1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
2D0AA 5L1IA 1ZJMA 3VQ5A 3ZT3A 3F9KA 2D5RA 1FKPA 3OYBA 4C8KA 4GXIA 4PHAA 7ICMA 4ZTFA 3SZ2A 1ZQMA 3L3UA 2BGWA 3C95A 3Q8PB 3GIIA 4YR0A 3V9XA 4KB0A 5KFKA 4LSNA 9ICJA 2GBZA 8ICBA 3QE9Y 7ICNA 5HROA 2PYJA 3KKSA 3AVFA 2PFOA 4X5VA 2R7YA 5J2JA 3TFSA 4IQVA 3A2FA 3AVCA 1TKTA 3QZ8A 3M9OB 4FM0A 1T7PA 2I1QA 1WNSA 8ICGA 4FJIA 4RNNA 2ASLA 4Q44A 1KSPA 5D3GA 4ZTJA 1S6QA 1L3TA 1H38A 2HVHA 1B43A 2C2DA 3ETLA 3TARA 3NBPA 3HXMA 3V7JA 4M3ZA 4FW1A 4DSJA 3ZSXA 1D8LA 3NTUA 4KTQA 3NGDA 1KLNA 4M47A 4M3XA 5SWMA 1YTUA 1ASUA 3P1GA 3PUFA 3RJJA 1QQCA 4PH5A 1BQMA 4CGFA 5EWGA 2ZJ5A 1EX4A 1MU2A 5CZ2A 3C1YA 5SZTA 4TUPA 2HNDA 4KFBA 3OYMA 3C6TA 4R8UA 1NK5A 1LB2B 4EZ6A 3AVIA 4DQSA 4NCBA 2I5JA 4DL2A 1ASVA 2AGOA 1IG9A 4M3YA 4I2CA 4CE9A 3AA4A 1XSLA 4FLWA 4DTMA 4W5OA 3SUNA 4DSEA 4CJ5A 2PZSA 3K75D 1Z26A 4IQUA 3M9MB 4H4OA 2YHBA 4DWIA 3TANA 1SKWA 1IKVA 3N4MB 3NF9A 2WONA 2FBTA 3PV8A 2HMIA 1RT3A 5J2EA 3L2WA 5J2NA 4KLQA 1ZQXA 3HWTA 9ICTA 1RT5A 1RPLA 4O0JA 4EYIB 4CJUA 3AO2A 5IINA 3KK2A 3KKRA 4RT2A 4TUSA 4F93B 1RBVA 2W8LA 2NRZA 4EP4A 4RQ8A 4M42A 4FJHA 9ICIA 2P1JA 2Y1IA 3FDSA 3JPTA 3JPSA 3Q8RB 3KK1A 4AHVA 3VA0A 3C5GA 1YTAA 4PPXA 1G15A 1TV9A 1RT2A 4CJLA 4FZYA 4QZHA 4NCAA 2NRWA 1LWCA 5FDLA 1FXXA 4OVLA 2ZQBA 2XCAA 5DQHA 4NM1A 4CGJA 3GQCA 4CK1A 1S97A 3RB3A 3LZIA 5KFFA 4PHDA 3LPUA 1VRTA 1RDBA 3MR5A 4ED7A 2FMSA 3VQ6A 4KPYA 8ICWA 1K6YA 3K57A 4YD1A 1KRPA 4C8MA 1XI1A 3IRXA 4J9OA 1BGXT 5DLFA 4CERA 1RBTA 3FFIA 4QAGA 4I9LA 5L1LA 5KFPA 5DG7A 4DTPA 4TQSA 3RMAA 3U6FA 3NHGA 3S3NA 3DLKA 4OJRA 4I2IA 4FJ5A 3HM9A 5D49A 3JPRA 3LP2A 3PO4A 1EXQA 3NGYA 2W9CA 3EY1A 5BPCA 2RDJA 4KLFA 4B9VA 1WCNA 3VQAA 1HYZA 1LW0A 1A5WA 1RBUA 3LAKA 2G8VA 4BXOB 3RRHA 3T5LA 4JS5A 2IOCA 1NK8A 1RXVA 3ZSVA 1N6QA 3DLHA 4OPJA 1FKOA 5HBMA 4NYFA 5J0WA 3TAQA 1HQEA 3EPGA 4HUEA 4CF1A 1SUQA 4Y1CA 4YFUA 1TKXA 4J2BA 1C0TA 2GUIA 5J2BA 4DL7A 1S1UA 2KZMA 3RJKA 4FZXC 1ZBFA 4KLTA 5KGXA 4W5RA 1EKEA 1W0HA 5KGWA 4B3OA 5DBBA 1ZQJA 8ICFA 1O1WA 4DTOA 3CM5A 4FM2A 3RMBA 5HP1A 3LK9A 2G8KA 4F8RA 4CGHA 2P5OA 1ZQZA 4YD2A 4PGXA 3AU6A 3SUPA 3TR8A 4CECA 5KI6A 4FCYA 4CJ3A 4DS5A 1TAQA 5KT6A 1HPZA 5KT7A 5KFSA 3OYKA 1ZBUA 4UAYA 1XO1A 1L3SA 4LH4A 3M8PA 2DPIA 2R8KA 8ICIA 1VSIA 3BGRA 3CQ8A 4QOZB 3B0YA 1BCMA 4ECVA 4LVSA 4J9KA 1UT5A 1BPYA 3JPPA 1L3UA 3V7LA 3GIJA 4I2JA 2YKMA 3RAXA 3H08A 2ALZA 3MFHA 3OJUA 1EXNA 1HUZA 9ICQA 1NK9A 4ECZA 4M9GA 2FLLA 4O5KA 4ECQA 4GW6A 4CF0A 5J2CA 4AHUA 4ECYA 9ICEA 4XA5A 2HNYA 4I2DA 4NCGA 3WNGA 4M6WA 1WSIA 3MDCA 4K4GA 4ZH4A 3V1OA 1NJWA 2FMPA 1BPXA 4F5NA 3D45A 5KRSA 2BANA 5C42A 3O3FA 4LY7A 4I29A 4MFBA 2FPLA 9ICUA 1S0VA 2HHWA 2IA6A 9ICOA 1D8YA 4FS1A 1Q9XA 3AVKA 4KKOA 3OYFA 3RMDA 2BQUA 2KZ3A 2PYLA 2ZUDA 3GIMA 4KLUA 2WTFA 4XUSA 3MXIA 2KQ2A 3K5MA 2IAJA 3KIOA 1L3VA 1JX4A 4HCCA 4DLGA 4K8XA 4TQRA 3VQDA 4EYHB 3S3OA 3OYGA 3DYAA 1K1QA 1JLEA 1S9EA 1X9MA 3HSTB 4HCBA 4CEQA 2P66A 3AO3A 4HHTA 2YKNA 3PX0A 2UVRA 1FK9A 1XSNA 4CEFA 4I2AA 2DFFA 4YN4A 2P5GA 1RTHA 3TAGA 5KFUA 3O3HA 4ELTA 1GOAA 3CFRA 4UB4A 2ZJ8A 3K59A 3ZDBA 4DFMA 5KG0A 1LV5A 1JL2A 2XGPA 1S0NA 3HYFA 7ICLA 1NK4A 7ICTA 1PZNA 2BQRA 3Q8SB 3NE6A 1U4BA 2LYHA 3OJSA 4O0IA 8ICJA 1L5UA 4M9NA 4B9MA 2ATQA 4FJMA 4CJPA 3HVTA 2DTUA 1TKZA 4CIGA 1F21A 4R8UB 5DBAA 2A1SA 4ED8A 1ZQWA 2D0CA 2XY8A 4LZGA 1IO2A 4I2FA 3MGHA 1NOMA 3G6VA 3KHLA 4RPZA 7ICKA 3C94A 3B6OA 8ICOA 1JLBA 5KFLA 5EU7A 4OKEA 4F91B 4DL3A 3OYHA 4HVJA 3F73A 3K5NA 5JS1A 4UB3A 2J6TA 4MQ3A 1JIHA 4DF8A 2A1RA 1YVUA 1MQ3A 5KT3A 3QEIA 1HYSA 4F5OA 4E19A 3GV5B 1BPEA 3SQ1A 3DLRA 4E1MA 3TABA 4IDKA 3AVHA 3QEAZ 2A1JA 4DS4A 1ZQRA 4FBTA 4YXJA 4RPXA 2W9BB 4KI4A 4UB2A 3DMJA 3OYCA 3EPIA 3V6HA 4YCXA 7ICGA 4O3QA 3MDAA 4DFKA 4NLZA 3BQ1A 8ICVA 4E89A 3KLHA 3AVNA 4ED2A 1HNIA 1BI4A 3HJFA 4H8KA 4GC7A 4CEDA 3ZSWA 4DTRA 1UA0A 3C6UA 4CEEA 4RQ2A 4KLSA 3WNHA 2ZUCA 3PO5A 3HW8A 3LWLA 2R8IA 1RYSA 3CFOA 5KG4A 2XY5A 2FBVA 5HRRA 3NF6A 4G1QA 4FLXA 5CWRA 3U3GA 5EWFA 3VQ9A 1Y88A 4KHSA 5HHIA 5KT5A 2OPRA 1ZQVA 3KK3A 3AO1A 1NK6A 5T7BA 1DTQA 3HPGA 1C1CA 4Z0UA 1LW2A 4M3TA 9ICBA 4O4GA 4UAWA 3RB4A 4CJFA 2BGGA 5KG5A 4UAZA 1NJYA 7ICRA 4IR1A 5CZ1A 4JV0A 8ICSA 4R64A 9ICFA 1JN3A 3I0RA 3V1QA 2BCQA 2FBYA 4ECUA 3RJFA 1QSLA 3RH4A 4K8ZA 3T19A 2ASDA 5J2HA 2W9CB 4ELVA 4KRFA 3RJHA 3SI6A 5DG8A 2YNHA 3OSNA 4Z4GA 5CHGA 3VN5A 1JLAA 3OVNA 2M9NA 4I2BA 1T8EA 2RPIA 4C8LA 1BL3A 4O5CA 3NFAA 4C8OA 2PFNA 3GV8B 4O3SA 4QWCA 4KHYA 1N5YA 1SL2A 4M2YA 4DOAA 3ULDA 5DQIA 4LZDA 2YNFA 5HRSA 2ZE2A 2E6MA 2I9GA 5IIJA 2C2EA 1BPDA 3G0ZA 5KFXA 2ETJA 5FRMA 2XRIA 5CYQA 1UOCA 3AO5A 3VQCA 4B8CA 3MFIA 4FW2A 1KLMA 3DRSA 2QKKA 4KTWA 4RUAA 1AROP 4FLYA 4LSLA 2BDPA 5HRPA 2O4IA 4DG1A 1QS4A 4KLMA 3SNNA 3HT3A 1BPZA 3DRPA 2VWKA 2W9MA 5DDMA 4KHUA 1ZQKA 2NUBA 3TWHA 1S10A 2X6NA 1NKBA 4KB1A 1I39A 3VQPA 4O3RA 3V1RA 5KT4A 5DB6A 4M41A 4RNMA 1S6PA 3OYIA 3SQ4A 2OPQA 1RDCA 3BQTA 5F9NA 5KFYA 4ED6A 3LWMA 4KLIA 4Q5VA 3P83D 3TQ1A 4DU1A 1XC9A 4P2HA 5J0YA 1RNHA 3UXNA 5J2DA 4IR9A 4J2DA 3Q8QB 1LWEA 4FM1A 2KW4A 3C23A 1ZQOA 4AHSA 1VSMA 3IG1A 4F4WA 3LANA 7ICEA 2BPCA 3OS2A 3SQ2A 3ZDCA 3SI8A 4FK2A 1TAUA 2HW3A 7ICOA 2YNIA 3M8RA 1QLNA 4IRDA 4OKJA 3ZDEA 2MUTA 3HPHA 3QINA 3DM2A 5KRTA 5KG1A 4Z6DA 4CJSA 3MXJA 4CESA 2E6LA 4BGDA 4QZBA 3OSPA 5I3UA 5KG3A 1ZYQA 3WNEA 3NF7A 2IBKA 2Z1IA 3T5JA 1TGOA 3MABA 2JGUA 1TK8A 1Z00A 4DQIA 3TAPA 4CIEA 4DTUA 4M9LA 2C22A 3Q8KA 1C0UA 3NH2A 2IDOA 3DI6A 4ID1A 5IIMA 4KLGA 4F3TA 3HVRA 4NXZA 2F96A 3C21A 1B9FA 4N47A 4Z4EA 3OS0A 5KFNA 2RDIA 9ICLA 4B08A 4F4ZA 4RW7A 4GXKA 4CJKA 1XHXA 4RUCA 1A77A 4UB1A 4DLEA 4RQ0A 4CJVA 2ZUBA 4QZ9A 5JUMA 3RWUA 1XHZA 1IXRA 5IIKA 3H8SA 2P6UA 1SZPA 2AGPA 4DO9A 2R8GA 1CLQA 2FLPA 2HHQA 3GILA 4ID5A 2F1IA 4C8NA 1RT4A 3NF8A 3ALYA 3NGIA 4RQ6A 4R66A 3SUOA 4FS2A 2KN7A 3CM6A 2ATLA 4W5NA 2OYQA 1D9FA 1QHTA 1UAXA 2OWOA 1X1PA 4CF8A 2XY7A 4E7IA 3KD5E 4DL5A 2KFZA 2JZBB 1IKXA 4J9PA 5JS2A 2KZZA 1KVBA 1RDAA 3OYAA 1VSLA 1T03A 1QTMA 4KLOA 1XU4A 1ZQNA 3O4QA 4YG2A 2VANA 3ISNC 4KN7A 4IG0A 4MFCA 3HK2A 5KFCA 5IIOA 3FYHA 3NAEA 1C7YA 3CYMA 4F2RA 4Q8FA 4O44A 1ITGA 1HJPA 4CFAA 4FJ9A 2ISOA 4NY8A 4FJJA 1WAFA 4Z4HA 3OYDA 5J0PA 4BDPA 3I0SA 1RXWA 2A1JB 8ICLA 4CHOA 4Z6CA 5J2GA 1ZQFA 2HHTA 1WN7A 1JLCA 3HL8A 2H5XA 3OGUA 1VRUA 1LAWA 2HHVA 3ZCMA 4KHNA 3MXMA 4J9NA 1UA1A 2YHAA 3U3YA 1IKWA 3AVAA 3IS9A 5KFTA 4CJQA 3I8DA 3V7KA 1ZQCA 2AQ0A 4QZAA 1S0MA 1S77D 4AHTA 4PY5A 2YV0X 3RBDA 3QEPA 4E7HA 3BJYA 4EZ9A 1QSYA 4UBBA 3SCXA 3IM1A 3PMLA 3EWAA 1T05A 2Z1GA 4GMJB 9ICNA 5DG9A 2PFPA 4E0DA 3JSMA 4FJXA 1RBRA 3OS1A 3PW7A 1ZQAA 4CIFA 4B9SA 5CP2A 4Y1DA 4YP3A 4F4XA 4QZEA 2UVVA 1XSPA 4CEAA 7ICSA 3UQ2A 4I2QA 4YMMA 1TVRA 4MEYA 4IKFA 1JLGA 5DDYA 2Y1JA 2AU0A 1C1BA 1C1AA 3PW5A 1TK5A 2OPPA 3EZ5A 3O3GA 4O3PA 3AA5X 3C2MA 4Z6EA 3V72A 5DB7A 4EP5A 4BDYA 4FJKA 2ISPA 5L1KA 5HRNA 4Z4FA 8ICPA 2JLEA 4I28A 1WSEA 4CGIA 1J5OA 3M8SA 2IC3A 3QEVA 1SV5A 1QE1A 4DQQA 4YMNA 3L2QA 3SV4A 3H8WA 3AU2A 1WLJA 1MSWD 1SL1A 4KLDA 4M45A 8ICHA 2BCSA 4BE0A 9ICGA 2IHNA 4ZHRA 1K1SA 3CFPA 4KITB 2FC0A 4B8AB 4CCHA 2JEGA 4IFVA 4ED3A 3ZDDA 1BISA 3PMNA 2KTQA 4CF2A 5L9XA 3NDKA 4RW4A 3K5OA 2FPKA 1RTIA 4I9QA 1VSJA 3Q8MA 5BOMA 5CR0A 5J0QA 1CXUA 3ISBA 1ZQTA 7ICFA 4CFBA 2VA2A 4QZFA 7ICIA 3ISCA 4ECTA 7ICQA 1NKEA 3V6KA 2ASJA 3TAMA 4CFDA 5KTQA 1HQUA 2NRTA 5KG7A 3HP9A 5I42A 2ZTDA 4N56A 3HX0A 1NOZA 5EOZA 3KHRA 4M9JA 4QCLA 3KHGA 3SV3A 3DLEA 4YMOA 4KLJA 4TUQA 2O4GA 3ZT4A 4FK4A 5HNKA 3LP0A 5J0XA 4Q45A 1IM4A 2ZJAA 3AUOA 2VA3A 4BXOA 2XY6A 4DSKA 4CFCA 3BDPA 5EWEA 1ZQIA 3NH0A 1WAJA 3H40A 7ICUA 3QEWA 1ZQBA 2Q0ZX 4W5QA 2GWSA 4AHRA 4UQGA 4I2HA 5C24A 4YFKA 1XWLA 1ZQQA 3TFRA 3PR5B 2PI5A 4FJGA 3SPYA 4FO6A 8ICUA 1ZJNA 1X9SA 3ZSZA 4K4IA 3MECA 2MUTB 4PGQA 5HLFA 3QZ7A 3JPNA 3RJGA 4BE1A 1NK7A 3GFKB 3H8JA 8ICTA 3JPOA 2LSNA 5E41A 1TL3A 1BPBA 3VQ8A 3C5FA 2HHUA 3ZDAA 3QESA 1DOQA 1ZQPA 3OYLA 5DBCA 5K14A 2G8HA 5DB9A 4DL6A 5DGBA 5D46A 4ECXA 5KFEA 4RU9A 3VQBA 1J9AA 4Z4CA 1ASWA 1VSKA 2FBXA 1Z3EB 4IG3A 4J9RA 2IMWP 2IHMA 1DTTA 2BKEA 2J6UA 3B0XA 1C6VA 3UXPA 1CEZA 3KLFA 4UBCA 4QZCA 3N97B 4MF8A 1Z00B 4DEZA 3QLHA 4XRHA 4GC6A 4CF9A 3K4GA 1HMVA 2F8SA 3S9HA 3PW2A 1ZQLA 1MQ2A 3AA3A 1UT8A 4DTJA 4I2GA 2ZTCA 4F4YA 3H7IA 3KTQA 4DU4A 2DFHA 4ELUA 5J0SA 1TVAA 1HRHA 4FJ7A 1U04A 4QW8A 2UVUA 4K4HA 3PVXA 5KFOA 3SUQA 5KFQA 4F2SA 2FPMA 4PGYA 4XIUA 4DTNA 3ZT2A 3P5JA 1XS9D 1S9GA 4FYDA 4QZDA 4MFAA 1KCFA 2PI4A 4IFYA 3L8BA 3QIOA 1JKHA 3LZJA 3LP1A 3ZT0A 4OLBA 4IBNA 4TURA 4DOBA 2BCRA 5J2IA 5C25A 3S3MA 4CK3A 4MF2A 2JEJA 4Q43A 4JV1A 3QERA 5D4BA 3RJEA 1ZQHA 4B9UA 3JPQA 4FLTA 3VQQA 4QZIA 4QW9A 8ICXA 4AILC 4FJNA 4QZ8A 2B4JA 3V6DA 4KMUA 3MEDA 5J2KA 2P51A 1S0OA 3PR4A 1CZ9A 1EP4A 4NLKA 3QIPA 1B92A 9ICPA 3LAMA 2NRXA 3RBEA 2HHSA 3KJVA 4CJEA 4PUOA 1HJRA 5J2MA 5KFJA 1RT7A 1ZQYA 1COOA 2BQ3A 1B9DA 2IGIA 4Z6FA 3L2UA 3EYZA 1BQNA 2E4LA 2F1HA 2Q3SA 4FLZA 8ICYA 4FBUA 4PWDA 2C28A 3TI0A 3MR3A 3JYTA 5KG2A 3T1AA 4E7KA 5KG6A 2V4QA 4KAZA 4KO0A 3RR8A 4QWEA 4CK2A 3RH5A 4DL4A 5DLGA 2FLNA 4CJWA 3DOKA 4GXJA 2Z1JA 1BIUA 2X74A 1RILA 1U9LA 4CEBA 1KFSA 2VG6A 1LWFA 5DQGA 3KLEA 5KFZA 4KN4A 9ICMA 1SKRA 1B22A 4I2PA 1VSDA 4M6WB 5CJ7A 7ICPA 2DY4A 5DK5A 1JXEA 9ICAA 2HVIA 3PX4A 3TAFA 3GIKA 3RTVA 3SYZA 3D0PA 1GOBA 1CXQA 1NOYA 4FLVA 4F5QA 1WSFA 4OLAA 4M3UA 4J9SA 3QO9A 4RW8A 4JV2A 4NM2A 4QZGA 3RRGA 3ZD9A 4F50A 5DGAA 1TKDA 4DQPA 2W9AA 3AV9A 4KI6A 2BPFA 4F5RA 5C5JA 1S1WA 4RG8A 1ZQDA 4PHEA 5IIIA 4DFPA 4J9LA 4R5PA 4JS4A 4CJRA 5CB1A 1KTQA 5F9LA 4RPYA 1RCHA 3DOLA 4HTUA 4M3RA 1R0AA 4NLGA 4F5PA 4I7FA 2W9BA 3IHQB 4J9MA 4CJTA 2NRVA 3C2KA 4KHQA 4E1NA 4PA1A 4O55A 1UWBA 3QNOA 1N56A 2B5JA 4N41A 1A5XA 1JL1A 1YT3A 4BACA 1ZBHA 2BPGA 3V9SA 2X6SA 4P4MA 4AHCA 4E3SA 3RAQA 4J2EA 1A76A 5CY4A 4KTZA 3V9UA 4B9LA 3BQ0A 3MEGA 2D0BA 3O4NA 3PY8A 3RB6A 2BE2A 5J0UA 4W5TA 4DF4A 3OHAA 1HUOA 1TK0A 1ZQSA 3ZSQA 2XO7A 3UQ0A 2XHBA 1Q9YA 5TZVA 4YXMA 3G6YA 5KFRA 4HYKA 1KFDA 1VK0A 2HB5A 3ZSOA 9ICKA 4MFFA 4O5EA 1JXBA 4O3NA 4IQTA 3SJJA 4O3OA 1EETA 4JRPA 1KVCA 1D5AA 5J2PA 4GVMA 3E01A 5IILA 3RB0A 2YNGA 3K2PA 2DFLA 4F4KA 4JLHA 3LALA 5KFWA 2XC9A 2V9WA 2P6RA 4R65A 1N48A 2XCPA 3ORYA 3V81A 5HMMA 4E7LA 1TV6A 3AVLA 3E2EA 4JWMA 4ECSA 4PHPA 3C1ZA 3ITHA 2HNZA 3GV7B 1U45A 5HHHA 3ASMA 1SL0A 5KFDA 4WE1A 3Q8LA 2BCUA 3V4IA 4TSXA 5DB8A 4CEOA 4RT3A 3AVMA 5KFMA 3VQEA 2VG5A 4R63A 3KLGA 1HNVA 1J54A 4RQ3A 1NJXA 4YNQA 1S1TA 3NH1A 5HP4A 3T5KA 4NLNA 1S76D 2JEFA 4RW9A 2X78A 4EBCA 3L2RA 4G3IA 4AH9A 4B9TA 4RQ4A 2RN2A 3QNNA 4RZRA 2XGQA 1WCLA 1S5JA 3M8QA 5KFIA 2BHNA 3ISDA 4DOCA 1NJZA 8ICEA 1SKSA 4QWAA 3V9WA 1U48A 3HPOA 3G10A 2MAXA 5KFBA 3QETA 2VA8A 3MR6A 2ITGA 3AA2A 4CGDA 4FXDA 1BI4B 1A5VA 8ICQA 4FK0A 4EBEA 1S1XA 2R8JA 1ZBIA 3TAEA 1IKYA 4MEXA 4F92B 2ZD1A 2R8HA 4JUZA 4XQ8A 1BIZA 1RTJA 1KVAA 3LPTA 4HUFA 4J9QA 3NGZA 4EEYA 2HHXA 9ICCA 1JLFA 4ED0A 3PW4A 9ICXA 7ICVA 1VSHA 3PX6A 1DLOA 3AVGA 3KHHA 1KEJA 2ZTEA 1TFRA 4H4MA 1RTDA 1NKCA 1Z25A 4KLLA 4Z4IA 2J6SA 4EBDA 4PQUA 9ICRA 4JWNA 2AJQA 4DMNA 3H4BA 5J0RA 1C0MA 4FJ8A 4NYNA 3RMCA 4CHQA 1WSHA 3C2LA 8ICCA 2EX3A 4DU3A 3VQ7A 1WSGA 1RZTA 1BHLA 9ICWA 3AVJA 3ZT1A 3DLBA 4N5SA 4YR3A 4M04A 3M9NB 2G8FA 4IRCA 2B6AA 4JRQA 5L1JA 2RF2A 3THVA 4FZZA 5J2AA 8ICMA 4P4PA 4KLHA 3VA3A 3DLGA 5BOLA 4CHNA 5KT2A 1BCOA 4OPKA 4KHWA 1RT6A 1U49A 3T5HA 3CG7A 1RYRA 4BE2A 3UIQA 5DKWA 2Z1HA 3G6XA 2QKBA 4CHYA 2AGQA 4YR2A 4RQ5A 3WNFA 4RQ1A 4OGCA 4CHPA 1Y97A 2BCVA 4CEZA 4J2AA 3HP6A 1NK0A 1JMSA 8ICRA 3PNCA 2AQ4A 4BDZA 4Q8EA 4P4OA 1REVA 2DFEA 3H4DA 4F3OA 5J2FA 4BWMA 4O9MA 5KFGA 4O5BA 3PW0A 8ICKA 4DSLA 2OPSA 4GLXA 4FLUA 1RT1A 1WSJA 1GOCA 1IH7A 5DMRA 1I3AA 4DFJA 5KFAA 4QWBA 1S1VA 2VWJA 2PY5A 3OHBA 3RH6A 5CYMA 3V9ZA 3GDXA 4FVMA 5FROA 4N76A 3MBYA 2UVWA 4DQRA 3ZD8A 3AVBA 4JK1A 2PXIA 2KFNA 4E7JA 4B9NA 2JEIA 3OYNA 4UB5A 5J29A 1QSSA 4YQWA 2WOMA 4QWDA 3BQ2A 1KFTA 4KREA 1T3NA 4DSFA 2OZSA 2PFQA 4BWJA 3RR7A 3T3FA 5J2QA 2JZBA 5FRNA 1VSEA 2OA8A 4OGEA 3RJIA 5J1EA 3MAQA 1LAVA 9ICVA 1BVSA 1ZQEA 3LDAA 3UPQA 4LH5A 1DGSA 1ZBLA 1W9HA 4I2EA 3HO1A 3LP3A 3DRRA 5CA7A 1Q8IA 2IS3A 2W8KA 2FMQA 3OYJA 3B6PA 2G8WA 2GV9A 2W42A 5J0OA 4DTSA 8ICZA 5KFHA 4RNOA 4I27A 3SQ0A 2B21A 3UXOA 2EHGA 1D9DA 1T4GA 1CZBA 3KLIA 4Q0BA 1CUKA 3SPZA 1MC8A 3QEBZ 2G8UA 1VSFA 8ICAA 1RDDA 1RBSA 4ICLA 3AO4A 4DTXA 4ECRA 9ICHA 3ZSYA 4IRKA 3K58A 1ZQGA 2DPJA 1ZQUA 3KD1E 3MEEA 1JLQA 7ICJA 3ZSRA 1HYVA 5HMLA 1X2IA 4HUGA 2F1JA 4LD0A 2C2RA 4CGGA 2VG7A 2RKIA 3K5LA 4CHZA 4DSIA 4YVZA 3EW9A 4M3WA 4RQ7A 3L3VA 1TL1A 3L2VA 1ZETA 4OKKA 2BR0A 1U47A 1JXLA 2G8IA 4KV8A 3V6JA 3IAYA 3MGIA 2V4RA 3OYEA 4L8RB 3LDSA 1V9PA 4KLEA 8ICNA 5J0TA 1J53A 2QXFA 4RW6A 4CJ4A 3VQ4A 3NCIA 3QEXA 1S9FA 7ICHA 1KDHA 2F8TA 4M9HA 4ECWA 4IQWA 4ED1A 2OZMA 2QK9A 3OY9A 3MR2A 5KFVA 9ICSA 4FJLA 1X9WA 4M0AA
chains in the Genus database with same CATH superfamily
5ALOA 2D0AA 3R9PA 1ZJMA 5GAHI 1XMOJ 2N1RA 1DGJA 3EUNA 3ZT3A 3D0IE 3F9KA 4DV2J 1V3RA 2DT9A 4C8KA 4GXIA 2V4JA 7ICMA 1YQHA 4ZTFA 2ZH5A 3V4IB 3L3UA 5TISU 1K9MO 4LSNA 2VG5B 4IG0B 2O3DA 2ZKUA 8ICBA 2QC3A 2VC1A 2IM3A 3Q0AA 4DUYK 1AXQA 1ELOA 4OJ1A 2R7YA 3CC7S 5J2JA 3W64A 1S7IA 3O9QA 4IQVA 3P6YC 1DK2A 4DXLA 1IQTA 2AJ4A 4RNNA 4FJIA 2AKWB 1FJGJ 3EN9A 3QGIA 1EQ0A 4ZTJA 2HVHA 1H38A 1RADB 4I69A 2IOFK 2XLIA 1VQ8N 1DHMA 5A8KA 3P45B 2BM0A 2C2ZB 4FW1A 2H3QA 3ZSXA 1D8LA 3OFEA 3DHXA 1JCEA 1S1XB 4M47A 1D9AA 1VQ5N 4MYUA 4CRXA 3RJJA 4PH5A 3M2UA 1BQMA 4FYYB 3WQUA 4DR2K 2C3UA 1VQSA 5A8RA 1RUSA 2RILA 5SZTA 2D69A 3RZAA 3J7Z5 2GVDA 1M1KT 1Y3JA 1N5WA 5I3QA 3AVIA 4DQSA 3VZHA 4NLVA 4DJBA 2G2YA 2AGOA 4C11A 1F5BA 2KXFA 4JKDA 3AA4A 3NOGA 4W5OA 3CC4S 4CJ5A 4K4YA 3K75D 4PQUB 1TVRB 2AEMA 1IKVA 4BQLA 2ZJQQ 1VC5A 2KHQA 2ZC4A 1F2HA 1LKZA 1RT3A 1B3TA 5JVGL 3MI7X 3RYLA 1V5VA 1NGFA 3FR0A 2VONA 1VC0A 4ZK7M 3F53A 5JLHA 2GGPA 3WK6A 4EYIB 5EE9A 3KKRA 2DR8A 2MZQA 1PYSB 2W8LA 2NRZA 4NLCA 1N5XA 4JKHA 1GX6A 3PSIA 3DXKB 1UW9A 3L7UA 4H4KC 1M5HA 2DEIA 2IM2A 5AQJA 3VTHA 3MM9B 1X0PA 1G15A 4CJLA 4HDHA 2D1CA 1FDDA 1FXXA 3FCHA 2PIIA 2PMZD 2OM6A 2ZQBA 4NM1A 2NUHA 4KB7A 3GQCA 3HD1A 1XMOF 1S97A 4PZVA 4MK8A 4DV2F 1UVNA 3RB3A 1RTIB 4YOUA 1VRTA 5JLFA 1QVFM 4CZLA 1VDVA 1RT1B 2ZM6J 5HVFA 5BPMA 4QAGA 4I9LA 4C0HA 3DNCA 4DTPA 3AOAA 4C9DA 3RMAA 1Y00A 3NHGA 2OKQA 3DLKA 4IOBA 2HF4A 4FJ5A 2FI1A 3HM9A 5D49A 1X4AA 3OXFA 3OTBA 3PO4A 1LKYA 3MN9A 2CH5A 3NGYA 2MQ8A 2OUGA 3EY1A 2KT2A 1FJGF 3E0FA 4DR6J 4B9VA 1R43A 2MLZA 2G8VA 1BWVA 3CJ7A 1WORA 3QATA 3NCRA 1QQNA 2IOCA 4QS8A 4CF5A 3CETA 4AYBD 4BQZA 2PA8D 2XG8A 3KKAC 4MKBA 2J0QD 3TAQA 2XQCA 3EPGA 1SUQA 4RWWA 1TKXA 3AL0B 3L5KA 2XYPB 5AK5A 4DL7A 2KZMA 3RJKA 5LMNK 3WK8A 4FZXC 1EKEA 5KGWA 5HQMA 4B3OA 3FEZA 1O1WA 5HLFB 3CJ0A 3M6KA 3B8AX 4PG6A 3WHIA 5GADI 3CM5A 3AOBA 3RMBA 3LK9A 2G8KA 3BSOA 3TX8A 5ETMA 1ZQZA 3EE9A 4OHZA 4PGXA 1TFYA 3CDEA 3SUPA 2HGNA 4CECA 3GIRA 5KI6A 3D67A 2YX6A 2ZUGA 4CH7A 1K73T 4DS5A 1TAQA 4IQXA 3R6MA 5KT6A 1HPZA 5KT7A 3MTKA 4TU8A 1NB7A 4LIRA 4UAYA 1KKXA 4UT4A 4J91A 3NOCA 3M8PA 1D1UA 4PXDA 2R8KA 1E6YB 3GJTB 1T9YA 2WB1D 1UFLA 2N4CA 1MMDA 2IIHA 4ITSA 2XI2A 1IBMK 3H98A 2QMWA 1O08A 2BJ8A 3MFHA 1EXNA 3A5LC 1SKUB 4GMKA 1TL1B 2EAMA 4O5KA 4ECQA 4MTPA 3PDNA 4GW6A 3PEHA 4OHWA 4CF0A 4XH1A 4RQNA 2YX8A 1IUJA 2ZJPQ 2Z7JA 1D3WA 4GO7X 2E8NA 4V19J 1WSIA 2IFXA 2YB4A 4K4GA 1NJWA 4M5MA 3S7RA 1B4FA 5MAOA 4FKYA 1S9GB 4Y2UA 1NZBA 5KRSA 4KHMA 3LDPA 4MFBA 6FD1A 2FPLA 9ICUA 4IFYB 3KUHA 1S0VA 3RU0A 2RRDA 2CXYA 3ONNA 5C25B 3D6MB 1YJNN 1FKPB 3HHKA 3N79A 3GIMA 4XUSA 4OI4A 1FEZA 3FMWA 5ALDA 3EICA 2P9PB 5LXRA 3VTIA 1GTHA 4EYHB 4ZVSB 5IC6B 2DD8S 1S9EA 1X9MA 2HWHA 3PKYA 2CQHA 3HSTB 3R1XA 4DR6F 3IM8A 2DFFA 5AQYA 3O6QA 1HNZJ 2CZVC 3HILA 2E1ZA 1YRUA 2FJ6A 3JYTB 2R4FA 4TLRA 4KGKA 4Y0FA 5ALHA 2LYAA 2NXJA 2Z30B 4DFMA 4CT8A 5KG0A 4MIAA 1Z2ZA 3D0GE 4PWUA 1S0NA 1WHYA 2H3EB 5GAGI 3HYFA 2RP5A 3U1NA 1N34J 1U4BA 2WSCC 4A5AA 2LQBA 4QIWD 4O0IA 1XR5A 4BX9C 4C97A 3O9UA 2BXJA 3HVTA 2IYIA 2DQNB 2DTUA 2R7UA 1ZQWA 2DRBA 4BHQA 1JWWA 5KQ8A 2XY8A 4ENOA 7ICKA 4DHYA 2KJWA 2FF6A 3A0BU 3NASA 5EU7A 2RUSA 3A8JA 3H5UA 3W2VA 4HVJA 2VBZA 4H4OB 2KT3A 5IT9U 2J5AA 2K3KA 3L7OA 2JH1A 3R2DJ 3MCAB 1M90T 1YTYA 2A40A 2JVRA 5KT3A 1HYSA 4F5OA 3GV5B 4CZHA 4E1MA 4J90A 4IWVA 3LVVA 3KK2B 2W04A 3M4XA 2L3MA 4YDUA 4LF8K 2DHHA 3DMJA 4NXNK 1ZPVA 2KL8A 3V6HA 4LRCA 2JWKA 4NLZA 4KIAA 2MGZA 2D9PA 2NO5A 3U7JA 3H8MA 4B1ZA 4WF9L 4ED2A 1HNIA 2ZEJA 4H54A 4H8KA 2PE8A 1ZAWA 2W1BA 3N4QA 3ZSWA 3WK4A 4K4WA 3T1YK 4CEEA 5DDPC 3MDQA 1LWCB 3HW8A 4DUZK 5FDLB 3CFOA 1YITN 4C0ZA 1QH9A 3GFZA 4YY3K 3N28A 2RS8A 2DR5A 3VQ9A 3IG5A 2MJUA 5KNIA 2BRKA 3EE3A 1ZQVA 3KK3A 4BR9A 2MEWA 1M5OC 1FERA 3FSXA 1TTHB 4UAWA 3RB4A 2BGGA 3EGZA 2OTLS 4FYWB 4OJ6A 3TQEA 5CZ1A 2ZJQL 4FKXA 4U67L 1JN3A 2COLA 4WXWA 2G1HA 1HJOA 3V81B 4BC5A 2BE7D 2Q3PA 4LBIA 4ECUA 1FFSB 2E7XA 1X4DA 3T19A 2IJRA 2ASDA 5AK4A 3KVGA 3BPDA 4AXIA 3CCLN 2RE2A 2OEHA 1HNZF 3TRGA 4Z4GA 3HSJA 3VN5A 3UM9A 3OVNA 2M9NA 3TADC 3R3LA 2RPIA 4C8LA 3D3CJ 4LC9B 1BL3A 3NFAA 2PO4A 2VBYA 2HPUA 3Q24A 2J8SA 5HMXA 3GV8B 1SWWA 1X3MA 5D78A 2EH9A 2A3VA 4HAIA 1N5YA 1SL2A 4M2YA 3LDLA 3VF6A 3VCDA 3X3UA 3SSRA 2E6MA 2CQIA 4K4UA 4JP8A 2KIWA 1N34F 3JQJA 4OHYA 2GWKA 1VQ7N 4FYXB 4B8CA 3VQCA 2ZBQA 3MFIA 4FW2A 1KLMA 4LRFA 4G1IA 3CO9A 3CJKA 4KTWA 3WKEA 4RUAA 1AROP 1RQLA 1UMJA 2AA4A 4ZOHC 1HW8A 1RAGB 5F3ZA 1KD1T 2BDPA 5IFMA 4FO0A 5HRPA 3OPXA 3U4LA 3SNNA 1LVHA 1BPZA 2VJ4A 3C65A 2W9MA 5DDMA 1QQOA 2NUBA 4YDDB 1S10A 2A42A 2CNNB 1PYOB 1NKBA 2HMXA 1PJ5A 2ZD1B 3CCMS 1I39A 3VQPA 2QGFB 4UOFA 2JVOA 4BUGA 3BGRB 5CH7B 1XNQK 2RIJA 3AQFA 5DB6A 2QA4N 3SFUA 1EO1A 2L9WA 3F2KA 3BQTA 1U8SA 4ED6A 4ZVEA 5FLXU 2HOFA 4KLIA 4WU2A 4H4MB 4NLYA 4KH4A 1WEZA 4MH8A 3TUZC 4M5LA 2OSRA 3A1YG 2V68A 4NLBA 1MWKA 2E1CA 3D1OA 5BREA 3PJXA 2KT5A 3CJ4A 1QQMA 1VSMA 1Q82O 4IOCL 2YWFA 2QWNA 3ZEUA 3CC2N 4IL6U 5DETA 3PFOA 1TAUA 4KH0B 7ICOA 2YNIA 3IR6B 2QW9A 2JH7A 4EIAA 1A7GE 4HHUA 3PKMA 4J03A 2J7KA 1RACB 4ZA1A 1N8RT 5KG1A 2ZZNA 2HAFA 3R9LA 2GMHA 1DGKN 4FWKA 5AKXA 4M5KA 4BR4A 4QZBA 1ZYQA 2RSQA 3AJDA 4QIVA 4ZPDA 3ENQA 3WNEA 3NF7A 5F3XB 4WZQA 3T5JA 1TK8A 1Z00A 4DQIA 4XAKA 4DTUA 3DYAB 4M9LA 3HJVA 1FTRA 1DARA 3Q8KA 1C0UA 1S49A 5E7OB 5BN9A 4NXZA 2F96A 4N47A 1J27A 2DO0A 3OS0A 1ZM4A 2EI5A 4TYAA 1YLXA 3C15B 3AAQA 2JL9A 4NE9C 2JMGA 2FHMA 1A77A 1S79A 2ZUBA 4QZ9A 3RWUA 2CQ4A 2BEFA 1S1VB 5C7PA 2ACYA 5CYMB 3EUB2 3MUTP 4JNEA 2MKCA 3VAKA 4WP3A 1UJ4A 3Q8UA 1HHQA 4ID5A 2RU9A 5H1SQ 4FZLA 3CDWA 3GG4A 4RQ6A 2QLWA 2ZITA 1TAMA 1TE2A 2FLOA 3KG1A 4ZVHA 2W6KA 4E7IA 3ICXA 4BG8A 1KQKA 4EEKA 3MDFA 1UPHA 4DL5A 2EC2A 5AQSA 1XEZA 1URNA 1IKXA 3PCOB 4J9PA 2GO7A 4BRKA 3NNAA 3PYDA 1URRA 2K7KA 1XU4A 1ZQNA 3CD7A 3MM6B 4NL5A 3MX5A 2Q79A 3ISNC 4H0PA 4IG0A 4FWMA 4MFCA 3QRQA 4O3MA 4Q8FA 4O44A 1KW4A 3VVTA 1HJPA 2Q66A 2F3JA 2H5JB 4CFAA 2WW8A 1VQON 4NY8A 1APSA 4K41A 3NWGA 5DDRC 2W55A 2GELA 4KH5A 3TNVA 1NGGA 1FF2A 1OQ3A 2XMVA 1J2VA 1VK8A 4YEAA 3M6VA 4PL8A 2XVTA 4XO0A 5JMVA 4ZP9A 4L3QA 3HL8A 1CULB 3OGUA 2UUCJ 4O8UA 2IYGA 2YHAA 2FZCB 2M2BA 3GJRB 3DDKA 4A8YA 3V7KA 3ZZPA 2FJVA 2XYHB 4AHTA 4PY5A 2C3MA 4ZCIA 1VLOA 3SCXA 3BS9A 2YWEA 1SV0C 4CZJA 3LVWA 5AI9A 1WTFA 4USWA 1UL3A 3WKAA 4M5GA 4R79A 5B0AA 4CIFA 1LW2B 2XMUA 1DQAA 2QZ8A 1XSPA 3AA8A 5CCMA 7ICSA 3UQ2A 1Y5LB 3V4MA 5AI5A 4MLEA 1VJWA 1TVRA 1YBUA 1C4CA 4HI2A 2G4BA 2XICA 1BUPA 3IGNA 1C1BA 3Q7BA 1DK3A 1ULRA 2YCHA 3WZ0A 3EZ5A 3L7PA 4X66J 4B1VA 4Z6EA 4FJKA 4DCJB 3VGTA 3SDEA 1A6LA 4DPOA 5HRNA 1J97A 2JLEA 2VGNA 4A5BA 2UUAK 1WSEA 2QYCA 3M8SA 1HQ2A 3QEVA 4FOEA 3TKAA 1JMTA 4YMNA 3M6GA 3WBZA 3HHLB 3MM5B 4WFNQ 1VQ9N 4WFZA 3CCSN 4C3MA 3VHQA 2GX9A 4P6QA 4M45A 4RBUA 4CLPA 3IM9A 5I9EB 2FVCA 4UTGA 4IO1A 4L3NA 1OY9A 1TKTB 4BVOA 1K1SA 2YNFB 2FC0A 5AQNA 2OTJN 4DV7K 2ZE2B 2OANA 2BTFA 1KAYA 4QBUA 2GOLA 5M1QA 4FXVA 2LI6A 2Z2YB 2KM8C 3ZDDA 4EX7A 1BISA 3RW7A 4A8SA 4CF2A 5L9XA 4DB3A 3CMAS 2FUG9 2BJDA 3QYPA 1RTIA 1ZTTA 1VSJA 5CYJA 3Q8MA 5J0QA 3F9MA 2ATCB 1ZQTA 2V34A 4QZFA 7ICIA 3ISCA 2HHPA 4A59A 1PK1B 1HLWA 3JTPA 2XTJP 1NOZA 3KHRA 1AYEA 3KZXA 3KHGA 5AKLA 2QA4G 2JFDA 2KSOB 2O8FA 4YMOA 3UPFA 2GAGC 1Q7LB 3GU0A 4LF9J 1YHQN 5HVGA 4FK4A 3T1HJ 4JI6J 5HNKA 3LP0A 3MM7B 4WFAQ 3CCJS 1FXDA 2SXLA 1VAZA 3R9KA 4DSKA 3M3ZA 3NKYA 1T6CA 4OMFG 1ZQIA 3H40A 3R5BA 3HHDA 2Q0ZX 1FX2A 1IR1A 3BDEA 2HMIB 1IG8A 1WEYA 3HOTA 4TLQA 2UUCF 1KBUA 4I2HA 2I38A 4IOAQ 4AUKA 3TFRA 1CJKB 2CQGA 2IJFA 3R6GB 5DM6L 5D77A 4FO6A 2LA6A 4DPXA 1BNPA 3HOSA 5G5HA 3CDBA 2KKZA 2HFVA 5HLFA 4DBQA 5AE2A 3JPNA 1NK7A 3F0NA 2C3YA 3I9ZA 3IDHA 3G87A 1TL3A 1BPBA 3VQ8A 3C5FA 2HHUA 2CGKA 3OYLA 4DUYJ 4ES3A 1PCAA 3H46O 4ECXA 3VQBA 5KFEA 4RU9A 2MU2A 2CNLB 3GFXA 4OYIA 4ANCA 1ASWA 2FVQA 1WOQA 3B0XA 1CEZA 4UBCA 4U7UD 1N52B 4MF8A 2C2NA 3PYGA 2E1PA 4DEZA 4GC6A 1U0HB 2W2PP 3ZFVA 1Q95G 4X4TA 4CF9A 4X66F 2E5GA 4LQ9A 5AIBA 4JBCA 3NVYA 1MQ2A 1UT8A 1U6BA 3P5TL 3IRXB 3AY0A 1Q81T 2DNLA 4M5DA 2UUBK 4ZMMA 3OR2B 3ZNUA 1VQLN 4QU7A 3QSIA 2LFVA 3ZYYX 3LO3A 1U8WA 2MZRA 1AUSL 4F4YA 4DPUA 4DU4A 4ELUA 1TVAA 3TSQA 3IGVA 3HVWA 3BSCA 2BA9A 5KFOA 4FVCA 3SUQA 2M5YA 1IR0A 4F2SA 4DX7A 2FPHX 4J5OA 4WIQA 1M1KO 1S9GA 1QAYA 2QB1A 1H1VA 1SJ1A 5GINA 3U9DA 4CRJA 5AQUA 4MFAA 1KCFA 4IQMA 4IFYA 2WC9A 2MYFA 3GPAA 2ZH8A 1RHMB 4ES2A 5C25A 3J81Y 2H1YA 2DHXA 4MF2A 2JEJA 4TY9A 5C12A 3CCVN 3MTJA 4ANEA 1FKOB 2XS5A 5KQDA 4HACA 4UF4A 1ZD5A 3JPQA 1T11A 1FDAA 4FLTA 3CDUA 3VQQA 1RGVA 4NX9A 2O01C 4DV3J 1PVQA 1TL5A 1F60B 5J2KA 3HRDD 3ZZZA 2NS1B 4FZMA 2AIRB 1S0OA 4ZPCA 2FVSA 3L4PA 1B92A 4NLDA 2HHSA 1GO3F 3SMVA 4LF9F 4CJEA 1CBKA 5J2MA 3DLJA 3T1HF 4JI6F 4ZPWR 1FJEB 1ZQYA 2XMTA 1NGJA 2MMYA 1IN0A 2YTCA 2GUPA 2P9SB 4C23A 2FGOA 1WC3A 4Y2CA 1SV4A 2F1HA 2YTUA 4FLZA 3KWIA 2WZ1A 3VMFB 4PWDA 3BF3A 3JYTA 3CI5A 5CZXA 4KO0A 3O9TA 4CK2A 4CDGA 2O6KA 4CJWA 3DOKA 3GZ7A 5U47A 2E1EA 3FUYA 3VF0B 1IKWB 3IS9B 2DWQA 2VG6A 3G82B 4U96A 3WKCA 3BPSP 4KX3A 2H65B 2HFSA 3CJAA 3J7A1 1VSDA 5CJ7A 4YB5A 4CD1A 5EUHA 4DUYF 2DY4A 4BRMA 2HBYB 3PX4A 1FWKA 4RJVA 2VQFK 3SYZA 1JALA 3D0PA 4JK7A 4I6WA 4Z94A 3J80O 4J9SA 2FHKA 2BRLA 3BN7A 4RW8A 5DJBA 3UKUA 2DITA 4JV2A 4QZGA 1S7HA 2NNWA 1FWPA 1TL4A 4GIBA 1FHTA 4ZP7A 3AV9A 4ZPAA 4KI6A 4F5RA 4ERDA 1VIXA 3HZGA 4RG8A 2GMLA 3M6WA 5IIIA 4DFPA 2WHEA 4XDCA 4V19X 4J9LA 1DXSA 1SIZA 1PC5A 2HIYA 5AKEA 1I1GA 4LRAA 1NO8A 2IAJB 2WVEA 3CIZA 1N54B 1TYQB 2OHFA 3O08A 1SXLA 1KVKA 4PA1A 5G0RA 1UWBA 1A5XA 3WT0A 1YT3A 3O1LA 4CO1A 1D8BA 2BPGA 3ENBA 3V9SA 2DNYA 3ULEA 4J2EA 4HTLA 4KTZA 4B9LA 2FJEB 1VHXA 4D3GA 1FK9B 2D0BA 1PIEA 3PY8A 2OD6A 2D4WA 5J0UA 1U25A 4DF4A 1KOOA 1FD2A 1ZQSA 3ZSQA 5ETOA 2XO7A 2XHBA 1ZM9A 4YXMA 1QZ5A 5AFUA 4HYKA 3FJ2A 1KFDA 4UZBA 3LPEA 3OA9A 4O3NA 4R0JA 3DWLA 2KXHA 1L7PA 2M8HA 2QWRA 1KVCA 4DV3F 5ELZA 3E01A 3RB0A 3O9RA 2Q36A 3I56N 4F4KA 1CQMA 5M2UA 1H2TZ 2QB0B 1IBMJ 3LALA 3CC7N 5LOQA 1HQUB 4OX8A 4A8OA 3AFGA 3L9ZA 3A0IX 4BR5A 2P9NB 3V81A 3T7ZA 3K89A 1DT9A 3LM2A 5H2FU 4DU8A 3I8BA 4E7LA 1Y9OA 2ZIWA 3AVLA 3E2EA 1Z19A 4ECSA 3CERA 3LPYA 5EXWA 3VQSA 2IVOA 2ZUAA 3ASMA 5KFDA 3BGOP 1R6YA 4IH5A 4KMOB 3Q8LA 3IA0A 2D3UA 4FE3A 1EKSA 5AI8A 3PNIA 2NZTA 1NZAA 2N82B 1E6VB 5CXTA 2W40A 5HL7Q 3G8QA 2FC8A 1S1TA 3T5KA 1LXNA 4NLNA 5BYRA 2JEFA 3D2SA 3L2RA 1PUZA 3RBZA 1NH7A 4DL0C 4P7TA 2PSZA 4RZRA 3M8QA 3AAPA 4JI8K 3H0LB 4QWAA 1QY7A 3G10A 2MAXA 5KFBA 3UDEA 4X65K 3QFWA 2U2FA 3QFPA 2VA8A 3KLHB 3MN5A 2F65A 1NDKA 4FXDA 3E1YA 1VQNN 3DFEA 1BI4B 4DV5K 1A5VA 8ICQA 5FIIA 3OVBA 4FK0A 1YSJA 1BWEA 2ZOFA 5ADXA 2DHGA 4X62K 4IG3B 2QXLA 3EM1A 3T9NA 1K44A 3LYSA 5F8IA 4FN5A 3WK7A 2ZD1A 3CQXA 2LKZA 1BE4A 2W7PA 3QLHB 4HUFA 4J9QA 4IFEA 5HMZA 4EEYA 2DR9A 3OFGA 3DGPB 4C8YA 1F5SA 1DTQB 4PXEA 5K8NA 2XHCA 3RF9A 1R6VA 4DR1K 4H0OA 4H4MA 4WBFA 4LUBA 3CNHA 4Z4IA 1LWXA 1DRGA 3QT8A 4CBXA 2ZBIA 4EBDA 2GC8A 2N4DA 2QLFB 2UXCK 4A8FA 1IG6A 9ICRA 2AJQA 3I0RB 1I3OB 3IBFB 1WSHA 1X0FA 8ICCA 2EX3A 4DU3A 1NPPA 3WX8A 3VQ7A 1YGYA 1SH3A 1YJWS 3AVJA 1YX2A 3DLBA 4N5SA 1VISA 3KG0A 3M9NB 5L1JA 1FI4A 4NLRA 3TVZA 3MMCA 1NU4A 1GTEA 5J2AA 2KKVA 4QIGA 4CHNA 4NZ6A 1SQEA 2V7ZA 4OI2A 5IT4A 1RHQB 1U49A 1M90O 1F3FA 5GAHU 4CTAA 3IDWA 3G6XA 4H5VA 1IBMF 2KJVA 2AGQA 2HFOA 4RQ5A 1RCOB 3IV6A 5CYQB 2XLJA 2F5GA 1CC7A 1RG6A 2Q1NA 3HP6A 1JMSA 2VJ5A 3PNCA 4AP9A 3DRSB 4Q8EA 2VASA 4LF8J 2B9EA 4P4OA 3EE8A 4NXNJ 2DFEA 2A19A 3H4DA 4F3OA 1RT7B 3BF1A 2D1KA 5KFGA 1MN7A 4DCCA 2P8IA 8ICKA 4O5BA 2P9UA 4GLXA 5LL6Z 1VQ4N 1WSJA 3S1TA 4CO4A 1IH7A 3T1YJ 4OJGA 4K50A 1RWOB 4A46A 4DR5K 2ZDPA 1SC1B 1S1VA 2MZSA 4ZJOA 4DUZJ 3RH6A 5CYMA 4YY3J 3V9ZA 3WXLA 4N76A 4IOXA 4NV0A 3BR8A 2UVWA 3MR7A 2VHGA 4NLXA 3ZD8A 4Y2KA 2KFNA 1LWFB 1M0SA 5GMEA 4B9NA 5GAHP 1SGGA 3PIPL 2KM8B 3KLEB 2CG4A 3AD8C 5G5GA 2M0NA 3HRGA 5HN0A 2R42A 5J29A 1EAYC 2X7IA 5I3PA 4QWDA 5JRTA 3BQ2A 3VC8A 1GXTA 2RQKA 4OLOA 2EC0A 4AXJA 1HBNB 3RR7A 3CF5Q 2KH9A 5FRNA 4OGEA 5KAKA 1G4CA 4RQMA 3UPQA 2Q43A 2V7YA 1ZBLA 2NQPA 2ZVIA 2KXNB 4CZKA 1NG9A 4OYAA 1Q8IA 4OQJA 3B6PA 1UEUA 2UXBK 3C2PA 4Y28C 4C4TA 4DTSA 8ICZA 2B21A 2EHGA 3MK6A 4USJC 4Q0BA 2E9ZA 2QL9B 4OZ3A 3IWNC 3DOLB 4K4SA 1R0AB 1X4GA 2EQYA 3WIUA 5AQWA 1ZTWA 1ZQGA 2DPJA 2VD3A 2AEFA 3MEEA 3KD1E 3KKAA 2RVJA 5HMLA 4EHTA 2HQGA 3CJ2A 4LD0A 2C2RA 3CW2C 1GEHA 2IDLA 2Q31A 3RSEA 4CHZA 4OYBA 1XNRJ 2K4PA 1WKJA 4RQ7A 1JJCB 2BE2B 4IJNA 2PMZC 5AQHA 1JXLA 1X5TA 4GNIA 4KV8A 3MGIA 1NU0A 2V4RA 3M2RA 3OYEA 3LDSA 3HHLD 3W8PA 5J0TA 1J53A 1Q5YA 1S5ZA 1BC6A 1ZD4A 2EBGA 3FC4A 1Q8LA 1HD0A 3QEXA 1XNQJ 7ICHA 1UVKA 4M9HA 1RXOB 2OZMA 2E3TA 4RO0A 2VJUA 2QM1A 4OLPA 4WYBA 1QAIA 5J8YA 4M0AA 4USTA 4LF8F 3AJ2A 4Y2PA 3CD0A 4NXNF 3VQ5A 2I7NA 4B6JA 3DOMB 4I56A 3UE2A 2FJAB 2D5RA 3ITHB 1UW4A 2DCUB 2DGOA 4CT9A 2YH0A 5IWAK 2HSTA 4CGZA 2PFFB 1ZQMA 3T1YF 4YR0A 2WFBA 4KB0A 3CT9A 5KFKA 3HHLA 3MM5A 2GBZA 4AYBC 4DUZF 3G25A 2RDDA 3KLGB 3E66A 5HROA 1KQSR 4JHDB 2PYJA 4YY3F 3AVFA 1BOTO 1JNRB 2P9LB 1DJ0A 4RW9B 3A2FA 2KHCA 2RRNA 1TKTA 3QZ8A 4K43A 3QUCA 2IM0A 2W2QP 1WNSA 1L8LA 2XULA 3H25A 4KHPK 4H0TB 1N8RO 1NM2A 5D3GA 5FLXO 5LMUK 5IS2A 3VAFA 5SUHA 4Y2JA 2KOBA 3BEXA 4OYOA 2C2DA 3O8WA 3H7HB 5MLCQ 3QMQA 1H7XA 3TARA 5BRHA 3P3DA 1JLCB 2CDQA 3HXMA 1BNOA 5A0LA 2YVSA 3NTUA 3W9HA 2GQQA 4QIFA 3HI0A 3PUFA 3B4MA 1QQCA 3HI9A 1P6TA 4CGFA 5CZVA 2CQCA 1D09B 4XK8C 1EX4A 1K8KB 5ALJA 4CW7B 1PK1A 1NDPA 1SB6A 1V4SA 1MU2A 1RTJB 5CZ2A 1R7IA 3MAAA 2AJ2A 1KC8O 2WB1C 2MA1A 4R8UA 1NK5A 1Q79A 1LB2B 2KSOA 3JSMB 4FOIA 3R1LA 4DL2A 1ASVA 5AFUH 3QWPA 1GH8A 4M3YA 6FDRA 4CE9A 3MM7A 3ZNJ1 4RWXA 5ALMA 7FDRA 3SUNA 2BKPA 3NY0A 4DSEA 3LF0A 1Z26A 3F5AA 1LNQA 1YBTA 4DWIA 3ZZTA 4ATNA 1SKWA 2XB2D 2C2OB 1H3DA 4QS7A 5BPNA 2WONA 3PV8A 3I87A 2JJ4D 3M8WA 2HMIA 5ETKA 1P90A 1NI3A 3ILIA 3FSYA 3RBXA 4KLQA 4CLYA 2L08A 1ZQXA 3HWTA 5JMNA 2WF6A 1XNRF 4U95A 4ZPTR 1RT5A 1RPLA 1J5OB 2B6AB 3LUYA 1WUDA 2DIVA 2WSEC 1MNEA 1QE1B 4RT2A 2B8QA 5IM0A 3UDCA 1R59O 3DLGB 4O4RA 2OTLN 4FJHA 5BRDA 3EMTA 1DBDA 2AYEA 3FDSA 3TOQA 3JPTA 1XNQF 1RT6B 3JPSA 3Q8RB 3QJLA 2LCWA 1N5QA 3H8YA 4F71A 1WOPA 3QXGA 2RQ4A 1LXJA 2BABA 2FIUA 4NCAA 1SS6A 1NZPA 4HT7A 1MN9A 1NDLA 1U0HA 5J1NA 4CK1A 4JI4K 4YDXA 1REVB 1BWFO 3LZIA 7FD1A 1RDBA 2FMSA 2DCLA 4K4XA 8ICWA 1QDUB 2RUGA 2YQ3A 3IRXA 2CPRA 3ETOA 5DLFA 1RBTA 3I28A 4DPYA 3FFIA 5EN1A 2P9CA 2ES6A 2UUTA 3BR9A 1B99A 1X5PA 3S3NA 2OP5A 4I2IA 2HS0A 3UO0A 2WF5A 3JPRA 1IJJA 2LM1A 1NMDA 1FNXH 3FSIA 1VK3A 4F25A 5BPCA 4BRHA 2RDJA 1AB8A 2W4CA 3MMBB 3DU5A 1VQKS 4QIWC 4P74A 1RBUA 1N61A 3T5LA 3K0JA 1RQNA 2KV2A 1B7FA 4YDUC 3FQKA 1RXVA 2XMJA 1N6QA 4Y2TA 1HI1A 4L73A 2WOMB 1NXIA 3THXB 1FKOA 1RWVB 2F4VK 4CF1A 4YFUA 2H3GX 1ZBFA 2LVWA 2B4VA 4BRFA 3CQYA 3DRRB 4NLPA 1VQ6N 3T41A 4NLOA 2ODGA 2DR7A 4FM2A 2FZGB 3OQ2A 4X64K 1URJA 3H3NO 4F8RA 1W2BR 4CGHA 3M30A 5K14B 2P9SA 3TYTA 4EI2A 3OFHA 3TR8A 3KNGA 6AT1B 2F77X 3TADA 3CIPA 2DNHA 1DQ8A 2ZIVB 2XHWA 5JU5A 3OYKA 3GYNA 1ZBUA 1WOSA 3TZXA 2YX4A 4LH4A 3HULA 2DPIA 8ICIA 3CQ8A 1NPRA 4QOZB 3B0YA 3NMAA 4ECVA 3IR7B 4J9KA 1FEEA 1M6YA 3DXBA 2HBKA 1UT5A 3KMQA 3JPPA 1L3UA 2VG7B 3QICA 3H08A 2ALZA 2BVZA 1WF1A 4YORA 3PIOQ 3TR5A 3G82A 9ICQA 1M5SA 4DR3K 3MMAA 1WI6A 3S01A 3CF5L 1ZC6A 1NGAA 2HNYA 3BO2A 5DZ6A 3SEOA 3MCOA 3V1OA 5BRFA 1BPXA 4CLLA 5LL6d 1KQSM 1M5VC 1YKWA 1BMQB 1X31C 2PAVA 3D45A 4BLGA 3NGSA 3O3FA 5AI0A 2ZOMA 5AXLA 1JKHB 2HHWA 3B8HA 2FZKB 9ICOA 2F8LA 4FS1A 3C7NB 4IJAA 1Q9XA 3THPA 5HANA 1LFPA 3RMDA 2VC0A 3CCZA 2DNPA 2F9TA 2GHPA 3A8KA 2MKIA 2ZUDA 2QFJA 2V4JB 2GIRA 1FNMA 2WTFA 2KQ2A 3HTVA 2K4EA 9RUBA 2E29A 2IAJA 1TYQA 2KU7A 4HCCA 2BJEA 4DLGA 5AQXA 3MOZA 5D8HB 4K8XA 3U27A 3VQDA 2WAQF 3MN6A 3KWGA 3OYGA 4JMUA 4QU6A 1JLEA 5T41A 4PUOB 5ALQA 3JXUA 2KJ8A 3AO3A 3VERA 3PX0A 3M7DA 2VV5A 3NNHA 1FK9A 1GLFO 4CEFA 1JI7A 2EZXA 3H42A 3QWUA 5KFUA 1W26A 3CFRA 2ZJ8A 1WF2A 3D2EB 5A8KB 2LU1A 5F1XA 4N7TA 3W8GA 2B0GA 2R7XA 1G3OA 4PG7A 4M8LA 1JL2A 1NHVA 2E8MA 3E51A 3ET6A 2O67A 2CH6A 3MXHP 4GKKJ 2PT0A 2RU3A 1HWJA 2QFIA 1NRKA 2G9OA 3M2UB 1BQMB 1C20A 1PZNA 2QB0A 3F2BA 4WWSA 2ZH9A 2D41A 1NJIT 1VQMN 2G2ZA 2LYHA 2DY1A 3OJSA 5A8RB 4F0MA 8ICJA 2O66A 2UUBJ 4PYDA 2P9NA 4CNYA 1L5UA 4M9NA 3VCBA 4ZS6A 4FJMA 1RWPB 4CYUA 3MWTA 2M9KA 2GVDB 1A0PA 1NPKA 3HZ6A 4LZGA 1U1QA 1A0OB 1L7NA 1EQMA 2R2TA 3G6VA 4NA3A 2F2AB 3KHLA 2NPFA 3K5PA 3WDOA 4RPZA 2DY9A 3B6OA 3BO4A 5KFLA 2AF6A 5JXSA 2QLTA 3OBWA 5JS1A 3A8IA 3EVMA 1BDGA 5D4PA 2VIHA 4OZLA 1IKVB 2KNJA 2N7YA 5AKYA 4K5SA 4FF4A 3MD3A 1RT3B 1FDBA 1YVUA 2DXDA 2XWYA 4GVEA 4YN3B 3QEIA 3BS5A 4E19A 1BPEA 5FJ4A 2IY5B 3H90A 3DLRA 2P5VA 4DV1J 1HHSA 4IDKA 5H1SV 1QM9A 2GGPB 2A1JA 1DY3A 3NGKA 1MA7A 2VFTA 1ZQRA 1F44A 4FBTA 2V5HG 3TA0A 5AZIB 4L6V3 1S3XA 2W9BB 1UEKA 4UB2A 3SBGA 3T6JA 3FNNA 3HLUA 3OYCA 3TWZA 3DEEA 2V8HA 5K8MA 2UP1A 4YCXA 3MDAA 1LOTB 2F8HA 3KLHA 3BQ1A 1NGHA 1YJ7A 5K5MA 3AVNA 1BI4A 1CJVA 3FZHA 4CEDA 1UA0A 5LT5A 3C6UA 4KLSA 4WZMA 5DDQC 2JSXA 5B09A 3LWLA 2EZZA 2FBVA 2YMPA 4G1QA 1OSDA 5CWRA 2LP4A 3U3GA 5EWFA 1Y88A 1RAAB 3SCKE 4KHSA 3DGPA 3OTEA 2Y8YA 5KT5A 2OPRA 3DLLL 2B9WA 5AM5A 2P6TA 1DTQA 1VRTB 2W25A 1C1CA 4Z0UA 2CJYB 1WWHA 5C15A 7ICRA 5A76A 1P1LA 8ICSA 1C0GA 4BRPA 3Q89A 2RAQA 5F8JA 2H4WB 2MZTA 1FKAF 3I0RA 2BCQA 4DMZA 4K8ZA 2VPYB 1LKYB 4X4RA 4KRFA 5CCLA 5C2CA 1FJCA 4C1NI 2HNZB 2YNHA 3EXYA 2CPYA 1W2BM 1I94K 1JLAA 1F9FA 2DGUA 2ASPA 2VQFJ 4L3KA 4Y3CA 4O5CA 1PVRA 1H0HB 3FCWA 1S4FA 4OI3A 1RE1B 4C8OA 5JVHQ 4U7UK 4O3SA 3H2LA 3KUGA 1NNEA 3CO0P 4EENA 1HWLA 2OYYA 3FGVA 1FJ7A 1SUQB 4DOAA 4GKKF 3VR1A 3VAGA 5L9NA 1UZDA 4B9QA 3JTNA 2C2EA 3G0ZA 4NEZA 4IEEA 3N0VA 3GWCA 2UUBF 2V67A 4B3OB 2XRIA 5CYQA 3TTDA 2GNKA 2E2NA 1KVJA 3DRSA 2E20A 3WQPA 1T94A 4QQBA 3EGNA 4Q2MA 4LSLA 3CCJN 2KE7A 4ISEA 2O4IA 1Y5IB 4KLMA 3N5BA 2ZIUB 1SWVA 4KHUA 3MGJA 1ZQKA 2GVZA 4NB4A 4KB1A 2AJ1A 3D68A 1TUVA 2O8DA 3W1YC 4MN4C 1WC1A 3AQEA 4O3RA 4M41A 3PYEA 4RNMA 4ZLPA 4JI0K 2NV3A 2OPQA 3TVKA 1HNXK 4DV1F 5CHIA 1YIJS 2H3IA 4BRAA 3EKSA 5GTHU 3LWMA 1WG8A 3O5TB 2HMPA 1VHIA 4FF1A 2V8DA 3P83D 4CE6A 1CJTA 1H73A 4JKEA 4P2HA 1DFDA 4H5NA 5J2DA 4IR9A 2DKZA 4J2DA 4QYZK 1LWEA 4FM1A 1UFWA 2GA7A 2UXDJ 1ZQOA 1HBNA 4WFBL 4F4WA 7ICEA 3E9OA 3SQ2A 3SI8A 4RTFD 4MFBB 3HSDA 3HKZF 2QLJB 4CH0S 5B0FA 3WEEA 1Y3KA 2RF2B 3ZDEA 3QINA 2DO4A 4GV6A 2WF8A 3EZWA 3DM2A 1WC5A 2PKEA 2YBVA 3UDVA 2KO1A 3ZTQA 3DHWC 4CJSA 3IG8A 4Y2RA 4NRTA 2DGQA 1Y5NB 3OSPA 1T9WA 5I3UA 3ZZUA 2JLGA 2G0AA 3WXIA 5FD1A 2Z1IA 1XMBA 2XMKA 3MABA 1TGOA 4JI8J 3B9JA 4IDHA 4WK1A 5F8HA 4CIEA 1PG5B 2Y0SC 2CWXA 2WVCA 1S9EB 3W63A 3NH2A 3DI6A 4KLGA 3HVRA 4X65J 1IXKA 3ZTOA 3CCUS 3G6EN 1B9FA 3CCQS 4Z4EA 2PFDA 1PK3A 2MQOA 2RDIA 4JKBA 4B08A 4F4ZA 4UZCA 4RW7A 2H51B 4DV5J 2VQFF 4GXKA 4X62J 2V0NA 2VODA 1XHXA 4UB1A 4UUXA 3F56A 1KS2A 1IXRA 3THWB 5CD4A 1SZPA 2AGPA 1SC6A 2FLPA 1WG4A 2HHQA 3F41A 1AW0A 3AAWB 4X4NA 3K0SA 4C8NA 2KYXA 3V5RA 2QEXS 3ALYA 2CPHA 5IT9Y 3KDOA 1ED1A 3R1HA 2AEJA 3SUOA 3MF5A 4DR1J 4XPCA 4W5NA 2JC0A 1NSQA 2OYQA 1QHTA 1UAXA 4KAIA 2OWOA 3DOMA 5AM3A 2UXCJ 4WJ3B 3KD5E 1VQYA 2QI2A 1YJTA 4Y00A 2JZBB 2P35A 2KZZA 4M63C 3GYGA 1T03A 3KUEA 3E58A 3O4QA 4YG2A 3HZEA 1RAIB 3W2VB 4KN7A 2NXEA 3FYHA 4CLWA 3CYMA 4OZJA 2ISOA 1HYSB 3TEHB 4FJJA 3UWTA 2FC9A 3C46A 2E8AA 1FE4A 3GFHA 4BDPA 2DGVA 1Q7YT 4OX9K 1C2PA 4A8WA 1WYGA 4CHOA 3DC2A 3DMJB 3QT7A 4M7YA 2HCFA 2UXDF 2AYMA 1JLCA 2E1AA 4TU7A 3MXMA 4CM0A 3KOOA 3AVAA 1R8BA 2B51A 4K4VA 3I8DA 2KICA 2C42A 2AQ0A 3QNMA 4QZAA 1WHWA 4BG9A 1V3SA 1HKBA 3QEPA 2LXFA 2OMLA 3IBCB 1QSYA 4UBBA 3IM1A 4U9RA 4GMJB 2ZH2A 4MT1A 5ALXA 2PFPA 3JSMA 3KK3B 4FJXA 2AJ0A 4DR5J 3PW7A 2PMZF 5CP2A 3AGRA 4Y1DA 3BO3A 4CEAA 3HFKA 3L4IA 3PEJA 4YMMA 2Y9HA 3WUHA 2JLFA 4PHTX 4IKFA 4JI8F 5DDYA 1TK5A 2CRLA 3PRDA 2UV8G 3AA5X 3C2MA 1Q16B 4X65F 3MN7A 2IMOA 3HFVA 4EP5A 4BDYA 4RNHA 2HRYA 2WFAA 4HTIA 4Z4FA 2RQCA 4DV5F 4P73A 1J5OA 2F63A 4X62F 3IN5A 4Y0WA 3A0HU 4EU0A 1QE1A 4DQQA 2G5HB 3AMZA 3H8WA 3GDQA 4FXWA 1WLJA 1N5YB 5L46A 1GLDG 8ICHA 2JNJA 3M6ZA 1DZ5A 4AFFA 4ZHRA 3CFPA 4KITB 3ILOA 4AYBF 3SQGB 2X1FA 2UXBJ 4B8AB 4OV6A 3CD5A 1V38A 2YX1A 3AN1A 4OJLA 4LSZB 2HHHK 4LF4K 4DR1F 2FVRA 3UB5A 3SLCA 2RD5C 2YQEA 1KLMB 2I5HA 4RW4A 2EVZA 2UXCF 4KBOA 3NBPB 2FPKA 3GP9A 1XBWA 5FLXY 3V2UC 2DKXA 4Y2VA 5BOMA 2CNOB 3EGWB 1T3VA 1N33K 7ICFA 2VA2A 1EIYB 5K8OA 5LY3A 2GX8A 2QT7A 2ASJA 3TAMA 4CFDA 2NRTA 2ZTDA 2B7CB 4GO5X 3IUCA 2EG1A 4QCLA 2HNDB 2EKNA 3SCJE 4F04B 2HZVA 3PHEA 5AE3A 2EFGA 2I5JB 2NYIA 3I82A 4FDFA 2O4GA 3ZT4A 1IM4A 1R8AA 3MMBA 3D2QA 2FHOB 2WB1F 1VQ8S 1L6NA 3P31A 3F2DA 1WJ9A 5JVHL 3BM7A 2VA3A 2QN6B 5AKIA 4F4AA 4KBIA 3H45C 3CHWA 4CFCA 4NJ8A 2VJVA 2B7BB 4WCEL 4I6MB 5EWEA 1JRPA 4OX7A 1WAJA 1VQ5S 3CJ3A 4QR0A 1ZQBA 3SFGA 1SZ2A 1U1OA 1PO6A 2GWSA 4AHRA 2OHDA 1Q0NA 2OAUA 1QD1A 2MDAA 2DNZA 2E1RA 2ADCA 1SCJB 3QGPA 2V6AA 1FRIA 3VEWA 3RJGA 4BE1A 2GS8A 3JPOA 1U02A 4DR5F 3QT5A 1DQ9A 3QESA 5DBCA 4V1Ak 5K14A 2G8HA 3N6MA 4LF1A 5DGBA 4Q7AA 2KN4A 1XJWB 3T9ZA 4MO4A 1H6KX 1Y0HA 2KVCA 1J9AA 3D1HA 3D7EO 2D0PA 1VSKA 1EARA 4J9RA 4ZCKA 2UYTA 2J6UA 1C6VA 4KHPJ 3MUVP 3N97B 2MRLA 5F3TA 1Z00B 4IC9A 5LMUJ 2F9JA 5BPLA 1C0UB 1HMVA 2MQQA 2F8SA 3S9HA 4BR0A 5B7WA 1ZQLA 2YXLA 5HVHA 2Y3YA 3PRVA 4DTJA 3HM8A 1RDWX 5EHHA 1YJ9S 4I2GA 4K8RA 3OV7A 2W11A 1XIQA 3CJRA 3H7IA 3KTQA 2ZIXA 4CLUA 3RJMB 1NDCA 4QW8A 2ZJRQ 2O8CA 4K4HA 3PVXA 3UD4P 3WC0A 3DXMA 3LP2B 4ID5B 4PGYA 2UXBF 1NBEB 4XIUA 2ZBRA 3P5JA 1XS9D 1XMQK 1NGEA 4USAA 2DNNA 4A8XA 4MAKA 1LW0B 3L8BA 1JKHA 1NSAA 2VZ9A 2LEPA 4IBNA 2FTRA 4F3QA 2BCRA 3C7NA 2XNQA 2LQ8A 4C2MA 4CK3A 1T3OA 4QIWF 4JV1A 1YDLA 3BSAA 3A5MC 1IKXB 2CQ3A 3FZLA 1SC3B 8ICXA 1L8OA 2ZG6A 4FJNA 5GMKa 1VR6A 2NCKL 4KMUA 4NL9A 4O8KA 1RYUA 3F44A 4CO2A 2P51A 2RMLA 5ETQA 1OW5A 4O44B 1CZ9A 3TX0A 2VICA 4M1KA 4H0XB 1RHRB 1Y7PA 3KJVA 5HP1B 3KHYA 4PUOA 3EGVA 1HJRA 2HK2A 3DCAA 1HKCA 2Z0GA 2BQ3A 1J5EK 4M5NA 2ZF5O 4F3MA 4P2MA 3H59A 2WK4A 1CZAN 2YKQA 3NVZA 2ZVSA 3KBBA 3PM9A 4Y2AA 2CG8A 2V4QA 4KAZA 3WC2A 3D2EA 3RR8A 1S72N 3IBPA 1S6UA 3R3TA 3NWRA 2O8BA 2FY1A 4DL4A 4TN2A 2FLNA 4JI4J 2QSFA 1BIUA 3TSPA 2X74A 4CEBA 2UZAA 5DQGA 3J81j 2HQFA 5KFZA 2H3FA 9ICMA 3HT0A 1XMOK 5KAIU 1JCFA 2Z4PA 4A61A 4NCGB 3EKUA 7ICPA 1F2GA 1YVNA 3RTVA 3POTB 1IVZA 1CXQA 4USUA 3KOAA 1KAZA 4OLAA 1RBOB 4KHPF 3R5JB 2YHYA 3ZX0A 3MURP 5BN8A 2FE9A 2P9KB 1KEKA 3ZD9A 5LMUF 3T6BA 1C1BB 3HDSA 4LFBJ 3GL1A 2GO9A 3PG9A 3NRZA 2W9AA 3AGKA 4AQYK 4QJVA 4EFAC 4AT1B 2NXUA 1ZQDA 3SDEB 2DGZA 5CAAA 4JS4A 3AT1B 2F4VJ 2EZYA 4I1TA 4EUVA 1FFUA 3U26A 3G2XA 4HTUA 5AZIA 2MQNA 2V2VA 4NLGA 3QIDA 4F5PA 4I7FA 2W9BA 2CJBA 3IHQB 4J9MA 2VUGA 5HMYA 4CJTA 5M1KA 2N3LA 2Q97A 4O55A 4CZMA 1NHKL 4DUTA 4N41A 2M88A 1JL1A 2B4OA 3WK5A 1GMUA 4B1WB 1R8CA 2CQDA 2R7OA 4LRDA 2YKNB 1OSCA 2VFVA 3D2FA 3FM9A 4DN0A 3BQ0A 3O4NA 1KP6A 2R2SA 1YJNS 4W5TA 3CJCA 3TU5A 5IZHA 5TZVA 2YWGA 3G6YA 2AX0A 3NGRA 3FRZA 1SJRA 2HB5A 4EX6A 3NAIA 9ICKA 4MFFA 4O5EA 3OTOK 4C0OC 1SPBP 1UTAA 4DR4K 3AY9A 2G06A 2BBEA 3OUYA 2HBLA 2HYIB 1RAHB 1NGDA 4JLHA 2HS4A 4C7YA 4N8OA 4DR3J 3ENWA 5AM0A 5C0YA 2XCPA 5HMMA 2LYVA 3LGHA 1TKZB 1S57A 4P52A 2O8FB 3FQLA 2J0WA 3C1ZA 3J81O 5F41A 2Q0UA 2HNZA 3GV7B 3LP0B 1K8AT 5HHHA 1SL0A 1L7OA 1ZM3A 3AODA 2YY3A 2BCUA 1U26A 3BV8A 2B4UA 3AVMA 5KFMA 5BJRA 3H5XA 5AKZA 2QARB 3BYPA 1HNVA 4RQ3A 1NJXA 2AJFE 5GVQA 4YNQA 4Z2XA 3R5AA 4JI4F 3HSCA 3LGMA 4M7XA 5AQRA 3RUBL 4AH9A 2XI9A 3VENA 4E1JA 3QNNA 3LGNA 3GCXP 3I96A 3CULA 2JFKA 5KFIA 3K1RB 2ZGYA 3ISDA 2HKEA 2GO8A 1U48A 3HPOA 2D0OA 3M5RA 1TL3B 1X8DA 3QETA 3VAJA 2NRRA 1U1LA 4M95A 4PQAA 2ZIUA 2ZM6K 2R8JA 4OL8A 1RHJB 2A18A 3VF4A 1MROB 1IKYA 2MKHA 3ZX3A 3RW6A 3L4BC 2AXTU 4PR6A 4GRSA 2VPXB 4GY2B 4LFBF 2LQ9A 2KHOA 1KVAA 3LPTA 5J8YC 3NGZA 9ICCA 1UWAA 1WHXA 9ICXA 1NGBA 1VSHA 3PX6A 1DLOA 2BJ3A 3IAS9 2FVPA 3KHHA 4O4GB 1RM6C 2F4VF 3IP4B 2MHEA 2QWMA 4M5DB 1RTDA 5C2FA 1PC4A 4V19S 3HHLC 5A2QU 3OL9A 1NJIO 3H4BA 5MLCV 3R5DA 3A3NB 1NWKA 2XSJA 1YJVA 4P72A 1YITS 2P9GA 4X64F 2AW0A 1RTZA 5A8WA 2LLZA 4AL6A 1B7YB 4ZVPB 1RZTA 1BHLA 9ICWA 4J9UE 2C3PA 4KRWA 3ZT1A 3IAM9 2DF4B 4YR3A 4M04A 1ZM2A 2LXIA 3GMGA 4JRQA 5BYQA 3L3FX 1QAXA 4JD2A 2RF2A 3VA3A 2C2MB 4BREA 1V97A 4EGLA 2Y9TA 5BOLA 4F9OA 2OSQA 5KT2A 3OLAA 4HACB 1BCOA 4ZCLA 3CG7A 1VCTA 4G1PA 1YG0A 5E3QA 1YZ7A 3UIQA 2A6OA 5E84A 2IDEA 1MWZA 4A47A 3WNFA 4DR3F 4RQ1A 4OGCA 3CCRS 3WXKA 1Y97A 1U6FA 3KKFA 3CCLS 2A2DA 4JKAA 3CCWA 3KXDA 5J2MB 5M1FA 4BC4A 4O9MA 8ATCB 5RUBA 3DRPB 3QB0A 2POKA 1GOCA 2RS2A 4PWDB 3SMZA 1I3AA 4DFJA 1P7DA 1RWWB 5KFAA 4LF7K 4ZVFA 2VWBA 4KO0B 3THWA 4CLFA 1AUDA 2OGUA 4FVMA 4KY3A 3DOKB 2BOPA 1S6PB 3MBYA 1VQ7S 5CEHA 3NUQA 2VG6B 4TXSA 4JI3K 2PXIA 5E0OA 5ETLA 2KJ5A 3SAFA 4UB5A 4JI5K 3ZZRA 2KVIA 1F9EB 4X4OA 3R8YA 3R27A 2CJKA 1MLAA 4CQ1A 5J2QA 2JZBA 1WC4A 3IG1B 3TJ9A 4CNZA 1WSRA 4FP9A 3VAMA 5J1EA 1LAVA 3H6EA 4C7ZA 1BVSA 4US9A 1ZQEA 2QA4S 4KGZB 1X5SA 2C3OA 1DGSA 4ES1A 2ASMA 4LH5A 4KSEB 5IV4A 1HBUB 1P9QC 3CD6N 4RW8B 3UKUB 1W9HA 1I94J 3HO1A 4CLZA 5CA7A 2CPJA 3UCUP 3BF4A 3HBTA 5AQOA 3OYJA 4ICAA 5F2RA 2LEAA 4RNOA 4I27A 3KLIA 2JX2A 1V85A 4YHHK 2G8UA 1JUDA 8ICAA 1RDDA 2MY7A 4DTXA 2A6MA 2CADA 4OZ1A 4ECRA 9ICHA 3ZSYA 5M1OA 2KHVA 3GSDA 5G0RB 1UWBB 2WVBA 3TTFA 1JLQA 2RLTA 2VKRA 1NSKL 4DV6K 1G1XA 1O03A 1X2IA 3NG8A 3QRPA 3ULEB 4RX6A 1WOOA 4PZOA 3K5LA 3VEOA 1GLEG 4FZNA 4DSIA 2I0XA 1RLCL 2R9LA 1FTCA 3NEKA 2BR0A 3IBWA 3IAYA 2JDJA 4L8RB 3A3PB 2IRXA 1V9PA 4KLEA 4FF2A 4F7VA 4RW6A 5FPEA 4ZLJA 2AWZA 5HO4A 3IWLA 1S9FA 2QMUB 2E1YA 4ZN1A 5AICA 4P2FA 3E01B 1HNXJ 2QK9A 2M4MA 4K0KK 2IJNA 1OH6A 2DHAA 3Q2SC 3A5NC 4FJLA 4R63A 5BR9A 3BY5A 3D2NA 5D15A 2ZIWB 3NP5A 2D3OR 3ATUA 2LDIA 4QYZJ 4PHAA 2E7VA 4PPDA 2QE5A 2AT1B 3B78A 2A41A 3T69A 2HG4A 3GIIA 1QQ5A 5AQZA 3W66A 1ZH5A 9ICJA 7ICNA 2LMIA 3KKSA 2G09A 4OYXA 1RWXB 2PFOA 1S1TB 1R31A 4OYWA 4PKIA 1ZA1B 2YY6A 3AVCA 2NLWA 3SQGA 3M9OB 1T7PA 2VBXA 4B02A 1H74A 8ICGA 2GZOA 2ASLA 3VV2B 4Q44A 1UJ5A 1T0TV 3P38A 1RA6A 3I0SB 4C4WA 1KSPA 3M8QB 1KQGB 1S6QA 1L3TA 1B43A 3C0BA 4LT6A 1VS3A 3IMXA 2GWJA 2RE1A 5E3RA 4CO3A 4UAUA 3NBPA 1C0FA 3CPWR 3UQSA 1X7VA 2EDUA 2D8CA 3UN5A 4M3ZA 1VRUB 2B4PA 5ITHA 4DSJA 4P10A 2L41A 4Y2XA 4KTQA 2AD9A 2L5YA 1KLNA 5SWMA 1HBOB 3VPZA 1V3ZA 1Y11A 3OBIA 1VQOS 2ZJ5A 1I94F 5AM2A 2W01A 5BXIA 4BC7A 1FFVA 4YOTA 2ESEA 2HNDA 4KFBA 2FJWA 3OYMA 2DBYA 3RAMA 4EZ6A 1LCUA 1UCNA 4UQTA 2BOAA 2I5JA 4NCBA 1OMSA 5ALPA 4I2CA 1XSLA 4OJ5A 2WCXA 3NVKA 2GW8A 2YX7A 4J7CA 1ZAVA 2PZSA 2CQ0A 4Y2YA 2BDUA 4I6MA 4IQUA 3M9MB 2YHBA 3TANA 3N4MB 3NF9A 2OD4A 1T9XA 3C28A 2B3TB 2FBTA 4CZGA 1T9VA 5AI6A 5J2EA 3T79A 3SBTA 9ICTA 4RKUC 2HFNA 1ICEB 2YPZA 4YOVA 2VQEK 3AO2A 5IINA 2K8BB 3LDQA 1T02A 3MMCB 4F93B 4EP4A 3R6LB 1ATNA 9ICIA 3MD1A 4QR2A 1HPMA 1U1MA 2P1JA 2Y1IA 4USMA 4CO0A 1ATRA 4AHVA 3VA0A 3MOJB 3OVSA 2CFXA 4CTAB 3HSZA 1YTAA 2FHJD 4PPXA 1HNXF 3K9KA 3I76A 1TV9A 1RT2A 2A10A 2BYCA 3GG1A 5AKHA 4IFVB 2V8PA 1VBKA 2K3IA 5DQHA 5A0YA 4OX9J 1RK8A 2RB7A 3MWPA 3QUQA 3OR1A 4BJQA 4NWBA 2QWPA 4KPYA 3VQ6A 2H3ZA 1NB2A 1VQ9S 2P9UB 3CCSS 4C8MA 4DX6A 3AXKA 1CRXA 1XI1A 4AD6A 1C4AA 2ZJPL 4CERA 3BP8A 5ALYA 1YI2N 5KFPA 3DKDA 3UFCX 2OTJS 4TQSA 1KAXA 4P75A 4LVNP 3U6FA 3J7YU 4KHRA 2YHXA 4UB6U 3NS5A 1NBWA 1Q82T 5AQPA 4BRGA 3LP2A 3DLEB 1EXQA 2YWKA 2W9CA 2CJ9A 2FHJA 2ERRA 1HUXA 1COKA 4KLFA 5HATA 1B0VA 1TMMA 4BRNA 3VQAA 1Q86O 2BJ7A 1HYZA 1LW0A 1A5WA 3LAKA 3CJQA 5AI4A 1H98A 3RRHA 2EFPA 2FYXA 3PXGa 3UD5A 4JV5K 1NK8A 5IOLA 1VLBA 3DLHA 1VQPS 3G4SS 2LECA 3NS1A 1NNLA 4WIIA 5HBMA 5J0WA 1HQEA 3I32A 2IOHA 5C24B 3HHNB 4ZDNA 4Y1CA 3CRXA 5C10A 2NYHA 3CUNA 4J2BA 4DV0K 1S1UA 3CWJA 5KGXA 2ZC3A 1KBRA 5JVGQ 4BC2A 2CGLA 1TZ0A 5DBBA 1F5CA 3U02A 2O8EB 4DTOA 1ZD3A 5HP1A 3J7YP 1B4SA 1HIWA 4EELA 3C66A 3ILJA 4Q0BB 3AU6A 4CZCA 1MWMA 4CJ3A 3M6XA 4QOTA 4NLUA 1DTTB 3O44A 2XI3A 3G96A 1XO1A 1L3SA 1WELA 3TACB 2HHHJ 4LF4J 1ILYA 4M5IA 3MEEB 1TELA 1BCMA 2IVMA 2GCFA 3VEXA 1XR6A 1BPYA 4OYZA 1MMNA 2YKMA 5AQQA 3RSEB 3OJUA 1HUZA 2W54A 4ECZA 1RKIA 4M9GA 4I0WA 4ZJLA 4KV8B 4ZPBA 3M2RB 5J2CA 3AXMA 2QWQA 4ECYA 2ACMA 2I9SA 3LW5C 5DM7Q 4I2DA 4NCGA 1OPZA 4BRDA 3MDCA 3ID8A 2FMPA 1RAEB 4CI0B