1SXDA

Solution structure of the pointed (pnt) domain from mgabpa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
GSHMAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, signaling protein
molecule keywords GA repeat binding protein, alpha
total genus 27
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxdA00
3IDWA 5F3XB 2KIVA 2F8KA 3K1RB 2ES6A 1V85A 2LPEA 1KW4A 2DKXA 2QARB 4IS7A 1Z1VA 1SGGA 1PK1B 2EAPA 1B4FA 1JI7A 2EANA 2QB0B 4RQMA 2Y9UA 2E8PA 3KKAC 2Y9TA 1UCVA 3BS5B 2EAOA 2DL0A 5JTIA 1LKYB 1X9XA 3HILA 4RQNA 3BQ7A 2F44A 3SEIA 5JU5A 1X66A 3BS5A 3SENA 2L5YA 1COKA 4NL9C 1LKYA 1V38A 1UQVA 2E8OA 1B0XA 4NJ8A 1WWUA 5L1MA 2K60A 1DXSA 2KSOB 5J8YA 1F0MA 2FE9A 2K4PA 2QB1A 2DKZA 2D8CA 4PZOA 3KKAA 3TADC 2KSOA 2YTUA 2QARA 5J8YC 3TACB 3BS7A 5KNIA 1WWVA 1RG6A 1SXEA 2JV3A 2ESEA 2KG5A 2EAMA 2D3DA 2B6GA 2KMDA 2LMRA 2QKQA 2GLEA 1PK3A 2KE7A 1PK1A 1SV4A 4MHVA 1OXJA 1SV0C 2E8MA 2F3NA 5JRTA 1X40A 3TADA 1OW5A 1SV0A 4NL9A 3H8MA 1SXDA 2QB0A 4PZNA 2E8NA
chains in the Genus database with same CATH superfamily
1XU4A 4QZIA 3C5GA 1JIHA 4DSKA 2FJ6A 4F4YA 2ES6A 4F3OA 1PK1B 9ICMA 4I2HA 2W55A 2WF9A 2ISPA 1Q3UA 1L5UA 3A0BU 3MGHA 3KFUF 8ICPA 2HOQA 4P4MA 2JEIA 4DQQA 4KX5A 4Y2VA 5KG7A 3FC4A 4M9HA 5BOLA 4DO9A 4QZBA 3QZ7A 3BZCA 1CRXA 1QLNA 4YD2A 1BPEA 1P7DA 4BWMA 3LVWA 2GWSA 2DBYA 1SL0A 4O5KA 4YMNA 2G08A 3F5AA 1JUDA 1SWWA 8ICEA 8ICUA 4QZDA 2FI1A 1ZRMA 9ICIA 1X9WA 3UXNA 5KT5A 2MSNA 4QZFA 4O3QA 5IIMA 2PFOA 2RDIA 3N7RC 1XSPA 2LHTA 2F1HA 2ATLA 1VLBA 4RU9A 4UB4A 4UAYA 2KE7A 1T94A 2R8HA 4NM1A 4I2EA 1N2XA 5J2EA 1KFDA 2NRWA 2LM1A 4NLCA 2ZIUA 4QWAA 3RBDA 3DDHA 7ICSA 3M7DA 3ZDEA 5AK6A 5HMMA 3FAHA 8ICFA 3T3FA 1L8LA 2WB1F 4KLSA 2XY5A 2KIVA 2F8KA 1J2NA 5DG9A 3ORYA 2WTFA 1JN3A 5KFPA 3G6VA 4B9VA 3ETLA 1BNPA 4CDGA 1HUOA 4OJOA 3F2DA 2P35A 1SGGA 2BDPA 4RQ2A 3AM9A 4EZ6A 2C2DA 1BVSA 2ZIVB 3V6HA 9ICCA 4IRCA 3WK4A 2DF4B 2VIXA 4MFFA 2EAOA 3ZD9A 1X9XA 2RRDA 1A77A 3HILA 3IG5A 5J2HA 1KFTA 3Q8LA 1ZQEA 1DOQA 1DGJA 5DBCA 3WK8A 4F4XA 3I76A 3B0XA 2IHMA 3RFAA 4NXZA 1ZD2P 4ECVA 3JPOA 4QW9A 3AU2A 2BDUA 1V38A 2HHTA 1RXWA 3E0FA 5ALKA 3H4DA 1PUZA 5L1LA 3M9MB 1X9MA 8ICNA 4KLJA 3C21A 4O5CA 1BPXA 8ICZA 7ICNA 2G06A 4FZLA 2W8LA 2KSOA 2JMGA 1ZQ1C 2JV3A 4MEYA 3RH4A 4OJ6A 4IQVA 1A6SA 1DGSA 3HT3A 9ICLA 2LMRA 3GV7B 1ZQPA 3RF9A 1SKRA 2BQUA 4R66A 1Z3EB 1U48A 3UXOA 1ZQLA 1HJPA 4J9KA 5J2GA 5KFXA 1ZQSA 5D49A 4OJ5A 5ALWA 4I2CA 2D6FC 5J0YA 5AI9A 4C0ZA 1NNLA 4PZNA 3MR3A 2QB0A 1NKEA 5HNKA 1O03A 1V97A 3L3FX 4P0QA 2ZJ5A 1IXRA 2XCPA 4ED7A 2ZTEA 2BCSA 4ECYA 3Q8PB 2BPFA 4M47A 3UM9A 2OXOA 3SAFA 1LVHA 4J9PA 4KLOA 1ZQWA 2C2RA 1PVQA 3PW5A 2KN7A 2DFLA 4RQMA 4XQ8A 1JX4A 4JWNA 2Y9TA 2WAQC 4RQ6A 4R63A 4DCCA 1SL1A 3VC8A 3UMCA 2YMLA 2VA2A 3GIJA 5HR7A 2NRTA 2C22A 2E5SA 1GO3F 2KVCA 1UA0A 8ICWA 4QZCA 5EWEA 5KFEA 4GXIA 1NJWA 5KFDA 1RQNA 5DG7A 2V9WA 1MSWD 3SQIA 5TISU 2NRVA 5ALMA 2K4PA 2EQYA 4QZ8A 2EH9A 3PW4A 5ALDA 3O0FA 2J6UA 3JPNA 2BPCA 2W9BB 1S8OA 3I28A 5AICA 7ICOA 2FMQA 4F50A 3C1ZA 4GFJA 2F1IA 1NZPA 1BPDA 2A1AA 2BZFA 4B9SA 1NK0A 2PFPA 4MHVA 2E8MA 1L7NA 3NS1A 1ZQMA 2H3ZA 1ECWA 4IQWA 2XC9A 2F76X 1QTMA 3CNHA 4DSLA 4KLGA 7ICUA 4QZGA 2FMSA 2F8LA 4GIBA 4KMOB 1V85A 3UQ0A 3BQTA 4QWDA 1RZTA 1S0MA 4Q45A 1NK6A 2I9GA 2JEFA 4USAA 4JUZA 4O3RA 2QB0B 1RYUA 2YMMA 2LI6A 1L7OA 2ASJA 5H2FU 4C80A 5ALIA 2W7OA 4O9MA 2NO4A 5ALSA 3BZKA 1HEKA 1Z00B 4IQUA 4TUQA 2P6UA 2JR5A 3F2BA 5KFWA 3L4PA 4CF5A 2V4QA 3WKDA 5JU5A 1X66A 4Y2QA 3NTUA 4J9LA 3D2NA 5L1MA 3RR8A 2KZ3A 4DF4A 3LWLA 2Q0ZX 5AM1A 5KFLA 1OUQA 4JK1A 3RB4A 2F2AB 4UB8U 3HP6A 4IRKA 3NRWA 4IQTA 4AYBC 1U45A 3C28A 3Q8KA 5KNIA 2MUTA 1WWVA 3GILA 3SR6A 3WK9A 4RQ1A 4F2SA 1FFUA 7ICKA 1KL9A 5KFQA 5J29A 3NGDA 5AKLA 1LV5A 4EEKA 2KKPA 2RHFA 5CA7A 5AKYA 4M04A 2BCRA 2W9AA 4DQIA 8ICLA 5AI0A 1KN5A 4EEYA 5KFFA 4NLNA 3IRUA 3T5LA 5AM5A 3RAQA 1KTQA 2BCVA 4CRXA 4M9LA 4KLDA 2VJ4A 7ICJA 9ICQA 3PSPA 3N28A 5E79U 2PFQA 1Z1VA 2DGZA 5KFVA 1L6NA 4LVSA 2O6KA 4M9NA 1ZD3A 2KJ5A 4QWBA 4Q8EA 2Y9UA 5AM3A 5D4BA 2NRXA 1NK7A 3SV3A 5AK5A 4R8UB 2A1JA 4F5PA 4PL1A 2L5YA 4UQGA 3QU9A 3M1YA 1UQVA 4F71A 2W7PA 4C4TA 3QUCA 2AJQA 3FYHA 5KFKA 4BWJA 1ZQGA 2K60A 4J03A 4F5OA 4AYBF 2H3QA 4EZ9A 2ZUBA 1IG6A 4Y2XA 4DQRA 5KG1A 4J9QA 4QWEA 3K4GA 1AROP 3BS7A 4JB3A 8ICTA 1NI3A 1SB3C 3QX7A 5FP0A 3THVA 2KVSA 1S9FA 1S77D 4DFKA 4F4ZA 1YZ7A 2K8AA 2W9CA 3EUB2 5DGBA 3H0MB 1DK2A 3H0LB 3MC1A 2E1FA 2B21A 4YFKA 2H5XA 5J2FA 3Q8SB 2RDJA 2ISOA 8ICKA 4NL9A 5KT4A 1X2IA 3SD7A 2G5IB 3B0YA 1KEJA 1L3UA 5EE9A 5F3XB 4C8KA 3C2MA 2PFNA 2UVUA 3SV4A 4CF3A 5AKEA 1ZQXA 2XGPA 5KL8B 2XVTA 4RNOA 5AK4A 5CEHA 2HDOA 3MR2A 1BPZA 1BPBA 4IL6U 3MR6A 4IRDA 4NLGA 3ETRA 4M9GA 8ICBA 3QEBZ 5KAFU 9ICRA 2LM4A 1S97A 4YXJA 4KTQA 1UCVA 1PVPA 4UAWA 4YMOA 4M0AA 2EZZA 4NM2A 1U9LA 2W03A 4G9BA 4K4HA 2HOFA 3IHQB 5HR6A 3M9OB 3GIMA 1K5OA 3C2KA 4WJ3B 4Z6FA 3C23A 2NO5A 3GQCA 1B0XA 1LB2B 4NV0A 2K8CB 1YZ6A 4DLEA 2DKZA 1MQ3A 2HHSA 1T7PA 3PW7A 4QZHA 5KFUA 8ICAA 4DS4A 5CHGA 5J8YC 4BX9C 1WUDA 2B0CA 9ICAA 2KJ9A 2CN1A 1IIPA 2WB1C 4J9RA 3UMBA 3OSPA 1M6YA 2HW3A 3NVYA 3RB3A 3GIIA 4F5NA 3M6ZA 1PK1A 5KG5A 4ECRA 1F5SA 3HKZF 2H3VA 4RUAA 2IOFK 2YMQA 5DGAA 4R64A 4YMMA 5ALQA 3QYPA 3NRZA 5KFTA 4PHAA 1N63A 3TARA 9ICJA 7ICVA 2YX8A 2WF6A 2FPLA 2I1QA 1JROA 1NKBA 4ECQA 1AQ6A 1Z00A 3GV5B 3K1RB 3GV8B 1Z4NA 5J2DA 1KW4A 1NK9A 3RBEA 4FBTA 5AKKA 1HUZA 4Z6CA 4KLQA 1N61A 4ACOA 5AKHA 4EENA 3MR5A 2EAPA 4M6WB 2Y1IA 3PO4A 3RB6A 4BJQA 2F1JA 3K1ZA 1XWLA 4KN7A 5J0TA 1T3QA 2AHOB 4XA5A 5AI6A 4JV1A 4KLTA 5KG0A 3GDXA 4F72A 3KKAC 5T14A 3PX0A 1RYRA 5J0PA 3H0RB 4PGQA 4TURA 9ICFA 3QXGA 2I5HA 4BXOB 3SENA 3A0HU 5IILA 4E0DA 5KFZA 1J97A 1N62A 4B6JA 4DWIA 4DL4A 3UQ2A 4RPZA 4FZNA 2HHXA 8ICGA 5L9XA 2K4HA 5EE0A 3H40A 5BPCA 1ZQRA 1U49A 3PO5A 3PSFA 4UASA 2YTUA 2AQ0A 2H3FA 3RAXA 4PH5A 1X42A 2W9BA 1XO0A 1TKDA 1ZYQA 3QE9Y 3JPTA 2D3DA 4FE3A 9ICGA 3OHAA 4DSJA 4C8LA 2KZZA 3T5HA 1ZJMA 3OJUA 1S10A 4DFPA 2JGAA 5JRTA 5DBAA 3WK7A 2ZIVA 2BCUA 5ALOA 2WHEA 3M8SA 2HOIA 1OW5A 4KX3A 2EZYA 9ICNA 2ZUDA 5KG3A 3F5EA 1B22A 3MABA 2OHFA 3OSNA 1IV8A 3Q8MA 7ICTA 4QIWF 5AKIA 1TK8A 3RJHA 3L5KA 3NVWA 2JHDA 3M6KA 1FFVA 7ICEA 3RJFA 3H8WA 2WF7A 2ZIXA 2CXYA 1PVRA 1ZOLA 1TVAA 3PV8A 2ZIUB 1ZRNA 1QSSA 5IINA 1YT3A 9ICXA 1Q46A 1KQQA 3JPQA 5DLFA 5ALPA 9ICWA 2AXTU 3ZI4A 4YN4A 2ODGA 3RJIA 4QW8A 4QZEA 4PGXA 3PW2A 4J9OA 3BS5A 5DB9A 4O3MA 4M9JA 3PZPA 2W11A 4QZ9A 1XC9A 5L1JA 4LZDA 1WWUA 3KZXA 3QUTA 2P6RA 5ALGA 5J8YA 5J0XA 3J81j 4KLFA 3TQ1A 2LKYA 4EYIB 1MC8A 2HSZA 2G07A 4Y2RA 2QARA 4OCZA 2HHQA 2ASDA 3QU7A 5AKGA 3MDAA 2YN4A 2EAMA 4PGYA 4NWIA 1S0NA 2IMWP 4O5EA 4CF4A 5EOZA 5KFAA 1ED1A 1N56A 1WG8A 4YR0A 5KFRA 4YQWA 3WK5A 3SMVA 2K4IA 2F3NA 2KEYA 2AGOA 2XIDA 2NRZA 2MAXA 5KG6A 2G5HB 1N5XA 3RTVA 3HPOA 4YXMA 1RXVA 5D46A 4DLGA 3T5JA 3F53A 7ICFA 1COOA 3IDWA 8ICOA 5DQIA 3WKBA 3ALRA 2ZG6A 3AQFA 1T3NA 8ICCA 3SZ2A 4I2GA 2XCAA 1BNOA 2DKXA 3EYZA 4B9UA 4DL7A 3PMLA 1B4FA 4YD1A 5CWRA 2EANA 1Z19A 4Y2JA 4HYKA 3PY8A 2DL0A 2E3TA 1UT5A 3T79A 4P2HA 4C7ZA 3MBYA 4RT3A 5CJ7A 2DPJA 3MFHA 3H4BA 5HMLA 1NJYA 3ZDBA 4MF2A 5KFBA 2E8OA 1C7YA 1CUKA 4NJ8A 2QLTA 5KAIU 4DQSA 1F0MA 5L1IA 1NK4A 4P0QB 9ICOA 1DK3A 3CW2C 3IM1A 1NZBA 1X9SA 4J9MA 2PMZC 3KHGA 4CGZA 3QEAZ 2YMPA 3WK6A 4UW9A 5DDYA 2E1EA 4YP3A 1RQLA 3QNMA 2VJ5A 2YY6A 2GLEA 4ECTA 1TE2A 4J9NA 3LVVA 1ZXIA 2ALZA 4P0PA 1ZQQA 3UXPA 9ICUA 2OH2A 3OJSA 4I28A 4F91B 4ECXA 4OO1J 3ISBA 7ICGA 3DV9A 7ICRA 4RQ8A 4PHPA 2HVHA 5EWGA 1ZQBA 3N7PD 4F93B 3G6YA 5IIOA 3TAQA 3U26A 1KSPA 2CPRA 4YVZA 5DLGA 5ALRA 2LYAA 4RUCA 5AKZA 4ED2A 3MGIA 4P4PA 2ZTDA 4JV2A 4BGDA 1BGXT 5KT7A 4BXOA 1JXLA 5KG4A 3C29A 1LKYB 2I6XA 3HKZC 4CCHA 3RJKA 2ZTCA 5GTIU 3V6KA 2VA3A 1QQ6A 3PR4A 1QQ7A 2BPGA 7ICPA 3PX6A 4OJLA 2DUYA 1FO4A 1S5LU 2WF5A 3DEEA 1QQ5A 2ZXIA 2JEJA 3H8SA 2Y1JA 2G09A 4ICAA 1RM6C 2K8BB 3V72A 3H8JA 2NYVA 5J2JA 2IHNA 8ICRA 4RQ0A 4C4SA 1SXEA 2ESEA 3NVZA 1F44A 4O0IA 5DB8A 3V6JA 2JH7A 4ED0A 1L8OA 5CRXA 4BDPA 4TQRA 4DSIA 4KLUA 3N7SC 1NK8A 3TAPA 5DBBA 1UPHA 3ZDDA 4DL6A 2MUTB 2OYYA 9ICBA 2PI4A 5CP2A 3H8MA 1XO1A 2IBKA 3RRHA 1QSYA 5JUMA 1MA7A 4GXKA 3KD3A 5G5HA 4CNQA 4UB1A 1DRGA 4EX7A 2W3SA 4FBUA 4ELUA 5KFJA 1JRPA 3PNCA 3UPQA 3KHRA 4FS1A 1RYSA 1ZQIA 2QARB 4F5QA 1IM4A 3MGVA 2GO7A 4K4IA 2CRXA 4US8A 1ZQTA 1CEZA 3WKEA 1ZD5A 1WYGA 1TV9A 3M8RA 2AGQA 5J0WA 2V4RA 3MDCA 1T4GA 5J0OA 4XUSA 3V7JA 1ZQJA 3LWMA 4DQPA 2KD1A 5CB1A 4A8EA 2KKVA 3NVVA 4RZRA 5J2CA 5KFIA 4KLHA 3D2SA 3IG8A 2GOLA 4NL9C 4R65A 1LKYA 4RPYA 3QUQA 5K4LA 3LK9A 5AIBA 2HHVA 2F77X 4I27A 3RJGA 5ALZA 5EE1A 3CP8A 3OTQA 2R8GA 4Z6EA 5DB6A 4TUSA 5ALJA 1V9PA 2KHQA 3G6XA 4NLBA 5AI4A 4O3NA 2XY7A 2J6TA 1SWVA 4IR1A 3BJYA 1N48A 5KL1B 4R8UA 3RJEA 4MFCA 3Q8QB 2DWQA 9ICSA 4ZH4A 2R18A 1OXJA 3FDSA 5AM4A 3C2LA 5DQHA 4I2JA 4F8RA 4UAUA 1KLNA 3TKAA 4MEXA 4KLEA 3GU3A 5ALEA 4C4RA 1U47A 4Q44A 1SV0A 9ICVA 4GXJA 3RH5A 5AKJA 4Y2UA 4ECSA 5B66U 3FM9A 1K1SA 4HAIA 3IV6A 1ZD4A 4DOCA 9ICKA 3PW0A 2GH1A 2RP5A 1SZHA 5AI8A 2G0AA 3ZD8A 2PKEA 5EE3A 5KFCA 4UBBA 1KBUA 4GLXA 1L7PA 2PI5A 4Y2SA 5C0YA 2KIWA 3SI8A 4DEZA 3EPIA 1Q3VA 4B9NA 2LYHA 2FMPA 1KKXA 3WKCA 3AUOA 9ICHA 1FEZA 2F44A 1ZQOA 2C2EA 2KP7A 3EPGA 1X6JA 2JH1A 4Y2YA 1X6IA 3T5KA 2R8IA 2IOHA 3HJEA 3JPPA 4QIWC 4X5VA 3GIKA 2MU2A 4B9TA 2ZIXB 3JPSA 1SKWA 4O3OA 4US9A 2UVRA 4DOBA 4F5RA 2J6SA 5HHHA 5ALFA 5J0UA 2HVIA 2C28A 1C20A 2KK0A 1RG6A 3M9NB 2KG5A 4F2RA 5ALUA 2R8JA 4KMUA 2N1RA 2HHWA 8ICMA 1HIWA 5J0SA 2K4EA 2BQ3A 2R8KA 3QZ8A 3TANA 4ED1A 1VJ5A 4CE6A 4QJFB 1Y88A 2AU0A 4P0PB 5AM0A 4YR2A 1SZPA 5KG2A 4O3SA 3MFIA 2M9NA 4PL2A 2MRLA 4ECUA 4GC6A 4TUPA 2KFNA 2OCEA 4DSEA 2A3VA 4YCXA 2LYBA 2LPEA 5F9NA 2FDRA 1Z1BA 4UATA 1BPYA 9ICEA 1RPLA 4ECZA 5GTHU 3PR5B 5TZVA 4YR3A 5BOMA 2M0NA 5HHIA 3EZ5A 1JI7A 2W3RA 4O3PA 4FO6A 3GZFA 1H38A 5ALXA 5KFGA 4XRHA 4JMUA 3IP4B 7ICHA 4Y2TA 2VA8A 4DFMA 3EW9A 2AH5A 2Y0SF 1QCKA 2KOBA 1ZQZA 4RQ5A 1A0PA 4FFDA 4U7CA 3AU6A 4I2FA 4NLZA 2DQNB 1URJA 5J0RA 4FS2A 4F4KA 3ONNA 1COKA 2OEHA 3CRXA 4RNNA 5J0QA 1VDVA 2W9CB 1NJXA 2WFAA 3EWAA 4KN4A 5ALVA 1S76D 2EZXA 4DL2A 1U4BA 1B43A 2W04A 2VANA 4UAVA 4EBCA 4MF8A 2Q4TA 5KFYA 4F92B 2JZBB 4UB6U 4ED3A 2KTQA 2FLPA 4PHEA 4PPXA 4DFDA 4GC7A 4UBCA 3BQ2A 2BQRA 2HBJA 5DG8A 4AP9A 4UB5A 3KOOA 5DB7A 2ZIWA 1JXEA 4DFJA 8ICJA 3CYMA 4FZMA 3C5FA 5IIIA 3HW8A 2YB1A 1X40A 2K89A 5KFMA 4EBEA 1UHUA 2VKQA 4I29A 2HI0A 5G5GA 5IIJA 3KZIU 1KDHA 1SXDA 2HMXA 2E8NA 2PXIA 2P66A 1ZQUA 2KHVA 4KITB 3N97B 1O08A 5ALNA 3RJJA 2H3IA 4DS5A 5KFSA 8ICXA 3RH6A 4I2DA 4EX6A 2XICA 3E2EA 3ICXA 4KLIA 3Q8RB 5AI5A 8ICIA 2PMZF 5CR0A 2JZBA 5KFHA 1NK5A 3ED5A 4IR9A 1TFRA 5A0LA 4RQ4A 4ED8A 4ED6A 2HBLA 3BQ0A 2ZXHA 2KZMA 5AIAA 1ZQVA 3BS5B 1KRPA 1XSLA 2ZIWB 1J2MA 1A76A 3BDPA 3SEIA 4PHDA 2XO7A 5KTQA 4G3IA 2FPMA 3AN1A 3QU5A 5DDMA 2XY6A 1TK5A 4C7YA 8ICQA 5DQGA 2EDUA 2OM6A 2KV2A 3V7KA 3RB0A 2HBKA 5ALYA 2W8KA 3B9JA 3SAGA 2D8CA 3QUBA 3KKAA 3TADC 3HWTA 4EELA 4IC9A 2JEGA 2IOFA 2Z7JA 3JPRA 2HCFA 1FIQA 4I2AA 4I2BA 1ZQFA 2W43A 2NV3A 1UT8A 2B6GA 3K75D 4TQSA 1PK3A 4KLMA 2WAQF 5KT3A 1ZJNA 5AHXA 1TK0A 1N60A 3N4MB 1XNSA 1D9DA 1PZNA 1JMSA 5KFOA 2DPIA 2W54A 4DL5A 3WKAA 3TADA 3I1YA 2A19A 2ZJ8A 2JXJA 5AK3A 4F4WA 4RQNA 4RPXA 7ICIA 4DF8A 1WCNA 3PSIA 3HX0A 4J9SA 1L3TA 4NY8A 4PJ0U 9ICPA 4MFAA 4IS7A 3OHBA 4M6WA 2A1JB 1ZQCA 3PVXA 3AL0B 4B9MA 1T8EA 2AQ4A 2WF8A 1SKSA 3TFRA 1EXNA 2XI9A 3SYZA 4JWMA 2KNJA 4ZOHC 2IA6A 4YG2A 2BHNA 3HRDD 1SIJA 3AQEA 3ZDCA 5HP4A 1XS9D 5KFNA 3LYSA 3BQ7A 3TFSA 5ALLA 3KHHA 2LBOA 2HHUA 3AMZA 3H7IA 3NUQA 4DSFA 4LJXA 3ISDA 4UARA 2FPKA 3NASA 1L3VA 8ICYA 1DXSA 2KSOB 8ICVA 7ICMA 2ZUCA 1N5WA 4Q8FA 2QB1A 8ICSA 1XSNA 3UMGA 1TAQA 4PZOA 5KT6A 3QU4A 5L1KA 3ZDAA 2MA1A 4JV0A 7ICQA 3R9KA 2FLLA 4P4OA 7ICLA 5AM2A 3D6JA 3PX4A 5J2IA 4EBDA 4K4GA 1S0OA 1NKCA 2KMDA 2QKQA 2BCQA 1JALA 1D9FA 4ELVA 3TI0A 3ISCA 1NJZA 1SV4A 2FLNA 1ZQYA 5J2BA 2Y0SC 3IN5A 1KFSA 4ELTA 2AGPA 3BQ1A 5F9LA 5J2AA 1WCLA 4M2YA 3VCBA 1L3SA 2KFZA 4Q43A 4RQ7A 1SL2A 3OGUA 3C1YA 3SAHA 4UB3A 4RQ3A 5KT2A 4RT2A 8ICHA 3AEVA 1D8BA 4UB2A 3KTQA 4B9LA 4C8NA 2OWOA 4QWCA 2KICA 1QSLA 4U6PA 3KBBA 3E58A 2E8PA 3PSTA 2W9MA 5JTIA 2YQEA 1ZQNA 1ZQAA 1Z4OA 9ICTA 1QH9A 4RNMA 2UVWA 3RRGA 4NLKA 4LZGA 4C8MA 2BKEA 3GFKB 5J2KA 4KLLA 1ZQDA 2ZJAA 4ECWA 2XGQA 4UAZA 4Y2PA 2HBMA 4C8OA 3WU2U 4EYHB 1RDFA 1D8YA 3KHLA 4OD0A 5DKWA 5C5JA 2FE9A 4DL3A 1Q8KA 1UA1A 2KJ8A 1S0VA 1TAUA 3S6JA 5ALHA 3TACB 1ZETA 3D2QA 4I2IA 4QZAA 1K1QA 2YB4A 5IIKA 2BGWA 3LDAA 1NOMA 3PMNA 2ASLA 3RR7A 1MQ2A 2RQ5A 4OJPA 1TAMA 1D8LA 2UVVA 2JRZA 3QU2A 1ZQHA 3OPXA 2RLTA 1L7MA 3V7LA 5AKXA 1SV0C 1CI4A 4BUGA 4Z6DA 2BR0A 1ZQKA 5B5EU 5EWFA 1MN8A 3F2CA 5ALTA 4DOAA 4QNLA
chains in the Genus database with same CATH topology
3IDWA 5F3XB 2KIVA 2F8KA 3K1RB 2ES6A 1V85A 2LPEA 1KW4A 2DKXA 2QARB 4IS7A 1Z1VA 1SGGA 1PK1B 2EAPA 1B4FA 1JI7A 2EANA 2QB0B 4RQMA 2Y9UA 2E8PA 3KKAC 2Y9TA 1UCVA 3BS5B 2EAOA 2DL0A 5JTIA 1LKYB 1X9XA 3HILA 4RQNA 3BQ7A 2F44A 3SEIA 5JU5A 1X66A 3BS5A 3SENA 2L5YA 1COKA 4NL9C 1LKYA 1V38A 1UQVA 2E8OA 1B0XA 4NJ8A 1WWUA 5L1MA 2K60A 1DXSA 2KSOB 5J8YA 1F0MA 2FE9A 2K4PA 2QB1A 2DKZA 2D8CA 4PZOA 3KKAA 3TADC 2KSOA 2YTUA 2QARA 5J8YC 3TACB 3BS7A 5KNIA 1WWVA 1RG6A 1SXEA 2JV3A 2ESEA 2KG5A 2EAMA 2D3DA 2B6GA 2KMDA 2LMRA 2QKQA 2GLEA 1PK3A 2KE7A 1PK1A 1SV4A 4MHVA 1OXJA 1SV0C 2E8MA 2F3NA 5JRTA 1X40A 3TADA 1OW5A 1SV0A 4NL9A 3H8MA 1SXDA 2QB0A 4PZNA 2E8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  5F3X B;  2KIV A;  2F8K A;  3K1R B;  2ES6 A;  1V85 A;  2LPE A;  1KW4 A;  2DKX A;  2QAR B;  4IS7 A;  1Z1V A;  1SGG A;  1PK1 B;  2EAP A;  1B4F A;  1JI7 A;  2EAN A;  2QB0 B;  4RQM A;  2Y9U A;  2E8P A;  3KKA C;  2Y9T A;  1UCV A;  3BS5 B;  2EAO A;  2DL0 A;  5JTI A;  1LKY B;  1X9X A;  3HIL A;  4RQN A;  3BQ7 A;  2F44 A;  3SEI A;  5JU5 A;  1X66 A;  3BS5 A;  3SEN A;  2L5Y A;  1COK A;  4NL9 C;  1LKY A;  1V38 A;  1UQV A;  2E8O A;  1B0X A;  4NJ8 A;  1WWU A;  5L1M A;  2K60 A;  1DXS A;  2KSO B;  5J8Y A;  1F0M A;  2FE9 A;  2K4P A;  2QB1 A;  2DKZ A;  2D8C A;  4PZO A;  3KKA A;  3TAD C;  2KSO A;  2YTU A;  2QAR A;  5J8Y C;  3TAC B;  3BS7 A;  5KNI A;  1WWV A;  1RG6 A;  1SXE A;  2JV3 A;  2ESE A;  2KG5 A;  2EAM A;  2D3D A;  2B6G A;  2KMD A;  2LMR A;  2QKQ A;  2GLE A;  1PK3 A;  2KE7 A;  1PK1 A;  1SV4 A;  4MHV A;  1OXJ A;  1SV0 C;  2E8M A;  2F3N A;  5JRT A;  1X40 A;  3TAD A;  1OW5 A;  1SV0 A;  4NL9 A;  3H8M A;  1SXD A;  2QB0 A;  4PZN A;  2E8N A; 
#chains in the Genus database with same CATH topology
 1XU4 A;  4QZI A;  3C5G A;  1JIH A;  4DSK A;  2FJ6 A;  4F4Y A;  2ES6 A;  4F3O A;  1PK1 B;  9ICM A;  4I2H A;  2W55 A;  2WF9 A;  2ISP A;  1Q3U A;  1L5U A;  3A0B U;  3MGH A;  3KFU F;  8ICP A;  2HOQ A;  4P4M A;  2JEI A;  4DQQ A;  4KX5 A;  4Y2V A;  5KG7 A;  3FC4 A;  4M9H A;  5BOL A;  4DO9 A;  4QZB A;  3QZ7 A;  3BZC A;  1CRX A;  1QLN A;  4YD2 A;  1BPE A;  1P7D A;  4BWM A;  3LVW A;  2GWS A;  2DBY A;  1SL0 A;  4O5K A;  4YMN A;  2G08 A;  3F5A A;  1JUD A;  1SWW A;  8ICE A;  8ICU A;  4QZD A;  2FI1 A;  1ZRM A;  9ICI A;  1X9W A;  3UXN A;  5KT5 A;  2MSN A;  4QZF A;  4O3Q A;  5IIM A;  2PFO A;  2RDI A;  3N7R C;  1XSP A;  2LHT A;  2F1H A;  2ATL A;  1VLB A;  4RU9 A;  4UB4 A;  4UAY A;  2KE7 A;  1T94 A;  2R8H A;  4NM1 A;  4I2E A;  1N2X A;  5J2E A;  1KFD A;  2NRW A;  2LM1 A;  4NLC A;  2ZIU A;  4QWA A;  3RBD A;  3DDH A;  7ICS A;  3M7D A;  3ZDE A;  5AK6 A;  5HMM A;  3FAH A;  8ICF A;  3T3F A;  1L8L A;  2WB1 F;  4KLS A;  2XY5 A;  2KIV A;  2F8K A;  1J2N A;  5DG9 A;  3ORY A;  2WTF A;  1JN3 A;  5KFP A;  3G6V A;  4B9V A;  3ETL A;  1BNP A;  4CDG A;  1HUO A;  4OJO A;  3F2D A;  2P35 A;  1SGG A;  2BDP A;  4RQ2 A;  3AM9 A;  4EZ6 A;  2C2D A;  1BVS A;  2ZIV B;  3V6H A;  9ICC A;  4IRC A;  3WK4 A;  2DF4 B;  2VIX A;  4MFF A;  2EAO A;  3ZD9 A;  1X9X A;  2RRD A;  1A77 A;  3HIL A;  3IG5 A;  5J2H A;  1KFT A;  3Q8L A;  1ZQE A;  1DOQ A;  1DGJ A;  5DBC A;  3WK8 A;  4F4X A;  3I76 A;  3B0X A;  2IHM A;  3RFA A;  4NXZ A;  1ZD2 P;  4ECV A;  3JPO A;  4QW9 A;  3AU2 A;  2BDU A;  1V38 A;  2HHT A;  1RXW A;  3E0F A;  5ALK A;  3H4D A;  1PUZ A;  5L1L A;  3M9M B;  1X9M A;  8ICN A;  4KLJ A;  3C21 A;  4O5C A;  1BPX A;  8ICZ A;  7ICN A;  2G06 A;  4FZL A;  2W8L A;  2KSO A;  2JMG A;  1ZQ1 C;  2JV3 A;  4MEY A;  3RH4 A;  4OJ6 A;  4IQV A;  1A6S A;  1DGS A;  3HT3 A;  9ICL A;  2LMR A;  3GV7 B;  1ZQP A;  3RF9 A;  1SKR A;  2BQU A;  4R66 A;  1Z3E B;  1U48 A;  3UXO A;  1ZQL A;  1HJP A;  4J9K A;  5J2G A;  5KFX A;  1ZQS A;  5D49 A;  4OJ5 A;  5ALW A;  4I2C A;  2D6F C;  5J0Y A;  5AI9 A;  4C0Z A;  1NNL A;  4PZN A;  3MR3 A;  2QB0 A;  1NKE A;  5HNK A;  1O03 A;  1V97 A;  3L3F X;  4P0Q A;  2ZJ5 A;  1IXR A;  2XCP A;  4ED7 A;  2ZTE A;  2BCS A;  4ECY A;  3Q8P B;  2BPF A;  4M47 A;  3UM9 A;  2OXO A;  3SAF A;  1LVH A;  4J9P A;  4KLO A;  1ZQW A;  2C2R A;  1PVQ A;  3PW5 A;  2KN7 A;  2DFL A;  4RQM A;  4XQ8 A;  1JX4 A;  4JWN A;  2Y9T A;  2WAQ C;  4RQ6 A;  4R63 A;  4DCC A;  1SL1 A;  3VC8 A;  3UMC A;  2YML A;  2VA2 A;  3GIJ A;  5HR7 A;  2NRT A;  2C22 A;  2E5S A;  1GO3 F;  2KVC A;  1UA0 A;  8ICW A;  4QZC A;  5EWE A;  5KFE A;  4GXI A;  1NJW A;  5KFD A;  1RQN A;  5DG7 A;  2V9W A;  1MSW D;  3SQI A;  5TIS U;  2NRV A;  5ALM A;  2K4P A;  2EQY A;  4QZ8 A;  2EH9 A;  3PW4 A;  5ALD A;  3O0F A;  2J6U A;  3JPN A;  2BPC A;  2W9B B;  1S8O A;  3I28 A;  5AIC A;  7ICO A;  2FMQ A;  4F50 A;  3C1Z A;  4GFJ A;  2F1I A;  1NZP A;  1BPD A;  2A1A A;  2BZF A;  4B9S A;  1NK0 A;  2PFP A;  4MHV A;  2E8M A;  1L7N A;  3NS1 A;  1ZQM A;  2H3Z A;  1ECW A;  4IQW A;  2XC9 A;  2F76 X;  1QTM A;  3CNH A;  4DSL A;  4KLG A;  7ICU A;  4QZG A;  2FMS A;  2F8L A;  4GIB A;  4KMO B;  1V85 A;  3UQ0 A;  3BQT A;  4QWD A;  1RZT A;  1S0M A;  4Q45 A;  1NK6 A;  2I9G A;  2JEF A;  4USA A;  4JUZ A;  4O3R A;  2QB0 B;  1RYU A;  2YMM A;  2LI6 A;  1L7O A;  2ASJ A;  5H2F U;  4C80 A;  5ALI A;  2W7O A;  4O9M A;  2NO4 A;  5ALS A;  3BZK A;  1HEK A;  1Z00 B;  4IQU A;  4TUQ A;  2P6U A;  2JR5 A;  3F2B A;  5KFW A;  3L4P A;  4CF5 A;  2V4Q A;  3WKD A;  5JU5 A;  1X66 A;  4Y2Q A;  3NTU A;  4J9L A;  3D2N A;  5L1M A;  3RR8 A;  2KZ3 A;  4DF4 A;  3LWL A;  2Q0Z X;  5AM1 A;  5KFL A;  1OUQ A;  4JK1 A;  3RB4 A;  2F2A B;  4UB8 U;  3HP6 A;  4IRK A;  3NRW A;  4IQT A;  4AYB C;  1U45 A;  3C28 A;  3Q8K A;  5KNI A;  2MUT A;  1WWV A;  3GIL A;  3SR6 A;  3WK9 A;  4RQ1 A;  4F2S A;  1FFU A;  7ICK A;  1KL9 A;  5KFQ A;  5J29 A;  3NGD A;  5AKL A;  1LV5 A;  4EEK A;  2KKP A;  2RHF A;  5CA7 A;  5AKY A;  4M04 A;  2BCR A;  2W9A A;  4DQI A;  8ICL A;  5AI0 A;  1KN5 A;  4EEY A;  5KFF A;  4NLN A;  3IRU A;  3T5L A;  5AM5 A;  3RAQ A;  1KTQ A;  2BCV A;  4CRX A;  4M9L A;  4KLD A;  2VJ4 A;  7ICJ A;  9ICQ A;  3PSP A;  3N28 A;  5E79 U;  2PFQ A;  1Z1V A;  2DGZ A;  5KFV A;  1L6N A;  4LVS A;  2O6K A;  4M9N A;  1ZD3 A;  2KJ5 A;  4QWB A;  4Q8E A;  2Y9U A;  5AM3 A;  5D4B A;  2NRX A;  1NK7 A;  3SV3 A;  5AK5 A;  4R8U B;  2A1J A;  4F5P A;  4PL1 A;  2L5Y A;  4UQG A;  3QU9 A;  3M1Y A;  1UQV A;  4F71 A;  2W7P A;  4C4T A;  3QUC A;  2AJQ A;  3FYH A;  5KFK A;  4BWJ A;  1ZQG A;  2K60 A;  4J03 A;  4F5O A;  4AYB F;  2H3Q A;  4EZ9 A;  2ZUB A;  1IG6 A;  4Y2X A;  4DQR A;  5KG1 A;  4J9Q A;  4QWE A;  3K4G A;  1ARO P;  3BS7 A;  4JB3 A;  8ICT A;  1NI3 A;  1SB3 C;  3QX7 A;  5FP0 A;  3THV A;  2KVS A;  1S9F A;  1S77 D;  4DFK A;  4F4Z A;  1YZ7 A;  2K8A A;  2W9C A;  3EUB 2;  5DGB A;  3H0M B;  1DK2 A;  3H0L B;  3MC1 A;  2E1F A;  2B21 A;  4YFK A;  2H5X A;  5J2F A;  3Q8S B;  2RDJ A;  2ISO A;  8ICK A;  4NL9 A;  5KT4 A;  1X2I A;  3SD7 A;  2G5I B;  3B0Y A;  1KEJ A;  1L3U A;  5EE9 A;  5F3X B;  4C8K A;  3C2M A;  2PFN A;  2UVU A;  3SV4 A;  4CF3 A;  5AKE A;  1ZQX A;  2XGP A;  5KL8 B;  2XVT A;  4RNO A;  5AK4 A;  5CEH A;  2HDO A;  3MR2 A;  1BPZ A;  1BPB A;  4IL6 U;  3MR6 A;  4IRD A;  4NLG A;  3ETR A;  4M9G A;  8ICB A;  3QEB Z;  5KAF U;  9ICR A;  2LM4 A;  1S97 A;  4YXJ A;  4KTQ A;  1UCV A;  1PVP A;  4UAW A;  4YMO A;  4M0A A;  2EZZ A;  4NM2 A;  1U9L A;  2W03 A;  4G9B A;  4K4H A;  2HOF A;  3IHQ B;  5HR6 A;  3M9O B;  3GIM A;  1K5O A;  3C2K A;  4WJ3 B;  4Z6F A;  3C23 A;  2NO5 A;  3GQC A;  1B0X A;  1LB2 B;  4NV0 A;  2K8C B;  1YZ6 A;  4DLE A;  2DKZ A;  1MQ3 A;  2HHS A;  1T7P A;  3PW7 A;  4QZH A;  5KFU A;  8ICA A;  4DS4 A;  5CHG A;  5J8Y C;  4BX9 C;  1WUD A;  2B0C A;  9ICA A;  2KJ9 A;  2CN1 A;  1IIP A;  2WB1 C;  4J9R A;  3UMB A;  3OSP A;  1M6Y A;  2HW3 A;  3NVY A;  3RB3 A;  3GII A;  4F5N A;  3M6Z A;  1PK1 A;  5KG5 A;  4ECR A;  1F5S A;  3HKZ F;  2H3V A;  4RUA A;  2IOF K;  2YMQ A;  5DGA A;  4R64 A;  4YMM A;  5ALQ A;  3QYP A;  3NRZ A;  5KFT A;  4PHA A;  1N63 A;  3TAR A;  9ICJ A;  7ICV A;  2YX8 A;  2WF6 A;  2FPL A;  2I1Q A;  1JRO A;  1NKB A;  4ECQ A;  1AQ6 A;  1Z00 A;  3GV5 B;  3K1R B;  3GV8 B;  1Z4N A;  5J2D A;  1KW4 A;  1NK9 A;  3RBE A;  4FBT A;  5AKK A;  1HUZ A;  4Z6C A;  4KLQ A;  1N61 A;  4ACO A;  5AKH A;  4EEN A;  3MR5 A;  2EAP A;  4M6W B;  2Y1I A;  3PO4 A;  3RB6 A;  4BJQ A;  2F1J A;  3K1Z A;  1XWL A;  4KN7 A;  5J0T A;  1T3Q A;  2AHO B;  4XA5 A;  5AI6 A;  4JV1 A;  4KLT A;  5KG0 A;  3GDX A;  4F72 A;  3KKA C;  5T14 A;  3PX0 A;  1RYR A;  5J0P A;  3H0R B;  4PGQ A;  4TUR A;  9ICF A;  3QXG A;  2I5H A;  4BXO B;  3SEN A;  3A0H U;  5IIL A;  4E0D A;  5KFZ A;  1J97 A;  1N62 A;  4B6J A;  4DWI A;  4DL4 A;  3UQ2 A;  4RPZ A;  4FZN A;  2HHX A;  8ICG A;  5L9X A;  2K4H A;  5EE0 A;  3H40 A;  5BPC A;  1ZQR A;  1U49 A;  3PO5 A;  3PSF A;  4UAS A;  2YTU A;  2AQ0 A;  2H3F A;  3RAX A;  4PH5 A;  1X42 A;  2W9B A;  1XO0 A;  1TKD A;  1ZYQ A;  3QE9 Y;  3JPT A;  2D3D A;  4FE3 A;  9ICG A;  3OHA A;  4DSJ A;  4C8L A;  2KZZ A;  3T5H A;  1ZJM A;  3OJU A;  1S10 A;  4DFP A;  2JGA A;  5JRT A;  5DBA A;  3WK7 A;  2ZIV A;  2BCU A;  5ALO A;  2WHE A;  3M8S A;  2HOI A;  1OW5 A;  4KX3 A;  2EZY A;  9ICN A;  2ZUD A;  5KG3 A;  3F5E A;  1B22 A;  3MAB A;  2OHF A;  3OSN A;  1IV8 A;  3Q8M A;  7ICT A;  4QIW F;  5AKI A;  1TK8 A;  3RJH A;  3L5K A;  3NVW A;  2JHD A;  3M6K A;  1FFV A;  7ICE A;  3RJF A;  3H8W A;  2WF7 A;  2ZIX A;  2CXY A;  1PVR A;  1ZOL A;  1TVA A;  3PV8 A;  2ZIU B;  1ZRN A;  1QSS A;  5IIN A;  1YT3 A;  9ICX A;  1Q46 A;  1KQQ A;  3JPQ A;  5DLF A;  5ALP A;  9ICW A;  2AXT U;  3ZI4 A;  4YN4 A;  2ODG A;  3RJI A;  4QW8 A;  4QZE A;  4PGX A;  3PW2 A;  4J9O A;  3BS5 A;  5DB9 A;  4O3M A;  4M9J A;  3PZP A;  2W11 A;  4QZ9 A;  1XC9 A;  5L1J A;  4LZD A;  1WWU A;  3KZX A;  3QUT A;  2P6R A;  5ALG A;  5J8Y A;  5J0X A;  3J81 j;  4KLF A;  3TQ1 A;  2LKY A;  4EYI B;  1MC8 A;  2HSZ A;  2G07 A;  4Y2R A;  2QAR A;  4OCZ A;  2HHQ A;  2ASD A;  3QU7 A;  5AKG A;  3MDA A;  2YN4 A;  2EAM A;  4PGY A;  4NWI A;  1S0N A;  2IMW P;  4O5E A;  4CF4 A;  5EOZ A;  5KFA A;  1ED1 A;  1N56 A;  1WG8 A;  4YR0 A;  5KFR A;  4YQW A;  3WK5 A;  3SMV A;  2K4I A;  2F3N A;  2KEY A;  2AGO A;  2XID A;  2NRZ A;  2MAX A;  5KG6 A;  2G5H B;  1N5X A;  3RTV A;  3HPO A;  4YXM A;  1RXV A;  5D46 A;  4DLG A;  3T5J A;  3F53 A;  7ICF A;  1COO A;  3IDW A;  8ICO A;  5DQI A;  3WKB A;  3ALR A;  2ZG6 A;  3AQF A;  1T3N A;  8ICC A;  3SZ2 A;  4I2G A;  2XCA A;  1BNO A;  2DKX A;  3EYZ A;  4B9U A;  4DL7 A;  3PML A;  1B4F A;  4YD1 A;  5CWR A;  2EAN A;  1Z19 A;  4Y2J A;  4HYK A;  3PY8 A;  2DL0 A;  2E3T A;  1UT5 A;  3T79 A;  4P2H A;  4C7Z A;  3MBY A;  4RT3 A;  5CJ7 A;  2DPJ A;  3MFH A;  3H4B A;  5HML A;  1NJY A;  3ZDB A;  4MF2 A;  5KFB A;  2E8O A;  1C7Y A;  1CUK A;  4NJ8 A;  2QLT A;  5KAI U;  4DQS A;  1F0M A;  5L1I A;  1NK4 A;  4P0Q B;  9ICO A;  1DK3 A;  3CW2 C;  3IM1 A;  1NZB A;  1X9S A;  4J9M A;  2PMZ C;  3KHG A;  4CGZ A;  3QEA Z;  2YMP A;  3WK6 A;  4UW9 A;  5DDY A;  2E1E A;  4YP3 A;  1RQL A;  3QNM A;  2VJ5 A;  2YY6 A;  2GLE A;  4ECT A;  1TE2 A;  4J9N A;  3LVV A;  1ZXI A;  2ALZ A;  4P0P A;  1ZQQ A;  3UXP A;  9ICU A;  2OH2 A;  3OJS A;  4I28 A;  4F91 B;  4ECX A;  4OO1 J;  3ISB A;  7ICG A;  3DV9 A;  7ICR A;  4RQ8 A;  4PHP A;  2HVH A;  5EWG A;  1ZQB A;  3N7P D;  4F93 B;  3G6Y A;  5IIO A;  3TAQ A;  3U26 A;  1KSP A;  2CPR A;  4YVZ A;  5DLG A;  5ALR A;  2LYA A;  4RUC A;  5AKZ A;  4ED2 A;  3MGI A;  4P4P A;  2ZTD A;  4JV2 A;  4BGD A;  1BGX T;  5KT7 A;  4BXO A;  1JXL A;  5KG4 A;  3C29 A;  1LKY B;  2I6X A;  3HKZ C;  4CCH A;  3RJK A;  2ZTC A;  5GTI U;  3V6K A;  2VA3 A;  1QQ6 A;  3PR4 A;  1QQ7 A;  2BPG A;  7ICP A;  3PX6 A;  4OJL A;  2DUY A;  1FO4 A;  1S5L U;  2WF5 A;  3DEE A;  1QQ5 A;  2ZXI A;  2JEJ A;  3H8S A;  2Y1J A;  2G09 A;  4ICA A;  1RM6 C;  2K8B B;  3V72 A;  3H8J A;  2NYV A;  5J2J A;  2IHN A;  8ICR A;  4RQ0 A;  4C4S A;  1SXE A;  2ESE A;  3NVZ A;  1F44 A;  4O0I A;  5DB8 A;  3V6J A;  2JH7 A;  4ED0 A;  1L8O A;  5CRX A;  4BDP A;  4TQR A;  4DSI A;  4KLU A;  3N7S C;  1NK8 A;  3TAP A;  5DBB A;  1UPH A;  3ZDD A;  4DL6 A;  2MUT B;  2OYY A;  9ICB A;  2PI4 A;  5CP2 A;  3H8M A;  1XO1 A;  2IBK A;  3RRH A;  1QSY A;  5JUM A;  1MA7 A;  4GXK A;  3KD3 A;  5G5H A;  4CNQ A;  4UB1 A;  1DRG A;  4EX7 A;  2W3S A;  4FBU A;  4ELU A;  5KFJ A;  1JRP A;  3PNC A;  3UPQ A;  3KHR A;  4FS1 A;  1RYS A;  1ZQI A;  2QAR B;  4F5Q A;  1IM4 A;  3MGV A;  2GO7 A;  4K4I A;  2CRX A;  4US8 A;  1ZQT A;  1CEZ A;  3WKE A;  1ZD5 A;  1WYG A;  1TV9 A;  3M8R A;  2AGQ A;  5J0W A;  2V4R A;  3MDC A;  1T4G A;  5J0O A;  4XUS A;  3V7J A;  1ZQJ A;  3LWM A;  4DQP A;  2KD1 A;  5CB1 A;  4A8E A;  2KKV A;  3NVV A;  4RZR A;  5J2C A;  5KFI A;  4KLH A;  3D2S A;  3IG8 A;  2GOL A;  4NL9 C;  4R65 A;  1LKY A;  4RPY A;  3QUQ A;  5K4L A;  3LK9 A;  5AIB A;  2HHV A;  2F77 X;  4I27 A;  3RJG A;  5ALZ A;  5EE1 A;  3CP8 A;  3OTQ A;  2R8G A;  4Z6E A;  5DB6 A;  4TUS A;  5ALJ A;  1V9P A;  2KHQ A;  3G6X A;  4NLB A;  5AI4 A;  4O3N A;  2XY7 A;  2J6T A;  1SWV A;  4IR1 A;  3BJY A;  1N48 A;  5KL1 B;  4R8U A;  3RJE A;  4MFC A;  3Q8Q B;  2DWQ A;  9ICS A;  4ZH4 A;  2R18 A;  1OXJ A;  3FDS A;  5AM4 A;  3C2L A;  5DQH A;  4I2J A;  4F8R A;  4UAU A;  1KLN A;  3TKA A;  4MEX A;  4KLE A;  3GU3 A;  5ALE A;  4C4R A;  1U47 A;  4Q44 A;  1SV0 A;  9ICV A;  4GXJ A;  3RH5 A;  5AKJ A;  4Y2U A;  4ECS A;  5B66 U;  3FM9 A;  1K1S A;  4HAI A;  3IV6 A;  1ZD4 A;  4DOC A;  9ICK A;  3PW0 A;  2GH1 A;  2RP5 A;  1SZH A;  5AI8 A;  2G0A A;  3ZD8 A;  2PKE A;  5EE3 A;  5KFC A;  4UBB A;  1KBU A;  4GLX A;  1L7P A;  2PI5 A;  4Y2S A;  5C0Y A;  2KIW A;  3SI8 A;  4DEZ A;  3EPI A;  1Q3V A;  4B9N A;  2LYH A;  2FMP A;  1KKX A;  3WKC A;  3AUO A;  9ICH A;  1FEZ A;  2F44 A;  1ZQO A;  2C2E A;  2KP7 A;  3EPG A;  1X6J A;  2JH1 A;  4Y2Y A;  1X6I A;  3T5K A;  2R8I A;  2IOH A;  3HJE A;  3JPP A;  4QIW C;  4X5V A;  3GIK A;  2MU2 A;  4B9T A;  2ZIX B;  3JPS A;  1SKW A;  4O3O A;  4US9 A;  2UVR A;  4DOB A;  4F5R A;  2J6S A;  5HHH A;  5ALF A;  5J0U A;  2HVI A;  2C28 A;  1C20 A;  2KK0 A;  1RG6 A;  3M9N B;  2KG5 A;  4F2R A;  5ALU A;  2R8J A;  4KMU A;  2N1R A;  2HHW A;  8ICM A;  1HIW A;  5J0S A;  2K4E A;  2BQ3 A;  2R8K A;  3QZ8 A;  3TAN A;  4ED1 A;  1VJ5 A;  4CE6 A;  4QJF B;  1Y88 A;  2AU0 A;  4P0P B;  5AM0 A;  4YR2 A;  1SZP A;  5KG2 A;  4O3S A;  3MFI A;  2M9N A;  4PL2 A;  2MRL A;  4ECU A;  4GC6 A;  4TUP A;  2KFN A;  2OCE A;  4DSE A;  2A3V A;  4YCX A;  2LYB A;  2LPE A;  5F9N A;  2FDR A;  1Z1B A;  4UAT A;  1BPY A;  9ICE A;  1RPL A;  4ECZ A;  5GTH U;  3PR5 B;  5TZV A;  4YR3 A;  5BOM A;  2M0N A;  5HHI A;  3EZ5 A;  1JI7 A;  2W3R A;  4O3P A;  4FO6 A;  3GZF A;  1H38 A;  5ALX A;  5KFG A;  4XRH A;  4JMU A;  3IP4 B;  7ICH A;  4Y2T A;  2VA8 A;  4DFM A;  3EW9 A;  2AH5 A;  2Y0S F;  1QCK A;  2KOB A;  1ZQZ A;  4RQ5 A;  1A0P A;  4FFD A;  4U7C A;  3AU6 A;  4I2F A;  4NLZ A;  2DQN B;  1URJ A;  5J0R A;  4FS2 A;  4F4K A;  3ONN A;  1COK A;  2OEH A;  3CRX A;  4RNN A;  5J0Q A;  1VDV A;  2W9C B;  1NJX A;  2WFA A;  3EWA A;  4KN4 A;  5ALV A;  1S76 D;  2EZX A;  4DL2 A;  1U4B A;  1B43 A;  2W04 A;  2VAN A;  4UAV A;  4EBC A;  4MF8 A;  2Q4T A;  5KFY A;  4F92 B;  2JZB B;  4UB6 U;  4ED3 A;  2KTQ A;  2FLP A;  4PHE A;  4PPX A;  4DFD A;  4GC7 A;  4UBC A;  3BQ2 A;  2BQR A;  2HBJ A;  5DG8 A;  4AP9 A;  4UB5 A;  3KOO A;  5DB7 A;  2ZIW A;  1JXE A;  4DFJ A;  8ICJ A;  3CYM A;  4FZM A;  3C5F A;  5III A;  3HW8 A;  2YB1 A;  1X40 A;  2K89 A;  5KFM A;  4EBE A;  1UHU A;  2VKQ A;  4I29 A;  2HI0 A;  5G5G A;  5IIJ A;  3KZI U;  1KDH A;  1SXD A;  2HMX A;  2E8N A;  2PXI A;  2P66 A;  1ZQU A;  2KHV A;  4KIT B;  3N97 B;  1O08 A;  5ALN A;  3RJJ A;  2H3I A;  4DS5 A;  5KFS A;  8ICX A;  3RH6 A;  4I2D A;  4EX6 A;  2XIC A;  3E2E A;  3ICX A;  4KLI A;  3Q8R B;  5AI5 A;  8ICI A;  2PMZ F;  5CR0 A;  2JZB A;  5KFH A;  1NK5 A;  3ED5 A;  4IR9 A;  1TFR A;  5A0L A;  4RQ4 A;  4ED8 A;  4ED6 A;  2HBL A;  3BQ0 A;  2ZXH A;  2KZM A;  5AIA A;  1ZQV A;  3BS5 B;  1KRP A;  1XSL A;  2ZIW B;  1J2M A;  1A76 A;  3BDP A;  3SEI A;  4PHD A;  2XO7 A;  5KTQ A;  4G3I A;  2FPM A;  3AN1 A;  3QU5 A;  5DDM A;  2XY6 A;  1TK5 A;  4C7Y A;  8ICQ A;  5DQG A;  2EDU A;  2OM6 A;  2KV2 A;  3V7K A;  3RB0 A;  2HBK A;  5ALY A;  2W8K A;  3B9J A;  3SAG A;  2D8C A;  3QUB A;  3KKA A;  3TAD C;  3HWT A;  4EEL A;  4IC9 A;  2JEG A;  2IOF A;  2Z7J A;  3JPR A;  2HCF A;  1FIQ A;  4I2A A;  4I2B A;  1ZQF A;  2W43 A;  2NV3 A;  1UT8 A;  2B6G A;  3K75 D;  4TQS A;  1PK3 A;  4KLM A;  2WAQ F;  5KT3 A;  1ZJN A;  5AHX A;  1TK0 A;  1N60 A;  3N4M B;  1XNS A;  1D9D A;  1PZN A;  1JMS A;  5KFO A;  2DPI A;  2W54 A;  4DL5 A;  3WKA A;  3TAD A;  3I1Y A;  2A19 A;  2ZJ8 A;  2JXJ A;  5AK3 A;  4F4W A;  4RQN A;  4RPX A;  7ICI A;  4DF8 A;  1WCN A;  3PSI A;  3HX0 A;  4J9S A;  1L3T A;  4NY8 A;  4PJ0 U;  9ICP A;  4MFA A;  4IS7 A;  3OHB A;  4M6W A;  2A1J B;  1ZQC A;  3PVX A;  3AL0 B;  4B9M A;  1T8E A;  2AQ4 A;  2WF8 A;  1SKS A;  3TFR A;  1EXN A;  2XI9 A;  3SYZ A;  4JWM A;  2KNJ A;  4ZOH C;  2IA6 A;  4YG2 A;  2BHN A;  3HRD D;  1SIJ A;  3AQE A;  3ZDC A;  5HP4 A;  1XS9 D;  5KFN A;  3LYS A;  3BQ7 A;  3TFS A;  5ALL A;  3KHH A;  2LBO A;  2HHU A;  3AMZ A;  3H7I A;  3NUQ A;  4DSF A;  4LJX A;  3ISD A;  4UAR A;  2FPK A;  3NAS A;  1L3V A;  8ICY A;  1DXS A;  2KSO B;  8ICV A;  7ICM A;  2ZUC A;  1N5W A;  4Q8F A;  2QB1 A;  8ICS A;  1XSN A;  3UMG A;  1TAQ A;  4PZO A;  5KT6 A;  3QU4 A;  5L1K A;  3ZDA A;  2MA1 A;  4JV0 A;  7ICQ A;  3R9K A;  2FLL A;  4P4O A;  7ICL A;  5AM2 A;  3D6J A;  3PX4 A;  5J2I A;  4EBD A;  4K4G A;  1S0O A;  1NKC A;  2KMD A;  2QKQ A;  2BCQ A;  1JAL A;  1D9F A;  4ELV A;  3TI0 A;  3ISC A;  1NJZ A;  1SV4 A;  2FLN A;  1ZQY A;  5J2B A;  2Y0S C;  3IN5 A;  1KFS A;  4ELT A;  2AGP A;  3BQ1 A;  5F9L A;  5J2A A;  1WCL A;  4M2Y A;  3VCB A;  1L3S A;  2KFZ A;  4Q43 A;  4RQ7 A;  1SL2 A;  3OGU A;  3C1Y A;  3SAH A;  4UB3 A;  4RQ3 A;  5KT2 A;  4RT2 A;  8ICH A;  3AEV A;  1D8B A;  4UB2 A;  3KTQ A;  4B9L A;  4C8N A;  2OWO A;  4QWC A;  2KIC A;  1QSL A;  4U6P A;  3KBB A;  3E58 A;  2E8P A;  3PST A;  2W9M A;  5JTI A;  2YQE A;  1ZQN A;  1ZQA A;  1Z4O A;  9ICT A;  1QH9 A;  4RNM A;  2UVW A;  3RRG A;  4NLK A;  4LZG A;  4C8M A;  2BKE A;  3GFK B;  5J2K A;  4KLL A;  1ZQD A;  2ZJA A;  4ECW A;  2XGQ A;  4UAZ A;  4Y2P A;  2HBM A;  4C8O A;  3WU2 U;  4EYH B;  1RDF A;  1D8Y A;  3KHL A;  4OD0 A;  5DKW A;  5C5J A;  2FE9 A;  4DL3 A;  1Q8K A;  1UA1 A;  2KJ8 A;  1S0V A;  1TAU A;  3S6J A;  5ALH A;  3TAC B;  1ZET A;  3D2Q A;  4I2I A;  4QZA A;  1K1Q A;  2YB4 A;  5IIK A;  2BGW A;  3LDA A;  1NOM A;  3PMN A;  2ASL A;  3RR7 A;  1MQ2 A;  2RQ5 A;  4OJP A;  1TAM A;  1D8L A;  2UVV A;  2JRZ A;  3QU2 A;  1ZQH A;  3OPX A;  2RLT A;  1L7M A;  3V7L A;  5AKX A;  1SV0 C;  1CI4 A;  4BUG A;  4Z6D A;  2BR0 A;  1ZQK A;  5B5E U;  5EWF A;  1MN8 A;  3F2C A;  5ALT A;  4DOA A;  4QNL A; 
#chains in the Genus database with same CATH homology
 3IDW A;  5F3X B;  2KIV A;  2F8K A;  3K1R B;  2ES6 A;  1V85 A;  2LPE A;  1KW4 A;  2DKX A;  2QAR B;  4IS7 A;  1Z1V A;  1SGG A;  1PK1 B;  2EAP A;  1B4F A;  1JI7 A;  2EAN A;  2QB0 B;  4RQM A;  2Y9U A;  2E8P A;  3KKA C;  2Y9T A;  1UCV A;  3BS5 B;  2EAO A;  2DL0 A;  5JTI A;  1LKY B;  1X9X A;  3HIL A;  4RQN A;  3BQ7 A;  2F44 A;  3SEI A;  5JU5 A;  1X66 A;  3BS5 A;  3SEN A;  2L5Y A;  1COK A;  4NL9 C;  1LKY A;  1V38 A;  1UQV A;  2E8O A;  1B0X A;  4NJ8 A;  1WWU A;  5L1M A;  2K60 A;  1DXS A;  2KSO B;  5J8Y A;  1F0M A;  2FE9 A;  2K4P A;  2QB1 A;  2DKZ A;  2D8C A;  4PZO A;  3KKA A;  3TAD C;  2KSO A;  2YTU A;  2QAR A;  5J8Y C;  3TAC B;  3BS7 A;  5KNI A;  1WWV A;  1RG6 A;  1SXE A;  2JV3 A;  2ESE A;  2KG5 A;  2EAM A;  2D3D A;  2B6G A;  2KMD A;  2LMR A;  2QKQ A;  2GLE A;  1PK3 A;  2KE7 A;  1PK1 A;  1SV4 A;  4MHV A;  1OXJ A;  1SV0 C;  2E8M A;  2F3N A;  5JRT A;  1X40 A;  3TAD A;  1OW5 A;  1SV0 A;  4NL9 A;  3H8M A;  1SXD A;  2QB0 A;  4PZN A;  2E8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...