4FE3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with uridinine monophosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
b'AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structural Basis of Substrate Specificity and Selectivity of Murine Cytosolic 5'-Nucleotidase III.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fe3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4fe3A01
3SLRA 2WF5A 4GIBA 3ZU6A 1Z4NA 4B6JA 3AR7A 1L7NA 3DAOA 3AR3A 2PQ0A 2RARA 3NIWA 5AM4A 2JAOA 3L0BA 4BKMA 3KD3A 5AKXA 3FVVA 2OA0A 3R09A 1RPZA 1T5TA 1RRCA 1Z4QA 2JAUA 5AVSA 2Q4RA 1J97A 3PGVA 2VKQA 1RKQA 4CNQA 2HSZA 1N9KA 2G1AA 1Z88A 3WK7A 2ZXEA 1TJ4A 3ZI4A 4YCMA 5AESA 1Y8AA 5AKHA 3OCWA 5ALHA 5AVRA 4Y2TA 5ALSA 4DW8A 3U7HB 4UAUA 5ALVA 4FFDA 2NO5A 2BDEA 5AW4A 1WZCA 1Z4IA 3MN1A 5AM1A 1Z4LA 4MUMA 5AVTA 4F71A 3N28A 2BY4A 1U02A 4DFDA 5AVZA 1VJRA 4C4SA 1WR8A 3E8MA 2AMYA 2FPRA 2B8JA 3QU5A 2CFRA 1NNLA 4DCCA 5AW0A 4XPZA 4BNDB 2JGAA 3NUQA 1ZRNA 1Z4PX 1ZOLA 2HX1A 3MMZA 1WVIA 4XE5A 4UU1A 2FPWA 2FPSA 2ODAA 2FI1A 3R9KA 3WKCA 5ALLA 3AR4A 1YS9A 4IG4A 5ALMA 3A1DA 3KOOA 1QH9A 2OBBA 1LTQA 4NV0A 2HDOA 1VFPA 3QUQA 3L8FA 5AICA 2W11A 3ZVLA 2X4DA 1TE2A 4C4RA 2G0AA 1O03A 3A3YA 5FP0A 4YCNA 3W5CA 5IS2A 1RKUA 2OM6A 5ALYA 5ALEA 2IOHA 3N5KA 1J8DA 1Z4MA 2B30A 3U7FB 4Y2XA 1T9ZA 3NALA 1L8OA 4UARA 2HHLA 2R8YA 2W43A 4HGRA 3A1CA 5AKYA 3GYGA 2JARA 5AVWA 4HGOA 4CE6A 3MC1A 5AI8A 1RLTA 3S6JA 4EEKA 3DV9A 3N1UA 3QU4A 2WHEA 1RQLA 3B8EA 2G08A 4UMDA 2G07A 1YJ5A 1L7PA 4HGPA 2BDUA 1EK2A 1QQ7A 5AI5A 3QLEA 3NANA 4QQFA 3ZX4A 5AVYA 2IOFA 4BX2A 5AVQA 2GMWA 2I54A 2ZBFA 4HYTA 5AK5A 3B9RA 3D6JA 4DWOA 1RDFA 4Y2UA 5ALKA 1AQ6A 2R8ZA 4UM5A 3VAYA 3IB6A 3PCTA 5AI6A 2OYCA 4Y2RA 4EX7A 2NO4A 1RMQA 5ALQA 2ZBEA 2HF2A 4Y3UA 5AM2A 1U2TA 5ALDA 2HO4A 3ESRA 1ZS9A 3NASA 4CF4A 4BX0A 4NWIA 1IWOA 3CZ4A 3ET4A 2FUCA 4E88A 3ESQA 3U19A 1CQZA 2YMPA 2YY6A 4EELA 5ALNA 3ZVNA 1Z5UA 2WM8A 3ED5A 3WK9A 3N07A 5AM3A 1NF2A 1Q92A 4ZEWA 4ZEXA 2AH5A 1Z5GA 5T41A 2YJ6A 3NRJA 4XOUA 4UATA 4BX3A 2YBDA 4BNDA 1TJ5A 3FPSA 2I34A 4AP9A 4AS3A 1ZD2P 1XPJA 1YV9A 3DNPA 2YN4A 4OFZA 3R4CA 1PW5A 4BEWA 4F72A 1XVIA 4Y2QA 2HEGA 3CNHA 4Y2VA 1RQNA 4HGNA 4I9GA 3W5AA 1SU4A 2HCFA 2FDRA 4UMFA 4BEVA 5A3QA 5ALTA 1SWVA 1XP5A 3ZVMA 4UMVA 1Z4JA 5ALUA 5A3RA 5AW7A 3N8GA 5A3SA 4L57A 5AIAA 3QUCA 1CR6A 1X42A 4UW9A 2YMMA 3K1ZA 1KYTA 4OHFA 2C4NA 2O2XA 3UMGA 2G09A 1L7MA 2CFTA 3QNMA 4C4TA 4YIKA 3A1EA 3BA6A 2ZOSA 2YJ4A 3AR9A 3ZTWA 1ZD4A 5AHXA 2GO7A 4MWOA 4KX5A 1ZJJA 5ALGA 3E84A 4I9FA 1ZD3A 1N8NA 1U7OA 4YH1A 1ZD5A 5AK3A 4Y2YA 4NAVA 2AUTA 3SKYA 2WF7A 2B0CA 1RKVA 3EPRA 5AW9A 5AKKA 4KX3A 2CFSA 1L8LA 4FYPA 1MH9A 4Y2PA 5AI4A 3HLTA 5AW8A 2GHTA 3ZUPA 2C88A 5AK6A 1RC8A 4CF5A 2PKEA 4UU0A 5AW5A 1WPGA 4O8CA 4QJBA 2FPXA 1O08A 4G63A 1RLMA 3WK6A 3WKAA 4JB3A 3SD7A 2YJ5A 5JJBA 3OPXA 3I6BA 1Z4KA 1L7OA 3U13A 5AIBA 1K1EA 2IA5A 4OCZA 5AM5A 3KBBA 2QLTA 2PR7A 3QX7A 3EF1A 5ALPA 5AW6A 3QU9A 3OCYA 2MU1A 3WKBA 3IJ5A 4EZEA 1ZRMA 4BYGA 2EAUA 2EARA 4FE3A 3WGVA 5AI9A 5IT4A 2R8XA 4HAIA 3AR5A 3OCXA 2RAVA 3RF6A 3ET5A 5ALWA 5AKZA 2Q5EA 5AW3A 5AK4A 2G06A 2RB5A 3KZXA 3WKEA 3ZX5A 3FPBA 2I33A 2C9MA 5E0OA 2WF8A 3U7GA 5AVXA 3L5KA 1YDFA 4RESA 3SF0A 4YCLA 2B82A 1F5SA 5AKGA 3FZQA 3ZWKA 3L8HA 2YMLA 1S2OA 5ALOA 2C8LA 2HF7A 4KNWA 4XQ0A 3QU2A 3AR6A 4OD0A 1LVHA 5AW1A 2NYVA 2QYHA 3WK4A 2WFAA 5IT0A 4H1WA 3SHQA 3I1YA 3WKDA 2FEAA 3WK8A 3AR8A 3BWVA 5AKJA 5AVUA 3M1YA 2MSNA 4KN8A 3ONNA 3ZW7A 2D2VA 4KYTA 3UM9A 3L7YA 1L6RA 1QQ5A 3P96A 2B1QA 3EF0A 3L0YA 2GHQA 3OCZA 2I7DA 3L8GA 4EX6A 2B8EA 3QYPA 5AKLA 3J7TA 3FGOA 1VJ5A 3I76A 5ALJA 5AVVA 4EENA 2EATA 2HI0A 3WGUA 4JDPA 4NFLA 4UM7A 5AKEA 3L1VA 4UMEA 2ZBGA 1RMYA 3W5DA 1Z4OA 2I55A 2IYEA 3E58A 3ZWDA 4Y2JA 1JUDA 1Q91A 1QQ6A 4YIHA 1NRWA 4IFTA 2B1RA 4KNVA 2RBKA 5ALFA 3SMVA 3KC2A 3QU7A 4L6CA 4G9BA 4RETA 4BBJA 4GXTA 3QXGA 2Q4TA 4J03A 4UAVA 3L1UA 3QUTA 3F9RA 5AW2A 1T5SA 2I6XA 1EK1A 1FEZA 3AR2A 5ALXA 3B9BA 2JAWA 2P9JA 4J2TA 3OTQA 1SWWA 2YMQA 3FM9A 3QGMA 2YJ3A 2FUEA 3PDWA 3OCVA 3UMBA 3ZTYA 2HOQA 2G80A 3M9LA 2C8KA 2YFYA 1TA0A 2O9JA 2IOFK 3TLMA 4PNHA 5ALZA 4HGQA 1RMTA 4UASA 5AM0A 4CF3A 1QYIA 2ZG6A 3MPOA 2R8EA 3EWIA 5AI0A 2FPUA 3W5BA 1S8OA 2W4MA 3NAMA 4AS2A 1RLOA 5AKIA 2WF9A 1U7PA 3PGLA 2GFHA 3E81A 3DDHA 3UMCA 3L8EA 2P27A 4L6AA 5ALRA 4Y2SA 3SKXA 1U2SA 3L0CA 2CN1A 3IRUA 3I28A 3QUBA 4YGYA 2ZBDA 3HYCA 2DQSA 3OCUA 1YNSA 1YMQA 2WF6A 2P11A 3U26A 1TJ3A 3WK5A 3RFUA 5ALIA 2AGVA 3KDPA 3U7EB 4ZEVA 2P69A 4NABA
chains in the Genus database with same CATH superfamily
1TC2A 4OXIA 1T1JA 3UV3A 1B14A 4X62B 2J30A 3EVNA 4OMUA 5J1SB 3LLSA 2IEAA 4P38A 2WIGA 3IKVA 5TPZD 5HGXA 4CIYA 1VIMA 3S2UA 2Y1JA 1JHDA 3WZMA 3KOYA 5K2MA 1M2GA 3JQGA 1TYZA 1FS5A 1Y8ZA 5CDYA 3PC7A 3W4KA 1Q1EA 1BS2A 1JIUA 1UOPA 1NKTA 1ZRNA 5HW0A 4K26A 4RTOA 3AKCA 4XPIB 2IX3A 1J2MA 2CMGA 2HWYA 4IQ0A 1QGOA 1BPXA 2D2XA 3CN7A 1O9GA 1N33B 3VJMA 4KQJA 1TE2A 4ZD6A 1PZEA 3LP5A 4O08A 1I7DA 3RNLA 1YL7A 5F33A 4RSMA 1E3DA 3HL0A 4DA6A 4I5FA 3ZDXB 3NBUA 1TK5A 1U6IA 2ATCA 3AXTA 1MA3A 1OI4A 5BNTA 3MGAA 4TLCA 3ZZMA 3UY4A 3NANA 2A92A 4L0CA 3MHTA 3JARA 4J1SA 2P1DA 4GFDA 1PT8A 1MNQA 5ALKA 1YSCA 4Q7LA 2FZ4A 1KSGA 4KPUA 2NP6A 1GKUB 3QSGA 2WKQA 4EMSA 3NASA 3GBPA 3VVMA 2E21A 5EJ9A 1SB3C 2BWJA 1NLUA 3SFVA 5DSXA 2W03A 1G2PA 1ZHOA 3CLUC 1FJXA 2L0XA 5EJMA 5BQFA 3HABA 4AS3A 4KITB 3FFAA 1P8JA 3T5JA 4M55A 1GVHA 2XYVA 1GD1O 1PR1A 2FSFA 2E4XA 1H5UA 2HCFA 5I7FA 1VCIA 2YQ5A 4MR7A 2CCGA 1QFYA 4HB2A 3C7TA 2GO1A 3CW8X 2GA8A 4Q9JA 1YUMA 2QGZA 2J6CA 1M72A 2QVLA 1CY8A 1NQXA 4LTDA 3RE1A 4L7VA 5AW8A 2ODGA 3EF3A 1QUEA 1VB5A 3MR3A 1VHQA 4KN5A 4P32A 4R9UC 3PNVA 4DPLA 3KZ1E 2VL7A 1MO3A 3FYCA 3LQKA 4YR9A 4Q5IA 3DMTA 3I8OA 3AUOA 4OQQA 1VI2A 1YACA 3I2FA 1XAGA 4LF4B 3JD4A 1MC1A 2B6NA 2EX1A 2MUTB 3O8LA 2GLTA 4BAGA 3ZXSA 3RHZA 2ZRMA 3QUAA 2BZFA 5ELXA 1A2KC 3SF0A 5AHWA 3OT5A 1RADA 1JQ3A 1B1AA 2YOGA 4Z4GA 5IYZB 3PW7A 4Q3LA 4COKA 3BQNB 3RJTA 1K6EA 3OFSA 1NKBA 3G13A 3PA6A 5BYKA 2GWRA 2DP4E 3EISA 1UJ2A 3ZDCA 4HN2A 1DK3A 2OWDA 2NRXA 4H3KB 2KVSA 3IR6A 1F4LA 6Q21A 3W5DA 3D81A 3RHSA 3O8NA 4JLKA 1HSOA 3T3FA 2YJGA 4GPBA 1DCFA 5J2FA 5ER9A 3Q5EA 4QJIA 1VYVA 3ZC3A 2PD3A 5KQRA 2X5JO 2IU4A 2H65A 3FBTA 2XXJA 4PXSA 2VWQA 4AKGA 3K8OE 5J4HA 4FD2A 2JFOA 2WIAA 1VKNA 3WLHA 2E2WA 3FG9A 1J99A 3TIGA 4E2XA 1IRXA 1CRLA 4S2EA 3VYVA 4PZ0A 2OXCA 1XLTC 5FYQA 4H7EA 2H3EA 7ADHA 4AKIA 4FU0A 5AOBA 5J59A 3IQGX 1XD9A 2HM7A 4LISA 3TOCA 1BXRA 3RFUA 1DBPA 4QARA 1AGRA 1Z15A 5D5HA 1G6Q1 3RH6A 4FJ0A 1OC2A 1UQTA 2BQUA 3C6XA 2QSZA 2HBRA 2QWXA 2G9UA 3PC8C 4YT5A 1FYFA 2G1JA 2D62A 2E4AA 2R7KA 4K8RB 4CKWB 1KTQA 4KXXA 5EQDA 1I14A 4QU8A 1Z08A 3JD0A 3D7RA 1ZL0A 1OJLA 5AM1A 2Y0SC 1VE6A 2MSKA 4DQKA 2D0DA 2VJNA 2HPAA 1JXMA 2W6JD 3QF4B 1JT2A 3U0VA 2OEPA 1SPBS 3IUSA 1E1DA 5DRYA 4N7BA 2ZJ6A 2ZIAA 3DAYA 1OUQA 2IU3A 3FUWA 4OQLA 3TLCA 4O5AA 5HTKA 3SEZA 3M1LA 2PSHA 3GJQA 4F84A 4ZOCA 1ZEMA 2ZSIA 2JRCA 3C16C 3IOMA 2WSLA 4YCNA 3G9ZA 4JGIA 3C6KA 3HHPA 3L3BA 1P0QA 1JH9A 2R8YA 3VKUA 4RKYA 1QKIA 2G1UA 4QUGA 1JHXA 1YBFA 2FMSA 2O0HA 3ZCVA 2Q0ZX 1YAJA 5L7TA 4YMTA 2H3VA 4E30A 3KCNA 2C0CA 2HHAA 4G1CA 1XPOA 1XV5A 5KTNA 4QAJA 5KO2A 1OY1A 3PXCX 2GPBA 1TFRA 2IF0A 1PLKA 4MP8A 3NKLA 1ENYA 1PGOA 4KJXA 1E6KA 3KVOA 1EDEA 1QYDA 1NF2A 3L1JA 2Q1YA 3M8RA 2D2IA 2PQ2A 2QTMA 3AEKA 1QSSA 4MFCA 3DWIA 3GUVA 5IC6A 3SKVA 3Q1KA 5JS6A 5JVDF 4L0MA 1BMFD 5IJAA 4ZC1A 1JFFA 4N4AA 1BVYF 1LLDA 3HEMA 1QS0B 4C0LA 2PE5A 2NM0A 2C4NA 4EHLA 4TL8A 3O4FA 1M7BA 5FL3A 2DQNB 4D2IA 5LZ2A 2I99A 5EKTA 5C1IA 2QLBA 1QRDA 2WY2D 4R9RA 1KY4A 2ZSKA 4PINA 5IRCD 4B81A 4HF7A 3WL4A 5EMHA 2II6A 3AM1A 4EP1A 2MA1A 1W6RA 4HP8A 2OXOA 4KL8S 1E58A 4RQ8A 3ZK9A 4Q05A 2ZCJA 3QXHA 1I7PA 5U4XA 3MILA 5K8UA 2O3RA 2WPDD 4EZBA 4R64A 2BTEA 4N5DA 3ISTA 3FZNA 3B5JA 2X0RA 1CQIA 1Z7YA 2RGNA 1ZQPA 1UK8A 3QOFA 2XVMA 4XIFA 4UTNA 2F00A 3OOWA 3SE7A 5C53B 2I22A 4RQ0A 3GA0A 3BJRA 3B82A 2E55A 5JXIA 3UT5A 4LW8A 3S5JA 3R3YA 3E3OA 1KO8A 1ULBA 3WK8A 4P2BA 1AKUA 4PHAA 4XI9A 2HXGA 4EGFA 5TMPA 4D9KA 1JJAA 3UAWA 1V0JA 3THVA 5CFPA 3OX2A 4EQ6A 5AVVA 3F6BX 4JXJA 3DCNA 4NK4A 1RM0A 1FTGA 5IM4A 1C8VB 5J2GA 3PJFA 3D2SA 3L1UA 4OF4A 1EFRD 2YTUA 1M54A 4XM1A 1N0HA 1APBA 1W2GA 8ICZA 5HOEA 1XO0A 3BWMA 4ZVQA 2G88A 3ZUGA 1RZRA 3BXPA 4O4HB 2QRNA 3ZJ4A 2PUVA 1PQYA 3U80A 4Q4AA 5EGSA 1VDVA 4JKOA 3IVAA 2NOAA 1U8UA 1ORWA 1YA8A 3RR7A 4M99A 4IKPA 1XLWA 3N9IA 3PSAA 3Q41A 2XCTB 3UAOA 2ID4A 1OI7A 4JV2A 1VPVA 1SY7A 1XYGA 4XJXA 5IVIA 1YDMA 3I9V6 5T8KA 3KYDA 5EVJA 3MB5A 5BQ3A 4KMRA 4B3TB 2D8CA 3BD8A 4UNQA 3UA3A 1MH1A 3LZDA 2R751 3N0RA 4LYEA 4QFDA 4OHKA 3KCQA 4V38A 5FOVA 2CLSA 3E8SA 1E7SA 4DNPA 2X15A 4XWWA 1I30A 1E92A 3S27A 1PJ8A 1PUXA 4ZTBA 1DRJA 3CPJB 1UM8A 5K20A 2LYAA 2GF2A 3DEIA 1X94A 5J2AA 1DRWA 4DJ5X 4WINA 2HBYA 4MUFA 2PPVA 1XTRA 1PWZA 3K75D 4MQUA 3Q1LA 3NGXA 1DRVA 5F9LA 1BROA 2XVXA 1U9ZA 3GMTA 4I55F 4ED7A 4W9NC 4R2LA 3C5CA 3IPAA 5EYPA 4DXAA 2H3FA 1FY2A 5CFMA 1BCRB 1NRIA 4QBFA 3E4DA 2ZROA 5ALEA 2FLNA 3UK1A 3PPYA 1ZD1A 5FFMA 1SHUX 1MF7A 5JV5A 3GUCA 4KLMA 2PXAA 4DV2B 1FZTA 2DR3A 5F2EA 1F7UA 2PRSA 2ZEJA 1Y4SA 1L5FA 5FI3A 1N78A 3M8KA 2HLDD 4DWOA 4FOOA 1FQJA 5AHOA 1UF9A 1RI5A 2VH1A 1TMKA 3TCXB 1T3ZA 4JOSA 3WGNA 2WBLC 1VP9A 4MUEA 3LBYA 2PUDA 3EDMA 2DULA 3PIDA 4HDNA 4DZRA 5IKOA 2ZIVB 4LMPA 3R6GA 1H66A 1FDWA 2WV7A 2Y76A 1R3DA 3TJMA 5JSZA 3BAZA 4PTYA 4CIWA 2OV3A 4I9GA 3OHBA 2X5NA 4BAZA 4JCCA 4ZT2A 1ZM3A 4FP9A 1CQPA 3DTVB 4A82A 3DMGA 7ICGA 5EIWA 2ORIA 1MG0A 4NPHA 2HK7A 5G4LA 3LUDA 4QUBA 2DKZA 3QNMA 1KLNA 4PLWA 3WI7A 3DUFB 3MXTA 2R84A 4U2EA 4Z9AA 1VLHA 3VNAA 3W1EA 4FDAA 4QZ9A 1MB9A 1OAKA 5K8VA 1KOFA 4W8OA 1XZFA 1D6SA 4H0NA 4C5AA 1T8EA 4KIJA 1WB5A 2H63A 1XTTA 4C07A 3T4PA 2ZE7A 3LY9A 4OQFA 3ORSA 4MCJA 3Q8KA 1KS9A 5SY9A 4AO7A 3H0CA 1M66A 3RB8A 2LBOA 3ZXXA 4U6SA 13PKA 4IR9A 3CNQS 1QCKA 5H0IA 3C39A 4RMHA 2DBQA 4LOKA 4H15A 2C4WA 4RZHA 2Y0PA 5FTWA 3EAGA 4QW8A 2JL1A 2B6GA 2KZ3A 4Z6EA 4YHBA 1R4NB 1PJSA 1G20A 1FRVA 2NLOA 2VT7A 3OEYA 3M5DA 4WBXC 1BFUA 4IO1A 2J9FB 3QW2A 4XQ0A 3EXEA 3S55A 4A7PA 3EXHA 4XR9A 1GTMA 3I1YA 4F46A 3AM3A 1E64A 3SEFA 4RD6A 4Q1AA 5DTJA 5L7WA 1J39A 3KYCA 4YUYA 2EH9A 1BCSB 2VK8A 4D3XA 4F21A 1NFQA 3L0YA 2FA9A 5H83A 4PAMA 3QYPA 3LXUX 4E33A 1ORDA 3GFRA 2NPOA 4DLTA 4L3OA 5EZSA 1Z4OA 3OJ0A 4PC3A 7REQB 4HRVA 3KEOA 3EUAA 2HUPA 1Q57A 4J1QA 2C98A 1KI1A 1QDEA 3KUXA 4KXYA 2Q3FA 4EJSC 3C8HA 4OJQA 4V0LA 4CQLB 5ERGB 2VRCA 3A32A 3OLZA 1U8AA 4TMYA 1RU3A 3AL3A 4TV9A 3A27A 1I2DA 3AY7A 5AT1A 3RS9A 2VDVE 3A1WA 2N0SA 5A2GA 4L4RA 2XKKA 4JNKA 1MVNA 1W0KA 1RTKA 4P0PB 4QM7A 3E3NA 4N5MA 1KQ3A 4GXKA 3WK5A 1GU0A 1M2VB 4YRIA 4HDSB 5B36A 4IMIB 1QO0A 1HPLA 2XDQA 1J2NA 2OA0A 3MWEB 3EUB2 4FWTA 4Z8YA 3QF7A 1E1LA 4H6VA 4LRQA 3CR3C 4KK3A 2OHVA 2E85A 2ASDA 3O84A 2VAXA 5LYJA 3GVCA 3I09A 2QZ4A 5I7EA 3H8WA 4IRXA 2EW8A 4QQ8A 5CFRA 3RRYA 4HB4A 1BVUA 1A50B 1D2HA 1WM1A 4UBNA 1FFSA 4CETA 4DUGD 3CRQA 2GFIA 3UZUA 1IUOA 3GGSA 4G5XA 1HDYA 3P2EA 4RVSA 5T6BA 1GRRA 4RJLA 1Z68A 1XQXA 1KKMA 3LKVA 3KQHA 1M2OA 1X80A 1W4CA 1K1QA 2B30A 4HGRA 2BSXA 3S6JA 2AQ8A 3ZYZA 4GUDA 4D8VA 1T2CA 3M2PA 3HR7A 1TCVA 2OBXA 3M4NA 3KYJB 5IJXA 1YB7A 3AP2A 3W8DA 2P6PA 3G1WA 4KRGA 3K6RA 2D4HA 3GAZA 1PS9A 1VJCA 1KI9A 2H2IA 2I3BA 1H6BA 1VCOA 3A2NA 2W2KA 3GJ8A 3CZQA 4AN4A 4IIJB 2Z83A 1JJFA 1RBMA 3KLNA 3I64A 1PT5A 4ELVA 1DFHA 5DEIA 1YKGA 1Y3FE 1EG7A 1SXPA 4OATA 5IIIA 1K98A 3KIPA 1H2XA 3HDQA 1Y88A 1EGAA 1B0UA 5CDSA 4MKZA 2V54A 3N0TA 2TYSB 2EBHX 1B0AA 3KPYA 1VE7A 2TS1A 4GM4A 2CEAA 1WYGA 2RCNA 2QMUA 2CLFB 4Z6CA 4QOJA 1KSHA 2G9ZA 2ZUWA 3M34A 2C5LA 1JEQA 2OCYC 6REQB 3U48A 1U0LA 5BSKA 4PZPA 5CT9A 3DVAA 4KLAA 4P4MA 3AR9A 3RTCA 1XDWA 4NDAA 3IMEA 4AJKA 3HVIA 1JLLB 3P2JA 2H9YA 1BX1A 3M6UA 2E89A 2PZKA 2ZRGA 4BGDA 1ESNA 3VPCA 3QVWA 1BPEA 3O82A 5F7XA 1QGZA 2ZTSA 1MH9A 1E60A 2FTKE 5CLJA 2GWHA 2VHQA 1YL6A 3ZLUA 4RY9A 5F23A 3B3FA 3Q12A 2OB2A 3JSXA 1WLSA 3T5DA 3C6MA 3Q7RA 3K31A 4LBYA 2B9EA 1IZ7A 4TQUS 4U3JA 4IOJA 3LW7A 4ZO4A 4MKRA 1Y48E 5J0RA 1JPVA 3D0KA 3GRZA 2PGXA 1PR5A 4YAGA 4PLFA 1R5OA 2CB0A 2VDPB 3AI7A 2NSDA 1MRZA 4J9RA 1QWSA 2I6SA 4WZBB 4U2KA 5D00A 5LWHA 4ALMA 4AT1A 4C6TB 2Q4DA 4NU0A 3JVVA 3UAVA 1XLTA 4JA0A 3HWRA 5BUCA 4B3DA 1TA9A 4ED8A 2B8NA 3X1KA 4LPSA 1E62A 3PT9A 3FB4A 1SVUA 2X58A 4IPTA 2CHGA 2AZXA 4IUCS 4RHXA 3SI8A 4O4LF 1KRXA 3H8SA 4ZXPA 5EQJB 2I7VA 2HV9A 3PC8A 2O07A 4LZDA 1KYXA 4JI0B 1TCBA 5ALXA 1ESEA 6CHYA 4AWBA 2AG5A 1JEDA 4MWGA 5FR1A 1LI5A 4KE9A 5IKXA 1QU3A 1GFSA 1VPEA 1QG6A 4M22A 2PA3A 5EY5B 4YDSA 3G1TA 3IPRA 2PRZA 1IZZA 2XUPA 2IQ5A 4P4GA 3HSSA 2GYWA 3TQOA 3O8QB 2QVZX 3VH2A 1O6CA 4QWWA 2NPIA 1TYAE 1DUIA 2L82A 4MKFA 5CG2A 2ENUA 4RLSA 1UJ4A 1S3SA 2ZPAA 3WLEA 4NOJA 2VN8A 1WCIB 3OEEA 1XI2A 3LBHA 3L1IA 1KJ9A 4H7HA 3TL6A 2A86A 4M9JA 3S40A 2BCRA 2O1EA 1TRKA 1OASA 4L5BA 2J3DA 3PGVA 4C7OB 5KNCA 2O8CB 3ZK7A 5FAXA 1DJNA 4DNFA 5ALHA 2XH8A 4QKQA 1EDDA 4QLBA 2Q9BA 5BN3A 1U0FA 5IVPA 4INAA 4P4NA 1NNLA 3PJGA 2H4HA 1PFKA 1GQOA 4PC7A 3OIFA 1NMZA 2E8MA 3EH2A 3DCIA 3MPUA 2IRWA 4J94A 2PFKA 2CNLA 3RSZA 2GZDA 3T3OA 2OBBA 1G8MA 2EZZA 4IDBA 4RJIA 5EJ6A 1F4VA 3BWYA 4PRKA 4P31A 1CFJA 3YASA 4XWGA 1Q1GA 3GLGE 1Y5LA 1ZQGA 4R69A 3OF5A 3GEDA 1AD2A 3R3XA 1N2CA 5L45A 2QHXA 3X2SA 1SKAA 1JR4A 2CNBA 2WUWE 1EVJA 1WP4A 3PWSA 3RJEA 3RAJA 3RBEA 4I2AA 2E8NA 1MVLA 3STTA 2NU7A 2VSQA 3C1AA 1K4KA 1V11B 5K99A 2WSSD 3ZWAA 1VKOA 3CZ4A 1ZIYA 2ZB2A 1U3DA 1QRSA 2W6IA 4LHVA 3SLGA 4PLTA 1YFJA 5IWCA 1W88A 3ZHUA 3HUUA 4BNDA 5BQXA 1T1IA 2EQYA 3IMGA 2QLMA 3V00A 5C9ZA 1TVKB 1VSVA 4F72A 1L7EA 2DBVO 4ECRA 4F91B 3N0VA 5A6SB 1B0XA 3IBCA 3I04M 1E2DA 4AYBC 1NJ1A 4CM4B 5JNUA 2Q5FA 1RWNA 4KTQA 1KJJA 2YXBA 8ICJA 2E4UA 3BSYA 3PHCA 5F35A 1SXJE 5JYBA 3N87A 3LGXA 1G3IA 4O4JB 2QBYA 1GR1A 1QF6A 3L6DA 5EHGA 2X41A 3ETEA 3OOHA 1I5EA 4JT9A 4YR7A 4GQIA 2YFKA 1Q20A 1S1MA 2ZR9A 2PSFA 2I4MA 3TAXA 4CTKA 4Y6GB 3GJZA 4I46A 3HV2A 2RHHA 1V35A 5F3XB 3DFFA 4NBUA 3B5EA 1BJRE 1JXLA 121PA 4NZYA 2C92A 2JGJA 1HYBA 5ALPA 1UBMS 2QD2A 2AGQA 3ASZA 2GUWA 3JD2A 3RJMA 3GLIE 3K1AA 3MWDA 4U6NA 5KFVA 3WO1A 3PUZA 2XGJA 2M1XA 1S10A 4JB8A 3ZQ4A 3ETLA 5LDHA 1XRQA 3N8HA 1PK9A 4N03A 5AVXA 1D1SA 1RZUA 1ZISA 3OGUA 5ITVA 4HXEB 3T9BA 3F78A 2HU7A 5C1OA 1UWLA 4UM9B 1ECFA 2V7UA 2AJBA 2J67A 4OHBA 5M7EA 5KFZA 3U9SA 2IYZA 4CKCB 3RDPA 5DZSA 4W1SA 3DE6X 1R6DA 3RSSA 3CCCA 2E18A 1O57A 5JRTA 4X8LA 3P0HA 1GZ7A 1S4MA 3SDBA 2QRLA 4FFSA 4LC0A 9ICIA 3E15A 1GM5A 4X5VA 3E6AA 1MT0A 2LGJA 4QZDA 1NUSA 3FRHA 1K1SA 3HNRA 1T2FA 3AGPA 2B1RA 2NNLD 3PRYA 1AY0A 1NYTA 2BMJA 4V0RA 3I6IA 4F1KA 1JJ7A 3CUYA 3PWTA 2F4NA 4C0WA 3DKRA 4EG0A 3RB3A 2WJIA 2AK3A 3Q5DA 2BFNA 4N7RA 4TS9A 5KT7A 1K4YA 1BFKA 3NR2A 4WI1A 2PDAA 3MLEA 4IIFA 2HL6A 4LE2A 2ES6A 1NQAO 2E1RA 2XHEA 3OCCA 1RYBA 2PR2A 5E4FA 5AXCA 4BE9A 5KZMB 3D1LA 1BQEA 1Q0HA 1NXVA 5SY6A 3D2LA 2J5BA 2BMFA 4NMHA 1A97A 3ZDZB 4W9NA 3PD0A 2Z95A 3JZDA 1THGA 5C8YB 2DUMA 1N5DA 3KVRA 3F7TA 2ECKA 5CWRA 5JALA 1QP8A 4DR5B 2NQTA 4GKAA 3K6JA 1DKUA 2W6OA 1MW9X 3T5PA 3HYLA 2QARA 1B43A 4D26A 4OQXA 4FX5A 3P4XA 1WCYA 2XHZA 4DSTA 2PSDA 1BDMA 4C3VA 2GAFA 3IIJA 2A9FA 4PV7A 1HQKA 3OZXA 4FZRA 5HDQA 1THMA 5A0FA 1I0IA 1JI7A 2PCLA 1W1IA 1LPMA 2VUUA 1V38A 3QYJA 1LB1B 1S3FA 3U17A 7ICFA 4ITVA 4QUHA 1JFTA 5BR7A 4XIIA 3CH5A 1T2NA 2W70A 3SMQA 4E3WA 2A5GA 3T4XA 4ARSA 4OYYA 2WB2A 4E2FA 2CL0X 5HS4A 3FHCB 4GS5A 2NU6A 4P3OA 1S0OA 1VL0A 1TQHA 3MWGA 4ZVUA 4X24A 3HZZA 1VFPA 4HNVA 5I47A 2OG2A 3OIUA 1U49A 1VMKA 1E1QD 1K6IA 3I62A 3ZEIA 3IDQA 3Q87B 1T9ZA 1EP2B 2F67A 3IPCA 1Q7RA 3AQFA 5GONB 1CYEA 3MC1A 3NIBA 1DAOA 4PGMA 4HYYA 2D8MA 1J2RA 3AYZB 2ZIUA 4FLFA 4N9WA 2E1FA 4J16C 1PFYA 1GTJ1 4DWIA 4J2OA 2QLLA 3SNKA 2QPOA 2ETVA 5JVDA 1DBIA 3Q8WA 4BWVA 1DS6A 4QWMA 3WOVA 5KNBA 1KI6A 4M1YA 4C7XA 4DPKA 1NVEA 4K6KA 3U1TA 1SVOA 2IYSA 2ZE5A 4ZVTA 3T06B 2PU7A 5IZCC 5HSGA 2IV3A 2F77X 4WN3A 3W05A 4PZLA 2LYHA 3ILVA 3HI4A 2Q4EA 4B7ZA 3C3CA 3NWJA 4ZEWA 2QY9A 3CN9A 1ZM2A 2IEZA 1ZGAA 4MW2A 4DIBA 4AM8A 3RJ9A 4P6VF 3WL7A 1RWQA 5CDFE 4YRZA 5JCOC 4EVIA 3NVKI 4UPVA 2P75A 2APJA 1K0FA 3LOUA 3GJ7A 1QUFA 1T6YA 4QXAA 4MO2A 3PIRA 4DQPA 3DBHB 1MEJA 2C1EA 3SBOA 4FD3A 2OZPA 4MWOA 3F2DA 4PAOA 3KXDA 3CLSD 4U7TB 2H17A 1QTQA 5K51A 3JQPA 4RUCA 3LUHA 2F3UA 3QHQA 2RGNC 2YWFA 4JYMA 5TJ9A 1DVRA 1W5TA 3BMCB 4YK7A 3QEOA 4M86A 4CTMA 1N7IA 4C7YA 5CIWA 3K9NA 3GZJA 3H4MA 3BZBA 4BMCA 5JY1A 3LVRE 2DERA 1ZICA 4L22A 4KAJA 1SHJA 2R1TA 1G5PA 2FEKA 2XUGA 2QP4A 4Y7DA 4UE6A 4MS3A 5HFNA 1QOZA 4DSJA 5JANA 3B8HA 3E9MA 2Q4BA 3HDGA 4AQYB 1NXOA 2V7WA 4PGFA 4CHGA 3MMNA 1NVTA 5HWSA 5H5JA 4RGBA 3L8HA 2FV8A 4Z4IA 3WU2U 1K2VN 1FXUA 1U8EA 1ZKMA 5FJIA 5CXUA 4CKZA 5C5CA 4QASA 4IW3B 2ZI5A 3BWBA 2LWIA 5K4GA 2G7ZA 5THXA 3ZPXA 2VWPA 4PM4A 4MMZB 3ALRA 2FUG6 1XF1A 4K46A 3CONA 2JLSA 3OE7A 4CKEA 4OAQA 3G7UA 3IP1A 4LXGA 3EZXA 1I4LD 3KC2A 4N9QA 4PHPA 4XLZA 3MWYW 2ZSEA 1T5SA 4M0AA 1EJ2A 5DH9A 4YUWA 5ICMA 3B9BA 1UT8A 2BEKA 4BO3A 5T8KC 2W0SA 4ARVA 4GXIA 2GD6A 2QDXA 3VOBA 4YFVA 3MK31 1HOTA 2O2ZA 1IZ0A 2P5SA 1C2YA 4RNCA 3NLLA 4YACA 3W5BA 3D5QA 2C84A 4UOEA 1V4BA 2ZP1A 4UAGA 4I2VA 1H6DA 1P7PA 5CAEA 1T26A 4PIPA 4IC9A 5G4KB 3NHKA 1PYDA 3LF1A 4EL0A 2Y9TA 4CZ2A 1KEEA 3GEBA 1J8QA 3T7AA 4ARBA 5C5JA 3J81k 3OLQA 3ZU6A 3IM1A 4CHTA 1GZVA 4HC4A 4LMAA 2YNMC 4I55A 1EDOA 2JAUA 2Q4RA 5CEJA 4RFLA 2HAEA 2B0JA 3E7PA 1RKQA 4MMXB 2ODWA 2PS9A 1J23A 2G1AA 5DDIP 2FPOA 3BE4A 2MSDB 2GTHA 1UPAA 3USZA 3D6UA 5FBRB 4GOOD 4DR4B 2H3ZA 2ZJYA 4A6DA 3LBNA 4Z9XA 2WFMA 4Q6BA 5B66U 3P0RA 5LUAA 2JGDA 3H2JA 4XWAA 4TYMA 2JKVA 4L9RA 3ICVA 3CEMA 4CDMA 2R2AA 1Y33E 2A58A 1UWVA 2YV5A 1MN8A 5J0WA 2FSPA 4HSEA 5FA8A 1ZBDA 3MJCA 2OO7A 4CM8A 3N1UA 5DM0A 3FMIA 4FFRA 3LPAA 4BVKA 1X1TA 1GYRA 2H1OA 5F9FA 1OFVA 1ZIXA 4CN8A 1LK0A 5AFSA 3GFVA 1IEWA 1V26A 3WWPA 3ZDAA 4C08A 1NIPA 4MF8A 1AROP 2V65A 4BE7B 2QX4A 4II3A 5FBZA 1U11A 1NR1A 5K0TA 1IG0A 4ANFA 3C6ZA 3KUUA 4H6XA 3KQWA 3KVYA 2XGOA 4Q3EA 2PKQP 4P58A 4WH0A 3A2LA 5CD1A 4OFZA 2V7QA 2DBYA 4U9UA 4BEWA 4LMRA 1ZOPA 3TSOA 2QMZA 3EBOA 5BURA 5DYYA 4B5KA 3T7DA 3I61A 3FDJA 3MABA 4MDYA 4L57A 4UW9A 1QGAA 2A94A 1JHVA 2ZOSA 4FUQA 1E2IA 4ZYVA 5ABPA 4W9MC 4WWHA 3GRPA 3TN7A 3WIUA 2J7PD 5DDMA 3T61A 4OQEA 2I6FA 3EPRA 4U5QA 4I1OA 4DM7A 4AJOA 1BS9A 3NVAA 3ZUPA 1VGRA 1E5LA 4NENB 5KQLA 2R44A 5EIHA 2XB8A 3H42B 1C7EA 2IPMA 2C29D 5C5IA 4HWRA 4GVLA 4AD8A 3EZFA 4O3RA 3DWFA 3EXHC 3GA7A 2RONA 3E82A 1KXZA 2ON6A 4N48A 3GQCA 1II8B 3W6PA 4L3VA 2MAXA 2H6EA 4DUZB 3PJRA 3K5WA 3NEAA 3DHVA 1NKSA 1T4DA 1SKYB 3B9PA 1X38A 2A9OA 1T94A 2QTNA 3DZHA 2JJYA 5KOJB 1DG1G 3TX2A 2CL5A 2VEOA 1I5RA 3DM5A 5AVUA 2P3LA 2ZB3A 4YN4A 2C5AA 3VR1A 1ZD8A 1OF1A 2J9YB 3F6PA 4IVPA 1MAUA 4Y1RA 3BS7A 4AY5A 3EIQA 4KQWA 2HHCA 4IQ4A 2VI5A 2IHYA 2C2GA 4JJGA 4UM7A 4O2BB 5B7GA 1DO8A 2ZI4A 3TLKA 2ILTA 3EGEA 2ZIWB 3M9OB 4HAOA 3RF7A 2WOOA 4LOJA 2KMDA 4TT3A 1JPNA 4BKUA 5NLLA 1KO7A 4JU8A 3UVEA 1OKKA 4IX1A 5K6RA 1ILEA 5AXAA 3O7MA 5KFFA 1A5TA 1TW2A 1DT3A 4D8WA 1L5MA 4DL4A 4C4ZA 4JJAA 3OPYI 2QN2A 2JBHA 2QUHA 4OGKA 1TI7A 4ZEVA 1BVSA 1GAJA 1YJBA 2GDJA 1E2UA 5I7UA 2YZMA 1G41A 1GT6A 3B1WA 1QANA 3Q0IA 5FWYA 1XF9A 2OPHA 2O7VA 4C4PA 4ZCSA 4P0QB 1CJKC 3GGDA 3WLKX 3U7HB 4G4GA 2NG1A 3FJYA 1SURA 4MIKA 3QFFA 1P9NA 2R6CA 4NHOA 3DLHA 3E5NA 1CY2A 4KWTA 1NQ5A 4J8PA 4OP3A 4J91A 2B8JA 4D6PA 3JPSA 1NRJB 2BFFA 4F2GA 3NM5A 4ND8B 3FPGA 3HKEA 2H06A 4V2UA 3AJ8A 3CH4B 3GOQA 4KQ2A 3FBGA 1USKA 2B3DA 3JQEA 1V2HE 3TTYA 2JCVA 2OQIA 3WBJA 1KAQA 1UT5A 4D8UA 1RKBA 3RJJA 4TSFD 4A8JB 3GZNA 2X0DA 4WFKA 2JJ2D 1FIQA 1K97A 2J5QA 1HT2E 3RSLA 3O91A 1IEQA 2Q3JA 3P26A 4C5BA 2HDHA 1Z6XA 3OTWA 4C0BA 1MAWA 1B26A 2A2ZA 1OWMA 3A3NA 4JB2A 3BEDA 3ORYA 3FJ1A 3KHHA 3KZCA 2UYGA 3V4SA 3A2KA 5E6SA 3NHAA 3UT0A 4R81A 4JYCA 3HN6A 3MBKA 4DCJA 3BMXA 4LX0A 3NHLA 1J8VA 1VCHA 3ZV4A 4KH1A 3FTDA 3ZH9B 4TVOA 2UYOA 4KUHA 3RU7A 2PXIA 1OA0A 2QV0A 4UE3S 3EW9A 1Z63A 4FB4A 1IY0A 2J9XB 5BVHA 4X84A 4F5OA 5FDFA 2I3DA 3GT0A 2UZ1A 4RAQA 1EB9A 1CNMA 4IEIA 4S2UA 4LQLA 5A71A 1Y8RA 4CG1A 3REGA 1YJQA 4HEQA 1GG2A 2VJ5A 2VRNA 5AI4A 4J9MA 2BMEA 5A9SB 3TI0A 1T9AA 1V3TA 4L78A 4UVIA 4QJBA 4B8ZA 1AKTA 1ISFA 4JK3A 4FGZA 4PFSA 5DTEA 3NG1A 4LFBB 1NONA 4DR2B 5FJJA 1QK3A 4EG6A 1FJHA 1YHZA 3MWKA 4ZVRA 2QRJA 3ASVA 8ICPA 1E7YA 4LHWA 4ECQA 1NK7A 2VK1A 2XUIA 4ISCA 1G3MA 2P3OA 2I2CA 2WT4A 3DAHA 5FWXB 2JFYA 3BXGA 1Q84A 3FUUA 3K4PA 3O73A 2WF8A 4XWOA 2OC9A 4RDXA 3U7GA 4MRMB 3KSBC 3DL4A 1JIQA 1RYRA 3ZCSA 5I8ZA 1P2FA 1KBUA 2R48A 2CE7A 3RS3A 3K0SA 3HDYA 2QS9A 3VRHA 1Z7BA 3CPSA 4I50F 4YJDA 2NUPA 3D8SA 4KIGA 2ZJFA 3D8RA 3MLBA 3SSNA 3IC5A 5JI3E 1DIHA 4FNOA 3T9CA 4K9QA 3GROA 2R8BA 1ZBQA 2R85A 3WTBA 4G4SO 2AUNA 3JQ8A 3I76A 2GJAA 1YIDA 1ZQ1C 3BFJA 3HDVA 2NSHA 1C7JA 1U9LA 1PV2A 1GU1A 4DABA 1HFWA 3CLVA 4LFAB 4RY8A 5C1PA 4UAVA 2IHBA 5B55A 1DX4A 1LH0A 5ELMA 5D5PA 1FDRA 2P6NA 1D9DA 5FO1A 3SEQA 3PC3A 1YVUA 1YO6A 3WB9A 2F3TA 2ECPA 3INRA 1XOIA 2DPHA 4EFLA 3FTQA 4C89A 5AHKA 5DLDA 2NXWA 3LCVB 1W36B 5BRAA 5BSUA 3F1KA 3I28A 2YTZA 1Z6ZA 2YCLA 5C35A 5BQ5A 3CTPA 1EEXB 2RE8A 2AR9A 3OCUA 1I24A 1TPYA 1JA1A 1GZSA 3E22A 2VA2A 1OXVA 3LHFA 3Q7PA 4P4UA 2QB1A 3WJAA 1L7NA 3D3NA 5IDWA 1Z6AA 5LQKA 5CA0A 1MRSA 1TV9A 1LRLA 2H2GA 4CCYB 4K6FA 1NN5A 2P5UA 4J16A 1N25A 3PJEA 9ICTA 5GIOE 4UHEA 4UBIA 2V03A 1VSTA 4Q8FA 2EFCB 1OZ0A 621PA 1BRTA 1GNTA 3H6HA 1ZVMA 2CBGA 2MU2A 3Q15C 1RRMA 3E5HA 5IZCA 4EH1A 4BXOB 3CKLA 1HRKA 5LA6F 4GPD1 3D0RA 1JFSA 1KW4A 3HB4X 4ZYXA 5KYUB 5I4BA 1H65A 2D59A 4HVLA 4UCWA 1GNSA 4D3FA 1AC5A 1MIOB 5JCOA 5BYJA 4MCHA 2PMZF 4GW3A 3LT5A 3I9NA 4CRWB 8ICLA 1KRPA 1M1XB 1RT9A 3KTAA 1F17A 4Q7QA 4KCGA 3CWCA 1Y7LA 3I39X 3BDAA 4QQRA 2HJ9A 2Q7DA 3IBSA 4YJHA 5ILGA 4LMBA 1RM4A 2OXFA 3G02A 3CFYA 4LJYA 2HMTA 4G9GA 5J58A 4BWMA 4HQ6A 2COKA 2N75A 2WJ6A 4WJKB 2E5LB 3JVEA 3LW8A 3N07A 4BUGA 2ZI3A 4FMDF 3FNQA 1ISJA 4TUPA 1UZLA 1C1YA 2I34A 2BCEA 1KEWA 5F5LA 2MYTA 3AF3A 4G67A 3WRXA 1Z25A 4QNLA 3FVRA 4WOCA 4BP9A 4EB6B 2SKEA 1K92A 5E0KB 2VAMA 8ICTA 1QHFA 2D7JA 5CLQA 1KP9A 1U1FA 4I6GA 2ZYSA 3V7LA 1KH2A 2RK3A 3CF2A 4YI5A 3DG9A 3D2AA 5DN9A 1LGYA 1DZIA 2EHDA 1JXAA 3NNSA 2GPTA 4KQ6A 3WGIA 1L3VA 5HNKA 3ITDA 5KUTA 1MO5A 4ZVSA 5D1NA 2CUKA 4O1IA 6ABPA 3QQ5A 1X74A 3D59A 4M1WA 1FZQA 1K7EB 3B1FA 1JHOA 3CMCO 4CEIA 1IZ8A 3HYTA 2J31A 2RGUA 1JIVA 3UJHA 4EZEA 4X8MA 4GP6A 3WDKA 4EHDA 3A10A 1LPSA 3F5FA 4M6WA 4DM3A 1IIBA 4TXJA 1LV8A 5EFZA 1THTA 2FAXA 3PFWO 2YMLA 2DPJA 1P5JA 2Z2ZA 3E35A 3IAS1 5F3RA 1JLMA 1HUOA 1MAAA 3WKDA 2HMYB 2FFAA 1FP2A 2VYVA 2ATVA 5C4GB 1C1DA 2CJPA 3IUEA 2NYUA 4G26A 1G8PA 3LY8A 3L8GA 2PV7A 2F64A 1LQTA 4R3NA 2VNHA 2WHXA 3TNDA 3HR4A 4GO1A 2UVDA 3ZXUB 1PJ4A 3W2HA 2VNJA 3H19A 1MXHA 3P4UA 2YNMA 1SEPA 2FZLA 3QU7A 2C5EA 4Q12A 1GSAA 3F4BA 2ZJ4A 4BP1A 1FMCA 3KSUA 3MUFA 4PSKA 1GTZA 4UCFA 3EPJA 3UMBA 2P2CA 4N7JA 3QEBZ 2Y0DA 5J4LA 2C7BA 1E4EA 1QYIA 2C96A 5JQGB 4MIOA 4HLDA 2HREA 3Q7EA 2W4MA 3LHDA 2OZEA 3R7SA 1I2MA 3QOWA 3MS2A 2V6FA 3ETNA 3PZBA 4CT4B 2ZBDA 4AJPA 5BV8A 4DDTA 4XUEA 1ZUNA 3DB2A 4OHYA 3HO6A 3PEEA 3LWZA 1ACMA 1JKXA 1ZM9A 3IUBA 1T0UA 3CRRA 1VFNA 3TVTA 3ILXA 4CQMB 4IJKA 1BOFA 1E9FA 4YT8A 2H1HA 1Q6YA 3BIOA 4H7KA 3NOXA 4O2AF 4L4XA 4XM0A 4U4AA 1F7VA 4YCXA 5EWMB 4TKUB 1WZCA 3OQHA 4LGCA 3ZZ0A 3DF7A 1LKYA 4PYRA 1JU4A 4NLZA 1SM4A 2ESRA 2FPRA 2V8OA 1C81A 2PEZA 3NDRA 2EJCA 3T54A 3ZHOA 4TZ0A 4NG5A 5DWVA 3T1YB 1EUZA 2OAEA 3AERB 1D8BA 3FKSA 2AHOB 1RI4A 4POAA 1FS4A 1EP3B 4BP3A 3RJGA 5DT9A 1JHYA 1BX3A 1SZHA 4GLFA 2E49A 3B13B 2JLZA 1NK0A 3QH4A 1TJYA 3WHKA 1GDHA 3TAPA 4KR6A 5JYEA 1PO7A 4GMHA 1VLJA 4HNRA 2NTEA 2VCEA 1GA4A 4IDGA 4JR0A 3K20A 4RIFA 3DMYA 1IOVA 3E48A 4EKEA 3O3MB 2H4YA 1A5ZA 2FPGB 5FPPA 3V8PA 3ZVRA 3ETGA 4MEAA 3HBJA 1Z0ZA 2VEDA 1GLNA 3QBVA 4I2CA 1P9WA 3AVWA 3ET4A 5EZYA 3OZTA 3HH8A 3CNLA 2C03A 1YHNA 1S02A 3REQA 2AYYA 2DFTA 2EIHA 1JLHA 3P9RA 2NZYA 1I2BA 4HZUA 2CNDA 2H9AA 5DG8A 5JECA 1K68A 1DE0A 3R6DA 3S99A 1ZQFA 3IJPA 2WIJA 3ESAA 1UWCA 3PW5A 3EXIB 1CUHA 1EGMB 1T5BA 1CP2A 2RC6A 3GNQA 2V6BA 1UC5B 1PZXA 1U5BA 1WA5A 3RVRA 4NOLA 1QZ3A 3FF1A 1C14A 1KTVA 3X1DA 4KLUA 2HPZA 2C22A 4NULA 2B99A 4AULA 3R9XB 5CGQB 2FW6A 3K0CA 3WWCA 4W1PA 3IQFA 5ANRB 5C3UA 1QYWA 4FDUA 3G0CA 1MAVA 3CVUA 5CBKA 2MSCB 3H86A 4JASB 2ONZA 1RC8A 4HEHA 5FHRA 2FLVA 3VGJA 2VTVA 4LF8B 2PWZA 3C8ZA 5IJ0A 3WLMA 2BRUC 4HQOA 3BWCA 2QRQA 2QVGA 3RHTA 3T5LA 1LBEA 4OUDB 4B5LA 2YS6A 4K81B 5FXMA 5FL7A 4X1YB 1U2DA 1SZPA 2HHTA 3BJEA 2PX4A 3PI7A 4MGEA 2IYTA 5AW6A 3UXEA 1LJUA 4DJAA 3I5MA 3IUMA 2LM1A 1SNYA 5JJKA 5KFJA 4QU5A 1QH0A 4WKBA 1TM5E 3RG2A 3PO5A 2GEKA 1J8YF 2UYQA 2UYHA 3OY2A 3F73A 5B64A 2I33A 1NG1A 2OT3B 3ZWPA 1XTJA 3EX7C 4DLZA 5BWCA 4Q1CA 5L4NA 3VR2D 2W0MA 1FNNA 4JJ7A 1U81A 3JAWA 4DNQA 1YS6A 3PGMA 4J9VA 4Z49A 4BECA 1G291 2Q3MA 2H0QA 3BN3A 1OCEA 2HA4A 4OB7A 4F6RB 3PX2A 1I4WA 5EWFA 2JZNA 4NLBA 1L9XA 1KE2A 1R8YA 4NCIA 1PJ3A 4YDHB 4DIOA 4OQPA 4BV9A 1PZNA 1G63A 4WZAB 1TADA 1Z8HA 1QKKA 5KQPA 2F8KA 3R40A 4OH1A 3VO1A 2H5EA 3A3KA 3G8DA 5SYNA 4PW0A 3W3AD 4XCQA 2FZEA 4E6EA 1D1PA 3S81A 4IQVA 3FZGA 1NK4A 3TPZA 2GXUA 3AW9A 4JYBA 2WC1A 5A03A 1W8IA 3LO5A 4WDQA 3HQ4O 1JTVA 3A6FA 2R8EA 1V2GA 3WBKA 4N0QA 1IIPA 2QTTA 4KAAA 4IQTA 4RULA 1A9XB 1GGHA 3OPYA 1UK6A 5F21A 4HY3A 2VWHA 3FR8A 2JBAA 4YRMA 1JEEA 2ZSHA 1M0TA 3WGGA 4L8VA 5LBTA 721PA 4HSGA 4TUYA 2CF6A 4CBVA 4G37A 1ZNXA 1VG1A 1C20A 4TZ6A 4PG6A 2ZBUA 3U16A 1UIRA 2CNKA 1CD5A 3STUA 4HYEA 1NV8A 4WXPA 3AL0C 1O6FA 2PGLA 4GL2A 4HB3A 2CXTA 2C2MA 2ZGVA 4EL5A 1P19A 4YHHB 1W5EA 2BLNA 3TOVA 3IR5A 1JT9A 5ARDA 1CUIA 3I04A 2HMAA 5HX7A 3KQVA 4B82A 1VJRA 1V8PA 3FWKA 2ZYIA 3U3KA 1HL7A 4KLQA 2OZVA 3I0MA 3OEHD 1T6NA 1IHPA 4YAOA 3MHPA 2Y27A 1E20A 3WKCA 4C0XA 2NADA 1XTIA 1UBHS 4F2DA 1HXHA 3EEOA 5CM8B 4TTRA 2WJ3A 5HKKD 2B25A 2CDAA 4GRAA 1A7AA 4WIAA 1J0BA 3ZOZA 1NY6A 2EBWA 2JCYA 2WLTA 2G08A 1KJIA 3BVPA 1C0IA 1TMYA 1L7PA 5HMLA 2C9YA 1Z6QA 1NI3A 4FMCF 4OKIA 2BSAA 3V2HA 4Z1MD 4UQOA 5K3OA 3OEWA 1YCGA 4M21A 4MVJP 4Y2RA 3FC4A 5T67A 3PNBA 4PGHA 4R6WA 5BV0A 5H59A 1K3UB 3P45A 1VSQA 4U7JA 3S29A 4A2PA 2YV3A 5I7WA 1D9XA 4YRTA 1G5FA 2RHTA 3PICA 3EZYA 4H0FA 1YI8A 2WTFA 3RK4A 1DXHA 4U7CA 1WTCA 1E6CA 3EXFB 3OIWA 5EJFA 4KXMA 1CUDA 3QTTA 1A71A 1L3BA 4CLOA 4S1VA 3PXXA 1SU4A 2CNNA 2B61A 4O6VA 1OZAA 5EMMA 4JI4B 1SWVA 1PK1A 2QMQA 2HW3A 2BFCA 3MMPA 1QIFA 4X9XA 2IYQA 3EBLA 3ABRB 1NFFA 3DQZA 1TDJA 1NTRA 5CLLA 3HPQA 4WFQA 2AC4A 1ZJJA 3AINA 1ZD5A 4I5DA 4MB6A 3LPMA 4G1EB 4CWAA 1LF0A 2ZR7A 3TWOA 1I5OA 3L92A 1JHUA 4V39A 2GHTA 3DTNA 1L7RA 4NCXA 2GUGA 4DNOA 5JUMA 4Q4JB 3NFRA 1T3TA 2X2FA 2EW2A 4S1OA 2VQDA 2PXXA 4GVPA 2OV8A 3IL2A 1U0RA 1OTHA 3QI2A 3U13A 2KV2A 3VI4B 2P6MA 5FBVB 3C3BA 5BN5B 1B8NA 3MJSA 1ZQ1A 2PR7A 1ZQZA 1TPZA 3WHLA 2F17A 1ZRMA 1C9JA 5DLEA 1DIOB 2ZJBA 9ICJA 1GGMA 1CPYA 2LPEA 4PPQA 3A9UA 3O8DA 5E4JA 4BB9A 4F9TA 4QWEA 3VC1A 4RWEA 3WL8A 3GQBA 3RO7A 2VIIA 4DEVA 1XXHA 2W9CB 5JQWA 5CVEA 2Z9CA 3LOQA 5D3ZA 2HK6A 2OHFA 4ND7A 3G0IA 1EFHA 3FETA 3B85A 1XMQB 2W83A 1OZGA 5GQSA 4LWOA 1GGVA 4R3UC 1LJ8A 1QIMA 4US8A 2Q3CA 2WOJA 4LEIA 3Q10A 3HWSA 1FJ2A 2AWOA 3GLFA 6ADHA 3IEIA 5LKRA 4ZGWA 2O52A 2WU3A 1AS0A 5JYCA 1CLUA 5DSZA 3P0EA 4LECA 2AMJA 5IFKA 3KTOA 2MSEB 1Q2XA 3UWKA 1YZVA 1MIHA 3QEJA 2IHTA 3HUEA 5DTIA 3RRZA 3SWWA 2FPMA 2R60A 1KPHA 1Q44A 4R9NA 1RXCA 3K4GA 2O3TA 2RHDA 4PX9A 2HBZA 4G5GA 3Q98A 3TARA 1OFHA 1XCJA 2YXNA 5TF4A 3PITA 4Q82A 3L0CA 4I4TF 5C80A 4FNGA 5GTHU 1T6BY 3TZHA 5I4IA 3N8KA 2OGWA 2NV0A 4JWMA 3H05A 3VZSA 5F3DA 4D74A 4I8DA 1GTRA 3B89A 1O4WA 4AMVA 5ELLA 3F8WA 4JL6A 2Q5CA 1K5GA 4NCHA 3AFGA 3D3WB 3P0FA 4HWKA 4V0OA 3W04A 3OCWA 4YAIA 3H7IA 3PX0A 2Z5GA 3F74A 3AY3A 1N61A 1IXSB 3SC2A 2VKTA 2AGOA 4JSRA 3I5AA 3C4JA 1YRHA 2W8BB 3PMLA 2VZEA 1UMCB 5CT6A 4IIHA 1YXMA 1FDTA 2VNIA 4AZVA 3NUZA 4JOQA 4EUEA 2AQKA 2GNOA 3W2TA 1QG0A 1GKIA 3HDJA 1ZQAA 4K88A 1WIWA 1A2OA 4XJTA 5CRXA 4KO3S 1X6IA 2X4DA 4PLPA 1SD5A 3C5VA 4HVAA 4CEHB 2PU5A 1I13A 1NJWA 2NAPA 1H85A 4CR8A 4F2SA 3ESZA 5JO9A 3IQDB 4UU8A 5JS7A 4B32A 1EESA 3I30X 4B3FX 4NY8A 1F51E 1DTEA 3DBLA 2XIQA 1YJ5A 5AJXA 3ST7A 2SHKA 3KKPA 4GOLD 5IF3A 4FWIB 5BY2A 4DBZA 1NZFA 4MA4A 1DRUA 2VHEA 4Y2UA 1GV0A 2HTEA 1W0CA 3MTDA 4CT5A 4J3NA 5KYYA 1RC0A 1IG6A 1JKJA 5KG0A 3BL8A 2BJHA 3JW8A 4E88A 4QTYA 2WYIA 1U4BA 3GIWA 3RVBA 3MEQA 1GFZA 2KIWA 4BNLA 4E13A 3MD9A 1A9QA 4MGYR 4DLXA 4OXYA 3THXB 4EMBA 5HIIA 2CDCA 4UMVA 3GP8A 4I3GA 2YQEA 3FUVA 3H65A 2C2YA 5FQOA 3EGCA 4XLLA 2Z9BA 5KSOA 1SOMA 3SJAA 2IXBA 4HADA 3IIEA 3VNQA 7ICPA 3S1AB 2ODTX 2BHRA 1QFMA 5KFGA 5GGYA 1PL7A 3NGLA 3IP8A 4FS2A 1TC1A 1Q1BA 2XMZA 1LFAA 1PBNA 1U8YA 1KVTA 4DFKA 4S0ZA 3VJLA 1KQQA 2OZKA 3OT4A 2FQYA 4RLHA 2OQ2A 5D46A 3SFZA 5CH8A 1MJGM 1KU6A 2KJ8A 3F67A 1BOOA 1JHZA 3LECA 1QU2A 4YRDA 2K7ZA 3A4LA 1FTWA 1R1DA 4BDTA 5HF9A 1JWLA 1N48A 4RUAA 1L5QA 2ZTEA 2LKYA 5ALWA 1J22A 1AX9A 3OJEA 4W82A 1H69A 2I7CA 1ZLYA 3HCNA 1N62A 1Q3KA 2ZYHA 4MWEA 3USCS 5BNIA 3ADBA 4P7GA 1YRQA 3EULA 4F5YA 4RPCA 2F3PA 3OMXA 4F2PA 4LBVA 5H02A 4V0SA 3GPBA 4PFQA 2FR0A 3LVBA 4GYYA 5EIFA 2JAXA 3KM0A 2QORA 1ZAKA 3HK2A 3QKUA 2ES4A 1ZQNA 4JMLA 2C1ZA 5SICE 1YZYA 5EOVA 2BFDB 1UDBA 4X3PA 1ZMRA 4LC9A 3QFHA 2E1PA 3KOWA 4BS9A 1S8AA 3H8JA 2EP5A 1VJDA 4M36A 4I1RA 1Y3CE 4GC5A 4B9UA 4PX3A 4HAYA 5KVQA 3W5SA 3U3DA 1G59A 1C9NA 4HXGA 2WAYA 3O1LA 4CDGA 5SZHB 7ICIA 4M9SA 2YVKA 5CYGA 1IATA 2DHRA 2G80A 4OHMA 1FNCA 4HLCA 4U2FA 2R8RA 1DEHA 4DHWA 1S2DA 4CTNA 1SIUA 3B2QA 1YQXA 1OSNA 1HOXA 3PBKA 4R1NA 5EXTA 4A8EA 5ICFA 2WP8J 2OSVA 4DDWA 9ATCA 2CL7X 4CMEA 2WF6A 2Q6OA 5DF1A 5DCWA 4GMKA 5LC1A 2AXEA 5AM4A 1CI4A 5LA6A 4CMBA 5KFQA 4LY9A 2OM2A 1EXVA 4JU9A 4BMDA 2X0IA 2IDMA 1JG2A 4NMWA 5EEGA 4YUVA 3HGQA 1YTUA 3ZBUA 5G02A 3ZD8A 2ISSD 1OIXA 1Q74A 5J2TB 3ZKWB 4UQPA 1YDHA 2HMSA 1E3LA 4RH0A 4KRYA 2VBCA 2MSLA 3DOCA 3G59A 5E9JA 2C31A 1LPBB 3U4QA 1NYQA 3SJCA 5HPYB 1Q16A 5DKWA 3HFGA 5DBAA 1D5WA 1XKLA 5KG7A 4S24A 4M47A 4MUJA 5KYKA 4GPZA 1DADA 2Y9PB 4KEAA 1F06A 5ESWA 4HDOB 2QN8A 2J3MA 5CM2Z 4K86A 2FFBA 3RAXA 3JZIA 2BPCA 3QVXA 4JL8A 5LQJA 4ZCPA 1KDZA 4MJXA 1RBZA 2OMEA 3JPPA 4B75A 5A4JA 3HL4A 1RJGA 3BX1A 5B37A 3RWOA 1MMFB 4WXYB 4QQFA 3NC0C 3RKRA 1MXFA 2G6BA 4A1OA 4BFWA 2BYTA 3WRXC 2KHVA 1AA9A 4HYTA 3VDRA 2O14A 5KYGA 2B4QA 2D3DA 3DBRA 5IDYA 4K2AA 4NECA 2I78A 1JQAA 4ECXA 1Y8QB 2FQ1A 3M6XA 1NFRA 4AP6A 1C3EA 2GCOB 4LHXA 2GM9A 3N7SC 4LUCA 1XP8A 2O8BA 2QRKA 2FK7A 2BRUA 2QM7A 3CE9A 5IMSA 1MR3F 1XLUA 4NM2A 3BE5A 3S2SA 1KI7A 1Z0AA 5L3RA 3BMOB 1Y8CA 2CZQA 1LNZA 4RA6B 3ECAA 3IN5A 4UB2A 4NPCA 2ZT6A 4QZEA 1TAQA 4GKBA 1ZJYA 2C3MA 1ADYA 3TPFA 3ICPA 2A14A 5L4LA 3GGOA 4ECZA 1DAIA 1WHTA 2JF0A 1L7XA 4V1CB 1AQJA 5IJZA 4ZOLB 5DTMA 4NH4A 4NFHA 3RFCA 2FLLA 1K9VF 3H8VA 4WUVA 1ZU5A 1O3YA 4UCQA 2H29A 1TEVA 3M5CA 3AH8A 5E79U 5DIZA 5EUMA 3ROXA 2PKEA 2NUTA 3H1AA 5TEWA 3NB0A 4MJLA 1ZY2A 3AETB 2A5LA 4R1MA 1YR8A 4LZPA 5E6RA 1KARA 1I4OA 4N49A 1JFRA 3GFFA 1P7DA 4OAOA 4ZIRA 4DBLE 1ZQJA 2ABWA 1E3WA 5JPIA 1AH2A 3EIUA 4MIYA 1QQTA 1T2VA 4BMOB 4I1VA 4S1NA 1JAIA 4RT2A 2YV2A 3JASA 1Y34E 2XD9A 5DHUA 3FDXA 2QX9A 1KZYC 4L08A 1XRLA 2QRVB 2Y67A 3IP3A 3VC2A 3KHKA 1ES9A 2HB6A 4IOMA 3AU8A 1M3SA 2P2ZA 4JUZA 2WILA 3MINA 4OHRA 1NJYA 3FOFC 5DN6A 1RWOA 1GDDA 2UKDA 2I71A 4MYUA 4FFOA 2I1LA 3IQZA 3BWEA 3NIDB 4JAVC 4LJ8A 1NU6A 4O5CA 1GAEO 1RNLA 4X41A 5I7VA 5FNVF 3O47A 3IQWA 1QZUA 1KZHA 2PSSA 2FUEA 4RVCA 3LIIA 1Y5NA 3RYFA 4I5GA 5ALZA 8GPBA 1NQOA 3AI1A 3K0FA 4GU5A 2GAIA 3OJOA 4WESB 5BWMA 1K3TA 3DDCA 4UD6A 2OEHA 1NQTA 2LD4A 5FT9A 5ES4B 1RS0A 3JQ7B 3PUHA 4HNAB 1NY5A 1PQ4A 1JXQA 3BICA 5C31A 1RQ2A 1QSLA 1V8OA 1K8YB 2PGOA 3ICWA 1ZVVA 1UAAA 3HJTA 3ISJA 1A5AB 1UFKA 2XBMA 3INTA 2WE8A 1XMSA 4DO9A 4CLEA 3QVVA 2QB5A 3FPJA 4RABA 2C9DA 2I4NA 1S2MA 1Z0UA 1PU2A 2X4LA 4B48A 3UXPA 1ULHA 2QTWB 5CFQA 3D8HA 2PMBA 4RQ1A 2QUIA 3A1UA 4IDEA 5KFXA 3VNVA 3TPCA 3ZJVA 5J2UF 3JRNA 5BORA 2IK8A 2A19A 3PFCA 3DOEA 3N2IA 3M83A 1L3CA 1UDAA 1N4AA 3V7FA 1KZ4A 1LBTA 4HAUA 1G21B 2D3TA 4IJWA 4UTOA 4AY2A 2QM3A 1KTIA 4I2IA 5KFCA 5JTIA 3I72A 4QG3A 2YVQA 1OFIA 2BEWA 2CB9A 4KU4A 2WYVA 2ZTUA 4IWYA 4KLHA 3IJRA 4EM6A 4LPKA 1ZLXA 3GZ4A 1D2RA 2IC5A 2YQ4A 3HXTA 3RU2A 1Z38A 1F2DA 4DN6A 1X7GA 1Z2DA 4F3KA 4UDNA 2UDPA 1Y4ZA 3ZU2A 3K6KA 2J3HA 2P78A 4GT1A 5EGNA 1XHFA 3IKTA 1JW9B 3PKIA 4KVZA 5B3KA 1KZ1A 2QRPA 4BN4A 2OUKA 3DZJA 3ZHYA 2FW0A 5I9IA 3WK9A 1UBKS 4EIWA 3K0CC 5EP4A 1WOYA 4R68A 2FZKA 5KFNA 2C07A 1BPDA 3MM4A 2EQBA 2I7XA 3FYSA 4Q24A 4M9LA 2PVPA 3G6WA 1OMOA 3GUYA 4G0UA 3O9ZA 1FTSA 3SYMA 1JSRA 1SCAA 5E1OA 1ZQHA 3K70C 4JLJA 4E2YA 4B4OA 4ENTA 4Y6QA 4Q37A 5G3YA 3JAKA 1U2DC 1ZQLA 4G07A 1W4AA 5H80A 2F8TA 1T3QA 4FT2A 4BJ6A 1NN1A 2C04A 1U7OA 1KEVA 1LEHA 4FFWA 1AK1A 2ZTVA 4BFUA 3ONDA 1DQSA 4D0RA 3V2IA 2F8MA 4Y2PA 4CIVA 5CDGA 1LKZA 3ZWQA 1DG9A 4CF5A 3NPMA 4TTVA 1BC5A 4ZOQI 4IGEA 1SCJA 2GCGA 2ZU6A 2IP4A 4NONA 821PA 3SYNA 3OJFA 5TC4A 1BE8A 2ONYA 1KBOA 4GX5A 1H2YA 2I5PO 5LQCA 4X1IB 3PEWA 4PZZA 1GVNB 2PS3A 2Z4SA 1C2TA 3ZCPA 3QKIA 3K4QA 4AW9A 3H1EA 2RHRA 2H1IA 1AXGA 1O8CA 4FHDA 3U4IA 3LXMA 3GPIA 2ZI9A 3RRBA 4RK4A 8ICFA 3IT3A 2HVHA 2I76A 2YOHA 5LLTA 3O0FA 4DKXA 5I5EA 3GT4A 3L0ZA 4K9NA 5LD2C 3WZ2A 1YKSA 1GZ4A 2JVJA 2X22A 1SJ9A 4YC7A 1F0PA 4F4YA 4H35A 4RJJA 3G8YA 4H0CA 3CV3A 4U7HA 1B1CA 4PO8A 4YLYA 1T8SA 5KOHB 3CB4A 5BSEA 1NVDA 2H2HA 4RVFA 1COOA 1ZMXA 4KO8A 2ANBA 1V41E 5KFLA 1QIJA 3BIXA 3X1YA 2RBKA 5ICCA 3DZIA 4WXEA 4UQGA 4OJ6A 4QPZA 5B4TA 2ZAYA 2PT9A 4D0NA 2VXYA 1FP6A 4G8DA 3RS4A 1SXDA 3ETCA 3I45A 3HBMA 4AG3A 2ZS9A 2Q5LA 4X6UA 2DKOA 2C20A 3GXOA 1N9GB 5CB0A 1OFUX 2ORYA 3P9NA 2VHYA 3TXXA 4DV7B 1YQQA 3E7WA 3OU7A 3QUBA 3I92A 2EWWA 3RBVA 2DQSA 1RQPA 3UQYS 1CZOA 1B8VA 4EW6A 2GZ1A 5HE9A 4UNSA 3SAHA 3ML1A 3CQ9A 1KORA 1WUDA 3W8RA 2PQ0A 1ST3A 3QE2A 3EYZA 5KTQA 5ILQA 2ZJ1A 4ZTZB 4DIKA 2X6RA 3SV4A 1C1HA 3GY0A 4YONB 5CW2A 4F06A 1IN4A 1H2WA 5JWOA 1LBIA 4QATA 4EHFA 3I37X 4EHIA 4RVNA 1PVVA 4CFZA 2BCGY 5KDLA 3GH1A 3NZEA 3SR3A 1FNMA 5EOZA 4YR3A 1SBNE 2NXNA 2CNWA 3C87A 2PJRA 4N5LA 3B3GA 5FUVA 1V1RA 4KBYA 3WOHA 1C30A 4K03A 3W06A 1X2EA 5HUQA 1CSEE 2ZZKA 1ZQCA 3B6ZA 2BE7A 3S2ZA 1KR5A 2GZ3A 4PONA 2EHJA 5KTMA 1IEXA 4CYMA 2OHHA 4Q19A 5JU5A 4Z2AA 1POXA 3Q0EA 2C1XA 4BU1A 1TAUA 3FPKA 2A3NA 1EVKA 4GG1A 4WJZA 2VPZA 4KUEA 2VIXA 4LDRA 1GZ3A 3C7AA 4NFSA 4WCFA 2WHEA 1Y7HA 3C45A 4JI8B 2P91A 4F5DA 1I1HA 1ZONA 1SBIA 3VR4H 3CXRA 3QA3E 4CMCA 1UKZA 1O2DA 2RG1A 2QIPA 3R8XA 4ZC8A 2KS6A 4R5MA 2HFKA 3NRZA 4GLLA 2H1SA 1CR4A 3V46A 2QTVB 4A23A 4UD2A 2V7PA 3ZBQA 4B3MB 3DC2A 3MSCA 4ZAZA 1JLRA 1IC6A 3ZQJA 2WM9B 4O4LA 4ZT4A 1FP4A 1E7WA 3G7NA 1G1MA 1DINA 1KO4A 1G7CA 1AKWA 4U2CA 4JQZA 4B8WA 3U9LA 4CG2A 4LGVA 3LY5A 4WKPA 3ACDA 1AGPA 2C4UA 3OSPA 2PD6A 2Q2QA 2R00A 1UMDA 3CNOA 5DJ5A 2PANA 2R6DA 1UM9A 1NPTO 3KT8A 2XD4A 1LX7A 4Q6WA 4PSDA 4JUFA 1KOLA 1Z0DA 4HMPA 2B8TA 3SE0A 3WLQA 1P81A 3LUBA 1GPH1 1SL2A 4AUNA 3OM0A 1N8TA 3LPDA 1LLUA 3T7TA 1HE2A 2P66A 2JRLA 3H9JA 3MTAA 3M4XA 3T12A 5AM5A 3PQ3A 2QLTA 1VKHA 4BGIA 3ZCRA 1X6JA 1R64A 3R5FA 3QEAZ 2H8GA 5LPNA 2C7RA 3WLJA 4GWLA 2VJPA 4I5IA 4QYXA 3THWB 1QGUB 2LW7A 2HGZA 1Z16A 3S8MA 4F9FA 2G06A 3IAHA 4BJ1A 3MOIA 4G0WA 3HRHA 1YDFA 1ZUWA 1T8WA 4LYGA 1ZEJA 2XUHA 3PSTA 3LX4A 4QODA 3RYIB 5HR6A 1LSSA 2CK3D 4MQ5A 4P2GA 1Y4DE 1S9HA 2O6KA 2XXBA 3W6UA 1VKZA 4XQ9A 2QAIA 3RJHA 3BE8A 4E4YA 3OY7A 2KSOB 2AZTA 5B2FA 4YNBA 2A9PA 4YMHA 3PTZA 4OXXA 3LHKA 2OESA 4LXYA 1DEOA 2O2GA 4FYIA 2P6OA 2X8JB 1Z3IX 1EVQA 4B87A 3B1YA 2GCIA 1IBRA 1FX0A 5T14A 3C3XA 3N59A 3FDZB 2C7GA 1W47A 2VWGA 2OBYA 2NN3C 1R0XA 3QKRA 4YCBA 2C2EA 3L1KA 1AUQA 5B6IA 1RW4A 3GYBA 1FNDA 3L6UA 3QVTA 2YYSA 3DXYA 1XTQA 4OG2A 4UDXX 3OKCA 3VR6H 4AJ9A 4UBMA 3BK2A 2WIFA 1FYVA 3OKPA 4NS4A 5A4IS 4EZ9A 1Y1TA 3W1VA 1FPQA 5D7NA 3BTUA 2IJGX 2PUCA 1NG9A 2V6IA 4E1BA 4YP0A 2KK0A 1GZHB 2OXIA 3O4VA 3QBDA 8ICAA 1ZKDA 2CXUA 3RIYA 2ZANA 3LDFA 2QR3A 3TL2A 4WD3A 4J0JA 3OHSX 5CP2A 3CW2A 3CVYA 1CUWA 3IHLA 3EUWA 5DCUA 4EY8A 4P4TA 3K6SA 1N7GA 4HK4A 4LI0A 3WMRA 4GP9A 2BMAA 5ESXA 5EHZA 3RVLA 1J00A 3K2QA 3ROFA 3U4HA 5SV2A 4BLSA 2NVOA 3DW1X 5B7NA 2Q41A 4ZQFA 4HDMA 2QQEA 1F2VA 5CH3A 3AONB 1CDOA 2VPXA 2P9BA 1QIDA 1O7JA 2B4AA 3G5AA 1ZGHA 1GUAA 3H5OA 1SD1A 3L05A 1W581 3IOBA 1PL8A 4ZT5A 4B83A 2MT9A 4FYKA 1O03A 4HYKA 3FKQA 1K66A 3NYWA 2P9CA 3OOYA 4JR2A 5DB7A 4ZJYA 4FKMA 5KSPA 4OP1A 2BUBA 2H7YA 3JPTA 2E4VA 3C3DA 1BNCA 3DXZA 1NK6A 3B52X 4RPJA 3AG5A 1J0EA 2AR7A 3KQNA 2WT8A 4FOSA 2C61A 4J9NA 3SZ2A 2D2FA 3HC7A 4MEBA 3G0BA 3CG0A 4KXUA 4B2IA 1XNQB 3RC2A 1AQ6A 2CWWA 2EKBA 2HADA 1AZSC 4OQMA 3TLBA 2RGCA 3V8NA 5FRDA 3IAEA 4NJEA 4ZVKA 2X5OA 4EYGA 2I62A 2CUNA 1UR5A 3HXQA 1X7XA 5REQB 1MBZA 3ROKA 4LJKA 4TQGA 1BAPA 3V8EA 2PMWB 1U4NA 2F48A 4UATA 3R3ZA 1XL0A 3HP6A 1NVVQ 2CPRA 2ZTCA 3AIKA 2VZ8A 2UUOA 2HJWA 4ONEA 3HHEA 2COUA 2MRLA 4Q34A 5K6TA 1GPDG 3CPEA 1X7ZB 4XRGA 2H52A 1JFLA 4L9AA 3NJRA 4LVCA 4RKWA 1UOEA 1AUOA 4Q47A 5A5VA 4BWFB 2NIPA 2VP2A 1O9HA 2YHIA 1NW7A 1CK4A 4BJ3A 1L5GB 3BQMB 2HHVA 1JAZA 2GD0A 1JEYA 3RGGA 1U2ZA 3H4IA 4QVGA 1CJTC 4KLSA 5CNKA 1QAOA 1EFVB 3HLTA 3P1JA 3RC9A 2VRBA 5KFKA 2WJWA 4ASUA 4HLQB 4QGSA 1GXSB 4NAUA 1A1VA 1LSUA 3WWZA 2TECE 3EGDA 2W4IA 4JV1A 2GJ4A 4XIYA 5JAOA 1BMFA 3OG9A 4BNNA 1CXZA 5DBIA 1FDOA 3QG5A 4QBTA 4F8JA 5IUJC 1XPRA 3A1NA 3EVFA 4D3DA 3GFSA 2KKVA 4S12A 4G1MB 3MGGA 2N1BA 4DWWA 3JXEA 2XNSA 4UBJA 2ZCUA 4M7RA 2G72A 1X7WB 4ZI3A 3M81A 4NU8X 3DFZA 1RHRA 3NTVA 5HZHA 3OFVA 4JZYA 1EB8A 2QVBA 3Q3JB 3QWBA 1GTG1 3JALA 5AKGA 2J85A 4C7VA 4PHFA 4BNTA 3UIEA 5KWEA 1XZDA 3TRIA 3OLVA 1A04A 4I29A 1UAYA 3V6JA 3JTMA 3BWVA 2VUTA 3PFGA 1S1CA 5TB5A 3GF4A 3KO8A 1YBVA 4LF7B 4JLMA 1PTJA 2QY6A 2PY6A 3A4YA 4FCWA 3OTOB 5BV2P 2WPDA 1XKXA 3LUPA 5JAQA 5F9NA 2Z8YM 4PG5A 3M82A 3H2IA 3U4GA 5T4EA 3U4AA 2FMIA 4H6PA 4ND4A 3DTVD 3ZW8A 2W98A 4CMEC 1EMDA 2IIBA 5TGZA 3E2PA 2YRFA 5DNWA 3PQ7A 4ECTA 1JGTA 3GLKA 2YR0A 1TECE 1S8OA 2XEXA 1YK0A 3JPRA 2FSGA 5K4LA 3EVBA 4KXWA 4MQEB 4H4EA 1QG2A 3O94A 2C95A 2NMVA 2PMZC 4EKDA 2XMRA 1W87A 3EYWA 2DKXA 4F11A 3QELA 4OXRA 3RUCA 3VAZA 3JSAA 2EL7A 1TUBB 3TLGB 4B79A 1NYLA 2Y2VA 2GM3A 1QHXA 3RVOA 3FTPA 4IDPA 3PGJA 3JQ6A 2QKYA 1C7ZA 421PA 3PKJA 1OLXA 3UPDA 3KTDA 4RQ4A 3MF4A 3FUXA 1KMHB 3JYOA 4RFVA 1XRJA 1GUFA 4O1MA 3BGSA 2D4AA 2YZ7A 1RRGA 4LOHA 2FE4A 2PI5A 4MUMA 4IRKA 5HFAA 3AUKA 4D3ZA 2BGNA 4NLKA 5KTOA 3GT3A 5EIOA 1Y6GA 5GAJA 1NVGA 2DQYA 2JGAA 2AOUA 4C21A 4IDDA 4IIUA 4Q3DA 1CY7A 2XT9A 3IXQA 3O4IA 3W6ZA 1IDOA 3DOIA 4ZDWA 3IV6A 3VVCA 3NTUA 2WTEA 3MTIA 4IUYA 4GM1A 5G41A 4QX6A 4NU5A 3K9WA 3O8OA 4IIXA 1KIFA 3B6JA 5E9WA 2GPWA 4KLNA 4RLFA 2OILA 1Z0KA 1JDBB 1NV9A 3HN2A 3V1YA 4NNPA 2O8EA 5A5GA 3CW9A 2EKLA 2VDUE 5CGZA 3LA8A 3ZGZA 4EX7A 4BVBA 2J0UB 1UCVA 4O1HA 1LCIA 1VL8A 1EFPA 1KDYA 2FWRA 4TWAA 3VBCA 4PN7A 4AMYA 5KWSA 1M76A 1PS8A 1QG4A 2VBFA 1YMUA 2ZUFA 1XNJA 5T6MA 5HHHA 1UXIA 1VYUA 2I03A 3T7IA 1SIJA 4Z9BA 3LA6A 3RVQA 4CTJA 1G20E 1MPTA 4R0NA 3EPLA 3L6EA 1W52X 2XO7A 4ZCMA 1FS6A 1LBHA 3QYAA 2HLDA 1K5PA 4IVQA 1KDRA 1PVPA 1OILA 2ZVJA 1B4FA 4M8LA 2QMOA 2WWFA 5AHXA 4MDHA 3KK0A 3SQLA 4ZU1X 1NM5C 4LJRA 4FFVA 4JWKA 3Q6NA 3EQ9A 4ARZA 1V4NA 4HFJA 1BW9B 3VZPA 2QB0A 1LDYA 2L2QA 1UP6A 4OIMA 1IRIA 4UU0A 3ZHSA 3QWHA 4F5NA 2ZYVX 3BZUA 1OXSC 1E9SA 3AX6A 3F3KA 2YFHA 3AYXB 3DP9A 1DKMA 2Z43A 5CHEA 1VL1A 2IDKA 1R9JA 2P41A 3OCYA 3ROMA 4IUDS 1KDTA 4HX5A 2PSEA 1KJQA 1RYSA 1P0FA 4L72A 4G2NA 3W2IA 3AIMA 4ZVOA 5DMHA 4MR8B 3PSFA 5C5EA 1XZEA 3BHMA 3V1TC 2Q62A 2X1HA 3R3WA 4I2BA 3KKEA 3FOCA 2GK7A 1RTTA 4LFCB 1GFWA 1O8BA 4C5CA 3HCCA 4PYIA 2CLKB 1XA4A 1N0WA 1D2AA 3T5GA 4ISBA 3UAYA 1SIOA 3T3MB 4LVNA 1BNOA 4BIMA 1YIAA 3KU1A 3PIIA 2IH4A 1MJNA 2QTGA 3DWGA 2LR0A 3UHPA 1DP4A 4AY6A 4PY2A 5D51S 3BCUA 3FGOA 1E3TA 3S5UA 1PGNA 4IXMA 1ID8A 3TL3A 1SQ5A 5DQIA 4JJEA 1Z28A 1A9ZA 1UQUA 4Q4LA 3IUNA 4R8MA 3HNOA 4EWLA 1J6UA 3TZKA 5CA1B 5FBKA 3H11B 1Z17A 1SUEA 3H2YA 3JWIA 3FR7A 5BR4A 2TMGA 3ABOB 4RETA 4W5JA 3P9IA 4GXTA 4IHJB 2Q28A 4W63A 4DC1A 2H3QA 3A25A 4UPEA 1SA0A 1JDJA 1ODJA 5BWOA 4TN5A 3R5HA 3GFGA 4FDLA 4BKOA 3JPQA 1H4QA 4HMQA 3EGWA 1GN8A 1B3RA 3EBPA 1TLFA 3RRNA 5KT3A 2OSBA 3BHNA 3NAMA 1K8QA 4ZMBA 3DNFA 4RJ2A 3AQIA 2IYUA 5HCIA 2P27A 4XB2A 2JFXA 1L4HA 4QNNA 2BUAA 3GK3A 3H9CA 1HE5A 2YWGA 3NGMA 3V1NA 1XSLA 1W49A 4R1QA 1XX6A 5F5NA 3ECCA 2ACKA 3L5OA 4PGXA 5B1SA 1ZGZA 4M0MA 5IJ9B 2KPOA 3TIIA 2RJOA 4DDMA 3RS7A 2JH1A 4P92A 3B3QA 3F2BA 2H08A 3DEYX 3QHAA 4XX0A 2KYRA 2JH9A 5T4BA 2ATIA 5PGMA 3PEYA 4X8HA 3N2GA 5JTTA 4KNYA 3L77A 1TKAA 1LPPA 4X71A 4NDNE 3P71T 2BGIA 4GXRA 4KTTE 3KQTA 4LZNA 3FLAA 2YB1A 3FYHA 5BNZA 1ECPA 3R6LA 5CVTA 4HN9A 3EFOA 4RXTA 2VHZA 2X4IA 3RRGA 4DCCA 1WUJS 2VF2A 5MFZA 4OJLA 4JCOA 4IZ6A 3X1MA 2CLOB 1DTWB 1RPLA 1YD7A 2PRIA 3M49A 3EFHA 1US8A 1RC1A 3N2KB 1OJ7A 1T0IA 3DW3X 5LU9A 1HMPA 4RTKA 2WSBA 4RY0A 3GEHA 9ICMA 1I36A 2ZT7A 2Q2WA 2H4XA 1FUEA 3LCJA 5BWLA 4CL3A 4GVXA 4TWIA 3GJ4A 5AI5A 1MJGA 3GNSA 3LKBA 3E7FA 1YQUA 3UMRA 5IU6A 2JG3A 3EEIA 4GNRA 4IZHA 3RCBA 3K1TA 3LL4A 4HD8A 4P86A 3QX8A 2NO4A 4RU9A 1TU4A 3IPLA 1U5AA 1JEJA 3WLTA 2ZIZA 2PUEA 3OHMA 4ECUA 2RI6A 2OD2A 2LCQA 4M1TA 4NK5A 5EG5A 3PL5A 1P4SA 4MGIR 1KQPA 3TSZA 4MROA 5FYDA 1UBGA 3V7YA 2Y1FA 1KL9A 2ZXHA 2FMUA 3HMKA 1OPXA 1L0BA 4KLZA 2JI6A 2JGFA 2OKCA 1MAHA 3PI6A 4JJZA 3DR3A 1B15A 5CX1B 4EUKA 3WNZA 2QAGA 5H68A 2YMMA 4MITA 5F5XA 4S0XA 4BUCA 1EUCB 4Q16A 3TNJA 1YB2A 2J0SA 1FX1A 2X8WA 5AK3A 1YFKA 2D1TA 4YEDA 3WA6A