2MRLA

Backbone 1h, 13c, and 15n chemical shift assignments and nmr structure for potential drug target from burkholderia thailandensis e264
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
b'MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein BTH I2711
publication title NMR structure for potential drug target from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.610 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2mrlA00
2MRLA
chains in the Genus database with same CATH superfamily
5KFUA 2FLNA 2KK0A 3IHQB 2HBLA 2ZUDA 4JUZA 3H0RB 2FI1A 1NJXA 1COKA 5ALRA 3M1YA 2K8BB 2W9AA 4F91B 2W7OA 2VJ5A 2HDOA 5AK5A 3OGUA 2XVTA 1AQ6A 3ZDCA 4CF4A 3MFIA 1C7YA 5KFCA 2KG5A 9ICKA 4G9BA 1XO1A 2IOFA 1KDHA 4B9TA 1N48A 4RT2A 2ZXHA 4XA5A 4FBTA 1V38A 5AM2A 1F0MA 2AHOB 4I2HA 2I6XA 4ELTA 2KTQA 1VLBA 4OJ6A 1XSPA 3V6HA 4I27A 1TK8A 3KHRA 4RUCA 3UMCA 3B0XA 3ED5A 1RXVA 7ICPA 2K8AA 1DRGA 1K1QA 3OJUA 4DOBA 3PMLA 4I2GA 4NV0A 2DL0A 4C4TA 4LVSA 1RYRA 3CRXA 5J8YA 5AKIA 2ZJ5A 1SL1A 2VA2A 9ICFA 3HW8A 4P0PA 1IIPA 2KD1A 4RPYA 1TFRA 4EENA 4UAUA 2NO5A 3N97B 3BJYA 4FS2A 5IILA 3RJHA 1UPHA 5DQGA 4QW8A 5L1IA 2F3NA 4J9KA 5J2DA 2NRWA 5IIJA 4TUSA 4Q8FA 5KFBA 3PW0A 7ICSA 2PMZF 5KT2A 2YTUA 2HHWA 3NGDA 5ALQA 3LK9A 1JRPA 2PFPA 3Q8PB 4QZEA 4GC6A 2CXYA 4JWMA 5DB8A 1CUKA 3MR3A 3MR5A 1RPLA 3N7RC 4UB3A 4NLNA 2QB0A 3HKZF 3KZXA 2XICA 3HWTA 1Z1BA 3RBEA 1QQ6A 1UT8A 5DBCA 5J0PA 2O6KA 1ZQZA 1TVAA 3A0BU 7ICJA 3AEVA 2YB4A 1NZBA 1X2IA 1KBUA 4EEYA 3LDAA 2R18A 4J9OA 3JPNA 1NK0A 9ICBA 3MBYA 4KX3A 1UCVA 4YG2A 4DLEA 4P0QB 5KFQA 4QZGA 2N1RA 2MA1A 1N5WA 2JHDA 3HJEA 2FMQA 5EWEA 2V4QA 4F5QA 2IOFK 4KLLA 1JIHA 4ED8A 4O9MA 4GLXA 3C29A 4KLOA 3IDWA 5KFJA 3TADC 4ED1A 2GO7A 4O3NA 2IBKA 1QSSA 4QZBA 3HRDD 4DEZA 2BPFA 4NXZA 5CHGA 2BCQA 5CR0A 2HHSA 2BPCA 7ICHA 3F5EA 1FIQA 2V9WA 4RNOA 1S8OA 4U7CA 2P35A 3AQEA 2QB0B 1D8BA 2ZUCA 2EAMA 1N2XA 5IIKA 1ZD4A 2YX8A 5J0RA 2I9GA 1J2NA 1U48A 3PY8A 4O3RA 1FFVA 5AICA 2FPMA 2IOHA 4R66A 3PVXA 5KAIU 3WK7A 3RR7A 4Q43A 1FO4A 2DKZA 4QNLA 9ICGA 3DEEA 3MDAA 3UMBA 3WK8A 2HBKA 3SR6A 4DL2A 5J0XA 3MFHA 2KV2A 4ECVA 2Y1IA 1L3TA 2DF4B 4BX9C 2JEGA 2F1IA 5KG5A 4RNMA 3G6XA 3HT3A 2KSOA 9ICRA 2W43A 2H3IA 2C2EA 1BPZA 3QUCA 3JPOA 4FFDA 3UQ0A 1L5UA 3PSFA 2A3VA 2BQRA 1NK5A 5AKHA 4DFJA 3E58A 1HIWA 3KHLA 2Q4TA 4R63A 2JH7A 1SWVA 4UAZA 2F2AB 4DSEA 5IINA 2YQEA 1WUDA 5ALGA 4A8EA 1L7PA 1ZQLA 1IV8A 1KSPA 1ZJMA 3RB3A 2F76X 2FMSA 4OJLA 2J6TA 3K1RB 4J9QA 3H0MB 4EYHB 1Z3EB 9ICOA 4UAVA 3UM9A 1ZD5A 9ICAA 5AM3A 4YQWA 2JXJA 1U47A 2WB1F 2H3ZA 5AK6A 4GXJA 1DK3A 2W7PA 4AYBC 2K60A 1V85A 4B9LA 4BGDA 2HBJA 4UARA 3SAFA 2F8KA 1F5SA 3ISDA 3SV3A 5JU5A 4RPZA 2K8CB 2F1JA 1NK4A 2RP5A 3TARA 4PL1A 2G08A 5KFIA 5J2IA 2OCEA 2ZIVB 1WCNA 1HUZA 4C4SA 2F1HA 1ZQVA 8ICTA 2AU0A 1ZQBA 1JALA 3WKCA 3PSIA 3H8MA 2WF7A 4YN4A 2IA6A 2B21A 3O0FA 4FZMA 4KX5A 2FE9A 5EE1A 5AM5A 3OSPA 3LVWA 4ACOA 1T4GA 3PX4A 2ZTCA 5CB1A 2H5XA 3RFAA 4PPXA 3QU7A 9ICUA 4IR1A 9ICIA 2DUYA 1N60A 1PVQA 4CDGA 3DDHA 3WKAA 2QKQA 9ICPA 2W9CB 2KZMA 2KNJA 2DWQA 4KLEA 2XCAA 2LI6A 5AM1A 4DSJA 3HPOA 1QH9A 3FDSA 3QYPA 2A1AA 3SD7A 2Y9UA 2LM1A 4RNNA 4OJ5A 4K4GA 4Q44A 1U4BA 1UA1A 3FC4A 1ZQYA 3H8JA 2D8CA 4DL5A 3UPQA 3AM9A 4RQMA 4DOCA 2EQYA 3DV9A 3PW2A 2ZIUA 1EXNA 3HILA 8ICPA 5HP4A 5J29A 4UAWA 2MAXA 3Q8LA 9ICQA 1NI3A 5J2KA 2KE7A 4DCCA 3MGHA 8ICIA 2NRXA 3MGVA 1RDFA 4DFKA 4F5NA 1X9SA 1NJYA 1A77A 1T94A 5J0UA 5AI0A 2PXIA 1ECWA 3C5GA 1D9FA 3IG8A 2KP7A 5ALKA 1O03A 1X9WA 4Z6DA 1A76A 2C2DA 3RAXA 1U9LA 1DOQA 3GFKB 5AKXA 2E1EA 1L3UA 1BPBA 1RXWA 3Q8RB 1F44A 4I28A 1ZQCA 1X6JA 3BQ1A 2PI4A 3ETLA 5J2CA 2HCFA 3PX6A 4M9GA 3SZ2A 3PZPA 1Q8KA 2W04A 1K1SA 2JEFA 1HUOA 2YMLA 5J2GA 3QUQA 4EYIB 1SV0C 5AM0A 4CE6A 4IQTA 2HI0A 1QLNA 4AYBF 4RQ0A 4FE3A 1S76D 3ORYA 3HP6A 1QCKA 2MU2A 2KIWA 4JK1A 4KLUA 3OTQA 1XO0A 4O3MA 3NTUA 5ALTA 4O3PA 1UT5A 1X6IA 1ZQPA 4CNQA 4F5PA 1S97A 4KN4A 2K4EA 3M8RA 2JRZA 3H8WA 3ZDEA 2W11A 5DBAA 3OSNA 2M9NA 4IRDA 5CA7A 3AUOA 1YZ7A 3PO5A 2BHNA 2PMZC 3D2NA 1KKXA 3D2SA 3VC8A 2BCVA 4F8RA 3C1ZA 3Q8QB 2W9BB 4M2YA 8ICLA 4C8OA 3GIJA 5IIOA 4F4WA 5J2AA 2HHXA 2F77X 3ZD9A 4WJ3B 1L6NA 5KG4A 3EYZA 4I29A 5J0YA 5A0LA 2AGOA 3IM1A 1ZQGA 1ZXIA 4PHPA 3GV8B 4TQSA 2LBOA 1QTMA 4UBCA 3ONNA 1N63A 5AHXA 4F72A 2RDJA 3TAQA 1XSNA 2BZFA 3D2QA 2D3DA 3IV6A 4J9PA 3GIIA 5KFNA 4PHAA 2PFOA 5D46A 3NUQA 4M0AA 9ICCA 1OW5A 4RUAA 5EE0A 2NRVA 1B4FA 5CJ7A 2PFNA 5BOLA 5HHIA 2F8LA 1PK1B 5J2FA 2KN7A 3BS7A 7ICOA 5DKWA 2W55A 2Y9TA 3PV8A 5KFAA 5C0YA 1IG6A 4F4ZA 8ICAA 4RZRA 3AQFA 8ICVA 4Q45A 1T7PA 4QIWF 4J9RA 1ZD3A 2XCPA 1XSLA 4NM2A 4YR0A 3NVWA 4RQ3A 3FAHA 3RJIA 5ALVA 5D49A 2K4PA 4F50A 7ICTA 5JUMA 2VKQA 3AU2A 1TK0A 4GIBA 4MFCA 1NJWA 3KBBA 3PNCA 4DS5A 1UA0A 4ECWA 4PHEA 1OUQA 4C0ZA 2QARB 2BQUA 1S0MA 3ZD8A 2W8LA 1DGJA 1PK3A 4HAIA 3QUBA 4RPXA 2KVSA 3EPIA 2KFZA 2DKXA 3AU6A 1MC8A 3QE9Y 4I2AA 3RJEA 4UW9A 4MFAA 2KKPA 3F53A 5J2JA 4P0QA 1BNPA 2WF8A 4ECSA 3GIMA 1UHUA 4DL6A 4Z6EA 9ICLA 4NY8A 1SXDA 5KFPA 3TANA 1NJZA 2ASJA 1Q3VA 3MR6A 1U49A 1KFSA 2ZTEA 9ICVA 8ICEA 4CF5A 2OEHA 4YP3A 3RH6A 5CWRA 2G5HB 4F93B 4DSKA 4R8UB 2NO4A 4US8A 1S0OA 4ED6A 2BCUA 8ICGA 3C1YA 3EZ5A 1WWVA 4I2JA 1MA7A 4QZAA 4MEXA 7ICQA 4K4IA 2KMDA 2W3RA 5AKJA 1M6YA 2ZG6A 1ZQIA 5KFYA 4YMOA 2KHQA 1NK7A 4G3IA 3LVVA 3FYHA 4ECQA 4AP9A 3SYZA 3BZKA 4DFMA 2P6RA 3V7LA 4M9HA 2WB1C 2LYBA 4QWAA 1RQNA 2XY5A 5HMMA 4YR3A 1NKBA 2AGQA 4J9SA 5EE3A 1S5LU 4HYKA 3I28A 1JUDA 2AGPA 3KKAC 3GZFA 4KLJA 2EZZA 5JTIA 3V72A 8ICXA 4DQRA 4LZDA 1CI4A 3I76A 1MN8A 1WG8A 3QEAZ 5ALOA 4UBBA 4M9JA 2HHUA 3TI0A 2JGAA 4JV2A 1S10A 4F4KA 5E79U 4UB4A 2J6SA 3CW2C 4UATA 4O3SA 2LYHA 3SMVA 3OHAA 4F4YA 2B0CA 3T5KA 4CGZA 2JEIA 3U26A 1LKYB 8ICWA 5L1LA 4EZ6A 2KZ3A 8ICNA 5AK3A 2KEYA 2I1QA 3RH4A 5J0WA 3RTVA 3TADA 2DPJA 4RQ2A 3SI8A 1IXRA 2QB1A 3B9JA 1ZQJA 4DO9A 5AIAA 2C2RA 2JR5A 4DF8A 4F71A 3LWLA 4M6WB 4RT3A 5DB7A 1NK6A 2R8HA 2PFQA 1O08A 4KMOB 2HMXA 1LVHA 1JN3A 5HNKA 4DWIA 2I5HA 3MABA 1TKDA 2QLTA 1KFTA 1YZ6A 2E8OA 4BXOB 4IQUA 2RQ5A 3SAHA 2ODGA 5DGAA 2ZIVA 4QWCA 5IIIA 3JPRA 4QWBA 1N61A 3C2LA 5ALMA 2GWSA 4QWDA 2Y0SC 2R8JA 2RDIA 5DQIA 5ALPA 2HVIA 4NWIA 1N56A 4B9SA 2A19A 3Q8MA 1CRXA 4Q8EA 4P4MA 4M04A 2HSZA 3WK9A 5DDMA 4ED2A 4ED3A 4BUGA 4LJXA 4UASA 3C2KA 4F4XA 2W9CA 2BCSA 1V97A 4IC9A 2P66A 3RB0A 1AROP 2Q0ZX 5CRXA 5KG3A 4ELVA 1TAUA 1SGGA 4F5OA 4NLGA 2E5SA 2KVCA 1Z4NA 2EANA 3K75D 4ED0A 4MHVA 4YMMA 4ZH4A 4R65A 5F3XB 1ZRMA 4KLDA 5IIMA 3IN5A 4IRCA 8ICBA 4JMUA 1S0NA 3WU2U 5ALNA 4PGQA 9ICEA 1SKSA 3EPGA 1JMSA 5AI6A 3TFRA 4QZ8A 4NL9C 1ZQEA 3NS1A 1DXSA 1Z00B 1ZJNA 3CNHA 2XC9A 3UXPA 5FP0A 3AL0B 9ICTA 8ICUA 5AKEA 1ZQUA 2D6FC 3C21A 4IL6U 3T5LA 1TV9A 4PJ0U 9ICSA 5GTHU 2R8IA 1ZETA 2FLLA 4C8NA 2EDUA 1X40A 2UVRA 2YY6A 4FBUA 3S6JA 4DQQA 2J6UA 3N28A 4KITB 3L4PA 3QU2A 3H8SA 1KW4A 2IMWP 4DL4A 2ZXIA 3QX7A 3N7SC 3WK4A 4KN7A 4KLTA 4B9MA 2G5IB 5HR7A 1SKWA 3I1YA 3RR8A 3F2BA 4RQ4A 3M9NB 4I2IA 4JWNA 4XRHA 2RLTA 3BQ7A 3K4GA 1J97A 2V4RA 1L3VA 5H2FU 3NVYA 2KHVA 4PHDA 3H4BA 3H4DA 3RAQA 5AI9A 2FMPA 1JI7A 5KFLA 2KZZA 2B6GA 1D9DA 2UVWA 1P7DA 4DQSA 1XWLA 2BDPA 1B22A 5DB9A 4QIWC 5KG1A 4QZDA 4J9LA 4P4OA 2BPGA 4UB5A 2IHMA 4TQRA 9ICHA 2ZIWB 4KLFA 2Y0SF 3IRUA 3QU4A 2W9BA 2E3TA 3M6KA 2EZYA 4I2DA 1NOMA 4CCHA 4ECTA 1PUZA 1NK9A 1X42A 9ICJA 3MDCA 4F3OA 2VJ4A 5J2HA 4J9NA 4F5RA 5KG0A 1K5OA 2G0AA 2BR0A 5J2EA 4UB8U 5ALLA 3PMNA 2XY6A 2VANA 4BDPA 3WKDA 4YR2A 2GOLA 4DL3A 2L5YA 2VIXA 4QWEA 3UXOA 8ICRA 2K89A 4X5VA 4I2BA 4I2CA 1B43A 1BGXT 8ICFA 1PK1A 2HOFA 3PX0A 4GXKA 4C7ZA 3JPSA 4RQ1A 3GIKA 1S77D 5EE9A 2LYAA 3QXGA 4DF4A 4LZGA 1SV4A 4M9LA 3RBDA 4F2RA 4DSLA 3MR2A 3JPTA 2WHEA 3QZ7A 2WAQC 4US9A 1VJ5A 7ICIA 2YMMA 5J0QA 1RG6A 8ICSA 4DFPA 2FPLA 2KOBA 1NZPA 2CN1A 2HW3A 1TE2A 3NVZA 2DGZA 4C8LA 2A1JB 3SEIA 7ICKA 1A6SA 2MUTB 4B9NA 1SV0A 3UXNA 1COOA 5BOMA 4IRKA 2QARA 2ESEA 4UB6U 4M47A 9ICWA 4IQWA 4DS4A 5KAFU 3PR5B 2C28A 4I2FA 2FDRA 1NNLA 5KL8B 2NRTA 2P6UA 1SIJA 2E1FA 3V7JA 1T8EA 1JROA 3UQ2A 2XGPA 5CEHA 5F9LA 1CEZA 2IHNA 2AXTU 5KT5A 2NYVA 1QSYA 5ALUA 5T14A 4YVZA 7ICRA 1L8OA 1X66A 3LWMA 1KRPA 2WF5A 3ICXA 3V6JA 4DLGA 1BPXA 3ZDBA 4IQVA 1KTQA 3H0LB 4R64A 4R8UA 4YMNA 1XS9D 5L1MA 1RZTA 8ICQA 3V7KA 2G07A 2WFAA 5KL1B 3GV7B 4QZ9A 2OH2A 5HHHA 1SZHA 4B6JA 5JRTA 5GTIU 2FJ6A 5EWFA 4ECYA 3RRGA 4ICAA 3ALRA 4TUPA 3FM9A 3ZDAA 2E8NA 5ALIA 5G5GA 3TKAA 2JZBB 1ZQDA 4DSIA 3F2DA 1ZQMA 4EZ9A 5K4LA 8ICCA 1BVSA 4Y2PA 4RQ7A 4MF2A 5J0SA 1ZQSA 1L3SA 3WKBA 3SQIA 5KTQA 3AN1A 1S9FA 4NLBA 4QZFA 4YD2A 4PGYA 1MQ2A 4ZOHC 5J8YC 2ZIXB 2HBMA 3BDPA 5KT7A 4DQIA 1A0PA 1B0XA 4IS7A 1NKCA 3EWAA 3GU3A 4TURA 3QUTA 4EX6A 5AI8A 5ALXA 3QU9A 4RQ5A 2RHFA 3V6KA 1NKEA 2M0NA 1Z19A 1N62A 2W3SA 1J2MA 2VA8A 2JMGA 3IG5A 4O0IA 5F9NA 4O3QA 3QZ8A 4EELA 2HHVA 1RYSA 1OXJA 5C5JA 1KN5A 2Y1JA 2WAQF 7ICNA 1KL9A 5KFXA 4Y2TA 4ED7A 2FPKA 3TFSA 3CP8A 4DOAA 8ICMA 2ASDA 3GILA 3GQCA 3KHHA 3BS5B 1ZQQA 1S0VA 4JV0A 1L7OA 4FO6A 2W54A 3OJSA 3EW9A 4QZCA 2XIDA 4XQ8A 3NASA 3JPPA 3F5AA 1WCLA 2GH1A 1ZYQA 3KOOA 1ZQNA 1LKYA 4NLCA 5KFWA 4PL2A 7ICMA 1T3NA 2R8KA 5KT3A 3TACB 5KFTA 4PZNA 3C2MA 4K4HA 3WKEA 5ALWA 4KLQA 1ZQRA 5J0OA 2KJ9A 8ICJA 5D4BA 1RQLA 4M6WA 4GC7A 3BQ2A 4YCXA 5DB6A 2ZJAA 3MC1A 4M9NA 3NRWA 4Y2SA 5AIBA 3D6JA 2H3QA 4BJQA 3QEBZ 2W8KA 4YFKA 3JPQA 3ISCA 4NM1A 1MSWD 2YMQA 5KFHA 5KFEA 1QQ7A 4J03A 4BXOA 2ISOA 4O3OA 4Z6CA 2DBYA 1WWUA 2DFLA 3H40A 1ZQXA 1JXEA 2LMRA 2HOQA 9ICMA 3PO4A 4O5KA 1BNOA 2KKVA 1XNSA 1ZD2P 4YXJA 5L9XA 4FZNA 2AQ0A 3J81j 4B9UA 2KJ5A 2BGWA 4BWJA 2LKYA 4P0PB 2K4IA 3KTQA 5HMLA 4GXIA 8ICHA 1SL0A 3H7IA 2OHFA 2HOIA 8ICKA 4E0DA 3EUB2 2KICA 2VA3A 1Z4OA 3SV4A 2ZJ8A 2EAPA 4KLMA 3ZDDA 4OD0A 3CYMA 7ICGA 3M6ZA 3NRZA 5L1KA 3KKAA 4CF3A 2ASLA 4RQ6A 1KEJA 3QNMA 4KLSA 1PVPA 4O5EA 5AKLA 4KLGA 1BPDA 3PW7A 3L3FX 2BQ3A 7ICLA 4UB1A 4YD1A 1ZQOA 2ZUBA 4RQNA 1L7NA 2ES6A 4IR9A 1RYUA 2CPRA 4OJOA 1KLNA 5AKKA 3R9KA 3SENA 7ICVA 3Q8KA 2H3VA 3T5JA 5L1JA 2CRXA 2C22A 1TK5A 7ICFA 1U45A 3A0HU 4OO1J 2MRLA 1Q46A 1Z00A 1SZPA 3B0YA 4XUSA 2BCRA 4NLKA 2ATLA 5TISU 3PR4A 4RQ8A 5KNIA 2G06A 5KFOA 2JEJA 3C28A 2OWOA 1XC9A 1SL2A 4Z6FA 3C5FA 7ICEA 4UAYA 1KQQA 3RJGA 3RB6A 4QJFB 1V9PA 2F44A 3IP4B 3MGIA 4P4PA 5B66U 4Y2XA 1NK8A 5DG7A 2LHTA 4C8MA 3E0FA 5AM4A 4JV1A 1PZNA 5G5HA 4UB2A 2HHQA 1ZQ1C 1FFUA 4P2HA 5ALYA 4FZLA 3NVVA 4Y2VA 3KZIU 3VCBA 3KD3A 5DGBA 3RJKA 1L7MA 4C7YA 3T3FA 1ED1A 5KG6A 4EBCA 2LPEA 1HJPA 3BQTA 5KG7A 4F92B 5KFZA 4DFDA 2ZTDA 1HEKA 4O5CA 5DG9A 2Z7JA 1ZQAA 4Y2RA 2YB1A 2EH9A 1SWWA 4PZOA 4KLHA 3E2EA 3M7DA 2W9MA 2ZIWA 5DBBA 3RJFA 4I2EA 5AI4A 1ZQHA 3PW5A 2W03A 2XY7A 5HR6A 2KSOB 3ZI4A 2MSNA 1GO3F 3WK6A 1JX4A 5KFKA 2XGQA 3GDXA 1URJA 1ZQFA 4JB3A 3L5KA 4C4RA 4PH5A 4C80A 3SAGA 1RM6C 8ICZA 3TQ1A 5AK4A 4QZIA 3PSTA 1JXLA 2BDUA 2OXOA 1VDVA 9ICNA 2YMPA 4NL9A 1N5XA 1Z1VA 4J9MA 5TZVA 2NRZA 1D8LA 4YXMA 5KFFA 4DSFA 5EOZA 2HHTA 5J2BA 2K4HA 4EEKA 1IM4A 4KMUA 5DDYA 1QQ5A 1QSLA 5AKGA 5B5EU 1SKRA 5AKZA 3LYSA 1T3QA 5KT6A 5KFGA 1ZQKA 2KFNA 4U6PA 4ECRA 2G09A 5KFMA 2AJQA 4DL7A 3BQ0A 4Y2UA 4UQGA 1TAMA 4EBEA 3ETRA 2A1JA 3RB4A 5BPCA 3PSPA 1LV5A 2MUTA 1H38A 3WK5A 3ISBA 4CRXA 2AH5A 1Q3UA 2ALZA 2EZXA 1LB2B 5ALHA 5AI5A 1D8YA 1X9MA 2WF6A 3KFUF 2WF9A 5KFSA 5ALFA 4DQPA 2JH1A 2EAOA 3TAPA 2LM4A 5ALDA 1ZQWA 4Y2JA 3QU5A 2JV3A 5CP2A 2H3FA 1DGSA 7ICUA 1FEZA 3G6YA 5KFVA 1KFDA 1C20A 3T79A 5ALZA 4USAA 2UVUA 4OJPA 2RRDA 4NLZA 4PGXA 2BKEA 1ZRNA 4ECXA 2HVHA 5EWGA 5KT4A 4OCZA 3RF9A 1Y88A 1TAQA 2XI9A 2ISPA 5J0TA 4MF8A 9ICXA 4QZHA 4MFFA 2WTFA 2E8PA 3GV5B 3C23A 1ZQTA 3HX0A 3AMZA 4MEYA 4B9VA 3M9OB 3N4MB 4Y2QA 3BZCA 4NJ8A 4RU9A 1SXEA 4TUQA 3F2CA 2JZBA 4EX7A 4EBDA 5ALSA 2ZIUB 5DG8A 1BPEA 5AKYA 3RH5A 3PW4A 4Y2YA 1UQVA 3M9MB 2FLPA 4ELUA 1DK2A 1ZOLA 5KG2A 3N7PD 2NV3A 4FS1A 3THVA 3M8SA 4BWMA 5KFRA 1XU4A 4KTQA 2OM6A 4KLIA 3KHGA 4ECUA 2ZIXA 2KIVA 2YN4A 5ALJA 2OYYA 3OPXA 1PVRA 3HKZC 4ECZA 2PKEA 3Q8SB 4F2SA 1MQ3A 1BPYA 1YT3A 2XO7A 5DLFA 3RRHA 5ALEA 2GLEA 2AQ4A 2E8MA 2KJ8A 1WYGA 3RJJA 4QW9A 3G6VA 3T5HA 4GFJA 5DLGA 2R8GA 3OHBA 8ICOA 3UMGA 3K1ZA 1L8LA 2DPIA 2UVVA 1SB3C 3BS5A 1X9XA 2DQNB 8ICYA 4C8KA 5KFDA 2PI5A 5DQHA
chains in the Genus database with same CATH topology
3SQIA 3MGVA 1A6SA 2HBJA 4NLBA 3SAFA 2HBLA 5CRXA 3ONNA 2JGAA 2G06A 1T94A 3H0RB 3RF9A 1ECWA 3D2QA 4QNLA 2ZIXB 2HBMA 2K8CB 3DEEA 3N7RC 3C28A 1Q3VA 1P7DA 2XI9A 3HKZF 3IG8A 2K4HA 2HBKA 3KZXA 1A0PA 2RP5A 2K8BB 2E5SA 2KVCA 2G08A 4PL1A 3GU3A 2XICA 2ZIVB 4QIWC 2W7OA 2HOQA 2VJ5A 1Z1BA 3SMVA 4QJFB 2G5HB 2KV2A 2KKVA 3IP4B 4CGZA 2E1EA 3NUQA 1XNSA 2ZIWB 2XVTA 2RHFA 3PSIA 3IN5A 1F44A 1NZBA 2M0NA 2YB4A 1Z19A 4FZNA 2LHTA 2KEYA 2DF4B 2F8LA 3O0FA 2JMGA 2Y0SF 4FZMA 3LYSA 4JMUA 3IG5A 3E0FA 4KX5A 1MA7A 2KJ5A 1KBUA 3M6KA 2LKYA 4BX9C 3PZPA 4P0PB 2W04A 3LVWA 4ACOA 2K4IA 5KL8B 2H3IA 4U6PA 5C0YA 2G09A 2ZXHA 3F2CA 2E1FA 1ZQ1C 2HOIA 2ZIUB 3AQFA 2WAQF 2R18A 2VJ4A 4FZLA 3RFAA 4QIWF 3CP8A 3VCBA 3PSFA 4KX3A 4AYBF 2A3VA 2KICA 4OJ6A 4FE3A 4P0QB 1PVQA 2ZG6A 1ED1A 2G0AA 2KHQA 4CDGA 4KMOB 1TAMA 2HMXA 2KIWA 3LVVA 3AL0B 1HIWA 3N7PD 1XO0A 2N1RA 2MA1A 2NV3A 2Q4TA 3CYMA 3M6ZA 4O3MA 3PSPA 2KNJA 2XIDA 5T14A 2D6FC 2JH7A 2JHDA 4CRXA 2OM6A 1Q3UA 2VKQA 1PVPA 2ZIXA 2GOLA 2F2AB 2K8AA 2VIXA 1DRGA 3ICXA 2OYYA 1HEKA 3F5AA 3OPXA 2Z7JA 2WB1C 3SAHA 1PVRA 2K4EA 3HKZC 3C29A 1WUDA 2K89A 3L3FX 2YB1A 2ZIVA 4NV0A 4A8EA 2LYBA 3M7DA 1OUQA 2GH1A 4C0ZA 3H0LB 4OJ5A 2ZIWA 4NLCA 2F76X 3CRXA 2PMZC 4PL2A 3D2NA 3KFUF 1YT3A 4OJLA 3D2SA 3VC8A 2CPRA 2ZXIA 4OJOA 2G07A 5KL1B 3N7SC 2HOFA 2OH2A 2JH1A 4IC9A 2Y0SC 1SZHA 3H0MB 4P0PA 2W03A 1IIPA 2KD1A 5HR6A 2H3VA 2LYAA 2CRXA 2KJ8A 4ICAA 2H3FA 3ALRA 4NWIA 2G5IB 5HR7A 1GO3F 4GFJA 3F5EA 2WB1F 2ZIUA 2KJ9A 1UPHA 2F77X 3GZFA 2H3ZA 2KKPA 2WAQC 4U7CA 3F2BA 1CRXA 4WJ3B 1L6NA 3F53A 1URJA 3AQEA 4OO1J 2MRLA 3K1ZA 2W7PA 1D8BA 3F2DA 2KOBA 3T79A 2CN1A 4AYBC 4P0QA 5A0LA 2YX8A 4BUGA 2DQNB 3SAGA 2PMZF 4OJPA 3NRWA 2RRDA 2DGZA 4BJQA 2H3QA 2KHVA 3PSTA 2LBOA 2BDUA 2OXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRL A; 
#chains in the Genus database with same CATH topology
 5KFU A;  2FLN A;  2KK0 A;  3IHQ B;  2HBL A;  2ZUD A;  4JUZ A;  3H0R B;  2FI1 A;  1NJX A;  1COK A;  5ALR A;  3M1Y A;  2K8B B;  2W9A A;  4F91 B;  2W7O A;  2VJ5 A;  2HDO A;  5AK5 A;  3OGU A;  2XVT A;  1AQ6 A;  3ZDC A;  4CF4 A;  3MFI A;  1C7Y A;  5KFC A;  2KG5 A;  9ICK A;  4G9B A;  1XO1 A;  2IOF A;  1KDH A;  4B9T A;  1N48 A;  4RT2 A;  2ZXH A;  4XA5 A;  4FBT A;  1V38 A;  5AM2 A;  1F0M A;  2AHO B;  4I2H A;  2I6X A;  4ELT A;  2KTQ A;  1VLB A;  4OJ6 A;  1XSP A;  3V6H A;  4I27 A;  1TK8 A;  3KHR A;  4RUC A;  3UMC A;  3B0X A;  3ED5 A;  1RXV A;  7ICP A;  2K8A A;  1DRG A;  1K1Q A;  3OJU A;  4DOB A;  3PML A;  4I2G A;  4NV0 A;  2DL0 A;  4C4T A;  4LVS A;  1RYR A;  3CRX A;  5J8Y A;  5AKI A;  2ZJ5 A;  1SL1 A;  2VA2 A;  9ICF A;  3HW8 A;  4P0P A;  1IIP A;  2KD1 A;  4RPY A;  1TFR A;  4EEN A;  4UAU A;  2NO5 A;  3N97 B;  3BJY A;  4FS2 A;  5IIL A;  3RJH A;  1UPH A;  5DQG A;  4QW8 A;  5L1I A;  2F3N A;  4J9K A;  5J2D A;  2NRW A;  5IIJ A;  4TUS A;  4Q8F A;  5KFB A;  3PW0 A;  7ICS A;  2PMZ F;  5KT2 A;  2YTU A;  2HHW A;  3NGD A;  5ALQ A;  3LK9 A;  1JRP A;  2PFP A;  3Q8P B;  4QZE A;  4GC6 A;  2CXY A;  4JWM A;  5DB8 A;  1CUK A;  3MR3 A;  3MR5 A;  1RPL A;  3N7R C;  4UB3 A;  4NLN A;  2QB0 A;  3HKZ F;  3KZX A;  2XIC A;  3HWT A;  1Z1B A;  3RBE A;  1QQ6 A;  1UT8 A;  5DBC A;  5J0P A;  2O6K A;  1ZQZ A;  1TVA A;  3A0B U;  7ICJ A;  3AEV A;  2YB4 A;  1NZB A;  1X2I A;  1KBU A;  4EEY A;  3LDA A;  2R18 A;  4J9O A;  3JPN A;  1NK0 A;  9ICB A;  3MBY A;  4KX3 A;  1UCV A;  4YG2 A;  4DLE A;  4P0Q B;  5KFQ A;  4QZG A;  2N1R A;  2MA1 A;  1N5W A;  2JHD A;  3HJE A;  2FMQ A;  5EWE A;  2V4Q A;  4F5Q A;  2IOF K;  4KLL A;  1JIH A;  4ED8 A;  4O9M A;  4GLX A;  3C29 A;  4KLO A;  3IDW A;  5KFJ A;  3TAD C;  4ED1 A;  2GO7 A;  4O3N A;  2IBK A;  1QSS A;  4QZB A;  3HRD D;  4DEZ A;  2BPF A;  4NXZ A;  5CHG A;  2BCQ A;  5CR0 A;  2HHS A;  2BPC A;  7ICH A;  3F5E A;  1FIQ A;  2V9W A;  4RNO A;  1S8O A;  4U7C A;  2P35 A;  3AQE A;  2QB0 B;  1D8B A;  2ZUC A;  2EAM A;  1N2X A;  5IIK A;  1ZD4 A;  2YX8 A;  5J0R A;  2I9G A;  1J2N A;  1U48 A;  3PY8 A;  4O3R A;  1FFV A;  5AIC A;  2FPM A;  2IOH A;  4R66 A;  3PVX A;  5KAI U;  3WK7 A;  3RR7 A;  4Q43 A;  1FO4 A;  2DKZ A;  4QNL A;  9ICG A;  3DEE A;  3MDA A;  3UMB A;  3WK8 A;  2HBK A;  3SR6 A;  4DL2 A;  5J0X A;  3MFH A;  2KV2 A;  4ECV A;  2Y1I A;  1L3T A;  2DF4 B;  4BX9 C;  2JEG A;  2F1I A;  5KG5 A;  4RNM A;  3G6X A;  3HT3 A;  2KSO A;  9ICR A;  2W43 A;  2H3I A;  2C2E A;  1BPZ A;  3QUC A;  3JPO A;  4FFD A;  3UQ0 A;  1L5U A;  3PSF A;  2A3V A;  2BQR A;  1NK5 A;  5AKH A;  4DFJ A;  3E58 A;  1HIW A;  3KHL A;  2Q4T A;  4R63 A;  2JH7 A;  1SWV A;  4UAZ A;  2F2A B;  4DSE A;  5IIN A;  2YQE A;  1WUD A;  5ALG A;  4A8E A;  1L7P A;  1ZQL A;  1IV8 A;  1KSP A;  1ZJM A;  3RB3 A;  2F76 X;  2FMS A;  4OJL A;  2J6T A;  3K1R B;  4J9Q A;  3H0M B;  4EYH B;  1Z3E B;  9ICO A;  4UAV A;  3UM9 A;  1ZD5 A;  9ICA A;  5AM3 A;  4YQW A;  2JXJ A;  1U47 A;  2WB1 F;  2H3Z A;  5AK6 A;  4GXJ A;  1DK3 A;  2W7P A;  4AYB C;  2K60 A;  1V85 A;  4B9L A;  4BGD A;  2HBJ A;  4UAR A;  3SAF A;  2F8K A;  1F5S A;  3ISD A;  3SV3 A;  5JU5 A;  4RPZ A;  2K8C B;  2F1J A;  1NK4 A;  2RP5 A;  3TAR A;  4PL1 A;  2G08 A;  5KFI A;  5J2I A;  2OCE A;  2ZIV B;  1WCN A;  1HUZ A;  4C4S A;  2F1H A;  1ZQV A;  8ICT A;  2AU0 A;  1ZQB A;  1JAL A;  3WKC A;  3PSI A;  3H8M A;  2WF7 A;  4YN4 A;  2IA6 A;  2B21 A;  3O0F A;  4FZM A;  4KX5 A;  2FE9 A;  5EE1 A;  5AM5 A;  3OSP A;  3LVW A;  4ACO A;  1T4G A;  3PX4 A;  2ZTC A;  5CB1 A;  2H5X A;  3RFA A;  4PPX A;  3QU7 A;  9ICU A;  4IR1 A;  9ICI A;  2DUY A;  1N60 A;  1PVQ A;  4CDG A;  3DDH A;  3WKA A;  2QKQ A;  9ICP A;  2W9C B;  2KZM A;  2KNJ A;  2DWQ A;  4KLE A;  2XCA A;  2LI6 A;  5AM1 A;  4DSJ A;  3HPO A;  1QH9 A;  3FDS A;  3QYP A;  2A1A A;  3SD7 A;  2Y9U A;  2LM1 A;  4RNN A;  4OJ5 A;  4K4G A;  4Q44 A;  1U4B A;  1UA1 A;  3FC4 A;  1ZQY A;  3H8J A;  2D8C A;  4DL5 A;  3UPQ A;  3AM9 A;  4RQM A;  4DOC A;  2EQY A;  3DV9 A;  3PW2 A;  2ZIU A;  1EXN A;  3HIL A;  8ICP A;  5HP4 A;  5J29 A;  4UAW A;  2MAX A;  3Q8L A;  9ICQ A;  1NI3 A;  5J2K A;  2KE7 A;  4DCC A;  3MGH A;  8ICI A;  2NRX A;  3MGV A;  1RDF A;  4DFK A;  4F5N A;  1X9S A;  1NJY A;  1A77 A;  1T94 A;  5J0U A;  5AI0 A;  2PXI A;  1ECW A;  3C5G A;  1D9F A;  3IG8 A;  2KP7 A;  5ALK A;  1O03 A;  1X9W A;  4Z6D A;  1A76 A;  2C2D A;  3RAX A;  1U9L A;  1DOQ A;  3GFK B;  5AKX A;  2E1E A;  1L3U A;  1BPB A;  1RXW A;  3Q8R B;  1F44 A;  4I28 A;  1ZQC A;  1X6J A;  3BQ1 A;  2PI4 A;  3ETL A;  5J2C A;  2HCF A;  3PX6 A;  4M9G A;  3SZ2 A;  3PZP A;  1Q8K A;  2W04 A;  1K1S A;  2JEF A;  1HUO A;  2YML A;  5J2G A;  3QUQ A;  4EYI B;  1SV0 C;  5AM0 A;  4CE6 A;  4IQT A;  2HI0 A;  1QLN A;  4AYB F;  4RQ0 A;  4FE3 A;  1S76 D;  3ORY A;  3HP6 A;  1QCK A;  2MU2 A;  2KIW A;  4JK1 A;  4KLU A;  3OTQ A;  1XO0 A;  4O3M A;  3NTU A;  5ALT A;  4O3P A;  1UT5 A;  1X6I A;  1ZQP A;  4CNQ A;  4F5P A;  1S97 A;  4KN4 A;  2K4E A;  3M8R A;  2JRZ A;  3H8W A;  3ZDE A;  2W11 A;  5DBA A;  3OSN A;  2M9N A;  4IRD A;  5CA7 A;  3AUO A;  1YZ7 A;  3PO5 A;  2BHN A;  2PMZ C;  3D2N A;  1KKX A;  3D2S A;  3VC8 A;  2BCV A;  4F8R A;  3C1Z A;  3Q8Q B;  2W9B B;  4M2Y A;  8ICL A;  4C8O A;  3GIJ A;  5IIO A;  4F4W A;  5J2A A;  2HHX A;  2F77 X;  3ZD9 A;  4WJ3 B;  1L6N A;  5KG4 A;  3EYZ A;  4I29 A;  5J0Y A;  5A0L A;  2AGO A;  3IM1 A;  1ZQG A;  1ZXI A;  4PHP A;  3GV8 B;  4TQS A;  2LBO A;  1QTM A;  4UBC A;  3ONN A;  1N63 A;  5AHX A;  4F72 A;  2RDJ A;  3TAQ A;  1XSN A;  2BZF A;  3D2Q A;  2D3D A;  3IV6 A;  4J9P A;  3GII A;  5KFN A;  4PHA A;  2PFO A;  5D46 A;  3NUQ A;  4M0A A;  9ICC A;  1OW5 A;  4RUA A;  5EE0 A;  2NRV A;  1B4F A;  5CJ7 A;  2PFN A;  5BOL A;  5HHI A;  2F8L A;  1PK1 B;  5J2F A;  2KN7 A;  3BS7 A;  7ICO A;  5DKW A;  2W55 A;  2Y9T A;  3PV8 A;  5KFA A;  5C0Y A;  1IG6 A;  4F4Z A;  8ICA A;  4RZR A;  3AQF A;  8ICV A;  4Q45 A;  1T7P A;  4QIW F;  4J9R A;  1ZD3 A;  2XCP A;  1XSL A;  4NM2 A;  4YR0 A;  3NVW A;  4RQ3 A;  3FAH A;  3RJI A;  5ALV A;  5D49 A;  2K4P A;  4F50 A;  7ICT A;  5JUM A;  2VKQ A;  3AU2 A;  1TK0 A;  4GIB A;  4MFC A;  1NJW A;  3KBB A;  3PNC A;  4DS5 A;  1UA0 A;  4ECW A;  4PHE A;  1OUQ A;  4C0Z A;  2QAR B;  2BQU A;  1S0M A;  3ZD8 A;  2W8L A;  1DGJ A;  1PK3 A;  4HAI A;  3QUB A;  4RPX A;  2KVS A;  3EPI A;  2KFZ A;  2DKX A;  3AU6 A;  1MC8 A;  3QE9 Y;  4I2A A;  3RJE A;  4UW9 A;  4MFA A;  2KKP A;  3F53 A;  5J2J A;  4P0Q A;  1BNP A;  2WF8 A;  4ECS A;  3GIM A;  1UHU A;  4DL6 A;  4Z6E A;  9ICL A;  4NY8 A;  1SXD A;  5KFP A;  3TAN A;  1NJZ A;  2ASJ A;  1Q3V A;  3MR6 A;  1U49 A;  1KFS A;  2ZTE A;  9ICV A;  8ICE A;  4CF5 A;  2OEH A;  4YP3 A;  3RH6 A;  5CWR A;  2G5H B;  4F93 B;  4DSK A;  4R8U B;  2NO4 A;  4US8 A;  1S0O A;  4ED6 A;  2BCU A;  8ICG A;  3C1Y A;  3EZ5 A;  1WWV A;  4I2J A;  1MA7 A;  4QZA A;  4MEX A;  7ICQ A;  4K4I A;  2KMD A;  2W3R A;  5AKJ A;  1M6Y A;  2ZG6 A;  1ZQI A;  5KFY A;  4YMO A;  2KHQ A;  1NK7 A;  4G3I A;  3LVV A;  3FYH A;  4ECQ A;  4AP9 A;  3SYZ A;  3BZK A;  4DFM A;  2P6R A;  3V7L A;  4M9H A;  2WB1 C;  2LYB A;  4QWA A;  1RQN A;  2XY5 A;  5HMM A;  4YR3 A;  1NKB A;  2AGQ A;  4J9S A;  5EE3 A;  1S5L U;  4HYK A;  3I28 A;  1JUD A;  2AGP A;  3KKA C;  3GZF A;  4KLJ A;  2EZZ A;  5JTI A;  3V72 A;  8ICX A;  4DQR A;  4LZD A;  1CI4 A;  3I76 A;  1MN8 A;  1WG8 A;  3QEA Z;  5ALO A;  4UBB A;  4M9J A;  2HHU A;  3TI0 A;  2JGA A;  4JV2 A;  1S10 A;  4F4K A;  5E79 U;  4UB4 A;  2J6S A;  3CW2 C;  4UAT A;  4O3S A;  2LYH A;  3SMV A;  3OHA A;  4F4Y A;  2B0C A;  3T5K A;  4CGZ A;  2JEI A;  3U26 A;  1LKY B;  8ICW A;  5L1L A;  4EZ6 A;  2KZ3 A;  8ICN A;  5AK3 A;  2KEY A;  2I1Q A;  3RH4 A;  5J0W A;  3RTV A;  3TAD A;  2DPJ A;  4RQ2 A;  3SI8 A;  1IXR A;  2QB1 A;  3B9J A;  1ZQJ A;  4DO9 A;  5AIA A;  2C2R A;  2JR5 A;  4DF8 A;  4F71 A;  3LWL A;  4M6W B;  4RT3 A;  5DB7 A;  1NK6 A;  2R8H A;  2PFQ A;  1O08 A;  4KMO B;  2HMX A;  1LVH A;  1JN3 A;  5HNK A;  4DWI A;  2I5H A;  3MAB A;  1TKD A;  2QLT A;  1KFT A;  1YZ6 A;  2E8O A;  4BXO B;  4IQU A;  2RQ5 A;  3SAH A;  2ODG A;  5DGA A;  2ZIV A;  4QWC A;  5III A;  3JPR A;  4QWB A;  1N61 A;  3C2L A;  5ALM A;  2GWS A;  4QWD A;  2Y0S C;  2R8J A;  2RDI A;  5DQI A;  5ALP A;  2HVI A;  4NWI A;  1N56 A;  4B9S A;  2A19 A;  3Q8M A;  1CRX A;  4Q8E A;  4P4M A;  4M04 A;  2HSZ A;  3WK9 A;  5DDM A;  4ED2 A;  4ED3 A;  4BUG A;  4LJX A;  4UAS A;  3C2K A;  4F4X A;  2W9C A;  2BCS A;  1V97 A;  4IC9 A;  2P66 A;  3RB0 A;  1ARO P;  2Q0Z X;  5CRX A;  5KG3 A;  4ELV A;  1TAU A;  1SGG A;  4F5O A;  4NLG A;  2E5S A;  2KVC A;  1Z4N A;  2EAN A;  3K75 D;  4ED0 A;  4MHV A;  4YMM A;  4ZH4 A;  4R65 A;  5F3X B;  1ZRM A;  4KLD A;  5IIM A;  3IN5 A;  4IRC A;  8ICB A;  4JMU A;  1S0N A;  3WU2 U;  5ALN A;  4PGQ A;  9ICE A;  1SKS A;  3EPG A;  1JMS A;  5AI6 A;  3TFR A;  4QZ8 A;  4NL9 C;  1ZQE A;  3NS1 A;  1DXS A;  1Z00 B;  1ZJN A;  3CNH A;  2XC9 A;  3UXP A;  5FP0 A;  3AL0 B;  9ICT A;  8ICU A;  5AKE A;  1ZQU A;  2D6F C;  3C21 A;  4IL6 U;  3T5L A;  1TV9 A;  4PJ0 U;  9ICS A;  5GTH U;  2R8I A;  1ZET A;  2FLL A;  4C8N A;  2EDU A;  1X40 A;  2UVR A;  2YY6 A;  4FBU A;  3S6J A;  4DQQ A;  2J6U A;  3N28 A;  4KIT B;  3L4P A;  3QU2 A;  3H8S A;  1KW4 A;  2IMW P;  4DL4 A;  2ZXI A;  3QX7 A;  3N7S C;  3WK4 A;  4KN7 A;  4KLT A;  4B9M A;  2G5I B;  5HR7 A;  1SKW A;  3I1Y A;  3RR8 A;  3F2B A;  4RQ4 A;  3M9N B;  4I2I A;  4JWN A;  4XRH A;  2RLT A;  3BQ7 A;  3K4G A;  1J97 A;  2V4R A;  1L3V A;  5H2F U;  3NVY A;  2KHV A;  4PHD A;  3H4B A;  3H4D A;  3RAQ A;  5AI9 A;  2FMP A;  1JI7 A;  5KFL A;  2KZZ A;  2B6G A;  1D9D A;  2UVW A;  1P7D A;  4DQS A;  1XWL A;  2BDP A;  1B22 A;  5DB9 A;  4QIW C;  5KG1 A;  4QZD A;  4J9L A;  4P4O A;  2BPG A;  4UB5 A;  2IHM A;  4TQR A;  9ICH A;  2ZIW B;  4KLF A;  2Y0S F;  3IRU A;  3QU4 A;  2W9B A;  2E3T A;  3M6K A;  2EZY A;  4I2D A;  1NOM A;  4CCH A;  4ECT A;  1PUZ A;  1NK9 A;  1X42 A;  9ICJ A;  3MDC A;  4F3O A;  2VJ4 A;  5J2H A;  4J9N A;  4F5R A;  5KG0 A;  1K5O A;  2G0A A;  2BR0 A;  5J2E A;  4UB8 U;  5ALL A;  3PMN A;  2XY6 A;  2VAN A;  4BDP A;  3WKD A;  4YR2 A;  2GOL A;  4DL3 A;  2L5Y A;  2VIX A;  4QWE A;  3UXO A;  8ICR A;  2K89 A;  4X5V A;  4I2B A;  4I2C A;  1B43 A;  1BGX T;  8ICF A;  1PK1 A;  2HOF A;  3PX0 A;  4GXK A;  4C7Z A;  3JPS A;  4RQ1 A;  3GIK A;  1S77 D;  5EE9 A;  2LYA A;  3QXG A;  4DF4 A;  4LZG A;  1SV4 A;  4M9L A;  3RBD A;  4F2R A;  4DSL A;  3MR2 A;  3JPT A;  2WHE A;  3QZ7 A;  2WAQ C;  4US9 A;  1VJ5 A;  7ICI A;  2YMM A;  5J0Q A;  1RG6 A;  8ICS A;  4DFP A;  2FPL A;  2KOB A;  1NZP A;  2CN1 A;  2HW3 A;  1TE2 A;  3NVZ A;  2DGZ A;  4C8L A;  2A1J B;  3SEI A;  7ICK A;  1A6S A;  2MUT B;  4B9N A;  1SV0 A;  3UXN A;  1COO A;  5BOM A;  4IRK A;  2QAR A;  2ESE A;  4UB6 U;  4M47 A;  9ICW A;  4IQW A;  4DS4 A;  5KAF U;  3PR5 B;  2C28 A;  4I2F A;  2FDR A;  1NNL A;  5KL8 B;  2NRT A;  2P6U A;  1SIJ A;  2E1F A;  3V7J A;  1T8E A;  1JRO A;  3UQ2 A;  2XGP A;  5CEH A;  5F9L A;  1CEZ A;  2IHN A;  2AXT U;  5KT5 A;  2NYV A;  1QSY A;  5ALU A;  5T14 A;  4YVZ A;  7ICR A;  1L8O A;  1X66 A;  3LWM A;  1KRP A;  2WF5 A;  3ICX A;  3V6J A;  4DLG A;  1BPX A;  3ZDB A;  4IQV A;  1KTQ A;  3H0L B;  4R64 A;  4R8U A;  4YMN A;  1XS9 D;  5L1M A;  1RZT A;  8ICQ A;  3V7K A;  2G07 A;  2WFA A;  5KL1 B;  3GV7 B;  4QZ9 A;  2OH2 A;  5HHH A;  1SZH A;  4B6J A;  5JRT A;  5GTI U;  2FJ6 A;  5EWF A;  4ECY A;  3RRG A;  4ICA A;  3ALR A;  4TUP A;  3FM9 A;  3ZDA A;  2E8N A;  5ALI A;  5G5G A;  3TKA A;  2JZB B;  1ZQD A;  4DSI A;  3F2D A;  1ZQM A;  4EZ9 A;  5K4L A;  8ICC A;  1BVS A;  4Y2P A;  4RQ7 A;  4MF2 A;  5J0S A;  1ZQS A;  1L3S A;  3WKB A;  3SQI A;  5KTQ A;  3AN1 A;  1S9F A;  4NLB A;  4QZF A;  4YD2 A;  4PGY A;  1MQ2 A;  4ZOH C;  5J8Y C;  2ZIX B;  2HBM A;  3BDP A;  5KT7 A;  4DQI A;  1A0P A;  1B0X A;  4IS7 A;  1NKC A;  3EWA A;  3GU3 A;  4TUR A;  3QUT A;  4EX6 A;  5AI8 A;  5ALX A;  3QU9 A;  4RQ5 A;  2RHF A;  3V6K A;  1NKE A;  2M0N A;  1Z19 A;  1N62 A;  2W3S A;  1J2M A;  2VA8 A;  2JMG A;  3IG5 A;  4O0I A;  5F9N A;  4O3Q A;  3QZ8 A;  4EEL A;  2HHV A;  1RYS A;  1OXJ A;  5C5J A;  1KN5 A;  2Y1J A;  2WAQ F;  7ICN A;  1KL9 A;  5KFX A;  4Y2T A;  4ED7 A;  2FPK A;  3TFS A;  3CP8 A;  4DOA A;  8ICM A;  2ASD A;  3GIL A;  3GQC A;  3KHH A;  3BS5 B;  1ZQQ A;  1S0V A;  4JV0 A;  1L7O A;  4FO6 A;  2W54 A;  3OJS A;  3EW9 A;  4QZC A;  2XID A;  4XQ8 A;  3NAS A;  3JPP A;  3F5A A;  1WCL A;  2GH1 A;  1ZYQ A;  3KOO A;  1ZQN A;  1LKY A;  4NLC A;  5KFW A;  4PL2 A;  7ICM A;  1T3N A;  2R8K A;  5KT3 A;  3TAC B;  5KFT A;  4PZN A;  3C2M A;  4K4H A;  3WKE A;  5ALW A;  4KLQ A;  1ZQR A;  5J0O A;  2KJ9 A;  8ICJ A;  5D4B A;  1RQL A;  4M6W A;  4GC7 A;  3BQ2 A;  4YCX A;  5DB6 A;  2ZJA A;  3MC1 A;  4M9N A;  3NRW A;  4Y2S A;  5AIB A;  3D6J A;  2H3Q A;  4BJQ A;  3QEB Z;  2W8K A;  4YFK A;  3JPQ A;  3ISC A;  4NM1 A;  1MSW D;  2YMQ A;  5KFH A;  5KFE A;  1QQ7 A;  4J03 A;  4BXO A;  2ISO A;  4O3O A;  4Z6C A;  2DBY A;  1WWU A;  2DFL A;  3H40 A;  1ZQX A;  1JXE A;  2LMR A;  2HOQ A;  9ICM A;  3PO4 A;  4O5K A;  1BNO A;  2KKV A;  1XNS A;  1ZD2 P;  4YXJ A;  5L9X A;  4FZN A;  2AQ0 A;  3J81 j;  4B9U A;  2KJ5 A;  2BGW A;  4BWJ A;  2LKY A;  4P0P B;  2K4I A;  3KTQ A;  5HML A;  4GXI A;  8ICH A;  1SL0 A;  3H7I A;  2OHF A;  2HOI A;  8ICK A;  4E0D A;  3EUB 2;  2KIC A;  2VA3 A;  1Z4O A;  3SV4 A;  2ZJ8 A;  2EAP A;  4KLM A;  3ZDD A;  4OD0 A;  3CYM A;  7ICG A;  3M6Z A;  3NRZ A;  5L1K A;  3KKA A;  4CF3 A;  2ASL A;  4RQ6 A;  1KEJ A;  3QNM A;  4KLS A;  1PVP A;  4O5E A;  5AKL A;  4KLG A;  1BPD A;  3PW7 A;  3L3F X;  2BQ3 A;  7ICL A;  4UB1 A;  4YD1 A;  1ZQO A;  2ZUB A;  4RQN A;  1L7N A;  2ES6 A;  4IR9 A;  1RYU A;  2CPR A;  4OJO A;  1KLN A;  5AKK A;  3R9K A;  3SEN A;  7ICV A;  3Q8K A;  2H3V A;  3T5J A;  5L1J A;  2CRX A;  2C22 A;  1TK5 A;  7ICF A;  1U45 A;  3A0H U;  4OO1 J;  2MRL A;  1Q46 A;  1Z00 A;  1SZP A;  3B0Y A;  4XUS A;  2BCR A;  4NLK A;  2ATL A;  5TIS U;  3PR4 A;  4RQ8 A;  5KNI A;  2G06 A;  5KFO A;  2JEJ A;  3C28 A;  2OWO A;  1XC9 A;  1SL2 A;  4Z6F A;  3C5F A;  7ICE A;  4UAY A;  1KQQ A;  3RJG A;  3RB6 A;  4QJF B;  1V9P A;  2F44 A;  3IP4 B;  3MGI A;  4P4P A;  5B66 U;  4Y2X A;  1NK8 A;  5DG7 A;  2LHT A;  4C8M A;  3E0F A;  5AM4 A;  4JV1 A;  1PZN A;  5G5H A;  4UB2 A;  2HHQ A;  1ZQ1 C;  1FFU A;  4P2H A;  5ALY A;  4FZL A;  3NVV A;  4Y2V A;  3KZI U;  3VCB A;  3KD3 A;  5DGB A;  3RJK A;  1L7M A;  4C7Y A;  3T3F A;  1ED1 A;  5KG6 A;  4EBC A;  2LPE A;  1HJP A;  3BQT A;  5KG7 A;  4F92 B;  5KFZ A;  4DFD A;  2ZTD A;  1HEK A;  4O5C A;  5DG9 A;  2Z7J A;  1ZQA A;  4Y2R A;  2YB1 A;  2EH9 A;  1SWW A;  4PZO A;  4KLH A;  3E2E A;  3M7D A;  2W9M A;  2ZIW A;  5DBB A;  3RJF A;  4I2E A;  5AI4 A;  1ZQH A;  3PW5 A;  2W03 A;  2XY7 A;  5HR6 A;  2KSO B;  3ZI4 A;  2MSN A;  1GO3 F;  3WK6 A;  1JX4 A;  5KFK A;  2XGQ A;  3GDX A;  1URJ A;  1ZQF A;  4JB3 A;  3L5K A;  4C4R A;  4PH5 A;  4C80 A;  3SAG A;  1RM6 C;  8ICZ A;  3TQ1 A;  5AK4 A;  4QZI A;  3PST A;  1JXL A;  2BDU A;  2OXO A;  1VDV A;  9ICN A;  2YMP A;  4NL9 A;  1N5X A;  1Z1V A;  4J9M A;  5TZV A;  2NRZ A;  1D8L A;  4YXM A;  5KFF A;  4DSF A;  5EOZ A;  2HHT A;  5J2B A;  2K4H A;  4EEK A;  1IM4 A;  4KMU A;  5DDY A;  1QQ5 A;  1QSL A;  5AKG A;  5B5E U;  1SKR A;  5AKZ A;  3LYS A;  1T3Q A;  5KT6 A;  5KFG A;  1ZQK A;  2KFN A;  4U6P A;  4ECR A;  2G09 A;  5KFM A;  2AJQ A;  4DL7 A;  3BQ0 A;  4Y2U A;  4UQG A;  1TAM A;  4EBE A;  3ETR A;  2A1J A;  3RB4 A;  5BPC A;  3PSP A;  1LV5 A;  2MUT A;  1H38 A;  3WK5 A;  3ISB A;  4CRX A;  2AH5 A;  1Q3U A;  2ALZ A;  2EZX A;  1LB2 B;  5ALH A;  5AI5 A;  1D8Y A;  1X9M A;  2WF6 A;  3KFU F;  2WF9 A;  5KFS A;  5ALF A;  4DQP A;  2JH1 A;  2EAO A;  3TAP A;  2LM4 A;  5ALD A;  1ZQW A;  4Y2J A;  3QU5 A;  2JV3 A;  5CP2 A;  2H3F A;  1DGS A;  7ICU A;  1FEZ A;  3G6Y A;  5KFV A;  1KFD A;  1C20 A;  3T79 A;  5ALZ A;  4USA A;  2UVU A;  4OJP A;  2RRD A;  4NLZ A;  4PGX A;  2BKE A;  1ZRN A;  4ECX A;  2HVH A;  5EWG A;  5KT4 A;  4OCZ A;  3RF9 A;  1Y88 A;  1TAQ A;  2XI9 A;  2ISP A;  5J0T A;  4MF8 A;  9ICX A;  4QZH A;  4MFF A;  2WTF A;  2E8P A;  3GV5 B;  3C23 A;  1ZQT A;  3HX0 A;  3AMZ A;  4MEY A;  4B9V A;  3M9O B;  3N4M B;  4Y2Q A;  3BZC A;  4NJ8 A;  4RU9 A;  1SXE A;  4TUQ A;  3F2C A;  2JZB A;  4EX7 A;  4EBD A;  5ALS A;  2ZIU B;  5DG8 A;  1BPE A;  5AKY A;  3RH5 A;  3PW4 A;  4Y2Y A;  1UQV A;  3M9M B;  2FLP A;  4ELU A;  1DK2 A;  1ZOL A;  5KG2 A;  3N7P D;  2NV3 A;  4FS1 A;  3THV A;  3M8S A;  4BWM A;  5KFR A;  1XU4 A;  4KTQ A;  2OM6 A;  4KLI A;  3KHG A;  4ECU A;  2ZIX A;  2KIV A;  2YN4 A;  5ALJ A;  2OYY A;  3OPX A;  1PVR A;  3HKZ C;  4ECZ A;  2PKE A;  3Q8S B;  4F2S A;  1MQ3 A;  1BPY A;  1YT3 A;  2XO7 A;  5DLF A;  3RRH A;  5ALE A;  2GLE A;  2AQ4 A;  2E8M A;  2KJ8 A;  1WYG A;  3RJJ A;  4QW9 A;  3G6V A;  3T5H A;  4GFJ A;  5DLG A;  2R8G A;  3OHB A;  8ICO A;  3UMG A;  3K1Z A;  1L8L A;  2DPI A;  2UVV A;  1SB3 C;  3BS5 A;  1X9X A;  2DQN B;  8ICY A;  4C8K A;  5KFD A;  2PI5 A;  5DQH A; 
#chains in the Genus database with same CATH homology
 3SQI A;  3MGV A;  1A6S A;  2HBJ A;  4NLB A;  3SAF A;  2HBL A;  5CRX A;  3ONN A;  2JGA A;  2G06 A;  1T94 A;  3H0R B;  3RF9 A;  1ECW A;  3D2Q A;  4QNL A;  2ZIX B;  2HBM A;  2K8C B;  3DEE A;  3N7R C;  3C28 A;  1Q3V A;  1P7D A;  2XI9 A;  3HKZ F;  3IG8 A;  2K4H A;  2HBK A;  3KZX A;  1A0P A;  2RP5 A;  2K8B B;  2E5S A;  2KVC A;  2G08 A;  4PL1 A;  3GU3 A;  2XIC A;  2ZIV B;  4QIW C;  2W7O A;  2HOQ A;  2VJ5 A;  1Z1B A;  3SMV A;  4QJF B;  2G5H B;  2KV2 A;  2KKV A;  3IP4 B;  4CGZ A;  2E1E A;  3NUQ A;  1XNS A;  2ZIW B;  2XVT A;  2RHF A;  3PSI A;  3IN5 A;  1F44 A;  1NZB A;  2M0N A;  2YB4 A;  1Z19 A;  4FZN A;  2LHT A;  2KEY A;  2DF4 B;  2F8L A;  3O0F A;  2JMG A;  2Y0S F;  4FZM A;  3LYS A;  4JMU A;  3IG5 A;  3E0F A;  4KX5 A;  1MA7 A;  2KJ5 A;  1KBU A;  3M6K A;  2LKY A;  4BX9 C;  3PZP A;  4P0P B;  2W04 A;  3LVW A;  4ACO A;  2K4I A;  5KL8 B;  2H3I A;  4U6P A;  5C0Y A;  2G09 A;  2ZXH A;  3F2C A;  2E1F A;  1ZQ1 C;  2HOI A;  2ZIU B;  3AQF A;  2WAQ F;  2R18 A;  2VJ4 A;  4FZL A;  3RFA A;  4QIW F;  3CP8 A;  3VCB A;  3PSF A;  4KX3 A;  4AYB F;  2A3V A;  2KIC A;  4OJ6 A;  4FE3 A;  4P0Q B;  1PVQ A;  2ZG6 A;  1ED1 A;  2G0A A;  2KHQ A;  4CDG A;  4KMO B;  1TAM A;  2HMX A;  2KIW A;  3LVV A;  3AL0 B;  1HIW A;  3N7P D;  1XO0 A;  2N1R A;  2MA1 A;  2NV3 A;  2Q4T A;  3CYM A;  3M6Z A;  4O3M A;  3PSP A;  2KNJ A;  2XID A;  5T14 A;  2D6F C;  2JH7 A;  2JHD A;  4CRX A;  2OM6 A;  1Q3U A;  2VKQ A;  1PVP A;  2ZIX A;  2GOL A;  2F2A B;  2K8A A;  2VIX A;  1DRG A;  3ICX A;  2OYY A;  1HEK A;  3F5A A;  3OPX A;  2Z7J A;  2WB1 C;  3SAH A;  1PVR A;  2K4E A;  3HKZ C;  3C29 A;  1WUD A;  2K89 A;  3L3F X;  2YB1 A;  2ZIV A;  4NV0 A;  4A8E A;  2LYB A;  3M7D A;  1OUQ A;  2GH1 A;  4C0Z A;  3H0L B;  4OJ5 A;  2ZIW A;  4NLC A;  2F76 X;  3CRX A;  2PMZ C;  4PL2 A;  3D2N A;  3KFU F;  1YT3 A;  4OJL A;  3D2S A;  3VC8 A;  2CPR A;  2ZXI A;  4OJO A;  2G07 A;  5KL1 B;  3N7S C;  2HOF A;  2OH2 A;  2JH1 A;  4IC9 A;  2Y0S C;  1SZH A;  3H0M B;  4P0P A;  2W03 A;  1IIP A;  2KD1 A;  5HR6 A;  2H3V A;  2LYA A;  2CRX A;  2KJ8 A;  4ICA A;  2H3F A;  3ALR A;  4NWI A;  2G5I B;  5HR7 A;  1GO3 F;  4GFJ A;  3F5E A;  2WB1 F;  2ZIU A;  2KJ9 A;  1UPH A;  2F77 X;  3GZF A;  2H3Z A;  2KKP A;  2WAQ C;  4U7C A;  3F2B A;  1CRX A;  4WJ3 B;  1L6N A;  3F53 A;  1URJ A;  3AQE A;  4OO1 J;  2MRL A;  3K1Z A;  2W7P A;  1D8B A;  3F2D A;  2KOB A;  3T79 A;  2CN1 A;  4AYB C;  4P0Q A;  5A0L A;  2YX8 A;  4BUG A;  2DQN B;  3SAG A;  2PMZ F;  4OJP A;  3NRW A;  2RRD A;  2DGZ A;  4BJQ A;  2H3Q A;  2KHV A;  3PST A;  2LBO A;  2BDU A;  2OXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...