1L3UA

Crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3'
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3uA01
1U48A 1RTJA 4W5OA 5CR0A 4F5NA 2OA8A 4AHSA 3OYHA 1IM4A 3OYMA 2BCQA 3NH2A 5J0QA 4R66A 4DL5A 5JS1A 1MSWD 1VSLA 2PFNA 1ZBIA 1D5AA 3M8RA 2BCRA 1S9GA 4DOBA 5KI6A 3GIMA 3HW8A 3RMDA 4EP5A 2LYHA 4RQ8A 4CJPA 4JUZA 4IR9A 1VSIA 5KTQA 4J9PA 3DYAA 3WNHA 4ED3A 5KT6A 3F73A 3ZDAA 7ICPA 4F4KA 1LWCA 4OJRA 4FLUA 4FJMA 2P5OA 2OZSA 1J5OA 4J9LA 4J9KA 3DRSA 4ED7A 5HRPA 3D45A 3VQ8A 4DEZA 2JZBB 1NK8A 1IKWA 5KT7A 1WCNA 1WNSA 1RTIA 3VQCA 1D8YA 1BPBA 3VQAA 3MGIA 3QEPA 1C1BA 4FK4A 1UA0A 4M9LA 4TURA 4CEQA 4DS4A 4FLXA 3V6DA 3MBYA 1DLOA 5KFEA 5J2KA 1NK6A 2HNYA 4E7KA 1BCOA 2ZJAA 5KFHA 2BGGA 3Q8SB 2IGIA 3BQ0A 4BWJA 4B9NA 4H4MA 4ID5A 4CHPA 4ZHRA 2HW3A 4Z4CA 1D9DA 1N48A 1KRPA 3CG7A 3RR8A 2R7YA 3TAPA 2VA3A 7ICUA 3VQEA 4YQWA 4KHQA 4CGJA 2BCVA 2FBTA 4IG3A 2R8HA 3KLEA 4GMJB 4DS5A 3PW2A 1IKVA 4H8KA 3RWUA 3K5LA 4DTNA 5HNKA 4FLZA 1ZBHA 2D0AA 2B21A 3MXJA 2Z1HA 3L2RA 3OJSA 4O0JA 4XUSA 8ICZA 4YXMA 4BACA 4RU9A 2FMSA 3RJEA 1D9FA 3PX4A 7ICFA 3CFOA 3ITHA 5D46A 4CJUA 4C8MA 4M2YA 1AROP 3SJJA 4PHDA 4FZXC 2ALZA 4IQUA 1RXWA 4IG0A 9ICAA 2RF2A 5CYMA 3PY8A 4YR0A 4CEZA 2FPKA 4X5VA 1VSKA 4F5OA 2ZUCA 4YCXA 2XC9A 3LP1A 2KZZA 4KLQA 4LD0A 4Q0BA 4UB3A 2BDPA 4JWMA 4FVMA 5HRSA 2F96A 1XC9A 1S0NA 2ZUDA 3OY9A 4E1MA 5CHGA 3NGDA 5KFUA 1TK8A 2FLPA 4B9TA 2ASDA 1ZQLA 4M3WA 5IIMA 2QKKA 1LAWA 5CP2A 1J54A 3PX0A 4CECA 4I2AA 4DSEA 3L3VA 8ICVA 3K75D 4O3RA 1C7YA 3AVGA 3TABA 2HHTA 3QEIA 3VQBA 1S0MA 2HB5A 3VQ4A 3NF6A 3EPGA 3GDXA 5KFTA 1JLCA 3MR2A 1JXLA 3ASMA 2W9CA 1Z26A 3IM1A 2QXFA 3DLBA 2P6RA 4C8LA 3OYEA 4B9UA 4BDYA 4QZCA 3UIQA 4JRPA 2AQ0A 4KLLA 3T5HA 4RQ5A 1C6VA 2XGPA 3V81A 4OGCA 4N47A 1QS4A 4CCHA 8ICXA 3QNOA 5J0PA 1XS9D 3MEDA 4KKOA 3V9ZA 2H5XA 4KAZA 4F5QA 1WSIA 5J0XA 4CJTA 3SUNA 8ICYA 3PW4A 1NKCA 1ZQZA 2BPFA 3OS0A 2XY5A 2FBXA 5EWFA 1TKZA 2Z1IA 3EW9A 1TGOA 4N76A 1U45A 1NK4A 4Z6EA 4P4MA 2KTQA 5KG0A 5DK5A 3V1QA 1HUOA 4M41A 4KFBA 4CGGA 4UAYA 3JPOA 4RNOA 4RPZA 4DQSA 3MFIA 4KI4A 2AU0A 4O44A 1NJXA 2UVWA 2R8GA 3QIOA 2G8KA 2GWSA 2A1SA 4YG2A 1B92A 3TANA 1TVRA 1WCLA 3QNNA 4GLXA 1NK0A 3E01A 2G8VA 5DB9A 1XHXA 4E7JA 1RDDA 3T19A 4ECYA 1CXQA 1W9HA 3NAEA 4IQTA 2MAXA 4I28A 1Z00B 4FJNA 4FLVA 4E7LA 1S0VA 1ZQVA 3H7IA 8ICQA 4YR2A 1RBVA 3PMLA 5KG7A 4CGFA 4ED0A 2AJQA 1T7PA 5IILA 3RH5A 5KFBA 4DFPA 3N97B 4O3SA 3HL8A 4FJ7A 5TZVA 4M3RA 4CJRA 5D3GA 2G8WA 2HVHA 9ICEA 1CXUA 1ZQDA 2DY4A 2M9NA 4CESA 3JPNA 2DPJA 4KLGA 1QSLA 2GBZA 3ZD8A 3UXOA 4UBCA 2PFPA 1ZQIA 1HMVA 2ATLA 4KITB 5KG6A 4RQ0A 1O1WA 5J2QA 3SUOA 1BPEA 4DU1A 4ECTA 4DTUA 3ZT0A 8ICAA 4RW4A 2FBVA 2XY6A 3EZ5A 2W9MA 4CJVA 3LDSA 5KFCA 1MC8A 1HYSA 3PV8A 5BPCA 3GV8B 9ICXA 2XO7A 3KKRA 4I2GA 5KFPA 2XCAA 2EHGA 4Q5VA 5JS2A 2DPIA 4FM0A 3KTQA 1HYVA 3O4NA 3AVHA 4WE1A 4CFBA 1Q9YA 4CJKA 1NK9A 4FLYA 1R0AA 4CEFA 4TQRA 4O5CA 3ZSYA 3K57A 5J29A 5J2AA 4PGQA 2VANA 3SQ4A 2XCPA 4I2EA 3H4BA 4DFJA 2BPGA 3I8DA 1KFTA 3ZT1A 1QTMA 2V4RA 4QOZB 2C2RA 3RMBA 3CFPA 4W5TA 5J0WA 4DSIA 4JWNA 9ICSA 4LSNA 1BPDA 3JPTA 2X78A 3MXIA 4I27A 4MEXA 1RT5A 4QZ9A 5IIOA 1EX4A 1RDCA 3MFHA 1VSJA 2HHWA 2JEJA 9ICPA 3DRPA 3VQPA 2A1JA 1VSFA 2A1RA 4R5PA 4M3YA 3ZSWA 2MUTA 2BHNA 1KVAA 4O3NA 3PW0A 5L1IA 4RT3A 4CJSA 3JSMA 4E7IA 3HVRA 4EBDA 1JLGA 3AVIA 4J9OA 4AHVA 1C0TA 2D0CA 5HLFA 3AVNA 1K6YA 2FMQA 5HMMA 3MGHA 4M9JA 4KN7A 1S6QA 4CJ5A 5SZTA 1K1QA 3ISBA 3HP6A 3SI8A 4O5BA 4QZIA 4TQSA 4I2HA 4KLJA 1ZQEA 5KG1A 4CEDA 1RBTA 4KLHA 9ICTA 1LAVA 8ICNA 2F1JA 5KFGA 1VSDA 3HPOA 1T8EA 3RJJA 5DBAA 3CM6A 9ICIA 1KLMA 3OS1A 2ASLA 4KTWA 4F93B 1LV5A 2KFZA 4Z4HA 1L3SA 4DL7A 4CE9A 1XI1A 2WTFA 7ICHA 3RH6A 1DTQA 4FZYA 1BPXA 9ICMA 3QEXA 4DF8A 1S1WA 9ICQA 1ZQNA 4B8AB 3KLHA 3AO1A 4ECXA 3OS2A 4RW9A 1WSHA 4DU4A 2FLLA 3RR7A 4HCCA 4J9SA 1CZ9A 4R8UB 3CM5A 1WAJA 3LP3A 4UQGA 5DGAA 2XGQA 4MFCA 3H08A 4Q44A 4YMNA 3QETA 3H8SA 5KG5A 2JGUA 5I3UA 4DL6A 1S1UA 4FS2A 4NLNA 1ZBLA 2EX3A 3Q8PB 3AO2A 4OKJA 4GC6A 1C0UA 2O4IA 5J2PA 4RW6A 3T1AA 4NM1A 5J2GA 2ISPA 4IQWA 3HVTA 1U4BA 1SKSA 2P1JA 1RDBA 4J2EA 1KLNA 3ZDBA 3C1ZA 4LZGA 4F4WA 2AGOA 5BOLA 3L2QA 7ICQA 2ASJA 1JXBA 5KT4A 1ZQJA 7ICLA 3RMCA 1L3UA 3TARA 4TUPA 2ZTEA 4JRQA 4I2DA 3KJVA 2G8UA 4F5PA 2G8IA 2PY5A 3HP9A 4KLIA 3OHAA 4NCAA 3LPUA 3UXNA 2HVIA 3OYBA 1TAUA 3NF7A 5HP1A 3TAEA 4BGDA 4M42A 1ZQFA 3KK3A 2BGWA 5C25A 1ZYQA 3H4DA 4DFKA 4ECRA 3HWTA 3MR3A 2F8SA 2YKMA 4RG8A 4HUEA 5EU7A 2E6LA 1XSPA 1ZETA 5CJ7A 1NKBA 9ICNA 4CJQA 4YD2A 4AHCA 3QEBZ 4PGXA 1IH7A 2R8KA 5DMRA 4EZ9A 1ZQMA 3C1YA 3LZJA 4M3UA 1KVBA 1XO1A 2NRTA 1Z25A 4IRDA 2RPIA 4MQ3A 5KG3A 3RTVA 1KFSA 2PI4A 4ECVA 4UB1A 1C1AA 1A76A 2BKEA 4RPXA 2ZD1A 5DB8A 4LVSA 4IRKA 3RJHA 1L5UA 3SNNA 8ICWA 5KRTA 1SL2A 3V9UA 1RZTA 2OYQA 5EOZA 4N56A 1RT3A 2BQUA 3K5NA 4Q43A 3OJUA 1ZQAA 1T03A 5DLGA 4CK2A 4M6WA 2I9GA 3ZSQA 4M9NA 4CK1A 2IHNA 2YHBA 3ZCMA 1VSMA 4QCLA 1QSSA 4F8RA 5CA7A 4GXJA 3MR5A 5CYQA 2IS3A 3ORYA 5HROA 4MFFA 4KB0A 4CJ3A 5KFAA 3LPTA 1A5XA 3O3HA 2ZTCA 3AV9A 3O3GA 4FJ8A 3A2FA 3KLGA 1NOZA 4NLZA 4DTJA 2XY8A 2QKBA 2KQ2A 5KFMA 4E1NA 4M3ZA 1S97A 2I1QA 9ICHA 4H4OA 3QERA 5DG8A 3FYHA 4O55A 3DOLA 5KT2A 1RCHA 8ICIA 5C5JA 4F91B 2FMPA 9ICUA 8ICRA 4XA5A 4YVZA 4NYFA 4QWCA 4OVLA 5KT5A 3TQ1A 4CHQA 2O4GA 3TWHA 4FCYA 3MDAA 3OVNA 2IMWP 4JS4A 3OYNA 3MEEA 3DLEA 1ZQPA 4FBTA 4CF9A 3EY1A 2PYJA 1BGXT 2YNFA 1WLJA 3V7LA 1Q8IA 7ICRA 1B9FA 4ED8A 3FFIA 4BWMA 3G10A 2IOCA 4M3TA 1ZQRA 4CGHA 5J2IA 5D4BA 4AHUA 3T3FA 3VQ6A 3T5LA 4I2CA 3KD5E 1ZJMA 3V4IA 3OYCA 2VG5A 2ZJ5A 1TK5A 4W5NA 1HUZA 1NOYA 2YHAA 3PW7A 3TAGA 1FKPA 3JPRA 4CF2A 1VSEA 3QINA 1I39A 3AUOA 2KN7A 4F2SA 3AVKA 3NFAA 5KFQA 4FK0A 1RYRA 3OYFA 2F8TA 1JIHA 4DF4A 2UVRA 4M3XA 3ZSVA 5J0OA 3NGIA 4CF1A 4F4ZA 4CIEA 3MABA 3AVMA 2RDJA 2WONA 3HX0A 3RBDA 3LAMA 4I7FA 4KLTA 3QE9Y 3DLKA 2C2EA 9ICCA 4M9HA 4W5RA 4B9SA 4Q8EA 1IXRA 2C2DA 2BQ3A 3SQ0A 4KLFA 4DTOA 2YNHA 5DQGA 1XU4A 4QZFA 1BCMA 1LWEA 1TAQA 3P83D 3LZIA 3BQ2A 2HNDA 4O5EA 1T4GA 3RB0A 4IRCA 4K8ZA 4XRHA 3MECA 3C6UA 2B5JA 4KN4A 9ICBA 2P66A 3RJFA 1KSPA 1JLFA 4MF2A 3KK1A 3DRRA 4IFVA 1IG9A 3Q8RB 3ZDDA 1LB2B 4CEBA 4FO6A 5HHIA 5CZ2A 3VQ5A 4UB4A 2D0BA 2FC0A 3PX6A 1S5JA 3MAQA 3D0PA 1I3AA 5KFRA 3CFRA 1KVCA 2JLEA 3C23A 1BL3A 3LANA 1UA1A 4NCGA 4RNMA 3LWMA 4QW8A 1TK0A 3HK2A 3C2MA 1X1PA 4B9MA 8ICGA 4KLUA 3S3NA 3HPHA 5KG2A 4KB1A 1RDAA 4XQ8A 1GOAA 2IHMA 1LW2A 4CJ4A 5J2MA 3I0SA 1NJWA 1HQUA 3M9NB 1ZQSA 1ZQBA 1H38A 1DTTA 4GW6A 3B6PA 3PR4A 4FZZA 2UVUA 2ZTDA 8ICKA 3V1RA 9ICVA 5DQHA 2J6UA 5KFJA 4E0DA 3JPPA 5HMLA 4QZAA 3QIPA 4CHOA 3GIJA 2LSNA 4TUQA 3TAMA 2HHSA 3ZSZA 4PUOA 8ICBA 8ICCA 1HQEA 3K4GA 4QZBA 1S0OA 4DU3A 3NCIA 1G15A 3PNCA 4EZ6A 4P4OA 3JYTA 4I29A 1IO2A 3M8PA 5J0YA 1S1TA 1WSGA 4I9LA 1JX4A 4AH9A 1X9SA 4DTMA 1GOCA 3IRXA 4L8RB 1JLEA 4F2RA 3MDCA 5KFOA 2YV0X 3OSNA 3DMJA 4FJHA 4ED2A 1Z3EB 1ZQTA 4OLBA 2ISOA 2NRVA 5DG9A 3K5OA 7ICKA 5DG7A 3ZT2A 1RXVA 2Q0ZX 3PW5A 9ICJA 5C24A 2PZSA 1Z00A 2NRZA 4LY7A 4KPYA 8ICFA 1RPLA 3LK9A 4CJEA 1RT6A 4DQRA 1S1VA 5J0RA 5L1LA 2W9CB 2W8LA 4ECQA 1BIUA 3NTUA 1SV5A 1HPZA 5I42A 4KHNA 1X2IA 4CF8A 1BISA 3B0XA 4FK2A 4FM1A 1BPZA 4CK3A 2XY7A 4DTRA 3U3YA 4KI6A 3ETLA 5T7BA 4CEOA 5J0UA 2ITGA 3I0RA 3DI6A 4YMOA 3JPSA 5DB6A 4FJLA 3NH0A 4Y1CA 3VQ9A 4Z6CA 3L8BA 2KZMA 2DFFA 7ICNA 1KEJA 4JLHA 3VQQA 4OKEA 1TKDA 5EWEA 1BHLA 5CB1A 3OYKA 1NKEA 3NE6A 3H40A 2W42A 2IAJA 4O5KA 3M8SA 1X9MA 4QAGA 4QWEA 4RQ7A 4B08A 2W9AA 3SV4A 1UWBA 2ETJA 5F9LA 4LSLA 2MUTB 1SL0A 4PGYA 4O0IA 4B9LA 1A5WA 1ZQOA 2P5GA 3V7KA 1C1CA 1EKEA 4CFAA 3CYMA 2YNGA 1ZQYA 4HCBA 4HUFA 2D5RA 2V9WA 4EYHB 5IIIA 4FW2A 4FXDA 2G8FA 1VSHA 1QE1A 1C0MA 4UBBA 4BE2A 1ZJNA 5DDMA 1T3NA 4ZTJA 5IIKA 5KFDA 3L3UA 3PVXA 5KGWA 1REVA 3RAQA 3KKSA 3AU6A 4HUGA 1CLQA 4RPYA 3V7JA 5KFIA 4QZEA 5HRRA 1JLQA 5J1EA 3G6XA 2KW4A 1D8LA 9ICRA 4Z0UA 2XRIA 2IA6A 3NGZA 4DL2A 1ITGA 4PPXA 3PO5A 3AVAA 1XSLA 4FS1A 1V9PA 4ELVA 1EXQA 2HNZA 3TFRA 1XSNA 4J9NA 9ICKA 3UQ0A 3U6FA 2BCUA 3C5FA 1SZPA 3OYIA 4E3SA 4ELUA 3BGRA 1DGSA 5KGXA 7ICOA 4HTUA 4FJIA 4HHTA 4J9RA 4RQ4A 4F4YA 4OPJA 1JLBA 2VA8A 3ZDEA 1S77D 4DTSA 3AO4A 2W9BA 2NRXA 3NBPA 3P5JA 4AHRA 5J2DA 5KFYA 3LP2A 4ED6A 4O3PA 9ICOA 1ZQHA 3VN5A 4NYNA 2W9BB 4LZDA 4RQ2A 4DFMA 2G8HA 3PR5B 4KLSA 4PA1A 4B8CA 7ICGA 2OZMA 4ED1A 3PUFA 3SI6A 5HRNA 1BVSA 1A5VA 5SWMA 2PI5A 3C2KA 1NK7A 4G3IA 5DBBA 1N5YA 3KD1E 3AA5X 3HJFA 1ZQCA 2BE2A 4KLEA 4CERA 4B3OA 2KZ3A 3O4QA 4GVMA 5C42A 4RNNA 2F1HA 1JL1A 2PFOA 4PHEA 2BQRA 4ECSA 3WNGA 4FLWA 4E89A 4R63A 1YT3A 3DLHA 1QQCA 2J6TA 2YKNA 4R65A 3NDKA 4IKFA 1BQMA 1T05A 2ZJ8A 3GQCA 3HT3A 4KTZA 4M0AA 1TL1A 3H8WA 4FW1A 3C5GA 1UOCA 4K4IA 4M45A 2ZE2A 7ICIA 3K59A 4UAZA 2DFLA 1MQ2A 3SV3A 1XHZA 2W8KA 3KK2A 3GV7B 4CIGA 2PYLA 1J9AA 1SUQA 1YTUA 3WNFA 3VA3A 2DFHA 1ZQWA 3M9OB 4M6WB 4Z6DA 3TFSA 3SUQA 1YVUA 2BCSA 4ZH4A 1TL3A 4BE0A 1L3TA 3S3OA 2WOMA 2VG6A 1RT2A 3RRGA 5L9XA 1IKXA 4PHPA 3FDSA 8ICOA 1BI4A 3C21A 4I2QA 4I2FA 2I5JA 2ZQBA 4QZDA 4F92B 3QEVA 3AU2A 5J2HA 3M8QA 3RAXA 3F9KA 4N5SA 3AVJA 2V4QA 4P4PA 7ICTA 5FRMA 2JZBA 4DQQA 4NXZA 7ICSA 1UAXA 3AO3A 3SUPA 8ICMA 4I2BA 1ZBFA 1QHTA 4JS5A 3THVA 3QZ8A 4DWIA 2RDIA 2OPRA 4Z4GA 4ID1A 4W5QA 1A77A 2AGQA 3TR8A 4LH5A 4F4XA 5KFSA 2FBYA 1RTDA 4KO0A 3NGYA 2KFNA 3T5KA 3OYAA 3G6VA 3KHRA 8ICEA 1S9FA 1MQ3A 1HRHA 3OYLA 1SKWA 4KLMA 3AVCA 5K14A 4OPKA 2HHQA 5DLFA 4FJKA 2OPSA 3IS9A 4JK1A 4G1QA 5KFXA 3M9MB 1Y97A 4EBEA 4MFAA 1ZQUA 4QZ8A 4E7HA 4CHYA 3ALYA 3SYZA 1WSFA 4J2DA 4FJXA 4GC7A 2HMIA 4MFBA 3RB6A 4AILC 8ICJA 8ICTA 1F21A 2IC3A 5CY4A 2AGPA 3SCXA 4O3OA 2ZUBA 3Q8KA 4I9QA 4DSKA 4YP3A 4YD1A 4DSFA 3JPQA 3LWLA 3C94A 4UB2A 3UQ2A 3ZT4A 3O3FA 3V72A 3SZ2A 4UB5A 4RW7A 1ZQGA 3P1GA 4B9VA 7ICEA 5KFVA 3SPZA 5FRNA 2X6NA 4FJ9A 4GXIA 2C28A 3VQ7A 1B9DA 4M47A 2BANA 4LH4A 3OYJA 4CFCA 3RB4A 1RT4A 2X6SA 4K8XA 4CJWA 3HM9A 3UXPA 4RT2A 4IR1A 5CWRA 8ICPA 4Z4EA 2GUIA 2F1IA 4RUAA 8ICUA 2ATQA 2GV9A 4Z6FA 1FKOA 1BIZA 1RBRA 3OYDA 1PZNA 5DB7A 4FBUA 1BI4B 1UT8A 1K1SA 4ZTFA 4FJ5A 3V9XA 4QZHA 1FXXA 3DLRA 4BE1A 4QZGA 4NLGA 4F5RA 2UVVA 3LAKA 4YR3A 4QWBA 1HJRA 3KIOA 2YNIA 4DLEA 7ICVA 3QEAZ 1CUKA 4DL4A 1RBSA 3NF9A 4C8KA 1HNIA 5DBCA 5J2CA 3EPIA 3QZ7A 3DOKA 5FDLA 4RUCA 5KT3A 1RNHA 2E6MA 5KFZA 3ZT3A 4K4GA 1RTHA 1JN3A 2FPMA 2IBKA 1WSJA 4YMMA 1HNVA 4KRFA 1KDHA 5J0SA 2B6AA 5HBMA 3PO4A 4KHUA 2C22A 5E41A 5JUMA 4I2IA 5L1JA 1RYSA 3QEWA 1ASWA 2BPCA 4KHYA 4P2HA 3AVBA 4YN4A 4C8OA 1HYZA 3AVFA 4DSJA 5KFNA 1U04A 4DTPA 1NJYA 4KV8A 5DQIA 3IAYA 4YXJA 4F3TA 1ZQXA 1ZQQA 2DFEA 4CJFA 3AA2A 4FLTA 5J2JA 3C6TA 3EWAA 1U49A 4JV1A 1COOA 3Q8MA 1ZQKA 4FYDA 3RJGA 4PY5A 2OPPA 1UT5A 4YNQA 4RZRA 9ICLA 4EP4A 3BQTA 5KG4A 3HPGA 3IHQB 1S76D 3NH1A 1L3VA 2IDOA 3HXMA 4E19A 3V9WA 4K4HA 1W0HA 2VWJA 4OLAA 2A1JB 1DOQA 4FM2A 3RB3A 4J2BA 3ZD9A 2Q3SA 2AQ4A 3RRHA 1RT7A 4XIUA 4QW9A 4Z4IA 3UPQA 3NF8A 1N6QA 4O3QA 1RT1A 4QWAA 4Y1DA 1NJZA 2HHXA 4YFUA 4IQVA 3V1OA 4IDKA 3SQ2A 1VK0A 3ZDCA 1Q9XA 3NHGA 1KTQA 1RILA 4PH5A 4DOCA 1WSEA 5KFLA 4DQPA 4OGEA 2FLNA 3BDPA 3OHBA 1JL2A 4CEEA 2PFQA 1LWFA 3U3GA 5BOMA 4EYIB 4ELTA 3KLIA 4CGDA 1XWLA 3B6OA 1QLNA 5IINA 2VWKA 7ICJA 3MXMA 4R64A 1TKXA 4OKKA 4TSXA 3GIKA 3DM2A 5J2NA 3OYGA 5CZ1A 3TAQA 2XHBA 1JKHA 3HSTB 1FK9A 3BQ1A 1Y88A 5KFWA 2RN2A 4ECZA 3KLFA 3ULDA 1N56A 1J53A 2HHVA 5IIJA 3TI0A 4PHAA 4CF0A 1S9EA 5J2FA 9ICFA 1MU2A 4ECWA 4QWDA 5KFFA 3K58A 1IKYA 1CZBA 4BXOB 4NLKA 1ASVA 2NRWA 2PXIA 4KLDA 3WNEA 3BJYA 1B22A 4DMNA 2R8JA 2NUBA 3AA3A 4Q45A 4KTQA 4CGIA 4PQUA 3KHGA 3QO9A 4J9MA 2JEGA 5DDYA 3V9SA 3V6KA 3L2UA 2P6UA 4O9MA 3RJKA 3QLHA 3OSPA 3KHLA 4KHSA 5L1KA 2X74A 1WN7A 2RKIA 3MEGA 1ASUA 5J2BA 3G0ZA 1NK5A 1U47A 4F3OA 4AHTA 4N41A 3LDAA 1NOMA 4DOAA 4JV2A 7ICMA 4I2PA 4BDZA 3ISCA 1S1XA 1U9LA 4KHWA 4CFDA 4M04A 2DTUA 3CQ8A 2R8IA 4DL3A 4KREA 1BPYA 1JMSA 3MR6A 1KFDA 8ICLA 3GFKB 5DKWA 1TFRA 3EYZA 4J2AA 8ICHA 2J6SA 1TV9A 5HHHA 4MEYA 2Z1JA 3GV5B 2VA2A 4DLGA 5KFKA 4KLOA 4CEAA 3K5MA 2OWOA 5EWGA 5D49A 4Z4FA 3C2LA 5HP4A 3RH4A 1TV6A 1YTAA 3RMAA 1JLAA 3K2PA 4NCBA 2HHUA 1GOBA 4GXKA 3B0YA 5KRSA 3L2WA 5J0TA 4CJLA 2BR0A 4M9GA 3G6YA 3Q8LA 1EETA 4TUSA 3Q8QB 3N4MB 4O4GA 4DG1A 5FROA 1X9WA 4DQIA 1EP4A 4PWDA 3ISDA 1B43A 4DTXA 3H8JA 4DO9A 3LALA 3AA4A 3V6HA 3ZSOA 4ICLA 3V6JA 1WAFA 4EBCA 8ICSA 1ZBUA 1S6PA 3S3MA 3SQ1A 3VQDA 4UAWA 4RW8A 9ICGA 1BQNA 2QK9A 2P51A 4R8UA 3HYFA 4FJGA 4FJJA 1HJPA 3KHHA 2OPQA 3ZSRA 3VA0A 4YFKA 4CHNA 3AO5A 1TKTA 4ECUA 3PMNA 3IG1A 1JXEA 4BXOA 9ICWA 3QESA 4Q8FA 5F9NA 4J9QA 3T5JA 3TAFA 3S9HA 2Y1JA 1RBUA 3RBEA 1EXNA 3OGUA 1VRTA 1S10A 4KMUA 4I2JA 1KCFA 1VRUA 3RJIA 2E4LA 4IFYA 3ISNC 1QSYA 2JEIA 4EEYA 3DLGA 3HO1A 5DGBA 4HYKA 4HVJA 2JEFA 3GILA 1SKRA 4RQ3A 3C95A 2Z1GA 4MF8A 3ZSXA 3L2VA 3GIIA 5J2EA 4F50A 1SL1A 3E2EA 4BDPA 4IBNA 2B4JA 4C8NA 3SPYA 1TVAA 1LW0A 2FPLA 4RQ6A 4CIFA 3AVLA 4DSLA 4JV0A 3LP0A 4NY8A 2Y1IA 1CEZA 4CHZA 2VG7A 4RQ1A 4NM2A
chains in the Genus database with same CATH superfamily
4KQZA 5AQPA 1JK9B 4LFCK 4F5NA 2KMDA 1QCKA 3PSFA 3UDCA 4M94A 1GMVA 4DL5A 4PWDB 1VSLA 1ZBIA 3VF2A 2HQDA 1YBUA 4OD0A 2Z8QA 1TU0B 3ONNA 4JI5K 2D74B 1YJUA 1EHWA 1JKHB 4PQUB 5KI6A 4I56A 3SDEA 2JV3A 1OH8A 3UCZP 4JUZA 4O4RA 2WVBA 1K73T 5KTQA 2AW0A 2ZF5O 2MB0B 4J9PA 1YAGA 3DYAA 2HNDB 3FZKA 2HIQA 4ILGB 5FPEA 4KV8B 4OZ5A 1J5OA 2CJAA 1VRUB 4J9LA 1U1PA 3OHRA 4YB1P 3WQUA 4GVBB 3G6ES 4Y2KA 4IO1A 2RDDA 3W65A 3MAAB 3VHQA 2JZBB 3PCOB 2H3ZA 1IKWA 3N28A 3ZZPA 3DLKB 5GAEU 1WUAA 3AGRA 2JHEA 2YHXA 3CCJN 3VQCA 2DRAA 1D8YA 5K9FA 3MGIA 3QEPA 1C1BA 1IM6A 3GJQB 4FK4A 4Y0FA 2IRXA 1UA0A 4M9LA 4TURA 4FPIA 1V9OA 8RUCA 2E5SA 1NWKA 4FLXA 1A6LA 5CAAA 2HQIA 2MSSA 3LYSA 2W01A 5KFHA 1ZAVA 3KJFB 3BQ0A 4CHPA 1SV4A 4IFVB 5KL8B 4Z4CA 2YNIB 1YXQA 1GAOA 1O8BA 3R5BA 3PSPA 1KRPA 2CJ9A 3CG7A 3RR8A 3G71S 2R7YA 4C9DA 2BH1A 1HNWK 3CDUA 3TO8A 4AQYK 4AD6A 2BCVA 2AF6A 1ICEB 2ADCA 3CDWA 4GMJB 3CPWM 3PW2A 2MGZA 5HNKA 3CJ9A 4IOCQ 5AQHA 2CRXA 1CJKB 3PJXA 4OPAA 3DXBA 1MROA 2V8VA 4RU9A 4OZ2A 1KHVA 3EE9A 3RJEA 4OYWA 3ITHA 1HIYA 2V52B 1VHIA 4DMZA 4O8UA 5AM4A 1Z2LA 1RT4B 2P9SA 1AROP 3SJJA 2WRMA 4FZXC 5C10A 3UKRB 4IQUA 1SC4B 1NZBA 1CJVA 2D4WA 5B0CA 2E3TA 2F76X 4LREA 2ZH3A 1X4BA 1LVHA 3B78A 2RF2A 3BUZB 3H8YA 3IUCA 5CYMA 2PDAA 1TR0A 4YR0A 4Z7YA 4ANEA 2FPKA 2IM0A 1GQEA 4U8VA 4I67A 2ZUCA 3FK4A 2CNNB 4C48A 1MWYA 3QAEA 4LD0A 2GJIA 3K0SA 4Q0BA 4UB3A 4DB3A 2KHCA 3WX8A 1HI1A 4FF4A 3MZIA 2DGXA 4AM6A 4LR8A 3OY9A 4E1MA 1TK8A 4UAVA 1KDNA 4OHVA 2L08A 4M3WA 4FL9A 1LAWA 4DR4K 4DSEA 4OJHA 1RHQB 3K75D 3MEDB 4KKOB 1C7YA 3AVGA 4OJ5A 4ERDA 4XH4A 3TABA 3BH7B 3OTEA 3HHLD 4OI6A 2KG0A 3VQ4A 3GDXA 1U1KA 1Y7PA 5EHHA 1YF5L 3L3FX 1Z26A 1HBMA 5BR8K 2P6RA 4QZCA 5IQQA 4JKDA 5D0RA 2RU9A 2OGUA 5TISU 3O9TA 2JXJA 2YWGA 2LKZA 1FFVA 4N47A 8ICXA 3MMAB 4Y65A 4LF5F 4KH0B 1OY6A 3QNOA 2QO3A 2G2YA 1PG5B 1XS9D 4A8MP 5AQFA 2J7UA 3TP2A 2GJ2A 4BY9C 3SUNA 1D9AA 2KKPA 1HARA 1NKCA 3MCNA 2BPFA 2HBKA 4NV0A 4JI7J 3TEGA 4M5JA 1HQEB 3EM1A 1U45A 3VQTA 2RRNA 3JPOA 3N4QA 2YMMA 3MFIA 4NLPA 1NJXA 3W2VB 1WCLA 4DG1B 3QNNA 2WBRA 1DRGA 2Z2YB 3UDVA 4UT4A 2G8VA 4ZPBA 5AKJA 5DB9A 4OZ1A 2HG4A 2X1BA 3MM6A 1CXQA 2O8CB 1HBUB 2DH9A 2ZITA 4FJNA 1S0VA 3QBCA 4USMA 4AXJA 1RBVA 4H5VA 5KOWA 4LRDA 3A5LC 4ED0A 5BXIA 2G08A 1ITPA 1NSPA 5KOXA 5TZVA 1W97L 3I55S 4CJRA 2G2ZA 1BO5O 4O5FA 1FXRA 3LTOA 2IJRA 2CVEA 2YQ1A 2DPJA 4XAKA 4ISFA 2GBZA 2OM6A 3U9ZA 2CQ0A 1JQGA 2ASYA 4KITB 5J2QA 2UXDJ 3P8BB 4ECTA 1VQSA 4USVA 3EVMA 2FBVA 4L3QA 4DCCA 4CJVA 4A62A 1CI4A 4J7CA 1HYSA 1FK9B 2XO7A 4I2GA 1NH7A 5KFPA 2EHGA 2YNGB 4Q5VA 2X51A 4Q2MA 5AZJB 2DPIA 4LF1A 2HYIB 3LPEA 2P9PB 1N5TA 4WE1A 1NK9A 3OPXA 1V5VA 4M63A 4TQRA 2J9DA 3NWRA 3GCXP 1TTHB 3DHWC 3SLCA 3QUBA 1TZ0A 5AXKA 1IKWB 2VANA 2XCPA 4NL5A 3C6HA 1LWFB 4DFJA 2WSFC 2YJEA 1OO0B 3VCBA 1QTMA 3GU0A 2BACA 4QOZB 1OMSA 5AKIA 9ATCB 3DLJA 1ZD2P 1TFWA 3VF6A 5EN1A 3E9LA 2VWBA 3H0LB 2E9RX 4JWNA 3QPIA 3DEEA 3TQEA 3FZMA 3CJ3A 3CCQN 4HI1A 2CN1A 4MEXA 3MPYA 3TTFA 1M5SA 1EX4A 4ICAA 2QV6A 2HHWA 1U2RA 2JEJA 3CNHA 2GIFA 4ED4A 1Y3JA 3AODA 2IY5B 3VQPA 3V4MA 2DGUA 5JJBA 5BJRA 4R5PA 1K5OA 4X64K 3VGLA 2BABA 4F3MA 2LCWA 3BB5A 2H4WB 3KG0A 4CJSA 4A46A 4EBDA 2VZ9A 1MNEA 2MQLA 2XVTA 2WAQC 1WG5A 5HMMA 3MGHA 1XC3A 3HZ6A 4LMZA 5AI4A 4H0TB 5DDOC 2HDOA 3ISBA 5CYQB 1VQ6N 2X1GA 4TQSA 4PPZA 1ZQEA 3D54A 5G0RB 4Z2XA 1FKAF 4KLHA 3WT0A 3QDKA 1BC6A 2ZVSA 3PNIA 2F1JA 1WOOA 1GXUA 1Q82T 5DBAA 3CM6A 1TE2A 4WP3A 4I4BA 1ACMB 2GS8A 4ZLNA 2Z4PA 5A6PA 1L3SA 4DL7A 2OCEA 1EP4B 3BQ7A 1PJ6A 1XI1A 4EHUA 3CC2S 2PE8A 1DTQA 3UE5A 4OZJA 5H1SQ 1FRJA 3G86A 2D8CA 1HA1A 3OS2A 1YRTA 4RW9A 3C8YA 4YOYA 3QJPA 1U09A 3KFUF 4KHPF 2Q36A 3ILOA 1J97A 4B3TK 1T9YA 1CZ9A 1N8RT 2LXIA 4OJOA 4JOUA 2XGQA 1K0VA 3MI7X 1NGFA 1QVGM 4KGXB 4YMNA 1VRQC 5KG5A 4FS2A 3FE1A 2BA9A 1SVDA 1ZBLA 2YWFA 4OKJA 1C0UA 4BR5A 2M3DA 4XDCA 2QGFB 5J2PA 2ZOGA 1LW0B 1RKIA 4DV2K 3T1AA 4WFAL 5J2GA 1JLEB 2B8PA 4TY8A 2VGNA 1LXJA 1FKOB 3ZDBA 3C1ZA 4LZGA 4F4WA 1DQAA 3CMAN 3BBCA 3R5AA 3JAMU 2HGNA 2ASJA 2QXLA 1ZQJA 3IWLA 5E3RA 4PL8A 7ICLA 3UB5A 4CD1A 3PDNA 1CJUA 2HHHF 2G8UA 3ETMA 2G8IA 3IMQJ 2CGKA 2I0XA 3HP9A 4GKJK 1NLKL 4GRSA 1GXLA 1Q7YO 4JYAF 2JC0A 4YDUA 3MCPA 4JB8B 2J7KA 4U96A 3H5YA 2BGWA 1KVKA 2HBMA 4QR1A 4X62K 1ZYQA 1GLLO 4DFKA 3CJKA 2O8FB 5HANA 4A59A 3MEKA 1AZSB 5HOOA 2QTDA 5IFMA 1U7LA 3J80O 3W60A 1FJ7A 1XSPA 2GC8A 4HI2A 5LT5A 2ZWPA 2NLWA 4ZPVR 5AQWA 3BGFA 1IH7A 4RTFD 4EZ9A 3UFCX 3EKSA 3EXYA 2CAJA 4NYZA 1XO1A 3W1YC 2JFDA 1NPKA 1UWAA 2RPIA 4ZVSB 4CH0S 2XMAA 4ECVA 1X0FA 1C1AA 4CZFA 4RPXA 2ZD1A 4K4TA 4CBWA 2NV3A 1ZH5A 8ICWA 5C15A 2K4HA 5KRTA 4HHJA 1RZTA 2DGWA 3D6MB 2F3JA 3T1HJ 3THXA 3PG9A 4Q43A 1ZQAA 2ZJQL 2IAJB 1SJ4P 4G9BA 2AMCB 2H9ZA 5GINA 2I9GA 2RQMA 1YJNS 4M9NA 3B4DA 3WU2U 4ZVEA 2I38A 1E6VB 1WACA 2IIRA 2MKYA 3R9LA 4HDHA 3MR5A 5E3AA 4K7QA 4KHPJ 4DR7J 1N34K 4NI2B 5AZJA 2ZDPA 4DX7A 1V3SA 2HWTA 5C2CA 2HBQB 1H2TZ 3ICLA 2XY8A 4OYIA 2I1QA 1UJ4A 5DG8A 1P7DA 2R7XA 3NNCA 5AQXA 2G06A 2FMPA 2DNPA 3NGRA 5EE0A 2PMZC 4CHQA 3TWHA 1R7IA 4RPFA 4P2MA 5H9FK 3ZEUA 2R7UA 4ETZA 4CJ7A 3G9CA 3N6NA 2DHXA 5I9EB 3EY1A 4LSNB 5F8LA 1Y11A 5FP0A 2XMUA 2GQCA 3V7LA 3FFIA 5IT9O 1U02A 3D4JA 2IOCA 4M3TA 5EX5A 3M8WA 5J2IA 5D4BA 3T5LA 3KD5E 2MJNA 4IOXA 2E1MC 1ZJMA 1RA6A 4ID5B 4WJBA 3W2WB 1IJJA 2ZJ5A 2VG5A 1HUZA 1NOYA 3I4PA 2IOFA 3W8GA 3N01A 2YNFB 1VQPS 2HWHA 3QINA 1SIZA 2KN7A 1FDAA 1XR7A 3FEXB 2ZH9A 3AAQA 1TFYA 3DFEA 4BG9A 3WIVA 2PMZF 2UVRA 3K9KA 3NGIA 3CVKA 4DV6F 1TL1B 3NY0A 2VQEK 2RDJA 2ZBPA 2FJ6A 2WONA 1NAQA 5HQLA 1M5PC 3VGUA 1DURA 2QRRA 1HWLA 2RVJA 3CIPA 1IKYB 4BHQA 2Q3PA 3Q8VA 4DTOA 1XNSA 2YNHA 3H2VE 2NQPA 2DGSA 3BEXA 3GZFA 3WKBA 4QZFA 1G3OA 5IT9U 1YJNN 3H2LA 1SIJA 4DV3F 3S01A 4LBHA 4WCEL 2AIRB 1OQ3A 2HI0A 1QVFM 1T4GA 3RB0A 1FRHA 3HHLC 2Y9TA 4IO9L 4U67L 3ZZZA 4K8ZA 3JTOA 3MECA 1G1XA 2E5HA 3AD8C 2XIDA 3D2SA 4NLUA 3H2UB 5AQMA 3ILIA 1VQ8S 3HI9A 3KK1A 5FPNA 3BS5B 1B0VA 1R8HA 2WSEC 3Q8RB 3I4HX 4FO6A 2PMWA 4JD2B 3NVKA 4ZP9A 4U7BA 3VQ5A 4UB4A 2ZM6K 2MKSA 3HSDA 2D0BA 3AOCA 3BYRA 1I3AA 5KFRA 3DRPB 4IUFA 2W54A 4FSVA 2RRAA 1V3RA 3C23A 1Z19A 1AUSL 3LANA 2EFGA 4UZCA 1YJ9N 1AQ6A 1S49A 4RNMA 1PC4A 4KFBB 3ALRA 3NVYA 1TK0A 4J91A 3ZETB 4OI1A 3HVWA 2HRYA 8ICGA 1G6BA 1P9YA 4DUTA 1OY9A 3L4PA 1RZMA 2X1FA 1IBKF 2CUYA 3MAHA 3KOAA 1K8KB 3AL0B 1KAXA 5KQDA 4EIAA 2MZJA 2A2CA 3I0SA 2PMZD 2NS1B 1ZQSA 3QFWA 3TZZA 4GW6A 1M5KC 1P90A 3B6PA 2HHPA 1MN7A 2DHGA 3O3LA 5J8YC 2D7SA 5HBMB 4DBQA 4JI6K 3HHDA 3AOAA 1IR0A 1NB7A 3NMUA 4QZAA 4C98A 2DO0A 1EIYB 2LSNA 4JKAA 4UOCA 1UWBB 1NHKL 1QJHA 1FO1A 2DR8A 4PUOA 1OVQA 3I31A 4TY9A 3QYPA 3PACA 4KYZA 5C0YA 1HQEA 3GYNA 3K4GA 5LMNF 1S0OA 3NCIA 4EZ6A 4P4OA 3P49B 3JYTA 3M8PA 2A3JA 5J0YA 1JRPA 3I56N 2VQFF 1NJIO 1RSCA 1IIPA 3P5BP 2QG9B 1GOCA 1YIJS 3Q2SC 4TY8B 1JLEA 4F2RA 3MDCA 4ZVQB 4MLEA 1DEJA 3HRGA 2RIJA 3WIUA 1XMBA 4OLBA 2ISOA 2NNWA 4AQYF 7ICKA 2LA4A 2DRDA 1VQLN 1URJA 5D0EA 9ICJA 3M7DA 3W61A 2PZSA 3GSIA 1Z00A 2M52A 2VICA 1NCLA 3UNYA 2ZC4A 1RT6A 1S1VA 3KXDA 2FGOA 1SV5A 4PEOA 4CNYA 1BISA 4NI2A 4CK3A 3CJKB 3FR0A 1KHWA 2F8MA 1M1HA 4YUDA 2R18A 5LY3A 5DB6A 2KP7A 3DWLA 4Z6CA 3L8BA 2KZMA 5AK5A 1RWNB 1FRKA 4OKEA 5J2MB 1WELA 4LF5K 2W42A 4O5KA 5F0XA 1X9MA 4QAGA 2KL8A 3CCQS 3D28A 2QYGA 1T3OA 2KNJA 3SV4A 2OMLA 1SCJB 1CC7A 4LSLA 2NZ4A 4PGYA 4USJC 2NSCA 1EKEA 1C1CA 3LM9A 4CFAA 3C14B 4H5TA 4ZPTR 1V97A 1HR0J 4KGVB 4EYHB 2ZZMA 4FXDA 4GKKJ 1N36J 2G8FA 4UBBA 1DTTB 2VPYB 2KYZA 4QPTA 1T3NA 2ZGZA 2W55A 3L3UA 1REVA 3RAQA 2DNZA 3WKAA 1TYQB 1VQNN 4KAIA 3SCLE 4RPYA 1M1KT 2H3VA 3VEVA 2EI5A 2BE7D 1HFEL 2CJBA 4B3TJ 5D77A 2Q0UA 5J1EA 5GAEI 3G6XA 2ODGA 4Z0UA 2Y0SD 2XRIA 2IA6A 4WYWA 3ENOA 3TZWA 5ALFA 3VENA 3U1MA 3PO5A 2LQBA 2QA1A 3AVAA 3N5BA 3B4MA 4ZP7A 1K47A 3QU7A 4CT9A 3E58A 4FS1A 2HLTA 2RMLA 1RT7B 3TFRA 2XSJB 1Z6RA 4B3OB 2BE2B 3M1YA 3BGRA 5KGXA 1RACB 4A8WA 3OFGA 4FJIA 3KLFB 3W5YA 4Y2UA 2M0GB 3F2CA 1JLBA 4USTA 2ZH7A 5D0HA 2VA8A 4UAUA 3QFHA 2HOFA 4DTSA 3H7HB 5C2FA 2W9BA 4XK8C 1WI8A 5EX3A 1S9GB 5KFYA 4O8KA 4IOAQ 5JLHA 4ZVOB 2JRSA 3MURP 4DFMA 3C2PA 1KAZA 2KSOB 4KLSA 2OZMA 3PUFA 5HRNA 5C2GA 1N5YA 5DBBA 1NGEA 5BYSA 1T6CA 4IQMA 2WFBA 4BGBA 3CD5A 2QSFA 2KZ3A 2GHPA 2XSJA 3MM5B 2HEKA 3GE1A 4GVLA 1RP5A 3JB9k 3ZZOA 4ZN1A 4LUBA 3DLHA 1T11A 1UJ5A 2J4RA 2N3LA 2J6TA 4R65A 2B9YA 2GWKA 2VU5A 4QJVA 4O4GB 1IQTA 4M0AA 1R0AB 3CD6N 1TL1A 3CXCR 3D1HA 3C5GA 1UOCA 5AJ3K 2K89A 3K59A 1N5SA 3WXJA 2YPZA 1L7NA 2FUG9 2ZJPL 2K60A 2QWMA 2I6XA 4MK7A 1NGDA 4LF6K 1J9AA 3CE8A 2YWKA 4LT6A 3RW6A 3VA3A 4RQNA 3TFSA 1YVUA 2BCSA 3OQ2A 2WOMA 4M7XA 2DNRA 2WW8A 2BZFA 1BI4A 4I2QA 2JSXA 3IBCB 2YHYA 2ZQBA 4H0PA 4GMKA 4OZ0A 3U1NA 4OLPA 3AU2A 5J2HA 4IO9Q 3M8QA 3RAXA 4C11A 3BZCA 4FNHA 2I5JB 1TMMA 7ICSA 3HLUA 3SUPA 4I2BA 1QHTA 1JLBB 5DZ6A 4CWBA 4RW8B 1W2BM 4AP9A 4CZHA 4A48A 3JSMB 2OPRA 4NZ0A 2CPXA 4ZVRB 4W5QA 1A77A 3G6EN 3EN9A 4F4XA 3QFUA 2GIQA 1Y4ZB 2PKEA 4JI4J 3SENA 3T5KA 1X3NA 3X3UA 5F8HA 1S9FA 3OYLA 4L3KA 5K14A 2A6OA 4OPKA 3MXHP 2HHQA 3KMSA 5DLFA 2NXJA 2VOOA 4FJKA 3PYFA 4WK1A 5ADXH 4YOWA 2HZCA 5KFXA 3H1VX 3M9MB 1Y97A 2NXUA 1W2IA 4QZ8A 1G7CB 1Q95G 3SYZA 1WSFA 3WUHA 3P4UB 4FJXA 4MFBA 4AILC 8ICJA 2BJ9A 1F21A 2IC3A 1WOSA 4WPAA 2P9UB 2AGPA 3SCXA 1SC6A 2VC1A 1ZS6A 3H6EA 1VLOA 4O3OA 1ZM9A 2HMIB 4U8YA 3KUGA 4I9QA 3TX0A 1CG2A 4DSFA 3JPQA 3IRXB 4WXWA 3UO0A 2J0QD 2YWHA 1WWUA 1JI7A 2ZD1B 1D3WA 3P1GA 1FDBA 5KFVA 5FRNA 1YHQN 4DV0F 2WOMB 5I42B 1QQMA 3LPYA 4M47A 2VIXA 1Y5IB 3HKZD 1B9DA 3OYJA 3ENVA 1RT4A 4CLYA 1GLEG 1M5HA 3R5CA 5CABA 3UXPA 4ZIVA 3MHYA 3GONA 4IR1A 3W63A 2CYYA 3H3NO 8ICUA 4OI2A 4AM7A 2UZAA 2R7TA 1HKCA 1NGBA 3OYDA 2BUNA 3FEZA 5DB7A 1NMDA 4LQ3A 1XMQK 2OP5A 1OPZA 1UT8A 1HQUB 2BUPA 1YKWA 2MQMA 3DLRA 4BE1A 2CQ1A 3LAKA 5CRXA 4KH4A 2UUBK 2GO7A 1HJRA 2YNIA 1MROB 3HOSA 2CNLB 2VFRA 1CUKA 1T0TV 3NF9A 2MLYA 3MPVA 3QSIA 1YVNA 3SFGA 1SJ1A 3MMCB 2PBDA 2X1AA 5J2CA 1AW0A 2RS2A 2LQ5A 1IV0A 1WHWA 2UXCF 4PZNA 2PT0A 1JN3A 5C7PA 2IBKA 2DVIA 4JB3A 4KRFA 1QZ5A 5J0SA 2B6AA 3PO4A 2MPUA 1MN9A 2H65B 4DX5A 4JI1J 2H3FA 3J7YP 1XEZA 4BUGA 2C2KB 2CQBA 4DR4F 5FJ4A 4ISEA 2CADA 1S7HA 4Y2JA 4UARA 4KHYA 4YN4A 1HYZA 4WIIA 3MX2A 4TNOA 4K41A 5KFNA 4LIRA 3SCJE 2C3PA 2CJQA 1RISA 3IAYA 2HGLA 4YXJA 4HWIA 4DR5J 2KU7A 4Y2AA 2XMWA 3AA2A 5M2PA 1EARA 4WP8A 3GLJA 2JJ4D 3EWAA 1A6SA 4JV1A 2OPPA 2ZH8A 4YNQA 1OY8A 4L6V3 1LFWA 4EP4A 1J27A 1HNZK 1VCTA 2CQ4A 5AKHA 1N63A 4I6YA 3HPGA 3IHQB 1S76D 3CI5A 3DXMB 2KV2A 2C42A 2B4VA 4WFZA 2DISA 4RO0A 3CCLN 2VWJA 2EKYA 4CI6A 4OLAA 3KLGB 3ADAC 2CIMA 2AZ1A 1DOQA 4FM2A 3CPEA 3H5UA 1RDRA 4RWWA 3RRHA 2Q2RA 2C2MB 3I6PA 4RU2A 3CQXA 1C1BB 4Y1DA 1FT8A 2OTJS 5M1PA 4OCZA 4IQVA 2QFJA 1PBAA 3SQ2A 2PO4A 1F3FA 3NHGA 1WSEA 2GZOA 5KFLA 4QS8A 4Y0WA 5AHXA 4QS7A 1GLJO 4X62J 5ALMA 3OHBA 3W5XA 1Q16B 2DNHA 3U3GA 2D3UA 3KLIA 1H73A 4YDDB 4GV9A 1NSAA 3H25A 4QIGA 1NLVA 3MXMA 3TEHB 4R64A 1Q7YT 1AUDA 3U26A 1TKXA 4ATNA 4OKKA 2HHHK 1UZDA 5LXYA 1SWVA 3W9JA 5E3QA 5J2NA 3HZEA 5ETPA 2P9NA 2ALYB 2KICA 3H98A 3MMCA 1JKHA 4WF9L 3HSTB 2M9KA 2RN2A 3KLFA 1N56A 1RWWB 3TI0A 4DR1K 4RJVA 5J2FA 9ICFA 4EELA 1MU2A 4IL6U 3ZZRA 2WF5A 3O1LA 2R2SA 1IKYA 1CZBA 3HRDD 4DUZJ 3CDAA 3OXLA 1HMVB 2PXIA 4KLDA 3AOBA 1N5YB 3O5BA 3RUBL 2DR6A 4DMNA 3FZ2A 2NUBA 4F0HA 1X4DA 1ZXIA 4KTQA 4E2FB 3A8YA 1H6KX 3ET6B 4CGIA 3U02A 1QQ5A 3OBWA 3BGUA 1QAJA 2JEGA 3CJTA 3V9SA 5AKXA 1FRIA 3L2UA 4IFYB 4O9MA 2CJXB 4ZOHC 2QLFB 3QLHA 4OI3A 2F9WA 1FW6A 1KQSM 4Y2PA 3KHLA 5L1KA 3Q89A 3WDOA 1WN7A 3RFAA 4EO8A 2AP6A 3MEGA 4V19S 2R4FA 1UEUA 3G0ZA 2A3ZA 1U47A 4F3OA 4GKKK 5F8NA 2K7JA 2ERRA 2AJ2A 2RE2A 3LDAA 4B17A 4DOAA 5CR4A 4AYBC 7ICMA 2NPFA 4I2PA 3ZFVA 3N7RC 1S1XA 1U9LA 2VH7A 2DTUA 3R97A 2ZIWA 3CQ8A 1VYAA 2KJ5A 4MKBA 2B51A 2R42A 3EZWA 4TU7A 3WXIA 3UVJA 8ICLA 3EYZA 3MPUB 1IKXB 1BMQB 2FQQB 4DV2F 1LWEB 3JYTB 1FNXH 4Z4FA 4U95A 1JWWA 1QQ7A 3F9MA 5K8OA 1ZOLA 1TV6A 3RMAA 3EDRB 2MQPA 1KBUA 3EEQA 1QY7A 5GADP 3O44A 3QUTA 4KMOB 2GNKA 4CJLA 4DR1F 1GMUA 2MA1A 1SXEA 5KAIU 3Q8QB 3N4MB 2VBYA 4A8YA 2YKPA 1X9WA 1S57A 3ISDA 4DTXA 3MCMA 3L4IA 4DO9A 2DH8A 4IH7A 1SGGA 4ZLPA 2KB2A 3IGNA 2XI3A 3V6HA 1A0PA 1HLWA 2EBEA 3THWA 4DCPB 2E1FA 3DDHA 1L8OA 4YFKA 5JRTA 2G07A 1NJIT 4RR5A 4F04B 1S1TB 4C4RA 3CB4A 9ICWA 2RH3A 3PSTA 4H0XB 5K14B 4NL9A 4Q8FA 2VFSA 2UXCK 1S10A 3R1XA 4YY3J 1NZPA 2E8PA 4IFYA 1VI7A 1PK1A 4AQYJ 3DLGA 2KEYA 3T1YJ 3HT0A 3GILA 5ETOA 1SKRA 4RQ3A 3C95A 2FZKB 3TX8A 3ZSXA 3L2VA 4CF5A 1SL1A 3IWNC 4BDPA 2FSJA 1HNZF 1Q82O 5BN8A 1TVAA 2FPLA 2BJ7A 1VC6A 1SXDA 3AVLA 2CZVC 2F5GA 2DBBA 3VAIA 1QTNB 2Y1IA 1CEZA 3G8SA 5DM7Q 1IBKJ 5E3PA 1IBCB 4NM2A 1U48A 3VESA 4FKYA 2XS2A 3OXFA 3OYMA 4USHA 4B1ZA 1IBLK 1H98A 5JS1A 5LL6d 2PFNA 1V4SA 4CZMA 1WWVA 1V5IB 1S9GA 4US9A 4BR2A 4LF6J 3I56S 4EP5A 1OH5A 2VPXB 4RQ8A 2APOA 1XO0A 3M7VA 2J0WA 1VSIA 1S5ZA 3F41A 4Y28C 1YI2S 1Q81T 4PJ0U 4DV5F 1LWCA 3NMAA 4FWMA 2P5OA 2DGZA 1FTRA 1K8AT 4ED7A 5HRPA 1TUYA 4V19X 4EUVA 1YJWS 3VQ8A 4BRQA 2YB1A 4LF4K 1WCNA 1WNSA 3D5MA 4OI4A 4MDAA 2V94A 1G2EA 3CC4S 3N7SC 2W40A 3D66A 3JSRA 1U1RA 3DLEB 4NMLA 2KIWA 1HUXA 1RBLA 2VJVA 1Q46A 1KEKA 1YJTA 1CZAN 3V6DA 5KFEA 7FDRA 2GOLA 1O0PA 1SUQB 2KRBA 1FESA 4BWJA 2KVCA 3M32A 2YQ0A 2L9WA 1N62A 3H1QA 3NUQA 1SJ3P 7ICUA 4YQWA 4M7YA 3T9NA 5ETMA 3W62A 3NMRA 2XMMA 4LF7J 1NBWA 2JZ5A 2FBTA 5CA5A 3M2UB 3RWUA 3K5LA 3OW2M 2OO4A 4FLZA 3X1LB 1ZBHA 3IWXA 2NSBA 4OJ6A 2VBXA 2K8AA 4X4QA 3L2RA 2HF4A 4YY3F 3OJSA 4KB7A 1FA0A 1BXNA 5DDPC 2VQFK 8ICZA 1M1GA 4NASA 4B6JA 2OXOA 3CFOA 4F25A 2CZ9A 7ICFA 2CFXA 5I3QA 5D46A 5ADZA 4CJUA 3LDLA 3MR7A 2I2YA 3TAMB 1DHMA 3LH2S 2NO5A 1V3ZA 4ILRA 1RXWA 4IG0A 4CO4A 1VR6A 1WHVA 5L9NA 2BW7A 3KLHB 3TACB 4NO7A 1Q8LA 1SV5B 3UMCA 3L4BC 3PY8A 2W4CA 4URGA 1XK8A 5HP1B 2JC1A 2EDUA 4HACA 4M8LA 1VSKA 1EQYA 2H5IB 3ZX3A 1IVZA 4F4AA 3LL3A 1O5JA 3KLVA 5HRSA 4FVMA 2HMPA 2P9UA 3HULA 3J7YI 1S0NA 1ELOA 3E01B 2ZH5A 5CHGA 3NGDA 2FLPA 4FXWA 2E1YA 4B9TA 4J9VA 1BWEA 4ZJOA 2J8SA 3HD2A 4I2AA 5C25B 3WXLA 5HMYA 3T7ZA 8ICVA 1FVQA 1J5EK 1U2CA 2HHTA 2Q43A 2V69A 5AM0A 3QEIA 3K7RA 1S0MA 4OMFG 2HB5A 3NF6A 3EPGA 1N52B 1VHFA 2IC3B 1RKJA 2I9SA 5KFTA 3K2YA 3ASMA 4ZS6A 3IM1A 2QXFA 4CTAB 4DHVA 4CZKA 4B9UA 2VQEF 3AB2B 3GYXB 4Y2TA 2YX8A 1WD6A 4AUKA 4RQ5A 4TN2A 2VHGA 1RAOA 1C6VA 1RCOB 4IJNA 3QNWB 4CLWA 1JLFB 4OGCA 1QS4A 4CCHA 3T6BA 2J0SD 1U6ZA 1PSDA 4DHYA 3AJ1A 5AQUA 4QR0A 5J0PA 3SSRA 3D0HE 3MEDA 4KKOA 4A5BA 3T6JA 4LVNP 3R3LA 4KAZA 5FPMA 1WOPA 4X4NA 2J5AA 4F5QA 2Y9HA 1X4AA 2M8DB 2CG4A 1KNZA 2XY5A 2FBXA 1IBMK 2KHOA 1JNRB 1VQ7N 4PZOA 2DY1A 3FM9A 2V8GA 1B7YB 1SV0C 4DV0K 3O8WA 1Q3VA 3THXB 4P4MA 2KTQA 2MGZB 1KAYA 4Y2RA 1HUOA 4HEA9 3MX5A 4KFBA 2XI2A 1KC8T 2PA3A 3UN3A 4O44A 2BRLA 2UVWA 1R6VA 2R8GA 3QIOA 2G8KA 2GWSA 4OO1J 1YGYA 1TAMA 1KBRA 4GLXA 1WKJA 3F53A 2BJEA 4DV4K 1ZPWX 5DETA 4J8FA 3W0LA 2U1AA 2CDRB 4ILHA 4FWPA 1VBZA 3NAEA 3JS6A 5AKKA 4IQTA 1QUVA 2OIHA 3DU6A 4Y2CA 1Z1VA 3H7IA 1I1GA 3VWSA 1I94F 2UUTA 4X66F 3W9IA 3VEWA 3ZTRA 3UR0A 3RH5A 2H5EA 1YDLA 3GTYX 3HL8A 2DJWA 2GH1A 4C11B 3A0IX 5D3GA 4M3RA 2G8WA 9ICEA 1AFJA 2QWRA 4M5KA 5DJBA 2DY4A 3NRZA 3DRXA 4OI0A 2L5YA 2M9NA 2O8EA 2HBRB 4KLGA 2DXEA 2LP4A 3ZD8A 3UXOA 2QT7A 5FLXO 2PFPA 4GVBA 1ZQIA 3FMWA 2ATLA 3K5PA 1VQ8N 1O1WA 3SBGA 4FPAA 4BCAA 1AXQA 4C2MA 4DR2F 1UL3A 2HMXA 4MIWA 4DDFA 1NXIA 5B0AA 2LEPA 4XDDA 2HSTA 4C7ZA 5AM3A 3EZ5A 3LDSA 2O8BA 1HBNB 3KKRA 2XZDB 1BU6O 1VQ7S 1KQFB 3OXGA 4FM0A 4F0KA 1F2HA 4KHMA 1RT5B 2ZWHA 4CEFA 4ZPCA 2FE9A 4O5CA 3UM9A 2HFVA 2P9CA 3PJWA 4TYAA 1RTIB 3H0RB 3K57A 5F1XA 4PGQA 3NS5A 1LCUA 1HX1A 1Q7LB 3C15B 1QQ6A 1ZA1B 3K1RB 5C2DA 2AYMA 2C2RA 2QA4N 1ZZFA 2KN4A 2R7OA 5JMVA 3CFPA 4W5TA 2QWNA 3IFEA 5U47A 5J0WA 2Q6CA 4DSIA 2ZOMA 1BPDA 4OYXA 1N61A 5F0UA 2W6LA 1FNOA 3OR2B 1RGVA 2DF4B 5J2NB 4JHDA 2WBNA 3CC7N 5HMWA 2JMGA 1Q53A 2B0CA 2GFFA 3I33A 3ZSWA 4K50A 4YOEA 1UFWA 4O3NA 1E6YB 3KVGA 3PW0A 4PG8A 1FCAA 3BGOP 5L1IA 4DR6F 1CQNA 3FBEA 4CTAA 4NJ8A 1CC8A 3AVIA 4J9OA 3TUZC 2PC6A 2GVDA 2D0CA 2Y0SF 4PYAA 2LECA 3SMSA 1JNZB 2A3VA 4KH6A 4CM0A 3AVNA 2RB7A 1KVJA 4KN7A 2MKJA 2BVZA 4CJ5A 3CJ2A 1K1QA 2FHJA 3HP6A 4Z94A 4WJ3B 1P1TA 2QJ3A 3TUIC 3GIRA 1KKXA 2B7CB 4LSLB 4Y2MA 2V51B 5AR0A 3KK3B 3Q22A 8ICNA 5AI8A 5KFGA 3KMQA 1WI6A 3PYEA 1FEZA 3E8OA 3FRYA 3M6ZA 2Z7JA 2O8BB 1EKSA 3OS1A 2ASLA 4KTWA 1PK3A 4F93B 2KFZA 3MWTA 3C28A 1Q18A 1DZ5A 2E20A 1S6UA 2E5GA 1URRA 1HD1A 2WTFA 2Q66A 2JH1A 3HSZA 5AQLA 2QL7B 1FDDA 4DR3K 3D0GE 1FD2A 1ZQNA 4NZ7A 3T1HK 4B8AB 5T14A 3AO1A 2ZJRL 5JVHL 3WK8A 1WSHA 1BQMB 4K8RA 2FLLA 1O13A 3ATVA 4DX6A 2ILYA 2ZDOA 4HT5A 3BPSP 3POTA 1UEKA 1YHQS 3V4IB 3VOVA 4MFCA 4V19J 1UCNA 3QETA 1VQ5S 1B4SA 4P2SA 5I3UA 2MKCA 4PL7A 3ULHA 4IOBA 4GC6A 2BE9B 3R1HA 5GTIU 4RW6A 3QU5A 4PXBA 4NM1A 2MEWA 3FQKA 1WJ9A 2ZIXA 1RDBA 3CGIA 4CW7B 1FX4A 3VAMA 3L2QA 2A2DA 5KT4A 2IBOA 1RAEB 3HSCA 3RMCA 1L3UA 2DIUA 2ZTEA 5IC4B 1LQ9A 3KJVA 4F5PA 5L39A 2PY5A 1J2VA 2IM3A 1F5SA 2YWWA 3A5NC 4QYRA 5AJ3J 4RQMA 1D0EA 3A0BU 2A1BA 1TAUA 3ZTSA 5HP1A 3M8ZA 4FZVA 2IOHA 4R0EA 4B3RF 2AA4A 1UVKA 2YH0A 2E2OA 4M42A 5C25A 2XLIA 2DKOB 2XYGB 2XHCA 3CCJS 1OYEA 4BRNA 3H4DA 4RW6B 3HDSA 1N8RO 5LXRA 2F8SA 3RYLA 4RG8A 1RT2B 1SBRA 3M2VB 1OIAA 2IVNA 1NGCA 5CJ7A 1NKBA 4BQZA 4DV5J 9ICNA 1Z1BA 4AHCA 2KJWA 2AYEA 2R8KA 5DMRA 1ZQMA 3CEDA 3D9BA 2ACYA 2MJUA 1CSJA 2J9CA 4JKCA 3VCDA 2NRTA 1Z25A 3FGUA 4IRDA 1NDPA 1YZ6A 3C46A 2OH2A 2QKQA 2XWXA 4WTOB 3AB4B 1WWHA 3RJHA 3N4WA 4G1PA 3SNNA 2BBEA 3CJBA 4OX6A 2PN6A 1SL2A 4P0PA 5K4LA 2OYQA 2FVRA 2QLTA 5LJWA 4DFDA 3K5NA 5BRFA 4NRTA 4DR5F 3OJUA 3Q7BA 5HATA 1R0CB 1LXNA 4CK1A 2IHNA 2A42A 4K4YA 3SBTA 3ZCMA 3CCLS 3J80U 3PYDA 1DKGD 2KHDA 1Q4RA 4QCLA 4F8RA 3KLEB 5CA7A 1RQNA 5CYQA 4YOVA 2WB1D 1EZZB 4KB0A 1A5XA 4OQJA 3O3GA 4FJ8A 4M5MA 1WBBA 3CCMN 2AYBA 3A2FA 3KLGA 2C2ZB 4TKTA 2KM8C 1FJGK 5E79U 3UDEA 1XN9A 4NLZA 4DTJA 2CXYA 1DBDA 2QKBA 2KQ2A 1C0TB 1LEOA 3CJSA 1TYQA 3M8YA 4NLWA 4I0WA 5HVHA 4HTLA 2QB1A 8ICIA 5C5JA 3HHLB 1RCHA 3GP9A 4H5NA 3R5JB 4F91B 1RWXB 4NYFA 2JWLA 2RF2B 4F26A 3TA0A 5KT5A 3EXCX 3MN6A 4FCYA 3I9V9 4IDKB 2R2UA 4X65K 3OVNA 1C4CA 4P10A 3QBWA 4JKGA 1ZQPA 1FRXA 3O1BA 4FBTA 4CF9A 2ZBIA 2YNFA 2Q0RA 4NX9A 1Q8IA 5A8WB 3CCUN 1B9FA 4ED8A 4RCHA 3CJ8A 1VK8A 1HNWJ 4A57A 2R7QA 3T3FA 2MHEA 3M32B 3VQ6A 3WX4A 4JK9A 1PJ5A 3OYCA 4W5NA 1FKPA 3LUYA 2I5HA 4OFZA 1XR6A 5IWAF 3AVKA 2KKZA 5KFQA 1NSQA 4M5IA 1YQHA 4FK0A 1RYRA 1JIHA 2A19A 3R27A 4M3XA 3ZSVA 2KYXA 4LRAA 2EQYA 4F4ZA 2GGPA 1U25A 4CIEA 4HVZA 3V5RA 5ADXA 3CULA 2C3OA 1Z4UA 2KOBA 3BN7A 1O6XA 1U0HA 3HX0A 3RBDA 3LAMA 4KLTA 3QE9Y 2YKQA 2C2EA 2EFVA 4BVOA 2BJ3A 4W5RA 5D6GA 1T3QA 1IXRA 4B1UB 1J5EJ 4XH1A 5HMXA 2CQCA 1LWEA 5ETLA 1Q3UA 3GCWP 1TAQA 3P83D 4J37A 2BEFA 4UOHA 5F8JA 2HNDA 4DR6K 3SCIE 1U24A 2DY9A 3MTJA 2DD8S 1Q0NA 2LDYA 4C23A 5M1QA 3KJQB 4KN4A 2H3IA 2P66A 2QIFA 3V81B 3UMBA 4KJIA 4MF2A 3DKDA 4H4KA 1RHRB 4IFVA 3ISND 3D3CJ 4DV1J 1ED1A 2B3TB 2LMIA 4IFEA 1LB2B 2BV3A 3US5A 2UU9F 5CZ2A 4UUWA 3MAQA 3AXMA 3FMBA 2WB1C 2POKA 2YTUA 4TYBA 2C3MA 3W2VA 1E4FT 4BRIA 2A0FB 3G87A 3N5FA 3O5TB 4P72A 1F9EB 3AH6A 3RVCA 4QOTA 1RGIA 3I5CA 4KHRA 5ETKA 4YDUC 3A3NB 5CD4A 3HPHA 2H4YB 5KG2A 4PKHA 1WF0A 4FXVA 5ETTA 3O80A 1TL5A 1MG7A 2K8CB 1HW8A 3OV7A 1NJWA 3OBIA 1I5OB 2EANA 5EUHA 1HR0K 5GIOA 4ISGA 3PR4A 1MMNA 5BRHA 1U1NA 2OD6A 4DOZA 2VQFJ 3JPPA 2ZM6J 5IXUA 1BOTO 3QIPA 5E84A 4GKKF 4TUQA 3IKMA 4GIBA 4MIBA 4WQ4A 1HNIB 1SB3C 8ICBA 1VQPN 8ICCA 5ALEA 3M8PB 2E9TA 2MKIA 5D4OA 4DU3A 2VKZG 1VC0A 3CCSS 3QB0A 2IVFB 1I6JA 3PNCA 1G15A 3J7YU 4I29A 1N5QA 2VQEJ 1KXPA 1S1TA 1C0FA 1JX4A 3LDPA 4ID8A 1NGAA 4ZVUB 1YX2A 1IKVB 4CDIA 3OVAA 2LU2A 3J81U 4OHXA 2DQNB 3BGLA 1BWFO 2GHWA 4FJHA 3NRWA 4ED2A 4P71A 1BUPA 5GAGI 5DG9A 3K5OA 4IS7A 5DG7A 2H3EB 1VLYA 2XB2D 4YOTA 1ILYA 5ALQA 3UWTA 2NRZA 4KPYA 2QL5B 4PUOB 1R6YA 3LK9A 4CJEA 4DQRA 5CHIA 2GCFA 1BIUA 1Y10A 2QW9A 1HPZA 4KHNA 2LXFA 3NXZA 3I5BA 3WXKA 4FK2A 2H1YA 1BPZA 1APSA 2XY7A 4JKFA 3C29A 4GFJA 4HTJA 4KI6A 3TVZA 5T7BA 5CQGA 2CZ4A 2HF3A 5J0UA 2ITGA 3I0RA 5D4PA 4YMOA 3CO9A 3OLBA 2WVFA 4USKA 3QUCA 1TUGB 5LMNK 1Y64A 1B3TA 1ZRNA 3CC2N 5ALSA 2DFFA 3NGUA 2D3O1 1KEJA 4JLHA 4B02A 1BHLA 5CB1A 1NKEA 2AD9A 4M5NA 3E51A 3H40A 4FF2A 4DR4J 3Q8YA 1C0GA 3E9OA 4CBXA 4B08A 2XM3A 2Z2LA 3QRPA 4QYZJ 4XEIA 2N82B 3GG4A 5J1PA 4O0IA 2P5GA 2BDUA 1PYSB 2HVDA 4HACB 2CPRA 2QLBB 3CYMA 2HVEA 1VSHA 1W2BR 3T1YK 4DUZK 3QJLA 1D8ZA 4DN0A 1J5EF 1YLXA 1NNEA 4ZTJA 3PVXA 3MOJB 8ATCB 3AU6A 2V8PA 1CLQA 3PIPQ 4JI0K 5HRRA 3BS5A 3UI3A 4FFDA 1X4GA 1JLQA 2KLAA 3AHPA 4FWKA 3WHIA 5A8WA 2YKMB 2KXNB 4NRUA 5M1OA 5BYRA 1NG9A 3IV6A 4BROA 1YITS 2YPYA 1P6TA 1ITGA 3KKFA 4M95A 4DKWA 1Y9OA 3ICXA 2KXHA 2J0XA 2HNZA 3O9SA 1XSNA 1UVLA 9ICKA 3U6FA 2XTJP 2FDNA 3C5FA 5EX0A 1HYSB 4N8OA 4PKIA 3DGPA 2FSNA 3HF5A 3DYAB 4HTUA 5LSOA 4C4SA 2EFPA 4NEZA 4J9RA 4RQ4A 4QBUA 4F4YA 3ZDEA 1YSJA 3NVVA 1RQLA 1T02A 4RWXA 2NRXA 3P5JA 3GYGA 2ZEJA 2UXDK 3M6VA 1ZQHA 4LZDA 1H2UX 5B08A 2IOFK 1CVJA 2IRUA 2QA4G 4LC9B 2E8AA 1H2VZ 3PR5B 5B8HA 3UNGC 3SI6A 3LO3A 1MDUB 3BZKA 3C2KA 1NK7A 4G3IA 2DGOA 3GR0A 3KG1A 3KD1E 3D7SB 3HJFA 2F8LA 1ZQCA 4KLEA 2EXUA 4EFHA 1H7XA 5C42A 3C15A 2DWQA 2DEIA 3O4QA 4GVMA 3B9JA 2HQGA 7AT1B 1JL1A 2PFOA 2BQRA 4ECSA 1F60B 3WNGA 1SH2A 5JLFA 1RDUA 4E89A 4R63A 1YT3A 2W43A 2QFIA 2AWZA 1QQCA 2D0OA 1YI2N 2O8FA 2ZE2B 2V7YA 2M70A 1DGJA 2IDLA 8AT1B 3A1YG 4KTZA 2W4PA 2RQ5A 2PGCA 1P8GA 3NS6A 7ICIA 1MA9B 4ZITA 4PG7A 3SXLA 2G0IA 3F5AA 2W2OP 1XHZA 2HVZA 3WK6A 3OR1A 5ELZA 5J8YA 2VDHA 4A8KA 4BLGA 2I7PA 1QM9A 1GXTA 2OPRB 3WNFA 1KD1O 2DFHA 5ALLA 3HKZF 4Z6DA 3VEOA 1L3TA 2OEHA 4YB6A 4OYPA 3TUPA 5K8MA 3RRGA 3H8MA 2YX1A 4PHPA 2B8QA 3FDSA 8ICOA 1BD6A 4PYDA 5RUBA 2I5JA 2VJUA 2OEMA 4QZDA 1WNEA 3QEVA 2E8MA 3TU5A 2AV5A 4C0OC 4PXCA 1TKTB 3SMPA 3F9KA 3PIOL 2DGTA 2V4QA 7ICTA 2G9OA 2AP1A 4DQQA 1UAXA 4BRKA 4Q2LA 2PFDA 1L7OA 3UMGA 1YJ9S 3BDEA 4ID1A 1X66A 3KK7A 2AGQA 5ALPA 1COKA 2LLZA 4PAAA 1RTDA 2GTDA 4P74A 1PILA 3OYAA 2XI9A 5G5GA 2C3YA 4CLLA 2KIVA 4A8QA 1HRHA 3EGWB 3R7SB 1SIWB 1SKWA 3AVCA 5KAFU 5AE3A 2RHSB 1EETB 2VBWA 4OZLA 4KGMA 2FC9A 4JK1A 4ED5A 4DV7J 4IZ9A 1IV8A 4E7HA 4LF9K 4JBCA 3ALYA 1QQOA 3QRQA 2MU2A 5ALTA 9RUBA 2E1EA 4Y2IA 4X4PA 2WUSA 1ZA2B 8ICTA 2QA4S 5GTHU 1GTEA 1IG8A 2H54B 2QI2A 1GK8A 1RXOB 3NNHA 3F0NA 3EX7B 5AIBA 1GMWD 4ZJLA 4DSKA 4MO4A 4YP3A 1IBMJ 5G0RA 3GSDA 3O3FA 1Y5LB 1SV0A 1NHUA 2QWQA 2HSEB 3CW2C 2HBJA 5MLCQ 4IEEA 4HH1A 1RCXB 2X6NA 3BREA 4FJ9A 4PXDA 3UKRA 4F9OA 3G82A 4IEIA 2KI2A 5E0OA 3RB4A 5E2QA 2GEMA 4CJWA 2EFOA 3ID8A 4OYOA 2FHKA 4MFBB 3NNAA 4RT2A 5CWRA 4Z4EA 2KFYA 5DM6L 2W1BA 4JI3F 1YJ7A 4DV1K 1GLDG 5KQ8A 3M6KA 5CXTA 1AZSA 4Z6FA 1NEEA 1FKOA 1WC3A 1BIZA 1X9JA 5HL7Q 1RBRA 3E66A 3HBTA 5F2RA 1PZNA 3WK7A 3H42A 4FBUA 1K1SA 3KDOA 4ZTFA 3V9XA 4CNQA 4QZHA 2VOPA 2FJDB 1Q5VA 4QZGA 4MYUA 5LOQA 1UPPA 4PWUA 2WF9A 4CZGA 3HFKA 5E5NA 1Q86O 4PL1A 4F7VA 4ZCMA 2VKRA 4OHZA 3OR1B 1HNIA 1VLBA 5B0DA 1W7AA 4PZVA 1UPMB 5B0EA 3M6XA 5FDLA 3HHKA 1HKBA 3RRKA 1RNHA 2E6MA 2EAMA 4JKHA 1S4EA 4LFCJ 4MKVA 3P38A 3ZT3A 2ZKUA 5B5EU 1WSJA 3CCUS 1KWMA 2ZUAA 3CHWA 1B4FA 4IH5A 5IV4A 5E41A 2J7WA 4PCQA 1TUUA 5L1JA 1RYSA 4Y34A 5J1NA 1X60A 3PLAA 3MF5A 1PKUA 3OFEA 3AVBA 1TL3B 1VQ5N 3LA0A 3KZBA 4DSJA 3L5KA 2KXFA 2QN6B 2NXEA 4KV8A 3ENWA 1UFKA 4LFCF 3SFUA 1N6QB 2F7VA 1ZQXA 3MEEB 5CCLA 5BREA 3R9PA 1WTBA 3FKBA 2PD1A 1X6JA 1DT9A 4B3MJ 4JYAK 5FPDA 4FYDA 3QAUA 3RJGA 3I55N 1UT5A 3ETOA 4OX7A 4U9RA 1WF2A 3O9UA 4MO5A 5KG4A 2QWOA 1OWXA 3TADA 1L3VA 3HXMA 4JI5J 2XULA 4K4HA 2EFQA 1V6HA 1NPRA 3QQCD 4WXOA 3O4WA 2IJFA 3SSQA 5AK6A 1CRXA 3M05A 1AT1B 3RB3A 4JV5J 3GDQA 4FWOA 4F02A 4OYAA 2Q3SA 3C16B 3QU4A 2DL0A 3DXKA 4YOUA 3LGHA 2OSRA 3NF8A 1YIJN 3MMBA 5F3ZA 1RT1A 3QGGA 1NJZA 4YFUA 4ZVHA 4QIEA 1VK0A 2AH5A 1Q9XA 4TXSA 3P45B 1PYTA 1RILA 4PH5A 1IJEB 5GAHU 4DQPA 1VS3A 3C66A 3THPA 4OGEA 4FOEA 4FE3A 2XMTA 4K0KJ 3CUNA 3MPWA 1JL2A 4O23A 2OSQA 1P1LA 1LWFA 5BOMA 4EYIB 2ZJQQ 4H03B 4WK3A 1N36K 3SEOA 1XWLA 3BF1A 3B6OA 1QLNA 3GG0A 2LKYA 3TYTA 2VWKA 3D0IE 4KGZB 5AFUA 1IBMF 4DR1J 2M88A 2O8DB 2O5DA 1NGHA 2W7OA 4K4SA 3CCWA 3TAQA 5LM7E 2XHBA 1VQYA 4JI1F 3CPWR 3QWUA 4BR4A 1HBNA 4C6AA 4M5LA 3MN5A 2F4FA 4C4WA 4CLKA 3Q7CA 1J53A 2XLJA 1GLCG 5IIJA 1RAGB 1RUSA 4GV6A 4ECWA 3W9HA 2FXUA 2E1AA 3ISZA 4CDGA 5A8KB 1QQNA 3BF3A 1REVB 4BXOB 1O51A 1ASVA 2NRWA 2U2FA 4HAIA 3BJYA 3OUYA 3UVJB 3FFKB 1T44A 3HTVA 2RUGA 3C16A 3AA3A 3G25A 4Q45A 1PAEX 1G4CA 4PQUA 3KHGA 1NRKA 1R43A 2QB0A 4CH7A 3V6KA 2P6UA 2PAVA 2V5HG 4IDHA 3MUMP 4ANCA 4KHSA 3R8EA 3GJRB 3J7AP 5J2BA 4JP8A 5GMDA 3VEYA 2FLOA 3SAFA 2P6SA 4N41A 4D3HA 1VRTB 4JV2A 4WQ5C 3ISCA 3CXCM 4CFDA 4I6MA 4DL3A 3MECB 3MR6A 1KFDA 1DRZA 2BKNA 2FSKA 4NMXA 1CJTB 4UY8T 4J2AA 1TFRA 5E33A 5FLXU 8ICHA 4P7VA 2P9IB 2Z1JA 2VD3A 3S8SA 4CLPA 3CRXA 3NKYA 4DLGA 5D78A 4FF1A 5LJ5Y 1D1UA 3K5MA 4CEAA 2DIVA 5KPZA 2JR5A 3FZHA 2QTWA 1S1UB 3GOIA 3C2LA 5H1SV 1EWRA 2VPWB 4C0BA 4GV3A 1JLAA 1NGJA 3K2PA 4BC4A 1ESVA 3DNCA 5D0GA 4GXKA 3B0YA 3L2WA 3C19A 4M9GA 1SB6A 2UUCJ 1EETA 4TUSA 3H5SA 3JTNA 3ZYYX 4DG1A 3MWPA 4YORA 4IG0B 1EP4A 5HSPA 1I94J 4HT7A 1OSDA 5AIAA 4DR3J 4OX9F 3LALA 2LQ9A 3PIOQ 3HHNB 1HQ2A 2PFUA 4ICLA 3V6JA 1RBOB 3VQDA 3SQ1A 5ALHA 4UY8O 1SZ2A 4NXMJ 3CWJA 4R8UA 3HYFA 1XNQJ 3EDQB 1HJPA 3M1VB 2VJ5A 4LBIA 1NPPA 1TKTA 3I8BA 5CYMB 2I1RA 4I2QB 3VAHA 4P73A 1JXEA 1HWUA 4CGZA 2IVMA 3T5JA 5F9NA 2HPUA 2OTJN 3TZXA 2CH5A 1D09B 3RBEA 1EXNA 1VRTA 1NI3A 4Q0BB 1VRUA 2ZHOA 1VMBA 4FPRA 1HI0P 2E4LA 3QGHA 3K89A 3P96A 5BR9A 1YITN 4HYKA 2CRLA 5ETVA 3CMEN 1YG0A 4LR7A 4MF8A 2XYHB 5IWAK 5F0WA 3KOOA 3SPYA 3TJAA 2KHQA 1UEVA 4LF4J 2GMHA 3LP0A 3RSEB 4NY8A 4ZVGA 3BO2A 2VG5B 2M4MA 2Q6BA 1WKKA 5CR0A 1WF1A 4JD2A 1IM4A 4QJFB 2AHOB 2BCQA 5JICA 1KTVA 1VC5A 3DOMB 2XZWA 4R66A 5HQMA 4CF3A 4C1NI 1MSWD 1M1KO 1MWZA 2B6AB 1H72C 2E8NA 3M8RA 1N5VA 1HD0A 1QE1B 2PEHA 3A3PB 4WKYA 3GIMA 3HW8A 3IBPA 2BMBA 4IOCL 3J7A1 1KN5A 4CJPA 1HI8A 4IR9A 2MZQA 4ILJA 4L72B 1RWVB 3WNHA 5KT6A 3F73A 1ZAWA 4F4KA 4OJRA 4FJMA 4CRXA 2OZSA 3EZUA 4FYVB 2ZXIA 1GLFO 4PQAA 3FCVA 2DNOA 5EGYA 3UKUB 3IP0A 4DEZA 2G0AA 2O67A 4I68A 1ZZNA 4QIWF 2F9DA 1CJTA 2NO4A 1BPBA 3VQAA 4EHTA 3I0RB 4J90A 1UW9A 5JU5A 1WYGA 2MRLA 4FWSA 2FD2A 3ZZTA 4DR3F 3T1HF 5J2KA 2KVIA 1NK6A 2DNMA 2HNYA 1GTHA 2DRBA 4OX9K 3D2NA 1BCOA 1HL6A 2BJDA 5HJYA 2Q4TA 2BGGA 2DBYA 4ID5A 2IGIA 4B9NA 3V6DB 3CP8A 4ZHRA 2HW3A 4EWTA 2MQQA 3OT9A 1N48A 3G71N 1WG1A 3TAPA 3GB0A 1RTHB 2OD4A 4IKAA 2R8HA 3DOKB 3FZLA 3KLEA 1UQVA 1IKVA 4H8KA 1NU4A 2D0AA 2QLJB 4RW4B 1NDCA 3W2WA 3MXJA 2Z1HA 2HSZA 1PUZA 3OL8A 3HI0A 4XUSA 4E1JA 2HZVA 4PHTX 1NM2A 4YXMA 4BACA 1RE1B 1D9FA 2DGQA 2KRRA 2D1KA 5I4MA 2QEXS 1NM1A 3A0HU 2PFFB 4DPUA 4KGKA 4M2YA 3BY5A 1PIEA 4C0ZA 4WU3A 5ALIA 5LJ3Y 3VMFB 1LK7A 2D9OA 3SAGA 3PIPL 3KWGA 1BQXA 1RWOB 3H59A 2O8DA 3IC1A 3P39A 3QX7A 2OKQA 2RP5A 1AYEA 4X5VA 3T9ZA 2LM4A 1XQIA 4YCXA 1HW9A 3Q23A 4HH0A 3LP1A 3L0QA 5C24B 4KLQA 4H4OB 2BDPA 4JWMA 1BNPA 2H51B 4A47A 1XC9A 3EGZA 4ZJQA 1CJUB 2ZUDA 1KC8O 2XHWA 1LW2B 3AQEA 1PO6A 2ASDA 3ZZUA 1ZQLA 3AAPA 3CMQA 1RHJB 5CP2A 4H0OA 4P6QA 2VODA 4CECA 1JJHA 3L3VA 3DXKB 3FZBA 2Y0SC 2DNLA 2JVOA 1HR0F 1SZHA 3AEVA 1X4EA 3VR1A 3DN9A 4OYMA 3THWB 3A5MC 1MWQA 1PK1B 3HFZB 2DHAA 5AK3A 4YOXA 1JLCA 3MR2A 1JXLA 3P3DA 2FZCB 1WUUA 3DLBA 4C8LA 4BDYA 2R2RA 3R6LB 4KLLA 4AL6A 3ZI4A 1RU1A 3VEZA 2XGPA 4NL9C 5AE2A 4BBYA 3V81A 3B8AX 4DR2K 2E2NA 4ZK7M 1MWKA 4JK7A 4WFXA 1D8BA 1DARA 3V9ZA 3ENAA 3K1ZA 2G1HA 1OYDA 4KO0B 2H48B 5CD4H 5ETRA 5ITHA 2L3MA 3ITHB 2V8HA 1TV6B 3HHEA 1ZQZA 3F5EA 4JI2J 4PKDB 4USAA 2DK2A 1Z2ZA 5EWFA 1TKZA 2WMMA 3MM8A 2Z1IA 3EW9A 1C2PA 2FDRA 3K0JA 1T03B 1S8OA 1RAIB 4K25A 3M3ZA 5KG0A 5DK5A 2Q97A 3V1QA 3K17A 1GMWA 3AJDA 3O9QA 4M41A 3WQTA 4UAYA 4DQSA 4UZBA 4KI4A 2AU0A 3TSPA 2JWKA 5C12A 1WSRA 3MCAB 2A1SA 4YG2A 3SSSA 3TANA 5A76A 4DV3K 1N33K 1NK0A 1IG6A 1XHXA 3T19A 4RBVA 3NLCA 2CXEA 3D6RA 1Z00B 2CWKA 4E7LA 2EC0A 8ICQA 1OS5A 1F44A 4YR2A 3PMLA 5KG7A 2AEFA 2AJQA 1T7PA 1XIQA 4O3SA 2LEBA 1X5SA 4FJ7A 2MZ1A 4KX3A 3PSIA 2HVHA 2NZTA 1SQKA 1CXUA 3VGTA 2A40A 2OPSB 2RQ4A 4H5RA 5EXWA 3JPNA 4R0JA 5J2PB 4JV5F 1QSLA 2YN4A 5KAKA 4A