1L3UA

Crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3uA01
3SNNA 3S3NA 1BQNA 4M42A 4RW6A 7ICJA 4KPYA 4FW2A 4KLHA 3RWUA 1KVBA 1S1WA 1ZYQA 3RRGA 3ZD9A 1U45A 2HVIA 4W5RA 5CWRA 1REVA 3C23A 3AA3A 3B0XA 4R63A 3F73A 4DMNA 4B8CA 1BPEA 3U3YA 4CHPA 2AGQA 2PFOA 4ED7A 8ICFA 8ICEA 1N5YA 2ETJA 5HHHA 3D45A 5HLFA 3NGZA 2YNIA 3CFOA 5F9LA 1VSIA 4NYNA 2D5RA 4RPZA 4I2DA 1HUOA 2HB5A 4QZEA 3OYCA 5D3GA 3VQ4A 1C0MA 4CFAA 3OYJA 4XIUA 4BE1A 5HMLA 3TFSA 2QXFA 2C22A 3HO1A 3B6OA 4GVMA 2VANA 4W5TA 1W0HA 1KVAA 1Q9YA 2W9BB 2YNGA 1WSIA 1HNIA 5HRPA 3V7LA 5KGXA 5EU7A 4HTUA 4UAYA 1SUQA 2QK9A 1B92A 3SQ1A 1JLQA 4P4OA 4TQRA 3JPTA 1RT6A 4CJ5A 1T05A 3RJEA 4DU3A 4EEYA 2BCQA 9ICNA 4CEFA 3LAKA 1ZQHA 9ICMA 1ZBUA 3M8RA 5HRRA 2FBXA 1RT5A 1UWBA 3LP0A 2EX3A 5KFMA 5CJ7A 5I3UA 4BDZA 1LWFA 4LSNA 4CJFA 3QEBZ 9ICEA 3VQEA 3RH5A 8ICJA 4DSEA 1FK9A 3IG1A 3VQPA 2PXIA 1U04A 4OPJA 5KG4A 2OPQA 3PMLA 4JLHA 3OS1A 1NJWA 2AGOA 3HT3A 4ECQA 5KFRA 4FS1A 2OZMA 4IFVA 3S3MA 1O1WA 5J2QA 2BE2A 3JYTA 4EBDA 4B9VA 2ISPA 4QZ9A 5HROA 3RR7A 4FLZA 3V6DA 2YV0X 5J2GA 4ELVA 3QNNA 4K8ZA 2X78A 2VG6A 3QEIA 9ICJA 3P83D 1MU2A 4XA5A 9ICAA 4GW6A 2F1JA 5HBMA 4KO0A 4Y1DA 1BPXA 2ALZA 5KFAA 3AVCA 1WCLA 2P6RA 4NM2A 4J9KA 3MEDA 4HHTA 1ZQKA 3OYKA 3H8JA 4IQWA 4O5EA 1GOBA 4DSKA 5CA7A 3TFRA 2OZSA 1VSJA 3KHHA 3MEEA 4IRCA 4F5OA 4FXDA 2MAXA 2FMPA 4RNMA 9ICXA 1TKZA 2D0CA 1LW0A 3QLHA 4B9LA 3CM6A 3TR8A 1S10A 1WAJA 1X9SA 3NFAA 4CGDA 4ED1A 3GV7B 1BCOA 4E3SA 1NK0A 1FKOA 1A77A 4L8RB 2P5GA 2W9MA 1WSFA 4KFBA 4FJHA 2VA3A 4I2AA 1D5AA 4FCYA 4M9HA 5KT4A 1I3AA 4OJRA 4KLIA 2XY5A 2DFHA 1NK4A 2ASDA 2MUTB 1BL3A 3RJJA 5DQIA 2YKMA 2C28A 3GV5B 2HMIA 4FZXC 1LW2A 5KFTA 1RDAA 4DTJA 3RBEA 2KTQA 4Z4IA 1JXLA 5IIJA 4CFBA 3OYAA 4QZDA 4KHUA 1V9PA 4E89A 4GXIA 3AU6A 1R0AA 4OGCA 3EWAA 3EPGA 2Z1GA 3QEVA 4O3OA 2PI4A 3H8SA 4MFAA 2P51A 3OYHA 7ICSA 1ZBHA 1NK9A 5E41A 1HYVA 1PZNA 4FM0A 4RZRA 1NKBA 4DL6A 4NLZA 2KZ3A 3L3UA 2BANA 1K1QA 4C8KA 5BOMA 1NKCA 4H4MA 5KFJA 4FJJA 4YNQA 3AO3A 4RUCA 5DB9A 4B08A 4CK2A 4IFYA 4F93B 5EOZA 4RW9A 4F5PA 2AQ4A 2J6TA 1IKXA 3K75D 4DU1A 3PW2A 1Q8IA 8ICUA 4J2BA 4Z0UA 4Z6FA 4FVMA 4QAGA 1Z00B 3ORYA 1LB2B 2WOMA 2DY4A 1S0MA 4JV0A 3BGRA 4OGEA 3NF9A 4YG2A 3OYLA 1SZPA 1KLNA 2ZUDA 4C8LA 3O3GA 4LY7A 1UA1A 2QKKA 1EETA 4K4GA 2XO7A 1NJYA 1S9EA 4G3IA 3AUOA 1TK8A 3TABA 3NGIA 4M9JA 4YXMA 5KFFA 4DFPA 4FJXA 1MQ3A 1RILA 1NK6A 1VSMA 2ITGA 9ICPA 1IM4A 3AO4A 2OA8A 1IKWA 5CB1A 3OYBA 3UXOA 1ZQRA 3HW8A 1YTAA 2OYQA 4KHWA 1ZQNA 4FLXA 3MGHA 2G8UA 3DM2A 1GOAA 3GIMA 4UB3A 5KFOA 4EZ9A 1NKEA 3VQDA 4M9NA 3F9KA 1TKTA 1A5VA 4F2RA 3TAFA 5DLFA 1RT2A 4F8RA 4KI4A 4TUPA 4DTOA 4W5NA 4DQIA 3HM9A 4E1MA 2HNYA 1UT5A 3QEPA 4P4MA 3TAQA 3MXMA 2HVHA 4UB2A 4DQPA 4F4KA 1ZQJA 4DTMA 4OKEA 3SV4A 3K58A 1J5OA 8ICZA 2YHAA 3JPPA 4GMJB 4B9NA 2IAJA 3ZSXA 1Y88A 4W5OA 5KG6A 4KLLA 4RU9A 4P4PA 3GQCA 2X74A 4YP3A 1RZTA 3LPTA 3C94A 3C2MA 4J9QA 4RQ3A 3FFIA 1S1UA 1G15A 9ICKA 1S0VA 4EP5A 5J0OA 4DTRA 4CHOA 3QO9A 2BGGA 7ICMA 4DFKA 1IKYA 1TL3A 4DQRA 1HPZA 4CFDA 4IQVA 4N47A 3JPQA 3TQ1A 5J2KA 4J9PA 4FJ7A 4B9UA 1XWLA 4CJKA 4R8UA 2W42A 4AHUA 3HYFA 4X5VA 3M8SA 3NF8A 4FK2A 3RMBA 4JUZA 4ID1A 4CJEA 4KLFA 1DOQA 4EYIB 4FLUA 1WLJA 3KTQA 3Q8QB 3SV3A 1BHLA 2A1RA 3HXMA 5J0TA 4P2HA 1ZQZA 3V9SA 2KFNA 2KN7A 4OKKA 2HHVA 3RAXA 3OJSA 4J9NA 1ASUA 3PO5A 1EXNA 1RDCA 1K6YA 2HHQA 1W9HA 3G6YA 1RTJA 1TAQA 4YCXA 4FLTA 1WSEA 2BPCA 4DL3A 4O5CA 1RT1A 1JL2A 3V72A 4CJVA 4QOZB 8ICAA 1JN3A 1RTHA 2XC9A 3Q8LA 3DLGA 4Z4CA 3KKRA 2ATLA 3OHAA 4MFCA 3SUPA 4DQSA 3AVLA 4QZ8A 4KITB 4IG3A 2G8HA 3OJUA 1S77D 3MAQA 4KLDA 1MC8A 1T8EA 3WNHA 2E6LA 3LK9A 1CUKA 1Q9XA 4Q0BA 5L1IA 1TAUA 4AHRA 1KDHA 3KD5E 3PW7A 3GILA 3PX6A 3ASMA 3THVA 1IH7A 3L2UA 2NRTA 3H08A 1RBSA 5KRSA 3CFRA 4O3PA 3JPSA 1L5UA 8ICLA 4KRFA 1BI4A 4UB5A 4TURA 3ZSOA 4F3TA 3LALA 4CJ4A 2VA8A 2E6MA 3ZDAA 1C0TA 2X6SA 4ICLA 4TUQA 4CHNA 2Z1JA 3VQ9A 3MECA 3OYIA 4M6WA 4M04A 2FBTA 3O3FA 2G8KA 5KFIA 4I9LA 3MFIA 4PH5A 5T7BA 1ZQWA 1ZQTA 4ED3A 3NH2A 4F4ZA 1N56A 5J2EA 3UIQA 3T3FA 3G6VA 4KKOA 1HYZA 4HCCA 3ALYA 2ZJ8A 4H4OA 4PQUA 7ICOA 4M9LA 1S6QA 3RH6A 4W5QA 3ZDEA 1JLBA 5KFKA 3RTVA 3NHGA 4JRPA 4KLEA 5J2FA 2XY7A 7ICQA 1F21A 3HX0A 4LVSA 1KCFA 3K4GA 2M9NA 4KV8A 8ICWA 4ID5A 8ICOA 2IS3A 4CEOA 3OYEA 3KK3A 3OY9A 1UAXA 1A76A 4CEZA 1RBRA 1N48A 4FZYA 3AVBA 1RTDA 4ED8A 1FXXA 4RQ0A 4IRDA 3RMDA 4PUOA 4CEEA 4YMOA 3JPRA 1ZETA 3T19A 4DOBA 4F5NA 1TGOA 4CEAA 2G8FA 3ZSYA 3K57A 3ZT3A 3AVHA 3CYMA 3AV9A 4F50A 5J2MA 1QSLA 1LAVA 3TANA 1ZQQA 4DFMA 1WSHA 2YKNA 7ICNA 1HRHA 4CHYA 2IA6A 3OS0A 5L1JA 3RB3A 3CQ8A 2UVUA 8ICMA 4MEYA 1ZQLA 4ZHRA 2BGWA 3HK2A 4RPYA 4IBNA 4AHVA 5HP4A 4QW9A 2JEIA 3PV8A 4FLWA 3V9ZA 1BIZA 2LSNA 4J9SA 3UQ2A 5KFSA 2G8VA 3T1AA 1CXUA 4E0DA 4Q5VA 3AVNA 3SQ0A 5DG7A 2UVRA 4IKFA 3C5FA 4BXOA 3V6JA 4M3TA 3AO1A 1RBTA 4O3SA 4B3OA 1JKHA 4K4HA 5DLGA 7ICTA 1WCNA 2NRVA 2VWKA 2FBVA 4RW4A 1NJZA 4M3RA 5J1EA 1ASWA 4AILC 1EX4A 3AVMA 4PPXA 5J2NA 3OSNA 3LP3A 4PWDA 4O3QA 3JPOA 4PGYA 1Y97A 4M2YA 3MFHA 4KB1A 2FBYA 1U48A 4DL2A 2HHXA 1CZBA 1ZJMA 3GDXA 3MBYA 5J0QA 2AGPA 3TAEA 1KTQA 3TI0A 4YD2A 1BPYA 4FZZA 2H5XA 3QEWA 3MEGA 4MF2A 4J9MA 5KG5A 1NJXA 4B9SA 3OVNA 2ATQA 1NOYA 1BISA 1TKDA 2F8SA 4BE2A 3BJYA 1ZQSA 3TAGA 4I9QA 3OYMA 1XI1A 4ECUA 3E01A 3KHRA 4CEDA 3VQAA 4CIEA 4IR1A 5FDLA 2KZMA 5CY4A 1C7YA 3Q8KA 3T5KA 7ICLA 1Z26A 3DLKA 4O5BA 2B4JA 4NXZA 4J9OA 2BQRA 1WSJA 1XSLA 3ULDA 5J2HA 3IM1A 2GUIA 1JLCA 4BDPA 1KFDA 2BKEA 1BQMA 2HHSA 5I42A 4I2BA 2W9BA 4E7JA 3H8WA 2AJQA 1L3UA 2PFQA 4Z6EA 4NLGA 1RBVA 2Y1IA 9ICGA 8ICHA 3FDSA 4I2IA 2O4GA 3OYGA 4CF1A 3QERA 1RPLA 1TK0A 2XY8A 4O0IA 5L9XA 1ZQPA 5CR0A 4M3WA 3U3GA 3G10A 4ECZA 3JSMA 4CJSA 1BPDA 2KQ2A 4I2QA 3C5GA 1CZ9A 3KJVA 4HVJA 2XHBA 2RDJA 3PY8A 2BCRA 3K5NA 4Y1CA 3BQ2A 2ISOA 4MFFA 3CM5A 3MDCA 3ISDA 1ZBIA 5BPCA 1YVUA 3ZDDA 3OYFA 3OYNA 3PO4A 3QESA 9ICCA 3Q8MA 5HMMA 4JWNA 3DOLA 3S9HA 3SUNA 5KT5A 2BPGA 2WTFA 3KHGA 4CJTA 4LSLA 4CFCA 1KFTA 4CEQA 3V9WA 8ICVA 3TAPA 4KTZA 5SWMA 2XCPA 1U4BA 2R8HA 4KTQA 3VQ5A 3MABA 3HWTA 3RJIA 3S3OA 4DO9A 1RCHA 1SKRA 2W9CB 2F1IA 9ICLA 3TAMA 4O44A 4YMNA 2I1QA 4OLAA 1S9FA 4Z6CA 3IHQB 3K59A 3PX4A 1ASVA 2A1JB 3VQ8A 1VSEA 2XCAA 4CHZA 3AVFA 7ICEA 3O4QA 3HVTA 3LPUA 4FJIA 4ECXA 4R5PA 2WONA 5BOLA 1LAWA 1JL1A 4YFKA 3RMAA 5J2IA 2IHNA 3A2FA 4K4IA 1N6QA 4WE1A 2NRXA 1JXBA 2ASLA 2X6NA 5D49A 1JX4A 3CG7A 5DBBA 2FLPA 2DFFA 4KN4A 3LWLA 5KTQA 4KN7A 3GIJA 3KD1E 3C95A 4FLVA 4ELUA 5KGWA 5L1LA 4R66A 1VSHA 1CEZA 3O4NA 2P5OA 4M47A 8ICYA 4CJQA 3C2KA 3MR2A 3ISBA 8ICRA 3EYZA 7ICKA 4YR3A 1UA0A 3KK1A 4HUGA 3UPQA 3WNFA 2J6SA 4O9MA 5IINA 2R8IA 2ZTCA 4JV2A 4DWIA 1WAFA 5DB7A 3VQ7A 3TWHA 2P66A 3KIOA 3ZDCA 1QSSA 1RYRA 4RPXA 4BGDA 4NCBA 2PI5A 1KSPA 5DQHA 1X9WA 3QEAZ 1L3VA 3RB6A 2HW3A 4YD1A 5J0SA 3AVJA 3SQ2A 2I5JA 1KRPA 2GBZA 2C2RA 2BQUA 4DOAA 3D0PA 5KFLA 3HP6A 1MSWD 4B9MA 2ZJAA 4C8NA 2JLEA 3ZD8A 7ICGA 1VSDA 4O55A 1VSFA 1C1AA 4KHSA 4UBBA 8ICTA 1XSPA 3NF7A 2F1HA 3ZSWA 4CIGA 2BQ3A 5DMRA 2IC3A 2BDPA 3B6PA 4N76A 4E7IA 1JLGA 3PR4A 3KHLA 4IR9A 4E7HA 2D0AA 3I8DA 4EYHB 9ICSA 1J54A 4CJPA 5TZVA 4QWAA 2JZBB 2AU0A 4FJGA 4TUSA 4LZDA 4KLSA 1XS9D 3VA0A 4HUFA 2RDIA 4XQ8A 3DLRA 5KFBA 2IMWP 5JS1A 1Z00A 2NUBA 3SUOA 4QWEA 3QE9Y 1J53A 3RMCA 4O3NA 5J2BA 2ZTEA 4EBCA 4Z4EA 3OYDA 1S0NA 5DGBA 1ITGA 1C0UA 3C6UA 2V4QA 3GIIA 1X9MA 3AA5X 3V1QA 5J0UA 2B6AA 1BI4B 5KT3A 3RR8A 2ZTDA 5DBCA 1ZQOA 3SJJA 2BHNA 3DI6A 4FYDA 3HPGA 3VA3A 2O4IA 4FM2A 2PYJA 2C2EA 2UVVA 3P1GA 4RG8A 4RT2A 9ICOA 4ED6A 2E4LA 3HSTB 4M6WB 5D46A 3V4IA 1RTIA 4EBEA 4R64A 3ZSZA 4F2SA 4NCGA 5HRNA 4N5SA 2R8KA 2G8IA 1CXQA 3MR5A 2ZQBA 4CHQA 4RQ7A 3AA2A 1RYSA 2F8TA 4FK4A 3GIKA 1A5WA 4JRQA 3LP2A 4KAZA 4RW7A 4DQQA 4F91B 3KLFA 1S9GA 4PA1A 3OS2A 4PHEA 9ICRA 3B0YA 4DL7A 3MR6A 2D0BA 1ZBLA 3V6HA 8ICPA 4PY5A 1ZQCA 4PGQA 8ICQA 2PFNA 8ICBA 1B9FA 5KFQA 3TARA 3ZT1A 3GV8B 2J6UA 3AVGA 4CESA 3DYAA 1Z25A 2I9GA 1J9AA 2AQ0A 5F9NA 1XU4A 2VG7A 1U47A 1HYSA 2F96A 8ICKA 3NCIA 4Q8EA 4M3XA 1BGXT 2LYHA 1IO2A 3AVAA 4CK3A 4KLQA 1QS4A 2BCSA 3C1YA 2VWJA 4FJ5A 1WSGA 2P1JA 2Z1IA 3KLGA 4F4WA 9ICQA 2GV9A 2KZZA 1RT4A 1ZQEA 4JS4A 1TL1A 4YVZA 5J0PA 1S0OA 5DG8A 5CYQA 8ICCA 3DMJA 4CF0A 4FS2A 2ZD1A 5J29A 3M9OB 4Q8FA 4PHAA 5DKWA 3L8BA 1B43A 4FBUA 3BQ0A 3Q8RB 1KFSA 2P6UA 5KFEA 1RT7A 4C8MA 4DSFA 2FLNA 3I0SA 4ELTA 3VQQA 5KFHA 1T3NA 2PY5A 3LDAA 4DEZA 4NYFA 4FJNA 4QCLA 1COOA 5KFZA 4ECYA 3VQCA 3MGIA 4ECSA 3BQTA 1TK5A 3HPOA 4DS4A 5C5JA 5KRTA 1JIHA 1BPZA 3I0RA 2IOCA 4LH4A 2OPPA 5J0RA 5KG3A 3UQ0A 3SYZA 4F4YA 4QZHA 5DBAA 4BWMA 4DS5A 4J2DA 3PR5B 5KG2A 4M3YA 3T5JA 5J0YA 4KREA 3OSPA 4QWBA 4MEXA 2FPLA 1IKVA 3QZ8A 1QE1A 4CE9A 7ICPA 3C1ZA 1ZQIA 4GLXA 5KFWA 4KLMA 3U6FA 1SV5A 5DDMA 5KFYA 4QZIA 5CZ2A 2FPMA 5KFDA 5FRNA 4UAWA 4DTNA 1U49A 2KW4A 3FYHA 3AO2A 1SKSA 3HJFA 5L1KA 3HVRA 3H40A 4NLKA 1XHXA 4OLBA 4FBTA 3ISNC 1IXRA 5DG9A 3L2RA 2HNZA 4I2PA 9ICVA 2IBKA 4KLOA 3LWMA 3EY1A 3KK2A 2ZJ5A 3RH4A 2BPFA 2JEFA 5KFNA 2XGQA 5DGAA 2HHTA 4OKJA 3IRXA 2V9WA 2VA2A 3QNOA 3ZCMA 4M41A 4UBCA 1QSYA 3RJGA 3BDPA 9ICTA 3V1OA 4RT3A 3V6KA 3NE6A 4ZTFA 4HCBA 5KI6A 4CJ3A 4RQ8A 1T7PA 2RKIA 3ZSRA 4CF8A 5EWFA 8ICSA 4ECRA 3PW0A 5HP1A 5JS2A 4E1NA 2XY6A 4YN4A 2ZUCA 1GOCA 3ZT4A 3T5LA 8ICGA 1JMSA 1YTUA 2HHWA 3SI6A 3ZT2A 2UVWA 4DSLA 4KLJA 8ICXA 4I7FA 4KHNA 5K14A 1XO1A 3NDKA 3AO5A 5JUMA 3T5HA 1WNSA 3O3HA 3QEXA 4QWDA 1SKWA 1ZQXA 4Z4FA 3RB0A 1S5JA 1ZQBA 4DF4A 3BQ1A 3K2PA 3QETA 3SPZA 5IIIA 5KFUA 1QHTA 2EHGA 3ETLA 1L3SA 2NRWA 4YMMA 4BDYA 5KG1A 4Q43A 3QZ7A 1XHZA 4FJ9A 1NK7A 4O0JA 1ZQFA 3G6XA 2KFZA 1WN7A 4PHPA 1NOMA 3PW5A 5J0WA 3M9NB 3ZSVA 3LAMA 5CZ1A 4ED2A 4J9LA 1D8LA 4LD0A 4HYKA 1MQ2A 4CIFA 4DOCA 4GXKA 4ECVA 5KT2A 4JV1A 1DTTA 4ZTJA 3AU2A 5KG0A 4CF2A 4ED0A 1HJRA 2ASJA 4M3UA 3Q8SB 4Q44A 4QZCA 2FMSA 2RN2A 4DTPA 2RF2A 3SUQA 3SI8A 3G0ZA 5FROA 4CGHA 3LDSA 4TSXA 2FMQA 2ZE2A 5KFPA 4K8XA 3RBDA 3AA4A 1SL0A 1JXEA 2ZUBA 5C24A 4GC6A 1H38A 7ICVA 1S1XA 4J2EA 3PVXA 3M9MB 2B21A 4CGIA 2DPIA 4LZGA 5D4BA 4AH9A 5FRMA 3UXNA 3RJFA 1RNHA 3NF6A 4F4XA 2RPIA 4AHCA 3C2LA 2A1SA 2PZSA 2R8JA 1S1TA 4UB1A 1RT3A 2G8WA 1BIUA 2W9AA 4G1QA 3ITHA 4I2HA 2IGIA 1XC9A 1T03A 2C2DA 4DSJA 2FPKA 8ICNA 2VG5A 1S6PA 4FJ8A 4NCAA 3KLEA 4QWCA 7ICHA 4DTSA 4CEBA 1X2IA 1X1PA 4R65A 4HUEA 1D9FA 1HNVA 4CERA 7ICUA 3LANA 1BPBA 3ZT0A 4IG0A 4MF8A 3RJHA 4IQUA 3H7IA 5DQGA 2YHBA 3RRHA 3QIPA 5KFXA 4IRKA 1SL1A 5KFVA 2OWOA 4RQ5A 4KHQA 4DL4A 4H8KA 2W8LA 3ZSQA 4AHSA 1C1CA 4RW8A 1HMVA 1YT3A 4M3ZA 4I2EA 4I29A 3MXIA 1DTQA 2OPSA 5KT6A 4RQ1A 3NTUA 1S76D 4NM1A 1QTMA 1TVAA 5J2DA 4ECWA 1ZQDA 4I2CA 3L2QA 3RB4A 4QW8A 4FJLA 2PFPA 4BWJA 3ISCA 3NGDA 3DLBA 4QZFA 1LWCA 5SZTA 4KTWA 4DTUA 7ICIA 4UAZA 4IQTA 4MFBA 3KLIA 1VSKA 5KFCA 1B22A 4YXJA 4RQ6A 1HQEA 3P5JA 2JEJA 4UB4A 4CF9A 3LP1A 1FKPA 2JEGA 3H4DA 4FJKA 5IIMA 1XSNA 3EZ5A 1ZQAA 4CK1A 5J0XA 4CGFA 1RDDA 2Z1HA 3NH0A 1S1VA 1NK8A 4CECA 1JLAA 1NOZA 2MUTA 5DB8A 4J9RA 3WNEA 3OHBA 4O5KA 1HJPA 3ZDBA 7ICRA 3RJKA 1I39A 4CJRA 1ZQGA 4EZ6A 5KG7A 4R8UB 4Z6DA 3AVIA 4AHTA 3AVKA 4QZAA 4IDKA 1C1BA 1EXQA 1T4GA 3CFPA 4NLNA 5EWEA 1VRUA 1KVCA 3MXJA 4I2JA 3LZJA 3C21A 3VN5A 5CHGA 3EW9A 4O4GA 4C8OA 5J2AA 4RQ4A 7ICFA 2IDOA 3WNGA 3SZ2A 1NK5A 3NAEA 3DLHA 3V9UA 4DTXA 3VQ6A 8ICIA 5J2JA 4BACA 5J2PA 3NH1A 2W9CA 1Z3EB 3KLHA 1UT8A 1TV6A 4QZGA 4ECTA 1TVRA 2PYLA 4XRHA 1AROP 4E19A 4NY8A 4BE0A 4CJLA 4F3OA 1UOCA 4M9GA 2A1JA 4B9TA 4YFUA 1U9LA 4O3RA 1RXVA 9ICUA 4DLEA 4CGJA 1VSLA 3M8PA 3N97B 4DLGA 2Q0ZX 1HUZA 4CCHA 4DL5A 5C25A 4KB0A 3PW4A 1RXWA 4MQ3A 1ZQUA 4RNOA 2HHUA 1IG9A 1ZQMA 4E7KA 3PNCA 3MR3A 4CJWA 4N41A 1HQUA 3IS9A 4I2GA 4QZBA 2Y1JA 5DDYA 3UXPA 4F5RA 2W8KA 4Z4HA 4JK1A 1C6VA 4PGXA 4KI6A 3L2WA 3C6TA 4FJMA 9ICBA 2YNFA 1EKEA 3L2VA 9ICHA 4KLUA 3PX0A 4KLTA 2YNHA 5KT7A 4YR0A 1CLQA 3QIOA 2BCUA 3VQBA 2DFEA 5CP2A 1TFRA 3SPYA 1EP4A 1TV9A 4B8AB 3KKSA 4Q45A 1K1SA 4J2AA 4DSIA 2OPRA 1L3TA 1VRTA 3DOKA 4DU4A 3V81A 3H4BA 1RDBA 5IIKA 5J2CA 5HRSA 1QLNA 3DRPA 4KHYA 4FLYA 2GWSA 4CJUA 2Q3SA 3HPHA 4I27A 4M0AA 3MDAA 3N4MB 2JGUA 4DG1A 4TQSA 3NGYA 3EPIA 4KMUA 2BCVA 4XUSA 3QINA 2R8GA 5DK5A 4FW1A 4RNNA 4N56A 2DPJA 4KLGA 3V9XA 3M8QA 5IILA 3E2EA 5KFGA 3IAYA 5HNKA 1A5XA 3HP9A 2IHMA 5CYMA 1QQCA 3OGUA 1D8YA 4GC7A 5EWGA 3DRSA 3HL8A 2BR0A 5DB6A 1LV5A 2XRIA 1ZQYA 1DGSA 2NRZA 3L3VA 4FK0A 2DTUA 4RQ2A 4ZH4A 2JZBA 1TKXA 1ZBFA 3NBPA 1LWEA 1SL2A 4E7LA 4DFJA 4YR2A 4FM1A 3V1RA 1BVSA 2FLLA 1RBUA 1JLEA 3K5OA 3K5MA 3SQ4A 4OPKA 3RAQA 1S97A 9ICFA 4EP4A 4JS5A 1KEJA 4I28A 2V4RA 1DLOA 4RUAA 4CGGA 1BCMA 3LZIA 2FC0A 4DF8A 4JWMA 2HNDA 4F92B 5C42A 1ZJNA 4M45A 3PUFA 4I2FA 3DRRA 5HHIA 2DFLA 2XGPA 4UQGA 1KLMA 3Q8PB 3SCXA 3GFKB 4GXJA 2QKBA 3V7JA 4LH5A 3PMNA 4OVLA 1ZQVA 3JPNA 9ICIA 4PHDA 9ICWA 1VK0A 4BXOB 3K5LA 5IIOA 4YQWA 3DLEA 4F5QA 2R7YA 1D9DA 2B5JA 1JLFA 4FO6A 3V7KA 1B9DA 4Z4GA
chains in the Genus database with same CATH superfamily
3AJ2A 2BVZA 1BQNA 2DVIA 3H0PA 1VGYA 1SZ2A 4NA2A 1ZYQA 5J2NB 2DNHA 3D7EO 1RBAA 2LEBA 2H5EA 2OKQA 2AA4A 4GVBB 2HFVA 1YHQN 1H0HB 5CWRA 4NLBA 2FJ6A 3MTKA 2Y8YA 3DAWA 5GIPA 2V52B 2Y0BB 1MG7A 4Y2MA 4ZJOA 4DMNA 3UCGA 3L3FX 4CHPA 3SQIA 2B6GA 4OX7A 2UXCJ 3QSIA 4C7YA 2MQOA 8ICEA 2LI6A 3W8PA 3VHQA 2F4VK 3DC2A 5ALJA 1EQYA 3D45A 1SXEA 2FB0A 4FN5A 5HLFA 3QUCA 2DY1A 3CFOA 5F9LA 1VSIA 2F65A 4NYNA 4I2DA 1HUOA 4QZEA 3ELHA 4DR3K 5D3GA 2O8EB 3H25A 1Z4NA 3MAHA 4XIUA 3TFSA 2M2BA 4USIA 2VASA 4WK3A 4OX9J 3MMJA 1Q9YA 2YNGA 3VV2B 4BGAA 4ZCKA 3MR7A 2VB6A 2EC0A 2JV3A 3V7LA 3D2SA 4EGLA 3CCUN 2KD1A 3FCVA 3M2VB 4OYBA 4ZVGA 5D6GA 4HTUA 3OT9A 2QK9A 3SQ1A 4P4OA 4X4RA 3JPTA 2BM1A 4YMEA 2LQ5A 4FVCA 2F4FA 1N33J 5ALEA 1UVMA 4CEFA 2M0GB 4OHVA 1ZBUA 1K9MO 5HRRA 3W66A 2HOQA 5DDPC 2R7OA 1P9QC 4JK9A 4H4KC 5I3UA 1ZM2A 4OHWA 1NJIO 1OQ3A 4FWLA 3LF0A 2VOPA 2JFKA 3D6HB 1KKHA 2A3JA 2DH9A 3O0FA 3QEBZ 3PRVA 4J7CA 2GVDA 1AUSL 2B7CB 2OLWA 5L9NA 4WFAQ 4LF7J 4DSEA 2PGCA 3HMJG 3EVOA 3VQPA 2K4PA 1U04A 3GOIA 4OPJA 1GXTA 4ETZA 1BHNA 3DOLB 5F8GA 3HT3A 3NNAA 4DB3A 3IWNC 2V63A 4ISEA 5LJVA 2XEXA 2V0NA 4B9VA 1XBWA 3GWCA 4F36A 4YORA 5HROA 3RR7A 3SQGA 4FLZA 3IXQA 1XR7A 5J2GA 3P5BP 4ELVA 1IG6A 1RISA 1WHXA 3EUNA 2N7YA 9ICJA 1HMVB 2V7ZA 1SC3B 4C8YA 1X4CA 4XA5A 4C80A 2F1JA 3TOQA 4Y1DA 1BPXA 3I31A 1WOPA 2VCPA 5F3ZA 1IR2A 4JI2J 2NXCA 3L7OA 4OPAA 2BJ3A 3HHLC 3W63A 1XUPO 4DR7K 4IRCA 1QDUB 5J1PA 4FXDA 4A47A 5GINA 5IQ6A 4CNZA 5M1FA 4A8YA 2FMPA 2AV5A 2LCWA 5DM6L 5D0EA 3K8WA 4JHDB 3HI0A 3QLHA 1HIWA 1RP5A 3CM6A 1RB0A 2QWOA 4CGDA 3GV7B 3M30B 4E3SA 2YBVA 1NK0A 1RHUB 3MMBB 3LUYA 3LVVA 4ZVFA 4KFBA 1HWJA 2J9DA 3PZPA 1CRXA 1FFUA 1EAYC 2QARB 2RP5A 2L9DA 1I3AA 2E7WA 4OJRA 2XY5A 2EQYA 2CRLA 1JLAB 3RF9A 3I32A 5ETVA 2VC1A 2W2NP 5HQMA 4Y65A 2MXYA 3CCLN 1RUSA 2XHCA 2O3DA 3KK1B 1OY6A 2A40A 3BO3A 5ALOA 4LBIA 3GL1A 4DTJA 2B56A 4OPHA 3R6LB 1QQ5A 4DV4K 3OR2B 4Z4IA 5AQVA 2DHXA 3MUVP 2E8AA 2XMUA 4AUKA 3OYAA 1PJ7A 1N8RT 1ZBSA 5GTIU 1P8GA 3O6WA 1UL3A 5H9FJ 4H0OA 1V9PA 2ASPA 4GXIA 4OGCA 1F5CA 4LF9K 2DNZA 2PEBA 2WHEA 2PI4A 3BH6B 4HHJA 2JWNA 2E1YA 4A8QA 5J2PB 1PZNA 4FM0A 5EE0A 1NKBA 4DL6A 1A0OB 3CO0P 5AE3A 4NLZA 2HMPA 3W1YC 2KZ3A 2E20A 1K1QA 4BRQA 2MTLA 3W3SA 3AN1A 5LJ5Y 5MLCV 1NKCA 1G7CB 4H4MA 2DY9A 1X66A 2LXUA 5LOQA 5KFJA 4USWA 3AO3A 1CJUA 1BUXA 5DB9A 2AJ1A 4B08A 4IFYA 4F93B 3ILIA 1K8KB 5EOZA 1JROA 4RW9A 4YHHJ 3C46A 1DZ5A 1YK9A 3K75D 4DU1A 3PW2A 3M32B 3GTYX 4GVLA 3CULA 3JSRA 4FVMA 4JAXA 1Z00B 4RWWA 5ETSA 2J7WA 3OL8A 4EWTA 1LB2B 4FWQA 4UTGA 5JTIA 4JV0A 2XNRA 1Z4OA 4X4SA 5DM7Q 1SZPA 4C8LA 4UT4A 2KU7A 1B0PA 2YNFB 1UA1A 3QGHA 3W0LA 3GU3A 1DBDA 3CIPA 1FJCA 3CI5A 1TK8A 3NGIA 1NK6A 3QJLA 3FR0A 4RUBA 3BEXA 5I3QA 4NLWA 1IKWA 1FO1A 1IVZA 4C4RA 3OYBA 1P27B 3H0MB 2OYQA 4EMDA 4M94A 2G8UA 1QUPA 3MMVA 2MDAA 1F9HA 1GAOA 1FNXH 3VQDA 2DPNA 4F2RA 2QSFA 4IOCQ 3HD2A 1XNRJ 5JJBA 3OV7A 3TJAA 2FC8A 2HNYA 1UVNA 1S9GB 1ZPWX 4H03B 3MCMA 4A8EA 4P4MA 3TAQA 1DY3A 4CI0B 2MMYA 1GLLO 4F4KA 3AJ1A 2VJ4A 3E8OA 4QPTA 3SV4A 1N32K 1VHIA 3FC4A 1GK8A 1V5VA 3DRSB 4GMJB 3JPPA 1VK8A 1Y88A 2YQEA 5GADP 4JV5F 2PMWA 2UUBK 1EJ7L 4CDGA 3C94A 1OMSA 1Y9OA 3EJMA 9ICKA 3WDOA 3SMSA 3T1HF 3ENHA 1PO6A 5J0OA 1HARA 1YGYA 4WQ5C 5AXKA 3SQOP 2F4VJ 1OYDA 4KGMA 1IKYA 2NQPA 2K8CB 2YX6A 1WB9A 4DQRA 5M2PA 2QA4S 2ODGA 1HPZA 3BSCA 3ZX2A 1RAFB 3H2UB 3JPQA 3TQ1A 3CXCM 5CYQB 2PBDA 3M8WA 3DMJB 2XMWA 4WQ5A 3QRRA 2HBZB 1TZ0A 1GTHA 1U6ZA 3OL6A 3HYFA 4HLBA 4FK2A 3DRRB 1CJVA 4I56A 4DR3J 2YJEA 3TA1A 5H2FU 1Q82T 3W5YA 5EE1A 3CIZA 4EYIB 4RCHA 5HQ8A 3NWRA 5K20B 1BHLA 2A1RA 3HXMA 4LF5F 3ADAC 3V9SA 3QPIA 2HHVA 3NS6A 3DXKA 3R7SB 4J9NA 3I0RB 4Y2UA 2HBLA 2KKHA 2BYCA 2BJDA 2WW4A 4OJ1A 3DDIA 4IO9Q 4FLTA 2BPCA 4DL3A 1DURA 3T1YF 2I5HA 1RTHA 2Q1NA 2ATLA 1T11A 3AVLA 1MWQA 4KITB 1BWFO 3B4DA 1MC8A 3TJ9A 1Q9XA 4OIXA 3H0LB 1RWXB 2HLTA 1SQGA 3HHNB 1O08A 1F0MA 3L9ZA 2E88A 3THVA 3UKRB 1RBSA 1QVGM 4BC3A 1HW9A 4O3PA 1BI4A 3CE8A 1HNXK 5HL7Q 4GNIA 2LU2A 4JKBA 4CJ4A 3ULEA 4CHNA 3ED5A 3WXKA 2O8CA 3MECA 3FJ2A 2FBTA 3VGKA 1ATSA 3MMCA 3MFIA 1Y10A 1ZQWA 2DEIA 3NH2A 1S57A 1HNIB 3UCZP 3UIQA 2XULA 4OJPA 1OY8A 4PWWA 1HYZA 3D0GE 4X66F 2AD9A 1NGDA 1MA9B 3ALYA 4LR7A 4M9LA 1S6QA 4W5QA 3QXGA 3DDKA 2WUSA 2P9UB 4DBQA 2A10A 4MT1A 1URRA 1HLWA 2GCFA 2V7YA 3RTVA 2XY7A 4TU8A 3HRDD 4DR7J 7ICQA 4A5AA 2H9ZA 3ZZRA 4LVSA 4H5TA 4C0ZA 1NSPA 1KCFA 1ZZFA 2A3VA 4ID5A 2HQGA 3BZKA 2GTDA 3L6QA 1M5HA 4TVAB 3GIRA 3OPKA 1RBRA 4FZYA 2NZ4A 4DPWA 1SIZA 1LWFB 1ICEB 2KOBA 1KBUA 4PUOA 1IBMF 2MHEA 4KJIA 3TUIC 3KKAC 3CCVS 1ZETA 4GVEA 2ZBRA 1YIJS 4LQ3A 3T19A 4DOBA 1H2TZ 1T95A 2IVNA 4CF4A 2G8FA 3K57A 5EX5A 3AVHA 3CYMA 1Y5NB 3AV9A 4J91A 3W5XA 3K5PA 2J8AA 2XLJA 3KKAA 3Q7BA 1J2MA 4MTPA 2RB7A 3MMAA 5J2QB 3H45C 2IA6A 1K8AT 2GJFA 3OS0A 3LH2S 3RB3A 1WWHA 5D4LA 1DTTB 4P7VA 4DV4J 3IM9A 3J7YP 4WFAL 4RPYA 4B3RK 2DR5A 5HP4A 3UD3P 3PV8A 1JWWA 4XPEA 4P72A 2KJWA 2ZC3A 5F41A 3IR6B 2ZE2B 2G8VA 3UN5A 2P9KB 2Q97A 2E1FA 3LOUA 4YS2A 2I2YA 1F2HA 3BBBA 3AH6A 2O01C 3D6TB 4B3OA 1RU1A 1NJZA 2H3FA 1Q7YO 1ASWA 1BD6A 4AILC 3U26A 4F9OA 5FD1A 4Y3CA 5F0XA 5J2NA 3UCUP 3LP3A 4U96A 4O3QA 1S1TB 3JPOA 4PGYA 4GVBA 2E1CA 3FRYA 4BJQA 1ZOTA 4KB1A 1RCOB 1X3MA 1LKYB 3I76A 4RU2A 2VQFF 5L38A 4JI1K 1FTRA 3MBYA 3KLEB 1ZC6A 2FJDB 3TI0A 3X3UA 4KB7A 1NWKA 2FJEB 1ZD3A 2XMTA 3O9SA 2H5XA 3CCQN 1RWUA 2W04A 4IKAA 5K8OA 1KKXA 3P6YC 4LREA 4NLCA 4CM0A 1NOYA 2AKWB 3MXHP 4HWIA 3LO3A 4BC7A 3AY0A 5K9FA 4BE2A 1ZQSA 3TAGA 2D3DA 4I9QA 2X51A 4ECUA 4Y2VA 4CNQA 4CEDA 4CIEA 2EANA 4IR1A 1RAIB 5CE3A 3Q8KA 1YJRA 2CPZA 4RO0A 2FJVA 1VQ7S 4RW8B 2RU9A 2O8EA 4FDFA 1S4EA 3IM1A 2OPSB 5LXRA 2CPJA 1JLCA 3BGFA 1KFDA 3BSAA 3P3DA 4YB5A 1T6CA 1SBRA 4M5HA 2W4PA 1G99A 3H8WA 2Z7JA 2PFQA 3C2PA 4NLGA 3RUBL 4B1VA 1QHAA 2FGOA 5CAAA 3GDQA 2BMBA 5BR8F 2E5HA 1TK0A 3D1QA 3Q0AA 2VODA 4O0IA 2XY8A 4CZIA 1ZQPA 4U7UK 1VQMN 1KQQA 1ULRA 3DDNA 3U3GA 3G10A 1YHQS 2QM1A 1Q5VA 1T3VA 1N32J 2CGLA 2FC9A 1GMVA 1BPDA 2ZJQL 5GAGP 3C5GA 2DO0A 2RDJA 3PY8A 4BHQA 4BLGA 3N5BA 4DUYK 3BGRB 1LNQA 5GIOA 4EENA 4MFFA 3ET6B 3WXMB 2DH7A 1WBDA 4MO4A 3VENA 1G3OA 4C98A 2YI1A 1VR6A 3WZ0A 4QR0A 4V19X 1C1BB 1UZDA 1N5TA 1VQYA 2XS2A 4PL2A 5HMMA 3CCZA 3DOLA 5KT5A 3M4XA 2EAPA 2WTFA 2OHDA 1GMWA 2UUWA 1MWKA 4O4GB 5DM7L 4NEZA 3KXDA 4KTZA 3KOOA 4CGZA 4U7UD 1AFIA 4DV3K 1FWPA 3MABA 3RJIA 2LHTA 4FZMA 1UPMB 1WC6A 3NAHA 3CPWM 2E8OA 1SKRA 2F1IA 4BRCA 2I1QA 4OLAA 1RK8A 1TVRB 3D1OA 2CPIA 3CCUS 2MHNA 2VF3A 3PX4A 5BXIA 1JQGA 3N6NA 3QWPA 3M8PB 1YZ6A 2KG5A 4PL1A 2QT7A 2VGMA 3LPUA 4CLKA 3MCPA 1IN0A 1Q86T 4UB6U 3D6FB 2WONA 3AQPA 5CZVA 3A5OC 4IOCL 1B7YB 1JL1A 4YFKA 3RMAA 3G25A 4K4IA 3NNHA 3JQMA 3O9RA 4JHDA 5D49A 1HQUB 3CG7A 5DBBA 2FLPA 5THWA 3M30A 2Z8QA 3P45B 4O4RA 3LWLA 3OVBA 4A4JA 2CRXA 5AM2A 2QX0A 3R27A 3IV6A 3HHKA 2B7BB 4JI4F 1TR0A 3MMBA 3O44A 2KYZA 5K8NA 2X1BA 4Y6IA 3C6TB 3C95A 1PILA 4EO8A 2KN4A 2QJ3A 2MSNA 3FSXA 1I5OB 1CEZA 3O4NA 2P5OA 3EXCX 3MR2A 3T6BA 2AEFA 2UUTA 2DHHA 3O08A 3EYZA 2ZNZA 1EP4B 3RJMB 1UA0A 3KK1A 5ETQA 2OPRB 3DOKB 4J5OA 3NG8A 1HNXJ 2R8IA 2ZTCA 2QWLA 3U4LA 4BRFA 3OR2A 5DB7A 3TWHA 1K73O 2P66A 2GVZB 5IV4A 1YJ7A 3QJPA 2KKZA 2PI5A 4QJFB 3SCJE 3BF4A 3AVJA 5KPTA 1KRPA 2QW9A 4B3MK 4DOAA 4DR4K 2YJFA 2IIRA 4B9MA 3EE9A 4L3QA 1FRHA 4C8NA 4ATNA 2PT0A 3M8QB 5AM3A 3CTRA 3CJRA 2IM2A 2KP7A 4C97A 2PMZF 5DMRA 4B3SF 2GOLA 1PYTA 3CJ5A 5M1KA 4JKGB 4EUVA 2OEKA 1R0BG 1K8KA 2HF3A 4LBHA 2JZBB 4FJGA 4LZDA 5HK4A 5B66U 3A0IX 2QEXN 5ALZA 3VA0A 3D67A 1CPZA 2RDIA 4XQ8A 1HNZF 4RKUC 1Z00A 2NUBA 4QWEA 1PAEX 4OHYA 1OSDA 3MOJB 1I94J 3CCEN 1C0UA 3SENA 3MGJA 1TUVA 4RQMA 1RADB 3N79A 5KT3A 2W7PA 2KRRA 1ZQOA 4A8FA 2BHNA 2HOIA 4JMUA 4TLQA 4ISFA 4FM2A 2KKVA 3QATA 4NLOA 2DGSA 1YXQA 4XH4A 1OQ6A 4IC9A 4B3RJ 2Z58B 4WZMA 5BREA 5M1NA 5AZIA 2IOFK 4EBEA 3ZSZA 4NCGA 4N5SA 3K8VA 4PAAA 5HL7L 2NYVA 2R8KA 2MKKA 1O51A 4CLLA 1PVQA 4RQ7A 4YY3K 4RW6B 4LFBJ 1F6TA 4A57A 3J81U 1QD1A 3LP2A 4JRQA 5LMNF 2D3UA 1S9GA 3CMQA 9ICRA 2DHGA 2Q4TA 2OCEA 1WYGA 2YWHA 2KJ5A 3UVJB 2D0BA 3SMVA 3HKZD 3CJ1A 2OHFA 8ICPA 5HSPA 1N62A 4PGQA 4AL6A 5IT0A 2W6LA 3TZYA 1Z05A 3TARA 2J6UA 2ZHAA 4CESA 3DYAA 5ALKA 1N5YB 4JI1J 2DIVA 5F9NA 3H7HB 2JGAA 3VAGA 1U47A 2FVPA 3EGZA 3AQFA 1BGXT 3MM6B 1U1LA 3AVAA 4DCHA 4IQXA 2BCSA 3C1YA 3EKUA 4FJ5A 1WSGA 4ES1A 1NSAA 3FZLA 4HTIA 3W64A 4YVZA 3RFAA 1S0OA 3RBXA 1TL4A 2GIQA 5CYQA 1T3OA 8ICCA 4X64F 3DMJA 4CF0A 2QZ8A 4PHAA 5DKWA 1VBYA 1B43A 4V1Ak 2FYXA 2ROGA 3VF6A 1MN8A 2ZC4A 4CRXA 5KFEA 1GLCG 5A0YB 4YB1P 1T3NA 4NYFA 4FJNA 5AZJB 1RBOB 1T05B 4ECSA 3VQCA 2DBYA 1U1QA 3E66A 2YWGA 4OMFG 4YOEA 5C5JA 4FL9A 3I0RA 4MAKA 4NXMK 4KGZB 2C42A 1R8AA 2WB1D 2CQ2A 4F4YA 2MKIA 1IBKK 3WK4A 4QZHA 3BS9A 4BWMA 2ROEA 4UY8O 5LMUK 3FMBA 3TEGA 5KG2A 1RT5B 2J4RA 4M3YA 2K1RB 3BN4A 1GX5A 4MEXA 4JK7A 4US8A 3NY0A 2Q0UA 3QZ8A 4CE9A 4K4VA 4GIBA 1ZQIA 2R9LA 5EDWA 5AI0A 1WG5A 4MMOA 2O6KA 2IVFB 2ZIWB 1T6DA 3B6BA 2OPQB 4DUYJ 4UAWA 2YWWA 1SIWB 2KE7A 4E98A 5TISU 3FYHA 2RQKA 1SKSA 2E1EA 4OLBA 2N3LA 2OD6A 5BRFA 3GFYA 1AQ6A 3UKRA 2Q2RA 9ICVA 2C2KB 2GWJA 3OTOK 2IBKA 1DFDA 1Q3UA 2ZVIA 4WQ4A 3L4PA 1WEYA 5C2GA 2BPFA 1PGZA 4OKJA 2XGQA 5DGAA 2HHTA 1I1GA 1HNWF 4DV5K 2HDOA 1BA0A 2W3SA 4LQ9A 3QNOA 3I55N 3CCSN 3MCOA 4UBCA 1T3QA 4WP9A 1SZHA 1X5SA 4DV3J 2VFUA 4ZTFA 3VETA 4CDIA 2QMWA 4JKEA 2W2OP 4RQ8A 1LFWA 2LYBA 3CDBA 4K8RA 3UD4P 3ZSRA 4CF8A 5EWFA 8ICSA 3PW0A 2GUPA 1VC6A 4E1NA 1TKZB 1GOCA 2P9UA 3HTVA 8ICGA 1UMJA 3SI6A 1NEEA 1IR0A 2UVWA 2PMHA 4ZKAA 4LF4F 1W97L 1RGVA 2H65B 2MRLA 4BUGA 3NVKA 3T5HA 4HT5A 2CQ3A 4QWDA 4F67A 1B0TA 3V2UC 2KVCA 2P35A 2JNJA 1VQSA 2D8CA 3RB0A 1S5JA 5IQQA 3MX5A 4DF4A 2BRKA 3R3TA 1N0VC 2AEMA 2VONA 3L4BC 3SSSA 4H0VB 5AFUA 2HMIB 1IV0A 4GKJK 2EHGA 3ETLA 3CHWA 4A59A 1VJQA 1RTZA 2AP1A 4N77A 1YBUA 2IHR1 3PIOQ 4IZ9A 3HFKA 1V6HA 3M9NB 3PCOB 2RILA 3PIPQ 2AH5A 1B4FA 1R0AB 1ROFA 1RGIA 1GH8A 1MQ2A 1HHQA 3A5LC 1GLBG 1DTTA 6AT1B 6FDRA 1M1KT 1Z1BA 4ED0A 1FNOA 5ADXH 4Q44A 2FMSA 1S79A 5G5GA 2CJXB 2HGMA 1D9AA 3SUQA 4L3NA 3SI8A 5AQRA 3G0ZA 5FROA 2BANB 2MLZA 4L76A 4CGHA 3GU0A 3UMGA 4YB7A 2ZE2A 3HVAA 4K8XA 3JQJA 3RBDA 4B3MJ 2P9KA 3B82A 4DR4J 4GC6A 2E8PA 4GFJA 3QYYA 4Y28C 4PKHA 3PNIA 2MZ1A 4JI3F 3M9MB 1JXVA 4P7TA 4ZP9A 4LZGA 2K60A 4YEAA 4U8VA 1NM2A 3EGNA 1QH9A 3RJFA 1UVJA 3NF6A 4FZVA 3V5RA 4OZ2A 4M5DB 1S1TA 3KUHA 4CZCA 3L95X 3BH7B 2W9AA 4G1QA 4EX7A 5J1NA 2IGIA 5AXMA 4DSJA 3GZFA 1RZMA 1LKYA 2RHFA 3KMSA 4G65A 4WYBA 2VZ9A 4ZOSA 1Q7YT 1WELA 3KLEA 1HUXA 4DTSA 5KL1B 1YG0A 2XYPB 2NYIA 3FK4A 1KP6A 2GQQA 1WTBA 2KB2A 3U7JA 1RHKB 2P5VA 3IP4B 3RRHA 4ANEA 2YHBA 5KFXA 4F25A 3DM2B 4KHQA 2IIHA 4M5NA 4UOFA 3FGUA 1PG5B 2V8HA 4MK9A 1DARA 1NZAA 5JRTA 2V50A 4RWTA 4AHSA 2D3OR 4RW8A 1RDWX 4I6MA 4OZ0A 4PKDB 2OPSA 4PZOA 2I5JB 3NTUA 1IJJA 2OXOA 5TKWA 1ZQDA 4I2CA 3KLVA 5JLHA 4QW8A 4JI7K 3I4HX 1J5EF 5K4LA 4YY3J 3ATVA 1NGBA 3ISCA 1A7GE 5ADXA 5GAHU 5SZTA 3TZXA 4KTWA 2YX4A 1J5OB 3C15B 4UAZA 1GX6A 3GG0A 4XPCA 4MFBA 2IAJB 2GWKA 3CCMN 3CJTA 2DR6A 2JEJA 1FKPA 1O6XA 3H4DA 3IWXA 3CC7N 3FFIB 5IIMA 1KBRA 3OTBA 3HRGA 9ATCB 4QIWD 4UOCA 1ZQAA 2G2ZA 2ASOA 5J0XA 2QO3A 4CGFA 2UXCF 2Z1HA 2HZVA 1F44A 2R4FA 4ZPCA 5DB8A 3C6UB 3CCQS 5CD4H 3QFWA 3ET6A 2MKJA 2HIYA 2DNKA 2BZFA 3ZDBA 1ZAVA 4ILRA 1KW4A 1EWQA 3AVKA 4QZAA 1C1BA 1FRKA 1EXQA 3AOAA 3OPXA 3AOCA 1VRUA 1N5VA 1OS5A 1KVCA 3MXJA 4I2JA 1UKUA 4LIWA 3VN5A 3MC1A 5AXLA 4O4GA 1FVQA 4C8OA 4OX9F 3G8SA 4KIAA 5KAKA 3WNGA 2Q43A 3DLHA 2GLEA 1HX1A 3CQXA 4DTXA 8ICIA 3ENVA 1RTJB 5JMNA 2IVOA 1Z3EB 1HWLA 3K0SA 1TVRA 4E19A 2RVJA 4H5RA 4F3OA 3WC2A 1N33F 3DLGB 4NXMJ 1X9JA 2DQNB 3G8QA 1VSLA 3M8PA 1CULB 1W2BM 4RNFA 1IBKJ 2IDLA 3KWMA 2HBMA 2Q0ZX 4I69A 3QU9A 1D0EA 5LMUJ 1XNQK 4MQ3A 1ZQUA 2XZDB 1VQMS 2HHUA 1IG9A 1ZXOA 2FF3B 1HQUA 2HURA 3F2BA 1FDDA 2A6MA 4FYXB 3F2KA 4JK1A 1C6VA 2QMXA 4PGXA 4ZPWR 3C6TA 1F5SA 1VBZA 4LF7F 1EKEA 5B0DA 4KLTA 1CLQA 3VQBA 3KLGB 1EP4A 1TV9A 3PJXA 4HKQA 4ICLB 3NUQA 4Q45A 4QYRA 4A8MP 4OZNA 4J2AA 1FIQA 4ITSA 2YTUA 2OPRA 4TXSA 3OTOJ 3DOKA 4DU4A 3O1LA 5CD4A 5M1OA 3KJFB 2KFYA 1HBOB 4DV5J 2BW7A 5J2CA 1QLNA 2VFTA 4H4OB 1NH7A 2AYMA 3HPHA 2OYYA 4M0AA 1X5PA 3ZX3A 1Y11A 3PG9A 2RE1A 4B3TK 1UW4A 4TQSA 4UW2A 3NGYA 4JI2F 1H6KX 1K44A 4KMUA 4BQZA 3M6VA 1ATRA 2YY3A 2R8GA 2B8QA 2M88A 4DPOA 5DK5A 1T9VA 5IZHA 4FW1A 2EPIA 2OPPB 1QQNA 2MU2A 4FPBA 3OD2A 4KLGA 3V9XA 3M8QA 5IILA 2JH1A 2QLWA 1YWXA 3U02A 5HNKA 3HP9A 3N9UC 2IHMA 1MWYA 1HL6A 3NS7B 1RTDB 1D8YA 2APOA 2HBJA 1CJTB 1RAGB 3PHTA 4Y2JA 2A5XA 3HL8A 5DB6A 5ALDA 4JKGA 4IO8A 3C6AA 4FYYB 4FK0A 2KRBA 3D3CJ 2DTUA 5HJXA 1UPPA 2JZBA 2KXFA 1VQ4N 5KQDA 1FRIA 1ZBFA 1LWEA 1FI4A 1SL2A 1K0VA 4E7LA 4YR2A 3KUEA 3NASA 5CCMA 1I6JA 5ALFA 1BE4A 3RAQA 1XR6A 9ICFA 4FNHA 2F7VA 4GKJJ 4GY2B 4I28A 1S6UA 4CLZA 1EWRA 2P2CB 4ZHRB 5CABA 2HF4A 1FEHA 2WSFC 3NVZA 4JWMA 3ALRA 2JHDA 3NMAA 2CQCA 2J7UA 4MDBA 2DFLA 3D28A 2Y9TA 3BREA 1FF2A 3GFKB 1MMDA 3MWBA 1LCUA 3H5UA 4WP8A 3V7JA 3PMNA 5JXSA 3VEVA 1VK0A 4FZLA 5ALXA 1YBAA 4BXOB 1FDBA 5ETRA 4WF9Q 3V7KA 5GAEP 1TMJA 2RH3A 3S3NA 2V2KA 4M42A 4RW6A 2AP6A 4KLHA 3QWUA 1S1WA 2F2AB 1CS4B 3RRGA 3UI3A 1WEXA 4DPYA 4KMOB 1YJTA 2ZHBA 1RSCA 2HVIA 3W2VB 4W5RA 4YOWA 4LFCK 4YHHF 1L3KA 2A42A 2BUNA 2XB2D 5ALIA 2G0JA 4R63A 2QIFA 1B64A 2GV1A 1BPEA 3VF0B 3ZTPA 3MEGB 1JCFA 1R59O 2AYEA 8ICFA 5HANA 2WAQD 1N5YA 1SC4B 4GKKK 2F8HA 5B0FA 1OJ4A 5GAHI 5AQYA 5GADU 3CCES 3E01B 2QMUB 3PJWA 1CVJA 3MM6A 5FDLB 4USVA 2NSCA 4RPZA 2P9NA 1QQMA 2HB5A 3OYCA 1N54B 2KVQE 2BJ9A 3VQ4A 1U2RA 3VGTA 5AI5A 5HMLA 2QXFA 4E2FB 2C22A 3HO1A 4GVMA 4NEYA 3G4SS 1W0HA 4JP8A 1BQMB 3N6LA 3FKBA 5I42B 3D2FB 1WSIA 2A0FB 3H3OB 5LL6Z 3C0BA 3IFEA 3PIOL 4NASA 2VU5A 2C3OA 4UAYA 2AWZA 1B92A 5A0YA 1XNRF 3T69A 1T05A 3S6EA 4JI7J 4ALZA 4QZVB 2DRDA 3OTCA 4KE5A 4OYOA 1C0FA 1M1HA 1LOTB 4NLSA 3LAKA 2GHPA 3O4WA 9ICMA 4UASA 1RT5A 4MN4C 2HQ3A 2K1RA 1Z1VA 4BDZA 2L08A 5D0RA 2VV5A 2ZH3A 2F9TA 1YKWA 4P2MA 4LSNA 4HDHA 1WC3A 4JKAA 3OFGA 4JI0J 5AJ3K 9ICEA 3RH5A 3EVWA 8ICJA 2MKCA 1Q95G 2VIHA 2PXIA 2ZIWA 2F4VF 4HI2A 2OPQA 3OS1A 1HNVB 3CMAN 2ZKUA 4ECQA 5AQHA 1IJEB 1ZRNA 1NI3A 1X4AA 2G2YA 2BE2A 2WF8A 3CJCA 3JYTA 3QIPB 2OUGA 5CA5A 5H9EK 1BY9A 3JAMU 3KZXA 1ILYA 4RNHA 4HVZA 1YJUA 3AQEA 4DR3F 3QNNA 2HWIA 2RE2A 3GSIA 5AKEA 3P83D 5F8JA 2KT5A 3ZTOA 2DKOB 5HBMA 2CJBA 2GGPB 2R7QA 5KFAA 4ZIVA 1KQFB 4J9KA 4DSKA 3TFRA 4F5OA 4JB8B 2JL9A 4R5PB 1F9FA 1WSVA 4QNLA 9ICXA 1NLKL 3QU4A 1TKZA 4RJVA 2F63A 2YHYA 4B9LA 4H0PA 1V4SA 2E1RA 1X9SA 2V69A 2B9YA 1IQZA 1DGJA 1CQNA 2EW9A 3LP1B 2A1AA 4WZQA 2W9MA 4CLYA 1XNQJ 2XMKA 4FWOA 3LL3A 2EWHA 1NUEA 4CD1A 5KT4A 4FCYA 3OVSA 1IQTA 4CRJA 4ZVSB 2DFHA 1NK4A 1DAXA 2AZ3A 1FCAA 3C8YA 2ASDA 4ENOA 3RZAA 1HR0K 2GX9A 2EFOA 3AY9A 4GV6A 4K5RA 1JJ4A 3OTQA 3OXFA 5I4MA 3CNQP 3GV5B 2HMIA 4FZXC 2KIVA 3OLBA 2WC9A 3K2YA 1B99A 5A2QO 1WUDA 1DK3A 1PUZA 1NHUA 2WW8A 2D1CA 2VD3A 4QZDA 4KHUA 2E5GA 1WC4A 3AXMA 1R0AA 3EWAA 3EPGA 1Z1ZA 2ZOFA 4O3OA 3I55S 3CCSS 3H8SA 3HSGA 4P6QA 1VBKA 4LF8J 2P51A 5E41A 1PBAA 3L7PA 4NI2A 3AQOA 3J7YU 3TSQA 4B3TJ 4RZRA 2RHSB 2BANA 1TV6B 2IVYA 2CPYA 4C8KA 1YRUA 5BOMA 4DR7F 2IC3B 3F2DA 2QLFB 2MPUA 1R8PA 1QAYA 2JWLA 2HRYA 4C3LA 4F5PA 1ZA1B 4U9RA 2V68A 1Q8IA 2J0SD 1KD1O 2DHAA 4FF4A 8ICUA 4WIIA 2NPFA 4J2BA 2HS0A 4Z0UA 4Z6FA 4QAGA 3ORYA 3Q2SC 1KNZA 1TUUA 2YB4A 5SUHA 1S0MA 4M5DA 2OSRA 3ZETA 4YG2A 3OYLA 3BDEA 5EGYA 2ZUDA 3OUYB 1FE4A 1EETA 2DITA 4OZ5A 8AT1B 1FVSA 4G3IA 3AUOA 3TP2A 4M9JA 5KFFA 1DQAA 2ITGA 9ICPA 1IM4A 5BJRA 1VRTB 4KYZA 3M1YA 3V4IB 3D2NA 1RTIB 2U2FA 4DV4F 1X0PA 3HW8A 3L5KA 3ENBA 1QQ6A 2FZGB 3DM2A 1KHVA 4UB3A 5KFOA 2HQDA 3DRPB 4H5VA 5AK6A 3ETRA 2H3EB 2H4YB 4M9NA 3QJJA 3F9KA 2P9EA 3I8BA 1KOOA 5DLFA 5IT9Y 5GADI 2ACMA 4KI4A 2E44A 3LGMA 1VS3A 4KQZA 1XR5A 3KLFB 4Y2AA 3IAS9 1UT5A 2LA4A 3VQTA 3G82B 4CZHA 1TELA 2WVEA 3F56A 2ZJRQ 2KJ8A 1J6ZA 4OKEA 2BOPA 3VGVA 2DK2A 3U1MA 1J5OA 1JI7A 1EX8A 1PBUA 3C15A 3IR5B 3WXLA 4CP5A 4LFCJ 4B9NA 2IAJA 2ZFHA 3J80Y 5KG6A 4RU9A 1N34K 2A1BA 5L39A 2R7UA 3N5FA 1WDTA 1ZM9A 1E6VA 2PSZA 2X74A 2VG7B 1HYSB 3C2MA 3FFIA 4RQ3A 4M5KA 1ZD2P 2CQBA 1G15A 3IWLA 2M52A 1S0VA 2F5GA 3MX2A 4CHOA 2WHOA 5C15A 3O8WA 4XDCA 2BGGA 4DFKA 3HULA 3F44A 2RRBA 4GKKJ 4CTAB 5MAOA 5J2KA 4FJ7A 1XWLA 2D3ZA 4DN9A 4AHUA 4X5VA 3M8SA 1VQ6N 4EIAA 3NF8A 2ZBIA 1R89A 5AKKA 4JUZA 4O8UA 5BYQA 1RT7B 1IBLK 5CXTA 2L3MA 4FLUA 2Z2YB 3HKZC 2W41A 4TU9A 5J0TA 2KFNA 1Y3KA 4LFAK 4OKKA 3RAXA 1UFKA 3L09A 5E2QA 4UZBA 2YTCA 1ASUA 3ATUA 3W65A 3PSTA 1EXNA 4C4SA 2YWKA 4NYPA 4BREA 3A13A 3HI9A 5A76A 3G6YA 5AXNA 1RTJA 4YCXA 1SJQA 1NPPA 3NEKA 4O5CA 1AUDA 4K50A 3L0QA 3V72A 2ATCB 2G5HB 5M1PA 3DLGA 2R18A 2XC9A 1YF5L 2YQ0A 4Z4CA 3TKAA 5AKGA 3KKRA 4OO1J 1MDUB 3OHAA 1CULA 4WF9L 3CCMS 4DQSA 2UUCK 1N32F 3A8JA 1PK1B 4KLDA 2E6LA 3LK9A 1CUKA 1XN9A 4AHRA 1KDHA 3PW7A 2HG4A 3TSPA 2N4CA 2R7SA 3GE9A 3MHYA 2W55A 3AD8C 4LVNP 2NRTA 3H08A 3NRBA 1DRZA 1W7AA 5KRSA 2IYIA 2N82B 5HLFB 3JPSA 4KRFA 4KGKA 3KK2B 4PKGA 2ADBA 2G5IB 3LALA 3I33A 3CT9A 3IRXB 5RUBA 2CNNB 4TYBA 3CGIA 4UOHA 1E6YA 5KAFU 2AJ0A 1AW0A 3IMXA 3K1RB 2X6SA 4ICLA 2L48A 2WB1C 5H9EJ 2LMIA 2Z1JA 3VQ9A 3OYIA 3O1BA 4M04A 1VOMA 2NRHA 3K89A 1ZTWA 2G8KA 5T7BA 2YNGB 1HBOA 1RA6A 1T9YA 4TNOA 1SGGA 2HWHA 1DGKN 3G6VA 1N5WA 2PAVA 2KV2A 3O5BA 1FD8A 3IRWP 2DIUA 4H4OA 3RH6A 3MZIA 4JRPA 3E58A 1F21A 2EAMA 3HX0A 3C3LA 2YMLA 2AF6A 4PYAA 5BR9A 4WJBA 2RRNA 3KKFA 4KV8A 2CG8A 8ICWA 2POKA 3HDSA 3CERA 8ICOA 3PYGA 1RXOB 5HVFA 4XH5A 3IFRA 1LWXA 2KG1A 1N48A 1H3DA 3AVBA 5E0OA 4QPXA 1RTDA 1CJTA 5I3UB 3R3LA 2IFXA 4IRDA 3RMDA 2M8HA 1KVIA 3JPRA 3J7YI 3CXCR 2PE8A 4CT8A 5F8IA 3CMEN 2Z2ZA 1WI8A 4CEAA 1ZXIA 3ZSYA 1HR0J 2MQLA 3TANA 1ZQQA 4DFMA 4DX6A 3THYA 2DISA 4DMZA 4BR9A 1CJKA 3UNGC 2W43A 4L3KA 1QZ6A 4OYWA 1NDKA 3LA0A 5HROB 3SQGB 1HNXF 4ZHRA 3HF5A 3GMGA 2OO4A 3IP0A 4IBNA 2CQ4A 2KI2A 3H20A 3ZEUB 3V9ZA 2RF2B 3G9CA 4CWBA 3FBEA 2BKNA 2E7VA 4MHVA 4E0DA 4Q5VA 3AVNA 3CD0A 3FCWA 3HOSA 5DG7A 2UVRA 3C5FA 4BXOA 2ZVSA 2FSJA 1JKHA 4K4HA 2NRVA 2KXNB 3KD3A 3RGIA 4M3RA 3LM2A 2O8FA 3N01A 4K7QA 4BC2A 3FZKA 3ZZYA 4X4PA 2BABA 3OSNA 1X9XA 3N7PD 1CS4A 3AFGA 5F3XB 3QT8A 3MCAB 5AQNA 2DCUB 1Y97A 3MFHA 3ITHB 3NOGA 3W2VA 1C0GA 5HO4A 1U48A 4DL2A 3AT1B 4LMZA 2L9NA 2HHXA 2QTWA 1ZJMA 1F9EB 3P38A 1KTQA 4YD2A 1PAUB 1ZD4A 4FZZA 2B8PA 3DV9A 3CW2C 2VPYB 3MEGA 1X60A 4OLOA 2CPEA 1I94F 1VQON 1N8RO 4Z94A 4IG0B 3EX7B 7FD1A 2ATQA 3DRYA 2UU9K 2LU1A 2XNQA 3KZIU 4NA1A 3E01A 5FDLA 2JRSA 2KZMA 3T5KA 7ICLA 3DLKA 4O5BA 5DDOC 1WKLA 4NXZA 1T9UA 1FXRA 1XTZA 3VESA 3ULDA 3EUB2 1DTQB 2UXBK 2GUIA 4B3RF 4WKYA 1G2EA 4PJ0U 5AKIA 1BQMA 5I42A 1N63A 4I2BA 3BBCA 4ILLA 3HZGA 2OEHA 1HD1A 3R5DA 1S6OA 1M1GA 3QMQA 2YPZA 5HAOA 1LVHA 1RBVA 4LFBF 9ICGA 2A6OA 1U6BA 4FWRA 1FEEA 1YVNA 3R8YA 3OYGA 4IOAQ 3KLIB 1D1UA 2CQHA 1RPLA 3SFGA 3ZZ0A 2ZGYA 4UQTA 5EE3A 4FPAA 3NGKA 3G86A 1NU0A 4ECZA 4KX3A 4R25A 4C3MA 4DHVA 2G1DA 4ES3A 2KQ2A 1U09A 1S1VB 3AA9A 3KJVA 3KVGA 4K43A 4DCPB 1N34J 3ILLA 2BCRA 1F3FA 4Y1CA 3AOBA 1FJEB 4K59A 4JI1F 4KX5A 3BQ2A 4FNIA 2EFGA 4DX7A 3W60A 2XS5A 1TMMA 1P7DA 3OYFA 5F8MA 2FE9A 2FHKA 2FY8A 9ICCA 2QA4N 1DHMA 1Q81T 1PCAA 4JWNA 3NAIA 3S9HA 3SUNA 5AKLA 3DHWC 1IKWB 4CFCA 1WF0A 3TAPA 2I7NA 2XCPA 4NYZA 1SQEA 3VQ5A 4OD0A 1IBLJ 4OZ3A 1NXIA 5AKYA 2E9RX 2W9CB 2FSKA 3FQKA 2BTFA 4O44A 5AT1B 1GMWD 4LFAJ 2QTDA 3QB0A 4QS7A 2R7VA 4QIWC 2HHHK 2OTJN 4Z6CA 3IR7B 1VMBA 5BPLA 3I82A 1MMNA 2HEKA 1JJ2M 2RUSA 2J0QD 3H3NO 1N60A 1Y00A 1XMQK 2N1RA 4FJIA 1N88A 4R5PA 4C1NK 4YOXA 4JV5K 3C14A 1KHWA 2AMCB 3LDQA 2IHNA 3MUMP 2CPXA 4WE1A 1OPZA 3R5CA 1SB6A 2ASLA 2VJUA 3MPYA 3ONNA 3KDNA 1AYEA 1VQKN 4KN4A 1VIXA 4NXNK 2WRMA 2UUCJ 4FWMA 1HKGA 2VH7A 2D74B 2BJ8A 2H1YA 3GJSB 3KD1E 4ZLPA 2M0NA 5L1LA 2ZJRL 4R66A 2E5LK 5LT5A 2Y9UA 4CJQA 4DUYF 3QUQA 3O8MA 4PL7A 7ICKA 1HPZB 2DL0A 4HUGA 3UPQA 3PEHA 4M63C 3HBTA 2BM0A 2P6SA 3FZBA 4DR6K 4RPXA 5K8MA 4Y0FA 3ENOA 1KSPA 3VZHA 1L3VA 3ZTSA 2YQ3A 2HW3A 4YD1A 3SQ2A 3F5AA 4DV3F 1PC4A 2GBZA 1VQ9S 5E3AA 4ZS6A 5KFLA 3HP6A 5AE1A 2XMAA 5G0RB 1UP1A 3RW6A 2JLEA 3ZD8A 1VRQC 3DGVA 4M5IA 7ICGA 2XWXA 4KHSA 2HZAA 3BPDA 4CIGA 3S41A 3UN2A 2BQ3A 4DCOB 2IC3A 1V3SA 1JLGA 3KHLA 2CN1A 4IR9A 4E7HA 4WFXA 4EYHB 4QWAA 1H7WA 4ZDNA 2AU0A 3NBPB 4TUSA 3FZMA 2IBOA 1WG8A 4FXWA 5A8RB 1XS9D 5M1QA 2IMWP 2EK1A 5JS1A 1GFWB 4C7ZA 3B4MA 2QSWA 3CCVN 4OJGA 4EBCA 4F02A 1NU4A 1YITN 1S0NA 2KT3A 1ITGA 1SQKA 4OJ5A 2VFRA 3AA5X 3OUYA 4LIRA 3V1QA 2I9SA 2B6AA 3AGRA 1BI4B 3LYSA 2HNDB 3MPDA 5IV3A 4ILHA 3SAGA 3TUJC 3ULHA 2O4IA 2E29A 4WKRA 4CBWA 3MPUB 4ZOHC 2UVVA 3ULEB 4RT2A 3L3CA 5E33A 1VHXA 2O8CB 2EFQA 4WXOA 3HSTB 5D46A 4ILMA 3V4IA 1RTIA 4WU2A 3DXBA 1QUVA 4F2SA 4BS2A 1HKAA 2JVOA 1X4HA 3ZNJ1 2MZRA 2W7OA 3DNCA 2G8IA 2DNPA 3MR5A 5CQGA 3AA2A 4K4YA 4Y2IA 4XDDA 3PRBA 4I6AA 4B3MF 1UCVA 2RQMA 3TADA 1PJ5A 5AQMA 3JAMY 4DR4F 3DFEA 1S5LU 3E9LA 4DQQA 3M6UA 3KLFA 1SJ1A 2ESEA 4PHEA 1OWXA 3B0YA 2LQ8A 2PA8D 2XZTB 4WYLA 3G82A 4B1UB 1U1NA 3WK8A 1QAXA 4PY5A 4JB3A 1S48A 1Z2ZA 3DOMB 2W6KA 1FT8A 2FJBB 2RJZA 4DX5A 5KFQA 4B1XB 1WC1A 3UWTA 4PUOB 4NYOA 4P10A 3H0RB 1K8AO 4ERDA 2DNLA 2Y3YA 2VG7A 1HYSA 2D69A 1SXLA 2F8KA 2QB1A 4IL6U 3VEWA 4CK3A 3LTOA 2YH1A 4KLQA 5HJYA 2VWJA 4LJMA 3I56N 1P9YA 4CZLA 4TYAA 1KXPA 3HT0A 4W92B 2X1AA 1RT4A 4K4SA 3J7AP 2QLJB 3GJTB 5DG8A 5M2RA 4K42A 1TUWA 4OFZA 2CJ9A 1X5OA 2ZBCA 4BRGA 2RQ4A 4IOXA 3L8BA 1WC0A 2HQFA 1WJ9A 1SVDA 2DTJA 1KFSA 2NO4A 1Y5LB 1RT7A 4A8OA 2UXBJ 1RWNB 4C8MA 2N3OA 2O5DA 4AXJA 4X2BA 2QG9B 4K4UA 5CYJA 1COOA 4ECYA 1YJ9N 3MGIA 3BQTA 1TK5A 2B9EA 3HPOA 2WAQC 1JIHA 2ZWOA 4YY3F 3A8KA 4OHZA 1G4CA 3J7ZT 2E1ZA 5IFMA 2YWEA 2IDEA 5A8WB 3PR5B 2P9LB 3LP0B 1SJFA 4IFEA 2W2QP 2VKZG 5AQXA 4QWBA 1HBMA 2FPLA 5E26A 4BRNA 1QE1A 4CM2A 3FEZA 4RBUA 3C1ZA 5KFWA 4FYWB 2XHWA 1PK1A 4KLMA 3U6FA 4HAIA 5DDMA 2WBNA 4RPFA 2HBQB 1YBTA 1TU0B 1U49A 2XSJB 4CLPA 3HVRA 4Y00A 4FBTA 3ZI4A 1R0CB 5DG9A 3L2RA 2HNZA 3A8IA 3EEQA 1Z4UA 4KAIA 3NGUA 3ETOA 4ZVRB 3QRQA 4CIOA 3LWMA 3KK2A 4USKA 3RH4A 2JEFA 3FE1A 4X62K 4MIWA 1NNDA 3IRXA 2CGKA 1VQ6S 1MU2B 3VWSA 4NO7A 4DV1K 1KAXA 3AB2B 4M41A 1W26A 1JLCB 2ZGZA 4WFZA 3NE6A 2PD1A 4FKXA 3MEDB 3QT6A 4DPTA 4HCBA 4Y2XA 5GAHP 4CJ3A 1ZA2B 2YKQA 4OYZA 5D78A 1TTHB 2HHHJ 1T02A 4JYAJ 3UDVA 5HP1A 3Q23A 1HBUB 1P90A 2XY6A 3ZT4A 2C2ZB 1SV0C 4NL9A 2WMMA 2K4HA 1JMSA 4NXMF 1URJA 1XMQJ 2RU3A 3ZT2A 2E2OA 1FFGB 2L5YA 4DSLA 1FKOB 8ICXA 1IBKF 4DV2K 1NRKA 5JUMA 1SV0A 4LRFA 5LMUF 5HATA 3O3HA 1B70B 3FLCO 1FXLA 3MOZA 4H5NA 2COLA 1PYOB 1ZQXA 1RAOA 4NXNJ 4IOAL 3VQSA 3CJQA 1BMQB 4Q2MA 3BQ1A 4FOEA 2E9ZA 3BSOA 3QETA 4OZLA 2E5LJ 1F2GA 5KFUA 1LW2B 1CQMA 1L3SA 4LRAA 2RAQA 4BRPA 5KG1A 4Q43A 3ETMA 5T7LB 4NB4A 4O0JA 4XEIA 2ZOGA 1NOMA 1SWVA 5J0WA 5LL6d 2A3ZA 1C4CA 2OSQA 5CZ1A 3VTHA 4P0QB 3EM1A 3THWB 3OTOF 3D54A 2DWQA 3FC9A 2FJWA 4J9LA 1D8LA 4LD0A 3WUHA 4ZITA 4HYKA 4DOCA 4ECVA 5IT9O 1NGEA 4DV5F 5KG0A 4CF2A 3NXZA 4DR6J 1HJRA 2ASJA 1TL5A 3ZEUA 4QZCA 4OHXA 2RN2A 2CUYA 3FZFA 2R3VA 2RF2A 1Q86O 3JS6A 4IO1A 2C3UA 1NGGA 3ZC4A 1M5PC 1B3TA 2ZUBA 3HHDA 4PZNA 1KS2A 1GLJO 4C11B 1NMEB 3J80O 4M5MA 2NXUA 4BR5A 4ZMMA 3G71N 1E3MA 2DPIA 5ALNA 1RAHB 2WONB 4V19J 2P9PB 4DQ8A 3POTB 3AA8A 1RNHA 3SXLA 2NRRA 5GAEU 2PZSA 3JTOA 2G8WA 3H6EA 2D3O1 3ITHA 5E3CA 5CEHA 4I2HA 3TTCA 1IJFB 1XC9A 3BP8A 2C2DA 8ICNA 2MQPA 2HS3A 4RWXA 5KL8B 2ZH8A 4NCAA 2JSXA 5K8PA 4QWCA 7ICHA 2LXIA 4OLPA 3HOTA 4CEBA 1X2IA 2CYYA 4R65A 3BGOP 1S49A 4OV6A 4LJXA 2MY8A 2Z30B 3CMES 1D9FA 1WOQA 7ICUA 1RWPB 3ZT0A 1BPBA 2ZDOA 4IG0A 1N5QA 4GKJF 2HSZA 4MF8A 2KH9A 3NMUA 2W24A 4AE5A 4RQ5A 4CF5A 4DL4A 4EAHD 2VJVA 1RG6A 2R7XA 3H90A 3MCNA 2Y0SF 1TKTB 1M5VC 4M3ZA 4I2EA 4IJNA 1GTEA 5JLFA 3R2DJ 1DTQA 5KT6A 4Y2SA 2QRRA 4PG4A 2BJ7A 1Q16B 2DXFA 3RB4A 2MQNA 4QIGA 5B0GA 3E1YA 3HSZA 2PFPA 4AL7A 4QZFA 3SDEB 3KLIA 1VSKA 5GTHU 3SMZA 1HNZK 4RQ6A 5JICA 1CBKA 2OM6A 4CF9A 3R8EA 3EE3A 2JEGA 3CJ8A 3OHRA 3O6QA 2YX8A 1S1UB 4FJKA 2ZH1A 1SPBP 1XSNA 1PK3A 3AAPA 4CK1A 3QO9B 1S1VA 3NH0A 2WVDA 3BZCA 4QR1A 1R6VA 5HMWA 3M7DA 2MUTA 4J9RA 1C0UB 2F7TA 1XERA 1HJPA 2GJ2A 7ICRA 4CJRA 3RJKA 4ANDA 1VQOS 1WNEA 4R8UB 2PMZD 4Z6DA 2PEHA 1U2FA 3H1VX 2G0CA 1O5JA 1B0VA 2JDJA 1T4GA 3CFPA 4NLNA 3THTA 4L74A 4HACB 2PFUA 2HFNA 1H7XA 1MW7A 2ZEJA 3O1WA 4BGBA 3PKYA 4OJLA 3Q24A 4M5GA 3EW9A 1VDHA 2B9WA 5J2AA 1SB3C 2V8PA 5AZIB 4RQ4A 4NCGB 2LYAA 1Z6RA 3NAEA 3V9UA 2V4JA 5J2JA 4WU3A 4BACA 1EKRA 3N4QA 2W9CA 1RABB 1AZSB 2R2UA 3ZZOA 3GP9A 4UUXA 2PYLA 3LP2B 1AROP 4DL0C 3WEEB 1X4FA 4CJLA 3P4UB 5AIBA 4JI7F 4B9TA 4YFUA 2Q31A 3K9KA 2BKOA 1HA1A 3N97B 1HQ2A 3AMZA 3RW7A 4DLGA 1HUZA 4WPAA 4KB0A 5EN1A 4PQAA 1RXWA 4ZPTR 3VTIA 1X5TA 2WVBA 2HSTA 5C10A 4Q0BB 1V97A 1NZPA 4CJWA 2DJWA 2KDOA 2EKNA 2KHVA 1NZ8A 4Q2LA 3DYAB 3IS9A 3OTEA 4QZBA 2Y1JA 1ZPVA 5DDYA 3ZZUA 2HK3A 2V6AA 5ALHA 2W8KA 2EBEA 2VWBA 3HSJA 2CXEA 4JI0F 3A3OB 2EZXA 4FJMA 9ICBA 5D15A 4DKWA 9ICHA 2JJ4D 4Q7AA 2H51B 3QIOA 3J81j 2X1GA 5FLXY 5CP2A 3SPYA 3T9NA 5AQQA 3T6JA 3SR6A 2MB0B 4B8AB 2WBRA 1C0TB 2XO6A 3SEIA 5AQLA 3AAWB 1ZQ1C 1NCLA 1OVYA 3H4BA 2G08A 4BBYA 3MUTP 3M05A 4X62J 3M6GA 4Y2YA 2E9TA 2VDIA 4DX8H 5IIKA 4KKOB 1S5ZA 4DV1J 4DU7A 2FIUA 4CJUA 2WSCC 3C66A 4I27A 5AR0A 2CNLB 2JGUA 4FE3A 4AYBF 1JLBB 3QYPA 4NMXA 1WHWA 1UJ5A 2IOFA 2OTJS 5G0RA 2DPJA 2XYGB 1KVJA 3KK3B 4CE6A 3IAYA 1H98A 3SMPA 1A5XA 3O9QA 5G4DA 3W2WB 5H1SV 1KQGB 4PXBA 1UPHA 2BR0A 2J0XA 1ZQYA 3ONQA 4DV2J 4M7XA 1XNQF 2NPIA 3NGTA 1RDUA 1U8WA 1VQKS 3NBPA 5A8RA 4ILJA 1M5OC 3RAMA 2C3MA 4CNYA 2RRDA 5J2MB 1O13A 2FLLA 1RWKB 4Z2XA 2EG1A 1RBUA 2XWYA 3SQ4A 4CZKA 3EXYA 4QU7A 3C65A 3W7BA 4JS5A 4K2XA 1LK5A 3BR8A 1KEJA 3D2EB 3BO4A 4DR1K 4US9A 2FC0A 3TU5A 3E0FA 2DNQA 1ED1A 2HNDA 5IWAK 4F92B 5GAEI 3PUFA 1T94A 5HHIA 3A8EA 4UQGA 2OEJA 1XNSA 2HBKA 4NLVA 4GXJA 4LH5A 4OVLA 3QT7A 4PHDA 3ZO7A 4HH1A 2YX7A 2NLXA 4FWNA 4LF8F 4CO5A 1RA7A 1UJ6A 1W2BR 2R7YA 2IRXA 2E1MC 4LF6K 4FO6A 4B3TF 5F8HA 4Z4GA 1OH8A 1TUYA 1EIYB 3CD7A 4ID8A 7ICJA 4KPYA 4GO7X 4FW2A 2MA1A 3RWUA 1KVBA 3ZD9A 5IM0B 1U45A 3GJRB 2H3GX 1BLUA 2MZJA 2C2OB 5AQJA 2MSSA 3BPSP 2AJ2A 5C2DA 3PYDA 2V2QA 3C23A 1HPMA 1LQ9A 3AA3A 4J9VA 3B0XA 2P9CA 5J8YC 3GCXP 1FE0A 3DOMA 4B8CA 4BR4A 2AGQA 2JZ5A 4ED7A 2HQIA 3UM9A 3Q8YA 4CH1A 5J8YA 1X4BA 1KC8T 4F0MA 3B9JA 1YITS 4NLPA 1RHQB 3NVMA 3NGZA 2MQQA 1M1KO 3QU5A 2D5RA 2ACYA 3OXLA 4LVOP 4NLDA 3OYJA 1C0MA 4CFAA 1X3NA 2ZH9A 4G9BA 3O9UA 2H3QA 2VANA 4W5TA 5ALWA 2MKHA 2W9BB 5HRPA 3FEYB 2JVRA 5KGXA 2WVCA 4LF9J 2NS1B 3R9LA 1JLQA 4CJ5A 4OYIA 1XMOK 5A8KB 3HZ6A 3KUGA 3M6ZA 2BCQA 4BR2A 2GFFA 4ZCMA 3H2VE 1N61A 4PG5A 3C16B 1A6LA 3H1QA 1ZQHA 2QL7B 1RFQA 2ZH6A 1SS6A 5D8HB 5A8WA 2KO1A 3V4MA 3K0JA 2P9LA 3LP0A 4LFCF 5KFMA 4G1QB 4DJBA 1GLFO 3CUNA 4CJFA 1COKA 3BV8A 3IG1A 4C23A 4UZCA 5KG4A 4ZVHA 2KM8B 1F1BB 4ISGA 1NJWA 1VYAA 4GKKF 5KFRA 2XSJA 1FRXA 3GFZA 5FJ4A 1O1WA 4MKBA 1SCJB 4EBDA 4MH8A 3C28A 1HWKA 3QIDA 2IVPA 3I56S 2G09A 3JSBA 4QZ9A 5HR7A 2FVRA 1YJNN 4CO2A 4URQU 2YV0X 5CRXA 3M1FA 3KFWX 1O0PA 2E5IA 3PSPA 2BW2A 2VJ5A 4K8ZA 5MLCQ 3D7SB 2VKRA 2X78A 2CA9A 4IDHA 3QEIA 3TAMB 1MU2A 4I6MB 3GYGA 4EELA 4OL8A 5HI7A 1V3ZA 1H2UX 3TR5A 4P2SA 3AVCA 3I1YA 4BCAA 1WCLA 2BOAA 3MEDA 4IQWA 1R27B 1GOBA 4OQJA 1VSJA 3R6MA 1YJ9S 1LXNA 1U1KA 1U8SA 4BRHA 1X0FA 2CADA 1WI6A 2UXDK 1T44A 2JC0A 1HBUA 1VQ8N 4ANCA 4QOTA 1N6QB 2D0CA 4IYQA 1LW0A 4MFBB 3WKDA 1HI1A 3TR8A 1S10A 2Z2MA 1WAJA 1K0TA 4ED1A 1N36K 1BCOA 5C0YA 1FKOA 1A77A 3I5BA 1SJRA 3MF5A 1FKPB 2DNOA 4IOBA 2P5GA 4L8RB 1XMBA 3Q83A 4AQYK 2OAUA 2LM4A 2R7RA 5DJBA 4FJHA 2VA3A 1D5AA 2MLXA 2VHGA 2I0XA 3JXUA 2MGZB 2F9DA 3N0VA 2K8BB 3THXB 2UUBJ 4QJVA 1BL3A 1EHWA 1NGCA 3OL7A 3E9OA 2OFHX 1RWMB 2EWSA 1M5SA 4HHUA 4LRCA 2F9JA 3VAFA 1Y7PA 3ID6A 3VGMA 1OIAA 1LW2A 3N6MA 1RDAA 5T7LA 2KTQA 4OX9K 1VRUB 1FTCA 2VPXB 5IIJA 3ICXA 1FEZA 1J97A 2WB4A 4JKHA 4YOTA 4U6PA 4P0QA 2J5AA 3TVZA 4OJ3A 5BPNA 3THWA 3KJNB 4OX6A 3MD3A 3QEVA 3CNHA 2EK6A 3NNCA 4MFAA 2K4IA 2LQ9A 3KJQB 3CPEA 3OYHA 7ICSA 4NMLA 1ZBHA 1HYVA 4DU8A 5FPEA 2RD5C 3SLCA 4FF2A 2HGNA 1YLXA 3L3UA 1Q4RA 4ZCLA 2NUUG 1FWKA 1V4TA 2K89A 2Q1LA 3SCIE 4FJJA 4YNQA 4C11A 2KLAA 2Q79A 2OIHA 3VALA 3BF3A 2J6TA 2IRYA 2KHDA