1SXDA

Solution structure of the pointed (pnt) domain from mgabpa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
GSHMAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GA repeat binding protein, alpha
publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, signaling protein
total genus 27
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxdA00
1UCVA 5F3XB 1SXDA 1WWVA 2ESEA 2D8CA 2QARA 1SV4A 3SENA 1F0MA 2F44A 2EAPA 2QB0B 2LMRA 3TADC 1DXSA 4RQMA 3K1RB 2QKQA 2YTUA 2ES6A 4IS7A 1PK1B 1PK3A 5JTIA 2E8OA 5J8YA 4RQNA 4PZOA 2KSOA 1V38A 1SGGA 1WWUA 5JRTA 2GLEA 3SEIA 2DKXA 2D3DA 2KE7A 5KNIA 2K60A 1SXEA 1V85A 2L5YA 1RG6A 1B0XA 1X66A 2QB0A 1SV0C 3KKAC 5L1MA 3TADA 1PK1A 2E8PA 2EAOA 1OW5A 1LKYB 4NL9C 2KMDA 2LPEA 3BS5B 1UQVA 1X40A 2KIVA 3HILA 1COKA 1B4FA 3IDWA 2E8MA 1OXJA 4MHVA 2DL0A 2QB1A 2E8NA 2KG5A 2QARB 4PZNA 2FE9A 2DKZA 4NJ8A 1KW4A 3TACB 1SV0A 3KKAA 2K4PA 1Z1VA 1X9XA 5J8YC 1JI7A 2EAMA 1LKYA 3BS7A 3BQ7A 3BS5A 4NL9A 2JV3A 2F8KA 2KSOB 3H8MA 5JU5A 2EANA 2F3NA 2Y9UA 2Y9TA 2B6GA
chains in the Genus database with same CATH superfamily
4R63A 4UB8U 1UCVA 5F3XB 4BXOB 3NRWA 4GLXA 2JEIA 3RJJA 4KITB 3G6XA 3IG5A 3SENA 4M0AA 2EAPA 2HI0A 3NVWA 1BVSA 4C80A 5ALRA 4RQ0A 2AGQA 2KFNA 4XA5A 8ICJA 5IILA 1WCLA 4R64A 4Y2TA 3BJYA 5KG2A 1KL9A 4YMOA 1QQ7A 1RYUA 2AJQA 4PZOA 4RQ4A 5KFOA 4F4YA 2LKYA 4DL3A 2A19A 1S97A 2FMQA 5JRTA 4M9JA 1ZQHA 5KFCA 5J2EA 2K8BB 3RH5A 3EYZA 4J9SA 5J0UA 2K4EA 4M9HA 4QIWC 2CRXA 1Z19A 4I29A 1RQNA 4RU9A 3Q8KA 3ZDEA 4DFPA 2MU2A 4MF8A 3TI0A 4Y2RA 3PMLA 4BWJA 1LKYB 3TFRA 1P7DA 3BS5B 3WU2U 8ICMA 3NS1A 1N61A 4UB1A 1DGJA 2BDUA 3O0FA 1IXRA 8ICAA 1N56A 2KG5A 2M9NA 1VJ5A 4DSKA 5J2FA 4Y2UA 4GIBA 4KX3A 2BPFA 3AMZA 4OCZA 2OHFA 4RPYA 2WF5A 5JU5A 1QQ6A 3N7RC 3KHHA 4LVSA 4QZ9A 5AKYA 2BCRA 3THVA 2DGZA 4QW9A 3C5FA 5ALQA 2YX8A 3I28A 2NRZA 4RNMA 3LVWA 4DFKA 1F5SA 3ISCA 5JUMA 2BCQA 2G0AA 1YZ7A 1WCNA 4KLHA 2ASDA 2AU0A 5AI0A 4IS7A 4EBCA 2XC9A 3ISDA 4DSIA 5CWRA 4DOAA 1T4GA 4F50A 1A77A 5ALZA 4FZNA 2IMWP 2XY5A 3T5JA 4C4SA 3RJIA 3F2CA 3TANA 1TAQA 5EE1A 1N2XA 4Q45A 4RNNA 2IHMA 4NM1A 5KG7A 5KFLA 4J9PA 1TAUA 3PR5B 4CDGA 2ZIUA 5E79U 4MF2A 3OGUA 1JALA 2BR0A 2LPEA 2I6XA 3EZ5A 4EZ9A 8ICSA 1NJYA 1UT5A 2ZIVB 4MFFA 3RAQA 5J0PA 3Q8QB 1N5XA 4UW9A 4PL1A 3SZ2A 4A8EA 8ICUA 1RDFA 2QARB 4YP3A 2DF4B 4M9NA 2WF6A 9ICOA 2P35A 4YQWA 2EQYA 3BDPA 5IIKA 3WKEA 5KFKA 1NNLA 1MQ3A 2KZ3A 9ICGA 1S0OA 1Z4OA 2VKQA 2NRTA 2XY6A 4RQ1A 5KFRA 1S9FA 3H4DA 1AROP 2AQ0A 1J97A 4Y2SA 5AM3A 1SXDA 4RNOA 3SV3A 2W9BA 2IHNA 3D2NA 1L5UA 2FLPA 2KIWA 3RJFA 5L1LA 2W9CB 4DQQA 2WF8A 2KP7A 4ECSA 3GV5B 2MUTA 1A0PA 3L3FX 1MA7A 4B9LA 3QU2A 3JPQA 4GC6A 3PR4A 4TUSA 1JMSA 3WKAA 1MQ2A 2KSOA 4EX7A 5CA7A 5A0LA 2CN1A 5D49A 2W43A 3QU4A 4P0QB 5KTQA 4LJXA 4O3SA 3UPQA 1K5OA 4F5RA 3PX6A 1RG6A 4UB4A 3M7DA 3MDCA 5IIIA 1MSWD 1U49A 4TURA 4I2CA 5KFDA 4U7CA 1UPHA 1WYGA 8ICVA 3C28A 1BPEA 3L5KA 4IR1A 2EH9A 4BXOA 2PFPA 1ZQBA 1COKA 4DLGA 3NTUA 1L7NA 3MC1A 4J9MA 4KMOB 3RJHA 7ICNA 1S5LU 3Q8PB 2VANA 1U9LA 2KNJA 4FS2A 2WFAA 9ICMA 2JRZA 4USAA 4CE6A 4UB2A 4RUAA 4DQIA 2KV2A 1ED1A 4YXMA 4J9LA 4I2GA 9ICHA 3BQ7A 4YMMA 4BWMA 3N97B 5J2IA 4YD1A 3Q8RB 2F8KA 1ZXIA 3QU5A 4NLNA 1LB2B 2W54A 2HOIA 2GO7A 4FBUA 2B6GA 3PW5A 4OJOA 3PY8A 1PVPA 3RB0A 1SL1A 4J9OA 4Z6CA 1N63A 3SMVA 2MRLA 3GU3A 4O3OA 1KFSA 4RQMA 5AI4A 4YXJA 1Q8KA 3SAGA 4KLSA 4DS4A 4F4WA 1ZQFA 2F1IA 1LV5A 2AXTU 1NI3A 3F5AA 5H2FU 3V7KA 1SZHA 8ICFA 4XQ8A 3LYSA 2YMMA 2NRXA 1ZJMA 3HX0A 4MFAA 2R8GA 1ZQAA 1RQLA 3TARA 5TZVA 3H0LB 2OEHA 1SV0C 4AYBF 2XVTA 4EZ6A 2PMZF 4I2BA 3K75D 1X6JA 4M6WA 1TV9A 1RXVA 2Y0SF 1NK9A 4KLDA 1ZJNA 4FZMA 4QZAA 2ALZA 1X42A 4K4GA 1T8EA 2DL0A 5ALWA 2E8NA 1UT8A 4UAVA 5AK6A 4F3OA 3NVVA 1NJZA 3TACB 1LVHA 2J6TA 1FFVA 1SV0A 5AICA 3PW0A 4CCHA 5AI9A 5AIAA 5ALIA 4O3QA 1J2MA 4O3RA 1NK8A 4B9NA 1N62A 2LI6A 5ALEA 1C20A 1PVRA 2KTQA 4NY8A 5DLGA 3MGVA 5KT3A 7ICTA 1N60A 2YB1A 1BPZA 4UAUA 4ECWA 1XSPA 2ESEA 2OXOA 4O5CA 4R65A 7ICEA 2AGPA 2ZIUB 4EEYA 3QU9A 1HEKA 4IRCA 4P0PA 3B9JA 5HR6A 2HHUA 4NLKA 5JTIA 5DGBA 2LHTA 4Z6DA 1B22A 3FC4A 3CW2C 3ETRA 5AKKA 1FIQA 3OJSA 2YN4A 2ATLA 2LYBA 5BOLA 1FO4A 3G6YA 3BQ0A 5HHHA 2BGWA 2EZYA 2F2AB 5KAIU 4JUZA 2NRWA 4C8OA 3MR3A 2RQ5A 3ZD8A 1TVAA 2BKEA 1BPDA 1L8OA 4DFDA 5F9NA 2W11A 1X9SA 5AI8A 1HIWA 3PZPA 2XIDA 3LK9A 1Q46A 3A0HU 3I1YA 3VC8A 4MEXA 2PFOA 3GIKA 4RQ3A 9ICWA 3KZIU 4I2EA 1J2NA 2H5XA 4F2RA 8ICRA 3QUBA 9ICVA 2W9CA 5HMMA 5DG8A 5DLFA 9ICNA 3SD7A 1QCKA 2DWQA 2ZTCA 2W9BB 2A1AA 3OSNA 4M2YA 2KKVA 2NO5A 4PHDA 1JUDA 5KG5A 2MUTB 5AK4A 3UQ0A 4F71A 4I2FA 2UVUA 2KSOB 2KJ8A 4G3IA 3H8MA 5AI5A 4RT3A 5DKWA 3QU7A 2DBYA 4YR0A 4K4IA 3HT3A 5ALSA 4OO1J 5K4LA 1U4BA 4DL6A 3K4GA 1X9WA 2D8CA 3MABA 5EE3A 8ICCA 5KFGA 2WF7A 3MGIA 3JPOA 4YFKA 3HKZC 3OJUA 5DBBA 2HOFA 4KLQA 5ALGA 1ZQPA 2M0NA 1S8OA 2JH7A 4C4RA 4MFCA 4DL7A 1KEJA 2ZJ8A 4RQNA 3VCBA 2A3VA 1TE2A 5TISU 4OJ5A 3N4MB 1X2IA 4I27A 2GLEA 5L1JA 4B6JA 1L8LA 3PSIA 4RT2A 2LYHA 3RJGA 3DV9A 1DGSA 3TAPA 8ICGA 1V85A 2W8LA 4DL4A 4DCCA 5AKXA 1QSYA 1A6SA 3PMNA 4M9GA 1S0MA 5KFIA 2KOBA 5DB9A 1ZQZA 8ICEA 1L6NA 5HHIA 2OCEA 1XC9A 1ZQIA 5J0WA 2Y1IA 2ZUDA 2WB1F 5DQGA 4CF5A 2DKZA 1KRPA 4NJ8A 1NK4A 2E1EA 1U48A 5KT4A 3M9OB 5ALLA 4US8A 1TAMA 2KJ9A 2ZG6A 4NWIA 4QWDA 3QX7A 2EAMA 3PW7A 4JWNA 3ZDAA 1DRGA 2JV3A 2ZJ5A 3KZXA 1M6YA 2LYAA 4RQ6A 3PX0A 4ICAA 5AIBA 3L4PA 2LMRA 2AHOB 4UARA 4RPXA 4BX9C 2VA8A 1ZQKA 5J2HA 1NZBA 1JN3A 5ALJA 3WK5A 3IHQB 3CYMA 1RYRA 2E3TA 2EZXA 1ZD2P 4ECUA 4M6WB 1L7OA 3RB4A 1L7PA 2E8OA 3HPOA 1QQ5A 4PGQA 4O3NA 2C2RA 2IOHA 2B21A 4RQ5A 1QTMA 4PHPA 1ZQUA 4ED7A 2D3DA 2BCSA 2VIXA 4QZHA 4FZLA 2G08A 2ZUBA 3MR2A 3E2EA 4J03A 2P66A 4ECYA 4YVZA 5D4BA 1JIHA 2EAOA 2BQUA 2VJ4A 5C5JA 3RR8A 2XO7A 8ICXA 2HBMA 5J2AA 3BQTA 3H8JA 1B43A 5KFVA 4F5OA 5AKZA 3OTQA 1JRPA 9ICPA 4MHVA 3GIMA 2ASLA 5B5EU 3D2QA 1NK5A 3KHGA 4ED3A 5AM2A 4YR3A 2H3QA 4KTQA 2HBKA 1D8LA 3DEEA 4Y2QA 7ICUA 5L9XA 2GWSA 5CHGA 1ZQDA 2JXJA 5KT2A 8ICNA 1ECWA 3K1ZA 4QIWF 7ICHA 3KOOA 2IOFA 4P0PB 3QUQA 4UBCA 2YMQA 2MAXA 1KBUA 1NJXA 1K1SA 3NRZA 2K4HA 5KG4A 2JH1A 4O5KA 2RDIA 3ORYA 4C8MA 3RRGA 2D6FC 3KTQA 2A1JA 2MSNA 4FS1A 4NM2A 1WG8A 4I2AA 5KFMA 3QUTA 5KFUA 4KLJA 1TFRA 2F44A 3RFAA 2YB4A 4IC9A 3LVVA 1PVQA 3E58A 2IA6A 4IQVA 8ICHA 4F4KA 3FDSA 2Q4TA 5KT5A 1TKDA 1CRXA 4Q8EA 4UB6U 2OWOA 5BPCA 2KJ5A 5T14A 8ICWA 1WWUA 3SV4A 2F77X 2ZXHA 3WKCA 2WHEA 1IV8A 2ZTEA 2H3ZA 5AHXA 1DK2A 4O9MA 1SXEA 4Y2JA 2W8KA 4RPZA 4B9MA 2W04A 5J29A 3M8SA 3C1YA 1ZQTA 4EEKA 1T3NA 4NL9C 2I5HA 4XUSA 5IIMA 2NRVA 3QE9Y 2JGAA 2ODGA 1OXJA 4KLTA 5GTIU 2KK0A 2QB1A 3JPTA 4DQPA 4NXZA 1SWVA 4AYBC 1S0VA 3BZCA 1KW4A 1ZD3A 2PMZC 4QWEA 3LDAA 4C8KA 3GIJA 3PX4A 3IRUA 3NVZA 4UAYA 2ZIXA 2Y0SC 2XY7A 3BS7A 3GDXA 3EWAA 4NL9A 4QZGA 4DSEA 9ICIA 3AN1A 1BPXA 4Y2YA 1XO1A 1L3VA 4EBDA 3H8SA 2KZMA 5EWFA 5ALKA 5HR7A 2FPLA 1Y88A 3RRHA 3M9NB 1XS9D 4JV0A 1ZD4A 2CPRA 3PO5A 3PSPA 7ICJA 3OSPA 1KSPA 1CI4A 2ES6A 2AH5A 3T79A 1PK3A 3IG8A 4OJ6A 5ALVA 1BNOA 5KFQA 5AKGA 3V6HA 3QNMA 2I1QA 1SGGA 9ICEA 1ZQJA 3PNCA 4F5PA 4HYKA 1SIJA 5DG9A 2FDRA 2FPMA 4NV0A 5DQHA 3MBYA 4JWMA 5L1IA 4YR2A 3SAFA 5KL8B 2L5YA 3F2BA 5HMLA 3QEAZ 3RBEA 3KKAC 3S6JA 2ZJAA 3TQ1A 4GC7A 4KLEA 1RPLA 4U6PA 1RM6C 3HWTA 1HUZA 2Z7JA 1Z4NA 2OM6A 1KLNA 2ZXIA 3PSFA 1UQVA 3FM9A 1ZQOA 3M1YA 3N7PD 4P4OA 3RR7A 2R8KA 3AM9A 3FAHA 4DOCA 3H8WA 5G5HA 9ICRA 3M8RA 2HHVA 5CEHA 2FI1A 1ZOLA 1QSLA 2C2DA 4PZNA 3GV8B 3EPGA 1QH9A 1D9FA 5DQIA 2O6KA 5AM0A 3KKAA 1IIPA 2JZBA 5KFSA 4QNLA 5KFEA 1JI7A 4Q8FA 3OHBA 2FJ6A 5J2BA 1ZRNA 1JXLA 4IQWA 4QWCA 3J81j 7ICVA 3AU6A 3I76A 5J2JA 2KD1A 4BJQA 3WK9A 1SV4A 3OPXA 4TUQA 2H3IA 2WAQC 3TADC 3ISBA 3LWMA 8ICKA 4FO6A 1PUZA 2HCFA 2PI5A 1Q3VA 4BGDA 4K4HA 1ZQSA 4UAWA 2J6UA 1V38A 5AKHA 3V6KA 5ALHA 5DBAA 4Y2PA 2R18A 2P6RA 2V4QA 4R66A 2KKPA 4NLGA 4ZOHC 2KE7A 1MC8A 5KNIA 3ETLA 3CNHA 2QB0A 2JEJA 5AKJA 7ICOA 3JPSA 3HP6A 3TADA 5AKLA 3C29A 3RTVA 3DDHA 2QLTA 3EPIA 3PW2A 8ICBA 5AK5A 1IG6A 4YCXA 1ZQYA 1KDHA 9ICCA 4UBBA 1B4FA 3UMBA 9ICJA 5AI6A 5AM4A 9ICBA 2A1JB 4QZFA 1YT3A 2AGOA 2HHXA 3C2KA 4LZDA 2VJ5A 1FEZA 3MFIA 1Z1VA 1CEZA 4F91B 4YN4A 1YZ6A 5D46A 1TK8A 2FPKA 3QEBZ 1COOA 4I2IA 1O08A 1TK0A 5DB6A 2HBLA 3QUCA 3KFUF 5J0QA 1IM4A 1SB3C 4B9UA 3A0BU 3ICXA 5ALXA 4KLUA 4R8UA 1XU4A 7ICSA 4KLFA 3T5LA 4F8RA 8ICYA 5KG0A 5KL1B 2ISPA 4I2DA 4FE3A 2IBKA 1UHUA 4KLLA 1Z3EB 4E0DA 3MGHA 3RH6A 2DQNB 4TUPA 2BCUA 2QKQA 4CF3A 1S77D 4QWBA 4F4ZA 1SWWA 1ZETA 1X6IA 4F5QA 2W9MA 1KN5A 2PKEA 2JR5A 4C8LA 2H3FA 2I9GA 7ICPA 9ICXA 4EYIB 1X66A 1AQ6A 4UAZA 3SYZA 4GXKA 4AP9A 1DK3A 4ECQA 5DGAA 2LM1A 1D9DA 1ZQRA 8ICZA 4YMNA 3RJEA 2JEGA 2PXIA 2R8HA 1XSLA 2ZIXB 4UB5A 3N28A 2FLNA 2N1RA 2KIVA 8ICIA 4DQSA 4US9A 4F92B 4RUCA 3IDWA 1XO0A 2E8MA 1NKBA 3ONNA 1GO3F 4EELA 4O0IA 9ICQA 5EE9A 2HVHA 1JX4A 3UMCA 4DS5A 4CNQA 3H7IA 4DSJA 4KMUA 2FE9A 5KFXA 2RRDA 2BPGA 1ZQWA 4BDPA 2V9WA 4QZEA 1D8BA 2AQ4A 4ACOA 4J9NA 3UXNA 4ECXA 2HHQA 2JMGA 1X9XA 3RF9A 4EENA 5DDMA 1BGXT 4DL2A 3M6ZA 2G09A 4ED8A 5G5GA 4ELVA 1JXEA 3ED5A 4KLOA 2Y9TA 3RH4A 2PFQA 8ICPA 4RZRA 3CRXA 4OJLA 3NVYA 3AEVA 4UATA 3KD3A 4JV1A 1F0MA 5J0RA 1QLNA 2CXYA 2UVRA 1VDVA 1A76A 4P4MA 3ZDCA 2YTUA 1ZQGA 7ICFA 2G5IB 4MEYA 1BPYA 4NLCA 7ICIA 5CB1A 4I28A 5AM5A 4IQUA 1PZNA 5J2KA 4ED2A 3PSTA 4UASA 4Z6EA 4CGZA 3H0MB 2DPJA 2W3RA 3MR6A 5B66U 2MA1A 1SZPA 8ICOA 2K60A 1D8YA 3G6VA 3WK7A 4F93B 2PFNA 1RYSA 5HP4A 3Q8SB 2HHTA 1ZQCA 3ZI4A 2JZBB 2XGQA 5ALMA 1L3SA 2E8PA 1BNPA 4B9SA 2W55A 1NKCA 7ICRA 3HKZF 4Y2XA 2FLLA 4O3MA 5KG1A 5ALTA 1ZQVA 4EX6A 1ZQMA 5EWEA 1V9PA 2VA2A 5CP2A 2P6UA 1ZQNA 7ICKA 4IRDA 2Q0ZX 4C7ZA 2KHQA 2FMSA 3M6KA 1O03A 3FYHA 4ED1A 2LBOA 1NJWA 4M04A 1WUDA 2KZZA 1BPBA 4P2HA 9ICAA 4IRKA 5C0YA 4X5VA 3CP8A 4P4PA 2DPIA 2EANA 4XRHA 2F3NA 3H40A 4KLMA 5KT6A 2GOLA 3PVXA 2Y9UA 3D2SA 1S76D 2HDOA 3WK4A 3IM1A 2K8AA 5ALPA 9ICKA 2VA3A 1EXNA 1NZPA 3GIIA 1NOMA 5EOZA 3V7LA 4J9RA 3BQ2A 2QB0B 4JMUA 2W3SA 4F72A 3K1RB 2FMPA 5CRXA 5EE0A 4PH5A 3PV8A 2UVVA 5DDYA 2KN7A 2ZIWA 4DSFA 4I2JA 1XSNA 2BQRA 1SL2A 1SKWA 3JPPA 2DKXA 5HNKA 3QXGA 2HOQA 4Q44A 4JK1A 3Q8LA 3NGDA 4QZBA 5KFYA 1ZQLA 1ZQQA 3AL0B 5L1MA 2XCAA 5DB8A 5F9LA 3IP4B 1PK1A 5J2CA 2ISOA 4F5NA 4C4TA 2KEYA 3C5GA 4QZDA 1UA0A 4WJ3B 4RQ8A 2HHSA 1SKRA 2J6SA 3D6JA 4ED6A 3UQ2A 3HRDD 4GXJA 4Q43A 7ICLA 3ZD9A 9ICTA 4R8UB 1L3UA 4M9LA 3F2DA 2W9AA 2F1JA 3IV6A 3R9KA 5KG3A 3RB6A 5ALUA 1KTQA 1L3TA 4QJFB 1QSSA 5J0TA 2C22A 2YMLA 2XGPA 2R8JA 1MN8A 3N7SC 5J8YC 4QZIA 1ZQXA 5J2GA 1Q3UA 2G06A 5ALOA 4ELTA 2YY6A 1Z00A 3JPNA 2NV3A 4ECZA 5CR0A 3TAQA 4OD0A 2W7OA 4UB3A 1NKEA 2G5HB 2YMPA 3KHLA 3PO4A 1XNSA 8ICTA 2KICA 3SI8A 5DBCA 4DQRA 3AU2A 4TQSA 2HW3A 4JV2A 5BOMA 5AK3A 1OUQA 3WK6A 3MDAA 5KFAA 3Q8MA 2NO4A 2ASJA 5ALNA 4DLEA 1T94A 1SL0A 2PI4A 3RJKA 2IOFK 7ICMA 3F5EA 5J8YA 3C2LA 2WF9A 3GV7B 8ICLA 5KFTA 2KVCA 1S0NA 2WTFA 9ICSA 4PHEA 4EYHB 5DG7A 4F4XA 4B9VA 5J2DA 1RZTA 2ZTDA 4DWIA 4C0ZA 4FBTA 3F53A 3E0FA 5AKEA 1X9MA 2JEFA 1SKSA 3T5KA 2KVSA 4GXIA 4GFJA 2HVIA 1ZD5A 2F76X 2EDUA 3UMGA 3H4BA 2G07A 1NK6A 1T7PA 3AUOA 3WK8A 4M47A 2JHDA 4RQ7A 5KFWA 4PL2A 2KMDA 3MR5A 5IINA 4PGXA 3EW9A 4ECTA 3RBDA 4DO9A 4J9KA 3WKBA 5KG6A 5DB7A 4G9BA 4YG2A 1KKXA 5CJ7A 2C2EA 1F44A 4F2SA 1NK0A 2W7PA 3V6JA 3C1ZA 2BZFA 4ECRA 1ZQEA 3GZFA 2OH2A 1LKYA 1CUKA 2HMXA 3LWLA 8ICQA 3NASA 3BS5A 3ZDBA 4QZ8A 3C23A 2V4RA 3V7JA 3B0YA 4ED0A 3WKDA 3TKAA 1HUOA 3IN5A 4C8NA 3SR6A 4I2HA 1ZQ1C 4ELUA 4DOBA 5AM1A 1ZRMA 2K8CB 2R8IA 5J0XA 2XI9A 5L1KA 1K1QA 2HSZA 4YD2A 1HJPA 4CF4A 2F1HA 4J9QA 4JB3A 4PGYA 4DF4A 1T3QA 5KAFU 4HAIA 5J0YA 4DL5A 2KHVA 2XCPA 3RB3A 5J0OA 1NK7A 4B9TA 1B0XA 1JROA 2YQEA 3BQ1A 5GTHU 1KFDA 2RLTA 5KFNA 2LM4A 5FP0A 2DFLA 2BDPA 3UXOA 2OYYA 1OW5A 1U45A 3RAXA 3UXPA 4PJ0U 3HILA 1UA1A 3SAHA 1H38A 2NYVA 3ZDDA 4OJPA 3M9MB 4KLGA 4LZGA 2BQ3A 2RDJA 3GILA 2UVWA 4DSLA 2KFZA 3NUQA 1Z1BA 4Y2VA 4PPXA 4CRXA 2W03A 4PHAA 1N48A 2XICA 4DF8A 5KT7A 4DEZA 2E5SA 2E1FA 2K4PA 3H0RB 5KFBA 3AQEA 1XWLA 4KN7A 2K89A 9ICFA 3KBBA 2ZIWB 2BHNA 3QYPA 4KN4A 1U47A 2ZIVA 5KFZA 2Y1JA 5ALFA 1V97A 2BPCA 1WWVA 3U26A 2QARA 4UQGA 4QWAA 3T5HA 3SQIA 4FFDA 4IQTA 1DXSA 9ICLA 1DOQA 1URJA 1PK1B 5IIJA 2HHWA 4NLBA 5KFHA 4ZH4A 4KLIA 2ZUCA 3T3FA 4Z6FA 2WB1C 3V72A 3BZKA 3SEIA 2B0CA 3PW4A 1S10A 3QZ7A 3UM9A 1FFUA 9ICUA 3OHAA 5KFPA 7ICQA 1KFTA 3C21A 2F8LA 1L7MA 4QW8A 3C2MA 4DFMA 4NLZA 1VLBA 3KHRA 5AKIA 2WAQF 3HW8A 4RQ2A 3HJEA 1X40A 4KX5A 1Z00B 2HBJA 5ALDA 1KQQA 4C7YA 4P0QA 3JPRA 3ALRA 3EUB2 4O3PA 4DFJA 5J0SA 4EBEA 5EWGA 3QZ8A 2RP5A 5ALYA 3GQCA 5IIOA 2EZZA 1RXWA 4ECVA 2DUYA 4TQRA 4IR9A 1TK5A 3MFHA 3TFSA 5KFFA 2BCVA 1N5WA 2RHFA 1ZYQA 2GH1A 7ICGA 2K4IA 3AQFA 1C7YA 4IL6U 3GFKB 4BUGA 2H3VA 3B0XA 4O5EA 5KFJA 2C28A 4QZCA
chains in the Genus database with same CATH topology
1UCVA 5F3XB 1SXDA 1WWVA 2ESEA 2D8CA 2QARA 1SV4A 3SENA 1F0MA 2F44A 2EAPA 2QB0B 2LMRA 3TADC 1DXSA 4RQMA 3K1RB 2QKQA 2YTUA 2ES6A 4IS7A 1PK1B 1PK3A 5JTIA 2E8OA 5J8YA 4RQNA 4PZOA 2KSOA 1V38A 1SGGA 1WWUA 5JRTA 2GLEA 3SEIA 2DKXA 2D3DA 2KE7A 5KNIA 2K60A 1SXEA 1V85A 2L5YA 1RG6A 1B0XA 1X66A 2QB0A 1SV0C 3KKAC 5L1MA 3TADA 1PK1A 2E8PA 2EAOA 1OW5A 1LKYB 4NL9C 2KMDA 2LPEA 3BS5B 1UQVA 1X40A 2KIVA 3HILA 1COKA 1B4FA 3IDWA 2E8MA 1OXJA 4MHVA 2DL0A 2QB1A 2E8NA 2KG5A 2QARB 4PZNA 2FE9A 2DKZA 4NJ8A 1KW4A 3TACB 1SV0A 3KKAA 2K4PA 1Z1VA 1X9XA 5J8YC 1JI7A 2EAMA 1LKYA 3BS7A 3BQ7A 3BS5A 4NL9A 2JV3A 2F8KA 2KSOB 3H8MA 5JU5A 2EANA 2F3NA 2Y9UA 2Y9TA 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCV A;  5F3X B;  1SXD A;  1WWV A;  2ESE A;  2D8C A;  2QAR A;  1SV4 A;  3SEN A;  1F0M A;  2F44 A;  2EAP A;  2QB0 B;  2LMR A;  3TAD C;  1DXS A;  4RQM A;  3K1R B;  2QKQ A;  2YTU A;  2ES6 A;  4IS7 A;  1PK1 B;  1PK3 A;  5JTI A;  2E8O A;  5J8Y A;  4RQN A;  4PZO A;  2KSO A;  1V38 A;  1SGG A;  1WWU A;  5JRT A;  2GLE A;  3SEI A;  2DKX A;  2D3D A;  2KE7 A;  5KNI A;  2K60 A;  1SXE A;  1V85 A;  2L5Y A;  1RG6 A;  1B0X A;  1X66 A;  2QB0 A;  1SV0 C;  3KKA C;  5L1M A;  3TAD A;  1PK1 A;  2E8P A;  2EAO A;  1OW5 A;  1LKY B;  4NL9 C;  2KMD A;  2LPE A;  3BS5 B;  1UQV A;  1X40 A;  2KIV A;  3HIL A;  1COK A;  1B4F A;  3IDW A;  2E8M A;  1OXJ A;  4MHV A;  2DL0 A;  2QB1 A;  2E8N A;  2KG5 A;  2QAR B;  4PZN A;  2FE9 A;  2DKZ A;  4NJ8 A;  1KW4 A;  3TAC B;  1SV0 A;  3KKA A;  2K4P A;  1Z1V A;  1X9X A;  5J8Y C;  1JI7 A;  2EAM A;  1LKY A;  3BS7 A;  3BQ7 A;  3BS5 A;  4NL9 A;  2JV3 A;  2F8K A;  2KSO B;  3H8M A;  5JU5 A;  2EAN A;  2F3N A;  2Y9U A;  2Y9T A;  2B6G A; 
#chains in the Genus database with same CATH topology
 4R63 A;  4UB8 U;  1UCV A;  5F3X B;  4BXO B;  3NRW A;  4GLX A;  2JEI A;  3RJJ A;  4KIT B;  3G6X A;  3IG5 A;  3SEN A;  4M0A A;  2EAP A;  2HI0 A;  3NVW A;  1BVS A;  4C80 A;  5ALR A;  4RQ0 A;  2AGQ A;  2KFN A;  4XA5 A;  8ICJ A;  5IIL A;  1WCL A;  4R64 A;  4Y2T A;  3BJY A;  5KG2 A;  1KL9 A;  4YMO A;  1QQ7 A;  1RYU A;  2AJQ A;  4PZO A;  4RQ4 A;  5KFO A;  4F4Y A;  2LKY A;  4DL3 A;  2A19 A;  1S97 A;  2FMQ A;  5JRT A;  4M9J A;  1ZQH A;  5KFC A;  5J2E A;  2K8B B;  3RH5 A;  3EYZ A;  4J9S A;  5J0U A;  2K4E A;  4M9H A;  4QIW C;  2CRX A;  1Z19 A;  4I29 A;  1RQN A;  4RU9 A;  3Q8K A;  3ZDE A;  4DFP A;  2MU2 A;  4MF8 A;  3TI0 A;  4Y2R A;  3PML A;  4BWJ A;  1LKY B;  3TFR A;  1P7D A;  3BS5 B;  3WU2 U;  8ICM A;  3NS1 A;  1N61 A;  4UB1 A;  1DGJ A;  2BDU A;  3O0F A;  1IXR A;  8ICA A;  1N56 A;  2KG5 A;  2M9N A;  1VJ5 A;  4DSK A;  5J2F A;  4Y2U A;  4GIB A;  4KX3 A;  2BPF A;  3AMZ A;  4OCZ A;  2OHF A;  4RPY A;  2WF5 A;  5JU5 A;  1QQ6 A;  3N7R C;  3KHH A;  4LVS A;  4QZ9 A;  5AKY A;  2BCR A;  3THV A;  2DGZ A;  4QW9 A;  3C5F A;  5ALQ A;  2YX8 A;  3I28 A;  2NRZ A;  4RNM A;  3LVW A;  4DFK A;  1F5S A;  3ISC A;  5JUM A;  2BCQ A;  2G0A A;  1YZ7 A;  1WCN A;  4KLH A;  2ASD A;  2AU0 A;  5AI0 A;  4IS7 A;  4EBC A;  2XC9 A;  3ISD A;  4DSI A;  5CWR A;  4DOA A;  1T4G A;  4F50 A;  1A77 A;  5ALZ A;  4FZN A;  2IMW P;  2XY5 A;  3T5J A;  4C4S A;  3RJI A;  3F2C A;  3TAN A;  1TAQ A;  5EE1 A;  1N2X A;  4Q45 A;  4RNN A;  2IHM A;  4NM1 A;  5KG7 A;  5KFL A;  4J9P A;  1TAU A;  3PR5 B;  4CDG A;  2ZIU A;  5E79 U;  4MF2 A;  3OGU A;  1JAL A;  2BR0 A;  2LPE A;  2I6X A;  3EZ5 A;  4EZ9 A;  8ICS A;  1NJY A;  1UT5 A;  2ZIV B;  4MFF A;  3RAQ A;  5J0P A;  3Q8Q B;  1N5X A;  4UW9 A;  4PL1 A;  3SZ2 A;  4A8E A;  8ICU A;  1RDF A;  2QAR B;  4YP3 A;  2DF4 B;  4M9N A;  2WF6 A;  9ICO A;  2P35 A;  4YQW A;  2EQY A;  3BDP A;  5IIK A;  3WKE A;  5KFK A;  1NNL A;  1MQ3 A;  2KZ3 A;  9ICG A;  1S0O A;  1Z4O A;  2VKQ A;  2NRT A;  2XY6 A;  4RQ1 A;  5KFR A;  1S9F A;  3H4D A;  1ARO P;  2AQ0 A;  1J97 A;  4Y2S A;  5AM3 A;  1SXD A;  4RNO A;  3SV3 A;  2W9B A;  2IHN A;  3D2N A;  1L5U A;  2FLP A;  2KIW A;  3RJF A;  5L1L A;  2W9C B;  4DQQ A;  2WF8 A;  2KP7 A;  4ECS A;  3GV5 B;  2MUT A;  1A0P A;  3L3F X;  1MA7 A;  4B9L A;  3QU2 A;  3JPQ A;  4GC6 A;  3PR4 A;  4TUS A;  1JMS A;  3WKA A;  1MQ2 A;  2KSO A;  4EX7 A;  5CA7 A;  5A0L A;  2CN1 A;  5D49 A;  2W43 A;  3QU4 A;  4P0Q B;  5KTQ A;  4LJX A;  4O3S A;  3UPQ A;  1K5O A;  4F5R A;  3PX6 A;  1RG6 A;  4UB4 A;  3M7D A;  3MDC A;  5III A;  1MSW D;  1U49 A;  4TUR A;  4I2C A;  5KFD A;  4U7C A;  1UPH A;  1WYG A;  8ICV A;  3C28 A;  1BPE A;  3L5K A;  4IR1 A;  2EH9 A;  4BXO A;  2PFP A;  1ZQB A;  1COK A;  4DLG A;  3NTU A;  1L7N A;  3MC1 A;  4J9M A;  4KMO B;  3RJH A;  7ICN A;  1S5L U;  3Q8P B;  2VAN A;  1U9L A;  2KNJ A;  4FS2 A;  2WFA A;  9ICM A;  2JRZ A;  4USA A;  4CE6 A;  4UB2 A;  4RUA A;  4DQI A;  2KV2 A;  1ED1 A;  4YXM A;  4J9L A;  4I2G A;  9ICH A;  3BQ7 A;  4YMM A;  4BWM A;  3N97 B;  5J2I A;  4YD1 A;  3Q8R B;  2F8K A;  1ZXI A;  3QU5 A;  4NLN A;  1LB2 B;  2W54 A;  2HOI A;  2GO7 A;  4FBU A;  2B6G A;  3PW5 A;  4OJO A;  3PY8 A;  1PVP A;  3RB0 A;  1SL1 A;  4J9O A;  4Z6C A;  1N63 A;  3SMV A;  2MRL A;  3GU3 A;  4O3O A;  1KFS A;  4RQM A;  5AI4 A;  4YXJ A;  1Q8K A;  3SAG A;  4KLS A;  4DS4 A;  4F4W A;  1ZQF A;  2F1I A;  1LV5 A;  2AXT U;  1NI3 A;  3F5A A;  5H2F U;  3V7K A;  1SZH A;  8ICF A;  4XQ8 A;  3LYS A;  2YMM A;  2NRX A;  1ZJM A;  3HX0 A;  4MFA A;  2R8G A;  1ZQA A;  1RQL A;  3TAR A;  5TZV A;  3H0L B;  2OEH A;  1SV0 C;  4AYB F;  2XVT A;  4EZ6 A;  2PMZ F;  4I2B A;  3K75 D;  1X6J A;  4M6W A;  1TV9 A;  1RXV A;  2Y0S F;  1NK9 A;  4KLD A;  1ZJN A;  4FZM A;  4QZA A;  2ALZ A;  1X42 A;  4K4G A;  1T8E A;  2DL0 A;  5ALW A;  2E8N A;  1UT8 A;  4UAV A;  5AK6 A;  4F3O A;  3NVV A;  1NJZ A;  3TAC B;  1LVH A;  2J6T A;  1FFV A;  1SV0 A;  5AIC A;  3PW0 A;  4CCH A;  5AI9 A;  5AIA A;  5ALI A;  4O3Q A;  1J2M A;  4O3R A;  1NK8 A;  4B9N A;  1N62 A;  2LI6 A;  5ALE A;  1C20 A;  1PVR A;  2KTQ A;  4NY8 A;  5DLG A;  3MGV A;  5KT3 A;  7ICT A;  1N60 A;  2YB1 A;  1BPZ A;  4UAU A;  4ECW A;  1XSP A;  2ESE A;  2OXO A;  4O5C A;  4R65 A;  7ICE A;  2AGP A;  2ZIU B;  4EEY A;  3QU9 A;  1HEK A;  4IRC A;  4P0P A;  3B9J A;  5HR6 A;  2HHU A;  4NLK A;  5JTI A;  5DGB A;  2LHT A;  4Z6D A;  1B22 A;  3FC4 A;  3CW2 C;  3ETR A;  5AKK A;  1FIQ A;  3OJS A;  2YN4 A;  2ATL A;  2LYB A;  5BOL A;  1FO4 A;  3G6Y A;  3BQ0 A;  5HHH A;  2BGW A;  2EZY A;  2F2A B;  5KAI U;  4JUZ A;  2NRW A;  4C8O A;  3MR3 A;  2RQ5 A;  3ZD8 A;  1TVA A;  2BKE A;  1BPD A;  1L8O A;  4DFD A;  5F9N A;  2W11 A;  1X9S A;  5AI8 A;  1HIW A;  3PZP A;  2XID A;  3LK9 A;  1Q46 A;  3A0H U;  3I1Y A;  3VC8 A;  4MEX A;  2PFO A;  3GIK A;  4RQ3 A;  9ICW A;  3KZI U;  4I2E A;  1J2N A;  2H5X A;  4F2R A;  8ICR A;  3QUB A;  9ICV A;  2W9C A;  5HMM A;  5DG8 A;  5DLF A;  9ICN A;  3SD7 A;  1QCK A;  2DWQ A;  2ZTC A;  2W9B B;  2A1A A;  3OSN A;  4M2Y A;  2KKV A;  2NO5 A;  4PHD A;  1JUD A;  5KG5 A;  2MUT B;  5AK4 A;  3UQ0 A;  4F71 A;  4I2F A;  2UVU A;  2KSO B;  2KJ8 A;  4G3I A;  3H8M A;  5AI5 A;  4RT3 A;  5DKW A;  3QU7 A;  2DBY A;  4YR0 A;  4K4I A;  3HT3 A;  5ALS A;  4OO1 J;  5K4L A;  1U4B A;  4DL6 A;  3K4G A;  1X9W A;  2D8C A;  3MAB A;  5EE3 A;  8ICC A;  5KFG A;  2WF7 A;  3MGI A;  3JPO A;  4YFK A;  3HKZ C;  3OJU A;  5DBB A;  2HOF A;  4KLQ A;  5ALG A;  1ZQP A;  2M0N A;  1S8O A;  2JH7 A;  4C4R A;  4MFC A;  4DL7 A;  1KEJ A;  2ZJ8 A;  4RQN A;  3VCB A;  2A3V A;  1TE2 A;  5TIS U;  4OJ5 A;  3N4M B;  1X2I A;  4I27 A;  2GLE A;  5L1J A;  4B6J A;  1L8L A;  3PSI A;  4RT2 A;  2LYH A;  3RJG A;  3DV9 A;  1DGS A;  3TAP A;  8ICG A;  1V85 A;  2W8L A;  4DL4 A;  4DCC A;  5AKX A;  1QSY A;  1A6S A;  3PMN A;  4M9G A;  1S0M A;  5KFI A;  2KOB A;  5DB9 A;  1ZQZ A;  8ICE A;  1L6N A;  5HHI A;  2OCE A;  1XC9 A;  1ZQI A;  5J0W A;  2Y1I A;  2ZUD A;  2WB1 F;  5DQG A;  4CF5 A;  2DKZ A;  1KRP A;  4NJ8 A;  1NK4 A;  2E1E A;  1U48 A;  5KT4 A;  3M9O B;  5ALL A;  4US8 A;  1TAM A;  2KJ9 A;  2ZG6 A;  4NWI A;  4QWD A;  3QX7 A;  2EAM A;  3PW7 A;  4JWN A;  3ZDA A;  1DRG A;  2JV3 A;  2ZJ5 A;  3KZX A;  1M6Y A;  2LYA A;  4RQ6 A;  3PX0 A;  4ICA A;  5AIB A;  3L4P A;  2LMR A;  2AHO B;  4UAR A;  4RPX A;  4BX9 C;  2VA8 A;  1ZQK A;  5J2H A;  1NZB A;  1JN3 A;  5ALJ A;  3WK5 A;  3IHQ B;  3CYM A;  1RYR A;  2E3T A;  2EZX A;  1ZD2 P;  4ECU A;  4M6W B;  1L7O A;  3RB4 A;  1L7P A;  2E8O A;  3HPO A;  1QQ5 A;  4PGQ A;  4O3N A;  2C2R A;  2IOH A;  2B21 A;  4RQ5 A;  1QTM A;  4PHP A;  1ZQU A;  4ED7 A;  2D3D A;  2BCS A;  2VIX A;  4QZH A;  4FZL A;  2G08 A;  2ZUB A;  3MR2 A;  3E2E A;  4J03 A;  2P66 A;  4ECY A;  4YVZ A;  5D4B A;  1JIH A;  2EAO A;  2BQU A;  2VJ4 A;  5C5J A;  3RR8 A;  2XO7 A;  8ICX A;  2HBM A;  5J2A A;  3BQT A;  3H8J A;  1B43 A;  5KFV A;  4F5O A;  5AKZ A;  3OTQ A;  1JRP A;  9ICP A;  4MHV A;  3GIM A;  2ASL A;  5B5E U;  3D2Q A;  1NK5 A;  3KHG A;  4ED3 A;  5AM2 A;  4YR3 A;  2H3Q A;  4KTQ A;  2HBK A;  1D8L A;  3DEE A;  4Y2Q A;  7ICU A;  5L9X A;  2GWS A;  5CHG A;  1ZQD A;  2JXJ A;  5KT2 A;  8ICN A;  1ECW A;  3K1Z A;  4QIW F;  7ICH A;  3KOO A;  2IOF A;  4P0P B;  3QUQ A;  4UBC A;  2YMQ A;  2MAX A;  1KBU A;  1NJX A;  1K1S A;  3NRZ A;  2K4H A;  5KG4 A;  2JH1 A;  4O5K A;  2RDI A;  3ORY A;  4C8M A;  3RRG A;  2D6F C;  3KTQ A;  2A1J A;  2MSN A;  4FS1 A;  4NM2 A;  1WG8 A;  4I2A A;  5KFM A;  3QUT A;  5KFU A;  4KLJ A;  1TFR A;  2F44 A;  3RFA A;  2YB4 A;  4IC9 A;  3LVV A;  1PVQ A;  3E58 A;  2IA6 A;  4IQV A;  8ICH A;  4F4K A;  3FDS A;  2Q4T A;  5KT5 A;  1TKD A;  1CRX A;  4Q8E A;  4UB6 U;  2OWO A;  5BPC A;  2KJ5 A;  5T14 A;  8ICW A;  1WWU A;  3SV4 A;  2F77 X;  2ZXH A;  3WKC A;  2WHE A;  1IV8 A;  2ZTE A;  2H3Z A;  5AHX A;  1DK2 A;  4O9M A;  1SXE A;  4Y2J A;  2W8K A;  4RPZ A;  4B9M A;  2W04 A;  5J29 A;  3M8S A;  3C1Y A;  1ZQT A;  4EEK A;  1T3N A;  4NL9 C;  2I5H A;  4XUS A;  5IIM A;  2NRV A;  3QE9 Y;  2JGA A;  2ODG A;  1OXJ A;  4KLT A;  5GTI U;  2KK0 A;  2QB1 A;  3JPT A;  4DQP A;  4NXZ A;  1SWV A;  4AYB C;  1S0V A;  3BZC A;  1KW4 A;  1ZD3 A;  2PMZ C;  4QWE A;  3LDA A;  4C8K A;  3GIJ A;  3PX4 A;  3IRU A;  3NVZ A;  4UAY A;  2ZIX A;  2Y0S C;  2XY7 A;  3BS7 A;  3GDX A;  3EWA A;  4NL9 A;  4QZG A;  4DSE A;  9ICI A;  3AN1 A;  1BPX A;  4Y2Y A;  1XO1 A;  1L3V A;  4EBD A;  3H8S A;  2KZM A;  5EWF A;  5ALK A;  5HR7 A;  2FPL A;  1Y88 A;  3RRH A;  3M9N B;  1XS9 D;  4JV0 A;  1ZD4 A;  2CPR A;  3PO5 A;  3PSP A;  7ICJ A;  3OSP A;  1KSP A;  1CI4 A;  2ES6 A;  2AH5 A;  3T79 A;  1PK3 A;  3IG8 A;  4OJ6 A;  5ALV A;  1BNO A;  5KFQ A;  5AKG A;  3V6H A;  3QNM A;  2I1Q A;  1SGG A;  9ICE A;  1ZQJ A;  3PNC A;  4F5P A;  4HYK A;  1SIJ A;  5DG9 A;  2FDR A;  2FPM A;  4NV0 A;  5DQH A;  3MBY A;  4JWM A;  5L1I A;  4YR2 A;  3SAF A;  5KL8 B;  2L5Y A;  3F2B A;  5HML A;  3QEA Z;  3RBE A;  3KKA C;  3S6J A;  2ZJA A;  3TQ1 A;  4GC7 A;  4KLE A;  1RPL A;  4U6P A;  1RM6 C;  3HWT A;  1HUZ A;  2Z7J A;  1Z4N A;  2OM6 A;  1KLN A;  2ZXI A;  3PSF A;  1UQV A;  3FM9 A;  1ZQO A;  3M1Y A;  3N7P D;  4P4O A;  3RR7 A;  2R8K A;  3AM9 A;  3FAH A;  4DOC A;  3H8W A;  5G5H A;  9ICR A;  3M8R A;  2HHV A;  5CEH A;  2FI1 A;  1ZOL A;  1QSL A;  2C2D A;  4PZN A;  3GV8 B;  3EPG A;  1QH9 A;  1D9F A;  5DQI A;  2O6K A;  5AM0 A;  3KKA A;  1IIP A;  2JZB A;  5KFS A;  4QNL A;  5KFE A;  1JI7 A;  4Q8F A;  3OHB A;  2FJ6 A;  5J2B A;  1ZRN A;  1JXL A;  4IQW A;  4QWC A;  3J81 j;  7ICV A;  3AU6 A;  3I76 A;  5J2J A;  2KD1 A;  4BJQ A;  3WK9 A;  1SV4 A;  3OPX A;  4TUQ A;  2H3I A;  2WAQ C;  3TAD C;  3ISB A;  3LWM A;  8ICK A;  4FO6 A;  1PUZ A;  2HCF A;  2PI5 A;  1Q3V A;  4BGD A;  4K4H A;  1ZQS A;  4UAW A;  2J6U A;  1V38 A;  5AKH A;  3V6K A;  5ALH A;  5DBA A;  4Y2P A;  2R18 A;  2P6R A;  2V4Q A;  4R66 A;  2KKP A;  4NLG A;  4ZOH C;  2KE7 A;  1MC8 A;  5KNI A;  3ETL A;  3CNH A;  2QB0 A;  2JEJ A;  5AKJ A;  7ICO A;  3JPS A;  3HP6 A;  3TAD A;  5AKL A;  3C29 A;  3RTV A;  3DDH A;  2QLT A;  3EPI A;  3PW2 A;  8ICB A;  5AK5 A;  1IG6 A;  4YCX A;  1ZQY A;  1KDH A;  9ICC A;  4UBB A;  1B4F A;  3UMB A;  9ICJ A;  5AI6 A;  5AM4 A;  9ICB A;  2A1J B;  4QZF A;  1YT3 A;  2AGO A;  2HHX A;  3C2K A;  4LZD A;  2VJ5 A;  1FEZ A;  3MFI A;  1Z1V A;  1CEZ A;  4F91 B;  4YN4 A;  1YZ6 A;  5D46 A;  1TK8 A;  2FPK A;  3QEB Z;  1COO A;  4I2I A;  1O08 A;  1TK0 A;  5DB6 A;  2HBL A;  3QUC A;  3KFU F;  5J0Q A;  1IM4 A;  1SB3 C;  4B9U A;  3A0B U;  3ICX A;  5ALX A;  4KLU A;  4R8U A;  1XU4 A;  7ICS A;  4KLF A;  3T5L A;  4F8R A;  8ICY A;  5KG0 A;  5KL1 B;  2ISP A;  4I2D A;  4FE3 A;  2IBK A;  1UHU A;  4KLL A;  1Z3E B;  4E0D A;  3MGH A;  3RH6 A;  2DQN B;  4TUP A;  2BCU A;  2QKQ A;  4CF3 A;  1S77 D;  4QWB A;  4F4Z A;  1SWW A;  1ZET A;  1X6I A;  4F5Q A;  2W9M A;  1KN5 A;  2PKE A;  2JR5 A;  4C8L A;  2H3F A;  2I9G A;  7ICP A;  9ICX A;  4EYI B;  1X66 A;  1AQ6 A;  4UAZ A;  3SYZ A;  4GXK A;  4AP9 A;  1DK3 A;  4ECQ A;  5DGA A;  2LM1 A;  1D9D A;  1ZQR A;  8ICZ A;  4YMN A;  3RJE A;  2JEG A;  2PXI A;  2R8H A;  1XSL A;  2ZIX B;  4UB5 A;  3N28 A;  2FLN A;  2N1R A;  2KIV A;  8ICI A;  4DQS A;  4US9 A;  4F92 B;  4RUC A;  3IDW A;  1XO0 A;  2E8M A;  1NKB A;  3ONN A;  1GO3 F;  4EEL A;  4O0I A;  9ICQ A;  5EE9 A;  2HVH A;  1JX4 A;  3UMC A;  4DS5 A;  4CNQ A;  3H7I A;  4DSJ A;  4KMU A;  2FE9 A;  5KFX A;  2RRD A;  2BPG A;  1ZQW A;  4BDP A;  2V9W A;  4QZE A;  1D8B A;  2AQ4 A;  4ACO A;  4J9N A;  3UXN A;  4ECX A;  2HHQ A;  2JMG A;  1X9X A;  3RF9 A;  4EEN A;  5DDM A;  1BGX T;  4DL2 A;  3M6Z A;  2G09 A;  4ED8 A;  5G5G A;  4ELV A;  1JXE A;  3ED5 A;  4KLO A;  2Y9T A;  3RH4 A;  2PFQ A;  8ICP A;  4RZR A;  3CRX A;  4OJL A;  3NVY A;  3AEV A;  4UAT A;  3KD3 A;  4JV1 A;  1F0M A;  5J0R A;  1QLN A;  2CXY A;  2UVR A;  1VDV A;  1A76 A;  4P4M A;  3ZDC A;  2YTU A;  1ZQG A;  7ICF A;  2G5I B;  4MEY A;  1BPY A;  4NLC A;  7ICI A;  5CB1 A;  4I28 A;  5AM5 A;  4IQU A;  1PZN A;  5J2K A;  4ED2 A;  3PST A;  4UAS A;  4Z6E A;  4CGZ A;  3H0M B;  2DPJ A;  2W3R A;  3MR6 A;  5B66 U;  2MA1 A;  1SZP A;  8ICO A;  2K60 A;  1D8Y A;  3G6V A;  3WK7 A;  4F93 B;  2PFN A;  1RYS A;  5HP4 A;  3Q8S B;  2HHT A;  1ZQC A;  3ZI4 A;  2JZB B;  2XGQ A;  5ALM A;  1L3S A;  2E8P A;  1BNP A;  4B9S A;  2W55 A;  1NKC A;  7ICR A;  3HKZ F;  4Y2X A;  2FLL A;  4O3M A;  5KG1 A;  5ALT A;  1ZQV A;  4EX6 A;  1ZQM A;  5EWE A;  1V9P A;  2VA2 A;  5CP2 A;  2P6U A;  1ZQN A;  7ICK A;  4IRD A;  2Q0Z X;  4C7Z A;  2KHQ A;  2FMS A;  3M6K A;  1O03 A;  3FYH A;  4ED1 A;  2LBO A;  1NJW A;  4M04 A;  1WUD A;  2KZZ A;  1BPB A;  4P2H A;  9ICA A;  4IRK A;  5C0Y A;  4X5V A;  3CP8 A;  4P4P A;  2DPI A;  2EAN A;  4XRH A;  2F3N A;  3H40 A;  4KLM A;  5KT6 A;  2GOL A;  3PVX A;  2Y9U A;  3D2S A;  1S76 D;  2HDO A;  3WK4 A;  3IM1 A;  2K8A A;  5ALP A;  9ICK A;  2VA3 A;  1EXN A;  1NZP A;  3GII A;  1NOM A;  5EOZ A;  3V7L A;  4J9R A;  3BQ2 A;  2QB0 B;  4JMU A;  2W3S A;  4F72 A;  3K1R B;  2FMP A;  5CRX A;  5EE0 A;  4PH5 A;  3PV8 A;  2UVV A;  5DDY A;  2KN7 A;  2ZIW A;  4DSF A;  4I2J A;  1XSN A;  2BQR A;  1SL2 A;  1SKW A;  3JPP A;  2DKX A;  5HNK A;  3QXG A;  2HOQ A;  4Q44 A;  4JK1 A;  3Q8L A;  3NGD A;  4QZB A;  5KFY A;  1ZQL A;  1ZQQ A;  3AL0 B;  5L1M A;  2XCA A;  5DB8 A;  5F9L A;  3IP4 B;  1PK1 A;  5J2C A;  2ISO A;  4F5N A;  4C4T A;  2KEY A;  3C5G A;  4QZD A;  1UA0 A;  4WJ3 B;  4RQ8 A;  2HHS A;  1SKR A;  2J6S A;  3D6J A;  4ED6 A;  3UQ2 A;  3HRD D;  4GXJ A;  4Q43 A;  7ICL A;  3ZD9 A;  9ICT A;  4R8U B;  1L3U A;  4M9L A;  3F2D A;  2W9A A;  2F1J A;  3IV6 A;  3R9K A;  5KG3 A;  3RB6 A;  5ALU A;  1KTQ A;  1L3T A;  4QJF B;  1QSS A;  5J0T A;  2C22 A;  2YML A;  2XGP A;  2R8J A;  1MN8 A;  3N7S C;  5J8Y C;  4QZI A;  1ZQX A;  5J2G A;  1Q3U A;  2G06 A;  5ALO A;  4ELT A;  2YY6 A;  1Z00 A;  3JPN A;  2NV3 A;  4ECZ A;  5CR0 A;  3TAQ A;  4OD0 A;  2W7O A;  4UB3 A;  1NKE A;  2G5H B;  2YMP A;  3KHL A;  3PO4 A;  1XNS A;  8ICT A;  2KIC A;  3SI8 A;  5DBC A;  4DQR A;  3AU2 A;  4TQS A;  2HW3 A;  4JV2 A;  5BOM A;  5AK3 A;  1OUQ A;  3WK6 A;  3MDA A;  5KFA A;  3Q8M A;  2NO4 A;  2ASJ A;  5ALN A;  4DLE A;  1T94 A;  1SL0 A;  2PI4 A;  3RJK A;  2IOF K;  7ICM A;  3F5E A;  5J8Y A;  3C2L A;  2WF9 A;  3GV7 B;  8ICL A;  5KFT A;  2KVC A;  1S0N A;  2WTF A;  9ICS A;  4PHE A;  4EYH B;  5DG7 A;  4F4X A;  4B9V A;  5J2D A;  1RZT A;  2ZTD A;  4DWI A;  4C0Z A;  4FBT A;  3F53 A;  3E0F A;  5AKE A;  1X9M A;  2JEF A;  1SKS A;  3T5K A;  2KVS A;  4GXI A;  4GFJ A;  2HVI A;  1ZD5 A;  2F76 X;  2EDU A;  3UMG A;  3H4B A;  2G07 A;  1NK6 A;  1T7P A;  3AUO A;  3WK8 A;  4M47 A;  2JHD A;  4RQ7 A;  5KFW A;  4PL2 A;  2KMD A;  3MR5 A;  5IIN A;  4PGX A;  3EW9 A;  4ECT A;  3RBD A;  4DO9 A;  4J9K A;  3WKB A;  5KG6 A;  5DB7 A;  4G9B A;  4YG2 A;  1KKX A;  5CJ7 A;  2C2E A;  1F44 A;  4F2S A;  1NK0 A;  2W7P A;  3V6J A;  3C1Z A;  2BZF A;  4ECR A;  1ZQE A;  3GZF A;  2OH2 A;  1LKY A;  1CUK A;  2HMX A;  3LWL A;  8ICQ A;  3NAS A;  3BS5 A;  3ZDB A;  4QZ8 A;  3C23 A;  2V4R A;  3V7J A;  3B0Y A;  4ED0 A;  3WKD A;  3TKA A;  1HUO A;  3IN5 A;  4C8N A;  3SR6 A;  4I2H A;  1ZQ1 C;  4ELU A;  4DOB A;  5AM1 A;  1ZRM A;  2K8C B;  2R8I A;  5J0X A;  2XI9 A;  5L1K A;  1K1Q A;  2HSZ A;  4YD2 A;  1HJP A;  4CF4 A;  2F1H A;  4J9Q A;  4JB3 A;  4PGY A;  4DF4 A;  1T3Q A;  5KAF U;  4HAI A;  5J0Y A;  4DL5 A;  2KHV A;  2XCP A;  3RB3 A;  5J0O A;  1NK7 A;  4B9T A;  1B0X A;  1JRO A;  2YQE A;  3BQ1 A;  5GTH U;  1KFD A;  2RLT A;  5KFN A;  2LM4 A;  5FP0 A;  2DFL A;  2BDP A;  3UXO A;  2OYY A;  1OW5 A;  1U45 A;  3RAX A;  3UXP A;  4PJ0 U;  3HIL A;  1UA1 A;  3SAH A;  1H38 A;  2NYV A;  3ZDD A;  4OJP A;  3M9M B;  4KLG A;  4LZG A;  2BQ3 A;  2RDJ A;  3GIL A;  2UVW A;  4DSL A;  2KFZ A;  3NUQ A;  1Z1B A;  4Y2V A;  4PPX A;  4CRX A;  2W03 A;  4PHA A;  1N48 A;  2XIC A;  4DF8 A;  5KT7 A;  4DEZ A;  2E5S A;  2E1F A;  2K4P A;  3H0R B;  5KFB A;  3AQE A;  1XWL A;  4KN7 A;  2K89 A;  9ICF A;  3KBB A;  2ZIW B;  2BHN A;  3QYP A;  4KN4 A;  1U47 A;  2ZIV A;  5KFZ A;  2Y1J A;  5ALF A;  1V97 A;  2BPC A;  1WWV A;  3U26 A;  2QAR A;  4UQG A;  4QWA A;  3T5H A;  3SQI A;  4FFD A;  4IQT A;  1DXS A;  9ICL A;  1DOQ A;  1URJ A;  1PK1 B;  5IIJ A;  2HHW A;  4NLB A;  5KFH A;  4ZH4 A;  4KLI A;  2ZUC A;  3T3F A;  4Z6F A;  2WB1 C;  3V72 A;  3BZK A;  3SEI A;  2B0C A;  3PW4 A;  1S10 A;  3QZ7 A;  3UM9 A;  1FFU A;  9ICU A;  3OHA A;  5KFP A;  7ICQ A;  1KFT A;  3C21 A;  2F8L A;  1L7M A;  4QW8 A;  3C2M A;  4DFM A;  4NLZ A;  1VLB A;  3KHR A;  5AKI A;  2WAQ F;  3HW8 A;  4RQ2 A;  3HJE A;  1X40 A;  4KX5 A;  1Z00 B;  2HBJ A;  5ALD A;  1KQQ A;  4C7Y A;  4P0Q A;  3JPR A;  3ALR A;  3EUB 2;  4O3P A;  4DFJ A;  5J0S A;  4EBE A;  5EWG A;  3QZ8 A;  2RP5 A;  5ALY A;  3GQC A;  5IIO A;  2EZZ A;  1RXW A;  4ECV A;  2DUY A;  4TQR A;  4IR9 A;  1TK5 A;  3MFH A;  3TFS A;  5KFF A;  2BCV A;  1N5W A;  2RHF A;  1ZYQ A;  2GH1 A;  7ICG A;  2K4I A;  3AQF A;  1C7Y A;  4IL6 U;  3GFK B;  4BUG A;  2H3V A;  3B0X A;  4O5E A;  5KFJ A;  2C28 A;  4QZC A; 
#chains in the Genus database with same CATH homology
 1UCV A;  5F3X B;  1SXD A;  1WWV A;  2ESE A;  2D8C A;  2QAR A;  1SV4 A;  3SEN A;  1F0M A;  2F44 A;  2EAP A;  2QB0 B;  2LMR A;  3TAD C;  1DXS A;  4RQM A;  3K1R B;  2QKQ A;  2YTU A;  2ES6 A;  4IS7 A;  1PK1 B;  1PK3 A;  5JTI A;  2E8O A;  5J8Y A;  4RQN A;  4PZO A;  2KSO A;  1V38 A;  1SGG A;  1WWU A;  5JRT A;  2GLE A;  3SEI A;  2DKX A;  2D3D A;  2KE7 A;  5KNI A;  2K60 A;  1SXE A;  1V85 A;  2L5Y A;  1RG6 A;  1B0X A;  1X66 A;  2QB0 A;  1SV0 C;  3KKA C;  5L1M A;  3TAD A;  1PK1 A;  2E8P A;  2EAO A;  1OW5 A;  1LKY B;  4NL9 C;  2KMD A;  2LPE A;  3BS5 B;  1UQV A;  1X40 A;  2KIV A;  3HIL A;  1COK A;  1B4F A;  3IDW A;  2E8M A;  1OXJ A;  4MHV A;  2DL0 A;  2QB1 A;  2E8N A;  2KG5 A;  2QAR B;  4PZN A;  2FE9 A;  2DKZ A;  4NJ8 A;  1KW4 A;  3TAC B;  1SV0 A;  3KKA A;  2K4P A;  1Z1V A;  1X9X A;  5J8Y C;  1JI7 A;  2EAM A;  1LKY A;  3BS7 A;  3BQ7 A;  3BS5 A;  4NL9 A;  2JV3 A;  2F8K A;  2KSO B;  3H8M A;  5JU5 A;  2EAN A;  2F3N A;  2Y9U A;  2Y9T A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...