1L3UA

Crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3'
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3uA01
5CY4A 2G8UA 5DQIA 1A77A 1HQUA 3A2FA 2Z1JA 4KHWA 1RDCA 1Q8IA 4DTUA 4DQPA 4E7JA 2X74A 3OHBA 3S3NA 3S9HA 1T7PA 2NRTA 2XRIA 4MF8A 1GOCA 3V9SA 4F2RA 3CG7A 1S5JA 1ZQYA 9ICIA 5DBCA 4F4WA 2BE2A 3ISCA 4I2HA 2ZTCA 2ZTEA 1JXBA 4CF9A 4F8RA 3V9UA 2XHBA 1S1WA 2FLNA 2P5GA 4MFAA 3PR4A 3PW2A 3L8BA 1XHZA 3OYKA 4HVJA 1JMSA 3SYZA 3V1RA 3QEPA 1ZQWA 1C0UA 4HUFA 4KLHA 8ICWA 3LANA 3NAEA 2EX3A 1W9HA 2FLPA 4CESA 4M3TA 1CXQA 3AV9A 1S9FA 3Q8SB 4RQ6A 4CHYA 4KLEA 4FO6A 2Y1IA 4KLOA 4GMJB 2F8TA 3D45A 3RB0A 3D0PA 5DB8A 3ZD8A 3GV5B 3JSMA 1S6PA 1N56A 4M41A 1SL0A 2J6SA 4KAZA 1UT5A 4DS4A 4I7FA 4FM0A 3V9WA 4NYNA 4KREA 3MABA 5KT6A 4FJLA 3NDKA 2BQRA 3RB6A 3T1AA 1U47A 4F5OA 4YD1A 1IKYA 3LZIA 4M9GA 4NCGA 2EHGA 2D0AA 1DTTA 3QERA 1VRTA 2VG5A 2JZBA 3QEAZ 2DPIA 4TURA 2F1IA 4EBEA 1WSGA 2YKMA 4KHUA 4QZIA 5KFBA 3ORYA 1ZJNA 4DL4A 5HP4A 4QAGA 4YFKA 4N56A 2UVVA 2O4GA 4CFDA 1BPYA 3OS0A 4DFPA 5T7BA 3MR2A 3RJEA 1WNSA 3ZSYA 1ZQJA 4LVSA 2FBVA 1ZBUA 4KLUA 2O4IA 5KG3A 1C1CA 4F3TA 3TABA 4TQRA 3ISDA 1ZQTA 5KFGA 5J2PA 4B9MA 4RQ0A 7ICUA 4KPYA 1ZQXA 1N5YA 3M9OB 1ZBHA 4B9VA 2P66A 4RQ5A 8ICSA 4E7IA 4O3PA 1NK7A 2E6MA 3KHGA 1U49A 3HSTB 3F9KA 5K14A 4NCBA 3K4GA 1VSEA 1ZJMA 3KK3A 4ECZA 5DK5A 3GIKA 5J2JA 4W5QA 1C6VA 1RDBA 2ZUCA 4W5RA 3OYHA 8ICEA 3TAPA 4K4IA 2YV0X 5DQGA 4I2CA 3OJSA 2I1QA 4CJWA 3L2VA 1C0MA 1K1QA 2W8LA 4H4OA 2AQ0A 4KHYA 1IKWA 3ZSVA 4Z4GA 2ZUBA 3TANA 1IM4A 3M9NB 9ICLA 3DLRA 5CZ2A 3NF6A 7ICTA 3FYHA 4MFBA 2D5RA 1QSSA 2JZBB 3ZDCA 1XS9D 3K5MA 5J29A 5CJ7A 3OJUA 2OYQA 1WN7A 5KGXA 2Q0ZX 3P1GA 4CGDA 5C24A 4L8RB 4CJ5A 2G8IA 2BQ3A 3UIQA 4F4YA 4CEBA 5EWFA 3BQ0A 3BGRA 7ICNA 1XHXA 5KI6A 4M3UA 2V4RA 1RT4A 4LZGA 1D9DA 3KK2A 2C2EA 4QZFA 3G6XA 1TVAA 5FROA 4FJXA 4FM2A 3Q8PB 5DGBA 2W9MA 5DGAA 4C8LA 1X9WA 1NJYA 4PHPA 1MQ3A 3ZSQA 4KHNA 1ZQGA 4BDZA 4FK4A 7ICVA 3LDAA 4FZZA 3H8SA 1QSLA 4FLXA 4M3WA 2X6NA 1EXNA 2FBYA 3L3VA 1NOZA 3K75D 1YVUA 1HNIA 2JEJA 3DRSA 3RMDA 3V7LA 8ICJA 1ZQPA 4RPYA 1S76D 3VA0A 4W5NA 2NRVA 4XA5A 3ISBA 5D3GA 5KFLA 4DU4A 3MAQA 4J9QA 2W8KA 4J9RA 8ICCA 5IIIA 4KKOA 2F8SA 4QW8A 3AVBA 7ICOA 3RB4A 4KTZA 1BPDA 4F5RA 2HVHA 2KQ2A 3H8WA 5CP2A 1IKVA 2XY7A 4CJ4A 3B6OA 4I29A 2BQUA 3PR5B 1J54A 4FBTA 3PW4A 4CIFA 5FRNA 3E01A 2XGPA 2ZQBA 3RJIA 4RW8A 3L2QA 4DTSA 4GC7A 3T5JA 3THVA 2D0CA 3AUOA 3G10A 5HMLA 4LSNA 4J9LA 3NFAA 2AU0A 3SQ4A 4RW9A 2G8HA 2HHVA 3ZT1A 5CYQA 3C5FA 3V6DA 1CXUA 4E7HA 2VA8A 3G6YA 1BIZA 4B9UA 4CERA 3RH6A 4RQ8A 1HYSA 2OZMA 2RN2A 3CM5A 1S1TA 3L2WA 3RJHA 4DEZA 5BOLA 1BQMA 2C22A 3M8PA 3QO9A 4Y1DA 5IIOA 4KI4A 4B9TA 9ICNA 3AA4A 1BPBA 3I0SA 3Q8MA 4KN7A 4RQ2A 3QLHA 1KVAA 3S3MA 4YMOA 3ZT4A 4F4XA 2IGIA 5HLFA 3KLEA 3BQ2A 4IFVA 2J6UA 3ZSOA 1ZBFA 4JRQA 3NH0A 5KRTA 1EX4A 4AH9A 4AHRA 2RF2A 4QWEA 3TQ1A 4RW4A 3OYLA 4FYDA 3OYJA 3HPOA 4IG0A 2PYJA 4DLGA 1JL1A 3K5OA 4R63A 9ICBA 3SUPA 1A5XA 3IRXA 3TAGA 3AVIA 3Q8LA 1J9AA 4Z4FA 1KFDA 7ICGA 2BPCA 1UOCA 4CK3A 2ZJAA 5EOZA 3MFIA 1RTHA 5KG5A 9ICRA 1N6QA 4IQWA 4Z0UA 4FJ8A 1TK0A 3MEEA 4YNQA 1S10A 1ZQNA 3L3UA 4PQUA 3RWUA 1JLBA 4DTXA 2I9GA 5KG7A 9ICXA 4Q44A 1KLMA 5HMMA 3CM6A 2KW4A 4JV2A 4CJ3A 4H8KA 3SZ2A 3V72A 2R8GA 3KTQA 1LWEA 3WNFA 3V6HA 2I5JA 5DDYA 1WSIA 3T5KA 2P6RA 2XO7A 1JIHA 9ICFA 1ASWA 4I2AA 4LH4A 1JLCA 3DLKA 3AVMA 3RR7A 4HHTA 4DL3A 4IRCA 4KB1A 4M0AA 1NOYA 2HNYA 4Z6DA 4IRKA 4ID1A 3TWHA 3H08A 1BPXA 4Z6CA 3IG1A 9ICQA 1KDHA 1YTUA 5HRPA 4LD0A 1BL3A 2Z1HA 5EU7A 2WOMA 4CJFA 2F1JA 5IILA 4KLQA 2Y1JA 4LZDA 2NRZA 4CEOA 4ECXA 4AHTA 3OS1A 4NLGA 1S1VA 2NUBA 4EZ9A 4Z4HA 2KFZA 7ICQA 3KLIA 3UXPA 4O9MA 1JLFA 3AO1A 3M8RA 4J2EA 4J2DA 3UQ0A 3PY8A 2FPKA 3HJFA 3CFOA 5KRSA 1VSLA 4YG2A 8ICYA 3RR8A 1NKCA 3KKRA 2H5XA 4O5KA 3IS9A 1D8YA 4FCYA 4N47A 3KLHA 2IOCA 3MDCA 2OWOA 4CEDA 1IXRA 1BIUA 4F2SA 1S1UA 4OVLA 4FJJA 3RMBA 1ZQOA 2PI4A 5KT5A 3KJVA 1EKEA 1DOQA 3VQ8A 1BPEA 5KFFA 2XY5A 7ICEA 3SPYA 1S0OA 4FJ5A 1SKSA 2R8IA 5HP1A 2FPMA 2GV9A 5J0XA 1NK9A 4PGYA 3KHRA 4O4GA 5KTQA 4PUOA 7ICMA 4PHAA 4CGIA 5KGWA 1ZQFA 3EWAA 3M8QA 3C5GA 1NJWA 3SJJA 1KVBA 3G0ZA 4ZH4A 4P4MA 1V9PA 1WSEA 8ICRA 2B5JA 3PUFA 2AJQA 3NCIA 1NOMA 4CJQA 4J2BA 4FS2A 4K4GA 1ZQQA 2OPRA 3VQBA 2BCSA 3NF9A 1VSFA 3OYIA 4PHEA 5I42A 5DMRA 4NLKA 3SUOA 3MFHA 4ED6A 1CZ9A 3QNNA 4NM2A 1X9MA 5DB6A 2J6TA 3AA2A 4O55A 4HUEA 3ISNC 8ICPA 2JEFA 3V7KA 1VRUA 1TFRA 4DSFA 4I2BA 2XY8A 2QKBA 2MUTB 3GDXA 9ICKA 2R8HA 4J9OA 9ICWA 1JKHA 4TUQA 2IDOA 3OYBA 4CEZA 8ICZA 3DYAA 2IHMA 4CJSA 3H8JA 3JPQA 1TV9A 5F9LA 7ICIA 7ICKA 4KMUA 4M3XA 4FM1A 1S9GA 4Q45A 1NK6A 4DFKA 4AHCA 3KHHA 3P5JA 3V9ZA 1S77D 3QEWA 3ZD9A 4GXKA 3V9XA 3HO1A 3HK2A 4YVZA 3RMCA 3PMNA 5KFHA 4KB0A 2KTQA 5KFPA 8ICLA 2AQ4A 4PPXA 5F9NA 3V7JA 3QZ8A 4G3IA 1Z00A 1U45A 3HL8A 1VSIA 1VSDA 3HXMA 2W9CA 4R8UB 2WTFA 1Z00B 1ZETA 3AVNA 1WAJA 1I39A 1CEZA 1Z25A 1XWLA 2PFPA 1S1XA 1JL2A 1VSJA 4FJMA 2BGWA 2BPGA 4J2AA 9ICCA 2R7YA 1WSFA 5IIKA 4KLIA 3HM9A 2RKIA 4IKFA 4JWMA 5KG4A 4QW9A 1CZBA 4DLEA 4YP3A 4DSEA 2HB5A 2G8FA 1ZQEA 2HHWA 3TI0A 2IBKA 2E6LA 3O4QA 5KFIA 1IKXA 4BE1A 4GXIA 1FKOA 4OKEA 3O3FA 1HJPA 1TGOA 2PY5A 2QXFA 4FLZA 2DY4A 4E7KA 4KI6A 2PZSA 1HRHA 3QIPA 1QS4A 4R65A 4F5PA 4KLTA 3RH5A 4O3SA 1ZQCA 7ICPA 1B9FA 3MGIA 3VQ4A 3OSPA 1KFSA 3ZDBA 2NRXA 3OGUA 4C8OA 1DLOA 4I27A 5J1EA 2YKNA 3DRRA 1D8LA 4KN4A 2VWKA 3K5LA 3JPTA 4CEEA 4O3NA 3K58A 1L3UA 1RZTA 2GUIA 1MC8A 4IR1A 1XC9A 3TR8A 1T4GA 1TKTA 1BHLA 5J2CA 3C1YA 3KKSA 2BGGA 3KD1E 3GILA 4MEXA 3SV4A 3JYTA 4M9JA 4KV8A 4I2FA 3AVLA 3LP0A 2ZJ5A 4YR0A 4DU3A 4C8KA 5KG2A 3BJYA 3RJJA 1B43A 3FDSA 2VG6A 1K1SA 4XUSA 4Z6FA 2AGOA 4Z4IA 4GLXA 1A5WA 1JN3A 5KFSA 3H40A 1LW2A 4I2PA 4M9HA 7ICFA 2ZTDA 4CJKA 4UQGA 3F73A 4O0IA 1ZQVA 4YD2A 3TFRA 4UBCA 3RAQA 1BI4A 3ITHA 1COOA 1BI4B 4BDPA 1LAWA 4FJ9A 1AROP 4RQ3A 1NK5A 4CGGA 1GOAA 9ICJA 2PFNA 4IR9A 4ELTA 4Q8FA 4AHVA 4FJGA 5KFYA 1BGXT 4I9QA 1CUKA 2FMPA 4Q5VA 2ETJA 2M9NA 4CCHA 3SNNA 1RTIA 5EWEA 1F21A 4YXJA 3M8SA 1ZQLA 1RDAA 4DQQA 1LV5A 2IMWP 2YNGA 4KFBA 4TUPA 4M2YA 1Q9XA 2PI5A 3PW5A 3V1OA 3QZ7A 1Z3EB 3NE6A 3UXOA 4KLFA 4DFMA 2JEIA 4KITB 4LSLA 4Z6EA 4KLMA 1RYRA 2PYLA 8ICGA 3VQ9A 4KTWA 2IAJA 4FLWA 3ZSZA 2BDPA 5HRRA 4BACA 4QCLA 2LYHA 5KG1A 5J2NA 4FJHA 4E3SA 5FRMA 2RPIA 4C8NA 4IQUA 2BCRA 1W0HA 3B0YA 3GIJA 4ID5A 1NK8A 4UBBA 2BCVA 2P6UA 2KFNA 4IFYA 3WNGA 1YT3A 3ZSRA 5HROA 4R8UA 2LSNA 3LPTA 4M9NA 3V1QA 2OPPA 1HQEA 1ZQIA 2ZUDA 3Q8QB 1RT1A 1S0MA 1HUOA 3FFIA 5J2DA 2ALZA 4O3RA 4EBCA 4CJVA 3PW0A 5J2KA 2P51A 2BKEA 5DBBA 4FW1A 4BGDA 3OSNA 2BANA 9ICEA 4R64A 3OS2A 3VQCA 4DQRA 1HYVA 3TAQA 4M45A 3SI8A 4RNNA 3I8DA 3MR6A 1U4BA 4CFBA 9ICVA 3ALYA 7ICLA 4CHQA 5KFXA 4DSIA 1KRPA 3HW8A 4DWIA 1D9FA 4YFUA 5CR0A 4RNOA 4YMNA 3GV8B 4OPKA 3NTUA 1C7YA 3LP1A 4CEQA 4OPJA 3MR3A 2Z1IA 2UVRA 3LAMA 1J53A 4M3RA 3MXIA 4ZTFA 5DB9A 3MDAA 1QHTA 4N41A 2XGQA 4OGCA 1R0AA 5BPCA 5KFNA 3RAXA 8ICQA 4DG1A 2A1JB 1X2IA 2HVIA 3SUNA 5KFQA 4F50A 4WE1A 4QZEA 4CK2A 2F96A 2ZD1A 4F3OA 4FLYA 4UB3A 1TAQA 4MF2A 1TV6A 4CJRA 3QE9Y 4ECYA 1MSWD 4EEYA 4LY7A 5KT4A 5J2GA 3GIIA 3LWLA 7ICRA 4I2EA 4KTQA 4CHZA 8ICIA 1O1WA 2E4LA 2UVUA 4M3ZA 4CHNA 1RT3A 4PGQA 2YNIA 5J2BA 4E1MA 3AU6A 2B6AA 3AVHA 4K8ZA 4DFJA 4E89A 9ICAA 2ISPA 1TL3A 1UAXA 2FMQA 1UA0A 1ZQHA 1S0VA 4MFFA 1UA1A 2YHAA 1KVCA 3QETA 3MEDA 4M9LA 1QE1A 5D46A 3JPPA 1Q9YA 3ASMA 3VQEA 1X1PA 1SL2A 7ICSA 2P5OA 2D0BA 3DOLA 3ZSWA 3LZJA 4KLDA 5KFZA 2ASJA 4FK0A 1HNVA 5KFOA 4NLZA 3T5LA 1JX4A 4W5OA 4BE0A 4QOZB 4NYFA 4CHOA 1HMVA 3H7IA 5KFRA 4CFCA 1ASVA 2BR0A 4ED8A 3M9MB 3AO3A 4P4PA 4UB4A 4UAWA 2XY6A 4RT2A 1B9DA 4QZ8A 1U48A 3KLFA 5E41A 4ECTA 2KZZA 3K57A 1NJXA 4YXMA 5J0QA 5HHHA 2JEGA 4I2IA 5KFDA 3U3YA 3SI6A 5CHGA 3K59A 3PV8A 5KT3A 3B6PA 4CECA 4M42A 5J0UA 3CFPA 1K6YA 3PX0A 4OKKA 4KLGA 4YCXA 4QZ9A 4GC6A 4PGXA 1C0TA 5J0SA 1X9SA 2VWJA 3VA3A 3CFRA 1RDDA 1ZQZA 3DOKA 3AVAA 3NGZA 3U3GA 3WNHA 1XSPA 1JXLA 4DSLA 2PFOA 4PWDA 2OPQA 4BE2A 2YNHA 2RDJA 3OYGA 2ZJ8A 3KLGA 3OVNA 3NF7A 3OYFA 1T8EA 2W9CB 1ZQBA 9ICGA 4RZRA 5FDLA 3AU2A 3C1ZA 1S9EA 4ELVA 4JK1A 3ULDA 3VQAA 4E1NA 4FVMA 1LB2B 3ZDDA 4QZHA 4CJEA 2VA3A 3AVFA 4QWDA 3VN5A 2KZ3A 4EYHB 1G15A 5L1KA 2FLLA 1JLAA 3OYEA 4KLLA 4QWCA 2W42A 2P1JA 4NM1A 8ICHA 1PZNA 4B8CA 4FLUA 5JS2A 2HHUA 5J0TA 2W9AA 3VQPA 5IIMA 1RBRA 4RQ4A 2R8JA 4Q0BA 2PXIA 4F5NA 1FXXA 1IG9A 3NH2A 3C21A 5L1IA 1I3AA 3V4IA 5DKWA 1QLNA 1VSHA 2A1JA 3H4DA 4IDKA 4CGJA 2VA2A 4HCCA 3KHLA 1ZQMA 2YNFA 3RH4A 4DO9A 4BXOA 4Z4CA 3GFKB 4O0JA 4JWNA 1REVA 3SV3A 4J9NA 3PMLA 4NLNA 5DBAA 3H4BA 4ECSA 3N4MB 3JPNA 3PO4A 9ICTA 4FK2A 5KFUA 2UVWA 4FZXC 4RPZA 2HHXA 4CJPA 1RYSA 3OHAA 4JS4A 3NGDA 4UAZA 3SQ1A 4YMMA 4ECWA 1FKPA 4XQ8A 4AILC 2C28A 1WSJA 3SQ0A 3ZDEA 1SZPA 3AVJA 4ECVA 5DG8A 1SL1A 3SQ2A 4JS5A 2MAXA 3ETLA 2HHQA 4E7LA 1LW0A 1DGSA 3QIOA 4N5SA 5KFVA 4EBDA 1XI1A 1T03A 1BVSA 3U6FA 1Z26A 3QINA 4NCAA 3HT3A 5DG7A 4KLJA 4UAYA 1L3VA 5JUMA 1A76A 3G6VA 1NJZA 1VSMA 4FJIA 4CJTA 3HVTA 4K4HA 1JLQA 3RBDA 1XSNA 3MEGA 1KLNA 1EXQA 2C2DA 1J5OA 4DOAA 3RRHA 3HPHA 3NHGA 2X78A 3PO5A 2A1RA 3ZT0A 4RW6A 4RU9A 2R8KA 9ICHA 2IHNA 4KHSA 1GOBA 3O3HA 4IG3A 5BOMA 1Y97A 3NGYA 4DOCA 3GIMA 2X6SA 3PW7A 4OKJA 4MEYA 1HYZA 2JLEA 3HVRA 2W9BA 3LP3A 1S6QA 1L5UA 3OYAA 1TKXA 4TQSA 2ASDA 4H4MA 2DTUA 2V4QA 3NH1A 5J2MA 2GWSA 5HBMA 4PY5A 4KHQA 1LAVA 1KSPA 8ICUA 3T5HA 8ICVA 3LPUA 1HJRA 2VG7A 5J2QA 5IIJA 1TL1A 2IA6A 3BQ1A 4DF4A 3MR5A 4FJKA 4CE9A 3PX6A 2ASLA 1ZQAA 4IQVA 1VSKA 3VQ6A 3SPZA 4IRDA 4CIEA 5J2IA 1EETA 2HNDA 5HRNA 1ZQSA 1RT7A 5D49A 2HMIA 4PH5A 1U9LA 1CLQA 2V9WA 2FBTA 2G8WA 3AVCA 8ICNA 4FJ7A 5CB1A 1ITGA 1RBSA 1NKEA 4RNMA 4ECRA 1RTDA 4LH5A 4CF8A 4Z4EA 3T19A 3K5NA 4EP4A 2F1HA 4GXJA 3O3GA 2FPLA 3HYFA 1T3NA 1NK4A 4KO0A 3OYNA 1IH7A 4EP5A 2B4JA 1RT5A 4B9NA 4O3OA 4DTPA 4DMNA 3CYMA 2XCPA 5D4BA 2ATLA 1ASUA 3AA5X 3RTVA 4NY8A 1ZBLA 1L3TA 3HP6A 5L9XA 4RUCA 4FZYA 4CIGA 1LWFA 2A1SA 4PHDA 1H38A 3QESA 4CEFA 4OLBA 1MQ2A 3LAKA 4PA1A 3ZT2A 1RBTA 4I2QA 1N48A 4CEAA 5IINA 4CHPA 2YHBA 2HW3A 4DTJA 1RXVA 3OYMA 4CF1A 4DL2A 3L2UA 3C6TA 4QZGA 3UXNA 1FK9A 1TVRA 3LK9A 5C5JA 4GVMA 3RBEA 3LALA 1YTAA 4F91B 4CK1A 4DTRA 5DB7A 1SKWA 4BXOB 1LWCA 4BWMA 5J0YA 3EYZA 4RQ7A 4MQ3A 4FW2A 1Y88A 2RDIA 3Q8RB 3UQ2A 9ICMA 4DTMA 4HUGA 2ATQA 2XC9A 1TK5A 1L3SA 3RJFA 1S97A 1RT6A 4DQIA 5J0WA 9ICUA 4DL7A 4ECQA 4M6WA 3HP9A 3RMAA 4J9PA 4HTUA 5SWMA 3TFSA 2HHTA 1KFTA 4CFAA 3EY1A 3UPQA 8ICXA 4F93B 3NBPA 4TSXA 1RBVA 3OYDA 3JPSA 4N76A 1BISA 3AVKA 5I3UA 3DI6A 5KFCA 5J2AA 3DLEA 2ITGA 4B9LA 3I0RA 3B0XA 3AVGA 3PNCA 3VQQA 4GW6A 4F92B 3C2LA 2BHNA 3KIOA 3DLHA 5L1LA 2B21A 1RBUA 4UB1A 4QZBA 5CYMA 3ZSXA 4TUSA 4O5EA 1TKDA 1RXWA 2BCQA 4JLHA 3EW9A 1QTMA 1RPLA 3Q8KA 4QWBA 1JLEA 1NK0A 4ZTJA 4FLVA 4UB2A 4FXDA 3VQDA 5J2HA 3DMJA 1MU2A 5HHIA 3NF8A 4HCBA 3QEIA 1BQNA 4J9MA 4X5VA 5EWGA 1XO1A 4B9SA 4W5TA 3OY9A 4MFCA 4EZ6A 9ICOA 2G8VA 4O5BA 4YR2A 1D5AA 4BDYA 3S3OA 4K8XA 5HRSA 1A5VA 4Q8EA 2BPFA 4BWJA 2DPJA 3EPIA 3MBYA 3DRPA 5KFAA 3KD5E 4CF0A 1ZQRA 5KFKA 3V6JA 1C1BA 2W9BB 3C94A 3DLGA 3OYCA 5KFWA 5DG9A 1WLJA 4JV0A 2C2RA 3MECA 4ICLA 2WONA 4CJLA 3CQ8A 4IQTA 8ICFA 4JUZA 7ICJA 4YR3A 3DLBA 4R66A 3LWMA 4XRHA 3QNOA 4Y1CA 1HUZA 1HPZA 3RJGA 4I28A 4G1QA 4ED2A 4QWAA 1XSLA 5KFJA 5C25A 4AHUA 4RQ1A 4B08A 4M04A 5KT2A 3V81A 4QZDA 4RT3A 1JLGA 3MXJA 3QEVA 1WSHA 3HWTA 3QEXA 2FC0A 3AO2A 4NXZA 3AA3A 2IS3A 1ZQKA 3DM2A 2OA8A 3TARA 4F5QA 5J2FA 3L2RA 1KCFA 3BDPA 4ED3A 3EPGA 4ED7A 4E0DA 5J0OA 4F4ZA 1WCLA 4J9SA 4JRPA 3P83D 3GV7B 4ECUA 4DOBA 4FBUA 1NKBA 1TKZA 3V6KA 5KFTA 3HPGA 8ICTA 3TAFA 2Z1GA 1TK8A 1SUQA 4DSKA 3JPOA 5J2EA 1RTJA 4RW7A 5TZVA 1KEJA 1RNHA 5KG0A 1RCHA 2ISOA 2OZSA 1ZYQA 3C2MA 4RG8A 5DLFA 1EP4A 1BPZA 3ZCMA 3MGHA 4CGFA 1UT8A 7ICHA 2JGUA 1BCOA 4DL5A 3VQ5A 4I9LA 5CWRA 4FLTA 4KLSA 2G8KA 1ZBIA 2GBZA 1KTQA 9ICPA 2OPSA 4E19A 1IO2A 4DF8A 1B92A 4RUAA 4EYIB 4IBNA 4OJRA 4CF2A 3NGIA 4OGEA 4M6WB 3LDSA 3JPRA 9ICSA 4YQWA 3PVXA 4J9KA 2PFQA 5JS1A 2DFFA 5CZ1A 4I2DA 2XCAA 5L1JA 4DQSA 4I2GA 1SV5A 5KFEA 4FJNA 4KRFA 4ELUA 3IAYA 2FBXA 3T3FA 4QZCA 8ICKA 1S0NA 4R5PA 2QK9A 2KN7A 3ZDAA 3RRGA 4DL6A 4O3QA 1C1AA 4P2HA 4XIUA 1RT2A 2IC3A 3C95A 3EZ5A 5DQHA 4DU1A 3ZT3A 4Q43A 5DLGA 3AO5A 3C23A 5HNKA 4ED0A 3N97B 5SZTA 3KK1A 3MXMA 5KG6A 4YN4A 2MUTA 2DFLA 3AO4A 3PX4A 5J0RA 4M3YA 4DTOA 3IM1A 1DTQA 4ED1A 4HYKA 4O5CA 4ZHRA 3TAMA 2NRWA 1ZQDA 4B8AB 8ICMA 2BCUA 8ICAA 3C2KA 3QEBZ 3WNEA 3C6UA 4DS5A 3IHQB 4CJUA 2QKKA 2HNZA 4AHSA 2AGQA 4FS1A 4I2JA 1TAUA 2FMSA 3BQTA 4JV1A 4C8MA 1B22A 1T05A 2Q3SA 8ICOA 3E2EA 3SUQA 4DTNA 4O44A 2KZMA 4P4OA 5KFMA 1JXEA 3O4NA 1WCNA 4F4KA 4M47A 1U04A 5J0PA 2DFHA 4CGHA 2AGPA 1RILA 4B3OA 5CA7A 2HHSA 4RPXA 4DSJA 3HX0A 4OLAA 1XU4A 1QQCA 8ICBA 5KT7A 2ZE2A 1QSYA 3TAEA 3GQCA 3SCXA 1VK0A 5C42A 5DDMA 3RB3A 2DFEA 1BCMA 1ZQUA 3LP2A 3VQ7A 4UB5A 2VANA 3K2PA 1SKRA 1WAFA 4QZAA 1UWBA 3RJKA
chains in the Genus database with same CATH superfamily
3M2RA 4Y28C 3MM7A 3WQPA 1BY9A 2Z1JA 2KB2A 4DTUA 4DQPA 5JMNA 4E7JA 2O3DA 1XJWB 1KL9A 3S3NA 1REGX 2NRTA 1KKHA 3DXSX 2LXUA 3CG7A 5LL6Z 2KSOB 1OY8A 2KG0A 5F0XA 2QEXN 5DBCA 4F4WA 2BE2A 3CMQA 4PQAA 3ISCA 4I2HA 2ZTCA 1Z1VA 2ZTEA 1N5XA 3FCVA 3A8KA 2UV8A 4IUFA 3RFAA 3IS9B 2UXCJ 4ZPVR 4DX6A 3V9UA 3PR4A 4YMEA 3L6QA 1JQGA 1U09A 4DPYA 3AD7C 3I0RB 3NGTA 1XR6A 4KLHA 2OELA 3WQTA 3CD6S 5K9FA 2EZXA 1Q8LA 2FLPA 2ILYA 3D7SB 2F63A 2RKIB 1TFWA 3MM9A 4Z2XA 3CCSN 3QX7A 1YJ9S 1LOTB 4FO6A 2Y1IA 1HNWJ 2F8TA 3TW0A 4DV0K 2ZD1B 3RB0A 3R5CA 5DB8A 5AQYA 4X4NA 3JSMA 1Z19A 2EWHA 3IBWA 1JCFA 4WFAQ 3J81U 4DV2K 2VBXA 3PDNA 1UT5A 4DV6F 5AM1A 1GK8A 1ULRA 4WJ3B 3RB6A 3T1AA 1U47A 4F5OA 3CJKB 3LZIA 1HBMB 1DTTA 5LT5A 3QEAZ 4PXDA 4TURA 3WU2U 3BGRB 2YKMA 3LP2B 3VESA 3QJLA 2O4GA 1BPYA 3UR0A 3MR2A 3DYAB 4KHPK 1FNOA 3HKWA 3GJQB 3PHEA 4F3TA 4A5BA 3TABA 2KICA 2V0NA 1X5PA 1LQ9A 2YKQA 5B08A 1XEZA 2CPDA 1WOOA 4WPAA 4JB8B 2QWNA 4IS7A 1ZQXA 3KK3B 1N5YA 1JLAB 1NH7A 2HMPA 2KKHA 3QBXA 4RQ5A 3VGUA 3ZXWA 1ED1A 1HKBA 1YITN 2KJ9A 1U49A 4ZK7M 2FHJD 2O6KA 2WAQC 1VSEA 5AE2A 5KL8B 5J2JA 2R18A 4W5QA 4DBQA 1X6JA 2L5YA 1N36F 2E7VA 3PHTA 4PPZA 1N88A 1XC3A 1DQ9A 5ETSA 2R2RA 3OJSA 2LQJA 3JAMU 2VZ9A 2AH5A 1C0MA 2W8LA 3EZWA 2B4VA 4KHYA 4EIAA 2ZUBA 4ILJA 1JUDA 4V19J 9ICLA 2OAUA 1YJ7A 2EBGA 3BR9A 3NRBA 1TKZB 2NYHA 4FVCA 3CUNA 3UNGC 4PWDB 1KP6A 4NX9A 2WFBA 2J0SD 2HSZA 2Z2MA 2MHEA 4CGDA 1OSDA 3BDEA 5HN0A 4CJ5A 2DEJA 4OX9J 2BQ3A 2GX9A 2N4CA 3CJ4A 3MUTP 2F4VJ 2O8BB 1JLGB 1YF5L 5D4PA 4A48A 5EWFA 4DR2J 4YOVA 2JVRA 2V4RA 1RT4A 4U95A 3N79A 2ZH8A 2QA1A 2OSRA 4BVPA 2FB0A 4ANEA 4YDUC 2Q0RA 3OQ2A 4FM2A 3ISND 1PBUA 3C14B 5DGBA 3PYDA 4LF8J 2FSKA 1NJYA 4PHPA 3CP8A 1MQ3A 1SZ2A 4KHNA 4BDZA 4DR3K 2LYBA 2EZYA 1HQ2A 3LTOA 3GE1A 2YNGB 1NM2A 2F4FA 3J7YP 2HK2A 5DM6L 2KSOA 3ZZZA 2X6NA 2VJUA 2FBYA 4BQLA 2DR6A 1FRKA 5G4DA 5G5HA 3RMDA 1NO8A 4X66F 4DR4K 8ICJA 2PSZA 3HVTB 4RPYA 5AM4A 3H0RB 2VBZA 5HR7A 5D4LA 4W5NA 4CE6A 3MM7B 2VG6B 4U8VA 2CPXA 1HPMA 3I87A 5KFLA 4J9QA 5EX5A 5IIIA 4KKOA 2G4BA 2E1PA 2QA2A 3I32A 2JNJA 3ZX0A 3RB4A 1YDLA 2HBRB 3QWUA 2NPIA 2HVHA 4AM7A 3FNNA 4OJHA 4Y2YA 5CP2A 2AX0A 3B6OA 2CZ9A 4AQYF 4B3OB 4OYXA 2L41A 3WDOA 3M1FA 1DARA 1J54A 1ZXIA 3EDQB 3QFHA 3PW4A 3LOUA 5AI6A 3H5XA 3CD7A 1IWAA 3THXB 3DN9A 2KVSA 2D0CA 4KSEB 4LSNA 1GXUA 3L4PA 4BG9A 1TL4A 2G8HA 3ZT1A 3HHLC 5CYQA 4YY3K 1CXUA 2ROPA 2GJIA 1ZRMA 2Z2ZA 4CVNE 3G6YA 4QS8A 1Z2LA 3MPVA 1ZOLA 4CERA 5BR8J 5B0FA 2PFUA 2RN2A 2DO4A 1NSQA 3KG0A 2OANA 4DEZA 2HIYA 3UFCX 4QYRA 3CO0P 3QU2A 3MD1A 3M8PA 3CJRA 5TKYA 2CQ1A 1IR1A 2CADA 4V1Ak 3L7PA 3Q24A 3O9QA 4C1NK 2W7AA 4LRCA 3S3MA 3K9KA 4OCZA 1FXLA 3BSAA 2VD3A 4F4XA 4GO7X 1VQ4S 4CBXA 1FVSA 3M8YA 5AQIA 5FD1A 3KLEA 2ROGA 4IFVA 3THWA 2AZ3A 1N63A 1V4TA 2VQFK 3HJVA 1S7HA 5HMXA 3F2BA 5E3CA 2DPNA 3VMFB 4KMOB 2OFGX 4DCHA 3NY0A 1Y10A 1SZHA 3K5OA 1YJVA 1LFWA 2N7YA 3CMAN 3AVIA 3Q8LA 2KI2A 3IRUA 1VQSA 4K4VA 2YJFA 2QN6B 2M52A 1KFDA 7ICGA 3EXYA 2ZJAA 3MFIA 2IYGA 4DPXA 3HMJG 1VQ7S 1Q81O 1FDBA 4ZCLA 1Z4NA 1EO1A 3CJQA 4IQWA 5B66U 1VQKN 4GVBA 4Z0UA 3VEOA 2BANB 3RWUA 2YMLA 1UW9A 5FLXO 4OJPA 2I9GA 4Q44A 3VEYA 4WFNL 3W2WA 1PJ5A 1XMQK 3PLAA 5ALKA 2R8GA 1OH8A 1V97A 3V6HA 4LUBA 5LM7E 2W2QP 1WSIA 3H42A 2O8FA 1R43A 3T5KA 3CNQP 4USIA 3LVVA 4I2AA 2M88A 5AIAA 4O0NA 3AVMA 3L3FX 3B78A 1FX2A 3PFOA 1UPHA 3TWHA 4BGAA 1UWBB 2R3VA 1SWWA 4MKBA 4ISGA 5EU7A 5AE3A 4CJFA 4F26A 4KLQA 1GLLO 1DBDA 2J0WA 1K0VA 4HHUA 1PYOB 4OYZA 1M1KT 1LWXA 2ZVIA 4Z4HA 5HP1B 5GMKa 3KLIA 5F1XA 3KFUF 4O9MA 1JLFA 4A8FA 2R2TA 5HK4A 1OYEA 4Y0FA 3UD3P 4CRJA 2FPKA 2APOA 4ISEA 1X42A 2HK3A 2VG7B 1U2FA 4H5TA 1NKCA 2Y9TA 1RAGB 5CHCB 4B3SJ 2H5XA 3PJWA 4O5KA 2VIHA 2YWEA 5HI7A 1S22A 3CERA 5JU5A 3O44A 3RMBA 3QRPA 3WQUA 2PI4A 5KT5A 4MO4A 1DJ0A 2F8HA 1DOQA 1JCEA 1YLXA 7ICEA 3EE9A 2D6FC 1Q4RA 3J81j 3P31A 1SKSA 2R8IA 2FHKA 2WF7A 3GFYA 2GV9A 1K0TA 4ZS6A 5J0XA 3I28A 4ZN1A 1WUAA 3SD7A 2FVPA 3F5EA 2H5JB 4WP9A 1M5PC 3UKUB 1HR0K 5J1NA 2O8FB 3O80A 1ZQFA 2Q4TA 1NZAA 3PJXA 1PK1B 2GUPA 1P6TA 2RU3A 1IKXB 2DBYA 2HFUA 2MKHA 3ENHA 5FPMA 4DR2F 2UUAK 3PUFA 1KNZA 3O5BA 3MN7A 3NCIA 3CD6N 2GFFA 4OX9F 4K4GA 4PABA 3MOZA 2JZ5A 5AZJB 3M8WA 3OR2B 4QPTA 1GLDG 2OPRA 1T3QA 2BCSA 3NF9A 5LJVA 2XI2A 3CCSS 4OLPA 3OYIA 5DMRA 4DR7F 1YJUA 2Q1NA 2ZBQA 3ONNA 4NM2A 4A47A 3AA2A 4HUEA 3RF9A 1YK9A 1NSKL 2IVPA 2MUTB 3GDXA 4YOUA 1RHQB 3UNYA 2HI0A 9ICWA 1JCGA 2QMUB 3B82A 1JRPA 1TV9A 5M2UA 2KP7A 7ICKA 2XI9A 4JI3K 3HI9A 5ETTA 2FJWA 1ZXOA 2BRKA 4GKJJ 2VKQA 1OMSA 3V9ZA 4CDIA 5JXSA 1LK5A 1E6VA 1IBKF 3D4JA 1VIOA 2HF3A 3GSIA 3AHPA 1DY3A 8ICLA 3TNVA 4C80A 2MYFA 3ENQA 1CC7A 1VQLN 1TFYA 1U2RA 3HL8A 4YB1P 4IG0B 4R8UB 2WTFA 1Z00B 2OMLA 4KC5A 1KQKA 3AVNA 3CEDA 1Z25A 1XTZA 4Y2JA 2H5EA 2WB1C 4BRIA 1S1XA 3UE5A 1VSJA 4IH7A 3MDQA 1XIQA 3NVYA 2JWLA 1DRGA 1IKVB 2O67A 1IN0A 9ICCA 2R7YA 1WSFA 3MK6A 4KLIA 3HM9A 4PHTX 5H9FK 5HQMA 5AI8A 5HJYA 2ZHBA 2G8FA 3TI0A 3O4QA 5KFIA 4ZPTR 3G4SS 1NXIA 1UQVA 1FKOA 4K4UA 1HJPA 1RWNB 1N52B 2Z2LA 4Y2AA 2XICA 4UUWA 3K0JA 3TA1A 4JI6J 1HKGA 4KI6A 1Q7LB 2GELA 2GNKA 4R65A 3Q2SC 4F5PA 2BXJA 1W7AA 2HOQA 4LC9B 1R6VA 4HH0A 2MZQA 1ZQCA 7ICPA 6FD1A 4FNHA 1B9FA 5DM7L 3DGPA 1NG9A 4C8OA 5J1EA 4JK7A 1UJ4A 2WF5A 4KN4A 2VWKA 2NZTA 3K5LA 4CD1A 4HLBA 1MC8A 2VPYB 3MWTA 4J03A 2HWTA 4MJKA 3W64A 1TKTA 4GVEA 1IBMJ 2BGGA 1RAOA 4GV6A 1P1TA 2IYIA 3GILA 3SV4A 4DCCA 4CZKA 1T9YA 1M5KC 2RQMA 3LP0A 3AVLA 2ZJ5A 4YR0A 2Y3YA 2PO4A 4C8KA 5KG2A 1WC3A 5AKEA 1WG5A 3RJJA 4NB4A 4XUSA 4G65A 1YBTA 3BN7A 1M5HA 1JN3A 3V81B 2MDAA 4UQGA 2HOIA 2ZIVA 2WHOA 4KHRA 1Y0HA 1FEHA 3D1QA 4KHPJ 2DD8S 1GOAA 1S4EA 4P10A 1ZPVA 1ATNA 2PFNA 4IR9A 4KRWA 1TU0B 4B1YB 1CUKA 4OZ2A 4YUDA 4Q5VA 4KR0B 2LU2A 1FFSB 2CXEA 3DRPB 5EE1A 4YXJA 3M8SA 1LV5A 1LK7A 2IBOA 1VQMN 2EFOA 2PI5A 5I3UB 3QZ7A 1Z3EB 2HBQB 1SJ3P 3UXOA 3J80U 4KLFA 4OV6A 4NLCA 5IC6B 1U1PA 4KITB 1HNZF 4CLPA 2QI2A 4UF4A 2W43A 1QTNB 2FGOA 3GTYX 5G0RB 2IAJA 5CRXA 2DNGA 3AB4B 4RJVA 4HI2A 5ALHA 3HZEA 4HDGA 3ICLA 1BNOA 2CIMA 4DR6J 5A0YB 4IQUA 1ATSA 5CHIA 5GIPA 2OGUA 5SUHA 3OFFA 2JRSA 3P39A 2P6UA 2GGPA 1WHWA 2XMWA 2NYIA 4ILGB 1U0HA 1YT3A 2DYAA 2IIRA 1CULB 4R8UA 1R27B 2D69A 4PG4A 3MXHP 4ZVRB 1CI4A 2ZUDA 2IDLA 1FFUA 4Y2UA 2VFVA 5J2DA 1GTHA 1KBRA 1HARA 4CJVA 4YB5A 2GZOA 4NJ8A 2RF2B 2MQMA 4URGA 2KK0A 2KKVA 2D3O1 3VQCA 4WFNQ 5C10A 5HROB 3ZFVA 1U4BA 4DUZK 2G0AA 3IA0A 2MZ1A 1U26A 4WYWA 1U8WA 3MGJA 4JV5K 4BJQA 1K73O 3HW8A 1D9FA 4YFUA 2CKWA 5CR0A 1YRUA 4XH4A 4YMNA 4AL7A 4OPKA 3NTUA 4WZQA 4BY9C 3LP1A 2VJVA 3QU5A 4OPJA 2Z1IA 3LAMA 1J53A 5M1OA 2XGQA 2ZKTA 1R0AA 5KFNA 1RUSA 2LM4A 2A1JB 1Q3VA 3GFHA 2BEFA 3SUNA 5KFQA 4G9ZA 2MY8A 4WE1A 3UCUP 1VQ4N 3PKMA 3VAIA 4CD3A 2F96A 1RAFB 4FLYA 2UZAA 2NZCA 5CYQB 3ZZOA 4DV3J 2KT2A 2LKYA 4MMOA 4I2EA 4CHZA 2LECA 2AYBA 1O1WA 4IOBA 3G6ES 3H2UB 1Q95G 3RVCA 1U2VA 1M0SA 2C3PA 2M4MA 3NAHA 4JHDB 2EKNA 2RAQA 3CCLN 4DFJA 2J8AA 1BWVA 3CMEN 3G8TA 1ZQHA 1EWRA 3L4IA 1S0VA 1VQ9S 2YHAA 5CZVA 4OPAA 1S1TB 1BHNA 2MSTA 4B1XB 4R25A 2VBWA 4DV2J 5BPLA 4JKHA 5D46A 1Z2ZA 3VQEA 1AXQA 7ICSA 2GCFA 2D0BA 1UZHA 1J5OB 3ZSWA 3DLLQ 5KFZA 2WUSA 2MSNA 3JB9k 3T5LA 3MAHA 1U1RA 3MGVA 1MG7A 4NYFA 1B4FA 4CHOA 3GBTA 1ASVA 1RYUA 2ZIXB 4NLBA 1N34J 3AO3A 3DLJA 2CQDA 4UAWA 2W01A 4CO4A 3ZLJA 2XY6A 1B9DA 2VGNA 3KLFA 3K57A 1Y64A 2CPEA 1RHUB 4I2IA 5KFDA 1XMBA 1Q0NA 2AEJA 2HZAA 4CM0A 3MEKA 3HM8A 3SI6A 2EQYA 4LBIA 5CHGA 4ZDNA 3I33A 3VVTA 3PV8A 4M42A 2QLJB 5J0UA 2F7VA 2KFYA 5AI4A 1WWUA 2KOBA 5GADU 4GC6A 4QZ9A 3OVSA 2ZH1A 2ADCA 3NRZA 4JAXA 1ZC6A 5J0SA 2VWJA 2ZZNA 2AA4A 4FL9A 3CDEA 3VA3A 3CFRA 5GINA 1QM9A 1N8RO 3UCZP 3MX5A 1KAZA 1D3WA 2BJ3A 4DV5K 2BBEA 2FJBB 1WI8A 3OFGA 3ZNUA 3VPZA 1YJ9N 3GYNA 1S7IA 1IBMF 3OVNA 5AQGA 1LXNA 4X4OA 1ZQBA 2VWBA 4AYBC 5A6PA 3NMAA 5FDLA 3AU2A 3J7ZT 4IO1A 2QTDA 4BC7A 3H5YA 3CULA 4JK1A 1UPMB 4E1NA 2QMWA 4YHHK 4TU9A 4QZHA 4H4OB 2VA3A 3ILOA 2KZ3A 3EGVA 4H0XB 2FLLA 1JLAA 2W42A 4CYUB 2ZBIA 2ACMA 4NM1A 2VJ4A 1ZOTA 4B8CA 3BZCA 2HHUA 1HBOA 2LCWA 5IIMA 1RBRA 2XULA 5AK6A 4RNHA 5DETA 1I3AA 2HQGA 3H2LA 4PG8A 2F40A 3N6NA 2H3QA 3IBFB 2V2KA 3P6YC 5BYRA 2A1JA 1RU1A 4A8SA 3DU5A 4IDKA 2VFTA 1ZA1B 4QNLA 4CW7B 1WUUA 3GFKB 3VERA 3AAWB 5ALJA 3WKAA 2IOFA 1IKYB 3SV3A 1OQ6A 1XK8A 2W2OP 5DBAA 3FVYA 2ZKUA 3PO4A 3I5AA 1N5QA 2W4CA 1FE4A 1PC5A 2GVZA 4U9RA 2HHXA 4CJPA 1RYSA 2VBYA 2AIRB 3OHAA 3AOBA 5J2PB 4UAZA 2HWIA 3SQ1A 3RAMA 2E5GA 2UV8G 4FPBA 2LA6A 4DV0J 1FKPA 2CGKA 2GO8A 4CLZA 3M8PB 3WKBA 3CCWA 2Y1RI 3M5RA 3K1ZA 2OEJA 2HFOA 1H98A 2KEYA 5DG8A 1SL1A 4K41A 1UHUA 3ETLA 4E7LA 4PPDA 1NZPA 4N5SA 1T94A 4GV9A 4X84A 1BVSA 4P9SA 3U6FA 2F65A 3QINA 2DGWA 3NGRA 4D3HA 2DCLA 3V4MA 2GGPB 2MY7A 4LRFA 4J9VA 5JUMA 1FJCA 1NJZA 4FJIA 1S59A 4CJTA 3ETRA 2E1MC 1JLQA 2I6XA 3FC9A 5MAOA 2FZCB 1KLNA 2GWKA 2B4OA 1SIZA 2U2FA 3EICA 2UUTA 2NXJA 3GG0A 3DXKA 2D0PA 1A9NB 4ES3A 2LHTA 3OLAA 3A5OC 5GAHU 4KHSA 4BX9C 1QUPA 4F25A 3ISZA 3NGYA 1NDCA 3GIMA 3PW7A 1KC8T 2BE7D 2UXBF 2UUBJ 4GRSA 3SFUA 4J91A 2E5LF 2HBMA 3J7A1 3QICA 1R0CB 3D6HB 2YHXA 2ZC4A 4TQSA 4H4MA 2BE2B 2VPWB 3J7AN 2DTUA 1S48A 1Z1BA 2V4QA 3FQKA 3N28A 2I5HA 4KB7A 5HBMA 4WIIA 2DR9A 3IFEA 1K9MO 2C3UA 2RJZA 3TZZA 1I6JA 1D1UA 1TL1A 3R7NB 1KAXA 2IA6A 1T44A 4K2JA 4DF4A 3E8OA 2E1ZA 2LA4A 3VGMA 3PX6A 2ASLA 1ZQAA 1RHRB 1VSKA 4IRDA 1EETA 1U2VB 2FJEB 4PL1A 2YN4A 4DX8H 2YPZA 3BS5A 1H7XA 1WG1A 1XR7A 3KLHB 4LJMA 2G8WA 1K8KA 1RBSA 2GQCA 4CF8A 2LDYA 3BYRA 3CJCA 2QWOA 4YB6A 2V34A 4JI1F 3HYFA 4M5DA 4FXVA 1T3NA 4KO0A 3OYNA 3N7PD 2MB0B 1IH7A 1T02A 3C8YA 2B4JA 4B9NA 4DTPA 3W7BA 3IM9A 5D4NA 2MRLA 3NVVA 1HBUB 2M9KA 4DV3K 2Q43A 1LWFA 2FHOB 3M1VA 3CPWR 4NXNK 4K43A 4OLBA 2IPOB 3HRDD 3EGNA 4WFYA 4PA1A 3ZT2A 1VJWA 5JVGL 1N48A 4JI2K 4LF9F 4Z37A 3N6LA 4NLUA 4CEAA 4K25A 1BA1A 4CHPA 3K17A 4LFAJ 4HAIA 1QUVA 2E88A 4F0HA 1VISA 2ZJRL 3I9ZA 2UUAJ 4DL2A 3HFZB 1VQMS 3BEGB 3GCXP 4HEA9 5LL6d 4M7YA 3F2DA 2HEKA 1X4GA 1IBLJ 3G8QA 1LEOA 3C0BA 3E9PA 3FUYA 1YTAA 4QIWF 1SKWA 1YAGA 3TAMB 4BXOB 1QQ7A 4JKCA 1WD6A 3FR0A 1KW4A 4FW2A 4X62J 3A3NB 5C2CA 1RCOB 2CPHA 9ICMA 1NHVA 3N9UC 5AXLA 2W6KA 4KH4A 2EH9A 2G0IA 2XC9A 1X4EA 3QYPA 4IEEA 3TQEA 5C2GA 3RJFA 4Q0BB 1S97A 1XMOF 2XS2A 2B5JB 4WKYA 2ODGA 3TTDA 5B0EA 1S5ZA 2UUCF 1FFVA 4J9PA 1HL6A 3R8EA 5SWMA 4C97A 2BJ1A 4FOIA 4B9QA 4RO0A 4AL5A 8ICXA 2OM6A 3JPSA 3S41A 4LF4K 3G25A 4Z94A 3AVKA 3LM9A 5I3UA 2OFHX 2W7OA 2XZTB 3G96A 5J2AA 3W8PA 2W04A 1UTAA 5I4MA 4UY8T 1H0HB 3OL7A 3F9MA 3IGNA 3E0FA 3KIOA 2JGAA 5F3XB 2B21A 4C8ZA 3MPWA 3BEXA 4LREA 2Y0BB 4OX8A 5D0RA 2H48B 3VV2B 4LF7F 4TUSA 1D8BA 2QL9B 2BCQA 5ALEA 3H45C 1QTMA 3DV9A 4QWBA 3PXGa 7FD1A 3QYYA 2KJWA 4ZTJA 1V3SA 4FXDA 4NLTA 1MU2A 4URQU 4NXNJ 9ATCB 3NF8A 2X1FA 4HCBA 3A8IA 3OTOF 2WHEA 1BQNA 2FJDB 4BRLA 3TADC 4X5VA 5EWGA 4B9SA 2MZJA 2VDIA 3L09A 2ZJPQ 9ICOA 4USKA 4O5BA 2L9NA 4EUVA 4K8XA 5K8OA 1HYSB 2V8GA 4MYUA 2BPFA 3EPIA 3MBYA 4TU7A 3KD5E 1ZQRA 2RHKA 3V6JA 4YDDB 5TISU 2W9BB 3OTCA 3C94A 2JC0A 3DLGA 5KFWA 5DG9A 4JMUA 1JXVA 1VQ9N 5F8JA 1TL1B 4KBOA 4CJLA 3I1YA 4IQTA 2HMIB 4XPEA 3LWMA 4XRHA 2HNDB 3KJVB 3MM8B 2NUHA 1RXOB 4QWAA 1XSLA 4QZDA 4RT3A 3QEVA 3H5SA 1LCUA 2F8KA 4ILHA 4NPOA 3VAMA 5H2FU 2CJQA 4ZPCA 3CJ5A 1YWXA 2OA8A 3DM2A 5J2FA 1BE4A 4ACOA 2CVIA 4CT8A 2YTCA 3S8SA 4F4ZA 2LQ5A 1J5EK 5B0BA 1F0MA 3FGVA 1FX4A 1TKZA 1VQ5N 2D1CA 3H20A 2ZUGA 3ZNJ1 5KFTA 2P9UA 8ICTA 5EY4A 4FWPA 1A6LA 3DRRB 3PIPQ 1FHTA 2CDQA 4DSKA 2HYIB 3EX7B 1KOOA 2OZSA 3NUQA 1EP4A 1BPZA 3U7JA 5K5MA 4JBCA 5JTIA 4FWLA 1QHAA 1X6IA 4XTTA 2J0QD 1UT8A 2J9CA 4DV0F 2C3OA 1CS4B 4DL5A 2JGUA 2QRRA 4RL1A 1T9VA 1KTQA 9ICPA 2DKXA 2OPSA 4CZHA 5FPNA 4E19A 1IO2A 2ILZA 4CLLA 3MEEB 3A0IX 4DF8A 4EYIB 4OJRA 1L8OA 1XO0A 4DL0C 3QIDA 2V2QA 1FNXH 1DAXA 1OYDA 2VPXB 3GLJA 4DQSA 2I8EA 1IBLK 2KXHA 1IJFB 3F56A 1DEJA 4FJNA 4ELUA 3KNGA 2FBXA 2Y1LB 4BRKA 1B0VA 1DURA 2P6TA 3PEJA 4QZCA 4U7UD 2M5YA 5AQKA 1Y5LB 2RDDA 2EDUA 1APSA 3RRGA 4Y2PA 4CTAB 5KQ8A 2RS8A 3LP1B 3AO5A 1TELA 1NH8A 4ED0A 5BREA 5A2QO 4O4GB 4IFVB 3MXMA 3SMZA 4YN4A 4DPUA 1IR2A 2DFLA 3AO4A 2AMCB 3FGUA 3CF5Q 4ZHRA 4X64J 5ALRA 5D4OA 1OUQA 1NGBA 4ICAA 1W26A 2W25A 2YKPA 3FZLA 2BCUA 1FEEA 8ICAA 1N54B 3C2KA 4LF1A 3IHQB 2Z8QA 4JI7K 2LEBA 3VEZA 3RW6A 4DR5K 2QKKA 2AGQA 3KLEB 1X4CA 4I2JA 1HWUA 4X4SA 2OP5A 5B0DA 4DR3J 1B22A 5HATA 3W66A 1P27B 4WJBA 4IJAA 4R0EA 4P2MA 2W3SA 3KJQB 3TWZA 3E2EA 4RBUA 2WZ1A 2G0JA 4WF9Q 4P4OA 4DCJB 1WKKA 2M70A 2QZ8A 3DLLL 4F4KA 1VRQC 2ZWHA 5J0PA 4IOCQ 2B8QA 2DITA 2AGPA 2BZFA 2HAFA 4RPXA 2WSCC 3A8EA 3GIRA 3DWLA 2ABYA 2JR5A 1XU4A 2F8EX 3GQCA 1VK0A 4BS2A 4W90B 5E3AA 1ZQUA 3QAEA 3VQ7A 2IM0A 1FERA 4JI5K 2D0OA 2VANA 3MN9A 1VMBA 1N61A 2O1PA 3T1YJ 1GLAG 2W6LA 1SKRA 3TVZA 3WKCA 5U47A 1NJIT 3US5A 2HVEA 1F5CA 4QZAA 1UWBA 1CPZA 3RJKA 4LIRA 1FRJA 3SMVA 2VDHA 3VGTA 4U7BA 3BS5B 3M2UB 4LSZB 4ATNA 1JJHA 3ZTQA 3M6KA 1QVGM 2AW0A 3QJPA 1MN9A 1RWWB 3W5ZA 1ZD3A 1T0TV 1GOCA 4P72A 3V9SA 1KQQA 2LEPA 3W9JA 1YHQN 4OJ1A 9ICIA 2ZIVB 4OQJA 1XMQF 3L95X 3T9ZA 2ZM6J 1DHMA 4K4WA 1PVPA 3QIPB 3IDHA 4CF5A 2L08A 4DPOA 4CF9A 1TL7B 4V19X 2DNYA 2LBOA 2P5GA 3IBPA 1CLFA 3BBFA 2F1FA 4O3MA 3ETOA 3L8BA 5AQXA 4QIWD 4ZOHC 1QQ5A 4HKQA 1NRKA 3VAJA 3V1RA 1ZQWA 1C0UA 3DOMB 3IG1B 3L7UA 3LANA 4OI6A 2EX3A 1HMVB 1W9HA 3CW2C 4GFJA 5DJBA 1C0FA 3OV7A 1S9FA 4CHYA 2QARA 1JI7A 2HRTA 2G06A 4KV8B 3QSYB 1RLCL 2XMTA 3D45A 2QC3A 4OJ6A 2ZXIA 1XQSC 4HTJA 1N56A 1O13A 2I9SA 2ATCB 1JNZB 3VENA 4L76A 4X4TA 2J6SA 1W25A 4K50A 3ENVA 3G86A 4NXMK 3ZZPA 2VFRA 4NYNA 3MABA 3PIOQ 3E3XA 2HBKA 4URSA 2ZGZA 5AFUA 1YJWS 1PJ7A 2A3JA 3TADA 4NCGA 2VG5A 1VQLS 3Q86A 5DS7A 3C6UB 4JB3A 2UU9F 4JKFA 3DKDA 5M1KA 3IAS9 4QZIA 5KFBA 2DNZA 3HSDA 4PL8A 4NYPA 4DL4A 4NXMJ 4F3QA 5HP4A 4YFKA 2VF3A 2DQNB 4RR5A 7FDRA 5T7BA 2MKKA 2J9DE 2H9ZA 3MPUB 5AK3A 3RJEA 3RSEA 1ZBUA 5A6WA 1C1CA 2V94A 5AE1A 4WIQA 1X9JA 4TQRA 1ZQTA 4C3KA 1ECWA 4ZHRB 1NNDA 4I69A 3UPFA 1L7PA 4AL6A 1SH2A 3CC7S 1SV0C 1B7FA 3QT8A 4GMKA 1RCXB 4E7IA 1HEKA 1SV5B 3TSQA 2E6MA 1SC1B 1AYEA 3KHGA 1XQIA 2IHR1 3BSCA 4OI4A 4K4ZA 5ALZA 4KH1B 3K4GA 3KK3A 1N5YB 4ECZA 4DCOB 3RUBL 2IC3B 4GKKK 5LMNK 1EB0A 1C6VA 4JD2A 5L38A 3OYHA 4X66K 8ICEA 3TAPA 1YBUA 3WXKA 4IDHA 2MQ8A 1CRXA 1RT1B 4K4IA 3KUGA 1KXPA 3T1HF 4CJWA 5GMDA 3L2VA 2HPUA 2AQ0A 1TYQB 3KZIU 1IKWA 1IM4A 2BKNA 5IQQA 3DDNA 3DLRA 5CZ2A 4B02A 3ULEB 3FYHA 1CJTA 4MFBA 5LMUJ 4J37A 1N33K 2A1AA 3VF0B 4ES1A 1M5OC 3HSCA 3H0LB 5J29A 1O0PA 1BOTO 5CJ7A 3OJUA 4FPIA 2PFDA 2LM1A 4I6AA 4F4AA 3GFXA 2MHNA 3VWSA 2G8IA 2XZDB 2W40A 3B54A 3UIQA 3WC2A 3AJDA 1O03A 2HAIA 4CEBA 2CA9A 2BH1A 2N1RA 3BGRA 1XHXA 4M3UA 2EAOA 1LXJA 1TMJA 4P7VA 2C2EA 4U7UK 4DX5A 1QAXA 1RTIB 2DKOB 4H4MB 3FK4A 3ILJA 1Q3UA 3ENBA 1S12A 5ALVA 5AZJA 4OZNA 2W9MA 3GPAA 4C8LA 1ZZNA 1VBYA 1UKUA 7ICVA 4NE9C 3MMJA 3NVZA 4KFBB 1QSLA 4FLXA 2B6GA 1EXNA 2CYYA 2JV3A 1GX5A 1ZM9A 3K75D 5KOWA 3CXCM 2W4PA 1YVUA 1HNIA 5AXKA 1GMWA 4HTLA 1YZ7A 1OIAA 3LGHA 1LKYA 2UUCJ 2YX8A 3HCXA 4C7QA 2DR8A 2NRVA 1SJRA 1F9EB 2DISA 4FF4A 4RX6A 1TKXB 3CDBA 1DLOB 3MAQA 1NGAA 2LMIA 2M0GB 8ICCA 2DHGA 2BJEA 3AVBA 3WKDA 4KTZA 1UFLA 4CWBA 2KQ2A 1G2EA 3H8WA 2OEHA 1TV6B 1CVJA 2V50A 4OO1J 4RWXA 1Q79A 3OBIA 4FBTA 3PSTA 4G1QB 3CC2S 1F9HA 3KG4A 1EWQA 4FZVA 2ZQBA 1OS5A 2DH7A 4EI2A 1VQKS 4GC7A 1GLCG 3THVA 2NNWA 3AUOA 3G10A 1GH8A 2RS2A 4J9LA 4EWTA 2AU0A 2G13A 1VQOS 2ZH2A 4JHDA 3SIPB 1BD6A 3C5FA 3V6DA 2HDOA 4E7HA 2VA8A 2A0FB 1BIZA 1NZ8A 4DDFA 4DR1F 4FYVB 4H03B 4KHPF 4C4SA 4RQ8A 4YDXA 1HYSA 2OZMA 3CM5A 1S1TA 2JX2A 3OW2R 2KO1A 2D1KA 3WK4A 2R7RA 2UUWA 1S3XA 4C11A 2YX7A 4XDDA 3ZTOA 2XMUA 1M6YA 5AI5A 1KC8O 1WORA 4KI4A 3UM9A 2CPFA 2VQEF 3AA4A 3PSIA 3OL9A 2A3VA 4RQ2A 4X66J 2EK1A 2K4HA 2HVDA 2XWXA 2CN1A 3KJNB 3TR5A 1X31C 3KFWX 5M1PA 4A4JA 2OJ3A 3LDNA 1I51B 1YGYA 2ZFHA 4WQ4A 3JSRA 5GAHP 1TVRB 2MQLA 2F9TA 2J6UA 3ZSOA 3JS9A 1ZBFA 4IEIA 4JRQA 3ZX3A 2Q6BA 2P9LA 5KRTA 2VUGA 3MCPA 1EX4A 4AHRA 1ZBTA 3LPEA 2OI2A 2G2ZA 3MMAA 1DK3A 4FYDA 3OYJA 3HPOA 4ZVOB 2NZ4A 2DVIA 2P9SB 3VF4A 2BDUA 9ICBA 2E66A 3AY9A 3IRXA 5HR6A 3CCES 3TAGA 1L7OA 2J8SA 2R7QA 3KMSA 3GSDA 1FXRA 3M05A 2LQBA 2P9UB 3MPYA 1VFJA 3HVAA 1UOCA 4CK3A 1VQ8N 5EOZA 2UXBJ 5ETVA 1N6QA 3BREA 2F9JA 4I1TA 3C65A 4OYWA 4C0OC 3QT7A 1FK9B 1TK0A 5I42B 1AUDA 1ZQNA 4XO0A 2ZWOA 1CJVB 2F5GA 4LR9A 1RDRA 5DDPC 2E2NA 1KLMA 5HMMA 2KW4A 7AT1B 3SZ2A 3V72A 3KTQA 3PIPL 1OH7A 4X65J 1Y11A 1LWEA 2I5JA 5A8KB 4P75A 1BUXA 1AB8A 2E7XA 2LKZA 3EJMA 5EOYA 2F2AB 2FC8A 2AJFE 2EEYA 5CE3A 3DLKA 4PCQA 3FE1A 2B43A 4CJ7A 3F44A 4KB1A 4M0AA 2HNYA 4IRKA 4ID1A 2YWWA 1RA7A 1BPXA 1S49A 4JI4K 3IG1A 2QGFB 9ICQA 5HRPA 1DRZA 1NAQA 1BL3A 2YNHB 1HHSA 4EELA 2NRZA 3AJ2A 2HG4A 3QGPA 1WBDA 3MTJA 2CNKB 1CQMA 1PK3A 1S1VA 1U1NA 5F0WA 2YWKA 2XNRA 3VOVA 2YH1A 4QIEA 2B51A 2NCKL 5KPRA 4J2EA 2XG8A 2MA1A 2KLAA 3PY8A 4K4SA 5KRSA 3CF5L 1JALA 1KQSR 4AQYK 3BY5A 4DJBA 1FWPA 1FIQA 4A57A 2NR0A 2WAQD 2E8OA 5ALDA 5A8RB 1U0SA 3KLHA 1IXRA 3K5PA 1SI9A 5I3QA 4F2SA 1S1UA 1C2PA 2FVQA 3CIMA 3O6QA 4ERDA 5BN8A 2DEIA 3BH6B 5KFFA 1TKTB 3DXBA 1RQLA 3GU3A 1DTQB 3OFHA 3O08A 2FPMA 1F2GA 2K1RB 3C3LA 1RB0A 3OXFA 3P5TL 5BR8K 5K4LA 4Y2VA 3NS6A 1BU6O 3KK1B 5KTQA 4PUOA 1KVJA 1VQ8S 5J2MB 4G9BA 5KGWA 4MKAA 1HNWF 5JRTA 3EWAA 3M8QA 4M5MA 3SEOA 4CBUA 4WTYA 2VOPA 3EVMA 3G82B 1V3ZA 1KVBA 4ZH4A 1RWXB 1V9PA 2QJ3A 4JI4J 2B5JA 2AJQA 2KN4A 1Q5YA 4CJQA 5KAKA 4O23A 4FS2A 4Y34A 2YTUA 1TUUA 3DHWC 4JI2J 4Y0WA 2H3IA 2IJFA 1ZQQA 4WU3A 1IIPA 1HA1A 4A8WA 2YVSA 4BR9A 1DQAA 3UD4P 4U96A 1FWLA 1U7LA 3DXKB 3PEHA 4OPHA 3RYLA 1CZ9A 4CZIA 5H1SQ 2J6TA 5DB6A 8ICPA 1VRUA 2LMRA 1TFRA 1KLMB 2QKBA 5EX0A 4OYIA 1B7YB 2WB1D 1JKHA 3D3BJ 3EE3A 2IDOA 3OYBA 4JYAK 1WEZA 3SBGA 4NLSA 4CEZA 8ICZA 2IHMA 4CJSA 3H8JA 1UJ5A 3L0QA 3FZHA 3OR1B 2ASMA 1S9GA 2A6AA 2H54B 1QY7A 1ZA2B 4NLWA 4UZBA 4L72B 3P5JA 4UY8O 3QEWA 5LJ5Y 3ZD9A 2DY9A 4GXKA 1VHXA 3RMCA 2G08A 2NYVA 2KTQA 5KFPA 2HFZA 1EQMA 3THWB 5F9NA 1ZD5A 4LBHA 3D6FB 3HXMA 3CJ8A 2E5IA 3NXZA 3OR2A 3R27A 4X62F 1IQTA 2PFPA 3SBTA 1HJOA 2Q2RA 2XM3A 1VBXA 2BGWA 1FDDA 1LKZA 1KBUA 2O8CA 5T14A 2ESEA 2HHHJ 2XIDA 1B4SA 5IIKA 4DR2K 4IKFA 4LF5J 2CJKA 4QW9A 2NO5A 4DLEA 4EAHD 4YP3A 3CJAA 2KIVA 1ZQEA 2HHWA 1NMDA 3FC4A 4OI1A 1SC4B 3LL3A 5EX3A 4GXIA 4OKEA 8AT1B 1U1QA 4OZ5A 2V52B 2PY5A 2QXFA 2KVIA 4RW7B 2OLWA 5L39A 4LSLB 4HR2A 3WIUA 3OVBA 1YIJN 3C28A 2DNMA 3QIPA 2GVDA 1QS4A 4CLYA 2JJ4D 1X7VA 3MN5A 1FD8A 1H6KX 4P0QB 2OXOA 4Y2KA 3HSZA 3MGIA 3OSPA 3D2EA 2P9PA 4ZJQA 5AQOA 1KFSA 4FWOA 3ZDBA 3OGUA 4NRUA 2YKNA 2ZIWA 5LY3A 1D8LA 1X0PA 4F02A 3KHYA 3HVWA 4WP8A 1ESVA 2GUIA 1RZTA 2KMDA 3H46O 4IR1A 1QZ6A 1KONA 1T4GA 5J2CA 2E29A 3KKSA 4PR6A 1PK1A 2EAMA 4MEXA 2YH0A 4BBYA 3JYTA 4M9JA 2GX8A 1ZTWA 1B43A 1LFPA 3FDSA 2DGOA 1K1SA 1XNQF 5DRKA 2LPEA 4Z6FA 1FESA 4Z4IA 4GV3A 2KKPA 2QXLA 4H0OA 5KFSA 3GONA 3TTFA 1LW2A 7ICFA 4CJKA 1R8PA 3F73A 4O0IA 1YBAA 1ZQVA 2LP4A 4Z7CA 3KJFB 3ITHA 4C4WA 1COOA 2ZIXA 1BI4B 3NASA 4M63C 1UVLA 4BDPA 1LAWA 1AROP 5GIOA 1GQEA 3MD3A 1VQ7N 2JXJA 2RHQB 1TL3B 9ICJA 4AM6A 4OHWA 4ELTA 4AHVA 4FJGA 1UEKA 1BGXT 3H2VE 3W65A 2UXDJ 3MCOA 4OZ1A 1M90T 3EGZA 4LF6F 2M9NA 4CCHA 3VCBA 2PA8D 3KLFB 1RTIA 2BJDA 2PC6A 4EO6A 5ALYA 4DQQA 2IMWP 3EKSA 4M2YA 1VHFA 2DT9A 2YNIB 3OFEA 1T95A 2OHFA 2BUPA 5A8WA 3HHLB 4ZJLA 1B0XA 4FPRA 4UW9A 2RE2A 1RYRA 2PYLA 2ZIUA 8ICGA 3UKRB 2IFXA 3FEYB 2P9PB 3ZSZA 1HKCA 4WFXA 2LYHA 4FNIA 2A41A 4UASA 3A5MC 1VK3A 2HFSA 3AARA 1D8ZA 1HLWA 4E3SA 1Q8BA 1N4LA 4BG8A 5FRMA 2ZE2B 1RT6B 3D9BA 1HI1A 1W0HA 3NOCA 5DDQC 2O8EB 3GIJA 2V67A 1WEXA 2AV5A 2BCVA 2DCUB 3EKUA 2GEMA 4MT1A 3BF3A 3ZSRA 2DKZA 1FTCA 3WUHA 3EVOA 4DV5J 1F6TA 3D2WA 3CCQS 4UOHA 2YKMB 4A8QA 5CD4A 4NV0A 2NSBA 5CQGA 2Z0GA 3MMAB 1U1LA 3QUTA 4P74A 2AHOB 5DBBA 4FW1A 4AT1B 3ETMA 4BGDA 2BANA 2ZJRQ 2ZVSA 2CQ0A 4XK8C 4DQRA 3I8BA 3BBCA 3SI8A 4RNNA 1XNQJ 2EXUA 3I8DA 3JSMB 5F2RA 3ALYA 4CLUA 2DNLA 5KFXA 1HWLA 1NBEB 1G6BA 4DSIA 2HQ3A 2X3GA 3CCMN 4OIXA 4TU8A 1VC6A 4RNOA 1R8HA 4MN4C 3MR3A 2YNFB 4X4QA 4M3RA 4ZTFA 4N41A 2XLKA 3O9RA 4OGCA 5BPCA 1NDKA 5AM2A 3RAXA 3EZOA 1Q86T 4F50A 1DK2A 1UVJA 3ZZRA 1TAQA 4CJRA 2RLTA 4ECYA 1X4FA 5F8LA 4EEYA 5JVGQ 1X0FA 2QB0B 4CZLA 2E4LA 2UVUA 4M3ZA 1RT3A 2V4JB 2HBZB 1PSDA 4M1KA 3AVHA 4GY2B 4QU6A 4P0PB 1M1KO 2QFIA 4E89A 2UUCK 2V7YA 2VJ5A 1UAXA 2FMQA 3MMCA 4UT4A 1LKYB 1W2BR 3NLCA 4MFFA 3AN1A 1UA1A 4Q2LA 3JAMY 2HF4A 2PEHA 5AR0A 4Y2IA 3JSYA 1QQNA 3RJMB 3QETA 4IOAL 3J81O 3BGUA 2HFVA 1QE1A 3JPPA 1Q9YA 1FRXA 3DRXA 5GAEI 2EFVA 1SL2A 1SJQA 2P5OA 3DOLA 3EO3A 4QPXA 4TY9A 5B7WA 3LZJA 1RAEB 3MR7A 1VQ5S 2ASJA 2RNEA 5AXMA 3VEWA 5KFOA 4NLZA 1FW6A 4W5OA 1S57A 3WXIA 3CC4N 3MN6A 2ZBRA 1HMVA 3H7IA 4DOZA 4CFCA 2BR0A 4IO9L 2DXFA 1Q5VA 2XEXA 4NO7A 3H6EA 4UB4A 3FEZA 2K8BB 2OHDA 1DXSA 4QZ8A 1S1UB 1U48A 2E5LK 4ECTA 1IWGA 4CI6A 2E8MA 2BKPA 5CA5A 5J0QA 5HHHA 1W7WA 2YCHA 4USVA 2QEXS 2CJXB 2MLXA 3ZX2A 3B6PA 4CGZA 2GC8A 2IVOA 3CFPA 2JFDA 3UMBA 3OTOK 4H4KA 2P6SA 1KN5A 5A2QY 4NYOA 1CJTB 4MFBB 2AF6A 1X9SA 4NA3A 1RDDA 3AVAA 4TN2A 4DSLA 4X4RA 3NGKA 1F0XA 2Q1LA 2W3RA 1PILA 2YNHA 4A8OA 2DK2A 3RGIA 2UP1A 1HBNB 3HZGA 5IT0A 3TZXA 4JKAA 2ZJ8A 1PJ6A 3KLGA 4X2BA 1HIYA 3WXJA 2DGTA 3OYFA 2W9CB 9ICGA 4CZCA 3AL0B 1SH3A 1S9EA 4YY3F 3SENA 3V4IB 3ULDA 1S1XB 5HMZA 3VQAA 3VTHA 4X64F 3WK5A 4B3MK 3LUYA 3CE8A 4GVLA 4CJEA 3AVFA 3VN5A 3WXLA 4EYHB 5GMEA 1G15A 5KAFU 1AFIA 3ENOA 3OYEA 1WOPA 4FYYB 3TX8A 2FLOA 5JS2A 5J0TA 3CCVN 1RWOB 1NPRA 4RQ4A 2R8JA 3IUCA 4F5NA 5BRHA 2VODA 3NH2A 3C21A 2HGLA 5L1IA 5M1QA 4HT5A 1BO5O 2QLWA 3V4IA 2HSEB 5EXWA 1R6YA 1WYGA 1QLNA 1VSHA 3RW7A 3HT0A 3CO9A 1ZQMA 2YNFA 2YY3A 4BXOA 1NCLA 4OYAA 5LMNF 3M6XA 1TUVA 4JWNA 4I67A 2FUG9 1HD1A 2B9YA 3N4MB 4C2MA 3JPNA 2UXCF 3DOKB 4FK2A 1J6ZA 2PBDA 2FQQB 5ADZA 5KFUA 3AB2B 3JTPA 1IJJA 1S72N 1NLKL 4BRPA 2LYAA 3NGDA 4EK2A 1D0EA 4YMMA 3T69A 3R7SB 4AILC 3F0NA 4LIWA 3W2VA 2C28A 2DGZA 4JN4A 2QMXA 1GO3F 2YJEA 3SQ0A 3ZDEA 2NXEA 3AVJA 1TUWA 3U1MA 4M5GA 2MAXA 4JS5A 3AQEA 1DGSA 5KFVA 1XI1A 3T6BA 3MMVA 1Z26A 3MCMA 4WBFA 3KWMA 3PJ9A 4CF4A 1ZBSA 4KLJA 4RKUC 4UAYA 1QAJA 1L3VA 1A76A 2WVBA 2YMQA 3HVTA 3C46A 3F53A 2IRXA 1ZPWX 2HGMA 3WHIA 1XSNA 3IG8A 2V5HG 2ZM6K 1OWXA 3CDWA 2YX4A 1ZS6A 4OZLA 4ZVUB 5BYQA 4QQBA 1PYTA 4PKIA 4K5SA 4IL6U 3ZT0A 3G8SA 4A62A 1HPZB 3Q83A 1URJA 2JH1A 4OL8A 3TKAA 2JC1A 2AP1A 3M2VA 3J8AA 1Y97A 1V5VA 2WONB 3A3OB 3AD9C 2JLEA 3HVRA 1S1VB 4P0PA 4OHVA 1WSVA 2P9EA 1MWZA 2RQ5A 3CJ1A 3OYAA 4BRNA 5D78A 1HNZK 2FVSA 1EHWA 1N5VA 4DZDA 3NH1A 1IQZA 4C23A 4WFAL 1SPBP 1U1MA 4PY5A 4C4RA 1OKJA 8ICVA 2I38A 2CH5A 1HJRA 3MR5A 2M2BA 2OTJN 4CE9A 4QIFA 2H3FA 4IQVA 6AT1B 2HNDA 2OO4A 1RT7A 2HMIA 1U9LA 2FBTA 2FF3B 3THTA 4F71A 5CB1A 2P2CB 1NKEA 4LH5A 4LF7J 4Z4EA 3TEGA 4JI3J 3T19A 4FF3A 4GXJA 3O3GA 3H1QA 5DZ7A 3UN5A 4PL7A 1M5SA 1NGFA 5C0YA 2QA4S 2A6OA 2HRUA 2PFFB 1T03B 2GVZB 3CYMA 4NZ0A 2ADBA 4NYZA 1NU0A 5D4BA 4LF4F 3HFKA 2KRRA 4B6JA 3ZTRA 3RTVA 5DDOC 3E66A 4NY8A 1L3TA 5L9XA 4RUCA 1R3NA 1S79A 3CJ9A 2WB4A 3QESA 4CEFA 3GWCA 4BGBA 4DUYF 3EMTA 1RBTA 2A19A 2GJ2A 1KS2A 3UB5A 2YHBA 4DTJA 1RXVA 2HBLA 4CZJA 5LSLA 4QR0A 3PRBA 3CC7N 2WRMA 1G99A 1NI3A 1B0TA 1TVRA 3LK9A 5C5JA 5L9NA 3RBEA 4P7TA 1VLOA 1SCJB 3EYZA 1QVFM 4RQ7A 2WVFA 5HL7L 4LF4J 3JSBA 2J9DA 3IO1A 3I0SB 2GHVC 5AK5A 1E6YA 2GW8A 2RDIA 3Q8RB 4DTMA 2N82B 4J7CA 4HUGA 2ATQA 1JNRB 3RBZA 5HSPA 3OT9A 2MQOA 1QQ6A 2NQPA 3GMGA 1H73A 1RT6A 1F5SA 5JVHL 1A6SA 5LXRA 3RMAA 1F1BB 4I6WA 4HTUA 2OPPB 3TFSA 1N32J 2HHTA 3OD2A 3EWGA 2GAHC 2KYZA 2UU9K 3EY1A 1SB6A 5JMVA 4LF5K 3BZQA 1RFQA 3SAHA 4F93B 3NBPA 4TSXA 3M8ZA 3OYDA 1WOSA 1XNRF 3U4LA 2QO3A 4CO3A 5HMYA 3VAHA 2OSQA 3QFUA 1L7MA 3FBEA 2VFUA 5KFCA 2ITGA 4FVUA 3AVGA 3PNCA 1SKUB 3U9DA 1RQNA 4GW6A 1VQYA 4U67L 2OMOA 2QW9A 1RBUA 1V3RA 1MNEA 3KUEA 2D4WA 3VTIA 4ENOA 3O9TA 4DR5F 1TKDA 3EW9A 4CH0S 4JI4F 1NK0A 1VQPN 4OHYA 4FLVA 2GIRA 4WCEQ 2KVQE 2D3ZA 2R7XA 5EVZA 2K06A 4ZCMA 4USUA 2QWMA 3CJTA 4NMLA 3QEIA 2LI6A 4I0WA 2HHHF 4MH8A 2CJBA 4W5TA 1YKWA 1FFWB 3KDOA 1OJ4A 3OY9A 1AZSA 4QOTA 1C1BB 3J80O 4AFFA 2IM3A 1D5AA 5A76A 3KDNA 3TZYA 3DRPA 1OSCA 1FA0A 5KFAA 2ZJPL 4CF0A 5A8RA 3OTBA 1XMOK 5JLFA 1P8ZA 4LSNB 4WXWA 1WLJA 3MECA 4QYZK 4Y2SA 1SIWB 2AT1B 1R7IA 8ICFA 4ZIVA 4ZVEA 1SQFA 3CT9A 5HOOA 1HUZA 3RJGA 4ED2A 3Q2TC 5C25A 5KFJA 2LFVA 4M04A 3AEVA 1YVNA 4JI1K 3D2QA 2CRXA 4X4PA 3MXJA 2AJ2A 5ELZA 2MKCA 4LF8K 3MDFA 3HBTA 1QZ5A 3QEXA 5HBMB 1SV0A 3AO2A 2IJRA 1DZ5A 3IXQA 4F5QA 3P8BB 2HBJA 3BDPA 4DV4K 3OXLA 2EFNA 3EPGA 1VJQA 4BR4A 4ED7A 1Z4OA 4E0DA 5KNIA 2FY8A 1VC0A 4J9SA 3I55N 3VHQA 1HI0P 2D74B 4ICLB 1NKBA 1EZZB 3FM9A 4J90A 1TK8A 1D09B 2W2MP 4WXOA 4M8LA 2FVRA 4CNZA 1KQFB 5J2EA 3QSIA 4RW7A 1KEJA 3PACA 4WZMA 4A2AA 3C2MA 3M3ZA 1WF0A 4PZNA 3QJJA 2BW2A 2V51B 5CWRA 3JQJA 2WW4A 3R97A 4FLTA 3Q7BA 3QFWA 1S4FA 4WYLA 4W92B 1B92A 2PE8A 3M7VA 4MO5A 4IBNA 3P3DA 4OGEA 3LDSA 3F2KA 4IH6A 9ICSA 2G2OA 5CD4H 4J9KA 2PFQA 4BRAA 1C4CA 2DFFA 3MM6B 5JS1A 3ALRA 4I2DA 3AQFA 1S9GB 3GG4A 2RILA 2E5LJ 4IFYB 2QX0A 3TUZC 3S6JA 3T3FA 4PZVA 5IQ6A 2Y0SC 4TY8B 1MMLA 2ZBPA 1LWCB 4PAAA 1T3OA 4R5PA 2K8GA 1N60A 1K44A 4P52A 1DGKN 2KN7A 2B3TB 2WBRA 3VZHA 4DL6A 1YQHA 4A8MP 2Q36A 4O8UA 3KOAA 1C1AA 1MA7A 4P2HA 5AQHA 4OHZA 2B9EA 3C95A 4OYPA 4M5LA 2ROEA 3M6GA 4Q43A 3NNHA 2H3EB 1VLYA 5E33A 2A3ZA 5KG6A 2MUTA 1J2MA 2YXLA 3MAAB 4K42A 3D6JA 4M3YA 4NZ6A 1DTQA 4ED1A 2EANA 1M90O 4HWIA 2NXCA 5AQPA 3VF2A 2QT7A 2KHDA 3W8GA 3G82A 4FPAA 4AF1A 1YZ6A 2D3DA 3CCVS 1FNMA 2K3IA 3PRDA 3AOCA 3JTNA 4FS1A 3VEVA 2YHWA 4L3NA 2E8AA 3OVAA 3BQTA 1EQYA 5AIBA 1CJKA 4FWKA 1Y00A 4E2FB 4DTNA 1EETB 3IDWA 1MWYA 1V6HA 3O4NA 3LQVA 1U04A 5D3GB 1VC5A 4CGHA 2WF6A 1O8BA 1X3MA 3HD1A 2EAPA 2D41A 4OLAA 2ZE2A 1QQCA 4LRDA 1OO0B 4X4VA 4AUKA 3SCXA 4B1WB 1SXLA 5DDMA 3NVWA 1BCMA 2KXFA 4LFCJ 3QU9A 1HFEL 3BKFA 3LP2A 9RUBA 2RRDA 4I2QB 3NAIA 1QD1A 1FJGF 1YUWA 5FIIA 3K2PA 3HI0A 3SQOP 2GOLA 2ZJQL 4EBDA 4LF6J 4OVLA 1FRMA 2LQ8A 5DQIA 3A2FA 1R59O 2KM8C 1U6FA 2KL8A 2E9ZA 1RDCA 1G7CB 2BA9A 3BGLA 3KUHA 2X74A 3O1BA 3OHBA 3S9HA 3MF5A 1RGIA 2B0CA 1BMQB 4ZVGA 5C15A 4MDBA 1T6DA 2XRIA 3FLCO 5ALMA 2M7SA 4DV3F 1ZQYA 3WK7A 3DM2B 2I5JB 2X3DA 1KQSM 1XBWA 5L46A 5AM3A 2QIFA 1LNQA 4YS2A 2OIHA 4UARA 4PZOA 2XHBA 3NEKA 1JLQB 2CQBA 2OCEA 3SQIA 4L75A 1XHZA 5C24B 3OYKA 4HVJA 1JMSA 3SYZA 1MLAA 2O66A 1UMJA 4HUFA 5LJ3Y 8ICWA 3U02A 4BRGA 3NAEA 4KX5A 4M3TA 1VDVA 2WB1F 4XH1A 5D6GA 4PG5A 4RCHA 5JICA 5GTHU 2VQEJ 1A0PA 3NBPB 3Q8SB 3OXGA 2H5IB 4KLEA 4P71A 4KLOA 2E9TA 1F3FA 1WEYA 3I56S 2F76X 3T1HK 1TE2A 3WT0A 3ZD8A 3T6JA 1NU4A 5BR9A 1S6PA 2ZH4A 3PM9A 1XNRJ 4X65K 4LFBK 2YKOA 1SL0A 4HHHA 4DS4A 4I7FA 3V9WA 4NOHA 4N7TA 1N33F 1L8LA 1YTYA 3CNHA 1WF2A 2VICA 4C98A 1IKYA 3CXCR 3LM2A 4Y2CA 2F4VF 2D0AA 3HOTA 1VRTA 1X9XA 2DPIA 4EGLA 5C12A 2F1IA 1T3VA 4KHUA 4DR6F 4YB7A 2VB6A 1T9UA 4N56A 2UVVA 1QVGR 4CFDA 3PCOB 1N0VC 1WC4A 4ZLJA 1WNSA 1RI7A 5FLXU 3ZSYA 1UCVA 3ONQA 4LVSA 5BYSA 4KLUA 3CIZA 5IV4A 1R89A 3ISDA 4B9MA 3R6LB 4RQ0A 4AXJA 3MCSA 1RTZA 2J9EA 1WG8A 2Z30B 2RIJA 2F77X 2WF8A 4B9VA 3NCRA 4C6AA 1W2BM 1TTHB 1H72C 3LGNA 4DUTA 2BW7A 4O3PA 4HH1A 4P2XA 3HSTB 4NCBA 3F9KA 4KIAA 5MLCQ 4C11B 1I3OB 3ADAC 3O6WA 3GIKA 4I7FB 1SH0A 2DIUA 3AA8A 2IY5B 3FEXB 1WC5A 4JI7F 3E01B 1G4CA 3NMRA 3FSIA 1F2HA 4ZPDA 3FZ2A 3DAWA 2GMHA 4TLQA 2I1QA 4IOXA 3FFKB 1K1QA 4H4OA 5HL7Q 3H0PA 2OTLN 2P9NA 3ZSVA 4RW9B 5ETPA 1H1VA 3NCQA 2FVCA 2QB1A 3OW2M 3FFIB 2A2DA 1RWKB 2JZBB 3S7RA 1U25A 1CULA 1FD2A 2MZRA 2VC0A 4NLQA 5F8MA 3UO0A 1WN7A 2Q0ZX 2VGMA 5C24A 4L8RB 1M1HA 2RP5A 2W2NP 4KT0C 4KJIA 2FY1A 2BUNA 3MX2A 3SR6A 1U6ZA 2FD2A 2LU1A 3BQ0A 2AYEA 5KI6A 1D9DA 3KK2A 5ALUA 5M2PA 2JH7A 1PYSB 1TVAA 5LMUF 1WDTA 5FROA 4FJXA 4IH5A 4FZNA 4FOEA 2POKA 4DR1K 3CETA 2LVWA 2O5DA 3GU0A 3AD8C 4DQ8A 1X9WA 4WWSA 3WBZA 1SIJA 1HNVB 1ZQGA 4OI3A 4FK4A 1J5EF 3LDAA 3D5MA 4FZZA 3WK6A 3H8SA 2ZG6A 3JYTB 3GG1A 2FTRA 3L3VA 3IR5B 2FSJA 2EVZA 4KX3A 1N62A 3BF4A 3TJ8A 3KYLA 3V7LA 5AJ3J 3W5XA 1I94F 1S76D 4KYZA 3VA0A 4HT7A 3BZKA 2ZWPA 3VETA 4XA5A 4IG3B 5D3GA 3WZ0A 2CQGA 2W8KA 4J9RA 2F8SA 2C3YA 1U2CA 3J7AP 3HHEA 3R9KA 1QAYA 4B3TJ 2ZZMA 4Y2QA 3R2DJ 4DB3A 2XY7A 4CJ4A 2WVDA 2Y9UA 2BQUA 1GMVA 3PR5B 3AXKA 4H