1L3UA

Crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3'
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3uA01
1ZQKA 2VANA 4DOBA 3SI8A 3GIJA 1NK7A 2OPQA 4FVMA 2G8VA 3H7IA 4CK2A 3AA3A 5K14A 3K5MA 7ICEA 4E7JA 3LP2A 3ZSWA 2C22A 2OWOA 1T03A 5EOZA 4RUAA 1COOA 9ICIA 1KVAA 3ZT2A 4OKKA 4DOCA 5IIJA 4M3TA 9ICAA 3KIOA 2GUIA 3NF7A 4ELVA 1BGXT 2PI5A 4CIEA 1IKYA 3L2VA 2NRTA 4K8XA 4FLUA 1L3TA 3Q8QB 1BVSA 3LANA 1BPBA 1XS9D 4AILC 2BPCA 1Q9YA 3PNCA 2RN2A 1ZQTA 1VSLA 3MEDA 3ZSQA 4BDZA 4HUFA 3JPNA 3OYCA 3GIKA 4F91B 2HHVA 2W8KA 1RZTA 3SQ2A 4PHPA 4DU1A 1RXVA 8ICTA 4CHQA 2R7YA 2ZUBA 4ECRA 1IKVA 2HB5A 5KFVA 2P5GA 3K5LA 3MR5A 4DL2A 4KHWA 5DQIA 5C5JA 4C8KA 4CEDA 4KV8A 3M9MB 3OYKA 2ISPA 9ICQA 3G6YA 4IRKA 3IAYA 3MR6A 1SZPA 1D8LA 3RJEA 3BDPA 4E1NA 4RT3A 4O5CA 5L9XA 1UWBA 2B4JA 3VQDA 3IM1A 3NAEA 4TURA 3V1OA 4CHOA 1T3NA 2G8FA 5J29A 3KHHA 7ICNA 5J2FA 3S3NA 3NF6A 3HWTA 4X5VA 4EBCA 4BGDA 2BKEA 3OS1A 5J2JA 1BCOA 5J2HA 2AQ4A 4KTZA 4LZGA 2BCUA 2FBYA 4DTJA 1C1AA 4ID1A 2JEFA 4DTNA 3C23A 4YCXA 3AU6A 2VG7A 1QTMA 3L3UA 3B6PA 3TFRA 4R66A 1JLFA 7ICKA 3K75D 4EZ6A 3FYHA 2BE2A 2X6NA 9ICUA 3SZ2A 4K4IA 3B0XA 2YNHA 3HYFA 1VK0A 1R0AA 4MQ3A 4FJGA 1ZQUA 4DTUA 3V81A 1ZQMA 2G8KA 3RH6A 4EP5A 4CIGA 1X9MA 5KFFA 4CF0A 3H8SA 2KFZA 1B92A 4PA1A 4PQUA 2AJQA 1ZQQA 3QO9A 5J0WA 3KK1A 2V9WA 2PFOA 4CJFA 4PH5A 2ASJA 4FJMA 1B9DA 5L1KA 1UOCA 3AVAA 3L8BA 2D5RA 2WOMA 4DTRA 9ICNA 3ISBA 2O4GA 4I2QA 1J54A 1JLCA 3KK2A 4M3XA 1JIHA 3U6FA 5CHGA 4FCYA 4AHSA 1KSPA 3Q8RB 2W9BB 3ISDA 4FJIA 3TQ1A 1X1PA 2J6TA 3QERA 4ZTFA 3CFOA 1L5UA 2BCRA 4FLXA 3AVKA 3KLHA 4PHDA 4ECYA 7ICIA 4AHCA 4NM1A 5DQHA 4DU4A 1JXLA 4HTUA 3OHBA 3SQ4A 3O3FA 4M9JA 3SUOA 4J9SA 4KLFA 2YNGA 2ITGA 3AVMA 4O44A 1NOZA 5DG9A 1IKWA 5KT4A 4DTSA 1HNVA 3V9WA 1XWLA 1TVAA 4KITB 1LWEA 9ICSA 1Z00B 2WTFA 3ZDBA 4Q45A 3DI6A 2G8UA 4DSEA 1XHXA 4MF8A 3RWUA 1S97A 9ICOA 3UIQA 4F2RA 2KW4A 3HPOA 4ECZA 4Q43A 3QLHA 4CFAA 2W9BA 4QW9A 3GDXA 1RBTA 9ICXA 4IG0A 3ISNC 4IFVA 1DOQA 1QQCA 5DB9A 7ICSA 4F5PA 3RR8A 2P51A 4JLHA 4DQRA 3KD5E 2R8HA 3KHGA 4DG1A 3DOLA 4F4ZA 4BDYA 5I3UA 4XUSA 4FO6A 3OYIA 4RQ1A 2PXIA 8ICYA 9ICFA 3OYGA 3ZSZA 3NGYA 1RTHA 8ICFA 2R8KA 4IR1A 1ZQYA 3MEGA 4O5KA 2BQ3A 5KFDA 4NYNA 2KZ3A 3KLEA 2IGIA 4BE1A 3RMAA 5DBBA 4FJ9A 1JL1A 1NK6A 4RQ6A 5KFOA 1D9DA 4O5BA 3UXOA 5KRTA 3H8JA 1QSLA 3S3OA 4HYKA 4RQ0A 3TWHA 2ZE2A 1ZQDA 4F92B 1RBRA 4Z4GA 4O9MA 4CEAA 4CJSA 4B8CA 1JX4A 1UA0A 4K4HA 9ICVA 1C0MA 4DQPA 4J9OA 1Y97A 4DSIA 3GFKB 5L1JA 3QINA 4NCBA 2FC0A 2VWKA 4DO9A 1A77A 2HHXA 4R8UA 4ED0A 3SYZA 4F4YA 3MAQA 3IG1A 3PW5A 4CHZA 4M6WA 4CECA 3NGZA 3DRSA 4Z6DA 3AVCA 4O0JA 4KMUA 4DFPA 3QEIA 4I7FA 4ECWA 3TAEA 3PO4A 3QESA 1RDCA 1NJXA 2ASDA 4IQTA 5KFCA 3MABA 1BQNA 3I8DA 2QKKA 2GWSA 8ICJA 3C94A 4DQIA 4QZ9A 2XO7A 3D0PA 1HMVA 3V7KA 3S9HA 1Q9XA 4FZYA 5BOLA 4CJRA 4GC6A 1S5JA 2FPLA 5J2NA 2BANA 5C25A 1NKCA 3OYEA 1YTUA 3QNOA 1S0NA 1HJRA 1ZQBA 1J9AA 2F1IA 3AVLA 2ZJ8A 3C5GA 3I0RA 4ECSA 4KLTA 2XY6A 4ZTJA 4FS2A 4J2BA 2NRVA 1LWCA 3ZT0A 1TL3A 8ICWA 4Y1CA 2M9NA 1KFSA 1IKXA 2BQRA 4YR0A 1TFRA 2AU0A 3BQTA 5J2CA 1KDHA 5JUMA 3AV9A 1Y88A 3RAXA 1HYZA 4E1MA 1BPDA 3O3HA 4GW6A 4W5NA 9ICBA 3M8SA 4QWCA 1TK8A 3GIMA 3MGHA 5J2MA 5HLFA 4RQ8A 4QW8A 3NTUA 4Q8EA 1QE1A 2WONA 3DRRA 1T8EA 3AA4A 2UVWA 4HVJA 9ICCA 1NJYA 3PUFA 2VG6A 1YTAA 5KTQA 1NK9A 3MFIA 2V4RA 3ZD9A 2XCPA 7ICTA 3TAMA 3NH2A 4CF1A 2KN7A 3QE9Y 4DTXA 1ZQSA 3HP9A 4FM0A 3Q8MA 4FLYA 3SUQA 8ICPA 5D3GA 4B9MA 2X6SA 3VA0A 3KLGA 4W5TA 3SNNA 2O4IA 1X2IA 4CJQA 4DLGA 3SUNA 2A1JA 8ICLA 4QCLA 3NHGA 1ZBLA 4QZCA 5J0YA 2X74A 2XGPA 4F2SA 1RT1A 4B8AB 2IC3A 3THVA 1NJZA 4C8NA 1SL1A 4DF8A 4FBTA 3MEEA 4FJLA 3PVXA 4FJ7A 4YD2A 4PGXA 4Y1DA 5CJ7A 3L2RA 4YN4A 4CJ3A 4MFAA 1B22A 2HHTA 5CYQA 4EBDA 2F8TA 1B43A 2KTQA 1BIZA 3RJHA 3CG7A 3RRHA 3G10A 3K2PA 5KT7A 3ZSRA 2DFFA 5KI6A 3DLGA 4MFFA 4M3RA 4Z6FA 1O1WA 5CA7A 1ZQEA 3HJFA 3C1ZA 2P1JA 2DTUA 3SQ0A 2OYQA 1TV9A 3ZDCA 5J0UA 4JS4A 3N97B 4YD1A 2F8SA 4O3NA 4H8KA 3T3FA 4DSFA 4OGCA 2I5JA 1KVCA 5J2DA 2YNFA 3LP3A 4J9NA 1HYSA 1TAQA 1NOYA 4GLXA 1IM4A 3DMJA 5IIOA 3RB0A 4RUCA 3NH0A 3T5LA 2HHSA 1D8YA 4MEYA 3SPZA 4O3OA 4FS1A 2BCSA 5J0PA 3JPTA 4UB2A 1XU4A 4DSLA 2ISOA 3PW4A 2ATLA 5IIIA 2FMSA 3SJJA 8ICMA 5FROA 4KI4A 3HP6A 2RDJA 1HUZA 4O3PA 4AHRA 2V4QA 1TVRA 1S10A 3Q8SB 4FW2A 3V1RA 2R8GA 3U3YA 3AO1A 3UQ2A 3Q8LA 3DLKA 5J2IA 4YFKA 5J2GA 3K5OA 3RTVA 3GQCA 1WN7A 4B9TA 5DGAA 1ASUA 3Q8PB 3AVBA 1RT3A 1HYVA 4R64A 3GIIA 4KTWA 3SCXA 4LD0A 3OYLA 4BWJA 2BQUA 1WAJA 1T7PA 1K1SA 2R8IA 4QZEA 2BGWA 2PYLA 1GOBA 1TV6A 3EW9A 3G6XA 4IBNA 4QWAA 3TANA 3MXIA 2G8WA 3V9UA 2KQ2A 2PFQA 4CF8A 5T7BA 1MQ2A 2I9GA 3ZDDA 1JL2A 2EHGA 4NLKA 3OVNA 3AVNA 4KLEA 1ZQCA 2OA8A 3NF9A 2JGUA 1NK8A 4I9QA 1NK5A 3DLBA 2Y1IA 4KAZA 5EWFA 1NKEA 3UQ0A 2XY7A 4J9MA 8ICHA 3AVJA 4Z0UA 3AA2A 2IMWP 1NOMA 3KKRA 4LVSA 2VA8A 2PI4A 2H5XA 7ICGA 1S9EA 4EBEA 4IKFA 4EEYA 9ICJA 4RPZA 2OPSA 1WCLA 3H08A 1WSHA 4CJ4A 2A1RA 2JZBA 2W9CA 1TKTA 2W42A 1SV5A 2PFNA 2D0BA 2QK9A 5KRSA 4M45A 4PHAA 3DLEA 1FKPA 4ELUA 4IQWA 4RNNA 4I9LA 3Q8KA 3PX0A 3CM5A 1BISA 2HVHA 1S6QA 3ZSOA 4F8RA 1WSEA 3CFRA 4DQSA 3WNGA 2P66A 3ZDAA 1ZQVA 4BXOA 1X9SA 4DS4A 3FFIA 3KD1E 2HHQA 4J2EA 2HHUA 2PY5A 3GV5B 2ZD1A 2YHAA 7ICRA 4ED1A 4RW4A 4J9QA 1Z00A 2JEIA 2FBXA 4OPKA 1ZQFA 3LDSA 3NBPA 4G1QA 3H4DA 1RXWA 4NLNA 1RYRA 1A76A 4W5QA 3V4IA 8ICNA 4CE9A 2VWJA 3PW2A 3IS9A 1BL3A 4CF2A 4EZ9A 1XSLA 4FK4A 1FXXA 3RB3A 1H38A 4QZGA 4CEQA 4UBBA 4TQRA 4ED7A 3KHRA 4KHYA 3ZT4A 4PPXA 4ZHRA 3AU2A 4KI6A 2BHNA 5D46A 4I2CA 4F93B 4DS5A 3GV7B 1X9WA 2BCQA 4FJNA 2NRXA 2IBKA 2NUBA 2MUTB 5BPCA 4R63A 8ICEA 2ATQA 5IILA 2BPGA 2UVVA 4Q0BA 3HL8A 1BPZA 4XIUA 1KVBA 4RQ3A 1CZ9A 4E7LA 1C1BA 4BWMA 3F9KA 3DM2A 4K8ZA 8ICCA 3V9SA 4ECTA 5KGWA 1Z3EB 4I2FA 2C2RA 1EP4A 3MXJA 2VA3A 2B6AA 4YXMA 4CGGA 4HUGA 5DG7A 3V7JA 1ZQJA 4B9VA 4GC7A 4IRDA 1DTQA 2R8JA 3C2LA 1S9FA 1C7YA 1D5AA 5E41A 1SKWA 2XRIA 2RF2A 1MU2A 4FK2A 4DSKA 2DFLA 4ED8A 1ZQNA 3TARA 4F5OA 1HRHA 4YMNA 9ICHA 4M3YA 1VSMA 5IIKA 3SPYA 1SKRA 4QWBA 3TI0A 3NFAA 9ICEA 3DLRA 3QZ7A 4CJPA 5HHIA 5HRSA 2X78A 4E7KA 1TK5A 3AUOA 4J2DA 5J2BA 1JKHA 5DLGA 3VQCA 1YT3A 2FLNA 1S76D 1RCHA 4CF9A 2AGOA 4MEXA 3ZSVA 3A2FA 3H40A 4O3RA 3KJVA 3KHLA 2FMPA 3EYZA 3DLHA 4FK0A 5KG0A 3TABA 1ZQHA 1GOAA 5KGXA 1KFTA 3HXMA 1DGSA 4UQGA 1HQUA 4H4MA 1ZQIA 5KT2A 5HRPA 1ZBFA 3LAKA 2QKBA 2YNIA 3PO5A 3L3VA 4NXZA 5HMMA 2GV9A 3RB4A 4N5SA 5KFAA 3SV3A 4CK3A 1RDBA 3RAQA 3OSPA 2W9AA 2KZMA 1JXBA 3BQ0A 2BCVA 2E6LA 4O4GA 4XQ8A 2JLEA 4CEBA 1SUQA 2HNDA 3RJFA 4F4XA 1Z26A 4UAZA 4FJ5A 5F9NA 1LW0A 3EPGA 4OKJA 1U04A 4JS5A 1LB2B 4MFCA 2ASLA 2XHBA 3HPHA 4O3SA 1L3UA 5JS2A 4FYDA 2NRWA 5KFJA 1J53A 4M42A 1A5WA 1JLQA 4N47A 3LALA 1VSEA 1U48A 3LWMA 3M9NB 1RT6A 1JLBA 4KREA 3QEWA 2RKIA 1EKEA 3OJUA 1EX4A 5EU7A 4IG3A 3ZT3A 4WE1A 1K1QA 2P6RA 4XA5A 5KFPA 1UT8A 3TR8A 2G8HA 3ZT1A 3F73A 1S1XA 4CJEA 2F1HA 1FK9A 3HT3A 3OYFA 9ICTA 1NK0A 2JEGA 3AO5A 2IAJA 9ICLA 4I29A 3PR4A 3QIOA 3EPIA 3VQPA 3ORYA 1YVUA 4Z4IA 1LAVA 1SL2A 2P6UA 4GXIA 2HW3A 5J0SA 3VQBA 7ICHA 4I2HA 3AO4A 4NM2A 5DBCA 5D49A 1XSNA 5CZ2A 3ULDA 1BCMA 3HK2A 3K5NA 3NGDA 4O0IA 4AHUA 4DL6A 4KLMA 5CR0A 4RNOA 4BE2A 1BI4A 3EY1A 3SV4A 2UVRA 2BPFA 2HNZA 4CESA 3KK3A 4F5RA 3HSTB 4CJUA 4RW8A 3MGIA 4KLJA 5KT3A 8ICKA 1D9FA 1RPLA 1BQMA 4FLZA 3EZ5A 1ITGA 1LWFA 4DWIA 3MECA 4O3QA 1ASVA 2D0AA 2I1QA 7ICMA 5C42A 5SZTA 5J2PA 1CXUA 5FDLA 8ICBA 4CERA 3SI6A 3D45A 1RTJA 3LP0A 5KFEA 4PY5A 2XY5A 3OS2A 3OS0A 4H4OA 4DMNA 4DEZA 4Z4CA 2MAXA 1XC9A 2ETJA 4YQWA 4I2IA 3H8WA 4KRFA 1S9GA 2IS3A 5KG3A 3PW0A 4CGFA 3HVRA 3G6VA 5KT6A 1FKOA 2KZZA 1IO2A 1RBSA 4IQUA 4YP3A 2Z1GA 2GBZA 1TGOA 4QZ8A 4CHYA 5L1LA 3QEBZ 4TUPA 4KN4A 3ITHA 1UA1A 1IH7A 2IHNA 3V6DA 3B6OA 3JPRA 4C8MA 3MXMA 1DLOA 3RJIA 4ED3A 3TFSA 1RBUA 1LW2A 3DYAA 1CZBA 2HHWA 3OYAA 4EYIB 7ICUA 1C1CA 4B9NA 4CGJA 1QS4A 1JMSA 4KTQA 3M9OB 5HBMA 1CXQA 3OYJA 5DLFA 5DBAA 3C5FA 4QAGA 2J6SA 1LV5A 3ZSYA 3CQ8A 5J0XA 1S1TA 4J9PA 4YR3A 4JV1A 2MUTA 4DFMA 4B9UA 4KLSA 5J0TA 3O4NA 7ICLA 2AGQA 4CFCA 4KLQA 3VA3A 3OHAA 1S0MA 1TAUA 1RDDA 4OVLA 4M9LA 4P2HA 4YXJA 1VRUA 3O4QA 1ZJMA 4KLHA 5J0RA 5HHHA 1NKBA 3MFHA 5KFWA 2BR0A 4GVMA 3LPUA 3NF8A 5J2QA 5CP2A 3OGUA 1JLEA 3C2KA 5D4BA 1VRTA 4OPJA 1ZYQA 4ECUA 4R8UB 5DDYA 3VQEA 3E2EA 1S6PA 4AHVA 4PHEA 2A1JB 3C1YA 3QZ8A 5J2AA 4OLAA 2OZMA 1VSJA 5CWRA 3TAGA 4QWEA 4F3TA 3OYDA 4YMOA 1QLNA 4DTMA 1KEJA 5KT5A 4HCBA 4E89A 5KFTA 2YKNA 4TUSA 1WSIA 2XY8A 8ICOA 4CGIA 4PGYA 3ISCA 5J2KA 4IR9A 4RQ4A 4I2AA 2YKMA 1KTQA 3ASMA 3VQ9A 2DPJA 9ICWA 2C28A 1LAWA 5HRNA 5KFNA 4ID5A 1RT5A 4ICLA 4KLDA 4DTPA 3GILA 4E19A 4I2DA 2IOCA 3RR7A 3M8PA 3DOKA 3UXNA 5HRRA 3AO2A 4AH9A 4JWNA 5KG6A 2ZTEA 4CIFA 4DSJA 3CFPA 3V6KA 2DFHA 2W8LA 2B21A 2DPIA 4DL4A 3AO3A 5KG4A 3JYTA 4YNQA 4JWMA 2ZQBA 3LZJA 4CJKA 4IDKA 2YHBA 4RZRA 3SUPA 4E7HA 5DK5A 2ZTCA 1C6VA 4FLVA 4UB1A 1N56A 1S0VA 3JPPA 4ECXA 1BPEA 5KFIA 3C95A 3JPQA 4JV2A 3NCIA 3T5JA 4F5NA 4M3UA 3MDAA 2J6UA 4QWDA 3V72A 4QZBA 4HUEA 5KFMA 4Z4FA 3PV8A 4BACA 1TKXA 1Z25A 3BQ2A 4B3OA 4W5OA 3NDKA 4C8OA 3V6HA 4NYFA 2IA6A 5I42A 3PX4A 1ZBUA 1XHZA 5F9LA 4IQVA 3B0YA 2OZSA 3QIPA 1KLMA 4C8LA 2DFEA 2XGQA 4DFKA 1WSFA 3RJJA 1ZQLA 3ALYA 4HHTA 4M04A 1RILA 4RW6A 4EP4A 4FJJA 2QXFA 4N41A 4M2YA 3MBYA 1RDAA 5KFBA 5KG1A 2NRZA 3PR5B 3HW8A 4M3WA 9ICPA 4FJKA 1PZNA 4CFBA 1QSSA 5CY4A 4Q5VA 4JRPA 4KLLA 3BJYA 3V1QA 4QZDA 4F50A 5DB8A 4CJLA 4RU9A 1S1WA 4FZXC 4M6WB 3C6TA 4CHPA 4DL5A 1G15A 1A5XA 8ICRA 4F3OA 2BDPA 1N6QA 4Q8FA 4IFYA 3ZDEA 2VG5A 1JN3A 1V9PA 4RT2A 9ICMA 4KB1A 1NK4A 2ZJAA 1ZQGA 3HO1A 4F4KA 1RNHA 2FMQA 1NJWA 1XI1A 5SWMA 4FXDA 1CLQA 4FJXA 3PX6A 4ED2A 5C24A 3ZSXA 4B9LA 3G0ZA 4DL3A 4PWDA 4FLTA 3RMBA 7ICJA 4B08A 3UXPA 3LDAA 4DU3A 3AA5X 5J1EA 2RPIA 1UT5A 4CEFA 3V6JA 3OY9A 2F96A 2EX3A 3LPTA 2P5OA 3FDSA 3I0SA 4J9LA 1ASWA 3RBEA 2JZBB 2FPMA 5DB6A 1T4GA 1XO1A 4AHTA 2G8IA 5DB7A 2Q3SA 4KPYA 1S0OA 3S3MA 5KFLA 1ZBHA 3AVGA 1W0HA 4QZAA 2KFNA 4LY7A 3K58A 4I28A 1CEZA 3RH4A 4FBUA 4NLZA 4CGHA 3NH1A 5KFZA 4R65A 4JK1A 4OKEA 5HP1A 2B5JA 4IRCA 1AROP 5FRMA 4BDPA 1VSHA 1IXRA 3M8RA 1N5YA 3HVTA 1TKZA 2DY4A 5HROA 4CCHA 3LK9A 4P4OA 4R5PA 2XC9A 5BOMA 3PMNA 1HQEA 5DMRA 1U45A 2Z1HA 1ZBIA 1JLAA 4K4GA 3L2QA 4LSNA 3VQQA 8ICIA 1I3AA 5KFGA 8ICGA 4W5RA 3K4GA 4XRHA 4N76A 3V7LA 1TL1A 3C6UA 1S1VA 3V9ZA 4CGDA 4NLGA 5DQGA 2BGGA 5HMLA 2Z1IA 4GMJB 1ZETA 5KG2A 3WNEA 1WCNA 3P1GA 4I2GA 4KHNA 1XSPA 9ICRA 3JPOA 4UB5A 4YVZA 3N4MB 3RJGA 4I2JA 4KHUA 4M9HA 5CYMA 3QETA 4GXKA 5J0QA 5HP4A 4NY8A 7ICPA 4L8RB 2W9CB 4KHQA 4E3SA 4OGEA 1MQ3A 3OYMA 3PMLA 4F4WA 5DG8A 1W9HA 3LAMA 1L3SA 3OSNA 1JLGA 3QEAZ 5J0OA 3HX0A 1HNIA 4RW9A 4CEOA 4UB4A 4KLGA 5DKWA 4M9NA 2ZUDA 4ECVA 4MFBA 3WNHA 4UBCA 3VQ4A 2OPPA 3LWLA 4KN7A 2JEJA 3VQ6A 2LYHA 1KLNA 3LZIA 5J2EA 1BPXA 7ICFA 1J5OA 3TAQA 3T1AA 3MR2A 3MDCA 4DFJA 3OYBA 9ICKA 5FRNA 1T05A 5KG5A 3VQAA 4GXJA 3T19A 2ZUCA 4M41A 3RBDA 2F1JA 3PW7A 1BI4B 2UVUA 4UAWA 4CJTA 1RTIA 3K57A 4DQQA 3KLIA 3VQ5A 4F5QA 3OYHA 1TK0A 1SL0A 3EWAA 1WAFA 2AQ0A 3OJSA 4G3IA 2E6MA 3IRXA 1QHTA 2Z1JA 4LH5A 1TKDA 3ETLA 2HMIA 4KFBA 2HVIA 5KFUA 3P83D 8ICQA 1MC8A 1CUKA 3K59A 1BIUA 4I27A 1EXNA 1EXQA 3AVHA 4LH4A 4CEEA 3VQ8A 2FBVA 4KB0A 4RPYA 3E01A 4PGQA 5KFRA 4CJVA 1BHLA 4M9GA 2AGPA 3LP1A 1WSJA 4CEZA 1WLJA 1B9FA 5CZ1A 4DLEA 4OJRA 4QZFA 4RPXA 1REVA 4YMMA 5IIMA 4DTOA 4I2BA 3T5KA 1L3VA 1WNSA 4QOZB 3RRGA 3OYNA 3KLFA 1EETA 4ZH4A 3CM6A 1C0UA 2RDIA 5JS1A 1DTTA 4J9RA 5CB1A 2IDOA 4KLUA 4N56A 7ICQA 3PY8A 1ZQRA 4QZIA 1U4BA 2LSNA 4FM1A 1RYSA 4RG8A 2HNYA 4LSLA 4RW7A 4CHNA 1ZQZA 1KFDA 2ZTDA 2IHMA 4Z4HA 4JV0A 3C2MA 4B9SA 4UB3A 1ZQAA 1Q8IA 5KG7A 4O55A 4KHSA 3C21A 4CFDA 1RT2A 5HNKA 1ZQXA 3VQ7A 4FLWA 1I39A 4LZDA 4M3ZA 8ICXA 3SQ1A 3KKSA 3QEPA 2XCAA 3BGRA 1F21A 4NCGA 1VSIA 5KFXA 4J2AA 4P4PA 1U47A 4FW1A 2C2EA 3TAFA 1QSYA 3HPGA 1IG9A 4QZHA 5KFKA 5L1IA 3VN5A 8ICUA 5DGBA 3CYMA 3RH5A 3T5HA 1WSGA 3M8QA 4JUZA 3JSMA 1VSFA 4ECQA 4J9KA 3UPQA 2FLLA 1A5VA 1K6YA 1U49A 2FPKA 1S1UA 4E7IA 3JPSA 2VA2A 4TUQA 5KFYA 4NCAA 4PUOA 3RMCA 2C2DA 4CK1A 7ICVA 4BXOB 5DDMA 4DOAA 4ELTA 4Z4EA 1U9LA 1HUOA 4CJ5A 5TZVA 2D0CA 5IINA 2W9MA 1RT4A 4OLBA 3QEVA 4HCCA 3U3GA 4Z6EA 1SKSA 3WNFA 4KO0A 4Z6CA 3L2UA 4I2EA 1RBVA 1VSDA 3BQ1A 3AVFA 2A1SA 3RMDA 1UAXA 2ALZA 1ZQOA 4O5EA 1C0TA 4EYHB 4RQ5A 4FZZA 1KRPA 2PZSA 4RNMA 4TQSA 3MR3A 1GOCA 3DRPA 4FJ8A 4JRQA 1S77D 3O3GA 8ICVA 3P5JA 3V9XA 4M47A 1RTDA 2E4LA 5EWGA 2OPRA 2YV0X 5KFHA 1RT7A 3HM9A 1ZQPA 4KKOA 4YR2A 1N48A 2Q0ZX 4YG2A 3L2WA 8ICSA 5KFQA 3AVIA 1HJPA 3QEXA 1ZQWA 3TAPA 1HPZA 4FJHA 8ICZA 4ED6A 4Q44A 4BE0A 4I2PA 8ICAA 1BPYA 1JXEA 2PYJA 3H4BA 1KCFA 2FLPA 4KLOA 1ZJNA 4FM2A 5KFSA 2Y1JA 3RJKA 5EWEA 3KTQA 4YFUA 4UAYA 3GV8B 3ZCMA 1MSWD 2FBTA 3RB6A 3NGIA 4DL7A 4MF2A 4M0AA 3QNNA 3NE6A 2ZJ5A 3IHQB 3ZD8A 9ICGA 4KLIA 4P4MA 7ICOA 1VSKA 4RQ2A 2PFPA 4E0DA 4CJWA 4DF4A 4RQ7A 4TSXA
chains in the Genus database with same CATH superfamily
2CUYA 1NHKL 5F8NA 1NK7A 4H5TA 5AKIA 1S7IA 1Q16B 3AA3A 3SAGA 3R3LA 7ICEA 1JALA 3TRGA 2P9UA 4P2FA 5A76A 1NPPA 3V5RA 2O01C 5EOZA 4RUAA 2DD8S 1HX1A 4RUBA 1COOA 3ZT2A 4Y2KA 4R79A 3QB0A 9ICAA 4WK1A 5D0RA 2HF3A 3KIOA 1BGXT 3D3BJ 2R2RA 4CLTA 3EE3A 1F5SA 2DKOB 1E3MA 2VYPA 3FMBA 4TVAB 4ZOHC 2YJEA 3CMQA 3N5BA 1WF0A 4HUFA 2E9TA 1WOQA 3OYCA 1B4FA 3OFFA 2W8KA 3PIPQ 3SQ2A 1WI6A 3D6FB 5EHHA 1N36K 4PHPA 2BJEA 2QMUB 3BGFA 3LP1B 3CCES 2B9XA 4ITSA 3KDOA 1SJ3P 2Q43A 4FOEA 4DL2A 3O9QA 1S9GB 1UW9A 3MMAA 1YJ7A 4C0HA 7FD1A 3QT8A 2OP5A 4MIAA 4MIBA 1RHUB 1L8LA 2QA2A 1NDCA 4O8KA 4KV8A 2BRLA 5F2RA 1P1TA 1M5OC 4LF7K 4JOUA 1T02A 1L7NA 3GE1A 3G6YA 1SZPA 3UWTA 1VCTA 1U1KA 3NMUA 4QS7A 4DXLA 1BHNA 2RLTA 1U1MA 1R89A 2DGWA 1JUDA 1OSDA 2AJ0A 3NF6A 3VR1A 1Q7YT 3OS1A 2XVTA 1P8ZA 3VHQA 4KTZA 4KBIA 1TP7A 2JEFA 1M5KC 3C23A 3GP9A 4YCXA 5AXNA 1Y10A 2VPWB 4P0QB 1RABB 3ID8A 1B0PA 2QWPA 2IRUA 4I2PB 4R66A 4NLCA 4EZ6A 4OYZA 4B1YB 4LRBA 4O5FA 4HDHA 4EX7A 2O8FA 1U7LA 3E1YA 2YNHA 2KH9A 2YMMA 2Y9HA 5IWAF 3FR0A 4DTUA 4UB6U 3V81A 1PJ7A 3JS9A 1X9MA 5KFFA 2F76X 1V4TA 2YWHA 3BF3A 1UMJA 3CJ8A 1B4SA 3EX7B 4PQUA 2X1FA 5GMEA 5J0WA 2J0XA 2PFOA 2JVRA 1NSAA 3TZYA 1QQNA 4FJMA 4ZMMA 1UOCA 3VTHA 3AVAA 2WOMA 3M30A 3MUTP 2D5RA 3K9JA 3D1QA 2P9PB 4IH6A 1FFWB 4I6YA 2HRYA 1MWKA 1J54A 1S3XA 3VGUA 1XNRF 1GLEG 3J7AN 4KX3A 1JIHA 3BGRB 1RKJA 4FCYA 1W2BR 3OR2A 2XLJA 4AHSA 1KBRA 3TQ1A 2J6TA 3QERA 4C11A 1RDWX 4ZTFA 1NPRA 1OUQA 4E1JA 3JAMY 4DPYA 5AQKA 4NZ6A 5C2GA 2I5JB 4PHDA 3N7SC 7ICIA 2KOBA 1G4CA 2K4IA 2ZIVB 4HTUA 3SQ4A 2JV3A 3W9JA 6FDRA 4KLFA 2ITGA 3NKYA 1ILYA 5ALDA 3PXGa 2PBDA 2L08A 3TW0A 1BLUA 3FZLA 1IKWA 2V8PA 1HNVA 3DNCA 4KITB 1N5VA 4CZGA 3MWPA 3DRYA 1NDKA 3ZDBA 4Q45A 1M1KT 3AXMA 3HLUA 1WUAA 1XHXA 1S97A 9ICOA 2Z57B 2CNNB 2VIHA 2GGPB 4EENA 4QW9A 2UUCJ 1RBTA 1UP1A 1DOQA 2GJIA 4KGKA 4U95A 7ICSA 2RKIB 2QKQA 4B3RJ 1HI1A 4DQRA 3JYTB 5AZIB 4ANDA 2MMYA 3LH2S 4IO1A 4DG1A 4DX6A 4QNLA 3MCAB 4RQ1A 2JVOA 3BS5A 8ICYA 1GK8A 3OYGA 4LR8A 3UVJB 5HOOA 3NGYA 3NVKA 4IR1A 1NNDA 1IWAA 2BQ3A 5KFDA 1I94F 1U6BA 3AD7C 2ZZNA 4YB7A 4ZITA 3L7UA 1J97A 3QFUA 2HLTA 1VDVA 2EI5A 3MCPA 5KRTA 2ZM6F 3F53A 5DM6L 5DDQC 4JKEA 3NS1A 1K8AO 4A2BA 3TAMB 3AJ1A 2ZIXA 1BDGA 4N77A 3MM8B 5JLFA 1QUVA 1YJVA 3T1YK 4U8YA 1Y97A 3GFKB 5L1JA 1YHQS 1J5OB 4OIXA 2VWKA 1ELOA 2MKSA 2I6XA 1K73O 2HHXA 4DR2K 2DGSA 1ZTTA 1Q53A 1F3VA 1VHXA 3MAQA 1RK8A 4CHZA 2ZDOA 1WDTA 3M2RB 3K17A 5F1XA 4JI2K 1TUVA 3AVCA 1WOSA 2WBNA 2XNQA 1S12A 4UF4A 3BN4A 1NXIA 4DR5J 1AFIA 3UMGA 2UU9K 5GADI 2UUBF 2BX6A 1RDCA 3M2RA 5KFCA 3MABA 1U02A 2XLKA 4DR3K 4DQ8A 3ZEUB 1EO1A 4QS9A 4ZP7A 1R7IA 1HBNA 3D1HA 5B66U 4MK7A 4FZYA 4GMKA 2LPEA 4GC6A 4PXBA 5AFUA 2NO4A 4JI3J 1IG8A 2LYAA 4DV6J 2F1IA 2HBKA 1HBNB 3AVLA 5ETLA 2E2NA 2DCLA 1MU2B 4TU9A 2O6KA 4FS2A 4J2BA 4YORA 2NRVA 1S6QB 4BC3A 1VK8A 2ALYB 2RHFA 5EE1A 4Y1CA 2V67A 2KKPA 3A8KA 3BO2A 3PIPL 1TFRA 2GW8A 3BQTA 2CPJA 2ZBRA 2W2PP 3EKUA 3AV9A 4DV0J 3G82A 4QBUA 3UN3A 4DR7K 1GLCG 2K1RA 1X4CA 3M1VA 3M32A 9ICBA 2J8SA 1G2EA 3GIMA 1MDUB 2OPSB 4RQ8A 3NGKA 3KG0A 9ATCB 3IS9B 3CB4A 2GWJA 1BNOA 4X4OA 1DQ9A 3DFEA 1H1VA 4OZ1A 3TJAA 1P8GA 4CW7B 1RP5A 4AP9A 2XSJB 1FNXH 2XCPA 2R9LA 2KT3A 2G0JA 3TAMA 2QA4N 2VBYA 4LF8F 2YKMB 4RW8B 2KN7A 3QE9Y 4DTXA 4GVBB 4PWDB 3NS6A 1VQSA 4NWBA 2VB6A 2BV3A 3I31A 4HT5A 2QARB 3QUBA 2W7PA 2GX8A 4M5DA 2X1AA 4Y2MA 4W5TA 2O4IA 1Q81T 4ZA1A 5KAKA 2HS0A 4DLGA 3SUNA 3UVJA 4IOAQ 3CDWA 3KKAA 4QCLA 1D9AA 3RBXA 3UR0A 3M8QB 5J0YA 3MMCB 2GX9A 3CCTA 4B8AB 1HBMB 4C8NA 2J4RA 4DF8A 4FBTA 1QQMA 4ERDA 3R6MA 3MK6A 1SV4A 1UETA 4ISFA 4YD2A 3ET6B 2ZZTA 4YN4A 1XMOJ 4ZJLA 4GNIA 5CYQA 3D1OA 1GO3F 2KTQA 5ALHA 2G1HA 5KI6A 4MFFA 1DGKN 3G8QA 4Z6FA 3D6JA 3SEOA 5AICA 2WOMB 3M30B 5AQLA 5F0WA 4DV0K 4K25A 3MX5A 3SQ0A 2OYQA 3QAUA 3ZDCA 4JS4A 3EWGA 2NV3A 4O3NA 3O9RA 5A6WA 5EVZA 3T3FA 3GG1A 1ZOLA 2I5JA 2HWHA 2DPNA 5MLCV 4ILLA 3LP3A 2OMOA 1NOYA 2QLJB 1F2HA 3DMJA 5HQMA 5IZHA 1CULA 2XM3A 2WRMA 1WKJA 4Y65A 3SPZA 4M5NA 3DLLL 2IJRA 5J8YC 1PYOB 2HOQA 4UB2A 4K8RA 3ENQA 2ISOA 8RUCA 5AQTA 3QYYA 3I33A 2FMSA 6FD1A 3SJJA 5FROA 5AQMA 4CBWA 2OSRA 3M6XA 2UXCK 4CLYA 5HVGA 1T44A 3V1RA 2R8GA 3DLKA 3QJPA 5J2IA 2MZTA 1IVZA 1R3NA 4AL5A 4ILRA 3ULEB 3CJ9A 4EHTA 3EO3A 3RTVA 1WN7A 3OBWA 5HR6A 1GMWD 5C10A 2JX2A 5AI5A 2OH2A 1WAJA 2YH0A 3GSDA 4QZEA 1HPZB 2EKNA 4FXWA 5AI8A 4QWAA 5L1MA 1W7AA 4NV0A 1PO6A 3SEIA 5LJWA 5T7BA 2V8DA 3ICXA 1MQ2A 2I9GA 1KTVA 3N6MA 2EHGA 3KNGA 1JCEA 3CCMS 3OVNA 1Y3JA 4I4BA 3VCBA 2OA8A 2DISA 2JGUA 4C4RA 2NYIA 3BR9A 3QATA 3I56N 1HBUB 2Y1IA 4KAZA 3JAMU 3E8OA 1FWKA 2HS4A 3VQSA 3CP8A 2XY7A 2XO6A 3OVBA 2IVYA 2VFTA 5DM7Q 4DV2F 3W61A 3BGLA 2DGTA 1NOMA 4ZDNA 1N6QB 2WF5A 4LVSA 1JLEB 4W90B 2GJ2A 2WAQF 2VA8A 2PI4A 3LL3A 7ICGA 4EBEA 4IKFA 9ICJA 1WG1A 3I4HX 4DV4J 1KVKA 1RU2A 3DEEA 2M52A 3EZOA 3HVAA 3GLJA 4CZJA 2AX0A 2E1EA 2QK9A 1C0GA 5J8YA 1FRLA 2J9DA 4CM2A 1UAWA 4ELUA 2HS3A 3Q8KA 3S1TA 4B3SK 1NGGA 3BSNA 1TL3B 1NEEA 1H0HB 2E9ZA 3AAQA 1RQ0A 4AFFA 4YOUA 5BPLA 1NLKL 4B3MK 1X9SA 4DS4A 4DCOB 1U2FA 2HHQA 2HHUA 2FTRA 5AQFA 2PY5A 3GV5B 2UXCJ 4RW4A 3CJSA 1ZQFA 3QO9B 3X1LB 4G6VB 3IBFB 4G1QA 3H4DA 1X9JA 4NZ0A 3M2UA 2F65A 4DR2J 3FZ2A 4BVPA 3G71N 2XS7A 1OY8A 1RAIB 1BL3A 3NNHA 1ZXOA 1FFGB 3A5MC 4PABA 4IG3B 4ED7A 4PXEA 4RWTA 2AEJA 4QIEA 4PPXA 4ZVPB 3IGNA 3K89A 4I2CA 4B3TJ 1SC1B 4BRGA 4F93B 4DS5A 1SV5B 2MZJA 2NUBA 2ATQA 5EGYA 5IILA 1G1XA 3KUEA 4A8SA 1VQ7N 4DUZJ 2DWQA 4XIUA 2E1AA 3MAAB 4RQ3A 4NLWA 3MN7A 1HI8A 1N8RO 4U7UK 1C1BA 2EC2A 3I28A 4CLZA 5ETQA 3BEXA 1U1RA 2B7CB 3O9UA 2MQLA 3HBTA 1DHMA 2HGNA 4NZ7A 1DK3A 3CCQN 3NS5A 3QU7A 4YXMA 3V7JA 4B9VA 1TQLA 1DTQA 4JI6K 2R8JA 2YB1A 3WX4A 4ZS6A 1S9FA 1H3DA 1D5AA 2WB1F 1RWOB 2ZH3A 2E5LJ 3C6AA 3LGHA 2XRIA 3WC0A 2KRRA 4AT1B 9ICHA 2GQCA 5AKXA 3DXBA 1SKRA 1EP4B 3TI0A 1RWMB 2QMXA 3QZ7A 5HRSA 2OEKA 3HFKA 4B1VA 3QICA 1K0VA 1ZAXA 2LQ8A 3CCLN 1NMNA 3U1NA 1JKHA 3ET6A 4Y00A 2MA1A 5L38A 2UXBK 2CPXA 3FNNA 1S76D 4CF9A 1KQGB 4XH4A 2AGOA 3HFVA 3IP0A 3M8PB 1OMSA 4FPBA 4PQAA 3WIVA 2FMPA 3DLHA 2BZ2A 4ICLB 3BF4A 1KFTA 3HXMA 4UQGA 3EN9A 2CPYA 1LEOA 4X62J 2VBXA 2Q0UA 4OYIA 2C2KB 1ZQIA 4KGMA 5KT2A 1IQTA 5HRPA 3VOVA 3LAKA 4QZVB 1XMQK 1U0SA 4LR7A 3L3VA 3VAHA 1VQKN 3KMSA 3NLCA 4C3KA 3J81O 3UE2A 3RAQA 2KZMA 1JXBA 2Z2YB 3DYAB 3W2WB 1LWEB 3HD1A 2BMBA 1SUQA 3PSPA 3WK4A 2HNDA 2D3O1 4A5BA 3OR1A 1B7FA 2JRZA 3EPGA 2OEHA 4OKJA 1U04A 3X3UA 1QAYA 4JS5A 5MAOA 3WEEA 3GJQB 3LPYA 3BGUA 2ASLA 3KFUF 2XHBA 1NH7A 4JI5J 2YCHA 4BR7A 2RUSA 1OXJA 4OHVA 2QYCA 2JWNA 5KFJA 1TFYA 3G82B 1A5WA 1JLQA 3BREA 4ILGB 5ADZA 1S7HA 1RT6A 1Z4NA 1A6SA 4I69A 2Y1LB 2GNKA 4OZ3A 2UV8A 3CJ0A 4KREA 1EX4A 3MTKA 4EX6A 2NREA 3DLLQ 1K1QA 4XA5A 3C0BA 3H46O 2HFUA 4BRFA 3Q2TC 1C2PA 2HGLA 1NGIA 2VFVA 5G4DA 9ICTA 5GMKa 5AI4A 1TTHB 5HK4A 4YMEA 2GO9A 2MKKA 4CLPA 2HFOA 2IAJA 4OZ2A 3UQSA 3D6TB 4L73A 3MM6B 4QQBA 1HEKA 3NVWA 2J9EA 1OPIA 3KK7A 5LOQA 4I0WA 1Q8KA 4KHRA 1SJ4P 3N0VA 1BCMA 3VZIA 3NGDA 1RBAA 3CC4N 2D69A 3CD0A 2P9EA 3Q23A 4DL6A 1AT1B 4ED4A 2FHJD 3CWJA 4KLMA 4FYYB 5CR0A 4RNOA 3RW6A 1BI4A 4RQMA 3EY1A 3NGRA 1C4AA 2NCKL 2UVRA 4OYAA 2BPFA 5D0HA 1EX8A 3ETRA 4F5RA 2ZBCA 5KT3A 1UJ4A 4D3HA 3THPA 4FLZA 1K9MO 4DWIA 3BZQA 4ZP6A 4ZPTR 4W98A 3K2YA 2PGCA 5AQUA 5KL8B 4CERA 1I5OB 3EICA 1RTJA 2IVPA 2M4MA 4N8OA 2AP6A 1O0PA 4PY5A 4FVCA 2KVIA 4Z4CA 3T41A 5BR8F 3EVWA 2LM4A 4M1KA 2YX7A 1O51A 3M5RA 3H8WA 3HZ6A 1S1TB 4FZVA 1WOOA 3A5NC 3IBPA 5IV4A 1JLQB 3UCZP 1GLBG 5KG3A 4WQ4A 4ZHRB 3Q2SC 2BE2B 1VGYA 2NUHA 4WJ3B 1IO2A 4I6MA 4JKHA 1CJUB 4RJVA 1RBSA 1FXDA 4IQUA 1WB9A 1PIEA 5A8RB 3IGVA 3TKAA 3QEBZ 4O4RA 4TUPA 4KN4A 2FY8A 3GSIA 2PSZA 1M5VC 5JVGL 4BRKA 2VG5B 3B6OA 4FWRA 4C8MA 3MXMA 1XQSC 4LF5F 1EWQA 2AHOB 2KLAA 2DYAA 2HQDA 3KDNA 2RS2A 3DYAA 3W2WA 3TA2A 8ATCB 5AJ3F 1VQ8S 1C1CA 3BH6B 4P0PA 1BE4A 3DGPB 4P73A 4KTQA 1UL3A 1SJFA 3OYJA 4LVNP 3C5FA 2MGZA 5E33A 3Q22A 5KQ8A 1HR0K 4Y2IA 2B4VA 3NCPA 4OX9J 3CEDA 4KGXB 4DFMA 4B9UA 1N2XA 3MEEB 4C6AA 2FC8A 4H5RA 3WC2A 7ICLA 3OHAA 3KUGA 4JI8K 4OVLA 4NASA 1HLWA 1A0OB 2BEFA 3AOAA 1FRXA 3J7Z5 2E8OA 5C2CA 3QGIA 1RWPB 4CZIA 1HMVB 2QZ8A 1JLEA 3C6UB 5D4BA 2W6LA 4R8UB 4USHA 4IWVA 3IFRA 2AWZA 3P96A 2XICA 3CD6N 4BC4A 1DXSA 3SAHA 2XBPA 3EGZA 2XMMA 1RACB 2H3ZA 5J1EB 1F5AA 5KT5A 3HJEA 4E89A 1R0BG 3R9PA 2A6OA 4LC9B 1DARA 4KHPK 3MEDB 2P9LA 1DTQB 2YPYA 3UNGC 1XNQK 2ZIWA 2FC9A 4GKJK 2C2OB 4H4OB 2NQPA 1HWIA 3IA0A 4LFBF 1RT5A 3AM9A 2AJ2A 5E3QA 3EVOA 3MM5B 2ESEA 4I2DA 4RUHA 1FXRA 2H3IA 1G6BA 3RR7A 3WKEA 2AP1A 5TKYA 3IFEA 2CPRA 2HRTA 4JWNA 3D7SB 4PQUB 2VC0A 5AQJA 2I6WA 4PKGA 5H9FJ 5C42B 3TEHB 2DFHA 1Q82T 3KKAC 1YXQA 2B43A 3D0HE 2CH5A 3ZYYX 2QA1A 4DL4A 2EC0A 1DY3A 1BUPA 4JWMA 2Q31A 2Z8QA 4U67L 3IG5A 5HN0A 2M2BA 2MPUA 4X84A 2NLXA 2GTDA 4UB1A 1QVGM 1BPEA 2M0NA 2ZVSA 1V97A 3TADC 1N61A 2ZDPA 5E3CA 2DO0A 4LF4F 5ETTA 2KHCA 2CKWA 3R5DA 2KJVA 1JLGB 1JROA 3KOAA 1CJKA 3PV8A 3KLVA 4B3OA 3V6HA 5D4PA 3EE9A 3VZHA 2QX0A 4NYFA 4HAIA 4WP8A 4PYAA 4P72A 1XHZA 2VONA 2HPUA 5CYMB 1EAYC 2CQ4A 2FVSA 1WSFA 5BR8J 3R1LA 5KNIA 3RJJA 5HATA 4M04A 2O8EB 4FJJA 2W04A 2QXFA 2DL0A 2XZTB 5A6PA 5JXSA 4JI7K 1ROFA 3PR5B 4Q5VA 1QSSA 4JRPA 3ZZRA 4KLLA 2A2DA 3UKUA 3A1YG 3MCOA 3V1QA 4LF5K 4F50A 5FPEA 5DB8A 4L3KA 4TN2A 1YITS 1UVNA 4CHPA 3PYEA 8ICRA 3QMLA 4F3OA 5M1OA 3AMZA 4IFYA 3ZDEA 4K2JA 3HCXA 2VG5A 1E6YA 1V9PA 2N7YA 1OWXA 4WK3A 5BYRA 4AQYF 1NK4A 4LFAF 1JWWA 3PHEA 4F4KA 4Y2YA 1YJ9S 4DR3F 1RNHA 1V5IB 2XTJP 2QO3A 3ICLA 4FJXA 4JI3K 2VKQA 4BGAA 2MHNA 4PWDA 1R0AB 2VBZA 3CJAA 4FLTA 1XNQF 7ICJA 3AGRA 2JWKA 3N28A 3M7DA 4B08A 2O3DA 4KAIA 4WYLA 2PO4A 1R43A 3LDAA 3NVVA 2GHWA 4A8MP 2RPIA 2XMAA 3V6JA 2F96A 1HNXJ 2EX3A 1X5PA 2P5OA 4PG4A 4J9LA 1SB6A 2UUWA 1T4GA 2JHDA 2M88A 1VRTB 3GJSB 3EGWB 3OPKA 5DB7A 3GJRB 5J2MB 1S0OA 4KPYA 2A41A 3S3MA 2KE7A 1WDDA 3C6TB 1ZBHA 3AVGA 1W0HA 3R9LA 2FI1A 1TYQB 1CEZA 5HQ8A 4YHHK 3MMCA 3IMXA 2VQFF 1J2NA 5EUHA 3LO3A 5ALVA 2FYXA 4DZDA 2DGUA 2YX8A 4CO0A 1IXRA 2O67A 3M8RA 1N5YA 1GNKA 1X8DA 4Y2TA 1WUUA 3ENWA 2WB1D 4R5PA 4A8WA 5EN1A 3PMNA 2DEIA 1HR0F 5IOLA 3KWMA 4RCHA 5HJYA 1FX2A 1FA0A 4OYPA 2AZ1A 3F56A 3L2QA 4G1PA 3I96A 5BN9A 3D0GE 2K3KA 3IWLA 3M6KA 8ICGA 2E5JA 2HIYA 3KZXA 3W0LA 1HNXF 2J0WA 3DLJA 3KFWX 5K8MA 5JU5A 5LSOA 1N5WA 1T3VA 1TUYA 1ZETA 2VC1A 2O8BA 5KG2A 2DNRA 4FWSA 4HH0A 4KHNA 1XSPA 4V19J 2K3IA 1N5TA 1OO0B 3MX2A 3N4MB 3L5KA 2D8CA 4RWWA 4CTAA 1DBDA 4L8RB 1MQ3A 4ZPBA 1B0TA 4W92B 1YI2N 3NASA 3IRUA 1HBOB 1RWVB 1GMWA 4PPZA 1LKYB 4Y2UA 2XMWA 5AIBA 3HX0A 4RW9A 4RX6A 4PUOB 4CNZA 4UAUA 4IFEA 5B0BA 4KLGA 2KO1A 1N5XA 5AR0A 2PMZF 4P74A 2XYHB 5TISU 2MU2A 2DNGA 3CCQS 4KN7A 2R3VA 1QD1A 3LZIA 5C15A 1J5OA 7ICFA 3TAQA 3MR2A 4DFJA 1O13A 9ICKA 4OI1A 3FCWA 4B3MJ 5FRNA 4L72B 1T05A 1HBOA 4EWTA 1T3OA 1VQNN 4PZNA 5A8WB 2UVUA 5AKHA 4KR0B 4CJTA 3C14B 2V8GA 3UCUP 3FZHA 3KLIA 3HKWA 4X64K 3OYHA 4WQ4C 4LF9K 1ZD5A 1TK0A 1SL0A 3EWAA 1ZM2A 1DQAA 3SCIE 1Z4OA 2E6MA 2DY9A 2E8PA 3JB9k 1MMDA 2G2OA 4J9VA 4KFBA 2VJVA 3FZFA 1U2RA 4HHJA 5BR9A 3QGHA 1BIUA 3AVHA 2N7CA 4WFZA 2W3SA 3M7VA 1RAEB 3J8AA 4CEEA 3CVKA 3LVVA 2FBVA 1UVLA 4PL2A 2RQMA 4RPYA 1WTBA 4DPWA 5KFRA 2QA4S 4CDIA 2CQCA 2WSCC 4QR1A 1VBXA 1WC4A 4M9GA 2ZM6J 3RJMB 1WSJA 1WLJA 3AQPA 4DLEA 3QAEA 1RDFA 4RPXA 1HUXA 2JSXA 1L8OA 2PMWA 3PJ9A 4AYBF 2F4FA 4GKKK 2JL9A 1L3VA 1WNSA 4QOZB 3W7BA 3WT0A 3OYNA 3KLFA 2JMGA 1C0UA 1DTTA 4PRFA 4WF9L 2IVMA 3H3OB 2IDOA 3MGJA 1N5YB 2DNPA 4N56A 1RA7A 2H9ZA 4F02A 2X3GA 1NMDA 4QZIA 2DY1A 2BANB 1U4BA 4B3TK 2OO4A 2YQ0A 1PK1A 5HL7L 1GT8A 4GV6A 2QLFB 2MZ1A 4RG8A 4BHQA 4LSLA 4CHNA 3LPEA 1CVJA 2RRBA 4FXVA 4Z4HA 4R5PB 3BSAA 3CCVN 3TJ9A 8AT1B 2UXDF 4JI8J 2J8AA 4GKJF 4FLWA 4AM7A 1HIWA 4DCCA 2B0GA 5LXRA 4M3ZA 1FJGJ 3J7YU 1JCFA 8ICXA 3SQ1A 2YWGA 3QEPA 3A13A 3BGRA 4NCGA 2FGOA 3VAIA 1HI0P 4WKRA 1VSIA 4KHPF 1WG8A 1U47A 3VAMA 2W6KA 4PR6A 4FE3A 1QSYA 2KHDA 4U6PA 3CQXA 2N82B 4NXNK 3D2FA 3VN5A 3MOZA 3DOKB 3VGTA 8ICUA 5DGBA 3CYMA 3QNWB 4JUZA 4DV1K 3A0HU 1JJCB 2UUAK 3ULHA 2P9KA 1K0TA 1YSJA 2W11A 2XMKA 3JQKA 2OPPB 2V2KA 1UEUA 2FPKA 1TU0B 1NB7A 3JPSA 2VA2A 4BREA 2QWOA 3RU0A 5GADP 1Q3VA 3ZZOA 1N36J 4NCAA 4OO1J 3WQUA 2LMRA 4DV2J 2C2DA 1IJJA 3NUQA 5JVGQ 4X4NA 1V9OA 5EXWA 2Y8WA 3N4QA 3DKDA 4ELTA 3F5AA 2EFNA 1VQYA 4MHVA 2QWRA 4CJ5A 3MMBA 4OV1A 2DH7A 2D0CA 1X6JA 2UUBJ 2W9MA 2GVDB 1RT4A 1N54B 4Z6EA 3W5ZA 3LP0B 1MLAA 4H4MB 2GV1A 2ZBPA 1VSDA 1RBVA 3L2UA 1VYAA 1S6OA 2MQNA 2ZGZA 3A3OB 4O5EA 4TU8A 4B17A 1X5TA 4HVZA 4H0XB 1RG6A 1QH9A 3MWTA 2VBWA 1CJVA 4KRWA 5HMYA 4NLVA 4QPXA 1NHUA 1KONA 3DJCA 3NG8A 2P9GA 2FVRA 3V9XA 4HH1A 4H0TB 1GLJO 5KFHA 2GGPA 4QIFA 2M7SA 3DXSX 3KK3B 4E98A 4P71A 3N4WA 2HGMA 5HAOA 1IJFB 3E51A 3L4IA 2V50A 4M94A 3QEXA 3FEYB 1HPZA 2OMLA 3SCKE 4FJHA 1VQ6N 4BE0A 4I2PA 3TYTA 5M2PA 2HSTA 2RDDA 1N5QA 4N8NA 3HOSA 2CJAA 4KLOA 1Z1VA 2F77X 4FM2A 2Y1JA 3I55S 5EWEA 2N1RA 1QE1B 1MSWD 3TZZA 3BYPA 2W1BA 1HNZJ 3RB6A 3NGIA 5K20B 4IO9L 3L09A 2LM1A 1N5SA 2ILYA 3IHQB 3BYRA 4JYAK 4DPOA 3ENHA 4RBVA 3F0NA 4YB5A 3TTDA 3I0SB 3GJTB 2KK0A 2Z7JA 5IT9Y 4TSXA 1WHYA 3DU6A 5LMNF 1XUPO 2VANA 1ZBSA 3BBCA 4FVMA 2AYBA 3SBMA 5K14A 2LDIA 4IL6U 3NVYA 2P9LB 4F67A 3LP2A 3TZXA 4C8YA 4KT0C 3PG9A 2PFFB 9ICIA 2UUAF 1KVAA 2KP7A 3ZI4A 5AM5A 4QS8A 3OW2M 3NF7A 1SQEA 2DHXA 3Q83A 4K8XA 4FLUA 2W54A 3Q8QB 2N3OA 4URGA 2R18A 3LANA 1LOUA 4QPTA 3GBTA 2KT5A 4AILC 2RN2A 4WZQA 2DNQA 1ZQTA 3MEDA 1VSLA 3JPNA 3GIKA 2FHJA 4DV6K 4JI0F 5KOXA 4DV2K 4ZPDA 3IRWP 3BSOA 3J80O 2QA4G 4OI0A 2HQFA 8ICTA 5E7OB 2P5GA 3QWPA 3K5LA 3MR5A 1RA6A 1NBEB 5ALMA 1VLYA 1OS5A 1FJGF 4A8YA 3AARA 4DR6K 3G25A 3M9MB 5K9FA 2JLFA 2E2QA 2HHHJ 9ICQA 4IRKA 1KAZA 3IAYA 3ED5A 3BDPA 3NGUA 1KQKA 4CIOA 3US5A 1SI9A 5C2DA 3VQDA 1ED1A 3IM1A 2VPYB 1TKTB 5EDWA 3NAEA 2F8KA 4LFAJ 3KHHA 7ICNA 4EHUA 5B09A 5J2FA 2Z2ZA 5CD4A 1KD1T 2G2YA 4WFNL 4EBCA 3VEYA 2KYZA 3TP2A 1IBMJ 2Q6BA 1YQHA 2FF6A 2BKEA 5GTHU 1BCOA 1OPZA 2AQ4A 2BCUA 1HD0A 2FBYA 1VQ4S 4ID1A 2VKRA 3S41A 4P2MA 1B7YB 3I8BA 1V38A 2VG7A 3TVKA 1QTMA 3L3UA 3B6PA 3MMBB 5BJRA 4BG9A 3CJQA 1DKGD 3CI5A 4CD3A 2BE2A 2X6NA 2PMZC 1HL6A 2B6AB 9ICUA 5GAHU 2J0QD 1VK0A 1WSRA 1AUSL 1HPMA 5ETOA 1RUSA 4J90A 2GO7A 1S99A 1N32K 4DHVA 2AEMA 3H8SA 2OTLN 2DHAA 1R8BA 3L3CA 2V9WA 4X64F 3CC2N 3D5MA 2OEMA 2H48B 2D0PA 4CJFA 2MY7A 2A1BA 1Z6RA 1P7DA 1B9DA 5L1KA 4PG7A 4DTRA 3FKBA 9ICNA 3NOGA 3ISBA 2CZ4A 2YKAA 2O4GA 2F2AB 4I2QA 1JNZB 2H5IB 1JLCB 3AB4B 5AM4A 1JLBB 3KK2A 4M3XA 2G07A 3U6FA 2A3ZA 5GVQA 4NLUA 1KSPA 1CG2A 4USIA 2W9BB 3ISDA 4UY8O 2H65B 1UZDA 2ASMA 5JJBA 1S4EA 1YKWA 3L4BC 3R9KA 4FLXA 3CCSN 3KLHA 1HLUA 4NXNJ 5MLCQ 2YQ3A 3KG1A 4M9JA 3WEEB 2YNGA 4P52A 4O44A 2A0FB 3RVCA 2KV2A 1OH6A 3V9WA 1HWKA 3W2VA 3MUMP 1XWLA 3TSPA 3ZTPA 1Z00B 2ZUGA 3QIDA 4DSEA 4B3TF 4IDKB 3UW1A 3SQIA 3WK6A 3UDLA 3QFWA 2WFAA 3B4DA 4ECZA 1T6DA 2W9BA 1J2VA 4YOTA 3HILA 3HVWA 2IDEA 1KXPA 2Z58B 5DB9A 1V5VA 2NSCA 3MM9B 4HKQA 2P51A 2O66A 2B56A 3ALRA 2RNEA 4IOCQ 3G86A 1QUPA 3KHGA 1B3TA 1T9VA 4F4ZA 2E1FA 4XUSA 5IM0A 2HBZB 4FO6A 3B4MA 1CSJA 3VEXA 9ICFA 5HSPA 4I6WA 1JJ4A 3SMPA 1HHTP 2EAOA 3CDAA 3JS6A 1NGCA 1YJUA 8ICFA 1R6YA 5BPMA 2Y0SF 2V2VA 4IUFA 3QXGA 2ZM6K 4UUWA 4NYNA 2V34A 2KZ3A 3KLEA 1NPKA 2IGIA 3MN6A 4BE1A 5DBBA 3D2QA 5HQLA 1JL1A 1O8BA 4ER8A 4JI5K 1SCJB 5BREA 5KFOA 2JH7A 3PLAA 2DVIA 4O5BA 2KB2A 1T95A 5JRTA 2P9CA 4NYPA 2GC8A 4YHHF 2ASPA 3SFGA 1S22A 1ZPVA 3S3OA 1NMEB 4LBPA 3SBGA 3HHKA 4DDFA 4ILHA 4OYMA 4OPHA 4DN0A 2BM0A 1UA0A 3EE8A 1C0MA 4DSIA 5BYQA 2JWLA 2K2PA 3VAGA 5AJ3J 4YB6A 1UPHA 4NLSA 2OTLS 3SYZA 2DBBA 4F4YA 1DFDA 3PW5A 4M6WA 1XN9A 2MLXA 1YBAA 2AKWB 3OVSA 2RUGA 4O0JA 4DFPA 4B02A 5IT0A 2KNJA 2BYCA 2J9CA 2NYHA 1KS2A 3PO4A 3QESA 4ZVQB 3WQTA 4OI3A 1P6TA 1B0XA 2CG8A 2X51A 1NJXA 3I32A 1BQNA 5IWAJ 4K7QA 2QKKA 3THYB 5ETKA 1VQMN 3V7KA 1Q9XA 5BOLA 5J2NA 1VQPN 5C25A 2FHOB 3U27A 3GOIA 4OMFG 3P38A 1NKCA 2IY5B 2ASYA 3ATVA 1RCXB 1EHWA 5AI9A 4Q2MA 3RSEA 1RHMB 3V6DB 1FKOB 2ZJ8A 4F04B 3C5GA 1FXLA 3I0RA 1XNRK 4DR1J 4XH5A 5GADU 1LWCA 2DT9A 4UZCA 2D7SA 2ZOFA 3T69A 4CZKA 3ZTSA 4GY2B 1TL3A 2Y8YA 8ICWA 4DB3A 3P39A 1NAQA 4MT1A 5CD4H 4U8VA 2PIIA 2MTLA 2W25A 2ZXIA 3B8HA 3M4XA 2KVSA 3ZC4A 2HHHK 5ALOA 2VHGA 1HYZA 4E1MA 2OANA 3O3HA 1GEHA 2LA6A 4K4SA 1X3NA 3M8SA 1TK8A 1PAUB 3O4WA 1IBKF 3P4UB 1I1GA 5J2MA 1YGYA 5HLFA 3H42A 2GIFA 2H5JB 2F9DA 2NXJA 1QAXA 4Q8EA 1XNSA 2ZH4A 1T8EA 1IBLJ 4HVJA 2PDAA 1OVQA 2R7UA 2KYXA 3PUFA 1RWKB 1PK3A 5KTQA 3R8YA 1URRA 3MFIA 1YIJS 3AAPA 4FYWB 2V4RA 4YN3B 7ICTA 2QMWA 3UDCA 5K8PA 1GLFO 4CF1A 4Y2PA 4DHYA 1Q7LB 4FF4A 3HP9A 4FM0A 3Q8MA 4WP3A 4KC5A 1T3QA 1TKZB 8ICPA 1Q82O 1LK5A 3VA0A 4CJQA 2HRUA 3NHGA 1UVIA 1ZBLA 1YJNS 3DRPB 1NGFA 2FJDB 4QZCA 2FJEB 3DXMA 2XGPA 4K42A 2YWKA 4AQYK 3MEGB 4F2SA 1RT1A 4ETXA 2IC3A 3O1LA 4MAKA 1NJZA 2WVCA 1SL1A 3ULEA 1LWFB 3FBCA 2XWXA 5AKLA 4CI0B 2VJ5A 1VIOA 2HHTA 5H9FK 4EBDA 4H5WA 1B43A 3QBXA 5ALNA 1Z2LA 3CG7A 4A2AA 4OI2A 3S01A 4FL9A 4MKYA 1HW8A 2CPZA 2HK3A 3FBFA 4BRCA 4C9DA 2CA9A 3I82A 2W4DA 4X65J 4LF8K 5E79U 3K0JA 1KLMB 5HL7Q 1K47A 2XMUA 4OHWA 1A9NB 3C1ZA 1XNQJ 5ALQA 3PSTA 1NGJA 4CVNE 4USJC 3IWXA 1N0VC 5F8LA 3THTA 3CT9A 4GLXA 2QV6A 5IIOA 3I9ZA 1Q3UA 1K9MT 2NSBA 3T5LA 4ZVTB 1UTAA 4MEYA 1WG4A 5FP0A 1VQON 4A8FA 5BRDA 3E9OA 5AJ3K 2A1AA 2ZFHA 1XU4A 4CLFA 3PW4A 2ATLA 5IIIA 1M5PC 2WTUA 4QIWF 4WYBA 2LEBA 4KI4A 2L5YA 4AHRA 4RO0A 4BVOA 1S10A 1EQYA 3OFHA 3Q8LA 2QTDA 4YFKA 4IOCL 4CZCA 1VQLS 4B9TA 3IO1A 3QT6A 5DGAA 1ASUA 3AVBA 1TUUA 3VCDA 1B70B 3MM5A 1RT3A 3AQFA 1HYVA 4RWXA 1WF1A 5AKKA 3SK3A 4G9BA 4LD0A 3MN9A 1F3FA 2MQOA 4BROA 3TUZC 5SUHA 1K1SA 7AT1B 4Y0WA 2BGWA 2PYLA 2WAQC 3EW9A 4IBNA 1BWFO 3TANA 2GIRA 3V9UA 2PFQA 1JLFB 4CF8A 3OXGA 2RF2B 4LF7F 4UQTA 4ENOA 2MKHA 1GLAG 4KLEA 1ZQCA 2L9WA 3NF9A 5AQWA 4OFZA 1UJ6A 3H1VX 3MPYA 2KN4A 5CYQB 2FJBB 1VMBA 3WHIA 4C98A 4J9MA 1N36F 4Z0UA 4F3QA 3AA2A 5C0YA 2QTWA 2C1EB 4WF9Q 3QRPA 3E9PA 4BQZA 4JEPA 4EEYA 5T7LA 2OPSA 1WCLA 3JQJA 4DR2F 3C6HA 2VGNA 2CGLA 2JZBA 1GAOA 4DCJB 2KMDA 3LTOA 3T1YF 4OJHA 2HNZB 1D1UA 2A6MA 2XZWA 5ALFA 2LYVA 3KLIB 3T6JA 4M45A 1FKPA 2FVPA 4K0KF 4RNNA 4TXSA 4I9LA 3PACA 2DKXA 5GIPA 2HVHA 1HNWJ 3C15B 2K8GA 2AXTU 1Q1KA 4FWOA 5CZVA 4DQSA 3ZDAA 1XR6A 3DMJB 3QUCA 2YWWA 4IJAA 3W9IA 4FPAA 5CYJA 1L6NA 4FWMA 4J2EA 3O8MA 4OI4A 7ICRA 2HG4A 1WKLA 2J7UA 4NEYA 3C2PA 1UPMB 3VC8A 1RYRA 1VQMS 5DM6Q 2JFKA 3WDOA 4CE9A 2VWJA 3PW2A 3IS9A 4EZ9A 1KWMA 2POKA 2VCPA 1V6HA 3RB3A 1MROB 2QSFA 3SR6A 4CEQA 3TX0A 4QJFB 4TQRA 2XSJA 3M6ZA 4NL5A 4ZHRA 4KI6A 5D46A 2MZSA 1WHWA 3GV7B 3U8XA 2IBKA 3E3XA 2RP5A 2DO4A 3TVYA 2BPGA 2UVVA 4Q0BA 1BPZA 2W43A 1KVBA 2BXJA 1CZ9A 4E7LA 3UDVA 4F0HA 2R2SA 1HW9A 2E2OA 3VGLA 3MM7B 2AZ3A 3FBBA 1E6VB 1QQ7A 4IH5A 2HQCA 1T6CA 2N3LA 2CQ0A 2D9OA 1VQLN 4GO5X 2XYPB 2LFVA 5B0FA 3LDOA 1ZQJA 3NCRA 2LCWA 3J7YP 4ACOA 1VBKA 1MU2A 1WACA 2F7VA 1ZPWX 3E66A 3A3NB 3BP8A 4EK2A 4DSKA 2HFNA 2DFLA 4ED8A 3TARA 1HRHA 3U1MA 1VQNS 4US9A 1VSMA 2IFXA 4J5OA 5FJ4A 4MDBA 1NLVA 4Z7YA 3NFAA 9ICEA 1Z05A 3DLRA 5HHIA 2X78A 2PN6A 1FTRA 4E7KA 3UD5A 3BV8A 3AUOA 1YT3A 1VISA 2NXNA 3MPUB 2F5GA 4Y0FA 4Z2XA 3IM9A 4MEXA 3M1VB 4F72A 2WVEA 3A2FA 2CDRB 2AEFA 3KJVA 2VGMA 3KHLA 1ZM3A 3EYZA 3PKMA 4HTJA 4C97A 2YMQA 3ZNJ1 1N63A 5KGXA 3BN7A 3MR7A 4IEEA 2O8DA 2NO5A 4OX6A 2HVZA 3QGPA 4U9RA 4CLUA 1NGBA 2KVQE 2H51B 4CH1A 3I5BA 3CMAN 4U96A 5AK6A 3PO5A 2VQEJ 2CFXA 2VPZB 5A0YB 2E8NA 4JV5F 3TUPA 4NLXA 3OSPA 1WI8A 2W9AA 2WUSA 2CQGA 2ZKUA 2E6LA 3BBBA 4CEBA 3UNYA 1RTZA 3HOTA 2ZIXB 5F8JA 1FEEA 4RW9B 3SCJE 1IBCB 4X4SA 5F9NA 1LW0A 1S4FA 2V94A 4LFCF 2YPZA 1LB2B 1UWAA 2HCFA 4Q0BB 1ZAWA 1TR0A 5AXKA 4O3SA 1IN0A 1L3UA 5JS2A 3ZNUA 1N0UA 1FKPB 1D4XA 3HSGA 4RLEA 2E7WA 4N47A 2VD3A 3G2XA 1GLLO 1VSEA 3FFKB 3M9NB 2H5EA 4NLDA 1JLBA 4HTLA 3QEWA 1JJHA 2G09A 2L9DA 2GMLA 2RKIA 2AD9A 4WE1A 4CYUB 5KFPA 2P9PA 2MHEA 1S1XA 3HTVA 1M1KO 2F3NA 4Y34A 1Y7PA 2F1HA 1UQVA 5AQXA 1TE2A 1FFVA 1NK0A 1SIJA 4WIQA 4PHTX 2HMXA 3RW7A 4FZMA 1ZA2B 2JEGA 3AO5A 2XMJA 9ICLA 4DG1B 1UJ5A 3K8WA 2HBRB 4XH1A 3ORYA 4IH7A 2CG4A 1PVRA 1LAVA 1SL2A 4LSNB 4NX9A 4ZN3A 2MLYA 2HW3A 3L9ZA 3VQBA 2IYIA 7ICHA 4I2HA 2BACA 5DBCA 5D49A 1XSNA 3CF5L 3GCWP 4X66F 1XK8A 5ALZA 3K5NA 3AJDA 4O0IA 1I3OB 4AHUA 3F2CA 3MZIA 2DH8A 3H0RB 1M1GA 2HNZA 1REVB 2VICA 3HSJA 3MGIA 4KLJA 8ICKA 2AJ4A 2Y3YA 2FJAB 3EZ5A 4CQ1A 3MECA 4O3QA 4A47A 1E4GT 2D0AA 3AEVA 5FIIA 2I1QA 7ICMA 5C42A 1F6TA 3AA8A 5CXTA 3ENBA 3SI6A 1NJIO 2HSZA 1VLOA 3CCLS 2A5XA 3D45A 1FK9B 4CGZA 2WF8A 2FSJA 2Z4PA 2DHGA 3OS2A 3DOLB 2QLTA 4DMNA 1RT5B 1UPPA 4C0BA 3TA0A 1XC9A 3KLGB 1SWVA 2ETJA 2HZCA 3Q7BA 1O5JA 4C7QA 1FKAF 3SXLA 1CPZA 1CZAN 2IS3A 4OZ5A 1QAJA 4DR4K 3W60A 3PW0A 2NR0A 2ZF5O 1VHIA 1X4GA 1UVKA 4X4UA 2ZZMA 2X7IA 1UCNA 5T41A 3H0LB 2DKZA 3HJVA 4TYAA 4IFYB 2IHNA 2GELA 3JPRA 1DLOA 3RJIA 2JH1A 2E5LF 3TFSA 3O08A 3BPDA 4X4VA 5FPNA 1CZBA 1R8HA 2HHWA 3HSDA 4O4GB 4LF4J 2DNLA 4QU6A 1IBKJ 5DJBA 4B9NA 4CGJA 1U1NA 3W5XA 1U1QA 1JMSA 3OR2B 3M9OB 1NU0A 5HBMA 1CS4B 1CXQA 3EXYA 2KL8A 2GHVC 4US8A 1AB8A 3CQ8A 5J0XA 4X62K 4B3MF 4JI1J 4IJNA 3SMZA 1DK2A 5HMWA 4JV1A 2P9NA 4KLSA 2YB4A 5F3TA 3TADA 5LT5A 3FQLA 5CE3A 2I7NA 4AYBD 3MMAB 4CFCA 4KLQA 4JYAJ 1S0MA 2D3DA 2CIMA 2KHOA 4YXJA 3F2KA 1C1CB 1CJVB 3IXQA 5BN8A 3W8GA 1NKBA 2BR0A 3QNMA 3LPUA 1QCKA 3EDRB 2DBYA 5J2QA 4KGZB 4H5VA 4ECUA 5DDYA 2DCUB 3E2EA 1N52B 3RAMA 4HEA9 4H5NA 3VEZA 4AHVA 4PHEA 2QM1A 3C1YA 4LF6K 5J2AA 5IT9O 1AZSA 4KE5A 3RG6A 5CWRA 3LUYA 4QWEA 2NXEA 4F3TA 4USAA 1VRQC 1QLNA 4DTMA 3MUVP 4HCBA 4C2MA 2YKNA 4ZVEA 4TUSA 4I7FB 2OKQA 3ISCA 2ZITA 4KKOB 5A8KA 2Y0BB 1SZHA 1ZAVA 4K4XA 9ICWA 4LF9J 2W40A 1GTHA 2DK2A 4DUYK 5L39A 5HRNA 1DJ0A 2L48A 3BO3A 1YX2A 3M6GA 3TEGA 1ZZFA 3TOQA 3DXMB 2CXEA 3IKMA 2IOCA 3DOKA 2CDQA 3QT5A 5CHIA 2D1KA 2LHTA 3SAFA 2PFDA 3MECB 1F0MA 2G2ZA 4XTTA 4M5GA 3F41A 3HHDA 2W8LA 4M5MA 4X4TA 2CJXB 3AO3A 3HHEA 4CZMA 2EK6A 1OH7A 2UUAJ 2ZQBA 4GV9A 4DR4J 3LZJA 3MC1A 2YHBA 4KH1B 3SUPA 4E7HA 3DHWC 5DK5A 5FLXU 2E8AA 2MQPA 3J80U 3CJ2A 4YDDB 4FLVA 1MN9A 3QLHB 4F36A 1KVIA 1B0VA 1NU4A 1S0VA 2GZOA 2LECA 1URJA 1OIAA 2G0AA 1S1VB 4XPCA 2LXFA 3R3TA 3NCIA 4F5NA 1F44A 4QZBA 5KAIU 2A6AA 5KFMA 2BJ1A 4HUEA 1KQQA 1RHQB 1PVQA 4W5OA 4C8OA 5D4LA 3KVGA 1JLAB 2YXLA 3CJKA 2RHSB 5F9LA 3I87A 4X62F 4YY3K 2G1DA 4CLWA 1OH8A 2DFEA 3ID6A 3I76A 4CYUA 4DFKA 2J7WA 3ILOA 4HHTA 1RILA 1U8SA 4MO5A 4EP4A 4IG0B 2E5HA 4M2YA 3NNCA 1RJJA 2OD4A 1WC0A 3DGPA 3H7HB 4NO7A 1XR7A 9ICPA 4P75A 4FJKA 1PZNA 4M3WA 2IJFA 3RSEB 5FPDA 4ZLPA 5EE3A 5L8RC 4QZDA 4ZVSB 4RU9A 2VH7A 4M6WB 5AKYA 2W2OP 1XERA 2IM0A 1LW0B 4Q8FA 1Y5IB 1ULRA 2JHEA 4C0ZA 3N7PD 4J7CA 2UU9F 2QW9A 4RT2A 5JMNA 1VJQA 2ZJAA 2IOFA 3P8BB 4WZMA 2JJ4D 2FMQA 1VC0A 2QARA 4CJ7A 3Q0AA 1RKIA 1X66A 2ZH8A 3WKBA 5SWMA 5AFUH 4DR5F 1SH0A 2UV8G 2KICA 2KKHA 4ED2A 5C24A 3ZSXA 5C12A 3N7RC 2DGQA 2IYGA 2PEBA 3ZZTA 3C28A 2ZBIA 4DJBA 3MN5A 4CEFA 1XBWA 5F8GA 2AJ1A 2H4YB 1EZZB 3FDSA 3QX7A 3FSXA 5FLXY 1EKRA 1ASWA 3T1HJ 4CO3A 1E6VA 3PZPA 1NZBA 3GMGA 1XO1A 3JTNA 2EZYA 4E8UA 2Q3SA 4K4YA 1RXOB 1ZTWA 4QZAA 4LY7A 2CQDA 1LWXA 1RGIA 4CGHA 2ZIUB 4JK1A 4KX5A 4OKEA 5HP1A 4MH8A 4F0KA 1Y11A 3NRZA 5FRMA 1K8KB 2FZGB 3HVTA 2QL5B 1N8RT 1NNLA 2OXOA 4CCHA 3LK9A 3S7RA 1EARA 1T05B 5F8MA 2HHPA 1KD1O 1YWXA 1ZBIA 3KG4A 5CR4A 1JLAA 2QB1A 4ZVGA 5E3RA 4JI4K 8ICIA 2BW2A 4FWPA 2EAPA 5KFGA 2C2NA 4XO0A 3UD3P 3HZGA 2W2NP 3UN2A 1YVFA 2ZWOA 4N76A 4C80A 2ZBQA 1S1VA 1FCAA 2BGGA 4BLGA 2Z1IA 4GMJB 4S0MA 3VQTA 2Q66A 2HBLA 2LXIA 2XYGB 3KK2B 2ZC4A 4CRXA 3C15A 4HR2A 2EANA 1JQGA 4CF4A 2GMJA 3IRXB 5ALLA 4I2GA 3VAJA 2DITA 3OXLA 3PEJA 3BQ7A 4IO9Q 4UB5A 4YVZA 2UUBK 3RJGA 4F25A 4M9HA 1IQZA 2BJ9A 3QETA 2DHHA 5J0QA 2RT3A 4NRTA 5HVFA 4K4ZA 2KSOB 3EGVA 4NYOA 1WELA 4CZHA 1UFLA 1JB0C 3OSNA 1T11A 3QEAZ 1B64A 2I1RA 5J0OA 2C3YA 3H2VE 1YZ7A 5DKWA 3CERA 5ETMA 4ATNA 3WNHA 3VQ4A 2JEJA 3VQ6A 3FGUA 3AL0B 1BPXA 1BWVA 3HDSA 4KIAA 3T1AA 3OYBA 3CD6S 3R2CJ 2BOPA 3DXKB 5I4MA 1PBUA 3OT9A 3U4LA 1KQSM 5KG5A 1WC1A 4DPTA 1Q95G 4OJ6A 3PW7A 2XHCA 1VQ5S 3CJCA 3T6BA 3D6MB 3OBYA 2XB2D 4BS2A 3K57A 3JSYA 4DQQA 5ADXH 3FRZA 4K2XA 5LMNJ 2LU1A 2PA3A 4DR6J 1WAFA 2OPRB 3H1QA 2WAQD 1TYQA 1TKDA 2HMIA 5KFUA 3P83D 1MC8A 1YRXA 2WK4A 4M5KA 1EXQA 4ZPCA 5IWAK 2VU5A 5AE2A 3GG0A 3FC4A 5LL6Z 1ZM4A 2F44A 1MNEA 2QL9B 3E01A 1XMBA 4PGQA 4CF5A 5G5GA 3C16B 2AGPA 5DO2A 3BB5A 5EX5A 4P7TA 6AT1B 5CZ1A 3QWUA 1NB2A 4GKKJ 2IM2A 4K59A 5A8KB 4YMMA 5IIMA 1LOTB 1LQ9A 4E2FB 1EETA 3ZTRA 3CM6A 2RILA 5JS1A 3I56S 3KBBA 4J9RA 3GYXB 1CLFA 5CB1A 5J2QB 1FEZA 7ICQA 3PY8A 4BC7A 1YJNN 4YS2A 3W63A 3FM9A 4HT7A 1JMTA 3CRXA 5KPTA 5B8HA 1RYSA 3SSSA 2ZTDA 4Y2QA 2WB1C 3IG8A 2V5HG 4NLYA 1SZ2A 4B9SA 1Q8IA 5KG7A 2OLWA 3R5GA 3A0IX 3ZX2A 1Q81O 1W2IA 2HF4A 1RT2A 1ZQXA 4LMZA 3JSBA 3DHXA 3KKSA 1NGHA 2P9NB 4UT4A 2XCAA 1F21A 3GFYA 3WU2U 4P4PA 2C2EA 3TAFA 5KPZA 2OCEA 4H4KA 2W7AA 3QIPB 2GJFA 2AYMA 3RH5A 3T5HA 3BEGB 1N62A 4B3OB 2XULA 2R7RA 4ECQA 3KK1B 2CJYB 2QLXA 5ALEA 4L3QA 1S1UA 4E7IA 1U1PA 5KFYA 2CPDA 2G9OA 1VC5A 3I4PA 1A0PA 2F8MA 4ZPWR 1W7WA 2P35A 4BXOB 4H03B 1LVHA 3OVAA 2C3PA 4RBUA 3CCWA 4Z4EA 5DM7L 3H20A 2NYVA 1SQGA 4PPDA 1U9LA 3M6UA 1HUOA 4JI6F 5TZVA 1SV0C 2HQIA 5IINA 4OLBA 2G06A 3BS7A 5H2FU 4YUDA 1SKSA 2XEXA 5LMNK 4Z6CA 1GMVA 4ZCMA 3BQ1A 3CD7A 1SIWB 2ALZA 1NI3A 1XO0A 3VAFA 3DLKB 1GH8A 4FVUA 2V68A 2PZSA 4C0OC 4TU7A 3MR3A 1GOCA 3DRPA 5HO4A 4FJ8A 4JRQA 2BBEA 3QU9A 2HBMA 3CSKA 2B4OA 3UKRA 1XJWB 2GVDA 3S6EA 3B9JA 2KXNB 3P5JA 4M47A 2IOFK 2NLWA 2E4LA 3H2UB 2OPRA 3LOUA 1M5SA 3F9MA 4LJMA 2DR5A 1LXJA 1LNQA 2Q0ZX 8ICSA 5BRFA 5KFQA 3JTPA 4ILJA 3HM8A 4EFAC 1XQIA 4LIRA 3TAPA 1TV6B 4KPCA 5AK3A 8ICZA 4ED6A 3R7SB 1RFQA 4DN9A 1PC4A 1DRGA 4JI1F 1RAOA 2A2CA 1SXDA 2PYJA 3D6HB 2FLPA 4LFCJ 3FUYA 2HOIA 4A62A 1T94A 2Y1RI 4Y2SA 3RJKA 4K43A 4WTOB 1K5OA 5CEHA 4JI4F 2VFRA 5BYSA 4UAYA 3GV8B 3ZCMA 2F4VJ 3IDWA 1S1XB 1EKSA 2V63A 2WSFC 2G08A 4DL7A 4MF2A 4X4PA 3CC7S 2ZJ5A 4WP9A 9ICGA 5ETRA 1OH5A 4KLIA 1GXUA 3ENVA 4RQ2A 1ZA1B 1CC7A 2ZH7A 2H4WB 1DQ8A 1ZQKA 3SI8A 2ZC3A 3GIJA 2OPQA 1YLXA 3H6EA 3K5MA 3NP5A 4E7JA 4X64J 3ZSWA 4B9QA 2CNLB 4OPAA 2BDUA 1IXKA 4OZNA 4LVOP 5F41A 1O08A 2DRAA 4DOCA 5D0GA 5IIJA 1Y00A 2EFPA 4WU2A 2GUIA 2HMPA 4USUA 4AUKA 4CIEA 1IKYA 5AM3A 4NYZA 3L2VA 1N34F 2QXLA 1L3TA 1F1BB 1BVSA 1XS9D 2CGKA 3V4IB 2BPCA 4UATA 2VDIA 4EUVA 2N4DA 3BGOP 3ZSQA 3KNAA 4H4KC 3ITHB 4IXCA 2HHVA 1RZTA 2KVCA 4LJXA 4OX8A 5FPMA 3CQYA 4DU1A 1C20A 2VWBA 1TFWA 4CHQA 2ZUBA 4ECRA 2HB5A 5KFVA 3EEQA 2HWIA 2K4PA 3LM9A 4I1TA 5C5JA 4C8KA 4CEDA 3G4SN 1CBKA 1S6PB 4JI2J 2ISPA 2KG5A 2RRAA 3MR6A 4E1NA 4RT3A 1J27A 2WHOA 5L9XA 1UWBA 2UXDK 2ERRA 4I56A 2ILZA 2R7SA 3WX8A 4TURA 3V1OA 2G8FA 1T3NA 1RTJB 1PK1B 4AXJA 3A8IA 2OHFA 1TAMA 1RSCA 5AQNA 1SIZA 1FT8A 2UXCF 4I67A 5J2HA 4LZGA 4KFBB 3CE8A 4DTJA 3MM9A 3DOMB 5C7PA 4B1XB 1NGEA 3AU6A 4OHZA 2PEHA 3TFRA 4LQ3A 3UD4P 4J8FA 1IBLK 3N5FA 1Y9OA 4BCAA 3C14A 4ES1A 7ICKA 1OYEA 3K75D 4AL6A 3SZ2A 2GVZB 3CCRS 4OX9F 3OTDA 4FJGA 1YHQN 1KN6A 5LSRA 5L46A 4ED5A 1ZQMA 4CF0A 3MM7A 2P5VA 3PNIA 5LJVA 1WC5A 4ZVUB 3H8MA 2E66A 5HMZA 1SJ1A 3BKFA 3JSMB 1ZQQA 3O0FA 5CAAA 2GMHA 1YAGA 3U02A 2K1RB 3DV9A 3BO4A 2HFZA 4DR7J 3AT1B 3OL7A 1XNRJ 1RHRB 2EWSA 4BRPA 2JLGA 4WFBL 3L8BA 2SXLA 4AL7A 2K06A 3AAWB 2PC6A 5AK5A 1JLCA 2ITMA 1CRXA 4OD0A 2O8BB 1X4DA 4YOYA 2WVBA 3CFOA 4H0VB 3NWRA 2FJWA 2XMTA 3H98A 3AVKA 1CQNA 5DQHA 3POTB 5J2PB 1JXLA 3ZZPA 3O3FA 2LKZA 3SUOA 2MSSA 4UOCA 1NOZA 4NWIA 2BJDA 5DG9A 3HRDD 4Y2XA 5IC6B 5KT4A 2VOPA 4DTSA 2DF4B 4I64A 4DV3J 3HRGA 2XHWA 1LWEA 3VV2B 2WTFA 4NLOA 4WQ5A 1U6FA 3DI6A 3G9CA 2G8UA 1WHVA 3RWUA 4MF8A 4Y2VA 1XEZA 3MD1A 4FP9A 2KW4A 2H3VA 3GU0A 1A6LA 3QLHA 3U7JA 1VQ5N 9ICXA 4IG0A 4BRMA 3OW2R 3ISNC 1WWUA 3O6WA 1TZ0A 4F5PA 2LBOA 3RR8A 4JLHA 4DX7A 2P9SB 1YTYA 3KD5E 2R8HA 4OJ1A 1FDDA 2A3JA 4NA2A 3HHLC 3UKRB 4BDYA 2XSFA 3QYPA 2CAJA 3OYIA 1ZD3A 2QRRA 1TL7B 2PXIA 2HQGA 2V4JA 1ZD2P 1HNWK 4DR7F 3ZSZA 2R8KA 1ZQYA 5D3GB 4O5KA 1DT9A 2YY3A 1H2UX 4JKBA 3PFOA 4FJ9A 4C23A 3EXCX 3GONA 4RQ6A 4FFDA 3G6ES 4HHHA 1D9DA 2IPOB 4J9UE 4NA3A 1QZ5A 3UXOA 3AY0A 5EY4A 3H8JA 2YTUA 2FDNA 1QSLA 2OGUA 1AFJA 1Q78A 3R5JB 2ZE2A 1ZQDA 4BR5A