4F3OA

Dna polymerase i large fragment complex 5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
566
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTANMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 198
structure length 566
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f3oA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f3oA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f3oA01
3LANA 4NLZA 7ICRA 4CF2A 5KFZA 1JIHA 3TWHA 4M9GA 3F73A 4CEQA 3BDPA 4CEBA 4J2BA 4CIFA 5C24A 3SQ0A 4W5QA 3ISNC 2FBYA 3ASMA 4CHOA 5J2MA 2DY4A 3SQ1A 3T5JA 3C94A 4RZRA 1HUOA 1Q9YA 2HHVA 5EOZA 5DQGA 3PW4A 3C1ZA 2JEFA 3C95A 1TK0A 1KEJA 3PR5B 4DL3A 4Z6FA 7ICIA 1RNHA 4YMNA 4KV8A 3EPGA 5HMMA 5KG4A 2YHBA 4OKEA 3SI8A 3LALA 1TKDA 4O0JA 2B6AA 4YFKA 4PGQA 4FK4A 4YFUA 3ZT2A 1C0TA 1RT1A 2XY5A 2XGQA 1S9GA 7ICUA 9ICRA 4JV0A 3TFRA 3IRXA 4IQTA 3TQ1A 1SL2A 1LWFA 4RT3A 1T7PA 4FJ9A 1ZQVA 1R0AA 4ED8A 3Q8SB 3ZSVA 4QW8A 5J2JA 2D0AA 3SUNA 2DTUA 1S77D 3PR4A 3GIJA 3V7LA 9ICUA 4CF9A 1H38A 4IR9A 2GWSA 4KLGA 3TFSA 4M04A 4QZ8A 3K5MA 3VQEA 2HB5A 1XI1A 1TL1A 2A1SA 5CYQA 4N76A 5KFGA 2IMWP 2DFHA 5JS1A 4DTSA 2XY7A 4RQ1A 2BDPA 5L1IA 4K8ZA 4Z4CA 3KKRA 3TAGA 3Q8MA 5J2IA 1T3NA 3DLEA 3SUQA 4CGFA 5HROA 4WE1A 1KRPA 3NE6A 3TAFA 5HP1A 2R8JA 3DYAA 3ZSYA 8ICXA 4EBDA 3PX0A 4DTNA 1JMSA 1RBSA 3K2PA 5J1EA 5KRSA 2QKKA 4I2GA 1TKTA 3OJUA 4CESA 3PW7A 1RYSA 3HVRA 1DLOA 1S9EA 2RDJA 2D5RA 4I2CA 1C1CA 1K6YA 2Z1HA 2BQUA 5SZTA 4DL2A 1FXXA 2P5OA 3UXPA 2HVIA 4BXOB 3RB6A 1HMVA 4JWNA 2KZZA 1ZBHA 1RDCA 3AA4A 3GQCA 5BOMA 3U3YA 4FM2A 9ICQA 5DBAA 4MFAA 1B22A 1RTIA 4B9TA 4DF8A 3DRRA 1HYZA 2PY5A 2OWOA 3LDSA 2ATLA 4G3IA 1CXUA 4JV2A 4J2DA 1XWLA 4BE1A 3P5JA 4RW9A 4KHSA 2PFPA 4Q44A 1WSEA 3DRSA 3KHGA 5IIOA 3RMDA 4DL5A 2E6MA 3NGZA 3QERA 1N48A 3VQ9A 3MXMA 4DQPA 4KPYA 3UXNA 5J2PA 5HBMA 1S10A 3GILA 4M6WA 8ICGA 3G10A 3SUPA 2HHWA 4ZTFA 3OS2A 4B08A 4QWDA 2Y1IA 4DSLA 3S9HA 1ZQGA 4JWMA 1N5YA 4O5CA 4N47A 4W5NA 3ULDA 4BDYA 3RAXA 4I27A 1RCHA 2ZJ8A 4AHRA 3L3UA 3OYBA 4ECUA 9ICCA 4I7FA 4KLHA 4BGDA 5D49A 2Q3SA 3NGIA 2XCPA 2BKEA 4O5BA 4CGDA 4UB3A 3B6OA 4IR1A 4QZGA 4O4GA 4KTWA 4PQUA 4M3RA 2P5GA 3OS0A 3M9MB 1ZQCA 5IIKA 4DOAA 3SQ2A 5J0QA 1DTQA 2ZQBA 7ICFA 9ICMA 5C5JA 4BWJA 2PYLA 8ICEA 4RW7A 1UT8A 3RJHA 2ATQA 2BGGA 4R8UB 3EZ5A 1KLMA 3TANA 2YKNA 4QZDA 3L3VA 3C1YA 4RPZA 5J0YA 3SNNA 2X6NA 1RDDA 1UA1A 3F9KA 1JLEA 3QLHA 3L2VA 4CEAA 3LWLA 4LVSA 4DSFA 4FJ5A 3IS9A 4ECSA 3ZSOA 9ICKA 1NOZA 1VRTA 1L5UA 8ICTA 1U9LA 1RBUA 1WNSA 4FJIA 4AH9A 2NRXA 4CJWA 1TV6A 1F21A 4CJQA 4E7HA 5CY4A 4F3OA 1S1WA 4O44A 1BPDA 4RW6A 3T19A 3KTQA 4DU1A 4DU3A 3KK1A 4PH5A 2C2RA 1RT5A 3VA3A 7ICJA 4HTUA 2JZBA 1Y88A 4EP5A 4CFCA 4R8UA 3ETLA 4R64A 5SWMA 1RZTA 2ASJA 4NXZA 3IM1A 1LW2A 1NK8A 4TUPA 7ICPA 1BCOA 4ECXA 1RTJA 4JLHA 2HHUA 4Y1CA 9ICEA 4R65A 5KFKA 2ALZA 5T7BA 3GDXA 5BOLA 4CHNA 3G6VA 4FJKA 1KVAA 3NH1A 1HQEA 2B21A 4CK1A 4PHPA 4QW9A 2W9BB 9ICTA 2W9AA 2F8SA 2KQ2A 5FRNA 5D46A 5EWGA 3KLGA 3TAEA 2J6UA 1CZ9A 3AO3A 3O4NA 4B9NA 3U6FA 3MR6A 1EKEA 4CJRA 4F93B 5DB6A 4KRFA 4RT2A 4CE9A 1UAXA 4RQ8A 4CGJA 2EX3A 3QIPA 4P2HA 3RTVA 1VK0A 3ZSWA 2C22A 1LB2B 3KLEA 4RUCA 5IILA 3NAEA 1S76D 1KSPA 2AGOA 8ICFA 9ICVA 2FPMA 4O3QA 5J0OA 2VA2A 2HMIA 4CF0A 1HYVA 3LPUA 1JXEA 5IIJA 3HWTA 3I0RA 4IFVA 1IH7A 4CGHA 1J54A 3AVFA 3K57A 3RH4A 3QZ7A 2ASDA 2KFNA 2HHXA 4PUOA 4JS5A 3MFHA 2DPIA 1U49A 3RH5A 1KFTA 3RWUA 2JLEA 3JPNA 1ZQJA 4CJVA 4RQ4A 2HHTA 3C2LA 4RQ7A 3GIMA 4KHWA 3Q8KA 8ICRA 2W8KA 1L3SA 4QZAA 4F91B 1QHTA 3GFKB 4M3YA 3PX4A 3AVAA 2XCAA 4M9JA 2F8TA 1DGSA 2PFNA 1ZQAA 4Z6DA 3QEVA 4I9QA 4FZXC 4FK0A 1FK9A 1HPZA 2MAXA 4ID5A 4I2PA 1D5AA 3HM9A 2Z1JA 2EHGA 4ED6A 5J0PA 4E19A 4Q43A 3WNEA 2D0CA 3K5LA 1WSHA 5KFWA 1SV5A 3V1RA 4KLIA 4MEXA 4N41A 4ED2A 5KT5A 1UWBA 5KFHA 4OGEA 4UB4A 3FDSA 1ZQZA 2ZJAA 1BGXT 4DLEA 4CJLA 4QWEA 4LZGA 4J9PA 3OS1A 3T5LA 5DG9A 1S1TA 1QQCA 2HNDA 5CR0A 3SPYA 3BQTA 3AVLA 5L1KA 5KFJA 3K75D 3HPHA 1ZQDA 3NTUA 2P1JA 2ZUBA 4M41A 3O4QA 4QWCA 1LV5A 3HSTB 2HHSA 1L3TA 1SL1A 3VQ5A 4UAZA 5DDMA 3V9UA 4FJGA 1BI4B 4M2YA 2W9MA 3AVKA 4BE0A 1XO1A 1TL3A 4CJKA 1RTDA 5DBBA 3T5KA 4I2JA 4Z4GA 5KG1A 3LZIA 3RJFA 2G8HA 1EX4A 4M42A 5KFYA 4Y1DA 1ZBUA 2FMPA 3P1GA 3QO9A 1Z25A 4DMNA 4MFBA 2QXFA 1ZBFA 2FBXA 2RN2A 4DL6A 5K14A 1RXWA 3V9ZA 3RMBA 1SZPA 4NCBA 5CP2A 1MQ3A 1S97A 2DFFA 4C8OA 4E7KA 1X9MA 3QNNA 4IBNA 4KLLA 3QESA 4J9RA 3V6HA 1VSLA 3T3FA 1LAWA 3ISBA 4FBUA 4NLKA 4GC7A 2YKMA 4EZ6A 2YNFA 4ECZA 4ELTA 2XC9A 3ZSQA 7ICEA 1S1VA 4DTXA 1RTHA 3QEXA 2IBKA 1G15A 4FXDA 5KFBA 3OYEA 5HP4A 5CYMA 3G6YA 1U48A 4FJXA 1NKEA 3TI0A 5HRRA 4EP4A 2P6RA 2PI5A 1IO2A 1YT3A 3ISDA 4F4WA 4OGCA 4E89A 2XY8A 4AHCA 2AGQA 4ECYA 4F5OA 1ZQUA 1CUKA 1XSPA 9ICHA 4CJEA 4M9LA 1LW0A 2ITGA 4KLTA 3RMAA 4YR2A 3HVTA 4CJ4A 3PW5A 1XSNA 5E41A 4TURA 1A76A 3C23A 8ICKA 3VQAA 3SUOA 2PFOA 4UBBA 3EY1A 3KHLA 4E1MA 1C7YA 3ZDBA 2LYHA 3RRGA 2HNZA 4YXJA 3EWAA 1S5JA 4NYNA 4QZIA 3ZD9A 1VSMA 4FS1A 2XRIA 4Z4IA 3IHQB 2BHNA 4DL4A 4Q8FA 2Q0ZX 4KHUA 5CHGA 4M47A 3JSMA 4Z4HA 4RQ5A 1JLCA 2VG7A 3EPIA 4ZHRA 1CLQA 1Y97A 3DLKA 2JZBB 3MR2A 4I2HA 4GC6A 1DOQA 3UPQA 3N97B 4L8RB 5J0WA 3A2FA 4I2BA 1A5VA 1ZETA 2G8FA 2P51A 4W5TA 3AVCA 3QE9Y 4OLAA 4YN4A 4ECVA 5IIMA 4NY8A 5KG6A 4M9HA 2QKBA 2F96A 5DKWA 4RU9A 4KLSA 1JN3A 4ED1A 4YVZA 5BPCA 4F5PA 4Z4EA 4DSKA 5CZ2A 1TVRA 2OZMA 5HHHA 2OPRA 3GV7B 3AO5A 3MXJA 3SPZA 1GOBA 1RBVA 4Q5VA 3KIOA 2W42A 3G6XA 2FMQA 8ICCA 2R8GA 1ZQXA 4M3TA 8ICMA 4DQRA 3UXOA 4JRPA 5L1JA 3MXIA 1GOAA 4Z4FA 4AHTA 3SYZA 2BCQA 1EXQA 1ZQWA 2B4JA 3OGUA 8ICUA 3HX0A 3AVJA 4YCXA 3OYIA 1ZQEA 4I2DA 4YQWA 3M9OB 1YTUA 2KW4A 1RBTA 4DSJA 1RT6A 4CJFA 1BVSA 3QINA 2O4GA 2XO7A 3VQDA 5DG8A 3MGHA 8ICQA 1CXQA 1N6QA 4ED0A 4KLEA 3LP3A 3HYFA 2G8WA 1IG9A 2UVRA 2PFQA 3D45A 3VA0A 3DLBA 3AVHA 3MAQA 4CJ5A 4NCAA 1ZQTA 1GOCA 1XU4A 1NK0A 4IFYA 4I2QA 4F2SA 1BHLA 3TR8A 2C2EA 1WAFA 1ZQSA 4YR3A 1NKBA 3ZDAA 4M6WB 1EETA 4QZBA 3OHBA 1JX4A 3RR7A 3RR8A 4LD0A 3LAKA 4KITB 4ECTA 3HP6A 3K4GA 4PGXA 1JL1A 3DLHA 1N56A 1BI4A 3O3HA 7ICQA 4FJ7A 2MUTB 2AU0A 4NYFA 1D8YA 3EW9A 3M8SA 4FM1A 3V81A 2X74A 4KREA 1KVBA 3LDAA 3V6KA 2IC3A 1NJWA 1I3AA 2VANA 2M9NA 1B92A 5D4BA 3L2RA 3V6JA 3SI6A 3DMJA 5I42A 2ZE2A 3QIOA 3LP0A 4AHVA 1XHZA 3NF7A 4RPXA 2IDOA 3M8PA 3NGYA 4FJ8A 1HNVA 2FMSA 3MEEA 3SV3A 2ZJ5A 4KKOA 1VSEA 1TVAA 1U4BA 3T1AA 3NH2A 1V9PA 5DGBA 3PY8A 4IQUA 4CFDA 1RBRA 3K5NA 1ZQMA 3PW0A 3V7JA 2VG6A 1W0HA 5CB1A 2WTFA 9ICSA 5HRPA 3PVXA 1HYSA 5KFFA 2PI4A 2YNIA 4FVMA 4KAZA 4FLVA 5HRSA 1BPEA 8ICNA 4ZTJA 2BE2A 1SUQA 5DQHA 4I2AA 7ICVA 5KFDA 1QSLA 1ZQBA 4RQ2A 5L1LA 4LY7A 1ZQHA 2BCVA 3QETA 8ICJA 3QEPA 3S3MA 1ZQOA 3TARA 1NK9A 3C5GA 4FS2A 4I28A 4DFKA 3CYMA 1NJZA 4FLYA 5J2AA 2VWJA 3WNFA 4ECRA 4KI6A 4DOBA 2KN7A 5KFVA 3AVGA 1U04A 4CFAA 3AA2A 2I9GA 3K5OA 4CEFA 1HRHA 4QZFA 1RDBA 5HMLA 4RG8A 4F5RA 4HUGA 4KHQA 9ICPA 1A77A 4EBCA 4FJJA 4DFMA 2OPQA 4OKJA 1HNIA 3M8QA 2BANA 2YNGA 1L3VA 4BWMA 4KB1A 3OSPA 4MF8A 2OPSA 4DQSA 3BQ2A 4DTPA 2OZSA 3HT3A 4PGYA 3NGDA 3THVA 3WNHA 3QZ8A 3UIQA 3VN5A 2V4RA 4ID1A 5HRNA 3OYFA 3BQ0A 2X78A 4DS5A 1XSLA 1KDHA 1QS4A 4W5RA 2W8LA 2QK9A 1ZQFA 4H4MA 8ICIA 3OYJA 3V9SA 1KFDA 4M3WA 4R66A 5KFCA 1TK5A 3NH0A 4DEZA 4KFBA 5DGAA 1S9FA 3PMNA 1B9DA 3DLRA 4KLFA 2UVVA 2FBTA 3OYGA 4O3OA 1T05A 3NF8A 3MR5A 1VSJA 4FW2A 1ITGA 4PA1A 5KFRA 1U45A 1NJYA 3OHAA 4FBTA 1FKPA 1JXBA 3RBDA 3OJSA 1TAQA 3PUFA 5KG2A 1BIUA 4OPKA 5KG0A 3V9WA 4KHYA 3PO5A 1B43A 9ICFA 4CK3A 4MQ3A 2F1IA 2BCSA 4TUQA 1LWCA 1S0MA 4UB1A 5KFUA 2ZUDA 5KFLA 8ICPA 2YHAA 3HK2A 4HCCA 1RT4A 3DRPA 1Z26A 3OYAA 1JLFA 3MDAA 2BPGA 4PHEA 3JPRA 1ZQKA 2KZ3A 1ASUA 1B9FA 2BQ3A 1EP4A 5J2QA 5KGXA 2WOMA 4GXKA 4CEEA 4FK2A 2JEGA 1TKZA 4M3ZA 5J0RA 1RT2A 1DTTA 4RNNA 1ZQPA 4FLXA 1TGOA 4F2RA 1BPBA 2PXIA 2YNHA 4CJSA 4H4OA 4ECWA 1IKVA 4KLDA 4DFPA 3P83D 2F1HA 4ICLA 4O0IA 4XUSA 4ELUA 3KD5E 3TAMA 3AU2A 5EWEA 2IA6A 1BPZA 4UB2A 4K4GA 3KK2A 2ZTCA 1T8EA 5KI6A 3B6PA 4DWIA 2KFZA 5I3UA 5J2GA 3MFIA 7ICMA 4UB5A 1RYRA 5DLGA 9ICIA 1S6QA 4NM1A 4C8LA 2ISOA 4EBEA 2XGPA 1O1WA 3ZDEA 2MUTA 4Q45A 4BACA 4J9KA 5KFEA 5HHIA 4Q0BA 2ZTDA 3H4DA 4O5KA 4FLTA 4MFFA 4UQGA 5FROA 3B0XA 4P4PA 2Z1GA 2HNYA 1RDAA 3MEGA 3OYNA 3NBPA 2PYJA 3LP2A 2O4IA 3OYLA 4EEYA 4B9MA 2UVWA 4KN4A 3G0ZA 2NRZA 4KLQA 4JV1A 3AV9A 3OY9A 4N56A 4I2EA 4J9OA 4CHYA 5J2BA 2NRTA 5KFXA 7ICTA 4MEYA 4EZ9A 3DI6A 3LP1A 4E0DA 1ZQYA 1ZQQA 3RAQA 4UBCA 1WLJA 4PHDA 4CJTA 1X9WA 5DB9A 4CIEA 4O3RA 3C2KA 3V4IA 1QSYA 3OYDA 3ZT1A 4QWAA 4C8NA 2E4LA 8ICHA 4GVMA 9ICAA 4FJNA 3RJJA 2JEJA 3NDKA 4FJHA 4GXJA 3MGIA 2BCUA 5D3GA 3HP9A 4ZH4A 3H08A 4O5EA 3C6UA 4KTQA 4N5SA 4M3UA 7ICNA 7ICKA 3PO4A 4CK2A 5EWFA 4DSIA 4CF8A 1A5WA 4RQ0A 1KLNA 4RQ3A 2FLNA 4QZHA 4RQ6A 1LWEA 4OLBA 5KT3A 3ZDDA 3DOLA 4F4XA 4KI4A 1JXLA 3DOKA 3D0PA 3KLIA 4Z6EA 5J2DA 1WAJA 1BQMA 4B8AB 7ICOA 2FLPA 4LSLA 4RUAA 4B8CA 5J2CA 1UT5A 3HJFA 3VQPA 4KHNA 3ORYA 3ZCMA 4J9QA 4IRKA 5DMRA 2LSNA 1L3UA 3VQ4A 2A1JB 4KLOA 5IINA 3LZJA 4QZEA 4TQSA 2J6SA 3OYMA 3HXMA 5KTQA 3RB3A 4J9SA 3DLGA 1ZQIA 4OVLA 1HJRA 4CJ3A 1NOMA 3RJGA 2G8UA 3LK9A 4R63A 3V9XA 2BPCA 2ZD1A 4JUZA 1Q8IA 3ZT0A 4YR0A 2AGPA 3RBEA 4YG2A 1X2IA 3PV8A 1ZQLA 2VG5A 1IM4A 4P4OA 4IQVA 3Q8LA 1NK6A 3RJIA 3SQ4A 7ICGA 2KTQA 4EYIB 4IDKA 3ZT4A 5KG7A 3L2QA 1IKXA 3RRHA 3NCIA 5J0TA 4ECQA 1BISA 2FLLA 3GIKA 3VQ6A 5KG5A 4Z0UA 4TSXA 4JRQA 3M9NB 4C8MA 3Q8PB 2W9BA 4BDPA 1ZBLA 4OPJA 3RB4A 5KGWA 3AUOA 4F5QA 1J9AA 3KHRA 3PX6A 2GUIA 4RNMA 1U47A 5IIIA 9ICWA 1LAVA 5CA7A 3ALYA 2F1JA 2ZTEA 1QTMA 4I2FA 1RT7A 2ZUCA 1KTQA 2ISPA 3HPGA 3JYTA 2DFLA 1AROP 4CCHA 3PNCA 1JLAA 4KLMA 4TQRA 8ICVA 4CIGA 4LZDA 4NM2A 1J5OA 5CWRA 4K4IA 3MECA 3Q8RB 3SCXA 3UQ0A 3LPTA 4M3XA 5KT7A 2RKIA 3VQ8A 1C1BA 4XIUA 3I8DA 1IKYA 4J9MA 4YXMA 3AA3A 4FLWA 2RDIA 4F8RA 4RPYA 4AHSA 4CHZA 4FM0A 1A5XA 2G8VA 3ZSZA 1VSKA 2R7YA 3OSNA 9ICGA 4DO9A 9ICBA 2ASLA 3JPSA 3O3GA 3DM2A 4F50A 1BPYA 1C6VA 1S1XA 1QLNA 3RJKA 1D9FA 4O3NA 4FO6A 2R8IA 8ICYA 2BPFA 2IAJA 1COOA 3GIIA 2Y1JA 1YVUA 3TAQA 5KFIA 4HYKA 2C28A 1VSDA 1HJPA 5TZVA 9ICLA 4F4KA 4YD2A 9ICOA 5KRTA 3NFAA 8ICBA 5JS2A 5KFAA 9ICXA 5KFOA 3UQ2A 5CJ7A 2NUBA 2NRVA 3S3OA 1WSIA 3AO2A 3T5HA 4AILC 4HCBA 3K58A 2AQ4A 8ICAA 3VQ7A 4OKKA 3H4BA 5J2HA 4FJMA 2J6TA 2VWKA 4J2AA 3ZSRA 1NKCA 2HHQA 9ICNA 4YMOA 4O3SA 4ED7A 5EU7A 4J2EA 2NRWA 4IKFA 3BGRA 3BQ1A 4HHTA 5JUMA 1VSHA 2V9WA 9ICJA 1XS9D 3K59A 4GMJB 1T03A 1SKRA 3MBYA 3CFPA 4QZCA 2UVUA 1VSIA 4KLJA 3E01A 1HUZA 3JPTA 3IG1A 3RB0A 4DTJA 4F92B 3QEBZ 4CHPA 4PHAA 1D8LA 3QEIA 3KK3A 2FC0A 1VSFA 7ICSA 3KKSA 2YV0X 3AVBA 2FBVA 3JPOA 1MU2A 4FCYA 1MC8A 4EYHB 4CEDA 4KLUA 4IG3A 3AVIA 1TK8A 3IAYA 3TABA 5KFPA 4DF4A 4BE2A 4B9UA 1X1PA 3KJVA 1HQUA 2D0BA 3KLHA 1ZJMA 1UA0A 2KZMA 4HVJA 3C21A 1SL0A 1BCMA 4CERA 1WSGA 1ASWA 3VQBA 4B9SA 1K1QA 3JPPA 2OPPA 3E2EA 2I1QA 5KT2A 4DS4A 1MSWD 4KMUA 1J53A 5F9NA 3TAPA 1Z00B 3V1OA 1NK5A 4DTMA 5J0XA 5KT6A 3WNGA 8ICZA 5KFQA 1JL2A 5DQIA 3RH6A 5HNKA 5DLFA 2G8IA 4YD1A 4CHQA 2E6LA 4BXOA 4CJUA 2HW3A 2GBZA 5DK5A 3MR3A 3M8RA 3HL8A 3AVMA 1KVCA 4XQ8A 1NOYA 5J0UA 4B9LA 2RPIA 3KHHA 2Z1IA 4KTZA 1Z3EB 2BR0A 1KFSA 1JKHA 1TV9A 2W9CB 4DQIA 1S1UA 5KG3A 5KFNA 3AO1A 1CZBA 2IS3A 3OVNA 2R8KA 1IKWA 1ASVA 1NJXA 4RW4A 4M0AA 4FYDA 2WONA 1Z00A 3LAMA 3NF9A 1X9SA 4DTUA 4YNQA 1BPXA 4G1QA 2IHNA 1S0OA 3MDCA 3RJEA 1T4GA 3SZ2A 4I2IA 3QEWA 8ICWA 3LWMA 3C2MA 1UOCA 5FDLA 4UAWA 4NLGA 5J29A 1BQNA 1EXNA 3S3NA 2G8KA 1I39A 2P66A 4BDZA 1WCNA 4DFJA 4KO0A 3AU6A 5C25A 1XHXA 4C8KA 4IRDA 4B9VA 4NCGA 4ED3A 1JLBA 3NHGA 1PZNA 4DL7A 5HLFA 2DFEA 2ETJA 1TKXA 1YTAA 5FRMA 5DG7A 2RF2A 1RXVA 1FKOA 3H8WA 4Z6CA 4R5PA 3SJJA 4CF1A 5J2FA 4PPXA 3ZT3A 4FW1A 4B3OA 3FFIA 3I0SA 3PMLA 3FYHA 2HVHA 3L2WA 1SKSA 4CFBA 5J2KA 3ZSXA 4E7LA 1NK4A 1S0VA 2FPKA 1RPLA 4E7JA 8ICSA 5DDYA 2JEIA 2IGIA 3C6TA 3VQQA 4LH4A 4CJPA 3C5FA 5C42A 3HW8A 3BJYA 4F4YA 2FPLA 1RT3A 4GW6A 4GXIA 2X6SA 4M45A 3CFOA 4J9NA 4Q8EA 1K1SA 1XC9A 4IG0A 4DSEA 4CEZA 8ICLA 3AA5X 1REVA 3PW2A 4X5VA 2JGUA 3N4MB 1ZBIA 3V6DA 4MF2A 1JLGA 4DTRA 3CQ8A 3H8JA 5L9XA 3V7KA 4FLZA 1BIZA 4QAGA 5KFTA 1CEZA 1IXRA 4GLXA 4CECA 8ICOA 3KLFA 5KFSA 4RNOA 2I5JA 5DB8A 2OA8A 3AVNA 7ICHA 3VQCA 4TUSA 3MEDA 5F9LA 2BCRA 4QCLA 4JK1A 4LH5A 4DQQA 2AQ0A 1JLQA 3MABA 3EYZA 1S0NA 4PY5A 5KT4A 1TFRA 4RW8A 3AO4A 1ZJNA 2VA3A 1C1AA 4E7IA 3KD1E 3HPOA 4I9LA 4QWBA 1WN7A 2OYQA 1MQ2A 3JPQA 3CG7A 3RMCA 4KB0A 1VRUA 4J9LA 2IHMA 3H8SA 3U3GA 1WCLA 2GV9A 4W5OA 4XRHA 3L2UA 2VA8A 3ZDCA 3B0YA 4DOCA 4IQWA 2DPJA 1SKWA 4FLUA 4YP3A 1QSSA 4DTOA 3OYHA 4K8XA 1D9DA 1Q9XA 3QEAZ 2BGWA 4P4MA 3ZD8A 1WSFA 2A1RA 1ZQNA 2A1JA 4O55A 4K4HA 4AHUA 3H7IA 3GV8B 4CGIA 2V4QA 3SV4A 2IOCA 1W9HA 4KN7A 2BQRA 3CFRA 4HUFA 5DBCA 1QE1A 3V72A 2C2DA 4PWDA 2AJQA 4E1NA 2XHBA 3GV5B 4F5NA 5CZ1A 4H8KA 3H40A 5J0SA 4NLNA 4JS4A 4FZZA 1BL3A 1RILA 3Q8QB 4M9NA 4DLGA 4OJRA 4CEOA 5DB7A 4CGGA 2H5XA 2W9CA 1ZYQA 5J2EA 3O3FA 4QZ9A 3OYCA 3V1QA 4FZYA 4F4ZA 3ITHA 2PZSA 4I29A 3NF6A 1KCFA 1S6PA 4XA5A 4FJLA 5J2NA 3CM6A 4DU4A 4IRCA 4UAYA 2B5JA 5KFMA 4YMMA 3ISCA 2XY6A 4QOZB 1C0MA 4O9MA 7ICLA 3L8BA 1TAUA 3HO1A 2P6UA 2R8HA 4ELVA 4O3PA 4MFCA 1ZQRA 3CM5A 4E3SA 4HUEA 1NK7A 4LSNA 3OYKA 1WSJA 4DG1A 4F3TA 1C0UA 3QNOA
chains in the Genus database with same CATH superfamily
4IH6A 2F8EX 3TZXA 4GV9A 3EJMA 4N7TA 4E2FB 1JIHA 2DCUB 4CEQA 4OYZA 3ET6A 1ULRA 3VGUA 3GG1A 4CIFA 2JH7A 3BV8A 2NNWA 3F2KA 4W5QA 2KB2A 2QE5A 3FC4A 1FTCA 3ISNC 4WJBA 2W25A 2C2OB 2DY4A 1NGEA 3NS1A 2C2NA 3T5JA 3C94A 3SQ1A 3JXUA 3VGSA 5D3GB 2RUSA 3WKAA 2I8EA 3R5AA 4BREA 3PW4A 2JEFA 2OXOA 1TK0A 3C95A 2QTDA 4DL3A 1RNHA 4WWSA 3CCMN 4O23A 2VL1A 3EGNA 5HMMA 2YHBA 1TKDA 2B6AA 1ZM9A 1YRTA 2J7WA 3NGRA 2V50A 3O1WA 4EX7A 9ICRA 4F04B 3TQ1A 4RT3A 3ZZYA 4FJ9A 3O1LA 5EUHA 1H7WA 4CLTA 4OYBA 1FHTA 3SUNA 4HVZA 2DGOA 2IJNA 2LQJA 3V7LA 1H38A 4CNZA 5F8JA 2PMHA 9RUBA 4KLGA 4M04A 1X60A 3K5MA 5LY3A 2QA4N 2L48A 4OJPA 5CYQA 2HAIA 1ZD4A 5KFGA 2FGOA 2LVWA 2IMWP 1N61A 2D4WA 3UN3A 2EFOA 3GFYA 1N5SA 3W5XA 1QH9A 4BHQA 4LFBJ 3GBTA 3S41A 1XMQF 3DLEA 2Q31A 2W2MP 2W03A 4CGFA 3MM9B 3KLGB 4WE1A 2H54B 1KRPA 3OTOJ 1OH7A 2R8JA 3AAWB 3DYAA 3D1QA 4FSVA 2HYIB 2G06A 1U6BA 5KPZA 3ZSYA 1DKGD 4EBDA 1VRTB 4WKYA 2WBMA 1N36K 2W2PP 5KRSA 4I2GA 1TKTA 4CESA 1K0TA 3JQJA 3J81O 2GH1A 2E7XA 2CQ1A 3G2XA 4FZVA 4I2CA 1PIEA 2BQUA 2CUYA 4P75A 3VAJA 4ES3A 2BW7A 4CT8A 1SQKA 2QKQA 3RB6A 1OSCA 1HMVA 4HHHA 2AZ3A 2HBQB 4OZNA 3WK5A 1CJTA 4LF7J 1B22A 1S49A 5B0DA 2PSZA 4JI4J 4DF8A 1U1LA 1FEEA 1N5VA 2OWOA 3E9PA 4WFZA 1O6XA 3I0SB 4WP3A 4J2DA 2KE7A 5D15A 4AYBF 4RW9A 4CD1A 3K2YA 3M1YA 1RHQB 5CYQB 1WSEA 5A6WA 4PHTX 2NXNA 5HVGA 4DL5A 2E6MA 2KG5A 1FFGB 2ILYA 2K8BB 3GFHA 4BY9C 3BS5B 1HHSA 4KPYA 2W2NP 3ENAA 2NXCA 3G10A 4F3MA 2DBYA 3NVKA 4QWDA 3OR1A 1N5YB 1EWRA 2EVZA 2KXNB 1ZQGA 2DCLA 4JWMA 3O6QA 2HZCA 1N36J 3Q0AA 4N47A 2Y8WA 3UE5A 4W5NA 4BDYA 4URQU 3UNYA 4K50A 1RCHA 1A0OB 1N62A 4PKDB 3FC9A 1NDPA 3VQSA 3RJMB 5DZ6A 4ECUA 2CPXA 1FCAA 1XQIA 5AE3A 3DXSX 1WWUA 4QS7A 9ICCA 4TLRA 4BGDA 2XCPA 2QIFA 2BKEA 1J5EJ 2F9DA 3DXMA 2ADCA 2B0CA 3D2EA 3TJ9A 3X3UA 3MUTP 4OLOA 1ZQCA 1WEYA 2L3MA 2ASOA 2GS8A 1QQOA 1DTQA 9ICMA 4MIBA 2WBNA 2E5IA 2NXJA 3LL3A 4JYAF 2O6KA 3PEJA 3QRQA 4ZVTB 5BPNA 3G8TA 1CJKA 3O9SA 3M30A 1IG6A 2F1FA 1EB0A 1NGIA 2YQ1A 6FDRA 3NMUA 4F71A 2YKNA 5GAEU 3C1YA 4RPZA 5J0YA 3WC0A 3CJ1A 1RDDA 3P8BB 3OQ2A 2DGTA 3QLHA 3OLBA 1RBAA 2NPFA 3D68A 3N6LA 3CJ7A 5EY4A 3IS9A 4DV5J 9ICKA 2CQ4A 1NOZA 2HSEB 3VEZA 4H0PA 1RBUA 1SV4A 4CJWA 3UPFA 2RRDA 1FKPB 4NLRA 5ITHA 3VAMA 2LU1A 2CZ4A 1YLXA 3KTQA 3LUYA 4DU3A 1VHFA 3MEKA 3NRBA 1IKVB 4MK8A 1XR6A 3D2WA 2ZZTA 7ICJA 2NCKL 4EP5A 2O8DB 4NXNF 4R8UA 1SH3A 4BR2A 5D4LA 2LM1A 3VEWA 1RZTA 4NXZA 1LW2A 1SKUB 1NK8A 2XTJP 5AI5A 4JHDB 1PVPA 1YI2S 4C80A 3M2UB 4JLHA 5D0GA 2JR5A 3VEVA 4JI8K 3JSBA 1UJ4A 5DM7Q 4X4RA 2ALZA 4URGA 1IN0A 3S6EA 2P5VA 1HNZF 4FJKA 3NH1A 3PSIA 2QMUB 3O2IA 5EE1A 2J9CA 2B21A 4QS9A 1SWWA 4PHPA 1NGGA 2F8SA 2Q6BA 5EWGA 1YJUA 1UJ6A 1CZ9A 2MTLA 1N60A 4MAKA 3O4NA 3ZC4A 3U6FA 3MR6A 3VV2B 1EKEA 1DBDA 4F93B 5DB6A 4KRFA 4RT2A 2ZIVB 3SQIA 4A2BA 4RQ8A 1DARA 3KUHA 3RTVA 2CFXA 4FFDA 1SXDA 4RUCA 5BR8F 1KSPA 2AGOA 1WWHA 3QDKA 2FPMA 3C7NA 5J0OA 1XMQJ 2HMIA 2BJ1A 2B4VA 4KGXB 4ETXA 3HWTA 3I0RA 4KGKA 4ZVGA 1ZPVA 3V6DB 4CGHA 3AVFA 3RH4A 1IIPA 2ASDA 4HAIA 3IR5B 2ZH1A 3JSMB 4EFHA 5DRKA 4RBUA 2DPIA 1PUZA 1KFTA 3K17A 2EXUA 1QM9A 1ZQJA 3CIZA 2HMXA 1FRIA 5F41A 4ZPBA 1F0MA 2HHTA 3O08A 3CCSS 3D6JA 2NYVA 2OPQB 1KL9A 4RQ7A 3GIMA 3BS7A 3H0PA 1RTDB 3VTIA 2CPJA 4DKWA 3HLUA 3OTDA 2FSKA 5K20B 1N4LA 4KBOA 2DNRA 5EN1A 2GVZB 3UN5A 4M9JA 2F8TA 1WUAA 1MROB 1RDUA 4JKHA 2HBRB 2AJ2A 1FK9A 2N82B 4I2PA 3R7NB 2Z1JA 2EHGA 5J0PA 3VGMA 3DDHA 1WSHA 1NO8A 3V1RA 3QU2A 4KLIA 4ED2A 4RW8B 1Z05A 1UWBA 1QTNB 4ILRA 1IV8A 5A0YB 3C6UB 5I3UB 1BGXT 3IR7B 2A6AA 1BNOA 2CPEA 1SIWB 1PCAA 4L74A 4P2SA 4FYVB 4F25A 5AI4A 3BDEA 1RQ0A 1Y5NB 2V94A 3BQTA 3AVLA 4V1Ak 3KKAC 2RHFA 1NSAA 2RE2A 1U24A 1CJVB 3MAAA 1ZQDA 3NTUA 2ZUBA 5CHCB 4M41A 2EWHA 3O4QA 1NZ8A 2E5LJ 3M1VB 2VQFK 2J7KA 1L3TA 1CC8A 3VQ5A 3ZZTA 3CIMA 1SQFA 2UZAA 4FJGA 1BI4B 2YY3A 2W9MA 2KVIA 2DNPA 1RTDA 5DBBA 4WFBL 1GMVA 3T5KA 3FJ2A 4IH5A 3LZIA 2LPEA 2G8HA 4DCJB 1EX4A 1VCTA 4Y1DA 1GLDG 1Y9OA 4PWWA 1PYOB 1Z25A 4DPXA 2V6AA 3KJFB 1VDVA 5A8KB 2QXFA 1ZBFA 1NZAA 2RN2A 3RMBA 3BSNA 4UASA 5ETPA 4Z2XA 4C8OA 4KLLA 3N7SC 1AQ6A 1S6QB 2CNOB 2YB4A 3PYEA 4J9RA 3QESA 5C2GA 1YXQA 3I4HX 2YXLA 4UY85 3HDSA 1NHVA 1GH8A 1KAZA 3FR0A 3K1ZA 1PAEX 4NLKA 4DV1F 5TKWA 5KQDA 1VMBA 3KZBA 5DS7A 3R5JB 1RGIA 3QUCA 2RQ4A 4FXDA 1S59A 4NXNK 4FWLA 4UY8O 4KBIA 2UV8A 3NL0A 4FJXA 3G6YA 5C10A 2JSXA 5GAGI 1XNQK 4NYPA 1N52B 3C6HA 4LF7K 5AKZA 4M5DB 1KQKA 2VG7B 2KHDA 5F8HA 2AGQA 3D2QA 4ECYA 3U1MA 1ZQUA 1XSPA 3G8QA 4FYXB 1LXJA 3CCSN 2HGLA 5BN8A 3CJSA 4KLTA 1URJA 4YR2A 4RPFA 1ITPA 2E1ZA 4ZVSB 4PZNA 2EFVA 4TURA 1HYSB 3NLCA 1UFLA 4NZ7A 3VQAA 4A2AA 1CVJA 3PKYA 4YOXA 2W41A 1IJEB 2IDEA 2E5JA 2KG1A 3ZDBA 1VQ4N 2DXFA 3L4BC 3EWAA 1JJ2M 1S5JA 4C8ZA 4NYNA 4WK1A 1WOPA 4QZIA 3ZD9A 1VSMA 4YORA 2QGFB 2CPFA 1M1GA 2BHNA 1UTAA 2FDNA 1O8BA 3ENWA 2UUWA 4KHUA 2BE7D 3BZKA 5CHGA 4M47A 3AY9A 1V3ZA 3AODA 2G2YA 2VG7A 2K4IA 5HL7Q 2ZBCA 2Q79A 3CF5L 3N97B 4L8RB 3RW6A 4I2BA 1T0TV 4B3MJ 2F7TA 1EWQA 2QW9A 3JAMY 1ZETA 2RD5C 4A5BA 4FWSA 3EL2A 3H45C 4RWXA 1NRKA 2V52B 5AM3A 4KY3A 3P96A 1X4EA 2QKBA 2F96A 2CJKA 2OM6A 2D74B 1F44A 5HI7A 3SDEB 5ETOA 1HQEB 4C8YA 1D1UA 4ZS6A 3GYNA 1YI2N 2AJ0A 3BREA 2W42A 2KU7A 4D3GA 1QQNA 5J2MB 4Y2KA 4JI3J 3NGKA 4YY3F 1NI3A 3D0GE 8ICMA 2DISA 4OJLA 4JRPA 1HW8A 5L1JA 3T6BA 4WJ3B 4LSLB 4C4WA 3G25A 2G2ZA 4HT7A 3J7YI 2BJ9A 1FFVA 1QVGM 3GPAA 3MM9A 3ENQA 2DGQA 3TJAA 5E3PA 1IKYB 1Y3JA 2B4JA 3OGUA 2XLIA 4RBVA 8ICUA 2W4DA 3HX0A 2HOFA 5L46A 3OYIA 2ZVSA 4I2DA 4YQWA 4KYZA 3R9KA 4A8YA 4CI0B 1RBTA 4DSJA 3TA0A 3KKFA 5GVQA 3QX7A 3QINA 5K5MA 2O4GA 1BU6O 2A42A 3UD3P 5CZVA 2Y9TA 3OR2B 2FJAB 1ZD5A 8ICQA 1N5TA 4JK7A 4ED0A 1HBNA 4KLEA 2PN6A 3GB0A 5B0GA 3HYFA 1YZ6A 4C3LA 4BG9A 1IG9A 4NMLA 2R42A 1SAZA 2KKZA 2HEKA 3DLBA 4HH1A 2QX0A 3MAQA 4DV5F 1YIJN 2DXEA 5L8RC 2DIUA 3MTKA 4U95A 1ZQTA 3HZ6A 1X5SA 1GOCA 2NO5A 3PRBA 4I2QA 2C2EA 1WAFA 2GQQA 1F0XA 4LF4F 2MRLA 4FKXA 2PEHA 2GEMA 4GKJJ 1EETA 3N6NA 5M1OA 2C3PA 5J1PA 3RR8A 3MM6B 2HF4A 4DR6J 3I5AA 4ECTA 1YBTA 4J90A 3MPWA 1NAQA 5IFMA 3BS9A 2WF6A 1BI4A 3J80U 7ICQA 2MQMA 3KUGA 4RW7B 3D6TB 1U1OA 3MM5A 3DDKA 4LFAK 1KBUA 2U2FA 5K8PA 3IBPA 2N3OA 1AFIA 2V0NA 2X74A 4JB8B 1GMWA 2PA8D 1O08A 2RLTA 2IC3A 5GADU 1NJWA 2XHWA 4DR7F 3CJKB 2M9NA 1EAYC 1VQMN 1ZA2B 2HG4A 2XEXA 3AH6A 5I42A 2ZE2A 4DUYJ 4WYLA 5HMZA 2UUAF 3LP0A 2LYBA 1PYSB 4AHVA 5LM7E 5JMNA 4RPXA 4J9VA 3M8PA 4CLFA 3NGYA 4C3KA 2K1RB 3ID8A 1HNVA 4ZITA 4B3RF 2P9CA 3EUNA 1P9YA 1WG5A 3VAGA 3TADA 4YOVA 5EX0A 5CB1A 2WTFA 1VGYA 3BPDA 3PVXA 3GSDA 4MYTA 1RACB 1CLFA 4FVMA 2LA6A 4PEOA 1HNXF 3QNWB 3J81U 8ICNA 3CJ2A 2WVCA 5HRSA 1WC6A 4JKAA 1SUQA 2BX6A 1GMUA 2E7WA 5CZXA 2GHWA 5GMDA 5H9FJ 2K8CB 4RQ2A 4A61A 3TAMB 1V4SA 2ZF5O 3UFCX 3THYB 4LY7A 1PILA 3HSDA 2QL7B 3EX7B 1ZQHA 1JKHB 8ICJA 5KPTA 3H42A 3C5GA 3GE1A 1V3SA 2AX0A 4FLYA 2FTRA 3W9JA 2VWJA 2YBVA 1Q53A 4KI6A 4CVNE 5C2CA 1CULB 2KN7A 3NEKA 2P9SB 4P10A 4CFAA 4K4WA 1IBMK 1S1VB 3NWRA 4MIWA 2MGZB 3DRSB 3EICA 2NZ4A 4I6MB 2EC2A 3F0NA 3TZZA 2B9WA 2PFDA 4KV8B 3ILJA 1A77A 2RT3A 4F02A 1SC6A 1RKJA 4OKJA 2QFJA 1XR7A 1HNIA 5ADXH 3EE3A 2DYAA 1Y0HA 4DV1J 2QLWA 3R5GA 4DTPA 3HT3A 3AD9C 2WB1C 2JFKA 5CHIA 4WTOB 3WNHA 4ZVPB 2V4RA 3OYFA 3PACA 1T3VA 1O0PA 3OYJA 3V9SA 1BWVA 3DXKA 4DV0J 4CH0S 5KFCA 1R8CA 3MOZA 1HIYA 5FD1A 5ETQA 1S9FA 3PMNA 1XMBA 1B0VA 4ISGA 3DLRA 4KFBB 4KLFA 2WF7A 2UVVA 1EQMA 4Q2MA 4O3OA 2GO7A 3H7HB 4DX8H 2CXEA 3GFXA 5ALRA 1GX5A 4PA1A 1NJYA 5BREA 4RL1A 1JXBA 3B8AX 5AM1A 5KG0A 3P5TL 4KHYA 4CK3A 2F1IA 4YDXA 2WB1D 1RT4B 3QU7A 2RB7A 2YHAA 1U0HA 2RRAA 2WC9A 3VAFA 1U2CA 4Y2TA 2OELA 1Z26A 2V34A 3W2WB 2Z2YB 4PHEA 2YKNB 2D6FC 3JPRA 3D6HB 3T1YF 3ZZRA 1FJ7A 3HHLB 1ASUA 2BQ3A 2WOMA 2RP5A 2ROPA 4CEEA 4KH6A 1DGKN 1X3MA 5LMUK 1TKZA 3J7YU 4M5MA 1SV0C 1RT2A 1RDWX 1ZQPA 4FLXA 3VR1A 4F2RA 1BPBA 2QG9B 4CJSA 3US5A 3UR3C 4FWPA 4O0IA 1T6CA 4XUSA 2C3OA 3FGUA 4LRDA 3D9BA 2CJAA 4OI3A 5EWEA 1W25A 3H46O 1T11A 2UXBJ 1NZBA 3GZFA 3CJQA 1Q1KA 1ZZFA 3MX5A 1IVZA 2NO4A 4DWIA 2VFTA 3DLEB 2D3OR 5I3UA 2QB0B 3MFIA 1QJHA 2CVIA 4C4RA 4JYAJ 3QB0A 3DU6A 5AKHA 2OPPB 4X4TA 4PABA 2W01A 1WC4A 2EH9A 2MKCA 2V68A 3KG0A 4EBEA 1JJCB 4LBPA 3ZDEA 3IWXA 3C3LA 4A5AA 4BACA 2IDLA 1KQQA 4PAAA 3THXB 4J9KA 3IMQJ 5HAOA 2XS2A 4KHPK 5HHIA 3UW1A 4O5KA 4YY3K 5HO4A 5E26A 3B0XA 2LFVA 4P4PA 2R18A 2HNYA 3OYNA 3NBPA 2PYJA 3OBYA 4WF9L 2R7XA 1P8ZA 4KN4A 1RBLA 3G0ZA 2NRZA 4JV1A 4W98A 2BJ3A 2YPYA 3FZ2A 4ZLLA 3LYSA 3U4LA 4FF1A 3KWGA 3EVWA 1CJTB 4MDBA 4CHYA 1JB0C 4LJMA 1MWQA 1YJWN 2KM8C 2R7UA 1PYTA 4I7FB 3HKZF 2R2TA 3A0BU 3FLCO 4K4TA 1X9WA 4LF2A 1B3TA 2QSFA 1S8OA 3R8EA 3UKUB 3T7ZA 3V4IA 2E4LA 4C8NA 4M63C 4QS8A 2QMXA 9ICAA 4QYZJ 3NDKA 2IYIA 3H2LA 2ZH3A 5CXTA 4GXJA 3MGIA 3I55S 1ZD2P 5AKXA 3THXA 5D3GA 3H3OB 2D3ZA 1Q46A 4ZVRB 2LEAA 4DR7K 4NOHA 2KYZA 3BR8A 2MSNA 2GWKA 3BQ7A 3SSQA 2QV6A 2VJVA 3VZHA 5CH7B 1A5WA 1HUXA 4RQ0A 3BO3A 1KLNA 2FLNA 4PJ0U 1WI8A 2FZKB 3CD7A 4RQ6A 3T1HJ 4NLVA 4HI2A 3DOLA 3RYLA 1FX2A 3FM9A 2BANB 3BSAA 4LIWA 2OFHX 4KKOB 5GMEA 3LPYA 5J2DA 3E51A 2ZH8A 4ZPCA 1FDDA 1BQMA 2FLPA 4LF4K 2FY1A 5J2CA 2V2QA 1UT5A 4X62F 4CZEA 3IAM9 3FAHA 4WKRA 2XMMA 2V7ZA 4IRKA 5E7OB 3DU5A 3GYXB 3L3CA 3CPEA 3TVYA 1IBMF 1X4FA 2QL9B 2X51A 2J6SA 4TQSA 1KQGB 3OYMA 1CJUB 2HHHK 4C2MA 3TEHB 4J9SA 4FO0A 4WBFA 4BR4A 4JI1J 3RJGA 1SVDA 3CCEN 8ATCB 1QE1B 2ZD1A 2MY7A 3NNCA 4JUZA 4YR0A 4DR1F 2AGPA 5H2FU 2WZ1A 1X2IA 1L3KA 3F2DA 4IWVA 3C2PA 4P4OA 1N34F 2FYXA 3Q8LA 4PYDA 3VAIA 3ENBA 3RJIA 3SQ4A 1C1BB 3QRRA 1U2VA 3ZT4A 2ZIWB 3IP0A 1VQMS 1ZH5A 5H9EK 1IKXA 1EKRA 4ECQA 1B0PA 4FXWA 3GIKA 4FF4A 5KG5A 2JLGA 4DUYK 2AP6A 4JRQA 4RW4B 4A8SA 4DV0F 2BRLA 2ERRA 3BBBA 3Q8PB 3EVMA 2W9BA 3HVWA 3WDOA 3P6YC 2VPXB 1ZBLA 1RTZA 1RA6A 3RB4A 1DFDA 4CF3A 3NMRA 1J9AA 1JJ2R 1U47A 9ICWA 2GUIA 1OIAA 3VOVA 3CTRA 5HQMA 4JI4K 4WQ4A 2ZHAA 2QLTA 1KTQA 3BN4A 2ISPA 3SR6A 3PNCA 4LMZA 4KLMA 4CIGA 4NM2A 2B9YA 1YTYA 2KIWA 2H3FA 3LPTA 3P4UB 2RKIA 5ALQA 1C1BA 1KN5A 1M90O 4XIUA 3W2VB 1UQVA 3CE8A 3SEIA 1IKYA 2DEIA 3I33A 3E0FA 4YXMA 1XN9A 3PJ9A 3R1XA 4L75A 4RPYA 3E8OA 4Z7YA 3GZ7A 1VSKA 4FWNA 3FQLA 2PAVA 3GMGA 1JLCB 1C6VA 2KYXA 1D9FA 1ATSA 4Y2XA 8ICYA 1COOA 2Y1JA 5KFIA 4HYKA 5TZVA 4JI5F 3IDWA 3NVMA 5DDRC 4F4KA 4YD2A 5I3QA 9ICXA 3SBMA 5CJ7A 5J8YA 1TAMA 5C2DA 2PIIA 4H5RA 5FPDA 3K58A 2AQ4A 8ICAA 1TL1B 3EEQA 3VCBA 3QFHA 2J6TA 3F9MA 2HHQA 4CNYA 4YMOA 3OTCA 3WKEA 5EU7A 4PL7A 2NRWA 1EJ7L 3MK6A 1ZTTA 5AI6A 2WTUA 1M5SA 1VOMA 1UAWA 4BROA 2KT3A 2N7CA 5ALSA 5AQOA 3IV6A 4QU6A 5GAEP 5L9NA 2BACA 2MJNA 4QIFA 2DIVA 5AK6A 2NS1B 2P9LB 1UJ5A 4CH7A 4B3TF 2AEJA 4PHAA 1D8LA 3KK3A 1BDGA 1VSFA 4CO3A 4ILLA 5HJXA 2FBVA 1VS3A 4CEDA 2O5DA 5HSPA 1H73A 4RX6A 5H1SV 4USWA 2Q97A 3D2FA 4DR4K 3OW2M 1R6YA 2JWNA 3U8XA 1W97L 3IAYA 5B66U 2GNKA 3FCWA 3TABA 5KFPA 3IWLA 3AL0B 4QYRA 1X1PA 1BXNA 1VK3A 2JC0A 3CGIA 1M90T 4OJ3A 2M9KA 4RBTA 2E2NA 1JJ4A 4KO0B 2AD9A 2MXYA 4B9SA 2YVSA 1J27A 1HR0K 1OKJA 2WAQC 3DRRB 1MSWD 1GFWB 4KMUA 2QEXN 4DTMA 5J0XA 3WNGA 8ICZA 1JL2A 3A3OB 2BTFA 5DQIA 1HQ2A 2E1MC 2R7OA 4DV4J 2DR7A 4DZDA 4IG0B 2AF6A 2EZYA 1C2PA 4CJUA 4WFYA 2PFUA 4UZCA 3AVMA 1KVCA 4XQ8A 1SV5B 4Y2QA 2BABA 1CS4A 2FGCA 1L6NA 2Z1IA 3PYDA 3KLHB 4KTZA 4R0JA 3A12A 3ZETA 1ZM3A 1JKHA 1PKUA 3CC7S 3MDFA 1U02A 3QT7A 2F40A 2YWKA 3OVNA 2XG8A 4YEAA 4MKAA 1IKWA 3HSCA 1JJHA 4M0AA 1JNZB 4FYDA 1Z00A 4YY3J 4MKYA 5AFUA 1YVNA 3BSOA 3CB4A 1BPXA 2IA0A 2K06A 2ZJPL 2MQQA 2IHNA 1S0OA 2W43A 3SZ2A 1RT3B 1Q8LA 1RA7A 3C2MA 2FHOB 1N63A 2NQPA 2P66A 5A8WA 4KO0A 5JICA 3C29A 4NEYA 2HOQA 1C0GA 2ZH4A 4X62J 4ED3A 4CZJA 3NHGA 2J8SA 2A40A 1PZNA 4DL7A 5AQLA 2DFEA 2ETJA 4B3RJ 1TKXA 4KJIA 3HM8A 1S1UB 2BA9A 5ALDA 2RF2A 2G5HB 1FKOA 3H8WA 2CRLA 4FYYB 5J2FA 4PPXA 1B4FA 2RE1A 4B3OA 1ZAWA 2CYYA 3TA1A 3HULA 3H2VE 3PMLA 3FYHA 2IVFB 3BEXA 3MDQA 5THWA 1Y10A 1NGCA 1SKSA 3J7ZO 4KR0B 5F8NA 2QWOA 1S0VA 4DV2F 1RPLA 2E2QA 8ICSA 2DL0A 2IGIA 1HX1A 4W4MA 4ZPWR 4CRJA 2ZM6F 3C5FA 3J7Z5 3HW8A 5L1MA 5A8RB 3D67A 1Q5YA 1RT3A 4S0MA 2X6SA 1UZHA 3CFOA 4J9NA 1K1SA 1AT1B 4C97A 4DSEA 1TVRB 2JGUA 5CYJA 2JOQA 4PPZA 2GX9A 4MF2A 2E3TA 4YMEA 2LKYA 2Q4TA 2H3IA 3IWNC 2POKA 1VJQA 3H8JA 3V7KA 2CQDA 1BIZA 4QAGA 1JLEB 1CEZA 4LF5J 3OFGA 3N01A 3KLFA 5AQQA 5KFSA 4RNOA 4AFFA 1JI7A 1HARA 3A3PB 2QSWA 2GWJA 1H0HB 4ZMMA 4B3RK 4YOTA 3VQCA 1X4HA 2CWXA 1R3NA 3MABA 1SH0A 4IOCL 6FD1A 4P0PA 4PY5A 4N8NA 1N32F 2CZ9A 3QJLA 4OHVA 4CLSA 3KNAA 4I6WA 3IRUA 3CJ0A 2X3GA 1IJJA 2FPHX 1C1AA 4E7IA 3KD1E 2QJ3A 4QWBA 2F65A 4DXLA 1MQ2A 3JPQA 2DK2A 2NZCA 3CG7A 2E1PA 3DDIA 2DJWA 2LDYA 2GV9A 1FE0A 4XRHA 3L2UA 4IQWA 3HSJA 2P6SA 3JS9A 4FLUA 1SKWA 1GK8A 1S4FA 2UXBF 3CNQP 3DRYA 2C42A 1QSSA 3N4WA 1D9DA 2KJVA 2BGWA 4ANDA 4KH1B 4P4MA 5E33A 5JRTA 3FMWA 5JXSA 3AAPA 4PUOB 2D9PA 2A1JA 3GTYX 4LFAF 1FFUA 4K4HA 1Z2ZA 4M5DA 3H7IA 1VQNS 2MLZA 3VAKA 2E5LF 1IBLK 2KVQE 3UE2A 3SV4A 1QZ6A 2M8HA 2IOCA 1W9HA 3VEYA 2F4VJ 2P9GA 4GIBA 3KK2B 1JUDA 3V72A 2W6LA 4FVCA 4PWDA 2AJQA 4NYZA 1N2XA 3ZTQA 3TNVA 2XHBA 2ZUGA 4QPXA 1IQZA 4H8KA 1YJRA 4YDUA 1U26A 5F3ZA 2LQ5A 1AUSL 4B3TK 1YJNN 1EP4B 1RILA 5BR9A 4M9NA 3IAS9 4CEOA 2CPHA 3A8IA 2H5XA 4DR5J 3IDHA 1O5JA 3GU0A 3O3FA 3ZZZA 4OI4A 1V97A 2BBEA 3V1QA 2VBXA 2LM4A 2B4OA 5DM6Q 4JI6K 4A48A 1S6PA 1RT5B 5B08A 4DU4A 4IRCA 4UAYA 4BUGA 3OL8A 5KFMA 2B5JA 4QOZB 4O9MA 2JHEA 3HO1A 2GHPA 7FD1A 3KDNA 4K4SA 4LFBF 2KKHA 4D3HA 4IO9Q 1VQLN 3ZX0A 4F67A 3ZZPA 5JTIA 3G82A 4I2PB 1RFQA 2RU9A 2OMLA 4IDHA 3LANA 3MWBA 3TKAA 4K4XA 4NLZA 4CF2A 4B3SF 2QYCA 1VQ5N 2DRDA 3H0MB 3Q7CA 2ZJRQ 2ZGZA 4CEBA 3VMFB 4J2BA 2ZFHA 1YJTA 4IQXA 2MKIA 3SQ0A 1VQNN 1QDUB 3UWTA 1PJ5A 2HHHJ 4Y3CA 5GAGP 2A2CA 5E3RA 3M8ZA 4IOBA 4CHOA 5J2MA 4RWTA 3W65A 2A3ZA 4RZRA 4J8FA 4MLEA 4EO8A 5GAHP 1Q9YA 3ICLA 1TUYA 4BR9A 1N33J 3FSIA 5H9FK 2DHAA 4JV5F 3QSIA 2EDUA 4H5WA 1A6SA 4YMNA 2PMZD 1XUPO 2BDUA 4Y2PA 3WK7A 3J80O 2E7VA 2RRBA 4OKEA 3V4MA 4O0JA 4YFKA 5JVGL 5G0RA 3AQPA 2L08A 2P9SA 2XY5A 2CRXA 2XGQA 4FL9A 2GCFA 1T3OA 2FDRA 4K0KF 5ALOA 2KOBA 1RQLA 3TFRA 1SL2A 2BKOA 1T7PA 2ALYB 3SENA 4CE6A 3FBBA 3PR4A 1RBOB 2E1FA 1R0AB 4IR9A 4RR5A 5HK4A 2EBEA 4FVUA 3CC2N 1UEUA 1OH8A 3DM2B 1XI1A 1M0SA 2AV5A 4QJVA 2P9PB 5EXWA 4NLOA 5IC4B 2LQ8A 1CJKB 1BUPA 3IMXA 2XY7A 3JTOA 5HVFA 2CJQA 4AD6A 1TU0B 4Z4CA 3M30B 3TAGA 3Q8MA 2F8KA 3S01A 2FJDB 5BPMA 3QYYA 1G3OA 4RKUC 1RTIB 3T79A 4MTPA 3SUQA 1R43A 3OHRA 1RHUB 2P9IA 4M5HA 2GVZA 2LMRA 1A6LA 2Z4PA 3TAFA 3MC1A 4LSNB 4YN3B 3R9LA 1UCVA 3TJ8A 5AM0A 3PHTA 5M1FA 3BGUA 1IM6A 4DTNA 3OVBA 3K2PA 1H98A 2QKKA 3H25A 1LFWA 4P0PB 2QO3A 3HVRA 1JXVA 1DLOA 3N5BA 2HBKA 2QTWA 2BM1A 1M1KT 2WF8A 1U1MA 3ADAC 5HR6A 2XMKA 3UXPA 2ZE2B 1E4FT 2YKAA 4NXMF 3WXMB 4P0QB 4CTAB 4PCQA 2EFNA 1NU0A 5CABA 1RDCA 3GQCA 4FM2A 1KW4A 3TZYA 9ICQA 2ZOGA 4MFAA 4AM6A 3MF5A 2JRZA 2PFFB 2K1RA 1HYZA 3CCQN 3I76A 3HHNB 1AA1B 3WK6A 4G3IA 4K2JA 2RQMA 2ZIUA 5E3CA 3P5JA 1RWNB 4KHSA 2NREA 2CPIA 3MD3A 8AT1B 1FF2A 2HWTA 5AQNA 1CPZA 3A5NC 1VJ5A 1HBMA 1JCEA 3RMDA 2Y0SC 2G07A 4FWQA 1YWXA 4CZMA 3PCOB 3KLVA 1N48A 1HBOA 3GG0A 3QWPA 4DQPA 3UXNA 4GMKA 4ZP8A 4OV6A 3GILA 3SUPA 2HHWA 3OS2A 3LPEA 3CCJS 4C7QA 5A0LA 5E2QA 3OR2A 4XO0A 3WQUA 1SJFA 3Q23A 4CH1A 5A8KA 2D41A 4P0QA 5CCMA 3RAXA 1EHWA 2AEFA 2P9LA 4H0VB 1TL4A 2OP5A 3SFUA 3CMAN 1OSDA 3SJHA 1TR0A 4YB7A 3NGIA 2Q3SA 2F4FA 3ITHB 3IRXB 4OHZA 1QHAA 2K89A 2YH1A 4O4GA 1N32K 5DDQC 3M9MB 1Q18A 5IIKA 4PZVA 2VU5A 4DOAA 4GVBB 2ZQBA 5B0CA 5HBMB 4CZLA 4ES2A 5C24B 4RW7A 2DB1A 1B64A 2W4CA 1UT8A 3M3ZA 1NBEB 1I5OB 2ATQA 2YX6A 5BYRA 2MKYA 5ALZA 2EZZA 3TANA 2ITMA 3L3VA 1PJ7A 1NM2A 1QAIA 2CQIA 2PGCA 1UA1A 3F9KA 5KL8B 4CEAA 1W7WA 4IEEA 5EVZA 4I68A 5IM0A 2Y0SD 1K44A 2AX1A 4FJIA 3RVCA 3CDWA 1ZAXA 1RT1B 4E7HA 4I56A 1S1WA 1VQ9S 3QSYB 1DT9A 3WT0A 3T19A 1Q3UA 3RUBL 2YHWA 4I0WA 2HQDA 5ALXA 5LMNJ 3FNNA 1NWKA 2C2RA 1TTHB 1XQSC 4GVEA 1Q4RA 2XNRA 2I6XA 3ETLA 2OH2A 1J2MA 5SWMA 3HVAA 2ASJA 1LOUA 2PA3A 3NOGA 4OHXA 3DXBA 2K4HA 4TUPA 4UATA 7ICPA 1BCOA 3OTQA 1WC0A 3KXDA 4X84A 1G7CB 4X4QA 2HMPA 2CKWA 4KHPJ 4Y1CA 2JXJA 3AT1B 1SWVA 3FMBA 5IQQA 4IL6U 3B54A 1SJ4P 1NLKL 5BOLA 2C3MA 2LLZA 1FD8A 1KVAA 4K41A 4ZP6A 9ICTA 2DR8A 2YMQA 2RHQB 3HT0A 3H20A 5FRNA 2J6UA 1NNEA 2EFQA 4A59A 2P9PA 3H0LB 2HRUA 3LP2B 1LW0B 3CJCA 2W7OA 2ZJPQ 1NMNA 3W9HA 3KJQB 4P2HA 1SPBP 1IR1A 3TVKA 4BR7A 3PRDA 4B3OB 4JI0F 5M1PA 1LB2B 3KLEA 5C7PA 2APOA 3MWPA 3QT8A 2ZOMA 3NCPA 3KZIU 5E3AA 5ETNA 3LPUA 1JXEA 1RTJB 3IG5A 4HTLA 5CEHA 2WMMA 5ALGA 3QZ7A 5J2QB 2KFNA 4LVOP 3C6TB 3F56A 3MFHA 5GAHU 3MXHP 4BRHA 4JK9A 3M2VA 4M5LA 4B3SK 2ZHBA 1KN6A 1S6OA 3N7RC 3J7ZT 2OGUA 2MQ8A 2E1RA 1OY9A 3UKRA 2KXHA 3NMAA 1N34K 3D2FB 2JHDA 2JJ4D 4LVNP 2CGKA 4WF9Q 1WI6A 3MX2A 1L3SA 1KKXA 5EGYA 2JC1A 3DLGB 1QHTA 4M3YA 1MROA 3MCNA 2DXDA 4QIWF 1ZOLA 3RF9A 5ADXA 3LGHA 4FK0A 2K2PA 1HPZA 2MAXA 2VKRA 2KJ5A 3KUEA 5IT9Y 2YX7A 1VQ4S 4Q43A 4A8QA 5GAGU 1XNRJ 3LDPA 1WOOA 4N41A 2Y0BB 2WK4A 1ZQZA 2XM3A 1DGJA 1KWMA 4QWEA 4LZGA 3DOLB 4AL7A 3T5LA 5DG9A 1S1TA 3OTOF 3ENVA 5CR0A 4IFYB 3C65A 3PRVA 4OZLA 4UUWA 1H2TZ 2UXDJ 1OPZA 4X65J 5KFJA 1YJNS 2B6GA 1IKWB 4K4ZA 3NVYA 2P1JA 4MK9A 4DHYA 4F9OA 2A10A 1FERA 2GJFA 1OUQA 4U7BA 3HSTB 2HHSA 1N5QA 1VQON 4WYWA 1SL1A 2X7IA 5DDMA 3SDEA 1HPZB 1M1KO 3V9UA 3M6ZA 3A5MC 2VBYA 4CJKA 2NLXA 2IM0A 5KG1A 2VV5A 3RJFA 4Y34A 1JQGA 3KG4A 4DU8A 1J5EK 4M42A 3MN9A 2O8EA 2FMPA 3P1GA 4FF3A 3QO9A 2DR6A 3CD5A 2KKVA 1TMMA 5AQSA 1RXWA 2FJVA 1TUGB 4U7UK 1YRXA 5CP2A 4JI5K 4GFJA 1MQ3A 3CF5Q 1V9OA 3QNNA 3HVTB 2BM0A 4M95A 3OT9A 4J91A 1YBAA 2GVDA 4AM7A 2M7SA 4IFVB 1VSLA 3M32A 4LQ9A 2H1YA 5D0HA 4FBUA 4NLBA 1UL3A 2PC6A 2YKMA 4WIIA 2W40A 3U26A 1L7MA 1OVQA 3ZSQA 7ICEA 1S1VA 4DTXA 1RTHA 3QEXA 1VQ5S 2XICA 4LFAJ 2HWIA 3T9NA 3WKDA 1RHRB 1U48A 2GAHC 1NKEA 3TI0A 4UOCA 3H5XA 5HRRA 1BQNB 1YT3A 2QB0A 3ISDA 3L4QA 4H5TA 4AHCA 4GRSA 4GKKJ 3WX8A 3AOAA 4CJEA 4DV1K 1W2BR 1FXDA 1H3DA 3UM9A 2FJBB 3R2DJ 2ITGA 3RMAA 2DR5A 4E8UA 4R25A 2WAQF 1XSNA 3EKSA 2N1RA 5E41A 1MN7A 2IVMA 8ICKA 2CGLA 1WC3A 3HILA 1M6YA 2JDJA 2N4CA 1SGGA 3O0FA 3GSIA 3EY1A 2Z57B 4IOCQ 4E1MA 1C7YA 2Z30B 2H3QA 4USIA 2LYHA 3RRGA 2HNZA 4UOHA 3RG6A 4YHHK 2XRIA 2DPNA 3IHQB 1AW0A 4KHPF 4Q8FA 3RSEA 2E5GA 4L73A 4FP9A 3PEHA 4DU7A 3MMJA 4Z4HA 1FRMA 4RQ5A 4OJGA 3CCRS 1JLCA 1MWYA 2B8PA 3MR2A 5M1NA 1DOQA 3UPQA 2HBYB 1HHTP 5J0WA 3A2FA 1A5VA 3KKAA 5ALUA 5EE3A 3Q8YA 5IQ6A 1RTHB 3NS6A 3M05A 4ECVA 5IIMA 3MN6A 5KG6A 1RT6B 4FYWB 4OZJA 4X66F 4RU9A 1H7XA 4YOEA 2XYGB 1JN3A 2Y9UA 4ED1A 2GLEA 2YKQA 4DV6J 4OYIA 4Z4EA 1NLVA 2ZC3A 3VCDA 2OZMA 4IJAA 5HHHA 3MXJA 3AO5A 3SPZA 2RMLA 2UUTA 5AXKA 3KIOA 3KWIA 4ZDNA 4NLYA 4BRGA 2FMQA 4X64F 2FY8A 1LKYB 2YQEA 3KJVB 2LMIA 3MAAB 2R8GA 3FRYA 3J81j 4M3TA 5BRDA 2KSOA 4BQZA 2D0OA 4LF9J 5HN0A 3U9ZA 3SYZA 2BCQA 5LSRA 2WUSA 3K89A 2P9KB 2Z58B 3OFFA 2OAUA 3VZIA 1K9MO 5FLXU 2AP1A 1WHVA 2HS3A 2KW4A 4CJFA 2MGZA 3AJDA 1FDNA 2IOFK 3VQDA 3MGHA 4YB5A 1L8LA 4MYUA 1V3RA 3HSGA 3SMSA 5LXYA 1N6QA 2CQ2A 3C6AA 4PL2A 4O44B 1MMNA 2UVRA 2KHOA 4NA2A 3G87A 2UXCF 3D45A 1LWEB 4ILJA 3Q8UA 4IFYA 4P9SA 2OHDA 1BHLA 3LVWA 5ADZA 1CRXA 2V67A 1S22A 1NKBA 3G71S 2UUCJ 4JI4F 3AD7C 4DV7K 4QZBA 2WAQD 2G0CA 1JX4A 1F6TA 4PQUB 3R5BA 3LAKA 4JKGB 5D0EA 3TUZC 1G99A 5AKIA 1RU1A 3HP6A 2CWKA 2F5GA 1JL1A 1N56A 2KNJA 1DRGA 2XWXA 3UCUP 4DV0K 1OMSA 3O3HA 2MUTB 5AE1A 2IPOB 1YQHA 4DR2J 3UDLA 3PIPQ 2DKOB 1PC4A 1RU2A 2VD3A 4FM1A 4KREA 3DRXA 4CM2A 1YKWA 4AQYJ 1OQ6A 2D9OA 4DZ6A 1B92A 5ALFA 2V5HG 3N4QA 4WP9A 3DMJA 2VKQA 4PKGA 3R1HA 1D0EA 3RZAA 4C4TA 3QIOA 4ENOA 2KD1A 2V8HA 1A9NB 1ZBSA 4UY8T 2IDOA 5A2QO 2HFVA 4PG4A 3GOIA 4KKOA 3VQTA 1VSEA 2QI2A 3NH2A 2B56A 3ZNJ1 2W3SA 3ED5A 3H1VX 4IQUA 3L7PA 3K5NA 3PW0A 2VG6A 4C0BA 1RI7A 1YAGA 3B82A 4PXCA 3M8QB 5HRPA 5AIBA 2CPRA 2ZIVA 4KAZA 4UAVA 1BPEA 4ZTJA 2BE2A 2D0PA 2ZBIA 4I2AA 2XWYA 3MN5A 1ELOA 7ICVA 3LDOA 1PC5A 1ZPWX 2H3VA 4G9BA 4L72B 3ET6B 4DN9A 2BCVA 1SXEA 4CBUA 3K0SA 1WC5A 2A1AA 4ECRA 1DTTB 4DOBA 2YWHA 3CJBA 5AQPA 5KFVA 3M8YA 1BA1A 1U04A 2J7UA 3EKUA 2O3DA 3W64A 2OHFA 5HMLA 2OEKA 4RG8A 4HUGA 2ZDPA 5HL7L 4K5RA 2OPQA 1HNWK 2L9WA 3M8QA 2RQCA 2VGNA 2YNGA 5C42B 3U7JA 3W60A 1R59O 4JAXA 4PKIA 1P90A 4DQSA 2OZSA 4N8OA 2PMZF 3THVA 5KL1B 3UIQA 1DY3A 2IMOA 2R7RA 4ID1A 3OLAA 1KTVA 5HRNA 1CS4B 2X78A 2W1BA 4W5RA 3ILLA 2V4JA 2MZQA 4B1WB 4H4MA 8ICIA 2KMDA 2HF3A 4R66A 4M3WA 2XMJA 1ZRMA 4KFBA 3WIVA 3I8BA 5DGAA 4AUKA 2EAOA 3ZZ0A 3I55N 2XZWA 3HTVA 3KFUF 2RIJA 1VHXA 4FZMA 4USHA 2G0AA 2FBTA 3NF8A 1RWXB 1VSJA 4DI6A 2HBMA 3DKDA 4FBTA 5K8NA 4EHTA 3OJSA 3AY0A 5A76A 2G5IB 3PO5A 5BJRA 4NXMK 2MLYA 4MQ3A 4ZJQA 1NU4A 1E6YA 1XMOJ 1T9TA 5KFLA 2VQEJ 2FLOA 1HKAA 3KVGA 4RUBA 4ZVFA 1JLFA 4HTJA 4O4RA 1K73T 1QAXA 2BPGA 2AYBA 5F1XA 1GTEA 1Z1BA 1ZQKA 2ZZNA 2CAJA 5J2QA 2MB0B 5KGXA 1QQMA 3DEEA 4OO1J 2NUUG 4ZOHC 3NWGA 2UXCK 3BEGB 2OKQA 1HMVB 3B4DA 3BGLA 1TGOA 2HDOA 4EFAC 1IKVA 1VIXA 2GFFA 4DFPA 1N0VC 3S7RA 1HD0A 3DHWC 5A6PA 2F4VK 3LTOA 4ELUA 3VF4A 1RQNA 1ZC6A 3HHKA 1BPZA 1WHXA 3BM7A 4LF6F 4UB2A 4K4GA 1NB7A 4CWBA 2ZTCA 5ALYA 5AQVA 4UW9A 2KFZA 3N7PD 1RWPB 4H0YB 2N3LA 3HHLA 4JI2J 2XI2A 1S6QA 4UQTA 1P8GA 4NM1A 1K8AO 4HDHA 1F5BA 2KVSA 2V2VA 1O1WA 3CCJN 4X4VA 2OANA 2V8GA 3QICA 2P9NA 4HACA 4BS2A 2VIXA 5KFEA 1RT2B 3H4DA 4JKFA 2H5JB 2M70A 1RDAA 5CR4A 4B9MA 5F8IA 2YX1A 1CC7A 2I9SA 1FD2A 2ZZMA 2UVWA 5AXMA 3SIPB 4KLQA 3N6MA 3AV9A 2GQCA 4I2EA 4J9OA 1HBNB 2E29A 3NNAA 4NZ0A 3WK8A 5J2BA 3U02A 5KFXA 7ICTA 2LYVA 3HKZD 2X3DA 4USJC 4K2XA 4EZ9A 4EHUA 4E0DA 1ZQQA 2ROGA 3F2BA 5AZIA 5M2UA 4DR4F 1YITN 5DB9A 3DI6B 3LP1B 2WSFC 2COLA 3HD1A 1QSYA 2ZH2A 1RDFA 2QA1A 4ZVOB 2JL9A 1T05B 4HACB 4FWRA 3O4WA 4ZH4A 3H08A 4O5EA 1CBKA 3C6UA 4LUBA 4KTQA 4N5SA 4M3UA 1FTRA 4EMDA 2HVZA 3HHLD 4NLPA 1RWVB 4TNOA 5J2NB 1TKZB 3GG4A 3CCZA 4OLBA 5KT3A 4JEPA 3PJWA 3EDRB 1J2VA 3R6MA 3HOSA 5IT4A 4KI4A 5T41A 4LJXA 1JXLA 2I5JB 1YSJA 3KLIA 4Z6EA 1NGJA 3CT9A 5IT0A 1BWFO 4B8AB 3TA2A 2FJWA 4RUAA 4B8CA 2B8QA 1GMWD 2GZOA 4HLBA 3ORYA 2CJ9A 4HHJA 1N32J 4L3NA 4J9QA 2CQGA 2XIDA 2LSNA 2KH9A 2WB1F 3KNGA 4AL6A 2FVQA 3C14A 2MKHA 2YNGB 4Y28C 2ZWPA 5JLHA 5IINA 4BG8A 3LZJA 3AJ2A 5C15A 3VERA 1A0PA 2ILZA 2NXUA 1ZQIA 3R5CA 1HJRA 4DCHA 1NOMA 3LK9A 3W3SA 4R63A 3V9XA 5AICA 1IBLF 3OD2A 1XMOF 1Q8IA 3ZT0A 1ZBTA 4H4MB 4XPCA 3LA0A 1P7DA 2VBZA 4PQAA 2KVCA 1N5WA 2OMOA 1U7LA 2GIQA 1CI4A 2CPYA 1NK6A 2WW4A 2DNKA 3G82B 2KTQA 4EYIB 4B9QA 3BKUA 3L2QA 3POTA 4LR7A 3RRHA 3ONNA 2EZXA 2DD8S 2GUPA 1RADB 2DNGA 5GAHI 5ETMA 1BISA 3ETOA 2XVTA 3IP4B 2FLLA 1RAOA 4I64A 4AF1A 2HK2A 1X4GA 3M9NB 2XLKA 4EK2A 5LL6d 1H72C 3D3BJ 3E1YA 5KGWA 3AUOA 4PG8A 4RNMA 1AFJA 5G5HA 4PG6A 3ALYA 1DEJA 4X4OA 1FJCA 4I2FA 5F0XA 2NSBA 4DCPB 3JYTA 2DFLA 1ILYA 1S12A 3FZFA 3VPZA 4CCHA 4TQRA 4H03B 3TR5A 5I3PA 3NBPB 3J7AN 4M7YA 1S6PB 1FXLA 1J5OA 5CWRA 3MECA 2VFSA 1B0TA 3MMCB 1IKXB 1Q5VA 5AQGA 3NVVA 4OYOA 3I8DA 5KOWA 4DPWA 5KQ8A 3X1LB 4J9MA 2FF3B 2AW0A 1LKYA 3GCXP 2KFYA 3AA3A 4FLWA 4DCOB 1B4SA 3T1YJ 4F8RA 4AHSA 1U25A 4C1NI 3L4PA 3A3NB 3ZSZA 3A8JA 2F9WA 4EELA 4CZIA 3OL6A 2CG4A 1RGVA 4ZCLA 4DO9A 2ASLA 1WOSA 2DGWA 3DM2A 4F50A 2XZTB 1BPYA 2P9KA 4FN5A 1DQAA 2V8DA 1GLAG 3RJKA 4FO6A 2JH3A 2YY6A 3QT5A 2BPFA 5AQMA 1UCNA 2AJFE 1NPPA 4WXWA 3K9KA 3D2NA 3TAQA 2DGZA 1VSDA 1HJPA 2YNFB 2I6WA 2OEHA 2HQGA 1TV6B 3NFAA 5KFAA 4OHYA 4QBUA 3S3OA 1WSIA 2DNQA 1RYUA 3AO2A 1KOOA 4HCBA 2YKMB 3JAMO 1HL6A 2ABYA 3VQ7A 3H4BA 3N0VA 2E9ZA 4FJMA 3CJAA 3S6JA 3VHQA 2E8NA 3Q7BA 1M5OC 4J2EA 5A8WB 2FF6A 3PNIA 3HCXA 1WG8A 1HWIA 4IKFA 1RKIA 4OYPA 3PYFA 1VSHA 4K0KK 2GIRA 3L5KA 4TU9A 4K59A 1X7VA 3QWUA 4LF5K 2VICA 3EE8A 3MAHA 2B9EA 5BRFA 2IFXA 2E5SA 4U6PA 2UU9K 2O8FA 4LQ3A 2D69A 7ICSA 2YMLA 4W92B 1MU2A 2CA9A 3O6WA 2WBRA 4NL5A 2DRBA 2CPZA 2RSQA 1TK8A 1OY8A 3LDNA 2DR9A 2W04A 4G6VB 1P27B 3B78A 4B9UA 3KJVA 2W24A 3W62A 2JH1A 5ALTA 2KZMA 1RZMA 3OTOK 4Y2AA 4HVJA 4CERA 1EARA 1RK8A 1ASWA 2E2OA 3FK4A 5AKYA 5HQLA 2VODA 3A0IX 3VQBA 3E2EA 3RGIA 2I1QA 5KT2A 3ZZUA 3ZTSA 4DS4A 3TAPA 1VQLS 1KR4A 1NK5A 4DMZA 2PD1A 5KT6A 4Y2JA 5KFQA 5AJ3J 4G1QB 2HSZA 2J0QD 2ES6A 2HW3A 4CM0A 3MR3A 5KOXA 2IM2A 3SBGA 5JVHL 2LKZA 5C25B 5B5EU 4YDDB 2O8EB 1NOYA 4B9LA 3KHHA 1L8OA 1KS2A 3KLEB 4B1VA 1KFSA 3UDCA 4OHWA 4E1JA 2JWKA 2UUAJ 2W9CB 1R89A 1VQKN 1IBKK 5KFNA 2VF3A 1UPHA 2ZKUA 4JI1K 2F8HA 3LO3A 3NF9A 4B1XB 1BC6A 3I82A 1IG8A 3NGUA 4CLPA 1LK5A 3DLJA 3RJEA 2D1CA 4XPEA 1NBWA 1T4GA 3TSQA 1GLJO 4I2IA 3ENHA 3LWMA 1UOCA 1UPMB 5J29A 1BQNA 1EXNA 1U1NA 1I39A 3G96A 4BDZA 4DFJA 1N34J 5K8MA 4NCGA 2DGXA 4MN4C 1S1WB 1YTAA 1HNZK 5J1NA 3V2UC 4R5PA 5DM6L 4FW1A 5F3TA 4LRAA 4H4KA 2XMUA 3BO2A 2G1HA 1U1PA 3I0SA 1T95A 1VBYA 3VC8A 4BC7A 5B8HA 4E7LA 4NL9C 2FPKA 1VHIA 2JEIA 3UO0A 1WUDA 1DK3A 3VQQA 2K60A 1U2VB 2D7SA 4QIEA 1WF0A 1HEKA 4GW6A 2ZWHA 1XMOK 3IXQA 4M45A 4Q8EA 3TUPA 4JKEA 4IG0A 2BH1A 1ZD3A 5KAFU 1REVA 1F2GA 3G4SN 5M1QA 1ZBIA 3L09A 2UV8G 5GADP 2RHKA 2YX8A 2OPSB 3CQ8A 5L9XA 3LGMA 4OYWA 2XSJB 5KFTA 3ATVA 2YWGA 4GLXA 3ONQA 4CECA 4MKBA 2EEYA 3MEGB 2XZDB 4ILGB 6AT1B 1K47A 2FHKA 2GJIA 3AVNA 1KOHA 3I56N 2QA4S 3K7RA 4TU7A 1F2HA 2R7SA 4OJ6A 2BCRA 4DV4F 5IS2A 4CNQA 4USKA 3EYZA 1S0NA 4EUVA 3CJ9A 1YHQN 1TL3B 5KT4A 5AQIA 5AHXA 4IJNA 3AO4A 2ZIXA 1X0FA 3NASA 4B02A 4DV2K 4PG7A 1S72S 4I9LA 2BOAA 1R7IA 2MHNA 3DYAB 3FZKA 5D78A 1KD1O 2MZ1A 5LSOA 4J9LA 3H8SA 3AQOA 2VA8A 1S79A 4BRMA 2ZC4A 4DOCA 1TKTB 3WQPA 4FF2A 3OYHA 5GADI 4Q0BB 1VR6A 2BMBA 3IGNA 4TLQA 1VISA 3QBXA 2VJUA 3CULA 5L39A 3PXGa 2FC8A 1Q3VA 4WP8A 3FFKB 3A8YA 2V4QA 2WFBA 1M5KC 4KN7A 1SB3C 4HUFA 3EGWB 5DBCA 1QE1A 3AN1A 3FUYA 3EE9A 4P71A 5CZ1A 3AOCA 3TSUA 3OW2R 1J2NA 1HI0P 5J0SA 4JS4A 4RQNA 1G2EA 1HNWF 2ZNZA 1X8DA 4BRFA 1OH5A 1YZ7A 1WEXA 4Q7AA 3Q8QB 3TWZA 3HKWA 3DCAA 2P9IB 3CWJA 5FP0A 1ZYQA 3C28A 3CJTA 1XO0A 3PFEA 3OYCA 2D8CA 3TACB 3W9IA 2E8AA 4FZYA 4M94A 4F4ZA 3L7UA 1VQYA 3TQEA 2Q6CA 1TE2A 3QGPA 3NF6A 4XA5A 1YHQS 3PSFA 3Q89A 4OI6A 5J2NA 3CM6A 1VQ6S 4C11B 3NNHA 4X2BA 3ISCA 2B0GA 2DHGA 1RWOB 1VC6A 3L8BA 3OFEA 5LMNK 3W7BA 2R8HA 4ELVA 3L6QA 2HOIA 5DETA 5IWAJ 4ZPAA 4HUEA 1NK7A 4OLPA 4BC2A 3UD4P 1GXTA 3O5TB 4F3TA 4MMOA 4UTGA 2LI6A 3UDEA 1C0UA 3QNOA 4E98A 1IR0A 3E01B 7ICRA 5AQYA 5KFZA 5J1EB 4M9GA 1SV0A 2JX2A 3ENOA 2VC1A 3GLJA 1Z19A 2O1PA 1IBKF 1KDNA 2P35A 1D8BA 3R7BB 1GTHA 1B7FA 1X4AA 2O66A 2JWLA 2GQ2A 3O9TA 2FBYA 2Z2LA 4ICLB 4WFNL 3J7AP 1HUOA 4K0KJ 4OZ3A 2HHHF 4KH0B 2WRMA 4P2MA 2Q43A 2JRSA 4RWWA 3C1ZA 1KEJA 3BH6B 2KSOB 7ICIA 3G86A 2MPUA 1RJJA 4A8FA 2OTLN 3SI8A 3LALA 1FRHA 1JRPA 4JI0J 2AIRB 4DDFA 4PGQA 3EVOA 5IT9O 1MA7A 1FJGK 3GWCA 2M88A 4FK4A 1Y5LB 3ZT2A 1WG4A 1UP1A 3AA9A 4DR7J 3FKBA 1S9GA 7ICUA 4UW2A 2DT9A 4JV0A 3IRXA 3CMEN 4IQTA 4US9A 2X1BA 3ZYYX 5ETSA 1R0AA 1DAXA 4ED8A 3ZSVA 5IWAK 4QW8A 5J2JA 2DTUA 1WUUA 1S77D 3GIJA 1WC1A 9ICUA 4CF9A 1S9EB 3AD8C 2O67A 4LF1A 2VQFF 2GWSA 1NH8A 3HSZA 2FHMA 4ZJOA 2HB5A 1TL1A 4OX9F 1GQEA 2IIRA 4GO7X 1T94A 2QEXS 1X66A 4DTSA 2VOPA 4OI1A 2ZXHA 1T9YA 4K8ZA 1RLCL 4X65F 1T3NA 2E9RX 3UVJB 2RU3A 4Y0WA 2CQ3A 3ICXA 1Q8KA 2OCEA 5HROA 1UVNA 1JK9B 3NE6A 5HP1A 4BGAA 3BGOP 1E4GT 2ZBPA 3AQEA 1TELA 8ICXA 1AYEA 3A8KA 1OQ3A 3DC2A 3NCRA 3K5PA 3ZXWA 4CO1A 2XMTA 1JMSA 3OJUA 2ZHOA 3PW7A 4IO1A 3QXGA 4EGLA 1S9EA 2AMCB 4DR2F 2AEMA 2Z1HA 4DL2A 4BXOB 1REGX 2HNDB 5GINA 4M5KA 4JN4A 4JWNA 2VQEK 3ATUA 2BV3A 4OI2A 3TTDA 3I87A 1F5CA 1R0CB 2B43A 1RTIA 3TYTA 4B9TA 2V2KA 5HMWA 1QZ5A 3DRRA 2PY5A 4ZN1A 1BOTO 2V7YA 3LDSA 2ATLA 3LQVA 1CXUA 1VLYA 2WF5A 2A19A 2UXCJ 4FE3A 3KHGA 3D4JA 3HF5A 3MCOA 3QERA 1U8WA 1HNZJ 3VQ9A 3MXMA 2E8PA 1Y64A 5J2PA 1HI1A 4IZ9A 1L7OA 2NPIA 1PBUA 2A0FB 3SK3A 1ROFA 2I1RA 4B08A 4KX3A 4WFNQ 1U1QA 4QU7A 4DSLA 4A8MP 1C4AA 2Q1LA 4O5CA 4QIVA 4M8LA 4AYBD 4XTTA 1MWKA 1Z6RA 5HANA 2ZJ8A 1HWJA 1DURA 3L3UA 2HQ3A 3OYBA 4LC9B 1C0TB 1VQPS 2Z56B 3CXCM 3L7OA 4KC5A 1RAGB 4KLHA 1HBMB 4O5BA 4CGDA 4AXJA 4UB3A 3B6OA 3AB4B 2XSFA 3MMCA 3FZHA 4JKBA 1EIYB 4QZGA 4PQUA 4KTWA 5ALHA 4DR5K 3OS0A 1BUXA 1D3WA 2RNEA 5D8HB 3ZNUA 7ICFA 5C5JA 5J2PB 2PYLA 8ICEA 4K4VA 4NA1A 1NGAA 1YIJS 2BGGA 5H9EJ 2J0WA 3HHEA 4GY2B 1FRKA 1KLMA 4PWDB 1B7YB 3VF0B 2X1GA 2KEYA 4UOFA 1YJ7A 3SNNA 2X6NA 4LRBA 4ZA1A 3O44A 4CTAA 2H3ZA 4LVSA 2UUBF 5FPEA