1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
4YXJA 4KI6A 4HUGA 3KTQA 5C25A 5DB6A 3CYMA 1DLOA 4PWDA 4TQSA 2VA8A 1CZ9A 2HHWA 4CJPA 4QZIA 1NK5A 3L2UA 2XY7A 1BPEA 1U49A 2DFFA 3PX0A 3UPQA 3C1YA 1KDHA 2XY5A 4Z0UA 4TSXA 5KFJA 5KFEA 4RQ2A 5J2DA 4CJSA 3PW7A 4DSEA 1BL3A 9ICKA 4K8XA 4RT2A 1ZETA 4PGXA 3QEWA 1D9DA 1BPXA 5E41A 4CE9A 4DF8A 3HP6A 4Z6DA 1JL1A 4B8AB 2VWJA 3UIQA 5J0YA 2FMSA 3AO3A 4B9TA 5KFOA 4E7JA 2G8IA 9ICTA 4ELVA 3SNNA 1Y97A 2OZMA 3LK9A 4RQ4A 2ATQA 4W5QA 5J2AA 5J2KA 4RUAA 2E6LA 3RJIA 4R65A 4XUSA 3QE9Y 4KHWA 3M9OB 2XGQA 3KHRA 1JL2A 2C2EA 3PW0A 1ZQPA 3VQDA 4O0JA 2P66A 1MSWD 1WCNA 4CHNA 3OYLA 3I8DA 5DBAA 4QWBA 4KPYA 2I9GA 4QZCA 2B4JA 4DLEA 5J0TA 4AHTA 2Q0ZX 1QSYA 1JLCA 4MEYA 4FJMA 3SPYA 1JMSA 4DSJA 1IKYA 4R5PA 2NRTA 3RBDA 4O3PA 3VA3A 4QZGA 5KGWA 1S76D 3QEAZ 8ICZA 4KTQA 4DOAA 4CF0A 4M9NA 4DL3A 3ZSQA 1MU2A 5KFUA 3ZSRA 3H7IA 4KI4A 4IKFA 3M9NB 4DLGA 2RF2A 1MC8A 4BGDA 3ZDEA 3Q8LA 2HVIA 4NM2A 2R8IA 4ELTA 8ICEA 5HRNA 4E7HA 3KLHA 3RMCA 4FJ9A 4NLKA 5BPCA 2V9WA 1L5UA 3QZ8A 4LH4A 3SQ2A 3RJGA 4DQIA 1CXQA 3LZJA 5CA7A 2OPRA 4E1MA 3QNNA 1BPZA 1TL3A 3V1RA 4AILC 3BQ1A 3IRXA 1Q8IA 4ID1A 2W9MA 2X78A 4FM0A 8ICLA 1S77D 1ZQWA 1NJZA 3FFIA 2W9CB 3OYAA 4E19A 2F8TA 4LZGA 3OYIA 4EEYA 2PFNA 4DSIA 3OY9A 3V1OA 4PUOA 1S0MA 4B3OA 3RB0A 3HP9A 2FMPA 5CZ2A 4RG8A 5KFAA 2ASLA 1RPLA 1NK8A 4O44A 2PY5A 4F5PA 5FROA 5IIMA 3ISDA 2FPLA 3VQQA 1ZBHA 2IAJA 4RW7A 3NCIA 3V9SA 2PXIA 4CGDA 4M6WA 1KRPA 9ICUA 1QSLA 1D5AA 3B0YA 2YV0X 1Z00B 5C5JA 3UXOA 3QNOA 3VQEA 4MFBA 4F91B 2UVRA 4JV0A 3VQ4A 3MR5A 3LPTA 3PVXA 1WN7A 4CEFA 4ZHRA 3H8WA 1S1VA 2HHSA 1LWCA 3NGYA 3G6VA 4YD1A 4DMNA 1S0NA 4NYFA 2NRVA 5DDYA 5J2EA 1ZQRA 3ISNC 1KFTA 3AA4A 2VA3A 3AVAA 4I9LA 3AVFA 3ZSYA 4OPJA 2F1HA 1MQ2A 3AUOA 3G10A 5DKWA 3NH2A 4N5SA 3RAQA 3OYEA 4CHZA 4K8ZA 3EW9A 1EXQA 1R0AA 2DY4A 2B6AA 4IRCA 4MEXA 5DMRA 4IQWA 3NGIA 3OSPA 1SKWA 5HLFA 2A1JB 1CLQA 1VRTA 4CEAA 1H38A 5CB1A 1BQNA 4GXIA 2ZTCA 2BGGA 2P6UA 8ICUA 1TAQA 4CJWA 3P1GA 1VSEA 3GDXA 3KIOA 4GVMA 4BACA 3JPTA 4CEZA 1BCMA 3G6YA 1RDAA 2DFLA 4IQVA 3O3FA 4C8NA 3NE6A 3ZDCA 4CJEA 4CJLA 2RKIA 1J5OA 1B92A 3OYBA 4DTXA 2YKNA 4RNMA 3F9KA 3RRHA 2ZTDA 4F4YA 3TR8A 5J29A 4RNOA 4KB0A 4CGIA 3RWUA 5HHHA 5KT6A 1Q9YA 3NGZA 1UAXA 4R64A 4JV2A 3ASMA 4DL6A 4FJ5A 5J0UA 1VSHA 4C8KA 2OWOA 3V7KA 4O3NA 4F4WA 1S6QA 1NK0A 4YCXA 4DF4A 3B6PA 1BHLA 3MDAA 1A5WA 1LAVA 3AVMA 4QZAA 2HNZA 1JXBA 1RYRA 2AGQA 4B9MA 2RPIA 3MXJA 4OGEA 4O55A 3CG7A 9ICQA 3QEPA 5HRRA 1RT3A 4YD2A 1KTQA 3AU6A 4CEQA 5DGAA 3MR3A 7ICNA 3M8PA 3O3GA 4QZBA 1ZBUA 3NFAA 2LSNA 4OGCA 3ZD8A 5DLFA 7ICFA 5J2BA 9ICMA 8ICBA 3JPNA 1HNIA 1JLAA 4FK2A 1IKXA 4FLVA 2C28A 4YR0A 3AVBA 4QZFA 3O3HA 1ZQGA 1U48A 3ZSOA 1ZQZA 3LWLA 2BQRA 5KT5A 4HYKA 1NK6A 3M8RA 4H4OA 4YMNA 4M45A 4QWCA 1IXRA 5EWFA 2XHBA 2GWSA 4M42A 3V72A 4ECZA 3KD5E 1C0TA 3VQCA 3TARA 1BISA 1KLMA 4J9OA 4O5CA 3MEEA 2PFOA 4RPZA 4UBBA 2HHQA 3SI6A 3AVNA 1KVCA 2GUIA 5IIJA 5J2QA 4KLFA 4J9PA 3OYNA 4I2FA 2FLLA 4YXMA 1ZYQA 2BANA 4KLGA 3EPGA 5J0PA 1KVAA 1KFSA 7ICMA 2KZZA 4E7KA 5C42A 1RT1A 3SZ2A 4DOBA 4E1NA 5SWMA 1B43A 1S9EA 1RTJA 4PH5A 3HSTB 5J0SA 1NJYA 3Q8SB 4HHTA 4HUEA 3DLHA 2M9NA 2E6MA 1QE1A 3KLEA 3V6DA 2WOMA 3HK2A 4KRFA 3MFHA 1L3VA 1JKHA 2JZBA 1LWEA 5D46A 5HP4A 3HW8A 4M3YA 5JS1A 4XRHA 4FM1A 3VQPA 5J2GA 4DU1A 5CWRA 4FZXC 4QWAA 4M9LA 3OYDA 2YHAA 2QK9A 2VG6A 9ICWA 3RJFA 3HX0A 3UQ0A 2GV9A 3PR5B 4Z4IA 5KG7A 5IINA 4L8RB 5KFXA 3TWHA 3JYTA 4F5NA 4QZHA 2JEGA 4O0IA 4B9SA 1CEZA 3TFRA 3DRSA 1C6VA 1ZQEA 3V7JA 2G8UA 2I5JA 1A77A 4R66A 4UB4A 1KFDA 4CEDA 4FLTA 3SUPA 8ICJA 3OYKA 3DLEA 4O3SA 4DWIA 4FLZA 3V9UA 2HNYA 3LDAA 1UA0A 3VA0A 2IMWP 1XC9A 2W9CA 1WSIA 3BQ2A 4KB1A 3PMLA 3QO9A 1GOBA 4F3OA 4IBNA 4CIEA 4CJKA 4DU4A 4HCBA 4LY7A 4FXDA 4X5VA 3JPOA 1W9HA 3H4DA 2EHGA 2KTQA 2P6RA 4FO6A 4TURA 4KHNA 4RQ1A 5CR0A 4F50A 4K4IA 4LSLA 4J2EA 2BDPA 5J2JA 2C22A 5KRTA 2BCVA 3WNFA 3DRRA 4LZDA 5J2HA 4Z6EA 3DLGA 4F93B 1RBSA 3HPGA 1YT3A 5HRPA 7ICPA 4CHPA 4HCCA 2PI4A 1RTIA 5HMLA 2W9AA 1XSPA 3SQ0A 4CGHA 3CM5A 5L9XA 2G8WA 1NKBA 1KEJA 2OA8A 3WNHA 4FJXA 4ECUA 5DG7A 1XHZA 5FRNA 4RW6A 4Z4HA 1HRHA 4I2GA 4NCGA 2JLEA 4J9LA 4I27A 4DSLA 4DQQA 1SL2A 2R8GA 4F8RA 4KAZA 3GV8B 4ID5A 4EP4A 5KFKA 1N6QA 4EZ9A 4I2QA 2W8KA 3SI8A 1ZQIA 4PHDA 1TVRA 7ICVA 4Q44A 4AHSA 4JRQA 5KFZA 4RPYA 3MFIA 4EZ6A 4J9QA 2QKBA 4I2JA 3B0XA 4QZ9A 1UA1A 4PPXA 4Z6FA 3N4MB 7ICKA 1WCLA 2ZUBA 1A5XA 3I0SA 1NOMA 3QEVA 4DTJA 2C2RA 4F2RA 2X74A 5D49A 2ZTEA 2P51A 4F4ZA 7ICIA 7ICUA 2R8KA 4N41A 4PQUA 3DRPA 4KLSA 1CZBA 1HQEA 1Q9XA 3K75D 4J9MA 2DPIA 3OS2A 4H8KA 3QIPA 3TAEA 3C21A 5KT2A 2F96A 1D8LA 3ZT2A 1BVSA 5KFNA 2UVUA 1ZQVA 1RCHA 5KG5A 3A2FA 3MXMA 3DMJA 3U6FA 4M2YA 2GBZA 2BPGA 1XWLA 2BCSA 4NLGA 2OPSA 4FBTA 4CJFA 1WSJA 4ZTJA 3ZSVA 1ZQQA 2KZ3A 1ZQBA 2R8JA 5CYMA 3H8SA 1N48A 2X6SA 1HYZA 3NDKA 4IQTA 1ZQOA 4KLHA 4GC6A 4Y1DA 3K57A 2QXFA 4DU3A 3K4GA 3KKRA 4IFYA 1CUKA 2QKKA 2KW4A 5HBMA 3OS0A 3NAEA 4DSKA 1A5VA 3ZDAA 3KD1E 4KMUA 3JPRA 3ZSXA 3MXIA 1X9SA 4TQRA 4LD0A 4E3SA 1TK8A 3RRGA 3LPUA 4CF9A 3V9WA 2PFPA 5D3GA 4W5RA 3V9XA 3AVJA 2NUBA 3OVNA 1RDBA 3CQ8A 2BQ3A 3V6KA 8ICTA 5J2CA 3UQ2A 1U45A 4B9VA 3MR6A 3NF8A 4MFAA 5KG6A 2OPPA 4RU9A 4PGQA 4RZRA 2ZJAA 5KFVA 4FZZA 5IIOA 4FBUA 1LWFA 4UAWA 3LALA 1JLQA 1WSEA 1EXNA 2YNIA 3L8BA 3LP3A 3SJJA 1T05A 1RBUA 3K59A 5DDMA 1C0MA 3DLBA 2BHNA 4NY8A 4QCLA 4YNQA 3N97B 1TKXA 1TV9A 2IDOA 3DLRA 1T3NA 4N56A 2P1JA 5CP2A 4J9KA 4C8LA 3BJYA 5KFBA 2RDIA 3VQ6A 1DGSA 3MABA 4KITB 3MEGA 1RTDA 4HTUA 5KRSA 3HO1A 4DFPA 9ICIA 1DTTA 4DL2A 3FDSA 4Q43A 5KG3A 2ZE2A 4G1QA 1ITGA 1WAFA 5DGBA 3H8JA 3ZT0A 1ZQYA 4CGFA 3G6XA 3L2QA 3TANA 2PI5A 3MEDA 3C23A 1YVUA 4FW2A 3C1ZA 1SUQA 4DS5A 4JWNA 8ICPA 3OYHA 3Q8RB 5KFMA 2BE2A 4FS1A 1C7YA 3PX6A 1TGOA 1VSMA 4BE0A 4FJKA 1IO2A 4HUFA 1S6PA 2JZBB 4DL4A 4FJ8A 3DI6A 5J0WA 2Y1IA 2XO7A 1O1WA 3EWAA 3C2KA 4JWMA 1SL1A 1T8EA 2X6NA 2ZD1A 4KHYA 4YR2A 1QSSA 1FKPA 3B6OA 3K5LA 4IRDA 1ASWA 4YMMA 5DG8A 1RT2A 1VSJA 2FLPA 3MECA 4F3TA 7ICGA 1BPBA 5J0OA 3KLFA 4CF8A 5HNKA 4YG2A 1ZQDA 2UVWA 1S10A 3WNGA 3OYJA 3V9ZA 1VSLA 4QZDA 4ECQA 1ZQNA 5CYQA 1BPDA 3KLIA 5J0QA 4RQ5A 1QTMA 3L2WA 2KFNA 4Z4EA 4KLTA 1TVAA 4KN7A 3JPPA 1HPZA 4NXZA 1L3UA 1RT7A 1VSDA 4KHUA 1RBVA 4M3ZA 2BCUA 3AA2A 1GOCA 1RDCA 5EWGA 1RYSA 3HVTA 4FK4A 4ECVA 5KFPA 1U47A 2H5XA 4UB2A 3AVLA 3C2LA 1S0OA 3PO4A 3HPHA 3S3MA 1XO1A 3D0PA 4MQ3A 1BIZA 1L3TA 1HNVA 1JN3A 4YFKA 3O4NA 4M04A 4CJ3A 1UWBA 3OS1A 5KGXA 3ZD9A 5EWEA 3T1AA 4ECXA 4K4HA 9ICRA 4ECWA 4LH5A 1RBTA 1Y88A 4IDKA 3K5MA 4M3UA 4K4GA 2FC0A 5F9LA 2WONA 4CFCA 3NBPA 9ICLA 2FPMA 1NKCA 2JEFA 4P4MA 4O3QA 4BDYA 3TAQA 2W42A 3HYFA 1JLFA 8ICKA 3VQAA 4FW1A 4M41A 3UXPA 5D4BA 5KFGA 9ICPA 4UBCA 2IGIA 4R63A 3F73A 2P5GA 3TAPA 1EKEA 2F8SA 5K14A 4XA5A 3RJKA 5C24A 4ED6A 3ZT1A 2B21A 1K1SA 1ZQUA 1S1TA 2J6TA 5DBCA 1DTQA 3HJFA 1BIUA 3RJHA 1QHTA 2BR0A 3LWMA 1S1WA 3ISCA 1F21A 1UT8A 4GLXA 4O3OA 2YKMA 4PA1A 2JGUA 3EYZA 4ECSA 2ISPA 1ZQSA 4DTPA 4W5OA 1C1BA 2HHVA 2XY8A 3QEXA 3RAXA 5I3UA 3T5LA 2W9BA 1SKSA 4BXOB 4FS2A 4OPKA 4BXOA 1XS9D 5KFFA 4PGYA 5HRSA 4ED2A 4FJHA 1BI4A 4UAZA 2BCRA 5J2FA 8ICXA 4I2DA 3PW2A 4O3RA 8ICVA 4QOZB 2HW3A 1U04A 4DTOA 4CIFA 1BCOA 3P5JA 2BKEA 3RJJA 2FMQA 5KFDA 2HMIA 3JPQA 1G15A 3AVHA 3RJEA 3BQ0A 1C1AA 4YQWA 3NF9A 4B8CA 3L3VA 3FYHA 5TZVA 3SQ1A 2PZSA 4FLYA 1JIHA 4FLUA 3VQ7A 3LANA 3AVCA 2DFEA 3HT3A 1NKEA 4KLMA 4IRKA 2RN2A 5DB9A 4BDPA 4CECA 3AA5X 4DTSA 1N5YA 3CFPA 1UT5A 2R7YA 3NTUA 3C94A 4Q5VA 3HVRA 2Y1JA 1X9WA 3RMBA 5CHGA 5KG1A 3AO5A 1VSIA 3NGDA 2FPKA 1L3SA 3LDSA 5IIKA 4YMOA 2ALZA 4KLDA 3GIKA 2KZMA 4ECTA 4IG0A 3SYZA 4M47A 5HHIA 1SL0A 1ZQMA 3M8QA 3OYMA 3S3NA 2AJQA 3M8SA 5KFWA 3V1QA 4O5EA 4DFMA 3HWTA 4KO0A 4E7IA 4BWMA 2HHTA 3T5KA 4TUQA 1QLNA 4NCBA 4OLBA 3KHHA 3EZ5A 4IQUA 2AGPA 3QETA 4MF2A 3L3UA 4UAYA 4Z4GA 4I2PA 3MAQA 4KLLA 2FLNA 1HMVA 4QZ8A 3HL8A 7ICHA 3P83D 2C2DA 3AU2A 1LW2A 3SCXA 3RB3A 2IHNA 8ICGA 3T3FA 9ICEA 4DQPA 3C95A 1ZQCA 2HHUA 3V6JA 3CFOA 3T19A 2O4IA 4DQRA 3KJVA 7ICSA 1SZPA 4YN4A 4F92B 4EBEA 9ICSA 2HNDA 4EYIB 4ELUA 2NRZA 3AVKA 1IM4A 2MUTB 1RT4A 1U9LA 1GOAA 3QESA 3PUFA 1ZQXA 5KFSA 3AV9A 4RW8A 3GV7B 8ICMA 3ZT3A 1LW0A 3T5JA 2FBYA 4XIUA 1S1UA 4JRPA 1NOYA 3C2MA 4IFVA 4QWEA 1JX4A 4FJGA 7ICRA 1Z26A 4H4MA 2ISOA 4UB3A 3ZSWA 4Z4CA 1S9FA 4JV1A 4ED8A 4RW9A 4KHSA 2FBVA 7ICJA 4CJ4A 5KI6A 4DTNA 1WAJA 4PY5A 4GXJA 1RILA 3EY1A 7ICTA 3SUNA 1HQUA 3VQ5A 2BPCA 3DYAA 4BE1A 1N56A 4AHCA 2XGPA 1YTUA 2KQ2A 3I0RA 2XCPA 4DTMA 3OHAA 2G8KA 3E01A 2D0BA 3OYCA 2A1RA 4QW9A 2VWKA 4GXKA 1KVBA 4FLXA 2G8HA 3AVIA 4I2EA 1ZBFA 5EU7A 1ZBIA 3LAKA 3RMDA 2J6UA 2OPQA 1X9MA 3MDCA 4C8OA 1RT6A 1S97A 4ED3A 3VQ8A 4JS5A 3ETLA 3OJUA 4Q8FA 3IG1A 3O4QA 1C1CA 2HVHA 3DLKA 4CK3A 3SUOA 2F1JA 8ICSA 3ISBA 2DFHA 2E4LA 1TAUA 2D0AA 3ZSZA 9ICJA 1X1PA 3PW4A 3K58A 4KREA 1V9PA 1XSLA 5CJ7A 1KCFA 3K5OA 4RQ7A 4J2BA 4IR1A 3PNCA 4DFJA 3SUQA 4ECYA 5J0RA 9ICAA 5KFRA 2KFZA 4DOCA 4Y1CA 1WNSA 1S9GA 3H40A 1DOQA 5KFYA 9ICFA 3RMAA 3LP1A 3WNEA 7ICEA 4Q45A 4RUCA 3D45A 3GIJA 3L2VA 4E7LA 1Z00A 2Q3SA 5EOZA 4CJVA 3CFRA 2XC9A 4DL5A 1HUZA 4CHOA 4RQ3A 1I3AA 3DOKA 3T5HA 4PHAA 3IHQB 1SKRA 4PHPA 4QZEA 4O9MA 4O4GA 4WE1A 4UB1A 3DOLA 3LZIA 5J2PA 3H08A 3IAYA 4J2DA 1COOA 3V81A 1HJPA 4E0DA 9ICVA 8ICNA 4UB5A 4CGGA 2OZSA 3M9MB 1EETA 4CEBA 3H4BA 4I2BA 4J9SA 2XY6A 4TUPA 1LB2B 2PYLA 3TAGA 1TK0A 1QQCA 1MQ3A 3MR2A 8ICQA 4CCHA 1UOCA 4KV8A 4NYNA 1D9FA 4CFAA 5J2MA 1K1QA 1WLJA 1IH7A 2A1JA 4KHQA 4MFCA 4CK2A 4I28A 2FBXA 4PHEA 2JEJA 3L2RA 8ICCA 4LSNA 4I7FA 3V4IA 1B22A 2IBKA 5SZTA 4B08A 9ICOA 3IM1A 1TKZA 4EP5A 3NHGA 3PMNA 1KLNA 4JLHA 4RQ6A 4CFBA 2ZUDA 1REVA 5L1KA 4F5QA 3NF7A 2P5OA 3PR4A 4EBCA 5FDLA 3QIOA 4IR9A 4RQ0A 4I2IA 4MFFA 1TL1A 2ZJ8A 4JK1A 8ICHA 5KG4A 4I2CA 4CFDA 3THVA 4JS4A 3C5GA 4XQ8A 1VRUA 2ITGA 3GV5B 2V4QA 1D8YA 3S3OA 5DLGA 2IS3A 4OKEA 4CIGA 4ZTFA 1RXWA 4B9LA 3C6TA 3TABA 4I9QA 1VSFA 5DBBA 2W9BB 3GIMA 1S5JA 1JLEA 3C5FA 2Z1IA 4DEZA 4KLJA 1PZNA 4J9NA 4LVSA 4EBDA 3GFKB 4YR3A 5L1JA 2PFQA 3OSNA 3E2EA 1YTAA 4Q8EA 4Q0BA 1NK7A 3VQBA 2IA6A 4CERA 3U3YA 4KLUA 9ICHA 3PY8A 2W8LA 4ZH4A 1ZQAA 2VA2A 4EYHB 3K2PA 4FJJA 2UVVA 2VG7A 5JS2A 5DQIA 4DTUA 1HUOA 2R8HA 4QAGA 1RBRA 4Z6CA 1VSKA 1ZQJA 1A76A 3PO5A 1ZQKA 3KHLA 3AO4A 4FVMA 4YP3A 2O4GA 3ITHA 4IG3A 2MAXA 2ASJA 4DG1A 5JUMA 4M3TA 5KFIA 1XHXA 4CEEA 3NH0A 3TAMA 2IC3A 3S9HA 2ASDA 4NLNA 4CGJA 4BWJA 3HXMA 2IOCA 4DS4A 5KFQA 4RT3A 4ED0A 4W5NA 4KTZA 3KK3A 5CZ1A 2YNGA 3QEIA 2JEIA 2OYQA 3Q8MA 2EX3A 4DO9A 7ICQA 3VQ9A 3C6UA 2MUTA 3SV3A 5J2IA 4CESA 2AU0A 1IKVA 4GW6A 4I2AA 3SQ4A 2AQ0A 4YFUA 3KK1A 3GQCA 5DB8A 4DL7A 8ICYA 4CJ5A 9ICNA 2I1QA 1T7PA 1EX4A 3OYGA 4M9GA 5HROA 5DB7A 3HPOA 4RW4A 3GILA 2WTFA 1FKOA 4N47A 3RBEA 4J2AA 1KSPA 3SPZA 9ICCA 1RT5A 2PYJA 1S1XA 3LAMA 3RR8A 4FLWA 1C0UA 5F9NA 2BCQA 1NOZA 2ZJ5A 4FJLA 3KLGA 4M3XA 4KTWA 4CHYA 2D0CA 1SV5A 3OGUA 3NH1A 4G3IA 3BQTA 4DTRA 8ICFA 5HP1A 1B9FA 4GMJB 1Z3EB 3Q8KA 3ALYA 1J53A 3VN5A 4DQSA 3TAFA 4ED7A 1RXVA 4CHQA 4KLIA 4O5KA 2A1SA 5DQGA 3OYFA 2DPJA 4TUSA 4QWDA 1XU4A 1J9AA 5J1EA 2D5RA 3GIIA 4UQGA 1T03A 3LP0A 1X2IA 4AHUA 4AHRA 4M3WA 5L1IA 4NCAA 5T7BA 3QEBZ 4F4XA 1S0VA 2RDJA 2HHXA 4E89A 4QW8A 2XCAA 3KKSA 2YNFA 4CEOA 1NK4A 2ZUCA 4W5TA 3G0ZA 4C8MA 3OHBA 3RH5A 3ULDA 3AVGA 1ZQLA 2YHBA 8ICIA 4BE2A 4KKOA 4KLQA 7ICLA 5I42A 1TV6A 4CF2A 2VG5A 5L1LA 5J2NA 2LYHA 1TKDA 3ZCMA 4F4KA 3Q8PB 1IKWA 2G8VA 2BPFA 4HVJA 4MF8A 2BGWA 4OVLA 3PV8A 9ICGA 4FYDA 4NLZA 3ZDBA 3HM9A 5KFHA 3RB6A 4RNNA 3TI0A 3BDPA 5CY4A 4KLEA 2Z1GA 4RPXA 2B5JA 2NRXA 1BQMA 2V4RA 4YVZA 2F1IA 4F5OA 3PX4A 3PW5A 2ETJA 4OJRA 4OLAA 1JXLA 1BPYA 1LAWA 4FJNA 1WSGA 3RB4A 1TK5A 4B9UA 4BDZA 2AGOA 4FK0A 1W0HA 4F2SA 2KN7A 3ZDDA 4CJRA 1RZTA 8ICRA 5BOLA 1FK9A 1ZBLA 3LP2A 4AHVA 4M6WB 1JLBA 1RTHA 5IILA 3QINA 4JUZA 1ZQHA 3JSMA 3BGRA 3AO1A 3K5NA 4KFBA 3TQ1A 3CM6A 4M9JA 4P4OA 4P2HA 2ATLA 2Z1HA 3NF6A 8ICAA 1TKTA 3SV4A 5DQHA 1XI1A 4RQ8A 4ICLA 4Z4FA 5KFLA 4OKKA 4FM2A 1J54A 2Z1JA 5KT4A 3RH4A 5HMMA 3ORYA 3U3GA 4I2HA 4CJQA 3AO2A 3IS9A 2YNHA 1NJWA 2NRWA 1JLGA 1B9DA 3OJSA 1EP4A 4ED1A 3RH6A 2AQ4A 4P4PA 1JXEA 3TFSA 1ASUA 9ICXA 4R8UB 1HYVA 4R8UA 4DFKA 2VANA 4CK1A 4CF1A 2G8FA 4FZYA 4CJTA 4M9HA 1Z25A 1ZJMA 1LV5A 1ZQTA 5KFTA 3AA3A 3MGIA 4F5RA 4FJIA 4KN4A 1AROP 3RR7A 2ZQBA 2DTUA 1HJRA 3KK2A 2XRIA 5KG2A 1K6YA 5DG9A 8ICWA 2J6SA 4AH9A 3RTVA 8ICOA 1TFRA 5J0XA 5BOMA 1FXXA 1BI4B 1XSNA 3DM2A 1T4GA 1ZJNA 3QERA 1WSFA 1QS4A 2HB5A 3V6HA 4I29A 1ASVA 3Q8QB 5KT7A 1HYSA 4KLOA 3KHGA 1I39A 1NJXA 3EPIA 7ICOA 4N76A 3MGHA 1U4BA 5KFCA 1NK9A 4ECRA 1VK0A 4O5BA 4FJ7A 4OKJA 5IIIA 9ICBA 4J9RA 4GC7A 4B9NA 1WSHA 3ZT4A 5KG0A 1BGXT 5KTQA 3UXNA 4M3RA 1IG9A 3JPSA 3V7LA 4M0AA 2BQUA 1RDDA 1ZQFA 5FRMA 4NM1A 3MBYA 1CXUA 2FBTA 4FCYA 5DK5A 5KT3A 3QZ7A 2IHMA 3QLHA 1RNHA 4CJUA 4DSFA
chains in the Genus database with same CATH superfamily
3FAHA 4KI6A 1V9OA 3KTQA 2MMYA 1IKVB 4TQSA 2ROGA 5KL1B 1NK5A 1XNQF 1BPEA 2A6OA 3S01A 1RCXB 3UPQA 2HAIA 2HGLA 4RCHA 4FXWA 4UW9A 3UR0A 3EDRB 3Q2TC 1XERA 2CH5A 4RQ2A 3PNIA 3D68A 3I4PA 2V8PA 1WACA 3G96A 3UMGA 2AV5A 1R89A 2HGNA 2JC1A 1Y64A 5AJ3F 5AHXA 4QYZK 4KYZA 1FWPA 4JI4F 3MWBA 4AE5A 1K8AO 2WSEC 2OTLN 4CO3A 4BR2A 1RHKB 2FXUA 1R8PA 1RKIA 4FKYA 5GADP 4XUSA 2YKQA 1L7NA 5ALNA 3MWTA 5ETRA 2OPRB 5ELZA 4F0KA 2YHWA 2DD8S 1YZ7A 3PW0A 4WK1A 3VQDA 2G2ZA 4FF1A 3CD5A 4Y2CA 3OXFA 1MSWD 1WCNA 3OYLA 3I8DA 2G08A 2LU1A 1FX4A 5DBAA 2J9DA 1W2BR 1CZAN 3ZFVA 3CCES 5CQGA 4KPYA 4QZCA 2B4JA 3BS7A 5J0TA 4AHTA 5F8HA 2OAUA 1QSYA 1Y7PA 2EWSA 4DV5F 1IKYA 3FEXB 4R5PA 2NRTA 2ZHOA 1KW4A 4QZGA 4R5PB 4DOAA 2HPUA 4CF0A 3PJXA 1Z4OA 3PACA 2KM8C 3TZWA 1WBDA 3I33A 5DM6Q 3H6EA 1S9GB 3RFAA 2RF2A 1MC8A 2B3TB 2KFYA 1K8AT 2XYGB 2GS8A 2HVIA 3MX2A 4NM2A 2R8IA 2YVSA 5HRNA 4M5IA 3RMCA 3ED5A 2E5HA 4FJ9A 4CO2A 3M32B 5BPCA 3TKAA 2DNYA 3OLBA 3TZXA 4H03B 4LH4A 2OGUA 5AE3A 3QYPA 3V1RA 3ET6B 5AQZA 1N36J 3I96A 4HKQA 5J2PB 2QWMA 1U25A 3RW7A 5DJBA 1NXIA 9ATCB 5D4OA 1ZM9A 3HHLD 2IDEA 2L5YA 2B0CA 3FFIA 3MOJB 2BJ1A 3R5JB 4HH0A 3RU0A 3CCSS 2E1EA 3OYIA 3VZIA 5IT4A 3QT6A 1HKAA 3OY9A 3E0FA 3CDBA 4K2XA 1QVGM 4BC9A 2AX1A 3M8YA 1GH8A 2MQ8A 4WCEQ 2FMPA 1NI3A 4P2SA 1VQ6N 4O44A 4OI2A 2VGNA 5G5HA 4URSA 4MHVA 4AXIA 5IIMA 2KIWA 3L5KA 2FD2A 3ISDA 4J91A 3P38A 2IAJA 1FRXA 4RW7A 2KE7A 3FFKB 3IR7B 5L1MA 4DHYA 2DGVA 4JI7J 5AI8A 9ICUA 4KY3A 1QSLA 3NVWA 4DPOA 3P31A 1TUYA 4F91B 1NH7A 3WHIA 3LPTA 2O8CA 3PVXA 3FC9A 4ICLB 3A4TA 1R8HA 4ZHRA 1B7YB 5AQXA 1OY8A 2HHSA 1LWCA 3NGYA 2BJ7A 4DMNA 1BOTO 2NRVA 3H0LB 1LXJA 5J2EA 2G0CA 1B64A 1KFTA 2DVIA 4B9QA 3J81U 3O5BA 4PL1A 1UPPA 2V50A 5HMZA 3ZSYA 1NJIO 2NYVA 3VGSA 2G13A 3H59A 3DLLL 2FHJD 1P1TA 3NH2A 1VQON 3HFZB 1RDUA 4N5SA 2OH2A 3WK9A 4DB3A 4CHZA 4K8ZA 4GO5X 4EENA 2WVBA 4IQWA 3NGIA 1WSRA 1VRTA 4U67L 1X60A 4MKYA 3F9MA 8ICUA 4X4TA 1VSEA 3G9CA 3KIOA 2E29A 4ZVPB 4BACA 1YSJA 1EJ7L 1RDAA 4IQVA 3O3FA 4Y3CA 4C8NA 1YUWA 3NE6A 1VFJA 2UUBF 4CJEA 2M52A 1B92A 3OYBA 3R3TA 5C12A 3PDNA 3PIOQ 2FLOA 3BS5A 3E1YA 3HT0A 1QQ5A 2HI0A 2IM0A 3CT9A 4KB0A 5HHHA 3ENQA 3W8PA 3F44A 5LMUJ 2LA6A 4DL6A 2Z0GA 2V34A 1X4AA 5J0UA 1VSHA 3MM8A 4KGKA 2OWOA 3V7KA 2U1AA 1OVYA 4DR3K 4O3NA 4F4WA 1UFLA 2D1CA 5CD4H 4XDDA 4CF3A 3TA2A 1FJEB 5LMUF 2V5HG 4OZLA 3B6PA 1SWVA 3MDAA 1DT9A 1LAVA 3AVMA 3CMES 2HDOA 2O8FB 2HNZA 3JS6A 3WK8A 4B9MA 3BREA 2RPIA 4RWXA 1FESA 1VC0A 3ZETB 9ICQA 2RUSA 2DCUB 2R7OA 1RT3A 4M1KA 3T69A 3L7PA 3AU6A 1RAEB 2ZJQL 2HNDB 7ICNA 3UKUA 4DR1J 1AA1B 2E5JA 5MAOA 2LSNA 2WK4A 4OGCA 4A57A 7ICFA 5J2BA 4C4WA 3RUBL 2AIRB 4DPXA 1M5HA 1IKXA 3UFCX 1HNIB 4YR0A 2DHHA 3M8QB 2W7PA 1U48A 1ZQGA 3LWLA 3DGVA 4CM2A 1XQIA 2XICA 2DXDA 4EIAA 2ALYB 4FOEA 3X1LB 1IXRA 5EWFA 2GWSA 3V72A 4P71A 5C0YA 3THYB 4J9OA 2OSQA 5AIAA 2FSKA 1RSCA 1UVJA 3SI6A 1JXVA 3PSPA 5IIJA 1C0UB 4OJGA 1HUXA 2E7XA 2CPJA 1SB3C 3KYLA 2YY6A 4YXMA 3B78A 3B8HA 2P5VA 4LQ3A 1VQOS 3MPWA 1OKJA 3VF0B 5C42A 3A8EA 2M0GB 1EARA 2WHOA 4NL9A 1ZD4A 1PK3A 3GMGA 5AM2A 5GAEU 3E58A 3Q8SB 4IO9L 2E2PA 1JWWA 1QE1A 3AT1B 2QARB 4PG8A 2CQHA 4N7TA 4DR1K 2FIUA 1EB0A 3RW6A 3CQXA 1OPZA 2JZBA 5D46A 5JS1A 2Y8WA 5B0DA 4E2FB 3VQPA 3GYNA 4K0KJ 4JB3A 4FZXC 2F44A 2HQCA 4UASA 3FCHA 2YHAA 4USTA 1KQQA 2PN6A 5J1NA 3QAEA 1WG4A 3TTDA 1N4LA 5FLXY 2N3LA 3JYTA 4PXCA 4O0IA 3TFRA 3DRSA 2WVDA 3KG1A 1Q86O 3GSDA 5D0HA 3N79A 2NREA 3SUPA 8ICJA 3OYKA 2QXLA 2OFHX 4LFAF 3T1YJ 4JK8A 4WFXA 4HTJA 3I87A 2W9CA 2I5HA 3PMLA 2FF6A 4PHTX 2CPYA 1NHKL 3OFEA 2F63A 1GOBA 4CJKA 2GCFA 3J7ZT 4DU4A 2LLZA 4HCBA 2LI6A 4LY7A 4X5VA 3JPOA 3H4DA 2VONA 4X65J 1RFQA 1QAXA 2P9PB 2GQ2A 4KHNA 4RQ1A 1TAMA 4NL5A 5A8KA 3THWA 4LSLA 5LJ3Y 2YMMA 1YJRA 1HWJA 1Y9OA 3CJCA 2C22A 4FDFA 5KRTA 3AGKA 4AM7A 2KRRA 3W2VB 4GKKJ 4LZDA 4GIBA 3UMCA 5J2HA 2CGKA 3ADAC 3B8AX 3QMLA 3DLGA 4IL6U 1YT3A 4CHPA 1PAUB 2DGOA 2K06A 2V6AA 4OV6A 3S8SA 1TZ0A 5HMLA 2W9AA 1XSPA 3SQ0A 1ACMB 2G8WA 3WZ0A 4FJXA 2VBWA 3C16B 5HR6A 4ECUA 5E33A 5G0RA 2OLWA 2DKXA 4BR0A 1C4CA 2CAJA 3BS9A 2HOEA 3HSZA 4NEYA 2XIDA 2C2NA 2RUGA 4ID5A 5KFKA 4ID5B 3J7ZO 3P3DA 2M8HA 2PO4A 3KMQA 3NOCA 3I9ZA 2YH0A 3J7AP 4Q44A 2ZIXA 1R8BA 2C2ZB 2QKBA 5AKEA 2IPOB 3I0SA 3NASA 2HZCA 5E2QA 4B3MK 4J9VA 1VK3A 2JLGA 3SMPA 4DTJA 4F2RA 4P75A 5AKJA 5D49A 2ZTEA 1A6LA 7ICUA 2KJWA 1WELA 4DV0K 2OFGX 3DRPA 3PJ9A 4JKDA 4KLSA 3K75D 1N5YB 4J9MA 3HMJG 2OD6A 3IC1A 2DPIA 4L73A 4H8KA 3QIPA 3TAEA 4TN2A 2KB2A 2YX6A 3ZT2A 2WSFC 2YX8A 3LW5C 3TO8A 1HL6A 1OUQA 5BRHA 5A2QY 3ZZOA 2KT5A 5GMKa 1J5OB 3E9LA 2BCSA 2BJEA 3UDVA 4XK8C 4P2XA 1WSJA 2P9UA 1ZQQA 2KZ3A 1ZQBA 2HS3A 2QN6B 2P9UB 3BF3A 1RABB 3CMAS 3DEEA 4JKEA 4J90A 6FDRA 3UE5A 3M6WA 4AQYF 3M6VA 3K57A 2CGLA 4DU3A 4AL7A 5B0FA 2EXUA 3OT9A 5HL7Q 1A5VA 3ZNUA 4KMUA 4BRDA 4W92B 3MXIA 4AQYJ 4E3SA 3UNYA 1TK8A 2VPXB 2VFUA 2Q6BA 3V9XA 1M5SA 3PG9A 2VJ5A 2CYYA 3OVNA 2N4CA 3Q8YA 1RDBA 2FY8A 2MYFA 3ENVA 3V6KA 3PM9A 3CIPA 4WYLA 2W6KA 1U45A 4B9VA 3MR6A 4GMKA 2JC0A 1RBOB 3JXOA 2F3NA 5KG6A 4MMOA 4FVUA 4RZRA 2BW7A 2P9SB 1DLOB 3O9SA 3G8QA 1Q7YO 2QEXN 1LWFB 2QMXA 1JLQA 4US9A 2YNIA 1Y5IB 3L8BA 3ATVA 1I1GA 5DDMA 4JOUA 5HL7L 1NDKA 5HJXA 3SBTA 5E0OA 2YTCA 4YNQA 3N97B 3GWCA 2FUG9 3IR6B 3GONA 4BLGA 4N56A 5CP2A 3BJYA 3QX7A 3LVVA 4F3QA 8AT1B 3MABA 4KITB 3MEGA 1RTDA 2JWKA 2AF6A 4J5OA 5IFMA 5KRSA 1RDRA 5AI9A 3PYEA 3FCWA 5AM3A 4Q43A 2GVDB 5IC4B 1T95A 1ITGA 3HM8A 5DGBA 1PO6A 3H8JA 3ZT0A 1WI6A 3G6XA 4EAHD 2H3IA 2Q43A 4DR5F 3N4QA 3H2LA 3NAHA 3EN9A 3CULA 3TANA 2PI5A 4OYMA 3I55S 3MEDA 4CDIA 3C23A 1T44A 1YVUA 2MLYA 2O8BB 4FW2A 2MRLA 1FX2A 3MM9A 4JI2F 3PSFA 4JI5F 3J7Z5 1WOQA 4JHDB 4JWNA 3MAAB 1BQXA 2M0NA 3HSJA 2LHTA 2QARA 4LF7J 4EX6A 1C7YA 1WTFA 2JZBB 4DL4A 1XR7A 4FJ8A 3D2NA 4JI7K 3DI6A 2OKQA 3HJEA 2D9OA 4ZOHC 2XO7A 1O1WA 3EEQA 2UUBJ 2DCLA 2QWOA 2G0AA 1DK3A 2JFKA 1X4EA 1WG8A 2FHMA 3VHQA 5ETTA 2DRAA 1N32K 3M5RA 1VI7A 3K5LA 3C6AA 3QNWB 3SD7A 3OHRA 2G5HB 1RT2A 3NAIA 4DV3F 7ICGA 1BPBA 3O4WA 2Y8YA 5HNKA 2UVWA 1S10A 3WNGA 3OYJA 4K4WA 1ITPA 3DXMA 2G5IB 4QZDA 4ECQA 4IDKB 2EFQA 1ZQNA 2ES6A 1BPDA 4F72A 3AFGA 2XM3A 1FWKA 2EFNA 4RQ5A 4MK8A 4O23A 3M32A 3CCRS 4O0NA 2KFNA 1CULB 2QYGA 3CCMN 1C1CB 4FO0A 2MEWA 1BA1A 3BO3A 3B9JA 2QL5B 5JXSA 4BQLA 4DQ8A 2EBEA 1L3UA 2MJNA 4IH6A 4L3QA 1RT6B 1TL3B 4M3ZA 2OUGA 2BCUA 1RDCA 5EWGA 3HVTA 3OL9A 4Y65A 1AT1B 3VVUA 1FO4A 3OTBA 2RHSB 4CI6A 4GKJK 4DV4F 1YRXA 4H0OA 1WDTA 2YNFB 4MQ3A 1S22A 1PK1A 2Y0BB 1IJFB 1D9AA 2BBEA 3UB5A 1IR0A 4YFKA 1X4CA 4M04A 1UWBA 3OS1A 4A2BA 5BN8A 1FI4A 3ZD9A 4DV4J 1CJTA 4KV8B 1E6YA 4I4BA 3MR7A 2ZZNA 1G6BA 9ICRA 1VCTA 5CHCB 1QM9A 4ECWA 1GT8A 1S79A 3WIVA 5I42B 1L7OA 1RBTA 3G4SS 4NMXA 3TA1A 3K5MA 3D1QA 1X31C 2CNLB 2CADA 5J2NB 5B0AA 3O3LA 3R2CJ 3AJ1A 3D0GE 3OD2A 1X3MA 2FC0A 5F9LA 1W2BM 2WONA 9ICLA 3VAKA 3M2VB 3A8KA 1YJVA 4AFFA 3V81B 8ICKA 5HQ8A 1J5EJ 3VQAA 3KKAA 2H5JB 4JP8A 9ICPA 4UBCA 4O4GB 3A5OC 3DOLB 4WFYA 1NNEA 3OW2M 3D6TB 1QY7A 3P4UB 2QW9A 5C24A 4NLQA 3ZT1A 5E3RA 4PKDB 2GJ2A 5DBCA 2YN4A 1KKHA 4BRGA 3RJHA 3J8AA 5GVQA 2ZIWB 3UW1A 2YKMA 3J81O 4O44B 5ADZA 4DTPA 2HHVA 2ODGA 3CIZA 3QFWA 5I3UA 1Z4NA 5AQSA 4FS2A 3U02A 2GMLA 4JI8J 5KFFA 3CCEN 4M5DB 2VOOA 1KD1O 3OR2A 1WEXA 3C3LA 1BI4A 3M6KA 2A1BA 4EK2A 4ZPVR 4JI6K 1Y10A 4QOZB 1U04A 3GFHA 4ZHRB 4X4OA 2FMQA 2YQ0A 1Y3KA 3RJEA 3BQ0A 2YXLA 1BHNA 2WVFA 1SH3A 4IDHA 4B8CA 1VQ5N 5K9FA 1KQKA 4F36A 3WXMB 4M5HA 1ZRMA 1H1VA 1K44A 3HHDA 4A8KA 4FLUA 3NMAA 5FLXO 3AVCA 4JI3K 2HBRB 1NPPA 3HT3A 3R6GB 1UJ5A 4I2PB 1WOOA 3U8XA 2H9ZA 1UVMA 3O0FA 1W7AA 4CECA 2KN4A 3AA5X 4DTSA 4FPBA 3D2EB 4DV2K 4TLRA 3GR0A 4P0QA 4BC5A 4CE6A 3HVRA 1U6ZA 1X9WA 3B4DA 1FNXH 2BA9A 3T1HF 1KONA 2DBBA 3AO5A 3LDSA 2FPKA 2OPPB 3NNAA 1P7DA 2ZIUB 3DHXA 2R9LA 2AYEA 1OMSA 2KZMA 1RM6C 1AZSB 4ILRA 4IG0A 1UVKA 3SYZA 4M47A 1YJ7A 2IM1A 2IM2A 1H73A 3S3NA 1YF5L 2EZZA 1XQSC 3CC4N 5LMUK 4DCOB 1GMVA 2HHTA 4JMUA 1QLNA 2HWHA 4YEAA 4P52A 1ZA1B 4OLBA 3KZBA 1LCUA 4U6PA 2BZ2A 2LMIA 3GIRA 3QETA 4IH7A 3KHYA 4WPAA 1PYSB 3UKRA 4CQ1A 3KK7A 4KLLA 5CCMA 1HMVA 4QZ8A 1UETA 5IZHA 2QM1A 3QRPA 4MAKA 3UR3C 3PFEA 3OPXA 2VYPA 3AU2A 5AKIA 4BVPA 3TP2A 8ICGA 2OHFA 3CTRA 2H48B 3H98A 3EZWA 3C95A 3T19A 3SXLA 3NL0A 2O4IA 2DO4A 2JLFA 3SLCA 7ICSA 4YN4A 2ZITA 3NS1A 2QSWA 4F92B 4EBEA 5LXYA 2FVSA 2HNDA 3GJTB 1UEKA 2MUTB 5FPDA 5FIIA 1RT4A 3DJCA 4ILGB 3ICLA 3JQKA 2DNNA 5KFSA 2Z2LA 2D7SA 2D3UA 3POTA 8ICMA 1S7IA 2GNKA 1D8ZA 4JRPA 3C2MA 2KKPA 1HHQA 1O51A 4H4MA 3PSTA 3MEKA 2P8IA 4ED8A 4RW9A 1S6PB 3N0VA 4K42A 3VGVA 3CD6N 1VJ5A 4GXJA 1T11A 3EY1A 3BR9A 7ICTA 1RISA 1WEZA 4H54A 4EHTA 3QPIA 3DYAA 1LW2B 2YQ3A 4CW7B 2VIHA 3A8IA 3VGLA 2M9KA 1FVQA 2XGPA 4ZN1A 3I0RA 4FWMA 2ZIVA 3OHAA 2MKJA 2G8KA 2XS5A 2D0BA 4QW9A 2VWKA 4GXKA 2BMBA 4FLXA 3RBXA 2Y0SD 4I2EA 1ZBFA 1N34J 5CAAA 4FWKA 2CFXA 2DRDA 4C8OA 1S97A 3ETLA 2VKRA 2LECA 3E9OA 1HHSA 2WUSA 2F1JA 3NVMA 3M6UA 2PEHA 1KL9A 3ISBA 2DTJA 2ZC3A 4ILJA 4X4RA 2D0AA 2JNJA 4RW9B 1XSLA 5CJ7A 3K5OA 4JKGB 4RQ7A 2DH8A 1REGX 5GAEP 4DFJA 2PKEA 4DV0F 3JSYA 2KFZA 2P9PA 2ZNYA 1VQYA 5TKYA 1CJTB 1MU2B 1DQAA 5K5MA 4DR4K 1DOQA 4OJLA 1R8AA 7ICEA 3ULHA 4BR4A 4IJNA 5IT0A 2EAOA 3L2VA 1JROA 3ZNJ1 4CZGA 4IOCL 1NGFA 3JAMU 3BSOA 5JMVA 1SC4B 1Z00A 5EOZA 1TKZB 2OEJA 5RUBA 4DL5A 2F65A 2IIHA 4EGLA 1I3AA 3T5HA 3CJKA 3CJKB 5AKGA 3E66A 3IHQB 5F8IA 1ZC6A 2K7KA 2CVIA 4RWTA 1COOA 2E8PA 5F3XB 4KAIA 3Q22A 9ICVA 2HBKA 5L8RC 1QVFM 3VEOA 4TUPA 1N88A 4BRIA 3EE8A 2UXDJ 1CPZA 1H2UX 3MI7X 4OYBA 3MR2A 4CFAA 1D9FA 2NXNA 5J2MA 3G8SA 4ISEA 2CQ0A 1IH7A 3A0IX 4MFCA 4CK2A 2MZQA 2IHR1 3H46O 4PHEA 1QQMA 2NPIA 2MZ1A 1JLBB 4WF9L 3AGRA 1OSDA 4Z37A 3V4IA 4ZP7A 9ICOA 4EP5A 4X2BA 2DGZA 4JLHA 2ZUDA 5GAHI 4Q0BB 2RB7A 4F5QA 2HBMA 2XI9A 4NE9C 4EBCA 4WU2A 2VPWB 4RQ0A 5HMYA 4CLYA 2CJ9A 4UUXA 3QSYB 4DR3F 1YX2A 4I6YA 4B6JA 2WHEA 3THVA 2XO6A 4JS4A 1YITN 4G1IA 3CCVN 1UJ6A 3ISZA 3ZI4A 2ITGA 3GV5B 4PEOA 5DLGA 5ALYA 1VGYA 1ZZNA 1RXWA 5AXNA 5FLXU 3NRWA 4Y2VA 1AQ6A 5ALQA 4OZ3A 5LSOA 4JI3F 3WKEA 4C11B 2DH9A 3QGHA 1LKZA 2Z1IA 4MN4C 1SH0A 2W43A 4KPCA 1G7CB 3GL1A 1FRKA 3O9QA 4Y2AA 4YR3A 3HZEA 5IT9O 4IKAA 3CPWM 3H7HB 2YNGB 1D8BA 3QWPA 2HSTA 2WC9A 4XH5A 5AK6A 2IA6A 4HDHA 3ZO7A 2CPDA 2QZ8A 3A0BU 1PUZA 1ILYA 1VBKA 2W8LA 4IEEA 4KO0B 4ZH4A 3VOVA 4NA1A 2VFSA 1JLQB 1XR6A 4FJJA 5C2DA 5JS2A 5HROB 2R8HA 3NVYA 1RBRA 4PWUA 1VSKA 4ZP8A 4WYWA 3W9JA 3DGPA 5EUHA 3PCOB 1CJVA 3FK4A 4LVNP 2FQQB 5FD1A 3KHLA 2G07A 3SFGA 2XLKA 2E5LF 4YP3A 1CG2A 1MWYA 2R7SA 2BKOA 1DTTB 4PKGA 3ITHA 1F5AA 1P6TA 3CD7A 4USHA 2C3YA 4G1QB 4CEEA 2IC3A 3SSSA 2ASDA 4NLNA 4BWJA 5AQJA 1VHFA 4Y2TA 1GXTA 5C42B 4FL9A 4ED0A 4KH0B 2FVPA 1ELOA 3T9NA 2CA9A 3Q8MA 2EX3A 3VQ9A 1U2CA 3JQMA 3C6UA 5A76A 1RT4B 4DR1F 4DV4K 4CESA 4FZLA 2ZOGA 3TPQA 4N77A 3SQ4A 3R27A 4RWWA 1CC8A 4YFUA 5ETQA 3AB2B 2KICA 1DY3A 2I1QA 1T7PA 1KD1T 1RP5A 4ED5A 4M9GA 3GILA 3PRBA 3W5ZA 3A12A 3PJWA 3SPZA 1RT5A 2PYJA 2B7CB 3RR8A 2D69A 2CQBA 2JXJA 2QJ3A 3QSIA 1ZPVA 2JVRA 2D74B 1EKRA 4ZPWR 2BCQA 5JLFA 4P6QA 1NOZA 2ZJ5A 1Y11A 3KLGA 2D0CA 4K41A 1X66A 2RMLA 5LT5A 1KAXA 4WCEL 4Y2SA 2MKYA 1SWWA 1WB9A 1GEHA 4KX5A 2RNEA 4RPFA 5ETLA 1RT1B 3K1RB 3D66A 3POTB 3R6MA 2IOFA 5AK4A 5HP1A 5LMNJ 1Z3EB 3W7BA 1J53A 3VN5A 4CO4A 4FWNA 3TVYA 3TAFA 2QIFA 4IFVB 4PYAA 1SQGA 1GLAG 4R0JA 2EW9A 5DQGA 2DPJA 3H5XA 4QWDA 2E5GA 1SVDA 1S72N 2DY9A 1N8RO 5KAFU 2XHWA 1MROA 2LQ9A 2D5RA 4KHPF 3N4PA 1U26A 3RZAA 3I82A 1BQMB 4NCAA 1HNXF 2UUBK 3VVTA 4KJIA 2NLWA 2HHXA 2IYGA 1N5QA 5B8HA 4QW8A 1SIJA 1N32J 4CEOA 2J8SA 5CYJA 2W4PA 1RAGB 3ULDA 1ZBTA 1ZQLA 2E1FA 8ICIA 4BE2A 4KKOA 4KX3A 1C0FA 1WC1A 1URRA 2C2OB 1TV6A 2Y9HA 5L1LA 4I6MB 1TKDA 3KLHB 4F4KA 3Q8PB 1FA0A 5M2RA 4QR1A 3KLVA 2LYVA 4MF8A 4A5BA 2BGWA 4CLLA 3PV8A 2DF4B 1QH9A 3BR8A 1YTYA 5JVGQ 3Q8VA 2P35A 4HHUA 3RB6A 4GRSA 2DNMA 3SCKE 4GKKF 4F25A 2B5JA 1NGCA 2H3GX 4ZA1A 4YOEA 3L4QA 2DNPA 4YVZA 2UP1A 3QFPA 2F1IA 1OYDA 3PX4A 2X7IA 2Z30B 3QJPA 3PIPL 3QUQA 4ZIVA 1SQEA 2A19A 1U8SA 1WSGA 2P9NB 4C6AA 3SEIA 3VCBA 3RB4A 4WP8A 4WTOB 4PKIA 3M1VA 4UOGA 1YHQS 4B9UA 1RGVA 3VQSA 3U1NA 4MDBA 4J37A 1NB7A 2AGOA 2LEAA 2CH6A 2DNOA 1RZTA 2E9TA 4M6WB 1JLBA 4USIA 5IILA 3K5NA 4KFBA 5G4DA 4P4OA 4LUBA 1X4HA 2Q79A 2HOQA 4BY9C 4ICLA 2YKNB 1I5OB 3CB4A 1C20A 4I2QB 3I31A 5JTIA 2Q1NA 3A0HU 4PPZA 1H72C 1VHIA 3T6JA 5HMMA 3R5CA 3IS9A 2VJUA 4FF4A 3UVJB 2YNHA 3VF6A 3C14B 2NRWA 2Q36A 2HHHK 2V4JA 1EP4A 4ED1A 4P4PA 1WG1A 2MLZA 4R8UB 4KHMA 1HI0P 1P9YA 2HMXA 4DFKA 4K0KK 2O8FA 4CK1A 3AJDA 4PQUB 4A48A 4CJTA 4M9HA 1ZJMA 1DEJA 1XNQK 1ZQTA 1V38A 4M5GA 4YORA 5ALXA 4JI6F 3F2KA 3RR7A 4K5SA 3KK2A 5KG2A 3D2WA 8ICWA 4NZ0A 3BGRB 1Q82T 2J6SA 1I6JA 1XSNA 4PRFA 4V1Ak 3DM2A 3DWLA 4GNIA 1ZJNA 4BGAA 4B17A 1NZAA 4FWSA 1QS4A 3O9UA 1FFUA 2WMMA 3MMBB 5CYMB 4OI6A 4KLOA 4OYAA 1X40A 3LM9A 4P0PA 7ICOA 4N76A 1U4BA 1NH8A 4EEKA 3CJ5A 1QAYA 2K7JA 4O5BA 3AHPA 1U1MA 5ADXH 3R97A 2VKQA 1T9XA 1WSHA 4CO5A 4NLVA 1BGXT 2HHHF 5GIOA 2UXCJ 4B3RF 2E1PA 3N01A 2W3RA 2BXJA 3UQSA 5ALZA 1IV8A 1CQMA 1ZQFA 2E5LK 5BREA 1QQ7A 2Y1RI 2EDUA 4DV2J 3QLHA 3AOCA 1RNHA 3O6QA 5GAHP 2LP4A 2DBYA 5C25A 2KG5A 4OZ1A 3DRXA 4DR4J 4C3MA 3TW0A 5I3PA 1CZ9A 4WXWA 2QO3A 4YB7A 3TJ9A 1HYSB 2D4WA 3FMWA 3OR1B 4IO9Q 3PX0A 1Q7LB 2KSOB 2HSEB 3NOGA 1QE1B 1WF1A 1HD0A 4ED4A 4Z0UA 4FNHA 2YH1A 1YJUA 3FBCA 5KFEA 3M2UB 1KEKA 1ZBSA 1FXRA 4NXMK 3H5UA 3PW7A 4DSEA 2Z56B 1JJ2R 9ICKA 1ZETA 1OW5A 5M2UA 4PGXA 3NGSA 2D1KA 3FE1A 2ZXHA 1EZZB 2B43A 1JL1A 1VQNS 5GIPA 2EFPA 3B82A 5J2QB 3BN4A 4C0ZA 4ISFA 4LIRA 4E7JA 1G99A 2G8IA 9ICTA 2BANB 4JB8B 4BCAA 3CDWA 2ZH7A 1Y97A 2ATQA 3WKDA 3C6UB 3RJIA 2UXCK 3QE9Y 4KHWA 2CUYA 1SUQB 3CCWA 4EI2A 3D2SA 1JL2A 2CPZA 1HI8A 2C2EA 2JJ4D 4DU8A 1ZQPA 2OD4A 3GSIA 2K1RA 5T41A 2LKZA 1U7LA 4CT8A 1QUVA 4OL8A 5BYSA 2KSOA 4QWBA 5ALUA 3F2BA 2K8CB 4DLEA 4X66J 1Q3UA 5ETVA 9RUBA 4MEYA 4F04B 4LJXA 1DRGA 4FJMA 1JMSA 4DSJA 3RBDA 1F2GA 1YLXA 3VA3A 2QG9B 1S76D 3AB4B 4KTQA 3IXQA 4M9NA 3MECB 4NEZA 1S6UA 4LF9F 5KFUA 2V63A 3H7IA 4NA2A 1FE0A 3EVWA 1IR2A 2IAJB 4ELTA 3CJQA 3KFWX 2N4DA 5IT9U 1O03A 3BBBA 2DXEA 4LF5F 1G3OA 3O08A 3QZ8A 2GELA 4DQIA 2WVCA 5CA7A 1BO5O 4E1MA 1RT7B 1TL3A 1GAOA 3BQ1A 3PYGA 4ID1A 3IBWA 4CZJA 4U7UD 2W9MA 2QLWA 2X78A 4FM0A 8ICLA 1S77D 1KQSM 3MDQA 2LA4A 1VIXA 1KVJA 4OJ3A 3IWNC 4E19A 3GG1A 2IVFB 4LZGA 2E66A 2PFNA 4DSIA 3BN7A 3V1OA 3RF9A 4GKKK 4B3OA 2Y0SC 3RB0A 4CD3A 4RG8A 2AHOB 3D2FA 2ASLA 1RPLA 3GBTA 4MYTA 4F5PA 2N1RA 5FROA 4ZPTR 3MMCA 2GOLA 2MQQA 2FPLA 1HX1A 3OTQA 3VQQA 1ZBHA 1WUAA 4DR2J 2PXIA 3NS6A 3K0SA 2WFBA 1SGGA 3HRDD 4ATNA 1RTHB 4QBUA 5HI7A 3B0YA 2PFFB 5D0EA 2YV0X 3CSKA 4DKWA 4C0BA 1Z00B 2WF5A 2GVZB 3VQEA 4WZQA 2UVRA 1HNZK 3QRRA 1FKAF 4YOWA 1VQNN 1Y00A 4CEFA 3H8WA 3U7JA 5DDYA 4H5WA 5K14B 2H65B 5CH7B 1AFJA 4MO5A 4KSEB 3D2QA 1RWMB 2VA3A 2GAGC 1HWUA 1HWLA 1S1TB 3AVFA 4OPJA 4C2MA 3WKCA 1MQ2A 4JI2K 3G10A 5D6GA 1EP4B 2CDRB 2CQCA 3SSRA 2P9NA 3RAQA 3OYEA 3IM8A 3WXKA 1RQ0A 2J76E 2DY4A 2B6AA 5LXRA 5AQFA 1HNWJ 1SKWA 1CLQA 3EGZA 5CB1A 5IM0A 2B56A 2LYBA 2LEPA 4ES2A 1VOMA 1G2EA 3HHLB 4CJWA 4LQ9A 2JDJA 3H8MA 3SIPB 4GVMA 2OYYA 5CRXA 2ZDOA 4CEZA 2MZJA 5ALKA 2EI5A 4HI1A 4NWBA 4OHZA 2OEKA 3ZDCA 1GXLA 2RKIA 3D6JA 4RNMA 1BLUA 3TTCA 1VR6A 2L9DA 2ZTDA 4F4YA 3TR8A 3VGMA 4RNOA 2WW4A 5KT6A 2RRAA 1AB8A 2ATCB 2FZKB 4JV2A 1U6FA 4FJ5A 1X5PA 4FWPA 1HNZJ 2W1BA 3MM5A 5KPRA 3SBGA 1S6QA 1TR0A 4YCXA 2W11A 4RLEA 2G0IA 1A5WA 4Y2QA 4QZAA 4A62A 5F8MA 1Q8BA 3H45C 4DR6J 1RYRA 2AGQA 2HNZB 4PR6A 3L0QA 5HRRA 1N0UA 4QIFA 1JLEB 1KTQA 3T9ZA 2ZE2B 4KC5A 1FCAA 4CEQA 4FXVA 3VAGA 2C42A 2FZCB 2Z58B 3M8PA 3O3GA 2YWWA 2NCKL 1VQLN 2YKOA 3NFAA 3ZD8A 5DLFA 1DARA 1SPBP 2JX2A 4BG9A 1XIQA 8ICBA 3JPNA 1JLAA 4FK2A 3IAM9 1GNKA 5F8LA 1ZQZA 3MAAA 2BQRA 1TL7B 4CDGA 4HYKA 1NK6A 1NMDA 5BPLA 2HBQB 4K4YA 2FJXA 4YMNA 1KHVA 3AA9A 4QWCA 1AFIA 2XHBA 4ECZA 1C0TA 1SC1B 2DHAA 4E8UA 1TMMA 3MEEB 4GFJA 4O5CA 3MEEA 1XO0A 2LFVA 4RPZA 1O5JA 4NLXA 2GUIA 2RILA 2UZAA 2N82B 2ZXIA 3MCSA 2FLLA 1RTDB 4AL5A 4LFAK 3M6ZA 1QD1A 3D0IE 2ZIVB 2RRBA 1BG3A 4KLGA 5IWAF 3EPGA 3KLGB 5J0PA 5ALWA 1KFSA 7ICMA 2UUTA 4A8EA 1E6VA 1UW9A 1UWAA 4DOBA 5SWMA 2YWHA 3FRYA 2HFUA 5SUHA 1RTJA 1S9EB 2H54B 2VC1A 3HD2A 5ETNA 1ZPWX 3CJ2A 4HHTA 4HUEA 2AW0A 3DLHA 2M9NA 2E6MA 1OJ4A 3KXDA 2QLBB 3KLEA 2BJ9A 3FSIA 4EX7A 2Z2MA 4LJMA 4K4VA 1GO3F 3HK2A 3MFHA 4RU2A 1Q3VA 3MN7A 1GTEA 4CZMA 5HP4A 3UE2A 3HW8A 4M3YA 4R79A 2XI2A 2ABYA 5B66U 4DU1A 1YI2N 2NSBA 4QWAA 1P8ZA 2XS2A 2VG6A 5CYQB 5B0BA 2HIYA 2WSCC 3KLIB 5T7LA 2GV9A 3PR5B 4BR5A 3MF5A 2NRHA 5KNIA 4ZPAA 1C6VA 3ZX3A 4CLWA 1ZQEA 4DX7A 4WIIA 1IJJA 3VGKA 1KFDA 1J2VA 1B0PA 3CNHA 4O3SA 3BKTA 4S0MA 4UY8O 3KZIU 3LDAA 4AT1B 1URNA 4M5LA 2JHDA 4DV2F 1JNRB 5IV3A 1WSIA 3BQ2A 1SV4A 1J2NA 4F3OA 4IBNA 4CIEA 1KC8O 2GV1A 2YCHA 3R5GA 4OJPA 4RTFD 3T1HK 4FXDA 3TRGA 1H2VZ 2HFOA 3F2CA 2KTQA 3HHNB 5C24B 4TURA 5CR0A 4K4IA 3R6LB 2ZJRQ 4J2EA 5J2JA 2RRDA 1M5PC 2Z7JA 3IM9A 3I0SB 2VG6B 3DRRB 3W61A 2GGPA 2E7WA 4Z6EA 5THWA 2A3ZA 4F93B 3HPGA 4OI1A 4CH7A 4AP9A 4B3SF 5HRPA 7ICPA 4KRWA 2PI4A 4J9UE 2PIIA 2OHDA 4MT1A 3CM5A 2KM8B 3MCOA 5E26A 1OXJA 4PXDA 1NKBA 3LP2B 4LF4F 1REVB 1CJKB 5FRNA 2HFVA 1HRHA 3RVCA 3JSMB 3B6BA 1U2VB 5GAGP 4ZP6A 2WB4A 5G5GA 4J9LA 4DSLA 3TSPA 4DR5J 3OVAA 2D3OR 3GV8B 3CJBA 4KAZA 3I5CA 2E1MC 2BM0A 1P8GA 2KXFA 3BQ7A 4EZ9A 2W8KA 5HATA 4NLOA 4AHSA 1F60B 1SJRA 3I6PA 4EZ6A 4J9QA 4I2JA 5H1SQ 1PJ5A 2KYZA 2V8DA 3ILLA 3ZZRA 3VGTA 3FBBA 3N4MB 7ICKA 1HEKA 3CJ9A 2AEMA 3F56A 1A5XA 2AYGA 1SJ3P 1NOMA 3QEVA 3SK3A 4DX5A 3RYLA 5ALSA 2C2RA 2QWQA 1Q8KA 3IFEA 5EX5A 4C0OC 4U7UK 4QIGA 1CZBA 4FE3A 3VEYA 3VAFA 4UY85 4WZMA 2YWKA 2LQ8A 1JK9B 3W2WB 4IOAL 5KT2A 2BDUA 4LF9J 2CXYA 4NWIA 4A8YA 5LM7E 1BVSA 2UVUA 5H9FK 4DZDA 5JLHA 4LF4K 1F3FA 1RCHA 3A2FA 3MXMA 3DMJA 3PEJA 1R43A 2W3SA 4CF5A 1N34K 1RQLA 3LGMA 2NXEA 4FBTA 5ALJA 1LXNA 3ZSVA 4LF5J 3H8SA 1SH2A 3ZX0A 4CZKA 3CC7S 2EFOA 2MZTA 4GC6A 4DR5K 2DY1A 4BREA 3K4GA 3NS5A 3WDOA 2YNHB 4P10A 1CUKA 2X1FA 4KBOA 3NAEA 4NI2B 4JI5K 3JPRA 3ZSXA 4MLHA 1X9SA 4ZN3A 2HIQA 5AE1A 1FFVA 4ES3A 4CLSA 2MSTA 4CF9A 4PWWA 3EL2A 4FFDA 3OQ2A 1PJ6A 1Q5YA 2KJVA 1V3ZA 3W2WA 1K8KB 3CQ8A 2BQ3A 3M4XA 2HG4A 3GE9A 1H0HB 3UQ2A 1IN0A 2YQEA 3DXBA 3UD3P 1FJGK 4MFAA 1T6CA 2RLTA 3O8MA 4PGQA 2VC0A 2ZJAA 3TZZA 5IIOA 4FBUA 2IMOA 2QE5A 3OPKA 2E1RA 1WSEA 1EXNA 1I94J 1EIYB 2QLXA 3LP3A 4DV3K 2DKOB 3JSRA 2WZ1A 4LF9K 1C0MA 3DLBA 3R1XA 5H9FJ 4NY8A 5A8RA 1NAQA 1TKXA 4DR7F 1T3NA 3E51A 1YBUA 4J9KA 3KUEA 2GFFA 4OLPA 2FB0A 2X1AA 5FPEA 1G1XA 5LJVA 1C0TB 4LF5K 3HO1A 2KLAA 9ICIA 2ZE2A 4KT0C 1TYQB 1N52B 1WAFA 1ZQYA 3CCUS 5AKLA 4MIBA 4X64K 2E5LJ 4PJ0U 4Y34A 4I1TA 2I8EA 2MSSA 3L2QA 4NPOA 3RSEB 3QNMA 3BGLA 3DLLQ 1FFWB 2AJFE 4Y6IA 5AQTA 4X4NA 1OYEA 1U6BA 1CI4A 4DS5A 8ICPA 3OYHA 4HACB 1VQ4N 3KLEB 2BE2A 3CJTA 2RQCA 2P9SA 4C4TA 1TGOA 1VSMA 1S6PA 3TVZA 5J0WA 2JWNA 3M30B 2PMZD 2LU2A 3THYA 1KLMB 1X0PA 2A1AA 1FJGJ 2K8BB 3EWAA 1FFSB 3C2KA 1SL1A 2P9LB 1T8EA 2X6NA 2HOIA 4KHYA 4YR2A 1FKPA 2YBVA 4UT4A 2WFAA 3MECA 3I4HX 2HBZB 4YG2A 1HNZF 1UL3A 3W63A 2PMZF 1VSLA 3EDQB 5HMXA 1JRPA 1PG5B 5CYQA 5AQGA 4P72A 1HR0K 2HLTA 7FDRA 1QTMA 4KHPJ 2BEFA 4JKBA 5JMNA 3QUBA 3WUHA 3AOBA 1M90T 1FDAA 2H5EA 4KN7A 2D6FC 1SC3B 3BO2A 3BGOP 3CP8A 1HPZA 4ANCA 4NXZA 1VSDA 5L9NA 1WHYA 1H98A 1GLDG 2FHOB 5M2PA 5I9EB 3QIDA 2WF6A 2RAQA 2QFJA 1U47A 4EFAC 5L38A 2OM6A 2UU9K 2CQIA 3SMZA 3R1LA 5ALEA 2HGMA 4RUHA 3HPHA 2LXUA 1ZRNA 4ZVGA 3TJ8A 5BRDA 1DXSA 2WAQD 1L3TA 4CM0A 3N5BA 3VZHA 2DUYA 4IOXA 2A0FB 5DM6L 3BO4A 4ECXA 2CNKB 4K4HA 4UOHA 2OI2A 2CPFA 4GVLA 2UUCJ 2RF2B 2CJXB 3QBWA 4IDKA 1V4SA 3MMCB 4ZLJA 3DLGB 2HLUA 1I51B 4PL2A 3M1YA 4BRKA 4K4GA 4CFCA 3KJFB 2ZBQA 3NBPA 1NDPA 4QS8A 5AT1B 2JEFA 1Q53A 3AODA 4K43A 1L7MA 4FW1A 4A8SA 5D4BA 3NMUA 2BKPA 4QQBA 4DN0A 3F73A 4MJKA 3AJ2A 1EKEA 2XMUA 2B5JB 2MDAA 4AM6A 2F8SA 5K14A 4YS2A 3RJKA 3H1QA 5U47A 4P73A 1Q5VA 1T9TA 3FLCO 4USJC 3GZFA 1DTQA 3HJFA 2QYCA 4W98A 1BIUA 2V4JB 2ADCA 3LWMA 2RP5A 1S1WA 1CVJA 1H7WA 2YKMB 4OI4A 2HWTA 3MUMP 1ZQSA 4TYAA 4JD2B 2YPZA 4JD2A 3QBCA 2K3IA 4O5FA 1Z1BA 2W9BA 2QWLA 2VQEF 4OPKA 3OBIA 5AI5A 3G2XA 4A46A 1WEYA 2HWIA 2VUGA 5J2FA 2F5GA 3Q86A 3PW2A 2F9TA 4O3RA 8ICVA 1NU4A 1RHQB 2CKWA 3P5JA 2BACA 3BF4A 3OTCA 2NQPA 2V7YA 3BS5B 3JPQA 3L4IA 3HCXA 5IQQA 2XWXA 1N34F 3NF9A 2KT2A 1RU1A 4A8WA 2PAVA 3LANA 4OFZA 2RN2A 4IWVA 3O6WA 2XWYA 4CT9A 1KC8T 3VF2A 5JVGL 2R7YA 1HWIA 2MSNA 1AUSL 1MWKA 4V19J 1HNXK 1ZM4A 4LRBA 5HO4A 1FF2A 1CS4B 1BNPA 4TU8A 2X3GA 4YMOA 2ZIUA 3GIKA 5E3CA 2AH5A 4F7VA 4ECTA 3S6JA 2BTFA 4CTAB 3QXGA 1MWMA 3FKBA 3AN1A 2LPEA 1KR4A 1SL0A 1ZQMA 3M8ZA 5A2QO 4LF1A 3TNVA 1IKXB 2AJQA 4OZ5A 2W7OA 3GFXA 1L8OA 1SZHA 4WTYA 4DFDA 1RHRB 2CJBA 2GW8A 2GA7A 2O8EA 4DFMA 4KO0A 2KEYA 4TUQA 1LK7A 4UZBA 2MPUA 3EZ5A 4IQUA 3ENAA 2XMMA 5D4LA 3ULEB 3IDHA 3L3UA 4UAYA 4Z4GA 4Y2IA 1FKOB 3HL8A 1RAFB 3P83D 3ZTQA 3VC8A 3C2PA 1LW2A 3SCXA 3H5SA 3HFVA 2WCXA 4DUZF 1NHUA 3CFOA 3V6JA 5DO2A 1F2HA 2UXCF 4B3RJ 4M5JA 4BUGA 4CF4A 9ICSA 2YJFA 4XEIA 1BNOA 1GOAA 4DZ6A 2O66A 3Q2SC 4RW8B 2DNQA 4F67A 3PUFA 3OUYB 4RW8A 1VS3A 3K9KA 3KK3B 3EWGA 1VQPN 2FC8A 1TTHB 1S1UB 4LRFA 1MWQA 1MA9B 2A6MA 1VIOA 2P6SA 3DU6A 1NOYA 1NGGA 1OH8A 4DCJB 1JX4A 2RIJA 4DR4F 2ISOA 1VK8A 1HARA 3SCJE 4QU7A 2DXFA 2YKPA 2WOMB 1T9UA 4Z4CA 4JV1A 1HW9A 1SJ4P 3LH2S 1ZAVA 2FBVA 4U9RA 7ICJA 4CJ4A 4PY5A 2EAPA 2O6KA 1UW4A 2XMJA 4YB6A 2P9LA 2CZVC 3Q23A 1UCVA 1N56A 3DDKA 1T9YA 4C4RA 7AT1B 2AA4A 4CH1A 4TU9A 4AHCA 4M5KA 3MPUB 1LKYA 2CJKA 3FZKA 5KOWA 4ZMMA 3K89A 3NS7B 1T9WA 2A1RA 3EKUA 2I2YA 3QU9A 3CXCR 3CC4S 1KVBA 2G8HA 3AVIA 1S99A 1TV6B 1Y3JA 2MGZA 1WC0A 4F71A 3BDEA 5IOLA 4CZEA 5HQMA 1TFYA 3VQ8A 4JS5A 2IVMA 4WFBQ 4BHQA 2DIVA 4IOBA 4PZOA 3QU4A 2EPIA 3A1YG 2HVHA 3DLKA 4BVOA 4CK3A 3O5TB 2GTDA 1Q18A 4H4MB 2HRTA 3H0RB 9ICJA 2XMVA 1X1PA 2DEJA 2OTJN 2VPYB 5H1SV 2OTLS 4J2BA 1YG0A 4IR1A 3PNCA 5J0RA 9ICAA 2I1RA 1VQLS 3HVWA 5ALDA 4NZ6A 1WNSA 1A9NB 1U0HB 5JICA 1S5LU 4Q45A 4RUCA 2BRLA 3HHKA 2BUPA 3GIJA 3IMQJ 3D45A 5TKWA 3GCXP 3VGUA 4CJVA 3CFRA 4P2MA 3OL8A 2VFRA 3DOKA 2ZH2A 4BRCA 1IBLF 1YJ9S 3KVGA 4H4KC 3QGGA 3B54A 1KVKA 1ZOTA 4QZEA 4U96A 4O4GA 4ZVRB 3IRXB 3M1FA 2DR8A 4NLPA 5IS2A 5HSPA 4NCGB 2NYHA 3H08A 2Q3PA 4KH1B 1HJPA 5D4PA 3FFIB 4UB5A 3AXKA 3O1LA 2OZSA 4M95A 4CEBA 2KH9A 4J9SA 1TQLA 1LB2B 5F0UA 5A8WA 3MWPA 2KKZA 2DNZA 4CCHA 4B3SK 3DCAA 5ALRA 1FHTA 1DRZA 3GJQB 2P2CB 3IBPA 2K8GA 4DPTA 2ZIWA 4WP9A 3C15B 1FJGF 3CWJA 3BSCA 2HCFA 1COKA 1NB2A 3THTA 3QQCD 3IM1A 3NHGA 2O8CB 2ROPA 1UFWA 2R7UA 3MN9A 2BJDA 1REVA 5L1KA 1SV0C 2P5OA 1LEOA 4NRTA 3HSGA 1URJA 3MURP 4IUFA 2Z2ZA 1YI2S 4JK1A 5KG4A 4I2CA 4CFDA 2ZUAA 4YDUA 2BYCA 3Q7BA 3FGUA 4WK3A 1VRUA 1FRIA 3T6BA 1D8YA 3VAIA 3S3OA 1RAAB 2IS3A 1KVIA 4ZTFA 3C8YA 4X4VA 3QT7A 1RBLA 4B9LA 4JNEA 1VLYA 3C6TA 3D3CJ 4IFYB 3K9JA 4FN5A 1WUUA 2A42A 3D2EA 2QC3A 2AZ3A 3P6YC 1WD6A 3U1LA 3GIMA 3L3FX 1JLEA 3H8YA 4DEZA 4KLJA 2W54A 1YIJN 3G6ES 2OCEA 4J9NA 2PGCA 3CJ7A 3UKUB 1JJ2M 1N32F 3M7DA 2C3OA 4J8FA 4O8KA 1YTAA 2RKIB 3ZC4A 2AYBA 2YX1A 3UMBA 3OFFA 4M5NA 4Q2MA 3DOMB 1NK7A 3FRZA 4ZVQB 1DK2A 3FM9A 3UCZP 3VTIA 4ALZA 3U3YA 3IGNA 4TNOA 1J97A 9ICHA 5AM0A 4P0PB 2JWLA 5A2QU 3VR1A 2QSFA 3ZTRA 1R0BG 3NY0A 2VG7A 2UUWA 3MM5B 3KKFA 3M2RA 4EELA 1HUOA 1GX6A 1TKXB 1CJUB 3UN5A 1IXKA 3AD8C 5AXMA 2O3DA 2ZEJA 2EZYA 2E5IA 1VQMN 2MAXA 5AFUA 4DG1A 4NLWA 2YMPA 2H3VA 3S9HA 5DDRC 3LUYA 2KVQE 4I69A 4DS4A 1RHUB 3H2VE 2ASOA 3OBYA 5KFQA 4RT3A 4ZVSB 4DUZK 1CLFA 1HBOB 1DHMA 4KTZA 3HTVA 3KJVB 3CCVS 2JEIA 2OYQA 2HYIB 1KN5A 4DO9A 2UU9F 1N33J 4L3NA 4O8UA 2VKZG 1IKVA 3LTOA 4GW6A 2AQ0A 3N9UC 4OHWA 2ZWHA 4DL7A 4IS7A 9ICNA 1RWWB 3HBTA 2M5YA 3THXB 2APOA 4RW4B 5C2GA 3NCRA 1W26A 1C0GA 1B3TA 3PZPA 1IR1A 2Q66A 4N47A 2HF3A 4GY2B 4H0YB 1XK8A 4OYWA 4QJFB 1S1XA 2CQGA 2FJWA 1KBRA 1IIPA 4JK9A 1C0UA 2YMLA 4OV1A 3ZYYX 2KHQA 5EE1A 5BYQA 2YKAA 4KTWA 3NUQA 4C8YA 2ADBA 1SV5A 1X5TA 1W7WA 1BWEA 1RHMB 4X84A 4X64J 5AI0A 3Q8UA 2R4FA 8ICFA 2KXNB 3CC7N 2V2ZA 3BEGB 1CULA 4DQSA 4ED7A 4CHQA 2JRZA 1GMWA 4O5KA 4F4AA 2W41A 3D6RA 1Z4UA 3G6EN 3OYFA 2QB0B 4HVZA 3KK1B 4PYDA 1J9AA 1M1KT 4X4SA 2HBLA 3W3SA 4AHRA 4AHUA 5F8JA 5L1IA 3A3PB 4RL1A 2OELA 3DN9A 4E1JA 2HFSA 3FCVA 2XZTB 3PHEA 1FRJA 1QUPA 2YNFA 1N60A 4IYQA 2ZUCA 2DR6A 3WQUA 3G0ZA 4C8MA 4F02A 2ZM6J 2IFXA 3UDCA 4KKOB 2H3EB 4CF2A 1SXEA 4IO1A 4ZIWA 3MZIA 4DV1F 3ZCMA 3CCJS 1E3MA 1LOUA 4CO0A 5D15A 4BRAA 5A6WA 1YVFA 1DFDA 3V5RA 3WX4A 3DOKB 1WNEA 4USAA 5ETOA 1M5OC 4NLZA 3GU3A 5H2FU 3BKFA 8ATCB 3BDPA 2GIQA 2GHWA 5CY4A 2Z1GA 2E2NA 1LWCB 4C48A 4HT7A 2XVTA 2XLJA 2K60A 2F4FA 3CEDA 4QIWF 3S1TA 4OX9J 3VEZA 1RAHB 5ALOA 4F5OA 3PW5A 4FWRA 4OJRA 1VQ7S 2F3JA 1LAWA 2FI1A 4FJNA 2FY1A 4YDDB 3W3DA 2VU5A 2VD3A 1QCKA 1TK5A 2KYXA 2GHPA 4FP9A 2DISA 4FK0A 2VBXA 4F2SA 3U1MA 4CJRA 3ZDDA 4JI1F 5BOLA 4LT6A 5IQ6A 2EK6A 3WC2A 2QV6A 1RTHA 3GG0A 4LF6J 4JUZA 1ZQHA 3JSMA 3BGRA 4IQMA 3FBEA 3CW2C 3TQ1A 3CUNA 4M9JA 4P2HA 2Z1HA 4KMOB 4MFBB 3R9PA 5GTIU 8ICAA 2AJ2A 3A5NC 3T41A 3ENBA 5ALFA 4LF6F 2WAQF 4Z4FA 4JI2J 4DV5J 3BBFA 2K8AA 4OKKA 4FM2A 1RA7A 1J54A 1F5BA 1M5VC 2JL9A 2ZOFA 5DDQC 3WQTA 5J2MB 4NLBA 3HJVA 3AO2A 2AYMA 2NNWA 1JLGA 4JYAK 3O1BA 1ASUA 3SDEB 4Y28C 2XSFA 1UTAA 2VANA 3BH7B 3D9BA 4FZYA 1XR5A 3W62A 2WF8A 4B1YB 4K5RA 1R31A 3AA3A 4FYYB 1Z05A 1BWFO 4KN4A 2D8CA 1AROP 1HJRA 2GIRA 4A59A 3MM7A 1K6YA 4ITSA 4H0PA 4AH9A 4ZCLA 3TACB 2DT9A 4PZNA 1UJ4A 1S12A 1UCNA 3UM9A 1T4GA 5CZXA 4ZDNA 1N5WA 2C2KB 1AZSA 4FPAA 4LBIA 3FUYA 3CJ0A 3Q8QB 2BW2A 3H3NO 5KT7A 4LF6K 1NJXA 4XPEA 4DCPB 2PMHA 1IBLJ 3CCJN 1N62A 1JJCB 1FEZA 3R5AA 5KFCA 1RLCL 4F26A 3AL0B 6FD1A 4FJ7A 5IIIA 1Y4ZB 5AXLA 2UXBK 1XMBA 5ETKA 4B9NA 1OPIA 3O1WA 3M2RB 1V5VA 3UO0A 4NXNF 5KTQA 4M3RA 1B0VA 3N7SC 4CBUA 1HMVB 3IFRA 3ETMA 5FRMA 4NM1A 3HDSA 5FPNA 3MBYA 3QT5A 3IO1A 5LY3A 5C2FA 1V5IB 3D5MA 3D6MB 3QZ7A 3QLHB 2IHMA 1L3KA 1ZXOA 3RSEA 4B1WB 4JYAJ 4CYUA 1IBKK 1ULRA 3BV8A 2E88A 4YXJA 5HN0A 2VHGA 4HUGA 4LF2A 3CCZA 5K8OA 4UTGA 1U09A 4PWDA 3OBWA 2VA8A 2FJAB 2GO8A 2DH7A 4CJPA 4H4OB 2VG7B 1ICEB 3L2UA 1U49A 1GXUA 1NZ8A 2BH1A 4DV6K 5B09A 2RQ4A 4QIWD 4TSXA 2GX9A 4NLRA 5KFJA 1KXPA 1BL3A 4Q7AA 4RT2A 3MHYA 4PPDA 5J1PA 3Q83A 1N0VC 3QEWA 1BPXA 7FD1A 4DF8A 3R1HA 4DR7J 4Z6DA 2EKYA 2GHVC 2BUNA 3KNAA 1IBLK 4B8AB 2VWJA 3UIQA 5J0YA 5E3PA 2FMSA 3AAPA 3AO3A 5AZIB 4B9TA 3PHTA 2QEXS 2LM1A 1HBOA 1R0CB 3OVSA 3OFHA 3BUZB 2F8EX 2OZMA 4RQ4A 4W5QA 3MEDB 5J2AA 5J2KA 3SENA 3AQPA 2P9GA 2E6LA 4R65A 5J8YA 2VQFK 2XGQA 3KHRA 4X4QA 3HFKA 1BXNA 1D3WA 2F4VK 2G1DA 4JI8F 1NBEB 2P66A 3HSDA 3M30A 2LDIA 4CHNA 4X4PA 4OD0A 3LL3A 5AFUH 1ED1A 5KOXA 2I9GA 5ALLA 2WB1F 4ZJLA 3VCDA 4WQ4C 1XNRK 1JLCB 2Q0ZX 4FWLA 4QZVB 3ICXA 5KQDA 1KTVA 3AEVA 4O3PA 2EAMA 5KGWA 4OHVA 3QEAZ 8ICZA 4FZMA 4C4SA 2DHGA 5D77A 5AKXA 1ZH5A 5HVHA 1OS5A 2CQ2A 3MMAA 4IKFA 4DLGA 4USUA 5D0RA 4MK7A 4BGDA 4JKHA 3ZDEA 4RW7B 3OTEA 5T7LB 1U1PA 5AKKA 8ICEA 1R3NA 4AYBD 4CNZA 4NLKA 1IJEB 2Z57B 3E9PA 1L5UA 2OANA 3WXLA 1N2XA 3RJGA 2H3QA 4LR8A 1PC5A 3QNNA 1BPZA 3CC2N 2KJ9A 1UFKA 3TVKA 3KUGA 3L09A 4NRUA 1RG6A 3ILOA 1Q8IA 3QAUA 1PBAA 4JN4A 2QFIA 1ZQWA 1N54B 1F6TA 2W9CB 1FJ7A 5HAOA 3S41A 2PE8A 2QMUB 4QS7A 2NZ4A 2AEJA 2FDRA 1Y5LB 3M6GA 5K8PA 4ZVFA 1S0MA 4U8VA 4FF2A 1SKUB 2ZIXB 1D09B 2FC9A 2RU3A 3HP9A 5CZ2A 1NK8A 3CCMS 2E1CA 3AD9C 4LRCA 3CNQP 1FDNA 3CCTA 3LGNA 2R7WA 3C19A 2WBRA 3TOQA 4IJAA 1NHVA 3NCIA 3H0MB 1WHWA 3V9SA 1LNQA 3BY5A 5D0GA 1YXQA 4A47A 4CGDA 4M6WA 1KRPA 4YDXA 1HKCA 1D5AA 3BM7A 2HS4A 4WKYA 2W4DA 3DDHA 1WKKA 4ZOSA 3UXOA 1U2VA 4WFAL 3QNOA 4YMEA 4CLZA 3I32A 3KKAC 2ZH1A 3FQLA 3MR5A 3JTPA 4YOUA 3F2DA 5EXWA 5IWAJ 2CZ4A 1BY9A 2M4MA 4I67A 3PSIA 1OWXA 1EWQA 2E8AA 2W25A 3TJAA 1S0NA 4NYFA 2I7NA 1ZQRA 1RI7A 1BD6A 1F1BB 3H42A 4D3HA 1SXLA 2GMHA 2W2PP 4NZ7A 3AVAA 4P74A 3UVJA 4G65A 4QR0A 2F1HA 3AUOA 4P2FA 3UI3A 5DKWA 2L41A 4ERDA 1DQ8A 3K1ZA 4YHHK 1CSJA 3A3NB 2GLEA 4BS2A 5FJ4A 4IRCA 4MEXA 5DMRA 5HLFB 2DL0A 4WP3A 5HLFA 3VAHA 3GJSB 1BQNA 1BA0A 4I64A 4ZPBA 3NVVA 2BGGA 5EVZA 5AQQA 2A5XA 3F5EA 4F0MA 2DIUA 3P1GA 1VQKN 4OZ0A 3GR1A 4P7VA 4ZCKA 3JPTA 2KNJA 3G6YA 3IWLA 4DX8H 4G9ZA 2DFLA 1QAJ