4P0PB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna, and mg2+
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
328
structure length
278
Chain Sequence
RMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords Crossover junction endonuclease MUS81
total genus 85
structure length 278
sequence length 328
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0pB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0pB01
1J23A 2JPDA 4BXOA 2ZIWB 2ZIUA 2M9MA 4P0QA 2ZIXA 1J25A 4M6WB 2ZIVB 2ZIUB 2A1IA 1J22A 4BXOB 4P0QB 1J24A 2BHNA 2ZIXB 4P0PA 2JNWA 4P0PB 2ZIVA 4M6WA 2BGWA 2ZIWA
chains in the Genus database with same CATH superfamily
3ZTWA 3TE6A 1FO4A 2F4VB 4NU5A 5KFKA 3AI3A 4CMBA 2IQIA 1KZ9A 1VHTA 1ZGAA 3KL4A 3WZMA 5A4KA 1OBVA 1IIPA 1B6SA 2JI8A 4Y0VA 4DV4B 3UT5B 1E69A 4EGJA 1Q3KA 3KQLA 1XJ0A 1G9XA 1THZA 3CUTA 1QYRA 4KQIA 1RM4A 4X1OA 2ES4A 4X3OA 5DYYA 1TJ4A 3RHZA 3LPMA 1P7CA 1HTTA 1FE8A 1TQ6A 2Y71A 4AJEA 4Z4CA 3A1TA 3OLYA 1AMOA 4A0SA 2PL1A 3NC4A 1CXZA 2ZPAA 4GD3Q 4QHTA 5JZBA 1TCAA 4B3RB 5TNXA 4RNOA 1GQFA 1VL6A 3F9CA 1Y37A 4TVBA 3IDZA 2WWVD 3VDMA 5KX5B 3DOEA 4OSPA 3LWDA 3OKCA 1NKCA 4PC1A 4AF7A 4K9SA 1ESZA 5HQTA 2CT8A 4PHPA 2X5OA 2RG1A 2XOEA 1YS7A 1R6XA 5E6UA 2X5XA 4MQLA 3V4RA 4XYBA 2FWJA 1M1XB 5ED0A 4UNIA 2CHEA 5EKSA 1VG1A 3KU4A 4BVGA 2VJPA 4TXNA 3HCFA 4UTZA 4LRXA 2VH2A 1PKXA 3A9CA 3F1KA 4C88A 3ZC3A 3ZD7A 4NV0A 5EIEA 1QH0A 1QIDA 2XTNA 4QPCA 4L6CA 2G5IB 3QUBA 3A3YA 3B8HA 4ZEWA 3A25A 1DDIA 3G9TA 4N7BA 5SYAA 3U48A 1AXEA 4XTRA 4B4OA 4PSCA 3BCSA 3N5CA 5GV8A 1GL3A 2ZIXB 2J31A 3IP9A 2XIJA 3AR6A 4HC4A 3R3ZA 3HX0A 4NBRA 4FWTA 5AYVA 3VX4A 1X14A 3BL8A 4ES6A 1U2EA 2FCAA 1ANKA 3RJEA 1I5OA 1OLSA 3LP8A 3RS8A 2OAEA 4DY6A 1HQDA 5AVRA 1KMNA 1GG8A 3F3YA 3TZBA 1Y4ZA 5EFOA 1XQYA 3BUSA 3Q8WA 2HW8A 1BWSA 4QZ8A 1CULC 1AT1A 4GP9A 3KQKA 1YOBA 2HHXA 1J21A 1JG7A 4RQ1A 5IASA 3MWFA 3STTA 2WU1A 2ONYA 3OO0A 1YA6A 3A4LA 2ZUSA 4F71A 1N5DA 2JI7A 5HZKA 5TX7A 1CB7A 3RRZA 4PINA 3RYIA 4R2IA 5SY9A 2PUHA 2WSLA 3E9NA 1BEZA 4R31A 4TYPA 1JHUA 1MW8X 2YWXA 4V02A 4Q1FA 2XKKA 4RD4A 4MQEA 4BNZA 4KWTA 1W94A 1LY1A 3AZPA 4PZ0A 3ZZ0A 3G0HA 1HEIA 4BDSA 3DUFB 2FDRA 3O0TA 1JXLA 2D8CA 1ISGA 2PSDA 2WKQA 5G1PA 1C7EA 1XDSA 5JLAA 1PFVA 1NFFA 1V37A 2VJLA 4HDCA 3D8TA 4MGEA 2OV8A 3V1UA 1SWWA 4KXXA 4DM7A 4LGVA 3TYXA 2LV8A 4B48A 4EGSA 3EQ7A 2ZRHA 1JKMA 3P9ZA 3PXGA 4PW0A 1FS6A 2H54A 2Z43A 3EY4A 3I0MA 4G41A 3UJPA 2VWHA 2CJYA 1QIMA 2PKCA 4LC0A 1H05A 5L8VA 1NC3A 4KR3A 3LYLA 2XUHA 1A50B 4ZQEA 4L3WA 1Q1BA 2C61A 3EGOA 1QIFA 3GUCA 3HN7A 1M34E 4HWGA 3V4LA 4PGHA 4HEA1 1ORHA 2E5LB 4EATA 1AJEA 1QCKA 2BGWA 3MUOA 4RHYA 3PITA 4LXQA 3OQPA 3QXJA 1ADYA 1N2HA 1Q11A 2BF7A 2WJWA 4LDQA 3BFVA 4N0DA 3VU9A 1SVLA 1I30A 2CY0A 1U9LA 2HBLA 1A82A 3QXCA 4UATA 3TD2A 5JD6A 4CM5A 3GLIB 5I8PA 4IOLA 3M34A 2YVQA 4GNRA 4W8GA 1RRVA 4EZEA 1U9IA 3E1KA 2BISA 2WIFA 1B93A 3NRWA 4B3DA 1SJ9A 4B35A 2H92A 1XX6A 3FDIA 1JH8A 5DB7A 2XW6A 2OG2A 5DQHA 4RTOA 3HJUA 2BPCA 3K0AA 1VHQA 3K4PA 1F8YA 1KK0A 2CZQA 3R7AA 3P26A 2OKCA 3UA4A 4MS3A 3CR3C 1E9FA 5DCYA 1LFDB 2YRFA 4XB6B 4F5EA 4QEDA 1GKUB 2D1SA 4ZGGA 1JU4A 1Z33A 1SC3A 2XODA 3K1AB 1Q57A 3LSTA 4YMLA 1ECLA 4NJMA 3WKBA 4J0QA 1W29A 4KOEC 2KMLA 1O9BA 1SCBA 2V74B 3PQ4A 1YQDA 2WWHA 1IZYA 2FR8C 1U5AA 5EUQB 1HE4A 5JCOA 2R6DA 4Z4GA 3U17A 3CF0A 2H07A 5H7XA 4U8HA 4Q9HA 3PUKA 2WMOB 4WZAB 4AJ4A 4C7YA 2E4ZA 2ZSKA 3PGJA 1Q0HA 2AD5A 4HOYA 1H3EA 1MAHA 1ABFA 3MMSA 2ACVA 1ZQRA 1IJEA 1QRTA 4YRKA 3BCUA 2JEZA 3EA5A 2A7QA 2FF7A 5HMLA 4ECXA 1XZDA 2HN9A 4N1AA 1RXVA 4NONA 521PA 3TTUA 4RT3A 1Q14A 1BGVA 2Z1MA 3FVRA 2D0IA 3ZDRA 2PUAA 2PTGA 2WNHA 4TUPA 1MEEA 5HE9A 1E2GA 1SZPA 3HVHA 4XD7A 1YRYE 1AS0A 4PANA 5C35A 2X15A 2Y1FA 1MCZA 1E8MA 1FP1D 1DTEA 4YXWA 1NQWA 4OLJA 1YAJA 5KTTA 2DQ4A 3PXAA 5E7JA 2D13A 4L4UA 4KLQA 3CLSC 3SEAA 2IZ7A 4E32A 1CETA 5CD1A 3BSYA 1C1XB 1UDWA 2ZUWA 4M54A 4ND5A 3I30X 4EM6A 3K4QA 5JANA 1YRBA 3OLVA 3EG9A 5KNCD 1SXPA 2H0AA 2XEDA 3S68A 3U6KA 2II6A 1EAYA 4F5RA 5BOSA 4IIGA 1COZA 2LUOA 4PTZA 1ID1A 5EMHA 1PYOA 1FYWA 3EZ9A 4GQBA 1SXQA 4FB4A 2VYVD 2C03A 2Q8PA 3BVPA 4P82A 1AHPA 4M1ZA 4LNUB 4UUPA 1YQWA 4JYAB 5T14A 3IURA 1NGSA 4Z7NB 5I4BA 1NMYA 1OC4A 1JBQA 1YA8A 1Z15A 5B37A 5L6LB 1DUSA 2NT3A 2YOHA 5ALOA 2KTQA 2I1LA 2QDXA 4FJ1A 1DXOA 3HRHA 3OFVA 5JJBA 2XLCA 3JPPA 5JSQA 2XGSA 2YQ5A 1R0XA 1OAAA 3UMVA 1PEKE 3LF1A 4XH9B 1OX6A 3N0XA 2XZOA 5A0TA 3P9KA 3AKYA 4ZT2A 5E4TA 4F6RA 1HUZA 1F8GA 1JXQA 4LWOA 5JVDB 4J2HA 2JIZA 2PS3A 4BVHA 2O8DA 3P9XA 4RKWA 1HPLA 2YFKA 4YV1A 2E4AA 1QGUB 4DSFA 3OURA 1RXSA 5DBBA 3GPIA 4FVTA 3RLIA 1RYFA 2Z98A 3PNBA 4FPXA 1T13A 4FYVA 1UXIA 5DN9A 7ICMA 5K6AA 3DHWC 4CM3A 1G8YA 4LGCA 4K0KB 1V4VA 1Z68A 2XF8A 5BRNA 4EPRA 4MVJP 1EYZA 1MABA 3CEMA 2PA3A 4TTTS 3OZAA 3PF9A 3ND7A 1D2HA 3FMIA 1GSHA 3FYDA 3NHJA 4FQ5A 4B3JA 4IKEA 3N1UA 2ZRQA 1RU3A 1HDZA 1QOPB 4TTJA 1QLHA 3UMFA 3TJMA 4J76A 2R8KA 3SC6A 5FTLA 3WOVA 1F3LA 4DDKA 2EZZA 5K3FA 3ZVMA 1XTZA 1FTSA 1EVYA 1P80A 5CEHA 1XQ9A 3H86A 3R5SA 3RJJA 2W6MA 3X1KA 5GTHU 7ICGA 4I4LA 4KVAA 2O5RA 3I76A 5DN6A 1AZSC 5IUKC 2PSJA 2PXXA 1XTPA 2QRZA 3TNJA 3U7JA 3IP4B 4M88A 1W5AA 5JNVA 1YCFA 4QFDA 4DFJA 4KDCA 3WR5A 1EB9A 3AU6A 1E0KA 2G04A 4ER7A 4JX9A 2LNDA 4ENRA 4Z51A 4GH5A 4OQPA 2BRUA 3AHEA 3D7LA 2VI5A 5BYKA 1C2YA 1RXUA 4FFNA 1ZKDA 2RG7A 5KS2A 1UBNA 2CMKA 3HU5A 5JJKA 4HR7A 4AJ1A 2YMPA 1NDQA 3FZQA 4DMFA 5KB3A 4AFNA 2VRCA 4F5PA 1XC7A 1TF2A 1YS6A 2PKEA 1M6VB 1FFSA 4M83A 4YROA 4DCJA 5AM3A 2GN1A 3Q5EA 4WKPA 1H2BA 1KJWA 4LFBB 2CXHA 3LUDA 3UN1A 1Z34A 4NPAA 1PTKA 4XUDA 1AZWA 2DUYA 2AX4A 5E38A 1PLLA 1PN3A 2J0UA 2OCGA 2XE8A 3V32A 8ICTA 1ZRHA 1XJQA 2VZ9A 4HQFA 3BZBA 3ESXA 4O4IB 4C6SA 1GAXA 3BQ9A 4QZIA 2D8MA 4CNQA 1YRLA 3HY6A 3KJIA 9ICBA 4FDAA 1T9ZA 2FAXA 4JUIA 4QRDA 5DM1A 3LQYA 3WYAA 4AJLA 1PZNA 1ZOPA 1M0SA 4CFYA 3E3AA 2XTMA 5CFMA 6REQA 1HNZB 2EP7A 2DPYA 3VOBA 2GLEA 2K4EA 1X1DA 2VF2A 3BBPA 4XQ9A 3J81k 4JY7A 1UA1A 4CM8A 1CZHA 3IHLA 3EPGA 3U3KA 4W8HA 1JEJA 2HB6A 5CLJA 2FZVA 3TOCA 3G9XA 3NWJA 3VR6H 1EWVA 4XYEA 4Y2JA 3MFIA 4EENA 3QG5A 1A8SA 4LVSA 4QXPA 2DMRA 3EIUA 1GQQA 1T4MA 1ODFA 1N6IA 1NA5A 5IHXA 1BC5A 1I4TD 2BSXA 1V7PC 2AK3A 1E4EB 4FHZA 2CB9A 4KXLA 4ZO8A 5UKDA 5BUQA 1G66A 1DARA 3VKWA 3K1TA 2P9BA 4Q15A 1Q3VA 1IDN1 4CIVA 1VLBA 1HRDA 2A5FA 3VOSA 1RC0A 1C4KA 1MTOA 4GOJA 3S1AA 1PEAA 1DTSA 1QOQB 2RAPA 4RVNA 4WECA 1B23P 4OJNA 2X2FA 4Z4IA 16PKA 4M0DA 5THQA 2WT4A 4UU8A 2V7QA 3QK7A 2GCGA 4UFNA 3FG9A 5H3HA 3ZWBA 1PQPA 4D74A 5B12A 2P77A 4ML3A 2QV7A 1R66A 1IULA 1Z0JA 2WVGA 4YMSA 5KIAA 4L08A 4GLXA 4D25A 4KFRA 1VJCA 1T15A 4O3NA 3DO5A 1EXWA 3QF7A 1NHGA 1I4LD 5A3VA 4EJFA 2GK6A 4HQ6A 3P9CA 4B3GA 2Q5JA 4F4XA 5A4AA 5K01A 4PNPA 4HZUB 4C07A 4JJEA 4KXNA 1CR4A 4JCOA 4M2LA 1K5HA 2H48A 3NRCA 3VXKA 2NO7A 3EFHA 2E1RA 4E08A 2F43B 1UBKS 2XMQA 3HO6A 1FLNA 2D74A 4YXMA 1TECE 2V7XA 3ZXYA 3TGPA 4QYIA 4B3MB 3B9JA 1HLDA 2F00A 1WXQA 4Q48A 3AB3A 3ZKWB 2WWYA 2Y93A 3B3JA 3E7WA 2PVPA 4YIKA 5EWJB 5GTDA 1CUVA 2FFAA 1OH7A 1WWVA 3W1VA 1VDMA 2Q2OA 2HXYA 2FWNA 4DT1B 3PXDA 2WWWA 3AUOA 4P9NA 5K05A 5E1OA 2GDZA 2O8DB 2ZGVA 1WU7A 4X94A 1GKIA 2ONCA 3LY9A 2JGDB 4M1QA 3QKRB 3P9IA 2QR5A 1CJSA 1JMSA 3UMBA 1K5DA 3NPAA 4KLJA 3LP6A 3CSUA 4U7GA 2XA9A 1SHUX 2IHJA 1L7BA 3H83A 1OXVA 3K9WA 4JQSA 4ZVQA 1J2MA 3F2DA 4BC1A 1W0KD 1Y6JA 3FVVA 4LX8A 4RXTA 4Y9TA 1ZNZA 1I7DA 2RKBA 3EIXA 4LXIA 4ZHQA 2IH2A 3LF2A 1R0KA 2EZYA 4G5YA 4LV8B 3X2FA 2ZYVX 3ZWXA 4DR6B 2JFZA 2ILTA 7YASA 2CKDA 1IATA 4HTFA 2IMWP 2FW6A 3WB0A 3MR6A 1U7XA 3OFSA 1TUBB 1MIHA 1A5AB 1UFKA 2G5GX 2QB5A 2C4VA 2ZROA 1HDXA 2VUUA 4K6MA 4CL8A 2W2PA 4I2VA 4IH1A 3AJ9A 5JSKA 1WCNA 2CMHA 5FEMA 4YJFA 1GOTA 2R87A 4H3VA 2B2NA 1J24A 4I1VA 4ZAFA 5JSYA 1A8IA 4EJSC 3WGIA 1CEYA 1OROA 5I4KA 1S2IA 3E23A 4AROA 3FFBA 4YN3A 2RDJA 3SZ2A 3CN7A 4QOEA 2Q6TA 2HWUA 2RJNA 4YMOA 1QYVA 3AUFA 1JXAA 4FXPA 2D1TA 5LQMA 3EZ6A 2QZJA 5EA2A 2Y1KA 1FL9A 1KC3A 5LB2A 3WICA 1RQNA 3DDOA 4LE1A 1QVWA 4BQQA 4ZVPA 2Z4RA 1FNBA 3PQ3A 4ECZA 4RK6A 3NRJA 4RQBA 5J0UA 4O3OA 4EAAA 4R6WA 2QMOA 3HDHA 3C7TA 4N01A 4CV0A 4DDUA 2FLLA 4DCGA 4NLGA 3C48A 4NABA 4GEKA 3HDGA 4XDZA 5JH7B 4O29A 3RU3A 1M1NA 2QLMA 1ZU5A 4MDFA 1JIIA 1YZ3A 3BS7A 4FLMA 3CE6A 4ED6A 2W2KB 2BHRA 3AJ8A 3WADA 3L02A 4C0WA 5T7BA 3FOAA 1Y5MA 4OJQA 2FGKA 4IOMA 3M6WA 2F76X 2AYXA 2ZIVA 1UMDB 1P0CA 3BCRA 2KQUA 5J2UB 3G3EA 3MERA 3R9IA 1X6VA 4BNNA 3S4YA 1KJQA 1U0TA 3L3BA 1KFJB 4GT1A 4KO2S 3M6ZA 1EGAA 3DOUA 3UTDA 4PS0A 2B69A 4Z54A 3BMOA 4Z0TA 1GZHB 1VIYA 3FPJA 2FZLA 5TMPA 4DSEA 4K5QA 4MXDA 3GEHA 1KEEA 3GYBA 5BURA 4GWGA 2V6JA 2PL5A 4J1SA 3WL6A 1E63A 3W3AD 1HQCA 3NALA 4KRXA 4E1VA 1PT8A 2LMRA 1CUFA 1ORVA 4LOIA 3ZLJA 3A6ZA 2GCIA 1AV7A 4XX1A 3G6YA 2DKNA 2G77B 3D6FA 3FPKA 3DE6X 3DDNA 3OZEA 1CZRA 3ETEA 3KZIU 2OGWA 3RGWS 3UJ8A 3WIUA 4DA0A 1AB6A 4EITA 9ICFA 1A9SA 2PS0A 5H4HA 3J80A 1TUGA 3FOBA 5AXCA 4MYHA 5CM8B 4FONA 3VMMA 1AA6A 5IM4F 5D4BA 4HF7A 5BMVB 1KSPA 4UAWA 2BEVB 3K1JA 3QFSA 2AGQA 1CZNA 2BVNA 4YV7A 5IDWA 3I5YA 4O5KA 3DAOA 3VOTA 1S2GA 4KAJA 4LGYA 3PVXA 3W8DA 4D81A 5ESWA 3CCBA 4WK6A 1W7AA 1D2CA 4ZOCA 4Q1DA 4CKEB 3QBEA 2GO1A 5EWMB 1N62A 2DWPA 3Q0TA 4KUGA 4ZYLA 4KKXB 1KTQA 4IQWA 3C21A 3LIIA 5DRYA 3GPDG 3F9IA 3LKBA 3GMIA 4Q47A 1HDEA 1X9WA 2OWOA 3DEFA 2IY8A 4MRPA 4KX5A 1QZUA 4UEOA 1DPGA 5CT6A 4L50A 3HB5X 3C6XA 4ENVA 1URJA 4WA8A 2O0LA 5JWRA 4F86A 4YQEA 3WDLA 4CV3A 1KJ8A 1ATZA 2YXDA 2IA5A 3JRWA 1VSBA 2HGSA 4R8LA 3U16A 3SFTA 1JAYA 2HMYB 3GWGA 2R00A 2IYTA 1L7XA 4AYBC 1ZG3A 3L01A 4REQA 5EZYF 5F12A 2A6PA 3SR3A 2OCDA 3NHPA 3OHSX 3H4BA 3WSTA 3F6RA 2C2WA 3HGMA 3KJQA 2CD9A 3I1FA 3H8WA 5LQSA 4EG4A 1NVVQ 2Q5LA 6CHYA 3E27A 1S8AA 4L75A 3UW3A 6ADHA 3OUZA 2ZLBA 3C3WA 3NHFA 4G81A 1ZO8A 5DH9A 5HA5A 2IV3A 4G9BA 3UUWA 4DR4B 2D2EA 2OHIA 2H2GA 5CB8A 1Z6GA 1OUQA 1Z08A 1AK9A 3AJAA 3PD0A 5F21A 4PBTA 5CB4A 4XXHA 1KJZA 4B9UA 3IQDB 2OT3B 4XCQA 1FX0B 3RRYA 3HS3A 4TKVA 2FMKA 1FX0A 4BTLA 3AKDA 4PVDA 4KYIB 5EVCA 2Z56A 3E0XA 4MLCA 4BEJA 4DKXA 1AMUA 4HAXA 5DGCA 3NEAA 1EJ2A 1QFYA 2UZ1A 2R62A 3HDJA 4RJJA 4S05A 2J9GA 1NK6A 2PFQA 3AM9A 3KJHA 3NCHA 3KT0A 4HNHA 4O2AB 4YDSA 1QE5A 1UPCA 2LM4A 3M4XA 4UEQA 3KOXA 2PT6A 1A71A 2NUTB 3C8DA 3GJZA 4ZOBA 4QXRA 1MDFA 2GN4A 1C0IA 1XEWY 5LYYA 4N18A 1V11A 3FW1A 1MC1A 2WTFA 1TDJA 1SL1A 3LO8A 3PC7A 5DXJA 4OJYA 2G40A 5EP1A 3EASA 3O90A 2P7IA 5JSFA 4Q6BA 1BE8A 3OFNA 4GU5A 3RE1A 5BWOA 1JG6A 3IEUA 4OOEA 3DVRX 4OXRA 1GLVA 5ALMA 3MTJA 2YWCA 3PD1A 4MRAA 5G1NA 1OI7A 3EAQA 5H59A 5CEJA 2PYZA 1N78A 4FUTA 4GGOA 3QITA 4Y9SA 5U4XA 1ENPA 1NULA 1ZJ5A 3U6BA 4MIYA 3GCGA 2NYUA 2VQSA 1GWNA 2FZKA 2HDHA 2XD4A 2QE6A 2BBOA 5HR7A 3M2TA 2XRZA 1JE0A 4E6EA 4LDPA 2AJDA 1FLAA 4FGZA 4HWTA 1A69A 4JLNA 2ECKA 2DT5A 4L9SA 1P1FA 1SQFA 1XP5A 4KFTA 4EIWA 4BWGA 1HSZA 5KYVA 1Q44A 5BSGA 1JALA 3SLGA 2ZS9A 9LDBA 5K5EA 1AE1A 3H05A 1MFZA 1ZITA 5DV9A 5A9SA 1XZFA 1HDRA 2BOVA 3PXEA 1AUXA 3F49S 4FOSA 2H3ZA 2V5VA 4FJ2A 3V8BA 1L4YA 1X94A 2J9RA 4G4GA 3VR1A 1RYYA 3RRNA 3VNSA 2PV7A 2DKFA 1HXHA 1V45E 5KEIA 2F8TA 4K88A 4CT5A 2WPNA 1XVLA 4ZQFA 3CRNA 3OSPA 3ZZ1A 1ZQXA 3EB9A 1XTJA 1P4HA 2VUSA 3GPCA 2GVZC 4HLQB 1ZOLA 4TS3A 1KEEB 3L82B 2JLBA 4QZHA 3GJQA 1WXDA 3IYLW 4RUKA 4S1VA 4ZK6A 4F91B 2FB9A 4KXUA 5JW6A 1E32A 4FOOA 1UBUS 1DGSA 2C3OA 4JT4A 3JPTA 3EQ8A 1DAHA 3IBYA 4GYYA 1UJ4A 8AT1A 1NUPA 1ZIXA 2Q4OA 5CX1B 3LWBA 1WG8A 1ULAA 3PNYA 4L8VA 1PSWA 2PLNA 4UMFA 1UJ2A 4CPDA 5FUQA 3RAFC 1J1ZA 2RGGA 4NDNE 4CG1A 5E2AA 1AQYA 4EJSA 2O1XA 3RQSA 2CN1A 1CJBA 3LFTA 3WG9A 3WMFA 5K4GA 3PDUA 2XX3A 5BWCA 2JH9A 3E6AA 4IIUA 2WF9A 5KFGA 2AI2A 3OQHA 1YZVA 2UYOA 2JFHA 1KJNA 3CZ4A 2F8LA 5SY6A 3SR6A 1JHMA 1Z19A 4G5RA 3I6ZA 3IS3A 2ZE7A 4IRUB 3LWNA 3MJFA 5CVDA 4NZZA 4JI8B 4KYTA 3R5HA 2HNBA 3W5DA 4MA5A 4ND3A 2F3SA 1LSJA 4PC3A 5J2FA 3KYJB 4BO3A 3LHIA 3D8RA 1TF7A 4LDRA 1N2CA 1E79D 1TC1A 3BHJA 3ADPA 3MFYA 3KFVA 5DLFA 4C8LA 3R6WA 2I29A 2TS1A 2DLDA 4N0EA 4INPA 4X20B 5G4KA 5FWXA 1F7UA 5BPCA 4O9MA 3O92A 2P5YA 3UHFA 5AKYA 5GMOA 4ED3A 2OBLA 1NBMA 1RWBA 2C83A 2IU6A 2V8OA 3KQWA 1R0SA 4W1SA 3SC3A 4ACAA 3Q8RB 3BD6A 3REFA 3IKLA 1KMCA 4B7AA 1MPTA 1XRJA 1XZ8A 1Y1SA 1XJWA 3GAAA 1FFCA 1VE5A 4TUSA 1B6TA 2EEPA 1JR6A 4R65A 2JZBA 1HYHA 2E3JA 5L3SA 3CRRA 1LTKA 4KO3S 3O9MA 3ROZA 3M5WA 1FS5A 3I09A 5LFAA 4XGRA 1Z3CA 3P9YA 3IAM6 2ZTSA 4JLBA 1U3DA 4IY1A 2B98A 2QM0A 3EZYA 3REQB 3T7RA 1BJKA 4FGWA 3DG9A 4P4TA 1UM9A 3L0CA 3PD7A 3B0YA 4ZHQB 4BGDA 4MMYB 4MGIR 2YHUA 4B9TA 1G98A 3I2FA 5JXWA 1W4BA 2E4YA 1X80B 3PNKA 4BZZA 4ANFA 2YKGA 1XZEA 3IIIA 4J75A 3VZRA 3TTVA 3NHAA 4OJKA 2VP6A 2DPJA 2HX1A 3EUFA 4ALJA 1AGNA 1OBCA 3GGPA 4YRTA 4ZVLA 5JZ9A 1KY5A 3MT8A 1QTRA 1S2MA 4QFBA 4Z2AA 4ER5A 3VU9B 4YRQA 2I6XA 1J6UA 2ZJOA 1YB6A 3LD9A 5PGMA 2FPIA 4I4NA 1GPUA 3TG2A 1RFGE 4EKGA 1RYNA 1G2PA 3NOXA 1PJAA 4R84A 4Y7DA 3RSHA 1HE2A 4ZOLB 5U1PA 3RVMA 1WXHA 5HJ5A 2BH2A 2CWWA 3RYFB 3OT1A 2QW0X 4C2AA 2DLNA 1AHHA 4BXOA 3DP7A 3O4IA 1ABEA 3IVXA 1QIGA 2B4AA 1EDZA 4LYGA 1SM4A 1CZKA 3ILVA 5D3QA 2WSIA 2YWHA 1EHIA 2FQYA 2A1UB 1ZSVA 3RAJA 1D5CA 4Z8YA 1FU7A 4B31A 3THXB 2X7JA 4XFKA 3R9XA 4KLEA 1S4MA 3WVNA 2J0QA 1CE8A 3F4KA 4N7RA 3T4EA 1K9SA 2H11A 1L5QA 2HPAA 4R66A 1XSEA 4ZVUA 2NPIA 4I3FA 2W6NA 3C4QA 2VT3A 1U8AA 4FHFA 4FW9A 4XPIB 2AEJA 4UHKA 3AFMA 4II2A 4YI5A 4RT2A 2D0DA 1WO8A 1N3YA 2GJSA 2OCIA 4ECRA 3PV0A 4J03A 3Q15C 4JXJA 4Q9AA 2O6KA 2VG8A 3R3XA 2GASA 1N2CB 3RRFA 4E5DA 2HPVA 2J4CA 4MVJM 1WQ4A 1AQJA 3D0OA 3IT1A 1HURA 2JVIA 3E2IA 3I12A 1G4HA 3OEHD 3PNPA 2WUVA 2Y76A 3NH9A 4GPD1 5C1BA 1C41A 1Z25A 2JFYA 4FFRA 3DWFA 4L27A 2XB6A 1E4YA 1GR1A 2R6ZA 3JYHA 4JKIA 3HV0A 5COQA 3DEYX 5SYMA 3DNMA 4M9HA 2EG5A 3JWJA 4JOQA 1RPAA 4YNBA 1ML3A 5LD2B 2FFJA 1L7VC 2NO6A 1ZOIA 3NHWA 1TFUA 2BRUC 2I9KA 1VG0B 1Z2DA 1FSFA 1Y1LA 1ZN7A 2FZ4A 3DBOB 3E9ZA 5EWLB 4DOAA 1UR5A 3NATA 4W9NA 4YY3B 1GPJA 2H06A 3R09A 4LBWA 5IVDA 4C6TB 2C20A 2BKEA 3RB6A 3I3OA 3HJHA 4B8WA 1TF5A 2AWOA 3I0ZA 4AMGA 3RFAA 1F1JA 3HSSA 5LQRA 1YR9A 1NZDA 2XJ4A 3KDAA 3H2SA 4U8GA 2W43A 1YR1A 3ODPA 3K8ZA 2EKBA 2DYKA 2ZOSA 1X13A 3AOGA 3PHHA 5DDYA 5EWGA 4YRRA 8ADHA 3A2KA 4EHBA 1Z0ZA 2AV6A 1Z13A 1T1RA 1C1DB 3EVBA 5CJJA 5JALA 3G59A 1VMDA 2YJGA 3TW6A 2REQB 3OWHA 2FEOA 5LP1A 3PIRA 4H7JA 4EWLA 3RSCA 2VJ4A 3AO0B 3JR7A 1JFRA 4ETNA 3DZ8A 3RVBA 2W2MA 1TLLA 4PGAA 4IDAA 4DLRA 3HH8A 4YRAA 1NUUA 4XUGB 2K2QB 5FXMA 1JMKC 4UOQA 1Z4JA 1RE1A 4AO8A 3OX1A 1CRQA 2P3SA 4UUQA 4D3YA 2G7MC 3AY3A 3K4HA 4O2BA 4IDFA 3FKSA 1L8XA 5ECGC 4EBFA 1E61A 3RHSA 1U2QA 1W34A 1E6KA 1GEGA 2ISQA 2P11A 1DXQA 1K0UA 3PX0A 5KT7A 1U0LA 3C14C 3JWGA 2FPGB 3IUJA 3L41A 4DE5A 3U4MA 1WBDA 2O2DA 4RSGA 3NYQA 2VZLA 2VZ0A 1N9GB 3Q7EA 2PH5A 5I7RA 1ZGGA 3G13A 3A4IA 1SKQA 1MQAA 1VPEA 4Z53A 4HDKA 5M3BA 5KVCA 3C97A 4O4HA 1QGYA 4EUFA 4JSTA 2H57A 5DWQA 4JYPA 1X86B 2BGJA 5G1OA 1QVZA 3SC4A 4E94A 4CLOA 8ICMA 3I8SA 5AKJA 7ICOA 1NPTO 1Y33E 2P0YA 3F5MA 4MW6A 5HRCA 1H2EA 3CSSA 3F6PA 4OXIA 5HIAA 4PX9A 2PHZA 4MW0A 4DBLC 2OCBA 4K4HA 2NU8B 2PA0A 4NJOA 4XVQA 1G5HA 4LOJA 3O2QB 4XM0A 3VR3A 4Y2YA 1QSLA 1PHRA 2H2WA 4E3ZA 5P21A 3U61B 1HORA 2BGKA 4FE4A 5DGBA 4J0CA 3ZE6A 1F6BA 4YCMA 1R0CA 4G9GA 2CHGA 4X24A 3EZ5A 3L04A 3OF2A 5CX1A 3ZCTA 4F2WA 1YXMA 2UUBB 3LZ6A 1I51A 3GT7A 3RS7A 1V8OA 4KHPB 2GT1A 1XDWA 8ICSA 3EGDB 4G67A 4JGIA 2EWWA 5LDHA 4N3NA 2OPBA 5EWFA 2BM1A 2HCJB 1TK2A 2FOXA 4TWJA 3VZBA 4EMBA 5IJWA 1XYGA 3I01A 4J0IA 1M2VB 3R8CA 2UZ4A 1K5GA 2P90A 4UHBA 4X64B 3KNZA 4X8LA 2WI8A 2UUAB 2YUTA 3MLAA 4GKJB 1U3FA 1KWGA 1QLNA 2WF5A 2XECA 3VH1A 2PAAA 5I6DA 2CLFB 4Q7KA 5IEJA 2X22A 1FFXA 2XY5A 2BN4A 1O5OA 2XNKA 1NK5A 3H18A 4F21A 1LPOA 2EX0A 4ZCTA 5JCOC 1OLUA 3PXUA 1ZQDA 2GX6A 3M9XA 3B12A 3IV7A 3WGKA 4KKVA 1B4FA 5TISU 4E7PA 1B0XA 1N5JA 1PUXA 2FPWA 3CMCO 3N86A 5AHOA 1NM5A 2KFNA 1O6CA 2HHHB 1Z56C 4MINA 4OGLA 4WT7A 2BI7A 4L73A 4RM3A 1R74A 5ALYA 3DL7A 3KHGA 2PFOA 1WDLA 3DULA 4NZOA 3VPFA 3KQNA 5C80A 1NJ5A 1ADFA 1B3RA 3NS1A 1Z8HA 4ZQGA 1G60A 3BFXA 2AF3C 4UMEA 4OEHA 2PZBA 4B45A 2ZRLA 5JECA 3HLKA 3I42A 3CE9A 4QECA 4BZWA 1TI7A 1TAMA 5JJCA 2C0PA 4LZWA 2C0QA 4KAXA 3UOWA 4DLBA 3U7IA 3LSYA 2AMVA 4XWAA 1VSQA 4J43A 1T36A 2G08A 4LSWA 3K70B 2G67A 2YBDA 2VAMA 4L8WB 3LK7A 1C20A 1O2DA 3FUCA 3OLQA 2JIOA 3EIFA 1S0VA 4Y30A 4PLFA 4INJA 2R96A 3I28A 2JL1A 2WLSA 4JUBA 4Q3EA 4BB9A 4EOGA 2RMKA 4HNTA 4B3TB 3Q3JB 1N8NA 2QE7D 1X70A 4BWJA 3BZKA 3HFSA 3O94A 4FZ3A 4JLAA 4KO1S 3VPCA 3SZRA 3JTEA 1RAIA 4FFMA 4Q9JA 3VI3B 4BUCA 3DSRA 2W6PA 5C9ZA 1G8HA 2PAFA 2FWAA 4GFJA 1WF6A 4Z1MA 2ETVA 3FN4A 3NM6B 1IN1A 1J90A 2OE2A 1RR6A 5CU7A 5IJXA 5BYJA 4PO9A 3RNLA 3FXAA 2XNHA 4XCXA 1Y9EA 3QPWA 3M6IA 2JV3A 1E9SA 2GAAA 4GNKA 4E5UA 3HTXA 3QVWA 3IVMA 1GT6A 2ZRNA 5K8IA 4YAKA 4C7OB 5FNVF 3PIIA 5DHTA 2H9AA 4BLQA 3B1ZA 4I8DA 1KDVA 1WD5A 2IYOA 1VCOA 4G56A 2JBWA 1VP3A 1XNGA 5F35A 1XMXA 2JFUA 1QIHA 3H2HA 3LX8A 4IQUA 2VT7A 3DZFA 3P9QA 4YCDA 2EKPA 4G1FA 2H3HA 1GG2A 4KXQA 2FSFA 4H0CA 1B15A 2JLUA 3HJCA 5DG7A 1MLDA 4FNMA 5AHWA 1M8KA 2BIFA 2WYHA 4CMEC 3P9SA 5DBGA 1QQ6A 3T52A 4CUKA 4Q43A 1BMFD 3JD3A 3HP4A 4A8JA 1SIUA 2WAYA 4TQGA 1H4SA 4Q1CA 5IHPA 3PX3A 5AVXA 3L4KA 1Y7TA 1V9CA 2C9BA 3L49A 1DTWA 3VJRA 3AHFA 3VU3A 3CNBA 4FUQA 4KLZA 4IJWA 2ORED 2DXIA 2WJ6A 4CXMA 4D9CA 1IXKA 2QYSA 4CODB 3LBNA 4JU8A 1G1AA 1P4GA 3UMRA 4CLRB 1Z39A 3RTAA 4NXMB 4CIBA 1F6WA 3VV3A 2Q3CA 1WUIS 2NUPA 3UGKA 4LK2A 5BWNA 3O3NB 4WN3A 1F1BA 5LLTA 1JEEA 1WUJS 2QUJA 5B2ZA 5KYKA 4KK4A 2PJDA 3R6TA 3IOCA 1KI4A 1MGPA 2GEFA 4OK5A 5TGDA 5JBQA 3QVTA 4HX9A 4QJ3A 1H0RA 2ZUVA 1P2GA 4DFKA 3QBDA 1IQRA 3KDPA 4YLGA 2H3EA 1QLJA 3A6GA 3AF4A 4HAWA 3EZXA 4MB0A 2AKYA 1ECWA 4IR1A 3W7VA 5A4DA 2PR2A 2NO4A 3KUCA 2VA8A 5AQEA 2CV2A 4Q7QA 2HUPA 4RA6A 4WSOA 1EFTA 2J85A 4NYIR 2JFQA 3JQCA 4RLHA 1D6JA 4YXJA 4BV2A 4TT8A 3KQVA 4PAWA 1U0NA 1FMCA 2OBXA 4PIPA 1HUQA 2HWWA 4FT2A 5NULA 3AFGA 3ZV5A 4BUJA 3TDKA 1TYCA 1A2KC 2FE9A 2ODGA 2DULA 2DFTA 1Y5LA 3NH6A 3J7AC 2NTNA 3DO8A 4C7OA 3M1IA 5ELLA 3D59A 5FA5A 4EGCB 2C5BA 4PLWA 1BZYA 3OM8A 4M0LA 3D6AA 4X00A 2C1EA 1KFCB 3OCJA 4OGWA 5MGNA 4CIDA 1CUIA 2QLLA 3PFFA 3RROA 1SHKA 5DULA 4Z0PA 2COUA 3II6X 4OYLA 1U7HA 2CK3D 1PP4A 3AMVA 4ZVSA 4UQGA 4KI7A 3MHPA 5BUCA 2QB1A 3FLAA 4NCKA 1O6FA 5I4IA 1T2EA 4E2YA 3CVWA 1C9JA 1G38A 5LBIA 4F7DA 3D6TB 3VSEA 1EG7A 1ETUA 2FEAA 1Y4UA 5ICFA 3RIEA 1HYBA 4TMZA 3HCPA 4WBNA 1YR7A 3EOBI 1T9HA 2YWRA 5BRAA 1UIMA 5KFZA 2PGAA 1PJQA 3AR7A 1EDBA 3GNLA 1ZYUA 4GZLA 2AHOA 8ICZA 4INOA 1Y9AA 4L6AA 4KLSA 1QRRA 2GKGA 3WDMA 4B84A 1RJGA 1M7BA 3CWZA 2ZTVA 3X2EA 3FPSA 4B43A 1NN5A 1XZIA 3ASYA 3FWNA 5EP4A 3CLTC 5IKXA 1HJPA 4J9PA 2ZZKA 3G2MA 5AIAA 4KLLA 1F8XA 5ISMA 2J3JA 2IZZA 2PX8A 3F46A 5DP2A 4B7CA 1OOEA 1SVKA 4HFMA 4Z99A 4AZSA 1A9XA 4OMFG 1I7PA 3QKIA 4NY8A 5ALJA 3EXAA 2E6KA 4EG0A 4Z86A 2XDYA 2C7GA 3HV2A 3I4LA 3NDIA 3UOGA 4GG1A 1SRRA 3LKVA 3WB1A 2R6R1 3G5MA 3Q3CA 4K81B 4YAEA 1RWWA 2EYUA 1Z62A 3Q87B 4JWNA 2GZ2A 5B53A 3AGQA 2NMVA 2PI5A 5JE8A 2EDAA 4C8KA 2KE5A 3NT5A 2K60A 1BJRE 1NZFA 1QE0A 2HJWA 4KN7A 3RC9A 4TV9B 2VBCA 2KW5A 2C4NA 4TXLA 3S5JA 4DFMA 1GZ5A 1ZMRA 3A6DA 4KLIA 2YZNA 3LK6A 1X7ZB 4UCWA 1ZQNA 2BEUB 1EINA 2FJUA 3ESYA 4BZQA 1PU2A 2C42A 2F2AB 3ET5A 2HQBA 1YRAA 3FA2A 3THWA 4DMLA 3UXOA 3W04A 2O54A 4FDTA 5AHKA 4ARCA 3O4HA 1SWVA 5EJ4A 2CLEB 4G63A 3G82C 5IARA 1MEJA 1CERA 1NVVR 1PG0A 3E61A 4ARVA 4B80A 1U81A 2J5QA 2CE7A 2VQDA 4J2OA 2G72A 5FT9A 2BCVA 2VQ3A 4DL3A 4CIWA 4M1WA 5KFWA 5DXFA 4C4ZA 3ER9A 4RTSA 4R83A 5B1SA 4DOCA 3EFOA 1D7AA 2JMGA 3ZGOA 1FTNA 1KO1A 1JIUA 1YB1A 3BDVA 4MAFA 4X63A 4ZJZA 1YB2A 2X0JA 1DIOB 3MTDA 5A5VA 1WULS 4XDGA 4IMJB 3TQ1A 2FA9A 3DM9B 3IQGX 3DEAA 2PBRA 1T4GA 1EU1A 4DIKA 5DCLA 4X0EA 4KMOA 1QQBA 3A6FA 4UW9A 3NBZC 4ECTA 1GO3F 3AL0B 1H2YA 3LXMA 4QT0A 2IF2A 3THSA 4DC1A 4D96A 4M46A 1UM8A 1Q0TA 4R2MA 1OGJA 1JIJA 3ZU3A 4C29A 5FPPA 1V4BA 1E1KA 2ZKLA 4IOJA 2JGAA 1BGXT 1DLJA 5CM9C 5IK2A 4U7JA 4XVCA 5A6SA 5A6SB 1PZXA 1T94A 8ICAA 4C7JA 1DC7A 2I9GA 4WZBE 4UHHA 1OZ0A 2IXAA 2WA1A 3E3NA 3DFMA 3OAAA 3T1VA 2WP8J 3GLGE 3TBHA 3GGDA 4IHJB 2FWBA 4F4YA 4Z4QA 1JAZA 2VJDA 1J49A 3WLPA 4P4PA 2NUTA 3CPHA 2SECE 3ND6A 1CUZA 4LYYA 5F5NA 4HGPA 4KODA 4Q3CA 1BKYA 2QRQA 3PSTA 4MVCA 2JZCA 3SFVA 3LUKA 3PGA1 4F85A 5AXDA 2G4VA 4UBMA 4LHVA 3AHCA 5GVSA 4PPNA 4CW7A 1NBHA 3DZBA 3RJFA 4R41A 4WFQA 5CVJA 3T9BA 4A73A 2XMGA 4DDWA 4ZYWA 4E88A 3NJ4A 3WA7A 2F55A 5KFCA 2PBZA 3UXEA 1CDZA 4WI1A 2E8MA 5H68A 4DEZA 1PL6A 4GUDA 1GRVA 3Q9LA 5KDLA 2ZXIA 1Q1ZA 1EDEA 4LMBA 4KGXA 1SBNE 4UVIA 3VBEA 1WCLA 3H4DA 2BI8A 2Q3BA 1GUBA 2GN6A 3FMOB 1R50A 3PC4A 1V47A 1V71A 2GAJA 2BTQB 3WHKA 3ZVRA 1O94D 1VKJA 5KFQA 2VYND 4DCTA 2AQHA 3VJLA 2ORWA 1BNPA 4XIFA 2RGRA 1SVNA 5FUXA 3TOVA 5JSUA 3HU1A 3RJHA 3M4JA 2XCSB 2V9WA 4NLZA 2C9CA 1UXHA 1GGJA 3OOHA 3WWYA 3UHOA 3BQ2A 4HY3A 4AJOA 4WINA 2ODPA 1P39A 3QLVA 4KE7A 4LY9A 1TCBA 1ISSA 2F3PA 4LBYA 3H19A 4IG9A 1RLMA 5L1IA 5EFZA 1JQJC 1LUAA 2RAVA 3FSJX 2IOHA 7ICHA 5FNVB 5A4IS 1Y1KE 1BPYA 1Z35A 4IJ6A 1JF8A 1KORA 4ZDKA 1SIJA 2WB2A 5AJHA 1HTWA 2IUSA 1CNFA 1JU3A 1HZJA 3AR5A 1H85A 2JHGA 2VF8A 3AEXA 3LPAA 4FFOA 3IRUA 2UYGA 4I66A 5ULLA 1CQWA 4XX0A 3OJUA 2G71A 3MFQA 5B1EA 1YBAA 1IXRA 1XTIA 4AIIA 3TZQA 2YNMD 3RBEA 2QD3A 3DD1A 3URMA 1N5KA 1GR0A 1SO8A 2BFFA 4OAPA 3MJCA 5C46F 4KJZA 2EBHX 1LGYA 1JHDA 2ZITA 1NNLA 3BWVA 3ORRA 3P32A 4YRSA 2K4PA 3Q3VA 3ZBQA 4D0NA 4J4TA 2AN3A 3JASB 5IC6A 3WWDA 2P5SA 2CUKA 2VNHA 4XB2A 1APBA 1SKYB 3T1NA 4ZAXA 3WIBA 5G5HA 5IDVA 5J0YA 1U90A 1ISIA 1G6KA 2GDJA 2BMDA 2N1MA 2NZ8A 2PQ0A 3CX8A 3MS4A 2PX0A 4ZAZA 1R9NA 3C1AA 2HZ7A 2PX6A 2YB1A 3EXIB 3QVXA 4IHJF 1C0KA 1USWA 1Z8NA 5CXUA 1IHUA 3GI1A 4RULA 1BH6A 5BN5A 3GMDA 3MGVA 4N5NA 1I9GA 1VBKA 1J06A 1HNNA 3PGLA 3RKRA 1R0WA 1WHSA 3BK1A 3TL2A 3AXSA 4MWEA 1UDAA 1GUZA 1SAYA 1DJOA 1SL2A 3RIMA 1JJVA 2CE2X 3PVSA 1N2EA 1TMGE 3IPRA 3RU9A 4NXZA 3QX9A 4A2PA 1HNXB 2GI4A 2RK3A 3H7IA 4PG5A 4PQEA 4OXNA 3GV8B 4REQB 1UQVA 2NO0A 3F5DA 4WJKB 4ED9A 2FLVA 2AJCA 2OXCA 4ZOLA 4AQ7A 4GX2A 2JGJA 4URZR 3W2IA 3EUWA 3CVXA 3PJRA 3AL0C 4XA5A 4YCCA 1LF5A 3WGNA 1Z17A 1TW2A 4DCMA 3GQVA 4DCCA 2WJPA 3C1UA 3RD5A 1TAGA 2J3EA 4V2UA 3MGHA 3CUKA 3C6BA 5F2OA 3W2FA 3HCWA 4QTUB 2AN4A 2VHXA 4NBSA 3FTPA 1O94C 4MUNA 1PYGA 2RI1A 2O2IA 1EB8A 5I7EA 3C6ZA 3TCKA 3GFPA 2W03A 3WLIA 1CJKC 1SY7A 1W4CA 2EFDB 3WRYA 2PUBA 3OQIA 5AWFC 5BSHA 4IJMA 1VE6A 3GLRA 2LDXA 1N9KA 3NIBA 3CF4G 2WQ6A 5GZ6A 2ZM6B 1CJCA 4BNLA 4ON9A 3W7BA 1UJ5A 5F2NA 3IKVA 3L7NA 3IGFA 3Q6NA 2DU8A 1DCKA 2INGX 3C8HA 3CT6A 3DQPA 2GCPA 3GY0A 1RI5A 3MJ4A 1LLFA 1OY1A 3GELA 2GF2A 3H99A 4GBED 4KXYA 4XD7D 3VAYA 3CVYA 5JIBA 4KIGA 3DTYA 3QW2A 1G42A 4WNAA 4CEHB 3L7BA 1NP3A 1IBLB 3CLRC 1SCKA 1J09A 5LJIA 1YS1X 1UINA 3JQ8B 1NBOA 5EJAA 1QFXA 3V2UA 3HMKA 2MR6A 4WK0B 1XZMA 9ICXA 3M6XA 1ABBA 3SZGA 3ZBUA 1PQUA 4ENQA 1Q6ZA 2J41A 2ESEA 4P4UA 3SE7A 1T4CA 1YK1A 2QSJA 3IP3A 4KR7A 1BA3A 3BB3A 4D26A 1Z73A 1HDGO 1XK7A 4DAOA 1Z9BA 4EG5A 3IB6A 1FDUA 4ZOHC 2W04A 2YVLA 3UC9A 4DV0B 1MT0A 2W9CB 1PR4A 3WQHA 5MHTA 5DNAA 3NYWA 1XR3A 5CFNA 5JS8A 5EWMA 4M0FA 1M67A 4CLEA 3FSGD 4UKDA 3LWMA 5BVHA 3L8FA 2HMAA 4B6RA 2SHKA 2ZTLA 4Y6PA 3RVLA 1L4BA 1ZMTA 4NS1A 5GOTA 3ZDEA 4CQMB 4KI0A 2WJYA 2JZOA 4YPFA 5T3YA 1IG6A 1NUQA 4FFPA 5J0QA 3GILA 2N42A 7AT1A 4IG4A 4YP5A 5HF5A 4IZ6A 3PPXA 4DUYB 3R9XB 3PUWA 1KH1A 1SVSA 3B1XA 3G2OA 2JIDA 4B09A 1DMRA 3ZS9A 5ADHA 3BIOA 1JX4A 3OP4A 3KOOA 1JQKA 4L16A 3LCRA 4OXKA 1GU0A 4URUR 2VDLB 5BR1A 3CO5A 1OTYA 2O5VA 1ZICA 3TAXA 5CFZA 3T5DA 1DXSA 1T24A 3SAJA 4WUTA 4QZ9A 1C30B 3SQNA 3AF5A 4RWEA 1U4OA 2I4OA 1C30A 5K4AA 2J5KA 5CA1B 2ZFUA 3B7GA 4NYMQ 2WJAA 3ETCA 3RR7A 4N47A 2IDZA 4GC9A 2ZI6A 4BX9C 1F4LA 2L42A 2W2LA 4L51A 4LSZA 4RY2A 3U4GA 4C2BA 2J0SA 3BXXA 4Y2HA 4LMPA 4LUCA 4FNOA 4NMHA 4EY6A 3OFJA 4G36A 4R5MA 3RRGA 5CNIA 3OZRA 3FLBA 4MVWA 1CQIB 4WNAB 2VDRB 3CPEA 3ZZNA 3W34A 3D81A 5IPFA 2MSKA 5DYWA 4H7HA 1TEXA 4X92A 1SBZA 4MRMB 1WMBA 3QUCA 4G5GA 5ADUS 1EE1A 2QGZA 3M6VA 1GV0A 1E3SA 3GGGA 3K70C 2O0KA 4EPWA 5EJ2A 3TQQA 1OB2A 2YV1A 3NTLA 5E0KB 1DL5A 4CQLA 5LLDA 1I2MA 3WGTA 3BSFA 4JI3B 4OUDB 2VJAA 2VSOA 2PGNA 3OD1A 4P32A 5E2BA 1L6IA 3B2QA 2A5JA 1FYFA 1A4RA 1QK4A 1MAAA 1GZ6A 1XCPA 2NN3C 4DABA 4ZYTA 1O9GA 2BP7B 1XQ6A 2ZRPA 2R1TA 2H7VA 2K8CB 1N5IA 1WKCA 4HWRA 3TB6A 3K20A 5DM0A 4WDQA 2H0RA 1PFKA 4OAQA 3IMEA 1A2QA 3GFBA 4ZAWA 3GJYA 4L74A 1HLGA 3UZUA 3BXPA 4GOKA 5BR8B 3WLNA 5ALXA 4NS4A 4M9ZA 1XU7A 1H6BA 4BVFA 4J7UA 3R7BA 1P61B 3C2LA 1ZNYA 3O74A 3VC7A 1N63A 1G64A 3GG2A 2ENWA 3GLSA 2WQZA 3LU1A 3D4BA 3DVSX 1K6IA 3MELA 3MS7A 1XZQA 4LJ7A 4JBXA 1XRQA 3NP7A 5H83A 5DNCA 4FD3A 4B76A 4M8IA 4MGKR 3QSYA 3RF7A 4RHFA 2QTRA 5AK0A 8ICFA 1BKSB 2BFBA 3RH5A 1GCIA 1YVEI 3QYAA 2A0UA 3T0GA 1SXIA 2HV8A 2AC2A 2XPCA 1WHTA 3Q41A 4KN8A 4V38A 1R5OA 1P9LA 1IY1A 2V9ZA 1AHIA 1X1BA 2V6GA 4Q0MA 1X7GA 4BBJA 3F6CA 4RENA 2GEBA 5MF6A 2UV8A 3AEZA 3S2GA 1S6YA 1USGA 3DHEA 4OLHA 1UBFA 2P9YA 2LIPA 2X9GA 3VC3A 1QG6A 2EAPA 1QWOA 3T3FA 2OQ2A 2QTTA 2IV2X 1F2TA 1AQIA 5JNWA 1LDMA 4ED1A 4FC6A 2O06A 1Q7EA 3WIEA 2Q41A 1W6UA 4QIHA 1T8TA 4UCFA 4UJ5A 1JLKA 1KO8A 1Y1PA 2ACWA 2NPOA 1DK2A 2DTEA 2BMEA 4I7EA 4L76A 5BNZA 4M1OA 1JDBC 4NMLA 4BJQA 1M2OB 3Q98A 1GGMA 4WCFC 1T6XA 3NBAA 1J20A 2XZTA 4LECA 1OTHA 1SUDA 1CJVC 4K2AA 4XWOA 4BLOA 4JL5A 5F64A 1GNLA 1XELA 7ICIA 2MJLA 1ZQUA 1GCUA 3H65A 3QOWA 3DVLA 4QWWA 4RZQA 4ZHQF 2BQUA 4F6LA 3JQ9C 1G16A 2V45A 2R85A 4LJ6A 1A5TA 4M7WA 4XCVA 3T1YB 2DFDA 2AOWA 5EKXA 3LS2A 4ZALA 5FWYA 5JS2A 4MVJD 4BQSA 2ZYTX 4QEKA 3D2AA 4RPGA 1XCGB 1RFLA 5A7GA 5IT9A 2Z2YA 3SVLA 3BD8A 5CT4A 3UTCA 2ZZNA 5C1IA 2QLNA 5KVSA 2C8LA 4V0OA 5ETJA 4JBGA 4PAMA 1FTYA 3LZCA 4PO8A 2IX3A 2CC2A 5BSWA 1Z2AA 1ZYQA 1T8WA 1EH5A 1OFVA 2QD2A 3BE5A 3JWPA 4FYJA 2Q5EA 2EG9A 2EJVA 4ZQCB 5EJIA 1IPHA 5BR4A 1H2FA 2PJRA 4B9AA 2TYSB 2P2YA 1D2AA 1LB2B 1FB5A 2EATA 3LT1A 2OFXA 5TF0A 1D09A 3SEFA 5JS6A 1S7GA 2Z9DA 9ICSA 2H1WA 2KK0A 2OESA 2WM8A 3D8SA 3FKSD 4XR4A 4FWIB 3LHFA 4FN5A 4DYVA 1WZCA 1X7XB 4JSYA 1HE3A 4NIMA 2BD0A 1YL5A 3D2CA 4TRRA 4U7WA 3N53A 4WY5A 5HK9A 2OV4A 4FYXA 5JOQA 4A82A 2HNAA 2VEOA 4GLLA 1WSDA 2PK3A 3KU1A 2ZBEA 1OXKB 1NJ8A 3PW2A 4V1CI 5TARA 2OH2A 4TSKA 2FSGA 2QD5A 1ZETA 5EWLA 1FNCA 1U7UA 1Z6AA 2GBGA 2Q6KA 2RCYA 3JVUA 2PRSA 2B94A 2P6PA 2W2XA 3H2KA 4LRUA 4NZ9A 2NUAB 3N9IA 3FRIA 1XLTA 1I7LA 4E5NA 2J0UB 3ZOZA 5JSZA 2XVYA 4EZIA 4KJXA 5CRXA 1KETA 3GRUA 3JWEA 4WV3A 2CNNA 3SXPA 5L7TA 1AV6A 3DC7A 2ECFA 2IIPA 1MENA 1BVRA 1P0PA 1W30A 3U4HA 2IHZA 4GBJA 1ZA2A 5HIIA 3WFJA 1S76D 2GHTA 1WS6A 3OCXA 3RS9A 2VHCA 5CB4B 9ICPA 3G23A 4FP9A 4BX2A 4DR7B 4CT0A 1KRXA 3SAHA 1BXRA 4PGGA 4WQMA 1V16B 1YS4A 4EHFA 1U8UA 1GUYA 1L3IA 4ZMSA 5IUJC 5KTYA 3O4RA 4A8JC 1E3TA 1L5UA 1MTZA 5J0XA 1TK3A 4DLKA 3H5OA 2Q49A 5BSMA 3UJAA 3OE7D 2GAIA 4BBAA 3WGMA 3P27A 2Y0PA 5KHOC 3M8RA 5C5JA 3H6GA 4FYMA 4MMXB 5C4IA 1AM4D 1KL9A 3LUHA 3DZCA 8ICIA 4FR0A 4GYJA 4P35A 3N2GA 3JQBC 3M3HA 3K32A 5BUZA 3UXNA 1DIBA 1ZQ9A 5ALDA 1YE5A 4PRKA 1C0PA 4ECEA 5I7SA 4MIOA 2C77A 3DDWA 3BSSA 4YH1A 4EEYA 4W8OA 4REMA 4XD2A 1S89A 2I0FA 2OUKA 3E2EA 2IPAB 2VTDA 3BZWA 3B9BA 3FUVA 3MBIA 3B78A 3OIFA 1JLLB 1IEQA 1RWOA 4ED0A 3NEPX 1YFJA 3KOUA 1ZGCA 3HXPA 3A0BU 1D1TA 1OYYA 4EHAA 5DG8A 2I4MA 2JK0A 3OTHA 4XSHA 1EBUA 2NVBA 2YOGA 5F51A 4DUPA 2KMDA 1ADGA 1WVGA 1J2RA 1P1RA 2O1EA 3F97A 3LRTA 5DM60 5ICSA 4S1WA 1BDIA 1JPVA 3KFXA 3UICA 1JAIA 1M1ZA 3TVYA 1YZGA 2P6UA 3COVA 5EJ8A 2ICAA 4JXKA 1ZIPA 2Z4TA 1PVPA 3IOBA 3WGJA 3PUZA 3EJ6A 4A8HA 4N82A 2RFLA 4FBTA 1F38A 2ZB2A 3FZNA 4JU9A 2GOYA 5CLFA 3RFXA 4GDFA 3W7AA 4QGAA 1CR0A 1NL3A 5D51S 1BMTA 1YASA 4MVXA 3RUAA 1QANA 2R25B 4WZAA 1JQ3A 3BFJA 5EESA 2EZUA 3SX4A 3PCXA 2O8CB 3GH3A 3M8KA 2HBMA 2WMYA 1ZQEA 1YJQA 3S28A 3H0CA 4AKTA 1UJ6A 3DHNA 4F96A 3F74A 4US0R 1GKKA 5KFMA 2GKSA 2ZSAA 2G0AA 4NWIA 2ZYGA 5JTTA 1A7JA 3QWIA 4MOWA 5BW5A 3RC7A 2XITA 5LM3A 4DG9A 3L0ZA 1VLMA 1FUKA 2XBUA 4ABYA 3S1SA 4FINA 1ZA1A 2EL7A 3TTYA 1FFBA 4R8RA 3TTXA 2EAOA 1NM5C 4MHTA 2IXDA 2Q3JA 3U7HB 3D8UA 3OIGA 2ACEA 2WJ3A 3MJTA 4B74A 5DMHA 3E7FA 2ZR0A 2H00A 5LZ7A 5D3KA 4R7GA 4KQ1A 3EXG2 1B0AA 1CIJA 2EZ4A 3BERA 2Z7JA 3BWYA 4R0MA 2QN6A 4PHTA 1QU3A 4HAUA 3HDYA 1FDWA 1U1CA 1PL0A 4X8HA 5EERA 3DBRB 3JARB 1WW3A 5J2TF 3S6JA 1DOZA 4UE6A 1ZQSA 1GU1A 2J8ZA 2F64A 4TSFD 4DJJA 5A04A 1MRNA 1D1PA 3PFHA 4CIAA 3M1LA 3K16A 2J3IA 1H94A 1B1CA 3DLCA 3NT4A 4IIEA 2W8LA 3W5IA 2GYUA 1Y42X 3CVJA 1TQ4A 4G0PA 3P4XA 1UZLA 2QTWB 4P3XA 5KYXB 3W1WA 1CDDA 3E84A 1MJFA 2QAGC 2WICA 3EEBA 4POAA 3RUIA 4A5SA 1W48A 4AUNA 2X5KO 1K6MA 3EWIA 3EEIA 1NVBA 2QVGA 2FGJA 2CXYA 1U48A 2GXUA 2RGNA 4IRMA 5EXDA 2VOJA 5D3MA 2CZGA 5F1OA 4N9WA 3TEMA 5KC9A 3TI0A 2VQEB 2I91A 2A1TR 2EHJA 1G9TA 2QQEA 2GH1A 3OE5A 3QOFA 1JXMA 1NZJA 2WIKA 2YWBA 2Z58A 4OO3A 4QU8A 3TFQA 1T8YA 3TLBA 1BCSB 5AI4A 3HSKA 2NZWA 4RKEA 3AJRA 1LW7A 4RFLA 3O0FA 1TM4E 3QFCA 2OL4A 2QVLA 2OWDA 4GECA 2V6IA 3UIEA 4L9RA 4EI7A 5DGXA 2P91A 5BMVF 4YT2A 2PSEA 1XMOB 4EYIB 1CQZA 1XRNA 3H9EO 2ZTDA 1FRVA 2FFHA 2HRDA 1DO0A 1YO6A 5FFMA 3SAGA 3PWZA 1U5CA 1ZM9A 1M1YE 4EUSA 3VOAA 4MW5A 4PYMA 4KR9A 4DC0A 1V6CA 1P5ZB 4BWFB 2Z3ZA 5CW1A 4CL3A 1I8TA 5I9SA 1PEDA 4BJ1A 4E5KA 3VA7A 4PRLA 3O2JA 2AFHB 1YT5A 4EUKA 1QVAA 4BO4A 1P7ZA 4UNRA 3T94A 3UBMA 5LP6C 3LZDA 3DKRA 6PFKA 3MINA 3UAWA 2GARA 3ZY4A 2HNKA 3ROFA 3BH6A 1SXJD 3ZVKA 2BHNA 1FYXA 1BQ4A 4MUBA 1IB0A 3ONEA 1QH8B 2A4MA 1NU8A 1V41E 3LNCA 2NSYA 5FF9A 4GL4A 3M6LA 1Z6QA 3PXCX 4S3MA 2ZYRA 4F3RA 1CEZA 2Q27A 5C8YB 1W85A 1Z83A 2W55A 1ZQGA 1QHXA 3EZGA 4FNAA 5G3ZA 3RW9A 4TRJA 1KJYA 2Q7OE 1Z29A 3LXRA 3TZ6A 4L0CA 4DCNA 2R7KA 2A58A 1ZUNA 2RHMA 3A9UA 5FOQA 3IAAA 4ZV9A 5EMJA 5EIBC 1XZJA 1LI7A 2NG1A 3H2IA 2J0VA 2RGAA 3P52A 4L0MA 3W4KA 1MX1A 2W98A 1E7QA 2JCBA 3HBLA 4G09A 5GIOE 1NFRA 3MC1A 1L5SA 1V25A 1MORA 4CEIA 1XSPA 1Y7IA 2QTMA 2RSLA 2VNKA 2H2HA 1LV8A 2PJUA 3Q9SA 1FFHA 2PFSA 2YFQA 3IHKA 9ICHA 1V5IA 2QX4A 2QUAA 3AETA 3RU2A 5DK4A 5JZMA 2YZKA 3WMXA 2UUPA 2EARA 2HQRA 1NLUA 2BFPA 1EUDA 4N6GA 4ZAGA 2IV7A 3SKYA 5EIXA 4HDRA 4WCDA 4MDYA 5HHIA 4W9NC 3DPIA 1X1CA 2IP2A 2OCXA 2A0WA 3L0DA 4U2KA 3ZQ4A 2ZCUA 4EFNA 3IEVA 2XUFA 3MJRA 1P9WA 2HT6A 2Y9MB 3NBKA 4MYUA 5KCMA 1YHZA 4WJ3B 1P31A 5T4BA 4JV5B 3AF2A 4NFYA 3ZE7A 3GT3A 1NMXA 1ZD4A 2W7TA 2GEUA 3B1YA 4UVGA 2W70A 5KSOA 4ZJPA 1KYYA 4AP6A 1U1IA 2HK8A 3L0BA 1ACLA 3AWIA 5DNUA 1XXHE 1ESCA 3ALRA 4HWSA 4MYTA 1MB0A 2K8AA 3DEZA 3MXTA 3B2NA 4Y2RA 1L4LA 4LK3A 5DM4A 3ZX4A 2L0XA 4XJSA 1N60A 3K71B 2Q3FA 3MBYA 1L5VA 3DMFA 4XRRA 2BFWA 1UFOA 2WJGA 5TDHA 3U7QB 4C76A 4EKEA 3RTVA 1NJWA 5BOMA 3M6KA 3LVVA 2UVWA 1X7WA 1CLUA 2ZATA 3PP8A 1YR6A 1DHRA 2LKCA 2H4JA 4M7RA 4PLPA 3MJHA 5EJ6A 1TAHA 3FYHA 1TO6A 1DFHA 3K9GA 4GE0A 2V4MA 4Q9DA 4S2UA 2YCLA 4QNMA 5IN4A 2CFIA 2YN0A 2HK7A 5AI0A 5HWSA 2PMBA 4DOMA 1TADA 1BS2A 4ZGBA 2CXNA 1WB4A 2O20A 3ID6C 1W59A 4U7CA 2PH3A 1LPPA 2NTYC 1LXCA 2QYOA 4AUMA 5JY1A 4AYWA 1QH1B 3OZ7A 4HGOA 3UCXA 5AVJA 3GVXA 2HM7A 2GXQA 1TIPA 3KYCB 1PWEA 4HUQA 5AUNB 1HR0B 4OHYA 2JGLA 3KQPA 3V3KA 4QKQA 5KNLA 4PL2A 1VB5A 1PD0A 2B3DA 4GXKA 2VT2A 3CH6A 4Z7OB 4FHEA 4BNUA 3AERB 5J8YC 2B7LA 3CUEF 3F1LA 3NHMA 4TSRA 5GY7A 4ND6A 2WT8A 4ID9A 1FFYA 1NRXA 1L0BA 2XGMA 2EFEB 5TF4A 1SIOA 3TNDA 4L0QA 2QRPA 2GZRA 1TYAE 2WUDA 2D5BA 2PM8A 1QG4A 2QD1A 1Q84A 2LRHA 2XH8A 4JMUA 1LDNA 4G07A 2FXIA 4LCJA 1AUQA 4P5PA 4ZRMA 3TDMA 1GPAA 2I6FA 4AT1A 3DEKA 1FP6A 4US8A 1XP8A 2BGNA 4GYWA 4MI3A 3KUKA 3U44A 1VI6A 1VJGA 1WAMA 2XMDA 4OBXA 4QTXA 1I7NA 2O23A 3PR5B 3O91A 4Z3DA 2CYAA 4F06A 2Q7DA 1NK0A 4WXPA 1EEXB 4B46A 2ZS8A 2OOKA 1X3LA 4KQ6A 1QC5B 5JTUA 1RI3A 3BJIC 5E8RA 3EPPA 3JQAA 2HF7A 2WE7A 2O8VA 3A1WA 4FKZA 1DXHA 1TOAA 2YTZA 1XGKA 2XGGA 2XQKA 4MKXA 5KFOA 5CHYA 4CLDA 2OZPA 3PPVA 2RC5A 3QMVA 5GPBA 3ZS8A 1KA9H 1FJGB 1GGFA 3FFTA 3SIXA 4YMWA 4AMBA 4ZH4A 1G6OA 4LDJA 1H38A 3MT9A 1QO0D 3THVA 3EC7A 3HPQA 5DSZA 3I72A 3SSNA 1Y0BA 3BKXA 4QUEA 4C9BA 3K8OE 5FPKA 1TK8A 5L9XA 1XTUA 3ROMA 2LZ0A 1PI3A 2AFRA 1Z0UA 2XVTA 4FS3A 1WZ2A 5CVCA 1VOTA 2AFHA 3ITNA 1KSJA 1W8DA 2X77A 2H2IA 1JTEA 4W4TA 2X3FA 2PUCA 3A6PC 3D3WB 5F76A 3MYYA 4Q66C 4RU1A 4O5CA 4ZZ1A 3I5UA 1X80A 1XROA 4II3A 2EWMA 5KVAA 1JR3A 2Q6LA 2AEEA 4BCCA 4UVHA 1Z0FA 5JCPA 2VH5R 3EFOB 1OJ7A 3LBIA 3ZJTA 4Q4DA 3E70C 4GBGA 1CY2A 1Z74A 4BMPB 1USVA 3M9OB 3UAVA 3C28A 1Z38A 3LT2A 3FHTA 1SB8A 4L3VA 1YMUA 4LJ8A 3AV0B 1W19A 4J3FA 1MH9A 5IIMA 1W0JD 4JYZA 1F9AA 4TT3A 4MFFA 2OHOA 3NR2A 2IWHA 3BTVA 2FPGA 1KARA 1FP2A 2W90A 3ZBTA 2VNJA 3I73A 2HSGA 3OTQA 2IY9A 3UQ0A 1KDYA 2OMKA 5KTRA 2CGEA 4C7ZA 1CR6A 2G0NA 3COSA 4JT2A 5I48A 3CZQA 3PY8A 2D1RA 1SCIA 2H85A 4IFBA 1R1DA 4R2HA 4WGFA 4A8TA 2FVXA 4MKRA 4OSOA 2I34A 3VYRB 3KJEA 2AR9A 3O7WA 2CLOB 3AWDA 2QBYA 3H1GA 5JHHB 5CLLA 1CUJA 3FJYA 2FDCA 5FA8A 3ACBA 2X13A 3PZPA 2HMTA 5TY0A 1ONPA 2O2HA 2XVMA 3BX1A 5JD4A 2X5NA 1V5FA 1RTKA 1RZ3A 1Y7PA 2CL6X 2NXCA 1SC9A 2VCHA 2OWEA 1UBCA 4HMOA 2WM3A 4IUCS 4M7PA 4KN5A 4U4AA 5IAAA 2HQSA 3ENNA 3PWTA 2YY6A 2QTCA 1Q0LA 2BUBA 2GSWA 2QT0A 4H3HB 4TVOA 5L6MB 1SCUB 2B5VA 1ZQIA 1Q15A 1SCDA 5K0TA 4UPVA 3V4PB 1XDZA 1NG1A 3PEFA 2VWPA 1QXSA 4TTSA 1BHSA 4I6EA 3EDOA 4WXYB 3EGXA 2PRKA 2ODAA 2ODNA 1KI6B 1Z5PA 4ZQHA 4CV1A 1XVVA 2GD6A 3JPYA 1QF9A 3JQFA 3NEYA 4ZVNA 1G291 1NY5A 4J0EA 1L9XA 2Q5IA 2NRZA 2BI4A 2ONZA 4MYRA 1GRRA 1GRNA 2HTFA 1FLVA 1JTVA 3D4IA 4GGMX 4PYLA 1OLSB 1S3SA 4Q8FA 1XG5A 2C5AA 2ZP1A 3C5EA 4DQSA 4GAEA 1P81A 1ZI6A 2ZYDA 1S9HA 3G5TA 3SVTA 5GM2A 1QV9A 2M6SA 3C5WP 3PKIA 4XIGS 5EE3A 1D04A 1SUCA 3E22B 3C8MA 1BHQ1 3RTEA 2ZPUA 1SQ0A 4FGKA 4GX5A 4HAIA 2HDNB 5JO0A 5FQNA 5BRJA 1MQ8B 1WDTA 4RE5A 1NVUQ 1E7SA 2Q4RA 3I9FA 4PBRA 3FAKA 1UDBA 2WIGA 3TEFA 2R5NA 4TTIA 3QWHA 2F77X 1CVIA 2WJJA 3JQEA 4DTIA 5HEKA 1J7JA 1RBZA 2IYEA 3H5TA 4AK9A 1ATIA 5JNTA 2OZEA 2DERA 1KY4A 2YUIA 4IEEA 1Q0RA 2ZRFA 2I4TA 1YZLA 2GPNA 4LE0A 3ZWQA 1U7TA 2BGTA 5JH7F 1FYDA 4CF6A 3DDHA 1FFUA 1GNPA 1JYEA 2O3RA 2PVCA 2UZ0A 3FWHA 4KP7A 4YC7A 3JSAA 3I1JA 4FLFA 5TLSA 2BFAA 4JLSA 2CW5A 1RSZA 4RLQA 2Z8YM 3U80A 1SBYA 2GBCA 1ZHFA 2HA6A 3OKPA 4U63A 1KFEB 1HFKA 2E55A 4M89A 5EEGA 2ENUA 2HZBA 4F56A 3REGA 3BIWA 3C2MA 2OCPA 1UXGA 3MRXA 7REQB 4KITB 5F2EA 3HWWA 4J9VA 4KLGA 3MCWA 3RCBA 4XUSA 1XO1A 3B8EA 3UUFA 4DCPA 4WPGA 3QXGA 4YRMA 1KJJA 2ZAMA 2WU0A 3EULA 3IPCA 1RWKA 5AKEA 3IR7A 2C5HA 1EFCA 3C1OA 3ELUA 4EG1A 1V1JA 3MS2A 4UEWA 2XWBF 3KTAB 2F67A 5DI3A 2P3OA 3ISVA 3W6NA 2BR3A 3A1FA 4CCAA 5IJ0A 1I6WA 4WN9A 3RJ5A 3WXBA 4QNNA 1VRWA 4F5NA 1U1DA 1YR8A 3R0XA 1CWUA 4MLDA 1D0SA 1DJQA 3DTVD 4UAUA 1GPBA 4RFSA 2ZAGA 4JYBA 5BN4A 5LYJB 1H6DA 3HYSA 4Y1GA 1B6GA 2AG5A 5CX4A 2IBSA 1KKXA 1G20A 2R00C 4IUDS 2OA0A 1NAIA 3U1TA 3ORFA 3VNBA 1SFRA 2X5JO 2Q2NA 3W3ZB 3IPYA 4KNYA 2EKDA 2JHCA 5CFOA 2Z09A 5HKOA 3DTVA 3R0VA 1U1GA 1U0RA 3I39X 2OHGA 1VL8A 3AY0A 5ADVA 1ZP6A 4UM7A 1VIDA 2WPDD 2PO7A 4NMXB 3FY4A 2XY6A 1JLSA 3H5LA 1V97A 3IVCA 3LPLA 4UD2A 2CUZA 2DR0A 4JUFA 3I3SR 3NHSA 3UH1A 4RQ4A 3D54D 3Q3EA 5AW4A 3SC2A 1KSHA 3OX3A 1A9PA 1BWRA 4Y2GA 1JSZA 3W9UA 1PV1A 1WP4A 3ETRA 2DPGA 1I33A 2VUIB 3U5ZB 4NLLA 1KAMA 4CDRA 1CUUA 3H42B 5DX1A 3TVTA 4CIYA 1FFVA 1SR8A 3QVMA 3V9AA 2DG2A 2HJHA 4OB8A 1Q0QA 4PBSA 5FNVA 2FG5A 2IEZA 2D7CA 2M98A 2XGJA 4QYTA 4CEIB 1MO2A 2F43A 4QC2A 5B1IA 5AW0A 1JYFA 3K9BA 5IKOA 4E70A 4UB4A 3QZ7A 1KE1A 2WYOA 4CQMD 1UKEA 4D3XA 1C9NA 1B8OA 3RARA 1JQDA 5KWJA 2FN9A 1DBPA 1NKEA 2GPYA 2WDZA 1HY3A 2XUZA 2AN9A 3HFRA 3CZ9A 3B2EA 3CR7A 3F71A 3SE0A 4C5AA 5KJ1A 3C3MA 3BF8A 1VXRA 4P4LA 2XNDA 4TROA 1FBTA 2EFGA 2GTPA 5I5GA 2EJCA 4R51A 1E8NA 2H59A 3D6VA 3FVTA 3FGZA 4C0AC 5I51A 2SKDA 4CEJB 4B9EA 2I87A 4E12A 2HYDA 2CMDA 2PUGA 3C74A 3PGKA 2BW0A 1IY9A 1RC1A 1RQRA 2AKEA 2FFQA 5KAMA 4PLGA 2FPPB 2LW7A 5CLQA 2NU6A 4KXFB 4ZPXA 3FWPA 4M36A 2H2AA 1KQNA 3R24A 3VYSB 5AKKA 3WYNA 1S8NA 4OHCA 3KC2A 5AW2A 4H9GA 2MSDB 3TZLA 1HMPA 4KNVA 4JVLA 5M5BA 5CDHA 4DS5A 2PD6A 4Q4AA 5K0LA 2Q5FA 4UNQA 1TC2A 1HWYA 1DRWA 2HSJA 2R68A 3CLVA 4IQ4A 1TMOA 5FFFA 1IN4A 2YJ3A 4OQEA 1G8GA 3V6KA 1PJBA 5KFTA 2PG3A 1FVHA 5DTRA 9ICNA 3UK6A 4AMUA 2JG3A 4I55B 1HTBA 2ZRCA 4OI4A 2BY4A 1NW4A 2JFVA 4QUGA 4LWPA 4RZ2A 3L6DA 1HC7A 1XZCA 4OP3A 1P1BA 2NSHA 1DQSA 4TV8A 4NZMA 2NNWB 1LSSA 4C78A 4JEHA 3DFUA 4BY9E 1OW3B 4HXFB 2AL7A 1G1MA 2RHRA 4FE7A 1JHAA 3HCCA 4MQUA 3U37A 2W4QA 3DAFA 3UMJA 3C0KA 2X4LA 1UJNA 1G55A 5CDUA 1V3UA 3KDSE 1KH2A 2DWOA 2GESA 2QHXA 5EMLA 4ZVMA 2DECA 1SQ6A 3JQPA 4ENTA 2Q4EA 4RSHA 4OD0A 3EA4A 4TM7A 2QROA 2C3UA 3WRVA 1VYUA 4NZPA 4YN4A 4JQOA 4ALIA 3BQMB 4BWMA 2IUUA 3NZEA 4NECA 2Q3MA 2HWKA 2IDJA 3DJFA 4P4OA 3TARA 3B6IA 2HXGA 4KBGA 4TKUA 4TLDA 3QU7A 4P2HA 1KYIA 5IBQA 4W5QA 3TANA 3T5AA 2HT1A 5T41A 5LYJF 5HFNA 5B66U 2G5PA 1REQB 2BCGY 3FOZA 1GTJ1 3SDSA 1NW9B 3N8DA 2HRRA 4OK6A 4RF4A 1ZXLA 5HUJA 4LBZA 3KKNA 1SRQA 4MKFA 6GPBA 1J39A 3D4PA 3D4NA 3HZZA 4G0YA 1E1YA 3DS8A 4MYCA 1M10A 3IT0A 4YALA 4PYIA 1U2RA 3JRXA 1MRSA 3WMRA 1U3WA 4BJHB 1C9DB 1Y3BE 3NO4A 4CHTA 1XKTA 1RYSA 3W2HA 1CZUA 4JP2A 4R2JA 3RWMB 2FLKA 3OZSA 4CM4A 2WLTA 1Q50A 4ETIA 3ZDCA 1T8EA 4TV9A 2E7ZA 2ASVA 1WD7A 4D9HA 5C31A 4B9SA 2PKYX 4Q01A 3VJKA 4BKRA 1KVQA 2VHTA 4F8YA 4RANA 5HF9A 1A1SA 1K98A 1EQAA 3U1BA 2D7DA 1QP8A 1O1YA 3REOA 5AI9A 1JEQA 3GLQA 3RS2A 5J0TA 1M2HA 3SQOA 4YLYA 4O2BF 1G7RA 5FBZA 4R1TA 1OTXA 2BTOA 1FJXA 3HWRA 3OZXA 5JCJD 2E2WA 1E1RA 1UPBA 4V1CA 1WPGA 1KMQA 5T6MA 1NW8A 5HQ3A 4H31A 4H6XA 4N54A 3O8RA 4URYR 1ECJA 1JL3A 4K8OA 1J8DA 3WMWA 4E21A 1JBKA 4EW2A 2EJUA 5CVVA 5LZ5A 1VL5A 1N5WA 1EFUA 4KLHA 4Y67A 2C1XA 1RZTA 3FOFC 1KTVA 1E2FA 3FNIA 3A6KA 3C1ZA 2WQ7A 1LW6E 1MBZA 7ICSA 3QENA 4OUKX 2Z1NA 3FTQA 3SJCA 1SBHA 4IV5A 1G41A 3QPUA 5H5JA 4N5HX 2FPXA 2DGDA 4RQ7A 5HHHA 2BPGA 4UXHA 5CNMA 5K51A 2VPQA 1KFBB 5REQA 3PUJA 3GMSA 1D1SA 2QRVB 2JARA 1N2OA 2OHHA 3MTBA 2GTIA 3EDRA 4OH1A 1NQXA 1E58A 5HR6A 1VPWA 1DCFA 4GWLA 4MQEB 4U39A 5ARDA 1KQPA 3VUEA 1QTMA 4RVDA 3DTNA 3K5IA 1F8FA 1G6HA 5FPSA 3TI7A 3JQQA 3Q8KA 5LIPA 1M5UA 3BRQA 4P7KA 3T5CA 4B6QA 5I5EA 2PMFA 3QW4B 2NQ2C 2AHRA 4YMIA 4DGSA 3ACCA 4TLBA 3P2EA 4ZZ3A 4TZ0A 1MVLA 1UAGA 3WKCA 1LC3A 1NUSA 2O14A 4JFRA 4BKMA 3HK2A 1L5RA 4CMGA 1V5GA 4UNNA 1QF7A 3B51X 2Z2ZA 1BU8A 4Q9KA 3ZD9A 5HQJA 3TO5A 2EFYA 2ZRAA 3K5PA 4FCVA 1WUTA 1F14A 4PCVA 4X8MA 1SCUA 1ESEA 2G82A 2QLBA 1SXDA 4QJIA 4QPNA 1MOPA 3S2EA 5EJ5A 3GJ5A 3JARA 3O1LA 3L4JA 3FLMA 5F5XA 3SOZA 2COEA 2NO9A 2I4RA 2FETA 2EEZA 1BX3A 1BS1A 3ST7A 2HOQA 3WK4A 4J0FA 1XA0A 1A88A 3E22A 1X1SA 1RMQA 3CC8A 4CT4B 4I8XA 2IUTA 4S1TA 3IBTA 4EDFA 1Q1QA 3I6BA 5E3IA 4WESA 2GLUA 4M99A 4PPFA 4JI5B 1JKJA 1DAEA 2PL3A 3MCAA 2FWRA 4OM7A 1AKQA 4ZI3A 5L45A 1GKYA 1RPZA 7MDHA 2HEIA 1L5YA 4HATA 1MV5A 3L1KA 3UMMA 4FJ0A 4GX1A 1VJTA 3O8OB 1AA9A 3O5AA 3SHWA 3OSUA 2VLBA 2P9QA 4JC4A 4MA4A 4PQYA 3IQFA 5JAMA 5DTEA 1G3UA 1D9XA 3ECSA 1DTWB 4TOIA 4HD8A 1PEYA 1PGJA 2FHPA 4WZAE 5JHGB 1H23A 3HXQA 1A9RA 5KFXA 1IONA 3I2YX 1QV7A 3C3JA 3QHPA 1P18A 4LVCA 3B3GA 1WCYA 4DQVA 2B4YA 1EIZA 1ORTA 3HJNA 4L4XA 1U98A 2JGFA 3L84A 1G3QA 4QQ8A 4CIXA 5CPBA 1LPMA 3B5JA 2CVPA 3CGGA 3O8LA 5HMMA 1AK1A 2Q7XA 3P8ZA 4GS5A 4IQ0A 4CZ2A 5AI6A 4F9GA 1WF3A 5JS7A 1PVRA 2AW3A 2P68A 2VHEA 4W82A 2P27A 1C7QA 4QNLA 1Q7GA 3DDCA 4G85A 4K05A 2R8PA 3BT7A 3P2KA 5LKAA 4HH3C 3T5LA 1LZLA 3WQBA 2ZXUA 1KVSA 1JXOA 2ISPA 5JLJA 5K6AC 4XLLA 3M5DA 5DTJA 4A92A 4X61A 3UT6A 1IL0A 2BZ1A 4IIJA 3ZU6A 1RWVA 3AFHA 4DG8A 2G3YA 2O3SA 3X2SA 3TKYA 5J47A 1Q20A 3G1UA 4PZLA 3FPHA 2A9OA 3V8EA 3PHJA 5B6PA 1UXKA 4NFSA 2KIVA 2JJ2D 3C5GA 2V59A 4KO4S 1J0DA 5JISA 3B3QA 1WHSB 2I99A 3UWOA 1BAPA 2X8JB 3WO0A 3VFDA 4YGYA 2B6NA 2WHYA 4FQ7A 4TLLB 2WB1F 3NEJA 4AO6A 4DLLA 5B64A 1I2CA 5KHAA 4IUYA 3G2QA 4MW9A 2RRDA 4C8NA 1L3UA 1R12A 1ZS9A 2FSHA 1USUA 2HL6A 2RP5A 3LLSA 4J7AA 4QDJA 5IIJA 1VKHA 3MQ2A 4H4DA 4GOXA 4YBRA 4B8YA 4FFBB 1XE3A 2OZKA 3DV0B 2C2XA 3L1JA 5BQFA 3UYLA 2BZGA 3MAJA 3C3DA 5BWMA 2O8EA 2EW1A 4YP3A 5EIFA 3SNHA 5LMUB 5ES3A 1X9XA 4P0QA 2XYRA 3Q6IA 4ENPA 5DWVA 1SD1A 3C6KA 1GGEA 2ZIXA 1R0BA 2PT9A 3P0HA 4WZBA 4D3ZA 1UBLS 1XUOA 1R5BA 4Z0NA 4HDNA 2C28A 3SYKA 5L1JA 4K4IA 3RB4A 4NP6A 4BFXA 2NYAA 2HK9A 4QZVA 1XDDA 1MQ9A 1DQYA 3WKEA 2CXQA 5K0ZA 1CYEA 4TKLA 4WASA 2KSOA 1RI4A 2FN3A 5KJEA 5KFEA 4UZFA 3GA0A 2R6CA 3PT9A 4G5FA 2E5WA 1LK5A 2B4QA 3GJ3A 4DIOA 2WJ4A 4CETA 3FTDA 5TRTA 5EOVA 4Y18A 2Q3HA 5TPZD 5LDDC 4B2YA 3U44B 2GBIA 2X0DA 1H4VB 2GTHA 1DUIA 4TVSA 3WZ2A 3T1TA 4DV2B 1JH9A 2WSBA 2XXJA 4G1BA 4D44A 2C4HA 3HNRA 3MCZA 1QMPA 2ATEA 4MAAA 1XTSA 3CTMA 3I4FA 4JC0A 1LI4A 2JLYA 3GFRA 3WHLA 1S01A 2ZRGA 3ZG6A 5EHXA 3G02A 1V6AA 2WFLB 3AUKA 3OPQA 5EXPA 5LQAA 1BYUA 2GILA 3IT2A 3KUDA 4P7FA 1CVRA 1OCEA 4H1HA 4CUJA 3DO6A 2JW5A 4CCWA 3L7MA 1M72A 2FP4B 4YRLA 3TRKA 4AN1A 2DJ5A 2DZDA 3MIZA 2EBWA 1H3FA 4QRHA 4X7MA 5HFJA 4E6PA 1EZ4A 5YASA 5J4KA 2CXSA 4LRQA 1QWSA 3A05A 2JPDA 2K4MA 2FPPA 3NBQA 1KDZA 2QN3A 3LPDA 1TAUA 3PX7A 4BCBA 5B36A 5CR0A 2C99A 4IFTA 3SFZA 1NONA 4CFZA 3RHFA 4CMIB 3HP7A 1S9FA 4JWKA 1NMZA 4RPKA 4F92B 4E4TA 4MW7A 4NG4A 5BXYA 1PGQA 4MAMA 3A2NA 2HWXA 3DWEX 4JLUA 2IC5A 2XVZA 3VO9A 3QPDA 2QLJA 3ROQA 8ICGA 3D2BA 3GFTA 1FZTA 3PFGA 3UA3A 3SYNA 1D7OA 5D6OA 1NSFA 1CQJB 5DHQA 4GM4A 2WF8A 4ZCLA 1P9RA 2VL7A 4CTNA 3QJGA 2F8MA 5THXA 1KK1A 3G5LA 3NVVA 1CSEE 1NVEA 1YOVA 4HB4A 4KO8A 4UBKA 2ZEJA 2E8PA 3GJRA 4GPZA 4YRJA 2Z5VA 5CNJA 4GR9A 4IGIA 4UQOA 2WWGA 5EAIA 3EQZA 4DA7A 1RZRA 3JW8A 1NJXA 3GLKA 2HA4A 2I67A 4LQDA 4EKYA 4LJXA 2E1PA 4L7QA 1G9SA 4INZA 1A97A 2HH9A 5ENDA 4FBGA 4O1IA 2H2FA 4JP5A 3EZLA 4DL4A 1ZFNA 3CNEA 1PLKA 4Z8XA 5E79U 2LIVA 2XCQA 1UZMA