4FE3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with uridinine monophosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
b'AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structural Basis of Substrate Specificity and Selectivity of Murine Cytosolic 5'-Nucleotidase III.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fe3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4fe3A01
3B9BA 1YS9A 3M9LA 3QUTA 3NALA 1FEZA 3ZU6A 3WKDA 5AKHA 3GYGA 4CF5A 2I34A 1RPZA 1YDFA 3L1VA 5ALOA 1ZD3A 2JARA 2FDRA 3ESQA 2WM8A 3WK6A 2GHTA 3WK5A 4UASA 2YJ5A 1T5SA 3I1YA 4UATA 4NAVA 4UMVA 5AW2A 3E84A 3QUQA 4CNQA 3U7HB 1YNSA 1QQ5A 3ET4A 5AI8A 2EATA 5AVSA 3WKCA 2AMYA 3OTQA 3QUCA 3UMBA 4NABA 3UM9A 5ALFA 5AW8A 4BYGA 2PR7A 2O2XA 4J03A 2OYCA 4UU0A 3I6BA 3A1DA 2I55A 5ALEA 3N5KA 4OCZA 3SMVA 4I9GA 4Y2QA 3MN1A 1RC8A 1WVIA 2FPSA 1Z4OA 3ZVMA 1IWOA 2AH5A 5A3QA 3OCVA 1N8NA 4BX2A 2HF7A 3R4CA 4G63A 1RLTA 4KYTA 4KNVA 4BNDA 4HGQA 4G9BA 1RQNA 1ZJJA 4KX5A 3DNPA 3FZQA 5AI6A 5AW4A 2YJ6A 3U7GA 3SLRA 1XVIA 4C4RA 1T5TA 3E58A 3CZ4A 1TJ3A 1Z4JA 5AM4A 4Y2VA 3QU5A 2ZBEA 3I28A 3ESRA 4QJBA 4UMFA 1X42A 5AVYA 3MC1A 2HSZA 1TJ4A 2EAUA 2OA0A 2RB5A 2MU1A 3F9RA 5ALYA 2R8XA 3WK4A 4UU1A 1RMYA 5AIAA 3WKAA 2G06A 2BY4A 1L8OA 2C4NA 1L7PA 4Y2TA 1NRWA 2HI0A 1O03A 2Q4RA 3OCXA 5ALZA 1Z4KA 3WK7A 2WF7A 5IT0A 2GHQA 2JGAA 5AKXA 2B8JA 2HCFA 3ZWKA 1LTQA 2IYEA 3QXGA 2RBKA 4JDPA 5AKJA 1Z4IA 2WF5A 5AIBA 2YMPA 3FVVA 3ZTYA 2PKEA 4QQFA 3OPXA 1Q91A 1NNLA 5ALVA 1K1EA 4HGOA 2YY6A 3PDWA 3MPOA 3DV9A 3PCTA 4UW9A 2ZXEA 3PGVA 3KBBA 2IOHA 4PNHA 1N9KA 3E8MA 3AR2A 3AR7A 4J2TA 4EX7A 3SKYA 3FPBA 2B0CA 5AKEA 2B30A 2FPRA 3DAOA 4FFDA 1XP5A 2BDEA 2HF2A 4Y2SA 2YJ4A 3ET5A 4Y3UA 1YJ5A 1U2SA 2AUTA 4NFLA 1Z88A 5AW6A 1VJRA 4NV0A 4RETA 2GO7A 3QGMA 2D2VA 1CR6A 2ZOSA 3A3YA 2B1RA 1Z4MA 5ALRA 4YCNA 5AW3A 1TJ5A 3QU7A 4XOUA 1KYTA 3AR6A 4HGPA 5AKZA 3SD7A 4HYTA 5ALWA 2G1AA 3CNHA 1Z5GA 2JAOA 4MWOA 5ALIA 5AM0A 3HLTA 2ZBGA 5IT4A 1MH9A 5AESA 3WKEA 3MMZA 1U7PA 2IOFA 1ZRMA 3NAMA 1TA0A 3P96A 2W43A 4ZEXA 3AR4A 3ZTWA 2W11A 2GFHA 5ALXA 2HOQA 5ALPA 4UM5A 3ZW7A 1ZOLA 1L8LA 5AW0A 4YIHA 1SU4A 4XQ0A 2I7DA 4YH1A 3ZUPA 4I9FA 3B8EA 5AVQA 1RKVA 4KN8A 5AW5A 3FPSA 2P9JA 2CFTA 4FYPA 4FE3A 5AM2A 2BDUA 5AVZA 1XPJA 4BX0A 1U02A 2G0AA 4GXTA 3N1UA 2P11A 4UMDA 4GIBA 3NRJA 3QU9A 5AM5A 1Z4LA 3KD3A 1Z4NA 2I33A 4Y2JA 2VKQA 4E88A 3W5CA 2P27A 1VFPA 1QH9A 1Q92A 5ALKA 5AK3A 2FPWA 3ZVLA 5AI5A 2YMMA 2O9JA 5IS2A 4Y2XA 2Q5EA 3AR8A 2YBDA 3D6JA 4L6AA 1S8OA 2HDOA 2X4DA 4XPZA 1L7OA 5AK5A 4IFTA 5AK4A 1WPGA 4UM7A 3IJ5A 3ZVNA 1U7OA 3I76A 5ALHA 4AP9A 2YFYA 1J97A 1JUDA 2C88A 3AR5A 3QX7A 4ZEVA 4UAVA 3EF0A 3WGVA 2HHLA 3NIWA 2I6XA 1F5SA 1CQZA 3IRUA 4KNWA 3TLMA 1RDFA 2HEGA 3ONNA 3U26A 4ZEWA 3WK9A 5AM1A 2FPUA 4BEVA 4RESA 4XE5A 1ZD5A 4OD0A 4UARA 1WR8A 2EARA 3PGLA 2OM6A 1YMQA 5AKLA 3WKBA 2RAVA 1Z5UA 2R8ZA 3OCYA 4MUMA 4Y2UA 5AI9A 4YIKA 5ALTA 3W5DA 5ALSA 2YN4A 3AR3A 3QU4A 3J7TA 2WF9A 3E81A 2CN1A 3W5BA 1QQ6A 3EF1A 1Z4PX 5AM3A 1RMQA 1NF2A 5AVVA 3U13A 4Y2PA 2P69A 1T9ZA 2FEAA 1L7MA 4JB3A 5ALNA 2YJ3A 1S2OA 3IB6A 3QUBA 5A3RA 3WGUA 5ALGA 4BNDB 3U7FB 1SWVA 5ALJA 1SWWA 2B8EA 3OCWA 5AKYA 2GMWA 2IOFK 4CE6A 2QLTA 5AVXA 2HX1A 2I54A 2G07A 2B1QA 4BBJA 1ZD4A 2C9MA 2CFRA 2C8KA 1L7NA 2G08A 5FP0A 3L8FA 4F71A 2FPXA 1RKQA 1RLOA 3A1CA 4EELA 3ZX5A 2OBBA 2AGVA 5ALUA 5AW7A 3KOOA 4YCLA 4DFDA 3ZI4A 1RRCA 3A1EA 4OFZA 4YGYA 5JJBA 4HGRA 3QU2A 3SKXA 3RFUA 4DW8A 3EPRA 2HO4A 2YMQA 3K1ZA 1ZS9A 1PW5A 1ZD2P 3QNMA 5ALLA 2NO5A 2R8YA 2CFSA 3SHQA 2RARA 3QYPA 2JAUA 4EZEA 4C4TA 4NWIA 2PQ0A 3W5AA 1WZCA 5AHXA 4C4SA 2G09A 4DWOA 5AICA 4HAIA 3OCZA 3L8HA 4Y2YA 1RQLA 3ED5A 3FM9A 5AI4A 4AS3A 1Z4QA 3L8GA 2NYVA 2C8LA 4H1WA 2Q4TA 3NASA 2R8EA 3L0YA 3N07A 2MSNA 3B9RA 5AKKA 4EEKA 2FUCA 2ODAA 2WHEA 4O8CA 5ALQA 2WF8A 3QLEA 2G80A 3L8EA 4CF4A 3VAYA 5ALDA 5AI0A 2WFAA 3M1YA 3L0CA 3AR9A 3NANA 3FGOA 5AW1A 4OHFA 1TE2A 5ALMA 4CF3A 3OCUA 4BKMA 3R9KA 3UMGA 3WK8A 4KX3A 3RF6A 2FI1A 4AS2A 1EK2A 1AQ6A 4BEWA 3BA6A 1J8DA 2ZBDA 4HGNA 5A3SA 4Y2RA 2B82A 4L57A 5AKGA 2W4MA 3U19A 4UMEA 1QQ7A 3EWIA 1RMTA 4DCCA 1LVHA 3L7YA 5AVWA 5E0OA 1RLMA 2JAWA 2WF6A 1ZRNA 2ZBFA 5AVTA 1O08A 3UMCA 5AK6A 3L0BA 3R09A 3NUQA 3SF0A 1EK1A 4B6JA 2ZG6A 3KZXA 2QYHA 1Y8AA 1RKUA 3N28A 1VJ5A 3DDHA 1U2TA 4L6CA 3KDPA 3S6JA 1L6RA 2NO4A 4YCMA 3HYCA 3ZX4A 4IG4A 2FUEA 2YMLA 4EX6A 3KC2A 3L5KA 5AVUA 3BWVA 4UAUA 3L1UA 3U7EB 5T41A 3N8GA 4F72A 4EENA 5AKIA 5AW9A 3ZWDA 2IA5A 4BX3A 1YV9A 1QYIA 5AVRA 2DQSA
chains in the Genus database with same CATH superfamily
3TGPA 4YMUA 1GU7A 5CA7A 2L19A 4RZIA 4BZWA 1A2QA 3H5TA 4QTTB 1SEVA 2OE2A 1D9ZA 5KTPA 4YO7A 5A4AA 4IDBA 1QYXA 2HA0A 4EKYA 4PTLA 2BQRA 1PD0A 2VHVA 2QRNA 3K70C 3H5VA 2VZ9A 1NI4A 4WZAE 1WWVA 2DFKB 1SQSA 3KVRA 1PBTA 2GASA 1RFGE 3WYGA 1LWNA 4Q7KA 3GB9A 2H5LA 5F9LA 5SYNA 1GR0A 1M33A 3RKRA 1Z34A 4RE6A 5JJLA 1W49A 1XZGA 4HGQA 3HFRA 5LJIA 1ACJA 7ADHA 5BOLA 3N74A 3OT1B 3ZN2A 3DPSA 2NVOA 1CLUA 5DHUA 3LS2A 9ICOA 1I7DA 2VUSA 1N6IA 3VR2A 3KTDA 2QS9A 1CLEA 1S7GA 3WK4A 2J3LA 2RJNA 3EVZA 3OLCX 3MSXA 4AF6A 2FR1A 4HLQB 3C3MA 4I5IA 3C8DA 1NC1A 4MJ3A 3MWYW 3ZWKA 1NPYA 4FYXA 3U1BA 2J4DA 4DCOA 3HKBA 3PNVA 4LS3A 1YK1A 3H99A 4MUNA 1SOVA 3LCCA 4AZ3A 1YZFA 2P6UA 4RIFA 2CW5A 3HRKA 1N6KA 5JNRA 3VDNB 1GA1A 3TTUA 2R84A 2Z1MA 1NK4A 1A4UA 2D5CA 2CSUA 3C8ZA 4UD2A 4DDUA 5J2AA 3N2ZB 2ZR9A 4DBLC 1CTQA 2OD7A 5JMWA 2ZAOA 1XO0A 4R0NA 2NUPB 2YWDA 3TRIA 2WT8A 5G1PA 1CJTC 1SQFA 1GTMA 1DWPA 4UNNA 5AW0A 4IZOA 4U0JA 3AU9A 5F2OA 3BRSA 3KR0A 3SXPA 2XXJA 1KQOA 5FKJA 3H6KA 1JHXA 5GIPE 4PBSA 3IKVA 4PHFA 1MB0A 1QBGA 3Q3GE 4AMVA 4INZA 4QELA 5HDBB 2WIKA 2WNHA 4BFTA 3BT7A 3BIJA 3IPAA 2C7OA 3UO8B 4KC0A 3L4BA 1SC1A 1D4ZA 4NBTA 3DE5X 4S2EA 2VHUA 2HPAA 3I2JA 2FPUA 1U8YA 4AU1A 2KM1A 1XTTA 3HJCA 1TVAA 4B43A 4EHBA 3Q8QB 2G4CA 3I37X 4EZ9A 2EFEB 1V5FA 1M6HA 3TAPA 3Q98A 5ECDA 4KYVA 1Z9BA 4AROA 2B98A 4OI2A 2QMUA 3BIWA 3K5WA 1CB0A 3PW0A 2Q3JA 3QUBA 5DN6D 3B0YA 2ICAA 1D4AA 3OT1A 2PGXA 5DM0A 3T0GA 3G82C 2FR0A 3WAGA 1G20E 3A3PA 1VG1A 2I2CA 2I1LA 3I8XA 4IX9A 1Z0AA 2LDXA 2P6MA 3BCSA 1KIFA 2FMXA 4JXKA 3PSTA 3ONDA 1Q15A 1SHZA 4NLLA 3TBHA 3WXBA 5AI4A 3QWFA 4ZK2A 8ICGA 1EGAA 3WJ2A 4D0RA 3MGGA 4KLMA 3UJ3X 4QUEA 3ABRB 2ONKA 3ZGVA 2NPFA 3IT1A 1GGJA 1E2BA 4LJ8A 3PPWA 2QTGA 3LNTA 4E4TA 4ZDJA 2KZZA 1NBMD 1DIOB 1GPMA 1RYYA 4QBHA 1LVHA 1E2HA 4OEHA 5KINB 3P26A 3E2EA 1U2QA 1SUWA 3J7AC 2BR3A 4LMAA 2JAWA 2NUPA 3H5LA 4KQHA 3H1BA 3G59A 4HKTA 1BGXT 1MO3A 3EGOA 1RYNA 5CIQA 2KJ9A 1MNQA 1RZVA 1FDIA 2IYVA 1TC2A 1QXSA 5AVUA 4BDTA 1EFRD 1AU9A 1OILA 3PX3A 4MP6A 2QZ4A 1O5IA 1IN7A 3PHIA 2GXSA 4AT1A 4PNPA 3JPWA 2N1MA 5IAEA 2HHHB 4UEQA 4BBPA 3PKZA 1JDSA 3INNA 1MOSA 3EF3A 3IDSA 4PSDA 4U8HA 2IF0A 4NMWA 4DPLA 4DV2B 1X15A 1U3TA 3WLOA 2EIHA 4KIUA 3PJGA 2PJRA 5B2FA 5AJWA 2YASA 3QUCA 1NE7A 4I2CA 3PUWA 3GG9A 2P2CA 2Q3HA 3VPSA 3NC0C 3W3ZB 4BX8A 1KEZA 1XWIA 3FMPB 3HADA 4V0QA 1Q46A 2HF7A 2IYLD 3WO0A 2QE6A 1NK0A 4P4NA 3LDHA 5KJFA 1IUPA 2YICA 1OWMA 1T8SA 5L9XA 1EFPB 2HHTA 1OAAA 2A1TR 5EMKA 1NOMA 3OQBA 1U28A 3QNWA 2WK1A 1OXVA 3D6MA 2AT1A 3T3PB 3Q7QA 5B64A 3THWB 3H16A 3FWKA 4MUHA 1A5AB 1QANA 2HCRA 2QUZA 1II9A 4KRXA 3NO4A 3N86A 1LPOA 4G89A 5KG3A 5HGXA 4FFDA 4S0ZA 3K2EA 4GF5A 4QQKA 5HILA 1OXSC 5IUNC 4KGDA 2G4VA 1WY5A 1NQXA 4HP8A 1BO6A 1VJRA 1P1KA 4WJKB 4P7BA 4AZSA 4R05A 3UOAB 3QU7A 3SOPA 3AL3A 4D5EA 4AJHA 4B9SA 1GPLA 1QC5B 1WCYA 2VBFA 3AYZB 2FEXA 1MX3A 1WB5A 1AOXA 1SL2A 2FSPA 4WUVA 4BVAA 1ODKA 1M10A 2IYTA 3UK7A 4UAJA 2LYBA 2WWVD 2Y6VA 4CCHA 2X6QA 3EBPA 3GVPA 2NYAA 3TBFA 1R64A 1ORVA 4NR0A 5BWNA 4Z8YA 4U39A 2Q0HA 1RG6A 5HEKA 2G0AA 3EWAA 1E79A 3O4IA 4RIIA 3N8KA 3OA0A 4EZIA 1L3BA 4TMZA 4WKCA 1Z8NA 4OSEA 2C96A 3G2NA 3N76A 1GCAA 5IAJA 2PUCA 3ISBA 1GTVA 3HILA 4UVIA 5JS8A 4X85A 2O0MA 4EL5A 3VC1A 4IRXA 1V96A 2F59A 1QX3A 4MW6A 3QFCA 2GLTA 2FSVA 1E5LA 5DCYA 1ZW1A 2B34A 3Q5GA 1GL6A 1A76A 5JALA 1GAQA 4XB6B 1A27A 5DYWA 4XWGA 4CCYB 4GQIA 3KQSA 2H3QA 3RRHA 1EFPA 2XVYA 1GFSA 4QOFA 4GRIA 3FI0A 1N5DA 4CLRB 2N46A 2AGVA 3AONB 5HQ3B 3AOEA 3PS9A 4MEBA 2ZSAA 5EWFA 3LO5A 4TLLB 3R9IA 1Z83A 1IIBA 3OF3A 4J9SA 3O21A 1N6HA 3W5AA 2GXAA 3TXYA 1DE0A 3THWA 3GIIA 4F3CA 2R6GA 1PZHA 3T7SA 1TLTA 4YDRA 1NXTA 2I7VA 3TSCA 2W42A 4DN6A 2AD1A 1MA3A 4GBED 3VAYA 1GAXA 3AI2A 1E3DA 5LUBA 4XCXA 2OUKA 4AJJA 2XSZD 4YHBA 3ZLJA 3QZ7A 1Y7IA 5DGCA 4IQUA 5TY0A 4U63A 2A4MA 4BP9A 1ZCAA 4IJ6A 4OVKA 3GCWA 5KQLA 5KFFA 2GXUA 3NUQA 3GDHA 1E2MA 3GU3A 1QYVA 3LY5A 3HDHA 3RAPR 1TKCA 3ETLA 4OJMX 1S3IA 3O31A 2BMEA 4OMFG 4OM8A 2QUBA 3RVMA 3P2YA 1TJYA 4Q0MA 4BX3A 1PQYA 4RHFA 3LV8A 2QTHA 1T4CB 1Z26A 1GL7A 1YE3A 621PA 1U1IA 3CX4A 3SQDA 2G77B 4LZZA 4MUFA 4LHVA 2F3TA 5KG7A 2FDRA 5F7XA 2PFGA 2C31A 3LQKA 1LF5A 1XEAA 3CPEA 1I24A 3U7HB 3EZ2A 1QIKA 4NS4A 3ZPXA 3ZD9A 1PYOA 3AHEA 4XASA 4F6CA 4M76B 3KFXA 5IMSA 5JWOA 4IO1A 4BQNA 4B7AA 1D3AA 2Z2JA 3HX0A 1VHQA 1T8RA 2JDIA 1EDOA 3PWKA 2IWHA 2VYCA 1IWOA 3R3UA 5CITA 4AY2A 1J7JA 5D3MB 3WYBA 4CCYA 4ECTA 1JB1A 2A1JB 2B92A 3KAKA 5AW4A 5JXJA 3A4TA 1A98A 2YJ6A 4JENA 3TSAA 2QJRA 1SZJG 3ZU4A 4CLRA 4NOKA 1KIMA 1B6SA 4ETIA 4DLLA 5J2CA 1NRIA 5LP6C 3ESBA 4JMLA 3IODA 5BW6B 5CCDA 3LIPA 2Q27A 3H8VA 1FMFA 3N3AC 4YUVA 13PKA 3IOYA 1JFSA 1Y1RA 3AF4A 3QEAZ 1G6OA 2HRQA 2IHYA 3T3MB 4FZNA 4R2XA 1L7RA 4IQWA 1ISMA 2SKDA 4G3XA 1EESA 4QGAA 3RBDA 2D2EA 3LC0A 4ISBA 4YQFA 4A2PA 3FTNA 3PITA 1X40A 4B35A 1ZL0A 4FBUA 4NHEA 3SKVA 3PC8A 4YUZA 3BREA 2Q0QA 3RUHA 1CR6A 4DSJA 5JNVA 2QD4A 1Z74A 3HXTA 4B9TA 4I8XA 3HVKA 2QA5A 3IIIA 3ECAA 2YFHA 4MWOA 4PR3A 5CVJA 3AB3A 1ZVQA 4IGEA 1BE0A 3ZTWA 4DFJA 1CZOA 4LKRA 2HSGA 4QJ4A 2XJ4A 4CM7A 4Q3BA 4Q7JB 4KZPA 1XE3A 1JALA 1AV7A 4BX9C 2BBWA 5SZHB 4QZIA 4ARUA 3WIVA 1P5JA 4RJJA 3ZLTA 5AVZA 4HBGA 1CV2A 3TMYA 3R9WA 1Z4NA 2C0QA 1TT7A 3DC2A 1ESMA 1T4CA 1ZHOA 3TLBA 2JJ1D 1C7ZA 3I01A 4CI0B 4X41A 1AKWA 1FVOA 5JSKA 4XVRA 1AV6A 1XSLA 1IUOA 3BEOA 1JR3A 4ACBA 1SVKA 3A6PC 3E70C 1KZYC 1JMYA 4TWZA 4LF7B 2N1RA 4ZT7A 2B69A 2NO0A 4RQ1A 3C5HA 1P18A 3HGMA 1Y89A 5AHRA 5KVQA 4DV6B 2IE8A 1KBZA 4KVZA 2ABWA 3I1FA 4HZGA 2FJPA 2O2JA 2ZYDA 1C29B 2VA2A 3J7TA 5DCUA 4MROA 2ZIXB 4FZMA 3RRYA 4X9XA 2RLTA 3BL6A 1T9ZA 4LC0A 3B7GA 5KFLA 3BCHA 3NIDB 8ICCA 2G04A 4F06A 4BC1A 1AKEA 3ZGNA 1O4VA 2A1JA 1WE2A 2GYUA 5CXSA 2X9QA 4HX5A 2ETVA 2IYOA 1R3UA 1EWTA 2ZSUA 1QZ3A 2C2KA 3LLMA 1HY3A 1V9SA 2XRFA 1FUEA 4IQ0A 2VH2A 5J47A 3O1LA 3L46A 1NG1A 4JITA 4JC4A 4OAOA 1OH5A 1AHHA 4I5GA 4QYIB 1WSDA 2DERA 4NBLA 5J1TB 5KKCA 4OJQA 2WF8A 1ZVJA 1TT5B 2BM9A 3LL4A 3JSXA 5AI0A 2XGPA 3WSWA 1Q5PA 4RSMA 4OHZA 3F8WA 3UCXA 2Y93A 2FOLA 1JDPA 3O8BA 4IL6U 1Z68A 3DMRA 3MS7A 3U9SA 2X7JA 3KWLA 4Q3AA 4P54A 6AT1A 4MPDA 2J5RA 2OOSA 4DR4B 2QDKA 4XQGA 2FSUA 2ALZA 1P0FA 2PSJA 2OQIA 3P4XA 4CKWB 2VDUE 4BVEA 3PGXA 2RKWA 3L6UA 2X6RA 2JLZA 5CMLA 1ZP6A 2X1HA 7ICEA 1I3LA 3FDJA 4QDOA 4FLMA 4XGNA 2AUMA 4UOQA 3P9KA 4GVLA 4N5MA 5LVAA 4FGSA 3MR2A 2HHXA 1KH1A 4OI4A 2GJ4A 3SHTA 3PWTA 3HWRA 2EJBA 4ECEA 3HE3A 4EMTA 4KXQA 5KHOC 1Z0UA 2O8DB 1YBFA 3Q87B 4EFDA 5A0TA 4HWPA 3MVEA 4FOPA 3QM1A 5K0CA 2VDMB 3EEYA 4W7HA 2QZ9A 2O7SA 3L9XA 3EN0A 2HF8A 4FEAA 1QLWA 4H7PA 4HEA1 1TRKA 2ZIXA 4J0DA 4TMFA 1B42A 4YG2A 3GRYA 1RYSA 3MB5A 4M9JA 1JH8A 4G0VA 1Y82A 2Q3CA 1CFZA 4E08A 4HRVA 4YRIA 3T0FA 2ZBVA 5LWHA 4M1YA 2XQGA 3MUNA 1GZHB 3K0SA 3S0JA 3OURA 4QDUA 1TAGA 4GC5A 2OB1A 3GEMA 1MQ3A 4E22A 4B6SA 5IUKC 4LA4A 1E6EA 3L7MA 1BRTA 3EGIA 4P2GA 4AW9A 5L1MA 1ADCA 1RHUA 3OPXA 4CFZA 3SJCA 1VP3A 3WRVA 1OROA 4PS1A 3EUAA 2K6GA 1TT5A 1XDGA 4BQSA 3S4YA 1WRBA 4KXWA 3CF6R 2OUIA 3ESDA 1M8KA 1AKRA 1QYRA 3IVMA 4TKUB 4H3HB 1JHVA 1ZUWA 2ID7A 3T06B 3NOXA 2XNDD 4RQ8A 2DBRA 4FWBA 5CA0F 1UANA 2A7XA 1ZY2A 2BKLA 4BNTA 1ZRMA 1GFZA 5CG1A 3B7PA 5E2AA 4CKWA 3VPFA 3MR6A 4UE6A 1S5LU 1HT3A 4M0EA 4DNXA 2ZRDA 1QHXA 2A86A 1KAGA 2X0EA 4MPRA 4DJDC 1ZA1A 4R41A 1WUIS 3KJQA 4FYVA 4EA8A 4I6GA 1TADA 4B3JA 2BM1A 2GKGA 4OGLA 4CEIB 3H1PA 4QNLA 2X5OA 1SXGA 2DPGA 4DB4A 3UJCA 4ZI2A 4GKKB 3BG5A 1VSQA 2O8DA 5E8RA 3EW9A 2DHEA 2R7NA 1JT2A 3NIWA 1RDFA 1EEHA 1FBTA 3FSJX 3LXRA 3ZXXA 2XYRA 2VO1A 4R7ZA 3FSRA 3CNEA 4ECAA 3VZQA 4PG8A 4QQRA 4CM1A 2IZ6A 4JIMA 1RHMA 3V7YA 1LFDB 3K1JA 1Z73A 1HUZA 4HNAB 3AERB 4N7BA 5AKYA 1V7QA 2PU5A 5D1HA 2B1QA 4XCVA 4O3SA 4AO6A 4BNXA 5F12A 5DW3A 4GQAA 3K9BA 4TKZA 3AP1A 3BXFA 2ZUCA 1OSNA 4OO1J 2K89A 3EIFA 3H9EO 4KQFA 1HYGA 4A8EA 4ZDKA 3FWHA 3A6HA 1GD1O 3A3NA 3DWIA 4QU5A 1L5RA 1YDHA 3DAGA 4C4SA 1C14A 2E85A 1XAGA 4H18A 3UWMA 2PI5A 4DMRA 3LUGA 3NHAA 4OGFA 4DZTA 2C77A 5EIHA 5DEOA 2OB2A 1OLUB 3IG5A 2PUBA 4RCYA 4UHDA 2HWKA 5F7JA 1KYQA 3GP5A 2QZSA 2ZRKA 2PNFA 2XOEA 3A9RA 2EWMA 5B3JA 2HU5A 2A9JA 1FVFA 1SUFA 4TKUA 3KKLA 1VJCA 5FTJA 1C3LA 5IT9A 3BWBA 4DCCA 1U9CA 4C0WA 4AJ4A 4KQ6A 3PUJA 2C8VA 1E1QA 4HDRA 5D84A 3T61A 4ISCA 2DY0A 2Q1SA 4NTZA 4GX5A 4MKRA 1KZ1A 1FIQA 1QS0B 4BJQA 3MJHA 4OSOA 2AMVA 3R77A 3LYAA 5KX5F 3PC3A 4LVUA 5HJEA 4IIYA 3KFUF 3OD1A 1Y9EA 2OWDA 2IKQA 3U3ZA 2YJTD 2ORED 1M8PA 5FO1A 3M7IA 5CA1F 4CEIA 3C7DB 5ICEA 4WD3A 1U3VA 2F3NA 1V8ZA 2QG9A 4G07A 1JAXA 1DG3A 3HH8A 4M46A 1NK7A 1YBMA 3RBVA 3RM3A 4TVBA 3L40A 1ISJA 2X7HA 4CR8A 1CR0A 1XRMA 1DRGA 4TUYB 4EG0A 4A82A 4KNVA 5FOVA 3PP8A 1LB1B 3SQMA 3ZGZA 4ZTUB 5EYPA 1RRGA 4U7WA 3RVLA 3D6FA 3PNOA 5FNZA 5IW8A 1U45A 4IOKA 4LZOA 4NBNA 3VR4A 1AGNA 3ZJTA 4D0GA 3FYUC 2QM0A 4GUDA 1RXUA 5DHSA 5EP4A 4JYPA 4ZT2A 1VLQA 2J5KA 3C3YA 3DKVA 2JGAA 5CB4F 1DK2A 5FD8A 1YKFA 2I8CA 5A5GA 3I8OA 3BGDA 3U3DA 2C5GA 5KNCD 2C58A 4CJXA 1OLUA 3HXKA 3TM5A 3LK6A 4AY5A 1DG9A 1Z37A 4C5CA 5FI3A 1SZPA 2OLJA 4US9A 4FJ0A 1LLDA 4Z4EA 1JH9A 4WX2B 2JLUA 3BHJA 4EYQA 4RIEA 3UB3A 3F8SA 2ZOSA 4IOMA 4MI1A 3H7IA 2EOAA 3CCCA 3HJNA 1VL6A 5JISA 3MHTA 2AG1A 1QGDA 1DVRA 2DE0X 4E21A 3MMZA 1HMPA 1FIUA 1P1HA 1OHHD 1QS0A 3RJ5A 4GMGA 8ICHA 4D4KA 1HSOA 4OA8A 2R8JA 3DKRA 4YR2A 3D3NA 5C1IA 2MTBA 3AIIA 3MGBA 2CD7A 2PEZA 1YRHA 2H1FA 2PYZA 5AVKA 1YQDA 4CLOA 4PPXA 3LUPA 4A27A 3TLJA 3TMAA 2X4DA 3MERA 1PP4A 1QO0D 4DSEA 3TR5A 4M1SA 1OE0A 4COOA 2HIMA 2LV8A 1U9IA 1R2QA 4U9UA 2G82A 1PR2A 1TCAA 4ZEWA 1FBNA 4AL4A 1E3WB 1I14A 1NP3A 3FBTA 3D8BA 1MRNA 2CN1A 2XLBA 3TX6A 3FC4A 4MQ5A 3TW0A 1SHUX 2ZUTA 4NK4A 4RHYA 4TUYA 1QTQA 1ZXBA 4YMNA 1J8YF 1IXSB 3PIDA 3IPLA 4BNDB 4DMGA 3IHWA 1PUJA 2VSQA 1RP1A 3FDSA 4A15A 5BSHA 2QUKA 4YP7A 1NLFA 4E6EA 1GP2A 3K2BA 1WL8A 1DIGA 3B3AA 1BKDR 3ADBA 3WICA 2VJAA 1QYDA 2RGGA 3K1ZA 3B2NA 2WU3A 1KO7A 1QCDA 3HQ4O 5AICA 5JTIA 4ZVTA 2BEJA 2WW8A 1Z4QA 1UBFA 1B2LA 3KPYA 4MH0R 3U5ZB 1OH7A 4XYGA 2PD4A 1WHSB 1Y81A 4JJ6A 1COWD 4F86A 3AR9A 1ZQCA 5TX7A 3EODA 4CR7A 1UAGA 2PL3A 3HUTA 5BQXA 5IVHA 2VP6A 1R6AA 2PVCA 5CVUA 2QP9X 4QTXA 1KK0A 3RBXA 4OHYA 1C7YA 1LV7A 1KO4A 5AJVB 3ZWCA 1TB4A 1UC9A 1GN9A 2V1XA 3L0BA 4GPAA 3F71A 1R8SA 4F3YA 1X7ZA 1GZSA 4IINA 1CERA 4RJTA 2YMLA 4HNTA 4DCTA 5KSPA 1O95D 4MJXA 1Z2DA 2H4FA 4P3YA 4RANA 3SOZA 2FV8A 2QGZA 1QHGA 5GMOA 3QUTA 1T6XA 1HDGO 1SRQA 3G5LA 1SQ6A 3SY8A 3H1TA 1DLIA 3EH2A 3SIRA 5AUQA 5LZ8A 8ICZA 3WMRA 3QV1A 1ETUA 8ICEA 4NBVA 1E3WA 5E1OA 2PR7A 4ZA2A 4OB8A 3PEYA 4J03A 2PX0A 1KZ7B 2A78A 4D3ZA 4OHCA 1QVAA 2I3ZA 2ZCUA 3OT4A 1C41A 4TZ6A 4B6FA 3UKJA 4BNDA 4CT0A 2JLRA 3OLWA 4X1KA 5KYXB 2GI4A 4QZFA 1GA6A 3WV5A 1YDMA 2CZGA 2VA8A 3D4NA 1RKBA 5ALYA 3T1VA 4C08A 2R00A 4X8HA 3NP9A 1XR3A 1Z7BA 3Q15C 3CW2A 3QVMA 3KXDA 1SBNE 2PJDA 5EL0A 4OTZA 3PGJA 3EZLA 3QXGA 3WRXC 4MS4B 1LRKA 1UFOA 1YE5A 1XDWA 4M1OA 2EZ4A 3R3SA 3P20A 1WHSA 3RAQA 2DWPA 3PUYA 1GAJA 1P4JA 4IDPA 2IOHA 1LFAA 4C3VA 4N3GA 4R7TA 4M49A 2WE8A 1L4YA 3NMUF 3S27A 1T24A 3Q5EA 1YRWA 2CBGA 1FFVA 1VE6A 3E9RA 2HA4A 2YH2A 2GCOB 2PN1A 1NR1A 3U4GA 1S8AA 2PV7A 3BZCA 5BSEA 5H3LA 3F3YA 4C4AA 1E9FA 1ZK0A 3AVWA 5A62A 5J0QA 3CVWA 4XW2A 2VXOA 1J20A 3KLBA 4AY4A 1GT6A 3WYNA 4GOKA 4MVYA 2J67A 2C0PA 1CWUA 3UUEA 2C8JA 5ALXA 3EWNA 1MIHA 2JIZD 1ZJ4A 7ICVA 1Z39A 3KPVA 3N8IA 4UCWA 4I2AA 3LT0A 1UADA 1R5OA 4V0SA 3IRVA 2Z98A 4JVNA 2PKRA 1NW9B 3D3JA 4MV5A 2YMMA 7MDHA 2EHDA 2NXNA 2PNJA 1LKYB 1LVGA 3P97A 3WAKA 3IJ5A 4RJIA 3LZ6A 5A1TA 1Q1BA 1TF2A 3E5NA 1CUZA 4NYMR 2D6FC 1SB3C 3TW8A 2JLQA 1AB5A 3PC6A 5DWVA 5KTKA 4Y0NA 4KTVE 1KMHB 2VK1A 3X2FA 1ZK4A 2BV3A 5DOZA 2B83A 4H08A 5TR9A 5JCJD 4JL5A 2G0NA 2BJHA 1GNVA 4WV3A 5DHFA 4NDAA 2P35A 2FFHA 1ACLA 2AKAB 5KPJA 1P9OA 3IB6A 4JI4B 4KLSA 4E2XA 2FFAA 2IOFK 2QLTA 1YK0A 3CYFA 4NLZA 1ZICA 1XCJA 2PMEA 3KLNA 4JP8A 3UMVA 1P6UA 1YRBA 3HCDA 1U3DA 4F4JA 5MFPA 1YZ7A 2RGNA 4HQ0A 3NRCA 2OZPA 1UKEA 1WUKS 4XQCA 1DKPA 3ZUGA 2GEUA 2ZWPA 4EABA 2D3TA 4NK5A 3R9XB 4MS4A 3NNNA 3BH6A 3U4AA 1VRWA 1JG7A 3N3BC 3TDNA 3GGSA 3HVUA 4B79A 1T3LA 3TVTA 5KVSA 3C2KA 4F92B 4DQXA 2WAAA 4LVOA 1DRVA 3O26A 2QUIA 3DMNA 4X91A 4EY4A 4NL9A 1QP0A 3T3EA 2GCOA 5A3SA 1J4AA 4UPEA 2B0JA 3PDIB 4NM1A 4CG2A 5L7YA 4MCHA 3TR0A 3IC5A 2VJ4A 4QBTA 4LNAA 3EXIA 3IDAA 1TV9A 5TJHA 3EZ9A 4H59A 2FMFA 3VX3A 3SF0A 1YR1A 3OJSA 1FYDA 2C5EA 3HP4A 3F7OA 2XMCA 4DKJA 1MO6A 3WWCA 1VSUA 5EWLA 3B60A 1T1JA 3U7EB 4DCNA 4IO0A 1RM6C 3AGPA 4ELTA 4GNRA 3ZOKA 2QR3A 3FUCA 3HP1A 2QUJA 5DZSA 3VOAA 3VJLA 1TU0A 1PVRA 4MAAA 3DZIA 1E18A 5EFOA 3OCJA 2PA0A 4BN5A 1L4MA 1XTSA 5AHKA 1ZKMA 1FQJA 4DWJA 3PYLA 1X1BA 2QUHA 5L6LB 3FPFA 4GLXA 1KMHA 2HMUA 4GZ3A 3RDPA 2Y0SF 1JPNA 3L0IB 4XUCA 4GGPA 1JILA 3MJEA 4U02A 2KHVA 4OQPA 4B2IA 4DIKA 1W36C 1X7XB 2JI9A 5EHZA 2IU6A 2GCIA 5JT1A 3I5UA 1PF7E 3DNPA 3STWA 3IV6A 3C1ZA 3H6GA 5FORA 2E5SA 1FSFA 5G5GA 1Z5OA 3KV1A 4YR3A 4OUDB 4DANA 4ZTZB 2FHSA 3UH1A 3RJJA 2X15A 4O5AA 4RY0A 2G36A 4XFKA 1B8NA 2Q2WA 1IAVA 4RHCA 3KT0A 2P9HA 4ME6A 3EVGA 1H0SA 3A6EA 4II7A 3R9XA 1V85A 1OLXB 3L43A 3PD0A 1FP1D 4WLEA 1QG6A 4UEKA 4L5CA 4LVSA 1CCWA 1MMFB 1SGWA 3DOIA 1K7YA 3R3VA 3GMTA 4HDKB 2QTCA 4R81A 2QL5A 4LSGA 1ENZA 1Q7CA 3T1TA 3K05A 4PO9A 4RKRA 2FP4B 2FZGA 3CJTA 2Q6OA 2D1QA 3W2HA 5AUPB 3HBFA 1DKQA 2ZUSA 1PGOA 2P9GA 2BEUB 4U3JA 3PQ2A 3PDIA 3B70A 3HUFA 5B12A 2EFYA 1G8FA 3CTPA 4YJ3B 1JDBC 2IELA 1W73A 4BJ5A 4OSPA 3FMFA 4MIKA 3OE7A 2VP5A 4UHCA 4IS3A 4H1HA 1AMNA 2Z43A 4RMNA 1UM9A 1G38A 5DOVA 5LQJA 2N75A 4WKGA 4M7OA 4G1MB 4RQ4A 1K3TA 1LUAA 5BV1A 1SK8A 5KNDH 2Y1CA 1ZINA 4O08A 1Y1TA 4AZ3B 1TO1E 5FQNA 4DLGA 4X65B 4LYAA 2CCKA 3KX2A 2ZPUA 2HQOA 3CB4A 3KTQA 4KR6A 4JELA 2C88A 5I3ZA 3H83A 1XDSA 4X54A 5KT3A 3CZQA 4C14A 2CEKA 4IM7A 2E4AA 4NU8X 3HWSA 2H1IA 4ECYA 1ZH4A 1TU3A 3E7FA 1I2MA 1C7JA 3EZ7A 3ZDYB 3U17A 1Y0BA 4BQQA 5FQOA 2VNIA 1HF3A 3G2IA 3ZLVA 3CZ5A 3CSSA 3MUEA 3W3AA 1X7XA 3PFWO 3MLAA 4ZFNA 4KGXA 1XC9A 4OJOA 2Q6VA 4DUYB 2HBKA 5LSAA 1T10A 5LP1A 1F5NA 1WKVA 2YOFA 3W7VA 4OUDA 1KJ9A 2ZRNA 4MK4A 1QRDA 3VYUB 3R0IA 4MA4A 5DBAA 2TECE 4GMXA 1A04A 1ZFNA 2BR5A 1WZCA 4X92A 1TEVA 2YZMA 4PWYA 1OLXA 5J4VA 2ESRA 3JQQA 4IICA 5JI3E 2CVQA 3L0YA 4CL0A 1L0BA 2LR0A 4HDKA 3RT9A 2P9EA 3M9OB 3L7NA 3PQFA 4M3NA 4WJZA 4LNUB 5CW1A 4CF4A 1Z6TA 3UB2A 3G9QA 3LBAA 1U5AA 2FP4A 2Z30A 4Q3OA 1QK5A 1UIMA 4UD6A 5KWVA 4PHGA 1V39A 2BEUA 5FJJA 2XMZA 1IHXA 4JKIA 1G21B 4YJ3A 4KL8S 1VCMA 1UZLA 3HB7A 2WU4A 1BMFA 3IE0A 2VYVA 1I36A 4MDEA 1DT5A 1JDTA 4Z6EA 4PRZA 1ESCA 3F98A 2PDAA 3CSDA 1H1DA 5LBIA 1WBBA 1YJQA 3RC3A 5IIJA 2VRBA 9ICBA 2FPKA 1XB2A 1JI3A 2HDWA 4YEDA 4IWYA 3W6PA 4CM8A 3KNZA 3VR5H 4GDFA 2YYZA 1A8IA 1Z5WA 3K0BA 3R7AA 3IBTA 3WFZA 4RVGA 1CB7A 5JXWA 1R0RE 4BLWA 1QRTA 3BD9A 3TPCA 2WSLA 2Z8XA 4OUKX 3PNPA 3ONFA 3N7PD 4IFIA 4HYKA 4Q21A 3WDLA 5DBHX 2ZVPX 4JU9A 1WMAA 5E9WA 3E15A 4S35A 1KO5A 3VNRA 4S04A 3T5TA 3CKKA 1ZJJA 2Z56A 4ODIA 1QJCA 1KFSA 4YRCA 5AM4A 1M9NA 1DJOA 3DDWA 1WB4A 4KO4S 1ZGAA 4RPKA 4YQZA 4EQ6B 4W7IA 4TLDA 4RS4A 3R1IA 4YMSA 5F33A 1ODIA 1KTQA 2V55B 1BS1A 2ZJ0A 2B8JA 5HKLA 4PVCA 3T3DA 2IHZA 1L3TA 1QSYA 3DMFA 3IP1A 4MX8A 1NZFA 3B2EA 2Q1XA 3BGSA 3OUTA 1JROA 4LNUA 4JLPA 5DLEA 4F5OA 4GI3A 4BMSA 1TECE 1TFRA 1F0KA 3ET5A 1RC0A 2EVWX 5HBRA 1J21A 3M6ZA 1O57A 4NV0A 4CFSA 5IC4A 3D8TA 3UANA 3O4RA 4M86A 3RRBA 4OQQA 4PZYA 5DTEA 1G21A 4CGZA 2C2BA 1X3LA 2HJWA 1Q57A 4QRIA 4LJRA 4GSYA 1SCUA 1I10A 3IDQA 1AS0A 3A32A 2CUKA 5CEHA 3VH4A 4Z53A 4GI5A 3WLLA 4YH1A 2ZTCA 4WXEA 3YASA 5FAKA 5KAIU 1HK7A 2P4SA 2DF8A 1DQPA 3QBEA 4TGLA 5M3BA 3G2JA 2OORC 4BX0A 3CR3C 1GYRA 3K6RA 4D42A 1DV2A 3N6XA 3CPHA 3STVA 4D9MA 1YL7A 1NK6A 2D4AA 3T95A 3CUTA 3E05A 2N0SA 4N6OA 2XITA 4URHA 3Q8WA 3U9TA 2FHPA 2JLAA 1ZQZA 1U7OA 2EGGA 2H5IA 4CLDA 3U5TA 1U1DA 1K92A 2Q3BA 3ZQJA 1X8XA 1ENPA 2BZSA 4JYAB 3PT5A 3M6VA 2QX8A 1GKYA 1KE2A 5K0GA 1IBKB 5JRDS 4JT2A 3LYLA 4N7RA 5K2OA 4KO3S 2CXNA 1U0SY 4R16A 1BH2A 4B3TB 3DXZA 4M2YA 2YJGA 2H2HA 3MTEA 4E15A 1ZGJA 1XKTA 4L8LA 4EQ6A 2I1VB 4QIWF 2UDPA 3ZHYA 1XSPA 1R0SA 3PXEA 5I48A 2XVMA 8ICYA 1F1BA 3VKWA 1RWMA 3L8HA 4HG2A 4LK2A 2OAQ1 2W70A 4ZOHC 1VKHA 5CFLA 4Q4AB 4YQEA 4C07A 5AXCA 5ALQA 3IHLA 1JU3A 5KYUB 4QBIA 1WPQA 2BJVA 5B7NA 3A2NA 3M1YA 1NUTA 4F91B 1Y1QA 2NU8A 2W2PA 5KVCA 2DWCA 1HL7A 1ZC4A 2XGJA 3GI1A 3O38A 3ADCA 4US1R 1C4XA 2R5WA 4EI8A 4PZLA 4L78A 3DDZX 5KO2A 1CUVA 4KXFB 3DOOA 2XDWA 1SU7A 4A5OA 4EAQA 3QTBA 4EVSA 3NS1A 1A71A 2BZ1A 1BOFA 1KDVA 4EUFA 5AVJA 4WFQA 3DWGA 1TOAA 1W35A 2LI6A 4RVFA 1TK0A 4UB8U 3IVAA 3D1JA 3EPHA 3FWNA 1U47A 4JDUA 3W6ZA 3ITKA 2DULA 1YCHA 1UWVA 2PGOA 4BUZA 8ICWA 2F4NA 2Q1YA 3D8SA 3DHEA 2FWBA 1Q7BA 1P74A 3B1KA 2JLWA 3IAUA 5D00A 4ZVSA 2QQ0A 3GRVA 1LK7A 4D4MA 1OIWA 1UBMS 3FCSB 4ZYTA 4MKFA 1HZZC 3NWEA 3DWEX 3O8DA 1E6CA 5JS7A 3NEPX 1D04A 1V8DA 1BJKA 5AVSA 1XHFA 4DMCA 3DYBA 3E9QA 2VDVE 1P5HA 6GPBA 1N32B 4BYGA 2EU8A 3PO4A 4BNMA 4UQLA 3MIIA 3O4FA 4GZ5A 1YR7A 1L4NA 4RT3A 3BEDA 4CCAA 3AY3A 1MAAA 4B84A 2VTEA 2DPHA 3HYNA 4R83A 2GEVA 1N2CE 3WP0A 1C2YA 2XGQA 2ATEA 3BS4A 2V74B 4XVHA 4O2BA 1WU8A 4OF4A 4Q7MB 3OG9A 1KYYA 1PO7A 2FZ5A 2KJ5A 4I2BA 1G8KA 1I3MA 4B2LA 1OI4A 3AO0B 1T4GA 3KYJB 4D3SA 1DCFA 4EPWA 5BSUA 1MQAA 3TRHA 3GUVA 4DCUA 1N78A 2Q3LA 3ZTYA 5FV4A 2FVYA 3DW3X 4MPJA 4AKEA 1A9RA 4Q4AA 2OV2A 4AXBA 5KYUA 1ZQXA 5B53A 1HNWB 1YUMA 3BGVA 1BQEA 3RF7A 2HBYA 4UFNA 1DO2A 1BVSA 2ZQZA 5B57C 2JL1A 2B1RA 2R8OA 4E6PA 4INOA 4JUDX 2GF9A 3QMWA 1YA4A 1DJLA 2CNWD 2XPCA 5IT4A 2NAPA 4R2JA 3PSIA 1Y9AA 1XVTA 3ILXA 4NARA 3T35A 4ZQBA 3K6KA 2JD2A 2ZS8A 2CFIA 3DKPA 4P92A 4CLEA 1Y3HA 5EIAA 2QARB 1WKCA 1EJ0A 1PQUA 4ZOEA 1IZZA 3JASA 4KO1S 4UMDA 4WASA 3L82B 1T1EA 2FN4A 2G5CA 2Y71A 2ZETA 3AMVA 4KLDA 1X2IA 2AG5A 2A2ZA 1S3FA 4DFMA 2QRZA 3E53A 4JBXA 4MZDA 2QJOA 4RU1A 3AFNA 5AK4A 1LCIA 1O94C 3N87A 2HWWA 1E98A 1GJRA 1YIOA 2J9GA 5FEMA 3ITDA 1D03A 3W2EA 1M2NA 3I52A 4UTXA 1L4GA 4HWSA 1FTWA 1IBRA 1GU0A 4Q9JA 4HXFB 2C92A 5JECA 1JDNA 3VI4B 1XRPA 3OP1A 3OY2A 4C4OA 5AOCA 2I54A 1OT3A 4EKNB 4TMTA 2C8KA 3AQEA 5DNWA 4I4LA 1UXIA 3UF0A 4H7DA 2IU4A 4CDRA 3A1EA 1FTQA 1N9GB 2H16A 2Y2UA 1NX6A 1ZS9A 2GPJA 3KKEA 3ETHA 4X5VA 4LJAA 4DG5A 3FYDA 3UUGA 3DE7X 3C3XA 2F00A 1UBNA 3ANLA 4FNOA 1ZN7A 2X2EA 4ARAA 2AG0A 3GGDA 2IMWP 2PCJA 1KS9A 1UJ6A 1UPCA 3EMVA 5BMVF 4IR1A 1HDCA 4NYMQ 4WGGA 3TLAA 2KG5A 2PMZF 3MXTA 2BI4A 1ZQ1C 5EXXA 5IDWA 3MGVA 1PWXA 3ORQA 2VAMA 1LS1A 3ZH2A 3WK8A 2W0MA 1J0BA 5EHGA 1Z28A 1RYBA 4LMPA 1JX6A 4URZR 1JN0A 4GNKA 1Q0ZA 2P62A 8ICIA 1DC8A 1XIVA 3C16C 5B7PA 5IANA 1D8AA 4BMOB 2HMWA 1EQAA 1SXJC 3QPDA 4E0DA 4DXAA 4LGVA 1KP2A 5F9MA 1EPUA 3COJA 4LW8A 2QARA 4MEJA 4RZSA 3K8QA 4MUKA 2NTYC 4BUGA 2EKZA 4EENA 4UUAA 3HBMA 4J75A 5DV9A 3TNLA 3H4VA 1JXOA 2R18A 1CIJA 3LGXA 1EXWA 2VQFB 2FUG1 1JFRA 1MUUA 2JBAB 3WKDA 4PYKA 1QF6A 4HWTA 2E87A 4BGEA 4B3SB 1TZBA 2PKCA 2WYUA 1FW6A 5FI1B 3DL0A 1ZSNA 3O4GA 1U0NA 3EZGA 4NI5A 2HSWA 5DKWA 3GR6A 3R0JA 2WUWE 2O2XA 3S7ZA 2ASVA 1PSZA 3P2KA 9ICGA 2VAXA 1A9QA 4AYWA 4JUFA 5DX1A 1RYFA 3P71T 1NG9A 1Z6AA 5C1BA 4BPBA 4D8WA 4REOA 4BMZA 3E8SA 1W4RA 5LNK6 3RRJA 2ZWOA 4DDHA 1FS6A 1YRLA 4B47A 3Q3CA 5BV2P 2L82A 1XD9A 3M4YA 3CZ4A 4M9GA 4ICAA 1UIRA 1E9BA 4BBZA 1E58A 3DYIA 4X90A 4DA7A 1QOQB 1I13A 2UUPA 1N9GA 4L50A 5FA5A 4D6XA 3LBNA 2FQQA 1OF1A 2RDMA 4EKIA 4YRBA 1IM4A 2NZXA 1TI7A 5DNDA 4WLFA 3IALA 6LDHA 3I92A 4MLDA 3A9UA 4UTNA 5CGZA 1STOA 2X8JB 1KR2A 4JJGA 5CXQA 1IN8A 1FSPA 3AKCA 3KTFA 1EDDA 1DAPA 2JVIA 5HKKD 4B34A 4DR6B 1DQZA 3NHFA 4JJAA 4RLQA 4P84A 2L17A 3EK2A 1JZTA 1AKNA 4JMPA 3LFUA 2W2LD 4S1OA 4TXJA 4EGSA 1G18A 4IGIA 3JU3A 4EMUA 1U80A 3PQDA 1SUBA 3G5UA 4CUJA 1WDKA 3HU2A 2A84A 3NAMA 3DKIA 4UM5A 2NV3A 2HSEA 5IIOA 1AO0A 3VYWA 1QPZA 2I5PO 3E48A 1CZHA 2PL9A 3AEZA 5DTMA 4E30A 4GLLA 4GR9A 1FFHA 2HMSA 3OIGA 3PWSA 1TDJA 1SQ0A 4V1CI 5TS2A 2GN6A 3D2QA 5E8JA 4KLLA 3U1VA 2IBTA 3VMFA 1GGMA 2JBAA 3OFJA 2LTAA 5FH9A 3PC7A 2GLXA 3GEPA 4QBGB 1F5SA 3CUKA 3TLMA 4P3KA 4JLOA 3KLPX 2Q3DA 1VGRA 3BTUA 3TANA 1A88A 4CIXA 1MG5A 2Z9BA 3V2HA 3VDQA 2CWWA 2W9XA 3DXFA 3KCNA 4I2FA 2HT6A 4KN5A 3FIUA 3PUKA 2P0EA 3STXA 2DFDA 1XCGB 4AZTA 2YRXA 1Y4AE 1UJCA 1F6BA 2EAOA 4GKBA 1ST3A 3HDYA 2VYFA 1UKBA 1GPBA 3IP7A 1RKQA 5D7BA 4NV3A 5FWYB 2R8PA 1FFGA 1JP7A 3A6LA 4MVJE 2WNIA 2N1BA 2PZLA 1R18A 3NVYA 2WJ6A 2HIAA 3IBGA 4DOMA 4XUSA 4OBBA 4G0PA 5FNVF 2X8JA 4BO0A 2PCLA 2FFRA 4DA8A 1FP4A 4F5NA 2VRCD 3DAYA 2OZLB 5KWIA 3COSA 2IEIA 5HX7A 1RM5A 3Q6IA 1VPDA 2FYTA 2JFBA 3X1XA 2HPVA 4MJLA 4WCFC 1VP9A 1P31A 3GDGA 2W03A 3PO5A 3GVHA 1TQHA 4MHTA 2X0NA 3N53A 4Y1FA 1C1YA 2B2NA 4R1UA 3MR5A 5KT5A 4TVKA 1JR6A 5J0TA 2AEJA 2JS7A 3VYSB 1VG0B 2FN7A 4RPLA 4G0YA 4MDYA 4MVWA 2J0EA 2J6BA 5DGAA 3P0RA 3SJAA 4C7VA 4JLNA 1JPVA 1MJHA 1ZCZA 5FA8A 4YRKA 4RQMA 3A14A 4R2HA 4IR9A 3ZR4B 3GRAA 4W1RA 2AQ0A 3RK4A 2A9RA 1MPTA 3K5IA 4LOKA 1ML4A 1NXSA 4OQ4A 3AUSA 3CIOA 1M2GA 1ZIXA 4EG8A 4DM3A 5IIIA 1G5RA 1MO2A 721PA 3LSYA 4FHGA 1W44A 3BTOA 4EB0A 1Y7PA 2AQHA 2NSLA 2R0QC 1XMSA 1XJ5A 1WQ3A 3WQBA 2Q9AA 3RF9A 1CF2O 5AI8A 2IYUA 4LJ7A 4HDRB 3AJAA 2F9MA 2YIJA 4JI8B 1H38A 4BB0A 1PK9A 4JXJA 4YI3A 2FR8C 3PE3A 2ZSDA 1AIPA 3WA7A 1ONOA 3ZBPA 2WTXA 4CTJA 3QOYA 4UAGA 3MRSA 3ZWMA 4GPD1 5HRUA 4DQSA 2GVNA 4L0QA 5A4JA 1JA0A 4O4HF 2KBFA 3V7LA 3E18A 1GNQA 4JT8A 4LY0A 5FWYA 1HSZA 1J2TA 3AF1A 3O03A 3RTGA 2B4YA 1EK0A 4LWZA 1V71A 3C28A 2Q45A 4PZDA 1T91A 3JTEA 5CFQA 2IYEA 2BF4A 1XN1A 4F4YA 4LHEA 4PS0A 3AUKA 1N2BA 1AF7A 2J32A 5LL6P 5CX4A 4H16A 1W8DA 1Y7LA 4R54A 1RJDA 4ARSA 1KZ6A 1SVLA 2ZE6A 2YUIA 4LNHA 2OZLA 1A8PA 2H1LA 1ISGA 2V7VA 2A3VA 1XP5A 3AM9A 3MJRA 4U7HA 5KFXA 1KL7A 3PSFA 1JR3E 1Z13A 1JLHA 3HPOA 1E3LA 1FYFA 1X1CA 2YZGA 4JD5A 5EYPB 2GO7A 4IF6A 2D5IA 2VUTA 3KQPA 4RQ3A 5CUQA 2J7PA 1WEHA 2PY6A 5TQJA 4FHZA 4HAUA 2RHTA 3TKAA 2R1TB 3K53A 4YJ2B 4LX0A 1A1VA 4LV5B 2NZWA 4UXHA 1GOTA 2WIGA 4J6FA 5CIYA 5EZ6B 2FW1A 3WZMA 2OXOA 1QLJA 3PIIA 2K8AA 4DLTA 4D57A 2VPIA 1OXUA 4Y6SA 1J1UA 4C9BA 4F5PA 4DV7B 4JASB 2BBSA 3IP4B 2AUNA 4Q18A 3N05A 3BKXA 5I4BA 2OV8A 4GR5A 5A1JA 3VNUA 1Z5NA 4WBNF 2F17A 3F2DA 2WDPA 2QE7A 2DJIA 3UHJA 1ARZA 4H9GA 4JCOA 1ULUA 1KZ9A 1DBQA 1DAFA 4PRLA 4LRSB 4TSFD 5JAMA 3VNVA 4IBOA 4OI1A 4A9AA 3ILVA 1Q8KA 3NH6A 4OXXA 1G6HA 4PLYA 4IDQA 3LL7A 3NIBA 2JJMA 3G79A 1ULAA 5KG5A 1YDGA 2G07A 3DO5A 4CLOB 4XIIA 3QY9A 2FRDA 3VZRA 3SAJA 5E7QA 3B82A 4HYQA 4NU0A 2XCAA 2R6ZA 4TRMA 3K1TA 1QSGA 1WVMA 2J6HA 4IOLA 3E9CA 4MB0A 2P30A 1FQKA 2HNKA 1I4EB 1N2SA 3WYDA 4ZKDA 2E4XA 4MHSA 3AW9A 4AS3A 3TSYA 3QF4B 4ZT4A 4AK9A 4BVJA 3D3QA 2ASLA 5DEIA 1J5PA 3F7TA 5A71A 1KJYA 4C7OA 5FL7D 4YP9A 2AEMA 3ZU2A 4J3NA 5DLYA 5JCOA 4P7KA 2Y1IA 1EK2A 4MICA 5TDHA 2OV1A 4L75A 1DIBA 1E1MA 1JBKA 2FMQA 2GN8A 2GTPA 2VWHA 2BZGA 4UNIA 4XIFA 2R1TA 5JO0A 4YJ2A 2VXCA 1P2GA 1B16A 3G8DA 3BJZA 1I8TA 4NLKA 1J2JA 1MW8X 4ID9A 2BHSA 1TIBA 4FLEA 2QPOA 3SIXA 2JEGA 1C7IA 3QKSB 2E3JA 4N8DA 5F1OA 1UA1A 1U0EA 2A59A 2HJSA 4RTSA 2FOIA 3LUCA 4HX2A 2EDUA 1P2VA 4GXJA 3KKZA 1X2BA 2HWXA 3ICEA 3EXHC 3NHRA 4DREA 3K70D 1R6VA 4C7KA 1XALA 1Z12A 3M9WA 1KY2A 1PN3A 3EIXA 4DOCA 3QSGA 5JSFA 1QR2A 3KHHA 4KK3A 4D99A 4ES6A 1V5EA 2B99A 1E9RA 1Z8DA 1WTCA 3IMGA 3NONA 1WDWB 4HLUC 3WI7A 1XF1A 4YMMA 2Z4TA 3SQOA 4TXMA 4K6GA 1X7ZB 3ZI0A 4G1FA 4UB1A 2X77A 3ZDXB 2CLDX 5AD1A 2YZ7A 2PT6A 3H13A 4MTCA 1KYVA 2CC2A 1OW3B 1WAMA 3TAXA 5AI6A 3MS4A 2ZWMA 2BN4A 1SH7A 5H83A 2HT1A 5KDLA 1D4FA 4OLJA 4NBWA 2CNLA 4EMBA 2YWHA 2G06A 2CXXA 1MEJA 1UFQA 4YRTA 5C3MA 2XT6A 3CUUA 3FZEA 3PEVA 2AFVA 1M8GA 1PTJA 4UDYX 1RYRA 3QF4A 1PS0A 3RSGA 5EMJA 1OXXK 2WM2A 4I2DA 2CXTA 3IB3A 2ZUDA 2IPNA 1V5IA 4S3MA 3GK3A 2YVLA 1F3LA 4FOSA 2OSBA 3HCEA 4B44A 4S1NA 3ZCVA 1U6IA 1XLWA 1B6RA 2BWJA 2Q6TA 1UEXC 3ICCA 3IQDB 4MUIA 4O3MA 1MNAA 4X1KB 2IJGX 3H8JA 4HMPA 1OTXA 4ZYLA 1M6YA 4Q24A 4ZI3A 5TPWA 5K3EA 1C7FA 1ZUNB 1BOOA 5C5EA 4MGIR 1JYFA 5AXBA 16PKA 4EJ6A 4YJKA 5KFJA 4B32A 1DBIA 1EIZA 5KNCH 5JQGF 3AJEA 3JQAB 3QKSA 3VZPA 1R66A 1KOFA 2YV4A 1KL9A 4ZO7A 4JZKA 3LX6A 3N1UA 1T8PA 3PNYA 3PX6A 1ABFA 2I33A 4NZMA 1NVEA 1I2BA 1U9JA 5EE3A 1YKSA 1ICIA 2YN0A 3UAOA 521PA 3MJDA 5EIEA 2R25B 4IQTA 2LWIA 5IBRA 1VYVA 3Q8MA 4JA0A 3CO5A 4KQWA 4M9LA 1NKSA 1WZEA 1N6RA 2OM6A 3K9NA 1GSOA 1S2GA 1RWOA 5T14A 3IAEA 3IUNA 1ABEA 4P2HA 4PYJA 1NM5C 4V2IA 1QO9A 1G5FA 4KACA 3ICWA 1XZDA 1E5VA 4IQGA 3E1GA 2XOKA 4Y30A 3OMLA 1XMIA 3OP4A 2HHQA 1PEAA 2F9LA 2XIQA 4M55A 4A7PA 3MT7A 3IIEA 1JXLA 1YD7A 3THOA 1WPXA 3QKUA 2PRKA 3TW8B 3BWXA 2P2ZA 1JXMA 3ZHSA 4R8VA 1ZJMA 4EWLA 4YAIA 3VR0A 1SQGA 3QWBA 3IAM6 5AFSA 3NRWA 3HVHA 4C21A 5C7YA 2HLDD 2HMYB 3F0TA 5EJ9A 2XV1A 3BIOA 4HRXA 4LYEA 5ECYA 2L2QA 3HL4A 3R6WA 3K0CC 4PZUA 1ZUNA 1KEKA 3H04A 1JMSA 1YZYA 4M0MA 3HXPA 5FUXA 3E3NA 4EYKA 3G2QA 5GP1A 3DZDA 3CRMA 2JH7A 5CT4A 4BQOA 2EP5A 4UE3S 1L5LA 5FR1A 3JQAA 3OU7A 4UPDA 4ZMBA 4NP6A 5HCIA 3JD4A 4C04A 1OIXA 4JY7A 4DQLA 2ZCVA 2RB4A 4F2DA 2O19A 2W6JA 4MO2A 2VQ3A 3GGJA 1WETA 3DF7A 3GMDA 4GOOD 3E82A 1TYBE 5BYKA 3B78A 4ZCQA 1MV8A 1FFWA 1Y88A 1KPHA 1LBEA 1F6DA 2EEZA 2PUWA 2IYPA 1NKVA 1HTWA 2R6AA 1U7HA 4BDPA 4E2FA 1KSHA 2VATA 1I9GA 2HHWA 3AF0A 3EXIB 3TTYA 1LVUA 5EWJB 4CL3A 4BCBA 3TNYA 1WXGA 3HLYA 4ZRDA 2OWEA 4GX0A 2EG5A 3G2OA 4EY8A 4X66B 5FBVB 1DUIA 3K4GA 5BO5A 1J00A 5EWLB 1D8LA 3IT0A 2AU0A 1GCGA 1XWFA 2YYSA 4C7XA 3IHTA 4RLSA 1AQYA 4N9QA 3X1WA 2FZWA 3HT3A 3I3SR 1QNFA 4Z9FA 3FPLA 1D5WA 2WAXA 1DAIA 4F3NA 2D1YA 2IU3A 3JVEA 3LWNA 1YHZA 2XI9A 4LDRA 4A1OA 1PKEA 3BYZA 3H11B 5SZKB 3T7IA 5CA0A 1S1MA 1TA4A 3PT9A 1S0VA 1O03A 1X8LA 1KRXA 5F64A 5ITSA 2WU1A 4C8NA 2JAHA 5ER6A 4MFAA 5I9LA 1I4LD 4ESEA 1ORRA 2PT5A 4YBZA 3C3PA 2V4UA 2W83A 3SZ2A 4QG3A 4K6CA 2XTZA 2CE7A 3K5HA 1DTWB 1GQRA 4BO3A 3KR2A 4NXMB 1L5WA 4XWYA 2NRTA 1DBSA 3PFFA 2CHVA 3QGMA 1RLIA 3W5JA 1ETHA 2O5RA 1IOVA 2CMHA 2WTAA 3PHHA 1U8AA 3PX4A 5T4EA 4P08A 5I4KA 2HA5A 1C9EA 2XGGA 1RPLA 4ASUD 3DEAA 2CFTA 4QZVA 5AM2A 1P8AA 2Y99A 1U02A 3V4PB 4IRUB 5HPYB 2PRZA 5K09A 3GA7A 1FTSA 2HEIA 4ED0A 2HDOA 2D3WA 2P3QA 5AK5A 4JBHA 1ELOA 1VLLA 4EJ0A 4DYHA 4U3JB 2YDYA 3D7NA 1PGQA 4BYMA 4NCIA 3SDBA 4CDGA 4XE5A 5EWJA 4QZAA 7ICIA 3F74A 1YMQA 4HADA 4Y2UA 2FY8A 2JHPA 1SU8A 3G49A 4XR4A 4MLPA 1UM9B 2NVWA 2A9KA 2D2FA 4RACA 1JJ7A 3OWHA 5BQPA 1OI2A 4HS9A 3VHQA 3VDRA 3D2LA 4MYRA 4DC1A 5E7IA 4RO0A 3RREA 4I14A 1TZJA 1DAHA 3NTUA 2XNKA 3KOOA 3SZUA 3H11A 2NWQA 4RQ7A 5LQRA 2HO4A 4ZVNA 3WHLA 1XK6A 4WDQA 3ELDA 4B2YA 4KQ1A 3A6ZA 4JP2A 2E4WA 1JYSA 1Q22A 2D2IA 4I4TF 4QC2A 2Q4TA 2RFLA 3RPEA 1KAOA 2QX6A 5KX5A 3AXTA 3MCZA 1VIVA 4D3FA 3TIGA 5L4NA 5JDIA 1Q2UA 5U1PA 4HQFA 2NNLD 2V4QA 4JWMA 3RFXA 1DTWA 1IB0A 2JHAA 3I23A 4LBWA 1JIIA 1AQ6A 4CN9A 5J0SA 3ZBQA 3ON5A 2ZB7A 2A8YA 2K4MA 2VH1A 1TW2A 3FSGD 4J07A 1T2UA 3KUKA 4C8KA 1ZRNA 1K5GA 2ODQA 2BD0A 3R0VA 4DMFA 2OC9A 1UEIA 4R5MA 1QMGA 3HJBA 4XM1A 3CLUC 4BLPA 2IYSA 2XQFA 4J3JA 1H8HA 4TQ9A 1WXDA 5JAOA 4E5VA 3CV3A 5AJUA 2HXYA 1RM3A 3CEAA 3P0JA 4YFYA 4P5PA 2P6OA 3I04A 5FBQB 1Y9JA 1I5EA 2XXBA 3DEFA 4QDXA 4Q66C 4DV3B 4AIRA 2VJBA 2Y9PB 2PXIA 2XWJI 4TX1A 3F5SA 3K9HA 2IGBA 1R4AA 3RBZA 4ZYUA 3UXHA 4BWFB 1AGYA 3K4QA 1MQSA 3PC4A 3IIKA 2J7KA 1DK3A 3GLVA 1CY1A 5CB4A 3UMBA 5ALFA 5KB3A 4FEEA 4WFKA 4N82A 4F4XA 3HC7A 1RZTA 3EEIA 1YRQA 1QAOA 3ZY3A 2BTOA 3FVTA 3CPJB 4LXXA 2NZ2A 1JG4A 1GG2A 1ECWA 4IQVA 4M22A 3JZMA 3B6IA 1S3GA 5F5LA 4CM8B 1CIVA 5A03A 5E9AA 1X9XA 4DL5A 1KARA 1QK4A 3HCOA 1PWEA 3GUZA 2IX3A 4Q1CA 5DISB 4TL9A 2YNMC 2PWZA 1SXQA 5EE1A 4G81A 3MAGA 5E2BA 5KFVA 4LRQA 1PLJA 3FG9A 4N3CA 1SV0C 1VHJA 2GRUA 1BVRA 1S0OA 4LJ6A 3CUWA 4K4GA 2CMGA 5DG9A 4KWIA 2ZZMA 1T29A 2ZT8A 1TQ8A 4J49A 1ZQQA 1U5BB 3KHRA 3L41A 3LTEA 2VJDA 5JE8A 1IEVA 1W93A 4DRZA 1ZZGA 4CQLB 2I0FA 4EF4A 2C99A 4B74A 1GZ5A 2RHBA 2PSFA 5ALRA 1K6IA 4G8BA 5TVKA 3PVZA 4TUQA 4ZI7B 1D1SA 2ZAMA 3H8SA 1MH9A 4DIBA 4GYYA 1RZRD 3RCBA 2OO5A 2DPXA 5D49A 4EY7A 3HP7A 3U3RA 4EFMA 5U9CA 2WSMA 1XYVA 2Q5FA 2ONZA 1OXJA 1SBIA 4KFUA 3ZGXA 1ZNXA 3ESCA 1XEXB 4ZO4A 3REQB 3DFIA 1G5QA 2PPVA 3OZFA 1OMOA 1MGOA 2O50A 5IS2A 2Q5EA 3AR8A 3D6JA 2ZKLA 4OP1A 1DWOA 4PX5A 1T1RA 2YHUA 2NZJA 2PEYA 1JSCA 3MLEA 3M1LA 4NEQA 1F0PA 3LF1A 3BJIC 2LDBA 1R88A 1W88B 1XFDA 1SCUB 3BMQB 3AN1A 3RH0A 3TO5A 1QH1A 1OGJA 1FYWA 4DG8A 4NZYA 3GOQA 4JSTA 4IH4A 2VBCA 2ZJ8A 2J31A 4ED3A 1SBZA 5ALGA 5F3DA 2FMPA 3RRFA 3DHWC 2AXEA 4L85A 1UOEA 4OGKA 3ZWXA 3WBKA 3MGKA 3AL0C 1C7RA 1OA1A 5JMPA 1JAHA 4PBRA 1AT1A 3O84A 2AEEA 5ALUA 3B12A 4GP7A 2RJOA 4D9FA 3X1ZA 4RQTA 3ZLBA 1GPNA 2Q9UA 2WQZA 3AHHA 1R6XA 5LBTA 1Z0JA 4RVHA 4CMAA 1ADGA 1Z06A 4C0ZA 2E82A 3RLIA 3EIHA 1IOLA 5AKKA 2YWJA 2PUHA 1PYGA 2WPDA 3G9XA 3L8YA 1U7XA 5DLQC 3QLEA 1ISRA 3U3MA 3U1TA 1AHNA 1U5BA 5AW1A 1PYDA 2QVXX 1NJYA 3EJ6A 2PZJA 3TADA 2Y4OA 4FD3A 4WKOA 2C4UA 4P36A 2ECPA 4CQLA 3H4TA 4H2DA 1GZVA 2MHCA 1ZIOA 2IIQA 1HGXA 1A8HA 4YDSA 4KBFA 3BA1A 2YIVX 2IHMA 1C3XA 5HMMA 4YACA 3VRHA 4IXDA 1WBJB 1ZHHA 4ZI7A 2GZ3A 3UMCA 2FW7A 2WZBA 1T3SA 5A0LA 4G5XA 3F6CA 1JXAA 2EJUA 4OQLA 1I0IA 4D9JA 3OEHD 1WZIA 4CMIB 4DSUA 3LQ4A 1MZPA 2G6BA 3KQMA 1U1FA 4O0MA 1NZJA 2M98A 5A6VA 2C1XA 4AZVA 1XEXA 1IVSA 3REQA 4MI3A 1TMYA 2FWRA 1QYIA 3ZK9A 2AI3A 4RV4A 3S1AB 1ZHFA 2NU8B 4WW0A 1ECPA 4M0CA 3T6KA 4RX1A 1NJGA 1OXBB 1OI7A 2AE2A 3IGFA 2X19A 1XQYA 3QUQA 1O1YA 1W88A 1PHRA 1N2IA 1E9EA 3LKDA 3NVKI 1T0HB 4NABA 3BMQA 3DS8A 3WV4A 3UXPA 3I73A 1IJFA 3AF2A 1RXVA 2YHSA 4PHTA 3FH0A 5K0NA 2V4ZA 2ZRGA 3F5AA 1HNNA 4DZZA 4MWCA 2JZOA 5BSGA 2VDPB 3MQ4A 2HOIA 1DC5A 2H6EA 2BKAA 2X40A 2ZBEA 4M0PA 5AVYA 2B4TO 2BCQA 4QA9A 3BXGA 3EUEA 3DSRA 2AJDA 3PNQA 4JUAA 1DEKA 4CTMA 1VSTA 4YS6A 3UNXA 1X77A 1FSSA 4RTJA 4ARCA 3QFRA 2DB3A 4JYCA 5E4JA 2ZRFA 3QY0A 1RXWA 1ZJNA 4JLUA 5DHAA 1DI0A 3I64A 4GRAA 1BMQA 1KJWA 4YT2A 5DFAA 2I62A 5EJAA 3I72A 3QIAA 3LPLA 4EAAA 1P2TA 3WZLA 5JQWA 5HZHA 1Z1BA 2YHIB 4A0SA 3SN6A 4O2BB 4S1WA 1M6WA 2I3AA 1NV8A 1JU4A 1ZJWA 1F9EA 2RK3A 3LLSA 5B58C 5J2EA 1F7VA 2XCIA 2ZTSA 3GLRA 4MA5A 3L6DA 1V5GA 3B8EA 4YR9A 1J24A 1BMTA 4CMIA 3MA0A 3NC1C 5J9FA 3ZDFA 4XFJA 1OZAA 1QIFA 4F3RA 4Q12A 2X9GA 5FWNA 3H6HA 1TAUA 1VXRA 1G8AA 2MJLA 5KFUA 4Q4JB 4XWKA 3HJFA 4BRWA 2V45A 3RIMA 3F1KA 5KI6A 2ZWAA 3B3FA 3S1AA 2D7JA 2FRXA 4RENA 2VQEB 2YXEA 1L7OA 4PL2A 2PWAA 5AR1A 3RGWS 4M1MA 1IBMB 4AP9A 4OJLA 5JS2A 1JLSA 3M4NA 2OK7A 3HDTA 4K4IA 2JGJA 4J9OA 3BDPA 3JCZA 5KTTA 1LB2B 4UM9D 4C0AC 1YOBA 5C8VA 3QHQA 2FWMX 5DN6A 4DJFC 2RAVA 4I2JA 1LJUA 2VPXA 1Z0IA 2XQVA 2BJWA 1X8JA 4CEHB 2PUEA 2JEFA 5EE9A 1IE3A 3DVSX 3JASB 5CLLA 3O2NA 2J5BA 2YDXA 4A0FA 4QUDA 3SM9A 2QROA 3N7UA 1BIFA 4PLTA 4DQPA 1T5LA 3ZX5A 4O4IF 3CGGA 3Q9LA 1S4MA 1P72A 1OOEA 2RKBA 2XCOA 1BGWA 5HHHA 3ZV4A 1XVVA 1SO8A 2PQ0A 1W4LA 2ZXFA 3FHLA 1XPUA 4RL6A 2P3SA 3K9WA 1P19A 3GT0A 2X5NA 1PJ8A 3CVYA 2WHEA 3PF8A 3IVCA 3D3KA 1MB3A 3O9VA 1GEGA 3CISA 1A7JA 3UMGA 3HV2A 3JWHA 4KX3A 1B8VA 3I5YA 1F0YA 9ICSA 1EFTA 2HTEA 1WMSA 2YHIA 4AUMA 2D5AA 4ENTA 2BCRA 4WLVA 1QZUA 2AKYA 3IP9A 2W8LA 3EAQA 3CZAA 4G56A 1PVPA 2WFLB 3PLRA 2YWEA 5C7IO 4XYEA 4Y7DA 1LGYA 4DLPA 2D4HA 3KZXA 1ZN8A 1DEAA 3GJ5A 3VTKA 2IVFA 3CRVA 5T41A 1MX1A 4L15A 3IR6A 2MCFA 2A1UB 2QTMA 4Q4JA 3OSNA 3WMGA 1BD4A 1ZD9A 3OOEA 2E1PA 2YN2A 3CEPB 3DDOA 5E6SB 5ICGA 4KLIA 4RTLA 1EFVA 3VOSA 4RY8A 4AJLA 3ILHA 1HDRA 4DKXA 5ICFA 4HXEB 4XGKA 2BGGA 1TYCA 3QJGA 4TQRA 1GGEA 4B46A 5BXQC 2R86A 5AW2A 4O5CA 3A04A 5L7TA 3UYKA 2JHCA 2ZYHA 5JARA 2AJCA 3FW1A 1EZZA 4LZDA 2FP3A 3EDQA 3VR6D 2CHGA 4RWEA 4XTCS 4L5YA 2FGKA 5EGSA 4HDNB 2OQRA 2QT9A 4CEHA 1M72A 5IN4A 4HAWA 4XJVA 4QW8A 3H75A 3KU1A 4Z0HO 1GUZA 3ORFA 1DL5A 2VH5R 4OYRA 3L7AA 3VXKA 2OCXA 1SIBE 4FGZA 4LPSA 5FI0B 3S44A 1G21E 2MIIA 5DYIA 3V1UA 1XAIA 3OQNA 1T9AA 2WINI 3WX0A 4EITA 4RKWA 1X1DA 3CF2A 4JBIA 4ZV7A 2MYTA 1KZ4A 4G25A 4DIDA 1YTUA 4GSLA 1K4MA 2HO5A 1FXSA 2XE6A 4MMZB 1Z8FA 3ND7A 2IXDA 2LP4Y 4ARBA 4QYTA 1YTLA 2B2XA 2ZYRA 3UAZA 2VPQA 4QZGA 4WNAB 2I2WA 3AR2A 3D2SA 3M6MD 1GG8A 1JI0A 3EARA 4Y0AA 5GY7A 3ETRA 1XZBA 3O75A 3W9YA 2WSSD 1OZFA 1NQUA 4WXYB 1WSAA 1RZUA 3H42B 2FZEA 1WZUA 2XUGA 1YVRA 1DAOA 2QN2A 4PLZA 4UUMA 2FLPA 5KVAA 2WFLA 2AN1A 3CNQS 1IC6A 3GCZA 4JN6B 2W6ID 4ZVKA 1DO0A 3KVYA 2G17A 1U90A 3ESYA 3AY7A 4FFPA 2EZ8A 3S8YA 3FR8A 1PGPA 1C7EA 1E8DA 2RHJA 5JXIA 4G23A 1UPBA 2GDJA 2ZU6A 1N5JA 2A1UA 3LBYA 2NMVA 2FG5A 4FOLA 1CNMA 4G5YA 3PDCA 5E6SA 5KKAA 3ZVLA 5GJCA 2XVXA 3PE4A 4ZAXA 3DBHB 4R1SA 2ERCA 4MPPA 2WUEA 4UAVA 5K3BA 4ZJZA 3CH4B 2P1RA 4W63A 2L42A 4JROA 2AZMA 4KQJA 2RGXA 1CUFA 1G2PA 4I66A 4LE2A 3ZV6A 4RTMA 1E0JA 2VSFA 4MDFA 1J09A 4HDNA 2DCUA 5J40A 4D9IA 4EG7A 5J2KA 2CWDA 1FK8A 4DOAA 1E1YA 1I3NA 1CW2B 5ILGA 2NXEA 4N41A 1US8B 2OYYA 4QWCA 1UOQA 2ZPAA 3K2IA 5AT1A 5CFNA 2RGDA 3QXCA 4ABYA 4BTLA 2KX7A 1XWLA 3IQIX 1QSSA 1QRSA 3K16A 4OHBA 2LVBA 4DFDA 2FWIA 4IUDS 2O06A 2JJYA 3EMKA 2JLCA 1T6YA 5DYYA 1JHZA 3COWA 4V0OA 2GNAA 5JJIA 4YCJA 3CZRA 4HNVA 4GP9A 2ID8A 2VL7A 3AM4A 1CRPA 3TEFA 1GFIA 2FZCA 3ETEA 3UJ9A 3TI9A 1CK4A 4WNAA 2O2GA 4UBMA 2IV3A 4UE2A 4UNRA 2WIJA 4FCWA 3TGWA 4MGZR 3CH7A 4R98A 1W4CA 2HQSA 4BKMA 3HJTA 3LNCA 1J7KA 1OBHA 2VP0A 4QYWA 1PHPA 4JB0A 3WHIA 5JROA 1W46A 3TN7A 1NVKA 1JQAA 1E1RA 2Z8ZA 4F1WA 4DVJA 1NFRA 2J0VA 3EZFA 1RWKA 3NCHA 1SC6A 1QGED 4MUJA 2GK6A 3HEBA 2C2DA 3MBIA 1OYVA 3SGLA 1DAKA 1FP4B 2WB2A 1N0HA 1FDUA 3T1HB 3ZDRA 4TZKA 1NASA 4PXAA 3DBHA 4ARVA 4E09A 1PDWA 3H0EA 3WK5A 3T7DA 1L3VA 4DFKA 4O0IA 2X0FA 2FU5C 1P4HA 2PZAA 2H1VA 3WKCA 4J0CA 3PX2A 4PNZA 4JB2A 5GM2A 3IUMA 4ED7A 1JGTA 4LDPA 4TTIA 4XLZA 3PFGA 2IYFA 4HDCA 5IJ9A 4N01A 4EKEA 5EXTA 5DB9A 1YFLA 4YAJA 4B9LA 2TS1A 3TLKA 1US8A 1PGJA 2R60A 1U7TA 1JLRA 2HAEA 2HJRA 2ZWIA 5I4CA 3OAAD 3LZDA 1GGFA 4XQ9A 5JTTA 1PZEA 1RVV1 4WXRA 3ER8A 1ZDMA 2QEQA 5JU5A 5AIAA 1N25A 2ONJA 4IX1A 4JFAA 3HCRA 4LIPD 2XQIA 3WK7A 2ZRBA 5B3KA 3EJWA 3OJWA 1JZQA 2FWAA 4BLTA 3CT6A 3FHOA 3QEKA 3JQFA 1UK8A 2PG3A 2WLSA 3IMFA 2RH9B 2ZREA 3TEMA 2SKCA 3IDZA 2V4RA 5ANRB 3V8MA 5IAOA 4EUNA 3KCQA 4G97A 3GDOA 3PSPA 4D9EA 5CJ7A 3H1GA 3JPNA 1VGVA 3G1WA 5BQFA 4CTOA 3ZZ1A 4LBZA 1NF9A 2HF9A 3RJKA 3LOPA 2NXWA 3OQJA 3T7TA 5IFKA 3AFMA 2ZR0A 1O5OA 4ANFA 5DP1A 1W9HA 3FCAA 2B5OA 3KKAA 5CPFA 3EQ7A 1ATIA 3ZV3A 1R16A 3IELA 1T2VA 2UYGA 1MAHA 4MULA 2P5TB 4PBTA 4O02B 2IHTA 1AXGA 1ONPA 4LZJA 4IZIA 1NJFA 2NM0A 2X9VA 2XMQA 1S3SA 1CT9A 5EJGA 1CEZA 3BHIA 1IQPA 1EZ1A 2G67A 3NJRA 4FDLA 1TEZA 3PGA1 5L1LA 1NUSA 4ICIA 3ZW8A 3C45A 3QFFA 4FGLA 3DUFA 1JYEA 5BPHA 4N0MA 4EQZA 5HVNA 1LC3A 5J43A 3ONVA 4RAQA 1BS9A 2DY1A 4XXHA 8ICVA 4G4GA 4Y67A 1TM3E 2HGZA 4GI1A 1QIGA 1JQ5A 2Q4BA 3MABA 5JAQA 1USWA 5IN5A 4MQ4A 3UUWA 3VGPA 3LCUA 2B8EA 5KTNA 4HWKA 4BBJA 1M6EX 1NDUA 2Y05A 3UVEA 2EWWA 3R6GA 3LOUA 4FLFA 4HC4A 3FKJA 2IX9A 2YMQA 4A8TA 1IOZA 3BXZA 4PIVA 2Z9CA 4DLKA 4PLHA 3CONA 1J9ZA 4WUTA 3ZDQA 2J07A 2XWQA 6CHYA 4PXYA 1ZQMA 3ZEAA 3HJEA 5B6PA 3MBOA 7MHTA 3R9KA 3RFAA 4EI2A 4N0DA 3PSAA 2IZ0A 2DR3A 2XLCA 4DCSA 4URWR 1L5ZA 3LK9A 3NRZA 2F8TA 2ZLBA 4AMBA 2IHBA 5DK4A 4HGYA 2FZLA 1XYYA 1E5TA 2AYYA 5T3UA 4V39A 4H4DA 2JATA 1KZHA 2XF8A 4FI3F 5AOBA 2P3OA 2V8OA 2ZYUX 3KOMA 1W87A 2PKQP 1UBGA 1NVUQ 3HCPA 3RSLA 5HQJA 4PNEA 4UREA 1PJSA 4BE9A 1ODCA 1KWGA 2AN3A 5TC4A 3DEJA 1QHFA 3DMTA 1H4TA 4QZEA 1ZITA 4C7OB 4YAKA 1F9AA 2OAP1 3ROZA 4PVDA 4H0NA 1IWBB 3GY0A 2I34A 3AVOA 4F8RA 4V24A 4HZIA 1WDTA 3P5SA 3TCKA 5DHRA 1C81A 2X8WA 4HEA6 4RABA 1F4VA 1H69A 1LNZA 3B1VA 4HLCA 2RHOA 4YP3A 4CXMA 3DKKA 1URPA 5KAMA 5BMVB 4Y2QA 1RQ7A 1RC8A 1E7YA 3GBSA 3ZVMA 1CE8B 3SQNA 1LW7A 4K5QA 2OGTA 2VHQA 2I2BA 5J29A 3GEIA 3O47A 5LLTA 4FIDA 2Y1XA 2YVKA 2ZBUA 4MYDA 2W58A 2GNPA 4ER3A 1NRWA 5DGTA 5FLKA 1ORIA 4P22A 3EVDA 1HRKA 4PINA 3T1NA 2ZB3A 4C7ZA 3TRDA 1YAHA 1NNLA 2XCPA 5I3CA 3PLAE 5KT6A 1Z29A 2VJKA 4KREA 1Z19A 3C4JA 5IEJA 1H23A 1WF3A 4ROSA 1JHDA 4KSBA 1GEEA 1R0YA 4KHZA 4FFOA 5FTWA 2YXLA 5IABA 2CLSA 5BW8A 4OJ6A 3KLMX 1XRQA 5SY4A 2WUFA 1HXHA 1ZMRA 5CVDA 2RGRA 1QR6A 1XO1A 2J9ZB 4HPJB 1NYTA 4C3UA 3ZW7A 3DW1X 2RHMA 2PX4A 5AYVA 1Q7TA 4OXNA 3B89A 1XNJA 1XZHA 3MG9A 2KOBA 3IBFA 2D06A 3GV0A 1IQUA 1NJWA 3ELBA 1K6MA 3WL6A 2YX8A 4UTVA 3OU2A 5EKTA 1E4EA 3VSEA 3RU3A 3U49A 3ID6C 4DSTA 2XJ9A 1P0CA 5EJ8A 1BHQ1 3F8TA 1G3UA 2Q6KA 4ZANA 3B3JA 2OGSA 2QN8A 3QJYA 5EEHA 4L74A 3W6NA 4IZHA 2I6XA 3BQ9A 2X42A 1QH8B 1CEXA 1V4VA 2FWNA 5TPWB 1YVDA 2DH6A 5J4YA 1NMXA 1PSWA 3AEQB 1N0WA 2Q4DA 1V8PA 2OV6A 3GJ3A 4YO8A 1GZUA 3E3AA 1TM5E 3Q4GA 4KQXA 2VDQB 5BMVA 5EY5B 3SNKA 4LGMA 1YVPA 2WJHA 4CMCA 1DKUA 1U8EA 1CE8A 1N6OA 3JYPA 4B9AA 1WW2A 3Q7EA 3DOFA 3ROGA 3CEJA 1NXVA 3H5WA 5IZCC 2QTRA 8ICNA 2ZK7A 1YS2X 1YI1A 3UWKA 4M88A 3BHNA 2ZIAA 3PNLA 2EYUA 4MFFA 5ERGB 5F5NA 3DTVD 1ZD2P 4DARA 1M67A 4X20B 5L1KA 3O0FA 1QB7A 3NH9A 1LU9A 5TV2A 4LRUA 1HH4A 3GRZA 2Z95A 4R84A 5IC6A 3WLFA 3THRA 1QG2A 1JX4A 4ENSA 5KFEA 4BV3A 1UC5B 1OX4B 5DIFA 4UHKA 1Z0KA 1G5HA 1UJ5A 2O2ZA 2JV3A 3AVVA 3FVRA 1FTGA 1D8BA 4HGNA 4Y2RA 3CMCO 4BVHA 2R6CA 4YCDA 2Q0ZX 4KN4A 4H0FA 1HL3A 1CY4A 1G4UR