1NKEA

A bacillus dna polymerase i product complex bound to a cytosine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 212
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nkeA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nkeA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nkeA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nkeA01
4F8RA 2JEIA 4ED8A 3OYNA 2UVVA 3ZSRA 4ED6A 2UVRA 3B6PA 3SCXA 4DL7A 2ZQBA 4J2EA 4CGHA 5DGBA 3DOLA 4ECZA 1IH7A 3NAEA 3NBPA 4CCHA 1ZQNA 9ICPA 3LDAA 3DLRA 3UQ0A 4CHZA 2DY4A 3I0RA 4DMNA 4KLOA 3QETA 2I5JA 4F91B 4FJXA 4LSNA 4E7KA 5IIOA 5IILA 2FC0A 2BE2A 1YTUA 4M2YA 5FRMA 2V9WA 4BE1A 5FRNA 1F21A 3I0SA 1DLOA 1ZQFA 3EWAA 4RQ3A 4Z6EA 1Z3EB 5KT2A 3SV3A 3LANA 1U45A 3OGUA 1BPYA 8ICXA 2P5OA 4M0AA 1LB2B 1FXXA 3ZSYA 1B22A 4JV1A 4KHQA 4CFAA 4KB0A 3P5JA 3KK3A 4AHTA 2E6LA 4DTUA 4M6WB 3RTVA 4FM1A 4RPXA 3QESA 3G6XA 4F5OA 4HCCA 3PW2A 3QO9A 1JIHA 3AO2A 5KFQA 8ICVA 4N56A 2BCVA 3MR5A 3UXOA 1X2IA 1JLEA 3F9KA 3KHHA 5KFCA 3OJSA 5IIJA 5KFHA 3E2EA 1NJXA 4CJVA 3PNCA 5L1KA 1NK7A 5DB9A 4BE0A 4LZGA 4I2GA 3SPZA 3Q8MA 4MFFA 4CHYA 1RT6A 4N5SA 5IIKA 1CEZA 2IMWP 4OKKA 1CZBA 4RW7A 2P6RA 3MR2A 7ICPA 2ASLA 4DSIA 4DL6A 4KAZA 9ICGA 4FS2A 2W9CA 2UVWA 2BDPA 4KLUA 1LAWA 8ICRA 3C1YA 2E6MA 1S76D 2GUIA 4ECVA 4JLHA 4CERA 4H4MA 2Y1JA 1B9DA 2QKKA 4PHDA 3PO5A 2HHVA 4YXMA 5HHHA 4OVLA 4G3IA 3EZ5A 1SKSA 5CYMA 5KFOA 4F3TA 4OLBA 4DS5A 3NGIA 3V81A 2YV0X 4KHNA 1XC9A 3HM9A 5CP2A 4RT2A 2QXFA 4CHQA 4HCBA 3OS1A 4O3PA 1TV6A 1L3VA 2P5GA 1TK5A 3V1RA 4CJPA 4H8KA 5J2QA 1ASWA 4I2DA 1A76A 3PR5B 4FLVA 4BGDA 3VQAA 3GFKB 4DLEA 3OY9A 1B43A 4YXJA 4UBCA 1VSFA 3MEEA 1ZJNA 3B6OA 9ICEA 3MFHA 4TQSA 4DSEA 1HYZA 1RBVA 4XQ8A 4IDKA 3Q8QB 4KTQA 3T5JA 8ICUA 3H4DA 4QZFA 3GDXA 2VG5A 3JPRA 5KFYA 3F73A 4ICLA 3AVBA 3K5MA 3H8WA 4IRDA 3LP1A 1QSSA 1TKDA 2BANA 3OYCA 1RBSA 1NOMA 1I3AA 2KTQA 3V6JA 4DQPA 7ICSA 2YKMA 4KLTA 5KFIA 4QZEA 2GV9A 2YHAA 1JL1A 5L1JA 5HP1A 1RXWA 4KKOA 4FM2A 4P4MA 3IAYA 5KT4A 3HVRA 3NF9A 5J0QA 3ZT3A 2XCAA 1LWCA 2IAJA 3ETLA 5KFJA 4KRFA 4EZ9A 5KT7A 5KT3A 2FPLA 5CZ2A 8ICWA 5DMRA 1X9WA 4RQ7A 9ICVA 3K5NA 4M9HA 4TUSA 1DTTA 4UB1A 4RPZA 4B9UA 1DOQA 2VANA 2KZMA 1ZQQA 4B08A 2MAXA 4BWMA 3PMNA 4DQRA 4YD1A 4BDZA 3C6UA 3HT3A 1QHTA 1A5WA 3AVLA 3L2VA 5C24A 1RYSA 3H40A 3VQ5A 3DOKA 3T5KA 3P83D 3C6TA 3RB4A 9ICAA 3T5HA 2W9BB 3ZDCA 5KG3A 1HNVA 1RBUA 1LW0A 2WONA 5DB8A 8ICQA 1YVUA 4PGQA 3BQ1A 5IINA 4QWCA 3HL8A 4CFCA 5J0RA 4YP3A 4B8CA 4FYDA 3RH4A 2AGPA 2YNFA 2C28A 1D8YA 1NK6A 3LWMA 4CIGA 2P6UA 3O3FA 4DQIA 2NRXA 4NM1A 1C7YA 5C25A 2HHUA 4J9RA 8ICIA 4AHUA 4EP5A 3D45A 5KFNA 4F92B 4PGYA 3M9OB 8ICEA 1L5UA 7ICOA 2KFNA 3OYBA 3SI8A 1UWBA 3HWTA 4J2AA 5D3GA 5DG7A 1VRTA 3O4NA 3KJVA 3SUOA 2BCQA 1KTQA 5SWMA 4CF8A 3S3NA 4LVSA 1RNHA 4CF0A 3MEDA 1J9AA 3HJFA 5J2KA 4ECWA 2A1JB 9ICKA 2P51A 2Z1IA 4M45A 1T8EA 4M3ZA 4OGEA 4F2RA 4UB5A 4UQGA 3C2MA 3K58A 2ATLA 2ZUCA 2BR0A 3LAKA 3NE6A 4J9LA 8ICFA 5J2PA 1TK8A 1ZQGA 9ICHA 4IQVA 3H4BA 1HPZA 3VQCA 4FJ7A 4K8ZA 9ICFA 1TV9A 1S6PA 4CF9A 5EWFA 3AVNA 1TL1A 1QSYA 3RMBA 4ED2A 4Z4GA 4OPJA 3TAPA 1JLQA 4KPYA 1WSFA 2UVUA 2BHNA 3K75D 5KFPA 5DBBA 4UAZA 1WSJA 4W5NA 2IGIA 3HVTA 3ZSQA 3MR3A 2V4RA 4CEOA 3RH6A 4CJRA 2G8IA 4N47A 1IKVA 4B9LA 1SL2A 8ICNA 3TQ1A 2HW3A 4KLIA 5I42A 5CB1A 2IHNA 5KFDA 4DFPA 2ISOA 1RPLA 1S1WA 1RCHA 3TANA 1RDBA 3AVJA 4FBTA 3MGIA 3E01A 4NCBA 1K6YA 4QZGA 1VSIA 1T3NA 3PR4A 3CFPA 1RBRA 4AHCA 4FJHA 4PHAA 3GQCA 1SKRA 3KIOA 1KEJA 4ID5A 2VWKA 3TARA 5J0YA 1ZQYA 4ZHRA 3Q8SB 3PY8A 3Q8RB 3G6YA 1NJZA 3S3OA 4R8UB 3IRXA 4M3UA 3SZ2A 2B21A 4KB1A 5J29A 4CF1A 1BQNA 4TSXA 4KLFA 4O0JA 2IA6A 2FMQA 4B3OA 2D5RA 9ICNA 5J1EA 3Q8KA 5KT6A 3KD1E 2YNHA 7ICKA 4QWEA 2P66A 2Q0ZX 1JXLA 2IHMA 3G0ZA 5KG1A 2PI5A 3VA0A 1S0NA 4J9KA 4PQUA 4YMOA 1NJYA 1HQEA 3KHGA 2XCPA 4YR2A 1WLJA 1XS9D 8ICLA 2DFLA 3AO5A 1Y88A 3M8PA 4DL3A 1UA1A 7ICRA 3K4GA 4CJSA 1S77D 2JEGA 3M8RA 3VQPA 4M9NA 2HNYA 4LY7A 4NLNA 2F8TA 3VQ9A 4F5RA 7ICTA 4GW6A 1HUOA 1UOCA 4PY5A 4K4IA 2EX3A 2FLLA 1A5XA 4I27A 2FPKA 2NUBA 4DSJA 2GWSA 5KFUA 1S6QA 3VQ7A 3AV9A 4O55A 3V7KA 3QIPA 3ALYA 3ZSXA 4CJ4A 5KFLA 1KVBA 3PW4A 4QWBA 1NK0A 3VQEA 4L8RB 1RT3A 4UAYA 1S1VA 4M41A 4P4PA 3CQ8A 1BCOA 1HQUA 4O3NA 4EBDA 1FK9A 1W9HA 2XY7A 1D5AA 1BIZA 1ZQZA 3ISNC 5L1IA 4OJRA 3ZD9A 4HYKA 2AQ0A 1XSPA 2BPFA 3AVIA 2ETJA 1BI4B 3TR8A 4E3SA 5I3UA 4CJ3A 4E7IA 3QEXA 3NGYA 5K14A 4C8KA 5KFRA 2OPQA 3ASMA 3L2RA 3FYHA 4DFKA 5KFFA 4OPKA 3U6FA 4IKFA 3CG7A 2W8KA 2Q3SA 3K2PA 1RT4A 4CHPA 3RJJA 3KKSA 1LWEA 3K57A 9ICSA 4KLJA 4JV2A 3P1GA 8ICKA 3WNEA 3ZT1A 2FLPA 4DTOA 4ED1A 3G6VA 5KI6A 4MEXA 3GIKA 4JK1A 4FJMA 3ZCMA 1S9FA 4C8MA 2C2EA 3CFRA 4LSLA 2YHBA 3GV5B 5HRPA 4B8AB 4KHWA 4O5CA 1XHZA 1TK0A 5KFEA 2VG6A 7ICMA 3MR6A 4Z4FA 1JLAA 4JWNA 1RYRA 4CFBA 4O3OA 2JZBA 1ASVA 1XSNA 5F9LA 4PUOA 4RG8A 5J2BA 3HPOA 4B9SA 5KRTA 4CJWA 1RT2A 3TAEA 1I39A 4XUSA 1NOYA 4QOZB 4FJNA 3V9UA 3PX6A 1S1XA 3EY1A 4JWMA 3DLHA 1VSEA 1C0MA 2ZE2A 4CJFA 3K5OA 5KFAA 1JLGA 4R64A 3UXPA 4FXDA 4HVJA 1QSLA 4DF4A 5DQHA 1BPBA 4E0DA 4IQWA 5CY4A 3GV8B 4CGDA 3IHQB 4DG1A 1HYSA 4DOBA 4CK1A 5KFBA 8ICZA 5FDLA 1LWFA 4QW8A 3WNGA 4GVMA 2FBYA 3PX4A 1MC8A 3ULDA 3LAMA 4MF2A 3IS9A 4DEZA 5J0PA 4QWDA 1RBTA 3SI6A 1L3TA 4CE9A 4YMMA 4M9GA 4FM0A 1U47A 3DLKA 4YCXA 1EXNA 8ICHA 3VQQA 3KLIA 1K1QA 5CR0A 3HXMA 1BQMA 4X5VA 1ZQVA 2W9CB 1JLCA 3NGDA 2R8IA 3MECA 3ZDBA 2XC9A 3PX0A 5J0SA 5HRNA 5KFTA 4FW1A 1BPXA 4Z0UA 1CZ9A 2ZJAA 1U04A 4CK3A 4J9OA 3MDAA 4CHOA 1BISA 3OVNA 3KTQA 3HPHA 2RDJA 3QIOA 5DB6A 4Q45A 2KZ3A 4YD2A 3OHAA 1RILA 2FMSA 3T19A 4YR3A 3VQ6A 1D8LA 5DB7A 2YNIA 4DTJA 4Z6DA 4Z6FA 3VA3A 3BQ2A 2OPRA 5DQIA 4QZAA 1N48A 4W5QA 5D46A 1REVA 3BQ0A 3C5FA 3ZT4A 4HUGA 1XSLA 3RAXA 9ICMA 3M8QA 4J2DA 5KFWA 3TFRA 9ICXA 4K4GA 2W9MA 3JSMA 2YNGA 1JLBA 1CUKA 4FLXA 3RWUA 1WAJA 1C6VA 4CGJA 4F4YA 4YFKA 3AVAA 2XY8A 7ICLA 3ISCA 1HYVA 4GC6A 3L3VA 1SV5A 4JUZA 3QNOA 2KZZA 4EEYA 5KRSA 5HRRA 2PY5A 2BKEA 4O3QA 3LALA 4KLDA 3A2FA 4PWDA 4M3RA 3PV8A 4DLGA 4KLHA 2G8VA 3DYAA 5DK5A 2E4LA 1X9MA 1NK9A 1ZQDA 3OSNA 3G10A 3OYHA 3B0YA 4RW8A 4R66A 2B4JA 3ZSWA 4O0IA 4ELUA 4O3SA 5J2FA 2R7YA 3SUQA 4DFJA 3K59A 1Q9YA 1ZQCA 1ZBIA 4FJKA 1L3SA 1TGOA 1WNSA 4IRCA 4F3OA 3KK1A 4EZ6A 2HHTA 3V7LA 3RB0A 1SKWA 3KKRA 4MFBA 2OWOA 3QEPA 4FZXC 2ISPA 2J6UA 4I2BA 5HNKA 3PW0A 3DLBA 5D49A 4FCYA 4R65A 1R0AA 4RQ4A 1HRHA 2ASJA 2XRIA 1GOAA 3QE9Y 2BPGA 3PUFA 5EOZA 4YMNA 2ITGA 2G8WA 1BPZA 3LPTA 2DFFA 2HHSA 1A5VA 4P4OA 1KSPA 2MUTA 5DBCA 4IG0A 3GIJA 2PFNA 1N5YA 5DG9A 4KTZA 1MQ3A 5J2HA 9ICUA 3QZ7A 4CEAA 4IR1A 1ZQLA 5DG8A 1N6QA 1ZQBA 4M3TA 4ED0A 2RN2A 2VG7A 5HRSA 4XRHA 3AVFA 1KCFA 3IG1A 2I9GA 2XY5A 3C21A 4ZH4A 4CJUA 4NLZA 4DL2A 4FLTA 8ICOA 1JXBA 2Z1JA 4NCGA 2QKBA 3EPGA 4RQ0A 4F5PA 4C8NA 3BDPA 4W5TA 1EKEA 4ED7A 1IG9A 3JYTA 3RJEA 2IDOA 5CA7A 2KQ2A 4OKJA 4M3YA 4YQWA 2A1JA 3ZT2A 1RT7A 1EXQA 4UB2A 1X1PA 2G8UA 3HW8A 2ZTCA 2ZD1A 5J0TA 2OZSA 4NLKA 3UXNA 5J2DA 2PFOA 3RR8A 4RUCA 1VSMA 3ITHA 3CM6A 4ECSA 1IXRA 4FLZA 3QEIA 1HNIA 4PHEA 2R8HA 3U3GA 5CJ7A 3ZDAA 3OYFA 4RT3A 2PI4A 3B0XA 3NCIA 3VQDA 2FPMA 3OYKA 3FDSA 1ZBHA 8ICCA 5J2AA 4KN7A 1RTJA 2BGWA 1NOZA 4CJKA 1HJPA 3EYZA 2IBKA 1K1SA 4JS5A 3SQ4A 1T4GA 5DKWA 4CJQA 9ICLA 4DU1A 1QS4A 1A77A 1IKYA 4E7JA 3GILA 4NXZA 4MEYA 4I2IA 4KMUA 4QZ8A 4FJIA 1UT8A 4FLYA 1MSWD 4CGGA 5J2CA 2A1SA 3TABA 2Z1HA 4GXIA 3ZD8A 5KFKA 4QZCA 1KLMA 5IIIA 3KLFA 4JV0A 1NKEA 3OYIA 3EW9A 4M3WA 3NH0A 3MXIA 1NK4A 4ECUA 3NDKA 1S1TA 4FK2A 3C1ZA 2ZUBA 3C23A 3OS2A 3SUNA 4ELVA 4F93B 4Q5VA 3V1OA 3QEAZ 4DOAA 3V6KA 3RJIA 5BOMA 1SUQA 4ECYA 1GOCA 4O3RA 3ZDDA 2DFHA 1WSIA 4R5PA 1VSLA 1LV5A 4AHSA 5J2EA 4G1QA 5TZVA 2PYJA 1ZBFA 1SL0A 5HMMA 3JPPA 1TKXA 1WSGA 3ZSOA 4RNNA 2YKNA 4NLGA 4PPXA 2D0CA 3V9ZA 4UAWA 4N41A 5KG4A 5J2JA 1RDAA 8ICAA 3V7JA 4NYFA 1ZQIA 4Q8EA 1U49A 4M9JA 3JPNA 1U48A 3QEBZ 1EX4A 3NHGA 4KV8A 3SJJA 3T3FA 1B9FA 3UQ2A 4O5KA 4KO0A 1Z00A 5IIMA 1W0HA 4DSFA 1ZQMA 4DOCA 3O4QA 5KTQA 5L1LA 1MQ2A 2PZSA 2P1JA 3KHLA 9ICBA 3WNHA 2X6NA 4BDYA 4DQQA 4UB4A 3ISDA 1S5JA 3NH2A 4GLXA 4FVMA 4EYHB 2HHXA 4MF8A 4Z4CA 4I9LA 3C2LA 1S0MA 3QNNA 1U9LA 4UBBA 1JKHA 1Q9XA 3GIIA 4MFCA 4QZIA 7ICUA 3RR7A 3KLGA 4E7LA 3RJHA 3AA2A 5J0WA 4F5NA 4DTXA 2NRWA 4BXOA 1SZPA 1U4BA 3RJFA 3VQ4A 3RRHA 1VSKA 4Z4EA 3N4MB 2J6SA 3MDCA 4FW2A 2FBTA 4YN4A 4ZTJA 2ZJ8A 4RUAA 4KN4A 2AJQA 3NF6A 3DRSA 7ICNA 3OYGA 8ICTA 1NKCA 4F50A 4B9NA 1J54A 4I9QA 2X78A 3AO3A 1KRPA 1KLNA 4TURA 3AU2A 5KGXA 1ZQOA 2X74A 1EETA 1QE1A 1C0UA 2BGGA 1B92A 2FLNA 1BVSA 2C22A 1LW2A 4F2SA 1ZQKA 4IRKA 1JX4A 3QLHA 1TFRA 1ZQTA 4XIUA 1N56A 3MEGA 4CGFA 3RMAA 3MAQA 2W9AA 9ICOA 4DSKA 1RDDA 2ZUDA 3O3GA 1ZQPA 4CJ5A 5EU7A 1HJRA 4I29A 1IM4A 2VA8A 4IFYA 3DI6A 2HNZA 3RBDA 8ICBA 2KN7A 7ICVA 3RH5A 3OS0A 1XI1A 1ZBUA 4NM2A 2FBXA 3AUOA 3HP6A 1S9GA 4FLUA 2F96A 1EP4A 4M9LA 3DMJA 3VN5A 4CGIA 2WTFA 2EHGA 1C1CA 3PVXA 4DWIA 8ICYA 3THVA 3PMLA 2KFZA 5J2IA 5J2MA 5J0OA 2HB5A 5J2GA 1NK8A 5DGAA 4YR0A 1X9SA 1UAXA 1V9PA 2PXIA 1RT1A 2BPCA 3SYZA 4CF2A 4O5EA 4M6WA 2HVHA 4KHUA 4I2EA 4Q8FA 2JZBB 3AO4A 5HP4A 1ZQXA 2DPIA 1MU2A 1ZQEA 3KLEA 1BIUA 3OYAA 3EPIA 3Q8LA 2DPJA 4I2HA 1FKPA 1NKBA 4KLEA 1VSJA 3SPYA 4CJTA 4F4WA 4JS4A 3ISBA 3SUPA 4QZHA 1S10A 2HMIA 1KFTA 5KGWA 4K4HA 4FZZA 1C1BA 2ZTDA 4FO6A 4CESA 2B6AA 1Y97A 2AQ4A 3FFIA 3V72A 4F4ZA 4DTMA 4LZDA 3LWLA 7ICJA 1RTIA 3BJYA 2F8SA 4M47A 4RW6A 4QZ9A 4J9MA 3L3UA 1PZNA 2JEFA 4AHRA 2J6TA 4QCLA 4IQTA 4P2HA 1HMVA 2W8LA 4W5OA 1T7PA 3V6HA 1TL3A 4DU4A 3LDSA 4KLQA 5KFZA 4HUEA 1CXQA 3AU6A 3PW7A 2VA3A 4AILC 2XGQA 3QEVA 4QW9A 1ZQWA 4ECXA 2A1RA 4LD0A 3HYFA 4RQ5A 3UPQA 2HVIA 4CJEA 3KD5E 2F1HA 3AVCA 1COOA 1WN7A 4OLAA 4OKEA 1VRUA 4FBUA 4QAGA 3DLEA 3H7IA 5DQGA 9ICWA 4Q44A 1UA0A 2XY6A 1Z25A 1HUZA 2NRVA 9ICCA 4ECTA 2JGUA 4Z4HA 1J53A 4RQ1A 2M9NA 3AA4A 4UB3A 1BCMA 3L8BA 2JEJA 3BGRA 4KITB 2X6SA 4HUFA 3GV7B 4B9VA 4B9MA 1DGSA 3IM1A 3OJUA 1S1UA 3PO4A 2ASDA 8ICJA 4AH9A 3ZDEA 8ICSA 2HHWA 1KVCA 4I7FA 4RNMA 4DTSA 2AU0A 4DF8A 4KLGA 4I2JA 4M42A 1BHLA 4R63A 1JL2A 3SQ2A 5KT5A 8ICPA 2XHBA 4GXKA 4M3XA 1IO2A 2RDIA 1QTMA 3MXMA 3AVGA 4CFDA 5HROA 3QINA 4KLMA 1TKZA 4CHNA 3V6DA 9ICIA 2R8KA 3JPSA 1RTHA 9ICRA 4W5RA 1ZQAA 3RMCA 4ID1A 3OYDA 2QK9A 4F5QA 9ICTA 3VQ8A 9ICJA 4TUQA 3V9WA 3OYEA 2VA2A 4NY8A 3WNFA 5JS2A 5F9NA 3SQ0A 4Z6CA 3RJGA 5DLGA 1TKTA 3NF8A 5J2NA 3ZT0A 1NJWA 4I2QA 4FJ5A 2VWJA 2IS3A 1QLNA 3QZ8A 1NK5A 4HHTA 2W9BA 5DLFA 1ZQJA 4BWJA 4KI6A 5BPCA 4O4GA 2RKIA 2G8FA 4RU9A 5FROA 4JRQA 4FJLA 3ZSVA 3RB6A 2PYLA 3HO1A 3Q8PB 4CECA 4RW9A 2BCSA 3HPGA 4H4OA 3MFIA 2OZMA 1O1WA 3RMDA 5EWGA 4EP4A 4CJLA 4KI4A 7ICGA 3SNNA 4LH5A 2W42A 1KDHA 3I8DA 2JLEA 3CM5A 5SZTA 5HHIA 3C95A 3HP9A 4I2CA 5CZ1A 3LP0A 8ICMA 4Q0BA 1T05A 1JMSA 3L2UA 4PA1A 2IC3A 1RXVA 4O9MA 3CYMA 1TAUA 1SL1A 3RB3A 7ICFA 1ZYQA 5C42A 2XGPA 1TAQA 5J0UA 1JLFA 3TAGA 3NGZA 4KLSA 4EBEA 2MUTB 2C2RA 4GXJA 1RDCA 4BACA 1G15A 5KG7A 2OPSA 3BQTA 2XO7A 4C8OA 3L2QA 4RPYA 4FK0A 4EYIB 2AGQA 4YVZA 2OYQA 4ELTA 4TUPA 3CFOA 1S0OA 4MFAA 3OYLA 2I1QA 4CEEA 1D9FA 1XU4A 3TAFA 1BPEA 3ZSZA 1VSHA 1WAFA 3TWHA 4Y1CA 3K5LA 1AROP 2D0BA 3HSTB 4RW4A 5C5JA 3NFAA 4I2FA 2NRZA 2R8GA 4GC7A 3MGHA 4QZDA 4MQ3A 2O4GA 4KREA 1VSDA 1RT5A 5J0XA 4E1MA 3ORYA 3TAMA 3HK2A 3UIQA 3KK2A 5KG6A 1S97A 5KG5A 4ED3A 2KW4A 1GOBA 4I2PA 5CHGA 1ZJMA 4WE1A 4DQSA 1YTAA 1S9EA 3OYJA 3QEWA 3LPUA 1ZQHA 4YNQA 4RQ8A 1XO1A 5EWEA 4CK2A 4Q43A 4J9NA 5JUMA 5D4BA 1BL3A 2AGOA 3KHRA 4QWAA 2BCRA 4DL4A 3TAQA 3LP2A 3JPQA 7ICEA 3D0PA 2PFPA 4B9TA 3TI0A 1ZQSA 3OHBA 2HHQA 4E7HA 2HNDA 2O4IA 1JN3A 1ZBLA 2FMPA 5DBAA 2D0AA 5KG2A 3M9MB 3DRRA 5JS1A 5HBMA 2R8JA 4DL5A 3C5GA 3NTUA 4KTWA 4RQ2A 1ZQUA 4CEZA 4N76A 4DO9A 4FK4A 3RBEA 2BCUA 4C8LA 1H38A 3S3MA 1BGXT 3JPTA 4J9SA 5HLFA 2LYHA 1QQCA 4R8UA 4KLLA 4J9PA 3LZJA 4E89A 1JXEA 1IKXA 1ASUA 3AVMA 4FJGA 3HX0A 3S9HA 4CIEA 4BE2A 2DFEA 4J9QA 3V9SA 3RJKA 3H08A 1CXUA 1RZTA 3AVKA 7ICHA 5E41A 4RZRA 4BDPA 2G8KA 3M9NB 3OYMA 1FKOA 1IKWA 3C94A 3NF7A 9ICQA 4Z4IA 2F1IA 4DTPA 3MBYA 5KFVA 3O3HA 4HTUA 2BQRA 8ICGA 2OPPA 3V1QA 5CWRA 3AA5X 4IQUA 3GIMA 3SV4A 5KFXA 4YFUA 4J2BA 1T03A 1LAVA 2DTUA 4M04A 4DSLA 3DLGA 3V4IA 1XWLA 3N97B 3H8SA 4XA5A 1L3UA 4FJJA 3C2KA 3TFSA 1CLQA 3RRGA 1DTQA 4O5BA 1WCNA 4E19A 4FJ9A 4ZTFA 4FJ8A 1Q8IA 3AVHA 5L9XA 3T5LA 1C0TA 4LH4A 1WSHA 1WSEA 2H5XA 1Z26A 2RPIA 4IG3A 1ZETA 2Y1IA 4CEFA 2Z1GA 3H8JA 3MXJA 3LZIA 4GMJB 5KFSA 1TVAA 1Z00B 2ZJ5A 2OA8A 4DU3A 4OGCA 1J5OA 4DTRA 2NRTA 3JPOA 4ECRA 3U3YA 4DS4A 1BPDA 4PH5A 4O44A 4DTNA 7ICIA 4KHSA 4PGXA 2BQUA 2RF2A 4JRPA 3RAQA 4RNOA 5KFMA 2F1JA 1D9DA 3MABA 5CYQA 3V9XA 3DRPA 2GBZA 4EBCA 2FBVA 4FZYA 4NCAA 3PW5A 1KFDA 4IR9A 3L2WA 4CEQA 2WOMA 3AA3A 4Y1DA 2ZTEA 4CIFA 1RTDA 4BXOB 1S0VA 4KHYA 4YG2A 4QZBA 4PHPA 5KFGA 4FLWA 4FS1A 4ECQA 1UT5A 1WCLA 1C1AA 1VK0A 4K8XA 1ZQRA 4AHVA 3LK9A 3OSPA 2ATQA 1XHXA 4TQRA 1YT3A 1BI4A 5T7BA 4NYNA 3T1AA 5HMLA 3AO1A 2IOCA 4RQ6A 2C2DA 5KG0A 7ICQA 3M8SA 3QERA 3KLHA 3LP3A 4I2AA 4CEDA 4IBNA 1TVRA 4I28A 4F4KA 2PFQA 3NH1A 3VQBA 4DFMA 1ITGA 5DDYA 3DM2A 2V4QA 2ALZA 1KVAA 2LSNA 4IFVA 2BQ3A 4F4XA 4KFBA 2G8HA 2B5JA 4E1NA 3SQ1A 5DDMA 5BOLA 1KFSA 4CEBA
chains in the Genus database with same CATH superfamily
3DV9A 4F8RA 2M9KA 4H0TB 4CLLA 2X3DA 3OTEA 3N6NA 4IFYB 4J2EA 4CGHA 2H3VA 3DI6B 2XNRA 2HNZB 3NAEA 1ZQNA 2YX7A 3I28A 3LDAA 3DKDA 3N6LA 1OVQA 4JP8A 2YQ1A 4IJNA 4UF4A 1OPIA 4JKGB 2BE2A 3E3XA 2Q79A 4OYOA 5FRMA 1WEXA 4BE1A 4M95A 1ZQFA 2JV3A 4RQ3A 4C11A 1Z3EB 3SV3A 5J2MB 1ICEB 4FYWB 1QM9A 4P71A 1RWVB 8ICXA 2AIRB 4M0AA 5M2RA 3ZSYA 4NV0A 2BJ8A 4K4VA 3W64A 1B22A 4QU7A 3TO8A 4CZLA 4KB0A 3IWNC 3OR1A 4M6WB 2FZKB 4USWA 1J2MA 5KNIA 1ESVA 4JKBA 5K9FA 4F5OA 4WYWA 3R2DJ 4WQ5A 3KLEB 4UB6U 5KFQA 3VVTA 2ROGA 4N56A 2MZRA 3UXOA 2VUGA 1N34K 2CQIA 4KHMA 1NJXA 4BE0A 3GMGA 2XM3A 4C4WA 4KH0B 4RBUA 4MFFA 1ZPWX 2HMIB 2OEJA 4NMXA 4N5SA 1IR2A 4K4ZA 3AA9A 3W2WA 3D6MB 2RQKA 3HTVA 4RW7A 2HI0A 1CPZA 3MR2A 1Q95G 1V6HA 4DL6A 4DX8H 9ICGA 3QATA 2W9CA 2UVWA 4KLUA 5IOLA 1LAWA 3CC4S 2E6MA 4DV3F 2E3TA 4J7CA 2GUIA 2MGZB 5AKLA 4H4MA 2Y1JA 3SLCA 5AQLA 2EFVA 1U0SA 3DXBA 1XNQJ 2FC8A 4FO0A 4GV3A 2Y0SC 2GO7A 3EZ5A 5CYMA 3R5DA 1DQ8A 5KFOA 2KHCA 3V81A 3BZKA 5TKYA 5CAAA 4KHNA 2HRTA 3HM9A 5CP2A 1T6CA 2CG8A 2QXFA 4CHQA 4JI0J 2ADBA 2AZ3A 1TV6A 2ACYA 5IC6B 2C3PA 2MQPA 3OR2A 1U2CA 2EXUA 2P5GA 1TK5A 5AQVA 3LL3A 3R7NB 1HNZJ 4U8VA 5H9EJ 4I2DA 4JB3A 1A76A 3NWGA 4ES2A 2WBRA 3EKUA 3PSFA 1VLOA 3GFKB 2ILYA 3TU5A 1F9EB 2R7WA 4JI4K 1SXDA 3U27A 1DKGD 3MEEA 1J97A 1ZJNA 1HW9A 1E6VA 3MFHA 5AZJB 4XQ8A 4AL6A 4K0KJ 2CA9A 3Q8QB 8ICUA 3H4DA 3T1YJ 3K0JA 4LR9A 4NZ7A 5DDQC 2P9KA 4IRDA 1QSSA 2BANA 1PC5A 2CQ0A 4QJFB 2DPNA 1Y5NB 3C8YA 3MN6A 4JI8K 2IDLA 2E7WA 1LNQA 3CJRA 1FRHA 3I32A 3TZZA 1M1KT 4PKDB 2XICA 4QZEA 1WF1A 2GV9A 2YHAA 5DO2A 5L1JA 3D6TB 1OXJA 4P7VA 5J0QA 4UUWA 3NF9A 1UPPA 1DK3A 2CJ9A 1X4AA 1ZOTA 1DBDA 4UOHA 4MDAA 1LWCA 2IAJA 1RABB 4WK1A 5HROB 4EWTA 4KRFA 2LEAA 3H5SA 5CZ2A 8ICWA 2K8GA 5DMRA 2J7KA 3C2PA 2LBOA 4OJLA 1NH7A 4PL1A 2ZZMA 3VGMA 3POTB 1PYSB 3K5NA 1DTTA 3E66A 2BBEA 3OL9A 2KZMA 3ZXWA 3UMCA 1L6NA 3LA0A 4B08A 2MAXA 3D6FB 1P9YA 3PMNA 2ZIWA 1KP6A 2WW8A 4L72B 3C6UA 1QHTA 1A5WA 3L2VA 5C24A 5J2NB 4H5VA 4JKAA 2RT3A 1CG2A 3P83D 4F04B 4LF5F 3PM9A 2VFVA 2RQ5A 3MN9A 2VQEK 4O4GB 1LW0A 1MA9B 8ICQA 1YVUA 2F8LA 3BQ1A 3JSRA 3P4IA 2W7AA 5F8JA 1HD1A 3HL8A 4DV6K 2BACA 2GUPA 4LFBJ 2OSQA 4FYDA 2NNWA 4PXBA 3RH4A 1F6TA 2AGPA 2YNFA 2IRYA 1DZ5A 2UP1A 4OHVA 4B1XB 2DCUB 2P6UA 2DKZA 2A19A 2CQGA 4GNIA 1RHRB 4RBTA 2WVFA 2NRXA 2NRHA 3X3UA 3MN5A 2H51B 1PILA 3LP0B 2MQLA 1HNXF 3D45A 3AAWB 1KD1T 4DR7J 3C7NA 4PGYA 2YWWA 1YJ9N 4LBPA 3NUQA 1CJVA 1FWPA 1S5ZA 1MN8A 2QIFA 4UW2A 4J2AA 5D3GA 5AQFA 2NV3A 3KJVA 2FYXA 4C1NK 3SUOA 4QS9A 3W5YA 4M5DA 2XMAA 3H2LA 5AK5A 3BGOP 1Z1VA 1MROA 2U2FA 2MLZA 1L3KA 2AEMA 2Q6CA 1RNHA 4NLWA 3O08A 2ROEA 9ICKA 2DWQA 3WKBA 4EO8A 1QVFR 3H0PA 1RM6C 1RWUA 2CJYB 4OJ6A 3C2MA 3LM2A 3NE6A 2B4PA 2QEXN 4NWBA 5J2PA 4EMDA 4AYBF 4BJQA 1OVYA 4X66K 1TK8A 9ICHA 1M1KO 4DPUA 3KK2B 2V9KA 4LF6K 4KH6A 9ICFA 1QAXA 1TV9A 4M5JA 1S6PA 1N88A 2YQ3A 3HULA 4OJOA 4ED2A 3AT1B 4OPJA 3TAPA 5F8LA 3EICA 5IC4B 1X4BA 2RMLA 1FF2A 2CQ1A 3CD5A 1Q86T 1WSJA 2IGIA 3ZSQA 3MR3A 3H7HB 3DDNA 2A6AA 3KZXA 2I7NA 4CJRA 4N47A 3FMBA 3VOVA 3NGRA 3Q89A 1R8HA 1SL2A 4CO4A 3TQ1A 2HW3A 2ASMA 5GADU 1KQQA 1YJVA 4DFPA 1RPLA 1S1WA 1RCHA 2XYGB 4ALZA 2DNQA 2EFQA 5KPTA 2FTRA 1AZSB 4NCBA 2D3UA 1RG6A 5ALFA 3GQCA 3OLAA 1SKRA 3KIOA 3BV8A 1BUXA 2DO0A 4HDGA 1GLCG 2JWKA 1VQKN 3GR0A 4K8RA 1KEJA 4ID5A 4JI5F 2OP5A 2YTUA 4OCZA 5AE1A 4CZJA 3M6WA 3WKEA 4R8UB 1FNOA 3IR5B 4C0HA 4X65J 1BQNA 2ZZNA 3VZHA 1H7XA 4TSXA 4ZPVR 4O0JA 1IWGA 2IA6A 4CO5A 2N4DA 4PWWA 3WKAA 2ROPA 4O23A 3KD1E 2YNHA 1IKWB 3M2RB 4YOEA 2KV2A 4QWEA 2F63A 2P66A 1XMQK 2OPPB 1P90A 1F1BB 1U2VB 3K9KA 1T03B 1S0NA 4J9KA 1F5CA 3DLGB 3V4IB 2PBDA 2DGQA 3CW2C 4ZIVA 3KJNB 2ZIVB 4PL8A 5KAFU 3E8OA 5M1OA 4BY9C 1XS9D 3J7YP 1N5QA 1HHTP 3DGVA 3KUEA 1FRJA 5ETRA 2H54B 2DNLA 3M8PA 4RPFA 3AO5A 3K4GA 1ECWA 4JV5J 2D9OA 1XBWA 4IG3B 2JEGA 2HNYA 3Q83A 3VQ9A 1U1PA 7ICTA 5AZIB 2OEHA 4CLWA 4QU6A 5JMVA 1HUOA 4QJVA 5AI9A 3ED5A 2EX3A 3OPXA 2YMMA 3KK7A 2FLLA 1T3VA 1A5XA 2HYIB 1X0FA 3BEGB 1CJUB 2M8DB 4YOWA 1A7GE 4DSJA 5BR9A 2GWSA 5KFUA 1Q86O 2GQ2A 3TP2A 3MMBB 3OFEA 1NBEB 2DIUA 3BREA 5H1SV 5AI4A 1NK0A 2FQQB 3VQEA 5EX5A 2WOMB 1PSDA 3KOAA 1HQUA 1COKA 3OBYA 4EBDA 3G2XA 3KLVA 5LMUJ 4Q2MA 2JH7A 1D5AA 2UUAJ 3ISNC 5GAEP 3DWLA 3UE5A 2AQ0A 1XSPA 3OTBA 5IXUA 4CT9A 1ULRA 5AKYA 3MM5B 5K14A 2BM0A 3F53A 1SJ3P 5DETA 1U1MA 2A6OA 2R2TA 3FYHA 4DFKA 3ZNJ1 1DT9A 3IAS9 3U6FA 1TVRB 4FWSA 2Q3SA 2GVZA 2WAQF 5ELZA 4CHPA 3RJJA 3FLCO 1LWEA 4DR3J 3DXKB 2L9WA 3ZZYA 4X62F 4JV2A 3P1GA 3DM2B 8ICKA 1FI4A 3FC9A 5C12A 1CJKA 3AAPA 3ZT1A 2QA1A 2QLWA 4WQ5C 3Q86A 2XZTB 4FJMA 4LVOP 3CDBA 1S9FA 2GQQA 5DZ7A 2B5JB 4FXWA 2ZWHA 4GY2B 3GIRA 4F71A 1I5OB 2P9CA 4FF4A 4NLQA 2VZ9A 4X4TA 3OVBA 2GHVC 1T11A 3MR6A 2NLWA 1RYRA 1X60A 4CLZA 4CFBA 3CUNA 2MTLA 3HZEA 2F7VA 1DARA 3CCMN 2YTCA 4W4MA 4AL5A 5J2BA 4LSNB 3RBXA 4XPEA 3TAEA 3OQ2A 1QZ5A 4XUSA 4JNEA 4P2MA 3WX4A 2RU3A 3RRKA 4DX6A 4J03A 2RP5A 2YH0A 4DCHA 1NM2A 2XLJA 3DLHA 1KHVA 3RU0A 1WWHA 5KFAA 3JAMU 4R64A 2DHGA 2LA6A 2E1RA 5GMEA 1KAYA 2HAIA 1VC5A 4NLRA 2UUCJ 4IQWA 3KK3B 2HGNA 2PIIA 4CGDA 3IHQB 2P2CB 5DM7L 3PDNA 2GWJA 2W3SA 3AQFA 3EGVA 1EWQA 5KFBA 3QO9B 4YHHJ 1LWFA 4JI7J 2PEHA 2LQBA 5ALSA 3VQSA 1BC6A 3PX4A 3QWPA 3LAMA 2DT9A 4MF2A 4URQU 3HLUA 1M5KC 1RBTA 1L3TA 4CE9A 2AV5A 8ATCB 4YMMA 3CEDA 5JLFA 6AT1B 4BBYA 3VQQA 3MM9B 1BQMA 2MZQA 4DCPB 1JLCA 1R27B 3T1HF 3HX9A 2WZ1A 3D0GE 3ZDBA 5ALOA 4X4RA 2FGOA 2DXFA 3THXA 3G82B 5EDWA 1OUQA 1LOUA 1CZ9A 1Y9OA 1U04A 4CHOA 1F44A 1SQKA 4FNHA 1U1QA 3QIOA 4YD2A 3HFVA 2ZH9A 1IQTA 1RILA 2FMSA 1ED1A 3T19A 1WG1A 4YR3A 3D7SB 1M90O 4MHVA 3GYXB 3HKZC 3MD3A 4NXMF 3GZFA 4QZAA 1REVA 2J9DE 5BPLA 3UKUA 2HHHF 3C5FA 2HBRB 5A76A 4B3TJ 1XSLA 2ZM6F 9ICMA 5ALYA 4J2DA 5KFWA 9ICXA 2DGOA 2W9MA 3JSMA 4FKYA 2F40A 4FLXA 3BKFA 3RWUA 3MPUB 2FUG9 4BR9A 4CDIA 3VR1A 3IR7B 3ENAA 2XY8A 1K47A 7ICLA 3LP1B 3ISCA 5B0BA 3L3VA 2MXYA 2EBEA 5AKIA 1AFIA 4CLKA 4ATNA 1SH2A 1VBZA 4OYMA 2E8NA 1NHKL 3QU9A 3LALA 1EQ0A 3FZFA 5HP1B 5D15A 5GVQA 2WF7A 2G8VA 1S6OA 2E4LA 3OYHA 3OSNA 1AT1B 4ELUA 2R7YA 3IM8A 3TVYA 3UMBA 1HIWA 1YJ9S 4GVLA 2XMVA 3TSPA 1X4EA 3IDWA 2GGPA 1AUDA 5JVHL 3KK1A 2W7OA 2EFPA 3W2VB 5FLXO 3QU5A 3CQXA 4YEAA 3CHWA 4FZXC 2IIHA 3I1YA 2DISA 1U25A 5EHHA 4DR5F 3NVMA 3UKRB 3DLBA 4K5SA 4JHDA 4RQ4A 4LF2A 3M1YA 3QE9Y 3CJ7A 2QEXS 4YMNA 1HNVB 2F4VK 1GEHA 4DCCA 4F72A 1GLDG 2DFFA 1PJ6A 3VHQA 3L4IA 3CCRS 1KSPA 1WBDA 2XSJA 2PFNA 5DG9A 1N54B 9ICUA 4CZIA 4IR1A 2FJBB 1GXUA 4OX7A 4USMA 3PFEA 1KR4A 1KS2A 3A1YG 5IFMA 4C3LA 2ZH1A 2QL5B 2R18A 1ZQBA 2MKSA 2MQMA 2ZBIA 1HI0P 2VG7A 3PEJA 4RL1A 3J81j 1FE0A 2LECA 4CJUA 2RQ4A 1FJ7A 4NLZA 1UVLA 3PYFA 1FJGJ 1UFWA 2FJDB 4LF7F 2BJ9A 1JALA 4RLEA 1IG9A 1FW6A 3SSRA 1VOMA 4Z94A 4FVUA 1JCGA 4B02A 4YQWA 5HJXA 1HHQA 1PUZA 1RT7A 3PJXA 1VRTB 4UB2A 4Y34A 2KU7A 1EWRA 1X1PA 4Y2MA 2OZSA 3UXNA 1N61A 3RR8A 3MCNA 1VSMA 3JB9k 4X64K 4P0PA 3WKDA 2MHNA 2QZ8A 2DR7A 4EENA 4FLZA 4CO1A 3MEDB 4RQMA 4BHQA 4YOUA 2C2MB 2R8HA 2KHDA 3NOCA 3SMPA 2FHMA 1SC3B 4H03B 2OTLS 1VK3A 1R59O 1GK8A 4UOCA 2FPMA 2AHOB 1YITN 1TAMA 2J76E 2MHEA 3WC0A 5CD4H 5J2AA 1IN0A 2H3FA 4Y3CA 2BYCA 3Q0AA 1NNLA 1RTJA 4B9QA 4CJKA 4BR2A 4NXNF 2NQPA 3DRXA 5ETLA 5HN0A 3SQ4A 4AD6A 3PJ9A 5EOYA 1QS4A 4CM0A 4NXZA 2A42A 5AM2A 3D28A 4FJIA 2P9LA 4FLYA 2DBYA 1BG3A 2VF3A 5M2PA 5D77A 3TABA 2YKOA 4GXIA 3BBCA 2N82B 3MX5A 2ZJRL 1KLMA 3OYIA 3EW9A 4V19J 3E9LA 3QGGA 3E1YA 3NH0A 4XK8C 1LVHA 4RQNA 5ETOA 2Y8WA 5AI0A 3QSIA 3C1ZA 2ZUBA 3Q8YA 3E01B 3HRGA 2M4MA 1N32K 3C23A 4ELVA 3J7Z5 3EDQB 3QEAZ 4AF1A 3IP4B 4H0YB 5IWAJ 3V5RA 4C7YA 1WSIA 2O8EB 1R31A 1ZBFA 5HMMA 1TKXA 3ZSOA 2YKNA 1XTZA 4A48A 2Y9UA 3V9ZA 5J2JA 3NLCA 2XHCA 4GV9A 3C65A 1HW8A 4PEOA 1WOSA 3CCSN 3V7JA 1P7DA 5E3CA 4Q8EA 3SQOP 3U02A 1WC0A 3A3NB 3EGNA 3QJLA 3PEHA 1EX4A 3NHGA 3FCWA 3SJJA 4OQJA 4O5KA 1J27A 1W0HA 4WJ3B 4DSFA 5KTQA 1MQ2A 3LPYA 1Q7YT 1SIZA 3WNHA 3NS5A 4CLSA 4GLXA 4Y2PA 2HHXA 4MF8A 3ZZUA 2FB0A 4Z4CA 4I9LA 3GJQB 1NGFA 3MWTA 1UHUA 1FXRA 1BD6A 7ICUA 3IMQJ 1FDAA 5CXTA 2PSZA 3SQGB 2W3RA 3FBCA 1JCEA 2NRWA 4XH4A 3H0RB 1Q8LA 4QOTA 1U4BA 2LPEA 4F3QA 3VQ4A 3WK7A 4PPZA 1XK8A 2J6SA 4JD2B 2IOFK 2O66A 2NPFA 3DRYA 2CRLA 1X8DA 4U7BA 4WCEQ 4RUAA 1IG8A 2DNPA 1D1UA 1OH6A 8ICTA 4F50A 4B9NA 1J54A 3AO3A 1AUSL 1KRPA 1J5EF 3M6KA 1I94J 1G2EA 3QAEA 1QAJA 3UPFA 3IBFB 4TURA 3CCMS 3TTDA 2AEJA 1S99A 1SJ1A 4EGLA 1VYAA 3UB5A 1ZRNA 1QE1A 2KSOA 3M6ZA 4OZNA 1U1LA 2GW8A 3NRWA 2XZWA 4CLFA 2FLNA 1TL4A 1ZQKA 1CC8A 3SENA 4YORA 1N56A 3MEGA 4WP8A 1WHXA 1KXPA 2HS0A 2O8BB 3QU2A 3CERA 1Q53A 3WK6A 2FJ6A 3ILIA 7ICVA 2VQFF 3Q23A 2VONA 3CJCA 1U1RA 3CE8A 4CTAB 2Q6BA 1F5SA 1XI1A 4NM2A 2FBXA 4XTTA 2XI2A 1S9GA 2VOOA 2F96A 5BREA 1M0SA 2OD6A 4BRFA 3EL2A 4WFNL 2PO4A 1R0BG 3J80Y 2LQ8A 4NE9C 3PMLA 5J0OA 3E51A 5HJYA 1NGDA 3CB4A 2B7CB 1CJTB 4MT1A 3L3CA 1JLAB 2K7KA 4UZCA 3SR6A 1B0TA 5E5NA 3PIOQ 4HACA 1U6BA 4Q8FA 3IXQA 5B0FA 5CR4A 3P8BB 1KQFB 2ZH7A 2DPIA 4PUOB 4DX7A 1ZQEA 1XUPO 2RVJA 4M5HA 4ZS6A 1Y3KA 2EZZA 5LMNK 4TY9A 4LF8J 1VBYA 1T9WA 3HOTA 2HGLA 3ISBA 3SUPA 1S1XB 4RJVA 4QZHA 1S10A 3R5JB 1QVFM 4DR6K 2ZE2B 2Y0SF 4QIEA 4FO6A 1Q18A 2AQ4A 3FFIA 4B3MK 4LZDA 2YWEA 4KH4A 2QTDA 1VHFA 2Z2MA 1PZNA 1K0VA 3EGWB 1ZRMA 2JRZA 2CJBA 2D1CA 3TEGA 4JI6F 1T7PA 3V6HA 2Z0GA 1K73T 4B17A 3F5TA 4IYQA 1IBMK 4HUEA 1SWVA 5GINA 4USJC 3AU6A 4DV1J 4PYAA 4AILC 4CO0A 1F5BA 1EZZB 5JU5A 1DURA 4BRQA 2XGQA 4ZN3A 3CC7N 4IDHA 2A18A 5M2UA 1XNRF 4DCJB 4ECXA 1UPHA 4C2MA 2CZ4A 1KN5A 3UPQA 2HVIA 3KD5E 1CULA 1RWNB 5B5EU 1COOA 1TL7A 3NAHA 3KLIB 4CP5A 4OZ2A 4BRHA 2XHWA 4H0PA 2FHJA 4QAGA 3H7IA 2KH9A 1BE4A 2N3LA 1T3QA 9ICWA 2XY6A 1HUZA 4ANCA 4Z4HA 4RQ1A 3AA4A 3L8BA 1NBWA 2JEJA 1NSQA 2C2OB 3IRUA 4KITB 2K89A 2O8FA 4RR5A 2X6SA 5D6GA 1N63A 2XIDA 3GV7B 1LCUA 3ETOA 1F9HA 3LGMA 1HBNA 1S1UA 3PO4A 1RKIA 5BR8K 4MK7A 4AH9A 2J7WA 3US5A 1BNOA 1KVCA 4I7FA 3QUBA 5KQ8A 2LMIA 1CVJA 4I2JA 5HOOA 4LMZA 1VLYA 1Y3JA 3SQ2A 5KT5A 8ICPA 3MTJA 1YHQN 3GONA 3MUMP 2ZXIA 2RDIA 5ALRA 1VHXA 4CFDA 3QINA 4KLMA 9ICIA 4TLQA 4US9A 3JPSA 3R9PA 1QHAA 1FJEB 3TZXA 4W5RA 3WHIA 1MMDA 2HQ3A 1DK2A 4N77A 2PMZC 4TUQA 1H0HB 4LSZB 1K8AO 4NY8A 1X40A 5F9NA 1FNXH 5DLGA 4G9BA 2VL1A 2JSXA 4FJ5A 2F9JA 2F8MA 2CGJA 4Y2AA 1QLNA 2HG4A 3QZ8A 5GAGP 3UFCX 4B1YB 1OSCA 1CRXA 1ZQJA 3C16B 2FSNA 2P9UB 4USVA 4LRAA 3C0BA 5FPNA 2FSKA 3HO1A 1Y4ZB 1WG4A 2APOA 2BCSA 1GLEG 2OZMA 2XSFA 4DV0F 2WFAA 4AFFA 4C8ZA 3SEIA 3ENHA 2W42A 1SV0C 3I4PA 3PTWA 3BH7B 3HP9A 4JKCA 2GMHA 5CZ1A 3OTDA 2H5JB 3L2UA 4O9MA 1SL1A 3RB3A 3L7PA 2P9NB 2V8GA 2W6LA 2C1EB 2XGPA 4ISGA 2KHQA 3IFEA 2P9SA 3LDPA 2KMDA 3N5FA 3UN3A 3P3DA 3I5BA 4IG0B 2C2RA 4GXJA 1YJWN 1G15A 5M1PA 2DGZA 3BQTA 3L2QA 3CIZA 2R7SA 2R7VA 1WC1A 2DKOB 4Y2JA 1RTZA 3I8BA 3J7YI 1UVJA 3VGLA 5FIIA 1RWWB 4TUPA 1S0OA 1HWJA 4DUTA 1QQ7A 1D9FA 3TAFA 1RACB 2DGSA 8AT1B 1VSHA 3IG1B 5C2FA 2D0BA 3NFAA 2NRZA 3LGNA 1MN7A 4QZDA 5EX3A 4E1MA 4ZVPB 3TAMA 3UR0A 5KG6A 3UI3A 5CHGA 2IVMA 5EY4A 1ZJMA 4OPHA 3QT8A 1Z2LA 4HVZA 3AQPA 2D3O1 1YTAA 1FRLA 3ITHB 1U2RA 2YX1A 4B3SK 1HNIB 3MM7B 2KVIA 1K8KB 1BL3A 1IUJA 3CSKA 4DL4A 5A0LA 3LP2A 7ICEA 5AI5A 1N34J 2W55A 4KHPK 3AOCA 4B9TA 1ZQSA 5BXIA 4LIWA 4MO5A 5LJWA 1GLAG 2Y9TA 4E7HA 5CH7B 4Y65A 1ZBLA 2IVNA 3D2QA 5JS1A 2I6WA 3B82A 3NTUA 2WSEC 4KTWA 4LF1A 1N5VA 3M6VA 4F9OA 4CZCA 4DO9A 2HOEA 1RHUB 1YDLA 3D0IE 3B4DA 3P96A 3SD7A 3VAFA 3M3ZA 2BJEA 3M2VB 1QQCA 5AQJA 4J9PA 2DNMA 2D4WA 2DBBA 4OX9K 1ASUA 4LFAK 3KLFB 1PVRA 3HX0A 4BE2A 1NWKA 5ALTA 3V9SA 3RJKA 3H08A 3AVKA 4M5MA 7ICHA 3ZETB 4HHHA 4L3KA 1HNWK 3TADA 4HT5A 1VIOA 1NNDA 1TL5A 9ICQA 2VPXB 4YUDA 4DTPA 5KFVA 3O3HA 4IS7A 2KT3A 3J81U 3AA5X 4J2BA 4FNIA 3ET6A 2DRAA 3KNGA 2MKCA 4Q2LA 3SBGA 3Q22A 3RRGA 3D0HE 1LK7A 5B7WA 1WDTA 2NS1B 1Q3VA 4FJ9A 2XWYA 4ZTFA 1UMJA 4AP9A 2GJIA 4C3MA 1S4FA 1Z26A 5CCMA 2EANA 5E33A 4JI8J 1ZETA 3UDLA 2Y1IA 1UPMB 3DOMA 5HVHA 3VMFB 3H8JA 2RH3A 2YY6A 2POKA 3FZLA 5AKZA 3O0FA 1L8OA 1R8CA 2E1PA 5LSOA 4DTRA 4JAXA 3O6QA 1Q82T 4DV2F 4ECRA 3U3YA 1AW0A 1BPDA 4PH5A 4KHSA 3U8XA 1NG9A 1CBKA 3A0BU 5ALIA 2OMOA 2RF2A 2KG0A 2WC9A 2IFXA 4S0MA 3WXJA 2OMLA 4CH7A 5E2QA 2K60A 3C28A 1D9DA 1JKHB 3MABA 2GBZA 2EAMA 4FZYA 3KLGB 3ZX0A 5F8IA 1N62A 5ALZA 4JK9A 4CEQA 4UY8O 3AA3A 2ZTEA 1RTDA 4C8YA 1S6QB 2VKQA 3DDHA 4OI2A 4YOXA 3MCMA 2JC0A 4QZBA 4PHPA 1S57A 4FLWA 4FS1A 4ECQA 1UT5A 2CVEA 4ZN1A 1WCLA 4K8XA 4AM6A 1XMOF 1XHXA 1RJJA 2VQEJ 1YT3A 1BI4A 2FDRA 3T1AA 2YWKA 1UVNA 1PK1A 5AQMA 2FJAB 3AO1A 4RQ6A 2DITA 1C4CA 2C2DA 2MLXA 2AW0A 4ZPCA 2E5GA 4DV6J 5GTIU 3CCZA 5JMNA 3HOSA 1GLFO 3MCSA 4IBNA 4F4KA 4PZOA 4DV7K 3AMZA 1QQ6A 3VQBA 1RBOB 1Y5LB 3R7BB 1YTYA 4WTYA 3OTOK 3QLHB 3QBCA 4E1NA 2GQCA 5DDMA 4EELA 3NVZA 2L08A 4JYAK 4USUA 2JEIA 4ED8A 1VBKA 2UVVA 3ZSRA 3OYNA 3O1LA 2W43A 5ETQA 2ZQBA 4ZPTR 1OQ6A 2QX0A 3NBPA 2DNKA 4IH5A 9ICPA 3DLRA 3UQ0A 2UXDF 5FJ4A 2MDAA 3I0RA 4DMNA 2UV8A 4WQ4A 3SIPB 2MKIA 4F91B 1FO4A 2FC0A 5AM0A 2CQ3A 1FRKA 2G1HA 2AX0A 3S1TA 4IJAA 3DMJB 3DGPA 4TLRA 5FRNA 3I0SA 2E20A 4YB6A 4F0HA 4CO3A 1C1CB 3NL0A 1PYTA 3PSIA 5KT2A 1GO3F 3LANA 3OGUA 1BPYA 4DHYA 2WBMA 1M5PC 1FXXA 4X66J 3QRRA 4X4NA 4LF6J 3QESA 2VFUA 3G6XA 1MWMA 3CO0P 1MU2B 3AO2A 4KMOB 3ULHA 3A5LC 3F9KA 1BDGA 2C3OA 3KKAA 5KFCA 3OJSA 5IIJA 2VHGA 1OO0B 3BZCA 5KFHA 3E2EA 3G4SS 5CHCB 2IY5B 3PNCA 5L1KA 1NK7A 5DB9A 4I2GA 1W26A 3SPZA 2N4CA 4CHYA 2H48B 5IIKA 4JI2F 2FJEB 3LGHA 1CZBA 3KDNA 5A6WA 3BS5A 3IGVA 4RW6B 1S76D 2D7SA 3I5AA 4ECVA 5AKKA 3BUZB 1B3TA 4YB5A 3LM9A 1HMVB 4PHDA 2QKKA 3PO5A 4A8MP 1YHQS 3HKZF 4OVLA 4GVBA 2VPWB 1VC6A 1SKSA 1UETA 3M1VB 1NGBA 1APSA 3NGIA 2UXBK 3OBIA 3TRGA 3I33A 3NKYA 1XC9A 3HHLB 1YI2N 4HCBA 5GTHU 1T44A 1RWOB 2AJ4A 4RBVA 1IVZA 2V6AA 3ZTQA 3I5CA 1FFGB 2V7ZA 5J2QA 1ASWA 2VKRA 1FO1A 3PR5B 4FLVA 1VRUB 1URJA 1KHWA 3TR5A 3T79A 1NU0A 1B43A 2AF6A 3SFGA 1X5OA 2CGKA 2NYIA 3FCVA 4YXJA 4FKXA 4I1TA 4UBCA 1NB2A 1VSFA 2NXUA 1XMQJ 1FTCA 2NREA 2A0FB 3B6OA 1BWFO 2A40A 2AKWB 2EZXA 2KHOA 4TQSA 2F3NA 3BGRB 2IIRA 4IDKA 4RU2A 3GDXA 2VG5A 3JPRA 1IJEB 5KFYA 3F73A 2DNYA 5D4LA 3GPAA 4FYXB 3H8WA 1RWMB 4ZA1A 4K4UA 3EUNA 1B70B 2NLXA 3CCEN 3IRWP 2YKMA 4KLTA 5A2QY 3FUYA 2E2QA 1QUVA 1RXWA 3R2CJ 3IAYA 1KOOA 2DRDA 1NGHA 3HVRA 2KKHA 3ZT3A 3R97A 4YOTA 1MWZA 2GNKA 1S22A 3ETLA 1YZ7A 3BGLA 3HVAA 1TKZB 5D0EA 5KT3A 3TVZA 2FPLA 2EVZA 2GIQA 1C20A 2W4DA 3CF5L 4RQ7A 4MIWA 9ICVA 2J0QD 1FD8A 2V8PA 3ALRA 2UU9K 5AFUA 4B9UA 3O3LA 3GR1A 3VV2B 2BXJA 5AQPA 4QIWC 2OXOA 3BF1A 4CH0S 3H40A 3NS6A 4I2QB 3VQTA 2I2YA 3RB4A 9ICAA 3T5HA 4I6YA 2B7BB 1TMJA 5KG3A 1KQKA 1Q8BA 2WONA 1Y0HA 5E3AA 4GKKF 2ZNZA 5B0GA 4CFCA 4NO7A 4H4OB 4B8CA 2FF3B 1NK6A 2JHEA 2YHWA 3O9TA 2E7VA 3R6GB 1W25A 3R1XA 1GMWA 3AJDA 3K5PA 1YJNN 3A12A 2ABYA 5HVFA 4UASA 2UUBF 3GJSB 3L3FX 2HHUA 4K2XA 2DIVA 3MMCB 4J9RA 2AXTU 4EP5A 3HHLD 2V2KA 2V8HA 4F92B 1KQGB 4OJ5A 1GX5A 1ZBSA 3OYBA 3CD0A 3AJ2A 3GCXP 4QNLA 3B54A 5DG7A 1T9UA 4WFBL 3JQJA 4FWPA 4TYAA 3QBXA 1TTHB 3PXGa 2BCQA 4F26A 1KTQA 1RU1A 3AB4B 1SGGA 3RG6A 7AT1B 2XS7A 3TPQA 3BSOA 3S3NA 3AL0B 4A8YA 3GSIA 1BUPA 2K06A 9ATCB 3HJFA 3EXYA 4FE3A 4JI1K 2A1JB 4M3ZA 2HWHA 1CS4A 1IBLF 4UB5A 2E1MC 4RW4B 8ICFA 3HSZA 2XLKA 3UCUP 2OO4A 4URGA 3FR0A 3QDKA 1LK5A 2J0SD 3AJ1A 1ZQGA 1RSCA 3S01A 4KT0C 2BKNA 4FPIA 4EO6A 1FDDA 1VQLN 2ZJPL 5AQWA 4I2PB 1VQPN 4K2JA 3AVNA 2BMBA 1R8PA 1JLQA 2QL7B 3ISZA 4ETZA 2UXCF 4JEPA 5ITHA 2UVUA 3K75D 5DBBA 1WSRA 1V4TA 4W5NA 3TADC 3CIPA 3QNWB 4Y2IA 1XERA 1H2TZ 4CEOA 5AQSA 4FYVB 2ZDOA 4ITSA 3R8EA 2CNOB 5BRDA 1NJIT 2HNDB 3CO9A 4KLIA 2DNRA 1ITPA 5I42A 3HHNB 3VF4A 5M1KA 5CB1A 3QAUA 2MSSA 3DRRB 2IHNA 2ISOA 3CCTA 2H65B 5GIOA 1E6YB 1H3DA 1N33K 4FBTA 3M2VA 1K6YA 3D2NA 4AHCA 3HZ6A 5BPMA 1L7OA 5J0YA 4IXCA 1ZQYA 4ZHRA 4BC9A 3PY8A 4DZDA 3Q8RB 3G6YA 1NJZA 3T6BA 1R6YA 1O13A 3GTYX 3ETMA 3DLLQ 5HMXA 4P2FA 2RJZA 3VCBA 1UEVA 4CF1A 2FJXA 4BCAA 5M1FA 5HR6A 2P5VA 4DUYK 2FMQA 4B3OA 2JDJA 9ICNA 5J1EA 2HIYA 3JSYA 2EH9A 1ZOLA 4OX6A 3ZZZA 4ZP9A 4EHTA 2ZH2A 4YDXA 1N0UA 1D09B 2M2BA 1WACA 3G0ZA 2YX6A 2PFUA 2KXFA 4PQUA 4I6MA 2GCFA 5A8RA 1HQEA 3BR8A 4YR2A 2HLTA 2VJVA 5C10A 3H1QA 3GFYA 4ZLJA 1RDWX 5AJ3F 5IT9O 2DFLA 3CMEN 1Y88A 3D3CJ 4DL3A 1FT8A 3NNAA 3PKMA 3MR7A 1C0TB 1YJUA 4C7ZA 1N36F 2KOBA 5IM0B 4FOEA 5L39A 3M2UB 2M0NA 2QA4N 3VQPA 8RUCA 3ZEUA 4ZJLA 2CJXB 3EZOA 1SAZA 4OX8A 2G2OA 2M8HA 1UOCA 3H0MB 1TUGB 4BC5A 4GO7X 3W1YC 2DNNA 4LIRA 2OJ3A 1HARA 2Z7JA 2W4PA 4P75A 4I27A 3UNYA 3JS6A 2FPKA 4O44B 4LF4F 3J7YU 4OI1A 3WZ0A 5FPDA 4CWBA 1S6QA 5AKGA 1WOOA 3P38A 3OL7A 4L76A 1RBAA 2O67A 3CJBA 2F65A 3ALYA 5MLCQ 3OW2R 2I5HA 2OSRA 3PW4A 5DDPC 5JJBA 1FFUA 3GB0A 4YB7A 3CPEA 3ZZ0A 3F9MA 4M5IA 4L8RB 1MNEA 4F02A 4WJBA 4P4PA 1P9QC 5BYQA 3OVAA 1UJ6A 2QWPA 2QYCA 1W97L 5AQKA 5B0CA 4QQBA 2V8DA 3SAHA 1F3VA 4OJRA 1BY9A 4CRXA 2F4VJ 4E3SA 3TR8A 4E7IA 1WHWA 3O80A 4JI3F 1QVGR 2OPQA 1X3NA 3ASMA 3M05A 3L2RA 2G1DA 4R0EA 4OPKA 4IKFA 2HBKA 1RT4A 4DUZK 4J5OA 3MAAB 4NMLA 3A0IX 2CUYA 4NA1A 5GMKa 1SVDA 3EZWA 2YHXA 2E2OA 3O8MA 3CPWR 2FLPA 4DTOA 4ED1A 3G6VA 4IFVB 1RE1B 2XMKA 1BHNA 3ZCMA 2WUSA 2C2EA 2VIXA 3W60A 1DY3A 4JOUA 4LSLA 3O5TB 2GVDA 3KWIA 2HS4A 2YHBA 2X7IA 5GAEU 3T6JA 4O5CA 4DR4K 2GO8A 3VAKA 4WYBA 2B6GA 3MGJA 1Q81O 5ALVA 2DHSA 7ICMA 4XEIA 2KVSA 4BRKA 4PCQA 1RISA 1ZA1B 2CQHA 2QMUB 3N6MA 3PJWA 2JZBA 2KM8C 3TEHB 1URNA 1UZHA 4W92B 1KWMA 2BE2B 4X64J 2E5LK 4QOZB 5AXNA 4CO2A 4IO9Q 1WTFA 4JWMA 2X1BA 1C0MA 4C11B 3R6MA 3ILLA 3EJMA 4FPAA 5IT0A 1JLGA 4FXDA 2HDOA 1VI7A 3MAHA 4IOCQ 3MZIA 4Y00A 4HVJA 5GAGI 4BR5A 4DF4A 5DQHA 2VCPA 4H0OA 2HVEA 4L74A 3WIVA 3OR1B 5IV4A 2ERRA 4DPWA 5AK6A 4CK1A 5LJ5Y 3IWLA 3JXUA 2QB0A 1S6UA 1HR0F 2ES6A 4PHTX 4GVMA 2IM3A 2WFBA 3OVSA 1MC8A 1U6FA 1Z4UA 2KIWA 1IXKA 2A3ZA 2IMOA 2AYEA 4MKBA 2FPHX 3IS9A 2YPZA 4DEZA 1KBRA 2ZH8A 5J0PA 4QWDA 1U02A 3W2WB 2VODA 4FM0A 4DX5A 2WSCC 2ZWPA 4RW7B 3DLKA 3W5XA 1KDNA 1FERA 4ZPDA 4C48A 1WWUA 3HXMA 2V67A 3QXGA 2W9CB 2WF5A 2KVCA 2J5AA 1L8LA 2XMJA 2MJUA 1XN9A 4H4MB 3MECA 2KEYA 2QFJA 3A4TA 1N32J 3PCOB 3KWMA 3QJPA 4FW1A 2KIVA 1DRGA 4P2SA 5CYMB 1BPXA 4YY3K 4R0JA 4Z0UA 1GLLO 4OYAA 1GFWB 3V81B 5B8HA 1VQ7N 1SH0A 3HPHA 3D4JA 1TV6B 4PKIA 4Q45A 5E3PA 2QKQA 2JWLA 3OR2B 4AXJA 4TNOA 3D2FA 2WK4A 3AOBA 3VQ6A 1D8LA 5DB7A 1HKAA 2YNIA 3VEZA 3I96A 4DTJA 4ED5A 1IWAA 1RHJB 3PIPL 6FDRA 2F3JA 1ROFA 3BQ0A 3ZT4A 2FF6A 2GX9A 2WF9A 1EJ7L 3VC8A 3CCQN 3M8QA 3BBFA 2HBLA 3MEEB 3CCJN 3KOOA 1E6VB 3ZC4A 3C46A 2HRYA 3H59A 1CUKA 2G2YA 5G5HA 1C6VA 1WAJA 1HWLA 2HQFA 3IUCA 2RRBA 2Z4PA 4F4YA 4LFCF 1S4EA 2LKZA 4BRDA 5ALUA 2KZZA 3CDEA 2G07A 4EEYA 5HRRA 3UCGA 1H98A 1YJNS 1B99A 1RTHB 5KOXA 2DHAA 1DQ9A 5LJ3Y 5DK5A 1X9MA 1ZQDA 3G10A 1A6SA 2HZVA 3ZSWA 4NLCA 2KLAA 1KNZA 5J2FA 5F0XA 1LWCB 4DFJA 1UKUA 2IAJB 3K59A 1UVIA 2HMPA 2YHYA 1ZQCA 4FJKA 2H3ZA 2QT7A 1QAIA 5C15A 1MW7A 3BGUA 2GELA 1WNSA 4M63A 4F3OA 1LKZA 1ZPVA 4EZ6A 4PXEA 1DTTB 2H3GX 2DUYA 3RB0A 1U2FA 3N5BA 4NI2A 4MFBA 2NZTA 3FEXB 4AUKA 4I2BA 2ZIWB 2RKIB 2DYAA 4C7QA 3C6UB 3NS7B 2P6TA 5D49A 3TUPA 4FCYA 5C24B 3CTRA 1I94K 3H98A 2ASJA 3FK4A 1YZ6A 2HWTA 4CT8A 2ZHAA 2ITGA 4MJKA 1LW0B 2H4WB 2FHKA 5DZ6A 3VVUA 4CI0B 5IQQA 1A5VA 4P4OA 1VQLS 2MUTA 1GXLA 2O8CA 1VQPS 1N5YA 4OL8A 4B1ZA 2YNFB 5J2HA 2QL9B 1FCAA 3CMAN 1X42A 3H5YA 5DG8A 2P35A 3UQSA 3BKUA 4ED0A 3MGVA 1D3WA 3GU3A 1KOHA 3HHEA 3AVFA 1GTHA 5AICA 3TA1A 3TA0A 2HCFA 1W2BR 1U8SA 4B3RF 8ICOA 2Z1JA 4NCGA 2QKBA 3C7NB 4C8NA 1IBKK 1RHKB 3BDPA 1CJVB 3JYTA 2ZVIA 4MKAA 3RJEA 3PYEA 1E4GT 3QMLA 1UW9A 4OJ1A 5D3GB 2A1JA 2FZGB 3L7OA 3KJVB 2CPXA 2G8UA 4M5DB 2ZTCA 2ZD1A 4A8WA 5A8KA 1MROB 5EN1A 3WC2A 4RUCA 4FP9A 3WU2U 1IXRA 2RQCA 3QEIA 4DR2F 4HTLA 3VESA 4BRIA 3S6JA 3W9JA 5CJ7A 3ZDAA 2CYYA 5LMNJ 4O0NA 5J2PB 2MKKA 1NO8A 3WQTA 3B0XA 3BYPA 3FE1A 1F0XA 3NCIA 2JGAA 2GIFA 4DR6J 3AXMA 2QWRA 8ICCA 1Q79A 4KN7A 3L4PA 2KL8A 4CQ1A 1S6PB 3PSPA 4B3MJ 3AB2B 2D1KA 1HJPA 5HMZA 1IG6A 4CJQA 1N8RT 4F0MA 1IM6A 1IKYA 4P10A 3MC1A 3JTNA 3KDOA 5HBMB 4KMUA 4QZ8A 1A9NB 3T9NA 4MMOA 3MWBA 5EUHA 3IBWA 4CGGA 5J2CA 4RNHA 1IBMJ 2A1SA 2Z30B 5KFKA 1ZTWA 3HKZD 5AK3A 3LO3A 3M8ZA 4NYZA 4FZLA 3AA8A 1P8GA 4QPXA 1S1WB 2XMMA 1UZDA 4F7VA 1NK4A 5M1QA 4FK2A 4GKJF 1O51A 1S8OA 4PABA 1RCXB 5DRKA 3N4QA 2H5EA 1PO6A 3SUNA 5LL6Z 4DFDA 4RCHA 1ZBTA 4Q5VA 5DDRC 4DOAA 4ID5B 3NG8A 1XQSC 1SUQA 1DRZA 3OXFA 2XG8A 3S41A 4DV3K 2WVCA 4UOFA 1PAEX 4US8A 1VSLA 4PR6A 4G1QA 2W24A 5D4PA 1BQNB 1WSGA 3HVWA 3B8AX 4NLGA 3NS1A 1P27B 4DV4F 5FLXY 2HVDA 5BR8J 2XMTA 1T94A 2YNHB 1RDAA 2DO4A 3H20A 3H1VX 4BQZA 2K8AA 1ZQIA 5FPEA 1U49A 3MMVA 1YBUA 3UQ2A 2K8CB 2A3JA 1V9OA 1CC7A 1ZQMA 3HHKA 3WEEA 2P1JA 3KHLA 1H1VA 1YX2A 3ZYYX 3TTCA 2V2VA 2M70A 3NASA 5IT4A 3NH2A 4EYHB 5JRTA 2AP1A 3M8PB 2W40A 4UTGA 3C2LA 1S0MA 3CD6N 3DU5A 3GIIA 3ENQA 4OV1A 2KP7A 2RHSB 5DM7Q 3JTPA 4DR1F 1FKAF 4WZQA 4PXDA 5ADZA 3RJHA 1QDUB 3AA2A 5J0WA 2HNYB 4IOAQ 4BXOA 4NLOA 3UWTA 1N60A 4NA3A 4Z4EA 3MDCA 4FW2A 4YN4A 4ZTJA 2ZJ8A 4KN4A 2AJQA 3CJKA 3NF6A 1VISA 3DRSA 3OYGA 1JNRB 3CC2N 4FVCA 2P6SA 4LRFA 1H72C 1R6VA 3D7EO 3EN9A 2B56A 1L7MA 1KLNA 1KVKA 3A3PB 1Q16B 2BE9B 2E1AA 1Q0NA 2YBVA 3JQKA 5BRFA 3IDHA 1C0UA 4OHYA 3NMRA 2PAVA 3KJFB 1U09A 1B92A 2A1AA 3FCHA 2C22A 1N5WA 1QH9A 1HQUB 4F2SA 1LW2A 2FE9A 4H5WA 4IRKA 1TFRA 3H90A 2G4BA 1ZS6A 4CGFA 5TISU 2R7RA 2YWFA 3C15A 5ALMA 2WTUA 2BJ3A 4CBXA 3O3GA 4CJ5A 5K14B 5F3TA 1HJRA 4I29A 4LF5K 2EG2A 4FXVA 2YJFA 4MDBA 3VWSA 3RBDA 2KN7A 4I6AA 3QB0A 2ZBCA 2HSEB 3RH5A 2GVZB 1LWEB 1Q5YA 1HBOA 1KC8T 5F1XA 5HQLA 1WUAA 1CJKB 1EP4A 2DRBA 1NDPA 4BR7A 2WMMA 2LHTA 1SJFA 3THVA 2CPJA 1WBBA 1QQMA 2HB5A 3CJ0A 1NK8A 3IN5A 4YR0A 1X9SA 1GNKA 3W8PA 1HNXK 4P52A 5AXKA 4UATA 1RT1A 3C29A 1S72S 2BPCA 4XPCA 2WB1D 5M1NA 5K8NA 3SBMA 4ZCKA 5HAOA 1FKPA 4I2HA 3M6UA 4WP9A 1BA0A 4B3SJ 3I31A 1R8BA 4JS4A 3EWGA 1VQ7S 4DDFA 1OW5A 2LM1A 1XNQF 4FZZA 1C1BA 2ZTDA 4KHPJ 5ETTA 1RUSA 5JVHQ 2P9PB 1RTIA 1M5OC 2Q97A 4JI0F 3BJYA 2G09A 4KIAA 4PKGA 2JEFA 2J6TA 1SC6A 4WCEL 3H5XA 3BGFA 2LMRA 3CJQA 2QO3A 1HNZF 2BE7D 2W8LA 1LWFB 3CCJS 3E9OA 2ESEA 3G25A 3LDSA 4KLQA 2E5IA 2N1RA 1F5AA 3CWJA 4ES3A 1YF5L 3R27A 2DXDA 6FD1A 2A1RA 4DZ6A 4RQ5A 3HYFA 1F2HA 4OX9J 3VETA 4LFAJ 2CH6A 3LOUA 3AVCA 1YJTA 4OZ3A 1HJOA 4K0KF 2L9NA 2YQ0A 1BQMB 3T1YF 5AXMA 5E84A 2JL9A 1HNWJ 3ENOA 1JLCB 1HA1A 4QIGA 1VQ4N 3MWPA 3DLEA 3NY0A 4OYPA 1URRA 4Q44A 1HWIA 1UA0A 5DJBA 4LQ9A 9ICCA 2XEXA 1J53A 2DF4B 3THXB 2IYGA 4PG5A 3M6XA 3IBPA 1SJRA 3NCQA 4OYXA 4HUFA 1HEKA 3ADAC 3SDEA 3IM1A 3OJUA 1NZAA 2A1BA 1UTAA 2X51A 3W5ZA 1HLWA 3GG0A 3ZDEA 4B1WB 4JI5K 2RILA 2YKQA 5CZVA 2XB2D 2OM6A 4RNMA 4DTSA 3MMAA 4DPTA 2UV8G 3JAMO 2DNGA 4M63C 1G4CA 3SSSA 4DF8A 3MN7A 1REVB 2XO6A 3UKUB 4WU3A 2H5IB 3AAQA 2XHBA 2Q66A 5KPRA 3TOQA 4D3GA 1NGJA 3IGNA 3MXMA 2WW4A 3AVGA 2KFYA 3JSMB 3PIOL 4QIWF 1NSAA 3V6DA 2R8KA 2NXNA 4AXIA 1HBUA 1RTHA 4KKOB 2Q0RA 3QGIA 2LYVA 4ID1A 3FM9A 3L9ZA 2A41A 9ICJA 1HWUA 3TJAA 3UDVA 5JS2A 2E2NA 2HLUA 1YK9A 4MLEA 3SQ0A 3H5UA 4LFBF 4F36A 2RE2A 3F2KA 1UL3A 3ZT0A 1WB9A 2OHFA 3BZQA 1PBUA 1JXVA 2W9BA 2YB1A 2HRUA 2QARA 4KGMA 2RKIA 2AJFE 3MI7X 3UO0A 2ZJRQ 1UJ5A 5FROA 4JRQA 2GGPB 3ZSVA 3RB6A 3Q8PB 4CECA 3IC1A 4C6AA 2ATCB 3KK1B 3BSNA 2E66A 3P45B 4ED4A 3THWA 5EWGA 4DR7F 2MSTA 1KKHA 3J7ZT 1VQMS 4CH1A 3VENA 2MQ8A 2DGVA 3WIUA 2NZCA 2M52A 4H54A 1KDHA 2PMHA 2JLEA 3OW2M 3HFKA 1RHMB 8ICMA 4DV7J 4Q0BA 1Q46A 1T05A 4JHDB 3MPWA 4PA1A 2IC3A 1RXVA 3CYMA 3DU6A 5GAGU 2BRKA 2O01C 3QU4A 1ZYQA 5C42A 3H2UB 3OTOJ 1MDUB 2E1EA 5J0UA 1JLFA 2BKPA 4OJPA 3GE1A 3NGZA 3JTOA 3O9RA 4G6VB 2XSJB 4MTPA 4JYAJ 5KG7A 2OPSA 2FY1A 5HQ8A 4K4WA 2XO7A 2XYHB 1SWWA 2GV1A 4YVZA 5ALXA 1QVGM 1O03A 3CFOA 4CEEA 2VG7B 2OELA 1WAFA 4MYUA 2ZXHA 2UUBJ 4WFAL 2W03A 1QZ6A 2NPIA 4ZVGA 3CPWM 1MMNA 2BOAA 3WQPA 2DEJA 3KD3A 1RT5A 5J0XA 3OTCA 4X62K 4LR8A 3ORYA 4KBIA 3G96A 3HKWA 1ZTTA 5KG5A 4ED3A 2KW4A 1GOBA 1RT7B 2QLBB 3RVCA 2DK2A 4WE1A 4DQSA 2D0OA 1XNSA 2CJAA 1PCAA 4IWVA 3OPKA 1WOQA 1S9EA 4P0PB 2DGXA 2QV6A 2CNNB 5EWEA 3N4WA 5JUMA 2Y1RI 2XS2A 3BDEA 5D4BA 2P9GA 3KHRA 2E5SA 4QWAA 3GFHA 4G65A 1OY8A 4DOZA 3EUB2 1QCKA 2HHQA 1T0TV 1EARA 3EVOA 2PFFB 1GH8A 5JVGQ 1TMMA 5DM6Q 2C2NA 5DBAA 3G8QA 1XO0A 5J8YC 2E9RX 3ILOA 5HBMA 5IQ6A 2YJEA 1RTJB 4X65F 1H74A 2N3OA 1GLBG 1RAOA 4N76A 2G9OA 2QC3A 4FK4A 4Y2UA 5AM4A 3N28A 2JWNA 3J7AN 3AD8C 4ZOSA 4K42A 1BGXT 1X5SA 2P9LB 1EKRA 2HFVA 2VFTA 5HLFA 1VQ5S 3CDAA 2GJ2A 1C0FA 5AQNA 3TX0A 1KLMB 1JXEA 1IKXA 2UXBJ 4V19X 2EK1A 2AYBA 4CIEA 2FSJA 2XMWA 2OEKA 1CXUA 1ZM3A 1RZTA 5E41A 2EFOA 2WVDA 2FC9A 2HZCA 3CD6S 3M9NB 5AKEA 4Z2XA 1XR7A 1FKOA 3C94A 3CNHA 2XBPA 4K4YA 4Z4IA 2BRLA 3MBYA 4JKDA 4KQZA 2F2AB 4IQUA 2HHPA 4AQYF 4JV5F 4JKHA 2HFUA 2YI1A 4M04A 1XWLA 4XA5A 3T1HK 1NHUA 1FTRA 2O8DA 3BQ7A 1CLQA 1DTQA 1TKXB 1KD1O 2YKNB 4E19A 3AVHA 2K3KA 5L9XA 3BO3A 4BRCA 4QYRA 2RPIA 2CWKA 3AFGA 1G1XA 3M5RA 3TSQA 2K4IA 5ALGA 3NGSA 3HD1A 1C2PA 2QMXA 1TVAA 2IVYA 2CXEA 4V1Ak 4NXMK 1J5OA 4WFXA 3JPOA 2HHHK 3F5AA 2C42A 4DTNA 3QX7A 7ICIA 3T41A 2ZM6K 3ZZRA 5LMUF 2F8EX 1QUPA 2UUAF 1N5SA 4OZJA 4ILHA 3R7SB 2UU9J 5CYQA 3DRPA 2Q1LA 3UDCA 4HHJA 5MAOA 4TY8A 1K5OA 5C0YA 4A5BA 3VGVA 5HQMA 4CE6A 2CZ9A 4Y1DA 1WC6A 4UY85 4CIFA 2CG4A 4M5GA 1S0VA 4YG2A 2ZIXA 2HSTA 4BVOA 1C1AA 1SQGA 4DR3F 3ZTOA 3GWCA 4TQRA 1RAAB 4W98A 5T7BA 5ALWA 4ANEA 1PKUA 2I9SA 2QI2A 5KG0A 5AK4A 3HCXA 1X9JA 3M8SA 3QERA 4D3HA 3KLHA 2KJ5A 2Z57B 4CNZA 2IVFB 4ZP7A 4I2AA 1Y7PA 2RHFA 2MB0B 4LBIA 2MQQA 4I28A 3PG9A 3NH1A 4A4JA 3VF2A 1QE1B 2KSOB 4WXWA 5DDYA 2ALZA 1FEEA 4A5AA 5AI8A 4KFBA 2JVOA 2PGCA 4L6V3 3MEGB 4DR5K 3GE9A 3LF0A 5AE2A 4CEBA 2C2KB 3ATVA 3SCXA 5B09A 1ILYA 2C3YA 3KUGA 3EO3A 3DOLA 4ECZA 4U67Q 3JS9A 1EIYB 1YLXA 5J1PA 4CHZA 4ZVFA 4KLOA 3QETA 2I5JA 4FJXA 2A2DA 1EX8A 2IOHA 1S9GB 2UUCF 5IILA 2V69A 1MWYA 2RRAA 3WXMB 3LYSA 5IZHA 4JI1J 4C98A 4YHHF 2ZNYA 1DLOA 3EWAA 4Z6EA 1OH5A 1T02A 4JI7F 1W2BM 1U45A 3AHPA 1HD0A 2LDIA 2PA8D 4FWKA 1LB2B 2QLJB 1V3SA 3OD2A 4C3KA 4KHQA 3LW5C 2VJ5A 4CFAA 1K44A 3P5JA 2E6LA 1NGIA 2CQDA 4HACB 4LF7K 1QQ5A 3RTVA 4QS8A 4EX6A 1GMVA 4HCCA 5C2CA 1JIHA 2BCVA 3MR5A 1JLEA 1NPKA 4MN4C 3KHHA 1D0EA 2P9PA 3UR3C 2HQDA 3PKYA 2HK3A 1ZXIA 1VHIA 3D6JA 4CJVA 2L48A 4LZGA 2DNOA 1RT6A 1K0TA 4ZMMA 1JJHA 1PG5B 1JJ4A 2RD5C 2IMWP 4OKKA 3AN1A 2B4OA 3FFIB 2P6RA 2WSFC 3KG0A 3QBWA 7ICPA 4F3MA 5ALKA 1B0VA 4DSIA 4P6QA 5EE9A 4FS2A 3R1HA 2BDPA 2VV5A 1RDFA 4NEZA 1WHVA 1LKYA 7FDRA 1ACMB 1N33J 4CF3A 4CERA 3FJ2A 1K9MT 2HHVA 1SZ2A 2E44A 5ETMA 3LDNA 1OMSA 4F3TA 1REGX 2CPZA 4DS5A 2ZVSA 4NXNK 3AOAA 4RT2A 4B3TF 2B0CA 3K89A 5B0AA 3OS1A 2DQNB 4O3PA 2KYXA 5THWA 1L3VA 5I9EB 1DGJA 4UAUA 1UFKA 3QQCD 1CULB 4CJPA 4EAHD 1TL7B 4KH1B 1JJ2M 4P2XA 2KXHA 4DUYJ 3VQAA 3NVYA 4DLEA 2FVSA 2J9CA 4DPYA 3W65A 1VRQC 2EFGA 3W62A 3N7RC 9ICEA 2I1RA 4BRNA 3C6AA 2ZH3A 3RW6A 1RBVA 2U1AA 3CJ1A 2O8FB 3O8WA 4KTQA 3T5JA 1HL6A 4TU9A 4QZFA 3DXMA 2GWKA 1HBNB 4ICLA 1S1UB 4M7YA 3OYCA 2DVIA 1RBSA 4X2BA 3IM9A 2WBNA 3NP5A 1I3AA 2KTQA 4I7FB 2YNGB 2GMJA 2E1CA 1NPPA 4U96A 5KFIA 3IA0A 3KKFA 3DCAA 1BMQB 2W2NP 4KKOA 2GAHC 3H42A 5KT4A 1N5XA 2B9WA 2XCAA 1CSJA 2Y3YA 3K2YA 3AD7C 5KFJA 3W63A 2EC2A 2E9TA 4Y2XA 3VGTA 4LRBA 3D6RA 1PVQA 4FN5A 4M9HA 4UB1A 2VANA 3FMWA 1ZQQA 2PT0A 4WF9Q 2MZTA 1EAYC 2JH3A 4DQRA 2FIUA 3VEXA 3S7RA 3AVLA 1N4LA 5ALHA 1RYSA 3VQ5A 3R9LA 4HAIA 4B1VA 1WF0A 3DOKA 4DPOA 3GG4A 3C6TA 3KBBA 1VDVA 4BGBA 4XH1A 1RAIB 1RBUA 2F1FA 1X4FA 2Z2ZA 3TUJC 1U1OA 3KZBA 1NZBA 4WK3A 4QWCA 4GO5X 3C3LA 4U8YA 4YP3A 1QQOA 3VEYA 4NL5A 1FJGF 2C28A 4OJGA 3LWMA 2VBYA 3HSDA 4CIGA 5BN8A 1MA7A 2LU1A 1VCTA 4TXSA 4DQIA 2L5YA 3J80U 4FFDA 2V51B 1W7WA 4DUZJ 5C25A 2HBMA 2IOFA 1NHVA 1J5EK 2HBZB 2EQYA 2FVQA 1EQMA 4BX9C 1TZ0A 1L5UA 2P9SB 4M7XA 5AM1A 1TYQA 1UWBA 3JXOA 3N4PA 1V38A 1IBCB 5EXWA 4PAAA 1RA6A 4YOYA 4DR4J 3IBCB 3V2UC 3O4NA 3S6EA 3WT0A 2H3QA 4DI6A 4P0QA 4KGKA 2FHJD 4CF8A 5K8PA 3HSGA 1WJ9A 1DGKN 2BTFA 3ENVA 5HR7A 3P39A 4A2BA 4CF0A 1RXOB 1J9AA 2R2SA 5J2KA 1SV0A 2P51A 2Z1IA 1T8EA 1RBLA 3KG4A 3K7RA 1NLKL 4F2RA 3K58A 2E5LJ 2VQFK 2BR0A 1XIQA 4ZOHC 2QM1A 4OYIA 1VQKS 4IQVA 3TAMB 1HPZA 1WD6A 1TUUA 4CF5A 4FJ7A 4K8ZA 5D4NA 3ZZOA 1NZPA 1TFWA 4CF9A 2G0AA 1TL1A 4QYZK 3KFWX 4Z4GA 1FNMA 3ZO7A 2GHWA