4F3OA

Dna polymerase i large fragment complex 5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
566
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTANMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 198
structure length 566
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f3oA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f3oA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f3oA01
3TAMA 2PI4A 4FS2A 4KLOA 4YXMA 1TKTA 1UT8A 3PX4A 3TQ1A 4OGEA 3AVCA 5CY4A 3NF8A 3L2VA 3DMJA 3QE9Y 4PGXA 3UPQA 4M9NA 7ICKA 3N4MB 5C24A 4O3SA 7ICQA 3HSTB 3EZ5A 1QLNA 1ZQIA 3NH1A 4QWEA 4ECUA 4KHUA 3C1YA 5DKWA 3I0RA 4CEZA 4J2EA 5KG4A 1WLJA 1IXRA 1T03A 5DB6A 4W5TA 4XUSA 1ZQPA 5KT2A 4I2AA 9ICTA 4CEFA 1A5XA 4KHWA 3HPOA 1ZQJA 2FMSA 4F4KA 1Y97A 4CFCA 3NGZA 1QSSA 4KLDA 9ICMA 1KFTA 1ZQOA 4CK3A 4KLJA 1A77A 4EBDA 2HNYA 3T1AA 3NTUA 5DMRA 4NM2A 4KAZA 4QZ8A 4FYDA 4Q0BA 1A5VA 3DOLA 1NJZA 1TAUA 4KLFA 1REVA 4YR2A 3G6XA 1TV9A 3QIOA 4IDKA 3TR8A 2PXIA 1ZQTA 4GC7A 1YTAA 4OKEA 4IR9A 1S9GA 3OYEA 4UB5A 1ZQYA 4MFBA 1NOMA 4Z4GA 2P66A 3GILA 3AVIA 4J9NA 4ED7A 1RZTA 4QAGA 4ED8A 4R65A 2VG5A 4IQUA 3I0SA 4KLTA 3MEDA 1DTQA 1ZBFA 4RQ8A 4KTQA 4UAZA 1CXQA 7ICJA 3MXMA 1KFDA 7ICLA 1S10A 1KFSA 2EHGA 4DTJA 5BPCA 1GOBA 3RR8A 3FFIA 3B0YA 2OWOA 4Y1DA 3RRHA 4IFYA 4JWMA 4OPJA 1BISA 7ICMA 1J53A 4FBUA 4RT2A 5K14A 1YTUA 7ICIA 4CIEA 1N56A 1EXQA 1NK7A 4F3TA 3D45A 3OYIA 3V7KA 1TK0A 2P5OA 3QZ7A 3Q8SB 2PZSA 1SUQA 4YD2A 3ZDDA 2HVHA 4F4XA 4QZAA 1NK0A 2FBXA 3HJFA 3KKSA 4MFAA 1WSEA 2BGWA 3SCXA 3MECA 2PI5A 1LW0A 3OJUA 3TFRA 2J6SA 3KLEA 2F1HA 3SPYA 9ICRA 4UB4A 3RMDA 3GIIA 1XC9A 3HXMA 4BE1A 2W9BB 1JL1A 1QTMA 2PFQA 4HTUA 3H40A 4C8OA 2BE2A 5J0QA 4GLXA 4GC6A 1RT7A 4FCYA 5L1JA 2UVWA 3N97B 3L2WA 4PHAA 4OLAA 4DQQA 3OYDA 1HPZA 3VQ8A 4C8KA 1FKOA 3DRPA 4F5NA 9ICJA 4KLMA 2D0BA 4I2QA 3L2QA 3C21A 3RTVA 8ICPA 2PY5A 1BPZA 3OYKA 5IIKA 1QHTA 3T5JA 2E4LA 1ZETA 4H4MA 4AHUA 2BGGA 4CGDA 3WNEA 2ZE2A 4DL5A 3LAKA 2KW4A 5J2GA 4UB1A 5KFZA 2R8IA 4NCAA 1RDCA 5J0RA 4FJGA 4M0AA 2JZBB 4DMNA 3G6YA 2FBVA 3LPUA 1WN7A 1TKDA 4P4MA 1HJPA 3NGYA 2JEJA 1NOYA 4BWMA 5J0WA 4O3QA 2PYLA 4FJIA 4CJPA 4BE0A 8ICRA 3UIQA 5HMMA 4CJ3A 1JMSA 2R7YA 4I2CA 3RMBA 1BPEA 3ITHA 3M8QA 4PPXA 3TABA 4ECVA 1X1PA 3OS2A 2R8JA 3SYZA 3NDKA 4F8RA 4H8KA 1ZQDA 4B8CA 1JLBA 3CM5A 3C6UA 3M8RA 4IQVA 3T5LA 4M9JA 7ICOA 3EWAA 3JPSA 4MEXA 8ICMA 4Z4EA 4GMJB 1KEJA 2JEFA 2XRIA 5F9LA 3AO2A 3KD5E 1Z00B 2OPSA 4UBCA 3TI0A 1U04A 1K1SA 5D49A 4B9TA 1X9MA 2E6MA 2C2RA 4R8UB 3LP1A 1SL1A 1WSJA 1ZQVA 4CHOA 4Q43A 4KB0A 4F50A 3EW9A 2FPMA 3ZD8A 2FMPA 4KLEA 2HHSA 1LWFA 1XHXA 1TL3A 4F93B 3OHBA 4O9MA 3NF7A 4CGIA 4UB3A 3BQTA 3GV5B 5KT3A 4Z4FA 3MR6A 1T8EA 1S1WA 4FJMA 8ICVA 1CLQA 1L3SA 1BI4B 2FPKA 4M3UA 1MU2A 1ZQMA 5KFPA 4F4YA 1XSNA 2RKIA 5J2FA 3K5OA 4GXJA 4DOAA 3VA3A 5KFOA 3VQCA 3LAMA 2KTQA 4X5VA 4KI4A 3SV3A 1D8LA 4DTXA 1QSYA 1LWEA 1HYZA 1U9LA 3U6FA 2BQRA 3VQDA 3V9XA 9ICPA 3JPOA 3HM9A 1ZQKA 1LW2A 3GFKB 2UVRA 3TAQA 4F5PA 3QEBZ 2BHNA 4IQTA 3H4BA 4O5CA 3K5MA 2RDIA 1I3AA 3K58A 1HQEA 2J6UA 2LSNA 4DSFA 2YKMA 2OYQA 4ECXA 4RQ4A 4F4WA 2W9CB 1ZQSA 1NJWA 1J54A 7ICUA 4QZDA 5DLFA 2OA8A 3G0ZA 4DF4A 2IOCA 2GWSA 4CF9A 4LY7A 4ZTFA 4W5OA 4ECYA 1VSKA 2MUTB 3RJEA 4G1QA 1KVAA 4GXIA 1RT3A 1QS4A 3O4NA 3HP6A 3FYHA 2F1IA 4IBNA 4CJWA 4RNOA 4CJVA 2W8LA 7ICHA 1ZQCA 4M3ZA 4RW7A 1A5WA 4ED1A 5CJ7A 5I42A 1Z25A 5SWMA 1RYRA 1ZBIA 3JPTA 1WSFA 2RN2A 4FZZA 1LB2B 5HBMA 1ZQWA 3LK9A 4CF2A 2HHXA 4BXOA 3V7LA 3CFOA 1Z26A 5J0OA 2X74A 4HHTA 1VRUA 4M6WA 4YR0A 4IFVA 1S77D 4QW8A 3Q8PB 4DOCA 5DB9A 4FJHA 8ICIA 4J9LA 1FK9A 5DGAA 2XGPA 3KK2A 5KTQA 2BKEA 5KFVA 3U3YA 3JPQA 4KLQA 3SI6A 5KT4A 4TQRA 3TARA 1R0AA 2BCUA 3UXNA 5HLFA 8ICGA 4NY8A 3V4IA 4KPYA 4LH5A 4CJ4A 3VQAA 1S1TA 2FBYA 3DYAA 5JS1A 4DWIA 2JGUA 2F1JA 1HYVA 4KLLA 3C1ZA 7ICGA 4Y1CA 4RQ0A 3C2KA 3V9ZA 1WSHA 4PY5A 4DL4A 4AH9A 4ECTA 4FLXA 1NJYA 2ATQA 2B6AA 2NRWA 3T5KA 4AHVA 9ICSA 2F96A 3HX0A 4KLIA 1XU4A 3CYMA 2OZMA 1S9EA 1XWLA 1WCNA 4CESA 3Q8LA 3RJKA 4I9LA 1MQ3A 3DLEA 4L8RB 4M9HA 2ASLA 4QZBA 2YNGA 3ETLA 4I2FA 3AVKA 4DTUA 2W8KA 4YVZA 3QO9A 3PY8A 2P51A 3P83D 4YQWA 1KTQA 4HCBA 1X9WA 4F2RA 3L3VA 4EZ9A 3IRXA 4DLGA 7ICFA 5IIMA 1RDAA 4CHPA 2B4JA 5J2CA 3KLHA 3NE6A 5EU7A 2G8WA 5HRRA 3H4DA 5L1IA 1SKWA 1JXLA 4AHTA 4DS5A 5DB8A 4CJEA 4RPYA 3HPGA 4IRDA 3TAPA 3C95A 2HHWA 2I1QA 1SKRA 3AVHA 3WNFA 3QETA 1BCMA 2KFNA 1RBTA 1EXNA 1XS9D 2R8HA 3NH0A 2OZSA 2XGQA 2RF2A 1TVRA 3MDAA 3IHQB 3SQ0A 4DTNA 4I2BA 4TQSA 4AILC 4KLSA 3MBYA 3KHHA 1RTIA 3LDAA 1C0MA 1YVUA 4N5SA 4XA5A 3RB4A 1T3NA 1IKYA 4RNMA 4B9NA 2DY4A 4CECA 3JYTA 4O55A 5KT7A 1JKHA 3NAEA 4HUEA 5BOMA 4FJLA 2ZD1A 3L8BA 4DL6A 1ASUA 5L1LA 1KDHA 4MEYA 5J2IA 2PFOA 2PFPA 1JLEA 1Q8IA 4PGYA 2NRXA 2R8GA 1JLFA 5DQGA 2FLPA 1C6VA 5J0YA 3TAGA 3MDCA 1ASWA 4QZCA 9ICOA 3L2RA 1B9DA 3QEWA 3RH5A 4M9LA 3A2FA 3RH4A 2IDOA 1RT1A 5IIJA 4W5RA 4JLHA 4FO6A 5TZVA 3NF6A 4RQ7A 3PR4A 2IBKA 4DQIA 3RB0A 4R64A 2FC0A 5L9XA 3HK2A 3EYZA 4OKJA 1LAWA 2OPQA 4DTSA 3GDXA 4F5QA 4I29A 3QEAZ 2ASDA 4FJJA 4DF8A 3PW4A 3MABA 1ZQNA 4NYNA 3KHRA 5EOZA 2ZTDA 3QNOA 4RZRA 4KHSA 3VQBA 2Z1HA 4NYFA 4BE2A 4DTPA 3BQ2A 2FLLA 2YHAA 5C5JA 4ELTA 1JXBA 5J2AA 4JV2A 4KV8A 2XO7A 4PHPA 5KGWA 2RDJA 4ED0A 4CHYA 4CGGA 4KITB 3ZSVA 1T7PA 3ULDA 3K75D 4P4PA 1VSJA 5HHIA 4E7JA 5F9NA 5DQHA 1ZQAA 1WCLA 2VA2A 5DBAA 2X6SA 4K4GA 4RQ5A 4F92B 5J2EA 1U4BA 2IA6A 5CZ1A 2WTFA 3DLBA 2DFEA 4KHNA 3AO5A 4ECRA 3LANA 1MSWD 4J9OA 4KREA 9ICFA 3B6PA 3Q8QB 3MR3A 1RT6A 3HT3A 4DLEA 2QKBA 1L3UA 5J1EA 4FJKA 4FW1A 4GW6A 4FK4A 8ICJA 1HUZA 2O4GA 4YMMA 4JV0A 4RQ3A 4CHNA 4JV1A 5E41A 3RMAA 2VA8A 1UAXA 4EP4A 2YV0X 3NBPA 2A1SA 4FK0A 2HHUA 1BIZA 3LP0A 3PW7A 2NRVA 1ZBUA 1NK6A 9ICKA 1QQCA 5HP1A 1DLOA 4DQPA 3V1RA 3KD1E 2C28A 5DDYA 5KFTA 3I8DA 4YP3A 4NM1A 1FXXA 5DLGA 3LWLA 4YMOA 4TSXA 4DSIA 8ICLA 1RNHA 3ZSXA 3M9MB 3IM1A 4CK1A 4DG1A 4O5EA 1C1AA 2DFFA 1ZBLA 1D5AA 1S1VA 2ZUBA 1RBRA 1UWBA 4BXOB 4MQ3A 1LAVA 4CGHA 2A1RA 4XIUA 3MFHA 4AHRA 4K4HA 3ZD9A 3AVMA 4E1NA 4R66A 4F3OA 2ZTCA 1U48A 3CFPA 4EYHB 8ICOA 4FLTA 4NLNA 2VA3A 4I9QA 3QEXA 7ICTA 4M3YA 2ASJA 3ZDBA 3ZSZA 1VSDA 5KRTA 2AJQA 1HJRA 4WE1A 1VSEA 1BGXT 5CHGA 2Y1JA 3SUPA 4OJRA 1N48A 4RUCA 1IO2A 4MFFA 4DS4A 1WAFA 3AUOA 2BR0A 2FLNA 1FKPA 4YN4A 4DFKA 4CJ5A 4JS4A 3OSNA 1VRTA 4MF2A 1S5JA 2MUTA 5KFQA 5BOLA 2KZZA 4B9MA 1UA0A 4Q44A 4HCCA 4HVJA 4NLZA 3OS1A 1L3TA 3RMCA 1K1QA 5KFGA 1IG9A 4I2DA 4FK2A 1NK9A 4IQWA 3LP2A 4PHDA 8ICQA 4KTWA 2G8IA 4FZYA 1Q9XA 5EWGA 1EX4A 4ZTJA 5J2PA 4I2PA 3KKRA 3ZSQA 4OPKA 3PO4A 3AVJA 5CWRA 5EWEA 3G10A 4B9VA 2GV9A 3T19A 5J2QA 3V6JA 3LZJA 3V72A 3E2EA 4QWBA 5CZ2A 4J2BA 3ZSRA 4O0JA 2W9CA 3T5HA 4JK1A 3JSMA 3OYJA 2PYJA 4CFDA 1RTHA 2ISOA 3OYMA 3OYGA 2X78A 3CM6A 3E01A 4PH5A 1TKXA 2IGIA 3D0PA 3RR7A 5CR0A 4BDZA 3QEVA 4HUFA 3IS9A 4FS1A 3ZT3A 7ICNA 3Q8MA 8ICAA 3RAQA 3PV8A 2BCRA 4J9MA 2UVVA 3QNNA 4M41A 4FJXA 3K4GA 3GIJA 4DFMA 3AV9A 1KSPA 5KFUA 4M47A 4YFKA 3EY1A 3C94A 1BPYA 2VG6A 4JRQA 3TAFA 2HW3A 4CIFA 3ZSYA 3WNGA 3SUQA 4ECQA 1C1BA 4DFJA 2Q0ZX 1B9FA 4M6WB 5T7BA 4I7FA 4QW9A 3RB6A 3SJJA 3Q8KA 3OYFA 5KG2A 4R8UA 1NK5A 3JPNA 5KG7A 2XY5A 2BDPA 2P6RA 4IR1A 1S1UA 4CEAA 4KN7A 4N41A 4YD1A 2H5XA 2IC3A 4K8XA 3SV4A 1NJXA 3ZDCA 1JX4A 8ICZA 1D9FA 5KFFA 1NK8A 1IKVA 5IINA 1KCFA 3QESA 2LYHA 4QWDA 3HP9A 3MR5A 3AVGA 1RPLA 1ZQXA 3PR5B 8ICCA 1S0VA 4LD0A 4CEOA 4KTZA 2I5JA 4EYIB 1HNIA 1VSIA 3QEIA 5HNKA 3AA5X 5C25A 1G15A 4P4OA 4FM0A 3QINA 3CG7A 2QKKA 1IM4A 4E19A 4FLUA 4OLBA 2R8KA 2UVUA 4J2AA 4LZDA 4DFPA 4E7KA 3DLHA 3SNNA 4IKFA 4KMUA 4JUZA 3AO1A 4O4GA 4I2EA 1JIHA 3RJIA 3PMNA 3VQ9A 3T3FA 2KFZA 2XCPA 1ZQEA 1K6YA 2JEIA 4UB2A 3AA2A 3UQ2A 1S97A 1ZQGA 2YHBA 3RJFA 2BANA 4QCLA 5HRNA 2V4RA 4O3RA 3IG1A 4KO0A 8ICNA 2KZ3A 3V1QA 2DTUA 2ZTEA 3OYLA 3MR2A 4FBTA 3M8PA 3MEEA 4QWAA 4B3OA 1V9PA 2ALZA 4OKKA 5IILA 3V1OA 3BQ1A 3M9NB 1RTDA 4KN4A 5D3GA 5L1KA 4Z4CA 2AQ0A 2W42A 3QZ8A 2ZQBA 3UXPA 5DBCA 4B8AB 4Z6DA 1RT4A 1Z00A 3C23A 3NGDA 2DPJA 3DRSA 3B0XA 4E7LA 1ZJMA 1X2IA 1A76A 3DLRA 4DTMA 4PGQA 3VQQA 4QZ9A 4FLZA 1L5UA 3GIMA 5J2BA 4M3RA 4I2HA 3ZCMA 3H08A 4ED3A 4E89A 1N6QA 1KRPA 3S3MA 2BQUA 1SV5A 2GBZA 3AVLA 4Z6CA 4RQ1A 1S76D 2VWJA 3LDSA 2YNIA 4RW6A 8ICWA 2ISPA 3C2LA 5KT5A 4K4IA 1ZQRA 1QSLA 3UXOA 8ICKA 3AA3A 1C0UA 3NFAA 4M3WA 4DL3A 4CK2A 5KT6A 4CJSA 4E1MA 5KFXA 1KVBA 5I3UA 2QXFA 4CEBA 4FJNA 5J2JA 3PNCA 2BCSA 3LPTA 1TKZA 1DGSA 4O5KA 3KK1A 3ZT0A 1BIUA 2PFNA 3HO1A 5KG3A 5KFDA 4NLGA 5DQIA 3SQ1A 4DL2A 1BHLA 5FRNA 1EP4A 4I27A 5CP2A 5DGBA 1S0OA 1F21A 4XQ8A 1VSFA 4M3TA 5FRMA 1TFRA 1CXUA 3AVNA 3NF9A 1SL0A 4ED6A 3SI8A 9ICWA 1HNVA 1KVCA 4XRHA 2OPPA 3BQ0A 3OSPA 1RDBA 4JWNA 3ASMA 2MAXA 1RILA 3O4QA 3ZT4A 1BPBA 2ZJ5A 1O1WA 4CJQA 4F2SA 4YMNA 2ZJ8A 4Z6EA 1DTTA 3RBDA 4CEQA 5C42A 1NOZA 1TK8A 4RW8A 1S0NA 1LWCA 4TUPA 5HHHA 4JS5A 1CZ9A 3U3GA 2HMIA 4K8ZA 3TANA 3NHGA 4NXZA 1S0MA 5J2MA 1HYSA 1WSIA 2XCAA 1NKBA 1CUKA 4YG2A 1UOCA 1JLGA 1X9SA 4DSJA 1JLCA 2W9MA 1MQ2A 4DTRA 4KB1A 3QIPA 2ZJAA 1VSHA 4HYKA 1VK0A 2G8VA 1HMVA 4ZH4A 4LVSA 3RAXA 2D0AA 2P5GA 4FW2A 5J2NA 5J2KA 1U47A 4RQ6A 3V6DA 4C8LA 5HMLA 1HQUA 3B6OA 1Z3EB 4E3SA 5HRSA 2IMWP 4KLGA 9ICEA 3S3NA 1W9HA 3KHGA 3TFSA 3DLKA 1JLAA 4N76A 4O3NA 4CFAA 4LH4A 4H4OA 3KHLA 4CF8A 8ICBA 1BCOA 2HNDA 3OHAA 4ECWA 3THVA 1QE1A 3PMLA 3HVTA 4RPXA 3PW5A 2G8HA 4FLVA 3C5GA 2YNFA 1XHZA 4QZGA 2AU0A 1IH7A 5KFYA 3ZDEA 1N5YA 1I39A 3RJGA 3K2PA 4IG3A 8ICTA 2EX3A 3RWUA 1RYSA 4ICLA 2HB5A 1B22A 4P2HA 2B5JA 5CYQA 1RTJA 4TUSA 1UT5A 9ICLA 4ECSA 8ICHA 4TURA 3S9HA 5KGXA 3PVXA 1CEZA 2BPCA 2G8FA 3RH6A 4CEEA 4ID5A 3LP3A 4RQ2A 5DB7A 4DQSA 3RBEA 2BPFA 2E6LA 4M45A 3MXIA 4O0IA 2AGPA 1B92A 7ICSA 1TL1A 4EP5A 3VQ5A 3EPGA 4OGCA 5KFHA 4O5BA 4DSEA 3EPIA 3DLGA 2JZBA 2HHQA 4UBBA 1ZQZA 1RXWA 9ICBA 1RBUA 4QZIA 4MFCA 4LSLA 3MAQA 3BDPA 4PQUA 4PHEA 3FDSA 3H8WA 2NUBA 3F9KA 4FM2A 2XHBA 1WNSA 2FPLA 1YT3A 3PX0A 1BPXA 1GOAA 4TUQA 4CHQA 4PWDA 5IIOA 4UAWA 1D9DA 2D5RA 1RDDA 4DU1A 5J0TA 3O3FA 4E7HA 1C7YA 4RUAA 4N56A 3V6KA 1BQNA 4KI6A 3JPPA 4ECZA 2QK9A 3RRGA 2C22A 4O3PA 1KLNA 3OJSA 3OYNA 4R63A 8ICEA 8ICFA 5D46A 2DPIA 1ZBHA 3K5NA 5KG1A 4LZGA 3MXJA 4CE9A 4PA1A 1BQMA 4Z4HA 4CF1A 4YFUA 3AVAA 3V9SA 4IRCA 3PX6A 2XY8A 2I9GA 3QLHA 9ICGA 5KG6A 3ZT2A 4J9KA 5KFLA 5DG8A 2ITGA 3H8SA 3PW0A 3K5LA 2OPRA 7ICRA 3H8JA 1MC8A 2FBTA 8ICSA 1UA1A 5KFCA 3DOKA 3OYAA 4EBEA 3GQCA 1S6PA 4AHSA 3VA0A 2NRTA 5CYMA 4CGFA 3ISCA 1SKSA 3C5FA 1GOCA 4RPZA 1DOQA 4DQRA 5SZTA 1XSLA 4M42A 1RBVA 3OS0A 1EKEA 4R5PA 3M8SA 2WONA 2IHMA 4CGJA 2A1JB 3ISDA 2C2DA 2V4QA 5KFBA 7ICPA 2KQ2A 4DTOA 1S1XA 4FJ8A 2HHVA 1BI4A 5KFAA 2IS3A 1VSMA 1Y88A 3C2MA 4CFBA 1ITGA 5KFKA 1JXEA 3KK3A 4I2IA 1ZYQA 3PUFA 4O44A 1COOA 4J9QA 4Z6FA 3ZT1A 1TV6A 4RW9A 2BPGA 2NRZA 4E0DA 1WAJA 3DM2A 5KG0A 4GVMA 4DL7A 3H7IA 5J29A 5KFNA 1RXVA 8ICXA 3SUOA 1XI1A 3CQ8A 2P6UA 3PO5A 5KFIA 4N47A 4CJLA 1SL2A 3VQ6A 2AGQA 4BWJA 4Q45A 3M9OB 1EETA 3HL8A 4KKOA 2J6TA 4G3IA 1RBSA 3ISBA 1SZPA 3G6VA 4NCGA 1U49A 3HW8A 3MGIA 2Z1GA 4GXKA 2BCQA 7ICVA 9ICXA 4Q5VA 2GUIA 4I2JA 3VQ4A 2G8KA 3HPHA 4M2YA 1CZBA 4FJ5A 2F8TA 4FZXC 4RG8A 3TWHA 3KLFA 3AVFA 4KLHA 5DG7A 3OVNA 3L3UA 5HP4A 4NCBA 1NK4A 2YNHA 2C2EA 3OYBA 4C8MA 4J9SA 3SUNA 2XY6A 4EEYA 5KG5A 1PZNA 4LSNA 2Z1JA 3OGUA 4ELVA 1ZJNA 4RU9A 2AGOA 3AO3A 4DO9A 1U45A 2WOMA 3KLIA 9ICHA 3V9WA 4CF0A 4E7IA 4RT3A 2RPIA 2X6NA 4EBCA 3DI6A 2M9NA 3RJJA 1TVAA 2XC9A 4M9GA 1ZQLA 4DSKA 4NLKA 3SQ2A 4CIGA 1HUOA 4F4ZA 3MFIA 3P1GA 4I28A 1KLMA 3KJVA 4CJUA 1IKWA 4DSLA 4KFBA 1C1CA 4W5QA 8ICYA 2DFHA 1RT2A 3VQEA 2F8SA 3VQPA 4J2DA 3AO4A 3OY9A 4BDPA 4QZHA 5HROA 4MF8A 1J9AA 2HVIA 1TGOA 3BJYA 1IKXA 4CJRA 4BACA 4RNNA 2W9BA 3V7JA 4F5OA 4FJ7A 9ICVA 5DDMA 2V9WA 4YXJA 4CCHA 5J2DA 4UQGA 1XSPA 3NGIA 5FROA 3ISNC 3QERA 5KFSA 3PW2A 1HRHA 3RB3A 2BCVA 5KI6A 3JPRA 4B9LA 3ALYA 2A1JA 3NCIA 3O3HA 9ICCA 3OYHA 5J0UA 2HHTA 1VSLA 4FXDA 4CJTA 3S3OA 2IHNA 1T05A 4J9RA 5KFWA 3ORYA 3V6HA 2JEGA 5DBBA 3HYFA 4Q8EA 4FJ9A 1H38A 4ELUA 9ICUA 3F73A 2XY7A 9ICNA 4CERA 3NH2A 5JUMA 5DG9A 7ICEA 4DOBA 3CFRA 1S9FA 4B08A 4Q8FA 2G8UA 3BGRA 4CJFA 4Z0UA 2KN7A 2ZUDA 1Q9YA 3UQ0A 5J0SA 4QZFA 1BVSA 1XO1A 1WSGA 9ICAA 5D4BA 4EZ6A 3ZSWA 2VG7A 4O3OA 1T4GA 4F91B 4I2GA 1TK5A 3QEPA 4C8NA 4QOZB 5J0XA 5IIIA 5DK5A 4KHQA 5KRSA 2Y1IA 3MEGA 1ZQHA 5KFEA 2IAJA 4ED2A 1L3VA 2AQ4A 2Z1IA 2ZUCA 4OVLA 3HWTA 3DRRA 4FLYA 4ZHRA 3SZ2A 5CA7A 4QWCA 1ZQFA 1BL3A 4KLUA 4M04A 4M3XA 3SQ4A 1JL2A 2FMQA 1D8YA 4F5RA 3K59A 1W0HA 3K57A 5J0PA 1NKCA 2P1JA 3AU6A 1ZQBA 3O3GA 4W5NA 3WNHA 5KFJA 5FDLA 3KLGA 4HUGA 1J5OA 1BPDA 1TAQA 2VANA 3L2UA 4FLWA 3GIKA 3ZDAA 3LALA 4IG0A 4CHZA 3IAYA 3OYCA 1JN3A 3AA4A 3ZSOA 4J9PA 4QZEA 4JRPA 2ATLA 2JLEA 4YCXA 5CB1A 8ICUA 2YKNA 2B21A 4PUOA 5JS2A 3MGHA 3KTQA 5KFMA 1JLQA 4B9UA 4B9SA 1NKEA 1C0TA 1S6QA 3KIOA 4BGDA 4DU4A 1AROP 3C6TA 4IRKA 2O4IA 3VQ7A 4KRFA 5EWFA 4UAYA 5HRPA 4BDYA 3VN5A 4RW4A 3V81A 4Z4IA 2VWKA 1B43A 4YNQA 3TAEA 2KZMA 4ID1A 3AU2A 9ICQA 3LZIA 4FM1A 2W9AA 4YR3A 3AVBA 3LWMA 4FVMA 3Q8RB 3GV8B 1ZQQA 3P5JA 2ETJA 1RT5A 2HNZA 2DFLA 4DEZA 4CJKA 3HVRA 2BQ3A 3SPZA 5J2HA 4AHCA 1LV5A 5KFRA 3GV7B 3RJHA 2D0CA 4KHYA 1RCHA 4DU3A 4CEDA 9ICIA 1ZQUA 3V9UA 2Q3SA 1ASVA
chains in the Genus database with same CATH superfamily
5J2PB 3J7YP 3Q7CA 3J7ZO 2MKHA 3FZMA 4US8A 3TQ1A 3OUYB 5CY4A 2XG8A 2YY6A 3NF8A 3DMJA 5K14B 1RTHB 1S8OA 7ICKA 2A18A 2UUWA 3HOSA 4LF6K 3UDLA 7ICQA 4Y65A 1WHYA 3EKSA 3NH1A 1NSAA 1B4FA 4LBIA 1MDUB 4P72A 1T03A 1BC6A 2IM1A 1ZQPA 2XEXA 4V1Ak 3HOTA 4B3MK 4E8UA 2KRRA 4KHWA 1HNWK 3GSIA 4B3MJ 4NXMK 3BGRB 1YJTA 1N52B 1E3MA 1N36K 3GFHA 5D4OA 3K8VA 4KLJA 2KVCA 5A76A 5AXNA 1URRA 4FYDA 3KJNB 1Q0NA 1A5VA 3DOLA 4CTAB 4IXCA 3IV6A 4HDHA 3KZIU 2BJ7A 3KUEA 4GC7A 1N5QA 4OKEA 4IR9A 3GG1A 1N5TA 2K60A 3QYPA 4Z4GA 2BUNA 2MTLA 1R31A 1Y3KA 3OL6A 1NGBA 5FPMA 4OYOA 5H2FU 2O66A 2ZZMA 4MK9A 2UXCK 2F7VA 4KLTA 2JRSA 3MM9B 3J7AN 2XSJB 4KTQA 3GTYX 2AWZA 1WNEA 1NGFA 4P2XA 4UAZA 1I6JA 3CC2N 1URJA 5IM0A 4HWIA 4DTJA 5BPCA 1APSA 4FKYA 5A8KB 4OYMA 3DNCA 1HBMB 2CPIA 2X1AA 4JD2B 2MGZB 1RGVA 2Z7JA 3B0YA 4WFXA 2ZOFA 3D6TB 3BS5A 2YQEA 2WVCA 1HPMA 3GCXP 2QWQA 2CGKA 5K14A 2QT7A 7ICIA 4LJXA 2GW8A 4A61A 1NK7A 2HFOA 3FCVA 4DV7J 3D45A 1DQ8A 2KXFA 2RU3A 1U26A 4U67L 4DHVA 4YD2A 3ZDDA 2QWNA 4H03B 5D78A 1RWMB 2V4JB 3A3NB 3MUMP 2HOQA 1IUJA 3MCPA 4GO7X 1HNXK 4OYIA 4DV0K 3KLEA 2QA4S 3P4IA 3VEOA 2F1HA 3SPYA 1VQOS 5D4PA 1XC9A 3LF0A 1RWPB 3P96A 3BYRA 1JL1A 3H1VX 2BJEA 4AQYK 4HTUA 1BQNB 3W61A 4FCYA 2XI9A 1RBAA 1AYEA 5L1JA 2UVWA 5K8OA 3L2WA 4PHAA 2LXFA 2NUHA 3K0SA 4WTOB 1K73T 4KGMA 1FKOA 3DRPA 9ICJA 1SZHA 2KVSA 4LR9A 1RQLA 3HSGA 1T3VA 2D0BA 2IOFK 2QB0B 1YZ7A 2LVWA 3KK2B 3C21A 2CQ0A 1F2GA 3OTBA 5A6PA 1FXDA 1BPZA 3OYKA 1RI7A 3T5JA 1PSDA 1ZETA 3D66A 1T11A 3ZX0A 2BGGA 2VPXB 4XAKA 2ZE2A 3M2RB 2KW4A 4UB1A 4AQYF 2ADCA 1WF1A 2LQ8A 3TWZA 1ZXOA 2ZH2A 2HGNA 2QEXS 4WYBA 2UZAA 3G6YA 2F8HA 2FBVA 1RA6A 3GJRB 2QWPA 4FVUA 4CLWA 5J0WA 4A2AA 4O3QA 2HK2A 4FJIA 4BE0A 1YZ6A 3UIQA 5HMMA 2QB0A 4I2CA 3TJAA 3AN1A 3CCUS 2XYPB 3M8QA 3G8TA 4PPXA 4NYZA 3J81U 2R8JA 1V6HA 3OXGA 2UUAK 3OL8A 4CP5A 4RCHA 1ZQDA 1JLBA 1TYQA 2E9ZA 1NI3A 3AXMA 3EZUA 4M94A 4MEXA 2YWFA 3IRXB 1U8WA 3CDWA 3NVVA 1KEJA 3KDNA 2XRIA 1Z19A 3FEXB 3UN2A 5DJBA 3AEVA 2R4FA 4LRCA 2O8EA 4M5IA 1VHIA 1SWWA 2ACYA 2VGNA 1XC3A 1X9MA 2GGPA 3Q2SC 2DGOA 4Y3CA 3AGKA 4QIFA 4R8UB 1ZQVA 4CHOA 4F50A 1TR0A 1QVFM 4JI7J 3VERA 3HD1A 1XUPO 4KLEA 2DBBA 4DU8A 1T94A 3A0BU 5ALGA 1KW4A 5KT3A 2RKIB 3BZQA 4F7VA 3TZYA 2D9PA 3MPVA 2VJVA 2GS8A 3F2KA 8ICVA 4A59A 1X60A 2CA9A 1T6DA 3D3CJ 3T9ZA 2HKEA 4OHVA 1RABB 2RKIA 2LA6A 3K5OA 4WBFA 5BRDA 4FYWB 4DOAA 5KFOA 2M4MA 1BNPA 3LAMA 3C14A 5LSOA 3MAHA 2EFVA 5F8LA 1OYDA 3VCBA 3VGSA 3EE9A 1XMQK 3SR6A 3SQIA 1RHRB 2PFFB 4O8KA 2MSTA 3QT8A 3UE5A 2RDIA 2P6SA 2J6UA 4K0KF 2V69A 4XH5A 5IQQA 5AKGA 4RQ4A 4XH1A 1B0XA 1RT2B 1J54A 2F40A 2RAQA 4MK7A 1LFPA 4AL5A 1WOOA 4KHPJ 4LY7A 1GLJO 4DB3A 2DD8S 1XK8A 1JLFB 4G1QA 2EZYA 1KVAA 1NNLA 1RT3A 3HT0A 4WXWA 1QS4A 4Y2KA 3VEZA 5D0EA 2ZD1B 2F1IA 2CPJA 4CJVA 2KLAA 2W8LA 3FBEA 1ZQCA 1GXTA 4C3MA 5EDWA 4RW7A 4M3ZA 1KQSR 4ZKAA 4M5HA 4PWDB 2RRDA 5C25B 2ZH9A 4WCEL 2ZH8A 3CCRN 1OQ3A 2BA9A 3AOBA 1ZBIA 4JV5K 4K4XA 2KJ5A 3W8PA 5ETSA 2RN2A 1YXQA 5HBMA 1ZQWA 3LK9A 3X3UA 4CF2A 2GWKA 3V7LA 2QMXA 2JZ5A 2VASA 4E1JA 1OYEA 1JWWA 1VLBA 2X74A 4HHTA 5LOQA 3OL7A 4M95A 1NZ8A 5E84A 4CZEA 1QCKA 2ZUAA 4DOCA 4M1KA 5BPLA 5CHIA 1Z1VA 4J9LA 2W2NP 3JPQA 3AA9A 3VV2B 4I6YA 1R7IA 3UXNA 2V8DA 3VCDA 4US9A 4MLHA 1J6ZA 3J80O 1HBMA 4WYLA 1S1TA 3DYAA 3J80U 1GLEG 2FBYA 2BJDA 3CCMS 2JGUA 3HFKA 2O8FA 4DR1K 4RQ0A 2CJYB 1KN5A 4PY5A 3FEZA 4FKXA 1SZ2A 2DNRA 4AH9A 2M0NA 1RKIA 3T5KA 2SXLA 1HKGA 3MM6A 2F96A 2HHHF 2CWXA 2Q79A 1S9EA 2EANA 4MKVA 4DL0C 1Q4RA 3RJKA 3DLEA 4HR2A 3QJJA 4L8RB 4Y2XA 5K5MA 3V6DB 4JKFA 2RB7A 4I2FA 2CJAA 1B99A 4WFNQ 3PY8A 3P83D 3BKFA 2ZH5A 2CJ9A 4HCBA 1WTFA 4F2RA 3L3VA 4UF4A 4FDFA 2H5IB 3SQGB 5IIMA 3D7EO 3AH6A 3KJVB 1RDAA 4CO4A 2B4JA 4M5NA 1VQKS 2WF9A 3MCNA 5AM2A 1WELA 4OLOA 3NE6A 4NXMJ 1HNVB 3BDEA 3N4WA 3E9PA 1KQQA 5HMWA 4WF9Q 1V5VA 4CJEA 3HPGA 1S9EB 3TAPA 3VMFB 5HBMB 1X5OA 4DUYJ 5BPMA 2WAQC 3R5BA 3R5DA 3HKWA 4B3MF 1BCMA 2KFNA 4CYUB 1KHWA 1NAQA 1Q81O 3O6QA 2UP1A 2E1ZA 3NH0A 4C11A 5AQFA 2K8GA 3BF4A 1L8OA 2XGQA 1BY9A 1TVRA 5AQYA 3MDAA 3SQ0A 1RT3B 4KLSA 3LDAA 4WZQA 2RUSA 3BP8A 2G0IA 2IOFA 1T3NA 5G5GA 1FFVA 1F5BA 4B9NA 2DY4A 4U67Q 4M8LA 2D8CA 2DK2A 4BRAA 1Z2LA 3QIPB 3G82A 5B8HA 4FJLA 2W2PP 1ASUA 4LIWA 2PFOA 1KDHA 2R8GA 4FZNA 3HJVA 5DQGA 4PL1A 1ZOLA 3MM8B 4RLEA 3MDCA 4QZCA 9ICOA 3L2RA 4O8UA 1B9DA 2EBEA 3GOIA 1HBUB 3M32A 3OVAA 1SJQA 2JMGA 4G1IA 4DV5J 3A2FA 2N3LA 5IIJA 1B0TA 4OYZA 4BR0A 1K5OA 1UZDA 4BCAA 4OFZA 5AQMA 2IBKA 1VQPN 4R64A 1XMQF 5L9XA 4ERDA 2E8NA 3QATA 4JK8A 3NVKA 3EYZA 4OKJA 5AQGA 2OPQA 1LAWA 4DTSA 1TKZB 3QO9B 3O2IA 4F5QA 3LQVA 1VBKA 1TL7A 2I0XA 1M1GA 3QT5A 2ASDA 4NLVA 4DF8A 3PW4A 2HBQB 2GH1A 1E6YB 1EARA 2NPFA 3K17A 4NYNA 3KHRA 2FYXA 3L9ZA 3VQBA 1WG1A 2KT2A 2ZXIA 4DTPA 2FLLA 2LEBA 3G2XA 1JXBA 2VIHA 1N32K 1RT7B 4LF7F 4JV2A 1WHVA 1C1BB 2XO7A 5C2GA 2PD1A 2RDJA 4ED0A 4P7TA 4CGGA 2IVNA 3O9SA 2CQDA 3ULDA 3K75D 1XNQF 2H3IA 1PVQA 3U8XA 1VSJA 2FE9A 3TTFA 1PO6A 1RZMA 4E7JA 1D8ZA 2X6SA 1M5VC 3FZFA 5BRHA 2W11A 1SI9A 1QDUB 2Q4TA 4KHNA 3U1MA 4LF1A 2JLGA 4OPHA 1WBBA 3HT3A 4DLEA 3KK1B 2QKBA 1NGJA 2AA4A 4FW1A 4NXNK 2OPSB 4GW6A 8ICJA 4PCQA 2V8GA 4YMMA 2CQCA 3L5KA 3ENBA 2BXJA 1PKUA 5A6WA 4LF4F 2ROPA 3QU5A 2A1SA 4LF8J 3C15A 4KH6A 4YN3B 3TYTA 1WSVA 3PW7A 3WK9A 1ZBUA 4CZCA 4BGBA 2XI2A 3DI6B 3C16B 5E7OB 3U27A 4YP3A 3NMRA 2VIXA 2CZ9A 1NGCA 2FGCA 3MEDB 8ICLA 3ZSXA 1RBOB 4OJHA 3AARA 3G25A 4O5EA 1F9EB 5TISU 1UWBA 2KHVA 3MFHA 2VJUA 2LPEA 3ZD9A 3GR0A 4EYHB 8ICOA 2QM1A 1J5EF 2VHGA 4I9QA 4X64F 4UZBA 2YHXA 4UOFA 3MM8A 1OJ4A 1VSDA 2GUPA 2IVPA 2AJQA 3NNAA 3ENQA 2CGLA 3O4WA 4IC9A 1DHMA 4DPWA 1N48A 3AAWB 3SBTA 4MFFA 1NWKA 2LU1A 2AV5A 5GAEU 5T7LB 3AUOA 1LWXA 1FKPA 3AB4B 1XQIA 1NDKA 3I28A 3UWTA 4CJ5A 1X4BA 4JS4A 1VRTA 1CSJA 3SEOA 5KFQA 1IJEB 2AEMA 2KZZA 4YOYA 2I6XA 1DURA 3IBCB 3R27A 2BJ1A 3DCAA 3OS1A 3L6QA 3RMCA 4BVOA 1RM6C 1JQGA 2AYBA 3OFFA 2LCWA 1NG9A 3MI7X 4OJ6A 4DV1K 4UTGA 1NK9A 3LP2A 1IQZA 2Y9UA 4YEAA 4P0PB 4KTWA 4ZVUB 3ULHA 2LQ9A 2G8IA 3AL0B 2VFUA 3W5YA 1EX4A 2H65B 2KH9A 1KR4A 3ZSQA 4OPKA 2XLKA 1OPZA 1BWEA 3WK8A 1TUYA 3IM8A 5AQLA 2I5JB 2MA1A 2HBKA 4B9VA 4HT7A 4JHDB 3LZJA 4I6MB 3CJAA 4UB6U 3DOMB 5CZ2A 5ADXA 1X4GA 3ZSRA 4O0JA 2XMWA 2A42A 5G5HA 1A6SA 2VC0A 2IDLA 2DY1A 2XBPA 3AOAA 3R9KA 3DRSB 3OYJA 1N33J 4NXMF 2ISOA 3QRRA 2HK3A 2E9TA 4PH5A 3RVCA 2A1AA 4LBPA 3M6WA 1H74A 3RR7A 2WW4A 1MWYA 1VQ6N 2I1RA 3Q8MA 3VEVA 1KOOA 3RAQA 4LF6F 3D1OA 4J9MA 4QJVA 3PIPL 4ZPWR 1JLBB 4QBUA 3GIJA 3TO8A 4NLCA 1VQ7N 2NSBA 2YX7A 3EY1A 4WTYA 3L4QA 1BPYA 3CD6N 4KSEB 2XB2D 1PK1A 1RYUA 4EU0A 1FO1A 4NE9C 2K06A 2Q0ZX 3IKMA 3H7HB 3AQFA 4WFNL 4I7FA 3Q8KA 1YJRA 3OYFA 4IG3B 4R8UA 1WHWA 3JPNA 5KG7A 4ILGB 5IZHA 2QYGA 3H0MB 4H5WA 2E1CA 4YD1A 1FDNA 3EVOA 2L48A 3BM7A 1L7MA 5D4LA 2F3NA 2O8CB 3T1YF 3ZDCA 3AFGA 2E44A 5A0YA 1D9FA 4BC2A 4K4ZA 1IKVA 3RG6A 5IINA 2LYHA 3O9UA 3HP9A 1K9MO 3GDQA 4H5TA 8ICCA 3I56N 2ZBIA 4HKQA 2K3IA 3ZTSA 3HRDD 3EO3A 3DLJA 4X65J 5HNKA 3I96A 2GVZA 4P4OA 2V6AA 4X65K 1F5AA 1N0UA 1NGEA 1RCOB 2J8SA 5JLFA 2R8KA 3H42A 2OH2A 4J2AA 4DFPA 1KKHA 1RAIB 2M7SA 3DLHA 4C23A 4X4VA 3AHPA 4IKFA 1MN8A 4JUZA 1U25A 4O4GA 2M70A 3QQCD 2ASMA 1JIHA 4FWPA 2EWSA 1RDRA 2RUGA 5LMUJ 1VQ5N 2CN1A 5AE3A 3GBTA 4JP8A 3AA2A 3C6TB 1RG6A 3FJ2A 3VAMA 2NPIA 3CCJN 3NP5A 2YHBA 3RJFA 3QGGA 5GAGU 2BANA 4QCLA 4DV4K 4MIAA 3FCWA 8ICNA 4B1VA 2Q0RA 3WXIA 3G4SN 2H3FA 4KBIA 3N7SC 2WBRA 1H7XA 5M1PA 3DOMA 4IO8A 1V9PA 3NVWA 1TMMA 2HNDB 3OHRA 3K89A 4UOCA 4FF2A 3BQ1A 3M9NB 1ED1A 5D3GA 2EKYA 5HQ8A 3I4PA 1HD0A 4A8YA 4Z4CA 2AQ0A 4IJNA 2XMVA 1EQ0A 1KWMA 2ZQBA 1WI8A 3B9JA 2QIFA 3UCUP 1XEZA 3G6EN 3ENHA 1Z00A 2E2OA 4DCJB 1LKYA 1W2BR 4Y2JA 3DLRA 4BC7A 1GX5A 4PGQA 1PVPA 1KEKA 4KV8B 4UB8U 3M32B 3B8HA 5GTIU 4M3RA 3WIUA 2EG1A 3EZWA 2DUYA 3H08A 4WQ4C 2AIRB 2EK1A 4FYYB 4Z6CA 3JAMU 2KD1A 5IC6B 3CIPA 1H2TZ 2WUSA 3WHIA 3MMBB 3VR1A 3A5NC 1SV0C 4EUVA 2IRYA 1UW4A 4CH0S 1K44A 4E1MA 3QGHA 5I3UA 2K89A 1I1GA 1FJGF 2YMPA 1LK5A 2BCSA 3LPTA 2ZBCA 4CNQA 1TKZA 1DGSA 3X1LB 3JSYA 1H3DA 2PFNA 3HO1A 2E5HA 3VEWA 3D4JA 3UI3A 4OJ5A 5F3TA 3R9PA 5D0GA 3MD3A 5DGBA 1S0OA 3WZ0A 1UP1A 4BRGA 5AT1B 4M3TA 2DNKA 4I7FB 3MMCA 4IUFA 2QSFA 4ES1A 3WXMB 4XRHA 2OPPA 4DQ8A 2OGUA 2YQ1A 1FESA 2MAXA 1RILA 1BPBA 4MDAA 1DQ9A 1EX8A 4K2XA 2D3O1 1DTTA 1U1PA 3O5BA 3PKMA 4QZVB 4CT9A 1FWPA 4JK9A 3PYFA 2G2YA 3RZAA 2P9KB 1TK8A 3P6YC 1E6VB 4DV1F 2NRRA 2DCUB 4Y2AA 1N36F 2HMIA 4EAHD 5GADI 3L4IA 3C14B 2MSNA 1R0CB 1WSIA 4IFYB 5AQQA 1E6VA 3PSPA 1UEUA 1UOCA 1X9SA 2W9MA 1GTHA 1HJOA 4NLDA 4JI3J 1IJFB 1VSHA 3TVYA 4DR6F 2FJWA 2P9NB 4FW2A 5BR8F 1WOPA 4QIWF 2RVJA 4RQ6A 3D0GE 4CBXA 1PK3A 4C8LA 4LJMA 1TAMA 1Z3EB 3GZFA 1GMWD 3S3NA 3KHGA 3DMJB 3DLKA 1ZD3A 1CULB 5T14A 2CUYA 4O3NA 4N76A 1H1VA 4R0JA 2LMRA 3MPDA 4PR6A 3CCQS 1FTCA 2HNDA 2DGWA 3THVA 1O13A 1OSCA 2ZC4A 4Y2TA 3BV8A 5DDOC 4RPXA 3I82A 2LEAA 4QIEA 2GO9A 3PHTA 3C5GA 2AU0A 5KFYA 1I39A 4A8XA 2JXJA 4LVOP 2I38A 2J7WA 2HB5A 1B22A 2HQGA 4P2HA 1IV0A 1HNZJ 2UUBJ 4TUSA 2DGUA 3F56A 9ICLA 3S9HA 8ICHA 4TURA 1U24A 4HAIA 2VYPA 4TYBA 4DR5J 3VGVA 1FDDA 1VJ5A 1FF2A 4ILJA 4KBOA 4RQ2A 2PFDA 3DLGB 3RBEA 2BPFA 1S22A 2E6LA 3CCSS 1B92A 3NXZA 4U8VA 4NA1A 5GMEA 2QA4G 4EP5A 4OGCA 3S1TA 2VFTA 3CQXA 4RKUC 5KFHA 4O5BA 4WQ5C 3EPIA 1JLQB 3DLGA 2JZBA 1RBUA 4R0EA 2H3ZA 2ZOGA 1DJ0A 4USAA 2U1AA 2H3EB 1HYSB 1IVZA 5TKYA 2VV5A 1WG5A 2VDHA 3SCJE 2A5XA 4TUQA 2K1RA 2VBXA 4C1NK 3D7SB 3NWRA 1HNXF 3CJ9A 4E7HA 1HR0J 1F6TA 4Q7AA 1VQLS 1C7YA 3WK5A 3CEDA 1Q7YO 4U7CA 4N56A 4GKJK 4ZVFA 4ECZA 3RRGA 2C22A 1K9MT 2UXCF 2CRXA 2W54A 3OJSA 1R6VA 4R63A 2IM2A 8ICFA 2DPIA 4BQZA 4LZGA 4CE9A 3F44A 3DGPA 2FY8A 4CF1A 4WXOA 1D8BA 1WOSA 2HGLA 5F8MA 3PX6A 2NR0A 5KG6A 5M2PA 4Y2MA 1HL6A 2QL5B 4G65A 3M6UA 2F76X 4Y2VA 1RU2A 4USHA 4LF9F 3BBCA 4JKDA 2OPRA 4CDIA 2OCEA 2VFVA 1YQHA 1UA1A 3DOKA 2M8DB 1K8KB 3N5FA 1VQ9S 1BLUA 4CGFA 2FIUA 2RHQB 2W4CA 1XSLA 2FF6A 4PKDB 3M6ZA 4I6AA 3HD2A 5CEHA 3SSSA 1YDLA 2DB1A 4A4JA 1KD1T 1VQ4S 3OS0A 2DR9A 3MM5B 2WSEC 4UASA 5B0DA 3ED5A 3CJ0A 2C2DA 2V4QA 1UVKA 5KFBA 4DTOA 4CLLA 1M5OC 3GZ7A 5KFAA 2I7NA 2ZH7A 1VK3A 2Q66A 1Y88A 1YTYA 2Z58B 3A8YA 1VS3A 2WOMB 3T1HF 1ZYQA 1WUDA 2GVDB 4QYRA 4O44A 1SJRA 4K43A 4Z6FA 3ZT1A 1TV6A 1FT8A 4CRXA 1WAJA 2LYAA 1K8KA 1X8DA 4NZ0A 5AXKA 2Z2LA 2HFVA 2OANA 1XI1A 5J29A 5KFNA 1RXVA 4AYBF 1GXUA 1VQMN 4RW8B 4CJLA 3W2VB 2C3PA 3U9ZA 1IIPA 3IN5A 2AGQA 1NGIA 4BWJA 4OV6A 2OXOA 3TADC 4KKOA 1FXLA 3H8MA 1RBSA 1N34J 4H0OA 1SZPA 3MN7A 2AP1A 3AAQA 3HJEA 4UY85 4P7VA 2N7YA 2B0CA 4OX8A 5IT9O 7ICVA 4J7CA 2GEMA 2W03A 2CZ4A 4RO0A 5K4LA 2OEKA 4I2JA 4A5AA 1MWKA 5E26A 2JSXA 1AZSB 1S6PB 2G8KA 2BE2B 3HPHA 1CZBA 1UPMB 3EDQB 5T7LA 3TWHA 8AT1B 1J2NA 1E4GT 4OZ0A 1ZRMA 5HP4A 4NCBA 2YNHA 4ZPAA 5HK4A 2QEXN 3OYBA 2FC9A 4QYZK 1N5WA 2XSFA 3R3LA 5AI8A 4X64K 5KG5A 4AFFA 1TMJA 4C6AA 2IYGA 1VQSA 4GKKJ 4DR1J 4RU9A 2ZKTA 4DX7A 3KLIA 1PIEA 9ICHA 1H2UX 4E7IA 2X6NA 1WC3A 2XC9A 5CABA 1GNKA 3CCZA 1ZQLA 4PL8A 3CIMA 4C4RA 3M2RA 3FZLA 1JCEA 3SQ2A 4WP8A 4CIGA 4YDXA 3ATVA 1RAEB 3F2BA 2ODGA 4X62K 1HUOA 4JI2F 3KJVA 2PBDA 3R6LB 1C1CA 2PA3A 3VQEA 1J2VA 4DV0J 4X4UA 2F8EX 1YJ9N 2G0AA 2H5EA 1ZAWA 2BW7A 1B0PA 3CTRA 2YX8A 3OBIA 5FPDA 4EO6A 2C1EB 4GV9A 3K8WA 4MYTA 3BJYA 1IKXA 4CJRA 3PIPQ 2RS2A 4PEOA 4RNNA 2P2CB 3V7JA 5BN8A 2BEFA 4C8YA 4FOEA 5J2DA 4NO7A 5ALPA 3G6ES 2O67A 2DPNA 3NGIA 1HIWA 3QERA 3CUNA 4C0OC 3PW2A 1ATNA 2BCVA 4JI6J 1UWBB 1ZD5A 3IWNC 1F3VA 3BYPA 3GB0A 3OYHA 2HHTA 1JI7A 2YB4A 1XNQK 4CJTA 2NSCA 3S3OA 1W7AA 4UY8T 1F9HA 3V6HA 2JEGA 3KUHA 3B8AX 3M8YA 4FF1A 5CH7B 9ICUA 4M5KA 3NH2A 7ICEA 4DOBA 2GIFA 4BVPA 4QS9A 4K8RA 2VOPA 5FD1A 4CJFA 2ZUDA 1Q9YA 2WF7A 5J0SA 5AJ3J 4QQBA 4K0KK 4EEKA 1EAYC 2I2YA 1FJGJ 1WSGA 9ICAA 1J27A 4EZ6A 3I0RB 3SK3A 2EBGA 3HX9A 3HM8A 4I2GA 3H6EA 4C8NA 2D6FC 2J0XA 5KRSA 5DETA 3NAHA 2Y1IA 4O5FA 1IBLJ 1FW6A 2NLWA 3DRRA 1IBLK 5CA7A 3TUPA 4QWCA 1ZQFA 3DDIA 5KPZA 1RU1A 2C3OA 3SQ4A 1CJKA 1JL2A 1H2VZ 3BUZB 3ONNA 1F60B 1KC8T 3NLCA 4M5MA 1S1VB 1WUUA 2H5JB 1RHMB 1IR2A 2P1JA 2F77X 1N5SA 2AYGA 4TY8B 3RF9A 4W5NA 3KLGA 4FWSA 1MWQA 3M8WA 3D5MA 2VANA 4P6QA 1CLFA 1KBRA 4CHZA 1B3TA 2WTUA 1W7WA 1JN3A 2K2PA 4U96A 2GZOA 2VL1A 4J9PA 2JLEA 4YCXA 1LFWA 4DX8H 4PUOA 3N7PD 2Z2YB 3KTQA 3CC2S 4B9SA 1C0TA 4FYXB 3QUBA 1FI4A 1HWKA 2YKOA 4DU4A 1AROP 2QMUB 1X9JA 4Y0FA 2CAJA 2E5LK 4D3GA 1SH0A 3F5EA 2MKSA 1VBXA 3V4IB 1IJJA 4WU2A 4NX9A 1CVJA 4NZ7A 4ID1A 1NJIT 3LM9A 2LP4A 2HWIA 5C2FA 4YR3A 1J5EK 3LWMA 2XS7A 4DV4F 4FVMA 3TOQA 1RUSA 2ZH1A 1B4SA 3GV8B 1ZQQA 3SAHA 1RT5A 2HNZA 4XDDA 2G1DA 4DEZA 3ZZUA 3QNMA 3VVUA 3RJHA 1KAZA 2D0CA 1OW5A 5L9NA 1L6NA 2RH3A 2CFXA 1X0FA 1ZQUA 1QZ6A 1C0TB 1LCUA 1G1XA 1H98A 2PI4A 3P5BP 1NRKA 5DM6L 2CQBA 1H73A 3AVCA 4P74A 3OTQA 3QE9Y 1HBNB 1YIJN 1WWVA 4M9NA 1NXIA 2KKHA 3N4MB 3NOCA 4O3SA 3HSTB 3S7RA 4YY3J 1L7NA 5LXRA 2RU9A 5TKWA 3I0RA 2MKYA 3D2WA 3FGUA 3IGVA 3PFOA 4ZMMA 4DR5K 5DB6A 4XUSA 4I2AA 2A19A 9ICTA 4B3SF 3HPOA 3OFGA 2C2NA 5IV4A 4PZVA 1UEVA 3MM7B 4CLZA 1IV8A 3K1RB 5HJXA 4YOEA 1QSSA 4KLDA 3ZZOA 4O4GB 3Q8YA 2RRBA 3ILIA 3MMCB 3ZX3A 5BYRA 2FJAB 4Z7YA 4NM2A 2M2BA 4Q0BA 4CLKA 4F0KA 1TAUA 2DNHA 1OH6A 4NYPA 1REVA 3QU9A 3G6XA 1TV9A 5IT9U 1SWVA 4C1NI 1S9GA 2W01A 4FZLA 4FXVA 1VQMS 1V38A 2P66A 3GILA 2BW2A 4J9NA 4ED7A 4QAGA 3J7Z5 2CKWA 5HVHA 1DEJA 1SC4B 4CGZA 2OTLN 1SUQB 3D54A 1TU0B 3I0SA 4ICLB 4FZVA 2K7KA 1ZBFA 3E58A 5AKYA 3EN9A 3HVWA 5AFUA 1CXQA 2IVFB 1URNA 1HUXA 1KFDA 2P9NA 4OHYA 1NJIO 3VAIA 2EKNA 4H0PA 1GOBA 4CZHA 3CE8A 2ZUGA 1UZHA 2ZZNA 1NU0A 2OWOA 4Y1DA 3RRHA 4IFYA 3K1ZA 1XMOJ 1FE4A 1COKA 4FBUA 3IDWA 4K4WA 1YTUA 2EVZA 1FVSA 5LJ5Y 2BRKA 3B78A 3S6JA 1Y0HA 4F3TA 2B0GA 5AJ3F 1YKWA 5ALJA 5DZ6A 3QZ7A 3Q8SB 3N28A 2PZSA 1SUQA 2E5JA 2KFYA 3NGTA 4F4XA 2BMBA 2QLXA 1NK0A 2FBXA 1E6YA 3HJFA 3KKSA 4MFAA 4C9DA 3OPXA 1FRIA 1IWGA 3ETRA 3MM6B 4H5NA 2BGWA 3ZC4A 3MECA 5DO2A 3WKAA 3TFRA 2J6SA 1Y64A 4P75A 2P9UB 9ICRA 3KOOA 4A8WA 2GVDA 3CD0A 4LF8F 3GIIA 5MLCQ 4OJPA 1OVYA 2W9BB 3T9NA 1QTMA 1NB2A 5C15A 4EIAA 1VQ7S 3VTHA 5HROB 4GLXA 4GC6A 1KVJA 5LSLA 4BQLA 3N97B 3A1YG 4OLAA 5ALOA 4Q2MA 4DQQA 1VRUB 2XMTA 4YOTA 4QYZJ 3M1YA 4C8KA 3QB0A 4F5NA 2C3UA 4I2QA 4USTA 3DXSX 5H9FK 1UHUA 3L2QA 2WF6A 5AQPA 2E1MC 3RTVA 3R6MA 3D1QA 3D2SA 3Q8VA 2PY5A 2ZIVA 4JKHA 3DRYA 4H4MA 2UUAF 2NCKL 4CGDA 2HWTA 4DR7K 4DL5A 3LAKA 4Y2PA 5J2GA 2ZHOA 1UAWA 5KFZA 4U95A 4WFYA 2MY7A 4PQUB 1ZAVA 5J0RA 4PJ0U 4FJGA 3EEQA 4M0AA 2RP5A 5E3QA 1RCXB 3D28A 3CD7A 1RAOA 1Y4ZB 1RSCA 3NGYA 3DXKA 2JEJA 1YLXA 4BWMA 1M0SA 2ASOA 2QO3A 8ICRA 1JMSA 4MFBB 1BPEA 2GA7A 3NKYA 3QAUA 1T9VA 3ITHA 3JYTB 4K5SA 1X1PA 3GFXA 3OS2A 2V52B 4GVBA 3NDKA 1T9TA 2MKJA 1KC8O 2XS5A 3M8RA 4EFHA 3IGNA 2IIHA 4IQVA 4K5RA 3QFHA 1HWJA 3L7OA 5M1FA 3W9HA 4JYAK 4K41A 2O01C 2HQDA 4PRFA 5F9LA 2NZCA 3AO2A 1MN9A 3QIDA 3UD4P 2FPHX 2NS1B 3KD5E 2OPSA 1U04A 1K1SA 4OMFG 4I56A 2QFIA 1RWVB 3WC0A 2E6MA 1DXSA 1O03A 3PFEA 5HAOA 1GTEA 2C2RA 3LP1A 2QV6A 4NLWA 1N62A 3K2YA 3ZD8A 1XHXA 3FBFA 1WG8A 5IV3A 3OHBA 4O9MA 4LMZA 2ZBQA 3N6NA 4Z94A 3BQTA 4CLTA 3DLLQ 1L8LA 3HKZD 3J81Y 1IBCB 4B3TK 3WC2A 3MR6A 3HZGA 1KVIA 4FJMA 2G4BA 1CLQA 1IKXB 4YDUC 3J7YI 1Q18A 5H1SQ 2QC3A 1MU2A 4BREA 5EOYA 3ILJA 2Y0SF 3HHLD 2EPIA 5J2NB 4GXJA 2RS8A 5ETLA 3VA3A 2B56A 1DFDA 2I8EA 3VQCA 3SV3A 1D8LA 1QSYA 1LWEA 1HYZA 2A3ZA 4OZ1A 3KBBA 2DQNB 3E9OA 3OLBA 2ZXHA 1G7CB 5C2CA 1OY9A 3V9XA 4YHHF 3M1VB 1TL5A 1VQKN 1ZQKA 1LW2A 2JRZA 4XPEA 4IQTA 4ETXA 3ZX2A 1MU2B 1I3AA 2LSNA 2KNJA 2QKQA 4ECXA 4BY9C 1X9XA 2UV8A 1QVFR 2R7XA 1ZQSA 2XMUA 2KIVA 3CJ3A 4QZDA 3PJXA 2OA8A 4M5LA 3G0ZA 4P0QB 3W1YC 2GWSA 3JB9k 3KK7A 4CF9A 5AK3A 4W5OA 4ECYA 3UFCX 5EX0A 2MUTB 3RJEA 2E1PA 3FYHA 1RDFA 4IBNA 4RNOA 2JWLA 5LXYA 7ICHA 2YNHB 4YB1P 5HLFB 2M3DA 4FE3A 1Q81T 2B8QA 3DGVA 3LGNA 2QWRA 3FKBA 4CO3A 3M5RA 1Z25A 1RYRA 2NXEA 1VRQC 4JI4K 2L9DA 1MMNA 3L95X 4JKGB 1LB2B 4M7XA 2ASPA 4DUTA 2DH9A 2W25A 4DR6K 1WF0A 4M6WA 1NZAA 4KGZB 2H3VA 3Q8PB 5DB9A 1PJ5A 4FJHA 8ICIA 4NI2A 2XGPA 3KK2A 3CMAS 2UXCJ 5KFVA 2RDDA 3PEHA 3U3YA 1W2BM 4KLQA 3JSBA 5KT4A 1UCVA 3TADA 1VQPS 1RJJA 1OQ6A 2ZKUA 2HWHA 3V4IA 5DDRC 2JVOA 1RWWB 4CJ4A 3VQAA 3MPUB 1IBMK 2PN6A 1UVMA 5GIPA 3LA0A 4B3SJ 1U7LA 4NWBA 3C28A 4LFBJ 4KLLA 1KQSM 2YMLA 3C2KA 3V9ZA 2G13A 5GINA 1WC5A 3KLHB 4DL4A 1JLCB 4ZP8A 2ATQA 4X4SA 5AQKA 2YB1A 2V34A 3N5BA 3KDOA 3PYGA 3HX0A 1XU4A 3CYMA 5IQ6A 1XWLA 3QU7A 2AYMA 4KH4A 4ZCLA 3C46A 4M9HA 2ASLA 3GE1A 2YNGA 3ETLA 3D67A 3MDQA 4DTUA 2W8KA 4BR9A 4YQWA 3CWJA 1NPPA 5A8KA 2RD5C 4KKOB 4WFBQ 3IRXA 4DLGA 1HNZK 2UUBK 1L7OA 4URSA 2CIMA 4EHTA 3FK4A 3UN5A 4BRCA 4PAAA 3VC8A 3CXCR 1LVHA 1NBWA 3IO1A 5J2CA 3KLHA 1DT9A 3M1VA 5HRRA 3H4DA 5L1IA 1HARA 3WBZA 5AQJA 5DB8A 1YIJS 3T6BA 4O4RA 3C95A 1S79A 3R8EA 3MX2A 3G9CA 5ETQA 3UR0A 3QETA 1RTJB 3WQUA 4DV6J 5J2MB 1X5TA 1FCAA 2GAHC 1RBTA 3SBMA 1XS9D 2OZSA 1SXDA 4ZIWA 1FFWB 2RF2A 1FX4A 1I51B 2W43A 3GPAA 4TQSA 3MBYA 3KHHA 2AEJA 3VOVA 2FZGB 2UU9F 1C0MA 1RDUA 3C3LA 3AD7C 2JWNA 4RNMA 1UWAA 3I33A 4F0HA 4ZLJA 3CCVS 2PO4A 3N79A 4DR5F 2DR8A 3J7A1 2ZD1A 2ZHAA 5K8NA 5JMNA 4F26A 4DPUA 5AKKA 3KWMA 2N7CA 4OPAA 2IC3B 5HOOA 3AY0A 3PXGa 3RH5A 1NCLA 4M9LA 2QA1A 4Y2CA 3RH4A 2IDOA 5KPRA 4W5RA 1GLBG 5TZVA 3NF6A 3DC2A 2K7JA 1M90T 2IVMA 3RB0A 2QA4N 3W62A 1FX2A 1VIOA 3FSIA 2ZF5O 1TQLA 1Q5YA 1SIZA 1I94K 3D3BJ 1VCTA 2O8CA 4DHYA 3CW2C 2IPOB 2FSKA 1RXOB 2V4JA 3MABA 3HHLB 2Y8YA 2ZTDA 1VFJA 3CCEN 4EI2A 4RZRA 3IXQA 4KHSA 3ZZYA 3A3OB 3EGNA 3BQ2A 3IS9B 2AT1B 1NNEA 4KB7A 1H6KX 4PHPA 5KGWA 3TPQA 5E3PA 4CHYA 3W66A 3ZSVA 3QBCA 4QPXA 1FJCA 3DJCA 1SIWB 4KIAA 4ZCIA 3FVYA 3KOAA 2P9UA 2ZHBA 2GO8A 2E5LF 5HL7Q 5DQHA 3ENWA 1ZQAA 1WCLA 2VA2A 4K4GA 2HQFA 3IR5B 4F92B 1U4BA 2LYVA 4MT1A 5IM0B 2P5VA 2HZVA 4DCPB 4ECRA 1MSWD 2O8DB 4LF4J 1SC1B 4FP9A 4FWRA 1T3QA 4H54A 1HKCA 3WX8A 1L3UA 4R5PB 2GQ2A 4FK4A 1HUZA 4JV0A 1HFEL 2FHKA 2XZDB 2F4VF 5E41A 2VA8A 4RL1A 1UAXA 2W7AA 1LWCB 2BE7D 4ZVEA 4OI0A 4FK0A 1ZC6A 4JK7A 5IWAJ 3LP0A 3TAMB 4H5RA 1ATSA 5ETPA 5J8YC 3OL9A 1NK6A 4CT8A 1LWFB 4DQPA 1C20A 2RE1A 1J5EJ 3PRVA 2B9EA 5AQRA 3BH6B 5KFTA 1Y5LB 3I8DA 1VQ9N 3BQ7A 3HFZB 5I4MA 5DLGA 2MQOA 2PA8D 2HSEB 4YMOA 3CB4A 1FE0A 2PC6A 2OPPB 3I0SB 5B0GA 2CXEA 1RNHA 4JD2A 4CK1A 2DFFA 4YOWA 1ZBLA 1AT1B 3FQKA 3T1HK 3ISND 2CGJA 1X66A 2KG1A 2A1RA 1JJ4A 4XIUA 4H0XB 2QFJA 3AVMA 3LO3A 4R66A 4BGAA 5E33A 4F3OA 1TVRB 2LMIA 2ITMA 3GCWP 4I1TA 1VQ5S 4FLTA 2AHOB 2GV1A 3ZETB 5K20B 1WOQA 2ASJA 2O3DA 2CPHA 5KRTA 1ULRA 2OJ3A 4L3NA 2KYXA 2HVDA 2EH9A 1BGXT 2D4WA 1Q86O 2Y1JA 2P9LA 2H4YB 3DHWC 2E88A 4BRKA 4OIXA 4OI3A 2DKOB 1WAFA 3CC7N 3DXKB 4OX9K 2BR0A 5AI4A 3CJ8A 3HILA 2UXDF 4YN4A 3LPYA 3OSNA 3VPZA 2DGSA 4I6WA 5BOLA 1Z2ZA 3D6HB 2CZVC 4Q44A 3G71N 4HCCA 1YITS 3O8WA 4IEIA 5CD4H 3OT9A 1P7DA 2YN4A 4WP9A 2YBVA 2A2CA 1IG9A 1BE4A 2KE7A 4JI5F 4ZPBA 1BG3A 1T9YA 4FK2A 1EIYB 3QUCA 4F67A 2AX1A 1K8AT 5CZVA 8ICQA 3HRGA 4FZYA 3CCMN 2GMHA 1TFWA 4H4OB 2HNZB 3KKRA 2LM1A 3AVJA 5CWRA 4DV6F 3C66A 2LU2A 2F8MA 1AW0A 3QRQA 3SDEA 3E2EA 3SCIE 2C42A 2VBZA 3WQPA 2LLZA 4J2BA 2Z4PA 4A57A 2WF8A 3ET6B 2W9CA 3CCLN 4K50A 3LL3A 3TSUA 3OYMA 3OYGA 1UJ4A 1PILA 1X5PA 4AP9A 1N4LA 2B4UA 2IGIA 2VONA 2ZIUB 2EWHA 2D3OR 2JOQA 1N61A 5CYJA 2DNYA 4FS1A 3DLEB 5D8HB 2IOHA 7ICNA 1ZPWX 8ICAA 2VF3A 5B08A 3ZXWA 2BCRA 4J37A 3NRBA 3QNNA 4FJXA 5ETRA 5AQIA 2ZIWA 2ZIUA 1ATRA 3T79A 1UFLA 2Q1NA 2J5AA 3KKAA 3AV9A 3CSKA 4CI6A 3LOUA 3DRXA 3M1FA 4M47A 1JALA 4YY3K 2PAVA 2VG6A 4AYBC 5KAFU 1C1BA 4C4WA 3WKDA 4DFJA 1TL3B 2YXLA 4AM6A 5T7BA 1N34F 4QW9A 2IY5B 3BEGB 3QLHB 2WK4A 1NK5A 4IR1A 4ID8A 1S1UA 2LDYA 2GIQA 5GAGP 1CJUB 2MQQA 2XMKA 3SV4A 1IBMJ 4PUOB 2PEBA 2JH7A 1JX4A 4CVNE 1Q7LB 1KCFA 1NEEA 2GLEA 1R8BA 3AVGA 3C6AA 1BQXA 3PR5B 1QAYA 1VQYA 3QPIA 2HF4A 2HNYB 2FSJA 4UQTA 1ZPVA 3MUTP 3UMCA 3DU6A 2X3GA 1YHQN 2HIQA 5C25A 4FM0A 3OLAA 1FD2A 1K0VA 3PRBA 1BWVA 3NL0A 2DGQA 4E19A 3N6LA 1RWNB 3EWGA 1KVKA 3BN7A 2UVUA 4JKAA 2OMLA 3FSXA 4F0MA 4E7KA 3PJWA 4UATA 1DLOB 2XMMA 3AO1A 2E5GA 3UNGC 5EE0A 4I2EA 1ZTWA 2FVCA 3RJIA 3PMNA 3VQ9A 1GX6A 3EMTA 2KFZA 2XCPA 1ZQEA 4JBCA 5F0XA 2VQFJ 2JEIA 3Q89A 3VAKA 4UB2A 2QA2A 3UQ2A 3L0QA 4HH0A 3TX8A 1S97A 1XIQA 5F8HA 1T9UA 3MGJA 2LM4A 2OO4A 4KAIA 3AQOA 1XBWA 2V4RA 4O3RA 3IG1A 4KO0A 2KZ3A 2XWYA 3EX7B 2ZTEA 4FWLA 3OYLA 3NS5A 3SSRA 2DRDA 3SDEB 4QWAA 4B3OA 2ALZA 3I5AA 1CBKA 1I94J 1PBUA 2MHNA 1ZA1B 5AKLA 1N34K 4JI5J 3JQJA 4O23A 1RTDA 4KN4A 3O1WA 5L1KA 1FFSB 2W42A 3WK4A 3QZ8A 3NEKA 1RFQA 4LFAK 2P9SA 1JNRB 5DBCA 4B8AB 1ROFA 5A2QO 2OPQB 2WVDA 2E9RX 4PHTX 2B51A 5IWAF 3E9LA 4J9UE 4QZ9A 2KXNB 4FLZA 5C42B 3QYYA 1L5UA 4UAVA 4FWMA 2ZBRA 1U8SA 4A8QA 3THWB 1WBDA 3ZCMA 2D1KA 4ED3A 3ISZA 1EWRA 4LQ9A 3IWLA 3KKAC 4NL5A 2BOPA 3U02A 5AQTA 2KICA 1UVJA 4ID5B 2VWJA 3LDSA 3C2LA 1JK9B 3DU5A 4K4IA 4JI0J 4OHZA 3AA3A 2FDRA 3GJQB 4JI6K 4DL3A 4JHDA 5KT6A 1X4FA 3P39A 1W26A 2HFSA 2FHJD 4QJFB 3DDKA 4ZOSA 4DR7J 4CO5A 4CEBA 4DCOB 5A8RA 3VALA 2QYCA 3LDQA 3KK1A 4AXIA 5KG3A 5KFDA 2OEJA 2HSZA 2G1HA 4NLGA 5DQIA 3SQ1A 2EAOA 1QQNA 5C0YA 4I27A 5ITHA 1C0GA 4MLEA 3BZCA 3ALRA 4JEPA 4JI2J 2LXUA 4PKIA 4TLQA 1CXUA 3RYLA 4M5JA 3NF9A 1SL0A 3MPYA 4NLSA 2L41A 1HNVA 1KVCA 4GV6A 1WORA 1LW2B 2ZNZA 1Y5NB 1RDBA 4JWNA 1HI0P 4JKCA 4DV2J 4K59A 2IJRA 4CJQA 2ZJ8A 4Z6EA 3UDVA 1XMOK 4CZLA 3CCES 1YWXA 4C48A 1SC6A 1N88A 2ZIXB 1AA1B 3UR3C 3QT6A 2WFAA 1WHXA 2BX6A 2UXDK 4RW8A 4TUPA 4DR7F 4JS5A 1WC0A 2JHDA 3U3GA 1NHVA 1RQNA 4K8ZA 3TANA 1ZH5A 2ABYA 4C98A 2XCAA 3I55S 1FERA 2E5LJ 1F3FA 2KI2A 1XNRJ 3A4TA 1JLGA 3GYGA 1LKZA 4KB1A 3QIPA 2DGTA 2ZJAA 5F0UA 3N4PA 2JWKA 3QJPA 2VBWA 2DR7A 2MQPA 4W92B 4DV0F 3AY9A 2Q3PA 4ICAA 5J2KA 3O8MA 2D69A 3HHLC 3KLGB 2DGVA 2YNGB 5AKXA 5HMLA 2D3UA 4E3SA 2PEHA 2HOIA 2IMWP 4KLGA 5HRSA 4WK1A 1JLAA 3EUB2 3NGUA 1W97L 4JI0K 4I2PB 3KHLA 1BCOA 1DAXA 1SKUB 2YKNB 4ECWA 1X31C 3AOCA 4OO1J 1REGX 2WB4A 1QE1A 2A1BA 4WCEQ 4NLXA 2DIVA 1Z1ZA 2JFDA 5J1NA 2VCPA 4WFAL 1S6UA 2YNFA 1XHZA 1IH7A 1NDCA 3ZDEA 2BJ9A 5HN0A 3A8JA 1UEKA 1H7WA 3K5PA 3K2PA 4IG3A 2KMDA 2H9ZA 3CHWA 1ITPA 3RWUA 1RYSA 2XWXA 5CYQA 1RTJA 3W64A 3CMES 3PDNA 1UT5A 5JTIA 3FZBA 5LT5A 2XNRA 5KGXA 3M6XA 3PVXA 4TU8A 1YJNS 2APOA 2G8FA 4CEEA 1ZM4A 5DB7A 4F02A 5IC4B 2IM3A 5CE3A 4M45A 3MXIA 4O0IA 2AGPA 3GE9A 1TL1A 3IP0A 4X66F 3EPGA 4BLGA 3UN3A 3R9LA 4ZP6A 4DSEA 3O5TB 3CNHA 1RXWA 2KSOB 1EP4B 4B02A 1RADB 4OHXA 2KVIA 1FEZA 4QZIA 1G4CA 4GIBA 4PHEA 4RQMA 1YT3A 2FPLA 3L4PA 3PX0A 5I3PA 3KZBA 4CO2A 4CHQA 4PWDA 1BMQB 1D9DA 2YX1A 5CAAA 1RDDA 3HI0A 1VIXA 3N7RC 3QDKA 4DR2J 1BQNA 4KI6A 3R5CA 2B4PA 4RUHA 1KLNA 2QL7B 2VUGA 4OLPA 1N63A 5GADP 5KG1A 5HI7A 1HPZB 4DR4J 1I94F 2JV3A 5LMNJ 3EVMA 4KT0C 2IHR1 2R7QA 5KFLA 1WJ9A 4OYWA 2ITGA 2V8PA 3PW0A 3K5LA 3CF5L 3NS6A 4LF2A 8ICSA 2BDUA 4B3RK 3OYAA 5D3GB 4EBEA 2P9PA 1S72N 4LF9K 1S6PA 2ZJPQ 2W4PA 3ZO7A 4AHSA 5CYMA 2MB0B 1EQMA 2C2OB 1SKSA 4UOHA 4RPZA 3GU0A 3DAWA 5E3CA 2GGPB 3EGVA 2CPZA 4DOZA 4ZVOB 4R5PA 2WONA 3CCJS 4LR8A 2A1JB 5LL6d 1S1XA 3D0IE 2EK6A 4GKJF 1GFWB 3C2MA 2CPEA 1W2IA 4OZ5A 5ADZA 3WX4A 5KFKA 3KLIB 4USWA 1EQYA 2HZAA 4UUWA 2O8DA 1Q8KA 1FVQA 1COOA 3PUFA 2O8FB 2NRZA 4UW9A 2QARA 3P38A 2A0FB 5KG0A 4GVMA 3TUZC 3IC1A 3M7VA 4DL7A 3H7IA 2DNGA 3I5CA 3SUOA 2ZJPL 3E3XA 4DR2F 3CQ8A 4DV4J 3MN5A 4CNZA 3A8EA 2QWLA 2DBYA 1SL2A 3VF4A 3NOGA 1MNEA 3UB5A 2HMIB 3WDOA 3HL8A 1JMTA 2Y1RI 4OX7A 3W5XA 4DV6K 2R7OA 3L7PA 3CMQA 3MGIA 4P9SA 2DRBA 2ASYA 2DNNA 3GFZA 5HR6A 5F41A 2GUIA 3KXDA 1C4AA 5AQHA 3FFKB 2V2QA 1Q82T 2C3YA 4X4OA 4YORA 4FJ5A 2R9LA 4FZXC 4RG8A 4ATNA 2X7IA 4CZGA 2N82B 3ELHA 3MEGB 4C7ZA 1SS6A 2OM6A 5AE1A 2AJFE 4J9SA 3SUNA 5ALDA 3WXLA 2UUCF 2DGXA 4EEYA 3RRKA 4ELVA 1ZJNA 2AGOA 4DO9A 5ALTA 1U45A 4CTAA 2A3JA 4CO1A 2WOMA 2P9EA 4K2JA 3LTOA 1UQVA 4CDGA 3V9WA 2V7ZA 3SLCA 4DJBA 2RPIA 2YCHA 4R79A 4DV2F 2KM8C 1TVAA 1XERA 4DSKA 2MU2A 1RAJA 3BO4A 1SH2A 1QAIA 3CULA 2VBYA 4R25A 3A5LC 4UY8O 5ALMA 5ETNA 1D1UA 4NL9C 3W7BA 4C4TA 3W3SA 4F4ZA 2EFQA 3VHQA 5FLXU 1KLMA 4CJUA 1BUXA 4W5QA 2NO5A 2DFHA 2F8SA 1OH7A 2GQCA 5CYMB 3TRGA 4YUDA 2WSCC 1YJ7A 3LM2A 2XHWA 3CJSA 3IBPA 1U6FA 4RW7B 2E2NA 4BDPA 2PIIA 3CCRS 4AQYJ 1JJ2R 5AIBA 2MKIA 4OI2A 1J9AA 3M4XA 4FF4A 4XO0A 1NH7A 2F9WA 4MO5A 2VB6A 3RSEA 1S5LU 4FJ7A 9ICVA 1JCFA 4OI1A 2V9WA 2WMMA 4CCHA 4F3MA 4B1YB 4DV1J 5FROA 2CRLA 3ISNC 2UXDJ 1WWHA 2RMLA 1HRHA 3RB3A 3OXLA 5KI6A 3ALYA 2A1JA 4YMEA 1RBLA 4CBWA 2Q97A 5FJ4A 4W4MA 2Z2MA 1CZAN 2BE9B 2EQYA 3KJFB 5B0CA 4FXDA 1JROA 2IHNA 4PXCA 1VQ8S 4NEZA 1KQKA 3ORYA 1F9FA 2RQKA 4Q8EA 3AXKA 4FJ9A 1BO5O 2FY1A 2ZVSA 4L72B 2XY7A 4CERA 3R5JB 1S9FA 4I6MA 2BM0A 3AJDA 4NLPA 4ZPVR 3BGRA 1DKGD 4ZVHA 2KN7A 2DISA 2DJWA 3UQ0A 3LDLA 4LRAA 5AJ3K 4J5OA 5AI5A 4QZFA 4JMUA 5ALUA 4G1PA 3ZSWA 3KG4A 1WYGA 5HP1B 2VG7A 4O3OA 2W2MP 4B3TF 4ZLPA 4KH1B 3VGMA 4ZJOA 2W3SA 2FVQA 2O1PA 5J0XA 5IIIA 1AZSA 4KHQA 4RBVA 1S1UB 2IAJA 2ZUCA 2HHHK 5THWA 2F65A 4ILLA 2WBMA 2NYVA 4HDGA 2FMQA 3K7RA 4F5RA 4GKKF 4TU9A 2BBEA 3POTA 4ZPTR 3K59A 4GVLA 3P45B 4DR4K 4RQNA 2JR5A 4ZJLA 1KQGB 1RK8A 2ZNYA 3AU6A 3WNHA 5KFJA 2P9SB 3LGHA 1V4TA 4PXDA 3L2UA 3S01A 3FZ2A 3GIKA 3LALA 2VPZB 3UMBA 3IAYA 2V8HA 3AA4A 5M1QA 3ZSOA 5AKZA 5MAOA 3PM9A 4QS8A 3MM9A 4BR5A 8ICUA 2M0GB 3MC1A 1FHTA 3MGHA 3GJSB 4USKA 4TU7A 2OP5A 2OTJS 4B9UA 4I64A 2AX0A 5HMZA 4GRSA 1LOTB 2B9YA 3QSYB 4BGDA 3TZZA 3VQ7A 4UAYA 4I0WA 2NRHA 3HVTB 3SENA 4P0PA 2JH3A 4HI1A 5ALYA 4Z4IA 2U2FA 2XLIA 2K4HA 5ALXA 2KZMA 4BRDA 5FIIA 3LZIA 4OZ2A 4FM1A 3Q8RB 1WF2A 1S5ZA 2ETJA 1Y5IB 2P35A 2DFLA 3NMUA 3OXFA 4CJKA 3QAEA 2BQ3A 2YHYA 5F2RA 4X4QA 5J2HA 4AHCA 5KFRA 2DHHA 4BRIA 2Y0SD 2M5YA 3L7UA 2W6LA 4USVA 5DS7A 3RAMA 3LDNA 4IOAL 4CEDA 4NMXA 3T1HJ 4AM7A 4FF3A 1ASVA 3O1BA 1NHUA 4FS2A 1HI8A 5ALHA 3W2WA 3PLAA 4ZVGA 3DXMA 3E66A 2BOAA 3BEXA 4NI2B 1N33F 3UPQA 3HTVA 3HHLA 5C24A 2R2TA 2HBZB 2HHHJ 3EZ5A 9RUBA 1HX1A 1Q16B 1QLNA 4QWEA 4ECUA 5HATA 1O6XA 4KR0B 2CH6A 4KHUA 3C1YA 4N8NA 3HZ6A 4CEZA 3DOLB 4IOXA 5KG4A 5GAEP 1YVNA 4W5TA 1SV0A 3KG1A 4V19S 1PGZA 2DGZA 1A5XA 2KRBA 1ZQJA 5LMNK 4IOAQ 4CFCA 2B6GA 2V0NA 2V7YA 3NGZA 1HW9A 1IR0A 1TL1B 4KGXB 1P8ZA 1DGJA 2B7CB 2HNYA 5DMRA 2YI1A 4D3HA 2NQPA 2MZQA 2IYIA 1F0MA 4FL9A 1KOHA 4YR2A 3QIOA 4IDKA 2PXIA 4U7BA 2ATCB 5ALWA 1YTAA 5AKIA 3WUHA 3OYEA 4WWSA 2F8LA 1ZQYA 2N4CA 2I7PA 1VJQA 1NOMA 4WYWA 2GQQA 4P2MA 3AVIA 1Y7PA 3UQSA 1XR6A 2EEYA 4X4PA 1ZD2P 4R65A 3LVWA 3IM9A 4IQUA 2FF3B 3MEDA 4OJ3A 5T41A 3M7DA 1QQMA 3R7NB 2G2ZA 3MXMA 4X66J 4ES3A 7ICLA 1HBOB 1S4FA 1KFSA 4IFVB 1ACMB 2JJ4D 2VQFK 2DR6A 2BUPA 4X64J 4UW2A 4ZITA 4LF9J 1J97A 3RBXA 3HSDA 4JWMA 5AHXA 2V8VA 4OPJA 4WP3A 1M1HA 1J53A 4RT2A 4PZOA 1HHQA 1BD6A 4OZJA 3ILLA 4CIEA 4N7TA 1A6LA 3NG8A 5M1OA 3OYIA 4FOIA 1YBAA 2P5OA 2WVEA 4FPIA 5HANA 3TA1A 3D2QA 4EX7A 4C2MA 4LFAJ 4QZAA 2KU7A 5LJ3Y 2LECA 2YQ0A 1FKAF 1WSEA 3DDNA 5AQZA 2EZZA 2BABA 1YITN 4UB4A 1SH3A 5D15A 2RILA 3SQGA 5RUBA 4BE1A 3P3DA 3UNYA 4ISEA 1HNWJ 4DUZF 3H40A 1M5PC 5J0QA 3UKRA 1RT1B 5BREA 3H5YA 4NXNF 2Y1LB 1RT7A 2HMXA 3WKEA 1EKRA 2YKPA 3OYDA 1HPZA 1VDHA 2E8OA 2A41A 4Y2QA 2F5GA 2EFGA 4JI3F 4KLMA 2QX0A 5H9FJ 4JI7F 4YS2A 2KKPA 3KWGA 4OV1A 8RUCA 3TEHB 4J03A 3C6HA 1UVLA 2VFRA 2F7TA 1VDVA 3ZZRA 3C6UB 4AHUA 1Y9OA 4EHUA 3WNEA 3J8AA 2EI5A 2YH1A 3EL2A 3MAAB 4MKYA 3U9DA 4NCAA 3V4MA 1RDCA 3R1XA 4PYAA 4JYAF 1YVFA 2WBNA 4DMNA 2X1FA 1KP6A 3LPUA 1WN7A 4P4MA 4B17A 3I56S 4OI6A 3ULEB 1Q53A 4O44B 4ZLNA 3K9JA 3POTB 3NNCA 2PYLA 4CJPA 1M5KC 4KFBB 3PCOB 2QG9B 2R7YA 2DYAA 3RMBA 4L75A 2RE2A 2WB1D 4PXBA 2LQ5A 4X4NA 3TABA 1WWUA 4HTLA 4KQZA 2KO1A 4JB3A 2J9DA 3KKFA 4HI2A 4F8RA 3CM5A 3C6UA 3IWXA 4OYBA 3D2EA 3VQTA 4B6JA 1K47A 3T5LA 2EC2A 4M9JA 7ICOA 3JPSA 4DV5F 3R2CJ 1O0PA 4GMJB 5J8YA 3BKTA 1SQKA 1JJHA 2JEFA 3ADAC 2RSQA 4DV7K 1JLGB 1U1QA 3BR9A 3I32A 4B9TA 1AFJA 3QGIA 5CD4A 2QXLA 2KHDA 4DV3K 2YTCA 4X2BA 1SL1A 1WSJA 4Q43A 2AP6A 2OKQA 4KB0A 3SEIA 5IT0A 2YWEA 3CCTA 1NDLA 1LWFA 1TL3A 1R27B 3C8YA 1FEHA 3IBFB 2Z2ZA 3GFYA 3NF7A 4UB3A 4CGIA 3GV5B 4Z4FA 4URGA 1JLAB 1WEXA 1T8EA 2MJNA 4AT1B 2IVYA 1KQFB 1S1XB 3W3DA 2B9XA 1HNWF 5EGYA 2F3JA 1BI4B 3H5SA 1ZQMA 2FZCB 1WC4A 1R8AA 4F4YA 1XSNA 1JB0C 3THXA 2W04A 1QTNB 4X4RA 3W65A 2KTQA 3TUIC 4X5VA