1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
3C2KA 1ZETA 9ICMA 3OYKA 4B9NA 9ICJA 4RPXA 1ASWA 4AHTA 4B9SA 1D5AA 8ICEA 3LAKA 8ICBA 2XY5A 3SJJA 1ZJNA 4MFAA 3RH4A 1GOBA 3VA3A 4H4MA 4O3OA 4DTRA 4KB1A 2D5RA 5J2BA 3C23A 3HP6A 4B8CA 4EYIB 4HHTA 3LWLA 2ZJAA 3MFHA 5KFXA 1RDCA 3DM2A 2XHBA 3PW5A 5IIJA 3MR2A 3E01A 4DL5A 4BDYA 4PA1A 9ICSA 3DLHA 3OJSA 5KRTA 1VK0A 4DMNA 3HM9A 1U9LA 3OHAA 4KKOA 1D9DA 4Y1DA 4FJNA 4FZXC 4UB4A 8ICSA 4EYHB 1VSDA 3MABA 2F8SA 3SCXA 2BPFA 5KG4A 4RNMA 2NRXA 4NYFA 3GDXA 4OGCA 1Z25A 5KFEA 3RMCA 4DU3A 5J0QA 3QNNA 3K4GA 1D8LA 4CF1A 3WNEA 2IHMA 1RTJA 2BCRA 2HMIA 3CFOA 4JS4A 4NM1A 7ICIA 1JLBA 3LZJA 8ICVA 3HL8A 3V72A 2DPIA 2XY8A 4C8KA 1UAXA 4KLDA 1JMSA 2Z1GA 1TFRA 4DTPA 8ICFA 4Z4FA 2HNZA 2P1JA 2G8HA 3EPGA 1JL2A 5DG7A 3AA2A 3G10A 3V7KA 2AQ4A 4FS1A 4B8AB 4UB1A 5KT2A 3TAEA 8ICNA 3PX0A 2Y1JA 1O1WA 1S77D 1WSEA 3U3YA 3KD5E 4YR2A 4I27A 2GUIA 3V6JA 3S3NA 5L1IA 2PI5A 4KRFA 2BGGA 8ICPA 3RB3A 1Z00A 4CK1A 9ICWA 3WNHA 4Z4EA 2QXFA 2P5OA 1C0MA 5C42A 2C2DA 5KFMA 9ICQA 3V6HA 4M9JA 1L3UA 5D46A 3AVIA 3AV9A 9ICNA 2HHVA 1K1QA 1TKDA 3L2QA 5KFSA 4FBTA 4F2SA 3SV3A 4Z4IA 5CJ7A 4B9MA 5KT4A 3H4DA 3PR4A 3AVLA 4O5KA 3AVAA 3GIMA 3V81A 4KPYA 3Q8LA 2ZE2A 3SPZA 1J5OA 2YHAA 1WSFA 4DQRA 1W0HA 4M3RA 2BQRA 4KLGA 2HHQA 4CGIA 7ICJA 4AHUA 4R65A 2R7YA 1ASVA 3HP9A 4Z4CA 4CIGA 4GXKA 3NF7A 1QLNA 5J2GA 1XI1A 3KTQA 2MUTB 3IHQB 1S5JA 1KVAA 3TFRA 2C2EA 1HYVA 4GMJB 4JS5A 3IS9A 3K57A 2XY6A 4RQ8A 1NKEA 4IRKA 3P1GA 1U49A 4FM1A 4GXJA 4YFKA 1RBRA 4CJFA 2ASLA 5KG3A 9ICPA 2Z1IA 9ICLA 4IRDA 3QZ8A 4E89A 4FLZA 5J2CA 2KZZA 4FJ8A 4CEBA 2VA3A 3TANA 3AO3A 3OYAA 4QWCA 2YKNA 2Y1IA 4J9PA 2IC3A 2PYLA 1KTQA 1S9GA 4CJWA 3OVNA 4M3UA 1RZTA 1ZBLA 4KHSA 3NF8A 4IDKA 5J2NA 2EX3A 3OS1A 1D9FA 4IG0A 2AJQA 4CJTA 3GIKA 2BQUA 3M9OB 1RPLA 2OPPA 4Z0UA 1C1CA 5T7BA 4IQUA 2KTQA 2PFQA 4LH5A 2R8IA 3ZDBA 7ICKA 1ZQHA 1TK8A 3ZSZA 4R8UA 1KFTA 2IGIA 4M9GA 3SNNA 2V4RA 3VN5A 4P2HA 1TVRA 4Z4HA 4J2BA 3OS2A 1RT3A 4L8RB 2D0BA 3G6YA 4H8KA 3C6TA 7ICGA 1C0UA 2JEGA 1B9DA 2PFOA 1HRHA 1LB2B 4NXZA 5I42A 4FLXA 3AA4A 3ZDEA 4F4XA 1U04A 1JL1A 4DTUA 2B6AA 3QLHA 3V6DA 1C1BA 1JN3A 1X9MA 4TQRA 3ASMA 3MAQA 1HJPA 2G8VA 3I0SA 3AUOA 4F3TA 1U45A 4IFVA 4MFBA 3AVFA 8ICRA 2DFEA 1WN7A 3IRXA 3K2PA 4M47A 4DF4A 3ZT4A 5KTQA 1CLQA 1Z00B 5J2FA 4NLZA 4CEFA 2OWOA 1ZQAA 5HRRA 4PPXA 3H4BA 3OYLA 5CR0A 3C95A 3RJEA 5JUMA 4P4OA 3QEBZ 1IKVA 3LDSA 7ICVA 4DS4A 2ETJA 2W42A 1ZQPA 5J1EA 4CJUA 3PV8A 4DQQA 1BCOA 5J0RA 3NF6A 3MXIA 1XHZA 5TZVA 4ECYA 4KHWA 4PGQA 3NDKA 2VA8A 2FLPA 4F5PA 4Z6FA 3PW7A 3CM5A 2IHNA 1NK8A 4FJLA 4JV0A 4I2DA 3VQ7A 1MQ3A 1ZYQA 4JUZA 3LPTA 3Q8KA 4RQ0A 3ISCA 5HBMA 1A5XA 2ZUCA 5F9LA 4CFCA 4ZTJA 4ECVA 4YNQA 3B6PA 4I2HA 3RB6A 2H5XA 2E6LA 1WAJA 2Z1JA 4I2PA 4J2AA 4R64A 2KZMA 1IKWA 3HXMA 2JZBA 4KHNA 2W8LA 4DLEA 4BGDA 1C1AA 4EZ6A 5K14A 2G8UA 4FO6A 9ICXA 4DTJA 3MEEA 3FYHA 3KK2A 1I3AA 5J0SA 2IBKA 3OYDA 4YR0A 3LALA 3OYJA 3RAQA 4O5BA 1BI4A 7ICTA 4O0IA 4HCBA 4BDZA 3C1YA 5KFBA 2O4GA 3D45A 5KFVA 1IKXA 1JKHA 1T4GA 1FKPA 1RBSA 3C1ZA 4JV2A 3H08A 2IDOA 1WSIA 4DWIA 4J9KA 3OYCA 5KFUA 1YVUA 4I2AA 5F9NA 2F1IA 4NCBA 1G15A 3MGHA 1BPYA 5KFJA 4F93B 1VSFA 5KGXA 3V9ZA 3AA5X 4CECA 4H4OA 3TR8A 3HJFA 5DBBA 4NLKA 5J2HA 4RQ2A 4FW1A 2KFNA 1XU4A 4DU4A 2HVIA 1WSGA 1PZNA 1CXQA 1DTTA 1RDDA 1BHLA 5BPCA 5HMMA 1LWCA 5KFDA 4Q0BA 4X5VA 5J0PA 9ICVA 4I2FA 4LSLA 1UT8A 5CYMA 3MDCA 1CEZA 3AO5A 4UBCA 7ICRA 4CJLA 3KHLA 4O5EA 5DGBA 4MFCA 4RT2A 3VQ9A 2AGPA 4DLGA 4RNOA 3RJIA 8ICCA 3KLHA 4M45A 4PY5A 3UQ0A 4W5NA 5DDYA 5DQHA 3GILA 5HRSA 4RNNA 3OS0A 1KRPA 4LY7A 4TUQA 3C6UA 1UA1A 5DDMA 7ICSA 4UBBA 1UWBA 1NKCA 2FBYA 4FJIA 3B0XA 3SQ2A 4CJQA 2RN2A 5CY4A 2JEJA 4ED3A 3V6KA 3HPOA 4ECZA 2ZTEA 4M3YA 2ALZA 1BIUA 3O4QA 2VG7A 4CEAA 2BCVA 2JEFA 5IINA 1J9AA 4E1MA 3NHGA 4DL6A 4CF0A 3CQ8A 5KFAA 3K5OA 4F91B 2F1JA 1ZQVA 4TQSA 3RRGA 2R8JA 3LANA 4AH9A 4N56A 1WSHA 3HX0A 1ZQCA 1ZQNA 3TAFA 1VRTA 8ICXA 3L3VA 3QEPA 1FKOA 4I2JA 4FW2A 2HVHA 2F1HA 3M8PA 4CK2A 1COOA 1TVAA 1BIZA 2FPMA 1JXLA 3HW8A 4YG2A 4FJJA 3UXPA 4FS2A 4HUGA 4M9NA 4Z6CA 1XO1A 5BOLA 1S0VA 2KFZA 4QZDA 3PR5B 4CIEA 3T5HA 1Q8IA 4CK3A 4FJ9A 5IIKA 2NUBA 1R0AA 4YXMA 2VA2A 4PGYA 2XY7A 4EP5A 3B6OA 5SZTA 2P66A 3PUFA 2P51A 1NK6A 1IH7A 5KFKA 3OYHA 3EWAA 5KFHA 1RBVA 5CHGA 1U4BA 1ZQQA 4KN7A 4J9SA 3JYTA 3RJGA 2JZBB 4XRHA 4HYKA 4FLTA 4DU1A 4F4YA 3HVRA 1A5WA 3TWHA 1RXWA 4MQ3A 3I8DA 4RUAA 1REVA 2HHUA 3ITHA 1IG9A 4I2IA 4KHUA 4FXDA 5L1KA 3THVA 1BI4B 3T5JA 3DRRA 5KG7A 4E7KA 3HVTA 1VRUA 3BJYA 4CJ4A 2WONA 5J2PA 1ZQSA 8ICOA 1JIHA 5FRNA 4IFYA 4BE1A 3ZSVA 3RJHA 4RQ6A 3RAXA 8ICYA 4NLGA 3MR3A 2HHTA 3K58A 4RQ3A 2M9NA 1Q9XA 4E7JA 3LDAA 1SKSA 4FJ5A 4QWAA 3BDPA 1BGXT 3MR6A 1B43A 1BPDA 2XO7A 1RT7A 4B9TA 1DGSA 3JPPA 3AVKA 8ICZA 4W5QA 4QZ8A 2UVVA 1GOCA 2GV9A 4PWDA 3AU2A 3P83D 5KFYA 3OYBA 4IBNA 5J2QA 5KG1A 4DTXA 3SYZA 4IG3A 3A2FA 3MGIA 3Q8MA 2G8WA 1C0TA 2PFNA 3V9SA 4YQWA 9ICRA 5DK5A 1TK0A 1Y88A 4CHYA 1RDAA 4LVSA 2XGPA 2YNFA 2GWSA 2KW4A 4LSNA 3DI6A 4DTMA 2NRZA 4QWBA 4P4PA 1ITGA 4XIUA 3MXJA 4CIFA 3OYEA 4ECQA 3OJUA 1JLGA 4M3WA 4XQ8A 1S1UA 4JLHA 4CEZA 1JLQA 2BE2A 4HCCA 1N6QA 1SUQA 2FC0A 1RNHA 1JLAA 1ZQZA 4MF8A 1VSKA 1IXRA 1TK5A 1KVBA 4E0DA 4EP4A 7ICOA 5EOZA 4FM0A 1BL3A 1NK9A 2VWJA 4QWDA 4HVJA 4Q43A 4QZAA 3KLEA 4CJPA 4DQSA 3C21A 3L3UA 1BQMA 4IR1A 4B9LA 1N48A 7ICPA 3RJKA 4RW7A 4FZYA 4DL2A 2PYJA 4DQIA 1TV9A 3C5GA 2ITGA 3CM6A 3HPGA 1NOZA 5J0UA 3T19A 5KT3A 1ZQXA 1NK4A 4B9UA 2ASDA 1X9WA 4I2CA 4FZZA 3ZSXA 1KFSA 1HYZA 4FJMA 3P5JA 4EEYA 1RYSA 2BPGA 1QSSA 4IRCA 4ED7A 1NJXA 4M6WA 3TAPA 1ZQGA 1HPZA 2A1RA 2BCSA 2EHGA 3IG1A 3LP3A 4Q44A 3SPYA 2X74A 3RBEA 4M2YA 4YR3A 5KFLA 1TGOA 2A1JA 5CZ2A 1LAWA 4KFBA 3T5KA 1B22A 4DSFA 1HNIA 4AHCA 4RW9A 1S1XA 3UXNA 1CZ9A 1U48A 3QE9Y 5KFPA 3AVJA 4F3OA 2ZTCA 4CCHA 2W9AA 4ED6A 3DYAA 1SKRA 3H7IA 3Q8SB 4QZ9A 4YMMA 1XWLA 2FPLA 3KLIA 5DLFA 4M0AA 2I9GA 3SUQA 5KT5A 4DSLA 4JWNA 1RTIA 1ZQJA 2Z1HA 4FLYA 3TI0A 5D3GA 4QZHA 5FROA 9ICFA 2P5GA 4FJKA 4O5CA 3ZT0A 3MBYA 4ZHRA 4W5RA 2ZUBA 4CEOA 4IQVA 3PVXA 1JLCA 2AQ0A 3NTUA 1RTDA 4KB0A 4I9QA 3C94A 4GLXA 4O4GA 2ZUDA 1MSWD 1Y97A 5C24A 3VQAA 1NJWA 4W5TA 3RR7A 7ICQA 3S9HA 4KLSA 3JPNA 1SL1A 1L3TA 4CHOA 3S3OA 3T5LA 1WLJA 4DTOA 3QESA 1XC9A 4NY8A 1NK0A 4CHQA 4PHPA 3HPHA 2QK9A 4NM2A 5DB8A 1EP4A 3WNFA 4FLUA 3AVMA 4R63A 1KCFA 1ZQKA 1YT3A 3O4NA 2VG5A 5KFTA 4CESA 2W9CA 1JLFA 1RBUA 1NJZA 4LZDA 4OVLA 1BPXA 4ED0A 1TV6A 3O3GA 5DG9A 4CHZA 5KFNA 3JPTA 1A76A 4BWMA 3GIJA 2FPKA 1QS4A 1VSMA 1BPEA 1HQUA 4F50A 4RPYA 1QSLA 8ICGA 4O55A 3QEIA 3MFIA 1K6YA 4MEYA 2ISPA 4W5OA 4KREA 5HHIA 3PNCA 3LWMA 3TAQA 1XS9D 8ICAA 9ICBA 2G8IA 1LWEA 4UAYA 4PHDA 1B92A 3HWTA 1T7PA 2NRTA 3AO1A 4CFBA 4KLOA 2J6UA 5EU7A 3AU6A 1MC8A 2YNIA 4QWEA 2W9BA 3QEWA 1SL2A 2I1QA 1RT5A 1J54A 4DFPA 3KKSA 3FFIA 2C2RA 2B5JA 3ISBA 1S1WA 3QEVA 5DG8A 2BGWA 3ZDAA 4E19A 4KLIA 4P4MA 3M9MB 4LH4A 4CJEA 4E1NA 2A1SA 3M9NB 2X6NA 3NFAA 4BXOA 1XSLA 4CFDA 4K4HA 1FK9A 1BPBA 1C7YA 2IS3A 3V9UA 4F4KA 4DL3A 1ZQMA 3V1OA 4YFUA 5EWGA 2NRVA 4UB5A 4F4WA 4CJSA 3TFSA 1HUOA 2ZJ5A 1X9SA 2UVUA 1A5VA 3MECA 1EX4A 4CHNA 3DRPA 4CEEA 4CJKA 1ASUA 4YCXA 1ZQFA 4M6WB 3SUPA 4QZBA 3K5LA 2QKBA 9ICEA 1TAUA 1QSYA 4EZ9A 4ECUA 8ICTA 5KFRA 5E41A 5HP4A 1L3VA 1XSPA 2FMPA 4TUSA 3H8WA 5KFWA 4ED1A 3KK1A 1DTQA 3I0RA 4FLWA 2ISOA 2ASJA 4ID1A 3UPQA 1QE1A 1LW2A 1KLMA 3DLKA 2VG6A 4BE0A 8ICHA 4EBEA 3UQ2A 1TL3A 5CP2A 1HQEA 2IOCA 2AGOA 1RYRA 4R66A 4I28A 4KTQA 4DO9A 3K5MA 3QIPA 2J6SA 3NCIA 3AO2A 4KN4A 4UB3A 1JX4A 5J2MA 5I3UA 1Z26A 4PQUA 3K59A 4TUPA 2ATQA 3RBDA 3VQDA 3OYFA 4N76A 5CB1A 4QZCA 5DB9A 3IM1A 4XUSA 5CZ1A 3QERA 4QZIA 4R8UB 2VANA 3RR8A 2HHSA 4CJVA 4JK1A 4CE9A 3PW0A 4KLTA 4DSKA 4YMNA 3MDAA 1MQ2A 4FVMA 2NRWA 1VSEA 1ZBFA 1HMVA 4I7FA 4CGHA 1KEJA 1FXXA 3KHRA 4MF2A 1T3NA 5KFGA 3Q8QB 3OGUA 3SQ4A 1T8EA 3LP2A 3G0ZA 4FJGA 3RTVA 4DOCA 4CGDA 4I9LA 1WAFA 5D49A 4J9RA 4M9HA 3B0YA 5KG2A 4RT3A 5IIIA 3EZ5A 3GV8B 5IIMA 2AGQA 4F92B 1W9HA 3VQ6A 3CG7A 2WOMA 5DB6A 4DSIA 5DLGA 4OLBA 1S0NA 3KIOA 4C8NA 1IM4A 4I29A 4DTSA 2C28A 3EY1A 1VSIA 4KHYA 1UT5A 4Z6EA 9ICHA 4B08A 2RPIA 3DRSA 5IILA 1S0MA 1T03A 1NOMA 3OSNA 4DQPA 4I2QA 2XGQA 1EETA 4FK0A 2RKIA 4QW8A 2E4LA 3C2MA 1LWFA 2HNDA 3H8SA 4CEQA 3HYFA 3SI6A 4TURA 4KLJA 4J9OA 4F4ZA 1LAVA 4CFAA 3UXOA 3ZDCA 3SUOA 3G6XA 3ZSQA 4IQWA 2HHWA 1RXVA 2YHBA 4GXIA 3MEGA 1ZQBA 2J6TA 3AVGA 4UAZA 2OPRA 2AU0A 2RF2A 2R8GA 4ICLA 4HUEA 2ATLA 3V4IA 3RB4A 3VQPA 4KV8A 5KFIA 1N56A 4O3SA 2BDPA 3AVNA 4BXOB 4E3SA 4CERA 1HNVA 1KFDA 3GV5B 1S1VA 4QCLA 1V9PA 5DBAA 2JGUA 3KD1E 1J53A 5BOMA 2WTFA 7ICFA 1RT1A 2E6MA 3GQCA 4KLQA 2ZQBA 3GFKB 3QETA 2MUTA 3VQBA 2UVWA 3PMNA 4F2RA 4CGJA 3RWUA 1A77A 4F5OA 4KAZA 4J2EA 1S76D 4PHEA 3OHBA 4E7IA 2O4IA 2YV0X 1ZQWA 5KG5A 4UQGA 3HSTB 4DOBA 2B4JA 3HO1A 4OKJA 2DY4A 4KO0A 9ICAA 3ZT3A 5J2JA 1TKZA 1QHTA 4RPZA 3PX6A 5CWRA 1GOAA 4NCAA 3LPUA 3TARA 1UA0A 4GC7A 5DKWA 5J0OA 4CJ5A 4OGEA 4YN4A 4QZEA 4M42A 3V1QA 3PW4A 3LZIA 2QKKA 3ISDA 4RW4A 5DMRA 2YNHA 3SQ1A 4O44A 2G8FA 4IKFA 2BPCA 4O0JA 4O3PA 4QZGA 3SI8A 1X2IA 4JV1A 2RDJA 4B9VA 4O3RA 4FCYA 3SV4A 1C6VA 4PHAA 3GIIA 3BQ1A 3VA0A 4ECXA 1BISA 3CYMA 2P6UA 4G1QA 4ECSA 2R8KA 4K8XA 3LP1A 4J9MA 4HUFA 4AILC 4KLFA 3ZD8A 3DLRA 3K5NA 2YNGA 3F9KA 4QAGA 5J2KA 3ZSYA 4RW8A 4KLEA 1ZQTA 4TSXA 2D0CA 5SWMA 2BCUA 2X6SA 2KQ2A 5C25A 1Z3EB 3G6VA 4BE2A 1RTHA 2ZJ8A 4KLMA 7ICHA 1KLNA 3U3GA 4CEDA 5DQIA 2BHNA 3NGYA 1NKBA 4RQ7A 3N4MB 4ELVA 1L3SA 2W8KA 3V7LA 5KFQA 3E2EA 3MR5A 4PUOA 5HP1A 3HK2A 2FLNA 2PXIA 4Z4GA 3O3HA 1ZQRA 3QO9A 3JPRA 2DFFA 1SKWA 4GW6A 2PI4A 3CFRA 4KI6A 4DFKA 1TKXA 1EKEA 8ICWA 1WCLA 1ZQLA 2X78A 3ZT1A 4QZFA 3ZSWA 2ZTDA 4DSJA 1WCNA 3RRHA 4KLHA 1RILA 1RT2A 4C8LA 2BR0A 5KT6A 2XCPA 4RUCA 3RMAA 3T3FA 3KJVA 3F73A 4J2DA 4G3IA 2VWKA 1S6PA 3O3FA 4EBCA 5DQGA 3KLGA 3RMDA 4ZH4A 4FBUA 1S97A 3DMJA 1VSLA 2BCQA 1T05A 3NBPA 3PX4A 5KFZA 4DOAA 2B21A 4FYDA 4KITB 1RCHA 9ICUA 3MEDA 4ED2A 2IMWP 1CXUA 4CF8A 3ALYA 3OY9A 4DSEA 4FM2A 2DTUA 2ZD1A 3RJJA 2V9WA 4BWJA 1S10A 4Q5VA 3V1RA 1YTAA 5KFCA 4F5NA 2LYHA 2PFPA 1UOCA 4FK4A 5EWEA 2FMSA 2I5JA 5CYQA 4FK2A 3U6FA 3OYNA 4ELUA 3PO5A 2GBZA 1XSNA 3HT3A 4GVMA 4OPKA 4KHQA 4DS5A 5HLFA 2FMQA 4ZTFA 5FRMA 5KFOA 2DFHA 1DLOA 3KHGA 3GV7B 3L2VA 4J9QA 4M04A 5KRSA 3RH5A 1XHXA 1ZQYA 4O9MA 4Q8FA 1N5YA 1HUZA 4GC6A 3RH6A 1EXQA 2YKMA 3AO4A 3JPQA 5DGAA 3RB0A 4CGGA 4CHPA 1ZQDA 3CFPA 3V9XA 1S0OA 3VQEA 1KVCA 4WE1A 1BPZA 3TAMA 3EYZA 3JSMA 3NGIA 1DOQA 5HHHA 2FBVA 4ECWA 2FBXA 4Y1CA 3NAEA 1WNSA 7ICNA 3OSPA 5J29A 3L2RA 1AROP 1KSPA 3DOLA 5J0XA 4KMUA 4M3TA 3DLBA 4J9LA 5J2EA 1NOYA 3V9WA 3Q8RB 4NYNA 3DLEA 4YMOA 8ICLA 3LAMA 3NGDA 4KTZA 3H8JA 3Q8PB 9ICOA 4I2BA 4ECRA 3PO4A 1LV5A 3KK3A 1ZQOA 4E7LA 4N5SA 4E7HA 5C5JA 1S9EA 4B3OA 2HNYA 3ISNC 4F8RA 5KG0A 4CGFA 3VQQA 4OKEA 1QTMA 8ICIA 2OYQA 7ICUA 8ICQA 2D0AA 1ZQUA 5HRPA 3KLFA 4QW9A 4AHSA 1D8YA 3SZ2A 4XA5A 1F21A 4NCGA 4AHRA 4RQ1A 4J9NA 4BACA 3L2UA 3JPSA 3QNOA 4M3ZA 4FJ7A 1SZPA 4RG8A 5JS1A 4KI4A 2KZ3A 1TAQA 3ZT2A 3PW2A 3VQ4A 4YXJA 4YP3A 4I2GA 4DTNA 1VSJA 2OA8A 4N41A 3BQ0A 4R5PA 5FDLA 1ZBUA 2Q0ZX 3OYGA 4RU9A 3M8RA 5HNKA 2JEIA 3ZSRA 3PY8A 1HYSA 1BQNA 1S1TA 1LW0A 4M9LA 3ZD9A 1RT6A 4Z6DA 5D4BA 3MXMA 3LP0A 3AA3A 4OPJA 2HHXA 3ZDDA 1RBTA 1S9FA 1I39A 4DFMA 2OPSA 1CUKA 3JPOA 5L1JA 3N97B 1H38A 4DL7A 3TABA 5KFFA 4JRPA 4LD0A 5KGWA 3KKRA 3IAYA 4KLUA 5L1LA 4OLAA 1SL0A 1NJYA 2Q3SA 4BDPA 3S3MA 4I2EA 2RDIA 3VQ8A 2JLEA 1RDBA 2MAXA 5HRNA 5KG6A 5HROA 1EXNA 2BKEA 3M8QA 4DF8A 1RT4A 3QEAZ 1X1PA 5L9XA 1SV5A 1K1SA 1KDHA 1TL1A 9ICKA 4RZRA 3KHHA 2DFLA 4C8OA 1BCMA 2A1JB 4YD2A 4Q8EA 1ZQEA 4N47A 4QOZB 4CJ3A 1YTUA 2HB5A 7ICMA 4MEXA 3SQ0A 4ELTA 1WSJA 3ETLA 4OKKA 4UAWA 1JXBA 1TKTA 3L2WA 2F8TA 2FBTA 1NK5A 2KN7A 4F5RA 1QQCA 4CF2A 5J0YA 5J2IA 3ZCMA 3L8BA 1U47A 1ZQIA 3V7JA 3QIOA 3M8SA 3WNGA 4MFFA 3SUNA 4FLVA 2LSNA 4RQ5A 4ED8A 4EBDA 4K8ZA 2PZSA 3ULDA 3FDSA 2F96A 1ZJMA 3PMLA 3K75D 4O3QA 2BANA 3QINA 4OJRA 4DFJA 1IO2A 4JRQA 2PY5A 2XC9A 5DB7A 7ICEA 5J0WA 3AVCA 3DOKA 3UIQA 2R8HA 4M41A 2V4QA 3VQ5A 5IIOA 4IQTA 5EWFA 4K4IA 3AVBA 4HTUA 3D0PA 4UB2A 2C22A 3AVHA 4DEZA 9ICIA 4KTWA 4YVZA 3C5FA 3VQCA 8ICUA 3RJFA 3TAGA 1Q9YA 3NF9A 4K4GA 2W9CB 4O3NA 4AHVA 9ICCA 4LZGA 3QZ7A 9ICGA 3NGZA 4ECTA 3DLGA 3H40A 2OZMA 2P6RA 1VSHA 1JXEA 8ICMA 1JLEA 5CA7A 4PGXA 4JWMA 3LK9A 1L5UA 3EW9A 2OZSA 5KT7A 2XRIA 4IR9A 1S6QA 3EPIA 1ZBIA 5HMLA 3NH2A 4F5QA 4FJXA 3BQ2A 2IA6A 2FLLA 1HJRA 2HW3A 4CJRA 3T1AA 3BQTA 5DBCA 4DL4A 3RMBA 5J2DA 2G8KA 1BVSA 1ZBHA 2W9BB 2XCAA 5KI6A 3NH1A 4Q45A 3QEXA 5JS2A 4DG1A 3OYIA 3ORYA 4FJHA 9ICTA 1MU2A 3BGRA 1CZBA 4KLLA 4ID5A 4CF9A 7ICLA 4RQ4A 5J0TA 3TQ1A 2DPJA 3C2LA 3ZSOA 3NE6A 2BQ3A 4M3XA 5J2AA 1NK7A 2OPQA 4YD1A 1B9FA 4NLNA 8ICJA 4C8MA 3NH0A 3OYMA 1IKYA 2IAJA 4PH5A 4RW6A 8ICKA 2W9MA 2UVRA
chains in the Genus database with same CATH superfamily
2OUGA 3TA0A 4LJMA 3MECB 3WQPA 4TY9A 2V4JB 3TADC 2WUSA 2G5HB 4DL0C 2DNLA 9ICJA 4RPXA 1QUVA 4AHTA 3LDLA 2ZBRA 4FZMA 3C6HA 4FYWB 2EBGA 2VBXA 3C16B 2DIUA 3HZEA 4R25A 1TFWA 4NO7A 3FEXB 5CXTA 3UE5A 1GOBA 3H2UB 3VA3A 4ICAA 2NYIA 2OSRA 1YIJS 4JI1F 4DTRA 4RX6A 5J2BA 5FPNA 4EYIB 3AJ1A 4US8A 1RDCA 2W25A 3PW5A 3MR2A 4HACA 3E01A 3KG0A 1X5PA 2V2VA 4BDYA 5EHHA 4DMNA 2ROEA 2VH7A 6AT1B 1SJQA 2GAHC 2WFAA 2GELA 3IKMA 3BM7A 3IBFB 4PQUB 4DDFA 2QEXS 3KUGA 4UB4A 1RFQA 3ZX3A 2HK3A 1U0HB 1WUAA 4OFZA 3AAPA 3CMAN 2E1FA 2BPFA 1SQGA 2D3DA 4Y2PA 5KFEA 1HMVB 3RMCA 5ALJA 1GH8A 3CQXA 5J0QA 3QNNA 3F2CA 4CF1A 2RSQA 3Q8YA 3VEVA 5KQ8A 2IHMA 3MX5A 3TEHB 2YWKA 3CFOA 4FDFA 3LP2B 2BABA 3K2YA 2GQ2A 3DOKB 2NPIA 4NM1A 3MM6A 1N52B 1JLBA 3MMBB 4X65F 2XY8A 1UAXA 4KLDA 5DDQC 1JMSA 2HBZB 2FI1A 2GO7A 2ZZNA 1K9MT 2JV3A 3CW2C 3SAHA 2V67A 2XHWA 1HNZK 1PK1B 1JL2A 4BVOA 2O66A 1Q46A 1SIWB 2J9DA 3V2UC 1C0GA 3NGSA 3H5UA 4B8AB 3O0FA 5KT2A 2JH3A 2ZWPA 4F0MA 1VISA 2UYTA 2HKEA 1JLEB 8ICNA 4USUA 2V94A 1O1WA 4JKCA 1WSEA 2C2ZB 3J7A1 3N6NA 1RAGB 3IWLA 5GAGP 3R3TA 1LWFB 3DWLA 4ZVPB 4M5GA 8ICPA 3RZAA 3R2DJ 2XI9A 4FXWA 1EWRA 5TISU 3MD3A 4M9JA 1HKAA 3AVIA 2G2OA 1RJJA 1BA0A 3H90A 2YMQA 5KFSA 4FBTA 4OMFG 3SV3A 4Z4IA 4TVAB 4DG1B 3MEGB 1ZZFA 3H4DA 1UVLA 3TU5A 1MU2B 2VC0A 2ODGA 3GIMA 1OIAA 1IR0A 4CBWA 3EVWA 1VQYA 3CPEA 1VQOS 1TR0A 2B4UA 3MDQA 3NWGA 3QWPA 4PG4A 5AE3A 4DCOB 4KLGA 2HHQA 2YKQA 2ZUGA 4JKFA 5B8HA 4OYBA 4R65A 2IAJB 2R7YA 1OH5A 1MN8A 2KSOA 3C7NB 2H65B 5J2GA 4WXWA 2AD9A 3CC4N 3AFGA 1S5JA 2RRAA 2FVSA 1KVAA 3AQFA 5GAEI 4FPBA 3OVBA 4JS5A 2M0NA 3D54A 4WFXA 4BQZA 3IS9A 3ZX0A 2XY6A 3MCNA 4IRKA 4K2XA 3NMUA 1NGFA 3P1GA 4FM1A 3WUHA 2J5AA 4M5DB 2ASLA 2LDYA 3UVJB 3MM8A 1YLXA 4FLZA 2ZH1A 2YH1A 3J80Y 3D2EA 4FJ8A 3UD4P 3L5KA 2YKNA 2PYLA 4JYAJ 3RSEA 1KTQA 1S9GA 3U1MA 4DUYJ 4KHSA 3G2XA 5ETMA 4IDKA 4BBYA 1ZD2P 3SFGA 1IBCB 3D1HA 3DLLL 3O9UA 5AQIA 2Z56B 3PDNA 3WKAA 5C0YA 2NSBA 1EKSA 4YOUA 4LFBJ 4JK8A 4IQUA 2KTQA 1FD8A 1PVPA 2DY9A 2J7UA 2LQJA 5DM7L 4CZLA 5IC4B 2VJ5A 3LP1B 2FZKB 1WG1A 7ICKA 2X51A 1ZQHA 1XNQK 3ZSZA 5CD4H 2IGIA 3B82A 1FVQA 2R2UA 3GB0A 4CT9A 1UL3A 4M9GA 2J9DE 2V4RA 5GMKa 5F3TA 3SNNA 5AQVA 3QAUA 1Z1BA 2HMIB 1R7IA 1RT3A 4H8KA 7ICGA 4CTAA 3G4SS 4CRXA 3AMZA 4ATNA 2I38A 3KZIU 1HW9A 5AQXA 3KD3A 4IO9L 1CJTB 4K59A 5I42A 1F5SA 3ZDEA 1EQYA 5J8YA 1U04A 1L8LA 2B8PA 2PN6A 1LOTB 1JL1A 4DTUA 1LWXA 2KRRA 1PILA 1C1BA 2BW2A 2DNGA 3MMCB 3ASMA 3W7BA 2G8VA 3AUOA 1A0PA 1T6CA 3D3BJ 3OTOF 4GKKF 4F3TA 1QH9A 3W2VA 4A8OA 2YCHA 3Q7CA 3OXFA 1YK9A 4M7YA 5F3ZA 5HVFA 2WCXA 2V0NA 2CQDA 4IWVA 3ULEB 1ZQAA 4OCZA 2DTJA 4C6AA 2WTUA 1CVJA 1SC6A 3CGIA 2J0WA 4AXIA 4MAKA 4FZLA 2V6AA 1VQ7N 5JUMA 3BBCA 1GT8A 3KKAC 3CJQA 4DS4A 1IQTA 1BA1A 1ZQPA 4YHHJ 2QE5A 1N5SA 4ZN3A 4J8FA 2VASA 2W01A 4M1KA 5D15A 3NF6A 2UU9K 3V81B 2FJDB 1B0XA 2LQ9A 2XM3A 2ZD1B 5E26A 2EKNA 4MKAA 2M8HA 4Z6FA 4XTTA 1D8ZA 2IHNA 3MGVA 1SQEA 3Q83A 2F3NA 3JS9A 1CULA 4QIFA 3HTVA 3HSJA 3VMFB 8RUCA 1ZYQA 4JUZA 4DR5J 1G99A 2XWXA 4C11B 4GVBA 1GLLO 2UXBF 4HKQA 3B6PA 4HTLA 4NMLA 2H5XA 5AK6A 1WAJA 2F7VA 3BF1A 2HVEA 2ZWHA 5CD4A 3ZZUA 4J2AA 1WBBA 4I6MA 2KZMA 3R7SB 3TEGA 3HXMA 2JZBA 4UUXA 5AXNA 2W8LA 4EZ6A 2PMWA 2FJ6A 5ETKA 3N4PA 2HHHJ 2HDOA 4EIAA 1DBDA 4ES1A 2WBRA 3C29A 2D0PA 4WE1B 3KK2A 5ETVA 3TAMB 3HI0A 3OYDA 4BC4A 3H1QA 3JTNA 3RUBL 5CHCB 3LM2A 4FF3A 7ICTA 1F44A 4ILLA 3THXA 3QGHA 2Y1RI 5KFBA 1HPMA 2QSFA 3F44A 1O03A 2JWKA 2KHCA 4HTIA 2FZCB 3C1ZA 4BC2A 1YRXA 1YVNA 2DGOA 4DWIA 3IAM9 2YKOA 4UB6U 3CJKA 4WK1A 2HHHK 1PJ7A 5F9NA 4NCBA 2XMKA 4JD2B 4C0ZA 5BYRA 4YY3J 2OTLN 1Z4OA 4F93B 1VSFA 2I9SA 3EN9A 1S59A 2ZZTA 3LDOA 2FVQA 2A6MA 5J2HA 3SXLA 4RQ2A 1TVRB 2KFNA 1XU4A 2MKCA 2GA7A 1PZNA 1DTTA 4GMKA 7FD1A 5BR8F 1LWCA 5KFDA 4Q0BA 2PFDA 1UEUA 1HBMB 1VMBA 4ZLLA 4I2FA 1YJRA 4NCGB 1CEZA 7ICRA 4N7TA 4DN0A 4O5EA 4RNHA 5DGBA 4DUTA 2AGPA 3QLHB 4MK8A 5ALDA 1WF1A 3RJIA 2AA4A 4M45A 3G6EN 5ALPA 2IIHA 5CHIA 4PY5A 3EE3A 2ZNYA 5ETLA 5ALRA 3OFGA 3QXGA 3SQGB 3HDSA 2CQGA 2LQBA 4TUQA 1MW7A 3C6UA 4R5PB 4DR3F 1FDBA 1UA1A 5DDMA 5B08A 5F8HA 3UI3A 1NKCA 2FBYA 1F3VA 4ACOA 4ETZA 3TOQA 5DZ7A 5IT9Y 4FJIA 4CJQA 1RB0A 3DC2A 1N32F 1WNEA 3HPOA 2OEKA 4ECZA 1LW0B 1N4LA 2ZTEA 2E7XA 2ALZA 2OH2A 3EZOA 1F3FA 5DDRC 2WVFA 4ID8A 2D7SA 1J97A 1N88A 1UZHA 4A5BA 3P4UB 4C3MA 3NCQA 3NHGA 4CF0A 1CJUB 5KFAA 4NL9A 2GGPB 4F4AA 2F1JA 4M8LA 1SAZA 2R8JA 3FZKA 2FF6A 2MLXA 2UZAA 2P9KA 4QYZK 1ZQNA 2DYAA 2I5HA 4LF6K 4RQNA 2KM8C 1PYSB 2GWJA 1UMJA 1QVFM 3OPKA 1QHAA 4V19X 3DNCA 3M8PA 4OJ6A 1COOA 3BSAA 1TVAA 2EBEA 1ZPWX 3DHWC 1BIZA 2FPMA 1N0UA 4M9NA 4Y0FA 5IT9O 4MTPA 2CQCA 3LA0A 4ZKAA 2KFZA 3MM9B 2W1BA 2JMGA 1VCTA 1SV5B 3VZIA 1R0AA 4YXMA 4P9SA 3GZ7A 4NLXA 1UEVA 2OIHA 4EP5A 3B6OA 4OI0A 4CWBA 1P8ZA 4C3KA 5DZ6A 2P66A 2UXDF 2MSTA 3D67A 4H0YB 3TACB 4P2XA 5KFHA 5CHGA 3ZZOA 4I2PB 2QWRA 4QJVA 2LI6A 4J9SA 3KOOA 4XEIA 3LOUA 5BRFA 4FLTA 1DY3A 4F4YA 2CPIA 3EL2A 2A40A 2O8CA 2QKQA 1RAIB 2A6AA 3QUQA 4JI8J 2GMJA 2HHUA 2HSZA 3Q23A 5LSOA 1F6TA 2QI2A 1VRUA 4YORA 4BR4A 4M5KA 3N7PD 1ZQSA 1B64A 4U67Q 2ZJQQ 3CIMA 2LYBA 1UHUA 4BE1A 3ZSVA 2CQHA 2HZAA 1PJ5A 2BANB 4RQ6A 3HOTA 3UM9A 3MEKA 2WHEA 1ZC6A 5LL6d 1SKSA 4YB6A 3A8JA 4BRIA 4QWAA 3BDPA 1BGXT 4K4XA 1B43A 4H4OB 1RT7A 3QATA 3D9BA 4B9TA 4DR2J 4DN9A 1DGSA 8ICZA 4Z7CA 2BW7A 4W5QA 4QZ8A 1MWKA 1RQLA 1XUPO 4IG3A 4ZA1A 3KUHA 1IN0A 2WAQF 1TZ0A 4A5AA 3CD0A 1FWPA 2DL0A 1VAZA 2KHOA 1XR6A 2YNFA 1S7IA 5HJXA 3BS5B 1FRKA 2KW4A 4LSNA 3QUBA 3DI6A 4URSA 3QX7A 4QWBA 4A2AA 4ES3A 5H9EJ 2HLUA 4CIFA 1X6IA 3EO3A 4OIXA 4ECQA 1NXIA 3OJUA 1JLGA 1S6QB 2CWXA 2BKOA 3DGPB 3MUTP 3QDKA 3BGOP 2BE2A 4K4SA 4HCCA 1ZAWA 1N6QA 1SUQA 1KS2A 1RNHA 4B1XB 1C4AA 3CCLS 2UXCK 4MYTA 4P2FA 2I2YA 1VSKA 3PSFA 2VWJA 3I8BA 3MPWA 4QZAA 1M5HA 4CJPA 4DQSA 3L3UA 4LT6A 3LVVA 3NVKA 1A6LA 2X3GA 2CNKB 4NXNJ 4FZYA 5LT5A 4PKDB 3GDQA 2ITGA 1HWJA 1H74A 2QTDA 2XMJA 3HPGA 1NOZA 4JMUA 4PPZA 2VQFJ 1RBLA 2ZOMA 3E8OA 1Y5NB 5IT4A 3BR8A 4DX7A 1R8CA 1NK4A 2C2OB 4L72B 5CR4A 2C3PA 4KYZA 1X9WA 4I2CA 3IRWP 2ZHAA 1KFSA 1ZAXA 1RYSA 2CPEA 4ED7A 2D3OR 4DR1K 3WXJA 4M6WA 2F44A 2J76E 1RA7A 3QU5A 2CYYA 3AOAA 3LP3A 4Q44A 3NAIA 2X74A 3U9ZA 5CZ2A 3ZTSA 5LSRA 2L41A 4NRTA 2EC0A 5F3XB 4FWQA 1U48A 1TL5A 3D7SB 2I7PA 4ZPDA 4OJOA 3FZHA 3ITHB 4JP8A 2HOEA 3Q8SB 4IOCQ 4QZ9A 3MN6A 1OVQA 3DRRB 1GO3F 2ZHBA 3BPDA 5DLFA 5J2PB 4DSLA 4OZNA 4JWNA 3QRQA 1FFSB 4FLYA 3BQ7A 3TI0A 4MLHA 5AKJA 5FROA 9ICFA 3CB4A 2P5GA 4FJKA 4W5RA 5LL6Z 2CZ4A 2HIQA 3PVXA 1JLCA 2AQ0A 4ZPBA 2HRYA 1FRHA 4NLCA 2VKQA 5CQGA 3J7Z5 4NYOA 5A8WB 1QAIA 3GJTB 1S4EA 5KOXA 4O4GA 2KN4A 4FFDA 1NJWA 3VENA 4IOBA 1FHTA 3S9HA 4PWDB 3JPNA 1VLBA 1WLJA 4UOHA 1HJOA 4DV5K 1PGZA 4B02A 4PHPA 4ANCA 4BROA 4NM2A 3NS6A 1NI3A 1YJWS 3WNFA 4FLUA 5AQHA 1H6KX 1YT3A 3D1OA 1ZD4A 1ZM2A 2DISA 4AM7A 1IUJA 4KGXB 4JI5J 1RBUA 1XBWA 4LIWA 1G7CB 1TAMA 2PMZD 5KFNA 3ETOA 4C2MA 4YOWA 4B3TF 1N62A 1A76A 2FPKA 5B0GA 1QS4A 2KG5A 3EXYA 4DUZF 2ZVIA 1KKHA 4O55A 3QEIA 2A41A 3PRVA 3UKUA 4U7CA 4KREA 2R7WA 1JLQB 3BGLA 3CNHA 3TZXA 3LWMA 3TAQA 1FNMA 3OXGA 1AW0A 4JI5K 9ICBA 2F9TA 2G8IA 1B92A 2RQ5A 1Y3KA 3C15B 2XLJA 1OXJA 4KLOA 5A2QY 1CS4A 1XK8A 3CCSS 2V68A 2E8NA 2W9BA 3QEWA 1H0HB 1SIZA 2IJRA 1SL2A 2I1QA 1RAJA 2RRDA 2XZDB 2GVZB 4J7CA 4I64A 3M32B 2D3UA 3H98A 3R5CA 2BGWA 1DKGD 1LKYB 2PT0A 3BBBA 1U1QA 4BXOA 2YTCA 4CFDA 4UZBA 4I6AA 2A3VA 5AQTA 4F36A 5BRDA 4EO6A 5AI6A 3CWJA 4Y2CA 3J7AN 2UV8A 4ZJQA 5M1OA 1HUOA 4QR1A 1NPRA 1X9SA 5GMEA 1X9JA 3MECA 3IM8A 1EX4A 1X4HA 2XMAA 4CHNA 4CEEA 4CJKA 2M70A 1UVMA 4Y3CA 1VQKN 2VV5A 9ICEA 4QJFB 3IBWA 1VQPN 1CRXA 4EZ9A 4AQYF 1HIWA 2KG0A 3C16A 1XSPA 3EKUA 3D6HB 4ED1A 2KJ5A 5AM0A 4USMA 4QS8A 3GONA 3UPQA 4DB3A 2V8PA 3QJPA 5KNIA 2IC3B 3CO9A 3SFUA 4BE0A 2ZKTA 5H9FK 2G0CA 3I56S 1ELOA 3I33A 1RYRA 3VTHA 2LKZA 2IVFB 2QWQA 1PYTA 3ZTPA 3NCIA 2XS2A 3GYGA 3GFZA 4CIOA 1U1MA 5HMYA 4L75A 3D2WA 2N3LA 1JX4A 1IM6A 2OPPB 4K50A 4H5TA 2XZTB 2A2CA 3BDEA 4PQUA 2W54A 3L0QA 3K59A 4ILRA 3VQDA 2AP6A 3HLUA 1DGJA 2B4OA 4WP3A 1JXVA 4QZCA 1WC1A 3PACA 1U0HA 4XUSA 4QZIA 3FC4A 4R8UB 3RR8A 1YQHA 4CJVA 4FPIA 3Q89A 1ZOLA 4JK1A 4FNHA 3S7RA 5ADXH 2JWNA 1TU0B 4X64K 3AXMA 4KAIA 4XK8C 4ED5A 2RT3A 1RTDB 1U0SA 4DR4F 4DV6J 1P7DA 1HMVA 4P7VA 1DGKN 3AA8A 3NP5A 1OQ6A 5KFGA 2XMVA 1C0UB 2E5GA 3CD7A 4JI3J 3OGUA 2KHQA 3C46A 5C24B 3PTWA 1FDAA 3LP2A 1LFWA 4FZNA 1YJUA 4FJGA 3RTVA 4KE5A 2KXHA 3MMBA 1WOPA 3KHYA 1O6XA 4NA2A 1VQMN 3V6DB 1FDNA 3R2CJ 5KG2A 2QL9B 4P2MA 3GV8B 5IIMA 2WFBA 1PK1A 1NAQA 4FXVA 1JJ4A 3CG7A 4Q2LA 4IFVB 1S0NA 3J7ZO 3KIOA 1IM4A 4I29A 2KIWA 4IH6A 3AN1A 3EY1A 1VSIA 2EG2A 1UT5A 4Z6EA 9ICHA 3THTA 1HQUB 1GXLA 5E0OA 1NMNA 4NLOA 1W2BM 1SC4B 3WIVA 5L1MA 2DK2A 1YG0A 1S12A 3LO3A 2XGQA 2XSFA 2N3OA 1L3KA 1HA1A 3NCPA 3C2MA 1LWFA 1FVSA 2P9UB 2MTLA 4KLJA 4F4ZA 2W55A 5D0HA 3UXOA 3T41A 2BOAA 2CZVC 3Q2TC 4Y2UA 3G6XA 2H4YB 1VK3A 3LDQA 3MEGA 3AVGA 5AQGA 4UAZA 2DGSA 5DJBA 4NLRA 3RB4A 5KFIA 2UUTA 5ALGA 4O3SA 2BDPA 2QWPA 2E20A 2KJVA 2WSFC 1N5QA 3GV5B 1QDUB 1S1VA 4B1VA 1HNWJ 3KD1E 2WSEC 3N5BA 2KLAA 4M63C 2IVPA 3C7NA 3HHKA 1OJ4A 1EJ7L 4BRGA 3VQBA 3DRPB 3TR5A 3FM9A 4A47A 2DKOB 1S76D 4JI1J 1RU2A 2O4IA 5KG5A 4NMXA 4OZ1A 4UQGA 4EU0A 1QVGM 1YKWA 2FHOB 4M5DA 4A8SA 1QUPA 1HNWK 1V5IB 3SMPA 4BRDA 2A42A 5AT1B 4OQJA 3AB4B 2OJ3A 3M2VB 3LPUA 4GC7A 2CPZA 2XI2A 4DR6F 4OGEA 3VPZA 5KQDA 1TUGB 4U9RA 3HFKA 2NZTA 1Y10A 3QRRA 2W43A 2AJ0A 4O44A 3PHEA 1BNPA 1NMDA 1AQ6A 2RDJA 4B9VA 1KQKA 2DY1A 4HVZA 2BZ2A 3GIIA 5U47A 1VQ4N 1T9XA 3SSRA 3PIPL 3CYMA 2ITMA 2P6UA 2ILZA 1PJ6A 1E6VB 2MPUA 3LP1A 3FSIA 3A5OC 1YJNN 4X65J 1JROA 4NLVA 3ZD8A 2Y9UA 4JKAA 1WC6A 1XNRF 5J2KA 4GV6A 1GNKA 3FMBA 5F41A 5LXRA 3ENQA 1V85A 2D1KA 2KH9A 2BHNA 2L9DA 2O5DA 3KLHB 1X4AA 3G25A 1BUXA 1L3SA 2ZITA 2W8KA 1Z1ZA 2WOMB 2CH6A 5EGYA 4KBIA 3ZYYX 3E2EA 3FMWA 3BSNA 2I6XA 1UWBB 1NUEA 1ZQRA 1IG8A 5E3QA 2DFFA 3WBZA 3CT9A 2JZ5A 4PRFA 2PI4A 5ETRA 2YB1A 5KAIU 5E3AA 4A8FA 1DQ9A 3HMJG 2VG7B 2X78A 2VDIA 3ZSWA 1SJFA 4DSJA 1WCNA 2RU9A 1RILA 2D3O1 1SC3B 3ULEA 2BR0A 1S72S 4NLUA 2HURA 2XCPA 3BN7A 4P7TA 1WEXA 1FE4A 3RJMB 3D4JA 4LSZB 1SWWA 3ZZ0A 3OTCA 4EBCA 1FKOB 4FBUA 3KG4A 4C8ZA 4BC3A 5EX0A 3M8ZA 1WWUA 1WDTA 3AL0B 1NBWA 2R3VA 3PX4A 5D0RA 5KFZA 1EX8A 1HWUA 4FYDA 4WFYA 1RCHA 4Y2IA 1P27B 4KV8B 3ALYA 3MXHP 4DSEA 4JN4A 2ZD1A 5CEHA 4BWJA 2LXUA 3AODA 3WXKA 5KFCA 3GFYA 4C0OC 4FK4A 1B99A 3TUZC 4LF5F 1I5OB 5CYQA 3FEZA 1KAYA 3O9TA 5JVHQ 2JHDA 1CJVB 4WYLA 3OYNA 5IQQA 2YWWA 2EDUA 4R79A 4C11A 4N77A 2PMZC 4ZIVA 2QJ3A 4OPKA 2V51B 1ZBTA 5KFOA 1RCOB 2DFHA 2VYPA 1HX1A 4J9QA 1E6YB 1VQ9S 1YHQS 5KPZA 1RHQB 3RH5A 4DV2K 2ZJRQ 1UJ5A 1HR0J 2E2PA 1REVB 4DV4K 2AWZA 2ZIUB 4CLUA 2YKMA 3JPQA 4CHPA 2JXJA 5EE9A 4PPDA 4LRDA 1KVCA 4WE1A 1P9YA 3OV7A 1U2RA 3TAMA 3EYZA 2D1CA 3NGIA 1NGEA 4X4VA 4PL8A 2W24A 1WNSA 7ICNA 2MZJA 2ROGA 4EX7A 5J0XA 4KMUA 1JWWA 4M3TA 3DLBA 2WB1D 1PAUB 1NOYA 1HR0K 2K4EA 4OJPA 4OV6A 3LAMA 8ICLA 1KR4A 5EE1A 4KTZA 4U6PA 1AT1B 5FIIA 3G82A 2B9XA 5L39A 9ICOA 4X4RA 4I2BA 4JD2A 3QBWA 3PO4A 5EE3A 1LV5A 2ZH5A 4RWWA 2HFOA 5C5JA 1ZZNA 1LXJA 2HNYA 4ZITA 2AEMA 3I4PA 3W0LA 1X3MA 2EAMA 3KVGA 2J4RA 1KQQA 4ETXA 3K5PA 1VBYA 4OKEA 4QIWD 8ICIA 1C0TB 2LVWA 4AHSA 4LFCK 2P2CB 3EUB2 3VALA 4XA5A 1F21A 4NCGA 4AHRA 4BACA 3KWGA 5M1NA 4GKKJ 3H8YA 3JPSA 4M3ZA 4RG8A 3J7ZT 1ZH5A 3RG6A 4PUOB 4ZJOA 4YXJA 2BBEA 4I2GA 2EVZA 1JNRB 1VSJA 4DTNA 3FKBA 1FWKA 4NLBA 4R5PA 2DNRA 2KVQE 3CCJS 4IH7A 1YTYA 2QYGA 4RU9A 2VFRA 2IIRA 3U27A 1S1TA 2VJ4A 1LW0A 3ZD9A 4NLDA 4C7QA 2JFDA 2QWNA 1YDLA 5EXWA 1RSCA 2K8AA 4DOZA 5C2FA 3O4WA 1S6PB 3DXMB 2GGPA 1ICEB 5GAHU 3KLGB 1RBTA 1S9FA 2Q6CA 4OX9K 2WF6A 5L1JA 1WG5A 3WQTA 4US9A 3NCRA 3OHRA 5KFFA 4JRPA 5KGWA 4P0PB 3NBPB 2NYVA 4KLUA 2Q3SA 1XEZA 1M5PC 3S3MA 4U7UK 4KIAA 1YAGA 3VQ8A 4IH5A 3LTOA 1JMTA 2KFYA 2YQ0A 5HRNA 2NREA 2R7SA 1EXNA 2UXBJ 3AAWB 5IWAF 2BTFA 1RT4A 3QEAZ 1ZRNA 2JH1A 2UUCF 2VD3A 1EO1A 1SV5A 4XDDA 1VQNS 2A18A 5DM6L 1XERA 1R89A 4RZRA 2KJ9A 1U6BA 5LMUF 5HLFB 1BCMA 4J03A 2JX2A 4I6WA 2VFUA 4ISFA 3KFUF 4N47A 3M2RA 4QOZB 4WP8A 4USWA 1N5XA 4DPYA 2DO4A 3CETA 3VC8A 1JCFA 3SQ0A 2XMMA 4AD6A 4DBQA 3U7JA 3QRPA 2L5YA 3CCUS 2KVIA 3NNCA 1NK5A 3OVAA 3KLIB 5ALLA 1QQCA 4CF2A 5J2IA 3JSMB 3D2FB 3BH6B 3RBZA 1HNXF 3QIOA 2FY8A 4GO5X 1RTIB 3RF9A 1L6NA 3SUNA 5D3GB 4YOXA 2CG4A 3HVWA 4NZ6A 3C14A 4K8ZA 2PZSA 4ZHRB 5BPNA 2GOLA 3K75D 2BANA 2HFSA 4FZVA 5F0XA 4JRQA 2ZOFA 3T6BA 3B9JA 4K4YA 1SVDA 2O8BB 2F40A 5JRTA 5BR8J 5BN9A 5D77A 3QUTA 7ICEA 2G0IA 1GLBG 4DV0F 1N33F 4M5JA 4RWTA 2O6KA 3JQKA 4BLGA 4IQTA 5EWFA 4K4IA 3AVBA 4PXCA 3O9RA 1ZA1B 4KTWA 4YVZA 4ZN1A 3VQCA 8ICUA 3RJFA 4X62K 4F0KA 3TAGA 1EWQA 2VOPA 1OSDA 5M1PA 4UZCA 4AHVA 1TV6B 4LZGA 4DR3J 1ZQ1C 4CO0A 1O8BA 1LNQA 3I5CA 2A5XA 2G4BA 2KKVA 2P6RA 3AXKA 3BS5A 2RH3A 2R2TA 3JXUA 4PGXA 5BPLA 1N32J 2EK1A 4G1IA 4FWLA 5BYQA 3HFVA 4IR9A 1S6QA 1ZBIA 3DGPA 5LOQA 5HMLA 3BQ2A 2IA6A 1ZS6A 2V50A 3GFHA 2Q66A 1D09B 1ZXOA 4AM6A 2MLZA 2E5JA 4CJRA 3ICXA 2OFHX 5AI8A 4DL4A 4DPTA 4OZLA 1R8HA 2LCWA 4IXCA 2HQIA 5LSLA 1RT5B 5KI6A 4JKHA 4Q45A 5JS2A 3OYIA 2B5JB 1S1WB 4KR0B 3T1YF 2CJKA 2FXUA 5J0TA 4CYUB 3NE6A 2H51B 1B9FA 1B7YB 1R31A 1WOOA 3NH0A 3D68A 1IKYA 1XMOF 3DLLQ 4PH5A 2OD6A 1L7MA 4D3HA 4A8QA 2OKQA 4G6VB 3C2KA 2UXDJ 2R7OA 2FIUA 4TNOA 4C0HA 4NA1A 1FO1A 4USAA 5DM7Q 1X3NA 3FE1A 2DD8S 4J91A 2G5IB 2H9ZA 3M6ZA 1D5AA 8ICEA 2Z2LA 3LAKA 2CQ0A 2DBYA 2XY5A 3I87A 2F65A 1KWMA 1ZJNA 4MFAA 3RH4A 5F8GA 1F2GA 4HT5A 2PMZF 3NGRA 1KLMB 3C23A 3FSXA 3LWLA 2MZTA 1G4CA 4F71A 4IO9Q 2IJFA 2MY7A 2GUPA 3ZEUA 3MFHA 1RM6C 3DM2A 2XHBA 3DDNA 5IIJA 2M5YA 5HMWA 2NQPA 2QLBB 1MN9A 3FEYB 1U9LA 3NWRA 4CD1A 5J2MB 5I3UB 2CJAA 1KC8O 3NRBA 4Y1DA 4JI7J 1VSDA 1FI4A 1S57A 4LF9K 2ZBQA 1J2VA 2AJ1A 3SCXA 3NVZA 4KHRA 4LBPA 1YJ9S 4RBUA 5KG4A 1N60A 3GDXA 3PSPA 2R9LA 4NZ7A 2QSWA 3K4GA 3IO1A 2GIQA 2VQEF 4EHTA 3W62A 4KGMA 3WNEA 2BM1A 3GCXP 4CF3A 4CM0A 5BN8A 2UUAF 4QYRA 3A8IA 1PIEA 4JI7K 7ICIA 3UFCX 5A8WA 3R27A 2QIFA 2DH9A 2DPIA 2FTRA 1TFRA 1OH8A 4MH8A 5AR0A 3OFEA 2P1JA 3E0FA 1F5CA 1OSCA 2GHPA 3EPGA 2F9WA 1X9XA 2NRRA 2FZGB 3AA2A 2ERRA 3V7KA 3NNAA 4FS1A 1OH7A 5ALKA 3TVKA 2P9CA 2AXTU 4UB1A 3CIZA 3H5YA 4K43A 3VAKA 2MKYA 4NXMF 4BC9A 3TAEA 3PX0A 1FRMA 1D8BA 3U3YA 3KD5E 2GJ2A 4I27A 3IBCB 3WC0A 4B3RF 3MN7A 1VQ6N 2CNLB 2PI5A 2HNDB 3VVUA 3RB3A 2HBRB 2QXFA 1U24A 4WFAL 2P5OA 2C2DA 5KFMA 1Y64A 2RQ4A 3LW5C 4YDUC 5F8LA 1LQ9A 2V2QA 2WB1C 4H5WA 5LMNF 1L3UA 3E9LA 1ED1A 5AK3A 2AX1A 2LLZA 4WZMA 4P2SA 3C15A 3U1NA 3OW2M 5CJ7A 4PZOA 2OM6A 3CRXA 3BGRB 2OPRB 1ZM9A 2M3DA 1W25A 4ICLB 3AVLA 4O5KA 3AVAA 3Q8LA 2ZE2A 4OJLA 4P73A 4JV5K 1WSFA 1W0HA 3M32A 5ADZA 3L3FX 3ULHA 4ED4A 3D6MB 7ICJA 4QS9A 5DDPC 4ANDA 1LKYA 4PG6A 2QWMA 3TNVA 1ASVA 4Z4CA 1Q78A 1RT1B 2YX1A 3M4XA 3ELHA 4C9DA 1Q5VA 3KTQA 2ADBA 2K89A 3IHQB 4LBHA 2IVYA 1WI6A 4KB7A 3M6UA 1HYVA 4LF8F 2WVDA 4YUDA 4U8VA 1UFWA 1HD0A 4KSEB 4F9OA 2B7BB 4CJFA 2CQIA 2ZF5O 9ICLA 1MWZA 4IRDA 2PGCA 3FBFA 1M0SA 3MMAA 1B4SA 1VDHA 2CDQA 2H48B 3G8TA 4CF4A 4CEBA 3AO3A 4FKXA 5F1XA 2NUUG 1B0TA 2IC3A 1RABB 4CJWA 3IFEA 2ACMA 5AI0A 3PKMA 2DGWA 1ZBLA 2XHCA 3NF8A 1NRKA 2UUBK 3H5XA 2FVCA 5HMZA 1XIQA 1VQ8N 4A8YA 5EN1A 5THWA 1TUYA 1X66A 2ABYA 3QU7A 3I5AA 5L9NA 1QY7A 2OPPA 3H25A 4E1JA 1SZ2A 3KMSA 2I7NA 4LH5A 5HR6A 1SH3A 2WC9A 4R8UA 1KFTA 2CQ1A 5GIPA 2CVIA 3MDFA 2G9OA 1T9WA 1IBMF 1RBAA 4KT0C 1DJ0A 2BEFA 4UASA 2MQNA 4X66J 2D0BA 3TSQA 4NLPA 3GZFA 1S4FA 4CZJA 4DCHA 1C0UA 4C1NK 5ALZA 2WRMA 2XI3A 1JJCB 2FSNA 2OAUA 3HHNB 2A0FB 1HHQA 1TFYA 3D0HE 3BO4A 2Y0SD 3GG0A 3VTIA 4CZFA 3OR1B 3CNQP 4KH5A 3J7YU 3V6DA 4KHMA 4B3TJ 1WSVA 3L3CA 1JN3A 3IA0A 4X66K 4DUZJ 4CLSA 1Q3VA 2DGUA 1NSAA 2E3TA 4Y0WA 5AZIA 4IFVA 1WSRA 3ZZRA 3AVFA 4K0KJ 1I3OB 2DFEA 2XQCA 4AYBD 3ID6A 3DDKA 1VQ5S 3CCMS 2DO0A 3MCPA 5F8MA 4M47A 1OPIA 3ZT4A 3OVSA 1D4XA 3W8PA 1OY9A 1ECWA 5J2FA 3O44A 5HRRA 1JB0C 1NZAA 3H4BA 1U1KA 2DPNA 5E5NA 3Q0AA 5C2DA 4LFAK 2P9UA 3RJEA 4IEEA 5I3QA 4WQ4C 3I55S 4K0KK 2CADA 1PVQA 2ETJA 3DOMB 3M30A 3L7OA 3PJWA 3D6TB 4DR7J 1NHKL 4DQQA 4F3QA 1BCOA 5J0RA 3EE9A 3DLJA 1XHZA 5AKIA 5TZVA 3BPSP 2DWQA 1NMEB 1RISA 3CCQN 1UCVA 1VQLS 1HBOB 3GWCA 4JB3A 3JTOA 1XNSA 4M7XA 2WW8A 2LBOA 3LQVA 2X1BA 2VIXA 4ZPWR 1NK8A 4FJLA 4JV0A 3T9ZA 3MCAB 1S5LU 1MQ3A 4FN5A 3SMVA 1SJ3P 4K41A 2YQ3A 2HQFA 4DR7K 4R0JA 4M94A 3TZYA 2MZRA 2W2PP 4PZVA 4RQ0A 3ISCA 3BGUA 4JI6F 4AQYJ 2ZUCA 3HD2A 3FGUA 2B8QA 2FHJD 5A8KB 1F9FA 3IS9B 1U1OA 1N36K 4M5HA 3OR2B 1YIJN 3FFKB 1FRJA 2YVSA 3MM8B 4BGDA 3W2WA 4H0XB 3D2EB 4B1YB 3OT9A 3QU4A 9ICXA 2B43A 3T69A 4BHQA 2RB7A 5J0SA 4RBVA 2IBKA 2JRZA 3BV8A 3C8YA 4AT1B 4YR0A 4GV3A 1S9GB 3OYJA 1WC0A 2CPHA 3WK5A 2WSCC 4PL2A 3TW0A 2QX0A 5A6PA 4HCBA 1RHKB 4IDKB 4BDZA 2QEXN 4MK9A 3D45A 5KFVA 2G2YA 2R7TA 1T4GA 3NGKA 3PYGA 1RBSA 2DXFA 3H08A 4JV2A 3DLEB 2IDOA 1XMQF 2JSXA 4C4SA 2E1AA 4HAIA 3OYCA 4DR4J 4FVCA 4WWSA 2C2MB 4I2AA 2F1IA 4V1Ak 4ZOHC 1RAAB 2LA6A 3MGHA 4XPCA 2KXFA 5KAKA 3V9ZA 4CECA 3C28A 1S9EB 2B7CB 2E9ZA 4NLKA 1E6VA 4WF9L 2HVIA 4LQ3A 2NXJA 1RT3B 1BHLA 3K9KA 5HMMA 2ZG6A 1EAYC 3UNGC 2EZXA 2KEYA 4H5VA 3VWSA 1QD1A 2EKYA 1XMQK 5I42B 2O8DA 4OYOA 3I28A 3T6JA 4RNOA 3KLHA 3UQ0A 5DDYA 2LECA 4LUBA 5DQHA 3GILA 5HRSA 2G06A 4LY7A 1KN6A 4B6JA 5SUHA 4UBBA 1UWBA 1NU0A 2N7CA 1R59O 3SQ2A 4BRQA 1LXNA 1RLCL 2V7YA 1P6TA 4M3YA 1GLAG 1BIUA 3O4QA 2VG7A 4CEAA 5ALXA 1RT6B 3D28A 4IOXA 1J9AA 3A0HU 3P38A 3C66A 3L7PA 4ZVSB 2V8VA 2GJFA 3CQ8A 3FQKA 4F91B 4D3GA 4TQSA 3RVCA 3RRGA 2MSNA 3ZZTA 2WB1F 3HX0A 2JL9A 2IOFA 4RUHA 1VRTA 8ICXA 3QEPA 1FKOA 3GCWP 1E3MA 3UQSA 4I2JA 3KOAA 4FW2A 3S8SA 2F1FA 1VQON 1BLUA 3WK9A 2Q0UA 4CZMA 1JXLA 4FJJA 4YB5A 3I5BA 4Z6CA 1FXLA 5D4OA 2VCPA 2XNRA 2DNZA 4QIWF 3T5HA 2ZBCA 4CK3A 4FJ9A 4JNEA 1WTBA 2VFSA 1CULB 1TL1B 4NLSA 1PAEX 2F3JA 3MUVP 3HHEA 4E98A 1CJVA 3KDOA 2HQDA 3PUFA 1NK6A 4WKYA 5KFKA 3FBEA 1XR5A 2W4CA 3O08A 1RBVA 2M4MA 3JYTA 2QLFB 3RJGA 2E5IA 4I6MB 2JZBB 2AJ4A 1E6YA 3DXSX 2IMOA 4DR6J 2NSCA 3HVRA 2F4VK 2L9NA 1A5WA 5A8RA 3O9SA 1TKTB 3EEQA 3UR3C 3O1LA 2XMUA 3I8DA 1REVA 2ZIUA 3LM9A 3WDOA 2ZEJA 4FXDA 4KHUA 2F76X 5L1KA 2P9SB 1NZ8A 1ZRMA 3HZGA 5KG7A 3CULA 1QAJA 3BJYA 4CJ4A 2BRLA 1MWQA 2H3IA 4DHYA 3CJ7A 5ELZA 4IFYA 3FR0A 4OD0A 3MR3A 3CJKB 3K58A 2ZH3A 3CD6S 3M2UB 2NCKL 4P74A 4CNQA 3MOZA 1Q9XA 4KHPK 3SSQA 4LRBA 4C80A 3OPXA 2JC1A 1XNRJ 4FJ5A 2M52A 4CLZA 3MAHA 2UP1A 4URQU 2ZDOA 3WXLA 1UVJA 3G4SN 1U26A 1GOCA 1DTTB 5IM0B 4KC5A 1RWKB 5JJBA 3A3NB 4ZPVR 1RA6A 4GKJK 2F4FA 3K8WA 3PYEA 1YI2N 1LK5A 4CZKA 1C0TA 2AH5A 3GSIA 3V9SA 4YQWA 9ICRA 5DK5A 2KICA 4KH4A 4OPAA 1TK0A 1Y88A 4MIAA 5LM7E 4C7ZA 2CJQA 2XGPA 4B3MK 4NLQA 4P10A 2W04A 4CO1A 4JI0F 1ITGA 4XIUA 2O1PA 3C6UB 2BV3A 5DETA 1V5VA 2CNOB 3NVYA 1S1UA 3JSBA 2CJXB 4A8WA 2PKEA 3PM9A 2FC0A 5JLFA 4HLBA 4NWIA 2HFNA 1JLAA 2HBMA 3R5BA 1PBAA 1HBNB 1YBUA 1RI7A 1ZQZA 1M1HA 1IXRA 1KVBA 3ETMA 1SXEA 3ILLA 4EP4A 7ICOA 3POTB 5EOZA 5IQ6A 3CDEA 1BL3A 4QWDA 4Q43A 2GIFA 2LYVA 2BJ1A 4EENA 1L7PA 4B9LA 2WZ1A 3W61A 4KH0B 4UB8U 2DNKA 4XH5A 3F0NA 4AP9A 4LF5J 3T19A 2Y0SC 2E1PA 1H2UX 2BX6A 2WF7A 2MDAA 2J0QD 4FZZA 1R0AB 1ZTTA 1HYZA 4EEYA 4K4UA 2BPGA 4IRCA 3S1TA 2E9TA 2DGVA 2OGUA 4LF4F 2BCSA 1LKZA 4H4MB 3SPYA 4ZOSA 5KFLA 2FDRA 3RGIA 1TGOA 3CJ5A 1LAWA 2ZM6F 2E44A 3H6EA 1HWLA 1HNIA 2IYGA 2B9EA 3KMQA 3QE9Y 5KFPA 3AVJA 5LJWA 1OWXA 2E2QA 5GAGI 4ED6A 4DCCA 2XBPA 1FRXA 2MQPA 4NB4A 1XWLA 1J5EK 2FC8A 3KLIA 3R97A 1NNLA 4M0AA 5KT5A 1KOOA 1SB6A 1RTIA 1ULRA 4P72A 5D3GA 3AAQA 3ZZZA 5CZVA 4ZHRA 2OTJS 1WI8A 2OO4A 3R3LA 2FJXA 1U09A 1PYOB 1RTJB 2E5LK 4ZK7M 1FNXH 4KB0A 4I9QA 3M3ZA 4BGBA 3ENVA 3F53A 3ZLJA 2BACA 4CH7A 5H2FU 3BB5A 1Y97A 1MSWD 4PQAA 3R1XA 3EKSA 2K7JA 4EX6A 3KNAA 2HNZB 2U1AA 1SL1A 1L3TA 5AIAA 1SJRA 3HD1A 2G1HA 2KO1A 4DTOA 2FY1A 1XC9A 4X4UA 1NK0A 2QK9A 3PFEA 1UAWA 4NOHA 1EP4A 3CCWA 1K9MO 1KCFA 2CGKA 4DV7K 4MK7A 1HFEL 2CPFA 2DHSA 4OJ3A 4Q2MA 2YNFB 4RNFA 2NYHA 2IJNA 1BPXA 4ED0A 1TV6A 1N34F 1G1XA 4LSNB 3DI6B 1LFPA 3NRWA 3EGZA 4FNIA 1QSLA 2VDHA 1TUVA 1JLGB 4RLEA 3MFIA 1SV0C 5C15A 2FVRA 3SR6A 1K6YA 2YJEA 2BMBA 5D0EA 2ISPA 4WYWA 4W5OA 1IBLK 4DMZA 1UZDA 1N6QB 1JRPA 1SUQB 4X4OA 1XS9D 1T9UA 2B0CA 4UAYA 4PHDA 5AJ3F 1T7PA 3UDCA 2NRTA 3AO1A 2EC2A 1FF2A 2VBZA 1CBKA 1RT5A 2N1RA 4DFPA 3QYYA 3BSCA 5AE1A 2B5JA 3ISBA 3CCES 1S1WA 5DG8A 1RDRA 3OTEA 4KLIA 2BUPA 4DV1K 2W7AA 4E1NA 4LH4A 4CYUA 3TQEA 2ZH8A 4KRWA 1HWIA 3VCDA 2A1SA 2H4WB 4K4HA 5IWAJ 1OYEA 2W7PA 4IFEA 5EWGA 2NRVA 2XNQA 3RW7A 2UV8G 2FGCA 4CJSA 3TFSA 3WK8A 2UVUA 5LMUJ 1Z4UA 1ZD5A 3PIPQ 4JI2F 2K8CB 4JKDA 3EGVA 4M6WB 3SUPA 2QKBA 4QZBA 5ALYA 1TAUA 2ZJPL 2VPXB 2Q43A 1ILYA 1Q8KA 3B8HA 5E41A 2B4PA 4TUSA 4DPWA 5KFWA 1DTQA 3VF4A 1I94K 4X2BA 2ASJA 4LR9A 4ID1A 1BOTO 2FYXA 1KLMA 1PKUA 2YH0A 2VG6A 4Y6IA 8ICHA 4EBEA 5CP2A 2AGOA 2W4DA 1HNXJ 3TRGA 3K5MA 3MZIA 4W92B 3PHTA 1QTNB 4LF7F 2BXJA 2E2OA 4KN4A 5LJ5Y 4GFJA 4MN4C 3CJTA 2G2ZA 2Z2YB 2GWKA 4UB3A 2YX7A 3SJHA 5J2MA 5I3UA 1Z26A 3M1FA 2WB4A 5GAHP 3G71S 2KE7A 4N76A 1WACA 1NB7A 5CZ1A 3IGNA 3H3NO 1RAFB 3G8SA 4YDDB 4PXEA 4DSKA 3BZCA 4FVMA 4DV0J 3CCZA 1OY6A 1ZBFA 3KK7A 3KHRA 4P71A 3GBTA 3C6TB 2V7ZA 3Q8QB 4X4SA 4YB7A 4FWKA 4ILHA 1RWNB 2YX6A 2ZH9A 1IG6A 4ZMMA 1T8EA 1DK2A 3NVWA 4DCJB 2P9LB 2YTUA 4WQ5A 2BJEA 2HHPA 3SMZA 2ZJRL 4I9LA 2B6AB 2CJ9A 4J9RA 3A8EA 2W03A 4F92B 4QIVA 1X4CA 3J81j 4C8NA 4DTSA 2GS8A 2MMYA 4KHYA 3SENA 3ZTQA 1PK3A 3O3LA 2EXUA 3GE1A 3LYSA 4XH1A 5AQNA 5CE3A 2H3QA 5IILA 4E8UA 3AQPA 2POKA 2KD1A 1XMBA 3UKUB 1ATSA 2HBQB 2EFGA 2HNDA 1QQOA 3CCLN 3TUJC 2KJWA 3HYFA 4UUWA 2OP5A 5HN0A 4H0OA 3CJ1A 2HS3A 3UN2A 1IKVB 4JOUA 1VS3A 4OYZA 1CS4B 3T1YJ 4A8MP 5J1EB 4IQWA 2V52B 2HHWA 4FE3A 2QA4S 5E84A 4GO7X 4GXIA 1D9AA 4YB1P 2J6TA 2E7WA 2OPRA 1XMOJ 4ICLA 3HHLB 3VEOA 4DHVA 3Q86A 5D0GA 3BS7A 4LRAA 1MNEA 1N56A 4BXOB 3PKYA 2OHDA 4E3SA 2CNNB 1KFDA 1K8AT 1WD6A 4QCLA 1J53A 5E3CA 3F41A 5BOMA 2WTFA 4Z7YA 5HBMB 2Y0SF 7ICFA 1RT1A 4WFBL 1Q4RA 2ZBPA 3GFKB 3MI7X 4PWWA 3S6EA 4J2EA 1X8DA 3G96A 2K2PA 5JICA 1ZQWA 1IKWB 1L8OA 3US5A 3F2BA 5K14B 4DOBA 4PKIA 5K5MA 1K5OA 3ZTOA 3MEEB 2AJ2A 3ZT3A 5J2JA 3NXZA 4AYBF 2FHMA 2EFNA 1TKZA 4ILMA 2OD4A 4RPZA 2LMIA 2OXOA 5CWRA 2VUGA 1UA0A 1U02A 2O67A 3R5JB 4WJBA 4C7YA 1HLUA 4IKAA 4MDBA 2DNPA 1FKPB 2XWYA 1PC4A 3ISDA 4RW4A 1NPKA 4IKFA 2G8FA 1NM1A 3ZI4A 2BPCA 1M1KO 1CSJA 1SCJB 1Z1VA 4PXBA 4WKRA 2W2MP 4QZGA 1WEZA 3CC2S 1Z2LA 3RFAA 3SV4A 2GNKA 3BQ1A 2R42A 1UJ4A 3Q22A 4UF4A 1BISA 4Y2KA 1HNZF 1HQ2A 4ECSA 4HUFA 4IQXA 4AILC 4KLFA 1VGYA 2I8EA 3TJAA 2IVMA 3DLRA 4QBUA 1U6ZA 3ZSYA 4O0NA 4RW8A 2A6OA 5A76A 4OYIA 2D0CA 5B0DA 4DZ6A 1BC6A 5SWMA 2BCUA 2KQ2A 3W66A 4OI3A 5GADU 1YJWN 4RO0A 5J8YC 3JXOA 1WBDA 7ICHA 5GVQA 1FEZA 2MZSA 2MGZA 2H3EB 1R27B 4A59A 1SJ1A 4NXMJ 4CNYA 3H3OB 2DITA 4IZ9A 3EE8A 3M6GA 3N4MB 4BRHA 3OR1A 2BYCA 1WHVA 3MR5A 2CQPA 2VF3A 5HP1A 3HK2A 3D5MA 2IPOB 2PXIA 3SCLE 3QO9A 2W11A 1WKLA 4B3RJ 4ZVGA 1SKWA 3C3LA 3SDEA 2ZGZA 1ZM3A 4DFKA 1FDDA 3P3DA 2QFJA 1S79A 4IO1A 3PYFA 8ICWA 1S8OA 1WCLA 1C2PA 5FPDA 1ZQLA 4QS7A 2NUHA 3ZT1A 1RAOA 3TUIC 1H72C 1WF2A 5LMNJ 5DM6Q 2HOIA 4KLHA 1UW9A 2J8AA 4FPAA 4AL6A 4Y2JA 2NNWA 2CVEA 4LRCA 2DH8A 2IDEA 3RMAA 2P9GA 3Q7BA 3CCSN 1X5SA 1WOQA 4G3IA 5DQGA 4LVOP 3DMJA 1M5OC 3EGWB 3L6QA 3HSZA 1X4EA 3DOMA 2PC6A 4F04B 1H7XA 4CO2A 4OYPA 5B66U 3EDRB 4DOAA 2BA9A 2DNNA 4JAXA 3FCVA 3DCAA 3OY9A 3EZWA 4FM2A 2Z0GA 1HBOA 2V9WA 1S10A 1PSDA 1S1VB 1YTAA 3WKBA 2LYHA 4F5NA 3HF5A 4LF8J 2I5JA 4FK2A 5EX5A 3MF5A 2G1DA 1QZ6A 1XSNA 4RTFD 2KKZA 5A8KA 4KH6A 3GSDA 1DLOA 3KHGA 1DQAA 3L2VA 3OL8A 3J80U 4NV0A 4DI6A 5KRSA 4EELA 2R18A 3WEEA 5M1FA 3OR2A 1XHXA 2V2KA 4O9MA 1TQLA 5IOLA 4CNZA 1HUZA 1SI9A 3IUCA 4DV3J 4GC6A 4NYZA 3I56N 1YSJA 2RQMA 1BUPA 4CGGA 1ZQDA 3UNYA 1ZD3A 3CFPA 1DQ8A 1S0OA 1MROA 4ZP6A 3V9XA 3AD9C 3VQEA 1XNQF 3U02A 2EAOA 1DOQA 5HHHA 2WONB 2FBVA 4JEPA 4ZVUB 2MQOA 3WK7A 4ECWA 5MAOA 3OUYB 1NHVA 5BYSA 3GIRA 4IYQA 4CLLA 3K8VA 3D0IE 2BM0A 2ZIVA 1WG8A 4O44B 1KSPA 1V4TA 5B5EU 5J2EA 2ASPA 4YOYA 3Q8RB 3KG1A 4DV3K 1KHWA 3L4BC 3DLEA 2GV1A 3NGDA 1IBMJ 3H8JA 3H5SA 1RHUB 4CO3A 1R6VA 4JYAK 1ZQOA 4N5SA 1S9EA 3ISNC 1T02A 4DUYK 2HFUA 1IV0A 2G07A 4CGFA 2K06A 1NGAA 1AFIA 1OUQA 2WHOA 4HH1A 2OYQA 5M2PA 2F5GA 5HRPA 4QW9A 4ILJA 2ZIWB 4LFBK 1NNEA 3VAFA 2WAQC 3SZ2A 1AUDA 1W97L 4RQ1A 3QNOA 4BR9A 1SZPA 1YI2S 5JS1A 1KDNA 1YZ6A 1TTHB 4NRUA 1NH8A 1IVZA 3PW2A 3VQ4A 4YP3A 1EHWA 2OA8A 4K7QA 5HO4A 4NEZA 3BQ0A 3EM1A 3OD2A 2RS2A 1ZBSA 5HNKA 1B3TA 1ATNA 4YDUA 3ZSRA 2UU9F 1FWLA 4M9LA 1OPZA 3TVZA 2EZZA 4NL9C 1RT6A 1TMMA 2K7KA 1QQNA 3QPIA 3LP0A 2QN6B 2XYPB 1KD1O 3WIUA 3AJ2A 3ZDDA 2CN1A 1CUKA 1VBXA 2OEMA 1H38A 1U2CA 4DJBA 3ED5A 3NGUA 3CC7S 4LD0A 5LJVA 2V8HA 3KKRA 2YHXA 4NWBA 1SL0A 5IV4A 4Y65A 4I2EA 1HI8A 2OELA 2DRBA 2JLEA 2JLFA 5K20B 5KG6A 5ALSA 2MKKA 4DF8A 5CYQB 2BJDA 3J7YP 3EVOA 1TL1A 2AT1B 1F0XA 1HPZB 3KHHA 4YHHK 1FX2A 3TX8A 2RQCA 2C3OA 1Z6RA 2X3DA 4EK2A 4KFBB 3A12A 3BKTA 1YTUA 3BY5A 3M6VA 7ICMA 4L3KA 3C0BA 4ELTA 4S0MA 3ETLA 5AQZA 4IC9A 1J6ZA 2YKMB 2HHHF 2DT9A 3TP2A 1RACB 5AHXA 1TKTA 4BRLA 3QJJA 4DR5K 3TPQA 4EUVA 4F5RA 2FPHX 5AQQA 3L8BA 3PEJA 3OFHA 3IN5A 3ZNUA 2MJNA 2P9SA 1VYAA 3DDHA 3WNGA 5F8IA 2DR9A 4FLVA 4ZP9A 3GPAA 1M1KT 2FJVA 3MM5B 4ED8A 3PCOB 4CT8A 4C0BA 3ULDA 3FDSA 1A7GE 3WC2A 4V19J 4OJRA 3M2UA 4U7BA 3G82B 4QR2A 4XO0A 2AF6A 4TY8A 1HBUA 2EH9A 4WFAQ 5DB7A 3L4IA 4IDHA 1X40A 2HNYB 2R8HA 2FJEB 2QA4G 2V4QA 5E2QA 3I82A 3VQ5A 5IIOA 3VGSA 5IM0A 1DFDA 5HSPA 2C22A 3AVHA 3QNWB 2DGZA 3NF9A 2HRUA 2W9CB 1UCNA 4YY3K 2BJ9A 1FE0A 9ICGA 3NGZA 3DLGA 2OYYA 2PEHA 2OZMA 4PL1A 2XB2D 4M5MA 2B0GA 2HAFA 2CJYB 2JNJA 8ICMA 5IT9U 1J2NA 5CA7A 2F63A 2F9DA 3EW9A 2OZSA 3GYXB 2W6KA 2LA4A 3ILIA 4LF6F 4KX5A 3LF0A 2VONA 3EPIA 1J27A 3IWXA 2HS4A 2HMPA 3NH2A 2FLLA 3RU0A 2HW3A 1S1TB 1S72N 4AUKA 1ZTWA 3BQTA 5DBCA 4C97A 3QSIA 4ENOA 2YNIB 1AXQA 4ZIWA 1HBNA 1R3NA 2XCAA 1N5TA 3QEXA 4HI2A 3P49B 3ZETB 3H0MB 3LGNA 1GLFO 2ESEA 3POTA 9ICTA 2ADCA 1CZBA 2DRDA 2J7WA 2YQEA 3VAMA 5BXIA 2WBNA 3Q24A 3UMCA 3C2LA 2BQ3A 5J2AA 1FK9B 3O9QA 4C8MA 1T0TV 3CHWA 2KP7A 4O23A 1X0PA 4RW6A 2UVRA 3SAGA 3A5LC 3CDBA 3UPFA 9ICMA 3OYKA 1RT4B 4MLEA 5JLHA 1ASWA 1F1BB 4B9SA 1CLFA 5GAEU 1T3QA 3IMQJ 8ICBA 2E1EA 5ALWA 2XLKA 1UPMB 5FD1A 1YHQN 1VQ9N 3M2RB 2HOQA 2LHTA 2E9RX 4LIRA 4H4MA 1HEKA 4MHVA 2IRXA 4DX8H 3HP6A 3B8AX 4F0HA 3E9PA 4HHTA 2ZJAA 1MN7A 2H3ZA 4ALZA 2RAQA 4PA1A 5KRTA 4MO5A 2JFKA 3OHAA 4KKOA 3J8AA 1EB0A 4RJVA 3A5NC 1L7NA 3NVVA 4F25A 4FJNA 1FXRA 3FSYA 4FZXC 3K89A 3M6XA 1S22A 4U7UD 2F8SA 3MK6A 2F8KA 2VWBA 3C14B 3S01A 3IG5A 4RNMA 1JNZB 2NRXA 3A0IX 1P1LA 4I7FB 1IWAA 1SC1B 4CZIA 1KP6A 4UAVA 4AFFA 2HBLA 3BGFA 4ZVEA 4X4NA 2CZ9A 4JI8K 2Z2MA 2BJ3A 1RTJA 5GIOA 2DHAA 2IM1A 3LZJA 4ISEA 3HL8A 2P6SA 4BC5A 2Z1GA 4DTPA 2RRNA 1Y7PA 2W2QP 2HNZA 2B51A 3O8MA 2G8HA 3HVAA 4IS7A 2GTDA 3SQIA 2EEYA 4TLQA 3HRGA 3G10A 2AQ4A 4JI0J 4DPXA 4H5NA 5F2RA 5ETNA 4CZCA 3UB5A 5E3PA 3CJ0A 4DR2K 2PFUA 2UXCF 1T03B 3E3XA 3QNMA 4OLOA 2MLYA 2Y1JA 1S77D 2HK2A 3CCJN 3IMXA 1BWFO 4YR2A 3CCVS 1WELA 3DKDA 3DFEA 5L1IA 1YRUA 3QT8A 1Z00A 4CK1A 9ICWA 4Z4EA 5C42A 3D7EO 4IJNA 4TN2A 4KPCA 4K4WA 2C42A 4WYBA 3V6HA 2QYCA 4K4VA 5D46A 1KQSR 3HILA 3AV9A 4TLRA 9ICNA 2HHVA 1TKDA 5EX3A 1KD1T 4F2SA 2VGMA 5H9EK 1CC7A 5KT4A 2VICA 4NLTA 4A57A 2Q0RA 3ZO7A 3P5BP 3PR4A 2X1GA 4ZP8A 3M1YA 2HRTA 4KPYA 3EGNA 3SPZA 1UEKA 1VC6A 4DR1F 1H3DA 4LREA 2BQRA 1DEJA 4CGIA 1IKYB 1S99A 4AHUA 4WBFA 3HP9A 4URGA 4CIGA 2AZ1A 1FJ7A 5G0RB 5TKYA 5HMXA 3MX2A 1VQNN 2XLIA 3R6MA 2X1FA 3TFRA 2C2EA 1FCAA 2KYZA 5AKEA 3K57A 1UW4A 3JTPA 4RQ8A 4Y2MA 2ZM6J 1EZZB 1U49A 4WF9Q 4NXNK 4YFKA 5ALOA 3UN3A 1RBRA 2Z1IA 4DCPB 4M5LA 5HOOA 4NASA 3QZ8A 2C2KB 5CCLA 4B3SJ 4Y2XA 2VQFK 4UT4A 4JI4J 5J2CA 2VGNA 4YOVA 2VA3A 3TANA 3OYAA 3CCUN 3AD7C 3ZEUB 4JKGB 1CG2A 4QWCA 2Y1IA 4J9PA 3DM2B 4KY3A 4M3UA 1EQMA 1QAXA 1T9YA 2P9NB 4C4TA 2EX3A 1KN5A 1N8RO 2KHVA 4DPOA 4IG0A 3H42A 5BPMA 4CJTA 5ETSA 1UKUA 4TU8A 3GIKA 2BQUA 2AKWB 2AYBA 3M9OB 4B3SK 4JI4K 4Y2YA 5T7BA 1C1CA 2F8MA 4I69A 2PFQA 1G6BA 2R8IA 4DV5F 4IL6U 3ZDBA 1TK8A 1DRZA 4BG8A 2E2NA 3VN5A 4P2HA 4Z4HA 1CQMA 4FOEA 2W41A 4B9QA 1N63A