4RQNA

Crystal structure of the native bicc1 sam domain r924e mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
SDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein bicaudal C homolog 1
publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqnA01
3BQ7A 1COKA 5JU5A 2KIVA 2KE7A 1OXJA 3BS5A 2KMDA 2QB0B 2JV3A 3BS5B 5L1MA 1SV0A 1UCVA 2L5YA 1V38A 1JI7A 1V85A 3H8MA 4NL9A 2KSOA 1UQVA 2QB1A 2QARA 1B4FA 2KSOB 3K1RB 2QARB 2E8NA 1SV4A 3TACB 2B6GA 2DKZA 5JRTA 1SXDA 5JTIA 2EANA 1Z1VA 4RQMA 4PZOA 1KW4A 2DL0A 2Y9UA 1B0XA 3BS7A 5J8YC 3HILA 4RQNA 2EAMA 2EAOA 1RG6A 4PZNA 4MHVA 4NJ8A 1DXSA 2K60A 3IDWA 3SENA 2GLEA 2E8PA 3SEIA 1F0MA 1X9XA 1PK1A 2LMRA 1PK1B 2Y9TA 3TADC 1SXEA 2K4PA 2DKXA 2F8KA 2F3NA 2QKQA 1LKYA 2E8OA 5J8YA 2EAPA 1SGGA 1LKYB 1WWVA 1PK3A 5F3XB 2LPEA 1WWUA 2QB0A 4IS7A 1X40A 2YTUA 5KNIA 1SV0C 2FE9A 2E8MA 2F44A 3KKAC 2D3DA 1OW5A 4NL9C 3TADA 2KG5A 3KKAA 2ESEA 2D8CA 2ES6A 1X66A
chains in the Genus database with same CATH superfamily
3EPIA 2K8AA 1RQNA 3AL0B 5AM4A 7ICJA 4YFKA 3RTVA 1JXLA 1A0PA 4M9JA 4Y2QA 4YXJA 1YT3A 3L3FX 4Y2SA 3RR8A 2RDIA 5B66U 4KLGA 4KLJA 3FYHA 2DGZA 4Y2XA 4CCHA 2MUTB 2KICA 4F5NA 2QB1A 4QZ8A 4JWMA 3EYZA 1TK0A 3LK9A 3K1RB 7ICPA 1D8LA 1QLNA 1NNLA 4TQRA 1X9WA 2JEIA 4IRDA 1ZYQA 2BGWA 2EQYA 3PVXA 4CGZA 3WKEA 3OGUA 5AKXA 1SL1A 4IQVA 4RQNA 5J0UA 3M1YA 3RJHA 4IQUA 4NJ8A 2W3RA 1ZRMA 3TQ1A 2GLEA 3SEIA 2W7PA 2W9BA 4JUZA 3PX6A 4NXZA 5DGBA 3HKZF 2YY6A 5KFHA 5ALJA 1ZQKA 9ICOA 7ICRA 4G3IA 4B9UA 2WF7A 2IHMA 9ICUA 5B5EU 4KMUA 2RP5A 3H40A 2ZIUA 3MGHA 3DDHA 2BDPA 4DL2A 4Y2YA 4CF3A 3M9MB 2HBMA 3ICXA 2OWOA 3PW0A 3PO4A 4UB4A 3Q8LA 3WK7A 1XS9D 4Y2PA 2WF8A 2XC9A 3PX0A 4M47A 1WYGA 2WB1C 3CRXA 4I28A 2F1JA 1C20A 4R65A 2KOBA 5ALGA 4O3MA 1NK0A 2KIVA 4O3SA 2BDUA 3N97B 4KLHA 8ICYA 3AM9A 1RDFA 2FPLA 2FMSA 2W11A 2L5YA 3QZ7A 1V38A 3NTUA 4F3OA 1JI7A 2AHOB 2H3VA 3TAQA 4M9GA 4C4RA 5AKHA 3ISBA 4UAZA 5AI0A 4FS1A 5EE9A 2PMZF 2BPCA 4G9BA 4NLNA 3T79A 4OJLA 4MF2A 4J9LA 1B43A 3SQIA 2DUYA 3B0YA 2AJQA 1BNPA 1KSPA 4RNNA 2P6RA 4EEKA 1KW4A 4GXJA 4GFJA 5KFZA 2Y9UA 5EE3A 4EX7A 1D9DA 2EAOA 1XO1A 1PUZA 5G5GA 2A1AA 1FFUA 4QZ9A 4GC6A 5IIIA 4O3NA 5AIBA 3ZDEA 4U7CA 3ALRA 5C5JA 3UXPA 2LMRA 1PK1B 8ICLA 2PXIA 3V6JA 5AI4A 1QSYA 2G5IB 4YD2A 2V4RA 1COOA 2WHEA 5J8YA 1HUOA 1SGGA 5KFMA 1X2IA 8ICPA 3KTQA 5ALTA 3PW7A 3C2LA 5IIJA 4US9A 5ALYA 4US8A 4ELVA 1X40A 1ZQJA 4C8KA 3GDXA 3FAHA 5CP2A 4I2AA 2R18A 2LKYA 3Q8SB 1BPBA 5BOLA 3H8JA 1RXWA 1IIPA 1L3TA 2VJ4A 4PHPA 2W9CA 9ICPA 3V6HA 5HHIA 5J0WA 3HRDD 4FS2A 4NM1A 2CXYA 1RXVA 3QEBZ 2KN7A 8ICAA 3RH4A 8ICHA 5HMLA 3K75D 5AK5A 3GIKA 4YVZA 3MC1A 1QQ6A 1UCVA 3UQ2A 8ICQA 4EZ6A 1SZHA 1KQQA 3D2SA 4YR2A 5KFKA 4KLIA 4DSJA 5KFRA 4RPYA 3PW5A 1L3UA 2B6GA 3D2NA 4RQ7A 5AK4A 8ICTA 1SXDA 3WK8A 4QIWC 5J0OA 1S10A 5JTIA 2BQ3A 1S97A 1Z1VA 1O08A 4O3PA 1S0NA 2KKPA 1A6SA 1U47A 3KOOA 4PL2A 5EWEA 5D49A 2BCRA 1ZXIA 1FO4A 5DBBA 1S5LU 3GV8B 5ALVA 4OJ5A 1X6IA 5TISU 4ECUA 7ICSA 4QZFA 3CW2C 4Z6FA 2F3NA 2IOFK 5AM1A 3RFAA 2KKVA 2AXTU 2EAPA 2KV2A 4QZBA 5F3XB 1SWVA 2W3SA 2EZYA 4EX6A 2E8MA 2KJ5A 3TADA 3RBEA 3EW9A 1ZOLA 1X6JA 1CUKA 4ELTA 2E1FA 3UXNA 2PFOA 1Q46A 2F8LA 2H3QA 3AMZA 2VANA 2HHTA 4DL3A 5ALFA 5KG5A 3KHGA 2IBKA 5AK6A 4RPZA 3C1ZA 4EYHB 4F2SA 4LZDA 3BDPA 3AUOA 5J0QA 4M6WA 1SV0A 3C2KA 4J9RA 1V85A 1S0OA 4Z6CA 4RZRA 2QLTA 2V9WA 5CEHA 2KJ9A 3QXGA 1HUZA 1U49A 2QARB 9ICVA 1N61A 4O3RA 4Y2VA 3QUBA 1Z19A 2I5HA 1N60A 5KT6A 1Q8KA 5J2BA 1T4GA 1DGJA 2JEJA 3ISDA 5DBCA 5AKKA 4KLLA 2C2RA 5L1IA 4OD0A 4NLKA 5J8YC 3ZDCA 1JIHA 1VLBA 1ZD5A 1TV9A 1ZQDA 4P4MA 1FFVA 4XRHA 1K1QA 5AI9A 4QWCA 7ICUA 4DSLA 3LDAA 4NLBA 1N5XA 4TUSA 3KD3A 3O0FA 5KFDA 1MSWD 3V7KA 4DFPA 4RQ8A 1Z4NA 3F2CA 9ICTA 1QQ5A 1LKYB 1ZETA 2WF9A 2F2AB 8ICFA 3ED5A 4ECTA 1ZQBA 1QSLA 5DB9A 2BZFA 1KFTA 4OJOA 3G6YA 3Q8RB 1MN8A 2YMLA 4R8UA 1NOMA 5J2EA 4O5CA 3KZIU 2W7OA 3L5KA 5CHGA 1HIWA 1ECWA 9ICEA 4PHEA 1JN3A 2H5XA 4C80A 3BS5A 2KMDA 4KLUA 2AH5A 7ICTA 5ALKA 3BQ1A 3GIJA 1ZQUA 4J03A 5ALDA 3MGIA 2RDJA 1NJZA 5L1MA 3Q8QB 3PY8A 3CP8A 2KFZA 4QZEA 3R9KA 5DG8A 4Y2TA 1M6YA 5HNKA 3PR5B 4BWJA 5J2FA 4NL9A 5KG0A 2WAQC 1D8YA 2PFQA 2OM6A 9ICAA 3RJEA 4EENA 3TANA 1ZQXA 2OCEA 4DFDA 4MEYA 4MEXA 2MA1A 1NK9A 2K4IA 4DFKA 3MABA 3PSPA 2JH1A 4BDPA 4RQ1A 2ZIWB 1L6NA 2RHFA 3RAXA 3N7SC 4UB8U 2XCAA 1K5OA 4F8RA 1RG6A 2WF6A 3TAPA 3LYSA 2RLTA 4HYKA 2E8PA 3V6KA 2VJ5A 2O6KA 4F5OA 3H8WA 1K1SA 1MC8A 3NRZA 3TADC 2DPJA 5KT4A 4TQSA 2MAXA 2CN1A 1DGSA 5AKJA 4DLEA 3FDSA 4EZ9A 3F2DA 1XNSA 1D9FA 2H3ZA 5DGAA 3B9JA 4EBDA 5DQGA 1ZQRA 2FMQA 4QZGA 4DCCA 2LPEA 5AKLA 1NK8A 1UT5A 2YTUA 1SV0C 1XWLA 2LYHA 4DO9A 2K8BB 3QU5A 4I27A 4B6JA 2FPMA 3B0XA 2JZBA 4JB3A 4BXOA 1Z00B 5KT7A 1LVHA 2KE7A 1OXJA 5AK3A 1LV5A 4E0DA 3ZD8A 2KK0A 5J2JA 4ED8A 4J9QA 1KL9A 4PPXA 8ICEA 2KZ3A 1CRXA 5AKIA 2WFAA 2KIWA 1J2MA 3SV3A 2NRWA 5E79U 2Y0SC 5ALNA 8ICNA 5KG6A 5KFUA 4GXIA 2LBOA 1MA7A 2P66A 2ZIXA 5HHHA 4QW9A 4P2HA 1U9LA 2HBLA 9ICCA 1DK3A 2ASJA 2YX8A 4F5PA 4KN7A 1FIQA 2ZIVB 3IRUA 4BJQA 3E2EA 1F0MA 1HJPA 1SIJA 2FI1A 1JMSA 5KG7A 5J0SA 1BPXA 4OCZA 4UBCA 4UAYA 1N2XA 4YN4A 3RH6A 2IHNA 4RT3A 3MFHA 3BQ0A 3BZKA 5CJ7A 2Q0ZX 1WCNA 4NWIA 1SKRA 2HHVA 3JPOA 2LYAA 1T94A 5DBAA 3WU2U 1WWVA 2NRXA 1ZJNA 5CRXA 5DLGA 3K4GA 8ICCA 1L7PA 4NLGA 1ZD3A 1XSNA 4TUPA 4UAVA 4KLOA 3MDAA 3ETLA 5AHXA 3WKDA 5AI6A 2H3FA 1ZQPA 1X9MA 4NL9C 1NKBA 3WK5A 5KL8B 4QJFB 1L8OA 4F4ZA 2CRXA 1DRGA 2HHWA 4DSFA 4FFDA 4K4HA 2LM4A 1L7NA 2C2DA 1SWWA 4M9NA 2YB4A 4ECYA 2KZZA 2LM1A 2QB0B 2ZIWA 3BQ2A 4AYBF 2A1JA 1PVRA 3V72A 4QW8A 1N5WA 4DL6A 3HP6A 9ICJA 2VA8A 2HI0A 2LHTA 2KSOA 3GIIA 2UVVA 4DL7A 4P4PA 4J9SA 2HHSA 4FZLA 7ICHA 1ZQQA 1S77D 5IILA 3QEAZ 4KLSA 4P0PA 5D46A 2DKZA 4ED3A 7ICLA 3S6JA 2MU2A 1KFDA 1VJ5A 2FJ6A 3THVA 1ZQEA 1BGXT 3BS7A 3T5LA 1X9SA 1NJWA 3JPSA 2UVUA 4PZNA 4IRCA 2K60A 2KP7A 4ACOA 3GIMA 9ICRA 5ALXA 1KFSA 8ICIA 2DKXA 5J2GA 5J2IA 5CR0A 2KZMA 4Q45A 1ZQIA 5KFGA 2I1QA 1JX4A 4ECWA 2WTFA 8ICMA 4RNMA 3ORYA 4J9OA 3G6VA 5EE0A 4UATA 4YMNA 4P0QB 3GU3A 4I2JA 4EYIB 4M9LA 2R8JA 3MGVA 4IS7A 2KHQA 3M9OB 2M0NA 1NKEA 1Z1BA 4CE6A 2XGQA 3KKAC 3ZI4A 2W9AA 4PGQA 4NY8A 3JPQA 1NK6A 2D8CA 4LZGA 3L4PA 4DQSA 3KBBA 2DPIA 2FLLA 3HWTA 5HP4A 1COKA 5JU5A 5KAIU 5GTIU 5ALSA 1S0MA 5KFSA 3RRGA 1XC9A 3EWAA 5J2AA 3GFKB 1RQLA 2MUTA 2YMPA 8ICXA 1KBUA 4C7ZA 4F91B 4F4YA 1UQVA 1T7PA 2CPRA 4DQIA 4YCXA 3SAFA 2OHFA 2R8GA 2NYVA 4DF4A 4Y2JA 8ICBA 2RQ5A 2GWSA 4B9SA 2W8LA 4RQ5A 4UW9A 2W9MA 7ICOA 3V7JA 2K8CB 2BHNA 5CWRA 3RB0A 4ZOHC 4ECZA 5AM2A 3H0LB 4MHVA 3IN5A 3SENA 1ZQZA 3PSIA 3AQFA 4I2EA 5KG2A 3WK9A 9ICMA 2V4QA 5F9LA 3GQCA 4RQ3A 4RQ2A 2PI5A 2XY5A 3RF9A 4BUGA 1ZJMA 4B9NA 2UVWA 1XSPA 4WJ3B 3IV6A 4YR0A 1L3SA 5DB7A 4C8NA 5J2DA 3C23A 1ZQTA 3CNHA 3OHAA 2XO7A 4C8OA 2NV3A 2ZJAA 2C22A 3WKBA 1S76D 1WWUA 2QB0A 3QUQA 3UMBA 5KG3A 5J0YA 3IM1A 2KG5A 4I2HA 8ICSA 5KAFU 4DS5A 4X5VA 4KN4A 4ECRA 5DLFA 1U48A 4ECSA 7ICVA 3NRWA 5KFYA 3E58A 2J6TA 4PHAA 1B22A 1KLNA 4Q8EA 1NI3A 2PI4A 4Q44A 4EBEA 4JV0A 2NRTA 3SMVA 3PZPA 3T5HA 2B0CA 2PKEA 5HMMA 1F5SA 2GOLA 5T14A 3H8MA 5L1KA 5K4LA 5ALUA 1RM6C 1FEZA 1S0VA 3J81j 4C4SA 2JMGA 5KFWA 1B4FA 4B9MA 4KLEA 1U45A 3I28A 3TARA 1UT8A 1D8BA 5IINA 3F5AA 4KX3A 4XQ8A 2F1HA 3ZDAA 2ZXIA 1YZ6A 4IRKA 4KLMA 5AKZA 1ZQSA 4PHDA 4RQMA 4MFCA 1N63A 4PZOA 3E0FA 3Q8PB 5KFTA 1GO3F 1T8EA 1KDHA 5J29A 2DF4B 4OJPA 4RQ6A 4QZCA 2HBKA 3KFUF 5AM5A 4UB1A 1PK1A 4ECXA 3H0RB 2YMMA 3PMLA 1SXEA 2LI6A 5J0XA 1ZD4A 4O9MA 3C28A 2WB1F 3JPPA 4I2CA 2HDOA 2G09A 4DWIA 4RNOA 4UB5A 4P4OA 4F4KA 4PGYA 1N56A 4J9KA 1J2NA 1TAQA 3QU7A 5AI5A 1SL2A 3NVYA 3U26A 8ICVA 1OW5A 1L3VA 3RJJA 3HKZC 3I1YA 5J2KA 4RPXA 2IA6A 2BPGA 8ICKA 4EEYA 1QH9A 3CYMA 4QNLA 3BQ7A 3T5JA 5ALZA 3RB6A 1TKDA 3F2BA 4B9LA 2NRZA 2P6UA 8ICRA 3M7DA 5ALPA 3VC8A 1NZPA 5ALWA 1UA0A 4KLDA 1AROP 5BOMA 1OUQA 5AM0A 4DL5A 1URJA 5IIOA 2OH2A 1DK2A 1SV4A 4AP9A 3GV7B 1KTQA 2OXOA 2FLNA 4FBUA 3A0BU 4DOCA 5AI8A 4RT2A 3SV4A 5J0TA 1O03A 3QE9Y 3HPOA 4DQPA 4ED7A 1Y88A 2K4HA 5DB6A 3SI8A 2XGPA 2RRDA 4JV1A 1ZQGA 2FMPA 4M04A 1BNOA 2NO5A 1JROA 4TURA 3TFRA 1V9PA 4I2DA 2PMZC 2W9BB 4IQWA 2ZG6A 4ICAA 3OSPA 4ECVA 4F4XA 3LVWA 1ZQMA 4C8MA 1UPHA 4RU9A 5J0PA 2HOIA 4F2RA 3RRHA 2E8OA 1WUDA 4IQTA 2ZIUB 3UQ0A 4ZH4A 1XSLA 4QWAA 2K89A 2EDUA 5KNIA 1L5UA 4HAIA 1BPDA 3HJEA 4XUSA 5J2CA 2XIDA 1MQ3A 3RJFA 4Y2UA 3PV8A 2ZTDA 2FDRA 1KKXA 4I2FA 5KG4A 3PR4A 1TK8A 2ESEA 4BX9C 1TVAA 1NK7A 3N7RC 5DQIA 4TUQA 1CI4A 3DEEA 3H0MB 2HSZA 3MBYA 4I29A 1XO0A 4QIWF 2G0AA 4F4WA 7ICKA 3AU2A 2AQ0A 1TAMA 2JV3A 1MQ2A 7ICMA 3UMGA 1ZQHA 7ICEA 3D2QA 3M8RA 2ALZA 2QARA 4DL4A 3ISCA 3RJIA 2YN4A 4FZNA 1WCLA 2G06A 5KL1B 3IP4B 1JALA 2I6XA 4FZMA 2OYYA 4IR1A 5KT3A 3C21A 4IL6U 3EPGA 5DQHA 2YB1A 4UBBA 5AKEA 4GC7A 2AGQA 7ICFA 4KTQA 4YMMA 4CNQA 2HOQA 5ALMA 5KT5A 2JGAA 3SR6A 2HBJA 5J2HA 4XA5A 2Y9TA 2K4PA 5KG1A 3MFIA 4F93B 4Z6DA 3WKAA 3NVWA 4Y2RA 3BJYA 5A0LA 1LKYA 2E3TA 1NJXA 1F44A 3IHQB 4Q8FA 3RAQA 1EXNA 4ED1A 4I2GA 1L7OA 9ICNA 4CDGA 2HCFA 4FE3A 3KHHA 3WKCA 3FM9A 3PW2A 4F71A 7ICQA 3RR7A 2XY6A 2KFNA 5BPCA 3H4BA 3ETRA 2W9CB 2JR5A 3AEVA 5DKWA 1NJYA 1XU4A 3HX0A 9ICBA 4C0ZA 1L8LA 4OJ6A 4J9PA 1L7MA 4UB2A 2YMQA 2DFLA 3OJUA 1QCKA 2KHVA 3BQTA 4UB6U 1ZRNA 4O5EA 4MF8A 4O3OA 1ZQVA 4RQ4A 4LVSA 4B9VA 1SKSA 2KVCA 2OEHA 3DV9A 5HR7A 3F5EA 1T3QA 5KFNA 4DSIA 1H38A 2BCSA 5L1LA 4F50A 2EAMA 3QX7A 3LWMA 2J6SA 4YD1A 1RZTA 3QYPA 1DXSA 3IDWA 3GZFA 3N7PD 1ZQOA 3QZ8A 3GV5B 8ICOA 3IG5A 4KLQA 2F1IA 5AICA 4YXMA 3QUCA 5KT2A 3JPTA 5DDMA 1N48A 4UARA 1ZQFA 2XY7A 4GLXA 2G07A 2XCPA 4O0IA 2DWQA 3OHBA 2W8KA 2J6UA 9ICQA 4YQWA 2AGOA 3HW8A 2ATLA 4F5QA 2XI9A 3KZXA 5DB8A 3RBDA 2FE9A 4FO6A 4PH5A 2WAQF 3C2MA 5CB1A 5KFFA 3WK4A 4CRXA 3TKAA 2ASLA 4J9NA 3C29A 2KD1A 2P35A 4NM2A 1Z00A 5AIAA 5KFEA 4R63A 4RQ0A 2LYBA 5KFJA 5G5HA 4C4TA 1KEJA 2HMXA 2EZZA 5DDYA 1QQ7A 2AGPA 2BPFA 1SZPA 1TK5A 4K4GA 4M6WB 2AU0A 4DOBA 2R8IA 4JWNA 7ICIA 9ICKA 5TZVA 3ZD9A 3H8SA 1A77A 2ZTCA 2EH9A 3LVVA 2XVTA 4UAUA 1BPYA 3SAHA 2HHUA 3TFSA 3OSNA 4OO1J 4EBCA 5GTHU 4C8LA 4KITB 4QZAA 3JPNA 3KHLA 4C7YA 4M0AA 4UAWA 4DQQA 2DL0A 3IG8A 1NZBA 2PFPA 3AN1A 2ZIVA 2BQUA 3HILA 2I9GA 1QTMA 2W55A 2MSNA 4LJXA 4UQGA 5AKYA 1ZQLA 3UPQA 5EE1A 2HVHA 5H2FU 2F76X 3RJKA 2W03A 1ZD2P 4R66A 8ICJA 2G5HB 5KFCA 3NS1A 2HOFA 1S9FA 1BPZA 5C0YA 5ALQA 4B9TA 1P7DA 2G08A 2H3IA 5KFLA 4F72A 3HT3A 3UMCA 2ZJ8A 3SYZA 2ISPA 2R8HA 4GXKA 1SB3C 2W04A 1PZNA 3MR3A 2ZUCA 5KFQA 1Q3VA 3H7IA 4O5KA 3RB4A 2F44A 5ALLA 5L1JA 4Z6EA 5IIKA 3QU9A 4R8UB 3QU4A 2Y0SF 3M6ZA 1Z4OA 1AQ6A 3M8SA 3TI0A 2BR0A 3C1YA 5DG7A 3UXOA 4BGDA 2B21A 1ZQNA 2ASDA 1YZ7A 3T3FA 3BS5B 3M9NB 3NGDA 1U4BA 3BZCA 3UM9A 4UB3A 4A8EA 2A19A 2K4EA 4DQRA 2HW3A 1IV8A 2NRVA 4KMOB 1KN5A 2GH1A 4M9HA 3H4DA 4MFFA 3TACB 5JRTA 1BVSA 2W43A 2BCQA 2FLPA 4ECQA 3C5FA 2BKEA 3PX4A 1SL0A 1ZQ1C 3FC4A 9ICHA 1X42A 4U6PA 5KTQA 2ODGA 1RYRA 4QWDA 4IR9A 5AM3A 3PO5A 1X9XA 1JRPA 4QZIA 3PSFA 3NVVA 2XICA 4ED0A 2AQ4A 2Y1IA 4DS4A 3SAGA 2E1EA 2F8KA 2KNJA 5KFOA 3MR6A 2N1RA 4USAA 4J9MA 2VA3A 1UA1A 4RUAA 2QKQA 1IXRA 2JRZA 4YMOA 4P0QA 4CF4A 3GILA 3OPXA 7ICNA 8ICWA 2A3VA 3WK6A 1ZQYA 2VA2A 1LB2B 3MR2A 5L9XA 2D3DA 3T5KA 1J97A 2E5SA 1NK5A 5ALRA 2HVIA 1V97A 2C2EA 1TFRA 4DEZA 4I2BA 4F5RA 1X66A 5KFIA 4ED2A 2UVRA 2IOHA 1VDVA 2JZBB 1IM4A 3EUB2 5ALIA 4BXOB 5IIMA 3VCBA 4DSKA 2ZUDA 4IC9A 2W54A 4QWEA 5J0RA 5ALHA 4JV2A 4YP3A 4JK1A 1S8OA 3G6XA 2Z7JA 1PVPA 4UASA 2E8NA 3PSTA 5JUMA 3RH5A 4DLGA 1ZQWA 3NUQA 3NVZA 5EWFA 5HR6A 2EANA 9ICIA 4KX5A 4NLCA 1NK4A 2Q4TA 2FPKA 2ZIXB 4AYBC 3AU6A 3ONNA 4GIBA 1WG8A 5KFPA 3QU2A 1SKWA 3RJGA 4M2YA 4I2IA 2ZTEA 2R8KA 2BQRA 2DQNB 4YG2A 1T3NA 5EWGA 4PL1A 3ZDDA 3I76A 2M9NA 2VKQA 2KEYA 9ICLA 4CF5A 2EZXA 3SD7A 2F77X 2DBYA 2KVSA 1HEKA 5CA7A 3LWLA 2PFNA 4R64A 4ED6A 3D6JA 1ZQAA 3OJSA 1N62A 2ZXHA 2IMWP 3PMNA 1ED1A 1ZQCA 9ICFA 1BPEA 9ICWA 3N28A 3MR5A 4O3QA 2NO4A 3QNMA 4QZDA 3SZ2A 1PVQA 3NASA 2HHQA 4DFJA 8ICUA 4F92B 2GO7A 4PJ0U 1RPLA 2C28A 5KFAA 4FBTA 8ICZA 4K4IA 3K1ZA 7ICGA 1IG6A 1TE2A 5EOZA 8ICGA 4DSEA 2D6FC 2A1JB 3M6KA 1QSSA 1JXEA 4QWBA 3N4MB 4YR3A 4RUCA 2ZUBA 3PNCA 3EZ5A 4KLTA 2KSOB 3OTQA 4NV0A 1CEZA 5AKGA 1DOQA 2MRLA 2Y1JA 2JEGA 1RYSA 5ALOA 4DOAA 4P0PB 4EELA 2IOFA 2BCVA 1JUDA 1TAUA 9ICSA 3Q8KA 2HHXA 3RB3A 2JEFA 1B0XA 1RYUA 5DG9A 1NKCA 4DF8A 5ALEA 3KHRA 2JH7A 1Q3UA 4Q43A 1KRPA 3V7LA 3C5GA 3AQEA 3ZDBA 4MFAA 2VIXA 2JHDA 4DFMA 1A76A 2WF5A 5KFVA 1UHUA 4JMUA 4QZHA 2BCUA 5F9NA 2KTQA 4PGXA 2ISOA 3PW4A 2YQEA 3F53A 1PK3A 4KLFA 9ICXA 9ICGA 2ZJ5A 3JPRA 5FP0A 5KFBA 3QUTA 3Q8MA 4BWMA 3A0HU 2KJ8A 5KFXA 1C7YA 3KKAA 5D4BA 3MDCA 4ELUA 4NLZA 2JXJA 2ES6A 1Z3EB
chains in the Genus database with same CATH topology
3BQ7A 1COKA 5JU5A 2KIVA 2KE7A 1OXJA 3BS5A 2KMDA 2QB0B 2JV3A 3BS5B 5L1MA 1SV0A 1UCVA 2L5YA 1V38A 1JI7A 1V85A 3H8MA 4NL9A 2KSOA 1UQVA 2QB1A 2QARA 1B4FA 2KSOB 3K1RB 2QARB 2E8NA 1SV4A 3TACB 2B6GA 2DKZA 5JRTA 1SXDA 5JTIA 2EANA 1Z1VA 4RQMA 4PZOA 1KW4A 2DL0A 2Y9UA 1B0XA 3BS7A 5J8YC 3HILA 4RQNA 2EAMA 2EAOA 1RG6A 4PZNA 4MHVA 4NJ8A 1DXSA 2K60A 3IDWA 3SENA 2GLEA 2E8PA 3SEIA 1F0MA 1X9XA 1PK1A 2LMRA 1PK1B 2Y9TA 3TADC 1SXEA 2K4PA 2DKXA 2F8KA 2F3NA 2QKQA 1LKYA 2E8OA 5J8YA 2EAPA 1SGGA 1LKYB 1WWVA 1PK3A 5F3XB 2LPEA 1WWUA 2QB0A 4IS7A 1X40A 2YTUA 5KNIA 1SV0C 2FE9A 2E8MA 2F44A 3KKAC 2D3DA 1OW5A 4NL9C 3TADA 2KG5A 3KKAA 2ESEA 2D8CA 2ES6A 1X66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ7 A;  1COK A;  5JU5 A;  2KIV A;  2KE7 A;  1OXJ A;  3BS5 A;  2KMD A;  2QB0 B;  2JV3 A;  3BS5 B;  5L1M A;  1SV0 A;  1UCV A;  2L5Y A;  1V38 A;  1JI7 A;  1V85 A;  3H8M A;  4NL9 A;  2KSO A;  1UQV A;  2QB1 A;  2QAR A;  1B4F A;  2KSO B;  3K1R B;  2QAR B;  2E8N A;  1SV4 A;  3TAC B;  2B6G A;  2DKZ A;  5JRT A;  1SXD A;  5JTI A;  2EAN A;  1Z1V A;  4RQM A;  4PZO A;  1KW4 A;  2DL0 A;  2Y9U A;  1B0X A;  3BS7 A;  5J8Y C;  3HIL A;  4RQN A;  2EAM A;  2EAO A;  1RG6 A;  4PZN A;  4MHV A;  4NJ8 A;  1DXS A;  2K60 A;  3IDW A;  3SEN A;  2GLE A;  2E8P A;  3SEI A;  1F0M A;  1X9X A;  1PK1 A;  2LMR A;  1PK1 B;  2Y9T A;  3TAD C;  1SXE A;  2K4P A;  2DKX A;  2F8K A;  2F3N A;  2QKQ A;  1LKY A;  2E8O A;  5J8Y A;  2EAP A;  1SGG A;  1LKY B;  1WWV A;  1PK3 A;  5F3X B;  2LPE A;  1WWU A;  2QB0 A;  4IS7 A;  1X40 A;  2YTU A;  5KNI A;  1SV0 C;  2FE9 A;  2E8M A;  2F44 A;  3KKA C;  2D3D A;  1OW5 A;  4NL9 C;  3TAD A;  2KG5 A;  3KKA A;  2ESE A;  2D8C A;  2ES6 A;  1X66 A; 
#chains in the Genus database with same CATH topology
 3EPI A;  2K8A A;  1RQN A;  3AL0 B;  5AM4 A;  7ICJ A;  4YFK A;  3RTV A;  1JXL A;  1A0P A;  4M9J A;  4Y2Q A;  4YXJ A;  1YT3 A;  3L3F X;  4Y2S A;  3RR8 A;  2RDI A;  5B66 U;  4KLG A;  4KLJ A;  3FYH A;  2DGZ A;  4Y2X A;  4CCH A;  2MUT B;  2KIC A;  4F5N A;  2QB1 A;  4QZ8 A;  4JWM A;  3EYZ A;  1TK0 A;  3LK9 A;  3K1R B;  7ICP A;  1D8L A;  1QLN A;  1NNL A;  4TQR A;  1X9W A;  2JEI A;  4IRD A;  1ZYQ A;  2BGW A;  2EQY A;  3PVX A;  4CGZ A;  3WKE A;  3OGU A;  5AKX A;  1SL1 A;  4IQV A;  4RQN A;  5J0U A;  3M1Y A;  3RJH A;  4IQU A;  4NJ8 A;  2W3R A;  1ZRM A;  3TQ1 A;  2GLE A;  3SEI A;  2W7P A;  2W9B A;  4JUZ A;  3PX6 A;  4NXZ A;  5DGB A;  3HKZ F;  2YY6 A;  5KFH A;  5ALJ A;  1ZQK A;  9ICO A;  7ICR A;  4G3I A;  4B9U A;  2WF7 A;  2IHM A;  9ICU A;  5B5E U;  4KMU A;  2RP5 A;  3H40 A;  2ZIU A;  3MGH A;  3DDH A;  2BDP A;  4DL2 A;  4Y2Y A;  4CF3 A;  3M9M B;  2HBM A;  3ICX A;  2OWO A;  3PW0 A;  3PO4 A;  4UB4 A;  3Q8L A;  3WK7 A;  1XS9 D;  4Y2P A;  2WF8 A;  2XC9 A;  3PX0 A;  4M47 A;  1WYG A;  2WB1 C;  3CRX A;  4I28 A;  2F1J A;  1C20 A;  4R65 A;  2KOB A;  5ALG A;  4O3M A;  1NK0 A;  2KIV A;  4O3S A;  2BDU A;  3N97 B;  4KLH A;  8ICY A;  3AM9 A;  1RDF A;  2FPL A;  2FMS A;  2W11 A;  2L5Y A;  3QZ7 A;  1V38 A;  3NTU A;  4F3O A;  1JI7 A;  2AHO B;  2H3V A;  3TAQ A;  4M9G A;  4C4R A;  5AKH A;  3ISB A;  4UAZ A;  5AI0 A;  4FS1 A;  5EE9 A;  2PMZ F;  2BPC A;  4G9B A;  4NLN A;  3T79 A;  4OJL A;  4MF2 A;  4J9L A;  1B43 A;  3SQI A;  2DUY A;  3B0Y A;  2AJQ A;  1BNP A;  1KSP A;  4RNN A;  2P6R A;  4EEK A;  1KW4 A;  4GXJ A;  4GFJ A;  5KFZ A;  2Y9U A;  5EE3 A;  4EX7 A;  1D9D A;  2EAO A;  1XO1 A;  1PUZ A;  5G5G A;  2A1A A;  1FFU A;  4QZ9 A;  4GC6 A;  5III A;  4O3N A;  5AIB A;  3ZDE A;  4U7C A;  3ALR A;  5C5J A;  3UXP A;  2LMR A;  1PK1 B;  8ICL A;  2PXI A;  3V6J A;  5AI4 A;  1QSY A;  2G5I B;  4YD2 A;  2V4R A;  1COO A;  2WHE A;  5J8Y A;  1HUO A;  1SGG A;  5KFM A;  1X2I A;  8ICP A;  3KTQ A;  5ALT A;  3PW7 A;  3C2L A;  5IIJ A;  4US9 A;  5ALY A;  4US8 A;  4ELV A;  1X40 A;  1ZQJ A;  4C8K A;  3GDX A;  3FAH A;  5CP2 A;  4I2A A;  2R18 A;  2LKY A;  3Q8S B;  1BPB A;  5BOL A;  3H8J A;  1RXW A;  1IIP A;  1L3T A;  2VJ4 A;  4PHP A;  2W9C A;  9ICP A;  3V6H A;  5HHI A;  5J0W A;  3HRD D;  4FS2 A;  4NM1 A;  2CXY A;  1RXV A;  3QEB Z;  2KN7 A;  8ICA A;  3RH4 A;  8ICH A;  5HML A;  3K75 D;  5AK5 A;  3GIK A;  4YVZ A;  3MC1 A;  1QQ6 A;  1UCV A;  3UQ2 A;  8ICQ A;  4EZ6 A;  1SZH A;  1KQQ A;  3D2S A;  4YR2 A;  5KFK A;  4KLI A;  4DSJ A;  5KFR A;  4RPY A;  3PW5 A;  1L3U A;  2B6G A;  3D2N A;  4RQ7 A;  5AK4 A;  8ICT A;  1SXD A;  3WK8 A;  4QIW C;  5J0O A;  1S10 A;  5JTI A;  2BQ3 A;  1S97 A;  1Z1V A;  1O08 A;  4O3P A;  1S0N A;  2KKP A;  1A6S A;  1U47 A;  3KOO A;  4PL2 A;  5EWE A;  5D49 A;  2BCR A;  1ZXI A;  1FO4 A;  5DBB A;  1S5L U;  3GV8 B;  5ALV A;  4OJ5 A;  1X6I A;  5TIS U;  4ECU A;  7ICS A;  4QZF A;  3CW2 C;  4Z6F A;  2F3N A;  2IOF K;  5AM1 A;  3RFA A;  2KKV A;  2AXT U;  2EAP A;  2KV2 A;  4QZB A;  5F3X B;  1SWV A;  2W3S A;  2EZY A;  4EX6 A;  2E8M A;  2KJ5 A;  3TAD A;  3RBE A;  3EW9 A;  1ZOL A;  1X6J A;  1CUK A;  4ELT A;  2E1F A;  3UXN A;  2PFO A;  1Q46 A;  2F8L A;  2H3Q A;  3AMZ A;  2VAN A;  2HHT A;  4DL3 A;  5ALF A;  5KG5 A;  3KHG A;  2IBK A;  5AK6 A;  4RPZ A;  3C1Z A;  4EYH B;  4F2S A;  4LZD A;  3BDP A;  3AUO A;  5J0Q A;  4M6W A;  1SV0 A;  3C2K A;  4J9R A;  1V85 A;  1S0O A;  4Z6C A;  4RZR A;  2QLT A;  2V9W A;  5CEH A;  2KJ9 A;  3QXG A;  1HUZ A;  1U49 A;  2QAR B;  9ICV A;  1N61 A;  4O3R A;  4Y2V A;  3QUB A;  1Z19 A;  2I5H A;  1N60 A;  5KT6 A;  1Q8K A;  5J2B A;  1T4G A;  1DGJ A;  2JEJ A;  3ISD A;  5DBC A;  5AKK A;  4KLL A;  2C2R A;  5L1I A;  4OD0 A;  4NLK A;  5J8Y C;  3ZDC A;  1JIH A;  1VLB A;  1ZD5 A;  1TV9 A;  1ZQD A;  4P4M A;  1FFV A;  4XRH A;  1K1Q A;  5AI9 A;  4QWC A;  7ICU A;  4DSL A;  3LDA A;  4NLB A;  1N5X A;  4TUS A;  3KD3 A;  3O0F A;  5KFD A;  1MSW D;  3V7K A;  4DFP A;  4RQ8 A;  1Z4N A;  3F2C A;  9ICT A;  1QQ5 A;  1LKY B;  1ZET A;  2WF9 A;  2F2A B;  8ICF A;  3ED5 A;  4ECT A;  1ZQB A;  1QSL A;  5DB9 A;  2BZF A;  1KFT A;  4OJO A;  3G6Y A;  3Q8R B;  1MN8 A;  2YML A;  4R8U A;  1NOM A;  5J2E A;  4O5C A;  3KZI U;  2W7O A;  3L5K A;  5CHG A;  1HIW A;  1ECW A;  9ICE A;  4PHE A;  1JN3 A;  2H5X A;  4C80 A;  3BS5 A;  2KMD A;  4KLU A;  2AH5 A;  7ICT A;  5ALK A;  3BQ1 A;  3GIJ A;  1ZQU A;  4J03 A;  5ALD A;  3MGI A;  2RDJ A;  1NJZ A;  5L1M A;  3Q8Q B;  3PY8 A;  3CP8 A;  2KFZ A;  4QZE A;  3R9K A;  5DG8 A;  4Y2T A;  1M6Y A;  5HNK A;  3PR5 B;  4BWJ A;  5J2F A;  4NL9 A;  5KG0 A;  2WAQ C;  1D8Y A;  2PFQ A;  2OM6 A;  9ICA A;  3RJE A;  4EEN A;  3TAN A;  1ZQX A;  2OCE A;  4DFD A;  4MEY A;  4MEX A;  2MA1 A;  1NK9 A;  2K4I A;  4DFK A;  3MAB A;  3PSP A;  2JH1 A;  4BDP A;  4RQ1 A;  2ZIW B;  1L6N A;  2RHF A;  3RAX A;  3N7S C;  4UB8 U;  2XCA A;  1K5O A;  4F8R A;  1RG6 A;  2WF6 A;  3TAP A;  3LYS A;  2RLT A;  4HYK A;  2E8P A;  3V6K A;  2VJ5 A;  2O6K A;  4F5O A;  3H8W A;  1K1S A;  1MC8 A;  3NRZ A;  3TAD C;  2DPJ A;  5KT4 A;  4TQS A;  2MAX A;  2CN1 A;  1DGS A;  5AKJ A;  4DLE A;  3FDS A;  4EZ9 A;  3F2D A;  1XNS A;  1D9F A;  2H3Z A;  5DGA A;  3B9J A;  4EBD A;  5DQG A;  1ZQR A;  2FMQ A;  4QZG A;  4DCC A;  2LPE A;  5AKL A;  1NK8 A;  1UT5 A;  2YTU A;  1SV0 C;  1XWL A;  2LYH A;  4DO9 A;  2K8B B;  3QU5 A;  4I27 A;  4B6J A;  2FPM A;  3B0X A;  2JZB A;  4JB3 A;  4BXO A;  1Z00 B;  5KT7 A;  1LVH A;  2KE7 A;  1OXJ A;  5AK3 A;  1LV5 A;  4E0D A;  3ZD8 A;  2KK0 A;  5J2J A;  4ED8 A;  4J9Q A;  1KL9 A;  4PPX A;  8ICE A;  2KZ3 A;  1CRX A;  5AKI A;  2WFA A;  2KIW A;  1J2M A;  3SV3 A;  2NRW A;  5E79 U;  2Y0S C;  5ALN A;  8ICN A;  5KG6 A;  5KFU A;  4GXI A;  2LBO A;  1MA7 A;  2P66 A;  2ZIX A;  5HHH A;  4QW9 A;  4P2H A;  1U9L A;  2HBL A;  9ICC A;  1DK3 A;  2ASJ A;  2YX8 A;  4F5P A;  4KN7 A;  1FIQ A;  2ZIV B;  3IRU A;  4BJQ A;  3E2E A;  1F0M A;  1HJP A;  1SIJ A;  2FI1 A;  1JMS A;  5KG7 A;  5J0S A;  1BPX A;  4OCZ A;  4UBC A;  4UAY A;  1N2X A;  4YN4 A;  3RH6 A;  2IHN A;  4RT3 A;  3MFH A;  3BQ0 A;  3BZK A;  5CJ7 A;  2Q0Z X;  1WCN A;  4NWI A;  1SKR A;  2HHV A;  3JPO A;  2LYA A;  1T94 A;  5DBA A;  3WU2 U;  1WWV A;  2NRX A;  1ZJN A;  5CRX A;  5DLG A;  3K4G A;  8ICC A;  1L7P A;  4NLG A;  1ZD3 A;  1XSN A;  4TUP A;  4UAV A;  4KLO A;  3MDA A;  3ETL A;  5AHX A;  3WKD A;  5AI6 A;  2H3F A;  1ZQP A;  1X9M A;  4NL9 C;  1NKB A;  3WK5 A;  5KL8 B;  4QJF B;  1L8O A;  4F4Z A;  2CRX A;  1DRG A;  2HHW A;  4DSF A;  4FFD A;  4K4H A;  2LM4 A;  1L7N A;  2C2D A;  1SWW A;  4M9N A;  2YB4 A;  4ECY A;  2KZZ A;  2LM1 A;  2QB0 B;  2ZIW A;  3BQ2 A;  4AYB F;  2A1J A;  1PVR A;  3V72 A;  4QW8 A;  1N5W A;  4DL6 A;  3HP6 A;  9ICJ A;  2VA8 A;  2HI0 A;  2LHT A;  2KSO A;  3GII A;  2UVV A;  4DL7 A;  4P4P A;  4J9S A;  2HHS A;  4FZL A;  7ICH A;  1ZQQ A;  1S77 D;  5IIL A;  3QEA Z;  4KLS A;  4P0P A;  5D46 A;  2DKZ A;  4ED3 A;  7ICL A;  3S6J A;  2MU2 A;  1KFD A;  1VJ5 A;  2FJ6 A;  3THV A;  1ZQE A;  1BGX T;  3BS7 A;  3T5L A;  1X9S A;  1NJW A;  3JPS A;  2UVU A;  4PZN A;  4IRC A;  2K60 A;  2KP7 A;  4ACO A;  3GIM A;  9ICR A;  5ALX A;  1KFS A;  8ICI A;  2DKX A;  5J2G A;  5J2I A;  5CR0 A;  2KZM A;  4Q45 A;  1ZQI A;  5KFG A;  2I1Q A;  1JX4 A;  4ECW A;  2WTF A;  8ICM A;  4RNM A;  3ORY A;  4J9O A;  3G6V A;  5EE0 A;  4UAT A;  4YMN A;  4P0Q B;  3GU3 A;  4I2J A;  4EYI B;  4M9L A;  2R8J A;  3MGV A;  4IS7 A;  2KHQ A;  3M9O B;  2M0N A;  1NKE A;  1Z1B A;  4CE6 A;  2XGQ A;  3KKA C;  3ZI4 A;  2W9A A;  4PGQ A;  4NY8 A;  3JPQ A;  1NK6 A;  2D8C A;  4LZG A;  3L4P A;  4DQS A;  3KBB A;  2DPI A;  2FLL A;  3HWT A;  5HP4 A;  1COK A;  5JU5 A;  5KAI U;  5GTI U;  5ALS A;  1S0M A;  5KFS A;  3RRG A;  1XC9 A;  3EWA A;  5J2A A;  3GFK B;  1RQL A;  2MUT A;  2YMP A;  8ICX A;  1KBU A;  4C7Z A;  4F91 B;  4F4Y A;  1UQV A;  1T7P A;  2CPR A;  4DQI A;  4YCX A;  3SAF A;  2OHF A;  2R8G A;  2NYV A;  4DF4 A;  4Y2J A;  8ICB A;  2RQ5 A;  2GWS A;  4B9S A;  2W8L A;  4RQ5 A;  4UW9 A;  2W9M A;  7ICO A;  3V7J A;  2K8C B;  2BHN A;  5CWR A;  3RB0 A;  4ZOH C;  4ECZ A;  5AM2 A;  3H0L B;  4MHV A;  3IN5 A;  3SEN A;  1ZQZ A;  3PSI A;  3AQF A;  4I2E A;  5KG2 A;  3WK9 A;  9ICM A;  2V4Q A;  5F9L A;  3GQC A;  4RQ3 A;  4RQ2 A;  2PI5 A;  2XY5 A;  3RF9 A;  4BUG A;  1ZJM A;  4B9N A;  2UVW A;  1XSP A;  4WJ3 B;  3IV6 A;  4YR0 A;  1L3S A;  5DB7 A;  4C8N A;  5J2D A;  3C23 A;  1ZQT A;  3CNH A;  3OHA A;  2XO7 A;  4C8O A;  2NV3 A;  2ZJA A;  2C22 A;  3WKB A;  1S76 D;  1WWU A;  2QB0 A;  3QUQ A;  3UMB A;  5KG3 A;  5J0Y A;  3IM1 A;  2KG5 A;  4I2H A;  8ICS A;  5KAF U;  4DS5 A;  4X5V A;  4KN4 A;  4ECR A;  5DLF A;  1U48 A;  4ECS A;  7ICV A;  3NRW A;  5KFY A;  3E58 A;  2J6T A;  4PHA A;  1B22 A;  1KLN A;  4Q8E A;  1NI3 A;  2PI4 A;  4Q44 A;  4EBE A;  4JV0 A;  2NRT A;  3SMV A;  3PZP A;  3T5H A;  2B0C A;  2PKE A;  5HMM A;  1F5S A;  2GOL A;  5T14 A;  3H8M A;  5L1K A;  5K4L A;  5ALU A;  1RM6 C;  1FEZ A;  1S0V A;  3J81 j;  4C4S A;  2JMG A;  5KFW A;  1B4F A;  4B9M A;  4KLE A;  1U45 A;  3I28 A;  3TAR A;  1UT8 A;  1D8B A;  5IIN A;  3F5A A;  4KX3 A;  4XQ8 A;  2F1H A;  3ZDA A;  2ZXI A;  1YZ6 A;  4IRK A;  4KLM A;  5AKZ A;  1ZQS A;  4PHD A;  4RQM A;  4MFC A;  1N63 A;  4PZO A;  3E0F A;  3Q8P B;  5KFT A;  1GO3 F;  1T8E A;  1KDH A;  5J29 A;  2DF4 B;  4OJP A;  4RQ6 A;  4QZC A;  2HBK A;  3KFU F;  5AM5 A;  4UB1 A;  1PK1 A;  4ECX A;  3H0R B;  2YMM A;  3PML A;  1SXE A;  2LI6 A;  5J0X A;  1ZD4 A;  4O9M A;  3C28 A;  2WB1 F;  3JPP A;  4I2C A;  2HDO A;  2G09 A;  4DWI A;  4RNO A;  4UB5 A;  4P4O A;  4F4K A;  4PGY A;  1N56 A;  4J9K A;  1J2N A;  1TAQ A;  3QU7 A;  5AI5 A;  1SL2 A;  3NVY A;  3U26 A;  8ICV A;  1OW5 A;  1L3V A;  3RJJ A;  3HKZ C;  3I1Y A;  5J2K A;  4RPX A;  2IA6 A;  2BPG A;  8ICK A;  4EEY A;  1QH9 A;  3CYM A;  4QNL A;  3BQ7 A;  3T5J A;  5ALZ A;  3RB6 A;  1TKD A;  3F2B A;  4B9L A;  2NRZ A;  2P6U A;  8ICR A;  3M7D A;  5ALP A;  3VC8 A;  1NZP A;  5ALW A;  1UA0 A;  4KLD A;  1ARO P;  5BOM A;  1OUQ A;  5AM0 A;  4DL5 A;  1URJ A;  5IIO A;  2OH2 A;  1DK2 A;  1SV4 A;  4AP9 A;  3GV7 B;  1KTQ A;  2OXO A;  2FLN A;  4FBU A;  3A0B U;  4DOC A;  5AI8 A;  4RT2 A;  3SV4 A;  5J0T A;  1O03 A;  3QE9 Y;  3HPO A;  4DQP A;  4ED7 A;  1Y88 A;  2K4H A;  5DB6 A;  3SI8 A;  2XGP A;  2RRD A;  4JV1 A;  1ZQG A;  2FMP A;  4M04 A;  1BNO A;  2NO5 A;  1JRO A;  4TUR A;  3TFR A;  1V9P A;  4I2D A;  2PMZ C;  2W9B B;  4IQW A;  2ZG6 A;  4ICA A;  3OSP A;  4ECV A;  4F4X A;  3LVW A;  1ZQM A;  4C8M A;  1UPH A;  4RU9 A;  5J0P A;  2HOI A;  4F2R A;  3RRH A;  2E8O A;  1WUD A;  4IQT A;  2ZIU B;  3UQ0 A;  4ZH4 A;  1XSL A;  4QWA A;  2K89 A;  2EDU A;  5KNI A;  1L5U A;  4HAI A;  1BPD A;  3HJE A;  4XUS A;  5J2C A;  2XID A;  1MQ3 A;  3RJF A;  4Y2U A;  3PV8 A;  2ZTD A;  2FDR A;  1KKX A;  4I2F A;  5KG4 A;  3PR4 A;  1TK8 A;  2ESE A;  4BX9 C;  1TVA A;  1NK7 A;  3N7R C;  5DQI A;  4TUQ A;  1CI4 A;  3DEE A;  3H0M B;  2HSZ A;  3MBY A;  4I29 A;  1XO0 A;  4QIW F;  2G0A A;  4F4W A;  7ICK A;  3AU2 A;  2AQ0 A;  1TAM A;  2JV3 A;  1MQ2 A;  7ICM A;  3UMG A;  1ZQH A;  7ICE A;  3D2Q A;  3M8R A;  2ALZ A;  2QAR A;  4DL4 A;  3ISC A;  3RJI A;  2YN4 A;  4FZN A;  1WCL A;  2G06 A;  5KL1 B;  3IP4 B;  1JAL A;  2I6X A;  4FZM A;  2OYY A;  4IR1 A;  5KT3 A;  3C21 A;  4IL6 U;  3EPG A;  5DQH A;  2YB1 A;  4UBB A;  5AKE A;  4GC7 A;  2AGQ A;  7ICF A;  4KTQ A;  4YMM A;  4CNQ A;  2HOQ A;  5ALM A;  5KT5 A;  2JGA A;  3SR6 A;  2HBJ A;  5J2H A;  4XA5 A;  2Y9T A;  2K4P A;  5KG1 A;  3MFI A;  4F93 B;  4Z6D A;  3WKA A;  3NVW A;  4Y2R A;  3BJY A;  5A0L A;  1LKY A;  2E3T A;  1NJX A;  1F44 A;  3IHQ B;  4Q8F A;  3RAQ A;  1EXN A;  4ED1 A;  4I2G A;  1L7O A;  9ICN A;  4CDG A;  2HCF A;  4FE3 A;  3KHH A;  3WKC A;  3FM9 A;  3PW2 A;  4F71 A;  7ICQ A;  3RR7 A;  2XY6 A;  2KFN A;  5BPC A;  3H4B A;  3ETR A;  2W9C B;  2JR5 A;  3AEV A;  5DKW A;  1NJY A;  1XU4 A;  3HX0 A;  9ICB A;  4C0Z A;  1L8L A;  4OJ6 A;  4J9P A;  1L7M A;  4UB2 A;  2YMQ A;  2DFL A;  3OJU A;  1QCK A;  2KHV A;  3BQT A;  4UB6 U;  1ZRN A;  4O5E A;  4MF8 A;  4O3O A;  1ZQV A;  4RQ4 A;  4LVS A;  4B9V A;  1SKS A;  2KVC A;  2OEH A;  3DV9 A;  5HR7 A;  3F5E A;  1T3Q A;  5KFN A;  4DSI A;  1H38 A;  2BCS A;  5L1L A;  4F50 A;  2EAM A;  3QX7 A;  3LWM A;  2J6S A;  4YD1 A;  1RZT A;  3QYP A;  1DXS A;  3IDW A;  3GZF A;  3N7P D;  1ZQO A;  3QZ8 A;  3GV5 B;  8ICO A;  3IG5 A;  4KLQ A;  2F1I A;  5AIC A;  4YXM A;  3QUC A;  5KT2 A;  3JPT A;  5DDM A;  1N48 A;  4UAR A;  1ZQF A;  2XY7 A;  4GLX A;  2G07 A;  2XCP A;  4O0I A;  2DWQ A;  3OHB A;  2W8K A;  2J6U A;  9ICQ A;  4YQW A;  2AGO A;  3HW8 A;  2ATL A;  4F5Q A;  2XI9 A;  3KZX A;  5DB8 A;  3RBD A;  2FE9 A;  4FO6 A;  4PH5 A;  2WAQ F;  3C2M A;  5CB1 A;  5KFF A;  3WK4 A;  4CRX A;  3TKA A;  2ASL A;  4J9N A;  3C29 A;  2KD1 A;  2P35 A;  4NM2 A;  1Z00 A;  5AIA A;  5KFE A;  4R63 A;  4RQ0 A;  2LYB A;  5KFJ A;  5G5H A;  4C4T A;  1KEJ A;  2HMX A;  2EZZ A;  5DDY A;  1QQ7 A;  2AGP A;  2BPF A;  1SZP A;  1TK5 A;  4K4G A;  4M6W B;  2AU0 A;  4DOB A;  2R8I A;  4JWN A;  7ICI A;  9ICK A;  5TZV A;  3ZD9 A;  3H8S A;  1A77 A;  2ZTC A;  2EH9 A;  3LVV A;  2XVT A;  4UAU A;  1BPY A;  3SAH A;  2HHU A;  3TFS A;  3OSN A;  4OO1 J;  4EBC A;  5GTH U;  4C8L A;  4KIT B;  4QZA A;  3JPN A;  3KHL A;  4C7Y A;  4M0A A;  4UAW A;  4DQQ A;  2DL0 A;  3IG8 A;  1NZB A;  2PFP A;  3AN1 A;  2ZIV A;  2BQU A;  3HIL A;  2I9G A;  1QTM A;  2W55 A;  2MSN A;  4LJX A;  4UQG A;  5AKY A;  1ZQL A;  3UPQ A;  5EE1 A;  2HVH A;  5H2F U;  2F76 X;  3RJK A;  2W03 A;  1ZD2 P;  4R66 A;  8ICJ A;  2G5H B;  5KFC A;  3NS1 A;  2HOF A;  1S9F A;  1BPZ A;  5C0Y A;  5ALQ A;  4B9T A;  1P7D A;  2G08 A;  2H3I A;  5KFL A;  4F72 A;  3HT3 A;  3UMC A;  2ZJ8 A;  3SYZ A;  2ISP A;  2R8H A;  4GXK A;  1SB3 C;  2W04 A;  1PZN A;  3MR3 A;  2ZUC A;  5KFQ A;  1Q3V A;  3H7I A;  4O5K A;  3RB4 A;  2F44 A;  5ALL A;  5L1J A;  4Z6E A;  5IIK A;  3QU9 A;  4R8U B;  3QU4 A;  2Y0S F;  3M6Z A;  1Z4O A;  1AQ6 A;  3M8S A;  3TI0 A;  2BR0 A;  3C1Y A;  5DG7 A;  3UXO A;  4BGD A;  2B21 A;  1ZQN A;  2ASD A;  1YZ7 A;  3T3F A;  3BS5 B;  3M9N B;  3NGD A;  1U4B A;  3BZC A;  3UM9 A;  4UB3 A;  4A8E A;  2A19 A;  2K4E A;  4DQR A;  2HW3 A;  1IV8 A;  2NRV A;  4KMO B;  1KN5 A;  2GH1 A;  4M9H A;  3H4D A;  4MFF A;  3TAC B;  5JRT A;  1BVS A;  2W43 A;  2BCQ A;  2FLP A;  4ECQ A;  3C5F A;  2BKE A;  3PX4 A;  1SL0 A;  1ZQ1 C;  3FC4 A;  9ICH A;  1X42 A;  4U6P A;  5KTQ A;  2ODG A;  1RYR A;  4QWD A;  4IR9 A;  5AM3 A;  3PO5 A;  1X9X A;  1JRP A;  4QZI A;  3PSF A;  3NVV A;  2XIC A;  4ED0 A;  2AQ4 A;  2Y1I A;  4DS4 A;  3SAG A;  2E1E A;  2F8K A;  2KNJ A;  5KFO A;  3MR6 A;  2N1R A;  4USA A;  4J9M A;  2VA3 A;  1UA1 A;  4RUA A;  2QKQ A;  1IXR A;  2JRZ A;  4YMO A;  4P0Q A;  4CF4 A;  3GIL A;  3OPX A;  7ICN A;  8ICW A;  2A3V A;  3WK6 A;  1ZQY A;  2VA2 A;  1LB2 B;  3MR2 A;  5L9X A;  2D3D A;  3T5K A;  1J97 A;  2E5S A;  1NK5 A;  5ALR A;  2HVI A;  1V97 A;  2C2E A;  1TFR A;  4DEZ A;  4I2B A;  4F5R A;  1X66 A;  5KFI A;  4ED2 A;  2UVR A;  2IOH A;  1VDV A;  2JZB B;  1IM4 A;  3EUB 2;  5ALI A;  4BXO B;  5IIM A;  3VCB A;  4DSK A;  2ZUD A;  4IC9 A;  2W54 A;  4QWE A;  5J0R A;  5ALH A;  4JV2 A;  4YP3 A;  4JK1 A;  1S8O A;  3G6X A;  2Z7J A;  1PVP A;  4UAS A;  2E8N A;  3PST A;  5JUM A;  3RH5 A;  4DLG A;  1ZQW A;  3NUQ A;  3NVZ A;  5EWF A;  5HR6 A;  2EAN A;  9ICI A;  4KX5 A;  4NLC A;  1NK4 A;  2Q4T A;  2FPK A;  2ZIX B;  4AYB C;  3AU6 A;  3ONN A;  4GIB A;  1WG8 A;  5KFP A;  3QU2 A;  1SKW A;  3RJG A;  4M2Y A;  4I2I A;  2ZTE A;  2R8K A;  2BQR A;  2DQN B;  4YG2 A;  1T3N A;  5EWG A;  4PL1 A;  3ZDD A;  3I76 A;  2M9N A;  2VKQ A;  2KEY A;  9ICL A;  4CF5 A;  2EZX A;  3SD7 A;  2F77 X;  2DBY A;  2KVS A;  1HEK A;  5CA7 A;  3LWL A;  2PFN A;  4R64 A;  4ED6 A;  3D6J A;  1ZQA A;  3OJS A;  1N62 A;  2ZXH A;  2IMW P;  3PMN A;  1ED1 A;  1ZQC A;  9ICF A;  1BPE A;  9ICW A;  3N28 A;  3MR5 A;  4O3Q A;  2NO4 A;  3QNM A;  4QZD A;  3SZ2 A;  1PVQ A;  3NAS A;  2HHQ A;  4DFJ A;  8ICU A;  4F92 B;  2GO7 A;  4PJ0 U;  1RPL A;  2C28 A;  5KFA A;  4FBT A;  8ICZ A;  4K4I A;  3K1Z A;  7ICG A;  1IG6 A;  1TE2 A;  5EOZ A;  8ICG A;  4DSE A;  2D6F C;  2A1J B;  3M6K A;  1QSS A;  1JXE A;  4QWB A;  3N4M B;  4YR3 A;  4RUC A;  2ZUB A;  3PNC A;  3EZ5 A;  4KLT A;  2KSO B;  3OTQ A;  4NV0 A;  1CEZ A;  5AKG A;  1DOQ A;  2MRL A;  2Y1J A;  2JEG A;  1RYS A;  5ALO A;  4DOA A;  4P0P B;  4EEL A;  2IOF A;  2BCV A;  1JUD A;  1TAU A;  9ICS A;  3Q8K A;  2HHX A;  3RB3 A;  2JEF A;  1B0X A;  1RYU A;  5DG9 A;  1NKC A;  4DF8 A;  5ALE A;  3KHR A;  2JH7 A;  1Q3U A;  4Q43 A;  1KRP A;  3V7L A;  3C5G A;  3AQE A;  3ZDB A;  4MFA A;  2VIX A;  2JHD A;  4DFM A;  1A76 A;  2WF5 A;  5KFV A;  1UHU A;  4JMU A;  4QZH A;  2BCU A;  5F9N A;  2KTQ A;  4PGX A;  2ISO A;  3PW4 A;  2YQE A;  3F53 A;  1PK3 A;  4KLF A;  9ICX A;  9ICG A;  2ZJ5 A;  3JPR A;  5FP0 A;  5KFB A;  3QUT A;  3Q8M A;  4BWM A;  3A0H U;  2KJ8 A;  5KFX A;  1C7Y A;  3KKA A;  5D4B A;  3MDC A;  4ELU A;  4NLZ A;  2JXJ A;  2ES6 A;  1Z3E B; 
#chains in the Genus database with same CATH homology
 3BQ7 A;  1COK A;  5JU5 A;  2KIV A;  2KE7 A;  1OXJ A;  3BS5 A;  2KMD A;  2QB0 B;  2JV3 A;  3BS5 B;  5L1M A;  1SV0 A;  1UCV A;  2L5Y A;  1V38 A;  1JI7 A;  1V85 A;  3H8M A;  4NL9 A;  2KSO A;  1UQV A;  2QB1 A;  2QAR A;  1B4F A;  2KSO B;  3K1R B;  2QAR B;  2E8N A;  1SV4 A;  3TAC B;  2B6G A;  2DKZ A;  5JRT A;  1SXD A;  5JTI A;  2EAN A;  1Z1V A;  4RQM A;  4PZO A;  1KW4 A;  2DL0 A;  2Y9U A;  1B0X A;  3BS7 A;  5J8Y C;  3HIL A;  4RQN A;  2EAM A;  2EAO A;  1RG6 A;  4PZN A;  4MHV A;  4NJ8 A;  1DXS A;  2K60 A;  3IDW A;  3SEN A;  2GLE A;  2E8P A;  3SEI A;  1F0M A;  1X9X A;  1PK1 A;  2LMR A;  1PK1 B;  2Y9T A;  3TAD C;  1SXE A;  2K4P A;  2DKX A;  2F8K A;  2F3N A;  2QKQ A;  1LKY A;  2E8O A;  5J8Y A;  2EAP A;  1SGG A;  1LKY B;  1WWV A;  1PK3 A;  5F3X B;  2LPE A;  1WWU A;  2QB0 A;  4IS7 A;  1X40 A;  2YTU A;  5KNI A;  1SV0 C;  2FE9 A;  2E8M A;  2F44 A;  3KKA C;  2D3D A;  1OW5 A;  4NL9 C;  3TAD A;  2KG5 A;  3KKA A;  2ESE A;  2D8C A;  2ES6 A;  1X66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...