1X2IA

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, helix-hairpin-helix domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
ALTLAERQRLIVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEIRRVITAPYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of an Archaeal XPF/Rad1/Mus81 Nuclease: Asymmetric DNA Binding and Cleavage Mechanisms
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Hef helicase/nuclease
total genus 19
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1x2iA00
9ICAA 3M8RA 1XC9A 7ICUA 5J2BA 5IINA 4KLHA 3OSPA 1NKBA 2F1IA 4DQRA 2HW3A 4YXJA 4RQ5A 4RQ0A 2KN7A 3Q8KA 4QZBA 1MQ2A 3M9NB 4JWMA 3M9OB 3MFIA 5BPCA 4EEYA 9ICPA 4QZHA 1XSNA 1S0NA 4JV0A 3ETLA 3ORYA 2XGPA 4RT2A 8ICKA 1T8EA 3ISDA 1U9LA 3V7JA 4IQWA 5HNKA 2JZBB 4YMOA 1X9MA 1XSPA 9ICNA 2IHNA 3IHQB 5J0UA 5L1KA 4Q44A 5KFTA 1ZQRA 4R63A 3ZDCA 2AGPA 1KDHA 4KTQA 2HHVA 1WCLA 4F5RA 4ECTA 1ZQJA 4NLKA 4MEXA 4UBCA 5KG6A 2XY7A 1TK0A 4ECVA 4J9SA 4X5VA 5KFUA 4YN4A 1ZQNA 4KLOA 4Q8EA 4F4ZA 5DGAA 1S0MA 4Q8FA 4ED6A 8ICEA 5CA7A 3C1YA 5KFDA 2HHSA 3GIMA 2C2EA 3SZ2A 7ICRA 4BWJA 4F5NA 1ZQDA 2Y1JA 1SZPA 2W9AA 2W8LA 3RBEA 2XGQA 1Y88A 4DOBA 4QZEA 3C2MA 3RB3A 5IIMA 9ICRA 4DFPA 5L1JA 4YD1A 5CWRA 4F5OA 5DG8A 4ECUA 3TQ1A 3EW9A 5TZVA 4BDPA 4JV1A 4JV2A 5CB1A 5J0XA 1COOA 4RT3A 4DSLA 4J9PA 1D8YA 5D4BA 5KFNA 2DFLA 2UVVA 4J9NA 2NRWA 1NJWA 1NJXA 3H40A 3HW8A 3OSNA 1S97A 1LV5A 1L3VA 3V7KA 9ICUA 4DL5A 2P6UA 5CR0A 8ICMA 3OHBA 4ECRA 4M6WB 4J9KA 1T7PA 1L5UA 3G6XA 1BPXA 4B9NA 1U48A 4EBCA 5HP4A 5DB8A 4C8MA 5J2DA 2AQ4A 4KLIA 4TUQA 3RH4A 3OGUA 4YD2A 4DSKA 4PHPA 5J0SA 2PI5A 4B9SA 3TI0A 4KLLA 2GWSA 9ICTA 4FS2A 3TFSA 4DSEA 4UQGA 4QZFA 4QWAA 4DFMA 3BDPA 5DGBA 2LYHA 4RNNA 4O5EA 5IIJA 4UB1A 4B9VA 3G6VA 3BQTA 8ICBA 4ELUA 3LK9A 1CUKA 1U49A 5J2KA 4R8UA 3MDCA 5J0WA 4LZGA 4RZRA 1T4GA 3H7IA 4Z6DA 4RU9A 3JPQA 3PX0A 2BR0A 2W8KA 4F2RA 4NLGA 1ZQMA 4XRHA 4PGQA 2HHTA 2I1QA 4MFCA 4FS1A 3EWAA 5KG4A 1U45A 1HUZA 3ZD9A 5DQIA 3QZ7A 2R8IA 2R8GA 3PR5B 3PX4A 2FPKA 3SV4A 3H8SA 2XY5A 1JXEA 2VA2A 5CJ7A 3Q8MA 1X9SA 3ZDAA 4BXOB 2Q0ZX 7ICJA 1D8LA 2C28A 4YXMA 1QTMA 2FMQA 4ELVA 5DBCA 5KG2A 4F8RA 7ICFA 9ICIA 2W9CA 5KFJA 3MGHA 1BGXT 4KLFA 3MR3A 1ZQGA 5KFVA 2JEFA 5DG7A 2P66A 9ICEA 8ICTA 4TQRA 5KFQA 1EXNA 1D9FA 1ZQQA 2BCQA 1X2IA 2UVWA 4LZDA 1XU4A 1XS9D 4EYIB 3RAXA 4O3QA 3GV7B 4F93B 1RXWA 4M04A 1Z00A 4UB4A 2FLLA 2PFNA 2BKEA 3PO5A 2J6UA 5EWEA 1XSLA 4RPYA 1NKCA 9ICLA 4IRDA 4PH5A 9ICXA 3JPTA 4F92B 5J0PA 4GXKA 4DQIA 9ICFA 3C5GA 2PXIA 1KLNA 4Q43A 2A1JA 3C23A 2FMSA 1S9FA 3MDAA 2MAXA 2IHMA 1CEZA 3K4GA 2PFQA 4YMNA 1HJPA 4ECYA 3HP6A 3OJSA 3FYHA 3RRHA 5KG5A 3GIKA 8ICZA 2PFOA 5IIKA 2BCSA 4QZ9A 5KFHA 2C2DA 2F1JA 5KFWA 4C8KA 4I2DA 4YVZA 2VANA 4DEZA 5KFGA 4J9MA 4LVSA 3EPIA 8ICJA 1K1QA 2HHUA 3TARA 4QZAA 1XWLA 1H38A 4Q45A 4DSIA 1ZJMA 2F1HA 5IIIA 4QZGA 1UA0A 4DL3A 4DOAA 1RPLA 3ISCA 4I2GA 4KITB 2HHWA 4NXZA 4O0IA 3JPRA 4I2JA 1NK0A 5KFAA 1JIHA 2R8HA 3UPQA 4M9HA 1BPBA 3UXNA 2V4RA 4RQ3A 9ICMA 3PY8A 4UB2A 7ICNA 3LWMA 4KLMA 5KFKA 3ZDDA 4YQWA 5KFLA 4RUAA 3M9MB 4QW8A 4M9GA 4BXOA 4IQTA 4M9NA 4O3PA 4QWEA 3MBYA 2W9BA 3SV3A 4ED7A 2AGQA 2FMPA 2ASLA 4IR9A 3SI8A 2HVHA 2BPGA 1N56A 4M0AA 3V6KA 4J9LA 1N48A 1ZQLA 2DPIA 4NLNA 4YP3A 2ZJAA 5DLFA 8ICUA 2ALZA 2NRZA 3NTUA 5J0QA 3GDXA 3AU6A 3TAQA 2V9WA 5CP2A 3PV8A 2AGOA 3PMNA 3JPNA 7ICEA 2NRVA 4QZDA 4IRKA 4O3OA 4NY8A 5DLGA 4GLXA 7ICQA 5JUMA 3RB0A 4ED2A 4K4HA 2HHQA 3KHGA 2XC9A 3TFRA 2W9BB 1NKEA 4I28A 5DB6A 3BQ2A 4C8NA 4P4OA 4ECXA 3C2LA 5J0YA 3C21A 4JUZA 2MUTB 4DFKA 3KHRA 4C8LA 3GV8B 3UQ0A 1WCNA 3Q8QB 4DO9A 4Z6EA 4F50A 3THVA 1JMSA 5KT2A 8ICGA 8ICAA 1UA1A 2RDJA 4I2AA 2BCRA 4R66A 4F4KA 5KFPA 5DQHA 3UQ2A 3GFKB 5KFSA 3MR2A 1S10A 7ICVA 1BPDA 5KT5A 4ED1A 3PW5A 4C8OA 3BQ1A 3B0XA 7ICHA 2C22A 2KFNA 4RUCA 2ASDA 3RAQA 1A77A 2BGWA 5IIOA 5KTQA 4R65A 1QSYA 3NGDA 3T3FA 5KT7A 1IM4A 4YR0A 3C1ZA 5J2IA 3Q8RB 3QEBZ 1IXRA 2AJQA 1S0OA 1NK4A 3RBDA 1XO1A 5J29A 4EBEA 4GXJA 4DQQA 5KG0A 3HT3A 4TUSA 2ZTEA 4RQ1A 4F5QA 4K4GA 4DOCA 4DF8A 4I27A 1KFSA 4PPXA 2KZZA 7ICKA 1SL1A 2ZUDA 3PMLA 4O5KA 4Z6CA 3PW7A 5DDMA 2W9MA 3RJGA 2XY6A 1KFDA 1Z00B 4UBBA 1S0VA 1BPYA 2A1JB 2KZ3A 2ATLA 1SKRA 9ICBA 3PW0A 4QW9A 4I2EA 4RQ4A 1NOMA 2I9GA 3EPGA 3N4MB 7ICSA 4DQSA 4M9LA 5KFMA 4F91B 2NRXA 3JPSA 4BWMA 5IILA 3B0YA 4MFFA 2B21A 3RJIA 2ISOA 4UAYA 5KG7A 5J2JA 3MABA 2R8KA 2PFPA 5KG1A 1U4BA 5J2CA 2KFZA 2AU0A 3FDSA 5L1LA 2FPMA 3SYZA 3V7LA 1UT8A 4DL7A 1ZETA 5DB7A 3PW4A 3RRGA 4I2BA 5DQGA 5D46A 1ZQZA 3N97B 1ZQHA 7ICMA 5DB9A 2KTQA 5KFIA 1JN3A 3T5JA 5KFBA 4RPXA 1UT5A 3BJYA 2M9NA 9ICCA 5EOZA 1K1SA 5BOLA 3RTVA 9ICVA 4PHAA 4F3OA 1ZYQA 2ZTCA 4EZ9A 4KLGA 3IM1A 2C2RA 1ZQEA 4DL4A 4GC6A 1PZNA 2RDIA 5J0OA 2BQ3A 1TKDA 4B9UA 2BPCA 4KLDA 2HVIA 8ICRA 4RQ8A 3H4DA 4QWBA 4IRCA 4R8UB 5J2FA 8ICSA 2IMWP 4B9MA 1SL0A 4DWIA 8ICVA 4TQSA 5DBAA 3AU2A 4CCHA 1A76A 3TAPA 4RNOA 4E0DA 4DSJA 4O9MA 4DSFA 4ZH4A 4F4XA 1TAUA 5EWFA 1SKSA 2XO7A 4TUPA 4YR3A 8ICLA 9ICKA 3UXPA 4ECZA 1ZQVA 8ICFA 2J6TA 5BOMA 1V9PA 4DF4A 1ZQKA 7ICPA 9ICHA 4KN4A 5L1IA 4IQVA 1MSWD 3M8SA 5DDYA 1ZQIA 7ICOA 5J0TA 1QSSA 4FO6A 4RQ2A 5F9LA 3T5HA 1TV9A 4JK1A 4MEYA 4PHEA 3MR5A 2HHXA 4ECWA 4ED0A 4NM2A 4DS4A 4UB5A 3KHLA 5L9XA 5DBBA 2Y1IA 8ICWA 4XQ8A 1ZQOA 2KZMA 3RJJA 5KFOA 1C7YA 3H8WA 2J6SA 4I2HA 3Q8PB 1NJZA 1B43A 4KMUA 2ASJA 8ICYA 2FLPA 2BQUA 4B9LA 3ISBA 2ZUCA 3H8JA 2XCPA 5J2HA 3QEAZ 3RR7A 4P2HA 8ICXA 1SL2A 1SKWA 4DFJA 3RH6A 5KFRA 2DPJA 1RYRA 9ICQA 2IBKA 3HX0A 4KLEA 3RR8A 5J0RA 1ZQTA 4F5PA 5KFCA 4DL6A 1RYSA 1KEJA 4JWNA 4RQ6A 1KFTA 4J9QA 8ICPA 3PR4A 1LB2B 4FBTA 8ICQA 2UVUA 3RJHA 3ZDBA 3QE9Y 3LWLA 1ZQBA 4EBDA 9ICOA 4I2FA 2JEJA 5KT3A 4F2SA 5C5JA 3PVXA 4EZ6A 7ICTA 3KTQA 1DOQA 2XCAA 3G6YA 8ICNA 1NK9A 2BHNA 1ZQSA 4QWDA 9ICGA 1T3NA 4O5CA 3RB4A 5EWGA 2VA3A 2OWOA 3MFHA 4R64A 4BGDA 3C2KA 4M6WA 5J2GA 2AQ0A 1TAQA 3JPOA 5KFYA 4HYKA 4J9OA 1NJYA 4O3RA 5HHHA 8ICOA 1ZQUA 4DS5A 4PGXA 1AROP 4DLEA 9ICSA 3Q8SB 5CHGA 4O3SA 2VA8A 2ZJ5A 5KG3A 4UB3A 1S77D 4KLUA 3KHHA 4KLTA 1MC8A 1BPZA 2BPFA 2ISPA 3GQCA 4DLGA 3PNCA 5DKWA 3GIJA 1ZQCA 1ZQWA 2H5XA 5HMMA 3OJUA 4QZ8A 4MF2A 8ICCA 3JPPA 2BDPA 3T5LA 3EYZA 1NK7A 4QZIA 9ICJA 5KFZA 1L3SA 4YFKA 2BCUA 4M2YA 7ICGA 3C5FA 3V6JA 3RJKA 3AUOA 3RJEA 1BVSA 1U47A 1ZQAA 1QSLA 4M9JA 1JXLA 4XA5A 4EYHB 1RZTA 1KSPA 5KT6A 1KTQA 7ICLA 4GXIA 3MR6A 1NK5A 3RJFA 4MF8A 4G3IA 3RH5A 4ECQA 4GC7A 3PW2A 4PGYA 2WTFA 1MQ3A 3TANA 3OHAA 2FPLA 4P4MA 4XUSA 4P4PA 4RPZA 1ZQPA 2W9CB 4K4IA 1NK6A 2JEIA 1RXVA 5KFEA 4PHDA 4ECSA 4B9TA 5D49A 1DGSA 4IR1A 8ICHA 2NRTA 1L3UA 4F4YA 2ZUBA 3EZ5A 3ZDEA 3V72A 4ED3A 2FLNA 4NM1A 3GIIA 3T5KA 1ZQFA 4FBUA 1ZQYA 3H4BA 2BQRA 1JX4A 1HUOA 4YR2A 4ED8A 5HHIA 4KLSA 1ZQXA 3ZD8A 3HPOA 4ELTA 8ICIA 4F4WA 4J9RA 4MFAA 4I29A 3GILA 4DL2A 1D9DA 4M47A 4RNMA 5KFFA 1BPEA 2BCVA 5F9NA 4NLZA 4TURA 1TK8A 5HMLA 4O3NA 5DG9A 4YCXA 4Z6FA 2ZJ8A 4UAWA 1QLNA 5J2AA 1TFRA 4RQ7A 1Z3EB 1X9WA 1TK5A 3BQ0A 4IQUA 4KLQA 2IA6A 1L3TA 1ZJNA 3Q8LA 2R8JA 2JEGA 1KRPA 1S76D 4QZCA 3QZ8A 3V6HA 3RB6A 4YMMA 4KN7A 2P6RA 3MGIA 5KT4A 4UAZA 2MUTA 3K75D 4I2IA 3UXOA 3PO4A 4YG2A 2V4QA 3PX6A 1B22A 3LDAA 5KFXA 3HWTA 4QWCA 5J2EA 2JZBA 3GV5B 1TVAA 2UVRA 4DQPA 7ICIA 3E2EA 4I2CA 4KLJA 1NK8A 2ZTDA 9ICWA 2PI4A
chains in the Genus database with same CATH superfamily
3M8RA 7ICUA 5J2BA 4DQRA 3TACB 1XSNA 1S0NA 2G06A 3ISDA 4KMOB 2K4PA 4IQWA 5HNKA 2H3FA 2WAQC 5L1KA 4Q44A 2F76X 2EAOA 2K8BB 4F5RA 1ZQJA 5ALDA 5KG6A 2XY7A 4J9SA 5KFUA 8ICEA 4ED6A 2DBYA 5CA7A 2HHSA 2C2EA 4F5NA 1ZD5A 4DOBA 5K4LA 5IIMA 9ICRA 5L1JA 4F5OA 4JV1A 3EW9A 2OHFA 4RT3A 3SR6A 1TAMA 3NASA 3D6JA 2UVVA 4J9NA 4USAA 3HW8A 1LV5A 5CR0A 3OHBA 2FI1A 4GIBA 1L5UA 2AQ4A 3WK8A 4TUQA 5J0SA 2PI5A 4B9SA 3TI0A 3IDWA 4UQGA 4QZFA 5AM0A 3G6VA 3LK9A 1U49A 1UPHA 1L7OA 5ALOA 1YZ7A 4BX9C 5J2KA 3H7IA 2BR0A 4FFDA 1ZQMA 4XRHA 4PGQA 3D2NA 4FS1A 3EWAA 2H3VA 3QZ7A 5ALTA 3PX4A 2YMMA 4P0QB 3H8SA 4DCCA 1L6NA 3KFUF 1QTMA 2FMQA 5KG2A 3LVVA 5KFJA 1IG6A 1ZQGA 2JEFA 2KVSA 5DG7A 2D6FC 1EXNA 4UW9A 1XS9D 2VKQA 4O3QA 4F93B 4UB4A 3M7DA 3BQ7A 2WF8A 4IRDA 9ICXA 3S6JA 2EAPA 4GXKA 3C5GA 2A1JA 2ZIUB 2PFQA 1HJPA 3PSTA 5KG5A 3N7PD 2F1JA 5KFWA 4I2DA 4DEZA 3WKCA 4J9MA 4LVSA 2Y0SC 4DSIA 2O6KA 2F1HA 1UA0A 4DOAA 1L7MA 4PL1A 2QB1A 4KITB 2HHWA 4O0IA 5KFAA 3M6KA 1BPBA 9ICMA 4B6JA 3QU5A 3PY8A 4RUAA 5F3XB 4Y2VA 4IQTA 4M9NA 3H0MB 4O3PA 1WWVA 4QIWF 2MU2A 2HVHA 1RQNA 2DWQA 1RQLA 5DLFA 2YMPA 5ALGA 8ICUA 2YX8A 2GH1A 3NVVA 2NRVA 4QZDA 4NY8A 4NWIA 3KHGA 2EQYA 1NKEA 3C21A 3KKAC 3GV8B 4Z6EA 4F50A 3THVA 4PZNA 4PL2A 1UA1A 2RDJA 2BCRA 3MR2A 5KT5A 2EH9A 4Y2SA 3PW5A 4RUCA 2ASDA 1A77A 5JRTA 1VLBA 5KTQA 1SZHA 3QEBZ 5J2IA 3Q8RB 1S0OA 4DQQA 1KFSA 2VJ4A 2KEYA 2XY6A 1KFDA 4UBBA 5ALWA 2KZ3A 2ATLA 2K4IA 3GZFA 7ICSA 1BNOA 2Y9UA 3IG8A 1V85A 2NRXA 5AK3A 1MA7A 2B21A 2ISOA 2OXOA 5J2JA 1C20A 2RP5A 3FDSA 3SYZA 4DL7A 1ZETA 3RRGA 7ICMA 5DB9A 5FP0A 1UT5A 3HKZC 3PSPA 5EOZA 2KJ8A 4PHAA 4F3OA 2ZTCA 4KLGA 2RDIA 5J0OA 4KLDA 5ALEA 4RQ8A 1SV0A 8ICSA 2IMWP 4TQSA 5DBAA 2AXTU 3WK6A 4CCHA 3TAPA 1L7NA 4RNOA 4O9MA 1ZRMA 8ICFA 5BOMA 7ICPA 5GTHU 4IQVA 5DDYA 7ICOA 5F9LA 4PHEA 2HHXA 4ECWA 4ED0A 2YQEA 4Y2RA 5AKLA 4C7YA 2YB4A 1Q3UA 1NJZA 5HR6A 4FE3A 1KL9A 1V38A 2HI0A 2FLPA 4CF4A 2KV2A 2DPJA 5KFRA 5J0RA 4F5PA 2A3VA 4DL6A 1RYSA 1L8LA 2ZIXB 3L4PA 1QCKA 4FBTA 2A19A 8ICQA 5KT3A 4EZ6A 1Z1VA 3KTQA 7ICTA 2XCAA 3G6YA 5AI6A 2E5SA 2K4HA 4O5CA 3RB4A 5EWGA 2VA3A 1NNLA 4J9OA 2WFAA 4DS5A 5AI9A 4PGXA 1PVQA 2VA8A 2ZJ5A 4CGZA 2ISPA 3QU4A 3GIJA 1ZQWA 4EEKA 3BS5B 2BDPA 3EYZA 3FM9A 3RJKA 1BVSA 1U47A 1QSLA 4XA5A 7ICLA 2QARA 4GXIA 3MR6A 1V97A 4G9BA 1JROA 5AK6A 4P4MA 4XUSA 1ZQPA 5D49A 2WF9A 1OUQA 4ZOHC 5CRXA 2JHDA 2ZUBA 3EZ5A 2FLNA 3QNMA 4NM1A 4UARA 3GIIA 4FZNA 1SWWA 2DKXA 2HSZA 4YR2A 1CI4A 4ED8A 3HPOA 8ICIA 4I29A 4J9RA 4DL2A 1QQ7A 5KFFA 3KD3A 4TURA 4YCXA 1XO0A 4QJFB 4RQ7A 5KAIU 2IA6A 2XVTA 1F5SA 3D2QA 1F44A 2R8JA 2ZG6A 2F8LA 1N62A 2P6RA 3K75D 4I2IA 3PO4A 2JGAA 3PX6A 4QWCA 1URJA 1TVAA 3E2EA 3QU9A 2PI4A 4LJXA 9ICAA 2EZZA 4OJ6A 5IINA 2DGZA 2K8AA 3D2SA 3SEIA 4RQ5A 4JWMA 4QZBA 2W43A 4EENA 2Q4TA 4EEYA 3K1ZA 2XGPA 3WKAA 4QIWC 9ICNA 1TE2A 4R63A 1X9XA 2MSNA 1KDHA 1WCLA 4ECTA 1T3QA 2E8OA 1TK0A 1X66A 2HVIA 4X5VA 5J8YC 4Q8FA 3F2BA 5DGAA 5KFDA 2B0CA 3CW2C 3SZ2A 1UQVA 4IC9A 4BWJA 1ZQDA 4BUGA 1SZPA 2W9AA 2XGQA 1Y88A 3AMZA 4DFPA 4JV2A 5CB1A 5J0XA 1D8YA 5A0LA 5D4BA 4IS7A 4Y2QA 2F2AB 2IOFK 2K4EA 2KVCA 2E1EA 3H40A 3OSNA 4J03A 4ECRA 4M6WB 2DF4B 1T7PA 1BPXA 1U48A 4EBCA 5HP4A 5DB8A 3NRWA 4C8MA 3OGUA 4PHPA 4WJ3B 9ICTA 3TFSA 4DSEA 3BDPA 5DGBA 2LYHA 5IIJA 5KNIA 4R8UA 5G5GA 4RZRA 1T4GA 3PX0A 4F2RA 2W8KA 2HHTA 3ZD9A 2R8IA 2FPKA 3SV4A 3ZDAA 2Q0ZX 2C28A 2BZFA 7ICFA 1NZPA 1BGXT 3WK4A 4KLFA 3MR3A 4Y2XA 9ICEA 8ICTA 5ALZA 4TQRA 3QUBA 3PZPA 1XU4A 2OYYA 3RAXA 3GV7B 3FAHA 1X42A 4M04A 5EWEA 4RPYA 3JPTA 5J0PA 2PXIA 2MAXA 1CEZA 3K4GA 4YMNA 4OD0A 3HP6A 3OJSA 3PSIA 2C2DA 2F44A 5KFHA 4C8KA 3IP4B 4HAIA 3EPIA 2HHUA 3WKEA 4UB6U 2E8MA 1H38A 4QZGA 5GTIU 3ISCA 4I2GA 3RF9A 4U7CA 3KOOA 4NLBA 4RQ3A 4UB2A 5KFKA 4YQWA 3F53A 3AN1A 3QX7A 5ALPA 4M9GA 4PZOA 2KD1A 2AGQA 2BPGA 4J9LA 1ZQLA 2DPIA 4OCZA 2WHEA 1NZBA 1PK1A 2ZJAA 2NRZA 3PV8A 4ED2A 4I28A 3BQ2A 2PMZC 2K8CB 4ECXA 5J0YA 1QH9A 4DFKA 4C8LA 3Q8QB 4DO9A 2YMQA 1JMSA 2FE9A 5KT2A 1SWVA 8ICGA 8ICAA 4I2AA 2W3SA 2ZIUA 7ICVA 1BPDA 4ED1A 4C8OA 3BQ1A 2C22A 5ALIA 1A6SA 1JRPA 1IM4A 4C4SA 4YR0A 2AJQA 5AKIA 1NK4A 4EBEA 1RM6C 4GXJA 1OXJA 3K1RB 2L5YA 4F5QA 4DF8A 2KKVA 2LMRA 1ECWA 4O5KA 3PW7A 5DDMA 2W9MA 2NO4A 1S0VA 1BPYA 3E0FA 3NVYA 9ICBA 3PW0A 4I2EA 2I9GA 3N4MB 1UCVA 3ED5A 5IILA 3B0YA 4MFFA 1HEKA 4PJ0U 2R8KA 3NRZA 2W3RA 2AU0A 2HDOA 1SV4A 5L1LA 1UT8A 3SENA 3NUQA 4I2BA 1ZQHA 2KTQA 1SXDA 2PMZF 5JU5A 3T5JA 5KFBA 1K1SA 3RTVA 4DL4A 1PZNA 4B9UA 2BPCA 2BDUA 3H4DA 4R8UB 5J2FA 3BZCA 1SL0A 4DWIA 8ICVA 1L7PA 2QB0A 4DSJA 4DSFA 4CDGA 2HBMA 5EWFA 2W11A 4YR3A 1S5LU 9ICKA 1IV8A 2LBOA 1XNSA 1MSWD 1ZQIA 2EDUA 1QSSA 4FO6A 1WUDA 2DUYA 2ZIVA 5HR7A 3SQIA 4NM2A 4UB5A 3KZIU 4XQ8A 2W7OA 5KFOA 3H8WA 2R18A 2QARB 2KG5A 5CEHA 3VCBA 3QYPA 2BQUA 2OH2A 4P2HA 1SKWA 1RYRA 2CPRA 1ZQTA 2F8KA 1DK3A 2YTUA 2RQ5A 4RQ6A 2ZXHA 3O0FA 4NL9C 5ALRA 3RJHA 2KMDA 9ICOA 8ICNA 1NK9A 2BHNA 5AM3A 9ICGA 5ALYA 4OJPA 3C2KA 4M6WA 1ED1A 2DL0A 3I76A 5AI5A 5KFYA 2WF7A 1ZQUA 4O3MA 3Q8SB 1PK1B 3N7SC 4UB3A 1S77D 4KLUA 3N7RC 2G5IB 1N63A 1Q3VA 1ZQCA 2H5XA 5HMMA 5ALNA 4EX7A 2LYBA 5KFZA 2AH5A 3RFAA 4QZIA 4M2YA 4M9JA 4EYHB 1KSPA 1NK5A 4MF8A 4GC7A 3OHAA 2FPLA 4P4PA 4RPZA 1RXVA 4B9TA 1DXSA 5AKJA 2OM6A 4ED3A 1NI3A 3T5KA 1ZQFA 1ZQYA 5AIAA 2F3NA 5HHIA 3ZD8A 1PUZA 4ELTA 1D9DA 3CRXA 2E8PA 3F2CA 1BPEA 4KX5A 5KAFU 4NLZA 1TK8A 2RHFA 4C80A 2Y0SF 2ZJ8A 5J2AA 3I28A 2WF6A 1X9WA 1Z3EB 1SB3C 4IQUA 4KLQA 3FC4A 3QZ8A 3V6HA 3PSFA 2AHOB 4OJ5A 1OW5A 3MGIA 5KT4A 3BS5A 4AYBC 3QXGA 1B22A 3LDAA 5KFXA 2ZIWB 5JTIA 4KLJA 1NK8A 3BS7A 1N60A 2E3TA 4EELA 3OSPA 2F1IA 4YXJA 2KN7A 4RQ0A 3Q8KA 1MQ2A 3M9NB 3MFIA 5BPCA 1SIJA 3ETLA 4RT2A 8ICKA 1T8EA 2JZBB 4U6PA 4YMOA 1XSPA 5KFTA 1ZQRA 3ZDCA 2HHVA 4MEXA 1ZQNA 4ECVA 4Q8EA 4YN4A 1PVRA 1VDVA 3C1YA 3HJEA 3GIMA 7ICRA 2Y1JA 2W8LA 3RBEA 5ALXA 2HCFA 3L3FX 2ODGA 3TQ1A 4BDPA 3OPXA 4DSLA 4P0PA 5KFNA 2MA1A 2LPEA 1S97A 4FZLA 2P6UA 4P0QA 3G6XA 3DDHA 2WAQF 5J2DA 4DSKA 3RH4A 4Y2JA 2GWSA 1N61A 4DFMA 4RNNA 5AICA 4B9VA 5B5EU 4QNLA 3BQTA 8ICBA 3MDCA 4LZGA 4Z6DA 4NLGA 1U45A 5KG4A 1HUZA 3T79A 2QLTA 2W55A 1J2NA 2CN1A 3CNHA 2VA2A 1JXEA 5CJ7A 1D8LA 3I1YA 1X6IA 2JMGA 4F8RA 5DBCA 2W9CA 5EE3A 1WWUA 1Z4OA 2EANA 3F5EA 3NVZA 5KFQA 2BCQA 2UVWA 4LZDA 2CXYA 2BKEA 1KN5A 2E8NA 2J6UA 1XSLA 1NKCA 1WYGA 2KNJA 5AI0A 4PH5A 4F92B 3KZXA 1KLNA 3C23A 2FMSA 1S9FA 2IHMA 1DK2A 3BZKA 1JI7A 4ECYA 3GIKA 1ZRNA 2PFOA 2BCSA 4UASA 1SV0C 2VANA 5KFGA 2GLEA 8ICJA 1B4FA 1XWLA 4Q45A 2W7PA 2IOHA 2KIVA 1RPLA 1X6JA 2R8HA 4M9HA 3UXNA 2V4RA 4Y2PA 7ICNA 3LWMA 2XICA 3ZDDA 2YMLA 4QW8A 4BXOA 3KKAA 4CE6A 2W9BA 4ED7A 3KBBA 2ASLA 4IR9A 3SI8A 4Y2TA 4M0AA 1RDFA 1A0PA 4YP3A 3GDXA 3NTUA 3AU6A 5CP2A 2AGOA 3JPNA 7ICEA 4IRKA 5DLGA 3MGVA 4GLXA 5ALSA 2HHQA 3TFRA 2XC9A 1Z1BA 3QU7A 5DB6A 5AKZA 2ZIWA 4C8NA 3C28A 4US9A 3C2LA 3KHRA 3UQ0A 5T14A 4R66A 3DV9A 4F4KA 5KFPA 3UQ2A 5KFSA 1S10A 3B0XA 3RAQA 2BGWA 4P0PB 1VJ5A 5IIOA 4R65A 1QSYA 1Z19A 1P7DA 1IXRA 3CYMA 3AQEA 1XO1A 5J29A 5AI4A 5KG0A 3HT3A 4TUSA 4DOCA 4I27A 4PPXA 7ICKA 2LM1A 2G5HB 1BNPA 2ZUDA 1SGGA 3PMLA 4Z6CA 1LVHA 4CF5A 2A1JB 3AQFA 5AM1A 1B0XA 4QW9A 4C0ZA 1LKYB 4F91B 2KIWA 3JPSA 4BWMA 2E1FA 3RJIA 4UAYA 5KG7A 3SAHA 2PFPA 5KG1A 1U4BA 5J2CA 2F77X 2OCEA 3V7LA 3PW4A 1WG8A 5DQGA 5C0YA 1ZQZA 1JN3A 2G0AA 3BJYA 1GO3F 3E58A 2I5HA 5BOLA 9ICVA 3SAFA 1ZYQA 5AK4A 4GC6A 1TKDA 4F71A 2XI9A 4IRCA 4B9MA 1ZD2P 1A76A 4ZH4A 1TAUA 2ZXIA 8ICLA 3UXPA 4F72A 4ECZA 3SAGA 1V9PA 4DF4A 1PVPA 9ICHA 2LI6A 4KN4A 5L1IA 4FZMA 3M8SA 1KQQA 3LVWA 5AM2A 4RQ2A 3T5HA 4C4TA 4MEYA 4NJ8A 2RLTA 5ALMA 3KHLA 1QQ5A 2OEHA 1ZQOA 1C7YA 4RQNA 1B43A 2HBKA 2YN4A 3WKBA 4B9LA 3ISBA 2KHQA 2ZUCA 3H8JA 3QUCA 2H3QA 3UMCA 5ALHA 2XCPA 3QEAZ 8ICXA 4NLCA 1SL2A 3RH6A 9ICQA 2IBKA 4KLEA 3RR8A 5KFCA 2FJ6A 4JWNA 1S8OA 2G08A 1KFTA 8ICPA 3PR4A 3QUTA 1LB2B 5ALFA 2M0NA 2UVUA 3ZDBA 2I6XA 1ZQBA 2JEJA 4NV0A 3PVXA 1QQ6A 4KX3A 1T3NA 4BGDA 5J2GA 2AQ0A 1TAQA 5AKEA 4HYKA 1NJYA 4O3RA 2HOIA 1FEZA 1ZD3A 1AROP 9ICSA 5KG3A 3KHHA 4KLTA 1MC8A 1SXEA 4DLGA 2G07A 2EZXA 3JPPA 1L3SA 4OJOA 4YFKA 2BCUA 3V6JA 3AUOA 1COKA 2JRZA 2D3DA 3A0BU 1JXLA 5E79U 3RH5A 4PGYA 1CRXA 4US8A 2WTFA 2H3ZA 2MRLA 3AM9A 2JEIA 2W9CB 1NK6A 2A1AA 3IRUA 5KFEA 4ECSA 1FFUA 4NL9A 1DGSA 3H0RB 2PKEA 2NRTA 1L3UA 3ZDEA 3V72A 5AI8A 3ALRA 4FBUA 1K5OA 4M47A 5AKKA 1J2MA 3L5KA 5H2FU 1N5XA 5F9NA 3LYSA 5HMLA 4O3NA 3F5AA 4Z6FA 4UAWA 1TFRA 2YY6A 1TK5A 2NO5A 5ALUA 5EE1A 3RB6A 4YMMA 2Y9TA 4UAZA 2GOLA 3UXOA 4YG2A 3N28A 3GV5B 4DQPA 7ICIA 2ZTDA 3UM9A 2KSOB 5TISU 1XC9A 5ALJA 4KLHA 1PK3A 1NKBA 2HW3A 3M9OB 3ETRA 2B6GA 1ZOLA 2HOQA 9ICPA 4QZHA 4JV0A 3ORYA 1U9LA 3V7JA 1X9MA 4UAUA 2IHNA 3IHQB 5J0UA 2LYAA 3B9JA 5AKXA 2AGPA 2W54A 4KTQA 4NLKA 2K89A 4UBCA 8ICZA 4KLOA 4F4ZA 1S0MA 3TKAA 5ALVA 1O08A 2Z7JA 2KICA 4BJQA 1KBUA 2KK0A 4QZEA 3C2MA 3RB3A 4UB8U 4YD1A 4IL6U 5CWRA 5DG8A 4ECUA 5TZVA 1COOA 4J9PA 2GO7A 2DFLA 2EZYA 2W04A 2N1RA 2NRWA 1NJWA 1NJXA 4RQMA 4C7ZA 1L3VA 3V7KA 9ICUA 4DL5A 8ICMA 1YT3A 5AIBA 4J9KA 4B9NA 8ICWA 2WF5A 4KLIA 2H3IA 3DEEA 4YD2A 2JH1A 4KLLA 4FS2A 3CP8A 4QWAA 5AKYA 4O5EA 4UB1A 4ELUA 1CUKA 4OO1J 2KJ9A 5J0WA 4RU9A 4KLSA 3JPQA 5ALKA 2I1QA 4MFCA 5DQIA 5ALQA 3TADA 2R8GA 3PR5B 3QU2A 2XY5A 4BXOB 2G09A 3Q8MA 1X9SA 7ICJA 5AM5A 4YXMA 9ICIA 4ELVA 3OTQA 4ACOA 3MGHA 1KW4A 3AEVA 2JH7A 2LM4A 5KFVA 2P66A 1D9FA 1ZQQA 1X2IA 3UMGA 4EYIB 2XIDA 1RXWA 1Z00A 2FLLA 2PFNA 3PO5A 5EE9A 9ICLA 1Z4NA 9ICFA 4DQIA 2KP7A 4DFDA 4Q43A 3MDAA 4EX6A 3FYHA 3RRHA 2HOFA 5IIKA 4QZ9A 4YVZA 3IN5A 3H8MA 1K1QA 3TARA 4QZAA 2DQNB 2VJ5A 1ZJMA 4AP9A 1O03A 5IIIA 4DL3A 1ZXIA 4NXZA 3JPRA 4I2JA 1NK0A 5B66U 1JIHA 3UPQA 4KLMA 5KFLA 3M9MB 2QKQA 4QWEA 3MBYA 3SV3A 2IOFA 2FMPA 4C4RA 1N56A 3V6KA 2QB0B 1N48A 4NLNA 1HIWA 2ALZA 5J0QA 1LKYA 3TAQA 2V9WA 3PMNA 2KHVA 3MC1A 5J8YA 3WK7A 4O3OA 7ICQA 5JUMA 3RB0A 1MN8A 1N5WA 5AM4A 4K4HA 2W9BB 2CRXA 2ESEA 4P4OA 2RRDA 4JUZA 2MUTB 2ZIVB 1WCNA 1ZD4A 5DQHA 3GFKB 1IIPA 3TADC 2EAMA 7ICHA 2KFNA 1Q8KA 4AYBF 2KE7A 3NGDA 3T3FA 5KT7A 3C1ZA 3RBDA 4Y2UA 2ZTEA 4RQ1A 4K4GA 2KZZA 2KKPA 2D8CA 1SL1A 1RG6A 4A8EA 1JUDA 1YZ6A 3RJGA 1Z00B 1SKRA 1JALA 4RQ4A 1NOMA 3EPGA 4DQSA 4M9LA 5KFMA 5G5HA 3EUB2 2KSOA 3MABA 1J97A 4UATA 2KFZA 2FPMA 1Q46A 5DB7A 4GFJA 2HBJA 5D46A 5L1MA 3M6ZA 2ZIXA 3N97B 3R9KA 1DRGA 5KFIA 4RPXA 2M9NA 9ICCA 3H0LB 4EZ9A 3IM1A 2C2RA 2NYVA 1ZQEA 8ICRA 2BQ3A 3UMBA 2P35A 5AK5A 4QWBA 2JXJA 3AU2A 4E0DA 3AL0B 3J81j 4F4XA 1SKSA 2XO7A 4TUPA 1FFVA 1L8OA 1ZQVA 2J6TA 1ZQKA 3WKDA 2W03A 4ICAA 5J0TA 1TV9A 4JK1A 3HILA 3MR5A 1KKXA 1FIQA 4DS4A 1T94A 5L9XA 5DBBA 2Y1IA 3GU3A 3C29A 2KZMA 3RJJA 2J6SA 4I2HA 3Q8PB 4KMUA 2ASJA 8ICYA 4JB3A 1N2XA 5J2HA 3ZI4A 3RR7A 1D8BA 4DFJA 1F0MA 3HX0A 1UHUA 3VC8A 3WK5A 3M1YA 1KEJA 1ZQ1C 4J9QA 4CNQA 3QE9Y 3LWLA 4EBDA 2YB1A 3ONNA 2JR5A 4I2FA 4F2SA 2VIXA 5C5JA 3WU2U 3HRDD 1DOQA 2LHTA 1ZQSA 2FDRA 4QWDA 5AKHA 3NS1A 2OWOA 3MFHA 4R64A 5AKGA 4Y2YA 3JPOA 5ALLA 5HHHA 8ICOA 3ICXA 4DLEA 5KL1B 5CHGA 4O3SA 2BPFA 1BPZA 3GQCA 2LKYA 3PNCA 5DKWA 3U26A 3OJUA 4QZ8A 4MF2A 8ICCA 9ICJA 3T5LA 1NK7A 7ICGA 3C5FA 3RJEA 1ZQAA 1M6YA 3A0HU 1RZTA 5KT6A 1KTQA 3RJFA 4G3IA 4ECQA 3PW2A 4CF3A 1MQ3A 3TANA 2K60A 1AQ6A 2NV3A 4K4IA 1DGJA 4PHDA 8ICHA 5AHXA 4IR1A 4F4YA 5KL8B 1FO4A 3H4BA 2BQRA 1JX4A 2HBLA 1HUOA 1ZQXA 4OJLA 4F4WA 4MFAA 3GILA 1RYUA 3HKZF 3SD7A 4RNMA 5EE0A 2HMXA 2KJ5A 2KOBA 4JMUA 2BCVA 2JV3A 5DG9A 3SMVA 2DKZA 3NVWA 2WB1F 3IG5A 1QLNA 3BQ0A 1L3TA 1ZJNA 3Q8LA 2JEGA 1KRPA 4CRXA 1S76D 4QZCA 3IV6A 2WB1C 1X40A 4KN7A 4UAVA 3F2DA 2MUTA 2V4QA 3WK9A 3HWTA 3QUQA 5J2EA 2JZBA 2UVRA 2ES6A 4I2CA 9ICWA 4MHVA
chains in the Genus database with same CATH topology
9ICAA 3M8RA 1XC9A 7ICUA 5J2BA 5IINA 4KLHA 3OSPA 1NKBA 2F1IA 4DQRA 2HW3A 4YXJA 4RQ5A 4RQ0A 2KN7A 3Q8KA 4QZBA 1MQ2A 3M9NB 4JWMA 3M9OB 3MFIA 5BPCA 4EEYA 9ICPA 4QZHA 1XSNA 1S0NA 4JV0A 3ETLA 3ORYA 2XGPA 4RT2A 8ICKA 1T8EA 3ISDA 1U9LA 3V7JA 4IQWA 5HNKA 2JZBB 4YMOA 1X9MA 1XSPA 9ICNA 2IHNA 3IHQB 5J0UA 5L1KA 4Q44A 5KFTA 1ZQRA 4R63A 3ZDCA 2AGPA 1KDHA 4KTQA 2HHVA 1WCLA 4F5RA 4ECTA 1ZQJA 4NLKA 4MEXA 4UBCA 5KG6A 2XY7A 1TK0A 4ECVA 4J9SA 4X5VA 5KFUA 4YN4A 1ZQNA 4KLOA 4Q8EA 4F4ZA 5DGAA 1S0MA 4Q8FA 4ED6A 8ICEA 5CA7A 3C1YA 5KFDA 2HHSA 3GIMA 2C2EA 3SZ2A 7ICRA 4BWJA 4F5NA 1ZQDA 2Y1JA 1SZPA 2W9AA 2W8LA 3RBEA 2XGQA 1Y88A 4DOBA 4QZEA 3C2MA 3RB3A 5IIMA 9ICRA 4DFPA 5L1JA 4YD1A 5CWRA 4F5OA 5DG8A 4ECUA 3TQ1A 3EW9A 5TZVA 4BDPA 4JV1A 4JV2A 5CB1A 5J0XA 1COOA 4RT3A 4DSLA 4J9PA 1D8YA 5D4BA 5KFNA 2DFLA 2UVVA 4J9NA 2NRWA 1NJWA 1NJXA 3H40A 3HW8A 3OSNA 1S97A 1LV5A 1L3VA 3V7KA 9ICUA 4DL5A 2P6UA 5CR0A 8ICMA 3OHBA 4ECRA 4M6WB 4J9KA 1T7PA 1L5UA 3G6XA 1BPXA 4B9NA 1U48A 4EBCA 5HP4A 5DB8A 4C8MA 5J2DA 2AQ4A 4KLIA 4TUQA 3RH4A 3OGUA 4YD2A 4DSKA 4PHPA 5J0SA 2PI5A 4B9SA 3TI0A 4KLLA 2GWSA 9ICTA 4FS2A 3TFSA 4DSEA 4UQGA 4QZFA 4QWAA 4DFMA 3BDPA 5DGBA 2LYHA 4RNNA 4O5EA 5IIJA 4UB1A 4B9VA 3G6VA 3BQTA 8ICBA 4ELUA 3LK9A 1CUKA 1U49A 5J2KA 4R8UA 3MDCA 5J0WA 4LZGA 4RZRA 1T4GA 3H7IA 4Z6DA 4RU9A 3JPQA 3PX0A 2BR0A 2W8KA 4F2RA 4NLGA 1ZQMA 4XRHA 4PGQA 2HHTA 2I1QA 4MFCA 4FS1A 3EWAA 5KG4A 1U45A 1HUZA 3ZD9A 5DQIA 3QZ7A 2R8IA 2R8GA 3PR5B 3PX4A 2FPKA 3SV4A 3H8SA 2XY5A 1JXEA 2VA2A 5CJ7A 3Q8MA 1X9SA 3ZDAA 4BXOB 2Q0ZX 7ICJA 1D8LA 2C28A 4YXMA 1QTMA 2FMQA 4ELVA 5DBCA 5KG2A 4F8RA 7ICFA 9ICIA 2W9CA 5KFJA 3MGHA 1BGXT 4KLFA 3MR3A 1ZQGA 5KFVA 2JEFA 5DG7A 2P66A 9ICEA 8ICTA 4TQRA 5KFQA 1EXNA 1D9FA 1ZQQA 2BCQA 1X2IA 2UVWA 4LZDA 1XU4A 1XS9D 4EYIB 3RAXA 4O3QA 3GV7B 4F93B 1RXWA 4M04A 1Z00A 4UB4A 2FLLA 2PFNA 2BKEA 3PO5A 2J6UA 5EWEA 1XSLA 4RPYA 1NKCA 9ICLA 4IRDA 4PH5A 9ICXA 3JPTA 4F92B 5J0PA 4GXKA 4DQIA 9ICFA 3C5GA 2PXIA 1KLNA 4Q43A 2A1JA 3C23A 2FMSA 1S9FA 3MDAA 2MAXA 2IHMA 1CEZA 3K4GA 2PFQA 4YMNA 1HJPA 4ECYA 3HP6A 3OJSA 3FYHA 3RRHA 5KG5A 3GIKA 8ICZA 2PFOA 5IIKA 2BCSA 4QZ9A 5KFHA 2C2DA 2F1JA 5KFWA 4C8KA 4I2DA 4YVZA 2VANA 4DEZA 5KFGA 4J9MA 4LVSA 3EPIA 8ICJA 1K1QA 2HHUA 3TARA 4QZAA 1XWLA 1H38A 4Q45A 4DSIA 1ZJMA 2F1HA 5IIIA 4QZGA 1UA0A 4DL3A 4DOAA 1RPLA 3ISCA 4I2GA 4KITB 2HHWA 4NXZA 4O0IA 3JPRA 4I2JA 1NK0A 5KFAA 1JIHA 2R8HA 3UPQA 4M9HA 1BPBA 3UXNA 2V4RA 4RQ3A 9ICMA 3PY8A 4UB2A 7ICNA 3LWMA 4KLMA 5KFKA 3ZDDA 4YQWA 5KFLA 4RUAA 3M9MB 4QW8A 4M9GA 4BXOA 4IQTA 4M9NA 4O3PA 4QWEA 3MBYA 2W9BA 3SV3A 4ED7A 2AGQA 2FMPA 2ASLA 4IR9A 3SI8A 2HVHA 2BPGA 1N56A 4M0AA 3V6KA 4J9LA 1N48A 1ZQLA 2DPIA 4NLNA 4YP3A 2ZJAA 5DLFA 8ICUA 2ALZA 2NRZA 3NTUA 5J0QA 3GDXA 3AU6A 3TAQA 2V9WA 5CP2A 3PV8A 2AGOA 3PMNA 3JPNA 7ICEA 2NRVA 4QZDA 4IRKA 4O3OA 4NY8A 5DLGA 4GLXA 7ICQA 5JUMA 3RB0A 4ED2A 4K4HA 2HHQA 3KHGA 2XC9A 3TFRA 2W9BB 1NKEA 4I28A 5DB6A 3BQ2A 4C8NA 4P4OA 4ECXA 3C2LA 5J0YA 3C21A 4JUZA 2MUTB 4DFKA 3KHRA 4C8LA 3GV8B 3UQ0A 1WCNA 3Q8QB 4DO9A 4Z6EA 4F50A 3THVA 1JMSA 5KT2A 8ICGA 8ICAA 1UA1A 2RDJA 4I2AA 2BCRA 4R66A 4F4KA 5KFPA 5DQHA 3UQ2A 3GFKB 5KFSA 3MR2A 1S10A 7ICVA 1BPDA 5KT5A 4ED1A 3PW5A 4C8OA 3BQ1A 3B0XA 7ICHA 2C22A 2KFNA 4RUCA 2ASDA 3RAQA 1A77A 2BGWA 5IIOA 5KTQA 4R65A 1QSYA 3NGDA 3T3FA 5KT7A 1IM4A 4YR0A 3C1ZA 5J2IA 3Q8RB 3QEBZ 1IXRA 2AJQA 1S0OA 1NK4A 3RBDA 1XO1A 5J29A 4EBEA 4GXJA 4DQQA 5KG0A 3HT3A 4TUSA 2ZTEA 4RQ1A 4F5QA 4K4GA 4DOCA 4DF8A 4I27A 1KFSA 4PPXA 2KZZA 7ICKA 1SL1A 2ZUDA 3PMLA 4O5KA 4Z6CA 3PW7A 5DDMA 2W9MA 3RJGA 2XY6A 1KFDA 1Z00B 4UBBA 1S0VA 1BPYA 2A1JB 2KZ3A 2ATLA 1SKRA 9ICBA 3PW0A 4QW9A 4I2EA 4RQ4A 1NOMA 2I9GA 3EPGA 3N4MB 7ICSA 4DQSA 4M9LA 5KFMA 4F91B 2NRXA 3JPSA 4BWMA 5IILA 3B0YA 4MFFA 2B21A 3RJIA 2ISOA 4UAYA 5KG7A 5J2JA 3MABA 2R8KA 2PFPA 5KG1A 1U4BA 5J2CA 2KFZA 2AU0A 3FDSA 5L1LA 2FPMA 3SYZA 3V7LA 1UT8A 4DL7A 1ZETA 5DB7A 3PW4A 3RRGA 4I2BA 5DQGA 5D46A 1ZQZA 3N97B 1ZQHA 7ICMA 5DB9A 2KTQA 5KFIA 1JN3A 3T5JA 5KFBA 4RPXA 1UT5A 3BJYA 2M9NA 9ICCA 5EOZA 1K1SA 5BOLA 3RTVA 9ICVA 4PHAA 4F3OA 1ZYQA 2ZTCA 4EZ9A 4KLGA 3IM1A 2C2RA 1ZQEA 4DL4A 4GC6A 1PZNA 2RDIA 5J0OA 2BQ3A 1TKDA 4B9UA 2BPCA 4KLDA 2HVIA 8ICRA 4RQ8A 3H4DA 4QWBA 4IRCA 4R8UB 5J2FA 8ICSA 2IMWP 4B9MA 1SL0A 4DWIA 8ICVA 4TQSA 5DBAA 3AU2A 4CCHA 1A76A 3TAPA 4RNOA 4E0DA 4DSJA 4O9MA 4DSFA 4ZH4A 4F4XA 1TAUA 5EWFA 1SKSA 2XO7A 4TUPA 4YR3A 8ICLA 9ICKA 3UXPA 4ECZA 1ZQVA 8ICFA 2J6TA 5BOMA 1V9PA 4DF4A 1ZQKA 7ICPA 9ICHA 4KN4A 5L1IA 4IQVA 1MSWD 3M8SA 5DDYA 1ZQIA 7ICOA 5J0TA 1QSSA 4FO6A 4RQ2A 5F9LA 3T5HA 1TV9A 4JK1A 4MEYA 4PHEA 3MR5A 2HHXA 4ECWA 4ED0A 4NM2A 4DS4A 4UB5A 3KHLA 5L9XA 5DBBA 2Y1IA 8ICWA 4XQ8A 1ZQOA 2KZMA 3RJJA 5KFOA 1C7YA 3H8WA 2J6SA 4I2HA 3Q8PB 1NJZA 1B43A 4KMUA 2ASJA 8ICYA 2FLPA 2BQUA 4B9LA 3ISBA 2ZUCA 3H8JA 2XCPA 5J2HA 3QEAZ 3RR7A 4P2HA 8ICXA 1SL2A 1SKWA 4DFJA 3RH6A 5KFRA 2DPJA 1RYRA 9ICQA 2IBKA 3HX0A 4KLEA 3RR8A 5J0RA 1ZQTA 4F5PA 5KFCA 4DL6A 1RYSA 1KEJA 4JWNA 4RQ6A 1KFTA 4J9QA 8ICPA 3PR4A 1LB2B 4FBTA 8ICQA 2UVUA 3RJHA 3ZDBA 3QE9Y 3LWLA 1ZQBA 4EBDA 9ICOA 4I2FA 2JEJA 5KT3A 4F2SA 5C5JA 3PVXA 4EZ6A 7ICTA 3KTQA 1DOQA 2XCAA 3G6YA 8ICNA 1NK9A 2BHNA 1ZQSA 4QWDA 9ICGA 1T3NA 4O5CA 3RB4A 5EWGA 2VA3A 2OWOA 3MFHA 4R64A 4BGDA 3C2KA 4M6WA 5J2GA 2AQ0A 1TAQA 3JPOA 5KFYA 4HYKA 4J9OA 1NJYA 4O3RA 5HHHA 8ICOA 1ZQUA 4DS5A 4PGXA 1AROP 4DLEA 9ICSA 3Q8SB 5CHGA 4O3SA 2VA8A 2ZJ5A 5KG3A 4UB3A 1S77D 4KLUA 3KHHA 4KLTA 1MC8A 1BPZA 2BPFA 2ISPA 3GQCA 4DLGA 3PNCA 5DKWA 3GIJA 1ZQCA 1ZQWA 2H5XA 5HMMA 3OJUA 4QZ8A 4MF2A 8ICCA 3JPPA 2BDPA 3T5LA 3EYZA 1NK7A 4QZIA 9ICJA 5KFZA 1L3SA 4YFKA 2BCUA 4M2YA 7ICGA 3C5FA 3V6JA 3RJKA 3AUOA 3RJEA 1BVSA 1U47A 1ZQAA 1QSLA 4M9JA 1JXLA 4XA5A 4EYHB 1RZTA 1KSPA 5KT6A 1KTQA 7ICLA 4GXIA 3MR6A 1NK5A 3RJFA 4MF8A 4G3IA 3RH5A 4ECQA 4GC7A 3PW2A 4PGYA 2WTFA 1MQ3A 3TANA 3OHAA 2FPLA 4P4MA 4XUSA 4P4PA 4RPZA 1ZQPA 2W9CB 4K4IA 1NK6A 2JEIA 1RXVA 5KFEA 4PHDA 4ECSA 4B9TA 5D49A 1DGSA 4IR1A 8ICHA 2NRTA 1L3UA 4F4YA 2ZUBA 3EZ5A 3ZDEA 3V72A 4ED3A 2FLNA 4NM1A 3GIIA 3T5KA 1ZQFA 4FBUA 1ZQYA 3H4BA 2BQRA 1JX4A 1HUOA 4YR2A 4ED8A 5HHIA 4KLSA 1ZQXA 3ZD8A 3HPOA 4ELTA 8ICIA 4F4WA 4J9RA 4MFAA 4I29A 3GILA 4DL2A 1D9DA 4M47A 4RNMA 5KFFA 1BPEA 2BCVA 5F9NA 4NLZA 4TURA 1TK8A 5HMLA 4O3NA 5DG9A 4YCXA 4Z6FA 2ZJ8A 4UAWA 1QLNA 5J2AA 1TFRA 4RQ7A 1Z3EB 1X9WA 1TK5A 3BQ0A 4IQUA 4KLQA 2IA6A 1L3TA 1ZJNA 3Q8LA 2R8JA 2JEGA 1KRPA 1S76D 4QZCA 3QZ8A 3V6HA 3RB6A 4YMMA 4KN7A 2P6RA 3MGIA 5KT4A 4UAZA 2MUTA 3K75D 4I2IA 3UXOA 3PO4A 4YG2A 2V4QA 3PX6A 1B22A 3LDAA 5KFXA 3HWTA 4QWCA 5J2EA 2JZBA 3GV5B 1TVAA 2UVRA 4DQPA 7ICIA 3E2EA 4I2CA 4KLJA 1NK8A 2ZTDA 9ICWA 2PI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICA A;  3M8R A;  1XC9 A;  7ICU A;  5J2B A;  5IIN A;  4KLH A;  3OSP A;  1NKB A;  2F1I A;  4DQR A;  2HW3 A;  4YXJ A;  4RQ5 A;  4RQ0 A;  2KN7 A;  3Q8K A;  4QZB A;  1MQ2 A;  3M9N B;  4JWM A;  3M9O B;  3MFI A;  5BPC A;  4EEY A;  9ICP A;  4QZH A;  1XSN A;  1S0N A;  4JV0 A;  3ETL A;  3ORY A;  2XGP A;  4RT2 A;  8ICK A;  1T8E A;  3ISD A;  1U9L A;  3V7J A;  4IQW A;  5HNK A;  2JZB B;  4YMO A;  1X9M A;  1XSP A;  9ICN A;  2IHN A;  3IHQ B;  5J0U A;  5L1K A;  4Q44 A;  5KFT A;  1ZQR A;  4R63 A;  3ZDC A;  2AGP A;  1KDH A;  4KTQ A;  2HHV A;  1WCL A;  4F5R A;  4ECT A;  1ZQJ A;  4NLK A;  4MEX A;  4UBC A;  5KG6 A;  2XY7 A;  1TK0 A;  4ECV A;  4J9S A;  4X5V A;  5KFU A;  4YN4 A;  1ZQN A;  4KLO A;  4Q8E A;  4F4Z A;  5DGA A;  1S0M A;  4Q8F A;  4ED6 A;  8ICE A;  5CA7 A;  3C1Y A;  5KFD A;  2HHS A;  3GIM A;  2C2E A;  3SZ2 A;  7ICR A;  4BWJ A;  4F5N A;  1ZQD A;  2Y1J A;  1SZP A;  2W9A A;  2W8L A;  3RBE A;  2XGQ A;  1Y88 A;  4DOB A;  4QZE A;  3C2M A;  3RB3 A;  5IIM A;  9ICR A;  4DFP A;  5L1J A;  4YD1 A;  5CWR A;  4F5O A;  5DG8 A;  4ECU A;  3TQ1 A;  3EW9 A;  5TZV A;  4BDP A;  4JV1 A;  4JV2 A;  5CB1 A;  5J0X A;  1COO A;  4RT3 A;  4DSL A;  4J9P A;  1D8Y A;  5D4B A;  5KFN A;  2DFL A;  2UVV A;  4J9N A;  2NRW A;  1NJW A;  1NJX A;  3H40 A;  3HW8 A;  3OSN A;  1S97 A;  1LV5 A;  1L3V A;  3V7K A;  9ICU A;  4DL5 A;  2P6U A;  5CR0 A;  8ICM A;  3OHB A;  4ECR A;  4M6W B;  4J9K A;  1T7P A;  1L5U A;  3G6X A;  1BPX A;  4B9N A;  1U48 A;  4EBC A;  5HP4 A;  5DB8 A;  4C8M A;  5J2D A;  2AQ4 A;  4KLI A;  4TUQ A;  3RH4 A;  3OGU A;  4YD2 A;  4DSK A;  4PHP A;  5J0S A;  2PI5 A;  4B9S A;  3TI0 A;  4KLL A;  2GWS A;  9ICT A;  4FS2 A;  3TFS A;  4DSE A;  4UQG A;  4QZF A;  4QWA A;  4DFM A;  3BDP A;  5DGB A;  2LYH A;  4RNN A;  4O5E A;  5IIJ A;  4UB1 A;  4B9V A;  3G6V A;  3BQT A;  8ICB A;  4ELU A;  3LK9 A;  1CUK A;  1U49 A;  5J2K A;  4R8U A;  3MDC A;  5J0W A;  4LZG A;  4RZR A;  1T4G A;  3H7I A;  4Z6D A;  4RU9 A;  3JPQ A;  3PX0 A;  2BR0 A;  2W8K A;  4F2R A;  4NLG A;  1ZQM A;  4XRH A;  4PGQ A;  2HHT A;  2I1Q A;  4MFC A;  4FS1 A;  3EWA A;  5KG4 A;  1U45 A;  1HUZ A;  3ZD9 A;  5DQI A;  3QZ7 A;  2R8I A;  2R8G A;  3PR5 B;  3PX4 A;  2FPK A;  3SV4 A;  3H8S A;  2XY5 A;  1JXE A;  2VA2 A;  5CJ7 A;  3Q8M A;  1X9S A;  3ZDA A;  4BXO B;  2Q0Z X;  7ICJ A;  1D8L A;  2C28 A;  4YXM A;  1QTM A;  2FMQ A;  4ELV A;  5DBC A;  5KG2 A;  4F8R A;  7ICF A;  9ICI A;  2W9C A;  5KFJ A;  3MGH A;  1BGX T;  4KLF A;  3MR3 A;  1ZQG A;  5KFV A;  2JEF A;  5DG7 A;  2P66 A;  9ICE A;  8ICT A;  4TQR A;  5KFQ A;  1EXN A;  1D9F A;  1ZQQ A;  2BCQ A;  1X2I A;  2UVW A;  4LZD A;  1XU4 A;  1XS9 D;  4EYI B;  3RAX A;  4O3Q A;  3GV7 B;  4F93 B;  1RXW A;  4M04 A;  1Z00 A;  4UB4 A;  2FLL A;  2PFN A;  2BKE A;  3PO5 A;  2J6U A;  5EWE A;  1XSL A;  4RPY A;  1NKC A;  9ICL A;  4IRD A;  4PH5 A;  9ICX A;  3JPT A;  4F92 B;  5J0P A;  4GXK A;  4DQI A;  9ICF A;  3C5G A;  2PXI A;  1KLN A;  4Q43 A;  2A1J A;  3C23 A;  2FMS A;  1S9F A;  3MDA A;  2MAX A;  2IHM A;  1CEZ A;  3K4G A;  2PFQ A;  4YMN A;  1HJP A;  4ECY A;  3HP6 A;  3OJS A;  3FYH A;  3RRH A;  5KG5 A;  3GIK A;  8ICZ A;  2PFO A;  5IIK A;  2BCS A;  4QZ9 A;  5KFH A;  2C2D A;  2F1J A;  5KFW A;  4C8K A;  4I2D A;  4YVZ A;  2VAN A;  4DEZ A;  5KFG A;  4J9M A;  4LVS A;  3EPI A;  8ICJ A;  1K1Q A;  2HHU A;  3TAR A;  4QZA A;  1XWL A;  1H38 A;  4Q45 A;  4DSI A;  1ZJM A;  2F1H A;  5III A;  4QZG A;  1UA0 A;  4DL3 A;  4DOA A;  1RPL A;  3ISC A;  4I2G A;  4KIT B;  2HHW A;  4NXZ A;  4O0I A;  3JPR A;  4I2J A;  1NK0 A;  5KFA A;  1JIH A;  2R8H A;  3UPQ A;  4M9H A;  1BPB A;  3UXN A;  2V4R A;  4RQ3 A;  9ICM A;  3PY8 A;  4UB2 A;  7ICN A;  3LWM A;  4KLM A;  5KFK A;  3ZDD A;  4YQW A;  5KFL A;  4RUA A;  3M9M B;  4QW8 A;  4M9G A;  4BXO A;  4IQT A;  4M9N A;  4O3P A;  4QWE A;  3MBY A;  2W9B A;  3SV3 A;  4ED7 A;  2AGQ A;  2FMP A;  2ASL A;  4IR9 A;  3SI8 A;  2HVH A;  2BPG A;  1N56 A;  4M0A A;  3V6K A;  4J9L A;  1N48 A;  1ZQL A;  2DPI A;  4NLN A;  4YP3 A;  2ZJA A;  5DLF A;  8ICU A;  2ALZ A;  2NRZ A;  3NTU A;  5J0Q A;  3GDX A;  3AU6 A;  3TAQ A;  2V9W A;  5CP2 A;  3PV8 A;  2AGO A;  3PMN A;  3JPN A;  7ICE A;  2NRV A;  4QZD A;  4IRK A;  4O3O A;  4NY8 A;  5DLG A;  4GLX A;  7ICQ A;  5JUM A;  3RB0 A;  4ED2 A;  4K4H A;  2HHQ A;  3KHG A;  2XC9 A;  3TFR A;  2W9B B;  1NKE A;  4I28 A;  5DB6 A;  3BQ2 A;  4C8N A;  4P4O A;  4ECX A;  3C2L A;  5J0Y A;  3C21 A;  4JUZ A;  2MUT B;  4DFK A;  3KHR A;  4C8L A;  3GV8 B;  3UQ0 A;  1WCN A;  3Q8Q B;  4DO9 A;  4Z6E A;  4F50 A;  3THV A;  1JMS A;  5KT2 A;  8ICG A;  8ICA A;  1UA1 A;  2RDJ A;  4I2A A;  2BCR A;  4R66 A;  4F4K A;  5KFP A;  5DQH A;  3UQ2 A;  3GFK B;  5KFS A;  3MR2 A;  1S10 A;  7ICV A;  1BPD A;  5KT5 A;  4ED1 A;  3PW5 A;  4C8O A;  3BQ1 A;  3B0X A;  7ICH A;  2C22 A;  2KFN A;  4RUC A;  2ASD A;  3RAQ A;  1A77 A;  2BGW A;  5IIO A;  5KTQ A;  4R65 A;  1QSY A;  3NGD A;  3T3F A;  5KT7 A;  1IM4 A;  4YR0 A;  3C1Z A;  5J2I A;  3Q8R B;  3QEB Z;  1IXR A;  2AJQ A;  1S0O A;  1NK4 A;  3RBD A;  1XO1 A;  5J29 A;  4EBE A;  4GXJ A;  4DQQ A;  5KG0 A;  3HT3 A;  4TUS A;  2ZTE A;  4RQ1 A;  4F5Q A;  4K4G A;  4DOC A;  4DF8 A;  4I27 A;  1KFS A;  4PPX A;  2KZZ A;  7ICK A;  1SL1 A;  2ZUD A;  3PML A;  4O5K A;  4Z6C A;  3PW7 A;  5DDM A;  2W9M A;  3RJG A;  2XY6 A;  1KFD A;  1Z00 B;  4UBB A;  1S0V A;  1BPY A;  2A1J B;  2KZ3 A;  2ATL A;  1SKR A;  9ICB A;  3PW0 A;  4QW9 A;  4I2E A;  4RQ4 A;  1NOM A;  2I9G A;  3EPG A;  3N4M B;  7ICS A;  4DQS A;  4M9L A;  5KFM A;  4F91 B;  2NRX A;  3JPS A;  4BWM A;  5IIL A;  3B0Y A;  4MFF A;  2B21 A;  3RJI A;  2ISO A;  4UAY A;  5KG7 A;  5J2J A;  3MAB A;  2R8K A;  2PFP A;  5KG1 A;  1U4B A;  5J2C A;  2KFZ A;  2AU0 A;  3FDS A;  5L1L A;  2FPM A;  3SYZ A;  3V7L A;  1UT8 A;  4DL7 A;  1ZET A;  5DB7 A;  3PW4 A;  3RRG A;  4I2B A;  5DQG A;  5D46 A;  1ZQZ A;  3N97 B;  1ZQH A;  7ICM A;  5DB9 A;  2KTQ A;  5KFI A;  1JN3 A;  3T5J A;  5KFB A;  4RPX A;  1UT5 A;  3BJY A;  2M9N A;  9ICC A;  5EOZ A;  1K1S A;  5BOL A;  3RTV A;  9ICV A;  4PHA A;  4F3O A;  1ZYQ A;  2ZTC A;  4EZ9 A;  4KLG A;  3IM1 A;  2C2R A;  1ZQE A;  4DL4 A;  4GC6 A;  1PZN A;  2RDI A;  5J0O A;  2BQ3 A;  1TKD A;  4B9U A;  2BPC A;  4KLD A;  2HVI A;  8ICR A;  4RQ8 A;  3H4D A;  4QWB A;  4IRC A;  4R8U B;  5J2F A;  8ICS A;  2IMW P;  4B9M A;  1SL0 A;  4DWI A;  8ICV A;  4TQS A;  5DBA A;  3AU2 A;  4CCH A;  1A76 A;  3TAP A;  4RNO A;  4E0D A;  4DSJ A;  4O9M A;  4DSF A;  4ZH4 A;  4F4X A;  1TAU A;  5EWF A;  1SKS A;  2XO7 A;  4TUP A;  4YR3 A;  8ICL A;  9ICK A;  3UXP A;  4ECZ A;  1ZQV A;  8ICF A;  2J6T A;  5BOM A;  1V9P A;  4DF4 A;  1ZQK A;  7ICP A;  9ICH A;  4KN4 A;  5L1I A;  4IQV A;  1MSW D;  3M8S A;  5DDY A;  1ZQI A;  7ICO A;  5J0T A;  1QSS A;  4FO6 A;  4RQ2 A;  5F9L A;  3T5H A;  1TV9 A;  4JK1 A;  4MEY A;  4PHE A;  3MR5 A;  2HHX A;  4ECW A;  4ED0 A;  4NM2 A;  4DS4 A;  4UB5 A;  3KHL A;  5L9X A;  5DBB A;  2Y1I A;  8ICW A;  4XQ8 A;  1ZQO A;  2KZM A;  3RJJ A;  5KFO A;  1C7Y A;  3H8W A;  2J6S A;  4I2H A;  3Q8P B;  1NJZ A;  1B43 A;  4KMU A;  2ASJ A;  8ICY A;  2FLP A;  2BQU A;  4B9L A;  3ISB A;  2ZUC A;  3H8J A;  2XCP A;  5J2H A;  3QEA Z;  3RR7 A;  4P2H A;  8ICX A;  1SL2 A;  1SKW A;  4DFJ A;  3RH6 A;  5KFR A;  2DPJ A;  1RYR A;  9ICQ A;  2IBK A;  3HX0 A;  4KLE A;  3RR8 A;  5J0R A;  1ZQT A;  4F5P A;  5KFC A;  4DL6 A;  1RYS A;  1KEJ A;  4JWN A;  4RQ6 A;  1KFT A;  4J9Q A;  8ICP A;  3PR4 A;  1LB2 B;  4FBT A;  8ICQ A;  2UVU A;  3RJH A;  3ZDB A;  3QE9 Y;  3LWL A;  1ZQB A;  4EBD A;  9ICO A;  4I2F A;  2JEJ A;  5KT3 A;  4F2S A;  5C5J A;  3PVX A;  4EZ6 A;  7ICT A;  3KTQ A;  1DOQ A;  2XCA A;  3G6Y A;  8ICN A;  1NK9 A;  2BHN A;  1ZQS A;  4QWD A;  9ICG A;  1T3N A;  4O5C A;  3RB4 A;  5EWG A;  2VA3 A;  2OWO A;  3MFH A;  4R64 A;  4BGD A;  3C2K A;  4M6W A;  5J2G A;  2AQ0 A;  1TAQ A;  3JPO A;  5KFY A;  4HYK A;  4J9O A;  1NJY A;  4O3R A;  5HHH A;  8ICO A;  1ZQU A;  4DS5 A;  4PGX A;  1ARO P;  4DLE A;  9ICS A;  3Q8S B;  5CHG A;  4O3S A;  2VA8 A;  2ZJ5 A;  5KG3 A;  4UB3 A;  1S77 D;  4KLU A;  3KHH A;  4KLT A;  1MC8 A;  1BPZ A;  2BPF A;  2ISP A;  3GQC A;  4DLG A;  3PNC A;  5DKW A;  3GIJ A;  1ZQC A;  1ZQW A;  2H5X A;  5HMM A;  3OJU A;  4QZ8 A;  4MF2 A;  8ICC A;  3JPP A;  2BDP A;  3T5L A;  3EYZ A;  1NK7 A;  4QZI A;  9ICJ A;  5KFZ A;  1L3S A;  4YFK A;  2BCU A;  4M2Y A;  7ICG A;  3C5F A;  3V6J A;  3RJK A;  3AUO A;  3RJE A;  1BVS A;  1U47 A;  1ZQA A;  1QSL A;  4M9J A;  1JXL A;  4XA5 A;  4EYH B;  1RZT A;  1KSP A;  5KT6 A;  1KTQ A;  7ICL A;  4GXI A;  3MR6 A;  1NK5 A;  3RJF A;  4MF8 A;  4G3I A;  3RH5 A;  4ECQ A;  4GC7 A;  3PW2 A;  4PGY A;  2WTF A;  1MQ3 A;  3TAN A;  3OHA A;  2FPL A;  4P4M A;  4XUS A;  4P4P A;  4RPZ A;  1ZQP A;  2W9C B;  4K4I A;  1NK6 A;  2JEI A;  1RXV A;  5KFE A;  4PHD A;  4ECS A;  4B9T A;  5D49 A;  1DGS A;  4IR1 A;  8ICH A;  2NRT A;  1L3U A;  4F4Y A;  2ZUB A;  3EZ5 A;  3ZDE A;  3V72 A;  4ED3 A;  2FLN A;  4NM1 A;  3GII A;  3T5K A;  1ZQF A;  4FBU A;  1ZQY A;  3H4B A;  2BQR A;  1JX4 A;  1HUO A;  4YR2 A;  4ED8 A;  5HHI A;  4KLS A;  1ZQX A;  3ZD8 A;  3HPO A;  4ELT A;  8ICI A;  4F4W A;  4J9R A;  4MFA A;  4I29 A;  3GIL A;  4DL2 A;  1D9D A;  4M47 A;  4RNM A;  5KFF A;  1BPE A;  2BCV A;  5F9N A;  4NLZ A;  4TUR A;  1TK8 A;  5HML A;  4O3N A;  5DG9 A;  4YCX A;  4Z6F A;  2ZJ8 A;  4UAW A;  1QLN A;  5J2A A;  1TFR A;  4RQ7 A;  1Z3E B;  1X9W A;  1TK5 A;  3BQ0 A;  4IQU A;  4KLQ A;  2IA6 A;  1L3T A;  1ZJN A;  3Q8L A;  2R8J A;  2JEG A;  1KRP A;  1S76 D;  4QZC A;  3QZ8 A;  3V6H A;  3RB6 A;  4YMM A;  4KN7 A;  2P6R A;  3MGI A;  5KT4 A;  4UAZ A;  2MUT A;  3K75 D;  4I2I A;  3UXO A;  3PO4 A;  4YG2 A;  2V4Q A;  3PX6 A;  1B22 A;  3LDA A;  5KFX A;  3HWT A;  4QWC A;  5J2E A;  2JZB A;  3GV5 B;  1TVA A;  2UVR A;  4DQP A;  7ICI A;  3E2E A;  4I2C A;  4KLJ A;  1NK8 A;  2ZTD A;  9ICW A;  2PI4 A; 
#chains in the Genus database with same CATH topology
 3M8R A;  7ICU A;  5J2B A;  4DQR A;  3TAC B;  1XSN A;  1S0N A;  2G06 A;  3ISD A;  4KMO B;  2K4P A;  4IQW A;  5HNK A;  2H3F A;  2WAQ C;  5L1K A;  4Q44 A;  2F76 X;  2EAO A;  2K8B B;  4F5R A;  1ZQJ A;  5ALD A;  5KG6 A;  2XY7 A;  4J9S A;  5KFU A;  8ICE A;  4ED6 A;  2DBY A;  5CA7 A;  2HHS A;  2C2E A;  4F5N A;  1ZD5 A;  4DOB A;  5K4L A;  5IIM A;  9ICR A;  5L1J A;  4F5O A;  4JV1 A;  3EW9 A;  2OHF A;  4RT3 A;  3SR6 A;  1TAM A;  3NAS A;  3D6J A;  2UVV A;  4J9N A;  4USA A;  3HW8 A;  1LV5 A;  5CR0 A;  3OHB A;  2FI1 A;  4GIB A;  1L5U A;  2AQ4 A;  3WK8 A;  4TUQ A;  5J0S A;  2PI5 A;  4B9S A;  3TI0 A;  3IDW A;  4UQG A;  4QZF A;  5AM0 A;  3G6V A;  3LK9 A;  1U49 A;  1UPH A;  1L7O A;  5ALO A;  1YZ7 A;  4BX9 C;  5J2K A;  3H7I A;  2BR0 A;  4FFD A;  1ZQM A;  4XRH A;  4PGQ A;  3D2N A;  4FS1 A;  3EWA A;  2H3V A;  3QZ7 A;  5ALT A;  3PX4 A;  2YMM A;  4P0Q B;  3H8S A;  4DCC A;  1L6N A;  3KFU F;  1QTM A;  2FMQ A;  5KG2 A;  3LVV A;  5KFJ A;  1IG6 A;  1ZQG A;  2JEF A;  2KVS A;  5DG7 A;  2D6F C;  1EXN A;  4UW9 A;  1XS9 D;  2VKQ A;  4O3Q A;  4F93 B;  4UB4 A;  3M7D A;  3BQ7 A;  2WF8 A;  4IRD A;  9ICX A;  3S6J A;  2EAP A;  4GXK A;  3C5G A;  2A1J A;  2ZIU B;  2PFQ A;  1HJP A;  3PST A;  5KG5 A;  3N7P D;  2F1J A;  5KFW A;  4I2D A;  4DEZ A;  3WKC A;  4J9M A;  4LVS A;  2Y0S C;  4DSI A;  2O6K A;  2F1H A;  1UA0 A;  4DOA A;  1L7M A;  4PL1 A;  2QB1 A;  4KIT B;  2HHW A;  4O0I A;  5KFA A;  3M6K A;  1BPB A;  9ICM A;  4B6J A;  3QU5 A;  3PY8 A;  4RUA A;  5F3X B;  4Y2V A;  4IQT A;  4M9N A;  3H0M B;  4O3P A;  1WWV A;  4QIW F;  2MU2 A;  2HVH A;  1RQN A;  2DWQ A;  1RQL A;  5DLF A;  2YMP A;  5ALG A;  8ICU A;  2YX8 A;  2GH1 A;  3NVV A;  2NRV A;  4QZD A;  4NY8 A;  4NWI A;  3KHG A;  2EQY A;  1NKE A;  3C21 A;  3KKA C;  3GV8 B;  4Z6E A;  4F50 A;  3THV A;  4PZN A;  4PL2 A;  1UA1 A;  2RDJ A;  2BCR A;  3MR2 A;  5KT5 A;  2EH9 A;  4Y2S A;  3PW5 A;  4RUC A;  2ASD A;  1A77 A;  5JRT A;  1VLB A;  5KTQ A;  1SZH A;  3QEB Z;  5J2I A;  3Q8R B;  1S0O A;  4DQQ A;  1KFS A;  2VJ4 A;  2KEY A;  2XY6 A;  1KFD A;  4UBB A;  5ALW A;  2KZ3 A;  2ATL A;  2K4I A;  3GZF A;  7ICS A;  1BNO A;  2Y9U A;  3IG8 A;  1V85 A;  2NRX A;  5AK3 A;  1MA7 A;  2B21 A;  2ISO A;  2OXO A;  5J2J A;  1C20 A;  2RP5 A;  3FDS A;  3SYZ A;  4DL7 A;  1ZET A;  3RRG A;  7ICM A;  5DB9 A;  5FP0 A;  1UT5 A;  3HKZ C;  3PSP A;  5EOZ A;  2KJ8 A;  4PHA A;  4F3O A;  2ZTC A;  4KLG A;  2RDI A;  5J0O A;  4KLD A;  5ALE A;  4RQ8 A;  1SV0 A;  8ICS A;  2IMW P;  4TQS A;  5DBA A;  2AXT U;  3WK6 A;  4CCH A;  3TAP A;  1L7N A;  4RNO A;  4O9M A;  1ZRM A;  8ICF A;  5BOM A;  7ICP A;  5GTH U;  4IQV A;  5DDY A;  7ICO A;  5F9L A;  4PHE A;  2HHX A;  4ECW A;  4ED0 A;  2YQE A;  4Y2R A;  5AKL A;  4C7Y A;  2YB4 A;  1Q3U A;  1NJZ A;  5HR6 A;  4FE3 A;  1KL9 A;  1V38 A;  2HI0 A;  2FLP A;  4CF4 A;  2KV2 A;  2DPJ A;  5KFR A;  5J0R A;  4F5P A;  2A3V A;  4DL6 A;  1RYS A;  1L8L A;  2ZIX B;  3L4P A;  1QCK A;  4FBT A;  2A19 A;  8ICQ A;  5KT3 A;  4EZ6 A;  1Z1V A;  3KTQ A;  7ICT A;  2XCA A;  3G6Y A;  5AI6 A;  2E5S A;  2K4H A;  4O5C A;  3RB4 A;  5EWG A;  2VA3 A;  1NNL A;  4J9O A;  2WFA A;  4DS5 A;  5AI9 A;  4PGX A;  1PVQ A;  2VA8 A;  2ZJ5 A;  4CGZ A;  2ISP A;  3QU4 A;  3GIJ A;  1ZQW A;  4EEK A;  3BS5 B;  2BDP A;  3EYZ A;  3FM9 A;  3RJK A;  1BVS A;  1U47 A;  1QSL A;  4XA5 A;  7ICL A;  2QAR A;  4GXI A;  3MR6 A;  1V97 A;  4G9B A;  1JRO A;  5AK6 A;  4P4M A;  4XUS A;  1ZQP A;  5D49 A;  2WF9 A;  1OUQ A;  4ZOH C;  5CRX A;  2JHD A;  2ZUB A;  3EZ5 A;  2FLN A;  3QNM A;  4NM1 A;  4UAR A;  3GII A;  4FZN A;  1SWW A;  2DKX A;  2HSZ A;  4YR2 A;  1CI4 A;  4ED8 A;  3HPO A;  8ICI A;  4I29 A;  4J9R A;  4DL2 A;  1QQ7 A;  5KFF A;  3KD3 A;  4TUR A;  4YCX A;  1XO0 A;  4QJF B;  4RQ7 A;  5KAI U;  2IA6 A;  2XVT A;  1F5S A;  3D2Q A;  1F44 A;  2R8J A;  2ZG6 A;  2F8L A;  1N62 A;  2P6R A;  3K75 D;  4I2I A;  3PO4 A;  2JGA A;  3PX6 A;  4QWC A;  1URJ A;  1TVA A;  3E2E A;  3QU9 A;  2PI4 A;  4LJX A;  9ICA A;  2EZZ A;  4OJ6 A;  5IIN A;  2DGZ A;  2K8A A;  3D2S A;  3SEI A;  4RQ5 A;  4JWM A;  4QZB A;  2W43 A;  4EEN A;  2Q4T A;  4EEY A;  3K1Z A;  2XGP A;  3WKA A;  4QIW C;  9ICN A;  1TE2 A;  4R63 A;  1X9X A;  2MSN A;  1KDH A;  1WCL A;  4ECT A;  1T3Q A;  2E8O A;  1TK0 A;  1X66 A;  2HVI A;  4X5V A;  5J8Y C;  4Q8F A;  3F2B A;  5DGA A;  5KFD A;  2B0C A;  3CW2 C;  3SZ2 A;  1UQV A;  4IC9 A;  4BWJ A;  1ZQD A;  4BUG A;  1SZP A;  2W9A A;  2XGQ A;  1Y88 A;  3AMZ A;  4DFP A;  4JV2 A;  5CB1 A;  5J0X A;  1D8Y A;  5A0L A;  5D4B A;  4IS7 A;  4Y2Q A;  2F2A B;  2IOF K;  2K4E A;  2KVC A;  2E1E A;  3H40 A;  3OSN A;  4J03 A;  4ECR A;  4M6W B;  2DF4 B;  1T7P A;  1BPX A;  1U48 A;  4EBC A;  5HP4 A;  5DB8 A;  3NRW A;  4C8M A;  3OGU A;  4PHP A;  4WJ3 B;  9ICT A;  3TFS A;  4DSE A;  3BDP A;  5DGB A;  2LYH A;  5IIJ A;  5KNI A;  4R8U A;  5G5G A;  4RZR A;  1T4G A;  3PX0 A;  4F2R A;  2W8K A;  2HHT A;  3ZD9 A;  2R8I A;  2FPK A;  3SV4 A;  3ZDA A;  2Q0Z X;  2C28 A;  2BZF A;  7ICF A;  1NZP A;  1BGX T;  3WK4 A;  4KLF A;  3MR3 A;  4Y2X A;  9ICE A;  8ICT A;  5ALZ A;  4TQR A;  3QUB A;  3PZP A;  1XU4 A;  2OYY A;  3RAX A;  3GV7 B;  3FAH A;  1X42 A;  4M04 A;  5EWE A;  4RPY A;  3JPT A;  5J0P A;  2PXI A;  2MAX A;  1CEZ A;  3K4G A;  4YMN A;  4OD0 A;  3HP6 A;  3OJS A;  3PSI A;  2C2D A;  2F44 A;  5KFH A;  4C8K A;  3IP4 B;  4HAI A;  3EPI A;  2HHU A;  3WKE A;  4UB6 U;  2E8M A;  1H38 A;  4QZG A;  5GTI U;  3ISC A;  4I2G A;  3RF9 A;  4U7C A;  3KOO A;  4NLB A;  4RQ3 A;  4UB2 A;  5KFK A;  4YQW A;  3F53 A;  3AN1 A;  3QX7 A;  5ALP A;  4M9G A;  4PZO A;  2KD1 A;  2AGQ A;  2BPG A;  4J9L A;  1ZQL A;  2DPI A;  4OCZ A;  2WHE A;  1NZB A;  1PK1 A;  2ZJA A;  2NRZ A;  3PV8 A;  4ED2 A;  4I28 A;  3BQ2 A;  2PMZ C;  2K8C B;  4ECX A;  5J0Y A;  1QH9 A;  4DFK A;  4C8L A;  3Q8Q B;  4DO9 A;  2YMQ A;  1JMS A;  2FE9 A;  5KT2 A;  1SWV A;  8ICG A;  8ICA A;  4I2A A;  2W3S A;  2ZIU A;  7ICV A;  1BPD A;  4ED1 A;  4C8O A;  3BQ1 A;  2C22 A;  5ALI A;  1A6S A;  1JRP A;  1IM4 A;  4C4S A;  4YR0 A;  2AJQ A;  5AKI A;  1NK4 A;  4EBE A;  1RM6 C;  4GXJ A;  1OXJ A;  3K1R B;  2L5Y A;  4F5Q A;  4DF8 A;  2KKV A;  2LMR A;  1ECW A;  4O5K A;  3PW7 A;  5DDM A;  2W9M A;  2NO4 A;  1S0V A;  1BPY A;  3E0F A;  3NVY A;  9ICB A;  3PW0 A;  4I2E A;  2I9G A;  3N4M B;  1UCV A;  3ED5 A;  5IIL A;  3B0Y A;  4MFF A;  1HEK A;  4PJ0 U;  2R8K A;  3NRZ A;  2W3R A;  2AU0 A;  2HDO A;  1SV4 A;  5L1L A;  1UT8 A;  3SEN A;  3NUQ A;  4I2B A;  1ZQH A;  2KTQ A;  1SXD A;  2PMZ F;  5JU5 A;  3T5J A;  5KFB A;  1K1S A;  3RTV A;  4DL4 A;  1PZN A;  4B9U A;  2BPC A;  2BDU A;  3H4D A;  4R8U B;  5J2F A;  3BZC A;  1SL0 A;  4DWI A;  8ICV A;  1L7P A;  2QB0 A;  4DSJ A;  4DSF A;  4CDG A;  2HBM A;  5EWF A;  2W11 A;  4YR3 A;  1S5L U;  9ICK A;  1IV8 A;  2LBO A;  1XNS A;  1MSW D;  1ZQI A;  2EDU A;  1QSS A;  4FO6 A;  1WUD A;  2DUY A;  2ZIV A;  5HR7 A;  3SQI A;  4NM2 A;  4UB5 A;  3KZI U;  4XQ8 A;  2W7O A;  5KFO A;  3H8W A;  2R18 A;  2QAR B;  2KG5 A;  5CEH A;  3VCB A;  3QYP A;  2BQU A;  2OH2 A;  4P2H A;  1SKW A;  1RYR A;  2CPR A;  1ZQT A;  2F8K A;  1DK3 A;  2YTU A;  2RQ5 A;  4RQ6 A;  2ZXH A;  3O0F A;  4NL9 C;  5ALR A;  3RJH A;  2KMD A;  9ICO A;  8ICN A;  1NK9 A;  2BHN A;  5AM3 A;  9ICG A;  5ALY A;  4OJP A;  3C2K A;  4M6W A;  1ED1 A;  2DL0 A;  3I76 A;  5AI5 A;  5KFY A;  2WF7 A;  1ZQU A;  4O3M A;  3Q8S B;  1PK1 B;  3N7S C;  4UB3 A;  1S77 D;  4KLU A;  3N7R C;  2G5I B;  1N63 A;  1Q3V A;  1ZQC A;  2H5X A;  5HMM A;  5ALN A;  4EX7 A;  2LYB A;  5KFZ A;  2AH5 A;  3RFA A;  4QZI A;  4M2Y A;  4M9J A;  4EYH B;  1KSP A;  1NK5 A;  4MF8 A;  4GC7 A;  3OHA A;  2FPL A;  4P4P A;  4RPZ A;  1RXV A;  4B9T A;  1DXS A;  5AKJ A;  2OM6 A;  4ED3 A;  1NI3 A;  3T5K A;  1ZQF A;  1ZQY A;  5AIA A;  2F3N A;  5HHI A;  3ZD8 A;  1PUZ A;  4ELT A;  1D9D A;  3CRX A;  2E8P A;  3F2C A;  1BPE A;  4KX5 A;  5KAF U;  4NLZ A;  1TK8 A;  2RHF A;  4C80 A;  2Y0S F;  2ZJ8 A;  5J2A A;  3I28 A;  2WF6 A;  1X9W A;  1Z3E B;  1SB3 C;  4IQU A;  4KLQ A;  3FC4 A;  3QZ8 A;  3V6H A;  3PSF A;  2AHO B;  4OJ5 A;  1OW5 A;  3MGI A;  5KT4 A;  3BS5 A;  4AYB C;  3QXG A;  1B22 A;  3LDA A;  5KFX A;  2ZIW B;  5JTI A;  4KLJ A;  1NK8 A;  3BS7 A;  1N60 A;  2E3T A;  4EEL A;  3OSP A;  2F1I A;  4YXJ A;  2KN7 A;  4RQ0 A;  3Q8K A;  1MQ2 A;  3M9N B;  3MFI A;  5BPC A;  1SIJ A;  3ETL A;  4RT2 A;  8ICK A;  1T8E A;  2JZB B;  4U6P A;  4YMO A;  1XSP A;  5KFT A;  1ZQR A;  3ZDC A;  2HHV A;  4MEX A;  1ZQN A;  4ECV A;  4Q8E A;  4YN4 A;  1PVR A;  1VDV A;  3C1Y A;  3HJE A;  3GIM A;  7ICR A;  2Y1J A;  2W8L A;  3RBE A;  5ALX A;  2HCF A;  3L3F X;  2ODG A;  3TQ1 A;  4BDP A;  3OPX A;  4DSL A;  4P0P A;  5KFN A;  2MA1 A;  2LPE A;  1S97 A;  4FZL A;  2P6U A;  4P0Q A;  3G6X A;  3DDH A;  2WAQ F;  5J2D A;  4DSK A;  3RH4 A;  4Y2J A;  2GWS A;  1N61 A;  4DFM A;  4RNN A;  5AIC A;  4B9V A;  5B5E U;  4QNL A;  3BQT A;  8ICB A;  3MDC A;  4LZG A;  4Z6D A;  4NLG A;  1U45 A;  5KG4 A;  1HUZ A;  3T79 A;  2QLT A;  2W55 A;  1J2N A;  2CN1 A;  3CNH A;  2VA2 A;  1JXE A;  5CJ7 A;  1D8L A;  3I1Y A;  1X6I A;  2JMG A;  4F8R A;  5DBC A;  2W9C A;  5EE3 A;  1WWU A;  1Z4O A;  2EAN A;  3F5E A;  3NVZ A;  5KFQ A;  2BCQ A;  2UVW A;  4LZD A;  2CXY A;  2BKE A;  1KN5 A;  2E8N A;  2J6U A;  1XSL A;  1NKC A;  1WYG A;  2KNJ A;  5AI0 A;  4PH5 A;  4F92 B;  3KZX A;  1KLN A;  3C23 A;  2FMS A;  1S9F A;  2IHM A;  1DK2 A;  3BZK A;  1JI7 A;  4ECY A;  3GIK A;  1ZRN A;  2PFO A;  2BCS A;  4UAS A;  1SV0 C;  2VAN A;  5KFG A;  2GLE A;  8ICJ A;  1B4F A;  1XWL A;  4Q45 A;  2W7P A;  2IOH A;  2KIV A;  1RPL A;  1X6J A;  2R8H A;  4M9H A;  3UXN A;  2V4R A;  4Y2P A;  7ICN A;  3LWM A;  2XIC A;  3ZDD A;  2YML A;  4QW8 A;  4BXO A;  3KKA A;  4CE6 A;  2W9B A;  4ED7 A;  3KBB A;  2ASL A;  4IR9 A;  3SI8 A;  4Y2T A;  4M0A A;  1RDF A;  1A0P A;  4YP3 A;  3GDX A;  3NTU A;  3AU6 A;  5CP2 A;  2AGO A;  3JPN A;  7ICE A;  4IRK A;  5DLG A;  3MGV A;  4GLX A;  5ALS A;  2HHQ A;  3TFR A;  2XC9 A;  1Z1B A;  3QU7 A;  5DB6 A;  5AKZ A;  2ZIW A;  4C8N A;  3C28 A;  4US9 A;  3C2L A;  3KHR A;  3UQ0 A;  5T14 A;  4R66 A;  3DV9 A;  4F4K A;  5KFP A;  3UQ2 A;  5KFS A;  1S10 A;  3B0X A;  3RAQ A;  2BGW A;  4P0P B;  1VJ5 A;  5IIO A;  4R65 A;  1QSY A;  1Z19 A;  1P7D A;  1IXR A;  3CYM A;  3AQE A;  1XO1 A;  5J29 A;  5AI4 A;  5KG0 A;  3HT3 A;  4TUS A;  4DOC A;  4I27 A;  4PPX A;  7ICK A;  2LM1 A;  2G5H B;  1BNP A;  2ZUD A;  1SGG A;  3PML A;  4Z6C A;  1LVH A;  4CF5 A;  2A1J B;  3AQF A;  5AM1 A;  1B0X A;  4QW9 A;  4C0Z A;  1LKY B;  4F91 B;  2KIW A;  3JPS A;  4BWM A;  2E1F A;  3RJI A;  4UAY A;  5KG7 A;  3SAH A;  2PFP A;  5KG1 A;  1U4B A;  5J2C A;  2F77 X;  2OCE A;  3V7L A;  3PW4 A;  1WG8 A;  5DQG A;  5C0Y A;  1ZQZ A;  1JN3 A;  2G0A A;  3BJY A;  1GO3 F;  3E58 A;  2I5H A;  5BOL A;  9ICV A;  3SAF A;  1ZYQ A;  5AK4 A;  4GC6 A;  1TKD A;  4F71 A;  2XI9 A;  4IRC A;  4B9M A;  1ZD2 P;  1A76 A;  4ZH4 A;  1TAU A;  2ZXI A;  8ICL A;  3UXP A;  4F72 A;  4ECZ A;  3SAG A;  1V9P A;  4DF4 A;  1PVP A;  9ICH A;  2LI6 A;  4KN4 A;  5L1I A;  4FZM A;  3M8S A;  1KQQ A;  3LVW A;  5AM2 A;  4RQ2 A;  3T5H A;  4C4T A;  4MEY A;  4NJ8 A;  2RLT A;  5ALM A;  3KHL A;  1QQ5 A;  2OEH A;  1ZQO A;  1C7Y A;  4RQN A;  1B43 A;  2HBK A;  2YN4 A;  3WKB A;  4B9L A;  3ISB A;  2KHQ A;  2ZUC A;  3H8J A;  3QUC A;  2H3Q A;  3UMC A;  5ALH A;  2XCP A;  3QEA Z;  8ICX A;  4NLC A;  1SL2 A;  3RH6 A;  9ICQ A;  2IBK A;  4KLE A;  3RR8 A;  5KFC A;  2FJ6 A;  4JWN A;  1S8O A;  2G08 A;  1KFT A;  8ICP A;  3PR4 A;  3QUT A;  1LB2 B;  5ALF A;  2M0N A;  2UVU A;  3ZDB A;  2I6X A;  1ZQB A;  2JEJ A;  4NV0 A;  3PVX A;  1QQ6 A;  4KX3 A;  1T3N A;  4BGD A;  5J2G A;  2AQ0 A;  1TAQ A;  5AKE A;  4HYK A;  1NJY A;  4O3R A;  2HOI A;  1FEZ A;  1ZD3 A;  1ARO P;  9ICS A;  5KG3 A;  3KHH A;  4KLT A;  1MC8 A;  1SXE A;  4DLG A;  2G07 A;  2EZX A;  3JPP A;  1L3S A;  4OJO A;  4YFK A;  2BCU A;  3V6J A;  3AUO A;  1COK A;  2JRZ A;  2D3D A;  3A0B U;  1JXL A;  5E79 U;  3RH5 A;  4PGY A;  1CRX A;  4US8 A;  2WTF A;  2H3Z A;  2MRL A;  3AM9 A;  2JEI A;  2W9C B;  1NK6 A;  2A1A A;  3IRU A;  5KFE A;  4ECS A;  1FFU A;  4NL9 A;  1DGS A;  3H0R B;  2PKE A;  2NRT A;  1L3U A;  3ZDE A;  3V72 A;  5AI8 A;  3ALR A;  4FBU A;  1K5O A;  4M47 A;  5AKK A;  1J2M A;  3L5K A;  5H2F U;  1N5X A;  5F9N A;  3LYS A;  5HML A;  4O3N A;  3F5A A;  4Z6F A;  4UAW A;  1TFR A;  2YY6 A;  1TK5 A;  2NO5 A;  5ALU A;  5EE1 A;  3RB6 A;  4YMM A;  2Y9T A;  4UAZ A;  2GOL A;  3UXO A;  4YG2 A;  3N28 A;  3GV5 B;  4DQP A;  7ICI A;  2ZTD A;  3UM9 A;  2KSO B;  5TIS U;  1XC9 A;  5ALJ A;  4KLH A;  1PK3 A;  1NKB A;  2HW3 A;  3M9O B;  3ETR A;  2B6G A;  1ZOL A;  2HOQ A;  9ICP A;  4QZH A;  4JV0 A;  3ORY A;  1U9L A;  3V7J A;  1X9M A;  4UAU A;  2IHN A;  3IHQ B;  5J0U A;  2LYA A;  3B9J A;  5AKX A;  2AGP A;  2W54 A;  4KTQ A;  4NLK A;  2K89 A;  4UBC A;  8ICZ A;  4KLO A;  4F4Z A;  1S0M A;  3TKA A;  5ALV A;  1O08 A;  2Z7J A;  2KIC A;  4BJQ A;  1KBU A;  2KK0 A;  4QZE A;  3C2M A;  3RB3 A;  4UB8 U;  4YD1 A;  4IL6 U;  5CWR A;  5DG8 A;  4ECU A;  5TZV A;  1COO A;  4J9P A;  2GO7 A;  2DFL A;  2EZY A;  2W04 A;  2N1R A;  2NRW A;  1NJW A;  1NJX A;  4RQM A;  4C7Z A;  1L3V A;  3V7K A;  9ICU A;  4DL5 A;  8ICM A;  1YT3 A;  5AIB A;  4J9K A;  4B9N A;  8ICW A;  2WF5 A;  4KLI A;  2H3I A;  3DEE A;  4YD2 A;  2JH1 A;  4KLL A;  4FS2 A;  3CP8 A;  4QWA A;  5AKY A;  4O5E A;  4UB1 A;  4ELU A;  1CUK A;  4OO1 J;  2KJ9 A;  5J0W A;  4RU9 A;  4KLS A;  3JPQ A;  5ALK A;  2I1Q A;  4MFC A;  5DQI A;  5ALQ A;  3TAD A;  2R8G A;  3PR5 B;  3QU2 A;  2XY5 A;  4BXO B;  2G09 A;  3Q8M A;  1X9S A;  7ICJ A;  5AM5 A;  4YXM A;  9ICI A;  4ELV A;  3OTQ A;  4ACO A;  3MGH A;  1KW4 A;  3AEV A;  2JH7 A;  2LM4 A;  5KFV A;  2P66 A;  1D9F A;  1ZQQ A;  1X2I A;  3UMG A;  4EYI B;  2XID A;  1RXW A;  1Z00 A;  2FLL A;  2PFN A;  3PO5 A;  5EE9 A;  9ICL A;  1Z4N A;  9ICF A;  4DQI A;  2KP7 A;  4DFD A;  4Q43 A;  3MDA A;  4EX6 A;  3FYH A;  3RRH A;  2HOF A;  5IIK A;  4QZ9 A;  4YVZ A;  3IN5 A;  3H8M A;  1K1Q A;  3TAR A;  4QZA A;  2DQN B;  2VJ5 A;  1ZJM A;  4AP9 A;  1O03 A;  5III A;  4DL3 A;  1ZXI A;  4NXZ A;  3JPR A;  4I2J A;  1NK0 A;  5B66 U;  1JIH A;  3UPQ A;  4KLM A;  5KFL A;  3M9M B;  2QKQ A;  4QWE A;  3MBY A;  3SV3 A;  2IOF A;  2FMP A;  4C4R A;  1N56 A;  3V6K A;  2QB0 B;  1N48 A;  4NLN A;  1HIW A;  2ALZ A;  5J0Q A;  1LKY A;  3TAQ A;  2V9W A;  3PMN A;  2KHV A;  3MC1 A;  5J8Y A;  3WK7 A;  4O3O A;  7ICQ A;  5JUM A;  3RB0 A;  1MN8 A;  1N5W A;  5AM4 A;  4K4H A;  2W9B B;  2CRX A;  2ESE A;  4P4O A;  2RRD A;  4JUZ A;  2MUT B;  2ZIV B;  1WCN A;  1ZD4 A;  5DQH A;  3GFK B;  1IIP A;  3TAD C;  2EAM A;  7ICH A;  2KFN A;  1Q8K A;  4AYB F;  2KE7 A;  3NGD A;  3T3F A;  5KT7 A;  3C1Z A;  3RBD A;  4Y2U A;  2ZTE A;  4RQ1 A;  4K4G A;  2KZZ A;  2KKP A;  2D8C A;  1SL1 A;  1RG6 A;  4A8E A;  1JUD A;  1YZ6 A;  3RJG A;  1Z00 B;  1SKR A;  1JAL A;  4RQ4 A;  1NOM A;  3EPG A;  4DQS A;  4M9L A;  5KFM A;  5G5H A;  3EUB 2;  2KSO A;  3MAB A;  1J97 A;  4UAT A;  2KFZ A;  2FPM A;  1Q46 A;  5DB7 A;  4GFJ A;  2HBJ A;  5D46 A;  5L1M A;  3M6Z A;  2ZIX A;  3N97 B;  3R9K A;  1DRG A;  5KFI A;  4RPX A;  2M9N A;  9ICC A;  3H0L B;  4EZ9 A;  3IM1 A;  2C2R A;  2NYV A;  1ZQE A;  8ICR A;  2BQ3 A;  3UMB A;  2P35 A;  5AK5 A;  4QWB A;  2JXJ A;  3AU2 A;  4E0D A;  3AL0 B;  3J81 j;  4F4X A;  1SKS A;  2XO7 A;  4TUP A;  1FFV A;  1L8O A;  1ZQV A;  2J6T A;  1ZQK A;  3WKD A;  2W03 A;  4ICA A;  5J0T A;  1TV9 A;  4JK1 A;  3HIL A;  3MR5 A;  1KKX A;  1FIQ A;  4DS4 A;  1T94 A;  5L9X A;  5DBB A;  2Y1I A;  3GU3 A;  3C29 A;  2KZM A;  3RJJ A;  2J6S A;  4I2H A;  3Q8P B;  4KMU A;  2ASJ A;  8ICY A;  4JB3 A;  1N2X A;  5J2H A;  3ZI4 A;  3RR7 A;  1D8B A;  4DFJ A;  1F0M A;  3HX0 A;  1UHU A;  3VC8 A;  3WK5 A;  3M1Y A;  1KEJ A;  1ZQ1 C;  4J9Q A;  4CNQ A;  3QE9 Y;  3LWL A;  4EBD A;  2YB1 A;  3ONN A;  2JR5 A;  4I2F A;  4F2S A;  2VIX A;  5C5J A;  3WU2 U;  3HRD D;  1DOQ A;  2LHT A;  1ZQS A;  2FDR A;  4QWD A;  5AKH A;  3NS1 A;  2OWO A;  3MFH A;  4R64 A;  5AKG A;  4Y2Y A;  3JPO A;  5ALL A;  5HHH A;  8ICO A;  3ICX A;  4DLE A;  5KL1 B;  5CHG A;  4O3S A;  2BPF A;  1BPZ A;  3GQC A;  2LKY A;  3PNC A;  5DKW A;  3U26 A;  3OJU A;  4QZ8 A;  4MF2 A;  8ICC A;  9ICJ A;  3T5L A;  1NK7 A;  7ICG A;  3C5F A;  3RJE A;  1ZQA A;  1M6Y A;  3A0H U;  1RZT A;  5KT6 A;  1KTQ A;  3RJF A;  4G3I A;  4ECQ A;  3PW2 A;  4CF3 A;  1MQ3 A;  3TAN A;  2K60 A;  1AQ6 A;  2NV3 A;  4K4I A;  1DGJ A;  4PHD A;  8ICH A;  5AHX A;  4IR1 A;  4F4Y A;  5KL8 B;  1FO4 A;  3H4B A;  2BQR A;  1JX4 A;  2HBL A;  1HUO A;  1ZQX A;  4OJL A;  4F4W A;  4MFA A;  3GIL A;  1RYU A;  3HKZ F;  3SD7 A;  4RNM A;  5EE0 A;  2HMX A;  2KJ5 A;  2KOB A;  4JMU A;  2BCV A;  2JV3 A;  5DG9 A;  3SMV A;  2DKZ A;  3NVW A;  2WB1 F;  3IG5 A;  1QLN A;  3BQ0 A;  1L3T A;  1ZJN A;  3Q8L A;  2JEG A;  1KRP A;  4CRX A;  1S76 D;  4QZC A;  3IV6 A;  2WB1 C;  1X40 A;  4KN7 A;  4UAV A;  3F2D A;  2MUT A;  2V4Q A;  3WK9 A;  3HWT A;  3QUQ A;  5J2E A;  2JZB A;  2UVR A;  2ES6 A;  4I2C A;  9ICW A;  4MHV A; 
#chains in the Genus database with same CATH homology
 9ICA A;  3M8R A;  1XC9 A;  7ICU A;  5J2B A;  5IIN A;  4KLH A;  3OSP A;  1NKB A;  2F1I A;  4DQR A;  2HW3 A;  4YXJ A;  4RQ5 A;  4RQ0 A;  2KN7 A;  3Q8K A;  4QZB A;  1MQ2 A;  3M9N B;  4JWM A;  3M9O B;  3MFI A;  5BPC A;  4EEY A;  9ICP A;  4QZH A;  1XSN A;  1S0N A;  4JV0 A;  3ETL A;  3ORY A;  2XGP A;  4RT2 A;  8ICK A;  1T8E A;  3ISD A;  1U9L A;  3V7J A;  4IQW A;  5HNK A;  2JZB B;  4YMO A;  1X9M A;  1XSP A;  9ICN A;  2IHN A;  3IHQ B;  5J0U A;  5L1K A;  4Q44 A;  5KFT A;  1ZQR A;  4R63 A;  3ZDC A;  2AGP A;  1KDH A;  4KTQ A;  2HHV A;  1WCL A;  4F5R A;  4ECT A;  1ZQJ A;  4NLK A;  4MEX A;  4UBC A;  5KG6 A;  2XY7 A;  1TK0 A;  4ECV A;  4J9S A;  4X5V A;  5KFU A;  4YN4 A;  1ZQN A;  4KLO A;  4Q8E A;  4F4Z A;  5DGA A;  1S0M A;  4Q8F A;  4ED6 A;  8ICE A;  5CA7 A;  3C1Y A;  5KFD A;  2HHS A;  3GIM A;  2C2E A;  3SZ2 A;  7ICR A;  4BWJ A;  4F5N A;  1ZQD A;  2Y1J A;  1SZP A;  2W9A A;  2W8L A;  3RBE A;  2XGQ A;  1Y88 A;  4DOB A;  4QZE A;  3C2M A;  3RB3 A;  5IIM A;  9ICR A;  4DFP A;  5L1J A;  4YD1 A;  5CWR A;  4F5O A;  5DG8 A;  4ECU A;  3TQ1 A;  3EW9 A;  5TZV A;  4BDP A;  4JV1 A;  4JV2 A;  5CB1 A;  5J0X A;  1COO A;  4RT3 A;  4DSL A;  4J9P A;  1D8Y A;  5D4B A;  5KFN A;  2DFL A;  2UVV A;  4J9N A;  2NRW A;  1NJW A;  1NJX A;  3H40 A;  3HW8 A;  3OSN A;  1S97 A;  1LV5 A;  1L3V A;  3V7K A;  9ICU A;  4DL5 A;  2P6U A;  5CR0 A;  8ICM A;  3OHB A;  4ECR A;  4M6W B;  4J9K A;  1T7P A;  1L5U A;  3G6X A;  1BPX A;  4B9N A;  1U48 A;  4EBC A;  5HP4 A;  5DB8 A;  4C8M A;  5J2D A;  2AQ4 A;  4KLI A;  4TUQ A;  3RH4 A;  3OGU A;  4YD2 A;  4DSK A;  4PHP A;  5J0S A;  2PI5 A;  4B9S A;  3TI0 A;  4KLL A;  2GWS A;  9ICT A;  4FS2 A;  3TFS A;  4DSE A;  4UQG A;  4QZF A;  4QWA A;  4DFM A;  3BDP A;  5DGB A;  2LYH A;  4RNN A;  4O5E A;  5IIJ A;  4UB1 A;  4B9V A;  3G6V A;  3BQT A;  8ICB A;  4ELU A;  3LK9 A;  1CUK A;  1U49 A;  5J2K A;  4R8U A;  3MDC A;  5J0W A;  4LZG A;  4RZR A;  1T4G A;  3H7I A;  4Z6D A;  4RU9 A;  3JPQ A;  3PX0 A;  2BR0 A;  2W8K A;  4F2R A;  4NLG A;  1ZQM A;  4XRH A;  4PGQ A;  2HHT A;  2I1Q A;  4MFC A;  4FS1 A;  3EWA A;  5KG4 A;  1U45 A;  1HUZ A;  3ZD9 A;  5DQI A;  3QZ7 A;  2R8I A;  2R8G A;  3PR5 B;  3PX4 A;  2FPK A;  3SV4 A;  3H8S A;  2XY5 A;  1JXE A;  2VA2 A;  5CJ7 A;  3Q8M A;  1X9S A;  3ZDA A;  4BXO B;  2Q0Z X;  7ICJ A;  1D8L A;  2C28 A;  4YXM A;  1QTM A;  2FMQ A;  4ELV A;  5DBC A;  5KG2 A;  4F8R A;  7ICF A;  9ICI A;  2W9C A;  5KFJ A;  3MGH A;  1BGX T;  4KLF A;  3MR3 A;  1ZQG A;  5KFV A;  2JEF A;  5DG7 A;  2P66 A;  9ICE A;  8ICT A;  4TQR A;  5KFQ A;  1EXN A;  1D9F A;  1ZQQ A;  2BCQ A;  1X2I A;  2UVW A;  4LZD A;  1XU4 A;  1XS9 D;  4EYI B;  3RAX A;  4O3Q A;  3GV7 B;  4F93 B;  1RXW A;  4M04 A;  1Z00 A;  4UB4 A;  2FLL A;  2PFN A;  2BKE A;  3PO5 A;  2J6U A;  5EWE A;  1XSL A;  4RPY A;  1NKC A;  9ICL A;  4IRD A;  4PH5 A;  9ICX A;  3JPT A;  4F92 B;  5J0P A;  4GXK A;  4DQI A;  9ICF A;  3C5G A;  2PXI A;  1KLN A;  4Q43 A;  2A1J A;  3C23 A;  2FMS A;  1S9F A;  3MDA A;  2MAX A;  2IHM A;  1CEZ A;  3K4G A;  2PFQ A;  4YMN A;  1HJP A;  4ECY A;  3HP6 A;  3OJS A;  3FYH A;  3RRH A;  5KG5 A;  3GIK A;  8ICZ A;  2PFO A;  5IIK A;  2BCS A;  4QZ9 A;  5KFH A;  2C2D A;  2F1J A;  5KFW A;  4C8K A;  4I2D A;  4YVZ A;  2VAN A;  4DEZ A;  5KFG A;  4J9M A;  4LVS A;  3EPI A;  8ICJ A;  1K1Q A;  2HHU A;  3TAR A;  4QZA A;  1XWL A;  1H38 A;  4Q45 A;  4DSI A;  1ZJM A;  2F1H A;  5III A;  4QZG A;  1UA0 A;  4DL3 A;  4DOA A;  1RPL A;  3ISC A;  4I2G A;  4KIT B;  2HHW A;  4NXZ A;  4O0I A;  3JPR A;  4I2J A;  1NK0 A;  5KFA A;  1JIH A;  2R8H A;  3UPQ A;  4M9H A;  1BPB A;  3UXN A;  2V4R A;  4RQ3 A;  9ICM A;  3PY8 A;  4UB2 A;  7ICN A;  3LWM A;  4KLM A;  5KFK A;  3ZDD A;  4YQW A;  5KFL A;  4RUA A;  3M9M B;  4QW8 A;  4M9G A;  4BXO A;  4IQT A;  4M9N A;  4O3P A;  4QWE A;  3MBY A;  2W9B A;  3SV3 A;  4ED7 A;  2AGQ A;  2FMP A;  2ASL A;  4IR9 A;  3SI8 A;  2HVH A;  2BPG A;  1N56 A;  4M0A A;  3V6K A;  4J9L A;  1N48 A;  1ZQL A;  2DPI A;  4NLN A;  4YP3 A;  2ZJA A;  5DLF A;  8ICU A;  2ALZ A;  2NRZ A;  3NTU A;  5J0Q A;  3GDX A;  3AU6 A;  3TAQ A;  2V9W A;  5CP2 A;  3PV8 A;  2AGO A;  3PMN A;  3JPN A;  7ICE A;  2NRV A;  4QZD A;  4IRK A;  4O3O A;  4NY8 A;  5DLG A;  4GLX A;  7ICQ A;  5JUM A;  3RB0 A;  4ED2 A;  4K4H A;  2HHQ A;  3KHG A;  2XC9 A;  3TFR A;  2W9B B;  1NKE A;  4I28 A;  5DB6 A;  3BQ2 A;  4C8N A;  4P4O A;  4ECX A;  3C2L A;  5J0Y A;  3C21 A;  4JUZ A;  2MUT B;  4DFK A;  3KHR A;  4C8L A;  3GV8 B;  3UQ0 A;  1WCN A;  3Q8Q B;  4DO9 A;  4Z6E A;  4F50 A;  3THV A;  1JMS A;  5KT2 A;  8ICG A;  8ICA A;  1UA1 A;  2RDJ A;  4I2A A;  2BCR A;  4R66 A;  4F4K A;  5KFP A;  5DQH A;  3UQ2 A;  3GFK B;  5KFS A;  3MR2 A;  1S10 A;  7ICV A;  1BPD A;  5KT5 A;  4ED1 A;  3PW5 A;  4C8O A;  3BQ1 A;  3B0X A;  7ICH A;  2C22 A;  2KFN A;  4RUC A;  2ASD A;  3RAQ A;  1A77 A;  2BGW A;  5IIO A;  5KTQ A;  4R65 A;  1QSY A;  3NGD A;  3T3F A;  5KT7 A;  1IM4 A;  4YR0 A;  3C1Z A;  5J2I A;  3Q8R B;  3QEB Z;  1IXR A;  2AJQ A;  1S0O A;  1NK4 A;  3RBD A;  1XO1 A;  5J29 A;  4EBE A;  4GXJ A;  4DQQ A;  5KG0 A;  3HT3 A;  4TUS A;  2ZTE A;  4RQ1 A;  4F5Q A;  4K4G A;  4DOC A;  4DF8 A;  4I27 A;  1KFS A;  4PPX A;  2KZZ A;  7ICK A;  1SL1 A;  2ZUD A;  3PML A;  4O5K A;  4Z6C A;  3PW7 A;  5DDM A;  2W9M A;  3RJG A;  2XY6 A;  1KFD A;  1Z00 B;  4UBB A;  1S0V A;  1BPY A;  2A1J B;  2KZ3 A;  2ATL A;  1SKR A;  9ICB A;  3PW0 A;  4QW9 A;  4I2E A;  4RQ4 A;  1NOM A;  2I9G A;  3EPG A;  3N4M B;  7ICS A;  4DQS A;  4M9L A;  5KFM A;  4F91 B;  2NRX A;  3JPS A;  4BWM A;  5IIL A;  3B0Y A;  4MFF A;  2B21 A;  3RJI A;  2ISO A;  4UAY A;  5KG7 A;  5J2J A;  3MAB A;  2R8K A;  2PFP A;  5KG1 A;  1U4B A;  5J2C A;  2KFZ A;  2AU0 A;  3FDS A;  5L1L A;  2FPM A;  3SYZ A;  3V7L A;  1UT8 A;  4DL7 A;  1ZET A;  5DB7 A;  3PW4 A;  3RRG A;  4I2B A;  5DQG A;  5D46 A;  1ZQZ A;  3N97 B;  1ZQH A;  7ICM A;  5DB9 A;  2KTQ A;  5KFI A;  1JN3 A;  3T5J A;  5KFB A;  4RPX A;  1UT5 A;  3BJY A;  2M9N A;  9ICC A;  5EOZ A;  1K1S A;  5BOL A;  3RTV A;  9ICV A;  4PHA A;  4F3O A;  1ZYQ A;  2ZTC A;  4EZ9 A;  4KLG A;  3IM1 A;  2C2R A;  1ZQE A;  4DL4 A;  4GC6 A;  1PZN A;  2RDI A;  5J0O A;  2BQ3 A;  1TKD A;  4B9U A;  2BPC A;  4KLD A;  2HVI A;  8ICR A;  4RQ8 A;  3H4D A;  4QWB A;  4IRC A;  4R8U B;  5J2F A;  8ICS A;  2IMW P;  4B9M A;  1SL0 A;  4DWI A;  8ICV A;  4TQS A;  5DBA A;  3AU2 A;  4CCH A;  1A76 A;  3TAP A;  4RNO A;  4E0D A;  4DSJ A;  4O9M A;  4DSF A;  4ZH4 A;  4F4X A;  1TAU A;  5EWF A;  1SKS A;  2XO7 A;  4TUP A;  4YR3 A;  8ICL A;  9ICK A;  3UXP A;  4ECZ A;  1ZQV A;  8ICF A;  2J6T A;  5BOM A;  1V9P A;  4DF4 A;  1ZQK A;  7ICP A;  9ICH A;  4KN4 A;  5L1I A;  4IQV A;  1MSW D;  3M8S A;  5DDY A;  1ZQI A;  7ICO A;  5J0T A;  1QSS A;  4FO6 A;  4RQ2 A;  5F9L A;  3T5H A;  1TV9 A;  4JK1 A;  4MEY A;  4PHE A;  3MR5 A;  2HHX A;  4ECW A;  4ED0 A;  4NM2 A;  4DS4 A;  4UB5 A;  3KHL A;  5L9X A;  5DBB A;  2Y1I A;  8ICW A;  4XQ8 A;  1ZQO A;  2KZM A;  3RJJ A;  5KFO A;  1C7Y A;  3H8W A;  2J6S A;  4I2H A;  3Q8P B;  1NJZ A;  1B43 A;  4KMU A;  2ASJ A;  8ICY A;  2FLP A;  2BQU A;  4B9L A;  3ISB A;  2ZUC A;  3H8J A;  2XCP A;  5J2H A;  3QEA Z;  3RR7 A;  4P2H A;  8ICX A;  1SL2 A;  1SKW A;  4DFJ A;  3RH6 A;  5KFR A;  2DPJ A;  1RYR A;  9ICQ A;  2IBK A;  3HX0 A;  4KLE A;  3RR8 A;  5J0R A;  1ZQT A;  4F5P A;  5KFC A;  4DL6 A;  1RYS A;  1KEJ A;  4JWN A;  4RQ6 A;  1KFT A;  4J9Q A;  8ICP A;  3PR4 A;  1LB2 B;  4FBT A;  8ICQ A;  2UVU A;  3RJH A;  3ZDB A;  3QE9 Y;  3LWL A;  1ZQB A;  4EBD A;  9ICO A;  4I2F A;  2JEJ A;  5KT3 A;  4F2S A;  5C5J A;  3PVX A;  4EZ6 A;  7ICT A;  3KTQ A;  1DOQ A;  2XCA A;  3G6Y A;  8ICN A;  1NK9 A;  2BHN A;  1ZQS A;  4QWD A;  9ICG A;  1T3N A;  4O5C A;  3RB4 A;  5EWG A;  2VA3 A;  2OWO A;  3MFH A;  4R64 A;  4BGD A;  3C2K A;  4M6W A;  5J2G A;  2AQ0 A;  1TAQ A;  3JPO A;  5KFY A;  4HYK A;  4J9O A;  1NJY A;  4O3R A;  5HHH A;  8ICO A;  1ZQU A;  4DS5 A;  4PGX A;  1ARO P;  4DLE A;  9ICS A;  3Q8S B;  5CHG A;  4O3S A;  2VA8 A;  2ZJ5 A;  5KG3 A;  4UB3 A;  1S77 D;  4KLU A;  3KHH A;  4KLT A;  1MC8 A;  1BPZ A;  2BPF A;  2ISP A;  3GQC A;  4DLG A;  3PNC A;  5DKW A;  3GIJ A;  1ZQC A;  1ZQW A;  2H5X A;  5HMM A;  3OJU A;  4QZ8 A;  4MF2 A;  8ICC A;  3JPP A;  2BDP A;  3T5L A;  3EYZ A;  1NK7 A;  4QZI A;  9ICJ A;  5KFZ A;  1L3S A;  4YFK A;  2BCU A;  4M2Y A;  7ICG A;  3C5F A;  3V6J A;  3RJK A;  3AUO A;  3RJE A;  1BVS A;  1U47 A;  1ZQA A;  1QSL A;  4M9J A;  1JXL A;  4XA5 A;  4EYH B;  1RZT A;  1KSP A;  5KT6 A;  1KTQ A;  7ICL A;  4GXI A;  3MR6 A;  1NK5 A;  3RJF A;  4MF8 A;  4G3I A;  3RH5 A;  4ECQ A;  4GC7 A;  3PW2 A;  4PGY A;  2WTF A;  1MQ3 A;  3TAN A;  3OHA A;  2FPL A;  4P4M A;  4XUS A;  4P4P A;  4RPZ A;  1ZQP A;  2W9C B;  4K4I A;  1NK6 A;  2JEI A;  1RXV A;  5KFE A;  4PHD A;  4ECS A;  4B9T A;  5D49 A;  1DGS A;  4IR1 A;  8ICH A;  2NRT A;  1L3U A;  4F4Y A;  2ZUB A;  3EZ5 A;  3ZDE A;  3V72 A;  4ED3 A;  2FLN A;  4NM1 A;  3GII A;  3T5K A;  1ZQF A;  4FBU A;  1ZQY A;  3H4B A;  2BQR A;  1JX4 A;  1HUO A;  4YR2 A;  4ED8 A;  5HHI A;  4KLS A;  1ZQX A;  3ZD8 A;  3HPO A;  4ELT A;  8ICI A;  4F4W A;  4J9R A;  4MFA A;  4I29 A;  3GIL A;  4DL2 A;  1D9D A;  4M47 A;  4RNM A;  5KFF A;  1BPE A;  2BCV A;  5F9N A;  4NLZ A;  4TUR A;  1TK8 A;  5HML A;  4O3N A;  5DG9 A;  4YCX A;  4Z6F A;  2ZJ8 A;  4UAW A;  1QLN A;  5J2A A;  1TFR A;  4RQ7 A;  1Z3E B;  1X9W A;  1TK5 A;  3BQ0 A;  4IQU A;  4KLQ A;  2IA6 A;  1L3T A;  1ZJN A;  3Q8L A;  2R8J A;  2JEG A;  1KRP A;  1S76 D;  4QZC A;  3QZ8 A;  3V6H A;  3RB6 A;  4YMM A;  4KN7 A;  2P6R A;  3MGI A;  5KT4 A;  4UAZ A;  2MUT A;  3K75 D;  4I2I A;  3UXO A;  3PO4 A;  4YG2 A;  2V4Q A;  3PX6 A;  1B22 A;  3LDA A;  5KFX A;  3HWT A;  4QWC A;  5J2E A;  2JZB A;  3GV5 B;  1TVA A;  2UVR A;  4DQP A;  7ICI A;  3E2E A;  4I2C A;  4KLJ A;  1NK8 A;  2ZTD A;  9ICW A;  2PI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...