2MRLA

Backbone 1h, 13c, and 15n chemical shift assignments and nmr structure for potential drug target from burkholderia thailandensis e264
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
MDRIFMTRTEALEFLLKAHQTAVDKIGHPSHKQTPADHAAIEALDRLLLDVRARRVDQFQINASAAQIIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein BTH I2711
publication title NMR structure for potential drug target from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis e264
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.610 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2mrlA00
2MRLA
chains in the Genus database with same CATH superfamily
3AUOA 1KSPA 1TVAA 1K1QA 2LYBA 3ETRA 5EE0A 2ZIUB 1DRGA 5IINA 1ZJNA 1ZRNA 2NRWA 8ICAA 1QSLA 2FJ6A 1URJA 4UASA 5JUMA 3RRGA 3PO5A 1D8BA 2PFPA 2BCRA 3RH5A 1L3UA 4I2CA 1V9PA 2LYHA 2R18A 4IR1A 1AROP 4KLUA 3AM9A 3B0XA 2C2DA 2NRXA 2YQEA 4M9GA 5KT3A 5KG5A 1Z00A 4DFJA 8ICHA 4KN4A 2A19A 3SV3A 4I2IA 3C1YA 3HX0A 2ZIUA 3TI0A 1Y88A 2JH1A 4DQQA 1RYUA 5KAFU 5KT5A 4PH5A 4CRXA 2FI1A 3ISCA 4P2HA 4UB8U 2FLNA 5J0WA 3EZ5A 2IOFK 3PX4A 4UAUA 2KKVA 4B9UA 2VIXA 3M7DA 5ALNA 4KLSA 2QKQA 2JHDA 4O5KA 2OWOA 4YP3A 4UB2A 1SV0C 3MR3A 2IOFA 7ICLA 3IDWA 3WK7A 2D3DA 3QEBZ 4Q8FA 5ALRA 1P7DA 2BGWA 1A6SA 5JRTA 5IIKA 5HHHA 3WU2U 1BPXA 1RXVA 1U49A 5KT4A 5A0LA 5J0QA 3M6ZA 4F2RA 2E8OA 3T5LA 2BCUA 1RDFA 4I2FA 1L3VA 5HNKA 2BKEA 3BQ7A 3AL0B 4YR3A 5KFLA 4F5RA 1KW4A 2HHWA 4IQUA 1L6NA 4RQ6A 4RT3A 1ZQJA 2XCAA 5KFZA 5KFJA 4GC6A 2EZYA 2ODGA 3E58A 2KZ3A 2Y0SF 3L4PA 4Z6CA 1BNOA 3RJJA 4DQIA 4Z6DA 4TUQA 3LK9A 3T5KA 1TE2A 2HBJA 2Y1JA 1NKEA 1ZD4A 3UXNA 3WK6A 2WF8A 2LM4A 5E79U 2OYYA 4JUZA 1TAUA 4DL5A 1ZQFA 2XO7A 4P4PA 4QWCA 2K89A 1JX4A 2GH1A 3C5GA 3F5EA 1JMSA 4BUGA 3GU3A 5ALKA 3L5KA 5KFWA 3JPQA 4OJ5A 1L3TA 4YQWA 3FDSA 2N1RA 2NRZA 1ZQWA 3ONNA 1S97A 4QZIA 2HMXA 2R8GA 3WKEA 3PR5B 4QNLA 2UVWA 3QU5A 4WJ3B 4C4SA 1NZPA 5AI6A 2LM1A 4ECTA 1A0PA 4Y2PA 4DSFA 2KP7A 4ELUA 1ZQDA 1B0XA 1L7NA 5B5EU 2KZMA 5ALOA 2KICA 2ZIXB 4QJFB 4F4ZA 3CYMA 5HMMA 1XSPA 4M47A 4CF5A 4B9NA 4YCXA 4NXZA 4RQNA 5KFFA 1JN3A 1U48A 2KHVA 2PMZF 4PHPA 2K4EA 5KAIU 4I2AA 2R8IA 4DLGA 2HHUA 3KKAC 2DUYA 1NKCA 3KHRA 1NOMA 2KIVA 2NV3A 1SZHA 3GFKB 3OGUA 7ICQA 2ES6A 3A0HU 4YXMA 4NJ8A 1N63A 1UA0A 3LVWA 1OW5A 2XIDA 2CN1A 4DS4A 4Q8EA 8ICFA 4NLNA 2ZIXA 1C7YA 4J9MA 1DGJA 4ACOA 5DDMA 1A77A 1PK1A 2WF7A 2VKQA 2KTQA 2W54A 3MGIA 1UQVA 2ALZA 4DSEA 3IRUA 2RDJA 1ZJMA 1TFRA 5DBAA 9ICPA 2HVHA 3ZD9A 2H3IA 4ECXA 2YMLA 1FIQA 2RHFA 4RQ1A 4DO9A 2VJ5A 3EWAA 5DQGA 1AQ6A 3H8SA 4ED2A 3SEIA 2MSNA 3AU2A 2W43A 2HSZA 1L5UA 3TACB 5J2EA 3K75D 2G08A 1YZ7A 1B22A 2FE9A 4C8LA 4RQMA 4RQ5A 5J8YC 4IR9A 3KZIU 3TQ1A 5G5HA 4BDPA 5KFSA 1ZQCA 3RB0A 3Q8MA 1FFVA 3UPQA 3PW4A 2PKEA 2B6GA 1UA1A 4RQ0A 4RT2A 1Z4NA 4P0QA 9ICKA 2KV2A 2PI4A 2WF5A 3K4GA 3C2KA 4O3QA 2JEJA 1Q3UA 3TADA 5AK5A 3AQEA 1KKXA 1L3SA 4PHEA 4CCHA 1NK7A 1DK3A 3BQ2A 4O3SA 1XO1A 4RZRA 5AKEA 1ZQRA 2ZTCA 2AJQA 1NZBA 2WAQC 1NJZA 3GV8B 2AQ0A 3MGVA 3R9KA 5CJ7A 8ICYA 4UAZA 4RQ3A 3OSNA 7ICGA 1L8OA 3QXGA 2ZTDA 4IRCA 3RJIA 2JEFA 1KFTA 3IHQB 4I2HA 9ICAA 1RG6A 2O6KA 3AN1A 3UQ2A 7ICNA 3BS7A 1XSNA 3C21A 5AI8A 4YFKA 3IP4B 2BCVA 4YMMA 4DQRA 4FS1A 2ZJ8A 3PSIA 5BOLA 4CE6A 4PL1A 1ZXIA 4XUSA 3BZCA 2J6UA 3SMVA 1Q3VA 2RP5A 3C1ZA 5AI5A 4F5OA 1S0VA 4F4XA 2KD1A 4KITB 4ZOHC 2LKYA 3HILA 5L1MA 4R64A 1SKSA 2LI6A 1ZQMA 9ICTA 3GDXA 3BQ1A 5J0TA 5AM3A 1DXSA 5AKLA 4NM1A 3G6VA 1U4BA 4EEYA 2ZUCA 3D2SA 4JWNA 4O3OA 1TKDA 4KLEA 3GV7B 4DQSA 5ALGA 5D4BA 5TISU 2CPRA 1S0OA 2W7OA 3KHLA 4A8EA 4I2BA 3N28A 2W9AA 1XC9A 4TQSA 4NL9A 4B9SA 5IIIA 4J03A 8ICLA 2A3VA 4EENA 3GZFA 3NUQA 4IQTA 3EW9A 2JRZA 1F0MA 2WTFA 2V4QA 3RH6A 1KEJA 2K4HA 3PW5A 1JXEA 2YN4A 3SYZA 3KHHA 3I28A 2HBLA 3B9JA 2F77X 4K4GA 3U26A 1ZQPA 5DBCA 1N62A 5KFRA 5KT6A 2E5SA 5J8YA 4DL6A 3RBDA 1XSLA 4KX5A 5KG1A 4J9OA 4Q44A 4UAWA 4I28A 4UBCA 1NJYA 3RB6A 1RPLA 4KX3A 3ED5A 1ZQYA 2LMRA 3VC8A 8ICPA 4IQVA 1WCLA 3V6HA 3WK9A 2JMGA 1BVSA 3GIJA 3FC4A 4QZ8A 3EUB2 4Y2TA 2DKXA 3ETLA 5AI4A 2J6TA 1B43A 2WB1C 4QW8A 5AM4A 1SWVA 5KFXA 1KFSA 2ZUDA 1SKRA 3LWMA 3J81j 2Y9UA 2RDIA 3G6YA 4LJXA 5KFKA 4QW9A 4UB6U 1ZQOA 1ZD3A 5CR0A 4FZMA 5L1LA 1QQ7A 4B9MA 2KE7A 4ECQA 5KG6A 5J0RA 2Y9TA 1JROA 1TK8A 1X9XA 2I6XA 3VCBA 2W8KA 2BZFA 2DKZA 4EBDA 2FLLA 1SZPA 3RR8A 5CA7A 5KNIA 4MHVA 4QWEA 5KFGA 3MR6A 4J9QA 3F2DA 5KG4A 2V9WA 1JRPA 2R8HA 4BX9C 5ALQA 1Z00B 3QZ8A 1TK5A 3EPGA 2XICA 1X2IA 1TV9A 7ICOA 2F1HA 4HAIA 2F76X 3GIIA 9ICWA 4F92B 4C4RA 3ISBA 4OJOA 3AMZA 2ISOA 2MAXA 2KK0A 9ICCA 2OCEA 4ECWA 5J2CA 3JPNA 5KG0A 3HWTA 3UXOA 1KFDA 4M9HA 3MR2A 4UB5A 5GTIU 2YTUA 4DCCA 4RUCA 1L7OA 2DWQA 7ICEA 5F9LA 4NLBA 9ICJA 2HOQA 1ZQUA 1NK6A 8ICEA 3SD7A 3ISDA 1HUZA 4O5CA 3M8RA 7ICUA 1QSYA 5KG7A 4I29A 2H3QA 3Q8LA 4DOCA 4Y2UA 2F1JA 1SB3C 4FBTA 5AKHA 1Z1VA 4OD0A 4UAVA 2H3VA 4ED7A 4FZNA 1QCKA 3QUTA 4ZH4A 1ED1A 2KMDA 5AI0A 5HP4A 8ICKA 1OUQA 3WKAA 1ZQEA 2HHXA 4C0ZA 1IG6A 4IL6U 4CNQA 2HOIA 1PZNA 2W11A 4MF8A 5ALSA 4QZBA 4DS5A 1JI7A 3H8JA 9ICLA 2VA3A 3KHGA 1WCNA 4ELVA 3MFHA 8ICWA 1KRPA 4NM2A 1N56A 4KLTA 2WFAA 1F44A 5DB9A 1KTQA 2OEHA 4QWDA 7ICKA 9ICRA 3TANA 3AEVA 4YG2A 4YR2A 3WK5A 5ALEA 5AKZA 2YY6A 1ZOLA 1KL9A 5ALLA 4M2YA 1KN5A 4LZGA 3BJYA 5DBBA 4DSIA 1T94A 2D6FC 2PI5A 2W8LA 1RXWA 2NRTA 1TAQA 1IM4A 5EWGA 1Z4OA 1XWLA 3WKCA 2EQYA 5J2HA 4BWJA 3GIKA 4B6JA 1XO0A 2K8CB 4UATA 4AYBC 3HKZF 5ALPA 8ICUA 4YD1A 4NWIA 5DG9A 5L1KA 5J0UA 2BR0A 2E1EA 2YB1A 3ZI4A 1VJ5A 5KFIA 3Q8KA 3H7IA 1UT5A 3F2BA 3HPOA 4KMUA 1BPYA 3H0LB 3IG5A 1KBUA 5DG8A 5J2BA 4ED1A 1X40A 2YMPA 4JV0A 4NLGA 1IV8A 3OJSA 3M9OB 4ECSA 4G3IA 5IIMA 4DL7A 8ICVA 1UHUA 1TAMA 3RB4A 4HYKA 5JTIA 3NTUA 2C2EA 1ZQ1C 1PK1B 3KBBA 3OHBA 1PVRA 9ICSA 8ICRA 1QTMA 2R8JA 4RNOA 3TAQA 1X6IA 2FPKA 3QYPA 2BQUA 1JALA 3BDPA 3RB3A 1N2XA 3LDAA 3F5AA 3NRWA 4M9JA 2KG5A 7ICMA 5HR7A 2OH2A 2C28A 5KFCA 3RJGA 1MA7A 4C7ZA 1SWWA 5IIJA 3OTQA 2YMMA 2VANA 1T3NA 1ZQNA 1ZQSA 5L1IA 1SV0A 5J2KA 1NK0A 3F2CA 2ZTEA 8ICSA 4FZLA 4JV2A 3RH4A 1RQLA 4KLLA 1PUZA 4J9SA 1ZRMA 5KT2A 4QZHA 3IM1A 4P0QB 4O3NA 3HW8A 2KZZA 3H40A 2LPEA 4MEYA 9ICVA 2J6SA 2WB1F 1HIWA 8ICQA 1HUOA 1L7PA 3CW2C 1A76A 4E0DA 2P35A 2HI0A 4DFDA 3RJHA 5ALTA 2QLTA 4EBEA 2LHTA 2ZG6A 1ZQLA 4US9A 1DOQA 2DL0A 1S5LU 7ICTA 2HBMA 1V97A 4EX6A 2DQNB 1N5WA 1BNPA 4DQPA 2MU2A 3PY8A 1K5OA 4EZ6A 3V7KA 8ICIA 5DB8A 4I2JA 5ALWA 3S6JA 4FO6A 3PO4A 1ZD5A 3ZDBA 5ALIA 1NKBA 5D46A 4UB4A 2VJ4A 2RRDA 1X9WA 2G06A 4DL3A 4F4WA 4OCZA 5AHXA 4OJ6A 5AM2A 3M1YA 3TKAA 4JK1A 8ICNA 3FM9A 4CDGA 3WK4A 5IIOA 4C8MA 8ICCA 2EZZA 3QU9A 4B9LA 2FDRA 2HCFA 2K4PA 2DF4B 4MFAA 5KFPA 2KN7A 5EE1A 1JUDA 3GIMA 5BPCA 3OSPA 3QUCA 3RTVA 2W9CA 5GTHU 7ICPA 4R8UB 3M9MB 2ASLA 9ICXA 1ZQAA 1PVPA 2RLTA 4J9KA 2F8LA 3H4DA 3OPXA 9ICNA 4KLFA 7ICJA 2Y0SC 2JV3A 5DB6A 4DF8A 5KG2A 3KKAA 2HOFA 5KTQA 1FO4A 4IQWA 3RF9A 4EYIB 3E0FA 2KJ9A 2V4RA 5H2FU 1WYGA 8ICMA 4UARA 5CRXA 4MF2A 1PVQA 3GV5B 4DOAA 5DLFA 4UBBA 2K8AA 4O3PA 4YN4A 3RR7A 4C80A 1Z3EB 1KDHA 1COOA 2QARB 2KJ8A 3H8WA 4F5QA 4R8UA 2F2AB 4Z6EA 2XGQA 5L9XA 4GC7A 4PGXA 5EWEA 1UCVA 4QWBA 3SAGA 4RQ7A 2E8PA 3DEEA 4F71A 4TQRA 4J9RA 2EAPA 4YVZA 2C2RA 4ECVA 3TARA 4F5NA 4F4YA 2DPIA 4KLDA 3ZDEA 2CXYA 1BPZA 3ORYA 1WUDA 3TFRA 1D8LA 4EZ9A 4JWMA 4TUSA 3ZD8A 2P6RA 2MUTB 5DG7A 5C0YA 2HW3A 2HDOA 3NS1A 1SKWA 4QZFA 1N5XA 4BGDA 2M0NA 2LBOA 2ISPA 2JGAA 3SV4A 1CI4A 5KG3A 2ESEA 4CF4A 2QARA 4GXKA 1T7PA 2E8NA 3MABA 1ZQZA 4PPXA 5KFDA 4RNNA 4KLIA 3MFIA 1U45A 2EDUA 3MGHA 3I76A 1CUKA 1YZ6A 2BCQA 2HHTA 1ZD2P 3E2EA 4JB3A 4DOBA 5AI9A 2MUTA 4J9LA 1KQQA 3WK8A 4DLEA 4GLXA 8ICZA 2BDUA 4YD2A 1GO3F 3MBYA 7ICRA 4I2DA 3ZDCA 4O3MA 4K4IA 1ZETA 1Z1BA 2G0AA 1LB2B 2KFZA 2KJ5A 3KZXA 5J0OA 5ALVA 2DGZA 9ICQA 4RQ8A 2BDPA 8ICOA 3FAHA 3M9NB 5D49A 3SR6A 2ZIVB 3MDAA 4I27A 1NK9A 1S0MA 4XRHA 4C8KA 9ICIA 3RFAA 3T5HA 4BJQA 3V6JA 9ICGA 3PZPA 3OHAA 1QSSA 5AKYA 1ZQKA 4O5EA 1BPDA 5K4LA 4ECRA 3QNMA 9ICFA 2W9BB 1ZQIA 1JIHA 1SXEA 4QZEA 3NGDA 1PK3A 3SAHA 1X42A 5KFQA 4P4MA 2W3SA 2IOHA 1FFUA 4IC9A 3V72A 4KLJA 3QU4A 1T4GA 2Q0ZX 3RRHA 5ALFA 2JZBA 4UB1A 4EYHB 1UPHA 3HT3A 2UVRA 2UVUA 5DDYA 4QIWC 1O03A 2XY5A 3T79A 3H0RB 4YXJA 3SQIA 2IHMA 2DBYA 1LKYB 4PZNA 3RAXA 2H3ZA 3D6JA 2E8MA 8ICGA 3QU7A 2ZIVA 2W3RA 2D8CA 1ZQTA 2BQ3A 5KFUA 3BQTA 4F72A 3SAFA 4TURA 1X9SA 2FPMA 4F50A 3PSPA 2F8KA 1L7MA 2W9BA 3GQCA 4KLQA 5DB7A 2PFQA 4RQ4A 2GWSA 2VA8A 4IRKA 2EH9A 2WF9A 2YMQA 4DL4A 2B21A 1N48A 2EZXA 1MC8A 3C2LA 4M6WB 4Y2SA 5IILA 4KMOB 2I1QA 2IA6A 4OJPA 4Y2QA 4P0PB 8ICTA 3PV8A 2I5HA 7ICHA 4DL2A 5KFVA 5J0PA 2C22A 4UAYA 4MFCA 2XI9A 4PHAA 5F9NA 3IG8A 1LKYA 3L3FX 1OXJA 1Q8KA 3THVA 3H8MA 3RAQA 9ICBA 3OJUA 4BXOB 2VA2A 5J2AA 2NO5A 1ZYQA 5C5JA 2XC9A 3NVZA 2K8BB 3MR5A 3NVYA 2ASDA 3O0FA 5AK3A 3M8SA 3V7LA 3ZDAA 5KFBA 4AP9A 2F3NA 1IIPA 5KFYA 4F3OA 5B66U 2YB4A 5EE9A 4M6WA 1V85A 1D8YA 4NY8A 2FPLA 4P0PA 4GFJA 4ED0A 4EX7A 3PVXA 2XCPA 3MC1A 1SXDA 3IV6A 2ZXIA 4FE3A 3RJEA 5AKXA 3UMCA 1J2MA 1O08A 2UVVA 1BPBA 2PXIA 2W03A 3NVVA 5DGAA 3PMLA 4BXOA 5JU5A 4Q45A 5J2GA 4J9PA 3C5FA 2JEIA 5HMLA 5TZVA 2WF6A 3JPRA 2I9GA 2WAQF 2F44A 4C8OA 1V38A 2G07A 1RZTA 3UXPA 1ZQGA 4U7CA 3JPPA 5F3XB 1JXLA 3JPSA 1RQNA 1QQ6A 4O3RA 1ZQXA 5AM1A 4Y2RA 3ICXA 4EBCA 2ZIWB 4PGQA 1QLNA 5KT7A 3PR4A 4I2GA 3T3FA 7ICVA 2BCSA 3ZDDA 5CWRA 1NJXA 5ALHA 4XA5A 4PGYA 2KVCA 2HVIA 2G5HB 2H3FA 3KOOA 3JPOA 3SI8A 3QX7A 4RPYA 4GXJA 2PFOA 4KLHA 4C4TA 4X5VA 1S77D 4KLGA 3HP6A 1ZQHA 2BPFA 1ZQVA 4FFDA 1SL2A 2G09A 3PMNA 1DK2A 4DSKA 2OHFA 5KFTA 2ATLA 5KFEA 5FP0A 4OJLA 1X9MA 5AM0A 2NO4A 5DGBA 4PHDA 2CRXA 2ZIWA 2HHQA 3QU2A 2MA1A 3TADC 2ZJAA 3GILA 1RM6C 3N7PD 4KN7A 7ICIA 3JPTA 2EANA 4IS7A 4PJ0U 3LYSA 4ED8A 3V6KA 2P6UA 4M9NA 2QB1A 4Z6FA 8ICJA 2W9MA 2G5IB 1X66A 5J2DA 3PSTA 1S0NA 1TK0A 4ED3A 2AXTU 2HBKA 5T14A 4MEXA 2KSOB 4R63A 1UT8A 2FMPA 3PW0A 2WHEA 1HEKA 4QZAA 4BWMA 2AU0A 4R66A 3ALRA 3Q8RB 1KLNA 5DQHA 1HJPA 2XGPA 3EYZA 3PX0A 3D2QA 1NI3A 4Y2JA 3NASA 2YX8A 4KLMA 1NK8A 8ICBA 1RYRA 1FEZA 4B9TA 2NRVA 2H5XA 4GIBA 3K1RB 1B4FA 4G9BA 2JR5A 1NK4A 3HJEA 5G5GA 3N4MB 4F93B 3QUQA 3H4BA 5AIAA 5KFMA 2KEYA 2KSOA 4F2SA 4QZDA 1S8OA 4PL2A 1DGSA 2K4IA 3AU6A 3AQFA 4TUPA 4FS2A 4CF3A 3EPIA 3V7JA 5J0YA 1D9DA 5KFNA 2KFNA 2JXJA 3BQ0A 2Q4TA 4F8RA 4O0IA 1N60A 4NL9C 1H38A 2KVSA 2KOBA 4C8NA 3QZ7A 5J2JA 3PW2A 3UMBA 5J0SA 1EXNA 2BHNA 4LVSA 5AKIA 5L1JA 3C29A 2AGPA 4ED6A 1ECWA 4O9MA 2EAMA 4ICAA 5J0XA 5CP2A 4NV0A 4DFKA 2A1AA 3N7RC 2FMSA 4DF4A 4F4KA 2W9CB 3NRZA 5AK6A 4Q43A 1T8EA 4QIWF 2NYVA 5KL1B 5ALZA 4US8A 1RYSA 1LV5A 1F5SA 3SENA 3BS5B 1BPEA 4P4OA 1T3QA 2RQ5A 1WWVA 1VDVA 2IMWP 4M0AA 4DEZA 1SL0A 2AHOB 1ZQBA 3DDHA 5BOMA 2P66A 4RUAA 3C2MA 4RPZA 7ICFA 3N97B 3CRXA 4DSLA 4I2EA 3K1ZA 4YR0A 2QB0B 2ZJ5A 1SIJA 5ALJA 3NVWA 2PFNA 2DFLA 3WKBA 5J2IA 2IBKA 1N61A 2KHQA 4ECYA 3BZKA 3TFSA 3I1YA 1S10A 2GO7A 3H0MB 2B0CA 1WWUA 3B0YA 4UQGA 3QE9Y 2Y1IA 1MQ3A 1SV4A 4YMNA 4DFMA 5ALDA 3BS5A 4F91B 4QZ9A 4GXIA 3SZ2A 4QZCA 9ICMA 1C20A 2BPGA 4IRDA 3FYHA 5DLGA 2BPCA 1YT3A 3F53A 2Z7JA 9ICOA 2DPJA 5AK4A 4NLKA 2AGOA 4Y2YA 4Y2XA 1X6JA 2AH5A 4RQ2A 3Q8SB 5J2FA 3Q8PB 3RJFA 4M04A 1MN8A 2QB0A 3DV9A 3A0BU 2W7PA 2KNJA 4U6PA 5AKGA 5CEHA 4ECUA 2W55A 2FMQA 1K1SA 2M9NA 5EWFA 4KLOA 1CEZA 1S9FA 3Q8QB 2IHNA 3LWLA 1MQ2A 4UW9A 3HKZC 5AKJA 2F1IA 2GLEA 5KFAA 2A1JB 1U47A 4MFFA 2HHSA 4B9VA 4NLCA 5HR6A 5KL8B 3N7SC 1VLBA 4OO1J 3KTQA 2FLPA 5DKWA 4M9LA 1Q46A 3HRDD 1ZQQA 5ALXA 2XVTA 3RJKA 5EE3A 3MDCA 3QUBA 2XY6A 4PZOA 1NJWA 5KFHA 2HHVA 5ALYA 2EAOA 1CRXA 5CB1A 5DQIA 4DSJA 2MRLA 1M6YA 4JMUA 1QQ5A 3C23A 3G6XA 3RBEA 1Z19A 2K60A 2A1JA 2PMZC 2KIWA 2OM6A 4YMOA 4K4HA 4C7YA 1L8LA 2JEGA 2W04A 2ASJA 2BQRA 4RU9A 1MSWD 4Y2VA 2E1FA 3CNHA 2OXOA 2GOLA 5CHGA 2ZUBA 4DFPA 5ALUA 4AYBF 3PNCA 9ICEA 4UB3A 3T5JA 5EOZA 3TAPA 2JZBB 5AKKA 4EEKA 2JH7A 4ELTA 2XY7A 1LVHA 5AICA 9ICHA 4USAA 1NNLA 3M6KA 3PW7A 1SL1A 3QEAZ 3CP8A 1WG8A 5ALMA 3IN5A 4FBUA 5KFOA 3D2NA 4ECZA 5J29A 3UQ0A 4JV1A 2L5YA 4R65A 2R8KA 1U9LA 1IXRA 4QWAA 3WKDA 4XQ8A 3UM9A 1J97A 4RNMA 5AM5A 1XU4A 9ICUA 3KFUF 1NK5A 4CGZA 3LVVA 2AQ4A 5AIBA 1QH9A 1J2NA 2LYAA 4LZDA 1S76D 4J9NA 7ICSA 4EELA 1XNSA 1XS9D 4NLZA 4DWIA 8ICXA 1COKA 2E3TA 3PX6A 4F5PA 5HHIA 1D9FA 3PSFA 2AGQA 1SGGA 4KTQA 2ZXHA 3C28A 3KD3A 3UMGA 2KKPA 4RPXA 1BGXT 4QZGA
chains in the Genus database with same CATH topology
3CYMA 1Z19A 3D2QA 1P7DA 2KHQA 1A6SA 4FZMA 2E1EA 2KVCA 2HOFA 2XI9A 2YB1A 2BDUA 2G5HB 2YX8A 2H3FA 3H0MB 2PMZC 1GO3F 2KIWA 2OM6A 3RF9A 4O3MA 3IG8A 3D2SA 2H3VA 3E0FA 2KJ9A 2LYBA 5A0LA 3VCBA 3F2BA 3H0LB 3L3FX 3M6ZA 3IG5A 4FZNA 2ZIUB 4P0QA 2G0AA 1Z1BA 1KBUA 1DRGA 1ED1A 2CPRA 2KJ5A 2W7OA 2KV2A 3KZXA 1OUQA 5CRXA 2W04A 2KHVA 2DGZA 2LHTA 2PMZF 4A8EA 2ZG6A 1PVQA 2K4EA 3AL0B 1URJA 4NWIA 2E1FA 4C0ZA 2OXOA 2GOLA 1Q3UA 2ZIVB 2HBMA 2K8AA 2HOIA 1D8BA 2DQNB 2KEYA 2K8BB 3AQEA 3F2DA 1L6NA 2G09A 3RFAA 1YT3A 4BJQA 2A3VA 1TAMA 2KJ8A 2K4IA 3F53A 3GZFA 3NUQA 2Z7JA 3O0FA 4PL2A 2F2AB 3AQFA 2NV3A 2R18A 3PZPA 1SZHA 1ZQ1C 2Y0SF 2K4HA 4OJLA 1PVRA 2JH7A 1IIPA 2XICA 1NZBA 2WAQC 2Q4TA 3LVWA 3SAGA 2ZIWA 2XIDA 3DEEA 2CN1A 2HBLA 3M6KA 2YB4A 2F77X 2HBJA 2MA1A 2F76X 2VJ4A 2KOBA 3CP8A 2RRDA 2KNJA 3MGVA 2W7PA 3IN5A 2ZIXA 3SAHA 4U6PA 1F44A 3N7PD 4P0PA 2G06A 4GFJA 4ACOA 3D2NA 2E5SA 4IC9A 4BX9C 2OYYA 3C29A 1ECWA 4OJ6A 4OJOA 1WUDA 3LYSA 4ICAA 2VKQA 2ZXIA 4FE3A 4KX5A 4NV0A 1UPHA 3HKZC 5C0YA 4CDGA 2ZIUA 4QIWC 2JH1A 2K89A 3F5AA 2GH1A 3N7RC 3T79A 3NRWA 3H0RB 3F5EA 4CRXA 3SQIA 5HR7A 2W03A 2OH2A 3KFUF 4KX3A 2M0NA 2LBOA 2G5IB 2H3ZA 1MA7A 2JGAA 4BUGA 2ZIVA 4QIWF 3VC8A 3GU3A 3PSTA 1T94A 3IP4B 4CGZA 5KL1B 2H3IA 2D6FC 2DF4B 3LVVA 4NLCA 5HR6A 4OJ5A 5KL8B 2RHFA 3N7SC 2HBKA 2JMGA 2VJ5A 3SAFA 4OO1J 3PSIA 2LYAA 2N1RA 2WAQF 5T14A 4PL1A 3F2CA 4FZLA 1XNSA 2CRXA 4P0PB 2G07A 3ONNA 3SMVA 3PSPA 2XVTA 4AYBF 4NLBA 2HMXA 2HOQA 4U7CA 1Q3VA 2KKVA 4QNLA 2VIXA 3M7DA 4WJ3B 2RP5A 1PVPA 1HEKA 2F8LA 1A0PA 3OPXA 2JHDA 1XO0A 2G08A 3PSFA 3CRXA 2WB1C 2KD1A 2ZXHA 2K8CB 3C28A 4AYBC 1CRXA 4P0QB 2LKYA 3HKZF 3ICXA 3K1ZA 3ALRA 2ZIWB 2KKPA 2Y0SC 2MRLA 4KMOB 2KICA 2H3QA 2ZIXB 4JMUA 4OJPA 2WB1F 4QJFB 1HIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRL A; 
#chains in the Genus database with same CATH topology
 3AUO A;  1KSP A;  1TVA A;  1K1Q A;  2LYB A;  3ETR A;  5EE0 A;  2ZIU B;  1DRG A;  5IIN A;  1ZJN A;  1ZRN A;  2NRW A;  8ICA A;  1QSL A;  2FJ6 A;  1URJ A;  4UAS A;  5JUM A;  3RRG A;  3PO5 A;  1D8B A;  2PFP A;  2BCR A;  3RH5 A;  1L3U A;  4I2C A;  1V9P A;  2LYH A;  2R18 A;  4IR1 A;  1ARO P;  4KLU A;  3AM9 A;  3B0X A;  2C2D A;  2NRX A;  2YQE A;  4M9G A;  5KT3 A;  5KG5 A;  1Z00 A;  4DFJ A;  8ICH A;  4KN4 A;  2A19 A;  3SV3 A;  4I2I A;  3C1Y A;  3HX0 A;  2ZIU A;  3TI0 A;  1Y88 A;  2JH1 A;  4DQQ A;  1RYU A;  5KAF U;  5KT5 A;  4PH5 A;  4CRX A;  2FI1 A;  3ISC A;  4P2H A;  4UB8 U;  2FLN A;  5J0W A;  3EZ5 A;  2IOF K;  3PX4 A;  4UAU A;  2KKV A;  4B9U A;  2VIX A;  3M7D A;  5ALN A;  4KLS A;  2QKQ A;  2JHD A;  4O5K A;  2OWO A;  4YP3 A;  4UB2 A;  1SV0 C;  3MR3 A;  2IOF A;  7ICL A;  3IDW A;  3WK7 A;  2D3D A;  3QEB Z;  4Q8F A;  5ALR A;  1P7D A;  2BGW A;  1A6S A;  5JRT A;  5IIK A;  5HHH A;  3WU2 U;  1BPX A;  1RXV A;  1U49 A;  5KT4 A;  5A0L A;  5J0Q A;  3M6Z A;  4F2R A;  2E8O A;  3T5L A;  2BCU A;  1RDF A;  4I2F A;  1L3V A;  5HNK A;  2BKE A;  3BQ7 A;  3AL0 B;  4YR3 A;  5KFL A;  4F5R A;  1KW4 A;  2HHW A;  4IQU A;  1L6N A;  4RQ6 A;  4RT3 A;  1ZQJ A;  2XCA A;  5KFZ A;  5KFJ A;  4GC6 A;  2EZY A;  2ODG A;  3E58 A;  2KZ3 A;  2Y0S F;  3L4P A;  4Z6C A;  1BNO A;  3RJJ A;  4DQI A;  4Z6D A;  4TUQ A;  3LK9 A;  3T5K A;  1TE2 A;  2HBJ A;  2Y1J A;  1NKE A;  1ZD4 A;  3UXN A;  3WK6 A;  2WF8 A;  2LM4 A;  5E79 U;  2OYY A;  4JUZ A;  1TAU A;  4DL5 A;  1ZQF A;  2XO7 A;  4P4P A;  4QWC A;  2K89 A;  1JX4 A;  2GH1 A;  3C5G A;  3F5E A;  1JMS A;  4BUG A;  3GU3 A;  5ALK A;  3L5K A;  5KFW A;  3JPQ A;  4OJ5 A;  1L3T A;  4YQW A;  3FDS A;  2N1R A;  2NRZ A;  1ZQW A;  3ONN A;  1S97 A;  4QZI A;  2HMX A;  2R8G A;  3WKE A;  3PR5 B;  4QNL A;  2UVW A;  3QU5 A;  4WJ3 B;  4C4S A;  1NZP A;  5AI6 A;  2LM1 A;  4ECT A;  1A0P A;  4Y2P A;  4DSF A;  2KP7 A;  4ELU A;  1ZQD A;  1B0X A;  1L7N A;  5B5E U;  2KZM A;  5ALO A;  2KIC A;  2ZIX B;  4QJF B;  4F4Z A;  3CYM A;  5HMM A;  1XSP A;  4M47 A;  4CF5 A;  4B9N A;  4YCX A;  4NXZ A;  4RQN A;  5KFF A;  1JN3 A;  1U48 A;  2KHV A;  2PMZ F;  4PHP A;  2K4E A;  5KAI U;  4I2A A;  2R8I A;  4DLG A;  2HHU A;  3KKA C;  2DUY A;  1NKC A;  3KHR A;  1NOM A;  2KIV A;  2NV3 A;  1SZH A;  3GFK B;  3OGU A;  7ICQ A;  2ES6 A;  3A0H U;  4YXM A;  4NJ8 A;  1N63 A;  1UA0 A;  3LVW A;  1OW5 A;  2XID A;  2CN1 A;  4DS4 A;  4Q8E A;  8ICF A;  4NLN A;  2ZIX A;  1C7Y A;  4J9M A;  1DGJ A;  4ACO A;  5DDM A;  1A77 A;  1PK1 A;  2WF7 A;  2VKQ A;  2KTQ A;  2W54 A;  3MGI A;  1UQV A;  2ALZ A;  4DSE A;  3IRU A;  2RDJ A;  1ZJM A;  1TFR A;  5DBA A;  9ICP A;  2HVH A;  3ZD9 A;  2H3I A;  4ECX A;  2YML A;  1FIQ A;  2RHF A;  4RQ1 A;  4DO9 A;  2VJ5 A;  3EWA A;  5DQG A;  1AQ6 A;  3H8S A;  4ED2 A;  3SEI A;  2MSN A;  3AU2 A;  2W43 A;  2HSZ A;  1L5U A;  3TAC B;  5J2E A;  3K75 D;  2G08 A;  1YZ7 A;  1B22 A;  2FE9 A;  4C8L A;  4RQM A;  4RQ5 A;  5J8Y C;  4IR9 A;  3KZI U;  3TQ1 A;  5G5H A;  4BDP A;  5KFS A;  1ZQC A;  3RB0 A;  3Q8M A;  1FFV A;  3UPQ A;  3PW4 A;  2PKE A;  2B6G A;  1UA1 A;  4RQ0 A;  4RT2 A;  1Z4N A;  4P0Q A;  9ICK A;  2KV2 A;  2PI4 A;  2WF5 A;  3K4G A;  3C2K A;  4O3Q A;  2JEJ A;  1Q3U A;  3TAD A;  5AK5 A;  3AQE A;  1KKX A;  1L3S A;  4PHE A;  4CCH A;  1NK7 A;  1DK3 A;  3BQ2 A;  4O3S A;  1XO1 A;  4RZR A;  5AKE A;  1ZQR A;  2ZTC A;  2AJQ A;  1NZB A;  2WAQ C;  1NJZ A;  3GV8 B;  2AQ0 A;  3MGV A;  3R9K A;  5CJ7 A;  8ICY A;  4UAZ A;  4RQ3 A;  3OSN A;  7ICG A;  1L8O A;  3QXG A;  2ZTD A;  4IRC A;  3RJI A;  2JEF A;  1KFT A;  3IHQ B;  4I2H A;  9ICA A;  1RG6 A;  2O6K A;  3AN1 A;  3UQ2 A;  7ICN A;  3BS7 A;  1XSN A;  3C21 A;  5AI8 A;  4YFK A;  3IP4 B;  2BCV A;  4YMM A;  4DQR A;  4FS1 A;  2ZJ8 A;  3PSI A;  5BOL A;  4CE6 A;  4PL1 A;  1ZXI A;  4XUS A;  3BZC A;  2J6U A;  3SMV A;  1Q3V A;  2RP5 A;  3C1Z A;  5AI5 A;  4F5O A;  1S0V A;  4F4X A;  2KD1 A;  4KIT B;  4ZOH C;  2LKY A;  3HIL A;  5L1M A;  4R64 A;  1SKS A;  2LI6 A;  1ZQM A;  9ICT A;  3GDX A;  3BQ1 A;  5J0T A;  5AM3 A;  1DXS A;  5AKL A;  4NM1 A;  3G6V A;  1U4B A;  4EEY A;  2ZUC A;  3D2S A;  4JWN A;  4O3O A;  1TKD A;  4KLE A;  3GV7 B;  4DQS A;  5ALG A;  5D4B A;  5TIS U;  2CPR A;  1S0O A;  2W7O A;  3KHL A;  4A8E A;  4I2B A;  3N28 A;  2W9A A;  1XC9 A;  4TQS A;  4NL9 A;  4B9S A;  5III A;  4J03 A;  8ICL A;  2A3V A;  4EEN A;  3GZF A;  3NUQ A;  4IQT A;  3EW9 A;  2JRZ A;  1F0M A;  2WTF A;  2V4Q A;  3RH6 A;  1KEJ A;  2K4H A;  3PW5 A;  1JXE A;  2YN4 A;  3SYZ A;  3KHH A;  3I28 A;  2HBL A;  3B9J A;  2F77 X;  4K4G A;  3U26 A;  1ZQP A;  5DBC A;  1N62 A;  5KFR A;  5KT6 A;  2E5S A;  5J8Y A;  4DL6 A;  3RBD A;  1XSL A;  4KX5 A;  5KG1 A;  4J9O A;  4Q44 A;  4UAW A;  4I28 A;  4UBC A;  1NJY A;  3RB6 A;  1RPL A;  4KX3 A;  3ED5 A;  1ZQY A;  2LMR A;  3VC8 A;  8ICP A;  4IQV A;  1WCL A;  3V6H A;  3WK9 A;  2JMG A;  1BVS A;  3GIJ A;  3FC4 A;  4QZ8 A;  3EUB 2;  4Y2T A;  2DKX A;  3ETL A;  5AI4 A;  2J6T A;  1B43 A;  2WB1 C;  4QW8 A;  5AM4 A;  1SWV A;  5KFX A;  1KFS A;  2ZUD A;  1SKR A;  3LWM A;  3J81 j;  2Y9U A;  2RDI A;  3G6Y A;  4LJX A;  5KFK A;  4QW9 A;  4UB6 U;  1ZQO A;  1ZD3 A;  5CR0 A;  4FZM A;  5L1L A;  1QQ7 A;  4B9M A;  2KE7 A;  4ECQ A;  5KG6 A;  5J0R A;  2Y9T A;  1JRO A;  1TK8 A;  1X9X A;  2I6X A;  3VCB A;  2W8K A;  2BZF A;  2DKZ A;  4EBD A;  2FLL A;  1SZP A;  3RR8 A;  5CA7 A;  5KNI A;  4MHV A;  4QWE A;  5KFG A;  3MR6 A;  4J9Q A;  3F2D A;  5KG4 A;  2V9W A;  1JRP A;  2R8H A;  4BX9 C;  5ALQ A;  1Z00 B;  3QZ8 A;  1TK5 A;  3EPG A;  2XIC A;  1X2I A;  1TV9 A;  7ICO A;  2F1H A;  4HAI A;  2F76 X;  3GII A;  9ICW A;  4F92 B;  4C4R A;  3ISB A;  4OJO A;  3AMZ A;  2ISO A;  2MAX A;  2KK0 A;  9ICC A;  2OCE A;  4ECW A;  5J2C A;  3JPN A;  5KG0 A;  3HWT A;  3UXO A;  1KFD A;  4M9H A;  3MR2 A;  4UB5 A;  5GTI U;  2YTU A;  4DCC A;  4RUC A;  1L7O A;  2DWQ A;  7ICE A;  5F9L A;  4NLB A;  9ICJ A;  2HOQ A;  1ZQU A;  1NK6 A;  8ICE A;  3SD7 A;  3ISD A;  1HUZ A;  4O5C A;  3M8R A;  7ICU A;  1QSY A;  5KG7 A;  4I29 A;  2H3Q A;  3Q8L A;  4DOC A;  4Y2U A;  2F1J A;  1SB3 C;  4FBT A;  5AKH A;  1Z1V A;  4OD0 A;  4UAV A;  2H3V A;  4ED7 A;  4FZN A;  1QCK A;  3QUT A;  4ZH4 A;  1ED1 A;  2KMD A;  5AI0 A;  5HP4 A;  8ICK A;  1OUQ A;  3WKA A;  1ZQE A;  2HHX A;  4C0Z A;  1IG6 A;  4IL6 U;  4CNQ A;  2HOI A;  1PZN A;  2W11 A;  4MF8 A;  5ALS A;  4QZB A;  4DS5 A;  1JI7 A;  3H8J A;  9ICL A;  2VA3 A;  3KHG A;  1WCN A;  4ELV A;  3MFH A;  8ICW A;  1KRP A;  4NM2 A;  1N56 A;  4KLT A;  2WFA A;  1F44 A;  5DB9 A;  1KTQ A;  2OEH A;  4QWD A;  7ICK A;  9ICR A;  3TAN A;  3AEV A;  4YG2 A;  4YR2 A;  3WK5 A;  5ALE A;  5AKZ A;  2YY6 A;  1ZOL A;  1KL9 A;  5ALL A;  4M2Y A;  1KN5 A;  4LZG A;  3BJY A;  5DBB A;  4DSI A;  1T94 A;  2D6F C;  2PI5 A;  2W8L A;  1RXW A;  2NRT A;  1TAQ A;  1IM4 A;  5EWG A;  1Z4O A;  1XWL A;  3WKC A;  2EQY A;  5J2H A;  4BWJ A;  3GIK A;  4B6J A;  1XO0 A;  2K8C B;  4UAT A;  4AYB C;  3HKZ F;  5ALP A;  8ICU A;  4YD1 A;  4NWI A;  5DG9 A;  5L1K A;  5J0U A;  2BR0 A;  2E1E A;  2YB1 A;  3ZI4 A;  1VJ5 A;  5KFI A;  3Q8K A;  3H7I A;  1UT5 A;  3F2B A;  3HPO A;  4KMU A;  1BPY A;  3H0L B;  3IG5 A;  1KBU A;  5DG8 A;  5J2B A;  4ED1 A;  1X40 A;  2YMP A;  4JV0 A;  4NLG A;  1IV8 A;  3OJS A;  3M9O B;  4ECS A;  4G3I A;  5IIM A;  4DL7 A;  8ICV A;  1UHU A;  1TAM A;  3RB4 A;  4HYK A;  5JTI A;  3NTU A;  2C2E A;  1ZQ1 C;  1PK1 B;  3KBB A;  3OHB A;  1PVR A;  9ICS A;  8ICR A;  1QTM A;  2R8J A;  4RNO A;  3TAQ A;  1X6I A;  2FPK A;  3QYP A;  2BQU A;  1JAL A;  3BDP A;  3RB3 A;  1N2X A;  3LDA A;  3F5A A;  3NRW A;  4M9J A;  2KG5 A;  7ICM A;  5HR7 A;  2OH2 A;  2C28 A;  5KFC A;  3RJG A;  1MA7 A;  4C7Z A;  1SWW A;  5IIJ A;  3OTQ A;  2YMM A;  2VAN A;  1T3N A;  1ZQN A;  1ZQS A;  5L1I A;  1SV0 A;  5J2K A;  1NK0 A;  3F2C A;  2ZTE A;  8ICS A;  4FZL A;  4JV2 A;  3RH4 A;  1RQL A;  4KLL A;  1PUZ A;  4J9S A;  1ZRM A;  5KT2 A;  4QZH A;  3IM1 A;  4P0Q B;  4O3N A;  3HW8 A;  2KZZ A;  3H40 A;  2LPE A;  4MEY A;  9ICV A;  2J6S A;  2WB1 F;  1HIW A;  8ICQ A;  1HUO A;  1L7P A;  3CW2 C;  1A76 A;  4E0D A;  2P35 A;  2HI0 A;  4DFD A;  3RJH A;  5ALT A;  2QLT A;  4EBE A;  2LHT A;  2ZG6 A;  1ZQL A;  4US9 A;  1DOQ A;  2DL0 A;  1S5L U;  7ICT A;  2HBM A;  1V97 A;  4EX6 A;  2DQN B;  1N5W A;  1BNP A;  4DQP A;  2MU2 A;  3PY8 A;  1K5O A;  4EZ6 A;  3V7K A;  8ICI A;  5DB8 A;  4I2J A;  5ALW A;  3S6J A;  4FO6 A;  3PO4 A;  1ZD5 A;  3ZDB A;  5ALI A;  1NKB A;  5D46 A;  4UB4 A;  2VJ4 A;  2RRD A;  1X9W A;  2G06 A;  4DL3 A;  4F4W A;  4OCZ A;  5AHX A;  4OJ6 A;  5AM2 A;  3M1Y A;  3TKA A;  4JK1 A;  8ICN A;  3FM9 A;  4CDG A;  3WK4 A;  5IIO A;  4C8M A;  8ICC A;  2EZZ A;  3QU9 A;  4B9L A;  2FDR A;  2HCF A;  2K4P A;  2DF4 B;  4MFA A;  5KFP A;  2KN7 A;  5EE1 A;  1JUD A;  3GIM A;  5BPC A;  3OSP A;  3QUC A;  3RTV A;  2W9C A;  5GTH U;  7ICP A;  4R8U B;  3M9M B;  2ASL A;  9ICX A;  1ZQA A;  1PVP A;  2RLT A;  4J9K A;  2F8L A;  3H4D A;  3OPX A;  9ICN A;  4KLF A;  7ICJ A;  2Y0S C;  2JV3 A;  5DB6 A;  4DF8 A;  5KG2 A;  3KKA A;  2HOF A;  5KTQ A;  1FO4 A;  4IQW A;  3RF9 A;  4EYI B;  3E0F A;  2KJ9 A;  2V4R A;  5H2F U;  1WYG A;  8ICM A;  4UAR A;  5CRX A;  4MF2 A;  1PVQ A;  3GV5 B;  4DOA A;  5DLF A;  4UBB A;  2K8A A;  4O3P A;  4YN4 A;  3RR7 A;  4C80 A;  1Z3E B;  1KDH A;  1COO A;  2QAR B;  2KJ8 A;  3H8W A;  4F5Q A;  4R8U A;  2F2A B;  4Z6E A;  2XGQ A;  5L9X A;  4GC7 A;  4PGX A;  5EWE A;  1UCV A;  4QWB A;  3SAG A;  4RQ7 A;  2E8P A;  3DEE A;  4F71 A;  4TQR A;  4J9R A;  2EAP A;  4YVZ A;  2C2R A;  4ECV A;  3TAR A;  4F5N A;  4F4Y A;  2DPI A;  4KLD A;  3ZDE A;  2CXY A;  1BPZ A;  3ORY A;  1WUD A;  3TFR A;  1D8L A;  4EZ9 A;  4JWM A;  4TUS A;  3ZD8 A;  2P6R A;  2MUT B;  5DG7 A;  5C0Y A;  2HW3 A;  2HDO A;  3NS1 A;  1SKW A;  4QZF A;  1N5X A;  4BGD A;  2M0N A;  2LBO A;  2ISP A;  2JGA A;  3SV4 A;  1CI4 A;  5KG3 A;  2ESE A;  4CF4 A;  2QAR A;  4GXK A;  1T7P A;  2E8N A;  3MAB A;  1ZQZ A;  4PPX A;  5KFD A;  4RNN A;  4KLI A;  3MFI A;  1U45 A;  2EDU A;  3MGH A;  3I76 A;  1CUK A;  1YZ6 A;  2BCQ A;  2HHT A;  1ZD2 P;  3E2E A;  4JB3 A;  4DOB A;  5AI9 A;  2MUT A;  4J9L A;  1KQQ A;  3WK8 A;  4DLE A;  4GLX A;  8ICZ A;  2BDU A;  4YD2 A;  1GO3 F;  3MBY A;  7ICR A;  4I2D A;  3ZDC A;  4O3M A;  4K4I A;  1ZET A;  1Z1B A;  2G0A A;  1LB2 B;  2KFZ A;  2KJ5 A;  3KZX A;  5J0O A;  5ALV A;  2DGZ A;  9ICQ A;  4RQ8 A;  2BDP A;  8ICO A;  3FAH A;  3M9N B;  5D49 A;  3SR6 A;  2ZIV B;  3MDA A;  4I27 A;  1NK9 A;  1S0M A;  4XRH A;  4C8K A;  9ICI A;  3RFA A;  3T5H A;  4BJQ A;  3V6J A;  9ICG A;  3PZP A;  3OHA A;  1QSS A;  5AKY A;  1ZQK A;  4O5E A;  1BPD A;  5K4L A;  4ECR A;  3QNM A;  9ICF A;  2W9B B;  1ZQI A;  1JIH A;  1SXE A;  4QZE A;  3NGD A;  1PK3 A;  3SAH A;  1X42 A;  5KFQ A;  4P4M A;  2W3S A;  2IOH A;  1FFU A;  4IC9 A;  3V72 A;  4KLJ A;  3QU4 A;  1T4G A;  2Q0Z X;  3RRH A;  5ALF A;  2JZB A;  4UB1 A;  4EYH B;  1UPH A;  3HT3 A;  2UVR A;  2UVU A;  5DDY A;  4QIW C;  1O03 A;  2XY5 A;  3T79 A;  3H0R B;  4YXJ A;  3SQI A;  2IHM A;  2DBY A;  1LKY B;  4PZN A;  3RAX A;  2H3Z A;  3D6J A;  2E8M A;  8ICG A;  3QU7 A;  2ZIV A;  2W3R A;  2D8C A;  1ZQT A;  2BQ3 A;  5KFU A;  3BQT A;  4F72 A;  3SAF A;  4TUR A;  1X9S A;  2FPM A;  4F50 A;  3PSP A;  2F8K A;  1L7M A;  2W9B A;  3GQC A;  4KLQ A;  5DB7 A;  2PFQ A;  4RQ4 A;  2GWS A;  2VA8 A;  4IRK A;  2EH9 A;  2WF9 A;  2YMQ A;  4DL4 A;  2B21 A;  1N48 A;  2EZX A;  1MC8 A;  3C2L A;  4M6W B;  4Y2S A;  5IIL A;  4KMO B;  2I1Q A;  2IA6 A;  4OJP A;  4Y2Q A;  4P0P B;  8ICT A;  3PV8 A;  2I5H A;  7ICH A;  4DL2 A;  5KFV A;  5J0P A;  2C22 A;  4UAY A;  4MFC A;  2XI9 A;  4PHA A;  5F9N A;  3IG8 A;  1LKY A;  3L3F X;  1OXJ A;  1Q8K A;  3THV A;  3H8M A;  3RAQ A;  9ICB A;  3OJU A;  4BXO B;  2VA2 A;  5J2A A;  2NO5 A;  1ZYQ A;  5C5J A;  2XC9 A;  3NVZ A;  2K8B B;  3MR5 A;  3NVY A;  2ASD A;  3O0F A;  5AK3 A;  3M8S A;  3V7L A;  3ZDA A;  5KFB A;  4AP9 A;  2F3N A;  1IIP A;  5KFY A;  4F3O A;  5B66 U;  2YB4 A;  5EE9 A;  4M6W A;  1V85 A;  1D8Y A;  4NY8 A;  2FPL A;  4P0P A;  4GFJ A;  4ED0 A;  4EX7 A;  3PVX A;  2XCP A;  3MC1 A;  1SXD A;  3IV6 A;  2ZXI A;  4FE3 A;  3RJE A;  5AKX A;  3UMC A;  1J2M A;  1O08 A;  2UVV A;  1BPB A;  2PXI A;  2W03 A;  3NVV A;  5DGA A;  3PML A;  4BXO A;  5JU5 A;  4Q45 A;  5J2G A;  4J9P A;  3C5F A;  2JEI A;  5HML A;  5TZV A;  2WF6 A;  3JPR A;  2I9G A;  2WAQ F;  2F44 A;  4C8O A;  1V38 A;  2G07 A;  1RZT A;  3UXP A;  1ZQG A;  4U7C A;  3JPP A;  5F3X B;  1JXL A;  3JPS A;  1RQN A;  1QQ6 A;  4O3R A;  1ZQX A;  5AM1 A;  4Y2R A;  3ICX A;  4EBC A;  2ZIW B;  4PGQ A;  1QLN A;  5KT7 A;  3PR4 A;  4I2G A;  3T3F A;  7ICV A;  2BCS A;  3ZDD A;  5CWR A;  1NJX A;  5ALH A;  4XA5 A;  4PGY A;  2KVC A;  2HVI A;  2G5H B;  2H3F A;  3KOO A;  3JPO A;  3SI8 A;  3QX7 A;  4RPY A;  4GXJ A;  2PFO A;  4KLH A;  4C4T A;  4X5V A;  1S77 D;  4KLG A;  3HP6 A;  1ZQH A;  2BPF A;  1ZQV A;  4FFD A;  1SL2 A;  2G09 A;  3PMN A;  1DK2 A;  4DSK A;  2OHF A;  5KFT A;  2ATL A;  5KFE A;  5FP0 A;  4OJL A;  1X9M A;  5AM0 A;  2NO4 A;  5DGB A;  4PHD A;  2CRX A;  2ZIW A;  2HHQ A;  3QU2 A;  2MA1 A;  3TAD C;  2ZJA A;  3GIL A;  1RM6 C;  3N7P D;  4KN7 A;  7ICI A;  3JPT A;  2EAN A;  4IS7 A;  4PJ0 U;  3LYS A;  4ED8 A;  3V6K A;  2P6U A;  4M9N A;  2QB1 A;  4Z6F A;  8ICJ A;  2W9M A;  2G5I B;  1X66 A;  5J2D A;  3PST A;  1S0N A;  1TK0 A;  4ED3 A;  2AXT U;  2HBK A;  5T14 A;  4MEX A;  2KSO B;  4R63 A;  1UT8 A;  2FMP A;  3PW0 A;  2WHE A;  1HEK A;  4QZA A;  4BWM A;  2AU0 A;  4R66 A;  3ALR A;  3Q8R B;  1KLN A;  5DQH A;  1HJP A;  2XGP A;  3EYZ A;  3PX0 A;  3D2Q A;  1NI3 A;  4Y2J A;  3NAS A;  2YX8 A;  4KLM A;  1NK8 A;  8ICB A;  1RYR A;  1FEZ A;  4B9T A;  2NRV A;  2H5X A;  4GIB A;  3K1R B;  1B4F A;  4G9B A;  2JR5 A;  1NK4 A;  3HJE A;  5G5G A;  3N4M B;  4F93 B;  3QUQ A;  3H4B A;  5AIA A;  5KFM A;  2KEY A;  2KSO A;  4F2S A;  4QZD A;  1S8O A;  4PL2 A;  1DGS A;  2K4I A;  3AU6 A;  3AQF A;  4TUP A;  4FS2 A;  4CF3 A;  3EPI A;  3V7J A;  5J0Y A;  1D9D A;  5KFN A;  2KFN A;  2JXJ A;  3BQ0 A;  2Q4T A;  4F8R A;  4O0I A;  1N60 A;  4NL9 C;  1H38 A;  2KVS A;  2KOB A;  4C8N A;  3QZ7 A;  5J2J A;  3PW2 A;  3UMB A;  5J0S A;  1EXN A;  2BHN A;  4LVS A;  5AKI A;  5L1J A;  3C29 A;  2AGP A;  4ED6 A;  1ECW A;  4O9M A;  2EAM A;  4ICA A;  5J0X A;  5CP2 A;  4NV0 A;  4DFK A;  2A1A A;  3N7R C;  2FMS A;  4DF4 A;  4F4K A;  2W9C B;  3NRZ A;  5AK6 A;  4Q43 A;  1T8E A;  4QIW F;  2NYV A;  5KL1 B;  5ALZ A;  4US8 A;  1RYS A;  1LV5 A;  1F5S A;  3SEN A;  3BS5 B;  1BPE A;  4P4O A;  1T3Q A;  2RQ5 A;  1WWV A;  1VDV A;  2IMW P;  4M0A A;  4DEZ A;  1SL0 A;  2AHO B;  1ZQB A;  3DDH A;  5BOM A;  2P66 A;  4RUA A;  3C2M A;  4RPZ A;  7ICF A;  3N97 B;  3CRX A;  4DSL A;  4I2E A;  3K1Z A;  4YR0 A;  2QB0 B;  2ZJ5 A;  1SIJ A;  5ALJ A;  3NVW A;  2PFN A;  2DFL A;  3WKB A;  5J2I A;  2IBK A;  1N61 A;  2KHQ A;  4ECY A;  3BZK A;  3TFS A;  3I1Y A;  1S10 A;  2GO7 A;  3H0M B;  2B0C A;  1WWU A;  3B0Y A;  4UQG A;  3QE9 Y;  2Y1I A;  1MQ3 A;  1SV4 A;  4YMN A;  4DFM A;  5ALD A;  3BS5 A;  4F91 B;  4QZ9 A;  4GXI A;  3SZ2 A;  4QZC A;  9ICM A;  1C20 A;  2BPG A;  4IRD A;  3FYH A;  5DLG A;  2BPC A;  1YT3 A;  3F53 A;  2Z7J A;  9ICO A;  2DPJ A;  5AK4 A;  4NLK A;  2AGO A;  4Y2Y A;  4Y2X A;  1X6J A;  2AH5 A;  4RQ2 A;  3Q8S B;  5J2F A;  3Q8P B;  3RJF A;  4M04 A;  1MN8 A;  2QB0 A;  3DV9 A;  3A0B U;  2W7P A;  2KNJ A;  4U6P A;  5AKG A;  5CEH A;  4ECU A;  2W55 A;  2FMQ A;  1K1S A;  2M9N A;  5EWF A;  4KLO A;  1CEZ A;  1S9F A;  3Q8Q B;  2IHN A;  3LWL A;  1MQ2 A;  4UW9 A;  3HKZ C;  5AKJ A;  2F1I A;  2GLE A;  5KFA A;  2A1J B;  1U47 A;  4MFF A;  2HHS A;  4B9V A;  4NLC A;  5HR6 A;  5KL8 B;  3N7S C;  1VLB A;  4OO1 J;  3KTQ A;  2FLP A;  5DKW A;  4M9L A;  1Q46 A;  3HRD D;  1ZQQ A;  5ALX A;  2XVT A;  3RJK A;  5EE3 A;  3MDC A;  3QUB A;  2XY6 A;  4PZO A;  1NJW A;  5KFH A;  2HHV A;  5ALY A;  2EAO A;  1CRX A;  5CB1 A;  5DQI A;  4DSJ A;  2MRL A;  1M6Y A;  4JMU A;  1QQ5 A;  3C23 A;  3G6X A;  3RBE A;  1Z19 A;  2K60 A;  2A1J A;  2PMZ C;  2KIW A;  2OM6 A;  4YMO A;  4K4H A;  4C7Y A;  1L8L A;  2JEG A;  2W04 A;  2ASJ A;  2BQR A;  4RU9 A;  1MSW D;  4Y2V A;  2E1F A;  3CNH A;  2OXO A;  2GOL A;  5CHG A;  2ZUB A;  4DFP A;  5ALU A;  4AYB F;  3PNC A;  9ICE A;  4UB3 A;  3T5J A;  5EOZ A;  3TAP A;  2JZB B;  5AKK A;  4EEK A;  2JH7 A;  4ELT A;  2XY7 A;  1LVH A;  5AIC A;  9ICH A;  4USA A;  1NNL A;  3M6K A;  3PW7 A;  1SL1 A;  3QEA Z;  3CP8 A;  1WG8 A;  5ALM A;  3IN5 A;  4FBU A;  5KFO A;  3D2N A;  4ECZ A;  5J29 A;  3UQ0 A;  4JV1 A;  2L5Y A;  4R65 A;  2R8K A;  1U9L A;  1IXR A;  4QWA A;  3WKD A;  4XQ8 A;  3UM9 A;  1J97 A;  4RNM A;  5AM5 A;  1XU4 A;  9ICU A;  3KFU F;  1NK5 A;  4CGZ A;  3LVV A;  2AQ4 A;  5AIB A;  1QH9 A;  1J2N A;  2LYA A;  4LZD A;  1S76 D;  4J9N A;  7ICS A;  4EEL A;  1XNS A;  1XS9 D;  4NLZ A;  4DWI A;  8ICX A;  1COK A;  2E3T A;  3PX6 A;  4F5P A;  5HHI A;  1D9F A;  3PSF A;  2AGQ A;  1SGG A;  4KTQ A;  2ZXH A;  3C28 A;  3KD3 A;  3UMG A;  2KKP A;  4RPX A;  1BGX T;  4QZG A; 
#chains in the Genus database with same CATH homology
 3CYM A;  1Z19 A;  3D2Q A;  1P7D A;  2KHQ A;  1A6S A;  4FZM A;  2E1E A;  2KVC A;  2HOF A;  2XI9 A;  2YB1 A;  2BDU A;  2G5H B;  2YX8 A;  2H3F A;  3H0M B;  2PMZ C;  1GO3 F;  2KIW A;  2OM6 A;  3RF9 A;  4O3M A;  3IG8 A;  3D2S A;  2H3V A;  3E0F A;  2KJ9 A;  2LYB A;  5A0L A;  3VCB A;  3F2B A;  3H0L B;  3L3F X;  3M6Z A;  3IG5 A;  4FZN A;  2ZIU B;  4P0Q A;  2G0A A;  1Z1B A;  1KBU A;  1DRG A;  1ED1 A;  2CPR A;  2KJ5 A;  2W7O A;  2KV2 A;  3KZX A;  1OUQ A;  5CRX A;  2W04 A;  2KHV A;  2DGZ A;  2LHT A;  2PMZ F;  4A8E A;  2ZG6 A;  1PVQ A;  2K4E A;  3AL0 B;  1URJ A;  4NWI A;  2E1F A;  4C0Z A;  2OXO A;  2GOL A;  1Q3U A;  2ZIV B;  2HBM A;  2K8A A;  2HOI A;  1D8B A;  2DQN B;  2KEY A;  2K8B B;  3AQE A;  3F2D A;  1L6N A;  2G09 A;  3RFA A;  1YT3 A;  4BJQ A;  2A3V A;  1TAM A;  2KJ8 A;  2K4I A;  3F53 A;  3GZF A;  3NUQ A;  2Z7J A;  3O0F A;  4PL2 A;  2F2A B;  3AQF A;  2NV3 A;  2R18 A;  3PZP A;  1SZH A;  1ZQ1 C;  2Y0S F;  2K4H A;  4OJL A;  1PVR A;  2JH7 A;  1IIP A;  2XIC A;  1NZB A;  2WAQ C;  2Q4T A;  3LVW A;  3SAG A;  2ZIW A;  2XID A;  3DEE A;  2CN1 A;  2HBL A;  3M6K A;  2YB4 A;  2F77 X;  2HBJ A;  2MA1 A;  2F76 X;  2VJ4 A;  2KOB A;  3CP8 A;  2RRD A;  2KNJ A;  3MGV A;  2W7P A;  3IN5 A;  2ZIX A;  3SAH A;  4U6P A;  1F44 A;  3N7P D;  4P0P A;  2G06 A;  4GFJ A;  4ACO A;  3D2N A;  2E5S A;  4IC9 A;  4BX9 C;  2OYY A;  3C29 A;  1ECW A;  4OJ6 A;  4OJO A;  1WUD A;  3LYS A;  4ICA A;  2VKQ A;  2ZXI A;  4FE3 A;  4KX5 A;  4NV0 A;  1UPH A;  3HKZ C;  5C0Y A;  4CDG A;  2ZIU A;  4QIW C;  2JH1 A;  2K89 A;  3F5A A;  2GH1 A;  3N7R C;  3T79 A;  3NRW A;  3H0R B;  3F5E A;  4CRX A;  3SQI A;  5HR7 A;  2W03 A;  2OH2 A;  3KFU F;  4KX3 A;  2M0N A;  2LBO A;  2G5I B;  2H3Z A;  1MA7 A;  2JGA A;  4BUG A;  2ZIV A;  4QIW F;  3VC8 A;  3GU3 A;  3PST A;  1T94 A;  3IP4 B;  4CGZ A;  5KL1 B;  2H3I A;  2D6F C;  2DF4 B;  3LVV A;  4NLC A;  5HR6 A;  4OJ5 A;  5KL8 B;  2RHF A;  3N7S C;  2HBK A;  2JMG A;  2VJ5 A;  3SAF A;  4OO1 J;  3PSI A;  2LYA A;  2N1R A;  2WAQ F;  5T14 A;  4PL1 A;  3F2C A;  4FZL A;  1XNS A;  2CRX A;  4P0P B;  2G07 A;  3ONN A;  3SMV A;  3PSP A;  2XVT A;  4AYB F;  4NLB A;  2HMX A;  2HOQ A;  4U7C A;  1Q3V A;  2KKV A;  4QNL A;  2VIX A;  3M7D A;  4WJ3 B;  2RP5 A;  1PVP A;  1HEK A;  2F8L A;  1A0P A;  3OPX A;  2JHD A;  1XO0 A;  2G08 A;  3PSF A;  3CRX A;  2WB1 C;  2KD1 A;  2ZXH A;  2K8C B;  3C28 A;  4AYB C;  1CRX A;  4P0Q B;  2LKY A;  3HKZ F;  3ICX A;  3K1Z A;  3ALR A;  2ZIW B;  2KKP A;  2Y0S C;  2MRL A;  4KMO B;  2KIC A;  2H3Q A;  2ZIX B;  4JMU A;  4OJP A;  2WB1 F;  4QJF B;  1HIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...