1SXDA

Solution structure of the pointed (pnt) domain from mgabpa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
b'GSHMAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GA repeat binding protein, alpha
molecule tags Transcription, signaling protein
source organism Mus musculus
publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
total genus 27
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxdA00
1V38A 2E8OA 1LKYB 1SV0C 3SEIA 2L5YA 1JI7A 2K4PA 2EAMA 2LPEA 1UCVA 1SV4A 1F0MA 2F8KA 2Y9UA 1B4FA 2D8CA 3KKAC 3SENA 4IS7A 1KW4A 1UQVA 3BQ7A 2F44A 2EANA 2K60A 2KSOB 3BS7A 5F3XB 1SV0A 1X9XA 1PK3A 4RQMA 1Z1VA 1COKA 4MHVA 2KG5A 1OXJA 2GLEA 3HILA 5JU5A 4PZNA 1SXDA 2F3NA 1WWVA 4NL9A 5JRTA 3H8MA 3TACB 3TADC 2QB0A 2B6GA 1DXSA 2KMDA 1OW5A 1PK1A 2D3DA 2E8NA 2QARA 2QARB 3IDWA 1X40A 3TADA 1V85A 2Y9TA 4PZOA 1PK1B 2KE7A 1B0XA 2DKZA 2YTUA 2QB0B 3KKAA 2FE9A 2EAPA 1RG6A 2DKXA 2LMRA 2E8PA 5L1MA 2EAOA 5KNIA 3BS5A 2QKQA 2JV3A 1WWUA 5JTIA 1SXEA 4NJ8A 3K1RB 5J8YC 5J8YA 2DL0A 2ESEA 1LKYA 1SGGA 3BS5B 2ES6A 2E8MA 2QB1A 1X66A 2KSOA 4NL9C 2KIVA 4RQNA
chains in the Genus database with same CATH superfamily
3QUBA 1V38A 5J0PA 2K8CB 2XCAA 2FLLA 2GWSA 3WKBA 1UCVA 5HR7A 5KFVA 4MFCA 1C20A 2ZTCA 8ICJA 4RQ8A 1N48A 2HVIA 1MQ2A 2PMZF 2W11A 4NLKA 3C5FA 2AGQA 4TQRA 4EBEA 5J0TA 5HR6A 5E79U 1CRXA 1N61A 2A1AA 4ICAA 3NVYA 4C8KA 4OO1J 1ZQXA 4PPXA 3BQ2A 4LJXA 1S0VA 4O3OA 4XQ8A 3SI8A 1OXJA 2HHSA 1SXDA 2W04A 5KFXA 2JEJA 1XSNA 3KBBA 2DQNB 4QZ8A 4KLLA 1KRPA 3K4GA 7ICVA 3N4MB 3QU2A 2W9CB 2VJ4A 1NK4A 2AQ0A 2IHMA 4BJQA 1L7NA 4GC6A 4I2IA 4RQ4A 4O3QA 5KFKA 4O5CA 3A0BU 1SL2A 4B9SA 3GIKA 4AYBF 2W03A 3BZKA 3TFSA 2XVTA 1ZQWA 1LV5A 3OHAA 4US9A 4KN4A 5KG3A 2AQ4A 3M9OB 4YR2A 2DFLA 1X9WA 5EE3A 3H4BA 3G6XA 3C2KA 3K1RB 2G0AA 2ALZA 1O08A 2W9BA 8ICCA 5KFHA 1ZQMA 2Y1JA 1J2NA 3MGHA 5H2FU 1RQLA 1UPHA 2VA8A 5KFJA 2P6UA 3CYMA 2LI6A 3FM9A 4BDPA 1UT5A 1FFVA 3RB3A 3T5JA 4IQTA 1JX4A 1SL0A 3H0MB 2LHTA 2OWOA 4U6PA 5KFIA 4CGZA 3V7LA 3RB4A 5TISU 4K4HA 1YZ7A 3KHHA 5A0LA 5ALMA 1RYSA 5ALLA 2BKEA 5J2KA 8ICWA 4ECZA 2NV3A 1XNSA 3PSIA 4NM1A 2PXIA 2NYVA 4Y2JA 3RTVA 4BWJA 2ODGA 3TFRA 4YMOA 2GO7A 4X5VA 4MHVA 4YXMA 5J2DA 4OCZA 4UASA 4DQPA 4B9LA 3ED5A 1TAUA 2VJ5A 4CF5A 5CRXA 5AM3A 2YX8A 4NLNA 2B6GA 3H8WA 4MF2A 5AKIA 4YCXA 2ZJ5A 4ED0A 4KLMA 2Z7JA 2DBYA 4UB1A 2JR5A 2K8BB 2B0CA 2W3RA 2DKZA 2G09A 5L1JA 3F2DA 4IL6U 5CP2A 4U7CA 2LKYA 3FDSA 3F5EA 2UVWA 2JV3A 3PMLA 1D9FA 1X42A 2F1IA 5DBAA 5DG8A 4KTQA 1N2XA 5KT6A 1QQ5A 4NJ8A 1TV9A 2C2DA 1TFRA 3Q8QB 2KJ5A 4KLGA 1YZ6A 3RH6A 5B66U 4OJ6A 5BOMA 1SZPA 2NRWA 5AK6A 2EAMA 2ZIWB 3U26A 2R18A 5KT7A 4I2DA 1B4FA 2G06A 3ICXA 4DOBA 1ZQFA 4DF4A 5AI4A 2AXTU 2RRDA 2W7PA 4Q8FA 2KZMA 4ECRA 2KKPA 4UBBA 4KLSA 1HJPA 2HDOA 7ICNA 4KX3A 3KOOA 5ALYA 3A0HU 4TQSA 2HW3A 1F5SA 5F9NA 1RQNA 1YT3A 4F4ZA 4R66A 2BCVA 1IG6A 3D2NA 3JPNA 1HUOA 4PZNA 3SV3A 3RRGA 2F1JA 4E0DA 3F5AA 9ICWA 1MC8A 4P0PA 2FLNA 3PO4A 5AKEA 5KG7A 3C2LA 2ZJ8A 2HHWA 4ED2A 3UXNA 4RQ0A 7ICQA 3AQEA 1ED1A 2EZXA 3OJUA 2EQYA 4R63A 3PY8A 4P4OA 3RF9A 2HMXA 3WK8A 5BOLA 2A1JB 2JZBB 2JZBA 2HHTA 2QB0B 4I2EA 4JV1A 4I2HA 4PL1A 9ICGA 1RG6A 4A8EA 4EZ9A 9ICIA 2YY6A 1N63A 2KD1A 4KLHA 4XRHA 2EDUA 3C21A 3M6KA 5ALGA 2HHXA 2ZUCA 2H3VA 2RHFA 3PSPA 9ICXA 5TZVA 4QZGA 5IINA 3PNCA 4FO6A 2C2EA 7ICKA 5J8YC 1VJ5A 4JMUA 4ECTA 4FE3A 1KKXA 2ZIXA 3PZPA 2QB1A 1CEZA 3SMVA 5KAFU 3BQTA 4DL5A 1MN8A 3IHQB 4Y2UA 5AI5A 8ICAA 3AM9A 3V6HA 3C23A 4P0QA 4DL6A 5AI9A 2F1HA 3KKAC 4DL4A 4R8UB 2XGQA 4UB4A 2EZZA 4FBTA 2QLTA 8ICGA 1SL1A 5AI6A 3IN5A 3IG8A 2LM4A 4ZH4A 3M9NB 4ED8A 3KFUF 1JN3A 1K5OA 8ICIA 5JU5A 3GIIA 5EWFA 2ISOA 4P4PA 4J9MA 4NY8A 5DGBA 9ICTA 3PMNA 7ICEA 4PJ0U 1TKDA 4KLTA 4M9HA 1K1QA 7ICSA 4J9RA 4DS4A 2KMDA 1OW5A 3OJSA 2RQ5A 3OTQA 3UMCA 1BPYA 2MU2A 5DQHA 2E5SA 4ECQA 3E0FA 1H38A 1Z4NA 2N1RA 3FYHA 2FE9A 1Q3VA 8ICXA 3AL0B 3NUQA 1L5UA 5ALUA 5FP0A 5J0WA 5HP4A 4QW8A 1RZTA 4DQQA 8ICTA 9ICKA 3OGUA 4YMNA 3MR6A 4O3MA 1WCLA 2VA2A 2H3QA 2NRVA 1S76D 3H40A 3LK9A 5J8YA 4WJ3B 1U47A 3ZD8A 5AKZA 1X9SA 1NNLA 1T4GA 2RDIA 3RAXA 4IR9A 3SAHA 4UW9A 2JRZA 5K4LA 5KFBA 1CUKA 5EE1A 5KFLA 1Y88A 2K4PA 5KFFA 1T7PA 2BGWA 1Q3UA 2KFZA 1L3UA 2KP7A 9ICSA 2V9WA 1XU4A 4PH5A 3IP4B 2KVCA 4IS7A 3GIMA 3MDAA 4P0QB 5KFZA 1Z00B 4LZGA 4I2FA 5DG9A 1D8YA 3LWMA 2LM1A 4FS2A 1X9XA 3QZ7A 2NO5A 4M04A 3QUTA 4C0ZA 2YB1A 2AJQA 3V7JA 3PX0A 5ALXA 3AUOA 3HT3A 1L7OA 4CRXA 5KTQA 1NJWA 1BPBA 3UMBA 4IR1A 4USAA 3M1YA 1J97A 2PMZC 1SIJA 5J0RA 2QB0A 5J2JA 5IIMA 3CRXA 4QNLA 1TK0A 4F93B 1ZQUA 1JUDA 5J0OA 1WUDA 1LVHA 8ICSA 3WKEA 2Y0SC 1KBUA 1ZD3A 2HBKA 2K4HA 5AHXA 7ICMA 3Q8MA 3V72A 9ICOA 4RQ1A 4KN7A 2BQUA 2DPJA 5L1MA 3ISBA 2V4QA 5T14A 1X2IA 3MDCA 3EYZA 5AM4A 4C7YA 1CI4A 3ZDEA 2GOLA 2OEHA 5HHHA 7ICHA 2DUYA 5KT3A 1NK7A 3QU7A 4IRDA 4YG2A 4QWAA 4KLJA 1X6JA 1QQ6A 5ALWA 5AKHA 3HWTA 4DSKA 4DCCA 4GFJA 2JMGA 3RR7A 4RNMA 2KKVA 3EZ5A 1ZD5A 2I9GA 7ICUA 8ICQA 4B6JA 2ZIWA 4DLEA 3WK7A 3GV8B 3VC8A 1KN5A 5C0YA 3BQ7A 1NZBA 4MEYA 5AKLA 1J2MA 5KFRA 4C8OA 3LVWA 2JEIA 2MUTA 1KFTA 4DFKA 2W3SA 1ZQCA 2HBJA 5GTIU 3UXPA 3QU5A 2OH2A 1NI3A 4ELVA 3QUQA 2CXYA 1U9LA 3ZD9A 4EEKA 5J2IA 3MR3A 2EH9A 5IILA 5KFNA 3PSFA 1TAQA 3Q8RB 3H8MA 4F5PA 4Q8EA 7ICRA 2KIWA 4O0IA 1WYGA 3AU6A 2Y1IA 5J2EA 4DSJA 2BDPA 4NM2A 1PK1A 3PR5B 2QARA 2WF5A 4KLUA 1ZOLA 4QWEA 1ZQSA 1X40A 4F91B 2EZYA 1V85A 4PZOA 4O3SA 1Q46A 1KDHA 1ZQNA 4I2BA 2RP5A 4QWCA 2KTQA 2R8JA 3BJYA 2BCQA 1ZD4A 5D46A 3QYPA 2LMRA 3KHGA 4JWMA 2XIDA 3RBDA 4O3PA 3HKZF 2KICA 4QZCA 1WWUA 5ALRA 3HW8A 2W8KA 8ICPA 3QEAZ 1XWLA 4BWMA 2FDRA 4J9SA 3JPRA 3L4PA 4M9GA 5DB8A 3E2EA 3PW0A 3I28A 9ICQA 4ED6A 3MC1A 5ALSA 4CNQA 2XC9A 1X66A 5ALTA 2KSOA 5J2CA 1ZRNA 4UATA 1RXVA 3TAQA 3MFHA 5KT4A 4Z6FA 5KFSA 2FJ6A 4F71A 3Q8SB 1RDFA 2LYHA 4YMMA 3N28A 1U4BA 1SKSA 3PV8A 1A77A 3ZDCA 4YN4A 5AK5A 3BDPA 4Y2TA 3RFAA 3H0RB 2XGPA 3SD7A 3GDXA 2F44A 3SAGA 5AM1A 5J0UA 1Z00A 2AHOB 3IRUA 4CF4A 2ZXIA 5KFYA 5AIBA 4M9LA 4QZIA 4AP9A 1TAMA 2C28A 2ZIUB 1L7MA 2MAXA 5AM5A 5EWGA 1COKA 1QQ7A 2VKQA 4RQ7A 2KFNA 5J0QA 2OXOA 4QZDA 4ACOA 2WAQC 2I5HA 1IIPA 3WKCA 4YR3A 4PHAA 5ALDA 3H8JA 8ICLA 3KD3A 2HI0A 1NKEA 3PO5A 4HAIA 4EELA 1UA0A 9ICEA 5ALIA 3RH4A 4Z6DA 5IIIA 3T5LA 3F2CA 4UAWA 4IC9A 1ZD2P 3NVVA 4DS5A 5L1LA 3LYSA 1ZQ1C 2E8PA 2EAOA 7ICOA 2ZJAA 1L3SA 3N97B 2KN7A 4NLCA 2I6XA 3DDHA 4KITB 3AEVA 2Q0ZX 3KHRA 3LDAA 2HVHA 3HX0A 5AK4A 1NJZA 4QJFB 2E8MA 4Q44A 3RB0A 5DKWA 5J29A 1NK8A 3EWAA 5AKGA 1ZQGA 3SEIA 2W43A 4UB6U 1ZQDA 3HP6A 1Z4OA 2W7OA 4DO9A 1S8OA 2YMQA 4J03A 5HHIA 2PFPA 3WK6A 4Y2SA 4Q43A 2JEFA 2D8CA 4KLDA 5AIAA 2BCUA 1ZQHA 3ONNA 1UHUA 5DBCA 2HHVA 2FMQA 2IOHA 4TUQA 3JPTA 4UB8U 1MQ3A 5GTHU 1XSLA 4EYIB 4RQMA 5DB9A 4M6WB 4TUSA 2CPRA 4P2HA 5KG5A 4F2SA 4ELTA 4RUAA 4UB5A 2XI9A 9ICVA 5HNKA 3SQIA 2KOBA 1ZQEA 2WF6A 3PW7A 4F3OA 4CCHA 4QZHA 2R8KA 3UMGA 2D3DA 3QEBZ 9ICBA 3IDWA 4CDGA 3GQCA 1NOMA 2ZIUA 1T94A 1IM4A 1PUZA 4NXZA 5KFUA 3PX4A 3C5GA 3EUB2 4FZLA 2D6FC 9ICJA 2A1JA 1PVRA 2F8LA 3PW2A 2OHFA 3M8RA 5KG4A 4XUSA 4TURA 4RQ6A 4IRKA 4ECVA 5AI8A 2K89A 4QWDA 1DGSA 5ALPA 3PW4A 1ZJNA 1LKYA 3BS5B 3TANA 4BXOB 4I2AA 3TI0A 4Y2QA 1N5WA 1U45A 1LKYB 4XA5A 4DSIA 2PFQA 3GZFA 2LPEA 4PHPA 2KHVA 2E3TA 5KFOA 2F8KA 4NWIA 4R8UA 3HKZC 2WHEA 2ZIVA 5KG2A 4KLEA 2K60A 3PX6A 2LYBA 5F3XB 2BR0A 1AROP 4ECYA 1RM6C 2YMLA 4IQUA 4Z6CA 3RR8A 1TE2A 4QZFA 3M7DA 4KX5A 3DEEA 1ZQTA 2ZIXB 2ZTDA 2GLEA 2F3NA 8ICMA 2IA6A 3Q8LA 1NK9A 3TACB 3B9JA 3CW2C 3TKAA 2H3FA 4BX9C 5KAIU 4DL2A 8ICYA 2F77X 1N56A 1A76A 3TAPA 2OCEA 4C4SA 2E8NA 1BPXA 5AM2A 3WKAA 3JPOA 3TADA 1ZQQA 5EE9A 1D8LA 4F72A 2J6TA 2WB1C 3KKAA 8ICOA 5D49A 2EAPA 1ECWA 2C2RA 3G6VA 2JEGA 5J0YA 4RQ5A 2ASDA 3TARA 1DGJA 3RJGA 4J9QA 2AU0A 5DGAA 3VCBA 2W8LA 1HUZA 1L3VA 3AQFA 2RLTA 2H3IA 2B21A 4Y2PA 2ESEA 1BPEA 3QX7A 4QZAA 3RH5A 2KIVA 5G5HA 1ZYQA 3T5KA 2KZZA 4GLXA 1L8OA 2ASJA 1SV0C 4F4YA 4GXIA 4F5NA 2NRTA 5J0SA 3L5KA 4DOAA 2Y9UA 3LWLA 1JROA 9ICAA 4B9UA 3THVA 3RB6A 4F8RA 4M2YA 3ETLA 3QU9A 3O0FA 5J2AA 1ZQLA 2HOFA 1UQVA 1FO4A 4ELUA 2UVRA 3J81j 2VIXA 3UXOA 3DV9A 3WK4A 1ZQAA 3IM1A 4F4XA 2XY5A 2Y0SF 3KZIU 4EX6A 2WFAA 4FS1A 2F76X 2XY6A 3JPPA 3PW5A 1Z1VA 4EEYA 2FMPA 4YFKA 2ISPA 3F53A 4UAZA 4J9PA 3L3FX 3WK9A 4BUGA 2JXJA 1S5LU 5DQGA 4Y2VA 2KV2A 4DFMA 1DOQA 3NTUA 4Z6EA 3BQ1A 3QE9Y 1DXSA 4Y2RA 1KL9A 3V6JA 3ISDA 2ASLA 2HHUA 1SKWA 7ICTA 4I27A 4O5KA 2YMMA 2KVSA 1KFDA 1QLNA 5DQIA 2MRLA 5KFTA 1Q8KA 2KE7A 2BHNA 3BZCA 2W54A 3C2MA 3RJIA 5KFWA 2HBLA 5BPCA 1ZXIA 4RQ2A 2BQRA 3G6YA 4O3NA 2O6KA 2ZUDA 5JTIA 4C4RA 3RAQA 4JB3A 3ZDAA 9ICRA 3JPQA 7ICPA 1A0PA 4IQWA 3Q8PB 4LZDA 2NO4A 1NJYA 4ED3A 4GXKA 4FZNA 1ZQRA 3FAHA 4RQNA 5KG1A 1D8BA 4OJPA 2J6UA 2PFNA 3NRWA 1PVQA 1DK2A 1VDVA 5DDYA 1NK5A 4UAUA 3ZI4A 5L1KA 3UQ2A 5DG7A 3CP8A 3C1YA 3UM9A 7ICGA 1N5XA 5HMLA 2BPGA 5J0XA 2IHNA 3QUCA 4EZ6A 9ICPA 2AH5A 2K4IA 2ZG6A 2FPKA 4KMUA 7ICLA 5J2HA 3LVVA 4DL3A 1TVAA 4DF8A 5DB6A 4C4TA 3IV6A 5KFMA 4RQ3A 5D4BA 2GH1A 4ECWA 4LVSA 1JALA 4BGDA 4HYKA 2OYYA 3GV5B 2DGZA 1SB3C 4F2RA 3N7SC 5J2FA 3AN1A 3TADC 3E58A 4C80A 2FPMA 3H0LB 4RNNA 4K4IA 1ZQVA 2ZIVB 1NKBA 1S9FA 3JPSA 5AICA 4DSFA 3ZDBA 8ICKA 5KFGA 4PHDA 1B22A 3MABA 5DLFA 4DQSA 4YVZA 5ALKA 9ICHA 1B0XA 1F44A 2MUTB 4JUZA 4M47A 4YQWA 4Y2YA 2QKQA 3SZ2A 2ZXHA 4F5OA 4KLIA 1JRPA 4DL7A 2ZTEA 2DWQA 3RJFA 4GC7A 4YXJA 1KLNA 1HIWA 2E8OA 3QZ8A 1ZQOA 4OJ5A 1QSSA 4I2CA 4C7ZA 2KHQA 4PHEA 1F0MA 5JUMA 1SZHA 2VA3A 2F2AB 4B9VA 4R64A 1X6IA 3H8SA 2LBOA 5KG6A 3M6ZA 1ZQPA 4DFJA 2PI4A 2WB1F 4NLBA 3GV7B 3D6JA 4O3RA 3OSNA 3T79A 4C8LA 4JK1A 4G3IA 3NRZA 3HPOA 3ORYA 1HEKA 8ICBA 2HOIA 4KLOA 4JWNA 1D9DA 4ECUA 5F9LA 7ICFA 4EX7A 4F5RA 4UAVA 5EOZA 1COOA 4GXJA 1JIHA 4RZRA 5B5EU 5CR0A 4UB3A 3OHBA 4K4GA 2JGAA 4I2JA 1JXLA 4DLGA 4J9LA 1ZQJA 5L1IA 2J6SA 1QSYA 1PK1B 5ALJA 1ZQKA 2YTUA 4C8MA 2R8HA 5EWEA 3S6JA 2W55A 1ZQIA 1S77D 4JV0A 3ALRA 2DKXA 3FC4A 2IMWP 2K4EA 3GIJA 2G07A 2A3VA 3NS1A 3R9KA 1L8LA 2H5XA 4MFAA 8ICRA 1AQ6A 2WTFA 2K8AA 4IQVA 1BPZA 3I76A 3OPXA 3AU2A 4UQGA 3KHLA 2P66A 2OM6A 5DBBA 4AYBC 1RYUA 3RRHA 2PFOA 1B43A 1M6YA 2ES6A 4US8A 4NL9C 2H3ZA 5KFPA 4O5EA 5ALQA 1C7YA 1JI7A 3SAFA 3MR2A 4M9JA 4YD2A 5G5GA 4ECXA 1O03A 4NLGA 3RJJA 5CHGA 4RNOA 5CEHA 5KFAA 5AKJA 2PKEA 3SENA 2E1EA 1TK8A 2V4RA 3EPIA 2BPCA 2IBKA 3OSPA 1ZETA 1RPLA 5ALHA 1S0OA 2KJ9A 1U48A 4QW9A 3GU3A 4OJLA 2G5IB 5JRTA 2AGOA 3SV4A 2YN4A 4QZEA 1MA7A 1RYRA 9ICCA 3QXGA 8ICUA 1ZRMA 1SKRA 1V97A 5KL1B 2KEYA 2A19A 4OJOA 4J9KA 3KTQA 5CWRA 5DDMA 5AKXA 4I2GA 1XO1A 8ICVA 1S97A 4F92B 3WK5A 3PR4A 4FFDA 1K1SA 1BNPA 2WF8A 3EPGA 2HOQA 3BS5A 1LB2B 4FBUA 4F4WA 4ECSA 4DSEA 1IV8A 3UQ0A 4J9OA 5ALEA 1NK6A 4B9TA 4ZOHC 2KNJA 4EBDA 8ICHA 1SGGA 4DFPA 2UVVA 4MEXA 2FMSA 2IOFA 5ALFA 2BQ3A 2WAQF 1QTMA 2KJ8A 1S0MA 2C22A 4P0PB 1BGXT 4DQIA 2XICA 3D2QA 3NASA 1OUQA 9ICLA 3B0YA 4EBCA 2FPLA 5KFDA 3HRDD 1SWVA 3MR5A 2FI1A 1KW4A 1TK5A 4DQRA 3F2BA 2EANA 2UVUA 5KT2A 4RUCA 4KLFA 1FIQA 2KSOB 3BS7A 5DLGA 2BCSA 3QNMA 3N7PD 2XY7A 4O9MA 4GIBA 2W9MA 5KFEA 4Q45A 4RPXA 3CNHA 4F4KA 1QCKA 1ZQZA 9ICNA 2E1FA 2JH1A 3HILA 5HMMA 3MFIA 4QWBA 1Z3EB 4NL9A 5ALNA 1GO3F 4TUPA 4EENA 2W9CA 4MFFA 3NVZA 4UAYA 3MBYA 4UARA 2KK0A 2DF4B 4NLZA 1SWWA 3PVXA 5ALOA 3ISCA 2QARB 1XO0A 4YP3A 2M9NA 2HBMA 1L6NA 3HJEA 3V6KA 5EE0A 1A6SA 5AKKA 4PL2A 2R8GA 3K75D 2YMPA 5J2BA 1UT8A 5CJ7A 1VLBA 5AK3A 5IIOA 1SXEA 2NRZA 4PGQA 4DEZA 1Z1BA 3C28A 1PZNA 4M0AA 2P35A 3T3FA 2XO7A 1FFUA 3T5HA 4QZBA 1WCNA 2BPFA 3M8SA 3H4DA 2RDJA 3TQ1A 4KMOB 3V7KA 3K1ZA 1JMSA 8ICEA 1XS9D 2BDUA 1L3TA 2PI5A 1URJA 1SV4A 4QZ9A 3GILA 2JHDA 4ED1A 4DSLA 4R65A 1L7PA 4YR0A 1MSWD 5L9XA 4OD0A 3MGVA 5ALVA 9ICFA 1KTQA 4I29A 5C5JA 3M9MB 4QIWF 3B0XA 3NVWA 1SV0A 1BVSA 1NJXA 1QSLA 3N7RC 2DPIA 3ETRA 5AKYA 4DOCA 3RBEA 4RPYA 3ZDDA 2NRXA 2FLPA 1FEZA 5CA7A 4F50A 3BQ0A 2IOFK 2VANA 4YD1A 3UPQA 3SR6A 4PGXA 1XC9A 2I1QA 7ICJA 5CB1A 5ALZA 4UBCA 5IIJA 3AMZA 4CE6A 4RT2A 3RJHA 9ICUA 1U49A 2YQEA 1PVPA 1T8EA 4FZMA 4DWIA 5KT5A 4M9NA 1QH9A 2CRXA 1S0NA 3H7IA 9ICMA 4Y2XA 1DK3A 2G08A 3SYZA 2Q4TA 1WG8A 3KZXA 3D2SA 1ZJMA 4B9NA 5KL8B 2BZFA 4UB2A 3MGIA 1NZPA 1NKCA 3QU4A 4KLQA 1JXEA 3GFKB 5KG0A 2LYAA 3C1ZA 8ICZA 1ZQYA 2P6RA 3RJKA 1EXNA 4CF3A 2L5YA 3I1YA 4JV2A 3WKDA 2G5HB 4DFDA 2HCFA 2ZUBA 5KFCA 1IXRA 5KFQA 2W9BB 4C8NA 3WU2U 4PGYA 1RXWA 4RU9A 2XCPA 1ZQBA 1BPDA 3NGDA 4B9MA 1KQQA 2ATLA 1PK3A 4RPZA 4NV0A 1UA1A 2HHQA 4F5QA 2YB4A 4P4MA 1KFSA 2KG5A 4BXOA 5J2GA 1P7DA 2BCRA 2WF9A 4G9BA 4J9NA 1WWVA 2JH7A 5DB7A 3Q8KA 2M0NA 1XSPA 1DRGA 2R8IA 5AM0A 3IG5A 2MSNA 1T3QA 1BNOA 1S10A 1N60A 1KSPA 1V9PA 2Y9TA 4I28A 4EYHB 4QIWC 1N62A 2MA1A 5AI0A 2HSZA 1NK0A 1Z19A 5KNIA 7ICIA 8ICFA 4IRCA 1X9MA 3PSTA 1T3NA 2W9AA 4RT3A 1KEJA 3EW9A 4M6WA 3C29A 3RJEA 2CN1A 8ICNA 2AGPA 2DL0A 4ED7A 2KZ3A 5IIKA 4MF8A 2WF7A
chains in the Genus database with same CATH topology
1V38A 2E8OA 1LKYB 1SV0C 3SEIA 2L5YA 1JI7A 2K4PA 2EAMA 2LPEA 1UCVA 1SV4A 1F0MA 2F8KA 2Y9UA 1B4FA 2D8CA 3KKAC 3SENA 4IS7A 1KW4A 1UQVA 3BQ7A 2F44A 2EANA 2K60A 2KSOB 3BS7A 5F3XB 1SV0A 1X9XA 1PK3A 4RQMA 1Z1VA 1COKA 4MHVA 2KG5A 1OXJA 2GLEA 3HILA 5JU5A 4PZNA 1SXDA 2F3NA 1WWVA 4NL9A 5JRTA 3H8MA 3TACB 3TADC 2QB0A 2B6GA 1DXSA 2KMDA 1OW5A 1PK1A 2D3DA 2E8NA 2QARA 2QARB 3IDWA 1X40A 3TADA 1V85A 2Y9TA 4PZOA 1PK1B 2KE7A 1B0XA 2DKZA 2YTUA 2QB0B 3KKAA 2FE9A 2EAPA 1RG6A 2DKXA 2LMRA 2E8PA 5L1MA 2EAOA 5KNIA 3BS5A 2QKQA 2JV3A 1WWUA 5JTIA 1SXEA 4NJ8A 3K1RB 5J8YC 5J8YA 2DL0A 2ESEA 1LKYA 1SGGA 3BS5B 2ES6A 2E8MA 2QB1A 1X66A 2KSOA 4NL9C 2KIVA 4RQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V38 A;  2E8O A;  1LKY B;  1SV0 C;  3SEI A;  2L5Y A;  1JI7 A;  2K4P A;  2EAM A;  2LPE A;  1UCV A;  1SV4 A;  1F0M A;  2F8K A;  2Y9U A;  1B4F A;  2D8C A;  3KKA C;  3SEN A;  4IS7 A;  1KW4 A;  1UQV A;  3BQ7 A;  2F44 A;  2EAN A;  2K60 A;  2KSO B;  3BS7 A;  5F3X B;  1SV0 A;  1X9X A;  1PK3 A;  4RQM A;  1Z1V A;  1COK A;  4MHV A;  2KG5 A;  1OXJ A;  2GLE A;  3HIL A;  5JU5 A;  4PZN A;  1SXD A;  2F3N A;  1WWV A;  4NL9 A;  5JRT A;  3H8M A;  3TAC B;  3TAD C;  2QB0 A;  2B6G A;  1DXS A;  2KMD A;  1OW5 A;  1PK1 A;  2D3D A;  2E8N A;  2QAR A;  2QAR B;  3IDW A;  1X40 A;  3TAD A;  1V85 A;  2Y9T A;  4PZO A;  1PK1 B;  2KE7 A;  1B0X A;  2DKZ A;  2YTU A;  2QB0 B;  3KKA A;  2FE9 A;  2EAP A;  1RG6 A;  2DKX A;  2LMR A;  2E8P A;  5L1M A;  2EAO A;  5KNI A;  3BS5 A;  2QKQ A;  2JV3 A;  1WWU A;  5JTI A;  1SXE A;  4NJ8 A;  3K1R B;  5J8Y C;  5J8Y A;  2DL0 A;  2ESE A;  1LKY A;  1SGG A;  3BS5 B;  2ES6 A;  2E8M A;  2QB1 A;  1X66 A;  2KSO A;  4NL9 C;  2KIV A;  4RQN A; 
#chains in the Genus database with same CATH topology
 3QUB A;  1V38 A;  5J0P A;  2K8C B;  2XCA A;  2FLL A;  2GWS A;  3WKB A;  1UCV A;  5HR7 A;  5KFV A;  4MFC A;  1C20 A;  2ZTC A;  8ICJ A;  4RQ8 A;  1N48 A;  2HVI A;  1MQ2 A;  2PMZ F;  2W11 A;  4NLK A;  3C5F A;  2AGQ A;  4TQR A;  4EBE A;  5J0T A;  5HR6 A;  5E79 U;  1CRX A;  1N61 A;  2A1A A;  4ICA A;  3NVY A;  4C8K A;  4OO1 J;  1ZQX A;  4PPX A;  3BQ2 A;  4LJX A;  1S0V A;  4O3O A;  4XQ8 A;  3SI8 A;  1OXJ A;  2HHS A;  1SXD A;  2W04 A;  5KFX A;  2JEJ A;  1XSN A;  3KBB A;  2DQN B;  4QZ8 A;  4KLL A;  1KRP A;  3K4G A;  7ICV A;  3N4M B;  3QU2 A;  2W9C B;  2VJ4 A;  1NK4 A;  2AQ0 A;  2IHM A;  4BJQ A;  1L7N A;  4GC6 A;  4I2I A;  4RQ4 A;  4O3Q A;  5KFK A;  4O5C A;  3A0B U;  1SL2 A;  4B9S A;  3GIK A;  4AYB F;  2W03 A;  3BZK A;  3TFS A;  2XVT A;  1ZQW A;  1LV5 A;  3OHA A;  4US9 A;  4KN4 A;  5KG3 A;  2AQ4 A;  3M9O B;  4YR2 A;  2DFL A;  1X9W A;  5EE3 A;  3H4B A;  3G6X A;  3C2K A;  3K1R B;  2G0A A;  2ALZ A;  1O08 A;  2W9B A;  8ICC A;  5KFH A;  1ZQM A;  2Y1J A;  1J2N A;  3MGH A;  5H2F U;  1RQL A;  1UPH A;  2VA8 A;  5KFJ A;  2P6U A;  3CYM A;  2LI6 A;  3FM9 A;  4BDP A;  1UT5 A;  1FFV A;  3RB3 A;  3T5J A;  4IQT A;  1JX4 A;  1SL0 A;  3H0M B;  2LHT A;  2OWO A;  4U6P A;  5KFI A;  4CGZ A;  3V7L A;  3RB4 A;  5TIS U;  4K4H A;  1YZ7 A;  3KHH A;  5A0L A;  5ALM A;  1RYS A;  5ALL A;  2BKE A;  5J2K A;  8ICW A;  4ECZ A;  2NV3 A;  1XNS A;  3PSI A;  4NM1 A;  2PXI A;  2NYV A;  4Y2J A;  3RTV A;  4BWJ A;  2ODG A;  3TFR A;  4YMO A;  2GO7 A;  4X5V A;  4MHV A;  4YXM A;  5J2D A;  4OCZ A;  4UAS A;  4DQP A;  4B9L A;  3ED5 A;  1TAU A;  2VJ5 A;  4CF5 A;  5CRX A;  5AM3 A;  2YX8 A;  4NLN A;  2B6G A;  3H8W A;  4MF2 A;  5AKI A;  4YCX A;  2ZJ5 A;  4ED0 A;  4KLM A;  2Z7J A;  2DBY A;  4UB1 A;  2JR5 A;  2K8B B;  2B0C A;  2W3R A;  2DKZ A;  2G09 A;  5L1J A;  3F2D A;  4IL6 U;  5CP2 A;  4U7C A;  2LKY A;  3FDS A;  3F5E A;  2UVW A;  2JV3 A;  3PML A;  1D9F A;  1X42 A;  2F1I A;  5DBA A;  5DG8 A;  4KTQ A;  1N2X A;  5KT6 A;  1QQ5 A;  4NJ8 A;  1TV9 A;  2C2D A;  1TFR A;  3Q8Q B;  2KJ5 A;  4KLG A;  1YZ6 A;  3RH6 A;  5B66 U;  4OJ6 A;  5BOM A;  1SZP A;  2NRW A;  5AK6 A;  2EAM A;  2ZIW B;  3U26 A;  2R18 A;  5KT7 A;  4I2D A;  1B4F A;  2G06 A;  3ICX A;  4DOB A;  1ZQF A;  4DF4 A;  5AI4 A;  2AXT U;  2RRD A;  2W7P A;  4Q8F A;  2KZM A;  4ECR A;  2KKP A;  4UBB A;  4KLS A;  1HJP A;  2HDO A;  7ICN A;  4KX3 A;  3KOO A;  5ALY A;  3A0H U;  4TQS A;  2HW3 A;  1F5S A;  5F9N A;  1RQN A;  1YT3 A;  4F4Z A;  4R66 A;  2BCV A;  1IG6 A;  3D2N A;  3JPN A;  1HUO A;  4PZN A;  3SV3 A;  3RRG A;  2F1J A;  4E0D A;  3F5A A;  9ICW A;  1MC8 A;  4P0P A;  2FLN A;  3PO4 A;  5AKE A;  5KG7 A;  3C2L A;  2ZJ8 A;  2HHW A;  4ED2 A;  3UXN A;  4RQ0 A;  7ICQ A;  3AQE A;  1ED1 A;  2EZX A;  3OJU A;  2EQY A;  4R63 A;  3PY8 A;  4P4O A;  3RF9 A;  2HMX A;  3WK8 A;  5BOL A;  2A1J B;  2JZB B;  2JZB A;  2HHT A;  2QB0 B;  4I2E A;  4JV1 A;  4I2H A;  4PL1 A;  9ICG A;  1RG6 A;  4A8E A;  4EZ9 A;  9ICI A;  2YY6 A;  1N63 A;  2KD1 A;  4KLH A;  4XRH A;  2EDU A;  3C21 A;  3M6K A;  5ALG A;  2HHX A;  2ZUC A;  2H3V A;  2RHF A;  3PSP A;  9ICX A;  5TZV A;  4QZG A;  5IIN A;  3PNC A;  4FO6 A;  2C2E A;  7ICK A;  5J8Y C;  1VJ5 A;  4JMU A;  4ECT A;  4FE3 A;  1KKX A;  2ZIX A;  3PZP A;  2QB1 A;  1CEZ A;  3SMV A;  5KAF U;  3BQT A;  4DL5 A;  1MN8 A;  3IHQ B;  4Y2U A;  5AI5 A;  8ICA A;  3AM9 A;  3V6H A;  3C23 A;  4P0Q A;  4DL6 A;  5AI9 A;  2F1H A;  3KKA C;  4DL4 A;  4R8U B;  2XGQ A;  4UB4 A;  2EZZ A;  4FBT A;  2QLT A;  8ICG A;  1SL1 A;  5AI6 A;  3IN5 A;  3IG8 A;  2LM4 A;  4ZH4 A;  3M9N B;  4ED8 A;  3KFU F;  1JN3 A;  1K5O A;  8ICI A;  5JU5 A;  3GII A;  5EWF A;  2ISO A;  4P4P A;  4J9M A;  4NY8 A;  5DGB A;  9ICT A;  3PMN A;  7ICE A;  4PJ0 U;  1TKD A;  4KLT A;  4M9H A;  1K1Q A;  7ICS A;  4J9R A;  4DS4 A;  2KMD A;  1OW5 A;  3OJS A;  2RQ5 A;  3OTQ A;  3UMC A;  1BPY A;  2MU2 A;  5DQH A;  2E5S A;  4ECQ A;  3E0F A;  1H38 A;  1Z4N A;  2N1R A;  3FYH A;  2FE9 A;  1Q3V A;  8ICX A;  3AL0 B;  3NUQ A;  1L5U A;  5ALU A;  5FP0 A;  5J0W A;  5HP4 A;  4QW8 A;  1RZT A;  4DQQ A;  8ICT A;  9ICK A;  3OGU A;  4YMN A;  3MR6 A;  4O3M A;  1WCL A;  2VA2 A;  2H3Q A;  2NRV A;  1S76 D;  3H40 A;  3LK9 A;  5J8Y A;  4WJ3 B;  1U47 A;  3ZD8 A;  5AKZ A;  1X9S A;  1NNL A;  1T4G A;  2RDI A;  3RAX A;  4IR9 A;  3SAH A;  4UW9 A;  2JRZ A;  5K4L A;  5KFB A;  1CUK A;  5EE1 A;  5KFL A;  1Y88 A;  2K4P A;  5KFF A;  1T7P A;  2BGW A;  1Q3U A;  2KFZ A;  1L3U A;  2KP7 A;  9ICS A;  2V9W A;  1XU4 A;  4PH5 A;  3IP4 B;  2KVC A;  4IS7 A;  3GIM A;  3MDA A;  4P0Q B;  5KFZ A;  1Z00 B;  4LZG A;  4I2F A;  5DG9 A;  1D8Y A;  3LWM A;  2LM1 A;  4FS2 A;  1X9X A;  3QZ7 A;  2NO5 A;  4M04 A;  3QUT A;  4C0Z A;  2YB1 A;  2AJQ A;  3V7J A;  3PX0 A;  5ALX A;  3AUO A;  3HT3 A;  1L7O A;  4CRX A;  5KTQ A;  1NJW A;  1BPB A;  3UMB A;  4IR1 A;  4USA A;  3M1Y A;  1J97 A;  2PMZ C;  1SIJ A;  5J0R A;  2QB0 A;  5J2J A;  5IIM A;  3CRX A;  4QNL A;  1TK0 A;  4F93 B;  1ZQU A;  1JUD A;  5J0O A;  1WUD A;  1LVH A;  8ICS A;  3WKE A;  2Y0S C;  1KBU A;  1ZD3 A;  2HBK A;  2K4H A;  5AHX A;  7ICM A;  3Q8M A;  3V72 A;  9ICO A;  4RQ1 A;  4KN7 A;  2BQU A;  2DPJ A;  5L1M A;  3ISB A;  2V4Q A;  5T14 A;  1X2I A;  3MDC A;  3EYZ A;  5AM4 A;  4C7Y A;  1CI4 A;  3ZDE A;  2GOL A;  2OEH A;  5HHH A;  7ICH A;  2DUY A;  5KT3 A;  1NK7 A;  3QU7 A;  4IRD A;  4YG2 A;  4QWA A;  4KLJ A;  1X6J A;  1QQ6 A;  5ALW A;  5AKH A;  3HWT A;  4DSK A;  4DCC A;  4GFJ A;  2JMG A;  3RR7 A;  4RNM A;  2KKV A;  3EZ5 A;  1ZD5 A;  2I9G A;  7ICU A;  8ICQ A;  4B6J A;  2ZIW A;  4DLE A;  3WK7 A;  3GV8 B;  3VC8 A;  1KN5 A;  5C0Y A;  3BQ7 A;  1NZB A;  4MEY A;  5AKL A;  1J2M A;  5KFR A;  4C8O A;  3LVW A;  2JEI A;  2MUT A;  1KFT A;  4DFK A;  2W3S A;  1ZQC A;  2HBJ A;  5GTI U;  3UXP A;  3QU5 A;  2OH2 A;  1NI3 A;  4ELV A;  3QUQ A;  2CXY A;  1U9L A;  3ZD9 A;  4EEK A;  5J2I A;  3MR3 A;  2EH9 A;  5IIL A;  5KFN A;  3PSF A;  1TAQ A;  3Q8R B;  3H8M A;  4F5P A;  4Q8E A;  7ICR A;  2KIW A;  4O0I A;  1WYG A;  3AU6 A;  2Y1I A;  5J2E A;  4DSJ A;  2BDP A;  4NM2 A;  1PK1 A;  3PR5 B;  2QAR A;  2WF5 A;  4KLU A;  1ZOL A;  4QWE A;  1ZQS A;  1X40 A;  4F91 B;  2EZY A;  1V85 A;  4PZO A;  4O3S A;  1Q46 A;  1KDH A;  1ZQN A;  4I2B A;  2RP5 A;  4QWC A;  2KTQ A;  2R8J A;  3BJY A;  2BCQ A;  1ZD4 A;  5D46 A;  3QYP A;  2LMR A;  3KHG A;  4JWM A;  2XID A;  3RBD A;  4O3P A;  3HKZ F;  2KIC A;  4QZC A;  1WWU A;  5ALR A;  3HW8 A;  2W8K A;  8ICP A;  3QEA Z;  1XWL A;  4BWM A;  2FDR A;  4J9S A;  3JPR A;  3L4P A;  4M9G A;  5DB8 A;  3E2E A;  3PW0 A;  3I28 A;  9ICQ A;  4ED6 A;  3MC1 A;  5ALS A;  4CNQ A;  2XC9 A;  1X66 A;  5ALT A;  2KSO A;  5J2C A;  1ZRN A;  4UAT A;  1RXV A;  3TAQ A;  3MFH A;  5KT4 A;  4Z6F A;  5KFS A;  2FJ6 A;  4F71 A;  3Q8S B;  1RDF A;  2LYH A;  4YMM A;  3N28 A;  1U4B A;  1SKS A;  3PV8 A;  1A77 A;  3ZDC A;  4YN4 A;  5AK5 A;  3BDP A;  4Y2T A;  3RFA A;  3H0R B;  2XGP A;  3SD7 A;  3GDX A;  2F44 A;  3SAG A;  5AM1 A;  5J0U A;  1Z00 A;  2AHO B;  3IRU A;  4CF4 A;  2ZXI A;  5KFY A;  5AIB A;  4M9L A;  4QZI A;  4AP9 A;  1TAM A;  2C28 A;  2ZIU B;  1L7M A;  2MAX A;  5AM5 A;  5EWG A;  1COK A;  1QQ7 A;  2VKQ A;  4RQ7 A;  2KFN A;  5J0Q A;  2OXO A;  4QZD A;  4ACO A;  2WAQ C;  2I5H A;  1IIP A;  3WKC A;  4YR3 A;  4PHA A;  5ALD A;  3H8J A;  8ICL A;  3KD3 A;  2HI0 A;  1NKE A;  3PO5 A;  4HAI A;  4EEL A;  1UA0 A;  9ICE A;  5ALI A;  3RH4 A;  4Z6D A;  5III A;  3T5L A;  3F2C A;  4UAW A;  4IC9 A;  1ZD2 P;  3NVV A;  4DS5 A;  5L1L A;  3LYS A;  1ZQ1 C;  2E8P A;  2EAO A;  7ICO A;  2ZJA A;  1L3S A;  3N97 B;  2KN7 A;  4NLC A;  2I6X A;  3DDH A;  4KIT B;  3AEV A;  2Q0Z X;  3KHR A;  3LDA A;  2HVH A;  3HX0 A;  5AK4 A;  1NJZ A;  4QJF B;  2E8M A;  4Q44 A;  3RB0 A;  5DKW A;  5J29 A;  1NK8 A;  3EWA A;  5AKG A;  1ZQG A;  3SEI A;  2W43 A;  4UB6 U;  1ZQD A;  3HP6 A;  1Z4O A;  2W7O A;  4DO9 A;  1S8O A;  2YMQ A;  4J03 A;  5HHI A;  2PFP A;  3WK6 A;  4Y2S A;  4Q43 A;  2JEF A;  2D8C A;  4KLD A;  5AIA A;  2BCU A;  1ZQH A;  3ONN A;  1UHU A;  5DBC A;  2HHV A;  2FMQ A;  2IOH A;  4TUQ A;  3JPT A;  4UB8 U;  1MQ3 A;  5GTH U;  1XSL A;  4EYI B;  4RQM A;  5DB9 A;  4M6W B;  4TUS A;  2CPR A;  4P2H A;  5KG5 A;  4F2S A;  4ELT A;  4RUA A;  4UB5 A;  2XI9 A;  9ICV A;  5HNK A;  3SQI A;  2KOB A;  1ZQE A;  2WF6 A;  3PW7 A;  4F3O A;  4CCH A;  4QZH A;  2R8K A;  3UMG A;  2D3D A;  3QEB Z;  9ICB A;  3IDW A;  4CDG A;  3GQC A;  1NOM A;  2ZIU A;  1T94 A;  1IM4 A;  1PUZ A;  4NXZ A;  5KFU A;  3PX4 A;  3C5G A;  3EUB 2;  4FZL A;  2D6F C;  9ICJ A;  2A1J A;  1PVR A;  2F8L A;  3PW2 A;  2OHF A;  3M8R A;  5KG4 A;  4XUS A;  4TUR A;  4RQ6 A;  4IRK A;  4ECV A;  5AI8 A;  2K89 A;  4QWD A;  1DGS A;  5ALP A;  3PW4 A;  1ZJN A;  1LKY A;  3BS5 B;  3TAN A;  4BXO B;  4I2A A;  3TI0 A;  4Y2Q A;  1N5W A;  1U45 A;  1LKY B;  4XA5 A;  4DSI A;  2PFQ A;  3GZF A;  2LPE A;  4PHP A;  2KHV A;  2E3T A;  5KFO A;  2F8K A;  4NWI A;  4R8U A;  3HKZ C;  2WHE A;  2ZIV A;  5KG2 A;  4KLE A;  2K60 A;  3PX6 A;  2LYB A;  5F3X B;  2BR0 A;  1ARO P;  4ECY A;  1RM6 C;  2YML A;  4IQU A;  4Z6C A;  3RR8 A;  1TE2 A;  4QZF A;  3M7D A;  4KX5 A;  3DEE A;  1ZQT A;  2ZIX B;  2ZTD A;  2GLE A;  2F3N A;  8ICM A;  2IA6 A;  3Q8L A;  1NK9 A;  3TAC B;  3B9J A;  3CW2 C;  3TKA A;  2H3F A;  4BX9 C;  5KAI U;  4DL2 A;  8ICY A;  2F77 X;  1N56 A;  1A76 A;  3TAP A;  2OCE A;  4C4S A;  2E8N A;  1BPX A;  5AM2 A;  3WKA A;  3JPO A;  3TAD A;  1ZQQ A;  5EE9 A;  1D8L A;  4F72 A;  2J6T A;  2WB1 C;  3KKA A;  8ICO A;  5D49 A;  2EAP A;  1ECW A;  2C2R A;  3G6V A;  2JEG A;  5J0Y A;  4RQ5 A;  2ASD A;  3TAR A;  1DGJ A;  3RJG A;  4J9Q A;  2AU0 A;  5DGA A;  3VCB A;  2W8L A;  1HUZ A;  1L3V A;  3AQF A;  2RLT A;  2H3I A;  2B21 A;  4Y2P A;  2ESE A;  1BPE A;  3QX7 A;  4QZA A;  3RH5 A;  2KIV A;  5G5H A;  1ZYQ A;  3T5K A;  2KZZ A;  4GLX A;  1L8O A;  2ASJ A;  1SV0 C;  4F4Y A;  4GXI A;  4F5N A;  2NRT A;  5J0S A;  3L5K A;  4DOA A;  2Y9U A;  3LWL A;  1JRO A;  9ICA A;  4B9U A;  3THV A;  3RB6 A;  4F8R A;  4M2Y A;  3ETL A;  3QU9 A;  3O0F A;  5J2A A;  1ZQL A;  2HOF A;  1UQV A;  1FO4 A;  4ELU A;  2UVR A;  3J81 j;  2VIX A;  3UXO A;  3DV9 A;  3WK4 A;  1ZQA A;  3IM1 A;  4F4X A;  2XY5 A;  2Y0S F;  3KZI U;  4EX6 A;  2WFA A;  4FS1 A;  2F76 X;  2XY6 A;  3JPP A;  3PW5 A;  1Z1V A;  4EEY A;  2FMP A;  4YFK A;  2ISP A;  3F53 A;  4UAZ A;  4J9P A;  3L3F X;  3WK9 A;  4BUG A;  2JXJ A;  1S5L U;  5DQG A;  4Y2V A;  2KV2 A;  4DFM A;  1DOQ A;  3NTU A;  4Z6E A;  3BQ1 A;  3QE9 Y;  1DXS A;  4Y2R A;  1KL9 A;  3V6J A;  3ISD A;  2ASL A;  2HHU A;  1SKW A;  7ICT A;  4I27 A;  4O5K A;  2YMM A;  2KVS A;  1KFD A;  1QLN A;  5DQI A;  2MRL A;  5KFT A;  1Q8K A;  2KE7 A;  2BHN A;  3BZC A;  2W54 A;  3C2M A;  3RJI A;  5KFW A;  2HBL A;  5BPC A;  1ZXI A;  4RQ2 A;  2BQR A;  3G6Y A;  4O3N A;  2O6K A;  2ZUD A;  5JTI A;  4C4R A;  3RAQ A;  4JB3 A;  3ZDA A;  9ICR A;  3JPQ A;  7ICP A;  1A0P A;  4IQW A;  3Q8P B;  4LZD A;  2NO4 A;  1NJY A;  4ED3 A;  4GXK A;  4FZN A;  1ZQR A;  3FAH A;  4RQN A;  5KG1 A;  1D8B A;  4OJP A;  2J6U A;  2PFN A;  3NRW A;  1PVQ A;  1DK2 A;  1VDV A;  5DDY A;  1NK5 A;  4UAU A;  3ZI4 A;  5L1K A;  3UQ2 A;  5DG7 A;  3CP8 A;  3C1Y A;  3UM9 A;  7ICG A;  1N5X A;  5HML A;  2BPG A;  5J0X A;  2IHN A;  3QUC A;  4EZ6 A;  9ICP A;  2AH5 A;  2K4I A;  2ZG6 A;  2FPK A;  4KMU A;  7ICL A;  5J2H A;  3LVV A;  4DL3 A;  1TVA A;  4DF8 A;  5DB6 A;  4C4T A;  3IV6 A;  5KFM A;  4RQ3 A;  5D4B A;  2GH1 A;  4ECW A;  4LVS A;  1JAL A;  4BGD A;  4HYK A;  2OYY A;  3GV5 B;  2DGZ A;  1SB3 C;  4F2R A;  3N7S C;  5J2F A;  3AN1 A;  3TAD C;  3E58 A;  4C80 A;  2FPM A;  3H0L B;  4RNN A;  4K4I A;  1ZQV A;  2ZIV B;  1NKB A;  1S9F A;  3JPS A;  5AIC A;  4DSF A;  3ZDB A;  8ICK A;  5KFG A;  4PHD A;  1B22 A;  3MAB A;  5DLF A;  4DQS A;  4YVZ A;  5ALK A;  9ICH A;  1B0X A;  1F44 A;  2MUT B;  4JUZ A;  4M47 A;  4YQW A;  4Y2Y A;  2QKQ A;  3SZ2 A;  2ZXH A;  4F5O A;  4KLI A;  1JRP A;  4DL7 A;  2ZTE A;  2DWQ A;  3RJF A;  4GC7 A;  4YXJ A;  1KLN A;  1HIW A;  2E8O A;  3QZ8 A;  1ZQO A;  4OJ5 A;  1QSS A;  4I2C A;  4C7Z A;  2KHQ A;  4PHE A;  1F0M A;  5JUM A;  1SZH A;  2VA3 A;  2F2A B;  4B9V A;  4R64 A;  1X6I A;  3H8S A;  2LBO A;  5KG6 A;  3M6Z A;  1ZQP A;  4DFJ A;  2PI4 A;  2WB1 F;  4NLB A;  3GV7 B;  3D6J A;  4O3R A;  3OSN A;  3T79 A;  4C8L A;  4JK1 A;  4G3I A;  3NRZ A;  3HPO A;  3ORY A;  1HEK A;  8ICB A;  2HOI A;  4KLO A;  4JWN A;  1D9D A;  4ECU A;  5F9L A;  7ICF A;  4EX7 A;  4F5R A;  4UAV A;  5EOZ A;  1COO A;  4GXJ A;  1JIH A;  4RZR A;  5B5E U;  5CR0 A;  4UB3 A;  3OHB A;  4K4G A;  2JGA A;  4I2J A;  1JXL A;  4DLG A;  4J9L A;  1ZQJ A;  5L1I A;  2J6S A;  1QSY A;  1PK1 B;  5ALJ A;  1ZQK A;  2YTU A;  4C8M A;  2R8H A;  5EWE A;  3S6J A;  2W55 A;  1ZQI A;  1S77 D;  4JV0 A;  3ALR A;  2DKX A;  3FC4 A;  2IMW P;  2K4E A;  3GIJ A;  2G07 A;  2A3V A;  3NS1 A;  3R9K A;  1L8L A;  2H5X A;  4MFA A;  8ICR A;  1AQ6 A;  2WTF A;  2K8A A;  4IQV A;  1BPZ A;  3I76 A;  3OPX A;  3AU2 A;  4UQG A;  3KHL A;  2P66 A;  2OM6 A;  5DBB A;  4AYB C;  1RYU A;  3RRH A;  2PFO A;  1B43 A;  1M6Y A;  2ES6 A;  4US8 A;  4NL9 C;  2H3Z A;  5KFP A;  4O5E A;  5ALQ A;  1C7Y A;  1JI7 A;  3SAF A;  3MR2 A;  4M9J A;  4YD2 A;  5G5G A;  4ECX A;  1O03 A;  4NLG A;  3RJJ A;  5CHG A;  4RNO A;  5CEH A;  5KFA A;  5AKJ A;  2PKE A;  3SEN A;  2E1E A;  1TK8 A;  2V4R A;  3EPI A;  2BPC A;  2IBK A;  3OSP A;  1ZET A;  1RPL A;  5ALH A;  1S0O A;  2KJ9 A;  1U48 A;  4QW9 A;  3GU3 A;  4OJL A;  2G5I B;  5JRT A;  2AGO A;  3SV4 A;  2YN4 A;  4QZE A;  1MA7 A;  1RYR A;  9ICC A;  3QXG A;  8ICU A;  1ZRM A;  1SKR A;  1V97 A;  5KL1 B;  2KEY A;  2A19 A;  4OJO A;  4J9K A;  3KTQ A;  5CWR A;  5DDM A;  5AKX A;  4I2G A;  1XO1 A;  8ICV A;  1S97 A;  4F92 B;  3WK5 A;  3PR4 A;  4FFD A;  1K1S A;  1BNP A;  2WF8 A;  3EPG A;  2HOQ A;  3BS5 A;  1LB2 B;  4FBU A;  4F4W A;  4ECS A;  4DSE A;  1IV8 A;  3UQ0 A;  4J9O A;  5ALE A;  1NK6 A;  4B9T A;  4ZOH C;  2KNJ A;  4EBD A;  8ICH A;  1SGG A;  4DFP A;  2UVV A;  4MEX A;  2FMS A;  2IOF A;  5ALF A;  2BQ3 A;  2WAQ F;  1QTM A;  2KJ8 A;  1S0M A;  2C22 A;  4P0P B;  1BGX T;  4DQI A;  2XIC A;  3D2Q A;  3NAS A;  1OUQ A;  9ICL A;  3B0Y A;  4EBC A;  2FPL A;  5KFD A;  3HRD D;  1SWV A;  3MR5 A;  2FI1 A;  1KW4 A;  1TK5 A;  4DQR A;  3F2B A;  2EAN A;  2UVU A;  5KT2 A;  4RUC A;  4KLF A;  1FIQ A;  2KSO B;  3BS7 A;  5DLG A;  2BCS A;  3QNM A;  3N7P D;  2XY7 A;  4O9M A;  4GIB A;  2W9M A;  5KFE A;  4Q45 A;  4RPX A;  3CNH A;  4F4K A;  1QCK A;  1ZQZ A;  9ICN A;  2E1F A;  2JH1 A;  3HIL A;  5HMM A;  3MFI A;  4QWB A;  1Z3E B;  4NL9 A;  5ALN A;  1GO3 F;  4TUP A;  4EEN A;  2W9C A;  4MFF A;  3NVZ A;  4UAY A;  3MBY A;  4UAR A;  2KK0 A;  2DF4 B;  4NLZ A;  1SWW A;  3PVX A;  5ALO A;  3ISC A;  2QAR B;  1XO0 A;  4YP3 A;  2M9N A;  2HBM A;  1L6N A;  3HJE A;  3V6K A;  5EE0 A;  1A6S A;  5AKK A;  4PL2 A;  2R8G A;  3K75 D;  2YMP A;  5J2B A;  1UT8 A;  5CJ7 A;  1VLB A;  5AK3 A;  5IIO A;  1SXE A;  2NRZ A;  4PGQ A;  4DEZ A;  1Z1B A;  3C28 A;  1PZN A;  4M0A A;  2P35 A;  3T3F A;  2XO7 A;  1FFU A;  3T5H A;  4QZB A;  1WCN A;  2BPF A;  3M8S A;  3H4D A;  2RDJ A;  3TQ1 A;  4KMO B;  3V7K A;  3K1Z A;  1JMS A;  8ICE A;  1XS9 D;  2BDU A;  1L3T A;  2PI5 A;  1URJ A;  1SV4 A;  4QZ9 A;  3GIL A;  2JHD A;  4ED1 A;  4DSL A;  4R65 A;  1L7P A;  4YR0 A;  1MSW D;  5L9X A;  4OD0 A;  3MGV A;  5ALV A;  9ICF A;  1KTQ A;  4I29 A;  5C5J A;  3M9M B;  4QIW F;  3B0X A;  3NVW A;  1SV0 A;  1BVS A;  1NJX A;  1QSL A;  3N7R C;  2DPI A;  3ETR A;  5AKY A;  4DOC A;  3RBE A;  4RPY A;  3ZDD A;  2NRX A;  2FLP A;  1FEZ A;  5CA7 A;  4F50 A;  3BQ0 A;  2IOF K;  2VAN A;  4YD1 A;  3UPQ A;  3SR6 A;  4PGX A;  1XC9 A;  2I1Q A;  7ICJ A;  5CB1 A;  5ALZ A;  4UBC A;  5IIJ A;  3AMZ A;  4CE6 A;  4RT2 A;  3RJH A;  9ICU A;  1U49 A;  2YQE A;  1PVP A;  1T8E A;  4FZM A;  4DWI A;  5KT5 A;  4M9N A;  1QH9 A;  2CRX A;  1S0N A;  3H7I A;  9ICM A;  4Y2X A;  1DK3 A;  2G08 A;  3SYZ A;  2Q4T A;  1WG8 A;  3KZX A;  3D2S A;  1ZJM A;  4B9N A;  5KL8 B;  2BZF A;  4UB2 A;  3MGI A;  1NZP A;  1NKC A;  3QU4 A;  4KLQ A;  1JXE A;  3GFK B;  5KG0 A;  2LYA A;  3C1Z A;  8ICZ A;  1ZQY A;  2P6R A;  3RJK A;  1EXN A;  4CF3 A;  2L5Y A;  3I1Y A;  4JV2 A;  3WKD A;  2G5H B;  4DFD A;  2HCF A;  2ZUB A;  5KFC A;  1IXR A;  5KFQ A;  2W9B B;  4C8N A;  3WU2 U;  4PGY A;  1RXW A;  4RU9 A;  2XCP A;  1ZQB A;  1BPD A;  3NGD A;  4B9M A;  1KQQ A;  2ATL A;  1PK3 A;  4RPZ A;  4NV0 A;  1UA1 A;  2HHQ A;  4F5Q A;  2YB4 A;  4P4M A;  1KFS A;  2KG5 A;  4BXO A;  5J2G A;  1P7D A;  2BCR A;  2WF9 A;  4G9B A;  4J9N A;  1WWV A;  2JH7 A;  5DB7 A;  3Q8K A;  2M0N A;  1XSP A;  1DRG A;  2R8I A;  5AM0 A;  3IG5 A;  2MSN A;  1T3Q A;  1BNO A;  1S10 A;  1N60 A;  1KSP A;  1V9P A;  2Y9T A;  4I28 A;  4EYH B;  4QIW C;  1N62 A;  2MA1 A;  5AI0 A;  2HSZ A;  1NK0 A;  1Z19 A;  5KNI A;  7ICI A;  8ICF A;  4IRC A;  1X9M A;  3PST A;  1T3N A;  2W9A A;  4RT3 A;  1KEJ A;  3EW9 A;  4M6W A;  3C29 A;  3RJE A;  2CN1 A;  8ICN A;  2AGP A;  2DL0 A;  4ED7 A;  2KZ3 A;  5IIK A;  4MF8 A;  2WF7 A; 
#chains in the Genus database with same CATH homology
 1V38 A;  2E8O A;  1LKY B;  1SV0 C;  3SEI A;  2L5Y A;  1JI7 A;  2K4P A;  2EAM A;  2LPE A;  1UCV A;  1SV4 A;  1F0M A;  2F8K A;  2Y9U A;  1B4F A;  2D8C A;  3KKA C;  3SEN A;  4IS7 A;  1KW4 A;  1UQV A;  3BQ7 A;  2F44 A;  2EAN A;  2K60 A;  2KSO B;  3BS7 A;  5F3X B;  1SV0 A;  1X9X A;  1PK3 A;  4RQM A;  1Z1V A;  1COK A;  4MHV A;  2KG5 A;  1OXJ A;  2GLE A;  3HIL A;  5JU5 A;  4PZN A;  1SXD A;  2F3N A;  1WWV A;  4NL9 A;  5JRT A;  3H8M A;  3TAC B;  3TAD C;  2QB0 A;  2B6G A;  1DXS A;  2KMD A;  1OW5 A;  1PK1 A;  2D3D A;  2E8N A;  2QAR A;  2QAR B;  3IDW A;  1X40 A;  3TAD A;  1V85 A;  2Y9T A;  4PZO A;  1PK1 B;  2KE7 A;  1B0X A;  2DKZ A;  2YTU A;  2QB0 B;  3KKA A;  2FE9 A;  2EAP A;  1RG6 A;  2DKX A;  2LMR A;  2E8P A;  5L1M A;  2EAO A;  5KNI A;  3BS5 A;  2QKQ A;  2JV3 A;  1WWU A;  5JTI A;  1SXE A;  4NJ8 A;  3K1R B;  5J8Y C;  5J8Y A;  2DL0 A;  2ESE A;  1LKY A;  1SGG A;  3BS5 B;  2ES6 A;  2E8M A;  2QB1 A;  1X66 A;  2KSO A;  4NL9 C;  2KIV A;  4RQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...