1SXDA

Solution structure of the pointed (pnt) domain from mgabpa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
GSHMAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription, signaling protein
molecule keywords GA repeat binding protein, alpha
publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxdA00
2F8KA 3TACB 2QB1A 5JTIA 2D8CA 2EAPA 2KIVA 2LMRA 4RQMA 2QKQA 3SEIA 5L1MA 1SV4A 2QB0B 1WWVA 2E8MA 3BS5A 1V38A 1OW5A 1COKA 2EAMA 2K60A 3IDWA 4NL9C 1F0MA 4IS7A 5JRTA 1RG6A 3HILA 2JV3A 2F3NA 4NL9A 4NJ8A 4RQNA 1SXEA 2FE9A 1DXSA 1SGGA 3TADC 3H8MA 1UQVA 3K1RB 3KKAC 1SXDA 1PK1A 1X40A 1WWUA 3TADA 3KKAA 2LPEA 2QARA 2ES6A 3BS7A 2KE7A 2DL0A 4PZNA 2KSOA 5J8YA 2E8NA 1UCVA 1SV0C 1JI7A 3BS5B 2D3DA 2E8PA 4MHVA 2KMDA 1PK3A 1LKYA 1SV0A 2K4PA 2Y9TA 2E8OA 2GLEA 2QARB 3SENA 1KW4A 5J8YC 2DKZA 4PZOA 1Z1VA 1X66A 2KSOB 2F44A 2ESEA 3BQ7A 5JU5A 2QB0A 2L5YA 2EANA 1X9XA 2KG5A 5F3XB 2B6GA 2YTUA 1B4FA 1OXJA 2DKXA 2Y9UA 1PK1B 1B0XA 1LKYB 5KNIA 1V85A 2EAOA
chains in the Genus database with same CATH superfamily
2ZIUA 3GIKA 4ECZA 4GXIA 4OJPA 3NVVA 5AIAA 2HHWA 3I76A 2IOFK 4KLIA 1V38A 2KD1A 4MFCA 2R8JA 3E0FA 2WB1C 3FM9A 3C5FA 5KFUA 4FBTA 2K4IA 3M8RA 1L3SA 4J9QA 3WKCA 4PH5A 2BQUA 1S77D 3I28A 2XICA 3WK9A 1B43A 4QW9A 2ZIVA 1L3VA 3N28A 2BKEA 5BOLA 1Z4OA 5E79U 4CRXA 4ZOHC 3ED5A 2PXIA 2DL0A 1LB2B 4YXMA 3SMVA 3QNMA 1ZJNA 5J8YA 1NJYA 5EWGA 5KT4A 3V7KA 3RJKA 2E8PA 3NS1A 2GH1A 4TUQA 1SKWA 4KLOA 3SENA 2FMSA 2PMZF 1KW4A 4Y2TA 4P4MA 4J9MA 1Z1VA 1X66A 1KLNA 2MUTA 4Z6CA 5D49A 1S0NA 3KOOA 4YD2A 3ISCA 3T3FA 1Q8KA 5L9XA 4QWEA 4RQ7A 2BZFA 1ZQLA 2YTUA 1IV8A 8ICXA 3GDXA 3RBDA 1V85A 4QZAA 2EAOA 9ICBA 4YP3A 7ICSA 3IP4B 2HOFA 3BJYA 4ED8A 4Y2VA 3MABA 5KG6A 4LZGA 5ALYA 3HT3A 4CDGA 4GC7A 5EE9A 1ZQCA 3GV8B 3KHLA 3ZD8A 1XSLA 2KFNA 4QNLA 4F5RA 4I2BA 4Q43A 4UB6U 2H3VA 5DLGA 3UMGA 4KLLA 3H8JA 2VIXA 2XCPA 1BPDA 1V9PA 2YX8A 3FYHA 8ICNA 2MUTB 4DF4A 1SB3C 1A0PA 4KN7A 1TAMA 3H7IA 3A0BU 1TK0A 2W8KA 2AXTU 1XS9D 1DOQA 4PGQA 2BCRA 3SV4A 4OCZA 4F5NA 4P2HA 3M6KA 3HWTA 3T5JA 4F92B 2LPEA 1ZQQA 2FI1A 2KV2A 5DGAA 2KE7A 4J03A 1S5LU 2PFPA 4ECXA 4PZNA 4DOAA 2PI4A 4UASA 3IN5A 5DQGA 4RPYA 1S9FA 2LHTA 3H4BA 3V7LA 2P6UA 4YMOA 2I6XA 1NKCA 2ZIXA 5L1LA 4ELVA 1SV0A 2RDIA 4XRHA 2E8OA 2YMMA 4ELUA 2DFLA 2HHXA 4FBUA 2DF4B 2ATLA 4PZOA 4O3MA 4Q8FA 3RFAA 3GZFA 3HKZF 2ZTEA 3DDHA 2DGZA 1C20A 4I2HA 2B6GA 3QYPA 4BUGA 2LM1A 1A6SA 3LWMA 3PX4A 3MC1A 2N1RA 2W9CB 8ICUA 5J2CA 4RNMA 2WF7A 4I2CA 4UW9A 3ETLA 2C22A 3MR3A 4QZCA 2FMPA 2GWSA 1C7YA 4PHEA 1ZQFA 3U26A 2JH7A 2NRTA 2ALZA 2OHFA 3VCBA 4DQRA 4NL9C 1AROP 8ICSA 4QZIA 4RPXA 1X6JA 4B6JA 4X5VA 2J6TA 5DBCA 3LDAA 3WKDA 1ZQOA 4UAWA 3Q8RB 4KMUA 5KFHA 2KN7A 3RJJA 3K1RB 4RUCA 3R9KA 4I2IA 2KTQA 4FS2A 4IRKA 2JH1A 3IHQB 1WWUA 2AGOA 2KZ3A 4FZLA 1JIHA 8ICKA 1NK6A 5KFRA 1D9FA 9ICEA 2W55A 3TFSA 2I9GA 2ASDA 2YB4A 2GO7A 2JRZA 2HI0A 5ALXA 5IIOA 4DOBA 1SKRA 1T7PA 1RYUA 4XUSA 4RQ3A 3PW7A 5IIIA 4QZDA 1ZQTA 3PW2A 3PSTA 2XI9A 2AH5A 7ICPA 1J2MA 5J8YC 1U47A 2KKVA 3GIJA 2VKQA 1X9MA 1X9WA 3ZDEA 8ICRA 7ICVA 1X9XA 4J9KA 3UXNA 2HW3A 3NGDA 5J2BA 3C29A 3MGHA 4IQTA 3IRUA 1B0XA 4QWCA 8ICOA 1NJXA 5KG7A 3WK7A 1DGSA 5HNKA 8ICYA 9ICCA 5DDYA 4M47A 4DF8A 5CEHA 4C8KA 2HVHA 1X42A 3OHAA 5L1MA 5KL1B 2WAQF 2EZYA 3PVXA 4CE6A 1NK7A 5CB1A 2AHOB 1WG8A 2EAMA 3HJEA 3WK5A 4O3OA 1KQQA 4US9A 5KFPA 2F1IA 3K4GA 4DWIA 2DPIA 1L3UA 3HKZC 7ICJA 4EELA 5AHXA 7ICFA 3Q8MA 2BHNA 3M6ZA 1IG6A 3ZDDA 3PR4A 3KBBA 5CHGA 1D9DA 5AKIA 8ICAA 4B9VA 4YXJA 4B9MA 1D8YA 3UM9A 5J2HA 4MEYA 3RTVA 4KTQA 3KTQA 5GTIU 3E58A 8ICJA 2D6FC 4RT3A 1OUQA 1UPHA 4US8A 1RYSA 4DFMA 5J0UA 4QZ9A 3B9JA 1XC9A 5KFWA 1JI7A 1MQ3A 3V72A 1T8EA 1ZQNA 3SAGA 4Q45A 3H8WA 1ZQVA 3C2MA 9ICFA 3M9MB 4UATA 5AK6A 2VA8A 5ALOA 2BDPA 5J0WA 2Y9TA 4JV2A 4I2AA 5CP2A 4M9HA 4M04A 4RQ2A 2W54A 5C0YA 5G5HA 7ICNA 1O03A 4R64A 3SV3A 2WF9A 1TKDA 1N2XA 2F44A 5JU5A 1XSNA 1HIWA 2G08A 3SI8A 4R65A 5KFMA 2W9BA 5F3XB 5ALFA 1OXJA 3UXOA 5AKGA 1ZD5A 3G6VA 3OSNA 4IRCA 3EWAA 4RQ6A 3GV7B 3MGIA 2WB1F 2QB1A 3NUQA 3PMLA 4O5KA 2DBYA 4BDPA 2KHQA 4MF8A 2QKQA 2LM4A 2O6KA 5J0YA 3GFKB 4QZHA 1J2NA 4JMUA 3QE9Y 1TVAA 1COKA 3C2KA 4ACOA 3C28A 8ICEA 1Q3VA 5KT6A 3NVWA 2R8KA 3AQFA 8ICFA 1A76A 5JRTA 1RG6A 4MEXA 3AU2A 3MR6A 1X9SA 2WF8A 4GXJA 2ZIWA 3WKAA 2RLTA 4KLFA 4YN4A 3BQ1A 2CN1A 1SXEA 5IINA 4J9RA 5J0TA 4O3RA 1NK4A 4KLUA 5GTHU 2KOBA 1SL2A 2HBMA 3EZ5A 2JR5A 5ALDA 4BWJA 1T94A 2W9MA 1KSPA 2HOIA 2JGAA 3F5EA 2WAQC 5AM2A 1S97A 2KVSA 8ICBA 1TK5A 1FIQA 1L7OA 2ISPA 1QCKA 4DSFA 5CRXA 2NV3A 3TANA 4PL1A 3AL0B 2LYAA 4DL4A 1KFSA 5DLFA 5D4BA 3PX6A 1VLBA 4AYBF 2JMGA 4B9NA 2RQ5A 3QUTA 8ICWA 2DUYA 2XGQA 4R63A 2KSOB 9ICRA 2AGQA 4F72A 4PHPA 4JUZA 4DSKA 5AKJA 4DL5A 2DPJA 3WU2U 3JPRA 3KHRA 3AQEA 3JPTA 2K8AA 4YR3A 3ISDA 1RYRA 3QEBZ 5DKWA 3A0HU 3Q8PB 1BPYA 3BZKA 3BS5A 5AI8A 2HBLA 2KZZA 1Z4NA 4FE3A 4EBCA 4I2FA 1ZD2P 4F2RA 1F0MA 1ZQ1C 2W7PA 1NI3A 2BPCA 1PVRA 1ZQYA 4NLNA 1WCNA 1XWLA 4EX6A 3PO5A 2VJ4A 2E1EA 7ICEA 3CYMA 2ODGA 4NL9A 2WTFA 3F5AA 2ZUBA 3ISBA 3AN1A 3ZI4A 3TADC 5KFFA 4IQUA 5DBAA 4EYIB 3UPQA 4ECQA 1ZQEA 1PUZA 1N5WA 4EYHB 5KFGA 4CCHA 4MFFA 4FZMA 1HUZA 2VA2A 2KZMA 2KNJA 3DV9A 8ICQA 3PSFA 2BCQA 3OHBA 3RJFA 1Z19A 4I2GA 3BS5B 7ICKA 4DQPA 4ED3A 4XA5A 2D3DA 3PW4A 2H3ZA 4ECVA 2KMDA 2XY6A 2HHUA 1ZQPA 3V7JA 4DLGA 3WKBA 2MU2A 2NO5A 4PGYA 3QU9A 3IG5A 3OTQA 4C80A 1YZ6A 4ECSA 3QUQA 4QZBA 2A3VA 9ICHA 3BQ7A 3LVVA 3F2CA 1N5XA 3L5KA 2DKXA 5KG3A 1SL0A 4F93B 2HBKA 1NK5A 3HX0A 3PW5A 1ZD4A 1BPBA 4JB3A 3TKAA 3FDSA 4RQMA 4EEYA 4F50A 1JUDA 1SV4A 4QWBA 1WWVA 2Y1JA 3EPIA 1LVHA 2F77X 4UARA 4AYBC 4NM2A 4KLGA 7ICGA 2G06A 5ALEA 4Q8EA 1T4GA 4C8LA 1MC8A 1KRPA 4RQNA 9ICSA 3PZPA 2PI5A 4PHDA 4Y2RA 4KLJA 1URJA 3H0RB 5AKYA 4TQRA 1TAUA 2HMXA 5HHIA 1RXVA 1LV5A 5KAIU 4GXKA 2OCEA 5J29A 4BGDA 4QZFA 5KFDA 2H3FA 9ICOA 3Q8KA 4RQ5A 4J9PA 3NVYA 3L4PA 2H3IA 2XO7A 3RH5A 2GOLA 3WK8A 4A8EA 2FMQA 1ZRNA 2W9CA 3LYSA 1D8LA 1Q3UA 4YMNA 4DFPA 1XU4A 3RR8A 4JV1A 3VC8A 7ICIA 1ZQJA 4UBBA 3C21A 4P4PA 1JXLA 5ALNA 5B5EU 1CUKA 5DQIA 5EOZA 3PMNA 3KHGA 2EZZA 3SR6A 1QSSA 3IV6A 3ICXA 2HHQA 5KT5A 3JPNA 4MF2A 4NM1A 1NK8A 2R18A 2D8CA 3TAPA 4ECTA 1EXNA 5IILA 5EE0A 2NRXA 3D6JA 1KFDA 4M9NA 4F5PA 3ZDCA 4NLGA 4R8UB 2ZTDA 5IIJA 2XY5A 1IXRA 4IQWA 8ICGA 2YN4A 2HOQA 4J9NA 8ICIA 1S0VA 2Y0SC 3BQ0A 5DB7A 2JEIA 3HPOA 1MSWD 4QZ8A 3LVWA 3QU7A 4EBEA 5AIBA 3PY8A 4P0QB 4PHAA 5ALKA 1QSLA 3KKAC 1MN8A 1VDVA 2C28A 9ICTA 5AKHA 1BNPA 2ES6A 4O3PA 1KL9A 3DEEA 2UVRA 2KEYA 4UAUA 3GQCA 7ICRA 1UHUA 2P35A 2NRWA 1ZQMA 2FLPA 3O0FA 1QSYA 1YT3A 1ECWA 2JXJA 2VANA 5KFNA 2NO4A 1K5OA 3QEAZ 3RJEA 2KFZA 4BWMA 5KFEA 4IR1A 2GLEA 1KKXA 2ISOA 2CXYA 5ALTA 4RNNA 5KFSA 2IA6A 8ICCA 2BR0A 4M9GA 3H4DA 2OEHA 2W43A 2KJ5A 1PVQA 3GILA 4Y2UA 2JZBA 7ICQA 2R8IA 5J0OA 4C7YA 5EWFA 4QWAA 4C7ZA 5H2FU 3SD7A 2FPLA 1QQ7A 3SYZA 1SWWA 2EQYA 1XO0A 4NLCA 4CNQA 3L3FX 5KG4A 3THVA 1HJPA 1ZQSA 4UB3A 4J9LA 1J97A 2B21A 2R8GA 4ED1A 1NK9A 1FFVA 4KMOB 1GO3F 8ICHA 4NJ8A 3KHHA 4AP9A 3RRHA 4FZNA 2W9AA 4FS1A 1MA7A 1SXDA 3MFIA 4XQ8A 2JZBB 4I2EA 4C4SA 1HEKA 3ETRA 4DLEA 1KTQA 2DQNB 2JEJA 3TADA 3MBYA 4O3SA 5KFBA 5KT3A 1N48A 5KFOA 2G07A 2EZXA 5A0LA 2A1JB 2EDUA 2YB1A 4GFJA 4F3OA 1KFTA 2WHEA 5IIMA 5AM5A 4B9TA 5TZVA 4QWDA 4DFKA 1T3NA 2I1QA 4Y2QA 2RP5A 5CA7A 2K4PA 1X2IA 5J0RA 1FFUA 4DEZA 4F4YA 3I1YA 2QARB 2VA3A 2W11A 5AM3A 5ALRA 1MQ2A 2JEFA 2YMLA 4K4GA 1ZQHA 4G9BA 3CNHA 1BPEA 2JHDA 5ALPA 2KVCA 1TV9A 1DK3A 3HRDD 2G09A 1Z00B 3M7DA 9ICWA 1XNSA 4TQSA 4Y2YA 5ALUA 3OJUA 3G6YA 2KIVA 5HMMA 2G5IB 2UVWA 3TAQA 1JN3A 3RR7A 2CRXA 4O9MA 3KZXA 1U9LA 3NRWA 1OW5A 4Y2JA 1KN5A 2FDRA 4ECUA 3UQ0A 5KT7A 3V6KA 4DL6A 1ED1A 4M9JA 1S8OA 2KJ9A 2MA1A 4DFJA 4UB8U 5KFYA 3PSIA 4KITB 3RB3A 2CPRA 4F71A 9ICGA 4LZDA 4O0IA 2BCSA 4EX7A 1L6NA 3OJSA 1ZQGA 4J9SA 3M8SA 3TARA 2E1FA 2ZG6A 4DSEA 3BS7A 2BQ3A 4DCCA 4GIBA 1TFRA 4F2SA 1KBUA 4P0PB 2KSOA 5KTQA 4CF5A 2IBKA 4KN4A 4KLHA 4RT2A 1M6YA 4MHVA 5KG2A 2BDUA 5KAFU 4BXOB 2BQRA 2KJ8A 4LVSA 1RQNA 2HDOA 4RNOA 5KFVA 1JXEA 5KFXA 5HP4A 5AICA 2WF5A 9ICJA 2K4EA 1BPZA 4Z6DA 5AI4A 3PV8A 3GU3A 3QX7A 3IG8A 2MSNA 2L5YA 2V4RA 4YD1A 4G3IA 4WJ3B 4EENA 4KLMA 2J6SA 4O3QA 4I2JA 3G6XA 2IOHA 4DSJA 4NLKA 3TACB 4M6WB 5AI9A 5F9LA 1ZETA 4QIWF 2AQ0A 2ZXIA 3QU5A 2K4HA 2LMRA 9ICKA 3SEIA 2PKEA 4FFDA 2A1AA 2C2RA 1L8LA 2PFQA 5J2IA 3ZDAA 3V6JA 4F5OA 1NJWA 1Z3EB 2K60A 4BX9C 1NKEA 3D2NA 4CF4A 4IS7A 5DBBA 3F2DA 3HILA 2AU0A 1IM4A 5AM1A 4GLXA 1COOA 4YVZA 1XO1A 1TAQA 3E2EA 5KFZA 3QUBA 3NASA 1BVSA 1IIPA 2YY6A 1ZQAA 5L1KA 4IL6U 1N56A 4EEKA 1RXWA 4OJOA 3QU2A 5K4LA 4ED7A 3H8MA 3RAXA 3N97B 1P7DA 4NXZA 2KICA 2V4QA 3D2SA 4NV0A 4OD0A 4ECWA 4U7CA 2W03A 3KKAA 4B9LA 1NZBA 5DG9A 2W3SA 3ZD9A 2F8LA 4NLZA 3PW0A 4EBDA 2KP7A 2NRVA 5B66U 1QQ6A 2F1HA 3FC4A 1UCVA 5TISU 4YG2A 2EH9A 3SAHA 4DSIA 1DK2A 5KFJA 3V6HA 7ICOA 4U6PA 3QXGA 2IHMA 1N62A 5AK3A 5CR0A 5AKEA 4Z6FA 4KX5A 4F5QA 4Y2PA 2XIDA 3AEVA 5DB6A 1NNLA 3PX0A 1Y88A 2WF6A 1QQ5A 1QTMA 3H40A 3H0LB 5DG8A 4B9UA 1B4FA 2IMWP 4RQ1A 4B9SA 4I28A 4KLEA 1LKYB 3HW8A 2F8KA 2YMQA 5ALZA 3AMZA 5ALJA 2EAPA 5KFLA 5BPCA 8ICTA 5J2JA 2QB0B 5KT2A 3RBEA 4YMMA 2Y0SF 2QLTA 3SZ2A 2Z7JA 4ECYA 1ZRMA 3Q8SB 3K1ZA 3ORYA 1U48A 2ZIUB 2W04A 2F3NA 3C2LA 2FJ6A 1NOMA 5KG0A 5ALVA 4M9LA 5DQHA 2BPGA 3H0MB 1N61A 4F4WA 4UAVA 4IQVA 1PK1A 2HHTA 1TE2A 4QIWC 4OO1J 2ZXHA 7ICHA 3AM9A 3N4MB 5J2EA 5AKLA 4QZGA 1S10A 4DSLA 3C1YA 3MR2A 3RJHA 2AQ4A 3RB0A 4C8OA 2HCFA 1L7MA 3MR5A 5KL8B 4YR0A 4IRDA 1L7NA 4I27A 8ICPA 3H8SA 2FLNA 1L8OA 3T5KA 2ZIVB 2M9NA 3LWLA 3MFHA 4DL3A 5J2KA 5T14A 1KDHA 4DFDA 2FPMA 1YZ7A 4F4KA 1VJ5A 3N7PD 5F9NA 9ICMA 5J2GA 1JALA 3BDPA 4RQ0A 4JK1A 2F1JA 1KEJA 5KFAA 2E3TA 1PK1B 4I2DA 5JUMA 4QJFB 4OJLA 3PO4A 3LK9A 5KFIA 2IOFA 1N60A 4R8UA 1XSPA 4DOCA 3M9NB 1U49A 2ZJ5A 5JTIA 5J2AA 1RPLA 3J81j 1O08A 3UQ2A 3PNCA 1CI4A 1RZTA 5ALMA 5ALHA 1B22A 4RQ4A 4P0QA 4ED2A 1ZJMA 2UVVA 5DDMA 3Q8LA 2XCAA 1N63A 1S0OA 4LJXA 3KFUF 2XVTA 5AM4A 1A77A 9ICAA 3UMBA 4Y2SA 3NVZA 3JPQA 4NWIA 3AU6A 2AGPA 4PJ0U 4JWNA 9ICVA 2BPFA 5HR7A 2FE9A 4HYKA 5AK5A 4NY8A 1ZQKA 4DQQA 3PR5B 5AKZA 4OJ5A 2OWOA 2ZUDA 4BJQA 1UA0A 3RAQA 4UQGA 4C4TA 4Z6EA 1RQLA 4GC6A 1NZPA 2RHFA 2A19A 5G5GA 7ICLA 2ZJ8A 1T3QA 2E8NA 3B0YA 2LKYA 1CEZA 9ICPA 2J6UA 8ICZA 1H38A 1SL1A 1PZNA 4RQ8A 3RJIA 3WK4A 2OYYA 5HMLA 1CRXA 1NKBA 4JV0A 5ALLA 3MGVA 3GIIA 3SQIA 5CJ7A 3EUB2 5ALWA 5IIKA 4O5EA 3OSPA 2MRLA 2ESEA 1QH9A 1NK0A 4RZRA 2EANA 5FP0A 1SZPA 3RB6A 2ZIXB 2PMZC 2PFOA 2F2AB 5KNIA 4CF3A 4F91B 2B0CA 3NRZA 3BQ2A 5DB9A 2FPKA 5AI0A 2JEGA 2C2EA 2G0AA 4QZEA 1L5UA 2W3RA 2KK0A 3CRXA 5L1IA 5AI6A 1ZQUA 3ALRA 2E8MA 5EWEA 4C8MA 5EE1A 4C8NA 4K4HA 3UXPA 2I5HA 3KD3A 2JV3A 2KHVA 3PSPA 4C4RA 3GV5B 5ALIA 3N7RC 4PL2A 1K1QA 3KZIU 2H3QA 1ZXIA 2RDJA 3K75D 2XGPA 1L3TA 2A1JA 2YMPA 4ELTA 1RM6C 1DXSA 1ZYQA 1SGGA 1JX4A 5DGBA 4YFKA 4UBCA 2V9WA 1S0MA 4RUAA 2R8HA 1DRGA 2RRDA 2PFNA 3M9OB 4K4IA 2G5HB 4ED0A 2QARA 4ECRA 3C1ZA 5J2DA 1ZQIA 4PGXA 1JMSA 1FEZA 2UVUA 8ICVA 4P4OA 3BQTA 1HUOA 3ZDBA 1SWVA 1ZQXA 1DGJA 3EPGA 5J0PA 3JPSA 4KLQA 5CWRA 3RB4A 4RPZA 4O5CA 1Z00A 3SAFA 5ALGA 3F2BA 2BGWA 2ASJA 1FO4A 1U45A 3WKEA 5KFKA 4M0AA 1F5SA 3JPPA 3RF9A 3D2QA 9ICIA 8ICMA 4TURA 4DS4A 2LBOA 4EZ6A 2HHVA 7ICTA 7ICUA 2Q4TA 9ICUA 4FO6A 4DL7A 5AK4A 3T5LA 5ALSA 4Q44A 5ALQA 4UB1A 2W7OA 9ICXA 4R66A 2Y1IA 1WUDA 1ZQWA 1X6IA 4J9OA 1BPXA 2YQEA 2ASLA 2HHSA 5C5JA 2HVIA 3F53A 4KLDA 3RRGA 3ONNA 4QW8A 4IC9A 4KLTA 2DWQA 5HR6A 2BCVA 2ZTCA 5D46A 4OJ6A 3NTUA 2FLLA 5J2FA 2C2DA 4P0PA 3WK6A 4NLBA 4USAA 1ZQBA 1UQVA 1UA1A 5KG5A 1X40A 4BXOA 5EE3A 4PPXA 2P6RA 4E0DA 4EZ9A 3QZ8A 3OPXA 4YQWA 5KFTA 2F76X 2KIWA 5AKXA 5DB8A 3UMCA 1SKSA 2K89A 3CW2C 4YR2A 1TK8A 2IHNA 2ZJAA 4CGZA 1ZQDA 1SV0C 4M2YA 1BNOA 3EW9A 1WYGA 2LYBA 3T79A 3MDAA 5AI5A 2M0NA 3TQ1A 1JROA 4DQSA 2DKZA 4UB4A 4M6WA 7ICMA 2ZUCA 1ZQZA 2HSZA 4C0ZA 1F44A 4O3NA 4TUPA 4UAZA 3B0XA 5AM0A 4UAYA 1L7PA 3EYZA 4ED6A 3CP8A 2W8LA 3T5HA 2XC9A 2MAXA 1SZHA 4Y2XA 4F4ZA 5KG1A 4KX3A 8ICLA 1Z1BA 1WCLA 2NYVA 2P66A 4ICAA 3RJGA 2LYHA 2OH2A 3TFRA 5J0QA 2W9BB 2KKPA 1S76D 3IDWA 1UT5A 2H5XA 5L1JA 3RH4A 4JWMA 1QLNA 1D8BA 5BOMA 4IR9A 1SIJA 4MFAA 4UB2A 1PVPA 2K8CB 1U4BA 3MDCA 1AQ6A 9ICNA 1UT8A 4DS5A 1ZOLA 1JRPA 5J0SA 4RU9A 2VJ5A 5J0XA 3M1YA 1V97A 3S6JA 4DO9A 4F4XA 3GIMA 3HP6A 3TI0A 5KFQA 4F8RA 1BGXT 3QUCA 4HAIA 4UB5A 4I29A 1ZQRA 1RDFA 2ZIWB 4ZH4A 2E5SA 1K1SA 2WFAA 2LI6A 3C5GA 2XY7A 2Q0ZX 4DL2A 1Q46A 2BCUA 3FAHA 3OGUA 2AJQA 1PK3A 1LKYA 3IM1A 1NJZA 4YCXA 2OM6A 3QU4A 2HBJA 1ZD3A 3JPOA 4DQIA 5HHHA 5KFCA 5AKKA 3N7SC 4KLSA 2K8BB 9ICLA 2QB0A 3RH6A 3QZ7A 2KG5A 3AUOA 2Y9UA 2NRZA 5DG7A 2OXOA 4TUSA 3C23A 9ICQA 3BZCA 3Q8QB
chains in the Genus database with same CATH topology
2F8KA 3TACB 2QB1A 5JTIA 2D8CA 2EAPA 2KIVA 2LMRA 4RQMA 2QKQA 3SEIA 5L1MA 1SV4A 2QB0B 1WWVA 2E8MA 3BS5A 1V38A 1OW5A 1COKA 2EAMA 2K60A 3IDWA 4NL9C 1F0MA 4IS7A 5JRTA 1RG6A 3HILA 2JV3A 2F3NA 4NL9A 4NJ8A 4RQNA 1SXEA 2FE9A 1DXSA 1SGGA 3TADC 3H8MA 1UQVA 3K1RB 3KKAC 1SXDA 1PK1A 1X40A 1WWUA 3TADA 3KKAA 2LPEA 2QARA 2ES6A 3BS7A 2KE7A 2DL0A 4PZNA 2KSOA 5J8YA 2E8NA 1UCVA 1SV0C 1JI7A 3BS5B 2D3DA 2E8PA 4MHVA 2KMDA 1PK3A 1LKYA 1SV0A 2K4PA 2Y9TA 2E8OA 2GLEA 2QARB 3SENA 1KW4A 5J8YC 2DKZA 4PZOA 1Z1VA 1X66A 2KSOB 2F44A 2ESEA 3BQ7A 5JU5A 2QB0A 2L5YA 2EANA 1X9XA 2KG5A 5F3XB 2B6GA 2YTUA 1B4FA 1OXJA 2DKXA 2Y9UA 1PK1B 1B0XA 1LKYB 5KNIA 1V85A 2EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8K A;  3TAC B;  2QB1 A;  5JTI A;  2D8C A;  2EAP A;  2KIV A;  2LMR A;  4RQM A;  2QKQ A;  3SEI A;  5L1M A;  1SV4 A;  2QB0 B;  1WWV A;  2E8M A;  3BS5 A;  1V38 A;  1OW5 A;  1COK A;  2EAM A;  2K60 A;  3IDW A;  4NL9 C;  1F0M A;  4IS7 A;  5JRT A;  1RG6 A;  3HIL A;  2JV3 A;  2F3N A;  4NL9 A;  4NJ8 A;  4RQN A;  1SXE A;  2FE9 A;  1DXS A;  1SGG A;  3TAD C;  3H8M A;  1UQV A;  3K1R B;  3KKA C;  1SXD A;  1PK1 A;  1X40 A;  1WWU A;  3TAD A;  3KKA A;  2LPE A;  2QAR A;  2ES6 A;  3BS7 A;  2KE7 A;  2DL0 A;  4PZN A;  2KSO A;  5J8Y A;  2E8N A;  1UCV A;  1SV0 C;  1JI7 A;  3BS5 B;  2D3D A;  2E8P A;  4MHV A;  2KMD A;  1PK3 A;  1LKY A;  1SV0 A;  2K4P A;  2Y9T A;  2E8O A;  2GLE A;  2QAR B;  3SEN A;  1KW4 A;  5J8Y C;  2DKZ A;  4PZO A;  1Z1V A;  1X66 A;  2KSO B;  2F44 A;  2ESE A;  3BQ7 A;  5JU5 A;  2QB0 A;  2L5Y A;  2EAN A;  1X9X A;  2KG5 A;  5F3X B;  2B6G A;  2YTU A;  1B4F A;  1OXJ A;  2DKX A;  2Y9U A;  1PK1 B;  1B0X A;  1LKY B;  5KNI A;  1V85 A;  2EAO A; 
#chains in the Genus database with same CATH topology
 2ZIU A;  3GIK A;  4ECZ A;  4GXI A;  4OJP A;  3NVV A;  5AIA A;  2HHW A;  3I76 A;  2IOF K;  4KLI A;  1V38 A;  2KD1 A;  4MFC A;  2R8J A;  3E0F A;  2WB1 C;  3FM9 A;  3C5F A;  5KFU A;  4FBT A;  2K4I A;  3M8R A;  1L3S A;  4J9Q A;  3WKC A;  4PH5 A;  2BQU A;  1S77 D;  3I28 A;  2XIC A;  3WK9 A;  1B43 A;  4QW9 A;  2ZIV A;  1L3V A;  3N28 A;  2BKE A;  5BOL A;  1Z4O A;  5E79 U;  4CRX A;  4ZOH C;  3ED5 A;  2PXI A;  2DL0 A;  1LB2 B;  4YXM A;  3SMV A;  3QNM A;  1ZJN A;  5J8Y A;  1NJY A;  5EWG A;  5KT4 A;  3V7K A;  3RJK A;  2E8P A;  3NS1 A;  2GH1 A;  4TUQ A;  1SKW A;  4KLO A;  3SEN A;  2FMS A;  2PMZ F;  1KW4 A;  4Y2T A;  4P4M A;  4J9M A;  1Z1V A;  1X66 A;  1KLN A;  2MUT A;  4Z6C A;  5D49 A;  1S0N A;  3KOO A;  4YD2 A;  3ISC A;  3T3F A;  1Q8K A;  5L9X A;  4QWE A;  4RQ7 A;  2BZF A;  1ZQL A;  2YTU A;  1IV8 A;  8ICX A;  3GDX A;  3RBD A;  1V85 A;  4QZA A;  2EAO A;  9ICB A;  4YP3 A;  7ICS A;  3IP4 B;  2HOF A;  3BJY A;  4ED8 A;  4Y2V A;  3MAB A;  5KG6 A;  4LZG A;  5ALY A;  3HT3 A;  4CDG A;  4GC7 A;  5EE9 A;  1ZQC A;  3GV8 B;  3KHL A;  3ZD8 A;  1XSL A;  2KFN A;  4QNL A;  4F5R A;  4I2B A;  4Q43 A;  4UB6 U;  2H3V A;  5DLG A;  3UMG A;  4KLL A;  3H8J A;  2VIX A;  2XCP A;  1BPD A;  1V9P A;  2YX8 A;  3FYH A;  8ICN A;  2MUT B;  4DF4 A;  1SB3 C;  1A0P A;  4KN7 A;  1TAM A;  3H7I A;  3A0B U;  1TK0 A;  2W8K A;  2AXT U;  1XS9 D;  1DOQ A;  4PGQ A;  2BCR A;  3SV4 A;  4OCZ A;  4F5N A;  4P2H A;  3M6K A;  3HWT A;  3T5J A;  4F92 B;  2LPE A;  1ZQQ A;  2FI1 A;  2KV2 A;  5DGA A;  2KE7 A;  4J03 A;  1S5L U;  2PFP A;  4ECX A;  4PZN A;  4DOA A;  2PI4 A;  4UAS A;  3IN5 A;  5DQG A;  4RPY A;  1S9F A;  2LHT A;  3H4B A;  3V7L A;  2P6U A;  4YMO A;  2I6X A;  1NKC A;  2ZIX A;  5L1L A;  4ELV A;  1SV0 A;  2RDI A;  4XRH A;  2E8O A;  2YMM A;  4ELU A;  2DFL A;  2HHX A;  4FBU A;  2DF4 B;  2ATL A;  4PZO A;  4O3M A;  4Q8F A;  3RFA A;  3GZF A;  3HKZ F;  2ZTE A;  3DDH A;  2DGZ A;  1C20 A;  4I2H A;  2B6G A;  3QYP A;  4BUG A;  2LM1 A;  1A6S A;  3LWM A;  3PX4 A;  3MC1 A;  2N1R A;  2W9C B;  8ICU A;  5J2C A;  4RNM A;  2WF7 A;  4I2C A;  4UW9 A;  3ETL A;  2C22 A;  3MR3 A;  4QZC A;  2FMP A;  2GWS A;  1C7Y A;  4PHE A;  1ZQF A;  3U26 A;  2JH7 A;  2NRT A;  2ALZ A;  2OHF A;  3VCB A;  4DQR A;  4NL9 C;  1ARO P;  8ICS A;  4QZI A;  4RPX A;  1X6J A;  4B6J A;  4X5V A;  2J6T A;  5DBC A;  3LDA A;  3WKD A;  1ZQO A;  4UAW A;  3Q8R B;  4KMU A;  5KFH A;  2KN7 A;  3RJJ A;  3K1R B;  4RUC A;  3R9K A;  4I2I A;  2KTQ A;  4FS2 A;  4IRK A;  2JH1 A;  3IHQ B;  1WWU A;  2AGO A;  2KZ3 A;  4FZL A;  1JIH A;  8ICK A;  1NK6 A;  5KFR A;  1D9F A;  9ICE A;  2W55 A;  3TFS A;  2I9G A;  2ASD A;  2YB4 A;  2GO7 A;  2JRZ A;  2HI0 A;  5ALX A;  5IIO A;  4DOB A;  1SKR A;  1T7P A;  1RYU A;  4XUS A;  4RQ3 A;  3PW7 A;  5III A;  4QZD A;  1ZQT A;  3PW2 A;  3PST A;  2XI9 A;  2AH5 A;  7ICP A;  1J2M A;  5J8Y C;  1U47 A;  2KKV A;  3GIJ A;  2VKQ A;  1X9M A;  1X9W A;  3ZDE A;  8ICR A;  7ICV A;  1X9X A;  4J9K A;  3UXN A;  2HW3 A;  3NGD A;  5J2B A;  3C29 A;  3MGH A;  4IQT A;  3IRU A;  1B0X A;  4QWC A;  8ICO A;  1NJX A;  5KG7 A;  3WK7 A;  1DGS A;  5HNK A;  8ICY A;  9ICC A;  5DDY A;  4M47 A;  4DF8 A;  5CEH A;  4C8K A;  2HVH A;  1X42 A;  3OHA A;  5L1M A;  5KL1 B;  2WAQ F;  2EZY A;  3PVX A;  4CE6 A;  1NK7 A;  5CB1 A;  2AHO B;  1WG8 A;  2EAM A;  3HJE A;  3WK5 A;  4O3O A;  1KQQ A;  4US9 A;  5KFP A;  2F1I A;  3K4G A;  4DWI A;  2DPI A;  1L3U A;  3HKZ C;  7ICJ A;  4EEL A;  5AHX A;  7ICF A;  3Q8M A;  2BHN A;  3M6Z A;  1IG6 A;  3ZDD A;  3PR4 A;  3KBB A;  5CHG A;  1D9D A;  5AKI A;  8ICA A;  4B9V A;  4YXJ A;  4B9M A;  1D8Y A;  3UM9 A;  5J2H A;  4MEY A;  3RTV A;  4KTQ A;  3KTQ A;  5GTI U;  3E58 A;  8ICJ A;  2D6F C;  4RT3 A;  1OUQ A;  1UPH A;  4US8 A;  1RYS A;  4DFM A;  5J0U A;  4QZ9 A;  3B9J A;  1XC9 A;  5KFW A;  1JI7 A;  1MQ3 A;  3V72 A;  1T8E A;  1ZQN A;  3SAG A;  4Q45 A;  3H8W A;  1ZQV A;  3C2M A;  9ICF A;  3M9M B;  4UAT A;  5AK6 A;  2VA8 A;  5ALO A;  2BDP A;  5J0W A;  2Y9T A;  4JV2 A;  4I2A A;  5CP2 A;  4M9H A;  4M04 A;  4RQ2 A;  2W54 A;  5C0Y A;  5G5H A;  7ICN A;  1O03 A;  4R64 A;  3SV3 A;  2WF9 A;  1TKD A;  1N2X A;  2F44 A;  5JU5 A;  1XSN A;  1HIW A;  2G08 A;  3SI8 A;  4R65 A;  5KFM A;  2W9B A;  5F3X B;  5ALF A;  1OXJ A;  3UXO A;  5AKG A;  1ZD5 A;  3G6V A;  3OSN A;  4IRC A;  3EWA A;  4RQ6 A;  3GV7 B;  3MGI A;  2WB1 F;  2QB1 A;  3NUQ A;  3PML A;  4O5K A;  2DBY A;  4BDP A;  2KHQ A;  4MF8 A;  2QKQ A;  2LM4 A;  2O6K A;  5J0Y A;  3GFK B;  4QZH A;  1J2N A;  4JMU A;  3QE9 Y;  1TVA A;  1COK A;  3C2K A;  4ACO A;  3C28 A;  8ICE A;  1Q3V A;  5KT6 A;  3NVW A;  2R8K A;  3AQF A;  8ICF A;  1A76 A;  5JRT A;  1RG6 A;  4MEX A;  3AU2 A;  3MR6 A;  1X9S A;  2WF8 A;  4GXJ A;  2ZIW A;  3WKA A;  2RLT A;  4KLF A;  4YN4 A;  3BQ1 A;  2CN1 A;  1SXE A;  5IIN A;  4J9R A;  5J0T A;  4O3R A;  1NK4 A;  4KLU A;  5GTH U;  2KOB A;  1SL2 A;  2HBM A;  3EZ5 A;  2JR5 A;  5ALD A;  4BWJ A;  1T94 A;  2W9M A;  1KSP A;  2HOI A;  2JGA A;  3F5E A;  2WAQ C;  5AM2 A;  1S97 A;  2KVS A;  8ICB A;  1TK5 A;  1FIQ A;  1L7O A;  2ISP A;  1QCK A;  4DSF A;  5CRX A;  2NV3 A;  3TAN A;  4PL1 A;  3AL0 B;  2LYA A;  4DL4 A;  1KFS A;  5DLF A;  5D4B A;  3PX6 A;  1VLB A;  4AYB F;  2JMG A;  4B9N A;  2RQ5 A;  3QUT A;  8ICW A;  2DUY A;  2XGQ A;  4R63 A;  2KSO B;  9ICR A;  2AGQ A;  4F72 A;  4PHP A;  4JUZ A;  4DSK A;  5AKJ A;  4DL5 A;  2DPJ A;  3WU2 U;  3JPR A;  3KHR A;  3AQE A;  3JPT A;  2K8A A;  4YR3 A;  3ISD A;  1RYR A;  3QEB Z;  5DKW A;  3A0H U;  3Q8P B;  1BPY A;  3BZK A;  3BS5 A;  5AI8 A;  2HBL A;  2KZZ A;  1Z4N A;  4FE3 A;  4EBC A;  4I2F A;  1ZD2 P;  4F2R A;  1F0M A;  1ZQ1 C;  2W7P A;  1NI3 A;  2BPC A;  1PVR A;  1ZQY A;  4NLN A;  1WCN A;  1XWL A;  4EX6 A;  3PO5 A;  2VJ4 A;  2E1E A;  7ICE A;  3CYM A;  2ODG A;  4NL9 A;  2WTF A;  3F5A A;  2ZUB A;  3ISB A;  3AN1 A;  3ZI4 A;  3TAD C;  5KFF A;  4IQU A;  5DBA A;  4EYI B;  3UPQ A;  4ECQ A;  1ZQE A;  1PUZ A;  1N5W A;  4EYH B;  5KFG A;  4CCH A;  4MFF A;  4FZM A;  1HUZ A;  2VA2 A;  2KZM A;  2KNJ A;  3DV9 A;  8ICQ A;  3PSF A;  2BCQ A;  3OHB A;  3RJF A;  1Z19 A;  4I2G A;  3BS5 B;  7ICK A;  4DQP A;  4ED3 A;  4XA5 A;  2D3D A;  3PW4 A;  2H3Z A;  4ECV A;  2KMD A;  2XY6 A;  2HHU A;  1ZQP A;  3V7J A;  4DLG A;  3WKB A;  2MU2 A;  2NO5 A;  4PGY A;  3QU9 A;  3IG5 A;  3OTQ A;  4C80 A;  1YZ6 A;  4ECS A;  3QUQ A;  4QZB A;  2A3V A;  9ICH A;  3BQ7 A;  3LVV A;  3F2C A;  1N5X A;  3L5K A;  2DKX A;  5KG3 A;  1SL0 A;  4F93 B;  2HBK A;  1NK5 A;  3HX0 A;  3PW5 A;  1ZD4 A;  1BPB A;  4JB3 A;  3TKA A;  3FDS A;  4RQM A;  4EEY A;  4F50 A;  1JUD A;  1SV4 A;  4QWB A;  1WWV A;  2Y1J A;  3EPI A;  1LVH A;  2F77 X;  4UAR A;  4AYB C;  4NM2 A;  4KLG A;  7ICG A;  2G06 A;  5ALE A;  4Q8E A;  1T4G A;  4C8L A;  1MC8 A;  1KRP A;  4RQN A;  9ICS A;  3PZP A;  2PI5 A;  4PHD A;  4Y2R A;  4KLJ A;  1URJ A;  3H0R B;  5AKY A;  4TQR A;  1TAU A;  2HMX A;  5HHI A;  1RXV A;  1LV5 A;  5KAI U;  4GXK A;  2OCE A;  5J29 A;  4BGD A;  4QZF A;  5KFD A;  2H3F A;  9ICO A;  3Q8K A;  4RQ5 A;  4J9P A;  3NVY A;  3L4P A;  2H3I A;  2XO7 A;  3RH5 A;  2GOL A;  3WK8 A;  4A8E A;  2FMQ A;  1ZRN A;  2W9C A;  3LYS A;  1D8L A;  1Q3U A;  4YMN A;  4DFP A;  1XU4 A;  3RR8 A;  4JV1 A;  3VC8 A;  7ICI A;  1ZQJ A;  4UBB A;  3C21 A;  4P4P A;  1JXL A;  5ALN A;  5B5E U;  1CUK A;  5DQI A;  5EOZ A;  3PMN A;  3KHG A;  2EZZ A;  3SR6 A;  1QSS A;  3IV6 A;  3ICX A;  2HHQ A;  5KT5 A;  3JPN A;  4MF2 A;  4NM1 A;  1NK8 A;  2R18 A;  2D8C A;  3TAP A;  4ECT A;  1EXN A;  5IIL A;  5EE0 A;  2NRX A;  3D6J A;  1KFD A;  4M9N A;  4F5P A;  3ZDC A;  4NLG A;  4R8U B;  2ZTD A;  5IIJ A;  2XY5 A;  1IXR A;  4IQW A;  8ICG A;  2YN4 A;  2HOQ A;  4J9N A;  8ICI A;  1S0V A;  2Y0S C;  3BQ0 A;  5DB7 A;  2JEI A;  3HPO A;  1MSW D;  4QZ8 A;  3LVW A;  3QU7 A;  4EBE A;  5AIB A;  3PY8 A;  4P0Q B;  4PHA A;  5ALK A;  1QSL A;  3KKA C;  1MN8 A;  1VDV A;  2C28 A;  9ICT A;  5AKH A;  1BNP A;  2ES6 A;  4O3P A;  1KL9 A;  3DEE A;  2UVR A;  2KEY A;  4UAU A;  3GQC A;  7ICR A;  1UHU A;  2P35 A;  2NRW A;  1ZQM A;  2FLP A;  3O0F A;  1QSY A;  1YT3 A;  1ECW A;  2JXJ A;  2VAN A;  5KFN A;  2NO4 A;  1K5O A;  3QEA Z;  3RJE A;  2KFZ A;  4BWM A;  5KFE A;  4IR1 A;  2GLE A;  1KKX A;  2ISO A;  2CXY A;  5ALT A;  4RNN A;  5KFS A;  2IA6 A;  8ICC A;  2BR0 A;  4M9G A;  3H4D A;  2OEH A;  2W43 A;  2KJ5 A;  1PVQ A;  3GIL A;  4Y2U A;  2JZB A;  7ICQ A;  2R8I A;  5J0O A;  4C7Y A;  5EWF A;  4QWA A;  4C7Z A;  5H2F U;  3SD7 A;  2FPL A;  1QQ7 A;  3SYZ A;  1SWW A;  2EQY A;  1XO0 A;  4NLC A;  4CNQ A;  3L3F X;  5KG4 A;  3THV A;  1HJP A;  1ZQS A;  4UB3 A;  4J9L A;  1J97 A;  2B21 A;  2R8G A;  4ED1 A;  1NK9 A;  1FFV A;  4KMO B;  1GO3 F;  8ICH A;  4NJ8 A;  3KHH A;  4AP9 A;  3RRH A;  4FZN A;  2W9A A;  4FS1 A;  1MA7 A;  1SXD A;  3MFI A;  4XQ8 A;  2JZB B;  4I2E A;  4C4S A;  1HEK A;  3ETR A;  4DLE A;  1KTQ A;  2DQN B;  2JEJ A;  3TAD A;  3MBY A;  4O3S A;  5KFB A;  5KT3 A;  1N48 A;  5KFO A;  2G07 A;  2EZX A;  5A0L A;  2A1J B;  2EDU A;  2YB1 A;  4GFJ A;  4F3O A;  1KFT A;  2WHE A;  5IIM A;  5AM5 A;  4B9T A;  5TZV A;  4QWD A;  4DFK A;  1T3N A;  2I1Q A;  4Y2Q A;  2RP5 A;  5CA7 A;  2K4P A;  1X2I A;  5J0R A;  1FFU A;  4DEZ A;  4F4Y A;  3I1Y A;  2QAR B;  2VA3 A;  2W11 A;  5AM3 A;  5ALR A;  1MQ2 A;  2JEF A;  2YML A;  4K4G A;  1ZQH A;  4G9B A;  3CNH A;  1BPE A;  2JHD A;  5ALP A;  2KVC A;  1TV9 A;  1DK3 A;  3HRD D;  2G09 A;  1Z00 B;  3M7D A;  9ICW A;  1XNS A;  4TQS A;  4Y2Y A;  5ALU A;  3OJU A;  3G6Y A;  2KIV A;  5HMM A;  2G5I B;  2UVW A;  3TAQ A;  1JN3 A;  3RR7 A;  2CRX A;  4O9M A;  3KZX A;  1U9L A;  3NRW A;  1OW5 A;  4Y2J A;  1KN5 A;  2FDR A;  4ECU A;  3UQ0 A;  5KT7 A;  3V6K A;  4DL6 A;  1ED1 A;  4M9J A;  1S8O A;  2KJ9 A;  2MA1 A;  4DFJ A;  4UB8 U;  5KFY A;  3PSI A;  4KIT B;  3RB3 A;  2CPR A;  4F71 A;  9ICG A;  4LZD A;  4O0I A;  2BCS A;  4EX7 A;  1L6N A;  3OJS A;  1ZQG A;  4J9S A;  3M8S A;  3TAR A;  2E1F A;  2ZG6 A;  4DSE A;  3BS7 A;  2BQ3 A;  4DCC A;  4GIB A;  1TFR A;  4F2S A;  1KBU A;  4P0P B;  2KSO A;  5KTQ A;  4CF5 A;  2IBK A;  4KN4 A;  4KLH A;  4RT2 A;  1M6Y A;  4MHV A;  5KG2 A;  2BDU A;  5KAF U;  4BXO B;  2BQR A;  2KJ8 A;  4LVS A;  1RQN A;  2HDO A;  4RNO A;  5KFV A;  1JXE A;  5KFX A;  5HP4 A;  5AIC A;  2WF5 A;  9ICJ A;  2K4E A;  1BPZ A;  4Z6D A;  5AI4 A;  3PV8 A;  3GU3 A;  3QX7 A;  3IG8 A;  2MSN A;  2L5Y A;  2V4R A;  4YD1 A;  4G3I A;  4WJ3 B;  4EEN A;  4KLM A;  2J6S A;  4O3Q A;  4I2J A;  3G6X A;  2IOH A;  4DSJ A;  4NLK A;  3TAC B;  4M6W B;  5AI9 A;  5F9L A;  1ZET A;  4QIW F;  2AQ0 A;  2ZXI A;  3QU5 A;  2K4H A;  2LMR A;  9ICK A;  3SEI A;  2PKE A;  4FFD A;  2A1A A;  2C2R A;  1L8L A;  2PFQ A;  5J2I A;  3ZDA A;  3V6J A;  4F5O A;  1NJW A;  1Z3E B;  2K60 A;  4BX9 C;  1NKE A;  3D2N A;  4CF4 A;  4IS7 A;  5DBB A;  3F2D A;  3HIL A;  2AU0 A;  1IM4 A;  5AM1 A;  4GLX A;  1COO A;  4YVZ A;  1XO1 A;  1TAQ A;  3E2E A;  5KFZ A;  3QUB A;  3NAS A;  1BVS A;  1IIP A;  2YY6 A;  1ZQA A;  5L1K A;  4IL6 U;  1N56 A;  4EEK A;  1RXW A;  4OJO A;  3QU2 A;  5K4L A;  4ED7 A;  3H8M A;  3RAX A;  3N97 B;  1P7D A;  4NXZ A;  2KIC A;  2V4Q A;  3D2S A;  4NV0 A;  4OD0 A;  4ECW A;  4U7C A;  2W03 A;  3KKA A;  4B9L A;  1NZB A;  5DG9 A;  2W3S A;  3ZD9 A;  2F8L A;  4NLZ A;  3PW0 A;  4EBD A;  2KP7 A;  2NRV A;  5B66 U;  1QQ6 A;  2F1H A;  3FC4 A;  1UCV A;  5TIS U;  4YG2 A;  2EH9 A;  3SAH A;  4DSI A;  1DK2 A;  5KFJ A;  3V6H A;  7ICO A;  4U6P A;  3QXG A;  2IHM A;  1N62 A;  5AK3 A;  5CR0 A;  5AKE A;  4Z6F A;  4KX5 A;  4F5Q A;  4Y2P A;  2XID A;  3AEV A;  5DB6 A;  1NNL A;  3PX0 A;  1Y88 A;  2WF6 A;  1QQ5 A;  1QTM A;  3H40 A;  3H0L B;  5DG8 A;  4B9U A;  1B4F A;  2IMW P;  4RQ1 A;  4B9S A;  4I28 A;  4KLE A;  1LKY B;  3HW8 A;  2F8K A;  2YMQ A;  5ALZ A;  3AMZ A;  5ALJ A;  2EAP A;  5KFL A;  5BPC A;  8ICT A;  5J2J A;  2QB0 B;  5KT2 A;  3RBE A;  4YMM A;  2Y0S F;  2QLT A;  3SZ2 A;  2Z7J A;  4ECY A;  1ZRM A;  3Q8S B;  3K1Z A;  3ORY A;  1U48 A;  2ZIU B;  2W04 A;  2F3N A;  3C2L A;  2FJ6 A;  1NOM A;  5KG0 A;  5ALV A;  4M9L A;  5DQH A;  2BPG A;  3H0M B;  1N61 A;  4F4W A;  4UAV A;  4IQV A;  1PK1 A;  2HHT A;  1TE2 A;  4QIW C;  4OO1 J;  2ZXH A;  7ICH A;  3AM9 A;  3N4M B;  5J2E A;  5AKL A;  4QZG A;  1S10 A;  4DSL A;  3C1Y A;  3MR2 A;  3RJH A;  2AQ4 A;  3RB0 A;  4C8O A;  2HCF A;  1L7M A;  3MR5 A;  5KL8 B;  4YR0 A;  4IRD A;  1L7N A;  4I27 A;  8ICP A;  3H8S A;  2FLN A;  1L8O A;  3T5K A;  2ZIV B;  2M9N A;  3LWL A;  3MFH A;  4DL3 A;  5J2K A;  5T14 A;  1KDH A;  4DFD A;  2FPM A;  1YZ7 A;  4F4K A;  1VJ5 A;  3N7P D;  5F9N A;  9ICM A;  5J2G A;  1JAL A;  3BDP A;  4RQ0 A;  4JK1 A;  2F1J A;  1KEJ A;  5KFA A;  2E3T A;  1PK1 B;  4I2D A;  5JUM A;  4QJF B;  4OJL A;  3PO4 A;  3LK9 A;  5KFI A;  2IOF A;  1N60 A;  4R8U A;  1XSP A;  4DOC A;  3M9N B;  1U49 A;  2ZJ5 A;  5JTI A;  5J2A A;  1RPL A;  3J81 j;  1O08 A;  3UQ2 A;  3PNC A;  1CI4 A;  1RZT A;  5ALM A;  5ALH A;  1B22 A;  4RQ4 A;  4P0Q A;  4ED2 A;  1ZJM A;  2UVV A;  5DDM A;  3Q8L A;  2XCA A;  1N63 A;  1S0O A;  4LJX A;  3KFU F;  2XVT A;  5AM4 A;  1A77 A;  9ICA A;  3UMB A;  4Y2S A;  3NVZ A;  3JPQ A;  4NWI A;  3AU6 A;  2AGP A;  4PJ0 U;  4JWN A;  9ICV A;  2BPF A;  5HR7 A;  2FE9 A;  4HYK A;  5AK5 A;  4NY8 A;  1ZQK A;  4DQQ A;  3PR5 B;  5AKZ A;  4OJ5 A;  2OWO A;  2ZUD A;  4BJQ A;  1UA0 A;  3RAQ A;  4UQG A;  4C4T A;  4Z6E A;  1RQL A;  4GC6 A;  1NZP A;  2RHF A;  2A19 A;  5G5G A;  7ICL A;  2ZJ8 A;  1T3Q A;  2E8N A;  3B0Y A;  2LKY A;  1CEZ A;  9ICP A;  2J6U A;  8ICZ A;  1H38 A;  1SL1 A;  1PZN A;  4RQ8 A;  3RJI A;  3WK4 A;  2OYY A;  5HML A;  1CRX A;  1NKB A;  4JV0 A;  5ALL A;  3MGV A;  3GII A;  3SQI A;  5CJ7 A;  3EUB 2;  5ALW A;  5IIK A;  4O5E A;  3OSP A;  2MRL A;  2ESE A;  1QH9 A;  1NK0 A;  4RZR A;  2EAN A;  5FP0 A;  1SZP A;  3RB6 A;  2ZIX B;  2PMZ C;  2PFO A;  2F2A B;  5KNI A;  4CF3 A;  4F91 B;  2B0C A;  3NRZ A;  3BQ2 A;  5DB9 A;  2FPK A;  5AI0 A;  2JEG A;  2C2E A;  2G0A A;  4QZE A;  1L5U A;  2W3R A;  2KK0 A;  3CRX A;  5L1I A;  5AI6 A;  1ZQU A;  3ALR A;  2E8M A;  5EWE A;  4C8M A;  5EE1 A;  4C8N A;  4K4H A;  3UXP A;  2I5H A;  3KD3 A;  2JV3 A;  2KHV A;  3PSP A;  4C4R A;  3GV5 B;  5ALI A;  3N7R C;  4PL2 A;  1K1Q A;  3KZI U;  2H3Q A;  1ZXI A;  2RDJ A;  3K75 D;  2XGP A;  1L3T A;  2A1J A;  2YMP A;  4ELT A;  1RM6 C;  1DXS A;  1ZYQ A;  1SGG A;  1JX4 A;  5DGB A;  4YFK A;  4UBC A;  2V9W A;  1S0M A;  4RUA A;  2R8H A;  1DRG A;  2RRD A;  2PFN A;  3M9O B;  4K4I A;  2G5H B;  4ED0 A;  2QAR A;  4ECR A;  3C1Z A;  5J2D A;  1ZQI A;  4PGX A;  1JMS A;  1FEZ A;  2UVU A;  8ICV A;  4P4O A;  3BQT A;  1HUO A;  3ZDB A;  1SWV A;  1ZQX A;  1DGJ A;  3EPG A;  5J0P A;  3JPS A;  4KLQ A;  5CWR A;  3RB4 A;  4RPZ A;  4O5C A;  1Z00 A;  3SAF A;  5ALG A;  3F2B A;  2BGW A;  2ASJ A;  1FO4 A;  1U45 A;  3WKE A;  5KFK A;  4M0A A;  1F5S A;  3JPP A;  3RF9 A;  3D2Q A;  9ICI A;  8ICM A;  4TUR A;  4DS4 A;  2LBO A;  4EZ6 A;  2HHV A;  7ICT A;  7ICU A;  2Q4T A;  9ICU A;  4FO6 A;  4DL7 A;  5AK4 A;  3T5L A;  5ALS A;  4Q44 A;  5ALQ A;  4UB1 A;  2W7O A;  9ICX A;  4R66 A;  2Y1I A;  1WUD A;  1ZQW A;  1X6I A;  4J9O A;  1BPX A;  2YQE A;  2ASL A;  2HHS A;  5C5J A;  2HVI A;  3F53 A;  4KLD A;  3RRG A;  3ONN A;  4QW8 A;  4IC9 A;  4KLT A;  2DWQ A;  5HR6 A;  2BCV A;  2ZTC A;  5D46 A;  4OJ6 A;  3NTU A;  2FLL A;  5J2F A;  2C2D A;  4P0P A;  3WK6 A;  4NLB A;  4USA A;  1ZQB A;  1UQV A;  1UA1 A;  5KG5 A;  1X40 A;  4BXO A;  5EE3 A;  4PPX A;  2P6R A;  4E0D A;  4EZ9 A;  3QZ8 A;  3OPX A;  4YQW A;  5KFT A;  2F76 X;  2KIW A;  5AKX A;  5DB8 A;  3UMC A;  1SKS A;  2K89 A;  3CW2 C;  4YR2 A;  1TK8 A;  2IHN A;  2ZJA A;  4CGZ A;  1ZQD A;  1SV0 C;  4M2Y A;  1BNO A;  3EW9 A;  1WYG A;  2LYB A;  3T79 A;  3MDA A;  5AI5 A;  2M0N A;  3TQ1 A;  1JRO A;  4DQS A;  2DKZ A;  4UB4 A;  4M6W A;  7ICM A;  2ZUC A;  1ZQZ A;  2HSZ A;  4C0Z A;  1F44 A;  4O3N A;  4TUP A;  4UAZ A;  3B0X A;  5AM0 A;  4UAY A;  1L7P A;  3EYZ A;  4ED6 A;  3CP8 A;  2W8L A;  3T5H A;  2XC9 A;  2MAX A;  1SZH A;  4Y2X A;  4F4Z A;  5KG1 A;  4KX3 A;  8ICL A;  1Z1B A;  1WCL A;  2NYV A;  2P66 A;  4ICA A;  3RJG A;  2LYH A;  2OH2 A;  3TFR A;  5J0Q A;  2W9B B;  2KKP A;  1S76 D;  3IDW A;  1UT5 A;  2H5X A;  5L1J A;  3RH4 A;  4JWM A;  1QLN A;  1D8B A;  5BOM A;  4IR9 A;  1SIJ A;  4MFA A;  4UB2 A;  1PVP A;  2K8C B;  1U4B A;  3MDC A;  1AQ6 A;  9ICN A;  1UT8 A;  4DS5 A;  1ZOL A;  1JRP A;  5J0S A;  4RU9 A;  2VJ5 A;  5J0X A;  3M1Y A;  1V97 A;  3S6J A;  4DO9 A;  4F4X A;  3GIM A;  3HP6 A;  3TI0 A;  5KFQ A;  4F8R A;  1BGX T;  3QUC A;  4HAI A;  4UB5 A;  4I29 A;  1ZQR A;  1RDF A;  2ZIW B;  4ZH4 A;  2E5S A;  1K1S A;  2WFA A;  2LI6 A;  3C5G A;  2XY7 A;  2Q0Z X;  4DL2 A;  1Q46 A;  2BCU A;  3FAH A;  3OGU A;  2AJQ A;  1PK3 A;  1LKY A;  3IM1 A;  1NJZ A;  4YCX A;  2OM6 A;  3QU4 A;  2HBJ A;  1ZD3 A;  3JPO A;  4DQI A;  5HHH A;  5KFC A;  5AKK A;  3N7S C;  4KLS A;  2K8B B;  9ICL A;  2QB0 A;  3RH6 A;  3QZ7 A;  2KG5 A;  3AUO A;  2Y9U A;  2NRZ A;  5DG7 A;  2OXO A;  4TUS A;  3C23 A;  9ICQ A;  3BZC A;  3Q8Q B; 
#chains in the Genus database with same CATH homology
 2F8K A;  3TAC B;  2QB1 A;  5JTI A;  2D8C A;  2EAP A;  2KIV A;  2LMR A;  4RQM A;  2QKQ A;  3SEI A;  5L1M A;  1SV4 A;  2QB0 B;  1WWV A;  2E8M A;  3BS5 A;  1V38 A;  1OW5 A;  1COK A;  2EAM A;  2K60 A;  3IDW A;  4NL9 C;  1F0M A;  4IS7 A;  5JRT A;  1RG6 A;  3HIL A;  2JV3 A;  2F3N A;  4NL9 A;  4NJ8 A;  4RQN A;  1SXE A;  2FE9 A;  1DXS A;  1SGG A;  3TAD C;  3H8M A;  1UQV A;  3K1R B;  3KKA C;  1SXD A;  1PK1 A;  1X40 A;  1WWU A;  3TAD A;  3KKA A;  2LPE A;  2QAR A;  2ES6 A;  3BS7 A;  2KE7 A;  2DL0 A;  4PZN A;  2KSO A;  5J8Y A;  2E8N A;  1UCV A;  1SV0 C;  1JI7 A;  3BS5 B;  2D3D A;  2E8P A;  4MHV A;  2KMD A;  1PK3 A;  1LKY A;  1SV0 A;  2K4P A;  2Y9T A;  2E8O A;  2GLE A;  2QAR B;  3SEN A;  1KW4 A;  5J8Y C;  2DKZ A;  4PZO A;  1Z1V A;  1X66 A;  2KSO B;  2F44 A;  2ESE A;  3BQ7 A;  5JU5 A;  2QB0 A;  2L5Y A;  2EAN A;  1X9X A;  2KG5 A;  5F3X B;  2B6G A;  2YTU A;  1B4F A;  1OXJ A;  2DKX A;  2Y9U A;  1PK1 B;  1B0X A;  1LKY B;  5KNI A;  1V85 A;  2EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...