4F3OA

Dna polymerase i large fragment complex 5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
566
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTANMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 198
structure length 566
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f3oA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f3oA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f3oA01
4NLZA 2JEJA 2NRTA 3JYTA 4P4PA 1BISA 3C6UA 3KHRA 1NK4A 3VQAA 3O3GA 2NRXA 4DSJA 8ICPA 2RKIA 2YNGA 3OYIA 2PI5A 4M9LA 5KFGA 2XCAA 2P66A 2WOMA 3RJIA 2R7YA 1KCFA 3V9ZA 4LH5A 4O5EA 3V9UA 4DFPA 4ECWA 3OYBA 2PYJA 4YR3A 4JWNA 1N6QA 1UT5A 3OHBA 7ICJA 4KLQA 1ASVA 4E1MA 4F3OA 5JS1A 3QESA 5DG7A 1Q9XA 5J2IA 4F4ZA 5J0OA 1YT3A 2XHBA 2ZJ8A 1ZJNA 2C22A 4IQUA 2P51A 3DYAA 9ICHA 4GMJB 3OHAA 3MGIA 4FZYA 2HNDA 5KG3A 1ZQCA 3WNFA 2FPLA 5KFXA 3MEDA 3ETLA 1ZQNA 4O5BA 3SQ1A 2W9BB 2KN7A 4IRCA 5J2JA 4CK3A 2Q0ZX 3MXIA 1ZQTA 5FRNA 4FJNA 5J0YA 4LSNA 3M9NB 2YHAA 2BR0A 1MQ2A 4O0JA 3ITHA 1VSFA 3DRSA 3NBPA 1D8LA 3TFSA 4YMOA 8ICRA 3V81A 1LW2A 1QLNA 4PQUA 3QNNA 3C1ZA 3GV7B 4CHYA 4R65A 2FMPA 1NJZA 2BGGA 3G6YA 3H8WA 3KHGA 5KFZA 4CJQA 3T5LA 1WSGA 3LAKA 3OYLA 5DBCA 1L3TA 4QW8A 1RTIA 1XO1A 1ZQFA 5I42A 1XSNA 3AA2A 1ZBUA 5C5JA 3CFRA 3KLHA 3EPIA 3HXMA 5JS2A 4Z6FA 1T8EA 5J2MA 2WONA 1WSEA 3UXPA 5DLGA 1WCLA 3KHLA 1NK6A 2ZD1A 1NJYA 1NOZA 3DOKA 3G10A 4FJIA 4E3SA 2JZBB 4Q8FA 4KLEA 1I39A 3QEVA 3OSPA 1C6VA 4EZ9A 3F9KA 5SZTA 4HHTA 3NGYA 1XI1A 3ISCA 2V4QA 1J9AA 1XWLA 7ICMA 4HCCA 1S97A 5DBBA 5KFNA 3K2PA 2A1JA 4J9PA 2KQ2A 3MAQA 4R64A 4BE2A 4F5QA 1RT4A 3EPGA 1WN7A 1KLMA 4B8AB 3RH5A 3Q8PB 1BI4A 3LZIA 3ORYA 4Z6CA 4DSEA 5J2EA 4PHEA 3C21A 4YR2A 2F1JA 4E7JA 3SUQA 2AQ4A 1NK7A 5C24A 3QINA 1BGXT 3SCXA 2FLLA 5CP2A 4IFYA 8ICIA 3KLGA 4DWIA 3NH2A 2P5OA 4K4GA 1BPZA 3GFKB 2HMIA 3RBDA 4JUZA 4EEYA 2UVWA 1T03A 4GLXA 2OYQA 4KLJA 5E41A 3TAMA 4AH9A 1QQCA 2ASJA 2QKBA 3VQEA 4ELVA 3ZSZA 2ITGA 1BHLA 2G8FA 4CECA 4N5SA 1Q9YA 3TAQA 4FJLA 4DSLA 3OYNA 2H5XA 3ZT1A 4YVZA 1R0AA 2ZE2A 1G15A 4CGDA 4M3TA 1U49A 1ZQZA 4YFUA 1NJXA 5J2AA 4ED7A 4I2JA 4F3TA 3QEBZ 9ICJA 5EWGA 3RMCA 1V9PA 4KLUA 3HT3A 3NCIA 1RTJA 5CYQA 4CFAA 4DFMA 1T7PA 1ZQUA 2Y1JA 1RDDA 1QE1A 4FLUA 4DTRA 4IQWA 3VA3A 4DTXA 2HW3A 3O4NA 2E6MA 3MXMA 2ZTDA 3MEEA 2QXFA 4UB3A 3HSTB 4M3XA 5DDMA 8ICGA 2BHNA 2RDIA 4JK1A 3V7KA 2PFPA 4E7HA 3NGIA 3DOLA 4RW8A 4ECVA 2V9WA 3ISDA 1ZQWA 3U6FA 2BQRA 3E2EA 3HW8A 1ZQBA 3RWUA 2E6LA 2ISOA 3GIJA 4I2PA 4GW6A 4RW9A 1RT7A 4IRKA 1S10A 5TZVA 3RH4A 4DFJA 4O3QA 3VQQA 4FK4A 4I7FA 2DFHA 2BCVA 1TVAA 1ZETA 4UB5A 1WAFA 2P1JA 1B92A 4KFBA 5CY4A 4G3IA 3IG1A 4UAYA 2JEGA 2BCRA 1YVUA 3LP0A 4TUPA 3NH1A 1TV9A 4RQ5A 3QEWA 4DTJA 1RDBA 3V1QA 9ICVA 4P4MA 3NAEA 1YTAA 3M9OB 8ICJA 4I2FA 9ICIA 2ZTCA 3AA3A 1C1BA 1VRTA 3RJJA 4NM2A 5CHGA 3TI0A 8ICKA 3OYHA 4M9GA 3I0SA 4I2IA 2W9CB 5J1EA 8ICTA 1JLEA 1RTHA 2BDPA 1D9DA 3OYGA 4IG3A 3M9MB 3UQ2A 4QW9A 3TQ1A 7ICQA 3JPNA 4CJSA 4F93B 4ECXA 3QNOA 4FK2A 1ZBLA 3EWAA 4NY8A 1JLAA 3ZSWA 3NFAA 5DB6A 4XRHA 5KG0A 4FJ9A 4KITB 1D5AA 4H4OA 4M45A 5C25A 3T1AA 1CUKA 2BANA 1LWEA 2G8HA 3E01A 4QZDA 3OYMA 3KIOA 5J0PA 1RXVA 3WNGA 4Z4HA 2ATQA 3OYDA 1ZQHA 1L5UA 3QERA 2A1RA 2VWKA 1UAXA 4ED2A 4CE9A 2QK9A 4FLZA 5KFVA 4O55A 1B9DA 4ECTA 4CJEA 4GVMA 4KLTA 2A1SA 4DMNA 4KTZA 5J0XA 4IBNA 1K1SA 3K59A 3PMNA 1C1CA 4QZ8A 3VQ8A 1TKDA 1LW0A 1U48A 2FBVA 4I9QA 3PV8A 2BGWA 1S1VA 2W8KA 4AHSA 3RB6A 5D4BA 4W5QA 3OYEA 2Z1GA 3AVBA 4CGJA 4O3RA 3MXJA 1RT5A 5KG2A 1NOYA 4CHNA 1S5JA 1U47A 1XSPA 3VA0A 4QZEA 4E19A 3AVFA 4J2EA 5L1IA 3KK3A 2IMWP 1JKHA 4XIUA 5HP1A 3EY1A 4I2HA 7ICNA 3PY8A 4TURA 4F5RA 1NJWA 3KK2A 2AQ0A 5DDYA 4QZ9A 3P1GA 4QZGA 3C94A 2ETJA 4OGEA 1SL0A 4CFCA 1RTDA 3DLGA 3M8QA 7ICIA 4CFDA 3B6PA 3DM2A 4AHTA 4KKOA 4K8XA 3EZ5A 3LP3A 4RQ6A 4FZXC 4I9LA 1NKEA 4DG1A 4RZRA 3WNEA 2FLPA 2R8GA 3ZD8A 2VANA 1DOQA 4RW7A 3RJHA 4CEZA 4P2HA 3AO4A 2XC9A 1S0NA 5KGWA 4ECRA 9ICBA 4MEXA 1ZQGA 4XQ8A 1U4BA 4FJKA 5KFHA 2PXIA 4NLNA 7ICUA 4JV2A 3SV3A 2FPMA 5KT7A 7ICHA 4ID1A 5HRSA 3U3GA 3GV5B 3MEGA 4M9HA 4BWMA 1B43A 5KFWA 4F4XA 3ZT0A 4KI4A 5HMLA 3ZSOA 2RN2A 1ZJMA 4KREA 4BXOA 1NKCA 1C7YA 1EX4A 3AVIA 3MR6A 1BPXA 4FVMA 4W5OA 4FZZA 2D0BA 4OKJA 3FYHA 3V1OA 4CFBA 4CGIA 1Y88A 1ZQVA 3QEIA 8ICEA 1BCMA 4DTSA 4CJUA 2IA6A 1N56A 3K5NA 4F4KA 1Q8IA 5KG1A 4CF2A 4CJRA 1L3SA 3IM1A 4FLYA 4E7LA 5DB7A 3RB4A 4UQGA 2NRZA 1UA1A 4YXMA 1BQMA 1ZQKA 4DLEA 2BPGA 4AILC 5EOZA 5J2DA 3T5JA 2KFZA 3HJFA 3AU6A 2PZSA 3OYJA 4UAWA 4O5KA 3K4GA 4RNNA 3OVNA 4ZTJA 1F21A 2HHQA 2JGUA 4LD0A 4EP5A 1H38A 4ECSA 3DLBA 2UVVA 3S3MA 1RBVA 3DLEA 1S6PA 9ICCA 4IDKA 4DTUA 1ZBIA 5CZ1A 2ZQBA 4EYHB 4F5OA 3RB0A 4QCLA 3H4DA 4RT3A 4ECYA 3BQ2A 3DLKA 2IDOA 3KLEA 4PH5A 5IINA 4ZH4A 4HTUA 1B9FA 4ELUA 3HVRA 5J0RA 4RUAA 4OLBA 3T3FA 4MFCA 4FM0A 3TAFA 4EP4A 3CYMA 4PGXA 1Z00A 2HNZA 4KHSA 1TKZA 3N4MB 1IM4A 4CERA 5IIKA 5KT6A 4KPYA 3O3HA 9ICUA 2X6NA 2W9MA 8ICHA 3BGRA 1RYSA 3V1RA 5CJ7A 4CHQA 5D3GA 4PGYA 4Q44A 4DQRA 3KKRA 4DOBA 4M6WB 1T05A 3C1YA 2PYLA 5KFBA 3SQ2A 4PY5A 4GC6A 3RAXA 4H8KA 1C0TA 5L1KA 2GBZA 3KKSA 4BDPA 4YCXA 1BVSA 4QZAA 3P5JA 4PHDA 3UPQA 1GOAA 3ZDAA 9ICTA 2Q3SA 4CJPA 4GC7A 3QO9A 1XSLA 4KLSA 4KMUA 1WCNA 3HP6A 2OPPA 4KN7A 5HLFA 1UOCA 4QZCA 1CXQA 1HQUA 8ICAA 5J2NA 1NOMA 4YG2A 4OPKA 2Z1IA 4J9RA 4CJVA 2BQ3A 3WNHA 3ZDEA 2HHWA 1KDHA 5KT2A 2D5RA 5KTQA 1JLCA 3SUNA 3K5LA 3AA5X 2W8LA 4ZHRA 2GV9A 1XC9A 4YN4A 1DTTA 4QWAA 3AUOA 2QKKA 3HVTA 1JMSA 1A5XA 4CEBA 1ASUA 2UVUA 3KJVA 4KHNA 2F8SA 5EU7A 4KHQA 4DEZA 4TSXA 1UA0A 3RR8A 1S77D 4CEQA 8ICZA 3ISBA 7ICKA 3L2RA 4B3OA 2WTFA 4Q5VA 3DLHA 3NF6A 9ICWA 8ICOA 4NLKA 1DGSA 4MEYA 4DF4A 2G8UA 3MDAA 1KEJA 4DSIA 7ICTA 3BQTA 4F50A 1FKOA 5HROA 1UT8A 4KLOA 4KV8A 4OJRA 1RCHA 5KFCA 4CGFA 8ICMA 3NF9A 3OS1A 2P6RA 1LAVA 3ZSXA 3PW7A 4DS4A 4KB1A 1ZQRA 8ICCA 4KO0A 1I3AA 3PVXA 4B9SA 2E4LA 4PHPA 3GQCA 3HPGA 2AGOA 1Y97A 3MGHA 3OYKA 3V6JA 1KSPA 2B5JA 1TFRA 1N48A 3TAPA 3H4BA 4UBCA 3B0XA 2OZSA 4K8ZA 1PZNA 1VSLA 2F1IA 3A2FA 4CHOA 7ICLA 3NHGA 4DL3A 4OKKA 5DG8A 1C1AA 2RPIA 1QSSA 1RDCA 1RPLA 2HB5A 3LPTA 4RPYA 4Q43A 4R8UB 3RAQA 4CJKA 2BCQA 1IKXA 4TQSA 3V6HA 2XY7A 5DK5A 5KFKA 4C8OA 4DQQA 3OS2A 4XUSA 5IIOA 5KFMA 2IHNA 4Q0BA 5DGAA 4W5NA 5KFTA 4CK2A 4IG0A 1UWBA 2AU0A 4FJMA 9ICRA 5K14A 1KLNA 3RJFA 1L3UA 3ZDBA 2HNYA 3EYZA 3OSNA 5I3UA 2PFOA 3JPSA 1T3NA 5J0TA 3PX6A 1S1WA 3GIIA 5EWFA 4AHRA 4F4YA 2HVHA 2O4IA 4QWEA 4TQRA 3HWTA 4CEEA 3RMDA 1BQNA 3RBEA 2AGQA 4QZBA 2D0CA 3UXOA 4FS2A 4K4HA 2FMQA 1EXNA 4OLAA 4YR0A 1C0UA 2G8VA 4M3YA 2ASDA 4LVSA 3QZ8A 2BPFA 3NGDA 1BCOA 3LDSA 1BIUA 7ICRA 4CCHA 2R8JA 2XY8A 3OJSA 3D0PA 1D9FA 3JPOA 1HJPA 1LWFA 2MAXA 1BPDA 4MF8A 3KD5E 4B9UA 2ZJ5A 2W9BA 1L3VA 1RT6A 4RQ7A 2OPQA 9ICXA 3OJUA 4ED0A 4OGCA 2F96A 3ZSVA 1ZQIA 2IBKA 5FDLA 4AHUA 3L8BA 3RB3A 3C2LA 1VSEA 4ED1A 2X6SA 2X74A 1RILA 4M3RA 9ICLA 3M8RA 5IIMA 4KLGA 3HPHA 3ZD9A 3H7IA 1ZQLA 4J9QA 5J2KA 4DU3A 4UB4A 3HK2A 1C0MA 4QOZB 3KLFA 4JS4A 1ZQMA 2C2EA 4BDYA 1O1WA 1HQEA 4KHUA 4YMMA 7ICEA 1X9SA 1NK0A 4HYKA 2FBYA 5J2QA 5DLFA 4F8RA 4FO6A 2FC0A 2XGQA 2B6AA 4W5RA 4X5VA 1LV5A 4DOCA 4QZFA 3RH6A 3QIPA 4J9NA 1TK0A 4TUSA 4E1NA 4YXJA 2I1QA 2LYHA 1KRPA 3L3VA 1ZQQA 2IS3A 4CGGA 1SL2A 1HUOA 4KRFA 4M42A 1JX4A 4PUOA 2MUTB 4DU1A 1RT1A 2ZUBA 3QE9Y 4F2RA 1SUQA 4DF8A 3V7LA 2JZBA 3DLRA 8ICUA 3JSMA 3GDXA 4IQTA 2OPRA 5J2CA 2KW4A 1Z25A 5IILA 1VSDA 2IC3A 4KN4A 4M41A 1HNVA 2I5JA 3V72A 1S9FA 3PNCA 3UIQA 4E0DA 4B8CA 3LZJA 1ZQDA 1RXWA 5DG9A 4AHVA 3RTVA 3ISNC 3NTUA 4W5TA 3ALYA 3T5KA 4YQWA 4EBDA 1HYZA 4FJ5A 1NKBA 2YV0X 3IAYA 1CXUA 4FJ8A 3DRRA 9ICNA 2C28A 3THVA 5D46A 1ASWA 1LAWA 3MBYA 4BGDA 4LH4A 7ICGA 2V4RA 3SZ2A 4OPJA 5J0QA 3AVCA 4CJ4A 4C8KA 2JEIA 3H08A 1MU2A 4KAZA 4Z4GA 1SL1A 2NRWA 5SWMA 3NF7A 3HP9A 4O4GA 5CYMA 3ZSRA 3JPQA 3LP2A 2HVIA 3AU2A 5T7BA 1BPEA 4QWCA 4RW6A 2OZMA 3QZ7A 1EKEA 1TKXA 2BKEA 1QSLA 5J2BA 4MQ3A 3S9HA 3RJKA 3ASMA 3PUFA 4I2DA 3V6KA 3EW9A 4RU9A 4UB1A 4Z4EA 1ZQXA 4DQIA 4N56A 4O3SA 5J0UA 4NCAA 3G6XA 5KG6A 4IRDA 1REVA 5D49A 3V9WA 2OWOA 1JXBA 2IGIA 3O4QA 2NRVA 4JV0A 4EYIB 5CWRA 5DB9A 2DFFA 4N76A 1JLGA 4OKEA 3MR5A 1CEZA 4CJLA 9ICSA 1J54A 1TL3A 3OGUA 3ZT3A 1JL1A 5F9LA 4EZ6A 4IFVA 1MC8A 4FBUA 4RQ0A 5KFRA 3VQ7A 4E7IA 3BDPA 3SQ0A 4O3OA 2XY6A 2YNHA 1U45A 5HNKA 4N41A 4KTWA 3ZSYA 4LY7A 4UAZA 3SPYA 5KFLA 4O5CA 1S76D 2IHMA 4KLDA 4KB0A 1IG9A 2HHTA 1QTMA 2JLEA 5HMMA 4ED8A 3HM9A 4CJWA 4FM1A 2ATLA 1A5WA 4C8MA 3AO3A 2KZ3A 1ZQAA 4N47A 3LWLA 2PY5A 1S0VA 3T5HA 3V4IA 1X1PA 3OYCA 5KT3A 4R66A 4PPXA 2M9NA 4UBBA 4YD1A 4RNOA 3RMAA 3VQ4A 4YMNA 1SV5A 3ZSQA 2DY4A 4FJHA 1TV6A 3NE6A 3K58A 3OYAA 3VN5A 4ID5A 3M8SA 5DKWA 4KLMA 2HHXA 2ALZA 4R63A 3B6OA 2KZMA 2G8IA 3VQDA 3AVHA 1IXRA 2LSNA 4FJJA 5FROA 2ZTEA 4CF0A 3DMJA 5KFPA 4FJXA 1HPZA 4AHCA 1K6YA 4FCYA 2W9CA 4M9NA 4KTQA 5CZ2A 2F1HA 1GOBA 4CF9A 5KG4A 8ICVA 4JRPA 1IO2A 4FYDA 4O3NA 4DU4A 4Q45A 4BE0A 3VQCA 4RW4A 4I29A 3LP1A 1JIHA 1BI4B 3H8JA 4KLIA 5J2GA 1XU4A 4GXJA 4M3WA 5KG7A 1KVAA 4FLWA 1MQ3A 4IR1A 3MR3A 4XA5A 3PW2A 7ICPA 2AGPA 4RQ8A 2HHSA 4YD2A 3GIMA 4J2DA 4YP3A 1ZYQA 8ICFA 4HVJA 2FPKA 1VSMA 1JXEA 2VG6A 3TANA 4DL5A 2Z1JA 5HP4A 2D0AA 4CIFA 1ZBHA 1XHXA 3RJEA 3S3NA 3QEAZ 1X9WA 3K75D 1RYRA 1IH7A 3C6TA 2GWSA 5BPCA 5DQGA 1ZQPA 2KTQA 4BACA 5DQHA 5CA7A 4O0IA 2DPIA 4Q8EA 2VG5A 3SJJA 4MF2A 3K5MA 3VQPA 1NK5A 4FK0A 4M04A 4Y1DA 3BJYA 1YTUA 3C5FA 1J53A 3M8PA 4L8RB 3N97B 3OS0A 1S1UA 3JPTA 3NH0A 3K5OA 4NYNA 1S6QA 1ZBFA 1VSJA 4ZTFA 3QLHA 5BOMA 2DFEA 5KFDA 4J9OA 2ZJAA 5HHHA 2R8KA 4B9LA 4MFFA 1KVBA 1ZQOA 3CM6A 3C2MA 1COOA 3GV8B 5FRMA 2BE2A 1BL3A 4I27A 3SI6A 2OA8A 1FK9A 3DI6A 2YHBA 5J2PA 4KHYA 4ECUA 3AO5A 3PO4A 5EWEA 5HRPA 5L1LA 3V9XA 4PGQA 4F91B 3CFOA 3GILA 2W42A 3SI8A 1NK8A 1VSHA 3OY9A 3MFIA 4OVLA 4QWBA 4IKFA 4DSKA 4DSFA 1HJRA 3LPUA 4KHWA 2DPJA 3QIOA 3ULDA 1S1XA 4J9LA 4H4MA 2KFNA 1JN3A 4DO9A 3CFPA 3L3UA 1SKWA 1SKRA 3PW5A 4PWDA 7ICOA 2EX3A 1T4GA 1TAQA 4FS1A 2VA3A 5KFUA 3GIKA 2XCPA 1RT3A 4J9MA 2FMSA 5DMRA 9ICMA 5KFYA 1KFSA 4LZDA 1TKTA 4Z4FA 1TL1A 4O9MA 1X2IA 4CGHA 1S1TA 9ICKA 1WSFA 2G8WA 1TVRA 2AJQA 3G6VA 4RQ1A 2VWJA 3KHHA 5CR0A 2UVRA 1MSWD 4JV1A 1ZQJA 5HBMA 4KLLA 3MDCA 4QAGA 1WLJA 1S0OA 9ICEA 1RDAA 4EBEA 5DQIA 3DRPA 5L9XA 9ICOA 2ASLA 4LSLA 4CJTA 4E7KA 1ZQEA 3K57A 4I28A 3IHQB 3KK1A 1QHTA 4Z6EA 2Y1IA 4CEFA 4FM2A 4Z0UA 4CIEA 4O44A 3L2UA 4K4IA 5J2HA 1TGOA 4RQ4A 3AVJA 3AO1A 2W9AA 3TAGA 1AROP 4ECQA 1VK0A 1SKSA 4NLGA 3S3OA 5IIJA 4R5PA 3RR7A 9ICAA 3CG7A 1Z3EB 2YKNA 3O3FA 3SUPA 1HMVA 3KD1E 3H8SA 4EBCA 3TWHA 5KGXA 8ICQA 4B9VA 4CJFA 5J29A 8ICNA 9ICPA 5KFSA 2FBXA 3UXNA 1WSJA 2G8KA 5KFOA 2XGPA 4CEDA 5J0SA 3OYFA 3Q8MA 3H40A 5JUMA 3RRHA 2DFLA 3D45A 5KT5A 3C23A 4CHPA 4FBTA 1RBRA 5DB8A 3AA4A 4FW1A 4CEOA 1GOCA 3Q8LA 4M3UA 1NK9A 5KFIA 3HO1A 2J6UA 4RQ3A 2OPSA 3PW4A 3QETA 3AO2A 1BIZA 4G1QA 1QS4A 4UB2A 2PI4A 2B4JA 5J0WA 4RPZA 4M6WA 9ICFA 1TK5A 2RF2A 3TARA 1SZPA 1FXXA 3PX4A 4F2SA 2X78A 3P83D 2R8IA 3SYZA 2O4GA 1S9GA 1RNHA 5KRTA 4TUQA 2R8HA 1X9MA 3QEPA 1ZQYA 3PO5A 3TAEA 4MFAA 4M0AA 1JXLA 4IR9A 1CZ9A 3Q8SB 4I2GA 3TABA 5KRSA 5C42A 1RBSA 3Q8QB 1W0HA 4FLXA 1TK8A 4ELTA 3HPOA 2PFQA 4JWMA 4QWDA 1JLQA 5IIIA 3LDAA 3FDSA 1WSIA 1A5VA 4RQ2A 4GXIA 4F5PA 2IOCA 1DTQA 2B21A 3LANA 3B0YA 1JLFA 4CJ3A 4DOAA 2ZUDA 1KFTA 5F9NA 3BQ0A 3JPRA 3AV9A 4BXOB 3V9SA 1JL2A 1RZTA 2P5GA 8ICXA 3PX0A 4I2QA 3U3YA 3G0ZA 4BE1A 3MABA 3C5GA 4DTNA 5BOLA 4M9JA 2HHUA 2VA2A 5KI6A 1HUZA 2KZZA 5KT4A 1BPBA 4FLTA 4DTOA 4LZGA 3QEXA 3L2QA 3SNNA 9ICQA 3T19A 4F92B 1FKPA 1VSKA 4J2AA 4JLHA 5L1JA 2YNIA 1Z26A 3CQ8A 1RT2A 2NUBA 4BDZA 1WSHA 4RG8A 3NDKA 3SPZA 1A77A 3VQBA 7ICVA 3NF8A 4I2AA 1HNIA 4B9NA 2PFNA 4PHAA 2F8TA 4DTPA 4RT2A 3HX0A 4B9TA 2JEFA 2YNFA 3RJGA 4WE1A 4ECZA 4M3ZA 1K1QA 2XRIA 4B9MA 4CF8A 3VQ5A 8ICLA 4M2YA 4C8LA 4Y1CA 8ICBA 4KLHA 3MR2A 4I2EA 2ISPA 1N5YA 1U04A 5KFJA 4YNQA 4CK1A 3F73A 4ED6A 1IKYA 4R8UA 8ICYA 3AVNA 4Z6DA 4JS5A 4PA1A 3KTQA 2VA8A 1Z00B 1IKWA 4P4OA 4RPXA 3V7JA 4Z4IA 2FBTA 3LAMA 3UQ0A 2EHGA 4DQPA 2IAJA 4HUEA 1LWCA 3I0RA 3I8DA 1J5OA 4DTMA 2BPCA 2YKMA 4J9SA 2XY5A 4MFBA 4DL2A 4NCGA 1CLQA 1EP4A 3ZDCA 3NGZA 1DLOA 4HCBA 1D8YA 3CM5A 1BPYA 4NCBA 5KFAA 4DL7A 4JRQA 3ZT4A 5HRRA 1CZBA 1HYVA 1JLBA 4RUCA 2J6SA 3PR5B 2BCSA 4J9KA 2C2DA 3PW0A 4KLFA 7ICSA 4DFKA 4F4WA 2RDJA 4ICLA 5DBAA 4FW2A 3AVMA 1KVCA 2GUIA 4J2BA 1RBUA 4QZHA 4ED3A 2BCUA 2ZUCA 3L2VA 4CHZA 4RNMA 5DGBA 2DTUA 3RMBA 4KI6A 5KFEA 3L2WA 4CJ5A 3AVGA 4O3PA 1KFDA 3HYFA 4HUFA 4IQVA 3HL8A 9ICGA 4DS5A 4YFKA 1QSYA 4DLGA 2J6TA 4DQSA 1EETA 3IS9A 3LALA 3ZCMA 1A76A 4F5NA 3MECA 3IRXA 4QZIA 3SV4A 2HHVA 3BQ1A 1U9LA 2C2RA 2VG7A 2BQUA 1WAJA 1RBTA 4B08A 4NXZA 4I2CA 3RRGA 3VQ6A 3VQ9A 4FJGA 4CESA 5HHIA 5CB1A 4CEAA 4DL4A 3SUOA 1KTQA 7ICFA 5KFFA 3C2KA 4C8NA 1ZQSA 2P6UA 3LK9A 3LWMA 1VSIA 2I9GA 1WNSA 2Z1HA 5KFQA 4M47A 3AVAA 2FLNA 4CIGA 8ICWA 2A1JB 1ITGA 1S9EA 3TR8A 3MFHA 1VRUA 4FLVA 3PMLA 4NYFA 3C95A 2MUTA 4DL6A 5KG5A 1HRHA 3V6DA 1XHZA 4BWJA 1LB2B 1IKVA 4FXDA 3TFRA 5HRNA 3SQ4A 4NM1A 8ICSA 4E89A 3Q8KA 3FFIA 4I2BA 1EXQA 1HYSA 1S0MA 4FJ7A 5J2FA 3AVKA 4CF1A 4HUGA 2XO7A 4Z4CA 3Q8RB 1TAUA 3ZDDA 4GXKA 1XS9D 3ZT2A 3KLIA 1W9HA 1B22A 3AVLA 3PR4A 3JPPA
chains in the Genus database with same CATH superfamily
2L48A 4FZVA 2A3VA 3B6BA 1P6TA 2NRTA 2WAQF 4KX3A 3AB4B 3R5BA 7AT1B 1KBUA 3KHRA 2AZ1A 2ZVSA 4OI0A 3I9V9 4CT9A 8ICPA 3M2RA 3CI5A 3H5SA 4X4NA 2FSKA 4J9VA 4ZA1A 5KFGA 2WOMA 4LR9A 4K2JA 1KCFA 3F9MA 5T41A 2V69A 1BQNB 4JWNA 5AQYA 1UT5A 1T3OA 3BQ7A 2Z0GA 3M30B 4CO2A 1O51A 4BR4A 1RJJA 1WYGA 3QESA 3E3XA 3N4WA 1AFIA 4Y2JA 4CJ7A 4QJVA 2E2QA 4BGAA 4LF2A 5J2IA 4BBYA 4B1WB 1YT3A 1PVPA 5GAEI 1ZJNA 4DR2J 2P51A 2W2QP 2H5IB 2QX0A 4IL6U 2B43A 2W4PA 2HNDA 5KG3A 1ZQCA 3WNFA 2J8AA 4RW8B 4NLVA 2ZFHA 3KK7A 5GAHU 2MU2A 4ZMMA 4GO5X 4IRCA 2DK2A 3O2IA 1Q7LB 2WBRA 1VOMA 4I2PB 2LHTA 4PRFA 5T7LB 1ZQTA 2KIWA 5FRNA 5AKZA 4FJNA 4A59A 3UM9A 2EFPA 2BR0A 1HNZJ 1F5SA 3CMQA 4ZJOA 4O0JA 4DPWA 1VSFA 5ALWA 1GLBG 2A6MA 3OQ2A 1FA0A 1FRJA 3R5CA 3LGMA 5A8WB 4B3RK 2ZIXA 4URGA 3AEVA 3QNNA 3GV7B 3OV7A 3D6RA 4R65A 2BGGA 3G6YA 1B64A 3M7DA 2FTRA 1YITS 2MGZB 5EE9A 4W92B 1RDRA 2GHVC 5FD1A 4DCOB 4CWBA 4ZLJA 3HHLD 1YRXA 3LAKA 3OYLA 3B82A 5U47A 3A8KA 1L3TA 1PK3A 1ZQFA 4RUHA 2R2RA 4HI2A 1MROB 2W40A 2Z4PA 5C10A 1XMQK 2ZHBA 1NDLA 1WNEA 2WONA 2HWIA 1WSEA 2I9SA 2H48B 4FYXB 3VAFA 4ZVUB 2ZD1A 5HJXA 5H9FJ 1NOZA 5AHXA 1HR0J 1SUQB 4JI2F 5EGYA 1LK7A 4Q8FA 5AM0A 3QEVA 1C6VA 4HHTA 4ZJQA 3WK5A 1IBMJ 4LF4K 2FHKA 3TPQA 3H90A 5KPRA 4CE6A 5KFNA 3K2PA 2F3NA 3SBMA 3B4MA 1OS5A 2A1JA 5IWAJ 4BRFA 4ILGB 2Q1LA 2E2PA 5AQNA 2V34A 5AKYA 1QTNB 4M1KA 1WN7A 4IH5A 2IFXA 4EWTA 4DSEA 4I6MB 3DRRB 3QIDA 2F1JA 3A5MC 2AQ4A 5CP2A 4IFYA 3B9JA 1SWVA 2FJWA 4DX6A 2IVNA 2RMLA 3TJAA 4PXEA 3H0MB 2MKIA 3M7VA 4O4RA 3I5AA 3TAMA 1QQCA 1K0VA 2QKBA 4NLBA 5FPEA 1BHLA 2WFAA 4N5SA 1X5PA 1X66A 2H5XA 2ASPA 2ZE2A 3MMAB 1G15A 5DZ6A 2AEMA 3MX5A 3CCWA 1NJXA 3C16B 1YJRA 2HIYA 4I2JA 4OV1A 5I3QA 3UMGA 5EWGA 4IO8A 1DJ0A 4KLUA 5KAFU 2CKWA 2Q79A 3HT3A 3WXLA 1J6ZA 4B3MK 2MQQA 1RTJA 4BY9C 2DGWA 3CJQA 3ZZRA 1RDDA 3N4PA 1JLGB 3MMCB 3L0QA 2HW3A 3O4NA 4ZVEA 5D8HB 4QNLA 2KT5A 2QXFA 4XO0A 1VQ7N 1R43A 3EL2A 2KHDA 3GONA 4M3XA 5EVZA 3NGTA 1DRGA 2BHNA 3GDQA 2V8GA 3GSIA 4RW7B 2GQCA 2DGOA 4M5DA 3GOIA 4F0KA 3KNAA 1KQSM 4M63C 2FE9A 4ECVA 2YNHB 3NRWA 2ZOGA 3CF5L 2V9WA 2E5LK 1SJQA 4U7BA 1B0XA 2MB0B 2BQRA 2HSZA 3MDFA 2E6LA 5CCLA 4RW9A 5ETSA 1X9XA 5TZVA 1S10A 4OJLA 4EFHA 3H5YA 4MK9A 3CERA 1SBRA 2HFUA 1ZETA 4UB5A 2UYTA 1WAFA 3SQIA 2GJFA 3H1QA 1B92A 5CY4A 3M8ZA 4G3IA 3WDOA 5B0CA 2J9EA 1YVUA 3NH1A 2CPEA 2FVRA 4TU9A 1TV6B 2AYBA 1TV9A 4RQ5A 4XPCA 2MYFA 1RHQB 1YTAA 2HBYB 2YI1A 4NZ6A 5LJVA 2GEMA 2ZH9A 2JL9A 2WHOA 2ZTCA 2P9LB 1YDLA 4RKUC 3OYHA 2HBZB 3ZZTA 4ILHA 4OPHA 2E7VA 3J81j 3TOQA 8ICTA 2JV3A 5GTHU 1D9DA 4IG3A 4ZPBA 4RCHA 1OO0B 3M9MB 4QW9A 5HMYA 3CCVN 5F8MA 4F93B 2VDHA 4U67Q 1U6ZA 5C15A 1RWUA 3EWAA 3PFEA 4FWOA 5AIBA 3K8WA 3NFAA 3ZSWA 5DB6A 3M8YA 4F36A 4CLFA 2XBPA 1CUKA 3VGSA 2BANA 2VB6A 4CLYA 1CI4A 3OR2B 4MDBA 1Y00A 1RXVA 3WNGA 3THXA 1T3QA 2A2CA 2XQCA 2ZIVA 1UAXA 1HPMA 3FRYA 1FDBA 3C6TB 3NVKA 4DU7A 5JRTA 3L7PA 1NLKL 1PO6A 4KTZA 3BYRA 3NUQA 5EXWA 3PMNA 1MWQA 4QZ8A 3VQ8A 1RBAA 3VVUA 1U48A 1L7PA 4BR0A 2ZH6A 4I9QA 3PV8A 2E2OA 4RQNA 1HARA 5ALOA 1NPPA 4CGJA 1VRQC 1JWWA 1VDHA 3QT8A 1S1UB 1NOYA 3QJLA 2LEPA 3SMZA 2D1KA 3PSFA 4CI0B 2VCPA 3VA0A 4E19A 3W66A 3AVFA 4DX8H 1N52B 1BD6A 5AICA 2IMWP 1V85A 2CQCA 4XIUA 5J2NB 2GCFA 5AQMA 2K3KA 2UXDK 3PHTA 4F5RA 2BE2B 4NRUA 4K50A 4ZITA 4R79A 1NNEA 4LF7F 4HDGA 2ETJA 3O0FA 2HGNA 3M8QA 7ICIA 2QMWA 4ZPCA 2O3DA 3B6PA 2ERRA 2UU9F 2QL5B 4ZCIA 5HO4A 2AX0A 3A8IA 1NKEA 1FESA 2R4FA 1CG2A 4UZCA 4PJ0U 1LWXA 1M90T 3Q2SC 1J5EF 3AO4A 2XC9A 3IG8A 5AKLA 3R2CJ 1QQ6A 1S0NA 2M4MA 4LBHA 5L39A 2CPDA 5KGWA 4H4MB 4B3OB 2NO5A 4XQ8A 1NDPA 3DN9A 2KSOB 5LMUF 2W1BA 2P8IA 4PWDB 3Q24A 3BSOA 3HOSA 2FPMA 4NL9C 1ICEB 3ZX0A 4DB3A 7ICHA 2OEMA 4ANEA 4OI4A 2IOFK 4M9HA 4BWMA 4M5HA 2CQ4A 2RRAA 4WK1A 2MLYA 3ZSOA 2RN2A 1R6YA 1TVRB 2PBDA 5ALEA 5SUHA 4FVMA 4KV8B 2BJ8A 1U25A 2D0BA 2E2NA 2GVDB 3V1OA 2CQ2A 3NVZA 1Y88A 2U2FA 1TUYA 3QEIA 8ICEA 2VPXB 2NXCA 2UUAF 4OZ5A 2ZBIA 1SJ3P 2PE8A 1XBWA 4KO0B 2YMQA 3DRPB 2V8PA 2AIRB 3RB4A 4USJC 1UA1A 1FE4A 1BQMA 4DLEA 1RDFA 5J2DA 4CO3A 4C0ZA 1GLJO 1K5OA 2DKOB 3HJFA 3OYJA 2RQ5A 2WK4A 1YJWS 3ENOA 3UD5A 4ZP7A 2A40A 3OVNA 3WEEA 2WF8A 2V52B 3GU3A 2AV5A 4ECSA 3MX2A 2UVVA 4JI3J 3TZZA 1PK1B 4FP9A 1RBVA 2O8EA 1D8ZA 1NG9A 9ICCA 4QU6A 3SDEA 3MWPA 1ZD4A 1SXDA 2YQ0A 3MD3A 3MOJB 1S12A 3UCUP 2FVCA 4QCLA 4Q0BB 4XH1A 3CNQP 3H4DA 2G9OA 1G3OA 3BQ2A 2CNOB 3KLEA 4FWKA 2C1EB 2YY6A 2IM2A 2MQ8A 5J0RA 2ZBQA 3HVRA 5AE2A 3T3FA 3UMBA 5B5EU 3MM6A 4FM0A 3AOAA 3J7YP 3CYMA 1WORA 4PGXA 2HGMA 2MSSA 1IJEB 4GO7X 1TKZA 4NL5A 2QMUB 4DR5F 1YUWA 1UETA 1VR6A 2IMOA 2X6NA 1IBLF 4G1QB 3A0IX 3LF0A 2WW8A 5CJ7A 2OIHA 4DQRA 4CO5A 3J7ZT 4BRGA 3SQ2A 1FX2A 3UO0A 3RAXA 3CXCR 1C0TA 3I76A 3KKSA 4YCXA 2NV3A 3P5JA 1FO4A 3P8BB 4RQMA 4U7UK 4FXWA 2HBRB 4KLSA 4P73A 2XMMA 1E6YA 3T1YJ 2KT3A 1UVLA 4OJ3A 5D6GA 1HQUA 8ICAA 2KKPA 4CLUA 2O66A 2UXBK 4OPKA 2D69A 1NMNA 4DUZJ 4J9RA 4H0TB 2EBGA 4DFDA 2DY1A 3WNHA 3QSYB 3MCNA 3PZPA 5KTQA 1S72S 4CZHA 2WBMA 2IRYA 3HRGA 3W60A 3CJ8A 4PXBA 2C2MB 1XQIA 1XC9A 2H3EB 4QWAA 3AUOA 2QKKA 1ASUA 5AKHA 5EU7A 2PMZF 1X31C 2OM6A 3RR8A 4WQ4A 3HRDD 3VEYA 4CEQA 1QUPA 2E8AA 4YY3K 3L2RA 3NGSA 2WTFA 2B6AB 3DLHA 5FP0A 4ZJLA 3AL0B 9ICWA 8ICOA 2A1AA 1DGSA 2IYIA 1QCKA 1RUSA 3EMTA 4DF4A 4NXMJ 4CH0S 2XSJB 3TVKA 2AEJA 1S48A 4DSIA 7ICTA 4B3RF 1JMTA 1FKOA 1FKPB 2EK6A 3Q83A 2P2CB 1RE1B 4KLOA 1RT2B 3OUYB 3DU6A 2OAUA 3QYYA 5KFCA 1L7NA 3DDNA 1AA1B 1T3VA 2W3RA 2J4RA 3NF9A 1VQ8S 1LAVA 5THWA 2DIUA 3PW7A 1ZQRA 1HNIB 4NRTA 4ISEA 1XMQF 4BRMA 1TYQA 4IO1A 1WI6A 3RSEB 2ZKUA 1HNWJ 1BUPA 1KSPA 1Y97A 2B5JA 3OTBA 4OI6A 3CPWM 1XMOJ 4JI8K 4CHOA 2VBXA 4DL3A 3CF5Q 1C1AA 2GHPA 2IM3A 1QVGR 4LF4F 4C7YA 1IKYB 3JAMY 2ZEJA 1NMDA 1R89A 4Q43A 4FF4A 4AUKA 4LF6J 2FQQB 3RAQA 3BBCA 2BCQA 2LBOA 2XY7A 4PPDA 2YKQA 5KFKA 4C8OA 4DQQA 4AQYJ 5KFMA 1LWCB 5CYMB 4CLTA 1J5OB 1K8AT 4LF5F 4WZQA 3OLAA 1XNSA 1YSJA 3ETMA 3CC7S 1EP4B 5HANA 9ICRA 3VEZA 1WDTA 4DPTA 4YOUA 3ZDBA 1R8PA 3OSNA 2VQFK 3GFXA 1JJCB 2W2PP 2KXHA 4H03B 5EWFA 1URRA 3M6WA 4AHRA 5AE1A 2GO8A 3FEYB 2XYGB 2DBBA 3HWTA 4AD6A 4FPAA 1BQNA 3RBEA 3M30A 1LCUA 3EXYA 4NLUA 2MA1A 3RW6A 1EXNA 2MQMA 2WSFC 3ISZA 5J8YA 1LNQA 4LVSA 5A0YA 1RGVA 1S7IA 3NGDA 2UV8G 2NPFA 2PAVA 3LDSA 2RHKA 2R8JA 4UOFA 4QIWF 3BS5B 1WEYA 4KH1B 4YB1P 1ATSA 1HJPA 1FX4A 5EE0A 3KBBA 3G71S 3AH6A 3PYGA 5ETKA 2MAXA 4MF8A 1Q46A 2ZJ5A 3AJDA 4B3MF 3OJUA 2GELA 4OGCA 1O13A 1FFVA 3TU5A 5FDLA 5AKEA 1DARA 3F2KA 4F04B 1VJQA 2IOFA 1RILA 3WIVA 3AQPA 3HD1A 3MECB 4W90B 3M8RA 5IIMA 3ZD9A 4WFBL 4BS2A 4ZLPA 5A8WA 3KZBA 4RBUA 3AOCA 1NGHA 3QUQA 2GJ2A 2NSCA 2V8DA 5ETVA 1R0CB 2AHOB 1ZQMA 3OXFA 2C2EA 2RNEA 2MGZA 4IH7A 1HQEA 4DPUA 7ICEA 4DKWA 4HYKA 1WG4A 1NXIA 3L3FX 5DLFA 4F8RA 3CCSN 2NO4A 2EANA 1SPBP 2DGXA 2FC0A 3S01A 2UXCJ 2QWMA 4W5RA 2ATCB 1MROA 1IV8A 1LV5A 2CRLA 3N28A 3UD4P 4E1NA 2FJXA 3OT9A 1KRPA 2IS3A 1SL2A 4F67A 2VU5A 3QE9Y 4LREA 1SUQA 2A10A 4R0EA 5H9FK 1TFYA 2WVDA 2QA4N 4ISFA 5EN1A 4IQTA 1XEZA 1KQQA 2CJQA 5J2CA 1FJ7A 1K0TA 1Z25A 4OZ2A 3TSQA 1IBMK 3ENWA 2VBZA 3TWZA 1D0EA 3LZJA 1ZQDA 3RTVA 3ZEUB 4I69A 2VG6B 1N8RO 1T9XA 3WK7A 1TQLA 4RWXA 4BQLA 1UZHA 5LL6Z 2QGFB 1MMDA 3UPFA 2M3DA 1CXUA 4I6MA 4YB7A 4EO6A 4FJ8A 3DRRA 2E1PA 5IC4B 2MQPA 3QRQA 4V19S 5D46A 5H1SV 1OVYA 1ASWA 3C6UB 4BGDA 1RADB 1NHKL 2OP5A 3MOZA 1T95A 1DQAA 4OPJA 1A6LA 2Y9HA 3AVCA 4C8KA 4KHMA 1NBEB 2D3ZA 5ALPA 3C14B 4Z4GA 1QQOA 2W7AA 2NRWA 5SWMA 1W26A 4JMUA 4BRLA 3JPQA 3LP2A 2CG8A 3CTRA 1N6QB 3G6ES 2BKEA 2XHCA 3S9HA 2AZ3A 2MZSA 3QFUA 1X4GA 2AXTU 3ASMA 4IOBA 2ZJQQ 2K2PA 3MMAA 3UDEA 4GRSA 4UB1A 3FEZA 4DQIA 4QYRA 1NH7A 5B0DA 2F44A 5AQVA 3G6XA 1WF2A 1UVKA 5B0EA 1UW9A 1RLCL 4QQBA 5J2PB 2OWOA 1RACB 5CWRA 2DFFA 1JLGA 3GCWP 1N33F 1CEZA 3NL0A 2DXFA 4BLGA 5AQWA 9ICSA 1J54A 1DY3A 1CSJA 3OGUA 5F9LA 5LXRA 1MC8A 2VFVA 4S0MA 5KFRA 3VGMA 2BMBA 1VFJA 4R0JA 2QC3A 1QVFR 3BDPA 1OWXA 1R59O 3QRRA 3NBPB 3EE3A 2YNHA 1U45A 1X40A 5HNKA 2UXDF 3ILIA 1VQOS 1ACMB 4Y28C 3TA0A 5AJ3K 1VBXA 2VC1A 2ZDOA 4KLDA 2ZIUB 4TXSA 2HHTA 4P2FA 3ZNJ1 3GFZA 4ED8A 3IMQJ 3H3OB 2ATLA 3FQKA 2WB1F 4C8MA 2Q43A 3UWTA 5DRKA 2DD8S 1S1TB 3FZFA 3CCEN 2CA9A 2VQEJ 1WC6A 1HWIA 1X1PA 2HURA 3OYCA 3HZEA 3KLHB 4UBBA 4IKAA 2GQQA 3RF9A 1XQSC 2JX2A 3VQ4A 2KJ9A 4AP9A 2RUSA 2DY4A 2HQCA 1TV6A 4RTFD 2CXYA 1K8KB 3NE6A 1Y4ZB 4NEZA 3DOKB 4DUYK 1KHWA 4ID5A 1WB9A 4KLMA 4BREA 1JI7A 3AQEA 3B6OA 2KZMA 3HJEA 4OJ6A 3WX4A 2VOOA 5A2QY 5FROA 1ZTWA 3KKAA 4CF0A 1FRHA 4OX6A 2A2DA 2HBQB 4FKXA 2QWPA 2GTDA 1VQ6N 4KTQA 1GOBA 3O5TB 4Y2QA 2DQNB 4O3NA 3C7NA 1RT4B 1P8ZA 4YOWA 5F8NA 1TL7B 4ERDA 5ALDA 1FO1A 1UW4A 2D3O1 3H8JA 4KLIA 2YKNB 4IJNA 3R1XA 5KG7A 2FI1A 1HMVB 1KVAA 3QWPA 3PW2A 5KL8B 4DV4J 2HHSA 3A5NC 4J2DA 4YP3A 2M2BA 2NCKL 4DCJB 3HKZF 1VSMA 3DXBA 5GAEP 4DR7F 1JXEA 3TZWA 1U2CA 3L5KA 4MKAA 1JALA 3HT0A 3CIZA 4HL9A 4PWUA 3CWJA 1MN9A 1XHXA 5J1NA 1V38A 3IUCA 3RJEA 4AT1B 1X9WA 4DV0F 1IH7A 4IC9A 2F9JA 3C6TA 4WFAL 5A8RA 3CP8A 4Q2MA 2BRLA 2Z8QA 2CQ0A 3NNAA 1V3ZA 1W25A 1LEOA 5B0BA 1IWGA 3KJFB 4BVOA 1R0AB 4OD0A 1VQNN 3SJJA 2H65B 1M1KO 3K5MA 2KYXA 3BJYA 4DR6F 1YTUA 4B6JA 1PJ7A 4HVZA 5CYQB 5ALHA 2Z2MA 2R7UA 2HCFA 3N97B 5EX5A 2VOPA 4USKA 1GFWB 1S1UA 4WP3A 3NH0A 4NYNA 3HHKA 1DGJA 1Z1VA 2CPRA 3MEEB 4XTTA 2LQ5A 3QLHA 5KFDA 4I6YA 5C42B 2ZJAA 4B9LA 1D9AA 3BF4A 2JNJA 2BE2A 1BL3A 3RUBL 2H3QA 3QU9A 4LFCK 1WC1A 3SI6A 3DRYA 2KK0A 2YHBA 4CBXA 1Q7YO 2YVSA 1OQ6A 4M7YA 4LVOP 1M0SA 2I0XA 2YXLA 3D6TB 3CFOA 2W42A 2GV1A 2P9IB 3GBTA 3DEEA 3MFIA 2H1YA 4CQ1A 3UKUB 4I7FB 2NXUA 1U24A 1X5TA 4WYBA 1S79A 1WI8A 1RFQA 4GNIA 2EZYA 2NRRA 4H4MA 4JYAF 1P27B 1ZPVA 5FIIA 1SKWA 4PWDA 1AYEA 7ICOA 4ZVPB 4CLPA 1R8AA 5AXLA 1FIQA 1XMBA 1IQTA 4M5IA 2DR7A 3DC2A 2G8WA 1TVRA 1WJ9A 4YMEA 4A8QA 2DF4B 2DGUA 2YNIB 3D2FB 4RQ1A 3QT7A 2GVDA 2DR5A 5CR0A 4JV1A 3VALA 4QAGA 1C0FA 1JLEB 5BR8F 4H4KA 3A5OC 1RTHB 3WHIA 1WLJA 5IT9U 1RCXB 4EBEA 2DHXA 2Q1NA 3QU2A 3DRPA 2UUBK 1ZQEA 5FLXU 4I28A 2R7XA 3EKSA 1HD1A 2Y1LB 2HQFA 2YB1A 5C25B 3T1HJ 1LWEB 2YX7A 1SS6A 1VQ7S 2DNKA 3L2UA 4JB8B 3CMEN 3P4UB 1NU4A 4KGKA 3KDOA 5IFMA 2J7WA 3CJ1A 3AO1A 3FSIA 3MPVA 2QA1A 1QH9A 2W9AA 3TVYA 1PK1A 1VK0A 1N36F 2QIFA 3O3FA 2CVIA 3AD8C 3GPAA 3KD1E 3CCLN 5KGXA 8ICQA 4B9VA 5J29A 2YKMB 9ICPA 2AMCB 3FM9A 1N0UA 2IVOA 4WFBQ 2XGPA 2HF4A 1WTBA 4JKFA 1ITPA 4CEDA 3KOOA 2ALYB 1Q82T 1LW0B 3H40A 2VZ9A 2P9UB 3KXDA 3RRHA 3QYPA 4Y2MA 2ZH4A 3HBTA 2BE7D 4DR4J 4FBTA 1JLBB 1AUDA 3OBYA 2QTWA 1RT5B 5KFIA 2LMIA 3D2WA 1VI7A 3QETA 2V2KA 3AODA 4G1QA 4U9RA 4UB2A 4AXIA 1J27A 2UUWA 2FJEB 4G1PA 3TADA 5AI0A 9ICFA 3VAIA 2RF2A 1FWLA 1IBCB 2ROGA 1SZPA 2X78A 3KK2B 4RUBA 2R8IA 4Y2PA 2R7WA 1RNHA 2K4IA 2K7KA 2HHHJ 1RTDB 2KIVA 3ZX2A 3CCVS 4CF4A 4MFAA 1NZAA 4XH4A 5A6WA 4IR9A 3UN3A 4KKOB 3TABA 5KRSA 3Q8QB 4DG1B 2X3GA 4DV3J 4H0OA 3T1YK 4B3TJ 4UB8U 1JLQA 3IS9B 3IAM9 4DUZK 8ATCB 1AB8A 3MMJA 3WKCA 3O44A 4DR2F 3LANA 2PGCA 5C0YA 3B0YA 1N34J 5AXKA 2ZM6J 1JCGA 2EXUA 3BQ0A 3JPRA 5IS2A 5CAAA 1KS2A 3D54A 4ZVOB 2EI5A 1KR4A 4KHPJ 2EK1A 1JL2A 4WCEL 3T9NA 1ZM2A 1A9NB 4JKCA 3PX0A 3JSBA 2FUG9 1NHVA 3U3YA 2M88A 2FY8A 2JH3A 4RLEA 5BN8A 4BE1A 4DTNA 2VPYB 4NXNJ 4CO0A 1HNZF 4M9JA 1UL3A 2HHUA 3BR9A 2DNOA 2QLJB 1HIWA 1ZD3A 4NZ7A 4NXMK 1HUZA 1BPBA 2DRBA 3O9TA 1T02A 3O6QA 1IXKA 1HI0P 1FKPA 3I9ZA 9RUBA 2H3ZA 5M2UA 3M3ZA 4JLHA 4PZVA 1RT2A 3OUYA 2H3FA 1A77A 2MZRA 3VQBA 1EZZB 3BZKA 2ZIWA 7ICVA 3IFEA 1H74A 1HNIA 4NJ8A 3NGKA 4V19X 3RSEA 4IDKB 4GVEA 5CYJA 2XRIA 1HNWK 4B9MA 4CF8A 4F9OA 2M5YA 2Z2ZA 5CXTA 4M2YA 1FXLA 3CCRN 2KXFA 1XMOK 3OTOJ 2ISPA 1HR0F 2H4WB 1XR6A 4RL1A 3RRKA 2G13A 2R7TA 4TY9A 4DR3F 1Y0HA 1BMQB 2YKPA 4JOUA 4FSVA 1IKYA 2RKIB 2LKZA 3KKAC 2VA8A 5ALIA 4LF6K 1Z00B 4Z4IA 2OSRA 2XZWA 2BJ1A 5LJWA 5IWAF 1LWCA 1J5OA 4DTMA 2BPCA 4J9SA 1VK8A 3WXJA 2HOEA 2XI3A 1EP4A 4HR2A 1IR1A 1Z4UA 1O6XA 3ID6A 3MK6A 2JLGA 2WVFA 5ALJA 1KNZA 1CZBA 2IJFA 4OYOA 1HYVA 4EX6A 5LOQA 2YWWA 4OI3A 3CO9A 3LH2S 1N0VC 2WHEA 2Z58B 2P6SA 5ALFA 1F9FA 1T9VA 5AM1A 4HEA9 2C2DA 4X65F 1OH6A 4CZEA 3D0HE 3W65A 3AXKA 3PW0A 7ICSA 2ZC4A 3R1HA 4F4WA 2OPPB 5HLFB 2DNGA 3AVMA 4URQU 2GUIA 4J2BA 1RBUA 4LSNB 4A8YA 3QSIA 2RSQA 2V94A 5CZXA 4CHZA 4KAIA 3BS5A 3DRSB 5DGBA 1JLCB 1FJEB 4LF8J 3LW5C 2KFYA 4H5VA 2CNKB 2QFIA 2YY3A 3SK3A 4DL0C 3SAFA 3OW2M 3D0IE 2FF6A 1RWOB 5LSRA 5AXNA 3QJPA 3AQOA 1Q3VA 5C2GA 4FWQA 1VLBA 1ZAWA 3HHDA 3IDWA 4C6AA 3LDQA 1A76A 4F5NA 3MECA 4FXVA 2A42A 1VBYA 3SENA 4QZIA 2QE5A 3VGLA 3NVYA 5GVQA 2J5AA 4WFAQ 3D3CJ 5J2MB 2VKQA 4I2CA 3LDLA 4CEAA 5FPDA 4WZMA 3H2VE 2HAIA 4DPOA 5CCMA 1ZQSA 3TYTA 1GLCG 1ROFA 2P6UA 2O8BB 3I32A 3J7Z5 4ZLNA 5GMDA 5ETRA 2OD6A 3N9UC 1WNSA 2PD1A 2E5IA 4MH8A 1FEEA 4C9DA 4NYFA 1M5SA 3SQGB 2IM1A 1XHZA 3MF5A 2I6XA 1LB2B 3U8XA 1U2FA 4A8SA 3N6NA 3BP8A 1FW6A 5HRNA 3HFKA 2QG9B 4Y2IA 4E89A 3BF1A 2XVTA 3DLLQ 3U4LA 3Q8KA 2X1GA 3CQYA 5HOOA 5J2FA 1P8GA 3BBBA 3CDAA 4J91A 4AL5A 1N2XA 3J80Y 1TAUA 4A5BA 1T9YA 4GXKA 1ZC6A 1VHXA 3ZT2A 3R5GA 2BE9B 2VFSA 4WFZA 2HFVA 3KWIA 2H4YB 1F2HA 2AJ2A 4K59A 2JEJA 3HSGA 3Q2TC 1ZBSA 5G5HA 1NPRA 3ED5A 2HBJA 4IG0B 3C6UA 5LJ5Y 3CCJN 3W2VB 1WUDA 2NRXA 4DSJA 3TUZC 3E9OA 3GB0A 2PI5A 3CCZA 3THWB 1S1WB 2XCAA 2CAJA 2PEBA 3C14A 1QAXA 2A6OA 4LH5A 1WWVA 2FB0A 3V9UA 1FF2A 4DFPA 2PYJA 4YR3A 1N6QA 5AKJA 3F5TA 1ASVA 5JS1A 2W6KA 2ZNYA 4MKBA 1H1VA 1NZ8A 2D3OR 3O9QA 1TMMA 2DBYA 4DBQA 1X4DA 2CPIA 1RWPB 9ICHA 3MGIA 5F3ZA 1X0PA 5AKXA 4FZYA 2FPLA 5KFXA 3IO1A 4YOEA 4YN3B 4O5BA 1JK9B 2W9BB 3GMGA 4P72A 1RT6B 1YI2N 1UCNA 4OI1A 2EKYA 4CK3A 3G8TA 4AFFA 3MXIA 4P7VA 1HI1A 1KN6A 2H3VA 5LY3A 3EGZA 4FL9A 3IMXA 2YHAA 3QICA 1MA9B 1T9WA 1MQ2A 2G07A 3SMPA 3NBPA 1D8LA 3TFSA 4KFBB 3BN4A 3D6MB 1WF0A 3V81A 1KQGB 4MT1A 2XNRA 5GAHI 1CC8A 2FMPA 4NO7A 2R18A 1YF5L 2ZIUA 4A8OA 3D2NA 2QYCA 1NM2A 4DN9A 3M32B 3US5A 4ZPWR 5J2QB 1P9QC 1XSNA 3CT9A 3SSSA 3AA2A 1C1BB 3TJ8A 3KLHA 2W7PA 2VQEK 5HI7A 3I0SB 5JS2A 1VQSA 3UXPA 5DLGA 1KHVA 1WCLA 4PUOB 1K8KA 1NBWA 5D0HA 3DOKA 2YMPA 3GYNA 2VC0A 2XLJA 4JI4J 2NPIA 3ONQA 3F5AA 4EZ9A 3F9KA 1YBAA 3JSMB 3H1VX 3NS1A 1B99A 2IC3B 1G7CB 5D0RA 4X64K 4HHHA 7ICMA 1KONA 2H54B 4HCCA 3BKUA 3DKDA 3V4MA 2KQ2A 1WELA 3VR1A 3MAQA 4BE2A 3KMQA 1RT4A 2A3JA 4MAKA 2HQ3A 3RH5A 1TL7A 4AXJA 3A8EA 3K9JA 2B6GA 5J2EA 3C21A 1RWMB 1ATNA 1WHVA 1DXSA 3P5BP 5C24A 3QINA 4I1TA 1BGXT 3SCXA 1CULB 2FLLA 2XMKA 3I6PA 2Q6CA 2WCXA 3VEOA 4JK7A 1JCFA 3H20A 4DV4K 3WK8A 3GFKB 4BGBA 1MU2B 3P49B 5ETPA 2EAPA 1S1VB 1EQMA 5E41A 1M90O 2VPZB 4P2XA 3H42A 4O4GB 3CVKA 4ZPTR 5ALXA 8RUCA 1KAYA 2UUCK 1M5OC 3ZSZA 4JI3F 3VZHA 2G8FA 2LPEA 4WCEQ 4CECA 2GX9A 4DMZA 3TAQA 1SB6A 4LF7J 2IOHA 3OYNA 3CCSS 3ZT1A 1R0AA 4IZ9A 3KK3B 4CGDA 1DQ9A 4FYYB 4ED7A 2UU9J 3QEBZ 9ICJA 1LKYB 2G0JA 4OX9J 1FRLA 3NCIA 1REVB 1NPKA 5CYQA 5KNIA 4CW7B 4FLUA 5AT1B 4OYIA 1C0GA 2E6MA 3MEEA 1X8DA 2QA4S 4Y2SA 4UB3A 3HSTB 3OR1B 3MMBA 4TY8A 3C15A 4JK1A 2PFPA 2V68A 2IDEA 4OHXA 3TW0A 5AFUH 4KB7A 3E8OA 2G1DA 3PIOL 3RJMB 4LMZA 2CQGA 2E66A 2O1PA 3HSZA 4Q2LA 1KEKA 1OYDA 5F8JA 1FFUA 1NSQA 2O01C 3NVVA 3EVOA 4GW6A 3TZYA 1RT7A 3ZI4A 4IRKA 2WSCC 1RDUA 3IGVA 3EUNA 2UUAJ 3UKUA 4I7FA 2YQ3A 3UCGA 1TVAA 4USUA 3F0NA 3H45C 3T1YF 5BRDA 4B02A 4UAYA 2H3IA 4BG9A 2BCRA 3RU0A 3LP0A 4TUPA 3MCMA 4DUZF 2NLXA 5IM0A 5EY4A 3PYEA 4P0QB 1UEKA 3QEWA 4DTJA 3V1QA 2ZJPQ 2XI2A 3EE8A 1IUJA 9ICVA 4USMA 4BC5A 4P4MA 1E6VB 1NGDA 4PQAA 8ICJA 3E9LA 3WKAA 3W2WB 3H0LB 3WT0A 4I2FA 4ZDNA 3D2FA 2YWFA 4K25A 1ZZFA 3DMJB 2ROEA 1TUUA 4NM2A 5CHGA 5L9NA 5J1EA 3M6XA 1JLEA 2HZAA 1RTHA 1FKAF 3AT1B 3Q7BA 3TQ1A 3W3SA 2NLWA 3JPNA 2GGPB 2QL9B 1IJFB 4CJSA 3QNOA 4FK2A 2HYIB 3EX7B 4DJBA 1ZBLA 3AGKA 2L08A 4NXMF 3J7ZO 2DHSA 4UF4A 4DN0A 4J9UE 5JTIA 4UOGA 2VIHA 2DHHA 5KG0A 4DU8A 4KITB 1D5AA 2XLKA 5C25A 2KRRA 1LWEA 1RXOB 1B7YB 3I4HX 4A5AA 4QZDA 5D0EA 3OYMA 3T1HK 5J0PA 2I2YA 4DR5J 2QA2A 3FVYA 1NGFA 4Z4HA 3OYDA 4Y2KA 1IBLJ 1ZQHA 4NYZA 1B7FA 4BRAA 1OPIA 3QERA 2A1RA 3MZIA 4FPBA 4ED2A 3FZMA 4FLZA 1P1TA 4DPYA 5HVFA 4ECTA 3W1YC 4GIBA 3BPDA 1NSPA 1HNWF 3S6EA 3DXKA 1S57A 4IBNA 3BGRB 2P6TA 2RQ4A 3OTDA 1XMOF 4UW9A 2V7ZA 1IQZA 1KOHA 3BGLA 4HTLA 5D3GB 2DPNA 2VG5B 1LW0A 1YZ7A 3CCES 2JHEA 1T05B 2BGWA 4AHSA 3RB6A 4FVUA 1MWMA 1ECWA 3OYEA 2Z1GA 5KQDA 4DR4K 3M8PB 2W4DA 4NE9C 1W97L 1RT5A 2B4PA 3TEHB 2WF7A 4CHNA 3BO4A 2EEYA 1S7HA 1FDNA 1XSPA 1KAZA 4OHVA 4DV7F 2K60A 1GXLA 4AQYF 2JJ4D 5C2FA 2VYPA 3I96A 1CZAN 2L5YA 3EY1A 2HRUA 3PY8A 3GG1A 3KK2A 2YX8A 1BXNA 2WVBA 4QZ9A 3P1GA 4QZGA 1FHTA 3C94A 1VQ6S 5LT5A 2G5HB 1SL0A 4CFCA 1RTDA 4E8UA 2HHHK 1DTTB 1MA7A 4LFAJ 4AHTA 4KKOA 3U9DA 3M6KA 4K8XA 3EZ5A 4R25A 2DNZA 4DG1A 2ZOFA 3WNEA 2VANA 3KKFA 1DOQA 4CEZA 2A19A 3D2QA 4P2HA 1Y3JA 1ZOTA 3THTA 4B3TK 5DM7Q 4K4UA 4HH0A 4ECRA 4MEXA 4QIEA 3MCSA 5KFHA 5C12A 4J7CA 3C8YA 3D7SB 5F0WA 3JS6A 5KT7A 2OMOA 2I1RA 2ZJRL 4RJVA 1N34K 2ZM6K 4ATNA 4F4XA 3O8MA 5GIPA 2CJXB 4KI4A 2RAQA 5HROB 1ZJMA 2E1ZA 1NKCA 1C7YA 4QIFA 4MK7A 2DNRA 4FZZA 3OFHA 3IAS9 4CGIA 3TP2A 1H72C 3FEXB 1K8AO 2MSTA 4CJUA 2IA6A 1VQNS 3P39A 1Q8IA 4CJRA 1L3SA 4NXNK 4LSLB 2LQJA 2K1RA 2LU1A 4YXMA 1ZQKA 4AL6A 3TUIC 3M6GA 3VETA 2E1YA 4CF5A 2KFZA 4UAWA 3EDQB 2MKJA 4ENOA 2HHQA 1JQGA 4LF5J 2UXCF 3PCOB 5L8RC 3S3MA 3D67A 4IDKA 2E7WA 2RRBA 1ZBIA 5CZ1A 1OYEA 2IIHA 4ECYA 4CBUA 3OTOK 4HTUA 3QMQA 4G1IA 3B8AX 2RILA 4OLBA 2CJAA 4MFCA 1Q8KA 3O1WA 1E3MA 2HS4A 2E29A 5I3UB 3TAFA 4L75A 2O8FA 4EP4A 3EEQA 2BACA 2QLFB 3M6VA 4CZMA 1Z00A 1U1PA 3G8SA 4KHSA 3WK9A 1SH3A 1HLUA 1FNXH 2EG2A 1R0BG 2HFNA 4QOTA 1AW0A 2MKSA 2W9MA 8ICHA 1XN9A 1RYSA 4CHQA 4Q44A 2VUGA 4IOCL 1SGGA 2GWJA 5AQKA 3OXGA 3C1YA 2KJWA 3QAUA 2PYLA 4ZCLA 4KRWA 1N61A 2QKQA 1UVJA 3UKRA 4ALZA 2HAFA 4C4SA 4QZAA 4H5RA 2YB4A 3ZDAA 2FXUA 3IBPA 4JK9A 4GC7A 3SBGA 2KI2A 2OPQB 4KIAA 1WCNA 2OPPA 4KN7A 4UT4A 5HLFA 5AE3A 3KZXA 1SQFA 1DT9A 1NOMA 2QN6B 4YG2A 4WQ5A 2KP7A 3FK4A 2KNJA 4EIAA 4WTYA 2DNYA 3BREA 2KEYA 2PT0A 2HHWA 2D5RA 1DTQB 1JLCA 3CMES 3R6GB 3SUNA 5MLCV 2BKOA 2E5HA 3O3LA 2W8LA 2GV9A 4LF8K 1BQXA 1HBOA 2ZBCA 3KYLA 3HVTA 4CT8A 4CEBA 3MCPA 1RQLA 1U1LA 4M5NA 3GE9A 1RYUA 3X1LB 1SAZA 1UA0A 1VBZA 2OYYA 1S77D 2HWTA 1WUUA 3HKWA 2ESEA 3IP0A 2W41A 3CCLS 5AKGA 3JAMO 4QJFB 4E98A 3IFRA 2BM0A 3NF6A 4CLLA 3T6JA 2FY1A 1RGIA 1RG6A 2J0WA 1K9MO 4JI2K 3MDAA 1KEJA 2ZXHA 4G9ZA 2YHXA 2BKPA 4Y34A 2MY8A 2DKXA 2RQMA 1OH7A 1NCLA 3VZIA 1D09B 5ETOA 3ZTSA 5AQXA 1UT8A 4B3SF 1WOOA 4OJRA 3HM8A 1OXJA 1RABB 8ICMA 4HHJA 5DDPC 2O8BA 1TFWA 2E7XA 2LCWA 2V8HA 2P9EA 3A1YG 1LFPA 3SR6A 1X6IA 2OHDA 4KPCA 4ZVTB 2CNLB 1PAUB 3EM1A 3PVXA 2E4LA 1ZA2B 2VQEF 3GQCA 1EWQA 5K5MA 3HPGA 2AGOA 5AQFA 1WHWA 2RH3A 4C11B 3B0XA 2DRDA 2N7CA 2AJ4A 1RU2A 2DH7A 2VFUA 2F1IA 5CE3A 3A2FA 4WXOA 1ELOA 3M2VB 3S1TA 1FD8A 1FWPA 4OZ1A 4K4TA 2RPIA 4EHTA 1RAJA 1T11A 2CQPA 1QSSA 4F3QA 4C4TA 1RDCA 4NYPA 2YX1A 4CD1A 4R8UB 3IWXA 3G96A 4TQSA 5DK5A 3GCXP 1URJA 2ZH5A 3OS2A 5IIOA 4CZFA 5DGAA 3CIMA 4W5NA 1CJUA 2DB1A 4HH1A 3KOAA 1VBKA 3ICLA 4IG0A 2W25A 1F0MA 1DLOB 3QB0A 5K14A 1RHUB 3W2VA 5M2PA 3RJFA 1L3UA 4C48A 1BA1A 4EAHD 3EYZA 1NMEB 1V9OA 1T3NA 1GT8A 3THWA 2GOLA 1S1WA 2ZKTA 1N33J 3FGVA 2FGCA 2HVEA 2O4IA 2LQ8A 4NEYA 4PL7A 4QWEA 1ZTTA 3ZZUA 1HNXJ 4K4HA 5CH7B 5GADU 3G82A 4YR0A 1C0UA 2Z57B 1TL3B 1FTCA 1WKJA 4OZNA 1BG3A 3QZ8A 4J90A 2BPFA 4B1YB 1Q86T 1BCOA 4M7XA 4RR5A 2XY8A 3OJSA 4PEOA 3D0PA 4RO0A 3L7UA 2NUHA 2YQEA 2PSZA 2IDLA 5IT4A 1BPDA 4V19J 4B9UA 2W9BA 1SC6A 1L3VA 1RT6A 2EKNA 9ICXA 4GV3A 1FXRA 2AT1B 4FE3A 2KL8A 1NGAA 3A3PB 4ED0A 4LUBA 2F96A 4ILLA 1ZQIA 4AHUA 1U2VB 1VSEA 2XI9A 3CCRS 3LYSA 2X74A 3OVBA 3OL9A 2PFUA 2XMAA 1UJ5A 2YQ1A 2BM1A 3UI3A 4J9QA 1IVZA 2EC0A 3KLFA 2MXYA 3LO3A 2V67A 3BO3A 1M1KT 3BB5A 1GLEG 2Z56B 5IXUA 4KHUA 1XK8A 1NK0A 3M32A 4USHA 1EQ0A 5J2QA 2HGLA 5B09A 3OVAA 4H5NA 4ISGA 4OZJA 2E8NA 1I6JA 1FNMA 3QIPA 4QZFA 1TK0A 3MEKA 1PILA 1QM9A 4UOHA 3H7HB 2DEJA 4QS7A 3L3VA 2P9CA 4CGGA 1S9EB 2F1FA 4MDAA 1FWKA 1JX4A 4PZNA 3HULA 4PABA 4PUOA 4DZ6A 2C3OA 4F2RA 2GHWA 2KICA 3N6MA 3V7LA 1IKVB 5DETA 2L9NA 2V8VA 1BU6O 1NGGA 4JI4K 1COKA 3JSMA 5EX3A 1FERA 4OHZA 1VSDA 2IC3A 2I5JA 2FHMA 3OFGA 6AT1B 1B4FA 5F8HA 4FWNA 4E0DA 4DV0J 3HDSA 3ISNC 3BZCA 3ALYA 2MMYA 4EBDA 4FJ5A 2YV0X 2BDUA 1PG5B 5HMXA 9ICNA 1L3KA 2RQKA 3NS5A 4ETXA 2DGZA 1RAGB 4Y6IA 2DR6A 1LAWA 3MBYA 2XS5A 1KC8O 4DR6J 2CJYB 2V4RA 3SZ2A 5J0QA 1UAWA 1Q81O 2YNGB 1IR0A 1V4SA 2ZJRQ 4LRDA 1MU2A 1NAQA 1U0SA 5AQPA 1EB0A 2XICA 3B78A 1RHKB 4O4GA 3ZSRA 1M1HA 4C0OC 4P2SA 2HVIA 1BPEA 2ZZMA 2OZMA 3U1NA 3QZ7A 3SCKE 1EKEA 1QSLA 4UTGA 5AIAA 1TL5A 4IDHA 1PBAA 4LF7K 3PUFA 3QQCD 4RU2A 4Y2VA 3EW9A 4RU9A 2KVQE 4Z4EA 1ZQXA 1SJ1A 1BNOA 3NXZA 4O3SA 2X1BA 4GMKA 1L7OA 4NLSA 2UU9K 1QAIA 1VQ5N 1REVA 5D49A 4OX9K 4C3KA 1HKCA 4JV0A 1OJ4A 1RTZA 1J5EK 5AKKA 5A2QO 4DR4F 4CJLA 2ZITA 3UNGC 1QVFM 3ZT3A 1JL1A 3I56N 4FBUA 3VQ7A 1RU1A 4E7IA 4MMOA 4L72B 3D9BA 4JKHA 4KTWA 2D41A 1JJ4A 1HLWA 2PFFB 1LK5A 1LFWA 3BUZB 1NGJA 2F65A 3BSNA 2H5JB 3EO3A 4UOCA 1KQKA 3TR5A 2ZDPA 5GAGU 2JLEA 5HMMA 4H54A 3TZXA 5BR8J 3VPZA 1SH2A 1S59A 2UUAK 3Q89A 1ZQAA 2PY5A 1S0VA 4IYQA 1WTFA 4Y2YA 1X60A 2F8EX 1FFSB 3CCJS 2Y8WA 5KT3A 3H25A 2M9NA 4DV3F 2W03A 3EVWA 2HPUA 5AK6A 4YMNA 4WFNL 2N4DA 3BH7B 1NM1A 2XS2A 5KOXA 4NB4A 4P0QA 2OO4A 4F7VA 1WC4A 3OYAA 2CQBA 1OUQA 3VN5A 1X4FA 2E8PA 1E6VA 4ZVGA 2ALZA 4IOCQ 1Q82O 1UEVA 4X62J 5IT0A 1RCOB 3KUGA 1N34F 3MM5A 3MTKA 2LSNA 4FJJA 3FZBA 5DDQC 2I5HA 3DMJA 4FPIA 2OJ3A 1N36J 3LTOA 5D0GA 1WC0A 4O44B 5LL6d 1IN0A 4UY8T 4KHPF 5C2CA 3GZFA 3VAJA 2DISA 4FYDA 4LJXA 4EUVA 4DU4A 4Q45A 2GGPA 4ES3A 3O4WA 3PRVA 3VQCA 1X3MA 3BBFA 1KBRA 5J2GA 4LSZB 2HZCA 2HFZA 4M3WA 2EZZA 3GIRA 1YI2S 4FLWA 1MQ3A 3MR3A 1N60A 2RDDA 3KLGB 4RQ8A 4QR0A 3MCOA 3T79A 2NXEA 2VFRA 3GIMA 2N1RA 1ZYQA 8ICFA 5AQHA 2FPKA 1QUVA 3FZLA 4DL5A 2Z1JA 1T03B 4DR5K 2D0AA 3DJCA 1OKJA 2M70A 2VJUA 1IBLK 3DGVA 3DXMA 2KKZA 3S3NA 5I4MA 4YB6A 1RYRA 1RLDA 1YGYA 2JH7A 5DQGA 1ZQPA 1VQKN 3D1OA 2QI2A 2OPSB 4O0IA 2VGNA 4AF1A 1VJWA 2P9GA 4Q8EA 4XEIA 2VG5A 4MF2A 3OTOF 2F9TA 4KH5A 4IUFA 3LM2A 3HJVA 2RU3A 2AYMA 2NNWA 1M6YA 1L8OA 4MTPA 4U8VA 1S9GB 3M8PA 3KWGA 1ZBTA 1Y11A 1QE1B 4WF9Q 2OEHA 5GAHP 2E3TA 3O80A 1ZBFA 4ZTFA 3VAHA 2OFGX 1MMNA 2BZFA 2X1FA 2RE2A 2HOIA 3C2MA 2O67A 5FRMA 4RPFA 2X3DA 1F0XA 3I5BA 1S8OA 2X7IA 4I27A 4TYAA 2OA8A 3GP9A 4DQ8A 1F5AA 1N5WA 2CNNB 1Q3UA 2MKYA 2XG8A 3PO4A 2W01A 5HRPA 3GJSB 3HMJG 3JXUA 2YH0A 4F91B 4UQTA 4EEKA 2C2OB 5E3RA 2ZGZA 3ULHA 5AQOA 4QWBA 4LFAK 4DSKA 5AM5A 1ZPWX 2BBEA 2D9OA 4DSFA 1HJRA 1WBDA 1RQNA 2GS8A 1T9UA 4WBFA 1UFWA 3DXSX 4OFZA 2CIMA 2Y0BB 3IG1B 1FDAA 2KFNA 5BRFA 3MCAB 4JV5J 1Y5IB 4I2QB 3L3UA 1HHSA 4JKEA 2CQIA 4ZIVA 2D0PA 2ADCA 3ZX3A 2KXNB 4YDUC 5DMRA 5KFYA 3CCMN 2LA4A 3NKYA 2D7SA 4PAAA 3I87A 4LF8F 1TL1A 1GO3F 2ACMA 3CEDA 4O9MA 5D77A 3HLUA 4CGHA 5TISU 1WSFA 2V51B 3UE5A 3PEHA 2DVIA 3G6VA 2WW4A 3HOTA 3JTOA 2P9KA 1WHXA 3CE8A 3MUMP 1R8BA 1FDDA 2FYXA 5DQIA 5L9XA 3QFHA 3WK6A 4LSLA 4DR3J 4E7KA 4ZK7M 3KK1A 4F0HA 2AH5A 1L7MA 4KC5A 1JLAB 4QS9A 1X9JA 2ZG6A 3CJ0A 5ETTA 4Z0UA 3E01B 4CIEA 3VHQA 5F3TA 3N5BA 2CRXA 4FWRA 1NWKA 8AT1B 4P52A 5J2HA 1TGOA 2LEBA 1MWYA 4FF3A 1PVRA 1X3NA 1HKAA 3P96A 4LBPA 1W7AA 4LF5K 3TAGA 1AROP 3S3OA 2BUPA 4R5PA 2KYZA 4Z2XA 3VTHA 3WX8A 1IKWB 3KD3A 2AJ0A 3D6FB 2B0CA 3H8SA 4EBCA 4CJFA 4L73A 4MHVA 2ZZNA 3O9SA 3OLBA 3LDOA 3UXNA 1WSJA 4MFBB 4RWTA 1X6JA 3EE9A 2Y3YA 9ATCB 1C1CB 3BZQA 2WAQC 2JWNA 4X65J 2DFLA 4DV1J 1Z05A 3D45A 2WC9A 4DCPB 5ADZA 4FW1A 1UMJA 1GOCA 3EGNA 2EW9A 2J0XA 2ZH1A 3MGVA 1NK9A 4HLBA 3QX7A 1N5QA 1VC6A 5LM7E 1FNOA 3KFWX 3IV6A 4HAIA 1BIZA 1QS4A 2VKZG 4RPZA 1R6VA 4F2SA 3W5XA 3BY5A 5A2QU 3HHLA 4FWSA 3HSDA 1HQ2A 3UNYA 1MNEA 1X9MA 1UP1A 5F8LA 1ZQYA 3PO5A 4JB3A 3TAEA 3Q86A 2GIRA 3BKTA 4Z7YA 5AM3A 2B56A 2JWLA 3ENAA 2KLAA 1NNDA 2R42A 2PFQA 5L46A 4DV5J 4QWDA 1EETB 2YPZA 5M1FA 1RAHB 4WKRA 4N8NA 1H73A 2BYCA 1A5VA 1T6CA 3TACB 2IOCA 3OL8A 4KH6A 3QPIA 1DTQA 4DX7A 3NS6A 2VG7B 2ZH7A 3QMLA 2ZUDA 1G4CA 2R7OA 1N5VA 2FJBB 5F9NA 5HN0A 2CZVC 3CD0A 2GMLA 2KJ5A 1CJVB 4BXOB 3W3DA 3ALRA 3L4IA 3R6LB 4OJPA 3V9SA 3AA9A 1PGZA 1RZTA 1F3FA 1YX2A 1BE4A 2P5GA 4JI7J 3SFGA 2GQ2A 4H0VB 3MN7A 5KT4A 2MHEA 2YTUA 4DTOA 2W2OP 3H0PA 3SNNA 9ICQA 3T19A 3DOMB 4NX9A 4KGMA 2EWSA 4J2AA 3SCIE 4NZ0A 1QQNA 3AM9A 2NUBA 1N54B 1WSHA 3K8VA 1NGEA 3MN5A 3K0JA 4E2FB 4I2AA 3H46O 4FPRA 1HJOA 3K9KA 2EZXA 5HMWA 2PFNA 4FNHA 4DTPA 3HZGA 5D15A 3QBXA 2NS1B 2JEFA 3ISND 3EICA 2YNFA 4WE1A 4M3ZA 4ECZA 1IM6A 4OYXA 1GK8A 3VQ5A 1KKHA 8ICBA 2HOFA 2LYBA 4I2EA 2MQNA 1R3NA 3R1LA 1U04A 3DLKB 5KFJA 2KG1A 4JI4F 2CPZA 1OY9A 3D68A 2LM4A 4ED6A 4CRXA 2AP1A 2CGJA 2HBKA 4R8UA 8ICYA 3ELHA 4Z6DA 3GYGA 5DM6Q 4JS5A 2B9EA 3KTQA 4P4OA 2FBTA 3LAMA 2HFOA 2Y0SD 1DZ5A 3POTB 4DQPA 2IAJA 2P9SA 4A47A 4Y2XA 4I67A 4NCGA 5K20B 2ZHAA 2E1RA 2XIDA 4LRCA 4FOEA 4ETZA 1GEHA 2ZH2A 1DLOA 4HCBA 1D8YA 4NCBA 4ZIWA 4FNIA 4WFNQ 4F25A 3WUHA 5IT9Y 1FCAA 5KFAA 1GTHA 1RWWB 4NMXA 2OFHX 4ZPVR 1V6HA 1UPMB 5HRRA 4WU3A 1W2IA 2F3JA 4K4VA 3ZTQA 2HNDB 3K17A 5FLXY 4ZP6A 1IG6A 3OBWA 1N33K 1FI4A 4UATA 3ETOA 4ZLLA 2B51A 4J9KA 3QO9B 2LP4A 6FD1A 2LYAA 1Q78A 4P10A 4F72A 1HNXK 1TE2A 3WC2A 1CQMA 3PXGa 4OCZA 4QZHA 1UZDA 3R3TA 3NNCA 3QT6A 2BCUA 2ZUCA 4TN2A 2HEKA 4RNMA 3D6JA 3VQTA 1C20A 2DTUA 3EXCX 3RMBA 4KI6A 5KFEA 2BRKA 2Q0UA 3ULEA 4ZHRB 2RS8A 4CJ5A 2ZIXB 1XC3A 4A8MP 3MM9B 1NI3A 3Q8VA 3HYFA 1PYSB 3KJVB 2QA4G 3ZO7A 4DS5A 4OX9F 3RAMA 1U0HA 1QSYA 2ZUAA 2J6TA 1U2VA 3TKAA 1FTRA 2YJEA 3ZCMA 1VIOA 3MPYA 2KOBA 1GAOA 3BQ1A 3FNNA 4C8ZA 2VASA 4MYUA 4KSEB 5K8PA 3B8HA 4NXZA 2WONB 3VQ9A 5HHIA 3W8PA 1WC3A 4PPZA 2FGOA 2GA7A 1KTQA 3NG8A 5ALSA 3T41A 3L95X 7ICFA 4UZBA 2QV6A 3CC4S 1LKZA 3IG5A 2EAOA 3TTCA 2ZJQL 4A2AA 1GTEA 5KFQA 2FLNA 4CIGA 3THYB 8ICWA 3SMSA 2A1JB 5GINA 1S9EA 3MHYA 4FLVA 3PMLA 3C95A 4DL6A 5KG5A 1F9HA 2NXJA 3V6DA 5ADXA 2C3UA 1IKVA 2W24A 4ILMA 3OL6A 4OMFG 2W43A 5AI5A 2DL0A 5ALMA 5ETQA 1EXQA 1S0MA 1XTZA 4DR7K 4FJ7A 3QRPA 2HBMA 1M5VC 3X3UA 3ZDDA 4DV0K 3KLIA 1BC6A 3AVLA 1IKXB 3TUPA 4WK3A 1VLOA 3BGUA 2YMLA 1Q1KA 5RUBA 2B7BB 1SC4B 3L9ZA 3JYTA 2VJ5A 3KWMA 1NJIT 1YJTA 1UWBB 4JKAA 4OYBA 3VVTA 1YK9A 3O3GA 4YOVA 4NI2B 3BEXA 3DGPA 1VHFA 2MZ1A 2HNYB 4DR6K 2YNGA 5AXMA 3UVJB 4M9LA 4US8A 4ZN3A 2P66A 2A41A 2NSBA 1ZXIA 3RJIA 4MLHA 3J7A1 2W3SA 5AK5A 2IPOB 5CEHA 4HT5A 1RTJB 3OHBA 3CO0P 3FCHA 4KLQA 1LVHA 4F3OA 4IEIA 2J8SA 4AM6A 3QDKA 2RT3A 4F4ZA 2GVZB 2XHBA 2ITMA 2C22A 4IQUA 1ED1A 3TA1A 4KT0C 3R6MA 3OHAA 1GMWD 2XMJA 2LLZA 5JXSA 2E5LJ 3TEGA 2RE1A 1CS4A 1LWFB 1ZD5A 5AQSA 1LOUA 1U1QA 4F71A 3FRZA 5J2JA 4OYWA 2Q0ZX 3FSYA 2PDAA 4RNFA 4RW9B 1DGKN 4JYAK 3QBCA 5TKYA 2AWZA 3M9NB 2RQCA 1RI7A 2EPIA 4GV9A 2Z7JA 5K9FA 1X5SA 4G65A 3D2EB 5EHHA 2V4JA 3BH6B 2YMMA 8ICRA 2DGTA 4Y0FA 1LW2A 2OEKA 4B17A 3C1ZA 2QARA 4N77A 1CQNA 2L3MA 5KFZA 3T5LA 1WSGA 2Y8YA 2FPHX 3VOVA 5DBCA 4QW8A 1RTIA 1XO1A 3HF5A 5BR8K 3I1YA 2Q3PA 3TX0A 3CJ9A 4LFAF 1RBOB 1AQ6A 1CPZA 3CFRA 3EPIA 4CF3A 4M5LA 4Z6FA 1T8EA 3VGVA 4NYOA 3KHLA 1NK6A 2RIJA 3G10A 1RT1B 4E3SA 4A48A 3M1YA 3CPEA 3LDPA 3OSPA 3UB5A 4PHTX 5SZTA 2C2KB 2E20A 3MWTA 3NGYA 1XI1A 2OPRB 1YRUA 2PIIA 2V4QA 1J9AA 1F5BA 4IXCA 1S97A 4PZOA 3H98A 1F60B 4JKDA 2V6AA 1N36K 2PC6A 1J2VA 4DZDA 3THXB 4R64A 4JKGA 4YHHF 4Y2UA 1VDVA 2OTLN 4F5QA 3EPGA 2ZIVB 2XZTB 3Q8PB 4AE5A 3VEWA 3OTCA 3IXQA 4PHEA 1X4EA 2DUYA 4L3NA 4E7JA 1TUGB 4GVBB 1GMWA 3G4SN 1NK7A 3H3NO 2GO9A 2QLXA 3FC9A 3KLGA 2A18A 4DWIA 2Y0SF 4US9A 2BABA 2DHGA 3RGIA 3NVMA 4O8KA 4K4GA 4WJBA 1D8BA 5MLCQ 1BPZA 2HMIA 3RBDA 4JUZA 4EEYA 3R7BB 1G99A 4PG7A 1T03A 4DV7J 4GLXA 2DHAA 2OYQA 4LRAA 2WUSA 2M9KA 4AH9A 3UDCA 4ELVA 4RW6B 3N01A 1OH5A 2ZHOA 3MUTP 2B4VA 3W9JA 4J8FA 3ZZZA 1R7IA 4FJLA 2E8MA 5ETNA 2CZ9A 3A3OB 3NAIA 3LGNA 1SV4A 4M3TA 2GW8A 1ZQZA 2K8CB 5J2AA 2FD2A 5HVHA 2E1AA 3QXGA 3PKMA 2PO4A 3RMCA 3KJNB 4CRJA 4CFAA 1T7PA 3H59A 4C98A 1QE1A 4DTRA 4IQWA 3VA3A 1U6FA 2VKRA 3MXMA 2Y1RI 1HX1A 5DDMA 8ICGA 5IV4A 2Q31A 2RDIA 4DR2K 4E7HA 4I0WA 3NGIA 1BA0A 1Y10A 3CB4A 4WFYA 4RW8A 3UDLA 4FYVB 4I6AA 1GH8A 3ISDA 2FZKB 4LQ9A 1HWUA 4ACOA 3U6FA 4KY3A 1NZBA 3PKYA 3E2EA 3RWUA 4I2PA 1DHMA 5T7LA 2KKVA 4CI6A 4GY2B 3RH4A 4UAVA 2UZAA 1JJ2M 4C2MA 4NA2A 4FK4A 4C0HA 1HNZK