4B9SA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion outside of the pre-insertion site.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9sA01
5HRNA 4ECYA 2ISPA 2BHNA 2AQ0A 2MUTB 1BQMA 1VRTA 2X6SA 4FLXA 4DTSA 2G8WA 1RCHA 4DL6A 3T5JA 1ZQXA 3VQ8A 3KK2A 4MF8A 4K4IA 4J9KA 4MFAA 3OSPA 5KFWA 3SCXA 3AVBA 5HRRA 3RTVA 3G0ZA 2WONA 1KFSA 3EPIA 4RW6A 5KFAA 2F1HA 5CJ7A 4Z0UA 3RH4A 3MXIA 3AVFA 4I28A 1JLAA 4KLQA 3DLHA 4JK1A 4AHRA 1JLCA 5J0PA 1HYZA 4CF8A 4PQUA 4B9NA 2XY6A 4KLFA 3NDKA 3IHQB 3T5HA 1B9DA 3DLGA 2HHTA 3LZJA 3LP1A 4ED8A 2Z1HA 3PUFA 4M9HA 1RBRA 4B08A 4FJ8A 1WSJA 4PWDA 7ICRA 2AGQA 4FW1A 3SQ2A 4CHNA 1RT1A 7ICTA 3KK1A 4LY7A 1RT6A 4N5SA 4EYHB 4DG1A 3ZSRA 2HNYA 2KZZA 3GV7B 3HX0A 1JLQA 1MU2A 4C8KA 2ZTDA 3PX6A 2NRWA 3V7KA 1ZQDA 4LD0A 3VQ9A 3MGHA 2DFLA 4KB0A 2BDPA 5CB1A 5J0WA 4M04A 2Z1IA 4F2RA 1IM4A 4M3WA 4FZZA 3QEIA 3HJFA 4DF4A 1NOYA 2BPCA 3ZT0A 4R65A 3TANA 4I9QA 1HYVA 4XA5A 3V1OA 1RYRA 4JWMA 4ECVA 5BOMA 3HT3A 1TGOA 2HNDA 3OYAA 4LSLA 3KIOA 3RJHA 3SI8A 3C23A 3PNCA 1JN3A 4YXMA 3PW2A 1U04A 3QNNA 4KB1A 3DLKA 3GV5B 4TUQA 5DKWA 8ICHA 1SUQA 2XRIA 2BGWA 4FJ7A 5DMRA 3Q8KA 1KSPA 4EP5A 5FRMA 3G6XA 1ZQTA 4DL2A 3PY8A 2HB5A 1XWLA 4NYFA 4I2JA 4CIFA 5EWGA 4P4MA 2FPLA 9ICNA 4OGEA 1JX4A 5F9LA 3V6KA 7ICLA 3MECA 5CWRA 1BPDA 4N56A 3AA5X 4O5KA 5KI6A 5KGXA 2LYHA 3I8DA 1J54A 4QCLA 2G8IA 1ZBLA 2C22A 4Z6DA 1UT8A 5KFUA 9ICFA 5L1JA 4YR3A 1U45A 5DB6A 1ZQCA 4NM2A 1BI4B 1TKZA 1TFRA 4N41A 2JEJA 2RKIA 4QWBA 4JRPA 3JPPA 4ED3A 1RTIA 3MXJA 5L1KA 4H4MA 2IMWP 5DB9A 4RQ0A 3MEDA 2IHMA 3OYKA 2DY4A 1S97A 4E19A 3TR8A 1V9PA 4RG8A 4W5RA 3LZIA 9ICTA 3H40A 4YMOA 3NHGA 4QZDA 2QXFA 4CESA 3MEGA 4I2FA 4FJHA 2YNIA 4R8UB 4TUPA 4DTPA 1ZQFA 4C8NA 4Q8EA 2XGPA 2FLLA 5CR0A 2PI5A 5J2PA 4DQSA 1ZBIA 3DLBA 8ICBA 5DLFA 3PMLA 2HVHA 1EXNA 5J2KA 1TK5A 5KG0A 5KFDA 3LAMA 1VSKA 2YV0X 4DL7A 2VA2A 1IKVA 3UXOA 3ISBA 1MQ3A 1HMVA 4QZEA 1DTTA 1LWEA 5DBAA 2D0AA 3O3HA 1S0OA 4DU3A 3HPHA 1W9HA 4PH5A 5KG6A 3C21A 4CEOA 1CLQA 2KZ3A 2BCSA 2E4LA 3NF9A 4J9RA 4RUAA 4CCHA 9ICXA 2BCUA 1S6PA 1KRPA 4W5QA 1VSIA 2FC0A 8ICOA 3OYIA 1UA1A 4P4OA 1WN7A 3B6PA 4FM1A 4I2PA 4DTNA 2ZJAA 3K2PA 3RMBA 3HM9A 3AU2A 4FBTA 4O5BA 8ICFA 2NUBA 4K8XA 4XRHA 2Z1JA 3SUOA 3BDPA 4CGFA 2C2RA 4PHEA 2HHXA 4BWMA 3RJGA 4J2AA 3SQ4A 3IG1A 2P6RA 4NCAA 3A2FA 4O3PA 3DRSA 1F21A 3H7IA 3AO2A 3K5LA 4E3SA 1SV5A 4ELUA 1SL2A 2BCQA 1D5AA 4LSNA 1ZQUA 3C2MA 2RDJA 4F5NA 4QWAA 4CERA 3OYCA 3L2QA 1J5OA 4DU1A 2B4JA 4RUCA 3PMNA 5I42A 1NOMA 2A1JB 2W9CA 1JLGA 2A1SA 2RF2A 4KFBA 4MEXA 2PFQA 3L2UA 5CP2A 4CHZA 1RT3A 3TWHA 3OY9A 2PI4A 4TQSA 9ICLA 3PO5A 3TFSA 3WNFA 1WSIA 3V6JA 1D8LA 3PVXA 5DG7A 1BCOA 4OPJA 5L9XA 4FXDA 5KGWA 5HHHA 3OSNA 1NK9A 4KO0A 1AROP 3E2EA 4F4KA 3RAQA 1WLJA 4ZH4A 3C6TA 2R8HA 2JGUA 5KT6A 3GIJA 5CZ1A 1RT5A 2FBVA 4BACA 4CEFA 1IKYA 4HHTA 4KHQA 7ICUA 4KHNA 2AJQA 3HXMA 4XUSA 5KRSA 1BISA 4QWCA 2DPIA 4PY5A 3RJJA 4ECSA 9ICPA 4F5PA 4JS4A 4OLAA 1JL2A 1A5XA 1HQEA 4F4WA 2G8KA 8ICCA 1ZQPA 3QEXA 5CYQA 1L3VA 1ZQMA 5HP1A 2HHSA 4DL4A 1KEJA 2C28A 3MR5A 4I2QA 4GMJB 4CEBA 2NRXA 3NTUA 3U3YA 1IG9A 3NGDA 8ICTA 1WSFA 3RJFA 1JXEA 1T05A 1VK0A 3K59A 1PZNA 5C5JA 1C1BA 4EBDA 5J2GA 4GLXA 1SZPA 1Z26A 4IKFA 1BPXA 3SQ0A 3Q8PB 5JUMA 3SUQA 3AA2A 3H4BA 4O3RA 8ICEA 1YTAA 1RDBA 2PFNA 3OYMA 3VQDA 3KK3A 4QZBA 4CEZA 2HW3A 1SKSA 3KHHA 4TSXA 1NK6A 5KTQA 2KQ2A 3S9HA 4NCBA 5KRTA 3ZD8A 1U9LA 2G8VA 1Z25A 4RU9A 4IR1A 1S0NA 4EYIB 4RQ3A 4CJEA 1ZQKA 3BJYA 4UQGA 4CJ3A 4RPZA 2Y1JA 4DOAA 4J9OA 4AH9A 3D0PA 4M9GA 4MQ3A 2AGPA 3K57A 4KI6A 4ELTA 3BQ1A 4IQUA 5L1LA 4F5QA 4GVMA 1RTDA 1Z00B 1A76A 5L1IA 1BIUA 1SKWA 3LPTA 5KT5A 2WOMA 2BQUA 4E1MA 4YFKA 4CJUA 4FK4A 4GW6A 3OHBA 5KFZA 5KG7A 1BCMA 3V6DA 3TQ1A 4TURA 8ICAA 8ICUA 3V1RA 4QZIA 2ASDA 1ZBUA 4GXKA 4FLTA 3QNOA 1NOZA 3AVMA 2BQRA 5HLFA 4YMNA 1BVSA 3KLGA 4JV0A 4IR9A 5IIMA 1N48A 2YHBA 4NLGA 4RT2A 3RB6A 2ZQBA 3V9UA 4TQRA 1YTUA 4E7HA 4KRFA 2AQ4A 3OYHA 3WNEA 4CEAA 3Q8SB 3EPGA 5CZ2A 4QZ8A 4BXOB 4K4HA 2X78A 3B0XA 4GC7A 3JPSA 5DGBA 4CJSA 4CIGA 1KDHA 4MFFA 2IBKA 3HSTB 2YNFA 1KVAA 5HMMA 7ICGA 4QZCA 3Q8QB 5D49A 5DLGA 1QSYA 3PX0A 4P2HA 3BQ0A 3RH5A 3QETA 1NJWA 4BDPA 1RBUA 2R8KA 3JPTA 4NCGA 4LVSA 3KD1E 1QE1A 2E6MA 1L3UA 3SQ1A 2B5JA 3NFAA 4RQ6A 2H5XA 4QAGA 3TAPA 3FFIA 3OYJA 2VG6A 4Z4HA 3LAKA 4DO9A 4EP4A 1RDCA 2EHGA 2A1RA 9ICWA 3AVJA 4FM2A 4M45A 2OA8A 5EWFA 1TK0A 4CJRA 2FPKA 3KTQA 3O4NA 4KI4A 3MR2A 2YHAA 5HROA 1RXVA 1J53A 3RR7A 4YG2A 3NAEA 1I39A 9ICJA 1ITGA 4CECA 2ZUCA 4EZ9A 2P1JA 3L2WA 1JIHA 3VA0A 1JXBA 9ICSA 3JPQA 3DLEA 4HCBA 2W9BB 3QERA 3ZT4A 3KLIA 3K5NA 4M42A 1X1PA 1ZQJA 4HVJA 5CY4A 1WSEA 5KT3A 2XCPA 3C1YA 2V4QA 4QZFA 4RW9A 3T1AA 3CFRA 2BPFA 4CJKA 3C1ZA 4BGDA 4UB5A 3RJEA 4CFDA 4RQ1A 2BPGA 3AVCA 1ZQQA 4DSKA 2I1QA 4YMMA 5IIIA 4DEZA 3AVAA 9ICUA 9ICKA 5JS2A 3PW4A 1NJXA 4IRKA 5IINA 1IKWA 9ICAA 1VSJA 4YCXA 3RJIA 4IDKA 3HWTA 3PW7A 4ECUA 4R64A 1S9GA 4Q8FA 3AU6A 3LK9A 4Q44A 3EWAA 3AVLA 2IA6A 2JEIA 4Z4EA 4OGCA 1XSPA 2W8LA 1S1UA 4ECZA 8ICMA 2ZUBA 1UT5A 4O0IA 3TI0A 3H8SA 5KFBA 4X5VA 4KHSA 3VQBA 2GV9A 5K14A 4Y1CA 1QLNA 2OPRA 4QWDA 5J2AA 1RT7A 3LP0A 1XO1A 1B92A 2DTUA 4DQRA 4CEQA 5FDLA 4B9SA 1HUOA 3NF7A 1S9FA 3IS9A 3I0SA 5KFFA 1XI1A 2ALZA 4RNMA 4B8CA 5HRSA 4L8RB 1S1XA 2IHNA 4CJVA 4AHVA 4M6WB 4KREA 4WE1A 2Q3SA 8ICRA 1JLBA 3QZ7A 2R8GA 3UXPA 1TL1A 2FBYA 4E7KA 4YD2A 4UAWA 3DYAA 3B0YA 4UB1A 2OPQA 3UQ0A 4DU4A 4O9MA 4CHOA 4KHWA 3NBPA 1KTQA 1S77D 3ZDBA 1D8YA 4BE0A 4CJLA 3LP2A 4I7FA 4DWIA 4JWNA 2GWSA 1K1SA 2BKEA 3M8QA 4CJQA 4M3YA 2P5OA 4B9UA 4FK0A 4M9LA 3KKRA 4E7JA 3NGIA 4KTQA 3MFHA 1C6VA 2O4IA 3VQ7A 4ICLA 1NKCA 2MAXA 3OGUA 2UVUA 3U3GA 3AVNA 3G6YA 3UIQA 1TKXA 3LPUA 4B8AB 2M9NA 4KLDA 2J6UA 3QZ8A 3QIPA 1NJYA 5FROA 5C42A 3AO3A 4I2DA 4NM1A 4HUFA 4MF2A 1FKOA 5HRPA 4LH5A 3GV8B 4F4XA 4YNQA 5DQHA 1QS4A 3TABA 4M0AA 4HUEA 4FLZA 2KN7A 1LB2B 4ECWA 3TAFA 4YVZA 4W5NA 4H8KA 4M9NA 1X9WA 3CM5A 1XC9A 2Z1GA 4NLNA 2FLPA 4E7IA 4AHCA 3ISCA 5KG3A 5KFPA 1JMSA 3VQQA 7ICEA 4UB2A 1TKDA 3CG7A 1ZQAA 1K1QA 4I27A 5J2IA 3CQ8A 3P1GA 4CJWA 4E1NA 3OHAA 3RB4A 4PHPA 3ZDDA 2IAJA 5KFCA 3VA3A 1ZQYA 4RPYA 3TAGA 4KN7A 1RNHA 1Z3EB 1WCLA 3MDAA 1RZTA 8ICIA 5DDYA 3QIOA 1VSMA 4RW7A 4DF8A 4JV2A 3QEVA 2OWOA 1TK8A 8ICJA 4DSIA 4RZRA 1GOAA 1EP4A 2F96A 5J0SA 1FK9A 1YT3A 4YXJA 2WTFA 1U49A 2OPPA 1SKRA 4ZTJA 2FBTA 1VSHA 3L3VA 4G3IA 5SZTA 1NJZA 4O44A 2Y1IA 1L3SA 3BQTA 2AU0A 2V4RA 2ITGA 3KHRA 3NH2A 1Y88A 1X9SA 5J2DA 4FJJA 4YQWA 4KHUA 3MBYA 3G6VA 7ICSA 3NE6A 3ZCMA 4RNOA 4Z4CA 2F1IA 4DSFA 3QESA 2I9GA 8ICNA 1GOBA 4FBUA 3KLFA 2UVRA 2XY7A 9ICMA 4O55A 1TV6A 3B6OA 5KG5A 1VSFA 4J2EA 4JUZA 2JZBA 2MUTA 3ZT3A 2UVVA 2Q0ZX 1S9EA 3M9MB 7ICQA 4DL5A 4FO6A 4CEEA 5HBMA 4DL3A 5E41A 4PUOA 1VSEA 5EWEA 3OVNA 1C0UA 1KFTA 2ASJA 1NK7A 4CJTA 3U6FA 4W5OA 1I3AA 1BPEA 4KV8A 4IQVA 4KLLA 4IRCA 4Z4IA 4DS5A 4E0DA 2YNGA 3MXMA 2KFNA 5KFSA 5KT2A 4B9VA 1IKXA 3UQ2A 5KFTA 4QWEA 1UWBA 1T7PA 3E01A 4ID5A 4CK2A 4UBCA 1T8EA 1QQCA 4ECRA 3ZSQA 4E89A 5J0QA 4DTOA 4W5TA 2HMIA 1UA0A 2D5RA 2W42A 2ZTEA 4PGXA 3KKSA 5KFYA 3K5MA 4HTUA 4B9LA 4EZ6A 4UAYA 3H8JA 1KCFA 4CJ4A 3DLRA 2UVWA 1ZQOA 2PZSA 5FRNA 1CZ9A 4FJ9A 4B9MA 3ALYA 1RTHA 1HYSA 2FLNA 5J2HA 4F93B 5BPCA 3VQCA 2IDOA 4DTRA 3C2LA 3N4MB 4JV1A 1XHZA 4KN4A 1U48A 2XY5A 3SUPA 5HNKA 2GBZA 1S1WA 5DQGA 1L5UA 4F92B 3AVIA 4EBCA 2ZJ5A 3V4IA 4DLEA 3O3FA 3V1QA 4KLHA 3C2KA 5JS1A 3VQ5A 1BIZA 1T3NA 4DOCA 3S3NA 5SWMA 1ZQHA 4NLKA 5KFLA 1ZYQA 1ZQNA 4FZYA 3CFPA 2HHUA 1ZQVA 3AUOA 4O3QA 4F91B 1H38A 4E7LA 2ZJ8A 4LH4A 2ATLA 5DB7A 4F5RA 4DFPA 3ZSXA 4NY8A 4KLSA 1BL3A 3OYDA 4OKKA 3OJSA 1ZQSA 4AHSA 5J0OA 5KFIA 1RXWA 4FJKA 4CFAA 5J2CA 4AILC 2O4GA 4CIEA 4FK2A 4G1QA 2BANA 3AV9A 4PPXA 1BI4A 1NK4A 4I2GA 3OS0A 3RBEA 3Q8RB 3RB0A 2J6SA 3K58A 5HP4A 1LW0A 3MEEA 3IAYA 1NK0A 4I2CA 3LANA 1D9FA 5IILA 4DMNA 2G8UA 2J6TA 4DSJA 3EW9A 5DG9A 4DSEA 3EYZA 4DFJA 4CJPA 3SV3A 4F4ZA 1BHLA 4R8UA 2G8FA 3EY1A 4FLVA 1RDDA 4PGYA 3NH0A 1DGSA 3LWMA 4I2BA 4I2EA 3GIIA 5J0YA 4C8LA 1CXUA 4ELVA 4RQ4A 2P6UA 4YFUA 8ICZA 1S6QA 4FJ5A 3V7JA 3ZSVA 3KLHA 4NLZA 3FDSA 5CHGA 4KLUA 3KD5E 5J2MA 4ED2A 1COOA 4PGQA 4KLJA 3L2VA 5KFXA 3M9OB 4FZXC 1R0AA 4DQPA 4F3TA 4DFMA 1BPYA 1N6QA 5DQIA 2BCRA 2YNHA 4IQTA 1IH7A 3RR8A 4PHAA 5J2JA 3ITHA 3KLEA 3JSMA 4FJMA 3T3FA 4M3RA 3ETLA 4MFBA 4KAZA 4O3SA 1B43A 2IGIA 1JLEA 3V9WA 5IIJA 4OVLA 1S5JA 3HL8A 2OPSA 5IIKA 8ICPA 2ZUDA 4KLIA 4MEYA 4ED7A 2R7YA 4F3OA 3OS1A 2FMSA 3F9KA 8ICKA 4M9JA 3SPYA 5J0XA 3DM2A 1C7YA 7ICVA 4YR0A 1Y97A 3ULDA 4Q45A 3HK2A 3LALA 4FS1A 5KFGA 3SJJA 3EZ5A 1XS9D 3UXNA 4Q5VA 2HHWA 1WSHA 4QZ9A 4RW8A 5J0TA 4O3NA 4LZGA 3HP9A 2VANA 4DS4A 2PFOA 3ASMA 3OYBA 3RAXA 4N76A 3ISNC 2ETJA 1TAQA 2KTQA 3JPOA 4F8RA 4R5PA 3OYFA 5EOZA 3ZDEA 3HVRA 2JZBB 4CF2A 3OYNA 4KLMA 3ZDCA 1CUKA 3M8RA 1C0MA 3LDSA 3WNHA 3NGZA 2VA8A 1ZJMA 3AO4A 4RT3A 3ZSWA 2W9CB 8ICYA 3RBDA 3ZSOA 1HNIA 2VWJA 5BOLA 2D0BA 1WCNA 3UPQA 4CF9A 1A5VA 3RMCA 1Q9XA 5TZVA 4IQWA 2IOCA 1CEZA 4DQQA 5KFJA 2F8TA 2B21A 1Q9YA 3RB3A 4XQ8A 1ZQEA 3VQAA 4J9QA 3QEAZ 2E6LA 1RT2A 4O0JA 2JEGA 3PW0A 4M3ZA 2G8HA 5CA7A 4DLGA 2EX3A 1REVA 3OYGA 1D9DA 2C2EA 3MGIA 7ICJA 3P83D 4TUSA 2PY5A 5KG1A 4RNNA 2RN2A 3WNGA 2RPIA 9ICGA 3N97B 9ICRA 3V72A 1DTQA 4I2IA 1T4GA 4JS5A 3HPOA 1EXQA 3TFRA 1ZQBA 7ICKA 3DOLA 4EBEA 4K4GA 2BE2A 1UOCA 4OPKA 5J0UA 4J9NA 4NYNA 2PYJA 3RMAA 3LDAA 2ATQA 2OYQA 3PR5B 1TAUA 3HO1A 4CJ5A 3QLHA 2YKNA 4J9PA 2ZTCA 4N47A 1RBVA 4M3TA 1QSSA 2X6NA 4M2YA 5KFRA 3M9NB 4OJRA 4YN4A 1GOCA 3HVTA 3C94A 4FJIA 1L3TA 3T5KA 2JEFA 2HNZA 1RYSA 4CK1A 3PX4A 1Z00A 3C6UA 3ZSYA 1TL3A 5C24A 4QZGA 4GXJA 4Z4FA 2QK9A 3V7LA 4AHUA 4IG0A 3GIMA 2PFPA 3RMDA 3VQ6A 8ICQA 2DFFA 2ZE2A 2B6AA 5EU7A 4O5EA 1U47A 4GXIA 4R63A 4M47A 4DTMA 9ICBA 2LSNA 3SNNA 5KG2A 1XU4A 2W8KA 1NK8A 4ED1A 4RQ7A 4IG3A 4CGDA 1ZQWA 4O4GA 5KT7A 4KMUA 4Z4GA 1N5YA 3QEPA 3OYEA 4FLYA 5F9NA 5KG4A 4UAZA 1BQNA 4RQ5A 5T7BA 1JL1A 4FLUA 3PV8A 4K8ZA 3M8SA 9ICQA 3GQCA 4FW2A 2ISOA 1LAWA 4PHDA 2KFZA 4UB3A 1J9AA 5KFOA 3Q8MA 3BGRA 3F73A 1KVCA 4YD1A 4BXOA 2VG5A 3AO1A 8ICVA 3SYZA 7ICPA 2PYLA 3QINA 3AA3A 3KHLA 1S0MA 1HRHA 4FJNA 3AVKA 1SL1A 3C5GA 3G10A 3O3GA 4OKJA 2P5GA 2IC3A 1ZBFA 4KLOA 3LWLA 2NRZA 5J2FA 2W9MA 3V9SA 5KFNA 4ED6A 2XY8A 4I2AA 1S1VA 4IFVA 3DRRA 4JRQA 3VQ4A 5DDMA 5DG8A 3PO4A 1C0TA 4Y1DA 1K6YA 3SUNA 3K4GA 2FMPA 4GC6A 4RQ2A 3HPGA 3RRGA 5C25A 1NKBA 3RJKA 4OKEA 4ECXA 4CE9A 4RPXA 4HYKA 4FJLA 4YP3A 3QE9Y 4F4YA 5DK5A 4QOZB 1IXRA 5J29A 4KTWA 3OJUA 4J9MA 1U4BA 2IS3A 3SV4A 1RTJA 4HCCA 3SZ2A 8ICXA 4B3OA 3ORYA 4M3XA 3C5FA 1EX4A 3GILA 5KFQA 4RQ8A 2YKMA 3KHGA 3O4QA 2XGQA 4UBBA 2BQ3A 3CFOA 2NRVA 3FYHA 3CM6A 3GFKB 5I3UA 2VG7A 1RBSA 1BPZA 3THVA 2W9BA 7ICIA 1KFDA 2C2DA 2HHQA 7ICMA 1ZBHA 3NF8A 3I0RA 1CXQA 2KW4A 8ICWA 3QEWA 4EEYA 4H4OA 3HP6A 1HQUA 1QHTA 5DB8A 3ZT2A 1TVRA 5KFHA 1HJRA 4FM0A 3H08A 1O1WA 2ASLA 3C95A 1EETA 1NK5A 4F5OA 3K75D 3VQPA 4ECQA 1XSLA 3SI6A 1XHXA 4DFKA 3Q8LA 4FVMA 4KKOA 4HUGA 3QO9A 4ZHRA 1LV5A 4FCYA 4KLGA 4BWJA 2QKBA 3TAEA 4QZHA 1A77A 1ZQGA 1WAFA 3ISDA 3OYLA 3TAQA 1A5WA 2FPMA 1RPLA 3MAQA 5J2BA 3IM1A 1Q8IA 2VWKA 2XO7A 2W9AA 2QKKA 4MFCA 1JKHA 4CGJA 3V9XA 3S3MA 1KLMA 4KPYA 7ICOA 3M8PA 3MDCA 4KLEA 1LWCA 5D4BA 1VSLA 1ASUA 3RH6A 1HUZA 1W0HA 1BGXT 5DBCA 3KJVA 1N56A 2D0CA 3QEBZ 7ICHA 5DGAA 4RW4A 3ZDAA 2DPJA 1RBTA 1ZQLA 3NCIA 1T03A 1S1TA 4IRDA 3ZSZA 5J0RA 3OS2A 5KFEA 3ZT1A 4KHYA 5KFMA 8ICGA 1G15A 4M6WA 3JPRA 1ASVA 2X74A 4BDYA 1FKPA 3V6HA 1LAVA 1LW2A 3GDXA 4Z6CA 3RWUA 4DQIA 4CEDA 1DOQA 4DOBA 1B9FA 1VSDA 4J2BA 4F2SA 3TAMA 4CFBA 4CK3A 2FBXA 2ZD1A 1JXLA 1B22A 3L2RA 3MR3A 3MABA 5IIOA 2BGGA 3SPZA 4J9LA 3TARA 5D46A 3K5OA 5HHIA 4DTJA 4J9SA 1CZBA 4ED0A 2PXIA 3H8WA 4QZAA 4DTUA 8ICSA 1X2IA 3JYTA 2FMQA 4O5CA 2F1JA 2NRTA 3VQEA 4ECTA 7ICFA 4IFYA 3L3UA 3V9ZA 2R8IA 1HJPA 3IRXA 4M3UA 1HNVA 4CF1A 2P66A 3ZD9A 3CYMA 1BPBA 7ICNA 4J2DA 4C8MA 3HW8A 3PR4A 4OLBA 1LWFA 1QSLA 1HPZA 4ZTFA 3DRPA 3AA4A 4FYDA 4CJFA 4CHYA 1S76D 2GUIA 3AO5A 3T19A 4PA1A 4CF0A 2R8JA 3H4DA 4DSLA 4DTXA 4O3OA 3MR6A 4C8OA 4I9LA 4KITB 1TKTA 5HMLA 4YR2A 9ICIA 3HYFA 2F8SA 5J2NA 2XHBA 3RRHA 2AGOA 1NKEA 1WAJA 3MFIA 2KZMA 5KFVA 1ZETA 4CHPA 4FLWA 1QTMA 9ICOA 1YVUA 2OZSA 4M41A 1S0VA 9ICEA 2V9WA 3DI6A 3NH1A 3NF6A 3V81A 4CGGA 2JLEA 4CGHA 1KLNA 3T5LA 5D3GA 2RDIA 5KFKA 4B9TA 3P5JA 1RDAA 4BDZA 1C1AA 3NGYA 1IO2A 1SL0A 2BCVA 3JPNA 4XIUA 1S10A 5J2EA 4AHTA 1TVAA 4Q0BA 4LZDA 4IBNA 4Q43A 1RT4A 5CYMA 3AVGA 1KVBA 4P4PA 2XC9A 3S3OA 1WSGA 2HHVA 3L8BA 5J1EA 3PW5A 3DOKA 3AVHA 3VN5A 2OZMA 1FXXA 2HVIA 2I5JA 4QW9A 2XCAA 9ICVA 4CHQA 1TV9A 9ICHA 4JLHA 4ID1A 5DBBA 1MSWD 1ASWA 4UB4A 3BQ2A 4I2HA 1X9MA 9ICCA 1UAXA 3LP3A 4NXZA 2VA3A 4Z6EA 4Z6FA 1ZQRA 5J2QA 4FS2A 1WNSA 4R66A 4FJGA 1JLFA 1ZQZA 1XSNA 1MQ2A 2DFHA 3DMJA 1DLOA 4F50A 4BE1A 1MC8A 2BR0A 4KTZA 3GIKA 4FJXA 5KT4A 4CFCA 1ZQIA 4CGIA 2DFEA 4BE2A 1EKEA 2P51A 1RILA 4KLTA 8ICLA 1VRUA 3D45A 2A1JA 1C1CA 4I29A 1ZJNA 4QW8A
chains in the Genus database with same CATH superfamily
2ISPA 1RHMB 1VRTA 4DV1J 4K0KJ 4DL6A 4WXOA 2HOEA 1ZQXA 3MMVA 5KFWA 2UP1A 5ALFA 1ZD2P 4WKRA 5JLHA 3RTVA 3EPIA 1VS3A 3CMQA 4Z0UA 1N5TA 2NRHA 1X7VA 1T11A 4JK1A 3SXLA 4LF8J 4AHRA 2XI2A 1HHTP 4GVBB 5E33A 3P4UB 4KLFA 3NDKA 4UAVA 2UXBF 2IYIA 4OQJA 2QYCA 4ED8A 2A6MA 2ASYA 3PUFA 1RBRA 3R8EA 2AD9A 1HW9A 2AGQA 4ID5B 3J80O 1U7LA 1RT1A 7ICTA 1UEUA 3TKAA 4GKJJ 3MEKA 1F6TA 4LY7A 3KD3A 2W01A 2R18A 4DG1A 4TKTA 4Y0FA 3GV7B 1RK8A 1JLQA 4Y2IA 1MU2A 1FE4A 1KS2A 3I76A 5J8YC 2EFNA 2DNPA 4ZVPB 4JKFA 3UB5A 3V7KA 3H7HB 1JKHB 3WC2A 2ERRA 1RSCA 5J0WA 4ZJQA 2BRLA 1LWCB 2VFTA 1FO1A 3CC4S 1IM4A 2JL9A 1H2UX 1HNXF 1X3NA 4R65A 3TANA 3I9ZA 4I9QA 4XA5A 2ZWPA 3V1OA 1VLOA 4PZNA 5BOMA 1HNWJ 3PYGA 4YXMA 3I56N 1NHKL 1KD1O 4WKYA 5T14A 4K4XA 2G2ZA 4FJ7A 3QYYA 3NNAA 3D2EB 4OD0A 2DNRA 2BYCA 3GOIA 3PY8A 1XWLA 4NYFA 2WF6A 5EWGA 2GO8A 4BC4A 3CI5A 3Q22A 5K9FA 9ICNA 5HMWA 3R9PA 1JUDA 3CDUA 5F9LA 5AM0A 2OSRA 4IWVA 3UKRA 3OR2B 3MECA 4WU3A 2ZBQA 1R43A 3ENOA 2UV8A 3E51A 2LYHA 3N4PA 3UN3A 1J54A 4QCLA 4BRPA 5H9EJ 3H90A 2QX0A 1UT8A 3WIUA 2E1EA 5I3PA 5ETLA 4IH5A 4QNLA 5A0YB 4NM2A 1T9VA 1M0SA 1TKZA 1TFRA 4NXNF 1N5VA 2YQ0A 1BMQB 2DNQA 2JEJA 3JPPA 4ED3A 3MXJA 3HHDA 2IHR1 4ZVGA 2BKPA 2ZIUA 1LW0B 3MEEB 4AL5A 2BMBA 3MEDA 2RRAA 2DY4A 3G8QA 2W55A 2ZH3A 3TR8A 4U8VA 4KBIA 3LZIA 3CTRA 1IBMJ 1TYQA 4C0BA 3TQEA 2CQCA 3VAIA 1F3FA 3CDBA 3NHGA 4L74A 3EGWB 3W1YC 2HBZB 2YNIA 2E1MC 3R27A 4B1XB 1Y10A 1FWLA 4DTPA 4C8NA 4HR2A 1P1LA 2XGPA 3VMFB 1TTHB 5ALHA 2FVPA 4DQSA 2VIHA 4C97A 5DLFA 2V5HG 3S6EA 5J2KA 3GFXA 1XO0A 1AFJA 3CCMN 2V4JA 3MI7X 3LUYA 4DL7A 2HVZA 3RVCA 2PC6A 1HI1A 2MSSA 1MQ3A 2ES6A 2R2SA 1DTTA 2D0AA 3O3HA 1A0PA 1S0OA 1W9HA 2LYAA 4BRQA 3KXDA 2JFKA 4PH5A 3UDVA 3POTB 3C21A 3VZIA 4CDIA 5J2MB 1F44A 3DNCA 4PWWA 4CCHA 1S6PA 5D0HA 1F0XA 3AODA 1UFWA 2N4CA 3R5AA 1R0AB 1IUJA 3NRBA 1VSIA 4W5QA 2FC0A 8ICOA 3D2QA 1R6YA 4KBOA 1UA1A 3KLEB 3B6PA 2LMIA 4ITSA 1GO3F 1KHVA 4DTNA 3BREA 3K2PA 2XZWA 2OPSB 2NZTA 1PCAA 3AU2A 1V3SA 2MEWA 4JB3A 1XEZA 2NUBA 4WK3A 2JH1A 3BDPA 1FA0A 2IVNA 2NCKL 1UPHA 2ESEA 2LQ9A 3TJAA 4P0QA 4ANEA 4JI6J 4MK8A 3QNWB 2UU9J 2KRRA 3THWA 4KR0B 1PO6A 2XWXA 3M2UB 1F21A 3K5LA 1LFWA 1Q78A 4ZVRB 1SL2A 3SJHA 2P2CB 3SBGA 1QTNB 3MM8A 3C2MA 4M5JA 2RDJA 1FEEA 4BRIA 4PG6A 1NOMA 3HSJA 2QLXA 3CERA 5CP2A 2E1FA 2E7XA 4CHZA 1K8AT 1RT3A 3L7OA 3TWHA 1R8BA 1BWVA 2PI4A 2HSEB 3N6NA 4ZPTR 3UPFA 5BRHA 2VQFK 3TFSA 3WNFA 2MHNA 2GAGC 2Q1NA 3PVXA 5DG7A 4OPJA 5L9XA 4RLEA 1HD1A 3ENAA 5HHHA 3IUCA 3OSNA 2BKOA 4KO0A 4BHQA 5LMNF 4F4KA 2YCHA 3RAQA 3C6TA 1ZA2B 4ER8A 4HVZA 1HI0P 5CZ1A 4FO0A 1S5ZA 1RT5A 1HLWA 4UASA 2ZVIA 5HR6A 4LR9A 5IT9Y 4X4PA 1WEXA 2FY1A 4DR1J 4KHQA 1NZBA 3N7SC 2AJQA 4OX9F 4RR5A 5KRSA 4ID8A 3A3PB 4DU8A 2DPIA 2R42A 2ACYA 2V2KA 3O5BA 4QIWC 3M2RB 2F8HA 3R97A 4JHDA 4AL6A 3U1LA 2LECA 2BJ8A 2CPEA 1YJWS 1IBLJ 3FZHA 4OLAA 1JL2A 1A5XA 3T1YK 2LEBA 4C7YA 2JNJA 5A6PA 2FDRA 1WC4A 1K9MT 4B3SF 2W6LA 1H2VZ 4DCOB 2PFUA 4ZOHC 2CNNB 3D1HA 4CEBA 2OTLN 5BPNA 5DDOC 3NGDA 1IG9A 8ICTA 2QL9B 3FSXA 1RYUA 2H3IA 1RWWB 3VC8A 4YY3J 5C5JA 1C1BA 3DOLB 3M7VA 4IKFA 2F5GA 4P73A 5AQTA 4JI4K 3EXYA 3OVSA 2PFNA 2H48B 2PA8D 4BG9A 4LREA 4EWTA 1M1GA 2WB1D 2YKNB 2QC3A 1Z25A 4B1YB 4WP8A 4AF1A 1RHRB 3OBWA 3BJYA 5AKIA 4PL1A 1S7HA 2LFVA 4CJ3A 4RPZA 3C19A 4J9OA 4M9GA 3CHWA 3HSGA 3HHKA 2A6AA 3MN5A 3BQ1A 4F5QA 4GVMA 2GMLA 1DQ8A 5L1IA 4WCEL 2VPXB 3IBCB 5EE3A 2AMCB 1SKWA 3N7RC 3MAHA 1U25A 5KT5A 2CJAA 1GMWD 1ZBTA 2H3QA 3QIDA 2GOLA 4IOBA 2QLJB 3KNAA 2F9DA 3SMZA 5KG7A 1BCMA 4CF3A 2B6AB 4DV2F 3V1RA 4QZIA 4B3TK 3CCVN 2ZH9A 1ZD3A 1F3VA 4GXKA 2WVFA 4Y2VA 3PACA 4A8XA 1NOZA 2XYHB 1UKUA 1NGFA 2VF3A 1N5YB 5HLFA 2A41A 2RHKA 1AW0A 2ZH5A 5C12A 1KNZA 1N48A 4AUKA 4MKAA 2YHBA 4UB6U 2RKIB 2RP5A 4BCAA 4E7HA 4KRFA 1TMMA 3D2WA 4DV3J 3BGRB 3SEIA 1V5VA 4CEAA 5CZ2A 4BXOB 4A2BA 3H0MB 4GC7A 3LVWA 1CBKA 3J7ZT 3QBWA 5DGBA 3N0VA 4CJSA 2VONA 4MFFA 2R7QA 3AOAA 3ED5A 4E2FB 1NDLA 2WMMA 1J6ZA 3PX0A 4DR3K 3UN2A 4F71A 3DRRB 3BSAA 5EDWA 3KD1E 4MAKA 3H5XA 1QE1A 5L46A 1IKVB 1RWNB 3D5MA 2E66A 3TAPA 3OYJA 4RWWA 2GVZA 4LF1A 3LAKA 4DO9A 3IP4B 4AM7A 2EHGA 9ICWA 4U8YA 2QLTA 2GJFA 4M45A 1GX5A 4C4TA 2BEFA 3WXKA 1MMDA 3O9SA 2VASA 4PKHA 2NRRA 4DV1K 4H0TB 1N5XA 4K0KK 1DKGD 3MR2A 2YKMB 3O8WA 3RR7A 2C3UA 4YG2A 3NAEA 5EY4A 3DEEA 2DY9A 2VG7B 3L95X 1JXBA 1B64A 2CQ4A 4HCBA 3QERA 3ZT4A 3KLIA 3D2FA 4JK7A 1ZQJA 1N36F 1AUDA 4LF8K 2XCPA 1XMBA 3JSYA 4H4OB 4RW9A 1F0MA 4FPAA 3CFRA 2VKRA 5ETVA 4KHPJ 1WI6A 2FJ6A 3RJEA 4CFDA 4M5DB 4RQ1A 2BPGA 3AVCA 4C80A 1ZQQA 2RRBA 1SXDA 2KT5A 3W9JA 4YMMA 9ICUA 2VKZG 3N6LA 2QWLA 1NJXA 1OIAA 2VGNA 1VQ9S 4GKJK 3A5NC 3I8BA 4YCXA 5F1XA 1YVNA 3NOCA 2VCPA 5ALQA 4ECUA 4ZHRB 2ZOGA 1K8AO 2YMQA 3EWAA 2E9RX 3U4LA 2NXUA 3AVLA 2IA6A 1FRHA 2QA4N 3HX9A 1GQEA 1RAHB 4AQYJ 8ICMA 3O1BA 2DT9A 2ZUBA 4LF7F 1UT5A 4DV0J 3MTKA 4OI4A 1SPBP 3FJ2A 3UI3A 1RAGB 3DXBA 2M8HA 3CD0A 4LBHA 4EFHA 1EWRA 2A10A 3C6AA 5J2AA 1F5BA 1S49A 4USKA 3I6PA 1T3VA 4MJKA 2JV3A 1RU2A 2WAQC 4M7XA 2PT0A 1HWJA 2YVSA 1HUOA 2KYXA 1ZOLA 3PYDA 2K4PA 1LOUA 4R0JA 3C0BA 3Q7CA 5TKWA 2LKYA 1GMUA 4A48A 4RNHA 4PXDA 4I6MA 2E8NA 2IHNA 3W8GA 1KAXA 3FUYA 2GMJA 3TX0A 3GFZA 4BR9A 3QZ7A 1XR5A 4ZVHA 1B0TA 4X64J 1TL1A 4OZ1A 1WORA 2XO6A 2WC9A 4JKEA 5AQXA 4UB1A 3O0FA 1NUEA 4KHWA 3NBPA 1KTQA 5F8JA 2ZD1B 4BE0A 4I7FA 3O44A 2BKEA 3UKUB 4CJQA 2P5OA 1VOMA 1F5AA 4OV6A 4FK0A 3KKRA 5IT0A 1Q82T 5H9EK 4Z37A 2MA1A 1PUZA 2G1HA 1JNZB 5AE2A 3D7SB 2MAXA 3OGUA 1JMTA 1JI7A 2CKWA 4WU2A 3G6YA 1LKYB 1HNVB 1D0EA 1W25A 3TR5A 3QIPA 1FJGJ 1NJYA 2CVEA 3HJEA 3IWXA 4NM1A 1XNSA 1LWFB 2GH1A 1HPZB 5HRPA 1IBMK 3DRPB 4F4XA 2Z8QA 3G8SA 1N5SA 3RSEB 2DYAA 5AK3A 3G96A 1W26A 4Y2KA 2WOMB 3FC4A 3TAFA 1HBOA 5GAHI 2B4PA 4W5NA 3CDEA 4M9NA 1RDFA 4ZKAA 2GWKA 3QWUA 1A7GE 1KQFB 1HI8A 3V6DB 3F41A 1XC9A 1X5TA 4URSA 1Z4NA 1Y64A 5KFPA 1JMSA 1NLKL 2KHDA 2P9LB 5J2NB 4RX6A 1BNPA 4UB2A 2EC0A 5AQUA 2O8BB 2LA6A 1K1QA 2IFXA 5J2IA 3CQ8A 1GAOA 2Y3YA 2CG4A 3C3LA 1MNEA 4PHPA 3M1YA 4BRMA 2XMKA 5KFCA 1RACB 3HOTA 3VA3A 1P27B 4A4JA 3EN9A 3TYTA 1BA1A 3R1XA 1HWIA 3D28A 1P9YA 2BM1A 2H5IB 3F56A 5ETKA 4RW7A 2RT3A 3QEVA 2OWOA 2OFGX 3G6ES 1CS4B 2JZ5A 4USUA 5J0SA 3KBBA 1FK9A 2P5VA 2WTFA 1U49A 5CR4A 2P9PB 2G09A 2DNMA 3VGSA 4Q0BB 2OSQA 1V4TA 1RT4B 5CYMB 2P9UA 4O44A 4ZCMA 2O6KA 1L3SA 4K5SA 2F9JA 2ZUGA 4JI6K 1VI7A 4H0PA 4OLOA 2QWOA 2GC8A 3NE6A 2PBDA 3TTCA 5EOYA 3ZCMA 2D9OA 2CXYA 2A2DA 2F4FA 3ZTRA 3QESA 2I9GA 8ICNA 2JMGA 2LBOA 9ICMA 1EKSA 4O55A 5M1FA 1SWVA 4CE6A 4JUZA 2JZBA 1S79A 2MQNA 3OR1B 3IKMA 3BR9A 1XBWA 2N3LA 4KJIA 4FWNA 4FO6A 4CEEA 5F8IA 4TLQA 1L3KA 5F3TA 5B66U 2HQFA 4P2FA 2RILA 5EWEA 4IH6A 1C0UA 5IWAF 1BA0A 1WOOA 2YWEA 1BQMB 2KJWA 3W3SA 1R27B 5BRFA 2QA1A 4I69A 1FJEB 2R7OA 2RIJA 4F67A 2NYVA 1NK7A 3FNNA 1R0CB 1BPEA 4KV8A 3UD3P 5ETTA 3AAWB 4P74A 1OVQA 2DBYA 3G4SN 2EG1A 5M2PA 3CJAA 4DS5A 3EM1A 4Z4IA 2J9DE 1VQLS 2F8LA 3UM9A 1IKXA 4NPOA 4UAUA 1JRPA 1JLCB 5DM6Q 1A0OB 1QQCA 1K0TA 1IBLK 4E89A 3M2VA 3EX7B 3W3DA 4YUDA 2HMIA 4W5TA 2D5RA 1U2FA 2W42A 4PGXA 3K5MA 4U7UK 2NXEA 4HTUA 4RWTA 4PWDB 3GBTA 3ZEUA 4YB5A 2E5GA 5F8NA 1P8GA 2CUYA 3H8JA 3U7JA 4YHHF 4CJ4A 4YY3K 2UVWA 1ZQOA 2ZWHA 1OH6A 4FJ9A 4F72A 3ALYA 1XNQJ 3TX8A 1JXVA 2YKOA 2FLNA 5J2HA 5J1NA 4OX8A 1HKBA 1PSDA 2M5YA 4PRFA 4KN4A 4JI5F 5LMUF 5HNKA 3SUPA 5DQGA 2VBWA 3AJDA 4E1JA 1WUUA 4PJ0U 1TP7A 1B7FA 4EBCA 3UCZP 3V4IA 3O3FA 4CZMA 1N0VC 5CD4A 2V34A 4DUYK 1DJ0A 5JS1A 1HBMB 1SIWB 3TNVA 4LF5F 1TAMA 3C7NA 2ZM6J 2DY1A 3PJWA 1VQMS 5KPZA 4FYWB 5SWMA 1P1TA 2WFAA 1Q86T 2DH8A 5KFLA 2UXCK 1ZZFA 4DCCA 3R3TA 1J2VA 3NG8A 4JI0J 4TY8B 1WHXA 3AUOA 2IPOB 5E3RA 3TADC 2V52B 3DLKB 2OO4A 2ZOMA 4OHVA 1RHUB 1SUQB 4RBTA 3CJ7A 1DY3A 4NXMF 1H6KX 3GONA 4DFPA 3ULEA 1HR0J 2DHAA 4MDBA 3RU0A 4NY8A 2B56A 3OYDA 4JKBA 1OWXA 3H45C 3OJSA 1LQ9A 4IL6U 4K2JA 1Q8BA 1EWQA 5J2CA 1YGYA 4AILC 2O4GA 3BS7A 5LL6Z 5C10A 4FK2A 2YTCA 2BANA 1NDCA 3S1TA 1RP5A 2IDLA 4PPXA 1BI4A 1J2MA 3IO1A 4I2GA 1RQLA 3QJLA 3M1VB 3LL3A 1NK0A 4I2CA 5C42B 3LANA 5AFUA 2I5HA 1YSJA 2G8UA 1NDPA 3HTVA 3AQOA 2DGTA 1ZD5A 4CJPA 3GJQB 4A8EA 2E9TA 1YJWN 1FFGB 5CCMA 4HT5A 5ITHA 4H4MB 2FVQA 1KOOA 3U9ZA 1NJIT 4MO5A 2FC9A 3CSKA 3ILIA 2YQ3A 2DGWA 4HEA9 4HHHA 1PILA 3FMWA 5IT9O 3VR1A 1O5JA 2E2OA 4Y28C 3MEGB 5FLXY 4ELVA 5DETA 8ICZA 3HFVA 1S6QA 3W65A 5AJ3K 4WFYA 2O8EB 1YDLA 2YBVA 3V7JA 4XH4A 4AE5A 3SD7A 1N33K 2WVBA 3FDSA 4F02A 3KD5E 1GX6A 3L2VA 1U1KA 4YOUA 1BPYA 1N6QA 5F0XA 1IH7A 3P39A 3RR8A 1HMVB 3IC1A 3T3FA 4M3RA 3QJPA 3LPYA 3ETLA 4ZOSA 3G71S 1B43A 1H7WA 4BR2A 3VAJA 1JJHA 4OVLA 4U96A 4G6VB 1RWMB 2IIHA 5IIKA 4F7VA 5HL7Q 3OS1A 3MDFA 3FZFA 2FMSA 2R7RA 4M9JA 1TMJA 3DM2A 4DR5K 4YR0A 2J0WA 2UUAF 4Q45A 1PC4A 1Q3VA 4UZBA 4Q5VA 2HHWA 2RU3A 2YPYA 5BYSA 3HHEA 1FW6A 5GVQA 4LZGA 4H5NA 2V8HA 2YWWA 5GAGP 3R9LA 3VGVA 2VANA 2PFOA 3EE3A 2ZJRQ 3MAAA 3RAXA 2EXUA 3MCMA 1RAFB 4N76A 3KLFB 1R89A 1CJVB 3JPOA 3IGVA 1NBWA 3CO9A 4F8RA 2VQEK 4DJBA 4OHZA 5EOZA 4LFAJ 4ZMMA 3HVRA 3IG1B 3M30A 3OYNA 1N61A 1M5HA 2NYHA 5LJWA 2PMZC 1RGVA 1SV5B 1X4HA 4PL2A 2DK2A 4ZPAA 3NGZA 2VA8A 4CH0S 1SJ4P 3AO4A 1NGHA 1WHWA 2RF2B 3RBDA 4KFBB 2HZVA 4BVPA 1AZSB 2VWJA 4DV0K 2LVWA 1WCNA 1OY8A 4V19J 4IQWA 2IOCA 4ZPDA 1RCOB 5KFJA 5G0RA 1KKHA 2B21A 2Q97A 2Q43A 5AQFA 2JEGA 4GKKF 5CA7A 1MROB 3EVWA 2HI0A 2EX3A 3P83D 2GS8A 4DR2K 4TU7A 1RDUA 3OW2M 3H6EA 4JYAK 2RHSB 2CPRA 3N97B 4B3RJ 5AQMA 1RCXB 1WUAA 1DTQA 3R5DA 4X64K 2D6FC 3OUYB 2VPZB 4BQLA 2ZJPQ 1MLAA 3TFRA 4PPDA 4K4GA 2DHGA 3W2VB 1BD6A 4JV5J 1GLEG 1N63A 5J0UA 1X3MA 4J9NA 2E1RA 4QIWF 3SSSA 1T6DA 4DR7K 1TAUA 3SEOA 4CJ5A 3HULA 4K50A 2VIXA 1YBTA 3A5OC 3DDIA 1T05B 3AA8A 1YKWA 2A1BA 4N47A 2MSNA 1VHIA 1FT8A 1N88A 3QJJA 1N34J 2D3ZA 2DRBA 4U67Q 3T5KA 3GU0A 1GH8A 2JEFA 1VQKN 1FJGK 4CK1A 4RNFA 3ZSYA 4P52A 5C24A 4Z4FA 1D1UA 5AKXA 3GE9A 2DHXA 5K8PA 2ZFHA 1FNXH 2NO4A 4L3NA 2KXNB 1HL6A 1G7CB 4NZ0A 2M3DA 4RJVA 2HQ3A 3FZMA 1U47A 4GXIA 2V67A 4DTMA 2VU5A 5BR8F 5KG2A 4ZIVA 3N4QA 1C2PA 2X51A 3WHIA 4BC2A 3UCUP 1ZQWA 5KT7A 4Z4GA 2YWHA 3FAHA 3QEPA 4A62A 4X4TA 1Q81T 4UAZA 2DGSA 3KKAA 2FJDB 4EHUA 3DXMA 2J76E 3M8SA 2BRKA 3GQCA 3DDNA 4FW2A 3W9IA 2XYPB 3HOSA 2KFZA 3MPUB 2CJQA 3QU7A 4U6PA 5A8RB 1O03A 1PK1B 3NWRA 2BV3A 1CZAN 2VG5A 5ALWA 8ICVA 3SYZA 2MKHA 7ICPA 4IYQA 3THYA 3KHLA 1DT9A 2P9NA 2AYBA 5AQYA 3SQGB 5LSOA 3G10A 1SIJA 3O3GA 1DAXA 2P5GA 2IC3A 4KLOA 2NRZA 3KFWX 2CQ1A 2DJWA 2CPIA 4HL9A 2W9MA 2Z2ZA 2IMOA 5KFNA 3DXKA 2UUBF 3OD2A 5CCLA 2C2NA 2N4DA 5IC4B 4I2AA 4WQ4C 4CLPA 4IFVA 1KXPA 4OPHA 4X4OA 2PA3A 4Z7YA 3LDPA 2JR5A 1WSVA 3MWTA 2D9PA 2ZKTA 3E3XA 5ADXA 1K73T 4GC6A 4I56A 2IM2A 5C25A 2RLTA 2CNOB 4CE9A 4RPXA 1LKZA 2MZRA 1FERA 2QSWA 3QE9Y 4DX5A 3K8VA 4CTAA 1XIQA 1FD2A 3MPYA 3CE8A 4KTWA 1L8OA 3BS5A 4TU8A 4CO5A 4DR6F 3MUMP 3SV4A 3KUEA 4M3XA 1S8OA 3GILA 3NOGA 1Q0NA 4BR4A 5HOOA 3C16A 4FP9A 3BBCA 4JKAA 4PG4A 4UBBA 2BQ3A 3OA9A 2NRVA 3JB9k 2GNKA 2GO9A 3CM6A 2WAQD 2B0CA 4FOEA 4LR7A 3WX4A 4P72A 2GVDA 2E1AA 1K5OA 3NGSA 1G2EA 2R3VA 4CM2A 2LP4A 1G4CA 1CXQA 3TA0A 4LRBA 8ICWA 1KP6A 5G5HA 3HP6A 4WIQA 5DB8A 3ZT2A 4UOGA 1NBEB 3A8JA 2ZIXB 1U2RA 2YN4A 5HQ8A 4GV9A 3H8MA 2AT1B 4DUZF 4JI8F 1LEOA 4FYVB 4FM0A 1GXLA 1M90T 1VK8A 1WF1A 3D1QA 3H08A 3AAPA 4ZPVR 1EETA 3A8KA 2ROPA 2HFSA 3SI6A 1XHXA 4DFKA 1JJ2M 3TSUA 5KOXA 5C0YA 3QO9A 3A8YA 2MSTA 2ABYA 3R1LA 3P38A 4OYXA 4NLCA 1RUSA 4NXNJ 2HOIA 1ZC6A 4ANCA 2W24A 4YDDB 4J8FA 4H5RA 1UHUA 2CJBA 1RPLA 1IKWB 3CMEN 3VF4A 5J2BA 1R3NA 3GJTB 3IM1A 4Q2MA 3NMAA 1V9OA 1HNIB 4IDKB 4LR8A 3EICA 1XNQK 2XO7A 1JKHA 3S3MA 4USVA 3MDCA 1LWCA 5D4BA 2IJFA 2A2CA 3CC2S 3KJVA 5BN9A 7AT1B 1H0HB 2D0CA 3ZDAA 2DPJA 2ASPA 4W92B 3PIPL 4DBQA 5ETMA 2WRMA 1RT7B 2LQ8A 1XTZA 3D68A 2LDIA 5KFMA 1YBAA 4PXCA 2ADBA 4H4KA 2V0NA 2ZJQQ 2CQ3A 2P9CA 3B8HA 2WFBA 1I51B 5JICA 3IMXA 1B9FA 4J2BA 1W2IA 3IS9B 3I32A 2CQ2A 1HWUA 2NR0A 5KL8B 2WAQF 2HAFA 3D6FB 1ATRA 1K8KA 1S1XB 2WHEA 4BR0A 1HR0K 2KHCA 4ZLLA 3MABA 1JLBB 1IR1A 3SPZA 5ALJA 1WC5A 1NGGA 2K4IA 2KKHA 4J9SA 3DYAB 4DTJA 1CZBA 4IJAA 4ZIWA 2OPQB 4ED0A 3H8WA 1N2XA 8ICSA 3VQEA 4IFYA 3LP2B 3L3UA 1J2NA 5JRTA 3M8QB 2IBOA 4M3UA 5E26A 4RTFD 4OI3A 3TUIC 3ZD9A 3VGUA 4J2DA 4H0OA 3HW8A 1Y5NB 4K4TA 4OLBA 2H4WB 1I3OB 1DURA 4DOZA 3F2DA 5HMXA 9ATCB 1S4EA 5K8NA 2LA4A 3PZPA 2E20A 1TELA 2YXLA 4O4RA 5BR9A 3IDWA 4CDGA 2YI1A 4K4YA 4PA1A 3O8MA 3PFEA 4C7ZA 4NEYA 4NRTA 4O3OA 4C8OA 3X1LB 3QFWA 5HMLA 4HACB 1FNMA 3H5SA 2IJNA 1OO0B 2XHBA 3RRHA 3MFIA 1S99A 1KQGB 3VGTA 4O4GB 5AKHA 3LGMA 4CHPA 3W61A 2HURA 2K8GA 9ICOA 2OZSA 5GMDA 2V9WA 3DI6A 3NF6A 4DHVA 3V81A 4ERDA 2Z58B 4G65A 1IM6A 1KLNA 2LI6A 3T5LA 1H2TZ 4B9TA 4CZIA 1RDAA 3NVWA 3US5A 2GTDA 2XULA 4LF9F 1SL0A 4OX9J 2PAVA 2XNRA 3BS9A 1JCFA 1S10A 5J2EA 1TUGB 3WXMB 3EGZA 5F3XB 1N54B 3Q0AA 1HW8A 3AVGA 1KVBA 4BC3A 2LEAA 3FMBA 3S3OA 2L48A 3KJQB 3PW5A 4C11B 2HVIA 2J7UA 4ES2A 9ICVA 2PE8A 4CHQA 4F0HA 4JLHA 1YJ9S 2BKNA 1MSWD 4OHXA 1ASWA 2YHWA 3NNCA 3JTNA 3PEJA 2L9DA 4I6YA 4CLKA 4X4RA 1X9MA 1VIXA 1UAXA 1JQGA 3LP3A 5F2RA 4ZN3A 4JKGA 4O8KA 3CJ1A 1MQ2A 2HS0A 4F50A 4WYWA 4KTZA 1KQSM 3GIKA 3AJ2A 4B3OB 5EXWA 1QVGR 4EELA 1ZQIA 3R6LB 4IOAQ 3UDCA 1EKEA 8ICLA 3MCAB 1C1CA 3S7RA 1R0BG 4ECYA 4DTSA 2AQ0A 2KT3A 4U9RA 1RCHA 3UNGC 4RQNA 3KK2A 4J9KA 2ZH8A 2IIRA 1QZ5A 3NRWA 5HRRA 4PUOB 3G0ZA 3SAHA 1V3ZA 4OX6A 4KY3A 5CJ7A 3RH4A 4EX6A 5AQKA 3NAIA 5J0PA 4CF8A 4ZP9A 2B9WA 3GMGA 3ICLA 1U0SA 5ADXH 4YORA 3LVVA 3KMSA 4TN2A 3LP1A 2DGXA 2NS1B 2D0PA 2JSXA 1N5WA 5E0OA 5LT5A 4B08A 1ZD4A 2A3VA 4FYXB 2H5JB 3SQ2A 1Z1BA 3E01B 3W5XA 3DXSX 3NKYA 4DV7F 2A19A 3QUCA 2JRZA 3K1RB 4DV5J 3HX0A 3BB5A 3G71N 4FNIA 3AHPA 2NQPA 5FLXO 1ZQDA 3VQ9A 3MGHA 2DFLA 3B6BA 4CO2A 1BDGA 1MWKA 4F2RA 4M3WA 4OJ6A 3HJFA 3CJ3A 3CCTA 2I7PA 3ZT0A 4A47A 4OYOA 1URRA 4RW4B 1N34K 5CABA 2MHEA 4ECVA 3HT3A 2FHJD 3K17A 3L9ZA 4H5TA 3C23A 2NPFA 3SDEB 1U04A 2WBMA 2LXUA 3GV5B 4OZ2A 4KH1B 3BEXA 1KN6A 1I94J 2ZBPA 2YH1A 2WF5A 1U0HB 3S6JA 2VYPA 3J81U 4YMEA 2W25A 2RB7A 2JWLA 1RAAB 1U1RA 3QU9A 5AKKA 2QO3A 3V6KA 3GG1A 4PCQA 2B8QA 2KSOA 4LFCF 3FC9A 3NVMA 5KGXA 4AD6A 2G8IA 4YDXA 3LM2A 1N36J 2HWIA 2C22A 2DGUA 2G2YA 5L1JA 4YR3A 3WKEA 2C2OB 4Y2QA 2UXBK 1ZQCA 4Y2UA 2JVRA 4UOFA 1BHNA 4PHTX 1HHQA 3OFFA 2B8PA 1BQXA 2RKIA 4JEPA 1XNRJ 4JRPA 2RS2A 4J37A 3O08A 4YS2A 4RQ0A 1S72S 2VH7A 4ICAA 2KLAA 5IFMA 3LGHA 3FEZA 5I4MA 2K7JA 9ICTA 1QAYA 1TKTB 4YMOA 3M6XA 4UW2A 4QZDA 1RJJA 1S3XA 4KRWA 1FO4A 5IV4A 1IWGA 4HLBA 5A8KB 4LIWA 4FZNA 4CNQA 4OZLA 1NHVA 1WKLA 1E6VA 2MQLA 2J0XA 1U1MA 5CR0A 5SUHA 3F5AA 2PI5A 5J2PA 1GLJO 4LF7J 3E9PA 4A8FA 3PMLA 5DDQC 1RWKB 2P9SA 1N5QA 5H9FK 5KFDA 2K4HA 2HS3A 3DU5A 3LAMA 5AXKA 3W5YA 1VSKA 2QN6B 3CVKA 4RL1A 3CJ0A 2YV0X 1HNXK 2VA2A 1IKVA 2OELA 2DEJA 3NVVA 3HF5A 3THXA 1SKUB 4QZEA 4B3MJ 3AD8C 3VGKA 3HPHA 3FRYA 2BCSA 1Z4UA 2AX1A 3ZLJA 3SFGA 1J5EF 1QQOA 4CRXA 4X65F 2LDYA 4ISFA 2LQJA 3DLJA 3ITHB 3CIMA 3OYIA 3J80U 2H5EA 5AM1A 1WN7A 2KICA 2AEJA 3BY5A 2IJRA 2H3ZA 2DXEA 4OJ3A 2E2QA 4BQZA 3H98A 2DGOA 3RMBA 3WQUA 1P7DA 3NRZA 4FBTA 2YKQA 1SQGA 3LO3A 4O5BA 1EX8A 2Z1JA 3SUOA 3DLLQ 2C2RA 3THPA 4BWMA 2EW9A 3ALRA 4FZVA 3RJGA 3HSCA 4J2AA 3SQ4A 1FDNA 2DR8A 1ITPA 4NCAA 4RW8B 3GG4A 1W7AA 3DRSA 1PVPA 1MA7A 5HR7A 3EVOA 2BCQA 4LSNA 3TOQA 4UOCA 4LUBA 2ZHAA 1BLUA 4F5NA 2QT7A 1J5OA 4NXNK 3NCRA 4MIWA 1VRUB 2FHOB 2A1JB 1JLGA 3VQTA 1D8ZA 5DS7A 2PFQA 1HBUB 2HF4A 2A6OA 2GQ2A 3N4WA 4IO9Q 2Q66A 4LJMA 1OKJA 1SQEA 1N32F 9ICLA 1WSIA 1DRGA 3SAFA 5A8WB 1BCOA 2OD6A 3C65A 4OHWA 5IT4A 2K1RB 2ZIWB 5FPDA 3SCIE 2PMZF 4X4SA 1AROP 2E44A 5DM7Q 3OT9A 3T6BA 4ZH4A 2ALYB 5GAEU 2R8HA 5KT6A 4IOCQ 4IUFA 3GIJA 5AKLA 5GTIU 2KI2A 2FBVA 1AQ6A 2FJBB 3HZGA 1YBUA 5IC6B 4CEFA 4PQUB 4FVCA 2FHMA 2H4YB 2AYGA 7ICUA 1LNQA 4KHNA 2HSTA 3J7YP 4PY5A 1RT2B 1BNOA 3KLVA 4I67A 1MG7A 4AYBC 4WP9A 1REVB 1BXNA 1HQEA 2G8KA 3AY0A 4JK9A 5CYQA 1L3VA 5HP1A 2KU7A 2HHSA 2HNYB 3G82B 2XMMA 3O4WA 2C28A 2DXFA 1DARA 2E8AA 3QGPA 4WK1A 1MN9A 3C6HA 2L41A 4EU0A 4MIAA 3IRWP 3CJTA 3PM9A 4GLXA 3E66A 2SXLA 3SQ0A 3Q8PB 3SUQA 1VBZA 8ICEA 3OYMA 3KK3A 4CEZA 3MCOA 3KHHA 3QLHB 3RRKA 3QMLA 2ZHOA 4NCBA 5KRTA 3ZD8A 2V2VA 4RU9A 3CEDA 1S0NA 2LYBA 4CJEA 1ZQKA 1SQKA 1JALA 1R6VA 2U1AA 4UATA 2OMLA 3W2WB 3CMAS 2Y1JA 4DOAA 3W5ZA 3HKZD 3K57A 4KI6A 2W11A 4IQUA 3K89A 3D4JA 1RTDA 2F40A 5AE3A 1FJCA 3AM9A 2XSJA 1T3OA 1CC7A 4NLPA 3RSEA 4M94A 2WOMA 2MGZB 4ZVEA 4OJOA 3M32B 3BR8A 4FK4A 3CJQA 1XQIA 4TLRA 3V6DA 9RUBA 8ICAA 8ICUA 2PN6A 1NXIA 2XYGB 3M4XA 3CC7S 4YB6A 2DTJA 4KH4A 1ZBUA 2DNYA 5IS2A 2JLFA 4FLTA 1UMJA 5LMNK 2O8BA 3AFGA 2E2PA 4DKWA 4IG3B 3AVMA 2OEMA 2FF6A 2GUPA 4YMNA 3BKTA 3EE9A 2ZBCA 3CC2N 1BQNB 3B9JA 1YXQA 4OX9K 2X1BA 2ASMA 4RT2A 3V9UA 3J80Y 4QU7A 3WNEA 3EPGA 4QZ8A 4FPRA 3CJKB 3BO2A 4X62J 5K4LA 2J7WA 2P9PA 4B3SK 4C98A 5ALZA 3JPSA 1NB2A 1KDHA 1F60B 5HMMA 4CM0A 2MQQA 4B9QA 3RGIA 6AT1B 3PKMA 3K5PA 3MMCB 7ICGA 2EWHA 3D6HB 4MHVA 3NS7B 3HSZA 2KM8C 2M0GB 1RBUA 3JPTA 2EFGA 4NCGA 2FJAB 2H3FA 1EQ0A 4QS9A 1WKJA 1C0TB 3D3CJ 4JI5J 5LMUJ 2B5JA 5FD1A 2H5XA 4E8UA 2CQHA 3CJ4A 1FTRA 4ZITA 2J7KA 3CCES 4DV6F 3FFIA 3BUZB 2P9KA 2YX4A 2VG6A 2Z56B 2G07A 3I82A 3GYGA 4JB8B 4Z4HA 1RDCA 2CPYA 2FZCB 4LF5J 2A1RA 3NCQA 3SQOP 3CCUS 2OA8A 2XIDA 1NGBA 1RTJB 2VL1A 3KTQA 3O4NA 1X40A 4Y2TA 1F9HA 2WW4A 2LM1A 3GP9A 3QATA 5HQMA 9ICJA 1ITGA 3CCSS 4P10A 2HBRB 3OFGA 4EZ9A 3VA0A 4NXMJ 1VQOS 3JPQA 3CCWA 2W9BB 1PG5B 3IFEA 1C0GA 5BPMA 1YZ7A 4Y2MA 2ROGA 3I0RB 3QFUA 4DV2K 1PBUA 5D78A 3F0NA 3RF9A 5D4NA 1HQUB 1VQ8S 2WF8A 3P5TL 1Z2ZA 3Q86A 1RE1B 4UB5A 4A8OA 1MWYA 2D41A 2Z2MA 3BPSP 1TVRB 2Y1RI 4M5HA 4FSVA 5IIIA 2XLKA 2C2MB 1Y5LB 3CGIA 3PW4A 2DUYA 2Z57B 2EBEA 5IINA 2KM8B 3T7ZA 4CW7B 3RJIA 4KKOB 4L3KA 2DR7A 1S9GA 5DZ7A 4Q8FA 2BOAA 1NDKA 1TUWA 4Q44A 2D1CA 4LSZB 5C15A 4MLHA 2ILYA 1W2BM 5THWA 1HJOA 3WK5A 2VBYA 2WW8A 1FRLA 4QYZJ 4YEAA 2FQQB 3H8SA 5KFBA 3MHYA 5HANA 3VQBA 3ZZPA 2XMVA 4K4UA 5C2GA 2OPRA 2GIFA 3LGNA 4ZP6A 2ZBRA 4QWDA 2ZIVB 2OEJA 3LP0A 2QMXA 1XO1A 3D66A 2R7SA 3OTDA 4WCEQ 1SC4B 1IVZA 1I1GA 4DQRA 2JGAA 1VQYA 3W63A 4CEQA 4B9SA 4FKXA 3ZTOA 1L7PA 3KJFB 2E8OA 1OH8A 1T03B 1S1TB 2FVRA 4M7YA 2GW8A 2Q31A 4L8RB 3SSQA 3ET6B 4BBYA 3MTJA 4DX6A 4CJVA 3J7AN 4AHVA 4M6WB 4KREA 2WTUA 3PIOQ 1FKPB 8ICRA 3TRGA 4I2QB 4NLYA 3UXPA 2FBYA 1FVQA 4YD2A 4FPBA 5AQQA 3TAMB 3HZ6A 4DU4A 4G1PA 3HM8A 1S77D 4BG8A 1D8YA 2W04A 2ASOA 2LCWA 3L7UA 2PFFB 4CJLA 2EH9A 1B99A 3QBCA 2GLEA 1B0PA 1SBRA 4C0HA 4YDUC 3NL0A 2UZAA 4CI0B 1EZZB 2CGLA 4C4WA 3ENHA 3NGIA 1N36K 1FDAA 3GPAA 3MFHA 1C6VA 4KYZA 3SAGA 4ICLA 3P45B 3CDWA 4NLDA 3O9UA 4JN4A 3JYTB 1NKCA 2P35A 4XEIA 4AM6A 2WB4A 2GHPA 3MD1A 3AVNA 4WXWA 3UIQA 1SC6A 3IRXB 3LPUA 4OJGA 2OKQA 1QUPA 2J6UA 1RABB 3UDEA 4P6QA 2KNJA 5C42A 2H1YA 2JVOA 2FSNA 3LTOA 4MF2A 5D4OA 2F4VF 4NOHA 2BACA 4EO8A 1LXNA 5ALEA 1T6CA 3GV8B 5F0UA 4M0AA 1NM1A 2DCUB 2OP5A 3AARA 2QEXS 1X9WA 2ZZNA 3CM5A 4NLNA 4AHCA 4EX7A 4LF7K 5KG3A 2ZG6A 1T94A 4NL9C 3HMJG 5D0EA 4A57A 1ZQAA 4MDAA 4JI1F 3WKAA 4E1NA 3RB4A 2A5XA 2IM0A 3TSQA 3MM9B 3DAWA 4RBVA 3D6RA 1WOQA 4GKKJ 2MLZA 3QIOA 2RE1A 3VCBA 1VSMA 2H9ZA 5ALPA 4USMA 5I9EB 1TK8A 2VFRA 3ONQA 2WB1C 3ONNA 5ALLA 4US8A 4KH0B 4OO1J 2XZTB 1YT3A 4ZTJA 1SKRA 1FI4A 2PSZA 2GCFA 3L3VA 1NZAA 3NASA 3WX8A 1NJZA 1M1KT 1NM2A 1W7WA 2CNKB 5E7OB 3BQTA 3KHRA 2RAQA 5AKYA 3NH2A 1Y88A 2G9OA 4FJJA 3MBYA 1OH7A 7ICSA 5BPLA 4RNOA 1GNKA 3TO8A 4Z4CA 2FI1A 2F1IA 4DSFA 3QUBA 1REGX 2JH7A 1S12A 3KLFA 2UVRA 4GRSA 1CJUB 3E8OA 1DLOB 1VSFA 2MUTA 4OYWA 4U95A 1QHAA 3ZT3A 2Q0ZX 1VDHA 1S9EA 7ICQA 2HHPA 1T9WA 4NL5A 5HBMA 2PKEA 2M2BA 4DL3A 5E41A 1LWXA 2A1AA 1RM6C 1VRTB 5M1QA 3CD7A 4OZ0A 1UWAA 3D1OA 4W5OA 1I3AA 4PQAA 4NMLA 3HFKA 4IQVA 1HBNB 3QFHA 4KLLA 4YOTA 2KO1A 3EKSA 2UV8G 2YNGA 4DPXA 2MMYA 3MXMA 4B9VA 3UQ2A 2FJEB 4QWEA 4WP3A 1UWBA 5AKEA 5ALRA 1YX2A 1D4XA 3LQVA 3KZIU 1PJ7A 4ECRA 1A6LA 4LF4F 4PEOA 1WD6A 1VQ7S 3VEYA 3VZHA 1E6YB 1H74A 2VQFJ 4B9LA 4UAYA 1RT1B 1S1UB 4DG1B 2DGQA 5FRNA 1VMBA 4DQ8A 2MQOA 2UUBJ 2KVSA 1RTHA 1JLQB 4JI7F 3ETMA 1MU2B 4DTRA 3N4MB 1RU1A 1JNRB 1KQQA 2EWSA 2XY5A 2C1EB 3OHRA 1S1WA 3CJRA 4F92B 5B7WA 2NV3A 2ZJ5A 4NWIA 4DLEA 3MZIA 4C0OC 4NMXA 4BX9C 4LRDA 1NO8A 1HQ2A 1UEVA 1T3NA 2DWQA 4NLKA 4DR4F 1ZQNA 2UYTA 3CFPA 2HHUA 5FPMA 2I7NA 4KGZB 2XMUA 4C3LA 3HZEA 1H38A 4E7LA 1SIZA 2F63A 2ZJ8A 4LH4A 4F5RA 2I38A 1SH0A 2K4EA 5CAAA 3ZSXA 4KLSA 5IWAK 3CQYA 1YIJS 4OKKA 2VHGA 4AHSA 3LDOA 1RISA 3J7A1 3UCGA 1RXWA 2CRLA 3CXCM 3AQFA 2V8DA 4OIXA 3UKRB 4G1QA 3MECB 2PEBA 1GLDG 3AV9A 2A3JA 2DCLA 4DUZJ 4JI8J 3OS0A 2IOFA 3Q8RB 1QQ6A 3BEGB 3MUVP 1TKXB 4BRCA 3AGKA 2ZOFA 2M52A 4DMNA 2XHWA 5CE3A 4KGVB 4DSEA 2OHFA 2YQEA 1TKZB 4DFJA 2C3PA 3SQGA 3SV3A 2MZJA 1OY9A 3MXHP 1F5SA 2ZIUB 4R8UA 1FJ7A 1UZHA 3MEDB 5M2RA 3GSIA 2DBBA 3T1HF 1Z2LA 3O6QA 4OMFG 3FGVA 3NH0A 1DGSA 4YHHK 3LWMA 4B3TJ 2W7PA 4I2BA 4I2EA 3CD6N 1TYQB 3GIIA 1GLCG 1IBKF 3FKBA 1PBAA 2N7CA 4LQ3A 2W40A 2YNIB 3CCRN 2P6UA 4JI5K 4WWSA 4FJ5A 2BJ7A 1WSRA 3IDHA 2EFVA 2KVCA 4ZJOA 3KLHA 3ZSVA 3TUZC 4Y6IA 4ZN1A 5ETSA 1HNWF 4IFEA 4ED2A 2CQIA 2VB6A 2V4JB 2CJKA 4LF5K 2ZZMA 1CQNA 3BP8A 4DFMA 2H65B 5DQIA 2YNHA 3FZKA 1YI2S 3MCPA 4MFBA 4KAZA 3V9WA 2OPPB 4QJVA 2XICA 1HKAA 2OTJN 2CDRB 3TACB 4BR5A 3QB0A 2ZUDA 3DHXA 4ED7A 1X5SA 1YITN 4NXMK 3F9KA 4AYBD 7ICVA 5IM0B 4J03A 2I2YA 3UR0A 4AXIA 3LALA 3CCJS 4A46A 3SJJA 3EZ5A 4NA2A 3UXNA 4KSEB 2MDAA 2ZIXA 4ENOA 5I3QA 1WSHA 4F04B 3CJ5A 1ZAVA 4QZ9A 1NH8A 3L0QA 3IV6A 3CC7N 4O3NA 5LSRA 3PSPA 4L3QA 1IWAA 2V2QA 4PPZA 3VWSA 2KG1A 2KIWA 3FEYB 3GDQA 5CXTA 4CZEA 3LW5C 4P0QB 2KTQA 3DOMB 4DB3A 4R5PA 3OYFA 4USJC 4YOEA 1U2VA 3CCLN 4M8LA 3ICXA 3RBZA 3ZDEA 5GADP 3M8ZA 4H0YB 3UD5A 1O0PA 1NZ8A 4M5GA 2E7WA 4N8NA 3M8RA 3OFHA 2YY6A 3DJCA 4DUTA 3C15B 2YQ1A 3FZBA 2R7WA 5LXRA 1ZM9A 1HNIA 3UD4P 3HRDD 4QYZK 5BOLA 3AOCA 2KKVA 2VKQA 4WJ3B 1X8DA 1RT3B 3WK4A 2H51B 3M6VA 5ADZA 3MPVA 2JH3A 4OJLA 4PKIA 1CEZA 4DQQA 4C1NI 4U7BA 1Y5IB 1QQ7A 4XQ8A 3VQAA 4A5AA 4KO0B 1OXJA 1S6OA 3EVMA 3W62A 3VEOA 3QGGA 2AXTU 5AQHA 3OW2R 4O3MA 3JQKA 3OYGA 2CH5A 4KGMA 1IXKA 4CO1A 1AFIA 5DJBA 4NB4A 5KG1A 4K42A 5LJVA 4RNNA 1BWFO 1X4GA 5E79U 5D6GA 1FFUA 3WNGA 9ICGA 3SQIA 4I2IA 5HAOA 4BRAA 3EEQA 4JHDB 4JS5A 1ESVA 4N8OA 3HPOA 2B0GA 2LM4A 1ZQBA 7ICKA 2BE2A 1JCGA 3L09A 4OPKA 1FEZA 4U7UD 3RMAA 1QH9A 4M63A 1MW7A 5AI4A 3KZBA 5DM6L 3HO1A 3CCSN 3LH2S 2UUAK 4BVOA 3OTOF 1VQON 2ZTCA 1YRUA 3M8YA 5IT9U 1C1BB 4M3TA 3P5BP 3TEGA 4JNEA 5KFRA 3M9NB 4YN4A 2OYYA 2HOFA 1CQMA 2UU9F 2XTJP 3WQPA 3BPDA 4K5RA 3TUJC 7FDRA 1KVIA 1VJQA 1Z00A 3C6UA 1UFKA 4QZGA 2IDEA 2UUWA 2F76X 2QK9A 4MYUA 2W54A 1GLFO 2KHVA 3GIMA 1U1LA 2PFPA 4BREA 3D67A 1F1BB 1F9FA 4OYMA 2X1FA 2DFFA 2MXYA 1QVFM 4IEEA 2BJEA 2R7VA 5EU7A 1B4FA 3D2SA 3MWBA 4CD1A 1OS5A 4HACA 3OBIA 9ICBA 2LSNA 2RNEA 1XU4A 2W8KA 5EN1A 5BREA 2HDOA 4RQ7A 5AQNA 3IR7B 4O4GA 2K06A 3ZETA 2GJIA 4KMUA 1UW9A 3I5BA 3ZO7A 4FLYA 5F9NA 1WKKA 5T7BA 2NLXA 3B82A 3DFEA 3M8WA 1U6ZA 3I1YA 4K8ZA 1BY9A 3C29A 1WJ9A 5J1PA 4DR1F 4GKKK 4EK2A 4PHDA 1RQ0A 3L4PA 1J9AA 5B0CA 2FD2A 4Y2YA 1KVCA 4YD1A 3EMTA 2PYLA 1S0MA 4FFDA 3DGPA 3U1MA 1PIEA 1SL1A 1HX1A 2G2OA 4X2BA 1GLBG 3V9SA 4DV7J 3QMQA 5B5EU 2B6GA 2J8AA 3WUHA 1S1VA 2AHOB 4ILGB 4LRCA 4JMUA 3ZNJ1 2DHSA 4JRQA 3VQ4A 4Y2JA 2QYGA 2RUGA 4NZ6A 5DG8A 1TL4A 3R5CA 1K6YA 1C4CA 2FMPA 1TZ0A 3RW6A 3HHLA 4F3MA 3DRYA 1NKBA 2BTFA 4OKEA 4ECXA 5CRXA 2LQ5A 5HN0A 1PK3A 4F4YA 5JXSA 1NU4A 4QOZB 1L6NA 4G9BA 4C4SA 2GIRA 2DKZA 1QAIA 2NZ4A 5J29A 2FJXA 2P9IB 2DITA 1KONA 1HWKA 3GCWP 2PGCA 1QE1B 5GAGI 4B3OA 2V8GA 3ORYA 3DGVA 1EX4A 4RQ8A 2HKEA 8RUCA 1X5OA 2XGQA 3VAHA 5D8HB 2GVZB 1RAIB 2Y9TA 2Y8YA 2JC0A 5I3UA 3TA1A 5JVGQ 4UY8T 3B78A 3WZ0A 4BGAA 2VOPA 1BPZA 1KFDA 3I4HX 2HHQA 3ZTSA 1ZBHA 1UQVA 2RUSA 4L76A 2KKZA 5DRKA 5BR8K 3VALA 1Q46A 3TTFA 3JQJA 3PXGa 3O80A 1BE4A 3KLIB 3UE2A 4KX3A 5JVHQ 3C95A 4F3QA 1JJ2R 2ZGZA 4F5OA 4RW9B 3FRZA 3K75D 3VQPA 2RQMA 1ZAWA 3VGLA 3A0HU 1RG6A 2J9CA 1WEZA 4KLGA 4BWJA 4MIBA 1WWVA 2JOQA 3NGUA 2ADCA 2CGJA 1RHKB 5CYJA 3TAEA 4QZHA 1QQMA 5FPEA 1ZQGA 3TAQA 4B02A 5KAIU 1Q8IA 2CZ9A 3PKYA 2KV2A 3HHNB 5B09A 4I4BA 2UUBK 1Y11A 5T41A 2QKKA 3R8YA 4C48A 3KG1A 2ZJRL 4LRAA 3DRXA 4DXLA 4ZVFA 5HMYA 1KLMA 3OPXA 7ICOA 3M8PA 1VSLA 4AP9A 1JJ4A 3RH6A 1HUZA 2VFSA 1N56A 5ELZA 4A59A 3CPEA 3VESA 1UZDA 4IC9A 1VLBA 4RW4A 2QV6A 2Q36A 1NRKA 5J0RA 1IJJA 2J0SD 5ALNA 2AF6A 3ZT1A 3CULA 3KHYA 1ASVA 4BDYA 1N4LA 1NEEA 4DR6K 1LW2A 1CPZA 3CPWM 4DQIA 2ZF5O 1VSDA 2E5JA 4HT7A 4S0MA 3QU2A 4CFBA 5EX3A 1RWPB 3SR6A 1CC8A 4I6MB 4X65J 3MR3A 2HBYB 4D3GA 4G1IA 3MK6A 3TARA 4F36A 2GWJA 4ZJLA 3NBPB 3WU2U 4XPCA 3Q8VA 1ZTTA 5ALOA 2FMQA 2F1JA 1SH3A 1NAQA 2RD5C 4DUYJ 5AQVA 2J8SA 5E5NA 3HVTB 2R8IA 4DUZK 4JI8K 1J97A 3MMBB 3TWZA 7ICNA 5C2CA 1VBXA 4KMOB 4KHPF 4C8MA 3FFKB 4PAAA 2B7CB 1RAJA 2K8BB 3ATUA 3ETOA 2UXCJ 1FEHA 3FM9A 4FYDA 4IG0B 4PXBA 4NYPA 1S76D 2GUIA 2ZEJA 2YB4A 3T19A 3A3NB 3HKWA 3QIPB 3EWGA 3H4DA 3QWPA 4I9LA 1VJWA 1TKTA 3C2PA 2E5SA 4MKBA 3GCXP 1ZETA 4AQYF 5A8KA 4WQ5A 1YVUA 1HIYA 2YMPA 3B4DA 1ED1A 2XQCA 2GAHC 3NH1A 1BWEA 4FF4A 3UNYA 3GTYX 3VAKA 1UJ4A 5AXLA 4CGHA 2E9ZA 5D3GA 3AH6A 4CLFA 4O0NA 3H2UB 4UW9A 4NRUA 1X4CA 3NGYA 2AP1A 1VC5A 3LOUA 4XIUA 5T7LB 4HDGA 1Y3KA 1Y00A 4LZDA 4IBNA 4FPIA 4P4PA 2XC9A 4RW7B 4BC5A 4P71A 3EO3A 1WSGA 4X66F 2OMOA 5J1EA 1MDUB 3DOKA 1RZMA 3AVHA 3PNIA 3FQLA 4L72B 1FK9B 4QW9A 5D0GA 3I5AA 2WB1F 5AJ3J 2HFOA 4UB4A 4OCZA 2P9UB 3BQ2A 9ICCA 1UVKA 4NXZA 1N33J 2VA3A 2GHVC 4Z6EA 3M3ZA 1U8WA 1KC8T 5CA5A 1GTEA 1WNSA 4R66A 1JLFA 1ZQZA 4PR6A 1KQSR 1XSNA 3DMJA 2WHOA 5JMVA 3UW1A 4BUGA 2O8DA 3IGNA 4FJXA 4CF5A 1FXDA 4P2MA 3F2BA 3LDLA 4CFCA 1LXJA 3I56S 4BE2A 3BSCA 4ZP8A 1U02A 2Q0UA 2P51A 4KLTA 3D45A 1VRUA 3H59A 2A1JA 4UY8O 5GMKa 2BHNA 3UMBA 4GIBA 2W2OP 5HK4A 3VQ8A 5ALKA 2UUCF 3BYRA 4MF8A 4DR5J 2DNZA 3PIPQ 3OSPA 4P0PA 3SCXA 3CF5Q 1AXQA 4ED5A 4MN4C 2WONA 4RW6A 5KFAA 3MXIA 1C0UB 3AVFA 4I28A 1JLAA 1AT1B 2CQ0A 4B17A 1X0PA 4DL0C 5TISU 3BZKA 4PQUA 2Q1LA 2VQEJ 3IHQB 2K8CB 4C8YA 4KV8B 1B9DA 5M1NA 4YOVA 4EGLA 2Z1HA 1NI3A 2EFOA 2FTRA 1WSJA 4OL8A 4IXCA 3A8EA 7ICRA 4LF9K 3HT0A 1CI4A 1RT6A 4N5SA 4FWSA 2KXHA 1B4SA 3ZSRA 2HNYA 1YI2N 3NVYA 4I1TA 2HMIB 3ENQA 2DNGA 4C8KA 2ZTDA 2NRWA 3MGJA 4LD0A 3ZEUB 3OV7A 2BDPA 3BH7B 5D0RA 3H2VE 2FZKB 3O6WA 2G0AA 1WF0A 1TL7B 3EGNA 4KE5A 3MPWA 1M5SA 4FZZA 2X1GA 1HWLA 2O8FA 5AZIA 3FQKA 4DF4A 1NOYA 1HYVA 1ZXIA 1TQLA 3MWPA 3SENA 2YWFA 3CCMS 1RYRA 3SCJE 4DR2J 4JWMA 2HNDA 3ILLA 3OYAA 4NLRA 4LSLA 2VBZA 3MM6A 4JYAJ 4JBCA 1WOPA 2ZH4A 1JN3A 3V4IB 4UB8U 1Z19A 1XMOF 1K9MO 3BZQA 2XRIA 5DKWA 1NHUA 2HHHF 3C7NB 2IRYA 5DMRA 3VEWA 3Q8KA 2RRNA 3VEXA 2F8EX 4EP5A 2W2QP 1KEKA 1ZQTA 4DL2A 3Q89A 4A5BA 2HB5A 2C3YA 4I2JA 4CIFA 1L7OA 4DR7J 3GG0A 4P4MA 2HS4A 3M32A 3BM7A 2FPLA 4OGEA 5B0FA 1KBUA 1CULA 1NGAA 3HRGA 2C2ZB 5CWRA 5JTIA 3K1ZA 3ULEB 1BPDA 2DQNB 3AA5X 4O5KA 2EBGA 2R4FA 5KI6A 5D77A 2ZJQL 5F3ZA 1S7IA 1U1QA 3I8DA 4RCHA 1WHYA 2F65A 3IR5B 2OM6A 5D4LA 4BLGA 5KFUA 1S22A 2O8CB 4OI1A 1OW5A 5DB6A 2BANB 2FF3B 2RHFA 2M7SA 3GJSB 4KC5A 2GX9A 1BI4B 3AN1A 5ALDA 3OL9A 1RTIA 3VEZA 3NY0A 2QTWA 4DV7K 4W5RA 3CJKA 1Z1ZA 3ZZYA 2ZWOA 2QXFA 1PYTA 2VC1A 3HD2A 4G9ZA 4DU7A 3OXFA 4I2FA 3LDNA 3HI9A 1TE2A 4TUPA 1ZQFA 4Q8EA 3CC4N 2FLLA 2HK3A 1ZBIA 3OL6A 4BGBA 1QM9A 2HVHA 1TK5A 2RMLA 4PG7A 3W64A 5KG0A 2E88A 3EDRB 3A12A 3MM7A 2V68A 5AI0A 3UXOA 3ISBA 2QFIA 2ZC4A 4JAXA 1S6QB 1LWEA 4ZVSB 4DU3A 2Y0SD 1ZPWX 3IAS9 5KG6A 2ZM6F 4DV4F 4CEOA 1CLQA 4GNIA 3J7ZO 1HLUA 3NF9A 4J9RA 2OIHA 9ICXA 4JI3F 4JI0F 1N6QB 5BRDA 1P6TA 3TVYA 4BY9C 4I6AA 2OTLS 4I2PA 4H0XB 2I5JB 4CLLA 3L7PA 2F77X 2UXDF 3HM9A 4Y2RA 3C14A 5KQDA 2E29A 3GLJA 5FLXU 8ICFA 4K8XA 4XRHA 4CGFA 3A3OB 4PHEA 3TZWA 4YB1P 4M95A 2HHXA 3DM2B 5IV3A 4LFCK 3WIVA 3T69A 2KP7A 2JDJA 5J2QB 3EZWA 3ENWA 1IV8A 1FRIA 4X4QA 2QB0B 3IBFB 3JAMU 3A2FA 4O3PA 3KWIA 2GHWA 3AO2A 2DNLA 2C42A 1WBDA 1KOHA 1ZQUA 4QWAA 4RUCA 4MO4A 1CJTA 5I42A 2W9CA 4MEXA 3N9UC 1X4AA 3ENVA 4TXSA 3L2UA 4Q7AA 4OYBA 3M30B 3OY9A 2F4VJ 2GQQA 4XAKA 2HK2A 1FRMA 3PO5A 3M7DA 4Q2LA 4KHMA 1D8LA 1ZOTA 3MX2A 3VAGA 4FXDA 4ILJA 1NK9A 3VERA 1F2HA 3E2EA 4JD2A 3CUNA 2JGUA 1RADB 2O5DA 3CCVS 2OHDA 4BACA 2O67A 5EE0A