1SXDA

Solution structure of the pointed (pnt) domain from mgabpa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
GSHMAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GA repeat binding protein, alpha
publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, signaling protein
total genus 27
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxdA00
3SEIA 5J8YC 2E8PA 2F3NA 3HILA 2EANA 2KSOA 1COKA 3TADA 1OW5A 1KW4A 2EAMA 2K60A 2DKXA 2KMDA 1LKYA 1SXEA 1SV0C 2F8KA 3BQ7A 1WWVA 1RG6A 2QB1A 4IS7A 2QB0B 5F3XB 1JI7A 2EAPA 2YTUA 4PZNA 1SV4A 2D3DA 1B4FA 2Y9UA 3TADC 1X40A 1OXJA 2DL0A 1WWUA 1UQVA 2E8OA 2E8MA 5JU5A 5L1MA 2QARA 4RQNA 3SENA 5JTIA 2B6GA 3BS5B 4RQMA 2ESEA 1V38A 1F0MA 3BS7A 1SGGA 1B0XA 2EAOA 3IDWA 2QKQA 2GLEA 2F44A 2E8NA 1PK3A 1PK1B 2JV3A 4PZOA 2DKZA 2Y9TA 2D8CA 5KNIA 1X9XA 1V85A 2LPEA 4MHVA 2L5YA 1DXSA 2LMRA 4NJ8A 2FE9A 1X66A 2KSOB 3KKAA 2K4PA 3KKAC 3BS5A 1UCVA 2KG5A 3TACB 2QARB 4NL9A 1PK1A 2QB0A 4NL9C 5JRTA 2KIVA 2ES6A 1LKYB 1Z1VA 3H8MA 3K1RB 1SXDA 1SV0A 2KE7A 5J8YA
chains in the Genus database with same CATH superfamily
2F1JA 4RQ6A 4Z6CA 4JUZA 5ALLA 4XA5A 3GIIA 3QUTA 2EDUA 3RJHA 3QZ7A 1JUDA 4EBEA 4YP3A 4ECRA 1SXEA 1SV0C 1SKSA 2ZTDA 5J0PA 2BGWA 1VDVA 2XCPA 2WB1C 1SWVA 4ED0A 2G06A 5BOMA 9ICLA 1NK5A 3AU6A 1ZQPA 1U49A 1NJXA 5AI6A 1QQ5A 5J29A 4ECUA 2P6RA 1VJ5A 2B6GA 4DFJA 2A3VA 4K4GA 1F0MA 2EAOA 4NLCA 3GV8B 4IQWA 3T5LA 1NKBA 2ZJAA 4I29A 4U6PA 3F2BA 3DEEA 3V6JA 4BX9C 9ICFA 1BPDA 3AU2A 2Y9TA 7ICPA 5KG3A 3CW2C 1DGJA 2BQUA 3L4PA 4CRXA 5J0OA 2JR5A 2MU2A 4KMUA 4F72A 3SI8A 4C8LA 1ZQBA 1BNOA 3SAFA 4C80A 3FC4A 2C28A 3GV5B 3VC8A 3OJSA 2KJ8A 3R9KA 4GXKA 2G5IB 3G6YA 4ZOHC 8ICAA 3OHBA 1ZQVA 5J0YA 2YMPA 4MFFA 5L1JA 4M47A 4RQ8A 4B9UA 1U9LA 5KFIA 2IBKA 2WAQC 3QZ8A 4DFKA 4YXMA 4O9MA 3M9OB 3F2DA 4B9MA 3NASA 8ICWA 3FYHA 2EANA 3HKZF 4O0IA 1ZJNA 3NRZA 3PSIA 4DQQA 4GXJA 4F5PA 4EZ9A 3WKEA 2GO7A 2M9NA 1JN3A 2DKXA 5HR7A 3TAQA 4DSJA 1O03A 8ICQA 9ICIA 2H3FA 3L5KA 3KTQA 1XC9A 3QEBZ 2JZBB 5CRXA 5KT4A 4US8A 3C2LA 1ECWA 2QB0B 1PVRA 4K4IA 4RPYA 5EOZA 5DBBA 4F8RA 2DL0A 1XO1A 3AQEA 1ZQ1C 2GH1A 4R65A 2YMLA 4X5VA 2B0CA 9ICAA 5JTIA 4EX7A 4EEKA 3THVA 2K8BB 2BQ3A 2W04A 3RRHA 4DL2A 4QZIA 4B9LA 8ICTA 2E8NA 4DCCA 2Q4TA 2KJ9A 4DF4A 1V97A 4P4MA 4FZNA 2MRLA 1KFDA 3H0RB 1X9MA 1N56A 9ICRA 5CA7A 1NK6A 5E79U 4KLDA 1NK8A 4KLEA 7ICNA 4IQTA 4I2BA 4RQ5A 1ZQUA 2W54A 2XVTA 3IHQB 4QW8A 4TQSA 3BZKA 3RJGA 4Q45A 4J9SA 2R8HA 4OO1J 7ICEA 4UB5A 4O5EA 1A76A 2OXOA 5AKIA 3MR2A 2W9CB 2H5XA 1S0NA 1DK3A 2A19A 4C4SA 3RJIA 3GIKA 3RTVA 4F4YA 2KSOA 1S10A 2OYYA 3TADA 3BQ2A 1KQQA 2BPCA 3ORYA 5CB1A 4OCZA 4M9LA 8ICKA 4US9A 3PW7A 4PGXA 7ICIA 3GU3A 2ZG6A 4F91B 1S9FA 3SR6A 2HVIA 4ECQA 5KFUA 3GDXA 2WF5A 5F3XB 3OHAA 2AGOA 1D8LA 2HBJA 5ALWA 5HHIA 2E8OA 4QZEA 3M6KA 1H38A 1QH9A 5AM2A 3SAHA 3M8RA 4KLGA 1SGGA 2JGAA 1N2XA 4GLXA 2HHUA 1T8EA 1SB3C 4EX6A 4PZOA 5C0YA 1D8BA 2KEYA 4ED8A 5KFGA 3C29A 1QQ7A 5DG7A 2KOBA 2ALZA 7ICOA 3LYSA 4UATA 5KFAA 4DFPA 4QZCA 3N7RC 3SYZA 9ICVA 3C28A 4BUGA 1U45A 4F4KA 3PW4A 4DQIA 2R8IA 7ICLA 3IG5A 3WK8A 4UAYA 4KLLA 1TAMA 2W8KA 4Y2SA 9ICKA 1S5LU 2HOIA 3MFIA 5KG6A 1Z4OA 5TISU 4UB2A 2VA2A 4I28A 2W9AA 4ECTA 4M0AA 1J2NA 2G09A 4RUAA 2W3SA 2XC9A 2KHVA 4J9MA 1C20A 5DDMA 4B9SA 4O5KA 3KFUF 4ECXA 3EZ5A 3KHGA 5ALSA 2JHDA 1NK7A 2ZIVA 5DDYA 1BNPA 4DL6A 2YN4A 5FP0A 5EE0A 3F53A 2AXTU 5ALIA 4Y2VA 4UAWA 3PSFA 5AI4A 5J0WA 4R8UB 3H4DA 5KT3A 4PH5A 3TFSA 5JU5A 3EPIA 4ED1A 2FPLA 2H3ZA 1L6NA 2PFQA 4C4RA 2MUTA 3PO5A 5JUMA 1U48A 3EPGA 3F5AA 4UBBA 3PMNA 1PK1B 2KN7A 2HOQA 4CCHA 2WF6A 2BHNA 3MBYA 1CEZA 5ALDA 4GC7A 2AHOB 5ALEA 4LZDA 3KZXA 4UASA 1HIWA 5ALUA 2LMRA 2W7OA 3SV3A 4NJ8A 4QIWF 2CRXA 4YD1A 5ALVA 3MGVA 1XSPA 1UA1A 9ICGA 1ZQZA 4BWMA 4RNMA 4Y2TA 4UB1A 5G5HA 3ETRA 3ZDAA 4RPXA 4FS1A 4UW9A 3NVZA 3V7LA 2XGQA 3LVVA 2H3IA 3H8MA 4RT2A 2W55A 4P0PA 2HBKA 2UVWA 4F5NA 3QUCA 4KLUA 3FAHA 5DB9A 4M6WA 5KAFU 2FDRA 3UM9A 2OWOA 2JXJA 1L7OA 3GQCA 2PKEA 5L1KA 2XIDA 5HP4A 2K4IA 3QU4A 7ICUA 5J0XA 4DOAA 2GWSA 2ZUDA 2IOFA 4UAZA 8ICBA 2GOLA 1K1QA 1TV9A 4P0QA 2ZIWA 4GXIA 2MSNA 4DQPA 3T5HA 5F9NA 4KLMA 3KHHA 1MQ2A 2F8LA 2C2DA 4KLJA 2KZMA 4O3PA 1SIJA 4PZNA 1FO4A 3HX0A 4DL7A 1SZPA 1QSLA 2D3DA 2LM1A 4FBUA 5DG8A 4QZ9A 1UQVA 3AN1A 1RM6C 2NO4A 2QARA 3OSNA 3N7SC 1M6YA 3BS5B 2VIXA 4RNOA 1SWWA 4EEYA 4MF2A 3RJEA 4O3MA 1JRPA 5AK6A 1ZQEA 4F92B 1YZ6A 5DKWA 2XI9A 4O3NA 4P4OA 4P4PA 1PK3A 4FE3A 2JV3A 4EZ6A 5KFNA 4DOCA 4DSEA 5IIMA 3ZDEA 1ZQNA 5L1IA 3IP4B 5KG0A 3QYPA 3ONNA 3MGIA 5L9XA 2WAQF 2ZXHA 1JALA 1BPBA 7ICSA 1N63A 5DQIA 1UCVA 1OUQA 1ZD2P 2FLLA 4YMOA 4DS5A 4Q44A 3M6ZA 1ZRMA 2MAXA 4YMNA 1FEZA 4KLOA 2F1HA 2JEIA 4ZH4A 2DF4B 2AH5A 4DQRA 2KE7A 2V4RA 4JWMA 9ICOA 1ZXIA 4UBCA 2DUYA 3SMVA 2VA3A 3F2CA 1QLNA 5BOLA 1VLBA 4PJ0U 4ED2A 5AI5A 5IINA 3FDSA 5AM4A 1QQ6A 1Z1BA 4Y2RA 4O3QA 3QUBA 2G07A 3QU2A 5AI0A 2ZIUB 1A77A 2DFLA 2ZIXB 5AIBA 4FO6A 2V4QA 2XY7A 2P66A 4B6JA 2XY5A 5EE3A 5AK5A 2OM6A 1ZOLA 4ECSA 1DOQA 2Y0SC 9ICNA 4KLIA 2EAPA 2W9BB 5HMLA 1NZPA 4EYIB 5EWEA 2E3TA 1WCNA 1ZQDA 2ESEA 5J0SA 3C1ZA 4M9GA 2HHQA 3PV8A 5AM0A 1RYSA 1TKDA 1WG8A 1XU4A 2KVCA 7ICGA 4DO9A 3ISBA 1L7NA 1L5UA 4C7YA 2D8CA 3JPTA 2FPMA 1DGSA 2C2RA 3HW8A 5KFMA 3G6XA 3E0FA 4HAIA 4DL4A 3PZPA 3N4MB 2IOFK 3N7PD 3WKDA 4J9PA 3T5JA 4IR1A 4QWAA 3HT3A 2A1JA 2KG5A 4YFKA 2KNJA 3TACB 1LB2B 4IRCA 3OPXA 1U47A 4Y2QA 3PNCA 3QUQA 4O3RA 1Z1VA 4KTQA 3BQ1A 8ICGA 1JROA 4A8EA 5F9LA 2VA8A 5ALQA 5DB8A 3LWLA 4G9BA 4F93B 3AQFA 5J8YA 3PVXA 5J8YC 4EBDA 3A0HU 3H7IA 3T79A 1S0OA 3PO4A 3GZFA 1BPZA 2G5HB 1RXWA 1N5WA 3KHLA 3MR5A 1F44A 9ICMA 4QWDA 4DQSA 1Z00B 4CE6A 4Q8FA 1LKYA 5ALNA 5DBCA 4F2RA 3CP8A 1ZYQA 1B22A 2M0NA 4M9HA 3UQ0A 4I2GA 3ZI4A 7ICKA 3UQ2A 2IOHA 4Y2XA 1V9PA 5KT7A 1NJYA 2LYBA 1TVAA 4RQNA 5D49A 2HHXA 4USAA 4Y2JA 4IRKA 3K4GA 1ZD5A 2W9MA 3D2SA 2RRDA 4J9QA 3M9NB 2BDPA 4JWNA 5KNIA 1ZQAA 3ALRA 1BPXA 2HBLA 3I28A 4ACOA 2PI4A 4RU9A 1ZJMA 3BQ0A 3U26A 4DSFA 3WKCA 2MA1A 2E1FA 2FJ6A 4MF8A 2ZXIA 3PMLA 1XS9D 4NL9A 1UPHA 3PW0A 4NL9C 5JRTA 3UMGA 2NV3A 2MUTB 1ED1A 4G3IA 5KL8B 3KBBA 4IL6U 1NKEA 5BPCA 5AKZA 8ICSA 3VCBA 2KK0A 4YN4A 1NK0A 3D2QA 4RQ4A 1UA0A 2KFZA 1A6SA 1ZQWA 2E8PA 4F71A 2OEHA 4ECVA 2RDJA 1L8LA 2XY6A 5KFFA 4CF5A 4J9OA 8ICFA 1DRGA 4HYKA 4Y2PA 5AK4A 5DB7A 2DBYA 2IMWP 1IIPA 2J6SA 1T4GA 4MEYA 5J2JA 5B5EU 2KKVA 8ICNA 2QB1A 4PHPA 4I2DA 3SZ2A 9ICQA 2YTUA 1K1SA 5J2EA 3EW9A 2HSZA 3TADC 4ELUA 1RQLA 3RAQA 3Q8MA 2ZJ8A 4JV0A 1S97A 3J81j 1QSSA 2FPKA 1S0MA 4C8MA 5AHXA 5ALKA 2F44A 1T3QA 5KL1B 4DL5A 3Q8RB 2DKZA 8ICEA 4PL1A 4OJ6A 3G6VA 1EXNA 2AGQA 2CPRA 2HOFA 8ICMA 5HMMA 1X6IA 4P0QB 2ZIWB 4YQWA 1BVSA 5AM5A 3MDCA 4BWJA 3AEVA 1O08A 2KZ3A 5KT2A 2HHSA 3FM9A 5AKLA 4NM2A 4I2HA 5L1LA 1MN8A 2WHEA 5AI8A 2QARB 2NYVA 4RNNA 5ALOA 2YY6A 1BGXT 2ES6A 1D9DA 2HDOA 4JMUA 3RH4A 8ICXA 4LVSA 1CRXA 1WUDA 2ZUCA 4WJ3B 3BQTA 4F4ZA 4CDGA 1TAQA 4BXOB 3Q8SB 1N60A 4UB3A 4C4TA 2YMQA 4IQVA 3ZDBA 3SQIA 2HCFA 2ASDA 2I5HA 5IIJA 3QNMA 5AKHA 7ICQA 1ZQFA 2EZZA 2KMDA 4Y2UA 3UMBA 2JH1A 3SV4A 9ICPA 5DQGA 3Q8LA 4OD0A 3S6JA 3QE9Y 1SZHA 3RB3A 3ETLA 3LK9A 4EBCA 1OXJA 3F5EA 5IIIA 5EWFA 3RFAA 5CR0A 3JPOA 3AUOA 3SENA 1SL0A 3WK6A 2ASLA 4M2YA 2YX8A 5KTQA 1PZNA 5AKEA 4QZHA 5AKGA 4J9LA 4ECZA 4F4XA 4QWBA 3CRXA 4F2SA 3TANA 2JEJA 4QWCA 2JZBA 3M9MB 1SKRA 4RQ7A 5ALYA 3K75D 1X9XA 3SAGA 1J97A 2K8CB 4NLNA 4XQ8A 3OTQA 2NO5A 1KEJA 4UAVA 1ZQSA 2FE9A 5KFSA 1C7YA 1NJZA 2RQ5A 3NRWA 4ECWA 1XNSA 2K89A 2BZFA 5KFXA 7ICFA 3KD3A 2HHVA 2LYHA 3Q8PB 4YXJA 4QZFA 4J9RA 2JEGA 3V7KA 1XSLA 3TKAA 3V7JA 4KLQA 2WFAA 3ISDA 1RYRA 5H2FU 4KX3A 5J2GA 5J2KA 4K4HA 2VKQA 3C2KA 4NLZA 2Y0SF 4KMOB 3HILA 2YQEA 4B9VA 3NS1A 4TUPA 4JV2A 3MFHA 4I27A 3UXPA 3RB0A 4DOBA 2IA6A 3DDHA 4JK1A 4I2JA 1KN5A 1KTQA 2W7PA 4QZBA 1YT3A 2W9CA 4NLKA 3UXOA 3V6HA 1JI7A 2JRZA 3H0LB 1N48A 2OCEA 3EWAA 4CF3A 2FMPA 5T14A 1SV4A 5DBAA 2HHWA 5J2CA 1WWUA 3RJFA 8ICCA 2LYAA 2R8KA 3IN5A 4C8KA 4QZAA 5L1MA 4OJPA 3WK5A 4AP9A 4UB4A 2DQNB 3RJKA 2H3VA 3BS7A 1L3UA 3RR7A 2QKQA 3EUB2 1CUKA 3D2NA 5KFRA 2AU0A 2F76X 4IRDA 2P6UA 3HRDD 5D46A 1PVQA 3V6KA 3RBEA 2J6UA 4R66A 1T94A 1SL1A 2Z7JA 3PR4A 2KJ5A 5AM3A 8ICRA 2NRWA 4MHVA 4Z6EA 4O5CA 4PGYA 2BCUA 2JH7A 4AYBC 1T3NA 2K4PA 4RUCA 4FFDA 2EZXA 5HR6A 2BPFA 1RQNA 5CHGA 1L3VA 2KD1A 1RXVA 1SKWA 4B9NA 3OSPA 2D6FC 4LZGA 3H8SA 2UVUA 2WF7A 3PX4A 4C0ZA 3NGDA 4C7ZA 4FBTA 3C2MA 5KT6A 5ALZA 2BQRA 5GTHU 3L3FX 1S77D 4EYHB 5AIAA 2K8AA 1KSPA 4R64A 4DS4A 2PFNA 3RH5A 7ICHA 1TAUA 2HMXA 9ICCA 3HPOA 5KFQA 3ICXA 4DFDA 4DSLA 4KLSA 3E2EA 4ELVA 4QJFB 5K4LA 3T5KA 1ZQGA 3C1YA 4RQ2A 2Q0ZX 4RQ0A 1WWVA 3GIMA 3AM9A 1DK2A 5ALRA 4YR3A 1ZQIA 3C23A 4CF4A 5J2DA 3A0BU 4J9KA 2YB4A 2KFNA 5KFHA 4M9NA 3RRGA 4BDPA 3MDAA 4IR9A 3QU7A 4KN7A 1ZQYA 2WF9A 5KFVA 2BR0A 3NVWA 1ZRNA 5KFPA 2K4EA 2AJQA 1V85A 9ICSA 4QZ8A 1ZQKA 3C5FA 3M1YA 4R8UA 3ZDDA 4YVZA 1QTMA 4NV0A 2ZTEA 4ECYA 1BPYA 7ICTA 2KSOB 2J6TA 1UT5A 2W43A 5J2IA 3B0YA 4FZMA 1X6JA 2HBMA 2HHTA 4PL2A 2YB1A 2F1IA 3PSPA 2G0AA 2I1QA 2CXYA 1RYUA 4YCXA 4NY8A 1PK1A 8ICYA 2LI6A 2CN1A 2NRTA 4XRHA 4O3OA 1SV0A 1D8YA 2C22A 4PHDA 1LV5A 4MEXA 1J2MA 2RHFA 3MR6A 1S0VA 2F3NA 3IRUA 1L7MA 3Q8QB 2I9GA 5KG7A 1T7PA 3QX7A 4F3OA 5J2FA 3TARA 1KW4A 1Q46A 5ALPA 4RPZA 4ELTA 2R18A 1IV8A 1Q8KA 2LM4A 3CYMA 7ICMA 1KL9A 3GIJA 3SD7A 3BJYA 2PFOA 3IG8A 2PMZF 3DV9A 1HUZA 5HNKA 4KX5A 2RDIA 8ICLA 2QLTA 5AI9A 2KICA 3O0FA 3QU5A 4JB3A 1B4FA 4F4WA 2VJ4A 1X40A 4IQUA 2FI1A 5KG4A 2E8MA 3C5GA 5D4BA 5IILA 2P35A 3M7DA 3IDWA 4TQRA 3JPPA 3I1YA 8ICIA 1RDFA 2BDUA 1X9SA 1FFVA 1JX4A 4YR2A 3QXGA 1TK5A 4Y2YA 3LDAA 1P7DA 1UT8A 1ZD3A 3TAPA 2FMSA 2W3RA 2W11A 9ICTA 4KN4A 3UMCA 7ICVA 5CJ7A 3KKAA 3KKAC 5IIOA 1Z3EB 3BS5A 4EELA 4QW9A 2KIWA 3C21A 1Q3UA 1GO3F 3PX6A 5G5GA 4PPXA 3HWTA 3PR5B 4DFMA 1TK8A 4BGDA 1KFTA 1N61A 1B43A 4RT3A 3Q8KA 2ZIVB 5AKYA 1U4BA 1NNLA 1RPLA 5KFLA 3ZDCA 3IM1A 3PW2A 2WF8A 7ICJA 3GILA 2R8GA 4P2HA 5EE9A 5KFDA 3HP6A 5IIKA 3ED5A 2VJ5A 1OW5A 4IC9A 2C2EA 4F50A 4Z6FA 4DSKA 2EH9A 4M04A 3MR3A 2XO7A 3ISCA 2PXIA 1XSNA 3H8WA 2XGPA 3K1ZA 3H0MB 4XUSA 1TK0A 5EE1A 3N28A 5DGBA 4IS7A 3OJUA 2XICA 1FIQA 2F77X 5ALJA 4NLBA 3GV7B 4J9NA 1ZQCA 2ISPA 2BCRA 4R63A 2AQ4A 5KG1A 2ODGA 4GC6A 5AICA 3AL0B 4ED6A 4UARA 1IM4A 1V38A 4Q8EA 3LWMA 2ZIUA 2ZIXA 9ICJA 5TZVA 1NKCA 1UHUA 4UB6U 2FLNA 4EENA 4DF8A 5CP2A 5ALXA 1LVHA 1KKXA 4DL3A 4P0PB 5DB6A 3WKAA 2W9BA 2I6XA 3RB6A 2NRVA 9ICHA 2LHTA 3NUQA 2L5YA 1DXSA 4Q43A 2A1AA 3WU2U 1S8OA 4C8NA 4M6WB 4GFJA 2PI5A 2OH2A 2DPJA 1ZQRA 3JPSA 2W8LA 2PMZC 4UB8U 1JXEA 3PW5A 5KFJA 4YR0A 4YD2A 1HJPA 2KVSA 3K1RB 4I2AA 2F2AB 1TE2A 1BPEA 5J0QA 3BZCA 3PY8A 5GTIU 2V9WA 4LJXA 3HJEA 1KRPA 3PX0A 2NRZA 4MFAA 3WK9A 2BPGA 2W03A 5KFOA 1D9FA 9ICBA 4OJ5A 2EAMA 5KFWA 4B9TA 4ICAA 2OHFA 3NVYA 5AK3A 1A0PA 4MFCA 3RBDA 1FFUA 2KZZA 4TUSA 1WYGA 1NOMA 1ZQTA 2KTQA 3T3FA 1AROP 4TUQA 2F8KA 1SL2A 5AKKA 5ALHA 5DGAA 3BDPA 3EYZA 4U7CA 3WKBA 5DQHA 3HKZC 4DWIA 4KLTA 3WK4A 5KFYA 2Y1IA 2EZYA 5A0LA 5J0UA 4AYBF 1N5XA 4FZLA 4RQMA 2BCVA 8ICHA 3B0XA 1B0XA 2KHQA 1Z00A 2GLEA 1HEKA 2E1EA 1L8OA 3NTUA 2ISOA 3V72A 2HVHA 1KBUA 3KZIU 2ZUBA 3KHRA 4JV1A 4RZRA 1MSWD 3MABA 1NZBA 3H8JA 2BCSA 1TFRA 5J0RA 3D6JA 5KFTA 9ICEA 1ZQMA 2DPIA 2VANA 4F5RA 4DLGA 4I2IA 2Y1JA 1ZQQA 2IHMA 1NK9A 1X2IA 8ICPA 3E58A 2O6KA 1JMSA 2QB0A 2KIVA 1MQ3A 5ALGA 1WCLA 1SXDA 3RR8A 1X42A 2ATLA 2AQ0A 1HUOA 1KDHA 1ZQHA 7ICRA 4KITB 3ZD9A 2H3QA 1JIHA 4UAUA 4CNQA 1QCKA 1NI3A 3ZD8A 3M8SA 3N97B 1ZQXA 5J2HA 3RH6A 5KFBA 8ICVA 2K60A 2FLPA 3I76A 1ZETA 4DEZA 1ZD4A 5CEHA 1L7PA 1RG6A 8ICUA 5KFEA 2RP5A 1JXLA 4QZGA 4UQGA 1ZQLA 3QU9A 2KV2A 4QZDA 5DLGA 4PHAA 2NRXA 4QNLA 1F5SA 5AKJA 3RJJA 2A1JB 2JEFA 2HW3A 3TFRA 2LBOA 4I2CA 1PVPA 1MA7A 4OJLA 2ZTCA 1YZ7A 2IHNA 2EQYA 4ED3A 3AMZA 4QWEA 2G08A 1URJA 4Z6DA 4DLEA 3H40A 2UVRA 5KG2A 3H4BA 1S76D 1XO0A 1NK4A 2ASJA 2HI0A 1CI4A 3TI0A 3CNHA 1COOA 1ZQJA 4I2EA 2WB1F 1X66A 3RF9A 2JMGA 4O3SA 3RAXA 1KLNA 1Z4NA 2K4HA 1XWLA 5KFKA 4PHEA 5C5JA 3UPQA 4NM1A 1IXRA 5ALTA 1LKYB 2DWQA 5J2BA 2KKPA 4QIWC 2R8JA 1L3TA 3SEIA 3MC1A 8ICOA 1IG6A 1PUZA 2YMMA 2WTFA 5B66U 1COKA 5J2AA 4I2FA 2RLTA 3PSTA 4NXZA 1Y88A 4PGQA 2N1RA 4BJQA 1RZTA 4M9JA 4RQ1A 1Z19A 2XCAA 3OGUA 5ALMA 2PFPA 5DG9A 3MGHA 3BQ7A 3TQ1A 2AGPA 5ALFA 2ZJ5A 2BKEA 3JPQA 1ZQOA 5J0TA 3NVVA 5AM1A 2Y9UA 2BCQA 4BXOA 5KG5A 4F5QA 4C8OA 4OJOA 8ICZA 4KLFA 3GFKB 4GIBA 4RQ3A 2DGZA 1KFSA 1AQ6A 5EWGA 4KLHA 2E5SA 2KP7A 1N62A 2B21A 3JPNA 5KT5A 3B9JA 4J03A 4ED7A 4FS2A 1Q3VA 3KOOA 9ICUA 4YG2A 5CWRA 5KFZA 3IV6A 2LPEA 4DSIA 3QEAZ 1MC8A 4NLGA 3WK7A 1NJWA 9ICXA 5KFCA 3JPRA 2FMQA 4YMMA 4E0DA 1QSYA 9ICWA 8ICJA 4F5OA 3RB4A 1X9WA 3LVWA 4CGZA 5AKXA 4TURA 3UXNA 4NWIA 2LKYA 5DLFA 2UVVA 1K5OA 1L3SA 5KAIU 5HHHA
chains in the Genus database with same CATH topology
3SEIA 5J8YC 2E8PA 2F3NA 3HILA 2EANA 2KSOA 1COKA 3TADA 1OW5A 1KW4A 2EAMA 2K60A 2DKXA 2KMDA 1LKYA 1SXEA 1SV0C 2F8KA 3BQ7A 1WWVA 1RG6A 2QB1A 4IS7A 2QB0B 5F3XB 1JI7A 2EAPA 2YTUA 4PZNA 1SV4A 2D3DA 1B4FA 2Y9UA 3TADC 1X40A 1OXJA 2DL0A 1WWUA 1UQVA 2E8OA 2E8MA 5JU5A 5L1MA 2QARA 4RQNA 3SENA 5JTIA 2B6GA 3BS5B 4RQMA 2ESEA 1V38A 1F0MA 3BS7A 1SGGA 1B0XA 2EAOA 3IDWA 2QKQA 2GLEA 2F44A 2E8NA 1PK3A 1PK1B 2JV3A 4PZOA 2DKZA 2Y9TA 2D8CA 5KNIA 1X9XA 1V85A 2LPEA 4MHVA 2L5YA 1DXSA 2LMRA 4NJ8A 2FE9A 1X66A 2KSOB 3KKAA 2K4PA 3KKAC 3BS5A 1UCVA 2KG5A 3TACB 2QARB 4NL9A 1PK1A 2QB0A 4NL9C 5JRTA 2KIVA 2ES6A 1LKYB 1Z1VA 3H8MA 3K1RB 1SXDA 1SV0A 2KE7A 5J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEI A;  5J8Y C;  2E8P A;  2F3N A;  3HIL A;  2EAN A;  2KSO A;  1COK A;  3TAD A;  1OW5 A;  1KW4 A;  2EAM A;  2K60 A;  2DKX A;  2KMD A;  1LKY A;  1SXE A;  1SV0 C;  2F8K A;  3BQ7 A;  1WWV A;  1RG6 A;  2QB1 A;  4IS7 A;  2QB0 B;  5F3X B;  1JI7 A;  2EAP A;  2YTU A;  4PZN A;  1SV4 A;  2D3D A;  1B4F A;  2Y9U A;  3TAD C;  1X40 A;  1OXJ A;  2DL0 A;  1WWU A;  1UQV A;  2E8O A;  2E8M A;  5JU5 A;  5L1M A;  2QAR A;  4RQN A;  3SEN A;  5JTI A;  2B6G A;  3BS5 B;  4RQM A;  2ESE A;  1V38 A;  1F0M A;  3BS7 A;  1SGG A;  1B0X A;  2EAO A;  3IDW A;  2QKQ A;  2GLE A;  2F44 A;  2E8N A;  1PK3 A;  1PK1 B;  2JV3 A;  4PZO A;  2DKZ A;  2Y9T A;  2D8C A;  5KNI A;  1X9X A;  1V85 A;  2LPE A;  4MHV A;  2L5Y A;  1DXS A;  2LMR A;  4NJ8 A;  2FE9 A;  1X66 A;  2KSO B;  3KKA A;  2K4P A;  3KKA C;  3BS5 A;  1UCV A;  2KG5 A;  3TAC B;  2QAR B;  4NL9 A;  1PK1 A;  2QB0 A;  4NL9 C;  5JRT A;  2KIV A;  2ES6 A;  1LKY B;  1Z1V A;  3H8M A;  3K1R B;  1SXD A;  1SV0 A;  2KE7 A;  5J8Y A; 
#chains in the Genus database with same CATH topology
 2F1J A;  4RQ6 A;  4Z6C A;  4JUZ A;  5ALL A;  4XA5 A;  3GII A;  3QUT A;  2EDU A;  3RJH A;  3QZ7 A;  1JUD A;  4EBE A;  4YP3 A;  4ECR A;  1SXE A;  1SV0 C;  1SKS A;  2ZTD A;  5J0P A;  2BGW A;  1VDV A;  2XCP A;  2WB1 C;  1SWV A;  4ED0 A;  2G06 A;  5BOM A;  9ICL A;  1NK5 A;  3AU6 A;  1ZQP A;  1U49 A;  1NJX A;  5AI6 A;  1QQ5 A;  5J29 A;  4ECU A;  2P6R A;  1VJ5 A;  2B6G A;  4DFJ A;  2A3V A;  4K4G A;  1F0M A;  2EAO A;  4NLC A;  3GV8 B;  4IQW A;  3T5L A;  1NKB A;  2ZJA A;  4I29 A;  4U6P A;  3F2B A;  3DEE A;  3V6J A;  4BX9 C;  9ICF A;  1BPD A;  3AU2 A;  2Y9T A;  7ICP A;  5KG3 A;  3CW2 C;  1DGJ A;  2BQU A;  3L4P A;  4CRX A;  5J0O A;  2JR5 A;  2MU2 A;  4KMU A;  4F72 A;  3SI8 A;  4C8L A;  1ZQB A;  1BNO A;  3SAF A;  4C80 A;  3FC4 A;  2C28 A;  3GV5 B;  3VC8 A;  3OJS A;  2KJ8 A;  3R9K A;  4GXK A;  2G5I B;  3G6Y A;  4ZOH C;  8ICA A;  3OHB A;  1ZQV A;  5J0Y A;  2YMP A;  4MFF A;  5L1J A;  4M47 A;  4RQ8 A;  4B9U A;  1U9L A;  5KFI A;  2IBK A;  2WAQ C;  3QZ8 A;  4DFK A;  4YXM A;  4O9M A;  3M9O B;  3F2D A;  4B9M A;  3NAS A;  8ICW A;  3FYH A;  2EAN A;  3HKZ F;  4O0I A;  1ZJN A;  3NRZ A;  3PSI A;  4DQQ A;  4GXJ A;  4F5P A;  4EZ9 A;  3WKE A;  2GO7 A;  2M9N A;  1JN3 A;  2DKX A;  5HR7 A;  3TAQ A;  4DSJ A;  1O03 A;  8ICQ A;  9ICI A;  2H3F A;  3L5K A;  3KTQ A;  1XC9 A;  3QEB Z;  2JZB B;  5CRX A;  5KT4 A;  4US8 A;  3C2L A;  1ECW A;  2QB0 B;  1PVR A;  4K4I A;  4RPY A;  5EOZ A;  5DBB A;  4F8R A;  2DL0 A;  1XO1 A;  3AQE A;  1ZQ1 C;  2GH1 A;  4R65 A;  2YML A;  4X5V A;  2B0C A;  9ICA A;  5JTI A;  4EX7 A;  4EEK A;  3THV A;  2K8B B;  2BQ3 A;  2W04 A;  3RRH A;  4DL2 A;  4QZI A;  4B9L A;  8ICT A;  2E8N A;  4DCC A;  2Q4T A;  2KJ9 A;  4DF4 A;  1V97 A;  4P4M A;  4FZN A;  2MRL A;  1KFD A;  3H0R B;  1X9M A;  1N56 A;  9ICR A;  5CA7 A;  1NK6 A;  5E79 U;  4KLD A;  1NK8 A;  4KLE A;  7ICN A;  4IQT A;  4I2B A;  4RQ5 A;  1ZQU A;  2W54 A;  2XVT A;  3IHQ B;  4QW8 A;  4TQS A;  3BZK A;  3RJG A;  4Q45 A;  4J9S A;  2R8H A;  4OO1 J;  7ICE A;  4UB5 A;  4O5E A;  1A76 A;  2OXO A;  5AKI A;  3MR2 A;  2W9C B;  2H5X A;  1S0N A;  1DK3 A;  2A19 A;  4C4S A;  3RJI A;  3GIK A;  3RTV A;  4F4Y A;  2KSO A;  1S10 A;  2OYY A;  3TAD A;  3BQ2 A;  1KQQ A;  2BPC A;  3ORY A;  5CB1 A;  4OCZ A;  4M9L A;  8ICK A;  4US9 A;  3PW7 A;  4PGX A;  7ICI A;  3GU3 A;  2ZG6 A;  4F91 B;  1S9F A;  3SR6 A;  2HVI A;  4ECQ A;  5KFU A;  3GDX A;  2WF5 A;  5F3X B;  3OHA A;  2AGO A;  1D8L A;  2HBJ A;  5ALW A;  5HHI A;  2E8O A;  4QZE A;  3M6K A;  1H38 A;  1QH9 A;  5AM2 A;  3SAH A;  3M8R A;  4KLG A;  1SGG A;  2JGA A;  1N2X A;  4GLX A;  2HHU A;  1T8E A;  1SB3 C;  4EX6 A;  4PZO A;  5C0Y A;  1D8B A;  2KEY A;  4ED8 A;  5KFG A;  3C29 A;  1QQ7 A;  5DG7 A;  2KOB A;  2ALZ A;  7ICO A;  3LYS A;  4UAT A;  5KFA A;  4DFP A;  4QZC A;  3N7R C;  3SYZ A;  9ICV A;  3C28 A;  4BUG A;  1U45 A;  4F4K A;  3PW4 A;  4DQI A;  2R8I A;  7ICL A;  3IG5 A;  3WK8 A;  4UAY A;  4KLL A;  1TAM A;  2W8K A;  4Y2S A;  9ICK A;  1S5L U;  2HOI A;  3MFI A;  5KG6 A;  1Z4O A;  5TIS U;  4UB2 A;  2VA2 A;  4I28 A;  2W9A A;  4ECT A;  4M0A A;  1J2N A;  2G09 A;  4RUA A;  2W3S A;  2XC9 A;  2KHV A;  4J9M A;  1C20 A;  5DDM A;  4B9S A;  4O5K A;  3KFU F;  4ECX A;  3EZ5 A;  3KHG A;  5ALS A;  2JHD A;  1NK7 A;  2ZIV A;  5DDY A;  1BNP A;  4DL6 A;  2YN4 A;  5FP0 A;  5EE0 A;  3F53 A;  2AXT U;  5ALI A;  4Y2V A;  4UAW A;  3PSF A;  5AI4 A;  5J0W A;  4R8U B;  3H4D A;  5KT3 A;  4PH5 A;  3TFS A;  5JU5 A;  3EPI A;  4ED1 A;  2FPL A;  2H3Z A;  1L6N A;  2PFQ A;  4C4R A;  2MUT A;  3PO5 A;  5JUM A;  1U48 A;  3EPG A;  3F5A A;  4UBB A;  3PMN A;  1PK1 B;  2KN7 A;  2HOQ A;  4CCH A;  2WF6 A;  2BHN A;  3MBY A;  1CEZ A;  5ALD A;  4GC7 A;  2AHO B;  5ALE A;  4LZD A;  3KZX A;  4UAS A;  1HIW A;  5ALU A;  2LMR A;  2W7O A;  3SV3 A;  4NJ8 A;  4QIW F;  2CRX A;  4YD1 A;  5ALV A;  3MGV A;  1XSP A;  1UA1 A;  9ICG A;  1ZQZ A;  4BWM A;  4RNM A;  4Y2T A;  4UB1 A;  5G5H A;  3ETR A;  3ZDA A;  4RPX A;  4FS1 A;  4UW9 A;  3NVZ A;  3V7L A;  2XGQ A;  3LVV A;  2H3I A;  3H8M A;  4RT2 A;  2W55 A;  4P0P A;  2HBK A;  2UVW A;  4F5N A;  3QUC A;  4KLU A;  3FAH A;  5DB9 A;  4M6W A;  5KAF U;  2FDR A;  3UM9 A;  2OWO A;  2JXJ A;  1L7O A;  3GQC A;  2PKE A;  5L1K A;  2XID A;  5HP4 A;  2K4I A;  3QU4 A;  7ICU A;  5J0X A;  4DOA A;  2GWS A;  2ZUD A;  2IOF A;  4UAZ A;  8ICB A;  2GOL A;  1K1Q A;  1TV9 A;  4P0Q A;  2ZIW A;  4GXI A;  2MSN A;  4DQP A;  3T5H A;  5F9N A;  4KLM A;  3KHH A;  1MQ2 A;  2F8L A;  2C2D A;  4KLJ A;  2KZM A;  4O3P A;  1SIJ A;  4PZN A;  1FO4 A;  3HX0 A;  4DL7 A;  1SZP A;  1QSL A;  2D3D A;  2LM1 A;  4FBU A;  5DG8 A;  4QZ9 A;  1UQV A;  3AN1 A;  1RM6 C;  2NO4 A;  2QAR A;  3OSN A;  3N7S C;  1M6Y A;  3BS5 B;  2VIX A;  4RNO A;  1SWW A;  4EEY A;  4MF2 A;  3RJE A;  4O3M A;  1JRP A;  5AK6 A;  1ZQE A;  4F92 B;  1YZ6 A;  5DKW A;  2XI9 A;  4O3N A;  4P4O A;  4P4P A;  1PK3 A;  4FE3 A;  2JV3 A;  4EZ6 A;  5KFN A;  4DOC A;  4DSE A;  5IIM A;  3ZDE A;  1ZQN A;  5L1I A;  3IP4 B;  5KG0 A;  3QYP A;  3ONN A;  3MGI A;  5L9X A;  2WAQ F;  2ZXH A;  1JAL A;  1BPB A;  7ICS A;  1N63 A;  5DQI A;  1UCV A;  1OUQ A;  1ZD2 P;  2FLL A;  4YMO A;  4DS5 A;  4Q44 A;  3M6Z A;  1ZRM A;  2MAX A;  4YMN A;  1FEZ A;  4KLO A;  2F1H A;  2JEI A;  4ZH4 A;  2DF4 B;  2AH5 A;  4DQR A;  2KE7 A;  2V4R A;  4JWM A;  9ICO A;  1ZXI A;  4UBC A;  2DUY A;  3SMV A;  2VA3 A;  3F2C A;  1QLN A;  5BOL A;  1VLB A;  4PJ0 U;  4ED2 A;  5AI5 A;  5IIN A;  3FDS A;  5AM4 A;  1QQ6 A;  1Z1B A;  4Y2R A;  4O3Q A;  3QUB A;  2G07 A;  3QU2 A;  5AI0 A;  2ZIU B;  1A77 A;  2DFL A;  2ZIX B;  5AIB A;  4FO6 A;  2V4Q A;  2XY7 A;  2P66 A;  4B6J A;  2XY5 A;  5EE3 A;  5AK5 A;  2OM6 A;  1ZOL A;  4ECS A;  1DOQ A;  2Y0S C;  9ICN A;  4KLI A;  2EAP A;  2W9B B;  5HML A;  1NZP A;  4EYI B;  5EWE A;  2E3T A;  1WCN A;  1ZQD A;  2ESE A;  5J0S A;  3C1Z A;  4M9G A;  2HHQ A;  3PV8 A;  5AM0 A;  1RYS A;  1TKD A;  1WG8 A;  1XU4 A;  2KVC A;  7ICG A;  4DO9 A;  3ISB A;  1L7N A;  1L5U A;  4C7Y A;  2D8C A;  3JPT A;  2FPM A;  1DGS A;  2C2R A;  3HW8 A;  5KFM A;  3G6X A;  3E0F A;  4HAI A;  4DL4 A;  3PZP A;  3N4M B;  2IOF K;  3N7P D;  3WKD A;  4J9P A;  3T5J A;  4IR1 A;  4QWA A;  3HT3 A;  2A1J A;  2KG5 A;  4YFK A;  2KNJ A;  3TAC B;  1LB2 B;  4IRC A;  3OPX A;  1U47 A;  4Y2Q A;  3PNC A;  3QUQ A;  4O3R A;  1Z1V A;  4KTQ A;  3BQ1 A;  8ICG A;  1JRO A;  4A8E A;  5F9L A;  2VA8 A;  5ALQ A;  5DB8 A;  3LWL A;  4G9B A;  4F93 B;  3AQF A;  5J8Y A;  3PVX A;  5J8Y C;  4EBD A;  3A0H U;  3H7I A;  3T79 A;  1S0O A;  3PO4 A;  3GZF A;  1BPZ A;  2G5H B;  1RXW A;  1N5W A;  3KHL A;  3MR5 A;  1F44 A;  9ICM A;  4QWD A;  4DQS A;  1Z00 B;  4CE6 A;  4Q8F A;  1LKY A;  5ALN A;  5DBC A;  4F2R A;  3CP8 A;  1ZYQ A;  1B22 A;  2M0N A;  4M9H A;  3UQ0 A;  4I2G A;  3ZI4 A;  7ICK A;  3UQ2 A;  2IOH A;  4Y2X A;  1V9P A;  5KT7 A;  1NJY A;  2LYB A;  1TVA A;  4RQN A;  5D49 A;  2HHX A;  4USA A;  4Y2J A;  4IRK A;  3K4G A;  1ZD5 A;  2W9M A;  3D2S A;  2RRD A;  4J9Q A;  3M9N B;  2BDP A;  4JWN A;  5KNI A;  1ZQA A;  3ALR A;  1BPX A;  2HBL A;  3I28 A;  4ACO A;  2PI4 A;  4RU9 A;  1ZJM A;  3BQ0 A;  3U26 A;  4DSF A;  3WKC A;  2MA1 A;  2E1F A;  2FJ6 A;  4MF8 A;  2ZXI A;  3PML A;  1XS9 D;  4NL9 A;  1UPH A;  3PW0 A;  4NL9 C;  5JRT A;  3UMG A;  2NV3 A;  2MUT B;  1ED1 A;  4G3I A;  5KL8 B;  3KBB A;  4IL6 U;  1NKE A;  5BPC A;  5AKZ A;  8ICS A;  3VCB A;  2KK0 A;  4YN4 A;  1NK0 A;  3D2Q A;  4RQ4 A;  1UA0 A;  2KFZ A;  1A6S A;  1ZQW A;  2E8P A;  4F71 A;  2OEH A;  4ECV A;  2RDJ A;  1L8L A;  2XY6 A;  5KFF A;  4CF5 A;  4J9O A;  8ICF A;  1DRG A;  4HYK A;  4Y2P A;  5AK4 A;  5DB7 A;  2DBY A;  2IMW P;  1IIP A;  2J6S A;  1T4G A;  4MEY A;  5J2J A;  5B5E U;  2KKV A;  8ICN A;  2QB1 A;  4PHP A;  4I2D A;  3SZ2 A;  9ICQ A;  2YTU A;  1K1S A;  5J2E A;  3EW9 A;  2HSZ A;  3TAD C;  4ELU A;  1RQL A;  3RAQ A;  3Q8M A;  2ZJ8 A;  4JV0 A;  1S97 A;  3J81 j;  1QSS A;  2FPK A;  1S0M A;  4C8M A;  5AHX A;  5ALK A;  2F44 A;  1T3Q A;  5KL1 B;  4DL5 A;  3Q8R B;  2DKZ A;  8ICE A;  4PL1 A;  4OJ6 A;  3G6V A;  1EXN A;  2AGQ A;  2CPR A;  2HOF A;  8ICM A;  5HMM A;  1X6I A;  4P0Q B;  2ZIW B;  4YQW A;  1BVS A;  5AM5 A;  3MDC A;  4BWJ A;  3AEV A;  1O08 A;  2KZ3 A;  5KT2 A;  2HHS A;  3FM9 A;  5AKL A;  4NM2 A;  4I2H A;  5L1L A;  1MN8 A;  2WHE A;  5AI8 A;  2QAR B;  2NYV A;  4RNN A;  5ALO A;  2YY6 A;  1BGX T;  2ES6 A;  1D9D A;  2HDO A;  4JMU A;  3RH4 A;  8ICX A;  4LVS A;  1CRX A;  1WUD A;  2ZUC A;  4WJ3 B;  3BQT A;  4F4Z A;  4CDG A;  1TAQ A;  4BXO B;  3Q8S B;  1N60 A;  4UB3 A;  4C4T A;  2YMQ A;  4IQV A;  3ZDB A;  3SQI A;  2HCF A;  2ASD A;  2I5H A;  5IIJ A;  3QNM A;  5AKH A;  7ICQ A;  1ZQF A;  2EZZ A;  2KMD A;  4Y2U A;  3UMB A;  2JH1 A;  3SV4 A;  9ICP A;  5DQG A;  3Q8L A;  4OD0 A;  3S6J A;  3QE9 Y;  1SZH A;  3RB3 A;  3ETL A;  3LK9 A;  4EBC A;  1OXJ A;  3F5E A;  5III A;  5EWF A;  3RFA A;  5CR0 A;  3JPO A;  3AUO A;  3SEN A;  1SL0 A;  3WK6 A;  2ASL A;  4M2Y A;  2YX8 A;  5KTQ A;  1PZN A;  5AKE A;  4QZH A;  5AKG A;  4J9L A;  4ECZ A;  4F4X A;  4QWB A;  3CRX A;  4F2S A;  3TAN A;  2JEJ A;  4QWC A;  2JZB A;  3M9M B;  1SKR A;  4RQ7 A;  5ALY A;  3K75 D;  1X9X A;  3SAG A;  1J97 A;  2K8C B;  4NLN A;  4XQ8 A;  3OTQ A;  2NO5 A;  1KEJ A;  4UAV A;  1ZQS A;  2FE9 A;  5KFS A;  1C7Y A;  1NJZ A;  2RQ5 A;  3NRW A;  4ECW A;  1XNS A;  2K89 A;  2BZF A;  5KFX A;  7ICF A;  3KD3 A;  2HHV A;  2LYH A;  3Q8P B;  4YXJ A;  4QZF A;  4J9R A;  2JEG A;  3V7K A;  1XSL A;  3TKA A;  3V7J A;  4KLQ A;  2WFA A;  3ISD A;  1RYR A;  5H2F U;  4KX3 A;  5J2G A;  5J2K A;  4K4H A;  2VKQ A;  3C2K A;  4NLZ A;  2Y0S F;  4KMO B;  3HIL A;  2YQE A;  4B9V A;  3NS1 A;  4TUP A;  4JV2 A;  3MFH A;  4I27 A;  3UXP A;  3RB0 A;  4DOB A;  2IA6 A;  3DDH A;  4JK1 A;  4I2J A;  1KN5 A;  1KTQ A;  2W7P A;  4QZB A;  1YT3 A;  2W9C A;  4NLK A;  3UXO A;  3V6H A;  1JI7 A;  2JRZ A;  3H0L B;  1N48 A;  2OCE A;  3EWA A;  4CF3 A;  2FMP A;  5T14 A;  1SV4 A;  5DBA A;  2HHW A;  5J2C A;  1WWU A;  3RJF A;  8ICC A;  2LYA A;  2R8K A;  3IN5 A;  4C8K A;  4QZA A;  5L1M A;  4OJP A;  3WK5 A;  4AP9 A;  4UB4 A;  2DQN B;  3RJK A;  2H3V A;  3BS7 A;  1L3U A;  3RR7 A;  2QKQ A;  3EUB 2;  1CUK A;  3D2N A;  5KFR A;  2AU0 A;  2F76 X;  4IRD A;  2P6U A;  3HRD D;  5D46 A;  1PVQ A;  3V6K A;  3RBE A;  2J6U A;  4R66 A;  1T94 A;  1SL1 A;  2Z7J A;  3PR4 A;  2KJ5 A;  5AM3 A;  8ICR A;  2NRW A;  4MHV A;  4Z6E A;  4O5C A;  4PGY A;  2BCU A;  2JH7 A;  4AYB C;  1T3N A;  2K4P A;  4RUC A;  4FFD A;  2EZX A;  5HR6 A;  2BPF A;  1RQN A;  5CHG A;  1L3V A;  2KD1 A;  1RXV A;  1SKW A;  4B9N A;  3OSP A;  2D6F C;  4LZG A;  3H8S A;  2UVU A;  2WF7 A;  3PX4 A;  4C0Z A;  3NGD A;  4C7Z A;  4FBT A;  3C2M A;  5KT6 A;  5ALZ A;  2BQR A;  5GTH U;  3L3F X;  1S77 D;  4EYH B;  5AIA A;  2K8A A;  1KSP A;  4R64 A;  4DS4 A;  2PFN A;  3RH5 A;  7ICH A;  1TAU A;  2HMX A;  9ICC A;  3HPO A;  5KFQ A;  3ICX A;  4DFD A;  4DSL A;  4KLS A;  3E2E A;  4ELV A;  4QJF B;  5K4L A;  3T5K A;  1ZQG A;  3C1Y A;  4RQ2 A;  2Q0Z X;  4RQ0 A;  1WWV A;  3GIM A;  3AM9 A;  1DK2 A;  5ALR A;  4YR3 A;  1ZQI A;  3C23 A;  4CF4 A;  5J2D A;  3A0B U;  4J9K A;  2YB4 A;  2KFN A;  5KFH A;  4M9N A;  3RRG A;  4BDP A;  3MDA A;  4IR9 A;  3QU7 A;  4KN7 A;  1ZQY A;  2WF9 A;  5KFV A;  2BR0 A;  3NVW A;  1ZRN A;  5KFP A;  2K4E A;  2AJQ A;  1V85 A;  9ICS A;  4QZ8 A;  1ZQK A;  3C5F A;  3M1Y A;  4R8U A;  3ZDD A;  4YVZ A;  1QTM A;  4NV0 A;  2ZTE A;  4ECY A;  1BPY A;  7ICT A;  2KSO B;  2J6T A;  1UT5 A;  2W43 A;  5J2I A;  3B0Y A;  4FZM A;  1X6J A;  2HBM A;  2HHT A;  4PL2 A;  2YB1 A;  2F1I A;  3PSP A;  2G0A A;  2I1Q A;  2CXY A;  1RYU A;  4YCX A;  4NY8 A;  1PK1 A;  8ICY A;  2LI6 A;  2CN1 A;  2NRT A;  4XRH A;  4O3O A;  1SV0 A;  1D8Y A;  2C22 A;  4PHD A;  1LV5 A;  4MEX A;  1J2M A;  2RHF A;  3MR6 A;  1S0V A;  2F3N A;  3IRU A;  1L7M A;  3Q8Q B;  2I9G A;  5KG7 A;  1T7P A;  3QX7 A;  4F3O A;  5J2F A;  3TAR A;  1KW4 A;  1Q46 A;  5ALP A;  4RPZ A;  4ELT A;  2R18 A;  1IV8 A;  1Q8K A;  2LM4 A;  3CYM A;  7ICM A;  1KL9 A;  3GIJ A;  3SD7 A;  3BJY A;  2PFO A;  3IG8 A;  2PMZ F;  3DV9 A;  1HUZ A;  5HNK A;  4KX5 A;  2RDI A;  8ICL A;  2QLT A;  5AI9 A;  2KIC A;  3O0F A;  3QU5 A;  4JB3 A;  1B4F A;  4F4W A;  2VJ4 A;  1X40 A;  4IQU A;  2FI1 A;  5KG4 A;  2E8M A;  3C5G A;  5D4B A;  5IIL A;  2P35 A;  3M7D A;  3IDW A;  4TQR A;  3JPP A;  3I1Y A;  8ICI A;  1RDF A;  2BDU A;  1X9S A;  1FFV A;  1JX4 A;  4YR2 A;  3QXG A;  1TK5 A;  4Y2Y A;  3LDA A;  1P7D A;  1UT8 A;  1ZD3 A;  3TAP A;  2FMS A;  2W3R A;  2W11 A;  9ICT A;  4KN4 A;  3UMC A;  7ICV A;  5CJ7 A;  3KKA A;  3KKA C;  5IIO A;  1Z3E B;  3BS5 A;  4EEL A;  4QW9 A;  2KIW A;  3C21 A;  1Q3U A;  1GO3 F;  3PX6 A;  5G5G A;  4PPX A;  3HWT A;  3PR5 B;  4DFM A;  1TK8 A;  4BGD A;  1KFT A;  1N61 A;  1B43 A;  4RT3 A;  3Q8K A;  2ZIV B;  5AKY A;  1U4B A;  1NNL A;  1RPL A;  5KFL A;  3ZDC A;  3IM1 A;  3PW2 A;  2WF8 A;  7ICJ A;  3GIL A;  2R8G A;  4P2H A;  5EE9 A;  5KFD A;  3HP6 A;  5IIK A;  3ED5 A;  2VJ5 A;  1OW5 A;  4IC9 A;  2C2E A;  4F50 A;  4Z6F A;  4DSK A;  2EH9 A;  4M04 A;  3MR3 A;  2XO7 A;  3ISC A;  2PXI A;  1XSN A;  3H8W A;  2XGP A;  3K1Z A;  3H0M B;  4XUS A;  1TK0 A;  5EE1 A;  3N28 A;  5DGB A;  4IS7 A;  3OJU A;  2XIC A;  1FIQ A;  2F77 X;  5ALJ A;  4NLB A;  3GV7 B;  4J9N A;  1ZQC A;  2ISP A;  2BCR A;  4R63 A;  2AQ4 A;  5KG1 A;  2ODG A;  4GC6 A;  5AIC A;  3AL0 B;  4ED6 A;  4UAR A;  1IM4 A;  1V38 A;  4Q8E A;  3LWM A;  2ZIU A;  2ZIX A;  9ICJ A;  5TZV A;  1NKC A;  1UHU A;  4UB6 U;  2FLN A;  4EEN A;  4DF8 A;  5CP2 A;  5ALX A;  1LVH A;  1KKX A;  4DL3 A;  4P0P B;  5DB6 A;  3WKA A;  2W9B A;  2I6X A;  3RB6 A;  2NRV A;  9ICH A;  2LHT A;  3NUQ A;  2L5Y A;  1DXS A;  4Q43 A;  2A1A A;  3WU2 U;  1S8O A;  4C8N A;  4M6W B;  4GFJ A;  2PI5 A;  2OH2 A;  2DPJ A;  1ZQR A;  3JPS A;  2W8L A;  2PMZ C;  4UB8 U;  1JXE A;  3PW5 A;  5KFJ A;  4YR0 A;  4YD2 A;  1HJP A;  2KVS A;  3K1R B;  4I2A A;  2F2A B;  1TE2 A;  1BPE A;  5J0Q A;  3BZC A;  3PY8 A;  5GTI U;  2V9W A;  4LJX A;  3HJE A;  1KRP A;  3PX0 A;  2NRZ A;  4MFA A;  3WK9 A;  2BPG A;  2W03 A;  5KFO A;  1D9F A;  9ICB A;  4OJ5 A;  2EAM A;  5KFW A;  4B9T A;  4ICA A;  2OHF A;  3NVY A;  5AK3 A;  1A0P A;  4MFC A;  3RBD A;  1FFU A;  2KZZ A;  4TUS A;  1WYG A;  1NOM A;  1ZQT A;  2KTQ A;  3T3F A;  1ARO P;  4TUQ A;  2F8K A;  1SL2 A;  5AKK A;  5ALH A;  5DGA A;  3BDP A;  3EYZ A;  4U7C A;  3WKB A;  5DQH A;  3HKZ C;  4DWI A;  4KLT A;  3WK4 A;  5KFY A;  2Y1I A;  2EZY A;  5A0L A;  5J0U A;  4AYB F;  1N5X A;  4FZL A;  4RQM A;  2BCV A;  8ICH A;  3B0X A;  1B0X A;  2KHQ A;  1Z00 A;  2GLE A;  1HEK A;  2E1E A;  1L8O A;  3NTU A;  2ISO A;  3V72 A;  2HVH A;  1KBU A;  3KZI U;  2ZUB A;  3KHR A;  4JV1 A;  4RZR A;  1MSW D;  3MAB A;  1NZB A;  3H8J A;  2BCS A;  1TFR A;  5J0R A;  3D6J A;  5KFT A;  9ICE A;  1ZQM A;  2DPI A;  2VAN A;  4F5R A;  4DLG A;  4I2I A;  2Y1J A;  1ZQQ A;  2IHM A;  1NK9 A;  1X2I A;  8ICP A;  3E58 A;  2O6K A;  1JMS A;  2QB0 A;  2KIV A;  1MQ3 A;  5ALG A;  1WCL A;  1SXD A;  3RR8 A;  1X42 A;  2ATL A;  2AQ0 A;  1HUO A;  1KDH A;  1ZQH A;  7ICR A;  4KIT B;  3ZD9 A;  2H3Q A;  1JIH A;  4UAU A;  4CNQ A;  1QCK A;  1NI3 A;  3ZD8 A;  3M8S A;  3N97 B;  1ZQX A;  5J2H A;  3RH6 A;  5KFB A;  8ICV A;  2K60 A;  2FLP A;  3I76 A;  1ZET A;  4DEZ A;  1ZD4 A;  5CEH A;  1L7P A;  1RG6 A;  8ICU A;  5KFE A;  2RP5 A;  1JXL A;  4QZG A;  4UQG A;  1ZQL A;  3QU9 A;  2KV2 A;  4QZD A;  5DLG A;  4PHA A;  2NRX A;  4QNL A;  1F5S A;  5AKJ A;  3RJJ A;  2A1J B;  2JEF A;  2HW3 A;  3TFR A;  2LBO A;  4I2C A;  1PVP A;  1MA7 A;  4OJL A;  2ZTC A;  1YZ7 A;  2IHN A;  2EQY A;  4ED3 A;  3AMZ A;  4QWE A;  2G08 A;  1URJ A;  4Z6D A;  4DLE A;  3H40 A;  2UVR A;  5KG2 A;  3H4B A;  1S76 D;  1XO0 A;  1NK4 A;  2ASJ A;  2HI0 A;  1CI4 A;  3TI0 A;  3CNH A;  1COO A;  1ZQJ A;  4I2E A;  2WB1 F;  1X66 A;  3RF9 A;  2JMG A;  4O3S A;  3RAX A;  1KLN A;  1Z4N A;  2K4H A;  1XWL A;  5KFK A;  4PHE A;  5C5J A;  3UPQ A;  4NM1 A;  1IXR A;  5ALT A;  1LKY B;  2DWQ A;  5J2B A;  2KKP A;  4QIW C;  2R8J A;  1L3T A;  3SEI A;  3MC1 A;  8ICO A;  1IG6 A;  1PUZ A;  2YMM A;  2WTF A;  5B66 U;  1COK A;  5J2A A;  4I2F A;  2RLT A;  3PST A;  4NXZ A;  1Y88 A;  4PGQ A;  2N1R A;  4BJQ A;  1RZT A;  4M9J A;  4RQ1 A;  1Z19 A;  2XCA A;  3OGU A;  5ALM A;  2PFP A;  5DG9 A;  3MGH A;  3BQ7 A;  3TQ1 A;  2AGP A;  5ALF A;  2ZJ5 A;  2BKE A;  3JPQ A;  1ZQO A;  5J0T A;  3NVV A;  5AM1 A;  2Y9U A;  2BCQ A;  4BXO A;  5KG5 A;  4F5Q A;  4C8O A;  4OJO A;  8ICZ A;  4KLF A;  3GFK B;  4GIB A;  4RQ3 A;  2DGZ A;  1KFS A;  1AQ6 A;  5EWG A;  4KLH A;  2E5S A;  2KP7 A;  1N62 A;  2B21 A;  3JPN A;  5KT5 A;  3B9J A;  4J03 A;  4ED7 A;  4FS2 A;  1Q3V A;  3KOO A;  9ICU A;  4YG2 A;  5CWR A;  5KFZ A;  3IV6 A;  2LPE A;  4DSI A;  3QEA Z;  1MC8 A;  4NLG A;  3WK7 A;  1NJW A;  9ICX A;  5KFC A;  3JPR A;  2FMQ A;  4YMM A;  4E0D A;  1QSY A;  9ICW A;  8ICJ A;  4F5O A;  3RB4 A;  1X9W A;  3LVW A;  4CGZ A;  5AKX A;  4TUR A;  3UXN A;  4NWI A;  2LKY A;  5DLF A;  2UVV A;  1K5O A;  1L3S A;  5KAI U;  5HHH A; 
#chains in the Genus database with same CATH homology
 3SEI A;  5J8Y C;  2E8P A;  2F3N A;  3HIL A;  2EAN A;  2KSO A;  1COK A;  3TAD A;  1OW5 A;  1KW4 A;  2EAM A;  2K60 A;  2DKX A;  2KMD A;  1LKY A;  1SXE A;  1SV0 C;  2F8K A;  3BQ7 A;  1WWV A;  1RG6 A;  2QB1 A;  4IS7 A;  2QB0 B;  5F3X B;  1JI7 A;  2EAP A;  2YTU A;  4PZN A;  1SV4 A;  2D3D A;  1B4F A;  2Y9U A;  3TAD C;  1X40 A;  1OXJ A;  2DL0 A;  1WWU A;  1UQV A;  2E8O A;  2E8M A;  5JU5 A;  5L1M A;  2QAR A;  4RQN A;  3SEN A;  5JTI A;  2B6G A;  3BS5 B;  4RQM A;  2ESE A;  1V38 A;  1F0M A;  3BS7 A;  1SGG A;  1B0X A;  2EAO A;  3IDW A;  2QKQ A;  2GLE A;  2F44 A;  2E8N A;  1PK3 A;  1PK1 B;  2JV3 A;  4PZO A;  2DKZ A;  2Y9T A;  2D8C A;  5KNI A;  1X9X A;  1V85 A;  2LPE A;  4MHV A;  2L5Y A;  1DXS A;  2LMR A;  4NJ8 A;  2FE9 A;  1X66 A;  2KSO B;  3KKA A;  2K4P A;  3KKA C;  3BS5 A;  1UCV A;  2KG5 A;  3TAC B;  2QAR B;  4NL9 A;  1PK1 A;  2QB0 A;  4NL9 C;  5JRT A;  2KIV A;  2ES6 A;  1LKY B;  1Z1V A;  3H8M A;  3K1R B;  1SXD A;  1SV0 A;  2KE7 A;  5J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...