4FE3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with uridinine monophosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structural Basis of Substrate Specificity and Selectivity of Murine Cytosolic 5'-Nucleotidase III.
pubmed doi rcsb
source organism Mus musculus
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fe3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4fe3A01
5ALRA 4OFZA 5AI9A 3WKDA 3NASA 1Z4MA 5AM4A 2NO4A 4CNQA 4C4SA 5AKKA 4FYPA 2DQSA 2IA5A 2O9JA 3HYCA 1JUDA 4BX0A 5T41A 4F72A 4FFDA 2I6XA 1RC8A 3SLRA 2D2VA 4H1WA 2GHQA 2WF9A 1KYTA 4HGPA 1Z4KA 2EAUA 1RRCA 1SWVA 1LVHA 2CFRA 3IRUA 4DW8A 4NWIA 3U7FB 4QQFA 2HCFA 1O03A 2OBBA 2GMWA 3N1UA 2HI0A 2YN4A 2ODAA 4MWOA 2W43A 3WKBA 1CQZA 2ZBFA 3UM9A 4UMVA 2HSZA 2NO5A 3ET5A 4KNWA 2JAUA 3VAYA 2B8EA 5AKYA 5AVTA 1T5TA 3PDWA 4KN8A 1Z4NA 2B1QA 3SF0A 3L8GA 4HGNA 3MC1A 2C8KA 5AW1A 3WK8A 2YJ3A 3KZXA 1Z4QA 3FPSA 2BDEA 3ESRA 5ALFA 5AM0A 3A3YA 1Z4JA 5AI4A 4ZEXA 4F71A 5AW2A 3K1ZA 3SKYA 2WF7A 2ZBDA 2YJ4A 4O8CA 1U7PA 2G09A 2MSNA 4BKMA 3U13A 5AVXA 3L8FA 1K1EA 2YMMA 3QU2A 1Z88A 5AIAA 2Q4RA 3ZVNA 5ALWA 3OCYA 4UM5A 3BA6A 4HGOA 2HOQA 3DV9A 1YNSA 2HDOA 3QLEA 3OCXA 3ED5A 1ZS9A 5ALVA 3E8MA 4AP9A 4E88A 4GXTA 3KOOA 3M1YA 3DAOA 3DNPA 5ALTA 4UM7A 2FPRA 4JB3A 1NF2A 1L6RA 3QUBA 3E58A 1RDFA 3QXGA 2RAVA 3W5AA 4Y2SA 1TJ3A 3J7TA 2IOFA 5AW9A 4YCMA 1EK2A 1QH9A 2ZBEA 3ZVMA 3AR2A 4I9FA 3ZX4A 3F9RA 1WVIA 4Y2JA 3NRJA 2I7DA 5E0OA 3QX7A 2R8XA 2R8ZA 1TJ5A 3ZUPA 4BX2A 3WK4A 3N8GA 1WPGA 1ZJJA 2I55A 4I9GA 4EENA 3QU5A 4CF4A 2WF5A 5AW0A 3ZTWA 5AKJA 4ZEWA 1PW5A 3W5DA 4FE3A 1Z4OA 3U7HB 1T5SA 5ALHA 3QNMA 4EEKA 2I54A 4YIKA 1VJ5A 2GO7A 5ALLA 1AQ6A 3I76A 2WFAA 4XOUA 3AR8A 3I28A 4XPZA 2HF7A 3KD3A 5AM2A 5AKLA 2P11A 3IB6A 3R4CA 2YJ6A 2MU1A 1QQ5A 4UAUA 1RQLA 3AR3A 3KBBA 2CFTA 3U7EB 2WF8A 3CNHA 2RARA 1RLOA 2JGAA 5ALXA 4HYTA 2FUCA 4CF5A 3WK5A 1TA0A 5AM5A 4Y2XA 4C4TA 2I34A 2P9JA 2R8EA 4YCNA 3QUTA 2AMYA 1XPJA 4Y2RA 3WK7A 3DDHA 3FVVA 1TJ4A 3KDPA 4UW9A 4HGRA 2P27A 3N5KA 2Q5EA 3WKCA 1RMQA 3OTQA 2QYHA 2B8JA 4HGQA 5ALQA 3AR7A 4KNVA 3RFUA 5AKHA 4OHFA 1Z4PX 2YBDA 4UMDA 3AR9A 4L6CA 2HHLA 4RESA 1N9KA 1L8LA 2C8LA 5ALYA 2YJ5A 2VKQA 5AW6A 1RPZA 2WM8A 5AI5A 4KYTA 2YFYA 2G07A 5AM3A 2OA0A 3L8HA 4KX3A 5AI6A 3HLTA 2G08A 3QGMA 3BWVA 3AR6A 3ZVLA 1FEZA 3FZQA 1O08A 1J97A 4JDPA 1CR6A 4NAVA 5AVYA 3NANA 3L0YA 3WGUA 4ZEVA 5A3RA 5AK4A 4L57A 2HO4A 3B9RA 1ZRMA 4CE6A 4OCZA 3FM9A 5AK6A 2OM6A 5IS2A 1Q91A 5AW7A 5AIBA 2RB5A 5ALZA 2ZG6A 3UMCA 3OCZA 3L8EA 5AW3A 2Q4TA 4BEWA 3L0CA 4EZEA 3UMGA 4YGYA 3ZX5A 2FDRA 5AHXA 3ZU6A 3QUQA 3PCTA 2JAOA 5ALSA 2ZOSA 1YV9A 4Y2TA 2OYCA 5ALGA 1X42A 3IJ5A 2BDUA 4EX7A 5AVUA 3KC2A 2FPUA 1YMQA 4GIBA 1ZD2P 2W11A 3SMVA 4YCLA 1QYIA 2NYVA 5A3QA 2O2XA 3QU4A 3FGOA 2G0AA 4UU1A 1RKQA 3SD7A 3ZI4A 1YJ5A 1XVIA 3NALA 4YH1A 4DCCA 3ET4A 4UATA 5IT4A 5AKEA 3SKXA 3NAMA 2GFHA 3I6BA 2G06A 3GYGA 2EATA 4RETA 5ALPA 2YMLA 5AICA 2EARA 1SWWA 1RKVA 2FI1A 3ZW7A 2FPXA 4Y2YA 3ZTYA 4DWOA 1F5SA 2WF6A 3R9KA 1WR8A 3OCVA 4Y3UA 1LTQA 1QQ7A 2ZBGA 4Y2VA 3ONNA 5AW5A 2C9MA 5AVVA 2G1AA 2HEGA 4MUMA 4NV0A 1J8DA 5AVRA 3A1EA 2YMQA 5ALEA 4BX3A 4G63A 3L7YA 5ALIA 1YS9A 4NABA 3EF1A 3AR4A 4B6JA 4YIHA 3N28A 2IOHA 3EPRA 2AH5A 2HF2A 3P96A 1T9ZA 3PGLA 5AI0A 3SHQA 2AGVA 2G80A 4HAIA 1YDFA 1Z4IA 3NIWA 2FPWA 1NNLA 3MPOA 3QU9A 2PR7A 4IG4A 1L7MA 4EX6A 2WHEA 2B0CA 4UMFA 5ALUA 3EWIA 3QYPA 2B1RA 5AK5A 1S8OA 3N07A 1S2OA 3AR5A 4UU0A 1L7NA 5AKGA 2AUTA 3FPBA 4BYGA 1N8NA 3CZ4A 4AS3A 1IWOA 3OCUA 1U02A 4DFDA 5ALJA 2RBKA 3D6JA 3QUCA 5AK3A 5ALDA 1XP5A 1SU4A 1L7PA 1U7OA 3ZWDA 3ZWKA 5AVWA 1NRWA 1EK1A 2FPSA 4UMEA 1ZRNA 4Y2PA 3WK6A 4BEVA 4BNDB 3ESQA 3UMBA 1Q92A 2IYEA 5AI8A 3S6JA 4OD0A 4AS2A 2P69A 3L0BA 5A3SA 3B8EA 3U26A 3EF0A 2GHTA 4C4RA 3MN1A 4CF3A 1RQNA 1VJRA 3E84A 5AW4A 4UAVA 4PNHA 1TE2A 2JAWA 3W5BA 3M9LA 5ALOA 3A1DA 5FP0A 5JJBA 5AKIA 3WKAA 2C4NA 3WGVA 1Z4LA 3E81A 4KX5A 2R8YA 1Z5GA 2PKEA 1RMYA 3L1UA 4BNDA 3OCWA 1RKUA 1ZD4A 1ZD5A 3U19A 1ZOLA 1U2SA 2FUEA 2ZXEA 4QJBA 2I33A 4J2TA 3OPXA 5ALKA 3R09A 1RLTA 4XE5A 3PGVA 4XQ0A 5AKXA 5ALNA 2YY6A 1U2TA 2QLTA 2YMPA 2CN1A 2HX1A 5AW8A 2C88A 1MH9A 1RLMA 5AVSA 2IOFK 5AESA 4J03A 3I1YA 5ALMA 4EELA 3B9BA 1WZCA 3L5KA 3WK9A 4Y2UA 1L7OA 5AM1A 1QQ6A 1ZD3A 4L6AA 1VFPA 2JARA 2X4DA 4NFLA 2B82A 3NUQA 3U7GA 2CFSA 4IFTA 1L8OA 3WKEA 5IT0A 3MMZA 5AKZA 2FEAA 3A1CA 4UASA 2B30A 3QU7A 2PQ0A 5AVZA 2BY4A 1Z5UA 3W5CA 3L1VA 4BBJA 3TLMA 5AVQA 1RMTA 4UARA 4Y2QA 1Y8AA 2W4MA 4G9BA 3RF6A
chains in the Genus database with same CATH superfamily
4AX8A 4D9HA 3ZHXA 5ILQA 2M32A 3DDCA 1I80A 4BNWA 3SQOA 3PUKA 1JR6A 5LMUB 2DH6A 1WMBA 2XVXA 3IHKA 1DEXA 3FWYA 4LZJA 1UK8A 2VDNB 4NYIQ 4CW7A 1YRAA 4G5YA 5M29A 3K0AA 2J07A 2OEHA 2IXAA 1QG0A 3WJ2A 1WNTA 3IDAA 3C6KA 1NN1A 4J0KA 4GYKA 2YJ4A 1UANA 3EZ5A 3O4IA 3LC2O 3T0IA 1N3LA 1RTKA 2F90A 5SY4A 5DW3A 4ZVQA 4IAOA 2VLIA 5CA0F 1RS0A 4MR7B 3IQWA 3GOQA 1Y4AE 5BRJA 2A19A 2C8JA 3DM5A 4PO3X 3T5BA 1WVIA 1G41A 2ABWA 3QPAA 3CE6A 3EIUA 3SZOA 3L02A 4R5HA 2O8BA 4RQ2A 1OX6A 1LWOA 2X8JB 3HE3A 1NDUA 4HAUA 4JGIA 3QU5A 1VKOA 4DEZA 1A97A 1RYDA 5L3QB 4OQDA 2AMVA 1EK5A 1T3SA 3GK3A 3CG0A 5C53B 5E38A 1KRPA 2BUBA 3OQBA 2H48A 3GJSA 4GNRA 4RMJA 2LUOA 2JI8A 3ZDAA 3NWPA 4B44A 5AM5A 1QPBA 2GCPA 4PAWA 5C8VA 1U11A 2RGGA 2NXNA 1V47A 3MINB 1XD9A 1GEEA 2HZ7A 2ZI4A 3V1TC 5KS2A 3SK0A 3CLTC 4OHBA 5L1LA 5AHOA 3ADBA 4NL4H 2I7CA 1G3QA 4ECRA 2KI5A 3ZWPA 5I7OA 3DJFA 4X65B 1SVMA 1L4GA 4B4DA 2FPMA 2H4FA 5JAQA 4Q4AA 121PA 3BZWA 2W2KB 2XOKA 4HWOA 2JLAA 4RSRA 2X58A 4ZVSA 3QLUC 1GTRA 2FTKE 2Z6VA 4WLUA 4DL6A 4NEQA 1TYAE 2BR5A 5EESA 3KQPA 1ODFA 1CUHA 3K6SA 2ZIXB 1MPXA 3VA7A 1BS9A 1X3SA 2VH2A 1R5BA 2EP8A 2IWHA 4GPTA 1HE3A 1LZKA 3PY8A 1TPZA 1MP0A 4LSGA 4JV2A 3HWRA 1L9XA 4HUTA 4RGQA 3WYCA 5JEDA 1AKQA 1S0UA 3IE0A 1E2DA 1AJEA 4AMYA 3GZJA 1VIDA 3ANSA 2K4HA 1MORA 1KOGA 2WJPA 1ZGJA 4MV5A 1Y8QA 4J90A 1I2BA 1BMFA 3PGKA 3BE5A 4OO3A 3KHLA 1AKMA 3DBHB 4LHXA 3PITA 2A86A 3E3MA 1E3WB 3DEKA 3KT6A 4V0SA 3MCZA 2IVFA 4KPEC 4C3OB 2PRKA 1ZZEA 3DP7A 4W6ZA 4IDPA 3HP4A 2W4QA 5LLDA 2FPGB 1QP0A 2B3TA 4TKLA 4P93A 1R8SA 4K0RA 2JB9A 4NM1A 2Y2VA 1D7OA 5A03A 1T13A 1A7JA 1OW3B 4KKVA 4F3TA 5KNBD 4UNRA 521PA 3K94A 2REQB 3R41A 3LYAA 3NWEA 1WSAA 4HQKA 3CF6R 4GI7A 4LRTB 1N6IA 3BZKA 5CGZA 1OXJA 3A4MA 2QTFA 1GVNB 4DIFA 4O2BB 3WFJA 4E09A 1C3JA 3RBDA 2DFVA 3X43A 4D79A 2DLNA 4MDYA 4YRLA 4CV1A 1ZYQA 2Q1TA 1J2UA 4XCQA 3GDOA 4X5OA 4LGYA 2PUDA 2MDTA 1X70A 2ISSD 4XVUA 1OZGA 2LBPA 1DS6A 1BQ3A 1IB0A 1V5FA 1W0KD 5J1SB 1STOA 1KL7A 1GYPA 3HKCB 1FLNA 1GUAA 4U0JA 2V0CA 4YX9A 5FIUA 2QUZA 1Z17A 3DVQX 2AI3A 4L9WA 1KVRA 4J0GA 4AN0A 1Y1PA 2FX2A 2ZI3A 2YIVX 4GZMA 1LSUA 4QXMA 3IO5A 4FWTA 3WLNA 3QRWA 5EE0A 1UPHA 3NB0A 4DDKA 3C1AA 1HLGA 2M1ZA 1UFOA 3UFXB 2PU7A 3CUYA 4HRYA 3AVVA 3OZVA 1RXSA 3A9SA 3CBQA 4TRMA 3UM9A 4YAFA 3Q7EA 1L4BA 4BRWA 4FJ2A 3W1WA 1R6XA 2GAFA 4E07A 1RYHA 5JJLA 3SY8A 2VH5R 4LF7B 3C6BA 2WYIA 4K3VA 4KE7A 3NIFB 4CT4B 4AG6A 1ZMOA 1UOEA 4G5HA 1GXSA 2QOEA 1L6RA 4MUJA 3PC8A 1RFLA 2EL7A 4AWAA 4DFMA 1QIIA 4M55A 4GG1A 3ZVMA 4K9SA 4QQRA 1XEWX 2XI9A 2F3QA 4DJFC 4O2BF 3QF4B 4ZA2A 4RKQA 4GGPA 2PI4A 1MQSA 5C3MA 3SJZA 4YXWD 2GAIA 1AC5A 2AGQA 1EGVB 4KGVA 2HSWA 1P39A 2AG5A 3GRKA 4HJRA 3GPCA 3Q9UA 2FR8A 4HX2A 4MICA 3L8DA 4QFDA 3AUYA 3FJ1A 3LOUA 2QPLA 1IC6A 3MFHA 2AZMA 1KRXA 3EZ9A 5CHEA 3RHFA 4C89A 3OF2A 3P5SA 3BBLA 1UAYA 2JEYA 4AO6A 3SXJA 4WK4B 1SUAA 3OEEA 3OVMA 1B16A 1QRRA 3VC3A 4YV1A 3RUCA 3QEMA 1QXSA 1A95A 4PYJA 1R3DA 1CG6A 5JXGA 4HK4A 2NMVA 3HSKA 3V8RA 1E0SA 4JQSA 3FUTA 1AQUA 4AO8A 5JDCA 2WAAA 3P19A 4G23A 1VHLA 2IBKA 1GADO 1XCOA 2E8MA 5DB7A 2Q7DA 1G5FA 4H6VA 1G21A 4E5NA 1F0NA 2DUMA 5BQ3A 1E5LA 5AVYA 3PX0A 1OLOA 2IKSA 2BQ3A 4PR0A 4L5IA 1DJLA 4JK1A 1NXPA 4J1NA 1A9ZA 3F7MA 5AHXA 5A9TA 5ALGA 1X42A 1KEZA 4G07A 3GDHA 3M49A 3FTEA 5EINA 1GPMA 2IW3A 4HEA1 2JLCA 3CJTA 2I7XA 2Q5CA 2PGOA 3HB5X 1DIHA 1VCMA 1DAHA 4L74A 4EGJA 1RYRA 4ZWNA 2VHCA 3BMCA 1ULAA 3KTDA 2ZM6B 4HY3A 2IH2A 2CXSA 2AWNA 1GHTA 1Y5IA 1DELA 3PMNA 3LRPA 4B9MA 3FHCB 5K0GA 1N7HA 4YRKA 3ZWOA 2OO5A 3VZQA 3ZZUA 3GEBA 4D25A 3PE3A 3JPQA 1IHXA 4GZ6A 1UC8A 5F2KA 5JPCA 2YMQA 1DLJA 1VE1A 1W2HA 1OA1A 5ALIA 4Z4QA 1AB5A 3A0RB 1JSZA 1L5GB 3PNKA 3KTAA 5K9ZA 2J4FA 4JBIA 5HKOA 1W88A 2F55A 3B3JA 3I2GA 3KL4A 5GJVC 1RCUA 3BMXA 5H3HA 1E9DA 3GCGA 2OHVA 2WJYA 5JCOC 2IIVA 1YS1X 3AR5A 5CD1A 4AD8A 3JD1A 4M8SA 2J8ZA 3E7DA 2W6PA 1H4TA 2XB6A 1U02A 3SZRA 3PB3A 2WMDA 1U7OA 3AYZB 4BAUA 2WFMA 2R68A 3BVPA 2IXFA 5COQA 3DNFA 4FFVA 2GPBA 1YC2A 3CKYA 4EGFA 1OI7A 4UBBA 1QX3A 4J9SA 1A4IA 3H0RB 3EQ7A 3EDRA 4R8LA 4DN6A 2Y9PB 2IYXA 1MTOA 2PGJA 1SBCA 2VJPA 1PYOA 1JBKA 3GUVA 4FJ0A 1QGED 3K1TA 4DSTA 4IJ6A 4E5YA 4PPYA 2GN9A 2GZMA 4L5JA 3DMYA 1L5YA 3GV0A 3SHTA 2CN1A 1RCFA 1X7DA 8ICFA 4Q39A 3O2NA 3SMQA 1NTOA 5CLJA 1D8TA 3SX4A 4ETNA 4QJ3A 3NUQA 3D6MA 4OJOA 4RHEA 3OJOA 3EA4A 4N5MA 3GN2A 1SAYA 2PIAA 4YYEA 2J6HA 2H3EA 3HRHA 3NHPA 2OD7A 5FBRB 4WADA 4QUAA 1WDMA 4K86A 2B4KA 3MXOA 4JB8A 4D2IA 5HHTA 2C5HA 3YASA 1Y1KE 2C84A 3KJNA 1DL5A 3IRUA 4A36A 1GITA 1HMYA 2YN4A 1R6VA 1JDBC 1SM4A 5EL0A 5B4VA 4PPNA 1EJ6A 1GVHA 1JEQA 1DIGA 3WL8A 4ZGGA 2Z08A 4MKIA 1Z9BA 4A8JA 2IMWP 1PGJA 4JT9A 1GNLA 1K5PA 1P2UA 1EB8A 1UJCA 1PU2A 3KB6A 4QU5A 3Q3GE 2ZITA 2HSGA 5AHRA 4BFUA 1W94A 3LPDA 3V8PA 4ILKA 2EFGA 4NDNE 4KN7A 3TQCA 2Z5FA 3HGQA 3C6ZA 4LHZA 2VJQA 7GPBA 4ZIRB 4YRAA 4MHSA 1RJWA 3THWB 1SK9A 5LL6P 1NUHA 3DL2A 1JDBB 2VP0A 3M4JA 1RWXA 2O2SA 3H2SA 1XWFA 3OX2A 3RC2A 4EB6B 4G9GA 3ZDFA 2Y0SF 4RSHA 1KSPA 2BZ0A 1ZM2A 2CJPA 5HR5A 4ZRNA 2WEKA 4D0RA 4O9MA 1IAVA 1N3IA 3PNSA 4BEBA 2HDNB 3D0QA 2XX3A 2OV2A 1P77A 5HG0A 1AURA 1VJCA 1ZQ9A 3S27A 2ZJAA 4ICAA 3SDBA 3KWJA 3AO0B 3TLKA 2C9BA 4LISA 1L5VA 2JAXA 1W36D 5KQMA 1VGRA 4EJ0A 3EARA 1ONNA 4C5CA 4A27A 4LDNA 5KT2A 4BU0A 1WYGA 1OXUA 4Q1AA 5JNRA 4CCAA 3BIFA 2Q3LA 2R85A 2C7OA 4O2LA 3C3BA 2SCUA 3NFRA 2EX0A 1SKUA 2OYCA 4ZQCB 4CKEA 2QRZA 1LC0A 3ENWA 1P29A 5DM4A 1G6Q1 4F21A 4YD2A 2P5YA 2D6FC 2QTVA 4RPHA 3RQSA 4URUR 1TJYA 3H0LB 2WG0A 3ZN2A 3GYGA 3PD7A 1AKYA 4KLZA 4V1CA 1BVUA 1PR9A 4TSFD 3HJRA 1XJCA 2H2AA 2A35A 3UN1A 1PV4A 4RT2A 3ZZ0A 4Q93A 3Q4GA 3H8SA 1OFUX 1QCKA 3LAWA 1Y1QA 2QY6A 1QANA 3RVOA 2V7UA 3QKRA 3MWEB 1FYXA 5JFGA 4YIHA 1UM9A 2O7RA 4TXHA 3D3EA 4MQFB 2J85A 4IP0A 4XLZA 2PGAA 4IRUB 4HB0A 4O08A 5T5QA 4TMWA 1Q74A 3LKVA 4BRUA 3N7AA 2K7ZA 3H11A 5JRJA 4XGRA 5J3JA 3IUEA 5NULA 2AIRA 1GKIA 3SF8A 5KNBA 4IXWA 5B12A 3V3TA 1A04A 3ETEA 4GO1A 1KSGA 3WA6A 1JQLB 2F00A 4Z9AA 1U8UA 3EQ2A 2PRJA 1OROA 3HWWA 1OBOA 1Q8KA 3VH2A 3WLEA 4FQ5A 4K6FA 1AE1A 4URZR 1SBYA 2ORYA 4IWNA 5GVRA 3UZUA 4BJQA 1NAIA 1R6TA 5ALKA 5DWQA 1NZPA 3JARA 4F2PA 4NICA 2Z98A 3O74A 4PN3A 1U7ZA 3OQ1A 4LA4A 5KCZA 3VPAA 3SYZA 1N2IA 4UPEA 1FFWA 1TAQA 4V0RA 2DEUA 4IRXA 1XQ9A 2B4AA 4OSEA 4M54A 2ZXIA 1RTTA 4URVR 3I3OA 4DQIA 1CFZA 5BYAA 1ZISA 4J16C 4GBGA 1KKMA 3ND8A 4J9OA 1U3TA 1IUKA 2OBFA 2WSYB 2A9VA 4B31A 3ONFA 3KCQA 3QJ5A 3Q8WA 4Q9HA 2RQ5A 3L8ZA 5TS2A 3IHWA 2GBLC 3BERA 2E8PA 1G55A 3EASA 1U90A 1BCSA 3P4YA 4NXMB 3AERA 3K4HA 1I2DA 4NZ9A 5A6SB 1NZDA 3UGKA 3HRDD 1WVGA 1RAGA 5C1DA 2JPDA 4EW3A 4QTYA 2AMLA 3DFKA 4LZWA 4M0DA 4C7ZA 3FPKA 1MJFA 1XROA 3OZUA 1S1CA 4D9MA 3GZFA 2R6CA 1IVSA 1VDVA 3NYQA 4BQEA 1VRCA 4BNLA 3BTOA 3RPEA 4PXAA 1FQKA 1WJGA 2CCJA 2HWYA 2JGFA 3NONA 2RK4A 4PC1A 3F3MA 1LV8A 1Y5LA 2RI0A 3ZX4A 1KY2A 1P62B 3VI4B 3ZWWA 4CG3A 5I3CA 3FTDA 4B8WA 4LW8A 4MW4A 3DMNA 2FPIB 3O8LA 2FLVA 3QEBZ 1QC5B 1R66A 3EXEA 1HEIA 3RRMA 2A9QA 2Q1YA 5K0NA 3N4MB 1G20B 5DTEA 1PBTA 2O6KA 4KGZA 3KD3A 1F8FA 2Q2WA 4IDCA 4H7DA 4M7WA 4LE1A 2ETXA 3N2NA 3STXA 2DPYA 4OX9Y 1W8IA 1YKGA 3RAJA 2QK4A 5ALXA 1ESMA 3DDHA 4AS1A 2EIXA 2J33A 4OI0A 4C8OA 2C7GA 1BN7A 1JSRA 2F2TA 4XGKA 3AP1A 1P1BA 2GCGA 3G0DA 5A2GA 3GLGB 3U3RA 1A76A 3ILSA 1Y8RA 2FPPB 2UVDA 3M6IA 2PRYA 1PGQA 1DWOA 1VECA 1LW6E 4OCZA 1YUBA 4RPXA 3ANLA 5K09A 3GP3A 5LZ7A 5DX8A 5JC1A 5KWIA 3BD9A 3I01M 2QBYA 3HLKA 3RJHA 1NUPA 4WQMA 3KLOA 3VO9A 3OEYA 2GBGA 4C1NA 1SEVA 1T3HA 1A9OA 3OJ0A 5CDYA 3ITKA 3O8CA 4MRNA 1QDEA 1XVIA 1OIVA 1YBFA 2AFVA 2HEIA 2EV9A 4FZRA 4WACA 1HDGO 4LVOA 2XDAA 2W0MA 1Q44A 4ESOA 3IRVA 7ICQA 2BMDA 2G70A 4QU8A 5EKSA 2FNAA 4F5NA 3K2QA 5DG7A 2DQZA 1VJGA 3DDOA 2HIAA 1WLYA 5H80A 4TYPA 1C7IA 2WKQA 4WJKB 2CBZA 1IQUA 3NHUA 5DLFA 2R65A 3G49A 1KQFA 3TI9A 4B83A 5A3JA 3L4SO 4YV7A 3I2JA 1D1PA 4NONA 1BDMA 2OTCA 5KYWA 1KOJA 4RXMA 2YTZA 5K4GA 1NRJB 3ENVA 4BMZA 1BVYF 1ONOA 4PGXA 1YOVB 3NM5A 2VNKA 2QORA 5JHGB 4JWKA 4YFKA 4HYYA 3ANMA 4ZDJA 4EJ2A 2IYOA 4EGAA 5ITZB 4ZOCA 3IUMA 1WG8A 2NAPA 2QAGC 5CTJA 5MGBA 2G40A 2HYDA 3KU1A 4MW6A 2FSPA 3CX8A 5KFKA 3NETA 1QQAA 1JFFA 3EC2A 4PGFA 1GWNA 3WKAA 4PX2A 1G2IA 4FW8A 4F84A 4JY7A 2PKEA 4Z2YA 3PVZA 2WD9A 3V7JA 1M67A 3VNAA 5KFDA 4WY8A 2X8LA 2ZPUA 1YQEA 3QG1A 3QY0A 4LSZA 3T5CA 1VPDA 5D85A 1ORDA 1SKBA 1M2VB 4NU8X 5E8JA 4ND7A 1NW3A 2UUBB 2WTNA 3C8MA 1XC7A 5E9AA 3COSA 5GV8A 2D2IA 3UJDA 1IXZA 3MUNA 4RKWA 4GQBA 4I50B 3EIWA 2J7PD 2VBIA 5BSMA 4O3QA 1VLJA 3OX1A 2XCSB 8ICLA 2X9GA 5BW6B 2BGWA 5CFRA 2AI1A 1UKZA 4MYDA 4QL3A 4JL8A 1IN4A 1O97D 2RG1A 5KFXA 3AMZA 1E66A 4MPDA 5A1JA 1CUKA 3PEYA 1GOTA 4HHEA 3E5RA 2R8JA 4BKMA 1J1ZA 1DKUA 2D1YA 4COKA 1P45A 3RYCA 5LZ2A 2Q3CA 4IHJB 2FSHA 3K35A 4YDSA 3PS9A 4PXYA 3AVYA 4EYEA 5H0IA 1NF2A 1RHQA 5G4KA 2WLSA 3TR6A 1MBZA 1DBQA 3RBVA 5DGXA 3LBAA 2ZP1A 4ZAVA 5JMOA 1FFVA 3L79A 4HH1A 3C5VA 4LNUB 4PZZA 2VL7A 2BBOA 3N8GA 2HM7A 3W7VA 1IUNA 2B6NA 4XB1A 3FYTA 4CIWA 3AHDA 3QNWA 4CM4A 5LQAA 1L6IA 5MN4A 3B6JA 2C5AA 5A5DA 3PHIA 2DLCX 5IJWA 2FX3A 1E2JA 3C21A 4P3NA 1Y7HA 4HI0E 3HY6A 3PGMA 1E5XA 3S29A 3P0RA 4EO4A 3T9EA 2GK3A 2ZYIA 2VRBA 3KDPA 2YCBA 4M88A 3NI2A 2QQEA 3C7CB 4A15A 3CZPA 1Z63A 2C9CA 3FCXA 4BMYA 1AS0A 4FE7A 4I50F 3G2HA 3OBBA 1LY1A 3EZXA 2WTAA 4EFNA 5C5DA 4Y67A 3TH5A 5KVSA 5GJCA 1X1EA 2BMFA 5EWFA 4DAOA 2D7DA 2C1EA 1OFGA 2Q4BA 4FMBB 2GJ9A 3AL0B 2DG2A 3C5GA 3HFGA 2ZRNA 3GL9A 1YU9A 4CZ2A 4B9SA 4M0AA 4FR0A 3LUAA 1GPDG 1RPAA 3EPHA 4O3MA 3VV3A 1RWOA 1ZI6A 1EHCA 2FVXA 3I0ZA 1N34B 1P8AA 2QG6A 3CPJB 3N7SC 1KO1A 2OUKA 5DRYA 5T4HA 2A9KA 2N9UA 4IHJF 3MGIA 4HNRA 4XM2A 3EAGA 4LTMA 3RRGA 1Y1TA 2G0TA 2O2HA 4XRGA 3C3AA 4RHCA 2J3JA 3HDGA 3W6OA 5E6SB 1DK3A 5LXTF 3OCVA 5HBGA 4YWJA 3OZSA 1U1CA 2HA2A 4IQ4A 1OKKD 3DE6X 2HSDA 2HHCA 4AN4A 1BN6A 4AC9A 4G1UC 1VLBA 1YB7A 3OQNA 5TC4A 1AHHA 2C59A 4KQHA 3N28A 4I28A 4KQ9A 3UJAA 5KSPA 4TSRA 2N47A 3QU9A 1NONA 2XYGA 5LQDA 1EVYA 2B0CA 3CEPB 4MV1A 4UREA 4UUPA 3C6XA 2PUGA 2OXRA 3LPCA 4N65A 1RZRA 1WWUA 2GXUA 3OUUA 2VQDA 1KJZA 1GFIA 1SCDA 5KYYA 1YJCA 5SYMA 5DCLA 4ARSA 2JH3A 2YV5A 1E2IA 4W4TA 2RHBA 3OFVA 1XQVA 1WUHS 1YVEI 2R7KA 5IXJA 3WRWA 9ICQA 2XKBA 2N1BA 1ZQBA 2OV4A 3K0BA 3WGNA 5LKRA 3TLBA 1ZIDA 1ZGAA 5F1YA 2E1FA 1I01A 2NXEA 4A5OA 4ZTBA 1ZJMA 1IQRA 1OU4A 4B6SA 3ELDA 5K7SA 8ICGA 3GJ5A 4BNTA 1RWVA 1W5EA 3AU2A 4DLBA 3U44A 2HT1A 5JECA 1LRJA 4HMPA 1DTSA 4OJLA 4KFRA 2PTHA 4IDNA 3D2NA 4LDQA 3JS5A 4UU8A 3RQIA 2JGMA 4JQZA 1ZNXA 1YZYA 2OG1A 1OGJA 5P21A 5AVZA 3FI9A 5I4BA 3FFBA 5DLPA 5ALRA 4ND6A 3CIOA 3I73A 5DDIP 1P1CA 2J59A 2WJ3A 2DULA 9ICPA 1J0BA 4IH9A 1PK7A 4PZEA 1E77A 2QG9A 4JOSA 2QVZX 1J24A 3GVIA 4YBRA 2ORED 5HF9A 3R5HA 3L7LA 1UWKA 2NZWA 3OZRA 4JZKA 5BOVA 3GBSA 4DLYA 2CMFA 1NOKA 2P5SA 1JDUA 1FP2A 4GRDA 2XOKD 1PR3A 1ZN7A 2FRDA 3FCOA 5BPHA 4UM5A 4QJ5A 3DZKA 1PX0A 1RM6C 3GQVA 1A9XB 4G84A 4WKNA 4OBBA 4E3ZA 4M0MA 1NFQA 3O75A 4HN2A 3AF5A 1H69A 1T36A 1L1EA 3G6YA 4YCSA 1KY4A 3S2IA 4P4NA 3C6YA 1J8FA 3U61B 2W2TA 3MCWA 3DDWA 1U8XX 4P7JA 1LV5A 4IV0A 3EXFB 3K1AB 3WSVA 1QRSA 4K6MA 3GLFB 4GU5A 3D43A 1A8QA 1VL8A 3K30A 2ZRQA 1DXQA 4F4HA 1ENOA 2C2BA 5D4BA 4UFPA 3PC3A 1YSCA 3PFBA 1E3IA 5LUBA 5LC1A 3NRWA 3O93A 1BMFD 3T9CA 4ZYTA 3DDZX 3ZCRA 3NU1A 2WIDA 2GVNA 4DNOA 5T3YA 4EJSA 5KAIU 2FG6C 2DERA 3IDSA 1KDTA 2X2EA 5I9IA 3Q5DA 1RWQA 3UENA 4P9NA 3PQ7A 4Q9IA 2RK3A 1T2UA 1K7XB 3I6QA 4O63O 3CIFA 1MIHA 4I9HA 3W5HA 2P67A 4M21A 4P4MA 2LM1A 3ICPA 3IAXA 1B6RA 3SYMA 4HAOA 2FETA 2GT1A 1FDVA 4GM0A 1CWUA 1G64A 2D62A 2DBYA 4RSMA 1EEXB 4RA6A 4KLRA 2M6KA 2PGXA 1UC5B 1Y8CA 4GLOA 2PIDA 5J2KA 3PDCA 1XMJA 1YJAA 1FFSA 3KQHA 5AOVA 4GLBA 2EQYA 1IPFA 3EVNA 4OJPA 2JANA 3K73O 4RIEA 4ZK6A 1QORA 2XITA 1OTHA 4LBWA 2IYUA 2V7TA 4PGQA 4E2XA 1RPNA 5B58C 4AG3A 4LZNA 5F33A 4DR6B 4B7CA 3UTCA 8ATCA 3KXIA 2FUNB 3JD4A 2JJ1A 2O2ZA 1ZINA 3OI7A 2UZ0A 3WHPA 3LYLA 1ENPA 3CNQS 4Z7JA 2ODQA 4YK7A 4RTSA 4TZKA 3K4QA 3OQJA 3WRXC 1T0PA 1NT2A 3TNYA 2VTVA 1R5NA 1NBAA 7ICUA 3Q2OA 1Q50A 3WVNA 1PP4A 1CR4A 4WXEA 4DFDA 4WDQA 5JWHA 3WNBA 1E1NA 3V55A 2C54A 3G0CA 4JNKA 4CMCA 4NVRA 4NM2A 2ZVJA 3A1TA 2P69A 4KHPB 2WWIA 1Q7RA 4DDMA 3G17A 5ALOA 1CJUC 3AWDA 3N76A 5FJJA 4Z6DA 4OP2A 3PFHA 2HOIA 3T7JA 3ZU4A 2YX1A 4QDUA 1YRBA 5DQIA 3RC8A 5AKXA 4KTVE 4MKXA 2HT6A 3ZV7A 1YULA 1NOIA 1KAGA 5DASA 4UXJA 2PS3A 3OE5A 2OLJA 1FMFA 3JQCA 4UB2A 3GDGA 5AM1A 4EARA 2RHLA 3BJEA 1EWRA 4PICA 3HXKA 5DLGA 5FWXA 1OY1A 2BF4A 1GKKA 1W47A 1JALA 1UPCA 3NBMA 3OEED 4H7HA 4AJOA 5ECYA 2DF8A 1QF7A 1N48A 3N2GA 1K8ZB 1DXSA 1KSFX 1U2EA 4OHPA 2VJMA 4EUSA 5IDXA 3F53A 1F6BA 3NWBA 3GAZA 1DWQA 4RLFA 4QJ4A 3PPYA 3K1RB 4O29A 3WHLA 4KMOB 1OIXA 1SV0C 4R05A 4KN8A 1XAIA 4W7IA 1SL1A 4OKNA 2NYAA 4PCLA 1SD2A 5J2UB 3W90A 1IN1A 3P94A 4IIVA 1WDLA 4OLAA 3C4VA 3ORRA 4B7AA 2PLAA 2AU0A 1XF9A 1TIKA 5CB4A 4OK5A 3QLEA 2DT5A 4RGVA 4EOGA 3MM4A 1YRQA 3U7JA 2BTEA 4MUIA 3QUBA 4B6RA 3WL3A 2F1IA 1O95C 4OYYA 4BX9C 2AA3A 3CE9A 1QU2A 5JALA 4HNAA 4JQOA 2QR3A 2R11A 5FTWA 4LZGA 1YE5A 2FFBA 4PN7A 1O3YA 5AKJA 2XVMA 2MSLA 2UVVA 3EVAA 1X8LA 3OAAA 2XUKA 1CDZA 2GESA 3A27A 4Q44A 2BEVB 2KMDA 1PS0A 1JLLB 4BQNA 1ZEJA 1AZWA 4R0MA 2Y8EA 2E4UA 2C2GA 3H9EO 2GZ2A 5ESDA 2X1HA 4I19A 5G53C 2MAXA 3WK7A 2Q5EA 2EAPA 5M7EA 4B9NA 2QZJA 1A0OA 3IOYA 3FFAA 2BONA 4ZCTA 1PTJA 3V9AA 4GYJA 4MLCA 4F6RB 3FA2A 1OU0A 4I4TB 1GQOA 4GKJB 5GPBA 1VSBA 4MS4A 3K09A 1EFKA 4AMGA 2IXGA 3U16A 3AZPA 4Q4DA 1V7CA 4F3RA 4GFDA 1C7RA 4LEIA 2QT0A 4G01B 2R1UA 5AYVA 4QWBA 5A1TA 1NTRA 3IKVA 4EB0A 2OBLA 3AW9A 2OYYA 3BH7A 4FCCA 4MVCA 5KTKA 2FDCA 2X8BA 2EJWA 4PW0A 3ABQB 2R6ZA 3EIOA 1YBAA 5K0BA 4JUFA 3RFVA 2QL9A 2PM8A 1XNQB 1NE2A 4MUGA 3KPVA 1ZCAA 1AA6A 3DBLB 1GA4A 1X7HA 3JQ8B 3HKZF 1YBHA 1XNJA 1JWAB 2VP5A 4W5NA 4U7HA 3GMSA 2IXEA 5CLIA 2J3EA 4JDUA 4L0DA 5JD6A 4KWCA 4HRAA 4K7JA 2QL6A 2Z1NA 3AR4A 3PXBA 2AOXA 1MQ3A 2V4QA 4H16A 1WDWB 4RPJA 3SHQA 1H6CA 5FTJA 4HAIA 2CUKA 1G6KA 4QFMA 3IQDB 1QIDA 4ICIA 4LNHA 2I2AA 3VOTA 1T2EA 1U65A 2C2RA 1XZDA 1WCIA 1E9EA 3KQQA 5DT2A 5I01A 4ZVMA 4EYGA 4QTUB 4QUEA 1QLWA 3ZDQA 3TZLA 2ZUFA 4G97A 4PQGA 3NHLA 1N56A 5EIAA 4QZVA 3DEJA 4RDIA 2R0QC 3R3UA 3C7AA 5EZYF 4K6CA 1GZ4A 3AHGA 5SZKB 5CVVA 2YQ5A 4KODA 4NHEA 3LCVB 4Y9DA 4BQOA 1QOQB 4WNAA 3V6JA 4D5GA 1WPQA 4GEGA 1R6DA 2VFAA 4BNIA 3DZCA 4BRZA 2O8DA 4PE5B 4WGFA 1QHGA 1ZXXA 2ASLA 1NLMA 1VL5A 4XX0B 4BNDA 3O1LA 4PLTA 3MGBA 1U4NA 3JQPA 3N9IA 1BQ4A 2Y1DA 5ARDA 1XZHA 1K4KA 4ZT4A 3SZUA 1ESNA 4JXXA 4N6OA 2AD1A 3QE9Y 3BT7A 2Q3JA 1EBFA 3PUIA 2FH5B 1NQVA 2HLHA 1XA4A 4WBSA 5E1OA 4DQDA 3Q40A 2XJ9A 3HFJA 3TBKA 1I7SB 1XCMA 4CTJA 3WBKA 4NNOA 3OJEA 4RTPA 1N32B 3UJPA 1LDBA 4JC0A 2I29A 1E0KA 3SLRA 5BSTA 3A6DA 5C35A 3KEGA 1WU7A 5A7HA 1Z4KA 2PWPA 4CUKA 3U7FB 2QU7A 2XW6A 1YKSA 2XMCA 3VHLB 4RUCA 2FJUA 3VX4A 4ESVA 3CR3C 3HUTA 2XRYA 5EJ4A 1D1TA 4TMYA 2QN1A 4M9HA 3A2LA 5AOBA 3IG8A 3SC3A 3ZDBA 2O7QA 4F7WA 3U13A 4E5KA 5TLSA 5LD2C 4ZO6A 3DLBA 1V8FA 1PWYE 3F4BA 3QQPA 4YN4A 1GPNA 4DMCA 4KQ1A 4WDRA 3T7KA 4ZKEA 1TQ2A 4O1IA 1SZJG 4UCFA 1QP7A 4DRXB 2CXXA 5CCDA 4BLSA 1B0AA 5EZQA 1AQLA 2ZATA 3AHIA 3LBYA 4BB5A 4N0QA 3C3EA 3RH5A 3O9ZA 2PA3A 1K5HA 1Z2OX 3H42B 4WRRA 3KUUA 4MGYR 3THOA 5KNDA 4EY5A 2NNWB 1QIHA 1LRKA 5PNTA 4XUEA 5HS4A 1MU0A 5FL3A 4BMXA 3ZY4A 4R0VA 4KP7A 1Q19A 4MV8A 3MJDA 1E4EB 3MTJA 2Z8ZA 3PE4A 2P40A 1KMNA 4HLNA 3KKLA 4IIBA 2QVBA 1NM5C 3F2BA 2P9TA 4TS9A 3AFIA 2VP4A 3RTBA 4S1OA 2PO5A 4OHKA 2QRQA 4XWKA 4Y2XA 2IJGX 5EYPB 3GVCA 1X9XA 2R4TA 1IXKA 1DOAA 3FUXA 2OGTA 3I42A 4DPLA 3THXA 1W6UA 1XCLA 4TMKA 1KGDA 2FLKA 3GIMA 5FADA 3TNDA 2C0PA 1YIDA 1RPZA 3VMMA 2YFYA 5JARA 3HACA 3L46A 4D9FA 1W52X 2IHYA 4DV5B 2OBYA 2XWQA 4Q9AA 1XZMA 4N0EA 4M0FA 3QWHA 3TB4A 3HCBA 3OWOA 2NO6A 3TX6A 2ZG6A 4MRMA 2XNHA 2O23A 4V3CA 1W8DA 2Q9UA 3O38A 3KC2A 3I92A 1UT8A 4EBBA 3LQ2A 3T7DA 5FORA 5KJEA 2VT3A 3QLTA 3W9SA 1F0YA 2V7BA 3EFOA 4ND4A 5IPFA 4Y9UA 3QBEA 4TWRA 1NN0A 2J9FB 3B3GA 3QV1A 4R3NA 1E2NA 4EL0A 4TWBA 1G8HA 4IYRA 1V4VA 3WISA 7ICNA 4M8IA 4RH3A 5CNIA 1AUVA 5IBRA 3SQWA 4WMLA 3M2PA 3LXXA 3I12A 4RY9A 5DBEX 4ENTA 3DMTA 5JQGB 2A9JA 3GMDA 2G17A 1OYOA 5C8YB 4MUMA 2G7ZA 3G8DA 4NU6A 1NW4A 5DNAA 3V8VA 3LHFA 3ITNA 1X7YA 4NOKA 5FOXA 3CWZA 4ALIA 2ZB4A 1DE0A 1P5ZB 2IODA 3GNLA 1MEOA 2IF2A 4HS9A 5JIBA 5DWDA 2FZVA 3K0CC 5REQA 4CKXA 4YI5A 2BPFA 1ZUNA 5FNVB 4AUEA 5HCNA 1TZBA 2CLSA 4J0JA 1PT5A 1FE8A 3TADC 4RIHA 1SU8A 5FWYB 4V2IA 4M53A 4ZOLB 4I55A 1YL7A 3B8EA 4IQGA 3BXXA 2PMDA 1TKCA 4F96A 4XSGA 1G8SA 5B4TA 2XB8A 4JBLA 5KFQA 4TTPA 2HF8A 4R98A 2WD8A 2OZVA 1NF9A 2GI4A 3ZCSA 3PKJA 3H0MB 1XZJA 4J07A 1OLUB 1OH6A 2OXCA 3FHOA 2VQEB 2PZFA 1AA9A 1XLTC 3I62A 3R23A 1ZK4A 3OZBA 1CNFA 2PLFA 2KHQA 1H1TA 1CUFA 2BFOA 3BCHA 1H05A 2C9YA 5KG7A 2YQZA 4GOXA 1NR1A 5K0EA 1KRHA 1RIIA 1Y4DE 1UMDB 3UPUA 2ZRLA 4MUHA 4B4WA 1F0PA 4CN9A 1M1NB 2PSSA 1PJ8A 1EFDN 1OE0A 3H4BA 3A1CA 2HU5A 5J2BA 1T2VA 5IJ0A 2RE8A 2FK8A 5JQGF 5C8YF 3AQIA 4B80A 3PHHA 5EMLA 3UQ2A 2XMSA 7ICIA 4ZT3A 1JDPA 2P2GA 2FMQA 4QQFA 1Y3AA 2OBBA 3BJRA 3UHOA 5IK2A 4JUBA 3ZU5A 1G3MA 3P2YA 2H31A 1RHUA 4Q3LA 3D4BA 2JK0A 1QLNA 1OZHA 4B4UA 1USWA 4HAVA 2A0UA 2ZJ2A 5FNVF 4BQFA 3L49A 1GZDA 3SJAA 4DSIA 4PAGA 2H6EA 2L18A 1UMBA 3CVWA 4ZOLF 4FYHA 2BZSA 2FPRA 1BDJA 3ANTA 2BFEB 4KDCA 2QNRA 5BRAA 5J0YA 4RFVA 3DOOA 4GDFA 4TL8A 3V8NA 1YQQA 1ZBQA 2HJWA 1UPAA 1KS9A 3P9YA 2JFUA 1GFZA 4PIMA 4EKNB 2EWVA 3KHRA 1T0HB 3P71T 1XRMA 3HQ4O 2CPRA 3O2SB 1AN9A 2TS1A 1F7VA 2QS9A 5KFUA 1WX1A 4RPLA 5BN5B 2QZ4A 4EHLA 2WB2A 2KOBA 4DJJA 3ZK8A 1XTJA 5D01A 1CY4A 3PX2A 3G6WA 3WV4A 5DBBA 4XUGB 3HADA 5G1PA 4NY8A 2OHHA 3DWEX 5CLQA 5CVUA 2Q7OE 5F98A 3JQAA 5E3JA 3P9QA 4L6CA 4TMZA 3RTDA 1N57A 1XN1A 1CJMA 3HBNA 3SAJA 4TM8A 2XZPA 1DVRA 1NPDA 2QUHA 4OMUA 1YZ6A 4KLDA 1IUPA 4LK2A 3NANA 1FFGA 1FY2A 3LPLA 4QUJA 4F4CA 3EYWA 1Q57A 3L8EA 4QUBA 1VYHA 1UDCA 2II6A 1BWSA 2OEPA 3B9QA 4X85A 1OF1A 3G2KA 4LWQA 5KL8B 1WHSA 2Q99A 1QS0A 2IZ1A 1VP3A 2XYHA 3OTHA 4FONA 4QZ8A 5L40A 2WAYA 1SIJA 3RAFC 3CKKA 4UTRA 4XIIA 5LIPA 5ARBA 4P08A 2XGGA 2Y4OA 2H2DA 1FX0B 3B12A 2NRZA 1EX9A 3MGVA 4F3OA 4W9MC 1FDWA 1WZIA 4HR7A 2WICA 5DN6A 4HVLA 1LTQA 5F1PA 5HGJA 2KZ3A 3BFXA 1X9GA 2GOLA 4WOJA 1L7BA 3QLVA 1J8DA 3RADC 1NWHA 2VATA 4MW0A 4QM7A 5EXSA 3HPQA 3P96A 4PX3A 3WNVA 1GZVA 3M0EA 3EPGA 1VQ1A 4P3YA 2X0FA 3RHZA 2PR7A 5BSUA 1SOMA 3OJLA 4TL9A 1MNQA 1WCV1 2KVCA 4ER3A 4PCUA 5CCXA 4NENB 3VU9A 2VS1A 3CEAA 3CPHA 1P81A 3C5HA 4KXNA 1K66A 4IR9A 4RQ5A 1M1ZA 3IT0A 2P9CA 3QMWA 3ZR4B 3IV9A 2COKA 1K68A 3FB1A 4KYVA 3AKEA 3UT5A 2VTDA 2EFYA 2PBZA 2OFOA 4JLAA 2X5JO 2W9CB 3RS0A 1VL6A 4K88A 3V6KA 4RNMA 3GIIA 3PFNA 3SV3A 2IT1A 3HBAA 4RYLA 1U2SA 1N2XA 5LJIA 1D2GA 2XUOA 3ERCA 5IIIA 1P33A 3RYIB 1O6GA 4MUYA 4JJFA 3RYFA 1C8KA 4GMHA 3SIRA 2XB9A 2IH4A 4WK0B 5G41A 1TK8A 4J7UA 1O0SA 3G8AA 3EW7A 4P4SB 1TFRA 1YUMA 4JOCA 3U7GA 2JVIA 5HFAA 2DU8A 4TKUB 5J0TA 3O47A 3HYTA 2CZQA 5FAXA 4QDKA 4FYXA 4B79A 2D59A 3JALB 4XYBA 2Q62A 2GASA 5ALHA 1ZQQA 2GLTA 1X1SA 3GUHA 1OBHA 4DC9A 3A1VA 4CF6A 4IUCS 4F2HA 3ZH9B 4V2UA 1VXRA 3OQPA 3AETA 3H3JA 4JP1A 4K4GA 3FWZA 4DSNA 4RW0A 1KK1A 5BN4B 4EHAA 1CRQA 2C4MA 2W6JA 4O5CA 4DQUA 2VUSA 1MVNA 3HI6A 4OHOA 1Z4QA 3V1NA 4CV2A 4TRRA 4WKBA 2AOVA 1HC7A 1KIFA 4PAMA 3A6EA 1LSSA 2HHHB 1WE2A 1P9OA 4C5BA 2AYYA 1SUEA 5EKXA 1JRPA 2W2NA 3R3XA 5DIFA 4KREA 3WBFA 5IC5A 3PSIA 3W06A 1ECJA 4QYIA 4I4IA 1T6ZA 2YYSA 6REQA 1RDFA 4RHFA 1FNMA 3S0JA 3NYRA 5EIHA 5AW9A 3WMEA 4B9VA 2R96A 3W2FA 3DF7A 4M38A 3B2EA 2JNWA 2W8BA 1ZP6A 5JC8A 2P6NA 2GEFA 3CRQA 2GRUA 3B1FA 4PHTA 3LVWA 2ST1A 4EPWA 2QP9X 3S68A 3PTZA 2OYSA 1OAKA 3VVCA 1OSNA 1Y81A 3AILA 2IGTA 3MTQA 4OMFG 3WS7A 3SI7A 4O3SA 2C95A 1K92A 1XVVA 3SC6A 1QQ5A 1H2ZA 2GYYA 3SAGA 4DLZA 1P8JA 3OD1A 1E20A 1DXHA 5FA5A 1Q16A 3UOAB 3VH4A 4KRGA 3PSAA 4Y2GA 5IKOA 5GTIU 3SZ3A 3FY4A 4XYMA 3JD3A 4ENQA 2PX5A 1COOA 4I5EA 2HJRA 1XQWA 1DRGA 3ZIDA 4JEMA 4A4DA 3ZWBA 2Z5GA 4ZO8A 3KHTA 1KEPA 1RZRD 4QNRA 2YASA 1UFVA 1E2QA 2CF6A 5I8WA 5LDDC 1DARA 2RGEA 1BH2A 3CRVA 4BC1A 2H1IA 4LN1A 3FM9A 2CYBA 1E61A 3EGDA 2O7NA 5DNUA 1SL2A 1T94A 4ER0A 1ZXBA 3ZX5A 5B3LA 2QM3A 3X3HA 4GX1A 4KH1A 5EHIA 4H1HA 4KPUB 1FXSA 1UZMA 4KLGA 4TTIA 4Q18A 5FQOA 1BPYA 3L43A 4YH1A 4B82A 1ZQHA 2ZYTX 4KHZA 3HR7A 4NL9C 4EH1A 4OXNA 2M0NA 1TAHA 5JFOA 3SBEA 1FTYA 1CUEA 1V5WA 1BMDA 1HY3A 2ZIVA 4XA8A 4JGGA 4YUYA 3TLCA 1LQTA 4TKZA 5C2JB 4RJIA 3TW4A 1JROA 3A32A 4RUAA 3SU8A 2HEGA 4KAXA 4TRJA 4PYOA 2H07A 1BXRA 4B3JA 3NCTA 1ZVKA 1DDGA 1LBHA 1VB3A 1UIRA 3IX7A 4TTJA 2JHPA 3EA0A 3EPRA 3FRIA 4EM6A 2FWMX 4D4LA 1TTPB 5KYXA 3R0IA 5TMBA 1XU4A 3I8SA 4V1CI 3O1JC 1SKYE 5GINE 4UCQA 1JLMA 4JFRA 5E6UA 3U3MA 3N39C 4G8BA 3A25A 3QELB 1DCMA 1FNNA 5EZ5A 1S3SA 3R9IA 4MRPA 3NAGA 4CLXA 4I1UA 3KZKA 2SKEA 3MD9A 3GRAA 1XLUA 4ZJYA 1NC3A 3U4GA 2O8CA 2E82A 4XASA 5FUMA 1AROP 3P9XA 4WZAE 1HEKA 3JQGA 4I6JA 2EKQA 2JAWA 3JWJA 3VOSA 3JASB 4IQVA 5AVKA 2D2FA 4C30A 4YI3A 3TLGA 1NYLA 2V4ZA 1O87A 3IVGA 1WS6A 1POXA 5FTMA 5EP4A 1R4NB 1XXHB 4MFAA 4M2LA 4RHYA 5EE3A 3OCWA 3FWHA 4X90A 3FUVA 2WVAA 1VE5A 2ZULA 2GPNA 2GD0A 1ND5A 2FQ1A 5L9AA 2BD0A 1K75A 1VE6A 3HJGA 1FSFA 2R00A 1D0IA 1YGPA 2YUTA 4EMTA 1P80A 4F06A 3EGWA 1JDTA 4RJ2A 1ODCA 2BP7A 5FBWB 3DE5X 3CONA 2VKTA 3QMPA 5HQ3A 1EVEA 3L7CA 3MMPA 4DXDA 1U8ZA 1S2LA 2FWBA 1H6DA 5AM4A 4CNQA 5JUMA 3ZCQA 3KYCA 4BTEA 3RAQA 1WU8A 3ZD7A 2QZ9A 5EJGA 4H1WA 5BMVB 4YJ3A 4QOEA 3BM5A 3G7UA 1KK2A 4FX5A 4X95A 4RZRA 4DMFA 2WZBA 2C0CA 1E4YA 3WB0A 4R65A 5D7NA 2UUCB 5B7QA 1SB3C 3FMPB 3ZD9A 5AW2A 3IT2A 2ZBDA 1V5GA 3SSOA 4Q1BA 2PFGA 2Z04A 4YEDA 3DPUA 1GAJA 3B60A 1NJSA 1UBUS 3WIBA 4N8SA 3E4DA 2C4VA 4HDMB 1BNOA 3CW9A 4DC1A 3DFZA 3T7SA 2H16A 1NVEA 2PZAA 4AJPA 4WVFA 1EFPA 4OMCA 4BPRA 3DO8A 5EIBD 4M7PA 4IR1A 2JGDA 4R2JA 4P0QA 2GYUA 2W98A 3MNFA 1GZUA 1LGYA 3ZKWB 3T7IA 1WBDA 1XNRB 4KN9S 3H1TA 3FVTA 2I87A 2P9QA 4RDCA 4KBYA 1KBOA 3KXPA 4GPBA 3KE9A 2Y0DA 3T5GA 1YT3A 2BI8A 3MAJA 3RS3A 2JJ1D 4F5RA 2H1CA 2GZSA 5DWVA 1SBQA 2N46A 1Z5NA 5DNVA 4LV6A 1H1LA 1RCTE 5IABA 1H4SA 2Q5FA 3AR9A 1WHTA 5CMLA 3C3JA 5JASA 1PYDA 2C1ZA 4FYYA 4HDKB 3RB6A 1X87A 3HLTA 2Q3HA 2KHZA 3RS2A 3B52X 3H9CA 5KFAA 2CNKA 1Z5PA 2AGOA 2HA6A 2WNHA 5T4FA 3FCCA 2G4VA 4RVFA 3M89A 4XWYA 4QTXA 2ZIUB 4OHYA 3PGXA 3WGGA 3DFFA 3N0RA 5AVUA 1Y8ZA 2ECKA 4ZZ0A 1XGKA 2O52A 2UVPB 4Z0HO 1UJMA 5EZSA 3EVBA 4FB4A 4HQLA 1VA4A 5A62A 2LKCA 1GZSA 2QVLA 3F9CA 5J1TB 1ZQWA 3BXHA 2BTOA 5BOSB 1UK6A 2ZRMA 1ECFA 5LYJA 1JKIA 2BBTA 1C7ZA 2QAGB 1D9ZA 3WR5A 9ICJA 3C3MA 3IXLA 4ALNA 4FKZA 2NPFA 3RS8A 1U1DA 3DHNA 3BILA 3DOUA 1YA6A 2QMOA 1NNLA 2V54A 1T9CA 3UXPA 5EJAA 2YJZA 4BNJA 4Q45A 2OY0A 1I1OA 2Z43A 4A2WA 1U0FA 1WUYA 2GVZC 3E2EA 5FTNA 2AW5A 4M8NE 3QUCA 2JLRA 4U7PB 4LXUA 1GPYA 1TRHA 1II0A 5HVNA 2BKAA 1JFVA 5KNCA 4H2DA 5L3ZA 4ZRMA 2JJ2A 4OI1A 4NQRA 2HA0A 2PT7A 1E3QA 1ED1A 1EP9A 3EIHA 4FK8A 2R1TB 2ZZKA 5K8CA 2VDMB 4U02A 5EFOA 3MABA 4M9JA 4I0WB 1ISJA 5E3IA 5JMPA 3U0VA 1MVOA 1I3MA 2DHDA 2DP4E 2NVUB 3KFUF 2BJVA 2INGX 3NHRA 4PPGA 4BTVA 3WK9A 5IANA 4P8RA 1UKBA 3OAAD 4NV3A 1CIJA 3NWOA 2G1UA 4IOJA 2DPHA 4NRDA 4CF7A 3AI7A 1F38A 4G9BA 3M34A 2B5OA 1WULS 1AO0A 4K4HA 1AS2A 4KV9A 3WYFA 3WWZA 5J8YA 4YR7A 1JI3A 1WB6A 2JKVA 4WY2A 4HUJA 1QYRA 2Y9UA 3MAGA 1DKMA 2FX5A 4LJSA 4B48A 4KNWA 3K9QO 3HBMA 3KZXA 3FIJA 2W9MA 3A28A 3DUFB 6NULA 4PX9A 2VJAA 3NKFA 4JUDX 1KI6A 2Y0CA 3E3NA 1D2RA 4I3FA 4ZC1A 4CUZA 3NDPA 1U0TA 4RTNA 1BGWA 1BPEA 4C07A 4KLAA 4X71A 3WYNA 3ZY6A 2OQVA 1TKDA 5I4CA 2ZJOA 4NV1A 1D2CA 1QH9A 1YI0A 1T9BA 5IJ9B 2RHTA 3K7EA 4QDTA 3NS7A 4BZQA 2J0UA 3FMFA 1VJ1A 4H7IA 3FNEA 2ZROA 2BCVA 5JG7A 1WWVA 3II6X 1Q3KA 4W5HA 1WSWA 5IDVA 2XHEA 5JT1A 4Y9RA 3RSFA 3GLKA 3TAQA 1MX3A 3IOCA 3ZD6A 1YZFA 3JR7A 4AURA 1JPUA 5JH7A 4H18A 2JR5A 1QUFA 2YRWA 2P11A 5INTA 3NKVA 3C4JA 1K5GA 1MFZA 4YT8A 1Y6GA 4E2WA 2JBHA 3T4PA 1EX6A 4NJMB 4LHEA 3QXJA 2FQWA 5LP6C 2WWWA 4CEJA 1OZ0A 4F4XA 4MJ3A 4HWTA 3NVZA 4ME6A 1V1JA 3TWOA 1RM4A 3EDCA 4LF9B 3ZCTA 3F96A 5E4FA 3PICA 4I2CA 4MKZA 1E5TA 1K8RA 2Q9BA 4P3XA 4K9MA 1FVFA 4TUPA 1O9HA 1SXJA 1R37A 4BGEA 5CDSA 3T7EA 4KYIB 3PHCA 2OZLA 4R3UC 3UA3A 5AK4A 4YAKA 1X94A 3D6AA 3D5EA 3LHDA 1RD4A 2Q3MA 4I6EA 4EEYA 4C21A 2EL9A 3H05A 3D7KA 4LZDA 3LWDA 1IULA 3L7AA 4N82A 1SG9A 4EHNA 3T3PB 1HNZB 4I6GA 4MRVA 1JIJA 1BA2A 4ZCMA 2K60A 4US8A 4V24A 3ET4A 5AKEA 3P0HA 8ICSA 4DA9A 1JKXA 2WSBA 3I6BA 3RVLA 1TNDA 4Q5IA 4L4ZA 3UHPA 4DWOA 2H9YA 1YBMA 4AJHA 1KLNA 1EVQA 2AR9A 4WKPA 1DK2A 4BB9A 3A1NA 4KW7A 2Z2YA 4NCNA 1EUZA 5DBCA 1COKA 1M34B 3I5YA 1LEHA 4NLNA 2NRTA 2WPDA 3NNNA 3UV6A 3QX9A 4EI9A 5K8LA 4RJLA 3M6UA 3ER6A 2Z3ZA 3FPCA 3USCS 2KE5A 4M04A 4EHFA 3H0CA 4UKDA 4ZEMA 3N7UA 2F1OA 2R6DA 1ZIPA 1VIVA 1U0EA 2HRBA 2GZ3A 2QXYA 3BUSA 1WW3A 4RF2A 2NZYA 3GG2A 4MWTA 2F3SA 3V32A 3PXDA 2HQBA 2X40A 2IV2X 3RUAA 3AUFA 4PNHA 2D1RA 1ABFA 1YS2X 1IN6A 1U8AA 2C4NA 3G2OA 4OQMA 1XWLA 5J2TB 1IK6A 3GFBA 1VLZA 3PDHA 4LJLA 3WL4A 4YXFA 5BSEA 1UCFA 1Y3FE 1RKUA 2NU9B 5JPIA 3B7GA 5IEJA 5F9LA 2KP7A 3EXHA 3WGTA 1P7VA 2EWWA 3TW8A 4AJ2A 4XYLA 4GYYA 4E3WA 3AVUA 1FSGA 1KW4A 3TAHA 1KO7A 1HZZC 3GIJA 1OAOA 5KNDD 2NV2B 2VT2A 3FD8A 2NACA 4ZAGA 2C0QA 2B4TO 1USIA 4JI5B 3F1LA 1LBTA 4CYMA 3CVUA 3GLIA 2JGLA 3NRBA 1VM6A 1CSEE 4O4LB 3CSDA 3CX3A 1LLCA 3OPYB 2VDJA 1LPOA 2ZUTA 2J7KA 1WUIS 3TX2A 2FW7A 1GTVA 1L5FA 2G0NA 3LT0A 1TO2E 2WJWA 1NVVR 2K87A 2QEQA 4LXTA 3F49S 2X41A 1CS4C 2CLOB 1JQBA 4MZDA 2WVHA 3FYUA 3PHJA 1UODA 2OK8A 2OFXA 1ZW6A 4KLLA 2HRQA 4KDFA 4MYTA 3P2KA 5KINB 3PDWA 1YC5A 1GJRA 1RRVA 1H5NA 1K2WA 3CUEF 3MWYW 4Q7JB 5DHAA 4YALA 4EITA 5CU7A 2KJ9A 4MVJE 1HPLA 1Y3IA 2WYWA 1PO7A 3JATA 4QTTB 1Z5OA 2PSEA 4X7RA 2C22A 4LYEA 3UKDA 1IN7A 1SRQA 1U5BB 4ELUA 4AP9A 2QNBA 4FS2A 2JDIA 1M8FA 1T4MA 4YCMA 4TUYB 2ZBEA 3FLAA 3A6PC 3AG5A 3ZU3A 3C14C 2V55B 2B4RO 3PJRA 1MGOA 5J2TF 5DMHA 2R47A 3MFYA 1U2DA 3W3AH 4QNLA 4RFSB 5MFPA 1AQIA 2PXHA 3SICE 4FYKA 2OB1A 1SURA 5J2JA 4NLKA 4FN4A 4PLGA 2QKQA 4RZIA 4CFSA 2BHRA 4IQUA 4KFTA 1QRTA 3LT2A 4RSGA 4L73A 2R8IA 1BDHA 2YWCA 2WZCA 1RLOA 3WLHA 1SCJA 1XD2B 2QMHA 4QUDA 3EPPA 3TIFA 1L1FA 4B9UA 1THMA 5ECWA 4HGRA 3GIKA 1ILEA 3NHAA 4O4LF 3KDSE 1YZ7A 4NH4A 3KJFA 3KJHA 1CUXA 4DNPA 4RDHA 5IASA 1XCJA 2W6MA 3FMIA 1PQ4A 3LO5A 4B3GA 2IHTA 3IJRA 1I0ZA 1RLJA 1Q0UA 2JAHA 2PX4A 5F3WB 1WABA 5G5HA 5A3RA 3QVUA 5J0RA 1IZZA 4BY9E 4HGYA 4QARA 3B3FA 2O3QA 3QEJA 3LXMA 3F6EX 1E3MA 2GF0A 4II2A 4TL7A 4A8JC 2R6JA 2ZYHA 3RJ5A 3A8TA 1B00A 2X3UA 2YDXA 1Q0PA 3KV1A 1ISGA 1G9XA 1NA5A 5A0VA 4J43A 4RV9A 1CPYA 1JLHA 5IAJA 4D96A 2A94A 5KX5A 4P3PA 2VZEA 1M72A 1JMYA 3B1JA 1RKBA 4ECQA 1VFNA 4TUYF 2BGNA 1L7DA 2EBFX 4QU0A 4D4KA 5IJAA 4QULA 4AY3A 5FEMA 2C61A 3RD5A 3DUWA 1FFDA 4CUJA 3N8HA 1W46A 3THRA 2XE8A 2XMGA 2FCAA 2YKGA 4C5AA 4YECA 2JZOA 2E5WA 1NKSA 2R84A 2Q4OA 4FXPA 4E22A 1CVLA 3HXMA 3EZ6A 1KDYA 3DL4A 3QYJA 2ZRAA 2F9LA 1GL9B 1SKWA 4C0WA 3GEPA 4PSCA 1B74A 3JQFC 1UINA 1KBUA 3UJ3X 1TMOA 4FFWA 3DVAA 5JD5A 3OJCA 1LZLA 2QN3A 5IK2D 2FPSA 4FX2A 4UPVA 1BX3A 1ODSA 1Z56C 4J0EA 3N74A 1R0RE 4DMKA 4D4JA 4IXTA 1QHHB 2FZWA 4PJ0U 2W8KA 4ZH4A 3H1AA 4UJ5A 2JKZA 4PONA 3TOCA 4TQSA 3NH9A 1ZAKA 3I5AA 5EOVA 1K86A 3VGPA 2W8LA 1OW5A 3KR1A 1SBTA 1ZIXA 3GARA 3NHMA 1TVKB 2LV8A 4LRXA 4IMPA 4EI2A 2ZXUA 5ALMA 3BC1A 3EUFA 2JMGA 1I4WA 9ICSA 4MUBA 4BKPA 3RS5A 1JG1A 3STHA 5JNSA 4GPD1 3U56A 4BFXA 3LCUA 4LJ7A 2K5UA 1C0IA 3QXXA 2R6HA 2QD4A 5K1ZA 3ZI7A 2J5XA 4YDQA 1RI3A 1OR8A 4QEZA 4G1FA 4YQZA 4UZEA 2VDWB 4C03A 1Z8NA 1SUFA 1OLSB 5EUQB 2VJOA 4E4TA 3GFTA 2I4LA 1E0JA 2XY4A 5DLYA 2XCIA 1SNYA 5C0YA 4JLPA 3JQAD 2UVUA 3IEIA 4J9LA 1XJ5A 5D3MB 4YB8A 4MOWA 3FAHA 1G8FA 1D07A 5JV5A 3QVVA 4LJAA 1C7QA 3EFHA 5LA6B 3D2LA 3BRSA 1QTQA 2J08A 3RVMA 1PF7E 4I4CA 1UKAA 2Q2NA 3KOOA 2X2PA 4FHEA 3ZHOA 3PF8A 5J2UF 3RE1A 3OM9A 4NZYA 5LU9A 4X1KA 5JAMA 2OQRA 3RBEA 3HUEA 1ZIYA 1X1TA 3R0XA 4PO8A 3N2KA 3GIWA 3LF2A 2PSDA 2VJDA 3MJRA 4QLAA 4R69A 3I8OA 3EF3A 4E30A 4GWKA 2EG5A 3N0VA 3RRNA 5U4QA 3WDSA 1NW5A 5FKJA 3IE1A 2HYIC 1WXQA 2A5DA 4D46A 1PT7A 4UOQA 2VIXA 2JKYA 4L15A 2NYRA 5DN6D 3PLNA 1WF6A 3RR8A 2H54A 2AG6A 2ZPAA 5A9SA 2YVLA 1IDOA 2V5VA 2OM2A 2R6GA 3STWA 3L04A 1XZLA 1HTBA 2J9YB 3P20A 1R0ZA 1AXEA 3GLHE 1Q84A 3N7RC 1JFLA 3PRKE 5BQ5A 1QAQA 1A9YA 4JT8A 1VG1A 3QJGA 2ES6A 3AFHA 2VR1A 3UJ9A 4N3NA 2F67A 1PFQA 1LNQA 4Y1FA 3UIEA 4IQTA 4G1MB 5G2OA 5CYGA 4S05A 3AONB 2JLQA 2AFHB 3L2OB 3KCNA 3M6LA 3DQZA 1Q91A 4N9QA 1IZ0A 4Q7QA 1P72A 1KEEB 4I4TF 4UBNA 3UK1A 2PUJA 1U8FO 5LA6F 3HWSA 2FPUA 1P6QA 5DM60 1Z7WA 3BXGA 3U4QB 3JAKA 2ZVDA 3PSHA 1GGFA 1ISFA 3T5JA 4YP0A 3JPNA 1KAEA 2HNBA 2VPZA 1EB9A 1JXMA 2X4GA 4RXUA 2HV9A 1QZUA 4AKSA 4KQJA 4OXXA 3TXXA 4ZGWA 4FHGA 1BQEA 4JLKA 2HTFA 1N2CE 4M9NA 1AK2A 3OJSA 4EW6A 2XHZA 9ICVA 1SXQA 1Z2AA 1C1DA 5AMXA 1XKQA 3H9GA 2QTMA 4G0UA 2CXRA 1AF7A 3HI4A 3HVIA 3ANXA 3AF3A 4BLTA 1YDMA 5FFFA 3L7MA 1K98A 4Q6WA 3FVRA 1Z8DA 2JFHA 1JH8A 4YAGA 3HJTA 2GN2A 3HUUA 3COYA 4C2AA 4MV3A 4JJ8A 3VPSA 4QBGB 2ZB8A 4CM7A 3CXRA 1QFZA 3JQ9C 1HG0A 2H3QA 2W6JD 1VGQA 3MERA 2Y76A 1MG5A 4PC6A 1OT5A 5IFKA 5E2IA 3BXFA 1CIPA 1H4QA 1BEZA 1ZVQA 4OXIA 2EF0A 1TYEB 1UJNA 3M9WA 3IBSA 1F12A 5AKIA 1M0SA 1NBHA 2J6IA 1BIFA 2AQHA 2JGRA 2V8OA 5GVSA 1NXVA 4F7DA 3VR4H 1Q77A 1KO5A 3ZWMA 3BK2A 1NSFA 5ILGA 4C29A 2EW8A 1XC9A 3ZGNA 1N6KA 8ICMA 1V3TA 3IQIX 1AF4A 2CB9A 3AUUA 1BX0A 3LLSA 1JXOA 4ILEA 5BMOA 1OI4A 3OTWA 1PQYA 3W2GA 1ZK1A 2G5TA 3LZDA 2NADA 3DW3X 2PZKA 1JP7A 5DEIA 5BR1A 1Y8AA 3N7PD 5LD2B 3DR5A 2KV2A 3NOVA 3HA3A 3LP6A 5JZ9A 1KVSA 1Y80A 4L9RA 1FRNA 4KAFA 1UFQA 3GN1A 8ICHA 1W4CA 2DETA 4GX2A 5EUMA 4F4IA 3DSRA 4TKVA 4DEVA 3WYBA 2KIVA 4FCVA 4TTRA 3F5AA 3RB3A 1ZO8A 4OGGA 2C5LA 1E60A 3N1UA 4X8HA 2WHXA 2R6FA 2D3DA 1ZC4A 3TNJA 2OECA 1C3EA 3HCCA 2O59A 3EWSA 1MC5A 5DGTA 3C87A 1E4OA 3R44A 1R0CA 2OO7A 3OU6A 4QJFB 4HVAA 4GKBA 2H4JA 3P9PA 1YZ3A 3ORFA 3T12A 3MPUA 1ZR2A 3KYBA 4AJ1A 3KB2A 3CGGA 3MT8A 4ZT6A 3SR3A 2EVWX 3T1QA 5HM8A 2FE4A 1Z8FA 2EF1A 3GPDG 2H4YA 2EJTA 2ZUBA 4J0CA 1D09A 3H0KA 1IWBB 2X3FA 1ZOIA 4HSGA 2W83A 5KAPA 3W9BA 1YZUA 4FDMA 3NV9A 1FX1A 3ER9A 5GZ1A 1F17A 4NJOA 4PZ9A 4UUQA 4XDHA 2BFWA 4ZEWA 2EFHB 9ABPA 1KH1A 1PJAA 1PR2A 5IVIA 2IA6A 2JIMA 3BWDD 2W2PA 1FDIA 4TUQA 3K6JA 3GNTA 4IMRA 1DAOA 2VK4A 9ICCA 2PG3A 3NBQA 5IN4A 4TTQA 2A5YB 1M10A 1SU7A 2GRAA 5EXEA 4B9TA 3Q8SB 2NSLA 2QIOA 1DCFA 2XCAA 1YJXA 3I1FA 3S1LA 4RPKA 1NVGA 3R7DA 1KR5A 2BEWA 1CDOA 5EIEA 1GT6A 3M6AA 2PHZA 2V7XA 4AFNA 1G8KA 4RBNA 1BXGA 4M87A 1K3TA 1L7XA 1FYWA 2X7XA 3CY6A 4LJRA 2G08A 1JQEA 1PFUA 5C5JA 2QX9A 2BFPA 1P1FA 3L4PA 4PCVA 4EFDA 1K0FA 2Q6TA 4HATA 4N5LA 3OQ6A 2COUA 1MIOB 4KK4A 2HNAA 4XQGA 4FB5A 3GLTA 4LNAA 1XPUA 1UDAA 1OA0A 1IM5A 1N5OX 3AKZA 4MWCA 1ZJZA 2XQIA 3JU3A 5CX1B 4ENRA 3NIDB 1HFWA 1I4TD 3V4LA 1K3UB 4QZDA 5DBHX 3WZ2A 2ZWOA 1FJHA 3KQNA 3GA7A 2FI1A 1TAMA 4MCAA 1RYEA 4P7GA 1MC8A 1PVQA 1HFEL 2C5SA 1O5OA 3ZBPA 5COBA 2EP5A 1U7WA 4PGMA 3MDAA 4ON9A 3V8MA 4DQSA 2JJYA 2HW8A 1D6MA 3TQ1A 1JU4A 3QPDA 4BE7B 1GU0A 3JTEA 2ZJ5A 5FNZA 4IRDA 3PGLA 2TECE 3IPAA 1PEYA 3NIWA 2B20A 1VJ0A 1TL7C 3MWDA 3CJRA 3H8JA 3AF0A 5AP9A 2ZCVA 2I8CA 2PH3A 4Q19A 4IIYA 3ZXIA 1N8KA 4GEKA 1S7GA 1A4RA 4UVGA 1G18A 4ADSG 5GOZA 4UMEA 4GGOA 2Z1DA 2ZJ7A 1DX4A 1W36C 1Z25A 2EZ4A 1NMXA 3FBTA 1ZSVA 1ORVA 4C6SA 3DM9B 4G26A 4A92A 3MBOA 4QRDA 3EQ6A 2ZIGA 4PHDA 5AH0A 1ZJ6A 2VTEA 4P53A 4EZBA 1OIWA 4OH1A 4YT2A 3CLHA 2H52A 2VPPA 2WPNA 3U19A 3NP9A 1NJ6A 1CRXA 5JNWA 4DMRA 1RLTA 5E95A 5FBKA 2CLLB 2WY2D 2PAAA 2YY6A 1M6EX 1B8NA 4KMMA 2ZB7A 5L3RA 2O20A 2CBGA 5AVSA 4IS2A 1POWA 3KEFA 3QUSA 1TVMA 5KOHA 1JYEA 3AJEA 3BMQB 5BXQC 2P6MA 3UANA 4M0UA 5JS7A 1UWLA 2GWHA 2HHAA 3MMZA 1I6MA 4L50A 4OBWA 1JAIA 5JS2A 4A82A 1A1VA 1Z2EA 3WZMA 2RGDA 1NQTA 2GZRA 3PNOA 4PRYA 1NHWA 1C7YA 3WNCA 4WLFA 5K51A 4KLUA 1C4XA 1YUNA 3I52A 1J9GA 1ANKA 3LSTA 3T0FA 1REQB 3AINA 1Z82A 2FWRA 2PPLA 2YIDA 4UE6A 2VAXA 3IKJA 5F2NA 2BDEA 1HYGA 2RHCA 2HHWA 1HURA 4ID3A 3CMCO 5D1HA 2I3ZA 2XNSA 3R8XA 1BKSB 4CQJA 5DO9A 3BJMA 1NMZA 1ID1A 1VLVA 4GXTA 5C8XA 3PL1A 1JJVA 1Z36A 4O3FA 1TZMA 5B6IA 2MYTA 3ZCVA 1YIAA 4B75A 1I13A 4D9CA 4NIMA 2JLWA 4EBFA 4N3BA 1P60A 2FA9A 3ZK7A 5J2HA 4S1PA 1QGZA 3TRKA 4CDNA 3HEAA 4DLTA 2H7YA 4H3VA 1FDRA 3ZZTA 2WB1C 5B6JA 2Z6UA 2CXOA 5LQCA 4ZU6X 2WWRA 3ZCXA 3LYHA 4GMKA 1T5SA 3EH2A 4PC3A 4RD0A 4NMWA 3IAAA 3MAAC 3VH3A 3L7NA 4NI5A 2B4QA 4LJ9A 5F9MA 1ZN2A 1XKTA 5EQJB 4MTCA 1R4AA 3ELUA 2XKAA 2C2KA 3GEDA 3DULA 4UNSA 4ALJA 1HIWA 4OQFA 4PG5A 5I7HA 4KQEA 4H3SA 5CT8A 2KD1A 4C9BA 1RMQA 4V0KA 3R75A 3DKRA 4OHFA 3ONWA 1NSYA 4UMDA 1D6JA 3TBFA 3B8HA 4WFQA 2YWRA 4L6IA 4ER7A 3SR4A 1X0VA 2D1QA 1N5DA 2BJHA 4A91A 5EHQA 5CGQB 5CPFA 3LU1A 2IBTA 5BQOA 4QDZA 2XYPA 2J5QA 2ZRFA 5CBPA 1LLDA 4PZUA 2EDUA 5KNCD 3IEMA 1N92A 2QE7A 4DJEC 3PXXA 3AESA 2JJ2D 3BB3A 2GNAA 2FWPA 1YQUA 1N6NA 1KDRA 4RADA 1N1DA 4ODIA 5HIIA 4YONB 2KBFA 2F76X 4BV9A 2WP0A 2ID7A 1M5RA 1KYXA 3GLUA 4CQLA 5AOAA 4BUZA 3HCOA 3HILA 3K0FB 4W9NA 4X20A 1TT7A 4BOYA 3O0TA 2EZ9A 5BQPA 4IDFA 1BVRA 2ZS7A 3NATA 4X1YB 1NI3A 3CRZA 3R0ZA 2IELA 3Q12A 1GM5A 1CULC 1U9YA 4BCCA 5ESRA 1YZNA 5KTNA 4CHTA 1GQYA 4FIDA 3L40A 3MPOA 2LM4A 2J67A 5J23A 2BEKA 3VR6D 1J7KA 4WXHA 3IPRA 2V9CA 4G0QA 1D2EA 1LSJA 1WY5A 5CP2A 4ZOHC 4OUDA 3KALA 1MX5A 2A4KA 1ZM4A 4BEVA 1EK6A 4YG2A 3KAPA 1DSSG 3PT5A 3ASYA 3IA2A 3LIIA 1G8GA 1L4LA 3TZEA 2I0FA 2BKLA 1VLMA 3CZAA 5L7WA 1XSLA 1PVVA 3RNLA 1CP2A 3GQBA 1YJBA 4MROA 5LLSA 2G25A 1H9BA 4H15A 3L1UA 3LBHA 1GNTA 4RCZA 2JFNA 3HU1A 1COWD 4PRLA 2TYSB 3U7QA 1VMKA 1C7EA 1RPTA 4X24A 1NN5A 4Y1RA 3HMQA 5CVEA 1GAXA 1ZD9A 1MDBA 4MUNA 4X3PA 2GN1A 2FFHA 5B1HA 1RLMA 5IAOA 4HP8A 5FBZA 3KKOA 1EGHA 4EHBA 2X5NA 5LZ4A 1NVMB 3PQ4A 2O8EA 1GL3A 2FVYA 1EYZA 1EFHA 2FN4A 1X1QA 1XVAA 2HAEA 1DIOB 1P2VA 3WKDA 4GE3A 2HPVA 4C76A 2H1VA 1RXEA 5DZSA 2NTEA 4NZZA 5EJ6A 4B6QA 4HDAA 1KYTA 5EI5A 1ZLXA 1ADYA 3HSSA 2WNIA 3R6TA 3AL3A 4MWOA 1T2DA 1MR3F 1X8XA 2O5RA 1M1YE 2HSZA 2B8EA 3HDTA 5DTIA 4N0MA 1JILA 3TEFA 1ZQVA 1SXJD 4B2PA 4GS5A 2B2XA 1O96A 1CQJB 4TPKA 1XMXA 5C46F 4GAEA 1JR4A 1GTJ1 2CFCA 1VSTA 7ADHA 3D54D 2YX8A 4IY1A 2IU4A 3RJJA 2IYAA 1W5SA 2J6CA 2ASVA 3TLZA 1GQSA 1BRTA 4EG3A 4RTOA 3AJDA 3KHHA 1HTWA 2R62A 7ICGA 5CTAA 3AUKA 3HBFA 3GJYA 2CDNA 4PLVA 1NT4A 4I46A 4E7OA 2O4CA 4RS3A 2CSUA 3EMKA 1PT6A 2Y0BA 4BNYA 4LAFA 4C43A 2C9DA 1THZA 3C45A 1XEXA 3RJIA 3ZW9A 1D2AA 3WGLA 3AR8A 3RAPR 5AXBA 2ERYA 4R7TA 4AJIA 4ABTA 1K9SA 4G9EA 4ZVRA 5I9SA 3H04A 1JJFA 5EWLA 2V4MA 4YP5A 4AJLA 3DOIA 2R48A 4HVTA 2WTMA 5K03A 1OVMA 1AKUA 3O8BA 4C01A 2GUGA 2WPDD 1C81A 2C2ZA 2J3QA 1DBPA 2AHOA 8ICRA 1MSWD 5BR7A 2H18A 1JKJA 1GG8A 4EI8A 4CM8A 4ECZA 1A9TA 4WBXC 3OOJA 4TTTS 1F6WA 2IE0A 2B37A 4LWZA 1TM1E 2JASA 4C7XA 1HO3A 4E12A 4EHKA 1ZCZA 4ES6A 3WGUA 3NEJA 3W79A 2SHKA 4E1VA 2DQKA 1O97C 3NC0C 4EATA 4BO4A 2C83A 1CW2B 2DF4B 3BMNA 4BP3A 3PP8A 4BWJA 3PC2A 3VVLA 4UBMA 1MJGA 1OYVA 3N8DA 4FIZA 1T0JB 1DJQA 4JHLA 2GEJA 5HK8A 1TT5A 1FOEB 3RWMB 1A3CA 1BOFA 4Y9TA 4CU2A 2WT4A 4X7BA 2VAVA 4GBED 2Y92A 3HJBA 5TGDA 1U49A 1IQ0A 1JN3A 1ZQDA 3BE6A 2O6LA 1M6VB 2V6IA 1XRQA 4O59O 4BLWA 3THVA 1EFVA 3FYDA 2Q07A 1ML3A 1WMFA 3I8XA 3M4XA 2HBRA 3BTUA 2W6ZA 1CYEA 3T1NA 3VJKA 1EP3B 1J21A 1TDJA 2H3FA 3NV7A 5DDMA 4DJ5X 4MRRA 2QV0A 4IO0A 4OEHA 4O4HB 1VSQA 4P4PA 4LE0A 5IVHA 2JF0A 3GMIA 5HNKA 3OESA 5JSUA 4X64B 2XUZA 1SUDA 2IBMA 5B5SA 1EEHA 3ZVKA 4KLHA 2HQ1A 1Z47A 2WQZA 4ND1A 3H2YA 4ALLA 4HUQA 3MXTA 2QXUA 5JOQA 3K9LA 1L7NA 4A2QA 1W44A 2HMYB 3MOGA 4BBPA 4MR9B 5CNKA 1ZD8A 3DZDA 4PFSA 3O0DA 2F1JA 2GZ1A 5HA5A 2HFJA 2BELA 4IDDA 1D4OA 1PTJC 1M2HA 1NVDA 2Z1MA 1PJCA 2EOAA 2J5BA 3ISVA 2HU8A 1U1EA 1RQNA 2A1IA 3BGIA 2GO1A 3E5HA 3OSZA 1U3CA 2HOFA 2V1XA 5BNWA 2C7RA 3F6RA 2WWFA 4UM9D 4I08A 4EWLA 4PYNA 1KQQA 2XCQA 2JDID 4BLQA 3T5LA 3PGA1 4QYSA 1YZHA 4TYNA 1RRMA 3DFMA 2DRIA 2D1SA 2WU0A 4FYJA 2VHYA 4UBIA 4J1TC 1KL9A 1U2ZA 5AESA 4IJKA 3WGMA 2VVTA 4C3VA 3QH4A 1KAHA 1BYUA 2AMJA 4FFBA 2X23A 3DXXA 5FBVB 5HM6A 2NUPB 1L8OA 2J3KA 5I47A 2YW9A 1Z00A 1BWQA 1CQIB 3Q3CA 3DYIA 3WNQA 3D6HA 1BOOA 5AKKA 2DQSA 1CQWA 4ATNA 2IQ5A 1ZHHA 3V33A 2FEPA 4EW2A 4HDNB 3NWJA 1Z62A 1L7RA 4O4HF 1EK0A 1NZJA 3BYZA 5KJ1A 1Y48E 4DF4A 3VHXA 2OK7A 4U6PA 1GT91 1LQ2A 2E4YA 2CDRA 1DJPA 5EHNA 1T5TA 3S2ZA 3BH6A 4EUKA 5BMVF 2YJ3A 3KQVA 4M37A 1N36B 4PIVA 1R1DA 1JVNA 2VHVA 2W2QA 4HWSA 2JV3A 2H3ZA 3CZ5A 3P0EA 4B6PA 3VZDA 2ONCA 3E7XA 4QIHA 2QJTA 3CF0A 1U6JA 1YR6A 3RK4A 3ZI0A 3EZFA 1ULUA 2RAVA 1PR0A 4ZQEA 4P31A 3VFDA 1ZWLA 4KO8A 4R1QA 1W4LA 3CNOA 4KQWA 3ZJ5A 1YZKA 2DQYA 4WV3A 1ZH6A 4L8VA 3U1VA 4AI6A 4ZTZB 1E7QA 1MZVA 2ZSHA 1VJ5A 1GG5A 2NSJA 5HEKA 4QELA 2WJGA 4KQCA 5DBFA 3EVZA 1P6UA 1QSSA 2JIPA 3OT5A 1XHLA 3OQIB 1FQOA 4NYJQ 4FEAA 2ACKA 1XPJA 1GZ3A 4JJAA 4CDMA 4RPYA 4BLOA 3R9XA 3BREA 2FPKA 4FBGA 3BTSA 3S2GA 2MSCB 1X1RA 2YB4A 4GXIA 4BCBA 2BAGA 1JAYA 4BV2A 4CLRA 5CH5A 1Q0TA 2HY7A 4DL4A 3OU2A 5KFPA 1AQJA 2NO7A 3BX1A 3KYJB 2FUG1<