4F3OA

Dna polymerase i large fragment complex 5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
566
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTANMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
molecule tags Transferase/dna
source organism Geobacillus kaustophilus
publication title Structures of a High-fidelity DNA Polymerase
rcsb
total genus 198
structure length 566
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f3oA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f3oA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f3oA01
3PR4A 4QZ8A 1BL3A 3RWUA 1CXUA 4AHUA 1TVRA 4CEOA 3AO3A 3AVBA 5J0PA 1L3TA 4TUSA 5KT6A 4BDPA 2XY7A 4XA5A 2GUIA 3U3GA 3LWMA 1B43A 4KHUA 2ZQBA 3JPTA 2HHQA 1GOCA 3JPSA 4DTMA 3G0ZA 2HNDA 1YVUA 4JLHA 4KV8A 1RBRA 1XHXA 4DTRA 1YT3A 5KT4A 4NY8A 4O4GA 1HQUA 4KO0A 3MR3A 3M9OB 3O3FA 4QW8A 2ASDA 1FXXA 2AGOA 5KRSA 3MR5A 4I2CA 1LAVA 4HUEA 3H7IA 3HL8A 3V6KA 2AQ0A 4YNQA 1BPZA 3AO1A 2DPIA 4F4KA 8ICLA 4DEZA 4W5QA 1W9HA 3JPNA 4E7KA 3K5LA 4UB5A 4YQWA 4Q8EA 5DG8A 3NGDA 3QERA 3RB0A 1VSKA 3TAGA 2ISOA 7ICTA 3OGUA 1LWFA 5KFNA 3CYMA 2W9BA 5DQIA 4CF2A 5J2KA 4IR9A 5IILA 2RPIA 5JUMA 2G8UA 3K4GA 3SI8A 4RW7A 4OGEA 1S0MA 1HJPA 4J2BA 2C28A 4YFKA 4I2AA 5KG3A 4AHCA 2I9GA 5KFPA 3NF7A 1S9FA 3RH4A 1NOMA 4Q43A 4Z0UA 2G8IA 1JL1A 4IQVA 3ZSVA 4TUQA 9ICIA 2JZBB 3PUFA 5EWGA 1C6VA 4QWAA 4HYKA 4PHDA 4QZAA 2MUTB 2H5XA 2V4QA 3LP1A 1RT5A 4QZGA 4KLHA 1A77A 1COOA 1ZETA 4B9UA 4DS5A 4PY5A 4NLZA 1ZQWA 4CFDA 1RTIA 3C5GA 4FK0A 4CGDA 1T4GA 1IXRA 1D9FA 3ASMA 3KK3A 4Z6DA 4PGQA 5J2PA 3DI6A 2NRXA 3MGIA 3PW5A 3B0XA 2O4GA 5KFIA 3CFOA 4CJEA 4JWNA 1BQNA 4IQUA 1Y97A 3THVA 4PHEA 2QKBA 2BQ3A 4QWDA 4DF8A 3SPYA 8ICQA 2A1RA 4DOAA 3OHAA 3KKRA 3OYFA 1VSLA 4FZYA 3JPRA 4CEAA 1D9DA 1HYVA 1LW0A 5HP1A 1S77D 3KTQA 2G8KA 9ICLA 3B6OA 2KZ3A 3V1RA 2Z1JA 3NF8A 5KTQA 2XY5A 2KZZA 3MR6A 3AVAA 1J53A 4J9PA 4E7HA 4QZCA 2F1JA 1N5YA 1S6PA 4JWMA 2NRTA 3TAPA 2BCSA 1V9PA 2FLNA 5KGWA 3L2WA 2W9AA 4BWJA 4PGXA 1QLNA 2NUBA 3V6DA 4CIEA 1VK0A 4I2HA 3DMJA 8ICBA 4DTPA 1BGXT 3GV8B 3HXMA 4RQ7A 1KVBA 8ICWA 4RQ2A 3AVFA 3ZDEA 5J0TA 9ICXA 1RPLA 8ICYA 5J0XA 3KLHA 3OYDA 5KG4A 1EP4A 2KQ2A 4FLXA 5C24A 4M6WB 3AVMA 4ECVA 4CEEA 1D8YA 1EXQA 2OZSA 4CHQA 3ZDDA 3ISBA 3WNGA 1SUQA 3UXPA 7ICPA 4YG2A 4QCLA 4G3IA 2PI5A 5KFYA 4DL2A 4CFAA 4YR2A 3SV4A 4Z6FA 2P66A 4DL4A 4K4HA 2D0AA 2KN7A 2IAJA 3KHHA 5KGXA 1I3AA 4FJ7A 2YKMA 3ORYA 3CQ8A 3AA4A 4DQPA 2BPGA 3K58A 5TZVA 1C1BA 4O44A 4O9MA 5J2AA 4ED0A 4QWBA 3V1QA 4RUAA 3Q8MA 4TQSA 1WSJA 2ZTCA 5CP2A 4GC6A 4GW6A 1WSHA 1JXEA 2BE2A 3BJYA 1RBVA 1BCOA 4J2AA 4I2EA 1KSPA 3Q8PB 3I0RA 4PUOA 5BPCA 1ZQRA 4AHRA 1T05A 1LV5A 4EZ6A 4ED3A 2BKEA 3DLKA 1BPBA 5IIJA 3FFIA 1JLBA 5L1JA 2RKIA 2BQRA 3VQ6A 3GDXA 4K4IA 3B6PA 3V9ZA 4Y1CA 2VG6A 1NKEA 7ICSA 5FRNA 3VA3A 4CK2A 5IIIA 1ASUA 1UOCA 4UB1A 2C2RA 3BQ2A 1EXNA 2BCVA 3P5JA 5KT3A 4CJFA 3OYEA 2JLEA 1NKBA 1VRTA 1TV9A 1ZQBA 4OKEA 1VSHA 5J2MA 4CJKA 1LWCA 3PVXA 7ICVA 4RNMA 4J9NA 5DK5A 5HHIA 4C8OA 1S10A 3H4BA 5L1LA 4DSKA 3OS2A 5EOZA 1B22A 4C8LA 1TL3A 4CGFA 3C2KA 3QIPA 5F9NA 4LH4A 4O55A 3DLHA 3ZT0A 4MFBA 5CZ1A 3S3OA 5EWFA 4I28A 4DSFA 4M3RA 4UAZA 2B21A 4F5NA 2OPRA 1L5UA 2OPPA 1NK9A 1JMSA 5L9XA 4DTXA 1O1WA 8ICAA 5J2DA 4RG8A 3WNHA 5BOMA 3NBPA 4FJKA 2ASJA 2GBZA 4F4WA 3B0YA 4QZFA 4QOZB 3ETLA 4YR3A 1TKXA 1ZQLA 5DDMA 4IRCA 4LD0A 4B9LA 4ECSA 3SQ2A 8ICNA 1XHZA 4DTSA 2IA6A 2BPCA 4CJSA 4ECRA 4K4GA 4M3YA 8ICVA 2ETJA 4FJ8A 3ZT4A 5KFMA 3KIOA 1BI4A 4KB1A 1RZTA 2HMIA 2PFQA 3UQ2A 9ICTA 5CY4A 1H38A 4F3TA 1WSIA 4B3OA 4JV2A 1D5AA 3SPZA 8ICRA 2W9MA 2DFEA 3RJIA 4J2EA 4NLKA 3LWLA 5J29A 3ZSQA 3ZSYA 4OGCA 1NJYA 3N97B 4DQSA 1C7YA 2FPKA 2W9CB 3L2VA 4P4PA 5CZ2A 2ITGA 3C5FA 3OVNA 4KLIA 9ICMA 3DM2A 3JYTA 1UT5A 5DG9A 1ZQHA 4RW8A 4LY7A 2J6SA 3KLFA 1RBTA 7ICLA 1Q9XA 1N6QA 4IKFA 3OY9A 1TKTA 8ICEA 2KFNA 3MR2A 3TQ1A 3PW4A 3VQEA 2HVHA 4CEFA 5J2CA 2ATLA 3BGRA 4ZHRA 1U47A 4UBBA 1JLGA 5J0YA 8ICTA 4OJRA 1KRPA 4ED2A 5DLGA 2MUTA 5J2GA 4FW1A 4F93B 4ID5A 3Q8QB 4MFFA 3M8QA 2F1HA 4X5VA 4Z4HA 3K5NA 1IO2A 1S0VA 4IG0A 2YNIA 1ZQSA 3QZ7A 2OWOA 5DBCA 2Y1JA 2PI4A 2IS3A 4W5NA 3T5JA 4I29A 8ICCA 4FVMA 5IIKA 3V7LA 2VANA 3ALYA 2V4RA 4CESA 2FPLA 1MC8A 3M9MB 3E2EA 4DQRA 1DLOA 1A76A 5KFBA 4UAYA 2DFLA 1TVAA 4R63A 3DLGA 2ZE2A 2XGPA 4P4MA 3V7JA 4MF8A 1ZBIA 2P5GA 4N5SA 3QEIA 2UVRA 4O3SA 3C23A 2HHUA 2AGQA 1ZYQA 1ZQAA 2FMQA 4YR0A 4F5OA 2VA8A 1KLMA 1TV6A 7ICNA 2C22A 3RJHA 4Q44A 1IM4A 7ICJA 3MFIA 3CG7A 1TFRA 2PFNA 3RMBA 3BQ0A 1WSGA 3RR8A 8ICSA 3S9HA 1KDHA 4R64A 3F73A 1CLQA 2GWSA 3AUOA 9ICWA 4C8MA 4CIGA 4KLUA 1K1SA 1TAQA 1HPZA 2ZUDA 3PR5B 4PPXA 4CJ5A 2ZJ8A 1RT4A 4DU4A 3VN5A 9ICCA 3KJVA 2DTUA 2PZSA 4KI4A 4Z4GA 1BHLA 4CECA 3QIOA 2FBXA 3ZDBA 4H4OA 4F92B 4J9LA 2P6UA 3CM6A 4BXOB 5I3UA 4KHWA 3HPOA 3GQCA 3GIJA 3ISDA 3ZT1A 4DSLA 1WAFA 1KFDA 1KCFA 5KFAA 3GV7B 2XO7A 5DGBA 3TANA 3G10A 4NM1A 4J9QA 3V9SA 1F21A 8ICKA 2Z1HA 3AA2A 1BVSA 1XI1A 4M45A 2JZBA 3QEAZ 3RR7A 9ICRA 3RAXA 3NHGA 5DB7A 4C8KA 4XUSA 3T3FA 5DB8A 4QZIA 1ZQKA 3HW8A 3C95A 4IRDA 4YN4A 7ICFA 4E1NA 4CCHA 3VQCA 4CHNA 4KLMA 4RW6A 5J0OA 4FLTA 3H08A 2XCAA 3H8SA 4DQQA 2W42A 4DL3A 4GMJB 3MEGA 5DLFA 4JK1A 2YKNA 3K5MA 1JLEA 5J2EA 1BIZA 3OYIA 2P51A 4AH9A 1UT8A 5CJ7A 1IKYA 4NCGA 4EBEA 5IIMA 1TAUA 1BCMA 1ASWA 3RMDA 4PHAA 3RH6A 4I2DA 2F8SA 8ICJA 2FC0A 5HMLA 2HNZA 1X2IA 4Z4FA 3SQ0A 5KFDA 2FBYA 4KREA 1VSIA 4JS4A 3E01A 2WOMA 4FS2A 3SJJA 5J2IA 4DWIA 4EBDA 3VQAA 4QWEA 4E7JA 4F4YA 2ASLA 4Z6EA 1NK6A 3OS1A 4CJQA 3QEPA 4F2RA 2Q0ZX 1UAXA 1ZQIA 4F8RA 3ZSOA 3NGIA 5KFUA 4ECTA 1SL2A 3PX4A 3QEXA 5KFQA 5J0WA 3VQ9A 3Q8LA 1KVCA 3C21A 1N56A 3JPQA 3LP3A 4NCBA 5KT5A 3H40A 1CZ9A 4P4OA 1X1PA 2RN2A 1S1XA 3V72A 1RNHA 3NF6A 5J2HA 4I2JA 3VQ5A 2PY5A 4FJLA 3WNEA 4ED8A 5D3GA 4M9HA 4OKJA 4KLEA 4KFBA 2AQ4A 1YTAA 3I8DA 1T3NA 3EPGA 1TGOA 1LB2B 3NTUA 4DSJA 3LPUA 4GLXA 5K14A 5KT2A 1WN7A 3G6VA 3HT3A 4TSXA 3C6UA 4JS5A 2YHBA 3SQ4A 3BDPA 1RT7A 2BDPA 5KFRA 1BISA 5JS2A 1TKZA 2B5JA 3H8WA 4XRHA 1BI4B 5L1IA 3MFHA 4FJHA 4ZH4A 4OPJA 3PW0A 9ICAA 2BGGA 3RB4A 1JLQA 4BE0A 2XHBA 4N76A 3LALA 1HYZA 4BE2A 1Z3EB 3IS9A 2YNFA 3V81A 3TI0A 1CZBA 4N47A 1ZQMA 3OYJA 4DTOA 5KG1A 3AA5X 3EYZA 3M9NB 4K8ZA 3AA3A 2ZD1A 4CHZA 4IQWA 2R8HA 3QINA 5KFGA 3QNNA 1FKPA 3PNCA 1SKSA 3IHQB 3C6TA 4CJ3A 4CGGA 3VQ7A 1A5VA 3ZDAA 3AU2A 3QEWA 2I5JA 3UXOA 5KFJA 2KFZA 1KFTA 3RMAA 5SZTA 1UWBA 4YCXA 7ICRA 3RBEA 9ICGA 4KPYA 1X9SA 1QSYA 4KHNA 4R8UB 4CE9A 2JEJA 1DGSA 3MECA 4JV0A 3UQ0A 1HMVA 3RB3A 1RDCA 4B08A 1HQEA 2VA3A 3TFRA 3ZT2A 4KTQA 2HHWA 1X9WA 3IM1A 1SKWA 3TABA 4YMMA 9ICVA 4DFJA 4UAWA 4ED7A 2IMWP 1S76D 1J9AA 4GXKA 4BACA 1UA1A 3F9KA 3MXMA 4CGIA 4NYNA 4ECZA 2NRWA 3LP2A 1SZPA 4O5BA 3QO9A 4FBUA 4QWCA 3NFAA 4FLVA 4RPXA 1JLAA 3BQTA 3KD5E 3L3VA 4B9MA 2FPMA 3L2RA 3AU6A 4P2HA 4FJ9A 3LPTA 3AVIA 4HVJA 3MABA 3MDCA 4FM1A 1ZQOA 2B6AA 4Q45A 4KLDA 4M04A 4DLEA 2HHVA 1JL2A 2G8WA 4F2SA 1GOBA 2Z1GA 4CFCA 4UQGA 3AO5A 3HK2A 2EX3A 1ZQXA 4I27A 4CGHA 2IC3A 4Z6CA 2GV9A 4M9LA 5J0SA 5KG6A 1J54A 2UVVA 4KHYA 3L8BA 4QZEA 1CXQA 4KB0A 5J2BA 3C2MA 3JPOA 1IKVA 4FZZA 3RTVA 4M3UA 4EP4A 4RZRA 4RNOA 4HUGA 1GOAA 4QZHA 5KG5A 4KITB 9ICOA 3CFRA 3K5OA 1ZQQA 1NK4A 1S0NA 2X6NA 9ICNA 7ICUA 3HP9A 4DOBA 4KMUA 4DG1A 3RRHA 2X74A 3LP0A 3HP6A 4CJ4A 4B9NA 4FYDA 4FM0A 2DFFA 2E6MA 3L2QA 1K1QA 3ULDA 4B9VA 3V4IA 4E89A 4M9GA 2RDIA 7ICGA 4CJPA 4IFVA 3PW2A 3EWAA 4M0AA 1WLJA 3M8PA 4O0IA 1RXWA 1ZQJA 1U04A 5KFWA 2R8JA 1XC9A 4CGJA 1BQMA 4ED1A 1Z26A 1C1CA 2EHGA 5KFZA 1QE1A 2W8KA 4KLLA 4GVMA 3KLGA 3HYFA 1LAWA 1C0MA 3VA0A 4KTWA 5HNKA 4OVLA 4R5PA 1A5XA 4I2BA 4LZGA 1N48A 1RTJA 3NH1A 2O4IA 4CHYA 5DBAA 4FCYA 3O3GA 1VSJA 4CJTA 4DQIA 4K8XA 4YD2A 4RU9A 2V9WA 4YD1A 3C1YA 5KFEA 1JXBA 3DLBA 2BR0A 2OPQA 2G8VA 4EYHB 2MAXA 3T5KA 4IDKA 3QEBZ 8ICXA 1A5WA 4MQ3A 5HRRA 3V9UA 2DFHA 2VWKA 3IRXA 1NJZA 5CA7A 5HROA 4RQ3A 2IBKA 5HMMA 2E6LA 4DO9A 3T1AA 4YVZA 4DF4A 1XO1A 1CEZA 7ICHA 3NAEA 4O3NA 3SYZA 5C42A 3LK9A 3LAKA 3C2LA 3L3UA 4B8CA 4DU1A 2YV0X 4M47A 4N56A 2W8LA 3EPIA 2IGIA 4E3SA 3JSMA 2BHNA 1U4BA 3RRGA 4E7IA 2D0CA 4M9JA 1FK9A 4YMNA 4LH5A 4B9TA 2ZTEA 1ASVA 5HP4A 4W5RA 3P83D 4Z4EA 2ZTDA 3KHRA 2G8FA 4FLWA 3Q8RB 4CJVA 5KFHA 3KK2A 4DOCA 1Z00A 4KI6A 2NRZA 1S9EA 4QZBA 4QAGA 3V6HA 2KW4A 1SKRA 2Y1IA 1ZBFA 4GC7A 4ICLA 4J9SA 4RUCA 3M8SA 3O4NA 4MFAA 3KLEA 2FBVA 3ZSZA 3QNOA 3VQQA 4J2DA 1S1UA 3HX0A 1NJXA 4IG3A 4NCAA 4ZTJA 4UB2A 1JLFA 5DDYA 1JIHA 3G6XA 4RQ0A 2J6TA 5HBMA 1JLCA 4RQ4A 1QQCA 1HYSA 3AVLA 1Y88A 9ICJA 1S0OA 4CJUA 4AHTA 3HJFA 4F3OA 3OSPA 2PXIA 4KKOA 4EP5A 4I2QA 3SZ2A 4FJXA 2BQUA 2QK9A 4KAZA 3QLHA 2Z1IA 4CEDA 5HRPA 3K57A 1RYSA 2R8IA 3AV9A 2BPFA 5DMRA 2LSNA 3OYNA 4RW4A 4RQ5A 2HNYA 5IINA 3V1OA 7ICOA 2BCQA 3ISNC 4B9SA 3QESA 4ECWA 1BPXA 1UA0A 3K75D 8ICFA 5KFSA 5D49A 4J9KA 5DGAA 3NDKA 4E19A 2XCPA 4IRKA 3V9WA 3SCXA 1QS4A 3ISCA 3TAMA 1ZQFA 1C1AA 5DKWA 4DSEA 4F5PA 2HHSA 1KTQA 4DFPA 1QHTA 5FRMA 1S1TA 1ITGA 3D45A 1NOZA 3RB6A 4MF2A 3OYKA 4RQ8A 3U3YA 5KFVA 2WONA 1WSEA 2VG7A 4DTUA 4M2YA 8ICUA 3DOLA 4RQ1A 4FLYA 4LVSA 1ZBLA 4M3WA 3SQ1A 4CF1A 4DL6A 4DFKA 2BANA 4AHVA 3ZT3A 4FW2A 2FMPA 3LZJA 3T5LA 3Q8SB 4B8AB 3WNFA 3PY8A 3GV5B 4YXJA 3ITHA 3TWHA 3OYLA 3SUOA 1B9FA 5D46A 4CHPA 1SL1A 4ZTFA 8ICIA 4QZDA 3OHBA 4E0DA 4J9OA 3GFKB 4PA1A 1RBSA 2W9CA 4CERA 4R65A 1KVAA 4CK1A 1ZQVA 3IAYA 5J0UA 7ICQA 1CUKA 3AVGA 2M9NA 4DLGA 5KFOA 4NLGA 4MEXA 4Q8FA 3TAFA 8ICOA 2DPJA 3C94A 3I0SA 4I2FA 4KLOA 1RT3A 4OLAA 4H4MA 1EETA 1EKEA 1XSLA 4BDZA 3FYHA 2ISPA 5KRTA 1XSPA 3DRSA 1DTTA 4IQTA 4PWDA 3CFPA 1VSMA 4PHPA 3BQ1A 3NGZA 3A2FA 3Q8KA 1XU4A 4RQ6A 3RBDA 3RMCA 5F9LA 1PZNA 2JEGA 2A1JA 8ICHA 4M3TA 2R8KA 3QETA 3ZSWA 1IH7A 4O5EA 5C5JA 5DQGA 2DY4A 4HCBA 1U48A 3AO2A 1Q8IA 1XWLA 4GXJA 2ATQA 4OKKA 1MU2A 3ZSRA 3OS0A 5KFTA 3EZ5A 4KLFA 3VQDA 4R8UA 3K59A 3AVKA 5J2NA 1WCLA 4FLUA 2C2EA 1T8EA 1HUZA 1NK0A 4M9NA 1ZJNA 4YMOA 3RJFA 5DB9A 3SUPA 3LDAA 1RT1A 8ICGA 3NGYA 2C2DA 3L2UA 3VQBA 4I9QA 4QZ9A 4CJWA 4W5TA 2ZUCA 2RDJA 3OJSA 2YNGA 5HRSA 9ICEA 2JGUA 4F5RA 4FJ5A 2YNHA 3LAMA 4N41A 4CHOA 1B92A 1RT2A 2Q3SA 4HHTA 4KN7A 1TL1A 2FLLA 1U9LA 2F96A 3HM9A 3RJKA 3RJGA 1HRHA 4M42A 5CWRA 4O5CA 3U6FA 7ICKA 4PH5A 2R8GA 1ZQNA 4YP3A 3O4QA 3PMLA 3PX6A 5KFCA 4E7LA 3ZCMA 5J2JA 2X6SA 1DTQA 3UXNA 5KG0A 4FK2A 4KHQA 1S9GA 3EY1A 4HTUA 2R7YA 5KI6A 4ELUA 3NH0A 3O3HA 5HHHA 2XRIA 1JXLA 8ICMA 2AJQA 1RDAA 5FROA 2FMSA 4UB4A 1ZQZA 4O5KA 3GIIA 1KFSA 4YFUA 4AILC 3AO4A 1U45A 1B9DA 2D5RA 2JEFA 2UVWA 1NK5A 1ZQPA 4JV1A 2E4LA 5KFKA 1JN3A 4ECQA 1RILA 5KG7A 1FKOA 2I1QA 2OPSA 3OYHA 4RW9A 3MXIA 9ICHA 4E1MA 4KRFA 5BOLA 4F5QA 3LZIA 1WNSA 3V7KA 2HW3A 4FBTA 3KHLA 2B4JA 2PYLA 3S3MA 4HUFA 2YHAA 2PYJA 3MDAA 2F1IA 4M3ZA 4G1QA 1JX4A 3AVCA 3NF9A 3TAQA 1D8LA 9ICBA 3RJEA 1RXVA 4FS1A 4KHSA 4GXIA 2ALZA 3KLIA 4CK3A 4DTJA 1L3VA 1HUOA 4JRQA 3PV8A 3CM5A 1EX4A 3H8JA 3MEEA 3DLEA 4DFMA 1TKDA 3NH2A 5KFLA 2OA8A 3NCIA 3UPQA 4YXMA 3LANA 5IIOA 1IG9A 2P5OA 4EEYA 4FLZA 2IOCA 5KFFA 4NXZA 4RT2A 4TUPA 5J0QA 4O0JA 4FK4A 3OSNA 1TK5A 4NYFA 1NK8A 3TARA 1BPYA 2IDOA 4LSNA 5CYMA 3TAEA 4CF9A 2PFOA 4KLJA 3SUQA 3PO5A 4M6WA 4L8RB 4ELVA 4I7FA 3GIMA 4DL5A 2FBTA 2XY8A 4RNNA 1Z00B 3MBYA 3DOKA 1C0TA 4CF8A 4O3RA 3QZ8A 4FZXC 4C8NA 1XSNA 3HWTA 2UVUA 3IG1A 5FDLA 3RJJA 1G15A 3FDSA 1S1VA 4KN4A 4PGYA 5T7BA 3ZD9A 4I9LA 5I42A 1ZBUA 4RPYA 2RF2A 1ZQEA 3OYGA 5D4BA 2P1JA 1Q9YA 4KLQA 4W5OA 3JPPA 4Z4CA 2F8TA 1WSFA 4DS4A 1RT6A 4LSLA 1DOQA 5CB1A 4MEYA 4KTZA 4FO6A 9ICKA 5SWMA 1S5JA 2A1SA 1U49A 4EYIB 3RAQA 3HSTB 4NLNA 4J9MA 3ZDCA 1JKHA 9ICPA 4Q0BA 2HVIA 1VSDA 2W9BB 3D0PA 3KKSA 3DRRA 5C25A 4I2IA 1QSSA 3MXJA 3DYAA 1TK0A 1Z25A 3PO4A 2OZMA 4IFYA 1L3UA 1AROP 3KHGA 3OYBA 1J5OA 4DU3A 5EWEA 4OPKA 3TFSA 5JS1A 5KFXA 2ZJAA 3KD1E 4TURA 3PX0A 1T7PA 2KTQA 5HRNA 4O3QA 4CJRA 4TQRA 4M41A 1W0HA 1ZJMA 4FXDA 2BCRA 1NJWA 4M3XA 7ICEA 3LDSA 5KT7A 1HNVA 5EU7A 5KG2A 3DRPA 3KK1A 1ZQGA 4IBNA 5E41A 2G8HA 3VQ4A 2PFPA 1RYRA 4CEQA 2BCUA 5J2FA 7ICIA 3OYAA 2BGWA 3SV3A 3QE9Y 3MAQA 4ID1A 4RPZA 4FJNA 4Z4IA 3TR8A 4BXOA 3SNNA 4F50A 2XGQA 1REVA 1SV5A 4BWMA 3NE6A 3OYMA 1IKWA 2LYHA 5J0RA 5DB6A 4ECYA 3VQ8A 7ICMA 3HVTA 4WE1A 4CIFA 2FLPA 3SI6A 4EBCA 4JRPA 3AVNA 4PQUA 4ELTA 4F91B 4NM2A 2AU0A 2VA2A 4DMNA 4FJGA 8ICPA 1ZQTA 3G6YA 3MGHA 5DBBA 1RBUA 1ZBHA 3P1GA 4UBCA 4CFBA 1NKCA 3HO1A 5HLFA 4O3PA 2X78A 3VQPA 4IR1A 1RDBA 3K2PA 9ICQA 1NK7A 3PW7A 1LW2A 1ZQDA 3PMNA 3H4DA 1MSWD 2A1JB 1KLNA 4F4ZA 5L1KA 4FJJA 4DSIA 1RDDA 4R66A 3OJUA 4RT3A 4Q5VA 1RCHA 9ICSA 4KLSA 4KLGA 5CYQA 2IHNA 3QEVA 2IHMA 4LZDA 4CJLA 1IKXA 4FJMA 2HHTA 4JUZA 3OYCA 2XC9A 4HCCA 4XQ8A 2ZJ5A 3HVRA 4BGDA 1BPEA 2ZUBA 1QSLA 5DG7A 4OLBA 1KEJA 5J1EA 1R0AA 1K6YA 5J2QA 1RTDA 3RH5A 4DTNA 4FM2A 1MQ2A 9ICUA 4O3OA 4ECXA 3HPHA 4F4XA 4I2PA 4UB3A 1I39A 4BE1A 2AGPA 3V9XA 1ZQYA 1NOYA 3T19A 1C0UA 3T5HA 5CR0A 1S1WA 1WCNA 2XY6A 1ZQUA 4I2GA 8ICZA 3M8RA 4DL7A 4QW9A 3GILA 4ECUA 4AHSA 2OYQA 3AVHA 1L3SA 1VRUA 1TK8A 5DQHA 3AVJA 4CEBA 2VWJA 3MEDA 3ZSXA 1X9MA 1S6QA 2NRVA 3DLRA 2J6UA 1XS9D 4Y1DA 4BDYA 1RTHA 2VG5A 1YTUA 4MFCA 2D0BA 4CEZA 3SUNA 2HB5A 1HJRA 1T03A 1VSEA 1QTMA 2HHXA 1BIUA 2KZMA 4H8KA 1LWEA 2P6RA 9ICFA 4FJIA 2QKKA 3S3NA 1HNIA 5CHGA 2WTFA 1S97A 2JEIA 4CF0A 4J9RA 1WAJA 3V6JA 2QXFA 3UIQA 1MQ3A 3GIKA 3HPGA 3N4MB 4ED6A 4KLTA 1SL0A 3ZD8A 1VSFA 1ZQCA 3EW9A 4XIUA 1BPDA 4EZ9A 3C1ZA
chains in the Genus database with same CATH superfamily
2CQ2A 1P8ZA 4DXLA 4B9QA 4TUSA 1YJ9N 4DCJB 1CQNA 5KT6A 3FBEA 3NS1A 5ALUA 2J9EA 3Q0AA 4K5RA 3G82A 3U3GA 4UY8T 2ZQBA 3C6UB 2HHQA 4DTMA 1GXLA 2NRRA 5DRKA 1YVUA 1S1UB 3BY5A 3THYB 2YMLA 5AM2A 3F56A 1HQUA 1WUDA 5AI0A 2F8LA 1KBRA 2Z4PA 4QW8A 4AYBD 1T3QA 2AGOA 4CZCA 2F3JA 3HL8A 1JLAB 2AQ0A 2E1MC 1KLMB 2YWFA 3KJFB 4X65F 4OX7A 3AO1A 5LMUK 4LFBK 2DPIA 3T1HJ 1M5KC 2FI1A 3DXSX 4YDDB 5LXYA 1MWKA 4UB5A 4YQWA 3QERA 2F4FA 2P8IA 2VJUA 2EFQA 2DEJA 1N0UA 2CRLA 4DFDA 1NU4A 1ROFA 4CF2A 4DR7J 3OTDA 5IILA 1YRTA 4I67A 2G8UA 2QLFB 1R0CB 4DR3J 2DBBA 4OGEA 3KWGA 1RJJA 2J0SD 2GV1A 5KFPA 3NF7A 1PCAA 5I9EB 1NOMA 4Q43A 4Z0UA 1JL1A 4IQVA 2YQEA 5GADI 1ZZNA 3PUFA 5EWGA 1C6VA 5DM7Q 1RK8A 3MDFA 4HYKA 4PHDA 1JLGB 3CDUA 3CPWR 3WQTA 2V4QA 1RT5A 3NMAA 1OQ3A 1WDDA 1COOA 3VGTA 1HA1A 4N8NA 4CFDA 1EO1A 3BKFA 1N5QA 1RTIA 5IZHA 3CJBA 4M95A 4CGDA 1N33J 1YJVA 5L1MA 3KK3A 4Z6DA 5JU5A 3VGMA 2KH9A 2O4GA 5KFIA 4PL7A 3BF4A 3THVA 1CJTB 4PHEA 2QKBA 3CC7S 4DF8A 3SPYA 3CJCA 3ULHA 3AQPA 1H3DA 5AQSA 3IA0A 1RHJB 3KMQA 1LW0A 1AT1B 2AF6A 3CCJS 5E5NA 5HP1A 1SQGA 3KTQA 4XH5A 1XBWA 5KTQA 2IVMA 1X66A 4WIQA 2HEKA 4J9PA 2W2OP 2LEBA 4OJHA 3KZBA 2WF7A 4BRIA 2FLNA 1SC1B 3MCNA 3PFOA 3EL2A 3N7SC 4PGXA 4CLYA 3TU5A 2P9SB 4CIEA 1CJKB 3QDKA 3DMJA 1BGXT 4A8YA 3IS9B 4RQ7A 1G7CB 3C2PA 3I82A 1B7FA 5T14A 3OXGA 3AXMA 2C3YA 3O2IA 5LOQA 5J0XA 4A8SA 1QVGR 2NRHA 4XH1A 2I5HA 1VQOS 4M6WB 4CEEA 4UAUA 1D8YA 2Z56B 1GH8A 1OH6A 2OZSA 2KHVA 4CZKA 1H7WA 4LT6A 1Q82T 4YG2A 4ZN1A 4G3IA 1OXJA 3P38A 4YR2A 2CPRA 3SV4A 2CYYA 2J0QD 3ET6B 1KQKA 4DL4A 4ICAA 2IAJA 3KHHA 5KGXA 3BF3A 4FJ7A 1XMQJ 3W2WA 1RHUB 4DQPA 2HSTA 1TFYA 1C1BA 4O44A 5BYQA 1PG5B 3OD2A 4O9MA 1Y10A 3H0PA 1G1XA 4ED0A 1S72S 5AZJB 3Q8MA 4FYWB 4DX6A 3KYLA 4GKJJ 2JHEA 1CULB 4LSLB 3AD7C 3W2VA 1OIAA 4J2AA 3Q8PB 5BPCA 3VTIA 2ZWHA 4EEKA 4QS9A 1NU0A 3AY9A 3U27A 1LV5A 1RWXB 2G2OA 1FF2A 2HLUA 2RU9A 2RKIA 2QLJB 3D66A 3GDXA 4NCGB 3FEZA 1SJQA 4QIFA 2VG6A 1NKEA 2DHAA 1BQXA 2WFAA 4CK2A 2PFFB 2EI5A 4WFBL 5KNIA 3THWA 2H4WB 5D4OA 2DGTA 4KX5A 2V2VA 3BQ2A 2EC2A 1NHUA 2JSXA 2W2MP 1U26A 1T9UA 2ROEA 1VRTA 3TZXA 1CSJA 3Q24A 2UUBK 5CHIA 4NXNJ 2EH9A 2R9LA 1BHNA 2K06A 4ZVGA 2ZBCA 3WHIA 3PVXA 7ICVA 1VQKN 4C8OA 1S49A 4I6YA 2DRDA 3ILLA 4JKBA 3QWPA 3BBBA 1ULRA 1B0TA 2EWHA 1IBKK 3MGJA 1MWZA 1D09B 3BS5A 3PNIA 4WU3A 2B21A 2OPRA 4RKUC 4DV2K 2D9OA 4KGMA 2RT3A 4WCEL 1O1WA 3A5NC 4RG8A 2DHGA 2DO4A 3E3XA 3WNHA 3IG8A 2RMLA 4J8FA 3NBPA 1V3SA 2FHJA 3ILIA 4B3MK 4QZFA 2G09A 1T3OA 3ETLA 1BNPA 2F9WA 4CIOA 5DDMA 5AQLA 4IRCA 3SCLE 4B9LA 3SQ2A 1XHZA 8ICNA 2RRNA 1LEOA 3CJ3A 3A12A 2OIHA 1WOSA 4KB1A 2N7YA 2I6WA 2YKAA 1QE1B 2G5IB 1EQ0A 1K5OA 4F3TA 4B3OA 3R8EA 3PSTA 3FMBA 1NEEA 1D5AA 2P9UB 3SPZA 1ESVA 1YJNS 2W9MA 2YX1A 3ONNA 2A6AA 3ICXA 4I2PB 2HWIA 4B1VA 1EAYC 1U8SA 4RU2A 3ZSQA 3HHLD 3V81B 3ZSYA 1NJYA 3CMAS 5GAGP 5AICA 2FJVA 1C7YA 1V97A 3OR1A 4DHVA 4QOTA 1AYEA 2WMMA 5ALPA 3BKTA 4DOZA 4P4PA 3NWGA 5CZ2A 3DDKA 2O8DA 3B9JA 4LF6F 3AFGA 3NNHA 2Q1LA 4JD2B 3EXCX 1UT5A 1MMDA 4B17A 3KLFA 4OV6A 3WXIA 1HNWJ 7ICLA 4F02A 5G4DA 1N6QA 1IBLJ 2HNDB 2VF3A 2LA6A 2XB2D 2FY8A 4DV1J 2WW4A 2WONB 2K3KA 1FERA 4UBBA 8ICTA 2XYGB 1KRPA 4OJRA 4ED2A 5DLGA 2MUTA 5J2GA 2CJXB 2XBPA 4ZLJA 4FW1A 4ES2A 3Q8QB 4MFFA 2LLZA 3M8QA 1FRIA 5AFUA 4Z4HA 1S0VA 2ZUGA 4IG0A 3T9NA 5K8OA 1WACA 5HQ8A 1ZQSA 3L3FX 2PI4A 1GNKA 2GVDB 1C4CA 1V6HA 4FVMA 5IIKA 3M2RA 5HJXA 2ZJPL 2VHGA 2V4RA 2FPLA 2MXYA 4KFBB 3MEKA 1MC8A 3TUJC 2VODA 4DQRA 2HFSA 3OL8A 2YKNB 2DFLA 2KRBA 3OFEA 2CQHA 4P4MA 2OUGA 1MROB 2YY3A 1V4SA 4ALZA 3EDRB 2FXUA 3T1YJ 5AQFA 1FRHA 4HR2A 2FMQA 1SB3C 5U47A 4IFYB 4OI6A 2VA8A 2I1RA 2EFOA 2DKOB 5E0OA 5B8HA 2FSNA 4LF9K 1CJVA 3MFIA 3UD5A 3BGUA 4JOUA 2UV8A 1KN5A 3NOGA 1HNXF 1WTFA 3D67A 2BRLA 1CLQA 2GWSA 3IBWA 5AKKA 1UVLA 3UNGC 4FKXA 5E3CA 4K0KJ 1TAQA 5AQRA 1DQAA 3R5DA 1BD6A 1Z4OA 2CH5A 1ZD2P 2J7KA 4CNQA 3MCOA 2BW2A 4RW8B 4B3SJ 2DIVA 3KLFB 3OPKA 2Q3PA 1LXJA 3HHNB 3ZZPA 5KQDA 2DTUA 2PZSA 1COKA 2BEFA 4KI4A 5F8GA 1OH8A 1HD1A 2QEXS 4J9LA 2P6UA 1IV0A 3CM6A 4OJOA 1YKWA 1M1KO 4KHWA 1S1TB 4FXVA 4CZIA 1KFDA 5KFAA 3NVZA 1HQ2A 3TA0A 2MA1A 2XO7A 3G10A 2PN6A 4J9QA 4B3RK 2Z1HA 8ICKA 3QAEA 3MN7A 4LFCK 3BZKA 2JZBA 1RQNA 4A5AA 3RR7A 1QZ6A 4OLPA 3RAXA 3RW7A 1M5HA 3I56N 4C8KA 2GVDA 4IRDA 7ICFA 4OI4A 2ITMA 4F0HA 1FX2A 4Z2XA 3B54A 3OBIA 3DJCA 3VGVA 4DL3A 4GMJB 1GO3F 1OS5A 4JK1A 3IMQJ 2ZEJA 1JLEA 4KRWA 3W65A 4GMKA 4P9SA 3OYIA 3OV7A 4CZEA 2OMOA 5AKHA 4IDKB 4EBEA 2XSFA 4OZ0A 1YWXA 5CD4H 4PHAA 3RH6A 4I2DA 2FC0A 3VAJA 5HMLA 2DNYA 4Z4FA 4ACOA 1SQKA 2DNKA 3KZXA 2WOMA 1ZAVA 1ED1A 4WJ3B 1PAEX 3O4WA 2Z7JA 4QWEA 1I6JA 4UAVA 4WXOA 4CNZA 2UXCF 2ZIUB 1RU1A 1ZTWA 2NREA 4J37A 2EK1A 2KRRA 4F2RA 5CYQB 3H5YA 2Y0SF 3QEPA 5CHCB 1ZQIA 5B08A 3NGIA 3PX4A 3I5CA 3SXLA 3L7PA 1LWCB 3QYPA 2RRBA 5TISU 5JMNA 3BBCA 3Q8LA 1IR2A 3CNHA 1KVCA 1HKCA 1IG8A 5AQOA 3LP3A 4ED4A 4NLTA 1ELOA 1QJHA 4JI8F 4ZOSA 1RNHA 5A76A 5J2HA 3UVJA 4FJLA 5J2NB 5A8RB 1OYEA 2KXNB 1Q0NA 3I9ZA 5A6WA 4O4RA 4M9HA 5LMNJ 4LFAF 4KFBA 2GH1A 2CZVC 2HK3A 1CBKA 2EAMA 2E2PA 4PAAA 1TGOA 3ENHA 2EDUA 4RLEA 5K14A 3M3ZA 2J0XA 3KKFA 3G6VA 2ILYA 4L72B 3THPA 3BDPA 1RT7A 1E4GT 4WFXA 1NMNA 4M5JA 1RLCL 1VS3A 1U6BA 4XRHA 4AXJA 2IM0A 4JEPA 2CWKA 1TMMA 1J5EJ 3MFHA 2VFSA 3E51A 3W2WB 3PW0A 3U9ZA 9ICAA 2ZM6J 4A62A 3RB4A 1IUJA 2O3DA 2ZKUA 4BE0A 1F2HA 3UDLA 4YN3B 2XLKA 5D6GA 4R5PB 3IS9A 2CFXA 3IN5A 3TI0A 2D8CA 1HPZB 3CCVN 3WQUA 1ZQMA 3OYJA 3AA5X 3JSBA 4L6V3 4WK3A 1DURA 3PJWA 3DU5A 5F0XA 2ZE2B 2EAPA 2R8HA 2V4JB 2QWMA 5ALRA 1HI1A 2F9TA 3VENA 4LREA 3ZDAA 3VAIA 4CZJA 2IYIA 4RBUA 3QEWA 1IWGA 1DQ8A 2P9NA 1KFTA 5AJ3J 1FJGF 3LTOA 2KOBA 1WSVA 4PL8A 1NNEA 1RAJA 2CADA 5ETSA 1RXOB 4CO5A 1QSYA 2L08A 2JEJA 4X4RA 1HARA 3MECA 4JV0A 4YOTA 3RB3A 3BS7A 4ZA1A 4B08A 3TFRA 5DO2A 4KTQA 1W2IA 3N4WA 5FPDA 4RO0A 1SKWA 2EZXA 4O44B 3AB4B 4UAWA 2IMWP 3CC2S 3T79A 3D2QA 4BRLA 5AQUA 1J9AA 2GJFA 2GJ2A 2ZIXA 2HFNA 3D2NA 4USAA 2EKYA 3QAUA 1RWOB 4CDGA 1HW8A 2NRWA 1SZPA 4USWA 2KO1A 1NDCA 4FLVA 1J97A 3KD5E 3L3VA 2KHDA 2Q79A 1KTVA 3W1YC 4LF5K 3M30B 2OPRB 3C3LA 5GIPA 2ZF5O 2G9OA 3QUTA 4FJ9A 1FDAA 3J81Y 3MABA 1XNQK 4IXCA 1ZQOA 1JJHA 1F60B 1VQNS 2OHDA 4Q45A 3WKCA 2JX2A 1EKRA 4QJFB 1IBCB 2Z1GA 4J9UE 5L46A 4Y2PA 2IDEA 1KEKA 3VF0B 1GMWD 2ZH2A 3BGFA 4FKYA 2G5HB 2ILZA 5B0EA 2LKYA 4Z6CA 2GV9A 5M2RA 3CC2N 3AJ2A 2K7KA 4M9LA 4JI2J 4TU9A 4JI7K 3M1VB 4OZ2A 3R7SB 3MWBA 3QGHA 2G1DA 3CJAA 2GMHA 3HSGA 3MM7B 3R27A 2DNQA 4F36A 4KB0A 2V63A 2OEHA 1IKVA 4B3RF 4FZZA 2WB1D 1DBDA 3H98A 4EP4A 1HHTP 4RZRA 3GYGA 3CJ7A 3K9KA 1GOAA 5KG5A 1NPPA 2FVPA 2UXDF 1ZQQA 4DOBA 4JI5F 3U02A 1NNDA 1BUPA 4BR2A 3ELHA 2X74A 9ATCB 1RDRA 4FYDA 3OT9A 4FM0A 1BE4A 4MHVA 3FSXA 4AQYK 3FZFA 3GJRB 2DFFA 2E6MA 3NRWA 2PA8D 1U1QA 4B9VA 2DH7A 3V4IA 2Q0RA 3I96A 4M9GA 2VJ4A 4IFVA 3N9UC 4LF8K 3JQKA 3M8PA 1U04A 5KFWA 2R8JA 4OD0A 2YTUA 1LWXA 3PFEA 3FLCO 4WQ5C 3ZZZA 2ZDPA 2MRLA 4OZ3A 4B3TJ 3GJQB 3H3OB 5BPMA 2R7QA 3FBBA 3VGKA 2MYFA 4JKFA 1IIPA 2AJ1A 2OI2A 2A3VA 4OJ1A 3PEJA 5JVHQ 1F0XA 2JWLA 2CXEA 5T7LB 4US8A 2QWLA 4OVLA 2E5LF 5EE3A 4R5PA 2W04A 3CCRS 1A5XA 1UJ4A 2CUYA 2ZH7A 2N3OA 5DBAA 3A13A 3O3GA 4DQIA 2CG8A 4P2SA 4YD2A 4RU9A 3C1YA 2HVEA 2NZCA 2O8DB 2XZDB 3DLBA 2BR0A 1IBKF 2MAXA 2Y0BB 3QEBZ 2QB1A 2NO5A 5HRRA 2Y0SD 1PC5A 2D0OA 3IRXA 5CA7A 5J1NA 2JC0A 3EKUA 3J7YP 3I4HX 3D68A 3TADC 2V8PA 2Z58B 2ASOA 2JH3A 3TJ9A 5LJ3Y 1CZAN 2WB1C 1BG3A 4B8CA 4OJLA 4DU1A 4R0JA 2IGIA 4E7IA 3RRGA 2Q1NA 5LJVA 2Y8WA 1YG0A 3QFWA 4JI1K 3D0IE 3LW5C 3P83D 1VHIA 2G8FA 2QLWA 4FLWA 4CJVA 4J91A 2DCLA 4DOCA 4CWBA 3RUBL 4KI6A 2NRZA 4CLSA 1RB0A 2LEPA 3P4IA 5E3RA 3MM8B 4ZVOB 4QAGA 2F3NA 3V6HA 5F8LA 4JK8A 1SKRA 2Y1IA 4GC7A 3W7BA 4RBTA 2XMWA 4L74A 2XM3A 2OFHX 4FF1A 3KLEA 3ZSZA 1FRMA 2UP1A 4IG3A 1HR0F 1OMSA 4UB2A 2QFJA 5DDYA 2HBRB 4RQ0A 1HIWA 2J6TA 4FWPA 1JLCA 3IP0A 1GX6A 5FD1A 4WYLA 2MGZA 1Z2ZA 3K89A 2ZWOA 4CJUA 3HJFA 4Y2YA 3FK4A 4I2QA 4DR3K 5JJBA 3QU9A 2BQUA 4PKDB 3NNAA 2VDHA 4KAZA 2Z1IA 2GHWA 4FZVA 1RYSA 2PC6A 2BPFA 5DMRA 3QT8A 2LSNA 3OYNA 2ZBQA 4CTAB 1QY7A 1HNZK 4KY3A 1UA0A 2QGFB 1XO0A 5KFSA 5DZ6A 5D49A 3VF2A 2XCPA 4IRKA 5C25B 2GHVC 3K0SA 5CQGA 2BJ9A 3TKAA 4DSEA 4F5PA 4DFPA 3IBFB 1Q53A 1W7AA 5FRMA 2E1YA 2FYXA 4X66J 1ITGA 3D45A 1NOZA 3VAMA 1H1VA 4MF2A 4ES1A 3OYKA 3L7OA 1NRKA 3WUHA 2B0CA 1HUXA 5KFVA 3EEQA 3RF9A 1WSEA 4DTUA 4JI8K 1JI7A 3GIRA 3UVJB 4X62K 4FLYA 4LVSA 4URQU 2VQFK 4IFEA 2I38A 4YOYA 4ZP7A 4DL6A 4DFKA 2BANA 3JTOA 2VD3A 2DBYA 1IBMJ 2RHKA 1WOPA 4FW2A 3ZT3A 2FTRA 3LZJA 4TU7A 3OW2R 4JP8A 3T5LA 4B8AB 1MN8A 3GV5B 4C8ZA 2P2CB 4TY9A 3QGGA 3SCKE 5D46A 2ALYB 1FE0A 4CHPA 3QJJA 1RKIA 3T9ZA 3OHBA 4J9OA 2C2NA 3PIOQ 1RBSA 2W9CA 4ZJOA 2F8HA 4CERA 4R65A 1KVAA 1KD1O 1ZQVA 4QIVA 7ICQA 4PXCA 4NLGA 1EJ7L 1U2VB 2V52B 4MEXA 4Q8FA 4X2BA 2DPJA 2D3DA 3I0SA 2DUYA 1Q18A 1EKEA 4V1Ak 3DHWC 5EGYA 3GL1A 3P96A 2W54A 3I32A 4I0WA 4IQTA 2CQIA 2A19A 2ROGA 4PHPA 3BQ1A 4ATNA 3MOZA 1VC5A 2XG8A 1XU4A 4LC9B 4RQ6A 4DN0A 3RBDA 1TAMA 3ZYYX 1FFGB 3BUZB 5F9LA 4FYVB 4FDFA 5C10A 1YGYA 4K4WA 3QETA 3ZSWA 3M2VB 3UN5A 2O1PA 3F53A 4TXSA 5ETTA 3UE5A 2ZM6F 1U48A 1TU0B 2WF6A 1Q8IA 2W7OA 2B8PA 2QSFA 4IO9Q 3GONA 1Z05A 3OS0A 4KLFA 1NDPA 5IS2A 4YUDA 2V94A 4DZDA 5HVHA 1ZM9A 4O4GB 1HUZA 3MWPA 4P0PA 4AQYJ 2RIJA 4YMOA 5DB9A 1PYTA 1U1RA 3GYXB 4OJ3A 3SBTA 1RI7A 2C2DA 4OHWA 2Q31A 3VQBA 1HQUB 4QZ9A 2YWHA 2ZUCA 1SI9A 2YNGA 1EARA 1SB6A 4QYRA 4Y2UA 5HRSA 3G6EN 2BJEA 5A6PA 2XZTB 1L6NA 1RAOA 2RHFA 3LDOA 4ISEA 2QL5B 1B92A 4HEA9 4KN7A 2PIIA 3A5MC 3QLHB 3GSIA 5K9FA 2YH1A 2UUBF 2JWKA 1KKHA 2VQEF 1TL4A 3ZXWA 5ETQA 1RAFB 3K0JA 3C6HA 2VFVA 4PYAA 1NBEB 2O8CB 4KC5A 3ZCMA 3UXNA 2W25A 4FK2A 2YWWA 1NXIA 4NA1A 4Y65A 2DGQA 3FFKB 5JLHA 1KQGB 2MKYA 5AFUH 2AJQA 1RDAA 2E20A 2WVEA 2FMSA 3NRBA 4ZPTR 4DUYF 5DS7A 4O5KA 3GIIA 1VK3A 4LBIA 4DV5J 2IVNA 4QIWF 4YFUA 1HNIB 5K14B 1FHTA 2LKZA 4AILC 2LHTA 1DQ9A 2D5RA 2E2OA 4X64K 1NK5A 1ZPWX 3FVYA 3DOLB 1X8DA 1ZD5A 2QA4N 1K73O 5KG7A 2OPSA 1HNWF 1Z2LA 4RW9A 3QMQA 4Q7AA 4P72A 1UETA 4E1MA 4KRFA 3E8OA 3UKUB 1S1XB 1IKVB 2UUAK 1FE4A 2DCUB 2GIRA 4JI2F 1HKGA 4BVOA 4FBTA 3D6FB 2B4JA 1JLBB 4HUFA 3LOUA 1AQ6A 3DN9A 2LQ8A 1MG7A 1M5OC 3MDAA 5H2FU 1UP1A 3WXJA 4G1QA 3M8YA 1LKZA 2AH5A 4C9DA 2O8EB 3NMRA 1KN6A 2L9DA 1TUUA 4F25A 4FS1A 4U95A 4KHSA 1SQEA 2W6LA 4DR4F 4DTJA 1HBUA 1L3VA 3SENA 1FWPA 4JRQA 3A5LC 1Q7LB 4NB4A 4NLSA 4DR5F 4FXWA 3TYTA 5AR0A 3ZEUA 1DFDA 2F8EX 3LPYA 3MEEA 2CKWA 2GQ2A 2XZWA 2J8AA 1RCXB 1JWWA 5AK3A 5GTHU 4FLZA 2V2QA 2IOCA 4QNLA 4NXZA 3U26A 1GK8A 2WBNA 3P31A 4RT2A 4TUPA 1W2BR 4OZLA 4PWWA 1HBNB 3IR7B 4NYFA 1RWWB 1NK8A 1S7IA 2JOQA 1S6OA 3TARA 1BPYA 1R6YA 2ZIXB 3MR7A 2RS8A 3MM7A 4WXWA 1EP4B 1VQ5N 4WP9A 3FZ2A 3P5BP 4M6WA 3QJLA 2CJQA 4ELVA 3AD8C 3E1YA 2FBTA 2LQJA 1RU2A 1OUQA 1WC4A 3GFXA 2VQEJ 2V34A 2LA4A 1XSNA 3HWTA 3D7SB 3CP8A 2UVUA 3HCXA 2DNNA 3RJJA 4Y00A 2MQ8A 1G15A 3SCJE 2XLIA 3OL6A 1G99A 4QQBA 5ALJA 1XMOK 1RWKB 4I9LA 5T7BA 2HHPA 3OYGA 3B6BA 1KQQA 3W9IA 1GTHA 2P1JA 2B5JB 4DV0F 3LDQA 1S57A 4AP9A 1SBRA 4Z4CA 3CW2C 1NZBA 4QU6A 4WQ5A 3EXYA 5SWMA 2ZJRQ 2WSFC 1VQ4S 2A1SA 2CPJA 4FWMA 4EYIB 3RAQA 4J9MA 1N2XA 4L73A 3SDEB 4IG3B 2IRUA 2E9RX 3KZIU 1HWUA 2W9BB 3KKSA 5BPNA 2FVRA 2DY9A 2VG6B 1QSSA 3MXJA 5AQYA 4JNEA 1HBUB 2X1FA 1RDFA 4LR7A 2E2NA 3PYGA 2OZMA 3KKAC 3TJ8A 1AROP 3KHGA 2CRXA 5KFXA 2ZJAA 3MC1A 3M6XA 1P1TA 3SSSA 2HOEA 1YI2S 4KX3A 2LFVA 3HFKA 2FJ6A 2ZZTA 4O3QA 4OYOA 4CJRA 5HRNA 1Y5IB 1RHQB 3QBXA 2ASYA 2MQLA 2W4PA 5EXWA 4M3XA 1HWLA 4ANEA 2UU9K 5B09A 1M90T 4PQAA 4USIA 3CPEA 1HIYA 2PEHA 3DRPA 2VIXA 2G8HA 4I64A 4P7VA 3CMEN 1FDNA 3M8QB 2PMZD 4CEQA 7ICIA 3TSPA 1V4TA 3VZHA 4NL9C 1VQ7S 4JD2A 1S3XA 3QMLA 3QE9Y 8RUCA 3P49B 3HF5A 4FJNA 4CD3A 3PZPA 4Z4IA 2MZQA 5ALWA 3NVVA 4URGA 4DG1B 2DNPA 2HAIA 3KLEB 2LM4A 1RT1B 4ED5A 5FP0A 5ALIA 2E1PA 1TUYA 3C6AA 3GE1A 3AMZA 7ICMA 4Y3CA 3HVTA 4WE1A 1Y5LB 2OLWA 2FLPA 2QARA 1N88A 4IO8A 1RHKB 4JRPA 1N63A 3G8SA 3G71N 2BANB 3R9PA 4PQUA 4ELTA 5ADXH 4F91B 1XC3A 3IDWA 3VGSA 1N8RO 3MM6A 1N5YB 1PVRA 1YQHA 2YNHB 4YY3K 5DBBA 3AN1A 3IG5A 1NGIA 1XNQF 1NCLA 3HO1A 3H5UA 4X64F 2A2CA 3CULA 3HDSA 3CD6S 4IR1A 5FLXU 3FUYA 4IOCQ 2J9DA 1LW2A 3MMJA 1ZQDA 1MSWD 3J81U 4WKRA 1R0BG 3OJUA 4EX6A 3GMGA 4Q5VA 9ICSA 1ZQ1C 4UW2A 4C11B 2IHNA 3QEVA 2AHOB 1IKXA 3Q8UA 3VAGA 4BVPA 2XC9A 2ADBA 4M5LA 3HVRA 2YPZA 2RQ4A 2OANA 3MM5A 4Y2MA 1KEJA 3TOQA 1VRQC 5J1EA 4GV9A 4KV8B 5AJ3F 3MCSA 2B51A 4F4XA 2PFUA 4UB3A 3K8WA 3QB0A 4WP8A 1I39A 4BE1A 2AGPA 2BKPA 2RJZA 3V9XA 4DR5K 4CI0B 2I7PA 2XWXA 4MK9A 4DR3F 2NZ4A 3T41A 3R6LB 3VWSA 3R3LA 2JH1A 2XY6A 4JAXA 1OKJA 1ZQUA 8ICZA 3M8RA 4DL7A 3GILA 4AHSA 2DGVA 5RUBA 3AVHA 3QJPA 4DCHA 4MLHA 4LF6J 1KAXA 1F9FA 1RQLA 5D4PA 4BR4A 2GCFA 4M8LA 5ALTA 3E01B 3D5MA 5HL7L 1X9MA 5CR4A 4IKAA 2PO4A 4BDYA 4OX8A 3QWUA 2FVCA 2BYCA 4G65A 4I1TA 4FOIA 2W55A 3SAHA 2E1ZA 3CI5A 5AT1B 1YRXA 3O9TA 3DLEB 3SQOP 3VEXA 1UAWA 2P6RA 4WFBQ 2FPHX 5C42B 2HGMA 4LSNB 1JXVA 1S4EA 3QGPA 1HNIA 4C3MA 1WAJA 3W8GA 3M2VA 2M7SA 3V6JA 2QXFA 3UIQA 4UARA 4K59A 4ED6A 1YSJA 4PHTX 3FZLA 3UO0A 3AQOA 2BACA 3DOKB 2XYPB 3EW9A 4C0ZA 4FZNA 1KQFB 4M5NA 4EZ9A 3C1ZA 3UKUA 4QZ8A 2CQCA 1CXUA 4DN9A 1UFWA 1QTNB 5IOLA 3ZTRA 2MSTA 3AO3A 5C2FA 1O6XA 4ZJLA 3G8TA 4C1NK 3NNCA 2F7VA 4BDPA 4EMDA 4XA5A 4IS7A 4EO6A 4M63C 4K0KK 1B43A 3IM9A 3MN5A 3KLIB 5BREA 3FM9A 7FDRA 5AQVA 3UPFA 1X4CA 1CC7A 4KV8A 4JLHA 2QTDA 4DV4K 2BZ2A 2OPSB 1YT3A 5KT4A 2MKKA 4NY8A 3JTNA 2CJKA 4O4GA 4FVUA 1R31A 5F8NA 5AIAA 4MDAA 1FWLA 1RWVB 3JSYA 3MAAA 2I9SA 2HMIB 1SIZA 1RHRB 3G2XA 2DR8A 2F76X 1SS6A 5AZJA 4I2CA 3IMXA 2WVCA 2ZC3A 4HUEA 2LMRA 3POTA 3H7IA 1S8OA 4AYBC 1CULA 3SD7A 2WTUA 3KWMA 1VQPS 4F4KA 8ICLA 2QA1A 1HWKA 1W9HA 4LMZA 3IWNC 4OV1A 1CG2A 5DG8A 1EZZB 3QFUA 3RB0A 2Z8QA 1VSKA 3G71S 5IV3A 2FUG9 1KVIA 1APSA 2NSCA 3MTKA 5KFNA 2OEMA 4NLUA 3KG4A 1UJ5A 4OX9J 3K4GA 3ZEUB 3J8AA 4WQ4C 3SI8A 5DJBA 2XLJA 3LQVA 1S0MA 4ES3A 2D4WA 2HFOA 3AAWB 2XHCA 1TKTB 4ISFA 1S9GB 2B4PA 5GADU 5G0RA 2G8IA 1SWWA 3B4DA 3CIPA 9ICIA 2JZBB 3UCUP 4IOXA 3MEEB 1VQ8S 2XWYA 4FYXB 2K7JA 4DPTA 1ZETA 1Y7PA 4LF8F 5AM4A 4DS5A 4NLZA 2W2NP 1ZQWA 1IM6A 5HATA 5G5GA 4G6VB 3QU4A 2F8MA 4FK0A 3RGIA 3FGUA 3EUB2 3Q7CA 1IXRA 3ASMA 1C0TB 3MCPA 2VPXB 2L9NA 2FC8A 2P9IB 2V50A 2BE2B 4BREA 3ENVA 4BCAA 2P6SA 2NRXA 1YZ7A 4RUBA 1YK9A 4G9BA 2EG2A 1NPRA 4ZVSB 5B0BA 5TKYA 2XULA 4CJEA 2LQ9A 1UVIA 1I1GA 4IQUA 5AKLA 2BQ3A 1KD1T 2JFDA 2V5HG 4RWWA 2A1RA 4HVZA 4FZYA 5ETNA 2O6KA 1XR5A 2VPYB 3H0RB 3PSIA 3A8IA 1D9DA 1CQMA 2VICA 1S77D 1IJEB 2Z1JA 4K4YA 2XY5A 2KZZA 1J27A 1VQ8N 4LSZB 3VOVA 1XJWB 4E7HA 3PRVA 1S6PA 1UCNA 2NRTA 3TAPA 4F3QA 1X60A 5KGWA 2YX4A 2NUBA 3V6DA 1YJNN 2HGNA 1UTAA 2OH2A 4I2HA 3HXMA 1KVBA 4OZ1A 8ICWA 3TUZC 3AVFA 3ZDEA 4OI0A 3DRPB 5J0TA 2DGSA 5MAOA 8ICYA 2VDIA 5H1SV 1EP4A 4FPRA 4FLXA 5C24A 1CI4A 4LJMA 2EQYA 3VVTA 3JS9A 3FSYA 1UHUA 2BUPA 1NI3A 1F5SA 3HTVA 3N4PA 2A6OA 3BP8A 3WT0A 3UXPA 3IM8A 3QGIA 4YOVA 5AIBA 3D6MB 3TA1A 4IFVB 4DL2A 2NUUG 5AQZA 4CFAA 1TE2A 5HVFA 2P66A 1HW9A 4DCOB 5HR6A 5HANA 2OJ3A 3CQ8A 4ZK7M 2QC3A 1R27B 3VEWA 3K58A 4Y2CA 5BN9A 1HX1A 1VQLS 2I6XA 4G9ZA 1WSJA 2ZTCA 2Q97A 2P9CA 5CP2A 5ALNA 2D3OR 3BR9A 1S9EB 2QLXA 2BE2A 3TO8A 1ZD3A 4QJVA 2AIRB 3I0RA 4PUOA 1WEYA 2GHPA 4AHRA 1T05A 2CPFA 2KXHA 1C0FA 1H72C 2V4JA 2ZIVB 4R25A 3OTQA 4EX7A 2BQRA 3VQ6A 1IKYB 3CCQS 1Y11A 4OYMA 1U0SA 3CDAA 5A0YB 1UQVA 2P9EA 2EG1A 1FCAA 3THTA 2C2RA 3BB5A 2G0AA 4F0KA 3P5JA 3R5AA 4FPAA 4HH1A 2YXLA 3CDBA 4ZCIA 2JLEA 3DU6A 1HNZF 1WOOA 3N5BA 3JSRA 4K8RA 2HBQB 2KM8B 2HOIA 3AA8A 2UUCK 4UB6U 4QPTA 4XH4A 3G4SN 1PILA 1QHAA 3M6KA 4RNMA 2CWXA 5HHIA 2X1AA 3AB2B 1S10A 3WKAA 3VEOA 5L1LA 2MJNA 3WKDA 1CC8A 4NYZA 3OS2A 5EOZA 1TL3A 3ZETB 5ETKA 3CD5A 4LH4A 4YMEA 3DLHA 4H5NA 3ZT0A 4BGAA 2KVSA 5EWFA 3ZNJ1 4C7QA 5C2GA 1CPZA 4NJ8A 5EOYA 5B66U 4DSFA 1FRLA 2QL7B 4FPBA 3IRXB 4M3RA 3TTDA 2IOHA 2P9IA 4IG0B 1L5UA 5EY4A 5L9XA 4NO7A 2UXCK 4LRAA 4FJKA 1JLEB 4PJ0U 2FZKB 4F4WA 4QOZB 2BV3A 4LF5F 1TKXA 1ZQLA 4DR2K 1N5WA 3GZFA 2NUHA 2BPCA 3RYLA 4K4GA 4M3YA 8ICVA 2ETJA 4FJ8A 5KFMA 1E6YB 2AEMA 5M1PA 3CRXA 3UQ2A 1XTZA 3O9UA 2ZIUA 1N34K 3E9OA 5JRTA 1RABB 1VQON 1WSIA 5GAGI 4CYUB 4Y2XA 8ICRA 2YJEA 4EENA 5AKJA 2M8HA 5JLFA 5D0GA 4JI5J 2HHHK 4J2EA 5B0GA 4HHUA 1AW0A 4DR1K 2XMTA 1RISA 3EX7B 4DQSA 2B6GA 4AL5A 4LFAJ 2FPKA 1URNA 3U1NA 2OMLA 2GX9A 3GZ7A 1DAXA 1DY3A 5MLCV 2NXNA 1NM1A 3OVNA 3FBFA 1XQIA 5A8RA 3L3CA 2CNKB 4MKVA 4RW8A 4LY7A 3MZIA 2J6SA 2E9TA 3F9MA 2MGZB 4NL5A 2ZIWB 1Q9XA 4EO8A 1SJ4P 3DRSB 5CE3A 4IKFA 1HL6A 1B0PA 3CDWA 4M63A 2KFNA 2P9NB 2HVHA 2OO4A 2EK6A 4FZLA 4V19J 1U47A 2DXFA 1M1GA 2ZVSA 4LQ9A 3VVUA 1JLGA 4NX9A 4MN4C 3HILA 3UD4P 4FWKA 1BY9A 4ID5A 3EUNA 5AQXA 2IVOA 3DRXA 5LSRA 1BNOA 2Y9HA 2YNIA 4DCPB 3QZ7A 2OWOA 1FA0A 3H8MA 2Y1JA 4OPAA 2HFZA 4KMOB 4I29A 3J80Y 3V7LA 1C0GA 1DHMA 4AFFA 1A9NB 1KAZA 4UAYA 3QO9B 3K9JA 4YOWA 3G25A 4R63A 2ZE2A 1F5CA 2QB0B 3V7JA 3K7RA 2I8EA 4NLOA 1R8AA 4MF8A 1U1LA 2MKIA 1ZBIA 2APOA 2HRYA 4JHDB 1BA1A 3C23A 2AGQA 3H0MB 1ZYQA 1ECWA 2Y9UA 1M1KT 4YR0A 4L76A 3CEDA 3H45C 1KLMA 4LBHA 3T6BA 2C22A 2LDIA 3B82A 1UL3A 1IM4A 7ICJA 4E98A 3CG7A 3RMBA 1WSGA 2YVSA 4EWTA 1YF5L 8ICSA 2YB4A 1KDHA 3D2FA 1M90O 2EZYA 3DLKB 4NLCA 3BREA 2QFIA 2K8CB 5ALLA 4LUBA 1HPZA 2ZUDA 1GLCG 2DNMA 4JKDA 2VH7A 4OMFG 1GXTA 4USKA 2JLFA 2OD4A 4B1YB 2ZJ8A 1Z19A 4CDIA 4DU4A 4ETXA 3KJVA 2OPQB 2P9LB 3TVZA 1BHLA 4IJAA 3T1HF 4ZPAA 2FBXA 4NEYA 3KK3B 4F92B 2DKXA 3ISZA 4C4TA 2O66A 1RHMB 1WHVA 2V51B 3ZT1A 1P1LA 1ZOTA 2W40A 3CCTA 3FCHA 5ALGA 5BR8J 1OY9A 2CPXA 3NHGA 1K8AO 3BZCA 2BH1A 1BMQB 4XUSA 5DB8A 1T03B 3HW8A 4E1NA 4X66K 4M5DA 4F4AA 3H08A 1KP6A 2CAJA 2XCAA 4DQQA 2W42A 3R3TA 5DLFA 3CMQA 2VGNA 2WVFA 3K5MA 3V5RA 3GOIA 3CJKA 1WG5A 1VHFA 4BS2A 3VGLA 1BIZA 4ZITA 1UT8A 2QB0A 4JI8J 2P9SA 4NCGA 1BCMA 1NMEB 4U9RA 4QYZK 2F8SA 1X2IA 3C16B 3UDCA 3BPDA 2FHKA 4KREA 5HP1B 4PG6A 4CW7B 3AXKA 1KC8T 4FVCA 3SJJA 4DWIA 2IIHA 3VQAA 2ASLA 4BHQA 5D4LA 4DX8H 2CQ3A 3OS1A 5IWAK 4LF4J 2Q0ZX 2ZZNA 1UAXA 2Q36A 5KFUA 4ECTA 1SL2A 5CZVA 3QEXA 1ZAXA 3M8PB 2E1AA 2F2AB 1YXQA 2UZAA 2RB7A 4DV7J 5C2DA 2HIYA 1SJFA 1QAIA 1RLDA 4WCEQ 4P4OA 3FMWA 2YWEA 2RN2A 1T3VA 1S1XA 3V72A 1PJ7A 4Y28C 4I2JA 2PY5A 2BOAA 3L0QA 1Y9OA 4K4UA 2YKPA 5D3GA 1WC5A 2D74B 2FHMA 3VEZA 3OR2A 1Z1BA 3I8DA 3SMSA 1T3NA 3LM2A 1K9MT 2FJDB 4GLXA 3LDNA 1WN7A 1SV4A 1RAEB 3N01A 5D77A 1VIOA 3W60A 3SQ4A 3HHEA 1X40A 1BISA 2U2FA 5JS2A 3H8WA 5GMDA 1N62A 4PKIA 3VALA 5L1IA 3FZKA 3GR1A 3OW2M 4OPJA 2VV5A 4B1UB 5A2QU 2P9KB 3EGVA 2J7WA 2UUAF 2XHBA 2F44A 2K4EA 3LALA 3O1WA 4BE2A 1ZM2A 5L9NA 3FRZA 3CJ1A 2HAFA 3GCWP 4WTYA 2Z2YB 3V81A 5JVGQ 2R3VA 1CZBA 3GPAA 3DRRB 2VBWA 3GG1A 4K8ZA 1EQYA 3J81O 1U0HB 5IT9O 2ZD1A 1UCVA 3DKDA 4S0MA 1KS2A 3R1XA 4Z7CA 2W24A 1ZA1B 3M8WA 5FLXO 4OX9K 1SKSA 2MMYA 1F44A 1A5VA 3MX2A 3UXOA 5KFJA 2KFZA 2E44A 4ZVTB 3JXUA 4PG4A 3UE2A 1UWBA 3L09A 7ICRA 4YEAA 1XIQA 3NGRA 1R8HA 4LF7J 1OQ6A 2ZJQL 3R8YA 3WEEB 1GLJO 2KJVA 5LY3A 3F2BA 3P8BB 2NXCA 3O1LA 4WPAA 2D9PA 4J03A 3NS5A 5HJYA 4BR5A 4LBPA 2W3SA 4YMMA 2GEMA 1FO4A 3NL0A 4DFJA 4RWXA 3VF4A 3LP1B 4BRGA 4KH6A 5AE3A 4YORA 1UA1A 3F9KA 3HMJG 2QMUB 4CF3A 4ECZA 4RW6B 3QYYA 3ZETA 1X5PA 2UUBJ 2N1RA 1T05B 2RQKA 4FBUA 1QDUB 1JLAA 1PO6A 2QW9A 3IRUA 3MM9B 3BQTA 4UUXA 1KONA 4JMUA 3N0VA 3J7AP 1F9HA 4P73A 2BW7A 2ADCA 5F0WA 5ALDA 4NASA 1GX5A 3J7Z5 1F3FA 3AVIA 3KBBA 2HQFA 2B6AA 1XK8A 1VQMN 4KLDA 4M04A 2HHVA 4DLEA 4H0OA 4JI4F 4DX5A 2V2KA 3BZQA 1TMJA 5F41A 1PK3A 1SC4B 2DISA 3WC0A 3A1YG 1FEEA 3MOJB 4F2SA 3IBCB 5A0YA 1HKAA 4UQGA 1JNZB 1A0OB 4DV2J 2BOPA 2LYAA 1ZQXA 4I27A 1O51A 3AD9C 1LFPA 2UXBJ 1NM2A 1VQYA 4DBQA 5F3XB 2MJUA 2MLYA 2DRBA 3UB5A 1XMQK 5AM3A 4TN2A 4PEOA 3O80A 2E5JA 1J54A 3L8BA 5D8HB 4GRSA 4IL6U 1CXQA 5J2BA 2ZD1B 2A18A 4M3UA 4RNOA 4HUGA 1LOUA 4QZHA 3QX7A 4KITB 1YX2A 1XUPO 3FNNA 3A8YA 3K5OA 1NK4A 1S0NA 2MZSA 3L7UA 2X6NA 3HP9A 4KMUA 1S72N 4DG1A 1XERA 3UN3A 3LP0A 3BO3A 1T02A 4JI3F 4FWSA 5GAEU 1F5BA 1QVGM 2YQ0A 5GAHI 3L2QA 3QATA 1H74A 3CMES 4WK1A 3O08A 2RDIA 3Q86A 4CJPA 4WE1B 4P71A 3EWAA 4CZFA 4K42A 5LMNK 4O0IA 5AE2A 3SIPB 3ZTOA 1SVDA 2D3UA 1VQ7N 3KOOA 5ALSA 4TLRA 3A4TA 4NLDA 3JTPA 1C1CA 4P7TA 1C20A 4NXNK 4WFAL 3TEGA 5IM0A 1K8AT 3AT1B 3HYFA 2F40A 1C0MA 1LAWA 4KTWA 3MM9A 3TW0A 2HFVA 2N82B 4I2BA 4TKTA 4LZGA 1N48A 3NH1A 3QU7A 1NMDA 1VSJA 4R0EA 3FBCA 4K4TA 2V9WA 2OEKA 1W2BM 2ZBPA 2XVTA 2H3GX 3O8WA 2G8VA 3EZWA 4EYHB 4USTA 3NRZA 2A3JA 3EVOA 4I56A 8ICXA 1VLBA 3L4BC 4MQ3A 2VWKA 1NJZA 3CCEN 1M5SA 4F9OA 4NL9A 3HZGA 5EN1A 3GFZA 2BJ8A 2Z2MA 4FN5A 4YVZA 2V8HA 1XO1A 4HWIA 3NAEA 3QU2A 3LK9A 1U2CA 3M6ZA 3C2LA 2RUGA 2YV0X 3CF5L 4M47A 3EPIA 4E3SA 2BTFA 4LRDA 1U4BA 3SMPA 2D0CA 1RP5A 1FK9A 2KSOB 4X4VA 5L39A 2QA2A 2G1HA 1ASVA 4IH5A 3FKBA 1M6YA 4YS2A 4U96A 3GJSB 3QIPB 3Q7BA 4Z4EA 1P6TA 2ZTDA 1UEUA 3RG6A 2V6AA 2H5IB 3Q8RB 3CDEA 3KK2A 1URJA 3AQEA 1BWFO 2AJFE 3TVYA 4J9SA 1F6TA 3IP4B 4MFAA 3IR6B 1AZSB 2MTLA 3QNOA 4J2DA 4L3KA 2KP7A 1S1UA 3THYA 2K1RB 1K47A 4KH1B 3HT0A 1JLFA 2HWTA 2LCWA 3N4QA 2QSWA 1JIHA 5FIIA 4UY8O 1QQCA 3HI9A 5D0RA 1Y88A 3CCVS 1HNXJ 4NPOA 9ICJA 2Q6BA 4Y0FA 1S0OA 1UFKA 1FI4A 5CCLA 2W2QP 2PXIA 3F0NA 2PMHA 4KKOA 5EVZA 4EP5A 3CJQA 4FJXA 4CO2A 2E5IA 3OTOK 5KQ8A 2QK9A 1YITS 3QLHA 5HRPA 3FAHA 1RG6A 1VQSA 3D6RA 4RQ5A 3SFUA 1MW7A 2XHWA 5J1PA 3BKUA 1IN0A 2AWZA 2QXLA 1KQSM 2KFYA 1NPKA 1TP7A 1BPXA 2DQNB 2D3O1 4J9KA 4E19A 3L4QA 1QS4A 2K3IA 2NQPA 1ZQFA 2MHEA 1C1AA 5CYMB 4L3NA 4WFAQ 3V4MA 1QHTA 1Y00A 2NCKL 3E66A 5HK4A 1LKYB 3CF5Q 1X6IA 3ZX2A 1HKBA 4KE5A 1U8WA 1E4FT 2ZJRL 2VG7A 3ZTPA 3DOLA 2RF2B 2YY6A 5HMZA 3D0HE 5E3AA 3SQ1A 3M05A 4CF1A 3HI0A 3ATUA 2CQPA 2GMJA 3HJVA 4BRFA 2KDOA 2DPNA 4OCZA 2AMCB 1Q7YO 3NP5A 5AQTA 3TWHA 3NAIA 2AP6A 1AZSA 7AT1B 1B9FA 3HM8A 4ZTFA 3WZ0A 4CP5A 1HD0A 5L8RC 4PA1A 2YQ1A 1CJUA 3I5AA 2E7XA 2OCEA 2QI2A 3IAYA 2L3MA 4DLGA 1F9EB 3JAMY 3C94A 1KHWA 4I2FA 4UUWA 5F3TA 4XPCA 4BDZA 1R7IA 2ISPA 4KQZA 1XSPA 1N6QB 4J9VA 4NXMJ 2DRAA 5AK4A 3CFPA 3JSMB 3NGZA 2HMPA 3I55N 3A2FA 3BSOA 5M1FA 4Y2AA 5LMNF 3RMCA 4FWOA 2KJ8A 2JEGA 1VJWA 3VGUA 1S59A 1YAGA 3DOMA 2VZ9A 4MIAA 2KIWA 1ICEB 1BWVA 4PL2A 3D1OA 4CH7A 2R7OA 5DQGA 1JJ2R 2DY4A 1HI8A 2KJ5A 3AO2A 4NYOA 3KJQB 2AP1A 3C7NB 1WJ9A 5AKIA 2Q6CA 5KFTA 3VQDA 3AVKA 3IAS9 1WCLA 4FLUA 1X42A 2C2EA 3TADA 5J8YA 1NK0A 1YTYA 4U7UK 4BRDA 4YOXA 1SXEA 4HDGA 2WF9A 2R7WA 3QUBA 5BR8K 2LXFA 2RQCA 3L2UA 2RHSB 3P3DA 1XNSA 4H54A 3QT7A 3S01A 3UDEA 1SJRA 2IC3B 2RDJA 3NG8A 3DLLL 2JGUA 4FJ5A 3ATVA 3CJ5A 3Q22A 4WU2A 2XMKA 3H20A 4A8XA 1U9LA 3H2UB 2M5YA 1WEXA 2EXUA 2UUCJ 5CWRA 3U6FA 7ICKA 3TP2A 4YP3A 2KKHA 3J80O 3PMLA 4QIWC 3PX6A 4E7LA 4JI1J 2Q2RA 1DTQA 1DRZA 1UEKA 2WUSA 2AKWB 5IC6B 1S9GA 4HTUA 4F71A 5KI6A 4P10A 3D0GE 4USVA 3EGWB 2HBYB 4C3LA 5FROA 1N5SA 2IVPA 4LF4K 4DR7F 2FB0A 1PK1B 1ILYA 3HHKA 1XN9A 3MAAB 2ZJQQ 4KHMA 3DV9A 5J2QB 1GQEA 4A48A 1Q5YA 2VG7B 2JEFA 3CCMS 4JV1A 2XNRA 5F8JA 1JN3A 4ECQA 4NEZA 3OXFA 2HQIA 4DPYA 1ZTTA 4ZPVR 1V85A 2B7CB 3D3BJ 3SQIA 1FO1A 3FQKA 3MK6A 3LZIA 1R3NA 1GXUA 3WK8A 3BO4A 2YKOA 4JI3K 5IV4A 2C3MA 4PWUA 1N34F 4PG7A 3S3MA 1LCUA 3Q23A 2I0XA 2XMJA 4X84A 3MMAB 2C3PA 1I3OB 4M3ZA 5AM1A 1JX4A 4ZVHA 3AVCA 1HBOA 1I94F 1LW2B 3TAQA 1D8LA 1U6ZA 3RJEA 1GEHA 4P6QA 1RXVA 1M5PC 5AJ3K 4CRXA 2A10A 2D3ZA 2OD6A 4IO9L 1S6PB 5HBMB 2RE2A 9RUBA 4DMZA 2YPYA 4JKGB 1D8ZA 2CIMA 3TWZA 3MEDB 1FKAF 2E5LK 4NLQA 4LRCA 3MM6B 2OA8A 5CXTA 5GMEA 4CLKA 2C2MB 4YXMA 1GMVA 2AV5A 5CA5A 1HQEB 1Z6RA 3GSDA 1NH8A 4P0QA 3ITHB 3TA2A 5J0QA 5DM7L 4LF8J 3C0BA 1M5VC 3DOMB 1XQSC 2AT1B 5TKWA 3UMGA 1Q4RA 3B4MA 1OPIA 3M32B 4CF9A 1VJ5A 1B4SA 4CTAA 3DI6B 3SUQA 4PCQA 1TVRB 4L8RB 4GV3A 2YMPA 3RBXA 4DL5A 2XICA 3DOKA 1FFUA 4CF8A 1SC6A 3PTWA 1BXNA 1U1PA 5BPLA 3AAPA 1F2GA 4EFAC 3HHLA 1YVFA 5AQJA 4JI1F 4HI1A 4ZVUB 2ZUAA 3FDSA 5GTIU 2DGOA 4PGYA 5I42A 4RPYA 3MMCA 4AF1A 2PE8A 2NLWA 3H0LB 3JPPA 4NZ6A 1DT9A 1RT6A 4DPWA 3QSIA 5ITHA 2DGWA 4IUFA 2IBOA 2FVSA 4JK7A 1DLOB 3NS7B 3PJ9A 4LF9F 4NLNA 1X4BA 2OEJA 9ICPA 4RNFA 4BC7A 3QBWA 4Q0BA 2HVIA 4D3HA 3VETA 3D0PA 5AXLA 1NGJA 4M5IA 1Z25A 3PO4A 4B6JA 2V2ZA 1BU6O 4OYAA 2B9WA 1J5OA 5JS1A 3D6JA 3TFSA 3W63A 4A8FA 1IR1A 3NWRA 3VERA 1J5EF 3MMBA 5KAKA 2K60A 1VJQA 2WK4A 1FTCA 3J7AN 3J7YI 4WFZA 4TQRA 4M41A 1W0HA 3OTOF 4FXDA 1QCKA 5JVGL 3FZMA 4Y2SA 2W41A 3LDSA 2NYHA 5KT7A 1SH3A 5H9FK 5KG2A 4OX6A 1RM6C 4IBNA 3IXQA 2AJ4A 1GLFO 2IPOB 1RYRA 1W25A 2KYXA 2NYIA 2ZH9A 3H2VE 2NR0A 3MPYA 1QD1A 4ID1A 2QRRA 4NMXA 3LL3A 4N8OA 3SNNA 4GKJK 4DR6J 2OPPB 1REVA 1UPHA 3E9PA 3KLVA 4A4JA 2OP5A 2EEYA 5EUHA 3NE6A 4NLPA 2Z0GA 4RTFD 2E1CA 4P75A 2EAOA 1IKWA 3ID8A 2UUAJ 4ECYA 1VQ6S 3VQ8A 2E5SA 2HQCA 3PLAA 5AXNA 4P0PB 1X9JA 3ZFVA 1B3TA 4EBCA 5T41A 1D1UA 4FWNA 1WOQA 1HNZJ 1ZA2B 4Y34A 4JV5F 3WK4A 1UW4A 2AU0A 2VA2A 3NXZA 3EGNA 1R59O 4Y2VA 5LL6d 2DF4B 1BUXA 8ICPA 4I69A 4BR9A 2PMZC 3IWXA 2DVIA 4U67Q 2VB6A 3IR5B 4YDUC 2W7AA 1DJ0A 4NLVA 4MMOA 1H0HB 2GA7A 1RDBA 3K2PA 1MWYA 5K20B 1KLNA 1Q3UA 3UI3A 4CNYA 4DSIA 1RDDA 4R66A 3ULEA 2Q43A 4RT3A 2XI3A 2F1FA 3BEGB 4KH0B 2Y9TA 4O5FA 3GP9A 3PYEA 3TZZA 2GIQA 4K4VA 4ILLA 1NJIO 2IHMA 4LZDA 2B56A 3BR8A 5B0AA 3OYCA 4LFAK 3F41A 5AQKA 1HHQA 4HCCA 1YRUA 1RT3B 1FKOB 4ID5B 4RNHA 4CO3A 3S8SA 4OLBA 2YNGB 4CF4A 1T6DA 3VESA 2ZNYA 4A8MP 3LDPA 2GC8A 3M7DA 1VBKA 4FM2A 1MQ2A 3ZX3A 4O3OA 3C66A 1CS4B 2GOLA 1ZQYA 2E7WA 2EANA 3PSPA 3M6UA 3CPWM 3T5HA 2DJWA 3QSYB 1S1WA 3CCWA 1WHXA 3NVYA 2KK0A 4AUKA 2HFUA 4Y2TA 4FPIA 4FNIA 3D2EB 2ROPA 4RJVA 2EVZA 5LXRA 5DQHA 3GLJA 3AVJA 2QA4S 2MKSA 3EJMA 4IC9A 3KUEA 2CGKA 4BLGA 5E33A 4H5VA 3ZSXA 5KL8B 2HPUA 2NRVA 4Y1DA 1XS9D 2QWRA 2KE7A 2A1BA 4CEZA 3SUNA 3RBZA 4B3TK 4Z7YA 1T03A 1HJRA 1G2EA 1VSEA 1QTMA 2E1RA 2HHXA 1H2VZ 2VQEK 2DHXA 3R1LA 3VCBA 4HT7A 4B3OB 3OL9A 3S3NA 2NXJA 5CHGA 2WTFA 4CF0A 2JEIA 2KJWA 2ZG6A 1T95A 3AEVA 1KVJA 4DJBA 2MU2A 5LMUJ 4H0XB 3HOTA 3C28A 4KHPJ 3A0IX 2RDDA 2G07A 4BC5A 4FNHA 4CVNE 3HBTA 3DYAB 5M1KA 3U4LA 1BL3A 3C7NA 1GLEG 4AHUA 3W5YA 1RGIA 2X1BA 1F5AA 3AVBA 1UW9A 5J0PA 4GY2B 3VPZA 1RWNB 3MECB 3UCGA 3OHRA 4C0BA 1CJUB 1JALA 3JPSA 3G0ZA 2AJ2A 2HNDA 1XHXA 1L3KA 1HBOB 5CYJA 4M7XA 4DTRA 3LM9A 1RAAB 1Y0HA 2ZC4A 5I3PA 3H3NO 3MR3A 3M9OB 3O3FA 1YIJN 4CZGA 3TX0A 4I6WA 2CQGA 5JMVA 2QX0A 1RAIB 4WYBA 4K41A 1LAVA 1ZM3A 3RAMA 4ILJA 2C1EB 1WF0A 3CJ0A 4OO1J 4DEZA 1PJ5A 4W5QA 3K5LA 4LRBA 2YBVA 3NMUA 4Q8EA 3PYDA 3GYNA 1RT2B 2F9JA 4UATA 2ATCB 1KAYA 2GELA 2ISOA 3OGUA 4E2FB 2P9LA 3H7HB 1Q81O 5IT9Y 2W9BA 5DQIA 1NSQA 2VPWB 5AI6A 1VAZA 2VC1A 3US5A 1YHQN 1NGDA 2EWSA 4J2BA 2C28A 3CUNA 4I2AA 3QQCD 2WB4A 4AHCA 2I9GA 4GVLA 3CB4A 3THXB 1S9FA 2AJ0A 1VIXA 3SJHA 1V38A 2KEYA 3SCIE 1UPPA 2CQDA 4GNIA 1N0VC 3HHLC 2MUTB 2H5XA 1U1OA 1JROA 4QZGA 4KLHA 4DHYA 3HHLB 3OL7A 4B9UA 1FDBA 1R43A 4LJXA 4C0HA 1UJ6A 1Q7YT 2DNZA 3QFPA 4BRAA 2GMLA 1B4FA 1J6ZA 2NV3A 2H3IA 4PGQA 4YY3J 2C42A 2VOPA 5J2PA 4ZPWR 5K8MA 2GAHC 3P45B 2GLEA 3RJMB 3DI6A 2VFUA 3MGIA 2OFGX 3CFOA 4P52A 4DUZK 2H3VA 2A3ZA 1MMNA 1IBKJ 3TEHB 4GVEA 8ICQA 1ZBTA 3OYFA 1WWUA 2J0WA 2O8FA 3JPRA 2NNWA 3A8KA 4GV6A 1WG1A 2YX7A 2GFFA 3I76A 1FDDA 1M0SA 4ZVPB 2QWOA 2KKZA 2G8KA 9ICLA 3OA9A 2O67A 2KZ3A 2QYGA 3NF8A 1VC0A 3MR6A 4MJKA 2FF6A 2MKCA 1J53A 5AE1A 2HQDA 1KQSR 3IGNA 4O8UA 2F1JA 1X31C 1N5YA 2XS5A 3ENBA 2YMMA 3L2WA 2FIUA 4BWJA 1TL1B 1QLNA 2KKVA 3EN9A 4HTJA 8ICBA 4DTPA 2ZBIA 4Y2QA 3J81j 4DU7A 2CH6A 3L9ZA 2VKQA 4RQ2A 1JCGA 4RL1A 2DR5A 4ERDA 2KQ2A 4IQMA 1ZBSA 2KVCA 1QH9A 1EXQA 2HS3A 3FCVA 1NJIT 2QWQA 4NLBA 3NUQA 4CHQA 1KDNA 1NHKL 3ZDDA 4HDHA 4BRQA 3ISBA 3WNGA 2W1BA 7ICPA 2WOMB 1VFJA 1J5OB 2EPIA 5DDPC 5KFYA 1I94K 1WUUA 4Z6FA 4I6MB 2D0AA 2KN7A 2PFDA 3UMCA 3H1VX 5EE1A 3KMSA 1N52B 2RQ5A 2BPGA 4A8EA 3TZYA 5TZVA 3GG0A 2KIVA 2BUNA 3G87A 3R2CJ 3R6GB 3HZ6A 2RE1A 2RNEA 1WSHA 1JXEA 1RT6B 2CA9A 3H2LA 3BJYA 1OW5A 1RBLA 4OQJA 2E1FA 4A8QA 2ACYA 2DHHA 3WIUA 4ED3A 2BKEA 2V68A 4USUA 3OTEA 3FFIA 3EMTA 4GO5X 5L1JA 1TL5A 2POKA 5HMXA 1BDGA 3B6PA 3C6TB 3V9ZA 4Y1CA 3ZZUA 2VBXA 5FRNA 2X1GA 5IIIA 5CRXA 1ASUA 4CLUA 4FSVA 5DZ7A 4JYAK 3HKZC 2GUPA 4B3MJ 2BCVA 4CM0A 4IYQA 1FNMA 5KT3A 1JJ4A 5ALZA 3OYEA