4RQNA

Crystal structure of the native bicc1 sam domain r924e mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
SDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Protein bicaudal C homolog 1
publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
total genus 21
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqnA01
2QKQA 4MHVA 2E8NA 5L1MA 3KKAC 2K4PA 3TACB 2QB0B 2EANA 3BS5A 3TADC 1B4FA 1LKYA 5F3XB 1SV0A 1KW4A 2DL0A 1PK3A 1X9XA 3K1RB 4NL9A 1JI7A 2E8MA 1RG6A 2F44A 2E8OA 5JU5A 1SGGA 2LMRA 1WWUA 2DKXA 3BS5B 1LKYB 1X40A 2EAOA 1DXSA 2KE7A 2KIVA 2F8KA 1F0MA 1V85A 3KKAA 3HILA 2FE9A 2Y9UA 2Y9TA 3TADA 2YTUA 1Z1VA 2ESEA 5J8YC 3H8MA 1UCVA 1WWVA 5JRTA 2D3DA 1V38A 2GLEA 4PZNA 2KSOA 3SEIA 2EAPA 1SV4A 2QARA 1OXJA 1UQVA 5KNIA 2E8PA 1SV0C 2ES6A 1SXEA 1PK1B 2EAMA 1PK1A 4RQNA 2LPEA 3BQ7A 1X66A 2L5YA 3SENA 2QB0A 4NL9C 2D8CA 5JTIA 2QB1A 2F3NA 2KSOB 4PZOA 2K60A 5J8YA 4NJ8A 1SXDA 2KMDA 4IS7A 2QARB 2JV3A 1OW5A 2DKZA 1B0XA 2KG5A 3BS7A 3IDWA 2B6GA 1COKA 4RQMA
chains in the Genus database with same CATH superfamily
2NV3A 2EH9A 3EZ5A 5AM3A 4BXOA 4IRDA 1QSSA 3MR3A 4DQIA 3D2QA 1ZQ1C 1U48A 3I28A 3QYPA 4F4KA 7ICVA 3H7IA 3ZI4A 5KG5A 1KRPA 2ZUBA 3VCBA 3JPQA 1SZPA 4E0DA 2DBYA 1RYSA 4OJPA 3NVYA 3HPOA 1J2NA 2ISOA 3KOOA 1KLNA 3CRXA 4QJFB 2A19A 4ECRA 1TV9A 2XY6A 3QXGA 1Y88A 4YMMA 2B0CA 5DB9A 2KE7A 1SL1A 5CRXA 1QSYA 4G9BA 4DFPA 1SKWA 2ASDA 4DWIA 1ZOLA 5ALKA 7ICPA 3PW5A 2KJ5A 1BPEA 3UMBA 5ALLA 2ESEA 1TK0A 5HP4A 3MR5A 2JEFA 4RQ8A 4DFMA 1C20A 3H8MA 1UCVA 5J0PA 1AROP 2WFAA 4I2EA 4PL2A 2GLEA 7ICGA 3RRHA 1NK6A 1BNPA 5KFAA 3NRZA 3RJJA 5DQGA 1KL9A 3SR6A 1L6NA 5AHXA 1F5SA 4EEYA 3KHRA 2E8PA 1NK5A 3ETRA 2WF7A 4IQUA 2W7OA 3JPOA 4EX7A 4FBUA 2ZIXA 3Q8LA 5EOZA 7ICNA 3Q8MA 4US9A 1N48A 4P0QB 3WKDA 1KEJA 4U7CA 4DQRA 5DG7A 4NJ8A 2KJ8A 1T7PA 4NLKA 2YN4A 3QZ7A 5CJ7A 3RH5A 1ZD2P 1ZJMA 3KHLA 4DSEA 1JUDA 3RR7A 9ICUA 5KFKA 4EX6A 8ICIA 3IDWA 2QLTA 4PHDA 9ICOA 2WF5A 5HMMA 3Q8KA 4NY8A 7ICKA 4I27A 3L4PA 1LKYA 4M47A 5ALSA 2Q0ZX 4B9VA 2VANA 3NRWA 1KFTA 4PL1A 3MGHA 5IILA 5DGBA 2YX8A 3RBEA 3H4BA 3H0LB 1RYRA 1MQ3A 2KHQA 1LV5A 2E8OA 3T3FA 4C8OA 1C7YA 2FDRA 5J2HA 4F92B 3GIJA 3UPQA 2C2RA 2HBKA 2NRZA 4KLEA 2JZBA 4GIBA 3SZ2A 9ICCA 4ED1A 4IRCA 1ZRMA 3FYHA 9ICKA 4YR0A 4DFKA 3MFIA 5AKZA 1YT3A 2P35A 2W9MA 4PZNA 1NJWA 2H3QA 3GILA 5DKWA 5KFPA 4Z6FA 3ZDAA 1O08A 2DF4B 4O3OA 1DRGA 5DDMA 1UQVA 3KHGA 4BX9C 4QZGA 2PXIA 5K4LA 2W11A 5KTQA 5KG3A 1A76A 2PFNA 2KICA 5J0YA 4RQNA 3C28A 1SKSA 2AHOB 1ZQUA 4C4TA 5AI5A 2Y0SC 4YR2A 2H3FA 2XO7A 3C5FA 3GDXA 2KMDA 1X9MA 5L9XA 3A0BU 2MSNA 4RQ1A 2JV3A 1OW5A 1D9FA 2XC9A 2KG5A 1CUKA 2FMSA 1NK9A 5KFSA 2JH1A 5IIJA 3PO4A 1ZJNA 4GXIA 2FMQA 5A0LA 1TK5A 3UM9A 8ICTA 4P0PB 3TADC 2LI6A 5J0WA 9ICAA 4GFJA 3MBYA 2WAQF 4ECVA 2UVUA 3KHHA 5AK4A 3AN1A 2CXYA 3JPPA 3RAQA 9ICVA 4NM2A 4JK1A 4JV2A 4J9NA 2YY6A 3BJYA 2F77X 3IRUA 1X9SA 2W54A 3L3FX 4GXJA 4BXOB 1ZYQA 4O9MA 3MR6A 1BPXA 4C8LA 9ICXA 4UAZA 2BCQA 3KD3A 3RTVA 5L1KA 2KN7A 3SAHA 7ICTA 3AM9A 3WKAA 1IG6A 3MABA 8ICOA 4ED8A 2R8JA 2H3ZA 3DDHA 1IM4A 2BZFA 3QUQA 2E3TA 4DF8A 2EAPA 2BKEA 3WK5A 3MDCA 3SV4A 3UQ0A 5AM2A 5EE3A 3OPXA 1JIHA 4J9MA 3RH6A 1PK1A 4DL2A 2KZMA 2G5IB 3WKBA 4O3RA 4ED3A 2D8CA 3V6KA 5AI6A 2KHVA 1ZQRA 4O3MA 2VA3A 7ICEA 5KFLA 1SXDA 2GOLA 5ALMA 2AJQA 3EW9A 3QU2A 4J9PA 3QE9Y 2RP5A 4YR3A 5IINA 1L3SA 2R8IA 3KKAC 4DQQA 5KFMA 3BS5A 4I2FA 3ED5A 4A8EA 5CR0A 4NLNA 1RXVA 8ICAA 1ZQSA 5GTIU 5D4BA 2J6UA 5J2GA 1L5UA 4K4IA 3NVVA 2E8MA 3UXNA 4F8RA 2IOFA 5J2EA 1ZQHA 5ALVA 1ZQAA 3CW2C 3TQ1A 4KLIA 2G5HB 9ICRA 3AQEA 4C8MA 4CGZA 1SB3C 1LKYB 3H8WA 3JPNA 4OJ5A 1RXWA 4F3OA 2C28A 2F8KA 3TI0A 3HILA 3TAPA 4C4RA 5D49A 1QCKA 2E1FA 4O3PA 9ICJA 4DQSA 2M0NA 2GH1A 3EWAA 5KFXA 7ICIA 4MF8A 1ZETA 1EXNA 2JR5A 4DSKA 2KIWA 2K8CB 5CB1A 4FE3A 8ICVA 5DLFA 3V6HA 3LK9A 5J2BA 3ZDCA 5KG1A 3OHBA 2JZBB 4JMUA 3OJUA 3WK4A 3TFSA 4B9TA 2JMGA 2KJ9A 2XVTA 4C8NA 4Y2SA 1ZQPA 3IG8A 3B0XA 4UAYA 3PX4A 4FZLA 2EZYA 1YZ7A 3LWMA 3NTUA 3GQCA 4GXKA 3WU2U 3UMGA 1ZQNA 4QZDA 4DL6A 2FLNA 2V9WA 2N1RA 3KZXA 2BR0A 2EANA 3QU4A 4EZ9A 3AU2A 2FMPA 3M9NB 5AIBA 4QWAA 5J2AA 4RPXA 4ECYA 1PK3A 2G0AA 4DL3A 1N5WA 4ED2A 4PH5A 1ZQLA 1XU4A 4DOBA 4R65A 3ZDEA 4Q43A 3PX6A 4FFDA 4GC6A 2P66A 4C80A 1U4BA 1ZQFA 3F2CA 4OJOA 9ICSA 4RU9A 4TUQA 2W9CA 2VKQA 1NZBA 4RQ4A 4Y2QA 5KFTA 4NLZA 4BJQA 4RPYA 2BPCA 1S77D 2KVCA 1NNLA 4M6WA 4G3IA 1X6IA 1QQ7A 2KFZA 1TKDA 4CNQA 2F76X 5DG9A 3PMNA 4M9HA 5AK6A 4IRKA 4F4WA 3H0MB 1NKEA 9ICLA 4F91B 8ICXA 4M9NA 1RQLA 3PSIA 4J9KA 4Y2JA 4B9LA 3H8JA 3I1YA 3IHQB 3A0HU 1BPYA 8ICQA 4XA5A 8ICZA 2LPEA 5J2FA 1KN5A 3QU9A 1ZQWA 5AM5A 1K5OA 3D2SA 4RNMA 3EPGA 3ALRA 2K60A 1S0OA 4QZHA 4LJXA 2OEHA 1UT5A 1T3NA 2FLLA 3C1YA 2QKQA 4QW8A 4Q8FA 2RDIA 4IC9A 3SI8A 7ICLA 2EQYA 1Z3EB 3N7RC 3PR4A 3Q8SB 1JRPA 3FAHA 4QZIA 4RQ6A 2HBJA 4BDPA 4UB8U 4I29A 2HI0A 2DFLA 2W03A 2MAXA 4DL5A 2VIXA 3RH4A 2ZJAA 4BUGA 1S10A 2ZJ5A 1Z00A 4NL9A 5AI9A 5ALTA 1TAUA 4F4ZA 4YXJA 5CWRA 4QIWC 2BCRA 1JN3A 1SZHA 1JXEA 2LMRA 1F44A 3SD7A 4YP3A 4QW9A 3BS5B 2YMMA 4JUZA 4F93B 4WJ3B 3C2LA 5DGAA 3UQ2A 2KIVA 4RQ2A 5T14A 2WTFA 2MA1A 2ASLA 2RLTA 8ICCA 5CHGA 1HEKA 4M9GA 2Y9UA 4IQVA 5J2CA 4F5QA 3T5HA 3PSTA 1A77A 1CRXA 4AYBC 1UPHA 2G09A 4M9JA 2G07A 3IM1A 2I5HA 7ICSA 3SQIA 3AEVA 4P2HA 3GV7B 1HUOA 3QU7A 1T8EA 8ICUA 1CI4A 5DG8A 2PFQA 9ICQA 4KN4A 5G5GA 5KNIA 3DEEA 5J29A 4DL4A 2HHUA 2MUTA 4I28A 2EAMA 4DS4A 2IA6A 4QZ9A 5DQIA 4UB2A 3N28A 5AM0A 4RT3A 1Z1BA 4QIWF 1ZQZA 1OUQA 4KLMA 4NWIA 1RPLA 2DKZA 3B0YA 1DGJA 2HW3A 4QZBA 2DPJA 1WUDA 4MHVA 4M0AA 1IXRA 2NRVA 1ZQBA 1ZD4A 2RHFA 4DEZA 4QZAA 8ICBA 3OSNA 1SV0A 4TQRA 2RDJA 4UB3A 4F5RA 1S0VA 1X9XA 4X5VA 5AI8A 4AP9A 2HBMA 3GU3A 5AK5A 2W9BA 2VA8A 3H8SA 3WK9A 8ICEA 5KFWA 3FM9A 2NRTA 2LBOA 4CF4A 4NM1A 2HDOA 3OTQA 8ICKA 5J2DA 3H40A 3T5KA 2R8KA 5B5EU 4DSFA 2LYBA 3N7SC 3EUB2 4M9LA 4EELA 3GV5B 7ICRA 2FPKA 2NO4A 4DOAA 1UHUA 3M8SA 2OH2A 4KMOB 1NKCA 1ZQTA 1JMSA 5F9LA 5ALZA 2W9CB 3M9OB 1NOMA 2HHWA 4F2RA 1QSLA 4F4YA 9ICBA 2XI9A 1SXEA 4KLUA 4M6WB 5KFUA 4B6JA 2FJ6A 4R64A 5KFIA 3MDAA 1S9FA 3N4MB 3HWTA 1S0MA 5KT6A 5HMLA 3RJHA 4Y2UA 2JH7A 1SL2A 2NYVA 2ZIVB 4I2DA 5C0YA 4JB3A 2AU0A 1COKA 3UMCA 4O5CA 5IIOA 5J0OA 4DSJA 2PMZC 3WK6A 3V6JA 2KK0A 2YMPA 3RJGA 5DB6A 1KFDA 3HT3A 2BQRA 1FFUA 4YVZA 9ICHA 4EBEA 5ALUA 2AQ4A 4MEXA 5DBBA 4HAIA 1IIPA 2CN1A 1FFVA 5KT7A 4ECTA 1Q3UA 5AKGA 1UA0A 2A1JB 1P7DA 2XIDA 2DWQA 1SGGA 8ICJA 3BQ2A 1UA1A 4KLDA 3SV3A 2AXTU 1RM6C 2ZTCA 4RUAA 2HVHA 2BQ3A 7ICOA 2AGPA 1Z00B 4MFFA 3CP8A 4NLCA 3HKZC 1RYUA 4UASA 2ZIWB 2JRZA 3Q8RB 3T5LA 2Y1JA 3R9KA 4DFDA 5J0TA 1ZD5A 1S76D 2ZIUA 5JUMA 5AKIA 2I9GA 1CEZA 4FZMA 2AGQA 1RZTA 5HHHA 2BDPA 2MU2A 5KG4A 4ECQA 2F8LA 3RR8A 2Y0SF 1MN8A 5AI4A 4IR9A 3AL0B 2VJ4A 3NVWA 1TAMA 1FO4A 5AKLA 3M6KA 3HX0A 2YMQA 2R8HA 3G6XA 3BQ0A 1ZQIA 9ICTA 2WB1C 1WYGA 1U49A 4F2SA 1BNOA 1URJA 5KAIU 3QX7A 1TVAA 5EE9A 3TAQA 4RQ3A 1T94A 4UATA 4CF3A 3S6JA 2MUTB 1J97A 4ED0A 3TFRA 3KBBA 1L7MA 2E8NA 2F1IA 5L1MA 5KT3A 2BPGA 4ECZA 3E2EA 3U26A 9ICMA 1L8LA 5CEHA 1PVRA 4KLJA 2UVWA 1QTMA 5KFDA 4FS2A 2BCSA 1UT8A 5G5HA 4KN7A 3LVWA 5DB8A 1XSLA 4Y2XA 3V7LA 4F4XA 3AUOA 2KZ3A 5DB7A 3MFHA 4Y2RA 2C22A 3AMZA 4GLXA 5HR6A 2F44A 5JU5A 4UBCA 2LYHA 2HOFA 3F5EA 4QNLA 4KLOA 3QU5A 4ECSA 3TANA 2G08A 3ISDA 3D2NA 3NS1A 1ZQYA 3K1ZA 1XNSA 2AGOA 3NGDA 3B9JA 2K8BB 3TADA 5J8YC 3PR5B 4DL7A 4M04A 2W9BB 2D6FC 4C7YA 3TKAA 1HUZA 4LVSA 4R8UB 4RNNA 1MQ2A 3NUQA 3PW2A 2QARA 2OCEA 2ZUDA 2KEYA 3PW4A 2IMWP 4F50A 4RQ5A 1DGSA 1ZQCA 2HHTA 3M6ZA 3M9MB 2KOBA 3BQ1A 3BQ7A 4KLSA 3ZD8A 4XUSA 5HNKA 2W3SA 2OYYA 3SENA 2F3NA 1D8BA 3PMLA 4QZCA 4UBBA 1N61A 3PSFA 3RB4A 4I2JA 1B0XA 2BCUA 4RUCA 3BS7A 5KFRA 2J6TA 2B6GA 4Z6DA 4RQMA 3C29A 3FC4A 3PW0A 1Q3VA 2XY7A 5KG6A 2K4PA 3TACB 2PKEA 2DPIA 2E5SA 3UXPA 3BQTA 3N7PD 2ZJ8A 3Q8QB 5DBAA 8ICFA 5EE1A 3ZD9A 4RQ0A 2ZTEA 4O0IA 4KLTA 2K4EA 2OWOA 3PO5A 2LKYA 1RG6A 4RZRA 5ALJA 1MSWD 3OJSA 4EYIB 2KZZA 4USAA 2PI4A 1WWUA 5KFNA 2FI1A 1NJXA 3HJEA 3LWLA 1XO0A 1F0MA 2JGAA 3KKAA 1X9WA 7ICMA 2Y9TA 2LHTA 7ICFA 5J0QA 3KZIU 3RAXA 1NK4A 5JRTA 8ICHA 2PFOA 8ICWA 4UAVA 2V4QA 2CRXA 4KLQA 5AKXA 4YQWA 3LDAA 4RT2A 1ZQDA 4QWDA 4Q45A 8ICPA 3H4DA 1Z4OA 2HMXA 4FO6A 1PZNA 5ALHA 4TQSA 3QUCA 5KG0A 4C0ZA 2XGPA 4EEKA 1L3UA 5J0XA 5TISU 3C23A 2ZIUB 4UB1A 5HHIA 4YCXA 4PPXA 4PHAA 4B9SA 4ECUA 2ZIVA 1HIWA 4I2CA 3WKCA 4QZEA 4R63A 2LM1A 4FS1A 1J2MA 1ZRNA 3UXOA 3V7KA 9ICPA 2XY5A 3K75D 2KD1A 2JEGA 2IBKA 4Y2VA 3MGIA 1B4FA 5TZVA 4F5PA 1XS9D 3G6VA 4DLEA 3C21A 4TURA 2YQEA 1NK0A 3AQFA 1SWWA 4KX3A 4EZ6A 3QZ8A 4BGDA 4U6PA 2A1JA 4CE6A 4J03A 3MC1A 3ISBA 3WK8A 4F71A 4IL6U 4B9UA 5J2JA 2E1EA 4Q8EA 2B21A 2ZXIA 3QUTA 2PI5A 2NO5A 1V85A 5ALRA 4J9SA 1KSPA 2RQ5A 1TE2A 4QZFA 3PNCA 4BWJA 2ZIWA 1JROA 2WF9A 7ICJA 3L5KA 5IIKA 2P6RA 4Q44A 2H3IA 1V38A 1ZQOA 3EYZA 4Y2PA 1JALA 2AH5A 1U45A 2ZXHA 4M2YA 1BGXT 4OO1J 5DBCA 5KG2A 4OJ6A 3HP6A 9ICEA 5FP0A 3NASA 5AKYA 1MA7A 5KFOA 2BGWA 4LZGA 1RQNA 4IQWA 2QB0A 1PVPA 3C2KA 2QB1A 2DGZA 1DK2A 3SMVA 1TAQA 4PZOA 1S0NA 1ZQGA 1KKXA 5AM4A 5B66U 3C2MA 2QARB 1Z4NA 1Q8KA 4XRHA 4KTQA 4ELTA 3LVVA 1KQQA 4P4OA 4EYHB 5AKHA 2UVVA 3Q8PB 3PVXA 4YD1A 1COOA 2EZZA 4UW9A 5ALNA 3KFUF 5F9NA 4C8KA 1BPZA 2HBLA 1KW4A 1L7OA 3RJEA 4PHEA 3K1RB 1IV8A 4RNOA 4DOCA 3F2BA 1O03A 5AKJA 9ICFA 1T3QA 3RF9A 3N97B 4DCCA 1KFSA 2ZUCA 4EENA 5J0SA 2W43A 1FEZA 4R66A 5J0UA 3ZDDA 1ZXIA 2DKXA 2R8GA 1X40A 2EAOA 1B22A 4NV0A 1DXSA 2IOFK 1A6SA 2H5XA 4J9RA 2BCVA 4CDGA 4AYBF 4UAWA 4I2AA 4K4HA 3WKEA 2FE9A 1TK8A 2A1AA 2W8LA 4UARA 1U9LA 5KFFA 2YB4A 5L1IA 2K89A 3T79A 1QQ6A 5ALYA 1SL0A 1QQ5A 9ICGA 1KDHA 4UAUA 1NJYA 3E58A 2BQUA 1L8OA 3GZFA 3J81j 4DQPA 1SV4A 2GO7A 2V4RA 3RJFA 4R8UA 5KFYA 2W04A 5ALOA 3BZKA 5KT5A 5KG7A 4Y2YA 4OD0A 4CRXA 1ZQJA 2L5YA 2BDUA 1N56A 1L7PA 2EDUA 2WF6A 2VJ5A 3RBDA 2ZG6A 2KKVA 2G06A 1ZQEA 4ELUA 4MF2A 3F5AA 4RPZA 3H0RB 5CA7A 2J6SA 1H38A 4DO9A 1XWLA 3ISCA 3M8RA 5J0RA 5IIMA 2F1HA 3RJIA 1FIQA 1VJ5A 2JEJA 2LM4A 4ELVA 2HHSA 1TFRA 1PUZA 2WAQC 2BPFA 3ORYA 3IN5A 5H2FU 2K4HA 5KFBA 5L1JA 1NJZA 4TUPA 4O3QA 1ED1A 1L3TA 2K8AA 3SYZA 4RQ7A 4ZOHC 2KP7A 3IG5A 3QUBA 4J9OA 5EWGA 5KFJA 2Y1IA 3MR2A 3NVZA 2RRDA 3DV9A 1ZQKA 2M9NA 2YB1A 3FDSA 4MEYA 3GFKB 2JHDA 4DSLA 9ICWA 2ODGA 2CPRA 4HYKA 1ZQXA 1JXLA 4GC7A 2KSOA 4JWMA 2PFPA 2HCFA 1Q46A 3F53A 5ALXA 4EBDA 1T4GA 2KV2A 4KLLA 3QEBZ 8ICRA 3TARA 5ALIA 1S97A 2ES6A 5D46A 4TUSA 3PV8A 3C1ZA 5EWFA 4LZDA 4QZ8A 4KLFA 7ICHA 5J2IA 4PGXA 2MRLA 2HSZA 4OCZA 1HJPA 5KT4A 1YZ6A 2PMZF 3ONNA 1BPBA 3ETLA 5L1LA 5ALEA 2HOQA 2W9AA 2I6XA 5KFCA 3QNMA 2QB0B 4UB5A 5KFGA 1JX4A 2XICA 1X2IA 4NXZA 1N2XA 1ZQQA 5CP2A 2AQ0A 3CYMA 4C7ZA 2HOIA 1ZQVA 4YMNA 3SAGA 5C5JA 8ICGA 1N62A 4P4PA 1JI7A 1SIJA 1XSPA 3WK7A 1Z19A 4O5KA 3JPSA 4NLGA 3M1YA 1XO1A 5AI0A 1WCLA 2W8KA 2C2EA 5KAFU 4PHPA 8ICMA 1NK7A 5AKKA 3HKZF 1B43A 3MGVA 1L7NA 1VLBA 2F1JA 5DDYA 4BWMA 2KNJA 2FPLA 3LYSA 3M7DA 5AICA 2YTUA 1Z1VA 4JV1A 5IIIA 2EZXA 2W7PA 2FPMA 4P4MA 2D3DA 3BZCA 4YMOA 5EWEA 3OHAA 3CNHA 2KVSA 3OGUA 4EBCA 2ASJA 4FBTA 3AU6A 4UB6U 4KITB 1KTQA 1SWVA 1OXJA 1ZD3A 4DF4A 4ACOA 4JV0A 5AM1A 4F72A 2WB1F 4FZNA 4CCHA 7ICUA 2ZIXB 1DK3A 5DLGA 4J9LA 4O5EA 1M6YA 2WF8A 4O3SA 7ICQA 2HHQA 2XGQA 5J2KA 4IQTA 3I76A 8ICLA 3OSPA 4K4GA 5DQHA 4KMUA 2F2AB 2JXJA 5E79U 4PGYA 3EPIA 8ICNA 2LYAA 1KBUA 5KFVA 2KKPA 3RB6A 5ALPA 3V72A 5KFHA 4NLBA 4MFCA 4UQGA 3GIIA 1BVSA 5AIAA 2DL0A 3ZDBA 5HR7A 4ED6A 1LB2B 5KFZA 4Z6EA 4DS5A 1X6JA 1D9DA 4O3NA 1VDVA 3F2DA 2ISPA 2OHFA 1V9PA 1S5LU 1S8OA 4UB4A 2IOHA 4QWBA 4C4SA 5KL1B 3RB3A 4DFJA 3PY8A 1V97A 4KLGA 4I2HA 4ECXA 2VA2A 1N63A 1RDFA 1K1QA 1XC9A 3KTQA 2P6UA 2HVIA 3GIKA 5BOMA 4YG2A 1NKBA 1K1SA 3O0FA 1WWVA 3HRDD 1U47A 1D8YA 3T5JA 4ZH4A 4P0QA 2XCAA 4QWCA 2OM6A 4PJ0U 4I2IA 3JPRA 1WCNA 5KFQA 4KX5A 5ALQA 9ICIA 4B9NA 3IV6A 4YFKA 4J9QA 3THVA 1ECWA 1N60A 2JEIA 2I1QA 1N5XA 2KFNA 3QEAZ 1X66A 2W3RA 4NL9C 1L3VA 2A3VA 8ICYA 5JTIA 3GIMA 2HHVA 2KSOB 4DSIA 3GV8B 5J8YA 1MC8A 2XCPA 4Y2TA 4IS7A 5ALWA 3D6JA 5GTHU 2ATLA 4I2GA 4DLGA 2BHNA 2GWSA 3G6YA 2FLPA 3JPTA 2K4IA 5F3XB 2R18A 4JWNA 1GO3F 1QH9A 1XSNA 2DUYA 2UVRA 9ICNA 3ICXA 3BDPA 3HW8A 1DOQA 4PGQA 2ZTDA 5KL8B 5ALFA 2YMLA 3RFAA 5KFEA 4ED7A 3PW7A 3RJKA 2IHMA 5EE0A 1NK8A 2IHNA 2NRXA 2C2DA 4QWEA 3RB0A 5BOLA 4CF5A 1D8LA 2NRWA 4ECWA 8ICSA 4YXMA 5AK3A 1QLNA 4XQ8A 3VC8A 1NZPA 3IP4B 4F5NA 2Q4TA 1PVQA 2O6KA 3PX0A 5AKEA 4YD2A 3PSPA 4IR1A 2HHXA 3RRGA 2DQNB 2OXOA 1BPDA 1LVHA 3SEIA 1SKRA 3PZPA 1WG8A 3K4GA 5KT2A 1ZQMA 2Z7JA 4ICAA 4I2BA 2KTQA 1X42A 4B9MA 1SV0C 5BPCA 3V7JA 4MFAA 1PK1B 4US8A 3E0FA 4OJLA 2WHEA 4Z6CA 1AQ6A 4P0PA 2H3VA 2W55A 5ALGA 3SAFA 4YN4A 5ALDA 1A0PA 1NI3A 2ALZA 4KLHA 4F5OA 3C5GA
chains in the Genus database with same CATH topology
2QKQA 4MHVA 2E8NA 5L1MA 3KKAC 2K4PA 3TACB 2QB0B 2EANA 3BS5A 3TADC 1B4FA 1LKYA 5F3XB 1SV0A 1KW4A 2DL0A 1PK3A 1X9XA 3K1RB 4NL9A 1JI7A 2E8MA 1RG6A 2F44A 2E8OA 5JU5A 1SGGA 2LMRA 1WWUA 2DKXA 3BS5B 1LKYB 1X40A 2EAOA 1DXSA 2KE7A 2KIVA 2F8KA 1F0MA 1V85A 3KKAA 3HILA 2FE9A 2Y9UA 2Y9TA 3TADA 2YTUA 1Z1VA 2ESEA 5J8YC 3H8MA 1UCVA 1WWVA 5JRTA 2D3DA 1V38A 2GLEA 4PZNA 2KSOA 3SEIA 2EAPA 1SV4A 2QARA 1OXJA 1UQVA 5KNIA 2E8PA 1SV0C 2ES6A 1SXEA 1PK1B 2EAMA 1PK1A 4RQNA 2LPEA 3BQ7A 1X66A 2L5YA 3SENA 2QB0A 4NL9C 2D8CA 5JTIA 2QB1A 2F3NA 2KSOB 4PZOA 2K60A 5J8YA 4NJ8A 1SXDA 2KMDA 4IS7A 2QARB 2JV3A 1OW5A 2DKZA 1B0XA 2KG5A 3BS7A 3IDWA 2B6GA 1COKA 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKQ A;  4MHV A;  2E8N A;  5L1M A;  3KKA C;  2K4P A;  3TAC B;  2QB0 B;  2EAN A;  3BS5 A;  3TAD C;  1B4F A;  1LKY A;  5F3X B;  1SV0 A;  1KW4 A;  2DL0 A;  1PK3 A;  1X9X A;  3K1R B;  4NL9 A;  1JI7 A;  2E8M A;  1RG6 A;  2F44 A;  2E8O A;  5JU5 A;  1SGG A;  2LMR A;  1WWU A;  2DKX A;  3BS5 B;  1LKY B;  1X40 A;  2EAO A;  1DXS A;  2KE7 A;  2KIV A;  2F8K A;  1F0M A;  1V85 A;  3KKA A;  3HIL A;  2FE9 A;  2Y9U A;  2Y9T A;  3TAD A;  2YTU A;  1Z1V A;  2ESE A;  5J8Y C;  3H8M A;  1UCV A;  1WWV A;  5JRT A;  2D3D A;  1V38 A;  2GLE A;  4PZN A;  2KSO A;  3SEI A;  2EAP A;  1SV4 A;  2QAR A;  1OXJ A;  1UQV A;  5KNI A;  2E8P A;  1SV0 C;  2ES6 A;  1SXE A;  1PK1 B;  2EAM A;  1PK1 A;  4RQN A;  2LPE A;  3BQ7 A;  1X66 A;  2L5Y A;  3SEN A;  2QB0 A;  4NL9 C;  2D8C A;  5JTI A;  2QB1 A;  2F3N A;  2KSO B;  4PZO A;  2K60 A;  5J8Y A;  4NJ8 A;  1SXD A;  2KMD A;  4IS7 A;  2QAR B;  2JV3 A;  1OW5 A;  2DKZ A;  1B0X A;  2KG5 A;  3BS7 A;  3IDW A;  2B6G A;  1COK A;  4RQM A; 
#chains in the Genus database with same CATH topology
 2NV3 A;  2EH9 A;  3EZ5 A;  5AM3 A;  4BXO A;  4IRD A;  1QSS A;  3MR3 A;  4DQI A;  3D2Q A;  1ZQ1 C;  1U48 A;  3I28 A;  3QYP A;  4F4K A;  7ICV A;  3H7I A;  3ZI4 A;  5KG5 A;  1KRP A;  2ZUB A;  3VCB A;  3JPQ A;  1SZP A;  4E0D A;  2DBY A;  1RYS A;  4OJP A;  3NVY A;  3HPO A;  1J2N A;  2ISO A;  3KOO A;  1KLN A;  3CRX A;  4QJF B;  2A19 A;  4ECR A;  1TV9 A;  2XY6 A;  3QXG A;  1Y88 A;  4YMM A;  2B0C A;  5DB9 A;  2KE7 A;  1SL1 A;  5CRX A;  1QSY A;  4G9B A;  4DFP A;  1SKW A;  2ASD A;  4DWI A;  1ZOL A;  5ALK A;  7ICP A;  3PW5 A;  2KJ5 A;  1BPE A;  3UMB A;  5ALL A;  2ESE A;  1TK0 A;  5HP4 A;  3MR5 A;  2JEF A;  4RQ8 A;  4DFM A;  1C20 A;  3H8M A;  1UCV A;  5J0P A;  1ARO P;  2WFA A;  4I2E A;  4PL2 A;  2GLE A;  7ICG A;  3RRH A;  1NK6 A;  1BNP A;  5KFA A;  3NRZ A;  3RJJ A;  5DQG A;  1KL9 A;  3SR6 A;  1L6N A;  5AHX A;  1F5S A;  4EEY A;  3KHR A;  2E8P A;  1NK5 A;  3ETR A;  2WF7 A;  4IQU A;  2W7O A;  3JPO A;  4EX7 A;  4FBU A;  2ZIX A;  3Q8L A;  5EOZ A;  7ICN A;  3Q8M A;  4US9 A;  1N48 A;  4P0Q B;  3WKD A;  1KEJ A;  4U7C A;  4DQR A;  5DG7 A;  4NJ8 A;  2KJ8 A;  1T7P A;  4NLK A;  2YN4 A;  3QZ7 A;  5CJ7 A;  3RH5 A;  1ZD2 P;  1ZJM A;  3KHL A;  4DSE A;  1JUD A;  3RR7 A;  9ICU A;  5KFK A;  4EX6 A;  8ICI A;  3IDW A;  2QLT A;  4PHD A;  9ICO A;  2WF5 A;  5HMM A;  3Q8K A;  4NY8 A;  7ICK A;  4I27 A;  3L4P A;  1LKY A;  4M47 A;  5ALS A;  2Q0Z X;  4B9V A;  2VAN A;  3NRW A;  1KFT A;  4PL1 A;  3MGH A;  5IIL A;  5DGB A;  2YX8 A;  3RBE A;  3H4B A;  3H0L B;  1RYR A;  1MQ3 A;  2KHQ A;  1LV5 A;  2E8O A;  3T3F A;  4C8O A;  1C7Y A;  2FDR A;  5J2H A;  4F92 B;  3GIJ A;  3UPQ A;  2C2R A;  2HBK A;  2NRZ A;  4KLE A;  2JZB A;  4GIB A;  3SZ2 A;  9ICC A;  4ED1 A;  4IRC A;  1ZRM A;  3FYH A;  9ICK A;  4YR0 A;  4DFK A;  3MFI A;  5AKZ A;  1YT3 A;  2P35 A;  2W9M A;  4PZN A;  1NJW A;  2H3Q A;  3GIL A;  5DKW A;  5KFP A;  4Z6F A;  3ZDA A;  1O08 A;  2DF4 B;  4O3O A;  1DRG A;  5DDM A;  1UQV A;  3KHG A;  4BX9 C;  4QZG A;  2PXI A;  5K4L A;  2W11 A;  5KTQ A;  5KG3 A;  1A76 A;  2PFN A;  2KIC A;  5J0Y A;  4RQN A;  3C28 A;  1SKS A;  2AHO B;  1ZQU A;  4C4T A;  5AI5 A;  2Y0S C;  4YR2 A;  2H3F A;  2XO7 A;  3C5F A;  3GDX A;  2KMD A;  1X9M A;  5L9X A;  3A0B U;  2MSN A;  4RQ1 A;  2JV3 A;  1OW5 A;  1D9F A;  2XC9 A;  2KG5 A;  1CUK A;  2FMS A;  1NK9 A;  5KFS A;  2JH1 A;  5IIJ A;  3PO4 A;  1ZJN A;  4GXI A;  2FMQ A;  5A0L A;  1TK5 A;  3UM9 A;  8ICT A;  4P0P B;  3TAD C;  2LI6 A;  5J0W A;  9ICA A;  4GFJ A;  3MBY A;  2WAQ F;  4ECV A;  2UVU A;  3KHH A;  5AK4 A;  3AN1 A;  2CXY A;  3JPP A;  3RAQ A;  9ICV A;  4NM2 A;  4JK1 A;  4JV2 A;  4J9N A;  2YY6 A;  3BJY A;  2F77 X;  3IRU A;  1X9S A;  2W54 A;  3L3F X;  4GXJ A;  4BXO B;  1ZYQ A;  4O9M A;  3MR6 A;  1BPX A;  4C8L A;  9ICX A;  4UAZ A;  2BCQ A;  3KD3 A;  3RTV A;  5L1K A;  2KN7 A;  3SAH A;  7ICT A;  3AM9 A;  3WKA A;  1IG6 A;  3MAB A;  8ICO A;  4ED8 A;  2R8J A;  2H3Z A;  3DDH A;  1IM4 A;  2BZF A;  3QUQ A;  2E3T A;  4DF8 A;  2EAP A;  2BKE A;  3WK5 A;  3MDC A;  3SV4 A;  3UQ0 A;  5AM2 A;  5EE3 A;  3OPX A;  1JIH A;  4J9M A;  3RH6 A;  1PK1 A;  4DL2 A;  2KZM A;  2G5I B;  3WKB A;  4O3R A;  4ED3 A;  2D8C A;  3V6K A;  5AI6 A;  2KHV A;  1ZQR A;  4O3M A;  2VA3 A;  7ICE A;  5KFL A;  1SXD A;  2GOL A;  5ALM A;  2AJQ A;  3EW9 A;  3QU2 A;  4J9P A;  3QE9 Y;  2RP5 A;  4YR3 A;  5IIN A;  1L3S A;  2R8I A;  3KKA C;  4DQQ A;  5KFM A;  3BS5 A;  4I2F A;  3ED5 A;  4A8E A;  5CR0 A;  4NLN A;  1RXV A;  8ICA A;  1ZQS A;  5GTI U;  5D4B A;  2J6U A;  5J2G A;  1L5U A;  4K4I A;  3NVV A;  2E8M A;  3UXN A;  4F8R A;  2IOF A;  5J2E A;  1ZQH A;  5ALV A;  1ZQA A;  3CW2 C;  3TQ1 A;  4KLI A;  2G5H B;  9ICR A;  3AQE A;  4C8M A;  4CGZ A;  1SB3 C;  1LKY B;  3H8W A;  3JPN A;  4OJ5 A;  1RXW A;  4F3O A;  2C28 A;  2F8K A;  3TI0 A;  3HIL A;  3TAP A;  4C4R A;  5D49 A;  1QCK A;  2E1F A;  4O3P A;  9ICJ A;  4DQS A;  2M0N A;  2GH1 A;  3EWA A;  5KFX A;  7ICI A;  4MF8 A;  1ZET A;  1EXN A;  2JR5 A;  4DSK A;  2KIW A;  2K8C B;  5CB1 A;  4FE3 A;  8ICV A;  5DLF A;  3V6H A;  3LK9 A;  5J2B A;  3ZDC A;  5KG1 A;  3OHB A;  2JZB B;  4JMU A;  3OJU A;  3WK4 A;  3TFS A;  4B9T A;  2JMG A;  2KJ9 A;  2XVT A;  4C8N A;  4Y2S A;  1ZQP A;  3IG8 A;  3B0X A;  4UAY A;  3PX4 A;  4FZL A;  2EZY A;  1YZ7 A;  3LWM A;  3NTU A;  3GQC A;  4GXK A;  3WU2 U;  3UMG A;  1ZQN A;  4QZD A;  4DL6 A;  2FLN A;  2V9W A;  2N1R A;  3KZX A;  2BR0 A;  2EAN A;  3QU4 A;  4EZ9 A;  3AU2 A;  2FMP A;  3M9N B;  5AIB A;  4QWA A;  5J2A A;  4RPX A;  4ECY A;  1PK3 A;  2G0A A;  4DL3 A;  1N5W A;  4ED2 A;  4PH5 A;  1ZQL A;  1XU4 A;  4DOB A;  4R65 A;  3ZDE A;  4Q43 A;  3PX6 A;  4FFD A;  4GC6 A;  2P66 A;  4C80 A;  1U4B A;  1ZQF A;  3F2C A;  4OJO A;  9ICS A;  4RU9 A;  4TUQ A;  2W9C A;  2VKQ A;  1NZB A;  4RQ4 A;  4Y2Q A;  5KFT A;  4NLZ A;  4BJQ A;  4RPY A;  2BPC A;  1S77 D;  2KVC A;  1NNL A;  4M6W A;  4G3I A;  1X6I A;  1QQ7 A;  2KFZ A;  1TKD A;  4CNQ A;  2F76 X;  5DG9 A;  3PMN A;  4M9H A;  5AK6 A;  4IRK A;  4F4W A;  3H0M B;  1NKE A;  9ICL A;  4F91 B;  8ICX A;  4M9N A;  1RQL A;  3PSI A;  4J9K A;  4Y2J A;  4B9L A;  3H8J A;  3I1Y A;  3IHQ B;  3A0H U;  1BPY A;  8ICQ A;  4XA5 A;  8ICZ A;  2LPE A;  5J2F A;  1KN5 A;  3QU9 A;  1ZQW A;  5AM5 A;  1K5O A;  3D2S A;  4RNM A;  3EPG A;  3ALR A;  2K60 A;  1S0O A;  4QZH A;  4LJX A;  2OEH A;  1UT5 A;  1T3N A;  2FLL A;  3C1Y A;  2QKQ A;  4QW8 A;  4Q8F A;  2RDI A;  4IC9 A;  3SI8 A;  7ICL A;  2EQY A;  1Z3E B;  3N7R C;  3PR4 A;  3Q8S B;  1JRP A;  3FAH A;  4QZI A;  4RQ6 A;  2HBJ A;  4BDP A;  4UB8 U;  4I29 A;  2HI0 A;  2DFL A;  2W03 A;  2MAX A;  4DL5 A;  2VIX A;  3RH4 A;  2ZJA A;  4BUG A;  1S10 A;  2ZJ5 A;  1Z00 A;  4NL9 A;  5AI9 A;  5ALT A;  1TAU A;  4F4Z A;  4YXJ A;  5CWR A;  4QIW C;  2BCR A;  1JN3 A;  1SZH A;  1JXE A;  2LMR A;  1F44 A;  3SD7 A;  4YP3 A;  4QW9 A;  3BS5 B;  2YMM A;  4JUZ A;  4F93 B;  4WJ3 B;  3C2L A;  5DGA A;  3UQ2 A;  2KIV A;  4RQ2 A;  5T14 A;  2WTF A;  2MA1 A;  2ASL A;  2RLT A;  8ICC A;  5CHG A;  1HEK A;  4M9G A;  2Y9U A;  4IQV A;  5J2C A;  4F5Q A;  3T5H A;  3PST A;  1A77 A;  1CRX A;  4AYB C;  1UPH A;  2G09 A;  4M9J A;  2G07 A;  3IM1 A;  2I5H A;  7ICS A;  3SQI A;  3AEV A;  4P2H A;  3GV7 B;  1HUO A;  3QU7 A;  1T8E A;  8ICU A;  1CI4 A;  5DG8 A;  2PFQ A;  9ICQ A;  4KN4 A;  5G5G A;  5KNI A;  3DEE A;  5J29 A;  4DL4 A;  2HHU A;  2MUT A;  4I28 A;  2EAM A;  4DS4 A;  2IA6 A;  4QZ9 A;  5DQI A;  4UB2 A;  3N28 A;  5AM0 A;  4RT3 A;  1Z1B A;  4QIW F;  1ZQZ A;  1OUQ A;  4KLM A;  4NWI A;  1RPL A;  2DKZ A;  3B0Y A;  1DGJ A;  2HW3 A;  4QZB A;  2DPJ A;  1WUD A;  4MHV A;  4M0A A;  1IXR A;  2NRV A;  1ZQB A;  1ZD4 A;  2RHF A;  4DEZ A;  4QZA A;  8ICB A;  3OSN A;  1SV0 A;  4TQR A;  2RDJ A;  4UB3 A;  4F5R A;  1S0V A;  1X9X A;  4X5V A;  5AI8 A;  4AP9 A;  2HBM A;  3GU3 A;  5AK5 A;  2W9B A;  2VA8 A;  3H8S A;  3WK9 A;  8ICE A;  5KFW A;  3FM9 A;  2NRT A;  2LBO A;  4CF4 A;  4NM1 A;  2HDO A;  3OTQ A;  8ICK A;  5J2D A;  3H40 A;  3T5K A;  2R8K A;  5B5E U;  4DSF A;  2LYB A;  3N7S C;  3EUB 2;  4M9L A;  4EEL A;  3GV5 B;  7ICR A;  2FPK A;  2NO4 A;  4DOA A;  1UHU A;  3M8S A;  2OH2 A;  4KMO B;  1NKC A;  1ZQT A;  1JMS A;  5F9L A;  5ALZ A;  2W9C B;  3M9O B;  1NOM A;  2HHW A;  4F2R A;  1QSL A;  4F4Y A;  9ICB A;  2XI9 A;  1SXE A;  4KLU A;  4M6W B;  5KFU A;  4B6J A;  2FJ6 A;  4R64 A;  5KFI A;  3MDA A;  1S9F A;  3N4M B;  3HWT A;  1S0M A;  5KT6 A;  5HML A;  3RJH A;  4Y2U A;  2JH7 A;  1SL2 A;  2NYV A;  2ZIV B;  4I2D A;  5C0Y A;  4JB3 A;  2AU0 A;  1COK A;  3UMC A;  4O5C A;  5IIO A;  5J0O A;  4DSJ A;  2PMZ C;  3WK6 A;  3V6J A;  2KK0 A;  2YMP A;  3RJG A;  5DB6 A;  1KFD A;  3HT3 A;  2BQR A;  1FFU A;  4YVZ A;  9ICH A;  4EBE A;  5ALU A;  2AQ4 A;  4MEX A;  5DBB A;  4HAI A;  1IIP A;  2CN1 A;  1FFV A;  5KT7 A;  4ECT A;  1Q3U A;  5AKG A;  1UA0 A;  2A1J B;  1P7D A;  2XID A;  2DWQ A;  1SGG A;  8ICJ A;  3BQ2 A;  1UA1 A;  4KLD A;  3SV3 A;  2AXT U;  1RM6 C;  2ZTC A;  4RUA A;  2HVH A;  2BQ3 A;  7ICO A;  2AGP A;  1Z00 B;  4MFF A;  3CP8 A;  4NLC A;  3HKZ C;  1RYU A;  4UAS A;  2ZIW B;  2JRZ A;  3Q8R B;  3T5L A;  2Y1J A;  3R9K A;  4DFD A;  5J0T A;  1ZD5 A;  1S76 D;  2ZIU A;  5JUM A;  5AKI A;  2I9G A;  1CEZ A;  4FZM A;  2AGQ A;  1RZT A;  5HHH A;  2BDP A;  2MU2 A;  5KG4 A;  4ECQ A;  2F8L A;  3RR8 A;  2Y0S F;  1MN8 A;  5AI4 A;  4IR9 A;  3AL0 B;  2VJ4 A;  3NVW A;  1TAM A;  1FO4 A;  5AKL A;  3M6K A;  3HX0 A;  2YMQ A;  2R8H A;  3G6X A;  3BQ0 A;  1ZQI A;  9ICT A;  2WB1 C;  1WYG A;  1U49 A;  4F2S A;  1BNO A;  1URJ A;  5KAI U;  3QX7 A;  1TVA A;  5EE9 A;  3TAQ A;  4RQ3 A;  1T94 A;  4UAT A;  4CF3 A;  3S6J A;  2MUT B;  1J97 A;  4ED0 A;  3TFR A;  3KBB A;  1L7M A;  2E8N A;  2F1I A;  5L1M A;  5KT3 A;  2BPG A;  4ECZ A;  3E2E A;  3U26 A;  9ICM A;  1L8L A;  5CEH A;  1PVR A;  4KLJ A;  2UVW A;  1QTM A;  5KFD A;  4FS2 A;  2BCS A;  1UT8 A;  5G5H A;  4KN7 A;  3LVW A;  5DB8 A;  1XSL A;  4Y2X A;  3V7L A;  4F4X A;  3AUO A;  2KZ3 A;  5DB7 A;  3MFH A;  4Y2R A;  2C22 A;  3AMZ A;  4GLX A;  5HR6 A;  2F44 A;  5JU5 A;  4UBC A;  2LYH A;  2HOF A;  3F5E A;  4QNL A;  4KLO A;  3QU5 A;  4ECS A;  3TAN A;  2G08 A;  3ISD A;  3D2N A;  3NS1 A;  1ZQY A;  3K1Z A;  1XNS A;  2AGO A;  3NGD A;  3B9J A;  2K8B B;  3TAD A;  5J8Y C;  3PR5 B;  4DL7 A;  4M04 A;  2W9B B;  2D6F C;  4C7Y A;  3TKA A;  1HUZ A;  4LVS A;  4R8U B;  4RNN A;  1MQ2 A;  3NUQ A;  3PW2 A;  2QAR A;  2OCE A;  2ZUD A;  2KEY A;  3PW4 A;  2IMW P;  4F50 A;  4RQ5 A;  1DGS A;  1ZQC A;  2HHT A;  3M6Z A;  3M9M B;  2KOB A;  3BQ1 A;  3BQ7 A;  4KLS A;  3ZD8 A;  4XUS A;  5HNK A;  2W3S A;  2OYY A;  3SEN A;  2F3N A;  1D8B A;  3PML A;  4QZC A;  4UBB A;  1N61 A;  3PSF A;  3RB4 A;  4I2J A;  1B0X A;  2BCU A;  4RUC A;  3BS7 A;  5KFR A;  2J6T A;  2B6G A;  4Z6D A;  4RQM A;  3C29 A;  3FC4 A;  3PW0 A;  1Q3V A;  2XY7 A;  5KG6 A;  2K4P A;  3TAC B;  2PKE A;  2DPI A;  2E5S A;  3UXP A;  3BQT A;  3N7P D;  2ZJ8 A;  3Q8Q B;  5DBA A;  8ICF A;  5EE1 A;  3ZD9 A;  4RQ0 A;  2ZTE A;  4O0I A;  4KLT A;  2K4E A;  2OWO A;  3PO5 A;  2LKY A;  1RG6 A;  4RZR A;  5ALJ A;  1MSW D;  3OJS A;  4EYI B;  2KZZ A;  4USA A;  2PI4 A;  1WWU A;  5KFN A;  2FI1 A;  1NJX A;  3HJE A;  3LWL A;  1XO0 A;  1F0M A;  2JGA A;  3KKA A;  1X9W A;  7ICM A;  2Y9T A;  2LHT A;  7ICF A;  5J0Q A;  3KZI U;  3RAX A;  1NK4 A;  5JRT A;  8ICH A;  2PFO A;  8ICW A;  4UAV A;  2V4Q A;  2CRX A;  4KLQ A;  5AKX A;  4YQW A;  3LDA A;  4RT2 A;  1ZQD A;  4QWD A;  4Q45 A;  8ICP A;  3H4D A;  1Z4O A;  2HMX A;  4FO6 A;  1PZN A;  5ALH A;  4TQS A;  3QUC A;  5KG0 A;  4C0Z A;  2XGP A;  4EEK A;  1L3U A;  5J0X A;  5TIS U;  3C23 A;  2ZIU B;  4UB1 A;  5HHI A;  4YCX A;  4PPX A;  4PHA A;  4B9S A;  4ECU A;  2ZIV A;  1HIW A;  4I2C A;  3WKC A;  4QZE A;  4R63 A;  2LM1 A;  4FS1 A;  1J2M A;  1ZRN A;  3UXO A;  3V7K A;  9ICP A;  2XY5 A;  3K75 D;  2KD1 A;  2JEG A;  2IBK A;  4Y2V A;  3MGI A;  1B4F A;  5TZV A;  4F5P A;  1XS9 D;  3G6V A;  4DLE A;  3C21 A;  4TUR A;  2YQE A;  1NK0 A;  3AQF A;  1SWW A;  4KX3 A;  4EZ6 A;  3QZ8 A;  4BGD A;  4U6P A;  2A1J A;  4CE6 A;  4J03 A;  3MC1 A;  3ISB A;  3WK8 A;  4F71 A;  4IL6 U;  4B9U A;  5J2J A;  2E1E A;  4Q8E A;  2B21 A;  2ZXI A;  3QUT A;  2PI5 A;  2NO5 A;  1V85 A;  5ALR A;  4J9S A;  1KSP A;  2RQ5 A;  1TE2 A;  4QZF A;  3PNC A;  4BWJ A;  2ZIW A;  1JRO A;  2WF9 A;  7ICJ A;  3L5K A;  5IIK A;  2P6R A;  4Q44 A;  2H3I A;  1V38 A;  1ZQO A;  3EYZ A;  4Y2P A;  1JAL A;  2AH5 A;  1U45 A;  2ZXH A;  4M2Y A;  1BGX T;  4OO1 J;  5DBC A;  5KG2 A;  4OJ6 A;  3HP6 A;  9ICE A;  5FP0 A;  3NAS A;  5AKY A;  1MA7 A;  5KFO A;  2BGW A;  4LZG A;  1RQN A;  4IQW A;  2QB0 A;  1PVP A;  3C2K A;  2QB1 A;  2DGZ A;  1DK2 A;  3SMV A;  1TAQ A;  4PZO A;  1S0N A;  1ZQG A;  1KKX A;  5AM4 A;  5B66 U;  3C2M A;  2QAR B;  1Z4N A;  1Q8K A;  4XRH A;  4KTQ A;  4ELT A;  3LVV A;  1KQQ A;  4P4O A;  4EYH B;  5AKH A;  2UVV A;  3Q8P B;  3PVX A;  4YD1 A;  1COO A;  2EZZ A;  4UW9 A;  5ALN A;  3KFU F;  5F9N A;  4C8K A;  1BPZ A;  2HBL A;  1KW4 A;  1L7O A;  3RJE A;  4PHE A;  3K1R B;  1IV8 A;  4RNO A;  4DOC A;  3F2B A;  1O03 A;  5AKJ A;  9ICF A;  1T3Q A;  3RF9 A;  3N97 B;  4DCC A;  1KFS A;  2ZUC A;  4EEN A;  5J0S A;  2W43 A;  1FEZ A;  4R66 A;  5J0U A;  3ZDD A;  1ZXI A;  2DKX A;  2R8G A;  1X40 A;  2EAO A;  1B22 A;  4NV0 A;  1DXS A;  2IOF K;  1A6S A;  2H5X A;  4J9R A;  2BCV A;  4CDG A;  4AYB F;  4UAW A;  4I2A A;  4K4H A;  3WKE A;  2FE9 A;  1TK8 A;  2A1A A;  2W8L A;  4UAR A;  1U9L A;  5KFF A;  2YB4 A;  5L1I A;  2K89 A;  3T79 A;  1QQ6 A;  5ALY A;  1SL0 A;  1QQ5 A;  9ICG A;  1KDH A;  4UAU A;  1NJY A;  3E58 A;  2BQU A;  1L8O A;  3GZF A;  3J81 j;  4DQP A;  1SV4 A;  2GO7 A;  2V4R A;  3RJF A;  4R8U A;  5KFY A;  2W04 A;  5ALO A;  3BZK A;  5KT5 A;  5KG7 A;  4Y2Y A;  4OD0 A;  4CRX A;  1ZQJ A;  2L5Y A;  2BDU A;  1N56 A;  1L7P A;  2EDU A;  2WF6 A;  2VJ5 A;  3RBD A;  2ZG6 A;  2KKV A;  2G06 A;  1ZQE A;  4ELU A;  4MF2 A;  3F5A A;  4RPZ A;  3H0R B;  5CA7 A;  2J6S A;  1H38 A;  4DO9 A;  1XWL A;  3ISC A;  3M8R A;  5J0R A;  5IIM A;  2F1H A;  3RJI A;  1FIQ A;  1VJ5 A;  2JEJ A;  2LM4 A;  4ELV A;  2HHS A;  1TFR A;  1PUZ A;  2WAQ C;  2BPF A;  3ORY A;  3IN5 A;  5H2F U;  2K4H A;  5KFB A;  5L1J A;  1NJZ A;  4TUP A;  4O3Q A;  1ED1 A;  1L3T A;  2K8A A;  3SYZ A;  4RQ7 A;  4ZOH C;  2KP7 A;  3IG5 A;  3QUB A;  4J9O A;  5EWG A;  5KFJ A;  2Y1I A;  3MR2 A;  3NVZ A;  2RRD A;  3DV9 A;  1ZQK A;  2M9N A;  2YB1 A;  3FDS A;  4MEY A;  3GFK B;  2JHD A;  4DSL A;  9ICW A;  2ODG A;  2CPR A;  4HYK A;  1ZQX A;  1JXL A;  4GC7 A;  2KSO A;  4JWM A;  2PFP A;  2HCF A;  1Q46 A;  3F53 A;  5ALX A;  4EBD A;  1T4G A;  2KV2 A;  4KLL A;  3QEB Z;  8ICR A;  3TAR A;  5ALI A;  1S97 A;  2ES6 A;  5D46 A;  4TUS A;  3PV8 A;  3C1Z A;  5EWF A;  4LZD A;  4QZ8 A;  4KLF A;  7ICH A;  5J2I A;  4PGX A;  2MRL A;  2HSZ A;  4OCZ A;  1HJP A;  5KT4 A;  1YZ6 A;  2PMZ F;  3ONN A;  1BPB A;  3ETL A;  5L1L A;  5ALE A;  2HOQ A;  2W9A A;  2I6X A;  5KFC A;  3QNM A;  2QB0 B;  4UB5 A;  5KFG A;  1JX4 A;  2XIC A;  1X2I A;  4NXZ A;  1N2X A;  1ZQQ A;  5CP2 A;  2AQ0 A;  3CYM A;  4C7Z A;  2HOI A;  1ZQV A;  4YMN A;  3SAG A;  5C5J A;  8ICG A;  1N62 A;  4P4P A;  1JI7 A;  1SIJ A;  1XSP A;  3WK7 A;  1Z19 A;  4O5K A;  3JPS A;  4NLG A;  3M1Y A;  1XO1 A;  5AI0 A;  1WCL A;  2W8K A;  2C2E A;  5KAF U;  4PHP A;  8ICM A;  1NK7 A;  5AKK A;  3HKZ F;  1B43 A;  3MGV A;  1L7N A;  1VLB A;  2F1J A;  5DDY A;  4BWM A;  2KNJ A;  2FPL A;  3LYS A;  3M7D A;  5AIC A;  2YTU A;  1Z1V A;  4JV1 A;  5III A;  2EZX A;  2W7P A;  2FPM A;  4P4M A;  2D3D A;  3BZC A;  4YMO A;  5EWE A;  3OHA A;  3CNH A;  2KVS A;  3OGU A;  4EBC A;  2ASJ A;  4FBT A;  3AU6 A;  4UB6 U;  4KIT B;  1KTQ A;  1SWV A;  1OXJ A;  1ZD3 A;  4DF4 A;  4ACO A;  4JV0 A;  5AM1 A;  4F72 A;  2WB1 F;  4FZN A;  4CCH A;  7ICU A;  2ZIX B;  1DK3 A;  5DLG A;  4J9L A;  4O5E A;  1M6Y A;  2WF8 A;  4O3S A;  7ICQ A;  2HHQ A;  2XGQ A;  5J2K A;  4IQT A;  3I76 A;  8ICL A;  3OSP A;  4K4G A;  5DQH A;  4KMU A;  2F2A B;  2JXJ A;  5E79 U;  4PGY A;  3EPI A;  8ICN A;  2LYA A;  1KBU A;  5KFV A;  2KKP A;  3RB6 A;  5ALP A;  3V72 A;  5KFH A;  4NLB A;  4MFC A;  4UQG A;  3GII A;  1BVS A;  5AIA A;  2DL0 A;  3ZDB A;  5HR7 A;  4ED6 A;  1LB2 B;  5KFZ A;  4Z6E A;  4DS5 A;  1X6J A;  1D9D A;  4O3N A;  1VDV A;  3F2D A;  2ISP A;  2OHF A;  1V9P A;  1S5L U;  1S8O A;  4UB4 A;  2IOH A;  4QWB A;  4C4S A;  5KL1 B;  3RB3 A;  4DFJ A;  3PY8 A;  1V97 A;  4KLG A;  4I2H A;  4ECX A;  2VA2 A;  1N63 A;  1RDF A;  1K1Q A;  1XC9 A;  3KTQ A;  2P6U A;  2HVI A;  3GIK A;  5BOM A;  4YG2 A;  1NKB A;  1K1S A;  3O0F A;  1WWV A;  3HRD D;  1U47 A;  1D8Y A;  3T5J A;  4ZH4 A;  4P0Q A;  2XCA A;  4QWC A;  2OM6 A;  4PJ0 U;  4I2I A;  3JPR A;  1WCN A;  5KFQ A;  4KX5 A;  5ALQ A;  9ICI A;  4B9N A;  3IV6 A;  4YFK A;  4J9Q A;  3THV A;  1ECW A;  1N60 A;  2JEI A;  2I1Q A;  1N5X A;  2KFN A;  3QEA Z;  1X66 A;  2W3R A;  4NL9 C;  1L3V A;  2A3V A;  8ICY A;  5JTI A;  3GIM A;  2HHV A;  2KSO B;  4DSI A;  3GV8 B;  5J8Y A;  1MC8 A;  2XCP A;  4Y2T A;  4IS7 A;  5ALW A;  3D6J A;  5GTH U;  2ATL A;  4I2G A;  4DLG A;  2BHN A;  2GWS A;  3G6Y A;  2FLP A;  3JPT A;  2K4I A;  5F3X B;  2R18 A;  4JWN A;  1GO3 F;  1QH9 A;  1XSN A;  2DUY A;  2UVR A;  9ICN A;  3ICX A;  3BDP A;  3HW8 A;  1DOQ A;  4PGQ A;  2ZTD A;  5KL8 B;  5ALF A;  2YML A;  3RFA A;  5KFE A;  4ED7 A;  3PW7 A;  3RJK A;  2IHM A;  5EE0 A;  1NK8 A;  2IHN A;  2NRX A;  2C2D A;  4QWE A;  3RB0 A;  5BOL A;  4CF5 A;  1D8L A;  2NRW A;  4ECW A;  8ICS A;  4YXM A;  5AK3 A;  1QLN A;  4XQ8 A;  3VC8 A;  1NZP A;  3IP4 B;  4F5N A;  2Q4T A;  1PVQ A;  2O6K A;  3PX0 A;  5AKE A;  4YD2 A;  3PSP A;  4IR1 A;  2HHX A;  3RRG A;  2DQN B;  2OXO A;  1BPD A;  1LVH A;  3SEI A;  1SKR A;  3PZP A;  1WG8 A;  3K4G A;  5KT2 A;  1ZQM A;  2Z7J A;  4ICA A;  4I2B A;  2KTQ A;  1X42 A;  4B9M A;  1SV0 C;  5BPC A;  3V7J A;  4MFA A;  1PK1 B;  4US8 A;  3E0F A;  4OJL A;  2WHE A;  4Z6C A;  1AQ6 A;  4P0P A;  2H3V A;  2W55 A;  5ALG A;  3SAF A;  4YN4 A;  5ALD A;  1A0P A;  1NI3 A;  2ALZ A;  4KLH A;  4F5O A;  3C5G A; 
#chains in the Genus database with same CATH homology
 2QKQ A;  4MHV A;  2E8N A;  5L1M A;  3KKA C;  2K4P A;  3TAC B;  2QB0 B;  2EAN A;  3BS5 A;  3TAD C;  1B4F A;  1LKY A;  5F3X B;  1SV0 A;  1KW4 A;  2DL0 A;  1PK3 A;  1X9X A;  3K1R B;  4NL9 A;  1JI7 A;  2E8M A;  1RG6 A;  2F44 A;  2E8O A;  5JU5 A;  1SGG A;  2LMR A;  1WWU A;  2DKX A;  3BS5 B;  1LKY B;  1X40 A;  2EAO A;  1DXS A;  2KE7 A;  2KIV A;  2F8K A;  1F0M A;  1V85 A;  3KKA A;  3HIL A;  2FE9 A;  2Y9U A;  2Y9T A;  3TAD A;  2YTU A;  1Z1V A;  2ESE A;  5J8Y C;  3H8M A;  1UCV A;  1WWV A;  5JRT A;  2D3D A;  1V38 A;  2GLE A;  4PZN A;  2KSO A;  3SEI A;  2EAP A;  1SV4 A;  2QAR A;  1OXJ A;  1UQV A;  5KNI A;  2E8P A;  1SV0 C;  2ES6 A;  1SXE A;  1PK1 B;  2EAM A;  1PK1 A;  4RQN A;  2LPE A;  3BQ7 A;  1X66 A;  2L5Y A;  3SEN A;  2QB0 A;  4NL9 C;  2D8C A;  5JTI A;  2QB1 A;  2F3N A;  2KSO B;  4PZO A;  2K60 A;  5J8Y A;  4NJ8 A;  1SXD A;  2KMD A;  4IS7 A;  2QAR B;  2JV3 A;  1OW5 A;  2DKZ A;  1B0X A;  2KG5 A;  3BS7 A;  3IDW A;  2B6G A;  1COK A;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...