1L3UA

Crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3uA01
3TANA 3VQ6A 4C8KA 1U48A 5KT4A 3K58A 4R65A 1JMSA 8ICNA 2W9BA 1RDAA 3HXMA 3DOKA 4B9MA 2XY8A 1BI4B 2P1JA 4LSLA 1BPDA 5BOMA 4NLGA 2WOMA 4NLNA 3O3GA 3C5GA 3H40A 1C1BA 3V6HA 3CFOA 2VWJA 2RKIA 5FDLA 3AO5A 4OLBA 4BDZA 4GXKA 1KFDA 1SL0A 4O3SA 3LZJA 3AU6A 4CFBA 3OHBA 4K4IA 5L1JA 5J0QA 1QSLA 2G8UA 4DTPA 2Z1IA 4ECUA 5KFBA 1NK0A 3HVTA 2AQ0A 5C5JA 4KPYA 3IM1A 5J2NA 3OYJA 2YNGA 3N4MB 2HB5A 4YR2A 1JLFA 3RRGA 2I1QA 4DFKA 3QEAZ 1REVA 3VQQA 2OYQA 2KW4A 4QWEA 4QW8A 1VSLA 3CG7A 4E0DA 4YR0A 4O3RA 1ZJMA 2HNYA 1ZQZA 3SV4A 3U6FA 1TK0A 4Q45A 4QZDA 2BPFA 3PMNA 4G1QA 4B08A 3PX4A 5KI6A 2HHXA 4DSLA 3RJHA 1BIUA 3V6JA 1ZQSA 4RG8A 4Y1CA 1A5XA 1TAUA 3VN5A 4NM1A 3M8RA 9ICGA 3CQ8A 2Z1HA 4IQVA 4FZYA 1CLQA 3OYFA 1WCLA 1X1PA 4CIFA 3SPYA 4CHOA 4HCBA 2X78A 2G8FA 1NK6A 1BCOA 1IM4A 3RMDA 3TR8A 4BDYA 4R66A 3K5NA 1KSPA 1RBRA 3MAQA 3B0YA 1IKVA 4CEBA 3PUFA 3UPQA 1NJXA 3L8BA 4FJIA 3DRPA 3SI8A 3TAPA 5FROA 9ICQA 2JEGA 5DDMA 1L5UA 1RT4A 1LV5A 3OGUA 3NH0A 4QZGA 8ICSA 4FJJA 4FJHA 2KZMA 1BPBA 2I9GA 4PGYA 4YD2A 8ICEA 4F50A 3JPSA 1VSJA 3KLIA 5JUMA 3JPOA 4EYHB 2KFNA 1LW2A 4M3YA 1MSWD 4M3TA 4E1MA 1ZQVA 5DLFA 3CYMA 1KRPA 4KLDA 4IQUA 3PO4A 1VSKA 4DTMA 3QEVA 1RYRA 1ASWA 2R8GA 3OS1A 1S0MA 2KFZA 4Z4IA 4EEYA 1X9WA 5DB6A 4K4HA 1B43A 3C1YA 1ZQKA 3K5OA 1IKWA 1T03A 3G10A 5KFKA 1JKHA 4IG0A 4Z0UA 3AVHA 4DFPA 8ICAA 5CZ1A 1ZQJA 3V81A 4IRDA 1Z26A 3E01A 5J2IA 3RJGA 2C28A 4LY7A 1YTUA 8ICJA 4JLHA 2BGWA 4KI6A 3LAKA 1DLOA 4JV1A 1S6PA 1XU4A 2GBZA 4FXDA 3L3VA 1GOBA 5CZ2A 1N6QA 2FMQA 4M0AA 5L1IA 4DL2A 3LDSA 3AVKA 4O5CA 4ZTJA 4GMJB 3PW5A 1HJPA 4QZFA 3NGZA 4I2IA 3VQ4A 4CGJA 5HRSA 4YFKA 1RBSA 4EBCA 4Z6EA 4BXOA 4IRCA 5KFNA 4LZGA 4BWJA 2DFFA 4NCAA 4YD1A 2YKNA 3M8PA 2F8TA 3MBYA 4B9NA 4RQ3A 4I28A 5KT2A 4DL7A 4RUCA 3TI0A 1BISA 1JL2A 4CGIA 2XY6A 3S3NA 4F4WA 1TVAA 4DMNA 1L3UA 4UB3A 4DQRA 4RT2A 1H38A 1MC8A 7ICFA 3AA4A 2GUIA 2XY7A 4CGGA 2NRZA 3ALYA 3UXOA 2DPJA 2KZZA 2DFLA 4KB1A 1KTQA 4M2YA 3NF9A 4HYKA 4EYIB 1UT5A 4L8RB 4YVZA 2Z1GA 4JV0A 2BCSA 4RQ5A 5KTQA 4EBDA 5HROA 3PR5B 4JUZA 4TSXA 1S1VA 3MXIA 3QZ8A 1NKCA 5SZTA 2W9AA 2PYJA 7ICNA 1XI1A 3K75D 4CJLA 1KVBA 1UT8A 3OS0A 5KG6A 3PW0A 1D8YA 4OVLA 1CZBA 2ISPA 4DO9A 3VQDA 1L3VA 5CB1A 1JXLA 1TKXA 1DOQA 3ISNC 4R5PA 4Q8FA 4CHZA 3DMJA 3DLBA 1C0MA 5J0YA 4UB5A 3OYBA 3IAYA 3KK2A 4LZDA 4DU1A 1B92A 1QTMA 4KTZA 1TL3A 2BANA 4NM2A 3G6XA 1HQEA 3MXJA 3KHGA 4F91B 2RF2A 4DSIA 4Q43A 1ZBLA 3JPQA 4DOCA 4KHUA 3OYDA 3AVNA 1XSLA 4M47A 1XWLA 3DRSA 4XQ8A 3K4GA 3WNGA 3HW8A 3JYTA 5FRMA 4KREA 3PV8A 7ICOA 4RZRA 1XSNA 4CEQA 2D5RA 5KFWA 4OPKA 1C1CA 5KG7A 4EP5A 1ZQNA 2DTUA 5KFTA 5DQGA 4YQWA 3OY9A 3SPZA 4E19A 3V1OA 4JS5A 4O5EA 3SQ1A 4QZAA 2R8HA 1S9GA 4ECQA 5DQIA 5DG7A 3KIOA 5J2AA 3C6TA 4IQWA 4QZEA 2RN2A 4O44A 3GV7B 3MEGA 3PY8A 3KK1A 4ICLA 2ZTDA 2ASLA 3ZT0A 1HNVA 3M9NB 4YNQA 2ZJ8A 3AO3A 2MUTA 4HUFA 4M41A 4M9JA 4O0IA 4CK1A 1VSFA 3GIKA 3OS2A 4MFFA 8ICBA 4CGDA 1VSIA 4DU4A 3M8QA 4XIUA 3ZSWA 1HJRA 1GOAA 3JPRA 1XO1A 5KFAA 5EWEA 4R64A 2W42A 4ID1A 1JXEA 8ICIA 4Q5VA 4BE0A 4KHQA 4CJVA 4OGCA 3VQBA 3SZ2A 3MGHA 8ICZA 1HNIA 3BQTA 3I0SA 2V4QA 1GOCA 2HMIA 3QETA 2FLNA 3C5FA 4DTRA 4RNMA 3SNNA 3DLEA 4I27A 1C6VA 1EETA 1BCMA 1RT6A 4IBNA 1T7PA 1ZQAA 3K2PA 4RQ2A 3H4BA 3LALA 3T5JA 4P4MA 4JRPA 5J2JA 2W9BB 2PXIA 3GV8B 2OPRA 5KG1A 2IHMA 3F9KA 1LB2B 1S1UA 4RQ1A 1SKRA 4DTUA 3AVJA 2OZMA 3KD1E 1N56A 5D49A 4MEYA 4ZTFA 3M9OB 5KFSA 1J53A 2J6UA 3O4NA 4TURA 4F5RA 3MFHA 2BGGA 4F2SA 2G8IA 4DG1A 3MFIA 4I2FA 1T05A 2NRWA 3QZ7A 1TVRA 2FMPA 3SQ2A 1COOA 4M3RA 3V6DA 1LWFA 4Q0BA 4CJWA 3TAGA 4QAGA 3LK9A 7ICEA 5DBCA 3GIIA 4F5NA 1NK7A 3C94A 3QIPA 4N56A 5KGXA 4FLUA 3ZD9A 3G0ZA 4CJPA 3RJKA 4PWDA 3AO4A 3OHAA 3MDCA 1T3NA 5DB8A 4KFBA 3ZSVA 3OYEA 1JXBA 3KLEA 1MQ2A 5EOZA 4GVMA 4PH5A 2Y1IA 1RPLA 4CJ3A 2A1SA 1BPXA 1KLNA 4W5TA 3BJYA 5BOLA 5KT3A 3LPUA 4IDKA 1VSMA 1ZBFA 1JLBA 2FBVA 1ZQEA 1VSEA 4KMUA 3RJEA 4EZ9A 7ICIA 1RCHA 5J0UA 2A1RA 4DOAA 1Z00A 4HTUA 4FK4A 3FDSA 5CYMA 4HUEA 2VA3A 3KHHA 5KFOA 5KG5A 1C0UA 1WSJA 4FJ5A 4I2JA 2X74A 2E4LA 3T3FA 4OPJA 4K8ZA 5CR0A 1U04A 1RNHA 8ICWA 4ED0A 3H08A 5KFHA 3VA0A 4QOZB 1RXWA 2YV0X 7ICMA 9ICSA 4IR9A 5HRNA 2ZQBA 2FC0A 1QSSA 9ICNA 3CM6A 4B8CA 5C25A 3HJFA 2BQUA 1HMVA 4BWMA 4Q44A 3MR6A 3TAEA 2GV9A 1TKTA 4FM2A 2GWSA 4F5OA 4DL4A 3NF8A 4CHPA 4J9RA 5HHHA 2HHTA 1TKZA 9ICPA 5IIKA 5KFEA 5J29A 4OGEA 4F5QA 5D46A 1C7YA 3SYZA 4LD0A 3OYMA 3QINA 3GQCA 8ICHA 1X2IA 4DF4A 4RQ0A 5DG9A 3M9MB 9ICEA 2QK9A 1NJYA 2ETJA 9ICIA 1T8EA 1BQNA 3S9HA 7ICLA 4NLKA 4OKJA 5HHIA 4BACA 4B9TA 5KFVA 3HPOA 5DGBA 5DBBA 4FW1A 4E3SA 2KTQA 3HO1A 4KLGA 2X6NA 3K5LA 5CHGA 4IR1A 1J9AA 3ZT1A 5SWMA 3OVNA 3B6PA 3PX0A 1QSYA 4J9QA 1KFSA 4B3OA 4RW9A 3Q8SB 8ICVA 2D0AA 3RAXA 1BHLA 8ICXA 4UAYA 3GIJA 3DYAA 1RDDA 2JLEA 2UVUA 3S3MA 4CEAA 1YTAA 2ZE2A 2FBYA 4J9OA 4ECYA 3RB3A 4UBCA 2ZJAA 4ECXA 1ITGA 4DTJA 4RU9A 1S97A 4GXJA 5KG2A 4C8MA 1U49A 1LWCA 5J0RA 3QNOA 1RTHA 4KLTA 3ZT2A 3GDXA 1NKEA 1KEJA 2HNZA 2RDJA 3NF6A 4W5QA 4MFAA 4C8LA 1IXRA 5J0XA 3JPNA 4BXOB 2F8SA 1JLCA 2C2EA 4KKOA 1TKDA 5KFRA 4FLTA 2XGQA 7ICKA 3OYAA 4IRKA 1EXNA 2C2RA 4O0JA 2HHWA 1RT5A 1SL1A 4B8AB 1RYSA 1HUOA 2NRTA 1VSDA 4FCYA 4PGXA 1QLNA 4KLOA 4CJRA 2W9MA 1D9DA 4M42A 5J2EA 2O4GA 1F21A 1WLJA 2W8LA 4E89A 2OPPA 4FW2A 1WN7A 3ZT3A 8ICCA 4F4KA 1KLMA 1CXUA 2FPMA 5KRTA 1C1AA 3VQAA 3TWHA 8ICGA 3EW9A 9ICLA 4CECA 1KVAA 5J2KA 4H4OA 2G8KA 3V72A 5DQHA 4JWNA 3QEXA 4LVSA 5DB9A 4X5VA 3AU2A 5BPCA 4M9LA 1IO2A 4NLZA 5J0TA 3Q8RB 2P66A 4FJ9A 3DLHA 1YVUA 2OA8A 2PFOA 4DSKA 4IFYA 5L9XA 4RQ4A 2BE2A 2IA6A 2PFQA 1S6QA 3ETLA 2ISOA 3RMAA 3RTVA 4LH4A 2AJQA 3L2RA 1ZQDA 3LAMA 1A5VA 4M6WA 1FKPA 5DGAA 1NJWA 1SKWA 3V4IA 4ED2A 3LWLA 3V9UA 3AVCA 3SUPA 4ED8A 2P6RA 1X9MA 1S1XA 4I9LA 5KFYA 3BQ1A 4MFCA 4QWAA 4E7HA 4NYFA 1SV5A 5KRSA 1HYVA 3KKRA 5J2MA 1N48A 4J9PA 1U4BA 4TUPA 2VG6A 4FJMA 2HW3A 5KT5A 5DG8A 5J2HA 2AU0A 4FLZA 3TFRA 3MXMA 4J9NA 4FLYA 4RQ8A 3THVA 3SCXA 5KFXA 4F92B 3ZDBA 1CUKA 5J0OA 1HUZA 2BQ3A 3OYIA 4OKEA 5HBMA 5L1KA 4DF8A 1ZQLA 4CHYA 1S1WA 3NF7A 4OKKA 5DKWA 4FLWA 4Z4HA 1RBVA 7ICHA 4TUSA 1NOMA 2RDIA 3KTQA 4KI4A 5DBAA 4PY5A 3OYLA 7ICRA 3SI6A 1RZTA 5K14A 1ZQBA 3RMCA 4KHNA 3EPIA 4ELTA 1VK0A 3TAFA 5C24A 4KRFA 1BPYA 4IQTA 3T1AA 7ICPA 5CY4A 4DSJA 4RW7A 5KFGA 2MUTB 4CEFA 1ZQQA 3KHRA 4QZIA 3V9SA 4RT3A 3LP2A 1ZJNA 3HM9A 3AO2A 4Z4EA 4CEEA 3S3OA 1BPZA 1D9FA 3ZSOA 9ICCA 2UVRA 3KD5E 3MABA 5HRRA 4FM1A 3PX6A 3DLKA 3ISBA 4GC6A 3AA2A 4K8XA 4KV8A 2A1JB 4KLQA 3PW2A 4O5KA 4ZHRA 1MU2A 4M45A 3UQ0A 3Q8KA 1WAJA 1ZBHA 2YHAA 4JK1A 2Z1JA 3HL8A 3OYKA 3VQ5A 9ICTA 1I39A 2BPCA 3QLHA 5KG4A 4KHYA 4FJKA 1RXVA 3C21A 2ZUDA 3TARA 2PY5A 3RMBA 1U9LA 3SJJA 4RQ7A 5J0SA 2PFPA 3D0PA 1TAQA 3AV9A 5EU7A 2HHSA 5CA7A 3FFIA 4FJ8A 3AUOA 4RPYA 4CJ5A 1LAVA 2V4RA 3Q8LA 1Q9XA 4Z4GA 4O3NA 1XC9A 3DI6A 3TAMA 2HHUA 4RNOA 4I2PA 4J2AA 3RAQA 2O4IA 2B21A 3DOLA 3NGIA 3HVRA 5CJ7A 1BPEA 3G6YA 1AROP 4CFCA 4FJXA 4W5NA 2E6LA 1TK8A 4XUSA 1VRUA 2ITGA 4PQUA 4JRQA 3WNHA 4GLXA 1CEZA 8ICRA 1S0VA 1A76A 3F73A 3RJFA 2H5XA 5J1EA 2KN7A 4I2BA 4N76A 3AVBA 4CJ4A 1WAFA 2DY4A 4F4ZA 4FVMA 4HHTA 5KFPA 4Z4CA 8ICPA 9ICVA 4CEOA 2BCQA 4GC7A 1Q8IA 2YKMA 3LPTA 4QZ9A 7ICGA 2AGOA 4CEZA 3GILA 4KLLA 2F96A 8ICYA 2QKKA 4CJTA 4ECVA 9ICAA 4F93B 4PGQA 4KLMA 3AA3A 2ZUBA 4FS2A 4DQIA 2NUBA 1VSHA 3ZSZA 4CF9A 3HT3A 2A1JA 3LZIA 4J9MA 3RRHA 3P1GA 3U3YA 1KVCA 1RT2A 3C2KA 3MEDA 1QE1A 1WSEA 4RUAA 3RWUA 2WTFA 3DRRA 4RPXA 4PHEA 1Z00B 4DL6A 4ED3A 2AGQA 3I0RA 4PPXA 2IC3A 4F3TA 2XO7A 5DK5A 2XGPA 2E6MA 1JLEA 3QESA 1ZQFA 1LWEA 2OPSA 3KLGA 5J0PA 1EXQA 5C42A 3PO5A 4FBUA 5IIIA 4KLEA 1ZQXA 2VG7A 1NK8A 3HK2A 5T7BA 4RW6A 3O3HA 1WSGA 4FJ7A 4KO0A 4DQQA 7ICJA 2OWOA 4EP4A 4W5RA 3L3UA 3B6OA 3TAQA 4I2EA 4KB0A 3HPGA 4DEZA 4K4GA 2X6SA 1ZBUA 3OYCA 2ATQA 3QERA 4UQGA 8ICKA 4HUGA 4I7FA 8ICTA 3AVIA 4CFDA 1BQMA 4I2CA 3RR7A 4ECTA 1CXQA 5F9LA 2R8IA 1FKOA 4CERA 4E7KA 5KFQA 1ASVA 2JEJA 4AHTA 3H8SA 1UA0A 4I9QA 3TFSA 1KDHA 8ICLA 4I2GA 3KLHA 2R7YA 1N5YA 5HLFA 5L1LA 2W9CA 7ICSA 2AQ4A 3NBPA 4M9HA 2DFEA 1WSHA 4CJQA 1IKYA 1YT3A 4E1NA 3V6KA 2ALZA 3AA5X 3V7KA 4IG3A 3V1RA 4R8UA 3L2VA 4DTNA 4UB4A 2NRXA 4P2HA 3P83D 1RDBA 2P51A 2M9NA 8ICOA 3AVGA 1DGSA 1RDCA 3PMLA 1XHZA 2IAJA 5KFLA 3ZD8A 3CFRA 2YHBA 2EHGA 2BDPA 1TK5A 2LYHA 5F9NA 1TV6A 2XHBA 3BDPA 4RW8A 2F1HA 1S77D 4CIEA 1SUQA 5HMLA 2FLLA 1UOCA 4QZBA 4ID5A 2MAXA 4J2DA 4CF0A 4M3XA 1ZQOA 4DTXA 5J0WA 4QWCA 5HMMA 1A5WA 4F2RA 2QXFA 4TUQA 4KTQA 4J9LA 4UB2A 3OYHA 4B9SA 5HRPA 3RH5A 3HWTA 4CGHA 4ELVA 4YXJA 2V9WA 1Y88A 4M3WA 4XA5A 4QZHA 4FYDA 1NK4A 4CE9A 4YMNA 1EKEA 4KN7A 1NJZA 1XHXA 1ZQIA 3UIQA 3O4QA 3PNCA 4FJGA 3LWMA 3IRXA 2VG5A 3NTUA 3BQ0A 3ULDA 2KQ2A 1A77A 2G8VA 3C2LA 3QO9A 4EBEA 2DPIA 2IS3A 3O3FA 1IG9A 4M04A 4KLIA 2R8KA 2IDOA 3NH1A 4KITB 2BCVA 3CM5A 1WSIA 4UAZA 4DU3A 3TQ1A 4NXZA 4E7IA 1RILA 4DTOA 2DFHA 3MR5A 3NDKA 4KLSA 3FYHA 4FJNA 4CK2A 4YP3A 3AVAA 4DSEA 2FBXA 4TQRA 4QCLA 2JZBA 4DQSA 4B9VA 2FMSA 3ZT4A 2F1JA 2KZ3A 2ASJA 3HSTB 1HQUA 4AHCA 1KFTA 3V9ZA 2FBTA 3OSNA 3NFAA 4O4GA 1ZQUA 3JSMA 2Q3SA 1Z25A 4LH5A 1NOZA 7ICQA 4DWIA 3LP1A 4CK3A 9ICFA 2I5JA 4DFJA 3A2FA 1D5AA 1TGOA 4Y1DA 1L3TA 1ASUA 1W0HA 5KFCA 3H8JA 3VQPA 1MQ3A 1S0OA 4LSNA 4AHRA 5KFDA 3SV3A 3RB6A 4O3OA 1HRHA 4M6WB 4FK2A 1WSFA 3NHGA 3SUOA 1NK9A 1ZQMA 4B9UA 4MEXA 1JLAA 3C2MA 4P4PA 3E2EA 3CFPA 5J2QA 3QE9Y 2JEIA 4O55A 3K59A 1S10A 4DLGA 2BCUA 4GXIA 5KFZA 1BI4A 4E7LA 4O3QA 5IIMA 1RTJA 3PW4A 4CEDA 3MR2A 2VA8A 3L2UA 1DTQA 1W9HA 7ICTA 4M3ZA 1JLQA 2VANA 4P4OA 1ZQGA 2XRIA 1NKBA 4UBBA 4O3PA 3Q8QB 4FO6A 1K6YA 4N5SA 2B5JA 4TQSA 2PFNA 4NCBA 4NY8A 2HHVA 4F5PA 2BKEA 4YMOA 4R63A 3T5LA 5IIOA 3T19A 5JS1A 1S9FA 1JX4A 4KHSA 3RB4A 5DLGA 2XCPA 1K1QA 3RH4A 3IS9A 2IGIA 1HPZA 4W5OA 4IFVA 3WNEA 3P5JA 1D8LA 2WONA 3C95A 3ISCA 4YCXA 4KLJA 9ICUA 2RPIA 4DSFA 1Z3EB 3HP9A 5DMRA 1ZBIA 8ICFA 1WNSA 4KLFA 3ZSQA 4O9MA 2J6SA 4DTSA 2C22A 5CWRA 4PHAA 1VRTA 5IINA 4DS4A 3OJSA 1Q9YA 3C6UA 1X9SA 2OPQA 4M3UA 4ED1A 4JS4A 1ZYQA 1SZPA 4ED7A 3RBEA 3VQ7A 5IIJA 1I3AA 4PUOA 5E41A 3GV5B 1XS9D 4FK0A 4KTWA 3ASMA 4Z6DA 1ZQYA 1JN3A 3KJVA 4AHUA 3L2WA 3V7LA 2UVWA 2UVVA 3AVFA 5J2FA 4ECSA 1NOYA 2HHQA 3AO1A 3HP6A 5D4BA 1B9DA 4KAZA 3EYZA 2YNFA 2ATLA 3RBDA 4F4YA 1UA1A 1S9EA 1TV9A 1L3SA 3EY1A 3K57A 2Y1JA 5HP4A 4RPZA 4ECWA 1XSPA 4J9KA 4CJKA 4AH9A 4AILC 1RT7A 3LP3A 2OZSA 3QIOA 4JV2A 4CF8A 1RBUA 4FM0A 1S5JA 2AGPA 1B9FA 4Z6CA 3UQ2A 4BGDA 4HCCA 5KFJA 2BHNA 1JLGA 2ZJ5A 5J2PA 4MF8A 3PR4A 2BCRA 4CCHA 4CF2A 4Z6FA 1NK5A 4OJRA 1ZQPA 4MF2A 4FLVA 2PI4A 1KCFA 4CESA 5D3GA 3IHQB 4QWDA 4DQPA 5KT6A 2IBKA 9ICOA 3JPTA 3H4DA 3VQ8A 2QKBA 1BVSA 2XC9A 3SUQA 2XCAA 3SUNA 3LANA 2HVIA 3C23A 3MGIA 4CGFA 3RJJA 1LW0A 2FPLA 2JGUA 3GIMA 4CF1A 4I2QA 3NGYA 4N41A 2HVHA 4FZXC 3GFKB 2D0BA 4I2AA 5I3UA 3T5HA 4MFBA 3MDAA 3HPHA 2BPGA 3QNNA 5J2CA 2PZSA 4KHWA 3DLGA 4C8OA 5KG0A 3T5KA 1UWBA 3KLFA 2G8HA 1ZQWA 3VA3A 4YN4A 4PHPA 1RT3A 1UAXA 3DM2A 1JL1A 4RNNA 4I29A 4N47A 1BGXT 3MECA 8ICQA 5CP2A 4OLAA 4Z4FA 1U47A 3ZDDA 4DOBA 2IHNA 3V9WA 2F1IA 3AVLA 3EZ5A 4I2HA 1O1WA 4F4XA 9ICWA 3Q8MA 4YG2A 3ITHA 1FXXA 4NYNA 3H8WA 4QZ8A 4RW4A 2NRVA 2W8KA 4DL3A 3LP0A 1CZ9A 4FJLA 4YFUA 8ICUA 2JEFA 4QW9A 5I42A 4FS1A 3MR3A 3OJUA 4RQ6A 2PYLA 9ICXA 9ICRA 3C1ZA 9ICBA 1K1SA 4YXMA 3G6VA 1QHTA 3SQ0A 5TZVA 2Q0ZX 1ZQHA 2YNIA 1LAWA 1R0AA 4DLEA 3OYNA 5J2GA 2LSNA 4I2DA 4AHVA 4PHDA 3V9XA 3ZDEA 2W9CB 2J6TA 1RTIA 4FLXA 2ZTCA 3NH2A 4MQ3A 1J5OA 1DTTA 1V9PA 4BE2A 4O5BA 1J54A 4BE1A 4KN4A 8ICMA 2P5GA 4PA1A 4R8UB 4XRHA 5KFIA 9ICMA 4CJUA 1S1TA 4CHQA 3HYFA 1T4GA 4ED6A 4M9NA 4AHSA 4CJFA 3TABA 1PZNA 3JPPA 3VQ9A 4KLHA 3OSPA 9ICHA 3NCIA 1RBTA 3KK3A 3K5MA 4FBTA 4B9LA 3IG1A 3V1QA 1Y97A 5DDYA 4QZCA 4JWMA 3I8DA 2YNHA 4YR3A 2B6AA 1U45A 3MEEA 4CJSA 5KG3A 4UAWA 2BQRA 3PW7A 5KGWA 2B4JA 4Q8EA 3D45A 4H4MA 4WE1A 3L2QA 2BR0A 3VQCA 3U3GA 3M8SA 3QEWA 4ELUA 3NAEA 2ZD1A 4FZZA 3NGDA 3ZCMA 1ZQTA 4J2BA 3PVXA 1HYZA 3Q8PB 1WCNA 1G15A 2EX3A 9ICKA 3DLRA 1FK9A 2VA2A 9ICJA 1IKXA 3ZDCA 1BL3A 4UB1A 4CFAA 4YMMA 1EP4A 1TFRA 5KT7A 3VQEA 4J2EA 3LDAA 1TL1A 3EWAA 1SL2A 5CYQA 5J2DA 3RH6A 3H7IA 2ASDA 1B22A 3N97B 1S0NA 1IH7A 1HYSA 5HNKA 4ECRA 3ISDA 2G8WA 4H8KA 2C2DA 4QWBA 7ICUA 5IILA 2VWKA 3QEBZ 4M9GA 5EWGA 4G3IA 4CJEA 3AVMA 3HX0A 1S76D 4BDPA 3ZDAA 1QS4A 2PI5A 3SQ4A 4ECZA 1BIZA 5KFFA 5J2BA 3KKSA 1C0TA 3KHLA 2IMWP 4J9SA 1SKSA 7ICVA 3QEPA 3RR8A 2FLPA 4IKFA 3ZSYA 3QEIA 4NCGA 5JS2A 2JZBB 3RJIA 3ZSXA 2P5OA 5KFMA 3RB0A 4KLUA 1ZQRA 5EWFA 5KFUA 4HVJA 3B0XA 3ZSRA 3ORYA 2IOCA 3WNFA 1RTDA 2ZUCA 3BQ2A 1ZETA 2FPKA 1RT1A 4CHNA 3V7JA 4DL5A 1EX4A 5DB7A 4CIGA 4E7JA 3EPGA 2XY5A 3UXNA 2D0CA 5FRNA 3BGRA 4GW6A 4DS5A 2P6UA 3UXPA 2ZTEA 4EZ6A 4C8NA 1JIHA 3OYGA 1QQCA 4F3OA 4F8RA 2HNDA 3NE6A 4DFMA 2R8JA 4ZH4A 5HP1A 1ZQCA
chains in the Genus database with same CATH superfamily
1N33J 3TANA 4NJ8A 2VDHA 4DFDA 1URNA 4C8KA 4NLUA 4LRAA 1PJ5A 5J2QB 4FVUA 3CRXA 1F3VA 3CCLN 3QGPA 2XMWA 4PPDA 4ZVEA 2W9BA 2XY8A 1BI4B 4WJBA 2B4PA 4M5DB 2P1JA 4Y2UA 4DPTA 1VQNN 1M1KO 2WF5A 4L75A 1BPDA 2YCHA 1ZTTA 5BOMA 4NLGA 3O3GA 3C5GA 1DTQB 3H40A 3LDLA 5FDLA 4FF2A 1H73A 1FRLA 3OXLA 3AH6A 4J91A 3CMAN 4GXKA 4RO0A 4WP9A 3OHBA 3EWGA 5L9NA 1J97A 3CDWA 4DTPA 2Z1IA 1VQ5N 4ECUA 1VIXA 1GQEA 2W25A 3EM1A 2V5HG 4DR3J 4LBHA 2ZHBA 3FEXB 4LF9K 2FGCA 4OMFG 5HN0A 2LU2A 4Y28C 3OYJA 1R89A 4ZLPA 3N4MB 2HB5A 3RRGA 2I1QA 1REVA 3VQQA 4AF1A 2JC1A 2P9PB 3CD6N 2FUG9 4K50A 4IFVB 4TLRA 3S6JA 4QR2A 4QW8A 2WONB 2WVBA 4YR0A 1IIPA 3M6KA 4JYAF 2JV3A 3EICA 2HNYA 3U6FA 1GK8A 2IVPA 1NGBA 4BY9C 2HHHJ 4ZPWR 4JK7A 4RU2A 4WJ3B 2DJWA 3ONQA 4EK2A 2HF3A 4AYBF 1ZQSA 4CLTA 4K5SA 3B8HA 2OPQB 3SAFA 8ATCB 4NM1A 1VAZA 3PM9A 3QT7A 4OX9K 2D6FC 4FZYA 1CLQA 3HM8A 4CHOA 3M8YA 2FSJA 1ATSA 1X40A 1BCOA 5G4DA 1IM4A 3QIDA 3KJVB 1HI8A 1UW4A 3TUZC 5AQIA 1VQKN 1RBRA 3WKEA 4FDFA 3B0YA 1Q8LA 1RU2A 4WK1A 3PUFA 2YNFB 1NJXA 2HSTA 3MGVA 1VC5A 3DRPA 3TAPA 2Z56B 3WKCA 5FROA 3WC2A 2YHWA 3QFPA 2AJ0A 3H7HB 2W40A 1RT4A 4FJJA 2J0QD 5H1SV 4DR7K 1NMNA 1Q18A 1NUEA 2VIXA 5EN1A 3TEGA 3JPSA 5LXYA 2MTLA 3WXIA 1X5TA 5JUMA 4I56A 3QBWA 2KFNA 4LRDA 4M3TA 4E1MA 4NRTA 4DCCA 5DLFA 3IR6B 1OH6A 3EJMA 2FJ6A 2MY8A 5J2PB 2AKWB 3IC1A 1AXQA 3EUB2 1WEZA 1JALA 4DTMA 4X64J 3QEVA 1RYRA 1ASWA 1E4FT 4CRXA 3ZX0A 2XHCA 3OS1A 2E8AA 3LVVA 5L1MA 1PK1A 2KEYA 1JKHA 4IG0A 4NLRA 2BABA 3VAHA 3V81A 4QS9A 4XTTA 3GOIA 4HH1A 5J2IA 5JICA 2QYCA 2YI1A 1I94F 4I2QB 3AAWB 2KHDA 1Z2LA 2BGWA 2H9ZA 2G1DA 2ZJQL 4FXDA 4JV1A 4PPZA 1N6QA 1O08A 2PMHA 1I94J 2F9TA 5AR0A 2R7VA 3LDSA 1VQ9N 2WVDA 4DI6A 3PW5A 5AQPA 4HHHA 2C2NA 4I2IA 4CGJA 1RBSA 3H5UA 5AQTA 3B82A 3ILIA 3KHYA 4GVEA 4LRCA 4QJFB 3IR5B 2QA4G 2OSQA 4RW4B 4YD1A 4WXWA 2RQKA 4V1Ak 1CJUA 2F8TA 4WZQA 4RQ3A 4I28A 2DITA 5KT2A 4DL7A 4RUCA 2E7WA 5I42B 4CGIA 3K9KA 4FWPA 2P9NA 2E1YA 3Q8VA 4DMNA 1WBDA 2OXOA 3QUCA 3M6GA 3BS7A 2ZXHA 1H38A 1MC8A 3AA4A 1ZZNA 2DO0A 2NRZA 3TUJC 3D7EO 4P72A 4HYKA 3PTWA 1HPMA 1FTCA 1FD2A 2AJFE 2HIQA 4RQ5A 4L6V3 2KXHA 3IM8A 3X1LB 4DV6K 1J5OB 2FDRA 4H5TA 2W9AA 2EFVA 2ZIWB 2E9ZA 3TO8A 4H5NA 4Y2JA 2P9LB 1D8YA 3HCXA 1HBNB 3WXJA 1D09B 2V4JB 1CZBA 2KHVA 2EFPA 5ALKA 2H3ZA 3FUYA 4JBCA 4W4MA 2VQFK 4KPCA 1TKXA 2JVOA 4JOUA 3IG1B 3KUEA 4CHZA 3H25A 3KK7A 3SEIA 2YJFA 1EHWA 4QIWD 1B92A 4RPFA 1QTMA 3A13A 4H4MB 3CC2N 2BJ8A 3AXKA 4QS8A 3MXJA 4P6QA 3BR9A 4F91B 1V5VA 2W3RA 4F71A 2IM3A 2RE2A 3ETMA 2M88A 3NNAA 4DOCA 3OYDA 2UU9F 4OV1A 3FSYA 1CULA 2B8PA 1XWLA 1IKXB 2G0CA 1KD1O 2QLTA 1SJQA 3JYTA 7ICOA 1XMQK 1V6HA 4DXLA 1EP4B 2CZ4A 3HKWA 2D5RA 3OA9A 4FWKA 2JJ4D 5KG7A 3E8OA 4DV7J 1Q5VA 2A2CA 2CQ1A 1VMBA 3AQFA 4BROA 3CMEN 3SPZA 2DGXA 4NZ0A 1U2FA 3V1OA 3OV7A 1UJ6A 4IC9A 3PJWA 3FM9A 1SZHA 3BY5A 3OHRA 4DV1J 4ECQA 2PO4A 3R1HA 2DNOA 5DG7A 3KIOA 1UVKA 4IQWA 3KK1A 3MEGA 5H9EJ 2AP1A 4ICLA 3QFWA 5HJXA 2ASLA 2V69A 2ZJ8A 3AO3A 2ZJRQ 2MUTA 3T1YJ 5EX3A 4CK1A 1VSFA 8ICBA 2VQEF 1COKA 3CJ7A 1QY7A 4ZVHA 1SB3C 3BZQA 1HHQA 1XJWB 3JPRA 1OPIA 1RT1B 3CW2C 4PG4A 3KOAA 1LCUA 4R64A 2W42A 8ICIA 1FD8A 3H20A 4CJVA 4OGCA 3BGRB 4OQJA 4ZITA 1T3OA 2E5LK 4WKYA 1KW4A 3BQTA 2AX1A 4J90A 5ALZA 3PDNA 4D3GA 3J7A1 4DTRA 3AODA 1KP6A 5AKHA 1TP7A 2IA0A 4YEAA 1NSPA 4Y34A 3WX4A 3QUBA 1DY3A 3H4BA 2AYMA 4K4XA 3LALA 1QDUB 2GVDA 4JRPA 5K9FA 1ZD3A 4DX6A 2UXDJ 1SKRA 4DTUA 4X4TA 5D49A 3M9OB 3SJHA 3HVWA 5HQ8A 3E51A 4M5MA 3SENA 2RKIB 3MPUB 2G8IA 3ET6B 1NHVA 4YDUA 1JROA 2NRWA 3SEOA 2FMPA 4ZVRB 4RWTA 2DO4A 2ZNZA 4L74A 2V52B 2RU3A 1IG8A 2BJDA 2DGSA 4JI3F 3TAGA 3DN9A 3IV6A 2CRLA 5DBCA 3GIIA 4F5NA 1NK7A 2MU2A 2DNQA 1WF1A 2H54B 2MZ1A 1WWUA 1V97A 1X4CA 3NMUA 4BLGA 4PWDA 4A5AA 1U2RA 2HVEA 3OYEA 4FVCA 3ATVA 4OYAA 4PH5A 1P1TA 2G09A 1Q53A 1KLNA 2X3DA 3NGRA 3P45B 3IDHA 2XMVA 3WKDA 3H0PA 4CTAB 2P9SB 4EZ9A 2F8HA 7ICIA 2H51B 5AQQA 2A1RA 3R1XA 5TISU 3F9MA 5KQDA 4MIBA 2GX8A 2BOAA 5CYMA 3EKUA 4P9SA 4LRBA 2RRDA 2ZWOA 1YHQS 2Y8YA 3QAEA 5KFOA 4WPAA 4JI1F 4U67Q 4ZCIA 4FJ5A 4GY2B 3EVOA 2FSNA 4X4QA 2P35A 3QNMA 2E4LA 3O8MA 3J7Z5 5LMNJ 3T1HF 3R8EA 2VKRA 1NMDA 4K8ZA 5CR0A 2F65A 3DDIA 2EZXA 1RNHA 4KGXB 1TU0B 2WSCC 3H08A 4ENOA 2JHDA 3SSSA 7ICMA 1FRMA 3OQ2A 3T9ZA 3CJTA 1QSSA 2H5JB 5C25A 1FEZA 1UVMA 1LXJA 2ASOA 4RJVA 1HMVA 4Q44A 5A0YA 1HA1A 3TAEA 2MB0B 4FM2A 4LF5J 4F5OA 1GNKA 1G6BA 3QJLA 2MZQA 3CJRA 3E9PA 3ZZYA 4RWWA 2C3UA 4NXNF 2HHTA 1TKZA 3W0LA 3TKAA 5DM6L 5IIKA 3SCKE 5J29A 5CD4A 3CCWA 1LQ9A 3U02A 2HRTA 3G71N 3LGNA 3P8BB 8ICHA 1OIAA 4IL6U 3VEYA 4DF4A 4RQ0A 4F0KA 9ICEA 4NXNJ 1FEHA 3MN9A 9ICIA 5HHIA 4LBPA 5K5MA 5KFVA 5DBBA 2CH6A 2DVIA 3A8YA 4HAIA 2ROGA 3G9CA 2QL7B 2MLXA 5CHGA 4IR1A 5CCLA 1J9AA 2DR6A 2EAPA 2F4FA 3CJKA 5A8RB 4UAYA 1V3ZA 1GMVA 1TL5A 1RDDA 3CJ4A 4BG8A 2V6AA 3O9SA 4LF7J 3RB3A 4Z7YA 2JFDA 4B3TK 1SH2A 1VCTA 2P9IA 1XK8A 4TU8A 2LECA 3UDCA 4ECXA 1KONA 3VGMA 3FGUA 3AB4B 4K7QA 3IUCA 2CXYA 4KGKA 2CNOB 3H42A 1AB8A 1NSKL 1FWLA 4JI8F 2MZTA 5IS2A 1LWCA 4MT1A 2KN4A 1FFSB 1EQMA 4HACB 1UCNA 3UKUB 2GZOA 2B9YA 1KEJA 3CXCM 4E1JA 1OYDA 4NWIA 4CLUA 3JPNA 4BXOB 5LJ5Y 3BB5A 3R7BB 4YMEA 4A5BA 1FE0A 1M1KT 2C2EA 1TKDA 3QICA 2WB1D 2OMOA 3DC2A 2YKNB 3M8PB 1JJCB 1TTHB 3OYAA 1WSRA 5HANA 3PIPQ 4J9UE 1EXNA 3OTCA 4Y2QA 4J7CA 4B8AB 3LA0A 2KVCA 4PGXA 1K9MO 2C1EB 3EGZA 4KLOA 2YMMA 2W9MA 4M5JA 2J8SA 4M42A 3FNNA 1F21A 1ZA2B 2W8LA 4K2XA 2OPPA 3QJJA 4FW2A 4XPCA 1WN7A 3DLLL 3RFAA 2P9UA 2H65B 5KRTA 1S1VB 2QB0B 4CECA 5J2KA 2WSEC 3VERA 2Z8QA 4P0PA 3M6ZA 5DB9A 2QXLA 2CWXA 3NGKA 1IO2A 2CQ0A 3DJCA 1JRPA 3N5BA 4KHPJ 4GVBA 1T9VA 3ETLA 2WAQD 4D3HA 1ROFA 5B0AA 1AQ6A 1FFWB 4LH4A 3SQIA 2AJQA 4X84A 1N34J 2LFVA 4R5PB 4G9BA 3CCVS 3KZXA 4MKBA 1SC4B 4M6WA 1QM9A 4PL7A 1SKWA 3UR3C 4LR8A 1NGFA 1N36J 2P6RA 3LW5C 2I2YA 1TL3B 2KKZA 4H4KA 1HQEB 4V19X 5KNIA 4OHWA 1N32J 2QLFB 3W62A 2E66A 1W97L 3KKRA 5F8HA 2GMHA 4TUPA 3RRKA 1JQGA 2NCKL 3Q2TC 2L9DA 5ALJA 5J2HA 3DRSB 3EDQB 3Q8UA 4DHVA 4FLYA 3ZC4A 3CC4N 3THVA 4EWTA 2K2PA 3N79A 3OTEA 1C1CB 1HUZA 1FCAA 1M0SA 2NXCA 4OKEA 5HBMA 5L1KA 4DF8A 2D69A 2IY5B 2VJUA 4CHYA 2QA1A 5CAAA 5EXWA 1Z4UA 1JJHA 3D6JA 1KEKA 1DK2A 1YJ9S 2HBKA 4R0JA 3CCRS 2RDIA 1S9GB 2ZH7A 1IBMK 1NGJA 2JL9A 4YOTA 4BC5A 3M2VA 5K14A 3RMCA 4ELTA 3BGLA 2Y9TA 3HSZA 4KRFA 3M30B 1JK9B 1HX1A 3L6QA 1HNVB 2DNGA 5KFGA 4K43A 4LJXA 2FJAB 4YHHK 4FYYB 2D41A 2QMWA 2P8IA 2JH7A 1BO5O 2GJ2A 2CG4A 3CETA 2ZUGA 3GCXP 3BSOA 2IIHA 1Q7YO 1D9FA 4C0BA 3ZSOA 3JQJA 5DM7L 3R7NB 1WUAA 3OLAA 4U7UK 4Y3CA 4CWBA 5IC6B 3V5RA 4FXVA 4KLQA 1HNIB 3F56A 3I0SB 4UOFA 2HMIB 3JAMU 4AXIA 1YAGA 1SAZA 3GZ7A 2YHAA 4AQYJ 4OYPA 4ZP7A 3MC1A 1I39A 4XH4A 3QLHA 2QARA 4FJKA 1RXVA 1WOSA 3LM2A 1VRQC 3SJJA 5E3AA 4KGZB 2HHSA 2ZJPQ 1C0FA 1LAVA 1Q9XA 2DGWA 3DI6A 3TAMA 2PE8A 4J2AA 2BBEA 2MSSA 4BRQA 2B21A 4WFAL 2Z30B 3CPWR 1ZAVA 4CF5A 5EVZA 2ZIVA 2V0NA 1UQVA 1Z1ZA 4DG1B 3EDRB 3VGSA 2B7CB 4DUYK 4QJVA 2ITGA 4JRQA 1LKYB 2O5DA 3D2FB 3M1YA 3POTA 5ALSA 3CTRA 2AJ4A 3F73A 1LWFB 2ZZNA 2KN7A 4I2BA 3AVBA 2HQIA 4FNIA 5CR4A 1KVKA 1FO1A 1CVJA 3R97A 1X9XA 3MMAB 3ILOA 4FVMA 3QIPB 5KAIU 3WDOA 2BH1A 4CEOA 1WDTA 1Q8IA 3JQMA 4QZ9A 7ICGA 4ZVGA 1DQ9A 3HKZD 1S57A 4DPYA 4JV5J 2V2ZA 2GNKA 4QIWF 4KLLA 2HZVA 2HCFA 4FYWB 4ECVA 3CGIA 4KLMA 1NGHA 2A3ZA 2KHQA 4DV4F 2QTWA 4AL5A 2ZUBA 4LFAK 3AA9A 4DQIA 3SFGA 4DR5F 3ZSZA 2B7BB 3OBWA 1RTZA 2DNZA 4KH1B 2Q31A 1JLBB 5H9FK 2DNPA 4PG7A 3U3YA 3JTPA 2DKOB 4DUZK 2EW9A 4BQZA 2N82B 1QE1A 2QMUB 4QYZK 3BGUA 1K8AO 4RUAA 4K0KF 3RWUA 2WTFA 2KG1A 4RPXA 4PHEA 1Z00B 3THYA 4DL6A 3J7ZO 4X65J 1PILA 4PPXA 1ZQFA 3G4SN 4K0KJ 2LQ8A 3KLGA 1IBLK 1EXQA 4N8NA 5C42A 4FBUA 2QWMA 1N8RO 2KM8C 2GVZA 2A2DA 1O0PA 3CCEN 1U0HB 2KKPA 2E5JA 4KO0A 1OUQA 1X66A 1KD1T 4ZLJA 7ICJA 1SVDA 3HHLB 1U6BA 2NRHA 3B6OA 2ZM6K 4DX7A 4UUWA 4KB0A 1PGZA 4G9ZA 1TL7B 2Z2ZA 4AFFA 3W3DA 1F5AA 4NLXA 4X4UA 3HSCA 2FD2A 2DHXA 5F9LA 1CJKB 4CERA 4B1VA 1ASVA 4AHTA 5KPTA 2VKZG 4OPAA 3VTIA 3V2UC 1TZ0A 3CJ3A 4JI7F 2VFUA 2B9XA 1YTYA 5L1LA 2W9CA 1M1GA 1BQNB 7ICSA 2AQ4A 1OY8A 4U7BA 4OYIA 3QYPA 1WSHA 1YUWA 4E1NA 3AA5X 3AFGA 4K4YA 1ZM3A 3CE8A 2E8OA 1XN9A 4A4JA 4IG3A 5LOQA 1FRXA 2NS1B 3CF5Q 3D2EA 1DT9A 3P83D 1RDBA 2Q97A 3M2UA 3BP8A 4B3OB 4JHDA 1YI2N 4GMKA 1RDCA 3DYAB 1HL6A 3ZD8A 3TNVA 3CFRA 2VBYA 2YHBA 2ZE2B 1SJFA 2BDPA 1A0OB 5F9NA 4JI0J 4X66J 5CQGA 4CIEA 4NZ7A 4DV5F 4F0MA 4ID5A 1XERA 1KKHA 4CZGA 3TWZA 4J2DA 4PXDA 3VR1A 1HWLA 3W9HA 1Y4ZB 4K42A 4DTXA 5J0WA 5HMMA 1A5WA 1M5HA 4TUQA 5ALWA 5F3ZA 4CGHA 4L3KA 1ZOTA 2HNZB 2QWPA 1GLDG 2DD8S 4KGMA 3VAKA 3O4QA 3PNCA 3N28A 3PRDA 4M63A 4KKOB 3LWMA 2YQ0A 3K0JA 2JRZA 2GHWA 3NTUA 2FY1A 3ULDA 2IM2A 1VLBA 2J9DA 3W66A 2A5XA 2J5AA 1XR6A 3W1YC 2E2PA 3VGUA 3MM5A 2IS3A 3O1LA 3BO2A 1RT5B 3M1VA 4KLIA 2F7VA 4K4VA 5BR8K 2R8KA 1QCKA 1RAEB 2BCVA 2E2NA 3O9UA 5AQSA 4UAZA 2QX0A 3MPWA 2JH3A 3DOMA 2ZC4A 4J9VA 3H2LA 2DFHA 4IO1A 3NDKA 2PIIA 3I56S 4I1TA 3FSIA 3FYHA 1U09A 4FJNA 1G2EA 5CH7B 2FBXA 1UHUA 4B9VA 2F1JA 4DR1K 4WQ5A 1U1OA 2R7TA 4AHCA 2E1EA 2I7NA 3OSNA 4KH4A 2RHQB 1Z25A 1AFJA 7ICQA 7AT1B 2UXBK 3W8GA 3DWLA 3LP1A 4CK3A 4NLOA 3O80A 1S6QB 4DKWA 4C4TA 3AOCA 1W0HA 1VC0A 2PSZA 4LSNA 4AHRA 3SV3A 3PG9A 1FKPB 4Y2IA 3R7SB 3OTOF 1SB6A 4CZFA 4AT1B 1HLUA 4FK2A 5HI7A 3SUOA 4CW7B 1NK9A 3K89A 1OW5A 1QQOA 3C2MA 4DCOB 3CFPA 5J2QA 2W41A 3JAMY 3TTCA 3OTOJ 3VGTA 2GO9A 4O55A 2VDIA 4DLGA 4OI2A 4XK8C 4GXIA 4ZA1A 2V8VA 4AYBC 1BI4A 2VG6B 4CBWA 4M5DA 3HJVA 2DCLA 4O3QA 5IIMA 3ZZZA 3PW4A 1GLCG 3SXLA 3L2UA 1DTQA 4AXJA 2DEJA 3K9JA 2H3FA 4P4OA 5MLCV 3F5TA 1YXQA 1S1WB 1M1HA 1F5SA 4TQSA 4B3MK 3AXMA 4HTJA 5CRXA 2GC8A 3BBFA 5BPNA 2ZH8A 3EGNA 4QYRA 4F5PA 4IOCQ 4YMOA 2X1BA 4NLDA 1XUPO 5F0WA 3T5LA 3TVKA 4LF4K 1QZ6A 4LC9B 1JX4A 3KWMA 3VQSA 5E3CA 2ROEA 3NRBA 2LLZA 2Y0SC 3RB4A 1K1QA 4DUTA 4WU3A 1BXNA 2HDOA 2P9PA 2ZH6A 5F3XB 4IFVA 1U1NA 2WONA 3CULA 3ISCA 2HRUA 1CQMA 3I31A 4OI0A 1XEZA 4DSFA 1X4EA 1WSVA 2YJEA 3VZHA 2BM1A 3ZXWA 1X6JA 3ZSQA 3DDNA 1RBLA 2J6SA 4JN4A 4DTSA 1B0PA 3D54A 2RUGA 4KV8B 4PHAA 2V50A 1WYGA 1GLLO 5IINA 4YORA 1MU2B 2WB1F 4DR7J 1X9SA 2AP6A 2OPQA 2HURA 1ZYQA 5B0FA 3RJMB 3NVWA 1WD6A 4ED7A 1NDPA 5IIJA 5A8KB 1VLOA 5I9EB 6FDRA 6FD1A 5BJRA 4FK0A 1HBMB 4H0PA 5D0HA 4YY3K 1ZQYA 1WOPA 1TE2A 4FPIA 3KJVA 2XLJA 2F5GA 2UVWA 3CC7S 5J2FA 1NOYA 3EL2A 2KT2A 4C23A 3DFEA 2YNFA 2ZH5A 2HS3A 2ATLA 4A59A 3DOLB 1TV9A 2NYHA 5AQXA 3EY1A 5B66U 1N2XA 3OFGA 3WK7A 4RPZA 4ECWA 1WF0A 4JK9A 3D2SA 3RU0A 3LP3A 3JB9k 4F26A 2O1PA 5F41A 2EKYA 4UW2A 3QIOA 4CF8A 2KKHA 1S5JA 5E3QA 2MQNA 4Z6CA 3G6ES 5B7WA 1L8OA 2WAQF 4BGDA 2FB0A 3IBFB 1B7YB 3P5BP 1K9MT 4B3RF 4AUKA 3TADA 1B0XA 4C98A 4EX7A 5I4MA 1VJ5A 1FDNA 5J2PA 4MF8A 4CCHA 3GP9A 1NK5A 1NU0A 2YKMB 2PI4A 4BRDA 4B3RJ 3HFKA 4QWDA 1OY6A 2LXFA 4DQPA 9RUBA 3TZXA 1MWQA 2E1CA 2W11A 2FC9A 2DNNA 4PCQA 3W8PA 1WG5A 1NAQA 3IP4B 3SUQA 3SUNA 3RF9A 4BC9A 1ZM4A 4XDDA 2QW9A 3HI0A 2MZRA 5LJ3Y 3KJFB 5BN9A 2UUBK 3MGIA 5HR6A 1URJA 1WELA 3PRBA 1RT2B 4OYOA 4OFZA 4I2QA 3NGYA 4FZXC 2GX9A 3QNNA 3CJ5A 3BO3A 4KHWA 1NLKL 4C8OA 3AGKA 1JB0C 4LF8F 4UQTA 2YB1A 2GHVC 3I0RB 1YQHA 4FXWA 1QUPA 2KVQE 2ZH9A 4CGZA 4M5GA 5LY3A 2OPSB 4Y2RA 1JL1A 4RNNA 5AJ3F 2ZOMA 3MPYA 1L7NA 3QATA 4Z4FA 3BREA 2YBVA 2IHNA 4DV6J 3MWTA 3AVLA 3EZ5A 1O1WA 4F4XA 3UDLA 3R6LB 3Q8MA 1FXXA 4NYNA 3QWUA 2CWKA 2KIWA 3JSRA 4RW4A 4B1WB 2VU5A 4NLPA 4I69A 2M0NA 2L48A 3K2YA 1VQYA 3FE1A 1Q46A 2JEFA 4QW9A 4NE9C 5I42A 2M70A 4X4RA 1XNRK 1FIQA 1HQ2A 5CZVA 2E5GA 2VQFJ 3C1ZA 3QSYB 2PKEA 3FGVA 1FKOB 3EZUA 5DDPC 2XVTA 2IOFA 2XB2D 4H54A 1N5YB 3KLHB 5HLFB 1TR0A 3V9XA 2L9NA 4UAUA 3BEXA 1GO3F 2QWNA 3ZDEA 3T6JA 3A8KA 5AQYA 5I3PA 1XQSC 3CCUN 1J5OA 3I32A 2WBRA 4JB8B 1NDCA 2YKAA 4KN4A 2ZIWA 2CRXA 8ICMA 3HMJG 4R8UB 2ATCB 4XRHA 2HLUA 4CO5A 2P9LA 9ICMA 1HNZK 4PRFA 1JUDA 3SD7A 4ED6A 2RVJA 2R2RA 2XMUA 3TABA 1C4CA 1HBNA 1YZ6A 2V4JA 1S59A 5CEHA 1Q7YT 3NCIA 1RBTA 1XMQJ 2XWXA 4YDUC 4ETZA 3HHLD 2XSJB 3MDFA 3JSYA 2PD1A 3IG1A 3V1QA 1Y97A 4OO1J 1FNXH 2QSFA 4JWMA 3BZCA 3BYPA 2JHEA 1UP1A 2HVZA 1U45A 5KG3A 4UAWA 2BQRA 2FQQB 2QL5B 2QA4N 1FHTA 2O8CB 4Q8EA 3L2QA 4H4MA 1V4SA 3U3GA 3NGDA 1HYZA 4CLYA 2O8EB 2M0GB 2RMLA 1G15A 1UVNA 3DLRA 3RBXA 2H3QA 3N01A 2YMPA 2VA2A 1EZZB 3DAWA 1IKXA 2EQYA 2FYXA 1BL3A 4X62F 1Q5YA 1NG9A 4CFAA 4H0TB 3HKZF 1EP4A 3O5TB 4PWWA 3VQEA 4J2EA 3MX2A 3CJQA 1VQ6S 2ZJQQ 3N97B 1S0NA 1IH7A 5HNKA 3KMQA 3ISDA 2VHGA 5IXUA 4M9GA 5EWGA 1Y00A 3NGSA 1HHTP 1ZRNA 3HX0A 1SQEA 1L6NA 2E5LJ 3GFHA 4US9A 1U8WA 1WDDA 1U1LA 5E3RA 3SQ4A 3UPFA 2VWBA 2GOLA 3O1BA 4YUDA 2ZH3A 1QQ7A 5J2BA 5GVQA 2CJBA 3R2DJ 1SKSA 2FLPA 4IKFA 3HOTA 4ES3A 4G1PA 4LFCF 3RJIA 2F3NA 2WUSA 1VJQA 1RBAA 4WIQA 2RS8A 4O4GB 3AEVA 3B0XA 3ZSRA 3NASA 2KXFA 3W2VB 3WNFA 2YWEA 5KL8B 4ZJLA 2DL0A 3CDAA 4HEA9 3FEZA 3CERA 1RT1A 3U7JA 1RU1A 4CIGA 4E7JA 3EPGA 2D0CA 3BGRA 1EWRA 2LYBA 4UARA 1CSJA 2FHKA 1FW6A 5C2FA 2ZTEA 2KU7A 1K8AT 3H8YA 4DFMA 4TY9A 3OR2B 2R4FA 1ZQCA 1O8BA 1ZOLA 3O08A 2IHR1 5AZJB 2YX4A 1JLAB 1U48A 2IVNA 4CZEA 4NL9A 3NOCA 3A5NC 5T41A 4P0QB 1JMSA 8ICNA 3HXMA 5SUHA 2OIHA 4GIBA 2XI3A 1N8RT 4IS7A 5ITHA 5F3TA 3MCAB 1FFUA 3I87A 4NLNA 3R5AA 4PXCA 3V6HA 2BUPA 2RKIA 1JLQB 1UEKA 5ETMA 1YZ7A 2N7YA 5ETLA 3ET6A 4K59A 4BDZA 3ELHA 3AA8A 2RQ5A 1SL0A 4JYAK 3OFEA 2BE9B 4K4IA 4L72B 4GNIA 4KHMA 5L1JA 5J0QA 3EGVA 4BRNA 1YRTA 3VESA 4CI6A 2OANA 4IOXA 5AI9A 2AQ0A 2HQDA 4MIWA 2KT5A 2O3DA 5C5JA 1R0BG 4Y65A 4I6YA 1T6CA 2IYIA 3LTOA 2Q6CA 3A1YG 2EC2A 2AH5A 4DFKA 3QEAZ 4FF1A 5M1KA 1HPZB 3MF5A 2CZVC 3H46O 4OI4A 4A8WA 5IV4A 2R7UA 1VS3A 4O3RA 1ZQZA 1HBOB 1TK0A 3QU4A 5LM7E 4QZDA 4RQNA 3FZHA 3QX7A 2A10A 4N8OA 3EZWA 2K60A 3EE9A 4B08A 1RBOB 4CTAA 5KI6A 2P9SA 1N4LA 1FJGF 2VCPA 3VF4A 1KWMA 3E58A 3FCWA 1A5XA 2XQCA 4ZVOB 3PSPA 4KH0B 2BACA 3O2IA 3OUYA 5AXKA 4WFZA 4ZCMA 5ALIA 3FJ2A 4DR2F 4ISGA 4WCEL 2EWSA 4CIFA 3SPYA 2X78A 2M2BA 4FPRA 4OJ5A 2O8DB 1TUUA 1VIOA 3F2CA 2KXNB 1VQ4S 2QRRA 1JMTA 1KSPA 1UTAA 3VWSA 3UVJB 2AA4A 4FWNA 4O5FA 1PAEX 2HFNA 4XPEA 5EDWA 3UPQA 1PBAA 3LPYA 3SI8A 1S9EB 4URQU 4KMOB 2JEGA 5DDMA 1RACB 3WIVA 1GAOA 4QZGA 1IBKF 5IM0B 2GO7A 1DURA 1GLBG 1Y11A 3CQYA 2ZHAA 2C2OB 1BPBA 4NWBA 1RT7B 4YD2A 8ICEA 2XZDB 2PFDA 4X4VA 1MN8A 4B3TJ 1IBKJ 2YB4A 4EENA 1VQ7S 2VJVA 1ZQVA 1T94A 4MKVA 1I94K 3CYMA 2V8DA 3WIUA 2ZIXB 4H4KC 4KLDA 2V34A 3PO4A 2XI9A 3ENBA 3G8QA 2G4BA 2R8GA 1S0MA 2KFZA 4Z4IA 2GELA 3M6VA 1U1QA 2CQ4A 3ZLJA 3E0FA 4USAA 4MMOA 2EZYA 3BBBA 1IV8A 4NMLA 5ALEA 4UF4A 4Z0UA 5A8RA 5CZ1A 1KHWA 1LW0B 2MHEA 3SR6A 1YTUA 2F9WA 4LREA 3H90A 1EKSA 4JLHA 3DLGB 1G3OA 3LAKA 2WB4A 3M05A 2GBZA 3RBZA 2CQGA 5CZ2A 1RHJB 3Q0AA 4DL2A 1PYTA 3AVKA 3DM2B 2QL9B 3MWBA 4HACA 3UKUA 3IG8A 4JKFA 4ZPAA 2VOOA 4YFKA 3GU3A 5CHIA 2N4CA 4EBCA 1RLDA 4BXOA 5ALUA 3ITHB 3WK6A 5K4LA 2I7PA 3BS9A 4JKEA 4NCAA 1C0GA 2YKNA 3LP0B 3WK5A 3M8PA 1M5VC 4B9NA 2CNKB 5HATA 3A5MC 1X6IA 1WUUA 2W3SA 1XTZA 4IUFA 1LFPA 1SJ1A 1TVAA 3S3NA 3AAQA 5AQHA 4DQRA 2W6LA 4RT2A 4CGGA 3I9V9 1P8GA 2Y1LB 3NF9A 2GHPA 3FZFA 4EYIB 4PKHA 5BPLA 3M32B 2ZH4A 5AK5A 2NZ4A 4JV0A 2BCSA 1RTIB 4JUZA 2HBYB 3UE2A 4TSXA 3BPDA 1S1VA 2QB0A 3QZ8A 1NKCA 5SZTA 2CDRB 2IRYA 2UUWA 1VQON 2PYJA 3CD7A 3K75D 1HI1A 1YWXA 3OS0A 3BSNA 3ZTPA 1S1TB 3CIMA 3CCJS 1VBKA 2FVPA 4OVLA 2ISPA 4Y00A 4DO9A 1HWUA 2UU9K 3OTDA 1L3VA 5EE0A 2U1AA 4OHYA 5CB1A 2NV3A 3QMLA 4PKGA 4E98A 4R5PA 2CPEA 3C16B 4KGVB 1C0MA 5FLXO 4UB5A 1OSCA 5ALRA 2AEMA 2B6AB 2H1YA 3MEEB 3OYBA 4P7TA 3IAYA 2IM0A 4LZDA 1S5LU 2KE7A 2D7SA 2HZCA 1TL3A 4KTZA 4WE1B 1IBMJ 3G6XA 2WVEA 1HQEA 1WHYA 1TFYA 3VCDA 3TTFA 3KBBA 5LL6Z 3HOSA 4JI2F 3ENQA 2CJYB 3AVNA 1X42A 4M47A 5AQRA 3DRSA 4NYZA 3HW8A 5FRMA 2DGOA 3PV8A 4ILRA 4RZRA 1XSNA 2CGJA 3R5JB 1SGGA 1ZM2A 3VVTA 3PYFA 1C1CA 4BR7A 4EP5A 4URGA 2ZBQA 3HTVA 2DTUA 5KFTA 4MJKA 2AHOB 3WX8A 3OY9A 1NDLA 1P6TA 1KQSR 1NNLA 4E19A 4ZLLA 1M5KC 2VQEK 1YKWA 4DU7A 4JS5A 3UB5A 1R8HA 3AD9C 2OCEA 3SQ1A 2FIUA 4QZAA 1WKKA 1S9GA 3U1NA 5IZHA 5GIOA 3US5A 4IH7A 3AD7C 5J2AA 1NNDA 5M2PA 5JJBA 3PHTA 3Q23A 3M30A 1KS2A 2E7VA 2ZTDA 3ZT0A 1HNVA 3M9NB 2BJ1A 1PVQA 3MN5A 3A8IA 3UMCA 4HUFA 4CVNE 1NBWA 4CD3A 4OZLA 2E3TA 2N3LA 2FHJD 4MKYA 3E9OA 1RTDB 3NS1A 1XO1A 5IOLA 3FBEA 3TJ8A 5KFAA 3FKBA 2VYPA 5EWEA 4OI1A 4KHQA 1RLCL 3VQBA 1AUDA 3MGHA 3GJSB 8ICZA 3W5ZA 1HNIA 4DUYJ 3I0SA 3ZX2A 4ETXA 4QIWC 2HMIA 1GOCA 2DTJA 3C5FA 1IWAA 3TTDA 1C6VA 1IVZA 2RQ4A 2GUPA 1KR4A 2UXCF 2D8CA 2Z57B 4IBNA 1T7PA 2GCFA 1T9XA 2LEPA 1R0CB 3J7YU 3OL9A 1H98A 5J2JA 1FESA 1EWQA 4JI3K 2IHMA 2YKPA 4LFAF 4XAKA 2EANA 6AT1B 4UB8U 4WFYA 4RQ1A 2QG9B 2UXCJ 4A8EA 3KD1E 1N56A 3SMPA 2HOEA 5KFSA 2OHFA 4DUZF 2VJ4A 1C1BB 5AK4A 1M6YA 4TURA 3KDNA 4LFAJ 1Q1KA 1NGEA 4YN3B 4WYLA 2QEXN 2A6AA 3BN4A 4DG1A 4I2FA 1NEEA 5H9FJ 3QZ7A 1LKYA 3D2FA 1YJNS 2B0CA 4DUZJ 1COOA 4N77A 1MMLA 5AT1B 2DB1A 4QYZJ 1LWFA 5DDQC 5KAFU 4CJWA 2ZVIA 3DRYA 2P2CB 2FXUA 1BMQB 3LK9A 1QAYA 3JTOA 5J2NB 1F9HA 3MMAA 2M9KA 4PKDB 3QIPA 2YNGB 4N56A 5KGXA 3ZD9A 2AX0A 1TMMA 1IBLJ 1VYAA 3MDCA 3AO4A 2ACYA 4JKBA 4JI1K 3ZSVA 5KL1B 2YHYA 1EQYA 1MQ2A 4GVMA 4PKIA 1I1GA 1RPLA 2E7XA 3OVAA 5AI6A 3T1HK 4RBUA 5IT9O 4M63C 1HLWA 5KT3A 3C65A 2IMOA 3DXMB 2DGQA 1JLBA 1ZBFA 4CF4A 1RHUB 1VSEA 3I55S 3RJEA 2D74B 2ZM6J 2X51A 1ACMB 2HEKA 1YIJS 3HSJA 1RCHA 5J0UA 1OQ3A 1RQLA 3ZZUA 1Z00A 4PL2A 4OJ1A 1T11A 3NUQA 2FZGB 4EO6A 5ALVA 3T79A 5HJYA 1SIJA 2YVSA 4HLBA 2Q2RA 3G82B 5F8IA 2JR5A 4M94A 2D1CA 5DM7Q 2RD5C 4WQ5C 4QOZB 1RXWA 1BWVA 1XNQF 3H2VE 4IR9A 4EIAA 2ZFHA 1U0HA 9ICNA 3CM6A 2I6XA 2A40A 3HHLA 3FFKB 2GGPB 4BWMA 4E2FB 3QFUA 2GV9A 4GV6A 1TL7A 2GWSA 1C2PA 5BRHA 1X7VA 2VFTA 5D4OA 1PC5A 4CHPA 9ICPA 3UCUP 1CJKA 1HFEL 4F5QA 5D46A 1LW2B 2LP4A 4LD0A 1PJ7A 1X2IA 3M9MB 3ZTRA 4NYPA 3DKDA 3IFEA 2ETJA 1NSAA 1ZD4A 1BQNA 3S9HA 7ICLA 4BACA 2KL8A 4WFAQ 4B9TA 3HPOA 2NO4A 2CYYA 4JI8K 2Y0SD 2WFBA 3VZIA 5SWMA 2BKPA 3B6PA 3PX0A 1F2GA 1LK7A 5D78A 2DUYA 5AKZA 4B3OA 2UUAF 3Q8SB 2ZKUA 1RAGB 8ICXA 1BHLA 3W5YA 3DYAA 3E01B 2PBDA 4WF9L 4CEAA 4BREA 3S3MA 2NPIA 2ZE2A 2O6KA 2FBYA 1S4FA 2MQ8A 5B08A 1VGYA 5A2QU 2UUAJ 4WFBL 2G2YA 3MN7A 2W03A 1DLOB 2BKNA 1ITGA 1S97A 5AKEA 2XYGB 1F44A 1HD1A 3UM9A 4IXCA 4P2SA 2D0OA 2HWHA 2ZH2A 3S8SA 1RK8A 1HKAA 2W1BA 4HH0A 3GDXA 3HX9A 5B0EA 2HNZA 4OX7A 2NSCA 3NF6A 2MKIA 4W5QA 2FGOA 1V5IB 4MFAA 4C8LA 2EG1A 2V2VA 1ZXIA 5J0XA 4DR1J 1S72N 2F8SA 2FJVA 1YBAA 2MQPA 4IEEA 4MDBA 2V63A 4KKOA 2RUSA 2MQOA 5AM4A 2KJWA 3MD1A 2UXBJ 4FE3A 3TACB 4IRKA 2QN6B 4O0JA 1HW9A 2F8KA 2HHWA 1RT5A 4FFDA 3RZAA 4DV2F 1VSDA 4FCYA 3Q2SC 3ZI4A 1QLNA 3WK4A 1N5SA 3WXLA 2AT1B 1AUSL 2AZ1A 3JXUA 2KOBA 3M2RB 4CLSA 2MKYA 5J2EA 4MTPA 1WLJA 2W55A 2HAFA 4DV2J 3GU0A 3ZT3A 4YOVA 2FPMA 4IH6A 1GLFO 3TWHA 1R8BA 2X3GA 1MA7A 2D3DA 2BDUA 4LVNP 1SJ4P 2OAUA 2ILYA 1SC6A 2WZ1A 2EVZA 4X5VA 3AU2A 5BPCA 4DCPB 3MEKA 5J0TA 1ZAXA 1KAYA 2QLJB 4NA3A 1VQMS 1YVUA 2OA8A 4DSKA 2UV8A 3HULA 2PFQA 1LWXA 1UMJA 2VGNA 1S6QA 3RYLA 2W7OA 3U9DA 2JWNA 4TU9A 5M1OA 5C7PA 3ALRA 1XQIA 1FKPA 1EQ0A 4B3MJ 2XS7A 3LWLA 3VAGA 3TADC 3VOVA 2W2OP 1TMJA 1X9MA 3BQ1A 2BANB 3MXHP 5FPMA 5D4PA 4NYFA 3QFHA 1IBCB 1PJ6A 2RF2B 1S6OA 1EKRA 2C2KB 2KH9A 2HGLA 4WYWA 2HS4A 2VG6A 2FVCA 2HW3A 3FMWA 5KT5A 4ES1A 4FJMA 3VMFB 3LQVA 3IO1A 2MLZA 3I96A 2WB1C 2HQFA 2MLYA 4FLZA 4QR1A 4J9NA 4P73A 4RQ8A 1NZPA 3RW7A 4US8A 3SCXA 3PEHA 3FZLA 4F92B 2VBZA 3ZDBA 2CUYA 4BRCA 3CO9A 2BJ9A 5J0OA 3W60A 2NZTA 2ADCA 3I5AA 3A3PB 2FJEB 1S1WA 4OKKA 2JZ5A 1H6KX 2B9WA 1NOMA 1DRGA 2UP1A 2Z58B 3OYLA 4YY3F 4U7UD 7ICRA 2YN4A 2KNJA 1RZTA 5ETKA 3EPIA 2EAMA 3TAFA 1MMDA 4IQTA 3L3FX 3ENOA 3T1AA 1RP5A 3K8VA 4YY3J 4DSJA 5CY4A 5ALNA 2E8NA 4QZIA 2VFSA 3PSFA 1KKXA 4RT3A 2NNWA 3FAHA 1IN0A 3MMJA 3M8QB 1S3XA 1BPZA 4ID8A 2OH2A 9ICCA 5IV3A 2UVRA 4P2XA 1MROB 3MABA 3MTJA 3GIRA 4FM1A 4M7XA 1I5OB 5HQMA 3ISBA 3R27A 3LDQA 4K8XA 4KV8A 4B6JA 2YQEA 3LL3A 1MU2A 4M45A 3Q8KA 1RG6A 1YITS 1WAJA 5L46A 2ASYA 3AOAA 4JK1A 3HL8A 3OYKA 5AM1A 3QT5A 1WKJA 3VQ5A 5A8KA 2BPCA 2WW4A 3ICXA 1VQ8S 2KHOA 2ZF5O 4HTIA 1RT6B 2H4WB 1Q95G 1HBMA 1Y64A 2PY5A 3RMBA 1U9LA 3ID6A 4CLPA 2OPRB 4WIIA 3AV9A 3LDPA 1HNWF 1QVFR 2OEMA 1ECWA 3VF0B 2UUBF 4O3NA 1XC9A 3V4MA 5TKYA 3RAQA 1OH8A 3DOLA 2OTLS 1DQ8A 1HNWJ 5BYQA 1BPEA 3G6YA 4FJXA 2UUBJ 4W5NA 2E6LA 1TK8A 2PGCA 5ALHA 1TVRB 4DV4K 2JGAA 1ZTWA 4CJ7A 3MWPA 1T95A 2WK4A 4DR5K 1EARA 3V6DB 2H3EB 1A9NB 4Q0BB 4N76A 1ULRA 5LMUK 3CPEA 5HOOA 4CJ4A 1WAFA 3HFZB 2XMTA 1RHRB 1RM6C 4F4ZA 2EFOA 2C3OA 4HHTA 1R3NA 3AOBA 4Z4CA 2YWKA 2KM8B 9ICVA 4GC7A 2N3OA 2YKMA 3LPTA 1RWKB 1T6DA 2F1FA 2HLTA 3Q7CA 4OYBA 5DJBA 4W90B 2EDUA 1YBUA 1JJ2R 5L39A 3KLEB 1ATRA 2ODGA 1ZD2P 4HHJA 1VSHA 4CF9A 4G65A 1XNRF 3THWB 2MJUA 2A1JA 2KB2A 4J9MA 3RRHA 1HARA 1D9AA 5JU5A 1RT2A 3C2KA 2AYEA 3SQOP 1MWKA 1XNRJ 4ED3A 4C6AA 1RWXB 1Y9OA 3I0RA 2AD9A 3AY0A 1NZAA 2XO7A 2E6MA 3LVWA 4C0ZA 5AZIB 5GAEI 3U27A 2EAOA 2OPSA 5AFUA 5A2QY 2E5IA 1YG0A 3TYTA 4ERDA 4KLEA 1L7PA 3IFRA 2W01A 2NYIA 2X1FA 4QU6A 3TR5A 5GMKa 5T7BA 2FI1A 4IOCL 4JI7K 4F9OA 5EE1A 5IC4B 3J80O 3GBTA 4W5RA 2BA9A 3L3UA 2OM6A 1VK3A 5ETOA 2XYHB 3HPGA 4DEZA 2EK1A 3C6HA 1TKTB 4CBUA 4PAAA 4LF6K 3OYCA 2ATQA 2MKSA 3EVWA 1CRXA 5AK3A 5BPMA 1Y5IB 2HBZB 4I2CA 3RR7A 1T9UA 4ECTA 1Y7PA 2R8IA 1U02A 1FKOA 2IM1A 4E7KA 1RB0A 1RKIA 3GG4A 2RHSB 2CPXA 1UA0A 2MEWA 1CLFA 4I9QA 1TFWA 1KDHA 4I2GA 1V3SA 2E1PA 4GRSA 3KLHA 3HKZC 5HLFA 1N5YA 2R7YA 1X3NA 1Q86T 3I4HX 3R2CJ 3IAS9 4NL9C 5FPEA 4BRAA 4ZVSB 4USJC 4DV5K 1WEYA 3R8YA 1S7HA 4FWSA 1RCXB 4DR4K 2UUTA 3FZMA 1YT3A 2ALZA 5D8HB 1WNEA 3MM8B 4JKCA 3HZGA 1K44A 3CD5A 3V1RA 4R8UA 3L2VA 5AIAA 3BN7A 4BRGA 2R2UA 3NNCA 1FE4A 3EO3A 8ICOA 4RW9B 2KSOB 5ALTA 1BHNA 3TZZA 1DGSA 2DR8A 2JC0A 2XSJA 5JVGQ 4LVOP 2XZWA 3BDPA 4MK7A 2OO4A 5EE9A 4QBUA 5HMLA 1IQTA 3WQUA 2COLA 2YWHA 3S01A 4AM7A 2O8CA 4BCAA 2LMRA 3EKSA 1RTHB 2RH3A 1WUDA 2O8EA 4KTQA 2CIMA 3AM9A 4DB3A 3PYDA 5E2QA 2FHJA 1Y88A 2CNNB 4M3WA 2D0PA 4ZVPB 1NZ8A 4BR4A 4YMNA 1EKEA 3IP0A 1VQSA 2I1RA 2A41A 3O9RA 4FJGA 2D3OR 1UCVA 1GEHA 3QBCA 3BQ0A 3GTYX 3NWGA 5KOWA 3IA0A 2KQ2A 1KQSM 2ZBIA 2EC0A 2G8VA 4I0WA 1MWYA 2DPIA 1IG9A 3TSPA 1WTFA 2H4YB 3FSXA 2EFNA 4Y2TA 4JD2B 4C8ZA 3CM5A 4OLPA 1WI6A 3Q8YA 4ATNA 2W4PA 4NXZA 2YTCA 4DTOA 1VBXA 3H0LB 3SAGA 1NB2A 5FIIA 3I9ZA 3A8JA 1MDUB 2JWKA 3NCRA 1KLMB 4DSEA 3OTOK 2OTJS 4TQRA 2XULA 4QCLA 1LXNA 4DQSA 2FMSA 4H4OB 1PKUA 2ASJA 5FPNA 5JMVA 1UPHA 2DK2A 2FBTA 1IWGA 5KPRA 4O4GA 2BJ7A 5AKYA 2ADBA 4K4TA 2RS2A 3W2VA 2RSQA 3PLAA 4DWIA 9ICFA 4IFYB 3E1YA 1GLAG 3BDEA 4CLFA 2Z2LA 1TGOA 4CO3A 2QC3A 4Y2PA 2LYAA 3FZBA 1S0OA 3DNCA 4JYAJ 3I6PA 1DRZA 2PMZD 3MAAB 3OR2A 1X4FA 1N63A 4PZOA 1RWNB 5KOXA 3KWIA 5AZJA 4OZNA 1JLAA 1K5OA 2ZDPA 2BJ3A 2O67A 3E2EA 4GKKF 4KC5A 1SV5B 5B0BA 3H5YA 1R8PA 1D4XA 4P0QA 1MMNA 2JEIA 1UKUA 3K59A 4J8FA 5J2MB 1SCJB 2XO6A 2VH7A 3O1WA 4CNQA 3W63A 1VQPS 3MMVA 4PABA 2XYPB 2ZDOA 4CEDA 2LEBA 3P96A 1QVGM 2JRSA 4ICAA 1W9HA 1JLQA 2VANA 1KVJA 1N61A 1FRHA 3OT9A 4DPOA 1ZQGA 2C42A 4CI0B 3WU2U 2Y0SF 2NQPA 3Q8QB 5AM3A 3NAIA 2KJ5A 1E6VB 3D0GE 1KVIA 3FC4A 5M1FA 5EE3A 4KIAA 3QDKA 3NAHA 1AYEA 2A42A 4IDHA 2P5VA 1BDGA 3BGFA 2UZAA 3TUPA 5IIOA 3T19A 4YOWA 4ZK7M 3T6BA 1CZAN 4ISFA 2J0SD 2QGFB 5DLGA 2XCPA 4IOBA 2NLXA 4AP9A 4PXBA 2IGIA 1HPZA 1Z4NA 4JKDA 3F2DA 1Z19A 4YCXA 4KLJA 3N4WA 4K4SA 3CCZA 3SMVA 3AJ1A 1OS5A 3LP2B 1HBOA 1Z3EB 1NGCA 2QLWA 5D6GA 3LYSA 1OVYA 2ZWPA 2LYVA 1NI3A 1N0VC 3QJPA 1F5CA 4X2BA 2HI0A 1Q8KA 3DLKB 1KAXA 1Y3JA 2VD3A 4ACOA 5CWRA 2G13A 4C2MA 3CCSS 4Y2VA 3H1VX 4WYBA 2CPYA 3MOJB 4M3UA 4ED1A 2VOPA 2H3VA 1FA0A 3RBEA 2F7TA 3VQ7A 4DOZA 1IR2A 1I3AA 2LQ5A 3GV5B 4KTWA 3ASMA 1O51A 2AV5A 3CP8A 2CZ9A 1G7CB 2O8DA 1V3RA 2JSXA 4OJOA 4K25A 4MLHA 3CJBA 4B3RK 1K0VA 3VEVA 3J81U 3EXCX 3FFIB 2NYVA 3AO1A 5D4BA 1XMBA 3UVJA 1B9DA 3O3LA 2YWWA 3VGVA 2V8HA 4JKGB 4I2PB 1RWOB 1S9EA 2RRAA 1L3SA 5BYSA 1QHAA 5IM0A 3CCMS 2GMJA 3UMGA 2Q3PA 1RT7A 2HBMA 5GINA 3CI5A 3JTNA 3MM7B 4CZCA 4O0NA 4FWLA 1RBUA 4FM0A 1B9FA 1KBUA 3UQ2A 2WVFA 3IWLA 4HCCA 3EUNA 2MRLA 2LQJA 1SJ3P 1JWWA 3QGHA 2ZJ5A 2ZIXA 3BPSP 3PR4A 1KHVA 3ENVA 3QB0A 4YOUA 4CF2A 1ZQPA 4MF2A 1YRXA 1KCFA 3VEXA 4LF8K 2PC6A 1OY9A 2DHHA 2N1RA 3CCTA 1A6SA 3ONNA 5KT6A 3GR1A 3QNWB 3FBFA 1WBBA 3H4DA 2QM1A 3HF5A 2QKBA 2MJNA 3H3OB 4EELA 2XCAA 5AJ3K 3LANA 4BUGA 2VPYB 3KKAA 1G99A 1NRKA 1LW0A 5T14A 1UL3A 3GIMA 2JGUA 4CF1A 3MEDB 4N41A 2HVHA 1NGGA 4IQXA 2B4UA 1DAXA 3D7SB 3BYRA 2WC9A 2GLEA 1F1BB 3DRRB 2PZSA 4BBYA 3DLGA 2XLIA 2K7KA 4RTFD 5KG0A 3PKYA 2PAVA 1ZQWA 3I5CA 2DPNA 5DS7A 1JLEB 2MHNA 3DM2A 1R6YA 4I29A 2NO5A 8ICQA 4L76A 2ACMA 2VODA 1U47A 4RW6B 1WACA 4ZIWA 1ZH5A 2QIFA 4IH5A 2KHCA 2XZTB 2CGLA 3ITHA 3ATUA 5EUHA 1SPBP 4QZ8A 4KY3A 3R9KA 1GX6A 3LP0A 1CZ9A 3FQLA 3A0BU 8ICUA 2FVQA 2P9GA 4FS1A 3UCZP 4WCEQ 2UU9J 4I7FB 2BKOA 2V2KA 2CJAA 2E8PA 3CJAA 1U1PA 1BQMB 4C0HA 3B4DA 4DDFA 1DKGD 1KQGB 4EGLA 1KN6A 4YXMA 1U8SA 1QHTA 1NWKA 5AKLA 1Z2ZA 4TXSA 3UNGC 4C7YA 4DLEA 2LSNA 4AHVA 2ES6A 3M32A 1WC4A 1U0SA 1ILYA 2L5YA 4H03B 3TSUA 1Q82O 1SI9A 4XH5A 1RTIA 3NMRA 3HT0A 2ZGYA 4I68A 1R8CA 2ZTCA 4CNYA 1IQZA 2GA7A 4R79A 1IKYB 5AKIA 1J54A 3BV8A 3BBCA 3Q24A 5KFIA 1UWAA 4CJUA 1S1TA 3HYFA 1T4GA 3GFZA 2J0XA 2A6MA 2ZKTA 2LA4A 4CLWA 1U1MA 3OSPA 9ICHA 2HFSA 5HO4A 4UASA 2K4EA 2XLKA 2M7SA 4BC4A 2AWZA 3K5MA 4FBTA 4B9LA 3NWRA 1SV0A 1ELOA 5DDYA 4X62K 1OYEA 1Y5NB 3C16A 1ATNA 2AW0A 5AE3A 4RW8B 5ALOA 1H7WA 1H2UX 4BQLA 2B6AA 4AL6A 2VQEJ 3MEEA 3I82A 2X1GA 4A47A 3PW7A 2PT0A 3UN3A 4WE1A 4OYZA 4YB1P 4ELUA 1NDKA 2OP5A 3IMQJ 2CPDA 2KIVA 2NPFA 1IUJA 1WCNA 3QPIA 3AMZA 5F1XA 2EX3A 9ICKA 4I67A 3EN9A 5ELZA 1MN9A 1TUYA 1RXOB 3K5PA 4GKJF 5ETQA 3VAIA 3PNIA 2YXLA 3A3NB 2W2QP 2GJIA 5G5HA 3LDAA 4LFCK 3EWAA 1SL2A 2L41A 2ASDA 3BZKA 4ECRA 3OVSA 2BEFA 2C2DA 7ICUA 5IILA 2VWKA 3QEBZ 2J9DE 4G3IA 2ZEJA 3IRUA 3NG8A 1S76D 4BDPA 4DPUA 1RKJA 1Q8BA 1WORA 2HGNA 3U26A 3PFEA 4ECZA 5D77A 1UZDA 1IJEB 5KFFA 3FZKA 1P90A 3ZETB 3KHLA 1CC8A 2EG2A 3DXBA 1P9QC 3ZSYA 2DY9A 3QEIA 2JZBB 1Q7LB 2MQQA 2CQ3A 3ZSXA 2P5OA 3RB0A 5D4NA 3PIOL 5EWFA 2RILA 4JKHA 4JI3J 4MYTA 3MCPA 3OXFA 1BA1A 3HHLC 3TX8A 5DO2A 1DGJA 1BG3A 1RTDA 2IOCA 3BQ2A 3J81j 2FPKA 1ZETA 2P9EA 1BQXA 2I5JB 3IBWA 4JI6F 4IZ9A 3V7JA 4BGAA 5AHXA 2XY5A 4BR9A 4ZPDA 4NXMF 2MGZB 2FPHX 5FRNA 3D2NA 2N7CA 1S79A 2I9SA 3UXPA 1WJ9A 3KZBA 1G4CA 2E20A 4PZVA 1JIHA 2VBXA 4ZOSA 3OYGA 1YHQN 1FERA 4ZH4A 1KNZA 5GADU 1EO1A 1FDAA 3OUYB 3M1FA 3DCAA 1VQLS 1N5VA 3CJ0A 1QVFM 4MIAA 2JNJA 1RDAA 3GYXB 3C2PA 4CZJA 4B9MA 2W2NP 1B64A 5GAGU 1NSQA 2G0JA 4DX8H 3ZTSA 1KBRA 4JI1J 1C1BA 2DHGA 1KAZA 3CFOA 4BRHA 4EHTA 3J81Y 3T1HJ 1DJ0A 4E8UA 2QKQA 2VL1A 3F5AA 3LZJA 4FOIA 4CFBA 1OKJA 5HVGA 2GWKA 1RJJA 3OW2M 1QSLA 2CG8A 1HNXF 2HAIA 4WP8A 5KFBA 2ZWHA 2W2PP 2XICA 4WU2A 2IIRA 2E29A 3D1HA 2L9WA 5EGYA 4CH7A 4KPYA 1FJGK 5J2NA 4RX6A 4UTGA 3KUHA 1D8BA 1F9EB 2YNGA 2MZSA 2OYQA 3ETOA 1VK8A 2CA9A 4CZLA 5IWAF 4BR2A 2XG8A 3PXGa 3CG7A 4DR2K 4RNHA 4E0DA 1GMWD 1C20A 1ZJMA 1HR0F 2VICA 2UUCF 2D3UA 2J9EA 1A6LA 4Q45A 4UOCA 5GAEP 3D1OA 2WF8A 3DXMA 2MQLA 4DSLA 3RJHA 3S1TA 1BIUA 2FF3B 3V6JA 3TJAA 4RG8A 4QU7A 3O9TA 4QQBA 1TAUA 2DEIA 3VN5A 5HMWA 4IQVA 1IBKK 4CLLA 3OYFA 4HCBA 2G8FA 2E8MA 5E0OA 3CDBA 1NK6A 3AARA 3G82A 1UEUA 4U8VA 2V67A 3RMDA 1L8LA 4NOHA 2OFGX 4ZP8A 4B1UB 4RR5A 1HUXA 4R66A 4A2BA 2HWIA 3P39A 1J2VA 4RUHA 3MAQA 4NLYA 2ERRA 2YTUA 3W9IA 4JI8J 3L8BA 4FJIA 3UD5A 2GGPA 2Z4PA 3I5BA 2Q0RA 4PQAA 1LV5A 3NH0A 8ICSA 1LOTB 1ZBSA 5LL6d 4FJHA 2K7JA 2KZMA 2I9GA 3RAMA 4PGYA 4F50A 3ZTQA 2DQNB 3R3TA 2ZGZA 3VCBA 3D68A 1LW2A 2B3TB 4M3YA 2HGMA 1MSWD 5B0GA 2G2OA 4JMUA 4ED5A 1PK3A 5FJ4A 4O23A 3J7YI 4IQUA 1AT1B 1VSKA 1Y3KA 4PXEA 2DIUA 2F4VF 1W2BR 5D3GB 3AAPA 3PZPA 1RWPB 4XO0A 2ZZTA 1VHFA 3EE3A 2HOQA 1X9WA 5DB6A 3UNYA 5A0LA 3NGTA 2YWFA 3C1YA 1ZQKA 1QQ6A 3PKMA 2ZBCA 3K7RA 4EUVA 3CB4A 3AVHA 8ICAA 4NASA 4Y2XA 3E01A 1Z26A 2K8BB 2BZ2A 1YRUA 3HSGA 1I6JA 3ID8A 3LDNA 2Y1RI 5AM0A 8ICJA 4OX8A 1D0EA 4MFBB 1RGVA 2OEHA 3CCVN 4KI6A 3NP5A 1UWBB 1DLOA 2KJVA 2XMJA 2FMQA 2HF4A 5L1IA 1ZPWX 1CJTB 2G06A 4ZTJA 4DL0C 3MECB 1S99A 3TX0A 4FNHA 2G07A 4TN2A 3PEJA 1IR0A 4P2MA 2FVRA 3NGZA 5HRSA 1YGYA 4RLEA 3U1LA 4GV3A 2IDLA 1JJ4A 2BOPA 2HQGA 4Z6EA 4TLQA 3FCHA 4IRCA