1L3TA

Crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3'
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3tA01
2J6SA 5HLFA 4I9QA 2R8JA 3RB3A 3QIOA 2FLPA 2KFZA 3M8SA 7ICMA 2PYJA 1L3SA 8ICRA 4PPXA 8ICWA 1NK5A 5KGWA 1BIUA 3NTUA 9ICBA 3DYAA 1XSLA 4PHAA 3DM2A 4FJ8A 4B8AB 2H5XA 2ZTDA 3ISCA 2HVIA 1ZQHA 4I2PA 4DSLA 4TQRA 5KFQA 4DL3A 4YD2A 4RQ8A 4FCYA 1NJXA 5HRRA 2VANA 1ZQWA 3BQ0A 2XO7A 3VQ4A 8ICPA 2B21A 2VG5A 3TWHA 2RDJA 5KFWA 4DOBA 4RQ5A 4AHSA 3NCIA 2D5RA 1GOCA 3GIJA 3SQ2A 4MF8A 3SQ4A 1CLQA 4OGCA 3V1RA 3ZSOA 3MR5A 4QZAA 2HB5A 4ECUA 2ATQA 5CR0A 4CFBA 3SV4A 3AO3A 2G8WA 2YNIA 2BCSA 5L1KA 3C1ZA 4KHSA 3MAQA 4KB0A 4FJJA 2JZBB 4F4KA 3VQBA 3HO1A 2ZTCA 1K1QA 8ICCA 2NRWA 3SUNA 4YR2A 3L3VA 3ZSQA 3K2PA 2Z1JA 1ZQGA 3ISBA 3KTQA 4B9VA 7ICJA 1HNIA 4CGHA 5HROA 4YFUA 4MFCA 4W5QA 1ZQFA 8ICZA 4DTXA 2W8LA 2AJQA 5DG7A 2HVHA 3LP0A 1CXQA 1UOCA 2AQ4A 5KFTA 5CWRA 1N6QA 4F4WA 3OYHA 3G6XA 4RQ4A 1XSPA 3TFSA 4B9UA 4I7FA 4O44A 5KG0A 4QZBA 3MGIA 4M6WB 3H40A 2Q3SA 3IG1A 4ECQA 1RBVA 1D9DA 1ZBFA 4R63A 1EETA 4FJNA 1JN3A 5L1IA 3OYDA 1JL1A 3K4GA 2XGPA 1RXWA 1NK6A 2VWJA 4NYNA 9ICCA 4FJHA 1WAJA 2C28A 3RJFA 5SZTA 3B6OA 5J0OA 2V9WA 1EX4A 2A1JB 4QZ9A 3LWLA 3KD1E 4FZZA 2NRXA 5CY4A 4EEYA 1RYSA 2XHBA 3MABA 8ICIA 1ASUA 4QWCA 1NK7A 1QTMA 4RQ7A 3NGYA 4Q5VA 3G6VA 3AVFA 4EP5A 3TARA 1TKTA 3BJYA 3Q8LA 3OYEA 1KFSA 4J9RA 1VSFA 3QERA 1ZJMA 3KLGA 2ZJ5A 1ZBIA 4QZDA 3MR2A 4DSJA 5KRTA 3OVNA 1S6QA 4FO6A 3KLHA 3GV5B 3V4IA 1AROP 1A76A 4LSLA 4GC6A 1BPBA 1BPYA 1CEZA 2C22A 3LK9A 2IMWP 4CHPA 1ZQLA 4OGEA 3M9MB 2QXFA 5JS1A 3NF8A 4IR9A 4CHYA 2XRIA 4DOCA 1HPZA 2BANA 3O3FA 4NCGA 5DBCA 4KLJA 2O4IA 5KFVA 4DFKA 3UXOA 4O0JA 3TAPA 2PI4A 1KFTA 3LAKA 3HPGA 3DRRA 8ICNA 4CESA 5L9XA 3P1GA 3N4MB 4IQWA 4K8XA 4DTJA 1ZQOA 3LWMA 1S9FA 2B6AA 4MQ3A 4ECSA 5KFZA 4C8LA 3ZSVA 2WTFA 3PNCA 4K8ZA 4RPXA 1TL1A 7ICTA 2BPGA 1JIHA 3OS0A 2DFLA 3EY1A 2AGQA 4F4ZA 4CGGA 2P6UA 4QZ8A 2XGQA 4EP4A 2P66A 1B9DA 2MUTA 4PUOA 3DLGA 4AHUA 4NYFA 4KHUA 1ZQQA 2D0BA 2W9CB 2R8GA 3P83D 7ICGA 5KT2A 3VA3A 4KITB 3OYAA 4ED6A 1BCMA 2I5JA 2DTUA 4J2EA 1XU4A 3QZ8A 3CM5A 4Q8EA 3QIPA 5DG8A 3RH6A 3NE6A 2HHTA 3RJIA 2AGOA 2IDOA 5C5JA 2BQUA 2F96A 5KG3A 1KRPA 4CJKA 3DOKA 5J0PA 1S9EA 3JPTA 1C6VA 1WCLA 3SZ2A 4NCBA 7ICSA 3ZCMA 4CJSA 4C8MA 1W9HA 4GXKA 4DL4A 2IHNA 3AVLA 4KLOA 2JEJA 1WSFA 1ZQTA 8ICMA 2XC9A 2BDPA 1KTQA 3O4QA 3F73A 3QESA 4Z4HA 3Q8QB 4GMJB 4N76A 3OY9A 4O5KA 3P5JA 4TUSA 2X6NA 3OYNA 8ICBA 2RDIA 3PW4A 4RU9A 1NK0A 4MEXA 3H7IA 1C0TA 8ICXA 1S1VA 3CYMA 2P6RA 4HUGA 4DTNA 1VK0A 5J2CA 1LWEA 1RCHA 3VQAA 2LSNA 3VQ6A 1VSLA 4M42A 3ZDDA 1EP4A 3HJFA 2EX3A 3ZT2A 2PY5A 4KTZA 1ZQRA 3ORYA 3UQ0A 4KHWA 1TKXA 3H4DA 3QEAZ 3V6JA 3Q8PB 1I3AA 3MXMA 1QSYA 3GFKB 3OS2A 5KFYA 5KFFA 4M47A 4JK1A 2ZJ8A 3C6TA 1TL3A 4PHDA 4C8OA 1Y97A 4CHZA 1TFRA 4G1QA 3CG7A 5KFCA 2YNHA 4DQPA 3JPNA 3AA2A 4KB1A 4R5PA 2NRTA 4MF2A 3GIIA 4O55A 7ICUA 3ETLA 3RMCA 1KDHA 5DB8A 3L2VA 3V9WA 2QKKA 2HHWA 4NLGA 1TK0A 3LPUA 3PX6A 3WNHA 4QW9A 1U4BA 4FK0A 2VWKA 4Z4CA 1L5UA 4OKJA 7ICHA 2KZMA 4FM2A 2FC0A 1T3NA 3HXMA 3RB4A 1O1WA 2X74A 3TAQA 1BPZA 3KHGA 4E3SA 5JS2A 3K5OA 9ICPA 1X9WA 3NGDA 1RT7A 2ETJA 2FMPA 3UPQA 3KK1A 2ISOA 4DSFA 9ICVA 3OJSA 4PHEA 2OPQA 3NH1A 5KFSA 4CK3A 3LP3A 4F3TA 4HTUA 3D45A 5EWGA 3KKRA 2I1QA 4LH5A 5IIJA 4YP3A 3KLFA 1TK8A 4KN4A 1I39A 4EBDA 2ASDA 4J2AA 4CJWA 4CJ4A 4RQ3A 5KFUA 2QKBA 3OYKA 3S9HA 3FDSA 4I27A 4KREA 5KG6A 3V7JA 2Q0ZX 5BPCA 4X5VA 4IG3A 3EWAA 3NAEA 5DB6A 4CJ5A 5KFIA 4RG8A 5J2QA 5KFXA 4F8RA 4DQRA 5JUMA 1KLNA 1WNSA 2R7YA 3LALA 2ISPA 3HVTA 2UVUA 4I2JA 8ICAA 2X78A 1HYZA 3QEIA 5DBBA 1GOAA 4F4YA 3EYZA 4Z0UA 1TVAA 1ZQXA 1K6YA 2DFEA 1S97A 4DU1A 9ICJA 3V9XA 4YFKA 1NK8A 3CQ8A 5DQGA 3PMNA 4YNQA 4Z6FA 1JMSA 2ZE2A 3AVKA 3FYHA 4MEYA 3AVNA 1UAXA 4MFAA 4K4GA 3DLEA 4M04A 4CGIA 3LP2A 4GW6A 5FDLA 1RT1A 4M3XA 1GOBA 2KZZA 3RR8A 3C2KA 5J0WA 2GUIA 3PR4A 5KFOA 1SZPA 4TQSA 4CF8A 4M6WA 4RW4A 5KFNA 2BCUA 4Z6CA 3L3UA 3THVA 2J6TA 2UVRA 1BQNA 3N97B 1RDAA 3KD5E 1T7PA 5FRNA 4CJPA 5DLFA 5D3GA 3NGZA 4C8KA 5J2MA 4M9NA 2C2EA 1KVBA 4HYKA 3MXIA 4JS4A 2BCVA 3ZSRA 5DGAA 2B4JA 5DLGA 4ECTA 9ICLA 5J2JA 1RBTA 4FLVA 5FRMA 2GV9A 4BXOA 1COOA 1ZQIA 2ASJA 1JX4A 4M3RA 2BPCA 3KK2A 4F3OA 1JKHA 3JPPA 3VA0A 1WSJA 1QSLA 1B22A 2HHUA 4RT2A 2XY8A 2RF2A 3JPRA 1HUOA 4KLDA 3AA4A 3QEBZ 3O3HA 3ZSYA 9ICMA 1UA1A 1JLQA 3TANA 5KTQA 1BPEA 7ICRA 3NFAA 3LPTA 1UA0A 2DPIA 1N48A 1T03A 2X6SA 4CEOA 4FJKA 4YCXA 3Q8MA 2BE2A 5J1EA 4KI4A 4OJRA 3RWUA 4IQUA 5CYMA 3RR7A 4I2GA 3ZT4A 3OJUA 4QZIA 3QZ7A 5KT4A 1XHZA 3HWTA 4W5RA 3PV8A 2V4QA 2IGIA 2I9GA 3MEEA 5IIKA 1RBUA 2ALZA 7ICPA 3AO2A 4KKOA 3AA3A 8ICQA 1QE1A 4UBBA 4DFJA 2DFHA 1ZBHA 1XSNA 1LV5A 1EKEA 1X2IA 3OYMA 5J2NA 3DLHA 4DTMA 4UQGA 4W5NA 5KG2A 3QNNA 4F92B 3OSPA 1Q9XA 3V1QA 1FKOA 4NXZA 1CUKA 2ASLA 8ICGA 2DPJA 4LY7A 4I9LA 5HMMA 3NHGA 4DQIA 4JLHA 1SL0A 4FYDA 3ZT0A 4ELVA 2YV0X 4HCCA 3PX0A 2XCAA 4IRCA 4XQ8A 2OPRA 4HUFA 2RPIA 5E41A 3HYFA 4EZ6A 3JPQA 1HRHA 4BE0A 3C2MA 2YNGA 1H38A 4DWIA 3AVCA 8ICKA 3VQ5A 1NJZA 4AHTA 4NCAA 4QZHA 7ICEA 5IIMA 2P51A 4FJGA 4TUQA 3JYTA 1J5OA 3C23A 3OYFA 2W9BB 1IG9A 1RTJA 5HBMA 2HNZA 3UIQA 1KFDA 4ELUA 4KLGA 3LDSA 5BOMA 3S3NA 5HHIA 3PVXA 4RNOA 1VSEA 2ZQBA 1S1TA 1S10A 1RBSA 4KI6A 9ICAA 3RB6A 3T3FA 1C7YA 4OKEA 5KFDA 1DTQA 3AVHA 4FXDA 1C0MA 4GC7A 1IKYA 9ICQA 1BL3A 4M9JA 3DOLA 4M41A 3K5LA 4CE9A 4QW8A 2R8HA 4KLFA 4CF9A 3MBYA 3TAEA 2MUTB 5FROA 1ZQPA 1U9LA 1X9MA 2OPSA 4AH9A 1ZQZA 1ZETA 1LWFA 1IH7A 7ICIA 3ITHA 4CJVA 1Z26A 4IRDA 1C1AA 4KO0A 4JV2A 5C25A 3KK3A 4O3OA 1LWCA 4J2DA 1JLEA 8ICVA 5DB7A 1VSJA 4UB2A 1TKZA 3C6UA 1Z25A 1HMVA 4CJTA 4O3NA 3UXPA 4FBUA 1QHTA 1KVAA 1DGSA 2FLLA 1ZQDA 3MEDA 4OPJA 4Z6EA 5T7BA 4BDYA 3AO5A 4H4MA 8ICYA 3RBDA 3HSTB 1HNVA 9ICEA 4KPYA 1BGXT 1LW2A 5KG4A 4EZ9A 2F1HA 1BI4A 1BQMA 4E7JA 4DU3A 2HMIA 4DSIA 2Y1JA 1RT4A 1NJYA 2WOMA 2VG7A 4FW1A 1J54A 3SQ0A 4KN7A 3AU6A 2BPFA 3MXJA 4M3WA 3AVAA 3G6YA 1TKDA 2OA8A 3PR5B 4BGDA 1WLJA 4ECWA 2HHQA 2FBVA 1LAVA 4DG1A 4E7HA 1NOYA 4LSNA 5J2BA 1IKWA 3LP1A 4CEQA 4FLZA 4PWDA 2G8FA 5CYQA 4CFAA 2A1SA 3QLHA 5HRNA 5SWMA 4ID5A 4FLXA 4YG2A 4MFBA 5DK5A 4ZHRA 4Y1CA 4J9OA 1RTIA 3MDAA 5EOZA 2PI5A 1S1WA 1RT5A 1BVSA 5K14A 1KVCA 3ZT3A 3V81A 2IOCA 4JV1A 2W9BA 3KLIA 3QO9A 3CFRA 4B8CA 3G0ZA 4DL7A 1A5XA 5IIOA 1TGOA 5J0SA 3T5JA 1BPDA 1LB2B 5C42A 2G8UA 1S1XA 2O4GA 3M9OB 4CJUA 4J9KA 4FJ5A 9ICRA 4RNNA 4DL2A 4I2CA 1B9FA 4LH4A 1CXUA 1DOQA 1WSHA 3RRHA 1ZQVA 2FMQA 4M9GA 3DRPA 3IS9A 3SI6A 4CF2A 1FKPA 9ICTA 1JXBA 3QINA 4F2SA 2VG6A 3IHQB 2A1RA 4FJIA 4Q8FA 3RJJA 2C2RA 3GV7B 1ITGA 4F5NA 3TFRA 4P4OA 4B3OA 4KAZA 3HK2A 1RDDA 4IQVA 3OYGA 4HHTA 3C2LA 3CFOA 3Q8SB 3PY8A 3M8QA 2OPPA 4JS5A 4YR3A 1MQ2A 3V9UA 4M0AA 2F1IA 2FMSA 4O3SA 2JZBA 1Y88A 1K1SA 4FLUA 1NJWA 3EW9A 1C1CA 3K5NA 4J9QA 1ZQUA 4XRHA 1YTUA 3OYLA 2FPLA 4I2AA 5KFKA 2ZUBA 4CJRA 1RPLA 5J0RA 4CIFA 3AVIA 3RAXA 4CGDA 4EYHB 5TZVA 3I0SA 4QZFA 3HM9A 4CEZA 4DS4A 4PGQA 4B9TA 3DLBA 4DTPA 2IS3A 3KIOA 1T8EA 2DFFA 3K5MA 4JRPA 4KLQA 8ICJA 3TAFA 5EWFA 4PGXA 4DEZA 4I2QA 3BGRA 3H08A 3SJJA 5DKWA 3LZJA 2Z1IA 1BISA 1ZQKA 3E01A 4EYIB 4AHCA 2G8KA 2NRZA 7ICFA 1QSSA 4CEAA 3NF9A 3ZDEA 3U6FA 5J2GA 3SCXA 2KN7A 5KFBA 1FK9A 3VQEA 3NH0A 4J9LA 3MFIA 4KLTA 1U45A 2W9MA 1DTTA 4QCLA 2QK9A 2NRVA 1WCNA 1BCOA 3C95A 4ELTA 1NK9A 3O4NA 4Z4FA 3S3OA 2P1JA 4R64A 5J2EA 3AUOA 3C94A 4TURA 1D5AA 4Q0BA 8ICTA 1TV9A 1NK4A 2FPKA 4FJMA 4B08A 7ICOA 1JLBA 4J9MA 4CHQA 3O3GA 3OYIA 4ED7A 2OZSA 4IBNA 4M3ZA 9ICHA 4I2BA 3K59A 1XI1A 1ZQCA 4RW7A 3L2UA 3MR6A 3VQDA 2XY5A 5DGBA 5IIIA 2BR0A 5I3UA 4DLEA 1ZQYA 3VN5A 4TSXA 2AQ0A 3FFIA 4F5PA 1L3VA 2JEFA 5HNKA 3CFPA 5KFHA 5KFPA 4YR0A 3SUPA 3ALYA 4KFBA 5DQIA 3PW7A 1N56A 3ZDBA 3BDPA 1RZTA 4WE1A 4IRKA 3A2FA 2KQ2A 5KRSA 4EBEA 3KHRA 2FBXA 4I2DA 4C8NA 5J0TA 1ASVA 3V72A 4O3QA 2RKIA 1IO2A 2VA3A 1SL1A 4RW8A 5KT7A 4R65A 2MAXA 1Z00B 5KT6A 3M9NB 1XHXA 1Q9YA 1RT6A 4KHYA 4CHOA 3SNNA 4ZH4A 4BDPA 5HRPA 3RJKA 2BCRA 1JLFA 8ICOA 1G15A 3WNFA 3L8BA 2HW3A 4J9NA 3RBEA 4AHRA 4FLYA 3Q8KA 1NKCA 5KFMA 1HYSA 4QAGA 2M9NA 2LYHA 4DLGA 5KG7A 4O3RA 3OYCA 3TAGA 3L2WA 1ZYQA 2HHXA 4DOAA 4YQWA 4L8RB 3TABA 5DBAA 1JLCA 5F9NA 4LZGA 1YT3A 4CK1A 3V6HA 4FS1A 3NBPA 2PFOA 4O5BA 2E4LA 3HP9A 4JUZA 4E1NA 2ATLA 4F5QA 3LAMA 2W9AA 7ICVA 4FJXA 3QEXA 3T1AA 3LZIA 4ED0A 5CP2A 3RJEA 4E89A 4Y1DA 3PUFA 4CIGA 3KHLA 1IM4A 1RT3A 2RN2A 3JPSA 1RNHA 2ZD1A 2G8HA 1RTDA 1JXEA 5CA7A 3RTVA 3H4BA 2XY7A 4O9MA 3SV3A 3VQ8A 1PZNA 4KLHA 4ICLA 3C1YA 3VQCA 2C2DA 2GBZA 1TAUA 4N56A 3NF6A 4W5TA 3V9ZA 5CZ2A 9ICFA 2ZUDA 4KHNA 3U3YA 1HQUA 4NLKA 2E6LA 3HPOA 4ZTJA 4Q43A 2PFPA 1X1PA 1RDBA 8ICSA 4CF1A 4ZTFA 5CHGA 3AVBA 3OS1A 1Z00A 1HYVA 1KCFA 4P4PA 1S77D 2GWSA 4GLXA 4F5OA 3QE9Y 2KW4A 1CZBA 3TR8A 3ZD8A 3HP6A 3T5KA 4CERA 4LD0A 3QEWA 4P4MA 3KLEA 3MR3A 5KG1A 5KFJA 3PW0A 4DTUA 5I42A 1XS9D 4RPZA 4QWBA 1NKBA 3H8WA 4K4HA 1YVUA 4QWAA 5IINA 4UB1A 3TQ1A 2R8KA 1W0HA 2VA8A 1N5YA 4O0IA 4RQ0A 4KTWA 3OYBA 3JSMA 2JGUA 4CECA 1S9GA 3V6DA 2YHAA 4FZYA 1WSEA 2ZUCA 1JLGA 1QS4A 3QETA 4NM2A 5D49A 4YN4A 3H8SA 2EHGA 2A1JA 4F4XA 4QWDA 3V1OA 1U04A 1REVA 4I2FA 2Z1HA 1BIZA 3NDKA 1F21A 4B9SA 4AHVA 3RMAA 1D8LA 3GDXA 2FBTA 1MC8A 4KLIA 4KLEA 4CEDA 4F50A 4J9PA 1SKRA 5J0YA 4HCBA 5D4BA 3BQ1A 3ZSWA 5DMRA 4LZDA 4FS2A 3KHHA 4ECRA 3B0YA 4UB4A 3ZSZA 4RQ6A 2B5JA 5KT5A 4UB5A 4G3IA 3C21A 4ED2A 2PZSA 2J6UA 3RMBA 4FJLA 4YMMA 1S1UA 4R8UA 3MDCA 3OHBA 3AO4A 5HHHA 4PGYA 5DDYA 9ICKA 1ZQEA 3M8PA 5KFLA 2Y1IA 1SUQA 5F9LA 3OGUA 2BQ3A 3NF7A 4RZRA 4DF4A 1NOMA 1D9FA 4Z4IA 3KJVA 2BQRA 4DSEA 9ICIA 1TVRA 3RH5A 1L3TA 1BHLA 4ECZA 4DS5A 3RAQA 1VSIA 4GVMA 3RMDA 4Q44A 4M3UA 1SKWA 1JLAA 4FLWA 4BWJA 4YVZA 4KLMA 2PYLA 5DDMA 4E7IA 4FM1A 4CEBA 4PY5A 1Q8IA 4RW9A 2BGGA 3H8JA 4DSKA 4BXOB 3DI6A 2UVVA 5EU7A 4KV8A 4B9NA 5J0QA 4KLUA 4P2HA 3B0XA 4OLAA 5J29A 1KEJA 1SV5A 3V9SA 3AV9A 3SUOA 3HT3A 5HRSA 3AVMA 2AU0A 3VQPA 2YHBA 4CIEA 4UAZA 1ZJNA 4M9LA 5KGXA 4DO9A 3T5LA 3B6PA 4DMNA 3GILA 3BQ2A 5KG5A 4I2EA 4QOZB 4CF0A 4N47A 3PX4A 4UB3A 4KLSA 3WNGA 9ICWA 3GQCA 1VRUA 4RW6A 1ZQNA 1MSWD 4IG0A 4DU4A 3C5FA 4CJ3A 1S0VA 1ZQBA 2PFNA 4OVLA 3NGIA 3OHAA 8ICEA 3K58A 5J2HA 3AU2A 1B92A 4HUEA 8ICUA 2AGPA 2OWOA 4M9HA 1KSPA 4RQ1A 4RUAA 4H4OA 4CCHA 3T19A 4FK2A 2V4RA 3RB0A 2BCQA 4Z4EA 5C24A 1RT2A 1ZQJA 4O5CA 4E0DA 1S0NA 3RH4A 1EXNA 3HW8A 3SPYA 5KFAA 4PHPA 3LDAA 4N5SA 1QQCA 2IHMA 1XC9A 2ZJAA 4I29A 4QZEA 1A5VA 4CFDA 2ZTEA 2FBYA 2D0AA 3SUQA 4CGFA 2IC3A 3S3MA 4BWMA 1UT5A 5KFEA 1U47A 1XWLA 1WSIA 3EPIA 4B9LA 1WN7A 4DFMA 5HMLA 1HJRA 3DLKA 4TUPA 5J0UA 3BQTA 3ZDCA 1A77A 1ASWA 3VQQA 1NOZA 4O5EA 4KLLA 5BOLA 4IKFA 4RT3A 2BKEA 5KT3A 2F1JA 3L2QA 2W42A 1RTHA 4ED1A 4YXJA 3ZSXA 2P5OA 3GV8B 2HHSA 1TAQA 3RRGA 4I2HA 1JXLA 2W9CA 1XO1A 2HNDA 2FPMA 4O4GA 3WNEA 3VQ9A 4ED8A 1VSHA 2UVWA 5L1LA 9ICNA 4DTOA 1KLMA 3U3GA 1HUZA 4CK2A 4IR1A 1S0MA 4DFPA 4QZCA 3M8RA 1IKXA 4CEFA 1HJPA 4YD1A 3V6KA 3VQ7A 3AVGA 1RBRA 4JWNA 3HPHA 4FK4A 3MEGA 5KFGA 4DL5A 4BDZA 1S76D 3GIKA 4IQTA 2BHNA 4XA5A 4CJFA 5D46A 3LANA 4Q45A 1EXQA 4R8UB 2ITGA 3V7LA 4F2RA 4YMNA 4BACA 3MECA 1ZBUA 4RNMA 4KRFA 3IM1A 1FXXA 3AA5X 2FLNA 3OSNA 3IRXA 1ZQMA 1RDCA 5IILA 3SYZA 2IBKA 2KZ3A 1CZ9A 3HX0A 4M45A 3I8DA 1WAFA 2KTQA 4I2IA 4FZXC 4DQQA 9ICGA 1NKEA 3RJGA 7ICQA 4F5RA 3ZDAA 4N41A 4E19A 3PO4A 3SI8A 5EWEA 4OKKA 4E7LA 4PQUA 1SKSA 3JPOA 2KFNA 3V7KA 4BE1A 1RILA 5J2DA 3EPGA 3PW5A 3KKSA 2G8VA 4FM0A 4UAYA 1ZQAA 3SQ1A 1MQ3A 1D8YA 4I28A 2NUBA 4UAWA 3ISNC 3Q8RB 4ID1A 4IFVA 1U48A 4GXIA 3TAMA 3ZT1A 2VA2A 1JL2A 4JWMA 4YMOA 1ZQSA 1ZBLA 3GIMA 3D0PA 4JRQA 2JEIA 1IKVA 5J2FA 2R8IA 3ZD9A 4IFYA 4W5OA 3PO5A 1UWBA 3DLRA 2F8TA 1IXRA 3HL8A 7ICNA 3RJHA 4M2YA 4GXJA 5KFRA 4DTSA 4J2BA 9ICSA 1RYRA 3K75D 4J9SA 3HVRA 9ICOA 4FJ9A 1VSKA 1YTAA 1TV6A 4QWEA 1J9AA 8ICFA 4PA1A 4ECYA 2IA6A 3MFHA 4DTRA 4B9MA 1VSDA 3CM6A 4AILC 5J0XA 2HNYA 2XY6A 3AVJA 4RQ2A 2P5GA 2PFQA 4OLBA 4R66A 4BE2A 3PW2A 5CB1A 4EBCA 3ULDA 4K4IA 5DB9A 1C0UA 7ICLA 2YKMA 3T5HA 1S0OA 4QZGA 4DQSA 3DMJA 1BPXA 3E2EA 1WSGA 3MGHA 4FLTA 5J2AA 1BI4B 5L1JA 4CFCA 9ICXA 4RPYA 4UBCA 8ICLA 4F91B 3AO1A 4KHQA 4KMUA 3UQ2A 1RXVA 4CJQA 4RUCA 1LAWA 3QEVA 3NH2A 3I0RA 2PXIA 5DG9A 2YKNA 1U49A 1Z3EB 1L3UA 3IAYA 4XUSA 1A5WA 4FBTA 1TK5A 4MFFA 1LW0A 1T05A 2OZMA 2W8KA 4LVSA 3SPZA 1SL2A 1C1BA 4FW2A 4DL6A 4ECXA 5J2KA 4PH5A 1S5JA 4OPKA 4XIUA 4F93B 2BGWA 2YNFA 2HHVA 3ASMA 4Z6DA 5J2PA 4NY8A 2E6MA 4NLZA 4FVMA 5HP1A 1V9PA 3QNOA 2OYQA 4IDKA 4DF8A 4CJLA 3F9KA 8ICHA 1VSMA 1HQEA 4FJ7A 2XCPA 1DLOA 3L2RA 7ICKA 5CZ1A 4M3TA 1QLNA 5CJ7A 5DQHA 3ISDA 2Z1GA 1S6PA 4M3YA 2DY4A 5KI6A 3TI0A 1VRTA 4YXMA 4Z4GA 4HVJA 4CJEA 4E1MA 1B43A 2WONA 1X9SA 2D0CA 1J53A 5HP4A 4KTQA 1MU2A 4E7KA 4O3PA 3C5GA 2F8SA 2IAJA 4CEEA 2G8IA 4JV0A 2JEGA 3EZ5A 3G10A 3QEPA 1T4GA 4ECVA 4NM1A 3OYJA 4H8KA 3UXNA 3K57A 4NLNA 4ED3A 1UT8A 5J2IA 2JLEA 4CHNA 4CGJA 9ICUA 3DRSA 1R0AA 3PMLA
chains in the Genus database with same CATH superfamily
1X9XA 2E3TA 1JALA 3OW2M 2Y0SC 2J6SA 4I9QA 9ATCB 3M8SA 2PYJA 2N3LA 8ICRA 1BIUA 3NTUA 2YH1A 5ETKA 4F67A 4ZPAA 2KG5A 4FF4A 4CQ1A 4CWBA 2LQ8A 4OZNA 3ISCA 5DM7L 5LJ3Y 4BRPA 1BQMB 1GLCG 2Y0SF 2WBRA 2ZBCA 3THWA 5AZJB 4YD2A 3O5BA 4YB5A 4DR5F 2GQ2A 3NS5A 5HRRA 3MMBA 2XO7A 3VQ4A 2R4FA 2VG5A 2IPOB 5KFWA 3FK4A 4FZNA 4RQ5A 2Q97A 4ZP6A 2HIQA 3I0RB 1TUUA 3SQ2A 3PACA 4MF8A 4RCHA 1CLQA 4C7YA 4OGCA 2OFGX 4FWMA 4C3KA 4H0VB 2EFQA 2WB4A 3V1RA 3PEHA 5CAAA 2OPQB 3M32B 1HNWK 4QZAA 2HB5A 4ECUA 3MOZA 3C14A 4RW9B 4LFBJ 1C1CB 4CLLA 2JC0A 2BCSA 5L1KA 2Q6CA 3C1ZA 4KHSA 3EVMA 3MAQA 3HI0A 4O8KA 5MAOA 1WHXA 2UZAA 1FFWB 2WVBA 1YGYA 2KO1A 1K1QA 2XHCA 8ICCA 1F5SA 1FNOA 1WEZA 2DNZA 3BGUA 4P10A 1ZS6A 2OGUA 1U1RA 2YX4A 2XSFA 1JJ2M 3ISBA 4B9VA 4AM6A 1RHUB 2GJFA 4NWBA 4CGHA 5HROA 5AHXA 1DFDA 4W5QA 4DTXA 2X1BA 4P2FA 1HNXJ 5DG7A 2HVHA 3QT7A 1N6QA 1TV6B 3KKAA 2BACA 3A4TA 2Q1NA 1V3ZA 1H7XA 2GVZB 2F7TA 1KC8T 4A8OA 2V8VA 2FSJA 2V8HA 4I7FA 2ZIUB 3NKYA 4O44A 3DLKB 5HSPA 3SMPA 2IM2A 1RBVA 1ZBFA 2OLWA 4FJNA 3OYDA 2XGPA 3LGHA 1NPPA 4A61A 4NYNA 4FJHA 5HL7Q 5SZTA 3D2SA 2EZZA 5J0OA 4YY3J 5FDLB 2E44A 1SIJA 2ROPA 2F4VF 5JLHA 3AFGA 1V3SA 2VPZB 2XWYA 1VQLN 3NXZA 1S72S 5F3TA 3MABA 4X66F 4ZK7M 1SQKA 1H98A 2FSKA 1XO0A 1NK7A 1QCKA 1VQ8N 1GXTA 4RQ7A 4US8A 4H4OB 4Q5VA 3AVFA 1A6LA 2CQ1A 2KJ5A 2XI9A 1MWKA 2CIMA 2GJ2A 4F3QA 5JRTA 1NXIA 1FKOB 1YJ7A 3HFKA 4OYIA 2P6TA 2V2QA 2ZJ5A 3CDUA 2DNKA 2PEHA 4ZVHA 2D3ZA 3KLHA 4ZA1A 4B3TK 2V8DA 4LSLA 5DZ7A 2L48A 1JCFA 1BPBA 1CEZA 2OHFA 2A0FB 1S4FA 2IMWP 1LW0B 5F8NA 3NF8A 4IR9A 4CHYA 3C7NA 1HPZA 2BANA 5DBCA 2QW9A 5KFVA 3MM5A 3CP8A 2VC0A 3LAKA 3HPGA 4CZJA 4U67Q 2JLFA 4KV8B 4IQWA 1HPMA 4DTJA 3MEGB 3H46O 3SENA 2B4UA 2QYCA 2GIRA 4KYZA 5KFZA 1JLAB 3ZSVA 1KKXA 4K4ZA 2CG4A 2BPGA 4UB8U 4PZOA 2OPSB 1OPIA 3I31A 2DFLA 4BRKA 2O66A 2YKMB 4NWIA 4F4ZA 3CC2S 3RFAA 5J8YA 4EP4A 3CC4N 2MUTA 2CQBA 5K5MA 1JUDA 4KIAA 2W9CB 1U7LA 5KT2A 3AL0B 3OYAA 1BCMA 2I5JA 2E1YA 1T95A 2DTUA 3DRRB 4P0QA 4OX6A 3V2UC 3IRWP 3CM5A 3QIPA 1R8HA 3RW7A 1UHUA 3HCXA 2HHTA 3NE6A 2AX0A 2HURA 1A0PA 2LDYA 3R5BA 3W7BA 5C5JA 1QUPA 3GBTA 2CVIA 1M90T 2ESEA 1S9EA 4UUXA 4RW4B 3K5PA 3O8WA 4PRFA 1HX1A 3DGPB 3ZCMA 4Y2JA 4C8MA 4DL4A 1HJOA 3O80A 4K0KF 3AVLA 2JEJA 2H4WB 4KGXB 2RKIB 2C2NA 3UDEA 4X4SA 2XC9A 4WU2A 5D4LA 3VZHA 4Z4HA 1NGHA 4N76A 3P5JA 2X6NA 1LVHA 3D6RA 4YDDB 3D9BA 3KMSA 2HOIA 3PW4A 1Y4ZB 4RU9A 1NK0A 4MEXA 4DV4F 3H7IA 3VQSA 1VIOA 8ICXA 1EB0A 3WC0A 1S1VA 5LOQA 1CJVA 4WP9A 1S99A 4U8YA 2ZOFA 4ZCMA 3VQAA 2LSNA 4LR7A 3FC4A 3ZDDA 2KIWA 1EP4A 4DX8H 1FHTA 3ZT2A 4P74A 4KHWA 4L76A 3QEAZ 4EO8A 3TQEA 3Q8PB 3P3DA 4QPTA 1I3AA 4K5RA 3ED5A 4OZ5A 2CJKA 3RU0A 3N79A 1NU4A 2M8HA 1DKGD 2FF3B 1TFRA 1WI6A 2JXJA 3B8HA 2E5LJ 2MZRA 5HVGA 1PKUA 4JI3F 3JPNA 3AA2A 1M5KC 2JOQA 4NRTA 1KQSM 3ETLA 3CQYA 1FO1A 2ZIXB 3T1YF 3FQLA 2HBRB 1RAEB 3WNHA 4FK0A 1RE1B 1L5UA 3BSOA 1I94F 1L7MA 4CLKA 2FC0A 1T3NA 5JTIA 3HXMA 1WHVA 4TKTA 5ETLA 1BPZA 1KS2A 2VQFF 2W2MP 4LQ9A 4ILGB 9ICPA 5KOWA 2QMUB 1GLEG 1RT7A 1TVRB 4USVA 1IG8A 2QIFA 4LVOP 2ISOA 2BJ9A 1Q7YT 1ZTWA 1U1MA 4B3MK 3MI7X 3QNMA 2H1YA 3CC4S 3K17A 2DCLA 1A9NB 4JKHA 3KDOA 4CZCA 4X62F 4QJVA 2I1QA 3EGVA 2VJ5A 2C3OA 3KLFA 2BANB 1I39A 4CM0A 2ASDA 4Q7AA 1XMOF 2K4IA 1AA1B 1TUYA 3OYKA 1V5VA 3FDSA 3MURP 1X5SA 4KREA 6AT1B 9RUBA 5KG6A 5AM0A 4Y2SA 1HBOB 3ZZZA 3MMCA 4LMZA 3EWAA 3G2XA 2GA7A 3QJLA 5J2QA 5KFXA 5GAGI 4IUFA 4A8SA 2LM4A 5DDOC 1NJIO 1M5VC 1GXUA 3C29A 1PJ6A 2E2OA 8ICAA 4BHQA 1GOAA 4F4YA 3EYZA 2CPDA 1R8BA 2QLFB 5DM6Q 1VBYA 1ZQXA 3ILLA 1S97A 2ZH4A 2VG6B 2FZKB 3OTOF 3CQ8A 2E5HA 3FCHA 1HR0J 4YNQA 3ZZUA 4X4PA 4Z6FA 1JMSA 2B7CB 6FDRA 1FIQA 4MEYA 2VPXB 2ZVIA 1K9MO 5FDLA 4NL9C 4GW6A 2RD5C 4M3XA 2Q6BA 3BPSP 4OQJA 2DXFA 5F0XA 3PRDA 1GOBA 3CPWM 4FYWB 3AA8A 3K2YA 4Y34A 1FFSB 2F9DA 2DKOB 1N63A 3V81B 3MMCB 3MPDA 5D78A 2VONA 4M6WA 1K0VA 4ZLLA 2WONB 5LMUJ 5SUHA 5IT4A 2GX8A 3PEJA 3Q24A 3OVAA 5FRNA 2HG4A 2HZCA 3PNIA 2IFXA 4C8KA 5J2MA 3PKMA 4KQZA 1O0PA 5E2QA 4PZVA 3MXIA 3NOCA 4USKA 2BBEA 1O51A 4TY9A 1OH7A 9ICLA 3MM6A 4L3KA 4HR2A 3VVUA 3ZX2A 2YWWA 5FRMA 5ETNA 5EY4A 4B3TF 1J5EF 1BMQB 1L6NA 2RUGA 2ASJA 4F3OA 1V9OA 4I67A 1WB9A 3KBBA 3R2CJ 1RT7B 3E01B 3MPUB 4ZVEA 1WSJA 1IBCB 1Q78A 1RTZA 3TTFA 1QSLA 1B22A 2HHUA 1TL1B 2YQ1A 4PAAA 3R5JB 3LA0A 4KLDA 2APOA 2KRBA 1T94A 1JMTA 2HHHJ 4M1KA 3P38A 2QRRA 3K7RA 4JKAA 3MZIA 1I3OB 1N34F 5AQQA 1HNZK 1BWEA 4RWXA 3I56N 3W65A 4AXJA 5AQFA 4OHZA 4KI4A 2HQCA 1YK9A 5CYMA 3OPKA 3RR7A 4I2GA 1YITS 4CZIA 2LQBA 2IM0A 4J9UE 3QSYB 4ICAA 2XMVA 4HACA 1XHZA 4YHHK 1JLEB 1SXDA 2I38A 2LEAA 3MEEA 7ICPA 4KE5A 5AZJA 3AA3A 1MN7A 3THWB 3QFWA 2D3O1 4DFJA 5AE2A 2E8OA 3I4HX 1VC6A 1EKEA 5IC6B 2CXEA 5J2NA 2ZGZA 4DTMA 2J76E 3QMQA 2CQCA 3QNNA 4LRCA 3R5CA 1B0VA 2Z56B 1YZ7A 2W01A 2ASLA 2LEPA 4LY7A 2NZ4A 3WXMB 2ZWHA 4RQNA 2YTCA 5GMEA 4XH1A 3NOGA 1NNLA 1RWUA 1R31A 4MK8A 4OHXA 3CPEA 2XCAA 4IRCA 3AB2B 1VBXA 1RBOB 4USUA 4JI0J 3VESA 5JVHL 2Y9HA 2RPIA 3HYFA 4BE0A 1B0XA 2W2OP 4WIIA 1H38A 4DWIA 4R0EA 1F3FA 4P72A 3ILIA 5A8RB 4DU8A 3VQ5A 4AHTA 1LOTB 2WVEA 4X65J 5GADP 2FVRA 1VQMS 2W9BB 1EETB 1XC3A 1RTJA 2HNZA 4ELUA 1VGYA 2KKPA 5M1QA 3G4SS 1YWXA 5B0FA 3LDSA 4ZVPB 1SIZA 5BOMA 4DX7A 3S3NA 4RNOA 1VSEA 3T41A 1T3QA 3QPIA 5GAHU 4DR1J 1S10A 1PO6A 2ZQBA 3IDHA 4DV7K 3WK9A 2WF7A 3MM9A 9ICAA 1KVIA 1KAYA 3CCSS 5I9EB 5ETOA 4OKEA 1DTQA 1BE4A 3JSBA 2DGWA 3Q8YA 2DGZA 5C2DA 2NZCA 4GC7A 1M5SA 9ICQA 3DOLA 3C6AA 3QXGA 2R8HA 2MGZA 3SDEA 3Q86A 2HOEA 2MUTB 3TAEA 1OWXA 1PAEX 3CCES 1U9LA 3H90A 2WF5A 2OPSA 1KDNA 2CQGA 1VJWA 2F9WA 3ITHA 4LF2A 1Z26A 1QVFM 2OANA 2BOPA 1T44A 4IH7A 5CQGA 4C4TA 1RWPB 2CQ2A 3A5MC 1VSJA 1TKZA 1FRJA 3C6UA 3DU5A 2EXUA 3QWPA 2POKA 1BO5O 2K4PA 4FBUA 5LM7E 1DGSA 4LF8K 3AOAA 1LKYB 3MM5B 2O8BA 2QARA 5B09A 4IO1A 2E20A 4OPJA 2HBLA 4DR4K 3OW2R 3C7NB 4ZCLA 4BDYA 1EQMA 3AO5A 2DVIA 8ICYA 3HSTB 1RHJB 4PG4A 4X4RA 5KG4A 4ZLPA 2F1HA 4OJ5A 2DH8A 4B3MF 4LR9A 3HF5A 4OI2A 1N32K 1RT4A 1NGFA 4DUTA 2RQ5A 3AMZA 1J54A 3EXCX 5HVHA 1DURA 1JKHB 3SQ0A 2BPFA 3AVAA 4BVPA 3G6YA 1UQVA 3VAKA 3NVKA 4BGDA 1WSRA 2HZAA 3G71N 2HHQA 4OYZA 3IMXA 3E0FA 5J2BA 1FF2A 2HNYB 4CEQA 2G0JA 3J7YI 3J80Y 2PD1A 2VDHA 2XLJA 1GLFO 1RB0A 1N88A 4ZHRA 1TUGB 2C42A 1RTIA 3MDAA 5EOZA 5LMNF 1S1WA 3DLLQ 1RT5A 4JN4A 3ZT3A 1RZMA 3V81A 2VHGA 5GTIU 5CA5A 4JV1A 4CYUB 1RU2A 4K4VA 2EQYA 4DL7A 4USWA 2H3QA 5IIOA 1DQAA 3QWUA 3UW1A 3NVMA 3IMQJ 3TSUA 5K14B 5C42A 2J5AA 1S1XA 2O4GA 4I7FB 2QTWA 1E6VB 4MKYA 2RB7A 4I2CA 1G1XA 2KHCA 4OHVA 4NLPA 1WSHA 1ZQVA 1S6OA 4M9GA 3EZUA 3SI6A 3KD3A 1FKPA 9ICTA 3O9SA 4F2SA 5HROB 3IHQB 2A1RA 2A6AA 4BRDA 4UZBA 4LFBF 1WOQA 1OQ3A 3GL1A 3QUTA 4DR3K 4H5RA 5HI7A 2BMBA 1N36F 3CFOA 3Q8SB 3M8QA 2OPPA 3MX2A 1KEKA 3SJHA 3V9UA 4M0AA 4CO5A 3AQPA 2JZBA 1D8ZA 3BZCA 1K1SA 3ONNA 1VRUB 5C12A 7AT1B 2LDIA 2IVNA 3C46A 3EW9A 5BXIA 1C1CA 2FJXA 3VEZA 3C14B 4J9QA 4LBPA 2R42A 1MNEA 3BBBA 2OM6A 1E6YB 1RHKB 4I2AA 2MHEA 4CJRA 3DU6A 1NGAA 1J5EK 1RPLA 5J0RA 2P8IA 4CIFA 1REGX 3D5MA 1F1BB 1SWWA 2A40A 3EE8A 3NVVA 5F8GA 5I3PA 3F41A 1R6YA 3HM9A 2HFOA 5G5HA 3VC8A 2JLGA 3VAJA 2D3OR 4PGQA 2GQCA 2IS3A 1NG9A 1T8EA 3HZ6A 5AQYA 4KLQA 2K89A 4PGXA 3QUQA 3SJJA 4Y2CA 5DKWA 3KDNA 5AJ3K 4HDHA 3GR1A 1X5PA 1N0VC 4R0JA 2AHOB 4EYIB 3W60A 3CCTA 2MMYA 3U6FA 4JV5K 3SCXA 2I6XA 4BR0A 1R27B 1Q8BA 4HTIA 2HI0A 4CD1A 1U45A 2ZIXA 2CGKA 3G71S 2QK9A 1WCNA 1U8SA 1BCOA 3NLCA 1NK9A 4DMZA 1IBLK 3GE1A 4EUVA 4R64A 5J2EA 3QYYA 3QU4A 2D8CA 3M30A 8ICTA 5IS2A 2CYYA 3CD7A 3DGVA 1N8RT 1P1LA 3Q7BA 4B08A 3K1ZA 3H1QA 4ZDNA 2XMKA 2LQ9A 3ADAC 1JLBA 3CO9A 4J9MA 1ATSA 2Y1LB 2DR7A 2JVOA 1XI1A 3L2UA 1RT1B 3VQDA 4WQ4A 3FNNA 3BBFA 5IIIA 2WB1D 1IN0A 4RR5A 4MIWA 3FFIA 2UU9K 2LYAA 4CLZA 5AK5A 4ZN1A 1VQNN 3SUPA 3ALYA 3IBWA 1NDCA 5FJ4A 1YJVA 3H6EA 1RZTA 2ZM6J 2GZOA 3BQ7A 3KHRA 2FBXA 2H5IB 2QWRA 5J0TA 1ASVA 2PA3A 2RKIA 4CO4A 3M5RA 2AYEA 2BKPA 4N77A 1FJCA 2KN4A 5KT7A 2MAXA 1RT6A 2NXNA 4EGLA 4CHOA 1RXOB 3EE9A 2PMZF 3CDWA 4PPDA 3RJKA 2BCRA 3KWIA 1FO4A 8ICOA 3L8BA 5AI4A 2HGLA 1HNWF 1DY3A 3MDQA 2PMZC 1RAGB 1TL4A 4QAGA 2I5HA 3L2WA 2EFNA 4Y2XA 4DOAA 2RRBA 1IUJA 1CULA 1YT3A 3QU9A 2KD1A 4CK1A 2MB0B 2VH7A 3KK3B 1RACB 4CTAA 4PZNA 4JUZA 4F5QA 7ICVA 4FJXA 1HBNA 4U8VA 2LU1A 4E89A 4XPCA 1UVIA 1HBNB 4USJC 4PL7A 5F0WA 1IM4A 1RCOB 5D8HB 2LQ5A 2ZD1A 1RNHA 3TEGA 2G8HA 1RTDA 1JXEA 5CA7A 1EKSA 5E3PA 4WIQA 4CBUA 4B1UB 4O9MA 2JFKA 4LQ3A 4JI6J 2OFHX 2DWQA 1RK8A 5FD1A 3CDAA 1BXNA 3VENA 3K0SA 4L6V3 3BGOP 4KX3A 1P9YA 5J2MB 5D3GB 4B9QA 2ZUDA 1C0FA 4IOAL 1SC4B 4IEEA 5BR9A 4ZTJA 2BZ2A 4NI2B 2IOFA 4DV6F 1RDBA 4LBIA 4LSLB 1SC6A 5CHGA 2W4DA 2D7SA 3OS1A 2BJ3A 4UASA 4PG8A 1HYVA 3BF4A 1J5OB 2YB1A 1VRQC 4WFZA 2PAVA 1IKVB 1VK3A 3KOAA 3ZD8A 4L3QA 4CERA 2U1AA 3KLEA 5KG1A 4WE1B 1ATRA 1ZM2A 4JKCA 3B4DA 4QWBA 3H8WA 2J8SA 4DV4K 5IINA 1I5OB 1YUWA 5C24B 1N5YA 4RQ0A 5KNIA 3V6DA 2HSTA 2YHAA 1JLGA 3FMBA 1QS4A 3E3XA 1VQNS 3H8SA 2HHPA 3KVGA 4XDDA 3V1OA 2HVZA 1REVA 1K47A 1YF5L 2ZIVB 2VQFJ 4FN5A 4AHVA 1T9XA 3BS5A 1MC8A 4ER8A 4RW6B 4GVBB 1QE1B 5AZIB 1VQON 3BREA 3B0YA 3Q8UA 4WQ4C 4UB4A 2Q79A 3ZSZA 2VB6A 3CB4A 4Q0BB 2B5JA 4UB5A 1MWQA 3C21A 2HWTA 5KL1B 2K7KA 2B0CA 2J6UA 4WCEQ 4H0YB 3TX8A 3KLFB 4GO7X 5GIOA 4FJLA 4DPWA 3OHBA 2WF8A 3VTIA 2XYHB 1X4FA 5A0YA 5HN0A 2BKOA 2JV3A 3QJJA 1DZ5A 2QM1A 2ROEA 2LA6A 4K7QA 1ZAXA 5F9LA 2BV3A 2D4WA 4MH8A 1AZSA 4RZRA 4K2JA 3U02A 1NOMA 3JXUA 2BQRA 1TVRA 3RH5A 3HZEA 2ZH8A 4ILLA 2O67A 3O0FA 4HTJA 3CO0P 3U1LA 2OTLS 2GOLA 5BR8K 3W5YA 2DRAA 4E7IA 1HHSA 4RW9A 2CVEA 3W5ZA 5KQ8A 4BR9A 1G4CA 4B9NA 2I8EA 2V7ZA 3BF3A 1X5TA 3UKRB 2HQ3A 4OV1A 3AV9A 3SUOA 3HT3A 1NCLA 1WELA 5AE3A 2G06A 5KGXA 3TSQA 4HT7A 1E6YA 3BQ2A 5KG5A 2ILYA 4C0ZA 3MXHP 2UUWA 2CG8A 4CF0A 2A2CA 4WK3A 4JYAJ 1N5SA 4H4KC 4RW6A 2H5EA 2ZH9A 2VF3A 3R7BB 2GELA 2DB1A 4OJLA 4NLOA 3Q8VA 2PFNA 2OPPB 3NGIA 4ZVQB 4O23A 1NGBA 1XUPO 1DK2A 1WWVA 4RUAA 5B0CA 1TQLA 1UCVA 1FI4A 4KFBB 1CJVB 4QIGA 3CCQS 4ZP8A 3DFEA 2PGCA 1VQ9N 1RT2A 1VDHA 3MN6A 1S0NA 3M7VA 3LDLA 5I42B 3NWGA 3EN9A 4PHPA 3LDAA 2V6AA 1WTFA 2BX6A 5T14A 3MCSA 1AUSL 2V52B 5FPMA 2PT0A 2UUTA 3HSGA 4AT1B 1WDDA 4QJFB 4F72A 5KFEA 1U47A 1WSIA 4JI3K 4B9LA 1WN7A 2YQEA 1VMBA 1H73A 3THXB 4DPYA 3T9NA 2VQEJ 1ASWA 5DZ6A 5G0RB 5HQMA 4OPAA 3OXGA 3HI9A 4KLLA 1ZA2B 1XN9A 4RT3A 1KBUA 3QIPB 5KT3A 4DV0F 1YX2A 1GTEA 1GFWB 1LWXA 5KAKA 1S12A 4DR2K 1RDWX 3L09A 2XI2A 3NY0A 3D2WA 2WHEA 3ZSXA 3GV8B 2HHSA 4TXSA 3DXSX 1Q3VA 1FDBA 5C2CA 2W4PA 1SB3C 1V4SA 5GAEU 3LTOA 3R1LA 4CNQA 2G5IB 1XEZA 2FJ6A 4K50A 2W3SA 1YVFA 1WKKA 2G0IA 3CT9A 1VSHA 2UVWA 4DTOA 2G13A 1X4BA 1KLMA 1PILA 1HUZA 2MZJA 4NLXA 2PFDA 4CK2A 2GFFA 1U1KA 3M1VA 3M8RA 1UPMB 3ENWA 3V6KA 1RBRA 3UFCX 2Y8WA 3MEGA 1TFYA 2V4JA 4NXNF 3OHRA 3MR7A 5K8OA 1VC5A 3HHKA 2ADBA 2E88A 3O1WA 4IQTA 2BHNA 3U1MA 4XA5A 1S1UB 3GJSB 3OXLA 1C4CA 4BACA 4U7BA 5HQLA 4KH0B 2G2ZA 3LVWA 5LSLA 2UUBK 3PSIA 3OSNA 3DNCA 3KKFA 3TOQA 1ZQMA 5GAHI 1RDCA 2E1FA 3QYPA 2E5SA 3L0QA 1N33K 4OYBA 2N7CA 2F4FA 3KLHB 4M45A 5BRFA 4CF5A 4DKWA 2YX7A 2F77X 3G6EN 4MT1A 4I2IA 4FZXC 4H0TB 2RHFA 2YJFA 3TADA 1HARA 4U7CA 9ICGA 4CH1A 1NKEA 1WC1A 1QH9A 3OQ2A 3ZDAA 1FRLA 3BBCA 4KHRA 1VHIA 4IJNA 3PO4A 2W2PP 4FSVA 4E7LA 1K73O 2C2ZB 1U2FA 1SKSA 2KFNA 3KWMA 1S7HA 1QZ5A 5J2DA 3PW5A 1F9HA 4HT5A 3J7AP 3HJEA 4M5IA 1NBWA 4F7VA 3US5A 1D8YA 4I28A 3ISNC 1ZAVA 3HKZC 4GXIA 2F8LA 3TKAA 2IRYA 4WF9Q 1UFWA 3N7SC 1IWGA 2R7XA 1YLXA 4WYLA 2V2VA 5AQLA 1RTJB 2ZH6A 3GJQB 4Y2AA 2ZBRA 1AQ6A 1DXSA 2KI2A 2WVDA 3DLRA 3KUEA 2E5GA 3J7YP 3I28A 1GMWD 2CH5A 3HL8A 2CXYA 2OEKA 3G82A 5MLCV 1S49A 4M2YA 4IQMA 3THYA 2OCEA 3K75D 5ETMA 1CBKA 1UVKA 2IJRA 2M4MA 3HZGA 1HBUB 1SJFA 4PA1A 4BC4A 5J0XA 2BJ1A 2CQ4A 2DKZA 2LXIA 3J7Z5 1XIQA 2RRNA 2WK4A 5DB9A 2AV5A 2G0AA 3H0PA 1NGDA 5A8KA 2DH9A 2YNFB 1WSGA 3AD8C 2E2NA 9ICXA 4IEIA 4RU2A 4Y2MA 1NGJA 3OA9A 3AO1A 1D09B 2ASYA 4HACB 3UKUA 3C28A 1Q8KA 4KMUA 2JNJA 2AXTU 2G0CA 3WIUA 3I0RA 5CCLA 4GRSA 5DG9A 4M5MA 5IXUA 4HHHA 4B02A 4NCGB 4ZVOB 4UAVA 3QSIA 4PPZA 4OZJA 2NV3A 4MFFA 5KAIU 5LMNJ 2BJ7A 1LFPA 4F3MA 3SPZA 4ECXA 4OI4A 1QAIA 7FDRA 4DUYK 4XIUA 3J81O 2ZZTA 3M8QB 3DM2B 1OSCA 5AK6A 3A5LC 2OYQA 3UM9A 4JI8F 4EFAC 1FESA 4IDKA 4KH4A 4CJLA 3F9KA 3B9JA 1WNEA 4K59A 1TKTB 1BNOA 3UE5A 3GMGA 1FRMA 4TYAA 1JB0C 4M3TA 5DQHA 4LRBA 2KXNB 2DNPA 1S1TB 1ZA1B 4BC2A 3O3LA 1VQ7S 4E1MA 1AT1B 2WONA 3DC2A 2D0CA 1SQEA 1J53A 1F5CA 4UY85 4QIFA 3FE1A 1MU2A 1HI0P 2F8SA 3I8BA 4CEEA 2M7SA 5G5GA 3QEPA 3AGRA 4R79A 2IHR1 1KP6A 4OYOA 4NLNA 4ED3A 2OPRB 1FERA 4CGJA 2EAPA 3KUGA 1B4SA 4EI2A 3I4PA 1RCXB 2DIVA 3R8EA 1U2VB 2R8JA 4I64A 2CWKA 2QA4S 2FLPA 3D28A 1RU1A 5AQNA 1PVRA 2DGXA 2M0NA 2BJ8A 2GX9A 8ICWA 2DD8S 5KGWA 9ICBA 2DGQA 4Y00A 4CLSA 4QZVB 2GJIA 4LF6K 1Q46A 3NL0A 4B8AB 2HVIA 3B54A 2NS1B 4L74A 5IWAJ 4JHDA 1F6TA 2RH3A 3CCMS 3CIZA 3VPZA 2W03A 4ACOA 4ILRA 3CULA 1R7IA 3D67A 3TWHA 4CBXA 4O4RA 2ZH1A 1RQNA 3NCIA 2D5RA 1B4FA 1ZZFA 1GOCA 1RWKB 4ETXA 5EN1A 2PN6A 3VTHA 3GIJA 1G2EA 1TL5A 1K44A 3MR5A 4ZN3A 1OY8A 1K9MT 2GH1A 3DV9A 4NOHA 1ZOTA 2H5JB 1HWKA 2P5VA 1F5BA 2YNIA 2G8WA 1EJ7L 5CCMA 2LA4A 3FZLA 4JHDB 3C16A 3GU0A 3FBBA 4WZQA 4Y2PA 1XNQJ 4FJJA 3T1YK 5H1SQ 3ITHB 3ZTSA 3S1TA 3OV7A 3ZLJA 3SUNA 3L3VA 4K4UA 3QICA 3KUHA 1QM9A 5B0DA 1YG0A 2ZH2A 3KTQA 5BYSA 3CDEA 2E5LF 3L4BC 4C8YA 1HEKA 4ZJOA 3WIVA 2KKVA 3UVJA 3VR1A 2W8LA 2AJQA 1CXQA 2AQ4A 3NCRA 5CWRA 4F4WA 1F9FA 1WWHA 2NYHA 3TFSA 2Z2LA 4TVAB 5KG0A 3C6TB 2ADCA 3IFEA 3H40A 2W4CA 1VQ7N 4OL8A 3H8MA 1D9DA 4R63A 3AT1B 3ZTPA 1RWXB 1I6JA 5K20B 2KG0A 1HKAA 3K4GA 1JL1A 3BSAA 3CD0A 1MU2B 2K7JA 3F5AA 9ICCA 5JXSA 3B6OA 1IM6A 1KHWA 4DX5A 2UXBJ 3LP2B 2A1JB 2BZFA 4KBOA 3LWLA 3KD1E 2BABA 5ALIA 2V8PA 1T3VA 3AARA 1WBBA 4EEYA 1XQIA 5F8IA 4X62J 1B7YB 2GVDA 5M1OA 2XHBA 4A2AA 3VAHA 1FCAA 8ICIA 4QWCA 4MJKA 4C11A 2MA1A 2FVSA 2UXDK 3MK6A 3UD3P 3BJYA 4LF9J 2Q0UA 2IOFK 4J9RA 1VSFA 2OTJN 3KLGA 3ULEA 2QWQA 2NPIA 4DSJA 5KRTA 4FO6A 1L3KA 4IH5A 3V4IA 1A76A 1AROP 2E5JA 4A46A 2BUPA 1G99A 2C22A 2RRAA 3TUIC 3IA0A 3MMAA 2JJ4D 8AT1B 4A5BA 3M9MB 2QXFA 4I0WA 4YDXA 2XRIA 4DOCA 1Q8LA 3JAMY 4NCGA 5CYMB 2A6OA 4DFKA 4X64K 1PYOB 1LEOA 1XK8A 2PI4A 1KFTA 2RQ4A 1XMOK 3S6EA 3BSNA 8ICNA 1BWFO 4DV6J 4H5VA 3N4MB 3MAHA 2N4CA 4ED4A 4L3NA 1UJ4A 2B6AA 2HBZB 3TYTA 4MQ3A 2O8EA 4C8LA 4K8ZA 1TL1A 2QSWA 2O8CA 1Z4UA 4GVEA 2QWLA 1IBKF 3EKSA 2BA9A 4NYFA 2IVFB 4ID8A 1YJ9S 3P83D 1J6ZA 4KITB 3OTOK 3CJKB 2CN1A 1N2XA 1MN8A 4J2EA 1LXJA 5H9EK 1IBMF 1N61A 5DG8A 4DR7J 3LVVA 4J7CA 3RH6A 1QQOA 4JI2J 1GT8A 4B3TJ 2GW8A 3EJMA 1NSAA 3TSPA 4IOXA 3RJIA 2AGOA 3FQKA 2BQUA 5KG3A 1KRPA 1NEEA 2DY1A 3SSSA 3DOKA 3CVKA 3NAIA 5J0PA 4CJKA 5T7LB 7FD1A 4NCBA 4UT4A 5EGYA 4CJSA 2IHNA 1ESVA 4KLOA 1HLWA 1WSFA 2HHHF 1QVFR 1DQ8A 2AZ3A 2RU9A 3AD9C 3MPYA 5ADZA 2QSFA 1KTQA 5F1XA 4NLBA 2O5DA 3QGPA 2R7WA 3QESA 4P0PA 4BRIA 2OXOA 1UEVA 3OY9A 4ZCIA 3K9KA 2R7QA 2P9PB 4KH6A 2JX2A 2QLBB 1RHQB 1VQ5S 3N6MA 4A8YA 2RDIA 1U1NA 2FVPA 2ZXIA 2VOPA 1C0TA 1U1LA 3CYMA 3J81U 5HOOA 1CJKA 2ZJQQ 1TELA 2KB2A 2OKQA 5JJBA 1FWKA 3VQ6A 2F4VK 3DEEA 4RW7B 3HJFA 2EX3A 4WJ3B 5ALHA 5ALRA 1ZQRA 1JK9B 3NGSA 3UQ0A 3ZETB 3H4DA 1TKXA 4A8EA 1AB8A 5J2QB 1QQ6A 1Y3KA 4ISFA 3OS2A 4M47A 5AKXA 2ZJ8A 1Y7PA 3D2EB 4NLCA 1IJJA 1TL3A 4PHDA 4C8OA 1N34K 1JCGA 4K8RA 2OTLN 1RABB 2DRBA 4FWQA 4G1QA 3C66A 2J0XA 5KFCA 2R2TA 5J1EB 1DRGA 4R5PA 1UVNA 2NRTA 1SV5B 2VGMA 4ZOSA 4O55A 4I6WA 3M8WA 4NLVA 4LRDA 3CJCA 3RMCA 3F0NA 5DB8A 3V9WA 2ZIWB 2HHWA 4NLGA 4JYAF 3E9LA 1U4BA 2QL5B 2VWKA 2E2PA 4Z4CA 3IN5A 7ICHA 2KZMA 1NZAA 1VDVA 5AQGA 3RB4A 5BREA 2DGSA 1B0TA 1PYSB 4I6AA 3KHGA 2ZWOA 4E3SA 3CTRA 5JS2A 1X9WA 3NGDA 4I6MA 3BGRB 1PUZA 4M5DB 2R7UA 2ETJA 4LR8A 3T1HK 2YMLA 3EZOA 9ICVA 3OJSA 3ISZA 4PHEA 2OPQA 3M32A 3NH1A 5KFSA 1OY9A 4HTUA 4F3TA 1OJ4A 1F9EB 1BU6O 2OELA 3N5BA 4NYPA 3UR3C 2G08A 5EWGA 3KKRA 4ATNA 4HI2A 2Q31A 5FP0A 5IIJA 1TK8A 3FCVA 2MRLA 4KN4A 1TE2A 4EBDA 4J2AA 1UVLA 1YAGA 2QKBA 5B66U 4I27A 5E33A 2Y1RI 1NUEA 1TP7A 5A8WB 2Q0ZX 1APSA 5DB6A 1RAJA 4RG8A 1YJNN 5F8MA 1RQ0A 2ZBQA 3SR6A 1H7WA 3OLBA 4LFAJ 4GKJJ 1HYZA 4BRGA 3ZZYA 3HFVA 4F4AA 3O4WA 2DNGA 3RG6A 3R9PA 3GSIA 3B4MA 3I76A 5AM2A 4Z0UA 1TVAA 2DFEA 1K6YA 1ZOLA 2IY5B 4DU1A 3JSMB 4NASA 2O8DB 2QV6A 3ATVA 1FD2A 2CQ0A 2FLOA 3DRPB 3E9OA 2RILA 2GVDB 3QUCA 5GTHU 4RWTA 2ZE2A 4DV3J 4NJ8A 3AVKA 3FYHA 4JEPA 2ZHOA 1XMQJ 3LP2A 4B3MJ 4C7QA 1BC6A 1RT1A 2KZZA 2QA4G 1LXNA 2Z58B 1WG1A 2OI2A 4IG0B 2XBPA 3W2WB 4ITSA 1SZPA 2WTUA 4B3RJ 4PXCA 4RW4A 3NUQA 3L3UA 3CJ4A 2J6TA 2AT1B 4A2BA 1JI7A 1RDAA 3KD5E 2CA9A 3CD6S 3E58A 2XHWA 4CJPA 2YXLA 2HK3A 4X4TA 1KHVA 4ZPDA 4LF8F 2LBOA 3LP0B 5F8LA 4NZ0A 3M05A 3ZSRA 2B4JA 1IKWB 2YMQA 3O44A 1RBTA 2GV9A 4BXOA 3MF5A 4LF7K 1COOA 2GO9A 2HGNA 2G1HA 3G86A 4MHVA 4X4OA 5J8YC 2KYXA 3SFGA 5HP1B 3JPPA 1ZD5A 5EE3A 4I6MB 3CD5A 1FX4A 8ATCB 4HH0A 3HHLB 4UUWA 4FO0A 4S0MA 2XY8A 3JPRA 1HUOA 1BUPA 4X64F 5DO2A 4ZP9A 3WKBA 3SXLA 1TFWA 4R25A 4OZ1A 4TYBA 4DCOB 2QI2A 3TANA 3QU5A 5KTQA 1BPEA 7ICRA 2YMPA 1V38A 3NRBA 2HWIA 3NFAA 5K8PA 2FD2A 5KOXA 1N48A 1U24A 1CVJA 1GAOA 3MM8A 5C0YA 4OHWA 3W2VB 3Q8MA 5J1EA 3I5BA 2XQCA 2D6FC 1EHWA 3CJSA 3ZT4A 1HMVB 4QZIA 3QZ7A 5KT4A 2DKXA 2DGTA 5E0OA 3NS7B 3D2EA 3AO2A 3CXCR 1H2TZ 2I7NA 4KO0B 4UBBA 1P6TA 4J90A 4RW8B 1ZBHA 1LV5A 2AYMA 3DLHA 1S5ZA 2K1RA 3AA9A 2GLEA 3LDOA 4F92B 2J9CA 4WK1A 3V1QA 1EO1A 1FKOA 1WD6A 3AJ1A 3NGTA 4NXZA 3VF4A 1CUKA 1HW9A 4CZEA 4DCHA 2A5XA 8ICGA 5AJ3F 4B3SJ 1VBZA 5HLFB 2X1GA 3NHGA 3K89A 5F3ZA 2MQMA 3EGZA 2VICA 3K8VA 1SL0A 3ZT0A 1DEJA 1FKPB 1FNXH 5AKJA 3LDNA 5ALEA 2YV0X 3F53A 3KG1A 1A0OB 4HCCA 3PX0A 1KQGB 3PJXA 2OPRA 2YKOA 5ADXA 3PJWA 1SI9A 3FFKB 2YNGA 1N36K 2NUUG 2MXYA 2UUCJ 5K8NA 4LF4J 4GNIA 1YRUA 3P96A 4QZHA 5AKHA 3O1LA 4MYTA 5AQXA 7ICEA 5IIMA 3IKMA 1PJ5A 1IG9A 5ELZA 1B7FA 1TTHB 5AQRA 1URNA 3IRUA 4KLGA 1RT5B 1PG5B 3EGWB 4DCCA 1Y00A 3X3UA 3CI5A 4I4BA 5IM0B 4CZKA 2DBYA 5KPTA 1HNXK 2GHWA 3CW2C 2RHSB 1S1TA 4KI6A 3BM7A 2VU5A 5IQQA 1FJGF 3AVHA 4OPHA 4FXDA 2Q43A 1WHWA 3WUHA 4I56A 1SQGA 3I9ZA 2R9LA 1D1UA 4M41A 4CE9A 2J0QD 3D66A 4IOBA 4CF9A 4IDKB 3ZX3A 3MBYA 4A8MP 4DUZJ 3BEXA 5FPEA 4A4JA 2DF4B 1ZD3A 4Y2KA 1VQOS 1ZETA 1LWFA 3UCZP 1IH7A 7ICIA 2WBNA 2A1AA 4IRDA 4KO0A 1C1AA 2WZ1A 4JV2A 2DNQA 4O3OA 2D3UA 3HOSA 1S57A 3KZBA 4AQYJ 1CULB 3H1VX 1HMVA 2E9RX 1N5WA 3AXMA 2IVOA 2PMWA 4XO0A 4FPRA 1U8WA 1UPHA 2FLLA 2WSCC 2KM8B 3GYXB 1ZQDA 1WEXA 1TYQB 4Z6EA 2ZM6F 1TL7B 4H4MA 3RBDA 5DM7Q 3ICXA 4M5KA 1WKLA 1YITN 3H8YA 4EZ9A 1SPBP 1BI4A 4E7JA 3DXKA 2K8AA 2MEWA 2Y1JA 1NJYA 2WOMA 1YI2N 4JI4J 2AZ1A 4KN7A 1Q16B 3MXJA 4DV5J 1TKDA 4UOFA 3PR5B 3L5KA 2CH6A 4LRAA 4ECWA 3QMLA 2FBVA 2UV8G 3PCOB 1G7CB 3SMSA 2UV8A 4E7HA 1NOYA 2VD3A 3D2NA 3LP1A 4FLZA 3IFRA 3ZX0A 5B0EA 1DTQB 4PWDA 4X4UA 5CEHA 2G8FA 4UW2A 2A1SA 1VLYA 4X2BA 1FXRA 3MM9B 4FVUA 5HRNA 1OPZA 4YG2A 3ATUA 4MFBA 1NSQA 5DK5A 3JB9k 2FSNA 1JRPA 2CPFA 2F2AB 4J9OA 5D0EA 2ACMA 1RG6A 3ZTQA 1NNDA 3CPWR 2ZUGA 1WKJA 1KVCA 2HVEA 2YVSA 2GIQA 3W3DA 3POTA 5ALQA 1QUVA 4YDUA 4FF2A 1ILYA 2IAJB 5B0AA 1UMJA 5HK4A 3RBXA 3CFRA 4B8CA 3G0ZA 3KLIB 1TGOA 5J0SA 1BPDA 1Z1BA 1LB2B 4DR4J 3CCQN 5AI0A 2BW7A 4DL2A 3FZHA 3M30B 4LH4A 2W7AA 4IFVB 2IVPA 3JAMO 3RRHA 1AUDA 1N4LA 1ULRA 4WP8A 1RP5A 3ENBA 2Q0RA 4DDFA 2RU3A 4KH1B 4BROA 2C2MB 2L3MA 2ASPA 5FLXY 2ZEJA 1XNQF 4IQVA 4EELA 3HK2A 5FLXU 3OYGA 1J2VA 4HHTA 2OH2A 4X4QA 5AXMA 4D3GA 4JS5A 4BRFA 3UWTA 2F1IA 4O3SA 4GKKJ 4YOVA 2AJ0A 4JI7J 3CJ1A 2YY6A 4USIA 1W7WA 1NJWA 3W1YC 3CC7S 3VEOA 1ITPA 2RQKA 5LSOA 2EWHA 5AM5A 5H2FU 2QWNA 3C15A 5KFKA 4DBQA 4LF7F 4NYZA 3OBIA 3AVIA 4IL6U 2P35A 4CGDA 4QS7A 3I0SA 3TVZA 4DUYF 4QZFA 3HILA 2VODA 4KGVB 4CEZA 2HFSA 2W25A 4ALZA 3NCPA 1X3NA 3D0HE 1IG6A 5E3AA 2DFFA 1X7VA 4JRPA 1ZQ1C 1X4HA 4I2QA 3BGRA 1SH0A 1SH3A 3GP9A 3H08A 2R7TA 3VCBA 3LZJA 3QJPA 2XEXA 3E01A 1FRHA 4AHCA 2OYYA 3E1YA 2FJWA 2QLJB 5J2GA 5CE3A 2KN7A 3PIPL 4B3OB 2HNDB 5AM3A 4J9LA 2GCFA 5AICA 2RQCA 3MFIA 3MMJA 4MLHA 4KLTA 3ZTOA 2F8KA 3MM6B 4X66J 2G09A 3OFHA 4QCLA 4BRAA 2MLYA 5ETVA 3CJ2A 2R7RA 4ELTA 1HD1A 1UJ5A 1E4GT 3VF0B 3G87A 3AUOA 1NM1A 4BRMA 3SIPB 4G1IA 4FYYB 2CQDA 1ZH5A 2DO4A 1TV9A 2YWEA 4ZPCA 1YIJN 4WQ5A 3NVZA 3MX5A 1ELOA 2FXUA 4KY3A 2KKHA 3OYIA 1QAXA 4ED7A 2OZSA 3ZETA 4IBNA 4M3ZA 4L75A 4I2BA 4PWWA 3D3BJ 3ID6A 2GAGC 4RW7A 2LKZA 3LGNA 2BR0A 5I3UA 4LFCJ 4DLEA 2F1FA 3DLEB 3VN5A 2IBOA 1XJWB 1XNRJ 2CPXA 1CPZA 1CJKB 3O9UA 4ZOHC 2M5YA 1PC4A 1C0TB 1RT2B 3RVCA 5HNKA 1G6BA 1FFVA 3MWTA 2CPIA 2DT9A 1MMNA 1U02A 4KFBA 3O9TA 4J37A 2ABYA 3C8YA 1DBDA 1N56A 1WF0A 4PG6A 1SV0C 2QYGA 3BDPA 3AQFA 3PG9A 4IRKA 2DNRA 1Q0NA 4ZVUB 1Q5YA 4EBEA 2EC2A 3P49B 2HRYA 3V72A 2HS4A 2KVCA 1FT8A 1IO2A 3AGKA 2VA3A 1VCTA 3N4PA 2WFAA 1SL1A 1HWIA 1JJCB 5KT6A 1XHXA 1H2VZ 5AQKA 3A8JA 5HRPA 5E5NA 3OXFA 2XS2A 3HHLC 2ALYB 1JLFA 4GFJA 1UVMA 4MKBA 4UTGA 2AEFA 2AF6A 4AL5A 2HW3A 4CO0A 3UR0A 4J9NA 3D6MB 2G2YA 2HBKA 4MAKA 1EIYB 4FPAA 2LYHA 4O3RA 3OYCA 1ZYQA 4QYZJ 5H9FJ 2HHXA 1KWMA 2KJWA 1E4FT 2ZBIA 1TKZB 5F9NA 4LZGA 3BO3A 2MJUA 2GQQA 1KN5A 4DHVA 4PUOB 2E4LA 3M1FA 3N9UC 4BGBA 1K8KB 2J8AA 1ZPVA 3LAMA 4K0KJ 3QIDA 1WBDA 3T1AA 1VHXA 3L6QA 3IR7B 4K42A 1MWYA 3BS9A 3IBCB 5BPMA 3ETMA 4M5HA 4M94A 3R5GA 3M2VB 2FHKA 2YH0A 2B6AB 4NA1A 3PIOL 2PKEA 3DOLB 3AM9A 3SV3A 3L95X 1HUXA 1XTZA 3KYLA 5F3XB 2BYCA 2ROGA 2C2DA 5EE9A 1TAUA 4OD0A 5ALFA 4N56A 2AA4A 1WEYA 2G1DA 3M6UA 4KC5A 3IC1A 9ICFA 2IM3A 1HQUA 3IO1A 4BLGA 5JLFA 5CH7B 2E6LA 4TY8B 3EVWA 4OX7A 4Q43A 1JLFB 2GV1A 1X1PA 5AZIA 4GVBA 1SWVA 4CF1A 2W1BA 2ZG6A 4GO5X 3V4IB 3AVBA 1Z00A 1ZC6A 2HHHK 3JYTB 2C3YA 2Z30B 1HKCA 3CCRS 1Y5IB 4IH6A 3KLGB 3CJAA 1CG2A 4GLXA 4IKAA 2KW4A 2EAMA 1VI7A 3QEWA 4DOZA 3PW0A 4DTUA 4B17A 1U0HA 2NPFA 4C4SA 2FJDB 4RPZA 4FNHA 3F56A 2MKKA 1BD6A 2F9TA 4UB1A 2YX6A 2R8KA 2VA8A 2E9TA 5E3RA 2D0OA 1KVKA 3TVYA 1Q3UA 4ZJLA 3W9HA 1L7PA 5BRDA 2XMWA 5HR6A 2KJVA 1DGJA 4UF4A 2ZUCA 5IT9Y 4A8QA 4YN4A 1EARA 4F4XA 4QWDA 2H4YB 2ZNYA 2QX0A 2Z1HA 4I2FA 2GHVC 4EHUA 3KG0A 4B1WB 2ZH5A 2EK1A 3NDKA 4B9SA 4LFBK 3GDXA 4KLIA 2GIFA 3BS7A 4F50A 4J9PA 1SKRA 4RPFA 4HCBA 2VPWB 1KXPA 3ZSWA 4AXIA 1RWOB 4WTOB 4HLBA 4FS2A 1Z6RA 2XNRA 4ECRA 3IAS9 3T79A 5ETPA 3ZO7A 3CCJN 2K4EA 3HBTA 2IVMA 4RQ6A 5KT5A 2QEXN 4ED2A 2F9JA 5AXNA 2JHEA 2KJ8A 4MO4A 3AXKA 3K9JA 5HHHA 1QZ6A 1R43A 4OYWA 2X51A 1DRZA 1KAXA 5ALWA 3M8ZA 1ZQEA 3CMQA 4OYXA 2XTJP 4HWIA 4WFNQ 1SUQA 2BQ3A 1KTVA 3C0BA 4DF4A 4PR6A 1J2MA 1NLKL 3PYEA 4DSEA 3J80O 4JI5F 1L3TA 2RF2B 5ETRA 4DS5A 4GVMA 3RMDA 4NXMK 1Q1KA 1JLAA 4KMOB 1ROFA 4I2QB 4BWJA 1V6HA 4LF1A 3W0LA 4PL2A 5AI6A 4KLMA 2PYLA 5DDMA 4CEBA 4PY5A 1UETA 4DV7J 2BGGA 2I9SA 4CP5A 3H8JA 2VJ4A 2KT2A 1JLCB 3N28A 4BRLA 5EU7A 3BO4A 4NLDA 4CLFA 4ZVSB 4BR5A 2ZKTA 1SJ4P 3BR8A 4M7YA 3AVMA 2E66A 1T6DA 1NHKL 4FKYA 1WC5A 3E9PA 3F44A 2O1PA 3PX4A 4UB3A 3VGKA 4KLSA 2B8PA 3GQCA 1FTCA 3B78A 3H0LB 4KH5A 3JQKA 4CJ3A 3UO0A 3WT0A 4OVLA 2GGPB 4PG7A 4ZCKA 4FWRA 2OJ3A 1UVJA 1KSPA 3WXLA 4RQ1A 5KAFU 3ZNUA 4Y2YA 4H4OA 4LF8J 4FPBA 3DDIA 1PK3A 3T19A 2ZDPA 3M6VA 4FK2A 4H0OA 3L9ZA 1MG7A 2NYVA 4U67L 1T0TV 1BG3A 4A59A 3HW8A 3R27A 2XNQA 1QAYA 1U0HB 2P9KA 4LREA 4N5SA 1ZD4A 2VJUA 3RUBL 1O08A 1QQCA 1YRXA 1SH2A 2IHMA 2Q66A 3BUZB 3F9MA 2D0PA 1NLVA 3IP0A 1X4DA 3F5EA 2ZTEA 2D0AA 4BWMA 1UT5A 2UXCJ 5M1FA 3HKZF 2JZ5A 3AJDA 3I55S 3EICA 5T7LA 4YOXA 3DLKA 3JTPA 4TUPA 4CNYA 2SXLA 1Y64A 2V2ZA 3CJTA 4TY8A 2GVZA 1NOZA 3UD4P 1COKA 1YBAA 3IR5B 4IKFA 3GCXP 3LPEA 4XK8C 5AQTA 4WKYA 3AAQA 1TAMA 4OJHA 4G6VB 3RAMA 3BKFA 2X1AA 2CQPA 1XO1A 5EXWA 2FPMA 2W2NP 3H2UB 4O4GA 1RAAB 2CQIA 1K8AO 4GV6A 5ALMA 3VQ9A 3T1HF 3TX0A 1HNZF 3FSIA 5L1LA 2KSOA 9ICNA 4YUDA 3U3GA 1GLDG 1GMUA 4IR1A 1S0MA 4QZCA 1EQ0A 3OVBA 1HJPA 3H2LA 2HPUA 1UZHA 2CKWA 4JD2B 4JWNA 2G9OA 4B3SF 3HPHA 3K1RB 1VISA 5ALZA 3D1HA 4ANCA 2ZH3A 4DL5A 2HEKA 3ENQA 2YI1A 4KHPJ 3CHWA 2ZZMA 3GIKA 1X4CA 3VWSA 3A0HU 3FKBA 3MCMA 4CJFA 3TPQA 5D46A 4ZS6A 1JROA 3HT0A 3DDNA 1OSDA 2HAFA 2XWXA 1Q5VA 2ITGA 1NZPA 5D15A 2DNOA 1ZBUA 1HHQA 1VQPS 1FXXA 1WHYA 2B4OA 3IRXA 1Q7LB 2HMXA 5IILA 3NASA 3OL9A 3C65A 4DV1K 2KZ3A 1CZ9A 4NLYA 3CC2N 2DHAA 3FAHA 2DYAA 2P9IB 3BS5B 1P1TA 1WAFA 3FEZA 2DEJA 2GMLA 2DCUB 2AEMA 4DR5J 3M7DA 3R6LB 3NMRA 3RJGA 7ICQA 3DXMB 3SI8A 3BKUA 4I69A 1S5LU 1X40A 4PQUA 4DR6J 1JLGB 4BE1A 3PM9A 2VIXA 3D6HB 1RILA 3EPGA 5LT5A 5KL8B 3FR0A 1ZXOA 5EDWA 4OX9K 3W9IA 2H3EB 3AB4B 4ID1A 1U48A 3HHDA 2QA2A 3EXYA 3ZT1A 1R0BG 4YMOA 1ZQSA 3TEHB 3O8MA 1ZBLA 3OVSA 1VJ5A 2EWSA 1IKVA 5FPNA 2CPRA 2DGOA 3ZD9A 4RKUC 1SJQA 4W5OA 2GEMA 4GY2B 3PO5A 1KL9A 5CRXA 1UWBA 3X1LB 3ZNJ1 2GUPA 1RGVA 1SXEA 4QOTA 3EEQA 3KNAA 5KFRA 4DV2K 1B0PA 4J2BA 1FRXA 1U1QA 5AR0A 2DH7A 1VRTB 4AFFA 2XYPB 2XZTB 3I55N 3AY0A 1VSKA 3HULA 2P9NA 1N33J 4ID5B 2VIHA 4ECYA 4B9MA 5CYQB 1NNEA 3D3CJ 4AILC 3THTA 2YB4A 3AVJA 3QBXA 4X84A 2FGCA 2FHJD 1CLFA 1N62A 4M5JA 2QMWA 3HVAA 1FK9B 4EX6A 4K4IA 7ICLA 2O8FA 2UXDF 3A0IX 1S0OA 4RJVA 4DV0K 4DZDA 4DQSA 2V63A 3DMJA 3CCLN 3MGHA 1X0PA 4DR2F 2PIIA 5L1JA 1WC6A 3SFUA 2KMDA 4TN2A 3ISND 1HNVB 3SCLE 3H0RB 3ELHA 3DLJA 4CJQA 4RUCA 3Q23A 5BR8F 3NGUA 4QPXA 2CJYB 2J4RA 2E8MA 2VUGA 3C2PA 1Z3EB 4QS9A 2ZM6K 3MTKA 1A5WA 4OHYA 5ETTA 2LMRA 1OYDA 2D9OA 2KVSA 1C1BA 3LF0A 4CO2A 4DL6A 3CF5Q 3H3OB 1SZHA 3G6ES 2R7VA 4K4YA 3WK8A 1S5JA 1HW8A 1GH8A 2WFBA 4F93B 3ASMA 5AK3A 1KLMB 2NUHA 3OL6A 4NLZA 5HP1A 5D4OA 2Q4TA 2XI3A 5AM4A 2D1KA 2KVIA 5ALUA 4DF8A 4DJBA 2UUBF 1HQEA 4ENOA 2F8HA 3D6FB 4YB7A 7ICKA 1CS4B 1GX5A 4BRNA 1O6XA 1RTHB 2Z1GA 2W7PA 1S6PA 1LFWA 3H5UA 1MWZA 4KHMA 5LSRA 2W7OA 1ZBTA 5JICA 3GYGA 4DL0C 4Z4GA 1R59O 4OCZA 1BQNB 2I2YA 2DRDA 1SJ1A 3DXBA 5DDQC 3CWJA 3BN7A 3A5NC 1N8RO 4IFYB 2K2PA 3QO9B 3QDKA 2RS8A 3LPYA 3EZ5A 4LF5J 4UZCA 2ERRA 3OYJA 2FQQB 1K73T 5CXTA 2XIDA 2ZIUA 3UXNA 4CF4A 3BF1A 1KQQA 4NLTA 1NGEA 2JLEA 4A8XA 2QWOA 4CHNA 3U27A 3SQGA 2L9WA 3KHYA 2XB2D 4GVLA 4QU7A 2XLKA 1DTTB 1XR7A 2EKNA 4HI1A 3RB3A 3QIOA 2CAJA 2J7WA 4KAIA 7ICMA 1L3SA 4PPXA 3DXMA 1RAIB 1NK5A 4WZMA 3UMGA 4Y28C 3EMTA 2KT5A 3DM2A 2C3UA 1VQ6S 2H5XA 4G9BA 5HMXA 1ZQHA 2GNKA 2EFPA 4DSLA 3LGMA 5KFQA 4DL3A 4IG3B 3J7ZO 1VIXA 4RQ8A 4FCYA 3CCLS 3OFEA 1F44A 2VANA 4H4MB 3BQ0A 1FEEA 2K06A 2FF6A 3CQXA 3ZC4A 2B21A 4MKVA 1IBMK 2IOHA 3TZXA 5AQWA 1TYQA 5ADXH 4W90B 1VQKN 2BJEA 3MWPA 4RTFD 3SQ4A 2Y0BB 1VAZA 3ZSOA 4JV5F 2H9ZA 1QVGM 1TMMA 4C3LA 3SV4A 5JMVA 3AO3A 2QXLA 4JI0K 2LI6A 4QNLA 2IDLA 1WC3A 4KB0A 3OT9A 2JZBB 4F4KA 3VQBA 3CNQP 5A8KB 1YIJS 2ZTCA 4YR2A 4LFCF 5AQZA 1KONA 2MYFA 2AJFE 3K2PA 2CPHA 4AUKA 1OH6A 2DNYA 1JJ4A 1XNRF 1ZQGA 1R6VA 2KFYA 1JXVA 2VC1A 3QAEA 7ICJA 3R6MA 1HNIA 4YFUA 3T69A 3TUPA 3ET6B 3NNHA 8ICZA 4K5SA 4R5PB 3H5XA 1VQYA 2RS2A 3RSEB 4C6AA 3SQGB 1UOCA 3AAWB 5KFTA 1VLOA 3OYHA 3UN2A 3G6XA 1IV8A 4NV0A 2DNMA 1I94J 4BUGA 5IM0A 3THYB 3FVYA 4M6WB 1F2GA 2Q3SA 3IG1A 4ECQA 2OMOA 1S8OA 3GB0A 4CGZA 2QKQA 4E1JA 2MKSA 3VALA 1JN3A 5L1IA 2IC3B 1L8OA 1RXWA 1NK6A 2DXEA 3CUNA 4CF3A 2MQLA 3UDLA 4FNIA 1S22A 3MAAB 4WCEL 1EX4A 1GX6A 2P9KB 1WACA 1HNWJ 1Y9OA 4ZKAA 2NRXA 1H2UX 1W2BR 2DR9A 2KVQE 1RAFB 3P4UB 1X3MA 2AP6A 3CIMA 1ACMB 3MUTP 4A8WA 4KJIA 2PSZA 2V9KA 4XH5A 2A2DA 4N8OA 2ATCB 2CPYA 1U1PA 1ASUA 3FZ2A 1QTMA 2UP1A 4JYAK 1SGGA 3NGYA 3G6VA 1TU0B 4EP5A 1ZD2P 3G96A 3Q8LA 2DNNA 2ZOMA 1KFSA 3WU2U 2MZQA 2QA4N 1ZJMA 2K1RB 2VG7B 2P9SB 3QB0A 1ZBIA 2KH9A 4C4WA 1DARA 2EFOA 2VL1A 4EFHA 4GKJF 3GV5B 3AOCA 3KWGA 4GC6A 4J9VA 1IR0A 2HFVA 4WFAQ 2ES6A 1WYGA 4JI6F 4O5FA 3N6LA 4CHPA 1ZQLA 1T05B 2F40A 3G8TA 5JS1A 2QL7B 3I5CA 3O3FA 3W9JA 1HR0F 1WUDA 2QARB 3ETRA 4LF6F 2QWPA 4CIOA 3UXOA 5A76A 4O0JA 3UNGC 3MM8B 4MTPA 4CD3A 5AE1A 3OR1A 4CESA 3H42A 4OZLA 5A2QY 4IDHA 5AFUA 1RA6A 3P1GA 4U9RA 4K8XA 1ZQOA 2NR0A 4WFNL 4TLQA 1AXQA 3LWMA 4N8NA 5AI9A 1F60B 2LXUA 3H45C 3ETOA 4YOWA 2MQOA 1IKXB 2HSEB 4UQTA 2KG1A 1RGIA 1V85A 2KM8C 2WTFA 3PNCA 4MLEA 2DGUA 2KDOA 3OS0A 3CERA 3EY1A 2AGQA 5AQJA 4DHYA 1XR5A 3P39A 2K4HA 3F5TA 2P66A 1H72C 4TLRA 3EE3A 4KGMA 4CTAB 1XNSA 3SMZA 1ZQQA 2D0BA 1WUAA 2R8GA 3VA3A 7ICGA 5JVGL 3DDKA 4ED6A 1VR6A 3PSPA 1WI8A 2JVRA 4H5WA 4JI8K 1XU4A 4A57A 4NLWA 2CJ9A 3GFHA 1RWMB 3VCDA 3HMJG 3FZFA 4BC5A 2IDOA 1W2IA 2N82B 1WCLA 1VOMA 5AI5A 2DEI