1NKEA

A bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkeA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkeA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkeA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkeA01
2VWKA 3NHGA 1S0NA 3PUFA 5D4BA 4BXOA 5DBAA 2ZJ5A 8ICNA 4I2QA 4KI6A 5J2DA 1RYSA 3RJKA 4QZ8A 4RQ8A 4C8OA 4KTZA 3GV7B 2DFEA 5KFZA 3V6HA 3V6JA 3LZJA 2RN2A 4CF9A 1YT3A 2FMPA 4TSXA 5BOMA 1IKYA 3L3VA 4M3WA 3DLHA 3AU6A 3OGUA 4B8AB 5KFRA 3VQDA 3ZSOA 2X6NA 5DQIA 3OYDA 3JPSA 4CHNA 3QIOA 4FXDA 3RJFA 1W0HA 5T7BA 4KHSA 4LVSA 4EZ9A 4KB0A 2VG5A 9ICEA 9ICBA 2BCSA 2OZSA 3NH0A 4O0IA 3MR2A 1B9DA 5J0OA 4QOZB 4OPKA 5J0RA 4FW1A 4CJUA 4DSLA 3SQ4A 1WSEA 2QK9A 4FZZA 5D49A 5DB6A 2NRWA 4EBCA 4KB1A 1N56A 2A1JB 7ICFA 2F1JA 3U3YA 4TUSA 4AHSA 1S0OA 2AQ4A 2D0CA 4J9LA 3PW7A 3QEXA 2BR0A 1RT3A 1JMSA 1S1WA 3RB0A 4NY8A 3T19A 2VA2A 3AO3A 4ECYA 4FBUA 3IHQB 4RW9A 3EYZA 4O5BA 5DLFA 3MDCA 1RBSA 4CF2A 2XCPA 1HYZA 1U4BA 1UA0A 3AVLA 4DQQA 4PQUA 5DKWA 3C23A 3SQ1A 4JK1A 4JWMA 1LW0A 5KFVA 4M04A 4DSKA 4KN7A 3KLGA 3OYGA 4Z0UA 3TAGA 1KFDA 5HP1A 3OSPA 2Z1HA 2I1QA 4HUEA 3GFKB 3EW9A 4Q0BA 3S3NA 1S1UA 4R8UA 4RUCA 4PHDA 4KPYA 4J9NA 2DPJA 4M9GA 1RT7A 1D9DA 4DMNA 1XHZA 4RT3A 4E7JA 3G6VA 4YP3A 4FYDA 1KVAA 1Q8IA 3OYFA 4M2YA 3K5OA 1JLBA 3SPYA 4W5NA 4Y1DA 3K75D 4KLIA 1HQEA 3FYHA 2UVWA 2GUIA 4AHTA 1RDAA 4EYHB 1NK9A 2C28A 3C94A 4IG3A 3MFIA 1DTTA 3TANA 3DM2A 4M3YA 7ICGA 4OKEA 3AVIA 3QIPA 4IG0A 2IOCA 3TAPA 4F4YA 5D3GA 2GWSA 1SV5A 5J2FA 7ICEA 3EPGA 3VQ5A 3MBYA 2NRTA 3ZD8A 1BHLA 3MEGA 4IR1A 1ZQVA 1VSEA 4ECZA 4OKKA 5J0SA 3Q8PB 4Q43A 3M9OB 5J2EA 4LZDA 4BGDA 3MGHA 8ICMA 2IAJA 7ICUA 1QSSA 4PH5A 1NK5A 3C21A 2KZ3A 2G8KA 3AVNA 4ED8A 2MUTA 3V1QA 3O3FA 4CGGA 3QINA 5KFUA 5HP4A 4CEBA 3IS9A 1LWEA 1A77A 1J54A 2IDOA 5J1EA 4RQ0A 3H4BA 4IQWA 3JPNA 3UXNA 4I2IA 4KHQA 5TZVA 1B22A 2ASJA 3IM1A 4UBCA 1EETA 1BPEA 1PZNA 3HPOA 1MU2A 4M0AA 4JS4A 1D9FA 4AILC 5KGWA 3GQCA 4FCYA 4DQSA 4O5KA 9ICKA 2BKEA 9ICOA 4B9UA 3V9SA 1ASWA 2P51A 1MC8A 5DBCA 2R8HA 3ZSVA 9ICPA 3KD5E 2ISOA 3JPTA 3UQ0A 9ICSA 2W8LA 5IIMA 1KLNA 4FJXA 4O3QA 3V7KA 2EX3A 4NLGA 3SV3A 1R0AA 5KFHA 4IRKA 1HUOA 3DMJA 4F5RA 3QETA 4RNOA 1WN7A 1VSDA 9ICAA 2O4IA 4YFUA 4HUGA 3WNGA 1WSHA 4CE9A 2Z1GA 3NAEA 2G8WA 2X6SA 1ZETA 4MF2A 4EYIB 4KLMA 4UB3A 7ICVA 4EEYA 3LP2A 4CJ5A 2IGIA 3JPPA 2FPLA 3NF6A 4O3PA 4KFBA 3V9ZA 3OS0A 4DU1A 2ZTEA 4UQGA 2OPSA 5KT2A 3ISBA 3ISDA 1RXVA 3GIKA 3BQ2A 4FJGA 2Z1IA 2YKMA 3HWTA 4K4IA 4OPJA 3PX6A 4RNNA 3H7IA 8ICSA 1T7PA 4F4XA 1LB2B 2PXIA 1JLGA 2ATQA 1KLMA 4I7FA 1ZYQA 4IFVA 3SUQA 4CGDA 1YVUA 3RH6A 7ICSA 1Q9YA 3PO4A 4IRDA 1TVAA 1S77D 2D0AA 4LSNA 3QEWA 4DTMA 4F5QA 2UVVA 5DGBA 5DLGA 4LD0A 5SWMA 4I2BA 3HT3A 4YR0A 1HNVA 4I27A 3M8SA 3PW5A 4C8NA 5IIIA 4OLBA 4RQ3A 1S1TA 9ICQA 3QEIA 1TAQA 3RH4A 8ICEA 3ETLA 4YXMA 3NTUA 8ICKA 1YTAA 2OPRA 4FBTA 4FM1A 1BPXA 5HRSA 3AO2A 4CJWA 4Z4FA 3SYZA 5BPCA 4IDKA 3RTVA 1RZTA 2ZTDA 2C22A 5KI6A 4P4PA 5C25A 1SKWA 5FROA 2ZJAA 3ZT0A 1ZQTA 3MXIA 1S10A 1ZQMA 2ASLA 3DLEA 4R5PA 3L2RA 4NXZA 2KTQA 3RWUA 4G1QA 2QKBA 5KT7A 1I39A 1WCNA 4E7HA 2DY4A 4F4ZA 1S5JA 1ZQFA 2PFOA 4FK0A 5KFMA 1V9PA 3B0YA 4RQ4A 4CJFA 4C8MA 5KFKA 2VG6A 2ZE2A 4QAGA 3RR7A 4UB1A 3HP6A 4DL3A 1DTQA 2Q3SA 2BGWA 4CHYA 4NM1A 8ICBA 5HRPA 1CEZA 3QEVA 1YTUA 3LWMA 1NK6A 2RKIA 3U6FA 3SV4A 2BPFA 1TK5A 2HNZA 1C6VA 4J9OA 4CHZA 3HXMA 1S9FA 1S1VA 3M9NB 3QERA 1HQUA 2ITGA 1BISA 4DOAA 3PW4A 5L1JA 2A1SA 4QW8A 1ZQJA 4BDYA 2F1HA 1TKTA 4KLSA 1RDCA 4EBDA 1HPZA 3RJGA 5KRSA 4DL7A 4O3OA 5C5JA 4DTRA 5CWRA 1RNHA 1RT6A 4CJLA 1ZQNA 4NYFA 5IIKA 3Q8SB 4HTUA 3OYKA 4K4HA 1TL1A 5KG0A 2HHXA 4KHYA 4PGQA 1BCOA 2HHSA 1JLFA 3QEBZ 2W8KA 5DMRA 3RMCA 4EZ6A 3VQ8A 4FLXA 5J2AA 4CJ3A 8ICGA 3OYEA 2VG7A 1LV5A 3AV9A 2JZBB 4Z6CA 2HHUA 2DTUA 4FLZA 4DQPA 5J2CA 4P4MA 2G8HA 1ZQGA 3KJVA 3NF7A 4ECQA 1NJXA 3GILA 3OSNA 3L3UA 4CJ4A 1Y88A 2OYQA 4FJ7A 4ZTJA 1EKEA 4N76A 9ICJA 3LDSA 4PGYA 3V7JA 2OWOA 5CZ2A 4IQTA 5J2PA 2XY8A 4CHQA 5J0PA 3B0XA 1NK8A 3T1AA 3L2UA 4Q8EA 2HW3A 2BE2A 1XO1A 1KFTA 4I2JA 5KT5A 1T4GA 2HHTA 2G8IA 4YR3A 4Q5VA 4PPXA 2BCRA 8ICZA 5DB9A 4LSLA 4DLGA 4CCHA 3OHBA 4DO9A 4OJRA 3EZ5A 4J9QA 4QW9A 2HMIA 3K4GA 4I2AA 3VQBA 3IG1A 4N56A 4AHUA 5EWEA 2P5GA 2ETJA 8ICJA 4H8KA 2R8IA 4KTWA 3PO5A 4E7KA 4I2DA 4W5RA 2KFNA 4CJRA 4RUAA 2UVRA 3Q8RB 1VSLA 1CXQA 1C0MA 8ICRA 4RQ7A 3AO4A 2KZZA 5L1LA 3U3GA 2VWJA 4M9NA 4ICLA 4RQ5A 2JEGA 1ZQWA 3RMAA 5J2HA 1NKBA 3ORYA 4W5OA 3QZ8A 4KREA 3MFHA 7ICTA 4J2BA 4F8RA 2B5JA 4TURA 3TAQA 4KLQA 3OHAA 4B3OA 3TR8A 2FBVA 3SI6A 4HCCA 4CFDA 4CEOA 4MFFA 4BACA 5HRRA 3AO1A 2W9MA 3EWAA 5CB1A 2W9CB 1B9FA 1Z25A 2W9BA 4XRHA 1Z00A 4RT2A 4FJ5A 1ZBFA 3ZCMA 4HUFA 4XUSA 2Y1IA 2P6RA 4JV1A 4E89A 4FM0A 1L3SA 1C1AA 2FLLA 3EY1A 3RJIA 4BDZA 4RW6A 3RRHA 4NCBA 4NM2A 4IR9A 4CJEA 3A2FA 5DDMA 3PW2A 1ZQOA 1CZ9A 2ZJ8A 7ICPA 4E1MA 4YMOA 4IRCA 4J2EA 1TAUA 4DQIA 4I9LA 3SUPA 4DS4A 2HVIA 1D8LA 4DTPA 4NLZA 5FRMA 2FLNA 3SQ2A 2F8SA 2YKNA 4DTNA 3NGIA 4CGJA 4NCAA 4CFCA 2I9GA 3DI6A 1N5YA 1JXLA 2OPQA 1ZBHA 4FJ9A 4NLNA 2F8TA 4O44A 4GLXA 3AVCA 1DGSA 4CEFA 3PMLA 3PX4A 1RTHA 4IQUA 3CG7A 4CF8A 1N48A 2Z1JA 3MDAA 1BVSA 3LK9A 4F5PA 5DG9A 4GC6A 3HK2A 1BL3A 4CEEA 4CGIA 3V6DA 2V4RA 3KLEA 9ICIA 1NKCA 3RR8A 4CJKA 3ZDDA 1COOA 3WNEA 3VA0A 2HHVA 2BQ3A 2WTFA 4TQRA 4QWAA 5KFNA 4JRQA 1K1QA 3ISCA 3RAQA 3LPTA 2D5RA 3D0PA 3IRXA 7ICKA 5CZ1A 3BQ1A 3NE6A 2DFLA 2PI4A 5HRNA 4JS5A 4KLDA 3NH2A 5J2MA 5KG3A 4FW2A 4GXJA 4PA1A 5KG1A 1WSJA 5E41A 3TWHA 2P5OA 7ICOA 4DWIA 1VSIA 4O55A 1NOYA 3HSTB 5DB8A 2PYJA 1JLCA 4MEYA 1ZQBA 4M9JA 4KMUA 4Z6EA 1REVA 3TFRA 4Z6FA 4M6WA 1VSHA 3AVFA 3LP0A 5JUMA 3L2WA 4GVMA 1IG9A 3O4NA 1HYSA 3NF8A 3H8JA 3DRPA 2IHMA 2PFPA 4OGEA 3QO9A 1ZQZA 4ECRA 2IC3A 5J2GA 2VA3A 1MQ2A 4B9LA 1QHTA 3DRRA 3LPUA 4MQ3A 4FK4A 5KFJA 4QZFA 5HHIA 5HLFA 4YXJA 3NGZA 3IAYA 3BGRA 4FJNA 4EP5A 4YD1A 3N4MB 4FJMA 3BDPA 4EP4A 2VA8A 4FJJA 2A1JA 1GOCA 4DL4A 4YFKA 3Q8LA 4Q45A 2FBYA 2KQ2A 3JPQA 1UWBA 4BDPA 3BJYA 2YHAA 1IXRA 3VQ9A 3VQ6A 3VQEA 2PY5A 5CYQA 1NOMA 4O3NA 3AA3A 3VA3A 1Z3EB 4AHVA 3ZD9A 3RB4A 4KHNA 4Z4HA 1XSNA 3PY8A 2PI5A 2V4QA 4CJSA 5FRNA 9ICMA 4FJ8A 3ZDEA 5KFTA 5KT4A 2R8GA 1BQMA 3QESA 3I0SA 4QZBA 3ZSXA 4CERA 4JV2A 5J2BA 4QZHA 1J9AA 5DG8A 2KN7A 2HHQA 5J29A 3E01A 5KTQA 3AVJA 5KFBA 4OVLA 3RJJA 3KLFA 2FMQA 4M3ZA 3HPGA 4M41A 2ZUCA 1KVCA 4JRPA 4KLLA 4QZGA 5HROA 5L1KA 1ZBLA 3T5LA 5CJ7A 2IA6A 4FJHA 3VQ7A 4FLUA 4B9SA 3LANA 3P1GA 5J2IA 3V4IA 1UAXA 4NYNA 4BE2A 1D8YA 1ZBIA 2PZSA 1Y97A 1L3TA 3UXPA 1JIHA 3K57A 3Q8QB 4QWBA 2G8UA 5I42A 1ZJNA 1ZQCA 3ZT2A 8ICLA 2X78A 1ZQQA 4HYKA 3PVXA 3K58A 4F5OA 3I0RA 1ZQSA 2P66A 3AVAA 5K14A 1TVRA 2WOMA 8ICOA 4TQSA 5CR0A 2FLPA 3CFRA 3ZSRA 1QTMA 1ZQRA 4DLEA 4M47A 3C6UA 3T5KA 1QQCA 2P6UA 3KK2A 4I2GA 4F2SA 1TV6A 5J0TA 1A5VA 2Y1JA 1FKPA 4CFAA 3MR3A 8ICTA 1VSJA 2XO7A 4ED7A 1HMVA 5KFPA 3HW8A 2D0BA 5CA7A 1EXNA 1RT4A 5KFCA 2RDIA 3V81A 4ECWA 1XI1A 3V9UA 3TAMA 4YD2A 2ISPA 1TL3A 4KLHA 2YNGA 4DFJA 1WSGA 8ICWA 4UB5A 4E3SA 1RTDA 5C42A 3C2MA 1KSPA 4QZAA 2JLEA 1S0VA 1GOAA 3THVA 3ZSZA 3AVKA 4CEQA 4OGCA 1U49A 4ED2A 1S9EA 2G8VA 4CJVA 7ICNA 4ZTFA 4M9HA 5KFQA 5J0XA 4I2HA 5HMMA 4FS1A 4PUOA 4AHCA 1VSMA 5J0UA 2WONA 3D45A 1SKSA 2JGUA 4LH4A 1SKRA 4BE0A 3VQ4A 2XHBA 3LP1A 2W42A 3CQ8A 1RBTA 3F73A 7ICHA 1T05A 1WNSA 4LZGA 5J2JA 4CECA 5DBBA 4DQRA 4UAYA 4M3XA 1RXWA 5DDYA 3KHLA 3MR6A 3H8WA 1KRPA 3PMNA 5IIOA 3SUOA 4F4WA 2X74A 2BQRA 4DOCA 3HX0A 3UQ2A 5D46A 4IBNA 4PHEA 4GXIA 3QLHA 3VQAA 1ZQHA 1KDHA 1BI4B 2W9AA 4NCGA 4Z4GA 1TK0A 3OYMA 3AO5A 5L9XA 2BANA 4OKJA 4KTQA 3DLKA 1ZQXA 1XSPA 1BQNA 4DTUA 3HL8A 3LDAA 3DLBA 1N6QA 4X5VA 2F1IA 2R8JA 1C0TA 3K59A 3RMDA 3NF9A 4DL2A 3QZ7A 2J6SA 4ELTA 1IO2A 4DTSA 4HCBA 4RPYA 2BGGA 4CJQA 3OS1A 2XGQA 3KK1A 4BXOB 2YV0X 1ZQAA 1RCHA 3H4DA 4KLEA 1J53A 4J2DA 1ASVA 1Z26A 1T03A 4M42A 1VRUA 4KLGA 4GXKA 4JWNA 3V7LA 4FS2A 2H5XA 4K8XA 3AVBA 1ZQEA 4QWDA 4ECXA 4QZDA 4Z4EA 4MF8A 1S0MA 2B4JA 1RILA 1ZQIA 1TFRA 3O4QA 3V1OA 3LP3A 9ICHA 3LZIA 4ELUA 1UOCA 1NK7A 1VRTA 1HRHA 1U48A 4CEDA 1S76D 2R7YA 2GV9A 3LWLA 3C2KA 2IMWP 3CFOA 3SJJA 2W9BB 1RYRA 1TV9A 3WNFA 1Z00B 4GW6A 3P83D 4RNMA 4FJIA 3MXMA 1VSKA 3C1ZA 4CGHA 3SZ2A 5J0WA 1BIZA 5KG5A 2BHNA 4ID5A 1TKXA 1XU4A 1QS4A 1JKHA 3MEDA 1JL2A 2M9NA 4O5CA 2ZUBA 2EHGA 3ZSQA 4BE1A 3FDSA 1NK4A 5KGXA 1J5OA 1JN3A 1IKXA 5HMLA 4YCXA 3MGIA 1WAFA 4GMJB 3S9HA 2FMSA 4F2RA 8ICPA 4RG8A 3LAMA 4J2AA 3HVRA 4Z4IA 2BCQA 5KFWA 4KLJA 1LAWA 5EOZA 4QCLA 3SPZA 4C8LA 3SQ0A 4ECVA 5KFSA 4R65A 5CHGA 1RDBA 4CGFA 5C24A 5KFEA 3GIIA 2G8FA 2GBZA 1JXBA 4Y1CA 3S3OA 1EX4A 4ECTA 5DB7A 9ICUA 2Q0ZX 3DRSA 4FLYA 8ICAA 3T3FA 2AJQA 4JUZA 4NLKA 5KG7A 2UVUA 1K1SA 1L3UA 2C2EA 4TUPA 4N5SA 2O4GA 2BCVA 9ICNA 3OYIA 1HJRA 5KFFA 3QE9Y 3BQ0A 3QEAZ 4M3UA 4F91B 3RBDA 1XS9D 4UAZA 3ZSWA 4R8UB 1JLQA 1S6QA 1JL1A 2HNYA 3OYBA 3L2VA 3ASMA 4XA5A 3MR5A 4O4GA 3BQTA 1EP4A 2JZBA 4CESA 3RB3A 1QSLA 2JEFA 1DLOA 5KRTA 1G15A 3C1YA 1C0UA 3F9KA 3NGYA 4HVJA 1NOZA 2VANA 2C2RA 4O3SA 2NRZA 1QE1A 4QZ9A 2B6AA 1BGXT 4EBEA 1QSYA 2JEJA 5EU7A 4O9MA 2OZMA 2R8KA 4WE1A 3VN5A 2E6LA 3SUNA 4H4OA 4I28A 1QLNA 3ZSYA 3C5GA 3VQPA 1LW2A 4M45A 3ZT1A 2DPIA 4P2HA 4IQVA 7ICLA 4M6WB 2ZQBA 3RB6A 1HNIA 4MFCA 2IBKA 2AU0A 4H4MA 4DFPA 4R63A 1XHXA 2XY5A 1NJWA 2MUTB 4KLUA 3SI8A 3NGDA 1XWLA 3I8DA 4DOBA 4C8KA 3VQQA 1ZJMA 4E0DA 5KFDA 4CHPA 3G6YA 2AGQA 3HPHA 4CFBA 3DOLA 4PWDA 1XC9A 2LYHA 4CHOA 3DOKA 3QEPA 1RTJA 3ISNC 4LH5A 2C2DA 1HUZA 4CF1A 4GC7A 1UT5A 2BCUA 1KVBA 1CZBA 4UB4A 3V9WA 3KHGA 3K5MA 9ICFA 4I9QA 2XC9A 3FFIA 3ZDAA 3KHRA 4CEZA 2AGPA 4YQWA 4I2EA 1FK9A 3LALA 4F4KA 8ICIA 3MABA 5IIJA 4K8ZA 5CYMA 5IILA 5F9NA 4KLOA 3T5JA 3TI0A 3RBEA 4FJKA 3OY9A 1X9WA 3HM9A 4F3OA 1IKVA 3DLGA 4RQ1A 1FKOA 3T5HA 1DOQA 2KZMA 4ECUA 1F21A 2DFFA 3N97B 2RDJA 1RT1A 1S6PA 4IKFA 4YMNA 1RT5A 4B9TA 2AQ0A 4RQ6A 3CYMA 3GIJA 8ICHA 2NRVA 3LAKA 3C5FA 3NCIA 5HHHA 4AH9A 3C2LA 4K4GA 3ZT3A 2W9CA 3M9MB 4BWJA 7ICIA 1H38A 3MAQA 3TFSA 1C7YA 3NBPA 3C6TA 5IINA 3AUOA 3ALYA 3RMBA 4KO0A 4ED6A 8ICQA 2ALZA 1U47A 3PR5B 4UBBA 4M9LA 1KEJA 4PY5A 2HHWA 5HNKA 2IS3A 2FC0A 4DU4A 4YR2A 3K5NA 4F50A 5L1IA 9ICWA 4IFYA 4YNQA 3KLIA 2PFQA 4CK2A 4DL6A 9ICTA 2V9WA 5KFXA 4DTJA 3UPQA 3HP9A 3QNNA 3V72A 3V6KA 4KV8A 1HJPA 3ULDA 1SL1A 3ZT4A 1U9LA 3AU2A 4RW7A 5DQHA 3RAXA 1ZQKA 2AGOA 4FLWA 2ASDA 1LAVA 2RPIA 1B92A 4RZRA 3Q8KA 1ZQLA 8ICXA 2YNFA 4FJLA 4QZIA 3Q8MA 3H40A 2ATLA 1C1BA 1RT2A 4JV0A 3QNOA 5EWGA 4DG1A 4DF8A 3PR4A 1BIUA 1JXEA 2YNIA 3OYHA 5KFGA 1TK8A 3DYAA 4N47A 1S9GA 3AA2A 4L8RB 3TABA 3B6OA 5KFYA 1BCMA 1TGOA 2J6TA 4PGXA 1ZQUA 4DTOA 1NKEA 3OJUA 2HNDA 3KTQA 2P1JA 2NRXA 3HYFA 4DTXA 4ZH4A 1I3AA 2RF2A 4CEAA 1A5XA 7ICJA 3C95A 2FBXA 3V9XA 3PX0A 4MFBA 4CIEA 3GIMA 1CXUA 4P4OA 3UIQA 5FDLA 2XY7A 2JEIA 3UXOA 2A1RA 4MEXA 1TKZA 4KHWA 1A76A 1U45A 4RW4A 8ICUA 3K2PA 4J9RA 4F92B 2PFNA 7ICMA 1ASUA 3GV8B 5DQGA 4ELVA 1JX4A 4ECSA 3ZDBA 4DFMA 2HVHA 5F9LA 9ICXA 3JSMA 2NUBA 9ICRA 5KFLA 4F5NA 8ICCA 1IKWA 4B08A 1X2IA 3AVHA 5BOLA 3MECA 5DK5A 3JPRA 5KT3A 4Q8FA 4UB2A 3RJHA 4HHTA 4E1NA 3AVGA 4O3RA 2QKKA 1WAJA 3EPIA 4O0JA 3G0ZA 4FO6A 4KAZA 1UA1A 5EWFA 4B9VA 1L3VA 4DSIA 8ICYA 1RBUA 3KHHA 4CIFA 3JPOA 3TAEA 4KLFA 4F93B 1KCFA 1LWCA 4OLAA 2YNHA 1AROP 4FM2A 3SCXA 1MQ3A 4KKOA 2XGPA 1KFSA 1D5AA 3HVTA 4CK3A 4DS5A 1A5WA 4ED0A 1BPZA 2E6MA 3KLHA 1O1WA 1RTIA 1RPLA 3HO1A 4B9MA 4ZHRA 1GOBA 3ITHA 3E2EA 5JS2A 1ZBUA 4I2FA 1RBVA 2ZTCA 5KG2A 4R64A 3CFPA 5I3UA 4FK2A 7ICRA 2PYLA 3OYNA 3O3HA 4PHPA 1KTQA 2HB5A 3OYAA 3H8SA 1W9HA 2ZD1A 3M8RA 2BPGA 4M3TA 1C1CA 1WSIA 4YG2A 4KRFA 4ED1A 4RQ2A 4DF4A 5J2KA 4DL5A 3OS2A 5DG7A 4CJPA 1EXQA 2E4LA 4N41A 1NJZA 1JLAA 4FVMA 1ZQYA 2XCAA 1RDDA 3AA4A 1TKDA 4YMMA 4RPZA 4DFKA 5KG4A 2KW4A 3G6XA 2QXFA 1SUQA 4CJTA 4J9MA 3AA5X 2DFHA 4ED3A 1SL2A 2I5JA 9ICVA 2FPMA 1SZPA 1WLJA 1X9SA 1IM4A 3HJFA 1S1XA 4FLVA 5CY4A 4G3IA 8ICFA 4W5QA 3VQCA 4JLHA 4Z6DA 3NDKA 1BPDA 1VSFA 3SNNA 2LSNA 4LY7A 1XSLA 5J2NA 1Q9XA 5KT6A 5J2QA 4KITB 3KK3A 3OYCA 3G10A 1U04A 2FPKA 1CLQA 1NJYA 3NFAA 1CUKA 3M8QA 5KFIA 1X9MA 1B43A 2MAXA 2XY6A 2BDPA 3OJSA 2J6UA 5J0QA 4CK1A 4E7IA 3PV8A 4XQ8A 4FZXC 8ICVA 5CP2A 1NK0A 3MEEA 4QWEA 4YN4A 3JYTA 3KIOA 1UT8A 2B21A 3RH5A 4KHUA 4I2CA 4O5EA 4Z4CA 1IH7A 3WNHA 4RPXA 3TQ1A 1ZQPA 4QWCA 5SZTA 5DGAA 5J0YA 1WSFA 3OVNA 1K6YA 3PW0A 4J9KA 4TUQA 4FZYA 1BPYA 1HYVA 4W5TA 4R66A 3DLRA 4KLTA 3AVMA 4M3RA 2OA8A 4DU3A 3O3GA 3KKRA 2XRIA 2FBTA 4QZEA 3OYJA 3S3MA 4DSEA 1MSWD 3K5LA 1JLEA 4J9SA 2IHNA 4F3TA 4UAWA 1ZQDA 4B8CA 2KFZA 2F96A 4BWMA 3TAFA 1ITGA 1VK0A 3NH1A 1BPBA 4AHRA 3KD1E 3H08A 1FXXA 3GV5B 5KG6A 3M8PA 3RRGA 4CIGA 4QZCA 4FLTA 5KFAA 5KFOA 4ID1A 9ICGA 9ICCA 7ICQA 2ZUDA 3P5JA 2YHBA 1T3NA 5JS1A 1L5UA 3TARA 2BQUA 3RJEA 4Q44A 4I2PA 9ICLA 1S97A 1SL0A 4MFAA 4DSFA 4XIUA 3L8BA 4RU9A 1BI4A 3CM5A 4CF0A 3GDXA 3KKSA 4J9PA 3ZDCA 1RBRA 4KI4A 4B9NA 4DEZA 2BPCA 3MXJA 3L2QA 4E19A 4PHAA 4E7LA 5HBMA 3B6PA 2OPPA 4KN4A 4DSJA 3PNCA 1LWFA 1T8EA 4YVZA 4I29A 1WCLA 3CM6A 1X1PA 3OYLA 3V1RA 4RW8A
chains in the Genus database with same CATH superfamily
2VWKA 2BX6A 3U1LA 5DBAA 2ZJ5A 3I96A 1MWQA 3DXMB 4ZMMA 2V7YA 2AJ2A 3LH2S 5CCLA 3VCDA 3O1WA 5H9EJ 3BGUA 3RJKA 2G5HB 1RQNA 4OIXA 4KTZA 2CGLA 4I0WA 2DCLA 2W41A 1T3QA 2QSWA 4B3MJ 3C2PA 2APOA 1FEHA 2DR5A 2FMPA 2E9TA 1QQMA 4M3WA 3DLHA 4DV7K 5KFRA 3VQDA 2IM0A 3ZSOA 2X6NA 3DXSX 2B9WA 1N5WA 1REVB 5DQIA 3OYDA 3CULA 4CHNA 4AE5A 3VAJA 1FHTA 1HYSB 1NGDA 2DR8A 3MPUB 2ZDPA 2FHJD 3GB0A 3K0SA 1RWPB 3P3DA 4O8KA 2WB1C 4IJNA 5AICA 2Z2YB 3SQOP 1B9DA 5J0OA 3QJPA 4FW1A 1FJ7A 2NS1B 5U47A 3SQ4A 4AD6A 5D49A 1HW9A 5DB6A 4TYAA 2H9ZA 4CLFA 2F1JA 3U3YA 2AYBA 1YBUA 3T69A 4TUSA 4AHSA 3WT0A 3O3LA 3CTRA 2P9LA 5H1SQ 2ZNZA 2AQ4A 1O51A 4RBTA 1HI8A 4Y2QA 3PW7A 4OV1A 5CYQB 3QEXA 3FAHA 2BR0A 2JHEA 1HBUA 1Q8LA 3CCLN 1S1WA 5LOQA 3T19A 3JSRA 3IG8A 4FWQA 3CMAS 1FNOA 5D77A 1HHSA 3AB2B 3FJ2A 3RYLA 2XS7A 3IHQB 4RW9A 5DLFA 4OYOA 4PPZA 1RACB 2FY1A 3Q7BA 4DR3F 3AVLA 3W9JA 3RFAA 4PQUA 5DKWA 3C23A 5K4LA 4TY9A 2B9YA 4KN7A 1U0HA 3KLGA 4RLEA 5EHHA 2VFRA 5HROB 4Z0UA 3CIMA 5HP1A 3OSPA 3GFKB 2WFAA 1FERA 4Q0BA 5CH7B 4RQNA 5MLCV 2AT1B 2X3DA 4UZBA 2DPJA 2GVZB 5AFUH 1S72N 3MCPA 4CLPA 3G6VA 1KVAA 4DV6F 4M2YA 5HMYA 3EWGA 2AX1A 3KYLA 2MEWA 2FYXA 4W5NA 4Y1DA 3IDHA 3DDKA 4DN9A 4KLIA 2UVWA 3I0RB 3BEGB 1TL7B 2WAQC 2C28A 1JCGA 3TANA 4M3YA 1HI0P 4DV2K 3AY0A 1TP7A 5KPRA 2W25A 1P1LA 2HZVA 1Q46A 5J2FA 2C2OB 1RCXB 5A8RB 4WQ5A 3C6UB 4YOVA 5F8GA 5AKGA 3R97A 2HOFA 1UEUA 3MBYA 1Y5IB 3CJ3A 4OYIA 1BHLA 3QUBA 3P39A 1XNRF 2HIQA 3NOCA 3MGHA 4XEIA 1FKPB 3C21A 1B3TA 4ZIVA 4ED8A 2MUTA 4ZN1A 1FJGF 2ITMA 4CGGA 1KHWA 1U2FA 4OHWA 3G82B 3L3FX 4DHVA 3IS9A 1U26A 4LQ9A 2ZHAA 1A77A 1HBOB 5C10A 4RQ0A 1K44A 3O8WA 1TL3B 2CNKB 4K7QA 4H0VB 2VJ4A 4IQWA 4PAAA 4CZLA 3UE2A 1SV4A 2GFFA 2RSQA 3UXNA 4I2IA 4KHQA 1LWCB 3RW6A 5F8JA 5TZVA 5HN0A 3BYPA 4JI8K 2E88A 2CPDA 1V38A 2ASJA 1LQ9A 2DGTA 3ZYYX 1RTDB 4BRCA 2F77X 3IM1A 1EETA 4H0XB 2KG1A 2OEKA 2GQ2A 1YI2N 3MURP 3HJVA 4ZJOA 4NASA 4OJ3A 4ISGA 4O5KA 2ZM6F 5C2GA 2BKEA 3M30B 3ENAA 2NSCA 3V9SA 2ZJQL 3T9NA 2ZJRL 1FFUA 3Q23A 3KD5E 2AMCB 3UQ0A 4D3HA 3ID6A 3HZ6A 1KW4A 3CJCA 4AYBF 4O3QA 2A0FB 5AQPA 3V7KA 2EXUA 2HOIA 5LM7E 1R0AA 2FJXA 1CZAN 4F5RA 4RNOA 3HSDA 1WN7A 5M1FA 3AM9A 3PRBA 5AJ3K 4YOWA 2O4IA 4HUGA 3WNGA 1X4AA 2Z1GA 5E84A 2X6SA 4MF2A 4KJIA 4EYIB 4KLMA 3LP2A 4CJ5A 4FWKA 3JPPA 2J0XA 3SMZA 3V9ZA 4AQYK 4DU1A 2ZTEA 3R5GA 3W5ZA 1N8RO 4Y2PA 2QLJB 3GIKA 2E5LJ 2ES6A 2DNQA 2RHSB 4PRFA 1BWFO 1U8SA 4FJGA 4JI4F 3THYB 2G0JA 3ED5A 4OPJA 3MM7A 2Q66A 4B1ZA 4RNNA 3H7IA 2R7TA 1T7PA 1LB2B 1JLGA 2VV5A 1RHKB 3CT9A 1KLMA 4I7FA 3UN3A 4B3RK 4OJLA 3RH6A 1Q9YA 3PO4A 4U8VA 5D0EA 3W3SA 3D68A 1TVAA 3JXUA 3BSAA 3CCUS 3B8HA 2UVVA 2FJVA 5HJYA 5SWMA 4ZP8A 5K8NA 4I2BA 1N63A 4DV5J 2CH6A 3W2WA 1WD6A 1VRUB 2BJEA 4YS2A 1HNWJ 3WQTA 1R31A 3LPYA 3OHRA 1OY9A 2DNKA 3GZ7A 3E66A 2GVDA 3EL2A 3O08A 1F60B 4HTLA 2MQOA 3N9UC 8ICEA 2QIFA 1M1KT 1SC3B 4A8XA 2HF3A 2DHHA 1F9FA 3TZYA 3MCNA 4DZ6A 1YTAA 1VRTB 2B7CB 2F8EX 1N5QA 3BREA 1KOHA 2CA9A 3EO3A 3H5XA 1NH7A 4K4UA 4NV0A 5LXRA 3MD3A 4DR1J 1HQ2A 1OYEA 1EIYB 1RZTA 2YPYA 2ZTDA 3GIRA 4P4PA 1KC8O 4DN0A 2ZJAA 2HVZA 4ES1A 1S10A 2ASLA 2KKHA 3DLEA 3L2RA 4NXZA 4EHTA 3CP8A 2LEPA 2QKBA 3J7YP 3UD3P 3B9JA 3C65A 1I39A 4WCEQ 4E7HA 2DY4A 2OEJA 1S5JA 1CJKB 1BDGA 1HA1A 2K89A 5JXSA 1V9PA 1L7PA 4IWVA 3PYDA 2ZE2A 4X4PA 5FPDA 3BF3A 2RILA 3RR7A 4UB1A 1CC7A 2YTUA 5E26A 4MN4C 3VAHA 2BGWA 2ZBPA 2G08A 8ICBA 5HRPA 2WVBA 2I7NA 3QEVA 4K50A 3A3OB 4OI0A 2W3RA 5HO4A 2BPFA 4DR7K 4J9OA 3HXMA 1S1VA 1FD8A 2BH1A 2QWQA 3QERA 1FWKA 1HQUA 2K4EA 3KG0A 4P72A 4RO0A 5C24B 4M5IA 1SC4B 2CQGA 2G2ZA 1BISA 3PW4A 1GLAG 3GSIA 1D09B 1ZQJA 4ES2A 2HFOA 1N32J 2DGOA 3DRSB 3QNWB 1TKTA 3PM9A 4KLSA 2PAVA 3O9QA 1AFJA 3FSIA 3RJGA 2CN1A 4JI2F 2IDLA 2ASMA 5CWRA 1HIYA 2XG8A 1MN8A 1RNHA 1Y5NB 1ZQNA 5ADXA 5IIKA 1L7NA 4WZMA 3Q8SB 4HTUA 2DO4A 1TL1A 4KHYA 4PGQA 1QQ7A 2W8KA 5DMRA 4CWBA 5J2AA 2QLFB 1RGIA 1FO1A 2CQPA 4HACA 1UP1A 4P4MA 2G8HA 1EX8A 1ZQGA 1UVMA 4M94A 3NF7A 4ECQA 1NJXA 1WEXA 2EZYA 3KLVA 3OSNA 2CG8A 3MX2A 3L3UA 3QT5A 2R2RA 1BE4A 1RB0A 2VQEF 1RWUA 2BUNA 2E5GA 2KYZA 5IC4B 4OX9J 4WE1B 1FRJA 4N76A 3CJ0A 9ICJA 1YG0A 2DCUB 3MWTA 1F2HA 2OAUA 2D69A 1WG1A 1RWWB 3NNCA 2KP7A 2BABA 1HNIB 1M5OC 1VC0A 2ZBRA 2UUCJ 2Q6CA 4I2JA 5KT5A 1S57A 1SJFA 2VODA 3H8YA 4EX6A 4Q5VA 1DGJA 3LGMA 4DV4K 1URRA 4PPXA 3FBEA 3C66A 2BCRA 3BPSP 4K5RA 4LSLA 1YKWA 5ALIA 1HR0J 2V0NA 3SQGA 3KKAA 4DO9A 3FBCA 2POKA 4JI1J 1PO6A 3W65A 1RTJB 2P5GA 2Y0BB 1HKCA 4KPCA 2R8IA 3KJNB 2R2SA 1WF0A 1LEOA 2KFNA 1UL3A 2RE2A 1WHWA 3ET6A 2UVRA 3Q8RB 4GKJJ 4BC4A 4F25A 3KG4A 4JI5F 1BA0A 3WQPA 4K4TA 2W2PP 1WTBA 2AHOB 5M1OA 2LHTA 8RUCA 1RBLA 3RBXA 2D0PA 2JEGA 3VTIA 3C46A 4CP5A 4K59A 2W7PA 2VICA 3G6EN 4J2BA 5IOLA 1SKUB 2B5JA 1FKOB 4O23A 4YB6A 1NGIA 4KLQA 1L8LA 3M6WA 2IOFA 1S1UB 4HCCA 3CF5Q 4BACA 4DX6A 8AT1B 3EWAA 3J7A1 2E2OA 5F0UA 2Q4TA 1GK8A 1Z25A 3HHEA 4XRHA 3TVYA 3ZCMA 2CQDA 3FGVA 3ILIA 4UOGA 4WQ5C 4JV1A 4PYAA 4E89A 4FM0A 4UARA 1HW8A 3PSFA 4KO0B 1SV5B 3NCRA 1RABB 3E9LA 2XIDA 2CJBA 2DEJA 1NB7A 5DDMA 1ZQOA 1CZ9A 2LI6A 3KLIB 1J5EJ 4USUA 1R8PA 2E1AA 5D15A 4FFDA 4IRCA 3FE1A 1TAUA 4DQIA 1NJIO 4DR5J 4E98A 2FC9A 2JH3A 4KH6A 2AP1A 1D8LA 3MN6A 4KV8B 5JVGQ 3QXGA 1SZHA 2YKNA 1SXLA 3L95X 3DI6A 3H5YA 5M1KA 4CQ1A 2EH9A 1ZBHA 4FPAA 4O44A 1E6YA 3F2KA 3AVCA 1F5SA 3ATUA 5AQMA 5DO2A 3PX4A 1RTHA 3CG7A 1WUDA 2W43A 1YITS 2Z1JA 4RWWA 1BVSA 1ZAWA 4F5PA 2MY7A 5DG9A 2QEXN 2IHR1 1RT2B 5HQ8A 5AQWA 4IO9Q 1KVKA 4J90A 5E5NA 2V4RA 3KLEA 2CPJA 1NKCA 2QA4S 1RWMB 2YNIB 1U1OA 4ZLJA 3QBXA 1NGCA 3LOUA 3BY5A 2PBDA 1S9GB 3L5KA 2BQ3A 4YOXA 2LVWA 2XHCA 1LVHA 3TU5A 2IM3A 3DCAA 4IQXA 5J8YA 5KFNA 2G07A 4JRQA 2F63A 2HNDB 3RAQA 4NL5A 3JQMA 3LPTA 3DXMA 2D5RA 2DKZA 1Q7LB 3BSOA 2RF2B 2EK6A 2O8FB 1IBCB 3I28A 1OSCA 2CVEA 4I68A 4JS5A 2UUBF 2CQ2A 2ZJPQ 2EZZA 1CJVB 1Z1BA 2R2TA 4FE3A 1Z6RA 4FWNA 5KG1A 4RW4B 4NJ8A 1YHQS 1N8RT 4DWIA 4O55A 2VHGA 3JSMB 3CC7S 1ZQBA 4M9JA 3TZXA 1REVA 5EX3A 3TFRA 3J7YI 1DARA 5GAHP 1NUEA 3L2WA 5HOOA 4GVMA 1HYSA 4DV1J 3NF8A 3H8JA 2WSFC 2IHMA 5A0LA 3PZPA 1ZQZA 4W90B 2VA3A 1MQ2A 4B9LA 4FK4A 4MQ3A 2YKMB 3M8ZA 2XLKA 5KQDA 2HLUA 3QGIA 3NGZA 4JKEA 2RNEA 2J7WA 4NXMF 4FJMA 2DD8S 3BDPA 4FJJA 2IVOA 1NGHA 4J9UE 1GOCA 1FA0A 1HEKA 3BF4A 4WJBA 2CJQA 4Q45A 4US8A 2AEFA 4BR7A 2YHAA 1IXRA 3VQ9A 2XWXA 4ZDNA 5CYQA 1RWNB 4JAXA 2L9WA 4AHVA 2DXDA 3PY8A 2PI5A 2FHOB 4P2XA 2W4DA 4RWXA 9ICMA 1AZSB 3BKFA 3ZDEA 2ZIWB 3CJQA 5AQKA 3QESA 4QZBA 1AQ6A 3OVSA 4ZPDA 3CJ7A 1PVRA 4IQMA 4LF5K 5J29A 3MUVP 2W24A 4QJVA 1B4SA 5KFBA 4OVLA 3RJJA 4CO2A 2FMQA 4M3ZA 3FBBA 1HBMB 1KC8T 2UXBJ 4UUWA 1TU0B 1KVCA 1G7CB 3IBFB 2XMJA 4ANCA 5HROA 4HDHA 1OWXA 3TZZA 1HI1A 4NLRA 3UI3A 5J2IA 4ZVEA 2FJWA 4HH0A 1I6JA 4BE2A 3TVZA 2GVZA 1L3TA 2BW2A 1F44A 2WHEA 5D0RA 1HBNB 2ACYA 3Q8QB 4LRCA 3DDNA 4G1QB 3ZT2A 8ICLA 4LF7K 2OMLA 3FZMA 1XN9A 2VCPA 3WU2U 2QWRA 1YTYA 1FRLA 3K58A 2MU2A 3I0RA 1Q7YO 1TL7A 4JKGB 2V69A 1BD6A 3HFZB 2G1DA 1GLFO 1QTMA 4K4XA 3QUQA 5A8RA 3C6UA 1OQ6A 1QQCA 2BACA 1P7DA 4NL9A 2P6UA 2RHFA 1WELA 2HEKA 5AM3A 2XMVA 5J2NB 5ALDA 2NLWA 3NWRA 1NSAA 5J0TA 1A5VA 3CXCM 2Y1JA 1FKPA 4CFAA 8ICTA 2IFXA 3I76A 2XO7A 2ZUAA 1KWMA 4H5VA 4FZNA 4JK8A 5CA7A 2V2KA 5D4OA 5H9EK 1RLCL 2LQJA 2F8KA 2DT9A 2WC9A 5BN9A 1HBOA 4PHTX 1TL3A 4KLHA 2F7TA 4B3MK 3A8IA 4PL2A 1MWYA 5BYRA 1E4FT 5GAGU 4DFJA 1WSGA 5CEHA 8ICWA 3UKRA 1RTDA 3C2MA 1HNZK 4QZAA 1S0VA 4BROA 2OTJN 5DJBA 2BKPA 2VDIA 3THVA 3ZSZA 2Y0SD 3CCVN 3CD6S 4CEQA 3MMBB 4DPXA 1YF5L 3GU3A 4OGCA 1D1UA 5AQHA 2G8VA 4V1Ak 7ICNA 3M30A 1FKAF 3GFYA 3KUHA 1IVZA 4I2HA 1P1TA 5HMMA 3D54A 5F41A 3QMQA 3U02A 3QU5A 1VSMA 3SDEB 1SKSA 3R7BB 5M1PA 1IIPA 2AJFE 2XHBA 1H74A 1RAJA 3RU0A 2WF9A 1U1NA 2W2NP 2O6KA 5J2PB 3CQ8A 5B0FA 4K4VA 1WBBA 1SQEA 2B8QA 3M8PB 1U2VB 4X65K 3KKAC 1KRPA 4HHJA 2ADCA 3AQFA 5IIOA 2B9XA 2BQRA 4Q7AA 3UQ2A 3FRYA 5AFUA 3FEYB 1JXVA 2E8OA 2DITA 3QLHA 2M52A 4UATA 3GG0A 1BI4B 1YJ7A 4C3MA 4CTAB 4LF6J 1GLCG 4Z4GA 2KB2A 2MZ1A 5BR8K 2HWTA 3THYA 2H4WB 3K9JA 3FLCO 3VGVA 4CDGA 4NLBA 3R1LA 3J81j 1DURA 4EGLA 3QFHA 3PSIA 2X1AA 1LWFB 2J6SA 1O13A 1WKLA 2W7OA 4DTSA 2XS5A 2BYCA 1X31C 3O6WA 4XPCA 4LREA 4FF1A 2Q0RA 4BRGA 4K8RA 3M5RA 2VQFF 4FOIA 1N0UA 2I2YA 4A8SA 2HMXA 4X64F 1J53A 3JSBA 1Z26A 4OZ3A 3OR2B 1VRUA 4KLGA 4GXKA 2H5XA 3AVBA 1T02A 4MF8A 2B4JA 2BJ3A 1BNPA 3LP3A 2ZEJA 5I3PA 9ICHA 4MLEA 4ELUA 1VJQA 1VRTA 1U48A 2R7YA 2IMWP 1ZQ1C 1RYRA 3NY0A 1XNQK 1QQ6A 3PHTA 2HURA 4CGHA 4NE9C 3SZ2A 5KPZA 1Q82O 1BIZA 3H25A 1FF2A 2VG5B 5AK3A 1NJIT 3VAMA 2M9NA 2EHGA 2F4FA 1CJKA 3C7NB 5KGXA 3W7BA 3PJWA 5GAHI 1JN3A 3ZLJA 3MPWA 2H4YB 5HMLA 4WYWA 4LFCJ 4YCXA 3MGIA 3S9HA 4RG8A 1UZDA 1NI3A 4PZOA 1VQ8N 4J2AA 1WOPA 3UW1A 4KLJA 2CH5A 2UUAK 3SPZA 4C8LA 3SQ0A 4Z37A 3BUZB 1KVJA 5JJBA 1IV0A 4O5FA 2F40A 5C24A 3H8MA 4Y2XA 2G8FA 4C97A 3VC8A 2ZF5O 2CJXB 5ETKA 3DRSA 1FFSB 1WC3A 2QZ8A 8ICAA 5AI4A 4FLYA 2AJQA 4LUBA 3CJ2A 2P9PB 5LXYA 2UVUA 4FL9A 3OLBA 4C4SA 4N5SA 3CIPA 2NV3A 5J8YC 3OYIA 1J2NA 3K8VA 1QM9A 2MKJA 4F91B 3RBDA 1HWIA 2HAIA 1YVFA 3HKWA 5THWA 3O5TB 4DPUA 3VAFA 1S6QA 2HNYA 3ALRA 4AYBD 4LF8F 1RT7B 4O4GA 4CLSA 4I6MB 3IRXB 5KRTA 4FXWA 3GONA 3H0PA 2E5LK 2HGNA 3DNCA 3F9KA 5F3TA 3NGYA 4HVJA 1HQEB 4W92B 2C2RA 3CMEN 2NRZA 2FZGB 3SEIA 1DTTB 3DM2B 2YI1A 2IY5B 3HILA 5G5HA 1JROA 3QIPB 3THWB 4UTGA 2V2VA 4P10A 2RP5A 4O9MA 1RHMB 1X4GA 4M5DB 2OZMA 4WE1A 3EGVA 4UF4A 1XTZA 5L39A 1S72S 4ZPWR 2QARB 1XQIA 3VQPA 1TAMA 1ZRNA 4M45A 4P2HA 7ICLA 4M6WB 3ZETB 5DDOC 2Y8YA 3RB6A 4L75A 2XMMA 1HNIA 4MFCA 1IM6A 1TQLA 1S6UA 2Z30B 4FPBA 4R63A 1ZS6A 3BV8A 3GU0A 3NGDA 2JWLA 4JI3K 3I8DA 1UFWA 2A10A 1HNWK 4DOBA 4B02A 1LWEB 3HPHA 4GKKF 3MR7A 4DUZF 2UXCF 3QEPA 1RTJA 1PKUA 3BZQA 5C2CA 4NLSA 5IS2A 3MMAB 1EWRA 1UT5A 2CDQA 1KVBA 4UB4A 3QIDA 4LRFA 4OFZA 3HOTA 1YWXA 3AAPA 4DR1K 1MU2B 4CEZA 5L9NA 3LALA 1WI8A 2CUYA 1SQKA 1SIJA 3PIOL 5IILA 3ZTQA 5F9NA 2G09A 2CGJA 1ZTWA 1XR5A 2JGAA 3B82A 1X9WA 3IUCA 4F3OA 4MIAA 3KZBA 1FKOA 2NZTA 4WFAQ 4CT8A 5AKLA 5EXWA 1VQON 2DFFA 4LR9A 3V4IB 2CXYA 2LKYA 2KMDA 4MK8A 4NLDA 3CYMA 1Q7YT 3NS6A 3N0VA 1Y4ZB 2MKHA 3JAMO 3NCIA 2L41A 3C2LA 3D6FB 1VQNS 4K4GA 3ZT3A 3SIPB 2D1KA 3VVUA 3CDUA 3MAQA 1H38A 5AZJB 4GVBB 3AUOA 2PDAA 4KO0A 1N32K 4NL9C 8ICQA 1RFQA 2R7XA 1S49A 1U47A 3PR5B 4UBBA 2HHWA 2HOQA 4NYPA 4DU4A 1NNDA 2XYGB 3WC2A 3V2UC 3TUPA 3KLIA 2CJAA 9ICTA 2B56A 4OZLA 2IIRA 2V9WA 2RRBA 4DTJA 3UPQA 1P9YA 3UQSA 1GXLA 3HP9A 3QNNA 3Q89A 2E9ZA 3V72A 3IBCB 5C2DA 4KV8A 1HJPA 3VAGA 4IEIA 2GGPB 3ULDA 2B9EA 3EE8A 4DV3F 1EQ0A 3ZT4A 2DISA 2E5HA 3A5LC 3V81B 1ZQKA 4GV6A 4C6AA 4FLWA 4IUFA 1CQMA 2E8AA 3SBTA 2HWHA 4DV6J 2A3JA 2YB1A 4IH7A 2P2CB 3H40A 2P9CA 3BS5A 1C1BA 1RT2A 1S1TB 4OX9K 1Q3VA 4FVUA 4DF8A 5C42B 2UU9K 3PR4A 3CDAA 2DR6A 5IWAJ 1CJTB 3SBMA 1JXEA 2YNIA 5IM0B 3OYHA 1FIQA 3UCZP 1TK8A 3BKTA 3DYAA 3D4JA 1S9GA 3AA2A 3RBZA 5AK4A 1YZ7A 1ZBTA 2UUCK 3H3NO 2UUWA 4K2JA 2QA2A 2HNDA 2G0IA 2NRXA 3TUZC 3Q7CA 1UVIA 3G8SA 4DTXA 1KQSM 1HR0K 2RF2A 4A5BA 5HK4A 2FBXA 5JMVA 1SJ4P 2J8SA 4JI1K 1CXUA 2JEIA 1CJVA 4MEXA 1TUVA 2LEAA 5KAIU 2BJ1A 4TN2A 4YB5A 3WK4A 4RW4A 3K2PA 3MCAB 4F92B 1HNXF 3GV8B 1GXUA 2ZZNA 1N34F 1H2VZ 4ECSA 3ZDBA 2VJVA 3AOBA 2HVHA 4OJ1A 3JSMA 2NUBA 1K8AO 2BRKA 2RQ4A 9ICRA 4GKJK 8ICCA 2AYGA 1X2IA 5IV3A 4L3KA 2AEMA 2ZH3A 1GLJO 2QKKA 3EPIA 2Z58B 3OTOK 4FO6A 3NG8A 2VU5A 1BQNB 2ZM6J 2NNWA 2MSSA 4L3QA 2M3DA 3P5TL 1UVJA 1VQ5N 5EE3A 4BRKA 2FVRA 1VR6A 4KLFA 2W54A 4BR4A 1KCFA 1GMUA 4I56A 4OLAA 1JJ4A 3OTCA 2GMLA 3SCXA 1MQ3A 3UFCX 1JLFB 4CYUA 1D5AA 2JSXA 2ZIWA 2VG7B 3ITHA 1BWEA 2VOOA 4TLQA 3DV9A 5IFMA 1RBVA 2ZTCA 1Q95G 3CFPA 1VJWA 4FK2A 4FWOA 2HHHK 4AYBC 3QX7A 1T9VA 2HB5A 2MSNA 1W9HA 1HBMA 1YRXA 2W40A 4NEZA 4PXCA 1J5EK 3CJTA 1Q82T 2BPGA 4M3TA 4DR5K 3J7Z5 2HBYB 4JI0F 3I56S 2RD5C 4DF4A 1XMBA 4WFNL 4EIAA 1DK2A 3D7SB 1WOOA 3NVKA 4CJPA 3G4SN 2JH7A 1HBNA 4LR7A 2HSTA 3AA4A 1TKDA 4NI2B 3BSCA 3G6XA 2UXDJ 1YJTA 3W63A 2IBOA 4CJTA 4J9MA 3MCOA 5F1XA 1YJNN 4ED3A 1SL2A 1BMQB 2RQMA 9ICVA 3PRDA 1WLJA 1TUGB 1IM4A 3T41A 1G99A 2MQLA 5CY4A 1RAEB 3Q2SC 3P31A 3ISZA 1VYAA 1ZZFA 3GMGA 1VSFA 2ZG6A 2DNHA 1X66A 1WHXA 4LY7A 3KXDA 2DGXA 1U6BA 5J2NA 2PEBA 4ZLNA 2DO0A 1NG9A 2CPEA 1KKXA 1U1QA 4ILJA 4FXVA 3N4QA 1CUKA 5KFIA 3ELHA 2MAXA 4W4MA 5ALSA 1M90O 1FRXA 3SR6A 3J80O 3CJ5A 3DXBA 3OJSA 4HH1A 1SC1B 3CJBA 4ANEA 4ICLB 3N7SC 1OO0B 2DGVA 2CQ4A 3BR8A 4C11B 1WG5A 3KIOA 2BTFA 2WVFA 2B21A 3RH5A 5CZVA 3SMSA 3O9UA 2DR7A 4I2CA 1VQ6S 3W2VB 5G5GA 4C1NI 3PKMA 5IT0A 3WNHA 4B3OB 3TQ1A 3L09A 1Q5VA 3HHLD 1N54B 1UZHA 2VFVA 3WXIA 2VGMA 2DNLA 3MMBA 3G71N 1Q8KA 4J9KA 4TUQA 1C0UB 2K4IA 1BPYA 1UJ6A 4FZYA 4W5TA 5LMUF 4R66A 3O5BA 3DLRA 2OA8A 2M70A 4MH8A 1ZC6A 1YJWS 3SDEA 1GTHA 1DQAA 1PIEA 2WW8A 3K5LA 2VC0A 1NLKL 3AD9C 2Q1NA 4J9SA 1DRZA 4L76A 5AQZA 4B8CA 1IN0A 3ONNA 1OH7A 2XO6A 3TAFA 1VK0A 3NH1A 1RHJB 2K4HA 5D0HA 2PMHA 2IRYA 3M8PA 4A5AA 3EUNA 4FLTA 1WTFA 1U2VA 1F6TA 1PC4A 4ID1A 3C14B 7ICQA 2ZUDA 1TTHB 3IAS9 1UHUA 5AKXA 1HWLA 2M7SA 3UN2A 4ZPBA 4FZVA 3EM1A 3CDEA 4OYPA 4NMXA 1BI4A 4CTAA 3CM5A 3DOKB 2I6XA 2QN6B 3ZDCA 4Z94A 1K73O 4KI4A 2UXBK 3L2QA 2HRTA 1G1XA 4E19A 4PHAA 2JRZA 3GOIA 2M0GB 2H3EB 2K2PA 1PYTA 4LRAA 2E7VA 2HQCA 4UY8O 3B6PA 1F5BA 2ZIXB 4KN4A 4DSJA 1GEHA 3AJ1A 3PNCA 1LWFA 5A8WB 3P4IA 3HDSA 5F0XA 2LFVA 1D9AA 2Q43A 3OYLA 4ED4A 5CYMB 1N2XA 1S0NA 5D4BA 4A8YA 2DPNA 3AGRA 2G4BA 4A2BA 3KFWX 1UETA 4CZJA 4DV0F 5J2DA 2XZDB 3FUYA 1IKVB 1RYSA 4OZNA 5LY3A 3J7YU 4C8OA 2V8DA 3TKAA 2WRMA 1FXLA 3RVCA 5KFZA 3V6HA 2H54B 1IBMJ 2RN2A 1RT5B 2O8DB 2KM8B 3L3VA 4NLPA 4M7XA 4UOFA 2R7WA 4M5HA 1VAZA 1GAOA 2HI0A 1JLCB 2DH8A 1BY9A 3ZNJ1 2CG4A 4JHDA 2DGQA 3QIOA 3RJFA 3QFWA 3LP0B 4M5GA 4B3SJ 4KT0C 3NBPB 4URGA 2FJDB 3CCQN 4XTTA 3DGPA 3VENA 2VG5A 3QO9B 2IC3B 4JI5J 2XI9A 3MR2A 2DEIA 2ZKUA 1TL5A 4OPKA 4DHYA 5HLFB 2YBVA 1JB0C 3QFUA 4DSLA 3ZZZA 1WSEA 2QK9A 4FZZA 3BGRB 3MD1A 3C7NA 2X1FA 4AL7A 2NRWA 3QNMA 7ICFA 3W5XA 3JB9k 4LMZA 1S0OA 1QVGM 4OYZA 2D0CA 3BH6B 3ENQA 4J9LA 3QSIA 3L9ZA 3U1NA 3AN1A 2RRNA 2KKVA 1RT3A 1JMSA 3C29A 1JI7A 2NYIA 3VQSA 2NZ4A 2AP6A 1QDUB 3H5UA 4DR6K 3QUCA 3AO3A 4BRQA 4LR8A 1TFYA 1XNSA 4MKBA 5GIOA 4CF2A 2XCPA 2R7VA 2XMUA 4P75A 2FPHX 4X4OA 5B0BA 4DQQA 4H5RA 1RA6A 3KLFB 4JWMA 4DUTA 4FWSA 1Q81O 3NNHA 4CI6A 4WF9L 5L1MA 3OYGA 3K17A 1KFDA 4HUEA 2I1QA 4DR4F 2E8NA 3EW9A 1VQYA 2QWLA 2MQQA 3L4QA 4J03A 2Z57B 3KNGA 1RU1A 1RT7A 3JTNA 4RT3A 4I6MA 4FKYA 1V4TA 3ZFVA 1C20A 3OYFA 1QCKA 2ROEA 4LF9J 4ZVTB 1VDVA 4Z7CA 1VQPS 3D2FB 4YHHK 1HQEA 3FYHA 2AEJA 1I94K 2VFSA 4ZOSA 1K8AT 3NMRA 2O01C 3MFIA 1DTTA 3DM2A 4AUKA 2NREA 4LFBF 4A8FA 2QA1A 2WOMB 3QIPA 3THWA 3PSPA 1U24A 2Y1RI 2GWSA 3N4WA 2ZGYA 2IOFK 1N88A 4P0QB 3UMGA 4OJ6A 4BX9C 4PKGA 1ZOLA 4Q43A 5E33A 2HSZA 1VMBA 4U7UK 5K9FA 7ICUA 3N6NA 2JV3A 4QS9A 3P5BP 4CZIA 4M5KA 4ZA1A 2KZ3A 2QGFB 5AI6A 3V1QA 2HBRB 2G5IB 3QINA 1RT4B 4CEBA 1LWEA 4A46A 2F2AB 4ISEA 1D8ZA 4IOBA 4UOCA 1I1GA 1PVQA 1KTVA 2W03A 2YNGB 5D0GA 5AM1A 4BC2A 1ACMB 3ZX2A 3HFKA 4Q2LA 1VHFA 1YK9A 4HT5A 3MMAA 2UUBJ 1L3KA 1DRGA 3WK8A 3DN9A 3HPOA 1GXTA 1MU2A 1RTIB 3FZBA 4M0AA 4FNHA 2ZJQQ 2GIFA 1HLWA 2E5SA 4FCYA 5I3UB 5AQUA 5BPLA 9ICKA 1QY7A 2J9DA 1ASWA 2FTRA 2XULA 5DBCA 4PUOB 3G2XA 4J5OA 3ZSVA 2ABYA 2WONB 4WFYA 2HFUA 9ICSA 2OTJS 2HZCA 4LFAF 2J0SD 3CCVS 4JYAF 4FJXA 2JX2A 1F5CA 1P27B 3SV3A 1T05B 5KFHA 1FDDA 1HUOA 3ULHA 4NXMJ 3DMJA 4ETZA 2VFUA 4JI6F 2KI2A 1VSDA 9ICAA 4YFUA 1WSHA 3NAEA 2G8WA 1JLAB 4U67L 2ACMA 4KYZA 3OW2M 3G8QA 3CCRN 3NF6A 4OJPA 2J7KA 1X8DA 4WQ4A 4R79A 1U1PA 3CCSN 2C2MB 5AZJA 4UQGA 1A0OB 2J0WA 4NCGB 2GWKA 1N5VA 3WKCA 4A8QA 3I6PA 2V67A 2V94A 4LF4F 1OYDA 3H45C 4C4RA 4K4IA 1XMOF 3W0LA 3VGLA 5DDQC 2PXIA 2HYIB 1M90T 2JLFA 2A1AA 2IDEA 1N6QB 1ZYQA 1N62A 1C0TB 3NVMA 3PIPL 4U7CA 3QRRA 2RUSA 3PLAA 2GGPA 2D0AA 3N01A 1FX4A 3PYEA 3DLLQ 2YQ3A 3M2VB 1KDNA 2F9DA 2EBEA 3M6KA 4YR0A 3U26A 4W98A 2H1YA 1HNVA 4I27A 3M8SA 2AIRB 3QGGA 4C8NA 1NMEB 4F04B 1S1TA 1PILA 3QEIA 1TAQA 5A2QY 1IBLK 3PFOA 4QIEA 7FD1A 3ETLA 2L9DA 3IM8A 1VK3A 1CJTA 4YXMA 3L6QA 5AI8A 4NWIA 5IM0A 4BQLA 4ZN3A 4FBTA 1WHYA 2LA4A 3AO2A 2F4VK 3RF9A 5BPCA 2QL5B 2OYYA 3RTVA 4IDKA 4CO4A 1CC8A 2OMOA 2KRBA 4USMA 2H3GX 1KBRA 5GTIU 1R8AA 2WK4A 4LBHA 5AQRA 4H5TA 1WUAA 4ID5B 1DHMA 4H03B 2Z7JA 1JKHB 4FYXB 2AYEA 1QVFR 5GADP 5EX5A 3CO9A 2KL8A 2LU1A 2DNNA 4NA2A 5CE3A 1NGEA 2YHWA 1MWZA 2ZOMA 2DL0A 5F8MA 5KOWA 1NBWA 1BUXA 4FZMA 1J5OB 2KVIA 3T7ZA 2FHKA 4QIGA 4CNZA 4K5SA 3HP6A 3BS7A 3KBBA 3M1FA 2Q3SA 1A6LA 2OXOA 4NM1A 3EICA 4JI7F 1K73T 2JR5A 1X4FA 4YEAA 4ED5A 3VEXA 4CJ7A 4OYAA 1C6VA 3M6UA 2HBMA 3M9NB 4ENOA 3LL3A 4UY8T 3SBGA 4FF2A 4DOAA 3AJDA 4DV2J 1QHAA 4QW8A 4WU3A 2LECA 1VISA 2F1HA 1RDCA 3BBFA 4BC9A 1B64A 1UPPA 3FC4A 5D78A 4DTRA 2KHCA 3TTFA 3CNHA 1B0XA 5K8OA 4NB4A 3O1LA 2A41A 3A0HU 1X0PA 5LMNF 2HHSA 1JLFA 2E7WA 3MF5A 3VAKA 3RMCA 4FLXA 3J7AP 4CJ3A 2VG7A 2OFGX 4MIWA 1W97L 1WC6A 4FLZA 1DLOB 4DQPA 4Y2CA 1ZA2B 5J2CA 3IKMA 2OD6A 2VDHA 3FEXB 3GILA 2FXUA 1KQQA 1FRIA 1LKZA 4JI8J 4A59A 4DR3K 2O66A 3LDSA 2EWHA 4PGYA 4MO4A 3V7JA 4NEYA 4DPOA 5E3RA 4DPYA 4M5MA 4IQTA 5CZ2A 3M1VB 3B0XA 3MX5A 1IG8A 4Q8EA 2GUPA 4ZLPA 2HFSA 2HW3A 3CMES 1IG6A 1KFTA 5D6GA 2VF3A 3I33A 1UPMB 3M4XA 4YR3A 1QAYA 4GY2B 1R8HA 5AQXA 2BKOA 5AKHA 4EEKA 2FJBB 5DB9A 4YY3F 2JH1A 4DV6K 2FSJA 4K4YA 2JLGA 2QSFA 1XMQF 2ZC4A 2R7UA 1R8BA 3R8EA 3FZKA 3VQBA 1QQNA 3IG1A 1N4LA 4AHUA 2P9LB 2KJ5A 4OHVA 1LK5A 5C15A 4ZP9A 2R7OA 5AJ3J 3I55N 3QSYB 2LYBA 2GMHA 4ZK7M 1R59O 4GO7X 1CXQA 1C0MA 4QR2A 1RU2A 2GJIA 4AQYJ 1Q81T 1XNRK 1M0SA 1Z2ZA 2CAJA 1U1MA 3U3GA 3V5RA 2VWJA 2EKYA 1RKJA 4UB6U 4ICLA 4PQUB 3DAWA 1ZQWA 1FJGK 2GEMA 5AXLA 3W64A 3GG4A 3QZ8A 2AKWB 2KYXA 2YTCA 1UEVA 4F8RA 2WBMA 2N3OA 1QTNB 5HP1B 4TURA 3W2VA 3CO0P 3OVAA 1RT1B 3QT7A 4B3OA 2HVEA 2FBVA 3W8GA 2HWIA 4NLTA 3Q2TC 3THXB 4USVA 4QS8A 2Q6BA 1U8WA 4EHUA 5IQQA 1B9FA 1ITPA 3H59A 2W9BA 1ZBFA 2CNLB 2XB2D 1R8CA 4QPXA 4HUFA 2P6RA 2MKIA 2DH7A 3D7EO 2HBLA 2M5YA 2ZM6K 2W2OP 4YORA 1E4GT 4ATNA 4PG6A 4WFXA 2QWPA 2ZGZA 3M6ZA 3RRHA 2G0CA 3A2FA 3PW2A 3LW5C 4YMOA 4JV5F 4I9LA 1Z4OA 2OKQA 4DS4A 1YSJA 3ZI4A 1WDTA 5FRMA 2F8SA 2CJYB 4CGJA 2RJZA 1PJ7A 3FMWA 1XR6A 2F44A 1IBKF 3FR0A 1R43A 2GHVC 2IJRA 2CRXA 4CE6A 4CEFA 1K47A 2FLOA 2E1MC 5MLCQ 4IQUA 1N48A 2XMTA 1H6KX 1JQGA 3HK2A 5FLXY 2GZOA 3A8YA 1Q1KA 1T94A 5HMWA 3NVVA 4JI4K 9ICIA 1HWKA 1NPPA 1WACA 5SUHA 3FKBA 3UD5A 1WEZA 3R5AA 1ESVA 9ATCB 2ZIXA 5A8WA 1SWWA 1XR7A 3L4BC 2FVPA 2KV2A 3FMBA 4DR7J 2HQGA 2MTLA 3ISCA 2Q36A 3H3OB 3D0PA 2MZJA 3H0RB 2D74B 4KAIA 1VRQC 3UWTA 2Q2RA 3BQ1A 3NE6A 3L7UA 5IT9U 4EELA 1FDAA 5AQVA 1VGYA 2RU3A 3AB4B 2G06A 5FDLB 2YH1A 1VQLS 3Q22A 5T7LB 3IWLA 1NSQA 1UJ5A 4GXJA 2J9CA 2BE9B 4PA1A 3O0FA 2O8DA 2HAFA 1WSJA 4NZ6A 1V3RA 5B8HA 2I9SA 5A0YB 2V8GA 1GMVA 3KG1A 4RL1A 5DB8A 2IVMA 1JLCA 4MEYA 4Z6EA 3WKBA 1IKWB 3IO1A 3LP0A 2F8HA 5GADI 2X51A 5HANA 1W26A 3DRPA 3CJ1A 3QO9A 2R42A 2IC3A 2WMMA 1QHTA 3MM7B 5HLFA 1JNRB 2XNRA 1JLGB 4JBCA 3BGRA 1WF1A 3N4MB 1ECWA 1KLMB 3CCWA 3SK3A 3AFGA 3GR0A 4DL4A 4YFKA 2ZH1A 2MJNA 1B99A 2AV5A 2IM1A 2IIHA 1RE1B 5AQLA 1E3MA 1NOMA 4LJXA 4F67A 3ZD9A 4KHNA 4KKOB 4NPOA 5H9FK 1VI7A 3HVTB 1XSNA 4CJSA 4R25A 5FRNA 3KLHB 4BRAA 1F3VA 4FJ8A 4DV4J 2K06A 3AAQA 1YBTA 5KFTA 5ALEA 1QUPA 2R8GA 4USKA 1P8GA 2KIVA 2OTLN 1VQ5S 3W2WB 1S4EA 5D4NA 3T9ZA 3QDKA 1SB6A 4CERA 3C6HA 4TLRA 4K42A 3WBZA 1V5VA 2KN7A 5KTQA 2KJ8A 3KLFA 4H0OA 2R9LA 1CULA 1RGVA 2YPZA 3HPGA 2ZD1B 4PG8A 3SMPA 4HI1A 2ZUCA 3LGHA 4X62F 1RAFB 4NA3A 3J81O 4KLLA 3R2CJ 1ZBLA 2YWEA 2QYCA 4CZEA 4JI2K 2NO5A 4FJHA 1VOMA 1RDWX 4B9SA 4A57A 1OJ4A 4NYNA 3EVMA 2DHSA 1Y97A 2O8EB 3ZZ0A 2LYAA 4L3NA 1UVKA 3R5BA 1FESA 1ZJNA 2V2ZA 3VALA 2X78A 3GFHA 3CCEN 1ZQQA 1RDFA 3NASA 4HYKA 4G9ZA 2P66A 4M95A 2I5JB 3AVAA 1FRKA 1MROB 2WOMA 4XO0A 1REGX 5CR0A 2FLPA 3TADA 3CFRA 1NGBA 3ZSRA 4MYUA 2RQCA 2AJ1A 4WIIA 4U7BA 3N5BA 4P0QA 3HD1A 2VQEK 3UD4P 2BJ8A 1O8BA 5J2QB 1KOOA 4F2SA 3KK3B 1TV6A 2E66A 2PSZA 1SWVA 1HQUB 4B3TF 2ZH7A 3T1HF 4KGKA 3KJQB 3ISND 3CNQP 3GSDA 1EKRA 3F9MA 1EXNA 1Z4NA 1RT4A 2RDIA 4CBXA 4ECWA 1XI1A 1X4CA 4YD2A 3LM2A 2YKAA 2KKPA 2YNGA 4Z7YA 3NGSA 3EKSA 2X1BA 2G0AA 1JMTA 2D8CA 4UB5A 2HQIA 3GBTA 3B4DA 2CQIA 4DX7A 4I64A 7AT1B 2MB0B 2YVSA 2HVDA 5AQGA 4BR5A 2ZVIA 3CPWR 4KH0B 1D8BA 2RE1A 4ED2A 3US5A 5KL8B 3AHPA 3DRXA 3R2DJ 4JI5K 4K4SA 5KFQA 4A4JA 1NXIA 4FS1A 5AM0A 4PUOA 2FDRA 2GAHC 5J0UA 2P9UB 2WONA 3D45A 2J0QD 2KK0A 3G8TA 3FRZA 1JLEB 4DJBA 1Q3UA 4IOCL 2GIRA 1M5KC 1RBTA 1Y0HA 1T05A 1WNSA 1NZPA 2DB1A 4HTIA 4LZGA 4CECA 4UAYA 2ZUGA 4CDIA 2HCFA 4M3XA 3L3CA 1RXWA 5IT9O 3KHLA 2V6AA 3MR6A 2N3LA 3H8WA 4MKVA 5E7OB 3WZ0A 2EKNA 2PFDA 4F4WA 2ILZA 2X74A 4R0EA 3HX0A 3FVYA 2YN4A 4PHEA 1HD0A 3GJQB 2SXLA 1BO5O 2CPZA 4BLGA 1ZQHA 2VFTA 1BWVA 4IL6U 4NCGA 1TK0A 1Y00A 3OYMA 3NLCA 3MWBA 1YRTA 2CQ1A 1XSPA 3VEZA 2EQYA 4F0KA 1N6QA 1IQZA 3MN5A 2R8JA 5L38A 3ET6B 1C0TA 4HKQA 3NF9A 4DFDA 2NXUA 2OPPB 5AIAA 1W2BR 1VHIA 1ZAVA 4DL2A 3QZ7A 1HFEL 3H0LB 4C0ZA 4ELTA 1UFLA 4JI0J 3RRKA 1WC4A 2A6OA 4RW8B 2BGGA 3M2VA 2OCEA 4EUVA 3OS1A 2XGQA 3KK1A 1B7YB 2FVSA 4BXOB 4OJHA 4OYXA 3AA9A 1ZQAA 4I2QB 2PA8D 3OXFA 4K4WA 4JWNA 2KJ9A 4FS2A 2EFQA 4K8XA 1ZQEA 3MPDA 1I5OB 4NA1A 5E2QA 2YMQA 1IKYB 4JNEA 4PJ0U 3LDQA 1YQHA 1AUDA 2U2FA 2YX4A 2XTJP 2EFNA 1NK7A 2WB4A 3QICA 3C2KA 3CFOA 2ZZMA 3BDEA 1JJ2M 4NLVA 1Y5LB 4KBOA 3R9LA 2FVCA 2WVCA 2BRLA 1F2GA 4MDBA 4QIWF 3WK9A 5HVFA 5AI5A 2CXEA 4ID5A 4LF5J 5B0EA 1JKHA 3MEDA 1JL2A 4O5CA 2P9NB 1MMLA 4DU7A 3FDSA 4QZVB 3CJ9A 4LSZB 2UUBK 1J5OA 4LBPA 3CUNA 1WOQA 1S22A 3IBPA 1IKXA 2FHJA 2FMSA 4F2RA 8ICPA 3LAMA 4H0PA 1UTAA 3HVRA 4Z4IA 2ZITA 2BCQA 5EOZA 3U1MA 4QCLA 1KQKA 2EAPA 3TRGA 5KFSA 4R65A 5CHGA 4JMUA 2CIMA 4DBQA 4CGFA 4BRIA 1VQ9S 3GIIA 3S3OA 4I6YA 4C7QA 3K89A 4JOUA 9ICUA 1MDUB 3UM9A 4ID8A 3ZX0A 3KLEB 1K1SA 3QUTA 1DQ8A 4CRXA 9ICNA 3SAFA 4XAKA 1HJRA 4NXMK 2H51B 5M2RA 3G25A 3UKUA 3F2BA 3BQ0A 4O8UA 3CGIA 1NZAA 3NMUA 4OL8A 3HVWA 3OYBA 3L2VA 4C0BA 3CCMN 2LXIA 1DLOA 3OL8A 2Q31A 1EHWA 2KM8C 3C1YA 2Y0SF 2W3SA 1KD1O 1NOZA 5AE1A 2VANA 2MMYA 1SAZA 3CF5L 4QZ9A 1M5SA 2E1YA 4BRDA 2K8GA 4UAUA 2VBWA 4IG0B 2XLIA 3Q83A 2BM0A 2R7QA 3VN5A 1QLNA 2MPUA 2Z2ZA 1HNZJ 1FRMA 1QZ5A 1VBKA 3ZT1A 3M1VA 5ALOA 3N5FA 2B4PA 1KN5A 3S7RA 4ZVOB 1VQMS 2AU0A 2IAJB 3WIVA 2KD1A 3GJRB 4NZ7A 3BN4A 2XY5A 1NJWA 1VIOA 4NLUA 4J9VA 3FQLA 4F3QA 4X4SA 4E0DA 1VFJA 2V52B 2RQ5A 4ZVGA 2O8BB 2QRRA 4DV0J 4CHOA 2HFZA 4G6VB 3ISNC 2XSJA 4CF1A 1AA1B 1BUPA 2FE9A 1ZOTA 4RBUA 3F0NA 1WUUA 3VGKA 1CSJA 2CQCA 1CZBA 1I51B 3K5MA 9ICFA 2V5HG 2XC9A 2OLWA 1FT8A 4X65J 2UV8A 1EAYC 5HAOA 4IOAQ 1FD2A 4CO5A 4YQWA 4I2EA 3KNAA 2G2OA 3M6VA 4IO9L 2WCXA 2FZCB 3C16B 3LGNA 3OT9A 1I3OB 2QG9B 3RBEA 3D3BJ 1U25A 5BR8J 4PEOA 3UB5A 1K5OA 1OUQA 5DS7A 4EI2A 3OY9A 2MDAA 2H3ZA 1S6OA 3TNVA 4YB7A 4DXLA 4ECUA 3CJAA 2RDJA 1RT1A 4IKFA 1C2PA 4YMNA 1CVJA 4C98A 1NU4A 1QAXA 2EG2A 3IRWP 4XPEA 3GIJA 3THXA 8ICHA 3CCZA 3DU5A 1N33F 4AH9A 3MUTP 2ZJPL 2OH2A 3BQ7A 4KFBB 3TADC 4C4TA 1FEEA 4TNOA 4RPFA 4QR1A 4D3GA 1C7YA 3EKUA 2OPSB 2EFOA 2GC8A 5IINA 3A8JA 2OJ3A 2PN6A 4PY5A 5DM7Q 4BUGA 2GCFA 2KU7A 4EK2A 4FWLA 5L1IA 9ICWA 2PFQA 3CCRS 3ZTPA 1JCFA 1WNEA 3IM9A 1XNQJ 2ZWOA 4EO8A 1QH9A 4HTJA 1FFWB 3A1YG 4YDUA 5AE3A 3IBWA 4E1JA 4DR4J 1DJ0A 4RW7A 4QIVA 2DNRA 5DQHA 3CEDA 4FZLA 3FCVA 4WFBQ 2HOEA 2AGOA 1ZAXA 3ZX3A 3WC0A 2HMPA 1MN9A 1B92A 1EARA 4RZRA 3BM7A 3Q8MA 2C42A 4BC5A 1YXQA 1A9NB 4IDHA 3QWPA 2KVQE 2RU9A 3UKRB 4DG1A 3TW0A 2ROGA 4CLZA 4P0PB 2OPRB 4WBFA 5A8KA 4N47A 2O8CB 4L8RB 2UUAJ 3TABA 1UEKA 1RZMA 2RHKA 5E3QA 5KFYA 4QPTA 2J6TA 4PGXA 2UP1A 2DRAA 3HX9A 1CLFA 1NKEA 5AE2A 4OMFG 5ETQA 1OH5A 4B17A 4DV5F 1E6VB 2KVCA 4RUBA 5J1PA 1A5XA 3M7VA 3C95A 4KGXB 4P7TA 2VQFK 1HIWA 1M1GA 3N7RC 1FE0A 4X64K 3UIQA 5FDLA 3GFXA 5B66U 5T7LA 2FQQB 4A48A 2W01A 1GTEA 5E0OA 3F41A 4KHWA 4ZVUB 4CM0A 1Y3JA 8ICUA 2PFNA 1ASUA 5A0YA 2A1BA 5DQGA 5EY4A 4ELVA 3AARA 4DFMA 2W4PA 1RBOB 4B08A 1IKWA 3UNYA 2BUPA 4DR2F 3AVHA 3JPRA 4Y2UA 5KT3A 4PZVA 2IVFB 1WB9A 2VKQA 3QLHB 4R0JA 4UB2A 2HNZB 4HHTA 4O3RA 5GAEP 2BJ7A 3QU9A 2H5IB 1YJUA 2YY6A 5D4PA 4Y2YA 1WKKA 1NDPA 1L3VA 2VGNA 4TKTA 3CPEA 1RBUA 4DCOB 2H5EA 1B4FA 2ZH6A 2JDJA 4Y6IA 3KHHA 1G3OA 3JQJA 3EGNA 3MMVA 4KH1B 3MAAB 2I7PA 1IV8A 3OQ2A 1AROP 5A6PA 3M05A 4KKOA 2XGPA 3HVTA 1R6VA 3KLHA 3L7OA 1RPLA 3HO1A 4B9MA 5ITHA 4JI6J 4BG9A 4B1YB 3E2EA 4JI3J 4XH4A 2GAGC 1M5HA 2XSFA 3HF5A 1NB2A 3A0IX 1RYUA 2RUGA 3O9SA 3SSQA 1OQ3A 1YJVA 3OYNA 3E0FA 4PHPA 1V9OA 2ZD1A 3M8RA 5F8LA 2B7BB 5AQOA 3MAHA 2COLA 4OI2A 1LWXA 2PMZD 4OZJA 1XMOJ 2YWWA 2DNMA 2VBZA 1J2MA 5DG7A 1EXQA 2O8EA 4PL1A 2E4LA 1ZM3A 1KEKA 4XDCA 4N41A 4P9SA 4FVMA 1ZQYA 2XCAA 1RDDA 3D1OA 1HKGA 4RPZA 4LF8K 3D2NA 4DFKA 1T11A 3VESA 2QXFA 1SUQA 1Q86O 2I5JA 2ODGA 1MROA 2CDRB 1SZPA 2H48B 2HMIB 2C1EB 3HJFA 1SJRA 2V8PA 3DXKB 3CCUN 8ICFA 4ZVQB 3QBCA 4W5QA 3NDKA 3SNNA 3VGMA 3BBCA 2GQQA 2DGSA 5J2QA 4KITB 3P38A 3KK3A 3OL6A 3R6MA 2KXHA 3G10A 2VPZB 1GMWD 1SIWB 2F8MA 1R89A 1B43A 3A4TA 2XY6A 1Y7PA 1CS4A 2J6UA 5ETPA 5J0QA 4B9QA 2Z0GA 8ICVA 1UWAA 3OUYA 4DZDA 3I55S 2JRSA 4QWEA 2P6TA 3B54A 5F3XB 2YX7A 3HHDA 4X4NA 2FSKA 3P8BB 2YWKA 3NWGA 2W4CA 4GKKK 4DUZK 2UXCK 4MMOA 4G1PA 1RHUB 4RPXA 1UW4A 1KD1T 4QWCA 1XERA 1ZZNA 1S6QB 3KOOA 2HNYB 4PXBA 1NGFA 4O4GB 4CVNE 3M32B 2HQ3A 1AW0A 1K6YA 2W6LA 1V6HA 1HYVA 2CWXA 3PJ9A 3AXMA 1WOSA 4KLTA 4JI7J 3AVMA 1U1KA 3O6QA 3QJLA 3SSSA 2XRIA 1NAQA 2P9UA 4BQZA 4QZEA 1FFGB 5HL7L 5AQYA 3PCOB 4X66F 1VC5A 4F9OA 2UU9J 1JLEA 3HSZA 4RW6B 3K1ZA 2IHNA 4IC9A 4UAWA 1ZQDA 2F96A 2IVNA 4QJFB 1KQFB 3GV5B 3GTYX 2QLBB 2W04A 2FVQA 3GZFA 5AXKA 5B09A 3N79A 3SQIA 1N5YB 5JS1A 1L5UA 2MYFA 5FIIA 2OPQB 2N82B 4JK9A 2E7XA 1S97A 1SL0A 3EGZA 3POTB 2FF3B 1EKSA 4DSFA 4XIUA 3L8BA 2NYVA 3M7DA 4BGAA 2QWMA 1YIJS 4J9PA 3AD7C 2P9KB 4DEZA 2VASA 3MXJA 1J2VA 4ZITA 3V6DB 1U2RA 5BRHA 1HJOA 1GO3F 3RAMA 1JJCB 3T6BA 2OPPA 2I8EA 1T95A 1WCLA 1SBRA 1NSPA 3CM6A 2FD2A 3SAHA 3ENVA 4RW8A 1KAXA 5E3CA 3NHGA 3WX4A 2IVYA 4F7VA 4C1NK 3PUFA 3OTOJ 3HZGA 4BXOA 3QT6A 3CC4S 1NGJA 8ICNA 4U8YA 4I2QA 4DV3K 4KI6A 1OY8A 2JVRA 2MA1A 2V50A 5LSLA 5ALWA 3HHNB 3GV7B 3I4HX 5GADU 3Q86A 1PAUB 3AODA 4H5WA 5C12A 4YOYA 2D0OA 2LM1A 5LSOA 1IKYA 4IJAA 5TKWA 3FSYA 2AH5A 3IRUA 3I31A 2E8MA 4XH1A 5HSPA 2CWKA 2OSQA 2MXYA 3JPSA 2NXJA 2MQPA 5AM2A 4FXDA 1OW5A 5T7BA 3D6MB 3GL1A 4EZ9A 2QMWA 3O2IA 9ICBA 4PXEA 2BM1A 4G9BA 2HHHJ 3HD2A 3NH0A 2D6FC 4O0IA 3DRRB 3QU2A 2P9NA 4QOZB 5J0RA 4CJUA 1TZ0A 2QLWA 4L72B 2PGCA 1N56A 4WU2A 4YDUC 1FX2A 2EC0A 3BSNA 3WKAA 3SSRA 3LF0A 5FPEA 5GAEI 3HT0A 1HNXK 1N34K 1VQ7S 3RG6A 4DV1F 2QWNA 4OI4A 2HS0A 4ZPVR 2VA2A 2X3GA 3BB5A 2QV6A 4ECYA 1Z19A 2YMLA 4AXIA 4RKUC 4O5BA 1RBSA 3AQOA 2J4RA 2BBEA 3BS5B 1C1BB 1OPZA 1U4BA 1H72C 1UA0A 2KDOA 3EJMA 3SQ1A 4JK1A 1VQKS 1LW0A 2HFNA 4M04A 4DSKA 2MKKA 3OV7A 4USIA 2W6KA 3MMJA 3DYAB 4EFAC 4NO7A 3LDOA 2WW4A 1Q78A 2BOAA 2DRDA 2Z1HA 5GAGP 2JMGA 4FNIA 2HBKA 3S3NA 5JLHA 4PG7A 4OI3A 4RUCA 4PHDA 4J9NA 2ZBQA 1X60A 3OTBA 1XHZA 2F1FA 3UDLA 1Q53A 4YP3A 5ETLA 2RDDA 4CH0S 2ZH4A 4WFAL 3UCGA 2HGLA 2QXLA 3R27A 2DIVA 1N5TA 4TVAB 2ZH5A 3SPYA 3H5SA 2B4OA 1YX2A 3WXJA 1IBKJ 4AHTA 2GUIA 1ATNA 1RDAA 2Q1LA 2DNZA 4IG3A 1YZ6A 3SFGA 4CD1A 7ICGA 4OKEA 5DDPC 3AVIA 1TVRB 4IG0A 3TAPA 1RDUA 2CQHA 1X9XA 4M1KA 3GP9A 1IQTA 1DT9A 3NS7B 2AD9A 1GQEA 3VQ5A 2NRTA 3ZD8A 2JC1A 3NNAA 3FZLA 1UVNA 4EX7A 1ZQVA 1VSEA 3KK2B 5J0SA 1OS5A 3VWSA 3Q8PB 4TYBA 3CCES 4BG8A 3M9OB 5J2EA 4LZDA 3D6TB 5BPNA 4JI0K 1FNMA 1YITN 3KFUF 2K3KA 4BCAA 3BGFA 5B5EU 3B4MA 3WXMB 2IAJA 3FSXA 1QSSA 4PH5A 1NK5A 1V4SA 2QTWA 3AVNA 2BJ9A 3N7PD 3O3FA 1RAOA 4AFFA 3ULEB 5HP4A 5JU5A 2IDOA 3TAMB 2O8BA 2WVDA 2HRYA 1V3SA 5BYQA 3BKUA 4B1UB 3H4BA 4A61A 5BRFA 3MK6A 1F9EB 4PCQA 4L73A 2VYPA 3AOAA 4IYQA 4K2XA 4CYUB 4UBCA 1PZNA 1YLXA 5K20B 1XQSC 3ITHB 3NCPA 1URJA 4JS4A 1D9FA 4OYWA 2LXFA 4CF4A 2MKCA 1GH8A 4AILC 5KGWA 1VQ4S 1GLBG 4DQSA 2AJ0A 4LC9B 3D2WA 3C16A 3OTDA 1YHQN 9ICOA 1GX6A 1MC8A 2PD1A 5AQSA 9ICPA 2KT5A 2ISOA 3CC7N 2YWFA 2K4PA 3JPTA 3HHLB 4GMKA 2V7ZA 2W8LA 5IIMA 2P8IA 2LPEA 3LP1B 4WK3A 3PYFA 4QIWD 5AK5A 2AZ3A 1T9UA 2EX3A 4NLGA 4RJVA 4IRKA