4B9SA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion outside of the pre-insertion site.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 209
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9sA01
1N56A 3PMLA 3HM9A 4FZYA 3B0YA 3RR7A 5CR0A 4P4OA 4QZ9A 5CWRA 2R8IA 4J9PA 2KZMA 3MGIA 4DTXA 2PFQA 5KFSA 4KI6A 3HT3A 4F5RA 1IKVA 4EYIB 4BE2A 2IBKA 4IFYA 2J6TA 3A2FA 4DQPA 3OYNA 4DU4A 3C6TA 2DY4A 1VSKA 4RQ3A 3AA5X 4I2IA 4Z6EA 4ICLA 4CK2A 1FXXA 2J6SA 4IQUA 4ECVA 2ASDA 2DFFA 1KDHA 3DLHA 3PW0A 3UIQA 3IAYA 4J2DA 3PR4A 4CESA 1DTTA 4AHSA 4QAGA 3PNCA 3H8JA 1NKBA 2BCRA 1RTIA 3TFRA 4FS2A 4K8ZA 4LSNA 1RXVA 1S5JA 3K58A 3RTVA 3ZT1A 1C7YA 4M9NA 3D45A 1T7PA 2YHAA 4Z6CA 4CGHA 3GIJA 4I2DA 4F4ZA 1UT8A 4RUCA 3MBYA 1TK8A 2BCQA 4XA5A 4B9SA 5EWEA 3NGZA 2BQRA 5FRNA 3KK3A 3MXMA 3DM2A 4KV8A 1BI4B 2ZTCA 4Z0UA 1ZJMA 1MSWD 3SZ2A 3KHLA 4KAZA 3HPHA 4J9NA 4RQ4A 5CYMA 1D8YA 2RDIA 2A1JA 4DQRA 2ZUCA 3GV5B 3RMCA 3TARA 1S6PA 1VSDA 3LAMA 4ZTFA 4B9VA 4DTRA 4QW8A 3SV4A 2G8VA 3AA4A 1CZBA 4PHPA 1RDBA 1TK5A 3QIOA 2WOMA 4CF1A 3QEAZ 4M3XA 4YXJA 2IGIA 4FZZA 1RBUA 4UB2A 4KLEA 4J9OA 3VN5A 2IC3A 2MUTB 1ZBLA 4K8XA 4RNOA 3OJUA 4I2JA 4BXOB 3C1YA 2ZD1A 2R8KA 2OPQA 4O9MA 2NRVA 2D0BA 4NYNA 1JIHA 4BDYA 1ZQJA 3K2PA 1VRTA 1RZTA 3C5GA 2W8LA 3AVNA 3DI6A 4KTZA 5KFAA 4AH9A 4KHQA 4M9HA 1B9DA 4Q0BA 4C8OA 3VQQA 4E7IA 1JXLA 4DTMA 3UQ2A 5BOLA 4HTUA 3M9MB 3LZJA 4B3OA 1LV5A 9ICSA 7ICLA 4RW9A 4QWDA 3S3OA 2W9MA 5F9LA 4FLYA 2R8HA 4I2QA 1SZPA 2FLLA 2NUBA 4AHTA 9ICNA 5C5JA 1CEZA 4W5OA 1T8EA 4Z4GA 1S1XA 2UVUA 4BDZA 2GWSA 5CHGA 3B0XA 4YFKA 3RBDA 4FYDA 2DPJA 2ISOA 3PVXA 4YMOA 4TUPA 9ICTA 4FW2A 3B6OA 4W5TA 2NRZA 1NJWA 1U47A 4QZEA 1YT3A 1X2IA 1ZBFA 4GXIA 1LWFA 3M9NB 1UA1A 3F73A 2W9CA 4CHZA 2G8IA 1T3NA 1VSHA 1U49A 3OYDA 1RCHA 2A1RA 4F8RA 1X9MA 4KRFA 1NK7A 1DTQA 4HVJA 3VQDA 1WSJA 1LW2A 1RT1A 3SPZA 2X6SA 3ZT3A 3OYMA 5KFIA 4O44A 4C8MA 5J2AA 3AUOA 1JLCA 4Z4HA 3QESA 1BCOA 3MDAA 4XUSA 3H40A 1KLMA 3GILA 2BE2A 2HVIA 4K4IA 5E41A 1IKYA 1RDAA 1ZQRA 3LP0A 4RPXA 3TABA 1RTHA 3V4IA 5J2BA 4EBEA 1C0UA 1CLQA 4KMUA 5J0PA 5KFDA 1LAVA 5DGBA 3LP1A 4K4HA 4NM2A 3DLGA 2F1IA 7ICUA 1VSEA 4KLHA 5CZ1A 1ZBHA 9ICQA 4EBCA 4KLMA 2ATQA 3HJFA 1Z00A 3PW2A 2G8FA 4UAWA 4DSKA 4B9TA 3AVIA 3JPPA 3OYKA 1QSLA 3DOLA 3RB6A 3V9SA 1S9EA 4FM1A 2YV0X 3LZIA 1ZQXA 2ZUBA 3ZSYA 3AVKA 1Z00B 2D0AA 4IBNA 4YR3A 3Q8MA 1QS4A 4CECA 1BISA 2Y1IA 4I2CA 4CK1A 3QEIA 3QEXA 4RQ0A 4E7LA 3KD5E 4BXOA 4P2HA 1S9GA 4RNNA 3AVLA 4DOCA 1RBRA 1S1VA 2V4QA 4DQIA 4CJSA 3RMBA 5DKWA 4I2GA 3UQ0A 4YNQA 3TAFA 4DLGA 5KG0A 3UXOA 2JEIA 4LH5A 1WNSA 2MAXA 1MC8A 2ZQBA 2ZTDA 3JPSA 1RBVA 1ZQHA 4O3SA 3ZSWA 5KG3A 3LANA 9ICXA 5KFMA 4NY8A 4AHVA 3JPRA 4QZBA 4CHNA 1T4GA 1Y97A 3UXNA 3NFAA 2VANA 2C2DA 1SL0A 5KTQA 4B8CA 2I1QA 1WSEA 4CJTA 1XHXA 5IIMA 4TUSA 5J0XA 8ICRA 4EP4A 4MF8A 4O0JA 2VWKA 1NOYA 1RTJA 9ICGA 3QO9A 2BQUA 4CJWA 4ECRA 3G10A 1TVAA 1HYVA 3V6DA 4F2SA 5DGAA 2X78A 1HMVA 5KFNA 3KKSA 1HJPA 1RDCA 3VQ7A 3CM6A 3FYHA 1SUQA 1T05A 4LSLA 4IR1A 4W5QA 2JZBB 2HNDA 3QNNA 4QZAA 5DB7A 4YN4A 4Q5VA 5JUMA 2RDJA 1F21A 3KLHA 5K14A 1KFSA 4N76A 5DQGA 3N4MB 4F5NA 4M45A 1CZ9A 5IINA 1ZBIA 3KKRA 1QLNA 7ICKA 3Q8LA 4CEOA 2KZZA 4JV0A 5J0UA 5KFTA 5HHHA 2P6RA 3K59A 4BE1A 3T1AA 4E7KA 3OYIA 3NTUA 5J2NA 2Z1HA 3DOKA 4BWJA 4M6WA 3RH4A 4B08A 2VA3A 9ICOA 3U3YA 1Y88A 2KFNA 4OLAA 3BDPA 3NF9A 3L2WA 2HMIA 4FJIA 3HP9A 3ZD8A 1HPZA 3CFPA 5I42A 4IDKA 1S1TA 4DTNA 5D4BA 2NRTA 1NK9A 8ICVA 3LDSA 3EZ5A 2ZUDA 4KREA 4QZ8A 3K5LA 1LAWA 3MAQA 4ED0A 4KLDA 3ITHA 3SUQA 1ZQYA 4O55A 3OHAA 5KT3A 4UBCA 3SV3A 3V9UA 4I29A 1WLJA 5KT2A 4E0DA 1RXWA 3ZDDA 2KTQA 3RB3A 2HHTA 4PH5A 4NLKA 9ICJA 2ATLA 8ICCA 3SI8A 3M8PA 2DTUA 2ZE2A 4IFVA 4P4PA 4FJXA 1JN3A 4FJLA 4TSXA 4O3NA 4I2AA 1R0AA 3AVGA 4PUOA 2LSNA 4R5PA 2Z1IA 1GOCA 4B9LA 3ZDBA 4BGDA 4Q44A 1TKXA 1KSPA 3V1OA 1BPEA 1QHTA 4CHYA 2AGQA 2BQ3A 4KITB 3Q8KA 1RT2A 8ICJA 4RQ8A 4FM2A 4JK1A 2YNGA 4FJJA 1WSIA 4KN4A 3V7JA 3V6KA 1D5AA 5J2EA 5EOZA 3V72A 4FZXC 1VSJA 1Q9YA 3PO4A 3LWMA 5D49A 3SQ1A 2DFHA 2JLEA 2XO7A 4HUFA 4ECXA 1ZQBA 4L8RB 4UB4A 1BHLA 2BANA 5DG9A 2ZJAA 1XS9D 1ZQDA 5HROA 3OYLA 1YTUA 2FBYA 3RJKA 4NLZA 1JKHA 4FO6A 4C8LA 4KLSA 4JUZA 3O4NA 4ED1A 3I8DA 5KGWA 4KLLA 4P4MA 3ZDAA 3KLIA 4KTWA 2AU0A 1EP4A 2O4GA 3OS0A 3IM1A 4OKKA 5J2PA 2BKEA 5DDMA 1BPDA 1NOMA 2YKMA 3GV8B 1WN7A 5KT7A 1HJRA 4NLNA 4JWMA 2DFLA 1C1BA 3PX0A 5KFWA 4QWBA 1ZQCA 2V9WA 1I39A 5KFFA 4CEDA 3EYZA 4Q8EA 4ZH4A 4PQUA 4KTQA 4I2BA 3K4GA 1HUZA 2RKIA 2C22A 1BPYA 5HRPA 4FM0A 4DTSA 3HO1A 4YMMA 2DPIA 2BCUA 1RT5A 4UB1A 1S9FA 2ETJA 3C1ZA 3AV9A 4QWEA 4C8KA 3HW8A 3DLKA 8ICBA 4EP5A 1D9DA 1ZQEA 1EKEA 4G3IA 4YD2A 1TL3A 4J9LA 3PY8A 1SKWA 4J9RA 4F4YA 5HLFA 4MFBA 3ZT4A 1H38A 4N56A 4KPYA 3TAMA 1QQCA 1Z26A 4R64A 1HNVA 1LWEA 1JL1A 5J0SA 4M0AA 3BQTA 1RYRA 3C6UA 4F5QA 7ICEA 2PI5A 5CYQA 3NF6A 4Z4EA 4NXZA 5CJ7A 4I7FA 4CF8A 1ASVA 5KFVA 3LDAA 4F93B 3LK9A 3RBEA 1LB2B 3EPIA 2VWJA 3KHRA 2EHGA 3NBPA 3OYJA 4LVSA 3MR5A 4PGYA 4ECWA 5C25A 2XY5A 1ZQPA 1HQEA 2XGQA 4CEFA 4RQ1A 4NCAA 3RMAA 4EZ9A 2IHNA 1G15A 4IG0A 4CFBA 1PZNA 2W9CB 4RZRA 2AJQA 3OVNA 5IILA 3V1RA 3JSMA 3HL8A 4PY5A 4DSIA 3GDXA 4FW1A 4H4MA 2BPFA 3F9KA 4J9MA 2YHBA 4KO0A 4RQ7A 3ZSVA 2ZTEA 5KFJA 1Z25A 3OYCA 1Q8IA 4FJMA 5DBAA 4IRKA 4PGXA 4O4GA 3I0SA 3GIIA 3PW4A 1BPBA 1XU4A 1TVRA 3DLRA 1W9HA 4FS1A 2P51A 4M3WA 2FLPA 4CE9A 3ZCMA 3QETA 4MFAA 2HB5A 5HP4A 5IIIA 4FLTA 3GV7B 5J0TA 4M04A 4LD0A 3QNOA 1N6QA 2BR0A 4ED2A 1LW0A 3RJIA 4JS4A 1UOCA 1XSPA 3S9HA 5DG8A 4KI4A 5L1IA 4PHAA 3GFKB 5EU7A 2B6AA 2Y1JA 4I28A 4E3SA 1L5UA 4FLWA 4RW7A 3BQ2A 4O3QA 3TAPA 3VQ5A 3SQ4A 2JEGA 4OKEA 1JL2A 1U4BA 4HUGA 4Q43A 4YQWA 2IMWP 2W9BA 8ICNA 1GOBA 3QERA 3PMNA 1TKTA 3VQEA 5J0WA 1S0OA 1UWBA 1K6YA 4Z6DA 1XI1A 8ICUA 3H4DA 2I5JA 7ICFA 7ICGA 4DTJA 1B9FA 4I9LA 3LAKA 3K57A 4DL3A 3HSTB 1ZJNA 4RPYA 9ICBA 3NH1A 4KLOA 4UAZA 4FCYA 5HP1A 1WCLA 2ZJ8A 3O3HA 1TFRA 3ORYA 1IKXA 4KB1A 4FVMA 1VSIA 5CY4A 4HYKA 1K1SA 3Q8SB 1X9WA 3LP3A 2OA8A 1UAXA 1TK0A 4CHOA 5KFOA 4QZCA 4DL2A 8ICFA 1LWCA 5KFHA 3MABA 4ID1A 2A1SA 3MEEA 4IQVA 4NM1A 2FMPA 1S76D 3TFSA 3BGRA 1KVCA 4QZHA 2GBZA 4UAYA 4F5PA 2F1HA 4ECTA 1SKRA 3JYTA 5DB9A 1K1QA 4RW4A 4FLXA 4UB3A 1TKDA 2RF2A 3DRRA 5FRMA 3C94A 1J9AA 2WONA 4ED3A 2YNHA 3E01A 5KFGA 1MU2A 4DOAA 1S77D 4ELUA 4DL6A 3K5OA 1RBSA 5J2IA 3CFOA 4DL5A 5J0OA 1JXBA 3G6XA 4ZHRA 3BQ1A 4F50A 4YD1A 4DQSA 1RDDA 4O0IA 4OJRA 2JGUA 1BGXT 4O5BA 4BWMA 4Z4CA 2G8UA 9ICEA 1A5VA 2HW3A 3SUNA 3CQ8A 5KFBA 4DS5A 3UXPA 3C23A 3V9XA 2HHUA 4HCCA 4RW8A 8ICOA 4TURA 4NCBA 1IM4A 3ZSXA 3OGUA 4YCXA 2B4JA 4CF2A 2HNZA 3T3FA 2G8HA 3MR3A 3LWLA 3K5MA 2DFEA 4QZIA 3QINA 1NKCA 4PPXA 7ICRA 1ASWA 4O3OA 1ZQWA 3HXMA 3V6HA 2F8TA 1ZQIA 1JX4A 3I0RA 3TAGA 1AROP 2KN7A 2C2EA 1B43A 1Q9XA 5D3GA 4RT2A 4CEBA 3AVMA 2IDOA 4OPKA 3T5LA 5IIKA 7ICJA 8ICPA 3ZSOA 2HHWA 2W9AA 3RRHA 3NGIA 2P5GA 5HRSA 2Q0ZX 4QZFA 4FJNA 4MF2A 3L3UA 3ISCA 2Q3SA 3ULDA 3O3FA 1JMSA 3AO2A 4M3ZA 1S0VA 3OYBA 4DF4A 2FPLA 1BPXA 5DQIA 1YTAA 4PWDA 4KFBA 3HYFA 4JRPA 2ZJ5A 4GVMA 3OHBA 2ITGA 4KLIA 3KLEA 3C2MA 4DEZA 5DB6A 2HHVA 1ZQFA 3NHGA 4CK3A 4TUQA 4IRDA 4Q8FA 2HHXA 3JPNA 3CG7A 2E6LA 1BCMA 4RPZA 3NH2A 4X5VA 3VQ4A 4CFCA 1QSYA 5HRRA 5L1JA 1UA0A 4O5CA 1MQ2A 4KLFA 3C2KA 4ECQA 3DMJA 9ICLA 5KG4A 3VQ8A 3NDKA 5KT4A 2E4LA 3SUOA 4LY7A 5DBBA 4I9QA 4M9JA 4BE0A 2FBTA 2HHQA 2KZ3A 1HUOA 3ISDA 2VA2A 1A77A 5KI6A 5L9XA 2PYLA 3LPUA 5KFPA 5KRTA 3ALYA 5KFZA 3HK2A 3MR2A 3AO4A 3VQ9A 4FLVA 8ICKA 5CA7A 2YNFA 2F8SA 3RJEA 1TL1A 4Z4IA 3ZSZA 4DSFA 3VQ6A 5KT6A 4DU1A 4FJ9A 5KFXA 4YR0A 4FJ5A 4RT3A 2JEFA 4KLTA 3IG1A 4DS4A 4M6WB 4J9KA 5SWMA 3ZD9A 3H8SA 4PA1A 1U48A 2QK9A 7ICVA 4I2PA 4W5NA 2FBVA 4HCBA 2XCPA 1S1WA 2G8WA 2VG6A 1RILA 4CERA 3FFIA 8ICWA 3ZDEA 5L1LA 3AVBA 1XSLA 5J0YA 1COOA 3OYGA 3M9OB 5DLGA 4R8UB 5L1KA 4KHYA 4Y1DA 3LALA 5KFKA 3AU6A 1NJXA 5EWFA 2F96A 4J2BA 4F2RA 1EXQA 4DFPA 3RB0A 3KLGA 4M3TA 4I2HA 4QWAA 3NF8A 4GLXA 5J2CA 2QKBA 1RT3A 5DBCA 2O4IA 4F3TA 1CXUA 1ZQQA 2UVRA 4CJ5A 9ICAA 4M2YA 4YR2A 4GXJA 3QZ7A 4JV1A 3S3MA 1NK0A 4M47A 4E7HA 4GC7A 5KFEA 5J2MA 5J2GA 4ECUA 5TZVA 3OSPA 4CJEA 3V6JA 3RH5A 1JLGA 4TQSA 3QLHA 7ICIA 3RR8A 4DTUA 4AHCA 4N47A 4W5RA 3ASMA 4DL4A 1ZQMA 3CFRA 4ZTJA 4KB0A 1ZQOA 1QE1A 1JLFA 5HRNA 3P1GA 4JWNA 3RJFA 4RUAA 4CCHA 3AVCA 1IKWA 1HYZA 3QEPA 4EBDA 1KCFA 3EY1A 1BQMA 4DFMA 1U04A 3HVTA 4CIGA 4DSEA 1GOAA 2AGOA 2M9NA 1S97A 2ASLA 2PYJA 2QKKA 1TKZA 1J5OA 4DFJA 8ICSA 1QSSA 1CXQA 1U9LA 4M9GA 2OZMA 2VG5A 4ID5A 1BVSA 3P83D 3RB4A 4PHDA 1JXEA 2D0CA 4ED6A 3HP6A 1DGSA 4QW9A 4PHEA 2BPGA 3SQ0A 3S3NA 2OPPA 2XRIA 4CJKA 3BQ0A 9ICHA 1C0TA 4ED8A 3G0ZA 4CHQA 9ICFA 4CJUA 1VSMA 4ECSA 5JS1A 4ELTA 4CEQA 5KG6A 2OPSA 3PV8A 4YP3A 3OS1A 4KHNA 3Q8PB 2R8GA 3OY9A 2P6UA 2C28A 3SJJA 4QZGA 3MR6A 2XC9A 3MFIA 3IHQB 3WNGA 1ZQNA 1XSNA 3TWHA 4Q45A 4DWIA 1HRHA 2YKNA 3VQAA 1SL1A 2PZSA 7ICSA 4CHPA 3RJJA 1KLNA 4CJFA 3WNEA 4K4GA 2F1JA 4M42A 1WSFA 3V9ZA 2BGWA 1IO2A 1RT7A 3VQCA 4M3YA 2YNIA 3Q8QB 3WNFA 1SKSA 2PFOA 1JLAA 4OLBA 2XCAA 2FLNA 3DLEA 1EX4A 1L3VA 3KD1E 1TV9A 2BPCA 4DMNA 3DRSA 4J9SA 5DG7A 2RPIA 4J2AA 4MFCA 4KKOA 3O3GA 3HX0A 1BIUA 3RAXA 2W8KA 1BIZA 3KTQA 4J2EA 5I3UA 2B21A 3D0PA 4E1MA 3CM5A 3GIMA 4XIUA 5HNKA 4OKJA 4B8AB 5C42A 3H7IA 4UBBA 5DQHA 4RNMA 4I2EA 3SPYA 4OVLA 5J2QA 4FJ8A 1EETA 1IH7A 5KFYA 9ICVA 1I3AA 4C8NA 1WSGA 4FBUA 1L3SA 4RU9A 2IOCA 3QEBZ 5J0QA 3PX4A 3ZT2A 2NRXA 4JV2A 3C2LA 4J9QA 3OYEA 1FK9A 4RQ6A 4CFAA 3QE9Y 3SNNA 4OPJA 3VA3A 1VSLA 3C95A 4CEAA 3NE6A 5CZ2A 4CJ3A 1RTDA 2JEJA 4MQ3A 3VA0A 1ZQSA 3ISNC 4GMJB 2IS3A 3NH0A 4KHUA 1NJYA 3KIOA 5KG7A 1RT4A 1A5XA 3VQPA 3EWAA 4B9UA 2PI4A 9ICUA 4FJKA 3CYMA 2OWOA 4F91B 3C5FA 2GUIA 3L2VA 1KFTA 1S6QA 3H8WA 3EPGA 4CGJA 3LP2A 1QTMA 8ICQA 8ICZA 1XHZA 4QWCA 4GW6A 1J54A 4F4WA 1YVUA 1T03A 4QCLA 3ISBA 5DK5A 3IRXA 1VSFA 3V81A 4CGFA 1DOQA 4M3UA 1S0MA 5DB8A 1NOZA 4CJPA 1WCNA 4F5OA 1KVAA 4CJLA 1S10A 2J6UA 3QIPA 1B92A 3DLBA 1X1PA 3T5KA 3MGHA 4LZGA 3T5JA 4N5SA 1ZYQA 3QEWA 4F4XA 3U3GA 4UQGA 5CP2A 3WNHA 2FBXA 4XRHA 1N48A 4FBTA 3NF7A 4RQ2A 1VRUA 1WAJA 1CUKA 2FPKA 2GV9A 4EEYA 2KQ2A 4TQRA 4MFFA 3QZ8A 1C1CA 4H8KA 1X9SA 9ICMA 4Z4FA 9ICIA 3L2QA 1D9FA 3NGYA 4RW6A 4CGDA 9ICCA 4YVZA 4CJ4A 5KFRA 3PW5A 2QXFA 3RRGA 2OYQA 1ZQZA 1ZQUA 5HHIA 4GC6A 2FPMA 4R65A 3MFHA 3L2UA 4DQQA 1ZQLA 4KLGA 4JS5A 5J2KA 8ICYA 1ZBUA 4DTPA 5DDYA 1BI4A 4F4KA 3OS2A 2VA8A 9ICRA 3PUFA 1JLQA 1JLBA 5D46A 4CF0A 2KFZA 3PX6A 2UVVA 3SUPA 2ISPA 3AVHA 4CGGA 2BGGA 3SI6A 2C2RA 3MECA 2OZSA 2A1JB 4F92B 4R66A 2AQ0A 5DMRA 3MEDA 2R8JA 3AU2A 5KFLA 5C24A 5KRSA 4CEEA 1BPZA 4FK4A 5IIJA 5HMMA 3ZT0A 2PFPA 3AO3A 2XY6A 4E7JA 1ZETA 3G6VA 2W9BB 2IHMA 2ALZA 4DSLA 1L3TA 3SCXA 3DRPA 1Z3EB 2XGPA 3OJSA 3HWTA 3M8QA 2PFNA 3JPOA 3JPTA 4ECZA 1XO1A 3UPQA 2VG7A 2ASJA 3NGDA 2HNYA 1BQNA 7ICQA 4Y1CA 4KN7A 5HMLA 2X74A 5J29A 4RQ5A 2XHBA 1NKEA 3M8RA 4KHWA 4YG2A 3AVAA 3OSNA 3NCIA 3NAEA 2Z1JA 4FK2A 3E2EA 1RPLA 2WTFA 2W42A 3HVRA 3K5NA 8ICIA 1IG9A 4CEZA 2HHSA 5KFUA 3RJHA 4ELVA 3TR8A 9ICWA 2B5JA 1V9PA 4CJVA 1NK5A 1RBTA 3TQ1A 1ZQVA 5J2DA 4LZDA 2KW4A 3KK2A 5HBMA 3N97B 4IKFA 3AVFA 2HVHA 4DF8A 4E89A 1ZQKA 4JRQA 3C21A 5SZTA 8ICMA 3FDSA 4M3RA 3VQBA 3O4QA 1HNIA 1NJZA 3IS9A 1TGOA 8ICGA 4CGIA 2BHNA 4KHSA 3LPTA 8ICEA 1SL2A 3V7LA 3AA2A 1JLEA 3KK1A 4B9NA 4KLJA 5BOMA 1C1AA 8ICAA 3V1QA 2BCVA 4HHTA 4O3RA 3P5JA 4FJ7A 3SYZA 1HQUA 4LH4A 5J2JA 3M8SA 5J1EA 4IG3A 3V9WA 3KHHA 4OGEA 2D5RA 1ZQTA 3ETLA 4HUEA 4CJRA 1SV5A 1A5WA 1N5YA 8ICLA 4QZDA 4DO9A 4GXKA 1ITGA 1TV6A 4IRCA 2Z1GA 2EX3A 3BJYA 1KRPA 4H4OA 1TAQA 3RAQA 8ICTA 3TAQA 1C0MA 3MXIA 1W0HA 4FJGA 1RT6A 1A76A 4MEYA 4QOZB 2OPRA 2PXIA 4DSJA 2FC0A 5KG1A 4DTOA 4ECYA 4YXMA 4YMNA 3KHGA 2P1JA 4M41A 1KTQA 2NRWA 1FKOA 4E1NA 3OYAA 3KLFA 2G8KA 4FJHA 7ICTA 3HPOA 4IQWA 7ICNA 2BCSA 4O3PA 3T5HA 4R8UA 4ED7A 4CFDA 4E19A 4I2FA 3GQCA 3SQ2A 1EXNA 4DFKA 3G6YA 3AVJA 2MUTA 4I27A 1VK0A 2FMQA 2H5XA 3OYHA 4F3OA 4PGQA 1XC9A 4G1QA 3RWUA 3V7KA 5J0RA 5J2FA 4DLEA 5T7BA 5EWGA 2V4RA 9ICKA 4EYHB 3T19A 3PO5A 4AHUA 1L3UA 4NYFA 2AQ4A 1RYSA 1J53A 1HYSA 2XY7A 3H08A 5JS2A 1ZQAA 2BDPA 2FMSA 1DLOA 3GIKA 5FROA 1ZQGA 1RNHA 1KFDA 3TAEA 1BL3A 4MEXA 2UVWA 2LYHA 4FLUA 5KG2A 4IR9A 2PY5A 2I9GA 3Q8RB 2P66A 1B22A 1REVA 5F9NA 1NK8A 4CIFA 4XQ8A 7ICPA 1XWLA 4Z6FA 3MEGA 9ICPA 2IAJA 4KLQA 4BACA 3PR5B 4FXDA 8ICXA 3EW9A 3K75D 5KT5A 1D8LA 5IIOA 3QEVA 5BPCA 5J2HA 1C6VA 1NK6A 2X6NA 3OYFA 1S0NA 4R63A 1ASUA 2P5OA 3PW7A 3ZSRA 3L3VA 3AO1A 1TAUA 3L2RA 3THVA 3B6PA 4NCGA 4M9LA 4DL7A 4N41A 4JLHA 1FKPA 4DOBA 1KEJA 3U6FA 3L8BA 4DG1A 4FK0A 5KGXA 4DU3A 2JZBA 1UT5A 4AILC 1U45A 3MDCA 4CIEA 1IXRA 1S1UA 2AGPA 2E6MA 3HPGA 4UB5A 1NK4A 4OGCA 1WSHA 5FDLA 4O5KA 3RJGA 2IA6A 2R7YA 7ICHA 3RMDA 4NLGA 3ZDCA 4CJQA 4B9MA 3TI0A 4O5EA 4RG8A 4AHRA 3ZSQA 5KG5A 3DYAA 3KJVA 4IQTA 4KLUA 7ICOA 5KFQA 4BDPA 2XY8A 3H4BA 3MXJA 8ICHA 4CF9A 4FLZA 7ICMA 1KVBA 2RN2A 3RH6A 3JPQA 3AO5A 1MQ3A 5DLFA 5CB1A 5KFCA 4EZ6A 4YFUA 3AA3A 1O1WA 4WE1A 3TANA 1WAFA
chains in the Genus database with same CATH superfamily
1NSPA 3B0YA 4FKYA 1JLFB 5FDLB 3TA0A 1UVLA 1HI1A 4QZ9A 1XMQK 1UW9A 2KZMA 1ZTTA 2DEIA 3LW5C 1M5KC 4BR5A 4DR7K 4NMLA 3OUYA 4F0KA 4OJ6A 3KNGA 3QSIA 4DQPA 3R6GB 3OYNA 5HANA 2R4FA 2DY4A 4RQ3A 4ICLA 2MQNA 1FXXA 1M90O 2J6SA 5GAGI 2E1PA 1OVQA 3R9PA 2ASDA 1CJUB 4C4WA 1J5EK 2DFFA 1UZHA 4JI7F 4J2DA 1RDUA 3PR4A 4JI4J 5IM0A 1B0PA 2Q0UA 4ZCIA 1YLXA 3O9SA 3PNCA 4NWBA 1AZSA 4MK8A 2NYIA 1NSQA 1NKBA 2BCRA 1RTIA 3TFRA 5H9FJ 4KGZB 4WU3A 5AQWA 1WHXA 3OTOF 4GIBA 1HR0F 3D45A 3NOGA 2FDRA 2YHAA 2QA1A 1N8RT 3UD4P 3F2DA 4JI5J 4OD0A 4E1JA 4F4ZA 3VMFB 4RUCA 1TK8A 3S7RA 1VGYA 4L3QA 3CO9A 4OYXA 3NGZA 1R0CB 2DRAA 2AZ3A 4LF4F 2OANA 3MXMA 2ZTCA 1N5SA 3W3DA 5MLCQ 3KHLA 3E9OA 1WI8A 4KAZA 3HPHA 4RQ4A 4CZCA 1FNMA 2RDIA 3A5MC 1X8DA 4R25A 4WF9Q 2DQNB 2ZUCA 1W2BM 1S6PA 2IVYA 2E1FA 5HR6A 5EE0A 4FZMA 1RDRA 4QW8A 3SV4A 2R7SA 3GTYX 3NXZA 5AKHA 2ZD1B 4ZLPA 1WC0A 4YY3F 3G25A 3OPKA 4FZZA 3A4TA 2OM6A 1U1LA 2WUSA 2IC3A 2NXUA 3TADC 3AAQA 2MQMA 2PD1A 2K4PA 2VBYA 4PKDB 3MCOA 1TUGB 4O9MA 2QM1A 2Q36A 1LVHA 2VG5B 4DR1K 1N36K 3QJJA 4QIGA 1JIHA 1XR5A 4DZDA 1ZQJA 1U1MA 4UY8O 4OI0A 4ZPTR 3DI6A 3ZX3A 5CD4A 3Q22A 2MQLA 3GDQA 1H2UX 3QYPA 4Q0BA 1O5JA 4DTMA 4MHVA 1AA1B 3TP2A 4HTUA 2ZJPQ 2XLKA 4B3OA 3S3OA 4QWDA 2YTCA 2J0WA 5D4LA 1RAAB 3PHTA 1SZPA 3M1YA 4C4RA 3F44A 5C5JA 4CH0S 3H90A 3I9V9 1CEZA 2E7XA 1SQFA 4BDZA 1S9EB 1SPBP 1V38A 5CHGA 4M7XA 1VQ8N 4FYDA 1URJA 4YMOA 3OFEA 2JVRA 3LH2S 3B6OA 4JYAF 4WFBQ 1YT3A 4NB4A 1QCKA 4OZ0A 1ZBFA 1LWFA 1OXJA 1QQ6A 1UA1A 2W9CA 4NL9A 3P4UB 3THXB 3OYDA 1HL6A 4F8RA 3F9MA 3BUZB 1X9MA 4KRFA 3DFEA 2HMXA 1YVFA 1D09B 2YQEA 4NLCA 4HVJA 5L9NA 4IOCL 1FJCA 1OSCA 4P0PA 1LW2A 4AYBF 4JI5K 4L73A 2X6SA 3VENA 1GX5A 3DNCA 3AUOA 4FKXA 2NLXA 4NMXA 3UN2A 3QESA 1BCOA 4YB1P 1U7LA 4K4IA 1C4AA 4R79A 2V8PA 2KU7A 1IKYA 3L09A 3ZTSA 3G86A 4OCZA 1ATNA 3D7EO 2FHOB 2J8AA 2V63A 4JI6K 2B4PA 3TABA 5J2BA 3CPWR 3BB5A 1RU2A 1HMVB 2SXLA 1UHUA 3NVZA 4K4HA 3P4IA 1Z05A 2F1IA 2DR7A 3OLAA 5CZ1A 4KLMA 2ZWPA 2VWBA 4BY9C 1FFUA 4WE1B 3IAM9 1NZPA 4LFBF 4UAWA 1PVPA 2ZE2B 3CJKB 2G9OA 2RILA 3M32A 2DXDA 4LF6K 2ZUBA 3AVKA 5ETNA 4IBNA 1CQNA 1RE1B 2VFTA 3CEDA 1BISA 4I2CA 4OZNA 3DM2B 3QEIA 4Y2UA 2CFXA 3DDHA 4E7LA 3OD2A 3KD5E 4UY8T 3W0LA 3GBTA 3H5YA 1R8CA 2V4QA 5DKWA 3PSIA 3UQ0A 2RJZA 3TAFA 5KG0A 2JEIA 2XHWA 3KMQA 1HNZJ 5EUHA 2MGZB 2EKYA 2HFNA 2ZTDA 3JPSA 4UAUA 4A8MP 3WK9A 3HM8A 1NSKL 3ZSWA 4CM0A 1DJ0A 3J7YU 3BGFA 3MUMP 3HULA 4QZBA 3SK3A 4JI0J 1C0FA 3UXNA 2VANA 1SL0A 2M7SA 3MUVP 1WSEA 4CJTA 3ZZTA 1FESA 1HBUB 3QGHA 2ZH2A 3MM8B 4EP4A 4CYUB 3VR1A 2OMOA 2YWHA 2GV1A 3BSAA 5HL7Q 3QFWA 2CZ9A 1PJ7A 3GR0A 2LM4A 3QO9A 4CJWA 3KUHA 1TVAA 3V6DA 1HYVA 4FNIA 2H3IA 3UM9A 2A19A 1J2NA 1CI4A 1RGIA 5THWA 2ZGZA 1HMVA 4Y2JA 3ULHA 5KFNA 4NLRA 2YPZA 5HJYA 1FRHA 4LSLA 2BE7D 1HPMA 5AJ3J 2OFHX 1HNWF 5JUMA 2RDJA 3H46O 2ZHBA 4ETZA 3WXLA 3Q2TC 1HW8A 3KLHA 5M1KA 1KFSA 4TXSA 4N76A 4ES2A 4DR6J 1ZBIA 4X65J 3KLGB 2O8DA 3KKRA 3FEYB 2JV3A 2VPWB 4U96A 4CEOA 2FYXA 2EI5A 1AUSL 2E88A 1N6QB 4JV0A 5KFTA 5HHHA 4E7KA 2IVMA 3NTUA 2FVSA 5IV3A 2Z1HA 1RZMA 1RXOB 2VA3A 9ICOA 2KOBA 2KFNA 4OI4A 3BDPA 5C12A 3NF9A 3O08A 1RYUA 3L2WA 1MWZA 1S1VB 4PKHA 2HMIA 1HR0K 5I42A 1Y00A 4ICAA 5J1NA 1L7MA 4C11A 4EENA 5EDWA 1SB3C 3LDSA 1DQ9A 3U1LA 4W92B 1T9WA 3K5LA 1D1UA 4KLDA 3ITHA 4FOIA 1V9OA 1ZQYA 4EK2A 2CPYA 4O55A 1SAZA 3CCSN 4F72A 3DXMB 8AT1B 4OJGA 3V9UA 3C15A 4E0DA 1RXWA 4OJ3A 1RTDB 2EDUA 4K0KK 2E2PA 5H1SQ 4PH5A 3VCBA 2DTJA 4OX8A 4N77A 2QARB 5AQFA 1TUVA 3SI8A 1MMNA 3DOLB 4CYUA 4C7ZA 5J1EB 3BQ7A 4PQAA 1U1OA 1JN3A 4CDGA 4TSXA 3IWXA 3N4WA 4O3NA 4I2AA 3AVGA 4I68A 4R5PA 2LYAA 5AQSA 3UE2A 2YH1A 1Q53A 4IFYB 4PHTX 4X4RA 1GOCA 4USMA 1UWAA 4BGDA 4Q44A 1S9GB 1UMJA 4QJVA 1BPEA 1YJRA 2FE9A 1AW0A 4WZQA 4NRUA 2KSOA 4WKYA 4KGKA 4CHYA 2BQ3A 2BKNA 4KITB 3BPDA 4OZ5A 4FM2A 2UP1A 4JK1A 2YNGA 1FNXH 4Z7YA 1YSJA 4KN4A 2XZDB 5D77A 2YPYA 2HQFA 1Q8BA 1TL5A 1D5AA 3V72A 2VFSA 2XMTA 4PPZA 1RGVA 5D49A 2JLEA 2XO7A 4HUFA 3KLEB 1FWLA 4ALZA 1SJ4P 4LF5F 2DO4A 3CC7N 2I5HA 2BANA 3OL7A 3UN5A 3CCLN 3OYLA 5AJ3K 3TX8A 1EKSA 4NLZA 4C8LA 4KLSA 4JUZA 1DK2A 3OV7A 3DOMB 4P4MA 3J80U 4K2JA 5I9EB 2BKEA 3S6JA 3V4IB 5GADP 3MGJA 4LF7J 1WOSA 1QVGR 2IYGA 3UFCX 4NLNA 4DN0A 3M5RA 4JWMA 2DFLA 2PMWA 2CKWA 5LMNJ 2VJ5A 3HT0A 3PX0A 4B02A 2QN6B 3UKUA 1I94K 4M5KA 4CEDA 3EYZA 3C15B 3J80Y 1K73O 2IC3B 4KTQA 3G2XA 1QAIA 5LJVA 2O8DB 5AQUA 3K4GA 1HUZA 4GV6A 1BPYA 4FM0A 4CVNE 4ILMA 2BCUA 1S9FA 3CDUA 3DDNA 3PYEA 1ZBSA 1KL9A 4C8KA 5ALYA 4DV7J 2MRLA 3UKRA 1T9YA 3JSRA 2QL9B 2LYVA 8ICBA 4BBYA 4KFBB 3QUBA 4YD2A 5KAFU 2HVZA 2AH5A 3PY8A 5CAAA 1SKWA 4J9RA 4F4YA 3ZZUA 3CNQP 3DHXA 1QH9A 1QQCA 3WBZA 1Z26A 3D2FA 3AB4B 2HBQB 3UMGA 1JL1A 1ILYA 4C0BA 2E1AA 3BQTA 1REVB 3C6UA 4LMZA 2RF2B 4F5QA 4O4GB 7ICEA 3HHLA 4A8QA 3WXIA 3UR0A 4Z4EA 5CJ7A 4JKGB 1YUWA 3RBEA 3KHRA 1HNWJ 3M6ZA 4NA2A 3T79A 4PGYA 1NDKA 1F9FA 1G1XA 4RQ1A 3WK6A 1Q1KA 4NCAA 3RMAA 2W6KA 2W9CB 3OVNA 5IILA 3IP4B 5AQVA 1IV0A 3Q83A 2KHQA 4DSIA 4FW1A 3BBCA 3F56A 3OTEA 5FPNA 4WF9L 1U1KA 4RQ7A 1AYEA 2LLZA 2ZZNA 3ZSVA 3QICA 5KFJA 1Z25A 3OYCA 4FJMA 5DBAA 3W63A 4PGXA 2ZG6A 3PG9A 4CLLA 3VEWA 3VGMA 2E5JA 1NNLA 2AZ1A 1RI7A 2V5HG 1NNEA 2O67A 5FLXU 5BR8J 3GV7B 4DR2J 5J0TA 2FGOA 1VQ6S 2O66A 4JS4A 4JI2K 1ULRA 1RTHB 4F3QA 4KI4A 5L1IA 5LSRA 3UD3P 4JKAA 4CNQA 2WB1C 2Y1JA 4I28A 4E3SA 1U26A 3AXMA 1IV8A 3CJ7A 4UARA 1XIQA 3A12A 2KRBA 4O3QA 3VQ5A 5BYRA 1X4GA 2QL7B 3R7SB 4LF2A 2JEGA 4OKEA 4BR2A 1JL2A 1MWMA 3M4XA 3LA0A 4C1NI 4Q43A 5D4NA 8ICNA 1F0XA 3KZBA 2KVCA 3KLVA 4WFAL 4DUZK 2GUPA 2ZOMA 2CA9A 2D74B 1XI1A 2OTLN 3NCPA 3UVJB 3CJKA 1AT1B 2I5JA 5AKZA 1N62A 1H3DA 4I9LA 3K57A 3IFRA 3AGKA 1VQ4N 3FBBA 4UAZA 3OL9A 1WWHA 2B51A 3OTBA 4C23A 3NS6A 3KG1A 3WQPA 2CRXA 1IKXA 4KB1A 4FVMA 1VSIA 4DUYK 2YBVA 2YX4A 2HQGA 1K1SA 3P38A 3PYFA 4BRDA 3C7NB 3EKUA 2DL0A 2RHQB 5KFOA 4DL2A 4KGMA 4FWRA 8ICFA 4ZLJA 3HKWA 2A1SA 3WEEB 3MEEA 3MOZA 2RUGA 3UCUP 3H0MB 3I76A 2VASA 1VQ7S 2A6MA 2WVCA 3ZZOA 5B8HA 2CJKA 3H5UA 2GBZA 2HZCA 4F5PA 1IKWB 4ECTA 1SKRA 4RW4A 3TJ9A 2COLA 3BEGB 3W65A 1H2VZ 5IWAK 4D3HA 2HNZB 3VF6A 3C94A 1J9AA 1HI8A 4JKGA 2R3VA 4LF1A 4QR0A 3E0FA 1IKXB 2Y9UA 3FBEA 2HK3A 4OV1A 5J2IA 3GU0A 3CMAN 1XN9A 2O1PA 1PIEA 2YMMA 2UXBK 3CPWM 1T3VA 2CQDA 4WFYA 2JGUA 3EZWA 3WK4A 4BWMA 4BGAA 2BKPA 4WPAA 2FZKB 3CQ8A 5KFBA 2ZH9A 4LFBK 4JI8K 3UXPA 3C23A 3ATVA 3OVSA 1WHYA 3PTWA 1KWMA 4I7FB 4RW8A 1IM4A 4UZBA 3ZSXA 3VAHA 1TYQA 1IQTA 4CF2A 2HNZA 1RT1B 4DV0K 2KJVA 3NBPB 4DUTA 3LWLA 4NPOA 1I6JA 3DRPB 3T1HJ 3L7OA 7ICRA 4J9VA 2AJ1A 1RUSA 1CULB 1UZDA 4QU7A 2KN7A 3QYYA 4Y2PA 2IFXA 2RT3A 1XQIA 4IQMA 3THPA 5J1PA 2EQYA 2HHWA 3RRHA 4FF4A 4QZFA 4MF2A 5ALUA 1SC1B 1NH8A 5HLFB 3O3FA 3OYBA 4DF4A 1FW6A 3PZPA 3W5XA 2AT1B 3LGMA 2QLWA 2GHVC 3QU9A 2GJ2A 4GVMA 1IIPA 2ITGA 1L8LA 2HAFA 5B09A 3KLEA 3C2MA 4P2XA 5DB6A 1VJ5A 1LW0B 4V19X 3Q23A 2WAQF 3H8MA 5HL7L 4UB6U 3JPNA 3CJSA 5CYJA 3PRVA 4A59A 3S01A 3FE1A 2B0GA 3HDSA 4A8OA 3CULA 2P9NB 4JKFA 2DRDA 2WF9A 4A8EA 4RPZA 2CQBA 2FLOA 3GONA 2XMKA 4G6VB 3Q24A 2B6GA 5AHXA 4AQYK 5AQNA 5HRRA 1UA0A 3KJNB 3PFEA 3W61A 3ENWA 5KT4A 1N52B 4JI6J 5AQYA 5DBBA 4M9JA 4HKQA 1GLCG 1R59O 2QWMA 2HHQA 3VAMA 2E5GA 2VA2A 5L9XA 4ZKAA 2PYLA 1GH8A 3LPUA 3MPWA 4Y2SA 2VDHA 3ALYA 5KFZA 3MR2A 2H65B 2QO3A 3I0SB 3AO4A 3VQ9A 2QB1A 2FPHX 2W2NP 1TL1A 3EGNA 2Z2LA 4Z4IA 4DSFA 3VQ6A 5KT6A 4DU1A 4FJ9A 5KFXA 4XDCA 3K1ZA 1GMWA 3IG1A 5EGYA 2F77X 2IIHA 3OVBA 4CRXA 5IWAF 1KOHA 4KH1B 4MLEA 3QFHA 5J2PB 4I2PA 4W5NA 4HCBA 4NLQA 1WF0A 3U1NA 4CF5A 4U95A 1U1NA 1DKGD 2AF6A 3M2UB 4QS9A 4NEYA 1JK9B 3M9OB 2N7CA 1S57A 5DLGA 1R3NA 3LOUA 2E20A 4FWPA 4QS7A 3TA2A 4KHYA 2XIDA 5KFKA 4O8KA 1X5OA 2I8EA 3AU6A 3PCOB 2F96A 1UJ6A 3SENA 4KIAA 1V3RA 1EXQA 3RB0A 3KLGA 1XTZA 3EDRB 5D0HA 1FE4A 4DV0J 2O4IA 4PQUB 4DCHA 2U1AA 4KX3A 2I6WA 4DR7J 3IO1A 4Y28C 4V19S 3KZXA 4JI7K 4F3MA 1NDCA 3CCES 3O5BA 3FC9A 1ZPWX 3N7RC 4ECUA 5M1OA 3OSPA 1VRQC 4CJEA 4TQSA 4MDAA 7ICIA 4GV9A 3RR8A 4DTUA 4W5RA 1K5OA 4Y3CA 4DL4A 4TLQA 2BZ2A 5HRNA 2FSNA 3OBYA 3P1GA 4JWNA 2H51B 2DUYA 4ER8A 1N8RO 3I55S 3AVCA 1HYZA 4KHPF 3SQIA 1WELA 4DFMA 1TL7B 2BABA 1BG3A 1CSJA 3ZTPA 1TKZA 4DFJA 8ICSA 3EJMA 4IOXA 1SB6A 2NPFA 4C48A 1CXQA 1U9LA 2OZMA 1JXVA 2VG5A 1URNA 1QQ5A 3JQKA 1R6VA 3HHKA 1M5OC 3P83D 4DI6A 3ZEUB 3PJXA 2KH9A 4QW9A 4NXMK 2FSKA 4LRBA 4H0YB 4O8UA 2JDJA 2H4WB 3R2DJ 3ZX2A 2PMZC 4WFAQ 3CT9A 3FRYA 4QBUA 4CJUA 1P90A 1VSMA 3R6LB 4DCOB 4CEQA 2F9WA 3NRWA 2QLBB 2ACMA 2MSNA 1N61A 2P6UA 1ELOA 4A61A 2MLXA 3I87A 2AMCB 5GAHI 1YIJS 3WNGA 1SVDA 2Q2RA 1HNXJ 2QLXA 2NUUG 4CO3A 3VQAA 7ICSA 1SCJB 4K2XA 2KXNB 5KAIU 2ODGA 5M1FA 4ZDNA 4K4GA 2F1JA 4ICLB 2W03A 3QGPA 1M5SA 2Q31A 4M3YA 2YNIA 3Q8QB 3L9ZA 3WNFA 5G5GA 1KHVA 2ZJRQ 4OLBA 2FLNA 1LXNA 3G6ES 1TV9A 1DRGA 4BRMA 3MMCB 3PKMA 2MLYA 4BLGA 4MIBA 3CJTA 2MDAA 4NLXA 2CPHA 3CJ3A 1QQMA 3KWMA 1DGKN 1D9AA 3QAUA 5I3UA 2B21A 3OR2A 4E1MA 3ZO7A 2IAJB 3GIMA 2MSSA 1YAGA 1OY6A 3H7IA 1OYDA 1XK8A 1I51B 3BEXA 2VU5A 4WXWA 4OVLA 2ZHOA 4OHYA 5E2QA 4FJ8A 1VC0A 9ICVA 3FZKA 1WSGA 3R97A 1M1KT 3W9IA 4Y2IA 1ITPA 4RU9A 3QB0A 2IOCA 5LM7E 2W2QP 2Z2YB 5J0QA 3UKRB 4I1TA 2J9EA 5BPNA 3OFGA 2HQCA 3HF5A 4NCGB 1C4CA 2IM3A 3QNMA 1RWXB 2B4VA 1S6OA 2E2QA 3C2LA 4J9QA 3T1HF 4RUBA 3BSCA 1LCUA 1FK9A 2GH1A 2MKSA 2O8FB 3QE9Y 2LQBA 3ET6A 3SNNA 2K1RA 4LT6A 3VA3A 5CHIA 4QZVB 1C20A 5HMXA 3IG8A 4CJ3A 1MW7A 1Y5IB 4JB3A 4NWIA 2ZBPA 2E5IA 4LUBA 3QSYB 1I94J 4GMJB 2MA1A 1N33K 5D0GA 2IS3A 2D69A 2X1AA 1NJYA 1YF5L 3KIOA 2HPUA 1RWKB 4DV2F 3EWAA 1Z1BA 1O08A 2RNEA 3DI6B 5KOWA 4EMDA 2QRRA 4ILRA 4YHHK 4UF4A 4DR7F 2VBXA 2GUIA 4KC5A 1KFTA 1FXRA 2W4CA 2O8CB 4KO0B 2C2NA 1S6QA 3H8WA 3EPGA 1T9TA 1QTMA 4BRLA 2NLWA 8ICQA 3D6JA 1EIYB 1J54A 2OEKA 3GYXB 2UXBF 3PRBA 3AAPA 2GMLA 1TELA 5HBMB 3V81A 1PK1B 4CGFA 4M3UA 1F0MA 5DB8A 5JVHL 1NOZA 4CJPA 1KXPA 3D2QA 2FJ6A 1IWGA 3DLBA 1X1PA 1U0HA 3MGHA 1X5SA 4LZGA 1X66A 2ZITA 1M5HA 3QUCA 2UUBJ 2LPEA 3T1YF 4H0PA 4XRHA 5EVZA 3PEHA 1X0FA 1M1GA 1N48A 5E0OA 3ENAA 4RQ2A 5F0WA 4JKDA 3H8YA 3SQGA 3VQTA 3QU2A 2JC1A 1QQ7A 1NAQA 1M1HA 3ETRA 3G87A 1FEZA 3CC7S 4H8KA 1X9SA 4Z4FA 3QLHB 3D6RA 2GVDB 2B9WA 3IMXA 2UUCK 2P35A 4BG9A 3CVKA 5KFRA 4RW4B 2LQ8A 1MN8A 1C2PA 3RRGA 2EWHA 1ZQUA 5HHIA 4ILLA 3KDNA 3TUIC 3X3UA 3IG1B 1KAZA 4DPOA 4DDFA 3PM9A 1X9XA 2G4BA 2YCHA 3L2UA 2RRDA 5FLXO 4PKGA 3TYTA 5JMVA 4DQQA 3LP0B 4C3LA 2C3UA 2M4MA 1ZBUA 4NLOA 2WAQC 4DTPA 5G0RA 4JV5F 2JRSA 1T44A 4F4KA 3EVWA 1YG0A 1WB9A 2HBYB 4IOCQ 3PX6A 4RJVA 3ENQA 4X65F 3AVHA 2BGGA 4X66K 3SI6A 1HQ2A 3OTOK 3MECA 4AT1B 4JN4A 2A1JB 1RWOB 3T7ZA 4DX5A 5DMRA 3DMJB 3THXA 2DGZA 3Q8YA 4L6V3 4WFNQ 2F4VK 1Z4NA 1S7HA 4K4XA 4FK4A 4JMUA 1PJ6A 2E8PA 4A57A 5HMMA 4NRTA 1XMOK 2PFPA 3H0RB 2B7BB 4E7JA 4IH5A 4WFXA 2V2VA 3VF2A 1N5QA 1L3TA 3BSNA 5B0GA 3PIOQ 2GX9A 2K1RB 4JK9A 2DNPA 3M8QA 3MGVA 4ECZA 3UR3C 1KVKA 2WK4A 3UPQA 7ICQA 3HFVA 4L3KA 5J29A 2XHBA 3WK8A 1NKEA 2DNMA 3U9ZA 4EUVA 2YXLA 3CC4N 3BBBA 2D9OA 3D1OA 1RPLA 2WTFA 2FUG9 4UZCA 2J76E 1U8SA 4USJC 1S49A 3DLEB 3THWB 2ILZA 2QMXA 3LUYA 4CJVA 1RBTA 3TQ1A 2HSEB 3AOBA 3UI3A 3O4WA 3WC0A 2MKCA 2VKRA 4UW2A 1RAFB 2Y3YA 1IBMJ 1U0SA 3N97B 4TN2A 4IKFA 1WHVA 2QB0B 2ZBRA 1XR7A 2B4UA 4CT9A 2HVHA 4CLPA 2NSCA 5C2FA 3Q8UA 2BANB 1RQ0A 2R2SA 4JRQA 4EFAC 5SZTA 5ALRA 3FDSA 4AXJA 5LL6d 2G06A 1OUQA 1JJCB 3B54A 1CQMA 3SBTA 2P6SA 4RQNA 2AW0A 2R7WA 1KQKA 2RQ4A 5SUHA 3Q7BA 5E79U 5IM0B 3J80O 1JLEA 4NLDA 4B9NA 2HK2A 5M2UA 1TKTB 2CQ3A 4O3RA 4BRNA 2W55A 3I1YA 1FKAF 2FJWA 2BMBA 3HRGA 3FSYA 2AJ2A 5J1EA 2QB0A 3ISZA 3WXJA 3QFPA 3KHHA 1XNQJ 3BH7B 4CJRA 1HBUA 3MCSA 1N5YA 2RS8A 1B3TA 4GXKA 2Z1GA 4ZHRB 2RQCA 2IVPA 3NKYA 3T1HK 2ZH5A 2J0XA 4LRCA 1C0MA 8ICTA 3MMBA 1W0HA 1XMOJ 3ZC4A 2ZC3A 1IR1A 4DSJA 2VG6B 2CZ4A 1JLBB 5GMEA 3MM5A 2B0CA 3KLFA 2G8KA 4URSA 1GNKA 2VUGA 1U2VA 2BCSA 2FI1A 3KK7A 2VFRA 2FVRA 4I2FA 3GQCA 5CXTA 3EGZA 1W2BR 3KLFB 3AVJA 3ICLA 4A47A 2PA8D 1VK0A 2UXDK 3VAIA 1UVJA 3Q2SC 4ZVOB 4Z94A 3AAWB 5ADXA 4J90A 4PGQA 4IUFA 2BXJA 2V8GA 2FXUA 3UD5A 1E6YA 5EWGA 1X4AA 2AQ4A 2RU9A 1X4BA 4I6WA 1O51A 1ZQAA 1KR4A 1X0PA 5FROA 1ZQGA 2OLWA 3EVOA 1RNHA 4A62A 1N34J 4I6MB 3TAEA 2PMHA 4FWLA 3W2VA 2LYBA 2HLTA 3SMPA 5KG2A 5AQMA 1MMDA 3E9LA 2EG2A 3OW2R 2LECA 1P9YA 3LDQA 3BS7A 3O8WA 3Q8RB 3QWUA 2P66A 2NREA 3A13A 1REVA 3C6UB 3CIPA 3PYDA 7ICPA 4ZOSA 4NLTA 5LMUF 4DV4F 3VGUA 2JH3A 2KEYA 3ZI4A 4BACA 1TFWA 1J5OB 3AA9A 4ES3A 4FXDA 1FJEB 3K75D 1GLJO 5KT5A 1SJQA 1SH3A 3BO3A 4PG7A 2XO6A 2ZH4A 2G5IB 5J2HA 2V34A 3HKZF 2W24A 5ALNA 5LT5A 4B3TF 4R63A 3KJFB 1NZ8A 1D8BA 3L3VA 2VQFJ 4KB7A 2CPZA 2M5YA 2F7VA 2DXFA 4OI1A 3SDEA 1F60B 1GT8A 1RA6A 4B3RF 1HKGA 4LC9B 1FF2A 3QGGA 4H4KA 4M9LA 2DD8S 2AP6A 2LU2A 4DBQA 4BHQA 1KEJA 3U6FA 1UPHA 2GGPA 4FK0A 2JZBA 1H7WA 1RT2B 3K2YA 4AILC 4O44B 2CN1A 3HI0A 4MKBA 1S4EA 5DDOC 1YTYA 2E6MA 3HPGA 3OFHA 2ALYB 2DT9A 1HQUB 1WSHA 2CJXB 1IBKJ 1PYSB 4NLGA 4IEEA 5KNIA 2W54A 4CJQA 5AM0A 2ASYA 3D3CJ 2YWKA 4C9DA 2XBPA 3I0RB 3ZSQA 3KJVA 4IQTA 4NI2A 4XH1A 4AL5A 3SBGA 1YRUA 2R7OA 7ICOA 2XY8A 3MXJA 8ICHA 4DV1J 7ICMA 2E2NA 1V97A 4ZVPB 3KJVB 2WFAA 3U1MA 3RH6A 4BRIA 4MN4C 2HBKA 3FZHA 3VPZA 1XMQJ 5CB1A 5HATA 4OX9K 2MKYA 3AA3A 4ZIVA 1O1WA 4Q45A 3C3LA 4M5LA 3PMLA 4FZYA 5CZVA 3ILJA 6FD1A 3O5TB 1H73A 3NLCA 4BRCA 4P4OA 1JB0C 5I3UB 3SEOA 2X51A 5ALJA 2R8IA 3C28A 2PFQA 1WG1A 1R27B 1GK8A 3VVUA 3HT3A 4F5RA 1BQMB 4EYIB 3M7DA 4BE2A 2ZBCA 5D8HB 2H4YB 2J6TA 3CJQA 3NNAA 3EX7B 4DU4A 2DHSA 2HBLA 1NGAA 2EH9A 3DGPA 3LQVA 3AA5X 1VLOA 5AQGA 4CK2A 4WFNL 1PYTA 2K60A 4ZPAA 5ALSA 4IQUA 2BRKA 5H9FK 4NXNK 1KDHA 4GY2B 3AMZA 3VESA 3UIQA 2UU9K 3IAYA 5KL1B 5A8WA 3GE1A 4RX6A 4AHSA 2Q43A 2KVQE 3RRKA 4DL0C 3SAGA 3DU6A 3VGTA 4DR1F 1BE4A 1BMQB 1DGJA 1RXVA 1Z2LA 4LSNA 2UUWA 3BF3A 2KV2A 1C7YA 4M9NA 1S48A 3MEGB 2DCLA 3QRQA 3IBCB 1YHQN 1UT8A 2WZ1A 3MBYA 1ZOTA 5TISU 3HRDD 2W25A 5B66U 3SMZA 2BQRA 2XHCA 1QVGM 2OIHA 1HR0J 5FJ4A 1BI4B 4WK3A 1ZJMA 3SZ2A 1F9HA 3AJ1A 4DCCA 4H4OB 2HHHF 3TA1A 1D8YA 5C24B 1M90T 1SQEA 4DQRA 2NXEA 3TARA 2PDAA 3P45B 3LAMA 4Q0BB 2QEXS 4DTRA 2FZCB 5JVHQ 3N6NA 5CE3A 4PHPA 3HOSA 3QIOA 4URGA 1KBUA 5BR9A 2FY8A 3US5A 1IBLK 1EQ0A 5DDPC 2FVCA 4F25A 4ZCLA 2KHVA 2N82B 2MUTB 4DJBA 3CCMN 4K8XA 2HNYB 2IJFA 3GP9A 3BO2A 3D54A 2ZD1A 2R8KA 2OPQA 2NRVA 2HGMA 2PAVA 2CQ4A 5ALVA 1XNRJ 4NYNA 2YHXA 3CQYA 1VDHA 1KAXA 2M3DA 3DN9A 3ILLA 3K2PA 4JI5F 3CMEN 1VRTA 3CQXA 2JH7A 1H1VA 3C5GA 1TE2A 2W8LA 3AHPA 4AH9A 1HD1A 4M9HA 1YX2A 2E1YA 2ZH3A 3VQQA 3UQ2A 3M9MB 4MFBB 7ICLA 9ICSA 3W5ZA 4TY8A 4HLBA 2HNDB 3UDLA 3H0PA 3MMAA 1VBZA 4AUKA 4FLYA 2NUBA 5FLXY 1SIWB 4RBVA 3VTHA 1S1XA 2XEXA 1XNSA 2LDIA 2FIUA 2XNRA 2QWQA 2H1YA 3PKYA 5AKYA 4TUPA 4JHDA 3BS5B 4C80A 3EXCX 1R43A 4EAHD 4QZEA 3S8SA 1SWWA 4OQJA 2VL1A 4CHZA 1RQLA 1FRLA 1AXQA 4X2BA 1RCHA 2CIMA 3QU5A 2YX6A 1LWFB 1QVFM 5AIBA 3RFAA 4W90B 2XWYA 2KM8C 1T6DA 3VQDA 1FEHA 3J81Y 1RT1A 4ILJA 3VEVA 2LQ9A 2UYTA 4OZ2A 5KFIA 1RAJA 3JSBA 4JI1F 4ANDA 2E5SA 2CQGA 1JLCA 3FZLA 4TKTA 1CBKA 4EEKA 5A0YB 3MDAA 3H40A 2UV8G 1HBNA 3GILA 3DU5A 3OR1B 3IR5B 3N4PA 3LP0A 3V4IA 4EBEA 2HEKA 1C0UA 2JJ4D 4KMUA 1Y4ZB 5KFDA 2K3IA 4CI6A 1MG7A 5DGBA 1Q78A 1W7WA 1IBLJ 3OTQA 3CHWA 1U6ZA 3WT0A 5E84A 7ICUA 2CNNB 1NHUA 3CC2S 1ZBHA 9ICQA 3DCAA 4EBCA 3TJ8A 3DXMA 4LF9J 4GKJJ 2A41A 4B9QA 3OL8A 3PXGa 3PJWA 3TNVA 4IDHA 3HJFA 2M9KA 4K4VA 4AQYF 3RSEB 4ED4A 4AE5A 4DSKA 3MUTP 2RKIB 3CJ9A 3JPPA 2VIHA 3OYKA 4G1IA 1HLWA 4Y2VA 1QSLA 3DLLL 3DOLA 2N3LA 4FM1A 4RU2A 2YV0X 1NZBA 3WKAA 2AX0A 1HFEL 1IN0A 1XERA 2VQFF 2E5LK 2UXCJ 2Y1IA 4CQ1A 1VQNN 3GCWP 3QEXA 4CF3A 1RT4B 4H0OA 1S9GA 1BNOA 3ZEUA 4E2FB 1S1VA 4DQIA 1SS6A 3RMBA 5AQOA 2GS8A 4YNQA 1Y5LB 3RBZA 3DXKB 1D3WA 2KG5A 5ALEA 3P5TL 4LH5A 3O9UA 1WNSA 2Q1LA 2MAXA 1MC8A 3EICA 4DV4J 1SXEA 3K7RA 3VWSA 1K73T 3R5AA 1FDBA 5KG3A 9ICXA 5KFMA 1A7GE 4NY8A 4FYYB 1GLLO 1ZAWA 4N8NA 1W7AA 1SZ2A 2ASMA 1Y97A 5F1XA 2ADCA 1T3OA 2ZOFA 4H54A 1F3VA 4ZS6A 4FWSA 3CCZA 2G0CA 4JI2J 3K8VA 3WXMB 1XHXA 2OUGA 2HKEA 1N33F 1VC6A 2ZWOA 4ERDA 4JI0F 8ICRA 2KT3A 3EL2A 1WOPA 4MF8A 2VWKA 1KQQA 2F3NA 1NOYA 9ICGA 2IHR1 3UCGA 3AD8C 2XMVA 1QHAA 2BQUA 4K4TA 2MTLA 4YORA 1U24A 3G10A 2MMYA 4QPTA 4BG8A 4F2SA 4QYZK 3O9RA 3TU5A 2XMWA 3ZNUA 4TY9A 2RE2A 3AB2B 2XI9A 1RDCA 4IH7A 4KH6A 1SUQA 4KRWA 1U1RA 4IR1A 2JZBB 1K47A 2DEJA 3M8YA 4G9ZA 3H6EA 2LEAA 1TVRB 4YN4A 2JLFA 4Q5VA 1F21A 3UPFA 2R2RA 1UVMA 4M45A 5IINA 1ZH5A 4DKWA 3H59A 3FZ2A 4Y2RA 2XSJB 5GAGU 1BA0A 1N33J 4LR9A 2KZZA 1YITS 3FQKA 1HBOA 3U8XA 1TR0A 3DOKA 5F3TA 5ALDA 2DGQA 4B08A 3C14B 2CWXA 4CLYA 4EFHA 1Y88A 2DKZA 6AT1B 2B6AB 1ESVA 3IM8A 4C4SA 4BVPA 3SJHA 4BC4A 4FJIA 3CFPA 2ZJPL 1FRXA 2JFDA 4YY3K 1S1TA 2F8EX 4C3MA 4DTNA 5D4BA 5JJBA 2XSFA 3G82B 3C6AA 1NK9A 3UQSA 3AOCA 2CPXA 3EZ5A 2WSCC 2QI2A 4UASA 4QZ8A 5I42B 5GIPA 1LAWA 4ED0A 3SUQA 1VBKA 2CWKA 3TX0A 1EQMA 4I29A 3BN4A 4KT0C 2UUBK 3VF4A 9ICJA 1M1KO 2E8AA 3RGIA 2Q3PA 4IFVA 5I4MA 1VFJA 4P4PA 4ANCA 3GYGA 5F8IA 3ZZPA 2HLUA 4B9LA 3ZDBA 5B0AA 3OLBA 4ZVGA 3PIOL 2X1FA 2E1CA 1TKXA 3HZ6A 1KSPA 3V1OA 5AK3A 1FDDA 1D0EA 3M6VA 2RQ5A 3IUCA 2OO4A 2KD1A 1QHTA 2BJ7A 2V2KA 4Y65A 3U27A 4NLBA 3Q8KA 1RT2A 8ICJA 3LTOA 3WKCA 4RQMA 5GADU 1CJVB 4CDIA 3V6KA 3D4JA 4U6PA 1VQ6N 4HT7A 3L4IA 4OJLA 4BRAA 4IFVB 1SIZA 4YOEA 2YJFA 3F2CA 2WMMA 1ZQBA 4L8RB 4DR5K 3BZKA 4USKA 4UB4A 1BHLA 1WDTA 2ZXIA 1XS9D 1YTUA 2FBYA 3ELHA 2QYGA 5DS7A 1YK9A 3I8DA 3O4NA 4M5IA 1YVNA 5EE3A 3ZDAA 2FVQA 2O4GA 3OS0A 2XS2A 5DDMA 1BPDA 3QRPA 3U02A 1NOMA 1J27A 2MKHA 4RTFD 2H5IB 2PA3A 4DV6J 4UOFA 1L3KA 2MKKA 4OZJA 3Q0AA 1C1BA 3TAMB 3H2VE 1LWEB 4DUZF 5ALOA 4QWBA 2OI2A 1I39A 5ALTA 5KFFA 1RT3B 4OYPA 1CC8A 1RT5B 2F8KA 2LQ5A 4BRKA 2D3O1 5TKWA 1O03A 4DTSA 1BLUA 2ROPA 2JVOA 1RT5A 3C1ZA 4G9BA 4QWEA 5JVGL 4HI2A 2C42A 3R9KA 2OPRB 3DLKA 4EP5A 3ED5A 1ZQEA 2RLTA 1EKEA 5C0YA 4ZPDA 4ZVRB 4MFBA 4QYRA 2P5VA 1C1BB 3TAMA 4PWDB 1HEKA 1LWEA 5J0SA 4M0AA 2VONA 3MN9A 2F5GA 2LEBA 5CYQA 3NF6A 4EO8A 4FL9A 3C16B 2JWNA 1JNZB 3OR1A 4F93B 5IV4A 3OT9A 1LB2B 2CQCA 3EPIA 2CQ1A 3P31A 1YI2S 3HSCA 3C66A 2EHGA 4M5NA 2JRZA 3OYJA 3MR5A 5HP1B 3JSMB 1FD2A 4XEIA 3I5AA 1HQEA 1N0VC 2KI2A 1I94F 1KVIA 4C4TA 4EZ9A 1FVQA 2HZVA 5AI8A 4EELA 1KTVA 3BYPA 1HNWK 3CD5A 3T1YK 1HYSB 2AJQA 3MCMA 3LM9A 1S6UA 1RU1A 3HL8A 1DY3A 3F9KA 2NS1B 5AXKA 2VV5A 1KVJA 4KO0A 4QIVA 3MK6A 2NUHA 2WF7A 1Q8IA 3CB4A 1SQKA 3QT6A 4UUXA 1N36J 5CH7B 3GIIA 3PW4A 4DCJB 1XU4A 3DLRA 3W2WB 2FLPA 4CE9A 2P9PB 5AKGA 3VZIA 3QETA 2DKOB 2HB5A 4FLTA 5A2QU 1LKZA 2YNHB 4KHPJ 2NO4A 4ED2A 1FDNA 1Q82T 3RJIA 2J0SD 2QX0A 1L7OA 5HVHA 4NOHA 1XSPA 2VQEF 3DEEA 4DXLA 1QAJA 5DG8A 2CADA 2YTUA 4ZLNA 3JTNA 2IY5B 3CDBA 4PHAA 1YJNS 4YUDA 4DFDA 1NGHA 2E7WA 4RW7A 4DR4F 1Z2ZA 4KV8B 3FAHA 1IJJA 1REGX 1U6BA 3WIVA 2J0QD 4HUGA 1N32K 1OH5A 4BR4A 3BM7A 1IXKA 4A8WA 3OXGA 1TKTA 1FD8A 1P8ZA 3DDIA 4PXEA 1KKXA 1JCEA 1DZ5A 1VQMN 1FFSB 4DV3F 4KQZA 1B9FA 3HSTB 2H9ZA 1ZJNA 4RWXA 4V19J 3KK2B 2Y8YA 3NH1A 3OFFA 1NMNA 5HP1A 1TFRA 2BOAA 1KAYA 2KVIA 3ORYA 4KY3A 3A0IX 4JKHA 4HEA9 3Q8SB 2PMZF 1SWVA 2OA8A 2E7VA 1KKHA 2KO1A 4F7VA 4LF7F 1Y10A 3CRXA 1TK0A 4F4AA 5KFHA 3D67A 4KE5A 3SIPB 3CXCM 1WORA 2FMPA 2EWSA 1FKPB 1KVCA 4QZHA 1RCXB 2AP1A 4OHWA 2KE7A 5A2QO 4UAYA 2CJYB 2F1HA 5IT4A 2FGCA 1JLCB 4USIA 4U67L 1FHTA 4WK1A 3DJCA 5M1PA 3NS5A 4ED3A 5F41A 2QLFB 1B7FA 2YNHA 2E44A 2HBRB 2V4JB 3QAEA 2C2KB 2CRLA 2MQ8A 4KX5A 2F7TA 5G0RB 3CXCR 3QUQA 2DRBA 2R9LA 3R5BA 4DL5A 5IFMA 1JXBA 2KDOA 4B17A 3G6XA 4ZHRA 3OXFA 2KG0A 3ULEA 1TUWA 2YWFA 2A3JA 1RDDA 3QDKA 2MXYA 4LF6F 2F3JA 3BKFA 3EUB2 3I28A 2BJ3A 1ZD3A 3P6YC 3DDKA 4F0HA 1FEEA 2CQIA 4TURA 4J91A 5BYSA 2E29A 3ONNA 5FIIA 2Q66A 2B4JA 3HBTA 3LM2A 2G8HA 2AIRB 4QZIA 1NKCA 5EXWA 3VEYA 3E58A 4ZJLA 4NXMF 1ZQWA 3DOKB 3V6HA 2B9EA 2F8TA 1ZQIA 1KQGB 3I0RA 1AROP 2K89A 1B43A 5KPZA 4RT2A 4OLOA 4RKUC 4OI6A 3KHYA 3MM5B 2W01A 2ZF5O 4QIFA 4YOYA 3K9KA 2HVEA 4YOUA 2QKQA 4EI2A 4FJNA 3L3UA 5AE3A 5EX5A 1NGDA 1RACB 1JLAB 4ATNA 2CQ0A 3PFOA 4NZ0A 1PCAA 1JMSA 3AO2A 1OO0B 4M3ZA 3MTKA 2FPLA 3N7PD 1BPXA 2BJEA 5DQIA 1YTAA 3HSDA 3I32A 4YB6A 3HYFA 3TSPA 4ENOA 2F65A 3HHLC 3OHBA 4EGLA 4HH1A 4DR4K 3LPYA 2D3DA 4WP8A 3HJVA 3F5TA 4ZN1A 4Y2XA 4XO0A 5ETMA 2P9LB 4DR3J 3OTDA 4L76A 4PYAA 3DHWC 1UEVA 3D2WA 4LBIA 2B9YA 3GFXA 4X5VA 2QGFB 4FWQA 2G2YA 1OJ4A 2EPIA 4KLFA 4Y2TA 3C2KA 3OHRA 9ICLA 4CNZA 5KG4A 2G5HB 1HLUA 3ZZYA 2P9KB 5BRFA 2VQFK 4OZLA 2O8EB 3SUOA 1SH2A 5T7LA 2CNOB 2CQ2A 4OYWA 4I9QA 5AQRA 5AQQA 4BE0A 5IT9U 3AXKA 3J7ZT 2FBTA 3UW1A 3W8PA 4LF4K 4CF4A 4OYBA 5GVQA 4JI6F 3L7UA 2ZZMA 4A4JA 3NASA 3CCUN 4H03B 3ZTOA 4BCAA 3D6TB 4C7YA 1YI2N 4HHUA 4UOCA 2J7KA 3RBXA 3GU3A 4RT3A 4P10A 3MX2A 2HRYA 2PEHA 2A10A 1T11A 5BN8A 5SWMA 5ETTA 3QNWB 3H8SA 4IJNA 3FJ2A 2QK9A 3VALA 4AP9A 1LQ9A 4DPWA 2DHGA 2XNQA 7ICVA 2FBVA 3D2FB 2XCPA 3A5OC 2VG6A 4MKYA 3ULEB 4G1PA 3MM9A 8ICWA 1HWLA 2IM2A 2B5JB 1RHRB 5J0YA 1X6JA 1COOA 1RBLA 3G4SN 1OYEA 3BR8A 2ZJRL 2F40A 4BVOA 4GKKJ 4YOWA 3BH6B 2PFUA 2JOQA 3KDOA 2OSQA 1TUYA 4LF8F 4F2RA 3ZLJA 3UKUB 3OPXA 3NMUA 4I2HA 3NF8A 5J2CA 3IR6B 1N34F 1K8AO 2QKBA 1EWQA 3BV8A 3L7PA 1MN7A 1X5PA 4USHA 2UVRA 4CJ5A 9ICAA 4BC9A 2PFFB 2VGNA 3VEXA 3EN9A 3ETMA 2BRLA 4BC3A 4YR2A 3FKBA 2ROEA 4P6QA 3DLKB 3BSOA 4LBPA 5J2MA 3AJDA 5D3GB 1VQOS 5TZVA 3V6JA 3RH5A 1JLGA 2CDQA 3QLHA 2MZSA 1FERA 4AHCA 2LHTA 4N47A 2DGVA 3ASMA 2PMZD 1ZQMA 4ZTJA 2KIWA 3T6JA 2IBOA 1KN5A 1CJKA 2EAMA 1QE1A 1WF1A 5ALMA 1MROA 1DAXA 2A42A 1N2XA 1IKWA 3WIUA 5K8NA 2QWLA 4DUZJ 3CGIA 3NOCA 1R31A 3EY1A 1BQMA 3C19A 3W66A 1VQLS 1U04A 2Y9TA 4IEIA 2G13A 3GZFA 1GOAA 2AGOA 2ASLA 2EBGA 2QKKA 2EAPA 1J5OA 3WQTA 3TUPA 3VCDA 2BE9B 2XSJA 5IQ6A 4CH1A 4Y00A 1U6FA 5AQJA 2QEXN 3D0HE 1SKUB 4JP8A 2CAJA 1BVSA 3KFWX 2CG4A 4QIWC 1JXEA 2PKEA 2GLEA 1DGSA 3G71S 4H0XB 1P8GA 3HZEA 4C7QA 1HKCA 2BPGA 3JAMY 2OPPA 1H6KX 3M8WA 3M30B 4DOZA 1WSVA 3KKAA 1SI9A 3CCJS 4ED8A 3G0ZA 4CHQA 9ICFA 2CG8A 5DDQC 3J7YI 5HVGA 4ECSA 2EZZA 4ELTA 5AI9A 3A3PB 2Q6CA 5KG6A 1FK9B 4CZIA 3PV8A 2BACA 4KHNA 3OY9A 4KH0B 2XZWA 1TUUA 2XQCA 3CCQS 2HZAA 4KBIA 5JLFA 1G6BA 1NNDA 2V2ZA 3VQSA 3JS9A 1VK3A 3TWHA 1VQYA 2YKNA 3HJEA 4PG4A 5JVGQ 4MIWA 2PZSA 2OHFA 1KLNA 4NLUA 3V9ZA 1R89A 4LF9F 1IO2A 4K5RA 2MZTA 1VRTB 2WVFA 2GVDA 4FWNA 4FWMA 2K8AA 4HHJA 4QOTA 4BC2A 3KD1E 2BPCA 4DMNA 1LW2B 4OFZA 2LVWA 2E1EA 2ZH6A 2Z2MA 3UVJA 4LFAJ 4B1XB 1JJ4A 3U9DA 4J2AA 4MFCA 4U8VA 2E9RX 1P27B 1QVFR 2EFGA 5LSOA 1BIZA 2WSFC 3ET6B 4J2EA 4XAKA 1YJ9N 3MMCA 5D0EA 3CM5A 4XIUA 4OKJA 2EKNA 2GIQA 1TMMA 5J2NB 4JKEA 4WXOA 2MQOA 4UBBA 5AXNA 1ZTWA 4PUOB 3I6PA 5BPMA 4ANEA 1IH7A 5ALXA 2KK0A 3CPEA 2EC0A 4RW9B 5B0FA 3K1RB 3UWTA 3TPQA 2O8CA 3J7YP 5EX0A 2IJRA 4QNLA 5C15A 1H2TZ 2OPSB 3TZXA 1YQHA 3KG0A 4LSZB 1Y9OA 2ZH7A 3CD6S 4OPJA 4LREA 1CC7A 3IDWA 3GZ7A 4EO6A 1J2MA 2I7PA 3CJ1A 4AYBD 4LSNB 2JEJA 4CIOA 4DV7F 1GLBG 3VA0A 1G3OA 1KBRA 1ZQSA 1VAZA 3D2NA 1QUPA 1YBTA 3MDQA 1YRTA 1UAWA 2IJNA 4X66F 2VYPA 2DR5A 3NH0A 5KG7A 2M0GB 2UU9J 2LKYA 3PSTA 2PI4A 9ICUA 5AKJA 3BF1A 1WYGA 2KN4A 3C5FA 1WC5A 3TZWA 4P71A 3PLAA 3HKZD 1WHWA 4BS2A 2XS5A 3L2VA 1YJWS 2KLAA 3VZHA 1FRIA 2WW4A 1HD0A 1YJ9S 4EX6A 1I3OB 4PG5A 3KUEA 3K9JA 8ICZA 1LKYB 1XHZA 3FCHA 2E5LF 3TWZA 1JCGA 4WFZA 5F8HA 1T03A 3ISBA 5DK5A 2YX1A 1HNXF 3IRXA 1VSFA 1DFDA 1DOQA 3B9JA 1HNVB 1WOQA 3EKSA 3NVMA 3FEZA 4IJAA 3BDEA 3QEWA 4CZJA 4YN3B 4P72A 5RUBA 4WIIA 1FCAA 5CP2A 1XO0A 1BQXA 4CLUA 2FBXA 4J5OA 3NF7A 4ZP6A 2OKQA 1GQEA 3IG5A 2MSTA 3H25A 4KYZA 1WC6A 5KPRA 4DV1F 1CUKA 4YDUA 2FPKA 1HQEB 1WEXA 2ILYA 2ZVIA 4EEYA 2KQ2A 1UVKA 4YB5A 4H5WA 3QZ8A 1C1CA 4DV4K 2DNRA 3VEZA 9ICIA 2WTUA 4CGDA 4FSVA 4DV2K 3PW5A 2G2OA 2LI6A 1WC3A 4U7BA 4FYVB 4GC6A 1N5YB 3MFHA 1GMVA 1GX6A 5L1MA 3B6BA 2NXJA 4ZJOA 4JI8J 2UUCJ 4Q2LA 2Z2ZA 2VA8A 2PFDA 3Q89A 4A46A 3PUFA 3FLCO 1ZAXA 4H0TB 1JLBA 2VJUA 5K5MA 2KFZA 5K8PA 2ISPA 4JI7J 2BW2A 5IC4B 2OZSA 5IT9O 2KM8B 4R66A 2R8JA 2YMPA 3M2VA 1HKAA 2VBZA 4CEEA 1BPZA 3P49B 1VYAA 5GAGP 4A8KA 3H1QA 4LF7K 4X84A 3IMQJ 4ZVTB 3ONQA 1ZETA 3G6VA 2IHMA 5K8MA 2E3TA 1K8KA 5C2GA 2XGPA 2UXDF 2D4WA 2PFNA 2GO7A 4U7UK 7AT1B 4WKRA 3JPTA 5K8OA 1GLDG 4BRFA 2HWHA 2ASJA 2D3UA 4DV3K 4Y1CA 4KN7A 3P96A 5AICA 2J7WA 3J7ZO 4KHWA 4YG2A 2IOFK 3AVAA 3OSNA 3NCIA 5ALGA 1RBOB 4Y0FA 1RABB 2Z1JA 4FK2A 3E2EA 2W42A 3KK3B 3K5NA 8ICIA 4CEZA 4AD6A 2BYCA 1RT7B 1T9XA 4YY3J 4FO0A 3TR8A 9ICWA 4UB8U 1YRXA 2ZIVA 3C0BA 3RZAA 3CI5A 1ZQVA 2A6AA 3OXLA 3QIDA 3CCMS 4LF5K 5MLCV 4MDBA 1UKUA 3IFEA 1FT8A 2KKVA 4P73A 1S1UB 2JC0A 5EN1A 2DGXA 4F02A 3AVFA 3J7AP 4DF8A 4E89A 1FI4A 5EHHA 3CF5L 3TADA 4G65A 4M3RA 1O6XA 1VQ5N 2DHHA 1T9VA 2LCWA 8ICGA 4BJQA 1XNRF 4CGIA 1RG6A 3AARA 2BHNA 1NGEA 3I4HX 8ATCB 1VLYA 1WG8A 1UTAA 4KR0B 5EX3A 3CC4S 2NYHA 4KLJA 2EZYA 4C98A 5CYQB 4K0KJ 5A8KA 3V5RA 3W9HA 3SYZA 1HQUA 4LH4A 5J2JA 3M8SA 2WONB 2LQJA 1U1QA 3NAIA 1NBEB 3V9WA 3R7BB 5I3PA 2HRTA 2QV6A 2D5RA 1B64A 5DRKA 2W7PA 2NXCA 3C14A 1ZQ1C 1SXLA 1Q79A 2V94A 5F3ZA 2Y1LB 2MZ1A 1KEKA 4IRCA 1P7DA 4NI2B 1NRKA 1BO5O 1KRPA 4H4OA 3MCPA 3RAQA 1KONA 2ZBIA 1BY9A 4FJGA 4MEYA 1EZZB 2LP4A 5KQDA 2NZCA 2OPPB 2Q97A 1MA9B 1VQON 4DN9A 4F36A 1GLFO 2A3ZA 2P9SB 4YXMA 2P1JA 1KTQA 4E1NA 1SH0A 2YHYA 4IQWA 2GGPB 4MH8A 7ICNA 2B7CB 3IBFB 4O3PA 4E19A 4FWOA 1ZOLA 1EXNA 1SV0C 3T69A 3G6YA 2FC9A 2WVBA 2ZBQA 1NM1A 2KVSA 3W62A 1BA1A 4WCEQ 4FZVA 3EZOA 4F3OA 1HBOB 3WKDA 1XC9A 2IM1A 4IO9Q 3O1BA 5J0RA 5HN0A 1FXLA 3OBIA 2YN4A 1VC5A 3UDVA 4EU0A 3G4SS 4FYWB 4CNYA 3IKMA 2ASPA 5MAOA 4H5NA 1L3UA 4KJIA 1RYSA 3K5PA 1HYSA 2UUCF 3MTJA 1F2GA 2XM3A 4C97A 4GVLA 1DLOA 4IDKB 2ZEJA 3BZQA 4JI4K 2UVWA 2LYHA 1JQGA 4FLUA 3AOAA 1DK3A 1NWKA 3CCWA 4BRQA 2ADBA 2E5HA 3VERA 3IA0A 4C0HA 4I6MA 1B22A 2LDYA 2OEHA 3OVAA 4KAIA 4Z6FA 2FHJD 3MEGA 4ZPVR 3BS5A 4LFCJ 5D0RA 2IAJA 4O4RA 4QIWF 3CIMA 8ICXA 4IS7A 1R8BA 4CI0B 3LL3A 1TTHB 1P1LA 1DRZA 1C6VA 5GTIU 4KMOB 1NK6A 2X6NA 5CA5A 5L46A 2YKOA 2YMLA 3AO1A 4A8SA 1X3NA 3QBWA 3SD7A 2I0XA 4NCGA 1YDLA 4TU7A 4ACOA 1KN6A 1FKPA 3E9PA 3H1VX 3OL6A 4DOBA 5KGXA 1Q82O 1PO6A 1UT5A 5B0BA 1HBNB 3T9NA 1U45A 3EEQA 3MDCA 2UUAF 2IOFA 1UPMB 2VGMA 3W2WA 4B3TK 2ZNYA 2YWEA 1V5IB 2QXLA 1DQ8A 4X4TA 5HOOA 1TU0B 4M94A 4O5KA 4Y6IA 5L8RC 3RJGA 2IA6A 2R7YA 7ICHA 3A8IA 3RMDA 4FE3A 2I7NA 3ZDCA 1B0VA 3I5CA 2VG7B 4K8RA 3TI0A 1Q5VA 3ICXA 3QJLA 4K43A 1NGJA 2VPYB 1IBKK 4OX9J 1RBAA 4KLUA 3UB5A 4BDPA 1YJTA 4CF9A 4FLZA 3MCAB 5KOXA 3HMJG 2YI1A 4GRSA 3ID6A 1TYQB 3HSJA 4C6AA 2A1BA 3AO5A 5DLFA 1T03B 3V2UC 1NLKL 3K0JA 5JU5A 3TANA 3R2CJ 1WAFA 2EW9A 1N56A 2C1EB 3HM9A 1NM2A 1NPPA 1LK7A 3VGLA 1TQLA 4DU7A 1NPKA 5CR0A 2JR5A 2HFUA 2XYGB 3UO0A 4CLWA 3CCSS 1EWRA 1SJ3P 1PVRA 2FJDB 3POTA 3ZETA 1XMQF 5AK4A 4L72B 1PYOB 2IBKA 1EETB 3GFZA 3EZUA 3A2FA 2ZIXB 4NXNJ 5IT0A 3G6EN 3C6TA 2F8MA 3K89A 2HQDA 3F5EA 1C1CB 2B9XA 5AI4A 4ECVA 4DV5K 2RP5A 2P9IB 1VCTA 2OSRA 5AQIA 4DHVA 2Z58B 4CESA 5T14A 4QAGA 3M8QB 5ELZA 4YHHJ 3H8JA 1O8BA 4A5BA 4FS2A 4K8ZA 4ZVFA 2GMHA 4B1VA 3RTVA 3ZT1A 1T7PA 4Z6CA 4CGHA 3GIJA 2YKPA 1U2RA 4F04B 4WP3A 2CUYA 4B9SA 1HWIA 2H3EB 1NMDA 4LJMA 4QR1A 3DAWA 5ETRA 3KK3A 3M8PB 2ZDOA 4KV8A 3B8HA 1JKHB 3RG6A 4DPUA 2IVOA 4Z0UA 1MSWD 2CXEA 1VISA 2GW8A 2DYAA 3QU4A 5CYMA 5AQLA 4LSLB 3LP2B 2A1JA 1SC6A 4UOHA 3GV5B 3RMCA 1UVIA 3H2UB 1VSDA 4P52A 1K9MT 2K4HA 2IDEA 2G8VA 2BKOA 1CZBA 1TK5A 2WOMA 2B43A 4TY8B 2AV5A 3PHEA 3CJBA 2R7TA 1LXJA 4W4MA 1KS2A 3DWLA 4BR0A 1XEZA 3AM9A 1RBUA 3NVYA 4J9OA 3I56S 1ZBLA 3WKEA 2BUNA 3C1YA 3GJQB 2CPDA 5C2DA 1TFYA 2D0BA 3HVWA 1LWXA 3CTRA 4C0OC 2MYFA 4Y2MA 5H2FU 4BDYA 3ZTQA 3P39A 2DKXA 3NMAA 1U25A 3AY0A 2BOPA 4KTZA 2R7RA 1D4XA 4KHQA 1I5OB 3QU7A 4C8OA 2V7YA 4NX9A 1JXLA 2W40A 2CH6A 5BOLA 3F53A 3CCEN 3LZJA 1ZM2A 4RW9A 3ID8A 2KHOA 2J8SA 4DQ8A 1L6NA 2R8HA 2YKMB 4I2QA 4X66J 2FLLA 4AHTA 4FZNA 9ICNA 2HWTA 3NUQA 1T8EA 3B0XA 3RBDA 2XTJP 2XMAA 2QARA 3HVTB 4PL1A 4US8A 3PVXA 9ICTA 1SJRA 5A0LA 4W5TA 2NRZA 1NJWA 2GJFA 2K2PA 3LDNA 1U47A 3MM7A 3PYGA 4C1NK 3IGNA 4ZOHC 3VEOA 4JI1J 1FTRA 4WZMA 3QT5A 3F73A 2KSOB 3R5GA 4BUGA 3H20A 1VSHA 1VHIA 1U49A 1JMTA 5CYMB 1SC4B 3NCRA 1NK7A 2ZZTA 4JKCA 1DTQA 2CYYA 4DR6K 5AE1A 2NNWA 1WSJA 2HIQA 5ETLA 3SAHA 1NGFA 3K17A 1TMJA 2BM1A 1UCNA 4DV5J 4K4UA 2ZJQL 1RCOB