1X2IA

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, helix-hairpin-helix domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
ALTLAERQRLIVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEIRRVITAPYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hef helicase/nuclease
publication title Structural and Functional Analyses of an Archaeal XPF/Rad1/Mus81 Nuclease: Asymmetric DNA Binding and Cleavage Mechanisms
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 19
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1x2iA00
3V7JA 4KLHA 3HX0A 1D8YA 3AU6A 2ZTCA 5J0RA 7ICQA 3GDXA 1DOQA 4EBCA 1L3UA 2RDIA 1ZJMA 4KLIA 3EYZA 4XA5A 1DGSA 2JEGA 4YMOA 3T5KA 5HMLA 5EWEA 1T8EA 7ICKA 3V6HA 2HHSA 3RJKA 4DSEA 4ED0A 5F9LA 2FLPA 4ECQA 4MFCA 1NKEA 3C1YA 3C5GA 4QZIA 3ISCA 4P4PA 3GIJA 7ICSA 1SKWA 1ZYQA 4DQSA 4KTQA 2Y1IA 5J2IA 4RPZA 5J2FA 1NK9A 4UQGA 5IINA 2JEIA 4RUAA 1JIHA 1T3NA 3RJFA 1U47A 4P4OA 1MQ3A 2PFNA 3Q8QB 4TQRA 2XGPA 3RJGA 1U45A 9ICSA 2VANA 4PHEA 4M9NA 9ICGA 5DBBA 1B22A 4O5KA 2NRWA 3M9MB 4UB3A 4B9UA 1ZQUA 3IHQB 5F9NA 4R66A 4TUPA 1TV9A 1MQ2A 4FBTA 1ZQPA 4JWNA 4F5PA 4UAZA 5EWFA 3Q8KA 7ICNA 2HHXA 5J2AA 2XGQA 4F4WA 4GXJA 1RXVA 1NK4A 3LWLA 4F2RA 4G3IA 1S76D 1NK5A 1NK0A 1NJWA 4KLOA 1H38A 5J2BA 1RYRA 5HMMA 5L1JA 2HVHA 5KG4A 4RQ5A 4R65A 1ZQLA 2KTQA 2AQ0A 3ZDEA 2KFNA 1XSPA 3JPOA 3PW4A 5KFUA 4DOAA 2VA2A 4TUQA 2FPMA 4DSLA 4I2GA 4RQ6A 3ZD8A 3TAPA 4DSFA 7ICMA 1ZQSA 1JXEA 3TFSA 3PMLA 2IA6A 2IMWP 2ASJA 4Z6FA 4NM1A 9ICRA 3EZ5A 9ICFA 3KHGA 4EZ6A 4GC6A 4NLKA 1IXRA 4RUCA 1ZQVA 5KFZA 3ZDBA 5KFKA 4F93B 3ORYA 4B9LA 5J0YA 5J0OA 3PX6A 2HHTA 1WCNA 4QWCA 1D9FA 3KTQA 4M9HA 5KFPA 3V6JA 2ZJ5A 4O0IA 8ICJA 4UBBA 2AGPA 1NJXA 5KFWA 3RRGA 5DB9A 5KG1A 4EEYA 2BQRA 4LZDA 4DSKA 1ZQKA 5KT7A 3KHHA 2BQUA 4P2HA 7ICFA 1ZQJA 2NRZA 2M9NA 5KFAA 4KLJA 4X5VA 4ED8A 5J2EA 4DS5A 3RBDA 4BDPA 5KFCA 2ZUDA 2JEJA 5CA7A 3UXPA 2PI4A 4RNOA 3Q8SB 3C2LA 2IHNA 1N48A 2BPFA 3JPNA 4ED3A 3Q8RB 2NRTA 5KFGA 5DB7A 3JPPA 2PFOA 4ELUA 4NXZA 4M9LA 9ICXA 9ICQA 4C8OA 2BPCA 1ZQNA 1S9FA 2FMQA 5DKWA 1RYSA 4DF8A 4HYKA 4RNNA 2BCUA 8ICBA 3T5HA 3QZ7A 1KLNA 4KITB 8ICUA 5DG8A 5EOZA 1CUKA 5DLFA 5KFRA 3C2MA 1XSNA 2VA3A 4F92B 5J0QA 1UA0A 1HUOA 3PO5A 1U48A 4YCXA 2RDJA 5L1IA 4KMUA 2F1JA 5DGBA 3UQ2A 8ICMA 5IIKA 8ICYA 3GIIA 3Q8PB 2ATLA 2AGQA 2W9AA 1JN3A 4ECYA 4DL2A 1ZQDA 5BOMA 3RB3A 5L9XA 5KG7A 3BQ0A 2AJQA 9ICTA 4EZ9A 4O5CA 2C22A 4E0DA 4O3RA 4J9LA 2J6TA 4QW9A 4TURA 2V4QA 4DL5A 4KLDA 4MFFA 2BGWA 5IIIA 3RH5A 7ICJA 4UBCA 4RQ7A 4I2BA 4J9KA 5KFHA 4NLNA 9ICCA 1COOA 2J6UA 4IR9A 4F4XA 7ICPA 4YR3A 1SKSA 1S0VA 2XC9A 8ICIA 3MGHA 4K4HA 9ICKA 1UT5A 4ECUA 4ELTA 3SYZA 5IIJA 3THVA 3PX0A 4DSIA 3PV8A 3JPRA 1NJZA 2IBKA 4DO9A 5D4BA 9ICBA 1Z3EB 2FPKA 1XO1A 1BPDA 1XWLA 4IQTA 9ICEA 1WCLA 1BPEA 8ICVA 4PH5A 2HHQA 5HNKA 1TAQA 2ALZA 5DG9A 3HW8A 4JWMA 5TZVA 1QSYA 4Q8EA 1JMSA 4QW8A 4UB4A 4R63A 7ICUA 2HHVA 4MEYA 4C8KA 3Q8LA 5KG2A 4DWIA 1BGXT 1RXWA 3QEBZ 3RB6A 2HVIA 1XC9A 2HHWA 4RQ0A 5D49A 4P4MA 1ZQOA 1SL2A 3MR2A 3PO4A 4O3QA 4QZ8A 5KFFA 3RRHA 1SL1A 1KFDA 1KTQA 4RQ1A 3RB4A 1T7PA 2ISPA 2XCPA 5CWRA 3V7KA 3MDAA 4FS1A 2BQ3A 2ISOA 4YR2A 4QZCA 4QZAA 5J2CA 3UPQA 3JPQA 5DQHA 4O3OA 1KSPA 1QSSA 3PW2A 1S10A 2W8LA 2C2RA 1ZQCA 4F5NA 1XSLA 1TAUA 1HJPA 4MF8A 4YFKA 2P6UA 8ICWA 4Q43A 3HT3A 4PGYA 5DGAA 3UXNA 4FO6A 2W9BB 8ICAA 5KFLA 2W9CB 4PGQA 9ICVA 5KFYA 3RJEA 4UB2A 4PHDA 2ZJ8A 3MR6A 1KFTA 5D46A 3TAQA 4O3PA 1NK8A 3FDSA 4IRKA 3MR3A 1BPZA 4I29A 4F4ZA 4Z6EA 2HW3A 4RT3A 3HWTA 1LB2B 4ECWA 3N4MB 3RR7A 2JZBB 3OGUA 1QSLA 1Y88A 3G6VA 3C1ZA 5KFEA 3ZDCA 1S97A 4ECXA 4I28A 8ICQA 3PR4A 4ED2A 4DOBA 4F2SA 4XRHA 4EBDA 4M9GA 5J2JA 5KFTA 3PX4A 9ICAA 4PHAA 5BPCA 1NOMA 2ZJAA 5DBCA 3JPSA 3ZDAA 3GFKB 2R8HA 4J9PA 3RR8A 4IRCA 1SKRA 4KLLA 2KZZA 4JV2A 4YD2A 1ZQRA 1JXLA 3LK9A 8ICTA 3RJIA 3QE9Y 5KFOA 1HUZA 4B9VA 4DQRA 3GV8B 2FMSA 5KG6A 3MBYA 4I2HA 2I9GA 2LYHA 4UB5A 8ICFA 4RQ3A 4I2AA 4O9MA 3ETLA 4F5OA 2UVVA 4C8LA 7ICEA 1X9MA 3EW9A 4QWAA 2A1JB 5L1KA 2ASDA 1MC8A 4Z6DA 5DQGA 4ELVA 3HP6A 4ED7A 4ECTA 2XY5A 3AUOA 1ZQHA 9ICIA 5L1LA 3BQ1A 5KT3A 4QZDA 2W9BA 4Q8FA 7ICHA 2W9CA 3OSNA 8ICPA 1U4BA 8ICOA 4NLGA 4YP3A 3MGIA 4DL3A 4DQIA 2HHUA 4MF2A 4RPYA 4JV0A 1X9WA 4F4KA 4DL7A 2B21A 2PFPA 3TQ1A 8ICKA 3N97B 4M6WB 2FLLA 5IIMA 3MFHA 3EPGA 3C23A 2ZUCA 4LVSA 2AGOA 4C8MA 1SL0A 2JZBA 2OWOA 5KFQA 5HHIA 9ICWA 9ICOA 1PZNA 4QZBA 5IILA 3TFRA 4DL4A 4JV1A 4F5RA 1S0NA 8ICCA 4JUZA 1KFSA 1XU4A 1S0OA 4UAWA 3RAXA 5KFVA 3H4BA 1ZQGA 1QTMA 4QWBA 3UQ0A 1V9PA 4I2JA 4F91B 3SZ2A 4QZHA 4F4YA 4BWMA 4ECVA 4KLQA 4B9TA 5DDMA 5KG0A 4Q44A 8ICZA 5J2HA 2MAXA 4KLSA 2UVRA 3MR5A 3Q8MA 4I2FA 4RZRA 8ICSA 5KT6A 5J2DA 4DQPA 4O3SA 5DG7A 4TQSA 4XQ8A 1NKCA 2VA8A 5KT4A 4LZGA 5IIOA 7ICRA 4I2DA 2XCAA 1NK6A 2V9WA 4KLTA 4DS4A 1TFRA 4I27A 5KFMA 4RQ4A 1ZQMA 1Z00B 4DOCA 2A1JA 1D8LA 1D9DA 2F1IA 1S0MA 3K75D 5EWGA 7ICOA 1QLNA 4KLMA 1TK5A 3ISBA 3GILA 1ZQIA 2KN7A 5DLGA 4RPXA 5CHGA 2AQ4A 4J9RA 4EYIB 4KN7A 1NJYA 3PW5A 5J0WA 9ICNA 1KDHA 3EPIA 1JX4A 2ZTDA 3GV5B 3PNCA 4F50A 1ZQAA 3B0XA 4I2IA 4M6WA 5CR0A 5CB1A 2W8KA 3V72A 2Y1JA 1L3VA 2BCRA 1TVAA 1A76A 4ECSA 1BPXA 4QZ9A 3C2KA 3MABA 5KT2A 3OHBA 2R8IA 4F5QA 4UAYA 4GXKA 4YXJA 5J0PA 9ICUA 3TARA 4YD1A 4PPXA 1X2IA 4DF4A 3ZD9A 3M9OB 8ICHA 4B9SA 4DFMA 1U9LA 3T3FA 2BR0A 3ZDDA 1LV5A 4I2EA 1ZQWA 5CP2A 3RBEA 2BKEA 4J9MA 3G6YA 5KFXA 2I1QA 1SZPA 4BGDA 5J29A 2H5XA 3V7LA 4R8UB 4Z6CA 3RH4A 1L5UA 3PY8A 3M8RA 1KRPA 4YXMA 5DDYA 3GIKA 4GLXA 7ICLA 4MFAA 2KZMA 5J2KA 2W9MA 2F1HA 3SV4A 3LWMA 2PXIA 3PW7A 3ISDA 5J0XA 3AU2A 3C21A 1ZQBA 2R8JA 3UXOA 5KFDA 1Z00A 4CCHA 4M04A 2MUTB 8ICGA 9ICHA 1N56A 3LDAA 1NKBA 4KLGA 3SV3A 4YN4A 4YQWA 3H7IA 3SI8A 8ICXA 4QWEA 2BHNA 3GIMA 3QZ8A 3NGDA 2XY7A 2P66A 3G6XA 1AROP 4IQVA 4GC7A 7ICIA 3TANA 3EWAA 1ZQYA 4Q45A 1KEJA 3TI0A 1K1QA 2C2DA 1IM4A 5DB6A 1BPBA 3OSPA 5KG3A 2PFQA 4ED1A 1B43A 4O3NA 3JPTA 2ZTEA 2FLNA 3PMNA 5KFJA 3NTUA 3H40A 7ICVA 4O5EA 5KFIA 2R8GA 4DLEA 4YR0A 3K4GA 4DEZA 5C5JA 1ZJNA 1TK0A 1L3SA 4K4IA 2KFZA 8ICEA 4XUSA 3C5FA 3GV7B 5KFSA 1UT8A 2V4RA 5J0TA 4DSJA 1ZQTA 4R64A 3RJHA 4IR1A 4FBUA 3M8SA 4JK1A 5J2GA 4F8RA 7ICGA 5J0SA 4FS2A 1TK8A 1ZQZA 3QEAZ 4ECRA 3MFIA 4DQQA 3H8JA 3RAQA 4R8UA 3RJJA 5BOLA 1C7YA 2BCVA 2Q0ZX 3T5JA 4NY8A 2BCQA 4BXOB 4KN4A 1X9SA 4B9NA 4J9SA 4IQWA 4KLEA 3RB0A 4BWJA 4PHPA 9ICJA 8ICRA 2ZUBA 4M47A 2BCSA 4M9JA 3V6KA 4DFJA 4J9OA 2ASLA 4NM2A 1RPLA 5DB8A 2MUTA 4DFKA 1NK7A 3H8SA 9ICMA 2DFLA 1ZETA 4B9MA 1BVSA 4TUSA 1L3TA 1T4GA 4ZH4A 4IQUA 4RQ2A 2WTFA 3RTVA 3PVXA 2AU0A 3H8WA 2PI5A 4KLUA 5KG5A 4ED6A 4J9NA 5JUMA 2DPJA 4UB1A 4PGXA 1ZQXA 4J9QA 4ECZA 3RH6A 1UA1A 2JEFA 1TKDA 4MEXA 9ICLA 1XS9D 2J6SA 5HHHA 4I2CA 2UVWA 4EBEA 4DLGA 3BQ2A 4RT2A 2DPIA 5KFNA 1BPYA 2C28A 4M0AA 2FPLA 4YVZA 3PW0A 3MDCA 1EXNA 5J0UA 5KTQA 3BJYA 3HPOA 2XY6A 4K4GA 3OHAA 4DFPA 1K1SA 2GWSA 3E2EA 1ZQEA 3T5LA 2BPGA 4NLZA 4F3OA 4QZEA 4QZFA 3PR5B 4M2YA 5CJ7A 4QZGA 3OJUA 1ZQFA 2P6RA 1S77D 3BQTA 4GXIA 5KT5A 3KHRA 4BXOA 5DBAA 2NRVA 2FMPA 4YG2A 2IHMA 4C8NA 1A77A 7ICTA 2UVUA 1CEZA 8ICNA 1MSWD 4KLFA 4YMMA 5HP4A 8ICLA 4IRDA 3IM1A 2C2EA 4RQ8A 3GQCA 2NRXA 4YMNA 4DL6A 1RZTA 5DQIA 3M9NB 4RU9A 2KZ3A 3KHLA 2R8KA 1ZQQA 3FYHA 3H4DA 5KFBA 3BDPA 9ICPA 3OJSA 2XO7A 1U49A 2BDPA 4RNMA 4EYHB 4QWDA 3B0YA
chains in the Genus database with same CATH superfamily
3AU6A 4CF4A 3GDXA 2RDIA 3D2QA 2GOLA 5ALFA 3V6HA 2HHSA 2WB1F 4HAIA 4ED0A 2ESEA 2FLPA 4ECQA 4MFCA 3FAHA 4QZIA 4P4PA 2OHFA 3GIJA 2Y1IA 5AIBA 3I1YA 4UARA 5B66U 2ZXIA 4UB6U 1T94A 1NK9A 4RUAA 1T3NA 4TQRA 2XGPA 1U45A 9ICSA 4PHEA 1TAMA 4Y2UA 5ALUA 2KKPA 2AH5A 4JMUA 3IHQB 1MQ2A 4JWNA 1ZQPA 3WKCA 1SV0C 3I76A 1DXSA 4GXJA 1S76D 5AK4A 1RYRA 3GZFA 5HMMA 2KTQA 5AI4A 1ZQLA 5KFUA 4DOAA 2LBOA 4DSLA 3ZD8A 3TAPA 4Y2XA 1SB3C 4DSFA 1RQNA 4Z6FA 4NM1A 3EZ5A 9ICFA 4NLKA 1IXRA 2WFAA 1QCKA 2RLTA 3ZDBA 3ORYA 4UW9A 4B9LA 5AK3A 1D9FA 2EQYA 5KFPA 4OCZA 1HEKA 4Y2PA 5G5GA 1NJXA 5H2FU 5DB9A 4ICAA 1Q3VA 2BQUA 2ZIXA 1ZQJA 4KLJA 3TADA 2PI4A 2IHNA 4ELUA 2E8MA 5DB7A 1ZQNA 2BCUA 2LPEA 3T5HA 3QZ7A 5DLFA 2OYYA 2K8AA 3N7SC 5AKXA 2F1JA 2KK0A 3A0HU 3GIIA 2AGQA 2W9AA 3OTQA 5ALHA 4DL2A 1ZQDA 5BOMA 3RB3A 1ZQ1C 5L9XA 4EZ9A 4Y2YA 4O5CA 4E0DA 4J9LA 4TURA 5IIIA 3RH5A 2MA1A 4UBCA 4J9KA 9ICCA 1COOA 4F4XA 1S0VA 3AQFA 5IIJA 3PX0A 3K1ZA 1NJZA 2HCFA 4DO9A 4IQTA 4F72A 8ICVA 4PH5A 5HNKA 1TAQA 2VIXA 4JWMA 1QSYA 4Q8EA 2D8CA 4R63A 2E8OA 3Q8LA 2IOHA 1COKA 1N61A 2HSZA 3QEBZ 1XC9A 2DQNB 4P4MA 1SL2A 5KFFA 1SL1A 1T7PA 1KFDA 2JXJA 2ISPA 3V7KA 4YR2A 1WWUA 1L8LA 5AKHA 3PW2A 1S10A 2W8LA 4F5NA 4MF8A 2P6UA 3HT3A 2LHTA 2W9BB 5ALTA 4PGQA 3RJEA 4PHDA 4US8A 4O3PA 3MR3A 5F3XB 1BPZA 4I29A 3HWTA 3RR7A 1Y88A 4ECXA 4EBDA 9ICAA 3WK4A 1KW4A 3ZDAA 2KZZA 4YD2A 1IIPA 4DQRA 3GV8B 4RQ3A 2W3SA 1KN5A 2HOFA 1Q3UA 1J2MA 1X9MA 3HJEA 4ECTA 1ZQHA 1QH9A 2KJ8A 1BNOA 7ICHA 4Q8FA 2W9CA 1U4BA 8ICOA 4NLGA 4YP3A 3MGIA 4DQIA 3BQ7A 2B21A 2FLLA 1SWWA 4C8MA 2JZBA 2VKQA 1PZNA 4UAWA 1ZQGA 3UQ0A 3SZ2A 2KHVA 4QZHA 5KAFU 4BWMA 2WF9A 3RFAA 4B9TA 2YMQA 5J2HA 4KLSA 3L4PA 1UCVA 3Q8MA 5AKGA 3QNMA 1PK1B 3PSFA 4XQ8A 4DS4A 4I27A 1ZQMA 1D9DA 3H0RB 4NL9C 1S0MA 1J2NA 4KLMA 3ISBA 2W54A 1KQQA 4J9RA 2JH7A 1NZPA 4JB3A 4KN7A 2XIDA 2P35A 2ZXHA 1JX4A 5ALRA 3PNCA 3KKAA 2OEHA 3B0XA 3V72A 4CGZA 1MA7A 2K8CB 1TVAA 1DRGA 3C2KA 2R8IA 2HMXA 4DF4A 3ZD9A 4B9SA 4P0PA 3PSTA 3RBEA 2BKEA 2G5IB 5KFXA 2W04A 3PZPA 4Z6CA 4YXMA 3SD7A 3GIKA 5ALPA 1X6IA 2ZIUA 5ALXA 2K8BB 4OJPA 2ZIWB 2F1HA 3LWMA 3PW7A 3AU2A 1UQVA 3CRXA 2YB1A 1Z00A 9ICHA 3SAFA 3LDAA 3WKAA 3H7IA 8ICXA 1VDVA 3GIMA 3NGDA 2EAMA 3LVVA 1IM4A 5DB6A 4U7CA 2PFQA 4NJ8A 3JPTA 2ZTEA 2FLNA 1ZD2P 3CYMA 2DF4B 4UB8U 4K4IA 1YZ6A 4DEZA 4YR0A 2KFZA 3GV7B 5KFSA 5KL8B 2K4HA 3SMVA 3H8JA 2LM4A 1IV8A 2Q0ZX 4B9NA 4IQWA 4KLEA 1Q46A 3SR6A 2ZUBA 2G07A 2BCSA 2W43A 4DFJA 2ASLA 3CNHA 1RPLA 2MUTA 4Y2VA 9ICMA 1J97A 4B9MA 4EX7A 1N60A 1L3TA 2RQ5A 4IQUA 2QB0B 5ALLA 2PI5A 5KG5A 4ED6A 4J9QA 1UA1A 1TKDA 1IG6A 2QARA 1SZHA 2ODGA 5ALGA 3S6JA 5HHHA 5AKEA 3BQ2A 2FDRA 3QUBA 2M0NA 4C80A 2WF6A 2ZG6A 2FJ6A 2C28A 4M0AA 4YVZA 2Y0SF 2YY6A 5KTQA 3OHAA 1K1SA 3E2EA 1RM6C 3T5LA 4M2YA 1S77D 4GXIA 2MSNA 3KHRA 4BXOA 5DBAA 3IG8A 2IHMA 3NS1A 1V38A 2UVUA 8ICNA 2WF5A 4YMMA 8ICLA 4IRDA 3IM1A 3M1YA 5J8YA 1F0MA 4DL6A 3RJGA 2WAQC 3FYHA 3H4DA 1ZQQA 2XO7A 4RNMA 4QWDA 4DCCA 3WK7A 3V7JA 4KLHA 1QQ5A 7ICQA 3MGVA 4QNLA 4EBCA 1ZJMA 1DGJA 1DGSA 2JEGA 5K4LA 4YMOA 1T8EA 3RJKA 5KL1B 1NKEA 2Y9TA 5ALDA 1SKWA 4CE6A 1QQ7A 5J2IA 3BS5B 1OW5A 4UQGA 5IINA 2JEIA 4MHVA 2VANA 1B22A 3I28A 3WK8A 4RQNA 1ZQUA 1JALA 5F9NA 4R66A 4TUPA 1TV9A 4FBTA 2JV3A 5J2AA 2XGQA 4F4WA 2DUYA 1RXVA 1NK4A 3LWLA 4F2RA 2VJ4A 1NK0A 1H38A 2CXYA 5KG4A 4R65A 3CW2C 1XSPA 1L6NA 4TUQA 1VLBA 5AM2A 1ZQSA 3TFSA 1LVHA 2CPRA 4G9BA 2ASJA 9ICRA 5ALQA 3WK9A 5KFZA 1NNLA 5KFKA 4CF5A 3AN1A 5G5HA 2MRLA 3RRGA 4EEYA 2BQRA 5ALMA 1ZQKA 3KHHA 2NV3A 4X5VA 3MC1A 3WK5A 4DS5A 2A1AA 3UXPA 5ALEA 3Q8SB 4AYBC 3J81j 2BPFA 3ZI4A 3JPNA 2GLEA 4M9LA 3JPPA 4C8OA 1S9FA 1RYSA 4DF8A 8ICBA 1KLNA 4KITB 8ICUA 2W7OA 5KFRA 1RYUA 1VJ5A 2WAQF 5J0QA 4YCXA 5L1IA 8ICMA 5DGBA 2KHQA 8ICYA 1X40A 2H3VA 4C4SA 2C22A 3ED5A 4QW9A 3IDWA 4MFFA 2GH1A 7ICJA 3N7RC 2QKQA 5KFHA 3C28A 1RG6A 3MGHA 9ICKA 3DDHA 2NO5A 3BZKA 3AQEA 3BS7A 3JPRA 1ZXIA 5D4BA 2FPKA 1BPDA 9ICEA 1WCLA 2KIWA 4OJ5A 5AK5A 5KAIU 5TZVA 2EH9A 1JMSA 4UB4A 7ICUA 5AM5A 4C8KA 3QUTA 5KG2A 2KVCA 3RB6A 4RQ1A 4I2AA 2XCPA 3MDAA 2BDUA 5DQHA 2JGAA 2RHFA 1KSPA 2C2RA 4YFKA 8ICWA 4Q43A 4PGYA 5DGAA 3WK6A 1V85A 4FO6A 8ICAA 5KFLA 3NVYA 2E1FA 1ZRNA 5KFYA 2HBKA 4UB2A 3TAQA 3FDSA 5AI6A 4IRKA 3KZIU 1X42A 5AM4A 2G0AA 4F4ZA 1LB2B 2IOFA 3N4MB 3ZDCA 4ED2A 4DOBA 4M9GA 3F2CA 5J2JA 5KFTA 2YMLA 4Y2SA 1NOMA 3F5EA 4IRCA 4JV2A 3QE9Y 5AKKA 1TE2A 3UMGA 4I2HA 4QIWC 8ICFA 4AYBF 4O9MA 2DWQA 4QWAA 4ELVA 2HBLA 2LMRA 3BQ1A 1OUQA 4QZDA 2W9BA 2HHUA 4RPYA 4EX6A 2PFPA 4FZLA 4CNQA 3TQ1A 3N97B 5IIMA 3C23A 2ZUCA 2AGOA 1SL0A 2OWOA 2Y9UA 2Z7JA 4QZBA 3WU2U 4F5RA 3U26A 1S0NA 4JUZA 1XU4A 2AXTU 3NASA 4QWBA 4F91B 4I2JA 2BZFA 4F4YA 4KLQA 4USAA 4Q44A 2D6FC 2UVRA 4PL1A 1T3QA 8ICSA 4FZMA 2EZZA 2IOFK 1NKCA 4LZGA 4KLTA 1NK6A 2YQEA 1X6JA 3SEIA 3K75D 5EE3A 5EWGA 1P7DA 4PZOA 5ALVA 5DLGA 4RPXA 5CHGA 2F8KA 1FEZA 3PW5A 1FIQA 5J0WA 1SXEA 3H0LB 2HDOA 5ALSA 2ZTDA 4F50A 1PVPA 2ES6A 1A76A 3OHBA 4NLBA 9ICUA 3SAHA 4YXJA 1X2IA 8ICHA 1U9LA 3T3FA 3VC8A 3FC4A 1CI4A 4J9MA 3G6YA 4BGDA 1SZPA 3RH4A 3PY8A 2H5XA 5GTHU 4GLXA 1PK1A 2I6XA 4UAVA 3SV4A 2PXIA 1ZQBA 2VJ5A 5KFDA 3HKZC 3SV3A 4YQWA 2KICA 2P66A 3G6XA 1F44A 2KKVA 3KD3A 2F77X 1F5SA 1KL9A 4QIWF 2H3QA 4O5EA 4ACOA 2R8GA 4DLEA 1ZJNA 3K4GA 1TK0A 1L3SA 3UMCA 4XUSA 8ICEA 1UT8A 5J0TA 3M8SA 4JK1A 2JRZA 1ZD4A 1ZQZA 5L1MA 3QEAZ 2HI0A 3MFIA 1YT3A 3RAQA 3L3FX 3RJJA 4Y2JA 5BOLA 3T5JA 4NY8A 4KN4A 4J9SA 3RB0A 2ZIWA 4PHPA 5DB8A 4DFKA 3QU4A 2DFLA 4TUSA 1T4GA 4ZH4A 5A0LA 2I5HA 4J9NA 1ZQXA 4ECZA 2JEFA 2E5SA 4MEXA 3DV9A 1XS9D 4AP9A 5KNIA 4RT2A 2DPIA 4CF3A 5KFNA 3NRZA 1JROA 5J0UA 2LI6A 3CP8A 1ZOLA 5EE1A 4DFPA 1SXDA 4NLZA 4QZEA 5CJ7A 4QZGA 3OJUA 2P6RA 3BQTA 1PVRA 4C4RA 5KT5A 4BX9C 2NRVA 2FMPA 7ICTA 4C8NA 1Z1VA 2NO4A 1K5OA 4RQ8A 3GQCA 2KIVA 1LKYB 5DQIA 2KZ3A 1U49A 4EYHB 2G06A 2QB0A 4NWIA 3HX0A 2ZTCA 1L3UA 4KLIA 5AI8A 3T5KA 2F2AB 5EWEA 5F9LA 1FO4A 3HKZF 1ZYQA 4DQSA 2YB4A 3H8MA 2A19A 5J2FA 1JIHA 4P4OA 1ED1A 2PFNA 3Q8QB 9ICGA 5DBBA 4O5KA 4UB3A 2AHOB 7ICNA 5JTIA 4F5PA 1UPHA 4G3IA 1NK5A 4KLOA 3D6JA 5J2BA 2KG5A 5L1JA 4IS7A 3KKAC 3JPOA 2VA2A 3F53A 2FPMA 1C20A 4I2GA 7ICMA 1JXEA 5C0YA 3IG5A 4LJXA 4GIBA 3KHGA 4GC6A 2N1RA 1ZQVA 3BS5A 4F93B 5J0OA 3PX6A 4QWCA 3KTQA 2YMMA 3V6JA 4O0IA 4OJOA 4UBBA 2AGPA 5KFWA 5AKIA 1L7OA 5HR6A 4DSKA 1M6YA 3KFUF 1X9XA 1FFVA 2NRZA 5AKZA 1CRXA 5J2EA 1N5WA 3RBDA 1B4FA 3C2LA 1N48A 4ED3A 3Q8RB 9ICQA 2PFOA 3M7DA 5DKWA 1RQLA 4RNNA 5DG8A 5EOZA 1CUKA 4Y2QA 2VA3A 3C2MA 1XSNA 1Z19A 3BZCA 4F92B 3QXGA 2OXOA 1U48A 2RDJA 3UQ2A 1L7PA 3QUCA 5IIKA 4ECYA 2W7PA 3E0FA 1DK2A 5KG7A 3BQ0A 2AJQA 3C29A 4UASA 2KV2A 2J6TA 4DL5A 4KLDA 2V4QA 2BGWA 2K4EA 4ZOHC 4RQ7A 2J6UA 3M6KA 2XC9A 2WF7A 4K4HA 3PSIA 4ECUA 4UATA 4DSIA 1O03A 9ICBA 1XWLA 3N7PD 2E1EA 2HHQA 5DG9A 2DKXA 3HW8A 4QW8A 3AMZA 5ALOA 2HHVA 4MEYA 1JUDA 2HHWA 5D49A 1ZQOA 3MR2A 3PO4A 4O3QA 4QZ8A 3RRHA 3RB4A 1L7NA 5CWRA 4FS1A 2BQ3A 4QZAA 5EE9A 5J2CA 3JPQA 1QSSA 2RRDA 1ZQCA 1TAUA 5J8YC 1OXJA 1X66A 9ICVA 5AI5A 2ZJ8A 3MR6A 5D46A 1L8OA 2HW3A 4EENA 1URJA 2RP5A 3N28A 3G6VA 1JRPA 3K1RB 1PVQA 1Z4NA 3PR4A 4F2SA 4XRHA 5ALJA 3JPSA 4NLCA 3GFKB 1PUZA 4J9PA 4Y2RA 3RR8A 4KLLA 1ZQRA 3LK9A 3RJIA 4CDGA 5AI9A 5KFOA 5JRTA 2LYAA 2FMSA 5KG6A 3MBYA 2I9GA 3SAGA 4F5OA 3GU3A 3DEEA 2KEYA 2A1JB 5L1KA 2ASDA 1MC8A 4Z6DA 5DQGA 3HP6A 4ED7A 2W03A 3AUOA 9ICIA 5KT3A 4C7ZA 3OSNA 8ICPA 4C4TA 4DL3A 4OJ6A 4JV0A 1X9WA 3NUQA 8ICKA 4M6WB 3MFHA 3EPGA 4LVSA 5AK6A 2KD1A 3IV6A 5KFQA 4US9A 4DL4A 4JV1A 8ICCA 3R9KA 1KKXA 3RAXA 5KFVA 3H4BA 3KOOA 2O6KA 2ZIVB 4ECVA 8ICZA 3RF9A 3MR5A 4I2FA 4RZRA 2K60A 5J2DA 4DQPA 4O3SA 5DG7A 4TQSA 2VA8A 2JHDA 1ZD3A 7ICRA 1TFRA 4P0QB 1D8LA 1SV0A 2G09A 1TK5A 3GILA 2HBJA 2KN7A 4IC9A 2AQ4A 4EYIB 4NV0A 1NJYA 9ICNA 3EPIA 1ZQAA 4I2IA 2W8KA 2Y1JA 3TACB 1L3VA 2E8PA 2KMDA 3B9JA 1A6SA 4QZ9A 4GXKA 5KT2A 4K4GA 4UAYA 5J0PA 2DL0A 3TARA 1XNSA 4YD1A 4PPXA 1DK3A 1KBUA 3M9OB 4QJFB 3QX7A 2KSOB 3D2SA 4Y2TA 4DFMA 1LV5A 1ZQWA 5CP2A 1SWVA 4UAUA 4R8UB 3V7LA 3M8RA 1KRPA 5DDYA 7ICLA 2Q4TA 4O3MA 2EZXA 2R8JA 3UXOA 1N56A 1NKBA 4KLGA 1Z1BA 3SI8A 4QWEA 3QZ8A 7ICIA 1AROP 2KOBA 3TANA 3WKBA 4Q45A 3IN5A 2EAOA 3OSPA 3UM9A 3IRUA 4OO1J 3H0MB 4KX3A 5KFJA 3NTUA 2JMGA 5KFIA 2HVIA 5C5JA 1QQ6A 2KE7A 4DSJA 1ZQTA 3RJHA 4IR1A 4FBUA 5J2GA 4F8RA 1BNPA 5J0SA 4FS2A 1TK8A 4DQQA 2BCVA 1X9SA 8ICRA 1JI7A 4NM2A 1NK7A 1ZETA 4OJLA 5ALZA 5AM1A 2AU0A 2H3FA 4KLUA 4PGXA 9ICLA 3RH6A 4OD0A 2F76X 4I2CA 2UVWA 4EBEA 4DLGA 3NVWA 2KVSA 2E3TA 1EXNA 3NRWA 3BJYA 3HPOA 2GWSA 4KX5A 1ZQEA 3PR5B 2WF8A 1N62A 2EDUA 4YG2A 5HP4A 1RZTA 4RU9A 4B6JA 3BDPA 9ICPA 2EAPA 3B0YA 3TADC 1D8YA 5J0RA 1DOQA 2HBMA 2JH1A 2W3RA 3EYZA 4XA5A 1MN8A 2PKEA 5HMLA 4PL2A 3SENA 7ICKA 4DSEA 3C1YA 3C5GA 2YN4A 3ISCA 7ICSA 1ECWA 4KTQA 5T14A 4RPZA 3RJFA 1U47A 1MQ3A 3KZXA 4M9NA 2NRWA 1V97A 3M9MB 4B9UA 1LKYA 4UAZA 5EWFA 3Q8KA 2ZIXB 2HHXA 1NJWA 5AHXA 1WWVA 2HVHA 4RQ5A 2G5HB 2AQ0A 3ZDEA 2KFNA 3PW4A 4RQ6A 5AI0A 3AL0B 3PMLA 2IA6A 2IMWP 2XI9A 2D3DA 4EZ6A 4RUCA 2K4PA 1SV4A 3T79A 5TISU 5EE0A 5J0YA 1A0PA 1GO3F 2HHTA 1WCNA 2HOQA 4M9HA 2CRXA 3ALRA 3AM9A 2ZJ5A 8ICJA 4NL9A 3LYSA 5KG1A 4LZDA 4C7YA 5KT7A 4P2HA 7ICFA 2M9NA 5KFAA 3IP4B 4ED8A 4C0ZA 5AICA 4BDPA 5CRXA 2DGZA 5KFCA 2ZUDA 2JEJA 5CA7A 4RNOA 2F8LA 2NRTA 5KFGA 9ICXA 4NXZA 2BPCA 1N2XA 2FMQA 5AIAA 4HYKA 1ZRMA 5AKYA 1UA0A 4U6PA 1HUOA 3ETRA 1NZBA 3PO5A 4CRXA 4KMUA 1SIJA 3UMBA 3Q8PB 2ATLA 1L7MA 1JN3A 3QU9A 4A8EA 1S8OA 1Q8KA 9ICTA 4FZNA 4O3RA 4FFDA 2DBYA 2YTUA 4GFJA 2K89A 4I2BA 4NLNA 2MU2A 4IR9A 7ICPA 8ICIA 4YR3A 1SKSA 3VCBA 2EZYA 3A0BU 2Y0SC 3QYPA 1UT5A 4ELTA 2DKZA 3SYZA 3THVA 3PV8A 5AKLA 2IBKA 3QU7A 3M6ZA 1Z3EB 2L5YA 1XO1A 2G08A 2B6GA 1BPEA 3O0FA 2ALZA 3D2NA 3LVWA 4DWIA 1BGXT 1RXWA 2PMZC 4RQ0A 2XICA 3E58A 1KTQA 2QLTA 2ISOA 4QZCA 2EANA 2XVTA 3UPQA 4O3OA 3QUQA 2B0CA 2K4IA 3FM9A 1XSLA 1HJPA 3L5KA 3KBBA 3UXNA 3AEVA 2W9CB 3OPXA 1KFTA 1N63A 1NK8A 5CEHA 2KP7A 4Z6EA 4RT3A 4ECWA 3ONNA 2JZBB 3OGUA 1QSLA 8ICQA 3C1ZA 5GTIU 5KFEA 3ICXA 1S97A 4I28A 3PX4A 4PHAA 5BPCA 2ZJAA 5DBCA 2R8HA 1SKRA 8ICTA 1JXLA 4B9VA 1HUZA 2LYHA 1WUDA 4UB5A 1NI3A 3ETLA 2UVVA 4C8LA 7ICEA 2HOIA 3EW9A 1XO0A 3TKAA 2W11A 2XY5A 1AQ6A 3HRDD 5L1LA 1S5LU 1WG8A 2LKYA 4MF2A 4KMOB 4IL6U 4F4KA 4DL7A 5ALYA 2OCEA 5HHIA 9ICWA 9ICOA 5IILA 3TFRA 1UHUA 4RQMA 1KFSA 1S0OA 2YMPA 2QB1A 4P0PB 1QTMA 5AKJA 5AM0A 1V9PA 5DDMA 5KG0A 2MAXA 5ALIA 2H3ZA 5KT6A 2ZIUB 3SQIA 5KT4A 5IIOA 4I2DA 2XCAA 2V9WA 2KJ9A 5KFMA 4RQ4A 1Z00B 4DOCA 2A1JA 4BUGA 2F1IA 7ICOA 1QLNA 2GO7A 1ZQIA 2WHEA 1Z4OA 2PMZF 1RDFA 3F2DA 1KDHA 3GV5B 4M6WA 5CB1A 5CR0A 2BCRA 4ECSA 1BPXA 4F5QA 3MABA 1D8BA 3F5AA 1YZ7A 2BR0A 3ZDDA 4I2EA 2ZIVA 5JU5A 2I1QA 5J29A 1L5UA 3F2BA 2F44A 4MFAA 2KZMA 5J2KA 2W9MA 2WB1C 3NVVA 2H3IA 3QU2A 3ISDA 5J0XA 3C21A 4P0QA 4M04A 4CCHA 8ICGA 2MUTB 2NYVA 4YN4A 2BHNA 2XY7A 2YX8A 4IQVA 5HR7A 4GC7A 5AM3A 3EWAA 1HIWA 1ZQYA 1KEJA 4J03A 3TI0A 1K1QA 2C2DA 1BPBA 5KG3A 4ED1A 2QARB 1B43A 4O3NA 4DFDA 3PMNA 3H40A 1O08A 7ICVA 5E79U 3C5FA 5ALNA 4EEKA 2KSOA 2V4RA 4R64A 2F3NA 7ICGA 4BJQA 2E8NA 4ECRA 2JR5A 5FP0A 2KNJA 4R8UA 1C7YA 3QU5A 5ALWA 2BCQA 4BXOB 3HILA 4BWJA 9ICJA 4M47A 1WYGA 1ZD5A 2OM6A 4M9JA 3V6KA 5ALKA 4J9OA 3H8SA 1BVSA 4PZNA 4EELA 4RQ2A 2WTFA 3RTVA 3PVXA 3H8WA 1SGGA 4WJ3B 2R18A 5JUMA 2DPJA 4UB1A 2OH2A 2W55A 4FE3A 3EUB2 2A3VA 3NVZA 2J6SA 3WKDA 1B0XA 4F71A 1BPYA 2LYBA 2FE9A 2FPLA 3PW0A 3MDCA 4PJ0U 2XY6A 2BPGA 4F3OA 2KJ5A 4QZFA 2CN1A 1ZQFA 3PSPA 3WKEA 1A77A 2FI1A 1CEZA 5B5EU 1MSWD 4KLFA 2C2EA 1PK3A 2NRXA 4YMNA 1N5XA 3M9NB 3KHLA 2R8KA 2LM1A 5KFBA 3OJSA 2BDPA 1FFUA
chains in the Genus database with same CATH topology
3V7JA 4KLHA 3HX0A 1D8YA 3AU6A 2ZTCA 5J0RA 7ICQA 3GDXA 1DOQA 4EBCA 1L3UA 2RDIA 1ZJMA 4KLIA 3EYZA 4XA5A 1DGSA 2JEGA 4YMOA 3T5KA 5HMLA 5EWEA 1T8EA 7ICKA 3V6HA 2HHSA 3RJKA 4DSEA 4ED0A 5F9LA 2FLPA 4ECQA 4MFCA 1NKEA 3C1YA 3C5GA 4QZIA 3ISCA 4P4PA 3GIJA 7ICSA 1SKWA 1ZYQA 4DQSA 4KTQA 2Y1IA 5J2IA 4RPZA 5J2FA 1NK9A 4UQGA 5IINA 2JEIA 4RUAA 1JIHA 1T3NA 3RJFA 1U47A 4P4OA 1MQ3A 2PFNA 3Q8QB 4TQRA 2XGPA 3RJGA 1U45A 9ICSA 2VANA 4PHEA 4M9NA 9ICGA 5DBBA 1B22A 4O5KA 2NRWA 3M9MB 4UB3A 4B9UA 1ZQUA 3IHQB 5F9NA 4R66A 4TUPA 1TV9A 1MQ2A 4FBTA 1ZQPA 4JWNA 4F5PA 4UAZA 5EWFA 3Q8KA 7ICNA 2HHXA 5J2AA 2XGQA 4F4WA 4GXJA 1RXVA 1NK4A 3LWLA 4F2RA 4G3IA 1S76D 1NK5A 1NK0A 1NJWA 4KLOA 1H38A 5J2BA 1RYRA 5HMMA 5L1JA 2HVHA 5KG4A 4RQ5A 4R65A 1ZQLA 2KTQA 2AQ0A 3ZDEA 2KFNA 1XSPA 3JPOA 3PW4A 5KFUA 4DOAA 2VA2A 4TUQA 2FPMA 4DSLA 4I2GA 4RQ6A 3ZD8A 3TAPA 4DSFA 7ICMA 1ZQSA 1JXEA 3TFSA 3PMLA 2IA6A 2IMWP 2ASJA 4Z6FA 4NM1A 9ICRA 3EZ5A 9ICFA 3KHGA 4EZ6A 4GC6A 4NLKA 1IXRA 4RUCA 1ZQVA 5KFZA 3ZDBA 5KFKA 4F93B 3ORYA 4B9LA 5J0YA 5J0OA 3PX6A 2HHTA 1WCNA 4QWCA 1D9FA 3KTQA 4M9HA 5KFPA 3V6JA 2ZJ5A 4O0IA 8ICJA 4UBBA 2AGPA 1NJXA 5KFWA 3RRGA 5DB9A 5KG1A 4EEYA 2BQRA 4LZDA 4DSKA 1ZQKA 5KT7A 3KHHA 2BQUA 4P2HA 7ICFA 1ZQJA 2NRZA 2M9NA 5KFAA 4KLJA 4X5VA 4ED8A 5J2EA 4DS5A 3RBDA 4BDPA 5KFCA 2ZUDA 2JEJA 5CA7A 3UXPA 2PI4A 4RNOA 3Q8SB 3C2LA 2IHNA 1N48A 2BPFA 3JPNA 4ED3A 3Q8RB 2NRTA 5KFGA 5DB7A 3JPPA 2PFOA 4ELUA 4NXZA 4M9LA 9ICXA 9ICQA 4C8OA 2BPCA 1ZQNA 1S9FA 2FMQA 5DKWA 1RYSA 4DF8A 4HYKA 4RNNA 2BCUA 8ICBA 3T5HA 3QZ7A 1KLNA 4KITB 8ICUA 5DG8A 5EOZA 1CUKA 5DLFA 5KFRA 3C2MA 1XSNA 2VA3A 4F92B 5J0QA 1UA0A 1HUOA 3PO5A 1U48A 4YCXA 2RDJA 5L1IA 4KMUA 2F1JA 5DGBA 3UQ2A 8ICMA 5IIKA 8ICYA 3GIIA 3Q8PB 2ATLA 2AGQA 2W9AA 1JN3A 4ECYA 4DL2A 1ZQDA 5BOMA 3RB3A 5L9XA 5KG7A 3BQ0A 2AJQA 9ICTA 4EZ9A 4O5CA 2C22A 4E0DA 4O3RA 4J9LA 2J6TA 4QW9A 4TURA 2V4QA 4DL5A 4KLDA 4MFFA 2BGWA 5IIIA 3RH5A 7ICJA 4UBCA 4RQ7A 4I2BA 4J9KA 5KFHA 4NLNA 9ICCA 1COOA 2J6UA 4IR9A 4F4XA 7ICPA 4YR3A 1SKSA 1S0VA 2XC9A 8ICIA 3MGHA 4K4HA 9ICKA 1UT5A 4ECUA 4ELTA 3SYZA 5IIJA 3THVA 3PX0A 4DSIA 3PV8A 3JPRA 1NJZA 2IBKA 4DO9A 5D4BA 9ICBA 1Z3EB 2FPKA 1XO1A 1BPDA 1XWLA 4IQTA 9ICEA 1WCLA 1BPEA 8ICVA 4PH5A 2HHQA 5HNKA 1TAQA 2ALZA 5DG9A 3HW8A 4JWMA 5TZVA 1QSYA 4Q8EA 1JMSA 4QW8A 4UB4A 4R63A 7ICUA 2HHVA 4MEYA 4C8KA 3Q8LA 5KG2A 4DWIA 1BGXT 1RXWA 3QEBZ 3RB6A 2HVIA 1XC9A 2HHWA 4RQ0A 5D49A 4P4MA 1ZQOA 1SL2A 3MR2A 3PO4A 4O3QA 4QZ8A 5KFFA 3RRHA 1SL1A 1KFDA 1KTQA 4RQ1A 3RB4A 1T7PA 2ISPA 2XCPA 5CWRA 3V7KA 3MDAA 4FS1A 2BQ3A 2ISOA 4YR2A 4QZCA 4QZAA 5J2CA 3UPQA 3JPQA 5DQHA 4O3OA 1KSPA 1QSSA 3PW2A 1S10A 2W8LA 2C2RA 1ZQCA 4F5NA 1XSLA 1TAUA 1HJPA 4MF8A 4YFKA 2P6UA 8ICWA 4Q43A 3HT3A 4PGYA 5DGAA 3UXNA 4FO6A 2W9BB 8ICAA 5KFLA 2W9CB 4PGQA 9ICVA 5KFYA 3RJEA 4UB2A 4PHDA 2ZJ8A 3MR6A 1KFTA 5D46A 3TAQA 4O3PA 1NK8A 3FDSA 4IRKA 3MR3A 1BPZA 4I29A 4F4ZA 4Z6EA 2HW3A 4RT3A 3HWTA 1LB2B 4ECWA 3N4MB 3RR7A 2JZBB 3OGUA 1QSLA 1Y88A 3G6VA 3C1ZA 5KFEA 3ZDCA 1S97A 4ECXA 4I28A 8ICQA 3PR4A 4ED2A 4DOBA 4F2SA 4XRHA 4EBDA 4M9GA 5J2JA 5KFTA 3PX4A 9ICAA 4PHAA 5BPCA 1NOMA 2ZJAA 5DBCA 3JPSA 3ZDAA 3GFKB 2R8HA 4J9PA 3RR8A 4IRCA 1SKRA 4KLLA 2KZZA 4JV2A 4YD2A 1ZQRA 1JXLA 3LK9A 8ICTA 3RJIA 3QE9Y 5KFOA 1HUZA 4B9VA 4DQRA 3GV8B 2FMSA 5KG6A 3MBYA 4I2HA 2I9GA 2LYHA 4UB5A 8ICFA 4RQ3A 4I2AA 4O9MA 3ETLA 4F5OA 2UVVA 4C8LA 7ICEA 1X9MA 3EW9A 4QWAA 2A1JB 5L1KA 2ASDA 1MC8A 4Z6DA 5DQGA 4ELVA 3HP6A 4ED7A 4ECTA 2XY5A 3AUOA 1ZQHA 9ICIA 5L1LA 3BQ1A 5KT3A 4QZDA 2W9BA 4Q8FA 7ICHA 2W9CA 3OSNA 8ICPA 1U4BA 8ICOA 4NLGA 4YP3A 3MGIA 4DL3A 4DQIA 2HHUA 4MF2A 4RPYA 4JV0A 1X9WA 4F4KA 4DL7A 2B21A 2PFPA 3TQ1A 8ICKA 3N97B 4M6WB 2FLLA 5IIMA 3MFHA 3EPGA 3C23A 2ZUCA 4LVSA 2AGOA 4C8MA 1SL0A 2JZBA 2OWOA 5KFQA 5HHIA 9ICWA 9ICOA 1PZNA 4QZBA 5IILA 3TFRA 4DL4A 4JV1A 4F5RA 1S0NA 8ICCA 4JUZA 1KFSA 1XU4A 1S0OA 4UAWA 3RAXA 5KFVA 3H4BA 1ZQGA 1QTMA 4QWBA 3UQ0A 1V9PA 4I2JA 4F91B 3SZ2A 4QZHA 4F4YA 4BWMA 4ECVA 4KLQA 4B9TA 5DDMA 5KG0A 4Q44A 8ICZA 5J2HA 2MAXA 4KLSA 2UVRA 3MR5A 3Q8MA 4I2FA 4RZRA 8ICSA 5KT6A 5J2DA 4DQPA 4O3SA 5DG7A 4TQSA 4XQ8A 1NKCA 2VA8A 5KT4A 4LZGA 5IIOA 7ICRA 4I2DA 2XCAA 1NK6A 2V9WA 4KLTA 4DS4A 1TFRA 4I27A 5KFMA 4RQ4A 1ZQMA 1Z00B 4DOCA 2A1JA 1D8LA 1D9DA 2F1IA 1S0MA 3K75D 5EWGA 7ICOA 1QLNA 4KLMA 1TK5A 3ISBA 3GILA 1ZQIA 2KN7A 5DLGA 4RPXA 5CHGA 2AQ4A 4J9RA 4EYIB 4KN7A 1NJYA 3PW5A 5J0WA 9ICNA 1KDHA 3EPIA 1JX4A 2ZTDA 3GV5B 3PNCA 4F50A 1ZQAA 3B0XA 4I2IA 4M6WA 5CR0A 5CB1A 2W8KA 3V72A 2Y1JA 1L3VA 2BCRA 1TVAA 1A76A 4ECSA 1BPXA 4QZ9A 3C2KA 3MABA 5KT2A 3OHBA 2R8IA 4F5QA 4UAYA 4GXKA 4YXJA 5J0PA 9ICUA 3TARA 4YD1A 4PPXA 1X2IA 4DF4A 3ZD9A 3M9OB 8ICHA 4B9SA 4DFMA 1U9LA 3T3FA 2BR0A 3ZDDA 1LV5A 4I2EA 1ZQWA 5CP2A 3RBEA 2BKEA 4J9MA 3G6YA 5KFXA 2I1QA 1SZPA 4BGDA 5J29A 2H5XA 3V7LA 4R8UB 4Z6CA 3RH4A 1L5UA 3PY8A 3M8RA 1KRPA 4YXMA 5DDYA 3GIKA 4GLXA 7ICLA 4MFAA 2KZMA 5J2KA 2W9MA 2F1HA 3SV4A 3LWMA 2PXIA 3PW7A 3ISDA 5J0XA 3AU2A 3C21A 1ZQBA 2R8JA 3UXOA 5KFDA 1Z00A 4CCHA 4M04A 2MUTB 8ICGA 9ICHA 1N56A 3LDAA 1NKBA 4KLGA 3SV3A 4YN4A 4YQWA 3H7IA 3SI8A 8ICXA 4QWEA 2BHNA 3GIMA 3QZ8A 3NGDA 2XY7A 2P66A 3G6XA 1AROP 4IQVA 4GC7A 7ICIA 3TANA 3EWAA 1ZQYA 4Q45A 1KEJA 3TI0A 1K1QA 2C2DA 1IM4A 5DB6A 1BPBA 3OSPA 5KG3A 2PFQA 4ED1A 1B43A 4O3NA 3JPTA 2ZTEA 2FLNA 3PMNA 5KFJA 3NTUA 3H40A 7ICVA 4O5EA 5KFIA 2R8GA 4DLEA 4YR0A 3K4GA 4DEZA 5C5JA 1ZJNA 1TK0A 1L3SA 4K4IA 2KFZA 8ICEA 4XUSA 3C5FA 3GV7B 5KFSA 1UT8A 2V4RA 5J0TA 4DSJA 1ZQTA 4R64A 3RJHA 4IR1A 4FBUA 3M8SA 4JK1A 5J2GA 4F8RA 7ICGA 5J0SA 4FS2A 1TK8A 1ZQZA 3QEAZ 4ECRA 3MFIA 4DQQA 3H8JA 3RAQA 4R8UA 3RJJA 5BOLA 1C7YA 2BCVA 2Q0ZX 3T5JA 4NY8A 2BCQA 4BXOB 4KN4A 1X9SA 4B9NA 4J9SA 4IQWA 4KLEA 3RB0A 4BWJA 4PHPA 9ICJA 8ICRA 2ZUBA 4M47A 2BCSA 4M9JA 3V6KA 4DFJA 4J9OA 2ASLA 4NM2A 1RPLA 5DB8A 2MUTA 4DFKA 1NK7A 3H8SA 9ICMA 2DFLA 1ZETA 4B9MA 1BVSA 4TUSA 1L3TA 1T4GA 4ZH4A 4IQUA 4RQ2A 2WTFA 3RTVA 3PVXA 2AU0A 3H8WA 2PI5A 4KLUA 5KG5A 4ED6A 4J9NA 5JUMA 2DPJA 4UB1A 4PGXA 1ZQXA 4J9QA 4ECZA 3RH6A 1UA1A 2JEFA 1TKDA 4MEXA 9ICLA 1XS9D 2J6SA 5HHHA 4I2CA 2UVWA 4EBEA 4DLGA 3BQ2A 4RT2A 2DPIA 5KFNA 1BPYA 2C28A 4M0AA 2FPLA 4YVZA 3PW0A 3MDCA 1EXNA 5J0UA 5KTQA 3BJYA 3HPOA 2XY6A 4K4GA 3OHAA 4DFPA 1K1SA 2GWSA 3E2EA 1ZQEA 3T5LA 2BPGA 4NLZA 4F3OA 4QZEA 4QZFA 3PR5B 4M2YA 5CJ7A 4QZGA 3OJUA 1ZQFA 2P6RA 1S77D 3BQTA 4GXIA 5KT5A 3KHRA 4BXOA 5DBAA 2NRVA 2FMPA 4YG2A 2IHMA 4C8NA 1A77A 7ICTA 2UVUA 1CEZA 8ICNA 1MSWD 4KLFA 4YMMA 5HP4A 8ICLA 4IRDA 3IM1A 2C2EA 4RQ8A 3GQCA 2NRXA 4YMNA 4DL6A 1RZTA 5DQIA 3M9NB 4RU9A 2KZ3A 3KHLA 2R8KA 1ZQQA 3FYHA 3H4DA 5KFBA 3BDPA 9ICPA 3OJSA 2XO7A 1U49A 2BDPA 4RNMA 4EYHB 4QWDA 3B0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7J A;  4KLH A;  3HX0 A;  1D8Y A;  3AU6 A;  2ZTC A;  5J0R A;  7ICQ A;  3GDX A;  1DOQ A;  4EBC A;  1L3U A;  2RDI A;  1ZJM A;  4KLI A;  3EYZ A;  4XA5 A;  1DGS A;  2JEG A;  4YMO A;  3T5K A;  5HML A;  5EWE A;  1T8E A;  7ICK A;  3V6H A;  2HHS A;  3RJK A;  4DSE A;  4ED0 A;  5F9L A;  2FLP A;  4ECQ A;  4MFC A;  1NKE A;  3C1Y A;  3C5G A;  4QZI A;  3ISC A;  4P4P A;  3GIJ A;  7ICS A;  1SKW A;  1ZYQ A;  4DQS A;  4KTQ A;  2Y1I A;  5J2I A;  4RPZ A;  5J2F A;  1NK9 A;  4UQG A;  5IIN A;  2JEI A;  4RUA A;  1JIH A;  1T3N A;  3RJF A;  1U47 A;  4P4O A;  1MQ3 A;  2PFN A;  3Q8Q B;  4TQR A;  2XGP A;  3RJG A;  1U45 A;  9ICS A;  2VAN A;  4PHE A;  4M9N A;  9ICG A;  5DBB A;  1B22 A;  4O5K A;  2NRW A;  3M9M B;  4UB3 A;  4B9U A;  1ZQU A;  3IHQ B;  5F9N A;  4R66 A;  4TUP A;  1TV9 A;  1MQ2 A;  4FBT A;  1ZQP A;  4JWN A;  4F5P A;  4UAZ A;  5EWF A;  3Q8K A;  7ICN A;  2HHX A;  5J2A A;  2XGQ A;  4F4W A;  4GXJ A;  1RXV A;  1NK4 A;  3LWL A;  4F2R A;  4G3I A;  1S76 D;  1NK5 A;  1NK0 A;  1NJW A;  4KLO A;  1H38 A;  5J2B A;  1RYR A;  5HMM A;  5L1J A;  2HVH A;  5KG4 A;  4RQ5 A;  4R65 A;  1ZQL A;  2KTQ A;  2AQ0 A;  3ZDE A;  2KFN A;  1XSP A;  3JPO A;  3PW4 A;  5KFU A;  4DOA A;  2VA2 A;  4TUQ A;  2FPM A;  4DSL A;  4I2G A;  4RQ6 A;  3ZD8 A;  3TAP A;  4DSF A;  7ICM A;  1ZQS A;  1JXE A;  3TFS A;  3PML A;  2IA6 A;  2IMW P;  2ASJ A;  4Z6F A;  4NM1 A;  9ICR A;  3EZ5 A;  9ICF A;  3KHG A;  4EZ6 A;  4GC6 A;  4NLK A;  1IXR A;  4RUC A;  1ZQV A;  5KFZ A;  3ZDB A;  5KFK A;  4F93 B;  3ORY A;  4B9L A;  5J0Y A;  5J0O A;  3PX6 A;  2HHT A;  1WCN A;  4QWC A;  1D9F A;  3KTQ A;  4M9H A;  5KFP A;  3V6J A;  2ZJ5 A;  4O0I A;  8ICJ A;  4UBB A;  2AGP A;  1NJX A;  5KFW A;  3RRG A;  5DB9 A;  5KG1 A;  4EEY A;  2BQR A;  4LZD A;  4DSK A;  1ZQK A;  5KT7 A;  3KHH A;  2BQU A;  4P2H A;  7ICF A;  1ZQJ A;  2NRZ A;  2M9N A;  5KFA A;  4KLJ A;  4X5V A;  4ED8 A;  5J2E A;  4DS5 A;  3RBD A;  4BDP A;  5KFC A;  2ZUD A;  2JEJ A;  5CA7 A;  3UXP A;  2PI4 A;  4RNO A;  3Q8S B;  3C2L A;  2IHN A;  1N48 A;  2BPF A;  3JPN A;  4ED3 A;  3Q8R B;  2NRT A;  5KFG A;  5DB7 A;  3JPP A;  2PFO A;  4ELU A;  4NXZ A;  4M9L A;  9ICX A;  9ICQ A;  4C8O A;  2BPC A;  1ZQN A;  1S9F A;  2FMQ A;  5DKW A;  1RYS A;  4DF8 A;  4HYK A;  4RNN A;  2BCU A;  8ICB A;  3T5H A;  3QZ7 A;  1KLN A;  4KIT B;  8ICU A;  5DG8 A;  5EOZ A;  1CUK A;  5DLF A;  5KFR A;  3C2M A;  1XSN A;  2VA3 A;  4F92 B;  5J0Q A;  1UA0 A;  1HUO A;  3PO5 A;  1U48 A;  4YCX A;  2RDJ A;  5L1I A;  4KMU A;  2F1J A;  5DGB A;  3UQ2 A;  8ICM A;  5IIK A;  8ICY A;  3GII A;  3Q8P B;  2ATL A;  2AGQ A;  2W9A A;  1JN3 A;  4ECY A;  4DL2 A;  1ZQD A;  5BOM A;  3RB3 A;  5L9X A;  5KG7 A;  3BQ0 A;  2AJQ A;  9ICT A;  4EZ9 A;  4O5C A;  2C22 A;  4E0D A;  4O3R A;  4J9L A;  2J6T A;  4QW9 A;  4TUR A;  2V4Q A;  4DL5 A;  4KLD A;  4MFF A;  2BGW A;  5III A;  3RH5 A;  7ICJ A;  4UBC A;  4RQ7 A;  4I2B A;  4J9K A;  5KFH A;  4NLN A;  9ICC A;  1COO A;  2J6U A;  4IR9 A;  4F4X A;  7ICP A;  4YR3 A;  1SKS A;  1S0V A;  2XC9 A;  8ICI A;  3MGH A;  4K4H A;  9ICK A;  1UT5 A;  4ECU A;  4ELT A;  3SYZ A;  5IIJ A;  3THV A;  3PX0 A;  4DSI A;  3PV8 A;  3JPR A;  1NJZ A;  2IBK A;  4DO9 A;  5D4B A;  9ICB A;  1Z3E B;  2FPK A;  1XO1 A;  1BPD A;  1XWL A;  4IQT A;  9ICE A;  1WCL A;  1BPE A;  8ICV A;  4PH5 A;  2HHQ A;  5HNK A;  1TAQ A;  2ALZ A;  5DG9 A;  3HW8 A;  4JWM A;  5TZV A;  1QSY A;  4Q8E A;  1JMS A;  4QW8 A;  4UB4 A;  4R63 A;  7ICU A;  2HHV A;  4MEY A;  4C8K A;  3Q8L A;  5KG2 A;  4DWI A;  1BGX T;  1RXW A;  3QEB Z;  3RB6 A;  2HVI A;  1XC9 A;  2HHW A;  4RQ0 A;  5D49 A;  4P4M A;  1ZQO A;  1SL2 A;  3MR2 A;  3PO4 A;  4O3Q A;  4QZ8 A;  5KFF A;  3RRH A;  1SL1 A;  1KFD A;  1KTQ A;  4RQ1 A;  3RB4 A;  1T7P A;  2ISP A;  2XCP A;  5CWR A;  3V7K A;  3MDA A;  4FS1 A;  2BQ3 A;  2ISO A;  4YR2 A;  4QZC A;  4QZA A;  5J2C A;  3UPQ A;  3JPQ A;  5DQH A;  4O3O A;  1KSP A;  1QSS A;  3PW2 A;  1S10 A;  2W8L A;  2C2R A;  1ZQC A;  4F5N A;  1XSL A;  1TAU A;  1HJP A;  4MF8 A;  4YFK A;  2P6U A;  8ICW A;  4Q43 A;  3HT3 A;  4PGY A;  5DGA A;  3UXN A;  4FO6 A;  2W9B B;  8ICA A;  5KFL A;  2W9C B;  4PGQ A;  9ICV A;  5KFY A;  3RJE A;  4UB2 A;  4PHD A;  2ZJ8 A;  3MR6 A;  1KFT A;  5D46 A;  3TAQ A;  4O3P A;  1NK8 A;  3FDS A;  4IRK A;  3MR3 A;  1BPZ A;  4I29 A;  4F4Z A;  4Z6E A;  2HW3 A;  4RT3 A;  3HWT A;  1LB2 B;  4ECW A;  3N4M B;  3RR7 A;  2JZB B;  3OGU A;  1QSL A;  1Y88 A;  3G6V A;  3C1Z A;  5KFE A;  3ZDC A;  1S97 A;  4ECX A;  4I28 A;  8ICQ A;  3PR4 A;  4ED2 A;  4DOB A;  4F2S A;  4XRH A;  4EBD A;  4M9G A;  5J2J A;  5KFT A;  3PX4 A;  9ICA A;  4PHA A;  5BPC A;  1NOM A;  2ZJA A;  5DBC A;  3JPS A;  3ZDA A;  3GFK B;  2R8H A;  4J9P A;  3RR8 A;  4IRC A;  1SKR A;  4KLL A;  2KZZ A;  4JV2 A;  4YD2 A;  1ZQR A;  1JXL A;  3LK9 A;  8ICT A;  3RJI A;  3QE9 Y;  5KFO A;  1HUZ A;  4B9V A;  4DQR A;  3GV8 B;  2FMS A;  5KG6 A;  3MBY A;  4I2H A;  2I9G A;  2LYH A;  4UB5 A;  8ICF A;  4RQ3 A;  4I2A A;  4O9M A;  3ETL A;  4F5O A;  2UVV A;  4C8L A;  7ICE A;  1X9M A;  3EW9 A;  4QWA A;  2A1J B;  5L1K A;  2ASD A;  1MC8 A;  4Z6D A;  5DQG A;  4ELV A;  3HP6 A;  4ED7 A;  4ECT A;  2XY5 A;  3AUO A;  1ZQH A;  9ICI A;  5L1L A;  3BQ1 A;  5KT3 A;  4QZD A;  2W9B A;  4Q8F A;  7ICH A;  2W9C A;  3OSN A;  8ICP A;  1U4B A;  8ICO A;  4NLG A;  4YP3 A;  3MGI A;  4DL3 A;  4DQI A;  2HHU A;  4MF2 A;  4RPY A;  4JV0 A;  1X9W A;  4F4K A;  4DL7 A;  2B21 A;  2PFP A;  3TQ1 A;  8ICK A;  3N97 B;  4M6W B;  2FLL A;  5IIM A;  3MFH A;  3EPG A;  3C23 A;  2ZUC A;  4LVS A;  2AGO A;  4C8M A;  1SL0 A;  2JZB A;  2OWO A;  5KFQ A;  5HHI A;  9ICW A;  9ICO A;  1PZN A;  4QZB A;  5IIL A;  3TFR A;  4DL4 A;  4JV1 A;  4F5R A;  1S0N A;  8ICC A;  4JUZ A;  1KFS A;  1XU4 A;  1S0O A;  4UAW A;  3RAX A;  5KFV A;  3H4B A;  1ZQG A;  1QTM A;  4QWB A;  3UQ0 A;  1V9P A;  4I2J A;  4F91 B;  3SZ2 A;  4QZH A;  4F4Y A;  4BWM A;  4ECV A;  4KLQ A;  4B9T A;  5DDM A;  5KG0 A;  4Q44 A;  8ICZ A;  5J2H A;  2MAX A;  4KLS A;  2UVR A;  3MR5 A;  3Q8M A;  4I2F A;  4RZR A;  8ICS A;  5KT6 A;  5J2D A;  4DQP A;  4O3S A;  5DG7 A;  4TQS A;  4XQ8 A;  1NKC A;  2VA8 A;  5KT4 A;  4LZG A;  5IIO A;  7ICR A;  4I2D A;  2XCA A;  1NK6 A;  2V9W A;  4KLT A;  4DS4 A;  1TFR A;  4I27 A;  5KFM A;  4RQ4 A;  1ZQM A;  1Z00 B;  4DOC A;  2A1J A;  1D8L A;  1D9D A;  2F1I A;  1S0M A;  3K75 D;  5EWG A;  7ICO A;  1QLN A;  4KLM A;  1TK5 A;  3ISB A;  3GIL A;  1ZQI A;  2KN7 A;  5DLG A;  4RPX A;  5CHG A;  2AQ4 A;  4J9R A;  4EYI B;  4KN7 A;  1NJY A;  3PW5 A;  5J0W A;  9ICN A;  1KDH A;  3EPI A;  1JX4 A;  2ZTD A;  3GV5 B;  3PNC A;  4F50 A;  1ZQA A;  3B0X A;  4I2I A;  4M6W A;  5CR0 A;  5CB1 A;  2W8K A;  3V72 A;  2Y1J A;  1L3V A;  2BCR A;  1TVA A;  1A76 A;  4ECS A;  1BPX A;  4QZ9 A;  3C2K A;  3MAB A;  5KT2 A;  3OHB A;  2R8I A;  4F5Q A;  4UAY A;  4GXK A;  4YXJ A;  5J0P A;  9ICU A;  3TAR A;  4YD1 A;  4PPX A;  1X2I A;  4DF4 A;  3ZD9 A;  3M9O B;  8ICH A;  4B9S A;  4DFM A;  1U9L A;  3T3F A;  2BR0 A;  3ZDD A;  1LV5 A;  4I2E A;  1ZQW A;  5CP2 A;  3RBE A;  2BKE A;  4J9M A;  3G6Y A;  5KFX A;  2I1Q A;  1SZP A;  4BGD A;  5J29 A;  2H5X A;  3V7L A;  4R8U B;  4Z6C A;  3RH4 A;  1L5U A;  3PY8 A;  3M8R A;  1KRP A;  4YXM A;  5DDY A;  3GIK A;  4GLX A;  7ICL A;  4MFA A;  2KZM A;  5J2K A;  2W9M A;  2F1H A;  3SV4 A;  3LWM A;  2PXI A;  3PW7 A;  3ISD A;  5J0X A;  3AU2 A;  3C21 A;  1ZQB A;  2R8J A;  3UXO A;  5KFD A;  1Z00 A;  4CCH A;  4M04 A;  2MUT B;  8ICG A;  9ICH A;  1N56 A;  3LDA A;  1NKB A;  4KLG A;  3SV3 A;  4YN4 A;  4YQW A;  3H7I A;  3SI8 A;  8ICX A;  4QWE A;  2BHN A;  3GIM A;  3QZ8 A;  3NGD A;  2XY7 A;  2P66 A;  3G6X A;  1ARO P;  4IQV A;  4GC7 A;  7ICI A;  3TAN A;  3EWA A;  1ZQY A;  4Q45 A;  1KEJ A;  3TI0 A;  1K1Q A;  2C2D A;  1IM4 A;  5DB6 A;  1BPB A;  3OSP A;  5KG3 A;  2PFQ A;  4ED1 A;  1B43 A;  4O3N A;  3JPT A;  2ZTE A;  2FLN A;  3PMN A;  5KFJ A;  3NTU A;  3H40 A;  7ICV A;  4O5E A;  5KFI A;  2R8G A;  4DLE A;  4YR0 A;  3K4G A;  4DEZ A;  5C5J A;  1ZJN A;  1TK0 A;  1L3S A;  4K4I A;  2KFZ A;  8ICE A;  4XUS A;  3C5F A;  3GV7 B;  5KFS A;  1UT8 A;  2V4R A;  5J0T A;  4DSJ A;  1ZQT A;  4R64 A;  3RJH A;  4IR1 A;  4FBU A;  3M8S A;  4JK1 A;  5J2G A;  4F8R A;  7ICG A;  5J0S A;  4FS2 A;  1TK8 A;  1ZQZ A;  3QEA Z;  4ECR A;  3MFI A;  4DQQ A;  3H8J A;  3RAQ A;  4R8U A;  3RJJ A;  5BOL A;  1C7Y A;  2BCV A;  2Q0Z X;  3T5J A;  4NY8 A;  2BCQ A;  4BXO B;  4KN4 A;  1X9S A;  4B9N A;  4J9S A;  4IQW A;  4KLE A;  3RB0 A;  4BWJ A;  4PHP A;  9ICJ A;  8ICR A;  2ZUB A;  4M47 A;  2BCS A;  4M9J A;  3V6K A;  4DFJ A;  4J9O A;  2ASL A;  4NM2 A;  1RPL A;  5DB8 A;  2MUT A;  4DFK A;  1NK7 A;  3H8S A;  9ICM A;  2DFL A;  1ZET A;  4B9M A;  1BVS A;  4TUS A;  1L3T A;  1T4G A;  4ZH4 A;  4IQU A;  4RQ2 A;  2WTF A;  3RTV A;  3PVX A;  2AU0 A;  3H8W A;  2PI5 A;  4KLU A;  5KG5 A;  4ED6 A;  4J9N A;  5JUM A;  2DPJ A;  4UB1 A;  4PGX A;  1ZQX A;  4J9Q A;  4ECZ A;  3RH6 A;  1UA1 A;  2JEF A;  1TKD A;  4MEX A;  9ICL A;  1XS9 D;  2J6S A;  5HHH A;  4I2C A;  2UVW A;  4EBE A;  4DLG A;  3BQ2 A;  4RT2 A;  2DPI A;  5KFN A;  1BPY A;  2C28 A;  4M0A A;  2FPL A;  4YVZ A;  3PW0 A;  3MDC A;  1EXN A;  5J0U A;  5KTQ A;  3BJY A;  3HPO A;  2XY6 A;  4K4G A;  3OHA A;  4DFP A;  1K1S A;  2GWS A;  3E2E A;  1ZQE A;  3T5L A;  2BPG A;  4NLZ A;  4F3O A;  4QZE A;  4QZF A;  3PR5 B;  4M2Y A;  5CJ7 A;  4QZG A;  3OJU A;  1ZQF A;  2P6R A;  1S77 D;  3BQT A;  4GXI A;  5KT5 A;  3KHR A;  4BXO A;  5DBA A;  2NRV A;  2FMP A;  4YG2 A;  2IHM A;  4C8N A;  1A77 A;  7ICT A;  2UVU A;  1CEZ A;  8ICN A;  1MSW D;  4KLF A;  4YMM A;  5HP4 A;  8ICL A;  4IRD A;  3IM1 A;  2C2E A;  4RQ8 A;  3GQC A;  2NRX A;  4YMN A;  4DL6 A;  1RZT A;  5DQI A;  3M9N B;  4RU9 A;  2KZ3 A;  3KHL A;  2R8K A;  1ZQQ A;  3FYH A;  3H4D A;  5KFB A;  3BDP A;  9ICP A;  3OJS A;  2XO7 A;  1U49 A;  2BDP A;  4RNM A;  4EYH B;  4QWD A;  3B0Y A; 
#chains in the Genus database with same CATH topology
 3AU6 A;  4CF4 A;  3GDX A;  2RDI A;  3D2Q A;  2GOL A;  5ALF A;  3V6H A;  2HHS A;  2WB1 F;  4HAI A;  4ED0 A;  2ESE A;  2FLP A;  4ECQ A;  4MFC A;  3FAH A;  4QZI A;  4P4P A;  2OHF A;  3GIJ A;  2Y1I A;  5AIB A;  3I1Y A;  4UAR A;  5B66 U;  2ZXI A;  4UB6 U;  1T94 A;  1NK9 A;  4RUA A;  1T3N A;  4TQR A;  2XGP A;  1U45 A;  9ICS A;  4PHE A;  1TAM A;  4Y2U A;  5ALU A;  2KKP A;  2AH5 A;  4JMU A;  3IHQ B;  1MQ2 A;  4JWN A;  1ZQP A;  3WKC A;  1SV0 C;  3I76 A;  1DXS A;  4GXJ A;  1S76 D;  5AK4 A;  1RYR A;  3GZF A;  5HMM A;  2KTQ A;  5AI4 A;  1ZQL A;  5KFU A;  4DOA A;  2LBO A;  4DSL A;  3ZD8 A;  3TAP A;  4Y2X A;  1SB3 C;  4DSF A;  1RQN A;  4Z6F A;  4NM1 A;  3EZ5 A;  9ICF A;  4NLK A;  1IXR A;  2WFA A;  1QCK A;  2RLT A;  3ZDB A;  3ORY A;  4UW9 A;  4B9L A;  5AK3 A;  1D9F A;  2EQY A;  5KFP A;  4OCZ A;  1HEK A;  4Y2P A;  5G5G A;  1NJX A;  5H2F U;  5DB9 A;  4ICA A;  1Q3V A;  2BQU A;  2ZIX A;  1ZQJ A;  4KLJ A;  3TAD A;  2PI4 A;  2IHN A;  4ELU A;  2E8M A;  5DB7 A;  1ZQN A;  2BCU A;  2LPE A;  3T5H A;  3QZ7 A;  5DLF A;  2OYY A;  2K8A A;  3N7S C;  5AKX A;  2F1J A;  2KK0 A;  3A0H U;  3GII A;  2AGQ A;  2W9A A;  3OTQ A;  5ALH A;  4DL2 A;  1ZQD A;  5BOM A;  3RB3 A;  1ZQ1 C;  5L9X A;  4EZ9 A;  4Y2Y A;  4O5C A;  4E0D A;  4J9L A;  4TUR A;  5III A;  3RH5 A;  2MA1 A;  4UBC A;  4J9K A;  9ICC A;  1COO A;  4F4X A;  1S0V A;  3AQF A;  5IIJ A;  3PX0 A;  3K1Z A;  1NJZ A;  2HCF A;  4DO9 A;  4IQT A;  4F72 A;  8ICV A;  4PH5 A;  5HNK A;  1TAQ A;  2VIX A;  4JWM A;  1QSY A;  4Q8E A;  2D8C A;  4R63 A;  2E8O A;  3Q8L A;  2IOH A;  1COK A;  1N61 A;  2HSZ A;  3QEB Z;  1XC9 A;  2DQN B;  4P4M A;  1SL2 A;  5KFF A;  1SL1 A;  1T7P A;  1KFD A;  2JXJ A;  2ISP A;  3V7K A;  4YR2 A;  1WWU A;  1L8L A;  5AKH A;  3PW2 A;  1S10 A;  2W8L A;  4F5N A;  4MF8 A;  2P6U A;  3HT3 A;  2LHT A;  2W9B B;  5ALT A;  4PGQ A;  3RJE A;  4PHD A;  4US8 A;  4O3P A;  3MR3 A;  5F3X B;  1BPZ A;  4I29 A;  3HWT A;  3RR7 A;  1Y88 A;  4ECX A;  4EBD A;  9ICA A;  3WK4 A;  1KW4 A;  3ZDA A;  2KZZ A;  4YD2 A;  1IIP A;  4DQR A;  3GV8 B;  4RQ3 A;  2W3S A;  1KN5 A;  2HOF A;  1Q3U A;  1J2M A;  1X9M A;  3HJE A;  4ECT A;  1ZQH A;  1QH9 A;  2KJ8 A;  1BNO A;  7ICH A;  4Q8F A;  2W9C A;  1U4B A;  8ICO A;  4NLG A;  4YP3 A;  3MGI A;  4DQI A;  3BQ7 A;  2B21 A;  2FLL A;  1SWW A;  4C8M A;  2JZB A;  2VKQ A;  1PZN A;  4UAW A;  1ZQG A;  3UQ0 A;  3SZ2 A;  2KHV A;  4QZH A;  5KAF U;  4BWM A;  2WF9 A;  3RFA A;  4B9T A;  2YMQ A;  5J2H A;  4KLS A;  3L4P A;  1UCV A;  3Q8M A;  5AKG A;  3QNM A;  1PK1 B;  3PSF A;  4XQ8 A;  4DS4 A;  4I27 A;  1ZQM A;  1D9D A;  3H0R B;  4NL9 C;  1S0M A;  1J2N A;  4KLM A;  3ISB A;  2W54 A;  1KQQ A;  4J9R A;  2JH7 A;  1NZP A;  4JB3 A;  4KN7 A;  2XID A;  2P35 A;  2ZXH A;  1JX4 A;  5ALR A;  3PNC A;  3KKA A;  2OEH A;  3B0X A;  3V72 A;  4CGZ A;  1MA7 A;  2K8C B;  1TVA A;  1DRG A;  3C2K A;  2R8I A;  2HMX A;  4DF4 A;  3ZD9 A;  4B9S A;  4P0P A;  3PST A;  3RBE A;  2BKE A;  2G5I B;  5KFX A;  2W04 A;  3PZP A;  4Z6C A;  4YXM A;  3SD7 A;  3GIK A;  5ALP A;  1X6I A;  2ZIU A;  5ALX A;  2K8B B;  4OJP A;  2ZIW B;  2F1H A;  3LWM A;  3PW7 A;  3AU2 A;  1UQV A;  3CRX A;  2YB1 A;  1Z00 A;  9ICH A;  3SAF A;  3LDA A;  3WKA A;  3H7I A;  8ICX A;  1VDV A;  3GIM A;  3NGD A;  2EAM A;  3LVV A;  1IM4 A;  5DB6 A;  4U7C A;  2PFQ A;  4NJ8 A;  3JPT A;  2ZTE A;  2FLN A;  1ZD2 P;  3CYM A;  2DF4 B;  4UB8 U;  4K4I A;  1YZ6 A;  4DEZ A;  4YR0 A;  2KFZ A;  3GV7 B;  5KFS A;  5KL8 B;  2K4H A;  3SMV A;  3H8J A;  2LM4 A;  1IV8 A;  2Q0Z X;  4B9N A;  4IQW A;  4KLE A;  1Q46 A;  3SR6 A;  2ZUB A;  2G07 A;  2BCS A;  2W43 A;  4DFJ A;  2ASL A;  3CNH A;  1RPL A;  2MUT A;  4Y2V A;  9ICM A;  1J97 A;  4B9M A;  4EX7 A;  1N60 A;  1L3T A;  2RQ5 A;  4IQU A;  2QB0 B;  5ALL A;  2PI5 A;  5KG5 A;  4ED6 A;  4J9Q A;  1UA1 A;  1TKD A;  1IG6 A;  2QAR A;  1SZH A;  2ODG A;  5ALG A;  3S6J A;  5HHH A;  5AKE A;  3BQ2 A;  2FDR A;  3QUB A;  2M0N A;  4C80 A;  2WF6 A;  2ZG6 A;  2FJ6 A;  2C28 A;  4M0A A;  4YVZ A;  2Y0S F;  2YY6 A;  5KTQ A;  3OHA A;  1K1S A;  3E2E A;  1RM6 C;  3T5L A;  4M2Y A;  1S77 D;  4GXI A;  2MSN A;  3KHR A;  4BXO A;  5DBA A;  3IG8 A;  2IHM A;  3NS1 A;  1V38 A;  2UVU A;  8ICN A;  2WF5 A;  4YMM A;  8ICL A;  4IRD A;  3IM1 A;  3M1Y A;  5J8Y A;  1F0M A;  4DL6 A;  3RJG A;  2WAQ C;  3FYH A;  3H4D A;  1ZQQ A;  2XO7 A;  4RNM A;  4QWD A;  4DCC A;  3WK7 A;  3V7J A;  4KLH A;  1QQ5 A;  7ICQ A;  3MGV A;  4QNL A;  4EBC A;  1ZJM A;  1DGJ A;  1DGS A;  2JEG A;  5K4L A;  4YMO A;  1T8E A;  3RJK A;  5KL1 B;  1NKE A;  2Y9T A;  5ALD A;  1SKW A;  4CE6 A;  1QQ7 A;  5J2I A;  3BS5 B;  1OW5 A;  4UQG A;  5IIN A;  2JEI A;  4MHV A;  2VAN A;  1B22 A;  3I28 A;  3WK8 A;  4RQN A;  1ZQU A;  1JAL A;  5F9N A;  4R66 A;  4TUP A;  1TV9 A;  4FBT A;  2JV3 A;  5J2A A;  2XGQ A;  4F4W A;  2DUY A;  1RXV A;  1NK4 A;  3LWL A;  4F2R A;  2VJ4 A;  1NK0 A;  1H38 A;  2CXY A;  5KG4 A;  4R65 A;  3CW2 C;  1XSP A;  1L6N A;  4TUQ A;  1VLB A;  5AM2 A;  1ZQS A;  3TFS A;  1LVH A;  2CPR A;  4G9B A;  2ASJ A;  9ICR A;  5ALQ A;  3WK9 A;  5KFZ A;  1NNL A;  5KFK A;  4CF5 A;  3AN1 A;  5G5H A;  2MRL A;  3RRG A;  4EEY A;  2BQR A;  5ALM A;  1ZQK A;  3KHH A;  2NV3 A;  4X5V A;  3MC1 A;  3WK5 A;  4DS5 A;  2A1A A;  3UXP A;  5ALE A;  3Q8S B;  4AYB C;  3J81 j;  2BPF A;  3ZI4 A;  3JPN A;  2GLE A;  4M9L A;  3JPP A;  4C8O A;  1S9F A;  1RYS A;  4DF8 A;  8ICB A;  1KLN A;  4KIT B;  8ICU A;  2W7O A;  5KFR A;  1RYU A;  1VJ5 A;  2WAQ F;  5J0Q A;  4YCX A;  5L1I A;  8ICM A;  5DGB A;  2KHQ A;  8ICY A;  1X40 A;  2H3V A;  4C4S A;  2C22 A;  3ED5 A;  4QW9 A;  3IDW A;  4MFF A;  2GH1 A;  7ICJ A;  3N7R C;  2QKQ A;  5KFH A;  3C28 A;  1RG6 A;  3MGH A;  9ICK A;  3DDH A;  2NO5 A;  3BZK A;  3AQE A;  3BS7 A;  3JPR A;  1ZXI A;  5D4B A;  2FPK A;  1BPD A;  9ICE A;  1WCL A;  2KIW A;  4OJ5 A;  5AK5 A;  5KAI U;  5TZV A;  2EH9 A;  1JMS A;  4UB4 A;  7ICU A;  5AM5 A;  4C8K A;  3QUT A;  5KG2 A;  2KVC A;  3RB6 A;  4RQ1 A;  4I2A A;  2XCP A;  3MDA A;  2BDU A;  5DQH A;  2JGA A;  2RHF A;  1KSP A;  2C2R A;  4YFK A;  8ICW A;  4Q43 A;  4PGY A;  5DGA A;  3WK6 A;  1V85 A;  4FO6 A;  8ICA A;  5KFL A;  3NVY A;  2E1F A;  1ZRN A;  5KFY A;  2HBK A;  4UB2 A;  3TAQ A;  3FDS A;  5AI6 A;  4IRK A;  3KZI U;  1X42 A;  5AM4 A;  2G0A A;  4F4Z A;  1LB2 B;  2IOF A;  3N4M B;  3ZDC A;  4ED2 A;  4DOB A;  4M9G A;  3F2C A;  5J2J A;  5KFT A;  2YML A;  4Y2S A;  1NOM A;  3F5E A;  4IRC A;  4JV2 A;  3QE9 Y;  5AKK A;  1TE2 A;  3UMG A;  4I2H A;  4QIW C;  8ICF A;  4AYB F;  4O9M A;  2DWQ A;  4QWA A;  4ELV A;  2HBL A;  2LMR A;  3BQ1 A;  1OUQ A;  4QZD A;  2W9B A;  2HHU A;  4RPY A;  4EX6 A;  2PFP A;  4FZL A;  4CNQ A;  3TQ1 A;  3N97 B;  5IIM A;  3C23 A;  2ZUC A;  2AGO A;  1SL0 A;  2OWO A;  2Y9U A;  2Z7J A;  4QZB A;  3WU2 U;  4F5R A;  3U26 A;  1S0N A;  4JUZ A;  1XU4 A;  2AXT U;  3NAS A;  4QWB A;  4F91 B;  4I2J A;  2BZF A;  4F4Y A;  4KLQ A;  4USA A;  4Q44 A;  2D6F C;  2UVR A;  4PL1 A;  1T3Q A;  8ICS A;  4FZM A;  2EZZ A;  2IOF K;  1NKC A;  4LZG A;  4KLT A;  1NK6 A;  2YQE A;  1X6J A;  3SEI A;  3K75 D;  5EE3 A;  5EWG A;  1P7D A;  4PZO A;  5ALV A;  5DLG A;  4RPX A;  5CHG A;  2F8K A;  1FEZ A;  3PW5 A;  1FIQ A;  5J0W A;  1SXE A;  3H0L B;  2HDO A;  5ALS A;  2ZTD A;  4F50 A;  1PVP A;  2ES6 A;  1A76 A;  3OHB A;  4NLB A;  9ICU A;  3SAH A;  4YXJ A;  1X2I A;  8ICH A;  1U9L A;  3T3F A;  3VC8 A;  3FC4 A;  1CI4 A;  4J9M A;  3G6Y A;  4BGD A;  1SZP A;  3RH4 A;  3PY8 A;  2H5X A;  5GTH U;  4GLX A;  1PK1 A;  2I6X A;  4UAV A;  3SV4 A;  2PXI A;  1ZQB A;  2VJ5 A;  5KFD A;  3HKZ C;  3SV3 A;  4YQW A;  2KIC A;  2P66 A;  3G6X A;  1F44 A;  2KKV A;  3KD3 A;  2F77 X;  1F5S A;  1KL9 A;  4QIW F;  2H3Q A;  4O5E A;  4ACO A;  2R8G A;  4DLE A;  1ZJN A;  3K4G A;  1TK0 A;  1L3S A;  3UMC A;  4XUS A;  8ICE A;  1UT8 A;  5J0T A;  3M8S A;  4JK1 A;  2JRZ A;  1ZD4 A;  1ZQZ A;  5L1M A;  3QEA Z;  2HI0 A;  3MFI A;  1YT3 A;  3RAQ A;  3L3F X;  3RJJ A;  4Y2J A;  5BOL A;  3T5J A;  4NY8 A;  4KN4 A;  4J9S A;  3RB0 A;  2ZIW A;  4PHP A;  5DB8 A;  4DFK A;  3QU4 A;  2DFL A;  4TUS A;  1T4G A;  4ZH4 A;  5A0L A;  2I5H A;  4J9N A;  1ZQX A;  4ECZ A;  2JEF A;  2E5S A;  4MEX A;  3DV9 A;  1XS9 D;  4AP9 A;  5KNI A;  4RT2 A;  2DPI A;  4CF3 A;  5KFN A;  3NRZ A;  1JRO A;  5J0U A;  2LI6 A;  3CP8 A;  1ZOL A;  5EE1 A;  4DFP A;  1SXD A;  4NLZ A;  4QZE A;  5CJ7 A;  4QZG A;  3OJU A;  2P6R A;  3BQT A;  1PVR A;  4C4R A;  5KT5 A;  4BX9 C;  2NRV A;  2FMP A;  7ICT A;  4C8N A;  1Z1V A;  2NO4 A;  1K5O A;  4RQ8 A;  3GQC A;  2KIV A;  1LKY B;  5DQI A;  2KZ3 A;  1U49 A;  4EYH B;  2G06 A;  2QB0 A;  4NWI A;  3HX0 A;  2ZTC A;  1L3U A;  4KLI A;  5AI8 A;  3T5K A;  2F2A B;  5EWE A;  5F9L A;  1FO4 A;  3HKZ F;  1ZYQ A;  4DQS A;  2YB4 A;  3H8M A;  2A19 A;  5J2F A;  1JIH A;  4P4O A;  1ED1 A;  2PFN A;  3Q8Q B;  9ICG A;  5DBB A;  4O5K A;  4UB3 A;  2AHO B;  7ICN A;  5JTI A;  4F5P A;  1UPH A;  4G3I A;  1NK5 A;  4KLO A;  3D6J A;  5J2B A;  2KG5 A;  5L1J A;  4IS7 A;  3KKA C;  3JPO A;  2VA2 A;  3F53 A;  2FPM A;  1C20 A;  4I2G A;  7ICM A;  1JXE A;  5C0Y A;  3IG5 A;  4LJX A;  4GIB A;  3KHG A;  4GC6 A;  2N1R A;  1ZQV A;  3BS5 A;  4F93 B;  5J0O A;  3PX6 A;  4QWC A;  3KTQ A;  2YMM A;  3V6J A;  4O0I A;  4OJO A;  4UBB A;  2AGP A;  5KFW A;  5AKI A;  1L7O A;  5HR6 A;  4DSK A;  1M6Y A;  3KFU F;  1X9X A;  1FFV A;  2NRZ A;  5AKZ A;  1CRX A;  5J2E A;  1N5W A;  3RBD A;  1B4F A;  3C2L A;  1N48 A;  4ED3 A;  3Q8R B;  9ICQ A;  2PFO A;  3M7D A;  5DKW A;  1RQL A;  4RNN A;  5DG8 A;  5EOZ A;  1CUK A;  4Y2Q A;  2VA3 A;  3C2M A;  1XSN A;  1Z19 A;  3BZC A;  4F92 B;  3QXG A;  2OXO A;  1U48 A;  2RDJ A;  3UQ2 A;  1L7P A;  3QUC A;  5IIK A;  4ECY A;  2W7P A;  3E0F A;  1DK2 A;  5KG7 A;  3BQ0 A;  2AJQ A;  3C29 A;  4UAS A;  2KV2 A;  2J6T A;  4DL5 A;  4KLD A;  2V4Q A;  2BGW A;  2K4E A;  4ZOH C;  4RQ7 A;  2J6U A;  3M6K A;  2XC9 A;  2WF7 A;  4K4H A;  3PSI A;  4ECU A;  4UAT A;  4DSI A;  1O03 A;  9ICB A;  1XWL A;  3N7P D;  2E1E A;  2HHQ A;  5DG9 A;  2DKX A;  3HW8 A;  4QW8 A;  3AMZ A;  5ALO A;  2HHV A;  4MEY A;  1JUD A;  2HHW A;  5D49 A;  1ZQO A;  3MR2 A;  3PO4 A;  4O3Q A;  4QZ8 A;  3RRH A;  3RB4 A;  1L7N A;  5CWR A;  4FS1 A;  2BQ3 A;  4QZA A;  5EE9 A;  5J2C A;  3JPQ A;  1QSS A;  2RRD A;  1ZQC A;  1TAU A;  5J8Y C;  1OXJ A;  1X66 A;  9ICV A;  5AI5 A;  2ZJ8 A;  3MR6 A;  5D46 A;  1L8O A;  2HW3 A;  4EEN A;  1URJ A;  2RP5 A;  3N28 A;  3G6V A;  1JRP A;  3K1R B;  1PVQ A;  1Z4N A;  3PR4 A;  4F2S A;  4XRH A;  5ALJ A;  3JPS A;  4NLC A;  3GFK B;  1PUZ A;  4J9P A;  4Y2R A;  3RR8 A;  4KLL A;  1ZQR A;  3LK9 A;  3RJI A;  4CDG A;  5AI9 A;  5KFO A;  5JRT A;  2LYA A;  2FMS A;  5KG6 A;  3MBY A;  2I9G A;  3SAG A;  4F5O A;  3GU3 A;  3DEE A;  2KEY A;  2A1J B;  5L1K A;  2ASD A;  1MC8 A;  4Z6D A;  5DQG A;  3HP6 A;  4ED7 A;  2W03 A;  3AUO A;  9ICI A;  5KT3 A;  4C7Z A;  3OSN A;  8ICP A;  4C4T A;  4DL3 A;  4OJ6 A;  4JV0 A;  1X9W A;  3NUQ A;  8ICK A;  4M6W B;  3MFH A;  3EPG A;  4LVS A;  5AK6 A;  2KD1 A;  3IV6 A;  5KFQ A;  4US9 A;  4DL4 A;  4JV1 A;  8ICC A;  3R9K A;  1KKX A;  3RAX A;  5KFV A;  3H4B A;  3KOO A;  2O6K A;  2ZIV B;  4ECV A;  8ICZ A;  3RF9 A;  3MR5 A;  4I2F A;  4RZR A;  2K60 A;  5J2D A;  4DQP A;  4O3S A;  5DG7 A;  4TQS A;  2VA8 A;  2JHD A;  1ZD3 A;  7ICR A;  1TFR A;  4P0Q B;  1D8L A;  1SV0 A;  2G09 A;  1TK5 A;  3GIL A;  2HBJ A;  2KN7 A;  4IC9 A;  2AQ4 A;  4EYI B;  4NV0 A;  1NJY A;  9ICN A;  3EPI A;  1ZQA A;  4I2I A;  2W8K A;  2Y1J A;  3TAC B;  1L3V A;  2E8P A;  2KMD A;  3B9J A;  1A6S A;  4QZ9 A;  4GXK A;  5KT2 A;  4K4G A;  4UAY A;  5J0P A;  2DL0 A;  3TAR A;  1XNS A;  4YD1 A;  4PPX A;  1DK3 A;  1KBU A;  3M9O B;  4QJF B;  3QX7 A;  2KSO B;  3D2S A;  4Y2T A;  4DFM A;  1LV5 A;  1ZQW A;  5CP2 A;  1SWV A;  4UAU A;  4R8U B;  3V7L A;  3M8R A;  1KRP A;  5DDY A;  7ICL A;  2Q4T A;  4O3M A;  2EZX A;  2R8J A;  3UXO A;  1N56 A;  1NKB A;  4KLG A;  1Z1B A;  3SI8 A;  4QWE A;  3QZ8 A;  7ICI A;  1ARO P;  2KOB A;  3TAN A;  3WKB A;  4Q45 A;  3IN5 A;  2EAO A;  3OSP A;  3UM9 A;  3IRU A;  4OO1 J;  3H0M B;  4KX3 A;  5KFJ A;  3NTU A;  2JMG A;  5KFI A;  2HVI A;  5C5J A;  1QQ6 A;  2KE7 A;  4DSJ A;  1ZQT A;  3RJH A;  4IR1 A;  4FBU A;  5J2G A;  4F8R A;  1BNP A;  5J0S A;  4FS2 A;  1TK8 A;  4DQQ A;  2BCV A;  1X9S A;  8ICR A;  1JI7 A;  4NM2 A;  1NK7 A;  1ZET A;  4OJL A;  5ALZ A;  5AM1 A;  2AU0 A;  2H3F A;  4KLU A;  4PGX A;  9ICL A;  3RH6 A;  4OD0 A;  2F76 X;  4I2C A;  2UVW A;  4EBE A;  4DLG A;  3NVW A;  2KVS A;  2E3T A;  1EXN A;  3NRW A;  3BJY A;  3HPO A;  2GWS A;  4KX5 A;  1ZQE A;  3PR5 B;  2WF8 A;  1N62 A;  2EDU A;  4YG2 A;  5HP4 A;  1RZT A;  4RU9 A;  4B6J A;  3BDP A;  9ICP A;  2EAP A;  3B0Y A;  3TAD C;  1D8Y A;  5J0R A;  1DOQ A;  2HBM A;  2JH1 A;  2W3R A;  3EYZ A;  4XA5 A;  1MN8 A;  2PKE A;  5HML A;  4PL2 A;  3SEN A;  7ICK A;  4DSE A;  3C1Y A;  3C5G A;  2YN4 A;  3ISC A;  7ICS A;  1ECW A;  4KTQ A;  5T14 A;  4RPZ A;  3RJF A;  1U47 A;  1MQ3 A;  3KZX A;  4M9N A;  2NRW A;  1V97 A;  3M9M B;  4B9U A;  1LKY A;  4UAZ A;  5EWF A;  3Q8K A;  2ZIX B;  2HHX A;  1NJW A;  5AHX A;  1WWV A;  2HVH A;  4RQ5 A;  2G5H B;  2AQ0 A;  3ZDE A;  2KFN A;  3PW4 A;  4RQ6 A;  5AI0 A;  3AL0 B;  3PML A;  2IA6 A;  2IMW P;  2XI9 A;  2D3D A;  4EZ6 A;  4RUC A;  2K4P A;  1SV4 A;  3T79 A;  5TIS U;  5EE0 A;  5J0Y A;  1A0P A;  1GO3 F;  2HHT A;  1WCN A;  2HOQ A;  4M9H A;  2CRX A;  3ALR A;  3AM9 A;  2ZJ5 A;  8ICJ A;  4NL9 A;  3LYS A;  5KG1 A;  4LZD A;  4C7Y A;  5KT7 A;  4P2H A;  7ICF A;  2M9N A;  5KFA A;  3IP4 B;  4ED8 A;  4C0Z A;  5AIC A;  4BDP A;  5CRX A;  2DGZ A;  5KFC A;  2ZUD A;  2JEJ A;  5CA7 A;  4RNO A;  2F8L A;  2NRT A;  5KFG A;  9ICX A;  4NXZ A;  2BPC A;  1N2X A;  2FMQ A;  5AIA A;  4HYK A;  1ZRM A;  5AKY A;  1UA0 A;  4U6P A;  1HUO A;  3ETR A;  1NZB A;  3PO5 A;  4CRX A;  4KMU A;  1SIJ A;  3UMB A;  3Q8P B;  2ATL A;  1L7M A;  1JN3 A;  3QU9 A;  4A8E A;  1S8O A;  1Q8K A;  9ICT A;  4FZN A;  4O3R A;  4FFD A;  2DBY A;  2YTU A;  4GFJ A;  2K89 A;  4I2B A;  4NLN A;  2MU2 A;  4IR9 A;  7ICP A;  8ICI A;  4YR3 A;  1SKS A;  3VCB A;  2EZY A;  3A0B U;  2Y0S C;  3QYP A;  1UT5 A;  4ELT A;  2DKZ A;  3SYZ A;  3THV A;  3PV8 A;  5AKL A;  2IBK A;  3QU7 A;  3M6Z A;  1Z3E B;  2L5Y A;  1XO1 A;  2G08 A;  2B6G A;  1BPE A;  3O0F A;  2ALZ A;  3D2N A;  3LVW A;  4DWI A;  1BGX T;  1RXW A;  2PMZ C;  4RQ0 A;  2XIC A;  3E58 A;  1KTQ A;  2QLT A;  2ISO A;  4QZC A;  2EAN A;  2XVT A;  3UPQ A;  4O3O A;  3QUQ A;  2B0C A;  2K4I A;  3FM9 A;  1XSL A;  1HJP A;  3L5K A;  3KBB A;  3UXN A;  3AEV A;  2W9C B;  3OPX A;  1KFT A;  1N63 A;  1NK8 A;  5CEH A;  2KP7 A;  4Z6E A;  4RT3 A;  4ECW A;  3ONN A;  2JZB B;  3OGU A;  1QSL A;  8ICQ A;  3C1Z A;  5GTI U;  5KFE A;  3ICX A;  1S97 A;  4I28 A;  3PX4 A;  4PHA A;  5BPC A;  2ZJA A;  5DBC A;  2R8H A;  1SKR A;  8ICT A;  1JXL A;  4B9V A;  1HUZ A;  2LYH A;  1WUD A;  4UB5 A;  1NI3 A;  3ETL A;  2UVV A;  4C8L A;  7ICE A;  2HOI A;  3EW9 A;  1XO0 A;  3TKA A;  2W11 A;  2XY5 A;  1AQ6 A;  3HRD D;  5L1L A;  1S5L U;  1WG8 A;  2LKY A;  4MF2 A;  4KMO B;  4IL6 U;  4F4K A;  4DL7 A;  5ALY A;  2OCE A;  5HHI A;  9ICW A;  9ICO A;  5IIL A;  3TFR A;  1UHU A;  4RQM A;  1KFS A;  1S0O A;  2YMP A;  2QB1 A;  4P0P B;  1QTM A;  5AKJ A;  5AM0 A;  1V9P A;  5DDM A;  5KG0 A;  2MAX A;  5ALI A;  2H3Z A;  5KT6 A;  2ZIU B;  3SQI A;  5KT4 A;  5IIO A;  4I2D A;  2XCA A;  2V9W A;  2KJ9 A;  5KFM A;  4RQ4 A;  1Z00 B;  4DOC A;  2A1J A;  4BUG A;  2F1I A;  7ICO A;  1QLN A;  2GO7 A;  1ZQI A;  2WHE A;  1Z4O A;  2PMZ F;  1RDF A;  3F2D A;  1KDH A;  3GV5 B;  4M6W A;  5CB1 A;  5CR0 A;  2BCR A;  4ECS A;  1BPX A;  4F5Q A;  3MAB A;  1D8B A;  3F5A A;  1YZ7 A;  2BR0 A;  3ZDD A;  4I2E A;  2ZIV A;  5JU5 A;  2I1Q A;  5J29 A;  1L5U A;  3F2B A;  2F44 A;  4MFA A;  2KZM A;  5J2K A;  2W9M A;  2WB1 C;  3NVV A;  2H3I A;  3QU2 A;  3ISD A;  5J0X A;  3C21 A;  4P0Q A;  4M04 A;  4CCH A;  8ICG A;  2MUT B;  2NYV A;  4YN4 A;  2BHN A;  2XY7 A;  2YX8 A;  4IQV A;  5HR7 A;  4GC7 A;  5AM3 A;  3EWA A;  1HIW A;  1ZQY A;  1KEJ A;  4J03 A;  3TI0 A;  1K1Q A;  2C2D A;  1BPB A;  5KG3 A;  4ED1 A;  2QAR B;  1B43 A;  4O3N A;  4DFD A;  3PMN A;  3H40 A;  1O08 A;  7ICV A;  5E79 U;  3C5F A;  5ALN A;  4EEK A;  2KSO A;  2V4R A;  4R64 A;  2F3N A;  7ICG A;  4BJQ A;  2E8N A;  4ECR A;  2JR5 A;  5FP0 A;  2KNJ A;  4R8U A;  1C7Y A;  3QU5 A;  5ALW A;  2BCQ A;  4BXO B;  3HIL A;  4BWJ A;  9ICJ A;  4M47 A;  1WYG A;  1ZD5 A;  2OM6 A;  4M9J A;  3V6K A;  5ALK A;  4J9O A;  3H8S A;  1BVS A;  4PZN A;  4EEL A;  4RQ2 A;  2WTF A;  3RTV A;  3PVX A;  3H8W A;  1SGG A;  4WJ3 B;  2R18 A;  5JUM A;  2DPJ A;  4UB1 A;  2OH2 A;  2W55 A;  4FE3 A;  3EUB 2;  2A3V A;  3NVZ A;  2J6S A;  3WKD A;  1B0X A;  4F71 A;  1BPY A;  2LYB A;  2FE9 A;  2FPL A;  3PW0 A;  3MDC A;  4PJ0 U;  2XY6 A;  2BPG A;  4F3O A;  2KJ5 A;  4QZF A;  2CN1 A;  1ZQF A;  3PSP A;  3WKE A;  1A77 A;  2FI1 A;  1CEZ A;  5B5E U;  1MSW D;  4KLF A;  2C2E A;  1PK3 A;  2NRX A;  4YMN A;  1N5X A;  3M9N B;  3KHL A;  2R8K A;  2LM1 A;  5KFB A;  3OJS A;  2BDP A;  1FFU A; 
#chains in the Genus database with same CATH homology
 3V7J A;  4KLH A;  3HX0 A;  1D8Y A;  3AU6 A;  2ZTC A;  5J0R A;  7ICQ A;  3GDX A;  1DOQ A;  4EBC A;  1L3U A;  2RDI A;  1ZJM A;  4KLI A;  3EYZ A;  4XA5 A;  1DGS A;  2JEG A;  4YMO A;  3T5K A;  5HML A;  5EWE A;  1T8E A;  7ICK A;  3V6H A;  2HHS A;  3RJK A;  4DSE A;  4ED0 A;  5F9L A;  2FLP A;  4ECQ A;  4MFC A;  1NKE A;  3C1Y A;  3C5G A;  4QZI A;  3ISC A;  4P4P A;  3GIJ A;  7ICS A;  1SKW A;  1ZYQ A;  4DQS A;  4KTQ A;  2Y1I A;  5J2I A;  4RPZ A;  5J2F A;  1NK9 A;  4UQG A;  5IIN A;  2JEI A;  4RUA A;  1JIH A;  1T3N A;  3RJF A;  1U47 A;  4P4O A;  1MQ3 A;  2PFN A;  3Q8Q B;  4TQR A;  2XGP A;  3RJG A;  1U45 A;  9ICS A;  2VAN A;  4PHE A;  4M9N A;  9ICG A;  5DBB A;  1B22 A;  4O5K A;  2NRW A;  3M9M B;  4UB3 A;  4B9U A;  1ZQU A;  3IHQ B;  5F9N A;  4R66 A;  4TUP A;  1TV9 A;  1MQ2 A;  4FBT A;  1ZQP A;  4JWN A;  4F5P A;  4UAZ A;  5EWF A;  3Q8K A;  7ICN A;  2HHX A;  5J2A A;  2XGQ A;  4F4W A;  4GXJ A;  1RXV A;  1NK4 A;  3LWL A;  4F2R A;  4G3I A;  1S76 D;  1NK5 A;  1NK0 A;  1NJW A;  4KLO A;  1H38 A;  5J2B A;  1RYR A;  5HMM A;  5L1J A;  2HVH A;  5KG4 A;  4RQ5 A;  4R65 A;  1ZQL A;  2KTQ A;  2AQ0 A;  3ZDE A;  2KFN A;  1XSP A;  3JPO A;  3PW4 A;  5KFU A;  4DOA A;  2VA2 A;  4TUQ A;  2FPM A;  4DSL A;  4I2G A;  4RQ6 A;  3ZD8 A;  3TAP A;  4DSF A;  7ICM A;  1ZQS A;  1JXE A;  3TFS A;  3PML A;  2IA6 A;  2IMW P;  2ASJ A;  4Z6F A;  4NM1 A;  9ICR A;  3EZ5 A;  9ICF A;  3KHG A;  4EZ6 A;  4GC6 A;  4NLK A;  1IXR A;  4RUC A;  1ZQV A;  5KFZ A;  3ZDB A;  5KFK A;  4F93 B;  3ORY A;  4B9L A;  5J0Y A;  5J0O A;  3PX6 A;  2HHT A;  1WCN A;  4QWC A;  1D9F A;  3KTQ A;  4M9H A;  5KFP A;  3V6J A;  2ZJ5 A;  4O0I A;  8ICJ A;  4UBB A;  2AGP A;  1NJX A;  5KFW A;  3RRG A;  5DB9 A;  5KG1 A;  4EEY A;  2BQR A;  4LZD A;  4DSK A;  1ZQK A;  5KT7 A;  3KHH A;  2BQU A;  4P2H A;  7ICF A;  1ZQJ A;  2NRZ A;  2M9N A;  5KFA A;  4KLJ A;  4X5V A;  4ED8 A;  5J2E A;  4DS5 A;  3RBD A;  4BDP A;  5KFC A;  2ZUD A;  2JEJ A;  5CA7 A;  3UXP A;  2PI4 A;  4RNO A;  3Q8S B;  3C2L A;  2IHN A;  1N48 A;  2BPF A;  3JPN A;  4ED3 A;  3Q8R B;  2NRT A;  5KFG A;  5DB7 A;  3JPP A;  2PFO A;  4ELU A;  4NXZ A;  4M9L A;  9ICX A;  9ICQ A;  4C8O A;  2BPC A;  1ZQN A;  1S9F A;  2FMQ A;  5DKW A;  1RYS A;  4DF8 A;  4HYK A;  4RNN A;  2BCU A;  8ICB A;  3T5H A;  3QZ7 A;  1KLN A;  4KIT B;  8ICU A;  5DG8 A;  5EOZ A;  1CUK A;  5DLF A;  5KFR A;  3C2M A;  1XSN A;  2VA3 A;  4F92 B;  5J0Q A;  1UA0 A;  1HUO A;  3PO5 A;  1U48 A;  4YCX A;  2RDJ A;  5L1I A;  4KMU A;  2F1J A;  5DGB A;  3UQ2 A;  8ICM A;  5IIK A;  8ICY A;  3GII A;  3Q8P B;  2ATL A;  2AGQ A;  2W9A A;  1JN3 A;  4ECY A;  4DL2 A;  1ZQD A;  5BOM A;  3RB3 A;  5L9X A;  5KG7 A;  3BQ0 A;  2AJQ A;  9ICT A;  4EZ9 A;  4O5C A;  2C22 A;  4E0D A;  4O3R A;  4J9L A;  2J6T A;  4QW9 A;  4TUR A;  2V4Q A;  4DL5 A;  4KLD A;  4MFF A;  2BGW A;  5III A;  3RH5 A;  7ICJ A;  4UBC A;  4RQ7 A;  4I2B A;  4J9K A;  5KFH A;  4NLN A;  9ICC A;  1COO A;  2J6U A;  4IR9 A;  4F4X A;  7ICP A;  4YR3 A;  1SKS A;  1S0V A;  2XC9 A;  8ICI A;  3MGH A;  4K4H A;  9ICK A;  1UT5 A;  4ECU A;  4ELT A;  3SYZ A;  5IIJ A;  3THV A;  3PX0 A;  4DSI A;  3PV8 A;  3JPR A;  1NJZ A;  2IBK A;  4DO9 A;  5D4B A;  9ICB A;  1Z3E B;  2FPK A;  1XO1 A;  1BPD A;  1XWL A;  4IQT A;  9ICE A;  1WCL A;  1BPE A;  8ICV A;  4PH5 A;  2HHQ A;  5HNK A;  1TAQ A;  2ALZ A;  5DG9 A;  3HW8 A;  4JWM A;  5TZV A;  1QSY A;  4Q8E A;  1JMS A;  4QW8 A;  4UB4 A;  4R63 A;  7ICU A;  2HHV A;  4MEY A;  4C8K A;  3Q8L A;  5KG2 A;  4DWI A;  1BGX T;  1RXW A;  3QEB Z;  3RB6 A;  2HVI A;  1XC9 A;  2HHW A;  4RQ0 A;  5D49 A;  4P4M A;  1ZQO A;  1SL2 A;  3MR2 A;  3PO4 A;  4O3Q A;  4QZ8 A;  5KFF A;  3RRH A;  1SL1 A;  1KFD A;  1KTQ A;  4RQ1 A;  3RB4 A;  1T7P A;  2ISP A;  2XCP A;  5CWR A;  3V7K A;  3MDA A;  4FS1 A;  2BQ3 A;  2ISO A;  4YR2 A;  4QZC A;  4QZA A;  5J2C A;  3UPQ A;  3JPQ A;  5DQH A;  4O3O A;  1KSP A;  1QSS A;  3PW2 A;  1S10 A;  2W8L A;  2C2R A;  1ZQC A;  4F5N A;  1XSL A;  1TAU A;  1HJP A;  4MF8 A;  4YFK A;  2P6U A;  8ICW A;  4Q43 A;  3HT3 A;  4PGY A;  5DGA A;  3UXN A;  4FO6 A;  2W9B B;  8ICA A;  5KFL A;  2W9C B;  4PGQ A;  9ICV A;  5KFY A;  3RJE A;  4UB2 A;  4PHD A;  2ZJ8 A;  3MR6 A;  1KFT A;  5D46 A;  3TAQ A;  4O3P A;  1NK8 A;  3FDS A;  4IRK A;  3MR3 A;  1BPZ A;  4I29 A;  4F4Z A;  4Z6E A;  2HW3 A;  4RT3 A;  3HWT A;  1LB2 B;  4ECW A;  3N4M B;  3RR7 A;  2JZB B;  3OGU A;  1QSL A;  1Y88 A;  3G6V A;  3C1Z A;  5KFE A;  3ZDC A;  1S97 A;  4ECX A;  4I28 A;  8ICQ A;  3PR4 A;  4ED2 A;  4DOB A;  4F2S A;  4XRH A;  4EBD A;  4M9G A;  5J2J A;  5KFT A;  3PX4 A;  9ICA A;  4PHA A;  5BPC A;  1NOM A;  2ZJA A;  5DBC A;  3JPS A;  3ZDA A;  3GFK B;  2R8H A;  4J9P A;  3RR8 A;  4IRC A;  1SKR A;  4KLL A;  2KZZ A;  4JV2 A;  4YD2 A;  1ZQR A;  1JXL A;  3LK9 A;  8ICT A;  3RJI A;  3QE9 Y;  5KFO A;  1HUZ A;  4B9V A;  4DQR A;  3GV8 B;  2FMS A;  5KG6 A;  3MBY A;  4I2H A;  2I9G A;  2LYH A;  4UB5 A;  8ICF A;  4RQ3 A;  4I2A A;  4O9M A;  3ETL A;  4F5O A;  2UVV A;  4C8L A;  7ICE A;  1X9M A;  3EW9 A;  4QWA A;  2A1J B;  5L1K A;  2ASD A;  1MC8 A;  4Z6D A;  5DQG A;  4ELV A;  3HP6 A;  4ED7 A;  4ECT A;  2XY5 A;  3AUO A;  1ZQH A;  9ICI A;  5L1L A;  3BQ1 A;  5KT3 A;  4QZD A;  2W9B A;  4Q8F A;  7ICH A;  2W9C A;  3OSN A;  8ICP A;  1U4B A;  8ICO A;  4NLG A;  4YP3 A;  3MGI A;  4DL3 A;  4DQI A;  2HHU A;  4MF2 A;  4RPY A;  4JV0 A;  1X9W A;  4F4K A;  4DL7 A;  2B21 A;  2PFP A;  3TQ1 A;  8ICK A;  3N97 B;  4M6W B;  2FLL A;  5IIM A;  3MFH A;  3EPG A;  3C23 A;  2ZUC A;  4LVS A;  2AGO A;  4C8M A;  1SL0 A;  2JZB A;  2OWO A;  5KFQ A;  5HHI A;  9ICW A;  9ICO A;  1PZN A;  4QZB A;  5IIL A;  3TFR A;  4DL4 A;  4JV1 A;  4F5R A;  1S0N A;  8ICC A;  4JUZ A;  1KFS A;  1XU4 A;  1S0O A;  4UAW A;  3RAX A;  5KFV A;  3H4B A;  1ZQG A;  1QTM A;  4QWB A;  3UQ0 A;  1V9P A;  4I2J A;  4F91 B;  3SZ2 A;  4QZH A;  4F4Y A;  4BWM A;  4ECV A;  4KLQ A;  4B9T A;  5DDM A;  5KG0 A;  4Q44 A;  8ICZ A;  5J2H A;  2MAX A;  4KLS A;  2UVR A;  3MR5 A;  3Q8M A;  4I2F A;  4RZR A;  8ICS A;  5KT6 A;  5J2D A;  4DQP A;  4O3S A;  5DG7 A;  4TQS A;  4XQ8 A;  1NKC A;  2VA8 A;  5KT4 A;  4LZG A;  5IIO A;  7ICR A;  4I2D A;  2XCA A;  1NK6 A;  2V9W A;  4KLT A;  4DS4 A;  1TFR A;  4I27 A;  5KFM A;  4RQ4 A;  1ZQM A;  1Z00 B;  4DOC A;  2A1J A;  1D8L A;  1D9D A;  2F1I A;  1S0M A;  3K75 D;  5EWG A;  7ICO A;  1QLN A;  4KLM A;  1TK5 A;  3ISB A;  3GIL A;  1ZQI A;  2KN7 A;  5DLG A;  4RPX A;  5CHG A;  2AQ4 A;  4J9R A;  4EYI B;  4KN7 A;  1NJY A;  3PW5 A;  5J0W A;  9ICN A;  1KDH A;  3EPI A;  1JX4 A;  2ZTD A;  3GV5 B;  3PNC A;  4F50 A;  1ZQA A;  3B0X A;  4I2I A;  4M6W A;  5CR0 A;  5CB1 A;  2W8K A;  3V72 A;  2Y1J A;  1L3V A;  2BCR A;  1TVA A;  1A76 A;  4ECS A;  1BPX A;  4QZ9 A;  3C2K A;  3MAB A;  5KT2 A;  3OHB A;  2R8I A;  4F5Q A;  4UAY A;  4GXK A;  4YXJ A;  5J0P A;  9ICU A;  3TAR A;  4YD1 A;  4PPX A;  1X2I A;  4DF4 A;  3ZD9 A;  3M9O B;  8ICH A;  4B9S A;  4DFM A;  1U9L A;  3T3F A;  2BR0 A;  3ZDD A;  1LV5 A;  4I2E A;  1ZQW A;  5CP2 A;  3RBE A;  2BKE A;  4J9M A;  3G6Y A;  5KFX A;  2I1Q A;  1SZP A;  4BGD A;  5J29 A;  2H5X A;  3V7L A;  4R8U B;  4Z6C A;  3RH4 A;  1L5U A;  3PY8 A;  3M8R A;  1KRP A;  4YXM A;  5DDY A;  3GIK A;  4GLX A;  7ICL A;  4MFA A;  2KZM A;  5J2K A;  2W9M A;  2F1H A;  3SV4 A;  3LWM A;  2PXI A;  3PW7 A;  3ISD A;  5J0X A;  3AU2 A;  3C21 A;  1ZQB A;  2R8J A;  3UXO A;  5KFD A;  1Z00 A;  4CCH A;  4M04 A;  2MUT B;  8ICG A;  9ICH A;  1N56 A;  3LDA A;  1NKB A;  4KLG A;  3SV3 A;  4YN4 A;  4YQW A;  3H7I A;  3SI8 A;  8ICX A;  4QWE A;  2BHN A;  3GIM A;  3QZ8 A;  3NGD A;  2XY7 A;  2P66 A;  3G6X A;  1ARO P;  4IQV A;  4GC7 A;  7ICI A;  3TAN A;  3EWA A;  1ZQY A;  4Q45 A;  1KEJ A;  3TI0 A;  1K1Q A;  2C2D A;  1IM4 A;  5DB6 A;  1BPB A;  3OSP A;  5KG3 A;  2PFQ A;  4ED1 A;  1B43 A;  4O3N A;  3JPT A;  2ZTE A;  2FLN A;  3PMN A;  5KFJ A;  3NTU A;  3H40 A;  7ICV A;  4O5E A;  5KFI A;  2R8G A;  4DLE A;  4YR0 A;  3K4G A;  4DEZ A;  5C5J A;  1ZJN A;  1TK0 A;  1L3S A;  4K4I A;  2KFZ A;  8ICE A;  4XUS A;  3C5F A;  3GV7 B;  5KFS A;  1UT8 A;  2V4R A;  5J0T A;  4DSJ A;  1ZQT A;  4R64 A;  3RJH A;  4IR1 A;  4FBU A;  3M8S A;  4JK1 A;  5J2G A;  4F8R A;  7ICG A;  5J0S A;  4FS2 A;  1TK8 A;  1ZQZ A;  3QEA Z;  4ECR A;  3MFI A;  4DQQ A;  3H8J A;  3RAQ A;  4R8U A;  3RJJ A;  5BOL A;  1C7Y A;  2BCV A;  2Q0Z X;  3T5J A;  4NY8 A;  2BCQ A;  4BXO B;  4KN4 A;  1X9S A;  4B9N A;  4J9S A;  4IQW A;  4KLE A;  3RB0 A;  4BWJ A;  4PHP A;  9ICJ A;  8ICR A;  2ZUB A;  4M47 A;  2BCS A;  4M9J A;  3V6K A;  4DFJ A;  4J9O A;  2ASL A;  4NM2 A;  1RPL A;  5DB8 A;  2MUT A;  4DFK A;  1NK7 A;  3H8S A;  9ICM A;  2DFL A;  1ZET A;  4B9M A;  1BVS A;  4TUS A;  1L3T A;  1T4G A;  4ZH4 A;  4IQU A;  4RQ2 A;  2WTF A;  3RTV A;  3PVX A;  2AU0 A;  3H8W A;  2PI5 A;  4KLU A;  5KG5 A;  4ED6 A;  4J9N A;  5JUM A;  2DPJ A;  4UB1 A;  4PGX A;  1ZQX A;  4J9Q A;  4ECZ A;  3RH6 A;  1UA1 A;  2JEF A;  1TKD A;  4MEX A;  9ICL A;  1XS9 D;  2J6S A;  5HHH A;  4I2C A;  2UVW A;  4EBE A;  4DLG A;  3BQ2 A;  4RT2 A;  2DPI A;  5KFN A;  1BPY A;  2C28 A;  4M0A A;  2FPL A;  4YVZ A;  3PW0 A;  3MDC A;  1EXN A;  5J0U A;  5KTQ A;  3BJY A;  3HPO A;  2XY6 A;  4K4G A;  3OHA A;  4DFP A;  1K1S A;  2GWS A;  3E2E A;  1ZQE A;  3T5L A;  2BPG A;  4NLZ A;  4F3O A;  4QZE A;  4QZF A;  3PR5 B;  4M2Y A;  5CJ7 A;  4QZG A;  3OJU A;  1ZQF A;  2P6R A;  1S77 D;  3BQT A;  4GXI A;  5KT5 A;  3KHR A;  4BXO A;  5DBA A;  2NRV A;  2FMP A;  4YG2 A;  2IHM A;  4C8N A;  1A77 A;  7ICT A;  2UVU A;  1CEZ A;  8ICN A;  1MSW D;  4KLF A;  4YMM A;  5HP4 A;  8ICL A;  4IRD A;  3IM1 A;  2C2E A;  4RQ8 A;  3GQC A;  2NRX A;  4YMN A;  4DL6 A;  1RZT A;  5DQI A;  3M9N B;  4RU9 A;  2KZ3 A;  3KHL A;  2R8K A;  1ZQQ A;  3FYH A;  3H4D A;  5KFB A;  3BDP A;  9ICP A;  3OJS A;  2XO7 A;  1U49 A;  2BDP A;  4RNM A;  4EYH B;  4QWD A;  3B0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...