1NKEA

A bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkeA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkeA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkeA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkeA01
4I2AA 2HMIA 2FBTA 1ZQWA 3VQ7A 1XI1A 3EPGA 2YHAA 2R8HA 1HJRA 9ICPA 5HRNA 3AVIA 3O4NA 3OYGA 1TV9A 8ICPA 4YG2A 1HJPA 5D46A 1ZBLA 2Z1GA 4YXMA 3G6VA 4LSLA 1W0HA 4R63A 3DLGA 3PW7A 1NOYA 3ZD8A 4F2RA 4OGEA 4FVMA 4QZHA 3AVMA 3T19A 5KT7A 3KHLA 1D9DA 1T7PA 3AA5X 5J2BA 4CFAA 1IKVA 3QEVA 2ZTCA 3SV4A 3SQ4A 3AV9A 2AJQA 5IILA 1RCHA 5FROA 3RRGA 1EETA 3RBEA 1S0MA 4GVMA 4KB1A 3WNGA 4DQPA 2BPCA 2FLNA 2IC3A 3OYLA 2XC9A 4HUGA 3VQEA 2DY4A 4RT2A 2A1RA 4BDZA 1S5JA 4O5BA 1ZQCA 4O5KA 7ICLA 5HMMA 3I8DA 4K8XA 4DSFA 4AHTA 3V1QA 1XSLA 4YMOA 1ITGA 1D9FA 5SZTA 3UIQA 2R8GA 3DI6A 2XO7A 5KG3A 1WCLA 4NYNA 2VA8A 3OYCA 3BJYA 4B9LA 4P2HA 3V9ZA 5KFOA 1RDDA 1S6PA 4IR9A 2PFOA 5KFNA 3EW9A 2XRIA 1K6YA 4CEOA 4C8KA 3EWAA 5KFBA 4HYKA 1IKYA 1HNIA 4FJNA 5BPCA 2C22A 2VG6A 5KFCA 3GV5B 3C6TA 4Z4CA 2BGWA 4CJSA 1MQ2A 3LP0A 3KK1A 2OPQA 4DEZA 4KLHA 4MFCA 9ICCA 3S3NA 5KG2A 1IO2A 3VQBA 1I39A 4UAZA 2FMQA 4OLBA 1SV5A 3M8SA 4BACA 4DL5A 2P6UA 5DGAA 2F1HA 2BCQA 1O1WA 1L3SA 4FYDA 7ICUA 4RPZA 4CIFA 4ED8A 4CERA 5KFZA 4KREA 4GXJA 3KHHA 3T5KA 3UXPA 4QW9A 3KKSA 9ICOA 4E7IA 2WONA 4PGXA 4R5PA 4TUQA 4JRQA 1BISA 3RH6A 8ICQA 3Q8LA 2EHGA 3V6JA 1X9WA 5KT6A 2OZSA 4M3XA 3QERA 1NKBA 2Y1IA 2BE2A 4DU3A 3MR5A 4DS5A 1HMVA 1W9HA 1VSJA 1VSKA 3C2LA 1XHXA 2HNYA 2I1QA 4DTNA 4W5TA 2GUIA 4I28A 4YFKA 2PXIA 4FJIA 4DSLA 5L1JA 2PFPA 2VA3A 2G8VA 4DLGA 3AVLA 1XWLA 3NCIA 4XQ8A 3DLRA 4O5EA 4Q45A 1BCOA 3V6HA 5J2AA 1RILA 3H4BA 4O3RA 3QETA 9ICJA 4KLTA 9ICIA 7ICPA 3SUOA 7ICMA 2QKBA 3AVBA 2PYJA 5F9NA 3MR6A 1ZQOA 4DQIA 1T8EA 3HM9A 1TKXA 3ZSVA 3JPTA 1TK8A 5EWEA 5DB9A 1HUZA 1DTTA 4RPYA 1BIZA 3DLBA 2ZQBA 4YD1A 4RPXA 2A1JB 3TAGA 4YNQA 3B6OA 5CYQA 5IIMA 3LAMA 2PFQA 2YV0X 4J2DA 4EEYA 1XC9A 2BDPA 4CEAA 1N48A 8ICZA 4C8NA 4XIUA 3Q8RB 1KVBA 3G6YA 4YR3A 4GW6A 4KFBA 3CQ8A 4KTZA 4F5PA 1WSEA 4FJ7A 3ZDBA 1H38A 4E89A 4ECUA 1ZQQA 1BGXT 1BHLA 4KHUA 2G8UA 4PHAA 1XHZA 3LPUA 2QXFA 1A5WA 4ELUA 4NYFA 2DPJA 1BPEA 4K4HA 3I0RA 4NLGA 1B92A 3F73A 4PHEA 1LW2A 5IIIA 4CK3A 7ICQA 4UB3A 1N6QA 1ZBFA 5CA7A 1VSLA 1GOBA 1YVUA 3N97B 4AH9A 4ED1A 4DTRA 1U04A 4CJFA 4KLEA 9ICWA 5DDYA 1ZQTA 1ZJMA 5KFVA 1RBRA 1I3AA 3O3GA 2G8FA 4ED0A 3C95A 3PV8A 2XHBA 4X5VA 4LZDA 1GOCA 5I3UA 2V9WA 1RDBA 4CHYA 2F8TA 5KFQA 4J9SA 1X1PA 1GOAA 3GV8B 9ICSA 4CJTA 4M9NA 4EBEA 3PW5A 1EX4A 3AVCA 1Q8IA 5CR0A 1TVAA 4FBTA 1NK5A 1QLNA 2E6LA 3K59A 4IQWA 5DGBA 4IRKA 5D3GA 3T3FA 5J2MA 2DTUA 3SJJA 2JEJA 4F5NA 3MGHA 1YTUA 4RQ6A 4CJKA 1U47A 5JUMA 4Q8FA 4UB1A 1RZTA 1TKZA 3RJGA 1BI4B 4B08A 1TVRA 4FCYA 4BE0A 3NDKA 4O44A 3K5MA 1ZQIA 4CEDA 1U4BA 3OYEA 3K5OA 4CHOA 3KTQA 2R7YA 3P1GA 3NBPA 1JLBA 1KVAA 4C8OA 3ISDA 4M9JA 3U3GA 2IHNA 4CGFA 3CFOA 4J9LA 3VQ4A 2YNHA 4DL2A 4DFMA 3RR7A 2ISOA 4MF2A 2PI4A 4HUFA 2KFNA 3MGIA 8ICWA 3OYBA 5DBCA 3G10A 2VWKA 3PO5A 2ITGA 5KFEA 4JWMA 3DLKA 4CJRA 3BGRA 3PW0A 2HW3A 4TQRA 4CJEA 3JPRA 4YXJA 4ZH4A 1VSEA 4CEQA 4P4MA 1LB2B 3OJSA 2OZMA 3EYZA 3M9NB 3MEEA 3GIJA 4QZ9A 2ZUBA 2J6SA 1KTQA 3AO5A 3C1YA 1XSNA 2KZMA 8ICHA 3KIOA 1WSGA 4JV0A 7ICJA 3V7LA 3VN5A 1RTDA 5J2NA 2HNZA 2ZD1A 1WLJA 1RBSA 5DLFA 4R8UA 4OKEA 4OJRA 4OPJA 5TZVA 4E1NA 3QEIA 3NF8A 3BQ0A 4O3PA 2HB5A 5HP1A 4W5RA 4CJ3A 3DOLA 1KLNA 4FJ9A 3B0XA 3TI0A 2P5OA 4KLOA 1S1UA 3NF6A 1KDHA 4E7HA 4QZEA 1QE1A 4DOBA 3H08A 3TAPA 3VQ9A 3V4IA 4P4PA 3PX6A 2IBKA 3HL8A 1B9FA 2X74A 1U48A 1UAXA 4IBNA 8ICXA 1T03A 4KLQA 3RR8A 1FXXA 3V9WA 3C6UA 4M3UA 5IIOA 3SCXA 1S9FA 8ICTA 2D0BA 3ORYA 4IQUA 2F8SA 3DLEA 4H4MA 3PMNA 4F3TA 4M6WA 3SQ2A 4QZDA 1U45A 1XSPA 1ZQHA 4LZGA 4LH5A 3CYMA 4PY5A 2KN7A 3OJUA 4EZ9A 3EPIA 1G15A 2YHBA 2ATQA 2Q0ZX 2YNFA 8ICYA 2ZJ8A 4CCHA 3O3FA 1BI4A 4QOZB 4ID5A 1BPZA 4Z6FA 3QNOA 1JXEA 3RH4A 3NH2A 4Z4EA 1S0VA 2P1JA 4DWIA 1QSSA 4F5OA 5J0OA 5J0QA 5J0PA 4ELVA 3SZ2A 7ICOA 4E7LA 1S1VA 3AVHA 5CY4A 4FJ8A 1A5VA 4NCAA 5CZ1A 3H4DA 3F9KA 2FLPA 3C2MA 2C2DA 2BGGA 3SUPA 2G8IA 3OYDA 3MEGA 1S10A 4ED2A 3RAQA 4F91B 5CP2A 3RRHA 4RQ2A 4O3QA 4QZFA 1KFTA 4I2EA 5KT3A 2W8KA 2D0CA 4FLYA 4DSKA 2F1JA 4MEYA 3PX4A 3VQ6A 4DOAA 3ZDCA 1RT2A 3M8RA 3AVJA 5J2GA 3AUOA 2BKEA 4M45A 3GIIA 4DTMA 3MFIA 3S3MA 5J0UA 1ZQSA 1BL3A 2FPKA 4KLMA 1Z3EB 4XUSA 1A5XA 3GFKB 3ETLA 3MBYA 4DFPA 4RZRA 2AGQA 2F96A 3DRSA 3OYAA 4C8LA 3NGZA 4M9GA 4ZHRA 4CGHA 4NLZA 3ZSQA 2DPIA 4PQUA 4QZ8A 3NFAA 4RUAA 3OS2A 1J53A 2X78A 4B8AB 3B6PA 5KRSA 4IRDA 3V1RA 2IOCA 4L8RB 1RDAA 2ETJA 4JK1A 1C1CA 3C5FA 3VQCA 4CJVA 1Y88A 4FJMA 3KHGA 4XRHA 1C0TA 1BVSA 2J6TA 2WTFA 3LP1A 4OKJA 2FPMA 2KZ3A 3AU6A 3RJEA 4QWCA 5BOLA 1RTIA 2NRZA 3UPQA 2MUTA 4CK1A 4N5SA 1C0MA 1QS4A 4IG0A 4AHVA 2BQRA 3GIMA 1KCFA 3MFHA 4UB2A 5KRTA 2IDOA 3ISBA 4F3OA 4RQ8A 4MEXA 2FBYA 4WE1A 2R8JA 3CFPA 3TANA 3QIPA 2JZBA 3ISNC 5J2PA 4M2YA 5KFWA 4KHYA 1D8YA 4ID1A 4F92B 1Q9XA 3QEPA 1VSDA 3IHQB 2VG5A 4GC6A 1KFDA 3FDSA 1KSPA 2Q3SA 5HP4A 1HYVA 2E4LA 2IGIA 3H8JA 4F2SA 4OPKA 3QESA 4CECA 9ICTA 2IS3A 3LALA 4RQ5A 4CJLA 1B43A 2A1JA 4R65A 3S3OA 5EOZA 1BQNA 3M9MB 4KI4A 1NJYA 1ZQPA 1SL2A 4DTSA 3BQ2A 2KW4A 3KLGA 4KLFA 1JLGA 4DL4A 4NCGA 1UA0A 4K4IA 8ICOA 2W9CA 1DLOA 3GIKA 2R8KA 3LP3A 4QAGA 3UXOA 4UQGA 4J2EA 4B3OA 3PVXA 1Z25A 4GXKA 4RW8A 4ZTJA 1TKDA 4FW1A 4R8UB 4I9QA 5CWRA 4I27A 1MSWD 1B9DA 4CIGA 4RW6A 4E7JA 3FYHA 1TL1A 4PGYA 2HVIA 2W9CB 3DYAA 3ZT1A 9ICQA 2B6AA 5KFMA 1ZQMA 8ICAA 4O9MA 1VK0A 5KTQA 4BXOA 3HPOA 3PR5B 4KO0A 3CG7A 2V4RA 3M8QA 1Z00A 4IR1A 4CFDA 1VRTA 4Y1DA 1JN3A 5J2EA 9ICMA 4RQ0A 1CEZA 1A77A 1S6QA 4QZIA 5DBAA 3IS9A 1HNVA 3QO9A 4EBDA 1JLCA 3ALYA 2AGOA 2B21A 3V6KA 4ELTA 3LDSA 1QTMA 3HWTA 5BOMA 3LZIA 2OWOA 1NJZA 3RJJA 4DSJA 4FJJA 4DS4A 1ASUA 3T5JA 4M47A 1ZQUA 4BWMA 5JS1A 3NF7A 3MXIA 1HRHA 2HHUA 5KFXA 3RMAA 4IFVA 1WNSA 2YKMA 3H8WA 2OPPA 3ZSZA 1IM4A 4KRFA 4UB5A 1X2IA 3NGYA 1S0OA 1ZQGA 5KI6A 2XCPA 4CJPA 3K5NA 2ZTEA 4ED7A 1TGOA 4CHPA 1CLQA 4MQ3A 5KT4A 4KHSA 4CHZA 1Z26A 1WN7A 7ICVA 5IIKA 2NRVA 4PPXA 1TV6A 3V1OA 4CGJA 4W5QA 3L8BA 5I42A 1RBTA 4GMJB 4KHQA 1K1SA 2HHQA 8ICSA 4I2DA 4QWEA 1RNHA 3PNCA 1S97A 5KGWA 1Q9YA 4E7KA 9ICLA 4IRCA 2Z1HA 3V9SA 3MDAA 2OPRA 4J9KA 1CZ9A 3QLHA 3MECA 1JMSA 4AHRA 4BE1A 3DRPA 2FBXA 3H8SA 4FK0A 2KTQA 8ICKA 5KFUA 3ISCA 1NJWA 1JLQA 5KFTA 4I7FA 5T7BA 3GILA 4KLJA 4FJGA 4RUCA 2MUTB 3B0YA 4MFAA 1KRPA 4E3SA 5KG1A 1LWEA 3MXMA 2ISPA 3HO1A 1BPYA 1TAUA 3AVKA 4KITB 3HK2A 4EP5A 3JSMA 3ZT0A 5KFPA 1T05A 1WSHA 1CUKA 4CEBA 3KD1E 3LPTA 2XY8A 4GLXA 3KKRA 4F5QA 9ICBA 2RF2A 8ICMA 5HRRA 4NM1A 1NKCA 3L2RA 4YR0A 4CHNA 3AA2A 2FLLA 4IDKA 4AHUA 4KHNA 4RNOA 1RYSA 3TFRA 4B9MA 4NY8A 4ECVA 3LDAA 1L5UA 4RQ3A 1UWBA 1U49A 2VWJA 5KG0A 4TSXA 1KVCA 4CGGA 3NHGA 4Z4FA 4QW8A 1TK5A 4PUOA 3OS0A 4DFKA 2HHWA 4RQ4A 3OVNA 4O4GA 2JEIA 4N56A 3SPZA 5DDMA 2P5GA 4H8KA 1SKWA 3VQDA 2Y1JA 4LVSA 3L3UA 1ZQXA 4DTPA 3OHAA 3AO2A 3TAFA 3HP6A 3IRXA 3A2FA 3WNEA 4IFYA 1ZQDA 1SZPA 2Z1JA 4HVJA 2PFNA 1MC8A 2W9AA 3RB6A 2BCVA 4KLIA 3V7KA 4FBUA 4IQTA 4CGIA 3E01A 1ZQYA 5J0RA 3Q8KA 3ITHA 4J9NA 3LWMA 1YT3A 3OYFA 4G3IA 4M0AA 4NXZA 4AHCA 2I9GA 3FFIA 1ZBUA 1NJXA 1JLFA 3AVAA 8ICCA 5HRSA 3HPGA 9ICNA 5KFRA 4FJLA 5J2KA 1JXLA 2OA8A 2QKKA 3Q8SB 5HMLA 3JPNA 8ICBA 1IKWA 1UOCA 1DOQA 4FLUA 3RMBA 2A1SA 2MAXA 4FXDA 1TL3A 4CESA 4HTUA 2ASLA 3U3YA 5FRNA 4AILC 4OLAA 1BIUA 4Z4GA 9ICGA 4FO6A 4M3RA 1C6VA 4CFCA 1LWFA 2OYQA 4DQQA 1ZQAA 4YCXA 3RJHA 2NRWA 3SV3A 4HUEA 2M9NA 4FS1A 5KFFA 2NRTA 3ZT4A 4KMUA 3L2WA 4M3YA 4YQWA 3AVFA 4KN4A 2XY7A 4ECXA 2WOMA 4CJQA 1NK0A 4FZZA 2VANA 5DB7A 1RTHA 3G0ZA 4CHQA 3HXMA 1WSIA 3U6FA 3DOKA 3AO3A 3RB4A 2RDIA 9ICHA 4B9NA 3HSTB 1X9SA 1QQCA 2FC0A 4PGQA 1ZQBA 5CYMA 3RAXA 4M42A 3BDPA 4CF1A 3HP9A 4RG8A 4F4ZA 1U9LA 4EZ6A 2IAJA 2GBZA 3MXJA 2I5JA 1SUQA 4B9SA 3JPPA 4DQSA 4Z4HA 3C1ZA 3SQ1A 4FM0A 1WAJA 2AU0A 4DSIA 4CEZA 3HT3A 2BCSA 2UVUA 1AROP 3IM1A 5C25A 3OY9A 4QZGA 5KFKA 4CFBA 4ED6A 4PWDA 2LYHA 1RYRA 3M9OB 4I2GA 4DO9A 5D4BA 1LW0A 3MDCA 3HPHA 2B4JA 1UT5A 3WNFA 4JRPA 4KTWA 2RN2A 3PW2A 3SI8A 1HQEA 4TUPA 4OKKA 9ICKA 1C1BA 4M3WA 4E0DA 2YNGA 4K4GA 2PI5A 5DQGA 2HHTA 1RBVA 2V4QA 5J0SA 3MABA 3NE6A 3QZ8A 4RU9A 5IIJA 1PZNA 4DFJA 4O3OA 8ICUA 3K58A 1DTQA 3ZSYA 2W9BA 4XA5A 3TR8A 4CJUA 3OSPA 4DOCA 3VQQA 3G6XA 4RQ1A 3OYKA 1XS9D 1NOZA 3H7IA 4FZYA 4FJ5A 3BQTA 4YFUA 3KK2A 3TAMA 1LWCA 1NK4A 3NH1A 5K14A 3K2PA 9ICFA 2FMSA 1JL2A 4KPYA 3I0SA 5KG6A 2P51A 3LWLA 4KI6A 4BE2A 4DSEA 4CGDA 3KLHA 2JLEA 1EXQA 3C5GA 1SL1A 3RB3A 3CM5A 1BCMA 5J2IA 5DG7A 2UVVA 4ED3A 3NGIA 4RW9A 4W5NA 4IG3A 4CIEA 3S9HA 3SQ0A 4JS5A 4M3ZA 4O0JA 1FKPA 1A76A 7ICEA 3ZCMA 2H5XA 4JUZA 1JIHA 4LY7A 4FLVA 3H40A 2HVHA 3KHRA 1C7YA 4PA1A 1YTAA 5DQIA 2D5RA 3C2KA 4I2BA 1SKSA 5CB1A 3VA0A 4RNMA 1S0NA 3VQ8A 1NKEA 3C21A 4FLWA 4N41A 2RKIA 5J0XA 3TAEA 2IHMA 2VA2A 4CJ4A 2ASJA 2AGPA 2X6SA 4J9PA 5KFJA 4FLXA 4I2JA 1F21A 1ZQEA 3O3HA 3LP2A 5HRPA 3K57A 2GV9A 4LD0A 4AHSA 4F50A 2UVWA 3HVTA 4ECZA 5C42A 2RPIA 3T5LA 4QWAA 4FM1A 1RPLA 8ICVA 2DFHA 3K75D 5KG4A 3V81A 8ICEA 2C2EA 3BQ1A 3CFRA 4F8RA 1WAFA 2ZUCA 2ZUDA 4BXOB 3C23A 3C94A 3D0PA 4I2IA 2BCUA 3ZSRA 1T4GA 3OYNA 1UA1A 5C24A 3ZT2A 4M9LA 3IG1A 5D49A 1NK9A 1ZJNA 1S76D 4CF2A 4FLZA 4EYHB 4F5RA 4P4OA 1RT7A 1Y97A 3AVNA 2DFFA 3OYIA 5HNKA 4YN4A 4FS2A 5FDLA 3K5LA 5HHHA 4KV8A 2P66A 1C1AA 4EBCA 4RT3A 2JEGA 2AQ4A 5J29A 3SNNA 4FM2A 2R8IA 3HX0A 5KFLA 4M04A 4O55A 4DQRA 1X9MA 3NTUA 3MR3A 3CM6A 3L3VA 2C2RA 4M41A 1T3NA 1S9GA 3EY1A 1ZQZA 2JGUA 4M3TA 4Q5VA 4RW4A 3TWHA 4MF8A 4TUSA 3P5JA 3ZSXA 1LAVA 3NF9A 3OHBA 2VG7A 1IG9A 1S1XA 2G8KA 3PR4A 7ICIA 1FKOA 1EKEA 4Z6DA 1XO1A 4UB4A 4FJXA 8ICLA 3HYFA 2FBVA 4BWJA 3VQ5A 3SYZA 2GWSA 4KLLA 3T1AA 5HHIA 4F4XA 4N47A 5KFYA 3DMJA 1RXVA 1ZBIA 2KQ2A 4B9VA 3M8PA 5DB6A 2G8WA 4J2AA 3PW4A 4DTXA 2BHNA 4M9HA 3TAQA 3VQAA 3TARA 1IKXA 3ZSWA 4PH5A 3QIOA 3VQPA 2HHSA 4LH4A 4DF8A 2J6UA 4UAYA 5L9XA 3RH5A 3PY8A 2XY5A 3MEDA 2HHXA 5DG8A 3E2EA 1RT6A 4RQ7A 2W9MA 4CF8A 5KT5A 1J54A 2OPSA 4I2PA 1ZQNA 4ECYA 5J2FA 4KAZA 1JLAA 3THVA 2FMPA 8ICRA 4YMMA 3TQ1A 4KN7A 1RT3A 4O3NA 5F9LA 9ICRA 2JZBB 4EP4A 1RBUA 4YMNA 2IA6A 3N4MB 3HW8A 5DB8A 4Q44A 4ECQA 3ZDDA 4Y1CA 3AU2A 4JWNA 1QHTA 3PO4A 8ICNA 1L3UA 2RDJA 1ZETA 4YD2A 2PYLA 3ULDA 7ICFA 3QINA 9ICUA 2ZTDA 4QZCA 1ZQVA 4J9QA 1Z00B 4J9RA 7ICTA 2JEFA 5SWMA 5KFHA 1ZQLA 2G8HA 1WSFA 4KLUA 4I9LA 3AA4A 5HBMA 1LAWA 4R66A 4QCLA 4EYIB 4CJ5A 4KLDA 3DRRA 1HQUA 2XGQA 4CF9A 2ZE2A 1TK0A 4Q0BA 3RJKA 3PX0A 7ICRA 3NAEA 3DLHA 1ZQJA 3D45A 3ZDAA 3AA3A 2EX3A 2NRXA 4F4WA 7ICGA 1EP4A 1ZQRA 1R0AA 1EXNA 1NK7A 4I2FA 1NOMA 5J2JA 3IAYA 4E19A 1ASVA 4N76A 3OYJA 2BQ3A 4KLGA 4ECSA 3PUFA 3QEAZ 1JX4A 4FLTA 4DL7A 4BGDA 3JPSA 2YKNA 2XY6A 2BQUA 4MFFA 2ASDA 3L2QA 5JS2A 2XCAA 4JS4A 3RJIA 4J9OA 2BCRA 4JV2A 3KK3A 4G1QA 9ICAA 5KGXA 5J2CA 2LSNA 7ICNA 8ICGA 2HNDA 3HJFA 3AO4A 4B8CA 1S9EA 5IINA 3NH0A 1CXQA 2DFLA 3HVRA 3KLFA 4TURA 1B22A 8ICFA 1L3TA 1RT5A 1KEJA 3V72A 3P83D 1UT8A 4C8MA 4CK2A 3L2UA 1JLEA 3K4GA 3EZ5A 4O3SA 1REVA 7ICKA 3KLIA 2BANA 1QSYA 5DKWA 3OGUA 1SKRA 5L1KA 3GV7B 4DTUA 4YVZA 1CZBA 1WSJA 5DK5A 1J5OA 1HYZA 1ZYQA 1VSHA 4NLNA 4I2QA 1TAQA 4MFBA 1RTJA 2YNIA 3QZ7A 1V9PA 2ATLA 1FK9A 2UVRA 5DLGA 3VA3A 3LZJA 4KLSA 4DU1A 1ZBHA 1MU2A 9ICVA 4LSNA 1CXUA 5DMRA 4KHWA 1S1TA 1COOA 2C28A 4DMNA 4Z4IA 5CHGA 4OGCA 3LK9A 4QWDA 3V7JA 4ECTA 4GC7A 1D8LA 4YP3A 3QEXA 3RMDA 5KG5A 7ICSA 5C5JA 5EU7A 4CEEA 2BR0A 4DTJA 5HROA 2W9BB 3T5HA 5KFGA 1C0UA 3KJVA 4DLEA 4HCCA 2O4GA 4FW2A 3ZDEA 5EWFA 1BPDA 4RW7A 4UAWA 1K1QA 1JXBA 3UXNA 4Z6EA 3RMCA 3RWUA 5FRMA 4M6WB 4NLKA 3V6DA 4QWBA 3JYTA 5J0WA 4H4OA 2ZJAA 3MR2A 1ZQKA 3SUQA 4UBBA 5J2DA 1HYSA 1HPZA 1BPXA 3NGDA 1N5YA 5KFDA 1S77D 1DGSA 1L3VA 3TFSA 4DF4A 4O5CA 3ZSOA 1RXWA 4CJWA 4O0IA 4FJKA 3OYHA 2B5JA 4I29A 3QE9Y 4GXIA 2O4IA 3JPOA 1TFRA 1RT1A 2ALZA 5J0YA 3JPQA 4F4YA 4F93B 2BPFA 4RNNA 9ICXA 3SPYA 4FK4A 1SL0A 2PY5A 5J0TA 3LANA 5DG9A 4Z0UA 4KTQA 1RDCA 1VSIA 2W42A 4FK2A 4NCBA 1KLMA 1VSMA 4IQVA 4CF0A 1WCNA 4BDYA 4I2CA 3V9XA 4DU4A 1MQ3A 3RBDA 4B9UA 2IMWP 1IH7A 3QEBZ 4DL6A 3LAKA 3ZT3A 4HCBA 5EWGA 1IXRA 4W5OA 1JKHA 3Q8PB 4E1MA 1VRUA 3QEWA 3GQCA 3QNNA 3RB0A 2W8LA 5CZ2A 4ICLA 2HHVA 3GDXA 5E41A 4R64A 1ZQFA 1S1WA 4JV1A 4F4KA 2NUBA 2BPGA 1LV5A 3OSNA 5HLFA 4PHDA 2D0AA 9ICEA 4BDPA 4ECRA 4I2HA 5L1LA 3UQ0A 2F1IA 3PMLA 4PHPA 1QSLA 4OVLA 3OS1A 4HHTA 1BQMA 3ASMA 5KFSA 4ECWA 1NK8A 1KFSA 1JL1A 4J2BA 2QK9A 3DM2A 3SI6A 3RJFA 1ASWA 2KFZA 3ZD9A 1J9AA 4Z6CA 4KB0A 1RT4A 2FPLA 2XGPA 1D5AA 2Z1IA 2ZJ5A 3KLEA 3V9UA 4FZXC 4KKOA 1HUOA 4B9TA 3L2VA 3TABA 3Q8QB 5KT2A 1N56A 4NM2A 4QZAA 4ZTFA 4CE9A 1NK6A 3MAQA 3AVGA 4CEFA 1BPBA 4FJHA 1XU4A 2PZSA 5L1IA 8ICJA 4YR2A 1TKTA 5KFAA 4Q8EA 3OYMA 3KD5E 7ICHA 1VSFA 5KFIA 5J2HA 2DFEA 2E6MA 4TQSA 5DBBA 4IKFA 2X6NA 4DL3A 4DTOA 4K8ZA 3O4QA 5CJ7A 5DQHA 3SUNA 3WNHA 5KG7A 5J1EA 3UQ2A 3Q8MA 4DG1A 4Q43A 8ICIA 2P6RA 4QZBA 4J9MA 4UBCA 2AQ0A 2KZZA 5J2QA 4JLHA 3RTVA 3AO1A
chains in the Genus database with same CATH superfamily
1ZQWA 1XI1A 3OTBA 1RGVA 4DX5A 3W61A 3TZXA 2R8HA 3MMCB 5CD4A 1FJGF 3O4NA 4UAVA 3OYGA 2UU9K 1WDDA 1TV9A 2VC0A 1U0HA 2DGQA 1Q18A 1RDRA 2A5XA 2Z1GA 2GO9A 1XMBA 4CLTA 3TSUA 1JWWA 2B4VA 1RA7A 4P0QB 3LA0A 4R63A 3PW7A 4F2RA 4K4VA 5KT7A 3IDWA 3ENOA 3K0SA 3ZEUA 3AA5X 2DNOA 2ROPA 4RNHA 1OH8A 5ALFA 1IKVA 2D4WA 2BABA 3IRUA 4IDKB 4FWRA 3G87A 3R7SB 4YOYA 1D8ZA 2B0CA 1UEVA 4KB1A 3QFPA 4C7QA 3WNGA 3MMAA 4D3GA 2B6GA 4OZ5A 2QARB 4Y2XA 3ADAC 3I76A 3VQEA 3PLAA 3DRSB 3OTOJ 2LKYA 3TKAA 4QQBA 4DSFA 2KJ5A 2DH8A 3V1QA 1SH3A 1HX1A 2KYXA 1IBLK 3KOOA 4NYNA 4WU2A 1RWKB 2EG2A 2MLZA 1V5VA 3OYCA 4B9LA 4KGXB 4P2HA 1YZ7A 1RDDA 1IQTA 2ZBQA 3N6NA 1VLYA 2PFOA 1CZAN 1K6YA 2CG4A 2OI2A 2MZJA 1N62A 5KFBA 1IKYA 4K4TA 1OUQA 3EVOA 2VG6A 1EQMA 3A8YA 1TKXB 4HAIA 3KK1A 1QZ6A 4HWIA 2LYBA 2HFUA 4OZLA 3WBZA 4M5DB 3CCES 4DV4J 4PG4A 4ZLPA 5KG2A 1IO2A 1KXPA 3WT0A 3VQBA 4OYPA 4UAZA 5F0WA 1UCNA 2FMQA 1SV5A 3CULA 4DL5A 5A8RB 4QPXA 5DGAA 4U8VA 2BCQA 4RPZA 5KFZA 3M2VB 1CBKA 1CI4A 2WOMB 4EFAC 1S1WB 2CQ0A 2D41A 9ICOA 4P74A 3JAMO 3N5FA 2JH1A 5AK6A 2GMLA 3W60A 4R5PA 4TUQA 3ZTSA 3RH6A 8ICQA 3TU5A 1OVQA 4LF6K 4A8EA 3V6JA 3GCXP 4RPFA 1FFVA 4BRHA 1H0HB 1WKKA 2Y1IA 3BGLA 2BE2A 3CI5A 3EXCX 2JHEA 2V7ZA 3QDKA 3C2LA 4LFAF 4DTNA 1VLBA 2DO4A 2GUIA 5HMXA 1WBBA 2EAOA 4FJIA 3WKDA 5L1JA 1VRTB 2W25A 2P9NA 2PFPA 3HHLC 3AVLA 4LF2A 4ZPCA 1LKYA 1WWHA 1FWPA 5E26A 4MDBA 1BCOA 2KVIA 3GG1A 1S49A 3C6AA 5ETNA 1GO3F 3DOLB 3BF4A 4YOEA 3F2KA 2VF3A 4O3RA 1N52B 2GZOA 1V3RA 3MUVP 4WYBA 2QB1A 4KLTA 1ILYA 5F9NA 1KWMA 3CDEA 4H0YB 2VPWB 3HM9A 3W2WA 2KHCA 4F67A 3ZSVA 3OBYA 1WC5A 1T94A 5A0YA 1E6VB 5DB9A 3C3LA 1N54B 1EQ0A 2AJ0A 2FVSA 3KZXA 4LFBF 2A1JB 1IR0A 1QQMA 3LAMA 1ELOA 1S7IA 4EEYA 1C0TB 1XC9A 2BDPA 1HKCA 2K4PA 4CO1A 2BM0A 1TMJA 1Q79A 5I4MA 4CEAA 3GG0A 2B9YA 3QU7A 1TELA 4C8NA 1ATSA 4NLQA 7FDRA 3G6YA 3U27A 3DHXA 4LBIA 5TISU 4F5PA 3H2VE 2BUNA 2FY1A 3KLHB 4E89A 1ZQQA 2HNDB 2EWHA 2ZJPL 1BHLA 3B8AX 2G8UA 2R7TA 4PHAA 2DBYA 1F3VA 4ELUA 5CD4H 2N3OA 2YI1A 4QIWD 5GAHI 2DPJA 1BPEA 3I0RA 5AZIB 3F73A 1LW2A 3QGHA 3Q23A 3KJNB 7ICQA 4YS2A 1N6QA 4PUOB 1VSLA 4KAIA 3K9KA 5HMYA 3N97B 4AH9A 2PAVA 5KFVA 4JV5J 3E9PA 4X4TA 2J9EA 2I9SA 3BEGB 1M0SA 2OKQA 3CD5A 4DQ8A 4ED0A 4FF4A 3PV8A 1E4FT 2CUYA 2ZITA 2DR8A 2V9WA 4JI1F 1RDBA 2F8TA 5KFQA 4J9SA 2GHVC 1GOAA 1NPPA 3JXUA 4KY3A 4X66F 1B0PA 3TEHB 3PW5A 1EX4A 3AVCA 1Q8IA 2XSJA 4FBTA 4FNIA 2HCFA 4X64K 3CUNA 2P9EA 4BRNA 5D3GA 5AQQA 3GIRA 2XWYA 3SJJA 1U47A 1V85A 5JUMA 4PEOA 3FLCO 4Q8FA 3ZX0A 2LFVA 3FGUA 1S12A 3J7AN 2OD4A 3ZTOA 4JHDB 1KQFB 3DFEA 3BO3A 4CEDA 4DZ6A 2F9DA 2CQGA 5DZ6A 4TYAA 3HJVA 5BRHA 3K7RA 2V8DA 4DUZJ 4NJ8A 4EO8A 3AODA 3CJKB 3SCIE 2G1HA 1BDGA 3CCZA 2QEXN 9ATCB 3CFOA 3VQ4A 2YNHA 4DFMA 2E66A 4DL0C 5GTIU 4F9OA 1XQIA 3OYBA 3G10A 2LA4A 3DDNA 3LPEA 2NNWA 5KFEA 3M8ZA 2ASMA 4QU7A 2R18A 4JWMA 2UXBJ 4CJRA 1XBWA 1OWXA 2ES6A 4TYBA 2ADCA 2OAUA 1V9OA 1S48A 4BRFA 4ZH4A 4FXWA 1VSEA 3QAUA 3JS6A 1QH9A 3LDPA 3F2BA 4OI3A 4LF5F 1O51A 2P9IB 3M9NB 3L9ZA 3JQKA 5EDWA 2QMWA 2J6SA 3JYTB 3C1YA 4XH5A 1VRUB 2NUHA 3KIOA 5EX0A 1ZTTA 3QU4A 1WB9A 4PZOA 2C3UA 2AX1A 5J2NA 1WLJA 2QW9A 3CMAN 2DR9A 4GKJJ 4R8UA 2AWZA 2YVSA 5F0UA 3VAIA 3MD1A 1O03A 3NKYA 3NF8A 1Z19A 3MMBA 5HP1A 3UMGA 5HROB 3B54A 2JDJA 2H4YB 4HH1A 2LQJA 5DDPC 1JLEB 2C1EB 3H08A 4OI1A 2IIRA 3IBCB 3RRKA 3ONNA 3PX6A 4DHVA 1B9FA 5AFUA 3V81B 3BR9A 5EXWA 1JLFB 2ZKTA 4IBNA 1CJUB 3NY0A 1YIJN 2W4DA 1FXXA 3C6UA 1J2NA 4RJVA 1S9FA 2KXHA 2D0BA 4L3KA 3KK1B 2QLFB 3DLEA 4H4MA 1T9UA 4DV3F 4X4SA 2R7WA 1YHQS 4QZDA 1U45A 1U02A 3NBPB 3PYDA 1XSPA 1ZQHA 1OYDA 1VJWA 2UZAA 3OJUA 2AF6A 2GO8A 2AKWB 3JSBA 3ENQA 4OI6A 3EPIA 1G15A 2O8EA 3G9CA 4B3RF 3CCUN 4WFBQ 5B0GA 4Q7AA 4ID5A 1MMDA 1BPZA 4NLXA 5BYSA 3RH4A 5AQKA 4PHTX 3IDHA 4NWIA 3NVKA 2K8BB 3SENA 5E84A 2HKEA 3MWTA 2D9OA 4PL1A 4H5WA 4FJ8A 1A5VA 5B09A 2QT7A 3C2MA 3J7ZO 3ZZRA 3R3LA 3MEGA 1GLEG 3WEEA 2DR5A 4RBTA 5AKHA 3RAQA 4RQ2A 4O3QA 2M7SA 3HOTA 1KFTA 4JI3F 2O5DA 3ONQA 2R7QA 4IFYB 2F1JA 3VMFB 2PFDA 5ALVA 3ZDCA 1RT2A 4LR9A 2HG4A 3CERA 5J2GA 1PAUB 1MN8A 3D9BA 4YB6A 3IA0A 4M45A 5J0UA 4EMDA 4G65A 3NVZA 4KLMA 2YKOA 1Z3EB 3D3BJ 1Y4ZB 3BB5A 3I6PA 2EC2A 4Y2VA 1C0GA 4CRJA 3UI3A 1VQNS 4M9GA 2DPIA 2ZNYA 4NXNF 3QLHB 2AD9A 3OS2A 2MQLA 1JJHA 2E5JA 1KP6A 4K4WA 2DGWA 2IOCA 2DNYA 2QWNA 3TJ8A 3HFVA 2PMWA 3HZ6A 1HQUB 4CJVA 2E1CA 4U8YA 2QA4G 2K1RB 1TUGB 4LMZA 4XRHA 4JN4A 2V67A 2UUTA 4DUYK 3KWMA 1HKAA 4KH4A 2KZ3A 6FDRA 1OQ6A 4ZVOB 4DR3F 2EBGA 2WVBA 5BOLA 2FY8A 4GIBA 3UPQA 2GVZB 3N6MA 4N5SA 2YX1A 4AHVA 3GIMA 4KHPF 2NZ4A 3LDLA 1KCFA 3TADA 4UB2A 4DR6J 3U9ZA 5D4OA 4FPAA 2V2QA 1ZPVA 2OFGX 3LL3A 2YX7A 1D3WA 2IDEA 1VQ5N 4CBUA 1ITPA 1Q9XA 2WF9A 4W4MA 2RQ4A 3IHQB 3DM2B 4NLSA 3F0NA 5LSOA 1KFDA 1WUDA 1UEUA 5J1EB 2HS3A 1HYVA 2E4LA 1FJGJ 2IGIA 1KTVA 3H0RB 2UUAK 2E88A 2DEJA 4RQ5A 3NGKA 3C66A 1WG1A 1SJ1A 2JC0A 2YX8A 4KO0B 4BR0A 3SEIA 1ZQPA 3C8YA 2BZ2A 4DTSA 2KW4A 2XYPB 4A4JA 5ELZA 4NCGA 4IOAQ 1UA0A 1GMUA 3H1VX 1W7AA 3GIKA 3I56S 2R8KA 5ALLA 4QAGA 1AUSL 1J2VA 1KQSR 4IH6A 2P2CB 3UM9A 2M3DA 3PVXA 3L7OA 5HK4A 2YX6A 4IEEA 1TKDA 3Q8UA 4BGAA 3FGVA 3OR2B 2YTUA 1MSWD 4Y28C 4CIGA 4NB4A 4J9UE 4BRLA 4KHPK 2ZIXA 4F7VA 4PG7A 3MOJB 2HVIA 2YNGB 3V5RA 5KFMA 1AT1B 1GLBG 2QA4S 2BJ1A 1VK0A 3DRRB 3ELHA 5KTQA 1RT6B 1UTAA 4KO0A 2V4RA 2MTLA 2P9NB 1Z00A 4ISEA 1VRTA 1NUEA 4K4YA 9ICMA 4YY3K 3PFOA 4QZIA 1GX6A 3HHEA 3FFKB 3BZCA 1HNVA 4OYAA 4C4WA 4Y2PA 4V19X 4LFAK 4ELTA 1FRIA 3PKYA 1JKHB 2OSQA 2OWOA 3SK3A 4DSJA 1FDDA 4I6WA 4FJJA 2KKPA 1ZQUA 4DV4F 1AUDA 3J7YU 3Q8VA 3I55N 2UUBJ 4KMOB 5KFXA 2MZTA 5F2RA 1WNSA 2D7SA 2F8MA 2P9UA 2RMLA 1KEKA 3NGYA 1S0OA 5E3RA 1CS4B 2EI5A 2HDOA 3MAAA 3CJTA 2QSWA 4NLTA 3MDQA 3PSTA 4O44B 4BC5A 5L9NA 3SBTA 2GMHA 4NPOA 4E1JA 5A6WA 1EHWA 2FZKB 4FYWB 4C80A 4CHZA 2H51B 1Z26A 1UJ4A 4DHYA 4J37A 2ZGZA 4ACOA 5J2MB 4W5QA 2AYGA 2ZJQL 1OIAA 2B0GA 1MN7A 4KHQA 3WDOA 2Q66A 4QWEA 4KV8B 2RD5C 1S97A 2R7UA 2HOQA 3D2EB 4E7KA 3MEKA 9ICLA 4IRCA 2E1AA 1RZMA 5AE3A 2CJQA 4OLPA 5C2GA 2VH7A 3MECA 1JMSA 3CTRA 3QIPB 3DRPA 4FK0A 2H3FA 2KTQA 3ISCA 1GTHA 2F8HA 4MKBA 1B4FA 2VGNA 4I7FA 4OHXA 3D54A 3B0YA 1RHJB 4MIAA 1KRPA 1JK9B 2MLXA 3MGVA 3UD3P 1N4LA 3MXMA 3LF0A 3HK2A 1QVGM 1YF5L 1LNQA 1W97L 5KNIA 1WSHA 2P5VA 1FT8A 4LF4K 2XY8A 3KKRA 3HHLB 4OI0A 4J8FA 8ICMA 3KLFB 4U67Q 4NM1A 3IO1A 3PM9A 3O4WA 3G96A 4YR0A 4CHNA 2FLLA 4NI2B 3A3OB 1RYSA 3PRDA 1L5UA 1UWBA 4UY8O 3OL7A 2YQ3A 4CGGA 3PRBA 4Z4FA 2QYGA 1YGYA 3LTOA 3OD2A 3BGFA 2H5IB 1XQSC 1YRUA 2KDOA 2QLXA 4C6AA 3FQLA 5DDMA 3BM7A 2L08A 4A59A 2LXIA 1VR6A 2D1CA 1ZQXA 4X65J 1IBLJ 3TAFA 3HP6A 5EGYA 4P52A 3A2FA 1PK3A 3QJJA 2PFNA 2GELA 2EZZA 1RDFA 1JRPA 1YKWA 5CCLA 4CGIA 2ZG6A 3DXBA 3OA9A 2CH5A 3ITHA 5AKIA 2C3MA 1WKLA 2AJ2A 4G1QB 4JKDA 4OQJA 4JNEA 3FFIA 2V8GA 1NJXA 2XHCA 3AEVA 3DN9A 8ICCA 5HRSA 3ETOA 1SIZA 3MPUB 3M2RA 1TAMA 3O5BA 3JPNA 3J81O 4QS8A 1NGJA 1XERA 4F72A 4Y00A 2EVZA 3O9SA 3T1YK 3RMBA 3BS7A 5DJBA 1DT9A 4CESA 4CNQA 4WP9A 5MLCQ 5G5HA 1PK1B 1CRXA 2IRYA 2M4MA 2E1RA 2WAQD 4FO6A 4ZPWR 3VR1A 2OYQA 3GYXB 4OCZA 4M5NA 1VCTA 4C48A 4RLEA 1VQKN 8AT1B 3I96A 5ITHA 4KMUA 2VQFK 3L2WA 2HWHA 4WU3A 4M3YA 3ENWA 4NOHA 3CJ9A 3C0BA 3AVFA 1CJTB 4XPEA 3HKZC 1ZBTA 4I69A 2E1EA 1NK0A 4FZZA 5ALUA 5DB7A 4H0PA 3AB2B 3CNHA 5B08A 1DGJA 1G99A 5LSRA 4HI1A 4OYZA 5AQWA 3AO3A 2KJ9A 1HBMB 4W98A 4XK8C 2RDIA 3P31A 9ICHA 3MCPA 3HSTB 4JKEA 4PGQA 5B0DA 1ZQBA 2ACYA 3RAXA 2GOLA 2I0XA 5AQMA 4M42A 2OPQB 4CF1A 3QPIA 4CH0S 2LM1A 4WE1B 4DPUA 3J7YI 4P2XA 1Y64A 4USUA 2GBZA 2MSSA 2ZD1B 1FX4A 4CVNE 3JPPA 4Z4HA 2W7PA 3S1TA 2VL1A 4PKGA 3R1XA 2GVDA 2Q2RA 3IN5A 1AROP 3OUYA 3FJ2A 3W64A 3S7RA 2NYVA 2HBKA 5KFKA 4ED6A 5HL7Q 4FF2A 3JQMA 2G08A 3BN7A 1LW0A 3HPHA 1IQZA 3AXMA 3BSNA 2X1FA 5H9FK 1FA0A 4MTPA 3D1OA 4HHHA 3LW5C 3MM6B 4KR0B 4X4PA 4KTWA 4JRPA 3PW2A 1ZM4A 4TUPA 3BYPA 9ICKA 4K4GA 2PI5A 1HR0J 1HNIB 1XNRJ 5J0SA 3MABA 3WK7A 2KRBA 4FF3A 1I51B 1PZNA 1GMWD 3FBFA 2VZ9A 8ICUA 1DTQA 3QQCD 2MQOA 2W9BA 1QUVA 4QIWC 3OSPA 4DOCA 5L38A 2BKNA 4JK8A 3VQQA 2HBRB 2HQFA 2D0OA 4ISGA 1AZSA 2ZH3A 1HR0F 4RQ1A 5B8HA 5KOXA 2ZBCA 4RW4B 3R1HA 2HI0A 4XO0A 3TAMA 1LWCA 5AR0A 3NEKA 5K14A 3SBMA 3QRRA 2CKWA 4IFEA 4EEKA 2FMSA 2F65A 3ILIA 2V52B 4WFNL 4KPYA 2FHMA 5KG6A 3LWLA 4KI6A 4LSNB 4BE2A 1Q5VA 4UASA 3QU2A 1V4TA 1OPIA 5DS7A 4B3TF 3C5GA 5FDLB 2WB4A 2P9PB 3Q0AA 4K2XA 4Y2MA 4RW9A 4LF7J 5BR9A 3HT0A 2I8EA 3MX5A 2LXUA 1HBUA 4OJ1A 4O0JA 2O8BB 4LF7F 4LSZB 1VS3A 3C15A 1NHKL 2N4CA 5T7LB 1SB3C 3SMVA 3H40A 1LWXA 4HVZA 2D5RA 4RNMA 3VQ8A 1NKEA 4OZJA 3FZHA 4B3MF 2RKIA 2JR5A 1PJ5A 2P9SA 4J9PA 2FVPA 2X6SA 1QAIA 3PCOB 4WZMA 3AT1B 1ZQEA 2MPUA 2A6MA 3O3HA 3QT7A 4LJXA 4IH5A 2A2CA 3FVYA 2GV9A 4AHSA 3CCQS 4F50A 2W1BA 4L76A 3LM9A 2XMUA 4DU8A 1FFGB 2C3PA 1NBWA 3W8GA 2WFBA 5IWAF 4QWAA 1X4HA 4FM1A 5AICA 3ET6A 8ICVA 3K75D 3IFEA 1T05B 3ETRA 5KG4A 8ICEA 2HF3A 4OHWA 2UXBF 1WAFA 2ZUDA 3C94A 4I2IA 2IOHA 1Z1BA 3BKFA 1UA1A 2Q1LA 5C2FA 3HFZB 3MMVA 4X64F 3EX7B 2U1AA 2Y1RI 4BROA 2ZIXB 5AM2A 4OI2A 1S76D 4XDDA 1HHTP 2DGXA 3IBWA 3WK5A 4NA2A 2AW0A 2QL5B 2CQPA 4LR7A 4JI2K 1MA9B 5ETQA 2YWFA 1S79A 3AVNA 5FDLA 2IRXA 1RWVB 4ETXA 2DGZA 4DV1K 3ZZPA 2D6FC 2A3VA 3NXZA 1S7HA 5KFLA 4M04A 1JLGB 3FCHA 3PRVA 5ETKA 2BX6A 4R5PB 4O55A 1ZS6A 3ZX2A 1X9MA 1CG2A 1T9XA 1ESVA 1VJ5A 3NTUA 3CM6A 3O8MA 3L3VA 2C2RA 4CLZA 4OZ1A 4M3TA 5F3ZA 1BE4A 4PWDB 4LVOP 2LP4A 3HSDA 4NX9A 4RW4A 5DETA 3I5AA 1KBUA 2VFSA 2OTJN 2VG7A 2GIRA 2EZXA 1S1XA 2CADA 3HI9A 1Y3JA 1WF0A 1RWUA 3C7NB 1WBDA 2G1DA 2HGNA 5AQHA 7ICIA 2DH7A 5M1KA 3CCJS 1CC7A 2E9ZA 4FJXA 8ICLA 3HYFA 2GWSA 4KLLA 3P3DA 2KIVA 2PKEA 5HHIA 2MZ1A 5A0LA 1QDUB 1VBXA 3TVYA 4LF9K 1X0PA 3SR6A 2XM3A 1RXVA 2G13A 3M8PA 1IJJA 4CLPA 5AM1A 4M9HA 3TAQA 2DGOA 3TARA 4DUYF 2N7YA 1LFPA 2B5JB 2N82B 1IKXA 5GMDA 4K5SA 3QT6A 1XUPO 4LH4A 3CCLN 1S9GB 3GFXA 2HHXA 3GYGA 1UP1A 1RT6A 2OFHX 4WFAL 2W9MA 3CC4N 3A13A 1RLDA 4ZCIA 3WC0A 1J54A 3D2FB 5M1NA 1SV0A 2OPSA 3SIPB 4DB3A 4LFCF 2KXNB 1JLAA 5F8JA 8ICRA 3W3SA 1AA1B 1NI3A 1ZAVA 4RW7B 3RW7A 4O3NA 2JZBB 5D78A 5GADI 5AK4A 3VVTA 2CH6A 5AKJA 3CJKA 9RUBA 1RGIA 2ZIUA 4Q44A 3C28A 3HX9A 3OTCA 3PHTA 1X60A 1L3UA 1FO4A 1ZETA 4CLFA 2CPRA 1H2UX 4MKAA 1D9AA 9ICUA 2ZVIA 3WKAA 2Z0GA 3C6HA 2LM4A 4OYWA 2JOQA 4J9RA 7ICTA 5SWMA 2IDLA 2V94A 1YDLA 2G8HA 3J7AP 3AA4A 2CPHA 1LAWA 4R66A 5ADXA 1KR4A 4TN2A 1UW9A 2DKOB 4CF9A 1BOTO 1U8SA 1W2IA 1X4AA 3Q86A 1TK0A 3JTNA 4Q0BA 4EI2A 2IC3B 3ISZA 3AHPA 1Z4NA 3GU0A 5CE3A 5D15A 3D45A 3OTOF 3ZDAA 2HBLA 2EX3A 2RUGA 2CFXA 7ICGA 1ZQRA 1P9QC 1NOMA 1VQMN 3MWPA 2VFRA 1KD1T 2V9KA 4DV1F 1S72S 2E9TA 1WORA 2BQ3A 2DNLA 1RWXB 4DI6A 2XZWA 2K89A 3PUFA 4IQXA 4CT8A 4B1WB 2ZXHA 3ICXA 3OR1A 3JPSA 3AM9A 2ITMA 1FFSB 3D2QA 5EX5A 2XCAA 4JS4A 1X4BA 3T1HF 4GVLA 2EBEA 4GVBA 3R5JB 2CJXB 3ULEB 1F2GA 4BR2A 4WYWA 4G1QA 5KGXA 5J2CA 1F2HA 1N5XA 2E8NA 4BRPA 3W7BA 2LSNA 4ZPVR 2XMWA 1PYTA 2ZBPA 3VV2B 4ILRA 4WZQA 2KLAA 2WF7A 3QX7A 2BUPA 4B8CA 1S9EA 4IQMA 1L8LA 1NJIO 3CDBA 1DRZA 2DHHA 1B22A 2BE9B 3D7EO 4GVBB 1VBYA 2W2OP 3DWLA 1N34K 4S0MA 1RT5A 1K47A 1T3OA 2DTJA 4LF9F 4H4KC 1JLEA 4MLEA 3K4GA 4LF7K 1HWUA 3D28A 4AM6A 3GPAA 4CO0A 3UB5A 2LMRA 3W62A 3P4IA 2J7UA 1E6YA 1R0AB 4NLNA 1TAQA 2JV3A 4MFBA 1RTJA 2YNIA 3QZ7A 1RADB 3CD7A 5J2NB 5HMWA 2EFGA 1VQPS 4MLHA 4DU1A 3KYLA 1ZBHA 3IGVA 2O8DA 4K25A 3VEYA 2D69A 4PG8A 4DR7F 4ALZA 2WONB 2AV5A 3ZTQA 4C4RA 1PVPA 1TV6B 3HHLA 2ZWPA 1XN9A 2K8GA 1S1TA 2DEIA 4DMNA 3D6TB 2BJ8A 2P8IA 1YZ6A 3GG4A 4ILLA 2FXUA 2FE9A 1D8LA 1NZ8A 5G0RB 4PZVA 3QEXA 3H8MA 3DDIA 2LEBA 4MHVA 5C5JA 3U9DA 3GFYA 4L3QA 4CEEA 4DTJA 3UDVA 3QUTA 4E2FB 4OPHA 2K7JA 1X8DA 1UZDA 2D3DA 4CZJA 1VJQA 3IFRA 4HCCA 5JLHA 2O4GA 2VV5A 1IBCB 1BPDA 4RW7A 3CQYA 1RABB 4I56A 3RMCA 5ALYA 2PFUA 3RWUA 4NLKA 4RWWA 4OYXA 4YEAA 3DLEB 3THPA 4UBBA 5J2DA 5AE2A 4PG5A 3PYGA 1JUDA 2CNLB 3C6UB 3WK9A 1BPXA 1N5YA 4C3KA 2KHDA 1DGSA 2LI6A 2DNQA 3P45B 3R5BA 1L3VA 2E7VA 4KX5A 4HTJA 3CCSN 1RXWA 3GONA 2B5JA 1HNWJ 4GXIA 2O4IA 3MM8B 2WBMA 1RHQB 2CPEA 5J0YA 4BX9C 3ED5A 3SDEA 4F93B 2BPFA 2GQQA 3K8WA 3MN5A 3QYYA 2NV3A 4KTQA 2QA2A 1RDCA 2I5JB 4FK2A 2DCLA 4NCBA 1KLMA 2IAJB 4IQVA 4BDYA 3EGWB 4I2CA 5J2PB 3R2DJ 2IMWP 4G1PA 2FDRA 4DV0F 3T7ZA 1IH7A 3LQVA 2E3TA 3LAKA 4HCBA 2YH0A 1JKHA 2X51A 5ETSA 1SS6A 2RILA 3QEWA 4MIBA 3GQCA 5JVGQ 3QNNA 3PIOL 3C19A 5CZ2A 4ICLA 3J81U 2CQHA 1WWVA 5EY4A 1WD6A 5E41A 3TX0A 1MWMA 3NCQA 1ZQFA 2MQQA 2ZJRQ 4IO1A 5D8HB 2NUBA 2KSOB 1LV5A 2M88A 2D0AA 2MZQA 4I2HA 1REVB 4NYOA 3UQ0A 4JI3K 4OVLA 4PHPA 2DR6A 4ZPTR 1MNEA 5KFSA 2AIRB 1NK8A 1JL1A 1LWFB 4BY9C 3CJ2A 3DLJA 2QL9B 4JK7A 2AEFA 4UY8T 1BUXA 3IBPA 1XR5A 2Z1IA 2GLEA 4DG1B 3S01A 1NHUA 5KT2A 1N56A 5T14A 5KPZA 3R5GA 2CQ1A 1XR6A 3DNCA 3A5OC 4O3MA 4CLLA 1BPBA 4CEFA 3OVAA 1SB6A 8ICJA 4LFCK 3OYMA 1FVSA 3BBFA 3L3FX 4M95A 2CJYB 5J2HA 4ZN3A 2NLXA 3WXIA 2DFEA 1K8KA 1XMOF 1YQHA 1X9XA 5AQVA 2M5YA 2X6NA 4GY2B 1FKPB 5C2DA 4USTA 3THYA 3DGPA 3OV7A 2W6LA 4C8ZA 4FWMA 5KG7A 3DLKB 1WC3A 4QR1A 3QICA 1M90O 3NG8A 1VOMA 4DG1A 5LXYA 1T95A 4X4OA 1NH7A 2CZ4A 3WK4A 3HOSA 2AQ0A 3CDAA 4JLHA 3KKAA 3AO1A 3OTOK 3J81j 1NMEB 1QAJA 1PVQA 2R2UA 4ZJLA 3FEZA 2ZE2B 2YHAA 3P5BP 1HJRA 5HRNA 2EKNA 2MZRA 4YHHK 2YXLA 1R6YA 3RUBL 5HBMB 3QBXA 1HJPA 1HEKA 2Z8QA 3EVWA 2BDUA 3Q89A 5AQPA 1R43A 3FZKA 1ZBLA 3Q83A 4YXMA 2A41A 2HZCA 2H3ZA 3UMCA 4LSLA 1B0XA 4ZS6A 1W0HA 3DLGA 3ZD8A 4F4AA 4GV6A 4MKVA 3GL1A 4OGEA 1TKZB 5FPDA 4QZHA 3BO4A 1JCEA 2Y8WA 3T19A 3AVMA 3KHLA 4Y65A 5BYRA 3DOMB 1S3XA 4CFAA 2ZTCA 3SV4A 3H5YA 3SQ4A 1Y7PA 2HBJA 4E8UA 2OANA 5FROA 4EENA 3D1QA 1R0CB 4Y3CA 3M6XA 4US8A 3MM9B 1J2MA 1KVJA 2FLNA 2IC3A 3FSYA 4CLKA 2XC9A 3JAMU 1TUUA 1P90A 4RT2A 2AH5A 3D2WA 2A1RA 3FQKA 4BDZA 4KJIA 3HKZD 2UU9F 3F44A 4O5BA 2LKZA 1ZQCA 4O5KA 3PFEA 4PPDA 2MU2A 3AH6A 2B3TB 3A4TA 3JQJA 2W43A 1U1OA 1ITGA 1QVFR 2CVEA 1D9FA 4OX8A 2HBMA 2G2YA 2BW7A 2XWXA 1VDHA 3BJYA 4QIWF 4LIRA 2ZZMA 3QRPA 1Q86O 4WFBL 3T6JA 2Z56B 4PJ0U 2AXTU 1HHSA 1T9TA 4FJNA 1S6UA 3W5ZA 4U67L 4DDFA 3C6TA 1HBOA 4LF1A 4CJSA 1MQ2A 4AYBC 1IR1A 4DEZA 2EPIA 4KLHA 2PMZC 5B5EU 5AI5A 1M1KO 4PL7A 3O5TB 4MFCA 2CA9A 5K8MA 2W3RA 4M5GA 2DPNA 1T03B 1WG4A 3H3NO 2IVFB 1JLAB 3SQGB 2YQ0A 1NCLA 2W2PP 4OLBA 3M8SA 2I2YA 4BACA 4CNZA 2PD1A 2P6UA 3ICLA 5KPTA 4TLQA 2YMLA 1HNXJ 1O1WA 1L3SA 2CXEA 4FYDA 2NZTA 1UVMA 4CERA 4HL9A 3SQGA 1IBLF 3JB9k 2K06A 3WXKA 4KREA 5AQXA 3KHHA 4LFBK 4JI7J 4ZP8A 1RWPB 4HT7A 2YNFB 2WONA 2HQ3A 2ZZTA 4JRQA 5BRFA 2Q0RA 5IQ6A 2OZSA 2F2AB 3QERA 3N7RC 4Y2UA 1WWUA 2JSXA 1NLVA 2AJFE 4YOWA 4ISFA 1HMVA 5E79U 3R27A 1VSJA 5M2PA 1Q7YO 1GXTA 1S6PB 3WKEA 4YFKA 3SBGA 3I87A 1GAOA 4DSLA 1F5SA 4Y0WA 4DN0A 5AJ3F 5MAOA 4QOTA 2VA3A 2UXBK 2BA9A 1XWLA 1IM6A 3IC1A 4UW9A 3DLRA 3T9ZA 3CMAS 5D4NA 4O5EA 4DPOA 4M94A 1N8RT 2P6SA 2XB2D 2VKZG 1RILA 1PG5B 1Q0NA 1N5YB 3SCJE 4BRQA 5JICA 2CJBA 2CJAA 1BD6A 1KOHA 3MR6A 2JVOA 1IJFB 1TKXA 5EVZA 3CCLS 4UT4A 3O9TA 5ALIA 2HLUA 1U6FA 3MGJA 3W5YA 4JI4J 1OY8A 1TL7A 3IWXA 3N4PA 3VF0B 3ULEA 2DITA 3FC9A 1DTTA 3QU5A 3QGPA 2KKZA 3DLBA 4DN9A 3PDNA 4YNQA 5CYQA 3B6OA 5A2QO 4ER8A 1N5TA 3UCZP 4QU6A 2YV0X 4J2DA 2EEYA 5FJ4A 3A12A 2JLGA 3QWUA 4FWLA 1N48A 1XC3A 1KVBA 2E1ZA 2ZDPA 5L46A 4X4QA 1S59A 4KFBA 3G8SA 4I1TA 1QJHA 2IBOA 3KZIU 4FJ7A 3H46O 3P96A 3ZDBA 4NI2A 4IJAA 4GMKA 3DXSX 2H3QA 2MXYA 3KLVA 3M1VA 5AQIA 4KHUA 1RU1A 3TWZA 2JWKA 5AKKA 4NYFA 3CMEN 2F7TA 3ZO7A 2V2ZA 5LOQA 2VONA 4UB3A 1ZBFA 1YVUA 2QWMA 1JJ2R 3IP0A 2V51B 1U04A 4CJFA 1J5EF 2YTCA 4DR2J 1RBRA 1I3AA 3O3GA 1AFJA 2KRRA 2P9KB 3NGRA 2XS7A 1Y5NB 4JV5K 3DRPB 3QUCA 1M1GA 4CZHA 4I6MB 4CHYA 2L5YA 2WUSA 1XO0A 9ICSA 3HHLD 4HEA9 4XH4A 1Z6RA 1NK5A 1S9EB 2E6LA 3K59A 4IQWA 5GAEI 1RDUA 4FPIA 3T1YF 5J2MA 4RQ6A 2V50A 4EAHD 4UB1A 4IEIA 1TKZA 1FX2A 1SQFA 4B08A 2D9PA 1TVRA 3AGKA 1T3QA 4NMLA 4X62K 2BOPA 4P2SA 5IWAK 4NLUA 4P10A 4CHOA 3KTQA 2F7VA 2G0CA 4NE9C 1GXUA 3M30A 1JLBA 1NH8A 1NMDA 1KVAA 1GNKA 3ISDA 5GVQA 2JMGA 2YB4A 1IBMF 1C0UB 2JRSA 1E3MA 1NMNA 1A6LA 2GWKA 1FXLA 1J27A 3M1FA 3RR7A 1R8PA 1OH5A 4HUFA 4DV6J 1UQVA 4USAA 2G9OA 2V0NA 3CO0P 3QO9B 4A48A 4LF9J 4TQRA 3SAHA 2BEFA 3KZBA 3IP4B 2K3KA 3JPRA 4BC9A 2OTLN 4C8YA 3OJSA 1KHVA 5GADU 3EYZA 4Y2RA 4PPZA 4RX6A 4F36A 4OYMA 2ZUBA 1X4CA 2B4OA 2KZMA 8ICHA 5IXUA 3WQUA 3B8HA 1S57A 1WSGA 4OPAA 5CYJA 4BRIA 2Y8YA 1TE2A 4RW6B 2G2ZA 2BH1A 4BG9A 3SSSA 4NMXA 4Z7YA 4OKEA 1NJIT 3DU5A 2J9CA 3MURP 4OJRA 3WX4A 3WQPA 4E1NA 3I1YA 2IJFA 4O3PA 2MSTA 4W5RA 4CJ3A 1CJKA 2NXEA 2B43A 2QWLA 2XMKA 4JKAA 5FP0A 3UDCA 4KLOA 1KDHA 2RHSB 4QZEA 4DOBA 1YJTA 4M8LA 3VQ9A 1PJ6A 4BC4A 3HVAA 5JLFA 4B1VA 1RDWX 2YQEA 1Q46A 2X74A 3M1YA 1UAXA 2XG8A 1T03A 3RR8A 1HI1A 1WTFA 5H1SV 5IIOA 3SCXA 4GVEA 8ICTA 4Y2KA 2F8SA 3PMNA 4M6WA 3NVYA 1H74A 2HRUA 2QLJB 4OJHA 1WG8A 4LZGA 5B0CA 4PY5A 3HILA 1KBRA 3CCVN 4EK2A 2QA1A 3SAFA 3FSXA 5B7WA 2YHBA 2ATQA 1O8BA 1OQ3A 3EKUA 8ICYA 2ZJ8A 4CCHA 3GJSB 1BI4A 4QOZB 3THXB 1O13A 1R89A 1Y00A 4K7QA 3BUZB 1JXEA 3BSCA 2QYCA 3C15B 3NH2A 2M2BA 1U25A 4DWIA 2IYGA 4AXIA 1ED1A 4F5OA 1F6TA 3QIDA 5E3CA 3AVHA 2VBXA 2YBVA 1G6BA 3NWRA 4NCAA 3H4DA 2FLPA 3SUPA 2G8IA 3OYDA 2PDAA 4IOCQ 1KC8O 1IUJA 3EDRB 2YMPA 2AP6A 2IJRA 4ED2A 3RRHA 4QZFA 4FVCA 5KT3A 4IG0B 4U7CA 1XTZA 2YKPA 2JFKA 4FLYA 5K14B 1T9VA 3VF6A 3AVJA 3AUOA 2BKEA 3TP2A 1I3OB 3GIIA 3MFIA 3ALRA 3S3MA 1ZQSA 1SQKA 1TVRB 1X40A 3GE1A 4JI6K 4DOZA 4BQZA 3D6MB 1A5XA 2HLTA 3ETLA 3MBYA 2I6WA 3VC8A 2B4PA 3DRSA 4EHTA 2E20A 3R5AA 3NVMA 1DTQB 4PKDB 4DR1J 1H2VZ 1O08A 3KG4A 4PQUA 4QZ8A 3NFAA 3CD6S 2OPRB 4PXBA 1RSCA 4RUAA 1PAEX 2ADBA 4O8UA 1J53A 2G07A 2HBZB 2X78A 3B6PA 5KRSA 4RUBA 2NR0A 4OYBA 3UR3C 4CZMA 5AKEA 2H54B 1DY3A 4C2MA 2DNZA 4EO6A 2DISA 4FJMA 1RHUB 1Y88A 2EAPA 5L8RC 2DNRA 4CO2A 1C0TA 2V63A 2J6TA 1N0VC 1LW0B 2HQDA 3LP1A 2HF4A 4GKJF 3CF5Q 3R97A 2J0XA 3T6BA 4MFBB 5G4DA 3CC7N 3AU6A 4ZVUB 4I6AA 3PIPQ 3U4LA 4QWCA 2YPZA 1RTIA 4LRAA 4WFXA 2NRZA 2CDQA 2ZJPQ 1RWOB 3NUQA 1QS4A 3ENHA 2VIHA 1FIQA 1WUAA 3QUQA 2DXDA 2ZIVA 5KRTA 2IDOA 4WFAQ 1HW8A 3ISBA 2QSFA 4RQ8A 3T1HJ 1Z1VA 2FBYA 1FDNA 4WE1A 2R8JA 3CFPA 3TANA 2JZBA 2GAHC 4YOVA 1RBOB 4KHYA 1D8YA 4ID1A 2F8KA 2WB1F 4B17A 1UVLA 2IYIA 3QEPA 2KIWA 2VG5A 1H98A 4GC6A 4Y2TA 3P39A 1PYOB 3AARA 3FDSA 1HNXK 3CHWA 2LPEA 2ZEJA 1HR0K 1RB0A 1W26A 5AIAA 4IH7A 1VISA 1XNRF 4F2SA 1UJ6A 2NPIA 5IWAJ 2JLFA 1X5OA 2GAGC 3PJXA 2YHXA 1F9FA 1SL2A 3TZYA 1R31A 4KLFA 4H4OB 4DL4A 1NDCA 3L4BC 2NQPA 2W9CA 2FJVA 1PBUA 2KJ8A 5C12A 4F02A 3UN5A 4B3MJ 4J2EA 4B3OA 2VPYB 5AK5A 3IWNC 3R3TA 2IFXA 1U24A 1WYGA 1RA6A 3AAWB 4ZTJA 3CIPA 1MN9A 2A1BA 2VHGA 1TL3B 2IOFK 3GB0A 2HHHK 4I9QA 4OHZA 2KKHA 4MMOA 4I27A 4X4RA 1B9DA 2QTDA 2HFVA 3FYHA 5CXTA 1EIYB 4BCAA 2W9CB 4OX7A 3OXLA 1SC6A 2B6AA 1ZQMA 8ICAA 2AHOB 4UOFA 2ZH9A 2KHOA 4BXOA 4TKTA 5E33A 4M63C 4Z94A 1TQLA 4IR1A 2B4UA 4CFDA 4LF5J 2PEBA 2ZH2A 4PKIA 5C15A 1Y9OA 1S6QA 1HUXA 5CCMA 1R8BA 2WRMA 1KQQA 1DRGA 3VAMA 3LDSA 1TL1B 2JRZA 3NAHA 4DR1K 1QTMA 4DX7A 3HWTA 2F8EX 3LZIA 3RJJA 2RQCA 2F4VJ 4DS4A 2RQKA 5IFMA 3MD3A 1NEEA 5JS1A 2EW9A 4Y2AA 2P9GA 1H72C 5D0HA 1HRHA 5A8KB 2HHUA 3RMAA 2J5AA 2GHWA 1VQYA 1IM4A 1FWKA 2DHAA 1N36J 5LL6Z 4LF6F 2OIHA 1ZQGA 3R5CA 3QU9A 2XCPA 3P4UB 1F9HA 2ZTEA 3KG0A 2MKIA 4JHDA 5B0EA 5KT4A 2KVSA 2XBPA 4MYTA 4KHSA 2DH9A 1SKUB 1ZM3A 7ICVA 5B0BA 1ECWA 2NRVA 1RXOB 1B70B 2F4FA 1YITN 3V1OA 1X3MA 2DQNB 4ZVGA 3L8BA 3BSAA 1K0VA 5F41A 2HHQA 5F8NA 1HWLA 1RNHA 4WK3A 5KGWA 5ETPA 1NNDA 2D0PA 1Q9YA 2GHPA 1N5QA 3GR1A 2M52A 2FIUA 1SCJB 4J9KA 1CZ9A 4CH1A 2ZJRL 4ZVSB 2E1FA 2FBXA 2XLJA 2C2ZB 4DFDA 1Z05A 1NJWA 1JLQA 2FC8A 2J7KA 1P27B 3C7NA 5KFTA 1YJVA 2PMHA 1YJUA 3GILA 2LEAA 1DKGD 4RUCA 1L7OA 2MUTB 1U0HB 3VETA 4MFAA 2E44A 1TAUA 3QMLA 4KITB 3JSMA 4MJKA 5IT4A 4CEBA 3VEWA 3ZZ0A 3I33A 4F5QA 1EETB 2VC1A 5F8MA 3J80Y 2YCHA 5CQGA 4DCCA 2GIQA 5ALDA 5A6PA 3AA2A 1TL4A 2J9DE 1Q81O 4HDHA 4ECVA 4N7TA 3IV6A 3M8WA 4RQ3A 1ZD2P 2P9LA 1U49A 4CDIA 5ETMA 3M32A 3AA9A 2ZWOA 2FDNA 1X4GA 1U2FA 1E4GT 3BV8A 3NHGA 2HHHF 4A8KA 4PUOA 3OS0A 4DFKA 4BVPA 1N88A 2DKXA 5HMZA 5ALTA 2ZHBA 3N0VA 4KIAA 2RE1A 4BRGA 3FUYA 3TR5A 3KUGA 2JL9A 2JVRA 2E8AA 1ZH5A 2NXNA 2H3VA 4DUZF 2Y1JA 1Z4UA 3OHAA 3AO2A 1ACMB 4DV2F 2MA1A 4CWBA 2IVOA 3IRXA 3S41A 3WNEA 1ZQDA 4JYAF 3A5NC 4FWKA 4JD2A 1QUPA 3CNQP 2BYCA 4KLIA 1VQ5S 2MGZB 3V7KA 4AYBD 3TA0A 4JBCA 4Z7CA 2GJFA 4GRSA 3JTOA 1HNVB 2V4JA 3Q8KA 4JEPA 2DL0A 3D3CJ 3BSOA 1YT3A 3CJ3A 3CXCR 4A8QA 4M0AA 4ZCMA 4Z2XA 1RE1B 3C2PA 3CCRN 1ZBUA 3R7BB 3MPYA 5E2QA 3DXKA 4JKBA 4PAAA 1Y0HA 1K8AO 3AJDA 3HPGA 1URRA 1LKYB 4FJLA 2QKKA 1T6DA 5HMLA 4WIIA 5AE1A 4FZNA 1C2PA 5AM4A 1IKWA 3CDWA 1UOCA 2VQEF 2UUCF 1T6CA 2GO7A 1UEKA 4FXDA 2FJWA 4NXMF 4IS7A 4KE5A 1VQ8S 5AKYA 1NPKA 3T1YJ 1BC6A 2ZIWA 5CYMB 3HHKA 4G6VB 3AA8A 1C6VA 3Q7CA 5AM3A 4CFCA 1LWFA 1ZQAA 5AKLA 3RJHA 2EQYA 4HUEA 4AFFA 2Q6CA 3DOKB 2NRTA 1OSDA 3ZT4A 1VAZA 2MHNA 4YQWA 2NSCA 1S72N 2HWIA 4JB8B 2JGAA 2WOMA 2XZDB 4CJQA 1KOOA 2SXLA 1GMWA 2VANA 4K0KF 3M8QB 1GQEA 2HEKA 3HXMA 1WSIA 2DGVA 1FRJA 4JAXA 3VAKA 4KQZA 1WHVA 1HA1A 3M8PB 4KGKA 5KL1B 3F5EA 4BR5A 2FC0A 3FE1A 3MMBB 1PK1A 1N33J 1K73O 4ERDA 1NXIA 3BDPA 4RG8A 4F4ZA 1NRKA 1NSAA 2OP5A 2QXLA 1FJGK 2I5JA 2KB2A 2J76E 3C1ZA 3SQ1A 4BR4A 2AU0A 3KNGA 3U8XA 4DSIA 3VZHA 2LXFA 2UVUA 1AYEA 4K59A 5CHCB 3PEHA 3OY9A 3DJCA 4U7UK 4CFBA 4PWDA 2VFUA 2BBEA 2D74B 3M9OB 4RBUA 2UP1A 4A5AA 1KAYA 1ZBSA 3FCWA 4M5JA 3MDCA 3M32B 2B4JA 3WNFA 1FRLA 1EAYC 2F44A 3OUYB 1O0PA 2GVDB 2LCWA 3FM9A 1OH7A 1SXDA 2RN2A 2VFVA 4OKKA 2OELA 1C1BA 5GADP 2YNGA 3RVCA 4J9VA 2WTUA 1YHQN 4J90A 4JI5J 2ASYA 1GLJO 2GWJA 5IM0B 2NRHA 3BGUA 3QZ8A 4H0TB 4RU9A 1IG8A 1EWQA 2DKZA 4PG6A 4I2QB 4B3RK 2KMDA 3E1YA 5K4LA 3ZSYA 5JMNA 4HACA 5HOOA 1LWEB 1S5LU 1GLDG 3POTA 1A9NB 2HZVA 2VCPA 1NOZA 1JLQB 1VQSA 4FJ5A 4OX6A 4JI4K 3W5XA 3EZWA 2QWOA 3HF5A 3NH1A 5L1MA 1YG0A 2FLOA 9ICFA 1IXKA 1T02A 2P51A 1DEJA 1Q8KA 1WC0A 4CGDA 2PA8D 4DUYJ 2JLEA 1WF1A 2MKKA 4LQ3A 4AYBF 4FKXA 1WOOA 4FKYA 5DG7A 1U2RA 3O44A 4PYAA 4ED3A 1SJQA 1RT7B 3UD5A 4W5NA 4IG3A 4C7ZA 3O6QA 4CIEA 2WHEA 3SQ0A 1EWRA 3CPEA 3W3DA 1DARA 4JS5A 5AI6A 5ETLA 3QFUA 3O9QA 3N79A 2CGKA 1Q7LB 1EJ7L 2VKQA 3L0QA 2JWLA 3ZCMA 1JIHA 4NA3A 1R8CA 3KHRA 4MO4A 5D0EA 1FHTA 1YTAA 4HACB 3MMCA 2Y0BB 4FLWA 5D4LA 4NXNK 2VA2A 3CJBA 3BR8A 1TL7B 1F21A 1QD1A 3SCKE 2CRXA 2B8QA 2QIFA 3LP2A 1PUZA 3QGGA 3R9KA 5A2QU 4DR4F 2W01A 4ED5A 2OGUA 1HKGA 2UV8G 4CE6A 4KGVB 3I0SB 3LDQA 4L6V3 3EDQB 1V3ZA 1RFQA 4PKHA 3TYTA 1RPLA 1U6ZA 2DFHA 3KK2B 3H2LA 2ZHOA 3V81A 2C2EA 3BQ1A 3CFRA 1URJA 3MTKA 3DU6A 3RG6A 3L4PA 2ZUCA 3KD3A 3IG8A 3EL2A 5K8OA 1OSCA 4F0KA 2BCUA 4OYIA 3OYNA 3BPDA 2AJ1A 4FLZA 2IM1A 4OX9K 1YJ7A 2FD2A 4P4OA 5BPLA 3AD7C 4UUWA 2CJ9A 1N2XA 1RT3B 3RBZA 1K0TA 5AQOA 1VQPN 4OZ0A 2Z58B 2DFFA 3OYIA 4YN4A 3K5LA 5HHHA 4J03A 1DLOB 4GKKK 1C1AA 1UKUA 1DZ5A 4I2PB 3SNNA 2YWGA 3H5SA 3OQ2A 3PXGa 3D2SA 2ZOGA 4CBXA 2DIVA 1ZQ1C 3MR3A 3QBCA 2DXEA 2R7SA 3TTFA 2B51A 2JGUA 4KYZA 4YDDB 4Q5VA 1ZZFA 3E9OA 3M5RA 3TWHA 5KL8B 5E5NA 3ZSXA 1LAVA 3AQPA 2BVZA 3OHBA 2KVQE 2W40A 1QE1B 4CIOA 2C3OA 4FN5A 1D1UA 3QYPA 3EZUA 2UUCK 1EKEA 5IV3A 1PIEA 4LBPA 4BWJA 2F4VK 3SYZA 1NZBA 2FJBB 4AF1A 1VLOA 3OFGA 4NLWA 3DMJA 1Q3VA 1IKWB 1Y3KA 2KQ2A 4ZDNA 2G8WA 3IS9B 4DTXA 2RVJA 4MDAA 3GYNA 1I6JA 5CRXA 3VQAA 4WK1A 4JI4F 2E5HA 3U7JA 1DXSA 3HI0A 4OJ5A 1CJUA 3WXJA 4N8OA 1BQNB 2XVTA 3VQPA 2UXCF 2HHSA 1BHNA 4JI3J 4UAYA 5A8WA 5AKGA 3RH5A 2XY5A 1ZAWA 4NLOA 5DG8A 1ZPWX 2Y9HA 1XK8A 3BZQA 1BG3A 4BLGA 2Z7JA 2FF3B 2M8DB 2IOFA 1TYQA 4A8FA 4DBQA 3THVA 4K4UA 4P6QA 1RT3A 1WG5A 5F9LA 9ICRA 1ZOLA 2OCEA 3N4MB 5AXKA 3FNNA 1Q1KA 3F2CA 5DB8A 1IJEB 3IWLA 3ZDDA 4N77A 3Q2TC 4Y1CA 3KVGA 1R27B 4OV1A 1JLCB 3ZFVA 4OZNA 2GVZA 1NG9A 3ULDA 3IUCA 1BLUA 5AXNA 3P38A 3QINA 2MKYA 5LMUJ 4ZVFA 4UZCA 3EJMA 4GO7X 4ZK7M 4QZCA 1IWGA 1ZQVA 2MY7A 1ZQLA 4FP9A 1WSFA 4KLUA 4ILHA 3H42A 5HBMA 4QCLA 4EYIB 3H5UA 3BY5A 3DRRA 4MK9A 2NCKL 2HVZA 1VBKA 4C0ZA 2CQCA 1OW5A 2VJVA 3H8YA 3RJKA 1SV4A 3I9V9 4NZ0A 4UZBA 2KH9A 3AA3A 1MROB 2NRXA 1PJ7A 4F4WA 2J0WA 5HVGA 3ZZZA 2WSFC 3SEOA 4I2FA 3O80A 4RQNA 2ZIVB 5J2JA 1VQ9N 4MO5A 1WDTA 1ASVA 4N76A 4ECSA 4C3LA 4DR7K 4EFHA 1JX4A 4FLTA 2L9NA 4DX6A 3EGZA 2YKNA 3A5MC 3GCWP 1CSJA 2ASDA 3PIPL 1KONA 3RJIA 2Y9TA 1K73T 2JHDA 2BCRA 5C42B 4JV2A 1X6IA 3SMZA 9ICAA 7ICNA 3K89A 3HJFA 2P6TA 5HVHA 3NH0A 5IINA 1L6NA 5ALNA 4UAUA 2CJKA 3HVRA 3KLFA 2EFQA 4TURA 3LDOA 8ICFA 2FVQA 5GAHU 2FJEB 2BRLA 1SWVA 1KEJA 2GMJA 2YKNB 4LF4F 2YKAA 1HLUA 2B9XA 4CK2A 4RWXA 2CRLA 1VQ8N 3EZ5A 3VGSA 2B8PA 4MIWA 4NZ7A 2VDIA 4IUFA 2O67A 2BANA 5DKWA 3GV7B 4DTUA 4YVZA 3POTB 4OO1J 2WHOA 4USJC 4UUXA 4FSVA 1ZYQA 1XR7A 1ZTWA 4WQ4C 1RACB 5GINA 3D7SB 2YKQA 1VHFA 4L3NA 2C42A 3KWGA 2ATLA 2H9ZA 1FK9A 5AM5A 4EX6A 4TXSA 2I1RA 4K2JA 3VA3A 3LZJA 1HNXF 4DJBA 1MU2A 4M63A 4A2AA 2W55A 3H2UB 4CLUA 1S4FA 1CXUA 2NO5A 5EOYA 2DY1A 4KHWA 2KO1A 3IM9A 4Z4IA 5C10A 3X1LB 4OGCA 3LK9A 4QWDA 1TYQB 2MYFA 1ZZNA 3GP9A 2Q97A 3MAAB 3RMDA 5BR8K 2BR0A 4A47A 5HROA 2CWKA 5KFGA 3MCOA 1B4SA 5AZJB 4FE3A 2KT2A 1FTRA 1C0UA 3KJVA 3QFWA 1VIOA 4URGA 2ZC4A 5LSLA 4DCHA 5EWFA 3GU3A 4UAWA 4FPRA 2PO4A 4WJ3B 4FZMA 1T9YA 5FRMA 4M6WB 3O1LA 4RKUC 3MPWA 3H20A 3D0HE 5J0WA 4L74A 3AMZA 3MR2A 4PRFA 4NXMK 3T69A 1RAIB 1HNZF 2EANA 2W11A 4PQAA 1K9MT 1S77D 4NLYA 2ZC3A 5ALOA 2HVDA 3J80O 2JNJA 2OEMA 1HFEL 4I29A 3S6JA 3QE9Y 2RB7A 4CF4A 1RT1A 3MCAB 3GWCA 3E8OA 3MX2A 4FK4A 1SL0A 1FVQA 3D6RA 3PHEA 5J0TA 5DG9A 2W42A 3H0LB 2YNHB 2BJ7A 3VVUA 2DUYA 1YJWS 1WCNA 4NL5A 3V9XA 4DU4A 1OO0B 1BXNA 3JS9A 2EK6A 3EZOA 3ZT3A 2UXCJ 3C6TB 4AT1B 3UD4P 3G4SN 4DMZA 4WP8A 5M1OA 2IY5B 3UCUP 2W8LA 2QO3A 2EFPA 4GV3A 2F1FA 2HAIA 5I9EB 2MQPA 5AI4A 5GAHP 4QIGA 1HJOA 1S1WA 4JV1A 4JI0K 1FRHA 4K5RA 1X3NA 3LP1B 1IIPA 2WF8A 1Z4OA 1MLAA 3KDNA 5HLFA 2A0FB 2KP7A 5K20B 4YHHF 2N1RA 2VKRA 3PMLA 1QSLA 2CZVC 2HFNA 3FCVA 3FZFA 3W63A 1BQMA 3ASMA 1EQYA 1KFSA 2VQEK 4JI7K 3SXLA 5KQ8A 2W7AA 3SI6A 5HP1B 1Q86T 3ZD9A 4Z6CA 4KB0A 1RT4A 4ZOHC 2FPLA 4F26A 4ES3A 3L7PA 1D5AA 3V9UA 3UVJB 4B9TA 4DPWA 2ZGYA 3L2VA 3Q8QB 4WPAA 3VAJA 2RHFA 1X5PA 2K8AA 4CE9A 4ANCA 1NK6A 5KOWA 2D3OR 2UV8A 3OXFA 4LUBA 1AFIA 2MKSA 5KFAA 4Q8EA 5D4PA 1NAQA 4P71A 1RJJA 4Q2LA 4A46A 1J5OB 5KFIA 5ALSA 2QWRA 4FL9A 2QG9B 4IKFA 5K5MA 4DV0K 3CIZA 3KLIB 3QFHA 3WNHA 2QV6A 2HURA 3Q8MA 3NS5A 2R9LA 8ICIA 2P6RA 2R7VA 3RAMA 1QM9A 4QZBA 3MMAB 5DRKA 1FNMA 5K9FA 4UBCA 4CLYA 1CULB 2KZZA 5J2QA 5F3TA 4UARA 2R2SA 2G5HB 3BBCA 2HMIA 3VQ7A 1WEYA 3EPGA 9ICPA 4FF1A 2H1YA 3KKFA 4CZKA 3B9JA 2RE2A 2BKPA 3KK3B 3D4JA 3IXQA 3ZYYX 2IM3A 4FZLA 5D46A 5DDQC 3THXA 4KHMA 1IBMJ 1F0XA 2MEWA 2PBDA 3RSEB 4DV0J 3G6VA 1R7IA 2DXFA 4V19S 3AD9C 1GK8A 2WMMA 3MC1A 1D9DA 1Q5YA 3HLUA 1T7PA 4DKWA 1RQ0A 3H0PA 2ZIUB 2WBNA 2GUPA 3AV9A 2Y3YA 3CCMS 5IILA 1NGEA 1RCHA 3NAIA 5GMKa 1BA1A 3RBEA 4YUDA 4F0HA 5BYQA 1EX8A 4DQPA 2BPCA 3VGLA 2LQ9A 2V68A 1F0MA 3A0HU 4C97A 3IBFB 4K8XA 1TL5A 2WK4A 3VEOA 1XSLA 2VPZB 2R8GA 3DI6A 1HBNA 3VESA 4LRBA 1WCLA 1KL9A 3CJSA 2FSKA 2IVNA 4FXVA 1K8AT 2ASOA 2QFJA 3AD8C 5AQRA 3CJ1A 2Q31A 2MB0B 3SQOP 4IR9A 5ETRA 3ATUA 2XRIA 2YHWA 1WEZA 4ILMA 4CEOA 2Q36A 5B66U 4C8KA 5IM0A 3EWAA 4HYKA 2ABYA 2BE2B 3B4DA 3DC2A 5E0OA 4DR2F 1ZRMA 3ID8A 2C22A 5KFCA 3GV5B 4Z4CA 1CQNA 4TU9A 2WFAA 1IV8A 4V19J 1KQSM 5AXMA 1I1GA 3MM7A 3K0JA 2PFFB 1S6QB 1U1LA 2KM8C 4BRKA 2X1AA 3P5TL 3HULA 4UOGA 4L73A 2WVDA 1I39A 3QAEA 3I31A 1S1XB 1SQGA 2CPYA 2MQ8A 3W9IA 5HI7A 1YK9A 4B1UB 4OJGA 2B9EA 4CO4A 4QJFB 4ZCKA 5A8RA 5T41A 2K7KA 4ED8A 4C4SA 4AQYJ 3IR6B 2AYMA 4BJQA 3UXPA 4QW9A 3CJ5A 4HTIA 4E7IA 3CD0A 3FBCA 1SJRA 1XNQJ 2HVEA 3EM1A 5HSPA 4ICAA 1EKRA 1E6VA 3Q8LA 4H0VB 1KKHA 2VG6B 3H3OB 4BVOA 3I32A 1SZHA 2FYXA 3DMJB 2XO6A 2BTFA 4H0XB 4DU3A 3MR5A 3I9ZA 4DS5A 4USWA 4WCEL 2KE7A 4R25A 3VENA 1GT8A 1XHXA 1UPMB 2KKVA 1A0PA 4CBWA 4W5TA 4I28A 3C16B 4U7UD 1RAOA 4QS7A 3HSCA 3H90A 4Y2CA 4P7TA 2G8VA 2KOBA 4DLGA 3NCIA 2NXJA 4WXOA 3THWB 1R8HA 4Q45A 3CCEN 3V6HA 3HBTA 2IM2A 5FPNA 2NO4A 4KBIA 3H4BA 1KVIA 5G5GA 2O1PA 4F71A 4RBVA 5LT5A 2BJ9A 1VQ4N 9ICIA 7ICPA 3SUOA 1A7GE 2DRAA 2DD8S 3AVBA 2PYJA 5JJBA 5ALGA 1ZQOA 4P2MA 1N61A 4CP5A 2CVIA 2ZJQQ 2RU9A 1U8WA 2CPIA 4JI6F 2FJDB