1NKEA

A bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkeA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkeA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkeA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkeA01
5CA7A 3PMNA 5I3UA 3K4GA 1ZQBA 4K8ZA 3L8BA 5KFHA 1SKWA 4LSLA 3WNHA 4IQTA 3VQPA 4Q45A 4FJLA 3QEIA 4GC7A 4E7IA 2W42A 1UT8A 4I9QA 3HP6A 2A1JA 3DLGA 9ICKA 4LZGA 4F4ZA 3MXIA 3JPPA 5DG7A 1HUZA 1EP4A 4PGXA 4UB1A 4KHUA 4CIGA 4QZ8A 2EHGA 1ZBFA 3ZSXA 5L1LA 4C8NA 2DPJA 3OYMA 4DO9A 3GILA 4DL5A 1KFSA 5J2PA 4YR2A 1W0HA 2KZZA 4J9QA 4BDPA 3JSMA 3MEDA 3GV7B 4C8OA 1S1VA 1VSEA 3NTUA 3UIQA 4J9NA 3AVFA 9ICXA 4EZ9A 3FFIA 2QKBA 1EETA 3VN5A 4FJJA 1NOYA 1YT3A 1X2IA 3NCIA 2UVRA 7ICJA 4DTRA 4O5CA 5KT7A 2HW3A 1J9AA 4RPXA 4MFBA 1XO1A 3ZDCA 4X5VA 1X9MA 7ICHA 3N97B 4O3PA 3TAQA 4M45A 8ICUA 4F3OA 4E7HA 4CGIA 4EZ6A 2W9BB 4PHPA 1MQ3A 4FBTA 2YHAA 1SL2A 4PH5A 3DOKA 3UQ0A 1TKDA 1LAWA 1QTMA 4RUCA 2HVIA 9ICTA 1I39A 4CHYA 3HT3A 4PA1A 4KKOA 1K1QA 5KG5A 3KLFA 9ICVA 2FLPA 2AGPA 2JEFA 1TK5A 2ASJA 2G8VA 3SV4A 3OVNA 4ECQA 4DTMA 1ZJNA 4B8AB 1ZQRA 5EWGA 2IMWP 3CQ8A 2OYQA 3HJFA 4KO0A 3Q8LA 1WSHA 1LWEA 4AILC 1O1WA 4KLLA 1TKXA 4OPJA 2BCVA 5SZTA 4F92B 4CJQA 2RPIA 5D3GA 4O55A 3CYMA 1NK5A 8ICRA 2BCSA 3BJYA 1Z00B 1BI4B 5DLGA 1VRUA 2Z1IA 3OYHA 4DU1A 4FJ9A 1YVUA 5KFEA 3UPQA 1RT1A 4R64A 3MR6A 4HUEA 4M42A 5J2BA 1C0UA 3S3MA 3RJHA 1RBUA 9ICWA 3HSTB 2IOCA 3HXMA 2JGUA 5EWFA 4BDZA 3HYFA 2D0BA 4HCCA 5E41A 1U04A 4R66A 1VSFA 4C8MA 3JPNA 4KLTA 3U6FA 4Q8EA 3RR8A 4NCBA 5KFCA 3E01A 2A1JB 3ZCMA 4HVJA 5KG3A 1JKHA 2R7YA 3E2EA 4ELVA 3V9SA 4XUSA 2GV9A 4CK2A 2P6RA 4W5OA 4O3OA 1BCMA 3VQAA 1RDAA 1XU4A 4CK3A 4IR9A 4M9HA 4CIFA 4QAGA 1ASWA 4RU9A 2PXIA 4CHOA 5DB9A 3NAEA 3K75D 4F93B 3Q8RB 4L8RB 1CZBA 3LPUA 4J9LA 1ZQAA 3TR8A 1HYZA 1RXWA 5KFKA 4QW9A 4NM1A 2BKEA 1HQEA 3AVMA 4FW1A 4DL3A 3HWTA 4BDYA 3TAPA 3DLKA 3ULDA 3QE9Y 9ICRA 4DFPA 2X74A 4PUOA 2HNYA 8ICZA 4DF4A 2BGGA 4JS5A 5TZVA 1RILA 1RTIA 1F21A 2KQ2A 4O0IA 4NLZA 4W5TA 1B43A 5IIJA 4F4KA 3L3VA 3O3GA 3Q8PB 3LK9A 4KLSA 3ZDBA 2DFFA 3V6JA 2XHBA 2XRIA 8ICBA 5KFNA 4ICLA 9ICLA 4KMUA 3JPTA 3AVNA 4DMNA 4XQ8A 4CEQA 4F4YA 4CJ5A 4OVLA 4ED6A 5HROA 4F2RA 1LV5A 3PX6A 1AROP 1NOZA 3NF9A 4M41A 3KD5E 3H7IA 5KFLA 4GLXA 3SQ1A 4P4MA 2I5JA 4CFDA 4J9PA 4M0AA 3I0RA 4MFFA 1Y97A 5JS1A 3HX0A 4B9MA 2ZUDA 3AVJA 2D0CA 2VA8A 1C7YA 5J0YA 3WNFA 2P5GA 4CERA 4F91B 1LWCA 2HHTA 3TQ1A 1ZBIA 4IQWA 4O3RA 2VG6A 5J1EA 3QEVA 4ECVA 1RT4A 1ZQCA 4ZTFA 5J0UA 4FLXA 2DFEA 4I7FA 4K4IA 1J5OA 3GIMA 3VQ6A 4CGDA 4HUFA 2JZBA 5KT4A 2E6MA 1U47A 3CM5A 3WNEA 4ECZA 1WSGA 3K5MA 2E6LA 3AVCA 4Q44A 3NH0A 2VA2A 1BGXT 4QCLA 3NBPA 3VQ8A 1VSMA 3IG1A 4E1NA 3G6XA 3KKSA 2XGPA 4Z6EA 1TK8A 2ISPA 2G8FA 4JWMA 4F2SA 3EWAA 4AHUA 4CEBA 7ICNA 4DSEA 5J0WA 4KTWA 3C1ZA 4DSKA 8ICXA 1A77A 4IFYA 1WCLA 3DI6A 8ICEA 1NK0A 5J2NA 3BQ0A 3CFPA 4I2CA 4I2BA 4PGQA 3I8DA 5DQGA 4ECXA 4MF8A 5DB7A 1QHTA 3ZT0A 2BE2A 3V7LA 2ZUBA 4ECRA 2FBVA 2FBTA 3MDAA 2KFZA 2W9CA 3AVAA 5KGXA 3ZSRA 3KLHA 4IG0A 9ICCA 1CZ9A 1KEJA 3RAXA 4KHSA 2JEGA 4I9LA 5KFQA 3V1OA 1IKXA 1RTHA 4YD2A 3PUFA 3V1RA 3TANA 3I0SA 8ICOA 4OKJA 1RBSA 3ZT1A 3MDCA 5FRNA 3QERA 3KK2A 4ECTA 3Q8SB 3EPGA 3KTQA 1HQUA 4CIEA 5C5JA 4I2QA 3KLIA 1VK0A 2HHWA 5DMRA 4CJVA 4KAZA 2LYHA 4QZ9A 4RPYA 2BCRA 4Q0BA 4YMMA 4RQ0A 4W5RA 3C6UA 4RW4A 5J2QA 4Z6FA 4KLJA 5FROA 1IKWA 1KFTA 1EKEA 2ZQBA 5J2HA 1XHXA 1XSNA 2F96A 5HMMA 5KI6A 2YKMA 1TKZA 3IM1A 5DGAA 4E89A 2Y1JA 1LAVA 2XY6A 7ICIA 3IAYA 1RT7A 1B22A 5KFAA 2OZMA 2G8WA 4FM2A 4GC6A 3DLRA 3ZT3A 2PFPA 1LW2A 4CECA 4FJ7A 9ICEA 4PPXA 3VQ7A 4RNNA 4C8KA 2C28A 1Q8IA 3LDAA 3OYIA 4O3SA 4FS2A 4F3TA 1PZNA 4DSIA 3HP9A 2NUBA 2NRVA 4RW6A 3RJEA 4EP4A 3P5JA 4DTJA 5HLFA 5L1IA 3TAEA 5J2KA 3ZDEA 5KG2A 3OY9A 4DFKA 2W9BA 4FLTA 4FLZA 1D9FA 1HMVA 2D5RA 1JL2A 4NCGA 4F5NA 4KLQA 4ID5A 1BPXA 1N48A 5HP4A 2BQRA 3ZSQA 3OHAA 5BOMA 2R8IA 1RDBA 4P2HA 3LP2A 4DL6A 1Z26A 1NK8A 3NH2A 5JUMA 2ATQA 4FW2A 4QZEA 4CGFA 2PYJA 2W9MA 4PQUA 1ZQUA 3MFHA 3M9MB 4FJIA 1RT5A 1S6QA 3NGZA 1JLBA 2FPLA 5KFRA 5KG4A 4O0JA 3LZIA 1T3NA 3H4DA 4QZFA 3SQ4A 1GOCA 4CHZA 4QWEA 3QETA 2Q0ZX 3B6OA 4DU4A 4KB0A 1XI1A 1NOMA 3LDSA 2BANA 1TAUA 5JS2A 3OS1A 4Z4FA 1SUQA 3PO4A 1VSIA 4XA5A 3M9OB 3H40A 4RNOA 4ELUA 1BPDA 5CB1A 4I2AA 2W9CB 1JN3A 1RTJA 3HL8A 3EPIA 2BR0A 1BCOA 5HP1A 2VWJA 2KZMA 3M8PA 4DOCA 1NK9A 4TQSA 2KTQA 1T03A 2QKKA 2MAXA 4G1QA 2IGIA 3VQCA 1X1PA 5KFSA 4Y1DA 2ASDA 1S0NA 3IHQB 4DTOA 2F1JA 5DBBA 3RBEA 1IKYA 2C2RA 2VA3A 1U4BA 4DQIA 3AVLA 3QEAZ 2EX3A 3AA4A 5KT2A 4RQ2A 7ICGA 5CYQA 2Z1JA 2V4RA 2B6AA 4RW8A 3H8WA 4RQ3A 5J2DA 3ZDAA 3BQTA 3WNGA 4DF8A 1FKPA 1TL3A 5FRMA 7ICSA 2FMQA 3TWHA 1HPZA 4BE0A 5J2IA 3RB4A 3AVGA 4E7JA 3EYZA 4FJ5A 4G3IA 5KFTA 2P66A 4DQRA 1ZQSA 1XWLA 4IRKA 3MEGA 4BE1A 5KFIA 9ICQA 4MFCA 3C95A 3DYAA 8ICPA 2H5XA 3GIJA 1TV9A 2J6SA 4H8KA 3M8SA 3KK3A 2DFLA 3K5NA 1UWBA 3SI6A 3C6TA 4DTSA 5DQHA 3RJIA 7ICLA 4H4OA 3MAQA 4F5PA 3MFIA 1S10A 3PX0A 4DL2A 1GOAA 9ICUA 4YFUA 5D46A 2YNFA 4ZHRA 1TAQA 1TL1A 4TUSA 2C22A 3OGUA 2P51A 2AGQA 2ZD1A 3MXJA 3A2FA 4YVZA 4WE1A 2F8SA 4OLBA 3RH5A 1ZQLA 1RXVA 1JXBA 4RW9A 4ECUA 5J2JA 5KFVA 5C24A 4F5RA 3L2RA 4FJHA 2FBYA 4EBCA 3OJUA 3V4IA 1UA1A 3EW9A 8ICMA 2VG5A 3RR7A 4FK4A 5DB8A 3O4QA 4DTUA 3LAKA 1ZQOA 3QZ8A 3NF7A 4CGJA 4NLKA 1HYVA 2RDJA 3JPSA 3MXMA 2FMSA 3D0PA 2PYLA 3HVRA 4EEYA 2NRWA 1IXRA 1QSYA 3PV8A 4CJFA 3PVXA 4FXDA 4E7LA 5EOZA 1QSSA 2OPRA 1ZQNA 1WNSA 1S1TA 2I9GA 1BISA 4I2GA 3GV8B 3SV3A 2NRXA 1HJPA 3B0YA 3QEWA 2ZJ8A 3PR5B 3OHBA 2I1QA 5J2FA 3RBDA 2P6UA 4EP5A 1ZQPA 1HJRA 3M8RA 4FZXC 3OYFA 3OYBA 9ICGA 5L1JA 4KHYA 2IA6A 1JMSA 4LY7A 3OSPA 3SCXA 3T5HA 4CFCA 1MC8A 4N76A 7ICRA 5DGBA 3L2WA 1KCFA 3KLGA 1S97A 3PW4A 2BGWA 7ICOA 2M9NA 3AVIA 1RT3A 4J9MA 1ZETA 2RF2A 4E7KA 3D45A 4LH4A 5IILA 1D5AA 1RBRA 4B9LA 2Q3SA 3SUOA 1D8LA 4J2EA 1SKRA 1ZJMA 4KHNA 1FXXA 3NDKA 1S9EA 5HBMA 4CEDA 4M3WA 4CJ4A 4NXZA 4MEXA 2BPFA 4F50A 3V81A 1ZQKA 1ZQQA 2HHQA 3ZSVA 4B3OA 3K2PA 3SPZA 5HRPA 3KHRA 3AA2A 4PHAA 5SWMA 4GMJB 1HUOA 3QIOA 1ASUA 4DOBA 4IQVA 1U48A 1JLFA 1R0AA 4CHNA 2ZTEA 1C0TA 1ZQWA 1VSLA 4KITB 3FYHA 3C1YA 4FS1A 4J2BA 1TV6A 4M3YA 3NF8A 4UB5A 1S1WA 2B4JA 2ZE2A 5KG7A 3PW7A 1NJYA 2OZSA 4HCBA 2BHNA 2HHSA 5D49A 5D4BA 3AO2A 5K14A 3DRPA 1ZQMA 2B5JA 5KFDA 1B9FA 1MSWD 3G0ZA 3RMCA 4W5NA 3SUPA 3LALA 3N4MB 3LANA 2ALZA 3ZSYA 4JUZA 3HPHA 4O5EA 3AA3A 5DB6A 4GXIA 2AU0A 2AQ0A 4B8CA 1VSHA 2F1HA 1N6QA 3SUQA 2PFOA 1D9DA 3NGDA 3LPTA 2IHNA 3NGYA 3P1GA 3RWUA 2F8TA 4YMOA 3ZSZA 2YV0X 4CESA 3CG7A 3U3YA 4FZZA 3AO5A 4CEZA 4QW8A 1NJXA 4H4MA 1RPLA 2R8KA 4N41A 1CEZA 4O9MA 1DLOA 7ICEA 1Y88A 1TVRA 2XY5A 3GDXA 1NKBA 3BQ2A 3KKRA 4TSXA 2BCUA 3VQ9A 4Q8FA 1S0VA 3OSNA 5DBCA 1ITGA 4DTXA 1TGOA 2J6TA 8ICFA 4IBNA 2RN2A 4CF0A 3RH6A 4DL7A 2KZ3A 5F9LA 3QNOA 1ZQZA 4BXOA 3ITHA 3RTVA 3RAQA 4ECSA 3MABA 3MBYA 3MR3A 3VQQA 1UOCA 4B9VA 2MUTA 1V9PA 3UXNA 3Q8QB 3SNNA 3KHLA 1KVBA 5KT5A 4CF1A 4UBBA 1S9FA 3OS2A 4F4WA 2ATLA 3QO9A 2ITGA 3QINA 4P4OA 3AO3A 1KRPA 7ICQA 3C23A 4N47A 1BPZA 3NGIA 1JIHA 3RH4A 3DLHA 4OKEA 1QSLA 7ICMA 4KV8A 4YXMA 4CJWA 1L5UA 4NLGA 2PZSA 4RQ7A 3HVTA 2BQ3A 1BQNA 3CM6A 1S1UA 5KFJA 8ICYA 3RJFA 3DM2A 1ASVA 4CGGA 4M3UA 3L3UA 2FPMA 1X9SA 4NCAA 4M3ZA 3C2LA 4CJLA 2Z1GA 3KK1A 3AVKA 4IQUA 1RDDA 9ICBA 4CJEA 4I2JA 3C5FA 3V9UA 3F73A 3SUNA 2AJQA 3KJVA 1WSFA 4Z4EA 3OYJA 3V72A 4KLUA 1QLNA 2FLLA 1BPYA 2X6NA 3NH1A 3OYLA 5KRTA 4Q43A 3PNCA 5KFPA 1YTUA 1DGSA 3NFAA 5KFFA 1C1AA 2UVUA 4FCYA 3ZSWA 4FBUA 3AO1A 4YG2A 3C5GA 3SQ0A 2IBKA 4OGEA 4QWCA 3BDPA 1ZQTA 5KFBA 4GW6A 4ED8A 4CHQA 4PY5A 4M3TA 5IIIA 2Z1HA 4DTNA 4KFBA 4I27A 4W5QA 3HO1A 1ZQDA 4I2IA 5KFYA 4F5OA 3CFOA 4CJ3A 3T5JA 4I29A 2FLNA 3PX4A 1JLCA 3LAMA 3ZD8A 1KLNA 1BVSA 3RMAA 1U9LA 1J53A 4IKFA 4Z4IA 1S0OA 1DTTA 4CHPA 2BQUA 5BOLA 5HMLA 2GUIA 9ICPA 4BXOB 1XSLA 4E0DA 4AHSA 4M6WA 4J9RA 1J54A 2FBXA 4CJSA 4OLAA 2YKNA 2PY5A 4O3NA 5DKWA 2X78A 4XRHA 2FMPA 5J0XA 4LD0A 3NE6A 2A1RA 3MECA 3VQ4A 3T3FA 1TFRA 4AHVA 2MUTB 1S9GA 9ICFA 2W8LA 3ASMA 4CF9A 4Z6CA 4FJXA 3ZD9A 1SZPA 8ICGA 4KB1A 3G6YA 5KFMA 1KFDA 8ICJA 4ED3A 4DS4A 4QZIA 3SJJA 3H8SA 3LP3A 4DEZA 3PY8A 5KTQA 1A5XA 3UXOA 1RT6A 4YP3A 2YNIA 1JX4A 4ED0A 1BIUA 3V9ZA 3GIKA 2BPCA 1Z25A 1CXQA 9ICJA 4ZTJA 3AU2A 3G10A 3RRHA 4O3QA 3V7JA 1UT5A 2NRTA 3AA5X 4KLHA 4DG1A 4Z4HA 4O4GA 1VSJA 2AQ4A 1W9HA 2ASLA 5HRNA 5L1KA 7ICKA 4Q5VA 1IKVA 4QZAA 3SYZA 4DFMA 4IRDA 2AGOA 4R63A 4XIUA 4YQWA 1WSJA 8ICQA 1HNVA 1JLQA 3DLEA 3KIOA 4GXKA 5KT6A 5DG9A 4Z6DA 4NM2A 5IIKA 3V9XA 3G6VA 2PI5A 3VQ5A 5DQIA 8ICIA 5IIMA 2HB5A 3PW2A 1DOQA 3BQ1A 5KFOA 5KFWA 4YN4A 4YR0A 3RMDA 2G8HA 1A5WA 4OPKA 1HNIA 3AV9A 3TI0A 2WOMA 4KTZA 5IIOA 5CY4A 5DDMA 9ICAA 5DG8A 4M04A 4FK0A 2W9AA 3RRGA 1IG9A 3V1QA 1QE1A 5KG1A 1YTAA 4F5QA 2XO7A 3AVBA 1TVAA 4QWDA 1WSIA 1VSKA 2OA8A 4DSLA 3BGRA 4R8UA 3JPOA 3HW8A 1BQMA 3ETLA 3QEBZ 2JEIA 2WONA 1ZYQA 1VRTA 2OPSA 2W8KA 5J0OA 1L3UA 1WN7A 4DOAA 1C1BA 4M47A 4N56A 7ICUA 1ZBUA 2HNDA 2NRZA 2V4QA 4EBEA 4KHQA 1BIZA 1S76D 4IRCA 1RT2A 4B08A 2BDPA 1ZQHA 1L3VA 1IM4A 1B9DA 2XCAA 3V7KA 4PHEA 3ZT4A 5J2GA 3V6HA 4YR3A 1WAFA 4FJGA 2YHBA 4M6WB 3MR2A 4KRFA 5HHHA 4CK1A 4ED7A 2JLEA 3IRXA 1X9WA 8ICLA 2RKIA 1SL1A 4M9LA 4RUAA 3O3FA 5IINA 3QIPA 3OYEA 2YNHA 3TFRA 3V6DA 3ORYA 3ALYA 3SZ2A 1UAXA 1KLMA 3QEPA 4Y1CA 1LB2B 5DDYA 1SKSA 3K59A 3CFRA 1NK7A 3C94A 2C2EA 1EXQA 3MGIA 3OYGA 2HHVA 3PR4A 4FM0A 1ZBLA 2XC9A 2A1SA 2BCQA 3TARA 2XGQA 5CHGA 4YNQA 3C2KA 1S77D 1C1CA 1K6YA 3QLHA 4RZRA 8ICNA 2O4IA 4Z4CA 4Z4GA 2XY7A 3KHGA 2XY8A 4DLGA 4AHRA 4I2FA 1Q9YA 3RMBA 9ICIA 1NKCA 4ECWA 1RZTA 2F1IA 5KFGA 5CYMA 4NYFA 8ICHA 1L3TA 3ZSOA 3OYKA 1S0MA 1RYSA 2P1JA 3RJGA 3QESA 2ETJA 3V9WA 1KVAA 1REVA 4TUQA 4HYKA 5F9NA 4OGCA 3PW0A 1RYRA 3UQ2A 1U45A 2R8GA 3TAFA 4DU3A 3LP1A 3GFKB 2Y1IA 4UB4A 9ICOA 1SL0A 4Z0UA 4KHWA 4GXJA 4CJRA 2B21A 4CEEA 4K4HA 5DK5A 1MU2A 4O5KA 4JK1A 4GVMA 4JRPA 3QZ7A 4B9TA 3AU6A 4AH9A 1L3SA 1NK4A 3T5LA 4JV0A 4CF8A 2V9WA 2WTFA 7ICPA 1S1XA 2OPQA 4M2YA 3RJJA 4NYNA 3LZJA 4MQ3A 4ZH4A 4CEOA 2ZJAA 4QZGA 3H4BA 4YD1A 5T7BA 4CEFA 1KDHA 3C2MA 4CJPA 4KLMA 1XHZA 1WAJA 3T1AA 4J2AA 3GV5B 5KG0A 4C8LA 5CJ7A 4PGYA 4ELTA 8ICKA 4R8UB 4RQ4A 1RNHA 4M3RA 4E3SA 1CUKA 1ZQIA 2R8JA 1I3AA 2G8UA 3OYCA 4KLOA 4PHDA 4DL4A 1N5YA 2UVWA 4PWDA 5FDLA 3SPYA 8ICWA 3DRRA 5CZ2A 4OJRA 1XS9D 4M3XA 1BL3A 2KN7A 2DY4A 5EWEA 3B6PA 4J9SA 4DTPA 4KLGA 4NY8A 4KLDA 1ZQYA 3VQEA 4B9SA 1T05A 4QZHA 3T19A 4JWNA 3RB6A 5J0PA 3DMJA 4ED2A 3K58A 4OKKA 1WSEA 4RW7A 4YMNA 1NJWA 3ZT2A 4M9NA 1JLEA 1WLJA 3MR5A 2E4LA 3K57A 1FKOA 4QWBA 4RT2A 4JV1A 4HTUA 4FJNA 2HHXA 3C21A 3IS9A 4R5PA 3EZ5A 4AHCA 5KGWA 1QS4A 4CJTA 4K4GA 3LWMA 4DWIA 5KFXA 3O4NA 1C0MA 2KFNA 1KTQA 2R8HA 2VWKA 3S9HA 2VG7A 2FPKA 1TK0A 4I2PA 2IC3A 4RPZA 1ZBHA 3EY1A 5C25A 3HPOA 4DQSA 1HRHA 3ISBA 4F4XA 5CP2A 1JXEA 1JLAA 5J0RA 3QNNA 4RNMA 1WCNA 4M9GA 4FZYA 4UQGA 2HNZA 4CFAA 4BACA 4I2DA 2GBZA 3L2UA 3TAMA 2KW4A 4CJKA 4FK2A 4QZBA 2IDOA 1KVCA 4E1MA 3VQDA 8ICAA 2OPPA 3K5LA 1RTDA 4DSJA 9ICSA 5J2MA 2PFQA 2ISOA 3AVHA 4UB3A 1TKTA 3F9KA 2YNGA 4UAWA 4RQ8A 2HMIA 3HK2A 1T4GA 4UAYA 4O44A 3H8JA 4JS4A 1NKEA 2DFHA 4YFKA 3OJSA 1D8YA 2ZUCA 1ZQXA 1K1SA 2J6UA 4KI6A 1N56A 4BE2A 1Z3EB 1BHLA 3M9NB 3SQ2A 4IG3A 4RQ5A 4IFVA 4MFAA 1H38A 4RQ6A 4CEAA 4KI4A 4DFJA 1SV5A 1UA0A 1IH7A 8ICVA 7ICTA 4R65A 1EXNA 1ZQGA 1ZQVA 3GQCA 1KSPA 3JPQA 1RCHA 4KN4A 3S3NA 3M8QA 4EBDA 3PO5A 4RQ1A 5HRRA 4LZDA 4YXJA 4YCXA 1GOBA 1C6VA 4DLEA 4J9OA 3RB0A 2LSNA 3ZDDA 3K5OA 4KTQA 1XC9A 1G15A 5KT3A 1A5VA 3Q8KA 4ED1A 2UVVA 4BWMA 2XCPA 4UB2A 5C42A 9ICHA 4KN7A 4B9UA 3OS0A 5L9XA 1NK6A 1NJZA 2X6SA 4KLIA 3DRSA 3JYTA 4TURA 1A76A 3KLEA 1RBTA 4FLUA 4O5BA 4KLFA 3V6KA 1CXUA 2DPIA 1RBVA 1ZQFA 3PW5A 5HHIA 2G8IA 1HYSA 1FK9A 8ICTA 3KD1E 4RT3A 1T7PA 4J2DA 3MGHA 4E19A 4BWJA 4I28A 2IS3A 3RJKA 2D0AA 5HRSA 1Q9XA 4KREA 4FLVA 1JL1A 3ISCA 5BPCA 4FJKA 4FO6A 3AO4A 5J0QA 5J29A 1S6PA 3O3HA 8ICSA 4QWAA 4CCHA 4J9KA 5J0TA 5KFUA 1EX4A 3P83D 4LSNA 4HUGA 1U49A 2HVHA 4HHTA 4ECYA 9ICNA 1LWFA 4CF2A 1S5JA 3Q8MA 3NF6A 2P5OA 2IHMA 1QQCA 4UBCA 4JV2A 5DLFA 1JXLA 4FLWA 4QZCA 3LWLA 4CGHA 3H08A 4IR1A 3VQBA 3ISNC 2ZTCA 4FYDA 4JRQA 4FM1A 5J2AA 2HHUA 3PMLA 2VANA 2ZTDA 3L2VA 4IDKA 2G8KA 1XSPA 2FC0A 4FJMA 4N5SA 3L2QA 3MEEA 5DBAA 4KLEA 3DOLA 3TABA 2GWSA 2BPGA 4NLNA 4MF2A 4P4PA 4I2EA 4F8RA 3TAGA 4KPYA 4RG8A 1B92A 2JZBB 4M9JA 9ICMA 1COOA 2PFNA 4DS5A 3HM9A 3JPRA 3NHGA 3S3OA 4QZDA 3VA3A 3HPGA 4UAZA 4I2HA 5CWRA 3OYAA 5HNKA 1ZQJA 4EYIB 1IO2A 4FJ8A 2OWOA 4MEYA 3AUOA 3DLBA 2DTUA 5CR0A 2C2DA 3FDSA 2ZJ5A 2PI4A 4QOZB 4DQQA 3UXPA 3VA0A 3B0XA 4DQPA 7ICFA 1RDCA 2RDIA 4TQRA 5KG6A 3GIIA 2IAJA 2QXFA 4LH5A 4BGDA 2QK9A 1ZQEA 4CE9A 4K8XA 1JLGA 7ICVA 1T8EA 1LW0A 5KRSA 5J2CA 4EYHB 4CFBA 4AHTA 3U3GA 1Z00A 1BI4A 3OYDA 4FVMA 1DTQA 3RB3A 1VSDA 2JEJA 3OYNA 4TUPA 3ISDA 3LP0A 5I42A 1MQ2A 3SI8A 8ICCA 3KHHA 3THVA 4DSFA 3TFSA 4LVSA 5KFZA 2O4GA 1BPEA 4B9NA 4FLYA 3QEXA 3T5KA 1CLQA 5J2EA 4JLHA 5EU7A 4CJUA 5CZ1A 1BPBA 5J0SA 4ID1A
chains in the Genus database with same CATH superfamily
1L8OA 3UD3P 2V63A 2DGQA 1PBUA 3FUYA 2ZH3A 4K8ZA 3L8BA 2ASOA 4RCHA 4PJ0U 1W2BR 2JHDA 1DAXA 3VQPA 1A9NB 1SVDA 3H42A 5FPMA 1QVFM 4LBPA 3PLAA 2Z30B 4RW4B 4LUBA 1EP4A 4PGXA 4XPEA 4LSNB 2EHGA 2PO4A 2R7XA 3A12A 2DPJA 3OHRA 4DO9A 1HQ2A 3GILA 2ZIXB 5AQSA 3N9UC 3U4LA 1KFSA 1K8AT 4DPXA 5J2PA 3SDEB 4DR7F 4J9QA 4X64F 1B0VA 3D3CJ 1U0HA 4DZDA 2ACMA 4C8OA 3AFGA 4WIIA 3NTUA 1QY7A 1ZM3A 5AKXA 4OD0A 4KHMA 5LMUJ 3CCLS 4CZIA 1X4FA 1QUVA 1ZC6A 1EETA 3VN5A 2A6AA 2E8PA 4I69A 3JQMA 2UVRA 3O9TA 1RA7A 3J81j 1XO1A 4LREA 2KHVA 4ALZA 3AGRA 1N5SA 3N97B 3TOQA 8ICUA 4F3OA 1L7PA 4MIAA 2F63A 1SL2A 2GWKA 2D0PA 1VFJA 1TKDA 1U2VA 4CF3A 4RUCA 1QTMA 3PRVA 3THWB 9ICTA 1VQ9N 4PA1A 3LP2B 5I3PA 4P71A 3KLFA 1TK5A 2ASJA 4YS2A 3U7JA 2BRLA 3N01A 2YTCA 4A8KA 2X1GA 2HFUA 1JLBB 4O23A 3FNNA 8ATCB 3Q8LA 5T14A 5KAIU 3M1VA 1CPZA 4P2SA 2CPDA 4UT4A 1YI2S 3J80Y 1RGIA 3UDLA 3F2BA 1R8HA 3S6EA 2YX1A 4IQMA 4WFAQ 5D3GA 5K5MA 3DXKA 4O55A 5ALIA 1QM9A 3CVKA 3NKYA 2X1BA 4DU1A 3MCOA 4FJ9A 3D28A 3LP0B 2RU3A 5HR7A 2MKKA 1GLFO 4P0QA 1V9OA 3M8PB 2DRBA 1QAYA 2KM8B 1MW7A 1C0UA 1R3NA 3C3LA 4KMOB 1OYDA 2IOCA 2AJ4A 1HL6A 1CLFA 2BZ2A 4HCCA 5E41A 1WKJA 4YORA 4WK3A 1R6VA 1KW4A 4C8MA 3CJ7A 2CQ2A 5CYQB 3FZKA 1KHVA 4Q8EA 2KV2A 3RR8A 4ES2A 1WEYA 5C12A 2YY3A 4DV2F 4Q7AA 1VQPN 4C97A 1JKHA 1FEZA 4P0PB 1HPZB 3FBFA 1NDLA 5LMNF 1SQEA 5ALZA 2GV9A 4CK2A 2P6RA 3OL7A 4W5OA 2F9JA 5LL6d 2BJ9A 4Y0WA 2GVZA 4M9HA 2OI2A 5J2PB 4G9ZA 4QAGA 1ASWA 2PXIA 5AJ3K 4QQBA 4OJOA 1U0HB 5DB9A 2B6GA 4NEZA 3MHYA 5F8GA 4F93B 2GQQA 3KK3B 1CZBA 1W2BM 3CMES 2P9NA 3I28A 1L8LA 1HW8A 1UWBB 3H98A 3IGVA 2C2MB 1J2VA 3GZ7A 3TYTA 2QYGA 4DB3A 4NLYA 2BKEA 3CQXA 1EETB 1E6YA 2DH7A 4LRBA 3DLKA 3AOCA 4LF8J 3UNYA 4ZPWR 4NV0A 4PUOA 2HNYA 4LF4F 8ICZA 4DR4J 5FLXY 3D0HE 2KT3A 4MMOA 3TNVA 2KQ2A 4RBUA 3F9MA 1Z2LA 3OVBA 4W5TA 4F4KA 2ZWOA 3O3GA 3Q8PB 3T1YF 1DARA 1U2VB 2XRIA 4DV1J 4ICLA 1VQNS 2HKEA 1WUDA 1ZM4A 3BS7A 3HZEA 2XI2A 4IQXA 3KLFB 3V5RA 1YQHA 4DN0A 1SIJA 4CJ5A 3H3NO 4U8YA 2AF6A 3E8OA 1LV5A 2E2NA 5GAGP 4NWIA 3CIPA 3NF9A 3KD5E 2CQ3A 4JI6J 1VK8A 1F2GA 3SQ1A 3F41A 1HLWA 2BJEA 4M0AA 3CCLN 1GLLO 5JS1A 2QLTA 4L74A 4JI2K 1S1TB 3TUJC 3HSCA 2CWKA 4CERA 1H72C 4FL9A 1CJVA 2UXBJ 2HHTA 5J1EA 2VG6A 4FKYA 3HF5A 5FD1A 4FPRA 5IV3A 4B17A 1RT4A 1T3OA 4ZTFA 1RADB 2H3EB 1IBKJ 2WHOA 2E5LK 2ERRA 1LOUA 3S1TA 4FPBA 4P0QB 5ETVA 4IEEA 1NBEB 1J5OA 5BR9A 1YJ9S 2F40A 1GTEA 3W9IA 3SQOP 2CQ1A 1BA1A 4CGDA 1HNXF 1PYOB 5F8IA 4BC7A 5C2CA 3QUBA 5A76A 2IPOB 2E9TA 3VESA 2VA2A 2D9OA 3NBPA 3PTWA 3R7NB 3C65A 1VSMA 3IBCB 4E1NA 1A6LA 4J37A 4F7VA 2VB6A 2PIIA 5JVHL 5DS7A 2PEHA 4JWMA 4AHUA 4CEBA 3WKAA 4CZKA 2JVRA 3C1ZA 3PSTA 1V97A 1YI2N 8ICXA 2ILZA 5AK6A 1WCLA 3PYEA 4KGMA 2VC1A 3QSYB 3BQ0A 2MEWA 3PJWA 4I2CA 3C7NA 4JKHA 4JNEA 5DQGA 2P9UA 2P9NB 3V7LA 2PAVA 2ZUBA 3KWGA 3MDAA 2KVQE 1XC3A 2VPZB 4FN5A 2E8AA 2ZZMA 3KLHA 1VQ4S 1E6YB 2E1RA 3RAXA 3RAMA 2JEGA 2UV8A 1OPIA 1IKXA 5AXKA 3DLKB 2QLWA 4K59A 1K0TA 4LSZB 3I0SA 8ICOA 5K8OA 4KH6A 1X4BA 4PUOB 2HNYB 1WF1A 3AQPA 1Z19A 2B9WA 3QERA 3L7UA 2C3OA 3QJLA 2DK2A 3EPGA 4R79A 5LSRA 1WC4A 1EHWA 3FEZA 3KLVA 3IR5B 1J97A 5ADXH 1DQ9A 1VK0A 5DMRA 2BZFA 2LYHA 5K8PA 4RPYA 4RQ0A 1VGYA 1ZBSA 4Z6FA 4KLJA 5FROA 2H3IA 4DV6F 1EKEA 2IVMA 4DV5F 2OTLS 4NA3A 2YX7A 4AT1B 5F0WA 5KI6A 3CMEN 3IM1A 2N3OA 2F5GA 5DGAA 2ZFHA 5LSOA 3ZNJ1 4LR8A 4BCAA 3GCWP 5HVFA 7ICIA 2F77X 3IAYA 2HG4A 3W65A 4US9A 3DJCA 3TJ8A 2DD8S 1EQYA 4U67L 4GC6A 2MQPA 1RHQB 4OYIA 1CJVB 4JI3J 2PFPA 5J1EB 1NU4A 2VG6B 1HX1A 4CECA 3Q0AA 4RNNA 3WKCA 3LDAA 2IM2A 3LGHA 3MN9A 2FC9A 4QOTA 3T6JA 2RHQB 4C3MA 1J5OB 3B82A 3GG1A 2Y8WA 2WUSA 3PJXA 5AI5A 1RWMB 3P5JA 3OTOK 3ITHB 3A5NC 5J2KA 1URJA 2I7NA 4DFKA 1VQNN 5CR4A 4FLTA 3NBPB 4NCGA 2UUCJ 4NASA 4HKQA 3MX2A 2V2QA 3OHAA 3JTPA 4P2HA 4K50A 1T9YA 3L7PA 5K8NA 5JUMA 4JP8A 4C0OC 2ATQA 3MFHA 2CDQA 2KVIA 2R7TA 3WK9A 3PKYA 5E0OA 3SSQA 1KL9A 4DU8A 2YWEA 5KFRA 5KG4A 4M5JA 4HHUA 4B3SF 4U7BA 3CIMA 4H0VB 3VAMA 3C7NB 5HJYA 2A19A 2Q0ZX 3B6OA 1BQNB 2XMTA 3LDSA 5AKLA 2NLXA 3CCRN 2BANA 5JS2A 3ETRA 3CJCA 2F3JA 3PO4A 4DR2K 3M9OB 3H40A 2RNEA 5CB1A 1YJ9N 4I2AA 3KLHB 2CGLA 1RTJA 3EPIA 1ILYA 2CG4A 4PYAA 1BCOA 5GIOA 1SKUB 1DJ0A 1NK9A 4IOBA 1T03A 3NVMA 3VQCA 1A0PA 1A0OB 3I0SB 2AIRB 1PAUB 3MF5A 4FYWB 4DTOA 2F1JA 3RBEA 4OI1A 2DGVA 2H65B 3J81U 2CGJA 1BQXA 1RQNA 3BS9A 3AVLA 3D7EO 3MC1A 3DC2A 2LVWA 4EK2A 3JTOA 5EE9A 3P49B 4KHPF 3ZDAA 5IQQA 3UMGA 2HMXA 4OJ5A 1FKPA 7ICSA 3O5TB 1N5TA 3TWHA 3K89A 3RB4A 3AVGA 3EYZA 1RLDA 4G3IA 1YIJS 4MK7A 4CT9A 5KFTA 3DYAA 8ICPA 2H5XA 2FE9A 3M8SA 1NB2A 2P9GA 1BWEA 2DFLA 2YQEA 1VQ4N 2CNOB 4NLSA 1CG2A 4BC9A 3RJIA 2DCLA 2ZIVA 2G09A 3TP2A 4DL2A 2J7WA 1WSVA 3VMFB 1QAJA 2C22A 2Y0BB 4FKXA 5CZXA 5FPNA 4X65F 3MXJA 5CH7B 4OLBA 1MROA 3QU5A 1JXBA 4LF5F 2FDRA 2AYMA 5J2JA 2UUBF 5KFVA 4NCGB 5C24A 4OV6A 3WXKA 2BACA 3EW9A 4NZ7A 2OTLN 4C4TA 4ILRA 3FR0A 1G6BA 2MJUA 2EK1A 3LAKA 1ZQOA 2E88A 1W7WA 1XEZA 2L08A 4U95A 3CDBA 3L3CA 3K1RB 3RRKA 4OYPA 3JPSA 2ZH9A 4K25A 2E8MA 2KT2A 2PYLA 5E3AA 5EX3A 3CTRA 3PVXA 4NX9A 2BANB 2M52A 1QSSA 3THXA 2NRXA 4C4WA 3B0YA 3D2SA 4ISGA 3PR5B 1IUJA 3OHBA 1RTJB 3VOVA 4I6YA 4A5BA 4EP5A 1ZQPA 4OPAA 3M8RA 2FF6A 3DRXA 1T03B 3OYFA 1WI6A 1K73T 2IA6A 3HHDA 5IT4A 2H5EA 1R27B 2K4IA 2CQDA 3SCXA 2ZGZA 1I5OB 3KG4A 3HT0A 3L4QA 3ALRA 3IP4B 1RQLA 4O8UA 1QQ6A 5DGBA 1KCFA 3JSRA 1Y5LB 2ATCB 2YX6A 4DKWA 7ICOA 1V4TA 2KVCA 1RT3A 3D45A 4B9LA 1MMDA 4J2EA 1FDBA 3MMBA 3WKBA 1SKRA 1W25A 1BO5O 1NJIT 2WOMB 2XS2A 3F5EA 1QQMA 2A6OA 3O44A 4CJ4A 1NHUA 4K0KJ 4F50A 3HILA 2OTJS 3VTHA 2O1PA 1HWIA 2XYGB 1RISA 3BF4A 1RAAB 1TUGB 4UTGA 5LMUK 3KHRA 3H25A 1B0TA 1WC6A 2JJ4D 4PHAA 2MKCA 5GAHI 3DYAB 1XQSC 3I76A 2R7QA 7FD1A 1M5OC 3I9ZA 4PCQA 3KK7A 1WG1A 4IQVA 3F2CA 1JLFA 1XMBA 5H1SQ 2DJWA 2HNDB 1C0TA 1ZQWA 2ZIVB 1VSLA 3FYHA 2BABA 5K20B 4DX6A 4X4OA 4FS1A 4E8UA 3I82A 4U9RA 4UB5A 1S1WA 3NF8A 3C6HA 4CZMA 5B0GA 4HCBA 3V4MA 5CABA 4JBCA 2NLWA 1N34F 2YHWA 1N32J 4C48A 3TKAA 4JI8J 3UMCA 4FNHA 1RE1B 2IHR1 2ITMA 2P9PA 1VC5A 3G0ZA 1IWAA 2J8AA 3AAWB 3MPYA 5C24B 3SUPA 2EH9A 3ZSYA 3DXBA 3HPHA 3R97A 1YIJN 4GXIA 2AU0A 4B8CA 3H1VX 1JWWA 3SUQA 2HF4A 4OJ6A 3R5DA 4C8ZA 3NGYA 3E1YA 1H2VZ 4N7TA 3VEXA 1WJ9A 3ZSZA 3CCJS 3CG7A 3U3YA 1VQ8S 2NRRA 1GLAG 4QW8A 3T7ZA 4H4MA 3THXB 1MN9A 2V69A 2R8KA 4N41A 1CEZA 2E5SA 2D41A 4U7UK 2WSCC 1UFLA 4WK1A 3GDXA 5ETSA 3VPZA 3BQ2A 2DH8A 1KWMA 4TSXA 2BCUA 1S99A 3A5MC 3OSNA 1IXKA 1TGOA 2J6TA 1VQ5N 1KC8T 1FRKA 3U1NA 1REVB 3DV9A 4DL7A 2RHFA 2C3YA 1ZQZA 4BXOA 1IBLJ 4NL5A 4ECSA 3MABA 4CIOA 3R7SB 1VBXA 1CJKA 4E98A 3CSKA 4BRDA 3UN5A 1RT3B 2J0WA 1G99A 2MUTA 2CPIA 3UDEA 2CPFA 4CF1A 3OS2A 4PPDA 2ATLA 4JKEA 1R8CA 3QINA 4P4OA 5KAKA 3MMBB 1LEOA 3HJEA 4L73A 2HSZA 4WIQA 4FVUA 4N47A 4PKDB 4B6JA 4BQZA 3RH4A 3BYRA 4OKEA 1N33J 4CO5A 3HBTA 2DNNA 2D3ZA 5GADU 4ZVTB 3W8GA 3HVTA 1WKKA 1S1UA 2CG8A 5J1PA 4BRFA 5KFJA 3ILJA 3IMQJ 2MSSA 4M3ZA 2FPMA 2LKZA 3C2LA 4TLQA 1Q8LA 4CJLA 2Z1GA 3KK1A 4LF8K 2HGMA 4IQUA 4EO6A 1C0TB 2B4UA 3BR9A 1WG4A 4DV3F 4DR4K 3F73A 3OL8A 4B9QA 3M6ZA 2P35A 1AZSA 1XNRF 5F8MA 4HDHA 4C98A 3V72A 4JI4F 1FEHA 3DDKA 4ACOA 1BPYA 1U2RA 2RRBA 3F0NA 3ISZA 4CI0B 1HR0K 3ZETB 3HFKA 3EO3A 5KNIA 2V50A 1T3VA 3L6QA 2RE2A 1NUEA 4Q43A 1VBKA 2DY1A 5IC6B 2P9PB 3NFAA 4DHYA 4BS2A 2UVUA 4FCYA 2OTJN 3BSAA 4R5PB 2YKAA 1YRTA 3SQ0A 3QFPA 4JI6K 3NY0A 4OGEA 3VGMA 3SCLE 4DMZA 4QWCA 5GAEP 1ZQTA 2PFDA 5TKYA 4GIBA 4PY5A 2H51B 4M5NA 4EWTA 2UXBK 2IC3B 2I0XA 4HEA9 4IJNA 1IBKK 4CQ1A 4F5OA 5JVGQ 3CFOA 4FSVA 4CJ3A 3RFAA 4CRXA 3Q7BA 4JKGB 4FXWA 2R2UA 2K06A 1PG5B 1L7NA 2HBZB 3LTOA 3N0VA 3Q89A 4DUYJ 3M6KA 4M1KA 4C7ZA 3U27A 1Q81O 5FLXO 1SJRA 2MTLA 4CHPA 2BQUA 5BOLA 1X4AA 3TADC 5EHHA 4BXOB 1M1KO 5FP0A 5KL1B 5HVGA 4J9RA 5HI7A 3EE9A 2YKNA 2I7PA 5J0XA 2M9KA 3VAHA 2OEKA 2UYTA 2UUAJ 1UZHA 4XH4A 3HCXA 1VHFA 2MUTB 5LJ3Y 4HTJA 1HWUA 9ICFA 4M5MA 4Z6CA 2OANA 1KQQA 4DV4J 4A8QA 3G6YA 2QL7B 3CCJN 2JGAA 4ED3A 1VQ8N 1RM6C 1VBYA 4F0MA 4OI2A 1TMMA 4A61A 1WWVA 4PKHA 3QU4A 3MM7A 2APOA 4DEZA 4L75A 3SBMA 2V68A 3UXOA 5C0YA 5IM0A 4AYBC 3CJKA 3HVTB 1JX4A 2DGOA 1BIUA 4LFAF 1S1UB 3V9ZA 3WEEA 2BPCA 2JRSA 3R1HA 2FVPA 4CZGA 3KK1B 4Y3CA 4JV5F 4QBUA 3DEEA 3RF9A 5A8KA 4QIVA 4O4GA 1VSJA 1KD1O 5KOWA 3AJ2A 2ASLA 4TU9A 3HI9A 5DM7L 4UAVA 3D1QA 4XDDA 4IH7A 3ZEUA 3K17A 3LQVA 4IRDA 2HZAA 4XIUA 3FSXA 2VBYA 1EX8A 8ICQA 1HNVA 4DJBA 2E8OA 2BJ3A 5KT6A 3LDOA 3N6MA 4CT8A 2JC0A 3G6VA 1ZH5A 4NA1A 2O8EA 5IIMA 5IFMA 5KFWA 4YN4A 4YR0A 3VF0B 4GY2B 3TI0A 5IIOA 5CY4A 9ICAA 4WP8A 2VONA 5GADI 5DG8A 4EU0A 3CCVS 3ZX2A 2V2VA 3V1QA 1QE1A 2GIFA 5G0RA 2B8QA 1YTAA 2E66A 4F5QA 2LPEA 1VSKA 4B3TJ 1BD6A 4OO1J 1MWMA 4CTAA 2WBRA 2OA8A 3BGRA 4R8UA 3HW8A 4ZVFA 4B1VA 2NRHA 5H2FU 2D6FC 4OYMA 3QEBZ 1DHMA 2DF4B 1WI8A 1C1BA 4Y2JA 5KQ8A 3GJSB 2O8FA 1G3OA 5A6WA 2V4QA 5ALEA 1BIZA 4Y2RA 2BOPA 1GK8A 1RT2A 4OZJA 2OUGA 3FRZA 5LXRA 1IM4A 2J9EA 3ZT4A 3K0JA 2M5YA 2UUCK 4FWMA 3VGUA 2GUPA 4M7XA 1NZPA 5CRXA 1FNOA 3QIDA 1WAFA 5G5HA 5K4LA 1TU0B 1OH6A 2YKNB 2ES6A 4KRFA 3DOLB 1NMDA 4ED7A 4J9VA 1X9WA 2YXLA 8ICLA 1IJFB 4OHWA 4X64J 1RQ0A 4URQU 4ZOHC 3UB5A 4M9LA 2LQBA 3O3FA 2LQJA 2MZRA 3QIPA 3OYEA 3J8AA 4Y2XA 2HZVA 1Q8BA 3FMWA 4ED5A 4Y1CA 1SKSA 2W25A 3IAM9 2HCFA 2OEMA 3C94A 3R1XA 3MGIA 4USVA 3OYGA 4XEIA 2LI6A 4FDFA 1ZBLA 2A1SA 2YWKA 3TARA 5CHGA 1WEXA 2O5DA 2W40A 3C2KA 1C1CA 4BC2A 5IM0B 8ICNA 3CE8A 5AZJB 2O4IA 3CJKB 2A3VA 2XY7A 4OYWA 3KHGA 4H0YB 3ELHA 1YHQS 2HRYA 3OTEA 4JI7F 3WEEB 1F0XA 3RMBA 3HZ6A 1NKCA 3A1YG 3E9LA 1FWPA 2IFXA 4ANCA 2FJDB 4PWWA 5K8MA 1CS4A 1EKSA 5A8KB 1C0GA 1M90T 1F6TA 5LXYA 4GO5X 3ZTOA 1S4FA 2GGPA 2QLXA 2KJ8A 4JI2F 4AD6A 3DHXA 3F5TA 1LW0B 3PW0A 1RYRA 1HNVB 3G6ES 3TAFA 3GU3A 1RCXB 4DU3A 3CDUA 3IR6B 2LP4A 3QJJA 2Y1IA 4UB4A 3DU5A 3HLUA 3B4DA 4GXJA 4CJRA 5AT1B 1WWUA 4K4HA 1MU2A 4O5KA 4JK1A 4NLTA 4GVMA 4B9TA 2JVOA 2O8EB 4Y2CA 3KDOA 4AH9A 4K41A 3T5LA 4NZ0A 2OPQA 4NYNA 3LZJA 2P9SB 2H5IB 5LOQA 4CEOA 4CZJA 2NSBA 3R8EA 3QAUA 4B02A 2QSWA 4QZGA 4ZLPA 3MXHP 2P8IA 3US5A 3W60A 1KDHA 1KN6A 5G0RB 4KLMA 3WIVA 4YY3F 2O8CB 3WQPA 4NOHA 3OT9A 1T3QA 3BGRB 2Y9HA 4R8UB 1S7HA 1JK9B 5HSPA 4IEIA 2QIFA 1KQGB 2IOFA 2KI2A 2W7PA 4UQTA 4I1TA 2G8UA 5L38A 4PHDA 3NRWA 4PWDA 1C1BB 2O8DA 3RGIA 3M6GA 1RWXB 8ICWA 3FCHA 2O8FB 1NGGA 1XS9D 2DY4A 2KN7A 1FRMA 3B6PA 1J2NA 4DTPA 1E6VA 4ZVEA 4DV2J 3FVYA 3MI7X 4B9SA 3VQEA 1URNA 4HR2A 4QZHA 3T19A 1HBMA 3N6NA 1HNWF 3AEVA 4QPTA 5LMNJ 2QV6A 3CB4A 3ZZOA 3CCZA 2HBLA 4ED2A 2HWHA 2I8EA 4ZOSA 4AYBF 2V52B 3FFIB 3ZT2A 4GO7X 2EFNA 1PIEA 5E84A 3SLCA 3SQIA 4X4QA 1KKXA 2FZCB 3EXCX 5IT9Y 2E4LA 1FKOA 4QWBA 1YAGA 3TRGA 2RHSB 3CNHA 2AP6A 2KYXA 1T9UA 4AHCA 4M7YA 1NPPA 2B0CA 3R2CJ 1C0MA 2KFNA 2R9LA 3I31A 1IV8A 2VIHA 2VWKA 3K9KA 3S9HA 1YTYA 2WBMA 2BYCA 2VFUA 3W2WA 4F02A 3H46O 1TK0A 4KB7A 4I2PA 1C1CB 3BR8A 2K1RA 3QBCA 2WF9A 1HARA 2RIJA 4LF4J 1HRHA 4KGVB 3ISBA 4EHUA 5CP2A 1JXEA 5KPRA 3WX8A 2XICA 1RI7A 1CS4B 4O0NA 1WCNA 3PSIA 4P74A 4KO0B 5CE3A 2UU9F 1LWEB 2XMWA 2KW4A 2RQ4A 5ALOA 2VFTA 5D4NA 1O08A 2GGPB 3WK4A 3ZZRA 4OZ3A 2ZH5A 1RTDA 2KHCA 3K5LA 4QIWD 4HWIA 2K3IA 2PFQA 2ISOA 4UB3A 3F9KA 4UAWA 2UZAA 2HMIA 2KIWA 5ALVA 4O44A 1MU2B 4JS4A 3P31A 4K0KK 1A7GE 3OJSA 1X42A 4HHHA 1D8YA 2ZUCA 1ZQXA 1K1SA 4G65A 2DTJA 4K4WA 2OPQB 4DR5F 4QIEA 2UV8G 4FF2A 1C20A 1VQ6S 2JH7A 2JLGA 1S72N 4HI2A 2E7VA 3PSPA 5EOYA 4RQ6A 1YHQN 1X4GA 1IWGA 1UA0A 8ICVA 3LO3A 1EXNA 1DK3A 3SQGA 3UCUP 2DH9A 1HNXJ 1X4HA 2XSJA 3M8QA 2QWNA 1FT8A 5DZ6A 2O8DB 5IT9U 4EBDA 3TA2A 2K8CB 5HRRA 3OTBA 1GXTA 5DETA 4DLEA 3ISND 2CZVC 1GO3F 1E6VB 1N32K 1OSCA 4JI8K 2VQEF 1Y00A 5AHXA 3Q8KA 2B7CB 2GS8A 4DR2F 1G1XA 2XCPA 2VIXA 3NMAA 6AT1B 2E44A 5B66U 4PAAA 3DGVA 1NJZA 3IWXA 5AQPA 2I2YA 3U9ZA 2DKOB 2DPIA 5ETOA 2YPYA 4CRJA 1NI3A 2VHGA 3VEOA 1FK9A 3TTCA 8ICTA 3BM7A 2JWKA 4E19A 1TE2A 2IIRA 2LA4A 3CJ2A 3RJKA 1FI4A 4RNFA 1Q9XA 3E9PA 3W2WB 1JL1A 3C15B 1SWVA 4AYBD 5JMNA 2Q6CA 5BPCA 4F0HA 3M2RB 4TN2A 2GO8A 4I2PB 1S6PA 2FDNA 2K1RB 1XMQF 4DCJB 3P83D 1HEKA 1X6IA 3AB2B 4AP9A 1S6OA 1EAYC 2F1FA 1TELA 4ECYA 4WPAA 3Q8MA 3D1HA 1TP7A 2DR8A 1NLVA 3NF6A 2P5OA 1I94F 2A1AA 2IHMA 5BR8F 2AZ3A 1JXLA 4F3MA 3WC2A 4UY8T 4QZCA 5JU5A 3L7OA 1HLUA 2QTDA 3VQBA 2ZTCA 5I4MA 4QR0A 5M2PA 3ZNUA 1YUWA 3MWBA 1DGKN 5J2AA 4FM1A 2KO1A 2HHUA 4DV6J 3PMLA 3GMGA 1CJUB 4DV5J 2CQHA 1LWCB 2MQOA 3L2QA 5DBAA 1U6BA 3B9JA 4JYAF 2HMIB 2BM0A 3QX7A 3D66A 4H5WA 4NLNA 5ALHA 3PKMA 4MF2A 4F8RA 1HHTP 2FJWA 3TAGA 1N33K 1M5KC 3MCPA 9ICMA 4DS5A 3JPRA 1ZRNA 4Y34A 3VA3A 5IOLA 1GFWB 5AE3A 5CWRA 5AXNA 3FGVA 2PKEA 3TADA 2MY7A 1JJ2R 1ZQJA 2M2BA 4P75A 3C19A 2NPIA 2ZUAA 3DLBA 3AXMA 5CR0A 4BBYA 3FDSA 4OYZA 1U8SA 4CP5A 2ZJ5A 3I1YA 2PI4A 1P6TA 3BB5A 2CH5A 1NZAA 5L1MA 3VA0A 3M8QB 4ZPBA 2RDIA 3A8YA 4IUFA 2DB1A 4H4KC 2IAJA 1NZBA 3IBWA 1VBZA 1T95A 2VJ4A 4OQJA 3NUQA 2R7SA 3SMPA 5BRFA 2BE2B 2FVCA 4EYHB 3AB4B 4CFBA 1FIQA 4TYAA 4B3SJ 1R8PA 3RB3A 3OYNA 4TUPA 4DPWA 2KJ9A 5F0UA 5I42A 1MQ2A 4HACA 3BO4A 3QRRA 3JXUA 3DLLL 3TFSA 4LVSA 1VQ6N 3CD0A 2MU2A 1RTHB 4FLYA 2QWOA 1RCOB 3NLCA 2MKIA 4CJUA 3PIPL 2N7YA 5DZ7A 1UTAA 1ZQBA 1NGAA 3KK2B 2GELA 5KFHA 3OW2R 5AQMA 1SKWA 4LSLA 3WNHA 1FNMA 4IQTA 4FJLA 4M5DB 4A8OA 4I2QB 4E7IA 2ZWHA 1JCGA 2R4FA 4DUYK 1S6PB 1ZOLA 3ZFVA 5ALYA 1Q0NA 4UB1A 5AXMA 1NDKA 1S6UA 2CJ9A 4FZNA 2MXYA 4CIGA 4QZ8A 2WMMA 1ZBFA 4CLLA 1RABB 3D5MA 3MM6A 3D54A 4C8NA 5U47A 1D9AA 2EFQA 1NMNA 1ZPWX 2DXFA 1MWYA 2CADA 4KHPJ 4X84A 3HSZA 2UUAK 3FEXB 4WQ5C 4K4XA 4J9NA 1FKAF 3H8MA 2N7CA 3WXLA 4CH0S 3HFZB 3RW6A 4DV4K 4ZITA 5LM7E 2OFGX 2GTDA 1X2IA 3EJMA 5D78A 2HVEA 3THYA 5MLCV 4O5CA 4WF9L 4RW6B 1J9AA 4KH1B 3QNMA 1R0CB 4RPXA 2OFHX 1X9MA 2KHQA 4Z7YA 5BRHA 4OJLA 1RUSA 1HBUB 4EZ6A 2W9BB 5F8HA 1HMVB 4FBTA 2YHAA 3VEZA 4ID5B 3KZBA 2HVIA 2E9RX 4JOUA 2NYHA 4X65J 4CHYA 1WHYA 1JCFA 4KKOA 1U25A 5KG5A 9ICVA 2FLPA 2JEFA 4DUTA 1WELA 2RUGA 4LF5J 1KN5A 4DTMA 1S6QB 4OHYA 1ZQRA 5EWGA 3CQ8A 3HJFA 2IAJB 3B8HA 1WSHA 3IWNC 4KLLA 1TKXA 4OPJA 1F1BB 4A46A 4PZNA 4FPIA 1JJ2M 2W01A 3CYMA 4BQLA 2BCSA 5DLGA 4C1NK 5I42B 1IQTA 2X3DA 4HACB 4KX5A 1RWNB 1GXUA 1FW6A 2QRRA 2PA3A 1RT1A 2HHPA 1XTZA 1HIWA 2XYHB 4HUEA 1FA0A 3CJ4A 2KK0A 3S3MA 4B3TK 3RW7A 3RJHA 1RBUA 4YOTA 3HXMA 3F44A 2JGUA 4K5SA 4BDZA 3HYFA 2B3TB 4NB4A 1KOHA 2AH5A 4LSLB 1IN0A 3U6FA 1VDHA 3ZZYA 1T02A 5A8RA 3P4UB 3ZCMA 2PA8D 4IOAL 3CT9A 1PUZA 3RSEA 3V9SA 1ZA1B 1JQGA 5SUHA 1KVJA 3B78A 1UEUA 2CQBA 3I4HX 1P27B 3EM1A 2G0AA 3G71S 2ZDPA 3TWZA 3UFCX 1XU4A 1RDAA 4RNHA 4DPYA 4RU9A 1W97L 3VF6A 4CHOA 2HQ3A 1N0VC 2KJWA 1AFIA 3Q8RB 1N62A 4X64K 3OW2M 2F9DA 1VYAA 3V2UC 4J9LA 2P2CB 5AQTA 3P8BB 5E5NA 4QW9A 4NM1A 3IUCA 2MJNA 2KHOA 3CPWR 3EXYA 2KG5A 4FW1A 4DL3A 2E1EA 3THYB 3SR6A 3LDNA 1U1RA 1J6ZA 1TL1B 4BR0A 4WU3A 3ULDA 3AOBA 3VEYA 4DV1F 1B0XA 1OH8A 4DFPA 1M5HA 1UAWA 4DF4A 2VFRA 1ZA2B 1C0FA 5TZVA 1B70B 1VC6A 3SAHA 1F21A 9ATCB 2Q31A 3SAGA 2IVNA 4I6WA 1UHUA 3C6AA 4H0XB 3ZDBA 1TUVA 3LDQA 1YITS 1H2TZ 3KNGA 2DFFA 1KBRA 8ICBA 2NUHA 3G86A 4PKGA 5KFNA 1PGZA 3VAKA 3TZYA 3NS5A 2VODA 3N4QA 3JPTA 3AVNA 4XQ8A 4ZVHA 4CEQA 2QWMA 5CHIA 4F4YA 3AMZA 4OVLA 3L4PA 5HROA 4F2RA 3M2VB 3PX6A 3KKAA 1AROP 1WF2A 2D3DA 1T6CA 2U1AA 1U6FA 3VV2B 1NNDA 3CCSS 5KFLA 5KPTA 4GLXA 1F5SA 2JLFA 1T94A 4P4MA 1TKXB 2V94A 2H3VA 2FHJA 4J9PA 1FWKA 2VPWB 2HHHF 3HX0A 4ES3A 3NVVA 4LR7A 1IQZA 3AVJA 3CJ9A 3RJMB 3HKZD 3WQTA 2QWPA 4EMDA 3QEVA 3R1LA 1VRQC 2B51A 3LGNA 4FLXA 1X5OA 3OQ2A 1TUYA 3ATVA 1ZZNA 1RT1B 2Q1LA 3D68A 4CLSA 4ICAA 4LC9B 4UATA 5EUHA 2HBMA 4ZCKA 2ZF5O 1VOMA 1ZQ1C 4EEKA 4PR6A 1Z1ZA 1U47A 3HTVA 3CO9A 3NH0A 4QCLA 1O03A 3OXGA 1SXEA 5A8RB 1IR0A 2XGPA 3KKSA 4C11A 1PC5A 2RU9A 3SEIA 3EX7B 1KC8O 2E2QA 2N1RA 1JCEA 4F2SA 4DV2K 5HBMB 3D1OA 3E66A 4CJ7A 3CWJA 4DSKA 3H7HB 1VQLS 5LMNK 5ALLA 1VMBA 3SXLA 2QFJA 1X40A 3BQ7A 3CFPA 1LNQA 2YMPA 5DB7A 1LQ9A 1QHTA 5H9FJ 1RWPB 4FPAA 2FF3B 4Y2UA 1Q53A 3NCPA 2P6SA 2E1PA 1D09B 3CCWA 4IG0A 9ICCA 3IM9A 4ITSA 1PK1B 1CQMA 4PKIA 2XO6A 4EENA 1CJTB 4YD2A 3V1RA 3F5AA 2HIQA 4X4TA 4OKJA 2RMLA 4RWXA 1G2EA 3MDCA 4NLBA 4DV3J 2WTUA 5CD4H 4LF4K 3CF5L 5B0AA 4ECTA 4DX7A 2FZKB 3MWTA 2HI0A 3KTQA 4J9UE 1HQUA 3I55S 1XNRJ 4UOHA 3TZXA 2CKWA 4JI4J 4KAZA 4CZCA 2CVIA 2HRTA 5HO4A 4IWVA 1RHKB 2PMZC 4BJQA 3C6UA 2DIVA 3ONQA 1SV0C 1IKWA 2CXEA 2AT1B 3CPWM 1KFTA 3J7ZT 4KBOA 2QYCA 2PE8A 3EGWB 4E2FB 2ZQBA 1T9XA 4CLPA 4L3QA 4JI3F 3HOTA 2Z57B 3ZTPA 2VC0A 2P9LA 3PFOA 2GMJA 4E89A 2RS2A 2KFYA 1WWHA 2RVJA 4CW7B 4CO0A 3JB9k 2OZMA 1R31A 2I6XA 2RUSA 1HBNB 3M5RA 2W11A 1ZM9A 1ZD4A 2MKSA 1TVRB 1TMJA 1IM6A 2VFSA 2VJ5A 4FJ7A 3ZTQA 4C4RA 9ICEA 4PPXA 2ZBCA 4C8KA 1YRXA 3JAMY 1Q8IA 4BRKA 4O3SA 4GVLA 4CLZA 4F3TA 3ENAA 1PZNA 4OI3A 4DSIA 2DHSA 2EKNA 2NRVA 4CD3A 2VCPA 5HLFA 5L1IA 3CJ1A 3ZDEA 5KG2A 1YITN 3NNHA 1HNXK 1B3TA 3OY9A 2XNQA 1ZXOA 3P96A 4WJ3B 3AD8C 4B1XB 1D9FA 2D5RA 1JL2A 5CHCB 4F5NA 4KLQA 3NGTA 3MN6A 3NGSA 2EC2A 2KD1A 2CJBA 1B7YB 4C11B 2G1HA 5BOMA 2R8IA 4Q2LA 4HL9A 3ETMA 4DL6A 3ZI4A 1NK8A 3NH2A 4FW2A 4QZEA 2W9MA 4PQUA 1ZQUA 3AAQA 3M9MB 2A41A 2EFOA 1GMVA 3NGZA 2J4RA 4FWLA 3VVTA 3MOZA 4KV8B 1T3NA 3DWLA 4KT0C 4QZFA 4RO0A 2HDOA 1NM2A 4CHZA 5EX5A 1XI1A 2OSRA 5C7PA 2EFVA 5A2QY 3OS1A 4Z4FA 1SUQA 4AM6A 2KXNB 2YMLA 4XA5A 4R0JA 1AXQA 3O8WA 2W43A 4IG0B 5ETPA 2W4CA 4BRLA 4DOCA 1Y4ZB 4LFAJ 4TQSA 1RLCL 4G1QA 3QU7A 4X4NA 4BGBA 5KFSA 4Y1DA 1RHUB 2DRAA 2E1YA 2OXOA 4DXLA 2DRDA 1S0NA 2W6KA 4CZLA 4JV5J 5DBBA 2R42A 3FM9A 4MN4C 3QEAZ 1HQUB 3AA4A 3TTFA 1P9QC 3GYXB 4LQ3A 3MWPA 4RW8A 2X7IA 4IH5A 2VV5A 3BQTA 1QD1A 4ZPAA 1VQLN 3F56A 1OYEA 1N61A 5FRMA 1DXSA 1IKWB 4JN4A 4ZP6A 5HL7L 2W7AA 5J2IA 4KH5A 1WDDA 4WXWA 4DV6K 4FJ5A 1MN7A 4DV5K 4KFBB 1LKZA 1ZRMA 1PYSB 4WBFA 2P9LB 2DGXA 1XWLA 3MEGA 4DPUA 1Y5NB 3A5OC 2WBNA 5ALUA 3MM5A 3GIJA 4KIAA 1TV9A 2GLEA 3D3BJ 2F8HA 2IBOA 3QDKA 3K5NA 1QAXA 2B0GA 1X60A 3CI5A 3C6TA 3LYSA 2IRXA 1BOTO 4QPXA 2CIMA 3L3FX 4X4PA 1FFUA 5AE2A 1VIXA 1UVMA 3MFIA 1YWXA 5D8HB 1M0SA 1GOAA 9ICUA 3CD7A 3SIPB 3Q83A 3HHKA 4ZPCA 1TAQA 2YH0A 4TUSA 1GTHA 3OGUA 5J1NA 2AGQA 3AGKA 4KAIA 1KEKA 3I55N 1FF2A 3NGRA 3IP0A 2FTRA 4USMA 3KJQB 2CJXB 3RH5A 2EG2A 4WQ5A 4RW9A 2K2PA 2MZSA 2Z7JA 5E3PA 3VGKA 2XMKA 3OJUA 2K8BB 3MCMA 2B9EA 3RR7A 2OAUA 1PC4A 4PG7A 3QB0A 2XLJA 2JL9A 2KEYA 2Y0SC 2CXYA 3O4QA 4PQUB 4NLKA 3QUCA 3D0PA 4KSEB 2DNPA 4B3SK 3HVRA 1T0TV 1QSYA 3PV8A 4EX6A 4CJFA 1Q7LB 4FXDA 1FESA 4E7LA 3SFGA 1GLCG 1V5IB 3R5CA 2OPRA 2Z2LA 3SMVA 2I9GA 4XDCA 2DY9A 2HOQA 3W5ZA 3SV3A 1KDNA 5AI9A 1HJPA 1SGGA 2XMUA 1D8ZA 2FUG9 2PMZF 3QEWA 4X4VA 2ZJ8A 4JHDB 2I1QA 5J2FA 3RBDA 4F3QA 3DAWA 1RAOA 2DNHA 5HQMA 4FZXC 4JI7J 5L1JA 4G1QB 2HBQB 2VJUA 4BRPA 1T9WA 4LY7A 1Q78A 5ALFA 1MNEA 3PEHA 3DLEB 1MC8A 4N76A 4KH4A 7ICRA 2H3GX 5F8NA 3KLGA 1E4FT 2VZ9A 2KL8A 3ENOA 2BGWA 3IG5A 2IM0A 3PRBA 2NXUA 4O4RA 2RF2A 1S59A 4PXCA 4NXNF 1RHJB 4MYTA 2FZGB 4RW8B 4CH7A 2Q3SA 3SUOA 2E5JA 1QAIA 2VJVA 1ZJMA 2QEXS 1YZ7A 4KHPK 2ZIWA 2MZTA 5JXSA 4UOGA 2HSTA 3NDKA 2CQPA 1UL3A 2ZH4A 2P5VA 2BPFA 1B4SA 2HQCA 4B3OA 2IYIA 3EZUA 2Q2RA 2VKRA 4U8VA 4TKTA 4IO1A 3MEGB 4GMJB 1EARA 2HVZA 3J7YU 3MM5B 5JLHA 2WONB 3QIOA 2OPSB 1PO6A 2F2AB 1ACMB 1U48A 2EKYA 1R0AA 4GKKF 4YY3J 2ZTEA 5HMWA 4PRFA 1ECWA 5IWAF 1PAEX 2K4PA 3C1YA 3O80A 2DR7A 1SPBP 4H5NA 2B4JA 3HHLC 3NCQA 2OZSA 2E1AA 2ASMA 2HHSA 4X65K 2VOOA 5D49A 4WJBA 4OZ1A 1NGHA 3DRPA 3K5PA 1WF0A 2MZQA 4NLUA 3HJVA 1MSWD 1RHMB 2ZJQL 3RMCA 4LF5K 1PJ6A 1MWQA 2AA4A 1HNWJ 5AQYA 2DVIA 1X66A 2ZOFA 3VQSA 4A8SA 2CQ0A 3WU2U 3H59A 3AA3A 1RAEB 5DB6A 2XMAA 2PFOA 3NGDA 2NO5A 1Q5VA 3BGFA 5AK3A 2ZEJA 3W1YC 1GMWD 3R9LA 4FZZA 3AO5A 4MKAA 3TACB 3UNGC 2FVSA 1SC6A 1AUSL 4O9MA 3JQJA 1DLOA 3VF4A 1Y88A 1IBLF 3ENBA 4A4JA 3CUNA 3VQ9A 3BKTA 1ED1A 2WVDA 4ILMA 2F9TA 2N3LA 3OR1B 2W4DA 4USAA 4OYBA 2A6MA 4Z2XA 2RN2A 4WQ4A 4CF0A 1AB8A 2DITA 2W2OP 3RH6A 2MHNA 1KAXA 3BP8A 3ULEB 3TJAA 1Q86T 6FD1A 1GAOA 2RQCA 3D6FB 1SBRA 2OCEA 4EI2A 3KLGB 3GFXA 1NH7A 2UU9J 2QLJB 3W66A 3D2EA 2LLZA 2XULA 4JD2B 1V9PA 3UXNA 2FB0A 3SNNA 5AI6A 3M6UA 5KT5A 4WCEQ 3BSOA 1TUWA 2BMBA 3AO3A 2JDJA 2EZYA 2N82B 2CH6A 3KKFA 1FO1A 1BPZA 5BJRA 3NGIA 1JIHA 4BVPA 4C0BA 4B3OB 5HMZA 1Y7PA 3G96A 3LPEA 1L5UA 1AQ6A 4DR5J 2YKOA 2E3TA 3KWMA 3I32A 3IFEA 4A57A 2CPYA 8ICYA 3DM2A 3CCTA 2ZH8A 2LHTA 1ASVA 4CGGA 4M3UA 5F1XA 1TTHB 1O8BA 1R0AB 4C0ZA 1RZMA 3BF1A 4ANEA 3AVKA 4ETXA 2JWLA 4CJEA 3C5FA 3KUGA 2ZZNA 1VISA 2F8LA 3FLCO 2Y0SF 3M6XA 3KJVA 5DJBA 4Z4EA 2D3OR 3MTKA 4KLUA 2Z58B 3B6BA 1QLNA 3ZZPA 1HI1A 1Z4NA 4FZLA 3HSDA 2VOPA 1OSDA 2JHEA 3O1WA 3BO3A 2BH1A 3DRPB 4RPFA 2QEXN 2VQEJ 1YTUA 1DGSA 1M1HA 4HVZA 4LIRA 2YHYA 1C1AA 1T9TA 3ZSWA 4FNIA 1OVYA 2MDAA 3RG6A 3MN5A 1FTCA 1F9FA 3OUYB 2H4WB 3G8SA 1U1NA 4GNIA 3NRBA 1Q4RA 1P1TA 2YHXA 2QARA 2HBYB 4GW6A 4NLVA 4CHQA 4M3TA 5BN9A 1LXJA 2WSEC 3WDOA 4MKVA 3JSYA 2DGSA 1ZQDA 4I2IA 3ZXWA 1UEKA 2V67A 3VGTA 1DKGD 4DQ8A 3T5JA 4F9OA 3D7SB 1RAGB 4EFHA 2FLNA 4YB5A 3CQYA 1DLOB 3TUPA 3PX4A 3BV8A 4JMUA 1APSA 4FF1A 2HYIB 1BWVA 1KLNA 1SV0A 2ROPA 1J53A 3X3UA 4IKFA 5KL8B 1N8RT 2WCXA 1XMQJ 2NXCA 2KKPA 1IBCB 1HWKA 5HMLA 2U2FA 4Q2MA 2ROGA 1XSLA 4AHSA 5HMXA 2YNGB 3VWSA 3B54A 1I94J 2ZGYA 5BR8J 2PBDA 2X78A 4K42A 2FMPA 1TUUA 4LJXA 4LD0A 2WVEA 3NE6A 3D2EB 2A1RA 3IV6A 3LDPA 3MECA 4WFBL 3T3FA 1ULRA 2XZDB 1S9GA 1NDCA 5TISU 1Z1BA 3ASMA 4CF9A 2HBJA 1DY3A 1UW4A 5LJ5Y 2OKQA 2XEXA 2CGKA 4KB1A 3S6JA 2ZC3A 4IG3B 1FFGB 4JYAJ 3N7PD 5D77A 3EVOA 1KFDA 2A2DA 3GSIA 4BREA 5H9FK 2V34A 2NNWA 4RUHA 3OFGA 3LP3A 2QB1A 4B1YB 2B56A 1A5XA 1XNSA 4DN9A 1RT6A 2GX9A 3TU5A 2BKOA 3P5TL 1HUXA 2NXEA 3GIKA 2VASA 3DM2B 1QDUB 9ICJA 2Y8YA 1VS3A 1BA0A 2NYIA 1UT5A 2NRTA 4KLHA 3EE3A 4C3KA 4DG1A 2XMJA 2HRUA 4DV3K 3W3DA 2AQ4A 3KJVB 3ET6A 2JR5A 1YF5L 1JI7A 5HRNA 5L1KA 1X7VA 7ICKA 1IKVA 4X66J 1XNRK 2AGOA 4JI4K 3HKWA 4YQWA 2OEHA 2HGNA 3PHTA 4GXKA 2J7KA 1DRZA 3ID6A 4O5FA 4Z6DA 4ZP7A 4NM2A 3NCRA 1XR6A 2CPXA 4LF6F 2PI5A 3DRSB 3VETA 2C3MA 3H90A 3TUIC 2QB0A 3PW2A 1R7IA 4K4YA 1DOQA 3BQ1A 3GDQA 2G8HA 4Y2MA 1A5WA 2EQYA 3IO1A 1HYSB 2XM3A 1IV0A 3SMZA 1M5PC 1DFDA 5DDMA 2F76X 3CJQA 4M04A 3UVJA 1IG9A 3AVBA 1MN8A 1A6SA 4LVNP 3I9V9 2WB1D 4RWTA 2DGZA 3O6WA 1UVIA 1BQMA 1UPPA 4LFCJ 4IO8A 1KHWA 4M5KA 1VRTA 2EZZA 5J0OA 3ETOA 4DOAA 3MK6A 4KE5A 2IOFK 1TQLA 4M47A 4ZS6A 1FXLA 1ZBUA 3CJTA 2K60A 4NLCA 4IRCA 4MLEA 4NXMF 1B9DA 2Z0GA 1FRLA 2AJ0A 3QT7A 3CRXA 5J8YC 1SQFA 3R9KA 4OCZA 3CPEA 2HURA 4F4AA 5E3RA 4FJGA 1DURA 3MR2A 1N5VA 2DR5A 5GAGU 3NEKA 4USKA 1XN9A 3R5JB 2ZVSA 3MECB 3M30A 1SL1A 2HOIA 1S9GB 4WYBA 5IINA 3LVVA 4JI5F 3TFRA 5LSLA 3V6DA 3X1LB 1KLMA 4RWWA 2IVOA 1LB2B 1RWKB 3HZGA 3PR4A 3K2YA 4FM0A 1YRUA 2XC9A 1TFYA 1SH0A 2LYAA 2XGQA 2WVFA 1S77D 3QLHA 1QZ6A 1RT6B 3MM9B 2BVZA 2XQCA 4AHRA 2DNLA 3JXOA 1Q9YA 4FWSA 3K8VA 9ICIA 3TZWA 4LFAK 4ECWA 3KMSA 4ATNA 3JAMO 1KNZA 5CYMA 1F2HA 2EBGA 1RDWX 4JV5K 2YKQA 2G2YA 3DXMA 3FQLA 4IKAA 4J5OA 3ET6B 3RJGA 4ETZA 2P9CA 1V6HA 1KVAA 2DHXA 2ZBQA 2EI5A 4TUQA 2ZXHA 3BPDA 5F9NA 2LXUA 3Q23A 3VF2A 5ALDA 2R8GA 1SJQA 2FSKA 2VD3A 4IS7A 1SL0A 2W2PP 1KP6A 3HX9A 3OR2A 4JRPA 1UVLA 1GLBG 4CZHA 2QB0B 3HULA 1KR4A 1L3SA 1KQSR 2MQ8A 2GVDB 3KYLA 4K4TA 4M2YA 3RJJA 4MQ3A 1HHQA 3H4BA 1UJ4A 1S22A 2E1MC 3C2MA 1XHZA 4A8YA 5JRTA 3T1AA 3GWCA 4G1PA 5A2QO 5KG0A 2B43A 8ICKA 4CNQA 5LL6Z 2M0NA 4M3RA 4DR3F 4FZMA 1EP4B 2L3MA 2CJKA 1WACA 1ZQIA 1VRTB 4AQYJ 2R8JA 3OYCA 2UVWA 2FI1A 2HAFA 3SPYA 2KICA 1MLAA 4OJRA 4M3XA 4F04B 2FSNA 1FD2A 1UVNA 1FTRA 4NY8A 2JWNA 4RTFD 2MKJA 1N54B 4Y2AA 4YDDB 4YUDA 1OIAA 3NNCA 2GQCA 2WF7A 4PG8A 1WG5A 5ETNA 3RB6A 2KJVA 3DMJA 4CZEA 4CGZA 4OKKA 2O66A 2C2ZB 2KH9A 4RW7A 3HSGA 2QA1A 3PACA 1F5BA 5ALMA 3PIOQ 2V7ZA 3M30B 3ONNA 1NSQA 4RT2A 4OZ2A 1Q82O 5B8HA 2HHXA 3R6LB 3OLBA 2WW8A 3IS9A 3V6DB 3EZ5A 4DDFA 3NS6A 4CJTA 2NZTA 4DWIA 5KFXA 3HHLA 3J80U 2YX4A 1S5LU 3O0FA 2X1FA 2VG7A 3NAHA 1B4FA 5IV4A 3CJ8A 3BGUA 2A18A 4RPZA 1WG8A 3QLHB 4BGAA 5IS2A 2ZHAA 1M5SA 4ILHA 2RH3A 4JI7K 5CCLA 2XNRA 1JLAA 4DOZA 1UVKA 2LCWA 4C4SA 2C2OB 2HNZA 1BWFO 4ZA1A 4CFAA 4I2DA 3M1VB 2GBZA 1NGCA 3DXMB 2VDIA 5HATA 2HWTA 3ADAC 2LDYA 4H5RA 5C2DA 4FK2A 4QZBA 2IDOA 5DM6L 5D3GB 3DXKB 4PZOA 3VQDA 8ICAA 4DSJA 9ICSA 5J2MA 3DOMA 3THPA 1HFEL 2BDUA 2GH1A 1X9XA 2H3FA 1U1PA 2PMWA 1T4GA 1JJCB 4UAYA 5AKZA 3H8JA 4ZMMA 1ROFA 1NGBA 5E2QA 3J7AN 1CBKA 3BBCA 2HHHJ 4FF4A 2ZNZA 1C0UB 4JK7A 1N56A 4BE2A 1Z3EB 4NLWA 1KONA 4LJMA 3WT0A 1V38A 2QX0A 3KUEA 2QZ8A 3VERA 4IFVA 4MFAA 4DFJA 2YWHA 1SV5A 4YY3K 4AL6A 1ZAVA 2K89A 1ZQVA 3AQFA 1Q7YT 1JKHB 3JPQA 2J7UA 3OPKA 2O6KA 3RYLA 2DBYA 4K5RA 1C4CA 3PRDA 4GMKA 1KQSM 3CMQA 2R18A 5M2UA 1OMSA 5BRDA 3RB0A 1W26A 2GVZB 4P7TA 2G1DA 2KDOA 3K5OA 5FLXU 1XC9A 1G15A 1A5VA 3PCOB 5T7LA 4BWMA 4HTLA 3JS9A 9ICHA 3DMJB 1HNWK 4AUKA 1V5VA 4KN7A 4B9UA 1H73A 3HHNB 2K4HA 5M1OA 2X6SA 2CVEA 4KLIA 4WFNQ 3TR5A 5B08A 1RBOB 1PVPA 3KLEA 2ZJRL 1RBTA 3UE2A 2EAPA 4OV1A 4KLFA 3V6KA 7AT1B 1CXUA 2Q0RA 4ILJA 3UPFA 3IS9B 1RWVB 1T7PA 2VDHA 3HHLB 4I28A 1MA7A 1DGJA 3W5XA 2D0AA 1LWXA 2VG7B 4FLVA 2LM1A 1ATNA 3ISCA 2PD1A 1YK9A 4B1WB 4BVOA 2JXJA 5J29A 1KKHA 3CCES 4ICLB 2LMRA 2LEPA 4J9KA 1SC1B 2ZNYA 2BW2A 2RP5A 1NM1A 1SJ4P 2Y9TA 4W90B 2XYPB 3FZBA 2HK3A 4FLWA 2R7VA 1TYQA 4CGHA 1GLEG 3KJNB 2UU9K 4IR1A 3MR7A 2XMMA 4USTA 2XVTA 4TNOA 5ALSA 2CJQA 2ZTDA 3L2VA 4IDKA 4ZP8A 5J2MB 4NEYA 4ZPDA 3DOMB 2ZIUA 1BY9A 1Q8KA 3MEEA 1RT4B 3HD2A 3DDNA 1I51B 3A4TA 2GWSA 2G0JA 2BPGA 2GJIA 1JMTA 4AFFA 1LXNA 2DBBA 4MIWA 4DCOB 4I2EA 4DX5A 1IIPA 5B5EU 4RG8A 4L3NA 4I4BA 5EX0A 1LK5A 3MX5A 2PFNA 3NHGA 2LYBA 4MO5A 4DR5K 1Q5YA 3HPGA 2G5IB 1HKAA 4M5IA 2AD9A 4IFVB 1IO2A 4FJ8A 2OWOA 1SV5B 4QIGA 1IJEB 3VQTA 3VGVA 2MGZA 1FFWB 2OH2A 4UOFA 1X8DA 2QLFB 4DQPA 4GV6A 7ICFA 3FZMA 4TQRA 1OKJA 1Y9OA 2YWWA 4WFZA 3GFHA 3VAJA 2CQIA 3H5UA 5HQ8A 3SK3A 1CULA 1ZQEA 4X62J 2XBPA 2VQEK 1SB3C 3HSJA 1JLGA 2P9UB 4JB8B 1WOPA 5KRSA 4IXCA 4PHTX 3U3GA 1QQNA 1BI4A 2GW8A 1DTQA 5HOOA 1VSDA 3D6HB 5AKKA 3W8PA 1YJTA 3FMBA 3THVA 1FRXA 1LOTB 1IKXB 5KFZA 3T5KA 1CZAN 1RSCA 4JLHA 4ID1A 5CA7A 5I3UA 4WP3A 4DR1F 1OS5A 1TAMA 2HS0A 1BNPA 3MUVP 5BN8A 4Q45A 2DNQA 7FDRA 2W2NP 3HHEA 4CWBA 1P1LA 1TL5A 2W42A 2GV1A 4Y65A 4I9QA 3HP6A 3GG4A 2A1JA 3DLGA 9ICKA 4LZGA 4F4ZA 3POTA 3JPPA 5DG7A 1HUZA 4KHUA 2OM6A 1XMQK 3PJ9A 4C0HA 4YEAA 3ZSXA 3FEYB 3AQOA 3NRZA 3TX0A 2QMWA 3TQEA 3OYMA 2P9IA 4YHHF 5AI4A 3EVWA 1W0HA 3PM9A 5D4PA 3M8WA 1I94K 5BR8K 5GVQA 4BDPA 3JSMA 2KOBA 3IMXA 3MEDA 4CO1A 3GOIA 4G6VB 5C10A 1VSEA 2M8HA 4JI1F 2ZDOA 2LBOA 3KG1A 1F3FA 1ZOTA 3TJ9A 3FCWA 9ICXA 3MEEB 3G25A 1RYUA 2H9ZA 2QKBA 4BR2A 4JYAK 1NSAA 3HD1A 3NCIA 3N7RC 1KXPA 4QYRA 4QJVA 4DTRA 1F9HA 5KT7A 4ZCLA 4WFYA 3ZDCA 3AN1A 3UR3C 1HKCA 2MSTA 2G0IA 4O3PA 2RQMA 4E7HA 3AH6A 5J8YA 3CCEN 4PHPA 3TUZC 1GX5A 3DOKA 1D4XA 1SZHA 1LAWA 3QT5A 1Z4OA 1WDTA 2G8VA 1IR2A 4F71A 1FHTA 4X66K 2C2KB 3L0QA 4ECQA 1ZJNA 3CULA 2VBWA 3L5KA 3AOAA 3EKSA 5A8WA 2NZ4A 2MB0B 4AILC 2HSEB 1O1WA 2VKQA 1GLDG 4CJQA 2RPIA 3VCDA 1E3MA 3H8YA 1JLGB 3IA0A 2ODGA 3BBFA 1MMNA 3BJYA 1WHWA 2D1CA 1BI4B 1NZ8A 4OX8A 2Z1IA 1DTQB 3OYHA 3A8JA 1AW0A 3DDIA 3H45C 2E7XA 1XNQF 5KFEA 3UPQA 1SCJB 4MKYA 5E33A 4Y0FA 4R64A 1D8BA 3MR6A 5GINA 3ZZTA 4E1JA 3G82A 5J2BA 4N8NA 3EGVA 2DKZA 9ICWA 2GMLA 3HSTB 5EWFA 3E51A 2VWBA 3UCGA 3OFFA 4WZMA 1FEEA 4R66A 1VSFA 3JPNA 4KLTA 3KDNA 4Y2SA 3FQKA 5KFCA 1YX2A 4NI2A 2ZJPL 2A1JB 2EBEA 2K3KA 3AODA 1FKPB 5KG3A 3POTB 4BRGA 3TEGA 3FZFA 3VZHA 4I6MA 4ELVA 2KXHA 3CJ0A 3I4PA 1NG9A 3D6RA 2A2CA 2HBRB 1O5JA 3O1BA 2J0QD 3VQAA 4NXNJ 3H1QA 4UASA 4CK3A 4IR9A 1TL4A 3JSMB 4L8RB 3FE1A 5GAEU 4V19S 1F9EB 3TR8A 1RXWA 5KFKA 1L6NA 5AKJA 3HWTA 4BDYA 1RFQA 2ZH2A 1M1GA 2PSZA 3QE9Y 9ICRA 2QO3A 4CNZA 1PVRA 3W7BA 4GKKJ 5HR6A 4CVNE 1F60B 2X3GA 3NP5A 1RTIA 5IWAJ 2NXJA 1MROB 2KT5A 4M63A 3EN9A 4O0IA 2GHWA 4NLZA 5DDPC 3DOKB 3EGZA 1WHXA 1NNEA 3LM2A 3V6JA 5GTIU 3IM8A 3FBBA 1NWKA 3MPDA 4JKDA 1EJ7L 9ICLA 4HTIA 4FXVA 2OJ3A 4MKBA 4OMFG 3DKDA 2L5YA 4C9DA 1RAFB 4YOYA 1AT1B 4M41A 3PFEA 3H7IA 2KSOA 5A8WB 3OXFA 2AYGA 4MFFA 2IJFA 3CERA 3NS1A 3CEDA 1L7OA 3AJDA 4YMEA 2ZUDA 3QSIA 3WZ0A 4DR6F 2D0CA 1C7YA 1KQKA 3TQ1A 4IQWA 4ECVA 1ZQCA 1KS2A 5ELZA 5AQFA 5B7WA 4I7FA 2D4WA 2WHEA 1AFJA 2KYZA 3ZZZA 3GIMA 3R5AA