4FE3A

Structure of murine cytosolic 5'-nucleotidase iii complexed with uridinine monophosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Structural Basis of Substrate Specificity and Selectivity of Murine Cytosolic 5'-Nucleotidase III.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fe3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4fe3A01
4BYGA 5AW0A 2HO4A 1QQ6A 1YV9A 2WHEA 4BX0A 3SMVA 5AW8A 4YCLA 3FPSA 3DV9A 3A1CA 2D2VA 5AVZA 1RPZA 3AR5A 5ALRA 1S2OA 5ALSA 3N5KA 5AKLA 2FPWA 2YBDA 3AR8A 5AI0A 1N8NA 4CF3A 2OA0A 3UMCA 2G09A 2NO4A 2W11A 5ALYA 3DAOA 1U2TA 2YFYA 4UAVA 2YJ3A 3HYCA 5AM0A 1RMYA 3L0YA 3QU2A 3ESQA 3OTQA 2W4MA 5AVWA 4UMEA 2ZXEA 4Y3UA 5AVVA 5AW7A 1T5TA 3OCXA 3ET4A 2G0AA 2HX1A 4JDPA 1L6RA 4DW8A 2ZG6A 3QUBA 2HDOA 5ALKA 3MPOA 2WM8A 2ZBDA 3EWIA 3QU9A 3SLRA 5A3QA 3NASA 4UU1A 4UMDA 2HF7A 2YMQA 3EF1A 3MMZA 1Z5UA 3FGOA 1CR6A 1QQ5A 1JUDA 3SHQA 4HGRA 1TJ4A 3UMBA 3I1YA 3ZWKA 3E58A 3OCYA 5ALOA 2Q4TA 3SF0A 3U7HB 2C4NA 4GIBA 3L8GA 4NFLA 3SKXA 1Z4PX 5ALMA 4UM5A 4UM7A 2O9JA 4IG4A 2C9MA 1VFPA 2G06A 2OBBA 1FEZA 3KDPA 4MWOA 5ALTA 2IOFA 1RKVA 5ALGA 5T41A 5AKKA 3L8EA 2PR7A 2OYCA 5JJBA 5ALUA 5AIBA 3AR7A 5AVXA 3NUQA 3KBBA 5ALLA 2WF9A 1YDFA 2GHTA 1QH9A 5E0OA 2GMWA 1PW5A 4FFDA 1RKUA 3RF6A 4YH1A 4B6JA 1XP5A 1ZRNA 5AESA 4DFDA 4KNVA 3WGVA 3E81A 3B9RA 2P27A 1Z4MA 4Y2VA 4FE3A 3TLMA 1ZD4A 2I33A 1J97A 5AM1A 3WKCA 4F71A 5AI9A 4F72A 1ZS9A 2YMPA 2FUEA 5ALQA 2FPUA 3EPRA 2FPXA 4JB3A 3U13A 1SWWA 4Y2JA 4OFZA 5AKXA 1F5SA 5ALDA 3L0BA 3AR4A 3AR2A 4QQFA 4E88A 3B9BA 5ALJA 4BKMA 1Z88A 1J8DA 3CNHA 1RKQA 2G07A 3IB6A 4UW9A 4BX3A 4CNQA 1Y8AA 1SU4A 2I54A 2Q4RA 2ZBEA 3OCZA 1NNLA 4CF4A 3NAMA 1WR8A 2B1QA 1L7PA 2FI1A 2MSNA 2FPSA 1RDFA 1IWOA 3E8MA 3QU5A 4L6AA 3ZX4A 1TA0A 2YY6A 3A1DA 1N9KA 3WK5A 1U02A 3N8GA 5AVYA 4Y2RA 5A3SA 3QU7A 5AM4A 5AKGA 4UARA 1Q92A 2Q5EA 3NIWA 3QNMA 4I9GA 5AK6A 2C8LA 2HOQA 4J2TA 4DCCA 2G08A 1RQLA 3WGUA 2WF5A 3FVVA 3PGLA 3D6JA 1QQ7A 1VJ5A 3W5BA 2OM6A 3ZTWA 1T9ZA 5IT4A 1Z4NA 2CN1A 5AW6A 2FPRA 1RRCA 2FEAA 1L7MA 2AMYA 1TJ5A 5AI6A 4RESA 2MU1A 3PGVA 3VAYA 3WK4A 5IT0A 3MC1A 3S6JA 2I55A 1WVIA 4KYTA 1U7OA 1O03A 4HYTA 4EEKA 5AK5A 2YJ5A 3KZXA 3M1YA 3I28A 3BWVA 3NALA 3IJ5A 5AKJA 2WF7A 3UM9A 3ZUPA 2BDUA 4Y2PA 4CF5A 2PKEA 2B8EA 3B8EA 2B1RA 3FPBA 1Z5GA 5ALPA 3ZVLA 4BBJA 5ALFA 1CQZA 1XPJA 3ED5A 1L7OA 1TE2A 3R09A 4C4TA 1ZD5A 4NABA 2NYVA 4KN8A 2W43A 1YMQA 4HGOA 2GO7A 3ESRA 3K1ZA 5ALVA 2FUCA 2RBKA 5AW3A 1SWVA 5AVSA 5AVUA 3J7TA 1XVIA 2G1AA 4C4SA 4YIHA 3OPXA 1ZD2P 5ALZA 3W5DA 2DQSA 5AI4A 4Y2QA 3W5CA 1S8OA 1L7NA 3ET5A 1ZRMA 1AQ6A 2B0CA 1NRWA 2AGVA 2CFTA 5ALHA 2QYHA 3EF0A 2RARA 2HEGA 3BA6A 2FDRA 4Y2YA 2ODAA 1RLMA 1X42A 4Y2XA 2VKQA 3F9RA 1QYIA 1RLOA 4IFTA 4YCNA 1RMTA 3AR3A 3R4CA 5ALNA 4AS3A 2WF6A 5FP0A 4EX7A 5ALXA 3NRJA 2JGAA 4YGYA 1Q91A 5AKZA 1ZD3A 1Z4JA 1Z4IA 2R8YA 3FZQA 3KD3A 2IA5A 2QLTA 5IS2A 4Y2TA 3L8HA 3ONNA 3U7EB 3OCWA 4DWOA 4OCZA 3I76A 3E84A 3AR9A 4EELA 2C8KA 4AP9A 2EAUA 4BEVA 1YJ5A 2AH5A 3ZX5A 1L8LA 2B30A 5AW5A 2ZBGA 1YS9A 3SKYA 3SD7A 1NF2A 4FYPA 5AK4A 3QUCA 4C4RA 3U7GA 4EX6A 2P11A 1U7PA 3WK8A 3CZ4A 5AHXA 3N1UA 2X4DA 3HLTA 5AM2A 2JAOA 3ZVNA 4PNHA 1RQNA 3WKEA 3M9LA 4OD0A 2I7DA 4HAIA 4Y2SA 2NO5A 3WKBA 3W5AA 3ZWDA 5AKIA 5A3RA 2PQ0A 5AVRA 5AKYA 4XPZA 4XOUA 3R9KA 3OCUA 3U26A 3WK7A 1ZOLA 2I6XA 2AUTA 5ALIA 4UMVA 4I9FA 3WKAA 4EZEA 1L8OA 3DDHA 4L6CA 1Z4OA 1U2SA 3QGMA 4L57A 5AW1A 3L0CA 3QXGA 4RETA 4XQ0A 1LTQA 2IOFK 2JAUA 4G63A 3ZVMA 4KX5A 2HHLA 2GFHA 1WPGA 2YJ4A 1ZJJA 5AM3A 5AIAA 3ZI4A 5AI8A 2YMLA 5AVTA 4BNDB 2IOHA 3WKDA 3OCVA 5ALEA 4BEWA 2I34A 2P69A 5AKHA 3GYGA 3L7YA 2YN4A 3U7FB 2P9JA 3ZU6A 1RLTA 2GHQA 4OHFA 4UASA 3QU4A 1WZCA 3ZW7A 1T5SA 2IYEA 1RC8A 2B8JA 2JARA 3QYPA 1Z4QA 4J03A 2ZOSA 1TJ3A 2HSZA 5AKEA 3U19A 3KC2A 2CFRA 5AI5A 3UMGA 4YIKA 3P96A 4HGPA 3QLEA 2R8ZA 4BX2A 1EK2A 3I6BA 3L8FA 1Z4LA 5AM5A 2RB5A 3A1EA 1K1EA 3KOOA 3MN1A 3QX7A 2O2XA 4UAUA 1YNSA 3RFUA 4UATA 1O08A 4YCMA 3L5KA 3FM9A 2CFSA 2RAVA 5AVQA 2WFAA 5AICA 3PDWA 2JAWA 1RMQA 5ALWA 4NAVA 4GXTA 4NWIA 2EATA 4ZEVA 3ZTYA 1MH9A 1EK1A 3L1VA 2R8XA 4UU0A 2C88A 4Y2UA 4EENA 5AK3A 2YJ6A 4BNDA 2G80A 4CE6A 3QUTA 3L1UA 4XE5A 3NANA 3A3YA 4QJBA 4AS2A 2ZBFA 2BDEA 2YMMA 1KYTA 4ZEWA 4NV0A 4O8CA 3PCTA 2WF8A 3IRUA 2R8EA 5AW2A 3N28A 4HGNA 2HCFA 5AW9A 2B82A 4UMFA 1LVHA 3AR6A 4ZEXA 4H1WA 3QUQA 4G9BA 4KNWA 3N07A 2EARA 4KX3A 2HI0A 1Z4KA 3WK6A 3DNPA 2HF2A 3WK9A 5AW4A 2BY4A 1VJRA 4HGQA 4MUMA
chains in the Genus database with same CATH superfamily
2JB9A 2JH8A 3MSCA 5I9NA 3NGLA 2OYSA 3IMFA 3A28A 721PA 3V4FA 3EFBA 1XFDA 1IEWA 2FZLA 4ZJYA 1PZEA 2PYDA 4YAEA 4O4LB 4ALKA 2ZJYA 4D9GA 3SV4A 1RHRA 1C7IA 4IKEA 4CMIB 2R6ZA 4PE5B 4HDKB 4HR7A 1BGXT 4JYBA 2I65A 4R2MA 2Y9TA 1WWUA 5C3MA 5F1YA 3GX1A 1T8TA 1NF8A 3H2BA 3FGNA 3FB1A 4RTMA 3T3FA 2ZS8A 4NFLA 4KNYA 3HY4A 3ZDFA 1JHMA 3STTA 3PUJA 3AUOA 5B3JA 4B34A 4ZI3A 1GWNA 4OKSA 1CDOA 3CXRA 4M55A 4D41A 4R0NA 1FS5A 2IVZA 5J4KA 1PW5A 5CH5A 4C0AC 1SL0A 1I4LD 3E82A 1M2NA 3AVQA 3DEYX 5EJ8A 1J8MF 4F1JA 4KMRA 2EP7A 4BLPA 3N0XA 1THGA 4GT1A 4D98A 4C0XA 1Z7BA 1Y6ZA 4FNGA 2JAHA 1II8A 1HOXA 2W3RA 2XMRA 3CH7A 1SVNA 2HCBA 3LIPA 1JDTA 4ESOA 2GF2A 4A82A 2W2XA 3HH8A 4V39A 3QWIA 2ZULA 5TQ0B 3D8UA 2QM3A 5LDHA 5CG2A 3V7JA 5H59A 2HIHA 1WKCA 5DSXA 2PK3A 2C58A 2AQ4A 1QQTA 4QTXA 1SQ0A 1PVVA 3IB3A 2QQ0A 4JL5A 4LZWA 1U2PA 2F1KA 2GPAA 1ZY2A 5LKRA 3MTGA 4JI3B 1Q3TA 3VPCA 3QSGA 2HMXA 5E7JA 4N12A 3IOEA 1UM9A 4ZQBA 2FRDC 2WIDA 1J22A 3DVQX 3V3TA 2XE6A 4C0JA 3PK0A 1YDWA 2R62A 2LR0A 3MD0A 2AX4A 1PKXA 2ZTDA 4X3OA 2GCOA 2C7PA 2N3ZA 3RSLA 3AUUA 4G97A 4FDVA 4NIMA 5A4DA 9ICOA 4MW1A 4YMIA 1EE9A 3BD7A 3U3KA 3ERCA 1Q22A 4F4UA 1ULHA 2WD7A 2Q4DA 3DBLA 4EYHB 3OHPA 3IKVA 4ARCA 2HZ7A 1FX0B 5J0TA 2ODAA 1U2QA 2OBXA 1BHJA 2WF6A 1P4AA 1SBQA 4D92A 3JYQA 5CA0B 3NP7A 4TV9F 1NJ8A 1Y3FE 5ISMA 2B6HA 3F74A 5FX2A 8MHTA 3L8HA 1Q3HA 1FJGB 3KHUA 5J2CA 3PZPA 2XF8A 3PV0A 2HHWA 2WRZA 4EHNA 3DJYA 5LVAA 1UT8A 2QAJA 5J2GA 1YS7A 4KAXA 5BNWA 3ZVNA 4ZOHC 2XMZA 3VRHA 1D9ZA 4H0NA 7ADHA 5BOSA 4DVGA 1P74A 2XCAA 3KIPA 3OA0A 4KRGA 3MUOA 3E3NA 2P0AA 1BXGA 4RD4A 5HCUA 9ICFA 3UT0A 1RHMA 3OOSA 3EGXB 2YVKA 3T99A 1C41A 2GQ0A 2M9MA 5CB1A 2P40A 2P4HX 3AU2A 3FCOA 1LRJA 2W6ZA 3WTBA 5JLJA 1TEHA 1Q0HA 3OHBA 3KYCB 3EDQA 2PRYA 1TK5A 2WUEA 4Y6SA 4UBOA 4PCLA 4RQUA 5TMPA 5BR8B 2XGOA 3RU9A 1N5WA 2WAAA 4F92B 2BWJA 5K4LA 3H6KA 3UH0A 3BK1A 2JCSA 4G5RA 2YIJA 4AUEA 1JXOA 3PGMA 1N7JA 1YGPA 1KQNA 1OREA 4NBSA 4G41A 3PV8A 1JFTA 1X15A 1FNNA 2JIZD 4OX9B 5D6NA 4PX9A 1UMDA 4P53A 4FFBA 1JPJA 1HFEL 2RGNA 4DUGD 4IXNA 3GDHA 5I8WA 4HNQA 2XSZA 1R10A 3OEHD 4BNFA 2QORA 4IWXA 5HPYB 1L3VA 1QB7A 4HGNA 5TF0A 1WULS 3YASA 4OJQA 1A8UA 3K8OE 2HI0A 3RRJA 1N0WA 4FB5A 4HK4A 4PG6A 3H1PA 1T6NA 4HAXA 4X63A 2WLSA 4C8KA 1W48A 3WHPA 4Z4CA 1MIHA 1NW8A 4RW0A 2F8KA 5F1PA 1E9AA 2JJ1A 4O2AB 4GLOA 1CEZA 5U4XA 1WSWA 3LQQA 1TAGA 2RC5A 3EWIA 2APJA 3U2QA 3RRFA 4IV0A 3FGOA 4PONA 2ZE5A 2PX5A 1MABA 2RGAA 4AQ7A 2W00A 4IMRA 2IYUA 1G18A 3INRA 5I7SA 4IG4A 2I6GA 3I4CA 5KOIA 3PQ5A 4RWZA 3RKUA 1ZQZA 2PS1A 1JHXA 3SNKA 3D3WA 1QVVA 1NFFA 4B82A 2W37A 1RRMA 4US2R 1W75A 4Z4EA 3MW8A 1PJ3A 8ICJA 4JA2A 1MPXA 2QV0A 4MJ7A 2ZWAA 1HL3A 4XEHA 2G1PA 2L42A 3RS2A 5DB9A 4L0DA 4OFZA 1E7WA 2PWYA 3C39A 5ALJA 1WMBA 1XE3A 4J0CA 2VT3A 3I9V6 2BMDA 1RKQA 1TGVA 4CNQA 1ODKA 3DHVA 1H2RS 2NAFA 5KC9A 2WQZA 4ZO4A 4Z0NA 4CKYA 2O7RA 4FOOA 2A9OA 4HDNB 1YU9A 3TKAA 4DNOA 4ZAXA 2XBUA 4Q4JB 1M1NB 2BEUB 3SJBA 1C20A 4L51A 4AJJA 3LL7A 4E2WA 5K0EA 4K40A 3FVVA 4JDUA 1Y89A 1K6XA 2FEAA 1G9XA 4CT5A 2HDWA 4D3FA 1R9NA 1EJ6A 2XR1A 3TKLA 3FDXA 4BGEA 3ZZNA 7REQB 4B9TA 4PZUA 5I4BA 3HXLA 5TQ2A 2ATEA 2Y99A 4A92A 4YCAA 1DKUA 1PS8A 2X2EA 2H2IA 1FTQA 3MAJA 4G56A 3KPWA 4YV2A 1YKFA 1DAEA 4I08A 4TTSA 3WA7A 4KLCA 5CDTA 2FP3A 4V2UA 4ESHA 4ED6A 3O0FA 4MI9A 2OCKA 4KVFA 7ICLA 3FAHA 5HHHA 1BXZA 4ROSA 3LCJA 4YBZA 2EU8A 5CDFE 2Q7XA 9ICTA 2W70A 2C78A 1E69A 1ST3A 1BDHA 1J00A 3E48A 4IXWA 1IDOA 2AFVA 4KMUA 1NUSA 3EIHA 2QUBA 3SKYA 4ND4A 2OQVA 2PNFA 1NLMA 4GI3A 1A3CA 5IDWA 4OQEA 3UJ3X 5IZ4A 3GR6A 3NHLA 3SHWA 3OFNA 5KFTA 4DLTA 3P0FA 4PZYA 4ERNA 1ZOLA 1Q7EA 3L8ZA 2GB4A 3C6MA 4MKXA 3E9MA 2LBOA 4O4LF 2QROA 2G5CA 3OCJA 4KBGA 1F14A 4FCTA 2AR9A 2K4MA 4LDPA 4F4JA 3B48A 3HB7A 5DYYA 4FZ5A 1KI1A 4TWBA 4XJTA 2JLZA 2G76A 1KFTA 3BT7A 4MWDA 3U1VA 2H3ZA 3T7TA 5FORA 3FYUC 3JTMA 5K8JB 1MLDA 4H1UA 3I6BA 1P2FA 1PZHA 3O4HA 1RRKA 5KQMA 2VDKB 3EPHA 1QHEA 5KBYA 3FG9A 1NLZA 4JOSA 4NU6A 2W2LA 1PEDA 3N0TA 3QVOA 4ZKEA 4P0PA 1YMVA 2LYBA 2MSEB 2CXSA 2QP9X 1LZKA 5U9CA 2JCVA 2R8EA 1N75A 3HX0A 1UPFA 1A2OA 4EF6A 2R8RA 1X2EA 5T3YA 1NGSA 4FYIA 1P61B 1THTA 4Z3KA 3BB3A 3H9CA 2AG0A 3BTUA 2Q1UA 5BUQA 3GRKA 1X2BA 1B2RA 1DBWA 3QHPA 4JJEA 3W9UA 5KHOC 3DGFC 8ICRA 4ZT4A 1X8KA 1M6EX 5B7QA 5C0YA 2AEEA 1K0UA 2H1WA 4Y0NA 2QD1A 3NYQA 3WYNA 1D8YA 3HHPA 3TMKA 4O4JA 1QGUA 2IPOA 5C4IA 1UPCA 4KCGA 1UPUA 3NTVA 1P77A 1ISGA 3GLGB 4EPTA 2BBWA 4JP5A 2H2FA 4BWYA 5JQWA 4QPPA 4J0QA 3BSSA 1WUDA 1A77A 4BUGA 3AR7A 4L9WA 1HV8A 2PQ2A 1X6VA 3H19A 3K9BA 4BNKA 3AFHA 4UCXA 3T8YA 4LHSA 3RSOA 4CEHA 1ZM2A 5LUAA 1OX5A 1BYUA 4R5HA 4UU7A 1T0HB 2FMHA 4Z0TA 4DSOA 5EHGA 5CA0F 1Z7YA 4XDZA 3ZD7A 3OEEA 3PXUA 3VI3B 4KLMA 3ANMA 4U2DA 1FYVA 1NOJA 1J09A 2PFQA 2ZUSA 8AT1A 3V8NA 1OWLA 3UAOA 1U98A 3NHSA 4FJ2A 2PV7A 1HLPA 3D7KA 4FZNA 2RKBA 1S01A 1E66A 4LEIA 2FW7A 5DJ5A 4F2WA 4MS4B 3JPWA 3MWYW 1H8HD 4O3QA 1KK0A 2XZDA 1KY3A 5TPZD 3LKBA 2IUSA 1NM5C 4PYJA 2N9UA 2QUKA 1TTQB 1KXZA 4GE0A 1FFYA 3H1BA 4GSKA 1XBTA 3QFHA 2BH9A 3UWOA 5C0OE 2VK2A 4EFNA 1UZMA 3DTVB 3Q1KA 3OTOB 1U1CA 3MBKA 4PLPA 4CMCA 2DH6A 2CNOA 1WPQA 5ECGC 2A8YA 3SS9X 4QPNA 3EIFA 5DYGA 3GGGA 2AXTU 1E2FA 4QWEA 3WNVA 4BP8A 2PX0A 2WPNA 4Q4CA 2WIJA 1J8VA 1NTRA 4JK1A 4AB1A 1PGNA 3AQEA 4O59O 4MZDA 1ADCA 5BRJA 1GZ6A 3PJDA 3GJ4A 4JKOA 2XVMA 4PHHA 3EOBI 1I3MA 2IE8A 4FJ0A 2WTMA 2XJ9A 5H7XA 4J9OA 1BC5A 1FVHA 2QLLA 1L5GB 4RY0A 2VSXA 4L8LA 3C5GA 4R81A 4E2ZA 2QENA 5IJ0A 2P2ZA 4RV9A 4BQFA 4I5FA 3RK0A 4OI0A 1RFLA 1QZZA 3IYLW 4J1TA 2RGRA 3E7DA 3MTAA 4DDWA 1AK1A 9ICNA 3HCDA 3QXXA 4JLVA 3MG9A 1ZQHA 4F1KA 4CG0A 3RSGA 5LBUA 3HVUA 3OKFA 5LLTA 3N2IA 4LQ4A 3IR5A 1X9WA 4RSMA 5H3HA 3UYKA 5KFKA 2GEKA 2GZHA 4KQXA 6REQA 1XQ6A 2B4AA 4XUGB 2PT9A 1B3BA 4UC0A 1KO1A 5K6AC 4I2JA 1ZUIA 1VM6A 2HWKA 1XKTA 5KFHA 2L5YA 4NAVA 3I9KA 3B9QA 3FF1A 4U4AA 4HY3A 4MQUA 1WXDA 4L3OA 3LQ1A 1EEHA 4PC3A 1G20E 1RPLA 3E27A 5EJFA 4QRHA 4Z49A 1N0UA 1XJ5A 2R1TB 1VKZA 3L79A 4Q82A 4RCZA 3MJ4A 3BJYA 2KX7A 1TMYA 4YT2A 2OBMA 2VF4X 2IX9A 2O0KA 4QXQA 3N9IA 3AV0B 1CUBA 4QQ8A 4A0GA 4EAQA 3QMPA 1Y3IA 2WP0A 4XDHA 5FWAA 3BTVA 4ZDIA 3EJ6A 1SOAA 4ZVVA 4O3RA 1FIQA 1PCXA 1QMPA 1FS6A 2YFYA 1GT6A 5CR0A 1JLMA 3G8AA 4RVNA 1NC1A 2VT2A 1MPTA 2A5DA 5BW6B 4TVSA 4F5ZA 5DTRA 3NASA 4I28A 1D6SA 2B61A 3K8QA 4Y0AA 4K1LA 4OJYA 2OUIA 3NWOA 3B7WA 1WETA 5KFDA 3ICVA 2Y1FA 4U63A 2BSQA 2WK1A 1JPVA 5SZKB 5ALTA 3T1TA 3G89A 2YIVX 2Z0MA 2NO6A 3SZRA 2FN7A 2JI4A 2CXNA 2EGUA 4OGFA 4X54A 2YINC 4YGXB 1FMTA 2XCSB 4I1RA 2BZ1A 3MGCA 3KXPA 4DCUA 4PZPA 1ZIPA 4MVWA 1PBNA 3M34A 2WWGA 2CXHA 3JD2A 1SKWA 1ECCA 1USUA 5G40A 5A0FA 1JFLA 4EYQA 4E22A 2HVHA 1XL1A 3ZYCA 4JC5A 2BCSA 2Z2ZA 2LKCA 3UGTA 4OJLA 5D46A 4W1SA 2ZI4A 1L7PA 1EWQA 3WA6A 4P4LA 1YQXA 4HX2A 1P60A 3ZHYA 1U0HC 2ZXUA 3F4LA 3R7DA 3L7OA 1ZH0A 3BS5A 4Z1MA 4Q0MA 2UU9B 4NYIQ 4DDKA 2Q1TA 4C4PA 1AQIA 2B8NA 1UK9A 4MW0A 3W8FA 3CO5A 3M49A 2I78A 4GMFA 3VH2A 3CKYA 3GIWA 3HGMA 1Z83A 4BS9A 1U48A 2VUTA 3RBZA 4QOIA 3LBNA 1U4NA 2UZIR 5ABPA 3KU1A 1SCIA 2ZTLA 5BT9A 2PKWA 1C4KA 1U28A 4Q9DA 3OPXA 4AJ2A 3B6EA 1KFJB 4L95C 4BWJA 3CTPA 4BJ5A 1F1BA 2FYTA 1IDN1 4KACA 4G25A 2BFAA 1JNXX 3QWHA 1ONBA 1LPMA 1IY8A 1R4NB 4OFWA 1FJ2A 2AHOA 3W7AA 2QBYA 1E4OA 3GLKA 3A6ZA 1E2DA 5FAXA 3BXHA 2GLXA 2NZYA 4N6OA 3VHQA 1W2GA 1S97A 2PMBA 3IBTA 5IBRA 5AJXA 4RQ4A 3GXBA 2I1LA 1U0GA 5H68A 1GPMA 1LLFA 1GEEA 4ID9A 3ZWPA 1CFJA 3IUJA 3CH6A 3AEZA 2XOKD 4KAFA 3U6BA 5EUMA 1V6CA 4EB6B 3OKPA 1BH2A 5CA1B 2J3EA 3IQIX 1EFRA 2QMYA 3MELA 4XWYA 3PPVA 4Q18A 2ZAMA 2FMUA 1HFKA 2YJ4A 4HNVA 1Y1PA 3QX9A 1OAOA 1ENPA 2Y1EA 3STUA 4M22A 2B2XA 4AJ1A 3AIOA 3BA1A 2JA2A 5TQVA 1UA0A 1N5JA 2ZU6A 4BMDA 4WW0A 5IYZB 4L02A 3OU7A 2A4MA 4Q9AA 2HYIC 4ZTUB 1R12A 1AOXA 2IV7A 5CDUA 1DO2A 3JPSA 1OBFO 3T34A 4TV8A 4N82A 5G4LA 5J0RA 2GKSA 2HK7A 3BMQA 1AT1A 5ENDA 4LYFA 4PTLA 1GFWA 4ZD6A 1KMQA 3RRZA 1KOFA 1ND5A 2ODWA 4PSVA 3WJ2A 2NZ2A 3RJ5A 5DGXA 2OR3A 1U3FA 3GGPA 3ZTTA 4HWKA 1UZAA 1GGKA 3UXMA 4X5VA 3ILHA 2BGKA 3BJIC 4EUHA 1GTRA 2Q9AA 5JRZA 2OCEA 4UE6A 2C4TA 4UBKA 2DTXA 4LJ8A 3JASB 2CXUA 3NC1C 5CFOA 9ABPA 1Y1KE 3DXZA 4QIHA 1T5DX 1H9AA 2V7VA 3KQYA 5E95A 2LCIA 1P33A 1VLMA 3EH2A 3HKCA 4C7YA 2H5XA 5B1IA 3OWOA 4I3HA 2H3IA 4YRCA 1RBYA 2GXUA 3ANYB 4EUSA 4NVRA 3GARA 1KYQA 3G1WA 4ZQCB 1BNPA 2GHRA 2NUBA 1U2GC 5C34B 3W8RA 1LFDB 3G0DA 3K09A 4WFIA 3PX6A 3ONEA 1PL0A 3SK0A 5THXA 3QPUA 2KLHA 3IP9A 2WZDA 2NU7A 3ZK8A 2RGDA 3ORFA 1YASA 1C9DB 4WESA 1JFSA 1BU8A 4JIMA 3C3XA 1JG3A 1E1RD 5CPFA 3AV3A 3D8TA 2PXAA 4KLLA 5EIOA 5DX8A 4NFHA 3A6EA 5HKAA 1CY7A 4R2KA 3FVWA 3AR2A 2P79A 4MB0A 1IHYA 3OQIA 3NCHA 3OHMA 1EVJA 1M2JA 3L7MA 4OHPA 3E5HA 1FUEA 2QJOA 4B4KA 1ZCJA 2CW5A 5JFTA 1A0OA 1DL5A 4L6AA 3UJ8A 3KVVA 3OSZA 4OHRA 1Z0AA 3RCBA 1I10A 4IIYA 5MDHA 1CB7A 4ZCTA 5AK6A 1EKXA 5CYFA 2KTQA 2VPPA 2PH7A 1IM8A 4AJIA 3H9EO 2C77A 1P1BA 2V6GA 1QAMA 1R6VA 2OT3B 3A14A 3FUCA 3B1YA 1G3MA 1U2RA 3BXEA 4JWNA 3WHLA 2P8SA 2CLIB 3LM8A 1N9GB 4B3SB 4CQNA 4WPGA 1YL5A 2NUPA 2ZRIA 4UHCA 3V2IA 3OETA 3ZGZA 5I45A 4XSHA 3ZCQA 4RHXA 1G5IA 5J2EA 1Z5GA 3FPBA 2ZJ1A 1I24A 2WTBA 4Y9UA 1SZJG 6NULA 5CLQA 3KLMX 4P7KA 2JAPA 2ZRQA 2YS7A 1QF7A 2PT7A 2QR5A 3THYA 1WUHS 4DIEA 3WS7A 4C4SA 4A9AA 5JS7A 4YACA 2XY7A 4Y7CA 4TUYB 1QVRA 4KSCA 2NSLA 4WD3A 4CW7A 2FW6A 4S04A 4YRPA 2Y0EA 1NI4B 1Z06A 3ORRA 3VNAA 3DONA 4EPVA 3KT3A 1DEAA 1LSOA 2P9BA 3HCBA 7ICKA 1OYOA 3L7IA 4JD5A 2FR8A 4AG6A 5JH7F 2C4VA 1IPFA 4JLUA 3GO4A 2G7MC 4A8TA 3DAGA 4D8XA 4QX6A 2KI5A 1XMOB 5F2KA 4RHFA 1PD1A 3DKIA 4RWEA 2RAPA 1RJWA 2CV1A 2BHNA 3WRXA 5LJLA 1U4OA 3T7SA 3HJUA 4DMHA 3SMQA 4NXMB 3TI0A 2C4MA 1UXOA 1Y8RB 4KR7A 3BFKA 5HUJA 5LU8A 5JANA 3K0EA 4JN6B 2P3SA 3HCPA 4BO3A 3T5BA 3IELA 1SOMA 3ZGVA 1X9SA 1WXIA 5T3UA 1WQ4A 3ETHA 1RM5A 1YS4A 4D0RA 4CV0A 4KP7A 2WU8A 3BMXA 3H40A 3LPLA 1FC0A 2DR3A 2ZROA 1LK7A 3KC2A 1B43A 1L3BA 4UOEA 1G98A 3DPUA 4BX2A 1MB4A 4UE2A 1HC7A 1JDPA 3IEPA 3QPAA 4KFTA 1C8BA 3O8OB 2VO1A 3A7EA 3D43A 1HYQA 3NEJA 4QPJC 3WMEA 1W8DA 2QDXA 4DKJA 2WM3A 2RJ3A 3CFYA 1SULA 2XO7A 4HDRA 5DNYB 4CEIA 1GFSA 5L1KA 3GNLA 2OZLB 4WINA 1ZQIA 1W0KD 3FX2A 4JK3A 4F4WA 4DS3A 1DS6A 1VPEA 3GFKB 4QKQA 1S9DA 3GLHE 2E3TA 8ICWA 3QIVA 5KFQA 2OPBA 3Q3CA 1IQRA 1J90A 4W5JA 2NVBA 1R3DA 1WXXA 1ORWA 2GLEA 4Z9YA 1FP1D 3TQOA 4C4YA 2D8AA 4CNBA 3UJDA 2HBMA 1HE1C 3G8DA 4JMPA 5B3AA 3T94A 2NU6B 3SQNA 2K8CB 3JQ9C 3JSXA 5FI3A 3P71T 1PWEA 1DX4A 4XTRA 3V2GA 1N0VC 1JG7A 3IODA 2JI8A 1T36A 2WTFA 2FWRA 1O9BA 3C5CA 2I7CA 1JTEA 2R84A 4DLZA 5LN1A 4I4TF 4I6GA 4UM7A 3MGVA 4TTTS 5IIJA 3JYPA 2C3YA 4AFNA 3VJKA 1V9LA 1W9MA 2YZMA 4ZEOA 3S70A 3Q8WA 1LC3A 5HIAA 3FFBA 1B00A 2Y0SC 3WFIA 3LXXA 4CR8A 4EQ6A 2G9UA 3MBOA 1RS0A 5SYAA 5AI9A 5GADl 1IV8A 2VHQA 5KFPA 3LVVA 1ORDA 1JDUA 5AXAA 3L7CA 2PNJA 3AVPA 1QZUA 5I5GA 3MJVA 2QNRA 2ZWOA 4YR7A 5AVOA 4BEJA 1IK6A 3LPMA 3PIDA 3L8YA 2XT9A 2AYYA 4TXJA 2OO5A 2I1QA 2HLDA 2ZCUA 3QBJA 3JYHA 2XQVA 5CVVA 2ODQA 4RDHA 2IL1A 3TTWA 1VQ1A 1ZQ9A 4OGGA 5J63A 1P0CA 3KUKA 2JZBB 1O89A 2DUNA 4LJ4A 3REQA 1RPJA 1V7QA 4EBCA 4LVSA 2GK6A 3R40A 4E30A 1CVRA 4H0CA 4UBLA 1WZ2A 5CFMA 1TYBE 1IE3A 1Y5RA 3GFTA 4N7BA 4CM4A 5HCNA 4WFQA 1J7JA 5CDFA 4DKXA 2D62A 2W9CA 1KVSA 3PD0A 4YEDA 1VRCA 4ZVTA 4KI7A 3SE0A 4WHMA 5IYZF 1L7NA 1ISSA 2ZRMA 3RM3A 1PI3A 4Q1AA 3PHGA 2ZE8A 1H2ZA 5J2DA 3L7NA 3H4MA 2ZJ0A 1X1QA 1VCMA 2GZAA 1KJNA 3PDIA 3ZHRA 4RD2A 1Z73A 3TB4A 3HR7A 2GTHA 1PK7A 1HORA 1TMOA 3L0PA 3HACA 3OJFA 4M0KA 4N4AA 2QY9A 5LFAA 3K9NA 1P91A 2O5VA 3ENNA 1JB9A 1L9KA 3GNTA 3O8CA 4GOXA 3SP1A 4R9NA 1CUAA 3IXLA 3I6IA 4KQIA 4IIBA 3Q7SA 3PPIA 4MEXA 4D74A 3IVAA 1PTJC 3BXPA 3N2ZB 2WFZA 4RLQA 2XUFA 4A1FA 3FPCA 4F84A 1UJ2A 2DJ5A 3SVZA 3LY5A 3PI7A 4NECA 1KGSA 1UXGA 2AFHE 5E1DA 2ZP1A 1YIAA 2V55B 4MLZA 4EJSB 1NN0A 2ES6A 4GKKB 1BN6A 1F0KA 1F60A 3LDAA 2AQHA 1L5LA 4B7UA 4KVZA 3GRZA 4D4HA 2HCTA 2COEA 4PZ0A 4CCYB 1KI7A 5FBVB 4M8KA 4BKUA 3TADC 4ISCA 3H9UA 1P2VA 4TQUS 1SA0B 3CB4A 5TMDA 3PDWA 1I3LA 3NHJA 1NJZA 4P54A 1EK1A 3F2BA 1SC4A 1V3VA 1SD1A 2K60A 1TMKA 3LDGA 1FDTA 1GZ3A 2BUAA 3PC3A 3PSFA 2TMDA 1L5WA 4WKBA 5CJPA 2C82A 3T1VA 4QJ3A 2OESA 1ZWKA 2VBGA 3D9QX 2FFBA 1ZC3A 2R6GA 4RDIA 4B8YA 2HOFA 4NENB 1XTKA 2BBSA 3GFGA 4J49A 3WK9A 1C1HA 1L7XA 4CTJA 3ZOZA 1OPXA 2HGSA 4JJ4A 3OHSX 5DHFA 1A5BB 1Y6FA 3STVA 4KQKA 1E3WB 2HA6A 2FUNB 4ZI7F 6CHYA 4ZP1A 1HT3A 2A30A 4M8LA 4N03A 1E98A 4XGKA 4LYGA 1B15A 4II7A 4ECXA 4E31A 3D6MA 4FQ8A 5JIBA 1GVHA 3P2EA 1IN5A 4YJ2A 4GICA 4E13A 4AJ4A 4RQBA 2W5UA 3K1RB 4BCDA 5J0UA 1VLHA 1TUBA 4BZXA 2UUCB 3I0NA 4D44A 3ZWAA 3ICQB 2YWFA 2PEZA 2OBBA 3PC2A 4BQEA 4ZVUA 3KOMA 1DKPA 1XZQA 1OHHA 2H63A 3M4ZA 1JALA 2JFVA 4KQ2A 3F5MA 4JOQA 1GG8A 1E89A 1PR5A 3N7AA 3H4VA 3WWOA 2CVQA 5EXSA 4AC9A 9ICQA 4DILA 1R0RE 4KYVA 4UAWA 3RFVA 2ZYWX 2XECA 3S2GA 4EPWA 2JDID 4MOWA 3C1AA 2JZCA 1GJRA 3F47A 1MMFB 4K6CA 4WEOA 5H4HA 3R9XA 2I4OA 4LX0A 2VQ6A 3PDCA 2ZIXA 2ZYHA 4BP1A 4WKPA 5I47A 3ZJ4A 1X8JA 1X7WB 1SC3A 2D5AA 2ZJ4A 5JO0A 5AVYA 1R0SA 1CUFA 2LPMA 2PZJA 3AEKB 4HAZA 1L7DA 2CNWD 3UJ9A 4L78A 1ZGBA 5TLSA 4ZYLA 1T9ZA 5FNZA 5KYWB 2A57A 1I3CA 2Q4EA 4LHVA 4F85A 3ZVRA 2PA0A 2JIDA 2IY7A 5KTQA 7MHTA 4KWTA 3WK4A 1H5NA 3WWZA 4TYPA 5AOCA 2DT8A 4RUAA 2F43A 4U7GA 3A6JA 5MF6A 4RM2A 4EJ6A 3AVTA 2IXFA 4D25A 4GD3Q 1PS0A 1UBMS 4JODA 3JPRA 5BQOA 3NV9A 1YHNA 1SXEA 3U0VA 5HDQA 4LBYA 2WKSA 4WCVA 2FE1A 3UMRA 3A2MA 2XY4A 4QUJA 3AUYA 2PZBA 4MEBA 4IMPA 3AWDA 4UJ5A 4QECA 3I45A 3FHJA 5DHRA 3W2EA 5TB5A 4US1R 4EY6A 1A7UA 1U2DC 1VLLA 4LPSA 5H2FU 2GWRA 5IAAA 1N62A 1SB3C 1XLTC 1OIWA 4HN9A 3D8RA 3LCUA 1T9GS 1S4QA 2QX4A 4IHKA 2C42A 1H8EA 2XW6A 4CM8B 1WY5A 1DIGA 3O0TA 3GL9A 2ATLA 3N8NA 2CNLA 3IHTA 2I7XA 3OWXA 4XPZA 3U7QA 2R6HA 1IXRA 4YB8A 1M8JA 3NNDA 3PQ2A 4RFSA 3LTNC 1L7BA 3BMOA 3G5AA 1K6MA 5DB7A 4TYMA 1EFTA 3DE0X 2QD5A 3MOIA 1RI4A 4H7KA 5LLDA 3BK7A 1BMTA 1TCVA 3NTLA 2K6GA 1G20A 2Y1IA 3KJXA 1YIOA 3A9WA 1JDBB 3RC8A 3NXSA 4KXQA 1ZR4A 3NETA 1OI3A 2E5WA 1QF6A 1E1QA 2WAQF 3GN2A 3U19A 2WNSA 4B7AA 4F2HA 4PIVA 2RB5A 4YRSA 4FKZA 1UBHS 2YDXA 3PHBE 4EP1A 1TW2A 1J5EB 5LOVF 5BWLA 1Y1SA 1AUPA 4R3WA 3DB2A 2X77A 5G2OA 1QH1B 2BPFA 1HSOA 4K6OA 3VO9A 1J99A 2VDQB 5FBQB 4NHEA 1R8YA 4ILKA 1FRNA 2CE2X 2V7XA 2FN4A 2H31A 2O20A 5IAJA 3LUFA 3SMVA 4MROA 3ZYZA 7ABPA 3FWZA 1WKVA 4AI6A 3N5KA 3A0UA 4HDQB 3QBEA 2DHCA 3GUVA 2VSFA 1KK3A 3CLTC 4RKFA 3NVWA 4L07A 2CUNA 3CNLA 3RAPR 2W2KB 4DW8A 3VO1A 2WM8A 3SM9A 4JQCA 4A73A 2BZ0A 4B3FX 1Y4DE 3R0VA 1PJBA 4MGZR 4YCSA 4HADA 4IUCS 3RTAA 3JRNA 4WECA 1M1XB 4K9LA 2QZZA 2G04A 1L3CA 2FPGA 5JAPA 1K1QA 2WB1F 3E0QA 2W9AA 5ALLA 3E3MA 3F6YA 3VOAA 3ZI7A 2GM3A 4DLRA 2Q2OA 5DLGA 2QV7A 5G0UA 5CMLA 2CWDA 3ZHOA 2XGGA 1H3EA 5IARA 5HR5A 1TECE 3AL0B 2FUEA 3QP9A 1EFVB 1CZLA 3LPNA 4CLRB 4E2YA 2FW8A 3H8SA 1CEXA 3FDJA 5FOTA 2CZQA 2IHVA 5F5XA 5DGHA 4CI0B 4H7DA 4QZVA 2GJ8A 1D5WA 1DCFA 1N9KA 4BRUA 1KRHA 4TKVB 1CQIB 5GTDA 2JEOA 2P67A 2BGRA 1FYWA 5L45A 4RH0A 4N0EA 2OB2A 3SHTA 3OZRA 4MB6A 3DT6A 3VR5D 3LPCA 3CF6R 2PA3A 3PSAA 4R5MA 4J0KA 1P5ZB 2FSPA 2I6TA 4CF5A 4IC9A 3VR1A 5ALFA 5K3FA 3C3YA 4YMVA 2IYTA 4A6DA 4LF9B 1B76A 1QK4A 3VR3D 3R7BA 2PXXA 5CXQA 5ESXA 5AVUA 3MA0A 5J5CA 3A1NA 2BMAA 2B98A 4LWZA 1FP4A 1RJEA 4MAFA 2E8NA 1JL3A 4J0EA 3P4XA 3VHRA 2X8JA 2WM9B 4H3VA 4L5CA 3AVXA 1VG0B 4ZZ2A 1NN3A 2ACKA 7ICTA 2OXFA 1P5FA 1Q1NA 1LBTA 4BN0A 3QEJA 1ES9A 1QCKA 4OYYA 4OQYA 3FI0A 3WZLA 1Y6QA 2EAUA 4UOQA 2AF4C 1O3YA 3QIAA 4TMTA 3AF5A 5DBOA 2G5GX 4Q12A 4IYJA 5JNSA 1Q50A 4R84A 4FX5A 2OENG 5GWXA 2FEPA 3AESB 3TMYA 1X7XA 5CGZA 4EECA 5K0TA 3S1SA 3T3GA 4LQDA 3PGXA 1Z22A 2QQGA 1H2XA 3DZGA 4DIOA 3R9KA 2ZYTX 2J9RA 1G9SA 3K4HA 2VDMB 1WSDA 5DHTA 5EL0A 3KYIB 2FR1A 1Z1VA 3BAZA 3F5FA 4QBKA 4HLQB 3DCYA 1XWIA 1EAMA 1N2IA 3X1MA 4M2LA 2CKMA 3LJKA 2EZ8A 2V7QD 2WAYA 4A0QA 1MJ5A 1X9GA 3GMTA 1WHTA 2GEUA 4C3OB 3PICA 3WLAA 2PMKA 4E6PA 5B3KA 2RHHA 2LP4Y 5G1OA 5CWRA 2ZQZA 4O0MA 3VPDA 3THVA 5C4MA 3AZOA 3LW8A 1XDGA 1MH1A 3VJLA 2JK0A 4M8NE 2VJQA 1G7SA 4LOJA 1M10A 1M76A 2ORIA 1CHNA 4TS1A 2C2OA 4ZGBA 3MTIA 1P2GA 3VKGA 4KLZA 1NJ1A 2HMYB 2J6SA 3LX5A 2BDEA 3TX6A 2DKZA 1JVNA 2Y3IA 1JJ7A 3JD0A 2HB6A 2DQ4A 2QN7A 5DM2A 4AY2A 1X7YB 4IYRA 2P1DA 3FTNA 3ZJ5A 2FF7A 2ZSUA 1Q1AA 2V7UA 2VAMA 3KKOA 2Y6UA 2ZTCA 1AS3A 2A5LA 1N8NA 1ZHOA 3NDJA 2IY8A 3WLEA 4EY5A 4B6RA 4K2AA 5FO0A 2PSJA 4MA5A 1FS4A 4XD2A 1X9HA 3DNMA 3BCRA 2GN1A 2OBYA 2CVFA 4FO6A 3HA3A 5K7SA 3B82A 2C9OA 2A3NA 2D2XA 2FLVA 3G9QA 4GIBA 3GDGA 4G1EB 4M9JA 3CA8A 4DYHA 2C7RA 3MGKA 3HSSA 2I2CA 3SOPA 3MDCA 4QQNA 3ZD9A 1U81A 2MT9A 3FZNA 4KLDA 1SVSA 3LC2O 2B94A 3H2KA 1JLLB 1O94C 4RPXA 5KT3A 4ZODA 5C46F 2LV8A 2JIMA 3NYRA 2VQFB 1COOA 3QOFA 2HHVA 1VKJA 2VZ8A 4ZVOA 3ZEIA 2GVNA 1FDRA 5E6SB 3B5IA 5BV2P 1N1DA 2O2ZA 2J59A 2XT0A 4C7ZA 4UJ3A 4AN4A 2UYHA 4AECA 5HBGA 3G6KA 2XWJI 4QUIA 5BWMA 5IT9A 4JI8B 3JQ7A 4U3JA 2FXIA 3OLCX 4KZPA 1ZQAA 1THMA 2FHSA 1XD2A 5KVCA 3COPA 2QAGA 1CQJA 4FWIB 3MBIA 1EGAA 1A5TA 1AKTA 2GZ3A 1UIRA 2IWHA 1S7GA 1FYDA 4O2BA 1EINA 3WGMA 4Q21A 2X0NA 3NIGB 1B6RA 2D3TA 4EGAA 4EUKA 5DT9A 3G7SA 1XR3A 4YXWD 5T67A 4WZAB 2G4VA 4QRIA 4KO4S 5C4GB 4Y6RA 3GD5A 1Z19A 3F98A 2NU9B 4WMLA 3NAGA 4QYIB 4O2RA 4KDCA 3HU1A 2IVFA 2ZBVA 1V38A 4F4DA 4KPUB 3ZGLA 1JHDA 4G5OA 3EVBA 4YD1A 2Z3ZA 1W30A 1K66A 4RA6B 1C50A 3HCOA 3AUTA 3BS7A 1SUEA 2KYRA 4Z53A 4RJJA 1SCUB 5KWVA 5KVQA 2E8PA 2PQMA 2EEPA 2PSEA 4NJ8A 1NTOA 4X1OA 3CEMA 4RD3A 2JLBA 3L0DA 1HDXA 3TSZA 4Q05A 3R5KA 4U9IS 2XUOA 1F6WA 2ZI9A 1T3ZA 2Z4RA 4LJAA 1FSZA 2RI6A 2BP7B 2O4UX 1BS9A 5I51A 2OFWA 2D8CA 4N0MA 4Z0PA 3RUPA 5DW0A 5AW1A 3ZNQA 4LY6A 4PXYA 2ZKLA 4ZOLB 5FNVB 2IYNA 3V9AA 3WXMA 3PX4A 4QFMA 5ALEA 2C5LA 2XCLA 5FWYA 3HRHA 4L50A 4NCAA 4H6VA 1Y8QA 2NUTB 4Q9HA 1EX7A 5DCWA 1W46A 4YA6A 3RABA 1A9YA 1SH7A 4ZC1A 3M6WA 2R4TA 3GLHA 1MOPA 1X7ZB 2ZYVX 2CY0A 4CKEA 3PMNA 1HOTA 3VDMA 4LOIA 1JHRA 2DKFA 3PHCA 3Q2OA 4FT2A 2VDJA 1QC5B 2GNPA 1JXAA 1E4YA 4G5YA 1QKJA 1JP7A 1TAUA 1ZIOA 1BA3A 3RUCA 3O3MB 2IPXA 2ZYSA 2BD0A 2N1BA 2D1TA 3LI2A 1KJYA 3IRUA 4KGVA 2HBRA 3BJZA 1FQJA 4PZZA 3T52A 2EBHX 3LLCA 5BVHB 2PL1A 1MX9A 1KN5A 1SR8A 3COJA 5EXDA 4IVRA 1E3DA 1PTKA 4ZYTA 4IV5A 2YHIA 3MT9A 5D3MB 4CM1A 2VDLB 4CCSA 3ABRB 3BWXA 3AX6A 2AYZA 1WSAA 1PO7A 1POXA 2BEWA 3LQKA 4JI4B 5KJ6A 3CU5A 4DRZA 5ALYA 2FPIA 3R7SA 5A4JA 1U2TA 4Y6QA 1MXHA 4Q4DA 4HAOA 1HNZB 4U2KA 3P94A 2C2EA 2XQFA 3DAYA 4X1IB 2JFUA 4EY3A 4R1LA 2WT8A 5LMUB 4QZIA 5KTMA 4DFPA 2RHGB 4X8LA 4FYMA 2ZBDA 2F3UA 1QH8B 5KI6A 5B58C 4UBIA 2A3VA 4U7DA 3PFGA 2ZAYA 4PYRA 2QG6A 4FKMA 1EB8A 4UM5A 4JT2A 2G6TA 4Q7EA 2GNOA 3L8EA 4IV8A 2X1MA 4ATNA 3V7NA 1T34A 4R9SA 5EINA 3QVXA 5LP6B 2OCBA 2P2GA 1AQYA 1JV2B 5LYJA 4KNVA 5F9FA 5J8YC 4ZC8A 1GXSB 1Z8NA 4YAFA 5JCOA 1U49A 4JJKA 4F71A 2FPUA 3LXMA 1KVUA 4C2BA 5K0NA 1JEOA 4IPTA 3F90A 2ZAOA 4N7RA 5DBFA 1DFHA 3TO5A 5KFCA 5BR7A 3MWLA 3LBIA 5K03A 4WCFA 3EGDB 3A3NA 1LV5A 1S8FA 1I1OA 2VLBA 3AU6A 4P81A 3L7JA 1TIKA 3H5OA 1XEWX 4XOIA 4UUPA 1EXMA 3RAXA 1GUBA 9ICKA 4W1PA 3ZQKA 5J2AA 1H23A 5EWEA 2VP2A 4OKIA 1FRZA 4JLAA 3GFVA 4MR8B 4O2AF 3ZUPA 2MYTA 3LYSA 1U0FA 4L75A 1FF9A 2DTDA 1XPJA 2VP3A 4C7OB 4BKRA 3Q72A 4MQLA 2Q7DA 1KEEA 1OY1A 2QTTA 4CLOA 5J40A 5B6IA 3LUDA 2VJMA 1P1RA 2EJVA 4WLUA 3TNLA 1SKQA 5JVDA 2QP3A 3I8XA 4MKFA 4FONA 3BA6A 4DV3B 1ZEMA 4RIIA 3QKWA 5EERA 8ICUA 1J9ZA 5GJBA 3RVPA 3ORYA 3HMQA 3KT6A 2YJNA 1Y3CE 5AKZA 2QZPA 4EYGA 1CV2A 4E2FA 2VT7A 2WKPA 3TQHA 4E03A 4P84A 2AJBA 3ZV4A 3TJMA 1Q7BA 3BTOA 4C0SA 2AFHA 5ED0A 5DW3A 5EJMA 4BB0A 1DQPA 2EH9A 1EXVA 4LYHA 1V6SA 2QTVB 4MP3A 2C9DA 1R88A 2CL0X 3FFAA 3M5WA 3BG5A 2V98A 1SKRA 4ZOAA 4DXAA 4PFKA 1ZQ1A 4QHSA 4LK2A 1TPYA 1UADA 4H4EA 4ZMSA 1TT5A 3R2JA 1GAJA 1GGEA 2CZGA 1C4XA 4MDYA 2W0SA 2Q1WA 4IO1A 4JUCA 2A5JA 1YJBA 3UCXA 2YRWA 3L46A 4BLSA 2RH8A 8ABPA 3WP0A 1U1DA 4BLOA 1TZMA 1XU7A 4LNUA 4RD6A 4P3NA 2QGFA 3PD7A 3HM2A 4WBSA 5L3QA 3IDSA 5FL7A 4GXNA 4RPYA 5KQLA 4PZCA 4KO3S 4FGWA 3FMOB 3R0QA 1PVQA 4DR2B 1F12A 1V41E 3A6KA 4DZTA 3EQ6A 1RMQA 1U7TA 4ZEVA 4UD2A 4BGIA 1HEIA 3D59A 3GILA 3HU2A 3ZU4A 1OUMA 1L5NA 3E05A 4R1PA 4OOEA 4PIMA 4G5FA 2GZDA 2JASA 3MMSA 3A4TA 1DDOA 1N6NA 3OZWA 4LKRA 2LW7A 4AZVA 1ZYQA 4WFKA 3R0XA 4HZUA 3A70A 4BYGA 1UUFA 2HKIA 2WHEA 3QVSA 3PXXA 4OQNA 2IH2A 2D2VA 3R6LA 3EISA 3EUAA 5HKBA 2GILA 2AN3A 2OA0A 2W11A 2AS0A 1CY6A 1AGRA 4K2HA 4YQZA 3ESAA 3FHCB 4XB6B 1HDYA 2DECA 3BZBA 1UBGA 1QNLA 3ND9A 2W58A 5A9RA 3QZUA 3L05A 5T4EA 2AMFA 4JBNA 4IRCA 2BISA 4FOPA 1AKUA 4PBSA 3OQ6A 2POQX 8OHMA 3DOCA 1BPBA 1ZUNA 4NCKA 1ZESA 9ATCA 2BGWA 2W2NA 3LHSA 3NG1A 4MRMA 3NDRA 1PNOA 2OYCA 2Z6AA 1KBZA 2RHOA 5KZMB 1K06A 2E4UA 1Y5IA 2CL7X 3SBOA 2O3JA 1XO1A 1OGIA 1WW8A 2JFPA 8ICFA 3HPQA 2ZJ6A 3G0HA 3WL6A 3MS4A 1NHWA 3MMNA 2YNMA 2MSDB 3PX3A 4I2BA 5C8YB 4GL2A 3PBKA 4QU5A 2DERA 3GLFB 1CEYA 4ZWNA 2FZEA 4DIMA 1R0LA 1RQ2A 1V1RB 1XLWA 1BPEA 4CG1A 1WUYA 3NAMA 5TS3A 4FHGA 6GPBA 2LVBA 2A7XA 1ST2A 4EJFA 5HK9A 1ZQQA 1WSBA 4HWSA 5EKUA 3IURA 1E79D 1NMXA 3AINA 5KFEA 4E07A 1IG3A 1XQ1A 3G6YA 4G86A 1G2QA 5FUXA 4KXNA 5JD5A 5JHHB 3FWPA 4PLGA 2G63A 2NSDA 4S3MA 3G0OA 3UPUA 1SZCA 3NALA 1PUXA 1KOLA 5IJ9A 2ZB7A 3OFVA 2PKEA 3K35A 2C94A 4R1QA 3HO6A 4D0LB 4O5OA 5JUWA 2P2DA 1KHTA 4K3VA 2I67A 5ALVA 3TAQA 4RZSA 4F0JA 3JCZA 1GGVA 3I8OA 1V5FA 1P31A 1UC9A 3AI3A 2AC7A 1QS0A 3CX8A 3GCGA 2BGIA 2VHTA 5LMNB 3LRXA 2DOKA 4OY3A 4XWWA 2VYNA 5BW4A 3K20A 3WLKX 1EFAA 2OSBA 4Z3DA 4EX7A 1HLGA 3JVDA 4PNEA 1XTRA 3LHKA 1Z4IA 4XGIA 2IA5A 3OD5A 3HCFA 3OP4A 1YC2A 4GXKA 2GK3A 1ZR2A 3OPVA 5CVUA 1KZ9A 1I80A 4R9RA 1KVQA 2GRAA 3LY9A 1ISPA 4L0MA 4MI1A 3T7RA 1ADJA 4QGBA 7ICEA 1SJ9A 1QGZA 2GEJA 5JCJA 1NF2A 5IDQA 1FY2A 4BB5A 3KKLA 4W5OA 2D59A 5J29A 4HWOA 2NO0A 4XB1A 3EIQA 1JLHA 4JUIA 4D80A 1T8YA 1JQ5A 1ODFA 3O38A 3FOFC 1K2WA 1KKUA 1VOTA 1L5VA 5B55A 2OMKA 3VU0A 1H42A 1PT6A 2YICA 4C6SA 3GZTB 1GPDG 3I05A 1KI2A 2GFHA 3HDYA 3JQ8B 3LT2A 4H08A 1T0PA 3CLTD 3AQ4A 1I7PA 1RXYA 3ENVA 3GRPA 1GL6A 5DBIA 1D09A 1KWKA 2AT1A 4YHBA 4M9LA 3UMJA 1G6OA 1YRLA 1WO8A 2ZXHA 5ED4A 3ILXA 1JN0A 3TYXA 4CQMD 2ZRLA 2KW5A 3PC6A 3H5WA 5B1EA 1EVIA 1JQKA 5GP1A 2H4ZA 3RWOA 5CX1A 4RTNA 1GG5A 4PC2A 1XTZA 2P0EA 3I6MA 3H9JA 2JAXA 2R6DA 3LS2A 2QQFA 4JT4A 4X6XA 4QJBA 2BMWA 3HN2A 1BFUA 2PUJA 2C04A 4DWWA 4IM7A 4RNNA 2H7VA 2JRCA 3K31A 3O8LA 2B21A 1OB5A 3GRCA 2BF4A 2VNJA 2Y0PA 4FTWA 4PBTA 2X7JA 4DM4A 2J48A 3P2YA 7ICJA 4XIFA 4NEHB 4ZREA 3VKFA 2ILVA 8ATCA 2WUGA 1ZITA 1A71A 1AXEA 1RWOA 1W76A 2EDUA 4P3PA 4NL9A 3KUDA 3UICA 1N92A 2D5CA 4JI0B 4UAVA 1IC6A 4PQRA 5KAIU 3O3OB 1OBCA 4GP6A 9ICAA 1SBIA 1CR2A 2INGX 4XQ8A 4DBZA 3KHKA 4BFUA 2E8MA 1C30B 1U9JA 4ZCPA 3FOBA 1EWVA 1YB7A 1RNLA 1NN1A 4BNTA 4AUNA 3A11A 3ETCA 2LYAA 3HJAA 2PR7A 5AD1A 5KB3A 3VHLB 4K1XA 2RFLA 2VG8A 2X2OA 3W04A 1O9HA 2RAFA 4MV1A 4ASUD 3LGAA 5HM6A 1D4AA 1W34A 4IL5A 3LDFA 2PGIA 4YUZA 4DBLE 1GARA 2EW8A 2YRFA 4B4WA 1S2LA 3G79A 1UZNA 4TGLA 3K9CA 1OLSB 4HQ0A 2WSIA 3WNQA 1UJNA 2D2IA 4LIPD 3AL2A 1MRSA 3GYBA 4OO3A 3PO5A 2BSAA 1RRVA 1WMFA 3F4KA 3R0JA 1C5KA 3BJMA 1PGOA 2UUAB 2FI1A 2MSNA 2DT5A 2C7VA 2NO9A 2K87A 1YSCA 3EPKA 1NNEA 2WIFA 4MJXA 3OT1A 2VWHA 4A36A 5EHNA 4NH0A 3AF2A 1OFUX 4RPCA 4ED3A 4O33A 1EP3B 1YZUA 1OASA 2RGYA 1PZGA 1PVOA 3PGVA 3M4YA 1ZVJA 2WAOA 3I6YA 4HFMA 4E15A 3RJFA 3AP1A 3U4AA 3VHXB 3WRYC 4OMFG 5KFOA 1C3OB 3ZGOA 2Y0CA 1ZMRA 1Q0QA 3ASUA 2ORYA 2UYQA 1YQDA 1FMJA 3GCXA 3IT3A 3DMTC 3OQHA 4BBPA 4MYDA 3PRJA 2IU6A 3M6MD 3AYZB 5AVSA 2FX2A 2R96A 5WRFA 4XX1A 1PSZA 3EG9A 3WDKA 4N0QA 3PY8A 5COAA 4K46A 4LI0A 1TM1E 5HCIA 2PHZA 2JGNA 5B7NA 2WHQA 1NZDA 5ALXA 1D9FA 5CFZA 4LDAA 3GA0A 4I8IA 1W0JD 3ZKWA 1J4AA 2EZTA 2B1GA 4WXYB 5ARBA 1V85A 3KOYA 3TL6A 2CK3A 5EJ9A 2AH5A 4URYR 4PAGA 1QDEA 2OXEA 1CJVC 5EVCA 3R76A 4INAA 2AJTA 1W5BA 2MINA 5DGCA 1QIFA 4KQMA 1B41A 2Z5VA 2GJSA 2BQ3A 1ZINA 1RYSA 3FDZA 4YRZA 4Y2HA 3WLHA 3GLIE 5G4KA 3CUTA 4RT3A 3A0HU 4FEGA 2DEUA 3IDWA 3SF8A 5K3CA 3N39C 1TYCA 4DCNA 2YV2A 4JUDX 4G8DA 1OLUA 5H80A 4A10A 3PWKA 3SYKA 1QV6A 1QTQA 1DUVG 1UZLA 2JEZA 4PYMA 2OCPA 3CF2A 3NHUA 4MEYA 3PQ3A 4WZBB 2PPLA 3MCVA 3KAPA 4P4SB 2FK8A 5KYVA 2TRSB 3GGJA 4IOMA 5DXFA 2WTAA 3NHMA 2UVVA 2EV9A 1WXWA 4ZCMA 4N9WA 4BMSA 2FOLA 1PDOA 3GZNB 4GYYA 3L1VA 4IW3B 3I9OA 1VL0A 4YRDA 1ZU4A 3HC7A 5A9SB 4PHPA 2IU0A 2C5AA 4OQXA 1ESMA 4C0KA 4RMNA 2QL6A 1BPZA 2H4FA 4X92A 2YHAA 4YALA 5ARDA 1Y5NA 4MQMA 3ORSA 2FLKA 3W3AA 3ETDA 2E1FA 1RYMA 1YI8A 3PFCA 4HLUC 2NSJA 1SC9A 4JQZA 4ISBA 4GOMD 1EP1B 2ZIWA 5I7WA 5IABA 4Y1GA 2Z8XA 3ZZMA 5L4SA 4DAOA 3DOIA 1F2UB 1F2TB 1X7GA 4PM4A 1JEQB 2AXQA 5B64A 4Z6FA 2Y77A 1OH7A 3ENQA 2H3HA 4YJGB 4QDXA 4NMMA 4MF2A 4LSZA 3ZOKA 2ZXEA 2V59A 2FEMA 4PTYA 4AS1A 2OCDA 4R6WA 4CM9A 3VJRA 4LYJA 2AI2A 4HJRA 2CMFA 5CA1F 2QTGA 6Q21A 5C51B 4H6PA 3SENA 4L5IA 4UZFA 3B36A 4KWIA 4ECZA 1HTBA 4ER3A 1IL0A 3WGKA 4NDZA 3ROPA 1NKEA 1XVUA 2JJ2D 5E38A 2H1OA 3OZGA 1TFUA 2GCGA 5KMGB 2X41A 4XTCS 4HVTA 2JATA 4FFDA 1E6MA 1OX4A 3IHKA 2J9YB 1NL3A 3B9RA 2UUOA 4QOFA 3IAM6 3R4VA 1Z3CA 1V16A 3U13A 4ARBA 3C3PA 1TM7E 2CMHA 2BV3A 2DFLA 1SO8A 3HVIA 1CZRA 3KSAC 2PFNA 1LVGA 1M5UA 1NNI1 1XEFA 4LDNA 4MRPA 2ODNA 4QDUA 3RJIA 2B5OA 5FWNA 4I46A 3T1HB 4L74A 2B78A 3ZWNA 1C4OA 3V6HA 3DWGA 5B4TA 2IHZA 3IBSA 4E7OA 1IZ0A 1XZFA 4TOIA 4H3SA 4CKCA 2HR1A 1KDVA 2DB3A 3AF4A 3FSEA 4BXOA 3DDZX 4Q24A 1XA3A 1BPDA 4MV5A 4B0OA 1USGA 1UC8A 4NQRA 4AYTA 3FBTA 3MCWA 5KAPA 3IXQA 1RHQA 3PC4A 1WF6A 1FMLA 3COYA 3RROA 2PUEA 2KE5A 4YASA 3BGSA 1Z6PA 4H1VA 5T6MA 3N76A 4YAOA 1GOTA 1Z00A 2ZE6A 3DMHA 1H5UA 1GTMA 2XZTA 1P19A 4WZZA 3G7UA 5ALZA 1IG0A 1D2RA 1KC1A 2WHYA 3HL4A 4C03A 3F2DA 5CHYA 3REFA 4MVJP 5JXWA 4B7XA 2OKCA 2EZ9A 3K8ZA 2JCBA 2VKQA 3B20A 3ON5A 3SS7X 5JI3E 5A5DA 4P7GA 3PTLA 4GMKA 4YXFA 3NFRA 1DUIA 4YAIA 2W2VA 3I5UA 4N7MA 1XLUA 4H35A 2R2GA 1FFAA 2FFAA 5BXYA 1SM4A 3N1UA 4GBJA 5AM2A 3KYJB 4LGVA 5T8KC 2D7DA 4YAGA 1D2HA 5HILA 1S9FA 1E3IA 1R6UA 2Q4BA 4NBLA 4BJHB 3CGGA 1ZL2A 3MMXA 3F8WA 3TN7A 1FW6A 2CNDA 4OJKA 3C6QA 4OB8A 1Q83A 4O4IA 4J9KA 2DPLA 4LOKA 1WWKA 3EVAA 4A0SA 1XRLA 2CWWA 1KH1A 1R4ZA 3O4VA 4RT2A 4Z4FA 4P0TA 2CXXA 2Z2YA 5CLFA 1Q16A 3AKCA 5J4VA 5JAOA 5EUQB 3FPKA 3FLMA 3D1LA 4D4IA 5KVAA 4HI0E 2DZDA 2R1VA 2FEKA 1JYSA 4XLTA 3JQCA 3Q0IA 2FEOA 4UBNA 3LDHA 4EHFA 4OX9Y 4EHBA 3W5IA 5FTLA 2ERYA 4Z7JA 2ZVJA 2PLRA 1NIJA 4PYLA 4TUYF 4W63A 3IQDB 1YGYA 3ISJA 1XRRA 2XTMA 3GGDA 3FPJA 1GLGA 3UWKA 5CB4A 1O8BA 4GPTA 4GGPA 3T3DA 3K1AB 1EUQA 1TF2A 3OJLA 4BFZA 2ZIUA 1YVDA 2L82A 1KS9A 2O7NA 2W54A 5KTSA 2FE9A 4NOJA 3ZHQA 3RKRA 3FYCA 4UNIA 4WDQA 2R7MA 5BYAA 3N4MB 2FEXA 2VA8A 2WKWA 1TUGA 3OQPA 1C8KA 1P75A 2IRWA 3VC1A 4RA9A 3QFFA 1MB2A 1LDMA 5JWHA 2OHFA 4P36A 2FNAA 2AA3A 4B31A 2KZMA 2PL5A 1AHPA 4M0UA 3UB3A 2D6FC 4LUCA 4MZXA 5J4LA 3BQTA 2P9EA 4TUQA 1CG6A 2OZEA 4COOA 1M1YB 4YVFA 2YCBA 4IGKA 3OZAA 3HABA 3ZW8A 1NXWA 4H0FA 3F71A 3VTZA 2JFFA 4PN3A 3C70A 4BJ6A 1VBNA 2D4HA 2F2TA 2QVGA 3KYDB 3SBXA 1G5QA 4X3PA 2P3LA 1YKSA 1VCHA 1Z28A 3HB5X 1ZJZA 4P3XA 3WL4A 2IA6A 4NE7A 3IHWA 4LHYA 3MWDA 2QJTA 3L0BA 4FZMA 1Z88A 1VL6A 3HGQA 4KLEA 2IIPA 1EAYA 2J6TA 3VH3A 5JALA 4MRSA 4V02A 2ZJOA 1LNZA 8ICVA 2OOSA 3QUSA 2KJ5A 1YJAA 4I1SA 4AMZA 2E4WA 1UC5B 2HQSA 5FWXA 4I3GA 2IUYA 1RHJA 4KQ6A 2ZT5A 2ASEA 5HKKA 2P8JA 3DFMA 1EK5A 5TMEA 3OJ0A 1LPSA 4YMTA 4Q3DA 3UWSA 5FR2A 5GM1A 2XUKA 2HHTA 1YOVA 2FOXA 1NY6A 1K5HA 3OIUA 4ZANA 3PUKA 3UQ0A 1K1SA 4B3IA 1KR2A 1Q5PA 3M5DA 3VU3A 4ZVNA 1VG1A 2C0PA 4I9HA 2YYYA 4MQFB 3SYTA 4HGOA 4EVIA 4IH1A 4RYDA 3L07A 5MFZA 4EB0A 3T6KA 4HAUA 1GAWA 3L6BA 4LDZA 4XLLA 5EEGA 2QB1A 4XJXA 5LC1A 1PQPA 5K20A 5IX8A 2OD7A 4ESEA 1ZJ6A 2BF7A 4LF5B 2FDRA 3KJIA 4KPYA 3VI4B 2ODBA 1OPRA 1VPLA 3NRCA 1H3NA 1N2CE 3IRVA 4ABYA 3FRHA 4GP7A 1CCWA 3A4VA 3L6DA 1JEYA 2UXBB 2JGAA 5SZIA 1JSCA 3FNBA 2GDZA 3F7MA 2C5BA 4XVHA 4J3FA 5KFNA 2OZVA 3IKJA 4IVPA 1JTFA 1P80A 2QLJA 4IVQA 2ZSHA 2B2CA 1HH4A 2Q8PA 1NP3A 4H18A 1R5OA 3BRSA 1T5OA 3TFRA 1JXMA 1TU0A 3IJPA 3T1NA 4B84A 3DULA 1WD5A 1MX1A 1YR1A 2FKAA 1G5FA 3FCUB 4CIAA 1NYTA 5F9LA 3O0DA 5HF8A 5T57A 3DB1A 1IHUA 4AX8A 3P2OA 1XCBA 4C14A 1NXTA 3WR5A 1NK9A 4DL5A 1JBEA 3LT1A 1V47A 1V8FA 4M9RA 3KQWA 3BSWA 1X1EA 2CB0A 4MWGA 4PO9A 2P6RA 3NATA 1PJ8A 3GYGA 1FZTA 2EFHB 1X9MA 3TZHA 1KFEB 1ZNQO 2BFNA 3ZW7A 3SX4A 2W7PA 1NMSA 5FOWA 2W90A 5B58T 2YC2C 3LD9A 1KVTA 1N2EA 3UJBA 1OD6A 3KR9A 1PUIA 3I2FA 4MV8A 5JRTA 3TFWA 2BPOA 1O1YA 2WFAA 4WGGA 3QKSB 4QJIA 3NWEA 5J0XA 1AUOA 4RD0A 2HJRA 1CLUA 2P9YA 3C6BA 1RZRA 5P8WA 1O8CA 4CGYA 2VXOA 4Q4HA 1KZGB 2D2EA 2W6MA 4M6WB 5HR7A 3N87A 5BSVA 1LTKA 5EKXA 2KSOA 1BCRB 4B33A 1U7UA 2AX3A 1E6LA 2WZQA 3UWDA 2IWRA 2VBIA 4UAGA 2XNCA 4LK3A 3M6ZA 3W1WA 2C9CA 3LF2A 4NCIA 4UVGA 9ICCA 1IY0A 4HBZA 3SVLA 3JARA 1LKYB 1NKSA 3U4IA 3NM6B 1EGVB 3EXEB 4M0DA 4TQGA 1FVOA 1A9XA 1CIJA 3UC5A 1W9HA 1DQZA 3ACBA 3EXG2 1I2BA 4CF7A 3EVTA 1C9EA 2WIBA 1NJYA 4PC6A 4QPDA 3SLRA 1W8IA 1PEAA 4UMDA 3EAGA 1DXSA 5KVSA 1QX3A 4TUPA 1VHJA 3GRUA 1RRPA 2HHHB 1KZHA 5THQA 4OU4A 2UV8A 3V55A 5BPHA 5DQGA 2FDXA 3UPQA 4DSKA 5CT4A 1CKEA 1X19A 4DQXA 2OHIA 5H02A 5IBCA 3GFRA 3KKPA 4M1KA 1UKEA 1ZD4A 4GLBA 1E60A 3DE6X 2W55A 1I36A 2IEIA 4CN9A 3NT2A 4CMJA 4MEAA 4BJ1A 4ED0A 5CVEA 4YS6A 4H7JA 3L49A 3INNA 4F5YA 3HR4A 3RC7A 3LC1O 4LHWA 4K88A 1T24A 4DG5A 2BM1A 2IZOA 3UAZA 4MW5A 3DXYA 3WZMA 2DVMA 1QYCA 1JG6A 1HDEA 4PW0A 2XC9A 4PHTA 1QYXA 7ICVA 4UB6U 5KNLA 4YP1A 1SVIA 3H4BA 1NMEA 5LQCA 2N42A 1G8SA 1L1RA 1WNFA 2YHBA 1PT7A 1UK6A 1T6XA 4DQUA 1OJLA 3PW7A 2J46A 1QFYA 3TNJA 1YB5A 4NOMA 3V48A 5LPNA 1VLVA 2CHEA 1E58A 4M9SA 3FHTA 1DAGA 3I32A 1BE0A 3I58A 4AKGA 4B80A 2YW9A 1JEEA 2RC6A 1NQAO 5D51S 4R8KA 2NTNA 3ESRA 3TS1A 3IA7A 4ER7A 1ODJA 3ESYA 1VPDA 4TRJA 4K6FA 1UJBA 5A7HA 1HDRA 4O63O 4CTKA 3L04A 1CUSA 3FCEA 1JPNA 2HRBA 1QHIA 4B2LA 4M0MA 1KRXA 2FZCA 1U8ZA 2RK6A 3J81j 4Y2XA 4NMLA 3GLUA 3WB0A 3EVNA 4LTNA 1E1MA 1VPTA 3OOHA 5I8ZA 5KNBH 1XNSA 2GAOA 2ZR7A 2V65A 2VZEA 1CNFA 2DQZA 2PUFA 1DIHA 1XQ9A 3S1LA 1MB9A 1XJCA 1SXIA 2Q0ZX 5B53A 3NDIA 3ONWA 5J58A 1W5SA 1RKXA 3GV7B 4CWAA 4V1CI 1FZQA 3S2YA 3RB3A 2IDMA 2I7DA 2P6PA 3ENKA 4FHEA 4KLGA 5DNDA 1E9BA 1S4MA 1EYZA 1QV9A 1BRMA 2NACA 5ULLA 4ECVA 2ZIVB 4HMQA 4GI5A 3PNLA 1H6DA 3E0FA 4XQ0A 5J0PA 4GQBA 4AZ0A 3SDSA 3ND5A 1V5IA 5EYPA 3I3SR 2EL9A 2C0CA 5IKEA 4RQNA 2X6TA 2HDHA 2OFFA 3TG8A 1RLTA 5TZVA 4ZJPA 4DIKA 1SUCA 2PXCA 2B8JA 3IPCA 2XIJA 2C92A 2RGUA 2HSZA 5G53C 4RS4A 3RUIA 5JNLA 1VMEA 4GX0A 2WPDA 3MNFA 3O92A 4XXHA 2CXQA 1UXJA 4DRXB 3FUXA 3OTHA 1M6VA 3NVMB 2R8XA 2Z2XA 4TS9A 4KTVE 4N1AA 3P9YA 4O08A 4GBGA 1AHNA 3WP1B 1Z39A 3ZQJA 4EVQA 2KSQA 1Y3HA 4DF4A 1VP3A 4UDNA 4F8EA 1NG1A 2Z1MA 4PO8A 5HKLA 3EK2A 4B4UA 4PN7A 2OCXA 3QLTA 3FUWA 5HRCA 3B2EA 5EUCA 4OO1J 3K3PA 4ACBA 1X74A 4NYIR 3GK3A 2ZIFA 3IQFA 2VANA 2D0IA 3R7LA 4OHUA 1MQ8B 4RQ1A 4QOHA 1E20A 2JLQA 9ICEA 4B3DA 2RGEA 3KHGA 5A71A 1RAAA 1YQTA 4DSZA 3WOHA 1EUCA 4IQ0A 2YXNA 3CF4A 5SYNA 5BSTA 4DEVA 2X0FA 2O8BB 2W2PA 4BYMA 2BM8A 2QPOA 2CUTA 3B3FA 1T0BA 3FUUA 3B78A 1Q1GA 5HF5A 3KZCA 4AKEA 2CGEA 5DBHX 1KMHB 1ABFA 1XZAA 4OQPA 3TBFA 2FE4A 4PGFA 5C9ZA 5CYPA 1QWSA 5E0OA 1B0XA 3B3JA 2O2GA 4RV4A 4W7IA 1KO7A 4YMGA 4C0QC 1AJEA 3ER6A 2ZIAA 4BNGA 3BIWA 1O0SA 4I4TA 1U94A 3L4KA 3DHYA 4QUAA 2QXYA 5IK2D 3DTYA 4KDFA 5AKXA 4WNYA 1COZA 3C8HA 4BEBA 3L18A 2GD2A 5EIBC 1WOMA 5IIIA 2NWQA 2XMBA 1L8XA 4HPJB 1CX9B 4LYEA 3V3KA 1NBME 4OLHA 1KJIA 2H11A 2AD5A 2H4XA 1RWNA 3OJEA 3GELA 3TKYA 1XCGB 3ZE1B 1BFDA 2HA4A 5FA5A 1FFBA 4U7FA 4QODA 3JU3A 5BUZA 1QQ7A 3WYEA 3C6YA 3CSSA 2D1RA 4OLFA 2GPJA 3P45A 1YIDA 3B85A 2PIAA 2R5WA 3ZDEA 2V0GA 1ESNA 2IX3A 3KWMA 2IYPA 3MAGA 1H2FA 2ZAIA 5C31A 4MCIA 3H8WA 1GNSA 4KYTA 1R0YA 5KQSA 5ER6A 1TM2A 2P9ZA 3RAGA 1JHAA 1Y3AA 1XZEA 2Z83A 3P9NA 4JNKA 4HXGA 3EUWA 4GZMA 1FFUA 1K88A 2EKLA 1XRQA 2NUAB 5BWOA 3B6IA 3FNEA 1UWLA 3Q7EA 3K2QA 3FCYA 3CZAA 1H66A 2XADA 4OK3A 4M9NA 3VSBA 5AHWA 3NDPA 2I8LA 3H1TA 4F5WA 3F49S 1G5TA 4LRUA 5IVDA 3PA6A 2WIKA 3GUCA 4UFPA 4ENTA 4GOND 2NSHA 3NVDA 4M89A 3TFQA 3GLIA 3I62A 5DN6D 2X9QA 1N4AA 2GJ9A 2JKZA 4ZDKA 1BS2A 4MS3A 3H1FA 2R4QA 4E5MA 1FBTA 3EPIA 3L40A 1L5FA 4PL2A 3HU3A 4LZGA 1QOQB 5HQ3A 4ZYUA 5EMHA 1LC0A 3UMFA 4KHZA 3RYHB 1YJ8A 4P82A 3T61A 4ZN6A 3WQHA 2WHPB 4O3MA 1DRVA 2O2HA 2P68A 1COWA 4BO9A 2PR2A 2ZRBA 4BBZA 4HGZA 4RV5A 3K6SB 4QEKA 4PBRA 4FSDA 4X1KA 1WPGA 1Q0PA 1LSSA 3D1JA 3O74A 3OCVA 4Q9KA 4BE4A 2BFCB 3PFFA 8ICSA 3SSAA 4O2LA 4YUXA 2AU0A 2Q29A 3HBMA 5EJ5A 1HQDA 2P35A 2IYEA 4ARVA 1SIBE 4BB9A 2DP4E 3E1GA 3ZWYA 5B1DA 3S0JA 2J7PD 1SUDA 1EIWA 3GUHA 3ROXA 4XARA 3I42A 5AXBA 1EWKA 3M8RA 3DOJA 4J16A 1UA1A 2L2QA 1MA3A 2ZJ3A 1GUFA 3HU5A 3RK1A 4FGKA 1DRGA 5B2EA 4OQ4A 5BOLA 3E70C 4B71A 2J87A 4GPZA 3WAJA 5HJ2A 1SHZA 2IZ1A 3ZWWA 5I9TA 2ZJ8A 3HFJA 3GFQA 1FMFA 4ZEWA 3T5MA 2IPNA 1D4FA 3HA2A 1HEYA 1SV0A 1BJRE 4RACA 4CKWA 4L4ZA 5GAJA 5AUOB 5FAKA 3L7BA 2EF0A 4EKGA 2IS1A 4GYJA 4MGHA 3UV6A 5DI9A 3A1CA 4ZVKA 1E0DA 4AT1A 3RUDA 3ZY2A 1R8XA 3Q98A 1N4DA 1QM5A 5E2IA 4GLLA 2QG9A 2W8KA 1RLIA 2YJGA 2H1IA 4P38A 3CE6A 2IJGX 2VDWB 4JZKA 1D6JA 3FN4A 3RQSA 1G2IA 3BWDD 3PQEA 3MINB 3TLGB 3L7AA 5CBPB 3MS2A 4R68A 1XNQB 1QPZA 3B60A 1JKIA 4O1HA 1EQUA 3IQWA 2WSYB 1AN9A 4EUNA 2J6CA 2C7OA 5ALOA 4ITVA 4EAAA 3U9SA 2WG0A 3AUJB 4XX0A 4FFNA 1D04A 3DOUA 4PS0A 3W4IA 4YJFA 4IR1A 1U99A 3I3OA 3FOEC 2GHTA 3DEKA 2IELA 1Z2PX 2O50A 2AHRA 2P9FA 3LOUA 4ZRMA 1B73A 2H5LA 3LNTA 7ICNA 2XOXA 1ELOA 5AM1A 4JKIA 1BS1A 3QELB 4PTZA 5JU6A 2B69A 1ENYA 2OV2A 3ID6C 1DEOA 4O1IA 3FYUB 1MO6A 3A6GA 5EP3A 1IJKA 2BFEA 5D7BA 4HUQA 3ILVA 5INTA 4X9XA 4AP6A 2FZVA 1NW6A 2AJLI 2MSCB 1K8QA 1GG9A 3TUZC 1FP6A 1P2SA 3FPEA 4DCCA 1ZGHA 4ECQA 4UKDA 16PKA 4PY2A 3JWHA 1QHHB 1NYLA 1YZGA 3D6JA 1DC6A 1Z4NA 2Z4TA 2KN7A 2FP4A 2GPTA 3LUAA 5J23A 3A6HA 4WY5A 5EGSA 4DLPA 2I7TA 3TACB 1N7IA 5D3QA 3IH5A 1LX7A 1SGGA 4ZHQA 4KKVA 4WGFA 4DRYA 3FTCA 3LT4A 3F1KA 1D4ZA 4FI3F 5JAIA 4Q45A 3DQZA 3JWEA 1IBCA 1PFKA 3VZRA 3DVLA 4Q4LA 4E09A 3ED5A 3M1LA 1ZD5A 2W8BB 2ZWVA 5C1IA 5LZ4A 2Z30A 3AQIA 4KC0A 2W9XA 3IX7A 4QNMA 1FX1A 4G1BA 2ADFA 3R5JA 3O9VA 4PVCA 3KLNA 3NIFB 1OXVA 3A6DA 3DBHA 5JDCA 3V1KA 4W9NC 1HFJA 1UMCA 2CHUA 1AIPA 1EVEA 3NC4A 1ZZGA 3T3PB 2V4MA 1GL9B 1NWHA 4MYCA 2GD6A 2QN8A 1DPFA 1T9BA 4P5PA 3H5IA 4MEJA 1NQWA 3C1UA 3C2KA 4G89A 1S2IA 1C9NA 2QTMA 1MJHA 3ZHVA 4TWAA 2XLCA 5IMBA 3IP7A 4EG4A 3NV7A 4RULA 5GZ1A 4ZZ0A 4OHYA 1OXTA 1IOWA 1P2TA 2EWMA 2OY0A 2X9GA 2NO7A 1OWMA 4NL4H 4GWGA 3PQ4A 3MUFA 1M6WA 2VYCA 4WXHA 1CRPA 3WB2A 3Q7PA 2ZTHA 3OLWA 5EIAA 3GV0A 4IJVA 1ACLA 3GLGE 2HMSA 4K05A 1DK3A 4BECA 1SCKA 4FXPA 2R7LA 3KQPA 2WWIA 4KPEC 3DMGA 1TJNA 2HN9A 3QOYA 3ESCA 1NMQA 3ZWBA 3K0FB 3GIKA 5ANRB 1YO6A 4GZ5A 1N36B 4UXHA 3ISDA 2KPOA 1BWRA 4F4FA 3S55A 1Z16A 4AAYA 4JXXA 2O06A 3HDGA 4EBFA 4CM5A 1OZGA 3Q7TA 2ALJA 2DLDA 3DLCA 4EFMA 3BQMB 4CLDA 3NOVA 5CK5A 3KL2A 3AB7A 2DYKA 2VVTA 1Z08A 2O2SA 3C3EA 4ZT5A 1T2NA 3UIEA 4Q4AB 1DAIA 5K8LA 3LHFA 4A2CA 1XRSB 4R8UB 3T5TA 1QLWA 4QU9A 4KQ9A 1EUDA 4PNZA 2HPHA 2QRVB 1ZUHA 4P4MA 2GOLA 2XOEA 2E8OA 4DCOA 2QTWB 4IJMA 4D0NA 2VR1A 2C31A 2Q45A 4MPRA 1YONA 5AHOA 1VL8A 2BI4A 1IBRA 1XQYA 4YYEA 3GDFA 1M2VA 3FZGA 3OSUA 3I5YA 3UK1A 3C16C 3B1JA 2GVDC 4GU5A 3PNBA 1GPAA 3LRTA 3MT8A 2BZGA 1EWRA 3ESQA 3C23A 1RBZA 3QH4A 1T5TA 2REQB 4J8PA 4YP3A 1QSGA 3AFGA 2GAAA 1OX6A 1KY5A 3UG6A 2WYWA 4BLRA 5F3XB 3TCKA 1UXKA 5ITZA 4XW2A 1H5QA 1OTYA 3HP6A 4PGXA 5J43A 4HWGA 4ZOLF 5FNVF 5BVGA 2NVUB 4D8TA 4DHEA 3PNCA 2E18A 5L7WA 1SMKA 2LXNA 5FI1B 1ZUD1 4MHSA 1WHSB 4ZXFA 2BTQB 1XS9D 3EE6A 2QE7D 3LVBA 3WE7A 4I2AA 5DMHA 3BGIA 1WV1A 1DDGA 1EP9A 1OI4A 4NCNA 2CLCX 1TI7A 3V8EA 4FBLA 2A1UB 2ONJA 4LRSB 2VH2A 4PRZA 1VTKA 3U3RA 3D4NA 3FPHA 1Q0ZA 2PBZA 2OGWA 1SB8A 1AZLA 1FYFA 5B4VA 1D8AA 1A4XA 2QNIA 2VTDA 5K4HA 5TEWA 2PD4A 5HS6A 4MYUA 2F3TA 3MRTA 4GMDA 4I2EA 2I76A 5J3JA 3OZIA 5JD3A 4HH4A 1CVIA 3EXIA 3NJ8A 4TV9A 4NE9A 3LRPA 1CJUC 4LE1A 4AIIA 3ZDXB 5KNDD 5IF3A 1MV8A 2PXIA 4N8SA 1EFUA 2IIVA 3E22B 5AT1A 3DHWC 1RFGE 1JAXA 2Y76A 1T4CA 3PEEA 1VECA 4L08A 2RGBA 1ZWLA 1W87A 1MJFA 4M7RA 1DB3A 4HYTA 1L7EA 1N2CA 3DAPA 3I2HA 2R66A 4EVRA 3ZVLA 1K9VF 3U3ZA 3AKZA 2I6FA 4IR7A 2BUCA 3LUGA 1TLFA 5KYNA 1SHUX 3ZE7A 4IOKA 4IRXA 2RH4A 3JVVA 5GIPE 5E4TA 2FUKA 5IZCA 3LWDA 4R71A 2OHXA 4Y2QA 1K8RA 1HE5A 4ZAFA 3U4HA 1YDHA 1SQ6A 2DPXA 5KYUB 2R47A 1BWQA 4JYCA 5SY4A 3GCDA 5F64A 4RIHA 2EQYA 3LFHA 2HJHA 4RPIA 3PENA 4KHPB 1I01A 2MOKA 2RAUA 4IMIB 4EKYA 5LP6F 4NK5A 1UQVA 3HSYA 2ZQ5A 3K2BA 4WACA 4C1NA 3F8SA 4OCZA 1QANA 4M2YA 4J7AA 2HREA 1U5BA 2QEQA 3VNBA 3FGPA 3V7UA 3ASZA 1W19A 5DM0A 3WADA 3SAJA 1H85A 1CNEA 1YRBA 4R63A 2AEJA 3WRWA 3I72A 4G81A 1I0LA 4NOLA 4G67A 1E63A 3KE9A 5FPPA 4RF4A 3AERA 4Z6DA 1T3SA 3R5SA 4OXKA 1SIOA 1N2ZA 1Z4OA 4QL3A 1EQAA 1KHHA 4YPFA 4YQYA 4A8HA 2BKUA 3FCCA 3RYIB 1OUQA 4WBXC 2ZVPX 3ZCVA 1HSZA 5J2JA 4FS1A 4BEWA 3QXSA 3O8NA 1A9SA 2JLSA 3SC2B 1E1CB 1YHZA 4OB7A 4WNAB 2EQBA 1W5AA 3DBOB 2CE7A 3ZHXA