5KL8B

Crystal structure of the pumilio-nos-cyclinb rna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna-binding protein/rna
molecule keywords Maternal protein pumilio
publication title Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05741 zf-nanos Nanos RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.680 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 5kl8B00
3ALRA 5KL1B 5KL8B
chains in the Genus database with same CATH superfamily
2W9MA 2QARA 3C1ZA 2CXYA 3NUQA 4K4GA 4I28A 1ZRNA 4NV0A 5J2JA 2KHQA 4PPXA 3AU6A 3PMNA 2VA8A 1Z00A 3ISBA 3C29A 4AYBF 1S10A 3WKEA 4RUAA 4I2AA 4Y2QA 3AN1A 4F5QA 5L1IA 4RZRA 1BPZA 2HHXA 1MN8A 2V4RA 2QKQA 3C2LA 2R18A 3KHLA 5E79U 4DEZA 4QWAA 4I2FA 5HR6A 5KG3A 2BQRA 2YMMA 4RQ6A 4QWDA 3MR5A 1L3SA 4QJFB 2C2RA 4UB5A 1XSPA 3PR4A 5KFXA 2ASJA 4C4TA 1IIPA 4JWNA 8ICSA 4Q43A 3K1RB 5KG0A 4YD2A 3MDCA 1CI4A 1YZ7A 4KTQA 8ICCA 1SZPA 3FM9A 4P4PA 1XC9A 3OJSA 3PX4A 2YMPA 2F2AB 8ICPA 3FDSA 5KFMA 3Q8LA 3IV6A 4FZNA 1Z3EB 1J97A 3H4DA 5ALTA 1ZQLA 2HBMA 2K8BB 4F50A 2F76X 3TARA 8ICOA 9ICGA 5KG6A 4Y2VA 3UM9A 5DB6A 2IHNA 1RQNA 1KDHA 2F44A 1ZD5A 1UCVA 5KFSA 1U49A 3K75D 5D49A 3M8SA 4R66A 1JXEA 3TAQA 2KOBA 5AI6A 2E8NA 3IDWA 3A0BU 2FPKA 2HMXA 3BZKA 3FYHA 4CF3A 2JXJA 5KFIA 2KTQA 1PK1A 3V6HA 3N4MB 1Z1BA 3WKBA 2XICA 4C8NA 2A1JB 3RR7A 2H5XA 2F3NA 4DFMA 2AHOB 2W9CA 3T79A 2I6XA 2HHWA 1S9FA 4CNQA 5KFNA 4XRHA 4RQ0A 4EENA 1ZQNA 9ICVA 2VA2A 2HHUA 3KD3A 3PSFA 1SKRA 5J2KA 2G07A 4DQSA 5KT6A 2NRWA 5DGBA 3KHHA 2VANA 5JTIA 4UW9A 1QQ7A 4CF5A 2FPLA 4R8UA 5DB9A 4RNMA 3AMZA 2ZTCA 3S6JA 3ZD9A 9ICQA 1S0OA 2ZIXA 5KG1A 3HPOA 4BUGA 5CP2A 5KFBA 7ICQA 2YN4A 4KLJA 2EQYA 1VDVA 5AM3A 1T3QA 1SWVA 1WWVA 2WF7A 1IG6A 2F1HA 4P0QA 1D8LA 2XGPA 2JEFA 4FBUA 4DO9A 2JGAA 4M9GA 4U7CA 3PMLA 3KHRA 5BPCA 1O03A 2DBYA 3JPRA 1DGSA 3TADC 1TVAA 4Z6CA 1L8OA 1SL1A 1LKYA 3RJIA 4CE6A 3T5JA 4I2CA 5AI0A 4O3OA 4MEXA 2BCSA 2KG5A 3M6KA 4DFDA 4B9TA 1Z00B 2BQUA 2LKYA 3OSPA 1L3UA 4KMOB 2KSOB 1X9XA 3UPQA 2B6GA 3QX7A 3WK5A 1JMSA 4X5VA 1TAMA 1ZQAA 2ZIWB 2ISPA 3EZ5A 1COKA 1XU4A 2A3VA 3MGHA 2LYBA 4O9MA 2I9GA 9ICLA 1F44A 2YX8A 2CRXA 3ONNA 5AKXA 4F93B 4C80A 5K4LA 1T94A 4M0AA 1SKWA 3QNMA 1NJXA 2HSZA 3NGDA 2UVRA 5KFFA 1QSYA 2NRXA 2HHTA 2ZIUA 3BS7A 5DB7A 3F2DA 5HP4A 1MSWD 5HHHA 4FS2A 4GXKA 5JUMA 3KTQA 5JRTA 1MQ3A 4NLZA 1NJZA 3RAQA 2KNJA 4Y2RA 4TUSA 2P6RA 2XI9A 2BHNA 4RQMA 8ICYA 5J0PA 5EOZA 4KLOA 5IIIA 3WK4A 4K4HA 4J9NA 3SV4A 5CRXA 2WTFA 1ZQMA 4JV0A 5AI5A 4O3PA 1X9WA 3OGUA 1UA0A 5HNKA 8ICGA 4PZNA 2WFAA 5DDYA 4RQ5A 1Z4NA 5AK6A 3BDPA 1XO0A 9ICIA 5AK5A 2H3VA 8ICMA 1U9LA 5KFZA 4QZHA 4UB3A 1MQ2A 5J29A 7ICLA 1KFSA 4CGZA 9ICRA 2KKPA 2ZJ5A 3EYZA 2G0AA 2C22A 2FMSA 3BZCA 1NOMA 2IOFK 1WCLA 2EH9A 2DPIA 3TI0A 4M47A 1FIQA 3ORYA 1A6SA 5D46A 5EE1A 3IRUA 5HHIA 4I2EA 4RPYA 4BXOA 4I2IA 2H3QA 3SYZA 1ZQEA 2J6UA 3KFUF 1RDFA 4TUPA 3D2NA 2I5HA 2ZIVB 3E0FA 7ICSA 4C0ZA 4LVSA 4UAZA 3ZDDA 2FJ6A 4ECRA 1JROA 3T5LA 4P0PA 3C2MA 1D8BA 3NRZA 2JHDA 2AQ4A 8ICRA 4ED2A 4GIBA 3RB3A 3RH6A 2XCAA 3RB0A 3NVYA 1ZQXA 2PMZF 5AM4A 2K4EA 4ACOA 4QWEA 4AYBC 2F8LA 3H0RB 1NI3A 3UXOA 1NZBA 1ZOLA 2H3ZA 3C23A 4UB8U 4QZ8A 1NK5A 1JALA 4DQIA 2G5IB 2PXIA 1LKYB 5ALLA 2W7OA 7ICRA 4KLTA 3NTUA 3K4GA 1ZD3A 5ALXA 5HMMA 1XSLA 4DSKA 5AHXA 4IQWA 3Q8PB 2MU2A 1SXDA 2JEGA 3MBYA 2R8KA 1SV4A 4XUSA 3AL0B 4GXJA 3SI8A 3QUCA 1SV0A 1YZ6A 4NJ8A 1FO4A 1SWWA 2K8CB 4ECTA 3GDXA 1X42A 3QZ8A 5AM0A 3WKCA 4Y2PA 3TAPA 4O5KA 4MHVA 4F8RA 4I2DA 4P2HA 4G3IA 2Z7JA 4KLQA 3QEAZ 2KIVA 1ZQOA 3VCBA 4QIWF 4OJ5A 4KLIA 3AQFA 4DL5A 4EZ6A 5GTHU 2AQ0A 5AM1A 5J8YC 3BS5B 3UQ0A 2QB0B 3B0XA 1ED1A 1N2XA 1L7MA 2FI1A 4K4IA 4KLMA 4LJXA 3I76A 7ICNA 3GIMA 3NVZA 3N7RC 5KFEA 4YQWA 5AKYA 4C4RA 4J9OA 1KTQA 4EX6A 1OXJA 4RQ8A 4NM1A 1N63A 5DG9A 3RF9A 1T8EA 2HCFA 1XNSA 1L7NA 1KQQA 1TKDA 2R8GA 1A76A 4GC6A 3HKZC 2KFZA 1L7PA 5ALVA 5KFOA 4PHEA 3G6YA 1UPHA 3L5KA 3RBEA 1D8YA 1NK6A 1QTMA 3OSNA 2BQ3A 3F53A 2BKEA 1SGGA 1TE2A 2D8CA 3RFAA 4PL2A 2DKXA 3OJUA 2Q4TA 2LM4A 2MUTB 4B9VA 4QZEA 1WWUA 4M9LA 1TAUA 4TQSA 5ALRA 3IN5A 5AKKA 1CRXA 9ICJA 1EXNA 2KD1A 3JPOA 5J0SA 5AKHA 4EZ9A 2FMQA 1ZQTA 3RB4A 2KJ9A 4I27A 5HR7A 1FEZA 4C4SA 4GLXA 1IV8A 1S76D 1XWLA 3HT3A 4FZLA 3UXPA 1KEJA 3GV5B 4JUZA 1CEZA 7ICUA 2NO5A 3UMGA 5BOLA 4F4YA 1ZD4A 2XIDA 4DL7A 1TAQA 4RQ1A 2G09A 3THVA 3MGVA 2PFQA 8ICAA 3RAXA 1ZQBA 4ED6A 3WK9A 1JIHA 5AK3A 1RG6A 3KOOA 3ISCA 2OM6A 5JU5A 3NVVA 2NRZA 3D6JA 4US8A 3N7SC 3ICXA 5IILA 2HOFA 5L1MA 3RH4A 4MFAA 2HBLA 2IOHA 2HDOA 1UT5A 4O5CA 2ZTEA 4KLEA 5ALHA 8ICFA 2PI4A 2YQEA 5ALGA 5CWRA 2HOIA 4YR0A 3IP4B 1Q3VA 5DG7A 5ALFA 4F5PA 1PZNA 1QSSA 4NWIA 2I1QA 4BWMA 1N61A 5AKIA 3SAFA 2PFOA 3H8JA 4YCXA 1Z19A 2WAQC 3H40A 1NK8A 1RZTA 2W11A 3C5FA 4AP9A 4M9NA 3OHAA 8ICJA 4OJLA 3V6JA 4QW9A 1K1SA 3LWMA 4ICAA 2ZUBA 5J0OA 3CP8A 4DF8A 5C0YA 2YTUA 4PGYA 2P6UA 3ED5A 4ECWA 4EBCA 2BCVA 4O3RA 2ZXIA 4I2HA 1ZQRA 1ZD2P 3KKAA 2JH1A 4FFDA 1S0MA 1L3TA 4UB2A 4BDPA 4F4XA 1X9MA 9ICFA 5EWGA 5ALWA 3MDAA 2DQNB 1KFDA 2B21A 2WB1C 3ETLA 4QW8A 2P66A 4Y2XA 3EUB2 2KJ8A 2Y0SF 4IS7A 1PVRA 4F5NA 3JPTA 3MR2A 3V7JA 2WF6A 2AXTU 1B4FA 4QZ9A 9ICCA 4FBTA 5KAFU 2QB1A 3B0YA 5KFAA 2JEJA 4C7ZA 3H8WA 5KL1B 3E58A 2UVVA 2F1JA 2G5HB 5GTIU 5J0RA 5KTQA 2HOQA 4YMMA 3C1YA 2LMRA 2K60A 3N28A 2Y1IA 3LDAA 5J2EA 4YR3A 4RU9A 5KFKA 4DSIA 1JUDA 3D2SA 4UQGA 1TFRA 3UXNA 2KMDA 2IOFA 1UT8A 3LVWA 1NKEA 4FE3A 4FO6A 3TANA 1ZQPA 4O3SA 4GXIA 1V85A 2IMWP 5KT3A 2BZFA 4NLCA 3N7PD 3PO5A 1BVSA 3MR3A 1Y88A 5KFGA 4A8EA 4EYIB 2GOLA 2AGPA 4M9HA 1JN3A 3PW7A 2QARB 2MRLA 4YFKA 2ZUCA 2PMZC 2FE9A 4DOCA 4R64A 9ICPA 3WK8A 4BJQA 5DLFA 4G9BA 5D4BA 4F92B 1ZQWA 3ZDEA 3AQEA 2QLTA 4UARA 2WHEA 3LK9A 4O0IA 4DQPA 4PHAA 2XCPA 2E8MA 2XY6A 2ZUDA 3HP6A 3PW4A 9ICNA 3DDHA 3HJEA 4HAIA 2ALZA 5KFUA 3QU9A 4F72A 4JMUA 1LB2B 4F91B 2OH2A 4PHDA 4RQNA 4Z6DA 8ICVA 1RQLA 3PZPA 1X6IA 2LBOA 1BNPA 3EPGA 1HJPA 5KG2A 9ICAA 2EAPA 4P4MA 3Q8SB 4LZDA 4MEYA 5DB8A 4YG2A 1KFTA 3GFKB 5ALKA 2Q0ZX 4NM2A 3SZ2A 4DOAA 2EDUA 4UAWA 5KFJA 1N5WA 4Y2UA 4RQ4A 4F4ZA 5G5HA 4KLUA 3LWLA 4QZDA 4M6WA 3MABA 4KX3A 1X2IA 3ISDA 4RQ3A 5CHGA 1PVQA 1NZPA 1KSPA 2BCQA 4KLSA 2NRTA 2OXOA 3KHGA 1KRPA 5KFDA 3A0HU 3QU2A 4I2GA 2KN7A 1TK0A 1V38A 1BPBA 2VIXA 3PY8A 1RM6C 2W3RA 1SIJA 3M1YA 8ICXA 2MAXA 4O3MA 3TKAA 5DQIA 8ICBA 1Q3UA 2VKQA 1KKXA 5KT7A 2RRDA 4RPZA 2BPFA 1SXEA 1S77D 3CYMA 5F3XB 1D9FA 2YMLA 1PK1B 3FAHA 3MR6A 5H2FU 4RNOA 5IINA 4WJ3B 4KN4A 1ZJMA 2RP5A 3TQ1A 2ISOA 4OJ6A 5FP0A 2D6FC 3QE9Y 3H8MA 4UB6U 3QU4A 2ZXHA 8ICQA 2W9CB 4KITB 4M9JA 1X6JA 8ICWA 4YD1A 1SV0C 4ED3A 2KZ3A 4J9PA 1KN5A 3RB6A 3GIKA 5C5JA 3GQCA 3OHBA 3ZD8A 2FPMA 1AROP 1RYRA 1KBUA 2KIWA 3GU3A 4RT3A 1Q46A 4PL1A 3C28A 3AEVA 5J2BA 2LI6A 4UATA 2W3SA 4R8UB 2LYAA 2YB1A 2KJ5A 4YR2A 4DCCA 2EANA 2ZIXB 5KFPA 5AI4A 4Q45A 5BOMA 3SMVA 3R9KA 2HBJA 2EZYA 1BPDA 9ICWA 4P0QB 3RTVA 2OHFA 5DKWA 3T5HA 2JR5A 3IG8A 1L8LA 4EBDA 3LVVA 2KP7A 2R8IA 1U45A 4Z6EA 4DS4A 4IR1A 4RT2A 4DLGA 1UA1A 3BQ1A 5TZVA 5CJ7A 3SQIA 4DSEA 4F2RA 5HMLA 4YVZA 2NRVA 3C2KA 5J0YA 1RXWA 1GO3F 2E3TA 2JMGA 3Q8KA 8ICNA 5EE9A 3M9OB 5CEHA 4DFJA 4M2YA 2KKVA 2O6KA 5J2HA 2N1RA 1COOA 3GZFA 1P7DA 3JPNA 4ECZA 4NL9A 2KICA 5KFVA 1RXVA 1L7OA 5J2AA 4PH5A 2Y9TA 2GO7A 2Y9UA 3H0LB 2WF8A 2M9NA 1S0NA 3RJFA 4IRCA 5AKGA 2OCEA 2BCRA 4Q44A 4C8MA 4P4OA 3V6KA 4ELUA 5AICA 4UB4A 4UASA 2K4IA 2YY6A 1D9DA 8ICEA 3PV8A 3Q8MA 5ALDA 5KAIU 5CB1A 4R63A 4YXMA 1N56A 2KE7A 7ICGA 4J9QA 4J9RA 3OTQA 4DS5A 9ICKA 9ICEA 2ZIUB 5AIAA 2GLEA 5J0UA 3T5KA 3ETRA 1X40A 3QXGA 3E2EA 1AQ6A 1XS9D 4M6WB 2BPCA 4I2JA 2KVSA 4U6PA 3M6ZA 1ZQZA 2GWSA 2NYVA 4IQVA 4Y2YA 2ZJ8A 5J2CA 4CDGA 1S5LU 4ZH4A 2OYYA 4ZOHC 2BDPA 4KN7A 2DF4B 2ZTDA 3WKAA 3ZDCA 4LZGA 8ICIA 5AK4A 1J2NA 4USAA 3SENA 3PSIA 4QZAA 1S97A 1S0VA 9ICXA 4F3OA 1NK4A 1ZQDA 3I28A 3EPIA 4KLHA 1UQVA 1NK9A 5IIMA 4DL2A 1BPXA 4PGQA 2BCUA 4Z6FA 5DBCA 3M8RA 3SR6A 3JPQA 1DOQA 4PZOA 5KL8B 2RLTA 3QUQA 5KNIA 5AI9A 4ED1A 2AGQA 2YMQA 3PNCA 1N62A 3GV7B 1HIWA 3SAGA 3C5GA 4BXOB 1BGXT 4MFCA 7ICTA 2KZZA 1ZXIA 3V72A 2JZBA 1ZQHA 1DGJA 3JPPA 4B9NA 4Q8EA 1U47A 4RUCA 3RRHA 4DQRA 3UQ2A 4UAUA 4R65A 2E1FA 3ZDAA 2ASDA 4J9SA 4NY8A 4ECSA 3H7IA 4OD0A 1N48A 5DGAA 9ICBA 4IQTA 2W9AA 4P0PB 2BDUA 3UMCA 3PVXA 3B9JA 1NK0A 5ALQA 3DEEA 2J6TA 3Q8QB 3IHQB 1ZQIA 5DBBA 3KKAC 2DWQA 2IHMA 2HVIA 2G06A 2KSOA 4UAYA 8ICKA 2WF5A 4DFPA 1QQ5A 4OO1J 3AUOA 2W9BA 2F8KA 4NLKA 5KFWA 2ZIWA 4DF4A 3SV3A 1UHUA 1V97A 4IR9A 4BGDA 1FFUA 2C2DA 5DG8A 5AKZA 3WK7A 4KLLA 4DSJA 1T3NA 4JWMA 3KZXA 4O5EA 5ALEA 1WYGA 4MF2A 3HRDD 3FC4A 1PVPA 1K1QA 2IA6A 2DPJA 1B22A 4NXZA 5KFRA 2PI5A 4B9UA 2KV2A 3M7DA 1RPLA 4KMUA 2W43A 3TFRA 3RJGA 5KT5A 3HW8A 3MFIA 8ICTA 4MFFA 3WU2U 3PR5B 4ED7A 4IQUA 4RPXA 1BPEA 1M6YA 2DFLA 2JRZA 2W8KA 3F2CA 5B5EU 2HHSA 5T14A 2ES6A 5ALOA 4J9MA 4CF4A 2GH1A 5KT2A 2BGWA 3QUTA 3NS1A 2XGQA 9ICMA 4DSFA 2K4PA 3RJHA 5ALPA 3IM1A 2H3IA 2KFNA 5F9LA 3RBDA 2EAMA 1MA7A 3HKZF 1DRGA 4JB3A 1ZYQA 4KLGA 8ICHA 4F5OA 2FDRA 2RDJA 3H8SA 1ZQSA 1YT3A 7ICJA 3BQ0A 3IG5A 3O0FA 8ICUA 3ZDBA 3V7KA 1NK7A 3M9MB 3WKDA 2E8OA 3M9NB 4TQRA 5KG5A 2HW3A 1OUQA 2IBKA 1J2MA 2JV3A 3PO4A 1VJ5A 3PW2A 1CUKA 5DQHA 1QLNA 5L1JA 4YMOA 4NLBA 1KW4A 7ICFA 3RJKA 4RNNA 5CA7A 2D3DA 4DSLA 3BQ7A 3QYPA 2JEIA 4Y2JA 4O3QA 2ZIVA 3MC1A 3LYSA 1PK3A 1NNLA 1QSLA 4XA5A 3ZI4A 3HILA 4DL4A 5IIJA 2W03A 4QNLA 2LPEA 2VJ5A 4HYKA 1JI7A 3BQ2A 2JZBB 5AI8A 1NKBA 3WK6A 4ED8A 5KG4A 4ELVA 5ALJA 1QCKA 3AU2A 2FLLA 2ODGA 2YB4A 3VC8A 4B9MA 8ICZA 4I29A 3BQTA 2R8JA 4B9SA 5DBAA 5AM5A 4PJ0U 1FFVA 4UB1A 5CR0A 4J9LA 3BJYA 3HX0A 4DLEA 3F5AA 3AM9A 3L4PA 4QZBA 1NJWA 4US9A 3KBBA 9ICHA 2PKEA 5ALZA 3GV8B 4EBEA 4KX5A 1U4BA 4UBBA 4DOBA 2F1IA 5ALIA 1C7YA 1WUDA 2G08A 2FLNA 5TISU 4F5RA 4J03A 2MA1A 5DDMA 2W9BB 2AH5A 1T4GA 7ICVA 3RJEA 4QWCA 3CNHA 1ZQCA 2KHVA 2EZZA 2HI0A 1RYSA 8ICLA 2LHTA 4ELTA 5J2FA 4FZMA 4ECQA 2BPGA 1KLNA 4B9LA 3G6VA 7ICIA 4ECYA 1XSNA 2PFPA 3DV9A 5DLGA 4QIWC 4JK1A 4UBCA 2VJ4A 3MFHA 2BR0A 7ICKA 3RR8A 3BS5A 4QZFA 2WAQF 1JRPA 2QB0A 2OWOA 2C2EA 2XVTA 1SL0A 1ZRMA 3QZ7A 1HUOA 4EELA 3QU7A 4CRXA 1B43A 3PX0A 3GIIA 3N97B 2HVHA 5KFYA 4IRDA 7ICEA 2W54A 3TADA 2W8LA 4OCZA 2B0CA 2OEHA 1BPYA 4IRKA 4ED0A 2CPRA 2UVUA 2WF9A 3H0MB 1SL2A 1K5OA 5J2GA 4Y2SA 3F2BA 4JV1A 3ALRA 2RQ5A 3C21A 1ZQKA 3GIJA 1L3VA 1XO1A 4B6JA 3EW9A 2XY7A 3OPXA 4EYHB 4F4KA 2HHVA 2WB1F 2LYHA 5ALYA 5AKJA 3EWAA 1ECWA 4C8OA 9ICSA 4Q8FA 2ZJAA 1ZQVA 1TK8A 2MUTA 4IL6U 3J81j 5DQGA 3NRWA 1WG8A 2KEYA 3JPSA 4F2SA 1X9SA 4O3NA 5EWEA 4I2BA 2L5YA 4ECVA 5ALUA 4DQQA 4IC9A 3Q8RB 4TURA 5J2DA 1S8OA 4NL9C 3T3FA 4UAVA 2XO7A 4OJPA 1DXSA 1V9PA 4QZGA 1O08A 3TFSA 3PSTA 4F4WA 1NKCA 4DFKA 4C8KA 4BWJA 5J0QA 4OJOA 5AIBA 4GFJA 2AJQA 2PFNA 5J0XA 1Q8KA 2R8HA 5ALNA 5J2IA 4C7YA 1F0MA 3NASA 3PW0A 4PGXA 1DK2A 2HBKA 2XC9A 1OW5A 1A77A 2VA3A 2P35A 2M0NA 1JXLA 3PW5A 4KLFA 4MF8A 1TK5A 2DGZA 2ESEA 1ZETA 1LV5A 1L5UA 1JX4A 1TV9A 7ICOA 7ICPA 1C20A 5F9NA 1NJYA 1H38A 9ICUA 3RRGA 4F71A 3I1YA 2AU0A 1F5SA 3G6XA 2ATLA 2MSNA 3PX6A 1LVHA 3CW2C 1Z4OA 3F5EA 1ZQFA 5IIOA 3NVWA 2K4HA 5A0LA 9ICTA 1SKSA 4M04A 1BNOA 4CCHA 4EX7A 1ZQYA 1DK3A 2NO4A 4RQ2A 3GILA 3L3FX 2F77X 3RJJA 4YMNA 1SZHA 4DL3A 2ASLA 5AKLA 3RH5A 2RDIA 3SEIA 4PHPA 3TACB 2E8PA 7ICMA 3V7LA 1U48A 2C28A 4QZCA 2H3FA 4XQ8A 2E1EA 5ALSA 2HHQA 1ZQQA 1N5XA 3KZIU 3MGIA 5AM2A 1URJA 5J0WA 2A19A 5J0TA 4QWBA 1A0PA 1IXRA 3HWTA 5L9XA 4YP3A 1HEKA 2LM1A 2W04A 9ICOA 4ECUA 1RYUA 5EWFA 2DL0A 1WCNA 1SB3C 1B0XA 4NLGA 3UMBA 4YN4A 4EEYA 5KT4A 5KFQA 2A1JA 4BX9C 1ZQGA 4TUQA 2KZMA 1PUZA 2V9WA 2Y0SC 3U26A 5KFHA 1MC8A 4GC7A 2FMPA 2W7PA 1T7PA 2UVWA 1X66A 2NV3A 5B66U 2KK0A 3QEBZ 2DUYA 4NLNA 2DKZA 3K1ZA 1N60A 5KFLA 5IIKA 1ZJNA 4C8LA 5L1KA 2RHFA 3QUBA 1ZQUA 2J6SA 2ZG6A 2AGOA 3CRXA 3H4BA 3SAHA 1Z1VA 1QH9A 1ZQ1C 2E5SA 2KVCA 3D2QA 4DL6A 1L6NA 2A1AA 5EE0A 2CN1A 5KG7A 5EE3A 2XY5A 4J9KA 1KL9A 2EZXA 4ECXA 5L1LA 4KLDA 2K8AA 3QU5A 5ALMA 1QQ6A 1HUZA 4EEKA 5KFCA 2W55A 4E0DA 4FS1A 2EAOA 5AKEA 2Y1JA 3SD7A 2V4QA 1IM4A 5J8YA 1ZQJA 4RQ7A 2K89A 1VLBA 2FLPA 2JH7A 5G5GA 4YXJA 7ICHA 4JV2A 5KFTA 4DWIA 4QZIA 4Y2TA 3PSPA
chains in the Genus database with same CATH topology
1Z19A 1CRXA 2H3FA 2HMXA 2WAQC 4OJOA 2E1EA 2KD1A 2KKPA 2LKYA 4GFJA 2G0AA 3NUQA 4KMOB 1URJA 2VIXA 2K8CB 4NV0A 3SQIA 2KHQA 1A0PA 4OJLA 2KJ9A 4QIWC 4NLCA 3C29A 4NLBA 3KZXA 3N7PD 4AYBF 1Z1BA 1Q3UA 1HEKA 2VJ4A 2VKQA 2W04A 2XICA 4ICAA 4A8EA 1TAMA 1GO3F 2RRDA 2GOLA 1A6SA 2ZIWB 1PVPA 2JMGA 2WAQF 3CP8A 2A3VA 2MRLA 2Z7JA 2LYBA 4FZLA 5C0YA 2HBKA 2PMZC 2XVTA 3CYMA 2R18A 2ZIVA 4O3MA 3LYSA 2KKVA 2H3QA 3VCBA 4BJQA 3T79A 4QIWF 4BX9C 4CRXA 2ZXIA 4OJ5A 1F44A 2KV2A 3AQFA 3M7DA 2M0NA 2N1RA 2YX8A 3GZFA 5KL8B 2CRXA 3KFUF 5HR6A 2W03A 1P7DA 2JH1A 3ONNA 2Y0SC 4QNLA 3AQEA 4WJ3B 2RP5A 2VJ5A 2XIDA 3D2NA 4OJ6A 2D6FC 2KICA 2DGZA 1HIWA 2W7PA 1ED1A 1T94A 3PSFA 4QJFB 3SAGA 2G07A 2NV3A 2G09A 2ZIVB 2ZXHA 3E0FA 3H0LB 3MGVA 2CPRA 3H0MB 2DQNB 4C0ZA 1IIPA 3K1ZA 3N7RC 2WB1C 2YB4A 3VC8A 3F2CA 2KJ8A 3F2BA 2Y0SF 1PVRA 2K4IA 2ZIUA 2RHFA 4JMUA 5T14A 3F2DA 3ALRA 2OH2A 3F5EA 2ZG6A 4P0PA 3CRXA 3RF9A 1D8BA 3SAHA 2E1FA 2OM6A 2JHDA 2K4HA 2ZIXA 5A0LA 3PZPA 1XNSA 2LBOA 3F5AA 1ZQ1C 2E5SA 2GH1A 2KIWA 2KVCA 3D2QA 3OPXA 4BUGA 1KBUA 1L6NA 3GU3A 3N7SC 2WB1F 3ICXA 2HOFA 2KNJA 2CN1A 3HKZC 2PMZF 4PL1A 1ECWA 2XI9A 3C28A 5HR7A 2HBLA 2K4EA 2ZIUB 4ACOA 4AYBC 2F8LA 4KX5A 3H0RB 1UPHA 4P0QA 5KL1B 4P0PB 2LYAA 2F2AB 2BDUA 2YB1A 1NZBA 5CRXA 2H3ZA 2KJ5A 4FZNA 2K8AA 3L3FX 2F77X 3DEEA 2ZIXB 3NRWA 2JGAA 3F53A 2KEYA 2H3IA 1WUDA 2G08A 1SZHA 4U7CA 2G5IB 2HBMA 2G5HB 3RFAA 4U6PA 1MA7A 4PL2A 3HKZF 1DRGA 3M6ZA 2K8BB 2HOQA 2F76X 4IC9A 2W7OA 2MA1A 1XO0A 3SMVA 2Q4TA 4KX3A 1YT3A 2HBJA 2H3VA 2HOIA 2K89A 3IG5A 4CDGA 3IP4B 3O0FA 1PVQA 2G06A 1Q3VA 2JH7A 4P0QB 4OJPA 2OYYA 2KHVA 3IG8A 3D2SA 2DF4B 4OO1J 4CGZA 2LHTA 3LVVA 3PSTA 4NWIA 2OXOA 3PSPA 3LVWA 3SAFA 1OUQA 3AL0B 4FE3A 3M6KA 4FZMA 3PSIA 2KOBA 2ZIWA 3IN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALR A;  5KL1 B;  5KL8 B; 
#chains in the Genus database with same CATH topology
 2W9M A;  2QAR A;  3C1Z A;  2CXY A;  3NUQ A;  4K4G A;  4I28 A;  1ZRN A;  4NV0 A;  5J2J A;  2KHQ A;  4PPX A;  3AU6 A;  3PMN A;  2VA8 A;  1Z00 A;  3ISB A;  3C29 A;  4AYB F;  1S10 A;  3WKE A;  4RUA A;  4I2A A;  4Y2Q A;  3AN1 A;  4F5Q A;  5L1I A;  4RZR A;  1BPZ A;  2HHX A;  1MN8 A;  2V4R A;  2QKQ A;  3C2L A;  2R18 A;  3KHL A;  5E79 U;  4DEZ A;  4QWA A;  4I2F A;  5HR6 A;  5KG3 A;  2BQR A;  2YMM A;  4RQ6 A;  4QWD A;  3MR5 A;  1L3S A;  4QJF B;  2C2R A;  4UB5 A;  1XSP A;  3PR4 A;  5KFX A;  2ASJ A;  4C4T A;  1IIP A;  4JWN A;  8ICS A;  4Q43 A;  3K1R B;  5KG0 A;  4YD2 A;  3MDC A;  1CI4 A;  1YZ7 A;  4KTQ A;  8ICC A;  1SZP A;  3FM9 A;  4P4P A;  1XC9 A;  3OJS A;  3PX4 A;  2YMP A;  2F2A B;  8ICP A;  3FDS A;  5KFM A;  3Q8L A;  3IV6 A;  4FZN A;  1Z3E B;  1J97 A;  3H4D A;  5ALT A;  1ZQL A;  2HBM A;  2K8B B;  4F50 A;  2F76 X;  3TAR A;  8ICO A;  9ICG A;  5KG6 A;  4Y2V A;  3UM9 A;  5DB6 A;  2IHN A;  1RQN A;  1KDH A;  2F44 A;  1ZD5 A;  1UCV A;  5KFS A;  1U49 A;  3K75 D;  5D49 A;  3M8S A;  4R66 A;  1JXE A;  3TAQ A;  2KOB A;  5AI6 A;  2E8N A;  3IDW A;  3A0B U;  2FPK A;  2HMX A;  3BZK A;  3FYH A;  4CF3 A;  2JXJ A;  5KFI A;  2KTQ A;  1PK1 A;  3V6H A;  3N4M B;  1Z1B A;  3WKB A;  2XIC A;  4C8N A;  2A1J B;  3RR7 A;  2H5X A;  2F3N A;  4DFM A;  2AHO B;  2W9C A;  3T79 A;  2I6X A;  2HHW A;  1S9F A;  4CNQ A;  5KFN A;  4XRH A;  4RQ0 A;  4EEN A;  1ZQN A;  9ICV A;  2VA2 A;  2HHU A;  3KD3 A;  3PSF A;  1SKR A;  5J2K A;  2G07 A;  4DQS A;  5KT6 A;  2NRW A;  5DGB A;  3KHH A;  2VAN A;  5JTI A;  4UW9 A;  1QQ7 A;  4CF5 A;  2FPL A;  4R8U A;  5DB9 A;  4RNM A;  3AMZ A;  2ZTC A;  3S6J A;  3ZD9 A;  9ICQ A;  1S0O A;  2ZIX A;  5KG1 A;  3HPO A;  4BUG A;  5CP2 A;  5KFB A;  7ICQ A;  2YN4 A;  4KLJ A;  2EQY A;  1VDV A;  5AM3 A;  1T3Q A;  1SWV A;  1WWV A;  2WF7 A;  1IG6 A;  2F1H A;  4P0Q A;  1D8L A;  2XGP A;  2JEF A;  4FBU A;  4DO9 A;  2JGA A;  4M9G A;  4U7C A;  3PML A;  3KHR A;  5BPC A;  1O03 A;  2DBY A;  3JPR A;  1DGS A;  3TAD C;  1TVA A;  4Z6C A;  1L8O A;  1SL1 A;  1LKY A;  3RJI A;  4CE6 A;  3T5J A;  4I2C A;  5AI0 A;  4O3O A;  4MEX A;  2BCS A;  2KG5 A;  3M6K A;  4DFD A;  4B9T A;  1Z00 B;  2BQU A;  2LKY A;  3OSP A;  1L3U A;  4KMO B;  2KSO B;  1X9X A;  3UPQ A;  2B6G A;  3QX7 A;  3WK5 A;  1JMS A;  4X5V A;  1TAM A;  1ZQA A;  2ZIW B;  2ISP A;  3EZ5 A;  1COK A;  1XU4 A;  2A3V A;  3MGH A;  2LYB A;  4O9M A;  2I9G A;  9ICL A;  1F44 A;  2YX8 A;  2CRX A;  3ONN A;  5AKX A;  4F93 B;  4C80 A;  5K4L A;  1T94 A;  4M0A A;  1SKW A;  3QNM A;  1NJX A;  2HSZ A;  3NGD A;  2UVR A;  5KFF A;  1QSY A;  2NRX A;  2HHT A;  2ZIU A;  3BS7 A;  5DB7 A;  3F2D A;  5HP4 A;  1MSW D;  5HHH A;  4FS2 A;  4GXK A;  5JUM A;  3KTQ A;  5JRT A;  1MQ3 A;  4NLZ A;  1NJZ A;  3RAQ A;  2KNJ A;  4Y2R A;  4TUS A;  2P6R A;  2XI9 A;  2BHN A;  4RQM A;  8ICY A;  5J0P A;  5EOZ A;  4KLO A;  5III A;  3WK4 A;  4K4H A;  4J9N A;  3SV4 A;  5CRX A;  2WTF A;  1ZQM A;  4JV0 A;  5AI5 A;  4O3P A;  1X9W A;  3OGU A;  1UA0 A;  5HNK A;  8ICG A;  4PZN A;  2WFA A;  5DDY A;  4RQ5 A;  1Z4N A;  5AK6 A;  3BDP A;  1XO0 A;  9ICI A;  5AK5 A;  2H3V A;  8ICM A;  1U9L A;  5KFZ A;  4QZH A;  4UB3 A;  1MQ2 A;  5J29 A;  7ICL A;  1KFS A;  4CGZ A;  9ICR A;  2KKP A;  2ZJ5 A;  3EYZ A;  2G0A A;  2C22 A;  2FMS A;  3BZC A;  1NOM A;  2IOF K;  1WCL A;  2EH9 A;  2DPI A;  3TI0 A;  4M47 A;  1FIQ A;  3ORY A;  1A6S A;  5D46 A;  5EE1 A;  3IRU A;  5HHI A;  4I2E A;  4RPY A;  4BXO A;  4I2I A;  2H3Q A;  3SYZ A;  1ZQE A;  2J6U A;  3KFU F;  1RDF A;  4TUP A;  3D2N A;  2I5H A;  2ZIV B;  3E0F A;  7ICS A;  4C0Z A;  4LVS A;  4UAZ A;  3ZDD A;  2FJ6 A;  4ECR A;  1JRO A;  3T5L A;  4P0P A;  3C2M A;  1D8B A;  3NRZ A;  2JHD A;  2AQ4 A;  8ICR A;  4ED2 A;  4GIB A;  3RB3 A;  3RH6 A;  2XCA A;  3RB0 A;  3NVY A;  1ZQX A;  2PMZ F;  5AM4 A;  2K4E A;  4ACO A;  4QWE A;  4AYB C;  2F8L A;  3H0R B;  1NI3 A;  3UXO A;  1NZB A;  1ZOL A;  2H3Z A;  3C23 A;  4UB8 U;  4QZ8 A;  1NK5 A;  1JAL A;  4DQI A;  2G5I B;  2PXI A;  1LKY B;  5ALL A;  2W7O A;  7ICR A;  4KLT A;  3NTU A;  3K4G A;  1ZD3 A;  5ALX A;  5HMM A;  1XSL A;  4DSK A;  5AHX A;  4IQW A;  3Q8P B;  2MU2 A;  1SXD A;  2JEG A;  3MBY A;  2R8K A;  1SV4 A;  4XUS A;  3AL0 B;  4GXJ A;  3SI8 A;  3QUC A;  1SV0 A;  1YZ6 A;  4NJ8 A;  1FO4 A;  1SWW A;  2K8C B;  4ECT A;  3GDX A;  1X42 A;  3QZ8 A;  5AM0 A;  3WKC A;  4Y2P A;  3TAP A;  4O5K A;  4MHV A;  4F8R A;  4I2D A;  4P2H A;  4G3I A;  2Z7J A;  4KLQ A;  3QEA Z;  2KIV A;  1ZQO A;  3VCB A;  4QIW F;  4OJ5 A;  4KLI A;  3AQF A;  4DL5 A;  4EZ6 A;  5GTH U;  2AQ0 A;  5AM1 A;  5J8Y C;  3BS5 B;  3UQ0 A;  2QB0 B;  3B0X A;  1ED1 A;  1N2X A;  1L7M A;  2FI1 A;  4K4I A;  4KLM A;  4LJX A;  3I76 A;  7ICN A;  3GIM A;  3NVZ A;  3N7R C;  5KFE A;  4YQW A;  5AKY A;  4C4R A;  4J9O A;  1KTQ A;  4EX6 A;  1OXJ A;  4RQ8 A;  4NM1 A;  1N63 A;  5DG9 A;  3RF9 A;  1T8E A;  2HCF A;  1XNS A;  1L7N A;  1KQQ A;  1TKD A;  2R8G A;  1A76 A;  4GC6 A;  3HKZ C;  2KFZ A;  1L7P A;  5ALV A;  5KFO A;  4PHE A;  3G6Y A;  1UPH A;  3L5K A;  3RBE A;  1D8Y A;  1NK6 A;  1QTM A;  3OSN A;  2BQ3 A;  3F53 A;  2BKE A;  1SGG A;  1TE2 A;  2D8C A;  3RFA A;  4PL2 A;  2DKX A;  3OJU A;  2Q4T A;  2LM4 A;  2MUT B;  4B9V A;  4QZE A;  1WWU A;  4M9L A;  1TAU A;  4TQS A;  5ALR A;  3IN5 A;  5AKK A;  1CRX A;  9ICJ A;  1EXN A;  2KD1 A;  3JPO A;  5J0S A;  5AKH A;  4EZ9 A;  2FMQ A;  1ZQT A;  3RB4 A;  2KJ9 A;  4I27 A;  5HR7 A;  1FEZ A;  4C4S A;  4GLX A;  1IV8 A;  1S76 D;  1XWL A;  3HT3 A;  4FZL A;  3UXP A;  1KEJ A;  3GV5 B;  4JUZ A;  1CEZ A;  7ICU A;  2NO5 A;  3UMG A;  5BOL A;  4F4Y A;  1ZD4 A;  2XID A;  4DL7 A;  1TAQ A;  4RQ1 A;  2G09 A;  3THV A;  3MGV A;  2PFQ A;  8ICA A;  3RAX A;  1ZQB A;  4ED6 A;  3WK9 A;  1JIH A;  5AK3 A;  1RG6 A;  3KOO A;  3ISC A;  2OM6 A;  5JU5 A;  3NVV A;  2NRZ A;  3D6J A;  4US8 A;  3N7S C;  3ICX A;  5IIL A;  2HOF A;  5L1M A;  3RH4 A;  4MFA A;  2HBL A;  2IOH A;  2HDO A;  1UT5 A;  4O5C A;  2ZTE A;  4KLE A;  5ALH A;  8ICF A;  2PI4 A;  2YQE A;  5ALG A;  5CWR A;  2HOI A;  4YR0 A;  3IP4 B;  1Q3V A;  5DG7 A;  5ALF A;  4F5P A;  1PZN A;  1QSS A;  4NWI A;  2I1Q A;  4BWM A;  1N61 A;  5AKI A;  3SAF A;  2PFO A;  3H8J A;  4YCX A;  1Z19 A;  2WAQ C;  3H40 A;  1NK8 A;  1RZT A;  2W11 A;  3C5F A;  4AP9 A;  4M9N A;  3OHA A;  8ICJ A;  4OJL A;  3V6J A;  4QW9 A;  1K1S A;  3LWM A;  4ICA A;  2ZUB A;  5J0O A;  3CP8 A;  4DF8 A;  5C0Y A;  2YTU A;  4PGY A;  2P6U A;  3ED5 A;  4ECW A;  4EBC A;  2BCV A;  4O3R A;  2ZXI A;  4I2H A;  1ZQR A;  1ZD2 P;  3KKA A;  2JH1 A;  4FFD A;  1S0M A;  1L3T A;  4UB2 A;  4BDP A;  4F4X A;  1X9M A;  9ICF A;  5EWG A;  5ALW A;  3MDA A;  2DQN B;  1KFD A;  2B21 A;  2WB1 C;  3ETL A;  4QW8 A;  2P66 A;  4Y2X A;  3EUB 2;  2KJ8 A;  2Y0S F;  4IS7 A;  1PVR A;  4F5N A;  3JPT A;  3MR2 A;  3V7J A;  2WF6 A;  2AXT U;  1B4F A;  4QZ9 A;  9ICC A;  4FBT A;  5KAF U;  2QB1 A;  3B0Y A;  5KFA A;  2JEJ A;  4C7Z A;  3H8W A;  5KL1 B;  3E58 A;  2UVV A;  2F1J A;  2G5H B;  5GTI U;  5J0R A;  5KTQ A;  2HOQ A;  4YMM A;  3C1Y A;  2LMR A;  2K60 A;  3N28 A;  2Y1I A;  3LDA A;  5J2E A;  4YR3 A;  4RU9 A;  5KFK A;  4DSI A;  1JUD A;  3D2S A;  4UQG A;  1TFR A;  3UXN A;  2KMD A;  2IOF A;  1UT8 A;  3LVW A;  1NKE A;  4FE3 A;  4FO6 A;  3TAN A;  1ZQP A;  4O3S A;  4GXI A;  1V85 A;  2IMW P;  5KT3 A;  2BZF A;  4NLC A;  3N7P D;  3PO5 A;  1BVS A;  3MR3 A;  1Y88 A;  5KFG A;  4A8E A;  4EYI B;  2GOL A;  2AGP A;  4M9H A;  1JN3 A;  3PW7 A;  2QAR B;  2MRL A;  4YFK A;  2ZUC A;  2PMZ C;  2FE9 A;  4DOC A;  4R64 A;  9ICP A;  3WK8 A;  4BJQ A;  5DLF A;  4G9B A;  5D4B A;  4F92 B;  1ZQW A;  3ZDE A;  3AQE A;  2QLT A;  4UAR A;  2WHE A;  3LK9 A;  4O0I A;  4DQP A;  4PHA A;  2XCP A;  2E8M A;  2XY6 A;  2ZUD A;  3HP6 A;  3PW4 A;  9ICN A;  3DDH A;  3HJE A;  4HAI A;  2ALZ A;  5KFU A;  3QU9 A;  4F72 A;  4JMU A;  1LB2 B;  4F91 B;  2OH2 A;  4PHD A;  4RQN A;  4Z6D A;  8ICV A;  1RQL A;  3PZP A;  1X6I A;  2LBO A;  1BNP A;  3EPG A;  1HJP A;  5KG2 A;  9ICA A;  2EAP A;  4P4M A;  3Q8S B;  4LZD A;  4MEY A;  5DB8 A;  4YG2 A;  1KFT A;  3GFK B;  5ALK A;  2Q0Z X;  4NM2 A;  3SZ2 A;  4DOA A;  2EDU A;  4UAW A;  5KFJ A;  1N5W A;  4Y2U A;  4RQ4 A;  4F4Z A;  5G5H A;  4KLU A;  3LWL A;  4QZD A;  4M6W A;  3MAB A;  4KX3 A;  1X2I A;  3ISD A;  4RQ3 A;  5CHG A;  1PVQ A;  1NZP A;  1KSP A;  2BCQ A;  4KLS A;  2NRT A;  2OXO A;  3KHG A;  1KRP A;  5KFD A;  3A0H U;  3QU2 A;  4I2G A;  2KN7 A;  1TK0 A;  1V38 A;  1BPB A;  2VIX A;  3PY8 A;  1RM6 C;  2W3R A;  1SIJ A;  3M1Y A;  8ICX A;  2MAX A;  4O3M A;  3TKA A;  5DQI A;  8ICB A;  1Q3U A;  2VKQ A;  1KKX A;  5KT7 A;  2RRD A;  4RPZ A;  2BPF A;  1SXE A;  1S77 D;  3CYM A;  5F3X B;  1D9F A;  2YML A;  1PK1 B;  3FAH A;  3MR6 A;  5H2F U;  4RNO A;  5IIN A;  4WJ3 B;  4KN4 A;  1ZJM A;  2RP5 A;  3TQ1 A;  2ISO A;  4OJ6 A;  5FP0 A;  2D6F C;  3QE9 Y;  3H8M A;  4UB6 U;  3QU4 A;  2ZXH A;  8ICQ A;  2W9C B;  4KIT B;  4M9J A;  1X6J A;  8ICW A;  4YD1 A;  1SV0 C;  4ED3 A;  2KZ3 A;  4J9P A;  1KN5 A;  3RB6 A;  3GIK A;  5C5J A;  3GQC A;  3OHB A;  3ZD8 A;  2FPM A;  1ARO P;  1RYR A;  1KBU A;  2KIW A;  3GU3 A;  4RT3 A;  1Q46 A;  4PL1 A;  3C28 A;  3AEV A;  5J2B A;  2LI6 A;  4UAT A;  2W3S A;  4R8U B;  2LYA A;  2YB1 A;  2KJ5 A;  4YR2 A;  4DCC A;  2EAN A;  2ZIX B;  5KFP A;  5AI4 A;  4Q45 A;  5BOM A;  3SMV A;  3R9K A;  2HBJ A;  2EZY A;  1BPD A;  9ICW A;  4P0Q B;  3RTV A;  2OHF A;  5DKW A;  3T5H A;  2JR5 A;  3IG8 A;  1L8L A;  4EBD A;  3LVV A;  2KP7 A;  2R8I A;  1U45 A;  4Z6E A;  4DS4 A;  4IR1 A;  4RT2 A;  4DLG A;  1UA1 A;  3BQ1 A;  5TZV A;  5CJ7 A;  3SQI A;  4DSE A;  4F2R A;  5HML A;  4YVZ A;  2NRV A;  3C2K A;  5J0Y A;  1RXW A;  1GO3 F;  2E3T A;  2JMG A;  3Q8K A;  8ICN A;  5EE9 A;  3M9O B;  5CEH A;  4DFJ A;  4M2Y A;  2KKV A;  2O6K A;  5J2H A;  2N1R A;  1COO A;  3GZF A;  1P7D A;  3JPN A;  4ECZ A;  4NL9 A;  2KIC A;  5KFV A;  1RXV A;  1L7O A;  5J2A A;  4PH5 A;  2Y9T A;  2GO7 A;  2Y9U A;  3H0L B;  2WF8 A;  2M9N A;  1S0N A;  3RJF A;  4IRC A;  5AKG A;  2OCE A;  2BCR A;  4Q44 A;  4C8M A;  4P4O A;  3V6K A;  4ELU A;  5AIC A;  4UB4 A;  4UAS A;  2K4I A;  2YY6 A;  1D9D A;  8ICE A;  3PV8 A;  3Q8M A;  5ALD A;  5KAI U;  5CB1 A;  4R63 A;  4YXM A;  1N56 A;  2KE7 A;  7ICG A;  4J9Q A;  4J9R A;  3OTQ A;  4DS5 A;  9ICK A;  9ICE A;  2ZIU B;  5AIA A;  2GLE A;  5J0U A;  3T5K A;  3ETR A;  1X40 A;  3QXG A;  3E2E A;  1AQ6 A;  1XS9 D;  4M6W B;  2BPC A;  4I2J A;  2KVS A;  4U6P A;  3M6Z A;  1ZQZ A;  2GWS A;  2NYV A;  4IQV A;  4Y2Y A;  2ZJ8 A;  5J2C A;  4CDG A;  1S5L U;  4ZH4 A;  2OYY A;  4ZOH C;  2BDP A;  4KN7 A;  2DF4 B;  2ZTD A;  3WKA A;  3ZDC A;  4LZG A;  8ICI A;  5AK4 A;  1J2N A;  4USA A;  3SEN A;  3PSI A;  4QZA A;  1S97 A;  1S0V A;  9ICX A;  4F3O A;  1NK4 A;  1ZQD A;  3I28 A;  3EPI A;  4KLH A;  1UQV A;  1NK9 A;  5IIM A;  4DL2 A;  1BPX A;  4PGQ A;  2BCU A;  4Z6F A;  5DBC A;  3M8R A;  3SR6 A;  3JPQ A;  1DOQ A;  4PZO A;  5KL8 B;  2RLT A;  3QUQ A;  5KNI A;  5AI9 A;  4ED1 A;  2AGQ A;  2YMQ A;  3PNC A;  1N62 A;  3GV7 B;  1HIW A;  3SAG A;  3C5G A;  4BXO B;  1BGX T;  4MFC A;  7ICT A;  2KZZ A;  1ZXI A;  3V72 A;  2JZB A;  1ZQH A;  1DGJ A;  3JPP A;  4B9N A;  4Q8E A;  1U47 A;  4RUC A;  3RRH A;  4DQR A;  3UQ2 A;  4UAU A;  4R65 A;  2E1F A;  3ZDA A;  2ASD A;  4J9S A;  4NY8 A;  4ECS A;  3H7I A;  4OD0 A;  1N48 A;  5DGA A;  9ICB A;  4IQT A;  2W9A A;  4P0P B;  2BDU A;  3UMC A;  3PVX A;  3B9J A;  1NK0 A;  5ALQ A;  3DEE A;  2J6T A;  3Q8Q B;  3IHQ B;  1ZQI A;  5DBB A;  3KKA C;  2DWQ A;  2IHM A;  2HVI A;  2G06 A;  2KSO A;  4UAY A;  8ICK A;  2WF5 A;  4DFP A;  1QQ5 A;  4OO1 J;  3AUO A;  2W9B A;  2F8K A;  4NLK A;  5KFW A;  2ZIW A;  4DF4 A;  3SV3 A;  1UHU A;  1V97 A;  4IR9 A;  4BGD A;  1FFU A;  2C2D A;  5DG8 A;  5AKZ A;  3WK7 A;  4KLL A;  4DSJ A;  1T3N A;  4JWM A;  3KZX A;  4O5E A;  5ALE A;  1WYG A;  4MF2 A;  3HRD D;  3FC4 A;  1PVP A;  1K1Q A;  2IA6 A;  2DPJ A;  1B22 A;  4NXZ A;  5KFR A;  2PI5 A;  4B9U A;  2KV2 A;  3M7D A;  1RPL A;  4KMU A;  2W43 A;  3TFR A;  3RJG A;  5KT5 A;  3HW8 A;  3MFI A;  8ICT A;  4MFF A;  3WU2 U;  3PR5 B;  4ED7 A;  4IQU A;  4RPX A;  1BPE A;  1M6Y A;  2DFL A;  2JRZ A;  2W8K A;  3F2C A;  5B5E U;  2HHS A;  5T14 A;  2ES6 A;  5ALO A;  4J9M A;  4CF4 A;  2GH1 A;  5KT2 A;  2BGW A;  3QUT A;  3NS1 A;  2XGQ A;  9ICM A;  4DSF A;  2K4P A;  3RJH A;  5ALP A;  3IM1 A;  2H3I A;  2KFN A;  5F9L A;  3RBD A;  2EAM A;  1MA7 A;  3HKZ F;  1DRG A;  4JB3 A;  1ZYQ A;  4KLG A;  8ICH A;  4F5O A;  2FDR A;  2RDJ A;  3H8S A;  1ZQS A;  1YT3 A;  7ICJ A;  3BQ0 A;  3IG5 A;  3O0F A;  8ICU A;  3ZDB A;  3V7K A;  1NK7 A;  3M9M B;  3WKD A;  2E8O A;  3M9N B;  4TQR A;  5KG5 A;  2HW3 A;  1OUQ A;  2IBK A;  1J2M A;  2JV3 A;  3PO4 A;  1VJ5 A;  3PW2 A;  1CUK A;  5DQH A;  1QLN A;  5L1J A;  4YMO A;  4NLB A;  1KW4 A;  7ICF A;  3RJK A;  4RNN A;  5CA7 A;  2D3D A;  4DSL A;  3BQ7 A;  3QYP A;  2JEI A;  4Y2J A;  4O3Q A;  2ZIV A;  3MC1 A;  3LYS A;  1PK3 A;  1NNL A;  1QSL A;  4XA5 A;  3ZI4 A;  3HIL A;  4DL4 A;  5IIJ A;  2W03 A;  4QNL A;  2LPE A;  2VJ5 A;  4HYK A;  1JI7 A;  3BQ2 A;  2JZB B;  5AI8 A;  1NKB A;  3WK6 A;  4ED8 A;  5KG4 A;  4ELV A;  5ALJ A;  1QCK A;  3AU2 A;  2FLL A;  2ODG A;  2YB4 A;  3VC8 A;  4B9M A;  8ICZ A;  4I29 A;  3BQT A;  2R8J A;  4B9S A;  5DBA A;  5AM5 A;  4PJ0 U;  1FFV A;  4UB1 A;  5CR0 A;  4J9L A;  3BJY A;  3HX0 A;  4DLE A;  3F5A A;  3AM9 A;  3L4P A;  4QZB A;  1NJW A;  4US9 A;  3KBB A;  9ICH A;  2PKE A;  5ALZ A;  3GV8 B;  4EBE A;  4KX5 A;  1U4B A;  4UBB A;  4DOB A;  2F1I A;  5ALI A;  1C7Y A;  1WUD A;  2G08 A;  2FLN A;  5TIS U;  4F5R A;  4J03 A;  2MA1 A;  5DDM A;  2W9B B;  2AH5 A;  1T4G A;  7ICV A;  3RJE A;  4QWC A;  3CNH A;  1ZQC A;  2KHV A;  2EZZ A;  2HI0 A;  1RYS A;  8ICL A;  2LHT A;  4ELT A;  5J2F A;  4FZM A;  4ECQ A;  2BPG A;  1KLN A;  4B9L A;  3G6V A;  7ICI A;  4ECY A;  1XSN A;  2PFP A;  3DV9 A;  5DLG A;  4QIW C;  4JK1 A;  4UBC A;  2VJ4 A;  3MFH A;  2BR0 A;  7ICK A;  3RR8 A;  3BS5 A;  4QZF A;  2WAQ F;  1JRP A;  2QB0 A;  2OWO A;  2C2E A;  2XVT A;  1SL0 A;  1ZRM A;  3QZ7 A;  1HUO A;  4EEL A;  3QU7 A;  4CRX A;  1B43 A;  3PX0 A;  3GII A;  3N97 B;  2HVH A;  5KFY A;  4IRD A;  7ICE A;  2W54 A;  3TAD A;  2W8L A;  4OCZ A;  2B0C A;  2OEH A;  1BPY A;  4IRK A;  4ED0 A;  2CPR A;  2UVU A;  2WF9 A;  3H0M B;  1SL2 A;  1K5O A;  5J2G A;  4Y2S A;  3F2B A;  4JV1 A;  3ALR A;  2RQ5 A;  3C21 A;  1ZQK A;  3GIJ A;  1L3V A;  1XO1 A;  4B6J A;  3EW9 A;  2XY7 A;  3OPX A;  4EYH B;  4F4K A;  2HHV A;  2WB1 F;  2LYH A;  5ALY A;  5AKJ A;  3EWA A;  1ECW A;  4C8O A;  9ICS A;  4Q8F A;  2ZJA A;  1ZQV A;  1TK8 A;  2MUT A;  4IL6 U;  3J81 j;  5DQG A;  3NRW A;  1WG8 A;  2KEY A;  3JPS A;  4F2S A;  1X9S A;  4O3N A;  5EWE A;  4I2B A;  2L5Y A;  4ECV A;  5ALU A;  4DQQ A;  4IC9 A;  3Q8R B;  4TUR A;  5J2D A;  1S8O A;  4NL9 C;  3T3F A;  4UAV A;  2XO7 A;  4OJP A;  1DXS A;  1V9P A;  4QZG A;  1O08 A;  3TFS A;  3PST A;  4F4W A;  1NKC A;  4DFK A;  4C8K A;  4BWJ A;  5J0Q A;  4OJO A;  5AIB A;  4GFJ A;  2AJQ A;  2PFN A;  5J0X A;  1Q8K A;  2R8H A;  5ALN A;  5J2I A;  4C7Y A;  1F0M A;  3NAS A;  3PW0 A;  4PGX A;  1DK2 A;  2HBK A;  2XC9 A;  1OW5 A;  1A77 A;  2VA3 A;  2P35 A;  2M0N A;  1JXL A;  3PW5 A;  4KLF A;  4MF8 A;  1TK5 A;  2DGZ A;  2ESE A;  1ZET A;  1LV5 A;  1L5U A;  1JX4 A;  1TV9 A;  7ICO A;  7ICP A;  1C20 A;  5F9N A;  1NJY A;  1H38 A;  9ICU A;  3RRG A;  4F71 A;  3I1Y A;  2AU0 A;  1F5S A;  3G6X A;  2ATL A;  2MSN A;  3PX6 A;  1LVH A;  3CW2 C;  1Z4O A;  3F5E A;  1ZQF A;  5IIO A;  3NVW A;  2K4H A;  5A0L A;  9ICT A;  1SKS A;  4M04 A;  1BNO A;  4CCH A;  4EX7 A;  1ZQY A;  1DK3 A;  2NO4 A;  4RQ2 A;  3GIL A;  3L3F X;  2F77 X;  3RJJ A;  4YMN A;  1SZH A;  4DL3 A;  2ASL A;  5AKL A;  3RH5 A;  2RDI A;  3SEI A;  4PHP A;  3TAC B;  2E8P A;  7ICM A;  3V7L A;  1U48 A;  2C28 A;  4QZC A;  2H3F A;  4XQ8 A;  2E1E A;  5ALS A;  2HHQ A;  1ZQQ A;  1N5X A;  3KZI U;  3MGI A;  5AM2 A;  1URJ A;  5J0W A;  2A19 A;  5J0T A;  4QWB A;  1A0P A;  1IXR A;  3HWT A;  5L9X A;  4YP3 A;  1HEK A;  2LM1 A;  2W04 A;  9ICO A;  4ECU A;  1RYU A;  5EWF A;  2DL0 A;  1WCN A;  1SB3 C;  1B0X A;  4NLG A;  3UMB A;  4YN4 A;  4EEY A;  5KT4 A;  5KFQ A;  2A1J A;  4BX9 C;  1ZQG A;  4TUQ A;  2KZM A;  1PUZ A;  2V9W A;  2Y0S C;  3U26 A;  5KFH A;  1MC8 A;  4GC7 A;  2FMP A;  2W7P A;  1T7P A;  2UVW A;  1X66 A;  2NV3 A;  5B66 U;  2KK0 A;  3QEB Z;  2DUY A;  4NLN A;  2DKZ A;  3K1Z A;  1N60 A;  5KFL A;  5IIK A;  1ZJN A;  4C8L A;  5L1K A;  2RHF A;  3QUB A;  1ZQU A;  2J6S A;  2ZG6 A;  2AGO A;  3CRX A;  3H4B A;  3SAH A;  1Z1V A;  1QH9 A;  1ZQ1 C;  2E5S A;  2KVC A;  3D2Q A;  4DL6 A;  1L6N A;  2A1A A;  5EE0 A;  2CN1 A;  5KG7 A;  5EE3 A;  2XY5 A;  4J9K A;  1KL9 A;  2EZX A;  4ECX A;  5L1L A;  4KLD A;  2K8A A;  3QU5 A;  5ALM A;  1QQ6 A;  1HUZ A;  4EEK A;  5KFC A;  2W55 A;  4E0D A;  4FS1 A;  2EAO A;  5AKE A;  2Y1J A;  3SD7 A;  2V4Q A;  1IM4 A;  5J8Y A;  1ZQJ A;  4RQ7 A;  2K89 A;  1VLB A;  2FLP A;  2JH7 A;  5G5G A;  4YXJ A;  7ICH A;  4JV2 A;  5KFT A;  4DWI A;  4QZI A;  4Y2T A;  3PSP A; 
#chains in the Genus database with same CATH homology
 1Z19 A;  1CRX A;  2H3F A;  2HMX A;  2WAQ C;  4OJO A;  2E1E A;  2KD1 A;  2KKP A;  2LKY A;  4GFJ A;  2G0A A;  3NUQ A;  4KMO B;  1URJ A;  2VIX A;  2K8C B;  4NV0 A;  3SQI A;  2KHQ A;  1A0P A;  4OJL A;  2KJ9 A;  4QIW C;  4NLC A;  3C29 A;  4NLB A;  3KZX A;  3N7P D;  4AYB F;  1Z1B A;  1Q3U A;  1HEK A;  2VJ4 A;  2VKQ A;  2W04 A;  2XIC A;  4ICA A;  4A8E A;  1TAM A;  1GO3 F;  2RRD A;  2GOL A;  1A6S A;  2ZIW B;  1PVP A;  2JMG A;  2WAQ F;  3CP8 A;  2A3V A;  2MRL A;  2Z7J A;  2LYB A;  4FZL A;  5C0Y A;  2HBK A;  2PMZ C;  2XVT A;  3CYM A;  2R18 A;  2ZIV A;  4O3M A;  3LYS A;  2KKV A;  2H3Q A;  3VCB A;  4BJQ A;  3T79 A;  4QIW F;  4BX9 C;  4CRX A;  2ZXI A;  4OJ5 A;  1F44 A;  2KV2 A;  3AQF A;  3M7D A;  2M0N A;  2N1R A;  2YX8 A;  3GZF A;  5KL8 B;  2CRX A;  3KFU F;  5HR6 A;  2W03 A;  1P7D A;  2JH1 A;  3ONN A;  2Y0S C;  4QNL A;  3AQE A;  4WJ3 B;  2RP5 A;  2VJ5 A;  2XID A;  3D2N A;  4OJ6 A;  2D6F C;  2KIC A;  2DGZ A;  1HIW A;  2W7P A;  1ED1 A;  1T94 A;  3PSF A;  4QJF B;  3SAG A;  2G07 A;  2NV3 A;  2G09 A;  2ZIV B;  2ZXH A;  3E0F A;  3H0L B;  3MGV A;  2CPR A;  3H0M B;  2DQN B;  4C0Z A;  1IIP A;  3K1Z A;  3N7R C;  2WB1 C;  2YB4 A;  3VC8 A;  3F2C A;  2KJ8 A;  3F2B A;  2Y0S F;  1PVR A;  2K4I A;  2ZIU A;  2RHF A;  4JMU A;  5T14 A;  3F2D A;  3ALR A;  2OH2 A;  3F5E A;  2ZG6 A;  4P0P A;  3CRX A;  3RF9 A;  1D8B A;  3SAH A;  2E1F A;  2OM6 A;  2JHD A;  2K4H A;  2ZIX A;  5A0L A;  3PZP A;  1XNS A;  2LBO A;  3F5A A;  1ZQ1 C;  2E5S A;  2GH1 A;  2KIW A;  2KVC A;  3D2Q A;  3OPX A;  4BUG A;  1KBU A;  1L6N A;  3GU3 A;  3N7S C;  2WB1 F;  3ICX A;  2HOF A;  2KNJ A;  2CN1 A;  3HKZ C;  2PMZ F;  4PL1 A;  1ECW A;  2XI9 A;  3C28 A;  5HR7 A;  2HBL A;  2K4E A;  2ZIU B;  4ACO A;  4AYB C;  2F8L A;  4KX5 A;  3H0R B;  1UPH A;  4P0Q A;  5KL1 B;  4P0P B;  2LYA A;  2F2A B;  2BDU A;  2YB1 A;  1NZB A;  5CRX A;  2H3Z A;  2KJ5 A;  4FZN A;  2K8A A;  3L3F X;  2F77 X;  3DEE A;  2ZIX B;  3NRW A;  2JGA A;  3F53 A;  2KEY A;  2H3I A;  1WUD A;  2G08 A;  1SZH A;  4U7C A;  2G5I B;  2HBM A;  2G5H B;  3RFA A;  4U6P A;  1MA7 A;  4PL2 A;  3HKZ F;  1DRG A;  3M6Z A;  2K8B B;  2HOQ A;  2F76 X;  4IC9 A;  2W7O A;  2MA1 A;  1XO0 A;  3SMV A;  2Q4T A;  4KX3 A;  1YT3 A;  2HBJ A;  2H3V A;  2HOI A;  2K89 A;  3IG5 A;  4CDG A;  3IP4 B;  3O0F A;  1PVQ A;  2G06 A;  1Q3V A;  2JH7 A;  4P0Q B;  4OJP A;  2OYY A;  2KHV A;  3IG8 A;  3D2S A;  2DF4 B;  4OO1 J;  4CGZ A;  2LHT A;  3LVV A;  3PST A;  4NWI A;  2OXO A;  3PSP A;  3LVW A;  3SAF A;  1OUQ A;  3AL0 B;  4FE3 A;  3M6K A;  4FZM A;  3PSI A;  2KOB A;  2ZIW A;  3IN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...