4RQNA

Crystal structure of the native bicc1 sam domain r924e mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
b'SDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISELNKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein bicaudal C homolog 1
publication title Characterization of the SAM Domain of BICC1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4rqnA01
1LKYA 4PZOA 1UQVA 2LMRA 5F3XB 1UCVA 2DKZA 2F3NA 1B0XA 2Y9TA 1X9XA 5J8YC 3BS5B 5JU5A 5J8YA 1X40A 2YTUA 4PZNA 1OW5A 2QKQA 4RQMA 3HILA 2Y9UA 1Z1VA 2FE9A 2K4PA 4NL9C 1SV0A 2QB0B 2ESEA 4NL9A 1SGGA 4NJ8A 5KNIA 2B6GA 1V38A 1V85A 3KKAA 3SEIA 4RQNA 2EANA 2F44A 4IS7A 1LKYB 2KSOA 1SV4A 1X66A 2E8PA 1SV0C 1SXDA 3SENA 3BQ7A 2QARA 1RG6A 2KSOB 2EAPA 1OXJA 2JV3A 1WWUA 2KMDA 2L5YA 5JRTA 2EAMA 3TACB 3KKAC 1JI7A 3K1RB 1PK1A 1B4FA 2D3DA 4MHVA 2GLEA 1SXEA 2ES6A 5JTIA 2KG5A 1DXSA 2DKXA 1KW4A 5L1MA 3BS5A 1PK3A 2LPEA 1F0MA 2E8NA 3H8MA 2D8CA 2DL0A 2KE7A 3BS7A 1WWVA 2KIVA 3TADC 2QARB 3TADA 2QB0A 2QB1A 3IDWA 1COKA 2K60A 2E8MA 2F8KA 1PK1B 2EAOA 2E8OA
chains in the Genus database with same CATH superfamily
4OJ6A 3ORYA 1PVRA 1TK8A 1SKRA 5IIKA 1TVAA 2W9BA 4ECVA 4BXOB 4G3IA 3GU3A 3BS5B 3A0BU 5IILA 2YTUA 4OO1J 1SKSA 9ICSA 3V6KA 5AK6A 4F71A 5J2AA 5EWFA 2IHMA 5ALWA 5AKJA 2R8HA 4Y2JA 3PO5A 1SGGA 3UM9A 2F1HA 3JPSA 5AKIA 9ICNA 5ALDA 8ICPA 3T5HA 1SKWA 2P6UA 5J2GA 3H8SA 2KSOA 4M04A 2EH9A 5ALOA 4C8MA 4IL6U 5CP2A 4AYBF 4RQ0A 3TKAA 5J2HA 3QNMA 4ICAA 3NGDA 2I6XA 4DL7A 3OPXA 7ICVA 3KHLA 3WK8A 3G6VA 3QUQA 2WFAA 4DSIA 1ZQNA 5H2FU 2LBOA 3RBEA 8ICZA 2ZUDA 4BWMA 3N7RC 4Y2PA 2JHDA 1IG6A 4P4OA 2Q4TA 3PW7A 2W8KA 1ZQVA 4UBCA 8ICWA 9ICCA 2W9CB 1Z4NA 9ICIA 3N4MB 4DSJA 5GTIU 4J9QA 4U7CA 3HX0A 2YY6A 1K1QA 1U9LA 2E8MA 1QTMA 5CRXA 4RNMA 2W3SA 4ECSA 4B6JA 2J6TA 2YMMA 5DB9A 1S0NA 4O3SA 1B22A 5AK3A 4RUAA 2A19A 1YZ7A 2ZUBA 2DUYA 3RJHA 4M9HA 5ALSA 4NL9A 4QNLA 2C2RA 9ICKA 4B9LA 4ED3A 1ZQBA 4NLCA 1NKCA 3F5AA 4EELA 4TUPA 1V85A 4PL1A 3AL0B 5GTHU 1K1SA 3EPIA 1L8OA 2ZG6A 5EE3A 1A76A 2FMPA 2G09A 2W9BB 1QCKA 4PH5A 5KFLA 1ED1A 9ICRA 4UB6U 1NKBA 4QWBA 5DKWA 2ASDA 2W7PA 3PSTA 3HP6A 2D3DA 1JALA 2IOFK 4US8A 1ZQSA 3EW9A 2RQ5A 5ALNA 4JV0A 3OSPA 3ED5A 3KHHA 2E3TA 5EE0A 3KTQA 5AM1A 4FO6A 2LYHA 3OTQA 4ED7A 1MQ3A 2K4EA 5KG2A 4F2RA 2QB0A 5DBBA 2YN4A 4JMUA 2I1QA 3D2SA 5KFOA 3GZFA 5AI5A 5AM2A 2K60A 3MR3A 5DB7A 2Y1IA 2Z7JA 1XS9D 4RQ4A 3QU5A 4DLEA 5DB8A 4F4YA 1WG8A 2LMRA 2PKEA 2P66A 2DPJA 2F3NA 2HHSA 9ICBA 3DDHA 1D8LA 4J03A 4YP3A 4F50A 3JPNA 2KFNA 2HBMA 4FS1A 3PV8A 2LHTA 1SV0A 4E0DA 4KLQA 4O3OA 2C28A 2B6GA 2VA2A 2HHVA 2I5HA 4ECUA 5KFJA 4AYBC 1ZD5A 4F72A 5IINA 5ALUA 5ALQA 3ZDDA 1Q3VA 4IRKA 4QZEA 1DGSA 2YQEA 4C8NA 4XUSA 2HVIA 4UAWA 4J9MA 7ICIA 4EEKA 3IG5A 2KFZA 1SL0A 5EOZA 1CUKA 4YR0A 3Q8PB 1QQ5A 7ICLA 3T5KA 1BNPA 2XCAA 5KFAA 3UXPA 3RR7A 3K1RB 2JEFA 1RDFA 3AEVA 3TARA 2YMPA 3GIIA 4M47A 5J0WA 1DXSA 3BZKA 2ODGA 2R8GA 1JRPA 3TI0A 3BQ1A 1DRGA 1X9SA 2A1AA 2D8CA 4M9GA 3THVA 3PZPA 5KFKA 3FM9A 4EZ9A 8ICJA 2VANA 2V9WA 2HMXA 2EZZA 3H8JA 3MC1A 5KFNA 4CNQA 4O9MA 2XY5A 3PW2A 1XWLA 1M6YA 3DV9A 1N62A 2HHUA 4KLHA 9ICXA 2YX8A 3WK4A 2G07A 5ALPA 1ZQAA 1L3UA 5J0UA 4JK1A 4PHPA 1DGJA 3I28A 3G6YA 4KLLA 4KLIA 4B9SA 9ICOA 4CGZA 3A0HU 5DLGA 2PI4A 3QZ8A 3JPOA 1WCLA 2VIXA 1QSYA 1NJXA 2BCSA 4RQ5A 2AGOA 2Q0ZX 1BVSA 4RQ6A 2QB0B 2K4HA 5KFVA 3GQCA 1V97A 4YR2A 1UA1A 2BPFA 3M8RA 1V38A 2BR0A 3KZXA 4F2SA 1LV5A 1WYGA 2ZIVA 3OSNA 1X9MA 3IN5A 2EANA 4C7YA 2IOHA 4F4WA 2KEYA 4FZNA 1RM6C 3L3FX 3NTUA 7ICSA 1NI3A 1SZPA 5KFWA 7ICNA 3BQ7A 4TQSA 7ICGA 1JXLA 4HAIA 2HBLA 3C5GA 2JV3A 2FPKA 3N97B 4ZOHC 1XSPA 3AQEA 1XSNA 4YD1A 3SAGA 3T5JA 2MU2A 1ZQYA 4YG2A 4LVSA 5J0YA 1BNOA 1Q46A 4DQIA 2PFPA 3H0LB 3T79A 2KE7A 3J81j 4C8KA 2PFNA 3ISBA 2DWQA 1ZQQA 4I2JA 5HMMA 3UPQA 5CB1A 3M9NB 1MQ2A 2A1JB 3PY8A 3BQTA 8ICFA 3MGVA 1UT8A 4KLTA 4DQQA 1PVQA 2OH2A 1X6IA 3QYPA 2FLLA 4BX9C 4US9A 2ZIWA 2WHEA 3C21A 1X9XA 4OJ5A 5JU5A 3JPRA 4RPYA 4F4XA 4DLGA 3C29A 1H38A 3QX7A 3PMNA 4NL9C 4CF3A 2EQYA 2AH5A 2BDPA 3AQFA 4I28A 5KNIA 3M7DA 3HT3A 4DS4A 1X9WA 1BPYA 2HDOA 2NV3A 1N60A 5AM0A 3KKAA 3QU4A 2W11A 3CNHA 3ETRA 1S8OA 4UB4A 9ICWA 1X66A 4MFFA 2GO7A 3AUOA 2XC9A 3TANA 4MEXA 3AN1A 2E8PA 4KLDA 5F9LA 2JEIA 4DL3A 3KD3A 2YMLA 4QZDA 3SV3A 4J9RA 1RG6A 8ICMA 1A77A 5CHGA 2EAMA 8ICNA 5G5HA 2ATLA 2MUTA 1NNLA 4J9PA 5AM5A 5DBAA 4Y2QA 3RRGA 1B4FA 7ICPA 2ZIVB 5KFMA 3H4BA 1T8EA 2KZZA 1Z1BA 4DOAA 4DL4A 2ZTDA 4NY8A 2E8NA 4IQVA 5J2FA 1DK3A 1TK5A 3BS7A 5DG7A 1U4BA 2C2DA 5FP0A 1IXRA 2B21A 4I29A 2DQNB 3TADA 2AXTU 2K8AA 2KTQA 4OJLA 3NUQA 2ZIXA 4DEZA 1XO0A 5C0YA 5B66U 2J6UA 8ICTA 1ZXIA 4C8OA 4YMOA 1WCNA 1HEKA 3NVYA 1HUOA 2KIWA 3RJIA 1L3VA 2BCQA 3UMCA 4K4HA 2Y9TA 3RFAA 5KFSA 2FPMA 4F5QA 3WKEA 2Y9UA 2IA6A 2WF8A 7ICKA 2P35A 4Y2SA 2BCVA 4DSEA 4C80A 1D8YA 2G08A 4EBEA 3WKDA 1NJWA 4O5KA 5KFBA 2MRLA 4KN7A 1UHUA 2WAQF 2F77X 2W3RA 3CP8A 1O03A 4QWAA 2VA8A 2WB1C 1Q8KA 1SV4A 2ZIWB 4Q43A 5KFHA 3L5KA 3IV6A 7ICEA 1ZQOA 4J9NA 2H3IA 3PW0A 2FLNA 3I1YA 5F9NA 1OXJA 8ICKA 3BQ0A 2AQ0A 5DDMA 4ED0A 4PGXA 1A0PA 2AJQA 1DOQA 4LZGA 8ICOA 2F1IA 3JPPA 2XY6A 3EPGA 5AK4A 2VA3A 4EX6A 2IMWP 3PX4A 4EYHB 4WJ3B 1JX4A 5ALLA 5AI8A 4NLZA 2XCPA 1TE2A 2M0NA 1LB2B 4Q44A 2M9NA 3E0FA 1S77D 1SB3C 4C7ZA 3Q8RB 5J2IA 5B5EU 2KN7A 4OCZA 2ALZA 2ASJA 4QWDA 3IDWA 4DL6A 4UB8U 4QZ9A 1RYRA 1NK8A 4C8LA 3H0MB 2XICA 5J0QA 2MUTB 3QUCA 3GV8B 2EAOA 4OJPA 3PSPA 5IIOA 7ICTA 4Y2YA 4IRDA 3U26A 4DSFA 3ZI4A 1RZTA 4YMMA 4EYIB 1OW5A 4O3MA 3S6JA 3IP4B 4J9OA 1DK2A 3RTVA 3BJYA 1ZQHA 3H40A 8ICQA 3OHBA 2KZ3A 2ZIXB 5J2JA 2JH1A 5CJ7A 3T3FA 2CRXA 4YMNA 4QIWC 2XY7A 2WF6A 4X5VA 8ICXA 4NLKA 2DF4B 4GC7A 5ALVA 4IS7A 3PX0A 4FZLA 3V7JA 2HHQA 3HPOA 3ICXA 3RH5A 2ZIUA 4RUCA 2K89A 3PW4A 2HW3A 1IIPA 1SWWA 2QARA 5EE1A 1S5LU 5C5JA 1ZD3A 7ICUA 5ALXA 2L5YA 4IRCA 2F2AB 4G9BA 2WF7A 1PK1A 3H0RB 3FC4A 8ICYA 1A6SA 2KJ5A 1KW4A 3RBDA 4OD0A 4RQ7A 3RB0A 4O5CA 1L8LA 1XNSA 2KIVA 5AK5A 2BPCA 3LK9A 1S10A 1UPHA 3UXOA 4UB2A 5KT7A 2IOFA 4DL2A 3HKZC 1D9FA 4Q8EA 2PXIA 2C2EA 4RU9A 3QUTA 1BPXA 4DQPA 4DSKA 2ZJ8A 3M9OB 1ZQJA 3RJFA 4ECRA 2OYYA 2RDIA 1NK5A 2HVHA 4RQ1A 4O5EA 4IQUA 4I2HA 5AKZA 4DSLA 2LYAA 5DG8A 1S0MA 4JV1A 4PZNA 2YB4A 4KLEA 3WK7A 2EDUA 3LWMA 4MFAA 2WAQC 5K4LA 2K8BB 3ZD8A 4UAYA 3UQ2A 3SI8A 5J2KA 2HOQA 1ZD2P 3SMVA 2UVWA 4GC6A 3G6XA 4BJQA 5BPCA 2W04A 4NV0A 1RQLA 3B9JA 2VKQA 4GXJA 4Y2VA 1L5UA 3IG8A 1NKEA 2OWOA 3E2EA 3MGIA 4RQ2A 4UAUA 5AI4A 4GIBA 3PNCA 3RH6A 8ICIA 1RPLA 1QQ6A 5AI0A 4PHEA 3PVXA 4C0ZA 5JTIA 4EBDA 3O0FA 4QZFA 2PFOA 1ZQ1C 1X42A 2DL0A 2ZIUB 4Y2XA 2YMQA 4KLOA 2A1JA 1D8BA 3TADC 1RYSA 2BHNA 1Y88A 5KFUA 2QARB 3FAHA 1ZQXA 2KV2A 1ZRNA 2MSNA 3ISDA 5KG5A 2DFLA 4UB3A 4I2BA 4KLSA 4ECZA 9ICPA 1PK1B 2ZXHA 1QLNA 3KHGA 2KHQA 5KFZA 2Y0SF 1ZQEA 8ICSA 4FBUA 3WKCA 1F44A 1NK9A 9ICHA 2QKQA 5HNKA 3PR5B 3QE9Y 2NRVA 3HILA 4UW9A 4DCCA 3AMZA 1Z1VA 5KT5A 9ICLA 5DQHA 4QZCA 5D46A 5KFTA 1KFTA 9ICAA 2UVRA 2KHVA 1QSSA 3FYHA 1Z3EB 3UMGA 4UARA 1C20A 4O3PA 3SD7A 1KL9A 5J0XA 5KFPA 1ZQUA 4NM1A 4CE6A 2JEGA 4JB3A 3AU2A 4YCXA 2F44A 4XA5A 5AM3A 2Y1JA 2NRTA 1SZHA 4QWCA 1ZQTA 4NLNA 2H3ZA 4Z6CA 1JXEA 4GXIA 4ZH4A 4KMOB 1BPDA 4I2AA 1D9DA 5KFGA 4NWIA 1N2XA 3MR5A 3EWAA 5J2EA 5HP4A 5TZVA 2BKEA 3GIMA 4MHVA 5D49A 3NRWA 4KX5A 3GILA 9ICTA 4TURA 1FEZA 2V4QA 4PGQA 8ICBA 3ISCA 3NASA 5AIBA 3ZDBA 5L1MA 2D6FC 7ICOA 2WF9A 3GFKB 4ED1A 3V6JA 5KT2A 1PVPA 2WB1F 1NK0A 2RP5A 1EXNA 3BZCA 4I2EA 4R65A 1HUZA 4KN4A 4I2CA 2JXJA 3KFUF 2WTFA 2EZXA 1UA0A 1FFUA 4ED2A 1RYUA 3K4GA 2C22A 1KRPA 4ECYA 1NOMA 1JN3A 2G06A 2BQ3A 1KFSA 1KN5A 3WK9A 7ICFA 4QW9A 5J29A 1QH9A 1HJPA 2R8KA 2F1JA 8ICRA 3RJJA 1S76D 4CCHA 4RNOA 3JPTA 1B43A 4Q45A 3D2QA 5AKEA 5IIIA 4NM2A 4QW8A 1J97A 2H3QA 4I2IA 3H8WA 1NK4A 4P4PA 1U49A 5ALFA 3SAFA 3SQIA 1PZNA 3Q8MA 1SWVA 1ZYQA 2EAPA 3ALRA 3R9KA 3QXGA 4RNNA 3BQ2A 1BPEA 4FFDA 1T94A 4PGYA 2KJ8A 1TAMA 1CRXA 3RB3A 2W9AA 4DF8A 5AKYA 5KT3A 4QZHA 5KG7A 2R8IA 2HHTA 1SXEA 2ES6A 2V4RA 4XQ8A 1U47A 2K4IA 2XVTA 5ALMA 4Z6FA 1ZQDA 4QIWF 1ZQPA 3N28A 3GDXA 5AKKA 3WK6A 3RF9A 3F2BA 1NZPA 4DF4A 2HBKA 3FDSA 1TAUA 3QUBA 4U6PA 1VLBA 3F53A 3QU7A 2Y0SC 1FIQA 3OJSA 4I27A 2PMZC 1URJA 5AKXA 2HSZA 1PUZA 4NLGA 4C4TA 4O3NA 1LKYA 3ETLA 4CRXA 4GXKA 3Q8SB 4CDGA 2LYBA 3QU2A 3WKBA 3C1ZA 5J8YA 5DLFA 4KLUA 4UAZA 2MAXA 3IRUA 4P4MA 2ZUCA 3C5FA 5J0OA 4YN4A 2JEJA 5ALEA 2K4PA 2LM1A 2HOIA 4MF8A 1IV8A 9ICFA 3IM1A 4RQ8A 3HKZF 4R8UA 1ZQWA 4JUZA 2AU0A 2JMGA 4RT3A 3D6JA 9ICUA 4DO9A 4DOBA 2KK0A 4IR1A 5KL1B 2DPIA 3GV7B 3K75D 4F3OA 2KJ9A 1T3QA 1T7PA 1SV0C 2GOLA 5D4BA 3PSFA 4UB5A 3RAXA 2GWSA 2WF5A 3H4DA 2FMSA 3RJGA 2FDRA 4BWJA 4GLXA 2E1EA 4ELUA 3C1YA 1JI7A 3PO4A 5KG0A 1RQNA 5L1IA 2W03A 3UQ0A 2ASLA 5AM4A 1S9FA 2ISOA 4ECQA 1XO1A 3MDCA 1SIJA 2LI6A 2XGQA 2R18A 4IC9A 3LDAA 2O6KA 1FO4A 4UQGA 3TAQA 2HOFA 2FI1A 3WU2U 4RPXA 1MN8A 3UXNA 5CWRA 1TAQA 1CEZA 3C28A 2HBJA 3MBYA 1X2IA 4KITB 1RXWA 4QZAA 4MF2A 2W43A 4B9UA 2AGPA 4HYKA 1CI4A 3GIKA 4TUQA 2BQRA 2BPGA 1NK7A 1N5WA 3K1ZA 4IR9A 4PZOA 1UQVA 2KKPA 3CW2C 1N61A 2KVCA 4LZDA 4CF4A 1KEJA 1X40A 3F5EA 5J0PA 4RT2A 1NJZA 2BQUA 4P2HA 3Q8QB 1SL2A 1MC8A 2ESEA 5HR7A 1ZD4A 1ZETA 1BPZA 4DQRA 3TQ1A 2W9MA 2HHWA 2OM6A 1GO3F 4ACOA 4IQWA 2RRDA 4DFKA 1QSLA 3SZ2A 9ICJA 3SEIA 1S0VA 1LKYB 1F5SA 1NK6A 5KFDA 3EYZA 4YQWA 4I2GA 3MGHA 4KX3A 1ZJNA 4J9LA 8ICAA 5KG4A 5DGAA 5CR0A 1KQQA 3QU9A 4O3RA 7ICJA 4Q8FA 8ICGA 3LWLA 4F4KA 1TK0A 1N56A 3NVZA 3SV4A 4Y2TA 5EWGA 4YXMA 4OJOA 1L7NA 4R8UB 3RH4A 7ICQA 8ICVA 5HHHA 2KD1A 2ISPA 2NO5A 4TUSA 4DFJA 5J2DA 3ZDAA 3N7PD 2I9GA 1L6NA 5BOMA 5KFEA 3LVWA 3IHQB 5AI9A 4Z6EA 2IBKA 1V9PA 4C4RA 2AQ4A 1VJ5A 4K4IA 1JIHA 2PI5A 4FS2A 2HHXA 2KICA 4NXZA 1ZQIA 4JV2A 4YD2A 3SR6A 1S0OA 2R8JA 4KLFA 1Z00A 9ICGA 3MR2A 5IIMA 5BOLA 9ICVA 4ECWA 3RJKA 1QQ7A 2OXOA 4B9MA 4RQMA 2NRZA 2BGWA 3M6KA 4F5NA 4Z6DA 3TFSA 4EBCA 4ELVA 2AHOB 4PL2A 2P6RA 2CPRA 5DQGA 5J2CA 1KTQA 2G5IB 1T4GA 4B9VA 2EZYA 2KOBA 2H3VA 5KFXA 4DFDA 4ED6A 2LM4A 4JWMA 2PFQA 4DQSA 3NVVA 3Q8KA 4QZ8A 2UVVA 2W54A 4FBTA 2RDJA 1COOA 8ICEA 7ICHA 1KFDA 3V7LA 2OCEA 3VCBA 9ICQA 4M2YA 4QJFB 4YXJA 1KKXA 2KSOB 1K5OA 3VC8A 2JR5A 2IHNA 3OJUA 2VJ5A 2HI0A 4GFJA 5KFFA 1YZ6A 1O08A 8ICHA 3MFHA 1BGXT 3LYSA 2H5XA 3RAQA 3TACB 3SYZA 3KKAC 5AKHA 1ZQCA 3LVVA 1XC9A 1ZOLA 4UB1A 2XGPA 3M6ZA 2F8LA 4TQRA 1JROA 3B0YA 3MABA 2DKXA 5HR6A 5DB6A 2NO4A 4BGDA 4B9TA 2XIDA 7ICRA 1ZQGA 4CF5A 2BDUA 4PHAA 1ZQFA 4PPXA 5KFQA 8ICCA 9ICEA 3OHAA 4DOCA 1U45A 4DFMA 5L9XA 1JMSA 4KMUA 5ALRA 5DG9A 1IM4A 5A0LA 2J6SA 5AKGA 3C2MA 5KT6A 5L1KA 5KFRA 4FE3A 3HJEA 4QZBA 2CN1A 4UASA 2F8KA 5DDYA 5ALHA 2ZJ5A 3PSIA 1T3NA 4RQNA 4YFKA 2OEHA 2FJ6A 2GH1A 4M0AA 2DKZA 1RXVA 2JGAA 1NJYA 5J8YC 5KG6A 1ECWA 4UAVA 4KLMA 1J2MA 4UBBA 4O0IA 2B0CA 1C7YA 5AICA 4J9KA 3C23A 2XO7A 2FLPA 4NJ8A 2KKVA 2RHFA 1JUDA 2UVUA 4JWNA 1L7PA 5TISU 3F2CA 5L1JA 4F4ZA 2PMZF 3V72A 3I76A 3AM9A 4R63A 1Z00B 1KLNA 3PMLA 4I2FA 4Y2RA 1SXDA 5CEHA 5KTQA 1L7MA 2JH7A 2NYVA 3D2NA 5EE9A 1L7OA 2CXYA 2K8CB 5KL8B 1FFVA 1WUDA 3GIJA 1MA7A 1AROP 1ZRMA 7ICMA 4I2DA 3QZ7A 3KHRA 1Q3UA 4F93B 3KOOA 2F76X 3OGUA 1TV9A 3MFIA 2ZXIA 1ZQMA 1LVHA 2LPEA 5AKLA 2AGQA 5DBCA 5T14A 5J0TA 4UATA 3PR4A 4LJXA 3UMBA 3V6HA 3Q8LA 3L4PA 5ALJA 2JZBA 5DQIA 3KZIU 2QB1A 3EUB2 4NLBA 4BDPA 1AQ6A 4EZ6A 1COKA 4EENA 5G5GA 3RRHA 2W8LA 5ALYA 3RB4A 1J2NA 9ICMA 4P0PA 2E8OA 4RZRA 4P0QA 2BCUA 4USAA 3RB6A 1UCVA 5DGBA 2NRXA 4F5RA 3M9MB 3BDPA 5AHXA 3QEAZ 2ZTCA 5AIAA 5EWEA 2JRZA 2LKYA 2A3VA 1TFRA 1L3SA 4FZMA 2RLTA 4F5PA 2FMQA 1L3TA 3H7IA 2DBYA 3NS1A 2H3FA 3RJEA 3JPQA 3M1YA 5L1LA 5ALZA 5AI6A 4M6WA 4MFCA 5KFIA 4IQTA 4QZIA 1ZQLA 2KNJA 2MA1A 2XI9A 4M9NA 4RQ3A 5ALTA 1WWUA 4A8EA 5KG1A 1N48A 5ALGA 3RR8A 5J2BA 5E79U 4F5OA 2VJ4A 1N5XA 3NVWA 2BCRA 2GLEA 1OUQA 5KFCA 4QZGA 5CA7A 2BZFA 3PW5A 1ZQKA 5J0SA 4BXOA 2KP7A 3WK5A 3BS5A 3ZD9A 5KAIU 3WKAA 1F0MA 1ZQZA 3H8MA 3QEBZ 3MR6A 3F2DA 4YVZA 4DL5A 4C4SA 3B0XA 4KTQA 5IIJA 3N7SC 3TAPA 4O3QA 1KDHA 1VDVA 1N63A 3EZ5A 3ZDEA 8ICLA 3CRXA 4XRHA 4F8RA 4B9NA 2ZTEA 4J9SA 1Z4OA 4M9LA 1P7DA 4KLGA 4KLJA 5HMLA 3KBBA 5F3XB 2DGZA 3PX6A 3E58A 3C2KA 2KZMA 1B0XA 5KG3A 2FPLA 4R66A 4ECXA 5ALIA 4F91B 1UT5A 1SL1A 3TFRA 2FE9A 2JZBB 1TKDA 2W7OA 1S97A 2N1RA 4DFPA 3ONNA 5J0RA 2HCFA 1KBUA 2E1FA 4Y2UA 4PJ0U 1U48A 4ECTA 3M8SA 4P0PB 1X6JA 3GV5B 3HWTA 1XSLA 4P0QB 3V7KA 4QWEA 4MEYA 2E5SA 5JUMA 2W9CA 5HHIA 1KSPA 3SENA 3T5LA 1MSWD 3SAHA 3MDAA 1YT3A 2YB1A 4K4GA 4EEYA 2KMDA 5JRTA 4M9JA 4ELTA 4BUGA 5KT4A 1HIWA 2QLTA 4EX7A 2KVSA 4ED8A 4RPZA 2G5HB 2W55A 2KG5A 4F92B 4M6WB 3CYMA 1PK3A 1BPBA 2ZJAA 3ZDCA 2OHFA 5ALKA 1XU4A 3HW8A 4PHDA 1WWVA 4DWIA 4YR3A 1NZBA 1ZQRA 8ICUA 5KAFU 4R64A 2G0AA 5KFYA 3C2LA 3HRDD 3AU6A 2NRWA 1Z19A 4AP9A 3NRZA 1ZJMA 3DEEA 4DS5A
chains in the Genus database with same CATH topology
1LKYA 4PZOA 1UQVA 2LMRA 5F3XB 1UCVA 2DKZA 2F3NA 1B0XA 2Y9TA 1X9XA 5J8YC 3BS5B 5JU5A 5J8YA 1X40A 2YTUA 4PZNA 1OW5A 2QKQA 4RQMA 3HILA 2Y9UA 1Z1VA 2FE9A 2K4PA 4NL9C 1SV0A 2QB0B 2ESEA 4NL9A 1SGGA 4NJ8A 5KNIA 2B6GA 1V38A 1V85A 3KKAA 3SEIA 4RQNA 2EANA 2F44A 4IS7A 1LKYB 2KSOA 1SV4A 1X66A 2E8PA 1SV0C 1SXDA 3SENA 3BQ7A 2QARA 1RG6A 2KSOB 2EAPA 1OXJA 2JV3A 1WWUA 2KMDA 2L5YA 5JRTA 2EAMA 3TACB 3KKAC 1JI7A 3K1RB 1PK1A 1B4FA 2D3DA 4MHVA 2GLEA 1SXEA 2ES6A 5JTIA 2KG5A 1DXSA 2DKXA 1KW4A 5L1MA 3BS5A 1PK3A 2LPEA 1F0MA 2E8NA 3H8MA 2D8CA 2DL0A 2KE7A 3BS7A 1WWVA 2KIVA 3TADC 2QARB 3TADA 2QB0A 2QB1A 3IDWA 1COKA 2K60A 2E8MA 2F8KA 1PK1B 2EAOA 2E8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY A;  4PZO A;  1UQV A;  2LMR A;  5F3X B;  1UCV A;  2DKZ A;  2F3N A;  1B0X A;  2Y9T A;  1X9X A;  5J8Y C;  3BS5 B;  5JU5 A;  5J8Y A;  1X40 A;  2YTU A;  4PZN A;  1OW5 A;  2QKQ A;  4RQM A;  3HIL A;  2Y9U A;  1Z1V A;  2FE9 A;  2K4P A;  4NL9 C;  1SV0 A;  2QB0 B;  2ESE A;  4NL9 A;  1SGG A;  4NJ8 A;  5KNI A;  2B6G A;  1V38 A;  1V85 A;  3KKA A;  3SEI A;  4RQN A;  2EAN A;  2F44 A;  4IS7 A;  1LKY B;  2KSO A;  1SV4 A;  1X66 A;  2E8P A;  1SV0 C;  1SXD A;  3SEN A;  3BQ7 A;  2QAR A;  1RG6 A;  2KSO B;  2EAP A;  1OXJ A;  2JV3 A;  1WWU A;  2KMD A;  2L5Y A;  5JRT A;  2EAM A;  3TAC B;  3KKA C;  1JI7 A;  3K1R B;  1PK1 A;  1B4F A;  2D3D A;  4MHV A;  2GLE A;  1SXE A;  2ES6 A;  5JTI A;  2KG5 A;  1DXS A;  2DKX A;  1KW4 A;  5L1M A;  3BS5 A;  1PK3 A;  2LPE A;  1F0M A;  2E8N A;  3H8M A;  2D8C A;  2DL0 A;  2KE7 A;  3BS7 A;  1WWV A;  2KIV A;  3TAD C;  2QAR B;  3TAD A;  2QB0 A;  2QB1 A;  3IDW A;  1COK A;  2K60 A;  2E8M A;  2F8K A;  1PK1 B;  2EAO A;  2E8O A; 
#chains in the Genus database with same CATH topology
 4OJ6 A;  3ORY A;  1PVR A;  1TK8 A;  1SKR A;  5IIK A;  1TVA A;  2W9B A;  4ECV A;  4BXO B;  4G3I A;  3GU3 A;  3BS5 B;  3A0B U;  5IIL A;  2YTU A;  4OO1 J;  1SKS A;  9ICS A;  3V6K A;  5AK6 A;  4F71 A;  5J2A A;  5EWF A;  2IHM A;  5ALW A;  5AKJ A;  2R8H A;  4Y2J A;  3PO5 A;  1SGG A;  3UM9 A;  2F1H A;  3JPS A;  5AKI A;  9ICN A;  5ALD A;  8ICP A;  3T5H A;  1SKW A;  2P6U A;  5J2G A;  3H8S A;  2KSO A;  4M04 A;  2EH9 A;  5ALO A;  4C8M A;  4IL6 U;  5CP2 A;  4AYB F;  4RQ0 A;  3TKA A;  5J2H A;  3QNM A;  4ICA A;  3NGD A;  2I6X A;  4DL7 A;  3OPX A;  7ICV A;  3KHL A;  3WK8 A;  3G6V A;  3QUQ A;  2WFA A;  4DSI A;  1ZQN A;  5H2F U;  2LBO A;  3RBE A;  8ICZ A;  2ZUD A;  4BWM A;  3N7R C;  4Y2P A;  2JHD A;  1IG6 A;  4P4O A;  2Q4T A;  3PW7 A;  2W8K A;  1ZQV A;  4UBC A;  8ICW A;  9ICC A;  2W9C B;  1Z4N A;  9ICI A;  3N4M B;  4DSJ A;  5GTI U;  4J9Q A;  4U7C A;  3HX0 A;  2YY6 A;  1K1Q A;  1U9L A;  2E8M A;  1QTM A;  5CRX A;  4RNM A;  2W3S A;  4ECS A;  4B6J A;  2J6T A;  2YMM A;  5DB9 A;  1S0N A;  4O3S A;  1B22 A;  5AK3 A;  4RUA A;  2A19 A;  1YZ7 A;  2ZUB A;  2DUY A;  3RJH A;  4M9H A;  5ALS A;  4NL9 A;  4QNL A;  2C2R A;  9ICK A;  4B9L A;  4ED3 A;  1ZQB A;  4NLC A;  1NKC A;  3F5A A;  4EEL A;  4TUP A;  1V85 A;  4PL1 A;  3AL0 B;  5GTH U;  1K1S A;  3EPI A;  1L8O A;  2ZG6 A;  5EE3 A;  1A76 A;  2FMP A;  2G09 A;  2W9B B;  1QCK A;  4PH5 A;  5KFL A;  1ED1 A;  9ICR A;  4UB6 U;  1NKB A;  4QWB A;  5DKW A;  2ASD A;  2W7P A;  3PST A;  3HP6 A;  2D3D A;  1JAL A;  2IOF K;  4US8 A;  1ZQS A;  3EW9 A;  2RQ5 A;  5ALN A;  4JV0 A;  3OSP A;  3ED5 A;  3KHH A;  2E3T A;  5EE0 A;  3KTQ A;  5AM1 A;  4FO6 A;  2LYH A;  3OTQ A;  4ED7 A;  1MQ3 A;  2K4E A;  5KG2 A;  4F2R A;  2QB0 A;  5DBB A;  2YN4 A;  4JMU A;  2I1Q A;  3D2S A;  5KFO A;  3GZF A;  5AI5 A;  5AM2 A;  2K60 A;  3MR3 A;  5DB7 A;  2Y1I A;  2Z7J A;  1XS9 D;  4RQ4 A;  3QU5 A;  4DLE A;  5DB8 A;  4F4Y A;  1WG8 A;  2LMR A;  2PKE A;  2P66 A;  2DPJ A;  2F3N A;  2HHS A;  9ICB A;  3DDH A;  1D8L A;  4J03 A;  4YP3 A;  4F50 A;  3JPN A;  2KFN A;  2HBM A;  4FS1 A;  3PV8 A;  2LHT A;  1SV0 A;  4E0D A;  4KLQ A;  4O3O A;  2C28 A;  2B6G A;  2VA2 A;  2HHV A;  2I5H A;  4ECU A;  5KFJ A;  4AYB C;  1ZD5 A;  4F72 A;  5IIN A;  5ALU A;  5ALQ A;  3ZDD A;  1Q3V A;  4IRK A;  4QZE A;  1DGS A;  2YQE A;  4C8N A;  4XUS A;  2HVI A;  4UAW A;  4J9M A;  7ICI A;  4EEK A;  3IG5 A;  2KFZ A;  1SL0 A;  5EOZ A;  1CUK A;  4YR0 A;  3Q8P B;  1QQ5 A;  7ICL A;  3T5K A;  1BNP A;  2XCA A;  5KFA A;  3UXP A;  3RR7 A;  3K1R B;  2JEF A;  1RDF A;  3AEV A;  3TAR A;  2YMP A;  3GII A;  4M47 A;  5J0W A;  1DXS A;  3BZK A;  2ODG A;  2R8G A;  1JRP A;  3TI0 A;  3BQ1 A;  1DRG A;  1X9S A;  2A1A A;  2D8C A;  4M9G A;  3THV A;  3PZP A;  5KFK A;  3FM9 A;  4EZ9 A;  8ICJ A;  2VAN A;  2V9W A;  2HMX A;  2EZZ A;  3H8J A;  3MC1 A;  5KFN A;  4CNQ A;  4O9M A;  2XY5 A;  3PW2 A;  1XWL A;  1M6Y A;  3DV9 A;  1N62 A;  2HHU A;  4KLH A;  9ICX A;  2YX8 A;  3WK4 A;  2G07 A;  5ALP A;  1ZQA A;  1L3U A;  5J0U A;  4JK1 A;  4PHP A;  1DGJ A;  3I28 A;  3G6Y A;  4KLL A;  4KLI A;  4B9S A;  9ICO A;  4CGZ A;  3A0H U;  5DLG A;  2PI4 A;  3QZ8 A;  3JPO A;  1WCL A;  2VIX A;  1QSY A;  1NJX A;  2BCS A;  4RQ5 A;  2AGO A;  2Q0Z X;  1BVS A;  4RQ6 A;  2QB0 B;  2K4H A;  5KFV A;  3GQC A;  1V97 A;  4YR2 A;  1UA1 A;  2BPF A;  3M8R A;  1V38 A;  2BR0 A;  3KZX A;  4F2S A;  1LV5 A;  1WYG A;  2ZIV A;  3OSN A;  1X9M A;  3IN5 A;  2EAN A;  4C7Y A;  2IOH A;  4F4W A;  2KEY A;  4FZN A;  1RM6 C;  3L3F X;  3NTU A;  7ICS A;  1NI3 A;  1SZP A;  5KFW A;  7ICN A;  3BQ7 A;  4TQS A;  7ICG A;  1JXL A;  4HAI A;  2HBL A;  3C5G A;  2JV3 A;  2FPK A;  3N97 B;  4ZOH C;  1XSP A;  3AQE A;  1XSN A;  4YD1 A;  3SAG A;  3T5J A;  2MU2 A;  1ZQY A;  4YG2 A;  4LVS A;  5J0Y A;  1BNO A;  1Q46 A;  4DQI A;  2PFP A;  3H0L B;  3T79 A;  2KE7 A;  3J81 j;  4C8K A;  2PFN A;  3ISB A;  2DWQ A;  1ZQQ A;  4I2J A;  5HMM A;  3UPQ A;  5CB1 A;  3M9N B;  1MQ2 A;  2A1J B;  3PY8 A;  3BQT A;  8ICF A;  3MGV A;  1UT8 A;  4KLT A;  4DQQ A;  1PVQ A;  2OH2 A;  1X6I A;  3QYP A;  2FLL A;  4BX9 C;  4US9 A;  2ZIW A;  2WHE A;  3C21 A;  1X9X A;  4OJ5 A;  5JU5 A;  3JPR A;  4RPY A;  4F4X A;  4DLG A;  3C29 A;  1H38 A;  3QX7 A;  3PMN A;  4NL9 C;  4CF3 A;  2EQY A;  2AH5 A;  2BDP A;  3AQF A;  4I28 A;  5KNI A;  3M7D A;  3HT3 A;  4DS4 A;  1X9W A;  1BPY A;  2HDO A;  2NV3 A;  1N60 A;  5AM0 A;  3KKA A;  3QU4 A;  2W11 A;  3CNH A;  3ETR A;  1S8O A;  4UB4 A;  9ICW A;  1X66 A;  4MFF A;  2GO7 A;  3AUO A;  2XC9 A;  3TAN A;  4MEX A;  3AN1 A;  2E8P A;  4KLD A;  5F9L A;  2JEI A;  4DL3 A;  3KD3 A;  2YML A;  4QZD A;  3SV3 A;  4J9R A;  1RG6 A;  8ICM A;  1A77 A;  5CHG A;  2EAM A;  8ICN A;  5G5H A;  2ATL A;  2MUT A;  1NNL A;  4J9P A;  5AM5 A;  5DBA A;  4Y2Q A;  3RRG A;  1B4F A;  7ICP A;  2ZIV B;  5KFM A;  3H4B A;  1T8E A;  2KZZ A;  1Z1B A;  4DOA A;  4DL4 A;  2ZTD A;  4NY8 A;  2E8N A;  4IQV A;  5J2F A;  1DK3 A;  1TK5 A;  3BS7 A;  5DG7 A;  1U4B A;  2C2D A;  5FP0 A;  1IXR A;  2B21 A;  4I29 A;  2DQN B;  3TAD A;  2AXT U;  2K8A A;  2KTQ A;  4OJL A;  3NUQ A;  2ZIX A;  4DEZ A;  1XO0 A;  5C0Y A;  5B66 U;  2J6U A;  8ICT A;  1ZXI A;  4C8O A;  4YMO A;  1WCN A;  1HEK A;  3NVY A;  1HUO A;  2KIW A;  3RJI A;  1L3V A;  2BCQ A;  3UMC A;  4K4H A;  2Y9T A;  3RFA A;  5KFS A;  2FPM A;  4F5Q A;  3WKE A;  2Y9U A;  2IA6 A;  2WF8 A;  7ICK A;  2P35 A;  4Y2S A;  2BCV A;  4DSE A;  4C80 A;  1D8Y A;  2G08 A;  4EBE A;  3WKD A;  1NJW A;  4O5K A;  5KFB A;  2MRL A;  4KN7 A;  1UHU A;  2WAQ F;  2F77 X;  2W3R A;  3CP8 A;  1O03 A;  4QWA A;  2VA8 A;  2WB1 C;  1Q8K A;  1SV4 A;  2ZIW B;  4Q43 A;  5KFH A;  3L5K A;  3IV6 A;  7ICE A;  1ZQO A;  4J9N A;  2H3I A;  3PW0 A;  2FLN A;  3I1Y A;  5F9N A;  1OXJ A;  8ICK A;  3BQ0 A;  2AQ0 A;  5DDM A;  4ED0 A;  4PGX A;  1A0P A;  2AJQ A;  1DOQ A;  4LZG A;  8ICO A;  2F1I A;  3JPP A;  2XY6 A;  3EPG A;  5AK4 A;  2VA3 A;  4EX6 A;  2IMW P;  3PX4 A;  4EYH B;  4WJ3 B;  1JX4 A;  5ALL A;  5AI8 A;  4NLZ A;  2XCP A;  1TE2 A;  2M0N A;  1LB2 B;  4Q44 A;  2M9N A;  3E0F A;  1S77 D;  1SB3 C;  4C7Z A;  3Q8R B;  5J2I A;  5B5E U;  2KN7 A;  4OCZ A;  2ALZ A;  2ASJ A;  4QWD A;  3IDW A;  4DL6 A;  4UB8 U;  4QZ9 A;  1RYR A;  1NK8 A;  4C8L A;  3H0M B;  2XIC A;  5J0Q A;  2MUT B;  3QUC A;  3GV8 B;  2EAO A;  4OJP A;  3PSP A;  5IIO A;  7ICT A;  4Y2Y A;  4IRD A;  3U26 A;  4DSF A;  3ZI4 A;  1RZT A;  4YMM A;  4EYI B;  1OW5 A;  4O3M A;  3S6J A;  3IP4 B;  4J9O A;  1DK2 A;  3RTV A;  3BJY A;  1ZQH A;  3H40 A;  8ICQ A;  3OHB A;  2KZ3 A;  2ZIX B;  5J2J A;  2JH1 A;  5CJ7 A;  3T3F A;  2CRX A;  4YMN A;  4QIW C;  2XY7 A;  2WF6 A;  4X5V A;  8ICX A;  4NLK A;  2DF4 B;  4GC7 A;  5ALV A;  4IS7 A;  3PX0 A;  4FZL A;  3V7J A;  2HHQ A;  3HPO A;  3ICX A;  3RH5 A;  2ZIU A;  4RUC A;  2K89 A;  3PW4 A;  2HW3 A;  1IIP A;  1SWW A;  2QAR A;  5EE1 A;  1S5L U;  5C5J A;  1ZD3 A;  7ICU A;  5ALX A;  2L5Y A;  4IRC A;  2F2A B;  4G9B A;  2WF7 A;  1PK1 A;  3H0R B;  3FC4 A;  8ICY A;  1A6S A;  2KJ5 A;  1KW4 A;  3RBD A;  4OD0 A;  4RQ7 A;  3RB0 A;  4O5C A;  1L8L A;  1XNS A;  2KIV A;  5AK5 A;  2BPC A;  3LK9 A;  1S10 A;  1UPH A;  3UXO A;  4UB2 A;  5KT7 A;  2IOF A;  4DL2 A;  3HKZ C;  1D9F A;  4Q8E A;  2PXI A;  2C2E A;  4RU9 A;  3QUT A;  1BPX A;  4DQP A;  4DSK A;  2ZJ8 A;  3M9O B;  1ZQJ A;  3RJF A;  4ECR A;  2OYY A;  2RDI A;  1NK5 A;  2HVH A;  4RQ1 A;  4O5E A;  4IQU A;  4I2H A;  5AKZ A;  4DSL A;  2LYA A;  5DG8 A;  1S0M A;  4JV1 A;  4PZN A;  2YB4 A;  4KLE A;  3WK7 A;  2EDU A;  3LWM A;  4MFA A;  2WAQ C;  5K4L A;  2K8B B;  3ZD8 A;  4UAY A;  3UQ2 A;  3SI8 A;  5J2K A;  2HOQ A;  1ZD2 P;  3SMV A;  2UVW A;  4GC6 A;  3G6X A;  4BJQ A;  5BPC A;  2W04 A;  4NV0 A;  1RQL A;  3B9J A;  2VKQ A;  4GXJ A;  4Y2V A;  1L5U A;  3IG8 A;  1NKE A;  2OWO A;  3E2E A;  3MGI A;  4RQ2 A;  4UAU A;  5AI4 A;  4GIB A;  3PNC A;  3RH6 A;  8ICI A;  1RPL A;  1QQ6 A;  5AI0 A;  4PHE A;  3PVX A;  4C0Z A;  5JTI A;  4EBD A;  3O0F A;  4QZF A;  2PFO A;  1ZQ1 C;  1X42 A;  2DL0 A;  2ZIU B;  4Y2X A;  2YMQ A;  4KLO A;  2A1J A;  1D8B A;  3TAD C;  1RYS A;  2BHN A;  1Y88 A;  5KFU A;  2QAR B;  3FAH A;  1ZQX A;  2KV2 A;  1ZRN A;  2MSN A;  3ISD A;  5KG5 A;  2DFL A;  4UB3 A;  4I2B A;  4KLS A;  4ECZ A;  9ICP A;  1PK1 B;  2ZXH A;  1QLN A;  3KHG A;  2KHQ A;  5KFZ A;  2Y0S F;  1ZQE A;  8ICS A;  4FBU A;  3WKC A;  1F44 A;  1NK9 A;  9ICH A;  2QKQ A;  5HNK A;  3PR5 B;  3QE9 Y;  2NRV A;  3HIL A;  4UW9 A;  4DCC A;  3AMZ A;  1Z1V A;  5KT5 A;  9ICL A;  5DQH A;  4QZC A;  5D46 A;  5KFT A;  1KFT A;  9ICA A;  2UVR A;  2KHV A;  1QSS A;  3FYH A;  1Z3E B;  3UMG A;  4UAR A;  1C20 A;  4O3P A;  3SD7 A;  1KL9 A;  5J0X A;  5KFP A;  1ZQU A;  4NM1 A;  4CE6 A;  2JEG A;  4JB3 A;  3AU2 A;  4YCX A;  2F44 A;  4XA5 A;  5AM3 A;  2Y1J A;  2NRT A;  1SZH A;  4QWC A;  1ZQT A;  4NLN A;  2H3Z A;  4Z6C A;  1JXE A;  4GXI A;  4ZH4 A;  4KMO B;  1BPD A;  4I2A A;  1D9D A;  5KFG A;  4NWI A;  1N2X A;  3MR5 A;  3EWA A;  5J2E A;  5HP4 A;  5TZV A;  2BKE A;  3GIM A;  4MHV A;  5D49 A;  3NRW A;  4KX5 A;  3GIL A;  9ICT A;  4TUR A;  1FEZ A;  2V4Q A;  4PGQ A;  8ICB A;  3ISC A;  3NAS A;  5AIB A;  3ZDB A;  5L1M A;  2D6F C;  7ICO A;  2WF9 A;  3GFK B;  4ED1 A;  3V6J A;  5KT2 A;  1PVP A;  2WB1 F;  1NK0 A;  2RP5 A;  1EXN A;  3BZC A;  4I2E A;  4R65 A;  1HUZ A;  4KN4 A;  4I2C A;  2JXJ A;  3KFU F;  2WTF A;  2EZX A;  1UA0 A;  1FFU A;  4ED2 A;  1RYU A;  3K4G A;  2C22 A;  1KRP A;  4ECY A;  1NOM A;  1JN3 A;  2G06 A;  2BQ3 A;  1KFS A;  1KN5 A;  3WK9 A;  7ICF A;  4QW9 A;  5J29 A;  1QH9 A;  1HJP A;  2R8K A;  2F1J A;  8ICR A;  3RJJ A;  1S76 D;  4CCH A;  4RNO A;  3JPT A;  1B43 A;  4Q45 A;  3D2Q A;  5AKE A;  5III A;  4NM2 A;  4QW8 A;  1J97 A;  2H3Q A;  4I2I A;  3H8W A;  1NK4 A;  4P4P A;  1U49 A;  5ALF A;  3SAF A;  3SQI A;  1PZN A;  3Q8M A;  1SWV A;  1ZYQ A;  2EAP A;  3ALR A;  3R9K A;  3QXG A;  4RNN A;  3BQ2 A;  1BPE A;  4FFD A;  1T94 A;  4PGY A;  2KJ8 A;  1TAM A;  1CRX A;  3RB3 A;  2W9A A;  4DF8 A;  5AKY A;  5KT3 A;  4QZH A;  5KG7 A;  2R8I A;  2HHT A;  1SXE A;  2ES6 A;  2V4R A;  4XQ8 A;  1U47 A;  2K4I A;  2XVT A;  5ALM A;  4Z6F A;  1ZQD A;  4QIW F;  1ZQP A;  3N28 A;  3GDX A;  5AKK A;  3WK6 A;  3RF9 A;  3F2B A;  1NZP A;  4DF4 A;  2HBK A;  3FDS A;  1TAU A;  3QUB A;  4U6P A;  1VLB A;  3F53 A;  3QU7 A;  2Y0S C;  1FIQ A;  3OJS A;  4I27 A;  2PMZ C;  1URJ A;  5AKX A;  2HSZ A;  1PUZ A;  4NLG A;  4C4T A;  4O3N A;  1LKY A;  3ETL A;  4CRX A;  4GXK A;  3Q8S B;  4CDG A;  2LYB A;  3QU2 A;  3WKB A;  3C1Z A;  5J8Y A;  5DLF A;  4KLU A;  4UAZ A;  2MAX A;  3IRU A;  4P4M A;  2ZUC A;  3C5F A;  5J0O A;  4YN4 A;  2JEJ A;  5ALE A;  2K4P A;  2LM1 A;  2HOI A;  4MF8 A;  1IV8 A;  9ICF A;  3IM1 A;  4RQ8 A;  3HKZ F;  4R8U A;  1ZQW A;  4JUZ A;  2AU0 A;  2JMG A;  4RT3 A;  3D6J A;  9ICU A;  4DO9 A;  4DOB A;  2KK0 A;  4IR1 A;  5KL1 B;  2DPI A;  3GV7 B;  3K75 D;  4F3O A;  2KJ9 A;  1T3Q A;  1T7P A;  1SV0 C;  2GOL A;  5D4B A;  3PSF A;  4UB5 A;  3RAX A;  2GWS A;  2WF5 A;  3H4D A;  2FMS A;  3RJG A;  2FDR A;  4BWJ A;  4GLX A;  2E1E A;  4ELU A;  3C1Y A;  1JI7 A;  3PO4 A;  5KG0 A;  1RQN A;  5L1I A;  2W03 A;  3UQ0 A;  2ASL A;  5AM4 A;  1S9F A;  2ISO A;  4ECQ A;  1XO1 A;  3MDC A;  1SIJ A;  2LI6 A;  2XGQ A;  2R18 A;  4IC9 A;  3LDA A;  2O6K A;  1FO4 A;  4UQG A;  3TAQ A;  2HOF A;  2FI1 A;  3WU2 U;  4RPX A;  1MN8 A;  3UXN A;  5CWR A;  1TAQ A;  1CEZ A;  3C28 A;  2HBJ A;  3MBY A;  1X2I A;  4KIT B;  1RXW A;  4QZA A;  4MF2 A;  2W43 A;  4B9U A;  2AGP A;  4HYK A;  1CI4 A;  3GIK A;  4TUQ A;  2BQR A;  2BPG A;  1NK7 A;  1N5W A;  3K1Z A;  4IR9 A;  4PZO A;  1UQV A;  2KKP A;  3CW2 C;  1N61 A;  2KVC A;  4LZD A;  4CF4 A;  1KEJ A;  1X40 A;  3F5E A;  5J0P A;  4RT2 A;  1NJZ A;  2BQU A;  4P2H A;  3Q8Q B;  1SL2 A;  1MC8 A;  2ESE A;  5HR7 A;  1ZD4 A;  1ZET A;  1BPZ A;  4DQR A;  3TQ1 A;  2W9M A;  2HHW A;  2OM6 A;  1GO3 F;  4ACO A;  4IQW A;  2RRD A;  4DFK A;  1QSL A;  3SZ2 A;  9ICJ A;  3SEI A;  1S0V A;  1LKY B;  1F5S A;  1NK6 A;  5KFD A;  3EYZ A;  4YQW A;  4I2G A;  3MGH A;  4KX3 A;  1ZJN A;  4J9L A;  8ICA A;  5KG4 A;  5DGA A;  5CR0 A;  1KQQ A;  3QU9 A;  4O3R A;  7ICJ A;  4Q8F A;  8ICG A;  3LWL A;  4F4K A;  1TK0 A;  1N56 A;  3NVZ A;  3SV4 A;  4Y2T A;  5EWG A;  4YXM A;  4OJO A;  1L7N A;  4R8U B;  3RH4 A;  7ICQ A;  8ICV A;  5HHH A;  2KD1 A;  2ISP A;  2NO5 A;  4TUS A;  4DFJ A;  5J2D A;  3ZDA A;  3N7P D;  2I9G A;  1L6N A;  5BOM A;  5KFE A;  3LVW A;  3IHQ B;  5AI9 A;  4Z6E A;  2IBK A;  1V9P A;  4C4R A;  2AQ4 A;  1VJ5 A;  4K4I A;  1JIH A;  2PI5 A;  4FS2 A;  2HHX A;  2KIC A;  4NXZ A;  1ZQI A;  4JV2 A;  4YD2 A;  3SR6 A;  1S0O A;  2R8J A;  4KLF A;  1Z00 A;  9ICG A;  3MR2 A;  5IIM A;  5BOL A;  9ICV A;  4ECW A;  3RJK A;  1QQ7 A;  2OXO A;  4B9M A;  4RQM A;  2NRZ A;  2BGW A;  3M6K A;  4F5N A;  4Z6D A;  3TFS A;  4EBC A;  4ELV A;  2AHO B;  4PL2 A;  2P6R A;  2CPR A;  5DQG A;  5J2C A;  1KTQ A;  2G5I B;  1T4G A;  4B9V A;  2EZY A;  2KOB A;  2H3V A;  5KFX A;  4DFD A;  4ED6 A;  2LM4 A;  4JWM A;  2PFQ A;  4DQS A;  3NVV A;  3Q8K A;  4QZ8 A;  2UVV A;  2W54 A;  4FBT A;  2RDJ A;  1COO A;  8ICE A;  7ICH A;  1KFD A;  3V7L A;  2OCE A;  3VCB A;  9ICQ A;  4M2Y A;  4QJF B;  4YXJ A;  1KKX A;  2KSO B;  1K5O A;  3VC8 A;  2JR5 A;  2IHN A;  3OJU A;  2VJ5 A;  2HI0 A;  4GFJ A;  5KFF A;  1YZ6 A;  1O08 A;  8ICH A;  3MFH A;  1BGX T;  3LYS A;  2H5X A;  3RAQ A;  3TAC B;  3SYZ A;  3KKA C;  5AKH A;  1ZQC A;  3LVV A;  1XC9 A;  1ZOL A;  4UB1 A;  2XGP A;  3M6Z A;  2F8L A;  4TQR A;  1JRO A;  3B0Y A;  3MAB A;  2DKX A;  5HR6 A;  5DB6 A;  2NO4 A;  4BGD A;  4B9T A;  2XID A;  7ICR A;  1ZQG A;  4CF5 A;  2BDU A;  4PHA A;  1ZQF A;  4PPX A;  5KFQ A;  8ICC A;  9ICE A;  3OHA A;  4DOC A;  1U45 A;  4DFM A;  5L9X A;  1JMS A;  4KMU A;  5ALR A;  5DG9 A;  1IM4 A;  5A0L A;  2J6S A;  5AKG A;  3C2M A;  5KT6 A;  5L1K A;  5KFR A;  4FE3 A;  3HJE A;  4QZB A;  2CN1 A;  4UAS A;  2F8K A;  5DDY A;  5ALH A;  2ZJ5 A;  3PSI A;  1T3N A;  4RQN A;  4YFK A;  2OEH A;  2FJ6 A;  2GH1 A;  4M0A A;  2DKZ A;  1RXV A;  2JGA A;  1NJY A;  5J8Y C;  5KG6 A;  1ECW A;  4UAV A;  4KLM A;  1J2M A;  4UBB A;  4O0I A;  2B0C A;  1C7Y A;  5AIC A;  4J9K A;  3C23 A;  2XO7 A;  2FLP A;  4NJ8 A;  2KKV A;  2RHF A;  1JUD A;  2UVU A;  4JWN A;  1L7P A;  5TIS U;  3F2C A;  5L1J A;  4F4Z A;  2PMZ F;  3V72 A;  3I76 A;  3AM9 A;  4R63 A;  1Z00 B;  1KLN A;  3PML A;  4I2F A;  4Y2R A;  1SXD A;  5CEH A;  5KTQ A;  1L7M A;  2JH7 A;  2NYV A;  3D2N A;  5EE9 A;  1L7O A;  2CXY A;  2K8C B;  5KL8 B;  1FFV A;  1WUD A;  3GIJ A;  1MA7 A;  1ARO P;  1ZRM A;  7ICM A;  4I2D A;  3QZ7 A;  3KHR A;  1Q3U A;  4F93 B;  3KOO A;  2F76 X;  3OGU A;  1TV9 A;  3MFI A;  2ZXI A;  1ZQM A;  1LVH A;  2LPE A;  5AKL A;  2AGQ A;  5DBC A;  5T14 A;  5J0T A;  4UAT A;  3PR4 A;  4LJX A;  3UMB A;  3V6H A;  3Q8L A;  3L4P A;  5ALJ A;  2JZB A;  5DQI A;  3KZI U;  2QB1 A;  3EUB 2;  4NLB A;  4BDP A;  1AQ6 A;  4EZ6 A;  1COK A;  4EEN A;  5G5G A;  3RRH A;  2W8L A;  5ALY A;  3RB4 A;  1J2N A;  9ICM A;  4P0P A;  2E8O A;  4RZR A;  4P0Q A;  2BCU A;  4USA A;  3RB6 A;  1UCV A;  5DGB A;  2NRX A;  4F5R A;  3M9M B;  3BDP A;  5AHX A;  3QEA Z;  2ZTC A;  5AIA A;  5EWE A;  2JRZ A;  2LKY A;  2A3V A;  1TFR A;  1L3S A;  4FZM A;  2RLT A;  4F5P A;  2FMQ A;  1L3T A;  3H7I A;  2DBY A;  3NS1 A;  2H3F A;  3RJE A;  3JPQ A;  3M1Y A;  5L1L A;  5ALZ A;  5AI6 A;  4M6W A;  4MFC A;  5KFI A;  4IQT A;  4QZI A;  1ZQL A;  2KNJ A;  2MA1 A;  2XI9 A;  4M9N A;  4RQ3 A;  5ALT A;  1WWU A;  4A8E A;  5KG1 A;  1N48 A;  5ALG A;  3RR8 A;  5J2B A;  5E79 U;  4F5O A;  2VJ4 A;  1N5X A;  3NVW A;  2BCR A;  2GLE A;  1OUQ A;  5KFC A;  4QZG A;  5CA7 A;  2BZF A;  3PW5 A;  1ZQK A;  5J0S A;  4BXO A;  2KP7 A;  3WK5 A;  3BS5 A;  3ZD9 A;  5KAI U;  3WKA A;  1F0M A;  1ZQZ A;  3H8M A;  3QEB Z;  3MR6 A;  3F2D A;  4YVZ A;  4DL5 A;  4C4S A;  3B0X A;  4KTQ A;  5IIJ A;  3N7S C;  3TAP A;  4O3Q A;  1KDH A;  1VDV A;  1N63 A;  3EZ5 A;  3ZDE A;  8ICL A;  3CRX A;  4XRH A;  4F8R A;  4B9N A;  2ZTE A;  4J9S A;  1Z4O A;  4M9L A;  1P7D A;  4KLG A;  4KLJ A;  5HML A;  3KBB A;  5F3X B;  2DGZ A;  3PX6 A;  3E58 A;  3C2K A;  2KZM A;  1B0X A;  5KG3 A;  2FPL A;  4R66 A;  4ECX A;  5ALI A;  4F91 B;  1UT5 A;  1SL1 A;  3TFR A;  2FE9 A;  2JZB B;  1TKD A;  2W7O A;  1S97 A;  2N1R A;  4DFP A;  3ONN A;  5J0R A;  2HCF A;  1KBU A;  2E1F A;  4Y2U A;  4PJ0 U;  1U48 A;  4ECT A;  3M8S A;  4P0P B;  1X6J A;  3GV5 B;  3HWT A;  1XSL A;  4P0Q B;  3V7K A;  4QWE A;  4MEY A;  2E5S A;  5JUM A;  2W9C A;  5HHI A;  1KSP A;  3SEN A;  3T5L A;  1MSW D;  3SAH A;  3MDA A;  1YT3 A;  2YB1 A;  4K4G A;  4EEY A;  2KMD A;  5JRT A;  4M9J A;  4ELT A;  4BUG A;  5KT4 A;  1HIW A;  2QLT A;  4EX7 A;  2KVS A;  4ED8 A;  4RPZ A;  2G5H B;  2W55 A;  2KG5 A;  4F92 B;  4M6W B;  3CYM A;  1PK3 A;  1BPB A;  2ZJA A;  3ZDC A;  2OHF A;  5ALK A;  1XU4 A;  3HW8 A;  4PHD A;  1WWV A;  4DWI A;  4YR3 A;  1NZB A;  1ZQR A;  8ICU A;  5KAF U;  4R64 A;  2G0A A;  5KFY A;  3C2L A;  3HRD D;  3AU6 A;  2NRW A;  1Z19 A;  4AP9 A;  3NRZ A;  1ZJM A;  3DEE A;  4DS5 A; 
#chains in the Genus database with same CATH homology
 1LKY A;  4PZO A;  1UQV A;  2LMR A;  5F3X B;  1UCV A;  2DKZ A;  2F3N A;  1B0X A;  2Y9T A;  1X9X A;  5J8Y C;  3BS5 B;  5JU5 A;  5J8Y A;  1X40 A;  2YTU A;  4PZN A;  1OW5 A;  2QKQ A;  4RQM A;  3HIL A;  2Y9U A;  1Z1V A;  2FE9 A;  2K4P A;  4NL9 C;  1SV0 A;  2QB0 B;  2ESE A;  4NL9 A;  1SGG A;  4NJ8 A;  5KNI A;  2B6G A;  1V38 A;  1V85 A;  3KKA A;  3SEI A;  4RQN A;  2EAN A;  2F44 A;  4IS7 A;  1LKY B;  2KSO A;  1SV4 A;  1X66 A;  2E8P A;  1SV0 C;  1SXD A;  3SEN A;  3BQ7 A;  2QAR A;  1RG6 A;  2KSO B;  2EAP A;  1OXJ A;  2JV3 A;  1WWU A;  2KMD A;  2L5Y A;  5JRT A;  2EAM A;  3TAC B;  3KKA C;  1JI7 A;  3K1R B;  1PK1 A;  1B4F A;  2D3D A;  4MHV A;  2GLE A;  1SXE A;  2ES6 A;  5JTI A;  2KG5 A;  1DXS A;  2DKX A;  1KW4 A;  5L1M A;  3BS5 A;  1PK3 A;  2LPE A;  1F0M A;  2E8N A;  3H8M A;  2D8C A;  2DL0 A;  2KE7 A;  3BS7 A;  1WWV A;  2KIV A;  3TAD C;  2QAR B;  3TAD A;  2QB0 A;  2QB1 A;  3IDW A;  1COK A;  2K60 A;  2E8M A;  2F8K A;  1PK1 B;  2EAO A;  2E8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...