1NKEA

A bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkeA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkeA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkeA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkeA01
1ZQDA 3VQ9A 3OYEA 4KHQA 2R8JA 3OYGA 3RJFA 3ZT3A 5KFAA 2IAJA 1JN3A 1ZQOA 4O3SA 1B92A 1RTJA 7ICUA 2PFQA 4DLEA 5KRTA 2BQUA 4MF2A 2VA3A 2ZTEA 1EKEA 1O1WA 8ICZA 1ZQUA 4KLTA 1NKEA 4M6WA 4K8XA 5CR0A 5KFHA 4K4GA 4KLDA 1RCHA 4CJLA 4O55A 1UA0A 4NLGA 5HRRA 1S1VA 3S3OA 4QWEA 3OYFA 4CESA 1WN7A 1S5JA 1KVAA 5CZ2A 5J0WA 4CGHA 1U4BA 2EX3A 2FMSA 5DDYA 1U48A 4K4HA 2BKEA 1WSFA 1BIZA 1NKCA 9ICHA 1S9FA 2W8LA 5FRNA 4CHNA 3AVGA 1NKBA 2Q3SA 5IIOA 1NOZA 3ZSVA 5L1LA 3GIJA 3RBEA 4Q5VA 4HCCA 4IQWA 3DYAA 2G8HA 1RTDA 9ICBA 1Y97A 8ICXA 3AVMA 4M3RA 4ED1A 4J2DA 1UOCA 4QZBA 4CJ5A 4CEEA 9ICGA 1NK6A 2P5OA 4I2GA 3MFIA 4CGDA 3VQ4A 1UT8A 2HHVA 4QZHA 4MQ3A 4RPXA 3HK2A 1B22A 3FFIA 3EWAA 4M3XA 3JSMA 4IRDA 1HPZA 3RB6A 2C2EA 4I2HA 1SZPA 5KFOA 3SQ0A 4W5QA 3GIKA 4KLUA 5T7BA 1RT5A 2IC3A 1Z26A 4DSIA 4KITB 3V6HA 3BGRA 3MEGA 3M8QA 4DEZA 1KSPA 4ED3A 1G15A 3PR5B 3G6XA 3H8WA 5HMMA 5IIMA 4QW8A 1HRHA 3KK3A 4Q45A 2OZSA 4RPYA 1B43A 2VA2A 4N76A 3M8PA 3PO4A 2BGGA 4E1NA 2ZTDA 2R8KA 5L1IA 3OSPA 5DMRA 3ZSYA 3Q8PB 3V1QA 4I9QA 1S10A 3BDPA 2JEFA 4CHZA 4H8KA 5KG1A 1K1QA 2R8GA 8ICUA 1CZ9A 7ICGA 3QIOA 5HMLA 4ZH4A 5J2FA 3B6OA 3KJVA 2BANA 3ALYA 2IA6A 2HVIA 2HMIA 4M9GA 3ZD8A 4CJWA 1S1XA 4CK1A 3KKSA 1JIHA 4N5SA 4XUSA 1ZBUA 3VQQA 5FDLA 3LP0A 2ATLA 4ECUA 3OYJA 3LANA 1A5VA 1COOA 4DFKA 2FMPA 4PQUA 4WE1A 4RUCA 4DLGA 1A5XA 2VWJA 5CYMA 2MAXA 3MGHA 1TKZA 3Q8SB 2W42A 3RRHA 4R63A 3Q8LA 4J2AA 3ZSWA 2FBTA 4CF9A 3EYZA 3PX0A 2OA8A 4IQTA 5KGWA 4UBCA 3K57A 1QS4A 3HX0A 3P1GA 4HUFA 4CF0A 4DSLA 4M42A 2FPKA 4DL2A 4JRQA 8ICKA 4Q0BA 3ZSQA 4CIEA 5KT5A 3ORYA 3UPQA 4LZGA 4O3NA 4RQ0A 4Q8FA 4IQVA 2ALZA 4CHQA 2UVWA 4GVMA 3HXMA 4LH5A 4KPYA 3LZJA 4BDZA 1VSFA 1Q9YA 3RR7A 1TK5A 1PZNA 4J9OA 3SUNA 3OS0A 3UXPA 1BPYA 1KVCA 1JX4A 1REVA 3SQ4A 3AO3A 4FLZA 1NOYA 2FBYA 1MC8A 4CJPA 9ICKA 1RTIA 1XSPA 4RQ3A 4CHOA 2XO7A 4J9RA 8ICAA 7ICQA 4IG0A 4DQSA 4FJ5A 1RBRA 4LZDA 3NCIA 4G1QA 3NGZA 4M3ZA 2P1JA 4O4GA 5KG7A 1X9SA 5CHGA 3VQBA 3VA3A 3OS1A 5KG5A 2XGQA 1S0VA 3T5HA 4I9LA 5J2MA 1JMSA 2V4QA 4CEQA 3Q8RB 5EWEA 4FJ9A 3QZ7A 5IINA 1L3SA 1BPDA 5L9XA 3ZDCA 4QZ8A 3OYHA 3TAQA 3LDSA 4FJIA 1RPLA 3B6PA 1ZBIA 2R7YA 3SUPA 1U9LA 3L2VA 4CF1A 2ZUDA 3AVNA 5IILA 1JKHA 2J6UA 5D49A 4OJRA 1NK8A 4FZYA 3SQ2A 1JLFA 3QERA 4YVZA 4DFPA 4ED7A 3HWTA 4FM0A 4FJ7A 2RKIA 3SI8A 4KLFA 2O4IA 4FK0A 3FYHA 4JS5A 3T3FA 3ISCA 4KLGA 2GV9A 1C7YA 3PW4A 3AA2A 1HMVA 4DSKA 3SCXA 2OPPA 3L8BA 5DQHA 3O4QA 4CJRA 3I0SA 5HNKA 4HVJA 2GWSA 4O5CA 4KHUA 1LWEA 1S9GA 3KLIA 1VRUA 4UAYA 1J54A 1U47A 4R64A 3M9NB 4J9NA 4R8UA 5C25A 4DTSA 3LP3A 4ID5A 3NH2A 4DS5A 1XU4A 2A1JA 4FVMA 4N56A 4FJLA 5L1KA 4ECRA 4ED6A 3M8RA 5EU7A 4DL6A 1ZQNA 4KLHA 4RZRA 1XWLA 4ECQA 4YXMA 3CQ8A 3H7IA 3NFAA 2ETJA 4Z4CA 1RT1A 4QWCA 1RT3A 1L3TA 2BCVA 2FBXA 2KZZA 2YKMA 9ICNA 3LP2A 1ZETA 2YHAA 1TK0A 7ICVA 3AO4A 2JLEA 2F8SA 4FJGA 8ICEA 4CJ3A 3M8SA 3L2WA 4CFAA 4IRKA 1B9FA 4CJKA 5EWFA 3E01A 4PGXA 5KFDA 1XO1A 5J29A 4Y1CA 4FM1A 1MQ2A 4DU1A 4KRFA 3V1RA 2C2RA 3Q8MA 4YQWA 1L5UA 9ICLA 1A76A 4KTZA 3NH1A 4FJKA 4M47A 4CEOA 3DRSA 5J2GA 2KW4A 4KHNA 4KLIA 2BCUA 3QETA 3VQPA 4AHCA 3KD1E 1BHLA 2R8IA 2G8WA 5KT6A 5J2DA 3LWLA 1RT2A 4BE2A 1TAUA 5HROA 4KLOA 4TQSA 4CGFA 4QZFA 4Z6EA 3JPNA 2PFOA 2FPMA 4HUEA 4I2AA 4NLKA 1HYSA 1LV5A 8ICQA 4KI6A 2F1HA 4KMUA 3N4MB 4I2PA 1ZQTA 4KLQA 3ISNC 4AHUA 3VQ8A 1ZQFA 2RN2A 4QWDA 5KTQA 3SV4A 4RQ5A 1NK0A 2WONA 2YNHA 4CGIA 3LDAA 2XY8A 1RDBA 3IG1A 1SL1A 2RDJA 4FCYA 3SYZA 4O9MA 4OGCA 3T1AA 5BOMA 2MUTA 2A1SA 2BPCA 1R0AA 1J5OA 3IAYA 4R8UB 4UB1A 2DPJA 4MFAA 1Z3EB 4JWMA 1AROP 1IM4A 3HPHA 3KLHA 4DG1A 5HRSA 3QZ8A 3RWUA 1B9DA 4FO6A 2OYQA 1LB2B 1RDAA 3ZSRA 3UIQA 4OKEA 1D8YA 3THVA 4NM1A 3CYMA 2PFNA 2X6SA 1VK0A 5DB8A 1HYZA 5DGBA 4M45A 5KI6A 1L3VA 3BJYA 9ICTA 1C1BA 1RTHA 2ZJAA 2KTQA 4I2EA 4EP5A 4DFJA 1ZQJA 2LYHA 4RQ4A 1BIUA 2XGPA 1S1TA 4CJTA 3GV7B 3T5LA 4PWDA 3OSNA 1S77D 4YP3A 1LAWA 3AUOA 9ICWA 4RQ8A 1IKVA 4DQPA 1TKTA 9ICPA 1JL2A 5J1EA 1CZBA 1S1WA 1RT4A 3UQ2A 1EXQA 2R8HA 3VN5A 1RZTA 4KFBA 3SJJA 3PW2A 2W9BB 3LAMA 5I42A 3LPUA 3OYAA 3EZ5A 4W5OA 1XSNA 4O3OA 2QK9A 2Y1IA 3PR4A 4FLWA 4BE0A 2P6RA 5JS1A 4Z0UA 3PW5A 1LW2A 3RJGA 3OYNA 2BCSA 2FBVA 4JRPA 2NUBA 4BGDA 2YNGA 1SKRA 1VSEA 4TUSA 3QEXA 1KLNA 2RPIA 4ZHRA 5K14A 2V9WA 2F1IA 3OYIA 3KKRA 4B9UA 2FLNA 3EPIA 3PMNA 4J9SA 3V72A 3RJEA 4PUOA 4FBTA 3QLHA 4F5OA 3ZD9A 2BQ3A 2BPGA 2AJQA 5JUMA 2BDPA 1VSKA 4ELTA 3IM1A 3TAEA 4IQUA 3T5JA 3L3UA 1C1CA 2XY5A 4F3OA 4RNNA 1ZQZA 2E6MA 2DFEA 3RTVA 2UVUA 4DO9A 4TUQA 1YTUA 1JLEA 1QE1A 4E7HA 1X2IA 4NCAA 4HCBA 1KTQA 2VG5A 3NGDA 4LSNA 4I27A 5KFRA 3VQDA 3DRPA 7ICPA 2KN7A 5J2EA 1HQUA 4CEBA 4YNQA 3MAQA 1IG9A 3DRRA 4O3PA 4YMOA 3V6JA 4UQGA 2YKNA 3RJHA 4M9JA 2D0BA 1H38A 3NF7A 3KHLA 4OLAA 3B0XA 3MR5A 2G8FA 1BPZA 9ICFA 4DMNA 5BPCA 4FLUA 7ICTA 3G6VA 4EEYA 4J2EA 1I3AA 1L3UA 2ZJ8A 4JV0A 4CJVA 2HHQA 3WNGA 3OHAA 1A5WA 4AILC 5CY4A 3V9UA 4FJNA 3C2LA 4EBDA 1TL3A 3K5MA 5C5JA 1XI1A 8ICHA 3GILA 2Q0ZX 2YV0X 4CJQA 3EY1A 1HUOA 3ITHA 4KN4A 2DY4A 1KRPA 1TVAA 4XRHA 4KI4A 2FLPA 3M9MB 3DLEA 3SUQA 4M04A 3H4BA 3TI0A 3C2MA 1QSLA 4RW7A 4RQ2A 4Z4IA 4NY8A 4GMJB 3O3FA 1C6VA 2ITGA 9ICJA 1A77A 2HHWA 4JLHA 5HLFA 3NAEA 1WCNA 1Q8IA 4KLJA 3DLGA 8ICRA 3BQ2A 7ICNA 3HT3A 1BPBA 9ICOA 8ICOA 4BWMA 1XC9A 3V7LA 1TGOA 3RB3A 1WAFA 1KFTA 4MEYA 5I3UA 2NRVA 3KK1A 4B9TA 4C8MA 4F92B 2DTUA 4NLNA 2JZBB 4CGJA 4EZ6A 3AA5X 2RDIA 4C8LA 1RILA 3I0RA 8ICLA 3MECA 5D46A 3MXMA 4QZ9A 5FROA 1MQ3A 4YMMA 2G8UA 3LP1A 4ECYA 4DL5A 4KV8A 2P51A 2HNDA 5KFFA 1VSLA 5J0PA 3DLHA 2OZMA 4E3SA 1DGSA 2FMQA 4UB3A 1VSIA 2DFLA 3K2PA 1LW0A 1T03A 3U3GA 3RH4A 1JLAA 4CJEA 1WSJA 3AVLA 4IR1A 3OGUA 4FJMA 4PH5A 2DPIA 1IH7A 1ZQSA 1ZBFA 1ZQAA 3OS2A 4Z4GA 4KTWA 2PYLA 3QESA 4Y1DA 1F21A 5L1JA 2G8KA 4M9NA 1W0HA 3QO9A 2H5XA 2Y1JA 1X9WA 1WNSA 3KHHA 5EWGA 1NK4A 2HNYA 1NK5A 3Q8KA 4P4MA 2IMWP 4DTXA 4M9HA 3MBYA 4E1MA 4AHSA 3PO5A 2JZBA 1SKSA 4YN4A 5KG0A 3RJIA 4FS1A 3L2QA 4E7IA 8ICIA 4ICLA 3MGIA 1VRTA 4KN7A 3K75D 2BCRA 4DU4A 8ICTA 3O3HA 4XIUA 5KFKA 4Z4EA 1UWBA 3NBPA 3DLKA 4QWAA 4QW9A 4NM2A 5HHHA 3PV8A 2BHNA 1TVRA 2RF2A 1ZQQA 4Q44A 4BXOA 3AVAA 2XC9A 4RQ7A 2HW3A 1CEZA 1CUKA 3C95A 4CHPA 3LPTA 1T05A 3V9XA 4IRCA 1TV6A 4H4OA 3IHQB 4F4YA 2ASDA 4K8ZA 1UA1A 4I2QA 3RH6A 3TFSA 2X74A 2P66A 4CF2A 3RJKA 4DTRA 1RYRA 3F9KA 1Z00B 3CFRA 3KK2A 3SI6A 3NGYA 3NHGA 2GBZA 3AU6A 5F9NA 3NDKA 3RJJA 3DLRA 4FLVA 3VA0A 3QNOA 4MFBA 5KFBA 4EYIB 3QEVA 5CZ1A 5J0QA 4DQQA 3VQAA 3C6UA 4J9KA 4QOZB 3ZCMA 1KVBA 1SV5A 2AGPA 4Z6DA 3K4GA 4RW8A 4HHTA 5BOLA 9ICAA 1TV9A 4O5EA 3OYKA 3AVKA 1TFRA 4ZTJA 5IIJA 1ZQRA 3MXJA 4RNMA 4TURA 2AGQA 1GOAA 4B8AB 1RBUA 4ELUA 2ISOA 2O4GA 2W8KA 2KZ3A 3LZIA 3PY8A 3S3NA 7ICFA 5DLFA 1FKPA 3RBDA 4RW6A 2ASLA 2B4JA 4F3TA 2HB5A 3OVNA 4M3WA 3CM5A 3RH5A 1Y88A 4F8RA 1S0MA 3ZDEA 3TQ1A 2FPLA 3K5NA 1D8LA 1QLNA 5TZVA 1XSLA 1JLBA 4ECTA 3DMJA 3E2EA 4CK2A 4YMNA 4F5NA 3C5FA 1NK9A 4UBBA 4CJUA 4OPJA 3GV5B 3V4IA 5IIIA 4UB2A 1C0TA 3AA4A 4NCGA 2F1JA 3P5JA 1BPXA 8ICCA 2PY5A 4RT2A 4F4WA 1WSIA 5J2AA 4UAWA 3RMDA 1WSGA 4BWJA 1JLQA 1LWCA 3ZSXA 4CFDA 2HHTA 1WAJA 9ICXA 1TL1A 4OGEA 1CLQA 4OVLA 3K59A 7ICLA 4YR0A 1RT6A 3P83D 4I2BA 2XRIA 4L8RB 2B5JA 3JPSA 4IFYA 1S6PA 3RAXA 4Z6CA 5KG2A 4RUAA 5DDMA 4F4XA 1JXBA 4LY7A 1ZQKA 5HP1A 4F2SA 5DB6A 2E4LA 4QZIA 3C23A 2ZUCA 3MABA 3NF6A 2QKKA 3JYTA 4LSLA 5KGXA 1ZQBA 4FXDA 4DU3A 4O3RA 4CF8A 4KHSA 5KFUA 3TAGA 3L2RA 4EYHB 4KB0A 3ISBA 2BCQA 4BDPA 4E7LA 3KIOA 1LAVA 3KLGA 1NOMA 7ICMA 4FK2A 4F4ZA 4DTUA 5FRMA 5CJ7A 3H8SA 4R66A 4MFFA 4QZEA 2W9CB 4CJ4A 1I39A 5CWRA 1NJWA 1BCMA 4F4KA 1IKXA 1ZQLA 3DOLA 7ICSA 3AVHA 3L2UA 2C2DA 3GIIA 4K4IA 3QEBZ 3HYFA 3K5OA 1NJZA 1TK8A 3C1YA 2OPSA 4P4OA 2ISPA 1BI4B 3DLBA 3H4DA 3NE6A 3WNHA 4N47A 5KFYA 1HUZA 4NYFA 2BR0A 3VQ6A 3B0YA 2MUTB 3H40A 3TWHA 1SKWA 1KFDA 4Z4FA 4E7KA 5J2IA 7ICEA 1KDHA 2M9NA 4RQ6A 4NYNA 4O0IA 4O0JA 2YNIA 3BQTA 5DB9A 1NK7A 8ICMA 2F96A 5J0OA 3RRGA 3HJFA 1MU2A 2HNZA 2OPRA 4BE1A 4ECVA 1DTQA 1VSHA 1FKOA 1N56A 3AO1A 4W5NA 3NF9A 3UXOA 1BI4A 4FJJA 3H08A 2B21A 8ICYA 1ZJMA 1X1PA 5DKWA 9ICIA 1D9FA 3V9ZA 5KT3A 3ZT2A 1N6QA 1RDCA 3HVRA 1LWFA 1HYVA 2PZSA 3ZSOA 1N5YA 5KFXA 1N48A 3ZDDA 3C5GA 2JEGA 3HPGA 3V6KA 2UVVA 4E89A 4AHRA 4CERA 5CP2A 4C8NA 2NRXA 1EX4A 4DSFA 4O5KA 3DI6A 4YFKA 3TAFA 3KTQA 4KHYA 1V9PA 1RYSA 1ITGA 3N97B 3AA3A 3UQ0A 2FC0A 5CYQA 4IBNA 3RB0A 4QCLA 2W9BA 3HO1A 9ICSA 4DQRA 5J2KA 1RXVA 4I2CA 3H8JA 1J53A 2EHGA 4KLMA 3OHBA 3OYLA 4DSJA 3V7JA 3ETLA 4FZZA 2AU0A 2UVRA 3HP9A 4Q43A 3AU2A 1ZQVA 4YR3A 4DTPA 4X5VA 3AVFA 5KFEA 3MDCA 3TFRA 1U04A 1UT5A 3TR8A 1U49A 1T7PA 1HNIA 5DBCA 4J9MA 3JPOA 3VQEA 4PHDA 1VSMA 3V7KA 2HVHA 4ECWA 9ICMA 5SZTA 1DTTA 3M9OB 4CEZA 2IS3A 4YCXA 4HTUA 7ICIA 3V81A 5KG6A 1K1SA 4O3QA 4M3YA 3ZDAA 5CB1A 3S3MA 2YNFA 2I9GA 3ZDBA 3RMBA 5DBAA 1KFSA 5KT2A 4M41A 4ED2A 1FXXA 4I2IA 3JPTA 3G6YA 5DB7A 2BQRA 4EZ9A 4KTQA 4YXJA 3BQ1A 1ZBHA 1BL3A 4CK3A 4CFBA 5J2QA 4DF8A 4KHWA 4B9MA 3VQCA 4FK4A 4M3TA 2FLLA 4KLSA 4FZXC 1Z00A 3HSTB 4R5PA 4IDKA 2ZJ5A 2HHUA 3O4NA 4DTOA 3ZSZA 7ICJA 4I7FA 9ICVA 1QTMA 1S9EA 5DGAA 3C21A 4F91B 1DOQA 3KLEA 4YG2A 8ICJA 3U3YA 3F73A 2AGOA 2F8TA 5CA7A 3WNFA 5D3GA 3PW7A 2QXFA 2ZE2A 4BACA 4JUZA 1X9MA 3NTUA 5KFPA 5SWMA 2WOMA 5DG7A 4R65A 2VA8A 4DOCA 1RDDA 3HW8A 2IBKA 3C1ZA 4DL3A 1D5AA 5J2HA 4RT3A 2YHBA 3QEIA 3ASMA 4MEXA 4H4MA 4UB5A 2Z1GA 5D4BA 3QIPA 3T5KA 5J0SA 4F5RA 3MEEA 2I1QA 3NH0A 1Q9XA 4CCHA 4C8OA 4W5TA 4FLXA 4OLBA 1K6YA 3QINA 1HQEA 9ICQA 4RPZA 4FJXA 2Z1JA 4F50A 8ICNA 3KHRA 1ZQEA 3T19A 4N41A 3HP6A 1Z25A 1SL0A 2JEJA 4E0DA 4E19A 5C42A 4GXIA 1QQCA 1SUQA 4DS4A 1ZQCA 4TUPA 3MR6A 1GOCA 3TARA 3OYMA 3FDSA 2BPFA 1IKWA 2KQ2A 4O44A 3LALA 2ATQA 5HRNA 1EXNA 4GLXA 4OKKA 4CIFA 4QZDA 2VG7A 4ED8A 2PI5A 4B9VA 1XHXA 4RW9A 1S0NA 3MXIA 1S1UA 2NRTA 3AO2A 9ICRA 4GC6A 5J0UA 1EETA 4QZCA 5KFJA 3V6DA 4PGYA 4DF4A 3GDXA 3IRXA 4C8KA 3K58A 3DOKA 4GXJA 4B9SA 5J2PA 3AV9A 2DFHA 1ZQXA 3RB4A 3ISDA 4DWIA 2HHSA 2VANA 3K5LA 4UB4A 9ICCA 4O5BA 4G3IA 2W9CA 8ICVA 5J0RA 2VWKA 2JEIA 2KFZA 1U45A 3OYDA 1JL1A 4OKJA 1JLCA 4RNOA 1MSWD 2D0AA 3RAQA 1RBTA 3ULDA 5J0XA 4FJHA 2X6NA 2G8IA 4CFCA 4DQIA 5KFCA 1KLMA 4KAZA 2NRWA 2BE2A 2ZQBA 3Q8QB 4Q8EA 3AVJA 5IIKA 1NJYA 3CM6A 4DSEA 2C22A 1NJXA 4FM2A 3NF8A 5DQGA 1ZBLA 3G10A 3O3GA 1ZQPA 1W9HA 3L3VA 3TAMA 4B08A 1DLOA 4UAZA 1S97A 1T8EA 4BDYA 1TKDA 4IR9A 3D0PA 4EP4A 3KHGA 3OYCA 4CEAA 4M0AA 2G8VA 4CE9A 3AO5A 5J2NA 3CG7A 4PA1A 4YD2A 4DTJA 4PY5A 3OY9A 1FK9A 3SPZA 3GQCA 1TKXA 4M9LA 1J9AA 3G0ZA 4DTMA 5C24A 1S0OA 4J2BA 4F5PA 2AQ4A 3VQ7A 1YVUA 1XHZA 2V4RA 2HHXA 4B9LA 3CFOA 4Z6FA 4EBEA 1RNHA 3QEWA 4EBCA 4JV1A 2IOCA 4FJ8A 3GIMA 3HPOA 3MDAA 4GC7A 4XA5A 5KFNA 2J6SA 3S9HA 4B8CA 3EPGA 8ICPA 1S76D 4F2RA 4CEDA 1UAXA 4PHEA 5KFLA 4RW4A 4AHTA 1JXLA 2PI4A 1WLJA 2AQ0A 1BPEA 5J2JA 2Z1HA 3RMAA 2IHNA 4GXKA 1HNVA 5DG8A 5KG4A 4I29A 3V1OA 1YT3A 3JPQA 1ASVA 4IFVA 1BGXT 5EOZA 3WNEA 2PYJA 4I2DA 1D9DA 3PW0A 4B3OA 2OPQA 5J2CA 4M6WB 4QZGA 4XQ8A 3RR8A 1RBSA 4ECSA 5DK5A 4IG3A 4Z4HA 1TAQA 4TQRA 3OJSA 1GOBA 3QEAZ 3MFHA 5KG3A 5JS2A 4KO0A 2D0CA 2PFPA 2VG6A 3QNNA 4OPKA 2P5GA 2W9AA 5KRSA 2I5JA 1VSJA 9ICUA 4IKFA 3LWMA 1JLGA 3HM9A 1VSDA 4NCBA 5KFIA 4FBUA 2NRZA 3A2FA 3DM2A 4TSXA 3ZT1A 2GUIA 3TABA 1WSHA 5DQIA 4KB1A 1XS9D 4CJSA 2IDOA 7ICRA 7ICHA 1BVSA 4I2JA 1QHTA 2LSNA 4B9NA 2E6LA 4HUGA 3GFKB 2ZTCA 2W9MA 4GW6A 4RU9A 3QEPA 1BQMA 1JXEA 4ELVA 5KFMA 3ZT0A 5KFZA 2XY6A 2C28A 4QZAA 5KFTA 4BXOB 4I28A 1WSEA 4CIGA 3TAPA 3PX6A 3QE9Y 1BISA 4ZTFA 4PPXA 3PUFA 4DFMA 4RG8A 5J2BA 1YTAA 3SNNA 1ZYQA 3I8DA 3UXNA 5HRPA 4ED0A 3PX4A 4KLLA 5HBMA 4FYDA 5E41A 3C94A 4JV2A 2PXIA 4CECA 4JK1A 4M3UA 1C1AA 1ZQIA 3LAKA 1C0UA 4P2HA 4FW2A 1ZQYA 3PNCA 1RBVA 3D45A 1RXWA 2XCPA 4FLTA 1ZJNA 1C0MA 4LH4A 3AVIA 3CFPA 4QWBA 3C6TA 4J9PA 1IKYA 3OYBA 1RT7A 4YFUA 3SZ2A 2ZUBA 5J0TA 3JPRA 8ICGA 4CHYA 1T3NA 1CXUA 4PHAA 8ICFA 2ASJA 1HJRA 4I2FA 4P4PA 3LK9A 1ZQGA 5DG9A 1IO2A 5HP4A 3AVBA 4CEFA 5KFQA 4DL7A 3BQ0A 2D5RA 4MF8A 2DFFA 5KFSA 1SL2A 3GV8B 2P6UA 1BQNA 3U6FA 2A1JB 5KFVA 4RQ1A 9ICEA 8ICSA 1ZQWA 5KFGA 3SUOA 3C2KA 4KREA 1T4GA 4J9QA 1ASWA 3NGIA 3V9WA 8ICWA 3JPPA 3TANA 3KLFA 5J0YA 1BCOA 2KZMA 1EP4A 2J6TA 2XHBA 1KCFA 2OWOA 3SQ1A 2BGWA 4YD1A 1ZQMA 7ICKA 5F9LA 5DLGA 3MR3A 4ECZA 3HVTA 4LD0A 4FW1A 5KT7A 1WCLA 1IXRA 2XCAA 2IHMA 4AH9A 3RMCA 3KD5E 1KEJA 1QSSA 3ZT4A 4NXZA 4YR2A 2A1RA 4DOBA 1HJPA 3SPYA 4HYKA 3VQ5A 4JS4A 4PGQA 3SV3A 4F5QA 4KLEA 3AVCA 1QSYA 3PMLA 4NLZA 2KFNA 4ID1A 3HL8A 4JWNA 5KFWA 4J9LA 2X78A 2XY7A 4F93B 4M2YA 1CXQA 2IGIA 4KKOA 2B6AA 4CGGA 2WTFA 7ICOA 3PVXA 4QAGA 4W5RA 4CJFA 1ZQHA 2JGUA 4LVSA 3V9SA 3MEDA 2ZD1A 2QKBA 3OJUA 2Z1IA 1S6QA 4DOAA 8ICBA 4PHPA 3EW9A 5KT4A 3MR2A 4E7JA 4FLYA 4DTNA 4DL4A 4MFCA 4AHVA 4ECXA 1ASUA 5DBBA 4FS2A 3IS9A 5HHIA
chains in the Genus database with same CATH superfamily
3TO8A 3N4WA 1X40A 4KHQA 4R79A 3OYGA 4DV5K 3RJFA 3GFHA 5KFAA 1JN3A 2K4PA 2V63A 2HOIA 4USVA 2M9KA 2J0WA 3SEOA 3HM8A 4XAKA 2HQDA 4DLEA 5AZJB 2BQUA 3GIRA 2N7YA 4MF2A 4KE5A 2VA3A 1EKEA 2ZVSA 4KLTA 5EX0A 1S1UB 3U1LA 4FF1A 3F2BA 5AE2A 1RCHA 2WK4A 1R0BG 4CWBA 3GB0A 1S1VA 1N32F 3NCPA 3QBCA 1RAAB 3BO2A 1RAJA 1S5JA 1PC4A 1NGGA 5CZ2A 3ONQA 4CGHA 3A3NB 2MLYA 4C9DA 3TACB 3QT7A 3RBZA 3CMAN 1BIZA 1XC3A 1S9FA 1X5SA 2W8LA 4Y2XA 4LMZA 3AVGA 2XMJA 2P5VA 3O9QA 3UB5A 4JI8F 4MIAA 3ZSVA 2DD8S 4DPOA 4HCCA 2DGVA 2N1RA 2PN6A 1NMNA 3UKRB 1RTDA 1P27B 5EE0A 9ICBA 3KZIU 4J2DA 4J90A 2KVCA 1GX6A 4CJ5A 2WB1C 1TFWA 1N32K 1O03A 1NK6A 1S1XB 3U9DA 2YTUA 3MOZA 1VQ4S 4M5MA 2O6KA 3C29A 2ZIWA 1KAYA 3UDEA 2O8CA 2R7OA 1I51B 4CTAB 3JSMA 4GFJA 4EUVA 3LDQA 2PEBA 3OL9A 3UM9A 1ZXOA 4W5QA 1RQ0A 3Q2SC 3M2RA 4KLUA 4KH0B 4IKAA 4QZVB 4K4TA 1Z26A 1HNVB 4LJXA 2I9SA 3OTBA 5D0EA 4QS8A 1UFLA 1G15A 1G4CA 3H8WA 1EHWA 1SJQA 2YX6A 3BGRB 5AQSA 4I2PB 3WBZA 4RPYA 4N76A 3NRWA 4OIXA 3M8PA 5AI0A 2K4HA 2BGGA 2R8KA 4WU2A 3CXCM 3OSPA 3K5PA 2R2SA 1RAFB 1RG6A 3NAIA 5D4NA 5KG1A 3C65A 2VJ4A 1CZ9A 3DLKB 1OKJA 3QIOA 4RNHA 4ZH4A 2DL0A 1WG4A 2KNJA 1IN0A 4YB5A 2HVIA 2G1DA 3ZD8A 2U1AA 3I9ZA 1JIHA 4N5SA 2HBQB 3BYPA 3VQQA 5DS7A 3SMZA 3FZBA 2ATLA 3MMBB 1FD2A 2B9XA 1R0AB 4LSNB 1A5VA 3DXMB 1LWXA 3A0IX 3DXSX 2WVEA 4DPXA 5BRHA 1URRA 3ULHA 4DV2K 2YMLA 3D3BJ 1WF0A 1WKKA 2Q43A 2MAXA 5ELZA 1TKZA 5ALQA 2ZEJA 2W42A 4NI2B 2FE9A 2FVQA 4I64A 5HR7A 2VGNA 4P6QA 3FUYA 2GZOA 5KGWA 4UBCA 3P1GA 2QLWA 3OVBA 1VQ5N 4M42A 4ZVUB 2E1AA 3JXOA 2PFDA 3ZSQA 3UPQA 4DCJB 1F9EB 4H0YB 2ZXHA 4CHQA 4GVMA 3HXMA 4C80A 2VIHA 4LH5A 4RWTA 4KPYA 4K41A 3VC8A 1UL3A 3RR7A 4C4RA 4FZNA 3SUNA 2HBKA 1BPYA 4AM6A 5DM7L 1KC8T 3ATUA 3IP0A 3QFHA 1S8OA 2G5IB 1VQKN 4HH0A 4RQ3A 2BEFA 2V50A 4IG0A 1OH6A 4DQSA 2MLXA 2ZIWB 3OVAA 1D1UA 4NCGB 2P1JA 1UFWA 2WAQD 4JKBA 3F41A 1UZDA 3D3CJ 4OI6A 5E5NA 3VA3A 4QS7A 2XGQA 3T5HA 1TTHB 5J2MA 4K42A 2V4QA 4FJ9A 1YBTA 4FWSA 3QZ7A 3A3OB 2KHOA 3THTA 2AA4A 4M8LA 2HZCA 5FJ4A 2O67A 3B6PA 4EELA 2A41A 2FF6A 1YI2S 2R7YA 1U9LA 4XTTA 2KKPA 2J6UA 4OJRA 4FZYA 4CRXA 2AXTU 4YVZA 4C98A 1V97A 1Y10A 4FOIA 1LKZA 4YUDA 4I4BA 4FK0A 2QARB 3D6RA 1KN5A 3FYHA 3SK3A 4M5KA 3RW7A 4BR7A 4CO0A 1HI0P 2JV3A 1HMVA 5L9NA 3I0SB 5AQOA 2W6LA 2MDAA 4Y2UA 5DQHA 4UW2A 3I0SA 4HVJA 4W92B 1KAZA 4FWNA 1VRUA 1J54A 2CNKB 4R64A 2CH5A 4PL8A 4PG5A 1GNKA 2CZ9A 5C25A 4K0KF 1JK9B 2LXFA 2CXEA 2HQCA 5L1MA 2YTCA 2FJ6A 4DU7A 3EN9A 3OTDA 2FY1A 3K7RA 4QIVA 4OHVA 2K1RA 4CF5A 1V3SA 3EM1A 4ECRA 4ED6A 3CJ3A 3HD1A 3P49B 1ZOLA 1N5TA 3QRRA 2P9UA 2IPOB 3P39A 4LR9A 3SAFA 2UP1A 4NX9A 2J0XA 3H7IA 2ETJA 4Z4CA 1RT1A 1Q3UA 1L3TA 4PXCA 2W4PA 3FEZA 4X66J 4Y2SA 2APOA 1AFJA 4OZNA 1ZETA 2YHAA 1B99A 1WWVA 2EVZA 2JWLA 3ILOA 5A8WB 2YKOA 4C4TA 3TP2A 3CDWA 3M8SA 4ZJQA 3L2WA 4CJKA 1B9FA 3MCSA 5EWFA 4O23A 4PGXA 1GQEA 1XO1A 1GK8A 5C7PA 5AJ3F 4Y1CA 4KRFA 1X66A 3IMXA 2HDOA 4PZNA 4YQWA 2J76E 3NH1A 1JLGB 2CDQA 4X4TA 1YQHA 5KAKA 3VQPA 4OHYA 3LWLA 4QPXA 3E01B 1IG6A 2BANB 4BE2A 4RWWA 4ZDNA 1TAUA 4TQSA 2Z30B 2HVZA 1O5JA 2UUBF 3C66A 4BR0A 3ZI4A 4I2AA 1HYSA 4OI2A 4CLLA 3VAMA 5A6WA 3M8WA 2MSTA 3R27A 2GIRA 2GMLA 3CIPA 4CZIA 4JI2K 2DNQA 2WF6A 4AHUA 3MMVA 2HBJA 1S9EB 1S1TB 3H46O 2P9UB 2F3NA 3CD5A 4V19X 2YNHA 4WP3A 1JCEA 4LIWA 1VS3A 2YN4A 1SL1A 1FFUA 3TU5A 3E66A 4I1TA 1NDCA 2G07A 3SBMA 4I0WA 4LF5F 1YAGA 2K8GA 1J5OA 2Q6BA 3IDWA 2KO1A 3IAYA 3GE1A 4WU3A 2GAGC 4GVBB 4DFDA 5F3TA 4HAIA 4JV5J 3VGSA 1LB2B 3ZTPA 1F5CA 3ZSRA 5A8KA 5HLFB 4MFBB 4OKEA 1D8YA 3THVA 5J1PA 4NM1A 1UJ5A 4MKYA 1VK0A 2K89A 2FHOB 1JJCB 1HYZA 4M45A 4NLVA 5KI6A 2K3KA 1JROA 2EEYA 1C1BA 4WFBQ 2KTQA 1ZZFA 1F5AA 2IVOA 4EP5A 1IR0A 4PYDA 1BIUA 2HVEA 3DDIA 3HHNB 3M1VA 4CBXA 3GV7B 4PWDA 1QVGR 1S77D 4H4OB 2E5LF 2GQQA 3MURP 4ZIVA 2V4JA 1XR5A 4DQPA 2CQHA 1TKTA 3I55N 5J1EA 1U1NA 4Y2MA 3WZ0A 1ILYA 3HHDA 1YRUA 2R8HA 4KFBA 3AQFA 1HLUA 2YX4A 3W3DA 3PW2A 3EZ5A 2CVEA 1XSNA 4O3OA 1ZZNA 2QK9A 1QQMA 4DUZK 1KVKA 2YNFB 2DNRA 3O6QA 3W65A 1Q86T 3CC2S 3THXA 4C4SA 4UOHA 1WDTA 1LW2A 3RJGA 3PG9A 1SC3B 1W2BM 4P2FA 2NUBA 1IQTA 1K44A 4BGDA 1QHAA 3MWPA 1Q95G 3C16A 3P96A 1SKRA 3F53A 3CNQP 3ENWA 1HKCA 2RPIA 2J7UA 4QJFB 3KKRA 1FD8A 4LFBJ 4Y2IA 3ULEA 2B56A 2ZD1B 3WXIA 4HTJA 2IJNA 3EPIA 5ETQA 5IWAF 1VJQA 2DK2A 3V72A 5J1EB 2H3VA 2DNLA 4FBTA 3ZD9A 1D3WA 2OMOA 5JVHQ 2BQ3A 3IWNC 5GMEA 2RS8A 2Z8QA 5JUMA 5HP1B 4KB7A 2RT3A 4DX6A 4EO8A 2CJBA 3T5JA 3NASA 3IR7B 5JRTA 4F3OA 4XEIA 2E6MA 3A0BU 4U8YA 3CEDA 2DFEA 3DLLQ 1VCTA 3F56A 1H7WA 2BKNA 3I0RB 1X2IA 2H3GX 1ZPVA 2VG5A 4KC5A 4LSNA 1PO6A 7ICPA 2KN7A 2HAIA 5K8MA 1RACB 5J2EA 2RLTA 2EFGA 2ZH5A 3EE9A 2GO8A 4QR1A 1K8AT 4YMOA 4LJMA 2RH3A 1AB8A 1NI3A 2YKNA 4YDDB 3RJHA 9ATCB 2JHEA 4X66K 4NYZA 5AIBA 1WG1A 4FVUA 3R5AA 4OLAA 3QT5A 2YKAA 5HJYA 4HHHA 2WSFC 5BPCA 7ICTA 3VF6A 4J2EA 3BBBA 2ZJ8A 4JV0A 3TJ8A 4OX8A 1O0PA 4OX6A 2UUBK 5D3GB 3BP8A 3C2LA 1X5TA 2HFZA 2E7XA 3MTKA 3V4MA 1U8SA 1VR6A 4MAKA 3IN5A 1ICEB 3I5BA 1KRPA 2QZ8A 4XRHA 4KI4A 3M9MB 3DLEA 5F8GA 4NXMF 1RE1B 4J9VA 3HLUA 3ET6A 3D7SB 2XWXA 5BJRA 4WKYA 2N7CA 2J9DA 2UU9K 2GV1A 1KN6A 2HYIB 4DR6F 3RBXA 1TYQB 4JLHA 1YBAA 4RW8B 1WJ9A 1Q7LB 2GVZB 1LK7A 4TYBA 7ICNA 3HT3A 1BPBA 1XC9A 3V7LA 1RWOB 3BS5A 1KC8O 3QJPA 4CLYA 1EQYA 3RB3A 5AKIA 3VV2B 4MEYA 3MM8A 1F6TA 3KLFB 3KK1A 2M8HA 5IT4A 1J5OB 5EY4A 3THWA 1AXQA 1HWKA 2RDIA 1RILA 3M32B 5HMWA 5D46A 1RI7A 2CIMA 3QGHA 3QGPA 2KI2A 1HBNA 3M2VA 4J7CA 2HNYB 3X3UA 3HZGA 5AM2A 4KV8A 4DL5A 2QG9B 2RHFA 4IUFA 1VSLA 3NS5A 2WZ1A 3IA0A 3BDEA 1GLAG 2FMQA 4ZPVR 4XPEA 4UB3A 2GH1A 4EU0A 2DFLA 2HHHJ 4HDHA 1T03A 2W43A 3OTQA 1U2VB 5EXWA 2EPIA 4YOEA 1WSJA 1VC0A 3VF0B 3I96A 4IR1A 4OJ5A 4BRDA 5J1NA 4UB6U 1QD1A 2DYAA 1U1QA 3IWXA 4ITSA 4NRUA 2PYLA 2JZ5A 3CJ4A 4Y1DA 1W0HA 4ZVFA 1N5SA 2IMWP 3CJCA 4A8XA 1OY6A 1SC6A 4BUGA 4AHSA 2FSKA 4H0TB 2R2TA 2YH1A 4JMUA 4YN4A 3TTFA 2HRYA 2EBEA 5KG0A 4E7IA 1D09B 1REGX 3MGIA 2MKKA 3Q22A 5A8RA 1S9GB 4KN7A 1J2VA 4JHDA 1N4LA 1WACA 2FDRA 5HN0A 3O3HA 1F9FA 2QFIA 2Q79A 4Z4EA 3BPDA 2H3FA 2E66A 4Y0WA 3D1OA 3M6GA 2O1PA 4QW9A 5LMUF 4ZA1A 4LRDA 5A2QU 5H9FK 4Z94A 4LFCJ 4I6MA 4TN2A 2G5HB 4CHPA 1I1GA 2E9RX 2B4UA 1N8RO 4ZP6A 3J8AA 3QFUA 4H4OA 2AJFE 6FD1A 4WYBA 4NLRA 3VTIA 3UD4P 2KB2A 3F9KA 2HFUA 1HJOA 1FX4A 2W2PP 4DN0A 2ILZA 3QFWA 3NGYA 3NHGA 3NDKA 4JI4F 3UR0A 4BR9A 2Z56B 4XK8C 2AYGA 5KFBA 3BF3A 4BRQA 3HZ6A 4EYIB 5CZ1A 1NHVA 1RDRA 3CDBA 2HWHA 2PDAA 4RU2A 4EIAA 4QOZB 4RLEA 1ZC6A 3MN5A 5BOLA 3CC4S 4O5EA 3R5BA 1H98A 1TFRA 2WB4A 4F0MA 1GO3F 2VL1A 3AMZA 1ZQRA 2HS4A 5AQIA 4RNMA 2DH7A 4PWUA 4YHHK 3G87A 1H3DA 1RK8A 3CF5L 2W8KA 2VFTA 5LOQA 4JI3J 1GT8A 4WWSA 1A6LA 5ALDA 3S8SA 4LF6J 3S3NA 2CRLA 5GTHU 1P8GA 3QJLA 3UN2A 2HB5A 4M3WA 3RH5A 2WBMA 1Y88A 1VLYA 3RSEB 2P9KB 3WKEA 3EVWA 4PZVA 1QLNA 3LH2S 3DMJA 1P1LA 3NBPB 4OPJA 4P0PB 3V4IA 3CQXA 5IIIA 4DPWA 1C0TA 4NCGA 2GJIA 1N60A 3P5JA 1BPXA 4DR4J 5FP0A 2QMUB 1R27B 3W9JA 4UASA 2P9EA 3W8GA 1RTIB 3NRBA 2VB6A 2OTJN 1JJ2M 1KR4A 1PJ5A 3VGMA 4UAWA 3RMDA 1WSGA 1ITPA 4CFDA 5ADXA 2HHTA 3PKYA 3MM5B 1CLQA 2KVQE 1YSJA 4LF5J 4I2BA 4GY2B 2QL5B 4L8RB 3JPSA 5LSLA 4U7UK 1TL5A 4RUAA 3DAWA 4RW9B 1MW7A 2VQEK 4C7ZA 2F7TA 5HP1A 3PEHA 4F2SA 4OJOA 4GKKF 2DGUA 4NXNJ 3MABA 3NF6A 1R43A 1FA0A 3JYTA 2CGJA 2Z4PA 4LSLA 4DU3A 5K20B 1FF2A 4KHSA 2VODA 1RHJB 1UHUA 2D0PA 3TAGA 3L2RA 3IGVA 3M30B 3SAHA 2UUCJ 1LAVA 3GJQB 3TZXA 3O9SA 2FQQB 1L6NA 3T1YJ 2W6KA 1WG5A 4MFFA 2OPSB 1O8BA 3MM8B 2C42A 3DOLA 4USKA 3H0LB 1IKXA 2O8EA 3QATA 3AVHA 4C7QA 3RFAA 2MJUA 3LW5C 2OD6A 4LBPA 1FWLA 4IJAA 2P9PA 3ZEUB 2F65A 4KFBB 1OPZA 3C1YA 1S1WB 3AQOA 3P5TL 3MM7B 3NE6A 3WNHA 2DT9A 4F36A 5KOWA 2W01A 5AQUA 2BYCA 1SKWA 2MY8A 2YWEA 3M6VA 3PCOB 4IH7A 1YJNN 1T0TV 1S72S 1X0PA 4RQ6A 3KLEB 1YITN 3MPUB 3NS6A 4USJC 3BQTA 4AF1A 2ZKUA 4US8A 3VENA 4FDFA 2MY7A 1P1TA 3WKDA 4A8KA 2W55A 3HJFA 2JFDA 2HNZA 2JFKA 3GP9A 3JYTB 2OPRA 1VBKA 3VEOA 2ROGA 3AD9C 2DR6A 3D67A 3PIOQ 5E3PA 1X1PA 9ICIA 4CYUA 3V9ZA 5KT3A 3MCAB 4P52A 1A9NB 2KU7A 3ZZUA 2ZOFA 1KKHA 3DRRB 2MJNA 3GFXA 5GAEP 1N48A 2ZH8A 3TA1A 3GL1A 3V6KA 1VJ5A 3AEVA 5AFUH 2QFJA 4CIOA 2DNHA 3DI6A 2UXDJ 2KHQA 2ROEA 3TAFA 3KTQA 1AQ6A 3DDHA 4I67A 1ITGA 3N97B 4JKEA 4JKDA 9ICSA 2HPUA 5J2KA 5ETMA 4CO1A 3NOCA 1YZ7A 3E8OA 4KLMA 4BRFA 3V7JA 3R5GA 3ETLA 1GLBG 2KT3A 1FWPA 4JI7J 5BN8A 4CD3A 4XDCA 4JEPA 4X5VA 4DR4K 3AVFA 5KFEA 3QSIA 3A8IA 3G6EN 2JNJA 1NGJA 1YRXA 4D3HA 1HNIA 1UWBB 3TUPA 4M5HA 1PYSB 5BR8F 2V94A 1SS6A 1VSMA 1DTTA 1KONA 4ZCLA 3M9OB 5IWAJ 1NSKL 2KH9A 1X6IA 4G9ZA 2YNGB 4FOEA 4JI3K 2XLJA 3WEEA 1WHWA 3H98A 3KD3A 4JI5F 5F41A 3NCQA 2ZJQL 3S3MA 3CD6S 1FXXA 4I2IA 2B4OA 3ZLJA 4Y2CA 4JV5K 4QJVA 3MK6A 1UZHA 2LQBA 2LU2A 1JJ4A 4KTQA 1RT4B 2FPHX 3BQ1A 2KJ5A 2GNKA 1HNZF 2K8BB 4ZP9A 4B9MA 1TUVA 2V4JB 4DZDA 1LCUA 1Z00A 1G99A 4R5PA 3EEQA 5A2QY 4CF3A 2ZJ5A 3I8BA 2HHUA 4DR5K 4DTOA 3FLCO 1HBOB 3HOTA 4OV1A 4RW4B 4F91B 4JKGB 4YG2A 2PD1A 8ICJA 2OIHA 3F73A 2F8TA 5CA7A 2L48A 3WNFA 2ZE2A 4NMLA 2QXFA 2M88A 4JUZA 3MWTA 3NTUA 5SWMA 2HFNA 4HWIA 2W04A 3NVZA 4WFNL 4JBCA 2OEHA 3IXQA 1RDDA 4Q2MA 1N34J 2IBKA 5BPMA 2OEKA 2OMLA 3ZNUA 4QR0A 3I56S 3VCDA 4ER8A 2DITA 3T7ZA 2WF7A 4IH5A 2DGXA 3IM8A 3QEIA 4BX9C 2O8EB 2I1QA 1G6BA 1VRTB 4C8OA 4JD2B 4FLXA 1D4XA 4MK8A 4QS9A 1K6YA 3MMCB 1HQEA 2VG5B 4JV5F 4RPZA 5AQFA 5L8RC 3BM7A 2F3JA 4N41A 3HP6A 2H3IA 4WQ4C 2JEJA 1Q78A 1SUQA 3WX8A 2ACYA 3P31A 2JX2A 3TARA 5TISU 4TXSA 1HWJA 1X3MA 4IO9L 1KQKA 5HRNA 1X4EA 4FF3A 1PCAA 3CJ1A 4RW9A 4JI0F 1EJ7L 1X31C 5F8IA 2B9EA 2IDLA 3VVTA 4FN5A 1Q18A 3V6DA 5KQDA 4HDGA 3UE2A 3BF1A 1RAGB 1FRKA 4OJLA 1G2EA 4C8KA 3K58A 5F8HA 1FHTA 4GXJA 2QB0A 1KQFB 3RB4A 3TSUA 2DEIA 3DM2B 3W5YA 1T11A 4G3IA 4UOFA 3V81B 2XMKA 4DCOB 5J0RA 3BSAA 2JEIA 4PXDA 5K4LA 2FXUA 3NVMA 4J91A 1N88A 1T9UA 4KO0B 1JL1A 4RNOA 3VEYA 3B8HA 1RBTA 1N6QB 1GMVA 5HK4A 2V7ZA 3BEXA 2ZIVA 2DHAA 5HJXA 2ZQBA 3Q8QB 5FPEA 4Q8EA 4YOWA 3AVJA 1NJYA 3WK9A 3BN4A 3VAKA 3CM6A 2VG7B 2VPYB 2GC8A 1WF2A 3IDHA 2W2NP 4PR6A 1NU4A 2OH2A 2QMXA 1IIPA 1ATRA 4BRKA 1W9HA 4NL9A 2HI0A 3W2WB 2ZWPA 2YB1A 1S97A 1Q4RA 2ASYA 1TKDA 1S6PB 2BVZA 1NNLA 2GO7A 2CGLA 3D0PA 2JRZA 4XO0A 3HKZC 3H3OB 2L9WA 4FWLA 2CPRA 4M0AA 4DV0K 3AO5A 5GIOA 2FB0A 3TUZC 2OJ3A 3F2CA 4PA1A 4YD2A 1CPZA 1X7VA 3OY9A 1FK9A 1RYUA 3CIMA 1RBAA 2BM0A 3K8WA 3ZEUA 4DTMA 3EZUA 3FCVA 1MN7A 1KKXA 4ZMMA 2Q36A 2GO9A 4BROA 3VQ7A 1YVUA 3OTOK 1NWKA 1FX2A 4JI0K 1RNHA 3M7VA 1OVQA 4BRGA 4QPTA 3UNGC 2GFFA 2MZSA 3UVJB 4DPTA 1T6DA 2IOCA 2BBEA 3TNVA 3MDAA 4XA5A 3TQEA 2CJ9A 1S76D 4F2RA 3MCMA 2I1RA 5KFLA 2ZJRL 3NMRA 5ALHA 1WLJA 2I7PA 3QYPA 1Q7YO 4GXKA 4Y2VA 4X4PA 3QQCD 4P71A 4I29A 1TV6B 1IV0A 1YT3A 2XHCA 4Y3CA 2W4DA 1BGXT 5AM4A 2DHHA 3WNEA 3PW0A 4LF6K 2QLFB 2OPQA 5FLXO 4C8ZA 3RR8A 5K14B 3SCLE 3TW0A 2UUCK 2Q2RA 4IFYB 2G1HA 4DV4K 1YJTA 4Z4HA 1TAQA 2D6FC 4JHDB 3LQVA 3MMAB 3MFHA 2K60A 3AOCA 2WAQF 2PFPA 3SQGA 1S7HA 4HHUA 3BS9A 2QL7B 2I5JA 3LWMA 3WKCA 4N77A 4F02A 4DMZA 3ZT1A 1NMEB 1ZPWX 4A59A 4RR5A 1JJ2R 3VMFB 3R2CJ 3GR0A 4TU8A 2QA1A 2WBNA 1ZTWA 1QHTA 5GADP 3BKFA 3VPZA 1C4CA 2E6LA 2DR5A 3MTJA 4A8FA 2CKWA 3LP2B 4LFCK 2KRRA 3TA2A 4RU9A 3GFZA 1MMDA 2RHQB 2HBRB 3QE9Y 1B0TA 2EI5A 4ZTFA 3AAQA 1X9XA 1DAXA 1WKJA 1YHQS 3PUFA 5ETLA 1WC4A 1F9HA 1SGGA 4MYTA 2D0OA 5HRPA 4ED0A 3PX4A 4K7QA 3C2PA 1N61A 3MD3A 2LI6A 4JV2A 3MF5A 4CECA 4JK1A 4MO5A 2ZH2A 4P2HA 1N36F 1T02A 2W25A 3PNCA 3D45A 1RXWA 3MEEB 2XCPA 5D77A 3PJXA 4LH4A 5CD4H 2W40A 4QWBA 4DR2K 3DHWC 1IKYA 3WIUA 3EO3A 4G9BA 2VD3A 4F26A 4L76A 2WRMA 4CHYA 4IH6A 3CCZA 2HBYB 2XI9A 8ICFA 3UMBA 2UUWA 5F1XA 5C2GA 4NXNF 3ZX0A 4P2MA 3CMAS 2YQ1A 4LF7K 3HMJG 5KFQA 4FYWB 2B0GA 3NG8A 4NJ8A 2P9SB 3JQMA 2A1JB 4GKKJ 4RQ1A 1T05B 4Q2LA 1XO0A 4ZPAA 5KFGA 3QUQA 3H45C 3C2KA 3SSQA 1B7FA 2RJZA 1B64A 3O3LA 3NGIA 3V9WA 4FWQA 2P6TA 2JL9A 4MLEA 2G4BA 2Q1NA 2J6TA 1IKYB 3SQ1A 4RBTA 4JP8A 1ZQMA 5IWAK 3GCWP 2O8DA 4BREA 3MGJA 4YOYA 2WCXA 2JH1A 4KGKA 3UFCX 2M2BA 1FK9B 1WC6A 2ALYB 3W64A 2CNLB 5HL7L 3L5KA 2IIRA 1LK5A 3P8BB 2IRYA 4YHHJ 1YITS 3SPYA 4HYKA 3VQ5A 3S1TA 1OH8A 3SV3A 3S6EA 4NZ7A 1QSYA 4ERDA 2H3ZA 1AYEA 4JWNA 5KFWA 4I2QB 2HQGA 4ZKAA 2AJ4A 3SQIA 2PMZF 4M2YA 2O8FA 2AP6A 2VJVA 5HANA 3KNGA 3KNAA 3PVXA 4QAGA 3OTOJ 4WK3A 4NMXA 4CJFA 2B6AB 4DV1F 2XNRA 5F0XA 4ES2A 4IO1A 5U47A 3FZFA 4DOAA 3H42A 4AT1B 3HTVA 3MR2A 2E5JA 4DX8H 5M1KA 4E7JA 3CJ2A 4MFCA 4QIWC 1ELOA 4FS2A 2VZ9A 1HW9A 2JRSA 3H25A 3D2EA 3FFKB 3D0GE 2QB0B 1J2NA 3CJBA 4A8SA 2B6GA 2HGLA 4F04B 1B92A 4TVAB 5IZHA 4DKWA 2PFQA 5KRTA 3GJRB 3E9OA 1E6YB 2CQ2A 1YIJS 2ZM6K 8ICZA 1ZQUA 4M6WA 4KRWA 4K8XA 2FJEB 5KFHA 3JXUA 3O9RA 5D4OA 1NLVA 4MLHA 1S5LU 4PG7A 1Q16B 5HRRA 2KJWA 3S3OA 4QWEA 5H9EJ 5B8HA 1Z1ZA 2ZH7A 1ACMB 1WN7A 1QQ7A 1CJKA 2EX3A 2FVCA 2FMSA 2J9DE 1NGEA 1U48A 1XBWA 2BOAA 1YF5L 2BKEA 2ZJPL 2CRXA 3N28A 2V7YA 2Z58B 3J7Z5 2FSJA 1NDKA 4F3QA 1NOZA 3R7BB 2CPHA 2E5SA 5L1LA 3GIJA 3KKAC 3RBEA 4B3RF 3DYAA 2G8HA 4F25A 5FPDA 3UPFA 4QOTA 2QJ3A 2CH6A 3CMES 1JWWA 4ILRA 3R3LA 1Z4UA 3MCPA 3J7YP 2HWIA 2KT2A 2BE7D 2CJAA 3OD2A 2P5OA 4MIWA 2VWBA 3VQ4A 4DV1K 4K8RA 3MPWA 2HHVA 3L3CA 2A2CA 4KH6A 2UXCJ 2J9CA 3CCMN 1B22A 3UCGA 4KHMA 2GUPA 3EWAA 3IBPA 2ROPA 4IRDA 5HQLA 1HPZA 3RB6A 2C2EA 2D4WA 2PSZA 5HVHA 2CPXA 2IC3A 4DSIA 5JTIA 1HIYA 2D1KA 3M8QA 4DOZA 3UKUB 4Z7CA 1VISA 3PR5B 5HMMA 2ZGYA 1FFGB 5IIMA 4QW8A 4DXLA 2J4RA 2Y8YA 2BX6A 3O5BA 2OZSA 4L3QA 3M2RB 4UUWA 2JVOA 4B17A 3QAUA 1FJ7A 2E9TA 5DMRA 1SVDA 4LFAK 1B0PA 3SR6A 4I9QA 1S10A 4CHZA 2E8NA 8ICUA 5HMLA 3B6OA 3KJVA 2HMIA 2XHWA 4CJWA 2F8MA 4CK1A 4N7TA 3ZETA 4XUSA 4WXWA 3OTCA 5FDLA 3LP0A 4OYIA 3T1HJ 2ZNYA 8ATCB 1LW2B 3DGPA 1URNA 3PYEA 2L5YA 2GHPA 4DLGA 5J2PB 2JLGA 1EAYC 2WFBA 1X5PA 3IM9A 3Q8SB 3Q8LA 3H3NO 4JI4J 1CS4B 2QWPA 3BZQA 2MKIA 1JUDA 3TAMB 4BS2A 4URSA 2OA8A 1KEKA 2DO0A 1IWGA 1UJ4A 3K57A 2IJRA 1QS4A 1TKTB 1MMLA 2LEBA 1TUWA 2KEYA 5LXRA 4LF4F 3GWCA 1Q0NA 2P9NA 2NSCA 5KT5A 4LZGA 4RQ0A 1F44A 2DY9A 3T69A 2VF3A 3LZJA 1M5SA 4BDZA 4LF9K 3QFPA 1PBUA 2ZKTA 5IXUA 5CCMA 1Q8KA 1HNXJ 1TK5A 3MM6A 3TUIC 4KHPJ 2FF3B 3OS0A 1KVCA 3SQ4A 1F3VA 1REVA 2OHDA 4EGLA 2FBYA 3M8YA 2VASA 5T14A 1MC8A 1PBAA 3VHQA 4CJPA 1Z05A 4CHOA 1W2IA 4J9RA 7ICQA 3GYGA 3MAAA 2VG6B 2HMPA 1NLKL 3DJCA 4LZDA 4DR7K 3NCIA 3NNCA 4OI1A 4O4GA 1TQLA 3QT8A 3MUVP 4CYUB 3ID8A 4J5OA 9RUBA 3NGTA 4OZ3A 2OHFA 2QA4S 1CJVA 3D66A 3Q8RB 2ZNZA 4FKXA 4X65J 4QYZJ 4FWPA 2VFRA 4KAIA 2DIUA 2FJBB 1XNRF 4QZ8A 3TAQA 1MU2B 2IM0A 3L95X 3UO0A 4FJIA 1RPLA 5LL6Z 1ZBIA 2E1PA 5LT5A 2AJ1A 1UEUA 1YRTA 2N4DA 2EQYA 3ZZPA 3VAHA 4XDDA 1NUEA 3SQ2A 4DFPA 1RTHB 5ALUA 3U8XA 3EE8A 3CCEN 1KBRA 2Y1RI 3K89A 3ISCA 2GV9A 4EHUA 1EKSA 4I68A 3KDNA 3A5OC 1NGHA 3HSZA 3UI3A 3HVTB 3PW4A 1IQZA 5GIPA 1OSCA 2MYFA 4DSKA 2ZZNA 4CI0B 3FZLA 4NLXA 2IHR1 3O4QA 5J8YA 4CJRA 1TE2A 4DG1B 1WSVA 4RPFA 3CC7S 4KX5A 4O5CA 3KWIA 1S9GA 4KHUA 4UAYA 1ZD2P 3UDLA 3CETA 1SJRA 1U47A 3LDPA 3M9NB 4J9NA 2UV8G 5M1OA 3L7PA 1T9VA 3CJAA 2A10A 4DTSA 1GFWB 2Z7JA 3LP3A 4ID5A 3QXGA 5J2NB 3NH2A 1OY9A 4GRSA 1XU4A 3MWBA 2B7CB 2MPUA 4M5IA 2A1JA 1BE4A 4FVMA 3QUBA 1N2XA 4FJLA 3K9JA 5L1KA 2U2FA 2HEKA 2IVYA 2ILYA 2FJWA 3M8RA 3ILIA 3PRDA 4RZRA 1B4SA 2QE5A 1L7OA 4DR6K 3QU9A 5EE1A 2W03A 4DPYA 2AEFA 1GAOA 3BEGB 2ZZTA 1PILA 2PT0A 5D0GA 7ICVA 2F8SA 2QTDA 1Z6RA 2G08A 3CJ9A 3KHYA 4CJ3A 4CFAA 1N36K 4V1Ak 1CJUA 3E1YA 5KFDA 1NBWA 3HFVA 2OFGX 5J29A 2QLBB 3RJMB 3AL0B 3VESA 4FM1A 4DU1A 3AY0A 2C2RA 1NZAA 1A76A 2Q31A 1PYOB 3LUYA 5J8YC 4KHNA 4KLIA 3ZETB 2ZOMA 2CQDA 2MZ1A 4IO9Q 3DC2A 4CP5A 2C3YA 4NZ6A 2XI3A 3R9PA 3IAM9 2HMIB 2DRBA 2AEJA 2LM1A 2B51A 5HROA 2E1MC 3QNWB 4DV0F 2AWZA 3QUTA 1QDUB 4NOHA 1TYQA 2PFOA 2FPMA 4HUEA 1MLAA 1XMOF 2AX0A 3HHLC 3W1YC 2LECA 1UW9A 8ICQA 1B7YB 1ZBSA 4L3NA 5AQWA 1BY9A 4X4UA 4TLQA 2ZBPA 4I2PA 1NH7A 2P9SA 4FSVA 1FDBA 3ISNC 3CUNA 2NR0A 1HBUA 4Y00A 1CS4A 2BRKA 5E26A 4CGIA 3CIZA 3LDAA 1R0CB 3IG1A 4LUBA 2HFVA 3CO9A 3SYZA 4OGCA 2QWOA 2VDHA 1WNEA 5BOMA 2RQMA 2YBVA 1WHXA 4ZVTB 1SC1B 1R0AA 3E9LA 3BV8A 4R8UB 4U6PA 4UB1A 1T6CA 4JWMA 3JS9A 4K4UA 1N5YB 1IM4A 4JKFA 3KLHA 3M8ZA 3HPHA 4DG1A 2AYBA 1B9DA 5DM7Q 1RP5A 4RBVA 1RDAA 5AK4A 1CG2A 1D8BA 3UIQA 2GCFA 3JAMY 3CYMA 4OD0A 5G5GA 4CT9A 1BDGA 1WEXA 5DGBA 2FGOA 4DCCA 3Q83A 9ICTA 1R89A 1OXJA 1QQOA 2ZBRA 1CC8A 4I2EA 3LO3A 1YGYA 2LYHA 2H3EB 2L9DA 5KPTA 4TYAA 3CJTA 2LEPA 1YX2A 1S1TA 5E3CA 1DLOB 2BM1A 5LJ5Y 3CQYA 3K8VA 3CULA 1HD0A 1U1MA 4LSZB 4AL5A 4WJBA 4PUOB 1JL2A 4ED5A 1SIZA 1K8AO 1CZBA 1VYAA 3UQ2A 2IYGA 2DPNA 5AK3A 3B4MA 4X64F 2W9BB 3LAMA 2JXJA 3UCZP 4U7BA 2YKQA 3KMSA 2ZJPQ 4DR3F 2DNZA 4W5OA 1VDHA 3SEIA 2Y1IA 4FLWA 3AJ1A 2LQ9A 2P6RA 4CLTA 2EK6A 4ISEA 3I56N 4YMEA 5JS1A 3OL8A 3PW5A 2PA3A 2WUSA 4B1XB 4CZEA 1WB9A 3OYNA 2FBVA 3DYAB 3CXCR 5IC4B 1OYEA 2Z2LA 2AT1B 3T41A 1NPKA 1FDNA 3FQLA 4JI6K 3FCHA 3T9NA 2KK0A 3BF4A 5HBMB 1VSEA 4TUSA 2BZ2A 4OX9K 4A57A 1P7DA 2CWKA 3M30A 3QEXA 5LL6d 3D6JA 3J7AP 2NXNA 2V9WA 4M5DA 2F1IA 4FPRA 4D3GA 1DK3A 3GU3A 1F2GA 2KV2A 1Q86O 5CXTA 3QLHA 3F2DA 5DO2A 3S7RA 1RSCA 1HQ2A 1KXPA 4ILJA 2E7WA 1SV0A 4Y65A 2GJFA 4GO7X 4FWKA 4IQUA 1N33J 3MX5A 2R7RA 4ZVQB 4GMKA 2PC6A 1CZAN 4AM7A 2MB0B 1FESA 2HG4A 1YTUA 2QLTA 2VKZG 3F0NA 2CAJA 2QO3A 3VEXA 2QWLA 1JLEA 1VQ7N 1KTQA 3VQDA 3TA0A 3O2IA 1SB6A 1VLOA 2YB4A 3MD1A 4YNQA 4A8WA 3J80O 3FZMA 5K8OA 4H5WA 1FTCA 1IG9A 1NZBA 3P38A 3BS5B 2OSQA 4PPZA 3AAWB 1W2BR 2QLXA 3T1YK 1K5OA 3L9ZA 1XN9A 3V4IB 2K8AA 3OFFA 2YH0A 4GVBA 3B0XA 3MR5A 4M5GA 2F63A 9ICFA 4DMNA 1VIOA 2V2ZA 2NREA 4EEYA 3LVVA 3HZEA 1BU6O 1RABB 2W41A 4BGAA 5CY4A 3V9UA 1HL6A 1WC3A 4YN3B 4BJQA 2UXDK 4EBDA 5HMZA 5CHCB 2HMXA 2YV0X 4ZLJA 2XM3A 4OLOA 1SAZA 2VBYA 4GV9A 3SUQA 3H4BA 2W11A 3C2MA 4QQBA 3I28A 1NNDA 4LIRA 4PABA 4NY8A 2B9YA 3OLAA 4GMJB 1MDUB 1KQQA 3SFUA 4J9UE 4I6MB 2FZCB 2ITGA 3OLBA 2ERRA 3CHWA 3ZXWA 4UOCA 2YKPA 3GYNA 1VHXA 3RAMA 2H5IB 3NAEA 1Y64A 1Y3JA 2M70A 4KLJA 2RAQA 3BQ2A 2WVDA 3N5BA 3K0JA 9ICOA 3KK7A 1BD6A 8ICOA 4OYWA 1RWWB 1HNWJ 1TGOA 3EMTA 1WAFA 5I3UA 2NRVA 4B9TA 2BW2A 3O8WA 4F92B 4NO7A 3CC4N 2JZBB 4CGJA 3RU0A 1JLEB 1HFEL 4L75A 2YWFA 3GZ7A 3I0RA 3D2SA 1C4AA 1MQ3A 1VBYA 1U09A 2PGCA 2WTUA 4KBOA 1FFWB 2IRUA 2P51A 4XH4A 3U1NA 5J0PA 3Q8YA 4USWA 1VSIA 2KSOB 4QYZK 1S72N 2DBBA 2ITMA 2VBXA 3G86A 5AXKA 1RDWX 1FXLA 4FJMA 2NO4A 4PH5A 5ALEA 1RDUA 2Q1LA 5IT9U 4F9OA 4GKJF 1V38A 1ZQSA 1ZBFA 1ZQAA 3OS2A 1GLCG 4KTWA 2KP7A 3QESA 1F21A 2G8KA 4M9NA 2Y1JA 1X9WA 3KHHA 1FI4A 1NK4A 3HFZB 4W98A 2Y9HA 3J7A1 3KVGA 1SKSA 3MMCA 1P9QC 1W26A 1YHQN 2CFXA 4FS1A 1M5KC 4U7UD 2CJYB 1VRTA 3KLIB 1VOMA 1LWEB 3D4JA 1VGYA 1VMBA 3C6UB 3R5DA 3UCUP 8ICTA 2V34A 1XNSA 3QPIA 5KFKA 3I1YA 1HNIB 1UWBA 1AUSL 1JRPA 3L4IA 3R7NB 4NM2A 1NB7A 5HHHA 1TVRA 2RF2A 1UVJA 4Q44A 2Q0RA 3AVAA 3C95A 4NLUA 3ALRA 1EZZB 3LPTA 4EO6A 3V9XA 2DCUB 3CC7N 4F4YA 2D8CA 5T41A 2ASDA 3KK3B 4K8ZA 3VAGA 2IY5B 5FIIA 4I2QA 1VQ6N 2IOHA 3QWUA 3ZC4A 1LXNA 2E29A 4B3MF 1XNRK 2E8MA 1RYRA 3M2VB 5IS2A 4QIWF 2LMRA 2GIQA 4NLCA 5EE9A 4C2MA 3KK2A 2LXUA 5LY3A 2GBZA 1HR0K 1U0HB 3IFEA 3I4PA 2YJEA 5J2QB 3A4TA 2Z0GA 1IR1A 1HW8A 3VA0A 1GLFO 3QNOA 4MFBA 2GHWA 2GW8A 3KUGA 3HHLD 2P9PB 3H5UA 5J0QA 2GOLA 4DQQA 3MM9A 3N79A 3VQAA 1HNZK 3GG4A 1JB0C 3H2VE 3K4GA 4DL0C 5IM0B 3PSIA 2NUUG 3VQSA 3J7ZO 4UAVA 1TV9A 1ZM3A 3OYKA 2XO6A 3AVKA 3T1YF 2HZVA 2QA4G 3SSSA 1FKOB 4TURA 3CCVN 1SJ1A 2Q3PA 1RBUA 3GYXB 2Q97A 1NPRA 2O4GA 3HHLA 2KZ3A 2GGPA 1PKUA 1HWIA 2EG1A 1FKPA 1RFQA 3M2UB 3NAHA 4RW6A 4JI1J 3W2WA 1Q8LA 5E79U 3W63A 1S0MA 4UB8U 3TQ1A 4I6WA 3OW2R 2O01C 3IV6A 2MHEA 4RBUA 5AIAA 3K1ZA 5TZVA 1JLBA 4CK2A 2AHOB 3E2EA 4YMNA 2E1ZA 2WHEA 1SJ3P 4F5NA 4P2XA 2P9IB 1FEEA 1UMJA 3GV5B 2N82B 1JJHA 4UB2A 1DEJA 2F2AB 5F8JA 2QN6B 1BUPA 3DU5A 1U6FA 5CQGA 5M2PA 2PY5A 4RT2A 1L3KA 1K47A 2KRBA 3G9CA 2RB7A 1EQ0A 1LWCB 1UVNA 1OS5A 3B9JA 3QU4A 1WSIA 1M90O 3DRPB 4BWJA 4USUA 5AM1A 1LWCA 3ZSXA 5BPNA 2RRNA 9ICXA 1TL1A 3FKBA 3ENOA 4OVLA 7ICLA 3LM2A 4YR0A 3DOMA 3ZZZA 5B09A 3H5YA 1N33K 1YWXA 2AH5A 1OW5A 1ZAWA 1S6PA 2E1CA 3RAXA 4Z6CA 2ZHOA 2YX8A 5KG2A 2MEWA 2XSJB 1U2FA 3D28A 3CCTA 1JXBA 3EL2A 2E4LA 2FZKB 4QZIA 5CHIA 5GAEI 3BSNA 3C23A 3E3XA 1SXLA 1GLDG 4YOUA 2HLUA 2PAVA 1CC7A 1FVQA 1R6YA 4JI6F 4DCPB 4HHJA 2VQFJ 3H1QA 1MG7A 1VC5A 2OLWA 2Q0UA 3CCJS 2CDRB 2LM4A 4O3RA 2P9CA 4Y2QA 3W5XA 4CF8A 3GBTA 1V4TA 4DX7A 3SCKE 1KD1T 4DQ8A 1RAIB 3FSYA 4E7LA 1QCKA 1TKZB 4KH4A 3DCAA 1WI8A 2YX7A 4H03B 3KLGA 4NWBA 3ENVA 1HNXK 5A0YA 3MDQA 3G8SA 4DTUA 5SUHA 3AD8C 3RGIA 1VQ8S 1JI7A 4X4NA 4BRNA 4NLYA 4DI6A 4R66A 2W9CB 4MK9A 5ALOA 4CJ4A 5CWRA 2FY8A 2NZCA 5IOLA 4ZVPB 4O3MA 3L2UA 2CQ1A 3GIIA 3PDNA 4K4IA 4A47A 3HRGA 2LYVA 4B3RJ 3QEBZ 3KOOA 2WAQC 3PKMA 4ES3A 1TKXB 2IJFA 5CZVA 2VH7A 1T3OA 2OGUA 3TPQA 2OPSA 4OMFG 2HFSA 1FTRA 1HUZA 4NYFA 1JCGA 3VQ6A 3CCVS 5AQMA 5E0OA 4JB3A 3TWHA 1X0FA 1KFDA 3O9UA 5D0HA 1XQSC 3M6ZA 1YJRA 4ZP8A 4NYNA 3H5SA 1N5WA 1GH8A 4O0JA 1F3FA 1HD1A 4HTIA 2YNIA 1QQ6A 4LF4J 1NK7A 2F96A 3HULA 1HNWK 3CCSS 3RVCA 1MU2A 4BE1A 3L7UA 4ECVA 4OZJA 1VSHA 1FKOA 3J7YI 3EVOA 3NOGA 3AO1A 4OZ0A 3QJJA 3NF9A 5D6GA 3H08A 2EDUA 2CVIA 1U1OA 5C2FA 1T94A 3KLVA 4JYAJ 3JQJA 1GX5A 3ZT2A 1RHMB 2VC1A 2VJUA 4KH1B 3CD6N 3TTCA 2BW7A 1HA1A 1KW4A 2W3SA 4WTOB 3CJ0A 1LWFA 2AYMA 2YPZA 1AUDA 5F0WA 4KHRA 2JEGA 2N3OA 1J97A 1NU0A 4AHRA 5CP2A 3TKAA 4C8NA 5A2QO 2F9TA 3CCUN 1EX4A 2LKYA 3SENA 4YFKA 2F1FA 3O5TB 4KHYA 3Q7CA 3D2FA 3HRDD 2LYAA 2MSSA 3GSIA 1V85A 3UQ0A 3L3FX 1FERA 5THWA 4DV6J 4QCLA 2W9BA 3HO1A 4DQRA 5GAGP 5AKYA 3W8PA 1B0VA 4K4XA 3HX9A 3BSOA 3WU2U 1UKUA 3N4QA 4IQMA 3BO4A 2XMMA 1ZA1B 3ZTRA 2AD9A 3HP9A 4FZZA 4Q43A 5AKZA 3AU2A 1VQPN 1ZQVA 4ZJOA 5GMDA 4DR1F 3O6WA 3MDCA 4ID8A 2X1FA 4CM2A 3CW2C 5B7WA 3TR8A 1U49A 2BE9B 1FCAA 4PHDA 5CYMB 1X4FA 1YUWA 2IS3A 2OAUA 2D1CA 3HJVA 3BGLA 4L6V3 1MROA 3BR9A 1ZA2B 3PHEA 1ZS6A 4B3TJ 3MN7A 4HTUA 1WC0A 3HBTA 4GIBA 2I9GA 3ZDBA 1DTTB 3JTOA 1KFSA 1R8BA 2D3DA 1EETB 4NZ0A 3G6YA 2XI2A 2PBDA 2BQRA 4LFBK 2OPQB 4MJKA 3SXLA 2HOQA 4ZOSA 3NRZA 1BL3A 3LPYA 2RUGA 3Q23A 2RQ4A 2RIJA 4DR2J 3VQCA 4CBUA 2BKOA 4FZXC 2A0FB 5K9FA 2GA7A 1DQ8A 1APSA 3ENHA 3O4NA 4K50A 4NLTA 2E5GA 3M6XA 4P75A 5ETTA 4BC9A 3FNNA 4CLKA 2HNDB 3KZXA 4BGBA 3KLEA 1NSAA 2H48B 3PW7A 5KFPA 2DB1A 4R65A 2A19A 5IQ6A 4YB7A 4CZMA 1SH0A 1UVIA 4CTAA 2KFYA 4PPDA 1D5AA 5IM0A 4ZLLA 2YHBA 4WTYA 4ZP7A 4ZCMA 4OJ6A 2IVPA 5KPRA 3WIVA 1OSDA 2I6WA 4DR1K 3L6QA 3A5MC 5EDWA 5J0SA 4DHVA 4FWMA 4A8YA 2QYGA 1N0VC 2O5DA 3QINA 2VIXA 1IBLF 2WF8A 3FEXB 3GOIA 2E2PA 1OH7A 2A2DA 2GAHC 3P6YC 3KHRA 4JI6J 5CH7B 1Z25A 4E19A 1Z2ZA 1DARA 4GXIA 2D7SA 4CT8A 5AQHA 3AARA 2EXUA 4TUPA 3MR6A 1GOCA 3OYMA 4US9A 3CCQS 1IKWA 1YJ9N 3N7RC 1YJNS 3V5RA 5A6PA 2ATQA 4AL7A 1EXNA 4KPCA 3LDLA 1ATNA 4LFBF 2IM1A 2VG7A 4LF8F 1XHXA 1B4FA 1S1UA 1A0OB 1YJVA 1FJCA 2NRTA 9ICRA 1KAXA 1QVFM 3P4IA 2HQIA 1CLFA 4QZCA 2Q66A 5KFJA 1YG0A 3OL7A 1U8WA 4PGYA 3IRWP 1FRXA 5ALSA 2W7AA 1FRLA 4B1UB 4B9SA 3CCWA 4MKBA 1ZQXA 2DFHA 3ISDA 4DUYF 2RMLA 5BRDA 1SZ2A 9ICCA 4WP8A 2C2NA 3D2EB 3POTA 4NA1A 1TAMA 5ALZA 5CA5A 2CGKA 3HKZD 1U45A 5GAHP 3H90A 1RGVA 3UW1A 3HJEA 4OKJA 1JLCA 4A8OA 1MSWD 2D0AA 3BR8A 2R2RA 4P0QA 5J0XA 4FJHA 4BCAA 3MC1A 4K4WA 2G8IA 4F3MA 4OV6A 1IBMF 2O8BA 1DQAA 3C19A 5IIKA 3KJFB 3H0MB 1VJWA 1NJXA 4FM2A 1ESVA 3ATVA 2YKMB 3EUB2 2QGFB 3NF8A 1UWAA 1SIWB 4B3MK 1ZBLA 2DRAA 2D3UA 3G10A 3O3GA 4LF1A 3TAMA 2Y1LB 1GXTA 3SQOP 2EWSA 1T8EA 1RHKB 1F0MA 2MZTA 5ALKA 4BDYA 4HTLA 4JB8B 1YJUA 4EP4A 1HHQA 3QNMA 4DB3A 3R9LA 2ZBCA 3MN9A 2AJ0A 2ASPA 3LVWA 3SDEB 4RQNA 4CE9A 1UFKA 3DRYA 2E1FA 2G8VA 5ALRA 2IOFA 3MMBA 4DTJA 3SPZA 5C24A 3SQGB 4ISGA 4JI2J 1I3OB 4F5PA 3UR3C 3KWGA 2WC9A 1L7NA 4U8VA 3PRVA 4PRFA 1U6ZA 4JI8K 2W2QP 2PFFB 3CFOA 2V8DA 4Z6FA 3IRUA 5EUHA 4CM0A 4JV1A 1IBKK 3UKRA 4BRLA 3GIMA 2SXLA 2E20A 3HPOA 5TKYA 2J6SA 4K0KK 3EPGA 1XERA 3NY0A 4FPIA 4PHEA 4RW4A 4AHTA 1JXLA 4C1NK 1Q53A 3QB0A 5J2JA 2Z1HA 3U02A 2PMHA 5KG4A 4UAUA 4IFVA 5LMUK 2PYJA 4I2DA 2ODGA 2K3IA 3MR7A 4CO5A 1RT7B 1RBSA 3A1YG 4ECSA 2JR5A 1M5HA 1SKUB 3F2KA 4NI2A 4IG3A 3M6UA 2CN1A 2DGSA 2YCHA 1NHKL 4DV6F 4IOCQ 3O1LA 4KO0A 5HSPA 2VG6A 5ALVA 2HOFA 4OPKA 3I9V9 4RNFA 1M1KO 4NRTA 9ICUA 1HQUB 3WUHA 2KXNB 1JLGA 4UW9A 1WHVA 5KFIA 2NRZA 4B3SJ 5KPZA 3DM2A 3THXB 4DJBA 1JCFA 3AH6A 4HR2A 5DQIA 1QAYA 2YHWA 2IDOA 7ICRA 4I2JA 1FKAF 1B0XA 1IV8A 1YZ6A 4B9NA 1R31A 3EE3A 4MYUA 1RBOB 3TJ9A 2PKEA 4GW6A 3QEPA 1BQMA 1N52B 5KFMA 2E8AA 3ZT0A 2XY6A 4WXOA 4IEEA 3BUZB 4QZAA 4BXOB 3PX6A 3PLAA 4OQJA 1BISA 2V52B 4NXMJ 1L7PA 1WI6A 4WQ5A 4PPXA 3FCWA 4DFMA 4RG8A 5J2BA 1UETA 1YTAA 1YVNA 1ZYQA 2LPEA 2K1RB 2C2ZB 5HBMA 1FEZA 2PXIA 3DI6B 1C0UA 2WBRA 4EHTA 3AQPA 2QSFA 4FW2A 2ES6A 5C25B 4FF2A 1ZQYA 4FXVA 2EK1A 1RBVA 2DIVA 3I6PA 3KMQA 3AY9A 2OSRA 2O8DB 2KXFA 1RKIA 4FLTA 4LF5K 5KOXA 3MCNA 1WELA 4J9PA 2DVIA 4P0PA 1WUDA 1FRHA 1R59O 3OFGA 3N7PD 5J0TA 3JPRA 4OI4A 1U25A 4LF8K 1T3NA 1SCJB 1VQ7S 1CXUA 1EARA 4PHAA 1M1KT 2D3O1 3AHPA 5H1SV 4ZPBA 1UVMA 3LK9A 5FPMA 2KG5A 2FHJD 4KH5A 1S7IA 4K4VA 4DL7A 2WF5A 2D5RA 4HACB 5AZIA 2QWRA 3WC0A 3GV8B 3T6JA 3U6FA 9ICEA 3LM9A 1S1VB 1KQSM 4Y28C 3RRKA 4KREA 4Y2AA 1T4GA 1Q5YA 4LF9J 1TUGB 2D69A 2ZH1A 2JWNA 2G9OA 3TANA 1ZTTA 5J0YA 5B0AA 1VHIA 3CCES 1RA6A 1H1VA 3WXLA 1Q82O 2F76X 2QC3A 1KCFA 2OWOA 2C2KB 2BGWA 5AKXA 4ACOA 1YIJN 4Y2PA 5MAOA 1UPMB 5AI8A 4C0OC 2LBOA 1ZM9A 4NLQA 1NB2A 1EP4B 2KM8C 4YY3J 1WCLA 1IXRA 2XCAA 3EX7B 2IHMA 1QM9A 4P7TA 3RMCA 4JK8A 4NL9C 5CRXA 2DR7A 3KD5E 1I94J 3SIPB 4ILGB 3ZT4A 4YR2A 4AQYF 2A1RA 2XMVA 5K5MA 1HJPA 3ENAA 3QBWA 4U67Q 3AODA 4FNIA 2EC0A 3C15A 5CYJA 4JI7F 1Z4NA 4F5QA 1BOTO 4KLEA 4K4YA 2KE7A 4NLZA 3MI7X 4URGA 2KFNA 5GAGI 4J9LA 3VGKA 3GZFA 2FC8A 4Y2RA 2KKHA 4Q0BB 2P9NB 3GMGA 4LREA 1HBMB 7ICOA 5LMNJ 2CJKA 1HBMA 4ILHA 1ZQHA 1M90T 2WMMA 5ETSA 4LVSA 3OV7A 2JGUA 4YDUC 4AUKA 5AQRA 1ATSA 2FJXA 4OHWA 1XNQK 2M7SA 2QKBA 2Z1IA 4M94A 1VQ8N 3DN9A 3CP8A 4PHPA 3EW9A 5KT4A 1FDAA 5AFUA 2GVDA 4LRBA 5B0DA 3NVVA 4DTNA 3E0FA 1ZAXA 3HHEA 3OUYB 2IRXA 3VAIA 5DBBA 1FO4A 5HHIA 4C0ZA 1NHUA 4WJ3B 1U2CA 1ZQDA 1VLBA 4ZOHC 3OYEA 3WXKA 2NLWA 3CDUA 3G82A 4FWOA 3ZT3A 2EZZA 1WG8A 1RTJA 7ICUA 1RWPB 4X64J 2R7UA 2E5LJ 2ZBQA 2D74B 1O1WA 1NKEA 3CGIA 1DZ5A 4NLDA 2W54A 1V6HA 4K4GA 4KLDA 4IWVA 4BVPA 1UA0A 3VCBA 1D9AA 4NLGA 1DBDA 1WC5A 4E1JA 4C3MA 4EWTA 4KKOB 1M6YA 1S79A 5J0WA 3LF0A 3HILA 4CJ7A 5DDYA 2W1BA 1F60B 2JHDA 4K4HA 1WSFA 2G2YA 3DNCA 2HOEA 1NKCA 9ICHA 1SH2A 4HI1A 1NM2A 2G0CA 4CHNA 3AJDA 1TL3B 5LXYA 1NKBA 2Q3SA 4C0BA 2CPIA 2DUYA 5IIOA 1N34K 3JSYA 1QVFR 3KUEA 1HQEB 3ELHA 5C2DA 2QB1A 4KY3A 2KIVA 1NSPA 8ICXA 3NWRA 4M3RA 5ETKA 4QZBA 1UOCA 2XMUA 4CEEA 4AYBF 9ICGA 2O8CB 4I2GA 3B6BA 4CGDA 2K4IA 4CZLA 3W9HA 1NBEB 3U9ZA 1RCXB 3UDCA 5GAEU 3GCXP 2OKQA 3N9UC 4DV4F 5IT9Y 3MEKA 3FFIA 2WW4A 3NGKA 4M3XA 2KG1A 2HRUA 2XZDB 3R8EA 1XK8A 1SZPA 5KFOA 4ZLNA 3AT1B 3GIKA 5GINA 4RCHA 1RT5A 1F5BA 4EI2A 4KITB 3BGRA 3MEGA 2NZTA 1KSPA 1PYTA 4MT1A 3G6XA 1P90A 2CPZA 2ZIUB 3G71S 3KK3A 1N32J 1PK1B 4BBYA 4LSLB 1B43A 1RLDA 3AA8A 4GKJJ 3R1XA 5DJBA 4E1NA 2ZTDA 3SAGA 5L1IA 1GLEG 1WOPA 3ZSYA 2YMMA 3Q8PB 4FVCA 3OTEA 1QH9A 3WK7A 4ZITA 3J80Y 2R8GA 7ICGA 2RHSB 2EBGA 4OJ3A 3CPWM 3KZBA 2YQEA 2IA6A 1W7WA 3ZX2A 2NRHA 3OBIA 1Z2LA 1RT6B 1S1XA 3ID6A 2A6OA 2EKNA 3FBBA 1P8ZA 1KHVA 2QSWA 3QSYB 2D9PA 4CLUA 1ZBUA 2JOQA 4H5TA 2YY3A 4ECUA 3OYJA 3ED5A 2D41A 2E8PA 3WEEB 1COOA 4WE1A 2MRLA 4ILMA 3T6BA 2VWJA 5CYMA 1VI7A 3RRHA 4DV6K 4L73A 3ZSWA 2LA4A 3NVKA 2FBTA 2ZC4A 2YY6A 3SFGA 3PX0A 1LXJA 3J81U 4F72A 3WQUA 3U4LA 2OTJS 1WWUA 3HX0A 3KWMA 1RWXB 2FPKA 2B4VA 8ICKA 4Q0BA 3ORYA 3EXYA 4Q8FA 5EGYA 2UVWA 4LBHA 4J8FA 6FDRA 1VSFA 5IQQA 1BC6A 3HHLB 4ISFA 1RWVB 2LHTA 1PZNA 4J9OA 2V2VA 1X42A 3UXPA 2C1EB 4PQUB 2DR8A 3NP5A 5CAAA 1JLQB 4A2AA 2GWKA 1I5OB 1PVQA 1RUSA 1RTIA 1XSPA 2MA1A 2XO7A 2NXCA 4G1QA 3NGZA 1CULB 2MTLA 5KG7A 2DXFA 5CHGA 3R1HA 3OS1A 4AFFA 2NRRA 1S0VA 1S6QB 4I9LA 3VAJA 4B3OB 5IT9O 1JMSA 5EWEA 1F1BB 1WD6A 2DXEA 3FGVA 1BHNA 1OWXA 2FI1A 1L3SA 1BPDA 3T79A 3ZDCA 3OYHA 5D4LA 3LDSA 3R3TA 4JI8J 3OR1B 3SUPA 3DHXA 4B02A 1NZPA 3D1HA 4ALZA 5IT0A 4CF1A 3AVNA 4TY8A 1JKHA 2RE1A 1NK8A 1RB0A 4ED7A 4AQYJ 3HWTA 4FJ7A 4M7XA 3SI8A 3ZNJ1 2A1BA