4F3OA

Dna polymerase i large fragment complex 5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
579
structure length
566
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTANMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 198
structure length 566
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f3oA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f3oA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f3oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f3oA01
4DWIA 3GIJA 1N48A 1EX4A 5KT4A 4KN7A 3SPZA 2W9CB 4KLSA 5J0PA 4N56A 2C22A 4TUPA 1NOYA 3OGUA 2BPFA 2B5JA 2OZMA 5DB8A 3H08A 3NBPA 1RYSA 2P1JA 2ZJ5A 4KLLA 5KFTA 3RH6A 2D5RA 1CXUA 3H4BA 1FXXA 5L1IA 4R8UA 3RAQA 4O44A 3GQCA 4EZ9A 1SL0A 2Z1HA 4PQUA 4FXDA 4FJHA 4LSLA 2NRZA 9ICXA 3QEXA 8ICNA 1Z26A 3PMNA 5HLFA 1WN7A 2UVUA 2BDPA 5DK5A 4KI6A 3S3NA 4CEBA 3Q8PB 1LW0A 3OS2A 1Y88A 5HHHA 1V9PA 1Q9YA 1B43A 1HQEA 3C2LA 4O3QA 1RNHA 1A77A 4QZ8A 4CHPA 1NJWA 4M3UA 5L1KA 2IS3A 4E1NA 4R5PA 2OPSA 4UB4A 3RJKA 4M9LA 3RB0A 2ATLA 3MXJA 4FLZA 5HP1A 4ECZA 3D0PA 3RH4A 4RPYA 3TARA 4ECTA 2ZD1A 3NH2A 3JPTA 2H5XA 8ICWA 4YMNA 1J53A 1NK0A 8ICAA 4OVLA 1ZQUA 3VQEA 4FJJA 4RU9A 8ICIA 1ZQCA 1XC9A 4ZTJA 1ZQXA 4EYHB 4YXJA 3P1GA 3JYTA 3LPTA 3V1RA 5IIMA 1SKRA 4CEQA 3PO4A 5C25A 4F8RA 3SNNA 1IG9A 3O3GA 1HMVA 4CEDA 2XY5A 2XRIA 7ICLA 4GC7A 1B92A 2R8KA 2IGIA 4H8KA 1MQ3A 1ZQOA 1RILA 2J6UA 4M0AA 1JLGA 3LPUA 4W5TA 5HNKA 4FLTA 3NAEA 4YFKA 4I2PA 3M8SA 3UXOA 4NLGA 5KG2A 3JPOA 2YV0X 5CA7A 4XRHA 5KFAA 3TAMA 5DB9A 5CR0A 3LALA 2DPIA 4CFDA 3PX6A 3VQAA 5KG3A 1EKEA 1BCMA 2BHNA 4F2SA 1JLCA 4Z4HA 4DTJA 3SPYA 1WSGA 2WONA 2RF2A 5IIKA 1S6QA 3QIOA 2BCRA 4CJPA 1QSSA 4O5CA 9ICKA 3TAPA 1GOCA 2IDOA 4FBTA 4K4IA 3ISDA 2PI5A 1QE1A 4KLEA 4MFBA 3NF9A 5CZ1A 1GOAA 4F4WA 1D9FA 3BDPA 4CJQA 1K1SA 4DSLA 1UOCA 4ZH4A 7ICRA 2FLPA 1RTIA 4PH5A 4UBBA 4KRFA 4KHSA 3LZIA 4ID5A 1NKEA 1ZJNA 2ASJA 3MR3A 4NYFA 4CCHA 1RBVA 9ICGA 1IM4A 1ZQHA 9ICWA 2X6SA 4J2EA 4FZXC 3T5LA 3V9ZA 5J2GA 2ZUDA 4PHEA 5KFSA 4CHNA 4TQSA 3ZT2A 1BQNA 3ZD8A 2ALZA 1NOMA 1S0NA 5KFWA 2Z1IA 1ASUA 3G0ZA 3O3HA 1DGSA 4EEYA 4DL2A 5CY4A 3OYHA 4ELTA 1HNIA 1XHZA 2O4IA 4YNQA 4F4ZA 4HCCA 4KHYA 4QZBA 3JPSA 3AUOA 4CGHA 2ISOA 2VA2A 7ICNA 1BI4B 4DQPA 5C42A 3OJSA 3KHRA 8ICRA 2Z1JA 3RB6A 3MAQA 1HNVA 2HHQA 4J9SA 3OHAA 5IINA 3RTVA 4DSEA 3B6OA 4J9KA 3ITHA 5F9NA 4KV8A 3DRRA 3KHLA 4M3RA 2KFZA 3V9UA 1D8YA 2FPLA 3CM5A 4MF2A 3AVCA 8ICEA 4DFMA 4KLIA 2BQUA 4UAWA 5KFDA 1ZETA 3LDAA 2ISPA 4CK3A 4NCGA 1RT1A 4ZHRA 5KFFA 1EXQA 1COOA 2HMIA 1WSFA 1SZPA 4WE1A 4DSKA 1HUZA 4MFCA 3VQBA 3T5JA 2JZBA 4O3SA 4Z0UA 4M9GA 4B9NA 5KFLA 3LP2A 2DFEA 3C95A 4YD2A 1LB2B 4ELVA 3FDSA 5FDLA 5SZTA 2BPGA 4M9NA 2ZUCA 4FVMA 1JXBA 4NLKA 2UVRA 1LW2A 2HHTA 5J2BA 3WNFA 4RQ7A 3EPGA 1ZQMA 1KVAA 1RZTA 4OKJA 2MAXA 4DTXA 1JLFA 3V6JA 4DTNA 1X9WA 2PI4A 4AHCA 3L2VA 4PWDA 3ASMA 2KZZA 3HPGA 1HYSA 1RT3A 1HQUA 3C6UA 3DMJA 3GDXA 4L8RB 1BISA 4I2EA 4AHVA 2YHAA 1ZQNA 1IKXA 1LAVA 1LWCA 4J9NA 2A1SA 5KFGA 4DF4A 4IG0A 1VSLA 3NGIA 4HUGA 4O4GA 3WNHA 4KLJA 4KO0A 1J5OA 4RUAA 4FJ8A 2KFNA 1CZBA 4RQ3A 2P5GA 4IG3A 4B9UA 4CFAA 3ZDAA 2NUBA 4K4GA 1NKBA 4CJ4A 8ICKA 1HYVA 4E7LA 2I5JA 3MABA 5J0UA 3HM9A 3RMCA 4EBCA 3QZ7A 4DEZA 3RJHA 1S5JA 2G8WA 4XA5A 4BDPA 4IFVA 1NJYA 2KZ3A 1XWLA 1S6PA 3SV4A 1T8EA 2PFPA 2BQRA 1ZQPA 3IRXA 8ICPA 4RW9A 4CJSA 3V9SA 3ETLA 3AA3A 3I0SA 3PUFA 4ECUA 3NTUA 4O0JA 2YHBA 2AGOA 4FW1A 3LWLA 3NHGA 3TFSA 2X6NA 3RBEA 1JN3A 1ZQEA 1BIZA 1UA1A 2QKBA 3AU6A 2NRWA 1WSHA 3MEGA 3CFRA 3U3YA 2GWSA 3TFRA 1Y97A 3NH1A 4N41A 9ICNA 4QWDA 4YR3A 4OJRA 2AJQA 4KTZA 5DLFA 3U3GA 7ICVA 3BQ0A 2NRVA 1JLEA 5EOZA 1BPBA 3SI8A 4UB2A 5JUMA 4FK0A 4LZDA 3HPOA 3ZSVA 4M04A 4J9QA 5DQIA 1TL1A 3OYMA 4I2QA 5KRSA 3SUNA 4CJRA 3GIMA 1SKWA 1IKWA 1ZQBA 4IQVA 4RQ5A 4EYIB 5KG1A 3DLEA 4FM0A 9ICSA 3K5MA 4DLEA 1LAWA 4CGJA 4CECA 4RNMA 3L2WA 3ISCA 9ICHA 1RDBA 4LD0A 4FK4A 2YNFA 3V4IA 2XY7A 4DL5A 4NLNA 1K1QA 5TZVA 2PZSA 3KK1A 4DFJA 4Z6FA 4CHQA 3ULDA 4F4YA 4YXMA 4CGDA 4F5QA 4KHWA 3HP9A 4ECVA 2IC3A 2Y1IA 3DOKA 3TR8A 1C0TA 2HVHA 5HRPA 3L3VA 2E6LA 3TAFA 4K4HA 1L5UA 4M9HA 4AHTA 4GXIA 4IRKA 4IR9A 4RW7A 2OYQA 5IIJA 7ICGA 3AV9A 2BE2A 4FM2A 4RW6A 4QZ9A 4ICLA 3HK2A 1Z00A 5KFHA 4ECWA 3T19A 3T1AA 5KT5A 3HL8A 3ZDBA 3AVGA 4UB5A 3WNGA 4KKOA 3ZSZA 9ICTA 4E19A 2F96A 2BQ3A 3QO9A 4GXKA 2P6RA 2W9MA 4E1MA 1BGXT 2AQ0A 1QQCA 4OGEA 4P4MA 4DTSA 4KMUA 1TKTA 3ZSXA 1TAQA 3CG7A 5IIOA 1EETA 4OLBA 2X78A 1WAFA 5J0OA 4FYDA 4N76A 3P83D 3GILA 4F92B 1NK8A 4F3OA 2C2EA 1WLJA 3ORYA 5J2KA 1ZQJA 4IQWA 2V9WA 4FS2A 4RNNA 2BKEA 3PY8A 4E7KA 9ICBA 3ZSWA 4M6WA 4FW2A 3UXPA 1B9DA 5FRMA 5KGWA 1VSIA 3QESA 1C6VA 2A1JA 4FLXA 3AVFA 1D8LA 1U49A 5KFOA 3SQ4A 3K5LA 4J9LA 1X2IA 5DB7A 1BPYA 1Q9XA 3O3FA 4M42A 2XGQA 3NE6A 5KFKA 4B9TA 4F50A 3KTQA 3GFKB 2PY5A 4DFPA 4QWEA 4F5OA 1TK5A 7ICOA 2BGWA 3MEEA 1D9DA 3LANA 3ZCMA 2B21A 1S1VA 4Z4IA 4RQ1A 3DLHA 4J9MA 2VWJA 3HVTA 1NK4A 5D46A 4YN4A 1U47A 1KFDA 5HP4A 2IA6A 2UVVA 4HHTA 4Z4CA 2P5OA 2BGGA 4DQSA 3FFIA 3EPIA 5I42A 1VSEA 1MSWD 2M9NA 5HMMA 4DMNA 4TQRA 5J2MA 3OS0A 1JLAA 3BGRA 4LZGA 2IHMA 5K14A 1ZQDA 4G3IA 4W5NA 4H4OA 5KFVA 3F73A 4QW9A 3UPQA 2XY8A 1BPDA 5KFBA 3PW5A 2OWOA 4I2JA 3OS1A 4M9JA 9ICVA 3RWUA 1CUKA 4CEZA 5DDYA 3PW4A 1RDDA 4EBEA 1CEZA 1C0MA 2ZE2A 2QXFA 4BXOB 3M9MB 3VN5A 7ICJA 4M3TA 3H8WA 5KTQA 5J2JA 3PO5A 5KFJA 2C28A 3ZT4A 1U45A 3E2EA 3NDKA 7ICMA 4FM1A 4RT3A 5IILA 4R66A 1NOZA 4Q44A 4DL4A 1NJZA 3KHHA 3VQ6A 3B0XA 5J0WA 2AU0A 1WCNA 8ICVA 2AGQA 4I7FA 4RQ2A 4J2DA 4CF1A 4CJ3A 2ZTDA 4JK1A 4O3NA 2HHXA 3K75D 3BQ1A 4F91B 5KG0A 4GMJB 3ZSRA 4PHPA 5KT2A 3G6VA 5CJ7A 2HHUA 2OPRA 1RT4A 1L3VA 4KHUA 3CFOA 3OSNA 3V6HA 3RRHA 1VSDA 1HUOA 5D3GA 3KKSA 4B9VA 4CIFA 3DLKA 2OA8A 3I8DA 3RJEA 4DTUA 2IBKA 2ZTCA 1T7PA 1KEJA 4DU3A 1HJPA 5L1LA 2J6TA 5DMRA 3OY9A 1ZQZA 4TURA 1RTHA 1AROP 3MDCA 4DSJA 3LWMA 3CFPA 3C94A 3OYAA 5J2DA 1BQMA 1CZ9A 4LVSA 3QETA 4KB0A 2R7YA 4Y1DA 1A5VA 2ASDA 3V72A 3DRSA 4DQQA 2XY6A 4BDYA 4QWAA 3VA0A 1JLQA 1S77D 3N97B 4BWMA 1HJRA 4DTOA 8ICSA 3TI0A 2QKKA 4OLAA 1L3SA 1RYRA 1KCFA 3MR2A 4FZZA 1QSLA 2KN7A 2W9BB 4OKEA 1BPXA 1DTTA 4P4OA 4HVJA 5DB6A 4W5QA 4AHSA 4KREA 3ZD9A 4IQUA 3Q8RB 1RCHA 1DOQA 1SKSA 1VSJA 3MDAA 3QNNA 4AILC 3VQ9A 2HNYA 5C24A 4I29A 4RW8A 3K58A 3AO2A 2MUTB 5J2PA 2HNDA 8ICCA 4M47A 3JSMA 3DYAA 4YCXA 3WNEA 1S1TA 4M3XA 1ZQGA 4C8NA 1ZQLA 3AVBA 4Y1CA 3AVMA 5DBAA 3UQ2A 1BHLA 1D5AA 3V6KA 4Q5VA 2NRTA 1N6QA 2RDJA 2W9CA 9ICOA 4DG1A 1JXEA 3PV8A 4BWJA 1ZQWA 1EXNA 3TQ1A 4MEXA 1T3NA 4CF0A 5FRNA 4MF8A 3VA3A 3GV8B 3KLEA 4ED1A 1VRUA 3THVA 4B9SA 4C8KA 4CEFA 1U4BA 1ZQVA 2PFNA 3AVIA 2LSNA 4KLUA 4EBDA 4RG8A 3NGYA 9ICJA 9ICUA 1KSPA 1C1AA 1VK0A 2YNIA 4CGFA 3KK3A 3C2KA 3QEAZ 1ZBHA 5F9LA 4I2CA 1YTAA 4KI4A 4QW8A 4IBNA 9ICIA 4CF2A 3RBDA 4J2AA 4ECRA 4ED7A 2AQ4A 3MECA 3TAEA 3P5JA 5BOLA 1L3UA 1RT5A 3NGDA 4P4PA 4UQGA 3OYCA 3MFHA 1NK7A 4BDZA 2HHVA 4ELUA 2FBXA 1ZBUA 3SQ0A 3H4DA 4C8LA 3LZJA 5HRSA 4JRPA 2RPIA 4DL3A 4DS4A 4CF9A 1JMSA 4J9OA 3OYNA 3V81A 1SUQA 3OYBA 3QIPA 2GBZA 5CYQA 3AVLA 2YKNA 3S3MA 4JV0A 3E01A 3LAMA 1JX4A 4KLHA 4PHAA 1QLNA 1S10A 3SUPA 4DL7A 1NK9A 1ZBFA 4CFCA 4CHZA 2XGPA 4CJVA 3B6PA 4X5VA 1UT5A 4KLGA 1HPZA 3SI6A 2G8HA 1J9AA 4J9PA 4QZHA 3HT3A 3ZSYA 1O1WA 2FLLA 3DLBA 3UQ0A 3KLFA 1RDAA 9ICRA 2BCVA 4YD1A 4GXJA 5CYMA 2G8VA 1NK5A 1JXLA 7ICPA 5KGXA 1S9EA 3BQTA 1YT3A 2VA8A 3CYMA 3HPHA 3ALYA 4I9LA 4CJKA 4GC6A 2I9GA 3NGZA 1IKVA 4ED8A 5SWMA 1UWBA 2W9AA 1RTJA 5DGAA 3EYZA 2C2RA 3AVAA 2IAJA 4YMMA 5BOMA 1XSNA 2ASLA 1RPLA 5KFPA 4R8UB 9ICAA 5J2NA 3C1ZA 1QTMA 5CHGA 1WSJA 1KFTA 4HYKA 3AA5X 2ETJA 3H8SA 4UAYA 4O9MA 1C0UA 1U9LA 3C5FA 4DTMA 4I2HA 3KD1E 3TANA 5J0TA 5KFYA 5CWRA 2RKIA 3DLRA 4KITB 3MGIA 4FJGA 2BCUA 4RQ4A 3KIOA 3VQ4A 3AVJA 1T05A 2G8FA 3K2PA 3V7JA 3QEPA 1JL2A 1B9FA 3KLGA 4GVMA 2FBYA 4RPZA 2E6MA 4FLVA 4F5RA 3NH0A 5DBBA 3C21A 1BI4A 2HVIA 1T03A 4ECSA 4JV1A 4BE1A 2W8KA 4F93B 3RB4A 1ZYQA 2JEFA 2R8JA 4IR1A 1N5YA 1MQ2A 1W9HA 3SZ2A 3QEWA 1S9FA 4ID1A 4C8OA 7ICFA 4CJFA 4ECYA 2VG6A 4M45A 4BE2A 2X74A 3TAQA 5KFIA 4F5PA 1KTQA 5JS2A 4DTPA 4I2GA 4DOCA 4CGIA 3GV5B 8ICQA 4JS5A 4O3PA 5J2FA 1JIHA 4P2HA 1ZQQA 3K5OA 4E7HA 3K57A 4KN4A 2ZJAA 4O3RA 3LDSA 1BVSA 3N4MB 1TVAA 3K59A 4FJKA 4CJ5A 4CIEA 2PFOA 4DFKA 1RT6A 4FJMA 2LYHA 2W8LA 3PMLA 4CJUA 3V9WA 1Q8IA 3L2QA 3OVNA 2V4RA 3HJFA 8ICLA 9ICPA 1TKDA 3T3FA 3TABA 2DFHA 8ICHA 4OPKA 3AVKA 4QZDA 1YTUA 4FJ7A 1MC8A 1ZQSA 4I28A 4Q8FA 3AO5A 4NY8A 2FBTA 4CK1A 2W42A 4DL6A 4G1QA 4RPXA 3HW8A 1ZQIA 5KFZA 5D49A 3BJYA 1FK9A 4GLXA 2B6AA 4DSFA 4PPXA 3SUQA 4K8ZA 3LAKA 4QOZB 4AHRA 2F8SA 2J6SA 4KTQA 2G8UA 2C2DA 2E4LA 3NF6A 5HRNA 3PR5B 3Q8SB 4JS4A 4HTUA 2YNHA 2V4QA 2XCAA 9ICFA 1KDHA 1KRPA 2QK9A 4FO6A 4ED3A 2F1HA 4F2RA 3RMDA 4CIGA 3RB3A 1S76D 1JLBA 3GIIA 4EZ6A 2FLNA 1LV5A 4NXZA 4GW6A 4M3YA 3HSTB 1JL1A 3HO1A 4PY5A 5CB1A 3ISBA 1NJXA 3AA2A 4LY7A 3RMAA 5J2QA 2RN2A 5KI6A 3C1YA 3MR6A 3GIKA 3KK2A 3KD5E 1A5WA 3C5GA 4TSXA 2R8GA 4M41A 4CHYA 4N5SA 3TWHA 3QNOA 3AA4A 4O5KA 4RNOA 1GOBA 2D0CA 1A76A 2DFFA 5J2CA 3JPRA 4XQ8A 4R63A 1UA0A 4PUOA 3U6FA 4DU4A 4KLQA 4I2AA 3OHBA 2F1JA 1WAJA 4FLWA 4OPJA 1C1BA 4KTWA 3SQ1A 1XSLA 1S97A 2YNGA 1RBUA 4AH9A 4N47A 3EY1A 1YVUA 4H4MA 4FJXA 4OKKA 3HX0A 3QZ8A 2HHWA 2ITGA 2PXIA 2ZJ8A 3SQ2A 1CLQA 3H40A 1XHXA 5KFUA 1S9GA 4RW4A 4M3WA 2VA3A 4CJTA 3MXIA 2Y1JA 3DM2A 4Q8EA 4JUZA 4CJEA 4MQ3A 3QLHA 1TVRA 2OPQA 4Z4EA 4ED2A 5DG7A 3DI6A 4HCBA 5EU7A 4ECXA 5J2IA 3JPNA 3VQPA 4QZIA 8ICBA 4KHQA 2JZBB 4IKFA 4KLMA 3V7LA 7ICQA 3RJGA 2HHSA 8ICFA 2B4JA 3NF8A 1IH7A 2F1IA 4O5EA 4B9LA 2VANA 3UIQA 5J1EA 2BANA 4KLFA 1RT7A 3PX0A 1C7YA 1TFRA 4RQ6A 3RR7A 4IQTA 4F4XA 5KG4A 3V7KA 1TKXA 2UVWA 4RT2A 1WCLA 4O3OA 1ASWA 3JPQA 4M3ZA 4KPYA 3L8BA 5T7BA 4R64A 1ZQTA 4YP3A 3M9OB 4UBCA 5HHIA 3SCXA 3G6YA 4I2IA 3T5KA 1TK0A 4CJWA 5I3UA 8ICYA 3LP3A 3KHGA 2R8HA 1SL1A 4CGGA 1WNSA 1WSEA 4YFUA 2BPCA 5KFXA 2P6UA 1SL2A 8ICOA 4KHNA 1X9SA 1IKYA 5HRRA 3PR4A 4RZRA 5HMLA 2NRXA 5DDMA 3G10A 2KZMA 7ICKA 4QZAA 7ICSA 3H8JA 2FPKA 2AGPA 3HP6A 1T4GA 5J2EA 1BL3A 1BIUA 3ZT3A 3CM6A 1XU4A 3NFAA 4HUFA 1MU2A 1W0HA 5KFQA 4FJ5A 9ICMA 4PA1A 2IHNA 4QAGA 4DOBA 1KVBA 3IS9A 3MBYA 4Z6CA 2JGUA 3V9XA 3AVNA 1CXQA 4JWMA 4XUSA 4DTRA 3I0RA 3NCIA 3K5NA 4QZGA 3EZ5A 5CP2A 2PFQA 4DLGA 2FC0A 2R8IA 1NK6A 4JV2A 1DLOA 5EWGA 3OYDA 3RR8A 2DFLA 2FPMA 1NKCA 5EWFA 1KLNA 4B9MA 1ZBLA 4FLUA 3AO1A 3VQ7A 5JS1A 2OZSA 3PX4A 8ICMA 1X9MA 3RJFA 3HYFA 1REVA 3QERA 4FZYA 4Q0BA 3O4QA 1QHTA 5KT3A 5CZ2A 4YMOA 5DQHA 7ICTA 4TUSA 5DLGA 4J9RA 3KLIA 4EP5A 4FJLA 2HW3A 3OYEA 5DG9A 5DQGA 1KVCA 3B0YA 2FBVA 4RQ8A 4Z6DA 3PW7A 4NLZA 2ZTEA 4YQWA 1RBSA 4QCLA 3K4GA 4DOAA 3MGHA 1I39A 3ZDDA 4E0DA 5IIIA 2KTQA 1FKPA 5KFRA 5C5JA 9ICCA 4W5OA 5DGBA 5BPCA 1S0VA 3AO4A 4EP4A 4FJNA 3G6XA 4UAZA 1LWEA 3KLHA 8ICXA 3M8PA 4RUCA 4DS5A 1KLMA 4JRQA 3NF7A 4PGXA 1S1WA 2FMQA 3PW0A 4NM1A 1ZQYA 3O4NA 2JEIA 4DQRA 1RT2A 1X1PA 3PW2A 4NYNA 4FK2A 1DTQA 3A2FA 4JWNA 3M8QA 4CEAA 2Q3SA 1F21A 4F3TA 2FMSA 3M8RA 3ZDCA 3ISNC 2IOCA 5HROA 1Z00B 5E41A 2FMPA 1S0OA 1C1CA 2DY4A 3ZT0A 3OYLA 5J2HA 2ZUBA 4B8CA 3V1QA 4BXOA 2D0AA 3LP0A 4TUQA 4DQIA 1BPEA 1BCOA 4ECQA 3OYGA 4O0IA 2O4GA 3QE9Y 8ICZA 4NM2A 4FJIA 5KG7A 4KLTA 4NCAA 2F8TA 4PGYA 4UB3A 1XO1A 5D4BA 1UAXA 2PYLA 5J0QA 3VQ5A 3MR5A 2XC9A 3AVHA 2G8IA 1ZJMA 1VSHA 4FLYA 3BQ2A 3SJJA 3OYFA 2P66A 1QSYA 4E7IA 4DU1A 1G15A 2P51A 4Q45A 4KLDA 2ZQBA 2BCSA 4IRDA 3AU2A 4M6WB 1VSFA 3ZT1A 3LP1A 2WOMA 5KFNA 4IRCA 1B22A 5HBMA 4OGCA 5DBCA 1UT8A 1U48A 3KJVA 4KB1A 3H7IA 4PGQA 2A1JB 2GV9A 4CF8A 1LWFA 3QEBZ 2D0BA 4QZCA 2EX3A 4QWBA 4BACA 1ZQRA 1QS4A 1Z25A 4B08A 1ITGA 1TAUA 2HNZA 3IAYA 3EW9A 8ICJA 3RJJA 3ZDEA 3MXMA 3OJUA 5KFEA 1TV6A 4KAZA 3C23A 2XHBA 4R65A 2BCQA 3MEDA 1RXWA 4MEYA 2XO7A 9ICEA 4J2BA 3IHQB 4E3SA 3FYHA 3HXMA 2JEGA 1WSIA 3HVRA 5J29A 4I2FA 4BE0A 1XS9D 1A5XA 5KG5A 5DG8A 7ICUA 4CK2A 3V1OA 1FKOA 4ED6A 2W9BA 2G8KA 4NCBA 1K6YA 2KQ2A 1ZQFA 3L2UA 4DSIA 4HUEA 4UB1A 1XI1A 3L2RA 4M2YA 3HWTA 5KFMA 9ICQA 1IO2A 3JPPA 2WTFA 1L3TA 3QINA 4QZFA 3IM1A 2EHGA 1ZQKA 5FROA 4Q43A 3S9HA 3ZSQA 4ED0A 2XCPA 1IXRA 5KRTA 4I2DA 3OYKA 2MUTA 2RDIA 1HRHA 4QWCA 4AHUA 5KFCA 4LSNA 2VG7A 4CESA 2KW4A 3UXNA 5KT6A 3T5HA 3AO3A 4CE9A 5DKWA 4JLHA 5L9XA 2DTUA 2HB5A 4CJLA 2GUIA 1H38A 3Q8LA 3RAXA 2PYJA 5J0SA 1S1UA 3LK9A 4E7JA 1S0MA 2IMWP 1U04A 9ICLA 4PHDA 2YKMA 4B3OA 4Z4FA 4LH5A 4XIUA 4IFYA 4YG2A 3VQ8A 5J2AA 4KLOA 3S3OA 4I2BA 1ZBIA 1Z3EB 3RMBA 4FBUA 4K8XA 3RRGA 1XSPA 3SYZA 1RBTA 4MFAA 8ICGA 4CEOA 5EWEA 4ZTFA 1RTDA 3GV7B 4W5RA 3M9NB 1S1XA 2Z1GA 4DF8A 1R0AA 5J0XA 5J0RA 3ZSOA 1BPZA 4F5NA 1TGOA 3VQDA 2DPJA 4I27A 1TV9A 4KFBA 3Q8MA 1J54A 4O55A 5KT7A 4MFFA 4FCYA 1RXVA 3DLGA 2OPPA 3QEVA 4FJ9A 3Q8KA 3TAGA 2JLEA 4BGDA 1RDCA 3PVXA 3IG1A 1HYZA 1TK8A 3C6TA 3DOLA 2A1RA 5J0YA 1ASVA 3CQ8A 1I3AA 1VSKA 7ICHA 1SV5A 4O5BA 1RBRA 3L3UA 2BR0A 8ICUA 4CFBA 3F9KA 2VWKA 4YVZA 1JKHA 3RH5A 3OSPA 4CEEA 4C8MA 4QZEA 5KG6A 3C2MA 1TKZA 3RJIA 3D45A 4B8AB 4YR0A 3MFIA 4FS1A 7ICIA 4IDKA 3SV3A 1VSMA 2ATQA 3PNCA 1KFSA 1TL3A 2JEJA 1N56A 4YR2A 4LH4A 4CHOA 4Z6EA 1VRTA 3KKRA 4I9QA 4DO9A 3Q8QB 1EP4A 7ICEA 3EWAA 4CERA 2VG5A 2I1QA 4RQ0A 1ZQAA 5L1JA 3V6DA 4Z4GA 3SUOA 3OYIA 4E89A 3QEIA 2Q0ZX 8ICTA 3OYJA 3VQCA 1PZNA 3VQQA 3DRPA 4F4KA
chains in the Genus database with same CATH superfamily
1VRQC 2PMWA 4DWIA 4OI4A 5BR8F 1EX4A 2MQ8A 5BPNA 2F3JA 1HHQA 3CCES 2HURA 1NOYA 4IS7A 2KXFA 1Q8LA 2DNPA 4CO3A 1QAIA 1N34K 4CVNE 3DN9A 5G0RB 2HKEA 2WAQF 3RH6A 4HTIA 1EZZB 3KLEB 1VRUB 3MAHA 2V2KA 1NDKA 2QLTA 1RABB 1X60A 1YBUA 3W64A 4O44A 2MQNA 4FXDA 3IWXA 3RW6A 1M5KC 4F04B 3QEXA 5ALZA 2YNIB 1WN7A 4Y34A 2BDPA 5HL7Q 5DK5A 4LQ9A 2GA7A 1W7AA 4JI4J 1I94J 1LW0A 1D3WA 5GAEI 3OS2A 5KAFU 2M8HA 1B43A 5BRHA 3C2LA 4MKVA 3CCVS 1FJGJ 1WKLA 3R7NB 2HQFA 1RT5B 2E1FA 5J1PA 3NG8A 2OD6A 4M9LA 3RB0A 2ATLA 2VODA 4FLZA 3D0PA 1X4EA 2K4IA 1IQTA 3G4SN 3MGVA 2F8KA 2XULA 2H5XA 2CJXB 1J53A 3MN6A 3EO3A 1NK0A 2W01A 2B9YA 3R1HA 5AFUH 4ZVSB 2IDLA 4MDBA 3HKZD 3EDRB 4YXJA 3LPTA 3CJBA 1S4EA 5EE0A 3BGFA 3PO4A 5C25A 4F8RA 1KC8T 2YQEA 2DRAA 1WD6A 2B0CA 4B1WB 4PL7A 4CEDA 1SV0A 4PXDA 2NS1B 2IGIA 2GHWA 3CDBA 4H8KA 4M0AA 5HNKA 2ZJPL 3ZZYA 2GO7A 3UXOA 2V0NA 3O9RA 4NLGA 5KG2A 3THXA 3JPOA 1NSQA 1IIPA 5DB9A 5CR0A 4CWBA 2JWLA 4PYDA 4CFDA 2QWRA 4O5FA 3THYA 1EKEA 4F2SA 4DTJA 3SPYA 3QPIA 3DLJA 4UAVA 2UUAF 4C48A 3ENWA 5IIKA 3DJCA 3FBEA 3OL8A 2CQHA 3MAAA 1IJEB 4CJPA 4P7TA 1GOCA 2HSZA 5ETQA 4DV1F 2WMMA 3OR1B 5EE3A 4ZP8A 2NLXA 1QE1A 4MFBA 2XZTB 2P9IA 2BJEA 1FESA 5B66U 1RGIA 3SFGA 1OVQA 5M1FA 2A10A 1RWPB 2ZOMA 4OI0A 1U1LA 1FHTA 5CQGA 1VBYA 4EWTA 4FNIA 4CDGA 1RTIA 5AQMA 4PH5A 2IAJB 4NLUA 2FHJA 4U7CA 3T9ZA 1ZJNA 4JYAJ 2ODGA 1ZQHA 3AARA 5KFSA 4LBIA 1FXLA 3CD6S 4JN4A 2EWSA 3WKBA 5C2DA 3ULHA 1S0NA 5KFWA 1DGSA 3AA8A 4EEYA 4I56A 4ELTA 3GP9A 1XHZA 3GMGA 1FTRA 2O4IA 1YITN 4YNQA 3I87A 2FZKB 4KHYA 1REGX 4K4SA 4Y2XA 3N5FA 1ZM3A 2KIVA 2ISOA 3L4IA 3E3XA 1BI4B 1X31C 3MAQA 3ETRA 1HNVA 4NXMK 1U2FA 5IWAF 4J9SA 1CQNA 2MQQA 3ITHA 4OYWA 3AQEA 4USTA 2J4RA 3DRRA 3KHLA 2QMXA 3IR7B 3V9UA 3MDQA 2FPLA 3SMZA 3T1YK 4MF2A 2QRRA 3AVCA 4DFMA 4KHMA 5KFDA 2ISPA 5BYRA 1ZXOA 1K8KB 4X84A 1IWGA 3FQLA 2VC1A 1WSFA 4BY9C 4MFCA 5CRXA 2V4JA 2JZBA 1VOMA 4O3SA 4Y2SA 4NA1A 2W25A 3C95A 1SCJB 1A0PA 4WIQA 4CZIA 2ZHOA 4B3RK 3FDSA 2Z2YB 5FDLA 2G5HB 5D0HA 5SZTA 4FVMA 5KOWA 3NVVA 5AJ3J 1RM6C 1LW2A 2HHTA 3WNFA 1ZQMA 2UXDK 3M2RA 2PMZF 1SH0A 4FWQA 3MPUB 2GX8A 2P35A 3ZEUB 3SENA 4DTXA 2QSFA 3V6JA 3KJFB 1X9WA 3QYYA 1KAYA 2YMQA 4K4VA 4AHCA 1FKAF 3BO3A 3EMTA 4PWDA 5A8WA 1FF2A 4P72A 1RT3A 2XYHB 1AXQA 4YB1P 4L8RB 4TNOA 4I2EA 4AHVA 4LBPA 2D6FC 1LWCA 4J9NA 5KFGA 4DF4A 1VSLA 3NGIA 1GEHA 2HK2A 2GUPA 3SEOA 4OV1A 4FJ8A 5E3QA 5EX3A 4RQ3A 2DGSA 3UDVA 2P5GA 3BBCA 4IG3A 1JMTA 3DXSX 2NUBA 2LVWA 4FE3A 1DURA 5MLCV 5AQOA 1X3NA 3IGVA 1VK8A 3CPWM 3CJ7A 3RMCA 1RYUA 5ALLA 3RJHA 2VPXB 2G8WA 4IFVA 2K7KA 8AT1B 4J03A 4PKGA 4M63C 2PFPA 3J7YI 3W8PA 3IRXA 1ZXIA 4RW9A 2ZJRQ 3CJKB 3AA3A 1EB0A 2YHBA 4DV7F 4Y0WA 3LWLA 2X6NA 2MZQA 3RBEA 4FWMA 3EXCX 4ZJOA 2CDQA 1F5SA 1ZQEA 3TZWA 4PWUA 2QKBA 3HI9A 4L6V3 5GAHP 4ITSA 5C10A 2K06A 1C1BB 3M32B 1Y97A 1WB9A 3GWCA 3JAMO 2B4PA 4YR3A 2AJQA 3HRGA 4KTZA 1DY3A 4ZOHC 1SBRA 2VU5A 1JLEA 3F53A 4EO6A 4OO1J 1PAEX 2CG8A 4OJPA 3HPOA 3JTNA 4LF5F 1S9GB 5LSRA 2DO0A 5DQIA 3TYTA 2NZTA 3SUNA 3GIMA 1IKWA 2PFUA 2BYCA 2GMJA 4DCCA 5ALKA 1P8GA 2GVDA 4CF4A 4DLEA 2MMYA 2WW8A 1NLKL 3D0IE 5CCMA 4YY3F 4CECA 1J2MA 2CPIA 3L2WA 1IV8A 3IG5A 9ICHA 2Y0BB 4FK4A 2XSFA 4EX6A 3CWJA 2YNFA 3T1HF 3J7AN 3FEYB 4DL5A 4Z94A 3BS9A 2PZSA 3KK1A 4UARA 4NZ0A 2DBYA 3TKAA 3B9JA 2OIHA 3ULDA 4IOXA 4IO8A 4P2SA 3ZYYX 2H3QA 1HHSA 3HP9A 5D77A 4E8UA 3D2EB 3W2WA 3OT9A 3SDEB 2AJ2A 3L3VA 1L5UA 4M9HA 4GXIA 3P4IA 4IRKA 2DNLA 4IR9A 4RW7A 2OYQA 1LOTB 2QB0B 2LPEA 2KT5A 3OLBA 2ROEA 1NZBA 3CI5A 5KFHA 4ECWA 2CADA 1VQ4S 3T1AA 3CCTA 2FJAB 2HFSA 1X5OA 3CJ5A 5AK6A 2CJQA 2V2QA 1VC5A 2BUNA 2IRXA 2F96A 1DBDA 3BEGB 4AYBC 2BVZA 4FKXA 3UDLA 3NEKA 2EZYA 2E5IA 4CYUB 2WW4A 3POTA 1BGXT 4K59A 5T7LB 4V19J 2IOHA 1VQ6S 3O1LA 4KMUA 1N5XA 1TKTA 3CQYA 4AP9A 3GFHA 5HJXA 2C42A 1OSCA 2FXUA 3P83D 3GILA 5KPTA 1NK8A 3AODA 5EVZA 1FEEA 3OXLA 3MCSA 2CQBA 1DLOB 5JMVA 3ZSWA 3UXPA 2MZ1A 3BSNA 5FRMA 1BUPA 1VSIA 1REVB 3U8XA 4RX6A 5E5NA 2O8DB 3EGVA 1U49A 2B51A 4JAXA 1Q9XA 1HIWA 4M42A 3NE6A 3ZZZA 5KFKA 4B9TA 1RAHB 1HBUB 1YWXA 1VLYA 2G09A 5A2QU 2UUBK 5A0YA 2MB0B 3KLIB 3MN7A 4F5OA 2F7TA 5L9NA 3ZCMA 2B21A 2GMHA 4Z4IA 1N4LA 4RQ1A 4J9MA 3U26A 1NK4A 5D46A 1BG3A 5ELZA 2LHTA 3CF5L 1FKPB 3CHWA 4HHTA 4Z4CA 2P5OA 1JRPA 2MKHA 4DQSA 4OHYA 3EPIA 4ERDA 1VQON 2VONA 1FXDA 3VCDA 1KLMB 2HWHA 1S8OA 4P0PB 5J2MA 2C3YA 4OI6A 2IM0A 4BC5A 1FE4A 2IHMA 2CYYA 4UB6U 1BXNA 1S49A 2BE9B 2O3DA 4QW9A 1WHXA 2XY8A 3O4WA 1RHUB 3C16A 2UUCF 1SQGA 4MKAA 3FZBA 4QR2A 4DV4J 4I2JA 4NA2A 4M9JA 1CULA 2OO4A 2HRTA 4FOIA 2QFJA 1C1CB 1M1KO 5BXIA 1CEZA 3DCAA 1WSRA 2RRBA 4U7UD 2PBDA 1WJ9A 7FD1A 1H1VA 3FBFA 1YGYA 3ISZA 4P52A 4M3TA 3P39A 3H8WA 2FSNA 5J2JA 2PAVA 1WNEA 4ER8A 2NSCA 4B3TF 3ZT4A 1U45A 4CM0A 4Z37A 3R5BA 5AQGA 3HSZA 1MROB 5AXNA 1ZTWA 5JXSA 4JI3J 5IILA 4R66A 2ERRA 4AYBD 2CH6A 5GADU 2A41A 3K0SA 1RXOB 4AQYK 8ICVA 4I7FA 4CF1A 4C4RA 4KHPK 3M30A 2IVMA 2Z58B 3FZHA 1Z2ZA 2A3JA 4ZVHA 3C46A 5BYSA 5KT2A 1VYAA 2HHUA 2JV3A 4DV6J 4OJLA 2EK1A 1ZAXA 3ET6A 4AXJA 1H73A 1TFWA 1L3VA 3LP1B 4ZIWA 2WOMB 3HVWA 1XN9A 1HUOA 5D3GA 3RF9A 4CIFA 2QKQA 3QT6A 2QFIA 2OA8A 3I8DA 1LWFB 2ZTCA 3K7RA 4DU3A 5L1LA 3QJJA 4WQ5C 5DMRA 4C1NK 3GCWP 3OY9A 2XO6A 2MQMA 4X62J 4A59A 4KPCA 4NLDA 2PA3A 1HJOA 1AROP 2HNZB 3HFVA 1SB6A 4DSJA 4MYUA 3LWMA 3AY0A 1FWPA 3OYAA 5J2DA 4A8YA 1TV6B 5LMNK 3CSKA 3ZTQA 1R8CA 4Y1DA 2WAQC 1A5VA 3S6EA 3L4PA 1PYSB 3DXKA 4N77A 2DIUA 4GVBB 2BRKA 3HHLA 4DTOA 4M7YA 1IKVB 3TI0A 1RYRA 2MZSA 4GKKK 1QSLA 1TFYA 2JFDA 2W9BB 4OKEA 4HVJA 3BREA 1Q7LB 2J0XA 3WQPA 2PGCA 2YVSA 3MM7B 5B08A 3ZD9A 2DGVA 1N34J 2W2OP 4S0MA 4ES2A 4WYWA 4NEZA 4ZOSA 1H98A 3TPQA 4I29A 3PYEA 1PC5A 3K58A 1B7YB 8ICCA 2D3ZA 4LSNB 2QLXA 5DRKA 1OJ4A 2NLWA 5AQTA 3CC2N 1SC3B 2FZCB 1ED1A 1K0TA 3M6WA 1S1UB 5DBAA 4DR4K 3Q7BA 3OFHA 2M8DB 3V6KA 3IN5A 5CZVA 4IFYB 1JXEA 1HWLA 4OHZA 2BZ2A 1HNXF 3NVYA 4PL2A 5E26A 4GV3A 2P6SA 3TQ1A 5G0RA 1JCGA 4IOCL 4XAKA 2AEFA 4KH5A 1Q8KA 2A6OA 4MF8A 2JZ5A 3G4SS 3KLEA 4ED1A 2F3NA 3NCPA 1VRUA 2XSJB 1RTDB 3THVA 1RCOB 2WB1C 5LJVA 2BV3A 2VFUA 2WF9A 2QW9A 2AKWB 2LSNA 2AX1A 3O08A 2WF5A 1S72S 4EBDA 4RG8A 1R8BA 3NGYA 1WDDA 3ENBA 2YNIA 1VK0A 3C2KA 3QEAZ 1BC6A 5F9LA 4JI1K 2BKPA 2DXEA 4Y00A 3DLGB 4RR5A 3M8WA 2AQ4A 4B1YB 4DR2F 1Z1ZA 3J7AP 1L3UA 4IO9L 1FVSA 1RT5A 3NGDA 4UQGA 2D1CA 2N4DA 3C6TB 3DOLB 4BS2A 1QH9A 3VV2B 2XVTA 4TLQA 5JVHQ 2KJVA 2A2DA 1CSJA 3QGPA 1KS2A 1QUPA 3MF5A 5GMDA 1CRXA 3B8HA 5HRSA 4JRPA 2RPIA 3LQVA 1RHMB 1HWUA 3BGOP 4LFCF 4HAIA 2ZIWB 1V97A 3VZIA 4J9OA 3J8AA 2DHSA 1OWXA 3VGVA 4JV0A 4K43A 4CZCA 3HRDD 1KAZA 5D4PA 2NRRA 4PXCA 1NLVA 3SUPA 1TL3B 2G0JA 2Q0UA 2UU9F 3GG0A 4XDDA 2XGPA 1UFWA 4P10A 4WKYA 2E3TA 4CF3A 3Q2SC 2W7AA 1HNZF 3TUIC 1QUVA 4Y28C 2GQ2A 2VG5B 2G8HA 4ZVFA 5B0FA 2ZF5O 4ZPDA 2CPJA 3OQ2A 3V6DB 2F1FA 3D6HB 2MSSA 1PO6A 3UQ0A 1F5BA 1K8AO 3OR1A 3ZZOA 1JXLA 1RI7A 2PSZA 3DRPB 3UB5A 3BQTA 1I6JA 3W66A 3HPHA 3VR1A 5H1SQ 4GC6A 3R5AA 4K5RA 1IJJA 4ED8A 2W9AA 2P9KB 4C6AA 1FWKA 1KD1O 3NBPB 2W54A 3Q83A 4JI6F 3ICLA 3EYZA 2ALYB 1ZM2A 2ZC4A 1WBBA 2IAJA 1L7OA 3VETA 4Y6IA 2OXOA 4NXMJ 1L7MA 3VF2A 3JQMA 4ZP6A 2VQFK 2DH7A 3W65A 3C1ZA 1QTMA 5CHGA 5EUHA 1WSJA 4N7TA 2WB1D 3H8SA 3TU5A 3T1YJ 5AKIA 2GHPA 4LSLB 3CJ9A 1U9LA 3C5FA 4IDHA 5HLFB 3SD7A 2H3IA 2PMZC 2XMKA 2LI6A 2R7OA 4KITB 1UETA 1L8LA 2CPEA 3VGMA 1FDAA 3ISND 3BGLA 3VQ4A 2E7WA 4CT9A 3TX8A 2G8FA 2UUWA 1JL2A 4R5PB 3ZZRA 4FLVA 3NP5A 5ETLA 5HP1B 5DBBA 1BI4A 4X4PA 1X3MA 4B3RJ 2W8KA 2ZD1B 4PZVA 2E1RA 2E5SA 4Y2CA 4BGBA 4USAA 2OJ3A 4DN9A 5LSLA 4IFEA 2QYGA 1MQ2A 5JJBA 1A6LA 3ETMA 3E51A 5C0YA 1PILA 2EFQA 4OLOA 3JYTB 4CJFA 4BE2A 1KQSM 2Y0SF 8ICQA 4JS5A 3DDHA 2KRRA 2X1FA 4I0WA 1JIHA 1IBKF 3D28A 2R7XA 2GHVC 3K5OA 1K8KA 2FF6A 2OELA 1Q82O 3D3BJ 2FSJA 4I2PB 2BZFA 1BVSA 3CJ8A 3N4MB 3TA0A 5L38A 1RAIB 4FJMA 4CLZA 3V9WA 1Q8IA 1VLBA 3I32A 4KGZB 4A61A 4PCQA 3UO0A 4YOTA 2KI2A 2WVCA 2DH8A 3L4BC 2RF2B 4CTAB 1S6QB 2FHJD 3A3OB 1NAQA 2NUUG 3OXFA 1K47A 3ZEUA 4FJ7A 4LRBA 4QPTA 5LOQA 4CK1A 4OX6A 2H4WB 1ZQIA 2OHFA 2ZFHA 2WHOA 2HFUA 5GAHI 4PKIA 3LAKA 4V1Ak 3GL1A 2NZCA 5JRTA 1SJFA 4QOZB 2J6SA 5DDRC 2DJWA 4DUZK 3SJHA 5HRNA 3PR5B 4TKTA 1YJNN 1GQEA 2E5GA 3MWPA 4FXVA 2AMCB 2F1HA 1GTEA 3H2VE 2E20A 3I28A 4X4TA 3MURP 5IXUA 2QM1A 4JI0K 1BQNB 3H45C 3HSTB 2F4VF 2F9JA 4OJ1A 3TACB 2A6MA 2VH7A 2CDRB 1URRA 4LY7A 2HHHF 2PMZD 2RN2A 2KP7A 3K9JA 3CJKA 1XC3A 3MR6A 3C2PA 4LRCA 2E1AA 3C5GA 2R8GA 4DX5A 3QNOA 5LM7E 4DR1F 1GOBA 2D0CA 5J2CA 1ZC6A 3ZNUA 1F9HA 5AKLA 3CT9A 5CXTA 4DU4A 3W3DA 4DPYA 1SGGA 2F1JA 4GO5X 4DR6F 1C1BA 3M32A 3SQ1A 1RBUA 4AH9A 1HD0A 2DR7A 4QJFB 2V67A 4OX9K 4MTPA 3HZGA 3QFWA 5KL8B 4DUYK 2POKA 3HX0A 2ITGA 4WJ3B 2MY7A 2A2CA 5BRDA 5KFUA 1S9GA 2QI2A 3NVZA 3SAGA 5GMKa 4C8ZA 2VA3A 2QL7B 2J8AA 3L7UA 1RLCL 4RJVA 3MXIA 4Q8EA 3KWGA 4H54A 4ZHRB 2ZWHA 2HWTA 2HMIB 4JKFA 5EU7A 4ECXA 5J2IA 2XICA 3JPNA 5EY4A 4KHQA 1HA1A 4BRFA 2F40A 5ALFA 8ICFA 3BH6B 4I67A 2D41A 4F4AA 1Y7PA 4LUBA 2F1IA 4BR4A 2LA6A 2MQPA 3AN1A 2B7CB 5AZJB 2OEKA 4H0VB 2Y9HA 2OTLN 5DDQC 4IQTA 2OKQA 3V7KA 1YIJN 3I9ZA 1EWQA 4RT2A 3NGSA 3JPQA 4M3ZA 3ELHA 3L8BA 4AL5A 4NOHA 1ZQTA 5E7OB 3OW2M 1RISA 4UBCA 3J81O 1JLFB 3KG4A 4Y2JA 3D2EA 3M4XA 3QU4A 2U1AA 1N8RT 3SDEA 2V52B 3J80O 3LP3A 2HLTA 2HAIA 2R8HA 2GOLA 4YFUA 5G4DA 2VCPA 2ZJQL 5CAAA 4KHNA 2QB0A 3MUTP 1X9SA 1U2CA 4J7CA 4H5NA 4O4GB 1ZRNA 4ZPBA 3I5BA 2IJFA 2AGPA 4CO0A 4LJXA 3ENHA 3ONQA 2JX2A 2XI2A 4NB4A 4RUBA 2ASOA 3NFAA 4CYUA 5IT0A 3M1YA 2OMLA 2DGWA 3SMSA 3W61A 2BEFA 3CCUN 1JJ2M 5T7LA 1IVZA 4QS7A 5K9FA 4RQMA 3UKRB 2D3DA 2HFNA 4CH7A 1UVMA 4Z6CA 2CQDA 2JGUA 2FYXA 4CZMA 3BEXA 2IYGA 2CVIA 3CCWA 4F0KA 3I0SB 2EVZA 2HBLA 3K5NA 4QZGA 3GONA 1VI7A 1MMLA 3EM1A 1Y5IB 3EZ5A 3IFRA 2GJFA 1F2HA 1NK6A 4JV2A 1DLOA 3CVKA 4YB6A 3D67A 3RR8A 2FPMA 1NKCA 1ZBLA 4FLUA 1SH3A 3BBBA 3X3UA 3PX4A 3AA9A 1X9MA 1REVA 2ZUAA 3NMUA 2O8DA 1PVQA 1DK2A 1PSDA 3CRXA 4L75A 3RAMA 3B78A 4A2BA 3FSXA 2D4WA 4OHVA 2BKNA 1O51A 4CZKA 5AT1B 1NG9A 1HBUA 4M5JA 5DQHA 1TL1B 1YXQA 2YMPA 4TUSA 1YRXA 3AJDA 3U27A 3KLIA 3OYEA 3VAFA 1AZSB 5DG9A 2JSXA 3TSUA 4DJBA 2WBMA 2FBVA 2NZ4A 4JYAF 4RQ8A 4Z6DA 2H65B 2H5EA 4YQWA 2DL0A 1FTCA 4L76A 1I39A 2C3MA 2DRBA 4C0ZA 2KTQA 1FKPA 5I4MA 3V4IB 2P9NB 2O01C 3BGUA 2KJ9A 4EP4A 3G6XA 2DHAA 1OH7A 1KLMA 1KN5A 4P0PA 1FERA 1BNOA 3PW0A 4AQYJ 1NDLA 4NM1A 1K73T 3O4NA 4HI2A 4RO0A 1TELA 3DOKB 4KHPJ 1C0TB 3PW2A 2EFOA 4NYNA 5BN8A 4FK2A 4CEAA 3TEGA 1VQ9N 4WK3A 4FPBA 5AKEA 5J8YC 2F9DA 5HROA 4RW6B 2N82B 1WWUA 2W2NP 1S0OA 1C1CA 2DY4A 2KB2A 3ZT0A 4C1NI 5J2HA 2ZUBA 3VF0B 4B8CA 2EZXA 2YWFA 3CJ0A 2D0AA 3KDNA 2ZXHA 4TUQA 4DQIA 4RBVA 3TNVA 1FRJA 3MN5A 4Y3CA 1KW4A 1RHKB 1MROA 4CI0B 3W2VB 3ONNA 2MY8A 2V8GA 3EL2A 2OH2A 3BO2A 4NCAA 1XO1A 4CRJA 2KM8C 3J81j 2C2MB 2HRUA 2PYLA 1UAXA 5ALGA 2KO1A 1HR0F 5LMNJ 1EETB 3AVHA 1ZJMA 3BQ2A 3CPWR 3RSEB 4DU1A 3SBTA 4LQ3A 2G1DA 2P51A 1PJ6A 2X51A 4CLUA 1DKGD 2ZQBA 3PYDA 3HHLC 1LXNA 4IRDA 1Q7YO 1VSFA 3LP1A 4GKKJ 2WOMA 4C98A 1F2GA 2LQJA 5DBCA 4M5MA 1U1NA 2IHR1 3H8YA 1HFEL 1RK8A 4CF8A 1LWFA 4ZLLA 2D0BA 4QZCA 4QWBA 1G6BA 4WFNL 2KE7A 1QS4A 2ZHAA 3LL3A 3PKYA 3MM8B 4B08A 2VOPA 4F25A 2E9TA 1TAUA 1UJ5A 2HNZA 6FDRA 3QT8A 3EGNA 3EW9A 2UUTA 8ICJA 3RJJA 3ZDEA 2G08A 1TV6A 3C66A 1A7GE 4KAZA 4JP8A 3MPVA 2EPIA 3G96A 3AQPA 3WX4A 2CPHA 4OI2A 4U7BA 3J7ZT 2XO7A 4LRAA 2H3VA 4GVBA 3IHQB 3FUYA 4IH5A 3FJ2A 1WSIA 2BH1A 3HVRA 4DR4J 4Y2TA 2KHCA 2HVEA 4BE0A 2CJYB 1NZ8A 1A5XA 2BM0A 3MCAB 5KG5A 5A2QY 4CRXA 2NV3A 4ED6A 2ZWOA 2W9BA 2G8KA 4NCBA 4L3NA 1WF0A 2KQ2A 1AYEA 4HUEA 1SXDA 5BRFA 3MM7A 3UD5A 4M2YA 3CC4S 2R3VA 2HS3A 1S5ZA 5KFMA 2L41A 2LFVA 1XBWA 3D9BA 5F41A 2A3VA 2A3ZA 4K4YA 1IXRA 3WK6A 4MO5A 3QMLA 1G3OA 4QWCA 3Q0AA 5KFCA 4LSNA 2KW4A 1SKUB 3VEOA 4L72B 2OYYA 3AO3A 4CE9A 1XMQF 4A8OA 2GUIA 2ZE2B 3RAXA 3O1WA 1S1UA 4E7JA 2GC8A 2FD2A 2C1EB 2Q66A 3I82A 4PHDA 5ALRA 4UOHA 1LK7A 2YHXA 4XIUA 4IFYA 1GMWA 1BWFO 3IV6A 3WT0A 5J2AA 1NBEB 3G6EN 1EARA 2LU2A 3FZKA 2VGNA 1ZBIA 1Z3EB 3OLAA 4FBUA 3QFPA 3TJAA 1QCKA 2AJ0A 2XSJA 1RTDA 3AD8C 3GV7B 1KTVA 4CT8A 1M0SA 4LFBF 3H2UB 5FLXO 2CQ0A 2AX0A 4F5NA 2ZH7A 1RWUA 4LR9A 3QICA 4J8FA 3HHLD 1TV9A 4DI6A 4X4QA 1UJ4A 5KT7A 2QSWA 3DLGA 1RUSA 3QEVA 2LEBA 5AKHA 4FJ9A 2MKYA 3KWIA 2JLEA 2F8LA 1RDCA 1VLOA 2W6KA 4C4TA 3C6TA 1TK8A 1RTHB 3DOLA 2HIQA 2YWHA 1Y9OA 2YY6A 4P7VA 4KGKA 3H7HB 2GAGC 1I3AA 1VSKA 4JK7A 3DRSB 3VWSA 4ANDA 5F8LA 3M6XA 2VWKA 3OSPA 2ZIWA 1WG8A 1NWKA 3TZXA 2CKWA 5ALJA 2IYIA 1HBMB 2AYMA 3RJIA 2HZCA 3P3DA 3CB4A 1QQNA 4FS1A 5DM7Q 2G2YA 3IAS9 3ID6A 1TL3A 3JXOA 4I4BA 1VIOA 4LH4A 4CHOA 4ATNA 3PIPQ 4FN5A 3Q8QB 2O66A 1Q1KA 7ICEA 3ILJA 4CERA 2VG5A 4DPTA 4CM2A 3V6DA 1S1TB 2Y1RI 2KG5A 2BJ3A 2M5YA 1FRMA 2RRNA 4E89A 3N4PA 2Q0ZX 8ICTA 4ED5A 2NXEA 3FSIA 4PHTX 1NB2A 3VQQA 3DRPA 5AI5A 4F4KA 3QGGA 4CO4A 4JI5K 4CP5A 1YJVA 5KT4A 3SPZA 1N6QB 2R9LA 3BP8A 4DG1B 2BPFA 2QWMA 2X1GA 2UXCK 1NGHA 3H08A 4LRDA 2P9KA 3NBPA 3FBBA 4QR0A 2Z0GA 4GY2B 1OQ6A 5AK3A 3CUNA 2CJAA 3QDKA 2DNQA 3H4BA 3UD4P 3C3LA 3WDOA 4OYZA 3AAPA 1SWVA 4C3KA 4H03B 2ZUGA 3MMJA 5A6WA 3GQCA 2EG1A 1BHNA 5B0AA 4FWKA 5AM2A 5HO4A 2ZVSA 4FJHA 5H2FU 4LSLA 1DEJA 5HLFA 2VWBA 4FZMA 2UVUA 3S3NA 3NRZA 1SC4B 3HD1A 9ATCB 3JS6A 4CEBA 4UOGA 3NCRA 5HHHA 1NZPA 3H1QA 2UV8A 4O3QA 3MECB 4QZ8A 4CHPA 5K8OA 4CQ1A 4M3UA 4R5PA 4ACOA 1R3NA 5FIIA 4LRFA 1V3SA 4DX7A 4DV4F 5HP1A 5SUHA 2J0WA 9RUBA 2O5DA 4RPYA 3NH2A 2ZD1A 3K9KA 3JPTA 8ICAA 2RH3A 2IVYA 4BC3A 1XC9A 3FNNA 4ZTJA 1N33K 4BR7A 1EIYB 3JYTA 3P1GA 2OD4A 3V1RA 5HR6A 3CCMS 4MLHA 3MMVA 3O3GA 2RRDA 2XY5A 1SUQB 3IKMA 2B8PA 4I1TA 2BJ8A 3B54A 2LP4A 1TUWA 1RILA 2K4PA 5CABA 4ZS6A 5H9FK 1K9MT 3LDLA 4FLTA 4YFKA 4CNYA 3CNQP 4I2PA 3CE8A 4PYAA 3H3NO 2R7VA 4HI1A 2YV0X 4XRHA 4K5SA 5LJ3Y 5KFAA 5TKWA 3UCGA 1XTZA 1X0PA 5AKJA 4DUZJ 1H6KX 2Z4PA 4DV6F 3OTOK 5KG3A 2BHNA 4Z4HA 5FPNA 3DV9A 1WSGA 3CULA 2RF2A 4CTAA 4JI7K 1S6QA 2E7XA 3VEVA 4YS2A 3W63A 3BYRA 4IEEA 2I5HA 4JI0J 4O5CA 4YUDA 5M1QA 4P2FA 1S4FA 5CYMB 4K4IA 2E5HA 1JCEA 1S9EB 2VBZA 1NJIT 2EQYA 1UPPA 3B8AX 3NF9A 4U7UK 4FF1A 2YJEA 3C29A 1UWBB 1ZA2B 1N61A 1K1SA 3IC1A 1UOCA 2QX0A 4FF2A 4PR6A 5K20B 2YPZA 2GEMA 4KRFA 4KHSA 1XEZA 3DAWA 1U1PA 2KL8A 4USUA 1NKEA 2VFVA 2B9XA 4CCHA 2W03A 5IC4B 3H5UA 3AQFA 3G82B 3ZETB 9ICWA 2DR6A 4FZXC 2W11A 1X7VA 4BGAA 4OX9J 4DUYJ 3V9ZA 5IV3A 2ZUDA 2F5GA 2ZNZA 4TQSA 1VHFA 1BQNA 1KONA 2JH1A 3KWMA 3PSFA 5HVHA 3G0ZA 3H2LA 1N34F 4F72A 2Z2MA 4OJ6A 4K2XA 3N6MA 4HACB 2XMTA 4F4ZA 1YJ7A 1TL4A 5AM3A 2E8MA 4E98A 4QZBA 3AUOA 3FCWA 4OIXA 4JI8K 3EUB2 2VA2A 2MQOA 4DR7F 3CERA 8ICRA 3RB6A 2MLZA 3GFXA 1FFWB 1RQNA 2OTLS 2QA4G 1N5YB 3B6OA 4CIOA 1YIJS 2CNLB 4DR5K 2KU7A 2Y3YA 3KG0A 1RQ0A 4M3RA 2U2FA 2YWEA 4RWXA 2FF3B 2VG6B 1WG4A 4NZ6A 2K1RB 4WYBA 3GSIA 4MYTA 2YMMA 2V50A 3LDAA 3QBCA 4IO1A 3MTJA 4CK3A 4RNHA 4KYZA 3PEJA 4ZHRA 2HMIA 3P49B 3O8MA 2CWXA 1SZPA 3KKFA 3VQBA 3M2VB 5E2QA 1RT6B 1IBCB 4Z0UA 5L8RC 1RWOB 5KFLA 2CQ2A 4XDCA 1UW4A 2DFEA 5EN1A 1R8HA 4M5DB 1B0VA 3HKWA 3R6GB 2UP1A 5AZJA 4X64J 2P2CB 3WXMB 1Z4UA 2APOA 2BPGA 1BWVA 3J7A1 1FWLA 4NLKA 4CH0S 3UVJB 4USKA 1A0OB 4P71A 1KVAA 4RKUC 1U0HB 2MAXA 1JLFA 4NLPA 2W24A 2ZGYA 2PI4A 1ICEB 3L2VA 1NGJA 4PABA 3H98A 1FK9B 3O5BA 3BYPA 3WXLA 2FLOA 2YHAA 1ZQNA 2JFKA 2A1SA 2EI5A 5F0WA 2RQ5A 3Q22A 4B1XB 3EVMA 3IBCB 4O4GA 3N7PD 1CZBA 4B9UA 4CFAA 3EJMA 4K4GA 2DGTA 4CJ4A 5KOXA 8ICKA 1TZ0A 2GZOA 4E7LA 3CTRA 4A48A 2H3FA 3S01A 4DV2K 3P5TL 4NI2B 4ZPCA 4M5KA 4EBCA 1S5JA 4Z7CA 1JLBB 1VR6A 1NJYA 2KZ3A 4R0EA 2ZM6K 2F9WA 1RBOB 3UKRA 2BQRA 5ALYA 4P0QB 4ZLJA 1ZQPA 5GADP 8ICPA 5J2QB 4IL6U 4CJSA 4ISEA 3V9SA 3ETLA 1G4CA 1F60B 3I0SA 3PUFA 1CLFA 3WXIA 1XNSA 4O0JA 4OZ1A 1MA9B 1Y64A 2AGOA 4U95A 2KHDA 2GCFA 5F2RA 1VQLS 3BM7A 3ILOA 1H2UX 4F3QA 2L48A 2QA4N 5AKYA 4IH6A 1WSHA 4X66K 2HS0A 3U3YA 1OMSA 2GWSA 5JVGL 3ENAA 5BR8K 9ICNA 1T9YA 4QWDA 2DD8S 3QATA 4OJRA 3U3GA 3MHYA 3BQ0A 4MH8A 2K2PA 4ILHA 5F3TA 5JUMA 3NOCA 4LZDA 4C3LA 1QZ5A 4J9QA 1T9UA 1TL1A 2RILA 3OYMA 4J90A 5KRSA 3C15B 3UMBA 3QLHB 3DI6B 4IQVA 4RQ5A 3PJXA 4FDFA 4NXMF 4JHDB 4LFAF 1YZ6A 5KG1A 1AZSA 4FM0A 1VHXA 3W8GA 1KQSR 4OZ5A 1LAWA 2MU2A 2MZRA 4GV6A 3OTEA 2VQEK 4RNMA 3CCQN 4W4MA 5J1EB 2BANB 1RDBA 2BJ1A 3HZ6A 1XNRF 2MQLA 5GIPA 3V4IA 2P9NA 2XY7A 1ZOLA 4X65K 1K1QA 3OBWA 5ALWA 3AOBA 3WUHA 5CHCB 1SH2A 4CLSA 1S12A 4I6YA 3UE5A 5DM6L 2VIHA 4F4YA 4YXMA 4KHWA 2ZHBA 3DOKA 1C0TA 2HVHA 1FT8A 2GJ2A 3OHRA 3TAFA 4USVA 4GVLA 4B3RF 5IIJA 4X4UA 1O13A 7ICGA 4FM2A 5AQRA 4RW6A 4WFBL 2B3TB 3UN3A 2YX6A 3R6LB 4NLCA 4BRPA 3AVGA 4UB5A 4KH0B 3WNGA 3NMRA 3GPAA 2I6WA 4RCHA 2K60A 2A18A 1EX8A 3W2VA 1UVIA 2P6RA 2W9MA 3ZI4A 4E1MA 2KT2A 3NNAA 5CHIA 3CJ4A 2P9CA 4OMFG 3ZLJA 4XTTA 4BC7A 1RG6A 1FEHA 1ZZFA 1WTFA 4KRWA 2FIUA 4YHHF 3F2DA 5ALOA 2QO3A 1U1RA 1EETA 3THPA 1PYOB 4OLBA 1VK3A 4XH5A 4HH1A 5AI9A 2UUAK 3I0RB 3RSEA 4F92B 4ANEA 2C2EA 1WLJA 2KHVA 1RAOA 5HL7L 5J2KA 4OYOA 4UUXA 1GAOA 2FJEB 2BKEA 4ILRA 1XERA 4FW2A 3GU3A 4NLQA 4EENA 2KVCA 1Z19A 3N9UC 2IM2A 4FLXA 3T6BA 4CLTA 1D8LA 1YLXA 4NLWA 5KFOA 2BM1A 3P4UB 3K5LA 4QS9A 3MM8A 1P27B 2VL1A 5JICA 3KTQA 3A13A 3GFKB 2PY5A 4CD1A 3M3ZA 2ZH8A 2VJUA 4QWEA 4KGVB 3KD3A 4J9UE 1KFDA 5M1NA 4YORA 2UVVA 3KUGA 4DV0K 2RD5C 2IDEA 5ALQA 3KLHB 1OH8A 4TQRA 3SXLA 1CG2A 2ADCA 2MEWA 2GFFA 5EE9A 1S1WB 1U1KA 4A46A 1TR0A 4F7VA 4G3IA 2VASA 4W5NA 1RT2B 3QRQA 5RUBA 1DTQB 2HSTA 3M8QB 4BG8A 5KFBA 1DGJA 3VALA 3PW5A 2OWOA 3ZTSA 3V5RA 1VQMN 3IUCA 2PO4A 3ZZUA 3QUQA 2G1HA 3OS1A 2RLTA 1CUKA 2CZVC 3ZZTA 1TU0B 3CMEN 4P6QA 1ESVA 4CEZA 4X4NA 3OW2R 4EBEA 2ZE2A 5C7PA 2QXFA 4BRGA 3BS7A 3LP0B 4USWA 3QNMA 2CZ4A 2DNRA 4A8SA 5M1KA 2FC9A 3NDKA 3R5JB 4DV3K 4FF4A 4FM1A 3BS5B 3ZXWA 4UUWA 1YF5L 3QXGA 4DL4A 3HJEA 3VQ6A 5J0WA 4RQ2A 1M5HA 5AQSA 1Q95G 4BRMA 4JK1A 4CBWA 4ZVTB 3O9UA 1HL6A 2DNNA 3BKTA 4FO0A 3VF6A 1RLDA 3ZSRA 5CJ7A 2B6GA 1S7IA 3MMBB 3SQGB 4RTFD 4I69A 1JJ2R 4F9OA 1NXIA 2WBRA 3CFOA 2HSEB 3G8QA 3QX7A 4B9VA 5HJYA 4A5AA 2I2YA 1KEJA 2RJZA 3PHTA 2XYGB 5D78A 4AT1B 1FRIA 1RTHA 3CFPA 2V9KA 4LVSA 4KGMA 2R7YA 1FD2A 3D0GE 1YX2A 3DRSA 4ES1A 5CYJA 5ADZA 4BDYA 1EQ0A 3VA0A 4QIVA 2V8PA 1VDVA 3N97B 2KKVA 1HEKA 5AQLA 3CDEA 4BWMA 1R8AA 3I55N 4QU7A 4GFJA 2HOFA 1ZD5A 1L3SA 4DU7A 2W43A 3RG6A 2AZ3A 2ZWPA 1HBMA 4JI5J 3SIPB 3QGHA 1GMUA 2XMWA 4P4OA 4RU2A 3SQOP 4KREA 2LMRA 2UXCJ 3ZFVA 1RCHA 1R0CB 1URNA 3MDAA 1JNZB 4AILC 1GMWD 3VQ9A 1Y3KA 5IC6B 3OFFA 1J5EK 2EK6A 5T41A 2KD1A 3AO2A 4WFAQ 4M63A 1X4CA 4ZIVA 1KHWA 1PK3A 4TU9A 3LGHA 2L9WA 3VVTA 1S1TA 3CGIA 4KB7A 1WI6A 5ALNA 3HHKA 1JB0C 6AT1B 4MIBA 2JLGA 2KLAA 3PJ9A 2JHEA 3UQ2A 1SJRA 3LDOA 3CMQA 2NRTA 1N6QA 3MZIA 9ICOA 2XS7A 2O8CB 2QTWA 4DG1A 3IMXA 1IWAA 1SIZA 2F4FA 2KRBA 2OM6A 2B4VA 2F77X 1BWEA 2NREA 4ZA1A 4ZN1A 1ZZNA 3UQSA 4BWJA 3THWB 2F8HA 2MGZB 1F6TA 3VA3A 2VPZB 4EELA 4C8KA 1OH5A 4US9A 1U4BA 3CMAN 1ZQVA 5CZXA 2BRLA 1PIEA 1N33J 2PFNA 1ATSA 3AVIA 1KL9A 4HLBA 4WXWA 2P9SB 4C0HA 2ZJRL 2H9ZA 1ZBHA 2CAJA 2ESEA 3F56A 5H9FJ 3CCSN 4KI4A 4QW8A 1J6ZA 4IBNA 1RA7A 1HI0P 2EEYA 4CF2A 3QFHA 3RBDA 4BLGA 4KHPF 4JI2K 3MECA 2HEKA 5BOLA 2FGOA 2ZH1A 5HQ8A 4P4PA 3N4WA 1UPMB 3MN9A 2K4EA 4PKHA 3OTOJ 2GO8A 3Q8YA 1NK7A 4BDZA 4B1UB 2HHVA 1RA6A 1QM9A 2FBXA 2ACMA 1ZBUA 3SQ0A 4DCOB 3HD2A 3M8YA 3SEIA 4JI7J 4NV0A 3H4DA 4ZPWR 3OPXA 4OYPA 1XNQK 4HDGA 3LZJA 2J9EA 2XS5A 2QG9B 1D0EA 1LFPA 1MWZA 4CF9A 4LF9K 3I1YA 4WFXA 5A6PA 2V8DA 4DZ6A 5A8KB 3OUYB 4CLFA 3OYNA 4JD2B 1SUQA 3NAIA 2GBZA 1DGKN 1TUYA 4PJ0U 3SCLE 5C2FA 4KLHA 5LMNF 2ZBQA 2RQ4A 3I96A 2D3OR 4DL7A 1NK9A 2VFRA 1S7HA 4ZJLA 4HR2A 3B6PA 2P9LB 3NCQA 1EP4B 1U2RA 3MGJA 2CVEA 2J0QD 1NPRA 4GKKF 3BH7B 3WC0A 5GAGP 5D0RA 1RAEB 5DZ6A 1C20A 1VDHA 3ZSYA 4RBUA 1Q3VA 1O1WA 3DLBA 1YVFA 3DHXA 1RDAA 9ICRA 2BCVA 4GXJA 3CD0A 4MMOA 4EFAC 5CYMA 2LKYA 4NWIA 1WC1A 1S9EA 3MWBA 1YT3A 3MPYA 3VGLA 2FVRA 3NGZA 3E9OA 1UWBA 1GXUA 2E1MC 2MKIA 2FJDB 4ZVPB 1AT1B 4XPCA 5F8GA 2P9EA 1TUVA 4I6AA 1S99A 2ADBA 2EAMA 1SQFA 4YMMA 5BOMA 2ZH9A 1XSNA 4UY85 5KAIU 3R9LA 5E3RA 4ZITA 1F3VA 5KFPA 1IR0A 4DR5J 1Q86O 9ICAA 3KLVA 4DHVA 3G82A 2OCEA 2XMMA 3ZETA 4RWTA 1KFTA 5B0DA 2ETJA 1T6CA 1U8WA 4O9MA 1J2NA 2F9TA 4I2HA 3AAQA 4DTMA 3FKBA 5AI6A 3OPKA 2GX9A 5J0TA 1HKBA 1VQ5S 5AHXA 1AW0A 3MGIA 1V4TA 2UUCK 1F44A 4HACA 2LMIA 3E8OA 4Y2PA 3KDOA 3V7JA 3MM9B 2OPSB 4GVMA 4RPZA 1ZBSA 2E6MA 1OPIA 2CGLA 4BR2A 4JV1A 4DB3A 1NRKA 2JEFA 1CPZA 4JKAA 1N5YA 3K8VA 3RUBL 4OHXA 1FCAA 2W7PA 2B9EA 3LO3A 3R3LA 4M45A 2VG6A 1I51B 3TAQA 1JJHA 5KFIA 4F5PA 2CPYA 1AUSL 3KNGA 2K1RA 4MLEA 4DTPA 4I2GA 2HFOA 3GV5B 1TYQB 1NMEB 2KG1A 3GJTB 4O3PA 3MCOA 5AE3A 3GJSB 5JTIA 2BJDA 4K4ZA 3D0HE 1JLGB 4E7HA 2ZIVB 1S3XA 3LDSA 1WC6A 2HQGA 1TVAA 4Y65A 2WZ1A 3M2VA 4DFKA 1JQGA 1RT6A 2Q79A 2LYHA 3TAMB 3PMLA 4CJUA 2GGPB 3DXMB 4M5DA 1WOQA 3FCHA 4B1ZA 2K3KA 1BNPA 3HT0A 1JLCB 2GIQA 2VJ4A 4DV2J 3LDPA 3RFAA 4CLWA 1HIYA 3UVJA 5LXYA 3L95X 3AY9A 5KPRA 3OR2B 5GADI 3MI7X 2ZM6J 1U0HA 4QZDA 1QHAA 1MC8A 1TAMA 4MKYA 2K3IA 2FBTA 3FGUA 5EHHA 2BW7A 2NNWA 3HW8A 2YQ0A 5D49A 1FK9A 4GLXA 4CBXA 1G99A 4DSFA 4PPXA 2HBJA 1UP1A 2LCWA 2F8SA 4Y2YA 2RQCA 1MMNA 1PYTA 2YTUA 3BR8A 3NF6A 3VAGA 3GB0A 2QA4S 3Q8SB 4JS4A 4X66J 2C3UA 2WF7A 4WQ5A 4ID5B 4ZVRB 5FJ4A 5BR8J 3PM9A 4ED3A 5LJWA 4F2RA 4NI2A 2G0IA 4YDDB 3RMDA 2M0NA 4CIGA 3RB3A 3WKEA 1S76D 4Z7YA 1JLBA 4M3YA 4WU3A 1JL1A 3HO1A 2BX6A 5CCLA 2LM1A 3MWTA 4P0QA 3MCNA 1OUQA 5J2QA 1TUGB 1HNIB 3QSIA 2IM3A 4CZGA 4RPFA 3K17A 2HBZB 4BVOA 4N5SA 1QAXA 3LGMA 2VQEJ 5C42B 1A76A 2DNGA 1NI3A 2IA0A 3CCQS 2DFFA 3JPRA 3WKDA 3L9ZA 5AR0A 1QQ6A 5M1PA 3FGVA 4X65J 3OHBA 3FMBA 1WAJA 4P73A 3RZAA 4JKHA 1B64A 1YRTA 4KV8B 2OFHX 2PN6A 3DLLQ 2ROPA 4OZJA 4FJXA 3A5LC 4OKKA 2QARB 1HNXK 3QZ8A 1HLUA 2ZJ8A 4B02A 3EZUA 3ENVA 3AJ1A 1CC8A 1CLQA 2E5LJ 3CCJS 4CJTA 4NLXA 4NCGB 3C15A 2DKZA 4MQ3A 3QLHA 4BC2A 5DG7A 3DI6A 1BDGA 1RWMB 4JHDA 2KKZA 3UKUB 3VQPA 4QZIA 2C2OB 8ICBA 5AKZA 7ICQA 1YUWA 1V9OA 5D0EA 1IBLK 2B4JA 3LP2B 4FYVB 1IUJA 4USIA 4O5EA 2KH9A 3UIQA 4H5TA 5J1EA 2BANA 1Y00A 1ZM9A 3AH6A 3N01A 2JVOA 4F4XA 3QBWA 4K25A 3RBZA 1WCLA 1LWXA 4DR2K 2I9SA 2M70A 5FD1A 1SV4A 1NPKA 2NO4A 1JXVA 1SXEA 3E9PA 3F5EA 5HHIA 2W4DA 2ZBIA 4V19S 3SCXA 4DR3F 1V6HA 2YX1A 1XQSC 2XMJA 4CJWA 5HI7A 1HYSB 3CCRS 2UUAJ 3C6UB 3DMJB 1SL1A 3D1HA 1MWQA 2BPCA 2ZGZA 4IG0B 4LFCK 1I1GA 5HMLA 1J27A 2I8EA 4KO0B 1J5OB 1Y5LB 5DDMA 1N0VC 3CIMA 1D9AA 5IT9U 3AOAA 3GTYX 2MA1A 3HLUA 3V4MA 3GZFA 4WU2A 2Y8WA 2FPKA 2I5JB 4IZ9A 3HP6A 2RS2A 1O08A 5J2EA 1BL3A 2O6KA 4H5WA 5HMWA 1XU4A 1H0HB 8RUCA 4HUFA 1XMOK 9ICMA 2UU9K 2LA4A 2IHNA 2HHPA 2L9NA 4IJNA 4UW9A 2GWJA 3VAMA 4ZN3A 2JC0A 3MBYA 3DU6A 2PA8D 3CC7N 1EKSA 1CXQA 3W5ZA 3Q2TC 3NMAA 3I0RA 1VQPS 1ZAWA 4OQJA 3CO0P 3TW0A 1COKA 2J9CA 2COLA 3FE1A 4AL7A 4DV0J 4HDHA 5F0UA 2LKZA 4H5VA 1N52B 2QLFB 3R8YA 2FPHX 4CI6A 3RJFA 3HYFA 3QERA 3F9MA 4GV9A 5BYQA 3DNCA 2E9ZA 1QHTA 1RKIA 4FWLA 5JVHL 4U67Q 3W5XA 4JI6K 2GV1A 4I6WA 3VOVA 5DLGA 4FJLA 2GELA 3U9ZA 1VQMS 2EC2A 4KSEB 4PZNA 4WXOA 2DWQA 2OHDA 2V63A 4QS8A 1S79A 2HOIA 4KX3A 1DJ0A 3MGHA 2ROGA 2QL9B 4OX9F 1KD1T 1Q78A 5IIIA 4JKBA 3D2NA 9ICCA 5AI0A 4BRKA 4FJNA 5BPCA 4JKGB 4UAZA 3KLHA 4DV3J 8ICXA 1WUDA 4ES3A 1ZH5A 4RUCA 1PBAA 1H7XA 3NRBA 3NF7A 1S1WA 5L46A 1VC6A 1HKCA 4DQRA 2G4BA 5ALIA 4DV5K 1M5VC 2LYVA 5B09A 1RT2A 1DTQA 3M8QA 2Q3SA 5DZ7A 3OBYA 4F3TA 2FMSA 1EJ7L 1U1MA 5HAOA 1JROA 2BE2B 4ZLPA 2FMPA 3OYLA 2VBYA 2Z56B 3LP0A 4LF8K 1IBKK 4KKOB 2MDAA 3FZMA 4O0IA 3A3NB 1KBRA 2VFSA 5HMYA 3QE9Y 5LSOA 4NM2A 3BS5A 3GIRA 4UW2A 1RAFB 3I6PA 3NXZA 1VQSA 4UB3A 2OLWA 1EKRA 5L1MA 5D4BA 5J0QA 2XC9A 2EWHA 2G8IA 1KXPA 1VSHA 3W9JA 1T9TA 3CCLN 4K0KK 3OYFA 1H2VZ 2P66A 2J8SA 4X64F 1QSYA 1Q82T 1RWKB 3MMBA 5ALXA 3SQGA 2OTJS 2P8IA 3M7DA 1NM1A 2KICA 2BMBA 2VV5A 2Z2LA 3UDCA 3I55S 3EUNA 4M6WB 2C2KB 3QRRA 1V85A 3PSTA 2FJXA 1B22A 2YWGA 2OSQA 4JV5F 3O6QA 4PGQA 2XYPB 2DNYA 2J7WA 3EE9A 2EX3A 1FRLA 3R7SB 3I56S 2M0GB 4NXNK 1H72C 2V2VA 2J7UA 3IAYA 1J5EJ 2LQ9A 3D54A 4RWWA 1T3VA 4URGA 2M9KA 3C23A 1WG5A 3MEEB 1SWWA 4URQU 4R65A 5ALVA 1PGZA 3GOIA 2XHBA 1S1VB 2N3OA 3MEDA 4MEYA 4OYMA 4EHUA 1UVJA 9ICEA 5F8IA 4F0MA 2QWOA 3HVTB 3K1ZA 3HXMA 2JEGA 3BSAA 4K50A 2ASPA 3LOUA 2H5IB 5DG8A 7ICUA 1DQAA 3FZLA 4AUKA 5I42B 3TTFA 1L7PA 2QT7A 2HHHK 3L2UA 3DGVA 4UB1A 1Q16B 5B0EA 1XI1A 1D8ZA 3HWTA 9ICQA 1IO2A 4PEOA 4DR1K 5GVQA 2HIYA 4TN2A 4QZFA 1RAGB 3IM1A 3IG8A 2VJVA 2OEJA 5FROA 3ZSQA 4ED0A 4HTJA 2VKRA 2HBKA 1T9WA 3OYKA 3NGUA 4N8OA 1IBMK 2OEHA 1E3MA 4K4TA 5M1OA 3T5HA 3KVGA 2E5JA 4A4JA 3CCEN 5L9XA 2HB5A 2WRMA 5J0SA 4C3MA 3U02A 3CCSS 4ISGA 3BF1A 4JI2J 2X1BA 2O8CA 4YG2A 4ZDNA 2J76E 4KLOA 3TO8A 3Q24A 2MZTA 2Q1LA 1U02A 3THWA 2F76X 1EAYC 1NEEA 2MGZA 1GLJO 3UI3A 1RBTA 4MFAA 2JR5A 8ICGA 1T94A 3ULEB 1WI8A 4LSZB 1RB0A 2QWQA 1XNQJ 3M9NB 2D1KA 2LXUA 4TLRA 1UKUA 2OPRB 5HN0A 4LF9J 3CCVN 4NASA 2IOFA 3EVWA 1OY8A 3VAJA 4DF8A 2P9SA 3ATVA 3ZSOA 1BPZA 1LKYB 3R9KA 1ILYA 5GAEP 4I27A 4EU0A 3Q8MA 2MTLA 4O55A 5AIBA 3BN4A 3MMAB 3TAGA 3ETOA 3IP0A 4BGDA 2MKCA 1W25A 1N88A 2UV8G 4MN4C 1F0MA 1NGIA 1SQKA 1H7WA 1WUAA 4FWOA 1RU2A 2A1RA 3JSYA 3CQ8A 3VQSA 3TTDA 4IC9A 3M6GA 2XHCA 4NEYA 3D4JA 5LL6d 8ICUA 1RWNB 2CRXA 3EGWB 4A8WA 3R7BB 5AFUA 1RZMA 2NXUA 4CEEA 3K89A 1MWYA 3P31A 3OUYA 5A8KA 3D66A 2E2NA 4JD2A 2H3ZA 1KWMA 1LNQA 3D45A 4FWSA 2I0XA 4YR0A 2V94A 3MFIA 3VAIA 2LQBA 3PNCA 1KFSA 1N56A 4NLYA 3MCPA 4DMZA 3BDEA 4H0YB 5C24B 4BRLA 4I9QA 2P9LA 2EFPA 4DO9A 2YX4A 2HNDB 1EP4A 2Q4TA 1U1OA 3UN5A 2I1QA 2AF6A 3DYAB 3QAUA 1X9JA 3EICA 3ENQA 3SUOA 2WFBA 3QEIA 1N5QA 4UB8U 1FW6A 4IYQA 3OYJA 3OVAA 5BREA 3DXBA 1PZNA 4RNFA 4XEIA 1JI7A 2NQPA 4LF2A 2ZOGA 4ETXA 1N48A 3BF4A 3AHPA 1Q46A 4KN7A 2HAFA 2UUCJ 4QU6A 1R59O 4KAIA 4H0XB 4N56A 5BJRA 1NGEA 5DB8A 4LMZA 4CGZA 2F8MA 3MUMP 1RYSA 2EFNA 4CH1A 4ISFA 2WFAA 3W3SA 2XMUA 5KFTA 2OUGA 2MKKA 4A47A 2D5RA 4FVCA 2R7WA 1Q18A 2V6AA 2YPYA 3CD6N 5BPLA 4BRIA 3TRGA 5L1IA 2DYAA 3D5MA 1KNZA 1YJWN 3WK5A 2E1ZA 4EZ9A 2Z1HA 2EDUA 3LUYA 2NRZA 9ICXA 1PJ7A 1YJRA 1AB8A 4NMXA 1HUXA 4ILJA 4KI6A 3EDQB 1Y5NB 1VQNN 3IBPA 3PZPA 1Y88A 4CJ7A 4C0OC 2FDRA 2QZ8A 2O8BB 1A77A 3G71S 2G2ZA 2MPUA 3B4MA 2R7QA 3MM9A 2IS3A 1BOTO 2OPSA 3RJKA 2AV5A 3EEQA 4A57A 2ZZTA 3SMPA 3CCZA 3W7BA 3QUCA 3TARA 4ALZA 4EAHD 3A1YG 3F44A 1AQ6A 3WZ0A 1ZQUA 3R3TA 3VQEA 4FJJA 4RU9A 7AT1B 2JOQA 1ZQCA 2XBPA 1NDCA 1ZQXA 4EYHB 1SKRA 2J5AA 3IXQA 4CEQA 1LEOA 1N32K 3SNNA 1IG9A 2Q1NA 3CIPA 1TYQA 5A8RB 5J8YA 2WSCC 2XRIA 3N7SC 4GC7A 7ICLA 1B92A 1HR0K 4FZVA 1YZ7A 4F67A 3E01B 5KQDA 2J6UA 1JLGA 4PG5A 3LPUA 2ZVIA 4W5TA 2V8VA 3NAEA 1BE4A 1MWMA 2ZIVA 3BQ7A 3M8SA 3NS7B 1M90O 3AEVA 3H20A 4FNHA 1CQMA 5CA7A 3TAMA 2GGPA 3DXMA 3PX6A 3VQAA 3RBXA 2CNKB 1JLCA 1RJJA 3E58A 4I68A 2VDHA 3P5BP 2NRHA 4PG4A 3GG4A 1UEVA 2CQPA 3QIOA 3CXCM 3QU7A 1CZAN 3OR2A 1WG1A 3F5TA 1BQXA 1NSKL 1QSSA 9ICKA 2DHGA 2OEMA 3M2UB 4FBTA 1ZTTA 2PI5A 4KLEA 4TU8A 3FAHA 1NNDA 1ZQ1C 3GYGA 3Q89A 1GOAA 4F4WA 4Y2RA 1D9FA 3BDPA 1F5CA 3FZ2A 1RTJB 3QSYB 2ILYA 1ECWA 4UBBA 5F0XA 2DR8A 1FO1A 3LZIA 4ID5A 2ASJA 4NYFA 3GR1A 4WP8A 3M6ZA 1RBVA 4USMA 5J2NB 4RQNA 4PAAA 1CS4B 1IM4A 2X6SA 4J2EA 4CO2A 3MXHP 1WF2A 4LF6F 4PHEA 1HNXJ 2M3DA 3HDSA 4CHNA 3ZT2A 3ZD8A 2ALZA 4USHA 2ZEJA 1OXJA 2XIDA 2IVNA 3NAHA 3NY0A 3O3HA 2QIFA 4DL2A 3N4QA 5CY4A 1PK1B 3OYHA 1HNIA 3RVCA 5H9EK 2IVOA 5G5HA 4P2XA 1S6OA 3KLGB 1IBLJ 4DPWA 1AFIA 4CGHA 2W41A 1XMQK 5C15A 2DKOB 2R2SA 4DQPA 5C42A 4K4UA 1IQZA 3OJSA 3KHRA 2GVZB 1DQ8A 2QMWA 2W3RA 1KKHA 3DDNA 4KE5A 3OHAA 5IINA 1P90A 4DSEA 4J9KA 3UMCA 3TWZA 5F9NA 1X9XA 4KV8A 4DU8A 3GFYA 4DR2J 1X4HA 5L39A 4RL1A 3CM5A 5A2QO 1T11A 5M2PA 2A40A 2QARA 4KLIA 5AK4A 2FGCA 3MM5B 1KN6A 4FOEA 1TMJA 2PFFB 2DGZA 1ZETA 2CGJA 2HPUA 3HSDA 4OI3A 4NCGA 3QUBA 3I5AA 1QQOA 2N7YA 3NVWA 3AB4B 4OL8A 1COOA 3UKUA 4DSKA 4LF4K 5C2CA 4RBTA 2D3UA 4LFCJ 4LFBK 4M9GA 3HSJA 3HFKA 1Q81T 3LP2A 4DCJB 1N33F 4YD2A 2E66A 1LB2B 4ELVA 4R79A 4Y2VA 2JDJA 3A8YA 1NH7A 1LCUA 4Y2QA 3EPGA 2YY3A 3FRZA 1XMOJ 2UU9J 1YHQN 4DCHA 4BRQA 3FEXB 4Y2MA 4AM6A 2KYZA 3L3FX 2YHWA 1H74A 1VQ4N 2ZG6A 2WAQD 3ASMA 2X1AA 3HPGA 3OTOF 1HYSA 2Q6BA 3C6UA 3DMJA 3MC1A 1BISA 2B6AB 3LA0A 1GLEG 4BUGA 3KOAA 1LAVA 1N60A 2N4CA 4JI7F 4IG0A