5KL8B

Crystal structure of the pumilio-nos-cyclinb rna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
b'SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maternal protein pumilio
publication title Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna-binding protein/rna
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05741 zf-nanos Nanos RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.680 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 5kl8B00
5KL8B 5KL1B 3ALRA
chains in the Genus database with same CATH superfamily
1S0MA 5AI6A 5BOMA 4QWBA 1N56A 3T5HA 4DL4A 2F8KA 2FJ6A 3PR5B 2VIXA 2WFAA 3FAHA 3F5EA 2B0CA 8ICLA 2AJQA 2BGWA 3F53A 4JV1A 5KFDA 3RBEA 1RZTA 3PW0A 3LWLA 1ZQHA 1PK1A 2O6KA 3MGVA 8ICJA 4UAZA 4EX6A 3WU2U 3LDAA 4GIBA 2CN1A 4ECZA 2GO7A 1B22A 2KN7A 1SKSA 2QLTA 3BZCA 5EOZA 1EXNA 4YFKA 3H8JA 1X40A 2EAOA 3BDPA 4IR9A 2JEIA 2VANA 4Y2PA 2HSZA 4Y2QA 1NKEA 2BCVA 2E5SA 5DDYA 1WCNA 5KFTA 4CRXA 2BPGA 3IM1A 5C0YA 4X5VA 1BNPA 5HNKA 2BQ3A 9ICBA 5J2IA 2V9WA 3PZPA 4LJXA 2HHVA 4C80A 5KT4A 3EW9A 1RQNA 2K8AA 5EWEA 4M6WB 1MSWD 3B9JA 5ALDA 3TACB 5AM1A 3UQ0A 1ZQWA 5DG8A 3I28A 2XCPA 1TK5A 1ZQAA 4Z6DA 2DWQA 1L5UA 1N61A 4QZFA 5IIKA 2HHUA 4IS7A 3IDWA 3H0MB 1U49A 3GFKB 3N97B 1T4GA 2RRDA 5L9XA 1BPXA 3GQCA 3BS5A 3FC4A 4O5EA 4YCXA 3T5JA 8ICNA 5J0QA 3PX6A 2K4IA 2WF8A 2F2AB 4BGDA 5AKGA 4IC9A 2R8IA 2VJ5A 4NLCA 5ALQA 5AM3A 3ZDEA 4F2RA 5CWRA 4M9HA 1H38A 2AGPA 4QWAA 4U6PA 5KFZA 3LWMA 1S97A 4F72A 4UW9A 5CEHA 1OXJA 2WF9A 4DFDA 2H3IA 4XA5A 2AQ4A 2C2DA 1K1SA 4DFKA 3RAXA 2DKXA 1JALA 3NRWA 1NOMA 4EYIB 4MFAA 4DQRA 3TI0A 2G5IB 4NL9C 3H0RB 1DGSA 1MQ2A 1OUQA 4R64A 1Q8KA 5DQHA 4PHAA 2OXOA 2H5XA 2ZJ5A 1KLNA 1J97A 5KFIA 1TAMA 2F44A 2Y0SC 1S0NA 5DQGA 1UHUA 2WTFA 4I2EA 5AM2A 3HT3A 2F8LA 5KFRA 4NJ8A 4UAVA 4F50A 3F2BA 2JH1A 5HHHA 2XGQA 1WYGA 4KITB 1RYUA 3BS7A 3HX0A 3GV8B 4F71A 5BPCA 1ZOLA 4R8UA 4ECUA 5E79U 4KMOB 3E2EA 3KZIU 2BDPA 3GIMA 1NZBA 3TAQA 2AXTU 3CYMA 3CP8A 5DQIA 8ICUA 1KQQA 1UA0A 3QXGA 4RQ2A 5ALTA 4KX5A 4PZOA 3QU5A 4I29A 1NK7A 7ICSA 3V7KA 4JV0A 2MRLA 2A19A 3O0FA 4F4XA 2W7OA 4CF4A 3ONNA 4EENA 4ED6A 2R8GA 4PZNA 3A0HU 3PW4A 4J9PA 4LVSA 1UT8A 8ICGA 3IV6A 3C5FA 5AI9A 1IIPA 4CE6A 2G0AA 4NV0A 5DBCA 4R65A 2PI4A 4PH5A 2RDIA 5ALIA 1ZETA 2KJ5A 5F9NA 4PHEA 4PGQA 2HOFA 5J0TA 3FM9A 1PZNA 1ZQTA 7ICTA 5DB6A 9ICFA 4DFPA 4DQSA 3SD7A 3TQ1A 3OHBA 4F5OA 4YR0A 3V6KA 4I2AA 4TURA 1PVRA 1BPEA 3MDAA 1MA7A 2VA8A 4RQ3A 5AKEA 4AYBC 3R9KA 4C8LA 4Z6FA 3UXOA 4JUZA 2MU2A 3C2KA 7ICGA 2IA6A 1JIHA 3JPOA 1ED1A 1V38A 9ICOA 2EAMA 4QZAA 2E8NA 5J8YC 2ZTCA 4YQWA 4YG2A 4O5CA 1QSSA 2CRXA 4GXKA 4C4TA 1V97A 2KJ8A 1COKA 5ALSA 1SKRA 5KFAA 2ATLA 2K8CB 1CEZA 2WHEA 3SEIA 1Z4NA 1QSYA 2KK0A 4R66A 5DBBA 4F4YA 5DDMA 2P6RA 2MUTA 8ICIA 5EE3A 3OHAA 4OCZA 2ZIUA 3NRZA 4FS2A 4UB1A 2HVHA 3SMVA 1HIWA 8ICSA 4F8RA 1X9MA 2H3VA 3RTVA 4US9A 1A77A 8ICHA 4I2IA 4RQ1A 3HRDD 1RXWA 2BCUA 8ICPA 4NY8A 3HWTA 2YMLA 2KD1A 4RNMA 1KEJA 1ZQYA 5T14A 1ZQZA 4RQ8A 3M9NB 1S8OA 2LYAA 3RJIA 4EX7A 3MBYA 4F4KA 3GV7B 4ED2A 5J0WA 3TANA 5HR7A 2W8LA 2Y1JA 4F4WA 1SGGA 5B66U 3A0BU 1X6IA 2XGPA 4QZEA 2KP7A 1XO0A 1FEZA 4DS5A 4Y2SA 4KLDA 5ALHA 2EZYA 4ED1A 4PHDA 4G3IA 4OJ6A 3WK5A 4QZ9A 2JGAA 2F1HA 8ICZA 3F2DA 5J2AA 1FIQA 4PPXA 1X6JA 2W9CB 7ICLA 3TADC 1S10A 1TAUA 3PR4A 4FS1A 3PW2A 8ICYA 3PSPA 2ISOA 2JH7A 4ECSA 5AK4A 2JZBB 2IHMA 2W7PA 1SWVA 4OO1J 1MN8A 4M9GA 5JUMA 1TV9A 1RYRA 3TARA 3LVWA 4F92B 1QLNA 2QB1A 3QZ8A 3AU2A 4R63A 9ICKA 2W9BB 3ETLA 3LVVA 2HBMA 5ALJA 3OSNA 1U47A 3OJUA 5AK3A 4NLNA 1RM6C 3KHRA 3MGHA 3EWAA 5AM5A 5EE0A 3QU2A 3H8WA 5J0PA 2JXJA 1SL2A 3Q8PB 3C23A 9ICJA 1J2NA 2HW3A 3E58A 1ZQVA 4UB2A 2KSOA 1QCKA 1QSLA 4B9SA 5AKYA 1SWWA 3H7IA 2FLNA 2JRZA 5KFXA 2FLPA 4UAYA 1KRPA 2JEFA 3SQIA 4ECVA 4JV2A 4O9MA 3PV8A 3NVYA 2WF5A 5KT2A 3MFIA 2UVUA 1NJYA 4Q43A 3D2NA 9ICRA 2JEJA 4NM2A 3KZXA 5KFHA 2QB0B 1L7MA 1YZ6A 3RF9A 4MFFA 4RQ0A 1RG6A 1D8LA 3L4PA 2F1IA 4GXIA 5DB7A 2G5HB 3GZFA 3RJFA 2HBKA 4ECYA 3THVA 4CGZA 4Z6EA 2NRZA 5AKXA 4C4RA 5AI8A 5AICA 5ALKA 9ICXA 4FBTA 1QQ7A 7ICFA 3N7SC 1OW5A 2I6XA 5KFBA 3MR6A 1ZYQA 1BPDA 1XSLA 3D2QA 3WKDA 2RP5A 5ALRA 3PMLA 1BPYA 3ZDDA 9ICAA 2DPIA 4UASA 8ICCA 3RAQA 3F2CA 4Y2TA 9ICIA 5AKZA 2ZIXA 2KV2A 3SV4A 4DQIA 2IHNA 3AEVA 1S5LU 1L7NA 4P4OA 1L7OA 3IG5A 5KT5A 5D46A 1NK4A 1WWUA 3I1YA 3C1ZA 4PGYA 4DF4A 3K4GA 5J2GA 2XY5A 8ICWA 1A0PA 2ODGA 2KHVA 1RQLA 3IG8A 5KFYA 1TK8A 5DGAA 2DUYA 7ICJA 4RQ5A 2D3DA 4RNOA 4LZGA 2BZFA 2KFZA 2NRWA 2E8MA 1ZQXA 3QZ7A 4RQMA 2Y1IA 4ED8A 3Q8MA 3GV5B 4ELUA 2W04A 4UBBA 5ALLA 3SI8A 4Q45A 2HHQA 2RHFA 4NLBA 3E0FA 2AGQA 2I9GA 2F76X 2HBJA 1LKYA 3J81j 2ZXIA 3SV3A 1SV0C 2Q0ZX 2K4EA 4YMNA 4UAUA 2K4PA 2M9NA 2YMMA 4KLHA 1UCVA 2NRVA 1M6YA 3TKAA 3BQ0A 1TKDA 4P0QA 5FP0A 5AKJA 2WAQF 3MR3A 4KLMA 3M1YA 3S6JA 2ZIWB 3DV9A 1NNLA 3EZ5A 2LYBA 2MAXA 2M0NA 4MEYA 4YD1A 4QZCA 4KLSA 3PY8A 3UM9A 1URJA 4ECWA 1S0OA 3QUBA 5J0RA 4NL9A 2H3FA 5ALGA 3RBDA 3C29A 5A0LA 4RQNA 4NLKA 4RUAA 1XU4A 5DKWA 3KKAC 3PMNA 1YT3A 2BQRA 4UATA 5AHXA 5KFPA 2LM1A 4EBDA 2A1JB 2VA2A 3PW5A 2FDRA 5KFJA 3JPNA 4QJFB 2KIWA 5KFLA 2AH5A 2BHNA 5KAFU 1V85A 2HOQA 2JHDA 3GIIA 5AIBA 3RB6A 2KZ3A 2BDUA 2DGZA 2WAQC 3NS1A 1UT5A 3PVXA 3IRUA 4O3RA 4M47A 3ED5A 3Q8LA 1Z4OA 3Q8KA 1DRGA 3D2SA 1RDFA 7ICOA 3KBBA 1ZQOA 3IN5A 7ICKA 1WCLA 2PKEA 2BQUA 4E0DA 1ZJNA 5KT7A 5C5JA 5DLGA 3G6XA 3TFRA 2ZIVB 1Z00B 2F1JA 2QARB 5ALVA 5CRXA 1SZPA 3AMZA 4GC7A 4BUGA 4KLFA 2BCQA 4IRKA 5AI4A 1J2MA 5KFEA 9ICVA 3OTQA 4JMUA 2K89A 3IHQB 5KFMA 3RJGA 3HILA 3UMBA 4P4MA 2J6SA 9ICGA 2BCSA 1TK0A 2LYHA 4KTQA 3SAHA 5J2EA 4DSIA 1DK3A 1HJPA 1VLBA 5AKLA 2KOBA 2HOIA 4K4IA 3ORYA 2G09A 1X66A 4DEZA 3NASA 2NO5A 4FZLA 4M04A 2XO7A 4RQ7A 5H2FU 5J2JA 2K60A 1ZQNA 1K5OA 4KLEA 3KFUF 1NJZA 8ICAA 4PJ0U 9ICPA 2ZUDA 5AKHA 2XIDA 1VDVA 4XUSA 3N28A 1S9FA 4DLGA 3MGIA 2YTUA 4F5RA 3HP6A 3L3FX 4YMOA 3T5LA 2KVCA 4MHVA 3C5GA 1ZQ1C 4QNLA 1PK1B 4I28A 4CDGA 9ICQA 2ISPA 1A76A 2IOHA 2KVSA 4LZDA 1NK0A 4J9SA 3NTUA 9ICTA 2EZZA 4BWJA 2ZTDA 5IIOA 5J8YA 1LVHA 5AI0A 3ISDA 3ETRA 5CHGA 3N4MB 4O3QA 4UB8U 5IIMA 3UMGA 1JX4A 4AP9A 1NJXA 4QW9A 3JPSA 4EELA 5KG2A 1JN3A 4I2DA 2W8KA 4U7CA 5KFOA 4DSLA 3ZDAA 2AHOB 5DG7A 3NUQA 1KSPA 2G08A 4FZMA 4M9NA 4K4HA 1BPBA 1AROP 4B6JA 3QU9A 3Q8RB 5AKKA 3ZDBA 5CA7A 1L3SA 2OCEA 2HHWA 1ZQJA 3EPIA 2A1AA 9ICLA 3WK9A 1KBUA 7ICMA 2HHSA 5J2HA 1ZQLA 2KG5A 2DBYA 2FMPA 4KLJA 3PSFA 4RZRA 5KFNA 3QX7A 2AU0A 4I2FA 1IM4A 1DGJA 9ICNA 1T8EA 9ICEA 4OJLA 3FYHA 1SIJA 2RLTA 3BS5B 4UARA 2GOLA 1UQVA 3SYZA 2DFLA 4RQ6A 1ZQCA 3HPOA 5B5EU 4MF8A 1QQ5A 3FDSA 4C7YA 2C2RA 2ES6A 3EUB2 3SZ2A 1U48A 5L1MA 1SL0A 3UPQA 2KICA 1Q46A 1CI4A 2EZXA 5L1KA 4EEKA 3ZD8A 1F5SA 2W3SA 3V6JA 1P7DA 2BCRA 2JV3A 5ALXA 3C28A 4F93B 4QIWF 1L8LA 3AUOA 3HJEA 7ICEA 3MFHA 4P0PA 3KHGA 1SV4A 1D8BA 3WKAA 2CPRA 3V7LA 1KL9A 3TADA 3PNCA 3BQTA 5GTHU 5ALWA 2NRXA 2LI6A 4RPZA 4B9LA 2ZG6A 8ICXA 1L6NA 3RH6A 5J0XA 3RRGA 2C22A 3MR5A 1X9XA 3AQFA 3NVVA 4ZOHC 2E8PA 1ZQUA 5KG7A 3G6VA 2N1RA 1HEKA 3ISCA 1MC8A 4ED3A 2BKEA 5EE1A 4EZ6A 1WUDA 1ECWA 5DB8A 4J9NA 1HUOA 4Y2VA 4C8NA 2R8JA 4US8A 5JRTA 1N48A 5KNIA 2HVIA 2C2EA 2V4RA 3MC1A 1XO1A 4B9VA 3AM9A 2KZZA 3QUCA 2WB1F 4R8UB 2IOFK 4CCHA 5ALPA 5CJ7A 1NK6A 2HI0A 2LMRA 4J9QA 9ICCA 2ESEA 4QIWC 3T5KA 4RNNA 3EPGA 9ICHA 3H4DA 2YN4A 3KTQA 4J9OA 1JI7A 4JWNA 3B0YA 3UXPA 3AN1A 3RR8A 4DCCA 5DGBA 2FPKA 1S77D 1SZHA 5KG5A 5J2FA 4DFJA 1N5XA 2XVTA 3QEAZ 2EANA 2QKQA 2F77X 4M6WA 3DDHA 2WF7A 4KN4A 2DKZA 4QZBA 3H40A 2P35A 2Z7JA 4Z6CA 2ZIWA 1NK9A 1FO4A 8ICTA 4UBCA 4G9BA 2OWOA 3UXNA 4ICAA 2BPCA 1B4FA 4YR3A 3RB4A 1X9SA 1Z19A 1JROA 4DSEA 3PO4A 1DOQA 2WB1C 4YD2A 3WK8A 3RH4A 1KFTA 2NV3A 5K4LA 3LK9A 1ZQSA 1DK2A 1SXDA 3AL0B 8ICFA 4C4SA 3V6HA 4B9TA 4IQTA 8ICQA 1ZQBA 5JU5A 4A8EA 2A1JA 5KL1B 1JMSA 1PVPA 2YX8A 2NO4A 1KFSA 2LPEA 2G06A 3BQ2A 2KKVA 1NZPA 3AQEA 3K1RB 4NLZA 3RB3A 2D6FC 3CW2C 1ZRMA 4IQVA 1ZQMA 2A3VA 1ZD2P 3QU7A 3C1YA 2J6UA 3ALRA 4ED7A 4C0ZA 2H3ZA 3BQ1A 5DG9A 3KD3A 4CF3A 4F5NA 3M7DA 2FPMA 2J6TA 5AK6A 4KLUA 4J9RA 1JRPA 4XQ8A 2W03A 4IRDA 4F3OA 3BZKA 3M9MB 1X9WA 1RYSA 2W9AA 2W55A 3QYPA 1XS9D 4KLLA 3JPQA 7ICQA 2R18A 5KFKA 3CNHA 3HW8A 4USAA 8ICKA 5KFFA 2K4HA 4DWIA 3K75D 2V4QA 2KIVA 5DB9A 2PFQA 1S76D 3ZI4A 1ZD3A 2ZIUB 2XI9A 1COOA 5JTIA 4Y2YA 4IR1A 2ASJA 5TISU 1ZQIA 2RDJA 2Q4TA 2FPLA 1JUDA 4ELVA 4EEYA 2ZXHA 1QH9A 1XSPA 3TAPA 4DOBA 4F4ZA 5D4BA 1SV0A 3H0LB 3WK6A 5KTQA 4M2YA 2EDUA 5CR0A 3M8RA 2DQNB 2KTQA 4B9UA 5ALNA 4ECRA 4BXOB 3H8MA 4HAIA 3EYZA 2I1QA 2OHFA 5HMLA 1T94A 5J0OA 1KTQA 1NI3A 2JEGA 1XSNA 1IXRA 5J0SA 8ICMA 1PUZA 2E1EA 3OPXA 3GIJA 1N63A 4RT2A 4TUQA 4CF5A 2P6UA 1B43A 1JXLA 1BGXT 1L8OA 3M6KA 3UMCA 5ALZA 4ACOA 3ZDCA 3KKAA 4DL3A 2MSNA 2L5YA 1BPZA 2YQEA 4RPXA 5L1LA 4JB3A 3B0XA 3T3FA 2GLEA 4UQGA 7ICNA 4I2JA 5HP4A 1NKCA 2Y9UA 1L3VA 4UAWA 2JMGA 5G5HA 5AI5A 1ZD4A 2YY6A 5J0YA 2PXIA 2ASDA 7ICPA 4GFJA 3JPRA 4C7ZA 2EQYA 2UVWA 2JR5A 4RPYA 4DSKA 2HBLA 2GH1A 2UVRA 4DFMA 3BQ7A 3RJKA 1N60A 4GC6A 3PX4A 9ICSA 2PFNA 2PMZF 2PFPA 4DOCA 5KFGA 4J9LA 1FFUA 4ECXA 4KLQA 3WKEA 5J0UA 4FO6A 5KFCA 3T79A 2D8CA 4QZDA 2ALZA 3RH5A 3SAFA 2HDOA 3TFSA 2FI1A 1Z1BA 4Q44A 8ICEA 1ZD5A 4DS4A 5J29A 2W54A 2G07A 4IQUA 2Y0SF 1B0XA 2W43A 4I2CA 1TAQA 2GWSA 2ZUBA 2VKQA 5L1JA 5D49A 2KSOB 3QUTA 1ZQGA 4QWDA 3M9OB 1KW4A 4BJQA 2ZJAA 3JPPA 7ICIA 4TUPA 2W3RA 1U45A 4Y2UA 1SL1A 2UVVA 5KG4A 3QE9Y 4NLGA 2BPFA 5AIAA 2NYVA 1LB2B 1SKWA 2PMZC 1ZQDA 4I2HA 2KKPA 2BR0A 3N7PD 1U4BA 3BJYA 3I76A 4NWIA 2DL0A 2HHTA 4CNQA 2PFOA 4YN4A 4BWMA 3H8SA 5KFWA 3LYSA 3V7JA 2ASLA 4QW8A 4M9LA 4F91B 4O3OA 3OGUA 1KDHA 8ICBA 4PGXA 2WF6A 9ICWA 4O5KA 5IIJA 1Z1VA 5EWGA 1S0VA 3JPTA 3RJJA 3VCBA 5KG0A 2ZIXB 4JK1A 4YXJA 4TQSA 3SR6A 4M9JA 4UB5A 1XNSA 5BOLA 3H4BA 2FLLA 4IL6U 4RU9A 1ZQEA 1ZXIA 2LM4A 4FBUA 2W9CA 4KLTA 3C2MA 4YR2A 2KE7A 2XC9A 1KN5A 3KHLA 1F44A 8ICRA 4Y2XA 1A6SA 2JZBA 1X2IA 2XICA 7ICRA 1UPHA 2VA3A 4AYBF 1C20A 1YZ7A 2E1FA 1QTMA 4DOAA 2W9BA 2ZJ8A 2IBKA 2KEYA 4OD0A 3WKCA 4YP3A 4M0AA 8ICVA 2YMQA 3RB0A 1ZJMA 2H3QA 2ZTEA 3QEBZ 4TQRA 1LKYB 2F3NA 1Q3VA 3PX0A 4QZIA 1T7PA 4F5PA 7ICUA 1O03A 3U26A 2C28A 1RXVA 4DSJA 3QU4A 1TFRA 1PVQA 2MA1A 3G6YA 4P0QB 4DL7A 4F5QA 1N62A 2KZMA 4RQ4A 4ECQA 2B6GA 4FZNA 4B9NA 1WWVA 5F9LA 4J9KA 4Y2JA 5L1IA 1CUKA 3NVZA 4GLXA 4ELTA 2FMSA 3M8SA 3ISBA 5ALFA 1Q3UA 5DLFA 2B21A 2IOFA 4ZH4A 5ALEA 1SB3C 2W11A 4QWEA 4DL6A 3OSPA 2QB0A 2XCAA 4J03A 4FE3A 4TUSA 1PK3A 3PW7A 4DL5A 4ECTA 3HKZF 4KMUA 1LV5A 2IMWP 4KN7A 2KNJA 3F5AA 4J9MA 3ZD9A 5KFVA 4DSFA 5DBAA 3WK4A 4KX3A 4EBCA 1D9FA 2KFNA 4DO9A 2KHQA 3Q8SB 4K4GA 4RT3A 4NXZA 3PO5A 2LKYA 1JXEA 2CXYA 5AM4A 3RJEA 4OJOA 3MR2A 4Q8FA 4RUCA 1AQ6A 2E8OA 4C8OA 1IG6A 4MF2A 1QQ6A 4I2BA 3DEEA 2NRTA 1NK8A 4EBEA 4C8MA 5KG6A 2Y9TA 2XY7A 1XWLA 3GIKA 5KL8B 3GU3A 4YMMA 3WKBA 5KT6A 1F0MA 4WJ3B 1L3UA 4P2HA 4OJ5A 3HKZC 4QWCA 1TE2A 4BXOA 1MQ3A 2EH9A 1FFVA 5KFQA 3VC8A 4P4PA 3PSIA 1ZQFA 2EAPA 3KHHA 3QUQA 1ZQKA 5HR6A 1NK5A 2FMQA 1WG8A 1UA1A 3RJHA 3SAGA 4XRHA 4O3PA 3NGDA 3GILA 2I5HA 1TVAA 1T3QA 5J2DA 4PHPA 3N7RC 5AK5A 4YVZA 2FE9A 4I27A 1SXEA 2VJ4A 1T3NA 5TZVA 5KAIU 3MABA 1N5WA 5G5GA 4HYKA 4UB6U 3UQ2A 5HMMA 5ALUA 1HUZA 1D8YA 4DQQA 2ZUCA 4I2GA 4Y2RA 3ICXA 1L3TA 2R8KA 3RR7A 5AKIA 3KOOA 5EE9A 4MFCA 1BNOA 2LHTA 5ALYA 5KFUA 4Q8EA 5IINA 1XC9A 4NM1A 5F3XB 2HHXA 4ED0A 1Z3EB 3L5KA 3D6JA 4YXMA 4C8KA 5EWFA 4DLEA 1KKXA 5CP2A 4UB3A 1VJ5A 1L7PA 2PI5A 2RQ5A 1ZQRA 3IP4B 3C2LA 4DF8A 7ICHA 1D9DA 1IV8A 2R8HA 1ZQQA 2YMPA 2AQ0A 1Y88A 2OYYA 4DQPA 2KJ9A 5J2CA 3GDXA 1NJWA 3V72A 4B9MA 3MDCA 5KFSA 4KLOA 2YB1A 1V9PA 3WK7A 4UB4A 4QZ8A 2AGOA 5ALMA 1ZRNA 1KFDA 2P66A 3C21A 2LBOA 4QZGA 2OM6A 4PL2A 4GXJA 1DXSA 5J2KA 4O0IA 5ALOA 1C7YA 2KMDA 5AM0A 2OEHA 2W9MA 4FFDA 4KLGA 9ICMA 3OJSA 7ICVA 5IIIA 3RFAA 4IQWA 9ICUA 4EYHB 3AU6A 8ICOA 4F2SA 2ZIVA 5J2BA 1Z00A 1CRXA 1RPLA 2QARA 2MUTB 3SENA 2DF4B 1N2XA 2E3TA 5KT3A 3K1ZA 2K8BB 4O3NA 4DL2A 4IRCA 2DPJA 3CRXA 5HHIA 3PSTA 4BDPA 3NVWA 5GTIU 4KLIA 2OH2A 1ZQPA 1O08A 4PL1A 4OJPA 4JWMA 1BVSA 1U9LA 3Q8QB 4EZ9A 5KG1A 1X42A 3M6ZA 4P0PB 1K1QA 3RRHA 2HMXA 4O3MA 4MEXA 5IILA 2HCFA 3QNMA 2YB4A 2XY6A 4BX9C 4QZHA 5KG3A 1NKBA 1GO3F 4O3SA 5CB1A
chains in the Genus database with same CATH topology
2WAQF 2JH7A 2A3VA 4KX5A 3M6KA 4ACOA 2ZIWB 2H3QA 2W7PA 3ALRA 3SAHA 4OO1J 2K8CB 2PMZC 2VIXA 4C0ZA 2H3ZA 3F5EA 1Q3VA 1KBUA 5KL8B 2KKPA 2LYBA 3GU3A 2OYYA 2M0NA 2KJ9A 3N7SC 2KOBA 2K4IA 3M7DA 3N7PD 2WB1F 3PSFA 2HOIA 2MRLA 3LVWA 4WJ3B 2F2AB 2ZIUA 2G09A 3F53A 3D2QA 3SMVA 1URJA 3O0FA 4QIWC 2RP5A 1HIWA 4NWIA 2W03A 2JMGA 4FZLA 3HKZC 3ONNA 2YB1A 4IC9A 4OJ5A 2VJ5A 4NLCA 2H3FA 2H3VA 1PVQA 4OJLA 3C29A 3MGVA 2MA1A 3KFUF 4P0QB 3VC8A 1IIPA 5A0LA 4U6PA 2G0AA 2R18A 3LVVA 3PSIA 2HBMA 2GOLA 3F2CA 4GFJA 4NV0A 2ZIXA 2KV2A 2XIDA 3LYSA 2K4HA 1YT3A 4FZNA 5HR6A 2CN1A 3IG5A 2H3IA 2LBOA 2KD1A 1SZHA 2GH1A 2HBLA 3SAGA 2KJ5A 2OM6A 4PL2A 2ZIUB 2HOFA 2XVTA 5T14A 2XI9A 1A0PA 2F77X 3NRWA 2W7OA 2KHVA 1Q3UA 3L3FX 2KVCA 4QJFB 2KIWA 2G5IB 1ZQ1C 2KICA 2LYAA 3IG8A 4QNLA 3H0RB 2PMZF 3N7RC 1OUQA 2VJ4A 2E5SA 2Z7JA 4CDGA 2HOQA 2ZIWA 2Q4TA 1P7DA 2JHDA 2OXOA 5HR7A 3RFAA 3VCBA 2ZIXB 3T79A 2ZXHA 4CRXA 1TAMA 2Y0SC 5C0YA 3SAFA 3C28A 4FE3A 1XNSA 2BDUA 2DGZA 2WAQC 4QIWF 4ICAA 2ZIVA 1PVRA 3HKZF 3PZPA 1Z1BA 3H0LB 1CRXA 3ICXA 4P0PA 1MA7A 2KNJA 2DF4B 3F5AA 1Z19A 1D8BA 3K1ZA 2CPRA 2K8BB 2W04A 4AYBC 2F8LA 1XO0A 2DQNB 1DRGA 2K8AA 3D2SA 3SQIA 2LHTA 2G07A 2WB1C 3F2BA 3CRXA 1F44A 2NV3A 2Y0SF 4KX3A 3PSTA 2RHFA 3IN5A 4NLBA 3E0FA 2JH1A 3AL0B 2KHQA 1A6SA 2F76X 3D2NA 4OJ6A 2XICA 2OH2A 2ZG6A 2HBJA 1UPHA 2JGAA 4OJPA 3KZXA 4PL1A 2LKYA 4AYBF 1L6NA 2VKQA 3RF9A 1T94A 2ZXIA 1ED1A 3AQFA 3F2DA 2E1FA 2ZIVB 2N1RA 4OJOA 1HEKA 4A8EA 5KL1B 4KMOB 5CRXA 3M6ZA 4P0PB 2HMXA 2YX8A 1PVPA 1WUDA 1ECWA 2K4EA 4BUGA 4U7CA 4O3MA 2G06A 2G5HB 3GZFA 4BJQA 2KKVA 1NZBA 3H0MB 2E1EA 2HBKA 3AQEA 2YB4A 3OPXA 2CRXA 3NUQA 4BX9C 3CYMA 2RRDA 2G08A 2KEYA 3CP8A 4FZMA 4JMUA 2K89A 4CGZA 2D6FC 3PSPA 3IP4B 1GO3F 4P0QA 3DEEA 2KJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL8 B;  5KL1 B;  3ALR A; 
#chains in the Genus database with same CATH topology
 1S0M A;  5AI6 A;  5BOM A;  4QWB A;  1N56 A;  3T5H A;  4DL4 A;  2F8K A;  2FJ6 A;  3PR5 B;  2VIX A;  2WFA A;  3FAH A;  3F5E A;  2B0C A;  8ICL A;  2AJQ A;  2BGW A;  3F53 A;  4JV1 A;  5KFD A;  3RBE A;  1RZT A;  3PW0 A;  3LWL A;  1ZQH A;  1PK1 A;  2O6K A;  3MGV A;  8ICJ A;  4UAZ A;  4EX6 A;  3WU2 U;  3LDA A;  4GIB A;  2CN1 A;  4ECZ A;  2GO7 A;  1B22 A;  2KN7 A;  1SKS A;  2QLT A;  3BZC A;  5EOZ A;  1EXN A;  4YFK A;  3H8J A;  1X40 A;  2EAO A;  3BDP A;  4IR9 A;  2JEI A;  2VAN A;  4Y2P A;  2HSZ A;  4Y2Q A;  1NKE A;  2BCV A;  2E5S A;  5DDY A;  1WCN A;  5KFT A;  4CRX A;  2BPG A;  3IM1 A;  5C0Y A;  4X5V A;  1BNP A;  5HNK A;  2BQ3 A;  9ICB A;  5J2I A;  2V9W A;  3PZP A;  4LJX A;  2HHV A;  4C80 A;  5KT4 A;  3EW9 A;  1RQN A;  2K8A A;  5EWE A;  4M6W B;  1MSW D;  3B9J A;  5ALD A;  3TAC B;  5AM1 A;  3UQ0 A;  1ZQW A;  5DG8 A;  3I28 A;  2XCP A;  1TK5 A;  1ZQA A;  4Z6D A;  2DWQ A;  1L5U A;  1N61 A;  4QZF A;  5IIK A;  2HHU A;  4IS7 A;  3IDW A;  3H0M B;  1U49 A;  3GFK B;  3N97 B;  1T4G A;  2RRD A;  5L9X A;  1BPX A;  3GQC A;  3BS5 A;  3FC4 A;  4O5E A;  4YCX A;  3T5J A;  8ICN A;  5J0Q A;  3PX6 A;  2K4I A;  2WF8 A;  2F2A B;  4BGD A;  5AKG A;  4IC9 A;  2R8I A;  2VJ5 A;  4NLC A;  5ALQ A;  5AM3 A;  3ZDE A;  4F2R A;  5CWR A;  4M9H A;  1H38 A;  2AGP A;  4QWA A;  4U6P A;  5KFZ A;  3LWM A;  1S97 A;  4F72 A;  4UW9 A;  5CEH A;  1OXJ A;  2WF9 A;  4DFD A;  2H3I A;  4XA5 A;  2AQ4 A;  2C2D A;  1K1S A;  4DFK A;  3RAX A;  2DKX A;  1JAL A;  3NRW A;  1NOM A;  4EYI B;  4MFA A;  4DQR A;  3TI0 A;  2G5I B;  4NL9 C;  3H0R B;  1DGS A;  1MQ2 A;  1OUQ A;  4R64 A;  1Q8K A;  5DQH A;  4PHA A;  2OXO A;  2H5X A;  2ZJ5 A;  1KLN A;  1J97 A;  5KFI A;  1TAM A;  2F44 A;  2Y0S C;  1S0N A;  5DQG A;  1UHU A;  2WTF A;  4I2E A;  5AM2 A;  3HT3 A;  2F8L A;  5KFR A;  4NJ8 A;  4UAV A;  4F50 A;  3F2B A;  2JH1 A;  5HHH A;  2XGQ A;  1WYG A;  4KIT B;  1RYU A;  3BS7 A;  3HX0 A;  3GV8 B;  4F71 A;  5BPC A;  1ZOL A;  4R8U A;  4ECU A;  5E79 U;  4KMO B;  3E2E A;  3KZI U;  2BDP A;  3GIM A;  1NZB A;  3TAQ A;  2AXT U;  3CYM A;  3CP8 A;  5DQI A;  8ICU A;  1KQQ A;  1UA0 A;  3QXG A;  4RQ2 A;  5ALT A;  4KX5 A;  4PZO A;  3QU5 A;  4I29 A;  1NK7 A;  7ICS A;  3V7K A;  4JV0 A;  2MRL A;  2A19 A;  3O0F A;  4F4X A;  2W7O A;  4CF4 A;  3ONN A;  4EEN A;  4ED6 A;  2R8G A;  4PZN A;  3A0H U;  3PW4 A;  4J9P A;  4LVS A;  1UT8 A;  8ICG A;  3IV6 A;  3C5F A;  5AI9 A;  1IIP A;  4CE6 A;  2G0A A;  4NV0 A;  5DBC A;  4R65 A;  2PI4 A;  4PH5 A;  2RDI A;  5ALI A;  1ZET A;  2KJ5 A;  5F9N A;  4PHE A;  4PGQ A;  2HOF A;  5J0T A;  3FM9 A;  1PZN A;  1ZQT A;  7ICT A;  5DB6 A;  9ICF A;  4DFP A;  4DQS A;  3SD7 A;  3TQ1 A;  3OHB A;  4F5O A;  4YR0 A;  3V6K A;  4I2A A;  4TUR A;  1PVR A;  1BPE A;  3MDA A;  1MA7 A;  2VA8 A;  4RQ3 A;  5AKE A;  4AYB C;  3R9K A;  4C8L A;  4Z6F A;  3UXO A;  4JUZ A;  2MU2 A;  3C2K A;  7ICG A;  2IA6 A;  1JIH A;  3JPO A;  1ED1 A;  1V38 A;  9ICO A;  2EAM A;  4QZA A;  2E8N A;  5J8Y C;  2ZTC A;  4YQW A;  4YG2 A;  4O5C A;  1QSS A;  2CRX A;  4GXK A;  4C4T A;  1V97 A;  2KJ8 A;  1COK A;  5ALS A;  1SKR A;  5KFA A;  2ATL A;  2K8C B;  1CEZ A;  2WHE A;  3SEI A;  1Z4N A;  1QSY A;  2KK0 A;  4R66 A;  5DBB A;  4F4Y A;  5DDM A;  2P6R A;  2MUT A;  8ICI A;  5EE3 A;  3OHA A;  4OCZ A;  2ZIU A;  3NRZ A;  4FS2 A;  4UB1 A;  2HVH A;  3SMV A;  1HIW A;  8ICS A;  4F8R A;  1X9M A;  2H3V A;  3RTV A;  4US9 A;  1A77 A;  8ICH A;  4I2I A;  4RQ1 A;  3HRD D;  1RXW A;  2BCU A;  8ICP A;  4NY8 A;  3HWT A;  2YML A;  2KD1 A;  4RNM A;  1KEJ A;  1ZQY A;  5T14 A;  1ZQZ A;  4RQ8 A;  3M9N B;  1S8O A;  2LYA A;  3RJI A;  4EX7 A;  3MBY A;  4F4K A;  3GV7 B;  4ED2 A;  5J0W A;  3TAN A;  5HR7 A;  2W8L A;  2Y1J A;  4F4W A;  1SGG A;  5B66 U;  3A0B U;  1X6I A;  2XGP A;  4QZE A;  2KP7 A;  1XO0 A;  1FEZ A;  4DS5 A;  4Y2S A;  4KLD A;  5ALH A;  2EZY A;  4ED1 A;  4PHD A;  4G3I A;  4OJ6 A;  3WK5 A;  4QZ9 A;  2JGA A;  2F1H A;  8ICZ A;  3F2D A;  5J2A A;  1FIQ A;  4PPX A;  1X6J A;  2W9C B;  7ICL A;  3TAD C;  1S10 A;  1TAU A;  3PR4 A;  4FS1 A;  3PW2 A;  8ICY A;  3PSP A;  2ISO A;  2JH7 A;  4ECS A;  5AK4 A;  2JZB B;  2IHM A;  2W7P A;  1SWV A;  4OO1 J;  1MN8 A;  4M9G A;  5JUM A;  1TV9 A;  1RYR A;  3TAR A;  3LVW A;  4F92 B;  1QLN A;  2QB1 A;  3QZ8 A;  3AU2 A;  4R63 A;  9ICK A;  2W9B B;  3ETL A;  3LVV A;  2HBM A;  5ALJ A;  3OSN A;  1U47 A;  3OJU A;  5AK3 A;  4NLN A;  1RM6 C;  3KHR A;  3MGH A;  3EWA A;  5AM5 A;  5EE0 A;  3QU2 A;  3H8W A;  5J0P A;  2JXJ A;  1SL2 A;  3Q8P B;  3C23 A;  9ICJ A;  1J2N A;  2HW3 A;  3E58 A;  1ZQV A;  4UB2 A;  2KSO A;  1QCK A;  1QSL A;  4B9S A;  5AKY A;  1SWW A;  3H7I A;  2FLN A;  2JRZ A;  5KFX A;  2FLP A;  4UAY A;  1KRP A;  2JEF A;  3SQI A;  4ECV A;  4JV2 A;  4O9M A;  3PV8 A;  3NVY A;  2WF5 A;  5KT2 A;  3MFI A;  2UVU A;  1NJY A;  4Q43 A;  3D2N A;  9ICR A;  2JEJ A;  4NM2 A;  3KZX A;  5KFH A;  2QB0 B;  1L7M A;  1YZ6 A;  3RF9 A;  4MFF A;  4RQ0 A;  1RG6 A;  1D8L A;  3L4P A;  2F1I A;  4GXI A;  5DB7 A;  2G5H B;  3GZF A;  3RJF A;  2HBK A;  4ECY A;  3THV A;  4CGZ A;  4Z6E A;  2NRZ A;  5AKX A;  4C4R A;  5AI8 A;  5AIC A;  5ALK A;  9ICX A;  4FBT A;  1QQ7 A;  7ICF A;  3N7S C;  1OW5 A;  2I6X A;  5KFB A;  3MR6 A;  1ZYQ A;  1BPD A;  1XSL A;  3D2Q A;  3WKD A;  2RP5 A;  5ALR A;  3PML A;  1BPY A;  3ZDD A;  9ICA A;  2DPI A;  4UAS A;  8ICC A;  3RAQ A;  3F2C A;  4Y2T A;  9ICI A;  5AKZ A;  2ZIX A;  2KV2 A;  3SV4 A;  4DQI A;  2IHN A;  3AEV A;  1S5L U;  1L7N A;  4P4O A;  1L7O A;  3IG5 A;  5KT5 A;  5D46 A;  1NK4 A;  1WWU A;  3I1Y A;  3C1Z A;  4PGY A;  4DF4 A;  3K4G A;  5J2G A;  2XY5 A;  8ICW A;  1A0P A;  2ODG A;  2KHV A;  1RQL A;  3IG8 A;  5KFY A;  1TK8 A;  5DGA A;  2DUY A;  7ICJ A;  4RQ5 A;  2D3D A;  4RNO A;  4LZG A;  2BZF A;  2KFZ A;  2NRW A;  2E8M A;  1ZQX A;  3QZ7 A;  4RQM A;  2Y1I A;  4ED8 A;  3Q8M A;  3GV5 B;  4ELU A;  2W04 A;  4UBB A;  5ALL A;  3SI8 A;  4Q45 A;  2HHQ A;  2RHF A;  4NLB A;  3E0F A;  2AGQ A;  2I9G A;  2F76 X;  2HBJ A;  1LKY A;  3J81 j;  2ZXI A;  3SV3 A;  1SV0 C;  2Q0Z X;  2K4E A;  4YMN A;  4UAU A;  2K4P A;  2M9N A;  2YMM A;  4KLH A;  1UCV A;  2NRV A;  1M6Y A;  3TKA A;  3BQ0 A;  1TKD A;  4P0Q A;  5FP0 A;  5AKJ A;  2WAQ F;  3MR3 A;  4KLM A;  3M1Y A;  3S6J A;  2ZIW B;  3DV9 A;  1NNL A;  3EZ5 A;  2LYB A;  2MAX A;  2M0N A;  4MEY A;  4YD1 A;  4QZC A;  4KLS A;  3PY8 A;  3UM9 A;  1URJ A;  4ECW A;  1S0O A;  3QUB A;  5J0R A;  4NL9 A;  2H3F A;  5ALG A;  3RBD A;  3C29 A;  5A0L A;  4RQN A;  4NLK A;  4RUA A;  1XU4 A;  5DKW A;  3KKA C;  3PMN A;  1YT3 A;  2BQR A;  4UAT A;  5AHX A;  5KFP A;  2LM1 A;  4EBD A;  2A1J B;  2VA2 A;  3PW5 A;  2FDR A;  5KFJ A;  3JPN A;  4QJF B;  2KIW A;  5KFL A;  2AH5 A;  2BHN A;  5KAF U;  1V85 A;  2HOQ A;  2JHD A;  3GII A;  5AIB A;  3RB6 A;  2KZ3 A;  2BDU A;  2DGZ A;  2WAQ C;  3NS1 A;  1UT5 A;  3PVX A;  3IRU A;  4O3R A;  4M47 A;  3ED5 A;  3Q8L A;  1Z4O A;  3Q8K A;  1DRG A;  3D2S A;  1RDF A;  7ICO A;  3KBB A;  1ZQO A;  3IN5 A;  7ICK A;  1WCL A;  2PKE A;  2BQU A;  4E0D A;  1ZJN A;  5KT7 A;  5C5J A;  5DLG A;  3G6X A;  3TFR A;  2ZIV B;  1Z00 B;  2F1J A;  2QAR B;  5ALV A;  5CRX A;  1SZP A;  3AMZ A;  4GC7 A;  4BUG A;  4KLF A;  2BCQ A;  4IRK A;  5AI4 A;  1J2M A;  5KFE A;  9ICV A;  3OTQ A;  4JMU A;  2K89 A;  3IHQ B;  5KFM A;  3RJG A;  3HIL A;  3UMB A;  4P4M A;  2J6S A;  9ICG A;  2BCS A;  1TK0 A;  2LYH A;  4KTQ A;  3SAH A;  5J2E A;  4DSI A;  1DK3 A;  1HJP A;  1VLB A;  5AKL A;  2KOB A;  2HOI A;  4K4I A;  3ORY A;  2G09 A;  1X66 A;  4DEZ A;  3NAS A;  2NO5 A;  4FZL A;  4M04 A;  2XO7 A;  4RQ7 A;  5H2F U;  5J2J A;  2K60 A;  1ZQN A;  1K5O A;  4KLE A;  3KFU F;  1NJZ A;  8ICA A;  4PJ0 U;  9ICP A;  2ZUD A;  5AKH A;  2XID A;  1VDV A;  4XUS A;  3N28 A;  1S9F A;  4DLG A;  3MGI A;  2YTU A;  4F5R A;  3HP6 A;  3L3F X;  4YMO A;  3T5L A;  2KVC A;  4MHV A;  3C5G A;  1ZQ1 C;  4QNL A;  1PK1 B;  4I28 A;  4CDG A;  9ICQ A;  2ISP A;  1A76 A;  2IOH A;  2KVS A;  4LZD A;  1NK0 A;  4J9S A;  3NTU A;  9ICT A;  2EZZ A;  4BWJ A;  2ZTD A;  5IIO A;  5J8Y A;  1LVH A;  5AI0 A;  3ISD A;  3ETR A;  5CHG A;  3N4M B;  4O3Q A;  4UB8 U;  5IIM A;  3UMG A;  1JX4 A;  4AP9 A;  1NJX A;  4QW9 A;  3JPS A;  4EEL A;  5KG2 A;  1JN3 A;  4I2D A;  2W8K A;  4U7C A;  5KFO A;  4DSL A;  3ZDA A;  2AHO B;  5DG7 A;  3NUQ A;  1KSP A;  2G08 A;  4FZM A;  4M9N A;  4K4H A;  1BPB A;  1ARO P;  4B6J A;  3QU9 A;  3Q8R B;  5AKK A;  3ZDB A;  5CA7 A;  1L3S A;  2OCE A;  2HHW A;  1ZQJ A;  3EPI A;  2A1A A;  9ICL A;  3WK9 A;  1KBU A;  7ICM A;  2HHS A;  5J2H A;  1ZQL A;  2KG5 A;  2DBY A;  2FMP A;  4KLJ A;  3PSF A;  4RZR A;  5KFN A;  3QX7 A;  2AU0 A;  4I2F A;  1IM4 A;  1DGJ A;  9ICN A;  1T8E A;  9ICE A;  4OJL A;  3FYH A;  1SIJ A;  2RLT A;  3BS5 B;  4UAR A;  2GOL A;  1UQV A;  3SYZ A;  2DFL A;  4RQ6 A;  1ZQC A;  3HPO A;  5B5E U;  4MF8 A;  1QQ5 A;  3FDS A;  4C7Y A;  2C2R A;  2ES6 A;  3EUB 2;  3SZ2 A;  1U48 A;  5L1M A;  1SL0 A;  3UPQ A;  2KIC A;  1Q46 A;  1CI4 A;  2EZX A;  5L1K A;  4EEK A;  3ZD8 A;  1F5S A;  2W3S A;  3V6J A;  1P7D A;  2BCR A;  2JV3 A;  5ALX A;  3C28 A;  4F93 B;  4QIW F;  1L8L A;  3AUO A;  3HJE A;  7ICE A;  3MFH A;  4P0P A;  3KHG A;  1SV4 A;  1D8B A;  3WKA A;  2CPR A;  3V7L A;  1KL9 A;  3TAD A;  3PNC A;  3BQT A;  5GTH U;  5ALW A;  2NRX A;  2LI6 A;  4RPZ A;  4B9L A;  2ZG6 A;  8ICX A;  1L6N A;  3RH6 A;  5J0X A;  3RRG A;  2C22 A;  3MR5 A;  1X9X A;  3AQF A;  3NVV A;  4ZOH C;  2E8P A;  1ZQU A;  5KG7 A;  3G6V A;  2N1R A;  1HEK A;  3ISC A;  1MC8 A;  4ED3 A;  2BKE A;  5EE1 A;  4EZ6 A;  1WUD A;  1ECW A;  5DB8 A;  4J9N A;  1HUO A;  4Y2V A;  4C8N A;  2R8J A;  4US8 A;  5JRT A;  1N48 A;  5KNI A;  2HVI A;  2C2E A;  2V4R A;  3MC1 A;  1XO1 A;  4B9V A;  3AM9 A;  2KZZ A;  3QUC A;  2WB1 F;  4R8U B;  2IOF K;  4CCH A;  5ALP A;  5CJ7 A;  1NK6 A;  2HI0 A;  2LMR A;  4J9Q A;  9ICC A;  2ESE A;  4QIW C;  3T5K A;  4RNN A;  3EPG A;  9ICH A;  3H4D A;  2YN4 A;  3KTQ A;  4J9O A;  1JI7 A;  4JWN A;  3B0Y A;  3UXP A;  3AN1 A;  3RR8 A;  4DCC A;  5DGB A;  2FPK A;  1S77 D;  1SZH A;  5KG5 A;  5J2F A;  4DFJ A;  1N5X A;  2XVT A;  3QEA Z;  2EAN A;  2QKQ A;  2F77 X;  4M6W A;  3DDH A;  2WF7 A;  4KN4 A;  2DKZ A;  4QZB A;  3H40 A;  2P35 A;  2Z7J A;  4Z6C A;  2ZIW A;  1NK9 A;  1FO4 A;  8ICT A;  4UBC A;  4G9B A;  2OWO A;  3UXN A;  4ICA A;  2BPC A;  1B4F A;  4YR3 A;  3RB4 A;  1X9S A;  1Z19 A;  1JRO A;  4DSE A;  3PO4 A;  1DOQ A;  2WB1 C;  4YD2 A;  3WK8 A;  3RH4 A;  1KFT A;  2NV3 A;  5K4L A;  3LK9 A;  1ZQS A;  1DK2 A;  1SXD A;  3AL0 B;  8ICF A;  4C4S A;  3V6H A;  4B9T A;  4IQT A;  8ICQ A;  1ZQB A;  5JU5 A;  4A8E A;  2A1J A;  5KL1 B;  1JMS A;  1PVP A;  2YX8 A;  2NO4 A;  1KFS A;  2LPE A;  2G06 A;  3BQ2 A;  2KKV A;  1NZP A;  3AQE A;  3K1R B;  4NLZ A;  3RB3 A;  2D6F C;  3CW2 C;  1ZRM A;  4IQV A;  1ZQM A;  2A3V A;  1ZD2 P;  3QU7 A;  3C1Y A;  2J6U A;  3ALR A;  4ED7 A;  4C0Z A;  2H3Z A;  3BQ1 A;  5DG9 A;  3KD3 A;  4CF3 A;  4F5N A;  3M7D A;  2FPM A;  2J6T A;  5AK6 A;  4KLU A;  4J9R A;  1JRP A;  4XQ8 A;  2W03 A;  4IRD A;  4F3O A;  3BZK A;  3M9M B;  1X9W A;  1RYS A;  2W9A A;  2W55 A;  3QYP A;  1XS9 D;  4KLL A;  3JPQ A;  7ICQ A;  2R18 A;  5KFK A;  3CNH A;  3HW8 A;  4USA A;  8ICK A;  5KFF A;  2K4H A;  4DWI A;  3K75 D;  2V4Q A;  2KIV A;  5DB9 A;  2PFQ A;  1S76 D;  3ZI4 A;  1ZD3 A;  2ZIU B;  2XI9 A;  1COO A;  5JTI A;  4Y2Y A;  4IR1 A;  2ASJ A;  5TIS U;  1ZQI A;  2RDJ A;  2Q4T A;  2FPL A;  1JUD A;  4ELV A;  4EEY A;  2ZXH A;  1QH9 A;  1XSP A;  3TAP A;  4DOB A;  4F4Z A;  5D4B A;  1SV0 A;  3H0L B;  3WK6 A;  5KTQ A;  4M2Y A;  2EDU A;  5CR0 A;  3M8R A;  2DQN B;  2KTQ A;  4B9U A;  5ALN A;  4ECR A;  4BXO B;  3H8M A;  4HAI A;  3EYZ A;  2I1Q A;  2OHF A;  5HML A;  1T94 A;  5J0O A;  1KTQ A;  1NI3 A;  2JEG A;  1XSN A;  1IXR A;  5J0S A;  8ICM A;  1PUZ A;  2E1E A;  3OPX A;  3GIJ A;  1N63 A;  4RT2 A;  4TUQ A;  4CF5 A;  2P6U A;  1B43 A;  1JXL A;  1BGX T;  1L8O A;  3M6K A;  3UMC A;  5ALZ A;  4ACO A;  3ZDC A;  3KKA A;  4DL3 A;  2MSN A;  2L5Y A;  1BPZ A;  2YQE A;  4RPX A;  5L1L A;  4JB3 A;  3B0X A;  3T3F A;  2GLE A;  4UQG A;  7ICN A;  4I2J A;  5HP4 A;  1NKC A;  2Y9U A;  1L3V A;  4UAW A;  2JMG A;  5G5H A;  5AI5 A;  1ZD4 A;  2YY6 A;  5J0Y A;  2PXI A;  2ASD A;  7ICP A;  4GFJ A;  3JPR A;  4C7Z A;  2EQY A;  2UVW A;  2JR5 A;  4RPY A;  4DSK A;  2HBL A;  2GH1 A;  2UVR A;  4DFM A;  3BQ7 A;  3RJK A;  1N60 A;  4GC6 A;  3PX4 A;  9ICS A;  2PFN A;  2PMZ F;  2PFP A;  4DOC A;  5KFG A;  4J9L A;  1FFU A;  4ECX A;  4KLQ A;  3WKE A;  5J0U A;  4FO6 A;  5KFC A;  3T79 A;  2D8C A;  4QZD A;  2ALZ A;  3RH5 A;  3SAF A;  2HDO A;  3TFS A;  2FI1 A;  1Z1B A;  4Q44 A;  8ICE A;  1ZD5 A;  4DS4 A;  5J29 A;  2W54 A;  2G07 A;  4IQU A;  2Y0S F;  1B0X A;  2W43 A;  4I2C A;  1TAQ A;  2GWS A;  2ZUB A;  2VKQ A;  5L1J A;  5D49 A;  2KSO B;  3QUT A;  1ZQG A;  4QWD A;  3M9O B;  1KW4 A;  4BJQ A;  2ZJA A;  3JPP A;  7ICI A;  4TUP A;  2W3R A;  1U45 A;  4Y2U A;  1SL1 A;  2UVV A;  5KG4 A;  3QE9 Y;  4NLG A;  2BPF A;  5AIA A;  2NYV A;  1LB2 B;  1SKW A;  2PMZ C;  1ZQD A;  4I2H A;  2KKP A;  2BR0 A;  3N7P D;  1U4B A;  3BJY A;  3I76 A;  4NWI A;  2DL0 A;  2HHT A;  4CNQ A;  2PFO A;  4YN4 A;  4BWM A;  3H8S A;  5KFW A;  3LYS A;  3V7J A;  2ASL A;  4QW8 A;  4M9L A;  4F91 B;  4O3O A;  3OGU A;  1KDH A;  8ICB A;  4PGX A;  2WF6 A;  9ICW A;  4O5K A;  5IIJ A;  1Z1V A;  5EWG A;  1S0V A;  3JPT A;  3RJJ A;  3VCB A;  5KG0 A;  2ZIX B;  4JK1 A;  4YXJ A;  4TQS A;  3SR6 A;  4M9J A;  4UB5 A;  1XNS A;  5BOL A;  3H4B A;  2FLL A;  4IL6 U;  4RU9 A;  1ZQE A;  1ZXI A;  2LM4 A;  4FBU A;  2W9C A;  4KLT A;  3C2M A;  4YR2 A;  2KE7 A;  2XC9 A;  1KN5 A;  3KHL A;  1F44 A;  8ICR A;  4Y2X A;  1A6S A;  2JZB A;  1X2I A;  2XIC A;  7ICR A;  1UPH A;  2VA3 A;  4AYB F;  1C20 A;  1YZ7 A;  2E1F A;  1QTM A;  4DOA A;  2W9B A;  2ZJ8 A;  2IBK A;  2KEY A;  4OD0 A;  3WKC A;  4YP3 A;  4M0A A;  8ICV A;  2YMQ A;  3RB0 A;  1ZJM A;  2H3Q A;  2ZTE A;  3QEB Z;  4TQR A;  1LKY B;  2F3N A;  1Q3V A;  3PX0 A;  4QZI A;  1T7P A;  4F5P A;  7ICU A;  1O03 A;  3U26 A;  2C28 A;  1RXV A;  4DSJ A;  3QU4 A;  1TFR A;  1PVQ A;  2MA1 A;  3G6Y A;  4P0Q B;  4DL7 A;  4F5Q A;  1N62 A;  2KZM A;  4RQ4 A;  4ECQ A;  2B6G A;  4FZN A;  4B9N A;  1WWV A;  5F9L A;  4J9K A;  4Y2J A;  5L1I A;  1CUK A;  3NVZ A;  4GLX A;  4ELT A;  2FMS A;  3M8S A;  3ISB A;  5ALF A;  1Q3U A;  5DLF A;  2B21 A;  2IOF A;  4ZH4 A;  5ALE A;  1SB3 C;  2W11 A;  4QWE A;  4DL6 A;  3OSP A;  2QB0 A;  2XCA A;  4J03 A;  4FE3 A;  4TUS A;  1PK3 A;  3PW7 A;  4DL5 A;  4ECT A;  3HKZ F;  4KMU A;  1LV5 A;  2IMW P;  4KN7 A;  2KNJ A;  3F5A A;  4J9M A;  3ZD9 A;  5KFV A;  4DSF A;  5DBA A;  3WK4 A;  4KX3 A;  4EBC A;  1D9F A;  2KFN A;  4DO9 A;  2KHQ A;  3Q8S B;  4K4G A;  4RT3 A;  4NXZ A;  3PO5 A;  2LKY A;  1JXE A;  2CXY A;  5AM4 A;  3RJE A;  4OJO A;  3MR2 A;  4Q8F A;  4RUC A;  1AQ6 A;  2E8O A;  4C8O A;  1IG6 A;  4MF2 A;  1QQ6 A;  4I2B A;  3DEE A;  2NRT A;  1NK8 A;  4EBE A;  4C8M A;  5KG6 A;  2Y9T A;  2XY7 A;  1XWL A;  3GIK A;  5KL8 B;  3GU3 A;  4YMM A;  3WKB A;  5KT6 A;  1F0M A;  4WJ3 B;  1L3U A;  4P2H A;  4OJ5 A;  3HKZ C;  4QWC A;  1TE2 A;  4BXO A;  1MQ3 A;  2EH9 A;  1FFV A;  5KFQ A;  3VC8 A;  4P4P A;  3PSI A;  1ZQF A;  2EAP A;  3KHH A;  3QUQ A;  1ZQK A;  5HR6 A;  1NK5 A;  2FMQ A;  1WG8 A;  1UA1 A;  3RJH A;  3SAG A;  4XRH A;  4O3P A;  3NGD A;  3GIL A;  2I5H A;  1TVA A;  1T3Q A;  5J2D A;  4PHP A;  3N7R C;  5AK5 A;  4YVZ A;  2FE9 A;  4I27 A;  1SXE A;  2VJ4 A;  1T3N A;  5TZV A;  5KAI U;  3MAB A;  1N5W A;  5G5G A;  4HYK A;  4UB6 U;  3UQ2 A;  5HMM A;  5ALU A;  1HUZ A;  1D8Y A;  4DQQ A;  2ZUC A;  4I2G A;  4Y2R A;  3ICX A;  1L3T A;  2R8K A;  3RR7 A;  5AKI A;  3KOO A;  5EE9 A;  4MFC A;  1BNO A;  2LHT A;  5ALY A;  5KFU A;  4Q8E A;  5IIN A;  1XC9 A;  4NM1 A;  5F3X B;  2HHX A;  4ED0 A;  1Z3E B;  3L5K A;  3D6J A;  4YXM A;  4C8K A;  5EWF A;  4DLE A;  1KKX A;  5CP2 A;  4UB3 A;  1VJ5 A;  1L7P A;  2PI5 A;  2RQ5 A;  1ZQR A;  3IP4 B;  3C2L A;  4DF8 A;  7ICH A;  1D9D A;  1IV8 A;  2R8H A;  1ZQQ A;  2YMP A;  2AQ0 A;  1Y88 A;  2OYY A;  4DQP A;  2KJ9 A;  5J2C A;  3GDX A;  1NJW A;  3V72 A;  4B9M A;  3MDC A;  5KFS A;  4KLO A;  2YB1 A;  1V9P A;  3WK7 A;  4UB4 A;  4QZ8 A;  2AGO A;  5ALM A;  1ZRN A;  1KFD A;  2P66 A;  3C21 A;  2LBO A;  4QZG A;  2OM6 A;  4PL2 A;  4GXJ A;  1DXS A;  5J2K A;  4O0I A;  5ALO A;  1C7Y A;  2KMD A;  5AM0 A;  2OEH A;  2W9M A;  4FFD A;  4KLG A;  9ICM A;  3OJS A;  7ICV A;  5III A;  3RFA A;  4IQW A;  9ICU A;  4EYH B;  3AU6 A;  8ICO A;  4F2S A;  2ZIV A;  5J2B A;  1Z00 A;  1CRX A;  1RPL A;  2QAR A;  2MUT B;  3SEN A;  2DF4 B;  1N2X A;  2E3T A;  5KT3 A;  3K1Z A;  2K8B B;  4O3N A;  4DL2 A;  4IRC A;  2DPJ A;  3CRX A;  5HHI A;  3PST A;  4BDP A;  3NVW A;  5GTI U;  4KLI A;  2OH2 A;  1ZQP A;  1O08 A;  4PL1 A;  4OJP A;  4JWM A;  1BVS A;  1U9L A;  3Q8Q B;  4EZ9 A;  5KG1 A;  1X42 A;  3M6Z A;  4P0P B;  1K1Q A;  3RRH A;  2HMX A;  4O3M A;  4MEX A;  5IIL A;  2HCF A;  3QNM A;  2YB4 A;  2XY6 A;  4BX9 C;  4QZH A;  5KG3 A;  1NKB A;  1GO3 F;  4O3S A;  5CB1 A; 
#chains in the Genus database with same CATH homology
 2WAQ F;  2JH7 A;  2A3V A;  4KX5 A;  3M6K A;  4ACO A;  2ZIW B;  2H3Q A;  2W7P A;  3ALR A;  3SAH A;  4OO1 J;  2K8C B;  2PMZ C;  2VIX A;  4C0Z A;  2H3Z A;  3F5E A;  1Q3V A;  1KBU A;  5KL8 B;  2KKP A;  2LYB A;  3GU3 A;  2OYY A;  2M0N A;  2KJ9 A;  3N7S C;  2KOB A;  2K4I A;  3M7D A;  3N7P D;  2WB1 F;  3PSF A;  2HOI A;  2MRL A;  3LVW A;  4WJ3 B;  2F2A B;  2ZIU A;  2G09 A;  3F53 A;  3D2Q A;  3SMV A;  1URJ A;  3O0F A;  4QIW C;  2RP5 A;  1HIW A;  4NWI A;  2W03 A;  2JMG A;  4FZL A;  3HKZ C;  3ONN A;  2YB1 A;  4IC9 A;  4OJ5 A;  2VJ5 A;  4NLC A;  2H3F A;  2H3V A;  1PVQ A;  4OJL A;  3C29 A;  3MGV A;  2MA1 A;  3KFU F;  4P0Q B;  3VC8 A;  1IIP A;  5A0L A;  4U6P A;  2G0A A;  2R18 A;  3LVV A;  3PSI A;  2HBM A;  2GOL A;  3F2C A;  4GFJ A;  4NV0 A;  2ZIX A;  2KV2 A;  2XID A;  3LYS A;  2K4H A;  1YT3 A;  4FZN A;  5HR6 A;  2CN1 A;  3IG5 A;  2H3I A;  2LBO A;  2KD1 A;  1SZH A;  2GH1 A;  2HBL A;  3SAG A;  2KJ5 A;  2OM6 A;  4PL2 A;  2ZIU B;  2HOF A;  2XVT A;  5T14 A;  2XI9 A;  1A0P A;  2F77 X;  3NRW A;  2W7O A;  2KHV A;  1Q3U A;  3L3F X;  2KVC A;  4QJF B;  2KIW A;  2G5I B;  1ZQ1 C;  2KIC A;  2LYA A;  3IG8 A;  4QNL A;  3H0R B;  2PMZ F;  3N7R C;  1OUQ A;  2VJ4 A;  2E5S A;  2Z7J A;  4CDG A;  2HOQ A;  2ZIW A;  2Q4T A;  1P7D A;  2JHD A;  2OXO A;  5HR7 A;  3RFA A;  3VCB A;  2ZIX B;  3T79 A;  2ZXH A;  4CRX A;  1TAM A;  2Y0S C;  5C0Y A;  3SAF A;  3C28 A;  4FE3 A;  1XNS A;  2BDU A;  2DGZ A;  2WAQ C;  4QIW F;  4ICA A;  2ZIV A;  1PVR A;  3HKZ F;  3PZP A;  1Z1B A;  3H0L B;  1CRX A;  3ICX A;  4P0P A;  1MA7 A;  2KNJ A;  2DF4 B;  3F5A A;  1Z19 A;  1D8B A;  3K1Z A;  2CPR A;  2K8B B;  2W04 A;  4AYB C;  2F8L A;  1XO0 A;  2DQN B;  1DRG A;  2K8A A;  3D2S A;  3SQI A;  2LHT A;  2G07 A;  2WB1 C;  3F2B A;  3CRX A;  1F44 A;  2NV3 A;  2Y0S F;  4KX3 A;  3PST A;  2RHF A;  3IN5 A;  4NLB A;  3E0F A;  2JH1 A;  3AL0 B;  2KHQ A;  1A6S A;  2F76 X;  3D2N A;  4OJ6 A;  2XIC A;  2OH2 A;  2ZG6 A;  2HBJ A;  1UPH A;  2JGA A;  4OJP A;  3KZX A;  4PL1 A;  2LKY A;  4AYB F;  1L6N A;  2VKQ A;  3RF9 A;  1T94 A;  2ZXI A;  1ED1 A;  3AQF A;  3F2D A;  2E1F A;  2ZIV B;  2N1R A;  4OJO A;  1HEK A;  4A8E A;  5KL1 B;  4KMO B;  5CRX A;  3M6Z A;  4P0P B;  2HMX A;  2YX8 A;  1PVP A;  1WUD A;  1ECW A;  2K4E A;  4BUG A;  4U7C A;  4O3M A;  2G06 A;  2G5H B;  3GZF A;  4BJQ A;  2KKV A;  1NZB A;  3H0M B;  2E1E A;  2HBK A;  3AQE A;  2YB4 A;  3OPX A;  2CRX A;  3NUQ A;  4BX9 C;  3CYM A;  2RRD A;  2G08 A;  2KEY A;  3CP8 A;  4FZM A;  4JMU A;  2K89 A;  4CGZ A;  2D6F C;  3PSP A;  3IP4 B;  1GO3 F;  4P0Q A;  3DEE A;  2KJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...