4B9SA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion outside of the pre-insertion site.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9sA01
5KG4A 4KHNA 1R0AA 4FLXA 2YNIA 4GC6A 1MU2A 3HVTA 4R63A 7ICJA 3DI6A 3TANA 7ICEA 8ICCA 2HHQA 1XU4A 1WLJA 5DK5A 4NYNA 2AGOA 3NH0A 5DLFA 3U3GA 1UOCA 3SUNA 4CF2A 4I9LA 5D3GA 4KTZA 3KK2A 3RMDA 2I9GA 4RW9A 4IRKA 2G8VA 1BPEA 3SI8A 3OSPA 1BHLA 4I2CA 3LZJA 1QS4A 5CHGA 3Q8LA 1CXUA 3BDPA 2VG6A 1O1WA 3QNOA 3P5JA 4FZXC 7ICIA 4FM2A 4N41A 4KLIA 1RDDA 4CFBA 1WSEA 1ZYQA 3K5OA 1ZBUA 2ITGA 4RW8A 3DLKA 4CHPA 8ICYA 4G1QA 3L3UA 1SZPA 4CF0A 2QKKA 3TWHA 4DO9A 4CGDA 3VQ5A 1U9LA 4Z6EA 5HLFA 3PX0A 4CJ4A 3KD1E 4LH4A 3HPOA 2C22A 8ICRA 4AHVA 9ICWA 4B9UA 3CFPA 5SWMA 3MEEA 3C2KA 4RW7A 4DL4A 5KFGA 3KK3A 2MUTA 4N5SA 3HXMA 4M9GA 5IIOA 4LSNA 3HK2A 4O5BA 5KFOA 3ZT0A 4E1NA 3GIIA 4LH5A 3O3FA 3RRHA 3IM1A 3HVRA 4DTPA 3HPHA 2KTQA 3TAQA 3UQ0A 7ICPA 2YHAA 1WCNA 4F4YA 4H4OA 3OYAA 2BPCA 3V9ZA 1MC8A 4FXDA 4I29A 3SZ2A 3VQPA 5J2QA 2FLPA 1TV9A 3T5KA 1B43A 1NJWA 1NJZA 3NTUA 4ECXA 4DOAA 4TQSA 3OGUA 1ZQOA 5HRRA 4LD0A 4NLKA 5J0QA 4RQ0A 8ICWA 1XHXA 4O0JA 3OYJA 2B21A 4FJLA 4CF8A 8ICSA 5DQHA 4EYIB 5KFTA 4M9NA 2Q3SA 5CYMA 3MDCA 2QK9A 1NK8A 4CERA 1B92A 4B9NA 3SV4A 3MEDA 2BCQA 4C8MA 5J2GA 7ICKA 9ICEA 4O55A 4AHCA 1HYZA 5KFLA 1SV5A 4DL3A 4QZ9A 5KG1A 4FLWA 4B9MA 4Z6DA 3DRSA 3LP2A 1CZBA 3RTVA 5J0WA 5BPCA 2G8KA 3KLIA 4ZH4A 2ISOA 9ICBA 3RR8A 2IBKA 1RBRA 8ICAA 3WNGA 4O0IA 5KFNA 2IDOA 2ZUCA 4DQIA 1ZBIA 4OPKA 3PW7A 1ASUA 5JS1A 1I39A 4HHTA 3LDAA 2I1QA 4F4WA 1RT4A 4KLEA 4UAWA 2X74A 1TK5A 5DQIA 5EWEA 2ZJ8A 3G0ZA 1REVA 1KCFA 4O3SA 3QE9Y 2JEIA 1WSHA 1S0MA 3ZDBA 4CEBA 8ICQA 2VWJA 4CK2A 4R64A 4CJVA 3SI6A 4ECZA 3GDXA 4RU9A 4DEZA 3V7LA 1ZBFA 4TUPA 4IKFA 5KGXA 3O3HA 1NKBA 4KI6A 4IQTA 1KTQA 2R8IA 5L1LA 3KLGA 4ECSA 3TAEA 4XA5A 4CHNA 1X9MA 2HNZA 1BIUA 2W9BB 4IQUA 1S1XA 4W5RA 5IIJA 1LB2B 5KFXA 1CEZA 5KFAA 2D0AA 1CUKA 4QWDA 4M04A 4O3RA 3RBEA 1ZQYA 4M47A 1HPZA 3AO3A 4FLYA 4ELUA 1FK9A 3MXJA 3TI0A 4KLSA 4NCAA 5DBAA 4J9SA 1X9WA 2KFZA 3RBDA 3HYFA 1BQMA 3GV8B 2BGWA 3V6HA 2W9CA 3KKSA 3C6TA 3HP6A 2G8FA 4QZCA 2BPFA 3OYBA 5CJ7A 1ZJMA 3V7JA 4E1MA 1YTUA 4MF2A 4IR9A 4F3TA 3T5LA 3OS1A 5J0PA 1NJYA 4CF9A 1C1AA 2ISPA 3OS0A 3QNNA 1S1UA 4K4IA 3VQAA 3V9WA 4CEFA 1Z00A 4Z6FA 7ICHA 1L3SA 3OYKA 4Z4HA 2R8HA 4PHPA 3QZ7A 4X5VA 1H38A 2OZSA 1Y97A 2E6LA 1QHTA 1JMSA 5HMLA 5HRNA 3NH1A 3RMBA 2A1JB 2W8LA 3TAFA 3QEAZ 4O5EA 1KFSA 4CGHA 4JK1A 3G6VA 4ECQA 1BI4A 3UXNA 5F9LA 3L2QA 4CF1A 5CP2A 4JUZA 4B8AB 2AGPA 5J1EA 2Y1IA 1RNHA 4IFYA 2V4RA 4M3WA 4BGDA 2RDJA 2FLNA 3E2EA 3PUFA 1Q9XA 4O5CA 1SKWA 2JEJA 1ZBHA 4TUSA 2OWOA 3EPGA 1IH7A 4M3XA 3PVXA 3MR5A 3VQ6A 2PY5A 4F5NA 4CJRA 1ZQFA 1NOYA 4C8NA 5HMMA 1S6PA 1IKXA 4EYHB 4MEXA 1ZQQA 9ICMA 2E4LA 5BOMA 1QE1A 5DB7A 3LAMA 4M6WB 1RBVA 3C2LA 2KZ3A 1JXBA 4DOCA 2R8KA 3VQ8A 3UXPA 3AVJA 1S5JA 4KLFA 5DDYA 4H4MA 4K4GA 4OKJA 3GV5B 4Z6CA 2OPRA 5J2FA 2DFHA 3V9XA 4DTUA 1MSWD 3JPNA 5J2DA 3IRXA 4YR0A 2W9MA 1RILA 3TAGA 1JKHA 3ZDEA 4F5QA 3OYDA 4HCBA 4CHQA 4CJKA 4QZAA 1NOZA 4RW4A 3C1YA 3CFOA 3JPPA 2D5RA 2C2RA 3UQ2A 8ICJA 4GLXA 5FRNA 2XCPA 5L1KA 2P51A 1VRTA 1KFTA 4AHUA 4W5QA 5KFZA 4KMUA 4E7HA 1NK9A 1Z26A 1ZQGA 4XQ8A 3VQ9A 2C28A 5HHHA 3MR3A 3PO5A 3QESA 2D0CA 1TKDA 1N48A 4E7JA 3H7IA 3OYMA 1BPDA 1D8LA 1N5YA 4PUOA 3OJSA 1UWBA 3DLBA 5HP1A 4ECWA 1S77D 3AO5A 5DGAA 3AVLA 3A2FA 4P2HA 4ID5A 2UVRA 2YKNA 4CGIA 4ZHRA 4PQUA 2MAXA 7ICSA 3ETLA 9ICRA 1A5XA 4JLHA 4LZDA 3VQDA 4DSFA 4KLQA 1BCOA 3VQBA 1ASWA 4YCXA 5C5JA 5KG3A 2A1RA 4TUQA 4IBNA 3L2RA 3OS2A 9ICFA 1TAQA 5J0SA 5KFEA 1BPXA 1UA1A 4F5OA 4J9LA 3ALYA 4KV8A 2NRTA 4ZTJA 3KLFA 4BDYA 1C0MA 4NLGA 4FLTA 4EBCA 3VQ4A 4IG3A 4I2EA 1HQUA 4FJNA 1KLMA 4UAZA 1TL3A 1I3AA 4CEAA 5KFJA 4K4HA 3I0RA 4EP4A 5KTQA 1TK0A 1Z3EB 1KSPA 2PZSA 1N56A 3KIOA 4CJTA 4IQWA 3AVCA 2BKEA 3T5HA 4J9OA 2IMWP 3OY9A 3NHGA 4YXMA 4F8RA 1IO2A 3F73A 4OLBA 1TKTA 5KG0A 3DM2A 8ICNA 4FJ8A 4E19A 5J2MA 5JS2A 1JLFA 5KFKA 3OSNA 2FBYA 3N4MB 4GMJB 3O3GA 2BHNA 1J5OA 4XIUA 4NY8A 4F91B 5KFWA 3V1QA 4UBCA 5J2HA 1TL1A 4DTXA 2PFQA 4O9MA 3AA5X 2M9NA 2FBVA 3G6YA 3M8SA 2HVIA 4F50A 4F92B 1VSFA 9ICJA 3RMCA 1WAFA 3WNFA 1JLQA 2W8KA 1C0UA 4E7KA 3RJJA 1RPLA 3EYZA 2IS3A 4CFDA 2ZJ5A 1RYRA 3VQ7A 4NCBA 1X1PA 4HYKA 2UVUA 8ICIA 5KRSA 4XRHA 4CESA 4BXOA 3H8WA 4QZFA 2D0BA 4R65A 2F1HA 1C6VA 4LSLA 4EZ6A 1XO1A 3HL8A 3P83D 5DG7A 1LAWA 2BR0A 3PW5A 1Q8IA 3MABA 3JPRA 2HHWA 4FLUA 2ZUBA 4QCLA 2YKMA 1U47A 4JRPA 3Q8RB 1GOCA 2VA2A 1SL0A 1T05A 1S6QA 2PFOA 4JS5A 2XY6A 1VSLA 2YNFA 3PY8A 4KREA 3KK1A 3SQ4A 4YR2A 5FROA 1LWEA 1X9SA 1S1TA 3ASMA 4EBDA 3GIJA 1ZQPA 1WSFA 5L1IA 1JL2A 1F21A 3VQEA 4KHUA 3ISCA 3QEXA 3LP1A 1Q9YA 3GILA 3SUOA 2VANA 3JYTA 4CECA 4I2BA 4YG2A 5KFSA 4CFCA 3RB4A 4YMMA 4E0DA 3HW8A 1J54A 5J2IA 7ICRA 2IHNA 5CZ1A 2BCUA 4GC7A 8ICGA 2VA3A 4KTWA 5KFMA 4QZHA 2MUTB 4CJUA 3SQ0A 5CR0A 2GUIA 4DLEA 4J2EA 3HSTB 5J2EA 1TKXA 4DFMA 2RKIA 4FK4A 4KLOA 2FPKA 4CK3A 7ICOA 1IG9A 2JEGA 2OZMA 4YR3A 1RTHA 3KLEA 1JX4A 5KFFA 3QEPA 2DPIA 3K5NA 5DLGA 2P6RA 3V6JA 4ED8A 1XSLA 1NK7A 4FK0A 5J0TA 1ZQTA 4KRFA 4H8KA 2FMPA 4YMOA 5KT6A 2J6TA 3K5LA 3S3MA 4KI4A 3TQ1A 1HJPA 4W5TA 3ZSXA 4Z4FA 4Z4GA 4O4GA 2I5JA 3Q8PB 1ZQXA 4K8XA 4PPXA 1HJRA 4CGFA 2FPMA 4LY7A 4XUSA 3NF9A 1ZQWA 4QZGA 3THVA 1SL2A 3NFAA 4CJ5A 5J0OA 1JL1A 4M3UA 1JLCA 4KLJA 4RQ2A 8ICUA 4ZTFA 3M9NB 1TFRA 3LWLA 2A1SA 2EX3A 4TURA 3IAYA 3M9OB 2BPGA 3TABA 2JLEA 3C5GA 2X78A 1HYVA 4BE0A 3K5MA 4NLZA 4FJHA 2P5OA 3ZDCA 2NRWA 4M9HA 4K8ZA 1S10A 4CHYA 3JSMA 4DTSA 4F4ZA 1WAJA 2IC3A 2WOMA 3M9MB 2KZZA 4FS2A 2V4QA 5DB6A 3TARA 3NGYA 4ECVA 4RW6A 8ICKA 3EW9A 3NAEA 4CGGA 3ZD9A 3SPZA 2XO7A 7ICNA 4N47A 3K2PA 4AHSA 5C42A 3KD5E 5L1JA 4M0AA 4DSLA 4DU4A 4KLLA 7ICGA 1EXQA 3AUOA 4M9LA 3C95A 1WSGA 4DG1A 4F2RA 1U49A 1LWCA 3I8DA 3T3FA 3EZ5A 5J2AA 3K59A 4B08A 1ZQAA 1S1VA 3H40A 1RBUA 4CIEA 4DL7A 8ICLA 1HNVA 4B3OA 3O4NA 3VA3A 1HUOA 4F5RA 1LW0A 3LDSA 4DS5A 5KG5A 3ZCMA 1NK0A 4DQSA 4B9TA 3EY1A 3MFIA 3OYHA 3C6UA 1ZQKA 4Q0BA 3PNCA 2JGUA 4CHZA 4FLZA 3B6OA 1NK4A 3HT3A 4J9MA 1VSJA 2W9CB 3MAQA 3AV9A 1RBSA 7ICUA 4IDKA 5D4BA 4FZZA 4DF8A 8ICEA 4RQ7A 2PI4A 4CJQA 4Y1CA 2BQRA 1WNSA 4QZIA 8ICZA 4FJKA 5IINA 5DB9A 4OVLA 4F4KA 1TAUA 4BDPA 1Z00B 4ECYA 3TAMA 3IG1A 4UB1A 3ZT1A 3ULDA 9ICCA 4CGJA 2FMSA 4EP5A 4RNOA 4M3TA 4QWEA 4FW1A 3SQ1A 1JXEA 1X2IA 4W5OA 4FJIA 4DF4A 1XS9D 4KFBA 3TAPA 4J2BA 1TKZA 1BI4B 2HHXA 2XY5A 4HTUA 2IA6A 4F2SA 9ICXA 4AILC 1L3TA 4FBUA 2PFNA 1UT8A 2JZBA 4M3ZA 3G10A 3AVNA 3BQ2A 4YNQA 2R8GA 5J2KA 1ZQSA 2HMIA 3BJYA 2J6SA 4RQ4A 1MQ2A 2E6MA 2GBZA 5KG7A 4FJ9A 5J2JA 2BDPA 3JPQA 3RRGA 1EXNA 2PXIA 3PMLA 2DFLA 5KT5A 1BPBA 3LPUA 1ZQLA 4BE1A 3AO2A 3HX0A 3DLEA 9ICOA 1KDHA 3IHQB 1ZQBA 8ICTA 2UVVA 3RWUA 5DMRA 5DG9A 1RXWA 3CQ8A 3QEBZ 2RDIA 2P5GA 4OPJA 1B9DA 4GW6A 4JV0A 4KLGA 5T7BA 4UB5A 1C7YA 2B6AA 4UQGA 1EKEA 1XI1A 4F93B 4I27A 5L9XA 1JIHA 1JLBA 4BE2A 1VSEA 3V72A 3MBYA 3AVBA 4DTOA 2KFNA 1AROP 4DL5A 2XY7A 3BQ1A 4ED6A 5C25A 2BQUA 2HW3A 4HVJA 3C5FA 2NRZA 3SV3A 3SQ2A 3LWMA 4I2PA 8ICVA 4RQ3A 4P4PA 2V9WA 3ZDAA 1NOMA 4PY5A 2BANA 3ZT3A 4Z4IA 2HVHA 1W9HA 5HNKA 4Q43A 1ZQEA 2VA8A 4O3QA 4Z4CA 1A5WA 4I2DA 1KLNA 4IRCA 4RUAA 1N6QA 3QINA 2ZTCA 3V81A 4M42A 4J2DA 4R8UA 4PA1A 3OYFA 4CJFA 4I28A 3KHHA 4E3SA 4C8LA 3NGZA 3L2WA 4DL6A 1HRHA 4KB0A 3MGIA 1W0HA 4KLHA 2YNGA 1ZQMA 3NF8A 4TSXA 4J9NA 1CXQA 2ZJAA 4QWAA 1SKRA 4CEOA 4MFBA 4CFAA 1VSHA 2KZMA 4KB1A 4Q8FA 1EETA 3PR4A 1D9FA 1KVCA 3LPTA 3QERA 1UT5A 3M8QA 3RAQA 4NLNA 1QLNA 5J0XA 4DWIA 3SPYA 4ED0A 4F5PA 1S9FA 1V9PA 1TGOA 2HB5A 4YP3A 3K57A 1RZTA 3L2VA 4GVMA 4J2AA 5KFDA 3C94A 1S1WA 1ZQIA 1JXLA 8ICPA 3V6DA 3EPIA 5I3UA 4JWNA 2RPIA 1L3UA 2QXFA 4JRQA 5HHIA 1FKPA 2Q0ZX 3AO4A 5KT2A 3RH4A 1T03A 9ICIA 2BGGA 4KHQA 1BGXT 5IILA 2F8SA 1ZQVA 5EU7A 4DSEA 4O5KA 1NK6A 4CIGA 3L8BA 1EP4A 1ZQDA 4ECRA 4RPXA 4FZYA 4PGXA 1S0VA 3T19A 4CJPA 4ECTA 1L3VA 4B9LA 4DU3A 5FRMA 1IXRA 4P4MA 4MEYA 7ICQA 5KFHA 3LAKA 1IKWA 2H5XA 4M9JA 1FKOA 3B0XA 3TFSA 3ISNC 1RCHA 3JPTA 4DSKA 3GQCA 5KFRA 1HQEA 4RZRA 3ZDDA 4N76A 2KW4A 2PYLA 3KTQA 4IRDA 1DTQA 2LYHA 2BQ3A 4DMNA 3NGIA 1Z25A 4KHYA 4FW2A 3MXMA 1JLAA 3ZSOA 4UB2A 2WONA 2G8WA 3V7KA 1U04A 3H8SA 1RT5A 3E01A 3RB3A 2ZQBA 3PX4A 3H08A 4O3NA 5J2BA 2F8TA 4ICLA 2DTUA 3B0YA 2YNHA 1K1SA 3ISBA 4BDZA 2O4GA 4CJSA 4ED1A 3QEIA 2R7YA 4BXOB 4OKEA 4FM0A 1T3NA 1BISA 5KFYA 1MQ3A 1LAVA 9ICQA 3Q8MA 1COOA 3HM9A 4R5PA 4B9VA 3RAXA 4KO0A 2OPPA 4CCHA 4CJ3A 1RDBA 3HWTA 4CK1A 3SNNA 1RDAA 1VSMA 2Z1HA 3CG7A 5HP4A 5CWRA 1G15A 3AVAA 9ICLA 1TVAA 3QETA 3TFRA 3PW0A 4CIFA 4I2HA 1NJXA 3C21A 3QEWA 2P6UA 4DOBA 4J9RA 2HHVA 2IHMA 3HO1A 3C1ZA 3RB0A 4KPYA 5KFVA 4ED3A 2XGPA 1BPYA 4MQ3A 1A5VA 4DS4A 4DSJA 3ZSWA 1CLQA 3I0SA 4FJ7A 2XCAA 5KGWA 1ASVA 4J9PA 1IKVA 3NH2A 1ITGA 4ED2A 2P1JA 4AH9A 3DOKA 2W42A 3GIKA 1BL3A 2DFEA 4YN4A 3AO1A 1D8YA 3S3OA 4PHAA 3PV8A 1U48A 3LALA 3PO4A 2VWKA 2ZTEA 4F3OA 3V4IA 4OKKA 3Q8KA 5D49A 1ZQNA 3DOLA 1VK0A 1TK8A 2WTFA 5CYQA 1KRPA 4RQ8A 1VRUA 3U3YA 3CM5A 1NKCA 1UA0A 1J53A 4ELTA 1D9DA 1S9GA 1K6YA 2XHBA 5KT3A 2NRVA 4KAZA 1DLOA 5KT7A 1S0NA 1KEJA 2AU0A 4RQ5A 1SL1A 1B22A 4PHEA 1QQCA 5KFPA 4EBEA 1RTIA 4FM1A 1XC9A 1VSKA 2F1IA 4I2IA 4RPZA 3OHBA 1C0TA 4RT2A 1WN7A 3VQCA 1DGSA 2XGQA 4HUFA 1PZNA 9ICGA 3KHLA 1DOQA 2IGIA 7ICMA 4IR1A 9ICAA 3NGDA 4UB3A 9ICVA 3QLHA 4Q45A 2C2DA 3RJHA 1IM4A 3ZT2A 1BPZA 4FO6A 3AA4A 4P4OA 4YD2A 2AJQA 3RJFA 3CM6A 4FLVA 1UAXA 1NK5A 4C8KA 4EZ9A 5J29A 4UAYA 1RXVA 5EOZA 1RYSA 5DKWA 9ICPA 3OJUA 4JS4A 1Y88A 3MR6A 2P66A 5EWGA 4KITB 2XY8A 7ICVA 3RJGA 3OVNA 2DY4A 5DQGA 1BIZA 2VG5A 1QSSA 1S0OA 2AQ0A 3OYNA 4YVZA 3OHAA 3MEGA 3RJKA 4KHSA 4I2AA 2G8IA 2ATLA 1C1CA 2VG7A 2DFFA 5KRTA 4QZDA 4JV2A 3CFRA 4CEQA 1EX4A 4CJLA 2NUBA 2ZUDA 4L8RB 3FDSA 1U4BA 3WNEA 4RNMA 4E7IA 3JPSA 4ED7A 4DLGA 3GFKB 3T1AA 3VN5A 5J2PA 3G6XA 2FBXA 1RTJA 2B4JA 1HMVA 5KFIA 3V6KA 3OYGA 4FK2A 5KFUA 1S76D 5KFQA 4FVMA 1RT1A 1HUZA 1RT2A 4ID1A 4QW9A 2ATQA 1XHZA 2HNYA 4WE1A 4DTMA 4CJEA 3H4DA 3V1RA 2QKBA 1JLGA 5HRPA 3VA0A 1DTTA 5KFBA 4DQPA 9ICUA 5EWFA 2LSNA 3T5JA 3K75D 4J9KA 9ICTA 5DBCA 3KHGA 3M8PA 4KHWA 1RT6A 3U6FA 1ZETA 4O3PA 4IG0A 3WNHA 4CEEA 4DU1A 5CB1A 3M8RA 1VSIA 4FJJA 3SJJA 3PW4A 3S9HA 4RT3A 4CEDA 4DQQA 1T7PA 3NF6A 8ICFA 4TQRA 5DG8A 2X6NA 2IOCA 1XSPA 4I2QA 1RDCA 2FBTA 1RT7A 2ZTDA 3RH5A 8ICXA 3DMJA 5J0UA 7ICTA 1GOBA 4MFFA 1VSDA 1CZ9A 3SUPA 4G3IA 5KG6A 4MFCA 1JLEA 4BWMA 4NYFA 4MF8A 2G8UA 3V1OA 3ORYA 5F9NA 2ALZA 4FJMA 3ZSRA 3OYIA 3C2MA 5J2CA 2PYJA 5CA7A 4Q8EA 3KHRA 4KLUA 2OPSA 1BQNA 7ICLA 2B5JA 3HPGA 4DTNA 2W9BA 3MXIA 3O4QA 1S97A 4DSIA 3MR2A 2DPJA 4DFPA 3HP9A 3PMNA 4B9SA 5IIIA 1T8EA 2W9AA 4RQ6A 3Q8SB 3MDAA 4EEYA 3LK9A 3DLGA 5CZ2A 4PH5A 4M41A 1T4GA 4NM1A 5DDMA 4LZGA 2XRIA 4W5NA 1WCLA 2JZBB 4J9QA 3IS9A 2KN7A 2ASJA 3QEVA 3LANA 4QZBA 5DBBA 3ZSVA 3B6PA 2FMQA 1SUQA 4JWMA 4QZ8A 3PW2A 4DTRA 2GWSA 5HBMA 1WSJA 4F4XA 4HUGA 1ZQCA 2BCSA 4E7LA 3BGRA 1J9AA 4DFJA 4M2YA 4RG8A 3KKRA 9ICSA 5SZTA 5K14A 5J0YA 1B9FA 1LW2A 3V9UA 1RBTA 4Y1DA 2NRXA 4UBBA 4FJGA 2AQ4A 2F96A 4PHDA 2A1JA 4GXKA 4HUEA 1BVSA 4YQWA 4OGCA 4KLDA 3DLRA 3AU6A 5I42A 2YV0X 2OYQA 1U45A 4YFKA 3DRPA 4PWDA 3FFIA 3DRRA 9ICHA 3BQ0A 1XWLA 4Q44A 1A77A 1YVUA 4YXJA 4O44A 4KN4A 4OJRA 5C24A 4BWJA 2GV9A 9ICNA 3GIMA 2ZE2A 8ICBA 2RF2A 2HHTA 3RMAA 4YD1A 3QIPA 2OPQA 4DFKA 4FCYA 2EHGA 3OYEA 4RPYA 3KLHA 2O4IA 5CY4A 1HYSA 1ZQZA 4M6WA 3OYCA 2HHUA 1QSYA 1KVAA 4NXZA 4R8UB 4RNNA 3AVGA 2XC9A 2RN2A 3MECA 3BQTA 5J2NA 4KN7A 2UVWA 3NE6A 2AGQA 4I7FA 4C8OA 1FXXA 2FC0A 2J6UA 2ZD1A 4NCGA 1GOAA 3Q8QB 3L2UA 3NCIA 2FLLA 2FPLA 4CJWA 5E41A 1QSLA 4KLMA 4PGQA 2KQ2A 2HNDA 3LP3A 1C1BA 1IKYA 4I2GA 4YMNA 3AA2A 3LZIA 3ZD8A 1QTMA 5IIKA 4PGYA 4UB4A 3AVHA 2Z1GA 3D0PA 3V9SA 2IAJA 3AVIA 2Z1IA 1YTAA 2G8HA 5KI6A 3MFHA 4IFVA 3P1GA 1XSNA 1KFDA 3ZSYA 1ZQRA 1JN3A 3CYMA 1WSIA 1LV5A 5J0RA 1BCMA 5TZVA 4CHOA 1ZJNA 4DL2A 1ZQJA 4FJ5A 3OYLA 3K58A 1ZQHA 3NBPA 5D46A 4QAGA 3ZSZA 1K1QA 8ICMA 1A76A 3NF7A 3AU2A 4DTJA 3HJFA 4GXJA 4M45A 4N56A 4I2JA 4FBTA 3ZSQA 4FS1A 2X6SA 5FDLA 3UIQA 4MFAA 5DB8A 1YT3A 3TR8A 3VQQA 4FJXA 3AVFA 7ICFA 5HRSA 4IQVA 1S9EA 4QZEA 3KJVA 4OGEA 3DLHA 4Z4EA 3PR5B 1RTDA 4AHRA 5HROA 1ZQUA 3GV7B 2BE2A 4KKOA 2YHBA 1HNIA 4R66A 1SKSA 4QWBA 4FYDA 5KT4A 4AHTA 2Y1JA 2ASLA 4ECUA 3FYHA 8ICOA 9ICKA 2Z1JA 4KTQA 1LWFA 3PX6A 4I9QA 3C23A 1D5AA 3ISDA 2PI5A 5KFCA 3JPOA 3EWAA 1ZBLA 1KVBA 3H4BA 4O3OA 4KLTA 5JUMA 1RT3A 4QWCA 2ETJA 4OLAA 1TV6A 4NM2A 3RR7A 2ASDA 4Z0UA 4RUCA 2OA8A 4DQRA 3RJIA 5DGBA 1NKEA 4B8CA 3DYAA 5KG2A 4I2FA 4CE9A 4BACA 4QW8A 3ITHA 3AVMA 2BCVA 2R8JA 3ZT4A 4CEZA 3RJEA 4JV1A 2BCRA 4ELVA 5IIMA 1TVRA 2PFPA 3AVKA 1L5UA 3SUQA 3QIOA 3RB6A 3L3VA 4E89A 4QOZB 3LP0A 3QZ8A 2JEFA 3QO9A 3N97B 4M3RA 4RQ1A 3F9KA 3RH6A 3AA3A 3UXOA 8ICHA 2HHSA 4YFUA 3SCXA 3K4GA 3SYZA 5BOLA 2F1JA 4Q5VA 3S3NA 3NDKA 3D45A 2C2EA 4LVSA 4M3YA 3MGHA 3H8JA 3UPQA 4GXIA 4HCCA
chains in the Genus database with same CATH superfamily
5KG4A 3KNGA 3CJ2A 5F3TA 3TJ9A 1Y10A 2YNIA 4GC6A 4GV3A 1F3VA 4EFHA 1Y3KA 4R63A 1OSCA 1A0PA 3MPUB 8ICCA 4NL5A 5ALEA 3ZTPA 6FDRA 2V8VA 3VEVA 3NCRA 1UOCA 2IDEA 4NLBA 5D3GA 1IR1A 3ZXWA 2MXYA 2GJFA 2YHXA 1WC4A 3SI8A 4UY8O 3HVAA 2EZZA 2QM1A 3THTA 1CXUA 5CHIA 3R5BA 3BDPA 2ZWHA 4PEOA 3WQUA 3QNOA 1RCOB 2HQGA 4FZXC 1ZM3A 2AMCB 4F04B 4DV6K 2RRNA 3UKRB 3R2CJ 3NWGA 2C3UA 4KLIA 2P9LA 1HW9A 3B4DA 2ZH5A 3KDNA 4G1QA 3BYPA 2E1EA 4DCOB 3MOZA 4CF0A 3CMAS 1WACA 2HZCA 3BZQA 3X3UA 3JS9A 1K8AT 2A41A 1K73O 3PX0A 1RGIA 2JH3A 1X8DA 3HPOA 3TVKA 5GADI 1NSPA 3WQTA 2VBXA 9ICWA 3CFPA 1FJ7A 2ZIUA 3W3DA 4P71A 3C2KA 4K4ZA 1E3MA 2EDUA 4DL4A 5KFGA 1KDNA 1ZA1B 4NMLA 1GH8A 3HXMA 3E0FA 5IIOA 3ADAC 5KFOA 3U1MA 2B7BB 5I3QA 2AF6A 3O3FA 1T94A 2WTUA 5GIOA 2ACMA 1KAYA 1N8RO 1YZ7A 5E3PA 4YOYA 1Z1ZA 1C1CB 7ICPA 3GDQA 4ILRA 2WF7A 3OYAA 2HLUA 2G06A 1VK3A 1U1KA 1TFWA 2A5XA 5ALNA 5J2QA 3O80A 3NTUA 2YMLA 3OGUA 4NLKA 1HMVB 4RQ0A 2CPZA 2PGCA 4WZMA 4C4RA 5DQHA 1V5VA 1NGBA 4WXOA 5CYMA 3IDHA 2HNYB 2YJEA 2F7TA 1V85A 3SV4A 3MEDA 2BCQA 4C8MA 3U02A 5F3XB 5IV4A 4O55A 1DTTB 3CMQA 3DDHA 4JI4K 4LFBJ 1SXEA 4QZ9A 1NGAA 2FY8A 4BRPA 5B8HA 4FLWA 5AQTA 5MAOA 5B0CA 1Q7LB 3LP2A 2YQ0A 5K8NA 2DHGA 2FHJA 1N5WA 1UZHA 1K9MO 1Q3UA 3KLIA 2MKKA 3I96A 1RBRA 3EZWA 8ICAA 1YX2A 1Q82O 1T02A 4IG0B 1Q5VA 2E88A 2JSXA 2WAQD 4EO8A 1B0TA 3N4QA 2IDOA 3M3ZA 2I8EA 2ZUCA 2GGPA 1KONA 1FO1A 5JS1A 1ASUA 2BMBA 3U7JA 2OJ3A 2M3DA 2D8CA 4F4WA 4DL0C 2F7VA 1RT4A 4FF4A 4UAWA 2X74A 2VU5A 1J5EF 1CI4A 5LMNJ 1TK5A 4DU8A 2KM8C 2ZJ8A 4NA3A 5CXTA 3G0ZA 3O0FA 2GO7A 4O3SA 1RBLA 2DPNA 2MKJA 1VC6A 4X66F 2JEIA 1WSHA 2LP4A 3JAMY 4LF6J 2NPFA 1RT7B 3IWLA 3I5CA 4JB8B 3DEEA 4CK2A 1FEEA 4FWOA 4PHTX 5LL6Z 2EFPA 4RUBA 1J5EJ 2QWQA 1OVQA 1FDDA 1XR5A 3C7NB 4QR2A 3QBXA 1VQLS 4KSEB 3OUYB 3I56S 1T3OA 2MQ8A 1OKJA 1XQIA 4TN2A 4A8OA 4AM7A 4DR1K 5HATA 1QJHA 1NKBA 3BF4A 2KVCA 4KI6A 5JMVA 2J4RA 4DUZJ 1VQON 2B5JB 1X9MA 1NBWA 1FJGK 1UFWA 2X3DA 4BG9A 5EY4A 1S1XA 3T69A 4UASA 4W5RA 4K42A 3MMBB 4ZITA 4A57A 2ZH3A 2L9DA 3MTKA 4WFAL 3RFAA 5KFXA 1CEZA 1EHWA 1QVFR 4I6WA 4LQ9A 3D66A 2NYVA 4O3RA 4HACB 4JI8F 3AO3A 3D2EB 3G25A 4ELUA 1PJ7A 1F5BA 2FJ6A 1TUYA 2ROEA 2FIUA 3HYFA 1BQMA 2BGWA 3V6HA 2NSBA 2ZIVB 3IS9B 3D0HE 4K0KF 1NNLA 1BOTO 3OR1A 1M5SA 2BPFA 1UL3A 1TAMA 2B4UA 1ZJMA 3SSRA 5C2FA 4BGBA 4DV1F 1OO0B 4WXWA 5J0PA 1FJEB 4KGZB 4B1ZA 1S1UA 3VQAA 4CEFA 4JV5K 2KXFA 2DY1A 2GZOA 3H6EA 1P27B 1UVMA 4Z4HA 2CQ2A 2VFUA 5DDPC 3QZ7A 1H38A 1NRKA 1DXSA 1JMSA 3NH1A 3PYDA 2A1JB 4WYWA 1KFSA 2KT5A 3DXMA 1DJ0A 2ILYA 2HMXA 2FSKA 1VQ4S 3UXNA 5F9LA 3L2QA 3AAQA 2RE1A 3OVSA 3QJPA 5J1EA 3HDSA 1WNEA 1RNHA 4FZNA 3SCIE 3H5YA 2YWHA 4IFYA 5IXUA 4O44B 4M3WA 3PACA 1GXLA 2ZE2B 5GMEA 1Q9XA 4PG5A 5H9EJ 2J9DE 3WXKA 4UAVA 5AKGA 2P9IA 3EPGA 3M2RB 3GE9A 4UOHA 4CJRA 1ZQFA 1EB0A 1RB0A 1IKXA 1ZQQA 3I4PA 2CWXA 4J37A 3KLHB 5GAHU 2MQQA 1RBVA 4QU7A 4TY9A 3C2LA 3NEKA 2ZBIA 2AJ1A 3VEYA 1JXBA 3RRKA 3NOGA 3MECB 3EE9A 1QQ5A 2PT0A 4KLFA 1RDFA 5DDYA 4K4GA 3J7Z5 3MD1A 4OLOA 3R9PA 4Z6CA 4NCGB 1F1BB 2G4BA 5B0BA 2WW8A 1MSWD 5IC6B 3ICLA 3JPNA 3AJ2A 3N7RC 4Y2CA 4V19X 3J81O 1RILA 3TAGA 1BXNA 1JKHA 1X4DA 2FB0A 2P9SB 3OYDA 1BUPA 2HNDB 3I82A 4QZAA 1NOZA 3EICA 3HHLC 3CFOA 2D5RA 4H0TB 3JAMO 3HLUA 2QKQA 8ICJA 3UCGA 3KD3A 3D0GE 5FRNA 4NZ6A 4WTOB 4MT1A 5L1KA 3M2UB 2IAJB 2P51A 2OTJS 1KFTA 3AD8C 4W5QA 5KFZA 2JGAA 4E7HA 1NK9A 5JU5A 2P6TA 1JCGA 1ZQGA 2PEHA 3PO5A 3QESA 1DT9A 3QAEA 1HX1A 2W2NP 3EVOA 2VQEF 3OYMA 1BPDA 1D8LA 3NBPB 4H0VB 4J7CA 1SC6A 1N5YA 3OTCA 2HCFA 2LEAA 1ZD5A 1FNOA 1MMLA 2BJ7A 1B7YB 4IQXA 5L1MA 2YKNA 5ALKA 4R0JA 3ZEUB 7ICSA 2VQEJ 3MM7A 3HF5A 3ALRA 3SEIA 4BHQA 5BPNA 4PG4A 1LOTB 3VQDA 1VQ9N 4ZCLA 2QI2A 4KLQA 1SXDA 4PQAA 4NEZA 3LPEA 2ZIWA 5EDWA 5C5JA 2MKIA 4TUQA 1M1GA 2CVEA 5HROB 4IZ9A 5KOWA 4KKOB 1UA1A 2HOQA 4J9LA 4KGKA 2D69A 3HKZD 3OTOJ 4P0PA 4C0OC 3QSIA 4YORA 2E29A 5AM1A 3GR0A 5AQQA 1HI0P 1K8KA 4LFBK 1SB3C 4NLGA 4BX9C 3H0PA 3G2XA 4FLTA 1UCNA 2RDDA 2J76E 3GG1A 1IM6A 3VQ4A 1HQUA 4FJNA 4DFDA 4NA2A 1I3AA 5KFJA 4DR4F 4OI4A 4I6MB 1Z3EB 4OYXA 3KIOA 2D74B 4IQWA 2QA1A 3ITHB 1X0FA 5LMNK 3F73A 1TKTA 2V63A 3TJAA 5IFMA 4GMJB 4LF6K 3AQOA 5AHXA 4XIUA 2LEPA 2WVCA 4M63A 4F91B 4DN0A 2D3UA 1CJVB 1U2RA 2CZ4A 3LW5C 2HK3A 5J1PA 2PFQA 2FVSA 2BZ2A 3ATVA 3MTJA 3UVJA 4O9MA 3EVWA 2OAUA 2HVIA 1CJTA 1ZAVA 1UFLA 4DR2J 4DUZK 2AX1A 3CDUA 3FK4A 4GY2B 2EI5A 4NLPA 3D2QA 1RYRA 3K8WA 5D8HB 3VQ7A 2FQQB 5KRSA 2J7KA 2P9CA 4HH1A 3H8WA 4PZOA 2CQ1A 4LBHA 2F1HA 2BW7A 3THWB 1M1KO 3T1HF 3HL8A 2GOLA 3M1VB 3P83D 1RHJB 3DI6B 2JWLA 2BR0A 3D6MB 1G3OA 5EX0A 3HFVA 1Q8IA 2ZUBA 2A3VA 3MCAB 4QCLA 3ENBA 2YKMA 3R8YA 3E9OA 2D0OA 1U47A 4BRQA 2Q1LA 3T1HJ 2K3IA 1XMBA 1SL0A 1YK9A 3H2UB 1BLUA 2PEBA 3M6XA 3QGHA 5FROA 3P38A 1GMUA 4K5RA 2M8HA 3NVMA 5E26A 1VLOA 1JL2A 2VC1A 3QWPA 4KHUA 3QEXA 4RW8B 3ELHA 4ZPBA 1GLFO 2MSNA 1WKLA 2G5HB 3SUOA 3UM9A 2VANA 4LBPA 5GIPA 1U0SA 4FWMA 5JXSA 4CECA 3M6UA 2DGTA 3K2YA 9ATCB 2KMDA 5F8JA 1DQ9A 5D6GA 3MPYA 1BG3A 1C4CA 4GFJA 2HWTA 4C4WA 2WSFC 1LQ9A 3OL9A 5H9EK 8ICGA 2LA4A 5KFMA 3ZLJA 3TJ8A 1WEXA 4DOZA 2GUIA 4CLTA 2E1ZA 3J7AN 3E9LA 2B7CB 2VPXB 5J2EA 3P96A 2NO4A 4FK4A 4MK7A 2FXUA 2LMIA 1H1VA 4H4OB 3PRVA 1VISA 3US5A 4OI3A 2ZXHA 3UKUB 5DLGA 3GJQB 4ED8A 3OTEA 2L48A 4NA1A 3EKSA 3ULEB 4FK0A 1FIQA 1Y00A 1ZQTA 2GX9A 4K4VA 5KPZA 1HJPA 3OTQA 3BN7A 2HBYB 4Z4FA 1E6VB 3W8GA 3WBZA 1Y11A 3TZWA 1QHAA 4Z4GA 2P9UB 5B7WA 3KBBA 4ZVUB 3NF9A 2BJ9A 4NXMF 2VJ5A 2XLIA 1MWZA 1S5ZA 4CJ5A 4MTPA 3KLVA 4ZTFA 1VYAA 1VFJA 1RXOB 1TTHB 2WMMA 4FWLA 3J80Y 2X78A 1HYVA 4FJHA 1RDWX 2P5OA 1Q86O 3MK6A 3LGMA 4O4RA 1RADB 1Q46A 1GX6A 3KOOA 4DTSA 2ZNYA 2LYBA 2KZZA 3GMGA 5F41A 1LEOA 1REVB 3VEZA 6AT1B 2V4QA 5DB6A 1CS4B 4BRLA 8ICKA 4CGGA 2Y8WA 1VQKS 1DAXA 5EE9A 3CCSN 2B51A 7ICNA 1BC6A 4AHSA 3AH6A 5AJ3J 3I76A 4I56A 3H1QA 4DSLA 1JCEA 1P8ZA 2GMJA 3CI5A 2D3OR 3THYA 2VKZG 1YLXA 2HYIB 3ZFVA 3CJRA 4ED4A 2MEWA 3OTOK 2HNZB 3BPSP 2BKPA 5AE1A 4B3OA 3J7YP 4CJ7A 3AQEA 4F71A 4F5RA 1LW0A 1OUQA 1RWKB 3LDSA 1NK0A 2BTFA 4DQSA 2YMMA 4F9OA 2Y0SC 3M30A 2K60A 4LR8A 1FK9B 2VQFF 2XZTB 3PNCA 1LWXA 2R9LA 3OR2B 1NK4A 4CRJA 3P39A 2KKZA 1YJWS 3C6TB 4NRTA 4P9SA 1V3RA 4FVCA 4FF3A 4DF8A 3MF5A 8ICEA 1FWPA 4RQ7A 2VQFJ 2PI4A 4CJQA 1GMWD 3G8QA 5AXMA 1TZ0A 4QZIA 8ICZA 4FJKA 3SCJE 4OVLA 1A6SA 2LKZA 1D8BA 4M95A 3EL2A 4F4KA 4CYUA 1TAUA 2K8GA 5AQVA 4X4SA 4JI1K 4BC3A 9ICCA 1JNRB 3SMVA 1NNEA 4RNOA 5G0RB 2VF3A 4M3TA 4QWEA 3SQ1A 2E1CA 1XNRF 4G6VB 4W5OA 3C28A 2MLYA 2XMJA 1MG7A 1IUJA 4DR7F 2HHXA 4DR2K 3GFYA 2XY5A 5JRTA 3A0BU 2IA6A 2P9PA 1YBTA 1X3NA 4M63C 9ICXA 5A8KA 4AILC 2UXBF 2JZBA 3JTOA 3F2DA 3AVNA 3BQ2A 4YNQA 5J2KA 1ZQSA 1XNRJ 3FMBA 4RQ4A 1FVSA 2E6MA 3QAUA 3CJQA 2GBZA 3W66A 4ZPDA 2G5IB 3JPQA 3RRGA 2KG0A 4DR7J 2DFLA 4XPCA 2O8CA 1BPBA 1AFIA 3J81j 4JD2B 2R2SA 2EFOA 4DPUA 1KOHA 2NSCA 8ICTA 4JKAA 4FKYA 2JWKA 1VQYA 3NMUA 2UUCF 5DMRA 4CQ1A 1RXWA 4NXNK 2R42A 4GW6A 4BR2A 4N7TA 2KU7A 3MM9B 2B6AA 1FI4A 2A42A 1XI1A 4DDFA 4I27A 3T79A 1JIHA 1VSEA 3MCPA 3HI0A 3R5CA 4RNHA 2DISA 4CZMA 4FWQA 3BR9A 2VFRA 2XY7A 5A2QO 5C25A 5L39A 2DNRA 4J9VA 4RW4B 4I2PA 3IWXA 4P4PA 4B1XB 1Y3JA 2V9WA 4M5DB 1FRKA 1HNXJ 3MAAA 5LJ3Y 2E5LJ 2LU2A 2XSJB 1VQ8S 1Q5YA 3VZHA 4BCAA 3D2WA 4Z4IA 5HQ8A 5AQMA 1D0EA 1MWQA 1XQSC 4LIWA 2NR0A 4E98A 4A2BA 3DDNA 3BN4A 2O8FA 4IRCA 4RUAA 2ZTCA 1Y5NB 4PA1A 3UMBA 4X4PA 1QM9A 4I28A 1A0OB 2DY9A 4K7QA 5L38A 1CULB 4C8LA 2CQIA 1HRHA 1A7GE 1B70B 1I3OB 1XO0A 3MPDA 3GYGA 3DLLL 3H5SA 3NF8A 2F77X 3Q7BA 1SKRA 4PUOB 4CEOA 1UWBB 3R1XA 4CFAA 5HP1B 4KB1A 3GFXA 1N34F 3H20A 5BYSA 3PR4A 4ZCKA 1D9FA 4WKRA 4GKKF 2NXUA 4ZHRB 4PQUB 4UZBA 3RAQA 3MHYA 2L08A 1ZQ1C 4Y2TA 2XHCA 3MDQA 5HOOA 3FKBA 1MW7A 3H7HB 4ZIVA 1VQPN 3AMZA 4PL2A 4GKKJ 3DJCA 3Q8YA 1NB2A 1RAOA 5KFDA 4A4JA 3CCMN 3WK5A 1X3MA 4ZVGA 1L3UA 2CQ0A 5HHIA 1FKPA 2AYBA 1KN6A 4M7XA 3AO4A 3W2WA 2X1AA 2BGGA 4KHQA 5G5GA 3FEYB 3NCQA 3GU3A 4O5KA 3N4WA 4WK1A 1BNOA 1TL3B 2IIHA 1VBZA 2F4VJ 3T19A 3VAMA 4B9LA 1XMOF 1WBBA 4CT8A 1YJTA 5AKXA 1RHKB 2RQKA 1IXRA 1EX8A 7ICQA 2H5XA 4GO5X 1SWVA 3DM2B 3B9JA 3TFSA 3Q0AA 1XC3A 1JLFB 4ITSA 4QS8A 3ISZA 4ZVTB 1J5OB 2DR9A 3SBMA 3R5JB 1XMOJ 5KFRA 1HQEA 3L6QA 4Q2LA 1O13A 2JDJA 2PYLA 2IYIA 2K4PA 4LBIA 3WEEA 1JJ4A 2BQ3A 4HKQA 3NGIA 5GAEU 4KHYA 5AJ3K 5F3ZA 2AJ0A 2CJKA 3ZSOA 3WK7A 2H4YB 3FZMA 3H8SA 3CSKA 5ALDA 2J0QD 5ALHA 3FZKA 4ICLA 4B02A 3BBCA 4JI0J 3EE3A 1WF0A 4EK2A 3TX0A 2HBMA 3MCNA 4BROA 1Q95G 1NMNA 2UP1A 4QS7A 2JJ4D 1FWKA 5I3PA 1YXQA 4ED1A 3ZETA 4BXOB 4IO9Q 3NRZA 4OKEA 2QB0B 1NDLA 5FLXY 1T3NA 5KFYA 1MQ3A 3MXHP 9ICQA 1IJEB 3HM9A 1QVGR 1Z2ZA 1N32J 3F2CA 4KO0A 4CJ3A 2EZXA 4CK1A 5G4DA 4P0QB 1VSMA 1RUSA 5JJBA 5E0OA 2Z1HA 4JEPA 5FPMA 2VD3A 3JSYA 2R2UA 4A46A 3D3CJ 2G0IA 3WU2U 1FJCA 2G2YA 3TFRA 3PW0A 1JJCB 4CIFA 4USWA 2ZF5O 3C21A 2J9EA 4QOTA 1T05B 2V7ZA 4J9RA 1S6QB 3EGVA 2HSEB 3FAHA 3H3OB 2IHMA 2YNFB 3HO1A 2VIXA 4U7CA 3RB0A 4KPYA 1RP5A 5IM0B 3KK1B 2C3OA 4MQ3A 1IBCB 2KG5A 1SC3B 4CH1A 1B4SA 2P1JA 3GIKA 2CAJA 2DFEA 4ATNA 3AO1A 3I32A 1GO3F 3ILLA 3PO4A 2EWHA 4F3OA 3MPWA 5HAOA 2H5EA 2NCKL 4G9BA 3J80U 2E5HA 3PIPL 3ETOA 1TK8A 4LREA 4Y2MA 4A47A 1FRXA 2WTFA 5CYQA 1F2HA 1VRUA 4CLUA 3AGRA 2ZDOA 1Q8BA 3C14A 1FTCA 1NKCA 1ZAWA 4ZLJA 5IT9U 5CABA 3HSDA 1FFSB 2CA9A 1K6YA 5KT3A 2NRVA 4K4WA 2VWBA 3ID8A 1S0NA 2ZOGA 1KEJA 2AU0A 2RKIB 3EX7B 4PHEA 4MH8A 4EBEA 1WHVA 5T7LB 4IOXA 1HWKA 5AQSA 1G1XA 3I31A 2XLJA 1C0TA 3IP0A 2R7OA 2F9WA 1U26A 4LF5J 1HW8A 3QLHA 3M2VA 3FBCA 3BB5A 3K9KA 3UW1A 3NWRA 3GP9A 2D0PA 2MY7A 1HEKA 4FO6A 2NXCA 4AL6A 3RJFA 2KVSA 4FLVA 3TUIC 4BR9A 3HFZB 4EZ9A 3CJCA 3U1LA 3TTFA 4OMFG 4UAYA 2YTUA 1HNXK 3CD0A 9ICPA 5DKWA 4Y0FA 2E5LK 3I87A 5AI6A 1NJIT 2P66A 4AF1A 4EENA 2YWEA 2AZ1A 2VG5A 1VQOS 2AQ0A 3CJAA 5E79U 3MEGA 2BUNA 4I2AA 2ABYA 2VG7A 2KT3A 4HI2A 2ZUDA 3BYRA 3FDSA 5AM5A 1U4BA 3WNEA 4C0ZA 2LXUA 3CNQP 3ZO7A 4ED7A 2YB4A 4DLGA 4PL7A 2Q66A 3SQOP 2HFSA 1S6UA 3BSCA 3G6XA 3B4MA 3KZBA 1RTJA 3SQGB 5KFIA 1QDUB 4TY8A 1NUEA 4FVMA 2ZOMA 5FLXO 2ATQA 2GO8A 4DTMA 3ZZOA 3WXLA 3FSIA 4LF7J 5C10A 2KHOA 3VA0A 2FSJA 9ICUA 1FWLA 3K75D 2WSEC 5IT0A 1WBDA 1HNZJ 3MM5A 4HHHA 3OVAA 2OD4A 3M8PA 3G9CA 1RT6A 3G4SN 4KHWA 1Q1KA 1ZETA 1SQEA 2ZGZA 2MQPA 2QWOA 4JKDA 2D1CA 4JP8A 2W7AA 4ISEA 1SAZA 2GV1A 2MKCA 5I9EB 4M5MA 4FJJA 1NPRA 4ZJOA 3NF6A 2E2NA 3U4LA 2ZHAA 2VDIA 3KKFA 2YCHA 3CXCM 5LXRA 3C6UB 2FHOB 2W25A 2IOCA 1CC7A 5CAAA 3SEOA 3SLCA 2F4VK 4FZMA 5J0UA 2R7VA 3NVVA 3R7NB 4MFFA 1P9YA 1UVJA 4UB6U 2JR5A 3W63A 1VSDA 3DAWA 1UETA 5B5EU 2HURA 4G3IA 5KG6A 2OEJA 1DBDA 2ALZA 1R8BA 3VESA 1YIJN 2FJXA 4U67Q 2ODGA 3OYIA 1XMOK 3HSZA 4Y3CA 2UUAK 7ICLA 3C8YA 4DTNA 4ZPTR 3MXIA 4C0HA 1Q0NA 4WQ4A 4DSIA 3MR2A 3AGKA 1OS5A 4QBUA 1S4EA 1T8EA 3LDNA 3MDAA 1T4GA 2LA6A 3MN6A 4JI0K 5AE3A 3KMQA 3LGNA 2KN7A 1WTFA 1WEYA 3ILIA 4OIXA 1SUQA 3ISND 2HSZA 1FFVA 1X9JA 1Y5LB 2ZM6F 4ZVSB 4U7UD 1F0MA 1N32K 3BGRA 1JJ2M 2NXJA 1J9AA 3EZOA 2PBDA 5LOQA 5JMNA 2DB1A 3M6KA 5SZTA 5K14A 5CD4H 1LW2A 2ZM6J 1GTHA 4UY85 4FJGA 4PHDA 2A1AA 1W2BM 1BVSA 4A2AA 3HX9A 3DLRA 3AU6A 1ZTWA 4FF1A 1YVNA 3UI3A 3FM9A 1JLBB 4YFKA 3DRPA 4KHPF 9ICHA 2G1DA 4X64K 3BQ0A 1L3KA 4GKJJ 1XWLA 1FDAA 1A77A 1D1UA 2ZXIA 5C24A 4BWJA 4AD6A 1RAEB 2RF2A 4OV1A 3BS9A 4KHPJ 2EAOA 3MM6A 4KGMA 4FP9A 2G9OA 1VQ9S 3KZXA 1VMBA 2K1RB 3QFUA 2Y3YA 2VPWB 5M2RA 4CP5A 3NGTA 4U8YA 1VBKA 3OL8A 4L3KA 2MKYA 2QC3A 4J8FA 2ZC4A 1I94F 2OXOA 4HEA9 4RNNA 3VF6A 1T11A 1VBXA 4JI5J 3KG4A 2IM2A 4NLRA 2WAQC 1FXXA 5D4NA 2FC0A 2J6UA 3UR3C 5BYQA 3A3NB 1HHTP 3MR7A 3NCIA 4CJWA 1U1OA 2PSZA 2WZ1A 4PGQA 3H8MA 2KQ2A 4HDHA 4B3RJ 5HVGA 1FEZA 2F8LA 5EHHA 1RFQA 3AA2A 1P1LA 4UB4A 2G08A 2M70A 3MMAB 3V9SA 4LF5K 2N4DA 3OW2M 2RSQA 3C19A 4IFVA 3P1GA 1XSNA 1KFDA 3QIDA 3ZSYA 5ALYA 5GAHP 1JN3A 1IN0A 2YWKA 4JYAJ 1D8ZA 4MMOA 1FRIA 1Q16B 4JKHA 4EFAC 3MN9A 4CHOA 3BGUA 3KOAA 1ZJNA 4D3GA 4WFNL 2AYEA 3NGUA 4XH4A 3CCRN 2CH6A 1P7DA 3EM1A 4JI6J 3SCLE 4L3QA 1A76A 1UW4A 3AU2A 4Y2XA 2YWGA 4HI1A 2IJRA 5KNIA 3M05A 1UTAA 2X6SA 5FDLA 2LEBA 2FHMA 1IQZA 2DKXA 1Z1BA 3VQQA 4IC9A 4FJXA 1R8AA 4BS2A 1V6HA 2DNGA 1RBOB 7ICFA 3DU6A 3VV2B 1FKOB 2HQIA 2F9JA 5AM4A 3KJVA 4OGEA 3DLHA 4Z4EA 4OZJA 1MWMA 1XN9A 3PR5B 2NZTA 4C3KA 2BOPA 4LRCA 3GV7B 2KHCA 3CIZA 1PVPA 5GMDA 4H5TA 1F6TA 3D6TB 4LF7K 4KBOA 3FYHA 4TU7A 3PX6A 5K9FA 3BS5B 3ISDA 2PI5A 4KT0C 1TMJA 1RT5B 4GVBA 2UXCF 1HNZK 3H4BA 4O3OA 2POKA 1HHQA 3HZ6A 3FLCO 2QE5A 4CF5A 1ACMB 1U0HB 4QWCA 1FT8A 5F8GA 4NM2A 4Z0UA 3QFPA 5IS2A 2PFFB 2FE9A 4MO4A 4Y28C 1NMDA 5KG2A 4CE9A 4QW8A 5DM6Q 2BCVA 2CNLB 3OFGA 2XYGB 1ATSA 3RJEA 4J03A 3EXCX 3T6BA 2AH5A 4XPEA 2YH1A 4ELVA 1TVRA 3TTCA 1DY3A 3MGVA 3AVKA 3PHEA 2DGZA 3OPKA 3RB6A 1HNWF 4LIRA 3L3VA 2GS8A 3QZ8A 2JEFA 2FD2A 5AZIA 5BREA 1COKA 3WKBA 3OT9A 3H5UA 2Y9HA 3AA3A 3EDRB 1HNWJ 4YFUA 1GLBG 3I0SB 3SYZA 3HD2A 4NYPA 3RSEB 4LF4F 4TNOA 5BOLA 5A0YA 1NGFA 5M1OA 1IKVB 1QUPA 4A8FA 3RBZA 3NDKA 2C42A 3D45A 5ETKA 3EUNA 4OCZA 5ALFA 4M3YA 3UPQA 3H8JA 3AD9C 1ECWA 3ZI4A 5AI0A 3ZTSA 4LF4J 2HBRB 4CM2A 4G1PA 1MU2A 2O1PA 3TANA 2F8HA 3Q86A 1WLJA 1XU4A 1WOQA 5GADP 1WG5A 2AIRB 3DOLB 5DLFA 2CGKA 1Y5IB 4HTJA 4WQ4C 2CQGA 2JMGA 3KK2A 3RMDA 4RW9A 4IRKA 2G8VA 1BPEA 1T95A 3CHWA 2XNQA 5ALGA 3Q8LA 3FBBA 3I8BA 2B0GA 2MDAA 4OYMA 4WCEL 2Z58B 1RTIB 3CC4N 2ZM6K 3ZZTA 2F5GA 1DK3A 3AAPA 1ZYQA 3K5OA 3HZGA 2ITGA 1R59O 3KKAA 3DLKA 3CJKB 4CHPA 1M90O 1RWVB 3L3UA 1SZPA 2HQFA 2UYTA 3IAS9 3IO1A 3AQPA 2BJ3A 3EXYA 4LFCK 2R7UA 1XMQK 2K8CB 1S57A 4CGDA 4IKAA 2GUPA 4FPRA 2RIJA 4GKJK 3PFEA 4RW7A 3CCSS 1VHFA 4JB3A 3KK3A 1OVYA 2ZIXA 2MUTA 1QAXA 3HK2A 4LSNA 3J7ZO 3IDWA 3KFWX 3HKZC 2C1EB 5AQRA 4E1NA 1U1PA 3HVRA 1LKYB 2WVEA 3NS5A 2HWHA 3PFOA 1BWEA 4KPCA 5IOLA 3DXSX 4X65J 4I64A 2YHAA 1R89A 3ZZZA 1U09A 1Z2LA 2BPCA 4L75A 4JI5K 3V9ZA 4L72B 2YWWA 1YVFA 4OJ3A 2CQCA 3W61A 1H6KX 3VQPA 1SIWB 1NJWA 3CJ9A 4ECXA 3D9BA 1U1NA 2CPYA 5C15A 2CADA 2LDIA 2VUGA 4LD0A 8ICWA 2N4CA 3OYJA 3L09A 3G71N 1ZD2P 4EYIB 2CWKA 1RT1B 1RT2B 4AXIA 3PEHA 3T6JA 4B3RK 4A8EA 1OWXA 3BM7A 4WE1B 4OZNA 1RK8A 1JLGB 2W2PP 3KZIU 1DHMA 1SV5A 3DWLA 5KG1A 4B9MA 2H1YA 1U1QA 3GZFA 3DRSA 3VALA 5BPCA 2G8KA 2GIRA 4PCQA 9ICBA 1OIAA 1JXVA 2CGJA 3RR8A 2N82B 3HJEA 4RUHA 4JYAK 5KFNA 2J9CA 4DQIA 4ZN3A 2ASPA 2VFSA 1I39A 4A59A 4OPHA 3LDAA 2Q6BA 2DHSA 3AFGA 4QS9A 2P8IA 2MU2A 1J2NA 4YB7A 5EWEA 4K4SA 1K8AO 3PG9A 1KCFA 4JI6K 3QE9Y 1S0MA 5LSOA 3ZDBA 1OY6A 8ICQA 2VWJA 4KQZA 4F02A 3DMJB 2X7IA 2QLJB 5K4LA 4CJVA 3Q23A 4ECZA 5M1NA 1H98A 4BC9A 1JLEB 2KJ5A 1TUGB 4LF1A 4QPXA 2DGSA 4DEZA 1UZDA 1ZBFA 4TUPA 2FZGB 1F0XA 1EQ0A 2ZKUA 1YSJA 4IKFA 1TE2A 5KGXA 4B17A 3O3HA 2AXTU 4EGLA 5AKIA 1SZHA 3TAEA 2OPSB 4XA5A 1BQNB 4OHYA 1SH0A 4CHNA 2VL1A 4YY3F 2P9EA 1Z1VA 1BIUA 2W9BB 1YRUA 1BMQB 4Y6IA 5IIJA 1U7LA 5F0WA 5KFAA 2D0AA 1R8PA 2V68A 3CRXA 4M04A 1VRQC 4LF9F 3N28A 3RBEA 4M47A 1TL7A 1HPZA 2GFFA 4F0HA 3GBTA 4FLYA 1G6BA 4BRHA 5ALVA 2YQ1A 4J9SA 1NPPA 4NO7A 3GV8B 2W9CA 3KKSA 1RAJA 3UCZP 3OYBA 3CWJA 4DX7A 4MF2A 4IR9A 4YHHF 5CR4A 2GVZB 3TZYA 3S6EA 2NUHA 4CF9A 1WOSA 3OS0A 4RX6A 2DITA 2HAIA 2CPFA 4K4IA 1HR0F 3BV8A 1GFWB 3T1YF 3V9WA 1QAYA 4TVAB 3J7YI 4TYBA 1Z00A 3D6FB 3FZ2A 7ICHA 1L3SA 1JUDA 2BDUA 2R8HA 3RGIA 1D3WA 3GFHA 2E6LA 3NVZA 1DGKN 1QHTA 1TYQB 5HMLA 2KB2A 3RMBA 1PC4A 1HR0J 5BPMA 1FHTA 4Z7YA 3DHWC 3T1YJ 2N7CA 2KN4A 5AQZA 3G6VA 5I42B 1HNWK 3UDEA 4CF1A 3FFIB 1AFJA 1CLFA 4JUZA 5AI8A 2AGPA 2CPDA 2FHJD 2Y1IA 2HIQA 3B54A 4C3MA 4IEEA 2V4RA 2JFDA 2R2RA 2NZCA 5AKHA 1NHVA 4DR6F 1MA9B 3BQ7A 1B99A 4O5CA 3HZEA 3RF9A 5HJXA 2XYHB 3L95X 2G2OA 1IH7A 2OPQB 4JI7F 3PVXA 1VQPS 3MR5A 5EOYA 3WUHA 1WUDA 2PY5A 2RVJA 1NOYA 4EYHB 4DR6J 2E4LA 1HYSB 5DB7A 3LAMA 3CCMS 2RE2A 4M6WB 1T6DA 4DXLA 1U2VA 2I9SA 2F1FA 4EIAA 3VQ8A 5E3RA 2CYYA 3GV5B 1Q78A 2ZD1B 2Q1NA 4CZLA 3BP8A 4OI0A 2Y0BB 1G99A 1HLUA 5ALWA 3Q89A 5GAGU 1R3NA 4F5QA 1VDHA 1NDKA 4CJKA 4M8LA 1OQ6A 4H5WA 1TL5A 3RJMB 3JPPA 2C2RA 4ZP9A 1N5VA 4CTAB 4H5RA 4GLXA 3KDOA 4ZJQA 2XCPA 4Z7CA 4WFZA 2A18A 1VRTA 3VGMA 3NG8A 4DV5K 3FZHA 3NMAA 3G82A 1VS3A 1Z26A 5T41A 1O51A 3PCOB 2FJBB 2GEMA 4ENOA 3MR3A 3I55N 1KAZA 3KKAC 3PSTA 1YKWA 2V51B 1NAQA 2QWRA 1TKDA 4P72A 1N48A 3BZCA 2KL8A 1YHQN 3L7PA 1WHYA 3QXGA 2XBPA 2KEYA 2XMUA 5EXWA 2AYGA 3DLBA 2XS2A 2KI2A 5DGAA 4C0BA 3A2FA 4P2HA 4X65K 2UVRA 3C2PA 5HMYA 3UN3A 4X2BA 4CGIA 2DH8A 4NYZA 2LFVA 2ZH4A 2BE9B 4ES2A 4BRAA 5ETPA 1WG1A 4LZDA 1YQHA 1CJUB 2RH3A 1S9EB 4CIOA 4YOWA 2RNEA 4B3MJ 1S12A 3GOIA 4IBNA 2YY6A 2HFVA 4Y0WA 2GWKA 5J0SA 2BE2B 3CQXA 4F5OA 3L9ZA 3ENVA 4KV8A 2NRTA 3CCEN 4BDYA 4IG3B 1N5XA 5LMUF 3GSIA 1WC3A 3M32B 2B56A 1SC4B 1XNQF 4BRNA 4EBCA 2ZFHA 4CBWA 1U02A 4KH5A 2PMZF 1N36K 1NGJA 1KLMA 4UAZA 4OYZA 4UY8T 3IUCA 2DRAA 1TV6B 5LMUJ 3I0RA 3BSNA 1NLVA 5KTQA 1XNQJ 3FC4A 4CJTA 4ZVEA 2RB7A 2BKEA 3T5HA 4J9OA 2IMWP 4WFXA 5I4MA 4FNIA 1IO2A 3HSCA 3VEWA 4E19A 5J2MA 5JS2A 4YEAA 1X5TA 2W54A 3OSNA 2RQ5A 3N4MB 3DXKB 3QQCD 1YJRA 2AJ2A 1KBUA 2OHDA 2UXDJ 5KFWA 3ENHA 1N54B 3V1QA 3J7AP 1Z05A 1K73T 4DV0F 2RUGA 3FGUA 4DV7F 5DM7L 2FBVA 3CXCR 1NGDA 4USAA 4F50A 1FRHA 1F2GA 1WAFA 3GTYX 4NLUA 1C0UA 4NLQA 2HF3A 3K7RA 1W7AA 4DV0J 4LT6A 2WF9A 4CNYA 2M7SA 3MM8A 3DKDA 4CFDA 3Q83A 4G9ZA 3MCOA 1EIYB 3UMGA 3BDEA 4GO7X 2OYYA 3KG0A 1QQMA 1N8RT 3G8TA 2FJDB 2D0BA 1C6VA 4LSLA 4EZ6A 2RRAA 2YNIB 1SCJB 1LAWA 3FBFA 3MMCA 2LCWA 3MABA 4P73A 2HHWA 2MYFA 2C3PA 4KB7A 5D3GB 3OXLA 5ALIA 2GTDA 1PK1A 5AQOA 3QU4A 3PY8A 4KREA 2ROPA 1XIQA 2JH1A 3SQ4A 4NLTA 3S8SA 1QY7A 1RU2A 4QR1A 2RT3A 1RLDA 4F4AA 3GIJA 1ZQPA 1WSFA 1FA0A 2O3DA 3SCKE 2P9LB 3VQEA 3UO0A 4J9UE 1K9MT 2OP5A 3LP1A 1HR0K 4KH1B 2V67A 4G1QB 3VAKA 3LDLA 3T1YK 1JJ2R 5HI7A 1Q82T 1JROA 1SVDA 4USMA 3A8EA 3CERA 1RHRB 2GJIA 3LUYA 5KFSA 4CFCA 3RB4A 4YMMA 2KDOA 3HW8A 4NWIA 1GT8A 4CLZA 4FSVA 2ZIUB 2IHNA 2VONA 5CZ1A 2WB1F 4GC7A 1W2BR 3FRZA 4QQBA 3NVWA 2EFQA 4QZHA 2HRTA 4NI2A 2MRLA 4CJUA 3NOCA 1RHUB 4LJMA 3TA0A 2DRDA 3IWNC 2FDRA 3A13A 2V2KA 2RLTA 3G4SS 4DR5F 4DV3K 4CK3A 5EGYA 1GK8A 1KP6A 2OZMA 4U6PA 4YR3A 4NLSA 4FN5A 3M7VA 3KLEA 1SKUB 2HQ3A 2W04A 5KFFA 1NSQA 3ULHA 4FNHA 1SGGA 3W5XA 3TX8A 5J2QB 3EEQA 1T9YA 2GLEA 2FMPA 5KT6A 1WC0A 3QU7A 1N33F 3N6NA 2J6TA 3GYNA 3K5LA 3J7A1 2K4EA 3SMPA 2KKPA 2HVZA 4OO1J 2QARA 3MI7X 3GG0A 4O4GA 4CH0S 1AW0A 1HJRA 3PJ9A 2AEFA 4LY7A 1IG8A 4XUSA 2DGUA 1ZQWA 1LOUA 1SZ2A 2YKQA 3VGKA 1YIJS 5B09A 1JL1A 4L76A 4WQ5A 4KLJA 8ICUA 3LP2B 4KE5A 3KLIB 3IMQJ 1HWJA 3IMXA 3TABA 3C5GA 4KH6A 4IH7A 3K5MA 3SMSA 3ZDCA 3QNWB 1V3ZA 4M9HA 1JMTA 2GGPB 2Z0GA 4E8UA 3JSMA 5ITHA 1KEKA 1KC8O 1RT4B 2DNQA 2SXLA 1AA1B 1WAJA 1X4GA 2HSTA 3OW2R 2P9NA 4M5KA 4ZP8A 4K4UA 5K8PA 2KNJA 2PFUA 4RW6A 5F2RA 4OYIA 2J8SA 4OYWA 4MYTA 4KJIA 2NRHA 2AKWB 3F56A 4RBUA 4LFAF 3HILA 2XO7A 2QW9A 2XMMA 1AYEA 3UCUP 3K2PA 5E33A 3W9HA 3KD5E 4M0AA 3PM9A 4PPDA 1QQ7A 2M4MA 2MQOA 3WKEA 4C8YA 1EXQA 1GX5A 4USIA 3AUOA 4DX5A 4M9LA 5CZXA 1N0UA 4DG1A 4B3MK 4F2RA 2XICA 5JVGQ 5KAIU 1BDGA 3CEDA 3I8DA 4U8VA 1IVZA 3EZ5A 5J2AA 1S4FA 3ICXA 1BY9A 1RBUA 3TR5A 1HNVA 8ICLA 3VA3A 4CDGA 1HUOA 3VF4A 5KG5A 3TA1A 4X4NA 5A8WA 1U1MA 1DRGA 2M9KA 3MFIA 2X51A 3OYHA 4Q0BA 2JGUA 2RRDA 4CHZA 2Z30B 4FLZA 4U9RA 1ZM4A 2AX0A 3O9RA 4QPTA 2DGOA 1VDVA 1BQMB 5A6WA 3MAQA 1H72C 3AV9A 2G0AA 3CW2C 2NLWA 3OR1B 4IDKA 5D4BA 4J90A 2C2NA 2QT7A 4IOBA 3PJXA 4USJC 4OL8A 4ICAA 1IBMJ 4Y1CA 3D68A 4DZ6A 1N4LA 1S1UB 4CLWA 3TZZA 4MAKA 4CNZA 4Y2QA 4ECYA 2UXDK 3IG1A 3ZT1A 4ES1A 4AUKA 3ULDA 3TEGA 3A5OC 4CGJA 1VIXA 2FMSA 3E8OA 2IDLA 4XK8C 4FW1A 3BKUA 3BKFA 4P2XA 5AK6A 1YTYA 3DXMB 2HFOA 2C2MB 2KJVA 4J2BA 4F25A 1C0GA 1PK3A 3IBPA 1TQLA 4F2SA 3IM8A 5J1EB 4DV0K 5AIBA 4IFYB 4FXVA 2HMPA 2ZOFA 2HMIA 4HWIA 3AN1A 2GAGC 4O8UA 5KG7A 2KJWA 4WKYA 2BDPA 3R27A 2PXIA 1H7WA 2XEXA 2WW4A 1PGZA 2P9IB 5KT5A 3M4XA 1U2FA 5L8RC 3F53A 3H2VE 2KSOA 3HX0A 2Z2YB 3CDWA 3DLEA 1IKXB 1ZQBA 3RWUA 5AXKA 1IJJA 1NGGA 2W7OA 3QEBZ 1SBRA 3JTNA 2RDIA 5TISU 5M2PA 2P5GA 3QJJA 4JV0A 2VBYA 5T7BA 1J2MA 1ITPA 2V69A 4F93B 3WC0A 3CCRS 3VPZA 2JNJA 5L9XA 1NBEB 3V72A 4H03B 3AVBA 4DTOA 4PJ0U 2EK6A 2KV2A 2GIFA 4FWRA 3EKUA 1S5LU 5AT1B 1JKHB 2XZWA 4HVJA 4OX9J 1Q7YO 1O0PA 1HBMA 1ZZFA 1KL9A 1HBUB 4PY5A 2BANA 2CPXA 3R5DA 3WK9A 2OHFA 1W9HA 3T7ZA 4O3QA 3U26A 2M2BA 4Z4CA 2HLTA 3R7BB 3QINA 4JKGA 2LECA 3JQKA 4M42A 4I1TA 4R8UA 1I51B 1UVKA 3OYFA 4CJFA 1RWMB 2WUSA 3KHHA 2R18A 5ETQA 3CCUN 3TRGA 4JI4F 4I0WA 3N5FA 3D7SB 4KHRA 3MGIA 3QSYB 2RU3A 1NHKL 3MCSA 5SUHA 2YNGA 1ZQMA 1HLWA 4MO5A 2NREA 4QJVA 3CCQN 4QWAA 1N5YB 2CPIA 1WWVA 4MFBA 4UATA 2XMTA 1EETA 2YX6A 2DBBA 3OFEA 1UT5A 2YKNB 2NYHA 3QBCA 1UP1A 3M8QA 1NM1A 3SPYA 3MM7B 3N01A 2VKRA 2EH9A 3Q8VA 1X4CA 2ZHBA 4F5PA 3ZTQA 1OY9A 1TGOA 4YP3A 1O08A 4CT9A 2ZIWB 6FD1A 3TADA 2G0CA 4GVMA 4FWKA 4ZVFA 3D1QA 1ZQIA 1KBRA 1JXLA 2E8OA 4CH7A 2E1RA 1OH5A 3EPIA 1BWVA 3SQIA 1VBYA 2L41A 1V97A 4A8KA 2RPIA 4P0PB 1K8KB 3L4QA 4ID8A 3CJ8A 2WHOA 2EAMA 2XULA 5AR0A 2J8AA 1F44A 4DR1F 1BGXT 5IILA 4BRMA 2F8SA 2RS8A 3MD3A 1HQUB 4O3MA 4DSEA 1AB8A 2IVNA 4CIGA 3L8BA 1ZQDA 3CPEA 4RPXA 1PYSB 1FJGF 2F8KA 4ECTA 1SPBP 4F3QA 2LU1A 4P4MA 1ATNA 5KFHA 3LAKA 1IKWA 2VOPA 1ZM2A 2EC0A 3B0XA 4WQ5C 1TKTB 4CZCA 2F8MA 2KOBA 3ISNC 4BRGA 5GAHI 1VK8A 2J5AA 1FJGJ 3EE8A 7FDRA 2XNRA 1QQNA 1C20A 4USKA 1GLCG 4N76A 2KW4A 3KTQA 2E66A 1RQNA 2LYHA 2QYCA 4DMNA 1ROFA 3T41A 4BQLA 3UVJB 3MXMA 4UB2A 3L7OA 2G8WA 4KAIA 3V7KA 4UW9A 1CJTB 3RB3A 8AT1B 2E1PA 4BUGA 4O3NA 1XEZA 2D3ZA 1VJWA 2DTUA 4JV5F 4OI1A 4CE6A 1XNSA 1U24A 2YNHA 2GC8A 2BKNA 1K1SA 3CC4S 3S7RA 1PIEA 2FZCB 2DHHA 1S99A 3GCWP 4BC2A 1X4AA 2GIQA 1N60A 4PKDB 1FW6A 4YB6A 3FE1A 4FM0A 1BISA 4JV5J 2HGLA 1WUAA 1COOA 5HL7Q 5M1KA 1FXRA 4BRDA 5JTIA 4CCHA 4BJQA 1RDBA 3HWTA 3SNNA 1CSJA 2YI1A 3BBBA 5HP4A 2BM0A 4M5HA 1DARA 2V94A 1GQEA 2ZVSA 2QWLA 3AVAA 4PL1A 2YKMB 2KFYA 2EVZA 3TA2A 2KE7A 4UOFA 4DOBA 1K0TA 1GXTA 1IBMK 2HHVA 2ZH1A 4YOVA 1WOPA 5KFVA 4ED3A 4N8NA 3CQYA 1BPYA 2R7SA 1A5VA 4DS4A 3ZSWA 2D9OA 2Q3PA 4L6V3 4WFNQ 1ASVA 4J9PA 1Y4ZB 2MKHA 4XDDA 3I5BA 3NH2A 1ITGA 4ED2A 4AH9A 2W7PA 3D54A 2UU9F 1M6YA 4IXCA 4GRSA 4I6AA 3WHIA 3R5AA 5BR9A 3S3OA 3PV8A 1Z4UA 1U48A 3LALA 1N61A 1FCAA 3AHPA 4QIGA 3NCPA 3V4IA 1Q86T 3NNCA 5LJ5Y 5D4PA 2JL9A 5CEHA 2UU9J 1RCXB 2VBZA 3K1ZA 3G71S 1VK0A 2APOA 5ETLA 2DHAA 1H2UX 2KVQE 3CCVN 4O23A 1UPMB 4XEIA 4F7VA 4RTFD 1SJQA 3KYLA 3I9ZA 2KKVA 1D9DA 3R1LA 1S9GA 2FLOA 1DLOA 4BG8A 2OFGX 5KT7A 3AODA 1SV0C 2E5SA 5KFPA 4DX8H 1VSKA 4I2IA 2VCPA 4RPZA 3J8AA 2FJEB 5TKWA 1I5OB 4PG7A 2GHPA 7ICMA 9ICAA 1PCAA 3NGDA 1WDDA 3TWZA 4UB3A 3AM9A 3P4IA 2PKEA 1Q79A 4U67L 4AYBD 3RJHA 3BH7B 2V2QA 3ZT2A 4M5IA 4OX9K 4P4OA 2FVPA 2GCFA 2RU9A 3NVKA 3CM6A 2DHXA 1M5VC 4C8KA 2EFGA 2AHOB 2OTLN 5J29A 2DT9A 1FX2A 3R7SB 2LMRA 3O6QA 2QSFA 3OJUA 4JS4A 2N7YA 1DRZA 2RILA 3MR6A 2B4VA 4PWWA 5A8RA 3A5LC 3IGNA 2MGZA 4YVZA 3OHAA 1Q81T 2OEMA 2QA4G 4QZDA 4CEQA 3C66A 4OX6A 4DR3J 3C15A 4L8RB 4YB1P 2DGXA 4LFBF 2MQMA 4E7IA 3JPSA 3GZ7A 4IH5A 3OTDA 5J2PA 3VN5A 2CG4A 4LRAA 4OX8A 3OYGA 4EUVA 2RHKA 4ZMMA 1HUZA 2EFVA 3FCHA 4QW9A 3TSUA 2ZH9A 3AT1B 2QKBA 2MMYA 5HRPA 3MUVP 2DO0A 4LJXA 1RSCA 3KUGA 5LMNF 3QATA 4FYYB 4JI2J 5EWFA 3E1YA 5EE0A 1VGYA 3THYB 4LF6F 3S01A 9ICTA 3IG8A 2QWNA 3U6FA 4CF4A 4Q2MA 3WNHA 3PIOQ 2XZDB 4H5NA 3TQEA 5ALOA 4MN4C 2YMPA 4WCEQ 2ZZMA 2YB1A 4B3OB 3M8RA 3MDFA 4CEDA 2ASOA 1LW0B 4DQQA 2HS3A 8ICFA 4ZLPA 1SJ4P 4TQRA 4ZA1A 4X84A 3OTBA 4HAIA 3WXMB 3M30B 2X6NA 3PSIA 4C1NI 5CE3A 4I2QA 4DUZF 3B6BA 2ZTDA 3AJ1A 3MN7A 2IM1A 3TSQA 2OEKA 2QFJA 4O5FA 3SUPA 2JH7A 1AUDA 1T9VA 3ORYA 1QVGM 3H2LA 3L3CA 2HGNA 5BN8A 1NJIO 3A12A 2BXJA 3GYXB 4QU6A 5RUBA 3C2MA 3WK6A 2DXFA 5CA7A 4Q8EA 2GQCA 4CYUB 4ILMA 3OPXA 3A0HU 3HPGA 1PYTA 1NB7A 2UUBJ 3ZX2A 3LM2A 2DPJA 2P5VA 3HP9A 3PMNA 3KNAA 5C2DA 4FPIA 3Q8SB 2V5HG 3MN5A 3LK9A 3DLGA 2BM1A 4PH5A 2P9PB 4LZGA 1SIZA 2E7VA 5A8KB 1VQNN 4YDUA 2CQHA 1WCLA 2P9KA 2JZBB 4J9QA 1G2EA 5HBMB 2JZ5A 4UW2A 2JFKA 2KICA 5DBBA 3B6PA 1OMSA 2WF5A 2F4FA 4B6JA 3R2DJ 2DR8A 1XBWA 4O8KA 1WSJA 2O8CB 4F4XA 4HUGA 3PSPA 1KVIA 1F60B 2MLXA 1H74A 1EWRA 4EELA 3C6HA 4DFJA 4WFBQ 1XTZA 3TUPA 3QUBA 3D2FA 1RDRA 1XK8A 2YX1A 5J0YA 4HDGA 3I55S 5J8YA 3NKYA 1K5OA 1UJ6A 5M2UA 4DHYA 4GXKA 4HUEA 1FEHA 2B6AB 1CJKA 1YHQS 3TYTA 4WP9A 2YV0X 2K8BB 3BH6B 4PWDA 3DRRA 5EE3A 3WKAA 3W0LA 1YVUA 2RHQB 4WU2A 4FZVA 1AT1B 4CBUA 5C25B 1FVQA 4KBIA 4A8WA 2K89A 4QIWF 4OZ3A 3GIMA 4US9A 8ICBA 3H5XA 4I2PB 3CJBA 1KTVA 3RMAA 4YD1A 2G13A 2FC9A 3MAAB 3QIPA 3NY0A 3L7UA 1N5SA 4FCYA 4JAXA 1EJ7L 3S1TA 4RPYA 2UU9K 3PDNA 2O8FB 1FE0A 4NX9A 2IJNA 4Y2KA 2RHFA 3CCES 5AFUH 2GMHA 2XC9A 2RRBA 3CJSA 3F5AA 2CJAA 3BQTA 5J2NA 1OH7A 2UVWA 2AGQA 4I7FA 4JNEA 1B7FA 3OXGA 5DM6L 1OH8A 3Q8QB 3ZTRA 3KJFB 1VQ6N 3FEXB 2FPLA 2FVQA 2QG9B 1QSLA 5ALRA 2DO4A 2LHTA 3RYLA 1C1BA 3EN9A 1IKYA 2BKOA 2Q6CA 4I6YA 5E2QA 2E9TA 4ZCMA 2NNWA 2FY1A 3ZD8A 1QTMA 5IIKA 2R7TA 3FSYA 1X6IA 3TO8A 3AVHA 4ILHA 3D0PA 1GEHA 1DQAA 5LM7E 4FZLA 2G8HA 3MFHA 4IUFA 2HFZA 5HK4A 4C2MA 2KT2A 2ZG6A 4BGAA 2AEJA 5J0RA 2X1GA 1PAUB 4YDXA 3D5MA 5KOXA 3NLCA 5LXYA 1FKPB 2DH7A 5F0XA 2YQ3A 5AK4A 1ZQJA 3W2WB 2B9XA 3Q24A 4HLBA 2IJFA 2A1BA 2AYMA 1OXJA 3FEZA 4N56A 4I2JA 2I1RA 4FBTA 1CVJA 1LKZA 3OTOF 4KR0B 1U2CA 3FC9A 4DR3K 3Q7CA 4MFAA 1ICEB 2ERRA 5DB8A 2CJQA 1RQLA 3CP8A 3IBFB 3TR8A 3AVFA 5EUHA 2NZ4A 4FFDA 2H51B 4QZEA 1BNPA 4AL5A 3IFRA 4I68A 1RTDA 2GQQA 3CCZA 1YAGA 4OI2A 1HQEB 4OJPA 1FERA 5AQUA 1HNIA 5DRKA 4DCPB 4QWBA 2QL5B 4AHTA 3WEEB 2Y1JA 1ELOA 2ASLA 2H3EB 4ECUA 1N0VC 2CNNB 3POTA 2QEXN 8ICOA 5L46A 3EZUA 2Z1JA 4KTQA 1LWFA 1PKUA 1NU0A 4JI2K 4UUXA 4UARA 3SAHA 3EWAA 2EC2A 2I6WA 3R97A 1G4CA 5AKLA 2LQ9A 3RZAA 1X40A 1EQMA 1RT3A 4ICLB 3C6AA 4OV6A 2ETJA 2ZUGA 4ZCIA 5KQ8A 2DBYA 4JI1F 1RAHB 1RYUA 4HL9A 4DQRA 3DGPA 4B8CA 3DYAA 3IA0A 3ZETB 1GLLO 1FKAF 4NLCA 2UV8G 2W2QP 4JV1A 3CC2N 2BCRA 1VI7A 4JI1J 1MDUB 3HSJA 5IIMA 3A8IA 4DR2F 4KO0B 2PFPA 3OBIA 2V52B 4CD1A 3AL0B 1Q3VA 1IBLF 3QIOA 5E3AA 2JV3A 4ZJLA 5C0YA 4YOTA 3CJ0A 3LP0A 1MROA 3QO9A 2EK1A 2CXEA 3K8VA 2DEJA 1W25A 3F9KA 1KAXA 4MYUA 1IBLJ 3M1FA 4V19S 5THWA 4PKGA 3VHQA 8ICHA 3JQMA 4ILJA 2PMWA 2ZJPL 2IY5B 1B0XA 2I6XA 2WC9A 3R8EA 4IL6U 2UUBK 5HO4A 4Q5VA 4GIBA 4NXNF 4LVSA 2HHHK 3MGHA 4GXIA 1FTRA 4KHNA 4FWNA 1R0AA 4FLXA 1LXNA 3MMVA 3HVTA 7ICJA 3CJ7A 4DPOA 4XO0A 3N0VA 4NXNJ 2QA2A 1ZOTA 2B3TB 4M7YA 3NH0A 2HDOA 2E7WA 1KVJA 5H1SQ 1R31A 2FUG9 3U3GA 3SUNA 4C97A 5CYQB 3LYSA 1VRUB 3VTHA 4LC9B 4X62F 5AKJA 3C14B 2V9KA 4KTZA 3VENA 1U25A 5IZHA 1QS4A 5D0EA 5CHGA 1RKIA 4KHMA 4P10A 2AT1B 1VQ7N 2VG6A 1O1WA 4YDUC 3P5JA 2W55A 7ICIA 4X62J 2ZVIA 4P2MA 1U1RA 3BBFA 3AXMA 2FPHX 5ETMA 1O6XA 2ZKTA 5AQHA 1C0TB 1WSEA 3OLBA 3VGVA 2FF6A 4URQU 2RQMA 5HQMA 3TWHA 4DO9A 4OHVA 3VQ5A 5HLFA 3OHRA 3QLHB 3QUTA 4CJ4A 3L0QA 3M2VB 3KD1E 5F8HA 4LH4A 3H90A 8ICRA 3BGLA 4AHVA 5J8YC 4B9UA 5SWMA 3MEEA 1NI3A 5GAEI 1P8GA 1QCKA 2CJBA 4B3TJ 2C2OB 3ZTOA 2CNOB 3DV9A 2FVCA 3CCJN 3QGIA 1URJA 4M9GA 4O5BA 4WK3A 2VV5A 5BXIA 5CYJA 1WC5A 2CRXA 3OL6A 3RRHA 3IM1A 2IRUA 3ZZYA 4DTPA 5DM7Q 2KTQA 1RHQB 2VG5B 4DPXA 2NV3A 3TAQA 3MEGB 4NLDA 2VG7B 2W11A 1FD2A 1SQKA 5CCMA 1LKYA 3UQ0A 4F4YA 5EVZA 3FR0A 1OJ4A 1FFWB 1MC8A 2XO6A 1WSVA 3SZ2A 1RI7A 4Y2AA 2K7KA 3HHKA 1NJZA 2DNPA 2YWFA 1ZQOA 4DX6A 1ZTTA 3IBCB 5AI5A 1RTJB 5J0QA 4WJ3B 2JX2A 2B21A 4FJLA 4TY8B 4CF8A 2CGLA 1VQMN 4M9NA 2Q3SA 2IVFB 2IMOA 1NK8A 4CERA 4MLEA 4B9NA 1BD6A 2DH9A 9ICEA 1XR6A 5KFLA 1ZZNA 4DL3A 1ZXIA 5E7OB 2LQBA 4RLEA 2XI9A 3P49B 4Z6DA 5CHCB 1CZBA 3MM5B 5J0WA 1HKGA 3ONNA 3BEGB 4ZH4A 3M8PB 1RT6B 2DIVA 2IBKA 3M6GA 4B9QA 3WNGA 1VLYA 4O0IA 3M5RA 4ZIWA 4PPZA 5IT9Y 1F5AA 5AJ3F 4OPKA 4HHTA 4KLEA 3PKMA 4OLPA 2PDAA 2P9GA 5D0GA 1NG9A 2MA1A 1NGCA 1HWUA 1TP7A 3OLAA 1RQ0A 8RUCA 2LPEA 3MPVA 3WIUA 4OD0A 3G8SA 3GLJA 3BREA 3LQVA 1TL4A 3GDXA 2CQPA 4MIWA 4RU9A 2COLA 3FZFA 3V7LA 4MJKA 5H9FJ 3BY5A 2E9RX 3BPDA 1SIJA 4IQTA 1KTQA 3E58A 1KQFB 3KLGA 3JXUA 4ECSA 2YY3A 3UDCA 5B0FA 5C12A 3BEXA 2DXEA 3KXDA 4USVA 4Y2SA 2CJYB 1OPIA 4KGVB 1CUKA 1ZQYA 1YITN 2QMUB 4FOEA 3TI0A 4NCAA 5DBAA 3H25A 1X9WA 3O5TB 3SFGA 3ET6A 3D28A 4CNQA 2PE8A 5CJ7A 3W8PA 1SUQB 1ZRNA 3VAFA 4E1MA 1T44A 1YTUA 5IWAF 4F3TA 3T5LA 1HKCA 3OS1A 2A19A 4F67A