5KL8B

Crystal structure of the pumilio-nos-cyclinb rna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna-binding protein/rna
molecule keywords Maternal protein pumilio
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05741 zf-nanos Nanos RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.680 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 5kl8B00
5KL1B 3ALRA 5KL8B
chains in the Genus database with same CATH superfamily
4RQ8A 5EWEA 4I2HA 5DB7A 3T79A 1ZETA 4J9QA 2DBYA 2ALZA 1BNOA 2HBJA 2YMLA 3HW8A 4QWEA 3QUQA 2MU2A 3IG5A 4YG2A 2OM6A 3F5AA 4BXOB 1Z3EB 4ELUA 2UVUA 4F91B 1SKSA 4F5RA 2ZIVA 9ICQA 4XUSA 4RQNA 3HWTA 1L3TA 3BZCA 5KFUA 4F4XA 4DOAA 4TUSA 4EZ6A 3PX4A 4GC6A 1HJPA 1SXDA 2JEJA 5AI6A 4DL4A 8ICCA 2BPGA 1WCLA 5KFLA 3AM9A 4Y2QA 1UHUA 4C8LA 3FAHA 1XS9D 3ZDBA 1D8YA 2ZTCA 2AXTU 1RQLA 3I76A 2E5SA 7ICEA 4KTQA 4OCZA 2W9MA 2MSNA 3UXNA 4KX5A 2H3VA 4RUCA 5L1MA 1HIWA 4IQWA 4KLEA 5AM0A 2F1HA 5A0LA 4J03A 2DPIA 2QKQA 4YP3A 2LM1A 2YTUA 2FMSA 1IG6A 5JTIA 5F9LA 3GQCA 3MDAA 5L1JA 2F77X 4NLBA 2A1AA 4P0QB 3QU5A 4DL3A 9ICSA 1D9FA 3K75D 4EX6A 1RXWA 1L3SA 2EZXA 3WK9A 4O5KA 8ICFA 2ZIXA 1U47A 2JR5A 4FFDA 4EX7A 2ESEA 4C7YA 2HOQA 3DV9A 4B9NA 2W43A 2E1FA 4UW9A 3ZDDA 4RQ6A 5GTHU 3S6JA 3HT3A 4YN4A 2F8KA 5J0XA 4ECZA 2W7PA 2JZBA 3OHBA 4KLHA 1NK8A 3RAQA 9ICKA 2KJ9A 2ZTDA 3RJIA 1ZJNA 3G6XA 3M1YA 5KFQA 4G9BA 2A1JB 1ZD4A 3WK8A 2YX8A 3SV4A 5J2AA 3AU2A 3RB4A 5ALUA 4QZEA 5AI5A 5HHIA 2AGQA 4F4ZA 4QWDA 1COOA 3RF9A 4O0IA 1ZQEA 1UPHA 2H3IA 2WF7A 3PMNA 1JALA 1UQVA 4J9KA 3M6ZA 9ICWA 3JPRA 1HUOA 3CP8A 1U48A 1Z1VA 3DDHA 2W55A 3UXPA 9ICBA 4R66A 4C4SA 5DG9A 5DLGA 3V7JA 4AYBC 3A0BU 3SD7A 3QUCA 5F9NA 3HRDD 4PGQA 2R8HA 3H0MB 2AQ0A 4E0DA 5AKXA 4BUGA 2XC9A 1S0NA 4KLOA 4YD1A 7ICMA 3PR4A 4QNLA 3SEIA 4EEYA 2GWSA 1PZNA 4MF2A 1PVPA 2LM4A 5KFHA 1ZQIA 4PZNA 2DKZA 2P6UA 1S77D 3V7LA 1ZRMA 5KG0A 3I1YA 4JWMA 1N63A 2YQEA 1Y88A 4F93B 3H8MA 8ICOA 3WKEA 3B0XA 2W03A 2YB4A 2WTFA 3UXOA 2PMZC 2LKYA 3MR6A 3H4DA 1ZQSA 2WB1F 2AQ4A 1ZQNA 4EYIB 3SENA 1T3QA 1K1SA 3GZFA 4RQ0A 2EANA 5J2CA 1Z1BA 2YMMA 3ETLA 2JV3A 3QUBA 4JUZA 2R8IA 4QZ9A 1NJWA 3LVVA 4PL1A 2LBOA 4Z6EA 5DGBA 1KFSA 3D6JA 1NK4A 4YR0A 3V6HA 2JH7A 5KFWA 5L1LA 4B9TA 3IDWA 3IN5A 5DB9A 2BR0A 9ICGA 2KHVA 4ECYA 2NO4A 1AQ6A 1O08A 3QX7A 9ICRA 3H4BA 3PZPA 7ICUA 2K4PA 5J0TA 4YMMA 9ICLA 1BPZA 1Z00A 2DWQA 2KSOA 4B9SA 1DK2A 5KFTA 4QWBA 1MN8A 5KG3A 3R9KA 4DL7A 2D8CA 4F5QA 2AGPA 2J6SA 3C29A 4EBEA 5KFIA 3SI8A 4BXOA 4ED3A 2FMPA 5KT4A 3HKZF 1JROA 2XO7A 4OJOA 5EE1A 1BPDA 5ALNA 3L3FX 3PW0A 1L5UA 3D2SA 1RG6A 7ICSA 1IIPA 5ALYA 3DEEA 3VCBA 1U4BA 4M9JA 2MAXA 3CRXA 2ODGA 1XNSA 4YMOA 3QU4A 1S0VA 3FM9A 4IR1A 1JUDA 4P0QA 8ICAA 2HBLA 2XVTA 1SKWA 8ICWA 4PJ0U 1U49A 2W8LA 2KIWA 8ICIA 3WKDA 3N97B 4IR9A 5J0UA 3PW7A 9ICNA 9ICVA 2H3FA 2ZUBA 5KFMA 2A1JA 3MR5A 1IV8A 5KT2A 3UPQA 3QU7A 3LWMA 4XRHA 3H7IA 2MUTB 5CA7A 1S97A 4BWJA 2Y1IA 4IRDA 3TAQA 4DL5A 2N1RA 4LZDA 4R64A 3T5KA 4Q8EA 5AM1A 4TUQA 2LPEA 1U9LA 1LKYA 1ZQFA 3O0FA 1V9PA 3BDPA 8ICNA 1ZQYA 1B22A 1NI3A 1N5WA 4UB3A 3ZDCA 2HCFA 4QZBA 5BOMA 3PO5A 9ICUA 1D8BA 4Y2RA 4ECWA 3RFAA 5J0RA 3BS7A 4Y2JA 3SV3A 3EZ5A 3IRUA 4IL6U 4UAZA 1NJZA 2LMRA 4NL9C 3WKBA 2I9GA 2KHQA 3NRWA 3MR2A 4BX9C 2FDRA 1NJXA 4PZOA 1L8LA 5AKLA 4AYBF 2ZIVB 5J2EA 2LHTA 4R65A 3JPSA 5AKJA 7ICNA 1SV0C 4ED7A 3HP6A 1ZJMA 1C7YA 5AI4A 3QE9Y 4J9OA 2KEYA 3B0YA 4P4PA 2HHUA 2KG5A 4GC7A 2VANA 1MSWD 5KNIA 3MR3A 3LYSA 4OD0A 5AK3A 3BS5A 2RRDA 2K8BB 3WK4A 3ISDA 2HHSA 3C2KA 5G5GA 1T4GA 1UA0A 4J9RA 2BKEA 2Y1JA 1EXNA 1C20A 7ICKA 1TKDA 2IHNA 3MBYA 3NVWA 4NLZA 4Y2TA 2ZIUA 2C22A 4JV0A 5HMMA 4F4YA 4F2RA 1FEZA 3M8RA 5CR0A 1X9WA 1KL9A 3EW9A 1AROP 3WU2U 5DG8A 2D3DA 3WK5A 1H38A 1RPLA 1WUDA 5ALDA 1A6SA 3RBDA 4FZNA 4C8MA 5KFCA 1IXRA 4MFAA 4UAWA 4NLKA 4C8KA 3NUQA 4UBBA 1VDVA 5FP0A 2HBKA 2DFLA 3RJEA 2K60A 1Q8KA 1NK7A 4MFFA 3LK9A 5ALPA 3LVWA 5CJ7A 4DQIA 4ZOHC 4PHAA 8ICQA 3PX0A 2BZFA 1BNPA 4RT2A 4IRCA 2PFPA 2V4QA 4DQSA 3N28A 2OXOA 1ZXIA 5C0YA 4O3OA 3RRHA 1SL0A 1A77A 4KLUA 5IIJA 3IV6A 2FJ6A 4DEZA 4G3IA 1L7OA 2HHVA 3BS5B 4RQ3A 4UAVA 3GU3A 1BVSA 9ICEA 8ICJA 5IIIA 2PXIA 2PKEA 2RHFA 1KBUA 4M04A 3JPQA 3KBBA 1SXEA 4I2GA 3Q8PB 1URJA 4B9MA 2E8NA 3PSFA 5KL8B 3JPOA 2FLPA 2Y0SC 3PVXA 2Y0SF 3WK6A 4O3PA 4DFPA 4FS2A 4KLQA 4QZ8A 2KN7A 3TADC 1ZOLA 5ALGA 3TI0A 4F5PA 5C5JA 3OGUA 5G5HA 3JPNA 4JV1A 3NRZA 5AKGA 4A8EA 1U45A 2JRZA 5KT6A 4QZDA 3NS1A 2W9CA 2B6GA 9ICPA 3F2BA 4YXMA 3SAFA 3Q8QB 4KX3A 2FI1A 5AKKA 5DLFA 4DLEA 2KZZA 3SZ2A 2KZ3A 2G06A 4O5EA 2K89A 8ICXA 3RB3A 3ZI4A 3PSTA 3OJUA 3PSPA 2H3QA 4C4TA 5IIMA 3KZIU 3H8SA 1SB3C 2OH2A 1RDFA 4O3QA 5DGAA 3C2LA 2DPJA 1QTMA 1NK0A 3N7PD 3TADA 3NGDA 5J8YC 4Y2YA 4MEYA 2HDOA 4QZIA 1WCNA 2XICA 2KV2A 4IRKA 9ICCA 5CP2A 2BCUA 2VIXA 3MABA 4CF5A 4J9MA 4O3MA 2A19A 3QZ7A 1HEKA 3QUTA 3PR5B 3MDCA 3M7DA 4MHVA 1ZQJA 1MC8A 3PSIA 2CXYA 1KDHA 5ALQA 5BPCA 4MEXA 4IQTA 1X6IA 1KW4A 9ICJA 1ZQDA 4ECVA 4TQSA 4O9MA 3RJFA 2YMPA 4QZAA 1JN3A 4ED1A 3THVA 1J97A 4CF4A 1M6YA 4OJLA 3HILA 4DQRA 9ICXA 4IQUA 3SR6A 2ZTEA 2HHQA 5AI8A 5J29A 4PH5A 3LDAA 5KT7A 1MQ3A 4Z6CA 3UMBA 2BQ3A 2BPCA 1ZQGA 2F76X 4UB1A 3GIJA 3ALRA 1NKCA 4JWNA 5KFAA 4RQ5A 2ZG6A 1Z4NA 5AI0A 1LV5A 4RUAA 3N7SC 3GIKA 5AHXA 8ICZA 2GO7A 3OPXA 4F71A 2IA6A 1QLNA 2KFNA 4P0PA 3T5LA 1L6NA 2E3TA 4J9LA 4OJ5A 5ALHA 3ISBA 2R8KA 4XQ8A 1BGXT 5HMLA 3QU2A 2Z7JA 4YR3A 5KFPA 5AKIA 2KD1A 5EOZA 2VA2A 1OW5A 1MQ2A 3ICXA 7ICQA 3TQ1A 5BOLA 4BGDA 4UAYA 1BPEA 5ALIA 3JPPA 4DL2A 5KG6A 1JIHA 2BDUA 1F0MA 2K4IA 5DB8A 3KZXA 3KKAC 3WK7A 4KITB 4ECXA 2ZXHA 1SWWA 9ICTA 2VA8A 2E8MA 3TARA 2D6FC 3UMGA 4MF8A 3RH5A 4DQQA 5L1IA 2QB0B 1KRPA 3F2CA 3BQ7A 2C2EA 5J0QA 1SKRA 2Q4TA 3H40A 5K4LA 5L9XA 3GFKB 4RQ2A 3RR8A 2K8AA 1YT3A 2OYYA 5T14A 2VA3A 1SV0A 1TAQA 1FO4A 3CW2C 5AKEA 3KFUF 5KFXA 4EELA 1N56A 5AK5A 2R8JA 4LVSA 2WF9A 3M6KA 4NWIA 5JUMA 2J6TA 4PHDA 8ICHA 2UVWA 3ZDAA 5KG1A 1QQ7A 2K8CB 3K1ZA 1S5LU 2AGOA 4QWAA 4J9PA 3F53A 8ICUA 1N62A 2FLNA 3GIIA 2XY6A 5KFGA 5AKYA 4PGYA 3OJSA 1JMSA 4UQGA 4UARA 2LYHA 1DRGA 5EE0A 2O6KA 1NKEA 4WJ3B 3EUB2 1V97A 2QLTA 3H0RB 3PW2A 1IM4A 3KHHA 2DGZA 5KFKA 5AKZA 2HOFA 1L8OA 1OUQA 4M2YA 3K1RB 4MFCA 2HHWA 2CN1A 5EE3A 1L7NA 4M9LA 4Y2XA 1S8OA 4KLFA 1ZQQA 3B9JA 5J2BA 3RR7A 1ZRNA 1X6JA 4DOBA 3T5HA 5JRTA 1YZ6A 4YR2A 3MFHA 2KP7A 4UB5A 2LYBA 3BJYA 4FBTA 1ZD5A 4OJPA 3NASA 5F3XB 3PW4A 2FMQA 4C80A 4KLIA 3OSPA 4RQ4A 2NV3A 2W3SA 1SL1A 4FZLA 1S9FA 4ECSA 5AKHA 4RQMA 3Q8KA 5KL1B 2W3RA 7ICTA 4DFJA 2RDIA 8ICLA 5J0PA 4J9SA 5D49A 4NM1A 4NLNA 7ICPA 5IILA 5HP4A 2AJQA 1J2NA 3ZD9A 2MRLA 1B4FA 5ALMA 4KLGA 3C28A 2EAMA 4K4HA 3IP4B 4FS1A 4UB2A 4QIWC 5KFVA 2HOIA 2FPLA 4UB6U 4DO9A 4DFKA 3GDXA 8ICBA 1KSPA 3MGVA 1SL2A 5L1KA 2G5IB 1F5SA 4ZH4A 2NYVA 1ZQUA 3MFIA 2ES6A 1KKXA 4RPZA 2BGWA 3GV5B 1TE2A 4YMNA 1ZQHA 4YCXA 5DB6A 3C1YA 1CRXA 3RJHA 3EYZA 5KT3A 5ALJA 3KKAA 3AN1A 5GTIU 4F4WA 1WWVA 1K1QA 1LB2B 3D2QA 1CI4A 4NL9A 4B9VA 3NVYA 1KQQA 3WKAA 4BJQA 4JV2A 5KFYA 4YQWA 1ZQTA 3ED5A 4C8OA 1ZQBA 1MA7A 5HHHA 4DFDA 8ICPA 1ZQ1C 2JEGA 5EWFA 4DSFA 1D9DA 2PI4A 5KFEA 5AM5A 2CPRA 4NM2A 1D8LA 2EZYA 3RAXA 4C0ZA 2HVHA 2VJ4A 2QB0A 5J0YA 3CYMA 4TQRA 2IOFA 5AK6A 8ICTA 2IOHA 4X5VA 4M0AA 1Z19A 2W9BA 4JB3A 1X40A 3LWLA 1X9SA 1SGGA 1RYUA 1S0OA 2ZIUB 4UB8U 5AK4A 3C5GA 4KN7A 4RPXA 1B0XA 1NZBA 4GIBA 4RQ7A 3E2EA 4C7ZA 3SMVA 2WAQC 3C23A 5J0SA 5KFRA 3GV7B 2KVCA 4UASA 1KLNA 4PL2A 1A0PA 8ICVA 3QYPA 1ZQWA 3FYHA 4RNOA 4F5OA 4UBCA 5DBBA 4EBDA 2QB1A 3N4MB 2K4EA 2RP5A 4I2EA 3WKCA 2JH1A 5AIAA 2E8OA 2FPMA 3RB0A 4GLXA 3PW5A 1UT8A 3MGHA 3Q8LA 4F5NA 1UT5A 3RH6A 4YD2A 4P4MA 2PFQA 1ZQAA 5ALFA 2ZJAA 5IIKA 8ICMA 4QZCA 2MUTA 1RZTA 4F2SA 3HJEA 2F44A 1L3VA 1N2XA 2FPKA 3M9OB 5ALRA 5KFFA 3RJGA 4JK1A 4Y2VA 4DOCA 2KOBA 5DQGA 2ZXIA 5AICA 1ECWA 4I2JA 3FC4A 2IMWP 2NO5A 2BDPA 4U6PA 4Q8FA 2PFNA 2H5XA 2W9CB 3H8WA 1A76A 2OHFA 2FLLA 1DK3A 4QZFA 2EDUA 5DKWA 4CE6A 1FFUA 3BQTA 1ZYQA 1B43A 3ONNA 2KJ5A 4K4GA 1J2MA 4RNMA 3SQIA 2F8LA 3AU6A 5B66U 5J0WA 4I2AA 3QXGA 1Q46A 3G6YA 4EZ9A 1NZPA 2XI9A 4P0PB 4ED2A 3UMCA 4EEKA 3OSNA 2F2AB 5KG2A 4GXKA 5TZVA 9ICIA 2EAOA 2CRXA 2XIDA 5D4BA 2ISOA 3T3FA 4QZGA 2EQYA 4F72A 2JGAA 2FE9A 1QQ6A 2KICA 2XGQA 4ECTA 2BQUA 3J81j 4ED0A 2BCVA 2BHNA 1S10A 2WHEA 2YMQA 4Q43A 1X66A 2I6XA 2HI0A 4CNQA 3VC8A 3CNHA 3IHQB 1PVRA 4KLJA 2F1JA 5JU5A 1BPYA 2EAPA 1ZQPA 2E8PA 1TK8A 9ICMA 4IQVA 5KFSA 5CEHA 2WF6A 5KFZA 3Q8RB 4PHEA 4ELVA 3BQ0A 4I2IA 1T8EA 4B9LA 3BQ2A 4YXJA 4B9UA 4FE3A 4FBUA 4RT3A 3PMLA 4OJ6A 3JPTA 1X42A 4O3RA 2XCPA 1TK5A 3SAGA 2QARB 3TAPA 2KTQA 3ISCA 5ALZA 1TK0A 1LKYB 2V9WA 1L3UA 1SIJA 1N5XA 5DQIA 2RLTA 2Y9UA 4HAIA 1YZ7A 1Q3VA 2DQNB 2XCAA 4DL6A 3FDSA 1RXVA 1XO1A 1QSLA 2G0AA 4UB4A 1DXSA 4NY8A 5CWRA 2NRWA 9ICFA 3M9MB 5DG7A 2KMDA 5KFOA 1S76D 2AHOB 5KFJA 1JXLA 2DUYA 1N48A 2P6RA 3N7RC 1N60A 2F1IA 2JXJA 4KLLA 4Q44A 1BPBA 2RDJA 2KKVA 2WF8A 4IS7A 3AUOA 2ZJ5A 3GV8B 2IOFK 3ORYA 1COKA 3Q8MA 5ALWA 2L5YA 5J2FA 4LJXA 1S0MA 5AM2A 2BPFA 2ZIWB 3V6KA 2LI6A 3UQ2A 4ECRA 2ZUDA 3RRGA 2WB1C 2W7OA 4KLSA 3V7KA 2PMZF 4AP9A 4ED6A 2VJ5A 7ICGA 2KE7A 1WG8A 2YN4A 5KT5A 4U7CA 4I29A 2KFZA 5AM3A 4USAA 5HR7A 1X2IA 1SWVA 4US8A 3HPOA 3PO4A 5ALEA 1ZQRA 4YVZA 4R63A 1KFTA 2WAQF 1XO0A 3T5JA 2G5HB 1XSNA 3PX6A 2V4RA 4NLGA 4EBCA 2NRVA 4NXZA 2I1QA 8ICYA 1CUKA 3SAHA 2HMXA 3RJJA 4KLTA 5J0OA 1ZD2P 1FFVA 3AMZA 3F2DA 4YFKA 5KFDA 1RYSA 4KN4A 5DBAA 5J2KA 2GLEA 1RQNA 4PGXA 8ICSA 1F44A 4B6JA 2ZIWA 8ICGA 1TV9A 2XY5A 3EPGA 3QEBZ 1KEJA 1OXJA 3KHLA 4RU9A 4IC9A 5J2HA 3G6VA 3ZDEA 3E0FA 3QU9A 1QH9A 5DDYA 1ZQZA 4F8RA 3RBEA 5CB1A 7ICIA 4C4RA 4M9GA 1ZQLA 2EH9A 9ICHA 3H8JA 1Z4OA 1QSYA 3RB6A 1JI7A 2R8GA 3TFSA 1ZQMA 2WF5A 4ACOA 4CRXA 2ASLA 2ZJ8A 5ALVA 2W54A 9ICOA 4ECUA 4M6WA 4O3NA 4CDGA 3AEVA 1NOMA 1NKBA 2KNJA 4PPXA 2NRTA 2M0NA 2JEFA 8ICKA 1UA1A 1XSPA 2R18A 4ICAA 3OHAA 2GH1A 1XU4A 5DQHA 4DFMA 2ZIXB 2JHDA 4DQPA 4QWCA 3C5FA 1WYGA 5D46A 3KHGA 3AQFA 5H2FU 4I2CA 9ICAA 4RQ1A 3E58A 4TUPA 1ZQOA 1VJ5A 3H0LB 4M47A 1SZHA 5ALOA 5KTQA 4R8UA 3PY8A 1TFRA 4NV0A 5EE9A 2GOLA 7ICRA 5KFNA 1PVQA 1P7DA 4UATA 1Z00B 2NRXA 4UAUA 4HYKA 4P4OA 2KK0A 2BCRA 4BDPA 5HR6A 1ED1A 3KD3A 4DSLA 2ASJA 1TVAA 4ELTA 2PFOA 2W11A 4DSEA 4NJ8A 1NK5A 1GO3F 3QZ8A 2DL0A 2HBMA 4C8NA 2DF4B 4DS4A 2HHXA 4R8UB 3KTQA 3M8SA 4O5CA 3BQ1A 3MGIA 2HSZA 3IG8A 3HKZC 5J2DA 4DCCA 1V38A 4I2BA 1KTQA 1X9XA 4M6WB 5AM4A 3KHRA 1CEZA 2UVRA 4EYHB 2C2RA 2XGPA 3F5EA 3RTVA 5ALSA 5ALTA 1NJYA 3ZD8A 4I2DA 5CRXA 1HUZA 3AQEA 4ED8A 4CGZA 2H3ZA 4QZHA 1L7PA 1TAMA 3NVZA 5KG4A 2BQRA 2ASDA 1JXEA 3BZKA 1DGJA 2W9BB 4US9A 4P2HA 4QW9A 3PNCA 2ATLA 1ZQCA 5ALLA 3TFRA 2MA1A 2Y9TA 3IM1A 4XA5A 2C2DA 4GXIA 7ICHA 1ZQVA 3C21A 5J2IA 4I28A 1PUZA 1JX4A 3U26A 2K4HA 5DBCA 2W9AA 1VLBA 4CF3A 3AL0B 1TAUA 4BWMA 2RQ5A 5ALKA 3V72A 1ZQKA 2YY6A 4OO1J 2EZZA 4DLGA 2UVVA 4I2FA 4JMUA 2HW3A 5KAFU 3SYZA 5E79U 4Z6FA 4DSKA 2M9NA 2IHMA 2C28A 5KG7A 4QJFB 1SV4A 5ALXA 2KZMA 1BPXA 2KKPA 2B21A 2OCEA 2JEIA 4KLDA 1KN5A 1QSSA 4NLCA 1V85A 5KAIU 3EPIA 1RM6C 7ICFA 3HX0A 2JZBB 2A3VA 4KLMA 1N61A 1PK3A 2IBKA 1DOQA 4KMUA 3RH4A 1PK1B 3KOOA 4M9NA 4RZRA 2KVSA 2BCQA 2ZUCA 5IINA 2B0CA 3GIMA 1SZPA 1X9MA 2E1EA 1QCKA 2LYAA 3TANA 4Y2UA 1JRPA 5DDMA 5J2GA 5TISU 1ZQXA 1NNLA 1T3NA 3NVVA 3TACB 1QQ5A 3ETRA 1Q3UA 2NRZA 7ICLA 3NTUA 4Y2SA 2JMGA 2G08A 2J6UA 5B5EU 4TURA 5J8YA 2AH5A 3QEAZ 8ICRA 1XSLA 2KIVA 2OWOA 1XWLA 3PV8A 2I5HA 1NK6A 3OTQA 4J9NA 4EENA 4DF4A 3C2MA 4ECQA 3TKAA 1L7MA 1T7PA 3UM9A 4Y2PA 1K5OA 7ICJA 3D2NA 3I28A 4QIWF 4PHPA 4GFJA 1KFDA 5EWGA 4GXJA 2HVIA 1LVHA 4DS5A 2G07A 2Q0ZX 4F92B 3Q8SB 2PI5A 4I27A 4K4IA 1PK1A 4FO6A 1UCVA 1O03A 3K4GA 2VKQA 4O3SA 4DWIA 3RJKA 1T94A 2XY7A 1RYRA 4CCHA 3M9NB 5AI9A 3C1ZA 1XC9A 2HHTA 2P66A 4RPYA 3GILA 2AU0A 4Z6DA 4F3OA 4LZGA 5IIOA 5J2JA 1WWUA 4F4KA 2G09A 2WFAA 2KJ8A 2W8KA 2OEHA 2F3NA 5AIBA 4DSIA 5KFBA 4DF8A 3QNMA 5KG5A 3MC1A 8ICEA 3EWAA 4KMOB 5CHGA 7ICVA 1FIQA 2DKXA 2BCSA 2W04A 7ICOA 4FZMA 3UQ0A 4F50A 1ZD3A 4QW8A 2P35A 4DSJA 3V6JA 1DGSA 3L4PA 3L5KA 4M9HA 2YB1A 4RNNA 2ISPA 2QARA 5HNKA 1NK9A 3A0HU 4Q45A 2KSOB
chains in the Genus database with same CATH topology
2OYYA 3CYMA 4OJ6A 3T79A 3SAHA 4FZLA 5T14A 4U6PA 2HMXA 4OJLA 2MA1A 3GZFA 3SAGA 3H0LB 1Z19A 1Z1BA 2KJ9A 1SZHA 2HBJA 5KL1B 3IG5A 3F2DA 2ZIUB 2OM6A 3LVVA 4PL1A 2LBOA 3F5AA 2YX8A 2K4HA 2KJ5A 3ONNA 4NV0A 4A8EA 3D2NA 1WUDA 2N1RA 1A6SA 4QIWF 3SQIA 3AL0B 1NZBA 3KFUF 2GOLA 2JH7A 4GFJA 1PVQA 3F2BA 1P7DA 2F76X 4FZNA 2F8LA 1F44A 3IN5A 2ZIVA 2MRLA 2G07A 2ZIWA 3SMVA 2DQNB 3ALRA 3SAFA 1Q3VA 4OO1J 2WAQC 4KX3A 2KHVA 3RF9A 5HR6A 2G0AA 3M6KA 4NWIA 3O0FA 3C28A 1UPHA 2H3IA 3NUQA 4JMUA 3IP4B 1ED1A 2KVCA 4QIWC 3PZPA 3M6ZA 2ZG6A 2HOIA 2VKQA 2HBKA 2XI9A 2G06A 4PL2A 1A0PA 4P0PB 2K8CB 3K1ZA 3CP8A 2K89A 4QJFB 2F2AB 3F53A 3N7SC 1GO3F 4IC9A 1D8BA 3PSTA 3PSPA 3OPXA 2H3QA 1T94A 3RFAA 3MGVA 2CRXA 2K4EA 2KKPA 2RP5A 2HBMA 2XIDA 3E0FA 3LVWA 2G5IB 3N7RC 2DF4B 4P0PA 2JH1A 2OH2A 4AYBC 1L6NA 1DRGA 4OJ5A 4NLCA 3N7PD 2E5SA 4WJ3B 2KKVA 2JGAA 3C29A 1CRXA 3IG8A 2Z7JA 2KHQA 3HKZC 3NRWA 3H0RB 2KD1A 4BX9C 3H0MB 2G09A 3HKZF 2KJ8A 4AYBF 2ZIVB 2KICA 2LHTA 2DGZA 2OXOA 3ICXA 2XICA 4OJOA 4BUGA 4KX5A 2H3VA 2KV2A 2A3VA 5C0YA 1HIWA 2HOFA 2Y0SF 2ZIWB 3D2QA 1OUQA 3L3FX 5A0LA 4QNLA 2VIXA 3D2SA 4O3MA 1IIPA 2BDUA 4BJQA 2K4IA 4ACOA 3DEEA 3VCBA 3F5EA 2CN1A 3KZXA 1PVPA 4CRXA 1HEKA 2KEYA 4KMOB 2WB1C 3CRXA 3VC8A 2F77X 3GU3A 4NLBA 2W7OA 1MA7A 4P0QB 5CRXA 1XNSA 4CDGA 2W04A 3M7DA 2E1EA 2KNJA 4FZMA 2PMZF 1PVRA 1ZQ1C 2LYAA 3AQEA 2ZXHA 3PSIA 2M0NA 2VJ5A 2ZIXA 2RHFA 4U7CA 1KBUA 3LYSA 4CGZA 2D6FC 2H3ZA 2CPRA 2R18A 2RRDA 2K8BB 5HR7A 4P0QA 1TAMA 2KOBA 4ICAA 2HOQA 2HBLA 2GH1A 2XVTA 2ZXIA 3F2CA 1Q3UA 2E1FA 2KIWA 2W03A 2WAQF 2YB4A 1URJA 4C0ZA 2ZIXB 2JHDA 1XO0A 2YB1A 2LYBA 2PMZC 2G5HB 2LKYA 3PSFA 2Q4TA 4OJPA 2JMGA 2G08A 5KL8B 2H3FA 2VJ4A 3AQFA 1ECWA 2K8AA 1YT3A 4FE3A 2WB1F 2Y0SC 2ZIUA 2W7PA 2NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL1 B;  3ALR A;  5KL8 B; 
#chains in the Genus database with same CATH topology
 4RQ8 A;  5EWE A;  4I2H A;  5DB7 A;  3T79 A;  1ZET A;  4J9Q A;  2DBY A;  2ALZ A;  1BNO A;  2HBJ A;  2YML A;  3HW8 A;  4QWE A;  3QUQ A;  2MU2 A;  3IG5 A;  4YG2 A;  2OM6 A;  3F5A A;  4BXO B;  1Z3E B;  4ELU A;  2UVU A;  4F91 B;  1SKS A;  4F5R A;  2ZIV A;  9ICQ A;  4XUS A;  4RQN A;  3HWT A;  1L3T A;  3BZC A;  5KFU A;  4F4X A;  4DOA A;  4TUS A;  4EZ6 A;  3PX4 A;  4GC6 A;  1HJP A;  1SXD A;  2JEJ A;  5AI6 A;  4DL4 A;  8ICC A;  2BPG A;  1WCL A;  5KFL A;  3AM9 A;  4Y2Q A;  1UHU A;  4C8L A;  3FAH A;  1XS9 D;  3ZDB A;  1D8Y A;  2ZTC A;  2AXT U;  1RQL A;  3I76 A;  2E5S A;  7ICE A;  4KTQ A;  4OCZ A;  2W9M A;  2MSN A;  3UXN A;  4KX5 A;  2H3V A;  4RUC A;  5L1M A;  1HIW A;  4IQW A;  4KLE A;  5AM0 A;  2F1H A;  5A0L A;  4J03 A;  2DPI A;  2QKQ A;  4YP3 A;  2LM1 A;  2YTU A;  2FMS A;  1IG6 A;  5JTI A;  5F9L A;  3GQC A;  3MDA A;  5L1J A;  2F77 X;  4NLB A;  2A1A A;  4P0Q B;  3QU5 A;  4DL3 A;  9ICS A;  1D9F A;  3K75 D;  4EX6 A;  1RXW A;  1L3S A;  2EZX A;  3WK9 A;  4O5K A;  8ICF A;  2ZIX A;  1U47 A;  2JR5 A;  4FFD A;  4EX7 A;  2ESE A;  4C7Y A;  2HOQ A;  3DV9 A;  4B9N A;  2W43 A;  2E1F A;  4UW9 A;  3ZDD A;  4RQ6 A;  5GTH U;  3S6J A;  3HT3 A;  4YN4 A;  2F8K A;  5J0X A;  4ECZ A;  2W7P A;  2JZB A;  3OHB A;  4KLH A;  1NK8 A;  3RAQ A;  9ICK A;  2KJ9 A;  2ZTD A;  3RJI A;  1ZJN A;  3G6X A;  3M1Y A;  5KFQ A;  4G9B A;  2A1J B;  1ZD4 A;  3WK8 A;  2YX8 A;  3SV4 A;  5J2A A;  3AU2 A;  3RB4 A;  5ALU A;  4QZE A;  5AI5 A;  5HHI A;  2AGQ A;  4F4Z A;  4QWD A;  1COO A;  3RF9 A;  4O0I A;  1ZQE A;  1UPH A;  2H3I A;  2WF7 A;  3PMN A;  1JAL A;  1UQV A;  4J9K A;  3M6Z A;  9ICW A;  3JPR A;  1HUO A;  3CP8 A;  1U48 A;  1Z1V A;  3DDH A;  2W55 A;  3UXP A;  9ICB A;  4R66 A;  4C4S A;  5DG9 A;  5DLG A;  3V7J A;  4AYB C;  3A0B U;  3SD7 A;  3QUC A;  5F9N A;  3HRD D;  4PGQ A;  2R8H A;  3H0M B;  2AQ0 A;  4E0D A;  5AKX A;  4BUG A;  2XC9 A;  1S0N A;  4KLO A;  4YD1 A;  7ICM A;  3PR4 A;  4QNL A;  3SEI A;  4EEY A;  2GWS A;  1PZN A;  4MF2 A;  1PVP A;  2LM4 A;  5KFH A;  1ZQI A;  4PZN A;  2DKZ A;  2P6U A;  1S77 D;  3V7L A;  1ZRM A;  5KG0 A;  3I1Y A;  4JWM A;  1N63 A;  2YQE A;  1Y88 A;  4F93 B;  3H8M A;  8ICO A;  3WKE A;  3B0X A;  2W03 A;  2YB4 A;  2WTF A;  3UXO A;  2PMZ C;  2LKY A;  3MR6 A;  3H4D A;  1ZQS A;  2WB1 F;  2AQ4 A;  1ZQN A;  4EYI B;  3SEN A;  1T3Q A;  1K1S A;  3GZF A;  4RQ0 A;  2EAN A;  5J2C A;  1Z1B A;  2YMM A;  3ETL A;  2JV3 A;  3QUB A;  4JUZ A;  2R8I A;  4QZ9 A;  1NJW A;  3LVV A;  4PL1 A;  2LBO A;  4Z6E A;  5DGB A;  1KFS A;  3D6J A;  1NK4 A;  4YR0 A;  3V6H A;  2JH7 A;  5KFW A;  5L1L A;  4B9T A;  3IDW A;  3IN5 A;  5DB9 A;  2BR0 A;  9ICG A;  2KHV A;  4ECY A;  2NO4 A;  1AQ6 A;  1O08 A;  3QX7 A;  9ICR A;  3H4B A;  3PZP A;  7ICU A;  2K4P A;  5J0T A;  4YMM A;  9ICL A;  1BPZ A;  1Z00 A;  2DWQ A;  2KSO A;  4B9S A;  1DK2 A;  5KFT A;  4QWB A;  1MN8 A;  5KG3 A;  3R9K A;  4DL7 A;  2D8C A;  4F5Q A;  2AGP A;  2J6S A;  3C29 A;  4EBE A;  5KFI A;  3SI8 A;  4BXO A;  4ED3 A;  2FMP A;  5KT4 A;  3HKZ F;  1JRO A;  2XO7 A;  4OJO A;  5EE1 A;  1BPD A;  5ALN A;  3L3F X;  3PW0 A;  1L5U A;  3D2S A;  1RG6 A;  7ICS A;  1IIP A;  5ALY A;  3DEE A;  3VCB A;  1U4B A;  4M9J A;  2MAX A;  3CRX A;  2ODG A;  1XNS A;  4YMO A;  3QU4 A;  1S0V A;  3FM9 A;  4IR1 A;  1JUD A;  4P0Q A;  8ICA A;  2HBL A;  2XVT A;  1SKW A;  8ICW A;  4PJ0 U;  1U49 A;  2W8L A;  2KIW A;  8ICI A;  3WKD A;  3N97 B;  4IR9 A;  5J0U A;  3PW7 A;  9ICN A;  9ICV A;  2H3F A;  2ZUB A;  5KFM A;  2A1J A;  3MR5 A;  1IV8 A;  5KT2 A;  3UPQ A;  3QU7 A;  3LWM A;  4XRH A;  3H7I A;  2MUT B;  5CA7 A;  1S97 A;  4BWJ A;  2Y1I A;  4IRD A;  3TAQ A;  4DL5 A;  2N1R A;  4LZD A;  4R64 A;  3T5K A;  4Q8E A;  5AM1 A;  4TUQ A;  2LPE A;  1U9L A;  1LKY A;  1ZQF A;  3O0F A;  1V9P A;  3BDP A;  8ICN A;  1ZQY A;  1B22 A;  1NI3 A;  1N5W A;  4UB3 A;  3ZDC A;  2HCF A;  4QZB A;  5BOM A;  3PO5 A;  9ICU A;  1D8B A;  4Y2R A;  4ECW A;  3RFA A;  5J0R A;  3BS7 A;  4Y2J A;  3SV3 A;  3EZ5 A;  3IRU A;  4IL6 U;  4UAZ A;  1NJZ A;  2LMR A;  4NL9 C;  3WKB A;  2I9G A;  2KHQ A;  3NRW A;  3MR2 A;  4BX9 C;  2FDR A;  1NJX A;  4PZO A;  1L8L A;  5AKL A;  4AYB F;  2ZIV B;  5J2E A;  2LHT A;  4R65 A;  3JPS A;  5AKJ A;  7ICN A;  1SV0 C;  4ED7 A;  3HP6 A;  1ZJM A;  1C7Y A;  5AI4 A;  3QE9 Y;  4J9O A;  2KEY A;  3B0Y A;  4P4P A;  2HHU A;  2KG5 A;  4GC7 A;  2VAN A;  1MSW D;  5KNI A;  3MR3 A;  3LYS A;  4OD0 A;  5AK3 A;  3BS5 A;  2RRD A;  2K8B B;  3WK4 A;  3ISD A;  2HHS A;  3C2K A;  5G5G A;  1T4G A;  1UA0 A;  4J9R A;  2BKE A;  2Y1J A;  1EXN A;  1C20 A;  7ICK A;  1TKD A;  2IHN A;  3MBY A;  3NVW A;  4NLZ A;  4Y2T A;  2ZIU A;  2C22 A;  4JV0 A;  5HMM A;  4F4Y A;  4F2R A;  1FEZ A;  3M8R A;  5CR0 A;  1X9W A;  1KL9 A;  3EW9 A;  1ARO P;  3WU2 U;  5DG8 A;  2D3D A;  3WK5 A;  1H38 A;  1RPL A;  1WUD A;  5ALD A;  1A6S A;  3RBD A;  4FZN A;  4C8M A;  5KFC A;  1IXR A;  4MFA A;  4UAW A;  4NLK A;  4C8K A;  3NUQ A;  4UBB A;  1VDV A;  5FP0 A;  2HBK A;  2DFL A;  3RJE A;  2K60 A;  1Q8K A;  1NK7 A;  4MFF A;  3LK9 A;  5ALP A;  3LVW A;  5CJ7 A;  4DQI A;  4ZOH C;  4PHA A;  8ICQ A;  3PX0 A;  2BZF A;  1BNP A;  4RT2 A;  4IRC A;  2PFP A;  2V4Q A;  4DQS A;  3N28 A;  2OXO A;  1ZXI A;  5C0Y A;  4O3O A;  3RRH A;  1SL0 A;  1A77 A;  4KLU A;  5IIJ A;  3IV6 A;  2FJ6 A;  4DEZ A;  4G3I A;  1L7O A;  2HHV A;  3BS5 B;  4RQ3 A;  4UAV A;  3GU3 A;  1BVS A;  9ICE A;  8ICJ A;  5III A;  2PXI A;  2PKE A;  2RHF A;  1KBU A;  4M04 A;  3JPQ A;  3KBB A;  1SXE A;  4I2G A;  3Q8P B;  1URJ A;  4B9M A;  2E8N A;  3PSF A;  5KL8 B;  3JPO A;  2FLP A;  2Y0S C;  3PVX A;  2Y0S F;  3WK6 A;  4O3P A;  4DFP A;  4FS2 A;  4KLQ A;  4QZ8 A;  2KN7 A;  3TAD C;  1ZOL A;  5ALG A;  3TI0 A;  4F5P A;  5C5J A;  3OGU A;  5G5H A;  3JPN A;  4JV1 A;  3NRZ A;  5AKG A;  4A8E A;  1U45 A;  2JRZ A;  5KT6 A;  4QZD A;  3NS1 A;  2W9C A;  2B6G A;  9ICP A;  3F2B A;  4YXM A;  3SAF A;  3Q8Q B;  4KX3 A;  2FI1 A;  5AKK A;  5DLF A;  4DLE A;  2KZZ A;  3SZ2 A;  2KZ3 A;  2G06 A;  4O5E A;  2K89 A;  8ICX A;  3RB3 A;  3ZI4 A;  3PST A;  3OJU A;  3PSP A;  2H3Q A;  4C4T A;  5IIM A;  3KZI U;  3H8S A;  1SB3 C;  2OH2 A;  1RDF A;  4O3Q A;  5DGA A;  3C2L A;  2DPJ A;  1QTM A;  1NK0 A;  3N7P D;  3TAD A;  3NGD A;  5J8Y C;  4Y2Y A;  4MEY A;  2HDO A;  4QZI A;  1WCN A;  2XIC A;  2KV2 A;  4IRK A;  9ICC A;  5CP2 A;  2BCU A;  2VIX A;  3MAB A;  4CF5 A;  4J9M A;  4O3M A;  2A19 A;  3QZ7 A;  1HEK A;  3QUT A;  3PR5 B;  3MDC A;  3M7D A;  4MHV A;  1ZQJ A;  1MC8 A;  3PSI A;  2CXY A;  1KDH A;  5ALQ A;  5BPC A;  4MEX A;  4IQT A;  1X6I A;  1KW4 A;  9ICJ A;  1ZQD A;  4ECV A;  4TQS A;  4O9M A;  3RJF A;  2YMP A;  4QZA A;  1JN3 A;  4ED1 A;  3THV A;  1J97 A;  4CF4 A;  1M6Y A;  4OJL A;  3HIL A;  4DQR A;  9ICX A;  4IQU A;  3SR6 A;  2ZTE A;  2HHQ A;  5AI8 A;  5J29 A;  4PH5 A;  3LDA A;  5KT7 A;  1MQ3 A;  4Z6C A;  3UMB A;  2BQ3 A;  2BPC A;  1ZQG A;  2F76 X;  4UB1 A;  3GIJ A;  3ALR A;  1NKC A;  4JWN A;  5KFA A;  4RQ5 A;  2ZG6 A;  1Z4N A;  5AI0 A;  1LV5 A;  4RUA A;  3N7S C;  3GIK A;  5AHX A;  8ICZ A;  2GO7 A;  3OPX A;  4F71 A;  2IA6 A;  1QLN A;  2KFN A;  4P0P A;  3T5L A;  1L6N A;  2E3T A;  4J9L A;  4OJ5 A;  5ALH A;  3ISB A;  2R8K A;  4XQ8 A;  1BGX T;  5HML A;  3QU2 A;  2Z7J A;  4YR3 A;  5KFP A;  5AKI A;  2KD1 A;  5EOZ A;  2VA2 A;  1OW5 A;  1MQ2 A;  3ICX A;  7ICQ A;  3TQ1 A;  5BOL A;  4BGD A;  4UAY A;  1BPE A;  5ALI A;  3JPP A;  4DL2 A;  5KG6 A;  1JIH A;  2BDU A;  1F0M A;  2K4I A;  5DB8 A;  3KZX A;  3KKA C;  3WK7 A;  4KIT B;  4ECX A;  2ZXH A;  1SWW A;  9ICT A;  2VA8 A;  2E8M A;  3TAR A;  2D6F C;  3UMG A;  4MF8 A;  3RH5 A;  4DQQ A;  5L1I A;  2QB0 B;  1KRP A;  3F2C A;  3BQ7 A;  2C2E A;  5J0Q A;  1SKR A;  2Q4T A;  3H40 A;  5K4L A;  5L9X A;  3GFK B;  4RQ2 A;  3RR8 A;  2K8A A;  1YT3 A;  2OYY A;  5T14 A;  2VA3 A;  1SV0 A;  1TAQ A;  1FO4 A;  3CW2 C;  5AKE A;  3KFU F;  5KFX A;  4EEL A;  1N56 A;  5AK5 A;  2R8J A;  4LVS A;  2WF9 A;  3M6K A;  4NWI A;  5JUM A;  2J6T A;  4PHD A;  8ICH A;  2UVW A;  3ZDA A;  5KG1 A;  1QQ7 A;  2K8C B;  3K1Z A;  1S5L U;  2AGO A;  4QWA A;  4J9P A;  3F53 A;  8ICU A;  1N62 A;  2FLN A;  3GII A;  2XY6 A;  5KFG A;  5AKY A;  4PGY A;  3OJS A;  1JMS A;  4UQG A;  4UAR A;  2LYH A;  1DRG A;  5EE0 A;  2O6K A;  1NKE A;  4WJ3 B;  3EUB 2;  1V97 A;  2QLT A;  3H0R B;  3PW2 A;  1IM4 A;  3KHH A;  2DGZ A;  5KFK A;  5AKZ A;  2HOF A;  1L8O A;  1OUQ A;  4M2Y A;  3K1R B;  4MFC A;  2HHW A;  2CN1 A;  5EE3 A;  1L7N A;  4M9L A;  4Y2X A;  1S8O A;  4KLF A;  1ZQQ A;  3B9J A;  5J2B A;  3RR7 A;  1ZRN A;  1X6J A;  4DOB A;  3T5H A;  5JRT A;  1YZ6 A;  4YR2 A;  3MFH A;  2KP7 A;  4UB5 A;  2LYB A;  3BJY A;  4FBT A;  1ZD5 A;  4OJP A;  3NAS A;  5F3X B;  3PW4 A;  2FMQ A;  4C80 A;  4KLI A;  3OSP A;  4RQ4 A;  2NV3 A;  2W3S A;  1SL1 A;  4FZL A;  1S9F A;  4ECS A;  5AKH A;  4RQM A;  3Q8K A;  5KL1 B;  2W3R A;  7ICT A;  4DFJ A;  2RDI A;  8ICL A;  5J0P A;  4J9S A;  5D49 A;  4NM1 A;  4NLN A;  7ICP A;  5IIL A;  5HP4 A;  2AJQ A;  1J2N A;  3ZD9 A;  2MRL A;  1B4F A;  5ALM A;  4KLG A;  3C28 A;  2EAM A;  4K4H A;  3IP4 B;  4FS1 A;  4UB2 A;  4QIW C;  5KFV A;  2HOI A;  2FPL A;  4UB6 U;  4DO9 A;  4DFK A;  3GDX A;  8ICB A;  1KSP A;  3MGV A;  1SL2 A;  5L1K A;  2G5I B;  1F5S A;  4ZH4 A;  2NYV A;  1ZQU A;  3MFI A;  2ES6 A;  1KKX A;  4RPZ A;  2BGW A;  3GV5 B;  1TE2 A;  4YMN A;  1ZQH A;  4YCX A;  5DB6 A;  3C1Y A;  1CRX A;  3RJH A;  3EYZ A;  5KT3 A;  5ALJ A;  3KKA A;  3AN1 A;  5GTI U;  4F4W A;  1WWV A;  1K1Q A;  1LB2 B;  3D2Q A;  1CI4 A;  4NL9 A;  4B9V A;  3NVY A;  1KQQ A;  3WKA A;  4BJQ A;  4JV2 A;  5KFY A;  4YQW A;  1ZQT A;  3ED5 A;  4C8O A;  1ZQB A;  1MA7 A;  5HHH A;  4DFD A;  8ICP A;  1ZQ1 C;  2JEG A;  5EWF A;  4DSF A;  1D9D A;  2PI4 A;  5KFE A;  5AM5 A;  2CPR A;  4NM2 A;  1D8L A;  2EZY A;  3RAX A;  4C0Z A;  2HVH A;  2VJ4 A;  2QB0 A;  5J0Y A;  3CYM A;  4TQR A;  2IOF A;  5AK6 A;  8ICT A;  2IOH A;  4X5V A;  4M0A A;  1Z19 A;  2W9B A;  4JB3 A;  1X40 A;  3LWL A;  1X9S A;  1SGG A;  1RYU A;  1S0O A;  2ZIU B;  4UB8 U;  5AK4 A;  3C5G A;  4KN7 A;  4RPX A;  1B0X A;  1NZB A;  4GIB A;  4RQ7 A;  3E2E A;  4C7Z A;  3SMV A;  2WAQ C;  3C23 A;  5J0S A;  5KFR A;  3GV7 B;  2KVC A;  4UAS A;  1KLN A;  4PL2 A;  1A0P A;  8ICV A;  3QYP A;  1ZQW A;  3FYH A;  4RNO A;  4F5O A;  4UBC A;  5DBB A;  4EBD A;  2QB1 A;  3N4M B;  2K4E A;  2RP5 A;  4I2E A;  3WKC A;  2JH1 A;  5AIA A;  2E8O A;  2FPM A;  3RB0 A;  4GLX A;  3PW5 A;  1UT8 A;  3MGH A;  3Q8L A;  4F5N A;  1UT5 A;  3RH6 A;  4YD2 A;  4P4M A;  2PFQ A;  1ZQA A;  5ALF A;  2ZJA A;  5IIK A;  8ICM A;  4QZC A;  2MUT A;  1RZT A;  4F2S A;  3HJE A;  2F44 A;  1L3V A;  1N2X A;  2FPK A;  3M9O B;  5ALR A;  5KFF A;  3RJG A;  4JK1 A;  4Y2V A;  4DOC A;  2KOB A;  5DQG A;  2ZXI A;  5AIC A;  1ECW A;  4I2J A;  3FC4 A;  2IMW P;  2NO5 A;  2BDP A;  4U6P A;  4Q8F A;  2PFN A;  2H5X A;  2W9C B;  3H8W A;  1A76 A;  2OHF A;  2FLL A;  1DK3 A;  4QZF A;  2EDU A;  5DKW A;  4CE6 A;  1FFU A;  3BQT A;  1ZYQ A;  1B43 A;  3ONN A;  2KJ5 A;  4K4G A;  1J2M A;  4RNM A;  3SQI A;  2F8L A;  3AU6 A;  5B66 U;  5J0W A;  4I2A A;  3QXG A;  1Q46 A;  3G6Y A;  4EZ9 A;  1NZP A;  2XI9 A;  4P0P B;  4ED2 A;  3UMC A;  4EEK A;  3OSN A;  2F2A B;  5KG2 A;  4GXK A;  5TZV A;  9ICI A;  2EAO A;  2CRX A;  2XID A;  5D4B A;  2ISO A;  3T3F A;  4QZG A;  2EQY A;  4F72 A;  2JGA A;  2FE9 A;  1QQ6 A;  2KIC A;  2XGQ A;  4ECT A;  2BQU A;  3J81 j;  4ED0 A;  2BCV A;  2BHN A;  1S10 A;  2WHE A;  2YMQ A;  4Q43 A;  1X66 A;  2I6X A;  2HI0 A;  4CNQ A;  3VC8 A;  3CNH A;  3IHQ B;  1PVR A;  4KLJ A;  2F1J A;  5JU5 A;  1BPY A;  2EAP A;  1ZQP A;  2E8P A;  1TK8 A;  9ICM A;  4IQV A;  5KFS A;  5CEH A;  2WF6 A;  5KFZ A;  3Q8R B;  4PHE A;  4ELV A;  3BQ0 A;  4I2I A;  1T8E A;  4B9L A;  3BQ2 A;  4YXJ A;  4B9U A;  4FE3 A;  4FBU A;  4RT3 A;  3PML A;  4OJ6 A;  3JPT A;  1X42 A;  4O3R A;  2XCP A;  1TK5 A;  3SAG A;  2QAR B;  3TAP A;  2KTQ A;  3ISC A;  5ALZ A;  1TK0 A;  1LKY B;  2V9W A;  1L3U A;  1SIJ A;  1N5X A;  5DQI A;  2RLT A;  2Y9U A;  4HAI A;  1YZ7 A;  1Q3V A;  2DQN B;  2XCA A;  4DL6 A;  3FDS A;  1RXV A;  1XO1 A;  1QSL A;  2G0A A;  4UB4 A;  1DXS A;  4NY8 A;  5CWR A;  2NRW A;  9ICF A;  3M9M B;  5DG7 A;  2KMD A;  5KFO A;  1S76 D;  2AHO B;  5KFJ A;  1JXL A;  2DUY A;  1N48 A;  2P6R A;  3N7R C;  1N60 A;  2F1I A;  2JXJ A;  4KLL A;  4Q44 A;  1BPB A;  2RDJ A;  2KKV A;  2WF8 A;  4IS7 A;  3AUO A;  2ZJ5 A;  3GV8 B;  2IOF K;  3ORY A;  1COK A;  3Q8M A;  5ALW A;  2L5Y A;  5J2F A;  4LJX A;  1S0M A;  5AM2 A;  2BPF A;  2ZIW B;  3V6K A;  2LI6 A;  3UQ2 A;  4ECR A;  2ZUD A;  3RRG A;  2WB1 C;  2W7O A;  4KLS A;  3V7K A;  2PMZ F;  4AP9 A;  4ED6 A;  2VJ5 A;  7ICG A;  2KE7 A;  1WG8 A;  2YN4 A;  5KT5 A;  4U7C A;  4I29 A;  2KFZ A;  5AM3 A;  4USA A;  5HR7 A;  1X2I A;  1SWV A;  4US8 A;  3HPO A;  3PO4 A;  5ALE A;  1ZQR A;  4YVZ A;  4R63 A;  1KFT A;  2WAQ F;  1XO0 A;  3T5J A;  2G5H B;  1XSN A;  3PX6 A;  2V4R A;  4NLG A;  4EBC A;  2NRV A;  4NXZ A;  2I1Q A;  8ICY A;  1CUK A;  3SAH A;  2HMX A;  3RJJ A;  4KLT A;  5J0O A;  1ZD2 P;  1FFV A;  3AMZ A;  3F2D A;  4YFK A;  5KFD A;  1RYS A;  4KN4 A;  5DBA A;  5J2K A;  2GLE A;  1RQN A;  4PGX A;  8ICS A;  1F44 A;  4B6J A;  2ZIW A;  8ICG A;  1TV9 A;  2XY5 A;  3EPG A;  3QEB Z;  1KEJ A;  1OXJ A;  3KHL A;  4RU9 A;  4IC9 A;  5J2H A;  3G6V A;  3ZDE A;  3E0F A;  3QU9 A;  1QH9 A;  5DDY A;  1ZQZ A;  4F8R A;  3RBE A;  5CB1 A;  7ICI A;  4C4R A;  4M9G A;  1ZQL A;  2EH9 A;  9ICH A;  3H8J A;  1Z4O A;  1QSY A;  3RB6 A;  1JI7 A;  2R8G A;  3TFS A;  1ZQM A;  2WF5 A;  4ACO A;  4CRX A;  2ASL A;  2ZJ8 A;  5ALV A;  2W54 A;  9ICO A;  4ECU A;  4M6W A;  4O3N A;  4CDG A;  3AEV A;  1NOM A;  1NKB A;  2KNJ A;  4PPX A;  2NRT A;  2M0N A;  2JEF A;  8ICK A;  1UA1 A;  1XSP A;  2R18 A;  4ICA A;  3OHA A;  2GH1 A;  1XU4 A;  5DQH A;  4DFM A;  2ZIX B;  2JHD A;  4DQP A;  4QWC A;  3C5F A;  1WYG A;  5D46 A;  3KHG A;  3AQF A;  5H2F U;  4I2C A;  9ICA A;  4RQ1 A;  3E58 A;  4TUP A;  1ZQO A;  1VJ5 A;  3H0L B;  4M47 A;  1SZH A;  5ALO A;  5KTQ A;  4R8U A;  3PY8 A;  1TFR A;  4NV0 A;  5EE9 A;  2GOL A;  7ICR A;  5KFN A;  1PVQ A;  1P7D A;  4UAT A;  1Z00 B;  2NRX A;  4UAU A;  4HYK A;  4P4O A;  2KK0 A;  2BCR A;  4BDP A;  5HR6 A;  1ED1 A;  3KD3 A;  4DSL A;  2ASJ A;  1TVA A;  4ELT A;  2PFO A;  2W11 A;  4DSE A;  4NJ8 A;  1NK5 A;  1GO3 F;  3QZ8 A;  2DL0 A;  2HBM A;  4C8N A;  2DF4 B;  4DS4 A;  2HHX A;  4R8U B;  3KTQ A;  3M8S A;  4O5C A;  3BQ1 A;  3MGI A;  2HSZ A;  3IG8 A;  3HKZ C;  5J2D A;  4DCC A;  1V38 A;  4I2B A;  1KTQ A;  1X9X A;  4M6W B;  5AM4 A;  3KHR A;  1CEZ A;  2UVR A;  4EYH B;  2C2R A;  2XGP A;  3F5E A;  3RTV A;  5ALS A;  5ALT A;  1NJY A;  3ZD8 A;  4I2D A;  5CRX A;  1HUZ A;  3AQE A;  4ED8 A;  4CGZ A;  2H3Z A;  4QZH A;  1L7P A;  1TAM A;  3NVZ A;  5KG4 A;  2BQR A;  2ASD A;  1JXE A;  3BZK A;  1DGJ A;  2W9B B;  4US9 A;  4P2H A;  4QW9 A;  3PNC A;  2ATL A;  1ZQC A;  5ALL A;  3TFR A;  2MA1 A;  2Y9T A;  3IM1 A;  4XA5 A;  2C2D A;  4GXI A;  7ICH A;  1ZQV A;  3C21 A;  5J2I A;  4I28 A;  1PUZ A;  1JX4 A;  3U26 A;  2K4H A;  5DBC A;  2W9A A;  1VLB A;  4CF3 A;  3AL0 B;  1TAU A;  4BWM A;  2RQ5 A;  5ALK A;  3V72 A;  1ZQK A;  2YY6 A;  4OO1 J;  2EZZ A;  4DLG A;  2UVV A;  4I2F A;  4JMU A;  2HW3 A;  5KAF U;  3SYZ A;  5E79 U;  4Z6F A;  4DSK A;  2M9N A;  2IHM A;  2C28 A;  5KG7 A;  4QJF B;  1SV4 A;  5ALX A;  2KZM A;  1BPX A;  2KKP A;  2B21 A;  2OCE A;  2JEI A;  4KLD A;  1KN5 A;  1QSS A;  4NLC A;  1V85 A;  5KAI U;  3EPI A;  1RM6 C;  7ICF A;  3HX0 A;  2JZB B;  2A3V A;  4KLM A;  1N61 A;  1PK3 A;  2IBK A;  1DOQ A;  4KMU A;  3RH4 A;  1PK1 B;  3KOO A;  4M9N A;  4RZR A;  2KVS A;  2BCQ A;  2ZUC A;  5IIN A;  2B0C A;  3GIM A;  1SZP A;  1X9M A;  2E1E A;  1QCK A;  2LYA A;  3TAN A;  4Y2U A;  1JRP A;  5DDM A;  5J2G A;  5TIS U;  1ZQX A;  1NNL A;  1T3N A;  3NVV A;  3TAC B;  1QQ5 A;  3ETR A;  1Q3U A;  2NRZ A;  7ICL A;  3NTU A;  4Y2S A;  2JMG A;  2G08 A;  2J6U A;  5B5E U;  4TUR A;  5J8Y A;  2AH5 A;  3QEA Z;  8ICR A;  1XSL A;  2KIV A;  2OWO A;  1XWL A;  3PV8 A;  2I5H A;  1NK6 A;  3OTQ A;  4J9N A;  4EEN A;  4DF4 A;  3C2M A;  4ECQ A;  3TKA A;  1L7M A;  1T7P A;  3UM9 A;  4Y2P A;  1K5O A;  7ICJ A;  3D2N A;  3I28 A;  4QIW F;  4PHP A;  4GFJ A;  1KFD A;  5EWG A;  4GXJ A;  2HVI A;  1LVH A;  4DS5 A;  2G07 A;  2Q0Z X;  4F92 B;  3Q8S B;  2PI5 A;  4I27 A;  4K4I A;  1PK1 A;  4FO6 A;  1UCV A;  1O03 A;  3K4G A;  2VKQ A;  4O3S A;  4DWI A;  3RJK A;  1T94 A;  2XY7 A;  1RYR A;  4CCH A;  3M9N B;  5AI9 A;  3C1Z A;  1XC9 A;  2HHT A;  2P66 A;  4RPY A;  3GIL A;  2AU0 A;  4Z6D A;  4F3O A;  4LZG A;  5IIO A;  5J2J A;  1WWU A;  4F4K A;  2G09 A;  2WFA A;  2KJ8 A;  2W8K A;  2OEH A;  2F3N A;  5AIB A;  4DSI A;  5KFB A;  4DF8 A;  3QNM A;  5KG5 A;  3MC1 A;  8ICE A;  3EWA A;  4KMO B;  5CHG A;  7ICV A;  1FIQ A;  2DKX A;  2BCS A;  2W04 A;  7ICO A;  4FZM A;  3UQ0 A;  4F50 A;  1ZD3 A;  4QW8 A;  2P35 A;  4DSJ A;  3V6J A;  1DGS A;  3L4P A;  3L5K A;  4M9H A;  2YB1 A;  4RNN A;  2ISP A;  2QAR A;  5HNK A;  1NK9 A;  3A0H U;  4Q45 A;  2KSO B; 
#chains in the Genus database with same CATH homology
 2OYY A;  3CYM A;  4OJ6 A;  3T79 A;  3SAH A;  4FZL A;  5T14 A;  4U6P A;  2HMX A;  4OJL A;  2MA1 A;  3GZF A;  3SAG A;  3H0L B;  1Z19 A;  1Z1B A;  2KJ9 A;  1SZH A;  2HBJ A;  5KL1 B;  3IG5 A;  3F2D A;  2ZIU B;  2OM6 A;  3LVV A;  4PL1 A;  2LBO A;  3F5A A;  2YX8 A;  2K4H A;  2KJ5 A;  3ONN A;  4NV0 A;  4A8E A;  3D2N A;  1WUD A;  2N1R A;  1A6S A;  4QIW F;  3SQI A;  3AL0 B;  1NZB A;  3KFU F;  2GOL A;  2JH7 A;  4GFJ A;  1PVQ A;  3F2B A;  1P7D A;  2F76 X;  4FZN A;  2F8L A;  1F44 A;  3IN5 A;  2ZIV A;  2MRL A;  2G07 A;  2ZIW A;  3SMV A;  2DQN B;  3ALR A;  3SAF A;  1Q3V A;  4OO1 J;  2WAQ C;  4KX3 A;  2KHV A;  3RF9 A;  5HR6 A;  2G0A A;  3M6K A;  4NWI A;  3O0F A;  3C28 A;  1UPH A;  2H3I A;  3NUQ A;  4JMU A;  3IP4 B;  1ED1 A;  2KVC A;  4QIW C;  3PZP A;  3M6Z A;  2ZG6 A;  2HOI A;  2VKQ A;  2HBK A;  2XI9 A;  2G06 A;  4PL2 A;  1A0P A;  4P0P B;  2K8C B;  3K1Z A;  3CP8 A;  2K89 A;  4QJF B;  2F2A B;  3F53 A;  3N7S C;  1GO3 F;  4IC9 A;  1D8B A;  3PST A;  3PSP A;  3OPX A;  2H3Q A;  1T94 A;  3RFA A;  3MGV A;  2CRX A;  2K4E A;  2KKP A;  2RP5 A;  2HBM A;  2XID A;  3E0F A;  3LVW A;  2G5I B;  3N7R C;  2DF4 B;  4P0P A;  2JH1 A;  2OH2 A;  4AYB C;  1L6N A;  1DRG A;  4OJ5 A;  4NLC A;  3N7P D;  2E5S A;  4WJ3 B;  2KKV A;  2JGA A;  3C29 A;  1CRX A;  3IG8 A;  2Z7J A;  2KHQ A;  3HKZ C;  3NRW A;  3H0R B;  2KD1 A;  4BX9 C;  3H0M B;  2G09 A;  3HKZ F;  2KJ8 A;  4AYB F;  2ZIV B;  2KIC A;  2LHT A;  2DGZ A;  2OXO A;  3ICX A;  2XIC A;  4OJO A;  4BUG A;  4KX5 A;  2H3V A;  2KV2 A;  2A3V A;  5C0Y A;  1HIW A;  2HOF A;  2Y0S F;  2ZIW B;  3D2Q A;  1OUQ A;  3L3F X;  5A0L A;  4QNL A;  2VIX A;  3D2S A;  4O3M A;  1IIP A;  2BDU A;  4BJQ A;  2K4I A;  4ACO A;  3DEE A;  3VCB A;  3F5E A;  2CN1 A;  3KZX A;  1PVP A;  4CRX A;  1HEK A;  2KEY A;  4KMO B;  2WB1 C;  3CRX A;  3VC8 A;  2F77 X;  3GU3 A;  4NLB A;  2W7O A;  1MA7 A;  4P0Q B;  5CRX A;  1XNS A;  4CDG A;  2W04 A;  3M7D A;  2E1E A;  2KNJ A;  4FZM A;  2PMZ F;  1PVR A;  1ZQ1 C;  2LYA A;  3AQE A;  2ZXH A;  3PSI A;  2M0N A;  2VJ5 A;  2ZIX A;  2RHF A;  4U7C A;  1KBU A;  3LYS A;  4CGZ A;  2D6F C;  2H3Z A;  2CPR A;  2R18 A;  2RRD A;  2K8B B;  5HR7 A;  4P0Q A;  1TAM A;  2KOB A;  4ICA A;  2HOQ A;  2HBL A;  2GH1 A;  2XVT A;  2ZXI A;  3F2C A;  1Q3U A;  2E1F A;  2KIW A;  2W03 A;  2WAQ F;  2YB4 A;  1URJ A;  4C0Z A;  2ZIX B;  2JHD A;  1XO0 A;  2YB1 A;  2LYB A;  2PMZ C;  2G5H B;  2LKY A;  3PSF A;  2Q4T A;  4OJP A;  2JMG A;  2G08 A;  5KL8 B;  2H3F A;  2VJ4 A;  3AQF A;  1ECW A;  2K8A A;  1YT3 A;  4FE3 A;  2WB1 F;  2Y0S C;  2ZIU A;  2W7P A;  2NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...