1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
2FBXA 2W9BA 1J54A 2FMPA 2I9GA 1X2IA 4NCGA 3KJVA 1JL1A 3VQ6A 1UA1A 1BPEA 5KG0A 4IR1A 2Z1GA 3I0RA 3NCIA 1FK9A 4CEOA 1LWFA 1ZQQA 4KV8A 7ICOA 7ICMA 3NE6A 3RR7A 3TQ1A 3TAPA 4F93B 5KFBA 1ZQIA 3MEGA 3P83D 1NOYA 4Z4CA 2RF2A 1ZQBA 4FS2A 2IS3A 5J2QA 3H8JA 1JXEA 4F4YA 4KKOA 3NF9A 2P1JA 3H4DA 3V7JA 4B08A 3H8WA 3AA3A 2FMSA 1BQMA 2ISOA 4TQSA 4FJIA 4M6WA 3QEIA 4FJMA 3GFKB 1BCOA 1RYSA 1ZETA 2PFNA 3LZIA 5I3UA 1NK7A 1ASVA 1T4GA 1U49A 3V81A 3SV4A 3UXOA 3SI6A 1KFDA 1NK0A 9ICXA 4JV2A 5C25A 3KLGA 5J2FA 5J1EA 4UB2A 2D5RA 3C23A 3ZT3A 4CGJA 1AROP 4QZIA 5L1LA 4FLZA 3HPGA 1R0AA 4KTZA 3NDKA 4CEDA 4FJLA 5J0WA 4F3TA 1KFSA 3AO2A 1RILA 4UBCA 4YFKA 4DFKA 4KTWA 4UB3A 3SZ2A 4M9HA 5DG9A 1ZQMA 5DLFA 4Z4IA 2A1JA 4IG3A 3QLHA 1TL1A 1NJWA 2H5XA 2FMQA 3V4IA 4KI6A 1L3SA 1Z25A 2BDPA 2BPGA 3KLIA 1Z00A 2Y1JA 1EX4A 4F8RA 2W9BB 4J9SA 4NXZA 4KLTA 4RW8A 4KLUA 3H4BA 5JS1A 3QEXA 2DTUA 4DLGA 2NRVA 3V6JA 2QKBA 5JUMA 3HP6A 5L1KA 1HJRA 5FROA 1ZQYA 5DB7A 5J2HA 2FLPA 3K75D 4KLEA 4GXIA 3ISDA 5DG8A 4EYIB 4O3NA 1BISA 5CP2A 3TFRA 4HVJA 4KI4A 4NY8A 7ICLA 4CFBA 1ZQVA 4NLGA 2HVIA 2BGGA 4OGEA 3ZT4A 2YNGA 3DLHA 1T05A 2JGUA 5DG7A 4O0JA 3NGIA 3NGDA 2F1HA 1LWCA 1HUOA 1ZBIA 3QEWA 3MR6A 3QNOA 3L8BA 4XQ8A 3JPPA 4ELUA 1ZQPA 2FC0A 3VA0A 2G8FA 3OJUA 5CZ1A 4OGCA 3SPYA 7ICJA 4F50A 4KLIA 9ICUA 2D0BA 2QKKA 4J9QA 1D9DA 3MXMA 2B21A 3M8SA 4NYNA 2Y1IA 3DRSA 3ISNC 4J9PA 1TKTA 1ASWA 2Z1HA 4I2AA 5KFYA 3KHLA 1S1UA 5KT6A 3AVHA 4CGGA 2XC9A 5F9LA 4ELTA 3Q8LA 4FJ8A 4RNMA 4FLYA 4ELVA 4E7KA 4OKJA 2NRXA 4FK0A 7ICQA 4I2JA 5KFCA 4K4GA 1HYSA 3PR4A 4IG0A 3S3OA 5KFRA 4GLXA 4CJEA 4QZBA 2P66A 1J9AA 1UT8A 4DL3A 1DGSA 2A1JB 4W5NA 4FJHA 5HNKA 4DO9A 4B8CA 3AO1A 5EWEA 1U9LA 4R64A 3VN5A 1XU4A 4BE2A 1Z00B 3RBDA 8ICEA 3SPZA 2ZQBA 4CJFA 4DL7A 1S0OA 3CFRA 5KTQA 1SKWA 4J9LA 5J0RA 4JUZA 3GIMA 3NH0A 3MGIA 3NHGA 1XHZA 3T5HA 3PMNA 4EEYA 1D5AA 9ICQA 4FBTA 3T3FA 4ED6A 3N97B 3Q8QB 3RH4A 2IOCA 4JK1A 4E1NA 1XSPA 4KREA 9ICCA 1GOCA 1HNVA 4CERA 3G10A 3H40A 2VA2A 3C2MA 4YMMA 3QEAZ 4DFJA 3C2KA 3LWLA 4CF9A 9ICTA 4CJTA 3RJKA 1CUKA 1BQNA 4OLBA 2HHVA 1L5UA 4QZHA 4CJKA 1ZBLA 2FPMA 1A5XA 4H8KA 4YXJA 4KAZA 1TGOA 1HMVA 4L8RB 3GILA 3LP2A 4YD1A 1WNSA 3G0ZA 3PW4A 8ICOA 3NGYA 4Z6CA 4BGDA 3EY1A 3M8RA 3BDPA 1Y88A 4KLDA 1CZ9A 5IILA 2ZUCA 1N48A 4M04A 1S9FA 3LDSA 3AVCA 1WSEA 2BQUA 4CJSA 3VQ4A 2KFNA 4BDYA 1ZQLA 1VSLA 4EP5A 4M3YA 4IQTA 2VG5A 3THVA 1LB2B 4N41A 3ZSWA 4CCHA 4BXOA 1YTUA 3LK9A 3MFHA 3JPQA 5KT2A 3QINA 1XS9D 3VQDA 4CJRA 4QWDA 3NF7A 2NRZA 4DS5A 2P51A 7ICHA 3T5KA 4N47A 3ZCMA 1WLJA 4DTPA 3MDAA 3V1RA 2ASJA 1RT4A 3PVXA 3NGZA 2W9CB 4DOBA 1SL0A 5HP1A 3LDAA 3EPIA 2F1JA 1KEJA 4DG1A 2D0CA 3L2UA 4Y1DA 4EBDA 5BOMA 2KN7A 4IQUA 3E01A 4CECA 3LP1A 4KITB 2B4JA 3VQ9A 9ICFA 3OYIA 4QWBA 4DMNA 1ZBFA 3JPTA 1PZNA 7ICRA 1KCFA 3K5OA 1MC8A 4P4PA 4RPYA 5IINA 4Z4GA 2UVRA 3LP3A 1S1TA 3T19A 2RN2A 4KLHA 7ICFA 4Z0UA 4TUPA 1RYRA 4NM2A 2QXFA 3HT3A 3AVJA 3V1QA 3AO4A 4O3PA 2ZJAA 4QOZB 3RAQA 4KLFA 3KK2A 5IIMA 2YNHA 4M41A 4RQ8A 4RQ6A 4CIFA 1ZQHA 3QE9Y 1S5JA 2ASDA 1QSLA 4O3OA 4I2HA 8ICXA 4YNQA 1WAFA 1NJXA 4MFBA 4QZCA 1HNIA 4B9NA 2XRIA 4CJ4A 1QQCA 4OKEA 2VA8A 7ICGA 4KO0A 7ICNA 1N6QA 3B0XA 2HNDA 1B9DA 4DL5A 9ICKA 3PV8A 1LAWA 5L1IA 4WE1A 1TAQA 4M9JA 2C2EA 1BPDA 3MAQA 2ZUDA 3M9NB 1WSHA 7ICIA 3RJFA 4CEAA 4N5SA 5J29A 2NRWA 3OYLA 4BXOB 3KD5E 2PYJA 4PHAA 1Z3EB 1Z26A 5KFOA 2HVHA 3ZSYA 3AVNA 3L3UA 3ZDCA 2IHMA 1HYVA 3KD1E 4B3OA 3VQ8A 4FJ9A 4PHEA 4PWDA 1FKPA 4R65A 7ICSA 5KGXA 4NCBA 5HRRA 1U4BA 5KFSA 2V9WA 2VG7A 7ICPA 2PI5A 3C2LA 3ZSQA 2HHSA 2P6RA 3OS1A 2DPJA 2IC3A 3NAEA 4FLUA 4RQ2A 2BHNA 2VANA 3AVLA 3MR3A 2R8GA 3RB6A 2PFOA 4J9MA 2YKNA 1IKWA 3PO4A 5EWFA 4XRHA 1J53A 3I8DA 5KG1A 2Z1JA 3JPOA 5HHIA 2GWSA 5J0QA 4ED3A 4GXKA 4O3QA 2X6SA 3HL8A 4QWCA 2M9NA 4NLNA 1HQEA 1S1WA 3ORYA 8ICAA 3KTQA 4B9UA 3B0YA 2P5OA 3OYBA 3MR5A 4FJJA 5D4BA 4FCYA 5HP4A 1LWEA 4CHYA 2IHNA 4ECZA 4NCAA 5KFEA 3O3HA 2E6MA 3HVRA 3TABA 3HO1A 3K58A 1UA0A 3LAMA 3K5MA 3PO5A 4M3WA 1JN3A 1ZQOA 2JEFA 3QESA 1VSDA 4FW1A 5CHGA 3JPNA 3DLBA 1DTTA 1QSYA 8ICNA 4F92B 5J2MA 1X9MA 4KPYA 1B9FA 2XGPA 5HRNA 4K4IA 4YD2A 4MF2A 8ICKA 3NF6A 1S10A 4I9QA 1QS4A 1RDBA 4RU9A 2HHUA 1LV5A 9ICSA 4LH5A 5J2GA 2JEJA 2DFHA 3EW9A 5J2EA 1SL1A 1G15A 3HSTB 8ICGA 4Z4HA 4LSNA 2DFLA 3V9SA 4I27A 4DQPA 3OYAA 3HYFA 3SUPA 3H08A 1HPZA 2ATQA 3PW5A 4OLAA 1ZQNA 1K1SA 4DTMA 1A77A 1J5OA 2PY5A 1X9WA 2BCUA 4IBNA 3DM2A 3VQQA 3Q8PB 2C22A 3B6PA 1NK6A 5TZVA 4LVSA 5HROA 3C5GA 9ICHA 1BI4A 1VSHA 1JLBA 4FJGA 1DTQA 4K8ZA 3PY8A 3QZ8A 4DSEA 4M47A 5KT5A 4OVLA 2YNFA 4NLZA 1WSIA 2UVVA 4Q43A 2ZTEA 8ICUA 1L3VA 4FVMA 4FZZA 2JEIA 3MEEA 3Q8KA 1CXQA 5J2IA 2EX3A 3K5NA 2ETJA 5J0YA 3F73A 3L3VA 3C6UA 4I2PA 4MFCA 2KTQA 8ICVA 4KB1A 1N56A 2R8KA 2IGIA 4AHRA 2HMIA 3LALA 1HQUA 4IDKA 2GUIA 1RCHA 4YR2A 2G8IA 1GOAA 3ZSRA 4HUFA 4FLXA 3MBYA 4M3TA 1SV5A 3G6YA 4ID1A 4K4HA 5E41A 3WNHA 3QZ7A 4Z4FA 3TAEA 1O1WA 2X6NA 3PW2A 2I1QA 4E7LA 4I2GA 4O5KA 7ICTA 1S1VA 3S3MA 4K8XA 3HXMA 2VWKA 4YFUA 3Q8MA 3KK3A 3RB4A 3T5LA 4QW8A 1XI1A 3UXNA 5J2DA 3OSPA 3DOLA 4B8AB 1A5WA 1LAVA 4Z6FA 4Q8FA 4RQ0A 9ICBA 5CB1A 3UQ0A 2JZBA 4PH5A 3HX0A 4QCLA 2XGQA 3ZDAA 3UQ2A 2W42A 2VWJA 1ZQDA 3Q8SB 5IIOA 2OPPA 5J2PA 4DTXA 3RRGA 2ATLA 4DSLA 2AJQA 1NJZA 4Q5VA 4KLJA 3DLEA 4I7FA 3FYHA 3IHQB 3OY9A 3EYZA 4KLSA 3QO9A 4LZDA 4RUCA 4ZHRA 3TAQA 1ZQZA 1S6QA 4F2SA 1BI4B 4DOAA 3BQ1A 1KVCA 5BOLA 3PX4A 5DK5A 4NM1A 9ICVA 4Z6EA 5CYMA 2IDOA 3HVTA 4PGYA 4N76A 2BPCA 1JX4A 4YVZA 1S97A 4FM1A 3ZD8A 4ECVA 3CM6A 4M3XA 1NJYA 4O5BA 4FS1A 2FBTA 3NH1A 3DYAA 4IRCA 5EWGA 4CK2A 5KFJA 4DS4A 4DOCA 5KG4A 3OJSA 2ASLA 3UIQA 5CA7A 3GV5B 5KRTA 1ZBHA 5KFAA 4E19A 1SUQA 4ED8A 3NBPA 2HB5A 5HLFA 1JLGA 4I9LA 1CZBA 4CIGA 8ICLA 7ICEA 5KG3A 1UWBA 3CFOA 1JIHA 3RB0A 4E3SA 1KFTA 2XCAA 4LD0A 3C95A 3H7IA 1KVAA 3KHGA 1RT2A 1DOQA 2YV0X 4KTQA 1KLMA 2E6LA 1B22A 2WOMA 1EETA 1TV9A 3ETLA 4RZRA 1VSKA 2P5GA 2DFFA 5EU7A 4CGFA 2YHAA 4ECQA 1JLEA 4Z6DA 4JRPA 1DLOA 4JLHA 2W9CA 3SCXA 4E7HA 5DQIA 2W8KA 2OPRA 3KLEA 2LSNA 1C0MA 4DWIA 3PR5B 2JZBB 4IQVA 4C8MA 2MAXA 1ZBUA 4O4GA 1BIZA 4QZ9A 2V4RA 4RNOA 1WAJA 4Y1CA 4JV1A 4ECYA 2O4IA 3VA3A 1MSWD 4EBCA 2DPIA 2BQRA 1TKXA 3TAGA 3TARA 4B9SA 4YP3A 3QNNA 5FRMA 4F5OA 1ZQRA 4W5RA 4I2IA 2PXIA 2YHBA 3H8SA 1KSPA 8ICTA 4M42A 4DU4A 4YR3A 2VG6A 4W5OA 1Q9YA 4E89A 1TK0A 3KK1A 3PMLA 4KLLA 1S76D 4FZYA 3ZT2A 2D0AA 3L2VA 3KKRA 2ZTCA 4YR0A 5KRSA 3ZT0A 4UAWA 3ZT1A 5KT7A 3JPRA 4DF8A 1X1PA 4IKFA 3AO5A 4DU3A 5KFTA 4CF2A 4Q44A 1IG9A 3QIOA 4KN7A 1IKXA 1C0UA 1ZJMA 4O0IA 1BGXT 1RPLA 1VRTA 4EP4A 2QK9A 4KMUA 2RKIA 4J2BA 4KRFA 4UB1A 1LW2A 4DQQA 4CEQA 3TWHA 3RMAA 4BWJA 5CR0A 3ZDDA 2ZJ5A 1D8LA 3QIPA 4F2RA 4I2QA 3DLKA 4DTRA 5KFWA 3S3NA 4RQ4A 4LH4A 4FLVA 5L1JA 3RAXA 3U6FA 4J9RA 5DBBA 3AU2A 3AA4A 2W8LA 3NH2A 1BL3A 3V6DA 4C8LA 1TVAA 3BQ0A 3UXPA 2NUBA 1BPBA 1ZQEA 3AUOA 3GQCA 4B9MA 4P2HA 3QEBZ 1S0VA 5DMRA 3QERA 3K59A 4RQ1A 3SQ2A 4IRKA 3VQBA 4CFCA 3ISCA 5DB6A 1MQ3A 5HHHA 4ZTJA 4CJLA 3LZJA 4X5VA 2KW4A 3O4NA 3AVFA 1EP4A 4JWMA 4J9OA 1T8EA 2DY4A 1QLNA 1U45A 4KLMA 4ECWA 1HRHA 3ULDA 3I0SA 4UQGA 3HW8A 3N4MB 1RT7A 2MUTA 1JLFA 5I42A 5C42A 3NTUA 4FJKA 4RPZA 4PGQA 1TV6A 3RMBA 4O3RA 4FXDA 5DGBA 1WCNA 4NYFA 4O9MA 3D45A 1FXXA 9ICWA 3DRPA 4DTNA 3SJJA 3EPGA 4QAGA 3PX6A 4GC6A 2HHQA 4FZXC 5CWRA 5KFLA 4DU1A 3C1ZA 2IA6A 3AU6A 5DB9A 3AVAA 3SQ4A 1SZPA 3VQPA 1ZQCA 4I2BA 3OGUA 3DRRA 1XSLA 4BACA 2XY7A 1SKRA 8ICCA 1SL2A 3MEDA 1YT3A 4MEXA 4MEYA 1RBSA 1W9HA 4FO6A 4DTSA 4HCCA 1NK4A 8ICIA 4B9LA 1ITGA 3OYEA 4C8KA 2R8IA 1NOZA 1ZQFA 5CZ2A 5DKWA 2OWOA 5L9XA 4IFVA 4DFMA 1IXRA 2XHBA 5KG6A 2PFPA 1I39A 3RH5A 4KFBA 1T03A 4DSFA 3RJHA 4F91B 4BE0A 5J2JA 1WSFA 4DQRA 5J2AA 8ICBA 8ICZA 5J0UA 5KFIA 5F9NA 4DQIA 2JEGA 1QE1A 3OYGA 8ICJA 5KT4A 1IH7A 4QZAA 4J9KA 4F5PA 4UB5A 1RTDA 4KLGA 4QZEA 4CEEA 4F4KA 4EZ9A 8ICMA 3RRHA 2BANA 1JLQA 1D9FA 3RMDA 3AA2A 1RT3A 4P4OA 1NKCA 5KFXA 4F5NA 2OA8A 4RQ3A 5J0XA 1A76A 2MUTB 3ZSOA 5SWMA 5J0PA 1VSFA 5KFUA 5KFVA 4MFAA 2W9AA 4PHDA 3MECA 2R8JA 2IMWP 1VSMA 4XIUA 2XCPA 4FLWA 3L2WA 4W5TA 5FDLA 2KZZA 2ISPA 4DLEA 3C1YA 2PFQA 4AHTA 4RPXA 1EXQA 3OS0A 1RTJA 5KFQA 3RWUA 2A1SA 2G8KA 4ECRA 1TVRA 4JS5A 9ICRA 3VQCA 1RBVA 4TSXA 1NOMA 4FYDA 1SKSA 2XY8A 4GVMA 4TURA 3HJFA 3ISBA 5IIIA 3MXIA 2PYLA 3ALYA 1W0HA 3V72A 2AGPA 3MFIA 5KG2A 4CJPA 3FDSA 3FFIA 2XY5A 2BGWA 3LAKA 2X74A 1NK9A 4E7IA 4MFFA 1JMSA 4M3RA 1RTHA 3L2RA 1BHLA 1KTQA 5HMMA 3HPOA 4OKKA 4BWMA 3GIIA 4B9VA 1BPYA 2F8SA 3JPSA 3HP9A 3F9KA 3V6HA 4AH9A 2AQ4A 3RR8A 4UBBA 4PY5A 3L2QA 4FK4A 4YCXA 3KIOA 1BPXA 2BCRA 4FJXA 1ZQTA 4HYKA 4Q45A 5EOZA 3P1GA 3HWTA 4CGDA 5KFPA 1TFRA 1U47A 1S77D 1IM4A 1RT1A 3SI8A 5KFHA 1COOA 3MDCA 1VK0A 4YMOA 4DSIA 4RUAA 2FBYA 1EXNA 5SZTA 4O3SA 3QEPA 4H4OA 4C8NA 3GIKA 4CESA 5BPCA 3LPUA 3SNNA 4ICLA 4KN4A 2BCQA 4KLQA 2R8HA 4I2EA 2BQ3A 4RQ7A 3G6XA 2HHTA 4ED7A 5KGWA 2KZ3A 1WN7A 4KHUA 3DMJA 8ICFA 4KHWA 4OJRA 3ZD9A 2IAJA 3PUFA 3T5JA 1JLCA 4KLOA 3ZSXA 5C24A 4DL2A 1WSGA 1S0NA 3RBEA 2YNIA 1T3NA 2HNYA 3RB3A 1QTMA 5KFZA 4KHQA 2PI4A 3PNCA 1JLAA 1HJPA 1C7YA 5CY4A 5KG7A 2C28A 1KVBA 2OPSA 4C8OA 1RXVA 1S6PA 4CJUA 1V9PA 1U04A 4PUOA 9ICNA 8ICSA 4GW6A 3U3GA 1Y97A 1XO1A 4RT3A 3VQAA 4CEBA 3IG1A 4FW2A 4JV0A 2WTFA 3OYHA 4FK2A 3UPQA 5J2BA 5DDYA 2Q3SA 4AHUA 3GV7B 1TL3A 2OZSA 5K14A 5CYQA 4CJVA 4ED1A 1RTIA 4W5QA 4UAZA 2AGQA 4RG8A 4QZFA 8ICWA 4O55A 4DQSA 1C0TA 1X9SA 4ECXA 5J2CA 3GIJA 2JLEA 1ZYQA 5HRPA 4YG2A 8ICYA 4DF4A 8ICHA 4F4WA 2R7YA 2NRTA 1XC9A 4DSJA 3C21A 4LSLA 1JXBA 3V6KA 3TR8A 5KFGA 2B5JA 1MQ2A 2AU0A 4DEZA 4JRQA 3AVBA 4NLKA 3BQTA 3B6OA 1K6YA 3G6VA 4TQRA 4G1QA 1WSJA 4LY7A 4AHSA 4XUSA 3TAMA 4R66A 7ICUA 3LANA 4QZ8A 3ITHA 3M8QA 4DL6A 5D3GA 1TKZA 4ECUA 3DLRA 4XA5A 3OHAA 3E2EA 3V9WA 2HW3A 2FLLA 4DSKA 2HHXA 3SQ0A 4M6WB 4CF8A 3CQ8A 2HHWA 3RMCA 4I2DA 4EYHB 1EKEA 3MGHA 4IRDA 2VA3A 4F5QA 5KFFA 4G3IA 3KLFA 4M9LA 4O5EA 7ICVA 2W9MA 5KFDA 1QSSA 4KHSA 2LYHA 3OSNA 4PQUA 2F96A 3V9UA 3QETA 1TKDA 3OS2A 5DGAA 4FM0A 4PA1A 4E0DA 2BPFA 2DFEA 3QEVA 1TAUA 4HHTA 3AVMA 2FLNA 2F8TA 3OYMA 4CJ3A 5FRNA 4Q8EA 4CGIA 2J6TA 3O4QA 2E4LA 5HBMA 4ED0A 1KRPA 3OHBA 9ICIA 3V9ZA 3AVIA 4CHZA 2G8VA 5CJ7A 3NF8A 2RDIA 1TK5A 3S9HA 4I2CA 5D49A 3IS9A 3HK2A 2XO7A 4HUEA 2RDJA 4QWEA 3V1OA 4B9TA 4HUGA 3SV3A 4GMJB 3CG7A 1IKYA 3HM9A 4FJNA 4ECSA 2BCVA 1U48A 3VQ7A 1UOCA 1L3UA 4RW9A 1VSIA 4RW4A 3ZDEA 4J2AA 2OYQA 3Q8RB 1LW0A 2I5JA 2AQ0A 3LP0A 4GC7A 4CHOA 1I3AA 5J2KA 2ZJ8A 4CEFA 1FKOA 5KI6A 4FJ5A 5DQHA 3KLHA 4I2FA 4M3ZA 3JSMA 1XSNA 4F4ZA 3DLGA 2Q0ZX 1KDHA 3VQ5A 4F5RA 4QWAA 3SUQA 3MXJA 3OVNA 5DDMA 4EZ6A 4CHQA 1B43A 3U3YA 1S9GA 3D0PA 1C6VA 2X78A 3C5FA 1KLNA 3RJIA 8ICPA 3C94A 1UAXA 1ZQGA 3TAFA 5J0OA 1NK8A 3RJGA 9ICJA 4PHPA 4FBUA 1YTAA 4J9NA 9ICPA 4CK1A 3SQ1A 4CGHA 1CXUA 5HRSA 4IQWA 3AO3A 3LWMA 3WNEA 3GV8B 3M9OB 2V4QA 1BCMA 4OPKA 4CIEA 3K2PA 1ZQJA 4CK3A 4R5PA 5KFNA 2UVWA 1ZQKA 2OZMA 4MF8A 1C1BA 4YXMA 4R8UA 9ICMA 4RW7A 4CJWA 2IBKA 5DBCA 1Q9XA 4ZTFA 4UAYA 2XY6A 4Q0BA 2GBZA 5C5JA 4FLTA 1XHXA 2O4GA 4DTUA 3KKSA 4AHCA 2GV9A 2ITGA 4R63A 4UB4A 3VQEA 2BE2A 1QHTA 1ZJNA 1T7PA 4M9GA 8ICRA 3DI6A 4I28A 2FBVA 2AGOA 1YVUA 1MU2A 1NK5A 4YQWA 3AVGA 1TK8A 4QZGA 3M9MB 3ZSVA 5IIKA 2ZUBA 3IAYA 3T1AA 1Q8IA 1UT5A 1WCLA 3K5LA 3IRXA 3TI0A 2PZSA 1ZQWA 2WONA 1ZQUA 2ZD1A 2J6SA 1ZQAA 3V9XA 4KHYA 1NKEA 3O3GA 2OPQA 4YN4A 5KT3A 3IM1A 2B6AA 1S1XA 4P4MA 9ICGA 1RNHA 5DQGA 2C2RA 1K1QA 4O44A 4DTJA 3RJEA 4F4XA 4CF0A 2ZE2A 4DFPA 3EZ5A 4CEZA 1ASUA 8ICQA 3K57A 4CJQA 1GOBA 1JKHA 5DBAA 5KFMA 4TUSA 2ALZA 1RBTA 2G8HA 3SYZA 3RJJA 3KHRA 1C1CA 3V7KA 4FM2A 4GXJA 1BVSA 5KG5A 3M8PA 7ICKA 3A2FA 3WNFA 3OYFA 3EWAA 1N5YA 2J6UA 1RT6A 2RPIA 4RT2A 1RT5A 1VRUA 2EHGA 1IO2A 4OPJA 4ZH4A 3AVKA 9ICOA 4CJ5A 1XWLA 5JS2A 3CM5A 9ICEA 4Z4EA 1RBRA 4AHVA 1A5VA 2HNZA 1VSEA 4R8UB 4BDPA 3KHHA 2KFZA 3BQ2A 1C1AA 4FJ7A 4RNNA 4BDZA 4QW9A 3NFAA 4MQ3A 3TFSA 1JL2A 3HPHA 4M45A 5J0TA 2A1RA 3MR2A 1REVA 5J2NA 4JWNA 1NKBA 5J0SA 1L3TA 4E1MA 2FPKA 1HYZA 4PGXA 4CFAA 1ZQSA 3RTVA 3AA5X 1D8YA 2BKEA 1B92A 4CHNA 4H4MA 3CFPA 3SUNA 1RDCA 3PW0A 4KHNA 1JXLA 1RZTA 4AILC 4M2YA 4CHPA 4ID5A 1HUZA 1CLQA 3CYMA 3TANA 4KB0A 4M9NA 1RXWA 3ZSZA 4DTOA 1VSJA 1BIUA 5IIJA 3O3FA 3V7LA 3ZDBA 4JS4A 2KZMA 3C6TA 3AV9A 1RDAA 4I29A 9ICLA 4J2DA 5DLGA 4QZDA 1CEZA 3ASMA 5HMLA 4RQ5A 1RDDA 2G8UA 3RH6A 4N56A 2UVUA 4O5CA 2F1IA 2G8WA 3K4GA 2P6UA 4LZGA 4CE9A 3OYJA 4HTUA 3LPTA 2BCSA 3PW7A 4IFYA 2C2DA 4ECTA 1BPZA 4DL4A 3JYTA 4BE1A 3BGRA 2BR0A 1S9EA 4CF1A 4YMNA 3SUOA 2YKMA 4TUQA 3OYDA 2ZTDA 4M0AA 4J2EA 2Z1IA 3P5JA 4IR9A 3PX0A 4F3OA 4ED2A 3WNGA 1S0MA 5DB8A 4RW6A 4CFDA 3OYCA 1RBUA 1IKVA 2FPLA 4E7JA 3GDXA 2KQ2A 1F21A 1ZQXA 5KFKA 4HCBA 9ICAA 3OYNA 4M3UA 1H38A 5D46A 3BJYA 3OYKA 3DOKA 3MABA 4PPXA 4EBEA 5T7BA
chains in the Genus database with same CATH superfamily
2ZKUA 2AP6A 1RAAB 1UMJA 2IYIA 1ZTTA 1JL1A 2K7JA 4IH7A 1UA1A 4JEPA 1F5CA 1BPEA 1REVB 4B1ZA 4CEOA 3AGKA 2DT9A 2MSTA 4KV8A 3ZC4A 1U2RA 7ICOA 5LSLA 3RR7A 1NBEB 4PL8A 5AI8A 3IBCB 1NOYA 4DV7F 4Z4CA 1ZQBA 1HHTP 2C2MB 1IBMF 5D4LA 2B0GA 3ILLA 3KD3A 3VR1A 3H4DA 3AJ2A 1NGEA 1LXNA 2MLYA 4TQSA 1VHXA 4CLPA 5LL6d 4JKDA 1N5XA 1S59A 2KHCA 3LZIA 2IC3B 5I4MA 5AHXA 5IOLA 3VWSA 1ASVA 1T4GA 1U49A 4IFYB 9ICXA 4JV2A 1VQ5N 1Q79A 3DDKA 3J7YP 3PKYA 4ALZA 1S9EB 5L39A 4F36A 3ZT3A 1DEJA 4JI8K 2CNNB 1R0AA 3NDKA 3DFEA 2HBRB 3JXOA 1NGIA 2Z2MA 3M4XA 2ZHBA 5F8LA 2Q97A 4FJLA 4F3TA 3AO2A 4UBCA 2KT2A 4RWWA 3K9JA 4KTWA 5GIOA 3GFXA 1YJUA 1U2CA 2BTFA 5AQSA 4DV3F 5DG9A 5AXNA 4Z4IA 1QCKA 1LWEB 1WOPA 2CNKB 1UVIA 4S0MA 1FDDA 1GMWD 3A8JA 4KI6A 4ED4A 2ZEJA 4FVCA 4KGKA 2I7NA 4LQ9A 3KLIA 3MM7A 3IM8A 3OBYA 1EX4A 3IDWA 4NXZA 3JAMU 4RW8A 4OJOA 2UYTA 2BJ9A 4NCGB 3KJVB 3PIOQ 3WC2A 4DV6F 5JUMA 3CCSN 1ZQYA 5DB7A 2C1EB 4NA2A 4K4WA 3NGUA 2RLTA 3K75D 3M6ZA 2F8EX 1NHUA 5DG8A 3L9ZA 3K0SA 5CP2A 3G8TA 4NY8A 1SQGA 1N34K 2A18A 4QIFA 2HVIA 2BGGA 2FD2A 1YLXA 3ZT4A 2DO0A 1Q16B 3FBFA 3IA0A 2W3RA 1XIQA 5DG7A 5J2QB 3NGDA 3LGMA 2CPYA 5THWA 1ZBIA 4C3KA 3K17A 5ALVA 1IN0A 1N52B 2GVDA 4BY9C 4ELUA 2FC0A 5JRTA 3CCTA 8ATCB 1U25A 1B99A 5AZJB 3RSEB 3QU4A 3O80A 3FC9A 3SPYA 3FE1A 1W26A 4CNYA 2CRXA 3V81B 9ICUA 2FSNA 1LXJA 4J9QA 3U02A 2IVOA 3HRDD 5M2UA 3ADAC 3MXMA 3ISNC 4J9PA 5F8MA 2Z1HA 2MPUA 3F9MA 2P6TA 5KFYA 2FJDB 2CAJA 2CGLA 4CGGA 5AQFA 2AJFE 2XC9A 2F9TA 4RNMA 3DN9A 5F1XA 2OXOA 4ELVA 4DV0K 1HJOA 4OKJA 4IJAA 2KJ5A 1HYSA 4K4GA 1S4EA 3GR1A 4P9SA 2E1RA 3THYA 4DL3A 2F9WA 4FJHA 4Y2MA 1TL1B 3V4IB 3VHQA 3VN5A 3FBEA 5AE2A 1Z00B 3ZXWA 2QZ8A 3R7SB 3IR7B 3IMXA 4Z37A 4Y3CA 1BXNA 4CJFA 3HJVA 4HACB 1S0OA 3SENA 1SKWA 4J9LA 2B43A 3CHWA 2HFOA 4MDBA 2WW4A 3HKWA 3EZOA 2E5SA 2H51B 3MHYA 1VQ5S 3QDKA 4E1NA 1X5SA 1GOCA 3H40A 1X31C 4YS2A 4DV4K 1O51A 1WHVA 2OLWA 2Q1NA 2XG8A 4TYAA 2E1ZA 5A8KA 3C2KA 9ICTA 2VJ5A 4E98A 1GFWB 2Q36A 4NA1A 1BQNA 2L3MA 4OLBA 4XPCA 1X0FA 3PYGA 1HWKA 4P2FA 2M8HA 4MK7A 3B54A 1QAIA 3UVJB 4L8RB 3GYGA 1WG4A 3MM6A 4YD1A 5AQRA 4JBCA 3NGYA 3MN9A 3WQPA 4DN9A 1QAYA 3BV8A 1Y88A 4G6VB 2A1AA 5ALWA 3M05A 1U1LA 1CZ9A 5IILA 3D6RA 3MGVA 3BN4A 3CCSS 4JI5F 1V3ZA 1RAHB 1VFJA 1CS4A 2M8DB 1DRGA 3VQ4A 2NSBA 4MKVA 3IAM9 4LF5K 1AZSB 5A76A 4NO7A 1KN5A 3G86A 1LB2B 4CBXA 4N41A 3PHEA 3CCLN 4BXOA 3SIPB 5KT2A 1XS9D 4NXNJ 4DV1J 4PXEA 2FGOA 4QWDA 2JSXA 1KLMB 4FPIA 2WUSA 1LKZA 3NGRA 1WLJA 3MDAA 3V1RA 1W7AA 1RT4A 3PVXA 3UN3A 3D2EA 3VF6A 5HP1A 2F1JA 3KLEB 1H6KX 3H90A 2DRAA 3L2UA 4ILLA 5BOMA 2ROPA 3TW0A 2GGPB 3D4JA 3GJTB 9ICFA 2KG0A 3K89A 3E9PA 3W65A 4BREA 4QWBA 1VIOA 4DMNA 7ICRA 1XR5A 1X0PA 3ICXA 2IOFK 1SH2A 2GTDA 4KHPJ 3CI5A 1S1TA 2RN2A 4HI2A 2D4WA 5ALEA 4C4RA 4M5KA 4OZ2A 4GKKJ 2ZJQL 2HAFA 5B0GA 4O3PA 2JWKA 4K0KK 2RT3A 4DV2J 4UF4A 4IOXA 3L6QA 2F3JA 3LP2B 3R27A 2OTJN 3HKZD 3OUYA 2Q6CA 1XNRJ 1FEHA 4CRJA 1QSLA 2DXEA 1SB3C 3SAFA 2EFVA 1L7OA 1ELOA 1FXRA 4MFBA 1W97L 2XRIA 1GLJO 1K73T 4CLKA 1Y3JA 7ICGA 7ICNA 3DJCA 2UUWA 2RQ5A 1H1VA 2P9LB 1B9DA 4DL5A 9ICKA 3PV8A 2P9SA 2PMZD 3S1TA 4M9JA 1RGIA 3G25A 4CD3A 3KG4A 3MCPA 5ETNA 1ZOTA 1WSHA 4K4TA 4USJC 3G87A 2DPNA 1NMDA 1J97A 2FY8A 3CDAA 2PYJA 4PHAA 1Z3EB 3BKTA 1Z26A 2HVHA 1PYOB 1Y11A 5B0FA 3ZDCA 4HI1A 3W64A 1HYVA 5ALOA 1H2UX 4DUTA 3M6UA 4RUBA 4B3OA 4DR4J 3GU3A 3S01A 1FKPA 1IUJA 1RBAA 1R3NA 3AN1A 7ICSA 4E8UA 3M3ZA 2V2ZA 4ZVUB 2K1RA 3R5CA 5A0YB 5KFSA 4CF5A 4M5HA 4JI2K 2VG7A 7ICPA 2PI5A 1RHQB 3B82A 2E8AA 3SR6A 2R7WA 1KQFB 3NAEA 4FLUA 1FNMA 4NYZA 4ZVSB 1PYTA 3MR3A 3MAAB 3DLLL 2H4WB 1IKWA 2CXYA 3I8DA 5C2DA 5KG1A 3JPOA 1Y5NB 2E7XA 2HHHK 3J7YU 2KHQA 5B09A 3MOJB 3P31A 1CULA 3ULEA 5ITHA 4NLNA 3UD4P 3DHXA 3CCLS 3B0YA 2W55A 2O1PA 1E3MA 1FE4A 1DY3A 3KG0A 3MR5A 3SFGA 2W43A 2UUAF 4HVZA 4MKAA 5JU5A 3HO1A 4NASA 3GPAA 2E2NA 3K58A 1HNIB 2MHEA 3G8SA 2N1RA 4YHHJ 2DNZA 1WBBA 4KH0B 4AYBD 5DJBA 2JEFA 5CHGA 4L72B 1DTTA 1WNEA 1QSYA 3LL3A 2Q6BA 5J2MA 5ALMA 3DOMA 4NXMK 4KPYA 5TISU 1SWVA 5HL7Q 1M90O 4YD2A 4A8EA 5ETQA 1SGGA 5J1PA 2LMRA 2OHFA 4I9QA 3KKAA 2FLOA 4LRBA 2HHUA 1LV5A 9ICSA 1K5OA 1QM9A 4O23A 2KK0A 2JEJA 2ZH9A 4KFBB 2VFVA 1SL1A 3A3PB 1MN9A 4OQJA 3W2VB 1PC4A 3IP0A 2DNHA 4OJHA 2NUHA 2XYHB 5AI9A 1BA0A 4LRDA 3OYAA 2G13A 1K1SA 2ADBA 1A77A 1R8HA 4PWWA 4IBNA 2KO1A 3EXCX 3Q8PB 4AQYJ 2OTJS 4ZPDA 3C5GA 5HROA 5AKKA 4DR6K 9ICHA 2N3LA 4M94A 3KJFB 1ZM3A 5JVGQ 2CGJA 4FJGA 1N2XA 4EEKA 3CJRA 4N7TA 2FVQA 2WAQC 2B8QA 1VLBA 2OEHA 4FVMA 2B9XA 4O5FA 3CDEA 3E9OA 5TKWA 3F5EA 5AQVA 3EZUA 2VV5A 2ETJA 3C6UA 8ICVA 2HMIA 4C23A 2QTDA 4YB5A 4KJIA 3HHLA 4YR2A 3WEEB 2XLKA 1LQ9A 4HUFA 1N5TA 2IIRA 1BDGA 3G6YA 4JKBA 5AQXA 1XMQK 4ATNA 3VGLA 1UVMA 3GE9A 2E9RX 1FX4A 3QZ7A 3KJNB 1FXLA 4DV5J 1TVRB 2GJFA 3PW2A 2E8PA 2B4OA 3FRZA 5JMNA 4BX9C 2RSQA 3H0MB 3ZZ0A 4I2GA 4O5KA 3V2UC 1J5EJ 3OA9A 3HXMA 1Y7PA 3NMUA 4YFUA 2CDRB 3KK3A 1VBXA 2OKQA 3J81Y 3T5LA 3THWA 1XI1A 3M2RA 3UXNA 5J2DA 4JI6J 2W7AA 1B64A 2W7PA 3N6MA 4WZMA 4OLOA 4RQ0A 4NMXA 4WPAA 3UQ0A 4LF2A 2NLXA 2XGQA 5A8RB 5AE3A 2W42A 1YBTA 1N62A 5IQ6A 2OPPA 2CPFA 5J2PA 3CJ5A 4DTXA 2QWQA 3RRGA 3BEGB 2V69A 4A8XA 1R89A 4NB4A 4OX6A 4DR2K 1V9OA 5M1FA 1O5JA 5DM7Q 3EYZA 5CD4H 4ZJOA 2AYEA 3F53A 2YKAA 1H74A 2FIUA 1DT9A 3E0FA 3CO9A 2V52B 4F2SA 3BQ1A 1RT1B 3EVMA 5GVQA 3ZTRA 3CJ9A 5IFMA 1LK5A 2HMXA 2YX7A 2IDOA 3RAMA 3GDQA 2OTLN 2JDJA 4MTPA 2HBYB 3L7PA 4GNIA 1LFPA 4I2PB 4NLQA 5CXTA 2IVYA 4DS4A 3RG6A 5KG4A 5K9FA 2F9JA 1HQUB 2PMHA 4A62A 3UIQA 1E4FT 4E19A 4H5TA 1SUQA 2V5HG 3WK7A 2HB5A 1SV5B 3I9ZA 4HT7A 1CZBA 2DXDA 5LXYA 1FRHA 1UWBA 5IM0B 1OPZA 4PZOA 1CJVB 4A2BA 2VPWB 4B3TF 2XCAA 2XSJA 1RKJA 1KVAA 3KHGA 1PILA 1FE0A 2OPSB 2F8HA 3HDSA 2E6LA 3K2YA 1EETA 3O8WA 2CRLA 2P5GA 5EU7A 4CGFA 3C7NA 4GVBA 2OIHA 3EM1A 4C8YA 1WF1A 1YJ7A 2F4FA 3KUHA 4JYAJ 2GLEA 5AICA 4IEEA 2FUG9 1YJ9N 2W9CA 2GO7A 1ZXOA 2GVZA 3DOLB 4QIEA 3M1FA 2BJ3A 2OPRA 2Y0SD 3BBCA 2LSNA 4U6PA 2AKWB 2E1FA 4A46A 1C0MA 4AQYF 1NGCA 3CCQN 5EHHA 1HR0K 1XQSC 4LFAF 1ZBUA 3C28A 4B02A 5M1PA 4QZ9A 1WAJA 3CCVN 4WFNL 3A5NC 2DPIA 2QLJB 4P6QA 5LY3A 3CB4A 4YP3A 3DDNA 1KSPA 5ALHA 4YR3A 3LPYA 3W9JA 2GMJA 3OR1A 2DH8A 3ZT2A 4MK9A 4ZHRB 5ALSA 4YR0A 2QV6A 4IKFA 1UVNA 2VPZB 3C19A 3MPWA 1M90T 3W5ZA 5BPMA 4C0OC 1FFGB 4NLCA 1IG9A 1IKXA 1C0UA 4CDGA 3PDNA 1ZJMA 1AA1B 5CYMB 1X4DA 1BGXT 1RPLA 1PIEA 1VRTA 1T11A 4UW9A 4KMUA 2X1GA 1TMMA 1K44A 2D41A 1LW2A 4XK8C 4DQQA 2L48A 3DYAB 4L76A 3VAGA 3BGUA 3TWHA 3RMAA 2V9KA 3UNGC 3UWTA 2YQ1A 3QIPA 1YRTA 3LVVA 5HLFB 1B3TA 4N77A 3I96A 4WXWA 4DUZK 4DPTA 5DBBA 4DR7K 2M4MA 4WF9Q 3V6DA 1KAYA 2G09A 2OM6A 3CJ0A 1ZQEA 3R6LB 3B8AX 2DCUB 4B9MA 5CYJA 3QEBZ 3BDEA 5AQTA 1S0VA 4IS7A 2PA3A 1JLEB 4CFCA 3JSYA 4ZTJA 3LZJA 3VEYA 4X5VA 4X65J 4TLQA 2KW4A 2HBZB 4MLHA 3HVAA 3NUQA 3VESA 1Z4NA 2A40A 2CQ0A 5IWAK 4KLMA 3IRUA 2Z2LA 4HHJA 4WP9A 1HRHA 2MQPA 2OTLS 1X4BA 2LYAA 4M63A 4BR4A 3I0SA 4FPBA 2IVPA 3HSDA 1N34F 3KJQB 1RT7A 2F77X 2V8VA 2MUTA 2PN6A 1ZM9A 4MYTA 5C42A 3H20A 3MPVA 4DL0C 4B1UB 4MKYA 4PGQA 3R3LA 1NH8A 4O3RA 5DGBA 2I1RA 2ZDOA 3HILA 2DYAA 4WP8A 4CYUB 3SJJA 3EPGA 4H0TB 2LDYA 3PSFA 4GC6A 3PX6A 3A8EA 5KAKA 2BX6A 2EAMA 5CWRA 3C1ZA 1EO1A 1N36F 2BJ1A 3VQPA 1U26A 2HIYA 2CJXB 1XSLA 5B08A 1L8LA 2CJBA 8ICCA 2DQNB 5CR4A 1FXDA 3BGOP 1YJ9S 1YT3A 5AKYA 4P0PB 2VB6A 5L46A 4DTSA 1HNZJ 1NK4A 4I2QB 3CCQS 3VALA 1Q78A 5AM3A 3B6BA 1TP7A 3TYTA 1HNWK 4KYZA 2ZBCA 3SCIE 3CCVS 2VQEK 4C8KA 3MZIA 3R5AA 2CH6A 4WU2A 5LM7E 4X4NA 2E5LK 2P9KB 4DFMA 2E9TA 2XHBA 2LKYA 1I39A 3MMCB 4GIBA 4F91B 1KEKA 8ICBA 8ICZA 3ZX3A 2DNNA 3JXUA 4H0OA 5KFIA 2VDHA 4IDHA 2HFNA 2ZBQA 5A2QY 8ICJA 1X4AA 4TVAB 2XZDB 4F5PA 3FCHA 3BKFA 3IGNA 1IBKJ 1Z2ZA 4F4KA 1NSPA 4AFFA 1QD1A 1JLQA 1D9FA 4CTAA 1ZQ1C 4P4OA 2QLTA 1NKCA 5KFXA 4EU0A 4URQU 4F5NA 1A0OB 2DKOB 2OA8A 3IG5A 5J0XA 4BRGA 1JLFB 5I42B 4QYZJ 2A1BA 3ZSOA 1TV6B 2Q0RA 2V4JA 2RB7A 4JI3J 3TA0A 3UKRA 1F3VA 2FGCA 3BO4A 2FSKA 1D1UA 5C2GA 1VSMA 2N3OA 1ZM2A 5FDLA 4WFBL 2KZZA 1HBUB 2ISPA 2JWLA 4DLEA 3C1YA 4AHTA 3NAIA 1YWXA 1EXQA 1N5YB 2CKWA 2V50A 1NRKA 1AUDA 5AK5A 5BR8J 2A1SA 3MPYA 1Q81O 5AKJA 2B56A 2KH9A 2KVQE 1NOMA 1FEZA 1SKSA 4NL5A 2R7VA 2ZIVA 3ISBA 3M5RA 3UR3C 4LF4K 3I76A 5IIIA 2W2OP 5LSRA 4K8RA 1D4XA 2PYLA 4LF8K 2HBQB 3ALYA 2K60A 1W0HA 4CJPA 4ZP7A 3FDSA 3VV2B 1NGHA 4BR5A 2BGWA 1U2VA 3LAKA 2YI1A 5CE3A 3ED5A 2DUYA 3ZZPA 3HPOA 5KNIA 3Q83A 2AYMA 3JPSA 3HP9A 1RHRB 2JXJA 3AARA 5D78A 4PY5A 3PYEA 2P9IB 4X62F 2FF6A 2DEIA 1BPXA 2V7ZA 4QNLA 2BCRA 3KLVA 1ZQTA 3Q22A 5EX0A 4Q45A 4X4TA 3P1GA 4O8KA 1VIXA 2BANB 2HZAA 2QWOA 4QIWF 2RQKA 2E1AA 4OYXA 4OX9J 2KI2A 3D28A 4JK8A 3CCWA 4YMOA 1D8ZA 5BREA 1EXNA 5DZ7A 3HHNB 2BJEA 1YUWA 1S22A 3TUPA 4AM6A 4ICLA 1SAZA 1N0UA 5GAHP 2BCQA 4KLQA 4I2EA 2NRHA 2KZ3A 3DDHA 2OI2A 3DMJA 4OJRA 3ZD9A 2IAJA 1GO3F 4EWTA 4XDCA 3BGRB 5C24A 2GAGC 4L73A 1VCTA 2BW7A 4CI0B 4XO0A 1WSGA 4ILGB 3MPUB 3RBEA 2YNIA 1RTJB 2K4PA 1QTMA 5KFZA 2PI4A 1F5BA 5AFUA 1WWVA 4WU3A 3CRXA 1KVBA 2B6GA 4DBQA 1RXVA 4CJUA 9ICNA 3VEVA 3OPXA 1GTHA 1PAEX 2E7VA 4RT3A 4X4OA 3BY5A 2OH2A 1UVKA 2JGAA 4FW2A 2WTFA 3TUZC 1QJHA 1HARA 5DO2A 4M5MA 1VAZA 1TL3A 3IBWA 1IBKF 5HQMA 2OZSA 5K14A 5GADP 4O55A 3WK8A 3QPIA 1X9SA 3BF1A 4OZ3A 1ZYQA 4O3MA 5HRPA 3I28A 1YVFA 3MI7X 1ZPVA 2RIJA 4LF6F 3IR6B 3EN9A 4U7BA 2W01A 3AHPA 3JS9A 4Y0WA 3WXLA 2O8BA 2R7TA 4XDDA 4P73A 2I2YA 1S6OA 1Y4ZB 4NA3A 2FVRA 3PYFA 3ZI4A 3BQTA 1QUPA 4P71A 3KNAA 3G6VA 1UFLA 4TQRA 1FRMA 4AHSA 4K5SA 1Q46A 2UZAA 7ICUA 2JFKA 4X64K 4JI2F 4KKOB 1TKZA 4WJ3B 2CQ1A 1PK3A 4OMFG 2F76X 2CQDA 3CWJA 4H4OB 2VQFJ 2YJFA 3OTOF 4C3MA 1H7WA 1TELA 3MGHA 2RRDA 1BO5O 1TAMA 1OQ6A 3D0IE 4M9LA 1Q8KA 4O5EA 5I3PA 2WVFA 3NVKA 7ICVA 2LYHA 1TTHB 4QS8A 3OSNA 3A5MC 2J0QD 3CDBA 2AJ0A 3HSZA 5J1EB 1U1MA 4F0MA 3V9UA 2EFQA 4FM0A 1F9EB 2IVFB 1TUWA 4E0DA 4ZP8A 3QEVA 1TAUA 2JH3A 2FLNA 2J0WA 1ULRA 4CH7A 2J6TA 3VGSA 1JLAB 3JAMY 5HBMA 3CC2N 2O8EB 2UUTA 5E3RA 1FFUA 5CHIA 3V9ZA 4CHZA 1CI4A 1D3WA 2CUYA 4L75A 1GT8A 2CADA 4HEA9 5H9EK 2GV1A 3P5TL 3CJQA 4Y2JA 1QZ6A 3DLJA 3IS9A 4XH5A 2GS8A 2L9DA 2QTWA 3AA8A 1HQ2A 1VMBA 4QWEA 3V1OA 1WI6A 2YPYA 1UW4A 1RTIB 2QMXA 1QUVA 4ECSA 2BCVA 1U48A 2KXFA 3NOGA 2QA1A 3CCZA 3W2WA 4RW9A 5DRKA 1HIYA 4RW4A 4OX9F 1VSIA 4QIVA 2YX4A 4J2AA 3Q8RB 5ETOA 4K7QA 3QGHA 2QFJA 4FJ5A 2QLWA 1Y5LB 3DLGA 3OL7A 3VQ5A 4QWAA 1Y0HA 3S41A 3T41A 3MXJA 4CHQA 1JNRB 2A2DA 1S9GA 1OWXA 2X78A 1OY9A 5ETPA 1KLNA 2ALYB 8ICPA 4DCHA 4ZS6A 3TAMB 3C94A 3R8EA 3TAFA 5J0OA 1ZTWA 3M8QB 3NS5A 3RJGA 3SCLE 9ICJA 1QHAA 5CZVA 4PHPA 1YTAA 4DR1K 1CXUA 3POTB 5AQUA 5AZIB 3HFZB 1G4CA 3M9OB 4Y34A 2A42A 1UPMB 5LJ3Y 2CPRA 3QT6A 1XNQJ 2DNPA 4EMDA 5K20B 2YQEA 5KFNA 4PQUB 3I56N 2R42A 1NB7A 1C1BA 1N32F 9ICMA 4ZITA 3VAFA 1CQNA 1XTZA 1EJ7L 2HOQA 3BS5B 3OTBA 1XMQF 1KVIA 2O8FA 2BVZA 4JKEA 5C5JA 2ZDPA 1X4HA 5LOQA 4CZLA 4DTUA 2IA0A 2W24A 4IG0B 1Q7YO 4QIGA 1ZJNA 4M9GA 2AGOA 1MU2A 1TYQB 3D6HB 3T1YJ 4EGLA 3SDEB 2FDRA 1JK9B 1S5ZA 1MG7A 1RAIB 3A8YA 4YOXA 3G82B 1WC3A 3O9TA 2WONA 3ZZRA 2J6SA 5C0YA 1NKEA 1M1GA 4YN4A 2PMZF 2Y9UA 2QA2A 3QBXA 5G4DA 5LJWA 4P4MA 2I5JB 3LP0B 4QS9A 5F2RA 3JQMA 3HULA 3C6AA 5DQGA 2JJ4D 3PG9A 2C2RA 5IT4A 1HUXA 2F65A 4I56A 4DTJA 2EI5A 3UQSA 3KLHB 2EKNA 3JSMB 3DXKA 1X4EA 5KQ8A 1ASUA 3KZIU 4YY3J 4CJQA 1GOBA 1W2BR 2FJVA 4DR2F 4TUSA 4OD0A 1RBTA 2G8HA 1Q3VA 4OHZA 2UXCK 1C1CA 3MM8B 4IL6U 1OQ3A 2E2QA 1URNA 2MTLA 2BV3A 1WDDA 1TL7A 3CC2S 5EX5A 4QJVA 9ICOA 1YRUA 2HOFA 4WK3A 5AQGA 4RWTA 5C2FA 5JS2A 2HBLA 4ZOSA 4LQ3A 4X4UA 2QYCA 2K3IA 1S6UA 2XWXA 4H4KA 2KLAA 3R7NB 4NX9A 3SSSA 2H65B 4R8UB 4OV6A 5B8HA 4QW9A 2F3NA 1YTYA 4DHYA 4IKAA 3AOAA 2KRBA 4Y2KA 5J2NA 4JWNA 5LMNJ 3DU6A 2IM2A 3DI6B 2O8DA 1HYZA 2HBJA 3RTVA 1G99A 3TZZA 4HTIA 3L3FX 4KHNA 3IRXB 4M2YA 1WWUA 1CLQA 2ZD1B 2HQDA 4I6YA 1HA1A 4M9NA 1BIUA 3PFEA 3V7LA 2H3IA 4M5DA 3FZHA 2KZMA 2IPOB 3AV9A 1RDAA 6AT1B 3MURP 9ICLA 1LEOA 4QPXA 5HMLA 4RQ5A 2M0NA 4K50A 1RDDA 3BYRA 4N56A 4JI0K 3K0JA 4LZGA 2IMOA 4HTUA 3E01B 2IJNA 4BC4A 1JKHB 5IQQA 4MK8A 3I56S 3U9ZA 4PCQA 1Y64A 1IBLK 4NE9C 3QUBA 2VONA 4EENA 1N33K 2C2DA 4ECTA 1BPZA 5GAHU 1KR4A 2C3OA 3GYNA 1IIPA 2F4VK 3IFEA 4OI1A 1BY9A 2HYIB 1WEYA 4CF1A 2Q2RA 1NNLA 3CD7A 5KPRA 1K9MO 4M0AA 3ETRA 2QB0B 1RKIA 4F3OA 1WKLA 1IR1A 4KH4A 5DB8A 4RW6A 2PD1A 2OELA 3OYCA 3QU2A 2JRSA 3QGPA 2OP5A 1RBUA 1IKVA 1CJTA 1CJUB 3GDXA 3VQTA 3MCNA 4HCBA 9ICAA 3D2SA 3NWRA 3MDFA 2KE7A 4K4YA 1X5OA 3OYFA 2FBXA 4KO0B 1KBRA 1U09A 2FMPA 2HURA 4H5RA 4DR7F 1RTZA 2E5HA 3TJAA 5GADU 4ES2A 4C2MA 2Z1GA 3NCIA 1FK9A 5AK4A 3TSPA 1LWFA 3D7SB 1ZQQA 1B70B 4LF7K 1ESVA 1HHSA 4LT6A 3THXB 4YY3F 3NE6A 4ERDA 3MD3A 3G71N 4ZK7M 3L4IA 1GLBG 4ZPWR 5K8NA 2G0CA 5KFBA 1ZQIA 3MEGA 3HKZC 4B3MJ 1YKWA 3M2UB 2IFXA 4GMKA 2ZIUA 2F5GA 1BC6A 1VQSA 1CRXA 5FPEA 4F4YA 2ZH1A 3V7JA 3AEVA 2DITA 5A0LA 4MH8A 4FJIA 3UB5A 4M6WA 3QEIA 4FJMA 4FZVA 4IOAQ 3B4DA 1Q7YT 1BCOA 2VC1A 4WWSA 1ZETA 3F41A 1RP5A 4DZ6A 2P9PB 3TU5A 3VGVA 5I3UA 1NK7A 1MWYA 2JRZA 3SV4A 1VQKN 1NK0A 1PUZA 2KIVA 5F0WA 2EWHA 3JYTB 2XNRA 3MN6A 4UB2A 2ILYA 1VHFA 1SJQA 1I1GA 4Z7CA 3VAIA 3BKUA 1AROP 3UO0A 4QZIA 5J8YA 1RWKB 5G0RA 3KOAA 3HTVA 2COLA 3C65A 5J0WA 1TZ0A 1KXPA 3FKBA 4YFKA 4DFKA 2DR7A 3ZFVA 4UB3A 2HK3A 4BR7A 2AH5A 2G08A 1SC3B 1RABB 4JI8J 1RLDA 3QLHA 1CC8A 1KD1O 1NJWA 4NLSA 2YX8A 1I94J 3H25A 3TZWA 2H5XA 1MWMA 3ZZTA 1CJKA 3C16B 5BRHA 2Q43A 3DOKB 2Y1JA 2AMCB 3W66A 2Q4TA 4CE6A 3I9V9 1HNWF 2MGZA 2VQEF 4DLGA 2IVMA 4GKJK 2NRVA 4PL1A 3V6JA 2QKBA 5L1KA 3CJ4A 2E5LF 3IWNC 5ALIA 1H7XA 5J2HA 3IBPA 3QSIA 1EQYA 4GXIA 3GJRB 3ISDA 1WUDA 4X66K 4EYIB 2UXBK 4QU7A 3LVWA 4NI2B 4O3NA 3MMVA 1S5LU 3TFRA 4ILJA 3SMVA 3PNIA 4OGEA 2D3OR 2XI3A 4LBPA 1P1LA 4B3SJ 3A5LC 4O0JA 1RBLA 3PIOL 1LWCA 2PBDA 3MR6A 2ESEA 3QNOA 2Y0SF 1F2GA 4OYZA 4XQ8A 3W62A 4AYBC 2E20A 3M30A 1HPZB 1ZQPA 5K5MA 3LGNA 2OEMA 2G8FA 1X3MA 5DM6Q 2KG1A 2K8BB 7ICJA 1WHWA 1XMOK 2LQBA 4MN4C 4JP8A 3WUHA 2KXNB 4BVPA 2YNFB 2H3QA 1G1XA 3R9LA 3BBBA 3KHLA 3MEEB 3UCZP 5KT6A 3AVHA 3N6LA 4WYWA 1FJGF 5F9LA 4WFAQ 4ELTA 1VC5A 3Q8LA 2F2AB 1R0AB 3NASA 1VJWA 3CUNA 1RDRA 2BMBA 3ZX2A 4PPZA 1UZDA 2KT3A 3LDQA 5ALZA 4BC2A 4ZN3A 1O8BA 2FJXA 2LPEA 3G71S 4QZBA 3R5JB 1ZA2B 2P66A 4Y2XA 2L9WA 4JI4K 1IM6A 5HNKA 4DO9A 5FPMA 4JD2B 4B8CA 3AO1A 4DV0J 4LF4F 3TJ8A 3NVYA 2VIXA 1ZBTA 4LF8F 3KLIB 3MM7B 4BE2A 2JLGA 8ICEA 1N5QA 3A5OC 2CQ4A 4RW8B 3MCSA 5GMKa 2J5AA 4FYXB 1K9MT 2GQQA 3GONA 2KFYA 2KJ8A 2MLZA 4KBOA 1N5WA 3T5HA 1AFIA 2QC3A 1XHZA 9ICQA 3T3FA 1ZAXA 4CLFA 4ZIVA 3Q8QB 1U24A 2N7YA 3RH4A 1VQKS 1N54B 3OD2A 3HZ6A 9ICCA 3QFWA 2UU9K 2NO4A 3G10A 1KAXA 2WF8A 4A8MP 1TU0B 2DY1A 4ISEA 2JC1A 2UXDK 2E9ZA 2GVDB 3M7VA 5ALXA 4CF9A 1U2FA 1CUKA 2J4RA 3BBFA 3QO9B 1YSJA 1RWMB 3IC1A 3BN7A 3W3SA 3D9BA 3CPWM 4R0EA 4DV4J 1A5XA 4H8KA 3ZYYX 4YXJA 3ILJA 1TGOA 1VBZA 3W8PA 1PC5A 1U0SA 2W6KA 3AQFA 1DARA 2MXYA 3CJAA 1HNXK 1N0VC 4Z6CA 2HAIA 4HKQA 3EY1A 1QY7A 4BRQA 1MWQA 4W90B 1RAGB 2WBNA 2ZUCA 3K7RA 1T9UA 2KN4A 5MLCV 3LDSA 2H1YA 4LFCF 1X5TA 4CJSA 4I6MA 4ZP9A 3GE1A 5JLFA 2KFNA 1HYSB 1VSLA 3NBPB 4WKYA 4BHQA 1JLGB 3THYB 2VG5A 2XI2A 3W63A 1HEKA 3LK9A 3JPQA 4GVLA 3ETMA 6FDRA 1WWHA 3F5AA 4CJRA 2NSCA 4DX8H 2OFHX 1H98A 3NF7A 4DS5A 2RHKA 1YBUA 2P51A 7ICHA 2Z56B 4DR5J 4LF5J 3T5KA 1IR0A 2O8CB 4N47A 3ZCMA 2MZSA 2G07A 4L3NA 4F3MA 2RRAA 2KJVA 3LDPA 5ADZA 3HHDA 3NGZA 3AOBA 2VCPA 5IZHA 3LA0A 4KR0B 1IBMK 3VAJA 2D0CA 1KAZA 4Y1DA 3PZPA 4G9ZA 2D9PA 1GXTA 4FO0A 2CPEA 3C6HA 3BSAA 4K42A 4CECA 3C14A 1HI8A 2QARA 4O4GB 3TTFA 3CNQP 2ZM6F 3OYIA 5CQGA 1KCFA 1OMSA 3UDLA 2CG8A 4UATA 1MC8A 1Q53A 5AQNA 5LMUF 4P4PA 5IINA 4KX5A 5A8KB 3LP3A 4OCZA 2GAHC 3T1HK 3PJXA 2XZTB 1YJWN 4TUPA 5DDQC 3TZYA 2J76E 3GG1A 5DZ6A 3AVJA 4QOZB 2WB1D 5IT0A 4YMEA 5C2CA 4FE3A 3EE3A 2N7CA 4TKTA 3SCJE 4NZ6A 1GLCG 2RJZA 5AI0A 3MM6B 1FX2A 3ZEUA 3T7ZA 2MQMA 2MZTA 1S5JA 4BRPA 2QT7A 4BG9A 4O3OA 4I2HA 2BBEA 4YNQA 5M1NA 5HR7A 4K0KJ 3J8AA 2UV8A 4QZCA 4B9NA 1UP1A 2EZYA 4OKEA 2VA8A 1FDAA 2G06A 1N6QA 3LYSA 2JMGA 1CS4B 1TUUA 5L1IA 3PHTA 3DLKB 2OSRA 1RWVB 2KSOA 2ZUDA 3M9NB 3AY9A 7ICIA 1JUDA 4Y2PA 4USMA 2Q31A 4LF9F 2Y9TA 3G6EN 4N5SA 2NRWA 4AT1B 3OYLA 4BXOB 1ZXIA 1HBOA 3TWZA 2WAQD 4DV6K 3QGGA 5KFOA 4B3RJ 3LQVA 1YJNN 3FFKB 3ZSYA 3F5TA 5A8WA 2IHMA 3SQOP 3MM9B 2D6FC 1KP6A 2ITMA 2EFNA 4DPXA 3VEXA 3VQ8A 1TMJA 1NWKA 4RNHA 1U8SA 1YRXA 4R65A 5HP1B 2NYVA 1V5VA 3KZBA 3U1NA 3TOQA 2V9WA 2EWSA 1WBDA 2KM8B 2A5XA 3ZSQA 5IT9O 2XLIA 2BABA 2P6RA 3OS1A 2IC3A 1NDPA 2UUBF 1ZAWA 4RQ2A 3AVLA 1OY8A 1OH8A 3RB6A 2PFOA 2QMUB 2YKNA 3WX4A 3KOOA 1NNEA 1S1TB 2QL9B 5ALQA 2RHQB 3GFHA 2NXCA 2GWSA 3Q7BA 1YIJN 1HWIA 4GXKA 4O3QA 2X6SA 5EVZA 3HL8A 1TUGB 3TNVA 2AXTU 2WHEA 2GWJA 1UEUA 3IBFB 3ORYA 2I9SA 2Y8WA 2JR5A 4B9UA 4QR1A 2IRXA 3CDWA 3EUB2 4FJJA 2POKA 5D4BA 4X4RA 2BZ2A 5HP4A 1LWEA 1CC7A 4U7UD 2HHHJ 2IHNA 4ECZA 5KFEA 3O3HA 4CBWA 3TABA 2VICA 1KC8T 2C2ZB 4DR5F 2GJ2A 3LAMA 3PO5A 1PJ6A 2HFVA 1T6CA 4M3WA 1JN3A 4J03A 1KBUA 3QESA 4FW1A 2G0AA 3JPNA 3FGUA 1SXDA 4H5VA 1X9MA 1B9FA 2XGPA 4K4IA 3QSYB 1YDLA 2W4DA 2VL1A 1FTCA 3HMJG 4RU9A 4PL7A 1ZPWX 4EO8A 2DFHA 2QWLA 4Q7AA 1LCUA 4NXMJ 3UDEA 1YJWS 1P1TA 3BO2A 3C46A 1FKPB 3V9SA 4LSNA 3PM9A 5F8JA 3TQEA 3KKAC 2K1RB 3DCAA 4DQPA 2K7KA 4OZ1A 5HL7L 2HBKA 3HYFA 2UV8G 2ZNYA 1HHQA 2ATQA 1O03A 3PW5A 3MAHA 2C3UA 4K43A 2PY5A 1CLFA 1SPBP 1U1QA 1NK6A 5TZVA 4LVSA 2FHOB 1ZAVA 1IJJA 1H2TZ 4M7XA 4K8ZA 4M47A 3QZ8A 2XICA 4HAIA 4OVLA 3CC7N 4NLZA 4FFDA 1Q4RA 1UVJA 2UVVA 1I5OB 1WSIA 2ZTEA 1L3VA 4FZZA 3Q8KA 2EX3A 1UFKA 3K5NA 4PG8A 4DR6J 3L3VA 5ETVA 4MFCA 4RL1A 2IGIA 2DY9A 3JS6A 1CULB 3Q8UA 3ULEB 3IAS9 4IDKA 3ZTOA 5JVGL 3G6ES 1RJJA 3ZSRA 1VQ4N 3DXBA 4FLXA 1YJNS 3A0BU 1EQMA 4ZVHA 5E41A 1T9YA 5CCLA 4J5OA 4Z4FA 3HHLC 1J2NA 2X6NA 5AJ3F 2I1QA 3DWLA 3S3MA 3UW1A 4K8XA 1DAXA 3Q8MA 3RB4A 1DTTB 4QW8A 1SQFA 4HACA 5J2MB 2RD5C 2BEFA 3EUNA 3DOMB 4B8AB 1VQYA 1IJEB 4C1NI 2LXUA 2JZBA 4P7TA 5GINA 3FFIB 5EE0A 5AKGA 2V2KA 3UQ2A 4OJGA 1ZQDA 1DQ9A 1YIJS 2MKKA 2ZFHA 2A41A 1NJZA 4Q5VA 2ACMA 3DLEA 3FYHA 4MIBA 5F3TA 3FCWA 3VVTA 3OY9A 4KLSA 5E3AA 5M2PA 4JHDA 5AIAA 2B51A 1C0FA 3R1XA 2CPDA 3AH6A 3HOSA 2Q0UA 1NSAA 3EJMA 5HROB 1QQOA 2V0NA 4Z6EA 4JI1J 4BQZA 3HVTA 4PGYA 1UTAA 2HQGA 4N76A 2BPCA 4FM1A 4ECVA 2CZVC 3CM6A 3PACA 4V19X 4X4PA 1NJYA 3R1HA 5DM7L 2W04A 2GEMA 2J0SD 2HSZA 4YOEA 3C6UB 5E2QA 2R2UA 2F4VF 5GTIU 4IRCA 2GO8A 1OVYA 4CK2A 2HOIA 2HMIB 3ONQA 4DOCA 2VKZG 5CA7A 3GV5B 5BYRA 2QL7B 1PAUB 4ED8A 4BC3A 4CF4A 3EZWA 2NYHA 4F7VA 2MKYA 3EE9A 5AKLA 5KG3A 2C42A 1JIHA 1G6BA 1KFTA 1L3KA 2F63A 2O66A 4LD0A 1DOQA 2I7PA 1KLMA 4BROA 1PVPA 2WOMA 3MMJA 3ETLA 4RZRA 3L95X 1M5OC 4H03B 4DI6A 1RQNA 1DLOA 3THWB 3BP8A 3M2RB 4M7YA 2XIDA 1RA7A 5DQIA 5HVGA 2V8PA 3KLEA 3ZNJ1 3KUGA 5CYQB 5KOWA 8AT1B 4DWIA 3H2UB 5C15A 1LNQA 1NNDA 2J0XA 2BOPA 2JL9A 4IQVA 2DL0A 2MAXA 4LJMA 4LF7F 3CC7S 2ZHAA 2V4RA 2X1FA 4Y1CA 2OPPB 4ECYA 2EVZA 1KONA 3VA3A 4JKGA 5M1OA 2BQRA 3TAGA 3TARA 3U7JA 3QNNA 5FRMA 4LSLB 4F5OA 1ZQRA 4W5RA 4M42A 4DU4A 3CMQA 4WCEL 3PSTA 5KQDA 1HR0J 4E89A 1TK0A 3PMLA 5D15A 2PKEA 2D0AA 1VQ4S 2DGWA 2HQFA 3ZT0A 3D1OA 3ZT1A 1OVQA 1X1PA 4QIWC 1UHUA 3AO5A 4DU3A 3G4SN 1ZD5A 3TX8A 4Q44A 9RUBA 4KN7A 3QIOA 1RAOA 3SMZA 1UQVA 4HT5A 1OH6A 3QU7A 4BUGA 4UOHA 3VGTA 5HAOA 1YXQA 2XS5A 4G65A 5CR0A 4F0HA 4NXNK 3VAKA 3FC4A 2ZJ5A 3ZDDA 2KB2A 3LH2S 2HVEA 2P9LA 5AQLA 2IM3A 1SUQB 5KFWA 2Z2YB 4ZA1A 4ZDNA 1W25A 1WC4A 1QVFM 1SH3A 1NGJA 4FLVA 4K4VA 3U6FA 3QFUA 1T6DA 2K8GA 3LPEA 4WFYA 3NH2A 5CH7B 1BL3A 1ACMB 2C3PA 3MUTP 1TVAA 3BQ0A 1PYSB 2NUBA 3R5DA 4CT8A 3GQCA 4P2HA 3N4PA 5GMEA 3E66A 4ANDA 3C7NB 4GVBB 4DUZJ 2B4VA 2WK4A 4CLWA 2KKVA 2XZWA 1OJ4A 3ISCA 2IYGA 1UZHA 2OPRB 4GKJF 3O1BA 4P72A 4KHPK 4J9OA 2DY4A 4WQ4A 2D3O1 4GKKK 1SIZA 1IBCB 4JI1F 1BWFO 3LOUA 3O4WA 2UXBF 3ULDA 4DV2K 2DCLA 4BS2A 4C4WA 4ZPBA 4FJKA 3RMBA 2VUGA 3FMBA 5IWAJ 4LC9B 4NYFA 3GL1A 2EKYA 3DRPA 2EAPA 1UEVA 2H4YB 3I32A 4FZXC 3C3LA 4DJBA 1FIQA 2IA6A 1IKXB 1C0UB 1CPZA 4B17A 4ZJLA 3THTA 1WOQA 1ZQCA 4I2BA 1VRTB 2Z8QA 5L1MA 3R5BA 4DR3F 1F0XA 5AKEA 4IFEA 2AA4A 4OI0A 4UY8T 3DNCA 1SL2A 5EXWA 4OZNA 3NS7B 4ZCIA 3F56A 4JOUA 1C4AA 1DJ0A 3QIPB 3ZNUA 4HCCA 8ICIA 1ZZNA 4B9LA 5CEHA 2LQJA 4RW7B 4XH1A 3OTCA 3O1WA 2VD3A 3DAWA 2YCHA 1YX2A 2R8IA 1NOZA 3V6DB 1DFDA 4Q0BB 5CZ2A 5L9XA 1KOHA 2FC9A 4KFBA 3CXCR 1N60A 3MN5A 1RDFA 2ZH8A 1WSFA 1DGKN 4A8KA 5K8MA 2ZH3A 4LR8A 4K2XA 2JEGA 3JQKA 2PEBA 2JFDA 1IH7A 4QZAA 3G4SS 3R2DJ 3ENBA 1NU4A 3I8BA 2G1DA 4UB5A 3M32A 2AZ3A 4CEEA 4BC5A 2HKEA 4MIAA 3CJ8A 2MMYA 1DHMA 3CJKB 4ZMMA 3RMDA 3D2NA 2A2CA 1G7CB 4LRCA 4Q2LA 2FC8A 3BSCA 4CLYA 4P2MA 1YJVA 3H46O 4RQ3A 1A76A 2MUTB 3AQPA 5C42B 2IIHA 3ATVA 5SWMA 5CA5A 4I0WA 1SV4A 4OI3A 4MFAA 2W9AA 4PAAA 3VZIA 2R8JA 2VJUA 2IMWP 5B0CA 1FJEB 3WKEA 2XCPA 3IN5A 1RWXB 3JTOA 4W5TA 5AXMA 3HT0A 3WEEA 4ZPAA 3K9KA 2DNMA 5AKZA 5ETSA 3L3CA 2LDIA 3RWUA 1NHVA 2G8KA 2RHFA 1BE4A 3GZFA 1RSCA 1TVRA 1HNXF 2ZZTA 3PEHA 2ZOGA 5EDWA 3CEDA 3T6JA 2DNKA 4B3TK 3QUCA 3MXIA 3TVYA 3IP4B 3VEZA 1SZHA 2DR9A 3O5BA 5KG2A 2ZWOA 4CO5A 5AXKA 1SC4B 1FVSA 4OYBA 4K4UA 3TPQA 2XY5A 1P9YA 1GMVA 2X74A 4OJ6A 4E7IA 3UMBA 3OLAA 2MU2A 5E3CA 1RTHA 1IG6A 2M2BA 3X3UA 4AQYK 3GIIA 2HG4A 1BPYA 4LFAK 1JB0C 3PXGa 1FNOA 4AH9A 4ZVPB 4M95A 3DGVA 1RGVA 3FJ2A 1FDNA 2CJYB 4WFXA 3O3LA 1GTEA 1XN9A 2JHDA 4ID5B 3R7BB 5EOZA 4P74A 5KFPA 1TFRA 1IM4A 2AYGA 2ROGA 4US9A 2P9NA 1RT1A 5HK4A 1VS3A 5KFHA 3AM9A 3D3CJ 1COOA 3MDCA 3U8XA 4DSIA 4RUAA 2FJBB 4I4BA 2FBYA 2NPIA 1K8KA 5HANA 2XMUA 3OTEA 3QEPA 4C8NA 3GIKA 4JV5F 4PL2A 4CESA 2WW8A 4CQ1A 3LPUA 3SNNA 1T9XA 2V4JB 3UKRB 4KN4A 2R8HA 2BQ3A 4RQ7A 2HHTA 4NLTA 3EGZA 3T1HF 4KHUA 4MAKA 3KMSA 3ENOA 4KHWA 2ASMA 4NEYA 4OYOA 2EXUA 1JLCA 1TR0A 1J5EK 1VQ6N 2RH3A 1HBMB 2KV2A 2E5GA 2FB0A 1VK3A 5IM0A 3BH6B 1T3NA 5F0XA 3ENVA 5F0UA 2XEXA 2C28A 2W4CA 4CNZA 3VF4A 2OPSA 1PO6A 3Q24A 2I8EA 4PPDA 4PUOA 2OAUA 3MM5A 1U04A 3KFUF 1Q7LB 4RQMA 1VQON 2ZIVB 1MNEA 3OYHA 2AEFA 2BKOA 1FTRA 4AHUA 3GV7B 3BR9A 3A4TA 2QEXN 2DEJA 4CJVA 5ALTA 2DBBA 4ID8A 4W5QA 4UAZA 3G9CA 3PYDA 8ICWA 3UN5A 1C0TA 3MPDA 2W03A 4ITSA 5ALYA 4F04B 1U2VB 3L7UA 2HOEA 3S6EA 4ECXA 4K59A 1SJ3P 2JH1A 1YF5L 4Y2UA 1XC9A 2BH1A 3C21A 1B4FA 3TR8A 3V5RA 1MQ2A 2AU0A 2LHTA 2VHGA 2I5HA 1S48A 2K3KA 4NLKA 3NNCA 1K6YA 3IXQA 3KMQA 1EIYB 4G1QA 1WSJA 3MR7A 4FKXA 4XUSA 1Y9OA 1HL6A 1HLWA 3LANA 3AD7C 3T9NA 5D3GA 3VGUA 2EC2A 4ECUA 3DLRA 1BNOA 1XMBA 2HLTA 2DXFA 1RM6C 3E2EA 3VTHA 5ETRA 1FFSB 4DSKA 1X8DA 3Q23A 3SQ0A 3CQ8A 1E4GT 2FJ6A 5HVFA 4CLLA 4I2DA 2MQQA 4EYHB 2E66A 1Q95G 4ICLB 2CG4A 1N36K 3O6WA 4IRDA 4OX7A 4ZPCA 4PEOA 5KFFA 4X64J 2YTUA 3DMJB 2W41A 2HGNA 2WSEC 2W9MA 1QAJA 5KFDA 2IAJB 2GIRA 4TLRA 1TKDA 5C24B 3GP9A 3W0LA 2J9EA 1WUUA 5AT1B 1WYGA 4PKDB 2BPFA 3TTDA 2YNIB 3AVMA 3OYMA 2CXEA 3KHYA 2DTJA 4HH1A 4Q8EA 3PJ9A 4ZP6A 5K8OA 3FZKA 5ALRA 3OHBA 3WXMB 9ICIA 3T69A 2K2PA 5CJ7A 1S7IA 3SJHA 1YJRA 4HH0A 3OTDA 4F4AA 4FWLA 4EAHD 1RHUB 1Q1KA 2X3DA 1TL3B 2RDJA 4WZQA 3BF4A 3SV3A 3MCAB 2NREA 4AXIA 1IKYA 3OV7A 3MF5A 1UOCA 2ZH6A 1K8AO 3ZDEA 4ANCA 1UVLA 3OW2M 1ROFA 1LW0A 4GC7A 4CO4A 4IC9A 3GR0A 1J6ZA 3QU9A 5J2KA 3BSOA 3N6NA 4H0XB 5KI6A 1A6LA 4AD6A 4LR9A 4I2FA 1XSNA 3BR8A 2QWRA 1JXVA 2YHXA 2GQCA 3SUQA 2L08A 3OVNA 5DDMA 4EZ6A 3CF5Q 3D0PA 3C5FA 1O08A 1YHQN 4A8FA 2ZGZA 3QAEA 1VQ6S 4ZLNA 3DKDA 2FPHX 1UAXA 3LGHA 1HFEL 1SC6A 2DHXA 3ZETA 2KL8A 2HSTA 1GH8A 1VLYA 4OZLA 4FBUA 4PZVA 1VQOS 2BE7D 5EX3A 3NRWA 5HRSA 3CPWR 4LVNP 2MKJA 3MWBA 2RQCA 2HWTA 1C4CA 2G1HA 2V4QA 3MGJA 2BE9B 4OPKA 4CIEA 2QEXS 2O3DA 3NVVA 2YKQA 4R5PA 3DRSB 1SJ1A 1TKTB 2YY6A 4MF8A 4DR1J 4CJWA 4GO5X 2ZVIA 3BGLA 1RCXB 2PIIA 1UL3A 4OLPA 2XY6A 4X65K 2GBZA 4DU7A 4EK2A 5HBMB 2YX6A 2E8NA 4UARA 1O6XA 2O4GA 2LECA 4JN4A 2G0JA 4R63A 1SIJA 2BE2A 1T7PA 2AHOB 2FBVA 1F9HA 3AVGA 4QZGA 3M9MB 3IS9B 3FNNA 3ZSVA 3PRDA 2ZUBA 2A19A 2MHNA 3CGIA 1WCLA 3NCPA 4ES1A 4EX6A 1ZQUA 1A7GE 3W2WB 1ZQAA 4BRMA 4RW9B 3TUJC 3O3GA 2OPQA 3AQOA 5KT3A 5LXRA 3J7AN 1E6VA 1PJ7A 3KK7A 4X62K 1JCFA 1MROB 3D1QA 3CNHA 2XMAA 2ROEA 2ZXHA 3MWPA 2MY7A 3RJEA 4XEIA 4W92B 2WAQF 2ZE2A 3DLGB 3H98A 4CEZA 2HMPA 1B0VA 3K57A 2GIQA 4LFBJ 3OHRA 1W2BM 1N8RO 1GQEA 2ALZA 1NHKL 3FK4A 3RJJA 1ECWA 1Z6RA 2VKRA 4NEZA 3V7KA 1RI7A 3W1YC 1UJ5A 3CD0A 1DQ8A 3SQGA 4PXCA 3WNFA 4EI2A 3EWAA 1N5YA 2RPIA 2IHR1 1HNZK 3BS7A 4O8UA 2BJ8A 3SAHA 2DO4A 2CQ2A 4KGMA 1YZ7A 2UXCJ 1XWLA 1KKHA 5I3QA 5FP0A 2LQ5A 4BRIA 3H2LA 3GFYA 9ICEA 3A3NB 5MAOA 3ZTPA 1B4SA 1HMVB 1B0PA 4UOFA 1EAYC 1IWGA 3RUBL 1PCAA 4AHVA 1A5VA 1FHTA 1B0XA 5D6GA 1VSEA 4IXCA 1C1BB 3MCOA 1SCJB 2FTRA 2VBYA 1NJIO 1D9AA 1FD8A 3NFAA 1Y5IB 4H4KC 1JL2A 2O8FB 2KNJA 2CPZA 2RAQA 1IBKK 4M45A 3MMBA 4LUBA 1R43A 3MR2A 4EFHA 2F40A 3FBCA 5J0SA 2MZJA 4J9UE 4NLDA 1IVZA 1ZQSA 1YHQS 1MU2B 3ZZZA 2VKQA 5AQPA 1Y10A 2B7CB 5IT9U 4H4MA 4PZNA 1RDCA 1JXLA 2KJWA 4LF6K 3WDOA 1HUZA 2WONB 4JI3K 3W5XA 3QU5A 3BF3A 1RXWA 3ZSZA 1SJRA 2FHMA 1VSJA 2XB2D 1BHNA 3ZDBA 3IO1A 4JS4A 4U67Q 1F9FA 3WK9A 1JRPA 5B0EA 5L8RC 1VYAA 3ASMA 3AD9C 4DG1B 2UVUA 2EC0A 4CE9A 3LP1B 5GAGP 1U1RA 1ZH5A 5BR8K 4KX3A 2YY3A 2BCSA 4OYIA 2RHSB 1KHVA 4NL9C 1T94A 3OTOK 1M1HA 3L4BC 3BGRA 4JI0J 2YWGA 4OV1A 1BWEA 1TL7B 1BU6O 3N9UC 2DR5A 2MSNA 4JK9A 2ZKTA 3SUOA 2YKMA 1VI7A 3UMGA 2ZTDA 1KVJA 4YOTA 1IBLJ 1NBWA 2J8AA 1O0PA 1N33J 3PX0A 4PXDA 4ED2A 3WNGA 3PSIA 4I6WA 2F8MA 2XS7A 3KK2B 3QYYA 1U0HB 4UUWA 2H3VA 2VJVA 2FVPA 2DWQA 4NXNF 4DV1F 4KY3A 1V6HA 1YJTA 4E7JA 3S6JA 3HFKA 1ZQXA 4CM2A 5KFKA 1F5AA 3OL9A 2DKXA 3QWUA 5AQZA 2HZCA 2W9BA 4IYQA 4CGZA 1T3VA 1J54A 2HNDB 2I9GA 1X2IA 4P75A 1HD0A 3OL6A 4UAUA 1FWPA 1OUQA 1SIWB 1VBKA 5J2NB 1EB0A 5KG0A 4IR1A 2QWMA 1OH7A 3I0RA 2AF6A 3PTWA 3ET6A 2BYCA 3SD7A 2O8DB 4F3QA 2ABYA 2WB1C 3D6JA 4PG5A 4OX9K 4CWBA 1RU1A 7ICMA 4LFBF 4CD1A 3H1QA 3TQ1A 3TAPA 2DF4B 3ZZUA 2GQ2A 3R5GA 1TL4A 2K8AA 4F93B 1N5SA 2RF2A 4USWA 4NOHA 4FS2A 1R27B 3K8WA 3PRVA 4P7VA 4KT0C 2Z58B 2IS3A 3H8JA 4KHPF 1JXEA 4PWDB 1PVRA 4M5DB 3VEWA 4KKOA 2MLXA 2P1JA 1P27B 4LIWA 4GKKF 2JZ5A 2FMSA 4RWXA 4IUFA 3FZLA 1BQMA 2QM1A 4DV2F 1RYSA 4FF4A 4U8YA 1XNRF 4JMUA 3ZX0A 3R2CJ 1KFDA 3BSNA 2ZG6A 2L9NA 4WIQA 5C25A 3KLGA 5J2FA 1WEZA 4TYBA 5J1EA 1JJHA 3F2DA 2D5RA 1H2VZ 2DHGA 2BA9A 4D3GA 3C23A 4M5GA 2LA6A 5L1LA 4FLZA 3CCEN 4IOAL 4CEDA 3I82A 1Q82O 2LYVA 2IM1A 1KFSA 1N32K 4P2XA 4CI6A 2ZHOA 4DPOA 1BD6A 3SZ2A 4M9HA 2JOQA 4FZLA 2A1JA 5J8YC 4IG3A 1CJTB 1UAWA 4FXWA 3QUQA 2FMQA 4C11A 2WF6A 1Z25A 2BDPA 3MK6A 4KHRA 4FNHA 4DR4F 9ATCB 4F8RA 2CWKA 5ADXH 3CJCA 3H4BA 3QEXA 2DTUA 2EFOA 3PCOB 3HP6A 4DUYJ 2J7WA 1WEXA 3DRXA 1HJRA 5FROA 1LWFB 3CW2C 2FLPA 3AA9A 1SJFA 4BC9A 3OVSA 1GX5A 1NB2A 3EGVA 5FD1A 4D3HA 5HMWA 3MEGB 4L3KA 5H1SV 4KI4A 4NLGA 3HFVA 1X3NA 3QT8A 2YNGA 3FEXB 4IWVA 1T05A 2JGUA 2ZIUB 3NGIA 4US8A 4Y2TA 1HUOA 5KL1B 4DQ8A 3O9RA 1T02A 4X66J 3CC4N 2H5EA 4PR6A 3IRWP 2FVSA 3OLBA 2KMDA 3I5BA 3AY0A 5JLHA 7FDRA 2J8SA 3PFOA 3POTA 1MWZA 2V34A 3OJUA 3H7HB 4GRSA 2I6WA 4UZBA 1WHYA 4OGCA 2K4HA 1X40A 4KLIA 2NS1B 5AXLA 2EBGA 2D0BA 2QKKA 3M8SA 5EE3A 2Y1IA 2R7OA 3FUYA 1TE2A 3VF0B 1S1UA 4FOEA 4YHHF 3HRGA 3BM7A 4J91A 4OJ1A 4U95A 5KPTA 4FLYA 2J7KA 2MKHA 5G0RB 4QPTA 5ALUA 1XMOJ 2FJEB 5DM6L 2LA4A 1DRZA 7ICQA 4AM7A 3PR4A 4IG0A 3QMQA 3S3OA 3R6GB 5JICA 3N7PD 3NS1A 2EQYA 3TZXA 4W5NA 1QQMA 4A57A 4A4JA 1TYQA 4ZVEA 3TTCA 1U9LA 4WFAL 1QAXA 3E3XA 3I1YA 2RILA 1CJKB 1XU4A 1FF2A 3G82A 1X4GA 3CDUA 3RBDA 1HI0P 3IUCA 3M2VA 2D1KA 3D2QA 1S1VB 5CAAA 1WUAA 1VC0A 3SPZA 3NL0A 4FKYA 3WIVA 4JI4J 3AD8C 1ZS6A 4CO2A 4DL7A 5J0RA 3ULHA 3GIMA 3IFRA 3NHGA 4NZ7A 3PMNA 4EEYA 2XMVA 3SMPA 4FBTA 4DB3A 3AMZA 4ED6A 1DGJA 3RJMB 2O67A 3QJLA 3D7EO 2C3YA 3M6VA 1PJ5A 1F44A 3HD2A 1HNVA 1VR6A 3OT9A 4KHMA 3E9LA 1FD2A 2FXUA 4PHTX 3ZZOA 3QEAZ 3GCXP 1LWCB 3CCES 2MY8A 2XMMA 3LWLA 1X66A 1XNQK 4CJTA 3RJKA 3M30B 1EQ0A 2DGUA 2L41A 2HHVA 2LQ9A 4QZHA 2UU9J 3FAHA 2IOFA 1ZBLA 2VFUA 2FPMA 3P3DA 1S3XA 2DGXA 4YDUA 4JI7J 2LP4A 3GILA 3CO0P 2UXDJ 5HJYA 2DNOA 4DV5F 1KHWA 3E58A 3R1LA 5D0EA 1RAJA 3QAUA 1J5EF 3T1YK 1S9FA 1JMTA 4Y6IA 1PBAA 3H1VX 3D1HA 3U1LA 2KVIA 4TU9A 4BDYA 1ZQLA 2W25A 4EP5A 4JI6F 3B4MA 1QVFR 3F2KA 2KXHA 2CQCA 1RLCL 3THVA 3FBBA 2FJAB 3ZSWA