4FE3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with uridinine monophosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Specificity and Selectivity of Murine Cytosolic 5'-Nucleotidase III.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Cytosolic 5'-nucleotidase 3
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fe3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4fe3A01
3QUCA 2YY6A 4Y2VA 1Z4JA 2HX1A 5ALHA 1TJ5A 1Z5UA 2W4MA 4H1WA 2B82A 4IFTA 3A3YA 4PNHA 1Z5GA 1U2TA 2FI1A 3ZWDA 4BNDA 3QX7A 1NRWA 3L7YA 3I76A 4QJBA 2HSZA 2OYCA 4L6AA 4EX6A 5AI6A 3ZVNA 2WHEA 4AS3A 1RKQA 4Y2SA 1T5SA 3AR4A 5E0OA 1JUDA 5AM5A 2RARA 3D6JA 2JAUA 2YFYA 2CFRA 2WF6A 5ALWA 4OD0A 2FPXA 4I9FA 3QNMA 2W43A 3U7HB 3K1ZA 4MWOA 5AK5A 4UMVA 1O08A 3ET5A 4Y2UA 4BX2A 3L0BA 3EWIA 1U2SA 1WR8A 3L1VA 2BDUA 5AI9A 2ZBDA 5AM3A 3IJ5A 5IT0A 4Y3UA 2P11A 1Z4QA 3U7EB 1ZD5A 4QQFA 4Y2XA 5AW2A 2PR7A 4UATA 4L6CA 1RPZA 3F9RA 3FZQA 3QYPA 3OCXA 1LTQA 4B6JA 2AGVA 4EELA 3AR8A 3L1UA 5AVRA 1YMQA 4YCNA 2JAWA 4F72A 3OTQA 4BYGA 5AW1A 5ALUA 3L8HA 3ZW7A 2I54A 2MSNA 3FGOA 3PCTA 1TJ4A 3NIWA 1L7PA 1YDFA 3DNPA 4UU1A 3RFUA 4BKMA 4Y2QA 1LVHA 3IRUA 3GYGA 3MC1A 1ZD4A 5A3RA 4EX7A 3QU9A 4OCZA 5AKIA 4YH1A 2RAVA 4Y2JA 2WF7A 3NALA 4G63A 5AM0A 1J8DA 3AR2A 1Q91A 3QU5A 3ZUPA 4FE3A 4C4SA 3BA6A 2C9MA 3NAMA 2YN4A 1CR6A 2B8EA 3L0YA 4UW9A 1Z4IA 1U7OA 4NAVA 5AW4A 5AVYA 3WK4A 4YCLA 4KYTA 4BEVA 4Y2PA 3UMGA 3MN1A 1VJ5A 4AS2A 4IG4A 4XOUA 5ALSA 4EEKA 3E58A 3OCZA 2YMQA 5AKKA 3R9KA 1RDFA 3N07A 3ESRA 3AR3A 3ONNA 5ALQA 3ZVLA 3QUTA 5IT4A 4FYPA 1RC8A 2GFHA 2NO4A 2YJ5A 5AKZA 3R09A 4YGYA 2FPWA 3ESQA 2ODAA 3OCUA 4FFDA 2ZBGA 5AK4A 5AHXA 3ED5A 4KN8A 2OBBA 1Z4KA 5ALMA 3N1UA 2CFSA 3AR7A 5AVUA 2G0AA 4XQ0A 3TLMA 4GIBA 2WF5A 1RLTA 2G06A 3QLEA 1L8OA 2R8ZA 2B1QA 1RKUA 4CF5A 3ZU6A 2CN1A 2BY4A 3AR5A 4C4TA 2EARA 5AVTA 3OCVA 1ZD2P 5ALKA 4UAUA 3SD7A 3FPSA 3RF6A 3WK8A 3U26A 4UASA 2CFTA 4EZEA 5IS2A 5ALJA 5AM1A 3SKYA 5AI8A 3NASA 5AKLA 3SLRA 2P27A 3NUQA 1EK1A 1T9ZA 2NYVA 3EF0A 3ZVMA 1L8LA 3WGUA 3I1YA 1YNSA 2Q5EA 4HGNA 3KOOA 4UAVA 5AW8A 2I7DA 2B30A 4J2TA 4UMDA 1FEZA 4BNDB 2WF9A 2IYEA 1RMYA 2AMYA 3VAYA 5AW3A 3N5KA 3L5KA 1QQ6A 4AP9A 1Y8AA 4CF4A 4CNQA 2G08A 2FPUA 4KNVA 2G09A 4G9BA 3UMCA 1NF2A 3L8EA 1MH9A 2FDRA 2JARA 2R8XA 2I6XA 4DW8A 5AKYA 5ALYA 3OCWA 3QXGA 3WK6A 1QQ5A 2FUCA 4UU0A 5AKGA 2IOFK 5A3QA 4JB3A 5AKXA 2ZBFA 2D2VA 2O2XA 4J03A 3B8EA 3AR6A 2W11A 2ZBEA 1KYTA 2WFAA 3EF1A 1ZRNA 1XVIA 4BX0A 4CF3A 4OFZA 4NV0A 2HI0A 2YJ6A 3L8FA 2YMPA 5A3SA 4CE6A 2AH5A 1RMTA 4MUMA 5AVQA 1IWOA 5ALLA 1TJ3A 4HGPA 3UM9A 4YCMA 2HF2A 5ALNA 3A1EA 2GHTA 2HOQA 4HGRA 4UM5A 1N8NA 5T41A 2G80A 4GXTA 2I33A 4Y2TA 3A1DA 2FPRA 4XPZA 2C8LA 1WPGA 3WK5A 2IOFA 2AUTA 2PKEA 3M1YA 2HF7A 2FEAA 1AQ6A 4UM7A 5AVWA 3WK9A 1ZOLA 3J7TA 2MU1A 4JDPA 5AKHA 4UARA 1RRCA 2ZXEA 3IB6A 3A1CA 5AKEA 5ALXA 4NABA 2OA0A 3FVVA 2B1RA 3PGVA 2YJ3A 3WGVA 1RQLA 3QUBA 4HGOA 2NO5A 4OHFA 3ZI4A 1RQNA 2YMLA 5AM2A 2HDOA 4BBJA 1XP5A 5AK3A 1ZJJA 3P96A 1ZS9A 2FUEA 1F5SA 1QYIA 3CNHA 3U7GA 4E88A 3E81A 3WKDA 3QUQA 3HYCA 3MPOA 2C88A 3QU2A 3E8MA 5ALZA 4Y2RA 4NFLA 3I6BA 5AICA 1WZCA 1RLMA 1Q92A 2QLTA 4HYTA 2GO7A 3NANA 1YJ5A 3NRJA 2BDEA 1TE2A 1SWWA 1YS9A 2IOHA 1U02A 2DQSA 1X42A 2HHLA 1YV9A 2HEGA 4BEWA 3FM9A 4I9GA 3MMZA 3KDPA 3WKBA 1O03A 3OPXA 1WVIA 4ZEWA 2X4DA 2EATA 5ALFA 3UMBA 5AVVA 1S8OA 3DV9A 1RMQA 3S6JA 3ZWKA 1Z4OA 2YMMA 2B0CA 5AESA 4KX3A 1TA0A 3PGLA 5ALVA 2G1AA 3ZTYA 5AW6A 1NNLA 2C4NA 3QGMA 1SU4A 3W5DA 2EAUA 4DWOA 2ZG6A 4EENA 1VFPA 2QYHA 5AI0A 5AI5A 2I55A 1L6RA 1U7PA 3N28A 3WKEA 2Q4RA 3SF0A 5JJBA 2YBDA 4UMFA 4HAIA 5ALDA 4YIHA 1QQ7A 3B9RA 2R8YA 1CQZA 1Z4PX 2WM8A 3KZXA 1L7NA 1QH9A 2PQ0A 4L57A 3ZX4A 1T5TA 2I34A 3E84A 5FP0A 4XE5A 1N9KA 1XPJA 3U19A 5AVSA 3KD3A 4HGQA 2WF8A 4UMEA 2VKQA 1Z4MA 2C8KA 4BX3A 2JAOA 1S2OA 2B8JA 4RETA 3QU4A 4ZEVA 3B9BA 3BWVA 3WKAA 4NWIA 4C4RA 2G07A 5AIBA 3U7FB 4DCCA 3I28A 3N8GA 1ZRMA 1Z4LA 5ALPA 2Q4TA 3R4CA 3WKCA 3FPBA 2IA5A 2HO4A 2GMWA 3SMVA 5AVZA 5ALTA 3ZX5A 5ALOA 3L0CA 3OCYA 5ALRA 5ALEA 4KNWA 1SWVA 5AW5A 4DFDA 5AK6A 2O9JA 1L7OA 1J97A 2FPSA 3ET4A 1RLOA 1VJRA 3L8GA 5AW0A 2RBKA 3KBBA 3W5AA 2HCFA 2ZOSA 5AI4A 3U13A 4RESA 5AM4A 3DAOA 3EPRA 3QU7A 3M9LA 3W5BA 3ZTWA 2P9JA 2RB5A 1ZD3A 3AR9A 3KC2A 5AKJA 5ALIA 1Z4NA 1Z88A 2OM6A 4O8CA 3W5CA 4F71A 3CZ4A 2JGAA 5AW7A 5ALGA 4KX5A 3SHQA 3DDHA 4Y2YA 2R8EA 3WK7A 5AIAA 1PW5A 1L7MA 1K1EA 5AVXA 1RKVA 4ZEXA 5AW9A 2P69A 3SKXA 1EK2A 4YIKA 3PDWA 2GHQA 2YJ4A 3HLTA
chains in the Genus database with same CATH superfamily
4MKHA 1ZQUA 1Q5PA 1X7DA 2B5VA 2YWDA 3F1KA 1PK9A 4V2UA 5EE5B 2GM3A 1F8XA 3UMVA 3W4JA 2Y92A 4HXYA 4LV8B 1JIXA 1DK3A 2IHBA 2W4MA 4WXEA 4H1WA 4UNSA 5AXBA 1XVTA 1UDBA 2PGOA 3TLKA 4IOKA 4L6IA 1IBLB 8ATCA 2Z30A 2O8FB 1VDVA 2BCUA 3ZHOA 4CV2A 3CN7A 2FI1A 1Z2AA 2O20A 2BCEA 2VF4X 3AUUA 3O03A 4X1YB 4L9RA 1F9EA 1AB6A 2XGGA 1HDXA 3M34A 4YALA 2FLKA 4LSZA 5H59A 3WV4A 1JXAA 4BNZA 1KGDA 1P2SA 2Y27A 1Z82A 3KOMA 3LUHA 1LPOA 3OX2A 4BUJA 2B35A 1KO4A 3G8AA 3V7NA 4ENVA 4CCHA 3I9FA 1HURA 3WHPA 3JQGA 3V4RA 3D6JA 2WUFA 4FEAA 3C21A 2GT1A 4JBIA 4K26A 3TLYA 2Z6UA 1M0EA 3WMGA 2GYVA 2KFNA 4D02A 4NLGA 2W43A 1I3NA 3RKRA 3O26A 3GNQA 2P6OA 5F35A 2GKOA 1INLA 5JO9A 4DIEA 5I8PA 2VJLA 4CMGA 4BX2A 1BEEA 2VRWA 1ZJ5A 4PLGA 1T9GR 3D6TB 4CL8A 1QC5B 3BWCA 1MV8A 5HZKA 4HATA 4ZO7A 4BV8A 2QW8A 3BCUA 5DMXA 2DBYA 3IT3A 3K6KA 4EF4A 3LTNC 4ZREA 1G8SA 1QLJA 3RM3A 2C29D 2OV2A 3PUWA 1XZQA 1PJTA 2Q3BA 5T6MA 3VUEA 1K06A 2IMWP 4PLCA 5EWLB 1U0NA 1JR3E 3DCIA 1YHNA 3AHDA 3FZQA 1MIHA 4AYXA 1YL7A 2FOXA 4Z2YA 4TLDA 3ROQA 5DHTA 1P2BA 1UKCA 1XLWA 2FFQA 2W3RA 1H85A 2I6FA 1MX1A 1EDOA 1V96A 4JN6B 4QXAA 5LWHA 3B1XA 2Q6VA 2Q8NA 4HLCA 5JXHA 3BTSA 3B1WA 1T8TA 3C3AA 3WYBA 4RLQA 4FX5A 4WY2A 3INYA 3LXXA 3J7AC 3MGKA 1KI9A 2J5QA 1KTVA 3DE0X 2A92A 5JVDA 4ERXA 4G5OA 4DLGA 2P65A 3LBAA 4X24A 3RSGA 1TM7E 4D9KA 4YMWA 1N9GB 1DARA 1UHUA 2Y6VA 3PWKA 4GR4A 1PV2A 3NBYC 4P80A 4H60A 2O1SA 4LGCA 2BCRA 1WCIB 4P6VF 1YR7A 5CH5A 3GLGE 4LMRA 2V1UA 4NCBA 5IMBA 5FBVB 5KL1B 2AC4A 1LTKA 1Y7IA 3K9HA 2PFQA 3KSRA 4A6DA 2NO6A 4OCZA 4GM0A 5HM6A 5JH7B 4RDHA 4WKCA 2FN8A 1LNSA 1DOZA 3H7IA 1GCAA 3F96A 4HF7A 3EBLA 5B3AA 4FBGA 4LJ6A 1MCZA 1GFZA 3VR0A 2WWFA 4PQRA 3ZOKA 2V5UA 4UPVA 3IAFA 1Q91A 4KUGA 4XOIA 5BT8A 2CDNA 1DAKA 3H18A 2PT6A 4I5EA 1RD4A 4Y1RB 2NU9B 1W9HA 4Z7QB 1A50B 1QYWA 3HWSA 1U7OA 3LF2A 3L7MA 3R3SA 1W9MA 4BQRA 4ALLA 3OJSA 3FHLA 3TCXB 5K4GA 4UD6A 5KYTA 1GLGA 1BW9B 4BXOA 1MHPA 1P31A 3ASZA 4KYTA 1ZY2A 1DFHA 4B5LA 1XMQB 4PYIA 1ODKA 4FB4A 3ADDA 4GXQA 2C2EA 2QRMA 2CEKA 2X22A 3G7SA 3NBXX 1NC1A 2G6TA 4IDCA 4JIMA 3KR0A 3T0IA 1PVPA 4YMUA 5HQ3B 3DJYA 2TYSB 4YAOA 8ICLA 3OOWA 3H0MB 3O2JA 3OZDA 3KQMA 1J8VA 1PNVA 2ZTSA 3JD0A 3H1AA 3MYYA 4CKBA 5KEIA 1R5JA 1BH6A 3ZW8A 5KHLB 2XMDA 1BFDA 3RTGA 2PHZA 3ISVA 1V7CA 1SURA 2PZJA 2B0JA 2EAOA 1QO9A 2VEOA 1MIOB 1DC4A 1U8CB 7ICOA 2PUHA 3HM2A 4C3UA 5KG7A 1BAPA 1RI4A 3ESQA 2FJ6A 1GGMA 3NATA 3Q3VA 4FW9A 4L0CA 3TDKA 1XSLA 3OU2A 4M7WA 4OXIA 2X9LA 3O93A 4ZAWA 1J2YA 2PI5A 1YASA 3K32A 3DEEA 4XA8A 1KKXA 1USGA 3CKMA 4PX9A 4E7OA 4HPJB 1NVAA 3JPOA 2VWPA 1RWBA 1YVRA 1JDTA 3U3DA 3TW4A 1S9HA 3ZDBA 2I2DA 5DTQA 2Q1WA 3U44B 4J9OA 4CLOB 1V9PA 1P81A 4IIJB 1WIWA 2ZIVB 1U6IA 1U1GA 1WMBA 2EZTA 4H0FA 4MGYR 3ZJVA 3B1FA 1GFSA 2B1QA 3DT9A 1MNQA 2E0IA 2BY4A 2QLJA 4PO8A 1JZQA 3TOCA 1ODLA 1UK8A 5C5CA 1NJ6A 2PANA 4IUDS 5GONA 7GPBA 5CA1B 4EB6A 3F5EA 4O3MA 5K0SA 2WG1A 2WKSA 1OV6A 2GVNA 2QNRA 3BTOA 3JQGB 4J0CA 3JRXA 4YP1A 2PIAA 1FDVA 5KJEA 4EF6A 1FP1D 1CZHA 3HO6A 3QY0A 4II3A 3MUNA 4PG4A 1HUZA 1XMJA 2QD5A 3SKYA 3IMGA 1N8SA 1A98A 4IXTA 2OBMA 3QSYA 1X7XB 4EG4A 3NETA 3PI6A 4YJFA 2PUFA 1JALA 2D74A 2C3YA 2XWQA 3G79A 4QYSA 2EU8A 1WMAA 4C6TA 3ZK9A 3MCTA 4B75A 5J5VA 3L6EA 5ARCA 3QFHA 8ICCA 3IIEA 5J4KA 4R41A 3U1VA 1VMKA 1T2AA 1BGXT 2CKMA 1REQA 1WUTA 2YB1A 2ACWA 2BFOA 3FZNA 2P30A 3O9MA 1S1CA 3WYNA 1LKYA 5LDDC 3KSZO 1H6CA 4L74A 4N3GA 2FGJA 3D31A 3K9QO 5EINA 1FEZA 4JUZA 3SJZA 3D0KA 3U4MA 4JC5A 2ZJOA 3K2QA 4PIVA 3K9GA 4E15A 1JXEA 1F0PA 4E70A 5D86A 5LQRA 5J2TA 5FUYA 3ZD8A 4GGPA 4DNFA 2Q0SA 2X1LA 3FR7A 2ZUBA 3VAYA 3RYIA 4QTYA 2R18A 2F62A 4Q1BA 4X5OA 2C4UA 2C42A 3EWSA 2E55A 5SZHB 1P1RA 4PZEA 4BJ6A 1OJ7A 5ES4B 1C4WA 3ONEA 4RC9A 3MIZA 3PVSA 2XNJA 5CH8A 1CS4C 2GWHA 2R8OA 5F9LA 2WT4A 2F4NA 2YZ7A 3T99A 2CNNA 1WMSA 3EW7A 2BUBA 2P6RA 3BQ2A 1J2EA 3ANXA 5L7TA 5K09A 2AMLA 3R8CA 1W75A 1K08A 2DBZA 4WZAA 4G5XA 1X40A 3UXEA 5EJ2A 1EVQA 2LM1A 1RAAA 4RAOA 4DL2A 4DXAA 1S01A 4HNGA 3OKAA 2VCEA 1FYXA 4J9MA 3OEED 5TS2A 4YPVA 1MVNA 1Q17A 4ZT3A 4D3SA 1XZEA 1QOPB 1E9AA 1TKRA 2WSSA 3AYZB 3MTDA 4V0LA 2YW9A 3NVZA 4M9RA 3B6JA 3GCXA 5K0BA 3NOOA 2EOAA 3FGPA 3DF7A 1TAGA 5JZSA 1JI7A 3WWZA 3VUFA 2WAMA 1G8HA 1FTSA 4FR0A 3VSAA 1NURA 1J2NA 2N46A 3HACA 3RGGA 4HS4A 4HG2A 2YXPX 1SVMA 3RS8A 3HI6A 1S3SA 3HGQA 4XGIA 1S9FA 4HQNA 1UMDA 2Y76A 3CRNA 2SKDA 1G7RA 1VYUA 4C7BA 4DLUA 4F2SA 2I2WA 2OGZA 4OSEA 4TSRA 2F1IA 4B7CA 5CYOA 2V7WA 1L4MA 3ZQUA 3ETGA 2GHRA 4XZ3A 5TV2A 2O7NA 1L5GB 4WNIA 1N6IA 4OK5A 1YZ7A 4KTVE 1MQ3A 3FCXA 1DIRA 5KFDA 2PLNA 5T64A 1MO2A 2ATCA 4MPDA 1Y9DA 3CMCO 3DMHA 3WG9A 4P58A 2REOA 5BNWA 4H4CA 1THZA 1QRTA 2AFHE 3AF0A 5HRAA 4EA9A 1EFPA 1Q0RA 3C1OA 4WK6A 4ECYA 3A9SA 4U8HA 2O2ZA 3AP1A 4Q4DA 5HFAA 3SZGA 1KSJA 3TEMA 1N5DA 4GM4A 2ZKLA 4MQMA 2D2EA 1QNLA 2C8LA 3UV6A 1G5TA 3SV4A 4ZOEA 3NHAA 2Q8PA 1GV0A 2E37A 3FPKA 3D1LA 3LM8A 3OT1B 5NULA 1JAYA 3TRJA 1M2JA 2AMVA 1RBYA 1A2KC 3FROA 3M89A 5TX7A 3TR0A 3W8EA 4AXXA 2JFNA 4OHZA 3ESDA 2AUTA 3LUPA 2VC2B 1KFSA 5D49A 2QJRA 3BX1A 1AA6A 4H59A 1Z5ZA 5MFZA 1F38A 3FOWA 5CVCA 1NW5A 2IPNA 3V4ZA 2F3QA 5A3JA 2A1TR 1GUDA 5IDWA 1KIFA 4BYMA 1MO4A 3E0FA 1W1WA 3IQZA 4R9SA 3BQ0A 4IRKA 4CEJB 2ISCA 3BWBA 4YG2A 3HP7A 3BXXA 4BMSA 3KYIB 5TVKA 2A3VA 3KPJA 2XYPA 4TUQA 2Y0SC 4KQIA 1UZNA 3EIFA 5EE3A 4MWBA 4POOA 3VR2D 2HJHA 2P67A 3TXXA 3LZCA 1FFXB 2HA0A 1SIOA 3GXBA 3YASA 1USVA 2QHXA 3CRZA 3HFRA 4OJLA 1AX9A 1A5BB 1HE1C 4KIJA 2Q9BA 1IMOA 1CHNA 1SKYE 5JWHA 4QOFA 2VZEA 1KFJB 2WIGA 1M75A 3I5MA 4OHFA 4WINA 5SYNA 4NYIR 1KSGA 1B3RA 1GPLA 5LJIA 4X9XA 5JIBA 2BIFA 2B5WA 3FCSB 4FUTA 1O89A 1W4CA 5DRYA 1H0KA 2X5JO 3LI2A 2F1RA 2DR3A 3L0ZA 4QO7A 3W5SA 2AMFA 4BU0A 4AJJA 1F5SA 2QN2A 2QAJA 2Y1KA 4YRGA 4Q3OA 3G8CA 4NOJA 2WYUA 4ELVA 1SRQA 4H1HA 2XB4A 3SAHA 4UB5A 4AU1A 5ALZA 1XZIA 5JNVA 1YDEA 3RYFA 1PLLA 4UQOA 1E2FA 3RYTC 3G0BA 2R6FA 3FMGA 4FOTA 4JB0A 3ZHQA 3W2EA 5L51A 1S3GA 4RH3A 3MWYW 3CG4A 2QLTA 1IDOA 2W8BA 3K1YA 4RE6A 3KKAA 3NANA 1VKHA 5KX5F 2RGYA 1I36A 1SWWA 5HKKD 1SXJA 1NRXA 1JN3A 2MSCB 4FD2A 4KRYA 5KOYA 1M72A 1SUWA 3BSFA 1XO0A 3JWJA 2OBYA 3LHIA 3M6LA 3N59A 4FWBA 1UMKA 3A1TA 4RZIA 3V8MA 1WXXA 2E7ZA 4KI7A 2Q1SA 3CH5A 3KDPA 3WB9A 4C78A 1OQAA 2VK8A 2VT2A 1AXGA 3MT8A 4K28A 3X43A 5AVVA 3BIOA 1TQHA 2XT6A 4RA9A 5J4VA 5AOAA 4AYBC 3EYAA 1JLLB 1JDPA 2VDMB 5SZJA 1GZ4A 4F3KA 1I7DA 4F46A 2DWOA 3QMVA 1FNSA 4FK8A 1NNLA 4DCSA 2NTNA 1FIUA 4OHWA 5FUWA 4QM6A 1E32A 3I5UA 3UTDA 5CA0B 3A28A 4DWOA 1T1EA 2FHPA 2OWEA 1UM8A 3DQPA 4KRGA 4EQ6A 1V9CA 4RPJA 5I47A 3THXB 3GLHA 4E08A 1NVTA 3KOUA 3LDFA 1D9DA 1PQ4A 5BUQA 1L4FA 3S8MA 1E5XA 3E9RA 3R5TA 4GVXA 5LFAA 2K6GA 2WHRA 4S12A 1WJGA 2VDWA 4QC2A 1VSVA 3RUHA 3PQ8A 4B4KA 3OZUA 1EP2B 2QTZA 2QZ9A 2W6OA 3AYXB 1OXSC 3OY2A 3B9RA 1XWWA 1GUAA 5F2NA 1ZISA 1ADGA 2M9NA 4LXYA 4KE6A 3T0GA 3ZJ5A 5K6RA 3FKJA 4QG3A 2YRFA 4CODB 1NMSA 4F7DA 2WP0A 1V8OA 3BGOS 3PIIA 4ROSA 1WHTB 4M54A 4O4IA 1UQVA 5C1PA 2D5CA 2HWUA 2XIJA 1J5EB 5C46F 2P40A 1VHQA 2VI5A 4KE7A 3TW0A 5BXQC 1WEHA 4LDQA 5IU6A 1K66A 2NQTA 5E2BA 3TPCA 1GGNA 4B76A 4YHHB 2O5VA 3GP3A 2HOFA 2VKQA 1FLVA 1NQOA 2NZYA 2C8KA 4IL5A 3D0RA 5CB0A 3ZHBA 2FFHA 3G2LA 4RETA 2VP0A 1RHMA 1K0UA 3QWFA 1G6OA 2VUSA 2IKSA 2GJ9A 3CGWA 5AUPB 1UBKS 5D51S 4A0GA 3HCFA 4RJKA 3HQ4O 1JQLB 4DCPA 2ALZA 2VA9A 4J0JA 2QUAA 3GAFA 4GWGA 1MV5A 4DNXA 3PX7A 1QTMA 4BIIA 4LYHA 3M82A 1YFLA 4BPBA 3M5CA 4FIZA 4GEGA 5KJCA 1XPUA 4HQLA 4KXYA 1WUHS 2GZ3A 4N3BA 4BL5A 4JWMA 1EPUA 2I3GA 2JGNA 3D6MA 4QU5A 2JASA 2AU0A 4AP5A 5ALOA 1Z74A 1YOBA 3KU1A 5J63A 4LRSB 4S1TA 1JU9A 2RC5A 1E79D 2VRCD 4MZXA 5AW5A 3U5TA 3MTEA 5AK6A 2EZYA 3B53X 3DEFA 2X0NA 1KZ4A 3Q87B 4GI1A 4OK6A 4X1YA 1EYZA 4LECA 3IQIX 3B3JA 1YTLA 1L7OA 3D2BA 3JYHA 1RLOA 3MS7A 4R6XA 3H0EA 3NV9A 1UT8A 2R8RA 2Q07A 2XCAA 3PRKE 5IWCA 2VJMB 3PEWA 3HJFA 3D4LA 2I1WA 4KLAA 4F04A 1NE7A 2ZI7A 4EVSA 2JB9A 1SB9A 3AZOA 3GRCA 4CG2A 2GPAA 4A10A 1NP7A 2PYDA 3PHHA 5EWMA 1NVEA 3QK7A 2XC9A 3EC2A 1KMCA 2GBLC 2D3TA 2O3QA 1TQ6A 5PGMA 3RWBA 4RQ8A 3QKUA 1S77D 4G0OA 4H3VA 2QDKA 4OJ5A 4GE3A 3LS2A 4GPIB 1M73E 4GXIA 1X2EA 5SY9A 4UE3S 1QMPA 3R9WA 1SH7A 1D4FA 4G8DA 3ABOB 4HQKA 2QTNA 2RBEA 3TQHA 1H2BA 4JUCA 4BE9A 1RHUA 4LSGA 3MTIA 5CHEA 5B1IA 3ZGOA 4UUNA 4YRZA 4UOEA 5LQKA 1XTBA 3DTVA 3CF2A 3F2IA 1N3BA 3OT4A 4E4TA 3SM9A 1JI0A 3T61A 3UY4A 4QWBA 1OU4A 3SR4A 2DPMA 1T6ZA 3HVIA 4E0DA 4JQCA 4URWR 4B3RB 2WE7A 1X6IA 1RE0A 2R7AA 4ZOAA 4ZZ2A 3RAJA 5KNDA 3FOFC 5HG0A 3RH5A 2NTJA 3PDWA 1O94C 4GSYA 5EE9A 3O4RA 3ZWQA 1E2NA 4LFAB 1EFVB 1XU4A 2CB0A 3GIWA 5B36A 1YQEA 3BPSA 3JVIA 3TCKA 4B3CA 2BFEB 5CB8A 3DYBA 8ICRA 4IMJB 1DHTA 2J3EA 2O2IA 1GSOA 1XRLA 1Z5UA 1VRWA 3K1RB 1K3UB 1I2AA 2ATXA 4TT3A 4AZVA 4ETWA 1OZFA 2I4IA 3UGTA 4IFTA 3AV0B 3IL2A 4AQYB 4AYWA 4MKIA 2V7QD 4WNCA 2HL6A 4S35A 1Y3HA 4OHVA 4UUPA 5LQUA 2IIQA 5KYYA 1J7JA 1JIHA 2BH9A 3JQAA 4C04A 4C0BA 4C4AA 4QGSA 3FTFA 4ENTA 4RGYA 2FQWA 2H7CA 3AF1A 3EGXA 4WK4B 4ZO8A 3R24A 5AI6A 1ZQPA 2PWZA 2N3ZA 2W2PA 3AH8A 1RKQA 4Y2SA 2AHRA 5IF3A 3VO2A 1QGUB 3COPA 3MR5A 1QZZA 4CW7A 1U9YA 2EQAA 4YI5A 3FRHA 2BGIA 4ZDJA 2G9RA 1KOFA 2CFRA 2QVLA 2FUKA 4JVSB 1NMZA 1ZC4A 2PXCA 3G5MA 1E7RA 4FWIB 2QKYA 1RKXA 2A0FA 4NJ8A 4UB2A 2B9EA 2ZI6A 3FNIA 3H0CA 3U7HB 3I9LA 3AQFA 2JHFA 2QMQA 2X0RA 3Q85A 1WEKA 3V8QA 3NWBA 6CHYA 4DOAA 3LOPA 3KETA 2E9SA 3FC4A 2CF6A 4J1QA 1AKNA 3TKLA 1JZSA 3GJRA 4Q15A 1L7BA 4DB4A 2I1LA 1G5RA 1Z12A 5JD3A 4B48A 4Y3UA 2PUCA 4H4DA 3SR0A 2FWPA 3R8FA 4HUQB 2Y67A 4QQFA 3JWEA 4XJTA 3L05A 1KEEA 1PVVA 4DEVA 4B3TB 2IEYA 4U5XA 3ZHXA 1ODSA 1B15A 4NR0A 4B9LA 1R50A 5FI1B 4P2GA 4Y6SA 4ZAYA 4PPNA 2Y6UA 4QSHA 5LYJB 2YUIA 1IH8A 1RS0A 5BN4B 4AQDA 2KIVA 4B33A 3ISCA 1DCMA 2JAWA 4QZDA 5EMLA 1K8RA 3VU9A 5IIMA 2G3YA 3NG1A 2HIMA 4RU9A 1L4NA 2COEA 4O2BA 2BV3A 3FGOA 4DV0B 1B8PA 1TJ4A 1TEXA 4H6XA 3BS5A 3CB2A 4Z4CA 2ZS9A 4JK1A 2ZWOA 3ZS9A 1A9PA 1JEYA 3SX4A 4ZFNA 1KVSA 3D6VA 3GB9A 3BHNA 1GPH1 4D45A 3I39X 1PN3A 1U65A 1U2DA 2XTJA 4QBHA 2V7BA 4P0PB 1TZ2A 2O5EA 4Z4GA 5T5QA 4CGZA 1P8AA 4BB9A 3VOTA 3C7DB 2V9CA 4BO5A 4B9EA 1E0DA 1MO3A 3B1ZA 2QP3A 5C8VA 4Z9XA 1AQLA 3BTUA 3CKKA 3NO4A 5JNLA 2HPAA 1SXJE 3EIUA 4N18A 1JEEA 2OP1A 4X8MA 3UC5A 4U2KA 3JATB 1E0KA 2YN4A 3HR7A 1VKJA 2H2AA 2YIMA 3LY5A 3QZUA 5FA8A 3HJRA 1RWOA 3QSGA 1KXZA 4TROA 1E59A 3NHZA 1CNMA 1X38A 3W4KA 1QP4A 3ELYA 2XIDA 4MVJP 2ZB7A 4RQTA 1M2FA 3OFJA 3TPFA 1GKUB 4QYXA 4TUYB 5FFMA 2R1ZA 3MG9A 1E1NA 4FI3F 3RVKA 2FRDA 3MN1A 3P5BA 3NB0A 5IZCA 1CUIA 4CEIA 4Q47A 3A3PA 4JYZA 2ISPA 2HJVA 4RCYA 5EUBA 4EZIA 5K9ZA 2OEHA 5KSPA 1QAOA 4HTFB 1ZD8A 1XZ8A 1MB2A 4QKQA 2BGUA 1P6UA 3R3UA 2H4XA 1E6LA 2ISQA 3NDIA 4N7BA 5HDQA 3K9FC 4WLEA 1IJEA 3QWAA 2XDQB 1CP3A 5DYGA 4B8YA 4EI7A 5BY2A 5HR7A 1GV1A 3N8KA 4OJ6A 4KDEA 2WTNA 4BMNA 4DGQA 5SICE 1K8QA 4YAJA 1BO6A 1IY9A 5DNVA 1TF7A 2ZRBA 2XUHA 3EC1A 3INRA 2KEYA 3FUVA 3QXJA 4S1PA 2G9NA 1ZK1A 1C4XA 1MFZA 2VNHA 1IG0A 2YDXA 2G1UA 7ICFA 5I7FA 1EK6A 1QGAA 2ETXA 4FFDA 2FPMA 4AKGA 4PO1A 3ED5A 3L46A 3ND9A 5JCPA 1J8FA 1QHNA 2RHMA 3BRCA 2IHVA 1NJ8A 2BISA 1QH8A 2TECE 3BXFA 5JZBA 3CNLA 1W30A 5IBPA 2H5JA 4RPKA 1H8EA 2ZWAA 3OFSA 4Q03A 1X92A 3DB2A 1E1CA 2X0KA 3EZGA 4RHCA 2G0AA 1WA5A 1TIBA 2XUPA 5D3KA 1MO5A 4XQ0A 4EB0A 2VEDA 4G0MA 1CETA 1N61A 4URZR 5HEKA 3Q3JB 1BMFA 4ZKDA 2Z2KA 3L6OO 4XQGA 1J9GA 1FS6A 3A1UA 3C7TA 4GOOD 4PLZA 3DR5A 1VP9A 4TZTA 8ICIA 1YR3A 3NAQA 2ATIA 4DLWA 5L6LB 2J85A 3LFUA 3IAM6 5F3WB 3L6CA 3V4OA 3USCS 4LYJA 1HSZA 1RI1A 1UH5A 3U26A 2QRLA 1JLKA 2RHWA 5G02A 5AJZA 1FNCA 3JQ7A 3KQTA 1Y8RB 3QBJA 2G4CA 1E9RA 3I45A 1NF9A 3MTBA 3SFZA 1JDUA 1HQDA 1QYRA 3SC3A 3TSWA 5IJ9B 3LX8A 2DQYA 2I71A 3O8QA 4GG1A 1V6CA 3F46A 1UJNA 1A8IA 1BS1A 4ZVRA 2IY7A 3KJQA 5DBOA 3A2MA 4MGHA 4PPXA 1Y8QB 3NRBA 3RS5A 5LMCA 1YL5A 4FS1A 5B30A 1I5EA 3QOXA 2HCRA 1SZJG 2CYCA 1V8BA 3HJCA 5K0LA 4CV1A 1J5PA 1K5DA 1UJ2A 2C4VA 2QN1A 2X2EA 2UUOA 4Z6KA 4D26A 1DC5A 1KETA 4DS3A 4U4AA 1CRWG 5E2IA 3CCFA 3IELA 1C7QA 1YKFA 3TL6A 4DQSA 2J31A 3RK0A 2R5WA 4HDSB 1C9DB 1D9FA 1LK5A 2D62A 2JGRA 3A06A 4CM4A 4Q93A 3ZJUA 1TYAE 4TTQA 1OXKB 1NKTA 3I32A 3LU1A 2ETVA 1D1QA 3K8QA 1GAQA 3FAKA 4D9MA 3D5TA 4M9CA 3WGNA 4IQTA 2CLFB 3VCBA 4JP1A 2ZIGA 7ABPA 2Q8QA 1YIAA 3KB6A 4G1MB 1C7JA 5ILQA 2VSFA 1UMCA 4D4HA 5G5HA 5CHGA 1GRVA 1TPZA 1WABA 1WO8A 2MUTB 2WHYA 3R1IA 5KMGA 2XE7A 3UB4A 1U3VA 1KL9A 1CDOA 1RM5A 5FBZA 1VDMA 4LVUA 4DW8A 1QE3A 3Q8KA 4O2RA 3LCJA 3VDRA 1SB8A 4OH7A 4EPWA 2H8KA 3P2IA 3RTAA 1KOGA 1IXSB 3AKCA 3TLBA 1QPGA 2VDRB 3GILA 4LYYA 2NYRA 2IOFK 4A6EA 5LYJF 1S2DA 2ZCUA 3N5CA 3PQCA 2WWGA 3G0IA 1I7NA 4HNAB 2NZJA 1RQ2A 1ECWA 4JLNA 4LBVA 5CVVA 1YRYE 4J07A 1C0LA 4UHHA 3QUSA 4QXOA 4JBGA 2L69A 1V39A 2ZE8A 2HBQA 4YRBA 1PFGA 1ST2A 1LW6E 2F1OA 2WIBA 3C6KA 3CT6A 2IYZA 2QE6A 1QTIA 1E3QA 4BFVA 5BSGA 5G0WA 3HY6A 3HHEA 4R81A 2O2JA 1M5RA 2FW7A 4B9MA 3E3MA 2ZIWB 3JQ8B 4IWXA 1WOYA 3PCXA 3T1QA 1QSGA 1DO2A 3EN0A 4IIVA 1QZXA 1G19A 5TMDA 4E09A 3OZBA 1M2OA 1QGOA 4OAOA 1BOFA 4KQWA 1I0LA 3HVJA 4OXNA 5B3JC 4CF7A 5AVQA 5JALA 3HW8A 3N75A 4GQBA 4MQEA 4LI0A 1HYGA 2Q5LA 5FO1A 1HE8B 4KEAA 4ZV7A 2VHQA 5J29A 4NICA 1ESCA 3SSAA 1BHJA 2E8NA 2HOQA 4GLXA 2ZRIA 4YR9A 4OJPA 1C9YA 4ZEMA 1AU9A 2XH8A 5T3YA 4KNYA 3H4DA 2RI0A 3FUUA 1PSWA 2C3PA 4HY3A 1IN4A 2I80A 4OLHA 4EJSB 4TTRA 2JGKA 1YC2A 2MSKA 4AIRA 3WGZA 4DQDA 5TS3A 3UAGA 4JJ4A 4TMKA 4AZWA 1VSQA 4BU1A 2PMKA 3GFQA 4CDRA 1E1CB 1PBNA 3WK5A 2FSVC 4AY3A 2Q7XA 4E5NA 2RHFA 3D6HA 5DW3A 2ZAOA 1K0FA 1J25A 1DTEA 4E2FA 3PSAA 1GJRA 3ZHRA 2P0YA 2PKQO 4YP7A 4J90A 2WJ4A 3AWDA 4AKTA 5KYGA 4UPEA 2HF7A 2P5YA 4JK3A 3HPOA 3AY7A 3VO9A 2GD2A 2H4WA 4KQFA 5DNYB 1RZRD 3B20A 4UM7A 2QAGC 4ISCA 5JH7F 4Q43A 2OBXA 5FBHA 1WXEA 3TR6A 4LJRA 3IKTA 3GEGA 3RBVA 1N9ZA 1IE3A 1PD0A 1O96B 4GECA 4V0NA 3FWKA 3MTGA 5AUQA 2O0MA 3SJCA 1T5LA 4EYEA 5J0YA 1FNMA 2ZSBA 2PMZC 4CT4B 3KLOA 4OMDA 4B74A 4BLVA 1BNCA 4GZ5A 1P61B 1DFIA 2SECE 3AMVA 4XFDA 4ZQEA 2W7TA 4JH0A 5IJ9A 3GEHA 5H5JA 3QUBA 2OCEA 2DHQA 2VT7A 1E5LA 1YCHA 1GYPA 2KV2A 3OZEA 3UIEA 3IUYA 4US0R 4G5QA 1PGJA 3DGEC 5EQDA 5FWDA 3G9XA 1SO8A 3B7GA 3LWBA 5B53A 3LECA 2J7KA 3THSA 3ZCTA 2PGAA 4J6FA 5FUVA 4PGFA 4W5TA 4UKDA 2NWQA 3W3AD 3KPVA 1KFEB 5E1MA 4JI6B 4D74A 3RD5A 4FGSA 3AETA 3UWSA 3LCRA 1CQXA 5KNCA 1OBFO 5UKDA 4ZN6A 5LP6C 5JBQA 2LVBA 3QUQA 4TWBA 1O2DA 4YRMA 4FWTA 2FR1A 1Y8ZA 2AGOA 1Z34A 3HPQA 4LVNA 1QO0D 4RDCA 3A4MA 2OXIA 4LTNA 5JLJA 3GJXC 4HAYA 5K0ZA 1AZLA 2OHFA 4X3OA 2VHUA 4Q00A 1FZTA 2E8MA 1Z0FA 5HS6A 3I61A 1NYRA 3HMQA 5DYYA 1XCPA 1TE2A 4RW0A 1Z5PA 2PM8A 1LS1A 2ZSIA 3DP7A 3SZLA 3FUXA 4F4DA 8ABPA 3WNCA 2HEGA 5J2FA 2FLVA 5T7BA 3IAS6 1GU1A 4AUNA 3DXFA 5HFJA 1KY2A 5JG7A 3HEAA 5JEDA 5DBBA 3WKBA 1Y1QA 2VJNA 4B82A 1QLNA 4V1CB 2Z6AA 1JDJA 5ALFA 4GXJA 1PX0A 1I3LA 2BM9A 2JAHA 4MP3A 5DGTA 4NCAA 3RAGA 1TA0A 1CZNA 5DRTA 2ZU0C 3TEJA 1L5ZA 1H6BA 4O3QA 1UBEA 2LYAA 3RBDA 4IHJF 5F73A 5JVDB 5A7HA 4AIIA 4CQMB 5DBGA 5BPHA 1G6Q1 2DETA 5ERGB 3NUZA 4ZK6A 9ICOA 1G20E 2DTXA 2QGNA 3RJFA 2FFJA 3ZDZB 4EMTA 4F1JA 4C4XA 3S1AB 3PKZA 2BHLA 3NYIA 4FT2A 4LPKA 4B4OA 4EW6A 4OJOA 2ASLA 1EXNA 2OC9A 3PLRA 1XKTA 2CUTA 2TMGA 4ABYA 3KKKA 2HSEA 1K4KA 2O7SA 2REQB 3MGAA 1GT91 1QK5A 3HUEA 3SSNA 1N33B 3QWHA 1JG3A 2AOUA 1NI5A 5C3UA 1G64A 4S2EA 1JU3A 4CI0B 1OHHD 2C2RA 3FFAA 1RYMA 2J0VA 4IRMA 3EVGA 1N2CA 5FF9A 3SLGA 1J70A 4S0ZA 4PL1A 3GJYA 3Q8LA 1IZZA 1N5KA 1X77A 3AQIA 3RRMA 1EBUA 5KT4A 1NU6A 2CLOB 1Q3UA 3C2QA 4MYDA 4PPQA 4EVIA 2DLNA 1S10A 2PH7A 2C2BA 3FI0A 3FNGA 1DXSA 2F3PA 4JELA 4XGQA 3V1NA 1TC2A 1HNZB 2YJZA 1X9IA 3PBKA 5LZ4A 3GLGB 1S2OA 3Q9LA 2X6TA 2B8JA 4QYIA 2BMEA 3TSOA 2JG3A 4CU5A 3BFPA 2PRJA 3ZNNA 4JJGA 1GYRA 3SCZA 2G07A 4DMCA 1HEUA 3WLEA 2KZZA 3HDVA 1E4EA 5CJ7A 3KTOA 3VSCA 1FJ2A 3REFA 4E4RA 3GMTA 3NYRA 3R7WA 4NNOA 4RVHA 1RACA 4KN5A 3UT0A 4LJ4A 5CCXA 3QQPA 4TYYA 1JNXX 1Z28A 1Z2OX 4X97A 3X2FA 1WKCA 1AKVA 3FRJA 1NZFA 1AQUA 1RKBA 2Z5GA 5IIIA 2IA5A 2JIOA 2VCYA 4IJKA 4OSOA 1GNTA 3O91A 2JATA 4W7SA 4GW3A 4OMFG 1FYWA 3CT4A 1CQWA 3PENA 2GCEA 5DJ5A 3PJGA 3OCYA 2HU2A 3K92A 3AONB 5B2EA 2HMSA 3ZDDA 2FJ0A 2OOSA 4QUDA 4LA4A 5FXMA 3A4LA 4EY8A 3UK2A 2V4RA 4J1TC 4FN5A 4WN9B 4HV4A 4L73A 2QM3A 3WMEA 3LSTA 2QARA 1RAGA 1SL2A 2ZBRA 3KJNA 1NQWA 5GJCA 4ZKEA 4PQGA 5GTHU 1PR2A 4XM1A 3M5PA 1LZKA 4M1YA 4I4CA 1A6SA 1TJPB 2R4TA 3QVWA 3U39A 5FWYA 2BR3A 1UBCA 4R63A 2ZQ5A 3LO8A 2WWIA 2KW5A 1P2FA 3DGFC 2QZSA 1WBJB 2YNMC 2ECPA 3IOCA 2VANA 3C43A 2IW3A 3NP9A 1MN6A 4N0DA 1Z4NA 1HNNA 2WAQC 4OYHA 2P9CA 4E5YA 1A82A 1MGPA 5TNXA 5FTMA 1AKEA 1HMPA 4QQ8A 5TDHA 3JSXA 3TR5A 4KX5A 1EGVB 3B6EA 2P78A 5BSUA 4B45A 3PDCA 4F6CA 4E5DA 1R8XA 1YDGA 1L7MA 4DPLA 5AVXA 3IP8A 1X1DA 2D2FA 3UAOA 2WTBA 3ESXA 3JALB 2PMWB 3P52A 2MUTA 1SNYA 2FW0A 3DYIA 4TUSA 1JDNA 4M1MA 1MAAA 4N6OA 4ECSA 4RNCA 2WUGA 3CX6A 4A6PA 8GPBA 4DSFA 2AUMA 2UU9B 3PDIB 4QGGA 2JPDA 1IAQA 1PK7A 2YJ4A 3DFMA 3NNNA 3Q98A 2ZTDA 4IHJA 4IIFA 4BBZA 1DIBA 2MINB 4Q3EA 1C80A 4P3XA 5T3UA 4BQQA 2IP2A 1XP8A 5CP2A 2HJ9A 2NUPA 3P45A 2HFJA 4MS4B 4N8EA 3UENA 1M8KA 4KTQA 1UBRS 2W6QA 4BOYA 9LDTA 2N47A 3RAPR 2J6CA 3SF8A 1CJCA 8ICXA 1CNFA 1XJWA 4TSFA 4B46A 4KR3A 4C8MA 5J0TA 2VJ4A 1YKSA 3DKKA 3H2GA 1YA4A 2PUJA 3P9ZA 8ICPA 3RYHB 3UKDA 2MTBA 2C5BA 3JZMA 3EVBA 1TJNA 3O8LA 1NZPA 1HJPA 4TYPA 4COKA 2XB6A 3TKAA 3OE1A 4DN6A 2OYCA 2HW8A 1OLUB 2FCRA 3DZ8A 4YV2A 4AS3A 3IFSA 4YLGA 4UULA 4OYLA 4XB1A 3KVYA 2BZ0A 4RIHA 2WFLA 2H31A 4LFBB 4CI9A 1CVIA 4EBCA 2ONCA 3A0RB 2LCFA 5JAMA 3F2CA 1ODJA 2EGHA 5FHRA 4JXXA 3BREA 2CHUA 4Q1CA 2XY6A 5CJPA 1F51E 2JNWA 1Z7WA 2PZ8A 3SI8A 1NRIA 2FPXA 5DE3A 3UWPA 4D79A 4YJ3B 1JFLA 2Z2XA 2ZRFA 3AJ8A 4JQOA 2JEZA 4B9UA 3DTVB 4GZ6A 3A11A 4RK1A 3WRYC 3DPIA 4MQFA 3RSOA 2WZQA 2FF5A 3NHLA 3TTWA 5HKBA 1O95A 4P54A 1T1JA 2IYTA 4QULA 4M0AA 4PLFA 3BBLA 5LA6F 3S7TA 4LC0A 2V6FA 3EXG1 2XB9A 1YB1A 1U9ZA 2EBWA 3A14A 4L07A 4NZZA 4JYCA 5E1BA 3W8FA 1Z4QA 4ZVKA 4HWKA 1AGRA 4ZI5A 5I01A 3V3KA 2H5LA 5TF4A 4D96A 2QD2A 1XC9A 4N47A 4ZYTA 3BUSA 2ZDQA 4YR2A 2VA3A 1YB7A 4L6CA 3VX3A 1RXEA 1D8YA 2FE4A 1QRUA 4MV5A 2GK4A 1RFGE 2R8HA 3AR8A 4QBKA 4UBLA 1HC7A 2QBYA 5FO0A 1OZAA 2E21A 4OF4A 4PQYA 3I72A 1ESDA 1G8FA 5AW1A 3HU3A 1ZK0A 4K8RB 3WLSA 5K4HA 3RAFC 3HVRA 4XRHA 3ZY2A 1QHIA 5ENZA 3Q8PB 2OLKA 1A88A 3PR1A 2W58A 1VOTA 3NWOA 1YSCA 3K1AB 1L7PA 3H9JA 2SNIE 4I1UA 2MWMA 4FMCF 1U99A 4EB3A 1V5FA 5IAJA 5C5DA 3M4XA 3LWLA 4Y0AA 2F76X 3NHWA 5BYJA 4GFJA 2OUIA 2PUVA 5CCBA 4B9TA 4K2AA 1SKRA 3SOPA 4DEZA 2X0JA 4B81A 2FZWA 4EO9A 4G8CA 3CC8A 3REQB 3IE1A 2UXDB 3HCWA 1S8FA 3AJRA 5BP7A 1N2CE 2QRPA 3PITA 4OTZA 4BNWA 2C2ZA 4XEHA 1VHTA 1FP2A 2RAVA 1R6XA 4MWZA 4UHFA 4O1HA 1JN0A 2OO7A 4I9UA 5KFKA 4YXJA 3QU5A 1JEQB 2Z4TA 3RS0A 1PKXA 3GRFA 5DGHA 3M6IA 2VTEA 2EJCA 3DUFA 4AMGA 4BCDA 4PYNA 3PQEA 3JASA 1EWTA 1PEKE 4ACAA 5IXYA 3PHLA 2IU0A 3UJBA 4I6GA 1XNQB 3BTVA 5EKDA 3HBAA 1AS3A 4YX9A 1BE1A 3UQ2A 1TIKA 1U6KA 3UMGA 1MXHA 3G9QA 2JAXA 2Q28A 1BRMA 1PEYA 3M6WA 4QFBA 4TMFA 4XOUA 2C04A 2J6HA 4MO9A 1ULBA 1H69A 4QZIA 4EY4A 2KZMA 3MMNA 4BNJA 5CFNA 4D8YA 3CVVA 4RGQA 3ESRA 1NVMB 2WE8A 3HUDA 3RJ9A 1TLLA 3ONNA 3HVHA 3WRXC 5JNRA 5CXQA 2C5EA 2XDYA 4PBSA 4DCTA 1XZAA 2D5AA 2NTYC 3JQRA 3KJHA 3ESYA 3NLLA 1XEXB 5BUZA 2NO7A 2XGQA 2GFHA 3VR5H 2E82A 4ALJA 1D6NA 2RK4A 1QOZA 1ZOPA 3WRXA 1DKQA 3PNQA 3ZWCA 1JKJB 3AGPA 4Q4HA 3SS7X 4CKCB 4CN8A 3FMOB 1NVDA 3SC4A 5AK4A 1W4LA 2OBBA 1NVVR 2B99A 4FGJA 5LNK6 1N2BA 2C03A 2O7RA 4QUBA 4OG2A 1NTRA 1Q1GA 1ZUNA 4IXWA 1W0JD 1P1JA 4G89A 2GJ4A 4MULA 4XD2A 1V3TA 2J1LA 4Q82A 5A9RA 1FJHA 4WNAB 1GTJ1 2GCOB 4F5DA 4MR7B 2ECFA 2HWXA 2IZ0A 3NGDA 5JSYA 2G06A 3GH3A 2RB4A 2L82A 3IUBA 3O38A 4MR9A 3W6PA 4DIMA 3NWJA 3ZU6A 1XLUA 1XZPA 4LQ4A 1W85B 3RWOA 2XYRA 2I6SA 3W9BA 5DNCA 3WVNA 4UM9B 3CB4A 4QWEA 1IUPA 1MVOA 3KS9A 3KQPA 4NNPA 1Z7EA 3UHOA 2HA5A 2FMKA 2HQRA 3GLTA 1RHJA 1EFAA 1CUHA 1GQFA 3L6BA 2QMEA 1NLYA 3OD5A 1GPMA 1H3FA 1FW8A 2Y9PB 5D7BA 1VSUA 2EZXA 2BHRA 1D1SA 2CJYA 1GTG1 2E4XA 2WINI 3IH5A 3L92A 3NEAA 1C50A 1KDTA 1LDBA 2BGNA 4WX2B 1G9TA 5EMHA 3AHGA 1F1JA 2HD4A 3KBOA 2ZVQX 2IEZA 3WQBA 1GY8A 2GKSA 3NOQA 4GNKA 4O02B 4OI4A 5D5PA 3BGSA 2VF2A 4ZHQA 1CJTC 4QOHA 2E8OA 1GZUA 4EUKA 3I1YA 4IG9A 2IYQA 4BFUA 1OROA 4AUEA 5GTDA 4KVFA 2D8CA 2ENUA 2BCQA 5IFLA 2QX7A 2JDID 1LEHA 1H5NA 2N42A 1U2GC 1WP9A 4MV7A 2IYUA 5MGBA 1A9QA 3FPHA 4TT3D 1PT9A 4IC9A 2OXCA 1DBSA 4RELA 1SQ5A 3IP4B 2AWOA 2J9ZB 2BONA 2YHIB 3I37X 3PHJA 2XWJI 4KN6A 4RK0A 4XWKA 2I66A 3L2OB 5IF9A 3U3JA 3KEFA 3QFCA 2UVPB 1GPJA 3VTZA 2GNAA 2XTNA 4AP9A 2DPGA 3P9RA 4MRSA 1KDZA 3FVWA 3T5GA 1P4GA 4ZIRB 1HKHA 4NU8X 2B83A 3PR3A 5A02A 4R40A 4ZPXA 2HH9A 2CD7A 3AOEC 4XLZA 5KNDD 4JCCA 1SCUB 4IHKA 4F1WA 4X7MA 5K3BA 1P7CA 2B7CA 2Z3WA 1TM5E 1PFYA 4EUNA 2GM5A 1ENOA 3PYMA 5B58T 4CEHA 5JS6A 3MRTA 2QMOA 1G42A 4TTJA 5C0OE 4D3ZA 5TGTA 4TS9A 4MKZA 4BJ3A 4ESHA 4KXXA 5K6TA 1LDYA 2O2XA 4RSHA 3N7RC 2IKQA 3KSAC 1K92A 4NJOA 3G1WA 2HHAA 4YPFA 1H0RA 3ZQKA 3WGQA 3N53A 3MJDA 3O8BA 1TK3A 2GN2A 3GG9A 1BKYA 3U7RA 3ZDXB 1A0PA 4RZSA 2RLTA 4DPKA 2G70A 4IILA 3CF6R 5LVAA 1SBHA 3JVUA 4U3JA 3PF8A 3B0YA 1O5OA 1SZCA 3MGGA 4ILEA 4QO8A 4H3SA 4PGHA 2RGDA 2WHPB 2I29A 2YY7A 3H87A 2KVCA 4JQSA 5FQNA 5TQVA 4ADSG 1IDN1 4L2IB 4WN3A 1ZVMA 4TSKA 1YA6A 1CWUA 2HHSA 1X1RA 2O2GA 1J0CA 2HC9A 4A0SA 3MGHA 3OQJA 1QU3A 3WDMA 4FBUA 2C57A 1US8A 1XEWY 3C7AA 2P41A 1KKUA 4EHAA 2NV2B 2KIWA 3EGDB 4RX1A 2IYNA 4UBOA 2AMJA 5C4GB 3ZOZA 4LGMA 1CQIB 4EUEA 4HDCA 3NEPX 3UTCA 2PXHA 5I5GA 5ALNA 1KYIA 3DD5A 3ZI7A 1ZNQO 3FUCA 4NDZA 3JQEA 3OQOA 1E6WA 3BAZA 4WOBA 1GTVA 1HH4A 1SIUA 2HMAA 1JF8A 2EJTA 5G4KA 4C9BA 2PA3A 1E3EA 2K60A 2HHCA 2WZDA 3JPNA 1Y6QA 1PRYA 2JI7A 2YFKA 3DBVO 4MX8A 4XPZA 1Z19A 4WHMA 1JJFA 4KGZA 5K0GA 4W63A 1ZETA 1ULAA 2OG2A 3TTYA 3FNRA 3V6LA 4ZCQA 1QMGA 2SICE 5I9IA 4C0QC 2JAPA 4JQZA 2ZIVA 4NZOA 2PKEA 4TYQA 5CFMA 2GCOA 2GD6A 1Z33A 1GNRA 2PXAA 4P3KA 5AVOA 5ICEA 2VF5X 3FOAA 3I5AA 3KZCA 1II9A 4L9SA 4D4LA 1QCDA 5EEGA 7ICJA 2IYLD 1FTQA 1U90A 1RJEA 3BERA 1XL0A 3H1PA 3WGLA 5AVWA 1VI6A 5EP4A 1ZOLA 2YASA 2Q3DA 4Z0PA 1JIIA 4J9LA 3OOSA 4EB6B 3A6GA 1A7AA 2Y0SF 2DCUA 2EKLA 2V7VA 5C1BA 1QE0A 4UBNA 4F6LA 3L4JA 4M1EA 1WPXA 1LX7A 5BV2P 5DLFA 4I4LA 2ADOA 4OGGA 2HHWA 3OE7D 1X7XA 5J2EA 2KQUA 3K70C 5LA6A 4Q1FA 4ALMA 1JSCA 3DHNA 3LCMA 5TGZA 4PG6A 1WSAA 1NK8A 3MLEA 4NXZA 4B84A 5HJ2A 5EJEA 1K88A 2OYYA 4NEQA 4NE2A 3E0XA 3WNVA 2EW2A 3W7BA 2QWXA 1Q50A 4A92A 1XNSA 4EPTA 1AQYA 3AUAA 1UEJA 1UM9A 2WICA 2P3OA 4R5HA 1QJ4A 2RJOA 5AK3A 3T5JA 1FUUA 1ZJJA 2WTXA 3U80A 5I45A 4UB4A 1QYXA 2VIXA 3ADKA 1SXQA 3GLFA 4GDFA 2KKVA 4ED3A 1X80A 5REQA 2JGDB 2GCPA 4KFUA 1PHRA 3EIEA 3WYCA 1I7LA 3LIPA 3WKDA 1P2TA 1UAYA 3VAZA 4E88A 5THKA 2PYIA 1C7FA 4P4GA 2AG6A 1AIPA 1P75A 4EYHB 3NVAA 3UAZA 2VL7A 1DQZA 4ZOLF 4P86A 3T1YB 1KDPA 2RK6A 3CBGA 4RQ1A 3UMRA 1LV7A 4G9EA 3TOSA 2H1CA 2GRUA 1G8AA 2RIRA 2R85A 2ZUSA 4HYTA 3RUAA 2X15A 3TM5A 5JROA 2HMVA 1K1SA 1J49A 2ILVA 2WNSA 5JTTA 4IXDA 3RIGA 1QF7A 2DQSA 2YOHA 4O2LA 4EKDA 4MVJF 2VP4A 1X70A 2BI7A 3LBFA 4WKBA 3RREA 5LQCA 4NS4A 3VHLB 2FRXA 1NFRA 4G84A 3UK7A 1E0JA 1EDBA 3ENWA 4HZGA 4OM7A 2W8BB 3PFCA 3WIBA 5COQA 1Q22A 4KAFA 1WVIA 4ITVA 2EG9A 4ZEWA 3DV9A 3BMCB 2YXLA 3I52A 5GADl 1Z4OA 4C8OA 4DTCA 1DXQA 2B0CA 1DP4A 4D92A 4EHHA 1XQXA 1QS0A 1JDVA 2G1AA 3D6AA 3ROXA 5TZVA 1B76A 4RQNA 1ZNWA 1K5HA 4RULA 1ONOA 3P9CA 1TCAA 4IDQA 4R16A 4RA9B 3GELA 4MUHA 3UEOA 1PKEA 4IF6A 2GVZC 3RJMA 2OVBA 1ZI8A 1RTTA 3V8NA 1ZJZA 1EJBA 3UZUA 1RCTE 4K9PA 3ZJ4A 1XO1A 1XQ1A 3L7OA 4R71A 4E14A 1HL7A 4LWZA 4M83A 2QSZA 2OWOA 2XHZA 3BXGA 2HW3A 1CT9A 3DWEX 3LYLA 5JJBA 5K4AA 1TKDA 4DOCA 4EOGA 2FPLA 1H0HA 5CFRA 5EZSA 1ZI9A 3GEMA 3MWEA 3GMDA 1KEKA 1B74A 4L3OA 5IAAA 1MAWA 1YS1X 4C0JA 2R1VA 4CKXA 1Z3EB 2Z8ZA 4UOQA 3HCRA 4FCTA 1ZHFA 3FRIA 3S0JA 4ZDIA 3MAJA 2C59A 2F2AB 4LJAA 5F7JA 1OYWA 3RSQA 2YV1A 4XVCA 3PG5A 5JYDA 1MAHA 1N9KA 1Q1NA 5A5GA 2R6R1 3MLAA 4ZOLA 4E03A 2NM0A 3WI7A 2GF9A 2P7HA 4A82A 3T9CA 3JVEA 3ZI0A 5JXWA 4TM7A 4XR9A 1O6BA 1P6QA 1VG9B 1C14A 3Q9NA 1J07A 3K0CA 5K2OA 4DM4A 5JQGB 3BS5B 3NTRA 4MDHA 5DDMA 1ZIXA 5E7JA 4C4RA 3P2OA 3F6YA 4BFZA 2KBFA 5LP6A 5AIBA 3JALA 1SUBA 2BF7A 4UM9D 4W6QA 2KLHA 4RUAA 3I2JA 4MA4A 4KR7A 1AS0A 4P53A 4KO8A 4PZYA 1FS4A 4NI5A 3USES 4D7AA 2ZXIA 1ZJNA 1KEZA 4UQGA 1Y8CA 3DMTA 3F6EX 3SK0A 2RH9B 1E92A 1BCSA 1LBHA 4TUYF 3DG9A 1RZRA 3UWKA 2OORA 5K4LA 5ALTA 2Y1FA 3FJOA 3H9UA 4O0MA 5BN5B 1TW2A 3A8TA 2Q6LA 5CYFA 1PGOA 1HZZC 3P1JA 4M53A 5AD1A 4ZVUA 5IT5A 1AJEA 1G7TA 2BI8A 2PJRA 1VC2A 4J0EA 1BA3A 1BNOA 5IAOA 2K87A 3WX0A 5B6PA 5SV2A 1XEWX 2WB1F 5FBKA 1U2ZA 1VJRA 2J9RA 1Y4AE 4MI3A 4KR0A 3KG2A 2H59A 2VF7A 3KBBA 1GNVA 2A7QA 3SZMA 4UBCA 1UL1X 3LK9A 2E3TA 3L1JA 3WLIA 2HRDA 4GQIA 2B4TO 2F8LA 2R8PA 3JD1A 1BPZA 4NENB 1JT9A 4MICA 1C3JA 1JVNA 1PR6A 1SV0C 1WL8A 2X5XA 3MJTA 1BVYF 4FQ5A 4PS0A 1PJSA 3AU6A 1FC0A 1T6NA 4H9GA 1JLSA 3D2SA 4GMXA 2ONJA 1O7JA 3O21A 4DV1B 1VMDA 1P0IA 4PGAA 1KI4A 4NDAA 4Q21A 1W49A 4X54A 3BRWA 2ODPA 1OXXK 1XFAA 2A33A 5KT7A 2X2PA 4KN4A 5U4XA 3UXPA 4KE8A 3ZJTA 1EM8B 5LDHA 5ESWA 2VDLB 4B6RA 4EFMA 1PJQA 2C82A 3FYUB 1WUJS 4G01B 4J7UA 2QVXX 4WZ6A 2IBSA 4NS1A 1KNQA 3GGOA 3ILXA 2FETA 1ZH6A 2Q62A 2Y0PA 3SYTA 1E4EB 1R5OA 4GPAA 4PM4A 5DU2A 4XSHA 1KVUA 5J4HA 3DC7A 4LJ5A 3E5HA 1EK2A 1HL3A 2RGGA 2V5AA 3OLZA 2BZFA 4I4TF 1R0CA 2NZUG 2O50A 3E18A 4UZEA 4NCIA 3TSCA 2J48A 2NAPA 2FWIA 3O1HB 4MHSA 3X1XA 1TQ4A 4F4KA 1U8YA 4MS1B 5FPQA 3TOZA 5A4JA 2J45A 4Z6FA 1BNPA 4MF8A 2C5GA 3BJYA 1GR1A 3KPUA 4BCCA 3JQ6A 2BKEA 1L3CA 4FDMA 1OFIA 4HN2A 4Q4CA 1ZQQA 4FFLA 3MVEA 1QWSA 3DE1X 3AKDA 3UXYA 3M8SA 4O4HA 5JWOA 5LKAA 2COUA 2OKGA 3AY3A 3ICQB 3HN2A 1JJIA 2B7BA 4X61A 1NWHA 1VE6A 4MHVA 1DCFA 4EW2A 3R7LA 4K9NA 5JPCA 5EWGA 3U3XA 2YKGA 2ONKA 4G5GA 2GXUA 1Y1KE 4QATA 5JY1A 5BVHA 4UDOA 1U45A 1SKMA 4D44A 5I9NA 2RARA 4US1R 3GVXA 2F67A 4Z51A 3CF4A 3STXA 1GDHA 2GPNA 4N54A 4Y6QA 4OJMX 1QONA 2K4EA 3ONFA 2IVFA 1Z7YA 4QASA 2QSUA 1ZLYA 4MWOA 1MOQA 2NU6A 1LC0A 2WU3A 4B4DA 3MBKA 4UXHA 4BZZA 1AK2A 3L0BA 1E3SA 3HKDB 1R5NA 2CNOA 3OEWA 3PLAE 1Z29A 2XUQA 1X9XA 1WR8A 1XIVA 3EAFA 1YIOA 3DZGA 3LW7A 4MRNA 4QWCA 1UIRA 4B32A 2IUTA 5IT0A 5ISMA 2FR8A 2H4JA 4MRRA 1XK6A 1RIIA 3DDCA 1EWKA 4ZOLB 4KXQA 4FTWA 5PNTA 2QQFA 2WFMA 1KSFX 1KZGB 3EWAA 2V7EA 4J2OA 4PFSA 1WY5A 3OIWA 2D1FA 5DQGA 3K9WA 4QG7A 5JSZA 3V72A 3R0VA 2AGVA 4LV5B 3SS9X 3L1UA 4RFSA 1NMXA 4N0MA 1YF3A 2BTEA 1P0CA 2BQ3A 2XDAA 5FT9A 4HNUA 2FN3A 1J2TA 4W1SA 1AS2A 1ETUA 1B8NA 2XUKA 3NBQA 4LIPD 1ZNXA 2MSNA 2EFDB 3UUFA 2OHJA 3AM1A 3VNQA 3N8DA 4P93A 3RVOA 4GKBA 3A1NA 1IB6A 4KWEA 3PDJA 3U6KA 3GPCA 5DHQA 5IDXA 4JI0B 3LJKA 9MHTA 3CURA 1QBKC 4Y2QA 2GARA 2I62A 8ICMA 4P92A 4U5QA 5K0TA 2LDXA 3DVQX 5ESXA 1XCGB 4J0FA 2CVOA 5ADHA 4MR8A 2XYGA 4XA5A 4RXMA 4EAAA 3GRKA 4IJ5A 7ICMA 1PJAA 4NDNE 3RTCA 2XUOA 4OQYA 1ZN9A 3NHKA 4PZUA 1KLNA 4EX7A 1V11A 3PNYA 4IIJF 3V4SA 4CFYA 2VDVE 5EJIA 1N5JA 4U7FA 1KY3A 3BFXA 2CXHA 4XB2A 8ICNA 2VO1A 1IAVA 5HIJA 1TM4E 5AM0A 4DSNA 4KO4S 3Q3IA 4GBJA 4FE3A 2OHOA 3GFVA 3UUWA 4CM7A 5DHAA 2FZ5A 3HCPA 3IT2A 3MSCA 3TMAA 2O3UA 4QWDA 1RFLA 1Z4IA 4ZU6X 1DRKA 3MHPA 3AINA 2XVTA 1N5MA 3M49A 3RS2A 2NG1A 1NVXQ 5IKOA 4CM6A 2HKIA 2XYHA 6PFKA 2RKOA 3LRXA 4RCZA 4MDEA 3NHYA 4WT7A 5K8VA 3EZXA 4WXYB 3I42A 1GL3A 4Q6BA 4A27A 5ALSA 4EEKA 3PVCA 3RR2A 3IXQA 4MWTA 3A3NA 3M3PA 3WZMA 4R69A 2XCTB 4DSTA 3WGJA 3N07A 5L4SA 3HCEA 3OZWA 1J5XA 2ZP1A 2O52A 4Q66C 3TJRA 1DDOA 2HXYA 3AL2A 3O9ZA 4X1KA 3B5IA 2AQIA 2ZYDA 3UFXA 2C0PA 2C4MA 5E8JA 3AQEA 3C6QA 3E3AA 3C5WP 3EODA 4L5JA 4MLZA 3V7KA 2VK4A 3IOMA 1N77A 5KU1A 3V3TA 2K7FA 1YQ9A 3ZQ4A 1V26A 3HFJA 4CL3A 1BEUB 1Q1AA 2X6QA 3CEJA 2R6DA 4Q48A 3FKSA 1PFVA 2PZGA 3V42A 2OKCA 1PEAA 4BVGA 5IZCC 3Q8SB 3FOZA 4GXKA 3ZWYA 2R4QA 5ALMA 3AEVA 4FFNA 5C7OO 5J2KA 1VB5A 3A31A 5CLLA 1E2MA 4M86A 3FKQA 1H94A 2NRTA 4EZ9A 2CLLB 2D5LA 2Q9AA 3AU8A 3NAZA 1ZESA 4K9LA 1RLTA 3LT4A 2R1UA 4G37A 1W88B 3IUJA 4YV0A 3Q2KA 1VBMA 1LV5A 1MTZA 2BF4A 4UEOA 2IXBA 4I2JA 4KMUA 3AP2A 4I3GA 4NL9C 2JLSA 1M1NB 1OI2A 2AL7A 1GKIA 1PTJA 2KB0A 3JQFA 2A0WA 4LMAA 5ER9A 4C3OB 1QF6A 4UAUA 1H1LB 2O4CA 1O4WA 2VPZA 4EM6A 3Q72A 3WK8A 2VN8A 1G8PA 5HHTA 1KI2A 1HI9A 2YZGA 2P77A 1T3QA 2P8JA 3BGVA 2BW0A 3DL2A 4YRAA 2EEPA 1N0HA 5AI8A 3ND8A 2XHEA 4M0EA 5JJKA 3NASA 2FSUA 4EF5A 1BD4A 1E61A 3MINB 4QRDA 3D7RA 2BFNA 4P0PA 2F1KA 2XJ9A 3EAQA 4K8OA 7ICVA 3SAFA 1LC3A 3UCEA 4PHEA 4JV0A 1KORA 3LE8A 3PEFA 4MVWA 8ICTA 3NXKA 1SQGA 1AGYA 5LLSA 5C1DA 1R9GA 4M87A 4MEAA 4A8HA 4HWTA 1N1DA 4G0UA 1KRXA 4ZTUB 1WDLA 2QX6A 3RTVA 4DSAA 3EPLA 1K9SA 1QRAA 4EJSC 5JFGA 3BDIA 3KQKA 1DTWB 1LK7A 4OMCA 3PO5A 2JFQA 1TFRA 1MRSA 3FTEA 2BFCA 2C54A 3DEKA 3KV1A 4QUHA 4QAJA 4RS4A 4LGYA 3RIYA 3VC2A 4WZBA 3WV5A 2QNBA 3D3WA 1XZNA 3PJFA 4W5WA 3E2EA 5LZ9A 1GL7A 1T5HX 4EGAA 4YCXA 1Z9BA 4KQMA 2PVSA 1PK3A 5E7QA 5FPSA 4XD7D 3RB3A 1U48A 2AJTA 3DVAA 4AG5A 4P36A 1J4AA 1P2DA 2N75A 3D3KA 3G2JA 5T67A 1KQNA 2QM7A 4AG3A 3N58A 1ABEA 3IP9A 4JSYA 4KNVA 1X6VA 2X40A 3CTPA 1OILA 1EA5A 5GWXA 3AEUB 4NMMA 4KQGA 1DKPA 1TT5B 3PV8A 3RC1A 2HSDA 4ZOHC 2Z3VA 3R6TA 1G4HA 3WSVA 2PUGA 3I9JA 4J3JA 1ZN8A 1TCCA 4M1WA 2CNLA 4DR2B 1NPDA 2XCIA 4HDAA 2CCGA 4B9NA 2YYZA 4QOGA 4ZO9A 3K8YA 4PZZA 4HI0E 4ZI7A 4Q1VA 2JGLA 1IEQA 1KU0A 3C87A 1XVLA 2UDPA 3JZFA 3PWZA 5KQRA 4MWGA 3KQYA 4TYMA 5KQPA 1YS7A 2R62A 5CEFA 3T34A 4JB3A 1V5WA 1XX6A 5DG9A 4GKKB 4LY6A 3JPTA 5K03A 1Z35A 2PL5A 1UDWA 1OA0A 3EA0A 3HRDD 3GBVA 2ZRCA 3KLPX 3NHJA 3UJPA 2A5YB 1MH1A 3Q10A 2WEKA 1CUEA 3O9VA 3ZIAD 5MFPA 3V7FA 4YXWA 2HN9A 3GLFE 4LHVA 5DM0A 1CE8B 1YZKA 4DL7A 1XVIA 4LEIA 4ZO6A 5BYBA 3U3MA 2ZPUA 4P8RA 1FIQA 4Q05A 1A69A 4PCVA 4BX0A 3JYLA 3O3OB 3ZV3A 1MP0A 1W87A 2NZ8A 4MGKR 4B3XA 3M3DA 1Z08A 3GLKA 3Q9UA 5EJGA 3NGMA 1ZITA 2YJ6A 3TNFA 5BSVA 5FEUA 3THXA 4LF5B 2QMZA 3GT7A 5E2AA 2Q9UA 1KYQA 4POAA 1TYCA 3VZSA 2VWGA 1TJ3A 2E87A 3FLEA 4BMXA 5HSGA 2FCAA 2JJ1D 10MHA 4Q01A 4Z3DA 3T3MB 5KYWB 1XKLA 3WZLA 3C28A 1II8B 1Y8QA 3GZFA 2EW8A 4L1KA 1XTSA 4GXTA 5LBUA 2JFZA 1MOZA 2YWRA 3DFIA 1I4WA 4E21A 2FYTA 4I50A 2IQ5A 4W5RA 3AF6A 3JD3A 5L3ZA 1WULS 3DQZA 4JU8A 3Q6MA 5P8WA 3DLPX 3T7DA 2IHYA 3UANA 1U1IA 5AJXA 4YR7A 5KX5B 4DJTA 1G20A 2YN2A 4XXHA 4FOOA 5I7RA 4ZVTA 1DG3A 1H9AA 1PJLA 3QFFA 4TV9B 5E9JA 5AXCA 2H1LA 3MJHA 4EJ0A 2NLOA 4N49A 1UJCA 4F38A 3EZLA 2G1KA 2R25B 5HF8A 2ZCJA 3DBHB 4NCHA 1NR1A 1ZRHA 1T3HA 2I99A 2SCUA 4BDTA 1LDMA 5IDVA 5TRTA 4MUGA 1EESA 2JFXA 1VI2A 2F8SA 4L8VA 4B6OA 3ZCXA 1TECE 2II6A 5IYZA 2ZBQA 4HXEB 5HF5A 2RSLA 3BF7A 3KHHA 1P7YA 4EI8A 4L4XA 5C8DA 4G25A 3T3PB 4L0MA 3NJ4A 3VYSB 1J7KA 1OAOA 1N8KA 3BE5A 1NDHA 3WFZA 3THYA 3SWWA 2IS2A 5CB1A 3GV7B 4I27A 3IEPA 2NNLD 4JXJA 3KUKA 3TO5A 4BASA 1TKBA 1SD5A 2F7SA 4LX0A 1OFVA 1IY0A 1DT3A 2UVRA 3GJTA 4BN4A 3OA2A 1D5CA 1ODTC 4Q9KA 1GM5A 1W0CA 4DC0A 1WX1A 5ECYA 4QT4A 3BD9A 3AW8A 1NBMA 3CQ9A 3IIJA 3NXSA 1JQEA 2H4ZA 3KIPA 3KHUA 2PBRA 2K2WA 4LDZA 2XTZA 1VPEA 1U8ZA 1KMHA 1M33A 3C5HA 4Q39A 3VPXA 2QRQA 1KY5A 2QTFA 3PGMA 2BPGA 1JDBC 4AWBA 3ML1A 3U7GA 5KSZA 3ZDQA 5K0JA 1NWCA 2Q3FA 4YGXB 2E4YA 4MH0R 4WASA 5IEJA 1UKEA 1Y5MA 2WPNA 4DLTA 5DHPA 2I22A 1WBDA 2RG7A 3DL0A 3U60B 4QTZA 1EFDN 3C24A 4YRKA 3DJFA 3C3EA 1KZ6A 3ONWA 1O6GA 2ID8A 1V25A 4U6PA 3QLVA 3VHXA 3COZA 2WKQA 3DTTA 1ZM2A 1ORRA 5SYMA 3VSDA 4E2XA 2ONZA 3HSSA 1K5OA 2BMFA 1MJGM 2QKQA 2UUPA 4RQ3A 5J2UF 3PIDA 4M9LA 2VHYA 4BP8A 2Y1JA 2AEJA 4BE7B 3MMZA 5ICSA 1RWNA 3NWEA 1ZKMA 1LZLA 1KYYA 3PRYA 3ZV4A 5A2QA 3TARA 1NSTA 2HMYB 5LU8A 4MEBA 4CUJA 1QK3A 3PFGA 1RMQA 1WXIA 1NXVA 2Z4RA 3VH2A 3RBEA 4CGYA 1KERA 1QVZA 2IPOA 5KQGA 3KE9A 4MYSA 2IJGX 5ALVA 4TT8A 1E2EA 5TQ2B 1VJCA 2W9MA 1M2NA 1U9IC 2FGKA 3N2IA 4DCMA 1LQTA 2RAFA 2GAIA 4CYMA 1JHAA 2JI6A 3WLQA 1U1FA 9ICUA 1WUKS 3RIEA 5IJ0B 5FLXA 3L4KA 3VZQA 2CDAA 4IM7A 1JFRA 2CWDA 2QD3A 4KLLA 3IHTA 3IXMA 5AI0A 3B89A 5EZYB 2VYFA 4DJJA 3RU9A 4BUGA 4X6YA 4DV5B 5JRJA 2I55A 4MVJI 1L6RA 2WB4A 1MZPA 1L6IA 3KALA 3WGHA 4NY1A 1ZICA 4RIEA 1OKKA 1T34A 2VQDA 2BFFA 1V38A 1DI0A 3TOVA 4JKOA 1QQ7A 1CVLA 2WU8A 3H5LA 2IV2X 2CPRA 1CQZA 4Z7NB 3IQEA 3WSTA 4J4BA 4TRJA 1CDDA 2PQ0A 2H06A 1VECA 1QWOA 3NH9A 2HDWA 3ER6A 2HUNA 1EE2A 1NONA 2QDXA 4V0OA 3U49A 3ZX4A 1Z8NA 5KYUB 2A9KA 2Y9TA 2C84A 2IYYA 1ZYUA 2G9ZA 4WNYA 2ZJ0A 4DAOA 3KKAC 3LUJA 3OIUA 1IZ8A 4FYWA 4NU0A 5F3RA 5AVSA 1Q3VA 1SCNE 5HR6A 2OM2A 2IDZA 1ZXBA 2C4WA 2R48A 5CT4A 2ISSD 2QD4A 3TAUA 5JMTA 4MJLA 4MQLA 1EUCB 2OV4A 1BXRB 3QF4A 1IUKA 3W3ZB 3A6FA 3IQGX 5EP1A 1X8JA 4QIWC 1R4MA 3MBIA 5LMUB 2O2SA 5IZ4A 4J1NA 3EEBA 5HK8A 4DO9A 2ATVA 3HCOA 3QHAA 1ZQIA 2WILA 3I04M 4QWAA 3GFFA 2BHTA 1P3DA 3KVVA 1DTSA 1G20B 1LCIA 1L7EA 2ZBUA 3Q8MA 4RPZA 1Y1TA 3NYWA 3QMMA 4LSWA 5JSUA 4P3YA 2Q1XA 4RQ2A 3N0WA 3WDSA 5AVZA 4PXAA 3PHCA 5CXXA 3DOHA 4FNGA 1GSAA 2CJWA 2ZT5A 4RSRA 4EDHA 3D2QA 1Z0KA 2SCUB 3KKMA 2FY8A 4HX9A 4F2GA 4EMUA 4ZICA 3QNUA 2Z4SA 4B3IA 4CFZA 4P3PA 2FWBA 2RD2A 2X41A 4WLFA 2XT0A 3SIXA 4H7PA 4QOIA 3VISA 2FPKA 1EGMB 5B1HA 3BQNB 5C37A 4JD5A 2L2QA 2NV6A 3MT7A 1AZSC 4QUAA 1D6MA 1DGJA 4AKIA 4KXFB 1JR6A 2CL5A 3FTQA 3RGWS 5AI4A 3FYTA 4GYJA 4YHBA 1XTUA 4B3BA 5J40A 1I6MA 4M04A 1ZVQA 4GI2A 4DXDA 2BFCB 3DT6A 3U48A 1B93A 5FOXA 3ZTWA 3D2CA 2MSLA 3DKIA 1PHPA 1SCAA 5J2TF 3PUHA 4OI1A 3KC2A 2DQ4A 2CNDA 3S2EA 3NAGA 4Z9AA 4YFYA 2RQ5A 4I66A 3LHKA 1U1CA 4AI6A 1U2PA 3DVAB 3SVLA 2PMDA 1IHXA 1JQJC 1M7HA 4FFMA 4I46A 4LN1A 2AFIB 2PS1A 1PO7A 3M6MD 4CIYA 4D3XA 1VMAA 3B6ZA 2VNAA 1K1EA 2ZIUA 1LPSA 2NZWA 4MDFA 3CZQA 5IT9A 1JPVA 4P31A 3VYTB 1TT5A 5KWEA 3JVVA 1OXBB 4DUYB 1CZOA 1NP3A 1FFCA 3DEYX 8ICVA 3IM1A 4DFKA 1ZUD1 3K4HA 2AN4A 3TW6A 2CV2A 3G2HA 5ANRB 2G8LA 2OO5A 8ICYA 2VK1A 3GR6A 3CCCA 3DE6X 1I30A 3EZ6A 2WTFA 3H2SA 3TI9A 4AJOA 4DLKA 5BN5A 2V0GA 3CPEA 1QV7A 4L7QA 1BKSB 2HHVA 3WWPA 1TMOA 4LZWA 2Y9UA 3KSDO 3S70A 3U81A 1DEKA 1Q14A 3QITA 3KB2A 5B3KA 2XRFA 4L4YA 4UNRA 1FLNA 4I99A 2NVBA 3IR5A 3QJ5A 3RR7A 1NRWA 2SKCA 1SBNE 2DL0A 2GCIA 4FZNA 4MS4A 4V3CA 5EG5A 5JQWA 3NPAA 4C7KA 2XF2A 1EAYA 2XOEA 3IILA 3FZGA 3ECSA 1EQUA 3KEQA 4NJEB 4X95A 5CH3A 3TXAA 3WLPA 4RF3A 3T5LA 2Q2WA 4LF4B 5EPOA 1SCUA 4PLHA 1TVCA 3UOWA 3V9PA 3QVKA 4WXHA 4EECA 1F8UA 4ED6A 2OFPA 4QDKA 1V1RB 2XA1A 5GJWC 1GPKA 2ID7A 1Z1VA 1EQAA 1HFJA 4RIIA 4A8JA 2WB1C 1DC8A 4TV9F 5DM60 1E3WA 1VIAA 2PH1A 3AV3A 1MDFA 2PQ6A 3RQIA 4WK2B 4B9VA 3E22B 4MUIA 1Z15A 2BP7A 4A2CA 3IPXA 2DU8A 1PE0A 2HRRA 4ZYUA 3RC8A 2WU4A 5B5SA 1B0AA 2F9FA 4Y2UA 4MB6A 1K97A 2E3JA 3IBCA 5JDCA 4M6WB 1K27A 1EGHA 1O0SA 4IKEA 1C20A 1MC1A 4PHHA 1HZZA 1W5TA 2W98A 3WYEA 1ZDMA 3EWIA 2VRBA 4XVUA 4Y6RA 3T0FA 4KXMA 2QTMA 2DWCA 1PT8A 3R44A 4UCQA 3JQ7B 4PIMA 2PYZA 2DF8A 1Z6GA 3V1KA 4D0SA 4RZUA 5LD2C 4Y2XA 2QRJA 3WGKA 4OHOA 1ZZGA 1OIXA 2RHOA 1N3LA 3AWIA 1L7AA 3CZAA 2TMDA 3RUCA 5KSWB 2YQEA 2IDKA 2LD4A 2O8BA 3QYPA 1EE9A 4DJEC 3ZV7A 5KHOC 4TQSA 4FLFA 4WCFC 1I2DA 1R0ZA 3AI3A 2J5BA 5B66U 2XDWA 3OTQA 2DBQA 3D7SA 3K0CC 3L1IA 1QH8B 1V45E 3BWMA 4JQYA 3OPQA 1PL7A 2WHQA 2KZ3A 4PGQA 4MUEA 4UU8A 4BVKA 3ME5A 3QKTA 3SNHA 2YNMD 3NPMA 2PU5A 4ZT4A 2GN6A 1T1GA 2PRSA 9ICAA 1WMEA 5F12A 1OWPA 1K6XA 2OFOA 4ZV9A 1E63A 5C8ZA 2C96A 1JZTA 3DOCA 1V4NA 4H3HB 4JYMA 1PT5A 4TLEA 4IVRA 4LI3X 1FYVA 1Z2EA 3IE2A 5FKJA 3VM6A 1Z06A 2WJAA 5DGAA 4F8YA 4R66A 1ZRSA 1XSPA 1PNTA 2V58A 3AHCA 4KMOA 4P4LA 4XUGB 1SBTA 5A3RA 1RQGA 1QS0B 3VHQA 4PHPA 1NXTA 3H2HA 3ZD7A 4LCEA 2XCUA 1G6KA 2DMRA 5CM2Z 1QSYA 5CA0A 4ME6A 2BQUA 1BIFA 2DTEA 3MCAA 3OWOA 4E5KA 3Q8QB 3D8HA 4HAUA 2VOEA 3GLHE 4HGZA 4F9FA 3MHTA 1HE4A 2C5AA 3NAMA 5LM3A 2PSDA 3G5AA 4QLOA 1P74A 3VV2A 1QGYA 3MGBA 4KO2S 2Y66A 2P9EA 4RXTA 5CNIA 4BIMA 3DUWA 2WSBA 1MO6A 4RHYA 3GDXA 1BW9A 3KZOA 3CMMA 1OFHA 2JIMA 3V32A 2CE2X 4UVHA 2QTHA 1F60A 2ZYRA 3CN9A 1DX4A 3UCFA 1P19A 2I87A 3RWMB 5AXDA 1TM1E 3X1JA 1KKLA 1VLVA 4Q3DA 1OLXB 4RPYA 3KEOA 1NW9B 5CVEA 1Q7CA 2YX8A 1I01A 4DBLE 2DCMA 2ZI9A 3CUKA 4KACA 1R4NA 4TN5A 2JFWA 2PLFA 4IGEA 5LBTA 3PSHA 2ON6A 1E98A 1QIGA 2B9VA 3PP8A 4RFSB 2QUBA 3ZVLA 2LDBA 4BO9A 4HRYA 1HY3A 5BORA 5J23A 5IN5A 1VPVA 4WDRA 5A03A 1E5TA 1RC8A 5H81A 4X92A 4ZAXA 4F5EA 2CV1A 1I2CA 2ROQA 4YDRA 4BQOA 3NRZA 3AUXA 2JLUA 1ZCFA 3OCUA 3B1KA 3DLCA 3I8OA 3VZPA 2BMDA 4KLFA 1WXHA 6REQB 1XLTA 4JLWA 2H16A 3GN2A 1P6XA 1C9NA 4J16A 3FWNA 5C5IA 1O9HA 4UDYX 4DQPA 4TLBA 4PIPA 4D6YA 1FU8A 3D3JA 3WGTA 1ANKA 1X86B 3A4IA 2Q1YA 2W2XA 3P4YA 4ALIA 1RVV1 2FMUA 2IT1A 2LIPA 3F4LA 1FXSA 2PGJA 1FUKA 3F97A 8ICOA 4GPEA 2I7VA 2CN1A 1X0XA 3U3KA 1UADA 1HQYE 4QIWF 1JIJA 1Z17A 5SY4A 1ECJA 4GT1A 5L1KA 5ALKA 4ZT7A 2LKDA 1M5UA 5EHXA 3GRYA 1YZQA 1VPLA 2FG6C 4Q7JB 3UQYS 5HDBB 3T5DA 4M98A 4DLBA 1UCVA 2NQ2C 4GUDA 3NRCA 4BB5A 1BE6A 2BEKA 2AZMA 1PJ2A 1WQ4A 3DM5A 2BM0A 3NM4A 3KJFA 4FN4A 5DIZA 4A73A 5EE1A 1R6AA 3AERA 1T9ZA 1SEVA 3P5SA 4BMZA 4C4PA 1XLTC 5CEHA 1Q44A 5AJUA 5TR9A 1QX4A 3SXPA 1VG8A 1EFRD 1NT2A 1N57A 2E4WA 1H5UA 1S02A 1EHIA 3GD5A 3IUNA 4ALKA 2V98A