1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
5KI6A 4RQ1A 3VQPA 2BCRA 2YNFA 2XY7A 4LSLA 3LZIA 1HUOA 4OKEA 1NKEA 3LPUA 4ECZA 3PV8A 5BPCA 5IINA 1QSYA 5KFYA 3RJEA 3DYAA 3Q8RB 3RJKA 4IFVA 3OSPA 2NRWA 4M3YA 5KG2A 4BXOB 1KTQA 4BWJA 5C42A 4DTPA 2MUTB 4UBCA 5IIIA 3PMLA 5J0RA 3RMCA 3L8BA 4CHOA 2XHBA 1LWCA 3L2WA 1RTIA 1N5YA 3K5OA 4X5VA 3VQQA 3TFRA 4LZGA 3S3NA 2UVWA 5DG8A 4IR1A 4CGDA 2PY5A 3KLGA 3PO5A 4QWDA 4EBEA 4M9GA 4FLZA 4NM2A 1U9LA 5KFCA 4YG2A 1S9FA 4O55A 1K1SA 2F1JA 4QZBA 4FBUA 5L1KA 4NM1A 4N76A 3MDAA 3C94A 2VA3A 3AA2A 4KFBA 4DU3A 2R8KA 5KG5A 2A1JA 4FVMA 1CEZA 5L9XA 1HYZA 1C7YA 4KLLA 2XCAA 1ZBIA 3AA5X 3AVKA 3DRPA 3AVNA 3T19A 1ZQAA 5J0UA 4M6WA 3OYKA 1ZQCA 3AVLA 1ZBHA 4TQSA 9ICNA 4CJEA 4ECUA 4UQGA 3CM5A 4DTRA 2LYHA 4OKKA 1D8LA 1Q9XA 3IM1A 4FYDA 4BDYA 5KFZA 3E01A 3C95A 4E7JA 5J2PA 3RMBA 4JLHA 3OVNA 1D9FA 2BPGA 1S1WA 4FJJA 1PZNA 4HVJA 4E1NA 1ZQUA 3VN5A 3V9WA 2IAJA 4QZ9A 5FDLA 1VSLA 8ICTA 3C5FA 4XIUA 5KG1A 4RNMA 3C2KA 2P66A 4RG8A 3MABA 1TVAA 1C0UA 5HRRA 4JS5A 4DS5A 1QSSA 5J29A 3HWTA 4CJSA 2RN2A 4ID5A 4UAYA 2RDJA 3V7LA 2PFPA 3NGYA 5CZ2A 3SQ1A 3JPOA 8ICEA 3AV9A 5J2BA 4ELTA 1NOYA 5KFUA 4MQ3A 7ICQA 4OVLA 3ZSWA 2FBXA 4I29A 2IDOA 2YNIA 9ICKA 5T7BA 4CIGA 5KG0A 3ISBA 3K5NA 3WNEA 2HHTA 5C24A 3OJUA 1MC8A 3MAQA 2ZTCA 5BOMA 1KEJA 4DTNA 4IRDA 3EW9A 2BQRA 2JGUA 3GIMA 4F92B 3KHRA 4FJ9A 4F4ZA 2P51A 5CZ1A 4GW6A 4KLFA 1ZQRA 3RBDA 3Q8QB 2FBYA 3KHLA 1KCFA 3JPSA 7ICLA 4PA1A 5KFNA 3OHBA 8ICOA 3G10A 3V72A 4LSNA 5KFVA 9ICLA 1IG9A 5DLGA 3PX4A 2NUBA 4H8KA 4ED6A 4Z0UA 3JYTA 4J9KA 5DMRA 2BCSA 3V1RA 1GOBA 1RDBA 4F5QA 1RBVA 1TKDA 3C2MA 1SKSA 1JIHA 3H4DA 1B9DA 4CJ4A 3C6UA 3KLIA 3L2UA 5EU7A 4CIFA 4CHYA 4BDPA 4NLGA 8ICRA 2BANA 5EOZA 1BGXT 1S9GA 5DB8A 3M9NB 4PHAA 4KKOA 4RT2A 4CF8A 4QZEA 1W9HA 3RJGA 4C8NA 2GV9A 3NHGA 3N97B 3ISNC 5L1IA 1ZBFA 2M9NA 3UQ2A 3N4MB 1KFSA 2OWOA 2X6NA 3Q8PB 5KFQA 4ID1A 4RW8A 5HHHA 2GBZA 3HPOA 3L2QA 4DWIA 3RB3A 2ATQA 2YNHA 3ASMA 2W8LA 4Q8EA 2FBTA 4Z4GA 1LV5A 4I2HA 1BISA 4BACA 4J9OA 4KLJA 2OPPA 1LAWA 4E7KA 1L3SA 3IS9A 3VQ9A 3V6KA 9ICBA 3D45A 1DTQA 3ZSZA 3FFIA 5CY4A 3V6HA 4UB1A 4QZHA 4YQWA 5J2EA 1N6QA 1KSPA 1ZQQA 2P6UA 3JPPA 4DF8A 5KFAA 4I2BA 1ZQJA 2PI5A 3PX0A 4RQ7A 1BPEA 4E7HA 1FK9A 5KFXA 3L3VA 3KTQA 4DL7A 4YFKA 4YCXA 5KFGA 2I1QA 3SI8A 1CUKA 3THVA 3G0ZA 1N48A 3LAKA 5KT3A 1RPLA 2AGPA 5KFIA 5KFJA 4M9NA 5IIMA 4QZGA 3AA4A 2KZZA 1MU2A 4CJUA 4CEOA 3PR4A 5J1EA 1Y88A 1VSKA 4FK4A 3H8JA 4JV1A 2BCQA 3TAGA 5F9LA 5BOLA 5EWGA 1MSWD 1JN3A 3ZT2A 3DLBA 1CLQA 4K4IA 3RR8A 1QTMA 3RBEA 1CZBA 4DL4A 4J9RA 5DB6A 4DLGA 4CCHA 4WE1A 1TKZA 1QHTA 4FW2A 4QOZB 8ICJA 2KTQA 4CF0A 1RTHA 3SUQA 4QW9A 1CZ9A 2KZ3A 3QIPA 5FRMA 1ZQZA 4KPYA 2AGQA 2ISPA 3ZDAA 1U45A 1ZQYA 3Q8LA 4KHQA 3C1ZA 4RPXA 3H08A 2D0BA 3DLKA 3QEWA 9ICFA 1NK9A 4Y1DA 4I28A 4YMOA 5DLFA 4NLKA 1BI4A 3QEVA 3SUPA 3OYDA 4DFPA 4UB2A 4Q5VA 4E1MA 1NOZA 3DRRA 1BIUA 4FCYA 4KLEA 3TARA 2W9MA 4O44A 1TL3A 5I42A 5KTQA 4E19A 1UAXA 3HXMA 3ZSXA 3VQCA 1SZPA 4HTUA 4TUQA 2W9BB 3HJFA 1RILA 4UB5A 1VSDA 5IIJA 2DFLA 2DPJA 3DOKA 3AU6A 4DEZA 4ZHRA 4BXOA 1C1BA 3QO9A 4KN7A 4KAZA 4Q45A 4K4GA 4FXDA 2MUTA 4B9LA 3LANA 4R65A 4E7LA 5J0OA 2Q0ZX 1HJRA 4XUSA 4IQUA 3LP2A 2KQ2A 2O4GA 1RZTA 4QZDA 4Q43A 4LVSA 1WAJA 2FPKA 2PXIA 3DM2A 2DY4A 8ICIA 1CXQA 4EP5A 2IOCA 4FJ8A 3V81A 4CJTA 4RQ2A 3NFAA 3BJYA 3MFHA 5CYMA 4P4OA 4FJLA 3T5JA 1IKYA 4DS4A 1F21A 1VK0A 3M9OB 2PFNA 3ISDA 2YV0X 2YHAA 1ZQIA 3RRGA 3NF6A 2HHUA 5KFHA 1JLBA 4PHEA 4YNQA 7ICKA 3TAQA 3OYLA 3GIIA 3MGHA 4CERA 4CF2A 2ASJA 5J2CA 4UB4A 4J9LA 2VG5A 3HO1A 1FXXA 1C0TA 1ZQEA 3T1AA 4QAGA 1S97A 2A1SA 2KFZA 3F9KA 2Z1IA 2F8TA 5J0SA 3AVBA 4DQPA 4JS4A 4DFMA 2HHVA 3VA3A 3KKSA 4FJHA 3OS1A 3ZDDA 4RU9A 2XY5A 1UT8A 7ICIA 2JEJA 5HLFA 1BQMA 1C1CA 1ZQWA 3KK2A 4I2PA 1XSPA 3P5JA 3CG7A 1S77D 3O4QA 4RT3A 4FJ7A 2XGQA 3C5GA 3QZ7A 9ICQA 4YR3A 1TK0A 4M3ZA 3OYFA 1RT4A 2YNGA 2Y1IA 5JS2A 4J2BA 3QEXA 2QKKA 2V4RA 4ED3A 5KFTA 1ZQKA 4B9NA 4JV0A 1NKCA 3NE6A 1EETA 1VSEA 1ZQMA 3EPIA 3L2VA 1WLJA 3PUFA 4FS1A 2GWSA 3LDAA 9ICTA 4HYKA 1VSJA 1RT1A 4Z4CA 4R66A 3H40A 5FROA 4KLHA 4DSLA 4ECWA 3KKRA 4NXZA 7ICRA 2W42A 2IBKA 4OLBA 3FYHA 3V9ZA 4KMUA 3OYEA 2UVUA 2ZD1A 4Y1CA 4ECYA 1ZQDA 2BCUA 2Z1HA 5HMMA 4O5CA 5KFBA 4NLNA 4KLMA 4PY5A 4YD2A 5J0QA 4JRPA 1LWEA 4CK1A 1XSNA 2NRZA 4AH9A 3DLRA 1HYVA 3HP6A 3UIQA 9ICIA 2OZSA 1UWBA 1NJYA 3MEGA 1AROP 3SI6A 5FRNA 3RJFA 4CFBA 1Q9YA 3G6YA 3OYGA 3IHQB 5DG7A 3V7JA 1JX4A 1V9PA 4O3PA 7ICGA 4F3TA 1TKTA 4CHNA 3BQ1A 2IC3A 4IBNA 4Q8FA 2DFFA 3RMDA 1WSEA 3MEEA 4G3IA 8ICSA 2AQ0A 4PPXA 4F93B 4F5PA 4M9LA 4MF8A 4UBBA 4J9NA 1JLQA 2R8IA 3ZT4A 2JZBB 1VSMA 4IR9A 4E7IA 4YXMA 4M45A 2IHNA 4CJFA 4XQ8A 2B4JA 4I27A 4YMNA 2ZE2A 5DGBA 2HNDA 3OYAA 4QZAA 1VSIA 3C2LA 3KK1A 1BCMA 2R8JA 3OHAA 3T3FA 4CGIA 4QWAA 1B9FA 4EBCA 2P5OA 7ICEA 4I2DA 4CFCA 4RNOA 3AVFA 3OYIA 4NYNA 4I2IA 3ZDCA 3DOLA 1U04A 4DLEA 2C2RA 3QEIA 1ZQTA 3V9SA 4IQWA 2OPQA 1QSLA 2RDIA 4DL2A 1IM4A 1JMSA 4XA5A 2PFOA 4KO0A 4I2FA 2G8IA 4PH5A 5I3UA 4QWBA 1TGOA 3C1YA 4DL5A 8ICHA 1VSHA 4E3SA 4PHPA 3RJJA 1NJWA 3RRHA 4J2EA 5J2GA 3NTUA 3VQ4A 1LAVA 1XHZA 3TABA 3T5LA 1U49A 5KFEA 3RB6A 4M3WA 8ICMA 4HUGA 1XWLA 1B92A 2F1HA 3KLHA 1JXBA 5CHGA 5KFWA 3OS2A 3HX0A 3PO4A 1WSHA 3OYMA 4BE1A 1LW2A 5J2JA 2YKNA 1ITGA 4P2HA 4DL3A 5D4BA 4KLOA 2ZUDA 4O4GA 1I39A 1SKWA 1WSGA 3LDSA 5HRNA 2XO7A 3O3GA 1EKEA 1ZQVA 4DQIA 1KRPA 4CF9A 4DMNA 7ICMA 4YVZA 4F2SA 3E2EA 5SWMA 1YVUA 1EX4A 3KJVA 3F73A 4RUAA 4KB0A 3MGIA 3M8SA 5DBAA 1H38A 4KHUA 1WSFA 1B22A 4M3UA 3KIOA 1REVA 1ZBLA 1C6VA 5J2AA 1J53A 3ALYA 1DGSA 4RNNA 4K8XA 4RZRA 5KT6A 3VA0A 3QEBZ 3V6JA 4LY7A 4F4WA 1BPYA 2QKBA 3AVHA 4RUCA 3MR3A 5KFKA 3NDKA 5C5JA 2ZJ8A 5J2KA 4CGHA 4DTXA 3PNCA 1IKVA 5HBMA 3ORYA 3DLHA 4F5OA 4W5TA 3SZ2A 4RQ6A 1RTDA 2I9GA 1NK5A 3I0RA 4FK2A 2BGWA 5DDMA 4KV8A 4ECSA 4FZZA 4N5SA 2HMIA 4M41A 4GVMA 1QQCA 5DQGA 3S9HA 4M9HA 3LP1A 3K59A 3DI6A 4QCLA 4CECA 4F8RA 4OPJA 2W9BA 5HRPA 4CGJA 2WTFA 1U4BA 2W8KA 4IG0A 1SL2A 1R0AA 2HHQA 5KFMA 1S0MA 1BPBA 4YR0A 5F9NA 3B6PA 1ZYQA 2IHMA 1XC9A 4CGGA 4P4MA 1WSJA 1BCOA 4I2EA 3MXIA 3I0SA 4KLDA 3O3HA 5DGAA 2RF2A 3L2RA 5KFPA 4ED1A 4ICLA 4HUFA 4DFJA 1RYRA 4N41A 4AILC 3IRXA 4M04A 4CJKA 3AVGA 5HHIA 2H5XA 9ICRA 3QEAZ 4I2QA 4RQ8A 2C22A 2G8VA 3GDXA 4J9QA 4GC7A 2C2EA 3ZSRA 3RR7A 3WNFA 4G1QA 3PX6A 1KLNA 1Q8IA 3QEPA 2P5GA 1X9MA 3KHGA 3NGDA 1BPZA 3AU2A 3BQTA 4E89A 3ETLA 4I9LA 9ICEA 1UA1A 2FLNA 2ZUCA 4CGFA 3HYFA 4FLWA 2FMSA 4F91B 4Z4FA 4ED2A 4CEDA 1J5OA 2OYQA 1S6QA 5KFLA 1DLOA 1ZQHA 1HJPA 1ZQBA 5HRSA 4C8KA 4BE0A 3UQ0A 5KFRA 3ZD9A 2VWJA 3QERA 3ZSYA 1U47A 4PWDA 1QLNA 3BGRA 3DRSA 3RMAA 1SUQA 3I8DA 3HVRA 3D0PA 3EY1A 3P83D 1A77A 1BPXA 3KLFA 3G6XA 7ICFA 2OZMA 8ICCA 4KRFA 2FBVA 5CR0A 8ICBA 4CJ5A 2HVIA 1I3AA 4RW6A 4ZTFA 4DTUA 2GUIA 4RQ4A 1KVCA 5KG3A 4NCGA 4CFDA 1S1UA 3VQ7A 1VSFA 3AO3A 1TAQA 4YFUA 4ED8A 3TFSA 4CF1A 2IS3A 1X2IA 1EXNA 2Q3SA 3HP9A 1S1VA 1COOA 4KLIA 4B9UA 1S5JA 9ICPA 3JPQA 1J54A 4O5BA 4M2YA 3V1OA 4FLVA 1JXLA 4MFFA 4HUEA 5C25A 3K2PA 5JS1A 5J2IA 4IRKA 2G8KA 1A5VA 3LALA 4EZ6A 8ICQA 1S1XA 2Z1JA 4FM0A 3PW5A 4AHSA 2NRVA 3BQ0A 4EEYA 2IMWP 2UVRA 1S9EA 5KFOA 4OJRA 5DG9A 1S0OA 3V1QA 5CP2A 3S3MA 3LPTA 4O3NA 3RJHA 2BPFA 3P1GA 2ALZA 4F4YA 4F4KA 9ICGA 2OA8A 2FLLA 3NCIA 4QW8A 1VRUA 4IFYA 2D0AA 1K6YA 2ZUBA 3GIKA 3UXPA 5DQHA 1JL1A 4I2JA 4LD0A 1MQ3A 4BWMA 1X1PA 1S76D 4CEAA 1BHLA 3JPTA 2X78A 5DKWA 1S6PA 4RQ3A 5KG6A 7ICSA 1TV6A 4OGCA 2W9CB 5CJ7A 2IGIA 4Z4IA 4NY8A 1UOCA 3ZT0A 3SQ0A 4DQSA 4B8AB 4DTMA 2BCVA 3OYHA 2PYLA 3U3GA 2JZBA 3S3OA 4QZFA 3QESA 4FZXC 1X9WA 4NCBA 2R8GA 4JWNA 1RBSA 3TR8A 4FBTA 1HMVA 3DLEA 3T5KA 3CFOA 3T5HA 1HPZA 5CB1A 4GLXA 2XC9A 2JEIA 4IRCA 3CFPA 4CEBA 4DQQA 4O3QA 3CQ8A 4CEFA 3TAMA 3AVMA 4HCBA 2E6LA 4FM2A 3LP3A 3NH1A 5KFSA 1RXVA 3NGIA 1TK8A 3ZCMA 2QXFA 5D49A 3B0YA 2NRTA 2ASLA 1NOMA 1WCNA 3CFRA 1D9DA 3ULDA 4KREA 5EWFA 1KVAA 1RT2A 1X9SA 2OPRA 1YT3A 4DSIA 2BQ3A 4DSFA 3RH4A 2C2DA 2ASDA 4R8UB 3O4NA 4C8OA 2FMPA 5J2QA 5TZVA 5J2FA 5IILA 2XGPA 4I2AA 1ZQPA 2D5RA 5J2HA 4B8CA 1HYSA 2JEFA 8ICGA 4C8MA 4QZCA 4LH5A 3MFIA 1NK6A 4FJNA 3H7IA 2DPIA 5DK5A 4KN4A 3QNOA 2J6UA 1EP4A 3K58A 2DFHA 3U3YA 4DL6A 4MFCA 3NAEA 1XI1A 4RW4A 5CWRA 1Z00B 3QLHA 4I9QA 4DU1A 1NKBA 2HHSA 1TK5A 2JLEA 4DTJA 3SPZA 1XHXA 3EZ5A 4M3TA 4Z4HA 4AHUA 5KFFA 4KHYA 2ATLA 1JL2A 1T8EA 4CHZA 1ASVA 3VQAA 4KB1A 4H4OA 4Z6EA 3LAMA 5HP1A 5SZTA 2C28A 3A2FA 3TI0A 1NK7A 3V9XA 4N56A 3MXJA 1KLMA 8ICKA 3SV3A 3OYBA 4O0IA 3K57A 4O9MA 3MECA 3RTVA 4CESA 3AO2A 4YN4A 4OKJA 4NYFA 5J0TA 4FS2A 1TAUA 7ICHA 4CJPA 3QNNA 2BE2A 4CHQA 3GV5B 3RB0A 3SUOA 3GFKB 1MQ2A 1XSLA 1RBUA 2BPCA 4IDKA 2B21A 3RAQA 4CJ3A 3SCXA 3GQCA 3HPHA 4W5OA 3ISCA 4IKFA 5HROA 5KGWA 1RXWA 3RAXA 8ICFA 1ZQFA 4HHTA 3CYMA 2XCPA 1JLCA 8ICVA 1JLAA 1RDCA 3ZD8A 2RKIA 3NGZA 2FMQA 3V7KA 5J0PA 5J0XA 3AVIA 2ZQBA 4C8LA 4I7FA 2XY6A 4M0AA 9ICJA 2R7YA 1T03A 2WOMA 2P6RA 5DDYA 4O3RA 4UAZA 1WCLA 9ICWA 1HUZA 4TUPA 4OPKA 4M42A 2EHGA 4ECXA 2F8SA 4XRHA 4QWEA 4LZDA 4KTWA 3VQ8A 1LW0A 3JPRA 3TWHA 3HVTA 4ZH4A 1HQEA 4DOCA 2KFNA 1WNSA 3ZDEA 1L3UA 1GOCA 4Z4EA 1BVSA 1L3TA 4AHTA 1C1AA 4F2RA 1FKOA 3ZT1A 3QINA 3PW4A 3HW8A 3PMNA 8ICNA 4DOBA 2P1JA 3AA3A 4JRQA 4DOAA 4AHVA 3TQ1A 8ICAA 2VWKA 2J6TA 4PUOA 1QS4A 2PFQA 4J9MA 8ICPA 3MEDA 1A5XA 4Q0BA 1Z25A 1ASUA 4CE9A 4O0JA 3SV4A 1S10A 1BQNA 5KRTA 3UPQA 5KT5A 1C0MA 9ICUA 4PGQA 2B6AA 1BIZA 5KRSA 9ICHA 4RQ0A 2RPIA 4YD1A 4JV2A 1RT5A 4IQVA 4KITB 1ZQNA 8ICWA 1RYSA 2E6MA 4QWCA 4KLUA 1Y97A 1DTTA 1TKXA 1XS9D 4FJ5A 5DBCA 4J2AA 4O5EA 1RBTA 3KLEA 4FJIA 3RJIA 2VG6A 4ECQA 2XY8A 4PGYA 2Y1JA 1JKHA 5IIKA 4BE2A 5J2MA 3K5MA 1LB2B 9ICCA 4MEXA 4FLXA 1ZQGA 4DSKA 2VANA 5DQIA 3K5LA 3UXNA 9ICMA 1B43A 5KT2A 2HVHA 2BR0A 2W9AA 1WSIA 4MFAA 4NLZA 1TV9A 1RBRA 4ECTA 4DSEA 5KT7A 5HMLA 4ELUA 1YTUA 2G8WA 1IXRA 3V4IA 3U6FA 7ICOA 3EPGA 3IG1A 4RW9A 4CEQA 4M47A 4CJRA 1NK0A 1WAFA 4CK2A 3LK9A 1DOQA 2X74A 4W5RA 4FJKA 5CYQA 3PY8A 3QE9Y 3HSTB 3AO1A 1RDDA 4ELVA 4JK1A 1NJZA 4Z6DA 1W0HA 7ICVA 1SKRA 3MDCA 2HNZA 3BQ2A 2MAXA 2HHWA 1HNVA 4J2DA 5DBBA 5KG4A 4CK3A 3KD1E 2PYJA 4CJLA 2EX3A 4K8ZA 4FLTA 4J9SA 4OLAA 4FM1A 1UA0A 4YP3A 4PHDA 4EBDA 4F50A 2ZJ5A 2ZTEA 1O1WA 4IQTA 1FKPA 1KFDA 4K4HA 2B5JA 3NF8A 3ZSQA 4CJQA 2A1RA 1KVBA 3PW2A 4R5PA 1S1TA 5HNKA 1NK8A 2HHXA 4FLUA 3VQBA 1ZQOA 3Q8SB 4MF2A 5EWEA 1HRHA 5HP4A 1RT7A 4ECVA 1ZBUA 4CFAA 2AJQA 2W9CA 3K4GA 1ZJMA 3VQ6A 4LH4A 4FK0A 1T4GA 3FDSA 3RWUA 2A1JB 1XU4A 2HB5A 1IO2A 1KFTA 4R63A 3M8RA 3V9UA 4FJXA 2LSNA 3JPNA 3AO4A 2V9WA 2D0CA 1IKXA 3PR5B 4M6WB 3M9MB 2KZMA 4KLQA 3AO5A 3H8WA 4DTOA 3OYNA 1NJXA 1RCHA 3EWAA 3AVAA 4M3RA 3O3FA 3KD5E 1D8YA 4B9SA 1N56A 3C6TA 1T7PA 4I2GA 4OGEA 4EYHB 1LWFA 2FPMA 2ITGA 7ICNA 5L1LA 2BQUA 4ED7A 3OYCA 4TSXA 3TAFA 3ZSOA 1QE1A 3SNNA 5K14A 4FW1A 3L3UA 1J9AA 4KHWA 5KFDA 4DU4A 4PQUA 4F5RA 2BGGA 4B9TA 1A76A 1S0NA 4KHSA 2KN7A 3OYJA 9ICVA 3CM6A 4P4PA 2NRXA 1U48A 3SPYA 3UXOA 4JWMA 2AQ4A 4R8UA 2I5JA 3VQ5A 9ICXA 1GOAA 4FZYA 3GIJA 4YMMA 1TVRA 1NK4A 2FC0A 3NF7A 2YHBA 1L3VA 3TAEA 2G8HA 3MBYA 1Z26A 4PGXA 5E41A 4KI6A 3EYZA 4B9MA 4E0DA 2E4LA 4TURA 5KT4A 4EZ9A 3NF9A 4H4MA 3OJSA 4ZTJA 1S0VA 2G8FA 9ICOA 4TUSA 1T05A 4UB3A 2XRIA 4UAWA 4GXIA 1Z00A 3LWLA 3KHHA 3PVXA 1CXUA 4GXKA 3K75D 1UT5A 3QZ8A 4HCCA 4F4XA 1HNIA 4NCAA 4KHNA 3GV8B 4F5NA 2BKEA 3IAYA 4Z6FA 1JLFA 1ZQSA 3HPGA 2V4QA 1T3NA 2FPLA 4RPYA 4DQRA 2HW3A 2R8HA 3ZSVA 4GC6A 4TQRA 5KG7A 1JXEA 2OPSA 9ICAA 2FLPA 2UVVA 3MR5A 7ICJA 3SQ4A 3ZDBA 2BHNA 1Z3EB 3WNGA 1RT3A 1VRTA 3AUOA 3V6DA 2DTUA 5L1JA 5D3GA 3BDPA 2HNYA 2ZTDA 1SL0A 1XO1A 2BDPA 1ZQXA 8ICXA 1BL3A 3AVCA 3LP0A 5J0WA 3SUNA 3GV7B 3H8SA 3PW0A 5JUMA 2IA6A 2PI4A 1YTAA 4CEZA 3NBPA 3Q8KA 4BDZA 2DFEA 1ASWA 5D46A 4M3XA 1BPDA 4FLYA 4RW7A 1A5WA 4L8RB 2KW4A 4AHCA 2X6SA 3HM9A 2ETJA 3HT3A 1KDHA 4IG3A 4QZ8A 4DSJA 4ED0A 3RB4A 3HL8A 1JLGA 1SL1A 4YR2A 3GILA 2J6SA 5KGXA 4Q44A 7ICPA 3OS0A 1JLEA 3SYZA 3QETA 4FJGA 3B6OA 2VG7A 4BGDA 3RH6A 1ZQLA 4DG1A 4EYIB 3AVJA 2JEGA 4JUZA 4KTQA 8ICYA 1ZJNA 3M8QA 4KTZA 5J2DA 4O5KA 4GMJB 4CJVA 4W5NA 3WNHA 3NH2A 3MR2A 3OY9A 4B3OA 4RQ5A 1SV5A 2G8UA 5DB7A 4DFKA 3DMJA 2VA2A 2F1IA 3B0XA 2QK9A 2O4IA 3KK3A 2YKMA 3HK2A 3Q8MA 5J2NA 3OSNA 1K1QA 1EXQA 3M8PA 2ISOA 4CHPA 3LWMA 3VQEA 4QZIA 4M9JA 4KI4A 4KLSA 4DO9A 4FO6A 4ECRA 4MEYA 5CA7A 3RH5A 5IIOA 2AU0A 4DTSA 1IH7A 4Z6CA 3SQ2A 1RDAA 1ZETA 3ITHA 2Z1GA 1L5UA 9ICSA 3DLGA 3JSMA 1IKWA 4O3SA 1TFRA 2F96A 7ICTA 4CIEA 4R64A 2VA8A 3MXMA 4I2CA 3OGUA 4DF4A 3G6VA 3MR6A 3NH0A 2ZJAA 3SJJA 4RPZA 3ZT3A 3VQDA 1RTJA 3QIOA 4MFBA 4F3OA 4N47A 3PW7A 1TL1A 3C21A 1HQUA 3H4BA 4W5QA 1RNHA 4AHRA 5DB9A 4KLTA 5J0YA 4CEEA 4YXJA 4B9VA 7ICUA 1G15A 4O3OA 3TANA 2PZSA 4KLGA 4J9PA 3LZJA 3TAPA 1BI4B 4FJMA 4B08A 4EP4A 2WONA 8ICUA 4CJWA 8ICLA 2AGOA 3C23A 1RT6A 1WN7A 1D5AA 8ICZA 4GXJA
chains in the Genus database with same CATH superfamily
5KI6A 3VQPA 2BCRA 1TL3B 2XY7A 5AQFA 1H7XA 1B7FA 3R5CA 4U67Q 3W3SA 4NRTA 4OKEA 1B4SA 2AJ2A 2GUPA 1RQ0A 3HMJG 3MPWA 4GV6A 1M5PC 3OSPA 3DAWA 4YDDB 4M3YA 1DZ5A 4FF3A 4ZHRB 2GW8A 2K4EA 2NSCA 3LM2A 1KTQA 4XH5A 3PDNA 5C42A 4UBCA 3VGMA 5IIIA 3PHTA 4YOXA 3H20A 3L8BA 1R7IA 3F56A 3AJ2A 1XBWA 5ETMA 4LZGA 3S3NA 2BX6A 1FFVA 4CYUA 2O8BB 3KLGA 1X7VA 3PO5A 5GTIU 3IKMA 2F1JA 2R18A 5CYMB 4FBUA 5L1KA 3ZNJ1 2F63A 4DV3J 3N28A 2R8KA 3J7Z5 2DNRA 2A1JA 2XYGB 1CEZA 1O51A 1C7YA 3P49B 1ZBIA 2EG2A 4TU9A 2Y9TA 1JLBB 2OIHA 1KVKA 1DBDA 1X0FA 1ZBHA 4TQSA 9ICNA 2VUGA 3UCUP 4CJEA 1U1MA 4ECUA 4KC5A 1IR2A 1SJ3P 4FYDA 4GVBB 1Q9XA 3IM1A 2LECA 4BDYA 4KHMA 4DR7F 2H5JB 3KZIU 3BF3A 3C95A 4E7JA 4RBUA 1URJA 4XAKA 4K42A 4DI6A 1NHKL 1D9FA 4QU6A 2VBWA 2ZWHA 1GX6A 1ZQUA 1BUPA 1NGAA 2L5YA 1RAJA 2IAJA 3BBCA 4NLPA 1Q46A 5ADXH 4TY8B 4DR4F 2KU7A 4RNMA 2P66A 4USIA 2QSFA 3MABA 1TVAA 3NCQA 4J91A 3O6QA 4DPUA 1YWXA 5HLFB 4DS5A 1C1CB 4J37A 1FJGF 3M2RB 4EELA 4JKBA 1FNMA 1K73O 2RN2A 3QYYA 4UAYA 3OTDA 4B3MJ 2JGAA 2WFBA 4DV6J 2PFPA 1NLKL 5CZ2A 4LF5K 2YTCA 3SQ1A 1RT4B 8ICEA 3AV9A 5J2BA 1OH8A 4AP9A 2IHR1 7ICQA 5L39A 2R2RA 3QFWA 4OVLA 5LJ5Y 1WG5A 1JRPA 4RX6A 1XK8A 2Z30B 4I29A 2FBXA 3MOZA 2YNIA 2X1GA 4KX3A 1AZSA 5AFUA 1OMSA 2KHOA 2HHTA 3BV8A 2YWEA 3OJUA 4NLTA 4M5DB 3R5GA 1KEJA 3IG8A 3ENOA 2DRDA 1RWPB 3CDWA 4IRDA 3MAAA 1NNLA 1HHTP 5ADZA 4KLFA 4I1TA 2FPHX 4W90B 2DBBA 1ZPWX 3KUEA 1S57A 5DM6L 1YI2S 1U2VB 5KFNA 1UWBB 3MEGB 2LMRA 9ICLA 3TQEA 4WKRA 3PX4A 4DV2K 4ED6A 4Z0UA 2A19A 4J9KA 3WC2A 3VF0B 1GOBA 3SBMA 4F67A 1TKTB 5A8RA 5BREA 2HAIA 3UI3A 1A0PA 1B9DA 3MEEB 2HIQA 2RRAA 1LCUA 1CULB 4CHYA 4DZDA 3P31A 8ICRA 4L72B 4XH4A 3VOVA 2KOBA 5AQJA 5DB8A 3M9NB 2Q6BA 4J8FA 4KKOA 1ZAVA 1W9HA 2GV9A 3A4TA 3O8MA 2HK3A 5AQPA 1EIYB 1ZBFA 2XI3A 4FDFA 3UQ2A 1SWVA 2XSFA 2X6NA 1RWKB 2OHFA 1NZ8A 5HHHA 3D68A 3LM9A 4YOEA 2AX0A 2W40A 3RB3A 4DWIA 3KK1B 3ASMA 1WBDA 3NKYA 4Q8EA 4BACA 1WWHA 2J7WA 3IS9A 2MHEA 9ICBA 4NXNK 3D45A 4O3MA 3FFIA 2CJQA 4UB1A 1VBYA 1PC4A 2IBOA 2G0JA 2OPQB 2P6UA 4XDCA 5KFAA 1FNXH 4JOUA 2JH7A 2EXUA 3T41A 4RQ7A 2JRZA 1K8AT 3J80O 2LBOA 3KTQA 3BS7A 4DL7A 3NNHA 1VQ4N 5KFGA 2JH1A 4USUA 1CUKA 5D77A 5IC4B 3N0VA 5HL7Q 2PAVA 1HIYA 1R8HA 1I1GA 5GIOA 4DR5J 5KFIA 1BWFO 1X4FA 3CMES 2HFZA 5LOQA 1URNA 3HHNB 4PXDA 3KLHB 5B0EA 4RKUC 2KZZA 1MU2A 4CJUA 4CEOA 5J1EA 1Y88A 1LW2B 2IJNA 4X62F 4LFBJ 5F9LA 4WFZA 4KH4A 2LKZA 1O6XA 3S6JA 4OZ0A 2K2PA 1RADB 1QTMA 2EK1A 1XNRF 4IJNA 1CZBA 3EN9A 4J9RA 5DB6A 1RCOB 1PILA 1QHTA 2KTQA 4CF0A 3SUQA 5ITHA 4FF2A 2KZ3A 1OVYA 3ALRA 2XS7A 2AGQA 3ZDAA 4BX9C 3D6TB 1REVB 2JJ4D 3EZUA 2M9KA 4DUZF 1VBZA 1NK9A 4EAHD 1CS4B 2Z2ZA 4Y1DA 2I7PA 4I28A 5DLFA 4CH1A 2KJWA 4RBVA 5C10A 3SUPA 3HZGA 3M1VA 2JR5A 1N34J 5BRHA 4UB2A 3A8YA 4E1MA 1NOZA 3ZEUA 4M5HA 4QIEA 3DRRA 2R7WA 5GAHU 3TRGA 2MQLA 3TSUA 3QJLA 5I42A 3M2UA 2HMIB 4E19A 4U67L 1KP6A 2V63A 4FZMA 2HQDA 1XN9A 3ZSXA 4LF9K 4JI2K 1RILA 5B0FA 4A59A 3R27A 4IO1A 2BVZA 1JJHA 1UFWA 2NLWA 3AAQA 4BLGA 5A0YA 3DOKA 3EEQA 4IEEA 1BDGA 1YK9A 4KIAA 5JVHL 3I0SB 3QO9A 2K7JA 1VISA 3BBFA 3TSPA 4KN7A 5AI9A 1N88A 4KAZA 4A8EA 2C2KB 2RF2B 4FXDA 4FWNA 2EQYA 2HHPA 4H4KC 4A48A 2Z7JA 4R65A 1K47A 2JV3A 3FC9A 3LGHA 3JB9k 4BVPA 2XHCA 4IQUA 4CBUA 2OANA 5AKYA 3NRWA 3VMFB 4Y2XA 2GO7A 4LVSA 2FPKA 3DM2A 2QRRA 4OHYA 4ZVHA 5ETLA 3CRXA 3V81A 4CJTA 4RQ2A 4CP5A 4KHPJ 5HSPA 4ZJLA 3QNWB 5A2QO 1GQEA 4P52A 2ES6A 1I51B 3O80A 2E1MC 1VK0A 4BREA 1ZQIA 4OI3A 1SH0A 4LR7A 2HBMA 4A57A 4WQ5A 4K7QA 4X4QA 4UOCA 3CIMA 2HHUA 4F9OA 1PVQA 1ZC6A 3LOUA 4PHEA 1JJCB 4W92B 7ICKA 5HOOA 3TAQA 2E5LK 2G08A 1FRIA 3MGHA 2R7OA 5FLXU 2ASJA 3L09A 2VQFJ 3HKZD 3I28A 3T1AA 4QAGA 4PXBA 3C19A 3UR3C 1K8KB 1FFSB 2RQKA 3HKZC 1SUQB 4PZNA 1M5HA 2IM2A 3MMCA 2DCUB 1K5OA 3TYTA 1N5VA 3RGIA 2GZOA 2Q1NA 3HTVA 4EU0A 2HHVA 3KKSA 4FJHA 4RU9A 7ICIA 4NL5A 3MCMA 1T95A 4RW6B 2JEJA 1BQMA 4IH7A 3H0MB 3LH2S 4B17A 1XSPA 4LFAJ 2HDOA 1Q3VA 3CG7A 3H25A 3O4QA 1ZOLA 4RT3A 3NAHA 3G6EN 1S1UB 3O2IA 9ICQA 5AZIA 5JRTA 4M3ZA 2G2OA 3AD7C 1HLUA 2V8DA 4H54A 3PFOA 1ZQKA 1QQ5A 4EO6A 2QLBB 4B9NA 2O3DA 2EI5A 2Y0BB 5D4LA 5GVQA 2H3GX 3W66A 4X65F 1VSEA 1I5OB 4G6VB 2JRSA 4FYXB 3UKRB 2VFTA 5C25B 4RQNA 1SS6A 3H40A 2DHAA 5FROA 4DSLA 3KJFB 4UW9A 3LF0A 7ICRA 4YEAA 3UN3A 5KAIU 3FYHA 1UVJA 3V9ZA 3ET6A 1VJ5A 2ZD1A 4Y1CA 1ZQDA 2BCUA 5HMMA 1N33J 5KFBA 4NLNA 1HHSA 4YD2A 2AA4A 4BR7A 3ILIA 1LWEA 1TELA 4EFHA 3VF4A 4C9DA 1F5CA 4F3MA 2OZSA 3HSJA 1NJYA 2D3ZA 3SI6A 5FRNA 2VOPA 3RSEB 1Q9YA 3OW2M 3G6YA 4KQZA 4PWUA 3D2SA 3V7JA 1HIWA 2YX6A 4O3PA 3GYNA 2FZKB 2IC3A 3Q0AA 2V2QA 4FNHA 2CJKA 4G3IA 3QU4A 1XQSC 2Y9UA 2RDDA 4UBBA 4J9NA 2QW9A 3J7YU 2CJYB 3A8EA 5HVHA 1HWKA 4EWTA 4IR9A 1VSMA 2IM3A 4M45A 2IHNA 5KAKA 2WRMA 4Y2UA 2NO5A 1HPZB 3M05A 1ZM9A 4WTYA 3E1YA 4OL8A 3MM9A 4JI1K 3KNAA 1BCMA 2R8JA 3VEXA 1Q7LB 1KOHA 4O0NA 2GEMA 3LVVA 3N01A 2N7YA 4OJPA 3CO0P 1VMBA 3GL1A 3MN7A 4CFCA 1VQSA 1FD2A 4I2IA 2ZM6J 4WP8A 2AIRB 2OM6A 1MWMA 1VQ4S 2XMAA 3DU5A 2CWXA 3PCOB 1RT2B 1NPPA 3VEVA 4V19S 5AQTA 4JI0K 1TGOA 3C1YA 1VSHA 4E3SA 5ALJA 1HWJA 3RRHA 3GP9A 4Y2TA 5AI4A 4EI2A 5HL7L 2HKEA 3CW2C 5H1SQ 1XHZA 4BR9A 1Q7YT 3O3LA 2D4WA 1HR0F 3OT9A 3O08A 4Y2QA 3OXLA 1DT9A 4HUGA 1XWLA 3AB4B 2CGJA 2F1HA 1P1TA 3SXLA 5AQKA 4Y2JA 1JXBA 1Z4NA 2FGCA 3HX0A 3PO4A 7FDRA 1EP4B 4OFZA 3BN7A 2YKNA 1ITGA 4LF7J 3CCZA 3I1YA 3D28A 5F0UA 4QQBA 2PC6A 1OO0B 1GO3F 5HRNA 2RNEA 3OVAA 1F60B 3U4LA 4DMNA 7ICMA 3M30B 5HP1B 2HLUA 5GAHI 3KJVA 3F73A 1EX4A 2BA9A 1KLMB 2KXFA 1RM6C 1B22A 5F41A 2UUAJ 3MECB 4JI6K 2WVDA 5AM5A 1IBMF 3F5EA 2XI9A 3J81Y 3WEEB 3P39A 3DGPB 2F8MA 1ZTWA 4FWMA 1DGSA 4K8XA 1IJFB 3CJKB 5ALKA 4F4WA 4KH5A 1C0GA 2V67A 4RUCA 3P5BP 4X4PA 3IP0A 5KFKA 3NDKA 5C5JA 1IKVA 3NS1A 4X4VA 3DLHA 3WK4A 4W5TA 3CJ3A 2IDLA 3SZ2A 4AXIA 1RTDA 2LM4A 2I9GA 3I0RA 5JMVA 5DDMA 4R0EA 5HN0A 4ECSA 4ZVPB 2ZGYA 4HVZA 2A18A 4GVMA 1AUSL 1QQCA 5DQGA 3HKWA 1RKIA 1W2IA 3SMVA 4OPJA 2HPUA 2WTFA 1Y0HA 2R3VA 1U4BA 1HNXJ 4OZLA 4IG0A 2GS8A 1OPIA 1R0AA 2HHQA 4GFJA 3P4UB 2W2QP 4A8KA 3OVBA 5KFMA 4DV0F 2CUYA 4YR0A 2VOOA 2MZRA 4E2FB 1WSJA 3MXIA 3O3HA 4ZP9A 2KV2A 2WAQF 1GXLA 2GGPA 3PSIA 3Q2SC 5AK4A 4FWSA 1WSVA 4FKYA 1ITPA 1U1RA 4AILC 1ZD2P 5CYJA 2PDAA 2KP7A 5HHIA 5AJ3K 4CLYA 5EY4A 2H5XA 3TADA 2XQCA 3MDFA 4I2QA 5ALDA 3F9MA 4ISEA 1Q8KA 1A7GE 3WNFA 3MEDB 3DJCA 4I6WA 4Y2CA 3BQTA 1UMJA 4U8YA 3CMAS 4C4WA 3DHWC 2FLNA 2ZUCA 2VF3A 1OYDA 4OYXA 4YMEA 3AOCA 3EDRB 4Z4FA 2I6XA 1J5OA 3D67A 3QSIA 1HJPA 2GVZA 1ZQBA 2LA4A 5HRSA 2FJWA 1GTEA 1NMDA 3ZD9A 4DZ6A 4B9QA 1U47A 1TKXB 1WNEA 3BGUA 3DRSA 3H5UA 1R8CA 2AP1A 5HAOA 2LEAA 2EAOA 2KJ9A 3HVRA 3D0PA 3G6ES 3EY1A 1JKHB 3P83D 2RLTA 5J2MB 3G6XA 8ICCA 1DGKN 2MSTA 2FBVA 1FERA 1I3AA 1WKKA 5AKEA 3ZFVA 1B99A 2DNKA 4DTUA 2KT3A 4CGZA 3ZO7A 4ZLPA 4OI6A 1LQ9A 4TYAA 1MN7A 2E5JA 2GELA 4JB8B 1VSFA 3VQ7A 3IWXA 3AO3A 1TAQA 4ED8A 1B64A 2X3DA 2JZ5A 2HQGA 2IS3A 1X2IA 2Z56B 1AFJA 2O6KA 2DVIA 4DV1K 1S1VA 4TNOA 1NGFA 5BR8K 3VAGA 1J54A 4UAVA 4NLBA 4M8LA 4CF5A 2DGTA 1KONA 2P9IA 2XSJA 2D0OA 4IRKA 2Z57B 3SQGB 4EZ6A 8ICQA 5ETKA 4EUVA 4X64J 1UZHA 1XMOK 4EEYA 2IMWP 4JYAF 4OJOA 2UVRA 1RBLA 4JB3A 3HZEA 5DG9A 3H1QA 4CF4A 3J7YI 4FF1A 2J0XA 3DOMA 3SBGA 3P1GA 4F4YA 2QA4G 2B5JB 5H9FK 3NCIA 4QW8A 4HACB 1J5EK 5M1KA 4USHA 3ILJA 4I2JA 3OD2A 4BWMA 1IBLK 3JPTA 4UZCA 5AI0A 4U8VA 2KMDA 2OO4A 3JTOA 4AT1B 4UQTA 1TV6A 1UW9A 3CCWA 3TU5A 2W9CB 4YY3F 2IGIA 2HURA 4Z4IA 3FFKB 4NYZA 3N7PD 4OCZA 1X4GA 4B8AB 4DTMA 3CC4N 4JKFA 3MM6B 4JI4F 3ZETA 2JZBA 1NCLA 3CCSN 4JWNA 1Y00A 2QFIA 3TR8A 2XLJA 2ACYA 4QPXA 2KT2A 4FBTA 1HMVA 3FBEA 4LF8J 1FEHA 4NLOA 2KO1A 4PHTX 2XIDA 4LVNP 1HX1A 4USKA 1NPRA 5H1SV 5DDPC 2ZJRQ 5CB1A 2XC9A 2G9OA 4IRCA 2XVTA 3CFPA 1OVQA 4LIRA 4CEFA 3TAMA 1NI3A 3LW5C 3DV9A 4HCBA 4FM2A 2OKQA 1Q78A 3NH1A 3D6FB 2C2OB 3J7AN 4E1JA 3AH6A 1BNPA 3SBTA 3PM9A 2W6KA 2RUSA 1QE1B 2ASLA 2AEJA 1NBEB 5EWFA 4A47A 5BN8A 2DBYA 3G87A 1CLFA 2QI2A 2DR7A 5E26A 3RH4A 4GY2B 5IM0B 4MT1A 3R8EA 2W3SA 4JI3J 1SZ2A 2GIQA 4C8OA 2EK6A 3VQTA 4F3QA 2KG5A 1MG7A 4P7VA 1ZRNA 4DR6K 1T3OA 1HBNB 4PYAA 4AQYK 4QZCA 4LH5A 2NRRA 3MFIA 3GJSB 4OYZA 3H7IA 2ZIVA 2YX4A 4BGAA 1FNOA 2VPYB 4F0MA 3R6LB 4KGKA 5CE3A 2DFHA 4DL6A 4MFCA 3VVUA 4RW4A 5CWRA 2OAUA 2NO4A 2OEHA 1OY6A 3UE2A 2HBKA 2BW7A 2N4DA 2JLEA 2HRTA 1HNIB 3QJJA 3DFEA 1HKGA 1S72N 1KAYA 4PL1A 2BXJA 4Y0WA 3W3DA 3CCLS 1WI8A 2K60A 3VQAA 4KH6A 3THWB 4H4OA 2EFPA 4DV5F 5SZTA 3K8WA 2YWWA 4B3RF 3ILOA 5GAEI 4NO7A 3OV7A 3ZZUA 1MA7A 3PEHA 4QOTA 1RT3B 1VRTB 3AO2A 4X66F 4YN4A 3HT0A 2X1FA 2F1FA 4DR3J 4Z94A 4OKJA 2H5EA 3VC8A 3ZTQA 5J0TA 2HNYB 5TKWA 4KX5A 4CJPA 2C3MA 1S59A 3QNNA 1YF5L 2BE2A 4CHQA 3GV5B 3SUOA 1RBUA 2BPCA 3NBPB 2N3LA 3I5BA 3UFCX 3UKUA 3HPHA 1I3OB 4ZVUB 3CWJA 3SMZA 4W5OA 2V69A 4KR0B 2XEXA 5ADXA 4HHTA 2XCPA 3D6JA 3UD3P 1DKGD 1YJTA 3M7VA 3S7RA 1JLGB 4MN4C 1JLEB 3V7KA 4C7YA 3WQTA 1EQMA 1FIQA 2VG7B 2WOMA 4YDUC 3R2CJ 2VQEJ 4FF4A 2BUPA 4U7CA 1IUJA 1CJVB 3NG8A 1HUZA 3P45B 4TUPA 4DPOA 5ALNA 4XRHA 4KTWA 2G5HB 1LW0A 4ALZA 2W01A 3NVWA 3HVTA 2V4JB 4K4UA 5GMEA 3WDOA 3ZDEA 1VDHA 4HI2A 1BVSA 1SV5B 4AHTA 1C1AA 2CZ9A 4DJBA 2ZVSA 1FKOA 2W7AA 3QINA 3U7JA 3TQ1A 3DLJA 4DR7K 2KN4A 4URQU 4OV1A 4NXMF 3L6QA 5C0YA 1A5XA 3W1YC 4N8OA 3PIPQ 4DR4K 1BQNA 3PTWA 3DXMA 1C0MA 1C0TB 1VQLN 2R7UA 5EX0A 2B6AA 2I38A 3FGUA 4LQ9A 4AL5A 3JSMB 4YD1A 1IVZA 1FJGK 1RT5A 1YJWN 3OUYA 4KITB 2IVPA 1RK8A 4KH1B 1RYSA 2ZH8A 3NVMA 5E2QA 1IJEB 2VICA 3MZIA 4UUWA 2Q3PA 2ZFHA 2CRLA 1DTTA 2IIRA 3GFZA 4FJ5A 1RCXB 4U95A 4FZNA 2E5SA 4O5EA 4A2BA 1RBTA 5EDWA 1TL7A 4MFBB 1OH7A 2LQBA 5A76A 1LK7A 4MO4A 4BE2A 2E1PA 4ZITA 2EVZA 3VCBA 2V2VA 2NXUA 2GJIA 2QARB 2VANA 3K5LA 3UXNA 4WP3A 3AQPA 2Q0RA 2DXEA 1L7NA 2KL8A 2HVHA 3G86A 4P2MA 1G99A 3ZX0A 4NLZA 1FRMA 1TV9A 1RBRA 2B8PA 5KT7A 1FI4A 1XO0A 1IXRA 2WONB 3IG1A 1AQ6A 2E1EA 1QY7A 2EBEA 3CVKA 2QL7B 2ZGZA 4W5RA 4FJKA 3UR0A 1UPMB 5CYQA 4BRCA 1FA0A 1X4CA 1UVMA 3HSTB 2YMLA 5HANA 1RDDA 3A3OB 4JK1A 4Z6DA 1DK3A 1RWXB 3IA0A 4ZVQB 2HHWA 4IOAQ 4J2DA 5KG4A 3NEKA 4CLWA 1IG8A 4HTLA 3HULA 4FLTA 2KKHA 2Z58B 1HNWJ 4DU7A 3OTOK 2WHEA 3HSGA 4FM1A 5C42B 1FKPA 2ZITA 1KFDA 3OW2R 3D0GE 4Q2LA 1IV0A 3G25A 2K4PA 4BG8A 4CYUB 1Y5NB 4R5PA 3KLGB 1S1TA 1NK8A 5ALRA 3A5MC 4FLUA 2WAQD 3CC4S 2UUCK 2D8CA 1ZQOA 3U1MA 4USVA 1Q0NA 1HRHA 4YHHJ 3CCSS 2FJVA 1FDDA 5HATA 2AJQA 3GG1A 4EHTA 1V97A 4H03B 2M3DA 4KY3A 2A1JB 1LXNA 4EX6A 4R63A 3SQIA 3KLVA 4C4RA 3CGIA 4B1UB 2D0CA 1IKXA 3M9MB 2DO0A 4C7ZA 3E0FA 4KLQA 3OYNA 3QAEA 1NJXA 3GB0A 5T41A 2E2NA 4YOTA 1EJ7L 3EWAA 3AVAA 1WYGA 4ANDA 1WOSA 3T1HF 4CBXA 2ZJRL 5KAFU 1D8YA 3BGLA 2W55A 5ALXA 2NPIA 3QFUA 4BRDA 4F0KA 2K89A 3MN6A 3TEHB 4ACOA 1RWUA 2WF9A 4EYHB 1ZM2A 4OGEA 1SZHA 5L1LA 2IAJB 2VONA 3OYCA 3IMQJ 2CPEA 4RPFA 2WTUA 4K5SA 3TUPA 4HEA9 3L3UA 4KHWA 5T7LA 4AF1A 2P9PA 3I55N 1KOOA 2C3OA 2LYAA 1FHTA 1A76A 4ES2A 4X62K 1ZOTA 2HF4A 4FNIA 2KN7A 2HHHJ 3CM6A 2R7VA 4Y2KA 3FNNA 3D4JA 3IR6B 3GE1A 2I5JA 2P9SA 2PFFB 3A12A 9ICXA 2V0NA 1FT8A 2F9JA 1QAYA 3OLBA 4ED4A 3H1VX 2YNIB 2G8HA 2VYPA 2CNOB 1Z26A 2QXLA 5E41A 4KI6A 1AZSB 3BZCA 4B9MA 3EE8A 3C8YA 5KT4A 4EZ9A 1S72S 2A5XA 1I94J 4DUZK 4UAWA 2QWOA 4EHUA 1Z00A 3MAAB 3AAPA 1NZAA 2DNHA 5F3TA 3T6JA 3QZ8A 3M7DA 2ZZMA 4HCCA 2AHOB 3TTCA 4ZCMA 5AK3A 1WI6A 3CPEA 4KHNA 2PMZD 4G1IA 3VGTA 3R1LA 1JLFA 1ZQSA 3HPGA 1RWVB 2ZUAA 1HNXK 2EW9A 2R8HA 2PMZC 4WYWA 3VEZA 1VS3A 1MWYA 2OPSA 1V3SA 2CNLB 2BW2A 4EO8A 3MR5A 4C1NI 1TL5A 4HH0A 1Z3EB 3Q8YA 1F5BA 5A8RB 5TISU 3CJQA 4DV7F 2DTUA 2F9WA 3BDPA 3OL7A 1XO1A 2FHOB 1UQVA 1WC4A 3A8KA 1ZQXA 4B1XB 1D0EA 4LT6A 3H8SA 3PW0A 5JUMA 3J7ZO 3QRQA 5ALFA 4BRHA 2GJ2A 2NLXA 4K4VA 5D0EA 3IR5B 1XC3A 1E6VA 1ASWA 4KKOB 3D54A 5SUHA 4PG5A 3I56N 2KW4A 1RG6A 3HM9A 2A6AA 1Q81O 3TADC 4F26A 2J6SA 5KGXA 2G2ZA 3KUGA 2DUYA 2MQNA 4F71A 1WDTA 4ZVRB 2Y1LB 3QT5A 4MIAA 3B6OA 1NDPA 1IWGA 4BGDA 3ID6A 3RH6A 1ZQLA 2BRLA 4LF4F 4EYIB 4V19X 4MDAA 8RUCA 1HQ2A 1MWQA 1QAXA 4JUZA 1N5QA 2H54B 2CPZA 4ILRA 4IC9A 3ENHA 3IS9B 5J2DA 4LVOP 3FFIB 2RIJA 3OY9A 4BS2A 2G8UA 3WHIA 4DFKA 3DMJA 5AI8A 5I3PA 5J2NA 4I4BA 2JC1A 2ZH1A 2ISOA 1QVFM 1VQLS 3CO9A 5AQLA 2F4VJ 1PAEX 3U02A 3PIPL 2FVCA 1YJWS 3RG6A 4FO6A 5EX3A 2I6WA 4C3LA 5CA7A 5KPZA 1N4LA 3GFYA 3JQJA 4OX9F 1ZETA 1D09B 4K4ZA 3ZZ0A 1MU2B 3NXZA 5J1EB 1Z1BA 2XULA 3ENBA 4G9BA 1REGX 4ZPTR 2VA8A 1YZ7A 5DZ6A 2R9LA 1HJOA 5E33A 1C20A 3CQYA 5ALTA 1L8OA 1KD1O 3IDHA 4ILLA 2ZBPA 4DF4A 3MR6A 4CO4A 2ZJAA 3SJJA 3VQDA 2CQ0A 3QIOA 4X65K 2U2FA 2G13A 4F3OA 3AXMA 1TL1A 1HQUA 2HBQB 4JI5J 4ICAA 3QUQA 2UUTA 1NO8A 1SJQA 4DN9A 4ZVOB 5AM0A 2ZKTA 3M8ZA 5MLCQ 2NQPA 1PCAA 1ZQ1C 4J9PA 2FVSA 3OL9A 1ZXIA 2VJ5A 3NY0A 1SJRA 2MU2A 1C4CA 4CZMA 1ECWA 4B08A 4F72A 1OSDA 2AGOA 3C23A 3QU2A 3C65A 3W2VA 1ZBSA 1YBAA 3ZEUB 2LI6A 3TACB 3DRRB 2CDRB 4DCOB 4UARA 5AM2A 2E1RA 3FEYB 2YNFA 2UXDJ 5I42B 3M2UB 3G96A 4Y2MA 3KG4A 2MKSA 1HUOA 1NKEA 4FYVB 3LPUA 4ECZA 1Y3KA 1S4EA 1WG4A 1AFIA 5B0BA 1QSYA 2L08A 3SSQA 3RJEA 1FTCA 3VALA 2E1ZA 4OYPA 4LBPA 3RJKA 4IFVA 3EE9A 5A0YB 3DOKB 1SPBP 3GSDA 2J9DA 2D9OA 3N5BA 5GAHP 2BJ1A 3MPVA 3QO9B 2HBRB 3O9SA 4DTPA 1OXJA 3M2VA 3PMLA 5J0RA 3RMCA 3SCJE 5HQMA 3L2WA 1RTIA 4DX8H 2O01C 4DR2K 2AEFA 2UVWA 5DM7Q 4IR1A 2PY5A 3UDCA 5FD1A 3DM2B 3MMBA 3POTA 4X2BA 1M5VC 4NM2A 4DXLA 4WF9Q 5KFCA 1S9FA 2BYCA 3V81B 4O55A 2JVRA 3CCJN 2HRYA 4N76A 4KFBA 4DU3A 5CHCB 4ZVGA 5KG5A 4WWSA 3SFGA 2XMVA 2MY8A 3AVNA 2YHYA 3T19A 1ZQAA 3A0IX 5J0UA 4LUBA 2J4RA 1ZQCA 3AVLA 2BJ8A 2ASPA 4JKAA 4A61A 2R7RA 3ZC4A 4BRIA 3CM5A 2MSSA 2LYHA 2J8AA 1J97A 3CC7N 3N7RC 3E01A 5E3RA 4RUBA 2D7SA 5AT1B 4B3SJ 2ZHOA 4FZVA 3I55S 1S1WA 4FJJA 1RHJB 3MMCB 4HVJA 2K06A 4E1NA 1UFKA 3V9WA 1DEJA 1HR0K 5LT5A 3BREA 2NXCA 3C5FA 2LQ8A 5KG1A 2DIVA 3A0BU 4YORA 3C2KA 4LREA 1Q8LA 1UKUA 5HRRA 3VCDA 2WHOA 1BQMB 4JS5A 1O5JA 5JLFA 2DY1A 2ZNYA 1TE2A 4BGBA 4ID5A 3HBTA 2RDJA 3GONA 3TZXA 2P8IA 5EE9A 5AZIB 1NDLA 3J81U 3JPOA 3T9ZA 1RDWX 2Q43A 4ELTA 2YQEA 3WXKA 1V38A 4IH6A 4NASA 2KSOB 1XR7A 4ZP6A 1G4CA 1DARA 4WFYA 1LFWA 5C2FA 2IDOA 9ICKA 2KHDA 2JDJA 1XNRJ 4JD2A 4CIGA 1RQNA 3H2UB 1IR1A 5C24A 1NEEA 1IBMK 3CCQN 2X1AA 4LF6J 5BOMA 1V4TA 3MDQA 2VWBA 4US9A 4RWWA 5IWAJ 3ET6B 3EW9A 4F92B 3PEJA 1ZS6A 4OYWA 5CZ1A 3KDNA 2A3JA 3RBDA 2KI2A 4ATNA 2FBYA 3QGPA 1LWEB 1XR5A 4OHWA 2XNRA 3JPSA 4CM2A 8ICOA 3G8QA 1IG9A 3R8YA 2QLXA 3SFUA 2DL0A 2P9KA 3LQVA 3TOQA 5DMRA 2FHJA 3OTCA 2BCSA 2GQQA 2IC3B 3N6LA 4ID8A 1FRLA 1RZMA 3F5TA 4DV0K 3I56S 3L2UA 4XTTA 3DDIA 4V19J 4BDPA 1HUXA 4NLGA 1BGXT 3HILA 4RT2A 4ZN3A 4CF8A 3UDVA 4QZEA 4HHUA 4C8NA 4GVEA 3N97B 2NUHA 3O1BA 4UAUA 3CJ5A 1KC8O 4NV0A 3CB4A 2M9NA 1J6ZA 3CIZA 2ILYA 3WKAA 5KFQA 4LC9B 3CD5A 2IVNA 2CPFA 4ID1A 3J7YP 1XNQK 5FPNA 3MM9B 5IQQA 3HPOA 2YNHA 2HFUA 5B8HA 1S7IA 2FBTA 4Z4GA 1LV5A 3E9OA 4AL7A 1O8BA 4KLJA 2OPPA 4E7KA 3M32A 1L3SA 3MX2A 2VFVA 4WFBL 3V6KA 6FDRA 1KBUA 1M1GA 5CY4A 3V6HA 2CYYA 2QA4N 5M2UA 4CNQA 4QZHA 1LOUA 2LFVA 3KOOA 2NUUG 5DO2A 5J2EA 4CZLA 1N6QA 4OI4A 4DF8A 2FHKA 5IT9Y 1FDAA 1RA6A 2HOQA 1TYQA 1ZQJA 5F8JA 3GDQA 4IOBA 3OFHA 4A8FA 2QIFA 3P6YC 2ZG6A 4A5BA 4YCXA 3SI8A 2BKNA 3THVA 3LAKA 1N48A 3G0ZA 2AEMA 5KT3A 1RPLA 1RLDA 1F2HA 4GKJF 3AHPA 1NMNA 5IIMA 2XNQA 4YOWA 3EVMA 5MLCV 5AXLA 2DD8S 4CDIA 1M1KO 4P0QA 3THPA 1VSKA 3MPDA 1TUUA 2DNOA 4FP9A 2YKNB 3H8JA 3IBFB 2E7VA 2OMOA 4IL6U 5BOLA 4WYBA 1PK1A 5ALQA 2RQMA 3IR7B 3CNHA 4FL9A 4PL7A 4K4IA 5CABA 3RBEA 4DL4A 1PSDA 4WE1A 1OS5A 8ICJA 1RTHA 3KJVB 2GMJA 1N36F 4CF3A 4BC4A 1RAOA 5FRMA 5HI7A 1ZQZA 5LMNJ 4KPYA 2E5IA 2ISPA 5D0HA 1GLJO 3C1ZA 4RPXA 2UUBJ 5DETA 3H08A 5DDQC 1JALA 2KDOA 1IN0A 4YMOA 3D3BJ 4NLKA 4MDBA 2CADA 2B43A 4JYAK 3CCVN 3VESA 2BJ7A 1IKVB 2XB2D 4B3TF 2JH3A 2MEWA 2DXDA 9ATCB 1X60A 1BIUA 1RTDB 3KFUF 3I0RB 3TARA 2CQBA 2LDIA 2W9MA 2NXEA 2BTFA 3O5BA 3HRGA 2KKVA 2Y1RI 2YMQA 1TAMA 3BO2A 3WKCA 4UB5A 4IG0B 1VLBA 3ISZA 1VSDA 3R9PA 2CQHA 4WU3A 2ZJPQ 1R0AB 3OTBA 5IIJA 2ZH5A 4NWBA 2Q66A 4YY3K 3L9ZA 3VENA 4PXCA 2CJAA 4BXOA 1C1BA 4H0VB 1T9WA 3MWPA 2BJEA 2ZIWA 3ZZOA 5GAEP 4ZJOA 1CPZA 2MUTA 4JI4K 1NSPA 2GGPB 3CCJS 4E7LA 1E6YA 4HL9A 5J0OA 3EGWB 4DR1J 3AQFA 1HJRA 4OYAA 1WUDA 4QPTA 2KQ2A 1RZTA 2Q1LA 2GNKA 3AY0A 3JS9A 8ICIA 4I2QB 4EP5A 2IOCA 3GFHA 4FJ8A 2IRXA 4HWIA 3AGRA 4IJAA 3MFHA 4BC7A 3HHDA 3BSOA 1G3OA 1VI7A 2P6SA 3OBWA 1ZAXA 3T5JA 4P71A 2EPIA 4DS4A 1R8AA 2VH7A 2QA2A 1F21A 1BA0A 1X4HA 1S3XA 2J8SA 2M2BA 2DPNA 1LNQA 2YV0X 1F3VA 3CC7S 3QWPA 2YHAA 3NF6A 5I4MA 1J5OB 3RF9A 2L9NA 4YNQA 2GVZB 4CLTA 4ER8A 2MKIA 2AYGA 4WFAQ 4CERA 4KE5A 4J9LA 1T02A 5LY3A 4I0WA 2KJ8A 1WSRA 2GHVC 4NLQA 3W5ZA 3KBBA 5J1PA 1WWVA 4CLUA 1S97A 4NLDA 3DRSB 1P9YA 1NDKA 2KK0A 2Z1IA 1PVPA 2ZH7A 3TZWA 1I94K 4U6PA 4DFMA 1VCTA 4J5OA 2L3MA 3QT7A 2PFDA 1ZQWA 4OO1J 4I2PA 4DV4F 2JXJA 3P5JA 2E29A 1XMQK 4CNZA 3G71N 4FJ7A 5ALHA 3OR2A 3SDEA 1A6LA 3PJ9A 4CNYA 2D69A 3OYFA 3JSBA 1NGGA 2UXBJ 5JS2A 1Z4UA 3QEXA 4RQMA 5HR6A 2QSWA 4ED3A 3R5BA 2QKKA 1KL9A 2GMLA 1S1VB 2RE1A 3CCQS 2FDRA 1ZM4A 1ZQMA 1WTFA 3R5AA 1WLJA 4DV5K 1Y5IB 4B3RK 1CG2A 3LDAA 1BOTO 2DGWA 5CD4H 1VSJA 2KICA 2P9IB 4R66A 1M1HA 4A5AA 4ECWA 3FR0A 4X66K 3A5LC 3UNYA 4PABA 1NJIT 2MQ8A 2AD9A 2NYVA 4B1ZA 2DB1A 2ZZNA 2Z1HA 3OTEA 1MMDA 4NL9A 3UMBA 2CA9A 4PY5A 2WVBA 4UB8U 2I2YA 3TA1A 3DOMB 4CK1A 1XERA 3F0NA 3D7EO 1HEKA 1HYVA 4AH9A 3UIQA 2HYIB 4CFBA 3EZWA 3OYGA 3IHQB 5DG7A 4RU2A 1JX4A 1V9PA 3CSKA 3SCKE 5DS7A 2CFXA 4Q8FA 1SV4A 1UZDA 3RMDA 2YPZA 2I7NA 5EE3A 4ZDNA 8ICSA 4PPXA 1TV6B 4PL8A 4IG3B 3W8GA 1VQPN 1KN6A 3FKBA 2KVSA 1BXNA 1SJ4P 2HSEB 3ENQA 1X5SA 3R5JB 3WZ0A 1KNZA 1P8ZA 4IFEA 2KNJA 5ETVA 3ZETB 2JZBB 3H46O 4CJFA 4MK8A 3R7SB 3MN9A 4XQ8A 1OPZA 1MW7A 1HMVB 2HNDA 3W0LA 3TTDA 4QZAA 2M8DB 3MC1A 5KPTA 4FWQA 3QUCA 2OH2A 4NXMK 2HRUA 1RXOB 2QA4S 1X3NA 2IOFK 3TAMB 3OHAA 3KWGA 4CZKA 1VK3A 4CGIA 2EFOA 2P5OA 7ICEA 4I2DA 4Y34A 3AVFA 3U1NA 3SSSA 2YHXA 2CDQA 3DOLA 3H59A 4DLEA 3VGUA 3V9SA 3U1LA 4UZBA 2ASOA 5ETPA 1G6BA 2HVDA 1QVFR 2PFOA 4KO0A 4I2FA 5D0RA 2BJDA 3TA2A 3ILLA 2AT1B 3BZKA 4QWBA 1ZA2B 3UD5A 3HOSA 4DL5A 8ICHA 3T1YF 4PHPA 3RJJA 5ELZA 1NJWA 2C3YA 2JOQA 5LL6d 4OIXA 4J2EA 5J2GA 3MPYA 4HAIA 2V8GA 4YOVA 4CH7A 5KFEA 4ZA1A 4I67A 2F2AB 5IOLA 1ZH5A 1K73T 2E8MA 3KZXA 2ZIVB 4HHJA 5LSLA 2MLXA 2CXEA 5D6GA 1QJHA 1WSHA 1KQSM 4A8YA 1RAAB 4BC5A 5JVGQ 5J2JA 1LEOA 2H9ZA 3T7ZA 4RW4B 4MAKA 3MWTA 2DEIA 3UVJA 1DAXA 4K59A 3JTNA 1M90O 5LXRA 3O3GA 1EKEA 2DHGA 4CF9A 1PUZA 3VAIA 4H4OB 5SWMA 1YVUA 4RUAA 3MGIA 4ZLNA 2J7UA 1NGJA 4KHUA 3CCVS 4M3UA 3BQ7A 3KIOA 2LQ9A 4MKYA 2EAPA 1J53A 4RNNA 3I76A 2LXIA 4RZRA 1YITN 5KT6A 5IZHA 3VA0A 3V6JA 3AEVA 1U7LA 3Q86A 2QKBA 2BE2B 3AVHA 2E66A 3WX4A 2ZJ8A 5J2KA 5HBMA 4F5OA 4NA2A 4MKAA 4C8YA 1YZ6A 1FJEB 1NK5A 3RUBL 4H5RA 4FK2A 2BGWA 2KKPA 2LEBA 2KM8C 4M41A 1L7OA 4M95A 1RUSA 3S9HA 4M9HA 3LP1A 2VIXA 4CECA 2FE9A 4UTGA 2VDHA 2LXFA 1Y9OA 4EEKA 2W8KA 2H5IB 2OMLA 4NWIA 3W5YA 2WOMB 2Q79A 4ENOA 1N5YB 5EXWA 2UXCJ 4B6JA 4CGGA 3THTA 4P4MA 5M1NA 4I2EA 3K1RB 3QSYB 4DV3F 3HVTB 2PD1A 3C0BA 4ICLA 1RYRA 4N41A 4M04A 3M6UA 2ZJQQ 3AVGA 2H4YB 1PBAA 1FKOB 2YY6A 1PVRA 4PPZA 3T1HK 4BY9C 1H2VZ 2C22A 1N61A 1EB0A 2DNPA 1VHXA 1IBKJ 1E4GT 4G1QA 4K0KJ 1Q8IA 2PGCA 5AKHA 1O13A 2FJ6A 1X9MA 1BPZA 2HGNA 3QGHA 1BQNB 4HR2A 3DXMB 3QNMA 1WOQA 4CGFA 2F9DA 5BRDA 4FLWA 2B6AB 3FZ2A 4P7TA 4UF4A 1V9OA 2OYQA 1MN9A 3ZTPA 2KH9A 1S6QA 5KFLA 1DLOA 1RT5B 3OUYB 4FSVA 4WFAL 4CI0B 3QERA 2QG9B 2E7XA 5E3PA 3HM8A 3ZSYA 3T9NA 4B3MF 3JAMU 4DV6F 4PWDA 1SXLA 1T9YA 1QLNA 3BGRA 2RQCA 2UYTA 3FSXA 1TL7B 1B0PA 3G71S 1Z19A 2RRDA 3KLFA 2XLKA 5JICA 4KRFA 2B9WA 2W1BA 2DQNB 2RHQB 5IWAK 5LSOA 4IUFA 3M6XA 3THXA 4A8XA 4ZTFA 3E66A 2E8PA 4RWXA 3H0RB 3M8WA 4EFAC 1GAOA 3NS5A 4NCGA 2EZYA 4JI7J 2ZXIA 1QZ6A 2HZCA 2BM0A 5AKLA 3IG1B 1KAXA 2VC1A 4CF1A 5LM7E 1EXNA 4NLRA 1R3NA 3HP9A 1WHYA 1SB6A 2FHJD 4YN3B 1JQGA 3JPQA 2RUGA 2VL1A 4WK1A 3CTRA 1HD0A 5CYQB 3CJAA 2QTDA 1N60A 3CETA 5B08A 4MFFA 2C1EB 4CD1A 4AE5A 3LALA 1A5VA 1NPKA 3DLLL 1KS2A 4C3MA 4DV7K 5EUHA 4CBWA 3PW5A 3JTPA 2D74B 2NRVA 5A6PA 4JV5J 3BQ0A 1S12A 1HBOA 3U9DA 1S9EA 5KFOA 2F8KA 2IYIA 1S0OA 3M1YA 2WVEA 3V1QA 1FKPB 1SIZA 2N1RA 1S6OA 3GR1A 2ALZA 4Q2MA 4PKIA 4F4KA 2AMCB 2GC8A 2OA8A 1MNEA 1VRUA 3DGVA 2D0AA 2ZUBA 1RBAA 3FLCO 5AM3A 2NYHA 4OX6A 4R5PB 2E2PA 1JL1A 1S1TB 1FJ7A 1MQ3A 1VQPS 1X1PA 5ETOA 3PRDA 3N4QA 4LRCA 2X78A 5DKWA 3RYLA 2E5GA 3FUYA 3NLCA 2DWQA 4LF4K 4GMKA 1U2FA 1BE4A 2PMWA 1HBUA 1QAJA 4I6AA 4NY8A 1CQMA 5BPNA 3ZT0A 1OH5A 1S79A 3DDHA 2B0GA 2BCVA 1VDVA 5AQXA 3TA0A 3R9KA 2PYLA 3S3OA 1IKXB 1Q5VA 3OFGA 3VAJA 2B3TB 1P27B 2XZDB 4FZXC 1X9WA 3WK8A 1RBSA 4NYPA 1WC6A 3QUTA 2CGKA 2E9ZA 4CEBA 2FJEB 4O3QA 3CQ8A 3LPYA 3AVMA 2E6LA 5AQSA 4CJ7A 2HIYA 2DKZA 1TK8A 4BRFA 4OX9K 2QXFA 2QX0A 3KJQB 5D49A 4Y2YA 4DR5F 4P74A 5T7LB 1HI1A 4MO5A 2P9PB 3ULDA 2VBZA 4PZOA 3W63A 2GQCA 2DH9A 4DSIA 2B56A 3C14A 2C2DA 3HKZF 3CC2N 2QYGA 1U1PA 4LFBF 2I5JB 2LP4A 1VQKN 2P9SB 3ONNA 5J2FA 1DRGA 2XGPA 4LFCJ 1CC7A 2HOFA 2JX2A 5J2HA 1FXLA 2JEFA 2W25A 4FJNA 2MB0B 5DK5A 3BSCA 4V1Ak 3QNOA 4ZPDA 5JVGL 1FE0A 1CJKA 3LDQA 1XI1A 2HVZA 1Z00B 1X4BA 3TW0A 2DGZA 2VZ9A 4CZHA 1WC5A 1TK5A 3C3LA 1J2VA 5LMUJ 1XHXA 3EZ5A 1SQGA 3ZX3A 4F25A 3CQXA 4KHYA 2ATLA 4CHZA 4KB1A 1JLFB 1N34F 1YJUA 3LAMA 2WFAA 4NLVA 1C2PA 3ZLJA 2QMXA 1NK7A 4N56A 2RRBA 3PIOQ 1YHQN 3CNQP 3NGRA 3IP4B 3SV3A 2OPSB 2DHXA 2M8HA 4O0IA 4O9MA 4CESA 2F44A 4PCQA 3BS9A 1TAUA 7ICHA 3A3NB 4FWOA 3GFKB 2DGSA 4PG6A 1O03A 1E6VB 3OHRA 5AQUA 4X4UA 4CJ3A 3GQCA 1KQGB 4IKFA 5HROA 2Z4PA 2B51A 3O44A 4HKQA 8ICFA 3PJXA 1ZQFA 3EMTA 3MPUB 3QXGA 1JLCA 2O1PA 1VQMN 1KHVA 1ZD4A 3M3ZA 1NH7A 2DNQA 5JVHQ 1RKJA 4XPCA 3GWCA 3UM9A 2XY6A 3AMZA 4M0AA 9ICJA 1T03A 5DDYA 3C7NA 3KKFA 3T79A 2G0AA 4KHPF 5E0OA 1ZD5A 2LM1A 4M42A 2DCLA 4ECXA 1S49A 4FWPA 3JPRA 2BEFA 1HQEA 2KFNA 4QYZK 2ZJQL 1L3UA 3DRYA 2FC8A 4Z4EA 3DMJB 1IWAA 2OEKA 3AB2B 3AA9A 2LVWA 3E9PA 4DOBA 5J2NB 1X8DA 2K3IA 2DO4A 2AWZA 8ICAA 1JJ2M 2ZWOA 3QGGA 4DMZA 2J6TA 1U09A 4AM6A 4PUOA 2VQFF 1B0XA 2CN1A 2NZTA 5AKIA 3EDQB 4Q0BA 5HMZA 2AW0A 3K89A 1Z25A 2C42A 3UDLA 3H7HB 3GBTA 2P9NA 3IWLA 3EUB2 2GO9A 2W4DA 4RCHA 1GLLO 3FCVA 4RO0A 3HX9A 1SIJA 2RPIA 2Z8QA 3BEGB 3D2QA 1FWLA 1WC3A 5IV4A 3BH6B 2M5YA 4TLRA 3K17A 2E6MA 1WHWA 2UV8G 1Y97A 4I68A 1XS9D 4NA1A 3TJAA 4J2AA 4KMOB 5F8IA 1JCFA 5ALSA 3KLEA 3BF4A 2V50A 2VG6A 8AT1B 4URGA 2XY8A 4XDDA 2RT3A 1TL1B 5IIKA 1HQUB 4X4OA 4CT9A 3K5MA 4NLCA 4DUYJ 4PQAA 1LB2B 4ZPCA 4JKHA 4MEXA 4FLXA 4DSKA 1F6TA 2CG8A 2B9XA 1R6VA 2BR0A 4HTIA 3N6NA 1UVIA 4MFAA 2N82B 2DR8A 5HMLA 1YTUA 3HSZA 2G8WA 3V4IA 2HF3A 4NL9C 3EPGA 4GKKJ 1PIEA 4CZIA 3W2VB 1DQ9A 3E9LA 1N33F 3FBBA 1QHAA 2NXNA 5E84A 3BB5A 3PY8A 2YNFB 3GJRB 3DRXA 3MMAA 4ELVA 1N0UA 2HNZA 1V5IB 1RLCL 2XM3A 3KD1E 2PYJA 3C46A 3WT0A 4CJLA 3WQPA 5FLXO 1JK9B 5D78A 3L4BC 3I4PA 3MUMP 3R7NB 4IFVB 2QWRA 3A8IA 5AQRA 2H1YA 1JJ4A 4OLAA 4Y0FA 3FAHA 2ZJ5A 5H9EK 2MKYA 2KHCA 3M2VB 1ZD3A 2FJXA 3UB5A 2E9RX 1RTIB 1OWXA 1ESVA 3I9ZA 3OTOF 2AYEA 2K3KA 2JLFA 2KM8B 5FPEA 3MMBB 3POTB 4UY8O 4KGXB 3I82A 4KYZA 3VF2A 1FJCA 2FVQA 4MF2A 3O8WA 4ZOSA 4CFAA 2XYPB 3WXIA 4KFBB 4LH4A 4FK0A 2MHNA 2FZGB 3IUCA 4WFNL 3EWGA 5HR7A 2LPEA 3EUNA 2HB5A 1KFTA 1UAWA 3D7SB 4FJXA 3KMQA 2UUCF 1RAGB 3AO4A 4LF2A 4P2SA 4OJ3A 4ZK7M 4BRPA 4WCEL 1HNZJ 4OI0A 5FPDA 3AA8A 2ZM6F 3ZZZA 3AO5A 1SVDA 3EX7B 3H8WA 1YXQA 1A6SA 1H1VA 2QWMA 3W5XA 1RCHA 1PG5B 4ILJA 3KD5E 3E01B 4K4WA 2J0WA 3U26A 2R42A 1N56A 1Y10A 2YCHA 4I2GA 4Z7YA 1S1WB 5HQ8A 1OY8A 2FPMA 4DX5A 2ITGA 7ICNA 1SJFA 2KJVA 4GKJK 3M6WA 2RVJA 3NVVA 4TSXA 3TAFA 1NZBA 3D66A 3SNNA 3CC2S 5K14A 4FVCA 3IAS9 4FZLA 4DB3A 1VQKS 4ZCIA 3K1ZA 2G0CA 4F5RA 4B9TA 4ID5B 2UU9K 3PKMA 1GXUA 1RAFB 4CQ1A 4WFXA 1U0SA 2Y3YA 2NRXA 2AQ4A 4R8UA 2BZFA 4LF7F 4TXSA 3P38A 4J03A 1BY9A 4AUKA 2DRBA 1ZTTA 2P9LA 1TVRA 4ISGA 2YHBA 4FOEA 2QWPA 3TAEA 1N36K 3MBYA 3HFKA 2MGZA 1KQSR 4JD2B 1UFLA 1FRXA 4E0DA 4JP8A 1VIXA 3FEZA 1P1LA 3NF9A 4H4MA 3AFGA 5C24B 1FDNA 2VASA 4WYLA 3C15A 9ICOA 4TUSA 2CVIA 2A41A 2UUAF 2XRIA 1NXIA 1HA1A 3AOBA 3PVXA 3K75D 1YHQS 1UT5A 1XNSA 3X3UA 1NU0A 4B3TK 3BYRA 3GV8B 3AM9A 2YBVA 1KW4A 3PIOL 1T3NA 4OJLA 4RPYA 4DQRA 2EH9A 2HW3A 1T44A 1SH3A 2W54A 1WD6A 4PKHA 2P9KB 5KG7A 4CWBA 3NNAA 1EAYC 7ICJA 3WNGA 3Q8VA 5HVGA 3AUOA 3V6DA 2W3RA 1RSCA 2HEKA 5L1JA 4M5KA 2HQFA 2BABA 1YDLA 1HNXF 1BL3A 3AVCA 5J0WA 3SUNA 3GV7B 4WKYA 1VQMS 4CEZA 2KJ5A 3NAIA 4FLYA 4LIWA 4RW7A 1A5WA 4AHCA 2ETJA 4QZ8A 4DSJA 3MOJB 4ED0A 4BR4A 3QJPA 4YR2A 3GILA 1SAZA 4Q44A 3OS0A 3HOTA 2AF6A 2CIMA 1OY9A 2ROEA 2Q0UA 3VF6A 1U1NA 4ZCLA 2YNHB 3U9ZA 3WXJA 1FCAA 5A8KA 3Q83A 2ZH4A 2DR6A 4I6MA 2OPPB 4KBIA 4AFFA 3M32B 4KTZA 4O5KA 3S01A 1S8OA 3FZLA 1WJ9A 1KXPA 2YH0A 2MZQA 4IS7A 2P9CA 3ATVA 5CD4A 1T3VA 4RQ5A 4X84A 1N6QB 4KT0C 3DXKA 4YDUA 2VA2A 1TYQB 3HDSA 3B0XA 3MR7A 2QK9A 2O4IA 3Q8MA 4EIAA 4H0OA 1K1QA 1NDCA 3M8PA 3D2NA 3PYFA 1VBXA 4QZIA 4RL1A 1WC1A 3LPEA 2ZXHA 2VD3A 4DO9A 4CLFA 3FRYA 2D9PA 2AU0A 3SIPB 3CMAN 1L5UA 2XBPA 2BZ2A 1CRXA 2VB6A 4P0QB 2PBDA 2QO3A 4DV4K 4K2JA 4ZS6A 2ZOGA 2OD4A 2OI2A 1NSQA 3OGUA 1PK1B 1VQ9N 3EGVA 1NGHA 1YX2A 4C0OC 3THYA 4LRFA 2ACMA 3NWRA 1M0SA 1RTJA 4WE1B 3CCEN 2GJFA 3PW7A 1RTHB 3C21A 1MLAA 4ANCA 3H4BA 4PXEA 4AHRA 2FTRA 2P35A 3B78A 3EICA 3L5KA 3BR9A 7ICUA 2E2OA 3U8XA 4KJIA 3PRBA 3KMSA 4LF5J 4JI8K 3LZJA 1BLUA 1F9HA 4ES1A 4IXCA 4I64A 1AB8A 1RGIA 4X64F 2BOPA 3NMRA 1U8SA 8ICZA 4D3GA 4K5RA 1JWWA 5G5GA 3D6RA 3WXMB 3HHKA 3NMUA 1RHUB 4LSLA 3L95X 2DY9A 3LZIA 4A8QA 4N7TA 3TZYA 5AQIA 1KQKA 2VODA 3CD0A 1JB0C 3K9KA 1UVNA 5AXNA 5ALUA 3I5CA 4JK8A 1TMMA 3C16A 3DYAA 2W4PA 4U7UD 3BZQA 2NRWA 1QVGM 3W2WA 5KG2A 1MWZA 3CD7A 4EX7A 4BXOB 1C1BB 2MYFA 2ZIWB 2MUTB 1UL3A 3EE3A 4IKAA 4BCAA 2V6AA 1N32K 1E6YB 5HJYA 4DV2J 4ZOHC 3C6AA 3K5OA 5CEHA 4ISFA 3IBWA 2R2SA 5DG8A 3J80Y 3AAWB 3Q22A 4USTA 2DTJA 3KYLA 1U9LA 4LF8F 3H3OB 4YG2A 2HBYB 3M8YA 5RUBA 1YRXA 4QZBA 3PSTA 2F65A 2HZAA 2YWGA 4LJXA 2CQ1A 1GT8A 4NLUA 1FTRA 1Z2LA 4DR2F 3MDAA 3C94A 3I33A 3AA2A 5KQ8A 3DLEB 3VEWA 4FVMA 1Y64A 1K9MO 1RWWB 3WK7A 3CCRN 3JXOA 3AA5X 4OJHA 4Y28C 3AVKA 3DRPA 3TPQA 2E44A 4M6WA 2WBMA 2KXNB 4OJ5A 3CJTA 1HKCA 1P8GA 4OLPA 3DNCA 1U6BA 1X5PA 3R3TA 4UQGA 4DTRA 4OKKA 1D8LA 3AJ1A 1YJRA 5C2GA 2ZIXA 3T1YK 3W65A 2LQJA 3H45C 2FF3B 5IQ6A 4L3QA 5J2PA 3RMBA 3OVNA 3ZZTA 4JI3F 3GU3A 4NXNJ 3V2UC 1R89A 3MMVA 3NGKA 5HMYA 3LDLA 3G2XA 1C0UA 2HLTA 2ZBQA 1SB3C 2E8AA 5ALWA 4CJSA 4I2PB 3DC2A 4NPOA 1H3DA 2E88A 3D6HB 4IQMA 3OR2B 3SDEB 3NGYA 5EN1A 2W03A 2H3ZA 2JFKA 2XMJA 5KFUA 3HI0A 4S0MA 5A0LA 2DISA 3QU5A 3KD3A 2ZH9A 2XWYA 4QR2A 3GJTB 5T7BA 2CQ4A 5KG0A 3ISBA 5DZ7A 3K5NA 1XIQA 3N4PA 2AZ1A 3SEIA 1MC8A 4G9ZA 5HQLA 3KJNB 1SIWB 4C0HA 2NZ4A 5KQDA 4RUHA 3KXDA 5KL1B 2BQRA 2JGUA 1LKYA 5LJVA 3GIMA 1KR4A 5M1OA 3KHRA 4DR3F 2P51A 4GW6A 1ZQRA 3Q8QB 1FWKA 1KCFA 2DITA 1BD6A 3CCLN 4PA1A 1V3ZA 2NR0A 1QM9A 3V72A 1N8RO 5AKGA 5DLGA 4QJFB 2NNWA 3W7BA 4H8KA 5GAGU 3VGVA 3V1RA 1RDBA 4ES3A 2HQIA 3QDKA 5A2QY 1QTNB 3C2MA 1JIHA 5M2PA 2QB1A 2DH8A 3H4DA 3C6UA 5K8OA 5GAEU 2FUG9 4CIFA 2VC0A 4L73A 1FX2A 2X3GA 2V8VA 2BANA 2VQEF 3WQUA 5EOZA 4DV3K 1S9GA 4PHAA 3WIVA 3OVSA 2WF7A 3Q24A 4Y2SA 3RJGA 3US5A 5GADI 2IVOA 2PMHA 4LF9J 3CE8A 2F7VA 4JI2J 5AQZA 2VJUA 1KFSA 2HNDB 2QT7A 2OWOA 4PR6A 3LDPA 4ZPVR 2HFNA 1FKAF 5CCLA 2ZH6A 1VAZA 3M6KA 3L2QA 2WSCC 4OZ5A 2W8LA 4CRJA 1FX4A 1B7YB 3DDNA 2BKPA 2VDIA 2CXYA 2O8FA 3CDBA 4J9OA 3FRZA 3CUNA 3DXSX 3S6EA 4UW2A 3VQ9A 5B5EU 3H0PA 1S22A 2A3ZA 1RAEB 1DTQA 1RA7A 3CP8A 4Y2PA 3DOLB 3F41A 1XNQF 4FO0A 4WJ3B 3CEDA 3IGNA 1CC8A 1ZQQA 2QZ8A 3JPPA 3FZBA 4I2BA 1PJ6A 4KO0B 4ZJQA 3PX0A 1R8BA 4E7HA 2HBZB 4B3MK 4DV6K 2OXOA 2N4CA 4UUXA 2I1QA 4P10A 2YXLA 1Q82O 3VAFA 1Q3UA 2IYGA 2AGPA 2I8EA 5KFJA 5JU5A 2RS2A 4M9NA 4QBUA 2QLFB 4C11A 3I6PA 4QZGA 2EZZA 2HI0A 1VQ9S 4YUDA 1UVLA 2E5LJ 2QMUB 3PR4A 1MA9B 4FK4A 3IRUA 3BS5A 4JV1A 1N62A 3CCES 1SQEA 3PACA 2PA8D 1KKHA 5AQOA 3UVJB 3L0QA 2H3FA 2CH5A 3SSRA 1JN3A 1OKJA 1OIAA 3ZT2A 3ZXWA 1CLQA 2MY7A 1XMBA 5AI5A 1SKUB 2YQ0A 2ZVIA 4YDXA 4DLGA 4CCHA 1TKZA 2ADCA 4FW2A 4QOZB 4BRNA 1OQ3A 1ILYA 7AT1B 3IDWA 4QW9A 3QIPA 2CQDA 4RW9B 1U45A 2BE7D 1ZQYA 3Q8LA 4KHQA 1P90A 1WKLA 2W2MP 4DCPB 2D0BA