4RQNA

Crystal structure of the native bicc1 sam domain r924e mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
SDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein bicaudal C homolog 1
total genus 21
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqnA01
2B6GA 1WWVA 2E8PA 1F0MA 2K60A 1SV4A 3TADC 2E8OA 2Y9UA 1WWUA 4RQMA 3TACB 5J8YC 1SV0C 2D3DA 2L5YA 2QB0B 1JI7A 3SEIA 1V38A 4PZOA 3IDWA 1PK1A 1X40A 3K1RB 2Y9TA 3TADA 2F3NA 5F3XB 2DL0A 1B0XA 1KW4A 1SGGA 2KSOB 2EANA 2EAPA 2KSOA 1SXEA 4NL9A 2EAOA 2LPEA 5JU5A 2KE7A 3H8MA 1X66A 2ESEA 5J8YA 3BS5A 1RG6A 2YTUA 1V85A 4RQNA 3BS5B 2FE9A 2QARA 1X9XA 2JV3A 1OXJA 1DXSA 1OW5A 2QARB 1B4FA 4MHVA 2GLEA 5L1MA 2D8CA 3BQ7A 3HILA 2DKXA 3SENA 1LKYA 2QB0A 1PK3A 1LKYB 1PK1B 2KMDA 2K4PA 4IS7A 5JRTA 4NJ8A 2KIVA 1SV0A 2F44A 1UQVA 2LMRA 1COKA 2F8KA 5JTIA 1SXDA 4NL9C 4PZNA 2E8MA 2DKZA 1Z1VA 2E8NA 2EAMA 2QB1A 3KKAA 2ES6A 5KNIA 1UCVA 3KKAC 3BS7A 2QKQA 2KG5A
chains in the Genus database with same CATH superfamily
1SKWA 2B6GA 5KT7A 2W11A 2OH2A 4PGYA 3C21A 2I9GA 3ETRA 2ZXHA 1XC9A 2FMQA 3PR5B 1SV0C 4ED1A 4Q45A 1NI3A 5J2HA 1ZYQA 2ZJ8A 4M6WB 4I2AA 2HBLA 5AIBA 2C28A 4GC7A 5AK3A 4HYKA 8ICMA 4EX7A 1KW4A 5KFAA 2EAPA 2OHFA 2F1JA 3KD3A 1RG6A 4M9GA 3FAHA 4BX9C 3NVVA 4Y2QA 1TFRA 2KHQA 4CF4A 4PL2A 3M8RA 5J2GA 1RXWA 4F5RA 4I2IA 5HMLA 1S8OA 2KTQA 2AGOA 4M04A 2VANA 4RNMA 3SENA 3ZD8A 3BJYA 2LI6A 4PHAA 3RTVA 2EDUA 5DG8A 1T7PA 3UQ2A 4U7CA 3SR6A 4QWDA 1L5UA 3I1YA 1ZRMA 1UT5A 4GFJA 2KVSA 1SWVA 2HHVA 3T5HA 2KVCA 5CEHA 2F1HA 2ATLA 4UB5A 4I2HA 3H8JA 1SKRA 3ZDAA 3WK7A 4PPXA 1Z1VA 2E1EA 4B9NA 1L3TA 4J9RA 4PH5A 5DDMA 1BVSA 2H3ZA 2FLPA 2EZYA 2F77X 3FDSA 4CRXA 3Q8QB 1X6JA 5L1KA 3MR6A 1MQ3A 1WWVA 5ALLA 8ICZA 2HMXA 3MR3A 3KHHA 2XCPA 2WF5A 1HUOA 4QZCA 4JMUA 1HUZA 1JALA 8ICLA 5EWEA 4MFAA 1LV5A 4Z6FA 4YCXA 3RAQA 4Y2RA 4ECZA 5KFMA 4I28A 5KFBA 4ED6A 1B43A 2E5SA 2HOQA 2K4EA 3UXOA 5J2JA 3MDAA 1IV8A 4YXJA 1RXVA 5ALVA 4GC6A 3PX6A 2KZ3A 2R8HA 1X66A 1DGSA 2YTUA 3H4BA 1NK6A 1NJYA 4O5EA 4Y2SA 3ISBA 4CCHA 4CF3A 5AI8A 3QU7A 5J0YA 4KX3A 4YG2A 2M0NA 2XIDA 4J9MA 2IA6A 3JPSA 9ICMA 5EWGA 4QWAA 4O3QA 1KSPA 5AK5A 4MFFA 4YXMA 1NK9A 3QUQA 3GIIA 3DEEA 1Z1BA 5TZVA 2J6SA 4ED0A 2ODGA 2W9CA 5CRXA 4ECUA 4K4GA 3C2LA 4B9SA 3BQ2A 3SZ2A 4CE6A 1QQ6A 4EZ9A 4DF8A 4M9JA 2F44A 1KLNA 1T94A 2LMRA 3T5LA 2JEIA 1MA7A 2ZIWB 1ZRNA 3HKZF 4LZDA 3BQ0A 3TAPA 1TAMA 3ZI4A 4NY8A 3QEAZ 2PFQA 4QZEA 3RBDA 2RDIA 8ICHA 3GIKA 4DL7A 2PFNA 8ICEA 3LYSA 5AM0A 5J2DA 4I2EA 4E0DA 4RQ3A 2WB1C 3T3FA 3KHRA 4C80A 4YD2A 4Y2YA 4DL2A 3UMGA 4ECSA 3D2QA 1N2XA 3T79A 2WHEA 4K4HA 4GXJA 4DQPA 7ICEA 2W54A 1DK3A 3GILA 3MGIA 2UVWA 4RUAA 1UA0A 5F3XB 4PHPA 2RDJA 5AIAA 5KFOA 4ECVA 4DSEA 1L7MA 1PUZA 2LPEA 4ECRA 4CGZA 2V9WA 1Z3EB 2ISOA 4DQRA 2FDRA 1U48A 2JH7A 7ICIA 3GV7B 5CWRA 1X9MA 4O0IA 5ALXA 4RZRA 1ZQRA 2BKEA 3RB3A 4Z6EA 5ALMA 1Q46A 2ZTCA 4B9UA 1S77D 2KD1A 5AI4A 4F5NA 4BDPA 9ICVA 3CRXA 4C4SA 4NM1A 5EOZA 1CUKA 4F2SA 5DBAA 4UAVA 2KJ8A 2PI5A 4B9MA 2H5XA 1ZETA 5KAIU 4I2GA 2JH1A 5EE9A 1GO3F 4YFKA 4DOBA 3F2BA 4I2JA 4ZOHC 4NLCA 5AI5A 4NJ8A 1UT8A 3GIMA 4TURA 2KIVA 1AQ6A 3NUQA 1DOQA 4NL9C 3UQ0A 4I2CA 3GZFA 5ALPA 2DKZA 4G3IA 5DGAA 1FFUA 4KLTA 2WF6A 1ZQJA 1KBUA 3N97B 4F91B 5J0WA 2RLTA 1D9FA 5ALQA 4GLXA 4EZ6A 3V6KA 2H3QA 4F4ZA 1HEKA 2BQRA 8ICBA 1O03A 3QU9A 4DL4A 4K4IA 3SAHA 2P35A 2D3DA 4NWIA 2NRVA 4QZGA 3AUOA 4M9LA 4RPZA 1PK1A 3C29A 3EZ5A 4ELTA 9ICXA 4EYIB 2F8LA 1TK8A 5J29A 1RDFA 1A0PA 4DFMA 3K1ZA 2W9AA 1JUDA 2ZUDA 1ZD5A 4YR3A 4IC9A 2ZXIA 4IQVA 3CNHA 9ICLA 2IOFK 3QZ7A 1BGXT 4ACOA 2IMWP 5AI0A 5KFGA 2W03A 5AKIA 4QJFB 1ZQOA 2BPFA 4KLSA 3K75D 3WK4A 1X9WA 3SD7A 4NXZA 5GTHU 3EPGA 1S0VA 2QB0A 1PK3A 4EENA 2KHVA 1BPDA 4FZNA 3D2SA 8ICPA 5ALSA 3H7IA 4O5CA 2NRTA 3UPQA 1FEZA 1ZD4A 1BPYA 3AEVA 1L7PA 4P0PA 4QZBA 1KFSA 4ED3A 1NZPA 1QSSA 3QUBA 4DL5A 1HJPA 1A76A 3TKAA 1SZHA 4NLNA 3OJSA 2YQEA 5F9LA 1QCKA 5CP2A 2EAMA 1ZJMA 4NV0A 1ZD2P 2QB1A 1N48A 3AL0B 2NO5A 2KV2A 9ICCA 2OWOA 8ICVA 2VJ4A 1QLNA 5HR6A 3L5KA 4KMOB 4LVSA 4UB3A 1KTQA 1YT3A 1ZOLA 4ELUA 4DS4A 2R8IA 4O3MA 2MA1A 5AM1A 4M47A 1ZQVA 1NNLA 5FP0A 1V38A 4O3RA 2HDOA 3IDWA 3AU6A 2EH9A 1T4GA 2DL0A 4FFDA 4FS2A 2OCEA 8ICTA 3UM9A 2BHNA 1T8EA 1ZQGA 1T3QA 4IRDA 2WF9A 5KG2A 1U9LA 4RNOA 2W3RA 3BS5A 5T14A 3SQIA 4F5PA 2UVRA 3JPOA 4HAIA 1A77A 2FE9A 3T5JA 2AH5A 1ZQYA 3ISCA 2V4RA 4MEXA 5KFCA 3TARA 7ICVA 3V72A 3F5AA 2IHNA 5ALOA 2YMLA 1DRGA 3WK9A 1IXRA 1V97A 1LKYA 3QUTA 5AKZA 9ICWA 5KG7A 2NRWA 4DL6A 3UMBA 4IQWA 2XCAA 8ICYA 4UATA 2ZJ5A 4DL3A 4F92B 5HHHA 2VJ5A 4UASA 4DLGA 4TQSA 9ICOA 5AKLA 4B6JA 4DO9A 4FE3A 5JTIA 1N61A 5H2FU 1JIHA 8ICIA 4OD0A 3QYPA 2KKPA 3E2EA 4XQ8A 3IHQB 4RQ1A 1RZTA 1X9SA 4Y2PA 5IIOA 3SYZA 3ONNA 4UBBA 3C23A 3QZ8A 3EUB2 4O3PA 1IIPA 4F93B 4ED7A 5D49A 8ICAA 2AQ0A 2OXOA 4DOAA 4R66A 4EEKA 3E0FA 1NK4A 4KMUA 3TACB 3QNMA 5J8YC 2KFNA 4UB1A 2BDPA 3KZXA 4J9SA 4F50A 1ZQLA 2FMSA 3RJGA 2OM6A 3V7LA 5J0OA 2F3NA 1B0XA 2I6XA 2UVUA 2XGQA 4JV1A 4DQSA 2A1AA 5KT6A 2KE7A 1HIWA 1PVQA 4C8MA 1TK0A 3WK6A 1ZQXA 5ALEA 5KG5A 4XRHA 3F53A 3NTUA 4Q44A 4WJ3B 3PSFA 3VC8A 4BXOA 1V9PA 3AQFA 1MSWD 1Z00A 2FLNA 1TE2A 1Q8KA 2W55A 1ZQQA 5GTIU 2PI4A 2G5HB 3SI8A 4IS7A 4B9LA 4DF4A 2E3TA 4QIWF 1ECWA 2BCVA 4P0QA 4B9VA 1ZQAA 2VA3A 2WF7A 8ICRA 2ZUCA 3MDCA 1RPLA 3OTQA 5TISU 5J0PA 1U4BA 2AHOB 5KFIA 5KFNA 1KEJA 2YN4A 5K4LA 3G6XA 1P7DA 4YR2A 5KFPA 5DGBA 3BQ1A 2LYBA 1JXLA 3KKAC 1JN3A 5KFTA 8ICFA 3IG5A 5DKWA 2FPKA 1N56A 3AN1A 5IINA 3QU2A 3SAFA 2KKVA 3THVA 2PFPA 4RQ7A 3PW5A 3B0YA 3H0MB 3SEIA 8ICQA 2BCSA 2HHSA 3FM9A 4UAYA 5CB1A 2K4HA 3MGHA 4J9LA 2HHWA 2KJ5A 2RHFA 4MEYA 4JV0A 4QZHA 4EEYA 4DEZA 5ALKA 2ASDA 4KLMA 4BJQA 5L1JA 3PW0A 3BS5B 1UA1A 5J2IA 1U49A 3M9NB 1NK8A 3C28A 4NM2A 1X9XA 1NZBA 5AK4A 1Q3UA 2ALZA 2HBJA 2WFAA 1K1QA 4EBCA 4F5QA 4DS5A 2K8AA 4DSLA 1NOMA 2KICA 2R8GA 3MABA 3BZCA 5J0SA 2BCUA 3M7DA 2HBKA 9ICEA 3UXNA 3C2KA 1L3VA 5ALWA 5DQGA 2HHQA 5J2FA 9ICFA 1SXDA 2GOLA 3NRZA 5IIKA 2F1IA 4IQUA 1QTMA 2K8CB 2PMZF 1PVPA 2KP7A 3AU2A 3GQCA 3QUCA 2I1QA 2WAQC 3Q8RB 4OJ6A 2WAQF 1S10A 3I76A 2G06A 5KFLA 3PX4A 3KFUF 5EWFA 4RUCA 5DDYA 4ECQA 3ZDBA 2PMZC 5KFJA 4F4XA 5DLFA 5KFYA 2Y9UA 1ZQIA 4KN4A 3Q8SB 2BPGA 3GV5B 2QB0B 4EELA 3D6JA 5KFDA 7ICQA 3RAXA 4KLIA 1RYSA 3RB6A 4MFCA 5KT5A 4PGXA 3HPOA 2YMQA 1L3UA 1SXEA 4P2HA 2F2AB 5ALFA 2BZFA 5KFFA 2F76X 1C7YA 1TVAA 2HSZA 4RQNA 4TUQA 7ICKA 1QQ7A 2W04A 4I27A 5AKYA 3SV3A 1BPXA 1MN8A 5L9XA 1DXSA 1B4FA 1PZNA 3LVWA 2D6FC 9ICAA 5D4BA 3TAQA 3BQ7A 3HILA 2C2DA 2KNJA 7ICGA 5HP4A 5L1IA 5KT4A 5KG4A 3VCBA 4JV2A 9ICBA 3IM1A 3JPNA 3N7SC 2XGPA 3IG8A 1J2NA 3O0FA 1PK1B 1SL1A 1KFTA 4JUZA 5J2KA 1M6YA 2Q0ZX 1LB2B 3HX0A 1FFVA 1BPEA 3PW7A 2LHTA 3Q8MA 2NRXA 2ZIWA 4PZNA 4JWNA 3RJEA 5KFUA 3RH5A 3MFHA 3HT3A 2HI0A 2ZIXA 1N5XA 4Y2TA 3I28A 4RQ5A 4YR0A 1N5WA 2YMMA 4TUSA 4PHDA 2DGZA 3KKAA 1J2MA 9ICPA 1TV9A 5KFEA 3TFSA 3BS7A 4IR1A 1VJ5A 4ICAA 5KG0A 2E8PA 3LK9A 4OJLA 4FBUA 1TKDA 9ICGA 5DBBA 5C0YA 3PR4A 3UMCA 4YMNA 3RRHA 1ZQTA 9ICRA 3V6JA 1N62A 4DFPA 2XY6A 1RQLA 4G9BA 4NLKA 5KG6A 1SB3C 3K1RB 5KFKA 1SWWA 2V4QA 2GO7A 4RQ0A 2UVVA 3K4GA 2FPLA 2XC9A 5J2BA 2KK0A 2QLTA 2HHTA 2EZXA 3NGDA 3IRUA 7ICTA 4DLEA 3OSPA 2B0CA 1WYGA 2BPCA 5JU5A 2ZTDA 3G6YA 4RQ8A 2BQUA 5B66U 9ICSA 2G08A 4GXKA 7ICPA 3H0RB 3C2MA 4YN4A 1ZQNA 2OEHA 3EPIA 1IG6A 4Q8FA 3MC1A 5ALYA 4MHVA 1J97A 4US9A 1FO4A 4QZ9A 5L1MA 3PO4A 2CRXA 4KX5A 4F72A 4YP3A 7ICRA 4IRCA 5KFQA 3IN5A 1X42A 4EX6A 1SZPA 2FMPA 1L3SA 1NJXA 4DWIA 4ED2A 2JXJA 1ZQPA 5KG1A 2KIWA 4M9NA 3BZKA 4ECTA 1ZQZA 4DSIA 2K4PA 1ZD3A 3KHGA 4XA5A 1ZJNA 1ZQWA 2DF4B 2JRZA 1N60A 1JRPA 2HCFA 4UB4A 3NVWA 3JPPA 1ZQKA 3E58A 5IIJA 1QSLA 4UAUA 3EYZA 4I2FA 1Q3VA 2XVTA 2YX8A 4FZMA 3ICXA 4LZGA 4F3OA 4C8NA 2JEFA 5HHIA 1L8LA 4Y2UA 1D8BA 2LYAA 2PKEA 2ISPA 2XY5A 4UBCA 4DQQA 4QNLA 8ICXA 3LWLA 5J0RA 7ICFA 2VA2A 4PZOA 1X6IA 1S0MA 3JPTA 2MUTB 2EANA 2GWSA 4NL9A 1S9FA 2EAOA 3F2CA 5DLGA 4IRKA 3H8MA 3C5FA 1UHUA 4R8UA 3MFIA 4DFKA 2HBMA 3RH6A 3CP8A 4R64A 1NKCA 1TAQA 3G6VA 3BDPA 2NRZA 2P6RA 3N28A 1XNSA 2DKXA 1WG8A 4RNNA 3TQ1A 3HWTA 3ED5A 5J2EA 3HJEA 4P4MA 3V7JA 1ZQDA 3GIJA 4UQGA 1S0OA 7ICUA 2KJ9A 5CR0A 2WF8A 4IR9A 2R18A 3RR8A 1SIJA 3RBEA 2GH1A 3PVXA 3IV6A 2IOFA 3ORYA 4F4YA 4Q8EA 5KFXA 8ICCA 3H0LB 2H3IA 3F2DA 4AYBC 5ALUA 4USAA 3ZDCA 1CEZA 2H3FA 1B22A 4ECXA 1KRPA 1L7OA 2KG5A 3PSIA 5AKGA 1MC8A 4BWMA 2ZJAA 1F0MA 2K60A 4QW9A 4BXOB 2KOBA 9ICHA 2JZBB 1LVHA 3OPXA 2E8OA 5AM2A 3N4MB 1VDVA 2DWQA 5AM5A 4KITB 2DQNB 2IBKA 4F4KA 3B9JA 2Y9TA 4M6WA 4AYBF 4AP9A 2K89A 3SAGA 5J2CA 3H4DA 3HKZC 2PFOA 1ED1A 5DQHA 3Q8KA 2Y0SC 1JX4A 4M9HA 2DBYA 7ICSA 4F8RA 2B21A 5J8YA 2BR0A 1KDHA 5ALJA 3OJUA 2J6TA 2ZUBA 2ZTEA 4IL6U 3EWAA 9ICIA 3OSNA 5HMMA 4EBDA 4Q43A 4A8EA 4RQ2A 5KFHA 4Y2JA 4IQTA 4O9MA 5AI6A 3RR7A 4CDGA 4QZFA 3PMLA 3PW4A 9ICTA 1NJWA 2VKQA 7ICNA 2DPJA 4OJPA 3MGVA 4PJ0U 3RB4A 4DSJA 2AGQA 4UARA 2NV3A 1SV0A 2KEYA 2W8LA 3TANA 3ZDEA 3DV9A 4DCCA 3RJFA 2A1JA 2ZIVA 2E8MA 1KN5A 4OCZA 2HW3A 1SL0A 3NASA 2CPRA 7ICJA 4X5VA 5AKKA 8ICWA 4R63A 1BPBA 5AM3A 4J9QA 5AKXA 4F4WA 2ASLA 4ZH4A 1ZQEA 1QSYA 4QZAA 4FBTA 3U26A 2N1RA 3TADC 4ELVA 1ZQ1C 4RQMA 4J9PA 4UB6U 4OO1J 3KBBA 3BQTA 2W3SA 2R8KA 1X40A 5C5JA 4UB8U 4R65A 4M0AA 1TK5A 2W9MA 4C7ZA 2W8KA 3PY8A 1QQ5A 2MUTA 2FJ6A 2AGPA 3ALRA 3WK5A 5B5EU 2XICA 1CRXA 2YB1A 3KZIU 1K1SA 2IHMA 1DGJA 3NVYA 3AM9A 3HRDD 3AMZA 3PSTA 8ICNA 3NS1A 5EE1A 2K4IA 5DB7A 2JV3A 1S5LU 1XWLA 2KFZA 2DUYA 1OW5A 2HOIA 4BWJA 3A0BU 5HNKA 3QU4A 4FO6A 3D2NA 1BNPA 4F5OA 4I2BA 4OJOA 5J0TA 7ICMA 1Z00B 2FLLA 1Z19A 4JB3A 2HVIA 1F44A 3HP6A 1NK7A 4P0QB 3MBYA 4MF2A 4QWCA 4RPYA 4PL1A 3RFAA 5KG3A 3MR2A 5ALGA 5EE3A 2WB1F 4QZIA 4NLZA 5BPCA 3QXGA 5KT3A 4DFJA 3WKBA 3M9OB 2FPMA 4KLGA 4ECYA 2EZZA 3FC4A 1DK2A 3DDHA 4YMMA 3M1YA 4KLJA 3M9MB 7ICOA 1N63A 5J2AA 2HHUA 5IIIA 2JZBA 3TFRA 1WUDA 4LJXA 3PX0A 3RB0A 3N7RC 2BCQA 5EE0A 4P4OA 1ZQHA 4C7YA 3J81j 2C2RA 5DG7A 9ICUA 2W9BA 3TI0A 2KSOB 3QX7A 5KFZA 4UAWA 1TAUA 3RJIA 1OUQA 2ZIXB 2LKYA 3WK8A 2ESEA 1D8LA 1KQQA 4C0ZA 4RPXA 4KLDA 4M2YA 2CN1A 4UW9A 3WU2U 2J6UA 3S6JA 2C2EA 2ZIUB 1BNOA 8ICSA 2Q4TA 5IIMA 3PZPA 4QZDA 5ALHA 3C5GA 2D8CA 2I5HA 1S76D 4TUPA 3CW2C 1Z4OA 4JK1A 1L6NA 9ICQA 2AXTU 3EW9A 1C20A 1XO1A 3SMVA 1S0NA 2DFLA 1XS9D 2YB4A 4J03A 4Y2XA 2CXYA 5AKJA 4C4TA 2Y1JA 1L8OA 2ZIVB 3H8SA 4I29A 4UB2A 3HW8A 5IILA 2AU0A 2RRDA 1XSLA 3C1ZA 2Y1IA 2HHXA 2OYYA 2Z7JA 4BGDA 3LVVA 3M6ZA 4J9KA 1D9DA 1SV4A 5BOLA 3UXPA 2RQ5A 4EYHB 3NVZA 1WWUA 3V6HA 1MQ2A 2A3VA 5JUMA 5KFVA 4NLGA 1JI7A 3RJKA 2G09A 2P6UA 4O3OA 4Y2VA 5E79U 2LM4A 4KLQA 3QE9Y 2W9CB 2AQ4A 5KFSA 2FI1A 4PHEA 3PW2A 5J0XA 4UAZA 2A19A 2W7PA 5AK6A 4J9OA 4F2RA 5AICA 2R8JA 1Y88A 1NKBA 2KZZA 3CYMA 1U47A 2BQ3A 1COOA 4RQ4A 2QARA 2MU2A 4CF5A 1OXJA 5D46A 4RT3A 3AQEA 1ZXIA 3RJHA 2NO4A 2MRLA 3LWMA 4ECWA 3RH4A 2JEJA 5J0QA 3ETLA 2XI9A 1SL2A 2HOFA 1YZ6A 4YMOA 4TQRA 3V7KA 3T5KA 3RJJA 2ASJA 3ISDA 2G0AA 4XUSA 3H40A 4P0PB 1T3NA 4QZ8A 5AKHA 2LYHA 1UQVA 4EBEA 5AI9A 2JEGA 8ICGA 3F5EA 2O6KA 4QW8A 1KL9A 5KL1B 3WKCA 4KN7A 3WKEA 2E1FA 2HVHA 2G07A 2E8NA 3RF9A 2XO7A 5DQIA 4F71A 2NYVA 5KL8B 5DB6A 1WCLA 3H8WA 2JR5A 1JXEA 9ICJA 4C8KA 5AKEA 3QEBZ 5A0LA 1ZQFA 4DFDA 3Q8PB 1BPZA 2H3VA 3OHBA 3FYHA 4FS1A 1NKEA 3PSPA 4MF8A 1F5SA 3A0HU 4NLBA 1IM4A 3NRWA 2K8BB 1CI4A 1JMSA 3Q8LA 2KZMA 3OGUA 3TADA 4DQIA 5KT2A 1SGGA 4JWMA 1Z4NA 2KSOA 3GV8B 2LBOA 4GXIA 5ALNA 4OJ5A 3L4PA 2A1JB 2VIXA 1XSNA 4RQ6A 4YD1A 4O3NA 3B0XA 4QIWC 5KAFU 3KHLA 4RT2A 1V85A 4US8A 4QWBA 2AJQA 1URJA 2W7OA 5CJ7A 2ZIUA 2M9NA 5ALRA 2GLEA 2BCRA 1WCNA 4KLLA 2C22A 5DG9A 4I2DA 3IP4B 1PVRA 5L1LA 2P66A 1LKYB 3JPQA 1ZQMA 2KMDA 8ICJA 3N7PD 5AHXA 5JRTA 2ZG6A 5CA7A 1RYUA 3JPRA 2BDUA 4DOCA 1L7NA 1U45A 1COKA 2F8KA 5G5GA 4KLUA 4ED8A 3WKDA 1D8YA 2WTFA 3RRGA 2W43A 4RU9A 5ALZA 1O08A 9ICKA 2ES6A 3R9KA 2JGAA 5KNIA 1NK0A 2PXIA 1RYRA 2XY7A 2Y0SF 2IOHA 2G5IB 3KOOA 4KTQA 4KLEA 8ICOA 3PMNA 5KFRA 2RP5A 1X2IA 2L5YA 1ZQBA 5KFWA 1QH9A 4J9NA 5CHGA 4P4PA 4PGQA 1RM6C 7ICLA 4Z6DA 2MSNA 5DB8A 4CNQA 3PV8A 4DSFA 4BUGA 4C8LA 1JROA 3PNCA 4DSKA 1S97A 1H38A 4C8OA 3L3FX 1XO0A 1KKXA 4KLOA 3LDAA 4R8UB 2LM1A 1SKSA 1ZQSA 7ICHA 3MR5A 5HR7A 1AROP 4B9TA 3C1YA 2QARB 2VA8A 5BOMA 5AM4A 1NK5A 2KN7A 3ZDDA 1EXNA 1ZQCA 1UPHA 4GIBA 1YZ7A 1ZQUA 4FZLA 5J0UA 5DB9A 5ALIA 3SV4A 4KLFA 2YMPA 2YY6A 3WKAA 1RQNA 1A6SA 8ICUA 1KFDA 8ICKA 3M6KA 3GFKB 1K5OA 5ALTA 1NJZA 3GDXA 3KTQA 2W9BB 2EQYA 1VLBA 4YQWA 2DPIA 4C4RA 4Z6CA 9ICNA 5KTQA 5G5HA 5F9NA 4O5KA 2JHDA 4YVZA 3GU3A 5DBCA 4QWEA 3M8SA 3OHAA 3QU5A 5ALDA 4KLHA 2JMGA 4U6PA 3ZD9A 2BGWA 1UCVA 1FIQA 4O3SA 2MAXA 1XU4A 3PO5A 2QKQA 1XSPA
chains in the Genus database with same CATH topology
2B6GA 1WWVA 2E8PA 1F0MA 2K60A 1SV4A 3TADC 2E8OA 2Y9UA 1WWUA 4RQMA 3TACB 5J8YC 1SV0C 2D3DA 2L5YA 2QB0B 1JI7A 3SEIA 1V38A 4PZOA 3IDWA 1PK1A 1X40A 3K1RB 2Y9TA 3TADA 2F3NA 5F3XB 2DL0A 1B0XA 1KW4A 1SGGA 2KSOB 2EANA 2EAPA 2KSOA 1SXEA 4NL9A 2EAOA 2LPEA 5JU5A 2KE7A 3H8MA 1X66A 2ESEA 5J8YA 3BS5A 1RG6A 2YTUA 1V85A 4RQNA 3BS5B 2FE9A 2QARA 1X9XA 2JV3A 1OXJA 1DXSA 1OW5A 2QARB 1B4FA 4MHVA 2GLEA 5L1MA 2D8CA 3BQ7A 3HILA 2DKXA 3SENA 1LKYA 2QB0A 1PK3A 1LKYB 1PK1B 2KMDA 2K4PA 4IS7A 5JRTA 4NJ8A 2KIVA 1SV0A 2F44A 1UQVA 2LMRA 1COKA 2F8KA 5JTIA 1SXDA 4NL9C 4PZNA 2E8MA 2DKZA 1Z1VA 2E8NA 2EAMA 2QB1A 3KKAA 2ES6A 5KNIA 1UCVA 3KKAC 3BS7A 2QKQA 2KG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B6G A;  1WWV A;  2E8P A;  1F0M A;  2K60 A;  1SV4 A;  3TAD C;  2E8O A;  2Y9U A;  1WWU A;  4RQM A;  3TAC B;  5J8Y C;  1SV0 C;  2D3D A;  2L5Y A;  2QB0 B;  1JI7 A;  3SEI A;  1V38 A;  4PZO A;  3IDW A;  1PK1 A;  1X40 A;  3K1R B;  2Y9T A;  3TAD A;  2F3N A;  5F3X B;  2DL0 A;  1B0X A;  1KW4 A;  1SGG A;  2KSO B;  2EAN A;  2EAP A;  2KSO A;  1SXE A;  4NL9 A;  2EAO A;  2LPE A;  5JU5 A;  2KE7 A;  3H8M A;  1X66 A;  2ESE A;  5J8Y A;  3BS5 A;  1RG6 A;  2YTU A;  1V85 A;  4RQN A;  3BS5 B;  2FE9 A;  2QAR A;  1X9X A;  2JV3 A;  1OXJ A;  1DXS A;  1OW5 A;  2QAR B;  1B4F A;  4MHV A;  2GLE A;  5L1M A;  2D8C A;  3BQ7 A;  3HIL A;  2DKX A;  3SEN A;  1LKY A;  2QB0 A;  1PK3 A;  1LKY B;  1PK1 B;  2KMD A;  2K4P A;  4IS7 A;  5JRT A;  4NJ8 A;  2KIV A;  1SV0 A;  2F44 A;  1UQV A;  2LMR A;  1COK A;  2F8K A;  5JTI A;  1SXD A;  4NL9 C;  4PZN A;  2E8M A;  2DKZ A;  1Z1V A;  2E8N A;  2EAM A;  2QB1 A;  3KKA A;  2ES6 A;  5KNI A;  1UCV A;  3KKA C;  3BS7 A;  2QKQ A;  2KG5 A; 
#chains in the Genus database with same CATH topology
 1SKW A;  2B6G A;  5KT7 A;  2W11 A;  2OH2 A;  4PGY A;  3C21 A;  2I9G A;  3ETR A;  2ZXH A;  1XC9 A;  2FMQ A;  3PR5 B;  1SV0 C;  4ED1 A;  4Q45 A;  1NI3 A;  5J2H A;  1ZYQ A;  2ZJ8 A;  4M6W B;  4I2A A;  2HBL A;  5AIB A;  2C28 A;  4GC7 A;  5AK3 A;  4HYK A;  8ICM A;  4EX7 A;  1KW4 A;  5KFA A;  2EAP A;  2OHF A;  2F1J A;  3KD3 A;  1RG6 A;  4M9G A;  3FAH A;  4BX9 C;  3NVV A;  4Y2Q A;  1TFR A;  2KHQ A;  4CF4 A;  4PL2 A;  3M8R A;  5J2G A;  1RXW A;  4F5R A;  4I2I A;  5HML A;  1S8O A;  2KTQ A;  2AGO A;  4M04 A;  2VAN A;  4RNM A;  3SEN A;  3ZD8 A;  3BJY A;  2LI6 A;  4PHA A;  3RTV A;  2EDU A;  5DG8 A;  1T7P A;  3UQ2 A;  4U7C A;  3SR6 A;  4QWD A;  1L5U A;  3I1Y A;  1ZRM A;  1UT5 A;  4GFJ A;  2KVS A;  1SWV A;  2HHV A;  3T5H A;  2KVC A;  5CEH A;  2F1H A;  2ATL A;  4UB5 A;  4I2H A;  3H8J A;  1SKR A;  3ZDA A;  3WK7 A;  4PPX A;  1Z1V A;  2E1E A;  4B9N A;  1L3T A;  4J9R A;  4PH5 A;  5DDM A;  1BVS A;  2H3Z A;  2FLP A;  2EZY A;  2F77 X;  3FDS A;  4CRX A;  3Q8Q B;  1X6J A;  5L1K A;  3MR6 A;  1MQ3 A;  1WWV A;  5ALL A;  8ICZ A;  2HMX A;  3MR3 A;  3KHH A;  2XCP A;  2WF5 A;  1HUO A;  4QZC A;  4JMU A;  1HUZ A;  1JAL A;  8ICL A;  5EWE A;  4MFA A;  1LV5 A;  4Z6F A;  4YCX A;  3RAQ A;  4Y2R A;  4ECZ A;  5KFM A;  4I28 A;  5KFB A;  4ED6 A;  1B43 A;  2E5S A;  2HOQ A;  2K4E A;  3UXO A;  5J2J A;  3MDA A;  1IV8 A;  4YXJ A;  1RXV A;  5ALV A;  4GC6 A;  3PX6 A;  2KZ3 A;  2R8H A;  1X66 A;  1DGS A;  2YTU A;  3H4B A;  1NK6 A;  1NJY A;  4O5E A;  4Y2S A;  3ISB A;  4CCH A;  4CF3 A;  5AI8 A;  3QU7 A;  5J0Y A;  4KX3 A;  4YG2 A;  2M0N A;  2XID A;  4J9M A;  2IA6 A;  3JPS A;  9ICM A;  5EWG A;  4QWA A;  4O3Q A;  1KSP A;  5AK5 A;  4MFF A;  4YXM A;  1NK9 A;  3QUQ A;  3GII A;  3DEE A;  1Z1B A;  5TZV A;  2J6S A;  4ED0 A;  2ODG A;  2W9C A;  5CRX A;  4ECU A;  4K4G A;  3C2L A;  4B9S A;  3BQ2 A;  3SZ2 A;  4CE6 A;  1QQ6 A;  4EZ9 A;  4DF8 A;  4M9J A;  2F44 A;  1KLN A;  1T94 A;  2LMR A;  3T5L A;  2JEI A;  1MA7 A;  2ZIW B;  1ZRN A;  3HKZ F;  4LZD A;  3BQ0 A;  3TAP A;  1TAM A;  3ZI4 A;  4NY8 A;  3QEA Z;  2PFQ A;  4QZE A;  3RBD A;  2RDI A;  8ICH A;  3GIK A;  4DL7 A;  2PFN A;  8ICE A;  3LYS A;  5AM0 A;  5J2D A;  4I2E A;  4E0D A;  4RQ3 A;  2WB1 C;  3T3F A;  3KHR A;  4C80 A;  4YD2 A;  4Y2Y A;  4DL2 A;  3UMG A;  4ECS A;  3D2Q A;  1N2X A;  3T79 A;  2WHE A;  4K4H A;  4GXJ A;  4DQP A;  7ICE A;  2W54 A;  1DK3 A;  3GIL A;  3MGI A;  2UVW A;  4RUA A;  1UA0 A;  5F3X B;  4PHP A;  2RDJ A;  5AIA A;  5KFO A;  4ECV A;  4DSE A;  1L7M A;  1PUZ A;  2LPE A;  4ECR A;  4CGZ A;  2V9W A;  1Z3E B;  2ISO A;  4DQR A;  2FDR A;  1U48 A;  2JH7 A;  7ICI A;  3GV7 B;  5CWR A;  1X9M A;  4O0I A;  5ALX A;  4RZR A;  1ZQR A;  2BKE A;  3RB3 A;  4Z6E A;  5ALM A;  1Q46 A;  2ZTC A;  4B9U A;  1S77 D;  2KD1 A;  5AI4 A;  4F5N A;  4BDP A;  9ICV A;  3CRX A;  4C4S A;  4NM1 A;  5EOZ A;  1CUK A;  4F2S A;  5DBA A;  4UAV A;  2KJ8 A;  2PI5 A;  4B9M A;  2H5X A;  1ZET A;  5KAI U;  4I2G A;  2JH1 A;  5EE9 A;  1GO3 F;  4YFK A;  4DOB A;  3F2B A;  4I2J A;  4ZOH C;  4NLC A;  5AI5 A;  4NJ8 A;  1UT8 A;  3GIM A;  4TUR A;  2KIV A;  1AQ6 A;  3NUQ A;  1DOQ A;  4NL9 C;  3UQ0 A;  4I2C A;  3GZF A;  5ALP A;  2DKZ A;  4G3I A;  5DGA A;  1FFU A;  4KLT A;  2WF6 A;  1ZQJ A;  1KBU A;  3N97 B;  4F91 B;  5J0W A;  2RLT A;  1D9F A;  5ALQ A;  4GLX A;  4EZ6 A;  3V6K A;  2H3Q A;  4F4Z A;  1HEK A;  2BQR A;  8ICB A;  1O03 A;  3QU9 A;  4DL4 A;  4K4I A;  3SAH A;  2P35 A;  2D3D A;  4NWI A;  2NRV A;  4QZG A;  3AUO A;  4M9L A;  4RPZ A;  1PK1 A;  3C29 A;  3EZ5 A;  4ELT A;  9ICX A;  4EYI B;  2F8L A;  1TK8 A;  5J29 A;  1RDF A;  1A0P A;  4DFM A;  3K1Z A;  2W9A A;  1JUD A;  2ZUD A;  1ZD5 A;  4YR3 A;  4IC9 A;  2ZXI A;  4IQV A;  3CNH A;  9ICL A;  2IOF K;  3QZ7 A;  1BGX T;  4ACO A;  2IMW P;  5AI0 A;  5KFG A;  2W03 A;  5AKI A;  4QJF B;  1ZQO A;  2BPF A;  4KLS A;  3K75 D;  3WK4 A;  1X9W A;  3SD7 A;  4NXZ A;  5GTH U;  3EPG A;  1S0V A;  2QB0 A;  1PK3 A;  4EEN A;  2KHV A;  1BPD A;  4FZN A;  3D2S A;  8ICP A;  5ALS A;  3H7I A;  4O5C A;  2NRT A;  3UPQ A;  1FEZ A;  1ZD4 A;  1BPY A;  3AEV A;  1L7P A;  4P0P A;  4QZB A;  1KFS A;  4ED3 A;  1NZP A;  1QSS A;  3QUB A;  4DL5 A;  1HJP A;  1A76 A;  3TKA A;  1SZH A;  4NLN A;  3OJS A;  2YQE A;  5F9L A;  1QCK A;  5CP2 A;  2EAM A;  1ZJM A;  4NV0 A;  1ZD2 P;  2QB1 A;  1N48 A;  3AL0 B;  2NO5 A;  2KV2 A;  9ICC A;  2OWO A;  8ICV A;  2VJ4 A;  1QLN A;  5HR6 A;  3L5K A;  4KMO B;  4LVS A;  4UB3 A;  1KTQ A;  1YT3 A;  1ZOL A;  4ELU A;  4DS4 A;  2R8I A;  4O3M A;  2MA1 A;  5AM1 A;  4M47 A;  1ZQV A;  1NNL A;  5FP0 A;  1V38 A;  4O3R A;  2HDO A;  3IDW A;  3AU6 A;  2EH9 A;  1T4G A;  2DL0 A;  4FFD A;  4FS2 A;  2OCE A;  8ICT A;  3UM9 A;  2BHN A;  1T8E A;  1ZQG A;  1T3Q A;  4IRD A;  2WF9 A;  5KG2 A;  1U9L A;  4RNO A;  2W3R A;  3BS5 A;  5T14 A;  3SQI A;  4F5P A;  2UVR A;  3JPO A;  4HAI A;  1A77 A;  2FE9 A;  3T5J A;  2AH5 A;  1ZQY A;  3ISC A;  2V4R A;  4MEX A;  5KFC A;  3TAR A;  7ICV A;  3V72 A;  3F5A A;  2IHN A;  5ALO A;  2YML A;  1DRG A;  3WK9 A;  1IXR A;  1V97 A;  1LKY A;  3QUT A;  5AKZ A;  9ICW A;  5KG7 A;  2NRW A;  4DL6 A;  3UMB A;  4IQW A;  2XCA A;  8ICY A;  4UAT A;  2ZJ5 A;  4DL3 A;  4F92 B;  5HHH A;  2VJ5 A;  4UAS A;  4DLG A;  4TQS A;  9ICO A;  5AKL A;  4B6J A;  4DO9 A;  4FE3 A;  5JTI A;  1N61 A;  5H2F U;  1JIH A;  8ICI A;  4OD0 A;  3QYP A;  2KKP A;  3E2E A;  4XQ8 A;  3IHQ B;  4RQ1 A;  1RZT A;  1X9S A;  4Y2P A;  5IIO A;  3SYZ A;  3ONN A;  4UBB A;  3C23 A;  3QZ8 A;  3EUB 2;  4O3P A;  1IIP A;  4F93 B;  4ED7 A;  5D49 A;  8ICA A;  2AQ0 A;  2OXO A;  4DOA A;  4R66 A;  4EEK A;  3E0F A;  1NK4 A;  4KMU A;  3TAC B;  3QNM A;  5J8Y C;  2KFN A;  4UB1 A;  2BDP A;  3KZX A;  4J9S A;  4F50 A;  1ZQL A;  2FMS A;  3RJG A;  2OM6 A;  3V7L A;  5J0O A;  2F3N A;  1B0X A;  2I6X A;  2UVU A;  2XGQ A;  4JV1 A;  4DQS A;  2A1A A;  5KT6 A;  2KE7 A;  1HIW A;  1PVQ A;  4C8M A;  1TK0 A;  3WK6 A;  1ZQX A;  5ALE A;  5KG5 A;  4XRH A;  3F53 A;  3NTU A;  4Q44 A;  4WJ3 B;  3PSF A;  3VC8 A;  4BXO A;  1V9P A;  3AQF A;  1MSW D;  1Z00 A;  2FLN A;  1TE2 A;  1Q8K A;  2W55 A;  1ZQQ A;  5GTI U;  2PI4 A;  2G5H B;  3SI8 A;  4IS7 A;  4B9L A;  4DF4 A;  2E3T A;  4QIW F;  1ECW A;  2BCV A;  4P0Q A;  4B9V A;  1ZQA A;  2VA3 A;  2WF7 A;  8ICR A;  2ZUC A;  3MDC A;  1RPL A;  3OTQ A;  5TIS U;  5J0P A;  1U4B A;  2AHO B;  5KFI A;  5KFN A;  1KEJ A;  2YN4 A;  5K4L A;  3G6X A;  1P7D A;  4YR2 A;  5KFP A;  5DGB A;  3BQ1 A;  2LYB A;  1JXL A;  3KKA C;  1JN3 A;  5KFT A;  8ICF A;  3IG5 A;  5DKW A;  2FPK A;  1N56 A;  3AN1 A;  5IIN A;  3QU2 A;  3SAF A;  2KKV A;  3THV A;  2PFP A;  4RQ7 A;  3PW5 A;  3B0Y A;  3H0M B;  3SEI A;  8ICQ A;  2BCS A;  2HHS A;  3FM9 A;  4UAY A;  5CB1 A;  2K4H A;  3MGH A;  4J9L A;  2HHW A;  2KJ5 A;  2RHF A;  4MEY A;  4JV0 A;  4QZH A;  4EEY A;  4DEZ A;  5ALK A;  2ASD A;  4KLM A;  4BJQ A;  5L1J A;  3PW0 A;  3BS5 B;  1UA1 A;  5J2I A;  1U49 A;  3M9N B;  1NK8 A;  3C28 A;  4NM2 A;  1X9X A;  1NZB A;  5AK4 A;  1Q3U A;  2ALZ A;  2HBJ A;  2WFA A;  1K1Q A;  4EBC A;  4F5Q A;  4DS5 A;  2K8A A;  4DSL A;  1NOM A;  2KIC A;  2R8G A;  3MAB A;  3BZC A;  5J0S A;  2BCU A;  3M7D A;  2HBK A;  9ICE A;  3UXN A;  3C2K A;  1L3V A;  5ALW A;  5DQG A;  2HHQ A;  5J2F A;  9ICF A;  1SXD A;  2GOL A;  3NRZ A;  5IIK A;  2F1I A;  4IQU A;  1QTM A;  2K8C B;  2PMZ F;  1PVP A;  2KP7 A;  3AU2 A;  3GQC A;  3QUC A;  2I1Q A;  2WAQ C;  3Q8R B;  4OJ6 A;  2WAQ F;  1S10 A;  3I76 A;  2G06 A;  5KFL A;  3PX4 A;  3KFU F;  5EWF A;  4RUC A;  5DDY A;  4ECQ A;  3ZDB A;  2PMZ C;  5KFJ A;  4F4X A;  5DLF A;  5KFY A;  2Y9U A;  1ZQI A;  4KN4 A;  3Q8S B;  2BPG A;  3GV5 B;  2QB0 B;  4EEL A;  3D6J A;  5KFD A;  7ICQ A;  3RAX A;  4KLI A;  1RYS A;  3RB6 A;  4MFC A;  5KT5 A;  4PGX A;  3HPO A;  2YMQ A;  1L3U A;  1SXE A;  4P2H A;  2F2A B;  5ALF A;  2BZF A;  5KFF A;  2F76 X;  1C7Y A;  1TVA A;  2HSZ A;  4RQN A;  4TUQ A;  7ICK A;  1QQ7 A;  2W04 A;  4I27 A;  5AKY A;  3SV3 A;  1BPX A;  1MN8 A;  5L9X A;  1DXS A;  1B4F A;  1PZN A;  3LVW A;  2D6F C;  9ICA A;  5D4B A;  3TAQ A;  3BQ7 A;  3HIL A;  2C2D A;  2KNJ A;  7ICG A;  5HP4 A;  5L1I A;  5KT4 A;  5KG4 A;  3VCB A;  4JV2 A;  9ICB A;  3IM1 A;  3JPN A;  3N7S C;  2XGP A;  3IG8 A;  1J2N A;  3O0F A;  1PK1 B;  1SL1 A;  1KFT A;  4JUZ A;  5J2K A;  1M6Y A;  2Q0Z X;  1LB2 B;  3HX0 A;  1FFV A;  1BPE A;  3PW7 A;  2LHT A;  3Q8M A;  2NRX A;  2ZIW A;  4PZN A;  4JWN A;  3RJE A;  5KFU A;  3RH5 A;  3MFH A;  3HT3 A;  2HI0 A;  2ZIX A;  1N5X A;  4Y2T A;  3I28 A;  4RQ5 A;  4YR0 A;  1N5W A;  2YMM A;  4TUS A;  4PHD A;  2DGZ A;  3KKA A;  1J2M A;  9ICP A;  1TV9 A;  5KFE A;  3TFS A;  3BS7 A;  4IR1 A;  1VJ5 A;  4ICA A;  5KG0 A;  2E8P A;  3LK9 A;  4OJL A;  4FBU A;  1TKD A;  9ICG A;  5DBB A;  5C0Y A;  3PR4 A;  3UMC A;  4YMN A;  3RRH A;  1ZQT A;  9ICR A;  3V6J A;  1N62 A;  4DFP A;  2XY6 A;  1RQL A;  4G9B A;  4NLK A;  5KG6 A;  1SB3 C;  3K1R B;  5KFK A;  1SWW A;  2V4Q A;  2GO7 A;  4RQ0 A;  2UVV A;  3K4G A;  2FPL A;  2XC9 A;  5J2B A;  2KK0 A;  2QLT A;  2HHT A;  2EZX A;  3NGD A;  3IRU A;  7ICT A;  4DLE A;  3OSP A;  2B0C A;  1WYG A;  2BPC A;  5JU5 A;  2ZTD A;  3G6Y A;  4RQ8 A;  2BQU A;  5B66 U;  9ICS A;  2G08 A;  4GXK A;  7ICP A;  3H0R B;  3C2M A;  4YN4 A;  1ZQN A;  2OEH A;  3EPI A;  1IG6 A;  4Q8F A;  3MC1 A;  5ALY A;  4MHV A;  1J97 A;  4US9 A;  1FO4 A;  4QZ9 A;  5L1M A;  3PO4 A;  2CRX A;  4KX5 A;  4F72 A;  4YP3 A;  7ICR A;  4IRC A;  5KFQ A;  3IN5 A;  1X42 A;  4EX6 A;  1SZP A;  2FMP A;  1L3S A;  1NJX A;  4DWI A;  4ED2 A;  2JXJ A;  1ZQP A;  5KG1 A;  2KIW A;  4M9N A;  3BZK A;  4ECT A;  1ZQZ A;  4DSI A;  2K4P A;  1ZD3 A;  3KHG A;  4XA5 A;  1ZJN A;  1ZQW A;  2DF4 B;  2JRZ A;  1N60 A;  1JRP A;  2HCF A;  4UB4 A;  3NVW A;  3JPP A;  1ZQK A;  3E58 A;  5IIJ A;  1QSL A;  4UAU A;  3EYZ A;  4I2F A;  1Q3V A;  2XVT A;  2YX8 A;  4FZM A;  3ICX A;  4LZG A;  4F3O A;  4C8N A;  2JEF A;  5HHI A;  1L8L A;  4Y2U A;  1D8B A;  2LYA A;  2PKE A;  2ISP A;  2XY5 A;  4UBC A;  4DQQ A;  4QNL A;  8ICX A;  3LWL A;  5J0R A;  7ICF A;  2VA2 A;  4PZO A;  1X6I A;  1S0M A;  3JPT A;  2MUT B;  2EAN A;  2GWS A;  4NL9 A;  1S9F A;  2EAO A;  3F2C A;  5DLG A;  4IRK A;  3H8M A;  3C5F A;  1UHU A;  4R8U A;  3MFI A;  4DFK A;  2HBM A;  3RH6 A;  3CP8 A;  4R64 A;  1NKC A;  1TAQ A;  3G6V A;  3BDP A;  2NRZ A;  2P6R A;  3N28 A;  1XNS A;  2DKX A;  1WG8 A;  4RNN A;  3TQ1 A;  3HWT A;  3ED5 A;  5J2E A;  3HJE A;  4P4M A;  3V7J A;  1ZQD A;  3GIJ A;  4UQG A;  1S0O A;  7ICU A;  2KJ9 A;  5CR0 A;  2WF8 A;  4IR9 A;  2R18 A;  3RR8 A;  1SIJ A;  3RBE A;  2GH1 A;  3PVX A;  3IV6 A;  2IOF A;  3ORY A;  4F4Y A;  4Q8E A;  5KFX A;  8ICC A;  3H0L B;  2H3I A;  3F2D A;  4AYB C;  5ALU A;  4USA A;  3ZDC A;  1CEZ A;  2H3F A;  1B22 A;  4ECX A;  1KRP A;  1L7O A;  2KG5 A;  3PSI A;  5AKG A;  1MC8 A;  4BWM A;  2ZJA A;  1F0M A;  2K60 A;  4QW9 A;  4BXO B;  2KOB A;  9ICH A;  2JZB B;  1LVH A;  3OPX A;  2E8O A;  5AM2 A;  3N4M B;  1VDV A;  2DWQ A;  5AM5 A;  4KIT B;  2DQN B;  2IBK A;  4F4K A;  3B9J A;  2Y9T A;  4M6W A;  4AYB F;  4AP9 A;  2K89 A;  3SAG A;  5J2C A;  3H4D A;  3HKZ C;  2PFO A;  1ED1 A;  5DQH A;  3Q8K A;  2Y0S C;  1JX4 A;  4M9H A;  2DBY A;  7ICS A;  4F8R A;  2B21 A;  5J8Y A;  2BR0 A;  1KDH A;  5ALJ A;  3OJU A;  2J6T A;  2ZUB A;  2ZTE A;  4IL6 U;  3EWA A;  9ICI A;  3OSN A;  5HMM A;  4EBD A;  4Q43 A;  4A8E A;  4RQ2 A;  5KFH A;  4Y2J A;  4IQT A;  4O9M A;  5AI6 A;  3RR7 A;  4CDG A;  4QZF A;  3PML A;  3PW4 A;  9ICT A;  1NJW A;  2VKQ A;  7ICN A;  2DPJ A;  4OJP A;  3MGV A;  4PJ0 U;  3RB4 A;  4DSJ A;  2AGQ A;  4UAR A;  2NV3 A;  1SV0 A;  2KEY A;  2W8L A;  3TAN A;  3ZDE A;  3DV9 A;  4DCC A;  3RJF A;  2A1J A;  2ZIV A;  2E8M A;  1KN5 A;  4OCZ A;  2HW3 A;  1SL0 A;  3NAS A;  2CPR A;  7ICJ A;  4X5V A;  5AKK A;  8ICW A;  4R63 A;  1BPB A;  5AM3 A;  4J9Q A;  5AKX A;  4F4W A;  2ASL A;  4ZH4 A;  1ZQE A;  1QSY A;  4QZA A;  4FBT A;  3U26 A;  2N1R A;  3TAD C;  4ELV A;  1ZQ1 C;  4RQM A;  4J9P A;  4UB6 U;  4OO1 J;  3KBB A;  3BQT A;  2W3S A;  2R8K A;  1X40 A;  5C5J A;  4UB8 U;  4R65 A;  4M0A A;  1TK5 A;  2W9M A;  4C7Z A;  2W8K A;  3PY8 A;  1QQ5 A;  2MUT A;  2FJ6 A;  2AGP A;  3ALR A;  3WK5 A;  5B5E U;  2XIC A;  1CRX A;  2YB1 A;  3KZI U;  1K1S A;  2IHM A;  1DGJ A;  3NVY A;  3AM9 A;  3HRD D;  3AMZ A;  3PST A;  8ICN A;  3NS1 A;  5EE1 A;  2K4I A;  5DB7 A;  2JV3 A;  1S5L U;  1XWL A;  2KFZ A;  2DUY A;  1OW5 A;  2HOI A;  4BWJ A;  3A0B U;  5HNK A;  3QU4 A;  4FO6 A;  3D2N A;  1BNP A;  4F5O A;  4I2B A;  4OJO A;  5J0T A;  7ICM A;  1Z00 B;  2FLL A;  1Z19 A;  4JB3 A;  2HVI A;  1F44 A;  3HP6 A;  1NK7 A;  4P0Q B;  3MBY A;  4MF2 A;  4QWC A;  4RPY A;  4PL1 A;  3RFA A;  5KG3 A;  3MR2 A;  5ALG A;  5EE3 A;  2WB1 F;  4QZI A;  4NLZ A;  5BPC A;  3QXG A;  5KT3 A;  4DFJ A;  3WKB A;  3M9O B;  2FPM A;  4KLG A;  4ECY A;  2EZZ A;  3FC4 A;  1DK2 A;  3DDH A;  4YMM A;  3M1Y A;  4KLJ A;  3M9M B;  7ICO A;  1N63 A;  5J2A A;  2HHU A;  5III A;  2JZB A;  3TFR A;  1WUD A;  4LJX A;  3PX0 A;  3RB0 A;  3N7R C;  2BCQ A;  5EE0 A;  4P4O A;  1ZQH A;  4C7Y A;  3J81 j;  2C2R A;  5DG7 A;  9ICU A;  2W9B A;  3TI0 A;  2KSO B;  3QX7 A;  5KFZ A;  4UAW A;  1TAU A;  3RJI A;  1OUQ A;  2ZIX B;  2LKY A;  3WK8 A;  2ESE A;  1D8L A;  1KQQ A;  4C0Z A;  4RPX A;  4KLD A;  4M2Y A;  2CN1 A;  4UW9 A;  3WU2 U;  2J6U A;  3S6J A;  2C2E A;  2ZIU B;  1BNO A;  8ICS A;  2Q4T A;  5IIM A;  3PZP A;  4QZD A;  5ALH A;  3C5G A;  2D8C A;  2I5H A;  1S76 D;  4TUP A;  3CW2 C;  1Z4O A;  4JK1 A;  1L6N A;  9ICQ A;  2AXT U;  3EW9 A;  1C20 A;  1XO1 A;  3SMV A;  1S0N A;  2DFL A;  1XS9 D;  2YB4 A;  4J03 A;  4Y2X A;  2CXY A;  5AKJ A;  4C4T A;  2Y1J A;  1L8O A;  2ZIV B;  3H8S A;  4I29 A;  4UB2 A;  3HW8 A;  5IIL A;  2AU0 A;  2RRD A;  1XSL A;  3C1Z A;  2Y1I A;  2HHX A;  2OYY A;  2Z7J A;  4BGD A;  3LVV A;  3M6Z A;  4J9K A;  1D9D A;  1SV4 A;  5BOL A;  3UXP A;  2RQ5 A;  4EYH B;  3NVZ A;  1WWU A;  3V6H A;  1MQ2 A;  2A3V A;  5JUM A;  5KFV A;  4NLG A;  1JI7 A;  3RJK A;  2G09 A;  2P6U A;  4O3O A;  4Y2V A;  5E79 U;  2LM4 A;  4KLQ A;  3QE9 Y;  2W9C B;  2AQ4 A;  5KFS A;  2FI1 A;  4PHE A;  3PW2 A;  5J0X A;  4UAZ A;  2A19 A;  2W7P A;  5AK6 A;  4J9O A;  4F2R A;  5AIC A;  2R8J A;  1Y88 A;  1NKB A;  2KZZ A;  3CYM A;  1U47 A;  2BQ3 A;  1COO A;  4RQ4 A;  2QAR A;  2MU2 A;  4CF5 A;  1OXJ A;  5D46 A;  4RT3 A;  3AQE A;  1ZXI A;  3RJH A;  2NO4 A;  2MRL A;  3LWM A;  4ECW A;  3RH4 A;  2JEJ A;  5J0Q A;  3ETL A;  2XI9 A;  1SL2 A;  2HOF A;  1YZ6 A;  4YMO A;  4TQR A;  3V7K A;  3T5K A;  3RJJ A;  2ASJ A;  3ISD A;  2G0A A;  4XUS A;  3H40 A;  4P0P B;  1T3N A;  4QZ8 A;  5AKH A;  2LYH A;  1UQV A;  4EBE A;  5AI9 A;  2JEG A;  8ICG A;  3F5E A;  2O6K A;  4QW8 A;  1KL9 A;  5KL1 B;  3WKC A;  4KN7 A;  3WKE A;  2E1F A;  2HVH A;  2G07 A;  2E8N A;  3RF9 A;  2XO7 A;  5DQI A;  4F71 A;  2NYV A;  5KL8 B;  5DB6 A;  1WCL A;  3H8W A;  2JR5 A;  1JXE A;  9ICJ A;  4C8K A;  5AKE A;  3QEB Z;  5A0L A;  1ZQF A;  4DFD A;  3Q8P B;  1BPZ A;  2H3V A;  3OHB A;  3FYH A;  4FS1 A;  1NKE A;  3PSP A;  4MF8 A;  1F5S A;  3A0H U;  4NLB A;  1IM4 A;  3NRW A;  2K8B B;  1CI4 A;  1JMS A;  3Q8L A;  2KZM A;  3OGU A;  3TAD A;  4DQI A;  5KT2 A;  1SGG A;  4JWM A;  1Z4N A;  2KSO A;  3GV8 B;  2LBO A;  4GXI A;  5ALN A;  4OJ5 A;  3L4P A;  2A1J B;  2VIX A;  1XSN A;  4RQ6 A;  4YD1 A;  4O3N A;  3B0X A;  4QIW C;  5KAF U;  3KHL A;  4RT2 A;  1V85 A;  4US8 A;  4QWB A;  2AJQ A;  1URJ A;  2W7O A;  5CJ7 A;  2ZIU A;  2M9N A;  5ALR A;  2GLE A;  2BCR A;  1WCN A;  4KLL A;  2C22 A;  5DG9 A;  4I2D A;  3IP4 B;  1PVR A;  5L1L A;  2P66 A;  1LKY B;  3JPQ A;  1ZQM A;  2KMD A;  8ICJ A;  3N7P D;  5AHX A;  5JRT A;  2ZG6 A;  5CA7 A;  1RYU A;  3JPR A;  2BDU A;  4DOC A;  1L7N A;  1U45 A;  1COK A;  2F8K A;  5G5G A;  4KLU A;  4ED8 A;  3WKD A;  1D8Y A;  2WTF A;  3RRG A;  2W43 A;  4RU9 A;  5ALZ A;  1O08 A;  9ICK A;  2ES6 A;  3R9K A;  2JGA A;  5KNI A;  1NK0 A;  2PXI A;  1RYR A;  2XY7 A;  2Y0S F;  2IOH A;  2G5I B;  3KOO A;  4KTQ A;  4KLE A;  8ICO A;  3PMN A;  5KFR A;  2RP5 A;  1X2I A;  2L5Y A;  1ZQB A;  5KFW A;  1QH9 A;  4J9N A;  5CHG A;  4P4P A;  4PGQ A;  1RM6 C;  7ICL A;  4Z6D A;  2MSN A;  5DB8 A;  4CNQ A;  3PV8 A;  4DSF A;  4BUG A;  4C8L A;  1JRO A;  3PNC A;  4DSK A;  1S97 A;  1H38 A;  4C8O A;  3L3F X;  1XO0 A;  1KKX A;  4KLO A;  3LDA A;  4R8U B;  2LM1 A;  1SKS A;  1ZQS A;  7ICH A;  3MR5 A;  5HR7 A;  1ARO P;  4B9T A;  3C1Y A;  2QAR B;  2VA8 A;  5BOM A;  5AM4 A;  1NK5 A;  2KN7 A;  3ZDD A;  1EXN A;  1ZQC A;  1UPH A;  4GIB A;  1YZ7 A;  1ZQU A;  4FZL A;  5J0U A;  5DB9 A;  5ALI A;  3SV4 A;  4KLF A;  2YMP A;  2YY6 A;  3WKA A;  1RQN A;  1A6S A;  8ICU A;  1KFD A;  8ICK A;  3M6K A;  3GFK B;  1K5O A;  5ALT A;  1NJZ A;  3GDX A;  3KTQ A;  2W9B B;  2EQY A;  1VLB A;  4YQW A;  2DPI A;  4C4R A;  4Z6C A;  9ICN A;  5KTQ A;  5G5H A;  5F9N A;  4O5K A;  2JHD A;  4YVZ A;  3GU3 A;  5DBC A;  4QWE A;  3M8S A;  3OHA A;  3QU5 A;  5ALD A;  4KLH A;  2JMG A;  4U6P A;  3ZD9 A;  2BGW A;  1UCV A;  1FIQ A;  4O3S A;  2MAX A;  1XU4 A;  3PO5 A;  2QKQ A;  1XSP A; 
#chains in the Genus database with same CATH homology
 2B6G A;  1WWV A;  2E8P A;  1F0M A;  2K60 A;  1SV4 A;  3TAD C;  2E8O A;  2Y9U A;  1WWU A;  4RQM A;  3TAC B;  5J8Y C;  1SV0 C;  2D3D A;  2L5Y A;  2QB0 B;  1JI7 A;  3SEI A;  1V38 A;  4PZO A;  3IDW A;  1PK1 A;  1X40 A;  3K1R B;  2Y9T A;  3TAD A;  2F3N A;  5F3X B;  2DL0 A;  1B0X A;  1KW4 A;  1SGG A;  2KSO B;  2EAN A;  2EAP A;  2KSO A;  1SXE A;  4NL9 A;  2EAO A;  2LPE A;  5JU5 A;  2KE7 A;  3H8M A;  1X66 A;  2ESE A;  5J8Y A;  3BS5 A;  1RG6 A;  2YTU A;  1V85 A;  4RQN A;  3BS5 B;  2FE9 A;  2QAR A;  1X9X A;  2JV3 A;  1OXJ A;  1DXS A;  1OW5 A;  2QAR B;  1B4F A;  4MHV A;  2GLE A;  5L1M A;  2D8C A;  3BQ7 A;  3HIL A;  2DKX A;  3SEN A;  1LKY A;  2QB0 A;  1PK3 A;  1LKY B;  1PK1 B;  2KMD A;  2K4P A;  4IS7 A;  5JRT A;  4NJ8 A;  2KIV A;  1SV0 A;  2F44 A;  1UQV A;  2LMR A;  1COK A;  2F8K A;  5JTI A;  1SXD A;  4NL9 C;  4PZN A;  2E8M A;  2DKZ A;  1Z1V A;  2E8N A;  2EAM A;  2QB1 A;  3KKA A;  2ES6 A;  5KNI A;  1UCV A;  3KKA C;  3BS7 A;  2QKQ A;  2KG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...