1NKEA

A bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkeA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkeA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkeA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkeA01
4P2HA 4ECZA 4YFKA 1JLGA 5KG6A 5CR0A 5J0OA 2ZJ8A 3ZT0A 4IFVA 4ZTFA 3AVGA 8ICXA 3AVBA 2W42A 1Z3EB 2OZSA 4KO0A 1Y97A 3C21A 4FZYA 4FLTA 1VRUA 3G10A 3C23A 3GIJA 8ICGA 4QZ9A 3RAQA 4FLUA 1C6VA 3OY9A 5KG3A 2DFHA 1F21A 4KLDA 4K8ZA 4F93B 1BPXA 2FC0A 3PW2A 3L3UA 1JX4A 1NK4A 1H38A 4F91B 3KTQA 4DU4A 3PO4A 4W5RA 3RTVA 4KLLA 4J2EA 4I2JA 1T4GA 4AHVA 4IFYA 4FJIA 2F1HA 1HPZA 2W9CB 2D0AA 4O3RA 3QIOA 4IR9A 3SQ0A 4KLQA 3MR3A 2FLPA 4UQGA 1XHZA 3RJIA 4YVZA 1WN7A 4I2PA 2IS3A 4CK3A 5KFAA 2OA8A 3OYKA 3VQ8A 3JSMA 1QS4A 2FMSA 4LH4A 1EETA 5L1KA 3JPSA 3OYEA 1A76A 1Z00B 1U04A 1VSFA 5IIIA 1RZTA 4I9QA 1LWCA 3TAPA 3DLRA 1JLBA 2G8VA 3KKSA 4CJVA 3OS1A 4Y1DA 4Z4IA 3IRXA 3HP6A 4KPYA 4CEFA 3HX0A 3AO2A 4IG3A 3MGIA 4FW2A 3VQQA 4BWJA 1VSJA 8ICNA 2OPPA 4RQ6A 1ZBFA 5KFIA 4PGXA 3GFKB 1MQ2A 3S9HA 4B08A 4BACA 4RQ0A 2BCVA 4CJPA 3SPZA 3LZIA 1S97A 2ZTEA 4O3PA 5DB7A 4DQRA 4FO6A 1RTIA 2RN2A 5D3GA 1HMVA 3ZSQA 5J2NA 4UAWA 1UT5A 3N4MB 3KLFA 2A1RA 1RCHA 1ZQKA 5HLFA 4CGDA 3M9MB 3NFAA 3MFHA 2IMWP 4NCBA 4FS1A 3AU2A 4YQWA 3OS2A 1HRHA 3ALYA 1S0MA 1N5YA 3NHGA 1VRTA 1RDBA 8ICPA 4KN4A 3ORYA 7ICIA 5IIMA 4BXOB 9ICLA 2UVUA 3O4QA 4RQ4A 5J0PA 4CK2A 2Z1HA 3RH5A 5EU7A 4QZDA 4E1NA 4CHZA 2HVHA 3OHBA 1RILA 4CECA 1B22A 3AA5X 2G8KA 4F4KA 2YKNA 1T05A 1R0AA 4CHOA 3KJVA 4KLSA 1S9EA 1YTUA 5KFGA 4QWAA 3B6PA 3V72A 2ZTDA 3OSPA 5E41A 2ISOA 3V4IA 4FJNA 3EYZA 3K4GA 2HNYA 5C24A 3IAYA 2DY4A 9ICSA 3H4DA 4MEYA 2J6SA 3G0ZA 1K1SA 4WE1A 4F8RA 5CZ1A 5KFBA 2A1JB 1LAVA 1TK0A 3HJFA 1BI4B 3OSNA 4OPJA 1VSEA 4M41A 2PXIA 2BANA 4EBCA 3HPHA 5DQGA 4HCBA 3V9ZA 2FBXA 5KFVA 2ATQA 1MU2A 4NCAA 3QINA 1U49A 2ZUDA 3HVTA 3N97B 3CM6A 1JLCA 1WSFA 1C1BA 1T7PA 1UAXA 3SUOA 3G6YA 2KFZA 4YFUA 3KHGA 4DQIA 4H8KA 4CF8A 4CEOA 3MDCA 3O3HA 2W9AA 4Z6FA 1TKTA 3PX6A 4LZGA 4CEEA 3EZ5A 4ED3A 3KLHA 3ZDCA 4NCGA 4B9NA 1RYRA 1NJWA 2D0CA 3ZSWA 4YR0A 4IBNA 1U4BA 2LSNA 5FROA 1ZQUA 2W9CA 2C2DA 3KLIA 2F1JA 4E7IA 4CHPA 1L3VA 4RG8A 2AGPA 1S1UA 4JWMA 3T1AA 2ZUBA 5C5JA 4EYIB 2OPQA 4R5PA 4J2AA 4PUOA 5F9LA 3SZ2A 1EXNA 3RB0A 3T5LA 8ICUA 3ZSYA 4QZGA 3B0XA 4DTMA 1COOA 3RRGA 3IS9A 4DTSA 3PO5A 3UIQA 2YHBA 1QSLA 1NK0A 4O55A 3DMJA 3TAMA 3S3NA 2XY8A 2VG5A 4O4GA 4G3IA 2HW3A 3JPQA 1XS9D 3VA0A 1FK9A 1Q9XA 4KB1A 4Z6DA 1RBVA 4QW8A 1QSSA 3HO1A 5J2AA 2XHBA 3SCXA 4ECUA 5L1LA 4RQ1A 3C5GA 1D9FA 3T19A 5KFSA 7ICHA 4CJRA 1RYSA 3JYTA 3LWMA 1FKPA 1KSPA 2R7YA 3ISBA 4J9KA 1XC9A 1TKZA 3SQ1A 2VWJA 2VG7A 4W5OA 2X78A 3C5FA 3NBPA 5KFPA 3P1GA 2KTQA 4M47A 3CYMA 3V6HA 3CFRA 1RBSA 3MR2A 3DRRA 1UA0A 2V4RA 1SZPA 1ZQWA 4JRQA 3LANA 3ZT1A 4I2GA 1EP4A 1J53A 1WCNA 2HHSA 3LDSA 5KT6A 5IINA 3ZDEA 3DOKA 4M3WA 5DGAA 1RDCA 3RH4A 2HHTA 9ICQA 3NH2A 9ICFA 4FJXA 4HHTA 4JS4A 8ICFA 1TK8A 4DSLA 3ASMA 7ICGA 3VQCA 4F92B 3PV8A 1JIHA 5F9NA 3FYHA 1ITGA 3DOLA 3LALA 2WTFA 3AVMA 5HRNA 2FMPA 4CHQA 3F9KA 5JUMA 4CF1A 2XY6A 4J9MA 1NOYA 3C1ZA 5J2FA 4CK1A 3BQ1A 7ICRA 4ECWA 2R8HA 4I28A 9ICEA 4DTOA 4GXJA 3OYGA 1X9SA 5I42A 3SQ4A 4UAYA 3MABA 1RDAA 3RMBA 2I9GA 1KFSA 4Q45A 5KFXA 4RT2A 1TKDA 8ICOA 3M8PA 4KI6A 4B9UA 4Q5VA 4Q8FA 5L1IA 1NK9A 4J9SA 5J2IA 3ULDA 7ICVA 9ICMA 4QWCA 2A1JA 2HHVA 3KKRA 3WNFA 3MECA 4DU1A 3ZDBA 1RXVA 1S0OA 4P4PA 4DEZA 3HPOA 2YNGA 2A1SA 3ZT4A 4IRKA 3AO4A 8ICYA 3OYAA 3SV3A 1KFTA 4HCCA 5CJ7A 2KZMA 4CFCA 1B92A 4RT3A 3KHRA 1WSHA 4FJKA 2W9BA 1ZQEA 3K5NA 4J2BA 2M9NA 2PFQA 1CZBA 4FZXC 5KFHA 5SWMA 1HYVA 2O4GA 4R8UB 2AGOA 4ZHRA 8ICCA 4DMNA 4DTNA 2MUTA 3MAQA 3QEBZ 4PY5A 3JPRA 2C2EA 5J2CA 3GIIA 4DF4A 4H4MA 4DFJA 4O5BA 3AVAA 2QXFA 4QZ8A 3TFRA 5DMRA 2XC9A 2PYLA 4J9QA 4DSJA 3LZJA 4PH5A 3OYJA 2YKMA 5L9XA 9ICJA 1X9WA 1XSPA 4ED1A 3SNNA 2KQ2A 5J2GA 3TFSA 4KTQA 3K5OA 5EWGA 1RXWA 4NLGA 3AU6A 1RNHA 3QEAZ 1K6YA 1KFDA 4KLJA 2Y1JA 4OGEA 3DLKA 4XIUA 3F73A 3LP1A 1SV5A 2XCPA 1FXXA 1NOMA 9ICRA 4J9LA 2D5RA 1HNIA 4E1MA 2DFFA 4DSEA 1YTAA 1WAFA 5KG5A 1C0MA 1BPBA 1S10A 1WLJA 5KT2A 3RJHA 3I0RA 4RPXA 4ED2A 3RRHA 5HNKA 3EPIA 4CEDA 3LPTA 3OYBA 3MBYA 3V7KA 4M9HA 4HUFA 4FLXA 1ZQOA 3U6FA 3A2FA 4J2DA 4QCLA 5HP4A 1Y88A 2YNFA 1JXBA 4RW9A 2HB5A 8ICBA 1BHLA 3DI6A 3VQPA 2VANA 1RT7A 3AO5A 3VQ5A 1XSNA 3AV9A 1BISA 4DU3A 2E4LA 1XI1A 4YMMA 2AJQA 1ZQDA 3BQ2A 1WNSA 4Q44A 4MF8A 2RDJA 1C1AA 1RBTA 3L2RA 4XQ8A 4PHEA 5KT7A 4CIEA 2BQ3A 1WSIA 4I2BA 4O5KA 4FLVA 2B5JA 5J2JA 1S77D 5IIKA 3EY1A 3SJJA 2GV9A 2MAXA 1NK8A 5CZ2A 2JGUA 4BGDA 4IRDA 4M45A 8ICEA 4FM2A 1QQCA 1MC8A 4LY7A 4YP3A 4FJMA 3QETA 2P66A 4R66A 1K1QA 3C2KA 1C0TA 1BQNA 3HSTB 2DTUA 3G6XA 1HJPA 1ZQBA 5SZTA 2KZZA 4GVMA 2IHMA 3AVHA 4O9MA 1Z26A 3S3OA 5KFMA 4KI4A 3QE9Y 4RNMA 2RKIA 3HT3A 1HNVA 1UOCA 4GW6A 3ZSZA 4QOZB 1U45A 4IQWA 1LW2A 3QO9A 1VSHA 2BHNA 2BE2A 3Q8QB 1S5JA 5CP2A 5KRTA 4KHYA 1T3NA 4Y1CA 1BCOA 5J0UA 2I5JA 2NRZA 1SUQA 1T03A 4F5OA 3C1YA 4OLBA 2ZJ5A 4LZDA 1ZQLA 4RQ3A 4CJ5A 1KVAA 3PW5A 1RT6A 5C42A 1HUZA 4CJQA 3GILA 3QEXA 4NM1A 3M8QA 3U3GA 4I2AA 2F8SA 3Q8RB 3V1RA 2J6UA 2OPSA 4C8MA 2Z1IA 3SUPA 7ICEA 4DLGA 1TKXA 3TAGA 1TL3A 4PGYA 1ZQNA 3TQ1A 4FJGA 1ZQAA 3L2VA 4Q8EA 4M3TA 4YCXA 2ATLA 4F3OA 2BPCA 3HVRA 4R8UA 4Z4FA 5BOLA 4DSFA 2E6MA 2OYQA 3VA3A 1ZQQA 2D0BA 1ZQIA 4YMNA 1XSLA 3BDPA 4IDKA 1NJZA 5DLFA 1EX4A 4JK1A 4DL7A 2PFNA 4CJ3A 3T3FA 3SYZA 1RBRA 1BQMA 2IBKA 4NXZA 1ZQTA 4CF9A 4LSNA 1LB2B 1BPEA 5KFQA 5J0RA 5J2HA 4CFBA 5KG7A 4OLAA 4F50A 4KTZA 4KHSA 4FBUA 5DGBA 1I3AA 2DPIA 4M9NA 4UB3A 4HUGA 1BCMA 4BE0A 1Q9YA 3K75D 1BGXT 5HMMA 3JPPA 2NRVA 1W9HA 2P1JA 4I2HA 3HL8A 2KZ3A 4J9RA 1A5WA 1CZ9A 1S1WA 4Z4CA 1ZBIA 4ECQA 3HP9A 1ZETA 9ICGA 4M9JA 2EHGA 8ICJA 4N41A 3VN5A 2YNHA 4MQ3A 4UB5A 3ETLA 3M9OB 1RTJA 2AGQA 4KHQA 5FRNA 1A5XA 2GBZA 3B0YA 1ZQXA 4DF8A 4KHNA 4ED6A 7ICQA 2XGQA 2Z1JA 4QWDA 1FKOA 1HQUA 1QE1A 8ICKA 3VQ7A 4K8XA 4DFKA 2ALZA 2XY5A 4XRHA 4O0JA 3SUQA 3VQ6A 4I27A 4DOBA 4TQSA 4I7FA 2OPRA 3NGDA 4KLUA 2W9BB 3H08A 4AHRA 4EZ9A 1DTTA 2G8WA 3QNNA 3MEEA 8ICWA 4I2EA 2XO7A 1D9DA 1YVUA 4ID1A 5KT4A 2XGPA 3OYDA 2MUTB 4M0AA 4CEAA 4B8CA 2YHAA 2O4IA 1KEJA 3SQ2A 4CJFA 4FJLA 5DKWA 2PFPA 3NGZA 3KHLA 4PPXA 4YXJA 4TUPA 5DB9A 2JLEA 4BWMA 2AQ0A 4E89A 3L2UA 5DB8A 4YD1A 7ICTA 2PY5A 1HJRA 2BCSA 2ETJA 3VQDA 3HWTA 4N76A 4DL6A 3OYHA 4ED0A 5DBBA 4O5CA 2JZBA 2OWOA 1TV6A 4FLZA 1HQEA 1IKXA 1UA1A 9ICUA 4ZTJA 5J2BA 5IILA 3RB4A 1S6QA 3TAEA 5HBMA 4KKOA 4M9LA 4CE9A 7ICLA 2QKBA 4FZZA 5KG2A 1A5VA 4FLWA 4JS5A 4TUSA 4TURA 1ZQVA 3SV4A 4B9VA 5I3UA 3CM5A 3O3GA 2G8IA 4IR1A 3VQAA 3QEIA 3TAQA 1WSGA 3RJGA 4RNOA 3QEPA 3C6TA 3MFIA 5DG9A 4F2SA 1S76D 4CEBA 2AU0A 2BQUA 3RR7A 2P6UA 4ECTA 4BDPA 9ICIA 1IKWA 5HP1A 3NGYA 1IM4A 2W8LA 1CXQA 4Q43A 4ECXA 4I2CA 3HM9A 4O3OA 3PR4A 2R8GA 7ICFA 5KG1A 4K4GA 3UXOA 4DLEA 1EXQA 4OKKA 1CEZA 3TR8A 1TK5A 1WAJA 4KLIA 4DWIA 4M3UA 4KAZA 2PI5A 4FK4A 5J2QA 5KFWA 3ZT3A 1S1TA 3PR5B 1ZQMA 3H7IA 1IKVA 1L3TA 2KW4A 4E7LA 2JEFA 8ICSA 1WSJA 1NKBA 3MEGA 3V9WA 4DQSA 2HNDA 3RBDA 3H4BA 5CYMA 4YG2A 3FFIA 4M04A 4JV1A 5J2PA 1SL2A 3KD1E 4W5TA 7ICMA 2IHNA 4CGHA 1VSKA 3L8BA 5KGXA 1IG9A 4R63A 4FJ9A 1ZQFA 3I0SA 2FBVA 5J1EA 3PMLA 3ZD8A 1ZQJA 3ZD9A 3OJSA 5KFZA 4F4YA 4KTWA 1X9MA 3AVLA 4I2IA 4KLFA 3NH1A 2IC3A 3HW8A 3ZT2A 4DFMA 3RJFA 4NLKA 2I1QA 3H40A 4FXDA 3OYCA 2ZE2A 4J9OA 3KK2A 9ICHA 2X74A 4RPZA 3O4NA 5DG7A 1QHTA 4F4WA 1HYSA 2R8IA 2GWSA 1B43A 4DTRA 4R64A 3AVFA 4TQRA 4KLMA 4GXIA 1JL1A 5D49A 5KG4A 3DLHA 4QWEA 1J5OA 4CJLA 4XUSA 4ED8A 2JEIA 2WONA 3ZSXA 4LVSA 1MQ3A 4FK2A 3SUNA 4KHUA 3B6OA 4YD2A 3BJYA 1WCLA 1RTDA 5HRRA 4BE2A 5J0WA 1KRPA 3ISNC 4FJJA 2OZMA 4OKJA 3OJUA 1ZQHA 3KK1A 2LYHA 1ASUA 1GOAA 5EOZA 4IG0A 1Q8IA 4M3RA 5KFUA 4KLGA 1I39A 1S1VA 2VA2A 4KITB 5KFNA 3UPQA 2FPLA 3OYNA 1VSLA 3K57A 1N48A 1GOBA 1O1WA 2BCRA 4NLNA 2VA8A 4C8LA 1QLNA 2FLNA 1JL2A 4OPKA 4RPYA 5KFRA 2PZSA 3RMCA 3K2PA 4KREA 2NRXA 3DM2A 3PUFA 3JPOA 5KFLA 3V7JA 1ZBLA 5T7BA 1RT3A 3BGRA 4IQUA 3RB6A 4O44A 3DRSA 3K59A 1SKWA 4G1QA 2G8HA 3LAKA 2R8JA 3UQ0A 1XU4A 3V6KA 1TGOA 2BGGA 3K58A 1TL1A 2PYJA 4UB2A 4N5SA 1ZQPA 4CF0A 4GC6A 2F96A 3S3MA 1NJXA 3LK9A 3NF6A 2X6NA 1CLQA 5J2KA 4RUAA 4QZFA 3GDXA 4FCYA 3D45A 2FLLA 3Q8SB 4QZHA 1RPLA 4EP5A 1IXRA 3D0PA 9ICOA 4CIGA 3BQTA 5K14A 1SKSA 1W0HA 3PW0A 4ECYA 2IAJA 2ITGA 1RT5A 5KFCA 4QW9A 1NJYA 3VQEA 1J54A 3CQ8A 4RZRA 5KI6A 4CCHA 1C7YA 4EEYA 3RJJA 4AHTA 2R8KA 4CGGA 4Z4GA 2W8KA 1RBUA 4Z6CA 1ZQRA 3NF9A 5IIOA 4PHPA 2YNIA 1C1CA 2F8TA 4EZ6A 1X2IA 3VQBA 1NKEA 5CA7A 2BR0A 5HRSA 3UXPA 4CF2A 4RQ5A 8ICHA 4CEZA 4BE1A 4PWDA 4H4OA 3DLEA 2ISPA 2DFEA 2BGWA 4NYFA 1UWBA 3DLBA 3VQ4A 5HMLA 3WNGA 3RH6A 1KTQA 2E6LA 2F1IA 4B9LA 4IRCA 4DTPA 4I29A 5CB1A 4F5QA 4RNNA 4AH9A 3MDAA 3GIKA 4F5RA 4KB0A 2JZBB 4NYNA 1VSMA 3GQCA 2IOCA 2NUBA 3LP0A 4M6WB 5KFKA 3EPGA 2ASDA 3P5JA 5KFTA 4NLZA 1KCFA 3M9NB 5IIJA 1NK5A 9ICNA 3SPYA 4I2FA 4CJWA 4LD0A 2RDIA 3TANA 1CUKA 3QZ8A 4DL5A 4LSLA 2J6TA 4CFAA 1UT8A 1YT3A 3V6JA 1IO2A 1JN3A 3V9SA 5CWRA 2ZTCA 1JLQA 1N6QA 4W5QA 4QZIA 7ICPA 9ICAA 4ZH4A 2PI4A 4DOCA 3OYMA 2C2RA 4DS5A 3AO3A 5L1JA 4AHCA 3QEWA 1LW0A 4NM2A 3HPGA 1JXLA 4OGCA 4O3SA 4I2DA 4E7HA 1DTQA 2VG6A 4ICLA 1TAUA 1LV5A 2BQRA 1S9GA 1DLOA 2NRWA 5DLGA 3ZSVA 4AILC 4ECSA 2FMQA 4FW1A 4UBBA 3QIPA 3AVKA 3OS0A 3C6UA 4KFBA 4JWNA 1BPDA 3QEVA 3CFPA 1L5UA 5J2EA 3PVXA 3T5JA 3SI8A 1XHXA 1ZJNA 3ZDDA 1A77A 1TVRA 4P4OA 3EW9A 2XCAA 4YN4A 9ICKA 3DRPA 4F5PA 8ICZA 4HTUA 4PGQA 2JEJA 3MXJA 3MR6A 1JXEA 4Z4HA 3TI0A 4M3ZA 3H8SA 2EX3A 4CJKA 4Q0BA 4GXKA 5CYQA 3V7LA 4Z4EA 4KLHA 3I8DA 4KLTA 3OYIA 5HROA 3FDSA 3KIOA 4Z0UA 2XRIA 4CHNA 4QZCA 1ZBUA 4CESA 4M3XA 1C0UA 1Z25A 4CFDA 4CERA 2KN7A 4E0DA 5J2DA 4GC7A 1NK7A 4MFCA 4DFPA 4UBCA 3PW7A 2WOMA 1QTMA 3AA3A 5KTQA 3Q8PB 4OVLA 3NTUA 3NDKA 3LAMA 1DOQA 1ZQCA 8ICAA 2RF2A 4KN7A 4GMJB 5KGWA 5KFFA 2HVIA 2B4JA 3OYFA 4MFFA 3K5LA 4DOAA 4CJEA 9ICVA 4FJHA 3V1OA 4K4HA 4CGIA 3RWUA 4FYDA 2UVWA 4MFAA 1L3UA 1WSEA 5HHIA 5KFJA 4FJ8A 3C95A 3L2WA 4F4XA 4PHDA 1B9DA 3GIMA 1ZQZA 3RAXA 5KT3A 2FBTA 3KK3A 2BPFA 3MXMA 3KLEA 4FM0A 3AUOA 1LAWA 4RW4A 1KLNA 1ZBHA 2BPGA 2G8FA 4DSKA 4YMOA 1TVAA 1RT1A 4QZAA 3AVIA 9ICBA 4DL3A 4CJ4A 3PW4A 4M3YA 1BL3A 1KVCA 4EBDA 3VQ9A 1D8YA 2IGIA 1ZYQA 5HHHA 4ELVA 3AVCA 3KD5E 5BOMA 2HHUA 4RU9A 1LWEA 4XA5A 1ASVA 9ICCA 1NK6A 2X6SA 4CJUA 7ICNA 2QK9A 4AHUA 8ICRA 2V9WA 2BDPA 3RJKA 1ASWA 2ZJAA 5D4BA 3C2LA 2AQ4A 3PNCA 4P4MA 9ICWA 4B8AB 4DL2A 3AVJA 1V9PA 2P6RA 2ZUCA 5C25A 2Y1IA 1KLMA 4DQQA 4MF2A 4E7KA 1ZJMA 3PY8A 2ASLA 2Q3SA 4EP4A 3C2MA 3QESA 1JLAA 3MXIA 3THVA 5KFEA 2DPJA 3RJEA 3NAEA 3ZSOA 4IKFA 4JRPA 4M6WA 3LDAA 3KHHA 3H8JA 1IH7A 5J0QA 2B6AA 3OVNA 3KLGA 1D5AA 3V9UA 3T5HA 2C22A 4F4ZA 1JLEA 2NRTA 4N56A 3DYAA 2QKKA 3AVNA 3MEDA 4CIFA 5BPCA 1SL0A 4LH5A 2GUIA 3NF8A 8ICQA 4YR2A 4KRFA 3JPTA 5FDLA 3NGIA 7ICJA 9ICXA 3P83D 3Q8KA 3G6VA 3OYLA 1D8LA 1KDHA 3AA4A 4O0IA 1Z00A 8ICLA 1U48A 1T8EA 3V1QA 3H8WA 4TUQA 2FBYA 2P51A 5FRMA 4F2RA 4O3QA 4BDZA 4KLEA 3TABA 1IKYA 4FM1A 1AROP 4DTXA 5KFDA 4FK0A 3SI6A 3UXNA 4QZEA 4ED7A 4CGFA 4KHWA 4ELUA 3ISDA 3QLHA 4B9SA 5CY4A 1BIZA 4M9GA 1ZQYA 2JEGA 4YNQA 5J29A 3RR8A 2XY7A 5CHGA 3ISCA 5KG0A 3HYFA 4ECRA 2DFLA 2BCQA 1VSIA 4TSXA 4RW6A 4QWBA 3QZ7A 4R65A 4I9LA 4CHYA 3T5KA 5DQHA 3UQ2A 1XO1A 4MEXA 5DBCA 4FS2A 3IHQB 4QAGA 4FJ5A 1J9AA 1EKEA 8ICMA 2VA3A 4DSIA 3CG7A 5J2MA 3OHAA 3PX0A 4ELTA 3O3FA 4RQ7A 2HHQA 3K5MA 4DQPA 7ICKA 4JLHA 2ASJA 3V6DA 4FVMA 4Z6EA 2UVRA 1PZNA 4KLOA 1LWFA 5KT5A 1U9LA 3Q8MA 4DTUA 4FBTA 1JMSA 5DDYA 4GLXA 4UB1A 3V9XA 4MFBA 5DQIA 1RDDA 8ICVA 4BXOA 3V81A 5DDMA 2Z1GA 5KFYA 2HHWA 2HNZA 2VWKA 1NOZA 1ZQGA 2H5XA 2P5OA 1SKRA 4QZBA 7ICSA 3TWHA 4J9NA 3NH0A 4C8OA 1N56A 4UB4A 2UVVA 1L3SA 3ZSRA 3HXMA 2Q0ZX 1DGSA 4ECVA 4PHAA 3GV8B 3ZCMA 3TAFA 2PFOA 4CGJA 1TV9A 3QERA 4EYHB 2IDOA 5J0TA 3LP2A 1S9FA 1JKHA 3TARA 1VSDA 2FPMA 4YR3A 4AHSA 4DS4A 4EBEA 3NF7A 1ZQSA 4OJRA 1S0NA 5JS2A 5DK5A 3L3VA 4FLYA 1REVA 1XWLA 2B21A 1BI4A 4O5EA 3IM1A 2HMIA 1BVSA 4PA1A 1NKCA 3LPUA 4X5VA 4F5NA 1B9FA 8ICIA 1CXUA 3HK2A 3OGUA 4HUEA 4IQTA 1TFRA 4BDYA 1S0VA 2BCUA 1S1XA 8ICTA 2BKEA 3L2QA 3AA2A 4YXMA 3NCIA 3EWAA 1BPZA 3MGHA 5EWFA 3RBEA 3WNHA 2YV0X 1BIUA 3QNOA 1RT2A 5J0YA 4PQUA 1MSWD 9ICTA 2ZD1A 1VK0A 2ZQBA 5DG8A 1TAQA 2FPKA 1HYZA 4CEQA 5KFOA 4B9MA 4DL4A 4I2QA 2G8UA 4DG1A 1SL1A 3PX4A 4ID5A 5DB6A 4RQ2A 2C28A 2IA6A 4OKEA 7ICUA 3IG1A 9ICPA 3GV7B 3RMAA 3C94A 3ITHA 3U3YA 2W9MA 3RMDA 4CJSA 1HUOA 4CJTA 4RQ8A 7ICOA 4NY8A 3LWLA 4IQVA 1BPYA 3E01A 4W5NA 5EWEA 3AO1A 3BQ0A 4N47A 4RW7A 1RT4A 4KV8A 4B3OA 3LP3A 4RUCA 3JPNA 4JUZA 4HYKA 1KVBA 3E2EA 3Q8LA 1X1PA 4FJ7A 1QSYA 3MR5A 3WNEA 4M2YA 1U47A 1GOCA 2P5GA 5DBAA 4O3NA 4L8RB 2HHXA 4UAZA 3PMNA 4K4IA 4RW8A 4M42A 3M8RA 5JS1A 4E19A 5J0SA 5D46A 3NE6A 3CFOA 4KMUA 4C8KA 5HRPA 1RTHA 1S6PA 2RPIA 4JV2A 3RB3A 4DO9A 3M8SA 3ZDAA 4F3TA 4J9PA 5TZVA 1G15A 2KFNA 1JLFA 4C8NA 5KRSA 4DTJA 4JV0A 3DLGA 4HVJA 4E3SA 4E7JA 2V4QA 4B9TA 3GV5B 5J0XA
chains in the Genus database with same CATH superfamily
4ECZA 4UZBA 5GAHU 1YAGA 5CR0A 5J0OA 2ZJ8A 2DHHA 4N8NA 4CLLA 2JLGA 4WP9A 4KO0A 1Y97A 2RHFA 3I6PA 1JLAB 2RS8A 4NYZA 2DHGA 2JXJA 1UHUA 1TL5A 3THWA 2ZVIA 4C23A 4FLUA 1C6VA 4CTAA 4K8ZA 3DEEA 3Q7BA 1FESA 5FJ4A 3LGNA 1HBMA 1H38A 4M5GA 4DU4A 3PO4A 1KDNA 1U2CA 3RTVA 1LWXA 3MEDB 4FJIA 4DMZA 1A0PA 1GLCG 4M8LA 2W9CB 1NGGA 5AQNA 4O3RA 2LQBA 3TPQA 2HVZA 4P0PB 4H5RA 2DRBA 4M5DA 4KLQA 4DPUA 2MSNA 1X3MA 1XHZA 4HHUA 5JICA 4R5PB 2IS3A 4PUOB 3CCVS 3CTRA 3WC2A 3O6WA 3JPSA 1A76A 2E88A 2E5GA 4BRNA 2RH3A 5EXWA 5FP0A 2WSEC 3UDEA 8AT1B 1KQQA 2ZJRQ 3PSFA 4EX7A 4I9QA 2V5HG 3T6JA 1LWCA 3OS1A 2LBOA 3LDOA 1N5WA 4QPTA 2NRRA 2CPZA 1RAGB 2JC0A 4KPYA 3CF5L 4OJ6A 2ZVSA 5F8LA 4ZLJA 4FPIA 5CE3A 4BWJA 8ICNA 5EDWA 2WFBA 2NUUG 1UFKA 1RWMB 1F6TA 4RQ0A 3OR1B 5AE2A 4KSEB 2QO3A 2FHKA 3D0GE 2GEMA 2ZTEA 1R8PA 1CJVA 4DPOA 4RUHA 3EKSA 2KL8A 5E3RA 2MU2A 2PD1A 4IJAA 3MOJB 4DQRA 3PDNA 1H72C 4FO6A 4B3RK 1SV0C 2QW9A 3D6JA 1F9EB 3ZSQA 5J2MB 4UAWA 2MY8A 2YX7A 3GJQB 1NDCA 1NG9A 4F02A 1RCHA 4QU6A 5HLFA 4CGDA 1HD1A 3M9MB 5JJBA 3BO3A 2V69A 4NCBA 4FS1A 2AEFA 1S0MA 3ISND 4CZEA 1G6BA 3LVVA 1BXNA 4KN4A 4MFBB 7ICIA 1RA7A 3V81B 1F0XA 1FFWB 9ICLA 3CMAS 2HNZB 1GLJO 2Z1HA 3RH5A 2K7JA 5EU7A 4QZDA 3BGOP 4E1NA 4CHZA 3TADA 3VC8A 3D28A 2G8KA 2YKNA 3FEZA 1YZ6A 1O0PA 3MM8B 1W2BM 5KQDA 1S9EA 5KFGA 4R79A 5FPNA 3B6PA 3A8YA 3K4GA 4F72A 9ICSA 1JKHB 2EAPA 4MEYA 1XQSC 5D8HB 1WB9A 2V34A 4Y65A 5IT4A 2ABYA 1KOOA 5CZ1A 1LAVA 1REVB 1RBAA 3HJFA 1DRZA 3OSNA 3AJDA 3AH6A 4M41A 3BS5A 2BANA 3W9HA 2A19A 4EBCA 1PC5A 4WJBA 3Q7CA 3QUTA 4TY9A 2W2OP 1MU2A 2QI2A 5AT1B 1FX4A 2ZUDA 1F60B 2FJWA 1RGVA 1C1BA 3CC4N 5LJ3Y 5B0FA 2KFZA 2JR5A 2GJ2A 4CLPA 2BZFA 2OEMA 5GMKa 2W7OA 1CG2A 1YTYA 2LQ8A 3HF5A 2JVOA 5G0RA 4JKGB 3J81O 4OYIA 2V2KA 3PXGa 3MDCA 5AM2A 4DR4J 4Z6FA 4L6V3 3BS9A 4CEEA 2OHDA 3EZ5A 3C66A 3KLHA 4IOCL 3ZDCA 4NCGA 4B9NA 3VGLA 1RYRA 4MLEA 1NJWA 2HWHA 2MGZB 5MLCQ 1I51B 2FGOA 3E01B 3OL8A 2CKWA 1HBNA 1ZQUA 1LKZA 2C2DA 3KLIA 4FSVA 4E7IA 4CHPA 2ZHAA 1L3VA 3WU2U 2BKPA 1VQ8S 2AGPA 3H2LA 3K7RA 1S1UA 2LP4A 2ZUBA 2IDEA 4EYIB 2V50A 2OPQA 3FCVA 4J2AA 1ZOTA 3OW2R 1DEJA 4RO0A 3ELHA 3B0XA 3CD7A 3N7SC 3PO5A 4UAVA 4USUA 4EHUA 1NK0A 1S6PB 3D54A 4HAIA 1P8GA 1OWXA 1Q46A 2VJUA 3GOIA 3NWGA 4BUGA 3S3NA 5EE1A 3LPYA 2XY8A 3VA0A 2XS2A 3JPQA 5AZIA 2DO0A 4L3QA 5KNIA 2JVRA 5HL7L 2I7NA 1Q95G 4UOFA 2ZXHA 1SJ3P 4LFBF 3FCHA 1WWVA 4LF5F 3SCXA 1FKAF 3RUBL 2ASPA 4HI1A 5AJ3F 1D9FA 3M32B 4IFEA 3KMQA 3FGUA 4CH0S 3JYTA 5ETSA 2KH9A 3T69A 1XC9A 2DR6A 2CQ1A 2W25A 2VG7A 2KHOA 3BUZB 3C5FA 3HFZB 5T7LB 4WIIA 3RW6A 3P1GA 1TELA 2VGNA 4CNZA 3V6HA 5B7WA 4CRJA 3FCWA 3DRRA 1UA0A 3W5YA 4BJQA 1SZPA 2V4RA 2NCKL 2NZCA 4G9BA 1VQ9S 3AB4B 1XJWB 3D2QA 3FEYB 3LANA 4LJXA 4I2GA 1WCNA 1NRKA 1VIXA 3VGUA 2QB1A 3ZDEA 1HPZB 1U0SA 4KX5A 4RQNA 4Y00A 3OV7A 2G4BA 3RH4A 2NXEA 1UWAA 2E2OA 2AD9A 4FJXA 4HHTA 2P5VA 4DSLA 1VBYA 2JWLA 2HEKA 3C65A 5L1MA 4F92B 3TX0A 4CM2A 4BREA 3TR5A 2ZM6K 5BPLA 3FYHA 3THPA 3ZTSA 3LALA 3D2EB 1OQ6A 5ADXA 3BQ1A 2P9NB 1F44A 2KJWA 3IRXB 4P0QB 2R8HA 1HKGA 2CZVC 4I28A 1ZD5A 4EENA 3SQ4A 1IBMK 3RMBA 4FOIA 4DV4K 2OPPB 1IBMJ 3I5CA 2VWBA 4GY2B 1O8BA 1ZTWA 5L1IA 1V97A 4Y2PA 4J9SA 4X65K 4H5WA 2QWOA 2OD4A 4QWCA 2A1JA 5C42B 1AYEA 1OQ3A 3RRKA 4CE6A 2E20A 2ITMA 1RXVA 2LCWA 3WK4A 6AT1B 4PL8A 4DEZA 1RHJB 1VJQA 3NVKA 2A1SA 5D0RA 1B0TA 1RADB 4IRKA 2IRXA 4ZCLA 4BC2A 3VTIA 8ICYA 3SV3A 3UDVA 2UU9F 5CJ7A 2XIDA 1BMQB 1ZQEA 1FFUA 3ENBA 2PFQA 2EG1A 1KQFB 2LYVA 4TN2A 1N5YB 1HYVA 2UXBJ 3P5TL 2OTLN 1VRTB 2W4CA 4DMNA 4DTNA 2MUTA 5J2CA 2OFGX 4H4MA 2N3LA 4OZLA 2QXFA 4QZ8A 3TFRA 1FD2A 1WOOA 1QZ6A 2AJ4A 2PYLA 4DSJA 4PH5A 1N54B 4NEYA 2CRXA 4NX9A 5ALGA 4P7VA 5B08A 4C97A 2YKMA 5L9XA 1FNXH 2D3UA 1XSPA 1FERA 3SNNA 2KQ2A 4M5LA 4KR0B 2IIHA 2UXDJ 4CLWA 3K5OA 1R0AB 1D09B 4UASA 1YJRA 3HHEA 1KFDA 3DLKA 4O8UA 3WQUA 4DR1F 3H1QA 1SV5A 1YJWN 2XCPA 5J8YC 2HIQA 4X64F 3HOSA 2J7KA 2XMUA 4WTOB 2A3JA 2EXUA 3C15B 1HNIA 3H2VE 3AFGA 1RTJB 2QG9B 4DSEA 1WAFA 4USMA 3I0RA 2H3ZA 1VQPS 1H74A 5I3QA 5HNKA 3SENA 3SSQA 4IWVA 4CEDA 3MBYA 4FLXA 2O8EA 1HWKA 4DV6J 4BRLA 4ISEA 4J2DA 4QCLA 2KG5A 1X0PA 3WK7A 4X2BA 1IV8A 1HBOB 2YNFA 8ICBA 3DI6A 3HVTB 3VQPA 4FWPA 2GIFA 4LF6J 4PZNA 1VQYA 1XI1A 3J81U 2O6KA 3W5ZA 3BQ2A 2ZHBA 4USTA 2AX1A 5AI0A 2RDJA 3A8JA 1RBTA 4YHHK 4NLSA 5KT7A 2Q1LA 2DD8S 2K60A 1WSIA 2CGLA 1BDGA 2F3JA 1RWOB 4YHHJ 4G1IA 2GV9A 1XMQF 3DOMB 5CZ2A 1EB0A 1GLLO 4DUZK 3RYLA 2YMLA 2IDLA 4DR6K 1IBKJ 4M45A 2ZKTA 3SCIE 4XDDA 2YWWA 1MC8A 2DRDA 1DQ8A 2VF3A 4NASA 3VVUA 1ATRA 1QUPA 1T0TV 1LFWA 3QFPA 4NLRA 2PMWA 1K1QA 4PXDA 3C2KA 4PXEA 2X51A 1HJPA 5SZTA 1ZM4A 1QH9A 2KZZA 4GVMA 4HHHA 2MTLA 3PLAA 4KI4A 3H7HB 4U7BA 3GE9A 2RKIA 3QFWA 3GZ7A 4FNHA 2NO4A 1UOCA 5I3UB 2XLIA 3UKUB 4QOZB 2Q0UA 2WB1F 1LW2A 3DMJB 2CWXA 1HNZJ 3TAMB 3JXUA 1VQ5S 2WHEA 1FRXA 3QUCA 3UB5A 3RF9A 5GTHU 3IWLA 2VICA 2EQYA 4LF7K 4PG6A 1S5JA 5KRTA 3TX8A 5AQUA 1FK9B 2N4DA 2NR0A 4Y1CA 3QRQA 5ADZA 2NRZA 3HJVA 3JXOA 1UFWA 2ERRA 2RSQA 4F5OA 1FI4A 1QAYA 1XTZA 2FUG9 3IBCB 4F0MA 4LZDA 1OVQA 5LSLA 3KYLA 5B0CA 3NRZA 1KVAA 4KHPK 1FTRA 4ZPVR 2KV2A 1NU4A 2QZ8A 3GL1A 2CH5A 2AV5A 4NM1A 3M8QA 4Z37A 5GADU 1AA1B 3V1RA 3EVOA 2GNKA 4C8MA 3TVZA 1NGEA 4CD3A 2A6AA 3G4SN 5F2RA 3RU0A 1GX5A 3ZTOA 3L2VA 2IPOB 3DOKB 1RAFB 4M3TA 4YCXA 4K4UA 3PTWA 4F3OA 2BPCA 2PC6A 4Z4FA 2GS8A 2D1KA 5CRXA 4OPAA 2D0BA 1ZQIA 2E8AA 3UM9A 1M90O 2VBXA 3CJ2A 3VGVA 1S48A 1DQ9A 4CJ3A 3T3FA 3DOLB 1NAQA 4PL1A 2VH7A 4CF9A 3I0SB 4X4VA 4LSNA 3TTFA 2W55A 2L48A 2LU1A 4C0BA 4KHSA 5DGBA 1I3AA 3L7OA 4M9NA 3K75D 1BGXT 1ELOA 4OZJA 5HMMA 3G87A 3IBWA 2R18A 1W9HA 2Q43A 3BR8A 4M5JA 5AQVA 2A6OA 2OANA 1ZETA 2EHGA 3M8PB 2KJ8A 3OFFA 4PHTX 3NXZA 3NOGA 2QFJA 4LFAF 2V6AA 3WXIA 3ETLA 2AGQA 2NNWA 4JYAK 3H8YA 3UPFA 1HNWK 1ZQXA 4FF1A 2HMXA 3I76A 7ICQA 2NREA 5HQMA 1OH7A 1FKOA 1MMNA 1QUVA 1X31C 8ICKA 3H5SA 4B3MF 4DFKA 3KZXA 1UPMB 4N7TA 4O0JA 5CD4H 2XO6A 3A3NB 1RTDB 3QIDA 3AOAA 4FWQA 1GLBG 3ZETA 4EZ9A 3Q8UA 2G8WA 3QNNA 2CPJA 1IBLK 4ZVRB 4OLPA 3D6TB 4I2EA 5EE3A 3MM6A 2XO7A 2DO4A 2QLJB 1YVUA 4ZHRB 1IBLJ 1T9VA 2B9WA 3VAFA 4OLOA 4ETZA 3GSIA 3P96A 4WXWA 1WNEA 1E4GT 2O4IA 4FJLA 2XWXA 3AXKA 5LMNK 2CH6A 3SMSA 4DR3F 2AT1B 3JQKA 4RWWA 2DXFA 1Q7LB 5DB8A 2FPHX 2MZJA 4D3HA 3S8SA 3HWTA 4IOCQ 4N76A 2W1BA 1U6ZA 2H65B 1EO1A 4PXCA 3OYHA 3C6HA 4ED0A 5DBBA 4O5CA 1PJ7A 1U0HB 1IKXA 9ICUA 4ZOHC 3RB4A 4X62J 2PEBA 1EKRA 3FKBA 4DV0K 5JVHL 1RWWB 4CE9A 5L46A 3CDEA 1A5VA 4JS5A 3TJAA 1XERA 4WTYA 2X1GA 4CWBA 4B9VA 3BKFA 3O3GA 4IR1A 3QEIA 3HSCA 1RG6A 3RJGA 2F44A 3KG4A 4QJFB 4B02A 3DNCA 4F2SA 1GLFO 1NMDA 2G2OA 2RRDA 3H6EA 2PMZD 1LOTB 4UARA 1CJUB 4BDPA 1R8BA 5ETTA 3NGYA 2W8LA 4ECXA 4I2CA 2V8PA 5CZXA 3HM9A 4O3OA 1SZ2A 4EU0A 7ICFA 5HL7Q 3UNYA 3AAQA 2AYMA 4WU3A 1M5HA 3HVWA 2CNNB 1CEZA 3TR8A 3AJ1A 2HI0A 1TK5A 3O9TA 3EXCX 4KLIA 4DWIA 2NS1B 2F3NA 1GMVA 1KONA 1H0HB 1U1KA 4KAZA 1PSDA 3F2BA 3N6LA 2LI6A 1G7CB 4Z7CA 1GO3F 4YY3K 3PR5B 1ZQMA 4GV9A 1WG4A 3UI3A 2XVTA 1IKVA 2VQFF 4E7LA 2JHEA 1WSJA 1ZH5A 3C6AA 3N5BA 3ZZOA 2YQEA 4CLSA 5HMYA 4I56A 3CPEA 4QIFA 3IBFB 2HNDA 3QQCD 3D6MB 3FFIA 4OX9K 1NMEB 3R8YA 5J2PA 4OZ3A 1SKUB 4ILLA 4W5TA 7ICMA 2ACMA 2IHNA 1QQNA 1H98A 2QA1A 3NNCA 1T6DA 1DK2A 2FHOB 3AQPA 5KGXA 2CJQA 1H7XA 4MKBA 1FIQA 2P6TA 2BE2B 5J1EA 3PMLA 5KAKA 3AY9A 3L4IA 3DV9A 3ZD8A 3VOVA 1RQLA 5KFZA 4Y2QA 5HVFA 1X9MA 3AVLA 4I2IA 3HVAA 3MX5A 2I5JB 1LW0B 5JRTA 3HW8A 4NLKA 3H40A 3ILLA 4ALZA 3TVYA 1Y7PA 4UATA 1FEHA 5F8IA 1WUAA 3O4NA 5DG7A 1HYSA 2B4VA 1B43A 4DTRA 2MZQA 2IVYA 2YCHA 4KLMA 2V67A 5D49A 2OHFA 1P8ZA 1EAYC 4P2MA 2WONA 4YOEA 3ZSXA 5H9FJ 2JLFA 1WJ9A 4ZVPB 4LMZA 1WCLA 2MLYA 5G5HA 1N8RO 5AQLA 3P31A 5HRRA 4BE2A 3V4MA 5J0WA 1KRPA 3ISNC 4B1ZA 3OJUA 4JI4F 4KH6A 1YITS 2PO4A 2LYHA 1AUDA 4C2MA 1R89A 4IG0A 2IFXA 4KLGA 4NLVA 1I39A 3O8WA 3FVYA 4QNLA 1IIPA 3K89A 3EDRB 3R5AA 5AQIA 4CJ7A 2IIRA 2BCRA 2VA8A 4DV5K 4OX7A 4FOEA 1DY3A 4H03B 2UUAF 1TYQA 2VPWB 4FKYA 1JL2A 4RPYA 3UDLA 3HHLD 2D0OA 4YB6A 3RMCA 2PZSA 5ALYA 2NRXA 3N28A 3CCLN 4ZP6A 4DR2J 2QE5A 3V7JA 1WF2A 4NMLA 3ENWA 1XNRK 1RT3A 2CNOB 4IQUA 3IWXA 3PEJA 1NB2A 2Y0SF 4ANEA 1RHMB 3J8AA 3IO1A 3CC2S 1K9MO 4G1QA 2UXCJ 1FA0A 4CLUA 4FL9A 2YWFA 3LAKA 1DBDA 2OJ3A 2E2PA 2GA7A 4OYOA 5AQZA 1AFJA 1M5VC 1K8AO 1IR0A 4CF0A 2NSCA 4GC6A 1MN9A 1FFGB 2X1AA 1VQOS 2BUPA 2C3MA 2YTCA 2GMLA 4OYZA 4C4SA 3SMPA 2DPNA 1RPLA 3MAAA 1IXRA 3GFYA 3BQTA 5K14A 4Y2RA 1SKSA 1KNZA 4F4AA 2ITGA 2OPRB 2ZZNA 2GO9A 2FVSA 3LYSA 3CD5A 5KI6A 4RWXA 4CCHA 2JV3A 3LDQA 1SIWB 2DNZA 4KBIA 3CCUN 5LXYA 4USIA 4CGGA 5LMUK 3I4PA 4H5VA 2DUYA 3NF9A 5E0OA 1C1CA 2F8TA 3VQBA 2BR0A 3T6BA 3RZAA 3QGHA 3UXPA 4RQ5A 3MCAB 5C25B 4H4OA 3MI7X 2ISPA 4K2XA 4QBUA 1T02A 3VQ4A 5HMLA 2Q2RA 5ALKA 2H3FA 2E6LA 4B9LA 2N7YA 4AQYF 3T1HK 4GKKK 3ZFVA 3OTOK 4JI2F 2W54A 2X7IA 3HZEA 4NYNA 4GKKJ 5JU5A 1HQEB 4BC5A 2NUBA 2PE8A 4L72B 5KFKA 3OVBA 2OEJA 1MWYA 1CJTB 1KCFA 1RABB 3HHDA 1OH6A 3AXMA 1DK3A 3SLCA 4CJWA 4LD0A 3AY0A 2NXNA 3TANA 3DGPA 4EX6A 4DL5A 2L9WA 2WFAA 2JNJA 3V6JA 3C6TB 1IO2A 3V9SA 1N6QA 4QZIA 4TU7A 1EJ7L 2P2CB 2C2RA 2PKEA 2A1AA 2E9TA 1Z1BA 3AO3A 1V3ZA 4MK9A 4NM2A 3HPGA 2VQEF 1Y3JA 8ATCB 3FMBA 4I2DA 1DTQA 1DFDA 2UYTA 1WTBA 2EWHA 3P6YC 3SDEB 1LV5A 4MIAA 2BQRA 2M3DA 2W3RA 3WX8A 2ZIWA 4UBBA 3MPUB 3AVKA 4K8RA 3OS0A 3QEVA 1L5UA 1Y64A 2A2DA 4UY8O 2AEJA 2E9RX 1SJRA 4CQ1A 1L7OA 1M6YA 1NNDA 1ZJNA 3ZDDA 2E1PA 4MYUA 1A77A 3FNNA 1TVRA 4H5NA 3NNHA 3M1VA 3HULA 2QXLA 4U8YA 1UVJA 1VYAA 2JEJA 3H20A 3MXJA 4Z4HA 1JXEA 2YMMA 2FSKA 2FSNA 4RPFA 4M3ZA 4CJKA 4BC3A 3NMAA 5CYQA 4X4PA 3OYIA 5K8MA 4ZPDA 3FDSA 3KIOA 5AK4A 4CHNA 1YBUA 1QD1A 4CESA 1O51A 5D15A 1Z25A 2PMHA 2KSOB 3ULEA 2I8EA 1U1NA 5HAOA 1X4HA 4NWIA 3JTOA 5J2DA 2BACA 2E9ZA 2MSTA 4UBCA 2BEFA 2QX0A 4QPXA 3F5AA 2J7WA 1Q79A 3BGFA 4J5OA 2RT3A 3AA3A 3HM8A 4LF4K 5KTQA 2XYGB 4FE3A 2CDRB 4KN7A 2P9UB 5IWAF 5KGWA 2XMJA 4W92B 2EZZA 3BGUA 3KK2B 4WZQA 4MFFA 2J8SA 2A3VA 2OGUA 3K5LA 4DOAA 2GO7A 3B6BA 3M3ZA 5AZJA 3RWUA 3O08A 4TVAB 4NYOA 4MFAA 5HHIA 1RQ0A 2R7WA 1Q82T 1Z05A 4F4XA 1NUEA 3L2WA 3GIMA 1ZQZA 2QB0B 4FM0A 1J5OB 4OJLA 1WC0A 2CFXA 3AUOA 3C16A 4RW4A 5AQGA 2BPGA 4Y2VA 1LVHA 2HRTA 3BKTA 2GWJA 3G71S 4YMOA 1RT1A 4TLRA 3DC2A 4FYXB 4FF3A 3C7NA 1XMOK 1D8YA 5L9NA 1ZYQA 5HHHA 3G96A 3AVCA 2HHUA 3EL2A 1SQGA 1LWEA 2R7VA 4C0HA 1KQGB 2P9PA 3G6ES 1WELA 4AHUA 8ICRA 2H5IB 1CZAN 1RT2B 3C2LA 2AQ4A 1U25A 2V7YA 3T1YF 1BC6A 4YDUA 1KLMA 3DM2B 1ZJMA 1FJ7A 3PY8A 4WK3A 5A0YA 3C2MA 4JI8F 3QESA 1JLAA 3H42A 3MXIA 3AJ2A 2L5YA 3MDQA 5ALWA 1FNOA 3RJEA 4O44B 2YQ0A 2RVJA 4CIOA 2E5IA 4WCEL 3IG1B 3ZYYX 3TVKA 3IUCA 1FHTA 3DRSB 2HBLA 3GE1A 4M6WA 2L08A 3LDAA 1CRXA 3AGRA 3CO0P 5JMNA 1ILYA 4QIWD 4CO2A 1OPIA 2NRTA 2EFOA 4USAA 3MEDA 2KJVA 4X4QA 4CIFA 2LHTA 3G8QA 2VC0A 2Q3PA 3JPTA 3E66A 3Q8KA 5DS7A 2E1RA 2LEPA 3MDFA 3NWRA 3IDWA 3LM9A 2J9DA 2RS2A 1RT5B 2FZCB 4H5TA 1A9NB 1VQKN 4BDZA 4O3QA 4BCAA 3TABA 4FM1A 3ZZUA 4C4RA 4DTXA 2W4PA 4FK0A 4ED7A 4KHWA 4ELUA 3BP8A 5E3AA 1X3NA 2DQNB 4M9GA 3DWLA 1QM9A 5G5GA 4IOBA 4UY85 5F8JA 5CHGA 2PT0A 4K7QA 2E1YA 2YNIB 3I9ZA 2O8CB 1VDHA 3OTEA 4QWBA 1NWKA 3QZ7A 3P39A 3K0JA 4R65A 1RLDA 2RD5C 4OYMA 3OR1A 5DQHA 3UQ2A 1N36K 5CCMA 4CH1A 4J9UE 5ETMA 3THWB 3BREA 2HFVA 1OY8A 4I0WA 3K8VA 4CTAB 2PGCA 4LF5K 5GVQA 4JMUA 5J2MA 5BR8F 4E98A 1XO0A 3PYDA 3PX0A 3TUZC 1HBMB 4LFBJ 1F2HA 3O3FA 4LF5J 2GQQA 1RKJA 4DQPA 2BXJA 4JI3K 5AJ3J 2ASJA 2UZAA 3MC1A 1ESVA 4LSLB 3DJCA 4KLOA 1LWFA 1WG8A 2BOAA 2FZGB 1JMSA 5DDYA 4DPTA 3V9XA 4MFBA 1L7PA 4DV1F 3V81A 5DDMA 3G8TA 2Z1GA 2HNZA 2HHWA 3IA0A 5M1OA 1ECWA 1K73O 5B0EA 3PNIA 3FR0A 4QZBA 2FVQA 2HAIA 1X5TA 1LWCB 3TWHA 3O8MA 4J9NA 3NH0A 3I28A 3CJSA 4FZLA 4ICLB 1QQ5A 3QT7A 2VIHA 1S9GB 2DRAA 1NGDA 3HXMA 2XS5A 1H3DA 1Z2LA 3W62A 1NGCA 2DHSA 4P2FA 3K8WA 4CGJA 3C6UB 1XR7A 2CAJA 4JI6F 2HRYA 3I4HX 1JKHA 3R1LA 3TARA 1VSDA 1PK3A 1WC4A 3MR7A 3KFWX 3NF7A 1M5KC 2HMPA 4OJRA 1S0NA 5JS2A 2AF6A 5M1FA 3L3VA 1X9XA 5M2UA 1YX2A 1REVA 4OHWA 1BQXA 5ALLA 3IM1A 2ZBIA 1HWJA 4JEPA 4X5VA 4F5NA 2EZXA 8ICIA 2VUGA 1UZHA 2NLWA 2W41A 4HUEA 1QQ7A 1TFRA 2AMCB 5HROB 3ID6A 3SAGA 4DB3A 1S0VA 2BM0A 1FDBA 2F40A 1UW9A 3NS6A 4EMDA 1B99A 3EWAA 1BPZA 2Y1LB 2HFZA 5AQXA 3LDNA 1BIUA 3QNOA 3L6QA 1T9YA 3L0QA 1N5VA 2RMLA 1VGYA 3SCJE 4JKGA 3I5BA 2WOMB 1B4SA 3FM9A 1NNLA 4RQ2A 1KHWA 2UU9K 4ANCA 2ZOGA 1WC3A 9ICPA 3DHXA 3C94A 2G08A 1BNPA 2UU9J 4BBYA 5M1QA 4DL0C 4MKAA 2QWMA 7ICOA 3CJAA 4BRCA 5EE0A 2YKNB 2MGZA 3E01A 3KBBA 3AO1A 2WSCC 3ZZRA 2DEIA 4RUCA 4JUZA 4USHA 4HYKA 3KLEB 3E2EA 3NEKA 2F9DA 3D3BJ 4FJ7A 1QSYA 3CD6N 4O3NA 2MHNA 3KFUF 4L8RB 3MMAB 4UAZA 4KGKA 2YXLA 3PSTA 5JS1A 3CPWM 5D46A 3MN7A 4GMKA 3IR6B 2GUPA 1S6PA 2CG8A 3RB3A 4DO9A 2IVMA 3VCBA 2KYXA 1MU2B 2BW7A 2GQCA 2KVIA 3EDQB 4NRTA 4DR1J 3OLBA 4DTJA 2DGWA 4C4TA 3TEHB 4X64J 2BBEA 4XPCA 4HVJA 4BRMA 2HAFA 4RJVA 5H9EK 1C1BB 2ZJPL 1G99A 1PK1B 1N63A 3GV5B 3I55N 2EAOA 4P2HA 1HARA 2CQIA 4DOZA 1JLGA 5H9EJ 3I96A 3O6QA 5E3PA 1X42A 5A8RA 2I6XA 2J76E 3M32A 1S59A 3ZT0A 1QAIA 4RL1A 4KH1B 3R1HA 1Q5YA 8ICXA 2N3OA 2W42A 1Z3EB 4JN4A 3JSRA 3C21A 2IM0A 4R0EA 4FLTA 5ALQA 3HHLA 5T7LA 2H3EB 3C14B 4X66F 3C23A 3GIJA 3OY9A 2VKQA 5GAGI 1OY6A 1EQYA 3MK6A 1FJCA 2DFHA 4KLDA 4JAXA 1BPXA 3KLGB 2QC3A 3PW2A 3L3UA 2GGPB 1VQLN 1JX4A 1NK4A 3WK8A 4F91B 3IM8A 1DT9A 3GU3A 3H2UB 1R6YA 3DYAB 4A8QA 1UVKA 4IFYA 2F1HA 1HPZA 2EFGA 3KLIB 3CJBA 3SQ0A 1RHQB 1URJA 3IXQA 3PKMA 3H25A 3MR3A 2BKNA 2FE9A 1S1UB 4HL9A 4YVZA 5AQTA 4I2PA 1NLKL 5KFAA 3L09A 3CCRN 4OX6A 5D6GA 2FMSA 1JUDA 5L1KA 2KE7A 3T9NA 1XMQJ 1U04A 3TACB 5IIIA 3AD7C 1RZTA 3EUNA 3FRZA 3SAHA 1LK5A 3D2EA 4FKXA 1IKYB 1FRHA 1JLBA 3UD5A 1ZD4A 4CJVA 4CZHA 1BHNA 2QTWA 5BJRA 3QLHB 2IVPA 3IRXA 1BE4A 4JI1F 4P0QA 3KDOA 4P75A 3KJNB 5AXKA 4CEFA 4K2JA 1ITPA 1WF1A 4B3RF 3K0SA 3DDIA 1XMBA 3MGIA 2DEJA 2OPPA 3MHYA 3AM9A 1VSJA 3R9LA 5KFIA 1QVFR 4JI5K 4YOUA 1MQ2A 3UW1A 2HCFA 4B08A 3QBXA 4YOYA 4CJPA 1D3WA 2RQCA 1JCGA 3LZIA 2VG7B 2CA9A 3M8ZA 3U7JA 1ZM2A 4PYAA 4Q2MA 3WIVA 4US8A 1KBRA 4O3PA 4GVLA 2MRLA 2GO8A 1M5PC 2LM4A 2DNQA 3DRRB 3H45C 3KK7A 1PYTA 1UT5A 3M2RB 3U02A 3KUEA 2AYGA 4ZP9A 3FEXB 5LJVA 3NFAA 3R2CJ 5HOOA 2IMWP 3BYRA 3A1YG 1CJKB 3LVWA 3EGNA 1XIQA 5F0WA 2DY1A 1N5YA 1RI7A 2VFSA 1VRTA 2BZ2A 3VGSA 3EKUA 3CQXA 1RDBA 3ORYA 1GXTA 5ETPA 1S4EA 5K5MA 1CC8A 4RX6A 3PIOL 1NPRA 1VC0A 3CJ5A 2BVZA 3K9KA 4KMOB 4ENOA 3NY0A 2HVHA 1RILA 3TP2A 4MH8A 3AA5X 2V8HA 1Q78A 1SBRA 3OBIA 1O08A 1R0AA 5ALFA 3CJCA 2YWGA 3VGKA 1F1BB 4KLSA 4QWAA 4FJNA 4RBVA 3VAHA 3IAYA 4BR2A 1MA9B 3H4DA 1FO1A 2J6SA 5TKYA 3CUNA 4H4KC 2WF6A 3C15A 5JXSA 4ZOSA 4GKJK 1QZ5A 3NG8A 3KNGA 3VETA 5KFBA 2A1JB 1FD8A 1RZMA 1YKWA 1TK0A 2DGTA 1YRTA 2LQ9A 3Q8YA 1B7FA 2FBXA 3NUQA 2ATQA 5HMWA 4NLUA 4NCAA 1VHFA 1HBOA 3HVTA 3N97B 3CM6A 1JLCA 1WSFA 3TJ8A 4LFAJ 3VGTA 1T7PA 1UAXA 4Y0FA 3SUOA 3G6YA 1SC4B 1YWXA 3MCMA 4ZPBA 1GTEA 3DXKB 5HK4A 2JFKA 5E79U 4B3MK 1VMBA 4DQIA 4OJ1A 4H8KA 2IM1A 2H5EA 2KJ5A 2OTJS 3O3HA 4B3MJ 3AL0B 1R0CB 2ZNZA 5AI9A 4DCHA 3ITHB 3DFEA 5TISU 2HFNA 1NU0A 1VBXA 3SEOA 2EC0A 2D0CA 4LRDA 2ASYA 4YR0A 2PEHA 1E4FT 4RW7B 1NO8A 5FROA 1RDWX 4B6JA 2GHPA 2G0IA 2G0CA 1KEKA 3FZKA 4BC4A 4FF2A 1NB7A 3M05A 5C5JA 2Z2MA 1X4CA 5F9LA 1HNIB 3NVMA 3SZ2A 1EXNA 5AQRA 3ZSYA 3WUHA 3VAMA 4DTMA 1EWQA 1COOA 3RRGA 4DR3J 4ZPCA 3TJ9A 1DGKN 3I0RB 3UKUA 1HKCA 3DMJA 2VODA 2CQ3A 2C42A 3TAMA 1VQNN 2RHSB 3MN9A 3MCNA 1N52B 2WZ1A 4G3IA 2HW3A 2LA4A 3HHNB 1FK9A 1Q9XA 4KB1A 4Z6DA 3R97A 4UQTA 3DI6B 4FNIA 3IP4B 1RHKB 5J2AA 1ZD2P 2XHBA 2JH7A 2ZG6A 2KG0A 3T19A 4PKDB 4CJRA 3LWMA 2R7YA 3R6LB 1T9UA 3SQ1A 2H54B 2MZSA 4K4VA 5KFPA 2EI5A 2KTQA 4M47A 5H2FU 1IV0A 2XNRA 1U8SA 3MR2A 5EX3A 1I3OB 2BJ8A 3VERA 4ITSA 2GH1A 1ZQWA 4LF8F 4EK2A 2ZM6F 4AL6A 3C2PA 1BO5O 1SH2A 4HH0A 4FYVB 3LDSA 3HZGA 3DOKA 5E26A 4M3WA 5DGAA 1PVQA 1UP1A 1UPPA 9ICFA 3CCWA 8ICFA 3ASMA 5M2RA 1TUGB 3JSMB 7ICGA 2KHDA 3AT1B 1TFYA 4DV4F 2RKIB 4KC5A 1BA1A 2VQFK 1G1XA 3W2WB 3D4JA 3DOLA 1BNOA 2WTFA 4CHQA 3F9KA 3GSDA 2ZH7A 4CF1A 1LW2B 1X5PA 2VQFJ 5MLCV 1T6CA 1NOYA 1FXLA 3AN1A 4X65F 2Z2ZA 2DR8A 1WHVA 1NM1A 5AQKA 4BC7A 4LBHA 2WVCA 2UUCK 2Z30B 5DRKA 3OYGA 1Y5IB 4UAYA 1AW0A 3MABA 5FPDA 1RDAA 4K4SA 5KFXA 3CCTA 3M8PA 4KI6A 3A3OB 4Q5VA 3MEKA 1T94A 3ULDA 3GZFA 7ICVA 3JSYA 1NGJA 4P10A 3JQMA 3M6KA 1N5XA 1NDKA 2AYEA 1NGIA 3WNFA 2QA2A 3M8QB 2ESEA 4O8KA 3ZDBA 1S0OA 4GV3A 3HPOA 5D3GB 1HMVB 1S4FA 3E9OA 2RU9A 5J2NB 1FRJA 4ICAA 3AO4A 4F25A 5ETKA 4B1XB 2BJEA 4CFCA 4WFNL 5GAGP 3KHRA 4FJKA 2CQDA 1RAHB 4J2BA 2M9NA 4ZJLA 3ATUA 3SR6A 1F0MA 4P2SA 2LM1A 2O4GA 2OSQA 5RUBA 4ZHRA 8ICCA 2AJ0A 2A6MA 1X5OA 3HILA 1T9XA 2MYFA 2JL9A 4PY5A 3JPRA 4TU9A 1T44A 4DF4A 4O5BA 5AK6A 2PFDA 2H3QA 4J9QA 3OYJA 1Q3UA 2POKA 3EEQA 1KHVA 1OH5A 5A0LA 5IFMA 4CYUB 2HHHF 3W64A 4K59A 5J2GA 3WHIA 3I56N 3DXBA 1T05B 4JI4J 1XEZA 3QEAZ 1RDFA 2VFVA 4CZKA 3A12A 1WI8A 4KLJA 3QNMA 2E8NA 2Y1JA 3EWGA 2AKWB 2W43A 4RR5A 2QRRA 5U47A 4P72A 2D5RA 3KWGA 1UAWA 5FLXU 2UUAJ 1EWRA 2NUHA 4XTTA 2B6GA 5E3CA 1C0MA 3KLVA 4Y2YA 1WLJA 2LMIA 1FKOB 3IGVA 2ZWOA 1QQOA 3CCVN 3EPIA 2E1EA 3OYBA 3V7KA 2WHOA 3U6FA 1GH8A 3GFZA 3AEVA 2KEYA 2OTLS 5HP4A 1Y88A 4F26A 2LMRA 4WKYA 1N34K 2RHKA 1CJUA 1HR0K 2ZH8A 3ZETB 2JGAA 4ILJA 3I82A 4DUZF 1APSA 1AT1B 4DR6F 5LT5A 2WB1D 2FJ6A 1KN6A 2Z4PA 3MM6B 1BISA 4DU3A 2E4LA 2AJQA 1ZQDA 1M90T 4B3TK 1WNSA 4WIQA 1QY7A 2KVCA 3QDKA 3ZC4A 1M1HA 1RWPB 2LLZA 2BQ3A 1QQMA 2BJ9A 4ZVFA 1S77D 1XR5A 1RP5A 5GAEI 3SJJA 2MAXA 3N4QA 4QIWC 3OPXA 2DGUA 4DPXA 1YJWS 2HPUA 3E9PA 4FVUA 2DKXA 4LY7A 2C3OA 1V4SA 3R3LA 2P66A 2LYBA 1IKXB 4LF7F 4OYWA 3R7NB 1NZPA 1K8KA 5B0AA 1V38A 3Q22A 5KOWA 1CQMA 2DB1A 4C7ZA 2IJRA 4IYQA 4URQU 2NRHA 1MDUB 4FWSA 4O9MA 1KW4A 4Y2UA 3UVJA 4YOTA 2NZTA 3MPDA 3HT3A 3IS9B 1HNVA 1X4DA 3ZSZA 4JI0K 1U45A 1EHWA 2BE2A 4NXNK 4KHPF 3Q8QB 4AQYJ 1T3VA 2MKJA 2PFUA 4O4GB 2EKYA 4JI2J 4KHYA 2Z7JA 1XQIA 2HSEB 5I9EB 3A8KA 2FJVA 2I5JA 3I9V9 5LJ5Y 3QFHA 4NO7A 3B78A 2G13A 1N62A 2VPYB 2VONA 4NZ6A 2GJFA 4QZVB 3ETOA 1VQ6N 2FXUA 1L8OA 3OTDA 3TZYA 4RQ3A 4CJ5A 3O5BA 2RAQA 1N32K 5E84A 1FCAA 2D74B 1EARA 3PW5A 1HUZA 2FZKB 4I2AA 2F8SA 2ROGA 5GMDA 4FFDA 1W2IA 4WKRA 2OPSA 2Z1IA 1ACMB 2JSXA 3TA1A 4CLKA 2VQEJ 3EE9A 1IKVB 3KXDA 3SFUA 4BG9A 3R5GA 4JI7F 1T9TA 1TL3A 2I2YA 1TFWA 5GAHI 3BF3A 3HCXA 4WBFA 2HNDB 2J9DE 3ET6A 4OYAA 2Y3YA 1WEXA 3V5RA 3CXCR 4XH4A 2ZH6A 3VA3A 1ZQQA 4Y6IA 1TP7A 5F1XA 4YMNA 3KUGA 3BDPA 3QGPA 3W3SA 4PR6A 2BJ1A 2P9EA 1U2VB 4DL7A 2CWKA 4B1VA 2EANA 4HEA9 1RBRA 2IBKA 2H1YA 2ZC3A 3MN5A 1ZQTA 3AAWB 5J1EB 4OO1J 1BPEA 2RQ4A 2V2QA 4OLAA 3D9BA 3UD3P 4FBUA 2YH0A 3ZTQA 4JYAF 1HNWF 2DPIA 1Q8LA 3TW0A 4HUGA 3PIOQ 2ZIUA 5ALPA 4LJMA 2ZH9A 2D1CA 2HDOA 2NRVA 2DITA 1TQLA 2MKYA 5AM4A 2W11A 5A2QY 1CZ9A 1A5WA 1ZBIA 2MPUA 4ECQA 3OQ2A 2BW2A 2OEHA 3HP9A 3QB0A 3FZ2A 1S6OA 3K9JA 1KBUA 4I4BA 4HWIA 3WK9A 1HYSB 2CQBA 4HACB 4LUBA 1J2VA 2M2BA 1PCAA 3BYPA 2A1BA 3ICXA 5FRNA 2GBZA 3B0YA 4DF8A 4WWSA 2HS4A 2XGQA 3MECB 1N4LA 1CI4A 2Z1JA 4QWDA 1KL9A 2XMVA 1Q5VA 3VQ7A 3UN5A 3M5RA 2DGSA 4XDCA 2UUTA 2P9LA 3LDLA 4B17A 5IWAJ 1RM6C 5AKEA 1M5OC 3NS5A 4I27A 4DOBA 2OPRA 2GTDA 2K3IA 3SAFA 4J37A 4OI4A 5LMNF 4AHRA 3CCEN 2ZUGA 2C3YA 2EPIA 5D77A 3IRUA 3EICA 1V5VA 1B0VA 1HIYA 1FE4A 3CW2C 3FGVA 5D0HA 3P38A 4ID1A 5KT4A 2G2ZA 2K89A 4CEAA 1SB6A 2EC2A 1DJ0A 3PSIA 3DRXA 2HQFA 4FPBA 1KEJA 4C98A 3SQ2A 4CJFA 3DDHA 1UJ6A 4PWWA 3KVGA 2O1PA 4DV0F 3NGZA 4YXJA 3TWZA 2E5LK 3MMJA 2WUSA 1VAZA 2CJ9A 3C8YA 3N7PD 2ZZTA 1RT3B 2Z0GA 1NPPA 1VR6A 1HJRA 1ZAVA 2WW8A 3FRYA 1HLWA 3VHQA 3OUYB 1HQEA 3TUPA 4IJNA 4DX6A 2CUYA 4ZTJA 3KWMA 3CMEN 5IILA 3H0RB 1S6QA 3TAEA 2RJZA 3UNGC 5HBMA 3OFEA 2B4UA 4ANDA 3W2VA 4M9LA 4K50A 3EZUA 7ICLA 4TKTA 3QATA 4TUSA 3CCMS 1U1QA 5IC6B 3T1YJ 4TURA 3HDSA 1Z4UA 2Q66A 2A2CA 3CM5A 3VQAA 3TAQA 4JI8J 2VASA 3MMBB 4RNOA 2OM6A 3C6TA 4USWA 2W7PA 2I38A 3C0BA 3J7YP 1S76D 2CXEA 1N8RT 3L4QA 2AYBA 2H3GX 2OMOA 3CJ1A 2BJ3A 3KKFA 5IOLA 3NGKA 2X3GA 4WQ5A 4LFCK 1OKJA 3FC4A 1FWLA 3N01A 4YY3F 4ILRA 3BY5A 2PSZA 3CIMA 3F9MA 2MJNA 1UTAA 3ZNUA 3WXLA 2N7CA 3SDEA 2XB2D 4OKKA 5BYRA 1WAJA 1FWPA 1HX1A 4M3UA 1G3OA 2IOFA 1UVMA 1RCOB 2KLAA 1C1CB 2P35A 4OX9F 1AQ6A 2ZIVA 3IMXA 2ZH2A 3ZT3A 1Y00A 4H4OB 2VC1A 2DKOB 1IWAA 2KW4A 2JEFA 3C46A 4OHYA 2ZGZA 1UCNA 1K9MT 1NI3A 2HGMA 3BS7A 3TKAA 4DQSA 1BQNB 1BU6O 4YG2A 5A6WA 2CVIA 4OI2A 1SL2A 4P9SA 5ALIA 1N5SA 3C19A 2RHQB 4DFDA 2KSOA 1RWXB 3DGPB 4R63A 3L95X 1IJEB 5ETRA 3M8YA 1U26A 2YKPA 1ZQJA 4HT7A 2DNMA 4F4YA 3NH1A 1YI2N 3RJFA 3D2WA 2KRBA 3J7ZT 5BR8J 2P9UA 1T03B 3OYCA 1MW7A 3KKAC 3KK2A 3T9ZA 4TLQA 4XEIA 4RKUC 1PGZA 2X74A 4A61A 4RPZA 2W40A 1QHTA 3A5OC 2R8IA 3CT9A 2LDIA 2GWSA 2MZRA 3G8SA 4R64A 1RA6A 1RT6B 1S79A 4LF9K 2Z56B 3F5TA 4TQRA 3BO4A 1XNQK 1J5OA 3K2YA 2Y0SD 4DV1J 4ED8A 3H5XA 1MQ3A 2C2KB 4HT5A 4FXWA 1X60A 4C9DA 4CBUA 4KHUA 3S6EA 4DV5F 1TVRB 1VQPN 1TKXB 1QVGM 2KVQE 2K2PA 4FJJA 4ZMMA 4OKJA 3A4TA 2VYPA 2BM1A 4FZVA 2NYHA 3KZIU 1X4AA 8RUCA 1Q8IA 5KFUA 1S1VA 1PO6A 1XNRF 4JI6K 4OI3A 5CYQB 2VA2A 5KFNA 3BO2A 1IR2A 3VENA 4JI6J 1WSVA 4IDKB 3K57A 1GOBA 4NLNA 2D0PA 4NLYA 3E1YA 1QLNA 3ULEB 2FLNA 2WCXA 5B0DA 1KWMA 1SV0A 4A47A 1CS4B 3JAMU 3MN6A 3N9UC 1VIOA 3CJ7A 4KREA 4JV5F 5AM5A 3DM2A 1RSCA 4CO5A 4ZS6A 3X3UA 5T7BA 1ZBLA 4EGLA 2CJBA 1UJ4A 4O44A 1M1KO 1S7IA 4IEIA 4LF1A 3OXGA 2J4RA 1LXNA 3DRSA 4B1UB 1SKWA 1Q86O 1MWKA 3U8XA 4I6WA 3O1WA 3QRPA 1JJ2M 2F7VA 1XU4A 5CEHA 2KNJA 5I4MA 4WZMA 5AR0A 3X1LB 1NJXA 4UY8T 2X6NA 2UV8A 1OYEA 3L9ZA 1Z4NA 1PAUB 3C16B 1VQMN 1E6YA 5T14A 4QZHA 2ZH5A 4EP5A 1OYDA 5LMUF 1RT1B 3UE5A 3PW0A 3K1ZA 1RT5A 5KFCA 5IT0A 4X4UA 5DZ6A 3DN9A 4L73A 1F5AA 2AJ1A 4QYZK 5L8RC 4EEYA 2B0CA 2HBKA 2Q36A 2D3O1 1P90A 3T1HF 1Y0HA 3OTOF 3Q2SC 4Z4GA 2FHJA 4Y2CA 1NSKL 3CCLS 1W2BR 1C2PA 1RBUA 1N0VC 5IIOA 2YNIA 3O9RA 4EZ6A 4DU8A 1NKEA 2O8CA 4OMFG 5CA7A 3EJMA 5F3ZA 2HGLA 8ICHA 4PWDA 1KLMB 4BE1A 4BGBA 2DGZA 1VBZA 5A0YB 3WNGA 2F8LA 3RH6A 1KTQA 1Q4RA 4IRCA 1SQKA 2JZBB 1VSMA 1SC3B 1X4FA 4M6WB 3EPGA 1URNA 2MKIA 2D69A 1S8OA 4NLZA 2QLWA 3M9NB 5IIJA 3J80O 4CZCA 3RGIA 3CHWA 3DGVA 1CUKA 2K4IA 2KI2A 4V19X 2GWKA 4NLTA 4LSLA 4X66K 3VGMA 1SIJA 1UT8A 3FBFA 1VS3A 4X66J 4ZH4A 1NSPA 1SXEA 2WK4A 4DS5A 3CB4A 2R7UA 5ALMA 4AHCA 3BBFA 3QEWA 2LKYA 3CCUS 4C3KA 1IKWB 3ENVA 1HI8A 5LSOA 4WYBA 3M7DA 1JXLA 3PJWA 4ZVHA 5FD1A 3ZX0A 1YK9A 3ALRA 4ICLA 2XULA 5EX0A 1S9GA 2NRWA 3ZSVA 4AILC 3ULHA 1BY9A 4DR7K 2R7RA 2R9LA 2IJNA 1ULRA 2HYIB 5AKXA 3HLUA 3C6UA 4DR7J 4JWNA 2E1AA 3PVXA 5J2QB 1WG1A 2HOIA 4DXLA 1S1TB 2MZTA 3SI8A 2Q79A 3ENHA 2DL0A 2YX8A 4M7XA 2F76X 4S0MA 2NYIA 2RQKA 4I69A 3EW9A 2XCAA 5IM0B 1RLCL 3CE8A 4F5PA 4NI2B 4JI1K 5A2QO 2CQ2A 2OYYA 1KAYA 4JI1J 1U6BA 4FN5A 3GR0A 3ED5A 2EX3A 5BREA 2HOEA 1RAAB 4DN9A 3SD7A 4ACOA 1SV4A 2L9NA 3OL6A 2E7XA 2E44A 4LF4F 4B3RJ 3V7LA 3MPYA 2E8PA 4Z4EA 3H0LB 2N4CA 3EXYA 3I8DA 2W2QP 5HROA 2HG4A 3WKDA 4NOHA 2GIRA 4QZCA 4M3XA 1J5EF 1U02A 2CNKB 1NHVA 2KN7A 4M1KA 4NE9C 1LWFB 1RJJA 4UZCA 5ALTA 3ZZZA 2AX0A 4DFPA 2BYCA 3PW7A 2WOMA 3WKEA 1R8HA 2ZBCA 3Q8PB 4OVLA 3IFEA 3LAMA 3CCSS 8ICAA 1DAXA 4GMJB 2HVIA 2ZBQA 2B4JA 4IO9Q 4CJEA 3N6MA 4ZVSB 5AK3A 1H1VA 4CGIA 2DR9A 2WB4A 3KOAA 4FYDA 3JS6A 2ZF5O 1U2FA 3RSEB 2CQCA 4KH0B 1XMOF 5KFJA 3HSGA 2MQ8A 3O44A 1I94F 4PHDA 2YI1A 4BQZA 2ADBA 1S6UA 5C2DA 2BPFA 3MXMA 3KLEA 2KIVA 3EMTA 1KLNA 3VF6A 4A5AA 3KOOA 1NZBA 3MMAA 3VCDA 1TVAA 2EG2A 3OHRA 2YKAA 4L3KA 5AKHA 3FSXA 4K4YA 4DL3A 1BL3A 1KVCA 4K43A 2QLFB 4O3MA 9ICCA 1PJ6A 7ICNA 3BPSP 4CNQA 2G5IB 4O23A 5GADI 3MF5A 1YJNS 1PK1A 1HI1A 2CPFA 1IWGA 5FPEA 3PNCA 4U96A 2OCEA 4TXSA 1V9PA 3B4DA 1HBUB 2J0WA 2EW9A 3SEIA 2R2SA 1DHMA 4EP4A 5HMXA 3H8MA 1K73T 2HBJA 3WXJA 3THVA 3SK3A 5KFEA 2DPJA 5L38A 3C14A 3NAEA 4IKFA 3O9QA 2VJ5A 5J1NA 3QPIA 1U1OA 2B6AA 3KLGA 2QWLA 2GGPA 2B51A 1FXRA 4OZ0A 3T5HA 4JB8B 1TL1B 4N56A 3DYAA 2QKKA 3AVNA 4B3SK 3QGGA 4C7QA 1WWHA 5BPMA 1OPZA 1SL0A 3SXLA 4LH5A 2GUIA 8ICQA 4KRFA 5IV4A 3PCOB 3VR1A 7ICJA 9ICXA 1KD1T 2ZZMA 1D8LA 1HIWA 3QGIA 2FC8A 2MDAA 3V1QA 2IAJB 3OL7A 4A62A 4TUQA 2WB1C 3L4PA 2FBYA 2P51A 5FRMA 2XSJB 1IKYA 1AROP 3DRYA 4LC9B 1PKUA 5J8YA 5AKIA 1N36F 4CGFA 4MO4A 2IRYA 3QLHA 3BH7B 1TZ0A 2ZDOA 4IZ9A 2JEGA 1IBCB 5J29A 5A8WA 3RR8A 1HQ2A 3HYFA 2VJ4A 4YEAA 4P71A 3R9KA 2BCQA 1JLGB 2RQ5A 4USKA 3T41A 4RW6A 5A8RB 3RG6A 4UOGA 3UMCA 4I9LA 4JI3F 4CHYA 3T5KA 1N5QA 1V4TA 2DBYA 2DXDA 5DDQC 3IHQB 3BSAA 2X3DA 1J9AA 2KIWA 3HHLB 1EKEA 1KC8T 2QWQA 4WQ4C 4EO8A 4NLPA 2AW0A 4QS8A 1NZ8A 3M2RA 3J80U 2HHQA 3K5MA 2HK3A 4ZLPA 5H1SV 1YITN 4JLHA 4IFYB 1IJJA 2HSTA 3FZBA 4ES2A 5TKWA 4G1PA 4FVMA 3O80A 1CJKA 3FMWA 4Z6EA 1HW8A 2KICA 4LSZB 3WQPA 5KT5A 1OXJA 1VHIA 4NV0A 4DTUA 4FBTA 3NCQA 4GLXA 4I2PB 1VQKS 4NLQA 4PWUA 2R7XA 5AQWA 1JNZB 4DUTA 1VBKA 5DQIA 1FVQA 1RDDA 4M63C 4DUYK 2MKKA 3QWPA 4K41A 4LF8K 2VWKA 4CBWA 4URSA 4QIVA 5AKYA 3B9JA 4LF8J 2ZM6J 4K4ZA 4IQXA 7ICSA 1JLBB 4JD2B 1HKBA 4C8OA 3MM7B 4UB4A 3FE1A 2UVVA 4IO1A 2AEMA 3U9DA 2DYAA 2KFYA 1VK8A 1FRIA 3HFKA 4DR5K 1W7AA 4ECVA 3GV8B 3M30A 2PFOA 3VF4A 2QKQA 3QERA 4EYHB 1GLAG 1RACB 5J0TA 3TO8A 3T79A 1S9FA 4DV4J 4UF4A 3SQOP 4CI6A 4YR3A 4PKHA 2V2ZA 1ZRMA 4OJ3A 3AMZA 1ZQSA 3VEVA 3VAJA 3KUHA 4FLYA 1P7DA 4X65J 5A2QU 2GQ2A 2QFIA 3D1HA 5AIBA 3MXHP 4C1NK 4PQAA 4NYPA 3I33A 1DURA 3MGJA 1B9FA 2R2UA 2ZH3A 4IQTA 5GAGU 1YF5L 1SS6A 1S1XA 2YMQA 8ICTA 2BKEA 3CDWA 3L2QA 2P9SA 4YXMA 3NCIA 3AARA 3MGHA 2QL9B 3RBEA 3A5LC 4F67A 2YV0X 4PQUA 1NH8A 3D2NA 5AQQA 5AI4A 4AM6A 2A41A 2PDAA 4OV6A 3FSIA 1XC3A 1CBKA 3W66A 5C12A 3DXKA 3MM5A 4RLEA 2FPKA 2IVFB 2EVZA 1JALA 3FBCA 1KQSM 4I2QA 5BPNA 3PX4A 5DB6A 1TL4A 4C0OC 4IOXA 3QUBA 4RUBA 3ITHA 3U3YA 3H0MB 3UCGA 4ED4A 4LQ9A 1FRLA 1X6JA 3KJQB 4CJTA 2HBRB 2PBDA 1ZA2B 4RQ8A 4LR8A 2EKNA 3LWLA 2D4WA 4K4TA 4DV7F 4NZ0A 4W5NA 5EWEA 4DQ8A 3BQ0A 3C29A 4RW7A 1FEZA 1ZQ1C 1WEZA 2R7SA 3KK3B 2ODGA 2ZH4A 4OZ5A 1X1PA 1WDTA 3WNEA 4M2YA 1U47A 4PL2A 1S5ZA 2CPYA 3PMNA 2DNKA 2HHHK 2VV5A 1ZM3A 3IM9A 2CGJA 1TAMA 4E19A 3AQEA 4JK9A 1DQAA 2HHHJ 3CFOA 5AE3A 4AL7A 4C8KA 3Q0AA 2JDJA 2RPIA 5AQFA 3M8SA 2AH5A 4F3MA 3F5EA 1U6FA 2AJFE 4F3TA 3R6MA 2EZYA 4YDDB 1VK3A 2H3VA 2WBMA 1JLFA 1F2GA 4C8NA 3D2FA 4RBTA 2DH8A 1JCFA 1JLCB 2XSFA 2E3TA 3ZZPA 2V4QA 4NEZA 3PKYA 5J0XA 1W7WA 4YFKA 2E5SA 5ETVA 5DJBA 3ZTRA 2ZJQQ 1Y9OA 3MTJA 4WFBL 5KG6A 4IFVA 4ZTFA 2YHXA 4JB3A 1FNMA 3AVBA 3ENAA 2OZSA 1N5TA 1VC6A 5EE9A 3OBYA 4HDGA 3G10A 1VDVA 2HWTA 2W2PP 1BWEA 2EH9A 4QZ9A 3PM9A 3RAQA 4ZVUB 2DNPA 2FC0A 1HNXK 1JB0C 1XNSA 4DUZJ 4J2EA 4KLLA 4HTLA 4DR6J 1HHQA 4I2JA 2ZEJA 3VESA 1T4GA 4AHVA 2QJ3A 1HJOA 1NMNA 3O9SA 3QIOA 4IS7A 1G4CA 4PZOA 4OV1A 4CP5A 4V19S 2OEKA 4YB5A 4PRFA 2FLPA 1WN7A 3CJ3A 3H0PA 2OA8A 3VQ8A 2QV6A 5LXRA 3JSMA 3PHEA 1QS4A 4LH4A 3OYEA 3GYNA 5EVZA 1Z00B 2LKZA 2Y8WA 2XMAA 1VSFA 4AE5A 2KHQA 4F9OA 3W2WA 4IEEA 1OUQA 7FDRA 4AL5A 2MQQA 3GJSB 4JI5F 3TAPA 4KRWA 2QARA 3KKSA 1WDDA 4D3GA 3VPZA 2W04A 4MHVA 2GCFA 1UJ5A 1WOPA 1LKYA 4KY3A 4CH7A 3I32A 3HP6A 3IC1A 1KVJA 4LF7J 1ZS6A 3WEEB 1SPBP 3AO2A 3H3NO 4FW2A 3F2DA 2VOOA 3SIPB 3R5JB 2D3DA 5ETOA 4PGXA 3GFKB 1O13A 5D4NA 3S9HA 4A8KA 1BG3A 4BACA 5D0GA 1V85A 4CGZA 5GIPA 3R5DA 1S97A 4LR9A 2XBPA 1VQLS 4KHPJ 5DB7A 2R3VA 2FI1A 4BR9A 4WXOA 1UVIA 3VEWA 3G71N 5D3GA 1HMVA 5J2NA 1N2XA 3GB0A 1Y5LB 3BN7A 1ZQKA 2HZVA 3D6HB 4ZCMA 4AP9A 3AB2B 3V6DB 3MFHA 5IC4B 4TU8A 3AU2A 4YQWA 1NH7A 1HRHA 2JMGA 1PYSB 3NHGA 4ID8A 3BSOA 2Q6BA 2KB2A 1SH3A 3BF1A 2UVUA 2CADA 3A5MC 4RQ4A 5J0PA 3UKRB 4CK2A 4Z2XA 1X4GA 4JI7K 3CULA 5M2PA 2I0XA 4MIBA 4JI7J 5HR7A 3OHBA 3C28A 1M0SA 4CYUA 4CECA 4GKJF 2IVNA 2E1CA 4U8VA 4MK7A 4J03A 4MDAA 2V4JB 1T05A 2V2VA 4CHOA 2Y0SC 1Z6RA 5HJYA 3V72A 2AWZA 2XEXA 2ISOA 2DY4A 5LY3A 2B43A 1GEHA 4DV2F 3OA9A 3CVKA 1K1SA 1YRUA 4WE1A 3EE8A 2MKSA 1YJUA 2CRLA 3WIUA 3FAHA 3GU0A 4EO6A 4MJKA 3O1LA 2XQCA 1VSEA 4UUXA 4JYAJ 1HNWJ 2FTRA 2HMIB 3HPHA 4C1NI 5DQGA 4HCBA 3V9ZA 5T41A 5KFVA 2JWNA 3CETA 3HD2A 2FDRA 1S72N 4A5BA 4Y2JA 3GYXB 3QINA 3CIPA 2QA4N 1U49A 2RIJA 2HQCA 4TYBA 4E8UA 1NGAA 2F4VK 4MO5A 1AXQA 2LQ5A 1NSQA 2L3MA 3KHGA 1PJ5A 3AD9C 4BLGA 3L7UA 2IJFA 4PZVA 4CF8A 1FF2A 1TKTA 4ID5B 3PX6A 5BYQA 3D0HE 4LZGA 3TNVA 3MX2A 1URRA 4F71A 4CO4A