4F3OA

Dna polymerase i large fragment complex 5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
566
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTANMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 198
structure length 566
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f3oA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f3oA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f3oA01
1BPZA 5KRTA 1WSIA 3O3HA 3MFHA 3VQQA 2DPIA 4MFAA 4M6WB 1IXRA 1ZQEA 4OGEA 3LDAA 2IHNA 8ICZA 3QEXA 4BDYA 1WSJA 8ICTA 2W8KA 4QW9A 1VSEA 4BXOA 4ICLA 4F50A 4DTPA 2YHAA 1L5UA 1L3TA 1U49A 4CHZA 3RJKA 3AVCA 1U47A 1WCNA 1DTTA 3KK3A 1Z00A 1U48A 4P4OA 2AGOA 5KG3A 1S10A 1C6VA 4ECQA 3U3GA 5J29A 1NJXA 4ECVA 2Z1JA 1MC8A 1FKPA 4I2FA 4W5NA 2Z1HA 3OYKA 4N41A 5HMLA 2ALZA 1SKRA 1ZQMA 1X1PA 3P1GA 4ECTA 5KTQA 1RXVA 1RILA 1XSPA 5KG2A 2UVUA 4BWJA 1Q8IA 1EETA 4CJPA 4KLUA 1ZQZA 5KG7A 1RBVA 4CJLA 3E2EA 4ED3A 8ICLA 1JLBA 3K2PA 3SUQA 4FBTA 3IS9A 5DBAA 4O9MA 1N56A 2ZUCA 3OYFA 4CEBA 4FJMA 4Q44A 1UOCA 4ZTJA 3HW8A 3AO2A 3CQ8A 4F5NA 1ZQWA 3VQ8A 5J2CA 2BQ3A 2MAXA 4KAZA 3AVHA 4Q43A 1LWCA 3CFOA 3ITHA 4KLLA 5DK5A 1UA0A 3HPHA 1BPEA 4GVMA 4KPYA 2OZMA 5IILA 2PFNA 5DLFA 4I2HA 4RT2A 4Z4IA 4KLGA 4FW2A 4AHSA 4CJKA 1G15A 4E1MA 4YMNA 3DMJA 4QZBA 4M3YA 4O3PA 3WNFA 1NK0A 5J0OA 4B9VA 4M41A 4KTZA 1RPLA 4F5RA 1QE1A 2ZUDA 4YQWA 4B9UA 3OS1A 4F4YA 5T7BA 2Q3SA 3TFSA 3FFIA 5J1EA 3SI6A 3H40A 3C2LA 2GUIA 3VQEA 2P1JA 1T3NA 4FZZA 1BHLA 2JEJA 3SQ2A 4DL3A 4RUCA 4CF2A 3K58A 4DQIA 2HHWA 3L8BA 2F8TA 3KJVA 3ZT0A 5KFDA 5KT6A 1L3UA 4JUZA 1IM4A 1TV9A 5KFVA 4QZFA 1C7YA 1GOAA 3DI6A 1HRHA 3V6HA 3RAXA 2BGWA 3RR7A 5C5JA 3SPZA 3OYGA 3EYZA 1ZBHA 1BL3A 2JGUA 3GFKB 3PW7A 4LD0A 5KFZA 7ICSA 8ICJA 2BCSA 1A5XA 3LP3A 2JLEA 2XGPA 1NK7A 4JS4A 3PO4A 4DF8A 3QZ7A 7ICKA 1DGSA 4TUSA 3PX0A 4HTUA 4CJ5A 4ELUA 3C2MA 4TUPA 4O3QA 4OKEA 1T05A 3V4IA 3TABA 4QZAA 4R66A 7ICRA 5J0XA 1XS9D 1VSKA 2A1JA 2F1HA 4RU9A 4CK2A 5DB6A 3Q8RB 3ASMA 9ICBA 2P51A 3SQ0A 5SWMA 4F4XA 1R0AA 3MEDA 4Q5VA 3V1RA 4PH5A 1COOA 5DQIA 1NOYA 4CHPA 1XWLA 4FO6A 5J2BA 4ECYA 3Q8SB 1HUOA 2XHBA 4K4IA 2IA6A 2X78A 2G8IA 4YR0A 4NCAA 4J9LA 3DRRA 2FMQA 3VQPA 1S0VA 1VSDA 4JWMA 3M8PA 2R8IA 4OJRA 2DFHA 4TQSA 3ZT4A 4KKOA 1LAWA 7ICIA 3G10A 4C8MA 2W9BB 1HYZA 3L2RA 4KHQA 5HBMA 4YCXA 4XQ8A 2YNHA 3T19A 3Q8KA 4N47A 4UBBA 4CJSA 1S77D 2X74A 3H7IA 3HVRA 2DFLA 2XY8A 4I29A 2ZJ8A 3CM5A 4QAGA 4FK4A 1X9SA 5DG9A 4DFJA 4NCBA 3QO9A 5KRSA 4KLEA 1C0TA 3ZSQA 1JL2A 4HCBA 1ZQAA 2VWJA 1ZQGA 2V4QA 3K5NA 3SNNA 2DPJA 1ZBLA 5HRSA 3T3FA 4NYFA 3V9XA 4KREA 1RTJA 5KFCA 4RW8A 7ICTA 4BE2A 9ICJA 4QWAA 2YNIA 3U6FA 1U04A 1RBUA 2ETJA 4NLNA 1SV5A 3N97B 3SCXA 1ZQXA 3KHLA 5D3GA 3TI0A 2XO7A 2LYHA 4J2BA 1PZNA 4AH9A 1VSIA 2ZJ5A 3OYLA 5CYQA 4JV0A 3DLRA 3TAEA 3PY8A 1A5WA 3ULDA 5KG0A 4IR1A 2JEFA 2QXFA 3BQ0A 1WN7A 3NH2A 2E6LA 1XI1A 4DU4A 2BCRA 9ICUA 4LH4A 3MXMA 2PXIA 2OA8A 4YVZA 1CZBA 4EBEA 5D49A 2XY5A 9ICIA 4KTWA 3Q8LA 4RQ8A 4QZEA 3T1AA 7ICPA 1RCHA 4KLTA 1ASVA 4OVLA 4F5OA 3AVNA 3KK1A 3K57A 5IIMA 3SUNA 2PI4A 2HHTA 1S5JA 4DTMA 8ICIA 2E4LA 2KW4A 3A2FA 1HPZA 4M3UA 4F93B 4CJ3A 4EZ9A 4LZGA 4J9KA 4H4OA 3AVBA 2PYJA 2V9WA 3AVMA 3S3NA 4ED0A 5J2EA 2IC3A 3OY9A 4J9MA 4LSLA 1D8LA 2JZBA 4CGJA 5J2AA 8ICEA 4M3ZA 4BE0A 2AQ0A 3O3GA 4NLZA 8ICRA 1S1VA 5KFNA 4CEOA 4CF9A 2LSNA 5EWFA 4F4ZA 1CZ9A 3I0RA 4QZ9A 5J0YA 2XCPA 4O5EA 3NF9A 7ICFA 2A1JB 3ISDA 3RTVA 3G0ZA 4YMMA 1VRTA 3TAQA 4KITB 3B6OA 4LVSA 3OYJA 4F2RA 1HNVA 3SPYA 3EW9A 4JS5A 3VA3A 3H8JA 1BCOA 4PY5A 4P4MA 3LALA 4OLAA 3B0YA 3AVFA 3AA4A 1VSFA 4ELTA 4CEAA 4RNMA 4RQ3A 1LW2A 2AQ4A 1ZBUA 3QLHA 4BGDA 4M3WA 9ICSA 4LH5A 9ICXA 4OKKA 1ASWA 1KCFA 2PY5A 1KVBA 4F4WA 2FLNA 3RB0A 3PX4A 2O4IA 1KVAA 1JLGA 1JKHA 3DLBA 8ICMA 3SZ2A 3RJGA 1MQ2A 5HNKA 2PYLA 4CGIA 3E01A 2ISPA 2OPQA 1Q9XA 5J0QA 5L1LA 1ZJNA 3RWUA 3QEPA 3H8WA 1HJRA 3JPPA 3HP9A 3KK2A 3Q8MA 4RW9A 3ZT1A 1TFRA 2RPIA 4I2JA 5J0RA 4YR2A 4J9SA 3RH5A 2YV0X 5KFAA 7ICLA 4NXZA 1YTAA 5HHIA 3LPTA 4KN4A 2RDJA 3NE6A 8ICCA 4CF8A 4M3RA 2VG6A 5JS2A 4XUSA 3C6UA 2D0CA 1K1QA 2D0AA 4R5PA 3DM2A 2EX3A 1HQEA 4Z4GA 4PHPA 4MFFA 4FVMA 3AA2A 2G8VA 5KFFA 2FPKA 1BISA 2R8KA 2ISOA 3V6KA 2WONA 1ZJMA 1NK6A 2KQ2A 4RW7A 3UXOA 1RDDA 3SV4A 1KRPA 3OYHA 4RPYA 4R63A 5KGXA 4FLXA 4R65A 5CP2A 1WSEA 4CJEA 3NGIA 3CFRA 4FLVA 1T7PA 1VSHA 1XO1A 1J53A 4MFCA 4O3SA 4UB5A 1REVA 3K5OA 3RMBA 4QZCA 4DF4A 3LP1A 3HWTA 1IO2A 4R8UA 3B6PA 2W9CB 4E0DA 2G8HA 5KFJA 4B9LA 3WNEA 4O3RA 4KFBA 4DG1A 2P6UA 4DL7A 3TAMA 1BPDA 1BGXT 1NJZA 5C42A 4MQ3A 4FJNA 4UAWA 3H4DA 4CF1A 5DQHA 1VSMA 2BCVA 4PQUA 4DTRA 5IIIA 1K6YA 5J2IA 1BI4A 1RBTA 3HPGA 3OYCA 5L1KA 2D0BA 4RT3A 2UVWA 3K59A 1KFTA 5BOMA 2KZMA 1QSLA 1T8EA 4CCHA 3AU2A 4CJVA 3TAGA 2V4RA 4UBCA 4GW6A 4BDZA 4Q8EA 3V1QA 3QETA 2R7YA 3PUFA 3MGHA 4IBNA 2YKMA 2HVIA 4PA1A 3VQAA 3C21A 1XSLA 2J6SA 8ICVA 4RW6A 5FRMA 5J2NA 3V6JA 3PW4A 3ZDAA 4BACA 3AUOA 7ICUA 1ZQTA 9ICCA 2IBKA 5KT3A 2Q0ZX 3OYNA 1YVUA 4KLSA 1JXLA 4E7JA 4DFKA 1V9PA 4PUOA 1B43A 1ZQYA 4DL6A 4XIUA 3DRPA 5CZ1A 4H8KA 4Z4FA 3F9KA 4IRCA 3H8SA 4HUFA 3KTQA 4DOBA 3AVIA 4O0JA 5F9NA 5KFHA 4TURA 2Z1IA 3OJUA 2Y1IA 2W42A 4DTUA 9ICTA 2XGQA 3V9WA 3HO1A 4M9NA 3OYMA 3AA5X 8ICUA 3KLGA 4CFCA 5KFSA 4KHUA 1NK9A 4J9PA 1NKEA 4PGQA 5KG1A 5C24A 1LWEA 3MECA 3SUOA 2AU0A 4CEFA 2IMWP 4YG2A 4B08A 3TARA 3F73A 4CGFA 3UXNA 5SZTA 5EWEA 1NK8A 2XRIA 4CIFA 3NH0A 1KEJA 4F91B 3EWAA 1ZQIA 2P66A 1ZQKA 9ICHA 4YFUA 4RQ1A 1X9MA 5CZ2A 3RR8A 4HVJA 4KB1A 4P2HA 2DFEA 2DTUA 2PFOA 8ICQA 1ZQFA 3HL8A 3NTUA 3ISCA 1FKOA 2ZJAA 3IRXA 5D46A 1BPXA 4FM2A 4KLHA 3OYAA 5L1JA 1IKXA 4Z6EA 2JEGA 4GC7A 1JLCA 2UVRA 1ZYQA 4M04A 5KFRA 5L1IA 2IHMA 4FJKA 4PWDA 1UAXA 3ISBA 5J0SA 3QEWA 5JUMA 2OYQA 3MXIA 1J5OA 4I27A 1HJPA 4I2PA 3AU6A 3L3VA 4CJWA 1JLAA 4IKFA 1ZBIA 1LB2B 2XY6A 3PW5A 1WSHA 3ZSYA 1AROP 2AGQA 1S1XA 4IDKA 2DY4A 4C8LA 4FK2A 4RQ0A 4KO0A 4CEQA 2NRTA 4R8UB 3GV5B 3MFIA 1D9DA 7ICEA 4DSKA 4YD2A 2OPPA 5KFMA 2VG5A 2Y1JA 1QSYA 4O4GA 4C8OA 4HCCA 3SQ1A 3Q8PB 4UB1A 4DQPA 3KLEA 3RH6A 1XHZA 4ZH4A 2HNDA 4QW8A 4I2DA 2ITGA 4YFKA 2QK9A 4RW4A 4ECXA 3ZDEA 4M9JA 4HYKA 2PFPA 1S1WA 3M9NB 1BQNA 2R8JA 4FLWA 3ETLA 4FJ5A 3IM1A 1WSGA 1ZQJA 4RZRA 1TAQA 1LW0A 3OYBA 3H4BA 8ICFA 3NF7A 3QE9Y 1TVAA 3HYFA 1YTUA 1NK4A 2VANA 3O3FA 3TANA 4CJTA 2B21A 1YT3A 4BXOB 3QEIA 1WNSA 4OGCA 4E7LA 3RJIA 4F2SA 2XY7A 1N6QA 4O0IA 1Z00B 1VK0A 3C1ZA 1CLQA 2HHXA 3EPGA 1TKZA 1S9FA 4FJ9A 4QWCA 2C2RA 4F5PA 5DGBA 4PGXA 4JV1A 2P6RA 2R8GA 1J9AA 4PGYA 1ZBFA 4KHYA 5DBCA 3K5LA 1RT3A 3M8QA 4Z4CA 4DMNA 7ICNA 1S76D 5KFLA 4IFYA 3ZCMA 3UPQA 3HX0A 9ICNA 2G8WA 4UB3A 8ICNA 4KHSA 3HPOA 5JS1A 9ICFA 4DTJA 3PW2A 4RQ2A 2W9AA 3FDSA 3ISNC 7ICMA 4KLFA 3KHGA 3T5HA 1IKWA 3NH1A 4CJ4A 5HRPA 3VA0A 1QHTA 4YXMA 4P4PA 4CECA 4QZ8A 4UB4A 2NRXA 3MR6A 4JWNA 1RDBA 1XSNA 7ICVA 3PX6A 4CHOA 4UAZA 4CIGA 3C6TA 4ECWA 4DU1A 2AGPA 1IKVA 3V6DA 4CHNA 3MR2A 1UT8A 5FRNA 2MUTA 4F5QA 4NLKA 1X2IA 1TKTA 2NRWA 2J6UA 4DTSA 5DG8A 3L3UA 5J2QA 3NGYA 3EPIA 1GOBA 1W9HA 1HYVA 5J0UA 5FROA 4KRFA 3UXPA 3Q8QB 5CA7A 3VQ9A 5E41A 4N56A 1A76A 4ID1A 2HB5A 3LZIA 4EEYA 4LSNA 1KFDA 4NLGA 4CJQA 4L8RB 3KKRA 3UIQA 3ZDCA 1RT2A 1ZQQA 1BPYA 2OWOA 3NDKA 1T03A 4F4KA 1HYSA 2BE2A 3SJJA 4DTNA 1I3AA 3T5LA 4MFBA 3TAPA 5C25A 1JN3A 2A1SA 2ZTDA 4NM2A 4FZXC 4R64A 4IQUA 4IQVA 3LK9A 3K5MA 4DOCA 4I9QA 3ZDBA 3ZD8A 4I2AA 3VQCA 3RB3A 3AVGA 3LZJA 9ICMA 3AVKA 4J2AA 2X6NA 1IH7A 1ZQDA 3T5KA 4QWDA 4M6WA 4I28A 3P83D 1KDHA 5I42A 4DFPA 5KFTA 8ICOA 4UAYA 4KV8A 4RUAA 4ED1A 4DTXA 2HW3A 1D9FA 1TGOA 3RMDA 1CUKA 4RPXA 4GMJB 3RMCA 3RBDA 3V7LA 3OSNA 2ZE2A 3QESA 1TK8A 1KVCA 4DEZA 4Z6CA 8ICAA 2J6TA 2W8LA 3VQ7A 4FLUA 2KN7A 1A5VA 2FC0A 3HK2A 3NF6A 1BCMA 3RRHA 3DYAA 2G8UA 1XHXA 4E89A 4J9QA 3RJHA 4E3SA 4M0AA 3C2KA 4OKJA 3OGUA 4KLDA 2B5JA 1L3SA 2ASDA 5HMMA 1S6QA 3PO5A 3NGZA 1RXWA 4NY8A 4FW1A 4WE1A 4MF2A 1J54A 4YN4A 1ZQOA 5DQGA 2IGIA 2QKBA 3KD5E 4IQTA 2G8KA 3C5FA 8ICSA 1S9GA 4CHYA 5BOLA 9ICRA 4CHQA 3ZSXA 2FPLA 3CYMA 4W5OA 5CJ7A 3MDCA 4RQ4A 2BCQA 5EU7A 3ZT2A 3NCIA 1C0MA 3DRSA 2VA3A 4O3OA 5HP1A 3V9UA 5KT2A 4FS2A 3DLEA 1TK0A 3V72A 5KFUA 4NM1A 4W5RA 4KMUA 5DB8A 4FJGA 5J2HA 5KFXA 4FJIA 4IFVA 5HROA 1N5YA 4YXJA 3JPTA 4ELVA 2G8FA 1JMSA 3JPQA 5HRRA 1RT1A 3HM9A 4CGDA 2ZTEA 3EZ5A 3KLFA 3DLGA 5KFPA 2NUBA 8ICKA 4Z6FA 8ICWA 5CY4A 3IHQB 5KFYA 3V1OA 2IS3A 1Q9YA 1WAJA 3KLHA 1F21A 1B9FA 1RTDA 4J2EA 5KFEA 4J9RA 3JYTA 4DTOA 1ZQUA 2VA8A 4AHRA 5J2KA 1GOCA 2E6MA 4OPJA 1EP4A 3S3MA 4O44A 1Z26A 3V7KA 3I8DA 1HUZA 3WNGA 2FBTA 1S1UA 1BVSA 2YNFA 2FBXA 3DLKA 4DWIA 3PR5B 2HHUA 1NJWA 2FBYA 3QNOA 3RJEA 4RQ6A 1NOMA 4K4GA 3LAKA 4ZHRA 4DQSA 4GC6A 2F1JA 4LZDA 2HMIA 1T4GA 4DL2A 2HNZA 1UT5A 1U9LA 8ICHA 2BANA 2I5JA 3PR4A 4DU3A 1RZTA 5DMRA 3VQBA 5DKWA 3RJFA 1S0OA 4O5KA 4GXIA 4YMOA 2KTQA 3LP0A 4Q0BA 2C2EA 3ZSRA 3AO1A 3T5JA 3QERA 1TL1A 3NBPA 4AHTA 2KFNA 3JPOA 1BQMA 4GXJA 3UQ2A 4OPKA 2PI5A 3MEEA 3MGIA 1LWFA 4RNNA 3G6XA 5J0TA 5BPCA 3OJSA 2ASLA 4QZDA 4O5CA 5KT4A 2P5GA 4ECZA 4TUQA 3GILA 4FLYA 3VQ5A 3RH4A 2F96A 2BPFA 1XC9A 2ZUBA 5KG4A 3SUPA 4FJ8A 1LV5A 1RT5A 4CEEA 5DDYA 4I2CA 5K14A 2JZBB 4IRDA 3MDAA 4PHAA 3C1YA 5KFGA 3KHRA 1FXXA 1Y97A 1MU2A 2RDIA 4J2DA 4B9NA 4IG3A 2F1IA 3I0SA 2BDPA 5IIOA 5J2GA 3RB4A 5J2DA 3HT3A 3GDXA 5KT5A 5EWGA 2W9BA 1CXQA 5KFKA 2BQUA 3ZSOA 2HVHA 1DLOA 4QCLA 1NKBA 2ZD1A 1JXEA 4YP3A 4G3IA 3V9SA 4M9GA 2R8HA 4F8RA 1NOZA 4E7KA 1SKSA 4CIEA 2D5RA 9ICVA 1C1AA 4ID5A 4ED2A 5CYMA 3BDPA 4JK1A 1RDCA 2WTFA 4GLXA 5IIJA 3PVXA 4M9HA 1ASUA 3RAQA 3AO4A 3KKSA 2F8SA 1SZPA 4I7FA 3TQ1A 2NRZA 7ICGA 4HHTA 1TKDA 1ZQNA 5CB1A 4YNQA 4FJJA 1BPBA 1TL3A 3OYEA 4FBUA 4KLQA 3TWHA 4K8ZA 2HNYA 4TQRA 3GIKA 4DS4A 2RN2A 1UA1A 4CFAA 1Z3EB 4ED6A 5J2PA 2C22A 4CK1A 4AHCA 3RBEA 3V81A 4JLHA 4C8KA 2XC9A 3BJYA 1NKCA 1D8YA 3VQ6A 4EZ6A 3LWMA 3MAQA 2ATLA 1BIUA 4IRKA 3OYDA 3SV3A 4F92B 5DB9A 4YR3A 4E7HA 3P5JA 5DG7A 4W5QA 4AHVA 1EX4A 2BPGA 4N5SA 1A77A 5KGWA 1W0HA 4JRQA 5IIKA 4KHNA 4FZYA 3H08A 4F3TA 4DL4A 4FJXA 4Q45A 5HRNA 4EYIB 1FK9A 4B3OA 4ZTFA 3SQ4A 3KHHA 1SUQA 2BR0A 3LP2A 3G6VA 3JPNA 3SYZA 7ICOA 2O4GA 1RNHA 2FMSA 4CJFA 4Y1DA 2IDOA 3NHGA 3N4MB 5HHHA 1DTQA 4DSJA 2BHNA 2FLLA 4KLJA 2VA2A 3ZT3A 8ICYA 4N76A 4FYDA 3HVTA 4NCGA 5J0WA 1RTHA 4KI4A 3ZSVA 1KLMA 5KFWA 1HMVA 2RKIA 1Z25A 2QKKA 3QZ8A 1KTQA 4NYNA 4M47A 4FJLA 4X5VA 1S9EA 1ZQBA 1QLNA 4CESA 2FBVA 4DQRA 3AVAA 3NGDA 4IR9A 3C23A 4CK3A 1ZQSA 4C8NA 1BI4B 4FK0A 4XA5A 4Z4HA 1NJYA 4TSXA 1L3VA 5CR0A 1S1TA 5J0PA 1JX4A 5IINA 2OPSA 3PV8A 4CEZA 4IG0A 1EXQA 2VWKA 1RT7A 1RYSA 4RPZA 3RB6A 4QZGA 3TAFA 1ZQCA 4KHWA 3HP6A 9ICWA 3OHAA 3C5GA 3AVLA 2NRVA 1MSWD 1VRUA 3IG1A 1RYRA 2OZSA 3ZDDA 4O3NA 4FM0A 4RQ5A 1S0NA 4FS1A 3GIMA 4MEYA 3PMNA 3C95A 3DLHA 4H4MA 4JRPA 3GV8B 4I2QA 4CFDA 2H5XA 4E7IA 1ZETA 3GIIA 5EOZA 5DBBA 3OVNA 3VN5A 5KG5A 4DSIA 3HSTB 2YKNA 2PFQA 9ICLA 3RMAA 5DLGA 3O4QA 3THVA 8ICGA 3K75D 4GXKA 4KLIA 2FLPA 9ICGA 3QIPA 4K4HA 1S6PA 3LAMA 3DOKA 1X9WA 2YNGA 4BE1A 5J2FA 3ALYA 4DSEA 1QSSA 1LAVA 4CF0A 3TFRA 1JL1A 2BKEA 2ZQBA 3M8SA 4IQWA 2AJQA 3KLIA 1WAFA 3L2WA 3M9MB 1ITGA 4M42A 2XCAA 1ZQLA 2HHVA 2B6AA 4FJ7A 4Z0UA 1C1BA 4EP5A 3NF8A 1BIZA 3GIJA 1JLEA 5KG6A 5FDLA 3M8RA 3B0XA 4DFMA 3NFAA 4M9LA 1IKYA 1RTIA 4BDPA 1S0MA 1XU4A 9ICAA 2FMPA 3IAYA 9ICPA 1QQCA 9ICOA 4HUEA 1S97A 5KT7A 3WNHA 4FJHA 1C1CA 2PZSA 3NAEA 4F3OA 3S9HA 4B9SA 2M9NA 5J2JA 9ICEA 4DSLA 3V9ZA 2ATQA 4M3XA 3DOLA 5HP4A 2C28A 3LWLA 1K1SA 1RT6A 4YD1A 3CFPA 1RBSA 1SL0A 4QZHA 1KFSA 1CEZA 3GQCA 2WOMA 4B8CA 1DOQA 4DLEA 2JEIA 3LANA 3GV7B 4KB0A 2W9CA 2ASJA 3MBYA 4CFBA 4DS5A 8ICPA 4G1QA 3UQ0A 3JPSA 4FLZA 2HHSA 1WSFA 1ZQHA 3HJFA 4QWEA 4AHUA 1JXBA 1QS4A 1KSPA 4DSFA 2OPRA 3CM6A 3BQ2A 1MQ3A 4RNOA 4LY7A 4CEDA 3TR8A 2KFZA 1TK5A 1SL1A 3RRGA 2Z1GA 3AA3A 4Z6DA 1D5AA 1WCLA 3AVJA 1JLQA 4FXDA 1SL2A 1EXNA 3D0PA 3PW0A 4M3TA 1VSJA 3QEAZ 4MEXA 2KZZA 4OLBA 4XRHA 2W9MA 2A1RA 2GV9A 3L2VA 5KFOA 4DOAA 3ZSZA 9ICKA 2ZTCA 3V7JA 3JSMA 3AV9A 1B9DA 4O5BA 5KI6A 3FYHA 5KFBA 4EBCA 1HNIA 3SI8A 4KN7A 4DO9A 2IAJA 1NK5A 3KD1E 1HQUA 3K4GA 4FLTA 4QZIA 4Z4EA 4ECRA 3LPUA 1TKXA 3BQTA 2RF2A 2YHBA 3MABA 2VG7A 1QTMA 1JLFA 3C94A 1TV6A 2P5OA 4CGGA 3QEBZ 5L9XA 4BWMA 4I2BA 8ICXA 4RQ7A 4E19A 3D45A 4M2YA 4EBDA 4K8XA 4CGHA 4ECUA 2BCUA 1U4BA 4DLGA 3JPRA 5HLFA 2I1QA 4CE9A 1TAUA 4RG8A 1H38A 3L2UA 2X6SA 9ICQA 5D4BA 1EKEA 1TVRA 5DGAA 1KLNA 3PMLA 4CERA 3G6YA 1N48A 4JV2A 7ICQA 4DL5A 5CHGA 2B4JA 4KLOA 2KZ3A 5TZVA 3MXJA 4QWBA 3QINA 1RDAA 4I2EA 4FM1A 2BGGA 5I3UA 2I9GA 4UB2A 4I9LA 4I2GA 3U3YA 1B22A 3RJJA 3HXMA 3L2QA 3MEGA 4Y1CA 3OHBA 1Y88A 3ZD9A 4ED8A 4KLMA 1RT4A 3QNNA 4KI6A 4J9OA 2GWSA 4EP4A 2IOCA 4B9MA 4MF8A 4B8AB 2UVVA 3ORYA 2BPCA 3OYIA 3OSPA 3BQ1A 2C2DA 1C0UA 1ZQVA 1ZQRA 3LDSA 4M45A 5KFIA 3EY1A 4I2IA 4W5TA 4PPXA 3VQDA 4PHEA 5DDMA 1B92A 4PHDA 4QOZB 8ICBA 1RBRA 4E1NA 1IG9A 1I39A 3VQ4A 1ZQPA 4CJUA 5KFQA 3QEVA 2FPMA 7ICJA 2MUTB 3S3OA 3BGRA 4ECSA 5F9LA 4DQQA 1CXUA 3M9OB 7ICHA 3AO3A 1JIHA 1SKWA 4J9NA 2DFFA 4Q8FA 4KTQA 1UWBA 4UQGA 1WLJA 1U45A 4HUGA 3CG7A 5DB7A 3AO5A 3KIOA 4EYHB 4ED7A 4CJRA 3OS0A 4O55A 3MR5A 1VSLA 1O1WA 4AILC 2BQRA 4FCYA 3ZSWA 5J2MA 4B9TA 3MR3A 5CWRA 3O4NA 2HHQA 3OS2A 2EHGA 3PNCA 2GBZA 3QIOA
chains in the Genus database with same CATH superfamily
2FVRA 2E9ZA 3O3HA 1F44A 3MFHA 4CO3A 2YJFA 4DV1J 1HBUA 4B3RF 1AFIA 2CPJA 2CWKA 4KV8B 2E1EA 2IHNA 1XBWA 2MZSA 1WSJA 2IYIA 3PYFA 4BXOA 2D3UA 1OXJA 3JSMB 4F50A 4DTPA 3FMBA 3EE8A 4CHZA 3KOAA 1T9UA 2LXFA 4W98A 1Z00A 2IAJB 3CJ9A 2E8OA 3Q0AA 3NRZA 4K59A 5A0YB 2Z1JA 2R2UA 5CR4A 1FKPA 2FJDB 2BJ1A 3S8SA 3J81O 2Z1HA 2PDAA 2ALZA 3MM7A 3ZNUA 3P1GA 4GY2B 2KK0A 1Y3JA 3AQOA 5HMYA 1NHKL 5KL1B 2OCEA 1ZQZA 5KG7A 5GMKa 2J9EA 4BGAA 1JALA 8ICLA 1ULRA 1JLBA 1U7LA 2EANA 1FO1A 3P3DA 4FBTA 1HNXF 3K2PA 2X1AA 1X4GA 1N36J 4YHHK 4Q44A 1UOCA 2HKEA 3EL2A 4ZTJA 1SJFA 1VQSA 3AO2A 1NLVA 5J2CA 5JRTA 3HFVA 5DZ6A 4JI1F 5HQMA 1TFWA 2MAXA 5BJRA 2YQ0A 3F2DA 4P7TA 5ADXA 3QRRA 4FZVA 2GJFA 3OTOF 1RAEB 1RI7A 5KL8B 2QMWA 1VQ7S 1NB7A 3HPHA 4GVMA 1U2FA 1QAXA 4IFVB 1N5YB 2GIFA 4AHSA 1P6TA 3MD1A 3DC2A 2E88A 2VFSA 5HR7A 3QWPA 3WNFA 1RG6A 2DIVA 5J0OA 1CVJA 4NLBA 2ZUDA 3I5BA 2DGVA 3WC2A 4YQWA 4KMOB 2GV1A 2PMZD 4CP5A 4CGZA 2Q3SA 1C2PA 2DRBA 2Y0BB 5AI0A 1W2IA 5IQQA 2H3GX 3FFIA 4RUBA 3QU5A 2M52A 3JYTB 3SI6A 3H40A 2GUIA 3KXDA 4OJHA 2CJAA 4FNHA 5CHCB 4YY3J 2P1JA 3VEXA 2LDIA 4DL3A 4DQIA 4WBFA 2F8TA 1F5AA 4FE3A 1DARA 1IM4A 3H1VX 2YNFB 2RRBA 4PL1A 3V6HA 4NLPA 2JHDA 2FZCB 1P1LA 2LM4A 2DO4A 4LF4K 3OYGA 5JVHL 3EYZA 1I51B 5IWAK 1FF2A 2K8GA 2BCSA 1WSRA 1A5XA 3H5SA 2JLEA 5E3QA 1N32K 4HDGA 5D0GA 1AT1B 4PZOA 4KRWA 3D3BJ 4CJ7A 1YI2N 3QZ7A 3CCMN 7ICKA 2AJ2A 4HTUA 5AI5A 4YHHF 2AMCB 1CJKA 3CETA 2FVCA 4TUPA 4O3QA 3J7Z5 4OKEA 2MGZB 3ALRA 1T05A 2J0SD 5IT9Y 2B8QA 2JWKA 3TABA 4OJ6A 5J0XA 1YJWN 2A1JA 2F1HA 1BQMB 4FNIA 2KI2A 5G5HA 1F0MA 2XS2A 1LCUA 5SWMA 1GXUA 3MEDA 3O1BA 3ET6A 4PH5A 1NOYA 2CPZA 4P9SA 2V34A 2RILA 2PSZA 2XHBA 2G2OA 4EU0A 3M8YA 3NVKA 4IXCA 2G8IA 1DQ9A 2GO9A 5K14B 4C4TA 2DL0A 1LK5A 5A8WA 2KB2A 1VSDA 4NLOA 1RAFB 1FE0A 2DFHA 3MPDA 1LAWA 3VQTA 7ICIA 2W9BB 2D0OA 3SQOP 2RRNA 3J80Y 2HSZA 3L2RA 4YY3F 1XUPO 3BPDA 5LL6d 2CH6A 3BV8A 4F04B 3UI3A 5AKEA 3T6BA 2FGCA 2YNHA 5HVHA 1VLYA 2B9XA 5AXNA 3GJQB 4UBBA 4NZ0A 1RKJA 4LF4F 2WK4A 3CM5A 4CLLA 2WB1F 1HBNA 4DHYA 2K2PA 5E84A 1YF5L 2E1ZA 5IWAF 2ZF5O 2DKZA 1N32F 4BHQA 5LMUJ 4AT1B 2HGLA 1YJVA 3GSDA 2AEJA 3T41A 3RVCA 5LMUK 3CXCR 2YY3A 1S6OA 2N3OA 2DPJA 5HRSA 3UFCX 2ZJPL 1RLDA 5AQJA 5KFCA 3HSZA 3VEOA 1HARA 3I6PA 1FWPA 2EZZA 1S3XA 1GLFO 3QDKA 3D6RA 3DXMA 3PHEA 1TR0A 3OR1B 3MUVP 4ZVEA 2E2OA 3HVWA 2FJEB 3Q89A 2YH0A 1Y5LB 2XMVA 5GVQA 3J7AN 3KHLA 3TI0A 2XO7A 1PZNA 4DV5K 4ETZA 4FXVA 4K5SA 3DLRA 2AH5A 1LVHA 5ALKA 3FCWA 2E6LA 1UW4A 2PA3A 9ICUA 1J2MA 3J8AA 3MXMA 4DMZA 4EBEA 1CZBA 5B0CA 4JK9A 4EHUA 3FSIA 1SC6A 1Q78A 2ZOMA 1RCHA 5DETA 2W6LA 2QTWA 2KP7A 1C0FA 3KJVB 4PZNA 3NRWA 2HHTA 3T1YK 5F8HA 4QJFB 1FFWB 1HPZA 4CJ3A 4EZ9A 4J9KA 2E8AA 4NCGB 3CJ0A 2EDUA 3KFWX 1KONA 2JHEA 4OYWA 2V8VA 3CJ5A 2V52B 1ZBTA 2UP1A 2JZBA 3N9UC 2ACMA 1XNRK 3TP2A 4USIA 4M3ZA 2HF3A 1M1HA 4DU8A 2A6OA 1QTNB 5LMUF 1RWWB 5AQLA 1CZ9A 4QZ9A 5LOQA 5HANA 2XCPA 4C9DA 4O5EA 1U1RA 3B78A 4IOAL 1IJFB 2DBBA 4DUTA 4J9VA 1LKYA 3D1OA 4YMMA 3OYJA 4R79A 3EW9A 4AYBC 3MAHA 4WFBL 1R0AB 4PXDA 4IDHA 3OFHA 3SSQA 3TO8A 4ELTA 4JI2J 2AJFE 4RNMA 4RQ3A 3QLHA 4LH5A 5ALZA 3OL6A 3K8VA 2ZBCA 2PY5A 3CCTA 4CDGA 2FLNA 1SAZA 3RB0A 1VQKS 3FBBA 3UKUB 1KVAA 3D4JA 4ICAA 5KAKA 1XMQK 3OQ2A 1MQ2A 5HNKA 2VC0A 4JD2A 1PJ5A 2OPQA 1Q9XA 4FYXB 2CQ3A 2XI3A 3JPPA 2IVNA 3Q8MA 3JAMO 4DUYK 2RPIA 3EE9A 1OUQA 1TUWA 4YR2A 1ZM3A 2I7PA 3T1YF 2B6AB 4ZVOB 2CQ1A 3NE6A 4JV5J 5FDLB 1G7CB 4DOZA 4M3RA 1IKYB 1SJ4P 2JXJA 2D0CA 1HQEA 3OW2R 2OMLA 1XNRF 3AA2A 5GINA 2W1BA 1BISA 3CCZA 1UPPA 2Q0RA 1T0TV 1YJ7A 3HHLB 2MKSA 3N0VA 3UDEA 3IGNA 1KRPA 3OYHA 1NSQA 1RTJB 5KGXA 2QA4G 1RT6B 2H3FA 4Z94A 1DZ5A 3NGIA 1N8RT 3ZZRA 1XO1A 4O3SA 4NOHA 1V38A 3DNCA 2DCLA 2Z8QA 2MEWA 4E0DA 3HLUA 3K17A 2G8HA 1V5VA 4B9LA 4O3RA 3Q86A 1NDCA 2DHSA 1BPDA 2VL1A 4DV2J 4QJVA 1F2GA 1Q4RA 4CO2A 2BCVA 4PQUA 5IIIA 3O44A 1OY9A 1DKGD 2YB4A 4KGKA 2GLEA 2D0BA 2WC9A 2QLWA 1XMQF 2I2YA 4RT3A 2NXEA 4KJIA 5AQNA 3LQVA 2FSJA 1QSLA 2EFPA 1GK8A 2Y0SF 3W9HA 2EAOA 1CC8A 1ESVA 3ULEB 4LJXA 2C3MA 3IAS9 4DUYF 3V1QA 2R7YA 3QFPA 2NR0A 3SQIA 2VDIA 1PVPA 5HO4A 3OUYB 3ED5A 4A8QA 3CCSN 8ICVA 5J2NA 4NLVA 1OPIA 2FE9A 1W25A 1EX8A 2VB6A 4BACA 5B66U 3CERA 5ALWA 2E1PA 4BRIA 4EK2A 1TV6B 5AQMA 4BX9C 4E98A 3BN4A 3O1LA 1VI7A 1JRPA 1WHVA 3C14A 1ZQYA 4DL6A 3I0RB 3DRPA 4C0HA 2E1CA 3IP0A 4YOYA 1TL4A 1FIQA 4PJ0U 2DGWA 2DGXA 2BJ9A 3V9WA 3HO1A 4JI5J 3AA5X 1YSJA 1T9TA 3W2VB 5LMNK 3OR2B 3AGRA 2FHJA 1ZZFA 1NKEA 4PGQA 4O3MA 5I3UB 5KG1A 2OANA 2VPWB 4DV7J 1T3OA 3MECA 2G06A 2AU0A 1YX2A 3MEGB 2IMWP 4YG2A 2O8DB 2QEXS 2B7CB 5SZTA 3ZTPA 3CMQA 4B1WB 4CIFA 1XEZA 2ZIVA 2BM0A 2P66A 4F91B 2O01C 2H5JB 1RA6A 5CD4H 1NB2A 3OVSA 3SAFA 1U24A 2YXLA 4X64J 4DR6K 3GYGA 2LA4A 3G4SS 1X9MA 5CZ2A 1VQON 2DFEA 2LYVA 2PFOA 8ICQA 2RMLA 1ZQFA 2Z4PA 1FRJA 5ETKA 2RVJA 3QBWA 4FM2A 1GLEG 1YLXA 4C8ZA 3RSEA 1NMNA 1IKXA 4Z6EA 2VG6B 3UD4P 4CZFA 4WYWA 3NNCA 3HI9A 4M04A 1KS2A 2KE7A 2IHMA 4FJKA 3CJQA 4PWDA 1IG8A 1OH5A 3UVJA 3GBTA 2VKZG 5JUMA 2HBJA 3BGRB 1T11A 1J5OA 1MMNA 2UXBK 1HJPA 2QMUB 3OBWA 4LBIA 4YDDB 1FRMA 3LM2A 2RQKA 3M6XA 2NSBA 3W60A 4DFDA 5F41A 1AROP 1S1XA 2DY4A 3ETRA 2GA7A 1REVB 4EX6A 1YBAA 3EZUA 1PK1A 3GV5B 2E5LK 2J9DA 2HZCA 2Y1JA 1UPMB 5T41A 5LMNF 5AI6A 3MURP 3Q8PB 5J1NA 5C42B 1SXDA 4EEKA 2Q79A 3MOZA 3BY5A 4PKDB 4YFKA 4KSEB 2QK9A 4RW4A 2GHVC 1GX5A 4A4JA 4HYKA 2HMPA 2W55A 5K8MA 2N4DA 1Y5IB 2WCXA 3FZHA 1YVFA 1BQNA 4X62J 4FLWA 1VBXA 3ETLA 5C7PA 4FJ5A 1S72S 2YTUA 4CLTA 3GJSB 4OQJA 3OLBA 3JB9k 3GJTB 8ICFA 3VWSA 1UVMA 4DR6F 3QE9Y 6FDRA 1ATNA 3HYFA 1WC5A 2DJWA 4CJTA 1V3RA 2J8SA 4OGCA 4E7LA 4HL9A 4F2SA 1SJ1A 1U0HB 3KK3B 2YCHA 3C1ZA 3N28A 2AD9A 3WIVA 1BNPA 2HHXA 2BV3A 1TKZA 1SPBP 4JV1A 2P6RA 2CJQA 2R8GA 4DV3J 4NL5A 3NNHA 2D9PA 5IZHA 1FCAA 2R7XA 2UXBF 2UUCK 5KFLA 2H9ZA 3UPQA 1CRXA 9ICNA 1WORA 5MAOA 3HPOA 3L4BC 4F25A 4I0WA 4WFNQ 3WBZA 5AM1A 2OH2A 3EE3A 4UOFA 3EEQA 2AEFA 5K8NA 2XMWA 2FTRA 4CECA 5BRHA 2V2ZA 3AEVA 2E5LF 3PX6A 6FD1A 3CSKA 4UAZA 5C2FA 3IRWP 4DU1A 2R7QA 1LWCB 3MR2A 4M94A 1UT8A 1NGGA 2R18A 2MUTA 1TKTA 2NRWA 2J6UA 3H5UA 4DTSA 5DG8A 3G8QA 4PXEA 4QIFA 5J2QA 4GVBB 2GEMA 1WACA 3NGYA 3EPIA 5DM7L 2CWXA 1UL3A 1W9HA 4JI4J 1BG3A 3HD2A 5E2QA 3QJJA 5B0FA 3FC4A 2Y9HA 1GMUA 3A0BU 2PAVA 4K4YA 4F0KA 4X62F 3UKRB 3TA0A 2A3JA 5F3TA 1RAOA 4LFCK 2FF3B 4F36A 2KM8B 4CJQA 4QPTA 5A8KA 1ZQQA 3WQPA 3SJHA 1QQ5A 5H9EJ 2RU3A 2BE2A 4KHRA 3AOAA 3G82A 3SJJA 4P2MA 4CZKA 1JN3A 2IMOA 2YBVA 2ADBA 4R64A 4G1PA 2IPOB 4IQVA 4OZ5A 1WYGA 3KBBA 4A5AA 2YQ3A 3EGVA 4I2AA 3VQCA 5AM5A 3HOTA 2DNGA 5CYJA 3RUBL 2RH3A 2VUGA 4QWDA 3D1QA 5C10A 1NSPA 5KFTA 4UAYA 2HAFA 4A48A 4ETXA 4ZPCA 2HLTA 2HW3A 3MCPA 4FWLA 4J90A 3MMCA 1J2VA 4XK8C 2WF5A 3BBFA 3WUHA 3RMCA 2XMKA 1G3OA 3V7LA 5H1SV 1TUYA 4HACA 4PRFA 4I6AA 3WKDA 2OPPB 2J6TA 4O4GB 4QS9A 1NDLA 3VQ7A 2FC0A 3NVMA 4U7UD 3NF6A 1BUXA 1X0PA 2ZC3A 2O5DA 4M0AA 3C2KA 1MWQA 3NS1A 1NXIA 4OKJA 2VJUA 3OGUA 3I4PA 4KGZB 2HYIB 2N7YA 4TU8A 3HSDA 4YB6A 4M5JA 4FW1A 4KBIA 4MF2A 1J54A 4YN4A 3WEEB 3BF3A 4F02A 1KOOA 3CCRN 8ICSA 1S9GA 4CHYA 4JYAJ 1VQ5N 2FDRA 3ZSXA 5CJ7A 1YJ9S 1CJTA 4LFCF 4JYAK 3M1VA 3UMCA 4RQ4A 1X5SA 5HP1A 3DGPB 5AQTA 5KT2A 4FS2A 3CCUS 4BRPA 3RU0A 2GJ2A 5BXIA 4US9A 2D3O1 1CS4B 5HBMB 3EUNA 4ELVA 2FJBB 2E1RA 2W4CA 4Y2VA 1VBZA 3M8QB 5BPNA 2G8FA 1JMSA 3A3PB 3OVBA 3D7SB 1RT1A 1VC6A 3U7JA 2YWGA 4D3HA 4Y2CA 2DGQA 3BZKA 8ICWA 2IJNA 1ZS6A 3IHQB 3FEZA 1Y0HA 2NS1B 4USKA 1X4AA 1RTDA 1B9FA 1XTZA 2GZOA 4DTOA 4BVPA 5A2QO 2VA8A 4Y2SA 1R8AA 2CRLA 3FZBA 1OQ3A 5J2KA 2F8LA 1RA7A 4U95A 4Y2RA 3S3MA 3J7AP 4RW8B 1KR4A 3MMAB 4LMZA 4M5DA 5HN0A 3FLCO 2IVYA 4QYZK 2FBTA 1S1UA 1VJ5A 1BVSA 2XSFA 1NM2A 5HL7Q 1P8GA 3PR5B 2ZNYA 3RJEA 4K4GA 2GW8A 3VGMA 3VAFA 3D2SA 1DBDA 2XWXA 3PIPL 2J5AA 3CJ4A 3HRGA 3A0HU 3MMJA 4LZDA 2HMIA 1KAYA 2QB0B 4DL2A 2HNZA 4NRTA 2ASOA 1UT5A 3CMAN 2BANA 1UWAA 5DMRA 4X66K 5DKWA 1S0OA 2P9UA 4ZVTB 4LSNB 3VGUA 2UXDJ 3ZYYX 4IZ9A 2JWNA 2C2EA 1HIYA 4JYAF 3HHEA 2UXDK 2X51A 2C3UA 2PEHA 2DNLA 2KFNA 2EBGA 5B5EU 3UQ2A 3M2VA 3TTFA 1IWGA 4Y2UA 5AQHA 3AXKA 3NGSA 2OO4A 4USMA 1H7XA 5HATA 4LQ3A 4U7BA 5M2UA 1NGFA 5HJYA 3OJSA 4TLRA 2ASLA 4QZDA 1HA1A 1YITN 4ECZA 4TUQA 4BRLA 4P7VA 4HT5A 2MZJA 2HVEA 4Y3CA 1Y3KA 3VQ5A 1XC9A 2XWYA 2F4FA 3W65A 1LV5A 4PL2A 1LEOA 5GTHU 3Q2TC 3U02A 2RP5A 4WCEL 3BYRA 2F3JA 4IRDA 3MDAA 2YMQA 2W03A 1R6YA 4ES2A 3CPWM 3QUBA 1MU2A 3GDQA 4B9NA 1S1VB 2HHPA 3I0SA 4JHDB 3D0GE 3GDXA 2FPHX 2KD1A 2BMBA 1ZRNA 3FCHA 5AQQA 3GE9A 3T9NA 2K4EA 4QCLA 5KOXA 4CI6A 4YP3A 2YKOA 1HNVB 4MKAA 4ZP7A 2R8HA 2JL9A 3IN5A 4B9QA 1RQ0A 3FJ2A 3THYA 2HOFA 3IGVA 1CC7A 3BBBA 4HVZA 5C2DA 1FRIA 2XYPB 4OZ2A 2GMJA 5CYMA 2FZGB 1VC0A 2UU9J 1WG4A 5IT4A 2H54B 4WKRA 2YMMA 2O8CA 1JUDA 3RJMB 4I7FA 3TQ1A 3WXKA 4A8OA 4HHHA 2J0WA 4HH0A 4X66F 3CCLN 4ANEA 3ID8A 2GJIA 2LLZA 1XMOJ 2W3SA 1GXTA 1JLGB 5KPTA 3EGWB 2UXDF 3HI0A 4FBUA 3TWHA 4K8ZA 4RNHA 2F63A 5B8HA 5LJ3Y 4TQRA 2D3ZA 4IJAA 4DV0K 3DLEB 3PFEA 2BKPA 3E01B 2IRXA 4ED6A 2BE7D 5G4DA 1WSVA 3VETA 4UQTA 4AYBD 2FUG9 2M4MA 4BRKA 2NO4A 3N5FA 3J81Y 4C8KA 3BJYA 3I32A 3ETOA 2K3KA 4EZ6A 3PIOQ 2ATLA 1T02A 4ZVRB 3OYDA 3GMGA 4M5IA 2E7VA 4F92B 1U09A 3BQ7A 5T7LA 3ZZPA 3C6UB 3THWA 3S01A 3NMAA 4PG5A 4E7HA 5AQVA 2CQ4A 4AHVA 4C11B 3BR8A 4QR2A 1WG1A 4JRQA 2H3QA 4FZYA 2VCPA 2MKYA 1VHIA 2YKAA 4F3TA 4FJXA 2QM1A 4ZLPA 3M1FA 4EYIB 2CQ2A 2NYHA 3KHHA 1B7FA 2YWWA 2WONB 2W40A 3UE5A 2YWFA 4BR7A 2AJ0A 1IR1A 3JPNA 2P9CA 2O4GA 1WOPA 1RNHA 3VF4A 4IOXA 2VD3A 1DTQA 2MRLA 4KLJA 4WFAQ 3UMGA 3ZT3A 4TY8B 3K1RB 4CLPA 2CQPA 2V4JA 3WKCA 3BSAA 4KFBB 3ZSVA 2G0AA 5L1MA 1N34J 3LGMA 4JKHA 1KTQA 4MKVA 1T6CA 1IUJA 1S9EA 1U2VB 3J7A1 2OD6A 2IDEA 1QLNA 2FBVA 4DQRA 2CQBA 4LIWA 1GMWA 4IR9A 2Z0GA 4A57A 4TSXA 4F0MA 5J0PA 1HKBA 5E3RA 1TL1B 5IINA 3NBPB 1YG0A 4ILJA 5AKYA 3FSXA 4IG0A 3BZCA 4WIIA 1NUEA 3NMRA 3US5A 4P0QA 3I5CA 3QSYB 3C2PA 4KHWA 3QATA 2WVFA 2QFIA 9ICWA 4C23A 1HWJA 1K9MT 1VRUA 3IG1A 3ZDDA 1S0NA 4OZJA 4MEYA 2KRBA 2Y8YA 3PMNA 5BYQA 3GV8B 4E7IA 2H5XA 4FFDA 1YGYA 5EOZA 5KG5A 3HSTB 3H8YA 2YKNA 1KL9A 3GG1A 9ICLA 5DLGA 3T1HJ 3O4QA 3VC8A 1NGIA 4GXKA 4KLIA 3JQMA 3K9KA 1X9WA 4PG4A 1YRTA 3R6GB 2YNGA 5J2FA 5E7OB 2DBYA 3ALYA 4DSEA 3ZEUB 4PUOB 1RQNA 4WTYA 4A8XA 3AD9C 2C2KB 4ZPDA 1SQFA 4RWWA 3TFRA 3WQTA 3N4WA 3L2WA 3M9MB 1ITGA 2ZD1B 4M42A 5EVZA 2LMRA 2XCAA 3S6EA 4FJ7A 4A47A 1C1BA 4BR0A 3NF8A 4Y2QA 1EIYB 3KLGB 4QQBA 3HKWA 5M2PA 4N8NA 3I33A 3NCQA 4H5WA 3QU2A 2FMPA 3IAYA 2MHNA 2FHKA 2QARB 3EKSA 3WNHA 1DJ0A 2I38A 4AL6A 2Y1RI 1VBKA 1VQPN 1R8BA 5J2JA 9ICEA 4ZCIA 1NGEA 4P0PB 1X4BA 5D4LA 2LDYA 3ZX2A 4M8LA 1JJ2M 3BDEA 4RO0A 4K2XA 2UZAA 3DDHA 2ABYA 1SB3C 1HNZK 5E79U 1BC6A 3CFPA 2GC8A 3GB0A 1KFSA 3CD6S 2NSCA 5AI8A 3W8PA 2HWTA 2E8NA 1YHQS 1DOQA 1FDAA 2CUYA 2H4WB 4LRBA 3FEYB 3W5ZA 3V81B 4CLYA 4WXWA 3CJBA 3MBYA 3CC4S 1FKOB 2DUYA 5GAHU 3CJAA 1FI4A 4A62A 4FLZA 1HLUA 4A8SA 1C4CA 1JLCB 4M63A 2AV5A 3CM6A 3R3TA 4LY7A 1RCOB 3VENA 4WTOB 1N63A 1TK5A 4MDAA 3O2IA 1JLAB 4CF5A 3F5TA 3AN1A 2B51A 1SL2A 3FR0A 4QS7A 3K8WA 3MUMP 4EX7A 3ZC4A 3LGNA 4BRAA 3MM6B 2A1RA 5KFOA 4DOAA 3ZSZA 9ICKA 3ZI4A 3V7JA 2XICA 3JSMA 3AV9A 4FKYA 1SVDA 5KI6A 4EBCA 3N6LA 3E66A 3I9ZA 2E9RX 2IAJA 3KD1E 5ETTA 3K4GA 4QZIA 5A0YA 4Y2XA 4EGLA 3LPUA 4LF7J 2HNDB 3DU5A 3TJAA 3C94A 5EE3A 2ROEA 5JVHQ 4CGGA 3QEBZ 3KG4A 3F56A 1S1WB 2EWHA 4Y2JA 3SD7A 4XO0A 1NM1A 2FJVA 1RBLA 5AJ3J 4EBDA 4OX8A 3HRDD 1B4SA 3CNHA 5LSOA 5HLFA 4CE9A 1TAUA 4ISGA 3VTHA 2X6SA 2H4YB 3H6EA 1EKEA 1HNZF 3CXCM 2YB1A 1LXJA 1CJUA 2BJ7A 3WDOA 4DL5A 3OXLA 4CT9A 3OV7A 2ILYA 4NLSA 1MLAA 4ZPBA 3EKUA 1HL6A 4FM1A 3WK7A 4OI6A 2ESEA 4I2GA 4O8KA 1H1VA 3U3YA 1B22A 4ZCKA 4LF5K 5EUHA 2NUHA 1Y88A 1WC6A 3BREA 1PJ7A 3CVKA 2YY6A 3CIPA 1WD6A 2A2CA 3QNNA 3DOKB 3TEGA 1IBKK 3D6FB 1W97L 3ETMA 2UVVA 5K9FA 4ZIVA 3ILIA 3HM8A 2F1FA 3ZETA 2KJ8A 3NCPA 2B0GA 1IKWB 3G8SA 3GU0A 1FVSA 2DR6A 3I56N 5ALTA 4BS2A 3TSQA 3W5YA 3VQDA 2WVBA 3W1YC 8ICBA 4E1NA 3AB4B 2ZZMA 2M88A 4DL0C 4LFAJ 4AQYK 3WK5A 1KKXA 5KFQA 5AKXA 3D67A 4HTIA 3IXQA 3NOCA 5AE3A 4UOHA 2V67A 4NE9C 4RBTA 3HZEA 3AO3A 1JIHA 2CPRA 1L3KA 2ZNZA 1TE2A 1SKWA 5FLXU 2K1RA 3MX2A 2V8GA 3PDNA 3Q2SC 5FJ4A 2CQCA 2XYHB 3D28A 2DFFA 1GAOA 4DBQA 2AYGA 4Q8FA 2EI5A 1Q8LA 2Q97A 3KMSA 4ILMA 1U26A 2ZJPQ 2P9EA 3AO5A 3KIOA 2ZBPA 3JAMY 2CNKB 2R2RA 2ZIXB 4PWUA 4W92B 1YZ6A 4AILC 2HCFA 1HHQA 4BCAA 4MFBB 1SJRA 1WNEA 1EJ7L 1HD0A 5J2MA 2L9WA 2POKA 2CADA 3CJ3A 2HHQA 4LF5F 2FQQB 4YOEA 3F53A 2CQIA 3HSCA 4RCHA 2RT3A 4CNZA 1QQOA 3P38A 5AK5A 3F5EA 4UOGA 1V6HA 1WSIA 3F9MA 1NSKL 3OT9A 1RFQA 3H0MB 2X1FA 3MAAB 3VQQA 4K2JA 4MFAA 1AUDA 3R8EA 3W66A 2JH3A 3H0PA 2ZJQL 1IBKF 2WBMA 4OGEA 3FSYA 4KGMA 3LDAA 3BGFA 2MSSA 3QEXA 1F5BA 1ATRA 1UQVA 2W8KA 1VSEA 1K9MO 4K0KJ 4ICLA 1Q81T 3EO3A 2NCKL 5L46A 3D2EB 3RJKA 1HNIB 3M5RA 1U47A 1X40A 3G87A 1WCNA 3PZPA 2U2FA 1U48A 2AGOA 4ECQA 1TELA 1BA1A 1V5IB 5IXUA 2D41A 3FKBA 4AQYF 2QTDA 3DYAB 4I1TA 2PMHA 1JLFB 4OYMA 2RB7A 2VIXA 2FVSA 3AARA 4W5NA 4AUKA 2I9SA 5JU5A 4LFAF 2VZ9A 3O9RA 5HMLA 3L09A 2VJ4A 1WG5A 4CQ1A 1PO6A 3MPWA 2B5JB 4ECTA 2OELA 4C3KA 1XSPA 1DRGA 2UVUA 2QWPA 4BWJA 3C8YA 5DO2A 3OTCA 5CA5A 2C3PA 3FUYA 4M5KA 1YVNA 1RBVA 1BNOA 2M2BA 1N56A 2ZUCA 4CEBA 4IOAQ 3TZXA 4AXIA 4KIAA 3CQ8A 4F5NA 1ZD5A 5D4PA 1SCJB 4FF3A 3R6MA 1VQ7N 1TMMA 4LR8A 4X2BA 3VEYA 3W8GA 5DK5A 2DGOA 5K5MA 1TUVA 2BTFA 1NPKA 4I2HA 4WP8A 5HROB 4PG8A 4FW2A 2YWKA 4YMNA 2QLJB 4E1JA 2IJFA 3CP8A 5AIBA 3DV9A 3SQGB 3EZOA 2VHGA 2E5IA 2IOFA 3C46A 1C0UB 1OH7A 2NXNA 2P6SA 4B9UA 1VK3A 2CPDA 4F4YA 3ENWA 2KEYA 1HR0K 3C2LA 1PC5A 3WXJA 1WUDA 3VQEA 2B9YA 3LVVA 3R2DJ 5B0AA 1T3NA 1XERA 3JTPA 1BHLA 1EP4B 1RACB 3IAM9 4FWOA 4CF2A 4RUCA 3CQXA 3K58A 1T9WA 2HHWA 4YB5A 2MTLA 1SV4A 3KJVA 5B0EA 5BRFA 3GP9A 4JUZA 4FSVA 4L3NA 1TV9A 5GIPA 1GOAA 3DLKB 5BN8A 5M1NA 3DI6A 1HRHA 3WT0A 3MM8A 3RAXA 3BSOA 4ZHRB 2G2YA 2H5EA 1KWMA 5ALXA 1Z4UA 4FXWA 1E6VB 2U1AA 2UUTA 3AA9A 2UXCK 7ICSA 3QBXA 2Y9UA 1SIZA 2XGPA 2CVIA 3LH2S 3O9QA 1UEKA 1S5ZA 3PO4A 4LBHA 1IG6A 3LP0B 4TUSA 3PX0A 4Q0BB 4CJ5A 4ELUA 3C2MA 1BWEA 4OJ1A 1QQ7A 3NAHA 5DRKA 5G0RB 1HUXA 4GVLA 1SB6A 4QZAA 7ICRA 4CK2A 5DB6A 4UW9A 3ASMA 3LPYA 9ICBA 3MEEB 1APSA 2HOEA 2MQMA 3WK4A 4RJVA 1LWFB 1CPZA 3QYYA 3KJFB 3HT0A 1WWHA 2Z2LA 1R0AA 2LU1A 1KC8O 3TZZA 1JK9B 3O08A 4QIGA 2K89A 3ZX3A 4YB1P 2V2QA 4ECYA 1KDNA 1HUOA 4P74A 1JNRB 1OH6A 1U25A 3ILJA 1JJ4A 4C6AA 1WWVA 3GZFA 2ZEJA 4DR4J 4DB3A 2VFVA 4N7TA 1NPRA 3L9ZA 4J9LA 2FMQA 2K06A 3NGKA 4DR1J 1N52B 1M90T 5AQWA 2HOIA 5HMWA 8AT1B 5CXTA 4TQSA 1HR0F 2VKRA 4FOIA 3EM1A 1O6XA 3JQJA 1CJVA 3QT6A 4M63C 3J7ZT 1FEHA 4LFBK 4CO4A 3VAIA 4KHQA 2BW2A 3L7UA 4GKKK 2XSJA 1YQHA 1TZ0A 2DYAA 2RE2A 4BRDA 3C6HA 3ICXA 4CJSA 2V8HA 3FGVA 3VAKA 2GTDA 2DFLA 4I29A 4QAGA 5DG9A 4DFJA 4NCBA 1OVYA 1T94A 1VJQA 3EWGA 3BF1A 1EETB 3CD0A 5H2FU 2UXCF 2IIHA 5IT9U 5KRSA 5JTIA 2KVIA 3ZSQA 1ZQAA 3ILOA 4CZMA 1XJWB 4B17A 2JLFA 2B7BB 2V4QA 3UPFA 5GAHI 2XMAA 4NYFA 2CZVC 3V9XA 1EO1A 4KREA 1RTJA 1WOSA 3QWUA 4FYWB 1WC4A 1O13A 1GX6A 4BE2A 2HNYB 3AA8A 2ZHBA 1X31C 1U04A 3LDOA 4XPCA 1WTFA 4NLNA 4PL7A 1SV5A 4G9ZA 1ECWA 3I87A 5J2PB 4FWKA 4B1XB 1B0TA 5ALOA 2P35A 5HAOA 2EVZA 1VK8A 2EC2A 1Y5NB 4UUXA 4UT4A 1ZQXA 3BUZB 5D3GA 1WDTA 3FZMA 3UW1A 2LYHA 2WB1C 1FJ7A 4X65K 4AH9A 1R7IA 1NZAA 4JV0A 1TUGB 3LDLA 3TAEA 3PY8A 4NRUA 2VC1A 1Z1ZA 3J80U 1WN7A 4PXBA 2VYPA 4DDFA 2BXJA 1R8CA 3QT7A 4LH4A 3QICA 2OA8A 2W3RA 1HBOB 2DNHA 1A0PA 1SQGA 3Q8LA 1SUQB 7ICPA 4ZVSB 4PKHA 4G1IA 1RUSA 3MTKA 4OVLA 4F5OA 1YJTA 3D6TB 2QN6B 1I94J 4F72A 3VQSA 2M70A 5AKLA 1FE4A 4LFBF 8ICIA 5EX5A 3L95X 4GKKF 1CI4A 2LECA 3IKMA 4CO5A 2E8PA 5CRXA 2PYJA 2V9WA 5U47A 3AVMA 4EAHD 4OX9J 4ED0A 5J2EA 2IC3A 4OI4A 1W2BR 3OTQA 4J9MA 4O23A 3ENQA 5J2AA 4A8FA 4BE0A 2AQ0A 1MA7A 1D4XA 2H1YA 3O3GA 8ICRA 3EN9A 5KFNA 4V19S 4CF9A 4K8RA 3CCQS 3I0RA 1AB8A 5AXLA 2R7OA 3ONNA 1RHMB 4ZPAA 2JH1A 5J0YA 3V4IB 4NJ8A 2OPSB 1NZ8A 5ALNA 4NPOA 5AZIA 4DV4J 2HVDA 3SDEA 1VRTA 2AT1B 3WK8A 4KITB 3TAQA 4LVSA 1DHMA 3B6OA 9RUBA 3NVZA 2I6WA 1WBBA 2YHWA 3VA3A 3DOMA 3IG8A 4JI7K 4OLAA 3B0YA 1VSFA 2PMWA 2W01A 2QZ8A 1GLCG 1LW2A 3G86A 1XC3A 1ZPWX 4IUFA 1ZBUA 5AZJA 1VQKN 4X65F 9ICSA 2RQ5A 9ICXA 3SFGA 4XDDA 1MG7A 2G1DA 5CD4A 3VZIA 5EX3A 3PX4A 1WC0A 3MCMA 2P9PB 2CNOB 4JI6J 1JKHA 1S6PB 1SIWB 2F5GA 8ICMA 5AQUA 1GLAG 2IOHA 3M8PB 4MLHA 3T9ZA 4LC9B 4TNOA 4X4VA 4CGIA 2LQJA 5F0UA 2HOQA 3B4MA 3H8WA 3QEPA 1ILYA 3HP9A 1RWXB 4NB4A 1VFJA 4RW9A 4I2JA 2LPEA 1DK2A 2D1CA 3VGLA 4J9SA 1SKUB 3PXGa 5HHIA 3LYSA 2RDJA 1T3QA 1JLEB 3L3CA 1Z1VA 3IRUA 4GFJA 2WSCC 3FRZA 4UY8O 2VG6A 4XUSA 1RTIB 2J4RA 4NL9A 3FEXB 4P52A 4R5PA 3KKAA 3TVYA 5I4MA 2IVPA 2R7TA 3DCAA 1NHVA 5AK3A 4PHPA 3NVYA 3GFXA 3OXFA 2BRKA 5A8RB 2G8VA 5F8JA 2Q1LA 1CULB 4CRJA 2YX6A 4DUZJ 3V6KA 1Q7YT 4ZPVR 1U1PA 3UXOA 1RDDA 4FZNA 2HS0A 2JMGA 4R63A 2P9LB 1M5PC 5CP2A 1UETA 1VSHA 4OYBA 4MFCA 1REVA 3K5OA 3UCZP 2GHWA 4DF4A 3LP1A 4DV4F 1FJGJ 2R4FA 2W9CB 5BYRA 3HHKA 1AZSB 5F8NA 4G1QB 3WNEA 1ZXIA 3TVKA 3M30A 3TAMA 4JI7F 2CPHA 2PKEA 1GNKA 1GMVA 1H6KX 4DR3J 3LDQA 2O8FB 1BGXT 5C42A 2ZM6K 5DM7Q 1Z2LA 1QY7A 3R9KA 1ZPVA 4EI2A 3VAHA 4DR3K 2P9KB 4X4TA 1PG5B 4Y0WA 4UAWA 3H4DA 4PWWA 3F44A 4OLOA 4OJLA 3ISZA 1OSDA 2BOPA 1K6YA 5J2IA 4OPHA 2ZIUB 4OZ0A 1N61A 3DFEA 5L1KA 1V4TA 3H59A 1H0HB 2LEBA 1XO0A 3RG6A 1JLQB 4CTAB 2NNWA 3AAQA 4OCZA 2UUAK 1T8EA 3AD7C 3AU2A 4CJVA 3TAGA 4NYZA 1FA0A 4UBCA 3NNAA 3HMJG 1FNXH 4NZ6A 3QETA 3GR1A 4GV9A 2AEMA 4PKGA 3LUYA 3D2WA 1N5QA 2KSOB 2HVIA 1U0HA 2AKWB 2ZH3A 4CE6A 3IMXA 1NU4A 1HQUB 5FRMA 2R9LA 4FO0A 2QRRA 1ZQTA 9ICCA 1UEVA 4OIXA 5KT3A 4C7QA 4NMXA 1VIXA 4WFNL 4KLSA 4E7JA 4DFKA 2YVSA 1HKAA 5ETMA 1PSDA 3A5NC 4DR5J 1B43A 4Z4FA 4FF2A 4F3QA 2GVDB 3F9KA 1B0VA 3KTQA 2Z30B 2Y0SC 2VPYB 2ZVIA 4DHVA 1DT9A 1SZ2A 5KFHA 2LI6A 4TURA 3WKEA 1RXOB 5HR6A 1TVRB 2Z1IA 4H5NA 2A10A 3OJUA 2Y1IA 2W42A 2X1GA 2QL9B 3OYMA 8ICUA 4DN9A 1MN8A 3UR0A 4KHUA 1NK9A 4J9PA 2CXEA 4FWRA 3ONQA 2QEXN 1QD1A 4UUWA 1UJ5A 4OHZA 2ZM6F 1O08A 1PYSB 4I6YA 3Q7BA 4DR3F 2W41A 1Q95G 1UJ6A 4B08A 4JEPA 3UXNA 4ANCA 4ZP6A 4C98A 3QNMA 4PG7A 4B3TK 3O9SA 2HFNA 1KEJA 8RUCA 1ZQKA 1WF2A 3KG0A 9ICHA 2YJEA 4YFUA 1FEEA 2AZ1A 3WXIA 2JGAA 2E2QA 1IBMK 3KK2B 1KQSM 4YDUC 2GMLA 1L7PA 2DTUA 1K8AO 3V5RA 3ISCA 1FDNA 1TL5A 2ZJAA 4NLRA 3J7YU 1X8DA 4ISEA 4ZMMA 5L1JA 2HPUA 3M8WA 1SC4B 3CJKB 2VU5A 5L1IA 4DPXA 4BR2A 1UAXA 5J0SA 1F6TA 2QLFB 2QKQA 4KAIA 4IEEA 5AM2A 3FBEA 3AU6A 5GAGP 4IKFA 1ZBIA 2HIQA 1SS6A 1UTAA 4HHJA 2Q1NA 3E1YA 3QRQA 2P5VA 5HVGA 3KWIA 3PW5A 3WX4A 2CRXA 1WSHA 3FQKA 1O51A 5EDWA 1VS3A 2V0NA 4KX5A 1QHAA 5MLCQ 4OYXA 1UVLA 1HBMB 2Y8WA 3LDPA 2GQ2A 4NXNJ 4R8UB 1YKWA 3MFIA 3TRGA 4YD2A 2OPPA 4H4KA 2FY1A 3QAEA 4Y34A 4NXNK 2P9IB 1RHJB 4O4GA 3BS5B 1QVFR 4M5NA 1PGZA 4C8OA 2VGMA 1PK3A 3I28A 2V50A 4HCCA 4DQPA 4CO0A 3KLEA 2OAUA 3QU9A 8ATCB 4URQU 3F2KA 4ZH4A 3PIPQ 3NGUA 3MTJA 3M2UB 1S72N 4XTTA 4YUDA 4NASA 4B3TF 3H2VE 3B8HA 5T14A 1HBUB 4RZRA 2F9JA 1TAQA 2DNKA 1LW0A 4UAVA 3NF7A 3BS7A 2YQEA 1IBMF 3O3FA 1RDFA 3QGPA 1BY9A 1YT3A 4BXOB 3CMES 3G8TA 1KVKA 3RJIA 2HBLA 2XY7A 1Z00B 1VK0A 2XZTB 7AT1B 2PFFB 3CCVN 2C2RA 3TR5A 1FKPB 5DGBA 4PGXA 2IM2A 3EX7B 4KHYA 3CC7S 5DBCA 4Y2YA 3M8QA 3SCIE 3E9OA 1BOTO 4Z4CA 4FWPA 4DMNA 5AKGA 2NRRA 1S76D 4WCEQ 2RUSA 3CJCA 3ZCMA 4K4ZA 1NZPA 2G8WA 8ICNA 4DN0A 1SJQA 4KHSA 5JS1A 2Q0UA 1OS5A 4MJKA 4RQ2A 3KFUF 3FDSA 1WKLA 3NH1A 3VV2B 5HRPA 1DURA 4P4PA 4FKXA 1S22A 3MR6A 2YX1A 4ZIWA 4JWNA 1UVKA 4M5GA 5HL7L 2WF8A 3AJ2A 1XSNA 3CCJS 4NXNF 2YKQA 4CIGA 4ECWA 1MMDA 3PHTA 3MMAA 4EFAC 2AGPA 1LWEB 3V6DA 4CHNA 2B8PA 4F5QA 3ZX0A 4F67A 3IFRA 2P8IA 1Q1KA 4FVCA 1J5EJ 1U02A 5ADXH 1D0EA 2HBQB 2A2DA 4GKJK 2DISA 4KRFA 3P45B 3VQ9A 1N0VC 5ALRA 2YQ1A 2HS3A 4ID1A 2HB5A 4HT7A 3LZIA 4EEYA 2KHDA 4LSNA 3QU4A 1X4DA 3KKRA 1RT2A 2AHOB 3FCVA 4Y65A 4GIBA 2PIIA 3NDKA 5LXYA 1T03A 1HYSA 3FFIB 2LU2A 3RYLA 5GTIU 2W2QP 2KH9A 3TVZA 1JQGA 4IQUA 3K5MA 1RKIA 3DDKA 3CCES 4B1YB 3ZDBA 1NH8A 1GMWD 2ZDPA 3C0BA 5FLXO 4ES1A 2CIMA 2EK6A 1TQLA 2X6NA 2KLAA 3NMUA 5F8MA 5GAEU 3QMQA 3T5KA 4M6WA 1FESA 3P83D 5I42A 3CTRA 4DTXA 2CG4A 3K0JA 1ZBSA 3H46O 3BO3A 3RMDA 4OLPA 4GMJB 4B3MK 2OUGA 5AXKA 3WXMB 3OSNA 2ZE2A 4JP8A 1VQMN 4DEZA 5AI4A 4JHDA 3O1WA 4KH5A 4NXMK 4NL9C 1JWWA 3F2BA 5CCMA 2W8LA 1TYQB 3E8OA 4CD3A 3KKAC 1T05B 2IA0A 3HCXA 1BCMA 1U6BA 1R43A 1X60A 1YTYA 4HKQA 3L4QA 1I1GA 4DV6J 2HQIA 3MHYA 2DGSA 4MTPA 4NLCA 3ET6B 1L3SA 1BA0A 3EVWA 4GKJF 1S6QA 3NGZA 3UNYA 1TUUA 2ATCB 3KNGA 1ZQOA 3CEDA 1FFUA 1YJ9N 4WQ5A 1RADB 1ZAVA 4RLEA 3P4IA 4KHPK 9ICRA 1FNOA 4CHQA 5B0BA 2FPLA 5FP0A 4NLTA 2YKPA 3LM9A 3MX5A 2MZTA 3CCUN 5EU7A 5A8WB 1KD1T 1X3NA 3DRSA 2FZKB 3R1XA 3ENVA 4ZN3A 4NZ7A 3DLEA 4USWA 4CBWA 3CO9A 3R5DA 1Y10A 2DIUA 2IM3A 3UB5A 5J2HA 3OD2A 2JJ4D 3CRXA 4YXJA 3JPQA 4NYOA 5HRRA 4WP3A 1OQ6A 3F0NA 5E5NA 2ZTEA 3EZ5A 3KLFA 1BXNA 2VQEJ 4BR4A 3O6WA 4L75A 4B3SJ 3FM9A 2MSTA 3DLGA 3POTA 1KQGB 1FJCA 2K8BB 4Z6FA 2XM3A 5CY4A 4C11A 1HBNB 1OYDA 5KOWA 2IS3A 3IWXA 3KLHA 1UHUA 4MN4C 4B3MF 5KFEA 1XNQK 3BS9A 4AHRA 4A8KA 2E6MA 1NMDA 5AM4A 1XK8A 2WSEC 4O44A 4NXMF 4FL9A 1Z26A 4WFAL 3V7KA 3I8DA 2LMIA 3RAMA 1KP6A 5AKZA 1E4FT 1T95A 4BJQA 5A0LA 1RHRB 3S41A 2HK2A 4BRHA 2HHUA 2KYXA 1NJWA 2FBYA 5D4OA 3D6MB 5M1QA 4TY8A 3EDQB 4DQSA 3G71S 4GC6A 3O3LA 4DV6F 3GE1A 2HZVA 4DXLA 2XLJA 4IS7A 4UARA 1HW8A 3R3LA 1VQ4N 4JK7A 3W3SA 1U9LA 1HJOA 3UM9A 8ICHA 3PR4A 1FRXA 4DU3A 1U2VA 4FPAA 4KHPF 5DZ7A 4ZVUB 1KBUA 4K4SA 3ZSRA 2VIHA 5HQ8A 2HFUA 2WW4A 4UTGA 2YX8A 1TL1A 2EFQA 3NBPA 4I69A 2B56A 1YJNS 1NGBA 4IH7A 2E2PA 3DEEA 2G9OA 2PI5A 4DR7K 4IO9L 2ZH9A 1AYEA 3JQKA 1B64A 4RNNA 3R8YA 1J2NA 1F9HA 1U6ZA 3G6XA 5J0TA 2GCFA 2V8DA 1KKHA 5KT4A 2WB1D 2ZH1A 2ZUBA 4NX9A 3SUPA 2WHOA 2DTJA 5GADU 2KKZA 4DV1K 5HMZA 3CIMA 1RT5A 4CEEA 2VQEF 3H98A 5DDYA 2JZBB 4CT8A 4PHAA 2FF6A 3KHRA 2ZH2A 2HQDA 1WBDA 1XNQF 5IIOA 3OTDA 1M5VC 5J2DA 3HT3A 3DLLQ 5IM0A 1CXQA 2I6XA 1LQ9A 5D8HB 3SBGA 1DLOA 4OX7A 4ZLJA 1LKYB 2ZD1A 2D6FC 2QL7B 1RWUA 1L6NA 1LFWA 4CIEA 2D5RA 1EQMA 3D0IE 1G4CA 4ID5A 3PM9A 4GLXA 1ASUA 2GQCA 3RAQA 3KKSA 5E33A 4QYRA 3QLHB 4XEIA 3SFUA 2NRZA 1ICEB 2PE8A 3P6YC 1SBRA 4FJJA 1BPBA 4H4KC 4W4MA 3RGIA 1N36K 3OVAA 4KLQA 3W7BA 4XH5A 2XHCA 3EUB2 1UA1A 4JNEA 4HI2A 3U9ZA 5KNIA 4BC9A 3R7NB 3CNQP 1QJHA 4DR7F 1S6UA 5AKIA 2A41A 1QZ5A 3V81A 4OJ3A 4JLHA 1NKCA 3VQ6A 1HHTP 3LWMA 3MAQA 3UNGC 4ATNA 1W26A 1FEZA 2JVOA 3SV3A 5DB9A 3CE8A 3VGVA 5AQOA 4W5QA 4DV1F 2EH9A 2IRUA 2XVTA 1EX4A 4LRAA 1A77A 2E29A 3CJRA 5KGWA 1J27A 1R59O 5TISU 1Q18A 1U8SA 2JDJA 3EVOA 4QNLA 4CW7B 4Q45A 2RAQA 3AOBA 1FK9A 4ZTFA 1SWVA 3OL9A 4CZEA 5ALQA 1KNZA 1RWMB 1UAWA 5C15A 4YY3K 3G6VA 7ICOA 4DKWA 4Y1DA 1DY3A 1G99A 2GX8A 3AY0A 3VESA 5AM3A 2BHNA 4OJOA 3V2UC 1KBRA 4N76A 2BDUA 3I55S 1RTHA 3ZLJA 4KI4A 3FQLA 2RKIA 1Z25A 5CCLA 5J8YA 1F5SA 4X5VA 2ZHOA 4BVOA 2W11A 3T79A 3V4MA 5AXMA 2LM1A 3VEWA 3MCNA 2BZFA 3AVAA 4C8NA 3CPEA 4QIVA 1K73O 1N36F 3W0LA 2JV3A 4MO4A 5DDOC 3J81U 5AR0A 2DGZA 3O5BA 5LL6Z 4RL1A 2KT2A 3QX7A 3W9IA 1EXQA 2MQ8A 3M4XA 4CM2A 1RT7A 4RPZA 3CF5Q 4M5MA 3TAFA 4K4UA 3CJSA 2FIUA 3HP6A 3C5GA 3MMVA 1AFJA 2ASYA 4FM0A 3GIMA 1N33J 4BY9C 3DLHA 1VQ8S 1ZETA 2NZCA 3KD3A 5DBBA 1T3VA 4DSIA 5AKHA 2PFQA 5J2NB 2GMHA 4Y00A 4AD6A 4PQAA 3K75D 5FPEA 2ZJQQ 2E5GA 2FLPA 5FPDA 3QIPA 3DOKA 3CDUA 4US8A 2MQQA 4IG3B 2DR7A 4NI2B 2PBDA 4KGVB 3C14B 1KEKA 1QSSA 4C0ZA 1LAVA 4NWIA 1K0VA 4CF0A 1X5TA 1XR6A 3KLIA 1KAZA 1MROA 1QUVA 4MIAA 4DZ6A 2B3TB 2CNNB 2O8BB 4GNIA 5ETRA 3GIJA 3ILLA 1IBLJ 2Q36A 2VKQA 1WHWA 4M9LA 1PBAA 1S0MA 4CLUA 2ZFHA 1FWKA 1UKUA 2H3EB 3NXZA 9ICPA 1GH8A 5A6WA 9ICOA 3MECB 4HUEA 2AIRB 5KT7A 2I8EA 2PZSA 2ZBRA 2OFHX 3QYPA 1TL3B 2UUBJ 1IBCB 3BKTA 2VBYA 3ICLA 2ZIVB 3DOLA 3CD6N 2BKOA 2Y0SD 5HP4A 2C28A 4DR2J 2XI2A 1YHQN 3THXA 1RBSA 4X4UA 4QZHA 1NDKA 1PYTA 3CC4N 3GQCA 3N6NA 1IN0A 4LF9J 4UB8U 4HI1A 4L72B 4HTJA 4V19X 4CFBA 1MDUB 3A8KA 2LQ5A 8ICPA 3EZWA 3NUQA 4Y2KA 3RSEB 1IKXB 2XLKA 3RBZA 1WSFA 4WQ5C 2OEMA 4AF1A 1ZQHA 3SCLE 4WWSA 1Q82T 1QS4A 3MDQA 2KRRA 4B1VA 4PWDB 1UP1A 4K4TA 4CH1A 3UVJB 5BR8J 3BQ2A 2Z7JA 2CVEA 4RNOA 2DQNB 1J5OB 3HJVA 1RU2A 5HK4A 3TR8A 1F0XA 5J1PA 1XIQA 4A46A 2Z1GA 1D5AA 1WCLA 2D9OA 4CM0A 3A8IA 3HILA 2KG1A 2G4BA 2WSFC 4MEXA 2KZZA 4WP9A 1E4GT 4XRHA 3TW0A 1IQTA 3L2VA 1S1XB 1GQEA 3GSIA 2ZTCA 3M1YA 3ID6A 2GUPA 2WTUA 4ID8A 1B9DA 4JKGB 1PK1B 2E2NA 3Q24A 1HNIA 2NRHA 3F5AA 2DWQA 3HVTB 1HWKA 1IIPA 2V7ZA 4DO9A 1Q16B 1KLMB 4DPOA 1HMVB 5HQLA 1IBLF 3T6JA 4ECRA 1TKXA 2QWRA 3BQTA 3NKYA 3MABA 1IV0A 2VG7A 4F4AA 1JLFA 1VQLS 3OTEA 4B1UB 2P5OA 1ZD4A 3HZGA 4BC3A 3FBFA 2CNLB 5L9XA 4I2BA 2D3OR 3FRYA 8ICXA 4XH1A 5LSLA 1RQLA 3D45A 3CD5A 1S1TB 1BQNB 5M1KA 1U4BA 3ZO7A 4ZN1A 4I68A 2FGOA 4RG8A 1H38A 2OEKA 2R7RA 1PYOB 4H5RA 2Q6BA 5DGAA 5C0YA 3PMLA 2F8EX 1JNZB 3G6YA 1RBOB 1RAHB 2B4JA 3CCRS 4KLOA 3JSBA 5ALIA 3KZXA 3FZKA 1VQ5S 5TZVA 3QINA 4BLGA 4I2EA 2I9GA 4UB2A 4H4MB 2DHGA 4I2QB 2IOFK 2MKIA 1KVJA 4JI2K 3L2QA 3ZD9A 3IR5B 4KLMA 3QUQA 2MJUA 1LFPA 2A42A 3FZLA 3PTWA 1JCEA 4Q2LA 2RU9A 5CABA 3U8XA 4KI6A 2RLTA 1N5TA 4BROA 3M6ZA 4B8AB 4PR6A 3N7RC 1FVQA 3ORYA 3SQGA 3OYIA 2EQYA 4XPEA 2C2DA 1C0UA 1E6YA 3BH6B 5I3PA 1ZQRA 2CPFA 3LDSA 4XH4A 4LRDA 4M45A 1CZAN 5KFIA 4I2IA 4W5TA 2CPYA 4FF1A 5FPNA 3FC9A 2GELA 4JV5K 2XQCA 1IG9A 1I39A 1ZQPA 1IWAA 1BMQB 4CJUA 2F7VA 2J9DE 1NGAA 2MUTB 3I96A 1TKTB 2Y1LB 1C1CB 4ECSA 5J2QB 1WJ9A 3S7RA 3R1HA 4Q2MA 2RUGA 3NG8A 1CXUA 4YOWA 7ICHA 4CD1A 4JI8J 1F2HA 2HWHA 1FRLA 1LK7A 4JI8K 1RWNB 2L08A 4RBUA 5B0GA 1UWBA 3AAPA 4UQGA 3HX9A 1WLJA 1RISA 4HUGA 2WOMB 4NMLA 5E26A 3A5LC 2K3IA 4EYHB 4ED7A 2HSEB 4JKCA 4HR2A 3SSSA 1VSLA 3MPYA 2VASA 4RNFA 2BQRA 2BE2B 3ZSWA 1MWYA 2A19A 3G82B 1JJCB 3K0SA 4JBCA 1RAGB 2MHEA 4B02A 4JI2F 2MLYA 2YI1A 4DV2K 5E0OA 4FZMA 2EHGA 2OPRB 1V97A 3QIOA 1P9QC 2O3DA 3TUZC 3HDSA 2HQGA 3PKMA 5KRTA 3NVWA 1N54B 5JMNA 2MKKA 3K5PA 1IXRA 2DRDA 3O8WA 8ICZA 2J0QD 3ZZZA 3VGKA 3MMCB 8ICTA 1T6DA 3EMTA 2XULA 5AHXA 2CYYA 4G9BA 3WU2U 2VJVA 2KFYA 2YHAA 1L5UA 1L3TA 1BDGA 4ZVHA 2JWLA 3ADAC 3AVCA 4NA2A 5SUHA 1GTHA 5AFUA 2Q31A 1S10A 4JV5F 1SQEA 3U3GA 1NJXA 4ECVA 2FB0A 2NREA 1MC8A 1KOHA 4QZVB 2E7WA 4OHVA 3OYKA 2XMJA 1M5KC 4CO1A 4N41A 2KHCA 2EAMA 2XB2D 3TNVA 1RAIB 2A6AA 1ZQMA 3JAMU 2QSFA 1X1PA 4FYYB 1RILA 2EBEA 4ILGB 4ZVFA 4JI8F 1Q8IA 3DXKA 1EETA 2EWSA 1M1KT 4KLUA 5L39A 5LY3A 1S9GB 4OZLA 4CZLA 3IS9A 5AQXA 4O9MA 1CJTB 3OYFA 1WC3A 3M1VB 3MM5B 3R5CA 4JOUA 2WB4A 4KY3A 3JXOA 2FD2A 4JI5K 3VQ8A 1ZQWA 3L3FX 2MQOA 1Z6RA 4R25A 5J8YC 2G1HA 3A5OC 4F7VA 3ITHA 3CFOA 2WZ1A 1VBYA 4OZ1A 1UA0A 2BJ8A 2KT3A 1PCAA 4DV7K 1Q53A 4DV2F 4KPYA 5IILA 3D2QA 4RT2A 4G6VB 4Z4IA 4KLGA 1R8PA 4M7YA 7FDRA 4E1MA 4CJKA 2IY5B 4F0HA 3HOSA 3DMJA 3O8MA 5KAIU 1UFKA 4QZBA 4M3YA 1IR0A 2YX7A 4O3PA 3VHQA 1NK0A 4B9VA 4M41A 1RPLA 4ED5A 4F5RA 3DDIA 1QE1A 2H51B 4X64K 2HZAA 3D68A 4KQZA 4TXSA 4PEOA 2JVRA 1R0CB 2E1YA 9ATCB 2AZ3A 1RTDB 1HD1A 2XTJP 2W2MP 5J1EA 3JSRA 3O5TB 2W04A 1VLOA 1XQIA 1N60A 3EDRB 3NS5A 2CKWA 2V94A 2L9NA 1HBOA 4ENOA 4NLDA 4FZZA 4ER8A 3R27A 1A0OB 2JEJA 1D8BA 4WU2A 4P2FA 3SQ2A 3GJRB 2KKVA 4A8MP 3L8BA 2LFVA 3M6GA 3ZT0A 1T9VA 1URJA 4U6PA 1RGIA 1L3UA 1VQYA 2HBMA 4QZFA 2BGWA 3RR7A 3VF6A 2DNQA 2IDLA 2G08A 3SPZA 2BBEA 2HMIB 1EKRA 3A0IX 2HNZB 1BL3A 3GFKB 3PW7A 4LD0A 4UZCA 2JFKA 1YBUA 2RQ4A 2B4VA 2BANB 3UN5A 4UF4A 4C7YA 1NK7A 4D3GA 1RGVA 4DF8A 1CBKA 2RSQA 1H7WA 4UASA 3T69A 4A5BA 1BLUA 3AODA 3D2NA 1XMBA 2XNRA 4JI5F 1FX2A 3D0HE 4XAKA 3V4IA 1WKKA 1MN7A 4X84A 4R66A 3RBXA 4ANDA 1XS9D 3SEIA 2EPIA 2YN4A 2W7PA 2G09A 3Q8RB 2ROGA 1VISA 3HULA 2P51A 2LHTA 3SQ0A 4DV7F 3MZIA 3M32A 2OSQA 4OO1J 1PVRA 3V1RA 1YRUA 4C0BA 5MLCV 5DQIA 3ENBA 1YIJS 4CHPA 4FO6A 4CLWA 3Q8SB 1B7YB 4X62K 1ZAWA 4KYZA 4YEAA 3TX0A 1KTVA 5HOOA 3PSTA 2IA6A 2X78A 3J7YP 2O66A 4YR0A 3CIZA 2PEBA 4X64F 4NCAA 3DRRA 1NMEB 3O9UA 3P8BB 3LDNA 3TADA 3H7HB 1OVQA 4JWMA 3M8PA 3KOOA 5AE1A 3I0SB 4RPFA 1DTTB 1Q3VA 3BGUA 4LF6J 3G10A 3I1YA 2LXIA 3L7PA 2ALYB 2V9KA 3TA1A 4IEIA 4K42A 2F9WA 4JAXA 2VQFJ 4I67A 3FZFA 5AQSA 3PYDA 2VQFK 4IYQA 5DDPC 4YCXA 3T19A 2LQBA 5BYSA 3W61A 4DV3K 4L6V3 3R6LB 4N47A 3SEOA 4J7CA 2HSTA 3TTCA