1L3UA

Crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3uA01
3MR2A 4DQSA 3CFPA 4ECXA 1QQCA 1XSLA 4ID1A 1TKDA 3RR7A 4F4XA 2LYHA 1YT3A 1WSGA 4CGFA 5HP1A 4NY8A 3C23A 4ECZA 4DFMA 1IKVA 3DLBA 2G8UA 2E6LA 2XY5A 4JRPA 1ZQEA 4LH5A 2ALZA 5KG2A 4DTUA 3Q8KA 7ICRA 5CYQA 4FXDA 2UVVA 3V9WA 4NXZA 7ICIA 3L2RA 5DB8A 3PW0A 9ICBA 1C1CA 3Q8RB 1JXBA 3RB3A 1ASUA 8ICFA 1JLQA 4KHUA 1NJWA 3O4QA 4EZ9A 4MF2A 3RRGA 9ICWA 1JL1A 3PMLA 3S3NA 3SI8A 1MU2A 3K5MA 4PPXA 4KLDA 3D45A 3HYFA 4QZFA 4KB1A 1JXEA 4BWMA 1LWCA 1S0NA 3C5FA 2OPQA 4CK2A 4QWCA 1BPYA 1ZBFA 1XS9D 1MSWD 4FJIA 1ZQBA 4MEXA 1EETA 2Q0ZX 4E7JA 4E3SA 8ICGA 4LZDA 3JPSA 2PXIA 4PA1A 4Q43A 3IS9A 4HUEA 2DFFA 4B08A 3HK2A 3LZIA 5CB1A 3DRPA 3NF9A 2HNDA 4IG3A 4CEBA 4CEOA 4BGDA 1G15A 3QNOA 5C25A 5CZ1A 1BGXT 1KSPA 3SV4A 3LWMA 4Z6FA 4J2AA 1T4GA 1FXXA 7ICLA 1J5OA 1RCHA 4DTRA 1Z3EB 5DDYA 3TAQA 1XSNA 4Z4GA 5KGXA 3ISNC 3D0PA 8ICMA 4OGCA 4B9SA 3HM9A 2IS3A 4DL6A 3SQ1A 4NYFA 4FYDA 4KLMA 1RDBA 5KG3A 1RT6A 3MEEA 2FPLA 9ICFA 2PFQA 2NRWA 4YXJA 2G8VA 3KD5E 1AROP 3V9SA 2XHBA 1TKTA 1SKSA 3OJSA 4H8KA 2W8LA 3C2KA 5KFTA 4CF2A 2OA8A 2BCSA 5D3GA 1GOAA 8ICEA 2MAXA 4ECYA 2BCQA 4J2BA 5KI6A 5J0QA 3DRRA 1RILA 7ICPA 3RH6A 3H40A 4F3TA 4C8KA 4DTXA 2BE2A 3NGDA 3S3OA 1K1SA 4IFVA 4NLKA 4YN4A 2ATQA 1T7PA 2DPJA 4KO0A 4AHVA 4DU3A 4ZH4A 4I2CA 3M8RA 3M8SA 4J9SA 5KFNA 1VRUA 4R5PA 3VQQA 3SYZA 4CFBA 4O3QA 1S6PA 3UXOA 9ICNA 4CK1A 9ICCA 3CM5A 1A77A 2IMWP 1LB2B 4RPYA 1HNVA 4PGQA 1RBVA 1WLJA 3KKRA 3C2LA 2PY5A 5J0SA 3Q8SB 1VSJA 1WAFA 2ZUDA 3V7KA 1L3SA 5JS2A 3JPQA 4Q0BA 1SL1A 2HHXA 3L3UA 4CGHA 1RNHA 2W9BA 3A2FA 3E01A 4ELTA 4F2RA 3PV8A 1Q8IA 4CJPA 4KLOA 2X78A 1FK9A 1MC8A 3OSNA 1HPZA 1Z25A 8ICUA 2R7YA 4XA5A 4J2EA 2D0BA 3NAEA 4J9RA 3IRXA 2XGPA 3OHAA 1K1QA 1KFSA 3TABA 1TAQA 8ICXA 1T8EA 4KLSA 4YQWA 4O3RA 3K5OA 5DQGA 8ICVA 4QZHA 3RJFA 3RBEA 2B4JA 1ZBHA 3UQ0A 1UOCA 7ICHA 4DL2A 7ICNA 3OJUA 7ICEA 2R8JA 3H8JA 2Z1HA 4KHYA 4CGGA 1LAVA 4DLGA 4IQWA 1TK8A 1R0AA 4L8RB 1S0VA 1B9FA 2ASDA 1I39A 4FCYA 3MDAA 2DFLA 4DTMA 4GVMA 4ZTFA 4ELUA 4UAWA 2DFEA 2MUTA 3AVMA 1U47A 3DLHA 3C2MA 4HUGA 4CHOA 2C28A 1IKYA 3DOLA 4KI4A 1NK5A 4M41A 4RNOA 3JPOA 2P66A 2FLPA 1DGSA 4RQ1A 1IM4A 5DDMA 2ZJAA 2ZTDA 1TGOA 4MF8A 4DL3A 5D4BA 8ICQA 3T3FA 4FJ8A 3QIPA 4HUFA 4RQ5A 3LDAA 1TKZA 5L9XA 3SQ0A 3ZD9A 2BR0A 3RMDA 4ECVA 4DSKA 4RUAA 5CYMA 2I1QA 2C2RA 1LWFA 2JEJA 4DG1A 4TURA 5KT3A 3NF8A 2JZBA 5HMMA 3G6YA 4F4YA 1C0MA 5KG5A 4FLXA 3QEVA 1TL3A 3UPQA 8ICKA 4W5TA 2QK9A 4NCAA 4FLYA 3MABA 5K14A 1KEJA 5BOLA 5KFXA 2G8WA 4FJ5A 2KZMA 3PW7A 3RB6A 3GQCA 4J9MA 1Y97A 1J54A 1KVBA 2VA2A 4CJUA 5TZVA 1Z00A 4CJ3A 4R8UA 4KMUA 1N6QA 2VA8A 3L3VA 4TQSA 1N5YA 1BQMA 3T19A 4RQ7A 1QS4A 4JS5A 4JS4A 1ZYQA 4TQRA 2YKMA 3K57A 5KRSA 4LY7A 2FMQA 1WSHA 2C22A 4B9VA 4DL5A 4BDPA 4AHRA 4PGYA 3KLHA 2F8TA 5EWFA 4N56A 4FS1A 2BDPA 3L2WA 4FJ7A 4HVJA 4EBCA 3IAYA 3OVNA 1UA0A 1BVSA 9ICOA 1UT5A 3QNNA 1GOBA 1QSSA 1ZQTA 4I2AA 2O4IA 4KFBA 4BXOB 2W9MA 4F5RA 3LP0A 4UAYA 1ZQKA 4OKEA 2W9BB 3ISDA 4DQQA 4LH4A 2RN2A 1TK0A 2HHVA 4UB3A 2XO7A 4M2YA 2P51A 2F8SA 2O4GA 5HRNA 5HHIA 4H4MA 4AILC 1FKOA 3KLEA 3BQ2A 4F4KA 4UBCA 4OKJA 3ZDBA 1VSDA 4CJSA 4I2BA 1C1AA 1ZETA 4F91B 2BQRA 2KW4A 4E1MA 1LW0A 2R8HA 4P4OA 3TQ1A 4CGIA 3I8DA 4R63A 1F21A 4PH5A 4TUQA 3JPNA 2PFPA 1IKXA 1X1PA 4CJ4A 3TFRA 4E1NA 2PFNA 5J1EA 1QE1A 2X6NA 3CM6A 1NJYA 4Z4FA 2QKBA 3ZT3A 3ZT1A 4C8LA 3QIOA 3Q8PB 1ZQMA 1T03A 3SNNA 1ZQLA 3NH0A 3JYTA 1RTHA 4GC7A 4JWMA 3QERA 8ICLA 2X74A 4O4GA 4RQ8A 4B9TA 2IDOA 3GIMA 2MUTB 1NK7A 4KITB 4M3ZA 1NK4A 3TANA 3KTQA 1ZQWA 4IG0A 4CHPA 4FLZA 1QTMA 2QKKA 1L3UA 5DLFA 4CEQA 9ICKA 5DBAA 1IG9A 3KJVA 3VA0A 3EYZA 4I28A 4LSNA 4M3RA 3EWAA 4FBTA 3KK3A 4WE1A 3BQ1A 3NCIA 3RB4A 5J2HA 1RXWA 4DU1A 2FBXA 4O5KA 5D46A 4F50A 3PO4A 3MEGA 4C8MA 2E4LA 1JLAA 3L2UA 3M8PA 3NF6A 3OS0A 1VSLA 4FJLA 2GUIA 3ZDAA 2Z1IA 4K8ZA 2OZSA 3EPIA 1QLNA 5CR0A 2HVHA 3EZ5A 4CF0A 2FBVA 3AO3A 4YMNA 4BDYA 4GXIA 2FMSA 4UBBA 5KGWA 4CHZA 4CHNA 3QETA 4CEEA 2FLLA 4MFFA 4O5BA 1NOZA 4CE9A 3KD1E 4PUOA 1UT8A 3NH1A 1RBRA 5J2DA 4O0JA 3OYJA 1HNIA 2HW3A 4RQ4A 8ICBA 1B92A 1FKPA 3N97B 1HUOA 1N56A 5KT5A 3OYMA 4RNMA 2NRXA 3WNGA 2G8IA 4F8RA 5KG1A 4UB1A 2P5GA 4DS4A 2BPCA 4Q8FA 4M47A 5CY4A 1NKCA 5J2EA 5CP2A 2J6UA 4KKOA 2RDIA 4CJVA 4QZGA 2BQUA 2ZJ5A 3PO5A 3VQ7A 1JXLA 3H4BA 3LANA 1D8LA 4Z4EA 4RW6A 3VA3A 5J0PA 4QOZB 4ICLA 3PW4A 3PX6A 4O3PA 1ZQSA 3KKSA 1C6VA 4DTPA 1U48A 1SV5A 4ED1A 3KK2A 1L3VA 4XQ8A 4G3IA 4IRDA 4QZCA 3HSTB 1C0TA 3M9MB 1XSPA 2BCUA 2PFOA 1RBSA 4KHNA 4YMOA 2BCRA 4YVZA 1ZQHA 4IR1A 4KRFA 4JRQA 4FVMA 4B9UA 3MXJA 2ASLA 4TSXA 1ZQFA 2VG5A 5HLFA 3V81A 1S6QA 3K59A 1ASWA 3MBYA 1JKHA 2JEFA 1WSFA 4Q44A 3RH4A 4KLHA 3RH5A 2UVRA 1S1TA 5IIOA 1TAUA 4CERA 2JEIA 9ICQA 2OPPA 2KN7A 4I7FA 1RTDA 2ETJA 4KTWA 4YD1A 1SZPA 2KQ2A 4Q45A 2V4QA 5J0TA 3FDSA 1I3AA 2AGPA 1RT3A 1ZQAA 2M9NA 2AQ4A 1Z26A 1TKXA 5EWEA 1KLMA 3GIJA 4J9QA 4DO9A 1KLNA 3OGUA 2J6SA 1ASVA 3ALYA 4KLGA 3PX4A 4DL4A 4O55A 2W9AA 1CEZA 3PVXA 8ICSA 4M3TA 3AVFA 2JGUA 4QZ8A 5J0RA 2BQ3A 1NK8A 3HVTA 2ATLA 3SCXA 5J2IA 5KRTA 2KFZA 1L5UA 3ULDA 3H7IA 2B5JA 3I0RA 4F5QA 3JPPA 1COOA 5J0UA 4I2HA 5EWGA 4DU4A 8ICYA 1JMSA 1WCLA 2C2DA 1BPBA 2R8IA 1BL3A 4J9LA 4M0AA 2JLEA 4I29A 4QZAA 4IQUA 5L1IA 3H8WA 1ZQIA 2QXFA 4Q5VA 2NRTA 9ICVA 4OJRA 3OYDA 3DLEA 1D9DA 4Z4IA 3AA3A 5I42A 5HP4A 2W8KA 2BGWA 3H8SA 4ID5A 2OYQA 4R66A 5J2PA 3PX0A 3PR5B 4BDZA 1HYSA 1YTAA 4YXMA 5L1JA 4AHCA 9ICIA 3OYCA 3CQ8A 4MEYA 2H5XA 1RT5A 2GV9A 1TVAA 4AHUA 2VWKA 2PI5A 9ICEA 5HRSA 3C95A 4KHSA 2ZE2A 5J2QA 3SQ2A 4CF9A 3ZSYA 2KZZA 4CEFA 3TAEA 4AHTA 4W5QA 2YNFA 2WONA 1U45A 4K4HA 5CJ7A 1W0HA 1HUZA 4JV1A 4M42A 9ICRA 8ICOA 2G8FA 3KK1A 2YNGA 5DK5A 3QE9Y 2ZTEA 3AUOA 4EEYA 5KG4A 4EYIB 1ZQOA 2FBTA 5FRMA 5KT6A 4GLXA 5HRPA 3LDSA 5L1KA 2RDJA 4BXOA 2ZJ8A 8ICJA 4CGDA 3QZ8A 2NRZA 1K6YA 4I2QA 1RT7A 3QZ7A 4YCXA 2AU0A 3HO1A 1U04A 1VSFA 5KFGA 4ZTJA 4DEZA 1RT1A 1S9EA 8ICWA 5CHGA 3C21A 3LWLA 8ICPA 4CHYA 1ZQNA 2A1SA 8ICCA 4CJQA 3LZJA 2FLNA 3G10A 1EXQA 4IKFA 4DMNA 3V9ZA 4O5EA 1LAWA 4O3OA 4FK2A 5IIIA 1A5VA 4Z4HA 3S3MA 2DY4A 4C8OA 5FRNA 4DSLA 4Z6CA 1S76D 2IAJA 4IRKA 3BGRA 4RW9A 4O3SA 4CJEA 5HMLA 3MXIA 3AO2A 4ECTA 2ISPA 1HJRA 5KFUA 1JLBA 4R64A 1Q9XA 2VA3A 3SPYA 2BCVA 5C5JA 4MFBA 4AHSA 4KAZA 2F1JA 1XWLA 1HQEA 2FMPA 3AV9A 3U3YA 3ZT4A 1WAJA 5J0YA 5DB9A 2DFHA 1NK9A 4B8CA 3V6KA 3DLRA 4PHDA 3AO5A 1N48A 2ASJA 4I9LA 4ECUA 4ELVA 4BE0A 3ZD8A 1S0MA 3WNHA 4ECRA 3T5HA 4Z4CA 4UB2A 3SUNA 4EBEA 5KFQA 3TAGA 7ICGA 2HHSA 3MFIA 2A1RA 3VQEA 7ICMA 3P1GA 1CXQA 4KV8A 9ICSA 4NLGA 4E0DA 2NUBA 4HCCA 1X9WA 7ICSA 3OYFA 4O3NA 1JLFA 1UAXA 4FM0A 2XCPA 4HYKA 4K8XA 1ZJNA 1WCNA 3RRHA 4Z0UA 1A5WA 1IXRA 4I2DA 1X9MA 3NFAA 4KN4A 5KTQA 3OY9A 3ZDDA 3PMNA 1J53A 1PZNA 3C94A 4YNQA 3OSPA 4Y1CA 3ZCMA 4PGXA 4CJ5A 3T5LA 3VQ9A 4RUCA 4EZ6A 1XU4A 5J2AA 4M9HA 3AVIA 4MQ3A 1NOYA 4DOCA 3RJJA 4YP3A 3LPUA 3TI0A 1HYZA 1YVUA 4M3XA 1KFTA 1RYSA 2R8GA 3PNCA 3MR3A 2E6MA 1DTTA 1T05A 4QZEA 1NK0A 3V6JA 4RU9A 3DM2A 2IOCA 3HW8A 3F9KA 4B8AB 2BGGA 5J2JA 2KTQA 3ZDCA 4ZHRA 3VQBA 3MEDA 4YR2A 4O44A 4CEZA 1KDHA 3ISBA 4OVLA 4FLWA 1BPZA 1H38A 4ECWA 5KFWA 4CJTA 1JLGA 1C0UA 3HL8A 4RQ0A 3VQ5A 4YMMA 3V1OA 2P6UA 5J2FA 1QSLA 4RZRA 4PHEA 2F1HA 3T5KA 3HVRA 2HHWA 3TFSA 4RW7A 2X6SA 3C1YA 4DFPA 3M8QA 3HPGA 4DLEA 1YTUA 4ECSA 5KFVA 3CG7A 3EW9A 4JK1A 1VK0A 2B21A 1KTQA 4NM1A 1ZBLA 1NOMA 3NTUA 2BPGA 3TARA 4XRHA 3VQAA 2P6RA 4FZYA 1QSYA 2HHUA 4KLUA 4PHAA 2P5OA 2ITGA 1A76A 3DYAA 1XHXA 3PY8A 3DMJA 7ICTA 4FW1A 2DPIA 4DFJA 5DQHA 4Z6EA 4DTJA 3SZ2A 4FS2A 3JPTA 3K5LA 3TAMA 4IBNA 1TK5A 1S1XA 4HCBA 4JV0A 1XO1A 5SWMA 1EKEA 3OHBA 4KLTA 4FJJA 3GFKB 4IR9A 4M45A 4UB5A 5J2GA 4FZXC 4K4GA 4I2JA 2RF2A 3AVAA 2AJQA 2EHGA 4LSLA 4M3UA 3KLGA 3PW5A 3RBDA 3TAPA 1IKWA 4M3WA 2AQ0A 3O4NA 1CXUA 2P1JA 5KFEA 4QZ9A 2G8KA 5KFIA 4F4ZA 3M9OB 3RJIA 4KLFA 1BPDA 4GC6A 3FFIA 1W9HA 4MFCA 4CIEA 3HP9A 3V7LA 4DSJA 4LD0A 3GDXA 3QLHA 5HRRA 1LW2A 3VQPA 4M9LA 4FW2A 4N5SA 4QW9A 2OPSA 3U6FA 2HNZA 5L1LA 1CZ9A 4DQRA 1ZBIA 3GIIA 2IGIA 4DTSA 1ZQYA 4KTZA 4CECA 3DLGA 5DBBA 4EP5A 1WN7A 2YKNA 5EU7A 4QWEA 1LV5A 4CFAA 3LAKA 3HWTA 1T3NA 3AO1A 2XY6A 3I0SA 3VQCA 5J2BA 4DSFA 3OYIA 3RJGA 4ED2A 4ED3A 3RB0A 4FJGA 3QO9A 1B9DA 3C1ZA 4KLJA 1BCOA 3UXNA 3SQ4A 3RWUA 4DSEA 4E7HA 2C2EA 4NCBA 1A5XA 4CJFA 1ZQCA 3S9HA 4IQVA 1CZBA 4BE2A 5KFPA 4YFUA 4CHQA 1TL1A 3VN5A 2VG7A 4DOAA 4C8NA 1MQ2A 5IIJA 4KTQA 4O0IA 1QHTA 3MDCA 5HROA 8ICNA 4OPKA 4RT2A 2AGOA 4QZIA 1BPXA 4F5OA 1VSKA 4OLBA 1BHLA 4GXJA 1KVAA 3AVLA 2J6TA 4DSIA 2KFNA 3OYBA 4W5NA 1C7YA 3AA5X 4FM2A 4CESA 4P4MA 3SI6A 4M9JA 4CCHA 3QEXA 3QEWA 4CGJA 1RYRA 4M3YA 5D49A 4B3OA 1RXVA 4CJLA 4P4PA 1JLCA 3AA2A 5IILA 3ZDEA 1S0OA 4F2SA 1JN3A 2XC9A 3QEAZ 4G1QA 4QAGA 4J9PA 3RMAA 1SL0A 1D8YA 2V4RA 4DF4A 5JUMA 4CF1A 4KN7A 1RTJA 3O3GA 5KFYA 1S77D 1BIZA 4N41A 4YR3A 4QW8A 3OYHA 3DLKA 5KFHA 2YNHA 1Q9YA 1BCMA 3L2VA 4PWDA 5KFKA 3KHGA 4OPJA 3NDKA 4M9NA 1VSIA 3QESA 2RPIA 4ED0A 4KHWA 3SUQA 4GW6A 2ZTCA 3RMCA 2HMIA 4QWDA 3QINA 2BANA 3MR5A 4OLAA 5FROA 3U3GA 1HQUA 2W42A 3RTVA 2YHBA 3AVJA 4KLEA 3C6UA 1WSEA 2PI4A 4I2PA 3RJHA 1XHZA 5DGAA 2PYJA 3NHGA 4DTNA 4M04A 3IM1A 1ZQRA 2OPRA 5IIMA 2OZMA 4I27A 1ZQXA 1JL2A 2YV0X 3WNEA 1DOQA 5JS1A 3SV3A 3CYMA 3T5JA 1ZQUA 1ZQQA 1KVCA 5J2NA 4RT3A 2FPKA 3O3HA 5DQIA 2BKEA 3OYLA 4YR0A 2OWOA 3KIOA 1WSJA 3VQ8A 1TV9A 3KLFA 3L2QA 1WSIA 1V9PA 4RQ6A 1BIUA 3ZSRA 5J29A 4HHTA 3ZSQA 3LALA 3B0YA 1GOCA 3OYNA 5KFLA 4UB4A 4FBUA 4RNNA 9ICUA 3AO4A 3Q8MA 8ICHA 1EP4A 4Z6DA 3K2PA 1NJXA 1HRHA 3VQDA 1VSEA 4IRCA 1VSMA 1SL2A 5J0OA 4FJMA 3HJFA 4CFCA 4CIGA 5J2KA 3GV8B 4DL7A 2UVWA 2Z1GA 4W5RA 4FLUA 5KFOA 4KPYA 1UA1A 4I9QA 4J9OA 4PQUA 4F92B 3V9UA 8ICTA 4P2HA 1B22A 3AA4A 5DGBA 3OS2A 4F3OA 2LSNA 9ICPA 4IDKA 4W5OA 2IC3A 3NE6A 3HX0A 5J2MA 4FK0A 3KHRA 9ICJA 3LP3A 3HPOA 2HB5A 1ZQVA 2GWSA 4Q8EA 4FK4A 2A1JA 1JX4A 1RDAA 5KFRA 1RPLA 1DLOA 2D0AA 1ZQGA 1C1BA 4F4WA 5F9NA 4RW8A 3BJYA 1D5AA 3FYHA 3B0XA 3ISCA 1L3TA 1U9LA 1ZQDA 3NH2A 2XGQA 9ICTA 2ZUCA 5KG0A 4O5CA 4EP4A 4ECQA 1S1UA 3UXPA 1Y88A 4JWNA 4GMJB 3ASMA 3ZT0A 3MGIA 1TV6A 4TUPA 5DG7A 2F96A 1UWBA 4J2DA 1NKEA 4YFKA 3ZT2A 5J0XA 4FJNA 4QZBA 2EX3A 4KLQA 3P5JA 2IBKA 3Q8QB 1IO2A 2XCAA 1SKRA 4Y1DA 5KFMA 3WNFA 5SZTA 2ZQBA 4FLVA 4RPXA 3HP6A 3VQ4A 2NRVA 4CFDA 4R65A 4QWAA 2Y1IA 3IG1A 4BE1A 3DI6A 3SJJA 3SPZA 1KFDA 1NKBA 4MFAA 3N4MB 3V1QA 4F5PA 4XIUA 2ZD1A 5IIKA 1RBTA 3ZSWA 4N76A 3NGIA 4E7IA 2IHNA 3ORYA 2HVIA 1RBUA 8ICZA 4B9MA 4FJXA 3V72A 2XRIA 1ZQZA 3RR8A 1TFRA 4O9MA 1BISA 4QCLA 5KFCA 3V6DA 7ICFA 2I9GA 5J0WA 3MXMA 1BI4A 1HYVA 4FZZA 3V7JA 9ICAA 4FJKA 7ICOA 1JLEA 2V9WA 2HHTA 2BHNA 3LK9A 3DOKA 5CA7A 3M9NB 3IHQB 4DQPA 1RZTA 4ED7A 3AVHA 2IA6A 4CJKA 3K58A 4NLZA 9ICLA 7ICVA 4X5VA 1S5JA 2D0CA 4RPZA 4DF8A 4CK3A 4FM1A 5EOZA 3BQTA 4HTUA 8ICIA 4IQTA 5KFAA 1LWEA 3LAMA 4YG2A 1TVRA 4QWBA 3RJKA 2G8HA 3ZSOA 2GBZA 4KB0A 5KFZA 3H08A 5KT4A 3EY1A 1CLQA 2BPFA 4M9GA 1S97A 1ZQPA 3KLIA 1CUKA 1B43A 1DTQA 1S1VA 4H4OA 3ETLA 3ZSXA 4M6WA 3PUFA 2FBYA 2W9CA 3OYKA 3K5NA 2ZUBA 5KG6A 4E89A 3UIQA 1U49A 4I2FA 1XC9A 3NGZA 4EYHB 2Q3SA 3MAQA 1J9AA 3C5GA 1IH7A 5C24A 1RT4A 3ITHA 3ZSVA 5DMRA 3QEPA 3HPHA 3TAFA 4DOBA 3QEIA 2WOMA 2VG6A 4FJ9A 2A1JB 4JV2A 2WTFA 3Q8LA 3AVGA 4FJHA 2PYLA 3DRSA 3TWHA 2VWJA 2FC0A 2KZ3A 3G6VA 1MQ3A 5CZ2A 5DG9A 3AVBA 4EBDA 4NCGA 1BPEA 4N47A 4E7KA 4ED6A 3AVCA 2ISOA 4I2GA 3JPRA 5DG8A 3BQ0A 3GIKA 3RAQA 3NGYA 3HT3A 5KFBA 4CEDA 3G0ZA 3MR6A 4LZGA 3SUOA 3AU2A 4RG8A 4OGEA 3EPGA 2HNYA 4K4IA 3V1RA 5I3UA 5BOMA 3RAXA 2Y1JA 3CFRA 4DQIA 3B6PA 5DKWA 5HHHA 4F5NA 5F9LA 1S1WA 3PR4A 1RDCA 3LP1A 1S9GA 4BWJA 4DFKA 4KLLA 1SKWA 5C42A 5CWRA 3NBPA 1RTIA 5DBCA 1NK6A 4PHPA 1XI1A 1ZBUA 9ICGA 1ZJMA 4RQ2A 3VQ6A 1VSHA 4KLIA 3GV5B 5KFJA 2HHQA 2JEGA 9ICMA 3L8BA 4PY5A 4F93B 1O1WA 4XUSA 2PZSA 4DTOA 4KI6A 4RW4A 4YD2A 5T7BA 4ED8A 9ICXA 1SUQA 2XY8A 4B9LA 3OS1A 2D5RA 2RKIA 3KHHA 4JUZA 3JSMA 3NF7A 4CJRA 1HJPA 1WNSA 4OKKA 1X9SA 4E19A 5IINA 1JIHA 4FO6A 1BI4B 1KCFA 5J2CA 5HNKA 5KFSA 1VRTA 1HMVA 4KHQA 3LP2A 2FPMA 3HXMA 5BPCA 7ICQA 3OYEA 5FDLA 3P83D 1X2IA 2Z1JA 5DB6A 3RJEA 4QZDA 5KFFA 3V6HA 4UQGA 4J9NA 1ZQJA 3V4IA 2R8KA 3C6TA 4CEAA 5DB7A 3H4DA 2AGQA 4LVSA 3BDPA 3MECA 3LPTA 4KREA 3THVA 3K4GA 5HBMA 3G6XA 4NLNA 3CFOA 4NM2A 7ICJA 4BACA 4E7LA 4NYNA 3AU6A 5KFDA 3MGHA 1EXNA 4J9KA 3O3FA 1BQNA 1S9FA 4IFYA 3OYGA 2YNIA 3V9XA 4DS5A 5E41A 2VANA 3GV7B 3B6OA 4JLHA 4M6WB 4I2EA 2XY7A 3KHLA 1U4BA 2W9CB 2B6AA 2I5JA 5KT7A 2JZBB 3TR8A 7ICKA 3UQ2A 3AVNA 3E2EA 4CJWA 2F1IA 2UVUA 3F73A 3RMBA 3ZSZA 3SUPA 4B9NA 2DTUA 4FLTA 3OYAA 1EX4A 4CIFA 5DLGA 1RDDA 8ICAA 1REVA 4AH9A 2IHMA 1Z00B 3PW2A 4R8UB 8ICRA 4GXKA 7ICUA 3T1AA 3MFHA 4CF8A 4DWIA 1S10A 4RQ3A 1ITGA 4TUSA 3AVKA 1NJZA 9ICHA 1RT2A 3QEBZ 1D9FA 2YHAA 5KG7A 4I2IA 4UAZA 3K75D 1KRPA 3GILA 5KT2A
chains in the Genus database with same CATH superfamily
2EBGA 4K0KJ 4ECXA 3CDEA 4ID1A 4RQNA 3D28A 2RILA 1DAXA 1HR0J 5I3UB 2A41A 4EMDA 4CGFA 4NY8A 3MPDA 4ECZA 2V8HA 2E6LA 1X4EA 4JRPA 2ALZA 3RYLA 1XNQJ 1N36K 2P9PB 1ZH5A 4FXDA 5C10A 2UVVA 3IAS9 4NXZA 4IOBA 5DB8A 1NDLA 1ROFA 2OANA 2XSFA 1RTIB 2VFSA 1ASUA 4ZA1A 2GVZA 1JLQA 1K47A 4I1TA 2QB1A 1RCXB 1ZPVA 4K41A 3P39A 4B1WB 3DFEA 1B3TA 1W26A 5GMEA 1BE4A 3GG4A 1X6JA 1XMOJ 2LYVA 4JB8B 3H5YA 4TU8A 3HYFA 3NMRA 3CCJN 1U1RA 3I9V9 1LWCA 1S0NA 3N6LA 2WAQF 3C5FA 3L5KA 1N33K 5AKYA 1XS9D 2A2DA 1YJRA 1MSWD 4OHWA 4HH1A 3D6HB 2CQGA 2E2PA 1HHQA 4Y6IA 2DIUA 3U1LA 3JSMB 2JV3A 4ZPBA 4E7JA 4Y3CA 2HKEA 4YORA 4LZDA 4OYIA 2B8QA 4Q43A 1VRTB 1HMVB 5C2DA 3HK2A 1G4CA 1U2CA 1R8AA 3GYXB 4PL7A 1N32K 1RADB 2EK6A 3RVCA 2VJ4A 2LXUA 1G7CB 4I0WA 4IG3A 4BROA 5LL6d 4CEBA 1YQHA 5E3RA 3QNOA 5C25A 1KD1T 1KSPA 2DY1A 3UE5A 2FY1A 2WHEA 5LXRA 4J2AA 1OW5A 4AL7A 3MECB 3VEYA 4Y2MA 1FXXA 7ICLA 1GLDG 4CLKA 4YEAA 3FQKA 2FJWA 5F3XB 1GTEA 2GZOA 5DDYA 4A8SA 3TAQA 4Z4GA 4ILHA 1QAXA 8ICMA 4B9SA 2KJ5A 4FYDA 4KLMA 3NNCA 2DO4A 4OX9J 2YNIB 5D4OA 2P9GA 3KD5E 1U1OA 1RBAA 4DDFA 1TKTA 2LM4A 4QS8A 4AXIA 4CF2A 3SAHA 2CQBA 2BCSA 1OMSA 4U9RA 3TJ9A 1GOAA 8ICEA 4ECYA 2BCQA 1I94J 2EC2A 3CJTA 4LVNP 2CQCA 2CGJA 2VZ9A 4BBYA 3S3OA 2EFPA 1BD6A 4LBIA 3M1VA 2UXDJ 1Y9OA 2WCXA 4NLKA 2MQLA 4KO0A 3H5UA 2W2NP 3BYPA 2E1EA 1NSPA 4LF4K 5AZJA 1K9MO 3M8RA 1V5VA 5KFNA 3CO0P 4OI0A 2A19A 1S6PA 1IWGA 5AQVA 4X4UA 1WI8A 2ZIXA 4X65J 2NS1B 1A77A 2OSRA 2JXJA 2G1DA 4CT8A 4MO4A 3KKRA 4PGQA 2PY5A 3L7OA 2LU2A 4OHVA 4ZVRB 5J0SA 3Q8SB 5K20B 4IWVA 4NLBA 3JPQA 2IBOA 2QSWA 1SL1A 2H5EA 3R2DJ 4DUZF 4DR6J 1RNHA 3M30A 1B4FA 3E01A 3R5GA 5E0OA 4IO9Q 4RWTA 1RA6A 2ZIWB 1XQIA 1HWKA 3PV8A 4A8EA 1QAYA 2X78A 2HF3A 3BKUA 4AQYJ 1MC8A 3VCDA 3OSNA 1HPZA 5K8NA 1C0TB 1JLQB 5ADXA 1SWWA 1Z25A 4B3SF 2Y0SC 2PIIA 4J2EA 4NL9C 4X4QA 2D0BA 2YN4A 2XGPA 3OHAA 2V2ZA 3TABA 8ICXA 1T8EA 5LOQA 4O3RA 5A2QO 1RQNA 8ICVA 4DR2F 2HF4A 2VOPA 3RBEA 2WW8A 5BN8A 3MAHA 5AQWA 2F1FA 1ZBHA 1U1KA 3KUGA 1URJA 1LWCB 1P9QC 1UOCA 1KBUA 1PVPA 3MEKA 3AOAA 3CJ2A 1QVFR 3MMJA 2Z1HA 4F36A 3CIPA 1OS5A 1LAVA 4IQWA 4OJ5A 4C7YA 1OUQA 4ZVHA 1I39A 4FCYA 2OP5A 2B3TB 2Q43A 1RAFB 1FE4A 1J27A 2MUTA 4IO1A 2QM1A 5IT9U 5C25B 1J5EF 4KI4A 1S59A 1NK5A 1HNXK 4RNOA 3EVWA 1E6YB 5A76A 2MKIA 5T41A 1YG0A 2ZBPA 1DGSA 2XHCA 1IM4A 2E1MC 2L48A 3V5RA 4USVA 2VOOA 4DL3A 1FEEA 2R7UA 4M1KA 4FJ8A 4HUFA 1TKZA 3EXYA 4OPHA 3RMDA 2I1QA 2KI2A 3FRYA 3WXLA 4DG1A 2VODA 3H5XA 2MY7A 1C0MA 1TKTB 2PO4A 3D2NA 3Q8VA 3DLEB 3W9JA 8ICKA 1GTHA 5HI7A 4OJ6A 1Z6RA 2K60A 3MABA 3CUNA 4EAHD 3HSJA 2KVQE 3GDQA 1HLUA 1EJ7L 1KEJA 2HK2A 1CZAN 5BOLA 2G8WA 4FJ5A 2KZMA 2ODGA 2WF9A 3GQCA 3MM5A 2MGZA 3L3CA 4CJ3A 1WC1A 1N6QA 3M1VB 4TQSA 3T19A 4RQ7A 4KO0B 2BDUA 4JS4A 1YUWA 3A0BU 1FFGB 1WSHA 3D2SA 2IM1A 1S6PB 3CPWR 4BRKA 1S57A 4BDPA 3HX9A 3KLHA 2GQQA 2F4VK 2F8TA 1ZOTA 3KG4A 1U02A 3QSIA 5E3QA 5HMZA 2PMHA 4H0PA 3OVNA 1UA0A 1UPPA 3OFHA 1BVSA 3CGIA 4TXSA 1U26A 1QSSA 1ZQTA 4I2AA 4KFBA 2YY6A 2I6WA 3MAAA 3D0GE 2HRTA 4DI6A 1ZQKA 1OVQA 1IBMK 1NPPA 3ISDA 3ZC4A 3E01B 1TE2A 4LH4A 4M2YA 2P51A 2J8SA 2O4GA 2MMYA 4WYBA 3G71N 3OFFA 2F9JA 1JALA 3KG0A 3ZDBA 1VSDA 2GX9A 2BM1A 4WCEQ 4OYAA 4I2BA 5JLFA 5AICA 5E2QA 2P9EA 4X2BA 4E1MA 4P4OA 1M6YA 4CGIA 1NBEB 1GAOA 4ALZA 4PH5A 1IKXA 1UWAA 2IAJB 2WF5A 2PFNA 3D6JA 5J1EA 3DWLA 2OHDA 4Z4FA 4NA2A 4OZ5A 4PZOA 9RUBA 3ZT1A 4C8LA 3QIOA 2FYXA 2JWKA 1ZQMA 4ZVSB 5HVGA 2AJ0A 4C48A 4HTLA 1NLKL 4UTGA 5IT0A 1ATSA 1SQKA 1MN8A 3IBPA 4OI2A 4CE6A 1X5PA 4DPWA 2MUTB 3R6GB 2YPZA 4HR2A 1NK7A 3AN1A 4KITB 3TANA 1DKGD 4QJFB 4CHPA 1Z19A 1QQNA 1H7WA 5DLFA 4CEQA 2CQ0A 2KXFA 2E1YA 4BVOA 3C7NA 4DU7A 5DBAA 2DBBA 4KV8B 5HMXA 4NZ0A 3O6WA 3KK3A 1X31C 4C6AA 1YJ9S 1S7IA 1Y5LB 3RB4A 3GZ7A 2AZ1A 1RXWA 4DU1A 2D0OA 2H3GX 1N34K 4ATNA 5HR7A 1VCTA 1UVJA 3CCSN 1DGKN 4DR7J 2UP1A 2G4BA 3FBCA 2O8EA 2H1YA 1VHIA 3M8PA 4TVAB 3NF6A 1XR5A 4F4AA 3N4QA 1K9MT 1NI3A 3DDIA 3EPIA 3WK9A 3QQCD 3LW5C 4DV4F 3GJSB 3GR1A 5KGWA 5ALQA 4CHZA 3AJ2A 4CEEA 4C8YA 4MFFA 5CHIA 4BS2A 1Y4ZB 3MM5B 1K0VA 2MGZB 1RBRA 1N6QB 5J2DA 5F8LA 5L1MA 4O0JA 3MPYA 1HNIA 4NRTA 4RQ4A 3D68A 3HKZD 3HOTA 5AE2A 3QFPA 5KT5A 4RNMA 4IQMA 2FIUA 4GRSA 4OJLA 1A0PA 2VJ5A 1M5HA 3CNHA 4DPTA 3KFUF 4DUTA 4PPZA 3JAMY 1UZDA 3LL3A 2P5GA 1Q7YO 1J2MA 4BR2A 2C2OB 4DV2F 2JJ4D 5CY4A 1C0UB 2J6UA 5EOYA 4KKOA 4L3NA 3S01A 2RDIA 1HKAA 1D3WA 4P73A 1NGJA 2BQUA 4K2XA 3VQ7A 2BRLA 2Z8QA 3MWPA 1D8LA 2XICA 4RW6A 3FZHA 4KFBB 3VA3A 4QOZB 2WF8A 4HLBA 5A8KB 3MAAB 1U48A 1SV5A 4U8VA 4ED1A 2VBZA 1UJ6A 4DV3K 5H9FJ 4AL5A 3SBTA 3UDLA 1RBSA 2DCLA 1Z1ZA 1ZQHA 3TSQA 2FVQA 1IBKK 3AXKA 4YN3B 2VFVA 1WEXA 3CMQA 2VG5A 3O5BA 2MLYA 3V81A 3K59A 1ASWA 5JVHL 1IKXB 4DCOB 1JKHA 1WORA 3H45C 2FJBB 4Q44A 4HT5A 2HFUA 3U4LA 5IIOA 4KAIA 2RMLA 1DGJA 1GFWB 1SH2A 5K8MA 2D9OA 2XLIA 4BC9A 4KTWA 4WFBQ 5HVFA 1RGIA 1ZM9A 4YOVA 2VKRA 1TMMA 1Q82T 3FDSA 4ZVTB 1TKXA 2MKHA 4QPTA 2LLZA 1JK9B 3BKTA 4DO9A 5MLCV 3OGUA 3VETA 4HKQA 4KLGA 2EAOA 2W9AA 4KQZA 2EZZA 8ICSA 4C0HA 3AVFA 4QZ8A 2VV5A 1LKYA 2HFZA 5HQMA 2VBYA 2B9XA 4C3KA 2DHHA 2IJNA 4FF4A 1L5UA 2CZVC 3H7IA 1F2HA 3G4SS 3QJJA 1U2RA 1EO1A 2OAUA 3EGWB 3B8AX 5EWGA 2N3OA 5ETPA 4YMEA 1GLBG 1X5OA 3PIPQ 1WCLA 3C7NB 1BPBA 1R31A 4DU8A 2R8IA 2R3VA 2RT3A 3MN9A 3DDKA 2FDRA 3CXCM 2UUAF 3O8MA 2B9YA 1KQFB 2D7SA 4DUYK 2XMTA 4OMFG 2HWTA 5IT4A 1YBAA 2MDAA 1T9YA 2IM2A 2O8EB 2ZJQQ 4Z4IA 3AA3A 1NU4A 3M8PB 3HILA 3I5AA 3QU2A 1YLXA 4A8XA 2YWWA 2NR0A 2WRMA 4YXMA 5L1JA 4Y2JA 4IO9L 1WJ9A 1U1LA 3CJAA 2A10A 1PC5A 4HACA 2QYGA 3CQ8A 2H5XA 4QZVB 4UOCA 2GV9A 2KHOA 3I55S 4DHYA 2ZVIA 1H73A 3C95A 2ZE2A 4CNYA 1HNIB 1PBUA 2X1AA 3ZSYA 1VQON 4V19J 3EVMA 2R7RA 5F8MA 4K4HA 4FOEA 2CG4A 1RKJA 1N60A 2UUTA 5MAOA 1UCNA 4BLGA 2KSOA 4X4SA 1GX6A 3QAEA 2ZTEA 4EEYA 2FBTA 4KKOB 5F0WA 4GLXA 3P4IA 4YOEA 1S7HA 2VQFJ 5L1KA 3MD3A 3VAIA 3KDNA 3SCKE 1X9XA 2XMAA 1UEVA 2HZCA 4FYXB 2ZBCA 8ICJA 4CGDA 3QZ8A 2M52A 4RW6B 1K6YA 4I2QA 2GHWA 2H9ZA 4B3OB 1U04A 4OJOA 1ITPA 4ISEA 1R3NA 3ZTQA 3AGKA 4ZTJA 4DEZA 1S9EA 4GKJK 3IXQA 3C21A 3R1LA 2GOLA 4CHYA 2OLWA 2DGTA 5D8HB 2A1SA 3MI7X 2FLNA 4LF1A 4NX9A 3G10A 2DR6A 3ZO7A 2GMLA 3VF6A 4DMNA 5AR0A 1HNZK 4FK2A 1A5VA 3PCOB 1IR1A 2VG5B 2R7VA 1S76D 3V81B 3BS7A 4U7CA 1W2IA 1AZSA 2UXBF 5LM7E 3AO2A 3MR7A 4F0KA 5H2FU 1JKHB 2G2YA 1X4FA 2ISPA 1UCVA 4JI2J 2YX1A 4DV5F 4NZ7A 3ID8A 2BCVA 2M4MA 4A57A 3WK7A 4WIIA 2HVZA 2JHDA 1WKLA 1XWLA 5DM7Q 1NZ8A 3ZT4A 4OI4A 3NS6A 3UPFA 5DB9A 2K1RA 4V19S 1N48A 3D0HE 3EN9A 2AP6A 1E6VA 3NAIA 5D78A 5E33A 3PACA 5LMNF 5C12A 4NLSA 4W98A 3SBMA 7ICMA 3TKAA 1OSDA 3J81O 3A8EA 2DXEA 4NLGA 1EQMA 4E0DA 4OYXA 4ZPWR 4M94A 1X9WA 2EPIA 1FRXA 4F04B 8RUCA 1ZBTA 3OYFA 3E0FA 2Y0SF 3JSBA 1RE1B 1UPMB 2IVNA 3RRHA 3PKYA 2E8NA 1IXRA 4I2DA 2CPJA 1I6JA 1VQ5N 5KTQA 4LF8K 3OY9A 1SS6A 2DIVA 1V5IB 4QU7A 4Y2PA 4CWBA 4PGXA 5AM2A 1RBOB 4BJQA 4J5OA 4RUCA 1NOYA 2MLZA 1R27B 1FKAF 3NY0A 3IR7B 4FPBA 3H7HB 2K06A 2V69A 1KFTA 1RYSA 4FWSA 4TY9A 1EB0A 4HACB 2P9SA 4QZEA 5GIPA 5F2RA 4L6V3 3MM7B 1DXSA 2QLWA 3IWXA 3ENBA 1XMBA 2QT7A 2ZE2B 4WCEL 2AHOB 3ISZA 1R7IA 2YHXA 1AW0A 7AT1B 3QICA 3H0RB 2RUSA 3ISBA 1RQLA 2OMOA 1NM2A 2HEKA 2WSFC 2GMJA 3UCZP 5HK4A 2VPYB 1RAHB 3HL8A 1FJGF 3ZZTA 4DR1F 2NQPA 4YMMA 5IV4A 4RZRA 3IRUA 1PAUB 2F1HA 1NSQA 4FYVB 1CQNA 1MMNA 3HVRA 3TFSA 3I87A 2KJWA 5EE3A 4RW7A 1VI7A 2CPFA 2C2MB 4DFPA 2HZAA 3BPSP 3M8QA 3IMXA 1BA1A 2NXCA 1IN0A 4NLOA 1BNOA 4EGLA 3HVAA 2U1AA 4ED5A 4JK1A 2DBYA 2BJ7A 1VK0A 4BRCA 2ZBRA 3M32B 4CI6A 1S9EB 4Y2AA 2GELA 3S8SA 4OQJA 1G2EA 5ALXA 3CD6S 3VQAA 3R9PA 1RDWX 4JP8A 2Z2LA 3CW2C 2HHUA 1ICEB 2ZJPQ 1XNRJ 3CCVN 5H9EJ 5L38A 4E98A 3DMJA 4GVEA 3C29A 4FW1A 4PR6A 2RHQB 2HOEA 1YHQN 4RLEA 5DQHA 1SIZA 4DTJA 1VC5A 3NG8A 4OL8A 3JPTA 1TL4A 3DOMA 3UFCX 1AZSB 1TK5A 4H5TA 1S1XA 4DR4J 3P96A 3OQ2A 2M8DB 3GFKB 1P6TA 3W7BA 5AFUA 2KH9A 4UB5A 4FZXC 4UOHA 2XWXA 4K4GA 4KH0B 4NXNJ 2ATCB 4JKAA 2H3FA 3PW5A 1HD0A 1SB6A 2K1RB 1KOHA 4JKHA 4FN5A 3ET6B 1FFVA 2NUHA 2XZTB 1E6VB 3JQKA 3QBXA 1EWQA 2AX0A 4LRBA 2DGSA 3DXSX 3M9OB 2MZQA 1BPDA 1D0EA 4WJBA 3IKMA 1I51B 4Y0WA 4Y34A 5CD4A 2BOPA 3TUIC 4C9DA 1H3DA 4WXWA 2NZCA 3THXA 1P7DA 3W60A 4N5SA 2OXOA 2OPSA 3CCLS 1CZ9A 3GIIA 4DTSA 1ZQYA 4I6WA 1VQ7S 3E51A 1PC4A 3DLGA 4EP5A 2XTJP 5CA5A 2XS5A 1FXRA 1J6ZA 3LAKA 3MWTA 1NBWA 3AO1A 3KOOA 3SAGA 1X42A 1FO1A 2EG2A 1DTQB 4ED2A 2VYPA 4ED3A 1QJHA 1RQ0A 3O5TB 4H4OB 3RB0A 4LFCF 4C23A 1B9DA 3M2RB 1TMJA 1SC1B 2YWGA 3RWUA 2J5AA 2PKEA 4K4VA 3OTDA 3AL0B 1A5XA 2P9SB 3U26A 3S9HA 1X60A 1KC8O 3F56A 2Q6CA 4LJXA 5AM3A 5HVHA 1YJNS 2RQCA 4KTQA 2P9IB 4JN4A 2MA1A 2BUNA 1QHTA 3MDCA 4GKKK 4OHYA 1BQXA 3WKBA 3KXDA 4RT2A 1GT8A 2JGAA 1S99A 4GXJA 1KVAA 1L7MA 3OYBA 4G1IA 1C7YA 4W5NA 4H03B 4CESA 3AEVA 1BHNA 5BJRA 5IWAF 4WFBL 4CGJA 1U6BA 4RW7B 2E5SA 1RXVA 3M8QB 1HNWJ 3HOSA 4P4PA 4C3LA 2M0GB 4U96A 3ZDEA 2HG4A 1JN3A 3QEAZ 2HOIA 1V9OA 4AM6A 2KN4A 1SL0A 5M1PA 1YK9A 5JUMA 3UN2A 2H3ZA 4KN7A 1HHSA 1RTJA 1WSRA 3B8HA 1S77D 5EUHA 1S1WB 4N41A 2Z57B 4QW8A 2HS3A 3DLKA 1EX8A 1Q9YA 3DCAA 2V7ZA 2K3IA 1BCMA 1PVQA 3KHGA 4ZIWA 2JHEA 3K9JA 3QESA 4DV6F 4ED0A 4HEA9 3PIPL 4GW6A 2ZTCA 3DOMB 4QWDA 3SBGA 2MSSA 3T1HF 1Y00A 1S72S 5F1XA 5BR8F 4KLEA 4WQ4C 1IBCB 2OELA 4RW4B 1P1LA 3SCLE 4CZIA 2HQIA 2ZJQL 2LI6A 1ZQRA 2YJFA 3QWPA 2OZMA 2RKIB 3QBCA 2EH9A 3WNEA 5JS1A 1ZQQA 1ZQUA 2RE1A 5DO2A 1RDRA 4LF9J 4Q7AA 1EQYA 3O3HA 3PSIA 5C7PA 3OYLA 4YR0A 4LRCA 4UUXA 2R2TA 2I9SA 5FDLB 3H3NO 1CJKA 2LXFA 3E9LA 3THXB 4ILGB 5J29A 4HHTA 3WXIA 2B4PA 3A5LC 1VJ5A 4UZCA 1F3FA 2CGKA 2GO9A 2QARA 3Q8MA 3M1YA 1HX1A 1WYGA 2D69A 3K2PA 1HRHA 3VQDA 5EX0A 2ZNYA 4IRCA 1FD2A 2CH5A 2FHJD 4PHTX 5IT9O 4W5RA 2Z2MA 4Y00A 3W66A 1APSA 3Q83A 2A0FB 4J9OA 2N7YA 4GV9A 1BMQB 1PCAA 3AA4A 2LSNA 3WXMB 9ICPA 4W5OA 4AFFA 3FMWA 5J2MA 1KTVA 2HB5A 3KDOA 1TYQA 5LMUF 2VJVA 1RDAA 4BRFA 4IH7A 5AQYA 1REVB 1DLOA 1ZQGA 2HBYB 3TTFA 3UR0A 3BSOA 4EK2A 3WIUA 4J7CA 1YZ6A 1D5AA 1L3TA 3CE8A 3BZKA 5DM7L 2IRXA 1Q7LB 2ZUCA 4Y2IA 5KG0A 4O0NA 1SGGA 2MKJA 2DGQA 2I6XA 5LSLA 1Y88A 3DJCA 1AUSL 3P5BP 4GMJB 3ZT0A 2E2NA 4YHHF 1U2FA 2CXYA 2F96A 1UWBA 3WDOA 2NRRA 4BRDA 1NKEA 2RLTA 4QIVA 3W61A 4OO1J 1RTJB 4ZLLA 4FDFA 3H25A 1FI4A 2JC0A 2ZOGA 4QJVA 2GGPA 3RW6A 3Q8QB 4Y1DA 3UVJA 4G9BA 1R89A 4CH0S 3WNFA 1KS2A 2NSCA 3VQ4A 2PMWA 1TTHB 5AK6A 4QWAA 2Y1IA 3SJJA 3F5AA 3DI6A 4BE1A 3SPZA 1NKBA 1MU2B 4FPIA 3V1QA 4F5PA 2ZD1A 4QYZK 3TR5A 3N79A 2EAPA 4N76A 4HDGA 2JX2A 2F3JA 4UARA 5DS7A 3C14A 3VF2A 1ZQZA 3RR8A 1TFRA 4O9MA 1U8SA 7ICFA 3V6DA 5J0WA 2QWLA 5ALUA 2CRXA 3V7JA 1JLEA 3CMES 2HHTA 2BHNA 3UW1A 1SI9A 2ZIVB 4GIBA 3AVHA 4CJKA 2G1HA 3K58A 9ICLA 3CJBA 1WSVA 3W64A 3UN5A 1QTNB 4RPZA 2FVRA 3CCUN 2XZDB 4FM1A 4CW7B 3C16A 2CPIA 8ICIA 3GPAA 3RSEB 5KFAA 3VAFA 4YG2A 1TVRA 2E88A 4RUHA 2QARB 3ENOA 6FD1A 3D7EO 4FZNA 4PZNA 1L8OA 3H08A 3GE1A 3EY1A 1HBMB 2NRHA 1KC8T 2ZC4A 3KLIA 4NLWA 2DKZA 2EWHA 1IG6A 5A0LA 4M6WA 3PUFA 2POKA 2W9CA 4X64K 2RRDA 4P2SA 1SC4B 4E89A 5ALMA 3UIQA 1RABB 1U49A 2BJDA 3GJQB 3GG0A 3OR1B 3NGZA 3BF4A 2CKWA 3CXCR 4NEYA 3MAQA 5C24A 2HVDA 1N36F 1SIWB 3J80Y 2L9DA 3QRPA 1DRGA 5J2MB 3QEPA 1U7LA 2ZJPL 4DOBA 2KRRA 2XULA 2OTJS 4FWMA 1TYQB 1LOTB 2XNRA 3DEEA 4AP9A 2QXLA 2GO7A 1DLOB 3H90A 2PYLA 3CDBA 3BB5A 3W9HA 2HGLA 3TWHA 1GXLA 3G6VA 5CZ2A 3H0PA 4EBDA 1BPEA 4NWIA 5DETA 3GP9A 4N47A 3HI0A 4E7KA 2LQBA 3JPRA 5AXLA 5KQ8A 3BQ0A 3GIKA 3HT3A 1Q81T 3G0ZA 3MR6A 3ILIA 2HNYA 4K4IA 4QIWF 1WDTA 2Y1JA 3CQXA 4CQ1A 2Q3PA 1YTYA 1FWPA 4DQIA 3QUTA 2DH7A 4ILMA 3B6PA 5DKWA 1M5OC 3G25A 1UWBB 3LP1A 4Q0BB 3LVVA 2H3VA 2LP4A 3T1YK 3D54A 3NBPA 4PHPA 1RKIA 1VLBA 3BDEA 3NMAA 2GGPB 4JI4F 9ICGA 1ZJMA 4RQ2A 2O8CA 1K73O 2F8MA 2ZNZA 2HHQA 4ZPTR 1HARA 1O1WA 3DI6B 1HA1A 1RSCA 3PTWA 1K8KA 3IM9A 4KX3A 1VGYA 2JSXA 1PBAA 1TZ0A 4B3MJ 4NLUA 4NLPA 4EHTA 4A8OA 3C14B 5KPZA 1G99A 4CD1A 4KHRA 3V6DB 4FO6A 5HN0A 3K0JA 1JLEB 1HL6A 2Y1LB 5KFSA 3LP2A 1M1KO 3HXMA 1SH3A 4LT6A 3QGGA 2IOFK 1HI8A 3J7ZO 2W3RA 3NRZA 2XMVA 3P83D 1QAIA 1FTCA 2LDYA 4UB8U 3V6HA 4UQGA 3QT7A 3V4IA 3DLLQ 5HR6A 3C6TA 5DJBA 2V7YA 2QA4N 3C16B 4LF4F 3K4GA 2OEHA 3QFUA 3MM8A 1FX2A 1VC6A 3OFGA 4NM2A 1TVRB 3EM1A 4NYNA 3L7UA 4H0VB 3OL8A 1YWXA 2AIRB 1T0TV 3HJVA 1BQNA 3O3FA 3KYLA 4GV6A 5AKHA 2KK0A 3A3PB 1UVMA 2X1GA 3KLIB 1WBBA 3D1QA 2VJUA 2VANA 4M6WB 2XY7A 1U4BA 2W9CB 2B6AA 2JZBB 2OKQA 1LK5A 4ACOA 4JI5J 5GTIU 3GIRA 2YWHA 2XEXA 2EC0A 1N5SA 2F1IA 5C24B 1UJ4A 2Y1RI 3VGMA 2NV3A 3RMBA 3MD1A 3SUPA 1VQ9N 4C4WA 2DTUA 3R9KA 1EX4A 3B54A 1RDDA 1N61A 3W5XA 1S48A 3BBCA 2C1EB 2IHMA 1Z00B 4C7QA 1CVJA 2QC3A 4DV6J 3SENA 1MWKA 2RIJA 5IC4B 1BQMB 1X6IA 3E3XA 3ZX3A 5BYQA 1RT2A 1C0GA 5KG7A 5ALEA 1NPRA 4UAZA 4FXWA 4MJKA 4A61A 3K75D 2KVIA 3GILA 1T9VA 2QKQA 3MR2A 4DQSA 2WB4A 4NA1A 5AE3A 2KG1A 2HNYB 1UAWA 2NYVA 4P9SA 5AE1A 5HP1A 2W4DA 1F1BB 5AQMA 2L08A 4PKHA 4DXLA 2QWRA 1K0TA 2ZZNA 4LH5A 2QA2A 5KG2A 3LP1B 7ICRA 1QVGM 5AKXA 5F41A 2DHSA 7ICIA 3L2RA 2KKPA 4JB3A 3NBPB 2HQFA 8ICFA 4KHUA 1QHAA 1NJWA 3O4QA 2CNLB 2JWLA 1FKOB 3JS9A 2V68A 3OBIA 1ILYA 4RR5A 3R1XA 4KSEB 2FPHX 3K5MA 1BOTO 4KLDA 2DUYA 5BYSA 3D45A 2GAGC 3O6QA 1K8KB 4OLOA 3O4WA 3FBFA 4KB1A 1JXEA 2J4RA 2OPQA 2JMGA 4QWCA 1BPYA 3JB9k 4CLLA 3G96A 5AQKA 1LQ9A 4X66F 2NSBA 1PK1B 1L8LA 3WC2A 8ICGA 3KBBA 3JPSA 3W0LA 1VQKN 2G06A 1QQMA 3DXKB 1SKUB 3LDPA 2VFUA 3LZIA 3W8GA 1GMVA 2CPYA 3PLAA 1AFJA 3DRPA 3AB4B 4NLTA 2CRLA 2HNDA 1OKJA 3NVYA 1RWKB 1JJHA 2AJFE 1G15A 4ZCMA 2OM6A 3D2FB 1F0MA 1BGXT 1CJVA 4NO7A 3SK3A 3LDLA 3SV4A 1Z4OA 3V4IB 3LWMA 4Z6FA 1PJ5A 3C6TB 1QQ6A 2CJAA 4IG0B 2YHYA 5TKYA 3MM8B 4OYZA 3UD5A 1VFJA 2YKPA 5HATA 2ZBQA 3ISNC 5FLXY 1J2NA 3HM9A 3QDKA 2IS3A 4DL6A 1I1GA 3SQ1A 4BR0A 2HZVA 1BQNB 1VQYA 2FC9A 5HAOA 4KGKA 3MEEA 9ICFA 3PJ9A 2PFQA 3QSYB 3K1RB 2IFXA 4YXJA 1P90A 2XHBA 3IR6B 4EHUA 2B6AB 1SKSA 4YHHJ 3HLUA 2CN1A 5KFTA 2OA8A 2KKHA 5KI6A 4LF6F 1RILA 2XI9A 3SQIA 3RH6A 4DTXA 3I33A 2RNEA 4LFBJ 3CC4N 2F4FA 4CH1A 1NGBA 5BPMA 4IFVA 1S49A 2DPJA 3I28A 1C0FA 2X51A 4KX5A 2IOFA 2RU3A 3VQQA 2C2ZB 4YY3K 1CQMA 2K7JA 2HPUA 3OVAA 9ICNA 9ICCA 2HGNA 2IMWP 1LB2B 4OZJA 4CTAB 2YB4A 1TUGB 1Q16B 3NS7B 1XMQK 2E5LK 3NGSA 1VSJA 1K73T 1EWRA 1WHYA 4CIOA 1L3SA 5HP1B 1BG3A 2KHCA 5IFMA 2F7VA 3EX7B 2HHXA 1DQ9A 5AIAA 2HHPA 4WFYA 3CJ7A 2W9BA 3CJ0A 3A2FA 5E3CA 1Y10A 2PD1A 4IC9A 3IC1A 3U7JA 5AK4A 1Q8IA 1TR0A 2V34A 4MK8A 4CJPA 4DV1K 4U7UK 1Q1KA 5FPDA 2FJ6A 2R7YA 4FWQA 1D09B 4XA5A 1NGGA 3TW0A 1E4GT 3I5BA 3IRXA 2VICA 4FKYA 2YX4A 3PYDA 5CAAA 4KLSA 2HHHK 2HSZA 2AZ3A 3CJ8A 2VASA 2DD8S 3RJFA 4TLRA 2MZRA 1S6QB 2UUCF 1BUXA 2OPQB 7ICHA 4O5FA 2RU9A 3RW7A 2LA6A 5HMWA 5IQQA 4Q2MA 2G0JA 2KICA 2R8JA 3SQGA 4J03A 2GC8A 1SXLA 4KHYA 2QIFA 4EFHA 3QRQA 4DLGA 2K4PA 1TK8A 4F02A 3QT5A 2ASDA 4KC5A 4OYOA 4JI1K 1RCOB 3GYGA 2OO4A 4DTMA 1N36J 2KJ8A 4Y2CA 2MKSA 1NMDA 4DR5K 5AQHA 4ZKAA 1Q46A 2HBLA 2Q79A 2PMZC 2DFEA 5D6GA 1U47A 3M8ZA 3CJ4A 5F3ZA 3UDCA 2JLFA 4DN9A 2X3GA 2V8GA 3JPOA 4PRFA 4RQ1A 5DDMA 1N88A 1TGOA 1NJIO 4ZLPA 1XN9A 2PN6A 2EBEA 1N5WA 2E29A 1N33J 4HDHA 3ZD9A 3CCWA 3OR2A 5CYMA 1KAZA 2JEJA 3MEEB 3G71S 4TURA 4LBHA 4USMA 4MLEA 4KGMA 3KHYA 2RJZA 1TL3A 2DR5A 4LRAA 3JSRA 4W5TA 2QK9A 4NCAA 2I5HA 4OYPA 3N28A 1F60B 3AT1B 3C8YA 5KFXA 4EO8A 1N32J 3PW7A 1FCAA 3FCHA 4J9MA 1Y97A 2G08A 1WHVA 3K0SA 3R27A 4ZVUB 4UW2A 4YDUC 1JJCB 2BABA 4IFVB 3L3VA 4KH6A 1W7WA 1N5YA 1X4AA 2Y9HA 1WNEA 1M5KC 3QWUA 1ZYQA 4CYUB 2DGWA 4TQRA 1AYEA 2W43A 2YKMA 5B09A 1RJJA 2HDOA 2YKAA 5AM0A 2HURA 2C22A 2MPUA 2QWNA 2WVEA 1U09A 2BDPA 3P45B 3SD7A 4FJ7A 3PIOQ 2LPEA 3E8OA 2YNGB 4HTJA 1UT5A 1LEOA 3QNNA 2O4IA 1FESA 3WK4A 4BXOB 1ZTTA 4DV7K 1CSJA 2JH1A 4UAYA 4B1UB 3EE9A 2MQQA 2W9BB 4DQQA 5E7OB 2F8SA 5HHIA 3MMBA 4H4MA 3FGUA 2QWQA 3BQ2A 4UBCA 5FP0A 2ROGA 5HMYA 1NDKA 3W9IA 1FW6A 4CJSA 5L8RC 3IRXB 1ZETA 3DLLL 4LF4J 3CCSS 4F91B 2VQEK 3I8DA 4Z37A 4JI8F 1F21A 2G13A 1FRHA 2CQPA 2ALYB 4RW9B 2KT2A 3EXCX 5KOXA 2X6NA 2GX8A 2W4PA 5K8PA 2B6GA 2QKBA 4DUYF 3ZT3A 3OTOK 3LGHA 2LKYA 1KVKA 3SQGB 1T03A 3TSUA 3R8YA 5D15A 1F9HA 3QJLA 4ANDA 3E9OA 3DXMA 1RTHA 3HHLB 3W3SA 2LFVA 1EZZB 4C3MA 4O4GA 1GH8A 4RQ8A 2IDOA 2DXDA 2ZITA 1HI0P 2ADCA 2UXDK 3W5YA 4DPUA 4YB5A 2AKWB 2KV2A 2UUBF 2BM0A 4FLZA 4A4JA 4M63A 5AI5A 4A8YA 3BN4A 3ENQA 1L3UA 2KO1A 3Q2TC 1YGYA 1V3SA 9ICKA 4CLWA 5CE3A 1IG9A 2ZM6K 1CC7A 3KJVA 2K3KA 3EYZA 4USHA 1UTAA 3EGNA 1F5CA 3OV7A 5A8RA 3EWAA 4FBTA 5GAEU 4WE1A 2AH5A 1N63A 3D2EA 3NCIA 2G0AA 3AXMA 4USTA 3OR2B 2DQNB 5CYMB 2FBXA 1F6TA 2VU5A 2HBQB 3QGIA 3CTRA 3PO4A 1NGEA 3MEGA 2E4LA 4B1YB 5ALVA 3L2UA 5JJBA 4BREA 4DJBA 4NMLA 1VSLA 5EX5A 2FGCA 4FJLA 2GUIA 3ZDAA 2Z1IA 3OD2A 3GU0A 2OZSA 1QLNA 5CR0A 1KHVA 4K25A 1NDCA 3ZYYX 1WC6A 5ALIA 4GKJF 4GXIA 2I7PA 2V8VA 2J0SD 3QETA 3I4PA 1FX4A 1H0HB 2FLLA 1VRQC 4PUOA 2FF3B 4PYDA 4H0XB 4WIQA 3OYJA 5FJ4A 1HNXJ 2FE9A 1N5YB 1UQVA 1HNZF 1P8GA 1B92A 2O01C 4MKVA 2P8IA 3OYMA 1NRKA 2JNJA 3TA1A 2NRXA 2YKMB 3M5RA 2DNKA 2A3JA 5ALDA 4UB1A 3DC2A 5L39A 5TKWA 4DS4A 3OXLA 4DZDA 4M47A 1I5OB 4PEOA 5CP2A 4B3RK 4CJVA 1NZPA 3RBZA 5FPEA 4Z7CA 2PEHA 1QD1A 3PO5A 3OXFA 3H4BA 3LANA 2O6KA 4LF7F 5IM0B 2QLFB 4HL9A 5J0PA 4ICLA 3NASA 4RU2A 3KKSA 1C6VA 3N7PD 1PYSB 1U1PA 3GU3A 3BO3A 2A18A 4JYAF 3PEHA 4ZVEA 2PFOA 2AMCB 3MMBB 4YMOA 4H4MB 2MU2A 5B0BA 3QUBA 4KRFA 4P72A 4IH6A 1XR7A 3T6JA 1PAEX 1GMWA 2GH1A 1Q53A 2JVRA 4ZPDA 4LC9B 1JNZB 2ASLA 1ZQFA 3CD5A 3N5FA 5HLFA 1YVNA 4PABA 1CJUB 2ZUGA 3EDRB 4LSZB 5AKGA 3PZPA 4OI6A 4EO6A 4B3TK 2H5IB 3TAMB 2UVRA 1S1TA 1T3VA 1R6VA 2M3DA 4CERA 1O8BA 1FT8A 2DB1A 2ETJA 4LF8F 4YD1A 1UFWA 4E1JA 4N77A 3Q23A 2V4QA 1T03B 3NXZA 1RT3A 1ZQAA 4K0KF 1LNQA 2E9ZA 2M9NA 2HK3A 2VFTA 1RTHB 1VQOS 1VQ6N 3GE9A 1IBMJ 1KLMA 4BC2A 3GIJA 4J9QA 4MYTA 1NJIT 3JSYA 1ASVA 2HSEB 1HR0F 1C4AA 4HHUA 1FNXH 4O4GB 3PVXA 4AYBC 3OVBA 4IO8A 2JGUA 2QWMA 3NCRA 5J0RA 3R5JB 1FJCA 3HVTA 1XNQF 1KVIA 4FO0A 3SCXA 1GLFO 1NWKA 3P49B 4RUBA 3FFIB 2B5JA 3CRXA 2WB1F 1COOA 3SEOA 4Q2LA 3K8WA 4MKYA 4DU4A 3DNCA 4V1Ak 3AY0A 2C2DA 2EVZA 2F65A 1O0PA 1BL3A 2J0WA 3KJVB 3I32A 1ESVA 2DNPA 2JLEA 3A5NC 5ELZA 3VGVA 1XMOF 3D2EB 1ED1A 2K8BB 4IQUA 2DNZA 2J0XA 3MMAA 3H8WA 1WWUA 2NRTA 4OJRA 5BXIA 3HZEA 1OQ6A 3NVVA 1D9DA 3MEGB 4ILRA 3U1NA 3MOJB 2W8KA 1Q4RA 2BGWA 1S12A 3H8SA 3PX0A 2P9KA 1GLCG 4G1PA 5KL1B 3MUVP 1Z1BA 4K43A 3OYCA 3FC9A 2P5VA 3I6PA 2W54A 1RT5A 3CDAA 1TVAA 4AHUA 4NWBA 1M1GA 9ICEA 4KHSA 3P31A 3HT0A 4XTTA 3SQ2A 1RK8A 2Z56B 5AKEA 2XHWA 1FEHA 3WX4A 1TFWA 3D4JA 1WD6A 2HIYA 4AHTA 3TAEA 2XMMA 1K8AT 2KKVA 5GAEI 1JCFA 4US9A 3QU5A 4PWUA 3QE9Y 1ZQOA 3W2WB 1N34J 5HRPA 4C4TA 5ALHA 1WTBA 1UVKA 1YX2A 4NOHA 3VQTA 3F53A 4QIEA 2RUGA 3QZ7A 4YCXA 2AU0A 3HO1A 4B6JA 4ICLB 4OX9F 3PDNA 1VSFA 2HOFA 5F8HA 5CHGA 3BY5A 3LWLA 1KXPA 3OPKA 4WBFA 5KAIU 8ICCA 4CJQA 3LZJA 5IV3A 1UZHA 1VC0A 3R97A 2R7QA 3V9ZA 1OO0B 4O5EA 5RUBA 4G6VB 4UY8O 2GIQA 1I94F 4O3OA 1VQ5S 5I3PA 3ILOA 4CZKA 2FDNA 3QT8A 4Z4HA 4C8OA 1NGIA 3Q0AA 2FLOA 4O3SA 4CJEA 1SJ1A 2WSEC 2LA4A 2PFUA 5KFUA 1SZHA 1CPZA 2VA3A 3SPYA 4NZ6A 3O1BA 2LVWA 2BANB 3PFEA 1RYUA 4MFBA 2F1JA 1OYEA 4EX6A 4ES1A 3FR0A 1HQUB 3JS6A 2G2ZA 4X65F 3U3YA 1HWIA 2W3SA 1FXDA 4BR4A 3NL0A 4ZJOA 3I4HX 5F3TA 3AHPA 4Y2TA 4QQBA 5J0YA 4NL9A 1RT3B 2F8LA 1WAJA 4KPCA 3V6KA 1OY9A 2W2QP 3POTA 1Q78A 2DH8A 3AO5A 3K1ZA 1KLMB 4HH0A 1U1NA 4ECUA 4ELVA 2AV5A 2KHVA 3J8AA 3EE8A 1KKXA 2A2CA 4UB2A 4F3MA 3HVTB 5AKKA 3TAGA 7ICGA 1W7AA 2CIMA 2B5JB 2O66A 3O2IA 3KLFB 1SC3B 3I82A 3M8WA 2NUBA 2W41A 4N8NA 3A13A 2XYPB 3EO3A 4HYKA 3DKDA 4K8XA 1F44A 4NLRA 1WCNA 1RWMB 4Z0UA 1T9UA 1A5WA 2CZ9A 2QV6A 3NFAA 3PIOL 2ZBIA 4OV1A 5ALPA 2RAQA 3J7Z5 1EARA 2E9RX 3CMAN 3ZCMA 3NEKA 4CJ5A 2WW4A 3CCEN 3H6EA 4KBOA 3VQ9A 2DXFA 5A0YA 3CCVS 5E3AA 2NLXA 3EWGA 4DOCA 3LPUA 3TI0A 2P9KB 3WQPA 4YOUA 1YHQS 3FLCO 4M3XA 2P9NB 2R8GA 1ZAXA 3PNCA 2JFDA 2IHR1 1DTTA 1T05A 3BN7A 1NK0A 4DV0K 2ZH7A 3DM2A 2IOCA 3HW8A 2HIQA 1GK8A 2OHFA 1RZMA 3ZDCA 4ZHRA 5CYJA 3VQBA 3MEDA 4YR2A 5GMDA 4G9ZA 1KDHA 3FEYB 3T9ZA 2PMZF 4FLWA 1ZD3A 4IKAA 5G5GA 5D0HA 1BWFO 5AKIA 1JLGA 5T7LA 2WBRA 3K89A 3MMCA 3ILLA 1C1BB 3SDEA 1Q8LA 1EHWA 4MIAA 1QSLA 1WC5A 3ENWA 4DUYJ 2KIWA 2MHNA 4CO1A 2BZFA 3NVMA 5ADXH 2CVIA 3HPGA 4OX7A 2AYGA 4NRUA 2EFNA 3EW9A 4PL8A 3L7PA 4CRJA 3NRBA 1S1UB 3IRWP 4DCPB 1LKZA 4C0ZA 1DQAA 1ZBLA 5LJ5Y 2BPGA 2N4CA 3HM8A 3TARA 2W04A 2P6RA 3R2CJ 1QSYA 4A8QA 2UUBJ 1TUYA 2QEXN 2ITGA 3DYAA 4ZCIA 2A1AA 4OYBA 2DPIA 5GAEP 5HSPA 4Z6EA 2DR7A 4X4RA 4B9QA 2YQ1A 3K5LA 2DNRA 1VYAA 1FRIA 4HCBA 2COLA 1XO1A 1EKEA 3UMGA 3OHBA 4K2JA 4MFBB 2BH1A 2DK2A 4HT7A 1F9FA 4M45A 5J2GA 2RF2A 2AJQA 2VCPA 3BEGB 4LSLA 4DUZK 3RBDA 1IKWA 2WF6A 2D3OR 3KMSA 3O4NA 1CXUA 4GKJJ 4P74A 5KFEA 3F44A 2VBXA 4P71A 4B3SK 2QFJA 5FPMA 3FAHA 3RJIA 2EZYA 3DOKB 1W9HA 2FXUA 4MFCA 3TVZA 1HNZJ 2FJDB 3SMZA 1KR4A 4CD3A 4DR2K 4DSJA 1NDPA 2FVSA 4LD0A 3K7RA 2CDRB 3QLHA 5AXNA 1LW2A 4F67A 2O8DA 4QW9A 4DPYA 2QWPA 2KNJA 2IGIA 1VQPN 1HW8A 4KTZA 2RDDA 3A1YG 3FVYA 4PJ0U 4CFAA 1CC8A 2XY6A 2B0CA 3BREA 1MW7A 3I0SA 4NYOA 2E5GA 3VQCA 3KUHA 1JXVA 3OYIA 1YZ7A 4FZMA 2R7XA 4FJGA 3QO9A 1BCOA 4JYAJ 3SQ4A 3VEWA 2HLTA 4A47A 4NCBA 1J5EK 4CJFA 3Q2SC 1DTTB 4ZVOB 1T05B 1WEZA 3FM9A 4I68A 2B7BB 2ZWPA 3ZX0A 3DM2B 4OYWA 2IM0A 2F44A 3AOCA 1Q8KA 1TL1A 2VG7A 4DOAA 4ZHRB 2D1KA 4C8NA 1MQ2A 3MEDB 4O0IA 4UW9A 5HROA 2HQDA 4U7BA 2XI2A 2PBDA 4F5OA 2MZTA 2GFFA 3BSCA 2J6TA 1FTRA 4MTPA 3THWA 3MM9B 3MC1A 3AA5X 2MQOA 4LF8J 3VAJA 2V67A 3QEWA 4GY2B 3LYSA 4OHXA 1RYRA 4UQTA 3HRDD 2YB1A 2EDUA 3U9ZA 4CRXA 1S0OA 3G86A 1M5PC 2CJQA 4G1QA 3FZ2A 4DR7F 3MTKA 4F0MA 2KU7A 4ID8A 2VB6A 1D8YA 3BBFA 2V4RA 2LEPA 5FD1A 2ZDOA 3H20A 5AZIA 4DF4A 2DEIA 2ILZA 4ZIVA 2DRBA 1BIZA 2D3UA 4BRHA 4WFNQ 1YAGA 4MKAA 1X8DA 5C42B 1RWVB 2YNHA 3MN7A 4P52A 4M9NA 1NNDA 3HFVA 2RPIA 3KKAC 3RMCA 3AD7C 3QINA 3MR5A 3K8VA 5GAGU 2D8CA 4PQAA 4KJIA 3AVJA 4X4PA 2YKOA 4JKFA 5ITHA 3IFEA 1WSEA 3RJHA 4PG8A 3AM9A 1WC4A 1ATRA 1TUVA 1T11A 5AM4A 5AQUA 3NHGA 1VR6A 2RF2B 2M2BA 3ZTPA 5B0DA 4LRDA 4LSLB 5IIMA 4BQLA 4I27A 2G0CA 4D3GA 1QAJA 4IJAA 1NMNA 4A59A 5AI4A 1KVCA 2DPNA 1TL7A 4Y28C 3TJ8A 4O3MA 1ZRMA 2V2VA 3EZOA 3N7RC 4CI0B 2BKEA 2DHAA 2QW9A 2JFKA 1RHMB 1UJ5A 1EKSA 1TV9A 4L76A 4XAKA 2RRBA 2QLBB 3E9PA 4LBPA 1FDDA 1PILA 3AJ1A 3VEOA 1LW2B 4Y65A 3B0YA 3GONA 4RBVA 4UB4A 1B0PA 1VJQA 2O8DB 3FCVA 2C3OA 1GLJO 4H5WA 3AO4A 3QJPA 3SMPA 4WYLA 1JROA 1Y3JA 2EKNA 4PG6A 2OIHA 2BBEA 4FVUA 5JICA 4Z6DA 5ETTA 1FJEB 1HUXA 1VSEA 3F2KA 2B43A 1HPMA 2G0IA 3HJFA 4CIGA 4DL7A 3HKZC 3PRDA 1UETA 5KL8B 3JXOA 1HWLA 1Y7PA 1RFQA 3QO9B 5DM6Q 3VC8A 1B22A 1PYOB 2W2MP 5DGBA 3OS2A 2GQ2A 2XBPA 4P2FA 2Z58B 2BXJA 4WZQA 3HX0A 2BJ3A 3KHRA 1X5TA 2F8EX 3MX2A 9ICJA 4ZP8A 3NCPA 3NOCA 4H4KC 1TL1B 1YJWN 1SJ4P 4IFEA 2VG7B 2F77X 4KMOB 4AYBF 5HROB 3K17A 3KWIA 4J90A 2D0AA 3WK8A 4F4WA 3B4DA 3ZZ0A 5F9NA 3C46A 4C8ZA 4W4MA 4M5KA 4UB6U 1SBRA 3QB0A 4QS7A 3RRKA 5F0XA 3THWB 3L4PA 4RW8A 3VAKA 4CM2A 1PG5B 3FYHA 3B0XA 3QYYA 2R7TA 3HSCA 4TU7A 5DDOC 1ZQDA 4AT1B 1LOUA 3UKRA 4O5CA 3LOUA 3TO8A 2J7UA 3UXPA 2OH2A 4I6MA 4DV4K 4JI0F 2B56A 1AB8A 3CCUS 1TUWA 4G1QB 5EE0A 4TUPA 3O9RA 3PRBA 3FRZA 4OYMA 3FSXA 3BO2A 2IM3A 4LR8A 5AZIB 3DRYA 1T44A 3ZT2A 3FKBA 5KQDA 2QG9B 4KLQA 3CD7A 1U25A 4A62A 4HHJA 3OW2M 3R7BB 4JMUA 3P5JA 2IVOA 4BUGA 4BRLA 2YNHB 3TQEA 3ZZOA 1MA9B 2YX6A 4GKKJ 2GVZB 1VJWA 2YPYA 3PHTA 2ITMA 4FLVA 3JXUA 1HBNA 4DV2K 1FDNA 2QLJB 3X3UA 1M5SA 3MM6A 2NRVA 1PSDA 2FJXA 4JK8A 3IG1A 3WQUA 1KFDA 3M05A 4H0TB 2F9TA 5IIKA 1RBTA 2W2OP 3ZSWA 1OWXA 3QU9A 1OH8A 1KL9A 2IHNA 3ORYA 2ZC3A 4F71A 2HVIA 8ICZA 2GW8A 2KHQA 4DKWA 3I8BA 4HWIA 4K4SA 3LGNA 3IM8A 1W97L 4FXVA 4QCLA 2K4IA 5KFCA 2I9GA 1PKUA 2VQFF 4F9OA 1BI4A 1HYVA 5J1PA 1S3XA 4CNQA 2R9LA 3LK9A 2VGNA 5CA7A 3M9NB 3IHQB 1TL7B 3JAMU 1RZTA 2IA6A 4CLZA 4NLZA 5BPLA 1GEHA 4WXOA 3TZZA 1S5JA 1RUSA 2CQ4A 4CK3A 4IG3B 2J0QD 3CETA 2W6LA 5GAGI 1L6NA 4IQTA 3PFOA 5GAHU 1LWEA 2N3LA 1OYDA 1Q82O 4FYWB 2I2YA 4U7UD 2XLJA 5AQGA 4ISFA 5AQQA 3VGLA 2G8HA 3ZSOA 3GSDA 3NGTA 4KB0A 2A3VA 5KT4A 2FSNA 1CLQA 1SCJB 4CZEA 4F7VA 3IWLA 4M9GA 2ZUAA 2A5XA 4JI2F 2DO0A 2FHJA 5DDQC 2FBYA 1FRJA 4HTIA 3K5NA 1J97A 3U9DA 4GMKA 1XC9A 2FHMA 3QPIA 5IC6B 3T79A 1PO6A 2H3EB 4I69A 4J91A 1J9AA 3C5GA 1IH7A 4BRAA 1BDGA 4UF4A 2HFNA 3VENA 2L9NA 3ITHA 4OZLA 3P8BB 2XVTA 3HPHA 4I64A 2OFGX 1B0XA 2D4WA 2XMUA 3CPEA 2LQ5A 2RS8A 3Q8LA 2VPXB 1R8CA 3M7DA 3ZTRA 4OZ0A 2UUAK 3DRSA 1SAZA 5AZJB 1U1QA 3THYA 2BV3A 4QS9A 2VWJA 2FC0A 1MQ3A 1ZA1B 4BR7A 1N5VA 2SXLA 1Z4UA 3FZBA 5JTIA 1RAAB 1J2VA 4ED6A 2ZIXB 3ENVA 3EZWA 1TU0B 3NGYA 3IFRA 1NGFA 5A2QU 2H5JB 3UI3A 4RG8A 1ZM4A 4OGEA 3UKRB 3EPGA 4ANCA 3SSRA 4FWOA 5BOMA 1OQ3A 4I6MB 3CFRA 4WQ5C 1DEJA 1WF0A 2QA4S 3IDHA 4FNHA 1OY6A 3MPVA 3PR4A 2G9OA 1RDCA 1S9GA 4CZMA 4H0OA 3M30B 4OX6A 5DBCA 1HBUA 4K4YA 3IG5A 2WVFA 4JKCA 1RLDA 3Q24A 1A6LA 3VQ6A 1HPZB 1T9WA 4KLIA 2E1ZA 4JK9A 5M2PA 5KFJA 3KZIU 1IV0A 5G4DA 4FNIA 3L8BA 2WB1D 2MZSA 1HBNB 1UL3A 4XUSA 3CIZA 3MM6B 1NZAA 3GZFA 3SSSA 4KI6A 2HOQA 1IBLF 4WK1A 4PXDA 3LPYA 2DYAA 4OJGA 5T7BA 4ED8A 1SUQA 3W8PA 2ZH2A 1VQ9S 3OS1A 2NPIA 3THTA 2D5RA 5AI9A 2E1AA 5ALLA 1WTFA 2O1PA 3IUCA 4M7XA 5EVZA 5M1OA 3KHHA 4UAUA 3CDUA 3NF7A 3CD0A 3C3LA 3DRXA 3C0BA 4E19A 4CJRA 3BYRA 5IINA 2U2FA 1JIHA 1BI4B 2E8AA 2IY5B 2CFXA 5HNKA 3A8KA 4KHQA 3BGOP 2FPMA 3B6BA 3U8XA 3NKYA 5CCLA 3HKWA 2EKYA 2HRUA 4GVBA 3BSNA 1TFYA 1A7GE 2Z1JA 3KLVA 3RG6A 3RJEA 2QJ3A 3WEEA 5KFFA 2B4OA 3H2UB 3N4PA 3WU2U 2UXBK 4CEAA 4RX6A 2AGQA 4LVSA 5JRTA 1XNRF 2KJ9A 4DV5K 1FDBA 5HBMA 3G6XA 4YY3F 1LWEB 4NLNA 4QYZJ 2IOHA 3AU6A 4YDDB 5AXKA 3VOVA 3MGHA 1M90T 2ACMA 1QUPA 4DR4F 4IEIA 4IFYA 3OYGA 1TKZB 4P2XA 1RGVA 3HD2A 3B6OA 5EGYA 2I5JA 4DG1B 5KT7A 4DQ8A 5DRKA 3AVNA 4WP8A 2PEBA 1BA0A 1H74A 5AKJA 5JLHA 4NXNF 1BU6O 3MPWA 2V51B 5LMNK 3F73A 1DBDA 1FFSB 2VFRA 3ITHB 3NP5A 4ZP6A 2W55A 4DV1F 1KVJA 4WFNL 2F40A 2WAQC 5GAGP 2KG0A 2GA7A 3PW2A 3R7NB 1Q79A 1YDLA 3K9KA 7ICUA 3T1AA 1WWVA 4DWIA 1YIJN 4DX8H 3AVKA 3HULA 3DRSB 2A6OA 1NJZA 9ICHA 1D9FA 2ERRA 1VQKS 3PKMA 2MTLA 3THYB 4H5NA 1YBTA 2ZWHA 4CBXA 2BEFA 4NB4A 3IDWA 3IV6A 1OH6A 2IYGA 2LYAA 3JTOA 5KT2A 2NZTA 3KLHB 4DR3K 5HANA 3CEDA 4A2AA 3WK5A 3RR7A 2ZOMA 2JL9A 4X64J 1YT3A 5AK5A 4XH5A 2CQDA 2XYHB 2LECA 5AQFA 3C23A 4BGBA 1IQZA 4DFMA 3D1HA 1IKVA 3DLBA 1MWZA 2QWOA 4RBTA 2XY5A 1ZQEA 3RZAA 2VBWA 1GLEG 4H0YB 4DTUA 5LXYA 2KKZA 4URGA 3V9WA 3SIPB 2G07A 1C1CA 3PW0A 2MZJA 1SB3C 1JXBA 1HBUB 1LK7A 3KFWX 1YSJA 3A4TA 1O08A 5AFUH 1WOQA 4MF2A 2F8HA 3RRGA 3FSIA 4A8FA 1JL1A 2W2PP 3F2BA 3S3NA 1FJGK 3EVOA 4DR1K 1NHUA 2NREA 1NHVA 2V5HG 5D4PA 3TUZC 4KGXB 3NNHA 4CF3A 1RACB 5AQRA 3FZKA 4BWMA 1AXQA 4CK2A 1ZBSA 1VQNN 1ZBFA 3BH6B 5A8WA 3WZ0A 1ZQBA 2RRAA 2JH7A 4R25A 5J1EB 5CD4H 4MEXA 4PL2A 1DHMA 1EETA 3CC4S 3S7RA 4BR5A 4BX9C 4UY85 3R6LB 1O13A 4M95A 1WHXA 3S41A 2PXIA 5DM6L 1RDFA 1FERA 4PA1A 1HNWF 4IDHA 3ZETA 3T1YJ 2DFFA 5G5HA 4B08A 3FJ2A 1HIYA 2G2OA 4GVBB 1Q5VA 3TADC 3MZIA 1K5OA 2ROEA 3AQOA 4BGDA 4WQ4A 5CZ1A 3MF5A 5A2QY 3CERA 1L7NA 1ZD2P 2X1BA 1SJFA 1QQ5A 3CF5Q 4ZLNA 1J5OA 1RCHA 4OZ3A 5HBMB 3AQPA 4DTRA 2YMMA 3G87A 1XSNA 2IDEA 3LVWA 2LCWA 3TX8A 1RDBA 4KHPK 1S22A 1PK3A 2O8BA 1RT6A 3KK3B 4PXCA 2ZKUA 3F2DA 1FFWB 2G8VA 4JI0J 3ALRA 3AJDA 2DGVA 2I5JB 3CJQA 3VV2B 3M1FA 3VQSA 1YJUA 3MX5A 5CZVA 4O8KA 3I31A 2KYZA 4GV3A 5D3GA 9ATCB 2MAXA 2ASYA 3DRRA 2EFVA 3H40A 2YX7A 4C8KA 3CC7N 2BE2A 3NGDA 3QGHA 2DGZA 1U2VA 4LF9F 4YN4A 2UXCF 1FRLA 1T7PA 1YRUA 4HHHA 4ZH4A 3NVWA 3M8SA 3NNAA 1VRUA 4R5PA 3KOAA 2VQEF 1ZA2B 2CQIA 2FGOA 4LFAF 4CFBA 1V4SA 5GVQA 2OTLN 3UXOA 4CLFA 4CK1A 2QYCA 3CM5A 3QU7A 2OJ3A 3C2PA 1YF5L 1WLJA 4QIFA 3C2LA 4CBWA 3UB5A 2JOQA 2XYGB 2UZAA 1IR0A 2XS2A 2EK1A 1UFLA 3OL7A 4LFCK 1SH0A 1WAFA 2BX6A 2ZUDA 3V7KA 5JS2A 3WQTA 2JVOA 1IKVB 3F2CA 1VQMN 1WF1A 2KVCA 3L3UA 3ENHA 4ER8A 3MK6A 2KXNB 4CF5A 4F2RA 1SV5B 2LEBA 4NE9C 1C1CB 5GAHP 4JKBA 3OTQA 1MMDA 1S5LU 8ICUA 5E84A 1WKKA 4J9RA 4K59A 2G09A 2JZ5A 4XO0A 2KOBA 1TAQA 4YQWA 1RAJA 2GJFA 3K5OA 3BPDA 2XB2D 1CS4A 4BRMA 5DQGA 4QZHA 3MGVA 3FZMA 2MZ1A 5IWAK 5L46A 2V8PA 4K5RA 1NMEB 5A8WB 3US5A 7ICNA 4CDIA 4JV5K 3G6ES 3HBTA 1N8RO 4TKTA 3OHRA 2WFBA 2HMPA 3NGUA 4K4UA 2M88A 1EETB 3H8JA 2MKCA 4ZP9A