4B9SA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion outside of the pre-insertion site.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 209
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9sA01
4DQRA 2D5RA 4FS2A 4CJFA 3T5LA 4CJEA 4O55A 1KRPA 4ED0A 3RBDA 2RF2A 3C6TA 4NY8A 1BPXA 3OYMA 3M8PA 2FPMA 1RT4A 4KLHA 1YTUA 2RKIA 2X74A 4FZYA 1QSSA 4GXKA 3DLGA 4OLBA 2ZD1A 1JLAA 2B5JA 4IFVA 2KZ3A 3D0PA 3VA0A 3SUOA 4F2RA 3ZDCA 5KT6A 1S10A 1S77D 4KN7A 3GV7B 4B3OA 5FRNA 4CFBA 3LALA 4QZ8A 1XC9A 9ICOA 4G1QA 5KTQA 1A76A 1WSJA 4UB3A 2XHBA 9ICEA 3EPGA 3RJHA 2LSNA 4B8CA 3AO3A 3O4QA 1BPZA 4FLUA 5J1EA 2G8KA 4UB4A 2HW3A 1Z00A 3MFHA 1Z00B 3CG7A 4N56A 5KG2A 1ZQJA 2P6UA 8ICQA 4IR9A 3F73A 1U9LA 2VA8A 4M41A 2PYLA 4JUZA 3O4NA 1SKWA 1B22A 9ICCA 4DTNA 2YNFA 4W5OA 4R8UB 9ICKA 3CFRA 4M42A 3BDPA 2KFZA 1NKEA 1JN3A 3ISDA 1HUZA 1XHZA 2FMPA 2NRWA 1KEJA 1FK9A 2HVHA 4CHPA 1R0AA 4F4WA 5J0PA 3DMJA 2C2DA 3SI8A 1Z26A 1K1QA 3QEAZ 4DSIA 4PQUA 4TUQA 4PA1A 2BDPA 2PI5A 1NJYA 1A5XA 5CHGA 2HHXA 3AVFA 2W9MA 4M04A 4B9UA 4QZAA 4CGIA 1IKXA 5BPCA 1QS4A 2W9AA 4FLTA 5EWFA 1J54A 4YFUA 1W9HA 4IQWA 3KJVA 3RB0A 4YXMA 1BL3A 2AQ0A 1TV9A 2O4GA 3L3VA 4W5NA 1C0UA 1G15A 3B0YA 8ICIA 4KRFA 4GVMA 4KO0A 4O0IA 3RBEA 4UAZA 1SZPA 2BANA 1UA0A 2NRZA 1NK7A 8ICYA 4DTPA 4CEQA 5EWGA 4AHSA 3LPTA 4JWNA 3P83D 3ZDAA 1IXRA 2OZSA 3MEEA 4CCHA 1BISA 3VQ4A 2F8TA 1RBUA 5KFUA 4CFAA 1UA1A 2B6AA 3RH5A 3TANA 1TL3A 3OGUA 3O3FA 2Q3SA 2ZJ5A 1W0HA 3G6XA 1NJWA 4UB2A 2C2EA 3SUQA 4HCBA 4IQUA 3A2FA 1DOQA 2R8HA 2FLLA 4P4OA 5L1IA 4QZDA 1S0NA 4YMOA 3LANA 3K4GA 3LK9A 5KG1A 3OY9A 2NUBA 3NF8A 2BCRA 9ICPA 3DLEA 5HNKA 4CFCA 3PW7A 2YNHA 1TKXA 2JEFA 5J0OA 4LY7A 3RWUA 4F8RA 1HMVA 4B9TA 4CJKA 3C23A 2D0BA 1S9FA 4FZXC 5L1JA 3NTUA 3CFPA 1BIZA 3V81A 3HW8A 3KIOA 3E2EA 3SV3A 2QK9A 3VQBA 4M47A 1SKSA 1HPZA 4RQ5A 4E1MA 2XC9A 4RT3A 3VQCA 5KT2A 3NBPA 1RCHA 1TKTA 5KFJA 7ICHA 1VSKA 1UT8A 5J2NA 4B9VA 4ZHRA 4DSJA 3HYFA 4I2QA 5CB1A 3QESA 3RMBA 2XO7A 4DL2A 4BE2A 3OYJA 1N6QA 4E89A 4OKKA 1BPBA 4NLKA 5KFEA 5HRNA 1AROP 3Q8RB 3HP6A 4J2BA 3T3FA 3NGZA 3RTVA 4RUAA 4DU4A 4Q0BA 3LZJA 4KLDA 1S0VA 1TGOA 2IHNA 3AU2A 4O5EA 4M6WA 5DB9A 4QWBA 4Q44A 4I2GA 3NGDA 3H8WA 3OYDA 3G6YA 3AVGA 3T5HA 4GLXA 1RPLA 2RDIA 4HCCA 3PW5A 3SPYA 2XY8A 1NOZA 3DYAA 4I2PA 1D8LA 2G8FA 2DFHA 3NF6A 1CUKA 1LW2A 2P5GA 1KVCA 2NRTA 4IQTA 3PV8A 4IR1A 4UAYA 3OSNA 1S1TA 5CZ2A 2FPKA 1D5AA 2BPFA 2BPCA 9ICWA 3HSTB 3OHBA 2ISOA 1KSPA 4RNMA 5KFDA 1ZQEA 2O4IA 4I27A 5IILA 4MFFA 1EETA 4AHUA 1LWCA 1VSIA 3LDSA 4DF4A 4UBCA 4YNQA 4NLGA 2E6MA 4Z6FA 1V9PA 1HRHA 4ECVA 2RPIA 2A1JA 4LH4A 2Y1IA 3E01A 5KFHA 1MSWD 2IBKA 1GOCA 3V7JA 3PX6A 4RQ6A 3JPTA 3VQQA 4F5OA 3Q8KA 2DFEA 3LDAA 4Q8EA 3OYIA 1KTQA 2VG6A 2X6NA 4J9RA 5K14A 4KREA 1RT6A 4HVJA 4O3RA 8ICSA 3RH6A 5J2QA 1NK0A 1NK4A 3RRHA 4RNNA 1U04A 3ISNC 3ZT1A 3V9ZA 4FJGA 4HUEA 3T1AA 7ICQA 5J2PA 9ICFA 1ZQXA 1LWFA 2X6SA 3HVTA 4H8KA 3RAQA 3KHGA 5JUMA 2MUTB 3OVNA 4QW9A 3CFOA 1ZQWA 1WSIA 4MQ3A 1ZQHA 2FC0A 2IMWP 3H8SA 4PHPA 4IRCA 1J53A 1D9FA 3MR5A 4ID5A 4RQ7A 3DLHA 2VA3A 5D46A 5KFVA 4KFBA 3C2LA 3EY1A 7ICNA 4JK1A 2F96A 4E3SA 4KITB 5KT5A 4BE0A 4PHDA 4CJ5A 3OYFA 4M9GA 1JXBA 1XU4A 3LP2A 4RNOA 1ZBIA 4DTJA 1BHLA 4CK1A 4E7LA 8ICAA 4NXZA 5IIMA 4PY5A 1RYSA 5F9LA 4E7JA 4KLOA 4CHYA 8ICMA 3PNCA 4FLYA 2BCUA 3UQ0A 2BR0A 8ICLA 3P1GA 7ICJA 4QZ9A 1KVAA 3SQ0A 2BQ3A 3HK2A 2YKNA 4O4GA 5BOMA 1S1XA 3KK3A 1KVBA 1L3VA 2JEIA 2FBVA 2YV0X 4FJ5A 1TK0A 3ZSOA 1BPEA 4CEEA 1TAUA 3ZT0A 5SWMA 3GV8B 5KFOA 3WNHA 4P4PA 4CERA 2PYJA 1T8EA 2BGWA 4BGDA 3C21A 1KLNA 3AU6A 5KRTA 2OA8A 4FJJA 2RN2A 4F3OA 3QNOA 3ZT4A 4B08A 5L9XA 3ZD9A 5TZVA 2BHNA 5DBAA 1MU2A 3DI6A 2M9NA 5DMRA 3MXIA 4EZ6A 3AO5A 4FJXA 3V1RA 4CGGA 4YR0A 4NYNA 3MEDA 2W8KA 5DK5A 4JLHA 3ASMA 1ZQZA 3S9HA 4ECZA 3C2KA 4QWCA 5HMLA 1ZQMA 1JLBA 1RBVA 3HL8A 1SV5A 4X5VA 3SQ1A 5CP2A 3MAQA 1HQUA 2PZSA 5DQGA 2R8GA 5J2JA 5IINA 4XUSA 4EP4A 4YVZA 4I2AA 1L3UA 2EHGA 1QQCA 2HHSA 1S6QA 2VA2A 3M9OB 4AHVA 3OYHA 1CXQA 4I28A 4JV2A 3QEVA 4KLSA 3MFIA 1C6VA 2PFQA 3M8QA 4YP3A 4Y1DA 5CYMA 4NLNA 4ZH4A 3QETA 4NCAA 4PUOA 1UT5A 1KFSA 2F1JA 1TAQA 3ZSQA 5KG6A 5KFGA 1SKRA 2V4RA 5HRSA 4QWAA 4CEFA 2R7YA 4LZGA 1UOCA 3AO2A 2P6RA 3QO9A 5BOLA 4TUSA 5JS1A 4Z6EA 4E7HA 4CJ4A 4BWJA 1SL2A 3K58A 4QWEA 9ICNA 3RR7A 3I8DA 8ICUA 2UVWA 4I9QA 1L3SA 3BQTA 2ASJA 1HYVA 1X1PA 3DM2A 1ZQBA 3AO1A 4CJRA 4DFPA 5I42A 3O3HA 4OLAA 2HNDA 2XGQA 1Y97A 4TSXA 3ZSRA 4ED7A 5CZ1A 4KHSA 4YQWA 2OYQA 2IAJA 3T19A 1ZQTA 1JLGA 4EBCA 5DDYA 4Z4CA 3QEIA 3ISCA 1C1AA 4OKJA 2OPSA 4AH9A 2H5XA 1RYRA 4ED3A 4MFCA 7ICTA 3RMAA 9ICBA 1WAJA 4WE1A 4CF0A 1RTDA 3VQEA 4KMUA 4CE9A 2XRIA 4CK2A 5KFIA 1S9GA 1IH7A 2DY4A 2D0CA 1IKYA 3KLFA 1LV5A 3K57A 1DLOA 3LZIA 1DTTA 3K2PA 3UIQA 4FJKA 2Y1JA 3KTQA 1BPYA 3WNFA 3P5JA 4FJ9A 3HT3A 3MR6A 4HTUA 3TFSA 1EKEA 3V9UA 2LYHA 3PW2A 4RW9A 5CR0A 3EZ5A 3S3NA 3AVAA 4DMNA 1HJRA 4LH5A 1D8YA 5CJ7A 4DSLA 4MF2A 3IG1A 1GOBA 5J0WA 5KRSA 1J9AA 4RQ2A 3V4IA 5HLFA 4R8UA 1ZBFA 3G0ZA 4J2EA 3QIPA 4UAWA 5J2IA 1JMSA 5J0UA 3GDXA 1DTQA 4JV0A 3KK2A 3OJUA 1WN7A 2QKKA 1X9SA 4M3YA 9ICRA 3AVMA 3N97B 4O9MA 3TFRA 3QIOA 4DTSA 1QSYA 2ZE2A 4Z6CA 4Q45A 2BQRA 4QOZB 1JLCA 1WCLA 2BE2A 3TAGA 4NCGA 2ZTDA 4DQSA 2OWOA 4QAGA 2KFNA 5J0RA 4PGXA 2MAXA 3T5JA 2ASDA 5KG4A 4EEYA 1HYSA 3RR8A 1QSLA 1ZQSA 5DGAA 1COOA 2VWKA 1YTAA 2I1QA 2IHMA 3OYCA 1ZQGA 4CEOA 3KLIA 3VQ8A 3V6JA 4DTRA 4FJ7A 3DRSA 1ASVA 5CYQA 4CK3A 4NCBA 3DLRA 1VSLA 3V7KA 1CEZA 5C25A 3C94A 4B9SA 4OVLA 3K5NA 4FK4A 2JZBB 3RJIA 2HHUA 3K59A 4FLZA 4HYKA 2BCSA 5DB6A 3U6FA 3TAPA 4KB0A 3KK1A 2R8JA 1S0MA 4KLLA 4UBBA 4KLJA 2IS3A 4BDYA 4RQ4A 4K4GA 1ASUA 1LW0A 3LP0A 4AHRA 5IIIA 9ICJA 2IC3A 2R8KA 4CJTA 5KFLA 4KV8A 3LAMA 5FDLA 4HUGA 2GBZA 3ZSYA 5JS2A 1CLQA 1IO2A 3MDCA 3QNNA 3U3GA 2VG5A 4JWMA 2JGUA 1ZQNA 2JEGA 1L5UA 5KFYA 2P51A 4M3TA 4Z4FA 3KHRA 1ZQLA 4QW8A 4YG2A 4I29A 1WAFA 4CEAA 3MBYA 4DSKA 1ASWA 2YNGA 4DL7A 2YKMA 5J2FA 5DB8A 1SUQA 8ICOA 7ICSA 4RU9A 4CEBA 1TVRA 3KKRA 2ZUDA 4F4YA 3ORYA 2I9GA 2UVUA 1RILA 4YR3A 1WLJA 4FO6A 2JEJA 3ALYA 4J9PA 1WNSA 1RT3A 4DS5A 2KTQA 1T3NA 3ZSXA 3HVRA 3VN5A 3OYBA 3QLHA 3NDKA 1NJXA 8ICWA 2G8WA 5DB7A 2BCQA 5IIJA 3RJKA 5J0TA 4CGHA 2G8HA 4JS5A 3OJSA 4FBTA 5J0YA 4KHNA 7ICKA 1KFDA 5J29A 4CJWA 2ATQA 2WTFA 3DLKA 3RMCA 4YMNA 8ICKA 4Z4GA 3GIIA 4H4MA 7ICOA 2GV9A 1C7YA 4E19A 4CECA 4E0DA 3L3UA 4FK0A 3ETLA 4Q5VA 2YHAA 5KT3A 4ZTFA 1BQMA 3K5LA 1HNVA 2NRXA 2C22A 2WOMA 4M3WA 1JLFA 4LZDA 5KFXA 5J2CA 2HHWA 3VQAA 2UVRA 3V6DA 1LWEA 2XY7A 3KLEA 3LWLA 4DFKA 4FJLA 3GIMA 5I3UA 8ICRA 3K75D 5DLGA 7ICFA 3G6VA 4CESA 4M9NA 1BPDA 4F5NA 1EXQA 3LP1A 5J0SA 4Q8FA 4QCLA 8ICEA 4AILC 3AVNA 4KKOA 4CIEA 3IHQB 2HHQA 5KFNA 4CJSA 2X78A 4RQ8A 4DQPA 4E7KA 5KGXA 4ELVA 3ZD8A 5KI6A 3SYZA 4OJRA 4YN4A 4F2SA 4Z4HA 2B4JA 1N48A 2PFNA 5KG3A 4KHUA 3AA2A 5DDMA 1DGSA 3ITHA 5KFMA 3RB3A 1QE1A 3CM5A 4Z0UA 4DSEA 3OYEA 2BKEA 2HHVA 1D9DA 9ICHA 3VA3A 3AVBA 3IS9A 4LSLA 2ZUBA 4KAZA 8ICJA 1WSGA 3ISBA 4N47A 3NCIA 5HHHA 2Z1IA 3C6UA 5HP4A 4B9LA 4RW8A 4CJQA 1ZYQA 4BWMA 4CGDA 1HJPA 3MR3A 4DL6A 2PFPA 1ZQOA 2NRVA 4O3OA 4G3IA 2ITGA 4E1NA 3L2UA 4DTUA 4KLTA 3TAQA 4RUCA 1RT5A 4CGFA 4OPJA 5J2BA 1I39A 4O5BA 4RQ3A 4J9MA 4KTQA 4RZRA 1BVSA 4IRDA 2MUTA 3QERA 3AVIA 4XRHA 4FCYA 4ELTA 1ZQRA 3N4MB 5KG0A 4ECRA 3EPIA 4QWDA 3TAMA 3U3YA 3AV9A 3KHLA 4F4XA 1ZQQA 4I2BA 7ICEA 4Q43A 4CHZA 2IGIA 3RB6A 9ICUA 4GXIA 2FBYA 4C8LA 3PMNA 4F50A 4DU3A 3G10A 3Q8MA 5J2GA 3QEXA 2W42A 3PR5B 1ZBHA 4I2HA 2KN7A 5HBMA 4CHNA 4K8XA 5DQIA 5CA7A 1NK9A 7ICRA 8ICVA 3MEGA 4HHTA 3H4BA 4RG8A 4BXOA 1U4BA 4BXOB 4I2IA 4DL5A 3MDAA 4CEZA 4LSNA 4YCXA 4GXJA 4KHQA 1KDHA 3JPOA 2V4QA 3KD5E 8ICNA 4M3XA 5FRMA 3OYGA 4MFAA 1ZJNA 5CY4A 4W5TA 1LAWA 9ICIA 1NKBA 4F4KA 4M2YA 4ED8A 2W9CA 2F1HA 3BQ2A 5KG5A 2W9CB 1S97A 4CJLA 4NM1A 5KT7A 3F9KA 5HHIA 4O5KA 5DGBA 3IRXA 4KPYA 3HPHA 3DLBA 2VANA 4OGCA 1XS9D 4W5QA 3RJJA 1HQEA 3C5GA 4FJNA 2UVVA 1S9EA 4L8RB 2A1SA 3EYZA 5DBCA 5EU7A 1KFTA 3BGRA 4OGEA 7ICUA 4KB1A 4CIGA 1ZQKA 4F91B 1ZBLA 4GW6A 3C5FA 4AHTA 4I2JA 3MR2A 2ZJ8A 1C1BA 3JYTA 4FXDA 3OYAA 4J9SA 3JPRA 3CM6A 3AVLA 5J0XA 2HB5A 4FLWA 1ZQDA 3PO4A 2IDOA 4FLVA 1RT7A 4AHCA 2HNZA 3QEPA 1XSPA 2P1JA 4ECWA 1EXNA 3C2MA 5KFCA 3SV4A 3BQ1A 4QZGA 3B6OA 2A1RA 3LAKA 1TFRA 5HP1A 3UXNA 4TURA 5D3GA 1VRUA 8ICXA 2ISPA 3MECA 4FM0A 4H4OA 2B21A 4KN4A 1WCNA 3V9WA 5J2AA 4ED2A 3KLGA 4DOCA 1RTIA 2EX3A 4DTMA 2FBTA 4J2DA 2HHTA 4YXJA 1Z25A 1N56A 1NKCA 1TVAA 4YD1A 4IKFA 2BQUA 4KLUA 3NGIA 3PUFA 1SL0A 4KI4A 3EW9A 4KTWA 4DTOA 2W9BA 1IM4A 3TABA 2W9BB 1VSEA 3Q8QB 2DTUA 1MQ3A 5HRPA 5IIOA 1VSHA 4I2DA 3QINA 8ICHA 5C42A 1NOMA 4RQ0A 3ZSVA 4DOAA 1J5OA 4I7FA 3KD1E 3B0XA 4JV1A 3IM1A 1HYZA 2QKBA 4FJ8A 4FYDA 2PXIA 1JIHA 4FW2A 7ICMA 1TK8A 1ZQIA 1C1CA 5HRRA 3VQ5A 4CF2A 4OKEA 3V72A 3SNNA 3JPQA 1B9FA 3AVHA 5KFPA 4M9HA 4R65A 4DL3A 1S1WA 3NAEA 3LPUA 4M9JA 4YR2A 5IIKA 1S1VA 2E6LA 9ICQA 4J9OA 4CHQA 3VQ9A 4Z4IA 4DQQA 2FMSA 1ITGA 4M9LA 1PZNA 4ED6A 2YHBA 1S76D 3SCXA 4XQ8A 1X9WA 7ICGA 1SL1A 2XCAA 3ZCMA 1XI1A 4PHAA 3H08A 9ICGA 1S0OA 1FKPA 5J2DA 4QZIA 1TKZA 4RPZA 4RW7A 2AJQA 4KTZA 4QZEA 2FPLA 3H7IA 4DL4A 3EWAA 3H40A 4J9QA 4FM2A 1RBTA 3C1ZA 3MXMA 5F9NA 4YFKA 4DTXA 1I3AA 1ZBUA 4BACA 5KGWA 1BIUA 1Q8IA 3CQ8A 3AA3A 4F5PA 1TKDA 5L1KA 1B9DA 4J2AA 9ICLA 4I9LA 2AGPA 1YT3A 2AU0A 3TARA 3K5OA 2F8SA 4FBUA 5DLFA 8ICPA 3DOKA 3GFKB 5DG9A 3SZ2A 5C24A 1IKVA 3GIKA 3PR4A 1H38A 1ZQFA 3T5KA 2IA6A 7ICLA 7ICVA 1CXUA 3RJGA 2F1IA 4M45A 4DU1A 3HJFA 1RT2A 2OZMA 3I0RA 2OPRA 4M3RA 3SJJA 3QZ8A 3PW0A 3BJYA 4UQGA 3HX0A 4KLQA 3IAYA 4MEYA 3C95A 3OYLA 4ZTJA 3HXMA 1BQNA 2ALZA 5KFQA 2HNYA 4EZ9A 3B6PA 4CJPA 3GIJA 4GC6A 5KT4A 2G8VA 4O3NA 2PI4A 7ICPA 3AO4A 2JZBA 4IG3A 3H4DA 5KFRA 2QXFA 4Z6DA 1XSNA 1B92A 2AGQA 2ZTCA 4UB5A 1VSMA 4LVSA 9ICXA 3WNEA 3WNGA 4FZZA 3LWMA 4MEXA 3ZDEA 1BCOA 4CF9A 2HMIA 3HPOA 4KLMA 1F21A 3PVXA 4EBEA 3PX0A 4ECQA 4K4HA 1O1WA 3K5MA 3RH4A 5J0QA 2G8UA 2Q0ZX 4DSFA 3TAEA 4O3QA 2XY6A 4F5RA 1YVUA 4UB1A 3L2WA 1B43A 9ICVA 1RTHA 2DFLA 2ZUCA 1X2IA 3JPSA 2DFFA 3SUNA 3S3OA 1XSLA 1HNIA 1WSEA 4PGYA 1VSFA 5SZTA 1A5VA 4DOBA 4DFJA 2FLPA 2J6UA 1BCMA 1ZQPA 5J2HA 9ICTA 3L2VA 2G8IA 3NH1A 4OPKA 3DRRA 1S6PA 3HWTA 4Z4EA 3V9SA 4P4MA 3H8JA 1WSHA 2VWJA 1ZQYA 1XO1A 4O3SA 2FBXA 1Q9XA 3MABA 4TQRA 1JXLA 3V9XA 3GV5B 4IFYA 4F93B 2Z1JA 1BGXT 1XWLA 1Z3EB 9ICAA 2OPPA 3PX4A 3KLHA 3V1OA 4NLZA 1RXWA 1C0TA 1RDDA 4ELUA 4DEZA 4TUPA 1EX4A 3HM9A 2YNIA 4KHYA 1ZQAA 2JLEA 4O5CA 3OYKA 3Q8SB 8ICBA 3O3GA 1KCFA 3QZ7A 3QEBZ 4FS1A 1ZQUA 5KFKA 3D45A 2GUIA 1QTMA 5D4BA 2WONA 1JL1A 8ICZA 1VSDA 4DO9A 4B9MA 5E41A 4M3UA 3THVA 3JPNA 4N41A 1RDBA 4FJHA 1ZETA 4M3ZA 1K6YA 4F4ZA 3UXPA 4BDPA 4FW1A 4YMMA 1T4GA 4C8OA 5FROA 4MFBA 4F92B 4FJMA 1ZQVA 3KHHA 4GMJB 4E7IA 4ID1A 3MXJA 5CWRA 4CHOA 2ZQBA 3TWHA 4NM2A 1RNHA 4PH5A 1Q9YA 5DKWA 1RBRA 4B8AB 4K8ZA 4J9NA 1MQ2A 4KLGA 1JKHA 3HP9A 1T7PA 2RDJA 3ZSZA 5KFAA 1U45A 4DS4A 3Q8PB 3I0SA 2P66A 1JLEA 4M6WB 3PW4A 2W8LA 2IOCA 1U48A 3UXOA 3OSPA 1S5JA 5HROA 4DQIA 4FK2A 3L2QA 4QZBA 3OS1A 4XIUA 1TL1A 8ICFA 1ZQCA 3M8RA 4CGJA 2I5JA 1RTJA 4CFDA 4FVMA 3OS2A 5EOZA 4RW6A 4RPXA 3ZT2A 2V9WA 2XY5A 4KLFA 1IG9A 1UWBA 4GC7A 1T05A 3V7LA 4EBDA 1S1UA 3MGHA 1JLQA 4KLIA 2A1JB 3VQ6A 3VQDA 5J2MA 4IBNA 3NE6A 5J2EA 2J6SA 3CYMA 5KFSA 1REVA 1MC8A 4DG1A 4M0AA 2D0AA 1HUOA 4JS4A 5EWEA 3UPQA 5C5JA 3PY8A 1RZTA 4KLEA 5KFZA 2ASLA 1EP4A 3NF9A 2R8IA 2ATLA 3AVKA 4DFMA 4DLGA 2PY5A 5DG7A 5KG7A 1U49A 4TQSA 4EP5A 4PPXA 4N76A 4FJIA 2BCVA 8ICTA 4IRKA 1BI4A 1BI4B 3AVJA 4YD2A 2E4LA 1IKWA 1CZBA 4JRPA 2KZMA 1RDAA 3NFAA 3AA4A 4CF1A 3RJFA 2Z1HA 1QHTA 4CJVA 2GWSA 4RQ1A 4Y1CA 1A5WA 3Q8LA 2VG7A 5DBBA 4ECTA 4O3PA 3UQ2A 3VQ7A 3AUOA 1GOAA 3S3MA 2P5OA 3FDSA 2PFOA 2BPGA 4KHWA 4C8KA 3FFIA 1RT1A 4K4IA 1TK5A 4XA5A 4PHEA 2DPIA 3V6HA 1JX4A 3L2RA 8ICGA 4CJ3A 3OYNA 3GILA 4ECSA 9ICSA 5L1LA 3KKSA 4RPYA 4R63A 3HO1A 1CZ9A 3ULDA 2BGGA 2XCPA 4QZFA 4I2EA 3NH2A 1JXEA 2ZTEA 4R5PA 4B9NA 1RXVA 1FXXA 4J9KA 2FLNA 4P2HA 3QEWA 3TI0A 4BE1A 3SI6A 1FKOA 4QZCA 5J2KA 4LD0A 3SQ4A 5T7BA 1LB2B 4N5SA 2AQ4A 2DPJA 4ICLA 3ZT3A 3JSMA 1ZJMA 4PWDA 1NOYA 4R64A 1X9MA 2HVIA 2J6TA 1VRTA 3M9MB 1NJZA 4I2FA 4R66A 3SPZA 5HMMA 4JRQA 3NHGA 4PGQA 4CIFA 3TR8A 3OHAA 3NGYA 2C28A 3AVCA 3LP3A 3NH0A 4CEDA 3RB4A 4C8NA 3AA5X 4IQVA 3PMLA 3ZDBA 2KQ2A 4NYFA 3QE9Y 3RJEA 4O0JA 3RMDA 1VSJA 4CJUA 9ICMA 3TQ1A 1T03A 4EYIB 1WSFA 5KFBA 1QLNA 4KI6A 5KFTA 4ECUA 3OS0A 1XHXA 1RBSA 1U47A 4DWIA 4F5QA 3ZSWA 1UAXA 3M9NB 4J9LA 1JL2A 3HPGA 4DF8A 4I2CA 3DRPA 4ECXA 4RW4A 3DOLA 4F3TA 1LAVA 4ECYA 1L3TA 3BQ0A 1RDCA 3JPPA 1VK0A 4EYHB 3ZDDA 4BDZA 2KZZA 3GQCA 4FLXA 3RAXA 1NK8A 5D49A 3PO5A 4IDKA 1A77A 4HUFA 3VQPA 2KW4A 3MGIA 5KFFA 1NK5A 1KLMA 3V6KA 4O44A 3RRGA 7ICIA 2FMQA 2Z1GA 3SQ2A 1N5YA 2ZJAA 4MF8A 1NK6A 4W5RA 1Y88A 2ETJA 1C0MA 3NF7A 8ICCA 4C8MA 2XGPA 4FM1A 5DG8A 1K1SA 4ED1A 4QZHA 2C2RA 3V1QA 3M8SA 3L8BA 2AGOA 3C1YA 4CF8A 3TAFA 4IG0A 4DLEA 5DQHA 4RT2A 3SUPA 2OPQA 5KFWA 3FYHA 1TV6A
chains in the Genus database with same CATH superfamily
3ZTOA 4KH0B 2D5RA 3PM9A 2DXDA 1IBKK 4FS2A 1FFUA 1TZ0A 1CI4A 5K8PA 2CPXA 5L1MA 1XNQK 1SVDA 2H48B 2WRMA 1SAZA 2HRTA 3TUJC 3VGUA 3M8PA 1VQPN 3VESA 4KLHA 1G6BA 1RT4B 1UPPA 3U7JA 5FPMA 3VGTA 3I4HX 3UN2A 3KUGA 2X74A 1X0PA 3J80Y 3CPWR 3C14B 4ETZA 4CE6A 4JV5F 4IFVA 3OXFA 4WE1B 3VA0A 4F2RA 1UVLA 4K4XA 2HBJA 1JNZB 4KN7A 5FRNA 2MLZA 1IKYB 1BA1A 3SMSA 1TTHB 4G1QA 4DR1F 1HX1A 5BRFA 2OD6A 2DNKA 5LXYA 2WVFA 1M5SA 2UXCF 1BPZA 5J1EA 1S79A 4UB4A 2HBMA 3PRBA 1Z00B 1ZQJA 4IR9A 4RW9B 3F73A 3O9UA 2K8AA 3EL2A 1UFKA 2F1FA 2M3DA 3DAWA 1UFWA 4M41A 3BZKA 3O4NA 4GVBA 2O3DA 9ICCA 2YNFA 3TSUA 5ALYA 1QVGM 2IOFK 2ZH7A 4M42A 1ZD2P 1NKEA 3IFEA 4CNQA 1FRXA 3D6FB 1HUZA 2UUWA 4ZVSB 2GHPA 2NRWA 3N28A 4F4WA 4U7BA 2V2KA 3JS6A 2UP1A 1K1QA 5AKJA 4PQUA 3DU6A 2ZE2B 3NY0A 2BDPA 4PA1A 1NJYA 5AICA 5CHGA 2HHXA 5AQXA 1L8OA 1ZQ1C 3UI3A 2O67A 4B9UA 4QZAA 1RDFA 4CGIA 3NNHA 1IKXB 2BZFA 2UV8G 2QWNA 1HYSB 2HBLA 4L6V3 4DOZA 1U8SA 3BBFA 2GO7A 4IQWA 1SPBP 1BL3A 3THXB 1Y11A 4GVMA 3DHWC 4O0IA 3RBEA 4DR5J 3DRSB 2ASPA 1TUYA 3WBZA 2FHMA 1VQLN 2HS4A 2K4IA 2BANB 3I4PA 3BV8A 3HSGA 3K9JA 4NXNJ 4NZ7A 1VK3A 3B9JA 3LPTA 4WYBA 2OZSA 2QW9A 1WG1A 3EUB2 4H0TB 1HNZJ 3NS7B 3LP0B 2F8TA 1UA1A 3DNCA 3BUZB 2HSEB 3CVKA 5M1KA 2KVQE 4LF1A 2E8MA 5ETVA 2AZ3A 1TL3A 3D6RA 3OGUA 3O3FA 1GH8A 4Y0WA 4USAA 2DNHA 3P5BP 1W0HA 1RKJA 3MK6A 5AI9A 2VG5B 4GVEA 2PEBA 3NRZA 4C7YA 3TQEA 1PIEA 2VKZG 4I67A 2R8HA 1IJEB 2DO4A 4BUGA 5L1IA 2CPDA 1S0NA 2B51A 5BPNA 1RWOB 4C0BA 1OH5A 1LEOA 5JICA 2DJWA 5KG1A 4NXMJ 3NF8A 3DGPA 5EE3A 9ICPA 1SQFA 3IDWA 4UW2A 4OPHA 2C3OA 4CFCA 3A3NB 4M8LA 3RWUA 2Q3PA 2ZM6F 2E1ZA 4F8RA 1RTZA 2E2QA 4LRFA 1E6VB 1NSPA 3NKYA 1OH7A 1RT3B 2D0BA 1XNRJ 1FRIA 1RE1B 3PRDA 4FZXC 5L1JA 4X64K 3NTUA 4DR4J 3V81B 5AKIA 3OTOK 1WB9A 2QK9A 2YMLA 4YB7A 5ELZA 4JB8B 1RWUA 2R7TA 3AGRA 1VYAA 2RT3A 5KFJA 8RUCA 2CRXA 1SV0A 1TKTB 7ICHA 4FWOA 2NPFA 5H9EK 5ALRA 2X1BA 1P1LA 3TTFA 2A3ZA 4ZHRA 4BRQA 4DSJA 4I2QA 1P9QC 1U8WA 4BE2A 1LVHA 2YX8A 4DI6A 4KY3A 4GKKF 2IVPA 4JI8F 3AM9A 4V19J 5HRNA 3Q8UA 2XQCA 3Q8RB 1T11A 3HP6A 2LQ9A 2B56A 4DR3F 1M1KT 3T3FA 2CA9A 3D3CJ 2DXEA 5LSRA 1VQMN 4Q0BA 4KLDA 1S0VA 1TGOA 2IHNA 3TX0A 3AU2A 2KXNB 4WWSA 1OIAA 4OI0A 2AHOB 1PUZA 3AVGA 3T5HA 2EQYA 1WTFA 2KIWA 4HHUA 1FRHA 3PW5A 4CNZA 3SPYA 5K8MA 1NOZA 3BP8A 1D8LA 4OHXA 3D1OA 3IM9A 2VHGA 4DV6J 3FZ2A 2DH9A 3NS5A 2UXDF 4IQTA 1YJTA 2XHWA 2AP6A 2QTWA 1YRUA 2ZJQL 3F5TA 1JCFA 2MZTA 4O8UA 3BBBA 1KC8O 9ICWA 2EWHA 3SBMA 1NBEB 2ISOA 3PKMA 2QMXA 5KFDA 2X3DA 5IC4B 2O4IA 2E8OA 2DHGA 1EETB 1LWCB 1K8AO 2VGNA 4NLGA 4WFBL 4Z6FA 1V9PA 2ZIXA 4ECVA 2RPIA 2Y1IA 2K8GA 3E01A 3UWTA 1MSWD 4F26A 1GOCA 3V7JA 4RQ6A 1M5HA 2QFIA 2DFEA 4WBFA 4C6AA 4Q8EA 5HMYA 4FF2A 2Y8YA 3DDNA 4DR2J 2WB1F 2NXEA 3AL0B 1NK4A 4ANDA 3FSXA 3M2VB 3ISNC 2VPYB 2H3ZA 4ZCMA 3T1AA 1U2FA 4LBIA 5J2PA 4TLRA 1LWFA 1NGAA 2EFPA 1WF0A 1S72S 2JVRA 2ZC3A 3CDUA 4QW9A 3NASA 3AOBA 3RU0A 2FC0A 2JMGA 4H4KA 4OX8A 1TFWA 3I96A 2BBEA 3TTDA 3KDOA 3MR5A 4NXNK 3GJTB 3KG4A 4RQ7A 4TXSA 3N7SC 2LXFA 3EY1A 4KFBB 1UTAA 4NX9A 2FF3B 1XUPO 4BE0A 4KGMA 5EE0A 2OTLN 4M9GA 1JXBA 2FSKA 4RNOA 1BHLA 4CK1A 2V94A 8ICAA 5IIMA 1Z1ZA 1X8DA 2DD8S 3PNCA 4FLYA 2BCUA 2QSFA 2BR0A 1V5VA 2FVPA 4QZ9A 1KVAA 4LSNB 2G9OA 2RRDA 2YKNA 3W2WA 5BOMA 1R8AA 1ILYA 1NDCA 1KVBA 2CH5A 3BKTA 3AQPA 2JEIA 2QL5B 4FJ5A 3VOVA 1Z4UA 2FC8A 3ZSOA 1L7PA 3S8SA 3H3OB 1TAUA 3RSEA 3GV8B 5A2QO 4CERA 5JU5A 2BGWA 2VPWB 5G4DA 2BRLA 4JI1F 5KRTA 2OA8A 4L73A 5LSLA 4F3OA 3G86A 1VQKS 1QAIA 3I5CA 2B9XA 1XNRK 3ZD9A 4DR4K 4PXCA 2A19A 5HQLA 2FB0A 4P73A 1S9EB 3U26A 3D2SA 1HLUA 3J7YP 1WWHA 2P9EA 3H7HB 3MEDA 2W8KA 4WKYA 4QU7A 5DK5A 2P35A 4U7UD 4ILRA 5GAHP 4QWCA 1FEEA 1JLBA 1RBVA 2DHXA 1N54B 2FHJD 3W8PA 4FPBA 1KD1T 3UD5A 2RH3A 4C4TA 4M5GA 3M32B 1YI2N 4WCEQ 3PJ9A 4I2AA 1T9TA 4CIOA 2P9PA 1L3UA 3OFGA 6FDRA 1K44A 5AZIA 3CJSA 2HHSA 1S6QB 3OYHA 4JV2A 1WOPA 1OY8A 4GO7X 2XS5A 4YP3A 5CYMB 2AF6A 4NLNA 4DR5F 1H7WA 4PR6A 2F1JA 1TAQA 3KLGB 5KFGA 2V4RA 1RAFB 3VETA 3FCHA 1XR5A 4CF3A 2BUPA 5LMNF 4LZGA 1F9EB 3CD6S 1HNZF 3QO9A 1Q3UA 4TUSA 1FFWB 2D9OA 4E7HA 4Y2JA 3SQIA 3I8DA 8ICUA 2F3NA 1RQ0A 4WYLA 3EZUA 3BQTA 3F56A 3DM2A 4I7FB 2NYIA 1EQ0A 4CJRA 4OLAA 3S41A 4TSXA 1ZD4A 4GV3A 1KHWA 1RAHB 3QFPA 4K5SA 4HACB 1JLGA 4EBCA 3FBFA 3ZZUA 2W43A 1Z4NA 4OKJA 4K59A 2RVJA 4K4SA 3QT5A 1S12A 3KZBA 1RYRA 4ED3A 2QB1A 4MFCA 1F3FA 4NXMF 4CLLA 9ICBA 2DNZA 1Q95G 1RTDA 1J2NA 1IJFB 3J7YU 1SJFA 2QIFA 4O5FA 4DR2K 5GAHU 3CCRS 4DZDA 4EO8A 2D0CA 4QIWF 1LV5A 3K57A 3KLFB 1BG3A 6FD1A 1DLOB 3TRGA 4K41A 2FGCA 3K2PA 3UD4P 1JRPA 4G9BA 3CJCA 1NDKA 3P5JA 4FJ9A 3MR6A 5AKEA 2PC6A 2G2OA 4HTUA 3TFSA 1KOOA 4BRMA 2E5SA 2DXFA 3OL8A 2LYHA 3QYPA 1N5WA 4MDAA 1LK5A 1D8YA 1DRGA 2IJFA 3M2UA 3KZIU 2E8AA 5GMEA 3M30A 1J9AA 2ZF5O 3G96A 3V4IB 1JK9B 4R8UA 3MD1A 1N32J 2EAOA 1Q7YO 3QIPA 4UAWA 1JJ2R 3CMEN 3MAAB 1L7OA 2N4DA 1FW6A 1V3RA 4KPCA 1WN7A 4TLQA 3THWA 3ZEUB 2CPIA 4B3RJ 5AXNA 3KHYA 3AVMA 3FAHA 5LOQA 4JI2J 1BA0A 4Z6CA 1SV0C 2BQRA 3T1YK 1UVIA 4I68A 4PKGA 2J9DE 4CGZA 1JLCB 3TAGA 2KHVA 4NCGB 3IP0A 3NLCA 4CZFA 1D1UA 3KDNA 5A76A 3Q24A 2MEWA 4KSEB 2M9KA 2WVDA 4J7CA 3CTRA 3G4SN 2VC1A 4Y65A 4DV6F 2EH9A 3DHXA 4EEYA 3ET6A 2H4YB 3CC4S 3OHRA 2W25A 3WHIA 3QT6A 2UXBJ 5C2FA 2IHMA 1PK1B 3BN4A 3ILIA 4CEOA 5AK6A 1URNA 1ATRA 3VQ8A 1HARA 1T6DA 2C42A 4CK3A 1WORA 2V8HA 4EUVA 3O6QA 1CEZA 5ALOA 2B8PA 3MMAA 1FT8A 3S7RA 1ZC6A 2WAQD 2JZBB 1YBUA 4X62J 2YI1A 3RJIA 3I5BA 2OSQA 4ES3A 5AQUA 3M2RA 4K4GA 4OCZA 4H0YB 1LW0A 4AHRA 5IIIA 4QJFB 2R8KA 4CJTA 2HMIB 3DXMB 2ZEJA 4KV8B 3LAMA 3OFEA 3DXBA 2O8DB 1IO2A 1QUVA 2GUPA 1N62A 3HOTA 2HQ3A 4JWMA 4QYZJ 1ZQNA 1R0CB 3NVKA 2P51A 4M3TA 3KHRA 5C2DA 3CJ0A 4QW8A 2PFFB 4YG2A 1S99A 1R6YA 1M0SA 2GS8A 4DSKA 2DH8A 1ZPVA 2HVDA 3W5YA 3DOMB 3BR8A 1HNIB 7ICSA 2RMLA 1TL4A 1U6ZA 2X7IA 3NVMA 2QA2A 3J81O 4FWSA 3WX8A 3ORYA 1RU1A 2A42A 1HWUA 5ETLA 1WLJA 3GTYX 1FTRA 3ALYA 1IWAA 3SCKE 4CBUA 4CLTA 2E5HA 2F8LA 5ETPA 3ZSXA 3HVRA 4W4MA 4PG6A 5B0DA 3NDKA 1NJXA 8ICWA 2G8WA 5DB7A 4CDGA 3RJKA 7FD1A 4FFDA 3UCUP 2V7YA 2WBRA 2G8HA 2VV5A 4JS5A 5CZVA 3OJSA 1F9FA 4KHNA 7ICKA 3BY5A 3D6JA 5J29A 3GMGA 4H4KC 4CO0A 3QSIA 4Y0FA 3WKEA 1BDGA 2AD9A 3CMAN 3DLKA 1Q86O 3U1NA 4H4MB 4USJC 1C7YA 3OTBA 1AQ6A 4E19A 5DM7L 1Q82T 4CECA 3CCJS 3ETLA 4Q5VA 4MK9A 4B3MK 3KJNB 2NRRA 1BQMA 2CWXA 3ENQA 2IM0A 3HHDA 5HQMA 4IYQA 3RAMA 3CCVS 2NRXA 4M3WA 1A7GE 1JLFA 1RG6A 2V4JB 2ZHBA 5HI7A 5KFXA 3W66A 1X5OA 3H8YA 3V6DA 3KLEA 2XY7A 1V4SA 2CGKA 3CWJA 1B4FA 3OVBA 3TP2A 5CZXA 5I3UB 2W11A 2WVCA 1T6CA 2OMOA 7ICFA 4CW7B 4G6VB 2ZGZA 1RAOA 3H98A 3LP1B 1XN9A 4JI3K 1X4CA 4UAUA 8ICEA 4DV0F 4DPTA 3WC0A 4NASA 5D0GA 2FIUA 2N1RA 3ZTQA 3H5XA 2R7RA 1AFJA 2M2BA 3R6GB 1DY3A 4UTGA 3BBCA 4E7KA 5L9NA 3VCBA 2C2KB 1DHMA 1N32K 2AZ1A 1LWXA 1L3KA 3GLJA 4F2SA 3WX4A 2B4JA 4Z4HA 5KG3A 1HHSA 1MN8A 1DGSA 4B3RK 2OP5A 3CM5A 2IDLA 1HHTP 4JI2K 3MN5A 4H0PA 1T05B 3DXSX 2KG0A 4BR0A 2NQPA 1NEEA 8ICJA 4MN4C 5HHHA 3ZZ0A 3C6UA 1N5QA 4RW8A 2F9WA 5AJ3J 4WFAL 1RWWB 4U67L 2YB1A 1HJPA 4U96A 2GZOA 3MM9B 1ZQOA 2E1PA 1URRA 2NRVA 3HHEA 1N5XA 2ITGA 2M7SA 2JLGA 4KLTA 3HKZC 1RT5A 2UXBK 4CGFA 5J2BA 3R1LA 4O5BA 4RQ3A 4J9MA 4RZRA 4IRDA 2DEIA 4DV1J 2HMXA 2VDIA 4YEAA 4CTAB 4ELTA 3BYRA 1IKWB 1PCAA 3JAMO 3EPIA 2BJDA 3TAMA 2MGZB 3A8KA 3U3YA 3QJJA 1KOHA 3W64A 1U1MA 5ALIA 1ZXOA 2LYBA 1RHJB 4F50A 2QM1A 4I6AA 3BO2A 3VF4A 5J2GA 3M4XA 2W42A 4I2HA 2KN7A 2COLA 2IVOA 3KD3A 4CHNA 3MX2A 1SH2A 2C3UA 3CCWA 3QU4A 4TU8A 4FVCA 2NXJA 1BXNA 8ICVA 4HHTA 3PTWA 4RG8A 4DL0C 4FPRA 4DL5A 3MDAA 4GXJA 4WFNQ 3WEEA 3MN9A 2KRRA 3NL0A 2V4QA 4DU8A 1OY6A 3FGUA 4V19X 3CNHA 3WXMB 3PLAA 4LBHA 1FHTA 5FRMA 4WP8A 1ZJNA 1I6JA 1OSCA 3VALA 3O4WA 1FKOB 3NAHA 2HQFA 5AHXA 2W9CA 2XO6A 2LU1A 3WK4A 1S97A 1K73O 3CMAS 2FJDB 1FNMA 2V51B 2VBYA 2P2CB 3DLBA 2ZJPL 4OJOA 4OZNA 2HFSA 4P72A 3DC2A 4NLTA 3EZOA 4DUYJ 2J5AA 4C9DA 3EYZA 1HKCA 5DBCA 5EU7A 1XMQF 3W1YC 1Y10A 3H0RB 4MMOA 1KFTA 3KMQA 3BGRB 4F4AA 4OGEA 1RWXB 3D2WA 2DGOA 4ZK7M 4AHTA 5ADXH 4WZMA 2O8CA 4EELA 2ZJ8A 3JYTB 4UZCA 3F5AA 4WKRA 3EM1A 2KSOB 3WIVA 3SJHA 4EHTA 5D0HA 3ZZZA 1F0MA 1VLYA 2HNZA 3QEPA 2P1JA 1EXNA 3BQ1A 3LAKA 4OX9J 4AF1A 3UXNA 4BRIA 4F9OA 3BS7A 5D3GA 2KXHA 2Q1LA 4PEOA 8ICXA 2W7OA 2NPIA 5HVGA 3R97A 4ED2A 4AQYK 2KKVA 2E5IA 1FE0A 5AM2A 4X62F 2R2RA 2EX3A 2HHTA 3P8BB 1Z25A 4FZLA 2BQUA 2OH2A 1D9AA 4KLUA 2Q31A 2Z2LA 1QDUB 3PUFA 1K8KA 2KJVA 1IWGA 2W9BA 1UEKA 3HILA 2PE8A 1SB3C 3Q8QB 3GONA 4DUZK 2DTUA 1MQ3A 1ZM9A 4CO1A 5I3QA 5IM0A 5AFUH 1VSHA 3CPWM 2B7BB 3QINA 8ICHA 1NOMA 2O8BB 2CPEA 3QBXA 3IM1A 3KYLA 2QX0A 2YWKA 3R3LA 4A47A 1DARA 2PXIA 1GNKA 4OFZA 4FW2A 4IG0B 7ICMA 4C1NK 2PMZD 1ZPWX 1URJA 1C1CA 1YTYA 2A6AA 4NLPA 3LPEA 4YOEA 4MDBA 3JPQA 4FKYA 4HLBA 4M9HA 5F2RA 4DN9A 3BB5A 2V63A 2D0PA 4DL3A 3D66A 3FLCO 2AH5A 3Q86A 4YR2A 1S1VA 1D8ZA 2UYTA 4KYZA 5AJ3K 1CULA 4MIBA 4C3LA 4YOVA 3R8EA 3VQ9A 4DQQA 4K4ZA 3OTDA 1IG8A 2ACYA 2P9KA 3C0BA 4ED6A 4IFVB 3NOGA 2P9CA 4P75A 1MN9A 2CJXB 4FVUA 7ICGA 2AP1A 1WUDA 1XEZA 2VKQA 2RUGA 1U0SA 3T7ZA 4DV1K 3NCRA 3FVYA 3UMGA 2AJQA 2AXTU 1NAQA 2KICA 4KTZA 3VC8A 2FPLA 5CXTA 4FO0A 4ZVEA 2F65A 3CHWA 3OUYA 4OJHA 3JS9A 2FVCA 5F9NA 5CEHA 4DHYA 1RYUA 4P6QA 1WWVA 2XLIA 3VAHA 1Q8IA 2XI9A 2KHDA 2GEMA 2XMJA 3NGUA 1HWJA 1BO5O 4F5PA 1B9DA 2XMMA 3TVYA 2AGPA 1YT3A 2QWRA 3QIDA 2E29A 3B8AX 3R9PA 5DLFA 8ICPA 1NSQA 3DOKA 3AN1A 2O8FA 3GIKA 1IKVB 4DN0A 1DURA 3PR4A 1S48A 3TUZC 3PKYA 4QU6A 3T5KA 2ZKUA 1JMTA 7ICVA 3HZEA 4OPAA 4UF4A 3RJGA 2WVBA 1WC4A 2OZMA 2EK1A 3I0RA 3CCES 4BBYA 3EGVA 1SC3B 1NH7A 3TZZA 4OI1A 2W7PA 4UQGA 1KC8T 2DKXA 3KUHA 3OYLA 1AA1B 1GXUA 1QQ6A 4DZ6A 2ALZA 2CRLA 3ICLA 2HNYA 1A0OB 2QMWA 2JGAA 2E1AA 3BO3A 1OVYA 1K8AT 4GC6A 3M05A 2OXOA 2G8VA 3AO4A 4DUYK 4ZVFA 2QXFA 4IG3B 5AQWA 3HULA 4CF5A 1VSMA 2FJBB 3UN3A 4C80A 9ICXA 3ZO7A 3NMAA 4R79A 4FZZA 3LWMA 3ONQA 4FF4A 4HKQA 1VQNS 3A8JA 3C16A 2BA9A 4NLYA 5J0QA 4JI6K 4UUXA 2G8UA 4P2FA 4C98A 2XYHB 4O3QA 1VJ5A 1O03A 4F5RA 1YVUA 1W97L 3L2WA 1NMDA 9ICVA 2DFLA 4Y2UA 3M8ZA 5DM6L 3JPSA 3J7AP 2DFFA 1XSLA 4OX9K 4ZCIA 1NNDA 4DUTA 1I94J 3CULA 4A46A 3OT9A 2IHR1 5ALFA 4DHVA 1M5OC 3R6MA 2FLPA 2W1BA 1QUPA 2HVEA 5EDWA 1ZTWA 5EVZA 4OPKA 2GV1A 3D28A 3MM5A 4EX6A 2L9WA 2FBXA 3MABA 4IFYB 1ESVA 1XWLA 1WACA 2OPPA 1IG6A 3DGPB 3V1OA 3KLHB 4MLHA 1WDTA 1C0TA 2E9RX 4RBUA 3J7YI 2VIXA 3VTIA 3VGLA 1GQEA 5GAHI 2OTJN 1GTEA 2YNIB 4KHYA 3F0NA 3OYKA 2YX4A 1RK8A 2JR5A 4BC4A 5RUBA 4PL8A 3CCLS 3O3GA 3EMTA 1KCFA 1HNWK 4FS1A 3D45A 1HEKA 4KX5A 5JVHL 4ID8A 4V19S 8ICZA 5EE1A 4M3UA 3NCQA 2DPNA 1ACMB 4ZHRB 3SBTA 4I2QB 4CP5A 4ZJOA 2HRUA 3QICA 4M3ZA 3NGSA 4F4ZA 2UU9J 4QR1A 3AAPA 3NS1A 2RQKA 1Q79A 3H6EA 1RAEB 4E7IA 2F9DA 1S4EA 2HBKA 2QZ8A 4CH7A 2F4VF 3IC1A 2DBBA 4B8AB 2FGOA 1TFYA 3HP9A 3F44A 1U45A 2RHQB 4Q0BB 1EQMA 3GFXA 4DS4A 3Q8PB 3IKMA 3PW4A 1FJ7A 5E3RA 4OI3A 3FUYA 3EDQB 3GFYA 2LHTA 4KB7A 3UXOA 3FCWA 2DO0A 1S5JA 3MWPA 5HROA 2B7CB 4TNOA 2F9JA 2NSCA 2IY5B 2MPUA 5E3AA 3W5XA 3L2QA 4JI5J 5F0XA 4CRXA 2KU7A 4BS2A 4QR2A 4EEKA 8ICFA 1N34K 4MTPA 1X66A 1FCAA 2I5JA 1E6YA 1RTJA 2IM3A 2ZIWA 3BZCA 1C2PA 1CJVA 4RW6A 4MHVA 3P5TL 2XY5A 2KG1A 3FEZA 1QAYA 4DPUA 1SWWA 5D0EA 1ZOTA 4GC7A 1UWBB 1N52B 2DKZA 3R9KA 4E2FB 3MGHA 3SR6A 1JLQA 1S1UB 3BGOP 3MM7B 2ZIXB 5H1SQ 3E01B 3VQ6A 2BX6A 5BR8J 3NE6A 3CYMA 4TY9A 5KFSA 1NSAA 2XSJB 2RQCA 3CF5Q 3FZBA 1HUOA 2XMVA 1YJWN 4JS4A 4KLEA 3VCDA 4IOAQ 4PG5A 4O4RA 1R0BG 2IBOA 2H54B 2JL9A 3VERA 1RWKB 1HJOA 4A59A 4EP5A 4PPXA 4LF6F 3QJLA 8ICTA 1FKAF 4CZJA 3R7BB 4E98A 5IT9Y 1FFSB 3TO8A 3NFAA 4CYUA 2DNQA 1FI4A 1LWFB 1QHTA 2ZIVA 2OFGX 5AKKA 4RQ1A 4CWBA 2VG7A 4J03A 4O3PA 3UQ2A 4ZPTR 3CJ1A 2P9NA 1CBKA 2P5OA 5A8WB 2V69A 4X4NA 4C8KA 4KHWA 1RT1A 4AL6A 2VKRA 1G2EA 4XA5A 2DPIA 2HBZB 1Q8LA 1WDDA 3CCMS 1IQZA 3WQPA 3NNCA 2AYEA 1K0VA 4ECSA 4K0KJ 5L1LA 4M5HA 3CDWA 1GLEG 4R63A 2E3TA 4XTTA 1P8GA 4ES1A 2XCPA 1OH6A 1NGHA 5BN9A 2ZG6A 3MGJA 2ZWHA 2P9IB 1D09B 4R5PA 4ISEA 1I94K 3ADAC 3OBWA 2LDYA 3GG0A 4BE1A 2W40A 4USIA 4H5TA 4LD0A 4M95A 1LB2B 1B64A 4CRJA 5G0RB 2AQ4A 2NO5A 2DPJA 4ZPWR 3JSMA 3OPXA 1ZJMA 1NOYA 1QQNA 4PWDB 1OJ4A 4WQ5A 2GIRA 1VRTA 3ALRA 4R66A 4CM0A 3SPZA 1Q7YT 3NHGA 3GJRB 3AFGA 4PGQA 4CIFA 4WK3A 2MLXA 2ZBRA 2C28A 3G25A 1T0TV 2CZVC 3RB4A 4JKBA 1N36K 2KVSA 1NPKA 3PMLA 3I9ZA 3QE9Y 1RDRA 3H0LB 5F8IA 3I56S 3IRUA 2EAPA 3RMDA 3BF4A 3QWUA 3MPDA 9ICMA 3TQ1A 1T03A 1YBAA 3SK3A 3H2LA 4NL9A 5AXKA 1O8BA 1YVFA 1UJ4A 1QLNA 3CT9A 4BR5A 3MCPA 4ECUA 4CH0S 1RBSA 4DWIA 1JLBB 3G6EN 4F5QA 3CJ3A 3M8WA 2XNRA 3CW2C 1R59O 1UAXA 3GDQA 3HPGA 4DF8A 4JYAJ 3DRPB 2HF4A 4NE9C 2HOFA 3DOLB 4IEIA 2JDJA 3O5TB 2FUG9 3H45C 2PFUA 2F8KA 2P9PB 4CLZA 2B6GA 3RAXA 3VGMA 3PO5A 5B8HA 3VQPA 4IDKB 2G08A 3MGIA 4DV2F 1SXDA 2G1HA 1KLMB 7ICIA 1N5YA 3NGKA 3LM2A 3W0LA 2BM1A 4DCCA 4MF8A 1PYOB 2A0FB 1C0MA 3IO1A 4B1XB 3N7RC 5DG8A 3E58A 4A5BA 1K1SA 1VS3A 3NRWA 3WK7A 3UKRA 1YXQA 4GFJA 3T1HJ 3IN5A 3TA0A 2KJ8A 2LQ5A 5H9FJ 4CLKA 5A8RA 4DLEA 1YJWS 4RT2A 5A6PA 3SUPA 2ZWPA 4DQRA 4NLQA 5EY4A 4DV5J 5ALZA 4CJEA 2V52B 1B7YB 4O55A 2R2UA 4ED0A 5A2QU 1X7VA 5AKXA 2W04A 1RT4A 2OM6A 4OQJA 4HH0A 1WUAA 2FJVA 5EX5A 4RNFA 5KAIU 3C14A 5E33A 5IQQA 4UQTA 1FX2A 4OLBA 4OI4A 2ZD1A 2MQQA 1JLAA 2XTJP 2GLEA 2DNLA 1RTDB 5AIBA 1OW5A 4CI6A 1XTZA 2PMHA 5KT6A 1R8BA 1S10A 2V68A 1JJ2M 4M7XA 1HL6A 1FO1A 4FXVA 2CQDA 4Y2IA 3HD2A 3LALA 4QZ8A 1VCTA 3MPUB 1UEUA 5KTQA 2G1DA 3AO3A 3SBGA 1Q86T 5M1QA 2W4CA 4FWKA 2FF6A 4FLUA 4UT4A 1H6KX 1Z00A 3MFHA 1DEJA 1YVNA 3CG7A 5KG2A 5C2CA 2HHHJ 4KQZA 1HI0P 4P2MA 1U26A 1SC4B 4JKDA 3M2UB 1N33J 1UMJA 1SKWA 1B22A 4BR2A 1SQGA 2UU9F 4R8UB 2KFZA 2FYXA 3QIPB 1VLOA 2GO8A 2EAMA 1GAOA 3ISDA 1XHZA 4ER8A 2FMPA 3OD2A 1VK8A 1FK9A 2HVHA 5J0PA 4K42A 2X1AA 3OTQA 1F0XA 3SI8A 4GKJJ 3BYPA 3I8BA 2HLUA 2E9TA 5AKYA 2VJ5A 5GIOA 3AA8A 2PI5A 2B4VA 3AVFA 4Y2YA 1YRTA 3I6PA 5MLCQ 1IKXA 2LYVA 1ELOA 2L5YA 4TYAA 2Y1RI 5BPCA 2D41A 2W9AA 5KNIA 1EWRA 2CQ4A 4FLTA 3ET6B 2D3DA 5E3PA 4JI5F 3L5KA 5EWFA 1NHUA 1CJKB 2R2SA 4XPCA 2AQ0A 2MZRA 3L3VA 4FWQA 2MSNA 3THPA 2D4WA 4KO0A 3CC2N 3MGVA 5CCMA 2BANA 1BWEA 1EX8A 8ICYA 2CYYA 4HT5A 1KQQA 4ZCLA 3UPFA 4BRAA 3P83D 5BR8F 3ZDAA 3M2RB 2DGWA 2JRSA 3PIOQ 4CCHA 5HVHA 4I6MB 8ATCB 1BISA 2QA4S 4ZP8A 4PYDA 1VQ4S 1RBUA 2YMMA 4CFAA 4NZ6A 2GO9A 1WKLA 5M1OA 1YAGA 5HANA 1XQSC 3CC7S 1RU2A 1R43A 1RCXB 3G6XA 2O1PA 2LEPA 4UB2A 2DNOA 1OPIA 3SUQA 2K8CB 1M1GA 4IQUA 2PA3A 2YHXA 1QD1A 3QYYA 3UVJB 1DFDA 2FLLA 2WAQF 1FDNA 5AXLA 2QLJB 2WUSA 4OJGA 3OY9A 2NUBA 4GRSA 4IOCQ 4GMKA 5HNKA 2QWMA 3M6ZA 2YNHA 2VZ9A 2BZ2A 3FQKA 1FIQA 2PT0A 4LY7A 1S57A 4C3MA 2IVYA 3T1HK 5LJ5Y 1PYSB 1R3NA 4K0KF 2XNQA 1U24A 1YJ9N 2MB0B 3V81A 1U25A 5AKGA 2QL7B 2WZ1A 4JKAA 2R7VA 5IOLA 1HWKA 1EB0A 4WFXA 2BJEA 3VQBA 4M47A 1HPZA 4E1MA 4DV5K 3MEKA 1TUUA 3EXCX 3VQCA 5AI5A 3ZETA 2GAGC 1RCHA 1TKTA 4L76A 3NBPB 3O80A 5FLXU 5I9EB 2LM4A 1UT8A 2KHCA 3ATVA 2D3UA 2OMLA 4B9VA 1S59A 1UJ6A 5A0YA 3QESA 1K73T 1GMWA 1K47A 4X66J 2QWPA 3DLKB 1QHAA 1UPHA 1XO0A 3QMLA 4IXCA 4WTOB 2W2PP 1T9XA 3POTA 2Q66A 2NLWA 1VBZA 2W7AA 2ZH9A 2OEMA 4F02A 3R5DA 2FQQB 1QVFR 3TU5A 3LZJA 2DL0A 1JLFB 2Z8QA 5DB9A 2OEKA 3OPKA 2ZWOA 3V6DB 3G6YA 3KLEB 4GLXA 2F8EX 1RPLA 4HCCA 2FY8A 3G2XA 4UOCA 5LMUF 4KGZB 3DYAB 2EFNA 2DFHA 4WQ5C 4FF1A 3G9CA 4EO6A 3EKSA 2IIHA 5KAKA 4OYIA 2HHHK 3PV8A 3DDIA 4IR1A 4A8FA 2GGPA 5A8KB 2Q6BA 2ZJRQ 2Q2RA 1BUXA 3OSNA 5CZ2A 2OCEA 2FPKA 1D5AA 4YS2A 3OHBA 1N33K 5HVFA 3WKDA 1KSPA 4JYAF 3FJ2A 3J81U 4YB1P 4LFCJ 3PNIA 5IILA 3C46A 5IT9U 4ZVTB 1EETA 4AHUA 4OV6A 1LWCA 4YNQA 2UUBJ 3ZTPA 2Q6CA 3HLUA 4A48A 4LH4A 2V8DA 3K0JA 3BH6B 5KFHA 4LFAF 2IBKA 2VDHA 2I5HA 5B0FA 4GKJK 3Q8KA 1X4AA 2IRYA 2CJYB 2X6NA 4F04B 2VG6B 4FYWB 4ILHA 5K14B 1RT6A 4HVJA 2K3IA 4JI7K 3NMUA 1VISA 4O3RA 1U6FA 3VAIA 1QH9A 1AB8A 2EZXA 2XS2A 4CZHA 3C6UB 5J2QB 1B0TA 4RW8B 1NK0A 3L6QA 1ZRMA 5BPMA 4BY9C 2ZHOA 4FJGA 1B3TA 1SIZA 2DWQA 2D0OA 2R42A 3G71N 4HUEA 2GJFA 2M70A 2WHEA 5BPLA 1RT5B 3GR1A 3HVTA 2X6SA 1WD6A 3ENHA 3IBPA 3RAQA 4PXEA 3OVNA 4UY8O 3CFOA 4PZOA 4MQ3A 4LF4K 1U1PA 3RFAA 2N3LA 2CQ3A 1DK2A 4HWIA 2V6AA 2UUCJ 1YITN 3TAMB 1WKKA 3DLHA 1BOTO 4EENA 1FFGB 5D46A 4KFBA 1HQ2A 7ICNA 4CZCA 2F96A 1TELA 4CJ5A 1HIYA 2R9LA 5K8NA 3TA2A 3LP2B 3O1BA 1U2RA 1BHNA 4DXLA 1NMNA 2JVOA 5ITHA 3HFZB 4JI3F 2VQEK 4NXZA 1RYSA 4E7JA 4KLOA 4CHYA 4ZLLA 2GH1A 3UQ0A 1FD8A 1PAUB 4CBXA 4RNHA 2BQ3A 3WEEB 2CG4A 4O4GB 3MWBA 1LXNA 3KK3B 4G1IA 2JZ5A 3J7A1 2YV0X 3PYDA 5U47A 2FLOA 3LVVA 1K0TA 3IP4B 3D0HE 1WI8A 1VQOS 3WNHA 4P4PA 4C97A 1T8EA 1JCGA 2RN2A 2FJXA 1SKUB 2F7TA 2Q0RA 4IWVA 2X3GA 3L4PA 5B0GA 2XLKA 3VF6A 5TZVA 2BHNA 5AQOA 2ZH5A 2M9NA 4OJ5A 3DI6B 5DMRA 3MXIA 2YMQA 4EZ6A 3ELHA 4LF5J 2WVEA 4CGGA 1FFVA 2GMHA 3ASMA 4JI4J 1ZQZA 5CE3A 5BYSA 1ZQMA 5ETNA 4ED4A 3HL8A 4UOGA 1SV5A 3BSNA 1H7XA 1GLLO 3MAQA 2O8CB 2O5DA 2OJ3A 2P9SA 3GOIA 3M32A 5DQGA 3CJRA 2KJWA 1MLAA 2IVFB 2WW8A 3FM9A 1SXLA 1QQCA 1S6QA 4EFHA 5HMZA 4AHVA 4QPTA 2CZ9A 5EE9A 4U95A 2J7KA 4KLSA 3MFIA 2XZDB 1C6VA 2PFQA 5CYMA 5ALWA 4ZH4A 5L38A 1IBCB 4NCAA 3WKBA 1S6OA 3I32A 1J2VA 3ZSQA 1Q16B 3MR7A 3MXHP 4ANEA 5HRSA 4L74A 5EGYA 4AD6A 4DPXA 4A61A 4CEFA 2BJ8A 4X4PA 1WHWA 4LF9J 2Z0GA 2GELA 7AT1B 1OH8A 4F3MA 4Z6EA 5CA5A 3K58A 5GAGP 3R5JB 1L3SA 1X1PA 5DZ7A 1ZQBA 4LFCK 3O3HA 2DGZA 5I42B 5AM5A 1Y97A 4IS7A 4ED7A 4KHSA 4LF8K 2JX2A 2DK2A 2ABYA 3T19A 4BCAA 4Z4CA 3QEIA 3ISCA 1C1AA 5IWAK 1TL7B 4WYWA 2OPSB 3VGKA 4H0XB 4AH9A 5ADXA 2WSCC 3QQCD 2VPZB 3C8YA 1XK8A 5AQZA 4KH4A 3L4IA 4CF0A 2P6TA 3EN9A 4KMUA 4CE9A 2B4PA 5KFIA 2CQCA 1S1VB 2MQOA 3KLFA 7FDRA 1MW7A 1DLOA 2H3EB 5F3XB 1CULB 1ITPA 1QZ5A 1VQ9N 2Z30B 1RHKB 4BC3A 1X4DA 3WNFA 2P9KB 4XK8C 3PSPA 2NREA 2PMZF 4KRWA 5F8NA 4G1PA 4MIWA 3LDLA 5CR0A 3EZ5A 3S3NA 3AVAA 1HJRA 4PAAA 4MF2A 2D8CA 4H0VB 4YB5A 4X66F 3V4IA 3OUYB 1CG2A 5HLFB 3QRRA 2UUCK 1ZBFA 5IC6B 3MAAA 5J0UA 3WT0A 1NGBA 1DTQB 4JV0A 1VGYA 3KK2A 4OJLA 5ETKA 4IQXA 1U2VA 3ZEUA 1RACB 4X4OA 2CPFA 3WUHA 1WHVA 4DV4K 3N97B 4O9MA 3QFUA 3TFRA 3KKFA 2MXYA 3BO4A 4C48A 2OD4A 5ETRA 3OLAA 5GAGU 2DCUB 4QOZB 1JLCA 2V50A 3VVUA 2BE2A 3PIPL 4NCGA 2ZTDA 2O8FB 4KIAA 3NWGA 4GNIA 2KFNA 4PGXA 2CQBA 1X6IA 8AT1B 2AW0A 4P2XA 5KG4A 3RR8A 3W63A 2ROPA 2VFSA 1QSLA 1ZQSA 4B3SF 2GQ2A 1HR0J 5BYRA 2I1QA 1PK1A 3CI5A 2ZBCA 1AW0A 2HOEA 3WXKA 3KLIB 1BQXA 3V6JA 1WI6A 3E1YA 3CDBA 2XWYA 1VQ7S 5CYQB 3DLRA 3V7KA 1H72C 3CCUN 1J5EJ 3C94A 1JROA 2UUBF 4B9SA 4OVLA 3K5NA 4FK4A 1FJCA 3TPQA 4FLZA 5DB6A 3PRVA 4UBBA 4KLJA 3HFVA 4JI4K 1LXJA 5EHHA 3AOAA 2JXJA 4LIRA 2XMUA 4CLFA 4FOIA 2QT7A 2IC3B 3ILLA 1T44A 1N5SA 3DXMA 4KV8A 1B70B 2DQNB 1HBOA 3W65A 2F3JA 4HUGA 2O8DA 3MDCA 3QNNA 4W90B 3C16B 3PJXA 4KGKA 3BSCA 2JGUA 2NYVA 3O0FA 2JEGA 1L5UA 5KFYA 4JN4A 4Z4FA 2F8MA 1FRMA 3T6BA 1ZQLA 5DZ6A 4P7TA 1WAFA 4FPAA 3MBYA 1ASWA 3F2BA 3VTHA 2YNGA 4DL7A 2F8HA 3DOMA 4WU3A 2YKMB 2FZKB 2AT1B 3TEHB 4OZLA 2ZUDA 3FZLA 2K60A 4X65K 3X3UA 4FO6A 2QWLA 3MM5B 1Q5YA 1J97A 1HNXF 4UASA 1T3NA 4LF9K 3D0IE 2LVWA 3HHLB 2K1RA 2KH9A 1R31A 3VN5A 5L39A 3OYBA 4KHMA 3ETRA 5THWA 2BCQA 2DIUA 3OW2M 3MX5A 1AYEA 2LQBA 4AE5A 1VQ9S 5J0YA 1HW8A 1X4HA 4DR1J 2A40A 2A5XA 4YMNA 2UXCJ 1NNLA 1Q8KA 1C20A 3D4JA 4H4MA 7ICOA 2AEJA 4USHA 3NWRA 4E0DA 3L3UA 3OFHA 3D2FA 1TUWA 4BVPA 4CZIA 3AD8C 2GVZB 4QS7A 2VASA 1NZPA 5C12A 2WOMB 2IM1A 2NV3A 5J2CA 2HHWA 3I82A 1LWEA 3UCGA 2J9CA 4DR6J 2FHOB 3L4BC 1VQ5S 3GIMA 5I3UA 2GMLA 5DLGA 4C1NI 4LF5F 2BKOA 3G6VA 2C3YA 5AI4A 1BPDA 4F5NA 1Q3VA 3LP1A 4X4QA 4JHDB 4JI6F 4B17A 4QCLA 4ZPDA 2QMUB 1ZM3A 4BHQA 1VR6A 2PBDA 1YJVA 4ZIWA 4IJAA 2X78A 4RQ8A 4FDFA 5HROB 5KGXA 1YSJA 2QYGA 3CDEA 3J7Z5 3SYZA 3BF1A 2MJUA 1WEYA 4PRFA 2CVEA 3AD9C 1A6SA 2PFNA 4KHUA 2ZIWB 1VFJA 2ZNYA 1CJVB 3CJ8A 3RB3A 1QE1A 3MTJA 4YMEA 3UB5A 2JFKA 4DSEA 2BKEA 5ETQA 3LM9A 1N5VA 3NVVA 9ICHA 2MHEA 4CLSA 2ZGYA 3IS9B 4LSLB 3W8GA 2E2NA 2X1FA 3ISBA 4N47A 3NCIA 4J91A 2XM3A 2G5IB 1ZYQA 3MM9A 4CGDA 1OVQA 2BV3A 2HQDA 5LXRA 3O9TA 3LDNA 3CE8A 4O3OA 5E2QA 2XG8A 4RUCA 2MSTA 1PBAA 1I39A 5BREA 3QATA 2CQIA 3R2DJ 3QERA 3AVIA 1S4FA 3FGVA 2B0GA 4FCYA 3B82A 5HO4A 3DLLQ 1ZQRA 1P27B 2GQQA 3MPVA 3N4MB 1WBBA 3HRDD 3IR5B 4WFBQ 3HT0A 2P5VA 2B9EA 5DJBA 4CYUB 1OXJA 2ZIVB 3AV9A 3WQUA 3QX7A 2VG7B 2HQGA 1KAZA 4CHZA 9ICUA 2CDQA 4GXIA 2FBYA 4Z2XA 5ALPA 3PMNA 4DU3A 2P9NB 3Q8MA 3FR0A 5LL6d 1RT1B 4A8QA 5HBMA 1O5JA 2WFBA 1XERA 3I87A 2CJAA 4JK7A 2CAJA 2VB6A 2C2ZB 4KH5A 2HK2A 1F1BB 1V3ZA 1NK9A 4C7QA 3MEGA 2ZBIA 1U4BA 4BXOB 2FVQA 4KHQA 1YUWA 4YN3B 3KD5E 2YX6A 4R5PB 1HI8A 2ZH6A 2VODA 4F72A 4MFAA 5CY4A 4B02A 1FNOA 2GOLA 3SFUA 4M2YA 4ED8A 5KG5A 1UAWA 5KT7A 3IRXA 1KN6A 3AEVA 2RDDA 3HPHA 4ZITA 2VANA 4JI8J 1VRTB 4W5QA 3C5GA 2JH1A 2UVVA 2KFYA 4JV5K 4DR3J 1M1HA 1RAAB 4Y2SA 3M6UA 4QIFA 3O9RA 2YKPA 3BGRA 1AT1B 5D4NA 2M5YA 3FBCA 2AJ4A 5LSOA 4CIGA 4F91B 2RU3A 5B7WA 1ZBLA 4GW6A 3C5FA 2PSZA 4DR1K 5F0UA 3HI9A 1C1BA 4KX3A 3JYTA 4FXDA 4URQU 3D6TB 3TJ8A 1GLFO 2ZBQA 2KSOA 2UXCK 3RYLA 4KBOA 2O8EB 5J0XA 3MCMA 1HKGA 4RQNA 1UVJA 4N8OA 3E66A 4FLVA 2UXDJ 1HR0F 3RG6A 3KUEA 4NA1A 5KFCA 3VWSA 2A1RA 3LVWA 5HP1A 4DQ8A 4P10A 4EMDA 1NUEA 4TURA 2QN6B 4ZS6A 1RJJA 2ISPA 3MECA 4FM0A 2XICA 4C3KA 4H4OB 1WCNA 4CLWA 2A1AA 5J2AA 1J5EF 4IDHA 2HFVA 5AQQA 4FNHA 2Q79A 4DOCA 2KK0A 1RTIA 2K8BB 3C29A 1NKCA 3KNGA 3DDKA 2NR0A 3SIPB 4IKFA 4WP9A 2QLTA 4XDCA 1N5YB 3U27A 3FRYA 4A8SA 1HA1A 3IDHA 3JAMY 1IM4A 3C2PA 3GWCA 5H1SV 1YIJS 5HRPA 5IIOA 3LGHA 4HHJA 3ZXWA 3QFWA 1F5BA 3FQLA 3G87A 4RQ0A 3KD1E 5C42B 1IN0A 3B0XA 1R27B 2PFDA 2QKBA 2YWFA 4FJ8A 3D1HA 3T9NA 2E1YA 1VHIA 2WCXA 2OIHA 3HTVA 1NB7A 1RHQB 4C4WA 1FE4A 5HRRA 3VQ5A 2CADA 4CF2A 4OKEA 3BM7A 2HG4A 4DV3J 2DR6A 5MAOA 3L9ZA 4R65A 2KT5A 4OLOA 5D0RA 4RKUC 3NAEA 2NXUA 3K5PA 1S1WB 3M6KA 3LPUA 3L4QA 3S1TA 2RU9A 3HZ6A 4CHQA 4DX6A 4ZMMA 5EXWA 2FMSA 2VJUA 2MQMA 1Z4OA 1PZNA 2ZD1B 1JLAB 4Z7YA 1MWQA 3VENA 5IXUA 2VYPA 3ZCMA 3H08A 1WC0A 1OSDA 5DS7A 1NG9A 4RPZA 1UPMB 4RW7B 2BDUA 1T9VA 3MDQA 3FSIA 3A3OB 4PZNA 4FM2A 1FXRA 3C1ZA 3BPSP 4J8FA 4M5LA 3MXMA 4HTLA 2QJ3A 3AY0A 1I3AA 3US5A 3I5AA 2QLFB 5AQJA 1Z2ZA 2XIDA 3AA3A 1YJ7A 4DKWA 2DR7A 5C7PA 4I9LA 4JI1J 2ZM6K 2E88A 1QQOA 2F8SA 4WP3A 4FBUA 4PPZA 3D7EO 3O8WA 4NB4A 2LA4A 1GXTA 1I5OB 3GFKB 1VMBA 1G3OA 3SZ2A 1O6XA 4F7VA 1IKVA 4DR6F 3IG8A 3DU5A 1ZQFA 4Y2AA 1U1LA 3QGGA 3BDEA 1FK9B 3FBEA 5F8GA 3MURP 4A8XA 4JKEA 1CXUA 4M45A 1F6TA 3HJFA 1O13A 1RT2A 3W3DA 2CQGA 2BOAA 3A8EA 3RJMB 3BJYA 3I55S 2DVIA 5AZJA 3T69A 4KLQA 3IAYA 4MEYA 1C0GA 3C3LA 3UKUB 4LVOP 4ZN1A 4GKKK 3UD3P 5KFQA 1MMDA 3JTPA 3L7OA 4JI8K 3C6AA 1YHQS 4WJBA 3B6PA 1QQ7A 4Q7AA 5KT4A 4LR7A 4IO9L 4IG3A 5KFRA 3LL3A 1XMOJ 1VQSA 4DR3K 1ZXIA 2AGQA 2ZTCA 4USVA 4UB5A 4BROA 2PD1A 4CZLA 4LVSA 2MKKA 1RZMA 3WNGA 4YHHF 1KBUA 1PBUA 3PYEA 4KO0B 3LGMA 3GJSB 4B3TF 4NA3A 2F5GA 4K50A 3HPOA 2MDAA 4PG8A 4B1VA 1MROA 1F21A 4EBEA 3PX0A 3D2QA 1WEZA 4H5VA 3RH4A 5LMNJ 1FEHA 3OXLA 5B08A 4DV7J 4LQ9A 3SDEB 1C0FA 1NDPA 2E66A 4TU7A 2QEXS 2UXDK 2CNKB 2Q0ZX 3TAEA 3QUTA 1W7WA 4NL5A 1DAXA 1CC8A 4UB1A 5AQRA 3CJ2A 1HLWA 5TISU 3I28A 2P6SA 1S72N 2XVTA 4BRNA 4YDUC 4ILMA 4P0PA 3SAFA 3ENAA 9ICTA 3L2VA 3ULHA 3NH1A 2ASMA 3DRRA 2PA8D 1S6PA 5A0LA 2VICA 4WIIA 2ZH3A 4P4MA 3H8JA 3TEGA 1WSHA 1XO1A 2Y8WA 4CZEA 4MT1A 2GWKA 1NGGA 1CC7A 4TQRA 1N61A 2KKPA 1ICEB 3V9XA 4IFYA 4OYOA 4OMFG 5LT5A 5AQIA 4KHPJ 2W55A 2E1MC 3KLHA 5KQDA 1WOOA 2W6KA 2JC1A 3J8AA 5FP0A 4YY3J 2YNHB 1ZRNA 4AUKA 4IEEA 5LY3A 3H46O 1Z6RA 3GU0A 2YNIA 4K25A 3CD0A 4WK1A 4FWRA 1QVFM 2K06A 8ICBA 3O8MA 3C15B 3QEBZ 3GCXP 2GUIA 1HPZB 3WK5A 4RUHA 5ALQA 4OHWA 3ZETB 4K43A 2WONB 2IRUA 2FE9A 3GSDA 1IR0A 3MMJA 1ZH5A 5A0YB 1DT9A 3CB4A 1RDBA 5FD1A 1K6YA 3UXPA 4BDPA 1F2HA 2ZOMA 4LF2A 1Z2LA 1VBKA 4F92B 5ALMA 1VQKN 4MFBB 3CJ7A 3POTB 3V2UC 2YB4A 3MXJA 2HHPA 4CHOA 4NM2A 1RNHA 3FE1A 3BS5A 5DKWA 1CRXA 3C65A 4K8ZA 1MQ2A 5KFAA 3SAGA 3TADA 3CF5L 5E3QA 3I0SB 2I6XA 2XMWA 5D78A 1U48A 4M5KA 3MM8A 5GAGI 4DCJB 4IQMA 5CD4H 4OYAA 4KMOB 1T02A 1JCEA 4BR4A 4DQIA 4MK8A 5DM7Q 3Q0AA 2GGPB 1H2TZ 3K17A 1ZQCA 1TL1B 2EBGA 3M8RA 3TZWA 5MLCV 3E9OA 3HFKA 3AT1B 4FVMA 3OS2A 4QIWC 4RPXA 1Q18A 2V9WA 1L7NA 3IBWA 4Z94A 4JI1K 4KLFA 4LJXA 4CO2A 4ENOA 4M5NA 4JNEA 1UWBA 4HTJA 4EBDA 1MWYA 1WUUA 1S1UA 2CJQA 3MM7A 4KLIA 3KJFB 1GXLA 2MTLA 5J2MA 4USWA 4IBNA 1ZM4A 2XSJA 3CD6N 2DITA 2U2FA 1REVB 3PYGA 4CM2A 2IOHA 4NLWA 2D0AA 2YY6A 4MK7A 3UPQA 5C5JA 2JLFA 2ASLA 3P38A 1RT6B 2WF6A 4DFMA 2RQ5A 3B78A 5DG7A 2KLAA 1U49A 4TQSA 3VZIA 2YKQA 2KJ5A 2I1RA 2BCVA 4YD2A 3GZFA 5IV3A 1NSKL 4M63A 1RDAA 3HVTB 2Z1HA 3GYNA 4OHVA 1SCJB 1U1KA 5ETMA 1SGGA 4DV3F 2HSTA 1NDLA 4DR5K 3H3NO 2BACA 3AUOA 2HGLA 3CD5A 3S3MA 5A8WA 3FDSA 3FFIA 2XHCA 2AEFA 2KVIA 2E9ZA 3CCRN 5LJWA 2CJBA 4U67Q 9ICSA 3F41A 3KKSA 2FJEB 3NEKA 1HNZK 4UB8U 4P7VA 4UOHA 3HO1A 4X4TA 2EWSA 3NH2A 2P9IA 1N60A 3Q8VA 3O08A 2EDUA 4B9NA 2CUYA 2GHVC 4H5RA 3WXLA 1ZA1B 4QZCA 5J2KA 2GA7A 2BM0A 4YOUA 2ASOA 1N63A 5G0RA 4N5SA 4ICLA 3OL6A 1PGZA 4M94A 2MKSA 4PWDA 1ZM2A 2ZOGA 2R4FA 1D4XA 2NZ4A 3LDOA 3T79A 1FRJA 1ULRA 5D6GA 5LJ3Y 3OHAA 3NGYA 4BR7A 2A2CA 4NXMK 4NLSA 5DRKA 4P0QA 1RADB 4CEDA 4IQVA 2KQ2A 2XWXA 2HK3A 1VLBA 4CZGA 2H3GX 4O0JA 4HL9A 1RDWX 4PYAA 4EYIB 5IV4A 1WC5A 3LPYA 4DJBA 3K2YA 2VIHA 2R3VA 2KM8B 4RUBA 2KB2A 3RBXA 4JB3A 4DV0J 3CC4N 1XHXA 2YN4A 3WQTA 1SV5B 3M9NB 2HAFA 4DPOA 2WF9A 1JL2A 2Q36A 4I2CA 2LU2A 3DRPA 2P9SB 2NS1B 3DOLA 2ZBPA 4BG9A 1LAVA 1L3TA 3D2EA 1VK0A 5I3PA 4EYHB 4Y2PA 2AYBA 3GQCA 4FLXA 1F5AA 1CLFA 4IDKA 1XMOF 1A77A 4HUFA 5F8HA 4EK2A 2RD5C 2BABA 3ISZA 2KW4A 2I6WA 3QT8A 4C8YA 1NK5A 1KLMA 3V6KA 4O44A 5FIIA 5FJ4A 3O2IA 2AKWB 2WF8A 1UZDA 2ZJAA 1NK6A 4W5RA 4OX6A 5GTHU 4Y2RA 8ICCA 2XGPA 1QQ5A 4FNIA 4QIWD 3J80U 3FZMA 2MA1A 1EIYB 3V1QA 1SJQA 4NLOA 3AMZA 1XR7A 1EWQA 1FA0A 1LNQA 2QA4G 4DV7F 2A6MA 4DV6K 4F67A 5DQHA 3TA1A 4RLEA 5KFWA 1VDVA 3Q8SB 2DY9A 3A8YA 5LL6Z 2PN6A 3TKAA 3LTOA 2U1AA 2W24A 3IBCB 4CJFA 3T5LA 4O8KA 2P9GA 5KPTA 3C6TA 2Q1NA 5TKYA 3OYMA 2XEXA 2FPMA 3LDQA 5EOYA 1JJHA 4NWBA 2VL1A 2GJ2A 5GMDA 1YTUA 2OEHA 1XIQA 2MHNA 4LVNP 4TY8B 2I2YA 4FZYA 2OHDA 2HI0A 4ZN3A 1QSSA 3NG8A 4GXKA 3DLGA 3ISND 4DCPB 5KQ8A 4KHPF 3W2VA 1SBRA 2KZ3A 3TJAA 3U9DA 2MYFA 4YY3F 3HSDA 2H9ZA 2OI2A 3G82B 4B3OB 4ZPAA 1UVKA 4CFBA 1XC9A 1KVJA 1KVKA 3CJAA 4UB3A 5AK5A 2QLXA 5CHCB 9ICEA 2E20A 3EPGA 2LSNA 1RQLA 2KRBA 3ATUA 5KL1B 2GCFA 2G8KA 2YY3A 1RKIA 4WFYA 1V97A 4JK8A 3CCJN 5HMXA 1IBMF 2R7XA 4R0EA 1FO4A 2VA8A 3JXUA 2KI2A 3CCVN 4JUZA 2IOFA 1SWVA 1PYTA 3GR0A 4W5OA 1H1VA 2ZH4A 4LIWA 3KK2B 1D0EA 1PKUA 4MKVA 1ZD3A 3N7PD 1U2VB 2FZCB 1KEJA 1XMQJ 4CHPA 1NCLA 2YX1A 1R0AB 3DMJA 2L9DA 1WSVA 3U4LA 3EO3A 2ZZTA 2C2DA 4C8ZA 4UAVA 1Z26A 5D77A 3SSSA 1BLUA 3B54A 4RL1A 3QEAZ 3K0SA 4TUQA 4CO5A 2POKA 4AP9A 1A5XA 2W9MA 1KD1O 2BE2B 1M90T 2HSZA 3WKCA 1HPMA 1WF1A 2CH6A 5C0YA 3CCSS 3ZZPA 1CJKA 2WSEC 4LF8F 1J54A 1RP5A 4YFUA 3KJVA 3SD7A 4YXMA 1TV9A 4TN2A 1C0UA 5FLXO 2DR8A 3B0YA 4KRFA 3TADC 1W2IA 4UAZA 1GLAG 1SZPA 3CCQS 5C15A 5ETOA 3MUMP 1RABB 1KKHA 4FPIA 1I51B 4I6MA 2NO4A 5HR7A 5B0BA 4FN5A 1JUDA 4DV0K 4HDHA 3VQ4A 3IMQJ 2JWLA 4X84A 3LYSA 5KFUA 4BRCA 2B6AA 4RQMA 1CJUB 1HBOB 4ZVOB 5AQGA 3CO9A 1NNEA 3BR9A 2QI2A 3HMJG 1NJWA 1JWWA 2J0SD 3A2FA 3UVJA 1DOQA 2WFAA 4P4OA 1TMMA 2YNGB 3IMXA 4QZDA 3LANA 4X4RA 4D3GA 3G8SA 3LK9A 2D6FC 2BCRA 3HKWA 2M52A 3OL9A 4NO7A 4OYPA 4WTYA 1X4FA 3KZXA 1FVSA 5IT9O 1TKXB 1Z1VA 2LMIA 1P7DA 1GLJO 4ILLA 2AX0A 1HMVB 3FK4A 2M88A 4HI1A 2YCHA 1S9FA 4EX7A 4DB3A 2YPZA 1SZHA 3CFPA 2GVDA 4RWWA 1BIZA 3A0IX 1UCNA 3P6YC 3ZZOA 2K1RB 2F40A 2Z7JA 1WJ9A 4RQ5A 3KKAA 2XC9A 3P96A 4A2AA 1SQEA 4RT3A 3NBPA 2ZJRL 5AIAA 2VUGA 5JVGL 1OMSA 2HZCA 1SZ2A 4K8RA 5J2NB 5CB1A 2XO7A 1WKJA 2HLTA 4DL2A 4RWTA 3OYJA 3OFFA 5KOWA 4QJVA 2JH7A 5HN0A 5AE2A 4NA2A 3PFEA 2DF4B 3H2VE 4ZDNA 3O44A 1AROP 2H51B 3D2FB 1KKXA 3NGZA 2AV5A 3BZQA 3RTVA 3IGNA 4K4YA 1OYDA 2VOPA 1YG0A 4I1TA 4M6WA 1QCKA 1V6HA 4C23A 4Q44A 1YRXA 3OYDA 1DKGD 1HBMB 1LWEB 4Y2CA 4BLGA 4BC2A 2VPXB 2RDIA 2VQFJ 2XY8A 4OV1A 3DYAA 4IC9A 4M5DB 2G8FA 4NI2B 2DTJA 1ECWA 2HURA 2P5GA 1LW2B 4KH1B 5A8KA 2RNEA 4UAYA 4HT7A 1V85A 3H1QA 2OKQA 1IBKJ 1CQNA 1S5LU 4RNMA 1ZQEA 3LUYA 1UKUA 2CIMA 1MDUB 3KLVA 4WPAA <