1X2IA

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, helix-hairpin-helix domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'ALTLAERQRLIVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEIRRVITAPYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hef helicase/nuclease
publication title Structural and Functional Analyses of an Archaeal XPF/Rad1/Mus81 Nuclease: Asymmetric DNA Binding and Cleavage Mechanisms
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 19
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1x2iA00
2R8HA 1ZQWA 9ICAA 3RJJA 4JK1A 4XRHA 4JV2A 4UB5A 2V4RA 1S0VA 1LB2B 4UB4A 3C2MA 5J2IA 2FPMA 3MR5A 2RDIA 3KHLA 1U9LA 4J9MA 2XC9A 2W9BA 8ICVA 2C2DA 4DLGA 3NTUA 3BQ0A 1SZPA 4RZRA 4YMNA 4DL5A 3ZDCA 1T3NA 1NK7A 4UBCA 2J6TA 4RNOA 1TK8A 9ICNA 9ICIA 4R63A 5HHIA 5J0QA 4K4HA 4RQ1A 1ZQQA 8ICJA 5KFXA 4O5EA 7ICFA 4B9NA 2BQ3A 7ICEA 3MR2A 1BVSA 4DFJA 1HUZA 2HHVA 5KFJA 3PW4A 2ZUBA 4NLKA 4M9HA 5KT7A 8ICHA 2ZJAA 1ZQSA 5J0PA 2JZBB 3RH5A 1S10A 4I2BA 2BQRA 3PO5A 1WCLA 1NOMA 4FBUA 3PW0A 1KLNA 5DDMA 1CEZA 2FLPA 2A1JB 3GILA 1COOA 4M9NA 4NM1A 9ICCA 5KTQA 3Q8PB 4ED3A 4LVSA 2A1JA 5J2BA 7ICSA 3PO4A 1L3SA 9ICKA 4YCXA 2AU0A 4QZDA 4YXJA 5KG4A 4LZDA 1JXEA 1U45A 2XY5A 3RH4A 4F4WA 5CP2A 2BGWA 2I9GA 3H8WA 1S0MA 4I2FA 5HMMA 4RQ0A 9ICPA 2BHNA 5J0YA 1NKEA 3Q8RB 1JMSA 4DL3A 1LV5A 5J2EA 3V7LA 4YVZA 4ECVA 3C2KA 4IR1A 1AROP 4J9SA 2HVIA 5IILA 3RH6A 4NLZA 2NRVA 3GQCA 1XU4A 3ZD9A 5KFHA 4IQUA 3N97B 3GIIA 1BPDA 2PFQA 9ICSA 3PX4A 4R8UA 4M2YA 3UXPA 2KZ3A 1DOQA 5J0OA 3GV7B 5C5JA 3V6JA 3QEAZ 2HHXA 5HMLA 2AQ4A 1X9WA 1NJZA 5DLFA 4ECXA 2UVUA 3GV8B 4PGYA 3C23A 3M9NB 2R8GA 2H5XA 4ED0A 8ICZA 4YN4A 4IRDA 5DLGA 5KFEA 2LYHA 1XSNA 1XWLA 2Q0ZX 1RXWA 4O9MA 7ICNA 3BQTA 4EZ9A 3V7JA 5KFCA 4MF2A 5CA7A 5J2AA 1D9DA 3BJYA 4F5OA 3ETLA 1QSSA 8ICFA 4DOBA 1DGSA 4ED6A 4QZFA 4QZ9A 2F1IA 4DEZA 2UVVA 4B9UA 1ZQBA 1NK0A 1XC9A 4ED1A 1K1QA 3V7KA 3IHQB 2HHTA 3RJKA 4KLLA 3PMLA 4J9PA 8ICCA 5DBCA 2XO7A 3RB0A 4ED8A 1RYSA 3ZDAA 1ZQPA 5DB6A 5DB9A 4RUCA 3LWMA 2ZTEA 4KN4A 4QZCA 3RJHA 1L3TA 4I27A 4RQ2A 3QE9Y 2BCQA 2ZTDA 4QWEA 5KFKA 4KLTA 5J2KA 4PPXA 3V6KA 3ISDA 1SL0A 2FMSA 2P6UA 1QSYA 4M04A 9ICUA 3RB4A 5DG8A 8ICUA 8ICSA 2PI4A 3M8SA 4KLUA 4J9RA 3ZDDA 3JPRA 4UQGA 4XQ8A 1CUKA 4PGQA 2ASDA 4J9KA 2ZUCA 1ZQLA 4C8NA 3TFSA 1A77A 1KFSA 4F2RA 1U49A 2VA3A 2ISPA 3THVA 4P4PA 2W9AA 4FS2A 4KLEA 2FMPA 3SI8A 5KFZA 1UA0A 4B9VA 3M9MB 2XY6A 4EYIB 2UVWA 1BPEA 4YR0A 2W9CA 2BCVA 4O3SA 2XY7A 2V4QA 4DSJA 4M9GA 4Z6CA 2IHMA 4ECTA 5KFVA 4GC7A 3C2LA 4RQ3A 3ZDEA 5DDYA 4EBCA 3Q8LA 4ECUA 2XGQA 3V72A 3HPOA 3H8JA 2M9NA 4C8LA 4IRKA 5KT4A 4M9LA 4F3OA 3PX6A 1Z00B 2C22A 4B9MA 1D8YA 2PI5A 2BDPA 1S0OA 1Z00A 5J0RA 1L3VA 4KLSA 4KLOA 1T8EA 2JEFA 4DQSA 3RJEA 7ICOA 5KFNA 1QTMA 2KTQA 1ZQJA 4RQ6A 5DQGA 4GC6A 3PW7A 4O3OA 8ICWA 3C5GA 4ECRA 2W9BB 4PHPA 2ASJA 4ELVA 3MDCA 4GXJA 4I2EA 4UB2A 5BOMA 3RRGA 3B0XA 1HJPA 4I2GA 4F8RA 1Z3EB 9ICGA 5DB7A 3PMNA 1UT5A 1UT8A 5J2JA 4Z6DA 8ICTA 4R64A 5F9LA 1NJYA 1JXLA 5HNKA 3AUOA 1X9MA 4GLXA 3T5LA 4UB3A 4QWCA 4IQWA 9ICBA 4IQVA 3C1ZA 4B9LA 4O0IA 4DQIA 3H8SA 1QSLA 3LDAA 2FLLA 4QZIA 1XS9D 5CWRA 1MQ2A 4P4OA 3SYZA 3PVXA 4YFKA 1BPBA 4YR2A 9ICVA 5L1LA 5IIMA 3UXNA 2KFNA 4RQ8A 4TUSA 2VA8A 1HUOA 4RQ5A 2XGPA 3RJGA 4QZHA 2W9MA 2BCUA 4YD1A 1BGXT 7ICGA 3RAXA 2ZTCA 3UPQA 3Q8QB 4NLGA 3TAPA 5IIJA 4PH5A 4DF4A 3NGDA 4RPXA 5IINA 1KRPA 4ZH4A 4UAZA 4DOAA 7ICQA 3RR8A 4UBBA 2R8JA 2BKEA 1ZQCA 3GIJA 3QEBZ 2JEGA 2HHUA 2KN7A 2ASLA 4KLDA 4O3RA 8ICAA 4QZAA 3GIKA 1B22A 1ZJNA 2NRZA 4RPYA 7ICHA 3PY8A 9ICHA 4IR9A 2FPKA 5CR0A 4Q8FA 1A76A 4BWMA 4C8OA 1ZYQA 1S76D 1ZQEA 5DBBA 3G6YA 1XSPA 2GWSA 4RT2A 4Z6EA 4F5RA 4O3PA 4R8UB 4EEYA 4DF8A 2PXIA 3Q8KA 4KLJA 3H4BA 3QZ8A 2KFZA 5KFSA 1N56A 7ICJA 2AJQA 5KFAA 1RYRA 1B43A 4KLHA 4KLMA 3PV8A 5J2CA 1ZETA 9ICQA 1KDHA 4R65A 3RJFA 3C1YA 3MABA 3ISBA 4F50A 3TARA 2OWOA 4Z6FA 7ICRA 5KG5A 3MFIA 5BPCA 9ICOA 1SL2A 4BWJA 5D49A 3GV5B 4F4XA 5D46A 1SKRA 2R8KA 4M0AA 4K4GA 1U48A 4EBEA 3GIMA 4DSFA 1NK9A 3PR4A 2HVHA 4NXZA 4DLEA 2NRTA 5DBAA 4TQSA 2Y1JA 1NJWA 4QW9A 3RBDA 4I29A 4YXMA 5DQIA 7ICUA 5J0WA 2VA2A 1TFRA 5KG2A 4QW8A 2HW3A 2F1HA 5DQHA 5KFWA 3JPOA 1XO1A 3ZDBA 2BPGA 1L5UA 2BCSA 2ZJ5A 3LK9A 5J2FA 3OJSA 5DG9A 3T5JA 2BR0A 1H38A 2IBKA 4DSEA 3HP6A 2J6UA 5DKWA 3OJUA 5J2DA 4IQTA 3ZD8A 1ZQGA 4EBDA 2R8IA 2FLNA 9ICEA 3IM1A 4O3NA 4ELUA 3K75D 4C8KA 4QZ8A 3KHGA 3PNCA 5HP4A 4UAYA 3GFKB 8ICQA 3SV3A 4J9OA 4I2CA 4JV0A 2NRWA 1X2IA 5KG6A 4BGDA 4R66A 4ED7A 3H7IA 1S97A 3EW9A 4M6WB 1S9FA 4P2HA 1K1SA 5L1IA 2P6RA 2ZUDA 4NM2A 4M6WA 1ZQKA 5CJ7A 8ICPA 5KFOA 2ATLA 4KLQA 5J2GA 4QZGA 4DWIA 4MFAA 3H40A 1ZQOA 5EWEA 3JPSA 3OHBA 2W9CB 4ECQA 4K4IA 3TANA 1ZQRA 8ICOA 4ECYA 5DGAA 1T4GA 5KFYA 3OSPA 4MFFA 1IM4A 4TURA 3KHHA 8ICRA 1ZQVA 5KG7A 5KFDA 3G6VA 4DO9A 4DL7A 3MGIA 5JUMA 2WTFA 5J2HA 2DFLA 4UB1A 1BPXA 1X9SA 4DSIA 1ZQUA 5IIOA 2F1JA 3MR6A 1WCNA 4F93B 2AGPA 4P4MA 2IMWP 1NK5A 7ICMA 4DL4A 5DB8A 4Q45A 3UXOA 4UAWA 4QWDA 3EYZA 4PHAA 8ICGA 3FYHA 4QZEA 3UQ0A 9ICJA 4F4ZA 1S0NA 1ZQDA 4F4KA 3HWTA 4DFPA 4DQPA 3MDAA 2AGOA 4Q8EA 5KFUA 5HHHA 5KFMA 2C28A 1SKSA 1NK6A 5J0TA 4J9QA 1ZQAA 4PHEA 4O5CA 5KFBA 4RT3A 3PW5A 5DGBA 1ZQMA 7ICPA 4QZBA 4DL6A 3OSNA 5DG7A 1JX4A 4F92B 4YD2A 4DS5A 2XCAA 4RQ7A 4YP3A 1ZJMA 1TKDA 4TQRA 1D9FA 4RQ4A 2P66A 4MEXA 8ICKA 1SKWA 4EZ6A 4MFCA 5KFGA 4J9NA 4Q43A 2IA6A 1KSPA 1ZQYA 3K4GA 3KHRA 1RXVA 3T3FA 1KEJA 5CB1A 4QWBA 3EWAA 1ZQIA 1RPLA 3TQ1A 4DS4A 1MC8A 4DFKA 3QZ7A 4NY8A 2AGQA 4I2HA 3UQ2A 8ICYA 3KTQA 5KFLA 4F91B 2KZZA 1TVAA 4ELTA 1ZQFA 2AQ0A 2BCRA 3RAQA 2MUTB 1IXRA 4KLGA 4FO6A 2MUTA 1KTQA 1RZTA 2JZBA 1C7YA 7ICIA 5CHGA 2V9WA 2ALZA 4YMOA 9ICXA 2C2RA 1U4BA 3RB6A 3EZ5A 3G6XA 4C8MA 4F2SA 4ED2A 3ORYA 4B9SA 4DSLA 3OGUA 3RR7A 2HHWA 2BPCA 1PZNA 1NK4A 1L3UA 2ISOA 9ICMA 4KN7A 4JWMA 4TUQA 2XCPA 3Q8SB 1TV9A 1V9PA 4YMMA 4JWNA 4FS1A 3PX0A 5KFRA 2PFPA 4NLNA 4MEYA 3MR3A 4X5VA 2JEIA 4M47A 5KG3A 5J29A 3OHAA 1D8LA 3H4DA 8ICXA 1Y88A 1TAQA 9ICTA 4O5KA 5J0XA 4DOCA 4DL2A 5J0UA 1N48A 4JUZA 2ZJ8A 4RNNA 3SV4A 5IIIA 3SZ2A 2PFOA 7ICLA 4ECSA 4DQQA 4KITB 2VANA 3BQ1A 4RUAA 2W8LA 2JEJA 4O3QA 3B0YA 1NJXA 3JPNA 5L1KA 1NKBA 4MF8A 2W8KA 1QLNA 4I2DA 3JPPA 4F4YA 7ICTA 3HT3A 4ECWA 4RNMA 5KG1A 3T5KA 2B21A 4PHDA 4YQWA 8ICMA 4RPZA 4KLFA 3TAQA 4E0DA 5KFPA 3E2EA 1BPYA 1MSWD 7ICKA 3RTVA 3C5FA 2RDJA 1U47A 2FMQA 4YG2A 5L9XA 4I2JA 4DFMA 2NRXA 3TFRA 4DSKA 8ICIA 4CCHA 3RBEA 3LWLA 1EXNA 3PW2A 4F5QA 2KZMA 3MGHA 4ECZA 4M9JA 4XA5A 4HYKA 3M9OB 4RU9A 5J0SA 2I1QA 8ICLA 1ZQZA 7ICVA 3EPGA 4Q44A 3EPIA 2DPIA 1T7PA 2IHNA 5IIKA 4F5PA 5KFTA 5BOLA 5KFFA 3AU6A 4I28A 8ICEA 9ICFA 4G3IA 4PGXA 1UA1A 3PR5B 1BPZA 9ICRA 5D4BA 5EWGA 1JN3A 2MAXA 4BXOB 3HW8A 2PFNA 2J6SA 4I2IA 4XUSA 4GXKA 1ZQNA 1TK0A 3M8RA 4QWAA 4BXOA 4KTQA 3C21A 3JPTA 3BQ2A 4F5NA 1TK5A 2BQUA 4GXIA 4DQRA 2UVRA 4TUPA 5EWFA 3HX0A 3Q8MA 4BDPA 3RRHA 1JIHA 4YR3A 1ZQTA 4LZGA 5KT2A 4I2AA 3ISCA 3V6HA 9ICLA 3FDSA 5KT5A 4IRCA 2FPLA 3RB3A 5EOZA 1NKCA 3TI0A 3RJIA 2BPFA 3BDPA 3MBYA 4J9LA 4KLIA 4EYHB 5KFIA 5KT3A 3AU2A 4KMUA 4FBTA 1NK8A 2Y1IA 9ICWA 3GDXA 5KFQA 1S77D 3N4MB 2C2EA 5TZVA 5KG0A 3MFHA 8ICNA 3T5HA 5F9NA 1KFDA 4B9TA 2HHSA 1MQ3A 2HHQA 3JPQA 1ZQXA 5KT6A 1ZQHA 5L1JA 1SL1A 2DPJA 4JV1A 8ICBA 1KFTA 1TAUA 1XSLA
chains in the Genus database with same CATH superfamily
2R8HA 2W55A 4XRHA 1S0VA 4UB4A 2KHVA 3C2MA 2RDIA 2A3VA 2LYBA 2KG5A 3SAFA 4OJOA 3BQ0A 1DK2A 1N60A 4UBCA 3ONNA 2BQ3A 1BVSA 5JTIA 5AKYA 4M9HA 8ICHA 4I2BA 5J0PA 3PW0A 5ALGA 1KLNA 3IDWA 1WWVA 5DDMA 9ICCA 4ED3A 4LVSA 2A1JA 2PMZC 2ZIWB 4YCXA 4QZDA 2KIWA 1JXEA 4F4WA 1NI3A 9ICPA 4WJ3B 3KD3A 5AIAA 3Q8RB 4IR1A 4O3MA 2HVIA 2ZXHA 3RH6A 1BPDA 4AP9A 4M2YA 3UXPA 1DOQA 5C5JA 5HMLA 2AQ4A 2E8PA 5DLFA 2VJ4A 2UVUA 2LM4A 3C23A 2XICA 2OXOA 2R8GA 1YT3A 2DGZA 2QKQA 1RXWA 2H3QA 3KZIU 3L4PA 3QU2A 4O9MA 5KFCA 2W7PA 4MF2A 1D9DA 1LKYA 4Y2TA 5AM2A 2KEYA 2LKYA 3KFUF 4B9UA 4UAVA 2HHTA 2RLTA 4P0QB 3RJKA 4ED8A 1RYSA 5DB6A 5ALJA 4I27A 4QWEA 5J2KA 1SL0A 3DEEA 2ZIUB 2F77X 5ALRA 5DG8A 1COKA 3ED5A 2PI4A 1CUKA 4PGQA 1Q3VA 2ZUCA 3D6JA 3BZCA 3QX7A 2ISPA 4P4PA 3O0FA 2FMPA 5KFZA 3K1ZA 3D2SA 2XY6A 2UVWA 3QUCA 2IOFK 2W9CA 4O3SA 4Z6CA 2F76X 4NL9C 1KN5A 3C2LA 2VKQA 4IRKA 2HSZA 2K8CB 5KT4A 3PX6A 2C22A 4F71A 1D8YA 2ZIVA 2PI5A 1OW5A 5J0RA 5ALPA 3NRWA 7ICOA 5KFNA 1WWUA 3PW7A 3C5GA 4ECRA 4ELVA 4PHPA 4P0PB 3MDCA 3RRGA 5BOMA 1IIPA 3ICXA 2K4HA 1Z3EB 2G09A 3PMNA 2RRDA 4Z6DA 4R64A 1JXLA 1PK1A 4QWCA 5AIBA 4IQVA 3C1ZA 3H8SA 1DXSA 1N61A 3SYZA 3PVXA 3BS5B 4YFKA 5IIMA 1HUOA 2VA8A 3OTQA 4FZMA 2XGPA 3RJGA 4YD1A 5GTIU 2E8OA 2ZTCA 2HDOA 1SXDA 3TAPA 2D3DA 3NGDA 4Y2JA 3RR8A 4A8EA 3FC4A 1ZJNA 2NRZA 9ICHA 4IR9A 2R18A 1ZQEA 1RQNA 1XSPA 4RT2A 4R8UB 3LVWA 3Q8KA 4KLJA 3QZ8A 2CRXA 1B43A 4KLHA 4NJ8A 1KDHA 4R65A 3RJFA 3C1YA 3ISBA 4UB8U 7ICRA 3MFIA 9ICOA 4CF5A 4BWJA 5D49A 2R8KA 1QH9A 5ALXA 3HRDD 1QCKA 5C0YA 1QQ7A 1NK9A 3PR4A 3DDHA 5DBAA 3NVZA 3UMCA 4QW9A 2VA2A 1TFRA 2HW3A 5DQHA 4ICAA 3JPOA 2BPGA 2DWQA 2ZIXB 4OCZA 2BCSA 2ZJ5A 2F2AB 5J2FA 3UMBA 1Q8KA 5JU5A 2IBKA 3TACB 4NLBA 1Q3UA 2W3SA 1K5OA 3ZD8A 9ICEA 3LYSA 1SB3C 1X40A 1JROA 5ALLA 4C8KA 4QZ8A 3SV3A 4I2CA 5KG6A 4BGDA 3H7IA 3EW9A 4P2HA 2A1AA 5ALDA 3GU3A 2ATLA 4Y2SA 1ZQOA 8ICOA 1UHUA 1SGGA 5DGAA 4MFFA 3KHHA 3G6VA 3L3FX 4DO9A 2LYAA 4OJ6A 5DB8A 3EYZA 8ICGA 2OHFA 3TKAA 4DFPA 3A0BU 3B9JA 2AGOA 4Q8EA 5KFUA 2C28A 1SKSA 1NK6A 5J0TA 2MSNA 5KFBA 4RT3A 1WYGA 5DGBA 4QZBA 5AKJA 4YD2A 4DS5A 2XCAA 1P7DA 4BJQA 1OUQA 4TQRA 5G5HA 3KHRA 1RXVA 1KEJA 4QWBA 2Y9UA 1RPLA 4DS4A 3KKAA 4EX6A 4I2HA 3OPXA 4PL2A 3UQ2A 1TVAA 1JI7A 2MUTB 1SZHA 1B4FA 4C7ZA 4YMOA 3RB6A 3RR7A 1NK4A 2ISOA 9ICMA 4C0ZA 3RFAA 1SV0A 5AI8A 4FS1A 2PFPA 1L7PA 4MEYA 3MR3A 2JEIA 4DL2A 4KITB 2W8LA 2JEJA 3JPPA 4F4YA 4QIWC 4YQWA 3M6KA 3E2EA 3RTVA 3K1RB 3AQFA 2KIVA 1RG6A 4DSKA 4CCHA 3RBEA 2QB1A 5AK5A 2F44A 4XA5A 4PZOA 4RU9A 4OJLA 2EZXA 2HBJA 1D8BA 3IV6A 3SEIA 3AU6A 2GLEA 4G3IA 2IOFA 5AHXA 3NASA 1JN3A 4BXOB 3HW8A 4I2IA 3WK8A 1ZQNA 4GXKA 5H2FU 2KKVA 4UATA 2K60A 2LHTA 3Q8MA 1ZQTA 3ISCA 5EE3A 3RB3A 3SR6A 3N7SC 1V38A 1NKCA 3RJIA 4EYHB 2MU2A 3AU2A 4KMUA 4FBTA 1NK8A 5KFQA 2HOIA 5AKEA 2KICA 5KG0A 5ALHA 1KFDA 1MQ3A 5KT6A 8ICBA 2DPJA 1Z4OA 1ZD5A 1ZQWA 4JK1A 3UM9A 3WKCA 1LB2B 2FE9A 1U9LA 2W43A 4BUGA 1NK7A 2J6TA 4RNOA 1TK8A 9ICNA 2Y9TA 5HHIA 5JRTA 4RQ1A 1ZQQA 1N62A 3WKEA 4B9NA 3MR2A 3SQIA 1HUZA 2HHVA 5KFJA 3PW4A 3RH5A 2JZBB 2BQRA 1J97A 1WCLA 2G5HB 2A1JB 3AL0B 4NM1A 5KTQA 5ALQA 5J2BA 4YXJA 5KG4A 4LZDA 3IRUA 2I5HA 2EANA 3I1YA 1S0MA 5HMMA 1NKEA 4U6PA 1LV5A 4YVZA 2E5SA 3HKZF 1SV4A 5IILA 1KQQA 2NRVA 5J8YA 5KFHA 4IQUA 1M6YA 3GIIA 2ZG6A 9ICSA 2KZ3A 5ALYA 2HHXA 3V6JA 4PGYA 3M9NB 4YN4A 5DLGA 2LYHA 1XWLA 2W03A 3BQTA 5CA7A 1LKYB 5J2AA 2HOFA 3BJYA 4F5OA 8ICFA 4DOBA 1DGSA 4ED6A 1L8OA 2B0CA 4QZ9A 2MRLA 1XC9A 4ED1A 2WAQC 5DBCA 3J81j 3RB0A 4KMOB 5AM4A 1ZQPA 3LWMA 3NVYA 5AKHA 4ACOA 2KHQA 4PPXA 3V6KA 2FMSA 1QSYA 9ICUA 3RB4A 2HBKA 3M8SA 4KLUA 2G5IB 2ASDA 1A77A 2VA3A 2KMDA 3THVA 4FS2A 1F44A 2EZYA 2XY7A 4LJXA 4DSJA 3QU9A 4ECTA 4GC7A 4RQ3A 3ZDEA 5DDYA 5A0LA 3Q8LA 4C4SA 4ECUA 2XGQA 3HPOA 3H8JA 2M9NA 1PVPA 1VDVA 2BDPA 4UARA 1Z00A 5ALZA 2JEFA 4DQSA 5G5GA 2KTQA 5AKIA 5DQGA 4GC6A 8ICWA 2W9BB 2ASJA 5AI9A 4UB2A 2DUYA 4I2GA 1X6JA 2VIXA 5J2JA 1PK1B 1NJYA 4UB3A 9ICBA 1KL9A 5ALIA 3QU7A 5CWRA 4P4OA 2L5YA 4EELA 1KKXA 3IG8A 2YY6A 3UXNA 2W9MA 7ICGA 3RAXA 3UPQA 4ZOHC 4DF4A 1KRPA 4UAZA 4DOAA 3FM9A 4UBBA 2R8JA 2BKEA 1ZQCA 3GIJA 2HHUA 2ASLA 4KLDA 8ICAA 3GIKA 3GZFA 4HAIA 2ES6A 2FPKA 5EE1A 2KVSA 3DV9A 5DBBA 2GWSA 4EEYA 2PXIA 4USAA 3A0HU 2KFZA 5J2CA 3MC1A 3MABA 3TARA 4F50A 5BPCA 4NL9A 4PL1A 4F4XA 1A0PA 5D46A 1IV8A 4DLEA 4NXZA 2F3NA 1AQ6A 4YXMA 7ICUA 3M1YA 5HR6A 3IN5A 2XVTA 4AYBF 3OJSA 3CRXA 4IC9A 3HP6A 2J6UA 3SENA 3BZKA 4RQNA 3WK7A 1ZQGA 4EBDA 2R8IA 3IM1A 4ELUA 3KHGA 5HP4A 3AEVA 1PUZA 4JV0A 1TAMA 5L1IA 2K4IA 4DWIA 3H40A 5EWEA 1IM4A 4TURA 2EAOA 5KG7A 4DL7A 3MGIA 2WTFA 5J2HA 2DFLA 1Z1VA 3MR6A 4F93B 2AGPA 5ALSA 1JUDA 3CYMA 4PHAA 3UQ0A 4QZEA 1S0NA 1ZQ1C 2KSOB 5HHHA 5KFMA 5AI5A 4EENA 5KAIU 4PJ0U 5AKKA 4F92B 1JX4A 2KNJA 3QYPA 1VLBA 1D9FA 4RQ4A 1SKWA 4Q43A 3ETRA 3EWAA 3TQ1A 2XIDA 1MC8A 3QZ7A 2CPRA 2NV3A 5KFLA 4F91B 2OH2A 4DCCA 4CGZA 3RAQA 4U7CA 4FO6A 1KTQA 3NVVA 7ICIA 1XO0A 1C20A 1J2NA 1WG8A 2V9WA 2W11A 2Y0SF 5AK6A 4ED2A 3I28A 1RQLA 2YX8A 4DSLA 2YTUA 2ZIWA 3AM9A 1L3UA 4JWMA 1TV9A 4YMMA 3PX0A 4NLNA 3BQ7A 5KFRA 4X5VA 4CE6A 5J29A 1D8LA 3QUQA 1Y88A 4UB6U 9ICTA 4O5KA 4B6JA 5J0UA 1N48A 5AM1A 4RNNA 3SV4A 3SZ2A 5ALNA 2JMGA 4ECSA 5KL1B 5EE0A 4RUAA 4QNLA 1NJXA 1NKBA 4CF4A 4MF8A 4I2DA 3D2QA 5KG1A 2B21A 4RPZA 4KLFA 2E1EA 1X66A 2P35A 3C5FA 3TADC 4DFMA 2K89A 2NRXA 1LVHA 1EXNA 4F5QA 2DQNB 4OO1J 4ECZA 4HYKA 5J0SA 3EPGA 3CP8A 1T7PA 5IIKA 4F5PA 5AM0A 1V97A 2GO7A 1BPZA 2B6GA 1BNPA 1JALA 3M8RA 4QWAA 2G07A 4DQRA 3C29A 4TUPA 3D2NA 1SWVA 3HX0A 1X6IA 3RRHA 1JIHA 4YR3A 3V6HA 3FDSA 5EOZA 2BPFA 3BDPA 4KLIA 3MBYA 2QARA 2K8BB 3N4MB 2E1FA 2OYYA 3MFHA 4B9TA 1ZQXA 1SL1A 4JV1A 1KFTA 1XSLA 9ICAA 3RJJA 3WU2U 2AH5A 2FPMA 3KHLA 4J9MA 2XC9A 5T14A 8ICVA 3H0LB 1SZPA 4DL5A 2W04A 1T3NA 2FI1A 1GO3F 4R63A 8ICJA 5KFXA 4O5EA 7ICFA 7ICEA 2IOHA 2ZUBA 5EE9A 5KT7A 1ZQSA 3WK6A 2K4PA 1FEZA 1CEZA 2PMZF 3Q8PB 2YN4A 3PO4A 3AMZA 4Y2PA 2AU0A 3F5EA 1U45A 3RH4A 5CP2A 5ALEA 4RQ0A 2LPEA 2BHNA 2GOLA 4ECVA 1B0XA 2F8KA 4NLZA 3PSIA 1XU4A 1NZPA 2PFQA 3PX4A 4R8UA 1S8OA 1NJZA 4ECXA 4JB3A 3GV8B 4ED0A 3M6ZA 4IRDA 1XSNA 1HIWA 4EZ9A 3V7JA 5ALFA 3ETLA 4DFDA 4F72A 3NRZA 2F1IA 4DEZA 1L8LA 4NLCA 1NK0A 1K1QA 4Y2XA 1PK3A 4J9PA 8ICCA 2XO7A 3VC8A 3NVWA 1X9XA 2ZTEA 4KN4A 4QZCA 2NYVA 4BX9C 3RJHA 1L3TA 4RQ2A 2ZTDA 5ALOA 4KLTA 3PSPA 3ISDA 2P6UA 8ICSA 4J9RA 1N5XA 2KJ9A 3JPRA 3ZDDA 4UQGA 4XQ8A 4J9KA 1ZQLA 5KAFU 4US9A 1KFSA 1U49A 1UA0A 3M9MB 3F2CA 4C7YA 1BPEA 4NWIA 4YR0A 2BCVA 2ESEA 2AHOB 5HR7A 5KFVA 1T3QA 4EBCA 4UW9A 3V72A 4C8LA 4F3OA 1Z00B 3H8MA 5KNIA 1ZRNA 4KLSA 1T8EA 1QTMA 1ZQJA 4RQ6A 4O3OA 4I2EA 3B0XA 4F8RA 3WKBA 5DB7A 1UT8A 8ICTA 3KBBA 5HNKA 3T5LA 1MN8A 2EZZA 4O0IA 4DQIA 2E8MA 3LDAA 4QZIA 1MQ2A 1BPBA 5L1LA 2KFNA 2JXJA 4RQ8A 5AKZA 4QZHA 2BCUA 1BGXT 1XNSA 1Z4NA 3Q8QB 5IIJA 3N7RC 5IINA 2YB1A 1SWWA 3QEBZ 2JEGA 2JHDA 2KN7A 4O3RA 2I6XA 1B22A 5TISU 4RPYA 7ICHA 3PY8A 4EEKA 1A76A 1UPHA 4C8OA 1ZYQA 3SMVA 2FDRA 4Z6EA 4F5RA 4O3PA 4DF8A 3H4BA 5KFSA 4MHVA 1N56A 2AJQA 5KFAA 1RYRA 2H3IA 4FZLA 2VJ5A 2K4EA 1SL2A 3PSTA 4K4GA 4EBEA 3GIMA 2W3RA 2HVHA 5F3XB 2NRTA 1RYUA 4TQSA 2Y1JA 1NJWA 4I29A 5DQIA 5J0WA 5KG2A 4QW8A 5KFWA 1DK3A 2BZFA 1XO1A 3ZDBA 1T94A 2YQEA 4FZNA 1L5UA 3LK9A 2BR0A 5DG9A 3T5JA 4G9BA 4DSEA 3OJUA 5J2DA 2H3VA 1URJA 3K75D 5AI4A 1CRXA 2EQYA 4J9OA 2NRWA 3WK9A 1S97A 3PSFA 1S9FA 2F8LA 4M6WA 5CJ7A 3VCBA 2Z7JA 5AM3A 4IS7A 4KLQA 2M0NA 1YZ7A 4MFAA 3JPSA 3OHBA 2W9CB 4ECQA 1RDFA 2N1RA 1ZQRA 1YZ6A 4K4IA 4ECYA 1T4GA 2E8NA 5KFYA 3OSPA 5AK4A 1DRGA 1Z1BA 2RQ5A 1UCVA 8ICRA 2ZIVB 1X9SA 4DSIA 1ZQUA 2QB0A 1TE2A 4Y2VA 2IMWP 2DL0A 2H3FA 5AK3A 4Q45A 2HMXA 3UXOA 2RHFA 9ICJA 2MA1A 1VJ5A 1ZQDA 3NUQA 2G08A 2CN1A 1ZQAA 7ICVA 4DL6A 5DG7A 5E79U 3KZXA 4OJPA 1TKDA 4YP3A 4MEXA 4J9NA 2CXYA 4EX7A 1ZQYA 3K4GA 5CB1A 2OEHA 4FE3A 1ZQIA 3CW2C 4DFKA 4NY8A 1ZQFA 1ZXIA 2BCRA 5ALUA 1RZTA 2JZBA 4FFDA 5CHGA 2ALZA 2C2RA 1U4BA 2YMPA 3EZ5A 5B66U 3RF9A 3BS7A 2HHWA 2JH1A 1NNLA 1ZD4A 4KN7A 3Q8SB 2KVCA 4JWNA 3R9KA 2KD1A 5KG3A 5J0XA 2JH7A 4DOCA 5FP0A 2ZJ8A 2KK0A 7ICLA 5L1KA 1QLNA 2K8AA 7ICTA 4QIWF 3T5KA 2KP7A 2WF5A 4PHDA 3EUB2 4E0DA 5KFPA 7ICKA 1BPYA 3WKDA 5AKLA 1U47A 2FMQA 4YG2A 3WKAA 3LWLA 2D8CA 3M9OB 8ICLA 4JMUA 4Q44A 3EPIA 2DPIA 2JRZA 4I28A 2HCFA 4PGXA 3PR5B 5D4BA 2PFNA 2ZXIA 4KX3A 4KTQA 1TK0A 1O03A 3JPTA 4F5NA 3H0RB 2G0AA 3IG5A 1BNOA 4BDPA 2OCEA 9ICLA 2FPLA 2QARB 3N28A 4J9LA 3E58A 5KT3A 9ICWA 3GDXA 2C2EA 5TZVA 1FIQA 5AICA 3JPQA 2KV2A 2HHQA 1ZQHA 2FJ6A 4JV2A 4UB5A 2V4RA 5J2IA 3S6JA 5ALWA 3MR5A 3M7DA 2W9BA 1OXJA 3L5KA 2C2DA 4DLGA 3NTUA 4RZRA 4YMNA 3ZDCA 2XI9A 9ICIA 5J0QA 4K4HA 2YMLA 4DFJA 3TADA 4NLKA 3CNHA 2ZJAA 1S10A 3PZPA 3PO5A 4QJFB 1NOMA 4FBUA 1UQVA 4C4RA 2G06A 2WB1F 2FLPA 3GILA 1COOA 4M9NA 1N2XA 5K4LA 7ICSA 2KE7A 1L3SA 9ICKA 2HBMA 2XY5A 2BGWA 2I9GA 2H3ZA 3H8WA 4I2FA 5J0YA 2W54A 1NZBA 4DL3A 1JMSA 5J2EA 3V7LA 3C2KA 3QXGA 1AROP 4J9SA 3GQCA 3HKZC 3ZD9A 3N97B 2YB4A 4CRXA 5J0OA 3GV7B 3QEAZ 1X9WA 2HBLA 2LBOA 2H5XA 8ICZA 2WF6A 7ICNA 5KFEA 2Q0ZX 1F0MA 3F53A 1ZOLA 4UASA 4C4TA 3QU4A 2WFAA 2BDUA 1QSSA 4QZFA 1RM6C 2UVVA 1S5LU 2WAQF 1ZQBA 2KJ8A 3V7KA 3IHQB 4KLLA 3PMLA 4P0QA 3ZDAA 5DB9A 4RUCA 4CF3A 3WK5A 3QNMA 3QE9Y 2BCQA 5KFKA 4M04A 3AN1A 2ZIUA 4Y2QA 4C8NA 3TFSA 4F2RA 5L1MA 3SAGA 2W9AA 4KLEA 3SI8A 4B9VA 1CI4A 4EYIB 1L7MA 2V4QA 4M9GA 2IHMA 4UAUA 2PKEA 3AQEA 3ZI4A 4M9LA 3HJEA 4B9MA 1S0OA 2NO4A 1L3VA 1J2MA 4KLOA 1KBUA 3RJEA 4GXJA 4P0PA 1HJPA 2WHEA 9ICGA 1UT5A 4C80A 8ICUA 5F9LA 5AKGA 3AUOA 1X9MA 4GLXA 2OM6A 2KSOA 4IQWA 4B9LA 1QSLA 2FLLA 1XS9D 2D6FC 2JV3A 1FFUA 4YR2A 9ICVA 3BS5A 1V85A 4TUSA 4PZNA 4RQ5A 3C28A 2JGAA 5GTHU 2GH1A 4NLGA 4PH5A 4RPXA 4ZH4A 4Y2YA 2EH9A 1Z19A 7ICQA 5AM5A 2EDUA 4J03A 4QZAA 5AI0A 4IL6U 5CR0A 4Q8FA 4BWMA 1N5WA 1S76D 3G6YA 1PVRA 2ODGA 3HILA 3U26A 3F2DA 2EAPA 1DGJA 7ICJA 1O08A 4KLMA 3PV8A 1L7OA 1ZETA 9ICQA 2OWOA 4CDGA 4Z6FA 5KG5A 2YMMA 3GV5B 1SKRA 4M0AA 3QUTA 1U48A 4DSFA 1JRPA 2JR5A 3E0FA 1ED1A 3FAHA 3RBDA 2F1HA 2AXTU 2WF7A 5AKXA 2ZIXA 2DKZA 3KKAC 1H38A 3WK4A 4AYBC 5DKWA 5ALVA 2A19A 4IQTA 2FLNA 2O6KA 4O3NA 2YMQA 5ALTA 3PNCA 1F5SA 4UAYA 3GFKB 8ICQA 1IG6A 1X2IA 4Y2RA 1L7NA 4R66A 1ZD3A 2HOQA 4ED7A 5AI6A 4M6WB 1K1SA 2P6RA 2ZUDA 4NM2A 1ZQKA 8ICPA 5KFOA 3F5AA 4GIBA 5J2GA 4QZGA 1SV0C 2RP5A 3TANA 1FO4A 1L6NA 2DKXA 1ZQVA 5KFDA 2LMRA 5JUMA 1ZD2P 4UB1A 2QB0B 1BPXA 4RQMA 5IIOA 2F1JA 2WF9A 3SAHA 1WCNA 4P4MA 7ICMA 1NK5A 3UMGA 2DBYA 4DL4A 5CRXA 1ECWA 4UAWA 4QWDA 3FYHA 4F4ZA 3QUBA 4F4KA 3HWTA 4DQPA 3MDAA 1SXEA 1SIJA 4J9QA 4O5CA 4PHEA 7ICPA 3PW5A 1ZQMA 1WUDA 3OSNA 1ZJMA 4RQ7A 2WF8A 2P66A 8ICKA 3I76A 4EZ6A 4MFCA 5KFGA 2IA6A 1KSPA 1Q46A 3T3FA 5ALMA 2DF4B 2AGQA 8ICYA 3KTQA 4GFJA 2KZZA 4ELTA 2EAMA 2AQ0A 1IXRA 4KLGA 1X42A 1FFVA 2MUTA 3NS1A 4US8A 1C7YA 5CEHA 9ICXA 2KKPA 3G6XA 4C8MA 2Y0SC 4F2SA 2WB1C 4OJ5A 5B5EU 3ORYA 3MGVA 4B9SA 1HEKA 3OGUA 2BPCA 3QU5A 1PZNA 5ALKA 4TUQA 2XCPA 3KOOA 1V9PA 4CNQA 2NO5A 4M47A 3OHAA 3H4DA 8ICXA 1TAQA 4JUZA 3F2BA 5IIIA 3IP4B 4Y2UA 2PFOA 1PVQA 4DQQA 2VANA 3LVVA 3BQ1A 3H0MB 4OD0A 4O3QA 3B0YA 3JPNA 2W8KA 3HT3A 4ECWA 4RNMA 2LM1A 2KOBA 8ICMA 3TAQA 1MSWD 2RDJA 5L9XA 4I2JA 3T79A 2Q4TA 3TFRA 8ICIA 3PW2A 2KZMA 2KJ5A 3MGHA 3SD7A 3N7PD 4M9JA 2I1QA 1ZQZA 1ZRMA 2IHNA 5KFTA 5BOLA 5KFFA 8ICEA 9ICFA 3ALRA 1UA1A 9ICRA 5EWGA 2MAXA 2J6SA 4XUSA 4BXOA 3C21A 3BQ2A 1TK5A 1KW4A 4GXIA 2BQUA 2UVRA 5EWFA 2HI0A 2QLTA 4LZGA 5KT2A 4I2AA 5J8YC 2W7OA 4KX5A 4IRCA 5KL8B 5KT5A 1QQ5A 1A6SA 3TI0A 5KFIA 1N63A 2Y1IA 4NV0A 1S77D 8ICNA 3T5HA 5F9NA 2LI6A 2HHSA 1MA7A 1QQ6A 5L1JA 2E3TA 1TAUA
chains in the Genus database with same CATH topology
2R8HA 1ZQWA 9ICAA 3RJJA 4JK1A 4XRHA 4JV2A 4UB5A 2V4RA 1S0VA 1LB2B 4UB4A 3C2MA 5J2IA 2FPMA 3MR5A 2RDIA 3KHLA 1U9LA 4J9MA 2XC9A 2W9BA 8ICVA 2C2DA 4DLGA 3NTUA 3BQ0A 1SZPA 4RZRA 4YMNA 4DL5A 3ZDCA 1T3NA 1NK7A 4UBCA 2J6TA 4RNOA 1TK8A 9ICNA 9ICIA 4R63A 5HHIA 5J0QA 4K4HA 4RQ1A 1ZQQA 8ICJA 5KFXA 4O5EA 7ICFA 4B9NA 2BQ3A 7ICEA 3MR2A 1BVSA 4DFJA 1HUZA 2HHVA 5KFJA 3PW4A 2ZUBA 4NLKA 4M9HA 5KT7A 8ICHA 2ZJAA 1ZQSA 5J0PA 2JZBB 3RH5A 1S10A 4I2BA 2BQRA 3PO5A 1WCLA 1NOMA 4FBUA 3PW0A 1KLNA 5DDMA 1CEZA 2FLPA 2A1JB 3GILA 1COOA 4M9NA 4NM1A 9ICCA 5KTQA 3Q8PB 4ED3A 4LVSA 2A1JA 5J2BA 7ICSA 3PO4A 1L3SA 9ICKA 4YCXA 2AU0A 4QZDA 4YXJA 5KG4A 4LZDA 1JXEA 1U45A 2XY5A 3RH4A 4F4WA 5CP2A 2BGWA 2I9GA 3H8WA 1S0MA 4I2FA 5HMMA 4RQ0A 9ICPA 2BHNA 5J0YA 1NKEA 3Q8RB 1JMSA 4DL3A 1LV5A 5J2EA 3V7LA 4YVZA 4ECVA 3C2KA 4IR1A 1AROP 4J9SA 2HVIA 5IILA 3RH6A 4NLZA 2NRVA 3GQCA 1XU4A 3ZD9A 5KFHA 4IQUA 3N97B 3GIIA 1BPDA 2PFQA 9ICSA 3PX4A 4R8UA 4M2YA 3UXPA 2KZ3A 1DOQA 5J0OA 3GV7B 5C5JA 3V6JA 3QEAZ 2HHXA 5HMLA 2AQ4A 1X9WA 1NJZA 5DLFA 4ECXA 2UVUA 3GV8B 4PGYA 3C23A 3M9NB 2R8GA 2H5XA 4ED0A 8ICZA 4YN4A 4IRDA 5DLGA 5KFEA 2LYHA 1XSNA 1XWLA 2Q0ZX 1RXWA 4O9MA 7ICNA 3BQTA 4EZ9A 3V7JA 5KFCA 4MF2A 5CA7A 5J2AA 1D9DA 3BJYA 4F5OA 3ETLA 1QSSA 8ICFA 4DOBA 1DGSA 4ED6A 4QZFA 4QZ9A 2F1IA 4DEZA 2UVVA 4B9UA 1ZQBA 1NK0A 1XC9A 4ED1A 1K1QA 3V7KA 3IHQB 2HHTA 3RJKA 4KLLA 3PMLA 4J9PA 8ICCA 5DBCA 2XO7A 3RB0A 4ED8A 1RYSA 3ZDAA 1ZQPA 5DB6A 5DB9A 4RUCA 3LWMA 2ZTEA 4KN4A 4QZCA 3RJHA 1L3TA 4I27A 4RQ2A 3QE9Y 2BCQA 2ZTDA 4QWEA 5KFKA 4KLTA 5J2KA 4PPXA 3V6KA 3ISDA 1SL0A 2FMSA 2P6UA 1QSYA 4M04A 9ICUA 3RB4A 5DG8A 8ICUA 8ICSA 2PI4A 3M8SA 4KLUA 4J9RA 3ZDDA 3JPRA 4UQGA 4XQ8A 1CUKA 4PGQA 2ASDA 4J9KA 2ZUCA 1ZQLA 4C8NA 3TFSA 1A77A 1KFSA 4F2RA 1U49A 2VA3A 2ISPA 3THVA 4P4PA 2W9AA 4FS2A 4KLEA 2FMPA 3SI8A 5KFZA 1UA0A 4B9VA 3M9MB 2XY6A 4EYIB 2UVWA 1BPEA 4YR0A 2W9CA 2BCVA 4O3SA 2XY7A 2V4QA 4DSJA 4M9GA 4Z6CA 2IHMA 4ECTA 5KFVA 4GC7A 3C2LA 4RQ3A 3ZDEA 5DDYA 4EBCA 3Q8LA 4ECUA 2XGQA 3V72A 3HPOA 3H8JA 2M9NA 4C8LA 4IRKA 5KT4A 4M9LA 4F3OA 3PX6A 1Z00B 2C22A 4B9MA 1D8YA 2PI5A 2BDPA 1S0OA 1Z00A 5J0RA 1L3VA 4KLSA 4KLOA 1T8EA 2JEFA 4DQSA 3RJEA 7ICOA 5KFNA 1QTMA 2KTQA 1ZQJA 4RQ6A 5DQGA 4GC6A 3PW7A 4O3OA 8ICWA 3C5GA 4ECRA 2W9BB 4PHPA 2ASJA 4ELVA 3MDCA 4GXJA 4I2EA 4UB2A 5BOMA 3RRGA 3B0XA 1HJPA 4I2GA 4F8RA 1Z3EB 9ICGA 5DB7A 3PMNA 1UT5A 1UT8A 5J2JA 4Z6DA 8ICTA 4R64A 5F9LA 1NJYA 1JXLA 5HNKA 3AUOA 1X9MA 4GLXA 3T5LA 4UB3A 4QWCA 4IQWA 9ICBA 4IQVA 3C1ZA 4B9LA 4O0IA 4DQIA 3H8SA 1QSLA 3LDAA 2FLLA 4QZIA 1XS9D 5CWRA 1MQ2A 4P4OA 3SYZA 3PVXA 4YFKA 1BPBA 4YR2A 9ICVA 5L1LA 5IIMA 3UXNA 2KFNA 4RQ8A 4TUSA 2VA8A 1HUOA 4RQ5A 2XGPA 3RJGA 4QZHA 2W9MA 2BCUA 4YD1A 1BGXT 7ICGA 3RAXA 2ZTCA 3UPQA 3Q8QB 4NLGA 3TAPA 5IIJA 4PH5A 4DF4A 3NGDA 4RPXA 5IINA 1KRPA 4ZH4A 4UAZA 4DOAA 7ICQA 3RR8A 4UBBA 2R8JA 2BKEA 1ZQCA 3GIJA 3QEBZ 2JEGA 2HHUA 2KN7A 2ASLA 4KLDA 4O3RA 8ICAA 4QZAA 3GIKA 1B22A 1ZJNA 2NRZA 4RPYA 7ICHA 3PY8A 9ICHA 4IR9A 2FPKA 5CR0A 4Q8FA 1A76A 4BWMA 4C8OA 1ZYQA 1S76D 1ZQEA 5DBBA 3G6YA 1XSPA 2GWSA 4RT2A 4Z6EA 4F5RA 4O3PA 4R8UB 4EEYA 4DF8A 2PXIA 3Q8KA 4KLJA 3H4BA 3QZ8A 2KFZA 5KFSA 1N56A 7ICJA 2AJQA 5KFAA 1RYRA 1B43A 4KLHA 4KLMA 3PV8A 5J2CA 1ZETA 9ICQA 1KDHA 4R65A 3RJFA 3C1YA 3MABA 3ISBA 4F50A 3TARA 2OWOA 4Z6FA 7ICRA 5KG5A 3MFIA 5BPCA 9ICOA 1SL2A 4BWJA 5D49A 3GV5B 4F4XA 5D46A 1SKRA 2R8KA 4M0AA 4K4GA 1U48A 4EBEA 3GIMA 4DSFA 1NK9A 3PR4A 2HVHA 4NXZA 4DLEA 2NRTA 5DBAA 4TQSA 2Y1JA 1NJWA 4QW9A 3RBDA 4I29A 4YXMA 5DQIA 7ICUA 5J0WA 2VA2A 1TFRA 5KG2A 4QW8A 2HW3A 2F1HA 5DQHA 5KFWA 3JPOA 1XO1A 3ZDBA 2BPGA 1L5UA 2BCSA 2ZJ5A 3LK9A 5J2FA 3OJSA 5DG9A 3T5JA 2BR0A 1H38A 2IBKA 4DSEA 3HP6A 2J6UA 5DKWA 3OJUA 5J2DA 4IQTA 3ZD8A 1ZQGA 4EBDA 2R8IA 2FLNA 9ICEA 3IM1A 4O3NA 4ELUA 3K75D 4C8KA 4QZ8A 3KHGA 3PNCA 5HP4A 4UAYA 3GFKB 8ICQA 3SV3A 4J9OA 4I2CA 4JV0A 2NRWA 1X2IA 5KG6A 4BGDA 4R66A 4ED7A 3H7IA 1S97A 3EW9A 4M6WB 1S9FA 4P2HA 1K1SA 5L1IA 2P6RA 2ZUDA 4NM2A 4M6WA 1ZQKA 5CJ7A 8ICPA 5KFOA 2ATLA 4KLQA 5J2GA 4QZGA 4DWIA 4MFAA 3H40A 1ZQOA 5EWEA 3JPSA 3OHBA 2W9CB 4ECQA 4K4IA 3TANA 1ZQRA 8ICOA 4ECYA 5DGAA 1T4GA 5KFYA 3OSPA 4MFFA 1IM4A 4TURA 3KHHA 8ICRA 1ZQVA 5KG7A 5KFDA 3G6VA 4DO9A 4DL7A 3MGIA 5JUMA 2WTFA 5J2HA 2DFLA 4UB1A 1BPXA 1X9SA 4DSIA 1ZQUA 5IIOA 2F1JA 3MR6A 1WCNA 4F93B 2AGPA 4P4MA 2IMWP 1NK5A 7ICMA 4DL4A 5DB8A 4Q45A 3UXOA 4UAWA 4QWDA 3EYZA 4PHAA 8ICGA 3FYHA 4QZEA 3UQ0A 9ICJA 4F4ZA 1S0NA 1ZQDA 4F4KA 3HWTA 4DFPA 4DQPA 3MDAA 2AGOA 4Q8EA 5KFUA 5HHHA 5KFMA 2C28A 1SKSA 1NK6A 5J0TA 4J9QA 1ZQAA 4PHEA 4O5CA 5KFBA 4RT3A 3PW5A 5DGBA 1ZQMA 7ICPA 4QZBA 4DL6A 3OSNA 5DG7A 1JX4A 4F92B 4YD2A 4DS5A 2XCAA 4RQ7A 4YP3A 1ZJMA 1TKDA 4TQRA 1D9FA 4RQ4A 2P66A 4MEXA 8ICKA 1SKWA 4EZ6A 4MFCA 5KFGA 4J9NA 4Q43A 2IA6A 1KSPA 1ZQYA 3K4GA 3KHRA 1RXVA 3T3FA 1KEJA 5CB1A 4QWBA 3EWAA 1ZQIA 1RPLA 3TQ1A 4DS4A 1MC8A 4DFKA 3QZ7A 4NY8A 2AGQA 4I2HA 3UQ2A 8ICYA 3KTQA 5KFLA 4F91B 2KZZA 1TVAA 4ELTA 1ZQFA 2AQ0A 2BCRA 3RAQA 2MUTB 1IXRA 4KLGA 4FO6A 2MUTA 1KTQA 1RZTA 2JZBA 1C7YA 7ICIA 5CHGA 2V9WA 2ALZA 4YMOA 9ICXA 2C2RA 1U4BA 3RB6A 3EZ5A 3G6XA 4C8MA 4F2SA 4ED2A 3ORYA 4B9SA 4DSLA 3OGUA 3RR7A 2HHWA 2BPCA 1PZNA 1NK4A 1L3UA 2ISOA 9ICMA 4KN7A 4JWMA 4TUQA 2XCPA 3Q8SB 1TV9A 1V9PA 4YMMA 4JWNA 4FS1A 3PX0A 5KFRA 2PFPA 4NLNA 4MEYA 3MR3A 4X5VA 2JEIA 4M47A 5KG3A 5J29A 3OHAA 1D8LA 3H4DA 8ICXA 1Y88A 1TAQA 9ICTA 4O5KA 5J0XA 4DOCA 4DL2A 5J0UA 1N48A 4JUZA 2ZJ8A 4RNNA 3SV4A 5IIIA 3SZ2A 2PFOA 7ICLA 4ECSA 4DQQA 4KITB 2VANA 3BQ1A 4RUAA 2W8LA 2JEJA 4O3QA 3B0YA 1NJXA 3JPNA 5L1KA 1NKBA 4MF8A 2W8KA 1QLNA 4I2DA 3JPPA 4F4YA 7ICTA 3HT3A 4ECWA 4RNMA 5KG1A 3T5KA 2B21A 4PHDA 4YQWA 8ICMA 4RPZA 4KLFA 3TAQA 4E0DA 5KFPA 3E2EA 1BPYA 1MSWD 7ICKA 3RTVA 3C5FA 2RDJA 1U47A 2FMQA 4YG2A 5L9XA 4I2JA 4DFMA 2NRXA 3TFRA 4DSKA 8ICIA 4CCHA 3RBEA 3LWLA 1EXNA 3PW2A 4F5QA 2KZMA 3MGHA 4ECZA 4M9JA 4XA5A 4HYKA 3M9OB 4RU9A 5J0SA 2I1QA 8ICLA 1ZQZA 7ICVA 3EPGA 4Q44A 3EPIA 2DPIA 1T7PA 2IHNA 5IIKA 4F5PA 5KFTA 5BOLA 5KFFA 3AU6A 4I28A 8ICEA 9ICFA 4G3IA 4PGXA 1UA1A 3PR5B 1BPZA 9ICRA 5D4BA 5EWGA 1JN3A 2MAXA 4BXOB 3HW8A 2PFNA 2J6SA 4I2IA 4XUSA 4GXKA 1ZQNA 1TK0A 3M8RA 4QWAA 4BXOA 4KTQA 3C21A 3JPTA 3BQ2A 4F5NA 1TK5A 2BQUA 4GXIA 4DQRA 2UVRA 4TUPA 5EWFA 3HX0A 3Q8MA 4BDPA 3RRHA 1JIHA 4YR3A 1ZQTA 4LZGA 5KT2A 4I2AA 3ISCA 3V6HA 9ICLA 3FDSA 5KT5A 4IRCA 2FPLA 3RB3A 5EOZA 1NKCA 3TI0A 3RJIA 2BPFA 3BDPA 3MBYA 4J9LA 4KLIA 4EYHB 5KFIA 5KT3A 3AU2A 4KMUA 4FBTA 1NK8A 2Y1IA 9ICWA 3GDXA 5KFQA 1S77D 3N4MB 2C2EA 5TZVA 5KG0A 3MFHA 8ICNA 3T5HA 5F9NA 1KFDA 4B9TA 2HHSA 1MQ3A 2HHQA 3JPQA 1ZQXA 5KT6A 1ZQHA 5L1JA 1SL1A 2DPJA 4JV1A 8ICBA 1KFTA 1TAUA 1XSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8H A;  1ZQW A;  9ICA A;  3RJJ A;  4JK1 A;  4XRH A;  4JV2 A;  4UB5 A;  2V4R A;  1S0V A;  1LB2 B;  4UB4 A;  3C2M A;  5J2I A;  2FPM A;  3MR5 A;  2RDI A;  3KHL A;  1U9L A;  4J9M A;  2XC9 A;  2W9B A;  8ICV A;  2C2D A;  4DLG A;  3NTU A;  3BQ0 A;  1SZP A;  4RZR A;  4YMN A;  4DL5 A;  3ZDC A;  1T3N A;  1NK7 A;  4UBC A;  2J6T A;  4RNO A;  1TK8 A;  9ICN A;  9ICI A;  4R63 A;  5HHI A;  5J0Q A;  4K4H A;  4RQ1 A;  1ZQQ A;  8ICJ A;  5KFX A;  4O5E A;  7ICF A;  4B9N A;  2BQ3 A;  7ICE A;  3MR2 A;  1BVS A;  4DFJ A;  1HUZ A;  2HHV A;  5KFJ A;  3PW4 A;  2ZUB A;  4NLK A;  4M9H A;  5KT7 A;  8ICH A;  2ZJA A;  1ZQS A;  5J0P A;  2JZB B;  3RH5 A;  1S10 A;  4I2B A;  2BQR A;  3PO5 A;  1WCL A;  1NOM A;  4FBU A;  3PW0 A;  1KLN A;  5DDM A;  1CEZ A;  2FLP A;  2A1J B;  3GIL A;  1COO A;  4M9N A;  4NM1 A;  9ICC A;  5KTQ A;  3Q8P B;  4ED3 A;  4LVS A;  2A1J A;  5J2B A;  7ICS A;  3PO4 A;  1L3S A;  9ICK A;  4YCX A;  2AU0 A;  4QZD A;  4YXJ A;  5KG4 A;  4LZD A;  1JXE A;  1U45 A;  2XY5 A;  3RH4 A;  4F4W A;  5CP2 A;  2BGW A;  2I9G A;  3H8W A;  1S0M A;  4I2F A;  5HMM A;  4RQ0 A;  9ICP A;  2BHN A;  5J0Y A;  1NKE A;  3Q8R B;  1JMS A;  4DL3 A;  1LV5 A;  5J2E A;  3V7L A;  4YVZ A;  4ECV A;  3C2K A;  4IR1 A;  1ARO P;  4J9S A;  2HVI A;  5IIL A;  3RH6 A;  4NLZ A;  2NRV A;  3GQC A;  1XU4 A;  3ZD9 A;  5KFH A;  4IQU A;  3N97 B;  3GII A;  1BPD A;  2PFQ A;  9ICS A;  3PX4 A;  4R8U A;  4M2Y A;  3UXP A;  2KZ3 A;  1DOQ A;  5J0O A;  3GV7 B;  5C5J A;  3V6J A;  3QEA Z;  2HHX A;  5HML A;  2AQ4 A;  1X9W A;  1NJZ A;  5DLF A;  4ECX A;  2UVU A;  3GV8 B;  4PGY A;  3C23 A;  3M9N B;  2R8G A;  2H5X A;  4ED0 A;  8ICZ A;  4YN4 A;  4IRD A;  5DLG A;  5KFE A;  2LYH A;  1XSN A;  1XWL A;  2Q0Z X;  1RXW A;  4O9M A;  7ICN A;  3BQT A;  4EZ9 A;  3V7J A;  5KFC A;  4MF2 A;  5CA7 A;  5J2A A;  1D9D A;  3BJY A;  4F5O A;  3ETL A;  1QSS A;  8ICF A;  4DOB A;  1DGS A;  4ED6 A;  4QZF A;  4QZ9 A;  2F1I A;  4DEZ A;  2UVV A;  4B9U A;  1ZQB A;  1NK0 A;  1XC9 A;  4ED1 A;  1K1Q A;  3V7K A;  3IHQ B;  2HHT A;  3RJK A;  4KLL A;  3PML A;  4J9P A;  8ICC A;  5DBC A;  2XO7 A;  3RB0 A;  4ED8 A;  1RYS A;  3ZDA A;  1ZQP A;  5DB6 A;  5DB9 A;  4RUC A;  3LWM A;  2ZTE A;  4KN4 A;  4QZC A;  3RJH A;  1L3T A;  4I27 A;  4RQ2 A;  3QE9 Y;  2BCQ A;  2ZTD A;  4QWE A;  5KFK A;  4KLT A;  5J2K A;  4PPX A;  3V6K A;  3ISD A;  1SL0 A;  2FMS A;  2P6U A;  1QSY A;  4M04 A;  9ICU A;  3RB4 A;  5DG8 A;  8ICU A;  8ICS A;  2PI4 A;  3M8S A;  4KLU A;  4J9R A;  3ZDD A;  3JPR A;  4UQG A;  4XQ8 A;  1CUK A;  4PGQ A;  2ASD A;  4J9K A;  2ZUC A;  1ZQL A;  4C8N A;  3TFS A;  1A77 A;  1KFS A;  4F2R A;  1U49 A;  2VA3 A;  2ISP A;  3THV A;  4P4P A;  2W9A A;  4FS2 A;  4KLE A;  2FMP A;  3SI8 A;  5KFZ A;  1UA0 A;  4B9V A;  3M9M B;  2XY6 A;  4EYI B;  2UVW A;  1BPE A;  4YR0 A;  2W9C A;  2BCV A;  4O3S A;  2XY7 A;  2V4Q A;  4DSJ A;  4M9G A;  4Z6C A;  2IHM A;  4ECT A;  5KFV A;  4GC7 A;  3C2L A;  4RQ3 A;  3ZDE A;  5DDY A;  4EBC A;  3Q8L A;  4ECU A;  2XGQ A;  3V72 A;  3HPO A;  3H8J A;  2M9N A;  4C8L A;  4IRK A;  5KT4 A;  4M9L A;  4F3O A;  3PX6 A;  1Z00 B;  2C22 A;  4B9M A;  1D8Y A;  2PI5 A;  2BDP A;  1S0O A;  1Z00 A;  5J0R A;  1L3V A;  4KLS A;  4KLO A;  1T8E A;  2JEF A;  4DQS A;  3RJE A;  7ICO A;  5KFN A;  1QTM A;  2KTQ A;  1ZQJ A;  4RQ6 A;  5DQG A;  4GC6 A;  3PW7 A;  4O3O A;  8ICW A;  3C5G A;  4ECR A;  2W9B B;  4PHP A;  2ASJ A;  4ELV A;  3MDC A;  4GXJ A;  4I2E A;  4UB2 A;  5BOM A;  3RRG A;  3B0X A;  1HJP A;  4I2G A;  4F8R A;  1Z3E B;  9ICG A;  5DB7 A;  3PMN A;  1UT5 A;  1UT8 A;  5J2J A;  4Z6D A;  8ICT A;  4R64 A;  5F9L A;  1NJY A;  1JXL A;  5HNK A;  3AUO A;  1X9M A;  4GLX A;  3T5L A;  4UB3 A;  4QWC A;  4IQW A;  9ICB A;  4IQV A;  3C1Z A;  4B9L A;  4O0I A;  4DQI A;  3H8S A;  1QSL A;  3LDA A;  2FLL A;  4QZI A;  1XS9 D;  5CWR A;  1MQ2 A;  4P4O A;  3SYZ A;  3PVX A;  4YFK A;  1BPB A;  4YR2 A;  9ICV A;  5L1L A;  5IIM A;  3UXN A;  2KFN A;  4RQ8 A;  4TUS A;  2VA8 A;  1HUO A;  4RQ5 A;  2XGP A;  3RJG A;  4QZH A;  2W9M A;  2BCU A;  4YD1 A;  1BGX T;  7ICG A;  3RAX A;  2ZTC A;  3UPQ A;  3Q8Q B;  4NLG A;  3TAP A;  5IIJ A;  4PH5 A;  4DF4 A;  3NGD A;  4RPX A;  5IIN A;  1KRP A;  4ZH4 A;  4UAZ A;  4DOA A;  7ICQ A;  3RR8 A;  4UBB A;  2R8J A;  2BKE A;  1ZQC A;  3GIJ A;  3QEB Z;  2JEG A;  2HHU A;  2KN7 A;  2ASL A;  4KLD A;  4O3R A;  8ICA A;  4QZA A;  3GIK A;  1B22 A;  1ZJN A;  2NRZ A;  4RPY A;  7ICH A;  3PY8 A;  9ICH A;  4IR9 A;  2FPK A;  5CR0 A;  4Q8F A;  1A76 A;  4BWM A;  4C8O A;  1ZYQ A;  1S76 D;  1ZQE A;  5DBB A;  3G6Y A;  1XSP A;  2GWS A;  4RT2 A;  4Z6E A;  4F5R A;  4O3P A;  4R8U B;  4EEY A;  4DF8 A;  2PXI A;  3Q8K A;  4KLJ A;  3H4B A;  3QZ8 A;  2KFZ A;  5KFS A;  1N56 A;  7ICJ A;  2AJQ A;  5KFA A;  1RYR A;  1B43 A;  4KLH A;  4KLM A;  3PV8 A;  5J2C A;  1ZET A;  9ICQ A;  1KDH A;  4R65 A;  3RJF A;  3C1Y A;  3MAB A;  3ISB A;  4F50 A;  3TAR A;  2OWO A;  4Z6F A;  7ICR A;  5KG5 A;  3MFI A;  5BPC A;  9ICO A;  1SL2 A;  4BWJ A;  5D49 A;  3GV5 B;  4F4X A;  5D46 A;  1SKR A;  2R8K A;  4M0A A;  4K4G A;  1U48 A;  4EBE A;  3GIM A;  4DSF A;  1NK9 A;  3PR4 A;  2HVH A;  4NXZ A;  4DLE A;  2NRT A;  5DBA A;  4TQS A;  2Y1J A;  1NJW A;  4QW9 A;  3RBD A;  4I29 A;  4YXM A;  5DQI A;  7ICU A;  5J0W A;  2VA2 A;  1TFR A;  5KG2 A;  4QW8 A;  2HW3 A;  2F1H A;  5DQH A;  5KFW A;  3JPO A;  1XO1 A;  3ZDB A;  2BPG A;  1L5U A;  2BCS A;  2ZJ5 A;  3LK9 A;  5J2F A;  3OJS A;  5DG9 A;  3T5J A;  2BR0 A;  1H38 A;  2IBK A;  4DSE A;  3HP6 A;  2J6U A;  5DKW A;  3OJU A;  5J2D A;  4IQT A;  3ZD8 A;  1ZQG A;  4EBD A;  2R8I A;  2FLN A;  9ICE A;  3IM1 A;  4O3N A;  4ELU A;  3K75 D;  4C8K A;  4QZ8 A;  3KHG A;  3PNC A;  5HP4 A;  4UAY A;  3GFK B;  8ICQ A;  3SV3 A;  4J9O A;  4I2C A;  4JV0 A;  2NRW A;  1X2I A;  5KG6 A;  4BGD A;  4R66 A;  4ED7 A;  3H7I A;  1S97 A;  3EW9 A;  4M6W B;  1S9F A;  4P2H A;  1K1S A;  5L1I A;  2P6R A;  2ZUD A;  4NM2 A;  4M6W A;  1ZQK A;  5CJ7 A;  8ICP A;  5KFO A;  2ATL A;  4KLQ A;  5J2G A;  4QZG A;  4DWI A;  4MFA A;  3H40 A;  1ZQO A;  5EWE A;  3JPS A;  3OHB A;  2W9C B;  4ECQ A;  4K4I A;  3TAN A;  1ZQR A;  8ICO A;  4ECY A;  5DGA A;  1T4G A;  5KFY A;  3OSP A;  4MFF A;  1IM4 A;  4TUR A;  3KHH A;  8ICR A;  1ZQV A;  5KG7 A;  5KFD A;  3G6V A;  4DO9 A;  4DL7 A;  3MGI A;  5JUM A;  2WTF A;  5J2H A;  2DFL A;  4UB1 A;  1BPX A;  1X9S A;  4DSI A;  1ZQU A;  5IIO A;  2F1J A;  3MR6 A;  1WCN A;  4F93 B;  2AGP A;  4P4M A;  2IMW P;  1NK5 A;  7ICM A;  4DL4 A;  5DB8 A;  4Q45 A;  3UXO A;  4UAW A;  4QWD A;  3EYZ A;  4PHA A;  8ICG A;  3FYH A;  4QZE A;  3UQ0 A;  9ICJ A;  4F4Z A;  1S0N A;  1ZQD A;  4F4K A;  3HWT A;  4DFP A;  4DQP A;  3MDA A;  2AGO A;  4Q8E A;  5KFU A;  5HHH A;  5KFM A;  2C28 A;  1SKS A;  1NK6 A;  5J0T A;  4J9Q A;  1ZQA A;  4PHE A;  4O5C A;  5KFB A;  4RT3 A;  3PW5 A;  5DGB A;  1ZQM A;  7ICP A;  4QZB A;  4DL6 A;  3OSN A;  5DG7 A;  1JX4 A;  4F92 B;  4YD2 A;  4DS5 A;  2XCA A;  4RQ7 A;  4YP3 A;  1ZJM A;  1TKD A;  4TQR A;  1D9F A;  4RQ4 A;  2P66 A;  4MEX A;  8ICK A;  1SKW A;  4EZ6 A;  4MFC A;  5KFG A;  4J9N A;  4Q43 A;  2IA6 A;  1KSP A;  1ZQY A;  3K4G A;  3KHR A;  1RXV A;  3T3F A;  1KEJ A;  5CB1 A;  4QWB A;  3EWA A;  1ZQI A;  1RPL A;  3TQ1 A;  4DS4 A;  1MC8 A;  4DFK A;  3QZ7 A;  4NY8 A;  2AGQ A;  4I2H A;  3UQ2 A;  8ICY A;  3KTQ A;  5KFL A;  4F91 B;  2KZZ A;  1TVA A;  4ELT A;  1ZQF A;  2AQ0 A;  2BCR A;  3RAQ A;  2MUT B;  1IXR A;  4KLG A;  4FO6 A;  2MUT A;  1KTQ A;  1RZT A;  2JZB A;  1C7Y A;  7ICI A;  5CHG A;  2V9W A;  2ALZ A;  4YMO A;  9ICX A;  2C2R A;  1U4B A;  3RB6 A;  3EZ5 A;  3G6X A;  4C8M A;  4F2S A;  4ED2 A;  3ORY A;  4B9S A;  4DSL A;  3OGU A;  3RR7 A;  2HHW A;  2BPC A;  1PZN A;  1NK4 A;  1L3U A;  2ISO A;  9ICM A;  4KN7 A;  4JWM A;  4TUQ A;  2XCP A;  3Q8S B;  1TV9 A;  1V9P A;  4YMM A;  4JWN A;  4FS1 A;  3PX0 A;  5KFR A;  2PFP A;  4NLN A;  4MEY A;  3MR3 A;  4X5V A;  2JEI A;  4M47 A;  5KG3 A;  5J29 A;  3OHA A;  1D8L A;  3H4D A;  8ICX A;  1Y88 A;  1TAQ A;  9ICT A;  4O5K A;  5J0X A;  4DOC A;  4DL2 A;  5J0U A;  1N48 A;  4JUZ A;  2ZJ8 A;  4RNN A;  3SV4 A;  5III A;  3SZ2 A;  2PFO A;  7ICL A;  4ECS A;  4DQQ A;  4KIT B;  2VAN A;  3BQ1 A;  4RUA A;  2W8L A;  2JEJ A;  4O3Q A;  3B0Y A;  1NJX A;  3JPN A;  5L1K A;  1NKB A;  4MF8 A;  2W8K A;  1QLN A;  4I2D A;  3JPP A;  4F4Y A;  7ICT A;  3HT3 A;  4ECW A;  4RNM A;  5KG1 A;  3T5K A;  2B21 A;  4PHD A;  4YQW A;  8ICM A;  4RPZ A;  4KLF A;  3TAQ A;  4E0D A;  5KFP A;  3E2E A;  1BPY A;  1MSW D;  7ICK A;  3RTV A;  3C5F A;  2RDJ A;  1U47 A;  2FMQ A;  4YG2 A;  5L9X A;  4I2J A;  4DFM A;  2NRX A;  3TFR A;  4DSK A;  8ICI A;  4CCH A;  3RBE A;  3LWL A;  1EXN A;  3PW2 A;  4F5Q A;  2KZM A;  3MGH A;  4ECZ A;  4M9J A;  4XA5 A;  4HYK A;  3M9O B;  4RU9 A;  5J0S A;  2I1Q A;  8ICL A;  1ZQZ A;  7ICV A;  3EPG A;  4Q44 A;  3EPI A;  2DPI A;  1T7P A;  2IHN A;  5IIK A;  4F5P A;  5KFT A;  5BOL A;  5KFF A;  3AU6 A;  4I28 A;  8ICE A;  9ICF A;  4G3I A;  4PGX A;  1UA1 A;  3PR5 B;  1BPZ A;  9ICR A;  5D4B A;  5EWG A;  1JN3 A;  2MAX A;  4BXO B;  3HW8 A;  2PFN A;  2J6S A;  4I2I A;  4XUS A;  4GXK A;  1ZQN A;  1TK0 A;  3M8R A;  4QWA A;  4BXO A;  4KTQ A;  3C21 A;  3JPT A;  3BQ2 A;  4F5N A;  1TK5 A;  2BQU A;  4GXI A;  4DQR A;  2UVR A;  4TUP A;  5EWF A;  3HX0 A;  3Q8M A;  4BDP A;  3RRH A;  1JIH A;  4YR3 A;  1ZQT A;  4LZG A;  5KT2 A;  4I2A A;  3ISC A;  3V6H A;  9ICL A;  3FDS A;  5KT5 A;  4IRC A;  2FPL A;  3RB3 A;  5EOZ A;  1NKC A;  3TI0 A;  3RJI A;  2BPF A;  3BDP A;  3MBY A;  4J9L A;  4KLI A;  4EYH B;  5KFI A;  5KT3 A;  3AU2 A;  4KMU A;  4FBT A;  1NK8 A;  2Y1I A;  9ICW A;  3GDX A;  5KFQ A;  1S77 D;  3N4M B;  2C2E A;  5TZV A;  5KG0 A;  3MFH A;  8ICN A;  3T5H A;  5F9N A;  1KFD A;  4B9T A;  2HHS A;  1MQ3 A;  2HHQ A;  3JPQ A;  1ZQX A;  5KT6 A;  1ZQH A;  5L1J A;  1SL1 A;  2DPJ A;  4JV1 A;  8ICB A;  1KFT A;  1TAU A;  1XSL A; 
#chains in the Genus database with same CATH topology
 2R8H A;  2W55 A;  4XRH A;  1S0V A;  4UB4 A;  2KHV A;  3C2M A;  2RDI A;  2A3V A;  2LYB A;  2KG5 A;  3SAF A;  4OJO A;  3BQ0 A;  1DK2 A;  1N60 A;  4UBC A;  3ONN A;  2BQ3 A;  1BVS A;  5JTI A;  5AKY A;  4M9H A;  8ICH A;  4I2B A;  5J0P A;  3PW0 A;  5ALG A;  1KLN A;  3IDW A;  1WWV A;  5DDM A;  9ICC A;  4ED3 A;  4LVS A;  2A1J A;  2PMZ C;  2ZIW B;  4YCX A;  4QZD A;  2KIW A;  1JXE A;  4F4W A;  1NI3 A;  9ICP A;  4WJ3 B;  3KD3 A;  5AIA A;  3Q8R B;  4IR1 A;  4O3M A;  2HVI A;  2ZXH A;  3RH6 A;  1BPD A;  4AP9 A;  4M2Y A;  3UXP A;  1DOQ A;  5C5J A;  5HML A;  2AQ4 A;  2E8P A;  5DLF A;  2VJ4 A;  2UVU A;  2LM4 A;  3C23 A;  2XIC A;  2OXO A;  2R8G A;  1YT3 A;  2DGZ A;  2QKQ A;  1RXW A;  2H3Q A;  3KZI U;  3L4P A;  3QU2 A;  4O9M A;  5KFC A;  2W7P A;  4MF2 A;  1D9D A;  1LKY A;  4Y2T A;  5AM2 A;  2KEY A;  2LKY A;  3KFU F;  4B9U A;  4UAV A;  2HHT A;  2RLT A;  4P0Q B;  3RJK A;  4ED8 A;  1RYS A;  5DB6 A;  5ALJ A;  4I27 A;  4QWE A;  5J2K A;  1SL0 A;  3DEE A;  2ZIU B;  2F77 X;  5ALR A;  5DG8 A;  1COK A;  3ED5 A;  2PI4 A;  1CUK A;  4PGQ A;  1Q3V A;  2ZUC A;  3D6J A;  3BZC A;  3QX7 A;  2ISP A;  4P4P A;  3O0F A;  2FMP A;  5KFZ A;  3K1Z A;  3D2S A;  2XY6 A;  2UVW A;  3QUC A;  2IOF K;  2W9C A;  4O3S A;  4Z6C A;  2F76 X;  4NL9 C;  1KN5 A;  3C2L A;  2VKQ A;  4IRK A;  2HSZ A;  2K8C B;  5KT4 A;  3PX6 A;  2C22 A;  4F71 A;  1D8Y A;  2ZIV A;  2PI5 A;  1OW5 A;  5J0R A;  5ALP A;  3NRW A;  7ICO A;  5KFN A;  1WWU A;  3PW7 A;  3C5G A;  4ECR A;  4ELV A;  4PHP A;  4P0P B;  3MDC A;  3RRG A;  5BOM A;  1IIP A;  3ICX A;  2K4H A;  1Z3E B;  2G09 A;  3PMN A;  2RRD A;  4Z6D A;  4R64 A;  1JXL A;  1PK1 A;  4QWC A;  5AIB A;  4IQV A;  3C1Z A;  3H8S A;  1DXS A;  1N61 A;  3SYZ A;  3PVX A;  3BS5 B;  4YFK A;  5IIM A;  1HUO A;  2VA8 A;  3OTQ A;  4FZM A;  2XGP A;  3RJG A;  4YD1 A;  5GTI U;  2E8O A;  2ZTC A;  2HDO A;  1SXD A;  3TAP A;  2D3D A;  3NGD A;  4Y2J A;  3RR8 A;  4A8E A;  3FC4 A;  1ZJN A;  2NRZ A;  9ICH A;  4IR9 A;  2R18 A;  1ZQE A;  1RQN A;  1XSP A;  4RT2 A;  4R8U B;  3LVW A;  3Q8K A;  4KLJ A;  3QZ8 A;  2CRX A;  1B43 A;  4KLH A;  4NJ8 A;  1KDH A;  4R65 A;  3RJF A;  3C1Y A;  3ISB A;  4UB8 U;  7ICR A;  3MFI A;  9ICO A;  4CF5 A;  4BWJ A;  5D49 A;  2R8K A;  1QH9 A;  5ALX A;  3HRD D;  1QCK A;  5C0Y A;  1QQ7 A;  1NK9 A;  3PR4 A;  3DDH A;  5DBA A;  3NVZ A;  3UMC A;  4QW9 A;  2VA2 A;  1TFR A;  2HW3 A;  5DQH A;  4ICA A;  3JPO A;  2BPG A;  2DWQ A;  2ZIX B;  4OCZ A;  2BCS A;  2ZJ5 A;  2F2A B;  5J2F A;  3UMB A;  1Q8K A;  5JU5 A;  2IBK A;  3TAC B;  4NLB A;  1Q3U A;  2W3S A;  1K5O A;  3ZD8 A;  9ICE A;  3LYS A;  1SB3 C;  1X40 A;  1JRO A;  5ALL A;  4C8K A;  4QZ8 A;  3SV3 A;  4I2C A;  5KG6 A;  4BGD A;  3H7I A;  3EW9 A;  4P2H A;  2A1A A;  5ALD A;  3GU3 A;  2ATL A;  4Y2S A;  1ZQO A;  8ICO A;  1UHU A;  1SGG A;  5DGA A;  4MFF A;  3KHH A;  3G6V A;  3L3F X;  4DO9 A;  2LYA A;  4OJ6 A;  5DB8 A;  3EYZ A;  8ICG A;  2OHF A;  3TKA A;  4DFP A;  3A0B U;  3B9J A;  2AGO A;  4Q8E A;  5KFU A;  2C28 A;  1SKS A;  1NK6 A;  5J0T A;  2MSN A;  5KFB A;  4RT3 A;  1WYG A;  5DGB A;  4QZB A;  5AKJ A;  4YD2 A;  4DS5 A;  2XCA A;  1P7D A;  4BJQ A;  1OUQ A;  4TQR A;  5G5H A;  3KHR A;  1RXV A;  1KEJ A;  4QWB A;  2Y9U A;  1RPL A;  4DS4 A;  3KKA A;  4EX6 A;  4I2H A;  3OPX A;  4PL2 A;  3UQ2 A;  1TVA A;  1JI7 A;  2MUT B;  1SZH A;  1B4F A;  4C7Z A;  4YMO A;  3RB6 A;  3RR7 A;  1NK4 A;  2ISO A;  9ICM A;  4C0Z A;  3RFA A;  1SV0 A;  5AI8 A;  4FS1 A;  2PFP A;  1L7P A;  4MEY A;  3MR3 A;  2JEI A;  4DL2 A;  4KIT B;  2W8L A;  2JEJ A;  3JPP A;  4F4Y A;  4QIW C;  4YQW A;  3M6K A;  3E2E A;  3RTV A;  3K1R B;  3AQF A;  2KIV A;  1RG6 A;  4DSK A;  4CCH A;  3RBE A;  2QB1 A;  5AK5 A;  2F44 A;  4XA5 A;  4PZO A;  4RU9 A;  4OJL A;  2EZX A;  2HBJ A;  1D8B A;  3IV6 A;  3SEI A;  3AU6 A;  2GLE A;  4G3I A;  2IOF A;  5AHX A;  3NAS A;  1JN3 A;  4BXO B;  3HW8 A;  4I2I A;  3WK8 A;  1ZQN A;  4GXK A;  5H2F U;  2KKV A;  4UAT A;  2K60 A;  2LHT A;  3Q8M A;  1ZQT A;  3ISC A;  5EE3 A;  3RB3 A;  3SR6 A;  3N7S C;  1V38 A;  1NKC A;  3RJI A;  4EYH B;  2MU2 A;  3AU2 A;  4KMU A;  4FBT A;  1NK8 A;  5KFQ A;  2HOI A;  5AKE A;  2KIC A;  5KG0 A;  5ALH A;  1KFD A;  1MQ3 A;  5KT6 A;  8ICB A;  2DPJ A;  1Z4O A;  1ZD5 A;  1ZQW A;  4JK1 A;  3UM9 A;  3WKC A;  1LB2 B;  2FE9 A;  1U9L A;  2W43 A;  4BUG A;  1NK7 A;  2J6T A;  4RNO A;  1TK8 A;  9ICN A;  2Y9T A;  5HHI A;  5JRT A;  4RQ1 A;  1ZQQ A;  1N62 A;  3WKE A;  4B9N A;  3MR2 A;  3SQI A;  1HUZ A;  2HHV A;  5KFJ A;  3PW4 A;  3RH5 A;  2JZB B;  2BQR A;  1J97 A;  1WCL A;  2G5H B;  2A1J B;  3AL0 B;  4NM1 A;  5KTQ A;  5ALQ A;  5J2B A;  4YXJ A;  5KG4 A;  4LZD A;  3IRU A;  2I5H A;  2EAN A;  3I1Y A;  1S0M A;  5HMM A;  1NKE A;  4U6P A;  1LV5 A;  4YVZ A;  2E5S A;  3HKZ F;  1SV4 A;  5IIL A;  1KQQ A;  2NRV A;  5J8Y A;  5KFH A;  4IQU A;  1M6Y A;  3GII A;  2ZG6 A;  9ICS A;  2KZ3 A;  5ALY A;  2HHX A;  3V6J A;  4PGY A;  3M9N B;  4YN4 A;  5DLG A;  2LYH A;  1XWL A;  2W03 A;  3BQT A;  5CA7 A;  1LKY B;  5J2A A;  2HOF A;  3BJY A;  4F5O A;  8ICF A;  4DOB A;  1DGS A;  4ED6 A;  1L8O A;  2B0C A;  4QZ9 A;  2MRL A;  1XC9 A;  4ED1 A;  2WAQ C;  5DBC A;  3J81 j;  3RB0 A;  4KMO B;  5AM4 A;  1ZQP A;  3LWM A;  3NVY A;  5AKH A;  4ACO A;  2KHQ A;  4PPX A;  3V6K A;  2FMS A;  1QSY A;  9ICU A;  3RB4 A;  2HBK A;  3M8S A;  4KLU A;  2G5I B;  2ASD A;  1A77 A;  2VA3 A;  2KMD A;  3THV A;  4FS2 A;  1F44 A;  2EZY A;  2XY7 A;  4LJX A;  4DSJ A;  3QU9 A;  4ECT A;  4GC7 A;  4RQ3 A;  3ZDE A;  5DDY A;  5A0L A;  3Q8L A;  4C4S A;  4ECU A;  2XGQ A;  3HPO A;  3H8J A;  2M9N A;  1PVP A;  1VDV A;  2BDP A;  4UAR A;  1Z00 A;  5ALZ A;  2JEF A;  4DQS A;  5G5G A;  2KTQ A;  5AKI A;  5DQG A;  4GC6 A;  8ICW A;  2W9B B;  2ASJ A;  5AI9 A;  4UB2 A;  2DUY A;  4I2G A;  1X6J A;  2VIX A;  5J2J A;  1PK1 B;  1NJY A;  4UB3 A;  9ICB A;  1KL9 A;  5ALI A;  3QU7 A;  5CWR A;  4P4O A;  2L5Y A;  4EEL A;  1KKX A;  3IG8 A;  2YY6 A;  3UXN A;  2W9M A;  7ICG A;  3RAX A;  3UPQ A;  4ZOH C;  4DF4 A;  1KRP A;  4UAZ A;  4DOA A;  3FM9 A;  4UBB A;  2R8J A;  2BKE A;  1ZQC A;  3GIJ A;  2HHU A;  2ASL A;  4KLD A;  8ICA A;  3GIK A;  3GZF A;  4HAI A;  2ES6 A;  2FPK A;  5EE1 A;  2KVS A;  3DV9 A;  5DBB A;  2GWS A;  4EEY A;  2PXI A;  4USA A;  3A0H U;  2KFZ A;  5J2C A;  3MC1 A;  3MAB A;  3TAR A;  4F50 A;  5BPC A;  4NL9 A;  4PL1 A;  4F4X A;  1A0P A;  5D46 A;  1IV8 A;  4DLE A;  4NXZ A;  2F3N A;  1AQ6 A;  4YXM A;  7ICU A;  3M1Y A;  5HR6 A;  3IN5 A;  2XVT A;  4AYB F;  3OJS A;  3CRX A;  4IC9 A;  3HP6 A;  2J6U A;  3SEN A;  3BZK A;  4RQN A;  3WK7 A;  1ZQG A;  4EBD A;  2R8I A;  3IM1 A;  4ELU A;  3KHG A;  5HP4 A;  3AEV A;  1PUZ A;  4JV0 A;  1TAM A;  5L1I A;  2K4I A;  4DWI A;  3H40 A;  5EWE A;  1IM4 A;  4TUR A;  2EAO A;  5KG7 A;  4DL7 A;  3MGI A;  2WTF A;  5J2H A;  2DFL A;  1Z1V A;  3MR6 A;  4F93 B;  2AGP A;  5ALS A;  1JUD A;  3CYM A;  4PHA A;  3UQ0 A;  4QZE A;  1S0N A;  1ZQ1 C;  2KSO B;  5HHH A;  5KFM A;  5AI5 A;  4EEN A;  5KAI U;  4PJ0 U;  5AKK A;  4F92 B;  1JX4 A;  2KNJ A;  3QYP A;  1VLB A;  1D9F A;  4RQ4 A;  1SKW A;  4Q43 A;  3ETR A;  3EWA A;  3TQ1 A;  2XID A;  1MC8 A;  3QZ7 A;  2CPR A;  2NV3 A;  5KFL A;  4F91 B;  2OH2 A;  4DCC A;  4CGZ A;  3RAQ A;  4U7C A;  4FO6 A;  1KTQ A;  3NVV A;  7ICI A;  1XO0 A;  1C20 A;  1J2N A;  1WG8 A;  2V9W A;  2W11 A;  2Y0S F;  5AK6 A;  4ED2 A;  3I28 A;  1RQL A;  2YX8 A;  4DSL A;  2YTU A;  2ZIW A;  3AM9 A;  1L3U A;  4JWM A;  1TV9 A;  4YMM A;  3PX0 A;  4NLN A;  3BQ7 A;  5KFR A;  4X5V A;  4CE6 A;  5J29 A;  1D8L A;  3QUQ A;  1Y88 A;  4UB6 U;  9ICT A;  4O5K A;  4B6J A;  5J0U A;  1N48 A;  5AM1 A;  4RNN A;  3SV4 A;  3SZ2 A;  5ALN A;  2JMG A;  4ECS A;  5KL1 B;  5EE0 A;  4RUA A;  4QNL A;  1NJX A;  1NKB A;  4CF4 A;  4MF8 A;  4I2D A;  3D2Q A;  5KG1 A;  2B21 A;  4RPZ A;  4KLF A;  2E1E A;  1X66 A;  2P35 A;  3C5F A;  3TAD C;  4DFM A;  2K89 A;  2NRX A;  1LVH A;  1EXN A;  4F5Q A;  2DQN B;  4OO1 J;  4ECZ A;  4HYK A;  5J0S A;  3EPG A;  3CP8 A;  1T7P A;  5IIK A;  4F5P A;  5AM0 A;  1V97 A;  2GO7 A;  1BPZ A;  2B6G A;  1BNP A;  1JAL A;  3M8R A;  4QWA A;  2G07 A;  4DQR A;  3C29 A;  4TUP A;  3D2N A;  1SWV A;  3HX0 A;  1X6I A;  3RRH A;  1JIH A;  4YR3 A;  3V6H A;  3FDS A;  5EOZ A;  2BPF A;  3BDP A;  4KLI A;  3MBY A;  2QAR A;  2K8B B;  3N4M B;  2E1F A;  2OYY A;  3MFH A;  4B9T A;  1ZQX A;  1SL1 A;  4JV1 A;  1KFT A;  1XSL A;  9ICA A;  3RJJ A;  3WU2 U;  2AH5 A;  2FPM A;  3KHL A;  4J9M A;  2XC9 A;  5T14 A;  8ICV A;  3H0L B;  1SZP A;  4DL5 A;  2W04 A;  1T3N A;  2FI1 A;  1GO3 F;  4R63 A;  8ICJ A;  5KFX A;  4O5E A;  7ICF A;  7ICE A;  2IOH A;  2ZUB A;  5EE9 A;  5KT7 A;  1ZQS A;  3WK6 A;  2K4P A;  1FEZ A;  1CEZ A;  2PMZ F;  3Q8P B;  2YN4 A;  3PO4 A;  3AMZ A;  4Y2P A;  2AU0 A;  3F5E A;  1U45 A;  3RH4 A;  5CP2 A;  5ALE A;  4RQ0 A;  2LPE A;  2BHN A;  2GOL A;  4ECV A;  1B0X A;  2F8K A;  4NLZ A;  3PSI A;  1XU4 A;  1NZP A;  2PFQ A;  3PX4 A;  4R8U A;  1S8O A;  1NJZ A;  4ECX A;  4JB3 A;  3GV8 B;  4ED0 A;  3M6Z A;  4IRD A;  1XSN A;  1HIW A;  4EZ9 A;  3V7J A;  5ALF A;  3ETL A;  4DFD A;  4F72 A;  3NRZ A;  2F1I A;  4DEZ A;  1L8L A;  4NLC A;  1NK0 A;  1K1Q A;  4Y2X A;  1PK3 A;  4J9P A;  8ICC A;  2XO7 A;  3VC8 A;  3NVW A;  1X9X A;  2ZTE A;  4KN4 A;  4QZC A;  2NYV A;  4BX9 C;  3RJH A;  1L3T A;  4RQ2 A;  2ZTD A;  5ALO A;  4KLT A;  3PSP A;  3ISD A;  2P6U A;  8ICS A;  4J9R A;  1N5X A;  2KJ9 A;  3JPR A;  3ZDD A;  4UQG A;  4XQ8 A;  4J9K A;  1ZQL A;  5KAF U;  4US9 A;  1KFS A;  1U49 A;  1UA0 A;  3M9M B;  3F2C A;  4C7Y A;  1BPE A;  4NWI A;  4YR0 A;  2BCV A;  2ESE A;  2AHO B;  5HR7 A;  5KFV A;  1T3Q A;  4EBC A;  4UW9 A;  3V72 A;  4C8L A;  4F3O A;  1Z00 B;  3H8M A;  5KNI A;  1ZRN A;  4KLS A;  1T8E A;  1QTM A;  1ZQJ A;  4RQ6 A;  4O3O A;  4I2E A;  3B0X A;  4F8R A;  3WKB A;  5DB7 A;  1UT8 A;  8ICT A;  3KBB A;  5HNK A;  3T5L A;  1MN8 A;  2EZZ A;  4O0I A;  4DQI A;  2E8M A;  3LDA A;  4QZI A;  1MQ2 A;  1BPB A;  5L1L A;  2KFN A;  2JXJ A;  4RQ8 A;  5AKZ A;  4QZH A;  2BCU A;  1BGX T;  1XNS A;  1Z4N A;  3Q8Q B;  5IIJ A;  3N7R C;  5IIN A;  2YB1 A;  1SWW A;  3QEB Z;  2JEG A;  2JHD A;  2KN7 A;  4O3R A;  2I6X A;  1B22 A;  5TIS U;  4RPY A;  7ICH A;  3PY8 A;  4EEK A;  1A76 A;  1UPH A;  4C8O A;  1ZYQ A;  3SMV A;  2FDR A;  4Z6E A;  4F5R A;  4O3P A;  4DF8 A;  3H4B A;  5KFS A;  4MHV A;  1N56 A;  2AJQ A;  5KFA A;  1RYR A;  2H3I A;  4FZL A;  2VJ5 A;  2K4E A;  1SL2 A;  3PST A;  4K4G A;  4EBE A;  3GIM A;  2W3R A;  2HVH A;  5F3X B;  2NRT A;  1RYU A;  4TQS A;  2Y1J A;  1NJW A;  4I29 A;  5DQI A;  5J0W A;  5KG2 A;  4QW8 A;  5KFW A;  1DK3 A;  2BZF A;  1XO1 A;  3ZDB A;  1T94 A;  2YQE A;  4FZN A;  1L5U A;  3LK9 A;  2BR0 A;  5DG9 A;  3T5J A;  4G9B A;  4DSE A;  3OJU A;  5J2D A;  2H3V A;  1URJ A;  3K75 D;  5AI4 A;  1CRX A;  2EQY A;  4J9O A;  2NRW A;  3WK9 A;  1S97 A;  3PSF A;  1S9F A;  2F8L A;  4M6W A;  5CJ7 A;  3VCB A;  2Z7J A;  5AM3 A;  4IS7 A;  4KLQ A;  2M0N A;  1YZ7 A;  4MFA A;  3JPS A;  3OHB A;  2W9C B;  4ECQ A;  1RDF A;  2N1R A;  1ZQR A;  1YZ6 A;  4K4I A;  4ECY A;  1T4G A;  2E8N A;  5KFY A;  3OSP A;  5AK4 A;  1DRG A;  1Z1B A;  2RQ5 A;  1UCV A;  8ICR A;  2ZIV B;  1X9S A;  4DSI A;  1ZQU A;  2QB0 A;  1TE2 A;  4Y2V A;  2IMW P;  2DL0 A;  2H3F A;  5AK3 A;  4Q45 A;  2HMX A;  3UXO A;  2RHF A;  9ICJ A;  2MA1 A;  1VJ5 A;  1ZQD A;  3NUQ A;  2G08 A;  2CN1 A;  1ZQA A;  7ICV A;  4DL6 A;  5DG7 A;  5E79 U;  3KZX A;  4OJP A;  1TKD A;  4YP3 A;  4MEX A;  4J9N A;  2CXY A;  4EX7 A;  1ZQY A;  3K4G A;  5CB1 A;  2OEH A;  4FE3 A;  1ZQI A;  3CW2 C;  4DFK A;  4NY8 A;  1ZQF A;  1ZXI A;  2BCR A;  5ALU A;  1RZT A;  2JZB A;  4FFD A;  5CHG A;  2ALZ A;  2C2R A;  1U4B A;  2YMP A;  3EZ5 A;  5B66 U;  3RF9 A;  3BS7 A;  2HHW A;  2JH1 A;  1NNL A;  1ZD4 A;  4KN7 A;  3Q8S B;  2KVC A;  4JWN A;  3R9K A;  2KD1 A;  5KG3 A;  5J0X A;  2JH7 A;  4DOC A;  5FP0 A;  2ZJ8 A;  2KK0 A;  7ICL A;  5L1K A;  1QLN A;  2K8A A;  7ICT A;  4QIW F;  3T5K A;  2KP7 A;  2WF5 A;  4PHD A;  3EUB 2;  4E0D A;  5KFP A;  7ICK A;  1BPY A;  3WKD A;  5AKL A;  1U47 A;  2FMQ A;  4YG2 A;  3WKA A;  3LWL A;  2D8C A;  3M9O B;  8ICL A;  4JMU A;  4Q44 A;  3EPI A;  2DPI A;  2JRZ A;  4I28 A;  2HCF A;  4PGX A;  3PR5 B;  5D4B A;  2PFN A;  2ZXI A;  4KX3 A;  4KTQ A;  1TK0 A;  1O03 A;  3JPT A;  4F5N A;  3H0R B;  2G0A A;  3IG5 A;  1BNO A;  4BDP A;  2OCE A;  9ICL A;  2FPL A;  2QAR B;  3N28 A;  4J9L A;  3E58 A;  5KT3 A;  9ICW A;  3GDX A;  2C2E A;  5TZV A;  1FIQ A;  5AIC A;  3JPQ A;  2KV2 A;  2HHQ A;  1ZQH A;  2FJ6 A;  4JV2 A;  4UB5 A;  2V4R A;  5J2I A;  3S6J A;  5ALW A;  3MR5 A;  3M7D A;  2W9B A;  1OXJ A;  3L5K A;  2C2D A;  4DLG A;  3NTU A;  4RZR A;  4YMN A;  3ZDC A;  2XI9 A;  9ICI A;  5J0Q A;  4K4H A;  2YML A;  4DFJ A;  3TAD A;  4NLK A;  3CNH A;  2ZJA A;  1S10 A;  3PZP A;  3PO5 A;  4QJF B;  1NOM A;  4FBU A;  1UQV A;  4C4R A;  2G06 A;  2WB1 F;  2FLP A;  3GIL A;  1COO A;  4M9N A;  1N2X A;  5K4L A;  7ICS A;  2KE7 A;  1L3S A;  9ICK A;  2HBM A;  2XY5 A;  2BGW A;  2I9G A;  2H3Z A;  3H8W A;  4I2F A;  5J0Y A;  2W54 A;  1NZB A;  4DL3 A;  1JMS A;  5J2E A;  3V7L A;  3C2K A;  3QXG A;  1ARO P;  4J9S A;  3GQC A;  3HKZ C;  3ZD9 A;  3N97 B;  2YB4 A;  4CRX A;  5J0O A;  3GV7 B;  3QEA Z;  1X9W A;  2HBL A;  2LBO A;  2H5X A;  8ICZ A;  2WF6 A;  7ICN A;  5KFE A;  2Q0Z X;  1F0M A;  3F53 A;  1ZOL A;  4UAS A;  4C4T A;  3QU4 A;  2WFA A;  2BDU A;  1QSS A;  4QZF A;  1RM6 C;  2UVV A;  1S5L U;  2WAQ F;  1ZQB A;  2KJ8 A;  3V7K A;  3IHQ B;  4KLL A;  3PML A;  4P0Q A;  3ZDA A;  5DB9 A;  4RUC A;  4CF3 A;  3WK5 A;  3QNM A;  3QE9 Y;  2BCQ A;  5KFK A;  4M04 A;  3AN1 A;  2ZIU A;  4Y2Q A;  4C8N A;  3TFS A;  4F2R A;  5L1M A;  3SAG A;  2W9A A;  4KLE A;  3SI8 A;  4B9V A;  1CI4 A;  4EYI B;  1L7M A;  2V4Q A;  4M9G A;  2IHM A;  4UAU A;  2PKE A;  3AQE A;  3ZI4 A;  4M9L A;  3HJE A;  4B9M A;  1S0O A;  2NO4 A;  1L3V A;  1J2M A;  4KLO A;  1KBU A;  3RJE A;  4GXJ A;  4P0P A;  1HJP A;  2WHE A;  9ICG A;  1UT5 A;  4C80 A;  8ICU A;  5F9L A;  5AKG A;  3AUO A;  1X9M A;  4GLX A;  2OM6 A;  2KSO A;  4IQW A;  4B9L A;  1QSL A;  2FLL A;  1XS9 D;  2D6F C;  2JV3 A;  1FFU A;  4YR2 A;  9ICV A;  3BS5 A;  1V85 A;  4TUS A;  4PZN A;  4RQ5 A;  3C28 A;  2JGA A;  5GTH U;  2GH1 A;  4NLG A;  4PH5 A;  4RPX A;  4ZH4 A;  4Y2Y A;  2EH9 A;  1Z19 A;  7ICQ A;  5AM5 A;  2EDU A;  4J03 A;  4QZA A;  5AI0 A;  4IL6 U;  5CR0 A;  4Q8F A;  4BWM A;  1N5W A;  1S76 D;  3G6Y A;  1PVR A;  2ODG A;  3HIL A;  3U26 A;  3F2D A;  2EAP A;  1DGJ A;  7ICJ A;  1O08 A;  4KLM A;  3PV8 A;  1L7O A;  1ZET A;  9ICQ A;  2OWO A;  4CDG A;  4Z6F A;  5KG5 A;  2YMM A;  3GV5 B;  1SKR A;  4M0A A;  3QUT A;  1U48 A;  4DSF A;  1JRP A;  2JR5 A;  3E0F A;  1ED1 A;  3FAH A;  3RBD A;  2F1H A;  2AXT U;  2WF7 A;  5AKX A;  2ZIX A;  2DKZ A;  3KKA C;  1H38 A;  3WK4 A;  4AYB C;  5DKW A;  5ALV A;  2A19 A;  4IQT A;  2FLN A;  2O6K A;  4O3N A;  2YMQ A;  5ALT A;  3PNC A;  1F5S A;  4UAY A;  3GFK B;  8ICQ A;  1IG6 A;  1X2I A;  4Y2R A;  1L7N A;  4R66 A;  1ZD3 A;  2HOQ A;  4ED7 A;  5AI6 A;  4M6W B;  1K1S A;  2P6R A;  2ZUD A;  4NM2 A;  1ZQK A;  8ICP A;  5KFO A;  3F5A A;  4GIB A;  5J2G A;  4QZG A;  1SV0 C;  2RP5 A;  3TAN A;  1FO4 A;  1L6N A;  2DKX A;  1ZQV A;  5KFD A;  2LMR A;  5JUM A;  1ZD2 P;  4UB1 A;  2QB0 B;  1BPX A;  4RQM A;  5IIO A;  2F1J A;  2WF9 A;  3SAH A;  1WCN A;  4P4M A;  7ICM A;  1NK5 A;  3UMG A;  2DBY A;  4DL4 A;  5CRX A;  1ECW A;  4UAW A;  4QWD A;  3FYH A;  4F4Z A;  3QUB A;  4F4K A;  3HWT A;  4DQP A;  3MDA A;  1SXE A;  1SIJ A;  4J9Q A;  4O5C A;  4PHE A;  7ICP A;  3PW5 A;  1ZQM A;  1WUD A;  3OSN A;  1ZJM A;  4RQ7 A;  2WF8 A;  2P66 A;  8ICK A;  3I76 A;  4EZ6 A;  4MFC A;  5KFG A;  2IA6 A;  1KSP A;  1Q46 A;  3T3F A;  5ALM A;  2DF4 B;  2AGQ A;  8ICY A;  3KTQ A;  4GFJ A;  2KZZ A;  4ELT A;  2EAM A;  2AQ0 A;  1IXR A;  4KLG A;  1X42 A;  1FFV A;  2MUT A;  3NS1 A;  4US8 A;  1C7Y A;  5CEH A;  9ICX A;  2KKP A;  3G6X A;  4C8M A;  2Y0S C;  4F2S A;  2WB1 C;  4OJ5 A;  5B5E U;  3ORY A;  3MGV A;  4B9S A;  1HEK A;  3OGU A;  2BPC A;  3QU5 A;  1PZN A;  5ALK A;  4TUQ A;  2XCP A;  3KOO A;  1V9P A;  4CNQ A;  2NO5 A;  4M47 A;  3OHA A;  3H4D A;  8ICX A;  1TAQ A;  4JUZ A;  3F2B A;  5III A;  3IP4 B;  4Y2U A;  2PFO A;  1PVQ A;  4DQQ A;  2VAN A;  3LVV A;  3BQ1 A;  3H0M B;  4OD0 A;  4O3Q A;  3B0Y A;  3JPN A;  2W8K A;  3HT3 A;  4ECW A;  4RNM A;  2LM1 A;  2KOB A;  8ICM A;  3TAQ A;  1MSW D;  2RDJ A;  5L9X A;  4I2J A;  3T79 A;  2Q4T A;  3TFR A;  8ICI A;  3PW2 A;  2KZM A;  2KJ5 A;  3MGH A;  3SD7 A;  3N7P D;  4M9J A;  2I1Q A;  1ZQZ A;  1ZRM A;  2IHN A;  5KFT A;  5BOL A;  5KFF A;  8ICE A;  9ICF A;  3ALR A;  1UA1 A;  9ICR A;  5EWG A;  2MAX A;  2J6S A;  4XUS A;  4BXO A;  3C21 A;  3BQ2 A;  1TK5 A;  1KW4 A;  4GXI A;  2BQU A;  2UVR A;  5EWF A;  2HI0 A;  2QLT A;  4LZG A;  5KT2 A;  4I2A A;  5J8Y C;  2W7O A;  4KX5 A;  4IRC A;  5KL8 B;  5KT5 A;  1QQ5 A;  1A6S A;  3TI0 A;  5KFI A;  1N63 A;  2Y1I A;  4NV0 A;  1S77 D;  8ICN A;  3T5H A;  5F9N A;  2LI6 A;  2HHS A;  1MA7 A;  1QQ6 A;  5L1J A;  2E3T A;  1TAU A; 
#chains in the Genus database with same CATH homology
 2R8H A;  1ZQW A;  9ICA A;  3RJJ A;  4JK1 A;  4XRH A;  4JV2 A;  4UB5 A;  2V4R A;  1S0V A;  1LB2 B;  4UB4 A;  3C2M A;  5J2I A;  2FPM A;  3MR5 A;  2RDI A;  3KHL A;  1U9L A;  4J9M A;  2XC9 A;  2W9B A;  8ICV A;  2C2D A;  4DLG A;  3NTU A;  3BQ0 A;  1SZP A;  4RZR A;  4YMN A;  4DL5 A;  3ZDC A;  1T3N A;  1NK7 A;  4UBC A;  2J6T A;  4RNO A;  1TK8 A;  9ICN A;  9ICI A;  4R63 A;  5HHI A;  5J0Q A;  4K4H A;  4RQ1 A;  1ZQQ A;  8ICJ A;  5KFX A;  4O5E A;  7ICF A;  4B9N A;  2BQ3 A;  7ICE A;  3MR2 A;  1BVS A;  4DFJ A;  1HUZ A;  2HHV A;  5KFJ A;  3PW4 A;  2ZUB A;  4NLK A;  4M9H A;  5KT7 A;  8ICH A;  2ZJA A;  1ZQS A;  5J0P A;  2JZB B;  3RH5 A;  1S10 A;  4I2B A;  2BQR A;  3PO5 A;  1WCL A;  1NOM A;  4FBU A;  3PW0 A;  1KLN A;  5DDM A;  1CEZ A;  2FLP A;  2A1J B;  3GIL A;  1COO A;  4M9N A;  4NM1 A;  9ICC A;  5KTQ A;  3Q8P B;  4ED3 A;  4LVS A;  2A1J A;  5J2B A;  7ICS A;  3PO4 A;  1L3S A;  9ICK A;  4YCX A;  2AU0 A;  4QZD A;  4YXJ A;  5KG4 A;  4LZD A;  1JXE A;  1U45 A;  2XY5 A;  3RH4 A;  4F4W A;  5CP2 A;  2BGW A;  2I9G A;  3H8W A;  1S0M A;  4I2F A;  5HMM A;  4RQ0 A;  9ICP A;  2BHN A;  5J0Y A;  1NKE A;  3Q8R B;  1JMS A;  4DL3 A;  1LV5 A;  5J2E A;  3V7L A;  4YVZ A;  4ECV A;  3C2K A;  4IR1 A;  1ARO P;  4J9S A;  2HVI A;  5IIL A;  3RH6 A;  4NLZ A;  2NRV A;  3GQC A;  1XU4 A;  3ZD9 A;  5KFH A;  4IQU A;  3N97 B;  3GII A;  1BPD A;  2PFQ A;  9ICS A;  3PX4 A;  4R8U A;  4M2Y A;  3UXP A;  2KZ3 A;  1DOQ A;  5J0O A;  3GV7 B;  5C5J A;  3V6J A;  3QEA Z;  2HHX A;  5HML A;  2AQ4 A;  1X9W A;  1NJZ A;  5DLF A;  4ECX A;  2UVU A;  3GV8 B;  4PGY A;  3C23 A;  3M9N B;  2R8G A;  2H5X A;  4ED0 A;  8ICZ A;  4YN4 A;  4IRD A;  5DLG A;  5KFE A;  2LYH A;  1XSN A;  1XWL A;  2Q0Z X;  1RXW A;  4O9M A;  7ICN A;  3BQT A;  4EZ9 A;  3V7J A;  5KFC A;  4MF2 A;  5CA7 A;  5J2A A;  1D9D A;  3BJY A;  4F5O A;  3ETL A;  1QSS A;  8ICF A;  4DOB A;  1DGS A;  4ED6 A;  4QZF A;  4QZ9 A;  2F1I A;  4DEZ A;  2UVV A;  4B9U A;  1ZQB A;  1NK0 A;  1XC9 A;  4ED1 A;  1K1Q A;  3V7K A;  3IHQ B;  2HHT A;  3RJK A;  4KLL A;  3PML A;  4J9P A;  8ICC A;  5DBC A;  2XO7 A;  3RB0 A;  4ED8 A;  1RYS A;  3ZDA A;  1ZQP A;  5DB6 A;  5DB9 A;  4RUC A;  3LWM A;  2ZTE A;  4KN4 A;  4QZC A;  3RJH A;  1L3T A;  4I27 A;  4RQ2 A;  3QE9 Y;  2BCQ A;  2ZTD A;  4QWE A;  5KFK A;  4KLT A;  5J2K A;  4PPX A;  3V6K A;  3ISD A;  1SL0 A;  2FMS A;  2P6U A;  1QSY A;  4M04 A;  9ICU A;  3RB4 A;  5DG8 A;  8ICU A;  8ICS A;  2PI4 A;  3M8S A;  4KLU A;  4J9R A;  3ZDD A;  3JPR A;  4UQG A;  4XQ8 A;  1CUK A;  4PGQ A;  2ASD A;  4J9K A;  2ZUC A;  1ZQL A;  4C8N A;  3TFS A;  1A77 A;  1KFS A;  4F2R A;  1U49 A;  2VA3 A;  2ISP A;  3THV A;  4P4P A;  2W9A A;  4FS2 A;  4KLE A;  2FMP A;  3SI8 A;  5KFZ A;  1UA0 A;  4B9V A;  3M9M B;  2XY6 A;  4EYI B;  2UVW A;  1BPE A;  4YR0 A;  2W9C A;  2BCV A;  4O3S A;  2XY7 A;  2V4Q A;  4DSJ A;  4M9G A;  4Z6C A;  2IHM A;  4ECT A;  5KFV A;  4GC7 A;  3C2L A;  4RQ3 A;  3ZDE A;  5DDY A;  4EBC A;  3Q8L A;  4ECU A;  2XGQ A;  3V72 A;  3HPO A;  3H8J A;  2M9N A;  4C8L A;  4IRK A;  5KT4 A;  4M9L A;  4F3O A;  3PX6 A;  1Z00 B;  2C22 A;  4B9M A;  1D8Y A;  2PI5 A;  2BDP A;  1S0O A;  1Z00 A;  5J0R A;  1L3V A;  4KLS A;  4KLO A;  1T8E A;  2JEF A;  4DQS A;  3RJE A;  7ICO A;  5KFN A;  1QTM A;  2KTQ A;  1ZQJ A;  4RQ6 A;  5DQG A;  4GC6 A;  3PW7 A;  4O3O A;  8ICW A;  3C5G A;  4ECR A;  2W9B B;  4PHP A;  2ASJ A;  4ELV A;  3MDC A;  4GXJ A;  4I2E A;  4UB2 A;  5BOM A;  3RRG A;  3B0X A;  1HJP A;  4I2G A;  4F8R A;  1Z3E B;  9ICG A;  5DB7 A;  3PMN A;  1UT5 A;  1UT8 A;  5J2J A;  4Z6D A;  8ICT A;  4R64 A;  5F9L A;  1NJY A;  1JXL A;  5HNK A;  3AUO A;  1X9M A;  4GLX A;  3T5L A;  4UB3 A;  4QWC A;  4IQW A;  9ICB A;  4IQV A;  3C1Z A;  4B9L A;  4O0I A;  4DQI A;  3H8S A;  1QSL A;  3LDA A;  2FLL A;  4QZI A;  1XS9 D;  5CWR A;  1MQ2 A;  4P4O A;  3SYZ A;  3PVX A;  4YFK A;  1BPB A;  4YR2 A;  9ICV A;  5L1L A;  5IIM A;  3UXN A;  2KFN A;  4RQ8 A;  4TUS A;  2VA8 A;  1HUO A;  4RQ5 A;  2XGP A;  3RJG A;  4QZH A;  2W9M A;  2BCU A;  4YD1 A;  1BGX T;  7ICG A;  3RAX A;  2ZTC A;  3UPQ A;  3Q8Q B;  4NLG A;  3TAP A;  5IIJ A;  4PH5 A;  4DF4 A;  3NGD A;  4RPX A;  5IIN A;  1KRP A;  4ZH4 A;  4UAZ A;  4DOA A;  7ICQ A;  3RR8 A;  4UBB A;  2R8J A;  2BKE A;  1ZQC A;  3GIJ A;  3QEB Z;  2JEG A;  2HHU A;  2KN7 A;  2ASL A;  4KLD A;  4O3R A;  8ICA A;  4QZA A;  3GIK A;  1B22 A;  1ZJN A;  2NRZ A;  4RPY A;  7ICH A;  3PY8 A;  9ICH A;  4IR9 A;  2FPK A;  5CR0 A;  4Q8F A;  1A76 A;  4BWM A;  4C8O A;  1ZYQ A;  1S76 D;  1ZQE A;  5DBB A;  3G6Y A;  1XSP A;  2GWS A;  4RT2 A;  4Z6E A;  4F5R A;  4O3P A;  4R8U B;  4EEY A;  4DF8 A;  2PXI A;  3Q8K A;  4KLJ A;  3H4B A;  3QZ8 A;  2KFZ A;  5KFS A;  1N56 A;  7ICJ A;  2AJQ A;  5KFA A;  1RYR A;  1B43 A;  4KLH A;  4KLM A;  3PV8 A;  5J2C A;  1ZET A;  9ICQ A;  1KDH A;  4R65 A;  3RJF A;  3C1Y A;  3MAB A;  3ISB A;  4F50 A;  3TAR A;  2OWO A;  4Z6F A;  7ICR A;  5KG5 A;  3MFI A;  5BPC A;  9ICO A;  1SL2 A;  4BWJ A;  5D49 A;  3GV5 B;  4F4X A;  5D46 A;  1SKR A;  2R8K A;  4M0A A;  4K4G A;  1U48 A;  4EBE A;  3GIM A;  4DSF A;  1NK9 A;  3PR4 A;  2HVH A;  4NXZ A;  4DLE A;  2NRT A;  5DBA A;  4TQS A;  2Y1J A;  1NJW A;  4QW9 A;  3RBD A;  4I29 A;  4YXM A;  5DQI A;  7ICU A;  5J0W A;  2VA2 A;  1TFR A;  5KG2 A;  4QW8 A;  2HW3 A;  2F1H A;  5DQH A;  5KFW A;  3JPO A;  1XO1 A;  3ZDB A;  2BPG A;  1L5U A;  2BCS A;  2ZJ5 A;  3LK9 A;  5J2F A;  3OJS A;  5DG9 A;  3T5J A;  2BR0 A;  1H38 A;  2IBK A;  4DSE A;  3HP6 A;  2J6U A;  5DKW A;  3OJU A;  5J2D A;  4IQT A;  3ZD8 A;  1ZQG A;  4EBD A;  2R8I A;  2FLN A;  9ICE A;  3IM1 A;  4O3N A;  4ELU A;  3K75 D;  4C8K A;  4QZ8 A;  3KHG A;  3PNC A;  5HP4 A;  4UAY A;  3GFK B;  8ICQ A;  3SV3 A;  4J9O A;  4I2C A;  4JV0 A;  2NRW A;  1X2I A;  5KG6 A;  4BGD A;  4R66 A;  4ED7 A;  3H7I A;  1S97 A;  3EW9 A;  4M6W B;  1S9F A;  4P2H A;  1K1S A;  5L1I A;  2P6R A;  2ZUD A;  4NM2 A;  4M6W A;  1ZQK A;  5CJ7 A;  8ICP A;  5KFO A;  2ATL A;  4KLQ A;  5J2G A;  4QZG A;  4DWI A;  4MFA A;  3H40 A;  1ZQO A;  5EWE A;  3JPS A;  3OHB A;  2W9C B;  4ECQ A;  4K4I A;  3TAN A;  1ZQR A;  8ICO A;  4ECY A;  5DGA A;  1T4G A;  5KFY A;  3OSP A;  4MFF A;  1IM4 A;  4TUR A;  3KHH A;  8ICR A;  1ZQV A;  5KG7 A;  5KFD A;  3G6V A;  4DO9 A;  4DL7 A;  3MGI A;  5JUM A;  2WTF A;  5J2H A;  2DFL A;  4UB1 A;  1BPX A;  1X9S A;  4DSI A;  1ZQU A;  5IIO A;  2F1J A;  3MR6 A;  1WCN A;  4F93 B;  2AGP A;  4P4M A;  2IMW P;  1NK5 A;  7ICM A;  4DL4 A;  5DB8 A;  4Q45 A;  3UXO A;  4UAW A;  4QWD A;  3EYZ A;  4PHA A;  8ICG A;  3FYH A;  4QZE A;  3UQ0 A;  9ICJ A;  4F4Z A;  1S0N A;  1ZQD A;  4F4K A;  3HWT A;  4DFP A;  4DQP A;  3MDA A;  2AGO A;  4Q8E A;  5KFU A;  5HHH A;  5KFM A;  2C28 A;  1SKS A;  1NK6 A;  5J0T A;  4J9Q A;  1ZQA A;  4PHE A;  4O5C A;  5KFB A;  4RT3 A;  3PW5 A;  5DGB A;  1ZQM A;  7ICP A;  4QZB A;  4DL6 A;  3OSN A;  5DG7 A;  1JX4 A;  4F92 B;  4YD2 A;  4DS5 A;  2XCA A;  4RQ7 A;  4YP3 A;  1ZJM A;  1TKD A;  4TQR A;  1D9F A;  4RQ4 A;  2P66 A;  4MEX A;  8ICK A;  1SKW A;  4EZ6 A;  4MFC A;  5KFG A;  4J9N A;  4Q43 A;  2IA6 A;  1KSP A;  1ZQY A;  3K4G A;  3KHR A;  1RXV A;  3T3F A;  1KEJ A;  5CB1 A;  4QWB A;  3EWA A;  1ZQI A;  1RPL A;  3TQ1 A;  4DS4 A;  1MC8 A;  4DFK A;  3QZ7 A;  4NY8 A;  2AGQ A;  4I2H A;  3UQ2 A;  8ICY A;  3KTQ A;  5KFL A;  4F91 B;  2KZZ A;  1TVA A;  4ELT A;  1ZQF A;  2AQ0 A;  2BCR A;  3RAQ A;  2MUT B;  1IXR A;  4KLG A;  4FO6 A;  2MUT A;  1KTQ A;  1RZT A;  2JZB A;  1C7Y A;  7ICI A;  5CHG A;  2V9W A;  2ALZ A;  4YMO A;  9ICX A;  2C2R A;  1U4B A;  3RB6 A;  3EZ5 A;  3G6X A;  4C8M A;  4F2S A;  4ED2 A;  3ORY A;  4B9S A;  4DSL A;  3OGU A;  3RR7 A;  2HHW A;  2BPC A;  1PZN A;  1NK4 A;  1L3U A;  2ISO A;  9ICM A;  4KN7 A;  4JWM A;  4TUQ A;  2XCP A;  3Q8S B;  1TV9 A;  1V9P A;  4YMM A;  4JWN A;  4FS1 A;  3PX0 A;  5KFR A;  2PFP A;  4NLN A;  4MEY A;  3MR3 A;  4X5V A;  2JEI A;  4M47 A;  5KG3 A;  5J29 A;  3OHA A;  1D8L A;  3H4D A;  8ICX A;  1Y88 A;  1TAQ A;  9ICT A;  4O5K A;  5J0X A;  4DOC A;  4DL2 A;  5J0U A;  1N48 A;  4JUZ A;  2ZJ8 A;  4RNN A;  3SV4 A;  5III A;  3SZ2 A;  2PFO A;  7ICL A;  4ECS A;  4DQQ A;  4KIT B;  2VAN A;  3BQ1 A;  4RUA A;  2W8L A;  2JEJ A;  4O3Q A;  3B0Y A;  1NJX A;  3JPN A;  5L1K A;  1NKB A;  4MF8 A;  2W8K A;  1QLN A;  4I2D A;  3JPP A;  4F4Y A;  7ICT A;  3HT3 A;  4ECW A;  4RNM A;  5KG1 A;  3T5K A;  2B21 A;  4PHD A;  4YQW A;  8ICM A;  4RPZ A;  4KLF A;  3TAQ A;  4E0D A;  5KFP A;  3E2E A;  1BPY A;  1MSW D;  7ICK A;  3RTV A;  3C5F A;  2RDJ A;  1U47 A;  2FMQ A;  4YG2 A;  5L9X A;  4I2J A;  4DFM A;  2NRX A;  3TFR A;  4DSK A;  8ICI A;  4CCH A;  3RBE A;  3LWL A;  1EXN A;  3PW2 A;  4F5Q A;  2KZM A;  3MGH A;  4ECZ A;  4M9J A;  4XA5 A;  4HYK A;  3M9O B;  4RU9 A;  5J0S A;  2I1Q A;  8ICL A;  1ZQZ A;  7ICV A;  3EPG A;  4Q44 A;  3EPI A;  2DPI A;  1T7P A;  2IHN A;  5IIK A;  4F5P A;  5KFT A;  5BOL A;  5KFF A;  3AU6 A;  4I28 A;  8ICE A;  9ICF A;  4G3I A;  4PGX A;  1UA1 A;  3PR5 B;  1BPZ A;  9ICR A;  5D4B A;  5EWG A;  1JN3 A;  2MAX A;  4BXO B;  3HW8 A;  2PFN A;  2J6S A;  4I2I A;  4XUS A;  4GXK A;  1ZQN A;  1TK0 A;  3M8R A;  4QWA A;  4BXO A;  4KTQ A;  3C21 A;  3JPT A;  3BQ2 A;  4F5N A;  1TK5 A;  2BQU A;  4GXI A;  4DQR A;  2UVR A;  4TUP A;  5EWF A;  3HX0 A;  3Q8M A;  4BDP A;  3RRH A;  1JIH A;  4YR3 A;  1ZQT A;  4LZG A;  5KT2 A;  4I2A A;  3ISC A;  3V6H A;  9ICL A;  3FDS A;  5KT5 A;  4IRC A;  2FPL A;  3RB3 A;  5EOZ A;  1NKC A;  3TI0 A;  3RJI A;  2BPF A;  3BDP A;  3MBY A;  4J9L A;  4KLI A;  4EYH B;  5KFI A;  5KT3 A;  3AU2 A;  4KMU A;  4FBT A;  1NK8 A;  2Y1I A;  9ICW A;  3GDX A;  5KFQ A;  1S77 D;  3N4M B;  2C2E A;  5TZV A;  5KG0 A;  3MFH A;  8ICN A;  3T5H A;  5F9N A;  1KFD A;  4B9T A;  2HHS A;  1MQ3 A;  2HHQ A;  3JPQ A;  1ZQX A;  5KT6 A;  1ZQH A;  5L1J A;  1SL1 A;  2DPJ A;  4JV1 A;  8ICB A;  1KFT A;  1TAU A;  1XSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...