4B9SA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion outside of the pre-insertion site.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 209
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9sA01
1UA1A 1LWCA 3LALA 3Q8RB 2WOMA 4IFVA 3V9SA 4KREA 2M9NA 4BE0A 4AHUA 1ZBUA 2BCQA 2FBTA 3SCXA 2FBXA 1ZQHA 4DL2A 1ASUA 2BKEA 1TKZA 1DLOA 3GDXA 5J2NA 4RNMA 1K1SA 5D46A 5DGBA 1JLGA 1TV6A 7ICSA 4DS4A 1X2IA 4FJKA 2G8WA 3PW0A 3DMJA 3RJKA 4BGDA 1EXQA 2FMQA 1S1VA 4J2AA 1S0VA 3V9WA 3QEVA 1I3AA 9ICBA 2DY4A 3AO2A 1ZQYA 4F5OA 1NK5A 4N5SA 1RYSA 4KLSA 3C6UA 1TKXA 4GVMA 3PR4A 2F1HA 3SV4A 4HUFA 3S3MA 3CFRA 1IM4A 1QSLA 4FLUA 1KVAA 1SKSA 4TURA 5KFLA 2X6SA 4DTMA 3MDCA 4UB2A 3V9ZA 4QZ8A 4UQGA 1A5XA 4LSNA 4Q43A 2BCVA 5CZ2A 3C1YA 3V1QA 4DF8A 5C25A 5CYQA 4OJRA 8ICAA 5DB8A 7ICIA 9ICQA 4ICLA 2AQ4A 2YHBA 3VQEA 5J0OA 4M9LA 3LP1A 5KFRA 2ZTEA 3RR7A 3MFHA 1I39A 1WNSA 4KLQA 4CJFA 5BPCA 4FZZA 9ICEA 5JS1A 3ETLA 1BI4B 3V6JA 3Q8SB 2FLNA 3E2EA 1BL3A 4KI4A 2DPIA 4F4KA 3AO1A 4YMNA 2KW4A 3E01A 8ICHA 4KB0A 4P4PA 3DLGA 3RMCA 2FPLA 3C2KA 4UB3A 2FC0A 3H8WA 2BGGA 3QNOA 2AU0A 3O3FA 2Z1JA 1Z3EB 5CWRA 4QCLA 2FBYA 4DSFA 3TAFA 1LWFA 2IAJA 7ICJA 3C5FA 4DTJA 4I2DA 4PGYA 5DDYA 4QZAA 4KTQA 4JS5A 4BE2A 1BGXT 2ZE2A 2P1JA 2OPSA 4B9TA 5J2HA 3LDAA 2NRZA 1LW2A 1VRTA 1IKWA 2NRXA 5J2QA 1T8EA 3PX6A 4O0IA 2GUIA 1YT3A 5KT7A 1VSDA 3C2LA 4RQ1A 5J2BA 4ECSA 4OKKA 1KLMA 3EWAA 1JLFA 5CR0A 5J1EA 3V9UA 5KI6A 5KRSA 3AVAA 1WAJA 3L8BA 3VQQA 4RPXA 4I2QA 1KVCA 1RDBA 1VK0A 3ZSXA 3K59A 3TI0A 1ZQMA 4R66A 1SZPA 9ICGA 4NLZA 3U6FA 1RCHA 4JV0A 4M2YA 2FLLA 4FLTA 5CJ7A 3JPOA 1ZQVA 3TABA 5DB7A 1S10A 4O5EA 4NCGA 3OY9A 3DLRA 5KFTA 2BQ3A 4XUSA 4YR2A 1VSIA 3LP3A 4H4OA 4O3SA 4Z6DA 4XIUA 4YNQA 8ICXA 3TWHA 4E7IA 3Q8LA 3MECA 2HHVA 3HW8A 3HK2A 2PI4A 3UXOA 4DQPA 3SUPA 1QSSA 3T5HA 4RW6A 1TVAA 4DSKA 4Z0UA 3VQAA 3WNHA 4J9QA 1VSLA 1EX4A 2W9CA 3GIMA 3VN5A 5HNKA 4E1NA 2P51A 4Q5VA 4RW4A 2KFZA 4UAYA 8ICEA 2KZZA 4MFAA 4RUAA 4I2CA 4KHWA 4QZGA 5IILA 4FBTA 4F91B 2YNGA 3PVXA 3HM9A 4KN4A 5KG6A 4CK2A 3KLFA 4KLIA 1HYZA 2Z1HA 1WCLA 2G8FA 4ECRA 3AA5X 1ZQKA 4CF8A 2ZUCA 5IIJA 2KN7A 2PYLA 2Z1GA 4DG1A 4UB4A 4BXOB 1FK9A 5IIMA 4GXIA 4E0DA 3L3VA 4C8OA 3S3NA 3RTVA 3OVNA 1HQUA 2D0AA 1KDHA 4DFJA 4CK3A 4FM2A 1FKPA 3T5LA 3UXNA 4DL5A 1F21A 4CJ5A 4OPKA 1BIZA 2FMPA 4YR3A 5FDLA 1IO2A 2R8JA 3PMNA 2FBVA 3KLHA 4E3SA 3FDSA 3Q8KA 4OLAA 3QESA 2DFEA 4XQ8A 7ICLA 3OYMA 5E41A 1QLNA 1HJPA 1NOZA 2F1IA 3JPNA 3AVFA 3PO5A 3OYKA 4ECTA 4JV1A 1FKOA 1RPLA 4H8KA 4QWDA 3VQBA 4O3RA 4AILC 7ICNA 3ALYA 3THVA 4BXOA 3NF6A 4RQ0A 5HBMA 2XY8A 4M9GA 1VSJA 3AU6A 2AJQA 4YQWA 7ICKA 2ATLA 5J0SA 2BPCA 3ZSWA 2BGWA 4KLFA 1LAWA 4PQUA 3SV3A 2E4LA 3ZSYA 4ED8A 4DSEA 4KLLA 3TAMA 3K5NA 1C0UA 3GV5B 3I0SA 1SL1A 1RT4A 4CCHA 3OJSA 3HJFA 4KMUA 3GQCA 1TAQA 4HUEA 3QETA 4FK4A 3BQ0A 1L3TA 3KHGA 4B8AB 4FLZA 4Z6EA 4DF4A 1XSLA 1JMSA 3CG7A 5CP2A 5KFFA 2G8KA 3P5JA 4RQ5A 4CIEA 2VA8A 3L2WA 5CB1A 2XCPA 5DB9A 4KO0A 4RNNA 4MFBA 4OKEA 5KG5A 5KFIA 3M8SA 1GOBA 8ICLA 1QSYA 1T7PA 1ZQFA 3OYDA 4F5PA 2O4IA 4CGHA 3VA0A 4FJLA 1SUQA 4CECA 1N5YA 1BVSA 1KCFA 7ICOA 4CJPA 4FXDA 4I2AA 4FJHA 3HO1A 3HL8A 1UOCA 3B6PA 1TK8A 5FROA 4KLUA 2HNYA 4IRKA 4KN7A 3MR3A 2VG6A 1HYSA 4ECYA 1SL0A 1HNIA 2YNFA 4O5KA 4YN4A 3TANA 4XRHA 4CHZA 1QHTA 8ICUA 2DTUA 2H5XA 3IAYA 3OGUA 3PV8A 1VSKA 8ICMA 4JK1A 2C2RA 1C0TA 4GLXA 3H8JA 1BHLA 3B6OA 5KFKA 4UB5A 3UQ2A 1RTHA 1HUZA 4CFCA 1DOQA 2DFFA 5L1JA 5KG3A 3NBPA 1SKRA 2UVVA 1UA0A 3CYMA 4NCBA 4ID1A 4UAWA 3QZ8A 4F2RA 4Z4CA 8ICRA 2ZD1A 1S1XA 4HVJA 2J6SA 4M3TA 5SWMA 5KFCA 4OVLA 4M3ZA 4RQ6A 5J0RA 3QEPA 4GC7A 4CJQA 8ICSA 4J9MA 1BISA 5HRNA 4FJJA 3RB4A 3N4MB 2HHTA 1LB2B 4KLOA 4DWIA 2ETJA 9ICCA 3LK9A 1HRHA 3EY1A 4CGGA 2OPRA 3U3GA 2ALZA 4EP5A 5FRMA 5KGXA 5KT5A 4QWEA 4JS4A 2HNZA 4CK1A 4CHPA 2A1RA 4AHRA 4BWJA 3CFPA 4TUSA 1QE1A 5HHIA 3DLHA 1QQCA 8ICIA 5JS2A 3OYEA 1ZQNA 1NJXA 4CGJA 1TL3A 4NCAA 4I2JA 1LAVA 4B8CA 3V6HA 3I0RA 4ELUA 5F9NA 3HPOA 1JLBA 3TFRA 3RB3A 5I3UA 3IG1A 4FJMA 2JGUA 1B9DA 2W8KA 3AO4A 3SQ2A 3OYLA 3K4GA 5KFBA 3RBEA 4ECWA 3S9HA 1RXVA 4O3NA 2OWOA 5HRSA 3G10A 4M3WA 4R65A 4F93B 1SKWA 2Q3SA 4W5NA 3HX0A 3ZT0A 4K8ZA 3RR8A 5J0PA 1ZQRA 5DG7A 1RBTA 2P6UA 4QZ9A 4KHNA 1G15A 1BPBA 3SUNA 1YTAA 4IR9A 1D9FA 5KRTA 3TAPA 4DFPA 4IQWA 5C24A 3MGIA 3LP2A 5L1LA 4B9MA 5DDMA 4B9NA 1N48A 1X1PA 5J0XA 4TSXA 1RBUA 5KT6A 1U45A 2D0BA 4CIGA 5HLFA 5L1KA 3K2PA 3JPQA 1T03A 1S6PA 4MFCA 2GWSA 5T7BA 3CM6A 4EZ9A 1RILA 5J29A 4YR0A 2HVIA 9ICVA 4Z4HA 1FXXA 3GFKB 5J2JA 5KFMA 4DL7A 5KFXA 3QLHA 3ZDDA 1ZQDA 5KFOA 2I1QA 2QKKA 3RRGA 9ICUA 4N56A 3LAMA 2HHUA 8ICWA 3ISBA 1S77D 3QERA 4W5TA 2OA8A 4BDZA 1Z25A 1X9MA 1XI1A 3ZT3A 4PGQA 5KFZA 2FLPA 4P4OA 3QEWA 4ZTJA 4C8MA 4NLGA 3AA3A 3D45A 1XSNA 1ZQLA 4ED6A 3NF8A 5J0YA 4RPYA 1ZBFA 9ICTA 1EKEA 4YVZA 1NJZA 3JPTA 5J2AA 1X9SA 5HMMA 8ICYA 1WSGA 4MF2A 1SV5A 3KLEA 4CHNA 2EHGA 3NH0A 2XY6A 3QNNA 3M9OB 1C1BA 1JIHA 3ASMA 5BOMA 1Q9YA 3RB0A 9ICOA 3HSTB 4PWDA 4ECVA 4F50A 8ICQA 3VQPA 4QWBA 4OGEA 3AU2A 4I2FA 2B21A 1ZQQA 7ICPA 1JLEA 1TL1A 1IKXA 4YXMA 3RBDA 1NKCA 1S1TA 3KJVA 3TR8A 2DFLA 1J54A 3K75D 3DRPA 4ZH4A 4KLTA 4LH5A 4I27A 5DG8A 1K6YA 4IQVA 4I9LA 3NGIA 4FVMA 4QW9A 2B4JA 3LWMA 5KFEA 2ASJA 4CEBA 4MEXA 3JPPA 3JSMA 2OPPA 1XC9A 2HVHA 4FLWA 4C8KA 3AA4A 4K4GA 4F4XA 5J2FA 2JEFA 4ED7A 4HCCA 1HJRA 3IS9A 4I2GA 3KHHA 1ZQEA 1XHZA 3AO5A 3BQTA 2O4GA 3AVNA 5JUMA 1U48A 4YFUA 4MEYA 2XGPA 1QTMA 4ED1A 3DLKA 5EWFA 4Q45A 4FLXA 4YFKA 1RT1A 3L2UA 4IBNA 1Y88A 2BCSA 5EU7A 3GILA 4KAZA 3G6YA 4JUZA 3CQ8A 3H08A 9ICKA 3MXJA 1KLNA 3NCIA 3RH4A 2YNIA 5KTQA 1VSHA 3IHQB 2HHQA 3M9MB 1ZQSA 4ECXA 1U49A 2RPIA 3O4NA 4M9HA 3UQ0A 3V7LA 2ISPA 4ECUA 2VWKA 2RF2A 4DOAA 1Z26A 1ZQOA 5IINA 3C94A 4DQIA 4W5QA 4QZIA 4KHUA 9ICLA 4FS2A 2PYJA 4EYIB 1HQEA 3TFSA 2YNHA 3A2FA 1R0AA 3ORYA 4B9VA 1T3NA 5DB6A 3OS2A 4PUOA 3PX0A 5KG7A 3PW4A 3UIQA 4I2PA 1BQMA 2RKIA 1S9FA 1CXQA 3RJHA 7ICMA 4I9QA 2PI5A 5EOZA 3WNEA 5KT3A 4OPJA 2V9WA 4JWMA 3L3UA 5CYMA 3UXPA 4QAGA 4PGXA 3KTQA 2UVRA 4QZFA 4FS1A 1NOYA 4J9RA 4P2HA 1X9WA 1NK9A 1B92A 3L2VA 1C6VA 4ECQA 1D8YA 4DL3A 3AVKA 5CA7A 1Z00A 5DQHA 4EBEA 4TUPA 9ICWA 2X74A 4CJEA 2Y1JA 1MU2A 2AQ0A 4K4HA 3C5GA 2IDOA 1ZQWA 3IM1A 4DFKA 1S6QA 2P6RA 3DOLA 3HPGA 4RQ8A 3RJFA 2HHXA 2F96A 3HVTA 4QZCA 1TK5A 4O44A 1ZQJA 4I28A 4RQ4A 1S5JA 5HMLA 4UBBA 2G8VA 3NGZA 1BPXA 3ITHA 1AROP 3EW9A 4QWAA 4EYHB 1JL1A 4HUGA 5HROA 3MBYA 5J2GA 4KI6A 4M3UA 4FO6A 2OPQA 4O55A 3ZDBA 5KT4A 4XA5A 4RW7A 1BIUA 3MR6A 3F9KA 1TAUA 4CJTA 2JZBA 3GIIA 4YD2A 4JV2A 1IG9A 2BE2A 2NRTA 3ZSRA 3JYTA 1T4GA 1ZYQA 3ZDEA 1WSIA 4IQUA 4J9SA 3OYIA 4B9LA 3ULDA 1IKYA 3MXIA 1U47A 4TQSA 2AGQA 4RU9A 4UBCA 5KGWA 4B08A 4CF0A 4DQSA 3NTUA 4NYFA 1ZQZA 1TGOA 1W0HA 3DM2A 9ICXA 3LZJA 1NK8A 5J2EA 5L1IA 4F4ZA 4CJWA 5I42A 4FJ5A 2VA3A 1TK0A 1W9HA 1PZNA 2BR0A 2P66A 4FCYA 4J9NA 2JEJA 2QKBA 4C8NA 1A77A 4M6WB 3PR5B 1NKEA 2W9BA 2R8KA 4KTWA 5DBCA 5J2IA 1RBVA 1A76A 4FJ9A 3SPZA 8ICTA 1ZQBA 3EZ5A 4YD1A 1Z00B 2YKMA 3JPRA 5CZ1A 1L3VA 3RH5A 2IMWP 3V7JA 2BCRA 2VANA 3AO3A 1RDDA 1MC8A 3TAGA 2KZ3A 3GIJA 4I2HA 4BACA 3QINA 4KLGA 4KPYA 1MQ2A 3VA3A 4RUCA 3ZT4A 1KRPA 1D8LA 1Q8IA 1UT8A 8ICJA 4IRDA 3O3GA 2IGIA 5J2MA 2OZMA 1KTQA 4DOBA 4CJ4A 4CJSA 3TQ1A 3K5LA 3KLGA 4KHQA 4EBDA 3V1RA 5EWEA 1O1WA 4K4IA 4M42A 3AVGA 4PY5A 4RG8A 5DGAA 1S0MA 3SJJA 3V72A 4YXJA 3M8QA 4CJRA 1VSFA 3F73A 2HMIA 3TARA 3OSNA 4QWCA 4DEZA 5HHHA 1TV9A 4DS5A 1RT6A 2J6TA 4G3IA 1JLCA 4O5CA 4AHCA 7ICGA 2G8UA 4ED2A 1ZJNA 1B9FA 3HVRA 1NK0A 4QZHA 3MFIA 1WAFA 1DTQA 2FPKA 4NYNA 4FK2A 4M45A 3SQ4A 4R63A 8ICPA 3H8SA 4O9MA 3ZD8A 1GOAA 1ZQAA 2B5JA 3OYFA 8ICFA 4NY8A 5KG2A 4QZBA 3QIOA 4B9SA 2UVWA 4FK0A 5D49A 2XY5A 9ICMA 3K5OA 4IG3A 4ZTFA 4L8RB 1KFSA 1COOA 4DFMA 3ZSOA 3VQ6A 4CEEA 3CFOA 3IRXA 4I2IA 4NLKA 4R5PA 8ICOA 7ICFA 1B43A 1U9LA 2DPJA 3DOKA 3S3OA 3EPIA 3LPUA 1XO1A 4CFAA 4ELTA 4PPXA 4GXKA 1N56A 3QEIA 1ZQPA 3RAXA 4DU1A 7ICVA 3U3YA 2XRIA 3N97B 3ZD9A 1BQNA 2IS3A 2ZJAA 4HCBA 4LZGA 8ICGA 2ZJ5A 4E7LA 2R7YA 1NOMA 1RT7A 3HP9A 4EZ6A 4ED3A 4EEYA 1L3SA 3PO4A 4TUQA 4DTSA 1ZJMA 4W5RA 3SI6A 1JLAA 3MEGA 5DQGA 1BPEA 5KFHA 3T19A 3TAQA 2C28A 3H7IA 4CGIA 4F3TA 1D5AA 2QK9A 1EP4A 2E6MA 3WNFA 4QZDA 2MUTA 3HWTA 5K14A 3OYJA 4KITB 4RNOA 2X6NA 5KFVA 1Q9XA 3RWUA 7ICHA 2ATQA 4PA1A 2XGQA 2V4QA 4X5VA 4E1MA 3AUOA 3QZ7A 2G8HA 4UB1A 1TFRA 4O0JA 4FZXC 1ZQUA 3RJJA 1J53A 3KHRA 3NH2A 4LH4A 2IA6A 3MR2A 3WNGA 4W5OA 2BCUA 5HP1A 4IKFA 1CEZA 3ZDAA 1WSHA 4HHTA 2JLEA 2ISOA 4IG0A 3VQ4A 8ICVA 2W9CB 1NKBA 4NLNA 2VA2A 3NGYA 3M9NB 4DLGA 1RTIA 2JZBB 3P83D 4B3OA 3KKRA 2AGOA 2PZSA 5KT2A 2A1JB 3C6TA 9ICSA 5J0WA 3DRSA 3SZ2A 7ICRA 4PHEA 4Z4EA 4E7KA 3OHBA 2BHNA 5KFSA 4O3PA 4BWMA 2W42A 3QE9Y 2ZJ8A 2ZUBA 2RDIA 2D0CA 4KB1A 4DTRA 4CJUA 2KFNA 4M6WA 3KK2A 5CHGA 4AH9A 2W9BB 3AVMA 4DTUA 4IR1A 3PY8A 4LY7A 3SUOA 1JXEA 3LZIA 1N6QA 4M3XA 3LPTA 4F4WA 3V4IA 4K8XA 1CZ9A 5FRNA 1ZBHA 2XO7A 4P4MA 2ZTDA 4CF2A 4BDYA 3ZT1A 3DRRA 2NUBA 4CFBA 4DMNA 5KFAA 1RT5A 5EWGA 4CERA 3DLEA 1C0MA 1WLJA 4G1QA 4OKJA 1ZQTA 3M8PA 1XS9D 2ZQBA 1REVA 1HYVA 4RQ2A 4KHSA 4FZYA 3SPYA 4Z4IA 5KFGA 1VRUA 1VSEA 9ICRA 1JLQA 3KD1E 3NAEA 3OYHA 3PNCA 2RDJA 3RJEA 3V9XA 3C95A 3V7KA 4FJNA 3T1AA 4KRFA 1BCOA 4CIFA 3QEXA 4J9LA 2IC3A 3C23A 9ICHA 4I2EA 3VQDA 1RTDA 3NFAA 2A1JA 3LDSA 2Q0ZX 1BPZA 4DLEA 3RAQA 3KK1A 4RT2A 2YV0X 3C21A 3NF7A 3ISNC 3QO9A 5DQIA 1ZQGA 9ICPA 4YCXA 2IOCA 3ZT2A 3HP6A 1YVUA 4H4MA 5KFDA 3GIKA 3SYZA 3EPGA 1TKTA 4Q44A 2EX3A 3MR5A 2BPFA 1S0NA 3BQ1A 3RH6A 1C1CA 1IH7A 3NGDA 5IIIA 5CY4A 1HUOA 1MQ3A 3V81A 3KK3A 1UWBA 1LV5A 3DLBA 4R8UA 3PX4A 2C22A 5SZTA 4NM2A 4CEFA 1ASWA 3SNNA 2B6AA 3GV7B 4I29A 4FBUA 1ZBIA 1QS4A 2A1SA 1JL2A 3OSPA 3SI8A 1C1AA 5DG9A 2J6UA 4QZEA 4KLJA 4FYDA 2BDPA 4Q8FA 3AVBA 3G6VA 4O3OA 3AVHA 2JEGA 3NH1A 1S97A 4IDKA 1KVBA 4M3YA 4FJ8A 2KTQA 2Z1IA 2W9AA 4PHDA 4AHTA 3QEAZ 4KTZA 4RZRA 1RYRA 5D4BA 5HP4A 1ZQCA 2HB5A 2W8LA 2R8GA 2RN2A 3C2MA 4AHVA 2NRVA 5HRRA 2VG5A 4DU3A 4I7FA 1CUKA 4FLYA 3AVCA 4RQ3A 9ICAA 3RMAA 4E89A 2PFNA 4FJIA 5HRPA 4J9OA 1EXNA 4DSLA 5DMRA 3G6XA 1EETA 1RNHA 4E19A 4EBCA 1VSMA 1DTTA 1WSEA 4BDPA 4R64A 1B22A 8ICZA 4EP4A 4J2BA 1NJWA 3VQ8A 1IXRA 2MAXA 5F9LA 1NK6A 3OHAA 3V1OA 4IRCA 3OYCA 1RT3A 2WTFA 3M8RA 1RDAA 4KLMA 1H38A 3ISCA 4MQ3A 4LZDA 3VQ9A 3L2RA 3HT3A 4PH5A 3NHGA 1CZBA 3MEEA 1MSWD 1L3UA 2PFOA 2YKNA 4J2EA 3AV9A 3Q8MA 4CGFA 3BGRA 1K1QA 3G0ZA 4N47A 2JEIA 4DTNA 4NM1A 5DLGA 4DU4A 2XHBA 4JRPA 3P1GA 2BQUA 3ISDA 1KFDA 3RJIA 7ICUA 3MEDA 4RT3A 4YG2A 2D5RA 2ASDA 4KFBA 4RW8A 3KIOA 4KLHA 4WE1A 3BJYA 3KLIA 3EYZA 1XSPA 1RZTA 9ICNA 3ZDCA 4M9NA 4DL4A 1A5WA 4DQRA 4CJLA 3V6DA 2X78A 4JWNA 1ASVA 1NJYA 4Z4FA 3PW5A 1RTJA 4QOZB 5DKWA 3LANA 3LP0A 3UPQA 1TKDA 3BDPA 1NK4A 4I2BA 1XU4A 4R8UB 1RT2A 4DTXA 4O4GA 1ZBLA 3SQ1A 3VQ7A 2PFPA 1BCMA 2E6LA 4M9JA 3K5MA 3DI6A 4GW6A 4DOCA 1U4BA 4F3OA 5KFWA 3T3FA 2LSNA 4IFYA 4ELVA 3NE6A 1J9AA 3D0PA 2FPMA 2ZTCA 3C1ZA 4GC6A 7ICTA 2HHSA 5C42A 2C2EA 1S9EA 1ITGA 3GV8B 3AA2A 1NK7A 2HNDA 2VWJA 4KV8A 2QXFA 4CF1A 3FYHA 1Y97A 4FJXA 1S1WA 1DGSA 2V4RA 3QEBZ 1S1UA 5D3GA 4F5NA 3DYAA 4M3RA 2BQRA 1ZETA 2ZUDA 4DL6A 4TQRA 3Q8QB 4KLDA 3LAKA 1XHXA 2LYHA 2XCAA 4CEDA 5BOLA 4CJ3A 8ICCA 5KFJA 2OYQA 4FW1A 5KFYA 4F8RA 4FW2A 4CF9A 2F8SA 4M47A 1T05A 1SL2A 2ASLA 3PW2A 4UAZA 4F2SA 1BI4A 3TAEA 4DQQA 9ICIA 4GMJB 3H40A 3RMDA 3B0YA 1ZQIA 3H4DA 4LVSA 3NDKA 1HPZA 4RW9A 2IHMA 4Y1CA 4DTPA 4JLHA 2WONA 4YP3A 1TVRA 2XC9A 9ICFA 4ED0A 3AVIA 4FLVA 3AVJA 2F1JA 4F92B 5J2DA 3OJUA 1KSPA 4AHSA 2GV9A 4LSLA 4QW8A 3NF9A 3JPSA 5IIKA 3ZSQA 1LW0A 3LWLA 3KKSA 2W9MA 3VQCA 3KD5E 2P5GA 3OYAA 4YMOA 5IIOA 4M04A 3MABA 3FFIA 2C2DA 4IQTA 9ICJA 3Q8PB 4KKOA 3RB6A 1RBSA 1J5OA 2AGPA 3SUQA 5KFNA 1RXWA 5KG0A 4RPZA 3I8DA 2IBKA 1L5UA 4FJ7A 4B9UA 5KFUA 3K57A 1HNVA 2ITGA 4HTUA 1RDCA 1KFTA 3RMBA 2XY7A 1LWEA 3ZCMA 3OYBA 8ICKA 3MAQA 1RBRA 4HYKA 4DTOA 3MXMA 4DSIA 3OS1A 4GXJA 2MUTB 4O3QA 4CHOA 2F8TA 1UAXA 5KFPA 4CJKA 4CEQA 5J2CA 2YHAA 5DBBA 3AVLA 1IKVA 4LD0A 4ECZA 2NRWA 2BPGA 4E7HA 4CHYA 4F5QA 4M41A 3HPHA 1S9GA 1WSFA 3T5JA 5DLFA 4J9KA 4E7JA 2HW3A 4J9PA 4O5BA 4F4YA 1JN3A 2KQ2A 4OLBA 3ZSZA 3OYGA 5TZVA 1GOCA 3B0XA 3KHLA 8ICBA 4N41A 2P5OA 3CM5A 3OYNA 4JRQA 3VQ5A 2BANA 3MGHA 3O4QA 4Z6FA 5J0QA 3MDAA 4Q0BA 3O3HA 2GBZA 5KFQA 2OZSA 1S0OA 1JKHA 4CE9A 1YTUA 4C8LA 4MF8A 4CEOA 5J2PA 3BQ2A 4DO9A 2KZMA 3OS0A 1WN7A 4Z6CA 4FM1A 5J2KA 1S76D 3RJGA 2I5JA 4FJGA 3L2QA 4Y1DA 4DSJA 4N76A 7ICEA 1JXBA 4CESA 1D9DA 4J2DA 5DK5A 2R8HA 4ID5A 4NXZA 1CXUA 4RQ7A 1JXLA 8ICNA 3K58A 1WCNA 2Y1IA 1U04A 5L9XA 2DFHA 4KLEA 1XWLA 4YMMA 4CHQA 2VG7A 1BPDA 3SQ0A 1ZQXA 4CGDA 4BE1A 3H4BA 3HYFA 1BPYA 5KG4A 4FM0A 7ICQA 5J0UA 3PUFA 1WSJA 5C5JA 4OGCA 4Z4GA 3PW7A 4CEZA 1HMVA 1JX4A 5J0TA 4CEAA 1CLQA 4MFFA 4Q8EA 1C7YA 4PHPA 2UVUA 4PHAA 4F5RA 4KHYA 2PXIA 2PFQA 3QIPA 3T5KA 2R8IA 4M0AA 2FMSA 2PY5A 5KG1A 1A5VA 3HXMA 1KEJA 3V6KA 3ZSVA 2G8IA 4CJVA 4ZHRA 4CFDA 3PMLA 2HHWA 1V9PA 2IHNA 5DBAA 3RRHA 2I9GA 1UT5A
chains in the Genus database with same CATH superfamily
1UA1A 4BRDA 3R5DA 1IV8A 1FTRA 3SAFA 2B8QA 2HWHA 3P5BP 2FBXA 2B4OA 3VGMA 4BLGA 2BKEA 3HX9A 3IRUA 4ZP9A 3EJMA 1KP6A 3H46O 5KAKA 1V5VA 2V5HG 5D46A 1ECWA 5DGBA 1JLGA 2AEMA 5AJ3K 4K4XA 3QFUA 3QFWA 1X2IA 1S5LU 4QU6A 3DMJA 2DR5A 4OHXA 2K7JA 1UVIA 2QV6A 4KHPK 2KRBA 1EXQA 4K50A 2HIYA 5GTIU 4J2AA 2V2KA 4ED5A 4QNLA 3W62A 5D4PA 4CVNE 2F8MA 9ICBA 4CBWA 1ZQYA 1RHQB 3AJ2A 1M1KT 1DK2A 4NOHA 1M5KC 3HSJA 1S1WB 3M1YA 1WELA 5M1KA 4HUFA 2XLJA 1IM4A 3BR9A 5EX0A 1GH8A 1SKSA 3V9ZA 4QZ8A 1ZD3A 3ENHA 4UB6U 5CZ2A 5CYQA 4A62A 4H5WA 1WI8A 7ICIA 2J9CA 3IFEA 2UUBJ 5IV4A 1HR0F 3NL0A 3FBBA 3CSKA 4JN4A 4M9LA 3LP1A 1Z05A 1S72S 1SB6A 5BPCA 2JHEA 4NPOA 3ETLA 3EVMA 1BI4B 2LA4A 2FLNA 1HIYA 4EIAA 4KI4A 2OELA 2DPIA 3OVSA 4CNYA 4UUXA 3AMZA 2CNNB 4P4PA 3G4SN 3C2KA 1AZSA 2VONA 2FC0A 3H8WA 5KAIU 1K8KA 2NYVA 1H7XA 3O3FA 1BQNB 5ETNA 1TFYA 5CWRA 2ZWOA 2FBYA 1WC5A 2QTWA 3GFYA 2KL8A 4NE9C 4NLCA 1N5WA 3HHNB 2QYGA 1Y64A 3W9JA 2KG1A 3MTJA 1XC3A 1S1UB 4JS5A 4CD3A 2ZE2A 2ZOMA 2EVZA 2I8EA 2ZIVA 3I55N 3KKFA 1LW2A 2VASA 2NSBA 1VRTA 1NU0A 5JLFA 3K0SA 1IKWA 5J2QA 1T8EA 4O0IA 5AKEA 1YT3A 3M2VB 5J2BA 4ECSA 2O1PA 1JLFA 5J1EA 1MMLA 3N9UC 4FWKA 5IS2A 2W7AA 2IRYA 1DQ8A 1Y9OA 4NA3A 1WAJA 1LW0B 3TZWA 2VF3A 1YJNN 3TI0A 4I56A 2F4VJ 3D66A 1SZPA 1OW5A 3THPA 4J90A 2I7NA 4TU8A 4JV0A 2QLWA 1AW0A 4QIVA 3TABA 4AM7A 5DB7A 4O5EA 3OY9A 3D7EO 1NHKL 4YR2A 1GXTA 3RFAA 5DS7A 1UFLA 3KNGA 1F1BB 3N4PA 5ALPA 2LXFA 1PIEA 4JKGB 4USHA 3NRBA 2RIJA 2BH1A 5ALIA 3Q8LA 2HHPA 3BBFA 1H74A 2IM0A 1NLVA 2NZ4A 3UXOA 3A3OB 1QSSA 5M2UA 2O8BA 3T5HA 2JL9A 4DSKA 2AEFA 5AE2A 1RHRB 2DH8A 1EX4A 2W9CA 2J7KA 4KGZB 3GONA 4Q5VA 1K0VA 2KFZA 4WFZA 4UAYA 4RUAA 1VI7A 2MLXA 4ZVPB 5JXSA 1U6ZA 4F91B 5KG6A 1R8HA 3EXCX 4YDDB 1SV0A 4JYAF 4CW7B 4EEKA 1RTZA 3T41A 3CJKA 4YHHF 2ZUCA 3A0HU 2KN7A 3C16A 5A2QU 1RABB 2AJ2A 4A8FA 3OR2B 1RT2B 3MF5A 4BXOB 2E1YA 4GXIA 4E0DA 1IR0A 2M70A 1T9YA 4YMEA 3S3NA 2BKOA 4KH6A 3CJ0A 1DJ0A 1KDHA 3LO3A 4P2SA 1FKPA 2A3JA 1WUAA 2CPFA 3T5LA 3MM9A 4DL5A 3MHYA 4CJ5A 3QBCA 4K8RA 3PMNA 1QTNB 1WKLA 4X66J 3OD2A 3BUZB 1W2BM 5GIPA 1NSPA 3MMAB 3W65A 5E41A 1Y5NB 1QLNA 3W5YA 1Q3VA 1NOZA 3H90A 1S72N 4EX7A 5AQSA 5CE3A 2DEIA 3AVFA 2MLYA 3ENQA 3FSXA 3OYKA 2NXCA 4Y34A 2M7SA 2X7IA 5ETVA 1RPLA 4H8KA 3NMAA 1RT6B 3VQBA 2DHHA 2HK3A 5AM1A 4AILC 3DDNA 3ALYA 4Q2MA 2E1MC 4BXOA 2Y9HA 3E8OA 4Y2CA 3J81U 2ZHBA 4F0HA 5AQQA 1K73O 2NQPA 1XMOJ 2XY8A 3AU6A 2AJQA 2BPCA 5J0SA 3M7VA 2AHOB 2UV8G 5AZJB 3SV3A 3ILOA 1VQLS 3ZSYA 2OM6A 3QWUA 3WX4A 1YLXA 4WJ3B 1FRJA 4JI6K 5DM7Q 1Z1VA 4ZIVA 1M6YA 4DV4J 2FJAB 1EWQA 3L4IA 5KPZA 3HJFA 4DX7A 2MY8A 2FHMA 3QETA 4FK4A 1QQ7A 2C2NA 3T6JA 1VBZA 4ILGB 1L3TA 2HSZA 3ENWA 4B8AB 4B3SK 5FPDA 3B78A 1JMSA 1IQTA 2WOMB 3MMJA 4ILLA 5CP2A 4LBPA 5D0HA 3CC4N 3NAIA 5D15A 2IIRA 4RQ5A 2B9YA 2Q0UA 5F3TA 5AK4A 1HARA 2I1RA 2HNDB 4RNNA 5KOXA 3MOJB 4MFBA 2EBGA 4OKEA 3HD1A 1PJ6A 5AE3A 3TACB 2CN1A 1GOBA 1UPHA 2F1FA 4M5IA 5IV3A 4LF8K 3OTEA 1E6YB 3H0LB 4LFCF 4F5PA 5B0GA 4YOTA 4ZMMA 2K1RA 4CECA 1JLBB 1FTCA 1KCFA 3AAQA 3BKTA 1YF5L 1JRPA 1S4FA 1N33J 3HL8A 3T1HJ 1GXLA 3WKBA 1UOCA 5FROA 4WTOB 1C2PA 4KN7A 4ZPCA 1X0FA 4WIQA 2VG6A 1VK8A 4K5RA 2EI5A 4CHZA 1R0AB 4I6AA 4PUOB 2F9WA 5AQWA 8ICUA 3RAMA 2UZAA 3IAYA 3P39A 3PEHA 2J0WA 2AJ1A 3VZIA 1BHLA 2EC2A 3OXFA 3IRWP 3B6OA 1HWIA 2W40A 3G4SS 2F9TA 3VF4A 5DO2A 4UB5A 3UQ2A 4M8LA 4DV2J 3W9IA 1DOQA 1HR0K 5L1JA 2UVVA 4NI2A 1X3MA 4F2RA 2DNPA 3R1XA 1TE2A 3M32A 1VQ7S 2HBLA 4OVLA 2KK0A 1O6XA 1VJWA 2YQ1A 3QEPA 1SH0A 8ICSA 3C6TB 1BISA 3K8WA 2G1DA 1WYGA 4FJJA 3FM9A 3PRDA 5AIAA 3N4MB 4J91A 5AKLA 2YWFA 9ICCA 2VKQA 1HRHA 5F0XA 3EY1A 3U3GA 1SC1B 2HG4A 5KGXA 5KT5A 4QWEA 4WYWA 4OD0A 2P9LB 3GB0A 3V4MA 2OTJS 3CFPA 4DQ8A 4TUSA 1BWEA 5GAGU 2E1PA 3AGKA 2ZUAA 8ICIA 1QQCA 3ZFVA 5E3AA 1UMJA 1LKYB 1NJXA 4I2JA 1LAVA 4C1NI 4UW9A 3I0RA 4ELUA 2XYGB 2LEAA 3TFRA 5GADU 3IG1A 3ZETA 2CJBA 2OAUA 2XYHB 2JGUA 1WF1A 1HWUA 2KHDA 2BJ3A 3SCIE 1VQPS 3OYLA 3K4GA 5K20B 1QAIA 5IT9U 3S9HA 4O3NA 3G10A 4F93B 3JTOA 1LW2B 3B9JA 4QQBA 1KS2A 3HX0A 4FVUA 3H5UA 5BXIA 2OEHA 4KH5A 5DG7A 5DDOC 2P6UA 2HFUA 1FKAF 1BPBA 2HBRB 3SUNA 2ADBA 2UXDF 1YTAA 1IXKA 4DFPA 3ZZZA 2D0OA 1K8KB 4B9MA 5DDMA 4B9NA 2QMXA 2PT0A 4DDFA 3D0GE 5EE3A 1X1PA 5J0XA 4TSXA 1NGJA 2OHDA 4MFBB 5KT6A 4DPUA 5HLFA 3DEEA 4OJGA 5L1KA 1XQIA 3CERA 4MFCA 3ZC4A 4WFYA 3CM6A 4YR0A 4Z4HA 1NDCA 3EL2A 4F4AA 3GFKB 5KFMA 2W03A 2ZXHA 1ZQDA 2LQBA 2I1QA 9ICUA 1WHXA 5LJ3Y 4N56A 1JI7A 4K25A 3BGRB 5BPMA 3PEJA 4DCJB 4H4KC 3E9OA 4JKEA 3P3DA 2OA8A 1ZQ1C 1X9MA 5AQVA 1XMQK 2ZJQQ 5KFZA 1LK5A 4P4OA 3CTRA 4U7BA 4PXCA 1T94A 2XZWA 3OW2R 2DGVA 3SJHA 4DUZK 5J2AA 1HBOB 4A8XA 1WB9A 3NCPA 2K4PA 2QTDA 4UAUA 2EHGA 2MTLA 4TLRA 3THYA 1VR6A 1JCGA 4HTJA 2FD2A 2LECA 5J8YA 4IQXA 3RB0A 1Q9YA 4O0NA 4PWDA 2YXLA 8ICQA 2GA7A 2W7PA 3A8JA 4ZP7A 4I2FA 2P9CA 1ZQQA 5ALZA 2AWZA 2RSQA 4UZCA 4YXMA 3KJVA 2DFLA 3HRGA 3Q2TC 1WNEA 4JI1K 4L75A 1LXNA 5EUHA 1V6HA 4QW9A 2YTCA 2AW0A 5HL7Q 2VHGA 2HZCA 2ASJA 4MEXA 2FJEB 2XI3A 3F2DA 3MM9B 4I6MB 4C8KA 4F4XA 3QGIA 3D0HE 5GMDA 2R7OA 4HCCA 1RTIB 4QIGA 1EARA 1ZQEA 3KG4A 1XHZA 3FBEA 1VMBA 2Y1RI 5ADXA 4M5HA 2LA6A 2HZVA 1KC8O 5AHXA 5JUMA 3SLCA 5KL1B 1U48A 4YFUA 1NPRA 4DV1F 1HPZB 3GDQA 4G6VB 4R0JA 2GV1A 3ZZOA 4IS7A 4IBNA 3AH6A 2BCSA 5EU7A 3WK4A 4KAZA 3G6YA 4CBUA 5A8RB 3H08A 2LPEA 4H0PA 9ICKA 2ILYA 2O8EB 3EE3A 2DHAA 2L9WA 1Q3UA 4CZFA 4HDHA 4MMOA 3DXKA 2MXYA 1ZQSA 1XEZA 3JS9A 3O4NA 2QIFA 3EGNA 4M9HA 3QMQA 4UT4A 3ITHB 2Q36A 1NPPA 4NCGB 3V7LA 1HBMA 1G6BA 2BYCA 2YKQA 5C2CA 1K9MO 1FJ7A 2Q66A 2GFFA 2HVDA 3CQYA 3SSRA 2VKZG 4X62J 4ZKAA 1IBLF 2JR5A 2YWKA 4ANDA 4QZIA 3DOKB 4CWBA 4MK7A 2YH0A 2IYIA 3K7RA 2YNHA 4IH5A 2VQFK 2MKIA 1T3NA 4RBUA 4OPAA 2JWKA 2QWQA 1UFKA 4PUOA 1FFGB 3QAUA 1WUUA 4I2PA 5DZ7A 5A0YB 2A5XA 3JAMO 3RJHA 2CQIA 2PI5A 4QYZK 3CJTA 3WNEA 5KT3A 1GAOA 2F63A 3CD7A 2V9WA 3L3UA 2H3IA 2IVMA 3KTQA 4FS1A 2CPJA 3IG5A 4P2HA 5AQNA 1P6TA 1B92A 2BUPA 1C6VA 4ECQA 1CJKB 3AVKA 3SMVA 4WJBA 4DCPB 5CA7A 9ICWA 4C2MA 4CJEA 2Y1JA 5DM6Q 3FZBA 3QYYA 1HFEL 2NLXA 5HVHA 5FIIA 2J7WA 2VBXA 2OSQA 2P6RA 1EETB 3S6EA 2EDUA 4CNQA 4OO1J 1I94F 1ZQJA 4RQ4A 2FSNA 2YQEA 1N5SA 4I2QB 2HQDA 3HKWA 1U6BA 2DBBA 1QD1A 2ZUGA 4P52A 1HEKA 2D69A 2MPUA 4EYHB 3A8KA 2B56A 3DXSX 3Q22A 5HROA 1Y7PA 2EW9A 3VTIA 3ZDBA 4RBVA 3MR6A 2E5SA 2W4DA 2HBYB 1TAUA 4GV9A 3GYNA 4W92B 4YD2A 3AGRA 4N8OA 3ZSRA 2W04A 5B0DA 3D2FB 3JYTA 1RT1B 1WSIA 4IQUA 4FOIA 1FA0A 3PIOQ 3I56N 3OYIA 1U47A 1KW4A 2AGQA 4PL7A 4CF0A 4B08A 5CAAA 2VPXB 4B1WB 3NTUA 1IKXB 1W0HA 3DM2A 3LZJA 5L1IA 1RAJA 5I42A 2G1HA 3PTWA 1PZNA 1VBYA 3CP8A 1T0TV 2DH9A 4J9NA 4O4GB 5AQTA 2JEJA 2AT1B 1A77A 2A10A 3N6LA 2YQ0A 3HCXA 2HBKA 2DWQA 3GU0A 5DBCA 1WSRA 1IQZA 2MZ1A 5J2IA 2A40A 3SEIA 1ZQBA 3EZ5A 1HWKA 4IFVB 3TUIC 1JLAB 3LQVA 1L3VA 4ZS6A 2BCRA 5A8WB 3AO3A 4AL6A 3GR0A 4NV0A 3ZXWA 1TUWA 3WHIA 2P8IA 2NYHA 2G5HB 2QARB 1I6JA 4BACA 3LGMA 4CH7A 4KPYA 2OH2A 1MQ2A 3ZT4A 2I9SA 5EE0A 8ICJA 3UCUP 4LJMA 3ZZPA 1N8RO 1UVMA 4JI7J 4I1TA 2OZMA 2YJEA 3D6FB 4DX6A 4DOBA 3H2LA 4BY9C 5D3GB 4CJSA 2HF3A 5HJYA 3CJ1A 4KHQA 3I76A 3VAIA 4X62K 2RHFA 3CIZA 3CD0A 5EWEA 4UUWA 2E20A 3CULA 4M42A 3AVGA 4LVOP 3ZX0A 2B4PA 1EQ0A 3J7AP 3V72A 3DDIA 2O8CA 3D6RA 1VBXA 4CJRA 3F73A 1T6DA 3UPFA 3VAFA 1PK1A 2V8HA 1CG2A 3H2UB 3MPUB 1RT6A 2MKKA 2J6TA 4JI0F 4USKA 4O5CA 3D6HB 1ZJNA 2HGNA 1B9FA 4DUZF 1XTZA 4ISGA 5BRDA 1JQGA 1E6VA 3G2XA 3RJMB 1X4EA 2H3VA 5L39A 5E0OA 1LWXA 1J5EK 1N88A 4QYRA 2UU9F 1LCUA 1BWFO 3H8SA 3CCVN 2LXUA 4O9MA 2F2AB 4B1ZA 4ITSA 3A13A 3QT8A 3BZQA 4LRDA 4DX8H 3L9ZA 4F26A 2M2BA 3E3XA 2B5JA 4OX7A 3OYFA 4QZBA 1HKCA 4FXVA 2UVWA 3SBGA 4FK0A 3BS5A 2DO4A 1VQKS 3O9QA 5D49A 3ET6B 4ZPDA 3HM8A 2XY5A 4ZTFA 4L8RB 3IC1A 1W97L 2ZH7A 1T44A 3M5RA 4DR7F 2FF6A 3DDKA 4OHYA 2ZBQA 4QU7A 3WQPA 3P31A 5AQMA 2F77X 3V4IB 4DHVA 4AF1A 4I2IA 2OTJN 1P9YA 2M88A 3N79A 8ICOA 1RT3B 3AQPA 2DPJA 2ZIVB 1NRKA 2GQQA 2IRUA 2IOHA 4ELTA 2ZKUA 4EO6A 3FMBA 3QEIA 3HJVA 3N97B 1KN5A 2OEKA 3ZD9A 1N36F 4Z7YA 3QICA 5HI7A 4LR8A 5ALTA 2MQMA 3HILA 4I4BA 1RT7A 3M05A 4X64F 3KK1B 1GTEA 4ED3A 2A3VA 3PO4A 1P8ZA 5GAEU 1IWAA 3ISND 1HNXF 4WTYA 4BRCA 3WK8A 3MEGA 4Y28C 4CGIA 3VCBA 3VERA 2QK9A 2GIQA 2NSCA 2FSJA 3T79A 1DLOB 2H3GX 2WC9A 4Y2MA 2F8EX 3I4HX 5K14A 3F41A 3OYJA 4RNOA 3MCAB 1GLJO 1VFJA 5KFVA 5M1PA 3QRRA 1N63A 1OO0B 2XGQA 3PFOA 4C4SA 2R3VA 3T7ZA 3DRYA 3HBTA 3ET6A 4O0JA 4NLVA 3MAHA 1ZQUA 3RJJA 2ZJRQ 5BN9A 3BN4A 1S59A 3HZEA 1R8CA 4AFFA 2J9EA 4A8WA 3TU5A 4J37A 3ZDAA 1WSHA 4HHTA 2JLEA 1E6YA 1F9EB 1HQ2A 1U1KA 1DTQB 2V8PA 4H0YB 3AOBA 2XZTB 3V6DB 2O6KA 2UXBF 3P83D 1HBUB 2HRTA 4NA2A 4KAIA 5KT2A 3C6TA 2ABYA 9ICSA 2A18A 3DRSA 1NI3A 5IQ6A 4LRBA 3U7JA 2RT3A 1NJIT 4Y2IA 4Z4EA 4E7KA 1N5TA 2W42A 4B17A 4NLWA 2ZUBA 1WDDA 1NM2A 4CJUA 3KK2A 4U67L 2W9BB 5AQYA 5F8MA 3PY8A 2C2MB 2J4RA 2VZ9A 2ZH2A 1C4AA 1RB0A 2OUGA 3SUOA 2EKYA 4WFAQ 2F8HA 2RU3A 3NS5A 3BSNA 4K8XA 4C48A 1CZ9A 2E5GA 1QQMA 2B51A 4KC5A 2DGXA 4BDYA 2BXJA 1RDUA 3DRRA 4P7TA 4DMNA 3ALRA 3DLEA 3O9SA 1WLJA 1FNXH 2YTUA 1XS9D 3M8PA 3PJWA 2ZQBA 1HYVA 1S6OA 3IR7B 1ZXIA 4KHSA 4ISEA 3Q24A 3W8PA 2GGPA 2QN6B 3KD1E 3GOIA 3B8HA 4QYZJ 4K4ZA 4FWMA 2RQ4A 5T14A 3EM1A 4KRFA 2YH1A 2DKXA 3HT0A 1NSAA 3T69A 1U8WA 3QEXA 2O8FB 4ZJLA 1B0TA 1RU1A 4I2EA 1GLFO 2VQFF 2MQ8A 3JSRA 2BV3A 3T1HF 2Q0ZX 5EXWA 3C19A 3RAQA 3KK1A 4WKRA 3CD6S 2NV3A 2D3O1 2YV0X 2K2PA 5F0UA 4LFCJ 4JAXA 5ALDA 3THYB 3SDEB 5HQMA 4JI7F 4FYXB 3RUBL 4USIA 3ZT2A 5GADI 4RKUC 5C25B 5KFDA 3IBFB 2HOEA 2BABA 1NHVA 4Q44A 2IJRA 3MR5A 1U1MA 1T9VA 2ESEA 4I67A 1UW4A 1WOSA 1ZM4A 3FQLA 4BVOA 3NGDA 5IIIA 3TADC 2ERRA 4PKIA 3OW2M 3BR8A 3SMPA 1MQ3A 2Y1LB 2KEYA 1MN8A 3DHWC 3PX4A 5SZTA 4NM2A 4CEFA 1ASWA 1ZA2B 1RGIA 2EANA 1GMWA 5E7OB 3SI8A 1C1AA 2BDPA 2LI6A 4Q8FA 3AVBA 3VGLA 2DRDA 4ZLLA 4DPOA 4LRCA 3PJXA 4M3YA 1N5YB 1VLBA 1LFWA 2V4JB 4PHDA 2BE9B 4AHTA 3EDQB 5D4BA 1ZQCA 2W8LA 4RBTA 2R8GA 2NRVA 4EFAC 2ZH4A 3EEQA 4KH1B 4MHVA 2K8AA 4NZ0A 3N4WA 4JI4J 4DU3A 2G2YA 1ZD2P 4DPWA 1XR6A 2A41A 3RMAA 2NXUA 4RW6B 5EE1A 4BREA 2VB6A 3NVVA 3LDQA 3NP5A 1GLDG 3BM7A 2ASPA 3SMZA 1EXNA 4AXIA 1RNHA 3HHLC 2X3DA 2AP6A 4B3SJ 1B22A 3WEEA 1VBKA 4DV7J 3C65A 4EP4A 3EXYA 2VC1A 3DN9A 1NMEB 2YVSA 5F9LA 8ATCB 5EN1A 1RGVA 3F9MA 1OY9A 3BGOP 3M4XA 4IRCA 3OYCA 2WTFA 3A5LC 1HQEB 3ISCA 3MMBA 3O3LA 5AQKA 4LZDA 3VETA 3HHLA 1NM1A 3NHGA 1MNEA 2DR9A 3NASA 2Q1LA 2Q2RA 2PFOA 4M5MA 1CJTA 3Q8MA 1IBMF 1K1QA 5ETQA 2DR8A 4JV5K 2E3TA 1UKUA 3DXBA 2EK1A 5FDLB 2XHBA 3Q8YA 1NB7A 7ICUA 2QA4S 1X6JA 2YNIB 3OVBA 3KIOA 1FXRA 3MN7A 3WXIA 4WE1A 3BJYA 2P9IB 3J81O 3AY0A 3KLIA 3C7NB 3EYZA 1Q4RA 1RZTA 1UJ5A 5F3ZA 3KXDA 1YVNA 2XHWA 2JJ4D 1MU2B 2WF7A 2X78A 1T9UA 5ETRA 4WXOA 2LFVA 2YWHA 2N82B 3U1MA 3TJ9A 1ZM9A 1ASVA 1NJYA 2CG8A 1DQ9A 3NVZA 2GOLA 5B08A 1Y4ZB 5DKWA 3LP0A 2UUCK 3EUNA 3CO0P 1NK4A 4I2BA 1XU4A 2HNYB 4O4GA 4DZ6A 2CIMA 3SQ1A 2W4PA 2M8HA 4F72A 1RWKB 1U4BA 3GPAA 3NE6A 4FL9A 2CDRB 4GC6A 7ICTA 5AQUA 3CMES 2JNJA 2N7YA 4URQU 4P2XA 4C0BA 1ITGA 3AA2A 3PXGa 2QA1A 5F8IA 1TYQA 3FYHA 4FJXA 2RJZA 2DITA 1WG4A 1TKXB 2PDAA 1S1UA 2KG5A 3BS7A 2OPSB 1PGZA 4M3RA 1SH2A 4X2BA 5J2NB 2RILA 1Q8LA 2ZUDA 4TQRA 3WK9A 1F5BA 2Z4PA 3LAKA 4MYUA 4KR0B 1XHXA 5BPLA 5F0WA 2XCAA 2DNRA 4CEDA 5BOLA 1V38A 8ICCA 4CJ3A 2H65B 1J27A 2R2SA 4TY9A 2WZ1A 1R0BG 4HL9A 5C10A 1U0SA 3R5JB 1I51B 3QT5A 1ZH5A 2KLAA 1ATSA 2VIXA 1N33K 2WFAA 4DR4F 4PZOA 2OI2A 3DFEA 9ICIA 4GMJB 3TAEA 2CNKB 1ZQIA 1X4CA 1YSJA 2Z7JA 4LVSA 3NDKA 4PG4A 4DTPA 4YP3A 1WSVA 2XC9A 1NZAA 1O03A 3DRXA 3CB4A 2XSJA 4Z7CA 3KZBA 3AVIA 4KRWA 4C0ZA 1L7MA 2HBJA 4P0PA 4LF4K 3AVJA 1U1OA 1KLMB 2ZKTA 4F92B 2HLTA 4B6JA 1F0XA 3OJUA 4KY3A 1RQNA 2GV9A 2YWGA 2RE2A 1PYTA 4ZVSB 1LW0A 3LWLA 4KPCA 4JI0J 3TJAA 2EBEA 1YJWS 3TJ8A 3HOTA 1RACB 3C66A 4YMOA 5ALYA 2JRSA 9ICJA 4OI1A 4NLYA 4KKOA 3F2BA 1GMWD 1NH8A 3H20A 3HSCA 1DTTB 3SUQA 5KFNA 4IJNA 4BR7A 2AEJA 4B3RF 4CZHA 3CCMN 5KG0A 3I8DA 1L5UA 5LSLA 3C15B 2A0FB 3BH6B 2ZH1A 3AA9A 2NPFA 2DNMA 1QAJA 4IQMA 3TX8A 4ES3A 4MJKA 1RDCA 3D9BA 5JLHA 1T3QA 1VQLN 3OYBA 4JI3F 4DTOA 3OS1A 4LFCK 1HNXK 1UPPA 1GLEG 2LVWA 3AJDA 1W2BR 2G0AA 3UE2A 1FFWB 4CHOA 4DZDA 3D7SB 4CEQA 4J9UE 3B4MA 4NXNJ 5IT0A 2QWPA 3JTNA 2AA4A 4F5QA 2OTLS 4OV1A 3UN2A 2WB4A 3FNNA 4HH0A 3GZFA 1KR4A 1NLKL 1VQ6N 2BJ8A 3ZNJ1 3KVGA 1UVKA 2W24A 4QBUA 2D1KA 4RW9B 2O8CB 1GOCA 2QSWA 5JU5A 4NLQA 4V19X 1NU4A 4B3MJ 2GQ2A 2HQ3A 2FVRA 1HNWK 4BRLA 3MGHA 3O4QA 1SQEA 3OLAA 3O3HA 3ILIA 1OSCA 1X4AA 2FY8A 1JKHA 3L6QA 3W64A 1UJ6A 4OX9F 1W7AA 3CCLN 3KWMA 3OS0A 4WF9Q 2RD5C 4LQ9A 1WN7A 4HACB 4YB5A 5B0BA 2IBOA 2LEPA 2FGOA 3F5AA 4F9OA 3AD7C 3MM6B 1XNSA 3IWXA 4Z37A 1GO3F 3I6PA 4EWTA 3AEVA 3E1YA 4H0TB 2Y0BB 4PWDB 4J2DA 2C3MA 2XS2A 2QGFB 3TX0A 2OMOA 1JXLA 8ICNA 2YKOA 2Y1IA 3SD7A 1LWFB 4RLEA 3ZX2A 2D3ZA 4OJOA 1C20A 3VCDA 4CLPA 1FK9B 5A76A 3H4BA 3H5SA 1BPYA 3CJKB 4DR6J 4WQ5A 1YBAA 4M5JA 2DK2A 4Z4GA 1A6LA 4CEAA 1BA1A 3CJ8A 4LR9A 3TTDA 5BREA 4KHYA 1HBNB 2G06A 5A8KA 4F71A 2PFQA 2WVDA 5B7WA 3BPDA 2R8IA 4BCAA 3HJEA 1LNQA 4JD2B 5KG1A 5AQXA 1IR1A 2G8IA 2W2NP 2RQKA 4ZHRA 2VFRA 3GBTA 2HHWA 2WCXA 1V9PA 1AUDA 5AQZA 1KQKA 3WDOA 1UT5A 1LWCA 5EX3A 3Q8RB 4XDDA 4IFVA 2F7VA 1FDNA 2M9NA 4BE0A 4CT9A 4AHUA 1SIZA 3G8QA 3KDOA 2MKHA 2HRYA 1O8BA 1ASUA 1NGFA 1LWEB 1Q7YT 2UV8A 1CS4A 4NX9A 1ZTTA 5J2NA 1Q16B 4RNMA 1K1SA 2ZIWB 1F3VA 2YWEA 1WACA 1LK7A 2OIHA 4JKHA 4JI4K 4P2MA 5A6PA 3CPWM 4CT8A 1WWVA 1DXSA 2Z8QA 4BGDA 1PJ5A 2O8DB 2FMQA 5C2GA 1FT8A 5C42B 1S0VA 1NGEA 1OIAA 3V9WA 2J8SA 5CXTA 3CJQA 4U9RA 1IBKF 1URRA 1MW7A 5M1NA 4DUZJ 2FI1A 1IBLK 3HFZB 3PR4A 5K5MA 1QUVA 1W7WA 2GEMA 1NNEA 2N4CA 4OLPA 1RDRA 3UMBA 2A2CA 3CFRA 4TURA 3MDCA 4ZDNA 4UB2A 2V7YA 4PPZA 2P9KB 4NXMK 5AT1B 4LSNA 5AM2A 4Q43A 2BCVA 3KOAA 4DF8A 3QUCA 1MROB 4CO4A 2V8VA 3CDBA 3B8AX 2ZM6F 5J0OA 3VHQA 2ZTEA 1I39A 4KLQA 2VFUA 5JS1A 1VQ9S 4M63C 1UTAA 4XTTA 3V6JA 5BYRA 3E2EA 3UKRB 4F4KA 1U2CA 3C46A 2QZ8A 3FRYA 3IM9A 3TVYA 4KB0A 5BYQA 3ONNA 2OPQB 1KXPA 1HNZJ 2FPLA 3D2SA 1JCFA 4EI2A 1ZM2A 5D78A 4DV3F 2Z1JA 1I94K 3R9PA 2XMJA 2ZOFA 4QCLA 3GSDA 1SKUB 3LF0A 3TAFA 3C29A 4GY2B 1KAZA 1ZD4A 4I2DA 3GFZA 5DDYA 4BE2A 1BGXT 1N61A 3GYXB 4B9TA 1TAMA 2PE8A 3LDAA 2EPIA 1NGIA 1SJQA 2KVIA 4LQ3A 1M1GA 3PX6A 3DLLL 1FRIA 2HQIA 2W54A 2CQGA 5GAEP 2ZM6K 1S48A 4HLBA 3VWSA 2V0NA 4XH4A 1X8DA 5KI6A 4BC5A 3UDEA 3J81Y 3BZCA 2MY7A 1RDBA 4FZLA 1ZQMA 5AI8A 2ROGA 1VS3A 1T03B 2Q3PA 1RCHA 3O5BA 4FLTA 2PBDA 2D8CA 1ZQVA 1R31A 4MLHA 4C9DA 3OUYB 3SEOA 1R8BA 5IWAJ 1MA9B 4NCGA 1NGCA 1X9XA 2LKZA 1VSIA 4ZPWR 4O3SA 2N7CA 2HZAA 4OPHA 4Z6DA 4HT5A 4NXNF 4YY3K 8ICXA 2FHOB 3T9NA 3L3CA 4E7IA 3LVVA 3ADAC 3KKAA 1L7NA 3UDCA 3MECA 3CMAN 3FCHA 3HW8A 1FEEA 2NXJA 4DQPA 2B8PA 4EMDA 3A5MC 4RW6A 1VCTA 1TVAA 2WBRA 4Z0UA 4LUBA 3WNHA 3N6MA 3DM2B 1VSLA 1N2XA 3UWTA 3MOZA 5AK3A 2FC9A 8ICEA 2KZZA 2YPYA 4MFAA 1Q7YO 1M5PC 4I2CA 2XI2A 2E2NA 4FBTA 2YNGA 3HM9A 4KN4A 2PA8D 3CWJA 3KLFA 3F5EA 2DHGA 1HYZA 4GV6A 2Z1HA 2M0GB 3EVWA 3MX5A 1WCLA 3NKYA 3EVOA 1D1UA 3PLAA 2UUBF 3VQSA 1ZQKA 1U8SA 1N52B 4DG1A 4I6WA 2FHJA 4F36A 5GAHP 4DR6F 4Y2AA 4L3QA 1OH7A 3I5AA 4ZVFA 4OMFG 1WEZA 3HSZA 2KHQA 4C8OA 1NMDA 1EB0A 3CI5A 4Y2YA 1OY8A 4HVZA 3M6KA 4CLKA 3M7DA 1X5SA 2IVPA 4DFJA 2D9OA 3O9UA 1VQ4S 2E2OA 4EU0A 2DGZA 3WXMB 1F21A 2MGZB 2QL7B 2FMPA 1UQVA 2IVYA 2R8JA 3D2QA 1HBOA 4OYXA 3QESA 3JSYA 3ZETB 3NOCA 4DJBA 1HJPA 4FNHA 2O8BB 2GMLA 4NEYA 4NLXA 5ALHA 3JPNA 5ALWA 4ECTA 1FKOA 2WK4A 2HVEA 4XK8C 4QWDA 2BJDA 1SJ1A 5BR8F 4BG8A 1N34K 4PL1A 3THVA 1HKAA 3NF6A 1DZ5A 4FKXA 4I2PB 4YB6A 2Z2ZA 5AFUH 2KJ5A 1ZA1B 3KFWX 4YQWA 7ICKA 2ATLA 3L09A 1JJHA 4U8VA 4DSEA 1C0UA 4FNIA 3W63A 1SL1A 2ADCA 4B3MK 3BF4A 3OJSA 1TAQA 4ZCMA 5I4MA 4DR4J 1K8AO 4MYTA 4MLEA 3O1BA 2V2QA 2GCFA 2QARA 2CPXA 4FLZA 2ZC3A 5GMEA 4Z6EA 1JJCB 1XSLA 2NPIA 3KD3A 4JYAJ 2KXHA 3CD6N 1YQHA 3IP4B 3UCGA 3P5JA 3MMVA 1XN9A 2KM8B 3HVTB 5GIOA 5CB1A 4NL5A 4KGVB 5DB9A 4US9A 4TYAA 1RLDA 5AXKA 3GLJA 1F5SA 1J5OB 5F3XB 3M8SA 2ZD1B 8ICLA 3CUNA 2J0XA 3OYDA 2HF4A 2O4IA 1RHUB 3M8QB 4X4SA 2E7VA 4DR7J 4BR9A 1V4SA 2DXFA 5LY3A 3QLHB 2GAGC 1BVSA 3R7NB 4JMUA 4FXDA 3R6LB 4M7YA 3NRWA 4PKDB 3SMSA 4Y65A 4DI6A 3KLFB 4IOAL 2HNYA 1C1CB 4DV3K 3MPDA 2V6AA 4FYVB 1HYSB 1HYSA 2KHOA 1VDVA 1SL0A 5K8NA 4PKGA 1BWVA 1CULB 1KAYA 1VQ6S 3H42A 8AT1B 2E9ZA 3AAPA 3CNHA 4DB3A 4B02A 3M2VA 2KH9A 1GMVA 2H5XA 3L5KA 4US8A 1VSKA 3S6JA 2V8GA 2MKYA 1RM6C 1LOTB 3DI6B 2XMAA 1RTHA 1HUZA 4CFCA 4LC9B 2VPWB 4PG7A 3NBPA 5KG3A 1E3MA 4I7FB 4ZITA 3TNVA 1UA0A 1AFIA 4NCBA 2GW8A 4LF4F 3UKUB 4C4TA 3CPEA 8ICRA 2ZD1A 1S1XA 2WTUA 1Q8BA 4I69A 4NRUA 4HVJA 1X3NA 4M3TA 4M3ZA 1YHQS 5J0RA 1BO5O 1AA1B 4LF5F 3ZI4A 4J9MA 4FVCA 4OZLA 3FJ2A 5E3PA 5HRNA 2MQLA 2VGMA 2C2ZB 3LK9A 2W3SA 4CLLA 1E4FT 4YB7A 1S12A 4H0VB 3A0IX 3FLCO 2ASOA 4HWIA 2YX1A 2CH5A 2IM1A 4JS4A 3SAGA 2PFFB 1NGAA 2HNZA 1AB8A 2GO9A 2A1RA 4BWJA 3P38A 4JKFA 3GMGA 5HHIA 1WJ9A 2QFIA 2DCUB 3NY0A 1G99A 4CGJA 4P0QA 4GKKF 3ENBA 1Z4NA 2IVNA 3NXZA 3V6HA 1WBBA 5F9NA 3HPOA 1JLBA 2M5YA 1YJUA 2CZ4A 1N5VA 3PSPA 2CQCA 1TVRB 2W8KA 4OYOA 4WK3A 5KFBA 3RBEA 4FF2A 4ECWA 5C0YA 2JXJA 1WC6A 2IMOA 3D1QA 3DKDA 1SKWA 2KG0A 1WORA 2G0JA 1QZ5A 4K8ZA 2VOOA 1ZQRA 4FSVA 3CCTA 2C1EB 1RBTA 4QZ9A 1OSDA 2ZIUB 2KSOA 4OI0A 4AE5A 4IR9A 4L3KA 3TAPA 1RAGB 1YJ9N 4WU2A 3LP2A 1KEKA 3UCZP 1N48A 1EWRA 1WOOA 1U45A 2GC8A 4ZVRB 2D0BA 4CIGA 1CJVA 2F9DA 3K2PA 3KKAC 1S6PA 6FDRA 3BY5A 3I9V9 1RILA 4QS7A 3I0RB 2JFDA 1FXXA 2KICA 4XPEA 3GG0A 3ZDDA 4BRQA 1JJ2R 3FSIA 3MM8B 3ISBA 3G82B 1S77D 5ALEA 4YOXA 4YN3B 2VJ4A 4MT1A 1OVYA 4PGQA 1HW9A 2GJIA 2FLPA 1I3OB 2WF8A 2P9UA 1YJTA 2W01A 1R59O 1ZQLA 3HSDA 2FJ6A 2GUPA 4BRHA 1ZBFA 1EKEA 1HHQA 4OJPA 3W1YC 3JPTA 1X9SA 1BHNA 5GADP 3OFHA 3NLCA 1R27B 2ACYA 4DKWA 1J2MA 1SV5B 2E9TA 2CFXA 2Q4TA 1WKJA 3KLEA 3VAKA 2XY6A 4JKBA 3EGVA 2AYMA 1S7IA 3CF5Q 3U1NA 3ASMA 5BJRA 3TQEA 2EK6A 2QEXN 4CZJA 3SQOP 4OYBA 3AU2A 4U6PA 3CCQN 1HD1A 2B21A 3A3PB 5AQOA 2J8AA 4PR6A 7ICPA 1JLEA 1TL1A 1IKXA 3L0QA 4KKOB 4ZH4A 2LLZA 2NYIA 3TYTA 2R4FA 3MMCB 4I27A 5DG8A 5J1EB 4IQVA 4I9LA 4M95A 4FVMA 3UD4P 2DNLA 5G5GA 4ZVTB 3VPZA 1VQ5N 3LWMA 5KFEA 4CEBA 4LR7A 1XC9A 4DV0J 2HVHA 4FLWA 2RUGA 3AA4A 1G1XA 4K4GA 2VD3A 2OKQA 2JEFA 3SQGB 3N5BA 3KHHA 4P0PB 5HBMB 3QJJA 4GO5X 4A8MP 3BQTA 4LBHA 2IDLA 5AQHA 3MM7A 3TZZA 4PG5A 4MEYA 3ZZUA 4ED1A 3QO9B 1WBDA 2CQ4A 5EWFA 2R7WA 1RBAA 1PO6A 2I6WA 1RT1A 2VFSA 3L2UA 1PAUB 5AM3A 3FZFA 3GILA 1WEYA 3CDAA 4JUZA 3RH4A 1K0TA 1VSHA 2HHQA 3M9MB 3NVWA 3O8MA 4ECXA 3TUZC 4JI2J 4OFZA 2E2PA 2NR0A 4F04B 2KNJA 1YXQA 1C0GA 1XQSC 5BYSA 3RBZA 1UW9A 2COLA 2ISPA 1EP4B 2VWKA 2RF2A 4DOAA 5DDRC 1ZQOA 5IINA 3KLIB 4J5OA 2GELA 3C94A 2N4DA 2KM8C 4DQIA 2XNRA 1LVHA 2W2PP 9ICLA 4FS2A 3NS1A 5LSRA 2JWLA 4Y2VA 2LCWA 2EWSA 4DU8A 3AY9A 2FXUA 3ORYA 4B9VA 3CO9A 3SAHA 1G3OA 4DV4F 5AKZA 3M8WA 3G9CA 3C3LA 4NLSA 1UHUA 4CNZA 7ICMA 2YKPA 2CG4A 1XMOF 4JWMA 1IV0A 5CYMA 2XG8A 1Q78A 1U7LA 2D6FC 2CQHA 4QZFA 2H9ZA 2VBYA 2ZNYA 4RW4B 1P27B 5AQGA 1NK9A 2MJUA 1Z00A 5DQHA 4EBEA 2DXEA 2FQQB 4Y3CA 1MU2A 3IXQA 3C5GA 5MLCV 4AM6A 5AZIA 3O5TB 4BGAA 3HPGA 2C3UA 2VU5A 1CBKA 2F4VK 1APSA 4OYAA 1TK5A 4O44A 4I28A 2JZ5A 2G8VA 1X60A 5JICA 3VALA 3QRQA 4QWAA 1HPMA 2V69A 2A6MA 3MBYA 4IKAA 2YJFA 2HQFA 2BW2A 3A4TA 5KT4A 4XA5A 4BC9A 2L41A 3HI9A 4CJTA 3Q7CA 4JI5K 4ZIWA 2NLWA 2RRDA 2DGUA 4ILRA 1IG9A 1ZBTA 4A8QA 2BE2A 4KV8B 3QT6A 2JH3A 2VQEF 1ZYQA 2AX0A 1HX1A 4J9SA 2MZSA 2D9PA 4OYWA 3TPQA 4B9LA 3ULDA 2HOFA 1HNIB 3MXIA 4TQSA 3MXHP 2K3IA 4FDFA 4LF6F 4NYFA 1TGOA 4IYQA 4DU7A 9ICXA 2MZTA 4F4ZA 2YPZA 3DC2A 3POTB 2VUGA 3SFGA 3OFGA 3H8MA 4CH1A 1F5CA 3IO1A 3F2KA 3D54A 5AXMA 1RBLA 4G9ZA 2CJAA 3PR5B 5I3QA 1NKEA 2EZXA 2GJ2A 2R8KA 3C6AA 3I8BA 1X42A 2C2KB 1CJUB 4CIOA 1ZM3A 1QY7A 3SPZA 1DEJA 2BJEA 8ICTA 4YD1A 1Z00B 6FD1A 2MKSA 5F41A 3JPRA 2FVQA 3RH5A 3V7JA 1F2HA 3C14A 3G96A 2MZQA 2VDHA 1MC8A 4CF4A 4IO9L 4FZVA 1PK1B 1TZ0A 2B7BB 2R2UA 3VA3A 4RUCA 2I7PA 4CO0A 4ILJA 1D8LA 4IRDA 4NLDA 1YJVA 3LYSA 1KTQA 2BE2B 1NDLA 3TQ1A 3K5LA 1FRHA 4FYYB 2RHSB 4R5PB 4PQUB 3MC1A 4K4IA 2O67A 2DL0A 3CCVS 4C97A 4QS9A 3G71S 2R7SA 3ULEB 2AD9A 4NYZA 2BBEA 4YXJA 3D68A 1NGGA 3M8QA 2HMPA 1Y00A 4UF4A 1H72C 4H4KA 3FZMA 1ACMB 3VGVA 3JTPA 2WW8A 2IM3A 4DEZA 5HHHA 4PWWA 3ZO7A 2AYEA 4BQLA 5AQFA 1V3SA 1UPMB 1NK0A 4H5VA 1FX4A 4KGKA 2Y3YA 4QZHA 3PYEA 4B3MF 2QB0A 2FPKA 4M5DA 1NWKA 3TTCA 4R63A 8ICPA 4H4OB 1HLWA 4KHMA 2PIIA 4PYDA 3AARA 2CH6A 2DNOA 3ZD8A 3UN5A 3BP8A 4MKYA 1L7OA 2EH9A 3IS9B 8ICFA 4NY8A 3GL1A 2KKVA 5KG2A 4B9SA 1FRXA 1PILA 4QS8A 1L3KA 2OFGX 3U9DA 4QZVB 4CJ7A 3UB5A 3UVJB 4OX9K 3K5OA 4IG3A 1GXUA 2Q0RA 1P90A 2ZFHA 2D74B 1KFSA 2Q97A 4DUYK 3ZSOA 4EENA 5BPNA 3M6ZA 2FHJD 3QU9A 4LSNB 4WFBL 3I9ZA 3I96A 3I0SB 2UUWA 1RWPB 3DOKA 4JI5J 3EPIA 2JRZA 4CFAA 5CCLA 5DDQC 4PPXA 2IHR1 4GXKA 1N56A 3RAXA 1U1QA 7ICVA 2Q31A 2XRIA 3U3YA 3IDHA 2WUSA 1H2TZ 2FGCA 3RSEB 1HBMB 3R8YA 4HCBA 1WI6A 8ICGA 5C12A 2ZJ5A 3OTOK 5H9FK 3PRVA 1U1RA 2MGZA 4EZ6A 4L76A 3ATVA 4TUQA 4P75A 3SI6A 1JLAA 5FD1A 1PC5A 3NGSA 2ZGZA 1EP4A 3VVTA 1C0TB 1JNRB 1IR2A 1YI2N 2XVTA 4QZDA 3KK7A 2RB7A 4ZPTR 4EUVA 1WTFA 3RWUA 2ZDOA 3G82A 7ICHA 1FEZA 1L7PA 1OKJA 1A7GE 3CXCR 4I6YA 1X66A 5AQPA 2FSKA 2E5IA 2I38A 1TFRA 4FZXC 2AJFE 1YWXA 1VRUB 4MO4A 1X31C 1DQAA 2K1RB 1RKIA 2ES6A 5A0LA 1D8ZA 1CRXA 3MR2A 4W5OA 5EHHA 2BCUA 4IKFA 1CEZA 4GKJK 1CJVB 5CA5A 3N28A 3PNIA 5ETSA 4IG0A 5LT5A 2DGWA 1Q18A 3R5AA 3JYTB 1NKBA 2POKA 2ZITA 3NGYA 2ZH6A 4DLGA 2VDIA 3MR7A 4QIEA 4RWXA 4WIIA 4B3OA 3HKZF 4KE5A 2AGOA 2PZSA 1TMMA 1NBEB 4FN5A 4QIWC 2VOPA 3EZWA 3SZ2A 3MI7X 2PMZF 2J9DA 2UUAK 2EZZA 3QT7A 5ALMA 3OHBA 1RWNB 3U26A 2VBZA 1XMQJ 4ERDA 1Y5IB 3GCWP 2RDDA 3QE9Y 3BO4A 2ZJ8A 1AZSB 1Q95G 2W2OP 2QB0B 2ZZMA 4AP9A 4NWIA 3NGKA 3MDQA 1KDNA 2DNYA 2KFNA 4M6WA 1RDWX 2RS8A 4K0KJ 2YHWA 1HI1A 3ZTQA 4FF3A 2Y9UA 4UW2A 4LY7A 4DR5K 4DL0C 2O5DA 2HHHK 1JXEA 4FFDA 5ITHA 5HANA 1FDAA 2W43A 4M3XA 1IN0A 4TYBA 4F4WA 3V4IA 1ZBHA 3OR1A 4P4MA 3ZT1A 2QYCA 2NUBA 1KBRA 3JQKA 1C0MA 1NJIO 3M8PB 5M2RA 4OJHA 3FC4A 4OKJA 4J03A 2XEXA 1M5OC 1JJ4A 5KL8B 4Z4IA 4X4QA 3CJ4A 1T02A 2XBPA 4YDUC 4U7UD 4TY8B 3OYHA 1XMOK 2W6KA 3RJEA 4TU9A 4R25A 2KRRA 5L46A 2NRHA 4USJC 4ILHA 5KQ8A 4FJNA 2HQGA 3TW0A 1BCOA 2BW7A 2Z2MA 3RG6A 4WWSA 2WAQD 3VR1A 2F44A 4MN4C 5D0EA 4J9LA 2YI1A 2OTLN 2HGLA 2KP7A 3E01B 2A1JA 3LDSA 4JP8A 1RCXB 5D8HB 2M4MA 1FF2A 5BRHA 1BPZA 4F67A 1S6PB 2HS3A 2DIUA 5B5EU 1UWAA 4W98A 3ISNC 1S4EA 4LFAF 1C1BB 4MIWA 1OY6A 3QMLA 3W3DA 5C15A 1BNPA 9ICPA 3HP6A 2BOPA 3GIKA 3NCQA 2HVZA 2K06A 1GLLO 2O8EA 1S0NA 3EKUA 5IZHA 1C1CA 2AYGA 3OFEA 2FZGB 3VAHA 3CD5A 5CY4A 3OTDA 1HUOA 3E66A 4IOCL 1LV5A 3DLBA 2KJVA 3M30A 5HQ8A 5BRFA 2C22A 1KTVA 2EEYA 4J7CA 2HNZB 4DN9A 4UY8O 2B6AB 4FBUA 1ZBIA 5F8GA 2A1SA 2F3NA 1JL2A 3OSPA 1PG5B 1YDLA 3D28A 2KKHA 4KLJA 4BRPA 2YX4A 2BKNA 3AQOA 4OZ5A 4P72A 4A61A 4O3OA 3NH1A 4NLTA 1S97A 2DY9A 1KVBA 1VHFA 3MEGB 1AQ6A 4LF2A 5FLXY 3TA0A 5HVGA 3D2NA 4L72B 2V94A 1T3VA 1O08A 1RYRA 2J7UA 5HP4A 2HB5A 3SDEA 4AHVA 1CPZA 3CXCM 5HRRA 3V2UC 4PZNA 4B1VA 1KQFB 3JAMY 2VG5A 4I7FA 1CUKA 5CHIA 3VV2B 4RQ3A 3GE1A 3LUYA 3MN5A 4KFBB 1SZ2A 3U8XA 1N0VC 3ONQA 1FFUA 2LBOA 4OHWA 3G6XA 1EETA 4YOWA 3N7SC 1WF2A 1DTTA 2H3QA 4L6V3 4PRFA 3CRXA 2MRLA 2OEJA 2MSSA 2XLIA 1NJWA 4A48A 1IXRA 2MAXA 1NK6A 1OQ3A 2QLXA 2MB0B 4KMOB 3OHAA 4O8UA 3MM7B 2HKEA 4PKHA 1SWWA 1E4GT 3M8RA 5IOLA 1RDAA 4MQ3A 2PC6A 2ZGYA 1TFWA 5AICA 1KWMA 1GLBG 2YX7A 2RMLA 2DRBA 1L3UA 2ZOGA 4U67Q 4CGFA 3BGRA 5AXNA 1ZAVA 4DTNA 1HIWA 3PSIA 1IJFB 2HOIA 5E26A 4NM1A 5DLGA 3FAHA 3KJFB 4JRPA 4ZOHC 2V34A 2YY6A 4MIAA 4RT3A 4AUKA 4YG2A 1Z19A 3IFRA 2D5RA 4RW8A 2WW4A 2PN6A 3HHKA 4B3TF 5GAEI 4ZHRB 1OJ4A 1XSPA 9ICNA 3AODA 1A5WA 1RT7B 4BRMA 4CJLA 3QU7A 4JWNA 4O8KA 1GT8A 2FZCB 1CJTB 5CYQB 3FBCA 2KO1A 3BDPA 4WKYA 1HBNA 4DTXA 1ZBLA 2H1YA 1H1VA 2PFPA 1BCMA 2E6LA 4M9JA 5BN8A 3D3CJ 2ZJQL 3GSIA 2FJBB 5AZJA 3Q0AA 3T3FA 4ELVA 1EIYB 3TEGA 3JSMB 3N7PD 3D0PA 3WKDA 2FPMA 3C1ZA 1Q5VA 3IMQJ 3PIOL 3PYDA 3CCUN 3WEEB 4WCEL 1N36J 3E9LA 2C2EA 1S9EA 2FDRA 2VJUA 3GV8B 2HNDA 3UNYA 3W2VB 2VPYB 4FE3A 2MHNA 2V4RA 3HHLD 2JWNA 4DV7F 5ALNA 5LMUJ 3DYAA 3K9JA 1FE0A 1ZETA 2CZVC 3Q8QB 4KLDA 5ALLA 4PQAA 3FRZA 2ACMA 3UR0A 3G71N 1FVSA 2RE1A 3FEXB 4F8RA 2ZBRA 3AXMA 2OPRB 1JKHB 3MCMA 4X4OA 2GQCA 1YVFA 1T3OA 1HHTP 2PO4A 3CHWA 1SL2A 2HLUA 4FWSA 3PW2A 3W2WB 1KQSM 4F2SA 3H40A 3RMDA 3B0YA 4FWOA 1HPZA 4RW9A 3CCWA 4Y1CA 4JLHA 2OSRA 3UR3C 4LIWA 9ICFA 4ED0A 1KD1O 5HP1B 2CPIA 1LWCB 2OLWA 4LSZB 4S0MA 1I1GA 3OR1B 3L7PA 2E7WA 5J2DA 2XS5A 3HMJG 4AHSA 2WAQF 5AE1A 2V7ZA 1IBMK 4JB3A 3O9RA 3KKSA 1TL7B 4KGMA 3KD5E 1YK9A 2P5GA 2EAPA 4ER8A 3RGIA 2L5YA 5IIOA 1VQKN 3FFIA 1SXEA 3LW5C 1KQSR 1A6SA 2PSZA 2AGPA 1VDHA 2P9PA 2M52A 1UZHA 4Y0WA 4FJ7A 3G8TA 4IWVA 1ZOTA 2IIHA 4B9UA 5KFUA 4YDUA 2O3DA 1U02A 4CZGA 2ITGA 1SZHA 3FZKA 4LFAJ 4HTUA 3RF9A 1KFTA 1TTHB 2L3MA 4IUFA 1WF0A 2RHQB 8ICKA 4USWA 1P8GA 4HYKA 1WWUA 4LIRA 4KB7A 2MUTB 1ULRA 3EZUA 4O3QA 2LMRA 3SXLA 1YUWA 2ZHAA 2CWXA 1UAXA 2YHAA 3CJRA 4JEPA 2LYBA 2NRWA 3BBBA 4WZQA 3NGUA 1QCKA 3L3FX 2OP5A 3US5A 5IXUA 3T5JA 1NSQA 2P35A 2KT2A 3G6ES 2ZNZA 5HMZA 4J9KA 1ZC6A 4CZIA 4E7JA 3NVMA 4O5BA 4F4YA 2KQ2A 2AP1A 1BMQB 2MHEA 4OLBA 4C4RA 5TZVA 3KUGA 4IFEA 4NEZA 8ICBA 2WVCA 2P5OA 3O1WA 2EC0A 3OYNA 3H0MB 2BANA 5J0QA 4Q0BA 3J7YP 1JNZB 3H45C 3Q23A 1T6CA 3W2VA 2CRXA 5KFQA 4MTPA 2V50A 5CYJA 5HLFB 4CE9A 4HAIA 4AYBF 3DNCA 4NZ6A 2ODGA 4EFHA 4Z6CA 4FM1A 4GMKA 1IBKK 4F7VA 5K4LA 1S76D 3HD2A 2W1BA 3L2QA 3P8BB 4CYUA 1JXBA 4UASA 2KYZA 4N77A 4JI4F 4JI7K 2R8HA 3QXGA 1XNRK 5CCMA 4BBYA 3QX7A 2AKWB 2RF2B 5L9XA 4CM2A 2Q6CA 3J80U 1SH3A 4CHQA 2KMDA 4A46A 1CQMA 2VBWA 2ZHOA 4QR1A 2XMKA 2K4HA 2DH7A 3DYAB 3T1HK 1FRKA 5E3RA 7ICQA 3PUFA 4KX3A 5C5JA 3R5GA 3PHEA 1HKBA 4CEZA 4OI4A 1JX4A 2BJ1A 1CLQA 4ETZA 3WXLA 1H0HB 4WU3A 4ZCKA 2DKOB 5JJBA 4PHAA 2Q43A 5J2MB 1NZ8A 3CEDA 4M5GA 4DR3J 2H3FA 2KHCA 3QIPA 4JI1F 2XQCA 4AQYK 4HHHA 1RFQA 2ZVIA 4YUDA 2ZDPA 1FWPA 2JFKA 4U7UK 3KFUF 4C98A 3HXMA 3ZYYX 3V6KA 1KEJA 3ZSVA 3C7NA 3VENA 4GVLA 3RVCA 1X4GA 4CFDA 1T05B 2G5IB 4RJVA 1H2VZ 1VQNN 3BGLA 2I9GA 2YY3A 3V9SA 4Z2XA 4KREA 1Q46A 1ZBUA 3H0PA 2BCQA 3H1VX 2JH7A 1ZQHA 4NASA 2FJXA 1DLOA 3O9TA 2W25A 4GVBB 1OUQA 1BG3A 3FCVA 4BRFA 2QWNA 3K9KA 2DNQA 7ICSA 1RTDB 4PAAA 2BTFA 4LBIA 4FJKA 3ILLA 3PW0A 3RJKA 3HZGA 3KYLA 2UUTA 2UP1A 2WMMA 1S1VA 1BU6O 4ZVUB 2CJKA 4LF8J 2M0NA 3RSEA 3M1VB 3QEVA 3IP0A 1I3AA 4UOGA 4C80A 1HWJA 1VQ9N 1F0MA 1A0PA 2GHVC 3IM8A 1NK5A 2CJ9A 4C3KA 1RYSA 1TKXA 4GVMA 2QJ3A 3SV4A 3IG8A 3OHRA 2WVFA 1QSLA 4FLUA 1KVAA 5KFLA 2X6SA 4DTMA 3MN9A 5F2RA 1A5XA 5A0YA 3C1YA 1N33F 3NGTA 4OJRA 2GNKA 9ICQA 1MWQA 4ICLA 5E33A 5K14B 1KN6A 2AQ4A 1CJUA 3VQEA 2W3RA 1G7CB 4KQZA 3UI3A 5KFRA 3MFHA 1WNSA 3VEOA 5K9FA 3FKBA 3CMEN 4IOBA 1M5HA 5AM5A 2LDIA 4YMNA 1YITN 1V4TA 3E01A 8ICHA 3HZ6A 1RWXB 3DLGA 1NHUA 1XNQF 4UB3A 2ROEA 2O01C 3KNAA 4LF9K 3NG8A 3QNOA 5B8HA 1Z3EB 3FZHA 3UW1A 1VJ5A 4DSFA 3DCAA 4UAVA 3DXMA 4X65J 4CO1A 1HW8A 1LWFA 2IAJA 4ICLB 3C5FA 3A1YG 4QZAA 4KTQA 2P1JA 2WFBA 4K42A 1RJJA 3UFCX 5MLCQ 4OYZA 2IRXA 1L8OA 1YZ7A 2BZFA 5KT7A 1VSDA 3C2LA 1MWMA 3EGWB 1X4FA 4B3RK 1KLMA 3EWAA 5J1NA 3MM8A 1TMJA 1ZS6A 5KRSA 1KL9A 3WK7A 1FWLA 5B0EA 3L8BA 4FWQA 4JI2K 4LF1A 3VQQA 2QL9B 2R7TA 1KVCA 3K59A 4GRSA 1B64A 4R66A 2AJ0A 2HMXA 3H7HB 1P1LA 4RNFA 4NLZA 4YOYA 5H9EK 1W26A 1OQ6A 3LL3A 3P4UB 4M2YA 5E3QA 1J5EF 2FLLA 5CJ7A 3JPOA 2QWLA 1H7WA 4B3TK 2K4IA 3X1LB 1S10A 4RWTA 3HKZD 3GU3A 2VODA 3AD8C 5KFTA 2KD1A 2BQ3A 4UOCA 1VQSA 1EKRA 3LP3A 4UY85 1WOPA 4XIUA 2DTJA 4YNQA 1QJHA 1N8RT 1Q7LB 3TWHA 3J7A1 2XS7A 1ZRNA 2HYIB 3HK2A 1DBDA 2PI4A 4ZCIA 3OBWA 3SUPA 5ALFA 2HHHJ 2Q79A 5D4OA 3MPVA 1URNA 4J9QA 4OZJA 3BYPA 2PD1A 4C7QA 3GIMA 5HNKA 4E1NA 2P51A 1NDPA 2KKZA 5LXRA 4KHWA 3KLVA 1R43A 4QZGA 2GVDA 3PVXA 3P5TL 4CK2A 3NMRA 2B4VA 3KK3B 5HOOA 3U1LA 5TISU 2QW9A 4ECRA 3AA5X 1NO8A 2ZM6J 4CF8A 3W9HA 2Z1GA 1Y10A 1U1PA 2XSJB 2G4BA 5CD4A 4F02A 3WZ0A 4UB4A 2VG7B 4H4MB 3QUQA 3BDEA 3TWZA 2BZ2A 3KMQA 2X1FA 3L3VA 5DDPC 2O8DA 3ATUA 2D0AA 2HEKA 4C3MA 3R3LA 4FM2A 2N3OA 2RRAA 7AT1B 1SAZA 4NO7A 1Z1BA 1TL4A 2MQOA