1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
3DLRA 4FJLA 1W0HA 4RQ3A 3THVA 1V9PA 4DQSA 1ZQVA 1S0VA 4B9VA 4CEDA 5DMRA 4KLIA 4HTUA 4YVZA 4JRQA 3G6VA 2PYLA 3H7IA 3UPQA 2UVWA 1X9WA 2HHUA 4YG2A 1JLQA 1ZQMA 1S9GA 3ITHA 1RNHA 9ICJA 3OY9A 4GW6A 3KK3A 4KI6A 1T7PA 4CF0A 2HNDA 4MFBA 2DTUA 5KFZA 4CF8A 3NGZA 3CM5A 4KN7A 4RNOA 9ICRA 5DLFA 4Y1DA 4N47A 3K5NA 1VSKA 5CYMA 5IIMA 2HB5A 4XRHA 1NK6A 1UAXA 3QZ7A 4BACA 1A5XA 1BISA 2VA2A 4M9HA 1ASUA 4BDZA 3RRGA 1ZQRA 4CJLA 4RZRA 4UB1A 4AHTA 4Q5VA 3EWAA 3C6UA 1S97A 4TSXA 4NXZA 4RW4A 5I3UA 3IM1A 2R8KA 3MECA 4KO0A 4ID1A 5EOZA 4IRKA 1CEZA 3HL8A 1NJXA 1K6YA 2C2EA 4KV8A 4OVLA 4F4XA 5I42A 1RPLA 4YR0A 2ISOA 4ED3A 3K2PA 3LDSA 4GLXA 4RQ0A 1B9DA 5L1IA 1MQ2A 4CJQA 3DLKA 3KLIA 3QE9Y 2NRVA 4OLBA 3MGIA 1QSLA 4M3RA 3V6HA 5J2IA 2GV9A 1BPBA 5TZVA 3DLBA 3KHGA 2BCRA 4CFCA 2W42A 1S0NA 2DFHA 2BPCA 2FBTA 4FLXA 5E41A 3LZIA 5J0SA 3M8SA 4QW9A 5DBCA 5D4BA 1WAFA 3V9WA 3WNHA 4DSIA 4LH4A 8ICSA 5KFSA 3SQ4A 3MR5A 2W8KA 2IDOA 3Q8PB 2ZUCA 3ISNC 1SV5A 3LAKA 2W9BA 3RR7A 1RDCA 3OYJA 1DGSA 2FMPA 2W9CB 9ICPA 4FS1A 4CGFA 4EZ9A 5KFVA 4DF4A 1JLFA 1C0TA 3DM2A 3ISDA 1ZQZA 8ICOA 7ICSA 3UIQA 1U9LA 4GXIA 5KG4A 4PHAA 4UB3A 2W9AA 8ICYA 3ZSRA 5KFLA 1MC8A 3OYBA 4NM2A 4YMMA 5KFOA 2Z1HA 3SQ2A 3ZCMA 1RBVA 1KEJA 4O0JA 3T1AA 3HJFA 3E01A 3OYMA 4KFBA 4YP3A 4M3ZA 3V9ZA 3DRPA 4DL3A 3HVRA 1U49A 1C6VA 3IG1A 2C2RA 1KVCA 2IOCA 4BGDA 4JWNA 3RMCA 1EXNA 5HHIA 2HVIA 3AO3A 4ED0A 9ICSA 4Z4FA 4OPJA 4KLHA 3K75D 4FJ8A 3ORYA 4R66A 4PA1A 3GDXA 4YXMA 3QIOA 1HUZA 3CFOA 5BPCA 3TFSA 4DTSA 3UXNA 4RW9A 1ZQGA 3KD1E 2W9MA 1TK8A 1KTQA 7ICPA 4FJ7A 3RH5A 4ZTJA 3EPIA 4JV2A 4CF9A 1N48A 2ATQA 3NH0A 8ICWA 1VSLA 3PNCA 4I2IA 5HNKA 1ZBHA 3LPUA 3RJIA 4IFVA 1VSMA 3UQ2A 1D9DA 2V4RA 2G8WA 2H5XA 1Q9XA 1C0MA 2BANA 4J9SA 1S1VA 1NK4A 3OS2A 3FFIA 1X9MA 5D3GA 3RMDA 5J2PA 3JPSA 2IHNA 1EX4A 4G3IA 1DTQA 2R8GA 3V6JA 4B3OA 1BPDA 2KFZA 3VQCA 3AVAA 1Z25A 4FK0A 1ZQYA 4XQ8A 2Y1IA 4JS4A 1BIZA 3RRHA 2PFQA 1RBUA 1Y88A 4NCAA 1RBTA 3QETA 4DSFA 3LP1A 5KFDA 8ICNA 1QS4A 4C8LA 3LANA 4HYKA 2QKKA 4DL4A 1CUKA 1U04A 1A5WA 1LAWA 4FZZA 3FDSA 3AA4A 1S5JA 4KLDA 3BGRA 4I7FA 4BDPA 2IS3A 3VQ9A 2JZBA 1HJRA 2R8HA 4KLTA 4CJSA 3A2FA 4RNMA 3NGDA 3JPTA 4FXDA 4CEEA 1U47A 1HYSA 3K5LA 2G8UA 3AV9A 3V7LA 3OYLA 4KLOA 4KHWA 1BPEA 4KHYA 2P6UA 8ICAA 8ICEA 4Y1CA 3ZSOA 4YN4A 1VSHA 1UA1A 3ZD8A 3M9NB 3PW0A 3QLHA 1JX4A 5J0YA 2B4JA 4DFKA 4DU3A 1HYVA 3QEBZ 1TAQA 1TVAA 3TAMA 4O5BA 1FXXA 1VRTA 1BPZA 1NK9A 3NGIA 3S3OA 1ZYQA 4Z4IA 3RR8A 5C5JA 4W5NA 4RQ7A 2PY5A 1VSIA 2FBVA 4BWJA 4MF8A 4NLZA 2JZBB 3PW4A 4NYFA 4M47A 2NRZA 1J5OA 2V9WA 4CHQA 3T5HA 4YCXA 4DLEA 3ZSVA 3PW7A 1N56A 8ICBA 5KFYA 3DOLA 4O44A 4K4HA 3CG7A 3K57A 1YVUA 5KG5A 3AU2A 5HROA 4DTOA 1B43A 1LV5A 4KLMA 5KFBA 1VRUA 4DWIA 4RW8A 1IG9A 1SL2A 3AVMA 4Z4HA 5J0XA 3QEIA 4LVSA 2KW4A 4NLKA 4ECTA 3E2EA 4NYNA 2XY7A 3ZSWA 1RBRA 4OKKA 3LP0A 4DMNA 3S3NA 2R8JA 4CGHA 4F3OA 2KZZA 3DMJA 3HX0A 3IS9A 4JS5A 1XU4A 3KLEA 4K4GA 4I2DA 1X2IA 4JV1A 1HNIA 4O5EA 5DLGA 4UB5A 3QEWA 4GC7A 5DG7A 3QO9A 3GFKB 3LWMA 2RKIA 4CJUA 4CHZA 4PHEA 4DOCA 1IM4A 4B08A 3OYIA 4Z6DA 4HCBA 5IIJA 3M9OB 1TVRA 1BPXA 4M6WB 2D5RA 2VWJA 4B9UA 2BR0A 2D0BA 1NJYA 4DU4A 5L1KA 5HP1A 3GIJA 2X6NA 4O5KA 1JXEA 4Q45A 4ECSA 1RILA 4GC6A 3CQ8A 1TK5A 1ZJNA 2W9CA 3AO1A 4F4WA 3Q8QB 4O3QA 4IG0A 5T7BA 1NJZA 5CA7A 4DSLA 2BCQA 5CZ1A 2X6SA 5CZ2A 5SWMA 4IBNA 2OPRA 4OPKA 5DQGA 4OKJA 4YNQA 4TUSA 4CECA 5FRNA 1AROP 3GV7B 3PMLA 4W5OA 3RH6A 1L5UA 2XY8A 1ASVA 4CJVA 2FLLA 1ZQSA 4E1MA 3CFRA 3MXJA 3CM6A 1HQUA 3SUOA 2V4QA 4M6WA 1U45A 1RT4A 3AVIA 4KLFA 3C23A 3C21A 3TR8A 5CHGA 2VG7A 1WSGA 1KVBA 2ALZA 5KRSA 1TKZA 4FJGA 2A1JA 2WTFA 3PR5B 3JSMA 1U48A 1SKRA 4RQ4A 4EYIB 8ICZA 3OS1A 3EYZA 4RQ6A 1RTIA 3VQBA 1MQ3A 3DLGA 3MR2A 3LP3A 1JLGA 2RDJA 1ZBLA 3PR4A 1J9AA 3K5OA 3TWHA 1RYRA 4F2RA 2IGIA 4H8KA 5D46A 1ASWA 1ZQKA 4ED6A 4ECRA 1KDHA 4PH5A 5D49A 1IKWA 4JUZA 1LWFA 2HMIA 3TQ1A 5JS2A 1LW0A 4KHUA 2HHXA 4KLUA 5KFIA 1WNSA 3QNNA 4QCLA 3H40A 4QZHA 4DTPA 4DSKA 3WNFA 2R7YA 3C95A 2BQ3A 2DPIA 3JYTA 5IIIA 5KFTA 3Q8RB 5KFRA 4E89A 4CEOA 1T8EA 1S77D 4NCBA 1ZQFA 7ICVA 3EY1A 4N76A 9ICGA 4UB4A 4CF2A 5L1LA 3OYEA 5F9NA 3SI6A 4AHSA 3L3UA 1ZQCA 2DFLA 4DQQA 4F92B 2ITGA 5DDYA 4IFYA 3AVGA 4ECZA 4EYHB 2GUIA 3C2MA 1DLOA 2YV0X 4FLZA 5F9LA 4UAWA 1X9SA 2ZD1A 1LWEA 3C5GA 3SUNA 2P5GA 9ICQA 2XHBA 2YNHA 1XI1A 7ICIA 4I2BA 4RW6A 4BXOA 3RJFA 3KHHA 8ICMA 1EXQA 1RT5A 3GV5B 3PUFA 3ZSXA 4CERA 4PGXA 4KN4A 9ICEA 3T3FA 3RJKA 4GMJB 2HW3A 4HHTA 4JWMA 3SV3A 2VANA 1FKPA 2J6UA 3PW5A 1GOBA 1BGXT 1QSSA 3V4IA 3C2LA 4RQ5A 1SKSA 4P2HA 1J53A 3RAXA 3SJJA 4M3WA 1WSJA 2FLPA 1I3AA 3KJVA 3B6OA 3HSTB 4ELUA 1FK9A 3K58A 3HWTA 3BJYA 2PI5A 2ETJA 1L3SA 3SYZA 2QK9A 4E7KA 4AHVA 3K59A 4RUAA 2AGQA 5CP2A 2Q0ZX 2C2DA 4F4KA 2BCVA 1XSNA 3BQ2A 4FBUA 1ZBUA 3RBDA 3S3MA 2JLEA 4E1NA 3SUQA 2ZJ8A 4M0AA 1TL1A 3HVTA 1UOCA 4PUOA 2XCPA 4FVMA 4DU1A 4QZFA 3O4QA 3LWLA 4O55A 3V7JA 4CIEA 1XSPA 4QZDA 4M9LA 5J2NA 2JEJA 1A77A 1RDDA 4LZDA 2BPFA 2AGPA 3GILA 4CFBA 2YNGA 1SL1A 4ZTFA 1TAUA 4CEBA 1FKOA 2FLNA 4I2HA 2OYQA 3KLHA 4FLVA 4Z4EA 3AVBA 5FDLA 3DRRA 4QAGA 3DRSA 3O3FA 4DFJA 4J2AA 3K5MA 3OVNA 1REVA 4O5CA 5DGBA 4RG8A 3QERA 3MEEA 4B9NA 4IDKA 3ZT4A 4R65A 3V1RA 3VQPA 3SCXA 3OYAA 4MFCA 5HHHA 3H4BA 8ICKA 2I9GA 3L2RA 1ZQBA 5KI6A 1ZBIA 5KG3A 1QE1A 1ZQPA 2B21A 3NGYA 8ICRA 1SL0A 2LYHA 3NBPA 4F3TA 3ISCA 4CJKA 3L3VA 7ICEA 8ICQA 1RTJA 2WOMA 1SUQA 3AA5X 3TAGA 1ZQWA 1D5AA 2IBKA 4IQWA 4TUQA 3L2UA 3VQ8A 4FLTA 1TFRA 2A1RA 4FLYA 1IKYA 4PHPA 4I9LA 4I2QA 1HNVA 1S9FA 4J9QA 4M04A 1QHTA 3BQ1A 5HP4A 4YQWA 3OYCA 4J9KA 4ECYA 4KI4A 1ZQIA 1S10A 4ZH4A 3MEGA 4J2EA 2IHMA 4KLGA 3AVHA 2RPIA 1NKCA 2XY5A 4MFFA 2YKNA 4F5OA 4KTZA 3MXIA 5KT6A 4HUFA 2GBZA 2NRXA 4ED7A 2G8HA 4LH5A 3JPQA 1YTUA 1S1XA 8ICPA 4O0IA 4O3RA 4YFUA 4CHPA 4W5RA 2ATLA 1LB2B 1YT3A 4FM2A 4DL5A 4DF8A 4DLGA 1VK0A 5KFNA 5J2FA 1BPYA 3SNNA 4OGCA 2FPLA 4CHNA 4B9SA 2BQUA 4EBCA 1NJWA 5J2KA 4QZIA 3V7KA 5J1EA 4MQ3A 5KT5A 4IKFA 2ISPA 4RQ2A 4F4YA 1KCFA 4HVJA 1ZQQA 3N97B 4IG3A 2G8KA 1RDBA 3ZDDA 2RF2A 3V9SA 5JS1A 4CGGA 3QEPA 1RDAA 3NCIA 3NFAA 1W9HA 2HHWA 4EP5A 4I2GA 3TAQA 1S9EA 4F5QA 1J54A 4IQVA 4Q0BA 4IRCA 2UVRA 1BL3A 1WN7A 1WCLA 3ZT0A 1IKVA 4QWCA 4FBTA 4B9MA 4DQPA 4TURA 7ICKA 5CR0A 4O4GA 3BDPA 4L8RB 4M3XA 3RJGA 3HP9A 5IINA 3TAEA 4GXJA 2BKEA 3V6KA 4LSNA 1U4BA 1BI4B 3OJUA 2M9NA 4DFMA 4DQRA 1JN3A 3B0XA 3AVFA 4CFDA 3PMNA 3ZSZA 5KG6A 9ICUA 3KIOA 4CJWA 4AH9A 5DG9A 1KLNA 1CLQA 4ELVA 3AO4A 4KMUA 4DTMA 2WONA 9ICWA 4KAZA 3ZSYA 3GIMA 4CK1A 4LD0A 3L2WA 5IILA 1ZQTA 5J2DA 5SZTA 4CJTA 4XIUA 4K8XA 4I2EA 5DKWA 3QEXA 3LDAA 2I1QA 2Z1IA 4CGIA 7ICFA 3MDAA 2AQ0A 3MGHA 3JPPA 4UBCA 3VQ6A 4Z6EA 2PZSA 4CJRA 5HRSA 1HJPA 1JXLA 1CZ9A 4FS2A 1EP4A 5K14A 1JLBA 5KFEA 3O4NA 7ICNA 3GIKA 3V72A 5KT7A 3HO1A 4J9LA 3IHQB 4CJFA 2DPJA 2X78A 3UQ0A 4I2PA 1SKWA 4XA5A 1TGOA 2OPPA 1ZETA 2DFFA 3ZDBA 1XS9D 3VA3A 5L9XA 1L3UA 3H4DA 4KTQA 2MAXA 4EZ6A 3L8BA 2O4GA 3EW9A 5KTQA 2FPMA 1B9FA 4NLGA 4R63A 4FK2A 3C6TA 4FJMA 3RB6A 4B8CA 3JPRA 4DTJA 1RZTA 3M8QA 3QZ8A 3PX6A 8ICJA 3RMAA 3N4MB 1KFDA 4I2AA 4LY7A 2G8FA 4CGDA 4I29A 4E7JA 4UAZA 2ZJAA 2BGWA 1NOMA 4O3NA 1XC9A 3TANA 3T5KA 3HW8A 3HK2A 5J0PA 3ALYA 9ICCA 2P1JA 4CE9A 4C8NA 4DTNA 4H4MA 3BQ0A 2PFOA 2MUTB 4KPYA 1C1AA 3SI8A 4KITB 1RT6A 3F9KA 3TFRA 3U3YA 5KFFA 4PWDA 4E0DA 4ID5A 1HRHA 3QESA 4MEYA 4MF2A 5DQIA 3GV8B 1S0OA 1L3TA 4QZGA 3QIPA 4ECQA 4R5PA 4CCHA 4BDYA 4CJ3A 5DG8A 2NUBA 4I2JA 4HUEA 4CJPA 4O3PA 3KLGA 1YTAA 4DSJA 5J2AA 5IIKA 4FJXA 2PFNA 1C1BA 1NK7A 9ICTA 2FC0A 1Z26A 7ICLA 2KZ3A 1ZQXA 1O1WA 1BI4A 4FJIA 1KRPA 7ICQA 4QZ8A 1ITGA 4KRFA 4AHCA 3SPYA 2OPSA 2G8VA 2ZTEA 3PV8A 5DB8A 3I8DA 4QZCA 3C1YA 4QWBA 2ZJ5A 1TKTA 1R0AA 4UQGA 3GIIA 3U6FA 4QWEA 5KRTA 2F1IA 8ICGA 2P51A 4CJEA 3HYFA 4FJ5A 2D0AA 5J2HA 2RDIA 4DS4A 4KHNA 2LSNA 4IR9A 3EPGA 3RWUA 1RTDA 1WCNA 5KFUA 9ICMA 4QZBA 1WSIA 3NH1A 3PVXA 1DOQA 4M45A 2XO7A 4CEZA 3OJSA 2HHVA 3V9XA 1RT7A 3NHGA 4F5NA 4PQUA 7ICTA 4FLWA 4M2YA 1TV6A 4QOZB 1Q9YA 4M9NA 3MFIA 1S76D 3LP2A 1XWLA 1NKEA 9ICAA 3JPNA 2E6LA 1ZQUA 3AA3A 2DY4A 3H8JA 2BE2A 1T4GA 1RYSA 1JLEA 1UWBA 3CYMA 4KLEA 1N6QA 8ICHA 1IKXA 5KFQA 1LWCA 3HPHA 3I0SA 4CJ4A 2PYJA 4IQTA 4J9PA 2I5JA 5DK5A 8ICUA 2BCUA 4ECUA 5KFPA 7ICJA 4YD1A 5L1JA 4RQ1A 5DBBA 1S1WA 2IC3A 2RN2A 4FJNA 4DSEA 3HP6A 5HMMA 4TQSA 3Q8MA 3U3GA 3NF7A 3CFPA 5J2GA 2P5OA 2YKMA 3T5LA 4G1QA 3KKRA 4WE1A 1ZQEA 3KK1A 3FYHA 4IQUA 4FO6A 3PO4A 1KLMA 4ICLA 4AHRA 4FYDA 1ZQJA 4W5TA 1UT8A 3AO2A 4J9MA 4ED2A 4NLNA 5C24A 2XCAA 4BE0A 2OWOA 2XGPA 1Z00A 1IH7A 5J2QA 4F50A 5J0QA 5EWEA 4FJHA 4DEZA 1I39A 1KFSA 3NF9A 1UA0A 2A1SA 3I0RA 1VSEA 5HBMA 5C42A 1B92A 1JL2A 4J2DA 5KG1A 4DQIA 2A1JB 1GOAA 1JKHA 4GXKA 5CY4A 4KLQA 2BHNA 3SZ2A 4CF1A 4QZEA 2JEIA 3ZDAA 2B6AA 1S6PA 3ULDA 4H4OA 4E7LA 4B9TA 4OKEA 1L3VA 3OSNA 4Z6FA 1C7YA 4HCCA 4M9JA 2FMQA 2FMSA 2W8LA 3NH2A 4EBEA 1NKBA 3RJJA 4KREA 1XSLA 1MU2A 4I2CA 4EP4A 1Z00B 3AUOA 3M8RA 4DG1A 1RTHA 3VQEA 3GQCA 9ICVA 2ZUBA 2BPGA 4Q8FA 4ED8A 4J9NA 4ECXA 4FJKA 2F1JA 4DTXA 4ECVA 3B0YA 5CB1A 1NK8A 3V1QA 5KT2A 1ZQLA 3OYHA 3ZDEA 1ZBFA 3OYFA 4FJJA 2GWSA 2XC9A 4Q8EA 3LALA 4I2FA 2Z1GA 4GVMA 7ICUA 3V9UA 3TI0A 8ICCA 5BOMA 1RXVA 1S0MA 3KTQA 1HPZA 1HQEA 4CHYA 4X5VA 4C8OA 4YMOA 3T5JA 5J0UA 1BIUA 5J2MA 5HRPA 3ETLA 3OHAA 3IAYA 3OHBA 5HLFA 1D8YA 2C22A 2JEGA 3MBYA 5KFKA 3C94A 5KFMA 2VG5A 1JLCA 2FBXA 3M9MB 4KLJA 3JPOA 4M3YA 2MUTA 3UXPA 4F4ZA 4QW8A 7ICHA 4BE1A 4QWAA 2AJQA 4E7HA 1BCMA 1QTMA 1IXRA 5KFXA 1EETA 4CEAA 2NRTA 1JIHA 1BCOA 3SQ1A 4E19A 9ICNA 2JGUA 5EWGA 5KT4A 4P4PA 3NE6A 4KB0A 2HHQA 5KFAA 4I9QA 2ASLA 3OSPA 5KG0A 1WSEA 2OZSA 3UXOA 2VA3A 2FPKA 2ZUDA 4Q44A 4PPXA 4TQRA 3HPOA 2J6SA 4O3SA 3C1ZA 4RUCA 5KG7A 7ICRA 8ICVA 4OLAA 3D0PA 4FCYA 4EBDA 4CEFA 2HHSA 4DL6A 3C2KA 2UVUA 4BXOB 4CJ5A 1LAVA 3P5JA 4ELTA 3MABA 1ZQDA 1BHLA 4R64A 4FLUA 4KKOA 4XUSA 5HRRA 3RAQA 4DTRA 4MEXA 1NOYA 3RB3A 4JRPA 9ICKA 1KSPA 4E7IA 3LK9A 3SV4A 3HPGA 3G0ZA 1COOA 3QNOA 3NAEA 3Q8KA 9ICBA 4I28A 8ICLA 4O9MA 3OS0A 3SQ0A 2ASJA 4B9LA 3V6DA 4YMNA 2OA8A 4FZXC 4M41A 4Z6CA 3LZJA 3MXMA 1XHZA 5EU7A 9ICHA 4FW2A 3LPTA 4CIFA 2O4IA 1EKEA 1D9FA 4PGYA 1MSWD 3BQTA 2VWKA 8ICIA 1TK0A 3DOKA 5FRMA 3PX4A 3P83D 5DGAA 4OJRA 2YHAA 2PXIA 4CIGA 3G10A 4FW1A 4J9OA 4EEYA 1B22A 5KGWA 2ZTCA 3ZT3A 1HUOA 3PY8A 2DFEA 3ZT1A 1RT1A 1KVAA 1WSHA 4KHQA 3TAPA 2ZQBA 2ASDA 1S6QA 3H8SA 3QEAZ 4IR1A 5KFHA 4KLSA 4BE2A 3HXMA 2KN7A 3TARA 2F8SA 2HHTA 1VSJA 3RJHA 2R8IA 4YD2A 4F5PA 4ECWA 1ZQAA 4J2BA 4FM0A 1S1TA 1WSFA 1WAJA 4N5SA 1G15A 3SUPA 4DOBA 5DQHA 2PFPA 3RTVA 4UAYA 1VSDA 3H8WA 5DBAA 4YFKA 3ZSQA 2Y1JA 2EX3A 3RB4A 2YNIA 4TUPA 4RPYA 1TKXA 5KFGA 2E6MA 4QZAA 4K4IA 4B8AB 4AILC 3ASMA 4K8ZA 1Y97A 9ICFA 1HYZA 4QZ9A 3PO5A 2F1HA 7ICOA 1LW2A 5FROA 1H38A 2FBYA 4YR2A 1ZJMA 3DYAA 3VQDA 4R8UA 3V1OA 3NTUA 3ZDCA 1IO2A 2VA8A 1NK0A 3HT3A 2AGOA 1RT3A 4MFAA 5CWRA 4W5QA 4C8MA 3OYDA 4JV0A 4DL2A 4ZHRA 4NM1A 3LAMA 1NK5A 4M3TA 3KHLA 5HMLA 2F96A 1XO1A 4F91B 5JUMA 3MR3A 1SZPA 3AVKA 4YXJA 3KK2A 1A76A 3MDCA 4RU9A 4JK1A 3VQ7A 4DL7A 2BCSA 4NY8A 3RMBA 1X1PA 8ICFA 1ZQOA 4LSLA 5KFCA 3TAFA 3TABA 2KZMA 5J0TA 2KQ2A 2Z1JA 9ICXA 5J29A 3WNEA 2KTQA 1RCHA 1GOCA 3AU6A 3AVCA 3EZ5A 3MR6A 9ICIA 1TV9A 3OGUA 4UBBA 4FK4A 2XGQA 1D8LA 1A5VA 2HNZA 4RNNA 4DOAA 1CZBA 4KLLA 2VG6A 3WNGA 1TKDA 1WLJA 1JMSA 2JEFA 3H08A 3G6YA 2IMWP 4DFPA 5CYQA 4CESA 3DI6A 4DTUA 4I27A 2AQ4A 2B5JA 4M9GA 1ZQNA 4M42A 5BOLA 1DTTA 3KKSA 4CHOA 1TL3A 3OYNA 1RBSA 7ICMA 4JLHA 4J9RA 4RPZA 5CJ7A 3KD5E 2BGGA 3ISBA 3Q8LA 3AVJA 3AVLA 4F93B 4F2SA 4P4MA 2QXFA 1T05A 3DLEA 4M3UA 4PGQA 3AA2A 3NDKA 2P66A 4C8KA 4O3OA 4DO9A 1ZQHA 4FJ9A 5KFJA 4N56A 4HUGA 5EWFA 4Z4GA 2Q3SA 2PI4A 7ICGA 3QEVA 4IRDA 9ICOA 3P1GA 5HRNA 3Q8SB 3AVNA 4UB2A 5J0WA 2P6RA 2HNYA 4QWDA 4F8RA 2F8TA 4CGJA 2BDPA 4RW7A 1Z3EB 4AHUA 5DDMA 4CK3A 2OZMA 2C28A 5J0RA 1CXQA 3VN5A 2OPQA 4FZYA 1HMVA 3RH4A 4KTWA 4NCGA 2YNFA 5KT3A 4RQ8A 1RT2A 5C25A 4KHSA 5J2CA 1JLAA 3T19A 4Z4CA 1C1CA 3L2QA 2ZE2A 3KHRA 1QQCA 1T03A 8ICXA 1VSFA 3D45A 2IAJA 3DLHA 4PHDA 3RB0A 3SPZA 5KGXA 3PX0A 3MAQA 9ICLA 1KFTA 4YR3A 4E3SA 3KLFA 4Q43A 4N41A 3O3GA 3VQQA 1K1QA 2NRWA 5DB7A 4RT3A 3RJEA 2IA6A 3V81A 3NF8A 2ZTDA 3M8PA 2X74A 8ICTA 4KB1A 5J2BA 4CEQA 3OYGA 1N5YA 4CFAA 3NF6A 5J0OA 3OYKA 3G6XA 2E4LA 1C0UA 4FM1A 2J6TA 2W9BB 4OGEA 5KFWA 1CXUA 2UVVA 1BQMA 3F73A 2G8IA 4RPXA 2XY6A 3B6PA 1JL1A 3PW2A 3VQ4A 1PZNA 3VA0A 4R8UB 4F5RA 3RBEA 2D0CA 3MEDA 3O3HA 3ZT2A 4LZGA 4PY5A 4Z0UA 3AO5A 5DB9A 2YHBA 3ZD9A 3QINA 1BVSA 1QSYA 5J2EA 2BQRA 3S9HA 2QKBA 5DB6A 4BWMA 1JXBA 3MFHA 3VQ5A 4ED1A 2KFNA 1XHXA 2XRIA 3IRXA 1T3NA 1F21A 5IIOA 5KG2A 1BQNA 3VQAA 4DS5A 4P4OA 4RT2A 3HM9A 1K1SA 1UT5A 3L2VA 1S1UA 1QLNA 3K4GA 2EHGA 1Q8IA 5J2JA 2HVHA 3C5FA 4CK2A 1RXWA 1NOZA 2AU0A
chains in the Genus database with same CATH superfamily
3D6RA 1W0HA 4RQ3A 1WBDA 1ZQVA 4KY3A 4RBTA 1S0VA 5J2PB 1X5SA 3HM8A 4CEDA 2PYLA 5HATA 4LREA 4V19X 2A18A 1RNHA 3KWMA 3AB2B 2VKQA 2GQQA 2BM0A 2HWIA 1TELA 3AQFA 4GFJA 2H3QA 2ZVIA 1ACMB 4IOCL 3CM5A 1WWUA 3VAFA 3OL6A 4KN7A 4Y1DA 4WWSA 3K5NA 5CYMA 5IIMA 5B0AA 2BYCA 2CFXA 1BISA 2VA2A 3CJ7A 1ULRA 3J8AA 1ZQRA 2E2NA 4Q5VA 1IV8A 2R7XA 3GOIA 2FTRA 1S97A 3J81j 3D1QA 3W2WB 2ZH5A 5C12A 5I3UA 3F2DA 2UZAA 4LF6K 1Q7LB 3MECA 3H5YA 1N36J 4DR6K 4ID1A 3D5MA 2CXYA 3L5KA 5EOZA 1CEZA 1SQEA 1JLQB 1ZM2A 4OVLA 3HHLB 1YHQN 2JMGA 5I42A 4LJMA 1VLBA 3WKBA 2GWKA 1RPLA 4ZIWA 1Y7PA 5A8WA 3DLKA 2MKHA 3KMSA 2FF6A 1QSLA 4M3RA 3V6HA 4JV5J 1BPBA 2IJRA 2JC1A 2HWHA 3BBCA 5BYQA 2FJBB 4GVBB 2W42A 2Z2YB 5BPLA 3N4QA 2BPCA 4ZP6A 1HMVB 8ICSA 2RE1A 3MX2A 2WFAA 3SQ4A 3MR5A 2W8KA 3OLBA 3Q8PB 2ZUCA 2EEYA 1FJGF 3LAKA 2W9BA 3RR7A 2AWZA 3P38A 9ICPA 2UUAJ 4B3SF 4PL7A 2RUGA 1XUPO 4ZN1A 5KFVA 3KJNB 3HKZD 1ZQZA 2OJ3A 3H45C 3UIQA 3JS6A 4UB3A 3ZSRA 2KIVA 2GH1A 1QHAA 5KFLA 3P39A 2AMCB 1MC8A 3DLGB 5JVGL 2Z1HA 2R2SA 3ZCMA 1RBVA 2W4DA 4LIWA 4O0JA 2H9ZA 3T1AA 3FBFA 3GJQB 3QICA 4DV7K 3OYMA 4KFBA 3UKUB 4OFZA 3JQJA 5J2MB 2C2KB 1G7CB 2VWBA 4LFAJ 1U49A 3ENQA 1C6VA 4PHTX 1NBWA 2BH1A 3CJ1A 2C2RA 3WDOA 1KVCA 4FWNA 2E20A 3IWLA 4BGDA 4FWOA 3NP5A 3M6KA 4F02A 3RMCA 3ENHA 1EXNA 1J97A 5HHIA 1NMEB 3CO0P 1SQKA 3AO3A 4Z4FA 5T7LA 4ILHA 5AQFA 1HA1A 3ORYA 4JI5F 2ZZNA 4PA1A 4MO5A 4YXMA 1VQKS 3I9V9 2QB0A 4USVA 2IBOA 3L4QA 4RW9A 3Q2SC 3MM6A 3NLCA 3KD1E 2W9MA 1KTQA 2DUYA 4DR3J 1TUYA 1ZRNA 3RH5A 3TR5A 3EE9A 4CF9A 1N48A 2VGNA 3NH0A 2HBJA 5HNKA 2WVDA 4MO4A 3V5RA 3H1VX 3ZO7A 3UQ2A 4DG1B 2C1EB 4NZ6A 4DV5J 3GYXB 1X4AA 1RT7B 3CJQA 1DGJA 1Q9XA 2BANA 1NK4A 1U0HB 3FFIA 1FEEA 3GB0A 5D6GA 4A4JA 2IHNA 4I69A 3N4PA 1O5JA 2R8GA 3V6JA 3THTA 2OPPB 1BPDA 5LMUF 3AVAA 4M1KA 5J1EB 4YOWA 2HFZA 4XQ8A 2Y1IA 4JS4A 4PWDB 3ENBA 2HSEB 2MKKA 4JYAJ 1BC6A 4HH0A 2PFQA 5MLCV 1U09A 1U24A 3MC1A 3SD7A 3B4DA 2GO8A 1QS4A 4HYKA 2J0WA 3VQSA 4IO1A 1U04A 1LAWA 1DQ8A 2ZD1B 3S01A 2V94A 1WSVA 3FEZA 2A2DA 2HS4A 4O5FA 2JZBA 5ALQA 2OEMA 5AR0A 3EVWA 2A42A 1REVB 3NGDA 3JPTA 4YOTA 1SAZA 2A41A 1U47A 3EJMA 1HYSA 2WFBA 4UB8U 3DLKB 2UUBF 2Q36A 4CDGA 3LW5C 4KHWA 4H0OA 4GO5X 2FHKA 2J9DA 8ICAA 2ZIXA 3GG1A 4Y1CA 5H9FJ 2MSTA 4TU9A 5I9EB 1S12A 1UFWA 3LDPA 4TLRA 5M1FA 3PW0A 4W4MA 3D66A 1JROA 4DU3A 3UB5A 1HYVA 1P7DA 4ENOA 1VQPS 1HD0A 3QJPA 3LDOA 1FEHA 1KS2A 2MQQA 3RBZA 2VD3A 4C3MA 5AZJB 3TAMA 1VRTA 3VEOA 1BPZA 1U2RA 2O1PA 3L09A 3NGIA 4Z4IA 4RQ7A 2PY5A 1VSIA 2JZBB 3PW4A 2P9CA 3SFUA 1OUQA 1GK8A 4X64K 2K06A 2RKIB 2NLXA 3T5HA 4YCXA 2W2PP 3K0JA 1RT3B 3CW2C 3ZSVA 4NA2A 4JKGB 3DOLA 3UD3P 5JTIA 1VJWA 2CQDA 4P0PA 3CG7A 1R89A 2OEHA 4EK2A 2NRHA 2D41A 2HOQA 2JVOA 2IVMA 4DPTA 4MH8A 4DTOA 1B43A 3TADC 2DITA 4JI1K 1VRUA 2QN6B 2QWMA 4LF2A 3ZZZA 4KYZA 3E2EA 4JI7J 4NYNA 2FDNA 2XY7A 1OJ4A 2F8EX 3ZSWA 3D28A 4OI4A 1F2GA 4KO0B 1RBRA 3HZ6A 4OKKA 2R8JA 1HNXK 4JI0F 4CZEA 3QFUA 3KLEA 4K4GA 5AKXA 3A8JA 3QQCD 4QIGA 1MDUB 4JV1A 1BUXA 2YX6A 5ETPA 5DG7A 5MAOA 3GYNA 1TMJA 3DGVA 4CJUA 4CHZA 4Y2KA 4X2BA 5D4NA 1IM4A 3M2UB 1TVRA 5DETA 2EH9A 3C28A 1IBLJ 3CP8A 2D5RA 3LPYA 1RKIA 2HVDA 2BR0A 1NJYA 4CZGA 1HNVB 2BJ3A 4X4PA 5HP1A 3I8BA 2VFRA 2DGOA 3RG6A 1JMTA 3WT0A 2KVQE 2CH5A 2E1MC 3QFWA 1S4EA 1T11A 4BC5A 3OVBA 4ECSA 3H5XA 2F4VF 3WKDA 5ALOA 1ZJNA 2KXHA 2W9CA 1YI2N 4FVUA 5HLFB 4EO6A 1T9UA 2QWRA 2X6SA 2X3DA 3GR1A 4B3MF 2V8DA 3PCOB 5DQGA 3CCLN 1HNZK 2CDQA 1Q79A 5K9FA 4OHZA 3EGVA 4TUSA 5A76A 3GV7B 4KR0B 4W5OA 3BF4A 1L5UA 2ZITA 1ASVA 2KVSA 1ZQSA 4USMA 4Y2UA 1HQUA 1ZAWA 3SUOA 1RT4A 2DNNA 3AVIA 2AD9A 3R7SB 2E7VA 5HJXA 4A8OA 4KLFA 2XWYA 2G4BA 3C23A 3NS6A 3TR8A 4UOHA 5DS7A 5JLFA 2K2PA 3CCWA 3FJ2A 1I1GA 3F5AA 5K8OA 3NMAA 1KAYA 1WSGA 5KRSA 2D0OA 2A1JA 1N5QA 2LFVA 4M5DA 1N32J 4CLPA 1SKRA 2MLXA 1RAEB 4NEYA 5KL1B 4EYIB 3GPAA 2J0QD 5FPMA 4IOAL 4A8YA 5D4PA 1KP6A 2HHHK 1IJJA 4DQ8A 4PL8A 1RTIA 3VQBA 5AI5A 3EGZA 3MR2A 2XZDB 2W55A 4JKGA 1JLGA 2KI2A 4A62A 1F6TA 2OP5A 4LVOP 3K5OA 2ZKUA 5C2CA 3TWHA 1OKJA 5A0LA 4KHRA 1P8GA 5E0OA 3N6LA 1FWLA 2RSQA 4IG3B 3LQVA 2QLJB 4WQ5A 2O5DA 2WF7A 2UU9K 4PH5A 2MKSA 1F9HA 4JUZA 2XHWA 5M1PA 4LUBA 5JS2A 2PSZA 3WC2A 1UMJA 3KZXA 1IUJA 1PG5B 5FIIA 5KFIA 1NHVA 4FDFA 3QNNA 2B9WA 4JI5J 4I68A 2B56A 4DTPA 1T3VA 3WNFA 3AODA 2GMHA 2DPIA 1VRTB 3JYTA 5HOOA 4HLBA 1KQSM 2QO3A 2A6OA 1ZQFA 3CF5Q 3EXYA 9ICGA 4UB4A 4H4MB 3C6HA 1X0PA 2G0JA 3BKUA 3OYEA 5EX5A 3SI6A 2LDYA 3SLCA 1M1KT 1RAHB 4DQQA 3QATA 4F92B 4WIQA 5ADXH 1RHJB 5AXNA 3AVGA 4BRPA 4P0PB 2DRAA 4JI8F 1N34K 4ECZA 2HHHJ 3CI5A 1WC3A 2RB7A 2Y1LB 4HACB 3R2DJ 4UAWA 1DQAA 9ICQA 2XHBA 1F5CA 3D0GE 7ICIA 5IT0A 3MMCA 4X62J 2G0AA 4CERA 5CYJA 9ICEA 4GMJB 3DXSX 4JWMA 4JYAF 3HVTB 4Y2XA 3FR0A 1FKPA 2J6UA 1J5EF 3G9CA 1QSSA 4XPEA 3W5YA 3SK3A 3MGVA 3ET6B 1I94J 1X4BA 2UUWA 3QGGA 3RAXA 1PVQA 1PJ6A 4KSEB 1TFWA 2WBNA 3B6OA 3HSTB 4ELUA 1HR0J 2OSQA 3K58A 1WUDA 2FVRA 3BJYA 2ETJA 1I6JA 4LFAF 4CRXA 4RW4B 4E7KA 4RUAA 2VQFF 5CP2A 2QT7A 3ZTSA 1ZM3A 1S4FA 1VGYA 3DXBA 4OYAA 3I55N 4AXJA 2Q0ZX 2RHFA 4F4KA 1AUSL 2B4PA 3BQ2A 2XMVA 2W2MP 3ATUA 2IRUA 2AEFA 2AF6A 3AOCA 4OI6A 2LQ8A 2JLEA 3SUQA 1TL1A 4HT5A 1NZBA 1YIJS 1IBLK 3O4QA 3LWLA 1XQIA 5LMNF 4O55A 3V7JA 1XSPA 3RGIA 2V67A 5D15A 4FPAA 1ZBSA 1F3VA 2I38A 1JWWA 1RDDA 1BLUA 4Y2YA 2RRBA 2KHVA 2AGPA 1R3NA 4Y2QA 3GILA 4CFBA 3R5GA 2B6GA 2RIJA 1TAUA 3CC7S 1VHIA 4P52A 2BRKA 4I2HA 4HTLA 1N2XA 3QFHA 2OYQA 5GIPA 5FDLA 3O8MA 2EK6A 3CC2S 4FNIA 1Y5LB 4DFJA 3OVNA 2WBRA 4O5CA 4RG8A 4J37A 2E8MA 2O8FA 3A4TA 5DDOC 4ZOHC 4B9NA 4KC5A 4IOXA 3B9JA 3SCXA 3OYAA 4BG9A 3LGNA 4MFCA 1CJTB 4NL5A 4KT0C 1WEXA 4CO0A 3CD6N 2RDDA 1K0TA 1N61A 4UZCA 1HARA 2B21A 4X4QA 1SL0A 3I31A 4CLSA 4CO2A 2LYHA 1GNKA 2HVEA 3ISCA 3NBPA 1DZ5A 2G06A 1DBDA 1ZBTA 3S1TA 1ZQWA 1NAQA 1WWVA 2LYAA 1EAYC 4AF1A 1XK8A 3VQ8A 4I9LA 5TISU 1H0HB 4OJOA 4DR1K 1S9FA 5IZHA 4TYAA 4AL5A 1Q82O 5DDPC 4JAXA 3BQ1A 4GVLA 1U8WA 1RP5A 4ECYA 3FRZA 3T1YK 2L48A 1GQEA 5AZIB 3QPIA 2F9JA 4ZVPB 4ZH4A 3DYAB 4KLGA 3D68A 3ALRA 4U7UK 4PAAA 1U1RA 2QB0B 1Q7YO 1JK9B 3AARA 2FQQB 2O8BB 3CC4N 3VWSA 2YB1A 3MWBA 2XY5A 4J7CA 2YKNA 2VFTA 3MXIA 4ED7A 4AQYJ 2G8HA 1URRA 3EGWB 2NXUA 3BSOA 4B1YB 2IAJB 2FE9A 4DV3J 2OELA 8ICPA 4O0IA 1FXRA 2GVDA 1YJ9S 4W5RA 3BPDA 4MTPA 2F4VJ 2GJFA 4YY3K 3DDNA 4LR9A 5BYSA 2V9KA 3R97A 4DLGA 1X0FA 3MMAA 3L7UA 1Q86T 5J2FA 2C3PA 1PYSB 3WQTA 1HBNB 3JSYA 3J80U 2KM8B 3OXFA 2NZTA 3BO3A 5E2QA 4QZIA 3V7KA 2WRMA 5F8MA 1PAUB 2KOBA 3H2VE 3R2CJ 2D3ZA 2LU2A 2X1BA 5RUBA 4LMZA 1RT6B 2ISPA 4RQ2A 2KG0A 1KCFA 4BUGA 5KAKA 5CYQB 1RDBA 1PK1B 3SMZA 2V6AA 2EW9A 2QLTA 2BVZA 1RDAA 3DDIA 4I2GA 3MGJA 3D6FB 1UEUA 1HQEB 1S1TB 4UB6U 2LQJA 2HFNA 1YJ7A 2UVRA 3GSDA 5AM0A 1WCLA 1WN7A 4Y0WA 4NJ8A 2D7SA 4FBTA 5IS2A 2I7NA 4DQPA 3D9BA 2QEXS 4O4GA 3BDPA 3RJGA 4K4SA 4QIWC 3TAEA 2BKEA 3DKDA 3DRXA 1U4BA 4JKEA 4DV4F 2OTJN 4DHVA 3S6EA 1UW4A 9ICUA 3WU2U 3NBPB 4NLRA 1VIOA 5AM2A 4OX7A 2JR5A 5A8RB 2Q2RA 2F9WA 2HBLA 3IN5A 9ICWA 3PJ9A 1N60A 5EY4A 3KYLA 2GELA 2FIUA 1PK1A 4IWVA 5J2DA 5F0XA 1T94A 1UEKA 7ICFA 3MDAA 1A7GE 3MGHA 4UBCA 2RUSA 1RISA 4Z6EA 2VFSA 1HKBA 4G65A 4WFAQ 2I0XA 3D3CJ 3SMSA 4X4VA 4OX8A 4BC4A 1SB3C 4ISEA 3MTJA 4HEA9 5KT7A 3VEYA 5F0UA 1D8BA 1Y11A 2W7PA 4BY9C 2X78A 2A0FB 2OPPA 1ZETA 1U6FA 2MKCA 2DFFA 4IFYB 4DV2K 3MM7B 3R5CA 2OH2A 1IWAA 2R2UA 3L8BA 3A12A 1U1MA 2EFVA 3GMGA 3AM9A 2FPMA 4L3QA 2YBVA 4M5NA 4ZCIA 2CJXB 2L08A 4FK2A 4FJMA 1OQ6A 3RB6A 4P2XA 3OV7A 4Y2AA 1IV0A 1KFDA 1BWEA 2G8FA 2E5LF 1ATNA 4I29A 2JDJA 4E7JA 2BGWA 1NOMA 1FTRA 5KAIU 1HD1A 3QRQA 4CP5A 5J0PA 2OHFA 4OZNA 4TNOA 3PNIA 4QYZJ 1EETB 4KPYA 4B3OB 1C1AA 5JJBA 2HYIB 4A8XA 2OIHA 3SI8A 3F9KA 4H5NA 2HBZB 4E0DA 1YHQS 3LTOA 5D8HB 4TY8A 3J7YP 2PA8D 2Q1LA 4MF2A 4ECQA 3IFEA 5KQDA 5DG8A 4LF4K 4I2JA 1AUDA 4CJPA 3THYA 2YQEA 2QXLA 1C4AA 2JLFA 3O6QA 1K5OA 3SR6A 4FJXA 3O9RA 1FRMA 2KT3A 5GAHU 3PG9A 1XEZA 1NK7A 4HKQA 1TE2A 1X9JA 2HS3A 3DCAA 1O1WA 2M8DB 2JH3A 2DEJA 1NM1A 2GIFA 4CLUA 2DGUA 2OTLN 4BRAA 2KLAA 2HNZB 4AHCA 3SPYA 1C2PA 2BZ2A 4M5KA 3FVYA 4ZOSA 3I8DA 3ED5A 2ZJ5A 3PIPQ 1WORA 1TKTA 1R0AA 4HR2A 4M5MA 3GIIA 4BRLA 2G08A 4QWEA 3DHXA 2F1IA 4Y65A 4CLTA 4CJEA 2F77X 3O6WA 2QJ3A 1HWKA 4U67Q 2J0XA 3IC1A 2WTUA 1FX4A 1U25A 2XWXA 3R27A 3NH1A 3PVXA 4M45A 2XO7A 5BYRA 4CEZA 3KK1B 2ZIWA 3NHGA 4ZPWR 5F8GA 5K8MA 4M9NA 4X65K 3LP2A 3HSCA 1UPMB 3JPNA 3MOJB 3A8EA 5E3AA 3TA2A 5IC6B 1K9MT 4RR5A 1ZQUA 4RUHA 1G6BA 2VBWA 4CYUB 3CJAA 2BE2A 1CSJA 4EENA 3E9LA 4WYBA 1X40A 3QWPA 3SQIA 2VL1A 4ED5A 2YHXA 4KLEA 1N6QA 8ICHA 3PYGA 2IFXA 1WBBA 5ETRA 1Q3VA 1LWCA 3HHKA 1G3OA 2FY8A 3HPHA 3I0SA 2BTFA 4QYRA 4J9PA 5C15A 1CBKA 2PE8A 4P2MA 1VQ7N 2Y8WA 4UY8T 1XMQJ 1S1WA 2IC3A 5HMMA 1FW6A 1Q5YA 3LP0B 3U3GA 3F53A 3KOAA 1T6CA 2Y3YA 4QIVA 3BR9A 2CIMA 2FJXA 2P5OA 3VALA 1ZQEA 3KK1A 1WD6A 2HGMA 5F2RA 4FO6A 4J9UE 2ASPA 1B3TA 3QO9B 2A40A 4MIWA 4ZVOB 2H3IA 1OVQA 1F5SA 2ZIXB 3TACB 2UUCF 4LVNP 3QMLA 4ED2A 2XCAA 1R43A 4BE0A 3H90A 4I6YA 2FC8A 4C2MA 5J2QA 4PG6A 1WTBA 2C42A 2YKAA 4DEZA 3T1HF 1NWKA 1LWXA 4GV9A 1RAFB 1KWMA 3THXA 3TA0A 2MZTA 1U1NA 3B54A 3I0RA 2R7RA 4NOHA 3ENAA 3CCEN 2OI2A 5AQXA 5LXRA 4IG0B 2DKXA 5KG1A 1X9XA 3O5BA 2A1JB 1VBZA 2VPWB 1QAIA 4K0KJ 3G6ES 4R25A 2JEIA 2YB4A 2CZ4A 5ALGA 4OJ5A 1W7WA 2OFHX 3TW0A 2FZKB 2NRRA 4OKEA 1UVNA 3DLEB 3MXHP 5GINA 4DV2F 3UVJB 4ID5B 1NKBA 3OR2B 3RJJA 4ZVEA 4I2CA 1ATSA 3ZXWA 1X3NA 3K17A 3M1VA 3THXB 4ED8A 4PKDB 2F1JA 3VVTA 4GNIA 4NRUA 3DRYA 5HO4A 3V1QA 1U6ZA 1L6NA 2VIXA 3RVCA 3OYHA 3AQEA 3MDFA 3IBWA 3MWPA 2FVCA 4FJJA 4ILRA 1S8OA 4NXMJ 3IG5A 5KQ8A 3WKAA 3CPWM 4Q8EA 3X1LB 7ICUA 4PXCA 2YTCA 1WC1A 3TI0A 2VU5A 3UCZP 5A2QO 1URJA 2RU3A 4B02A 5AQLA 1VS3A 1U2VB 4X5VA 2F4VK 1J2MA 4C8OA 4B3TJ 3ILOA 1JJ2M 2XZWA 4UW2A 5HRPA 2FSKA 4AQYK 2KG1A 3IAYA 1ELOA 2IOHA 2L9DA 3OHBA 2XTJP 3N4WA 5HLFA 2NXCA 2JEGA 5KFKA 2ASOA 8RUCA 1JI7A 1X6IA 1JLCA 2HBYB 3DOKB 4DHYA 3L0QA 3TOQA 3HKWA 3GZFA 3JPOA 4CLFA 1DFDA 4M3YA 2DNQA 3CPWR 5AJ3F 4F4ZA 4E7HA 2ROPA 3WEEB 1PYTA 1QTMA 1IXRA 1JIHA 1RDWX 1RTJB 4YHHK 4QZVB 3A8IA 2MQLA 3SQ1A 2JGUA 3QIDA 2NZCA 2MZSA 1WYGA 2R7QA 2QWNA 2HIQA 4KB0A 4I9QA 5AKEA 2F9TA 2ASLA 3LPEA 2DNMA 1LQ9A 4CLZA 1HNWJ 2BJ1A 5ALYA 4DR7K 5ALKA 2E5LJ 4OJ6A 1MA9B 3SBGA 1IJEB 1TYQB 3AFGA 2LEBA 2J6SA 4O3SA 1VHFA 3C1ZA 7ICRA 4BRDA 1NZ8A 4PKGA 4OLAA 2Y0BB 1HI0P 1XNRJ 4CEFA 1WELA 3DXKB 5ALMA 2JWNA 2N1RA 3MN7A 3P5JA 4PG5A 3AN1A 2EWSA 1QQMA 3IFRA 1BHLA 2COLA 4LF8K 1T95A 4XUSA 1HNIB 4RWXA 5JRTA 4F4AA 4MEXA 2CJKA 3O2IA 3HPGA 2E44A 4PUOB 1MWZA 3CNHA 4BG8A 3OLAA 3NAEA 1NCLA 3I5BA 1BWVA 3QMQA 2XI3A 3M4XA 2NUUG 4URQU 3HOTA 2I6XA 2ASJA 4BGAA 4YMNA 1NU0A 2AJ1A 3VAHA 2C3YA 3DGPA 4UUXA 2R9LA 3J7YU 4NCGB 1EKEA 2QM1A 5AXLA 1TK0A 3LUYA 2DNZA 1VI7A 3TVZA 3P83D 4OJRA 4I6MA 4J9OA 2DWQA 4CD1A 3KK3B 1RDUA 3PY8A 2C3MA 1RT1A 3OW2M 1AZSA 1WSHA 2A3VA 3I56S 3KFWX 3GU3A 3P4UB 4DV1J 4EFHA 4ISGA 5KFHA 1Q8KA 4OYZA 2K8CB 4BE2A 3TARA 3RJHA 4Z94A 1ZQAA 1SVDA 1PJ5A 5K4LA 3SUPA 2GW8A 2HNYB 2HLUA 3VEVA 1IKYB 4NL9C 4UAYA 3MX5A 5DBAA 5LSRA 4YFKA 3PIOL 3JXOA 3RB4A 4CLYA 4NWIA 4OHXA 1YRUA 4DKWA 1Z05A 4TUPA 2WC9A 3VEWA 4QZAA 4K4IA 4B8AB 4K8ZA 4DFDA 4JHDB 3AA8A 3QDKA 3W9HA 1HYZA 2EKYA 5B0CA 2KYXA 5F8IA 1H38A 1YITN 1ZJMA 3DYAA 4X62K 4XO0A 1FF2A 3V1OA 5HAOA 4CNYA 4ZCMA 5I42B 1Q81T 2VA8A 3BY5A 3HT3A 2VBZA 1RT3A 2DBYA 2DGXA 4CT9A 4W5QA 3CUNA 4BLGA 1NK5A 3W8GA 4CBUA 2JJ4D 2F96A 1N34J 5DM7L 5D0EA 3VZHA 1NBEB 3CD7A 3ZX2A 4BRFA 2QSFA 4YXJA 4UZBA 1S48A 1A76A 4RWTA 4FWLA 2V8PA 1WHWA 4JK1A 3VQ7A 3ZZOA 4NY8A 3WXJA 2HBRB 3L7OA 4K5SA 1ZQOA 2OGUA 2AYBA 3TJ8A 2KQ2A 3VGSA 3SAFA 2KTQA 1IR0A 4MKYA 3DMJB 4UAVA 3EZ5A 1L7OA 3F56A 3MR6A 4JI5K 1FE0A 3JSRA 3OGUA 1NDLA 2JH1A 4GMKA 3KWGA 4FK4A 2HNZA 2O8EB 3EN9A 5F0WA 4OYBA 1SS6A 4KLLA 5T41A 3D2FA 2YWKA 3HJEA 1WLJA 4USUA 1JMSA 3J80O 2QMWA 1OS5A 4UF4A 1SJQA 2B7BB 3DJCA 3KD3A 4BQLA 1SIJA 3QSIA 2Z56B 2AQ4A 4P0QB 5HBMB 2E7XA 2WBMA 4LF4F 1VQ9N 4M42A 1S1WB 2K3IA 4BS2A 5FJ4A 1Z1ZA 3CCUN 2W4CA 3G8QA 3RJMB 1RBSA 2HFOA 4C80A 3KD5E 2BGGA 2ZKTA 3VAIA 3AVJA 1JALA 2VB6A 2FF3B 3WK5A 1T05A 4FZNA 4PGQA 1KEKA 3E66A 3TZYA 2UUBJ 4FJ9A 1OH8A 4OO1J 5GAGU 2GO9A 2L9NA 2WVBA 4HUGA 3M8WA 2Q97A 2Z4PA 1YIJN 3QEVA 2LI6A 1VISA 4D3HA 1UWAA 4D3GA 4EEKA 2XMUA 5J0WA 2XLIA 5M1QA 2HNYA 4WZQA 1FO1A 1Y9OA 2G2ZA 1Z3EB 1QAJA 1BD6A 2OZMA 4EMDA 2KHOA 1FESA 2AXTU 1VQSA 1WHXA 2EBEA 2V2ZA 4LSNB 3CF5L 1KQKA 4NCGA 5KT3A 4KHSA 5J2CA 4Z4CA 1C1CA 2RHSB 2ZE2A 5AI0A 4BCAA 1HBUA 4DZDA 2IAJA 3QNWB 3SPZA 9ICLA 1BQNB 4DMZA 4O23A 2CWXA 2WAQD 4OV6A 2CG4A 4ZP8A 5E5NA 4E3SA 1KN6A 5L39A 3HFZB 4Q43A 3KLFA 3O3GA 3A0BU 3ETMA 2NRWA 5DB7A 4RT3A 1PSDA 1IBMJ 2IA6A 3V81A 3M8PA 3PZPA 4CEQA 1N5YA 2LLZA 4JBCA 1DEJA 4XEIA 1FNMA 2E4LA 3D7EO 1C0UA 4MLEA 3UR0A 3ZFVA 1QDUB 4DOZA 3DN9A 3VZIA 4X84A 3CJCA 1T3QA 2KKHA 1P6TA 1SCJB 3BSNA 5ETLA 4MKAA 3RBEA 3J7Z5 3IBPA 2KRRA 1D9AA 2IJNA 3CT9A 2RH3A 4JI7K 3QINA 4KGKA 1IM6A 3CMAN 3MM6B 1N8RO 4NXNF 3MFHA 3VQ5A 4ED1A 2KFNA 3VF0B 1U1QA 3HHLD 4I0WA 5EN1A 1QQOA 3U9ZA 1UZHA 4LF8J 4KGMA 4JB3A 5HL7L 2DR6A 1BQNA 4OYOA 5C2GA 4RT2A 4ZHRB 1UT5A 4DV5F 2CQ1A 4JV5F 3K4GA 1PK3A 2O6KA 2RAQA 3H20A 4CK2A 3MMBA 1SV0A 4YDXA 2CPDA 4JKDA 2QWLA 3TEGA 4B9VA 2VKRA 3MUTP 3WX4A 2JWLA 3FGVA 4C3LA 2QV6A 5AIAA 3OTOF 2L5YA 3U1MA 3OY9A 2KJWA 4GW6A 2ZJRL 3LL3A 2K4HA 4IQXA 2CNLB 3FGUA 2DTUA 1U26A 5KFZA 4WYLA 2VODA 4CF8A 3NGZA 2AT1B 5BN8A 1N33F 4RNOA 9ICRA 2JXJA 1N62A 1FE4A 3OR1A 4C1NK 4P0QA 2MSSA 4BACA 1A5XA 3KNGA 4P7VA 1MMDA 2ZBRA 4BDZA 1RA7A 4RW7B 4CJLA 1OXJA 3K1ZA 1HEKA 4RZRA 3JS9A 2ZH1A 2ZBPA 4A2BA 2XI9A 1FVQA 2B5JB 4NXZA 2CKWA 3WK6A 3W66A 4RW4A 4BGBA 2K60A 3IM1A 4DN0A 2R8KA 4R0JA 5IFMA 3HOSA 2VONA 3L4IA 3BYRA 4IRKA 1JLFB 2ZJPQ 3HL8A 3THPA 1NJXA 3PSTA 4ITSA 4F4XA 4YR0A 4ZK7M 2ISOA 2WHEA 3K2PA 3LDSA 4Y2PA 4RQ0A 1EJ7L 2JL9A 1B9DA 5ALIA 5L1IA 1MQ2A 2PA3A 3C7NB 4OLBA 3FZBA 3SMVA 5TZVA 5HMXA 4BRGA 1HUXA 2ZUGA 2KXNB 4CFCA 3KHYA 2FBTA 2E1CA 4A8KA 5E41A 2HURA 1FHTA 3LZIA 4B1XB 5D4BA 3V9WA 4LH4A 1LWCB 3DLLQ 1RABB 1LOTB 2LYBA 1SV5A 5CZVA 2EANA 1E4GT 4C98A 1GLBG 3OYJA 1DGSA 2WHOA 5B5EU 2MGZA 3D2SA 1W7AA 3VERA 1RDRA 4CGFA 3R9KA 4EZ9A 2VUGA 5H1SV 2CJYB 3TSUA 3R8YA 1HBUB 2OPRB 4C4SA 1O8BA 4GXIA 2CGJA 4WTOB 5ETVA 3BGOP 5K8PA 3OYBA 2G5IB 4P72A 2NUHA 2NCKL 2VQEJ 2LEAA 3MPWA 1F9FA 1RACB 2XULA 3E01A 2DHSA 2K4EA 1AFIA 3GP9A 1U02A 4Q0BB 4LR8A 4JI8J 1CI4A 1UETA 3WQPA 4E8UA 5FLXY 3I5CA 3HVRA 4RQNA 3DXMA 3H5UA 5D3GB 2GX8A 2KG5A 1ZM4A 1S1VB 2P9GA 2WB1D 4H0TB 2KN4A 3G82B 1X5TA 2VDIA 4BX9C 3ITHB 3GU0A 3AMZA 2B3TB 3GG4A 1M5OC 3R5AA 4ED0A 4C0ZA 3HHLA 3W60A 9ICSA 4ICLB 2YI1A 1X31C 2DNYA 3GDXA 1HUZA 3MMJA 5A8WB 5AI8A 2JFDA 4YB5A 4LSZB 5AE1A 3UXNA 4LFAK 3MM9B 1TK8A 1HKAA 2ZXHA 2LQ9A 5BRHA 5M1NA 8ICWA 1VSLA 2F65A 1TUGB 3PNCA 4MK9A 1K8AT 3RJIA 1NGJA 1VSMA 2H3GX 3O1BA 2G8WA 4DCJB 3T6BA 5ETMA 3OFHA 1C0MA 3IG1B 3C3LA 2FJ6A 5D3GA 3IA0A 3QJJA 1A9NB 3RMDA 3F0NA 4CZIA 1VQYA 2HWTA 2E2QA 1DTQA 1YSJA 3VQCA 3UN3A 4L76A 3M2VB 2HZVA 4K4XA 1ZRMA 3NUQA 2FHOB 3BKFA 1JJHA 3JB9k 1BIZA 1RBUA 1Y88A 5JICA 3UNGC 4DZ6A 1RBTA 3QETA 4DSFA 2OSRA 3LP1A 3LH2S 3QLHB 4C8LA 1SKUB 1VQNN 4C9DA 2QKKA 3FAHA 4FZVA 4JKHA 4CZKA 1A5WA 4FZZA 1KOHA 2OFGX 1IWGA 4A8EA 4KLDA 4BDPA 3NNAA 5LJWA 2YKMB 1HJRA 4ZVRB 1FI4A 5GAEI 4M5DB 3VTHA 2FSJA 4AUKA 3AQOA 1JLCB 2KHDA 4AL7A 4DR6J 1N36K 3AV9A 4LF6J 1S99A 3V7LA 4O8KA 3OYLA 1K47A 2CN1A 4BRCA 4JK9A 1BPEA 3HZGA 8ICEA 4FNHA 4IEIA 1QTNB 1T9YA 2HFUA 2I9SA 4X4UA 4AYBC 2JOQA 4ZPAA 3MM5B 2ZJRQ 1HR0K 4U6PA 1Y0HA 3W5ZA 4X4RA 5J0YA 3KDOA 1ZTTA 2B4JA 1P90A 1YAGA 3G96A 4JK8A 1TAQA 3BGRB 3V4MA 2LQBA 4JKBA 1M5SA 3H8MA 1FXXA 1IR2A 4IO9Q 1NDCA 2DH9A 4RPFA 3S3OA 1BOTO 1L8LA 1ZYQA 1U1KA 2MJNA 4BWJA 4ETZA 4NLZA 2WVEA 2CQBA 4DLEA 3LVVA 1N56A 2WSFC 2W4PA 3MCNA 3VR1A 4F7VA 4AD6A 1FRLA 4O44A 4K4HA 3ETOA 3K57A 1GH8A 2DR9A 2QC3A 1CS4B 3D2QA 5KG5A 3AU2A 3R5BA 4ED4A 3SSSA 3VVUA 1LV5A 2HBKA 4KLMA 5KFBA 4DWIA 1SL2A 3AVMA 3H46O 5J0XA 1DARA 2KSOA 4OHWA 2M8HA 3L6QA 2XSFA 1CRXA 1HFEL 4DUTA 1D0EA 4XDDA 1FX2A 3SQOP 3GFZA 1ATRA 1RAJA 2JVRA 4JS5A 1XU4A 1N33J 1BHNA 1M1HA 1W2BM 5DLGA 3QEWA 2EBGA 1AB8A 2G5HB 2RKIA 3O80A 1PUZA 2LXFA 4B08A 4HCBA 2Y9UA 3NEKA 4CQ1A 3VGMA 2QKQA 2SXLA 2D0BA 5L1KA 2E3TA 2H65B 1I3OB 5L8RC 4B1VA 3THYB 2ZBQA 2W3SA 4O5KA 1JXEA 4AM6A 4WKYA 2ASMA 2DHAA 1C1BB 2R7VA 4B1WB 1C0UB 2KKPA 2FUG9 4F4WA 2Z30B 4DL0C 3VCDA 1IG6A 4JHDA 4OPKA 2Q0RA 2KL8A 5KPTA 1NM2A 4CECA 2UU9F 2XQCA 3PMLA 1N32K 3TYTA 2XY8A 4CO4A 3DDKA 3GCXP 3QXGA 4CZLA 5ALEA 4QR2A 5JVGQ 1U45A 1LW0B 2V63A 1XMOF 5BN9A 1RSCA 1XBWA 2L9WA 3RW7A 4B3RF 2VG7A 2BOPA 2K4IA 1TKZA 4CD3A 3KFUF 2C3OA 3SCIE 5IT9U 3DOMA 3PR5B 3JSMA 4A8SA 4K4VA 4DCPB 1C1CB 4I7FB 3UPFA 1U0SA 5AQNA 4BRIA 5EX3A 4ANEA 3DHWC 2VJVA 4EHTA 2VQEF 1MQ3A 3NL0A 1B0TA 3FZ2A 4H0YB 1Q53A 5AQIA 3KDNA 1J9AA 2OCEA 1RYRA 4A8WA 4DR4J 3LDLA 4FWKA 4CZMA 4H8KA 3IBCB 2AYGA 2CRXA 3LO3A 1ZQKA 2QA4N 4ECRA 1KDHA 2F3NA 2GLEA 3EUB2 3NNHA 1UCVA 2KICA 3M30B 2DNPA 1S9EB 1OH7A 2HMIA 3TQ1A 3QNMA 2K7JA 2FB0A 1SQGA 1YJTA 2QB1A 2HHXA 3VGVA 1RE1B 4ZLNA 4KLUA 2DH8A 1FJGK 2D3O1 2QLWA 2FY1A 1WNSA 2P35A 3VF6A 4UOFA 3UDVA 1QVGM 4QZHA 4CIOA 1DY3A 3C95A 2B9EA 4E89A 4CEOA 1T8EA 1S77D 1HNXJ 2R4FA 5D0HA 4N76A 5SUHA 2KJ8A 3AJ1A 5KPZA 5U47A 3Q8YA 4NLWA 2F40A 2AJ4A 5L1LA 5F9NA 2NYIA 1WHVA 1RYUA 1NHKL 1CS4A 2W01A 2YKNB 3D2EA 2LKYA 2FVQA 4PEOA 4IFYA 4ZIVA 2W04A 5AICA 1ECWA 3CJKA 1QAXA 2AP6A 4EYHB 5HVHA 2Q4TA 3P49B 1DLOA 1FKOB 2HDOA 1UVLA 4FLZA 3AXMA 4JKAA 4Y2IA 1XNRK 1N5TA 1LWEA 3SUNA 3N9UC 2P5GA 2J8SA 1SXEA 3BQ7A 4I64A 4I2BA 8ICMA 3UNYA 3GV5B 3ZSXA 4F9OA 1NB2A 2CVIA 5ALRA 3T3FA 3JYTB 2P9LB 2HW3A 1C4CA 3AOAA 2PEHA 4LC9B 3IS9B 3SV3A 3DV9A 1GOBA 1U1LA 2HVZA 2IIRA 1NO8A 5IV4A 1BGXT 4XH1A 2CZ9A 1TUWA 1GTEA 1OSDA 2EI5A 1RHKB 4LFBK 5AFUH 1SKSA 4US8A 1IG8A 1J53A 1YJRA 1S1XB 4OX6A 1JNZB 4M3WA 1FFVA 1CJUB 2D74B 4IXCA 2PI5A 2NYVA 2RILA 1F3FA 1QZ6A 1KBRA 4LIRA 1L3SA 3SYZA 3UWTA 3AJDA 3TSQA 3ULEA 2ERRA 1IBKJ 4TVAB 2C2OB 2KEYA 4QS8A 2ZG6A 3FQLA 5E79U 3OQ2A 2RRAA 4B3TK 1RAIB 3S3MA 1FDBA 4E1NA 2ZJ8A 3HVTA 4JI4K 1VQMN 5ETNA 3ZNUA 4EHUA 3T9ZA 4CIEA 3WKCA 1TTHB 2MQPA 5J2NA 3DOLB 5CABA 5DZ6A 4ZJLA 4NLDA 2BPFA 5HN0A 4EUVA 1VFJA 3BGUA 2YH1A 3QYPA 4RL1A 4DX8H 3KLHA 1EARA 3JQMA 3DRRA 4QAGA 3O3FA 4KHPK 2ILYA 3T6JA 4J2AA 3K5MA 3MMCB 1REVA 3OFEA 2N3OA 5DGBA 1TKXB 3MEEA 2J5AA 2XLKA 4R65A 3CWJA 3V1RA 2C2MB 4YB1P 4P7TA 1YJUA 1ZQBA 5KI6A 5KG3A 1QE1A 1YLXA 3RRKA 5AQWA 3NGYA 2DHXA 2XZTB 4F3TA 1RTJA 1SB6A 2GHVC 4M63A 4WP9A 1PGZA 5GMKa 3FCVA 3J80Y 2CNOB 1D5AA 2IBKA 4IQWA 4TUQA 3IKMA 4C7QA 2LCWA 3L2UA 4FLTA 2V2VA 4O4RA 4ERDA 5GTIU 1HNVA 2DXEA 2W25A 4J9QA 2R7OA 5BRDA 2I1RA 2CQCA 1DKGD 4OJLA 3CRXA 3G82A 3OYCA 4WBFA 2QWQA 4J9KA 4YB6A 2IYGA 4KMOB 4DR5F 4KI4A 1K73T 4OYWA 4YN3B 1S10A 1WC4A 3MEGA 4J2EA 3DLJA 1VK3A 5A2QU 1NNDA 1RHRB 4KBIA 3VCBA 1LKZA 1WF0A 3D3BJ 4F5OA 4KTZA 1GT8A 4HUFA 2FPHX 3SDEA 1NH7A 5KOWA 2MY8A 2RF2B 1HPZB 2FLOA 2O01C 1S1XA 4HHUA 4JKFA 1Z2ZA 4NLOA 2Z2ZA 3PIOQ 5AKKA 3NCPA 2OMOA 1YT3A 2EFQA 4DL5A 4FM2A 3M1YA 2DNGA 1UVMA 3QGHA 3R1LA 4U7BA 2QARB 4I56A 1BPYA 1HHTP 1FWPA 3SNNA 4CLKA 2YWHA 2UU9J 2FPLA 1RWWB 1NJWA 1OSCA 4FF3A 3WX8A 4HAIA 5KT5A 1ZD2P 4IKFA 4B17A 2UUAK 4F4YA 3WK7A 1RK8A 3NWGA 4OX9J 3N97B 1AFJA 5BPMA 2ZFHA 1WG8A 2G8KA 3ZDDA 2MU2A 1KD1O 1DT9A 3QEPA 3NCIA 4X65J 4YY3F 3MPDA 2RQKA 3MAHA 4OQJA 1GLAG 3TAQA 2VCPA 1N5XA 1X8DA 1IBCB 2W43A 4Z37A 1F5AA 4B9MA 1NMNA 2RU9A 3AB4B 4LF9F 5CR0A 4L8RB 2D4WA 4I6AA 2UUAF 3HP9A 5IINA 1Q3UA 3ULEB 4WQ5C 5F3XB 1BI4B 3OJUA 3AVFA 1JN3A 3B0XA 4C4TA 2DVIA 5AQSA 3PMNA 5BR8J 4DR4F 3H0MB 4M5IA 4PPDA 1OH6A 3KIOA 1LFWA 2VF3A 5DG9A 4J5OA 3AO4A 4ILLA 3I56N 4DTMA 2ZDPA 2YVSA 4JB8B 1V85A 1TVRB 4KAZA 4HVZA 5AK6A 3ZSYA 5L38A 3QRPA 4IS7A 5IILA 1ZQTA 2EXUA 5SZTA 2ADBA 1L7NA 2I1QA 5ALWA 3MMAB 3G86A 1OYDA 1HJPA 2OXOA 4R79A 5LJ5Y 2BE7D 3O4NA 2XVTA 7ICNA 2O8CA 3CCSN 1EX8A 1V6HA 2ZH4A 1YWXA 4LRDA 1QVFM 3HO1A 5AQZA 4J9LA 3IHQB 2XMTA 2DPJA 5J2QB 1QY7A 3WXMB 3TKAA 3AQPA 1S57A 3F2KA 3ZDBA 1L3UA 2EG1A 4IC9A 2HCFA 2QMXA 4YOVA 2CDRB 4KTQA 2M52A 4KH1B 4UT4A 3AGRA 4FWQA 3EW9A 2QLFB 2WB1F 2Q31A 2DXFA 2W41A 4NLGA 3VAJA 4R63A 3C6TA 3JPRA 1RZTA 4WPAA 8ICJA 3RMAA 1C0GA 1NGEA 1UJ6A 4CGDA 4C23A 2CPEA 2IC3B 1VC5A 2QYCA 1XC9A 1VLOA 4NLVA 3NCRA 3U1NA 1UJ5A 3MEDB 2VJUA 1SZHA 4IH7A 2P1JA 3NMUA 2CPJA 3AD8C 4H4MA 1MMLA 2PFOA 4YHHF 3R9PA 2XYHB 3C15A 4KITB 3PRDA 1ED1A 4DV2J 3U3YA 2CXEA 4PWDA 2YTUA 4ID5A 1LOUA 4N8NA 4MHVA 3OFGA 1TAMA 3N28A 1S0OA 1P9YA 3GV8B 2HFVA 1WTFA 3QIPA 4USWA 5AFUA 3WZ0A 2CJAA 3O0FA 1QUPA 4CCHA 3HFKA 1KQQA 1YZ6A 1V97A 2H4YB 3KLGA 1YTAA 3VTIA 2IVYA 4CF4A 5IIKA 4QIWF 5ALZA 3G25A 1OYEA 5A0YB 2PFNA 4P73A 5AKZA 9ICTA 4M8LA 1RBOB 4NXMF 3G6EN 1BI4A 4FJIA 5CA5A 2ZHAA 1Q86O 3J7ZO 2LXIA 3CCMS 5H9FK 4F25A 2WVCA 4TLQA 5HK4A 3NGRA 1ITGA 2CRLA 3CJ5A 1D1UA 1R8AA 2AEMA 3PV8A 1JJ2R 3E9OA 3C1YA 2RHKA 1T0TV 2KE7A 1R6YA 4H4KC 3CCVN 4PL1A 1BO5O 2H5EA 2NZ4A 4O44B 5KRTA 7FDRA 3HYFA 4GVBA 1EWQA 3UN5A 2RDIA 1O13A 3RWUA 1DJ0A 1GXTA 3F44A 9ICMA 4JEPA 1LEOA 1WSIA 1S79A 1VIXA 3CTRA 2HHVA 4B6JA 4KV8B 4USKA 4IH5A 2BJ8A 4F5NA 5IXUA 2P2CB 1HBOB 4PQUA 4DV6F 4UARA 1J2NA 2O8CB 3T1YF 1H6KX 4RTFD 2MB0B 2VICA 4QOZB 2F8KA 5EX0A 1Q9YA 2C2NA 3R5JB 9ICAA 3HULA 3PEHA 3N79A 2GAHC 5E7OB 2ZM6J 2BKPA 3CQYA 3HKZC 3H8JA 1V5IB 3LF0A 3CNQP 5ETOA 1T4GA 1RYSA 2HQ3A 5AKHA 2QI2A 1UWBA 2HFSA 3MCSA 4FFDA 1NSAA 4HTIA 3H2UB 2V34A 2KVCA 5KFQA 3F41A 1VQ4S 2HK2A 3CDEA 5DM6Q 2B0GA 3T41A 1A6SA 2I5JA 4OYXA 2QYGA 4GV3A 8ICUA 1H1VA 3CETA 3BF3A 4CZJA 5KFPA 5AQVA 4YD1A 1ITPA 4RQ1A 2RN2A 4QPXA 3HP6A 3TJAA 1HJOA 5F1XA 3CFPA 5I3PA 2CNNB 5CCMA 3NS5A 4KHPF 1V9OA 2YKMA 3AY9A 4OI1A 3KKRA 5M2RA 5CHCB 4DR3K 3FYHA 1KLMA 4AHRA 2GZOA 1FA0A 5BXIA 1ZQJA 4CE6A 4RO0A 4NLNA 5C24A 2DGTA 3MM5A 2R2RA 1WJ9A 3BPSP 1RWOB 5EWEA 4WCEL 2HOEA 3BKTA 4ZPVR 1R8CA 1KFSA 1MN9A 3EEQA 2A1SA 1YJWS 4EELA 3MPUB 1VSEA 3D7SB 3LVWA 4F04B 3NXZA 2HQGA 1UPHA 2CQGA 1JL2A 4DQIA 2ZH3A 5GIOA 4PXDA 2BHNA 2Q3PA 1B70B 4QZEA 4DR1J 2AV5A 1AZSB 3FBCA 3ZDAA 3LP2B 2B6AA 5BR9A 3U9DA 3ULDA 2OKQA 4H4OA 4B9TA 2GJ2A 3OSNA 4Z6FA 1F60B 5AK4A 3R6GB 4HCCA 1SJRA 2GVZA 3JSBA 2BE9B 2F1FA 4L75A 3SSQA 1OY9A 2LHTA 4EBEA 4QIWD 4YOYA 1MU2A 3H25A 3AUOA 1NGFA 4LFCF 1OY6A 2Z7JA 1FK9B 1Z2LA 3GQCA 2U1AA 3O8WA 2KHCA 2CPIA 2IM2A 1ZXOA 5CCLA 1FFUA 4CI6A 1BY9A 3EO3A 4IEEA 1HWLA 3B0YA 5ETTA 3A0IX 1RGIA 4DR5J 1T6DA 2GJIA 3DFEA 3VETA 4XH4A 1XNRF 2RQMA 2GWSA 3LALA 4I2FA 1RWMB 4BHQA 2Z1GA 1FT8A 4GVMA 1RADB 3QYYA 4U96A 3V9UA 2DKZA 2CZVC 2OMLA 4A5AA 5AKIA 2BKNA 1MN8A 4IOAQ 1IJFB 3KTQA 1HQEA 4CHYA 4TY9A 1XO0A 2AJ0A 1CLFA 2O8DA 3HILA 4DJBA 1AT1B 4R0EA 3TTDA 1O51A 3IM8A 4AM7A 1KC8T 4Y34A 5C10A 3OHAA 2HZAA 1PVRA 1DK2A 4UOCA 4CZHA 4DV0K 1SJ1A 1K73O 4K8RA 3CCQN 5AZJA 5EDWA 4KRWA 2MUTA 4KAIA 1FCAA 3HZEA 2DJWA 4CBWA 1EETA 4CEAA 3D2WA 1TL7B 2F8MA 3B8AX 1DAXA 2V2QA 2WOMB 1XQSC 1BCOA 2DY9A 2YCHA 2RVJA 1UVJA 4P9SA 1PO6A 5AKJA 1LVHA 2DHHA 4P4PA 3NE6A 2HHQA 5KFAA 3NAHA 4DPUA 2M5YA 3PSFA 4UW9A 1WSEA 5IC4B 4Q44A 1HIYA 4PPXA 3QU7A 5ALLA 4RUCA 5KG7A 3FSXA 3O08A 3D1HA 2DR7A 2BUNA 3QBCA 3NGKA 3L7PA 4O4GB 2UVUA 2P9PB 4BXOB 4RX6A 2P9KB 4CJ5A 4IOCQ 2DXDA 2CPFA 3MABA 3HI0A 5H2FU 3U4LA 4RCHA 4USHA 4R64A 4LF5K 4FLUA 5HQMA 3RAQA 2GX9A 1VC6A 2MRLA 1QZ5A 2FXUA 4JRPA 9ICKA 1RQ0A 1RJJA 4E7IA 3LK9A 3PXGa 3DDHA 4LF9K 2CA9A 1I94F 3Q8KA 3G4SN 3WIUA 4I28A 8ICLA 4O9MA 1NH8A 3OS0A 4NMXA 1TP7A 1BQXA 2UUTA 3Q86A 3BH6B 4B9LA 2E9RX 2OA8A 3RSEA 4FVCA 3LZJA 2BW2A 3T1HK 3LPTA 3HFVA 5C2DA 1D9FA 1MSWD 2BV3A 2O67A 2N7CA 4C7ZA 4G9BA 2QZ8A 2Y9TA 2OPSB 4OHYA 2PMWA 3VEXA 4LRFA 1KVAA 4C11A 1S5LU 1C0TB 3DM2B 1RU1A 1Q8LA 3UDCA 4DXLA 1VCTA 4G1PA 1EWRA 2ASDA 2DQNB 3H8SA 5GMDA 4IR1A 4KLSA 3PRVA 3ZZPA 4U8YA 1HI1A 2J0SD 3G8SA 2PEBA 2R8IA 4YD2A 2EC2A 5HVGA 3OR1B 4FM0A 2OUGA 1HQUB 5GAHP 5D78A 3D2EB 3CCJN 1G15A 4USAA 2E1FA 5AQPA 2E1EA 3T7ZA 3KXDA 3D6MB 3THWA 2B7CB 2NYHA 1RT5B 3RYLA 4GKKF 3UDEA 2YMQA 4BJQA 5KFGA 1VAZA 3ATVA 1HLUA 3CJ9A 7ICOA 4Y0FA 3BGLA 2FBYA 4O8UA 4YR2A 3BS5A 4R8UA 1D09B 1TU0B 2LPEA 2AGOA 3KJFB 4C8MA 3JTNA 2HHPA 2HLTA 3HSJA 1IKXB 4ZHRA 2IOFA 2XMJA 1OQ3A 4M3TA 3KLFB 3OTDA 1XR7A 2QA1A 2LU1A 3MURP 5JUMA 1Q5VA 5LY3A 3U8XA 1SZPA 2QA4G 2OLWA 2JX2A 4M5HA 3CJSA 4RU9A 2UP1A 2HF3A 4DL7A 4KHPJ 2BCSA 2ATCB 3TAFA 1KQGB 5FPDA 4G1QB 2Z1JA 3CCUS 3SIPB 3AU6A 1HW9A 1N88A 3ZTQA 3FBBA 4LBHA 1R59O 3MZIA 3BS7A 1N5VA 3CMAS 1TV9A 2ACYA 4AE5A 1GLDG 2XGQA 5ALJA 4DOAA 3PJXA 4LR7A 4JI4J 1CZBA 4LQ3A 4BC7A 1FJ7A 3J7ZT 2VG6A 4KX5A 3V2UC 4MLHA 4UOGA 3G6YA 5AT1B 4DFPA 5CYQA 4C8YA 4CESA 3N7SC 3C6TB 4DTUA 4I27A 1RWUA 2B5JA 4DR2J 1ZQNA 6FD1A 4P10A 1SZ2A 1ZTWA 2L3MA 3L4BC 4JLHA 3H42A 4FYYB 1X4DA 3I5AA 1GFWB 3IO1A 1HBOA 4M94A 4F93B 5IWAJ 1S9GB 4JOUA 4DV6J 2QXFA 3O1WA 2ZBIA 1FFGB 4M3UA 4KX3A 3CHWA 2W2QP 5EE0A 3C7NA 4C8KA 2JNJA 4LF6F 4QU6A 1ZQHA 2BDUA 5KFJA 1NSKL 4RW9B 4JI2F 3IUCA 4N56A 2Q3SA 2HEKA 4DR7J 5HRNA 3BYPA 4QWDA 4RBUA 1KQFB 1CQMA 4JI3K 1PJ7A 1MW7A 2BDPA 4RW7A 2JHDA 4CK3A 1KVIA 2EWHA 4YEAA 2DPNA 1AQ6A 3VN5A 3PSPA 2FJAB 2AX1A 4ID8A 1YZ7A 5ALUA 2H1YA 3ID6A 2PDAA 3QFPA 1H73A 1YX2A 2ZIUB 3T19A 2F76X 1QQCA 2BX6A 1T03A 4IJNA 8ICXA 1Z4OA 2DO0A 3AHPA 3C19A 3RB0A 2NQPA 2FHMA 2KVIA 3MAQA 5ALHA 1YJNS 3C14A 3N0VA 3UW1A 3NASA 1F0MA 3HCXA 1K1QA 3AAQA 3FLCO 2ZTDA 2X74A 1TR0A 3KG4A 5K8NA 3FSIA 1WSRA 2R42A 1QQ5A 1RTDB 1KL9A 1Y3KA 2HMIB 3NF6A 1FJGJ 3OTBA 3EE3A 5J0OA 3OYKA 4J8FA 1QQ7A 4P75A 1FRJA 4B3SJ 2DK2A 4K50A 2HMPA 2VJ5A 3EMTA 4RPXA 5AQQA 4Z2XA 2MA1A 3VA0A 2ZOGA 4R8UB 3MEDA 4Z7YA 4JI6J 2HSTA 2CQ0A 4PY5A 4Z0UA 1N63A 1JJCB 5DB9A 2YHBA 3ZD9A 2YKOA 5L1MA 4JYAK 1FRHA 4KH0B 2BQRA 2IMOA 2QWOA 5DB6A 4FN5A 1JXBA 3ZX3A 1XHXA 4MN4C 2XS2A 1CJKA 1U6BA 1WC0A 2Q6CA 4ES3A 4DV7F 3UM9A 4CO3A 3D6TB 5IIOA 3FEXB 2EK1A 8AT1B 2E66A 4DS5A 1VQKN 4K59A 4TN2A 3OHRA 3EKUA 4UTGA 3FMWA 4PYAA 9ATCB 4ICAA 3M6WA 2LYVA 1RXWA 3O3LA 3M8QB 2AU0A 4A8QA 1B7FA 1O6XA 1V9PA 4DQSA 3MECB 1VRUB 3W5XA 4HTUA 4ES2A 3GFHA 2KM8C 4DX7A 2HHUA 4YG2A 1JLQA 3PEJA 1JNRB 4WE1B 1S9GA 3ITHA 1TL7A 3Q8VA 3GJSB 5HMZA 3UQSA 4BRNA 5IQQA 4CTAA 4NRTA 3HBTA 1N36F 4M63C 2HNDA 4MFBA 2D3UA 1RWVB 2QLBB 2K4PA 5AQOA 1KHVA 2XS5A 4C0BA 1QAYA 2HB5A 4NLSA 1IVZA 3AAWB 1FEZA 1TYQA 3UD4P 1XNQJ 3RRGA 1LK7A 2N4DA 4AHTA 5IM0B 3QUTA 5B0EA 4OZJA 4YOEA 2D8CA 1PAEX 2ZH6A 3CIZA 3FBEA 4B1UB 4FYWB 4OJ3A 4DR6F 3D0IE 3AJ2A 1K6YA 1P8ZA 1WNEA 2C2EA 5I4MA 5C0YA 2QL5B 2YX4A 5FLXU 2GVZB 4ED3A 3ZTRA 4FF4A 4IO8A 1CVJA 2CJ9A 1YVFA 2G13A 4CJQA 4B9QA 4NLUA 4QJVA 2NRVA 2J7KA 2KJ5A 3MGIA 5J2IA 3DLBA 1N33K 3UI3A 2BCRA 3BO2A 1XC3A 1HPMA 3OT9A 1E4FT 4FLXA 3M8SA 5B0BA 4QW9A 5DBCA 1WAFA 3WNHA 4DSIA 5KFSA 4FO0A 2IDOA 3ISNC 3JTPA 4DPYA 2RHQB 2K1RA 2W9CB 3A3NB 4F67A 2BBEA 3LOUA 2IDLA 2FJVA 4EAHD 4PL2A 4CZFA 4FSVA 4JI6K 1C0TA 3DM2A 4C11B 3A3OB 3ISDA 1X4EA 7ICSA 1U9LA 1ZOLA 1KONA 2HBMA 5KG4A 2Z2LA 2W9AA 3EGNA 1S22A 2BABA 2O8EA 4YMMA 1QCKA 4EX7A 1WDTA 2RD5C 4ISFA 2A3ZA 2AYEA 2CYYA 2LP4A 2X1AA 3CIPA 2MDAA 2G09A 4CNQA 4HTJA 2MMYA 4WXWA 3P5BP 2VHGA 1KAZA 1KC8O 5AQGA 2XICA 4AFFA 3DRPA 3TUJC 3AOBA 1PC4A 5G0RB 2GEMA 3U02A 5G4DA 3G8TA 3KVGA 1DURA 2HGNA 4JWNA 2MZ1A 4KB7A 2HVIA 2H48B 1FFSB 4OPJA 3K75D 3N7RC 4IH6A 4FJ8A 3CB4A 1RTIB 3QIOA 3ZZYA 2V2KA 3CFOA 4DUYK 5TKWA 1Y10A 5LM7E 3D4JA 3TFSA 3A3PB 1XN9A 2YX8A 3M32B 2ZOMA 2P8IA 4ZTJA 4JV2A 4I2IA 3Q23A 1HHQA 4YUDA 3LPUA 1HWUA 1GLLO 1GMUA 5IV3A 1HHSA 2V4RA 1DRZA 4ZP7A 4PQUB 2OANA 2H5XA 4K4TA 3QWUA 4XH5A 3OS2A 4PABA 5AQTA 3VGKA 1XR6A 1EX4A 3CCRS 3BF1A 3X3UA 3I96A 4OLPA 3BN7A 5F8NA 4NI2A 2ZWPA 2KFZA 2M7SA 1Z25A 4FK0A 1ZQYA 3GJRB 1BG3A 2WK4A 4L74A 5IT4A 1YGYA 2BXJA 3RRHA 2J8AA 3AGKA 1H2UX 1KN5A 4U67L 4NCAA 4KFBB 3ET6A 5CQGA 2NPFA 8ICNA 1JJ4A 5H1SQ 3M8PB 1TKZB 4TYBA 4DL4A 1CUKA 1EQMA 2AZ1A 1EIYB 3AA4A 4ZS6A 2EPIA 3LDNA 1I5OB 4TXSA 4ZVTB 1SWWA 4I7FA 4EU0A 2IS3A 3VQ9A 4NYOA 2N7YA 4KLTA 2GV1A 2V4JA 1F5BA 3A2FA 2Z0GA 4RNMA 4IQMA 5T7LB 2IHR1 3NY0A 3SSRA 2PC6A 4OV1A 4C0OC 2G8UA 2NXEA 3IDWA 4LQ9A 2V68A 2UV8G 1NLVA 2FC9