2MRLA

Backbone 1h, 13c, and 15n chemical shift assignments and nmr structure for potential drug target from burkholderia thailandensis e264
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure for potential drug target from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
molecule keywords Uncharacterized protein BTH I2711
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.610 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2mrlA00
2MRLA
chains in the Genus database with same CATH superfamily
3ISBA 3SENA 4K4HA 4NLCA 4F3OA 2NRTA 4DO9A 5J2EA 3GU3A 1ZQOA 3RJJA 4IQWA 5AM5A 4M9NA 2YTUA 3HW8A 3RTVA 2UVVA 2QB0B 5KT4A 2BDUA 4R64A 3IDWA 2PKEA 2LMRA 5KFXA 4FBUA 5E79U 1PK3A 2E8NA 5ALFA 2KICA 9ICKA 2KKPA 2IHMA 5J0UA 3RR8A 2W04A 1T3QA 3BQ7A 4QW8A 4J9MA 4OO1J 3QEAZ 4DL2A 2QARB 3TANA 5KFKA 2KSOA 3F2CA 3WK6A 3TACB 4QZCA 3RBDA 3H8SA 3KKAA 3G6XA 3RJEA 4BWJA 4O3MA 3GQCA 4YN4A 1F5SA 5DG8A 2YMMA 5KG5A 3UM9A 3M8RA 2KEYA 3TI0A 2JXJA 8ICPA 2EANA 4Z6CA 1LV5A 2A19A 2KK0A 2MRLA 4B9SA 2LBOA 3IHQB 3H4BA 5KAFU 1BNPA 2AHOB 2DKZA 4KLLA 2KHVA 3H0LB 1KKXA 4MHVA 2EAMA 2WF7A 2DPJA 1J2MA 1SIJA 3EPIA 2K8CB 3V72A 4B6JA 4I2HA 2Q0ZX 1DRGA 4OCZA 4XA5A 2WTFA 2CPRA 2EH9A 2JR5A 5KL1B 2EDUA 4O5EA 8ICJA 1X9XA 2W8LA 1L3UA 2H3IA 1NOMA 1NK0A 2HHXA 4K4IA 2JZBB 2F44A 5J2IA 2FLLA 5HR6A 4KX3A 1Z00B 1FEZA 1K1QA 3N7PD 2W9CB 4P0QA 1DK3A 2XC9A 1U49A 9ICMA 4M9GA 3QEBZ 3CP8A 2AXTU 2KNJA 5ALPA 4RQNA 5IIMA 2MUTA 3PO5A 4FS2A 1TK8A 1PVPA 3N7SC 7ICLA 4TUPA 4DFJA 4GC6A 1M6YA 2B0CA 1PVRA 1S0OA 1QSYA 9ICJA 2HBKA 4ED0A 2E1EA 5KFCA 5J2DA 1UT8A 1WG8A 4QZHA 4DS4A 2ZXIA 2P66A 1HUZA 4J9LA 4NLNA 3GIKA 3M9MB 9ICAA 4TUSA 4JMUA 2XY5A 1IM4A 1TK5A 3ZDBA 2R18A 5JTIA 5AK5A 1C7YA 9ICNA 3PR5B 1SKSA 1KFDA 1IV8A 4F72A 4A8EA 4IC9A 3MR5A 3O0FA 4F4YA 1KQQA 3RAXA 4P2HA 3CRXA 2E8MA 3EYZA 4FS1A 1ZQIA 5AM0A 3PSFA 5IIKA 3C2LA 1FIQA 3QNMA 3TADC 1QSLA 4PGYA 3IG8A 3KD3A 4Z6DA 2W9AA 3ETLA 3MGHA 1SZHA 5CB1A 4MEXA 2HHQA 7ICSA 2JEJA 4KMOB 2KMDA 2W7OA 4JWNA 2JH7A 1DOQA 8ICCA 3RH4A 2ZIUB 4US9A 2IBKA 2K8BB 4F8RA 2W7PA 2FLNA 4QZFA 4KLMA 1ZQZA 4PHPA 1NZPA 1UT5A 5KL8B 4F5NA 4R65A 1UPHA 4RQ3A 4ED7A 2EAPA 3AU2A 3R9KA 5J8YA 4ECRA 3UPQA 4DSKA 2OHFA 2YMQA 3IRUA 1A77A 3UMCA 1NK8A 1ZETA 1WUDA 1HJPA 3GV7B 1QSSA 2PFOA 5DDYA 2G08A 5KFHA 2QARA 2QLTA 1N56A 3NRWA 2F8KA 5C5JA 4F93B 4DSLA 4IQTA 4ELUA 5CP2A 7ICQA 4UB6U 4U6PA 1PK1A 5AI8A 3LYSA 4C4SA 2F1HA 4UARA 2A1JA 7ICJA 1GO3F 2C2DA 4RUAA 5KFWA 3UMBA 1L7MA 1LKYB 1TVAA 1KFSA 3I76A 2V9WA 1U45A 5AM4A 4F4XA 2DPIA 4ZOHC 4Y2YA 2OM6A 1PVQA 1ZQBA 4QJFB 4MF2A 2P6RA 5AM3A 5J8YC 1ZJMA 8ICXA 2XY6A 1N63A 2CN1A 3WKDA 9ICPA 3QUTA 5D46A 7ICRA 2PMZF 4KITB 1KDHA 3C5FA 2W43A 3TKAA 9ICLA 5AI5A 4I2CA 1EXNA 3RH5A 7ICMA 4M2YA 1B22A 2WB1C 2M9NA 2E8OA 4J03A 9ICHA 4NLZA 3MR2A 3D2QA 3N97B 2K60A 1XC9A 2HW3A 2N1RA 3TARA 2BQUA 2OWOA 4M9LA 4C8KA 3QU2A 2ZIUA 4ED2A 2XIDA 8ICBA 2W3RA 4KN7A 1OW5A 3N7RC 4YMMA 2F2AB 4UB3A 5J2JA 3QUCA 1ZRNA 8ICNA 3K4GA 4UBCA 4DFKA 4UAYA 3M1YA 3A0HU 5AKKA 1S77D 2DGZA 5KAIU 5J2HA 5IIOA 2ASLA 1J97A 2F1JA 2D6FC 1U47A 3NVYA 2FLPA 1K1SA 1NKBA 4ECYA 4F4ZA 5J0RA 1SL0A 4O3PA 2XCAA 1D9DA 1RXWA 4DFPA 4F71A 5KFFA 2ZTDA 3F53A 2YB1A 2NRVA 4GXJA 2FPLA 3B0YA 1X9MA 2BPCA 5CRXA 5DB8A 3GIMA 5KFMA 4C8MA 4YVZA 3IP4B 2ZJ8A 3WKCA 2KFNA 1BGXT 4E0DA 3SEIA 5KFUA 3PY8A 3T5JA 4DSEA 4CGZA 4RPXA 9ICVA 4NL9A 3HT3A 3PX6A 4B9TA 2XCPA 2ZIWA 1F44A 3MDAA 1B43A 2YMLA 3WKBA 1L8LA 4PH5A 4C0ZA 1PZNA 1ZQCA 2ZIVA 1Z1VA 5AKZA 3C23A 3T3FA 4UW9A 1ZQVA 1A0PA 1SXEA 4RQ0A 2FPMA 3LVWA 5HR7A 2W54A 1B4FA 3Q8PB 4AP9A 4ED6A 4IL6U 2JV3A 2HBMA 3AMZA 2F1IA 2A3VA 2VA8A 1ZQ1C 2IOHA 5KG6A 3SV4A 3RJHA 3VC8A 3GDXA 2ASJA 4RQ5A 4ECTA 4QW9A 5ALSA 2YY6A 4P0PB 1ZQAA 5EE9A 4FFDA 5KFTA 3Q8SB 1SXDA 3C1YA 1Q3VA 4FZLA 3UXOA 2KFZA 3V6HA 4DQSA 2OEHA 4FBTA 3CW2C 2H3VA 3ISCA 1WYGA 3NVVA 4CF5A 4ECXA 8ICIA 1RQNA 3OGUA 3V7KA 5B66U 4AYBF 2JEGA 4NLKA 1CI4A 5IIJA 2RLTA 4JWMA 3IM1A 3IV6A 3E58A 4RZRA 3RR7A 3OJSA 3SAFA 1NK4A 2C2RA 2V4RA 3GIIA 4ECVA 3C29A 2F3NA 4RNMA 4MEYA 3RFAA 5DQHA 4IR1A 1N48A 2G0AA 2FI1A 4B9UA 1RPLA 3PX4A 1Z19A 4KLJA 2VJ4A 2ZUCA 4KLEA 2RRDA 2KTQA 1KLNA 4DFMA 4ECSA 5KFSA 1XSLA 2JH1A 2KZZA 1AQ6A 4MFAA 2AQ4A 1JROA 4R8UA 4I2FA 3B0XA 2HI0A 5ALZA 5H2FU 5CR0A 3FAHA 2BQRA 4OJ5A 2Y1JA 4ED3A 2WAQF 2FJ6A 4F4KA 4O3RA 1TKDA 1XNSA 9ICOA 5AM2A 5J0PA 4C80A 2WF5A 3UQ0A 3ICXA 3PZPA 4P0QB 2PXIA 1KEJA 1QQ7A 4RU9A 3RF9A 3Q8KA 3ZDCA 1ZOLA 4C4TA 2R8JA 3QU4A 1WCLA 2VKQA 2VJ5A 4RPYA 4I2EA 1Y88A 2ASDA 2KV2A 5DQGA 1MSWD 7ICEA 4DQIA 2I9GA 4YXJA 5J2GA 3TAQA 1ZQDA 4ACOA 5AK3A 2AJQA 4EENA 5BPCA 3ZDEA 2F76X 4YFKA 4YR3A 4QIWF 1X66A 2BR0A 3CNHA 3PVXA 1TE2A 4TURA 3OHAA 2KZMA 3L3FX 4EEYA 2E8PA 2BCRA 2HHWA 4EBEA 2KHQA 4C8OA 9ICWA 5CHGA 3N4MB 2IOFA 7ICNA 8ICEA 2K8AA 2WFAA 5EE0A 2ZJAA 5BOLA 3F2DA 3H40A 5HHIA 4I29A 4CE6A 2H3FA 4PHEA 5AI0A 1IIPA 4UBBA 1XS9D 5HP4A 2GO7A 4YD2A 3E0FA 2WF9A 4OJPA 5J2FA 1X9SA 2XGQA 2I1QA 4O3NA 4YG2A 1NJZA 5HMLA 2CRXA 4XRHA 2ZXHA 1L3TA 2MSNA 5JU5A 3FDSA 4O9MA 2FPKA 2G5IB 2FE9A 3T5KA 4O5CA 5DB6A 2Y9TA 8ICLA 1XSPA 1NJYA 1ECWA 1J2NA 4QZBA 1SV0A 1ZD5A 1U48A 3RB0A 7ICGA 1QQ5A 5KFGA 1ZQGA 4M9JA 5ALDA 3KFUF 5AKLA 3HP6A 1ZQSA 4LZGA 9ICTA 1Z4NA 3MGVA 5AI6A 3BQ1A 1O08A 3VCBA 3AU6A 5HHHA 2DL0A 2RHFA 4ICAA 4RQ2A 2EZXA 1UA0A 3ZDAA 4CNQA 4DOCA 2UVRA 4NXZA 4B9NA 4P4OA 3ED5A 3T5LA 5KFNA 2F8LA 1JXEA 4GXIA 2HOIA 3WK7A 4KLSA 3SV3A 3MFHA 5L9XA 3HWTA 1QH9A 4YMOA 4DL6A 1Q8KA 4GFJA 2ZTCA 3FM9A 2LM4A 2YX8A 3UXNA 3HKZC 3F5AA 2ESEA 1KW4A 4JK1A 4G9BA 1YZ7A 8ICOA 4DSJA 5KTQA 2LYBA 4JUZA 1QCKA 5J0YA 1CUKA 9ICGA 2HBJA 8ICVA 5KFQA 2K4PA 3QUBA 3NVWA 5F3XB 2A1AA 4DL5A 3M9NB 4PL2A 2LHTA 5ALHA 4EBCA 5AI4A 3T79A 4KLFA 4YQWA 7ICTA 4BX9C 2KE7A 2KN7A 5ALLA 5DLFA 5KT3A 4EBDA 2C22A 3HRDD 3TADA 4CDGA 4O5KA 2HHVA 1ZQYA 3QYPA 2ZUBA 4YMNA 2W9MA 5AIBA 2FDRA 4QZDA 3QU9A 4KN4A 2AGQA 5DLGA 1V85A 3KTQA 2O6KA 3RJFA 1QTMA 4ELVA 4USAA 4EX6A 2KJ5A 4FZMA 9ICEA 1TV9A 5FP0A 1KRPA 4NL9C 5L1LA 3OSPA 4DF8A 1JRPA 4PHDA 1RXVA 2VA2A 5KFRA 5CWRA 1BPZA 7ICVA 7ICUA 4EZ6A 5J2BA 1Z1BA 5KG7A 2B21A 4KLDA 2H3QA 1BPDA 4IRKA 3KZXA 4QWDA 5F9NA 1XU4A 3LWLA 5AKXA 1YT3A 2C28A 4I2GA 5J0QA 1SB3C 2QB1A 4NJ8A 4P4PA 5KG4A 2KIVA 4Q45A 1FFUA 3EPGA 4Y2XA 1ED1A 8ICKA 1OUQA 4FZNA 2OCEA 3HX0A 4PJ0U 5ALOA 3V7LA 4YD1A 2G5HB 2R8HA 4IRDA 1NKEA 1ZJNA 9ICQA 2ZIVB 1UCVA 4M0AA 4YXMA 5IIIA 7ICPA 3LWMA 4KLTA 1NZBA 2ZG6A 2EAOA 1S0MA 3PX0A 3V7JA 2KKVA 4F5QA 4DF4A 4PHAA 5KFOA 4DCCA 2IHNA 1N2XA 2HHUA 2AGPA 4J9RA 1HEKA 2HOFA 3Q8QB 5KFJA 1XSNA 2ALZA 2K4IA 3ONNA 2KG5A 2GOLA 2BCVA 3LDAA 1S76D 2NO5A 1RYUA 4I2AA 5GTIU 3ISDA 1V38A 2W8KA 3RJKA 2PMZC 4UAWA 3ETRA 3KKAC 4G3IA 8ICTA 3IN5A 4IQUA 5CA7A 5L1KA 2EQYA 4B9LA 2WB1F 9ICUA 1S0NA 1JI7A 4TUQA 3JPRA 2K4HA 4XQ8A 5EE1A 2VA3A 2PFPA 3G6YA 4F4WA 1IG6A 2F77X 5J2AA 2RP5A 4RQ1A 1DK2A 4Y2RA 4RT2A 2Q4TA 1TAMA 5KFAA 5KG1A 4F5RA 1Z4OA 3TQ1A 4M47A 3BQ0A 2AQ0A 4IS7A 2PFNA 1BPXA 1HIWA 5J0OA 2XVTA 1ZQJA 5CJ7A 4FO6A 5HMMA 4QZAA 3JPNA 2W11A 8ICGA 5DKWA 4R63A 2DKXA 9ICFA 1NJXA 8ICSA 4J9KA 4UASA 1D8LA 3EZ5A 4ECWA 4ECZA 2ISPA 4DWIA 2BQ3A 2LM1A 2KJ9A 2AU0A 1X40A 2HHTA 1JMSA 1CRXA 2XGPA 2OXOA 3BZCA 4NLGA 2XICA 3SI8A 4F91B 2I5HA 2DUYA 3ZDDA 2IA6A 3TFSA 8ICFA 2CXYA 2BCQA 4F2SA 1JIHA 3OSNA 4C7ZA 5EWFA 3ALRA 1NK7A 4I2BA 1X6IA 2HBLA 7ICFA 1O03A 3GILA 3SQIA 5KFLA 2PI4A 3D2NA 3WKEA 4YR0A 5JUMA 1Q46A 4Z6EA 1N61A 4Z6FA 1S8OA 1BVSA 5AI9A 4EEKA 4DQPA 2AH5A 4Y2VA 1ZQHA 3QX7A 4UB4A 4F92B 1A6SA 3C21A 4B9VA 1L3SA 5ALRA 5HNKA 3GV5B 8ICRA 3L5KA 2JHDA 2ISOA 3ORYA 3ZD8A 3WK4A 2MUTB 4DQQA 2K89A 4KTQA 2IMWP 3I28A 4CF3A 3L4PA 5ALVA 4Y2SA 1XO0A 5L1MA 1SWVA 8ICYA 2W9CA 3NUQA 3UQ2A 2H3ZA 3N28A 1SGGA 3AUOA 1ZQTA 5AKHA 5KFPA 4P4MA 2PFQA 4KLGA 1F0MA 3MR3A 3KHRA 4QNLA 2G09A 4BGDA 3OPXA 9ICXA 4AYBC 3C28A 2ATLA 1L5UA 3F5EA 2ZIXB 5DG9A 2HCFA 3QZ8A 3UMGA 2KJ8A 1S9FA 3F2BA 3Q8LA 4WJ3B 4OJ6A 1KN5A 2R8GA 3QE9Y 3WKAA 1DGJA 4F50A 2KP7A 3HPOA 4C7YA 3NGDA 2W03A 4PGQA 3BQTA 1JN3A 4U7CA 3LK9A 4UAZA 5DGBA 4LVSA 4QWAA 3E2EA 3PMLA 3BDPA 2NRWA 3PO4A 5AKIA 5ALIA 1XWLA 3PR4A 3WK9A 3Q8MA 5KFDA 4US8A 3Q8RB 4PGXA 1WWUA 1K5OA 2NRXA 4I27A 2K4EA 3K75D 3PW7A 3WK5A 4QZEA 2D3DA 4NWIA 3M9OB 5L1IA 4Y2PA 1FO4A 3CYMA 5DBCA 1L7PA 4DS5A 1X2IA 3BS5B 1N5XA 5G5GA 4HAIA 1T94A 3C1ZA 3J81j 1RDFA 1YZ6A 8ICMA 1COKA 1SKWA 3TAPA 4EYIB 1WCNA 2HOQA 4XUSA 1Z3EB 4YCXA 4UB5A 3KHGA 8ICQA 3BZKA 2RQ5A 4ELTA 4RQ6A 2ZIWB 4EYHB 2W9BB 4DEZA 5EWEA 4Q44A 2ZJ5A 3MGIA 1BPBA 4DLGA 4IRCA 2GWSA 4NY8A 1ZQNA 1L8OA 5D4BA 1NK9A 2ZUDA 2BCUA 2JEFA 4O0IA 2Y0SF 4O3SA 5ALJA 3V6KA 2KIWA 3SAHA 4FE3A 2YB4A 5DDMA 4UATA 3U26A 4JB3A 3ZD9A 1LB2B 2XI9A 5IINA 4QWBA 5J0TA 3NVZA 2W3SA 4NM1A 3ZI4A 2D8CA 4RUCA 4DSFA 2WAQC 4LJXA 4KX5A 1DGSA 1ZYQA 2ZIXA 2OH2A 2KSOB 5A0LA 2W9BA 4F2RA 1N60A 2Y0SC 4Q8EA 4QZGA 4ED1A 5L1JA 1D9FA 3FC4A 3B9JA 3AQFA 3QUQA 7ICOA 4TQRA 5KG3A 5JRTA 3PSPA 3K1RB 4QWEA 1T4GA 3PNCA 2ES6A 4RPZA 1NK5A 2J6SA 2EZYA 1X6JA 1ZRMA 4K4GA 5DBAA 2DWQA 2VIXA 3TFRA 2Z7JA 2I6XA 3AEVA 2QB0A 2XO7A 1S97A 1RG6A 3C2KA 4DOBA 4OJOA 1SZPA 2EZZA 1SL1A 7ICHA 3RJGA 1RZTA 3NS1A 1ZQFA 1XO1A 4F5OA 4EX7A 1PUZA 2BZFA 2BHNA 3AM9A 2BDPA 2UVWA 3C5GA 2LKYA 1ZQMA 5J29A 5EWGA 5ALNA 1H38A 2KZ3A 3M7DA 3DEEA 4O3QA 4J9OA 4RQ8A 5ALQA 3AL0B 4LZDA 4CCHA 1NKCA 2A1JB 3FYHA 2HVIA 4CF4A 1NNLA 1LVHA 3RJIA 3V6JA 1D8BA 4EELA 1T8EA 1S5LU 3QU5A 1ZQWA 5ALEA 4BXOB 4DOAA 4UAVA 2BCSA 5KNIA 3M6ZA 2V4QA 1S10A 5J2CA 4R8UB 5C0YA 4OD0A 3WU2U 2E5SA 2JMGA 2HMXA 2ZTEA 2KOBA 4M6WA 4GXKA 5ALGA 5KG0A 3LVVA 2KVCA 4O3OA 1ZQKA 4KMUA 5KFYA 2LYHA 5KT7A 4RQ4A 2UVUA 3PV8A 4UQGA 4I2JA 1KFTA 5DB9A 4KLQA 1JALA 5D49A 3KZIU 3K1ZA 4JV1A 5DG7A 5B5EU 4BWMA 1MN8A 1KBUA 5J0WA 4RNOA 2YQEA 4PL1A 2LI6A 2LYAA 3D6JA 3RRHA 3PMNA 1JUDA 1HUOA 1OXJA 3PW2A 1D8YA 3QXGA 4NV0A 2MA1A 1RYSA 2DBYA 5KT2A 2WF6A 3RH6A 4M6WB 5AM1A 5K4LA 2R8IA 9ICRA 3GZFA 4EZ9A 2GH1A 3I1YA 2NRZA 3QZ7A 4DSIA 2L5YA 4Q8FA 4BXOA 3EWAA 4RT3A 1T7PA 1RM6C 1QLNA 2DFLA 1QQ6A 5ALWA 4GC7A 4KLIA 1BNOA 3PW0A 3KBBA 4C8NA 2PI5A 4OJLA 2HSZA 4DL7A 4QZ8A 5DB7A 3PSTA 5TZVA 4NM2A 4JV0A 5KFBA 3T5HA 3RAQA 2E3TA 2RDIA 4BUGA 1PK1B 2G07A 1ZD3A 3WK8A 5KFEA 1ZD4A 4Y2TA 1TAUA 1RYRA 5ALKA 3DV9A 1KTQA 3GFKB 2RDJA 1V9PA 3RB3A 1DXSA 1U4BA 7ICIA 2YMPA 3H7IA 1UQVA 3SYZA 3M8SA 4DQRA 2BGWA 5IILA 4BDPA 4M9HA 4J9SA 1MC8A 2IOFK 4R66A 9ICSA 3SAGA 2ODGA 3DDHA 2FMQA 3OJUA 1X42A 2Y1IA 1AROP 4CRXA 5EE3A 5AIAA 4ZH4A 1Z00A 1NK6A 4ECUA 3PW4A 1ZQQA 2JZBA 2NV3A 3MC1A 3H4DA 2M0NA 2E1FA 2H5XA 2WHEA 2AGOA 3KOOA 5AHXA 2NO4A 4F5PA 4I28A 5KFIA 2FMSA 2OYYA 1N5WA 3MR6A 1VJ5A 1B0XA 3H0MB 2JEIA 3D2SA 1KSPA 1SV4A 1C20A 5AKYA 2G06A 2KVSA 4J9PA 5J0XA 2W55A 4RQ7A 2BPGA 4J9NA 5AKGA 5ALXA 4IR9A 4PZNA 4RQMA 5KT6A 5DQIA 3HKZF 3GIJA 1SV0C 1JX4A 4DFDA 1CEZA 1U9LA 1ZQEA 9ICCA 5J2KA 2HHSA 1MQ3A 2LPEA 3C2MA 5F9LA 3OTQA 5ALUA 3KHHA 3NRZA 1JXLA 3JPQA 1Q3UA 4UAUA 8ICHA 3M6KA 3SR6A 1X9WA 5AKEA 3MFIA 5DGAA 1SKRA 3OHBA 4MFFA 5TISU 9ICBA 2MU2A 2XY7A 7ICKA 4ED8A 1ZQXA 4GIBA 1L7OA 3MABA 4NLBA 3RRGA 4QIWC 4RNNA 2DF4B 4I2DA 5KFZA 1A76A 1TK0A 1TAQA 2HDOA 3JPOA 4GLXA 4Y2UA 2C2EA 3SMVA 3UXPA 1VDVA 4KLOA 5J0SA 3JPSA 2P35A 2FMPA 4MF8A 4I2IA 1ZXIA 4QZ9A 4Y2JA 3KHLA 3THVA 4QZIA 2B6GA 4X5VA 4JV2A 3MBYA 1N62A 2QKQA 2YN4A 5KG2A 1KL9A 3H8JA 2GLEA 3PW5A 4UB2A 4IQVA 2KD1A 3H0RB 2P6UA 5ALYA 4TQSA 3GV8B 3BS7A 4PZOA 1L3VA 5DBBA 1P7DA 4ECQA 4C8LA 1VLBA 2NYVA 1NJWA 5T14A 3EUB2 3BJYA 8ICWA 1BPEA 2Y9UA 3BQ2A 3AN1A 3RB6A 1URJA 4DLEA 3H8MA 4PPXA 3RB4A 5ALTA 3IG5A 4YR2A 1SL2A 4BJQA 8ICZA 8ICUA 4J9QA 4Q43A 5ALMA 5KFVA 1L6NA 4UB8U 1UA1A 5BOMA 1TFRA 2J6TA 9ICIA 1SWWA 5AK4A 5AKJA 1MA7A 2VANA 2J6UA 1T3NA 1WWVA 3JPTA 3NASA 4YP3A 3QU7A 5GTHU 2BPFA 2JGAA 3NTUA 3HJEA 4QWCA 2JRZA 3HILA 1V97A 5CEHA 1MQ2A 4P0PA 3SD7A 3EW9A 1NI3A 1ZQLA 1COOA 3AQEA 1ZQUA 4MFCA 2R8KA 5KT5A 1LKYA 5G5HA 3G6VA 3BS5A 1IXRA 3PSIA 3JPPA 1ZD2P 8ICAA 1UHUA 4KLUA 1ZQRA 3A0BU 3RBEA 3H8WA 1BPYA 5AICA 4DL3A 2WF8A 4Y2QA 5EOZA 1ZQPA 1L7NA 2HVHA 4M04A 4B9MA 2MAXA 4UB1A 3MDCA 4C4RA 4HYKA 1RQLA 1FFVA 4KLHA 2DQNB 2BKEA 3SZ2A 4DL4A 3S6JA 1S0VA 5AK6A
chains in the Genus database with same CATH topology
2ZIXB 2ZG6A 5KL1B 4BX9C 1NZBA 4C0ZA 3GZFA 2CRXA 2GH1A 2ZIVA 2PMZF 2ZXHA 3D2SA 1URJA 4NLCA 2KKVA 2KJ8A 1SZHA 2H3IA 4OJ5A 3GU3A 2G06A 2LKYA 1A0PA 2WAQF 3F2BA 3LVWA 4KMOB 2G5IB 5HR7A 2W7OA 5HR6A 4CDGA 2JH7A 4WJ3B 4OJ6A 3IG5A 4KX3A 2WB1C 3M7DA 2KJ9A 1XNSA 2BDUA 3N7PD 1ECWA 3HKZF 3DEEA 1HEKA 4P0QA 2HOFA 3AL0B 4BJQA 3D2QA 1CRXA 2Y0SF 2ZIUB 2OXOA 2XICA 2K8BB 2N1RA 2HBMA 2W03A 2W7PA 2KIWA 2ZIUA 2A3VA 3SAHA 2XIDA 3ICXA 4OJLA 3CP8A 1ZQ1C 4FE3A 3PZPA 4P0QB 2YB4A 3N7RC 3KFUF 2K4IA 3ONNA 3VC8A 4U7CA 1L6NA 3PSTA 2KNJA 3RF9A 2KICA 2GOLA 2F2AB 2KKPA 1D8BA 3ALRA 1Q3UA 5KL8B 2HBLA 1UPHA 2XI9A 3M6KA 4BUGA 2W04A 3MGVA 3SQIA 4P0PB 3D2NA 1PVPA 3N7SC 2WAQC 2VKQA 2G07A 2VJ5A 3VCBA 3M6ZA 4KX5A 1MA7A 2KJ5A 4FZMA 1Q3VA 4FZLA 2ZIXA 2OH2A 2RHFA 1WUDA 4ICAA 5A0LA 5C0YA 2PMZC 4OO1J 2DGZA 2KV2A 1PVRA 2E5SA 2JMGA 2G08A 2Y0SC 2HMXA 2H3VA 2HBKA 2KOBA 3IN5A 2JGAA 1A6SA 3F2CA 4ACOA 2E1EA 2D6FC 3LVVA 2K4EA 3NRWA 4NLBA 4QIWC 2ZXIA 3AQFA 4AYBF 2WB1F 2KVCA 2F8LA 1Z1BA 2DF4B 4O3MA 2JHDA 2F76X 3PSPA 2HOIA 4P0PA 4U6PA 4NWIA 4QIWF 2H3QA 2K89A 3AQEA 3KZXA 4JMUA 3SMVA 3SAGA 3LYSA 2K4HA 4GFJA 2R18A 3SAFA 2KEYA 1XO0A 1GO3F 3F53A 1YT3A 3L3FX 3CYMA 3T79A 3PSIA 2YX8A 3C29A 2YB1A 3HKZC 2VIXA 3F5AA 3K1ZA 4IC9A 4A8EA 2MRLA 3RFAA 4CRXA 2F77X 2KHQA 1T94A 3O0FA 2Z7JA 2LBOA 2RP5A 1KBUA 4PL1A 2G0AA 5CRXA 3NUQA 2LYAA 3CRXA 1ED1A 2Q4TA 1OUQA 2LYBA 4FZNA 1Z19A 2H3ZA 2KHVA 2K8AA 3H0LB 1TAMA 2OM6A 2NV3A 2G5HB 3F2DA 2M0NA 3IP4B 3PSFA 2E1FA 4QJFB 2HOQA 2VJ4A 1PVQA 4OJOA 2H3FA 2KD1A 3H0RB 2HBJA 2K8CB 2ZIVB 1IIPA 4NV0A 2RRDA 2MA1A 4QNLA 4CGZA 2G09A 2OYYA 3OPXA 1HIWA 1P7DA 3E0FA 4OJPA 4PL2A 4AYBC 2LHTA 2ZIWA 1F44A 2JH1A 2XVTA 2CN1A 3IG8A 2ZIWB 1DRGA 2DQNB 3C28A 5T14A 3H0MB 3F5EA 2CPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRL A; 
#chains in the Genus database with same CATH topology
 3ISB A;  3SEN A;  4K4H A;  4NLC A;  4F3O A;  2NRT A;  4DO9 A;  5J2E A;  3GU3 A;  1ZQO A;  3RJJ A;  4IQW A;  5AM5 A;  4M9N A;  2YTU A;  3HW8 A;  3RTV A;  2UVV A;  2QB0 B;  5KT4 A;  2BDU A;  4R64 A;  3IDW A;  2PKE A;  2LMR A;  5KFX A;  4FBU A;  5E79 U;  1PK3 A;  2E8N A;  5ALF A;  2KIC A;  9ICK A;  2KKP A;  2IHM A;  5J0U A;  3RR8 A;  2W04 A;  1T3Q A;  3BQ7 A;  4QW8 A;  4J9M A;  4OO1 J;  3QEA Z;  4DL2 A;  2QAR B;  3TAN A;  5KFK A;  2KSO A;  3F2C A;  3WK6 A;  3TAC B;  4QZC A;  3RBD A;  3H8S A;  3KKA A;  3G6X A;  3RJE A;  4BWJ A;  4O3M A;  3GQC A;  4YN4 A;  1F5S A;  5DG8 A;  2YMM A;  5KG5 A;  3UM9 A;  3M8R A;  2KEY A;  3TI0 A;  2JXJ A;  8ICP A;  2EAN A;  4Z6C A;  1LV5 A;  2A19 A;  2KK0 A;  2MRL A;  4B9S A;  2LBO A;  3IHQ B;  3H4B A;  5KAF U;  1BNP A;  2AHO B;  2DKZ A;  4KLL A;  2KHV A;  3H0L B;  1KKX A;  4MHV A;  2EAM A;  2WF7 A;  2DPJ A;  1J2M A;  1SIJ A;  3EPI A;  2K8C B;  3V72 A;  4B6J A;  4I2H A;  2Q0Z X;  1DRG A;  4OCZ A;  4XA5 A;  2WTF A;  2CPR A;  2EH9 A;  2JR5 A;  5KL1 B;  2EDU A;  4O5E A;  8ICJ A;  1X9X A;  2W8L A;  1L3U A;  2H3I A;  1NOM A;  1NK0 A;  2HHX A;  4K4I A;  2JZB B;  2F44 A;  5J2I A;  2FLL A;  5HR6 A;  4KX3 A;  1Z00 B;  1FEZ A;  1K1Q A;  3N7P D;  2W9C B;  4P0Q A;  1DK3 A;  2XC9 A;  1U49 A;  9ICM A;  4M9G A;  3QEB Z;  3CP8 A;  2AXT U;  2KNJ A;  5ALP A;  4RQN A;  5IIM A;  2MUT A;  3PO5 A;  4FS2 A;  1TK8 A;  1PVP A;  3N7S C;  7ICL A;  4TUP A;  4DFJ A;  4GC6 A;  1M6Y A;  2B0C A;  1PVR A;  1S0O A;  1QSY A;  9ICJ A;  2HBK A;  4ED0 A;  2E1E A;  5KFC A;  5J2D A;  1UT8 A;  1WG8 A;  4QZH A;  4DS4 A;  2ZXI A;  2P66 A;  1HUZ A;  4J9L A;  4NLN A;  3GIK A;  3M9M B;  9ICA A;  4TUS A;  4JMU A;  2XY5 A;  1IM4 A;  1TK5 A;  3ZDB A;  2R18 A;  5JTI A;  5AK5 A;  1C7Y A;  9ICN A;  3PR5 B;  1SKS A;  1KFD A;  1IV8 A;  4F72 A;  4A8E A;  4IC9 A;  3MR5 A;  3O0F A;  4F4Y A;  1KQQ A;  3RAX A;  4P2H A;  3CRX A;  2E8M A;  3EYZ A;  4FS1 A;  1ZQI A;  5AM0 A;  3PSF A;  5IIK A;  3C2L A;  1FIQ A;  3QNM A;  3TAD C;  1QSL A;  4PGY A;  3IG8 A;  3KD3 A;  4Z6D A;  2W9A A;  3ETL A;  3MGH A;  1SZH A;  5CB1 A;  4MEX A;  2HHQ A;  7ICS A;  2JEJ A;  4KMO B;  2KMD A;  2W7O A;  4JWN A;  2JH7 A;  1DOQ A;  8ICC A;  3RH4 A;  2ZIU B;  4US9 A;  2IBK A;  2K8B B;  4F8R A;  2W7P A;  2FLN A;  4QZF A;  4KLM A;  1ZQZ A;  4PHP A;  1NZP A;  1UT5 A;  5KL8 B;  4F5N A;  4R65 A;  1UPH A;  4RQ3 A;  4ED7 A;  2EAP A;  3AU2 A;  3R9K A;  5J8Y A;  4ECR A;  3UPQ A;  4DSK A;  2OHF A;  2YMQ A;  3IRU A;  1A77 A;  3UMC A;  1NK8 A;  1ZET A;  1WUD A;  1HJP A;  3GV7 B;  1QSS A;  2PFO A;  5DDY A;  2G08 A;  5KFH A;  2QAR A;  2QLT A;  1N56 A;  3NRW A;  2F8K A;  5C5J A;  4F93 B;  4DSL A;  4IQT A;  4ELU A;  5CP2 A;  7ICQ A;  4UB6 U;  4U6P A;  1PK1 A;  5AI8 A;  3LYS A;  4C4S A;  2F1H A;  4UAR A;  2A1J A;  7ICJ A;  1GO3 F;  2C2D A;  4RUA A;  5KFW A;  3UMB A;  1L7M A;  1LKY B;  1TVA A;  1KFS A;  3I76 A;  2V9W A;  1U45 A;  5AM4 A;  4F4X A;  2DPI A;  4ZOH C;  4Y2Y A;  2OM6 A;  1PVQ A;  1ZQB A;  4QJF B;  4MF2 A;  2P6R A;  5AM3 A;  5J8Y C;  1ZJM A;  8ICX A;  2XY6 A;  1N63 A;  2CN1 A;  3WKD A;  9ICP A;  3QUT A;  5D46 A;  7ICR A;  2PMZ F;  4KIT B;  1KDH A;  3C5F A;  2W43 A;  3TKA A;  9ICL A;  5AI5 A;  4I2C A;  1EXN A;  3RH5 A;  7ICM A;  4M2Y A;  1B22 A;  2WB1 C;  2M9N A;  2E8O A;  4J03 A;  9ICH A;  4NLZ A;  3MR2 A;  3D2Q A;  3N97 B;  2K60 A;  1XC9 A;  2HW3 A;  2N1R A;  3TAR A;  2BQU A;  2OWO A;  4M9L A;  4C8K A;  3QU2 A;  2ZIU A;  4ED2 A;  2XID A;  8ICB A;  2W3R A;  4KN7 A;  1OW5 A;  3N7R C;  4YMM A;  2F2A B;  4UB3 A;  5J2J A;  3QUC A;  1ZRN A;  8ICN A;  3K4G A;  4UBC A;  4DFK A;  4UAY A;  3M1Y A;  3A0H U;  5AKK A;  1S77 D;  2DGZ A;  5KAI U;  5J2H A;  5IIO A;  2ASL A;  1J97 A;  2F1J A;  2D6F C;  1U47 A;  3NVY A;  2FLP A;  1K1S A;  1NKB A;  4ECY A;  4F4Z A;  5J0R A;  1SL0 A;  4O3P A;  2XCA A;  1D9D A;  1RXW A;  4DFP A;  4F71 A;  5KFF A;  2ZTD A;  3F53 A;  2YB1 A;  2NRV A;  4GXJ A;  2FPL A;  3B0Y A;  1X9M A;  2BPC A;  5CRX A;  5DB8 A;  3GIM A;  5KFM A;  4C8M A;  4YVZ A;  3IP4 B;  2ZJ8 A;  3WKC A;  2KFN A;  1BGX T;  4E0D A;  3SEI A;  5KFU A;  3PY8 A;  3T5J A;  4DSE A;  4CGZ A;  4RPX A;  9ICV A;  4NL9 A;  3HT3 A;  3PX6 A;  4B9T A;  2XCP A;  2ZIW A;  1F44 A;  3MDA A;  1B43 A;  2YML A;  3WKB A;  1L8L A;  4PH5 A;  4C0Z A;  1PZN A;  1ZQC A;  2ZIV A;  1Z1V A;  5AKZ A;  3C23 A;  3T3F A;  4UW9 A;  1ZQV A;  1A0P A;  1SXE A;  4RQ0 A;  2FPM A;  3LVW A;  5HR7 A;  2W54 A;  1B4F A;  3Q8P B;  4AP9 A;  4ED6 A;  4IL6 U;  2JV3 A;  2HBM A;  3AMZ A;  2F1I A;  2A3V A;  2VA8 A;  1ZQ1 C;  2IOH A;  5KG6 A;  3SV4 A;  3RJH A;  3VC8 A;  3GDX A;  2ASJ A;  4RQ5 A;  4ECT A;  4QW9 A;  5ALS A;  2YY6 A;  4P0P B;  1ZQA A;  5EE9 A;  4FFD A;  5KFT A;  3Q8S B;  1SXD A;  3C1Y A;  1Q3V A;  4FZL A;  3UXO A;  2KFZ A;  3V6H A;  4DQS A;  2OEH A;  4FBT A;  3CW2 C;  2H3V A;  3ISC A;  1WYG A;  3NVV A;  4CF5 A;  4ECX A;  8ICI A;  1RQN A;  3OGU A;  3V7K A;  5B66 U;  4AYB F;  2JEG A;  4NLK A;  1CI4 A;  5IIJ A;  2RLT A;  4JWM A;  3IM1 A;  3IV6 A;  3E58 A;  4RZR A;  3RR7 A;  3OJS A;  3SAF A;  1NK4 A;  2C2R A;  2V4R A;  3GII A;  4ECV A;  3C29 A;  2F3N A;  4RNM A;  4MEY A;  3RFA A;  5DQH A;  4IR1 A;  1N48 A;  2G0A A;  2FI1 A;  4B9U A;  1RPL A;  3PX4 A;  1Z19 A;  4KLJ A;  2VJ4 A;  2ZUC A;  4KLE A;  2RRD A;  2KTQ A;  1KLN A;  4DFM A;  4ECS A;  5KFS A;  1XSL A;  2JH1 A;  2KZZ A;  1AQ6 A;  4MFA A;  2AQ4 A;  1JRO A;  4R8U A;  4I2F A;  3B0X A;  2HI0 A;  5ALZ A;  5H2F U;  5CR0 A;  3FAH A;  2BQR A;  4OJ5 A;  2Y1J A;  4ED3 A;  2WAQ F;  2FJ6 A;  4F4K A;  4O3R A;  1TKD A;  1XNS A;  9ICO A;  5AM2 A;  5J0P A;  4C80 A;  2WF5 A;  3UQ0 A;  3ICX A;  3PZP A;  4P0Q B;  2PXI A;  1KEJ A;  1QQ7 A;  4RU9 A;  3RF9 A;  3Q8K A;  3ZDC A;  1ZOL A;  4C4T A;  2R8J A;  3QU4 A;  1WCL A;  2VKQ A;  2VJ5 A;  4RPY A;  4I2E A;  1Y88 A;  2ASD A;  2KV2 A;  5DQG A;  1MSW D;  7ICE A;  4DQI A;  2I9G A;  4YXJ A;  5J2G A;  3TAQ A;  1ZQD A;  4ACO A;  5AK3 A;  2AJQ A;  4EEN A;  5BPC A;  3ZDE A;  2F76 X;  4YFK A;  4YR3 A;  4QIW F;  1X66 A;  2BR0 A;  3CNH A;  3PVX A;  1TE2 A;  4TUR A;  3OHA A;  2KZM A;  3L3F X;  4EEY A;  2E8P A;  2BCR A;  2HHW A;  4EBE A;  2KHQ A;  4C8O A;  9ICW A;  5CHG A;  3N4M B;  2IOF A;  7ICN A;  8ICE A;  2K8A A;  2WFA A;  5EE0 A;  2ZJA A;  5BOL A;  3F2D A;  3H40 A;  5HHI A;  4I29 A;  4CE6 A;  2H3F A;  4PHE A;  5AI0 A;  1IIP A;  4UBB A;  1XS9 D;  5HP4 A;  2GO7 A;  4YD2 A;  3E0F A;  2WF9 A;  4OJP A;  5J2F A;  1X9S A;  2XGQ A;  2I1Q A;  4O3N A;  4YG2 A;  1NJZ A;  5HML A;  2CRX A;  4XRH A;  2ZXH A;  1L3T A;  2MSN A;  5JU5 A;  3FDS A;  4O9M A;  2FPK A;  2G5I B;  2FE9 A;  3T5K A;  4O5C A;  5DB6 A;  2Y9T A;  8ICL A;  1XSP A;  1NJY A;  1ECW A;  1J2N A;  4QZB A;  1SV0 A;  1ZD5 A;  1U48 A;  3RB0 A;  7ICG A;  1QQ5 A;  5KFG A;  1ZQG A;  4M9J A;  5ALD A;  3KFU F;  5AKL A;  3HP6 A;  1ZQS A;  4LZG A;  9ICT A;  1Z4N A;  3MGV A;  5AI6 A;  3BQ1 A;  1O08 A;  3VCB A;  3AU6 A;  5HHH A;  2DL0 A;  2RHF A;  4ICA A;  4RQ2 A;  2EZX A;  1UA0 A;  3ZDA A;  4CNQ A;  4DOC A;  2UVR A;  4NXZ A;  4B9N A;  4P4O A;  3ED5 A;  3T5L A;  5KFN A;  2F8L A;  1JXE A;  4GXI A;  2HOI A;  3WK7 A;  4KLS A;  3SV3 A;  3MFH A;  5L9X A;  3HWT A;  1QH9 A;  4YMO A;  4DL6 A;  1Q8K A;  4GFJ A;  2ZTC A;  3FM9 A;  2LM4 A;  2YX8 A;  3UXN A;  3HKZ C;  3F5A A;  2ESE A;  1KW4 A;  4JK1 A;  4G9B A;  1YZ7 A;  8ICO A;  4DSJ A;  5KTQ A;  2LYB A;  4JUZ A;  1QCK A;  5J0Y A;  1CUK A;  9ICG A;  2HBJ A;  8ICV A;  5KFQ A;  2K4P A;  3QUB A;  3NVW A;  5F3X B;  2A1A A;  4DL5 A;  3M9N B;  4PL2 A;  2LHT A;  5ALH A;  4EBC A;  5AI4 A;  3T79 A;  4KLF A;  4YQW A;  7ICT A;  4BX9 C;  2KE7 A;  2KN7 A;  5ALL A;  5DLF A;  5KT3 A;  4EBD A;  2C22 A;  3HRD D;  3TAD A;  4CDG A;  4O5K A;  2HHV A;  1ZQY A;  3QYP A;  2ZUB A;  4YMN A;  2W9M A;  5AIB A;  2FDR A;  4QZD A;  3QU9 A;  4KN4 A;  2AGQ A;  5DLG A;  1V85 A;  3KTQ A;  2O6K A;  3RJF A;  1QTM A;  4ELV A;  4USA A;  4EX6 A;  2KJ5 A;  4FZM A;  9ICE A;  1TV9 A;  5FP0 A;  1KRP A;  4NL9 C;  5L1L A;  3OSP A;  4DF8 A;  1JRP A;  4PHD A;  1RXV A;  2VA2 A;  5KFR A;  5CWR A;  1BPZ A;  7ICV A;  7ICU A;  4EZ6 A;  5J2B A;  1Z1B A;  5KG7 A;  2B21 A;  4KLD A;  2H3Q A;  1BPD A;  4IRK A;  3KZX A;  4QWD A;  5F9N A;  1XU4 A;  3LWL A;  5AKX A;  1YT3 A;  2C28 A;  4I2G A;  5J0Q A;  1SB3 C;  2QB1 A;  4NJ8 A;  4P4P A;  5KG4 A;  2KIV A;  4Q45 A;  1FFU A;  3EPG A;  4Y2X A;  1ED1 A;  8ICK A;  1OUQ A;  4FZN A;  2OCE A;  3HX0 A;  4PJ0 U;  5ALO A;  3V7L A;  4YD1 A;  2G5H B;  2R8H A;  4IRD A;  1NKE A;  1ZJN A;  9ICQ A;  2ZIV B;  1UCV A;  4M0A A;  4YXM A;  5III A;  7ICP A;  3LWM A;  4KLT A;  1NZB A;  2ZG6 A;  2EAO A;  1S0M A;  3PX0 A;  3V7J A;  2KKV A;  4F5Q A;  4DF4 A;  4PHA A;  5KFO A;  4DCC A;  2IHN A;  1N2X A;  2HHU A;  2AGP A;  4J9R A;  1HEK A;  2HOF A;  3Q8Q B;  5KFJ A;  1XSN A;  2ALZ A;  2K4I A;  3ONN A;  2KG5 A;  2GOL A;  2BCV A;  3LDA A;  1S76 D;  2NO5 A;  1RYU A;  4I2A A;  5GTI U;  3ISD A;  1V38 A;  2W8K A;  3RJK A;  2PMZ C;  4UAW A;  3ETR A;  3KKA C;  4G3I A;  8ICT A;  3IN5 A;  4IQU A;  5CA7 A;  5L1K A;  2EQY A;  4B9L A;  2WB1 F;  9ICU A;  1S0N A;  1JI7 A;  4TUQ A;  3JPR A;  2K4H A;  4XQ8 A;  5EE1 A;  2VA3 A;  2PFP A;  3G6Y A;  4F4W A;  1IG6 A;  2F77 X;  5J2A A;  2RP5 A;  4RQ1 A;  1DK2 A;  4Y2R A;  4RT2 A;  2Q4T A;  1TAM A;  5KFA A;  5KG1 A;  4F5R A;  1Z4O A;  3TQ1 A;  4M47 A;  3BQ0 A;  2AQ0 A;  4IS7 A;  2PFN A;  1BPX A;  1HIW A;  5J0O A;  2XVT A;  1ZQJ A;  5CJ7 A;  4FO6 A;  5HMM A;  4QZA A;  3JPN A;  2W11 A;  8ICG A;  5DKW A;  4R63 A;  2DKX A;  9ICF A;  1NJX A;  8ICS A;  4J9K A;  4UAS A;  1D8L A;  3EZ5 A;  4ECW A;  4ECZ A;  2ISP A;  4DWI A;  2BQ3 A;  2LM1 A;  2KJ9 A;  2AU0 A;  1X40 A;  2HHT A;  1JMS A;  1CRX A;  2XGP A;  2OXO A;  3BZC A;  4NLG A;  2XIC A;  3SI8 A;  4F91 B;  2I5H A;  2DUY A;  3ZDD A;  2IA6 A;  3TFS A;  8ICF A;  2CXY A;  2BCQ A;  4F2S A;  1JIH A;  3OSN A;  4C7Z A;  5EWF A;  3ALR A;  1NK7 A;  4I2B A;  1X6I A;  2HBL A;  7ICF A;  1O03 A;  3GIL A;  3SQI A;  5KFL A;  2PI4 A;  3D2N A;  3WKE A;  4YR0 A;  5JUM A;  1Q46 A;  4Z6E A;  1N61 A;  4Z6F A;  1S8O A;  1BVS A;  5AI9 A;  4EEK A;  4DQP A;  2AH5 A;  4Y2V A;  1ZQH A;  3QX7 A;  4UB4 A;  4F92 B;  1A6S A;  3C21 A;  4B9V A;  1L3S A;  5ALR A;  5HNK A;  3GV5 B;  8ICR A;  3L5K A;  2JHD A;  2ISO A;  3ORY A;  3ZD8 A;  3WK4 A;  2MUT B;  4DQQ A;  2K89 A;  4KTQ A;  2IMW P;  3I28 A;  4CF3 A;  3L4P A;  5ALV A;  4Y2S A;  1XO0 A;  5L1M A;  1SWV A;  8ICY A;  2W9C A;  3NUQ A;  3UQ2 A;  2H3Z A;  3N28 A;  1SGG A;  3AUO A;  1ZQT A;  5AKH A;  5KFP A;  4P4M A;  2PFQ A;  4KLG A;  1F0M A;  3MR3 A;  3KHR A;  4QNL A;  2G09 A;  4BGD A;  3OPX A;  9ICX A;  4AYB C;  3C28 A;  2ATL A;  1L5U A;  3F5E A;  2ZIX B;  5DG9 A;  2HCF A;  3QZ8 A;  3UMG A;  2KJ8 A;  1S9F A;  3F2B A;  3Q8L A;  4WJ3 B;  4OJ6 A;  1KN5 A;  2R8G A;  3QE9 Y;  3WKA A;  1DGJ A;  4F50 A;  2KP7 A;  3HPO A;  4C7Y A;  3NGD A;  2W03 A;  4PGQ A;  3BQT A;  1JN3 A;  4U7C A;  3LK9 A;  4UAZ A;  5DGB A;  4LVS A;  4QWA A;  3E2E A;  3PML A;  3BDP A;  2NRW A;  3PO4 A;  5AKI A;  5ALI A;  1XWL A;  3PR4 A;  3WK9 A;  3Q8M A;  5KFD A;  4US8 A;  3Q8R B;  4PGX A;  1WWU A;  1K5O A;  2NRX A;  4I27 A;  2K4E A;  3K75 D;  3PW7 A;  3WK5 A;  4QZE A;  2D3D A;  4NWI A;  3M9O B;  5L1I A;  4Y2P A;  1FO4 A;  3CYM A;  5DBC A;  1L7P A;  4DS5 A;  1X2I A;  3BS5 B;  1N5X A;  5G5G A;  4HAI A;  1T94 A;  3C1Z A;  3J81 j;  1RDF A;  1YZ6 A;  8ICM A;  1COK A;  1SKW A;  3TAP A;  4EYI B;  1WCN A;  2HOQ A;  4XUS A;  1Z3E B;  4YCX A;  4UB5 A;  3KHG A;  8ICQ A;  3BZK A;  2RQ5 A;  4ELT A;  4RQ6 A;  2ZIW B;  4EYH B;  2W9B B;  4DEZ A;  5EWE A;  4Q44 A;  2ZJ5 A;  3MGI A;  1BPB A;  4DLG A;  4IRC A;  2GWS A;  4NY8 A;  1ZQN A;  1L8O A;  5D4B A;  1NK9 A;  2ZUD A;  2BCU A;  2JEF A;  4O0I A;  2Y0S F;  4O3S A;  5ALJ A;  3V6K A;  2KIW A;  3SAH A;  4FE3 A;  2YB4 A;  5DDM A;  4UAT A;  3U26 A;  4JB3 A;  3ZD9 A;  1LB2 B;  2XI9 A;  5IIN A;  4QWB A;  5J0T A;  3NVZ A;  2W3S A;  4NM1 A;  3ZI4 A;  2D8C A;  4RUC A;  4DSF A;  2WAQ C;  4LJX A;  4KX5 A;  1DGS A;  1ZYQ A;  2ZIX A;  2OH2 A;  2KSO B;  5A0L A;  2W9B A;  4F2R A;  1N60 A;  2Y0S C;  4Q8E A;  4QZG A;  4ED1 A;  5L1J A;  1D9F A;  3FC4 A;  3B9J A;  3AQF A;  3QUQ A;  7ICO A;  4TQR A;  5KG3 A;  5JRT A;  3PSP A;  3K1R B;  4QWE A;  1T4G A;  3PNC A;  2ES6 A;  4RPZ A;  1NK5 A;  2J6S A;  2EZY A;  1X6J A;  1ZRM A;  4K4G A;  5DBA A;  2DWQ A;  2VIX A;  3TFR A;  2Z7J A;  2I6X A;  3AEV A;  2QB0 A;  2XO7 A;  1S97 A;  1RG6 A;  3C2K A;  4DOB A;  4OJO A;  1SZP A;  2EZZ A;  1SL1 A;  7ICH A;  3RJG A;  1RZT A;  3NS1 A;  1ZQF A;  1XO1 A;  4F5O A;  4EX7 A;  1PUZ A;  2BZF A;  2BHN A;  3AM9 A;  2BDP A;  2UVW A;  3C5G A;  2LKY A;  1ZQM A;  5J29 A;  5EWG A;  5ALN A;  1H38 A;  2KZ3 A;  3M7D A;  3DEE A;  4O3Q A;  4J9O A;  4RQ8 A;  5ALQ A;  3AL0 B;  4LZD A;  4CCH A;  1NKC A;  2A1J B;  3FYH A;  2HVI A;  4CF4 A;  1NNL A;  1LVH A;  3RJI A;  3V6J A;  1D8B A;  4EEL A;  1T8E A;  1S5L U;  3QU5 A;  1ZQW A;  5ALE A;  4BXO B;  4DOA A;  4UAV A;  2BCS A;  5KNI A;  3M6Z A;  2V4Q A;  1S10 A;  5J2C A;  4R8U B;  5C0Y A;  4OD0 A;  3WU2 U;  2E5S A;  2JMG A;  2HMX A;  2ZTE A;  2KOB A;  4M6W A;  4GXK A;  5ALG A;  5KG0 A;  3LVV A;  2KVC A;  4O3O A;  1ZQK A;  4KMU A;  5KFY A;  2LYH A;  5KT7 A;  4RQ4 A;  2UVU A;  3PV8 A;  4UQG A;  4I2J A;  1KFT A;  5DB9 A;  4KLQ A;  1JAL A;  5D49 A;  3KZI U;  3K1Z A;  4JV1 A;  5DG7 A;  5B5E U;  4BWM A;  1MN8 A;  1KBU A;  5J0W A;  4RNO A;  2YQE A;  4PL1 A;  2LI6 A;  2LYA A;  3D6J A;  3RRH A;  3PMN A;  1JUD A;  1HUO A;  1OXJ A;  3PW2 A;  1D8Y A;  3QXG A;  4NV0 A;  2MA1 A;  1RYS A;  2DBY A;  5KT2 A;  2WF6 A;  3RH6 A;  4M6W B;  5AM1 A;  5K4L A;  2R8I A;  9ICR A;  3GZF A;  4EZ9 A;  2GH1 A;  3I1Y A;  2NRZ A;  3QZ7 A;  4DSI A;  2L5Y A;  4Q8F A;  4BXO A;  3EWA A;  4RT3 A;  1T7P A;  1RM6 C;  1QLN A;  2DFL A;  1QQ6 A;  5ALW A;  4GC7 A;  4KLI A;  1BNO A;  3PW0 A;  3KBB A;  4C8N A;  2PI5 A;  4OJL A;  2HSZ A;  4DL7 A;  4QZ8 A;  5DB7 A;  3PST A;  5TZV A;  4NM2 A;  4JV0 A;  5KFB A;  3T5H A;  3RAQ A;  2E3T A;  2RDI A;  4BUG A;  1PK1 B;  2G07 A;  1ZD3 A;  3WK8 A;  5KFE A;  1ZD4 A;  4Y2T A;  1TAU A;  1RYR A;  5ALK A;  3DV9 A;  1KTQ A;  3GFK B;  2RDJ A;  1V9P A;  3RB3 A;  1DXS A;  1U4B A;  7ICI A;  2YMP A;  3H7I A;  1UQV A;  3SYZ A;  3M8S A;  4DQR A;  2BGW A;  5IIL A;  4BDP A;  4M9H A;  4J9S A;  1MC8 A;  2IOF K;  4R66 A;  9ICS A;  3SAG A;  2ODG A;  3DDH A;  2FMQ A;  3OJU A;  1X42 A;  2Y1I A;  1ARO P;  4CRX A;  5EE3 A;  5AIA A;  4ZH4 A;  1Z00 A;  1NK6 A;  4ECU A;  3PW4 A;  1ZQQ A;  2JZB A;  2NV3 A;  3MC1 A;  3H4D A;  2M0N A;  2E1F A;  2H5X A;  2WHE A;  2AGO A;  3KOO A;  5AHX A;  2NO4 A;  4F5P A;  4I28 A;  5KFI A;  2FMS A;  2OYY A;  1N5W A;  3MR6 A;  1VJ5 A;  1B0X A;  3H0M B;  2JEI A;  3D2S A;  1KSP A;  1SV4 A;  1C20 A;  5AKY A;  2G06 A;  2KVS A;  4J9P A;  5J0X A;  2W55 A;  4RQ7 A;  2BPG A;  4J9N A;  5AKG A;  5ALX A;  4IR9 A;  4PZN A;  4RQM A;  5KT6 A;  5DQI A;  3HKZ F;  3GIJ A;  1SV0 C;  1JX4 A;  4DFD A;  1CEZ A;  1U9L A;  1ZQE A;  9ICC A;  5J2K A;  2HHS A;  1MQ3 A;  2LPE A;  3C2M A;  5F9L A;  3OTQ A;  5ALU A;  3KHH A;  3NRZ A;  1JXL A;  3JPQ A;  1Q3U A;  4UAU A;  8ICH A;  3M6K A;  3SR6 A;  1X9W A;  5AKE A;  3MFI A;  5DGA A;  1SKR A;  3OHB A;  4MFF A;  5TIS U;  9ICB A;  2MU2 A;  2XY7 A;  7ICK A;  4ED8 A;  1ZQX A;  4GIB A;  1L7O A;  3MAB A;  4NLB A;  3RRG A;  4QIW C;  4RNN A;  2DF4 B;  4I2D A;  5KFZ A;  1A76 A;  1TK0 A;  1TAQ A;  2HDO A;  3JPO A;  4GLX A;  4Y2U A;  2C2E A;  3SMV A;  3UXP A;  1VDV A;  4KLO A;  5J0S A;  3JPS A;  2P35 A;  2FMP A;  4MF8 A;  4I2I A;  1ZXI A;  4QZ9 A;  4Y2J A;  3KHL A;  3THV A;  4QZI A;  2B6G A;  4X5V A;  4JV2 A;  3MBY A;  1N62 A;  2QKQ A;  2YN4 A;  5KG2 A;  1KL9 A;  3H8J A;  2GLE A;  3PW5 A;  4UB2 A;  4IQV A;  2KD1 A;  3H0R B;  2P6U A;  5ALY A;  4TQS A;  3GV8 B;  3BS7 A;  4PZO A;  1L3V A;  5DBB A;  1P7D A;  4ECQ A;  4C8L A;  1VLB A;  2NYV A;  1NJW A;  5T14 A;  3EUB 2;  3BJY A;  8ICW A;  1BPE A;  2Y9U A;  3BQ2 A;  3AN1 A;  3RB6 A;  1URJ A;  4DLE A;  3H8M A;  4PPX A;  3RB4 A;  5ALT A;  3IG5 A;  4YR2 A;  1SL2 A;  4BJQ A;  8ICZ A;  8ICU A;  4J9Q A;  4Q43 A;  5ALM A;  5KFV A;  1L6N A;  4UB8 U;  1UA1 A;  5BOM A;  1TFR A;  2J6T A;  9ICI A;  1SWW A;  5AK4 A;  5AKJ A;  1MA7 A;  2VAN A;  2J6U A;  1T3N A;  1WWV A;  3JPT A;  3NAS A;  4YP3 A;  3QU7 A;  5GTH U;  2BPF A;  2JGA A;  3NTU A;  3HJE A;  4QWC A;  2JRZ A;  3HIL A;  1V97 A;  5CEH A;  1MQ2 A;  4P0P A;  3SD7 A;  3EW9 A;  1NI3 A;  1ZQL A;  1COO A;  3AQE A;  1ZQU A;  4MFC A;  2R8K A;  5KT5 A;  1LKY A;  5G5H A;  3G6V A;  3BS5 A;  1IXR A;  3PSI A;  3JPP A;  1ZD2 P;  8ICA A;  1UHU A;  4KLU A;  1ZQR A;  3A0B U;  3RBE A;  3H8W A;  1BPY A;  5AIC A;  4DL3 A;  2WF8 A;  4Y2Q A;  5EOZ A;  1ZQP A;  1L7N A;  2HVH A;  4M04 A;  4B9M A;  2MAX A;  4UB1 A;  3MDC A;  4C4R A;  4HYK A;  1RQL A;  1FFV A;  4KLH A;  2DQN B;  2BKE A;  3SZ2 A;  4DL4 A;  3S6J A;  1S0V A;  5AK6 A; 
#chains in the Genus database with same CATH homology
 2ZIX B;  2ZG6 A;  5KL1 B;  4BX9 C;  1NZB A;  4C0Z A;  3GZF A;  2CRX A;  2GH1 A;  2ZIV A;  2PMZ F;  2ZXH A;  3D2S A;  1URJ A;  4NLC A;  2KKV A;  2KJ8 A;  1SZH A;  2H3I A;  4OJ5 A;  3GU3 A;  2G06 A;  2LKY A;  1A0P A;  2WAQ F;  3F2B A;  3LVW A;  4KMO B;  2G5I B;  5HR7 A;  2W7O A;  5HR6 A;  4CDG A;  2JH7 A;  4WJ3 B;  4OJ6 A;  3IG5 A;  4KX3 A;  2WB1 C;  3M7D A;  2KJ9 A;  1XNS A;  2BDU A;  3N7P D;  1ECW A;  3HKZ F;  3DEE A;  1HEK A;  4P0Q A;  2HOF A;  3AL0 B;  4BJQ A;  3D2Q A;  1CRX A;  2Y0S F;  2ZIU B;  2OXO A;  2XIC A;  2K8B B;  2N1R A;  2HBM A;  2W03 A;  2W7P A;  2KIW A;  2ZIU A;  2A3V A;  3SAH A;  2XID A;  3ICX A;  4OJL A;  3CP8 A;  1ZQ1 C;  4FE3 A;  3PZP A;  4P0Q B;  2YB4 A;  3N7R C;  3KFU F;  2K4I A;  3ONN A;  3VC8 A;  4U7C A;  1L6N A;  3PST A;  2KNJ A;  3RF9 A;  2KIC A;  2GOL A;  2F2A B;  2KKP A;  1D8B A;  3ALR A;  1Q3U A;  5KL8 B;  2HBL A;  1UPH A;  2XI9 A;  3M6K A;  4BUG A;  2W04 A;  3MGV A;  3SQI A;  4P0P B;  3D2N A;  1PVP A;  3N7S C;  2WAQ C;  2VKQ A;  2G07 A;  2VJ5 A;  3VCB A;  3M6Z A;  4KX5 A;  1MA7 A;  2KJ5 A;  4FZM A;  1Q3V A;  4FZL A;  2ZIX A;  2OH2 A;  2RHF A;  1WUD A;  4ICA A;  5A0L A;  5C0Y A;  2PMZ C;  4OO1 J;  2DGZ A;  2KV2 A;  1PVR A;  2E5S A;  2JMG A;  2G08 A;  2Y0S C;  2HMX A;  2H3V A;  2HBK A;  2KOB A;  3IN5 A;  2JGA A;  1A6S A;  3F2C A;  4ACO A;  2E1E A;  2D6F C;  3LVV A;  2K4E A;  3NRW A;  4NLB A;  4QIW C;  2ZXI A;  3AQF A;  4AYB F;  2WB1 F;  2KVC A;  2F8L A;  1Z1B A;  2DF4 B;  4O3M A;  2JHD A;  2F76 X;  3PSP A;  2HOI A;  4P0P A;  4U6P A;  4NWI A;  4QIW F;  2H3Q A;  2K89 A;  3AQE A;  3KZX A;  4JMU A;  3SMV A;  3SAG A;  3LYS A;  2K4H A;  4GFJ A;  2R18 A;  3SAF A;  2KEY A;  1XO0 A;  1GO3 F;  3F53 A;  1YT3 A;  3L3F X;  3CYM A;  3T79 A;  3PSI A;  2YX8 A;  3C29 A;  2YB1 A;  3HKZ C;  2VIX A;  3F5A A;  3K1Z A;  4IC9 A;  4A8E A;  2MRL A;  3RFA A;  4CRX A;  2F77 X;  2KHQ A;  1T94 A;  3O0F A;  2Z7J A;  2LBO A;  2RP5 A;  1KBU A;  4PL1 A;  2G0A A;  5CRX A;  3NUQ A;  2LYA A;  3CRX A;  1ED1 A;  2Q4T A;  1OUQ A;  2LYB A;  4FZN A;  1Z19 A;  2H3Z A;  2KHV A;  2K8A A;  3H0L B;  1TAM A;  2OM6 A;  2NV3 A;  2G5H B;  3F2D A;  2M0N A;  3IP4 B;  3PSF A;  2E1F A;  4QJF B;  2HOQ A;  2VJ4 A;  1PVQ A;  4OJO A;  2H3F A;  2KD1 A;  3H0R B;  2HBJ A;  2K8C B;  2ZIV B;  1IIP A;  4NV0 A;  2RRD A;  2MA1 A;  4QNL A;  4CGZ A;  2G09 A;  2OYY A;  3OPX A;  1HIW A;  1P7D A;  3E0F A;  4OJP A;  4PL2 A;  4AYB C;  2LHT A;  2ZIW A;  1F44 A;  2JH1 A;  2XVT A;  2CN1 A;  3IG8 A;  2ZIW B;  1DRG A;  2DQN B;  3C28 A;  5T14 A;  3H0M B;  3F5E A;  2CPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...