2MRLA

Backbone 1h, 13c, and 15n chemical shift assignments and nmr structure for potential drug target from burkholderia thailandensis e264
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure for potential drug target from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
molecule keywords Uncharacterized protein BTH I2711
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.610 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2mrlA00
2MRLA
chains in the Genus database with same CATH superfamily
1ZQSA 5KFVA 4NY8A 5ALEA 5KFGA 2JZBB 1ZQUA 5EE1A 1RYUA 9ICXA 1RG6A 2KZMA 3MFIA 4NLGA 2KP7A 2RLTA 3PO5A 3TARA 4ECYA 1RZTA 4DEZA 2HBLA 1KEJA 3UQ0A 4NV0A 1EXNA 5J8YC 2WF8A 1U9LA 2KV2A 2F2AB 1L8LA 1XWLA 1KTQA 3M8RA 1SGGA 1U49A 3RJIA 2JEIA 3TADC 4PGXA 2Y0SF 3MR2A 5ALRA 3KKAA 2OM6A 2IBKA 4DSIA 2ZG6A 2JXJA 4WJ3B 5DGBA 1L7OA 3CYMA 2ZTCA 3E58A 4OJ5A 5ALZA 4O5CA 1X9MA 3RH6A 4FE3A 3LK9A 1D8BA 5KFWA 4OJPA 2VANA 4UAYA 5KFHA 3T3FA 1NKBA 2WFAA 1IV8A 4NJ8A 4KITB 5AM5A 3ONNA 1N62A 3Q8MA 5AK6A 2WAQC 3T5HA 5J0XA 3T5JA 4MEXA 4JV1A 5KT3A 3KD3A 1NJZA 3VC8A 4EX7A 2W7OA 1J97A 4RUAA 8ICYA 4F5RA 3B9JA 5AI5A 4Y2PA 1BPZA 2G07A 4EYHB 3FC4A 5AI6A 3LVVA 2KHVA 2KG5A 2K4EA 1N5XA 2ZIXA 1Y88A 1KBUA 2W9CB 4PHEA 3GV8B 3UXOA 3VCBA 5J0QA 2Y1IA 3AQFA 3H8MA 3OGUA 1BNOA 4JUZA 4DS4A 3ICXA 3ZD8A 4ED2A 4RQ7A 4OCZA 1KFSA 4P4MA 2J6TA 1COOA 2KIVA 4OJLA 3DV9A 5J2AA 3ISDA 4TUSA 3HT3A 7ICQA 1K1QA 2AGPA 4KMOB 2BDPA 2ZXIA 4NWIA 1L3TA 4M47A 2MAXA 1Z00A 4EBCA 4PHAA 4GXJA 2W9AA 3WKEA 4YG2A 2P66A 2BKEA 3CW2C 4O3SA 1TK0A 1ZQAA 4KLEA 1U47A 2Y9UA 5KT2A 1ZQWA 2VKQA 9ICGA 1SIJA 4O0IA 4YQWA 4CF5A 1BPYA 2I5HA 2AGOA 2JH1A 3GV7B 3LDAA 3N7SC 4UAVA 4I29A 3ZD9A 3UMGA 3L4PA 2BCRA 1TVAA 1ZJNA 2FMSA 5HR6A 3SAGA 8ICVA 2LM4A 3NTUA 3OJUA 4M9GA 2DPJA 4P4PA 1Z4OA 5ALKA 3HILA 4PL2A 5DG9A 2OCEA 4MFCA 8ICAA 1L6NA 3MGHA 3SEIA 7ICGA 1DK3A 4O5EA 4QZIA 1ED1A 3HKZC 4YN4A 3WKDA 1ZRNA 3ORYA 4DQSA 2E8PA 4Y2VA 1T4GA 3C21A 2HDOA 4JMUA 3T5LA 1T7PA 3K4GA 2UVVA 2OHFA 4ELTA 5C0YA 9ICJA 2KK0A 4DSFA 2HHQA 1WWUA 3K75D 4IQTA 5J2EA 2WAQF 4YD1A 3SZ2A 1Z00B 4O3QA 2P35A 5L1JA 2RQ5A 1M6YA 4O3NA 2UVUA 2W43A 4DSKA 4CNQA 3F2BA 3MR3A 1SXEA 3BQ2A 2ZJAA 3UXNA 4YMMA 2A3VA 2W3SA 1NKEA 1SZPA 5ALYA 3H8SA 3C23A 1DRGA 3PSFA 2RRDA 2HBJA 2R8KA 1SV4A 2AQ0A 3EPGA 3QUBA 9ICAA 2NRTA 4DF8A 3TFSA 4GLXA 4Z6EA 4F3OA 4NXZA 3I1YA 5AM4A 3PMNA 4I27A 1B22A 2JR5A 3BQ7A 2WB1C 1NZPA 2XI9A 2B6GA 3PY8A 3NVWA 5KFSA 2B21A 2M9NA 1JXLA 4P2HA 1CUKA 3AQEA 4XRHA 4ECZA 3SQIA 2XVTA 2YB1A 1D9FA 4ECVA 1HEKA 1ZOLA 3GU3A 2FI1A 3HP6A 2KEYA 3OJSA 3NVYA 1GO3F 4ED1A 3ZDDA 2KSOB 2N1RA 1PK1B 3V7LA 5DG8A 4F92B 3T79A 1K5OA 4ED0A 1ZQZA 1B43A 2W8KA 4JV2A 2PFNA 7ICFA 7ICJA 2E1EA 4C0ZA 1KN5A 3G6VA 3HX0A 5ALVA 3RBDA 4DL7A 7ICEA 4DOAA 2V9WA 3HJEA 4YR0A 4DL5A 4PHDA 4EZ6A 1WCLA 3NVVA 1KDHA 5KG1A 2FE9A 2EAMA 4P0QB 3QU2A 3HW8A 3CP8A 1WUDA 5DB6A 7ICNA 2MUTA 4RQ8A 3EPIA 1S0VA 4DOBA 4NL9C 4DFMA 5CA7A 4JK1A 3RJEA 3IDWA 1ZD2P 2D6FC 2E3TA 1SKRA 4F4KA 2K8AA 3JPRA 2KJ8A 8ICNA 9ICFA 5KFBA 4OD0A 5KNIA 2JV3A 2NO4A 1SKSA 1NOMA 3E0FA 4RQ6A 4O5KA 7ICPA 1PUZA 2CN1A 2YQEA 4FFDA 2C22A 4Q44A 1FIQA 5IIIA 2ODGA 1PK1A 2YB4A 3A0HU 5AI8A 4QZHA 3WK8A 4JWMA 2I6XA 2FDRA 5J2FA 1ZD5A 4ZOHC 4M9JA 5GTIU 4J9PA 2EANA 2C28A 2LYAA 5J0TA 4O3PA 5KFTA 2WB1F 4HAIA 1WCNA 4YMOA 3V6KA 5AICA 3IG5A 1X42A 3RB6A 4IQWA 2W3RA 1N2XA 2LHTA 2ZUCA 8ICBA 4Y2JA 3L3FX 2YN4A 4F4YA 2R18A 5KFCA 4RQ5A 4KLJA 3AEVA 2HI0A 3FDSA 3BDPA 4F50A 2P6RA 4C7YA 5KFPA 4RQNA 3KZIU 4JWNA 7ICSA 3NUQA 5D4BA 1RQNA 3FM9A 5AI4A 2ZTDA 1N63A 2IHMA 9ICOA 2KHQA 2HW3A 5ALWA 1VDVA 2ZXHA 4DFPA 1ZQQA 2JH7A 4C8KA 3AUOA 4Y2SA 2QB0B 1RYSA 2E1FA 5KL8B 4ED6A 4FZLA 1ZQBA 5ALHA 4UASA 4RQ4A 3L5KA 2VA2A 1O08A 4XQ8A 2W04A 2H3VA 3PSTA 2HBKA 3IN5A 3EW9A 2VIXA 1QH9A 4IQVA 3Q8PB 3RJFA 4DQPA 3QZ7A 5IIMA 4C8MA 4QWEA 8ICJA 9ICLA 4QZDA 5AKXA 4LJXA 1UCVA 3JPSA 4UAZA 1LB2B 4GXKA 5KFXA 4Q8EA 4NLCA 4EYIB 4DFDA 4ED7A 2Q4TA 4UARA 1CEZA 1V85A 2WHEA 5ALFA 4K4GA 2Q0ZX 4Q8FA 1ZQ1C 3LYSA 1FO4A 7ICLA 5ALNA 5ALMA 2KTQA 4RU9A 4Z6CA 4FS2A 1V9PA 4PHPA 2FLLA 2QKQA 8ICRA 2IHNA 1T94A 5AI9A 4Y2TA 1ZQFA 4F2SA 2HHSA 5ALSA 3SMVA 4CF4A 4EEKA 7ICVA 4EELA 3AM9A 7ICHA 1TV9A 3V7JA 4ELUA 4RT3A 5KTQA 4BDPA 1KFTA 2UVWA 1K1SA 2GH1A 1BPBA 4AP9A 3S6JA 3N7RC 1JXEA 5ALPA 5B66U 4RQ1A 1Z4NA 2ZIVB 3E2EA 2PMZF 2R8HA 3DDHA 1UT8A 5DBAA 5KFRA 2KZ3A 8ICFA 1A0PA 5AI0A 3MDAA 4IRDA 1WWVA 2KIWA 8ICOA 1FEZA 1TAMA 1JX4A 2K60A 2LKYA 5ALUA 4DQQA 4P0PB 5AK3A 3FYHA 2HHUA 2DGZA 3TKAA 1V97A 4DLEA 4RT2A 4C8OA 1TAUA 3ZDCA 4QJFB 2W54A 2VA3A 3JPOA 3F2CA 3UXPA 1T3NA 1MSWD 4DQRA 5G5HA 1QCKA 5IIKA 4B9LA 4KX5A 1OUQA 2XO7A 4NLZA 1AROP 4FBUA 1ZJMA 5HMMA 3MGIA 5JU5A 4C4RA 2H3QA 2HBMA 3QE9Y 1B4FA 3BS7A 4QZEA 4ECQA 4OJ6A 1ZQKA 4CCHA 3C29A 2RP5A 4KTQA 3OHAA 3H0RB 3CNHA 2F3NA 4G9BA 2FLPA 1Z3EB 5KT6A 1KRPA 4J9SA 2JEFA 1L7MA 4B9NA 3WKCA 3RJHA 4O3OA 4OJOA 8ICTA 3JPPA 3NGDA 1IIPA 3V6JA 1S9FA 1NJYA 8ICPA 4XA5A 5DLGA 3ALRA 2LBOA 1X40A 1S0NA 5CJ7A 4QIWF 2KD1A 4C80A 2NRXA 1Z1VA 4IQUA 1J2NA 2BZFA 4F72A 3GQCA 4UB8U 4TQSA 4TQRA 4KMUA 9ICQA 4IL6U 2NV3A 4KLOA 5DBBA 3THVA 4HYKA 4F91B 1Q3VA 2A1AA 2CRXA 3BZCA 4ECRA 1BPEA 5J0PA 2Y9TA 2DBYA 1YZ6A 3QZ8A 9ICIA 3RBEA 3BS5B 2ATLA 4EEYA 4YD2A 5IIOA 4BWJA 2L5YA 2K89A 2KNJA 4NLNA 2K4PA 2DUYA 2JZBA 8ICLA 3UMCA 1HUOA 5J2HA 3PX0A 7ICKA 1ZQEA 4I2FA 3WU2U 3C2MA 2PKEA 3SV3A 3O0FA 2AU0A 1VLBA 9ICEA 2LPEA 2ASDA 4M0AA 4UB6U 2NRWA 1ZQJA 1SWVA 3KHLA 3TAQA 2ALZA 4FO6A 4IR9A 1UPHA 2MU2A 5KFZA 2HHWA 1ZQYA 5ALQA 3M9NB 4DL3A 3PZPA 2KN7A 2HHXA 3M7DA 3PX4A 1SV0A 3KTQA 5BOLA 2BQUA 4Z6DA 2KICA 1S5LU 2WF7A 2ZIUB 5IIJA 4ECSA 5KT7A 3SI8A 2AXTU 4M9LA 4DF4A 4BJQA 1D9DA 3WK4A 1N61A 5L1MA 1NZBA 4A8EA 4O3RA 1PZNA 4EBEA 3NRZA 8ICSA 1X9XA 3SENA 4Y2YA 5EE3A 5ALOA 1ZQTA 2JMGA 1S0OA 3D2SA 4Q43A 1IG6A 4MFFA 2E8NA 3QUQA 4DL4A 2K8BB 5AK5A 3Q8KA 1F5SA 1ZQNA 1NNLA 3RH5A 4RQ2A 5E79U 2H3FA 2Y1JA 2FMQA 5G5GA 2JRZA 2OEHA 3PW0A 2NRVA 5KFEA 5AKKA 1TK8A 9ICRA 4I28A 3Q8SB 5ALGA 3WK6A 1AQ6A 4UQGA 4QZFA 3RJKA 2W11A 3B0YA 2DKXA 2XGPA 5AM3A 4R66A 3QUCA 4J9MA 9ICBA 2BCQA 2C2EA 4Z6FA 3D2QA 4ECTA 2C2RA 5J0YA 3M1YA 4QIWC 2R8JA 2GO7A 4K4HA 8ICWA 4FS1A 3TAPA 1ZQMA 5FP0A 5D46A 1PVPA 2ZJ5A 5AM0A 5B5EU 2BGWA 2QLTA 1RXWA 1XSPA 3HRDD 4DFJA 4J9OA 3NASA 2J6SA 3AU2A 3WKAA 5ALJA 2W55A 2FMPA 3M8SA 3Q8RB 5DB8A 2EDUA 2MSNA 2AGQA 3EYZA 2HOFA 3LWLA 4UAUA 2G0AA 5CR0A 2BR0A 7ICOA 3UMBA 4B9SA 2V4RA 3T5KA 3WK7A 3A0BU 2IOHA 3IP4B 1T3QA 1N5WA 3RTVA 3G6YA 2CXYA 4DQIA 8ICCA 1KKXA 3CRXA 4R64A 4C8NA 1X2IA 2YMMA 2BDUA 2M0NA 3PW4A 5H2FU 3KZXA 1OW5A 5DDMA 1KSPA 4NLBA 4P4OA 3RAXA 2IOFA 2WF9A 1ZXIA 2ZIUA 3UM9A 5JTIA 2KE7A 2PFPA 4XUSA 1NKCA 4QZ9A 3WK5A 4FZNA 5KFDA 5ALXA 2RDJA 4B9MA 3H4BA 2KKPA 8ICZA 1LKYA 5EOZA 3G6XA 4F93B 2MUTB 4LZDA 1KQQA 4KN4A 2MA1A 3M6ZA 2Z7JA 2R8IA 1XU4A 3PSIA 4RZRA 3C5FA 2LM1A 2EQYA 1ZQCA 3IV6A 8ICIA 5CB1A 1A76A 1BPXA 3BQ1A 2F1JA 8ICUA 2NO5A 3AL0B 5J29A 2W9BA 3MFHA 2AHOB 5DQHA 2FLNA 1D8LA 2YTUA 2GWSA 3OSPA 1HUZA 2W9CA 3MC1A 4J9NA 3C5GA 4RNMA 4US8A 2D3DA 4UAWA 1NK0A 1JALA 2YX8A 4F4ZA 4GC6A 1OXJA 1QQ7A 3LWMA 3ISCA 1PK3A 2ESEA 1UHUA 4EENA 1T8EA 4DO9A 2A19A 2QARA 9ICPA 1H38A 8ICHA 2K4IA 2XC9A 4EX6A 1UT5A 3GILA 2EAPA 5KFNA 4QZCA 5CP2A 4J03A 1L8OA 4YCXA 2DQNB 1X9SA 1COKA 3BQTA 1TKDA 5AKHA 3GV5B 5BOMA 3PSPA 2W8LA 1TE2A 1JIHA 3RFAA 3V6HA 3OPXA 4KLMA 4C4TA 4F5NA 4TUQA 5GTHU 2KOBA 3GFKB 5JUMA 3H8WA 3WK9A 2K4HA 4I2HA 3JPNA 3AN1A 4KN7A 4Y2RA 4Y2XA 5CHGA 5T14A 5DQGA 2JEGA 3RJJA 2NYVA 3R9KA 4B6JA 9ICVA 5A0LA 4CE6A 5IINA 4R8UA 4ICAA 2XY6A 4B9VA 1L3SA 1N56A 4R65A 3PR4A 8ICKA 2ZUDA 4UB4A 4LVSA 2VJ5A 3PW5A 3PO4A 5KFJA 1RDFA 4U7CA 2KVSA 4AYBC 3BJYA 4EBDA 3TI0A 9ICNA 2I1QA 2GLEA 3K1RB 1F44A 2HOQA 5EE9A 3RJGA 2DFLA 2VA8A 1TAQA 2J6UA 4KLUA 4IC9A 5AK4A 5EWEA 4YR3A 1JRPA 2G5IB 1SZHA 5KFFA 4YXMA 4U6PA 2XCAA 2BPGA 2F44A 4F4WA 4JB3A 2XICA 8ICMA 4YR2A 2CPRA 2XY5A 1QLNA 1CI4A 1YT3A 5J2IA 5AM2A 3ED5A 3NRWA 1Z19A 1C20A 1JI7A 3PR5B 1Q8KA 2BPFA 2ZUBA 2W9MA 1HJPA 5KFKA 5DBCA 3C1ZA 1MQ2A 1Z1BA 3RR8A 3PX6A 4US9A 1XO1A 5KFMA 2ZIXB 3H4DA 3D6JA 1L7PA 2ASJA 3SD7A 3GIJA 4PPXA 4UB2A 1ZETA 7ICUA 4FZMA 3HPOA 3BZKA 2W7PA 2O6KA 1JROA 2H3ZA 3GDXA 1NK7A 2BPCA 2YMQA 9ICKA 3GIIA 3MR6A 3RRGA 4QZGA 4QZAA 1XNSA 5KG0A 1PVRA 3QU5A 1WG8A 3H0MB 3QU7A 1SWWA 2DL0A 3HWTA 4UB1A 1X66A 5KG2A 2ZIWA 4RPXA 4KLGA 2EH9A 4TURA 2JEJA 2G09A 4J9KA 2D8CA 1SXDA 3HKZF 2RDIA 5DGAA 3WKBA 2ZIWB 5DKWA 1QSLA 4TUPA 3SR6A 2LI6A 2LYBA 2VJ4A 3ZDBA 4DS5A 5CEHA 4FBTA 3H8JA 2PI5A 4DFKA 4M04A 4RQ0A 5AKIA 4B9TA 4MF2A 3AMZA 1D8YA 4I2BA 2JGAA 3IM1A 2F77X 4O3MA 4QWBA 3DEEA 4ECXA 1BPDA 5HP4A 3QU9A 4QWAA 2BQRA 2OYYA 5AKEA 2ES6A 4QZ8A 4F8RA 8ICEA 5J2JA 1QQ5A 1S0MA 3ETLA 4BUGA 4RPZA 3QEBZ 2FPKA 1MC8A 4O9MA 2BCUA 4GIBA 4I2JA 1QQ6A 3U26A 4NLKA 1SL0A 1HIWA 1XSNA 5HHHA 1NK5A 1ZQLA 5KFYA 1NK6A 5L9XA 2PFOA 3MR5A 2AJQA 3QUTA 5KL1B 2WF6A 4ED8A 4G3IA 1S77D 1WYGA 2B0CA 2W9BB 5CRXA 4IRCA 4USAA 5AKLA 5C5JA 1RPLA 4QW9A 4NM1A 5IILA 3F5AA 4C8LA 3EUB2 2AQ4A 4M9NA 4JV0A 3V7KA 4M6WA 1FFVA 5ALLA 5DQIA 1A6SA 4UB3A 3QNMA 3Q8LA 2HOIA 1UA0A 4BXOA 3KBBA 3GZFA 1U48A 3I28A 2FPLA 1DOQA 3RB4A 5J0UA 1O03A 3C1YA 4PH5A 3ETRA 1UQVA 2KSOA 3IG8A 9ICSA 3OSNA 2E5SA 4NL9A 5AM1A 5F9NA 3M9OB 1MN8A 5AKZA 4NM2A 5KFQA 3IRUA 5J0SA 1JN3A 5AKYA 3RRHA 4GC7A 3KOOA 4AYBF 3QYPA 3EWAA 4YFKA 4GFJA 1IM4A 4RQ3A 1ZQRA 4KLHA 1ZD3A 4Y2UA 2BCVA 3RH4A 5J0OA 1NK8A 4F71A 5AHXA 1ZQOA 4I2CA 4X5VA 1B0XA 4BGDA 2KFNA 2BQ3A 4YP3A 2A1JB 4F5QA 5J8YA 5TZVA 1C7YA 5F9LA 4QWCA 2KKVA 5J0WA 3KHHA 5J2CA 1L3VA 1PVQA 1XSLA 3KFUF 3PNCA 1QSYA 4RUCA 4CF3A 3TADA 3SYZA 2W03A 4CDGA 1ECWA 1J2MA 2IA6A 3H40A 4DSJA 3D2NA 5DLFA 3QEAZ 4M2YA 1NK4A 5KFLA 4UATA 1VJ5A 4UB5A 2JHDA 5BPCA 3Q8QB 2F1IA 5KFUA 3N4MB 2I9GA 4BXOB 5J0RA 1SB3C 1S8OA 3SAFA 2ZJ8A 2KMDA 2ZTEA 5L1LA 3PVXA 1S97A 2HSZA 4DSLA 2DF4B 5ALDA 3C2KA 1NJXA 2LYHA 3N28A 2ASLA 3RB0A 1XS9D 1N60A 4YMNA 4LZGA 4I2DA 4QWDA 1ZQPA 3M6KA 4M6WB 4F5OA 3C28A 1YZ7A 3V72A 1S10A 3TACB 1TK5A 2IMWP 3RR7A 1ZQGA 5KAFU 5EE0A 2LMRA 4PGYA 2KFZA 4BWMA 3NS1A 1X6JA 5KFAA 3ZDEA 5TISU 1ZD4A 4P0PA 1CRXA 4ECWA 9ICMA 3C2LA 1UA1A 3MDCA 4UBBA 1L7NA 3IHQB 1ZYQA 1MQ3A 3UQ2A 3KHRA 4KX3A 3JPQA 1RQLA 5D49A 9ICTA 2FPMA 1S76D 3H0LB 1RXVA 3QX7A 2BCSA 3RAQA 3B0XA 4DSEA 3N7PD 2EZXA 1KL9A 3QU4A 4CGZA 4PGQA 4YXJA 1DGJA 2R8GA 3RB3A 1V38A 5HNKA 2RHFA 3PW7A 1SL2A 2F76X 5HR7A 1Q3UA 2HCFA 1ZQXA 2P6UA 1KFDA 3TFRA 4ACOA 3GIKA 2HHTA 3BS5A 2WTFA 5AKGA 4MFAA 4KLIA 4KLTA 4Q45A 3TANA 1BVSA 5KG7A 4F4XA 4ECUA 5DG7A 5DDYA 1A77A 2ISPA 8ICGA 4RNNA 3ZI4A 3KKAC 3UPQA 1SL1A 3MABA 3OHBA 3SV4A 1DXSA 4F2RA 5KFOA 1X9WA 4CRXA 2QB0A 2XGQA 3PV8A 4QZBA 3MBYA 4I2AA 3F53A 7ICRA 3KHGA 2Y0SC 2E8OA 1RYRA 4IR1A 4R63A 2AH5A 5KG6A 4Y2QA 9ICUA 2YMPA 2OH2A 3K1ZA 4RNOA 2E8MA 2H3IA 4C4SA 1LKYB 4IS7A 3TQ1A 1SV0C 4PJ0U 1XO0A 1MA7A 2G08A 2NRZA 5KG3A 5L1KA 4F5PA 2HMXA 4ED3A 3FAHA 4E0DA 4BX9C 2WF5A 2F1HA 2YMLA 9ICHA 4DL6A 5AIAA 2HVHA 5L1IA 2DKZA 1KW4A 2PI4A 4I2EA 5DB9A 1NJWA 1LVHA 2DWQA 4PZNA 5AKJA 5KFIA 4DOCA 1ZQHA 3JPTA 4K4IA 5ALTA 1L5UA 2YY6A 1P7DA 4DL2A 5J2BA 4OO1J 1NI3A 4RQMA 4PL1A 2MRLA 2KJ5A 5KAIU 2A1JA 2PFQA 9ICWA 2KVCA 1JMSA 4C7ZA 2IOFK 2EZYA 4MF8A 4IRKA 5EWGA 2KZZA 4RPYA 3ISBA 5J2DA 4KLLA 2F8LA 8ICQA 5K4LA 1KLNA 1TFRA 3F5EA 2C2DA 2BHNA 2V4QA 4PZOA 1N48A 2H5XA 1JUDA 5KT5A 4KLSA 2HHVA 8ICXA 1DK2A 1QSSA 4YVZA 4QNLA 1FFUA 3NVZA 1ZRMA 2ZIVA 5KT4A 2UVRA 3AU6A 3M9MB 3MGVA 4I2IA 4EZ9A 4J9QA 4J9LA 2KJ9A 4KLDA 1RM6C 2G06A 4QW8A 1U45A 2ISOA 3LVWA 5ALIA 1BNPA 2G5HB 4UBCA 5J2GA 2K8CB 5DB7A 3J81j 7ICIA 5KG5A 3PW2A 2PXIA 7ICMA 4J9RA 9ICCA 5KG4A 2OXOA 1ZQDA 5HHIA 3EZ5A 4ELVA 1LV5A 1QTMA 3QXGA 5AIBA 4DCCA 5J2KA 3PMLA 5F3XB 2F8KA 2XY7A 2QARB 3BQ0A 1DGSA 2XIDA 1NK9A 3ZDAA 1F0MA 4DWIA 4I2GA 2QB1A 4ZH4A 2HVIA 4DLGA 1IXRA 5JRTA 1BGXT 3N97B 1U4BA 4MEYA 1Q46A 4GXIA 2EZZA 3OTQA 1X6IA 2OWOA 3RF9A 7ICTA 2EAOA 2DPIA 4KLQA 5EWFA 1L3UA 1XC9A 4M9HA 1ZQVA 1URJA 4B9UA 3GIMA 2XCPA 1ZQIA 4MHVA 3SAHA 3I76A 2PMZC 2GOLA 5HMLA 1SKWA 5CWRA 3H7IA 2FJ6A 4P0QA 3F2DA 4UW9A 4R8UB 4KLFA
chains in the Genus database with same CATH topology
4QNLA 2DF4B 2G07A 2ZIWB 3L3FX 2KICA 3LVVA 2KHVA 1ED1A 2R18A 2LYBA 2ZIVA 2VJ4A 2YX8A 3HKZC 2HOQA 2ZIUB 1F44A 4CRXA 4AYBF 3SMVA 4OJOA 2HOFA 3MGVA 2K4EA 3M6KA 1IIPA 2ZIXA 4GFJA 3C28A 1KBUA 2G0AA 3F53A 4IC9A 4BJQA 2KJ9A 3VCBA 1NZBA 2G5IB 1SZHA 4A8EA 4JMUA 2JGAA 4U6PA 3ALRA 2Y0SC 2LBOA 2G06A 4P0QB 2F77X 3AQFA 3NUQA 4O3MA 2HBLA 3CP8A 2XICA 3LVWA 1WUDA 3DEEA 4NV0A 5C0YA 2CPRA 2K4IA 4QIWF 2OYYA 2KD1A 2KHQA 3IP4B 2KV2A 2WAQF 2F2AB 2GH1A 3ICXA 2OH2A 3K1ZA 2JMGA 2G5HB 2H3IA 2ZXHA 3N7RC 3D2SA 2K8CB 4BUGA 2DQNB 1XO0A 1MA7A 3CRXA 1YT3A 2JH7A 2G08A 2BDUA 2M0NA 3KZXA 2Y0SF 2NV3A 3PSPA 4NLBA 2ZIVB 4OJLA 2D6FC 2OXOA 3NRWA 2PMZF 3F2BA 1Z19A 1CRXA 4P0PA 2E1FA 5KL8B 2K8BB 3RFAA 4FZLA 3OPXA 1HIWA 2K8AA 2OM6A 1A0PA 2HMXA 2KJ8A 4KMOB 2A3VA 2KIWA 2ZIUA 1Q3VA 4BX9C 2ZXIA 2ZG6A 4NWIA 4WJ3B 1TAMA 1DRGA 5KL1B 2KOBA 2CRXA 2KKVA 2H3FA 2W04A 2LKYA 2H3VA 3CYMA 1Z1BA 3PSFA 1PVQA 4P0PB 2K4HA 3PSTA 2HBKA 2RRDA 2HBJA 2XIDA 4KX3A 4OJ5A 3IN5A 5CRXA 3KFUF 2VIXA 1L6NA 3E0FA 2DGZA 2ZIXB 4FZNA 4FE3A 1D8BA 4OJPA 5T14A 2CN1A 2KKPA 3H0LB 2W03A 4FZMA 4CDGA 4QJFB 3F5AA 2W7PA 1ECWA 2K89A 2KNJA 5A0LA 3F2CA 2H3ZA 2MA1A 2YB4A 3M6ZA 2Z7JA 3RF9A 2WB1C 3N7PD 1P7DA 2VKQA 2XI9A 4ICAA 4NLCA 4CGZA 3ONNA 4OO1J 3D2NA 4PL1A 4KX5A 1OUQA 1A6SA 2MRLA 2KJ5A 2JH1A 2Q4TA 2RHFA 3AQEA 3D2QA 3PSIA 1XNSA 2KVCA 3SQIA 2XVTA 3O0FA 2YB1A 2F76X 3N7SC 2WAQC 2H3QA 1PVRA 1HEKA 1Q3UA 2HOIA 3GU3A 5HR7A 4QIWC 2HBMA 1URJA 3GZFA 4ACOA 2LYAA 2JHDA 1ZQ1C 2KEYA 3LYSA 3H0MB 5HR6A 1GO3F 4OJ6A 3SAHA 2WB1F 3VC8A 2N1RA 2W7OA 2VJ5A 1UPHA 3SAGA 2ZIWA 3C29A 1PVPA 3AL0B 2F8LA 2RP5A 3IG5A 2PMZC 2GOLA 4U7CA 3F5EA 3T79A 2G09A 3SAFA 3H0RB 3PZPA 4AYBC 4P0QA 2LHTA 3IG8A 4PL2A 2E5SA 1T94A 3M7DA 3HKZF 3F2DA 2E1EA 4C0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRL A; 
#chains in the Genus database with same CATH topology
 1ZQS A;  5KFV A;  4NY8 A;  5ALE A;  5KFG A;  2JZB B;  1ZQU A;  5EE1 A;  1RYU A;  9ICX A;  1RG6 A;  2KZM A;  3MFI A;  4NLG A;  2KP7 A;  2RLT A;  3PO5 A;  3TAR A;  4ECY A;  1RZT A;  4DEZ A;  2HBL A;  1KEJ A;  3UQ0 A;  4NV0 A;  1EXN A;  5J8Y C;  2WF8 A;  1U9L A;  2KV2 A;  2F2A B;  1L8L A;  1XWL A;  1KTQ A;  3M8R A;  1SGG A;  1U49 A;  3RJI A;  2JEI A;  3TAD C;  4PGX A;  2Y0S F;  3MR2 A;  5ALR A;  3KKA A;  2OM6 A;  2IBK A;  4DSI A;  2ZG6 A;  2JXJ A;  4WJ3 B;  5DGB A;  1L7O A;  3CYM A;  2ZTC A;  3E58 A;  4OJ5 A;  5ALZ A;  4O5C A;  1X9M A;  3RH6 A;  4FE3 A;  3LK9 A;  1D8B A;  5KFW A;  4OJP A;  2VAN A;  4UAY A;  5KFH A;  3T3F A;  1NKB A;  2WFA A;  1IV8 A;  4NJ8 A;  4KIT B;  5AM5 A;  3ONN A;  1N62 A;  3Q8M A;  5AK6 A;  2WAQ C;  3T5H A;  5J0X A;  3T5J A;  4MEX A;  4JV1 A;  5KT3 A;  3KD3 A;  1NJZ A;  3VC8 A;  4EX7 A;  2W7O A;  1J97 A;  4RUA A;  8ICY A;  4F5R A;  3B9J A;  5AI5 A;  4Y2P A;  1BPZ A;  2G07 A;  4EYH B;  3FC4 A;  5AI6 A;  3LVV A;  2KHV A;  2KG5 A;  2K4E A;  1N5X A;  2ZIX A;  1Y88 A;  1KBU A;  2W9C B;  4PHE A;  3GV8 B;  3UXO A;  3VCB A;  5J0Q A;  2Y1I A;  3AQF A;  3H8M A;  3OGU A;  1BNO A;  4JUZ A;  4DS4 A;  3ICX A;  3ZD8 A;  4ED2 A;  4RQ7 A;  4OCZ A;  1KFS A;  4P4M A;  2J6T A;  1COO A;  2KIV A;  4OJL A;  3DV9 A;  5J2A A;  3ISD A;  4TUS A;  3HT3 A;  7ICQ A;  1K1Q A;  2AGP A;  4KMO B;  2BDP A;  2ZXI A;  4NWI A;  1L3T A;  4M47 A;  2MAX A;  1Z00 A;  4EBC A;  4PHA A;  4GXJ A;  2W9A A;  3WKE A;  4YG2 A;  2P66 A;  2BKE A;  3CW2 C;  4O3S A;  1TK0 A;  1ZQA A;  4KLE A;  1U47 A;  2Y9U A;  5KT2 A;  1ZQW A;  2VKQ A;  9ICG A;  1SIJ A;  4O0I A;  4YQW A;  4CF5 A;  1BPY A;  2I5H A;  2AGO A;  2JH1 A;  3GV7 B;  3LDA A;  3N7S C;  4UAV A;  4I29 A;  3ZD9 A;  3UMG A;  3L4P A;  2BCR A;  1TVA A;  1ZJN A;  2FMS A;  5HR6 A;  3SAG A;  8ICV A;  2LM4 A;  3NTU A;  3OJU A;  4M9G A;  2DPJ A;  4P4P A;  1Z4O A;  5ALK A;  3HIL A;  4PL2 A;  5DG9 A;  2OCE A;  4MFC A;  8ICA A;  1L6N A;  3MGH A;  3SEI A;  7ICG A;  1DK3 A;  4O5E A;  4QZI A;  1ED1 A;  3HKZ C;  4YN4 A;  3WKD A;  1ZRN A;  3ORY A;  4DQS A;  2E8P A;  4Y2V A;  1T4G A;  3C21 A;  2HDO A;  4JMU A;  3T5L A;  1T7P A;  3K4G A;  2UVV A;  2OHF A;  4ELT A;  5C0Y A;  9ICJ A;  2KK0 A;  4DSF A;  2HHQ A;  1WWU A;  3K75 D;  4IQT A;  5J2E A;  2WAQ F;  4YD1 A;  3SZ2 A;  1Z00 B;  4O3Q A;  2P35 A;  5L1J A;  2RQ5 A;  1M6Y A;  4O3N A;  2UVU A;  2W43 A;  4DSK A;  4CNQ A;  3F2B A;  3MR3 A;  1SXE A;  3BQ2 A;  2ZJA A;  3UXN A;  4YMM A;  2A3V A;  2W3S A;  1NKE A;  1SZP A;  5ALY A;  3H8S A;  3C23 A;  1DRG A;  3PSF A;  2RRD A;  2HBJ A;  2R8K A;  1SV4 A;  2AQ0 A;  3EPG A;  3QUB A;  9ICA A;  2NRT A;  4DF8 A;  3TFS A;  4GLX A;  4Z6E A;  4F3O A;  4NXZ A;  3I1Y A;  5AM4 A;  3PMN A;  4I27 A;  1B22 A;  2JR5 A;  3BQ7 A;  2WB1 C;  1NZP A;  2XI9 A;  2B6G A;  3PY8 A;  3NVW A;  5KFS A;  2B21 A;  2M9N A;  1JXL A;  4P2H A;  1CUK A;  3AQE A;  4XRH A;  4ECZ A;  3SQI A;  2XVT A;  2YB1 A;  1D9F A;  4ECV A;  1HEK A;  1ZOL A;  3GU3 A;  2FI1 A;  3HP6 A;  2KEY A;  3OJS A;  3NVY A;  1GO3 F;  4ED1 A;  3ZDD A;  2KSO B;  2N1R A;  1PK1 B;  3V7L A;  5DG8 A;  4F92 B;  3T79 A;  1K5O A;  4ED0 A;  1ZQZ A;  1B43 A;  2W8K A;  4JV2 A;  2PFN A;  7ICF A;  7ICJ A;  2E1E A;  4C0Z A;  1KN5 A;  3G6V A;  3HX0 A;  5ALV A;  3RBD A;  4DL7 A;  7ICE A;  4DOA A;  2V9W A;  3HJE A;  4YR0 A;  4DL5 A;  4PHD A;  4EZ6 A;  1WCL A;  3NVV A;  1KDH A;  5KG1 A;  2FE9 A;  2EAM A;  4P0Q B;  3QU2 A;  3HW8 A;  3CP8 A;  1WUD A;  5DB6 A;  7ICN A;  2MUT A;  4RQ8 A;  3EPI A;  1S0V A;  4DOB A;  4NL9 C;  4DFM A;  5CA7 A;  4JK1 A;  3RJE A;  3IDW A;  1ZD2 P;  2D6F C;  2E3T A;  1SKR A;  4F4K A;  2K8A A;  3JPR A;  2KJ8 A;  8ICN A;  9ICF A;  5KFB A;  4OD0 A;  5KNI A;  2JV3 A;  2NO4 A;  1SKS A;  1NOM A;  3E0F A;  4RQ6 A;  4O5K A;  7ICP A;  1PUZ A;  2CN1 A;  2YQE A;  4FFD A;  2C22 A;  4Q44 A;  1FIQ A;  5III A;  2ODG A;  1PK1 A;  2YB4 A;  3A0H U;  5AI8 A;  4QZH A;  3WK8 A;  4JWM A;  2I6X A;  2FDR A;  5J2F A;  1ZD5 A;  4ZOH C;  4M9J A;  5GTI U;  4J9P A;  2EAN A;  2C28 A;  2LYA A;  5J0T A;  4O3P A;  5KFT A;  2WB1 F;  4HAI A;  1WCN A;  4YMO A;  3V6K A;  5AIC A;  3IG5 A;  1X42 A;  3RB6 A;  4IQW A;  2W3R A;  1N2X A;  2LHT A;  2ZUC A;  8ICB A;  4Y2J A;  3L3F X;  2YN4 A;  4F4Y A;  2R18 A;  5KFC A;  4RQ5 A;  4KLJ A;  3AEV A;  2HI0 A;  3FDS A;  3BDP A;  4F50 A;  2P6R A;  4C7Y A;  5KFP A;  4RQN A;  3KZI U;  4JWN A;  7ICS A;  3NUQ A;  5D4B A;  1RQN A;  3FM9 A;  5AI4 A;  2ZTD A;  1N63 A;  2IHM A;  9ICO A;  2KHQ A;  2HW3 A;  5ALW A;  1VDV A;  2ZXH A;  4DFP A;  1ZQQ A;  2JH7 A;  4C8K A;  3AUO A;  4Y2S A;  2QB0 B;  1RYS A;  2E1F A;  5KL8 B;  4ED6 A;  4FZL A;  1ZQB A;  5ALH A;  4UAS A;  4RQ4 A;  3L5K A;  2VA2 A;  1O08 A;  4XQ8 A;  2W04 A;  2H3V A;  3PST A;  2HBK A;  3IN5 A;  3EW9 A;  2VIX A;  1QH9 A;  4IQV A;  3Q8P B;  3RJF A;  4DQP A;  3QZ7 A;  5IIM A;  4C8M A;  4QWE A;  8ICJ A;  9ICL A;  4QZD A;  5AKX A;  4LJX A;  1UCV A;  3JPS A;  4UAZ A;  1LB2 B;  4GXK A;  5KFX A;  4Q8E A;  4NLC A;  4EYI B;  4DFD A;  4ED7 A;  2Q4T A;  4UAR A;  1CEZ A;  1V85 A;  2WHE A;  5ALF A;  4K4G A;  2Q0Z X;  4Q8F A;  1ZQ1 C;  3LYS A;  1FO4 A;  7ICL A;  5ALN A;  5ALM A;  2KTQ A;  4RU9 A;  4Z6C A;  4FS2 A;  1V9P A;  4PHP A;  2FLL A;  2QKQ A;  8ICR A;  2IHN A;  1T94 A;  5AI9 A;  4Y2T A;  1ZQF A;  4F2S A;  2HHS A;  5ALS A;  3SMV A;  4CF4 A;  4EEK A;  7ICV A;  4EEL A;  3AM9 A;  7ICH A;  1TV9 A;  3V7J A;  4ELU A;  4RT3 A;  5KTQ A;  4BDP A;  1KFT A;  2UVW A;  1K1S A;  2GH1 A;  1BPB A;  4AP9 A;  3S6J A;  3N7R C;  1JXE A;  5ALP A;  5B66 U;  4RQ1 A;  1Z4N A;  2ZIV B;  3E2E A;  2PMZ F;  2R8H A;  3DDH A;  1UT8 A;  5DBA A;  5KFR A;  2KZ3 A;  8ICF A;  1A0P A;  5AI0 A;  3MDA A;  4IRD A;  1WWV A;  2KIW A;  8ICO A;  1FEZ A;  1TAM A;  1JX4 A;  2K60 A;  2LKY A;  5ALU A;  4DQQ A;  4P0P B;  5AK3 A;  3FYH A;  2HHU A;  2DGZ A;  3TKA A;  1V97 A;  4DLE A;  4RT2 A;  4C8O A;  1TAU A;  3ZDC A;  4QJF B;  2W54 A;  2VA3 A;  3JPO A;  3F2C A;  3UXP A;  1T3N A;  1MSW D;  4DQR A;  5G5H A;  1QCK A;  5IIK A;  4B9L A;  4KX5 A;  1OUQ A;  2XO7 A;  4NLZ A;  1ARO P;  4FBU A;  1ZJM A;  5HMM A;  3MGI A;  5JU5 A;  4C4R A;  2H3Q A;  2HBM A;  3QE9 Y;  1B4F A;  3BS7 A;  4QZE A;  4ECQ A;  4OJ6 A;  1ZQK A;  4CCH A;  3C29 A;  2RP5 A;  4KTQ A;  3OHA A;  3H0R B;  3CNH A;  2F3N A;  4G9B A;  2FLP A;  1Z3E B;  5KT6 A;  1KRP A;  4J9S A;  2JEF A;  1L7M A;  4B9N A;  3WKC A;  3RJH A;  4O3O A;  4OJO A;  8ICT A;  3JPP A;  3NGD A;  1IIP A;  3V6J A;  1S9F A;  1NJY A;  8ICP A;  4XA5 A;  5DLG A;  3ALR A;  2LBO A;  1X40 A;  1S0N A;  5CJ7 A;  4QIW F;  2KD1 A;  4C80 A;  2NRX A;  1Z1V A;  4IQU A;  1J2N A;  2BZF A;  4F72 A;  3GQC A;  4UB8 U;  4TQS A;  4TQR A;  4KMU A;  9ICQ A;  4IL6 U;  2NV3 A;  4KLO A;  5DBB A;  3THV A;  4HYK A;  4F91 B;  1Q3V A;  2A1A A;  2CRX A;  3BZC A;  4ECR A;  1BPE A;  5J0P A;  2Y9T A;  2DBY A;  1YZ6 A;  3QZ8 A;  9ICI A;  3RBE A;  3BS5 B;  2ATL A;  4EEY A;  4YD2 A;  5IIO A;  4BWJ A;  2L5Y A;  2K89 A;  2KNJ A;  4NLN A;  2K4P A;  2DUY A;  2JZB A;  8ICL A;  3UMC A;  1HUO A;  5J2H A;  3PX0 A;  7ICK A;  1ZQE A;  4I2F A;  3WU2 U;  3C2M A;  2PKE A;  3SV3 A;  3O0F A;  2AU0 A;  1VLB A;  9ICE A;  2LPE A;  2ASD A;  4M0A A;  4UB6 U;  2NRW A;  1ZQJ A;  1SWV A;  3KHL A;  3TAQ A;  2ALZ A;  4FO6 A;  4IR9 A;  1UPH A;  2MU2 A;  5KFZ A;  2HHW A;  1ZQY A;  5ALQ A;  3M9N B;  4DL3 A;  3PZP A;  2KN7 A;  2HHX A;  3M7D A;  3PX4 A;  1SV0 A;  3KTQ A;  5BOL A;  2BQU A;  4Z6D A;  2KIC A;  1S5L U;  2WF7 A;  2ZIU B;  5IIJ A;  4ECS A;  5KT7 A;  3SI8 A;  2AXT U;  4M9L A;  4DF4 A;  4BJQ A;  1D9D A;  3WK4 A;  1N61 A;  5L1M A;  1NZB A;  4A8E A;  4O3R A;  1PZN A;  4EBE A;  3NRZ A;  8ICS A;  1X9X A;  3SEN A;  4Y2Y A;  5EE3 A;  5ALO A;  1ZQT A;  2JMG A;  1S0O A;  3D2S A;  4Q43 A;  1IG6 A;  4MFF A;  2E8N A;  3QUQ A;  4DL4 A;  2K8B B;  5AK5 A;  3Q8K A;  1F5S A;  1ZQN A;  1NNL A;  3RH5 A;  4RQ2 A;  5E79 U;  2H3F A;  2Y1J A;  2FMQ A;  5G5G A;  2JRZ A;  2OEH A;  3PW0 A;  2NRV A;  5KFE A;  5AKK A;  1TK8 A;  9ICR A;  4I28 A;  3Q8S B;  5ALG A;  3WK6 A;  1AQ6 A;  4UQG A;  4QZF A;  3RJK A;  2W11 A;  3B0Y A;  2DKX A;  2XGP A;  5AM3 A;  4R66 A;  3QUC A;  4J9M A;  9ICB A;  2BCQ A;  2C2E A;  4Z6F A;  3D2Q A;  4ECT A;  2C2R A;  5J0Y A;  3M1Y A;  4QIW C;  2R8J A;  2GO7 A;  4K4H A;  8ICW A;  4FS1 A;  3TAP A;  1ZQM A;  5FP0 A;  5D46 A;  1PVP A;  2ZJ5 A;  5AM0 A;  5B5E U;  2BGW A;  2QLT A;  1RXW A;  1XSP A;  3HRD D;  4DFJ A;  4J9O A;  3NAS A;  2J6S A;  3AU2 A;  3WKA A;  5ALJ A;  2W55 A;  2FMP A;  3M8S A;  3Q8R B;  5DB8 A;  2EDU A;  2MSN A;  2AGQ A;  3EYZ A;  2HOF A;  3LWL A;  4UAU A;  2G0A A;  5CR0 A;  2BR0 A;  7ICO A;  3UMB A;  4B9S A;  2V4R A;  3T5K A;  3WK7 A;  3A0B U;  2IOH A;  3IP4 B;  1T3Q A;  1N5W A;  3RTV A;  3G6Y A;  2CXY A;  4DQI A;  8ICC A;  1KKX A;  3CRX A;  4R64 A;  4C8N A;  1X2I A;  2YMM A;  2BDU A;  2M0N A;  3PW4 A;  5H2F U;  3KZX A;  1OW5 A;  5DDM A;  1KSP A;  4NLB A;  4P4O A;  3RAX A;  2IOF A;  2WF9 A;  1ZXI A;  2ZIU A;  3UM9 A;  5JTI A;  2KE7 A;  2PFP A;  4XUS A;  1NKC A;  4QZ9 A;  3WK5 A;  4FZN A;  5KFD A;  5ALX A;  2RDJ A;  4B9M A;  3H4B A;  2KKP A;  8ICZ A;  1LKY A;  5EOZ A;  3G6X A;  4F93 B;  2MUT B;  4LZD A;  1KQQ A;  4KN4 A;  2MA1 A;  3M6Z A;  2Z7J A;  2R8I A;  1XU4 A;  3PSI A;  4RZR A;  3C5F A;  2LM1 A;  2EQY A;  1ZQC A;  3IV6 A;  8ICI A;  5CB1 A;  1A76 A;  1BPX A;  3BQ1 A;  2F1J A;  8ICU A;  2NO5 A;  3AL0 B;  5J29 A;  2W9B A;  3MFH A;  2AHO B;  5DQH A;  2FLN A;  1D8L A;  2YTU A;  2GWS A;  3OSP A;  1HUZ A;  2W9C A;  3MC1 A;  4J9N A;  3C5G A;  4RNM A;  4US8 A;  2D3D A;  4UAW A;  1NK0 A;  1JAL A;  2YX8 A;  4F4Z A;  4GC6 A;  1OXJ A;  1QQ7 A;  3LWM A;  3ISC A;  1PK3 A;  2ESE A;  1UHU A;  4EEN A;  1T8E A;  4DO9 A;  2A19 A;  2QAR A;  9ICP A;  1H38 A;  8ICH A;  2K4I A;  2XC9 A;  4EX6 A;  1UT5 A;  3GIL A;  2EAP A;  5KFN A;  4QZC A;  5CP2 A;  4J03 A;  1L8O A;  4YCX A;  2DQN B;  1X9S A;  1COK A;  3BQT A;  1TKD A;  5AKH A;  3GV5 B;  5BOM A;  3PSP A;  2W8L A;  1TE2 A;  1JIH A;  3RFA A;  3V6H A;  3OPX A;  4KLM A;  4C4T A;  4F5N A;  4TUQ A;  5GTH U;  2KOB A;  3GFK B;  5JUM A;  3H8W A;  3WK9 A;  2K4H A;  4I2H A;  3JPN A;  3AN1 A;  4KN7 A;  4Y2R A;  4Y2X A;  5CHG A;  5T14 A;  5DQG A;  2JEG A;  3RJJ A;  2NYV A;  3R9K A;  4B6J A;  9ICV A;  5A0L A;  4CE6 A;  5IIN A;  4R8U A;  4ICA A;  2XY6 A;  4B9V A;  1L3S A;  1N56 A;  4R65 A;  3PR4 A;  8ICK A;  2ZUD A;  4UB4 A;  4LVS A;  2VJ5 A;  3PW5 A;  3PO4 A;  5KFJ A;  1RDF A;  4U7C A;  2KVS A;  4AYB C;  3BJY A;  4EBD A;  3TI0 A;  9ICN A;  2I1Q A;  2GLE A;  3K1R B;  1F44 A;  2HOQ A;  5EE9 A;  3RJG A;  2DFL A;  2VA8 A;  1TAQ A;  2J6U A;  4KLU A;  4IC9 A;  5AK4 A;  5EWE A;  4YR3 A;  1JRP A;  2G5I B;  1SZH A;  5KFF A;  4YXM A;  4U6P A;  2XCA A;  2BPG A;  2F44 A;  4F4W A;  4JB3 A;  2XIC A;  8ICM A;  4YR2 A;  2CPR A;  2XY5 A;  1QLN A;  1CI4 A;  1YT3 A;  5J2I A;  5AM2 A;  3ED5 A;  3NRW A;  1Z19 A;  1C20 A;  1JI7 A;  3PR5 B;  1Q8K A;  2BPF A;  2ZUB A;  2W9M A;  1HJP A;  5KFK A;  5DBC A;  3C1Z A;  1MQ2 A;  1Z1B A;  3RR8 A;  3PX6 A;  4US9 A;  1XO1 A;  5KFM A;  2ZIX B;  3H4D A;  3D6J A;  1L7P A;  2ASJ A;  3SD7 A;  3GIJ A;  4PPX A;  4UB2 A;  1ZET A;  7ICU A;  4FZM A;  3HPO A;  3BZK A;  2W7P A;  2O6K A;  1JRO A;  2H3Z A;  3GDX A;  1NK7 A;  2BPC A;  2YMQ A;  9ICK A;  3GII A;  3MR6 A;  3RRG A;  4QZG A;  4QZA A;  1XNS A;  5KG0 A;  1PVR A;  3QU5 A;  1WG8 A;  3H0M B;  3QU7 A;  1SWW A;  2DL0 A;  3HWT A;  4UB1 A;  1X66 A;  5KG2 A;  2ZIW A;  4RPX A;  4KLG A;  2EH9 A;  4TUR A;  2JEJ A;  2G09 A;  4J9K A;  2D8C A;  1SXD A;  3HKZ F;  2RDI A;  5DGA A;  3WKB A;  2ZIW B;  5DKW A;  1QSL A;  4TUP A;  3SR6 A;  2LI6 A;  2LYB A;  2VJ4 A;  3ZDB A;  4DS5 A;  5CEH A;  4FBT A;  3H8J A;  2PI5 A;  4DFK A;  4M04 A;  4RQ0 A;  5AKI A;  4B9T A;  4MF2 A;  3AMZ A;  1D8Y A;  4I2B A;  2JGA A;  3IM1 A;  2F77 X;  4O3M A;  4QWB A;  3DEE A;  4ECX A;  1BPD A;  5HP4 A;  3QU9 A;  4QWA A;  2BQR A;  2OYY A;  5AKE A;  2ES6 A;  4QZ8 A;  4F8R A;  8ICE A;  5J2J A;  1QQ5 A;  1S0M A;  3ETL A;  4BUG A;  4RPZ A;  3QEB Z;  2FPK A;  1MC8 A;  4O9M A;  2BCU A;  4GIB A;  4I2J A;  1QQ6 A;  3U26 A;  4NLK A;  1SL0 A;  1HIW A;  1XSN A;  5HHH A;  1NK5 A;  1ZQL A;  5KFY A;  1NK6 A;  5L9X A;  2PFO A;  3MR5 A;  2AJQ A;  3QUT A;  5KL1 B;  2WF6 A;  4ED8 A;  4G3I A;  1S77 D;  1WYG A;  2B0C A;  2W9B B;  5CRX A;  4IRC A;  4USA A;  5AKL A;  5C5J A;  1RPL A;  4QW9 A;  4NM1 A;  5IIL A;  3F5A A;  4C8L A;  3EUB 2;  2AQ4 A;  4M9N A;  4JV0 A;  3V7K A;  4M6W A;  1FFV A;  5ALL A;  5DQI A;  1A6S A;  4UB3 A;  3QNM A;  3Q8L A;  2HOI A;  1UA0 A;  4BXO A;  3KBB A;  3GZF A;  1U48 A;  3I28 A;  2FPL A;  1DOQ A;  3RB4 A;  5J0U A;  1O03 A;  3C1Y A;  4PH5 A;  3ETR A;  1UQV A;  2KSO A;  3IG8 A;  9ICS A;  3OSN A;  2E5S A;  4NL9 A;  5AM1 A;  5F9N A;  3M9O B;  1MN8 A;  5AKZ A;  4NM2 A;  5KFQ A;  3IRU A;  5J0S A;  1JN3 A;  5AKY A;  3RRH A;  4GC7 A;  3KOO A;  4AYB F;  3QYP A;  3EWA A;  4YFK A;  4GFJ A;  1IM4 A;  4RQ3 A;  1ZQR A;  4KLH A;  1ZD3 A;  4Y2U A;  2BCV A;  3RH4 A;  5J0O A;  1NK8 A;  4F71 A;  5AHX A;  1ZQO A;  4I2C A;  4X5V A;  1B0X A;  4BGD A;  2KFN A;  2BQ3 A;  4YP3 A;  2A1J B;  4F5Q A;  5J8Y A;  5TZV A;  1C7Y A;  5F9L A;  4QWC A;  2KKV A;  5J0W A;  3KHH A;  5J2C A;  1L3V A;  1PVQ A;  1XSL A;  3KFU F;  3PNC A;  1QSY A;  4RUC A;  4CF3 A;  3TAD A;  3SYZ A;  2W03 A;  4CDG A;  1ECW A;  1J2M A;  2IA6 A;  3H40 A;  4DSJ A;  3D2N A;  5DLF A;  3QEA Z;  4M2Y A;  1NK4 A;  5KFL A;  4UAT A;  1VJ5 A;  4UB5 A;  2JHD A;  5BPC A;  3Q8Q B;  2F1I A;  5KFU A;  3N4M B;  2I9G A;  4BXO B;  5J0R A;  1SB3 C;  1S8O A;  3SAF A;  2ZJ8 A;  2KMD A;  2ZTE A;  5L1L A;  3PVX A;  1S97 A;  2HSZ A;  4DSL A;  2DF4 B;  5ALD A;  3C2K A;  1NJX A;  2LYH A;  3N28 A;  2ASL A;  3RB0 A;  1XS9 D;  1N60 A;  4YMN A;  4LZG A;  4I2D A;  4QWD A;  1ZQP A;  3M6K A;  4M6W B;  4F5O A;  3C28 A;  1YZ7 A;  3V72 A;  1S10 A;  3TAC B;  1TK5 A;  2IMW P;  3RR7 A;  1ZQG A;  5KAF U;  5EE0 A;  2LMR A;  4PGY A;  2KFZ A;  4BWM A;  3NS1 A;  1X6J A;  5KFA A;  3ZDE A;  5TIS U;  1ZD4 A;  4P0P A;  1CRX A;  4ECW A;  9ICM A;  3C2L A;  1UA1 A;  3MDC A;  4UBB A;  1L7N A;  3IHQ B;  1ZYQ A;  1MQ3 A;  3UQ2 A;  3KHR A;  4KX3 A;  3JPQ A;  1RQL A;  5D49 A;  9ICT A;  2FPM A;  1S76 D;  3H0L B;  1RXV A;  3QX7 A;  2BCS A;  3RAQ A;  3B0X A;  4DSE A;  3N7P D;  2EZX A;  1KL9 A;  3QU4 A;  4CGZ A;  4PGQ A;  4YXJ A;  1DGJ A;  2R8G A;  3RB3 A;  1V38 A;  5HNK A;  2RHF A;  3PW7 A;  1SL2 A;  2F76 X;  5HR7 A;  1Q3U A;  2HCF A;  1ZQX A;  2P6U A;  1KFD A;  3TFR A;  4ACO A;  3GIK A;  2HHT A;  3BS5 A;  2WTF A;  5AKG A;  4MFA A;  4KLI A;  4KLT A;  4Q45 A;  3TAN A;  1BVS A;  5KG7 A;  4F4X A;  4ECU A;  5DG7 A;  5DDY A;  1A77 A;  2ISP A;  8ICG A;  4RNN A;  3ZI4 A;  3KKA C;  3UPQ A;  1SL1 A;  3MAB A;  3OHB A;  3SV4 A;  1DXS A;  4F2R A;  5KFO A;  1X9W A;  4CRX A;  2QB0 A;  2XGQ A;  3PV8 A;  4QZB A;  3MBY A;  4I2A A;  3F53 A;  7ICR A;  3KHG A;  2Y0S C;  2E8O A;  1RYR A;  4IR1 A;  4R63 A;  2AH5 A;  5KG6 A;  4Y2Q A;  9ICU A;  2YMP A;  2OH2 A;  3K1Z A;  4RNO A;  2E8M A;  2H3I A;  4C4S A;  1LKY B;  4IS7 A;  3TQ1 A;  1SV0 C;  4PJ0 U;  1XO0 A;  1MA7 A;  2G08 A;  2NRZ A;  5KG3 A;  5L1K A;  4F5P A;  2HMX A;  4ED3 A;  3FAH A;  4E0D A;  4BX9 C;  2WF5 A;  2F1H A;  2YML A;  9ICH A;  4DL6 A;  5AIA A;  2HVH A;  5L1I A;  2DKZ A;  1KW4 A;  2PI4 A;  4I2E A;  5DB9 A;  1NJW A;  1LVH A;  2DWQ A;  4PZN A;  5AKJ A;  5KFI A;  4DOC A;  1ZQH A;  3JPT A;  4K4I A;  5ALT A;  1L5U A;  2YY6 A;  1P7D A;  4DL2 A;  5J2B A;  4OO1 J;  1NI3 A;  4RQM A;  4PL1 A;  2MRL A;  2KJ5 A;  5KAI U;  2A1J A;  2PFQ A;  9ICW A;  2KVC A;  1JMS A;  4C7Z A;  2IOF K;  2EZY A;  4MF8 A;  4IRK A;  5EWG A;  2KZZ A;  4RPY A;  3ISB A;  5J2D A;  4KLL A;  2F8L A;  8ICQ A;  5K4L A;  1KLN A;  1TFR A;  3F5E A;  2C2D A;  2BHN A;  2V4Q A;  4PZO A;  1N48 A;  2H5X A;  1JUD A;  5KT5 A;  4KLS A;  2HHV A;  8ICX A;  1DK2 A;  1QSS A;  4YVZ A;  4QNL A;  1FFU A;  3NVZ A;  1ZRM A;  2ZIV A;  5KT4 A;  2UVR A;  3AU6 A;  3M9M B;  3MGV A;  4I2I A;  4EZ9 A;  4J9Q A;  4J9L A;  2KJ9 A;  4KLD A;  1RM6 C;  2G06 A;  4QW8 A;  1U45 A;  2ISO A;  3LVW A;  5ALI A;  1BNP A;  2G5H B;  4UBC A;  5J2G A;  2K8C B;  5DB7 A;  3J81 j;  7ICI A;  5KG5 A;  3PW2 A;  2PXI A;  7ICM A;  4J9R A;  9ICC A;  5KG4 A;  2OXO A;  1ZQD A;  5HHI A;  3EZ5 A;  4ELV A;  1LV5 A;  1QTM A;  3QXG A;  5AIB A;  4DCC A;  5J2K A;  3PML A;  5F3X B;  2F8K A;  2XY7 A;  2QAR B;  3BQ0 A;  1DGS A;  2XID A;  1NK9 A;  3ZDA A;  1F0M A;  4DWI A;  4I2G A;  2QB1 A;  4ZH4 A;  2HVI A;  4DLG A;  1IXR A;  5JRT A;  1BGX T;  3N97 B;  1U4B A;  4MEY A;  1Q46 A;  4GXI A;  2EZZ A;  3OTQ A;  1X6I A;  2OWO A;  3RF9 A;  7ICT A;  2EAO A;  2DPI A;  4KLQ A;  5EWF A;  1L3U A;  1XC9 A;  4M9H A;  1ZQV A;  1URJ A;  4B9U A;  3GIM A;  2XCP A;  1ZQI A;  4MHV A;  3SAH A;  3I76 A;  2PMZ C;  2GOL A;  5HML A;  1SKW A;  5CWR A;  3H7I A;  2FJ6 A;  4P0Q A;  3F2D A;  4UW9 A;  4R8U B;  4KLF A; 
#chains in the Genus database with same CATH homology
 4QNL A;  2DF4 B;  2G07 A;  2ZIW B;  3L3F X;  2KIC A;  3LVV A;  2KHV A;  1ED1 A;  2R18 A;  2LYB A;  2ZIV A;  2VJ4 A;  2YX8 A;  3HKZ C;  2HOQ A;  2ZIU B;  1F44 A;  4CRX A;  4AYB F;  3SMV A;  4OJO A;  2HOF A;  3MGV A;  2K4E A;  3M6K A;  1IIP A;  2ZIX A;  4GFJ A;  3C28 A;  1KBU A;  2G0A A;  3F53 A;  4IC9 A;  4BJQ A;  2KJ9 A;  3VCB A;  1NZB A;  2G5I B;  1SZH A;  4A8E A;  4JMU A;  2JGA A;  4U6P A;  3ALR A;  2Y0S C;  2LBO A;  2G06 A;  4P0Q B;  2F77 X;  3AQF A;  3NUQ A;  4O3M A;  2HBL A;  3CP8 A;  2XIC A;  3LVW A;  1WUD A;  3DEE A;  4NV0 A;  5C0Y A;  2CPR A;  2K4I A;  4QIW F;  2OYY A;  2KD1 A;  2KHQ A;  3IP4 B;  2KV2 A;  2WAQ F;  2F2A B;  2GH1 A;  3ICX A;  2OH2 A;  3K1Z A;  2JMG A;  2G5H B;  2H3I A;  2ZXH A;  3N7R C;  3D2S A;  2K8C B;  4BUG A;  2DQN B;  1XO0 A;  1MA7 A;  3CRX A;  1YT3 A;  2JH7 A;  2G08 A;  2BDU A;  2M0N A;  3KZX A;  2Y0S F;  2NV3 A;  3PSP A;  4NLB A;  2ZIV B;  4OJL A;  2D6F C;  2OXO A;  3NRW A;  2PMZ F;  3F2B A;  1Z19 A;  1CRX A;  4P0P A;  2E1F A;  5KL8 B;  2K8B B;  3RFA A;  4FZL A;  3OPX A;  1HIW A;  2K8A A;  2OM6 A;  1A0P A;  2HMX A;  2KJ8 A;  4KMO B;  2A3V A;  2KIW A;  2ZIU A;  1Q3V A;  4BX9 C;  2ZXI A;  2ZG6 A;  4NWI A;  4WJ3 B;  1TAM A;  1DRG A;  5KL1 B;  2KOB A;  2CRX A;  2KKV A;  2H3F A;  2W04 A;  2LKY A;  2H3V A;  3CYM A;  1Z1B A;  3PSF A;  1PVQ A;  4P0P B;  2K4H A;  3PST A;  2HBK A;  2RRD A;  2HBJ A;  2XID A;  4KX3 A;  4OJ5 A;  3IN5 A;  5CRX A;  3KFU F;  2VIX A;  1L6N A;  3E0F A;  2DGZ A;  2ZIX B;  4FZN A;  4FE3 A;  1D8B A;  4OJP A;  5T14 A;  2CN1 A;  2KKP A;  3H0L B;  2W03 A;  4FZM A;  4CDG A;  4QJF B;  3F5A A;  2W7P A;  1ECW A;  2K89 A;  2KNJ A;  5A0L A;  3F2C A;  2H3Z A;  2MA1 A;  2YB4 A;  3M6Z A;  2Z7J A;  3RF9 A;  2WB1 C;  3N7P D;  1P7D A;  2VKQ A;  2XI9 A;  4ICA A;  4NLC A;  4CGZ A;  3ONN A;  4OO1 J;  3D2N A;  4PL1 A;  4KX5 A;  1OUQ A;  1A6S A;  2MRL A;  2KJ5 A;  2JH1 A;  2Q4T A;  2RHF A;  3AQE A;  3D2Q A;  3PSI A;  1XNS A;  2KVC A;  3SQI A;  2XVT A;  3O0F A;  2YB1 A;  2F76 X;  3N7S C;  2WAQ C;  2H3Q A;  1PVR A;  1HEK A;  1Q3U A;  2HOI A;  3GU3 A;  5HR7 A;  4QIW C;  2HBM A;  1URJ A;  3GZF A;  4ACO A;  2LYA A;  2JHD A;  1ZQ1 C;  2KEY A;  3LYS A;  3H0M B;  5HR6 A;  1GO3 F;  4OJ6 A;  3SAH A;  2WB1 F;  3VC8 A;  2N1R A;  2W7O A;  2VJ5 A;  1UPH A;  3SAG A;  2ZIW A;  3C29 A;  1PVP A;  3AL0 B;  2F8L A;  2RP5 A;  3IG5 A;  2PMZ C;  2GOL A;  4U7C A;  3F5E A;  3T79 A;  2G09 A;  3SAF A;  3H0R B;  3PZP A;  4AYB C;  4P0Q A;  2LHT A;  3IG8 A;  4PL2 A;  2E5S A;  1T94 A;  3M7D A;  3HKZ F;  3F2D A;  2E1E A;  4C0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...