH A;  1KKX A;  4EBD A;  3UQ0 A;  3ZDE A;  4MEY A;  2BCR A;  2F2A B;  2VA8 A;  3QEB Z;  4DFM A;  4Z6C A;  4QZI A;  3TAP A;  3K75 D;  1J2M A;  2R8H A;  4RT3 A;  7ICV A;  2HBJ A;  5JTI A;  7ICU A;  5DQH A;  3PW5 A;  3L4P A;  3UXN A;  4JUZ A;  4F4X A;  2DKZ A;  3OPX A;  4PZN A;  4BWJ A;  4Y2Q A;  4J9P A;  1T7P A;  2I6X A;  1A0P A;  2AU0 A;  4US9 A;  5J8Y A;  5KT2 A;  3OJS A;  3EUB 2;  2UVR A;  2YB4 A;  4QZE A;  3CW2 C;  1V9P A;  3HKZ C;  3N7R C;  1ZRN A;  2WAQ F;  4MFF A;  4F8R A;  5J2K A;  3CYM A;  5J0S A;  5F9N A;  1DOQ A;  2Y1I A;  2KFN A;  4FS1 A;  3QUT A;  1M6Y A;  1VDV A;  1TK5 A;  5KFX A;  3GIL A;  5AKY A;  3C21 A;  3H0M B;  1S0O A;  2ZIU B;  5KFP A;  5DB9 A;  7ICQ A;  3ZI4 A;  2NRT A;  5EE0 A;  4P0Q B;  1KLN A;  1SKS A;  1L8O A;  4RQ2 A;  1UA1 A;  3Q8P B;  1Z4N A;  4C0Z A;  1AQ6 A;  2C2E A;  4IQT A;  4UB6 U;  3HJE A;  1X2I A;  7ICP A;  1Y88 A;  2GOL A;  2AGO A;  1RYS A;  2YX8 A;  1SWV A;  4CGZ A;  2F76 X;  3V7J A;  2MUT A;  4FBT A;  1NZB A;  2FPM A;  2KE7 A;  2FMQ A;  4EZ9 A;  3QUB A;  4QZB A;  1NK4 A;  4Y2P A;  1N2X A;  8ICM A;  3A0H U;  4YR0 A;  2IMW P;  5J2I A;  2PFN A;  2EH9 A;  2XC9 A;  1DK2 A;  2JZB A;  3MDC A;  3Q8S B;  3VCB A;  2PKE A;  4NLG A;  2UVV A;  1K1Q A;  3WK4 A;  1UT8 A;  2OXO A;  3WKE A;  2VAN A;  4FS2 A;  2LHT A;  4I2I A;  2I1Q A;  9ICS A;  3PML A;  2QB0 A;  1NK8 A;  9ICW A;  5H2F U;  2HBK A;  5KFO A;  4EEK A;  2E5S A;  4QZC A;  4GC6 A;  4DL2 A;  2NO4 A;  5AI4 A;  2D8C A;  1S9F A;  3F2D A;  1XNS A;  4RZR A;  2BCU A;  1WCN A;  3SV3 A;  1BPZ A;  4KLO A;  3GZF A;  2FLL A;  3LVW A;  4R8U A;  1L3U A;  4FE3 A;  1ZQQ A;  5AKJ A;  4C8K A;  2KIW A;  8ICF A;  4J9K A;  5KFD A;  5L1M A;  2W03 A;  4GXK A;  5C5J A;  4IRK A;  4ED2 A;  2EQY A;  1KN5 A;  3UMC A;  4O3M A;  3WU2 U;  1U48 A;  4KIT B;  2BPF A;  3GDX A;  2LKY A;  5DG7 A;  3QUC A;  2XY5 A;  2WF6 A;  1L5U A;  4DQP A;  4NWI A;  5ALJ A;  4PHE A;  4EYI B;  3UPQ A;  5KFR A;  3N4M B;  3J81 j;  5DQI A;  1RQL A;  3V7L A;  5CB1 A;  5ALH A;  1D8Y A;  4KN4 A;  5KNI A;  3M6K A;  5GTH U;  4YQW A;  1S77 D;  4YD2 A;  1Q46 A;  2KK0 A;  1SV0 C;  4DFD A;  3KZI U;  4LZG A;  4Z6D A;  5KT3 A;  3IV6 A;  2IA6 A;  2ASD A;  1T94 A;  4ECV A;  5TZV A;  2R8K A;  2BDU A;  2C22 A;  3TFS A;  4F50 A;  4LJX A;  2K8A A;  2KKV A;  2P6R A;  1O03 A;  3MAB A;  3UM9 A;  4UB4 A;  2EAP A;  2DUY A;  3Q8Q B;  1Z3E B;  3QZ7 A;  5AKI A;  3CNH A;  2CXY A;  1ZQN A;  2DPJ A;  1ZQG A;  2W9C B;  2W3S A;  2HBL A;  2IOF A;  8ICH A;  2K8B B;  4C80 A;  1WYG A;  2YML A;  4I27 A;  1D9D A;  1FIQ A;  4KX5 A;  4U7C A;  2WB1 C;  1N5W A;  4KLJ A;  5DB8 A;  1RQN A;  2A1J B;  2C28 A;  4PL2 A;  1ZQT A;  5F9L A;  4BXO B;  2RRD A;  2RP5 A;  2ZIW B;  5J0P A;  2HHW A;  3PSI A;  2KD1 A;  1Q3U A;  2HHT A;  1JXE A;  3JPO A;  3EPG A;  1X9X A;  3ISB A;  4JWM A;  4EBE A;  3G6V A;  2B6G A;  5J0X A;  5ALI A;  3PV8 A;  4X5V A;  1DGJ A;  5E79 U;  3GFK B;  9ICP A;  2ASJ A;  1S97 A;  4RQ8 A;  9ICV A;  3GQC A;  5AM5 A;  5KFV A;  1BGX T;  4DFP A;  3TQ1 A;  7ICI A;  3SD7 A;  9ICG A;  8ICL A;  3PX6 A;  1CI4 A;  5KFJ A;  4F2S A;  5L9X A;  2DF4 B;  4DWI A;  2H3V A;  5DLF A;  2JMG A;  3ISD A;  2LM1 A;  1ZQO A;  5CJ7 A;  5HR6 A;  2G0A A;  3OSN A;  5DBC A;  2WF9 A;  1C7Y A;  2ZIU A;  1ZQB A;  3M8S A;  3RAQ A;  5JU5 A;  1PVR A;  3H7I A;  3PW7 A;  2EAM A;  4K4G A;  3ISC A;  1SZH A;  2EAN A;  4B9L A;  3KHL A;  2YY6 A;  2QLT A;  5AK6 A;  5KFT A;  4M9N A;  5AKH A;  4FFD A;  2EAO A;  5ALQ A;  7ICN A;  2ZTE A;  2D6F C;  1SKR A;  2DGZ A;  3RH5 A;  4YN4 A;  5L1K A;  4O3S A;  3C29 A;  5KFL A;  4PGY A;  5KL1 B;  1NK0 A;  3KHH A;  2JEF A;  2KZM A;  1KFD A;  1U45 A;  1S0N A;  4RQ6 A;  3QZ8 A;  1UT5 A;  4RUC A;  4ECS A;  3LYS A;  3RRH A;  2Y0S C;  5AM2 A;  3PVX A;  3TI0 A;  2HHU A;  4PHP A;  1UCV A;  2WF7 A;  3ZDA A;  1WUD A;  4ED6 A;  4O5K A;  3HT3 A;  4FBU A;  2UVU A;  3NUQ A;  4R63 A;  3T5K A;  3GV7 B;  3FYH A;  1J2N A;  1TE2 A;  2H3F A;  4F4K A;  2HSZ A;  5KFW A;  3PR4 A;  4RQ1 A;  3E58 A;  1TK0 A;  1COO A;  4KTQ A;  1A6S A;  2KSO B;  2NRV A;  4ECQ A;  3R9K A;  5DQG A;  1CRX A;  5ALT A;  3HP6 A;  4P0P B;  2WTF A;  1KEJ A;  1NZP A;  3BS5 B;  2KMD A;  4EEN A;  4NLB A;  2PMZ C;  2E8N A;  4UBB A;  2XIC A;  3UXO A;  1ZQI A;  1BNO A;  4KLT A;  3Q8L A;  5J0T A;  2PI4 A;  1X6J A;  5ALK A;  4QWB A;  9ICO A;  1IV8 A;  3UMB A;  3RBD A;  3RH4 A;  2HW3 A;  2KN7 A;  4EBC A;  1SL0 A;  2RQ5 A;  1RM6 C;  1ZET A;  2XCP A;  4F71 A;  2KVC A;  2R18 A;  5G5G A;  1BVS A;  2R8G A;  5AIC A;  2F8L A;  2KJ9 A;  2A19 A;  4O3N A;  2AGP A;  1N63 A;  4EX7 A;  7ICL A;  4UAZ A;  2YMP A;  5DDY A;  5AK3 A;  3SYZ A;  4AYB C;  3WK9 A;  3MDA A;  5ALV A;  4ELT A;  5ALU A;  1LB2 B;  5J29 A;  3JPT A;  2GO7 A;  4TQR A;  9ICR A;  1IXR A;  3RB0 A;  5KT4 A;  2PFQ A;  4IS7 A;  4US8 A;  1IM4 A;  4I2G A;  3PX0 A;  2VIX A;  1VJ5 A;  1N56 A;  3QU7 A;  4IR1 A;  5KFZ A;  1MSW D;  4M6W B;  5EWE A;  1TAQ A;  2JH1 A;  4O5E A;  3DV9 A;  4OD0 A;  5KFB A;  5KFS A;  2BQ3 A;  2BR0 A;  5DB7 A;  4DQQ A;  1NKE A;  3PX4 A;  5CHG A;  3D2S A;  2KIV A;  5KAI U;  5AKX A;  1IG6 A;  3UXP A;  3I1Y A;  2YMQ A;  9ICA A;  2W9C A;  4KMU A;  1MA7 A;  4GLX A;  4RNN A;  3WKD A;  1S10 A;  1T4G A;  5J0W A;  4DF8 A;  2FPL A;  2H3Q A;  4IL6 U;  5AKZ A;  2W43 A;  2Q4T A;  2VKQ A;  2KVS A;  4JWN A;  1KW4 A;  4YMN A;  4QJF B;  4BXO A;  3L5K A;  2BQR A;  3PO4 A;  5ALE A;  1NI3 A;  2ZTD A;  1XO1 A;  4BJQ A;  2V4Q A;  4JK1 A;  3NAS A;  5ALP A;  2W9M A;  3V6K A;  3LVV A;  3QX7 A;  2F8K A;  4K4I A;  1TVA A;  2K4P A;  3N7P D;  3JPP A;  4IQV A;  4B9S A;  4CF3 A;  4YXM A;  3RJK A;  2I5H A;  1U47 A;  4K4H A;  2FMS A;  4EYH B;  4DSL A;  3M7D A;  3RB4 A;  9ICI A;  3IDW A;  8ICO A;  8ICX A;  1HIW A;  2MSN A;  5AI6 A;  3BQ2 A;  2EZY A;  2W9A A;  5K4L A;  3QEA Z;  4I2C A;  3AN1 A;  1UHU A;  4C4T A;  4B9M A;  4ICA A;  4ECU A;  4NL9 C;  8ICQ A;  4J9O A;  3NVZ A;  2A1A A;  2JXJ A;  1FFV A;  2RHF A;  5HR7 A;  4E0D A;  2QKQ A;  2XY6 A;  1BPE A;  2DKX A;  4CCH A;  4ECW A;  3E0F A;  2YMM A;  2LM4 A;  1SIJ A;  5CP2 A;  5J2E A;  4YMO A;  3B0X A;  2GWS A;  5HHH A;  3TAN A;  5IIM A;  8ICY A;  4TUQ A;  4PHD A;  2OH2 A;  2RLT A;  7ICO A;  1KBU A;  4M9L A;  2H3Z A;  4QZ9 A;  1N5X A;  5D49 A;  1B0X A;  3AM9 A;  4UAR A;  5IIN A;  3QU9 A;  2JEI A;  3WK7 A;  2J6U A;  7ICF A;  4JB3 A;  4R66 A;  2KV2 A;  3K1R B;  5EWF A;  1RYU A;  1ZQU A;  1JI7 A;  1KFS A;  3G6Y A;  4ED0 A;  5EE1 A;  1F0M A;  4KLM A;  1NK6 A;  1S76 D;  1XSL A;  1SXE A;  3C23 A;  4P4M A;  3BZC A;  2A3V A;  5KL8 B;  3IHQ B;  4RQ4 A;  8ICA A;  3RBE A;  5KFF A;  1ZD3 A;  2HVI A;  1NKB A;  2B0C A;  4Q45 A;  5KT5 A;  5AKL A;  3LWL A;  2JH7 A;  4NLK A;  4WJ3 B;  2OM6 A;  5KG4 A;  1TFR A;  1ZQX A;  2FDR A;  2KSO A;  3ZD8 A;  3T5L A;  1ZQH A;  4EX6 A;  3LK9 A;  2KNJ A;  1LVH A;  4M9H A;  1X40 A;  1XC9 A;  3MR2 A;  4F3O A;  1KFT A;  5L1I A;  2QAR B;  5J0Q A;  4QNL A;  4GC7 A;  3EWA A;  3WK8 A;  2KFZ A;  2M9N A;  4J9N A;  2MU2 A;  2RDJ A;  1X42 A;  4DSF A;  5KG3 A;  1ZD5 A;  3V6J A;  3T5H A;  2WF8 A;  1T3N A;  3SR6 A;  5ALR A;  4RNO A;  2E3T A;  1OW5 A;  2ZIX A;  3OTQ A;  2WB1 F;  1KL9 A;  3MFH A;  1DGS A;  4MF2 A;  1ZQK A;  5DB6 A;  3C28 A;  2RDI A;  1N60 A;  1ZQ1 C;  3LDA A;  5J2D A;  5CRX A;  3QYP A;  3NVY A;  2LYH A;  2LBO A;  3SZ2 A;  2VA2 A;  3DEE A;  3IP4 B;  4PZO A;  4P4P A;  4O5C A;  4EEY A;  2HMX A;  4ED1 A;  8ICN A;  1O08 A;  1XWL A;  4MHV A;  4DF4 A;  4M47 A;  2ZUB A;  2KP7 A;  9ICB A;  4DQI A;  1ED1 A;  2DPI A;  1WCL A;  3PSP A;  5B66 U;  3SQI A;  5CR0 A;  1NOM A;  4QZH A;  1ZD4 A;  1D8L A;  2O6K A;  2BPG A;  4ELV A;  1HUO A;  4IRC A;  1TV9 A;  3SAF A;  3PNC A;  1SL2 A;  5J2F A;  1PUZ A;  4DCC A;  2HHV A;  2XVT A;  2KIC A;  3Q8M A;  2NO5 A;  2OCE A;  4YD1 A;  3M1Y A;  1WWV A;  5KFE A;  2C2D A;  2NV3 A;  5ALY A;  2LI6 A;  2KHQ A;  4YP3 A;  4PGQ A;  3RJE A;  1ZQW A;  1ZQE A;  5KAF U;  2CPR A;  4NLC A;  1JX4 A;  2GLE A;  4TQS A;  1H38 A;  3QU2 A;  4DSJ A;  4YVZ A;  3F2B A;  4OJL A;  3OSP A;  4DEZ A;  4RT2 A;  2VA3 A;  5KG6 A;  2K60 A;  1SV0 A;  2KZZ A;  1BNP A;  1BPD A;  2MA1 A;  3RF9 A;  1L7P A;  2Y0S F;  1RYR A;  4DS5 A;  2K4H A;  8ICR A;  4Q8E A;  3OGU A;  4ED7 A;  3AUO A;  3RH6 A;  2G09 A;  4O3O A;  4Q44 A;  1URJ A;  5ALO A;  4KN7 A;  2J6S A;  1IIP A;  5DBB A;  2FPK A;  1RPL A;  5KG0 A;  4DL6 A;  4UAT A;  3TAD C;  4GXI A;  5AM3 A;  3AQE A;  5AK5 A;  1LKY B;  1B4F A;  2BDP A;  2W8K A;  1X66 A;  2P66 A;  2YTU A;  3I76 A;  1V38 A;  8ICK A;  5T14 A;  2PMZ F;  2W9B B;  3DDH A;  2E1F A;  4UAU A;  2HDO A;  9ICL A;  1ECW A;  1XO0 A;  3IRU A;  1X9M A;  1ZQR A;  3RJH A;  1XS9 D;  3UQ2 A;  1RZT A;  2NRZ A;  2BPC A;  3C2L A;  1QSL A;  4PJ0 U;  4P0Q A;  3PMN A;  2JHD A;  1K5O A;  3QE9 Y;  3ORY A;  4I29 A;  1DK3 A;  2PFO A;  3O0F A;  3GIK A;  2EDU A;  5KG5 A;  2XI9 A;  4OJO A;  4IR9 A;  4RQM A;  5IIL A;  4KX3 A;  4ECZ A;  1COK A;  3ZDB A;  1B22 A;  2ZUC A;  5J2B A;  5J2C A;  2F1I A;  2KG5 A;  1D9F A;  4AYB F;  5A0L A;  2G07 A;  2FLN A;  3MBY A;  4OCZ A;  1XU4 A;  2LMR A;  4DL3 A;  5KT6 A;  3ED5 A;  3I28 A;  3PW4 A;  4J9M A;  2XGQ A;  2R8J A;  3SAH A;  4F4W A;  3KBB A;  3T3F A;  1U9L A;  2AGQ A;  1SKW A;  1T8E A;  4Y2R A;  4U6P A;  2VJ5 A;  3KFU F;  2Z7J A;  3RB3 A;  2B21 A;  3S6J A;  4DOA A;  3NRZ A;  4Y2U A;  2W11 A;  2YQE A;  3EZ5 A;  3WK6 A;  4QZ8 A;  5HHI A;  5AI9 A;  5J2A A;  3M9O B;  5CEH A;  3OJU A;  3EPI A;  4PHA A;  2R8I A;  1X9W A;  2FMP A;  2JEJ A;  1OXJ A;  3AL0 B;  3TFR A;  2MUT B;  5KFM A;  1QH9 A;  5ALS A;  1P7D A;  4C8L A;  4RQ0 A;  2ES6 A;  3GU3 A;  3H8S A;  8ICP A;  4QWA A;  1EXN A;  1JIH A;  4UQG A;  2IHM A;  4O9M A;  3H8J A;  3F5A A;  4CDG A;  3M9N B;  2JZB B;  4CRX A;  4F5Q A;  1XSP A;  1JRO A;  4UB2 A;  2ISP A;  1A77 A;  1JUD A;  5AM0 A;  4OJ6 A;  4QIW C;  1ZQL A;  5KFC A;  3HRD D;  3FM9 A;  1PK3 A;  2BQU A;  4EEL A;  3GII A;  2WF5 A;  3PST A;  3EW9 A;  3MFI A;  3RAX A;  3AQF A;  2WHE A;  2ZXI A;  2QB1 A;  2QB0 B;  4YCX A;  5D46 A;  2ODG A;  3QNM A;  9ICM A;  4I2D A;  1ZQY A;  5HP4 A;  1JMS A;  8ICV A;  4Y2S A;  3V72 A;  1NK9 A;  4B9N A;  2KTQ A;  2EZZ A;  4M04 A;  4UAS A;  3V7K A;  4R8U B;  4DFK A;  3AU6 A;  4NM2 A;  3MGV A;  4Z6E A;  3HX0 A;  5L1L A;  3PW0 A;  1C20 A;  1YZ6 A;  9ICE A;  4KLH A;  1L7N A;  3HW8 A;  1Z00 B;  4M2Y A;  3E2E A;  5J0U A;  4ED8 A;  3AMZ A;  1N61 A;  2AQ0 A;  5EE9 A;  3HKZ F;  1LV5 A;  3QUQ A;  3MC1 A;  4IC9 A;  2FI1 A;  4PGX A;  1ARO P;  3Q8K A;  1MC8 A;  3JPN A;  3ZDC A;  5J2H A;  4BDP A;  3THV A;  3KKA C;  4CF4 A;  4XQ8 A;  5AM1 A;  5J2J A;  1KSP A;  5DBA A;  4DOB A;  4DL4 A;  3RR8 A;  4B9U A;  1ZD2 P;  2E8P A;  1ZJN A;  1NK5 A;  2XGP A;  3V6H A;  4GIB A;  2PFP A;  2AJQ A;  5DGA A;  2JRZ A;  4FZN A;  3AEV A;  8ICT A;  4CF5 A;  2ESE A;  2W54 A;  2CRX A;  2DQN B;  2A1J A;  4ELU A;  5CWR A;  3ONN A;  4UB1 A;  1QSY A;  2ZIW A;  3C5F A;  1PVQ A;  5J0R A;  2HHX A;  2LYA A;  4YFK A;  5ALX A;  5GTI U;  3GIM A;  3TAQ A;  2JGA A;  4KMO B;  3QXG A;  1QQ7 A;  3MGH A;  4NXZ A;  4C8O A;  2YN4 A;  3WK5 A;  4RPZ A;  9ICK A;  1PZN A;  3SEN A;  3GIJ A;  5J8Y C;  4GXJ A;  4I2J A;  4YG2 A;  1ZQJ A;  3MR6 A;  2E8O A;  1ZQC A;  4IRD A;  4I2F A;  3BQ0 A;  1S5L U;  3SV4 A;  4Y2Y A;  2ZJA A;  3BDP A;  2W9B A;  3Q8R B;  1HEK A;  8ICJ A;  5FP0 A;  4XA5 A;  4ZH4 A; 
#chains in the Genus database with same CATH homology
 5KAI U;  3A0B U;  2DUY A;  5E79 U;  5H2F U;  2AXT U;  4PJ0 U;  5GTH U;  1S5L U;  4UB8 U;  5KAF U;  5B66 U;  5GTI U;  3WU2 U;  5B5E U;  4IL6 U;  3KZI U;  5TIS U;  3A0H U;  4UB6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...