4P0PB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna, and mg2+
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
328
structure length
278
Chain Sequence
RMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 278
sequence length 328
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0pB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0pB01
1J23A 4BXOB 1J24A 2ZIXB 2A1IA 1J22A 2M9MA 4BXOA 2ZIXA 4P0QB 4P0PB 2JNWA 2JPDA 4P0QA 4P0PA 4M6WB 2ZIWB 2ZIUB 2ZIWA 4M6WA 2ZIVB 2ZIUA 2BGWA 1J25A 2ZIVA 2BHNA
chains in the Genus database with same CATH superfamily
3FDSA 1SCNE 1EJ2A 1V26A 4YCCA 4DSZA 5H80A 2FF7A 5LMZA 4U7DA 4AK9A 5KINB 4IFTA 1VSTA 1X0XA 2VPPA 4U9IS 1ZIXA 1PJSA 4ECEA 1Q22A 1VL5A 4RQ1A 1OZFA 3LE8A 5A3SA 5FA5A 1I6MA 5IJ9B 3GV5B 3RQIA 2VAVA 1KDTA 1A4IA 5JYEA 4NBRA 1Y3IA 1M34E 1QNFA 5BUCA 1VDVA 2ZI6A 1PR1A 3V72A 3KRTA 3R9XA 3A0BU 4RDXA 1WW3A 3N7UA 2CPRA 1F17A 4C89A 2TSYB 4ZXPA 1M34B 5BQXA 2A7QA 4ZOQI 1L7NA 3WDKA 3ZJYA 3E9DA 2WLSA 1I3MA 3V6JA 1IQ0A 4KLZA 3GCXA 1P0PA 3OJWA 1IULA 2X0FA 4BO2A 3R3YA 4R41A 3D8NA 1Y1PA 4PHCA 3E8XA 1DADA 1V85A 1U7WA 1YH3A 2IIPA 3QV1A 1YQWA 2R2AA 3EOBI 3MUEA 2DKZA 1R0WA 1O54A 1I36A 4GFJA 1XBTA 2X5OA 4PPQA 3OECA 5AVQA 1KAGA 2FFJA 3EFBA 2V7QA 3KX2A 4ZCSA 5JS7A 1OX5A 4DA6A 2YZGA 3RSQA 1RLJA 2YV5A 4KXVA 4OV6B 1DCFA 3A2MA 4IINA 8ICPA 1VJ0A 2RGGA 4BCCA 2VN8A 4WOPA 5IZCC 2IH5A 1E58A 2GBCA 2GJ9A 3OZDA 1U63A 3DONA 4LVOA 3L5OA 4KN7A 4E22A 1M2EA 8AT1A 1Z68A 3QU7A 2HQRA 4O2LA 3THWA 5KNCD 1WCNA 1BTOA 4X62B 1IAVA 1E2PA 2E48A 3HB9A 1JHRA 4MCIA 4ZO9A 3U1VA 4U2GA 2H8KA 4PU0A 1ZOIA 3CRXA 2JHFA 4QKQA 2NVUA 1BGXT 1WB4A 3H4VA 3ETDA 4L22A 2R6R1 1X7YA 3PKJA 3FWYA 5K6TA 1AHIA 2IS2A 4UB3A 3T52A 2QRVB 1S0MA 9ICWA 3W9SA 4C4AA 3F5QA 3HL4A 3B8EA 1RXWA 1ZUNA 2WYHA 1EVQA 3TW4A 3ZHXA 3N0VA 1OAOA 3NDJA 4CCAA 3J81A 3GEIA 4TTAA 4WZZA 3BRSA 1YBVA 1PZEA 5IXSA 3RJ5A 1FNCA 1LK5A 4J9LA 3W5UA 3W7VA 1YVEI 1OIVA 3D3EA 1IE3A 4JLBA 2D8CA 4W6ZA 3TE7A 3L7IA 1Z4OA 3H2JA 3O4FA 3C6KA 5IAEA 4OH1A 4RABA 3D6TB 1ZSVA 5DASA 3B3QA 4OHXA 1JAXA 3MWDA 2CE2X 3DLIA 4MI9A 4A2CA 2QB1A 4B83A 3SHTA 3T5PA 3PEFA 1REQB 2HA6A 1CUWA 5CDFE 3ENQA 3JQ7B 1E4EB 4BOYA 2O5VA 4Q05A 3EPRA 1ZINA 3FSEA 2W37A 3R41A 3FPBA 5EZ5A 4E12A 4L75A 1BX3A 5JXJA 3U80A 4BE4A 2B69A 2WHPA 1WCV1 1DGSA 2AC4A 3VTFA 3T0IA 1HEUA 2OEPA 4Y6LA 1JRPA 1XHEA 2IYEA 4RUAA 2VHQA 3BXPA 1JB1A 1C0LA 3IAS1 2PD6A 2ID4A 4HY3A 3ELWA 5JASA 1ORHA 1NBHA 4YRNA 1NBAA 4MHTA 5BVGA 3DR3A 3ZCXA 3WNBA 4BWFB 1OT3A 2GNOA 3ROQA 3MAGA 2BCUA 3EEYA 1XD8A 3BGOS 1ZHOA 2EG9A 5FF9A 3MTDA 4GSKA 3PVCA 4E6PA 4WI1A 4X9XA 1M2VA 1VP3A 3WGVA 2BWJA 2KSOB 5LQSA 4OLBA 1LV5A 4BVJA 1XIVA 2VRBA 3RTEA 5T14A 1XC7A 4BZXA 5KX5B 3TQOA 2HFJA 4XVQA 3D4PA 3CUTA 3P9IA 2CK3A 1EFHA 2VJCA 1DBRA 2R8PA 4IVPA 1BVRA 2VHWA 4MJXA 1QG2A 4ZCPA 3LWNA 3CKMA 4FFMA 4EYGA 1KZ1A 4I2VA 5EOVA 1XMSA 2DCMA 2JJ8A 2X9QA 5MGNA 2PKWA 3S8YA 3QH4A 4LY6A 3LQKA 4AI6A 4BX9C 2OC9A 2GCGA 3RNOA 3KDAA 2ODNA 3QBEA 1ZIPA 4Z7OB 2J8ZA 4QG7A 5AJXA 2AYYA 4ARUA 3ND6A 1GGFA 1S01A 2PJRA 2ZT7A 2AQ8A 3ISBA 9ICUA 3FFXA 3K2IA 3PSPA 4BEWA 4WERA 2VOEA 4FYXA 2ZR9A 2CLFB 2C0PA 1T0UA 5GM2A 1RHUA 4EGAA 4PHAA 4I4IA 4B7UA 4LZJA 5KOJA 5CXQA 2I6UA 1TRHA 1N7IA 1KAMA 2XNJA 5H8WA 1NW8A 4I3HA 4UHEA 3H4MA 1U0SY 4YUWA 3LRPA 4AKHA 3V6HA 3AJ9A 1RU3A 1WRBA 3A27A 2B0CA 2DLDA 2NU8B 1EDBA 3I6IA 3R44A 4QT0A 4K1LA 2AVNA 1EGAA 1WBDA 1HEYA 1JT2A 1TKDA 3JSXA 3GK3A 3I9MA 3H9BA 4IG4A 1LVUA 4LYFA 1ZQKA 1XSNA 1P77A 1K7FB 5K0CA 3G0CA 2QP3A 4C0ZA 1CR4A 3B89A 4MYCA 3F6SA 1QLHA 3UJPA 1GQRA 3L18A 4FLFA 1DDGA 3GT7A 5F64A 5DT9A 4M22A 1YCHA 3HYRA 4MR8A 1PZNA 1YBAA 2Q5LA 2X8LA 3W1WA 2B1RA 1CLEA 5ALJA 9ICLA 3AGPA 4R6WA 4EA6A 3IDZA 4R1SA 4RK1A 3DP9A 3E8SA 2VDOB 1JG1A 1G3IA 3EASA 3VPHA 4HDQB 4RTMA 2VP9A 4HWSA 2BFPA 4WXMA 1FNBA 3HU5A 3DXFA 4RVHA 4B6EA 2VFAA 3IMCA 5IEBA 2AEFA 1S2NA 4DEXA 2B83A 3UMFA 4DMRA 4EKGA 4QPDA 3VYUB 4CEJB 4I46A 4G01B 3OPQA 1ZH2A 2IEDA 2GAAA 3QLUA 2CHQA 3NGXA 1H69A 4C6TB 2ERCA 3PW7A 5I7VA 1A7KA 2BPOA 7ICRA 1ZZEA 3B5EA 2R6DA 4YREA 1QYXA 1A1SA 4IHJF 3QXXA 5ECDA 5AR1A 5JCJD 5AMXA 3HXMA 3OE7A 5ALQA 3DAOA 3GVIA 5BUZA 3TNDA 3RSLA 3PX7A 3K9GA 4CT5A 5LBIA 1F2UB 4OHBA 1YD7A 4NABA 5G0VA 3PW2A 2XDAA 3O6VA 3LZDA 3JPNA 4QT4A 4RLSA 3S2EA 4B7XA 3PDIA 2PS1A 1QR2A 1GR1A 5BR4A 1BS9A 3JR7A 4JEIA 1ZR2A 1XDBA 4FFPA 2EZ9A 3GN1A 1LI4A 4EELA 5J0RA 5J9FA 2VQ3A 1O03A 3N75A 4KLGA 1E1DA 1WCYA 2BEVA 2NRZA 2I8LA 1YR7A 2VCEA 1UPHA 3HM9A 1YU6A 1TZBA 1O4VA 4DOAA 2B1QA 1SH7A 2EGHA 3BH7A 2HO4A 2AHRA 1GL3A 4U2DA 3T5AA 5IXJA 1C8LA 2I0FA 1L5MA 2RIPA 3STVA 2BEJA 1KZHA 3FOCA 1D4OA 3TH5A 5CVCA 1NKBA 3AU8A 4MDYA 1SC9A 3Q8MA 1UBOS 1ZQVA 3RRBA 2HJRA 1ORVA 2BFAA 1AF4A 2C03A 2FMFA 1I7SB 3SZUA 5KL8B 1SL1A 3S40A 1NNEA 4C4YA 3ZBTA 1AKNA 2OZVA 1LSJA 4FFBB 5DXJA 5CFNA 3BTOA 4OOEA 4YCBA 4LWPA 3K4PA 4WKGA 1R8SA 4P38A 2A1JB 1EJBA 2JFXA 4UFPA 2HLHA 4XH9B 3M9WA 4V0ME 4YLGA 3D3QA 2ZIGA 3DB2A 4ZOCA 1B73A 4J2TA 4Y0AA 2CNKA 2V5UA 3DZCA 3MR5A 4GXNA 3PSAA 4EECA 1EJ6A 3DZIA 1FVXA 2FN7A 5IX8A 3MA0A 4EYQA 4MWCA 9ICHA 4EIWA 3C8ZA 3K8ZA 4TVBA 4QUKA 3EG5A 1SV0C 1W36B 3RB0A 1L4EA 4C4XA 3DT6A 1EDOA 5BVHA 1QYWA 5FBVB 3L7YA 3P5BA 3UICA 3V55A 1U7PA 1G18A 4DJTA 1B1CA 1ANKA 1E6CA 5AJYA 1NOKA 1HWYA 7ICOA 5JW6A 1Q14A 2V3WA 3A31A 4WK4B 4O1MA 3G49A 1LF5A 5DHUA 2XSZD 5AKYA 5C8YF 4JB3A 5KT3A 1E9DA 5L3ZA 2FUNB 3PDCA 3RTGA 3AXTA 3U4DA 5ILQA 3MCAA 5CNKA 4KTTE 5A3VA 4BJ6A 1GCIA 1GHTA 2QJRA 4V3BA 1FYFA 1NTRA 3WLEA 4C07A 2POCA 1NQWA 1ZXXA 3AUOA 3PF9A 3ICCA 3LTNC 1IBKB 3KKZA 4QAQA 5BN3B 4LHVA 3SYKA 3EZYA 4UXJA 1MXFA 4J0CA 2G1JA 1D2CA 3JAWB 1HC7A 4O5KA 5ITSA 3K9BA 3HHEA 2N1RA 4MUIA 4KKXB 5DB7A 3JATA 1XYGA 1LJLA 4NR0A 3NTQA 5ECWA 5J2JA 1KPGA 2Q3LA 3N7RC 2UAGA 4OXKA 4CLXA 4C4OA 4OSOA 3ABRB 1G21B 1XZCA 1VYVA 2V3VA 4ZEXA 3ZYZA 4CDMA 1JFLA 3KOMA 1TJ5A 5EJ6A 4G0OA 3T06B 4FJ1A 1LLCA 4HDSA 4DBVO 5EMHA 1Y9AA 2DVMA 2GZ2A 3LP5A 1AT1A 1JHXA 4OGWA 4BYGA 2QUZA 4RVCA 4YJHA 4B9UA 5CA1F 2WWGA 1J5PA 2H1HA 1T43A 4H4CA 4RNMA 4UB2A 1F0PA 1LTQA 1HK7A 3V8RA 4XD7A 4BFZA 1YC2A 4HBGA 1VLBA 1TEZA 3FJ1A 1X42A 7ICLA 1J2UA 4BAZA 1UM9B 4L2IA 3X1XA 3DULA 5KB3A 4W8GA 3VR5A 2RK3A 3VHQA 1P9LA 1Z22A 2QMUA 4KMSA 2VPIA 4OAQA 3VOSA 2ICAA 4XSGA 5CXXA 1XX6A 3PEWA 1C2TA 3VC2A 4JFRA 1V47A 2L2QA 5SYNA 5H16A 3P2YA 2WF5A 3FF4A 2QP4A 5K8TA 2FMPA 1VP9A 4L74A 4EBEA 1GN8A 4IFEA 3QXGA 2C4MA 4E2WA 1IL0A 1TIPA 2UUCB 3M33A 2JHGA 4NE9A 1X1DA 3G3EA 3LBNA 3AKDA 1VE9A 5JECA 3F7OA 1D0IA 5GTHU 1N63A 2Q1WA 4E1VA 3O8NA 5B3KA 3ICPA 1O3YA 1UJNA 1JSXA 3BF7A 3ICXA 4G8BA 4M1SA 2A7XA 2XYGA 4RNNA 1CR6A 2RHDA 1NNSA 4GXQA 4H3KB 1C4WA 2JKVA 3ODGA 4JQOA 3LDHA 4D99A 3IXMA 1X0VA 7ICMA 3BFXA 4CMIA 3LUHA 4FEYA 5TMBA 3U7QB 3FPAA 3THSA 1PV1A 3L0OA 1D6JA 2V65A 4G0WA 9ICXA 2VXCA 2LBOA 4DDKA 4DFPA 4NOLA 3CF4A 5HW0A 1ZKDA 3MPOA 4AAYA 1B23P 5IULC 3S70A 5I4KA 3QPBA 3N2IA 3ZJ5A 1VKZA 5TQVA 3A36A 2KLHA 3PQ4A 3VISA 4R01A 3G0IA 3S1AA 4YJ2F 4Y2JA 5AM2A 3LBIA 4CCSA 3TCKA 1DARA 3PRHA 5DM70 1QGDA 3ZNPA 3OD1A 5DIZA 1EESA 1MX3A 1FSSA 3TRJA 4RA6B 2XY6A 3R5HA 5LU8A 1HH4A 3BCUA 3QVXA 4TKVA 4IJKA 1PBNA 2IQ5A 2X9GA 3C7DB 4O4HF 3K8OE 1CEQA 1OPXA 4OHMA 4QZDA 3KB2A 4HNTA 1O6ZA 3ZZNA 1E3JA 4JBGA 5JTIA 1AJEA 1ZS9A 4ELTA 3TRIA 2MT9A 4WKOA 3MPUA 1FDVA 8ICCA 3RT7A 1EFDN 4HNSA 3TJMA 1F12A 1WQ1R 4AT1A 3A4TA 2CVOA 4HX9A 3IV7A 4ER7A 2PX4A 3OFSA 1Y98A 2V0GA 3DTVD 4NAHA 4PFQA 5BSRA 2IWRA 3LUCA 4DREA 3C3PA 5JNVA 5G0UA 1UBUS 4AQDA 5C4GB 2BONA 3FVWA 1TZCA 4AJEA 2PPLA 6AT1A 3RFFA 3WGGA 4QHYA 4UBBA 1ND5A 4L3OA 3H1TA 1YOVB 3IESA 3K0EA 1US8B 2PWZA 2EIHA 2BFOA 3BG5A 5EJ9A 2AMLA 3LK6A 1ULAA 3SJZA 3FPCA 4LPKA 1QDUA 4AWXA 1LLQA 3GIIA 1FLVA 2ZAYA 1DOZA 3IEIA 4NFSA 3TOCA 5K3SA 4HDAA 4WN3A 4ZWNA 1POWA 2E4ZA 1UADA 2XUOA 4UAZA 5K51A 3GILA 3GDFA 3LYUA 4K40A 5CDUA 4MJ7A 1PVRA 5IM4F 3WLKX 3OLCX 1DSSG 5ITWA 4TTQA 2GM4A 2XUIA 4MVXA 4EB8A 4J90A 4Y2TA 1EE9A 4I5EA 1IXKA 1F2VA 2QJFA 1A5BB 4IWXA 3BMCB 4Q3AA 2PWPA 3MGVA 1FMTA 3GCGA 3DXYA 3LCJA 2G0TA 1UJ5A 4OXRA 1UWKA 2V4MA 1NY6A 1H8ED 1WHSA 4ZOLA 1SL2A 3UXMA 4GDMA 5F33A 1XS9D 3DDCA 3L93A 4DV0B 5ADUS 2QSJA 1J90A 2G9NA 2H59A 3C3JA 2VQFB 1H0RA 2O8CA 3NHAA 2EATA 3AV0B 4OMUA 4A2PA 4DRYA 1COWA 1R6XA 3IRVA 3L46A 5HIKA 2JPDA 2JANA 4AULA 3ZY2A 2HUNA 1TTHA 1XTRA 4WCVA 5KVQA 2BV3A 4UU0A 3Q41A 5F9NA 4W5JA 4DY4A 3MJEA 4BIMA 5LBUA 2QGZA 4B6JA 4QLOA 2VT3A 3L43A 2YINC 2C77A 2A35A 4MO2A 3GZ4A 1BVYF 4MW1A 2OZPA 1GILA 4R3UC 1KRPA 3OA2A 3MTAA 2G80A 2C1EA 4HYQA 5ALTA 2QAIA 4U5XA 5LMCA 3TBHA 1PJRA 1VG1A 3SHQA 1LZKA 4IYRA 2QN9A 5K3FB 1ZXIA 3EFEA 2RGNC 4R2MA 1NN0A 4RTRA 4I1SA 3H97A 4E0DA 1K7YA 2RHLA 5ETJA 1R37A 4KJZA 4LF5B 3I6QA 4I28A 3I01A 5DTQA 1JR2A 4FE4A 1NAIA 5ENVA 1YA4A 2XMQA 4NFYA 4RVOA 4BECA 3OZEA 4IDOA 4JIMA 3WHIA 4ZVKA 2DQSA 1X2EA 4NYJR 2LXNA 2Q2WA 3IVGA 3NTVA 3PLNA 3DGEC 1Z15A 2VYQA 1L7RA 2Y0PA 1FDIA 5SV2A 3THWB 3TM4A 3FTFA 4B8WA 4O4LF 4GLBA 3ZVNA 5KYWB 1VZ2A 2G40A 1P2UA 4XYGA 1QF9A 2GJ4A 4FHCA 5DJ5A 3BMOB 4LJSA 4QUHA 2B4KA 2QD2A 4NZZA 3CPHA 4JJFA 4Z6DA 3DFMA 2PXCA 5E7MA 1L7BA 5DX1A 1TCUA 3IG8A 4QQNA 2DHQA 3RF7A 1EI9A 3AEQA 3V7UA 1YACA 3PD0A 2ZB8A 4F06A 3I32A 3DTYA 4DLTA 2EZ4A 5DPMA 3BVPA 3H18A 3D8TA 4Z4QA 2C5GA 4EGJA 2OKGA 5IIJA 4BC0A 5AJUA 2GXQA 3O0FA 2OILA 5FAKA 4RF4A 3R3HA 4B2PA 4AMGA 4BO4A 3FLBA 3ZE1B 2ZRBA 3MR2A 3IVMA 2XB8A 3LLCA 3PT9A 4NPHA 5M29A 4ECYA 2W8KA 2E7ZA 2HB6A 3HJEA 5K03A 4N8DA 4ZQGA 3SE7A 5GY7A 2D7CA 4F56A 5HJ5A 4E70A 2OKCA 4UXHA 1EAYA 3OQNA 3RVLA 1E6EA 5JSZA 2EWWA 3VVLA 4GRDA 2HU8A 2XTJA 1Q3UA 3Q3CA 2M1XA 1EE2A 5DULA 3QPDA 2NVBA 8ICAA 4K03A 4WXEA 4MHVA 1QH8A 2UYHA 1R6DA 1LPMA 3FMIA 1JAIA 3RUHA 3V9AA 1P9RA 2RG7A 4NWIA 1MEOA 4DV5B 1PRYA 1SOWA 2R8EA 3I3OA 4NJ8A 4BO6A 3GCDA 5DW0A 3X1WA 2K4IA 1P60A 4X6UA 1VLLA 1PR5A 2RHFA 2XBUA 2FNAA 4RACA 3QF4B 1CUHA 1SKAA 2G5TA 3UJ9A 4FFNA 2JATA 3GA5A 1U1DA 2XMRA 4B0PA 3G2IA 2KN7A 4C03A 2GFQA 2FW7A 1ORRA 3MSCA 4WNAA 5FBZA 1L5VA 4J16A 4MEJA 3ENKA 1OA0A 3ZWWA 4HXGA 2X7JA 3CNEA 2YJ3A 4PLYA 1Z5GA 1A76A 2E8PA 3KHRA 4NHOA 4Q1EA 1XWWA 5DLFA 3PNYA 1I3KA 2J9ZB 3OJUA 1IJEA 2JKYA 1E2DA 2OQRA 2JKZA 5BO5A 5EWMA 2P11A 1HA3A 1KZYC 3HU2A 2PQMA 2UUPA 4Q7MB 2QOEA 1HQCA 3IOCA 4URYR 2WR8A 2JG3A 1N6NA 3H17A 5F2EA 2AZTA 1NVWQ 1OH6A 4PWZA 2W4MA 4ZQCB 5DE3A 5KWEA 3U4QA 3FOFC 1COZA 4F2RA 3CINA 3I0NA 1KE2A 4Z7NB 1TQHA 3RRGA 1R16A 1XJ5A 5DRTA 3HN2A 5KVVA 1EBFA 5TPZD 3QYPA 3E1KA 3TB6A 4HSGA 1Z6TA 1RI1A 4JGBA 4MS4A 1GU1A 3RAGA 4EUEA 1CUYA 1EUDA 3K9WA 1N9KA 4ABTA 1E3MA 3UT5A 3RAXA 4X92A 1JXEA 3UXHA 4IJWA 2ZM6B 1JWLA 3EVCA 2OOKA 3UG7A 1FRQA 2ARKA 4WASA 4GGPA 2BELA 1GUAA 2DY0A 2O2XA 3TOZA 4JDPA 1GTJ1 4Q03A 4M98A 3EHEA 5HCNA 1ZOLA 1O8CA 3BTUA 2V6GA 5G1NA 3SXPA 1XTTA 3UK6A 4K9OA 4ZYVA 3EXHB 1UUFA 3F6EX 4JBHA 3C8UA 5G3ZA 4QOGA 4ZO4A 2WUEA 2EH9A 3RAQA 5DLDA 1QWSA 4DJFC 3SC2A 4IVRA 5BPCA 4ATNA 4TUQA 1U8XX 1Z29A 1LW7A 5DH9A 1NVGA 1GUFA 5EEGA 5JZ9A 4MNTA 1RRGA 3OA0A 1GKLA 3RRNA 4RTQA 3LFTA 2XOKD 3G0GA 1UK8A 3EZ7A 3LWBA 1CEYA 2GETA 5KX5F 2O2ZA 4ZVRA 2OQIA 4JV1A 5IRCD 1ZGCA 3C5WP 1IY0A 4MIOA 1XZDA 3I01M 2P9BA 3C3MA 2VHYA 1GKKA 4B48A 2GZRA 2ZUBA 4TL6A 3GG9A 2VG8A 3NXKA 1XLUA 5LPNA 1X77A 2IYVA 4LGVA 4B2YA 1TKCA 2ZSUA 1Z38A 3NO4A 4LECA 3M6LA 1UF9A 5B66U 4G37A 2JFQA 1UZMA 1EGHA 4MP8A 3BX1A 5M3BA 2BT4A 3COSA 4OYRA 1ODSA 1DIOB 2ZSKA 3W1VA 3GT4A 5I7RA 4MJ3A 4LSZA 3UMGA 4UM9B 2P0AA 1KYIA 4ITUA 4YNBA 3RJZA 1HZJA 1SFRA 1SB9A 4B3TB 2XNSA 1NK6A 3PQ8A 3TTYA 4PQEA 5DBGA 4U2BA 1K3TA 3RREA 3UFXA 1BN7A 3F2VA 2G7ZA 2ZRNA 1J4AA 4X1YA 1FDRA 2BEVB 3IUNA 8ICMA 1Z33A 1OFTA 2X19A 4TTJA 3NVMB 4M0MA 3OI7A 4TZ0A 4UVIA 4XQCA 2E82A 4AKSA 4QODA 5JY1A 1QP8A 1NZJA 3U4MA 4US2R 3OC6A 4Q0MA 2P40A 4J0IA 1GEGA 1FRFS 4B6FA 3AL3A 1K98A 2IH2A 2IVFA 1ZGHA 3PLAE 3IMKA 4CLHA 1Q83A 2BCVA 3LLSA 1UPBA 2ZROA 4P80A 3IE1A 3G9XA 1NK4A 4QSHA 3GNLA 1QKKA 4JQSA 3PNPA 4ZN6A 5INTA 1XL1A 4IDDA 2PDAA 4DRZA 3T5LA 3UAOA 1FP4A 2WWWA 3IIIA 4XWYA 4G3XA 4J75A 4HEA6 5DW3A 3OPYB 4ESVA 3RHTA 3WNZA 3EA4A 2O1XA 3IAAA 1YI0A 1UWLA 1P5ZB 1OI7A 4PO1A 2OCGA 1OLSA 3FNBA 3WBFA 3LBFA 1W0JA 2J87A 4ECVA 4RGYA 3L1UA 4DC0A 4WINA 4GMGA 3W6NA 4BKUA 3DBRA 4O4JB 4GBJA 3DDSA 1PS8A 2Y67A 2A1UA 1BHQ1 4M37A 5GGYA 2REBA 1I5RA 3COWA 4X61A 4XB6B 1GRRA 2IRWA 3CYFA 1USWA 4Q4LA 3WK4A 1RQXA 1SUWA 4OQXA 7ICPA 4UAYA 1Z6ZA 5BVHB 4M83A 1HM5A 1G2OA 3QU5A 3S2FA 3GJ4A 4II7A 4M9CA 4BNZA 3VKWA 2GDZA 5JEEA 5EYPA 5K0GA 3FMFA 4C2BA 2RH8A 3N6XA 2PL1A 1KJIA 1RYYA 1U3WA 4XQGA 5AW7A 4HFJA 3GFSA 2R84A 1YQUA 4P98A 4YDHB 2R5FA 4L85A 5C5EA 1JR3D 2AR7A 2ZAMA 1MTZA 2AXPA 3QJ5A 2WA2A 4N0DA 2FSUA 2FA9A 1TW3A 2H7CA 1E5TA 4KSBA 4KRFA 3CO5A 2TMDA 2WV9A 5ICFA 1NRJB 1XCJA 4X97A 1WTCA 4RPJA 2HSEA 4GRIA 3C15C 2YQEA 4QO8A 1ZIYA 3N5CA 2I34A 4FUTA 4OP1A 1NZBA 4FYKA 1JDVA 2VJAA 3C41J 3KZMA 4RX1A 2QR5A 2FMQA 2H6EA 1UFQA 3D43A 4AG6A 1Z7GA 3PE4A 3ZXSA 5CCXA 4N48A 2R8YA 2NYAA 3IHWA 4C3OB 1WU8A 1IQPA 2CL0X 2ZSFA 2YZ7A 3H3JA 3KJIA 4F2DA 3EYZA 2JJYA 3SJAA 1RPZA 5D01A 3RT1A 3CNOA 2IA6A 3GZTB 2Z1NA 2PGLA 1L3SA 4QU8A 3SI8A 4TUYA 5BQPA 3N3AC 3KQQA 1CTQA 2CXSA 5E9AA 2P8SA 3ZV6A 4I66A 4N3GA 4GM4A 1LV7A 3JQ8B 2G17A 2AF4C 1NJ8A 4UNSA 5LCXA 4FILA 2XUZA 2IHUA 4P3NA 3RSCA 4K9PA 4L15A 1H65A 5HF8A 5DCYA 2PM8A 1NJ1A 4XVHA 4XEUA 3DZBA 2R8ZA 4G2TA 3UIEA 3CIFA 4D9BA 4RVSA 5DG7A 4QU9A 5KQLA 5HVNA 1QF7A 4KREA 2J0UA 2LYAA 3NM4A 1RYBA 3DOIA 3DWGA 3L0DA 4MAMA 2I87A 2GDJA 5K0FA 3C3CA 1UBKS 3RLFA 2PH1A 5AW6A 4G0VA 1BJRE 2E3JA 3HBFA 3UKJA 4EJSA 2AN4A 2F3QA 1T4MA 2DBZA 1IZYA 2RHOA 4BV9A 3EGOA 2N1BA 3PVSA 2FR0A 4O3OA 5CDTA 2I3BA 4GIBA 4FT4A 1FCJA 3OLXA 2IQIA 3DEHA 4OGGA 1RZVA 4XTRA 1GA6A 2ZRCA 2CZQA 3HY3A 4CMIB 1EGMB 3ZGVA 3G7NA 4R1MA 4GXJA 3RC1A 4D6PA 4OMFG 5A4AA 4HGYA 3JAMA 2K2QB 3R8FA 1IYZA 2IODA 2I22A 1PUJA 2I4TA 1P2GA 5TS3A 3W2IA 4EARA 3ND5A 2SCUA 1FUIA 2WKQA 2EXXA 4B8ZA 2G6TA 2CJYA 3CLRC 3WWOA 4RJLA 1NRXA 3G0OA 4DSFA 2QK4A 4MQLA 1P8AA 3RCBA 3DQZA 2Z3VA 1XO1A 2WOOA 3REQB 3VDQA 3TLAA 1VE7A 5SY9A 2D0DA 3O26A 3HADA 1SXQA 1BROA 2YVAA 2B2XA 3EEOA 3KR0A 4MQ6A 1QO0D 5IS2A 2C57A 1MX5A 5GPBA 2FJUA 3ZZMA 1YQQA 3L4PA 4DL4A 3O84A 4NBNA 2R86A 4CTKA 3Q3GE 2NYVA 3NWJA 1Y5RA 1BKYA 3IR6A 1LZLA 2ZVJA 1X2IA 1C9DB 5DWVA 4RTOA 3TEJA 2JLWA 1E3WB 3R3UA 3FWHA 3AERB 2XR1A 2E8NA 5HS6A 1EWKA 4TWZA 4EY7A 3IEPA 3MCUA 3NUZA 1E18A 1C3LA 4Q01A 3GROA 4UE6A 1H6CA 3DFKA 2QLBA 2WAMA 4Z7QB 3FDIA 2YWEA 1YV9A 2XQGA 1X8LA 1SIBE 4MO9A 1M7BA 3KQSA 4QWCA 4O4IA 2V54A 3Q9NA 3UK0A 4QGFA 1D2EA 1QG4A 2PO5A 3HXQA 4ARAA 5JY6A 2R7AA 2PH5A 4BNWA 1WX1A 3U19A 1KAQA 3OFKA 4RIHA 4QYIB 1WKBA 1FFWA 1ID8A 4Q3BA 4BUCA 2B21A 1ZPDA 1Z25A 1M9NA 3ILYA 4EFDA 2C3UA 1MA7A 1XN1A 3BDAA 5HNKA 2ONCA 4GR9A 1LC3A 2BGWA 5E6UB 3ZTWA 4QOEA 3LY5A 2IEAA 2P1DA 1Y3FE 1BE8A 4KQ9A 1MW9X 2A67A 2CXNA 1ED1A 3O4RA 4LC9A 2NXCA 1LLFA 4MRVA 3W77A 3F5DA 1N6LA 4BCBA 1W8DA 2ZRPA 4QFCA 4U0JA 1Y9JA 1MZPA 4JV0A 2E5SA 4UDOA 3Q7SA 4FFSA 1ADJA 2VP3A 3D1VA 2X9VA 2EWVA 3A3NA 4DSUA 5C0YA 2OXRA 1AK9A 1BN6A 4AJ1A 4DLPA 3F6PA 5C8XA 1T2AA 2PLRA 5TLSA 1AMUA 2YY7A 4LC0A 2C8KA 3QNUA 1W4AA 5BNFA 3MD9A 4KC0A 5JFOA 1A1VA 5J4HA 4L8LA 4GG1A 4PG8A 3PC6A 3IBSA 4LFCB 1OI4A 4FD2A 3CXUA 3RR8A 1ES9A 3X1KA 3CUKA 3OIDA 2IYYA 4AY5A 4ZEMA 4KIFA 1U9LA 4LYHA 3CLUC 1RRKA 2JCSA 2N47A 2BBSA 2QT1A 3PFFA 3UBMA 1DQRA 5JAIA 1BAPA 2NRWA 2BP7B 3R23A 4S0ZA 1ZC3A 1TMKA 3FX2A 5JBNA 4GECA 1TMOA 3H04A 1VL6A 1OTHA 4HEA1 3D4IA 3C3EA 1VC2A 3OKFA 1UOQA 4MKXA 3VJLA 4B9AA 1T5OA 3G6KA 4E5VA 1V39A 4QOJA 1FYWA 1FFVA 2ZIUB 5LU9A 2WB1F 4NNPA 4ZVVA 2G5GX 2ESRA 4QD3A 1J97A 4ZPXA 4GOND 3B6EA 3RSHA 1A5TA 4RZ3A 2ZS9A 1OYVA 1DX4A 1U8CB 4L3WA 3ZN2A 3PWTA 4HLNA 3C5FA 3WLSA 1DKMA 3HO1A 4R65A 1HUOA 3IT2A 1ZQUA 2DBRA 2VK4A 5THQA 1U11A 4CG0A 1K5HA 1I3CA 4N3NA 5HF9A 4D9IA 4ZYYA 2PX3A 3ASUA 3GGSA 3RS4A 4S04A 4M9GA 4XDGA 1RJ9B 2P9TA 5CK5A 1Z2AA 2J09A 2VO1A 3CE6A 5LYYA 5JO9A 4UHDA 4LQCA 3BZBA 3WB1A 2AWNA 2QW8A 2OGSA 1T3NA 3I9KA 4FEGA 1O08A 2GN8A 3OLQA 4C5BA 2HHHB 2NVWA 1F7VA 3BQ7A 3RRZA 4DV4B 5CD1A 3PKIA 2FOLA 3H40A 1S77D 2BFNA 4M53A 5SY4A 3N0RA 3WYDA 3IPAA 1K88A 1QHGA 4KLOA 3O21A 5CK4A 4BGIA 5HGJA 2IPMA 1FX0A 3PKZA 5A0LA 2C61A 2PNJA 4O33A 5A5GA 5AVXA 3D81A 4TKUB 4KR3A 2W6IA 1NK7A 1JYFA 4KXWA 3HGMA 1J5XA 1YJ8A 2PFPA 3JVEA 4US8A 5C80A 3AEQB 2RGRA 3H1FA 1QRDA 1YJXA 1N0HA 3GP5A 5DO9A 1HE5A 1PFWA 2ORIA 2RBEA 4J9UE 2XXBA 2WICA 4B85A 4ND1A 1YQGA 4OQEA 1WF6A 2QSZA 3GXOA 5DG8A 3NIBA 1GNLA 2EVWX 1U2SA 4M87A 4LWZA 3CU5A 2PUTA 2CEAA 1L6NA 1KVRA 3GMTA 5I01A 3RUIA 5ALKA 4DC9A 5KWVA 3D7KA 2GCNA 3NBZC 5DGDA 1NI5A 1TYCA 2JIRA 5CB8A 3VZQA 5BWBA 1CF9A 3B9QA 1Q95A 1VJ5A 1LFDB 3AINA 4H6XA 3BCRA 1OBVA 1GNQA 2ZIVA 3AFIA 3G5UA 2EAUA 1QYCA 3FCCA 1KP3A 1BH2A 1THZA 1QH8B 4U5QA 1VM6A 4QFDA 3WYBA 4XDZA 5DM4A 3OIGA 2I8AA 2N1MA 2XCSB 4OHPA 1QCKA 2ZU6A 1HFKA 1LB2B 2IUFA 4BE9A 1CF2O 2ZAOA 3M3HA 3I30X 2JLYA 4URWR 2WD7A 1PL7A 3LLUA 3RC3A 3DLHA 4OK3A 4ECTA 3MTBA 2HJVA 4YMGA 4RGBA 3SS7X 5SZKB 2PCLA 4XM2A 1AURA 3KXDA 1FFEA 4TLDA 4BEVA 3O1HB 3IQGX 3JYQA 3SZ3A 4QVKA 4H0CA 1U2DC 1EK5A 1VJCA 3KE9A 3GJZA 5HRCA 2P75A 5LLSA 3AWIA 4PXSA 4HRAA 3HEBA 3DZKA 3I0MA 1HKUA 1YULA 2IZOA 4FX2A 1X1TA 1YS9A 5FADA 1LRJA 2YNMC 2WSMA 5EXSA 2E3TA 5MN4A 3B1JA 3WJ7A 4P7JA 3PZRA 1P5HA 3UV7A 3AMVA 3SLRA 2IYTA 2QT9A 1KZ4A 4ZQFA 1QSSA 3FF1A 3TB4A 2IUTA 4EZ6A 3NASA 1OIXA 221PA 2JGAA 1WCIB 2N9UA 2BISA 1NJ5A 3W5DA 2IHKA 1RRVA 5JNRA 2QTGA 2Y1LA 3IE0A 2C07A 5GP1A 4NMHA 4V2UA 1IM4A 1PIWA 1BXRB 5FIUA 1XWFA 4ALLA 2PLNA 1E2BA 3U4QB 2OAP1 2PFNA 1PK1A 1MB9A 2RB4A 4JQCA 2WUFA 4D4GA 3WLMA 1B6TA 4H7EA 1LDGA 2Y1XA 5TQ2A 3SLKA 4B17A 2NW6A 1MAVA 5IFLA 2IYXA 2DWCA 3QHAA 1RHKA 3INGA 5FQOA 3CVYA 2DPLA 4MS4B 3BL5A 5EJ4A 4QZ9A 4JX8A 3PEVA 1EUDB 2OECA 5KS2A 4YCXA 3UT5B 3IMGA 1X9WA 5FKJA 2CYAA 3FKJA 7ICIA 3V8QA 1CBUA 5FPQA 2P2NA 1UJBA 4KO3S 4DSEA 3KEOA 4MA0A 4YRPA 1WEKA 1ZVQA 3EYWA 3THYB 2YY6A 3DYVA 2R3SA 3B82A 4PHTA 2AC7A 1IN5A 3LECA 3P71T 2AFIA 3DEZA 2AHOA 4X91A 1R4MA 1T1IA 1W5AA 1HLDA 3TGPA 4DQKA 1SPXA 4ZAVA 5DSZA 3DV0B 3DWEX 4OQLA 2ACVA 4EH1A 2XUQA 4MUMA 1RI3A 1FTQA 1C3XA 1X14A 3SC2B 1WUIS 1OC2A 1N34B 1KQQA 1UPAA 1CQJB 5KSOA 3VNSA 4K0RA 3UXEA 3KCQA 1VPDA 1DAFA 5TT1A 4TVSA 3SVZA 3MJHA 3NETA 4CM3A 3K0CA 1WA5A 4C3VA 3KETA 3JQDA 5JG7A 1T8PA 4DGSA 2G1AA 4IIDA 1N2SA 4FNMA 5J58A 5DEOA 1CB7A 1R7RA 1EP1B 2J85A 1FLNA 1GG8A 4FMBB 1TK8A 4PIMA 5HKLA 1TA9A 5ALUA 4DR6B 4M6WB 4MX8A 4YEDA 4JT4A 5ADHA 3CISA 5C5JA 1WWVA 5C5DA 4QGBA 2CSUA 3HDVA 2QZZA 4CLOB 1KYXA 3EXFA 2EKDA 1Q1ZA 4FZRA 1IQUA 1MNQA 2R8GA 3FAKA 3CJTA 4YDQA 2OZLA 1M33A 2CLMB 2CLLB 1WEHA 2HV9A 2UXCB 2J08A 2QN2A 2ODGA 5LIPA 1IXRA 5JHGB 5KYNA 4H6VA 3WR5A 3WA7A 1NHGA 4YPFA 5BQ3A 2BR0A 1V8PA 2VA8A 1JHVA 1ZQQA 4BV2A 3LUAA 3VI3B 3UB4A 2D8MA 3E23A 1Y6QA 3KLPX 1G8PA 1HEIA 4W1RA 2JAQA 4EK9A 3TDMA 3PO4A 1Q1AA 5KCZA 2EX0A 3WLJA 1FE8A 1KFSA 1T0JB 3V1LA 4RU9A 4BRUA 1JX6A 1PNVA 1RC0A 3UFXB 1C5KA 3HR7A 3SYTA 4ED9A 3DNFA 1NXSA 2I2WA 2OCPA 1PR6A 3RVJA 3AR5A 3JPOA 4C2UA 1E9CA 2YN4A 1KC1A 2WP8J 3QKSB 3EIHA 4W7IA 2REXB 1OIWA 1JR4A 5I6DA 1RHRA 4JJ6A 3K7EA 2FN9A 4QTZA 3R7LA 3AR9A 3HKEB 1INLA 4LRSB 1L8QA 3M6VA 3ADOA 4RESA 1KSGA 5BNTA 3AB3A 2BMVA 3QKTA 2RAFA 5C81A 1N8KA 5ARCA 3ZLJA 1K8QA 3HR4A 1ZWKA 3R3WA 4XD2A 4IR1A 3PR3A 3HXTA 3U39A 4F3OA 1LDBA 2EJCA 3NFYA 2PWAA 1ZISA 2R8KA 1CR0A 4F60A 3IP1A 3A1NA 1SQFA 1OWNA 2J5KA 1FP4B 4Z7JA 4DLXA 1VKNA 2ZE5A 1FFDA 2NV2B 2PRJA 1Q2XA 1W8IA 3HK2A 3I4CA 1F8XA 2PKEA 1QJ4A 1TU3A 3Q12A 2YZKA 2F8LA 2X2OA 1DQPA 4IJ5A 1EFPB 1WVGA 1L0BA 3D8UA 4YMUA 4P0QA 5JD4A 2Y1OA 5IKXA 4M1ZA 4F5EA 2XQJA 5EMJA 5A3RA 1FZTA 4KUHA 1PKEA 3AL2A 2PS3A 4DLSA 4ZHQB 4FB5A 2X0NA 4BXOA 3HCDA 3FR8A 3TVTA 3KJQA 2F3SA 2HLDA 3TTWA 1NKSA 4TQAA 4QOHA 2XV1A 4ID3A 1S0NA 4KWHA 3OLZA 4B31A 3O03A 4A0GA 4JYPA 3Q5EA 4GXTA 2K60A 2BRUC 4USAA 2Q6LA 1CUKA 2F59A 1BKSB 4UATA 3W8DA 5IMBA 1UPTA 1M7HA 1N0VC 2J4FA 1K9VF 4Z2AA 4S24A 4J6FA 3PCTA 4LJLA 2VT2A 4I19A 3Q8QB 1P5RA 2EZTA 4BMVA 4ECSA 2V4UA 2AXNA 1TIKA 1VJDA 2V7XA 1V9CA 1V8BA 5F73A 3PB3A 2VP2A 3C6YA 2B8TA 5DMHA 3LX8A 2UKDA 4AMZA 1MV5A 5E9WA 2O3UA 2QBYB 3PPYA 4G5RA 2R79A 1HKHA 3ZHZA 4NIMA 4QZHA 4MGKR 1Y4UA 1MGOA 1AROP 3KAPA 4YDRA 1HQKA 5LQMA 3U7HB 1YBHA 4MDEA 1ND6A 3CLTD 2IKQA 5LUAA 3TTXA 1ONPA 2VRCD 1N0IA 5ALEA 3K1JA 1ZLXA 2NLOA 5ANRB 4FR5A 1N8SA 2WYVA 2AG0A 1G9SA 2OOSA 2ANBA 2Q5JA 4TN1A 1XAJA 4B73A 3FKSA 4H31A 2BBWA 3FPFA 4JASB 4J2HA 4GD3Q 2I78A 3WRXA 4KI0A 1YL5A 2X41A 5HZGA 1SCQA 3M8SA 4EB0A 2OV8A 2H08A 1P2BA 4L4ZA 2IDMA 2RGUA 2YDYA 3L1KA 4MR7A 5IJAA 2X0KA 4YR3A 3T9EA 4C8KA 3ZV3A 4JLNA 2JEZA 2IVZA 1ZX1A 1Q20A 4QXPA 2Z1DA 2C2HA 1X15A 4OLJA 1VYUA 2JH8A 2X14A 5HE8A 4TUYB 1PT5A 1HDXA 1NSTA 3RHZA 3HTXA 1WCWA 1YO6A 4YROA 4G2NA 1U0HC 1X1EA 4L7VA 3A0HU 3AQFA 4O4JF 2PEZA 4YWJA 3SS9X 3ESZA 4N03A 4Q21A 5HOEA 5MGBA 4I9UA 1QGAA 4DOCA 4C80A 3O8BA 3DOOA 4GUAA 2CDAA 3NLLA 1N7JA 1E62A 1T8UA 3ICOA 4C7JA 3NYQA 4JR0A 2BM1A 3UENA 3ZE7A 1SXJD 2PX8A 3OQ1A 1GZHB 4FSDA 3WO0A 5TSDA 3K5IA 3EWSA 1V97A 3WNQA 4N5MA 5JSHA 4F85A 3ORHA 4KVFA 5DI3A 4UUOA 2VTVA 3QNWA 4Y9TA 4I9NA 3V34A 4D92A 5AVRA 2O19A 1RFLA 2AUMA 1II0A 5HIMA 1G16A 1SC4A 3VNBA 5B3JA 3B3GA 4TWIA 3S7TA 2ZJ2A 4CRXA 4MS1A 4D74A 4XXHA 3F7TA 3N74A 3FOZA 4FBUA 1MDFA 2XADA 3BQ2A 1DTSA 4DVJA 3PUZA 1IY2A 3ZCRA 3JQGB 4ZT5A 1EQUA 4AY2A 1IHYA 1KK3A 4YAJA 1HJPA 4OHYA 5TRTA 3RIYA 2C4NA 3C6BA 2XRFA 5C8VA 3PPXA 3KKAA 1T25A 2YIVX 4NV3A 1X1RA 2QW1A 4IKOA 1N2EA 3HFGA 4CQMB 3K0BA 2FFHA 1FC0A 1N1DA 4WXYB 2RC5A 4M21A 2V7PA 3LJKA 2O7NA 2SCUB 1UKBA 4YH1A 3OC0A 5ER9A 1JI0A 2VPZA 5DSXA 4FYPA 4ECRA 3FA2A 4J2OA 3DHYA 2GI4A 4BLSA 3GPIA 2I4IA 3BRWD 4XX0A 3NIFB 4C06A 3AEUA 4K88A 3SFTA 1J0AA 1WD5A 1ZBQA 3PX2A 2Y1WA 3HDTA 2H17A 3ICQB 1EE1A 4CF4A 2M2IA 4WBNA 1KFTA 4NQZA 4DCGA 4ARZB 2B20A 4YONB 5DTRA 1PK7A 3DZDA 1LTKA 2EC5A 1C8KA 4JUBA 5JISA 4MUEA 1V9PA 4TXJA 3KT0A 3KQKA 4MKZA 3AEZA 2PPVA 4MWGA 2HH9A 1H9BA 1C80A 5K8LA 2CD9A 1PX2A 1NWHA 4RANA 2K7FA 4I2NA 2FPXA 1ORIA 1QAQA 3ICVA 4GOMD 1WSWA 2Y1JA 3R9XB 3ZPXA 4Y0VA 4AQYB 1IRIA 1RQ2A 3I1JA 2MINA 4EZEA 3NRZA 5HX7A 3RGWS 4G8JA 3L4KA 4G56A 5KFYA 3WGUA 1S7CA 2O8NA 5DB4A 1UZUA 3V97A 1SC6A 1ZL2A 1YS2X 1NUHA 4UVHA 4M89A 3ZIUA 4OXIA 3EF0A 4A3SA 2IEZA 3FLMA 2FFQA 3IAFA 5F4ZA 1IZZA 4YAEA 1U7OA 1Z5NA 4WSOA 5LC1A 2C83A 4YQZA 3OZBA 4UCWA 2QN6A 3RF6A 3H9QA 4US0R 4KDRA 1LDNA 2PWBA 3D3WA 2ZJZA 2WOJA 2W2OA 3CZQA 2HIGA 4P4GA 3NJ8A 3PGVA 1ACJA 3KV1A 2NYRA 2M6LA 4JOQA 3T9DA 5EJ7A 3HNPA 2Y1IA 1MB3A 1Y3CE 1A0OA 2NVUB 2IEBA 1GG5A 2GRUA 3QX7A 4BNIA 1X7YB 2AKAB 1N25A 1GT91 3QVUA 4INPA 1YZKA 4GC5A 3DDWA 3GRFA 3MC1A 3E1SA 3R4VA 5REQA 3O83A 3VR1A 2HLNA 5HILA 1R6UA 1T15A 1RM0A 1NUSA 1Y7IA 1MKYA 3AOEC 1ZUNB 1L7PA 4ENPA 4GQIA 2ZAIA 4UB4A 1BXZA 2FHPA 3D2SA 1TK3A 1FZQA 1I7NA 2IT1A 3WOVA 1RWQA 1FSPA 3KOUA 2QM3A 3THOA 4WUVA 5AHRA 3PC4A 5IKOA 2HUPA 1KQOA 2Y9UA 1E9FA 2UVVA 1TX4B 1W35A 2P35A 1C2YA 3C6ZA 1AU9A 2RGDA 1GGVA 3GDXA 2O9JA 3CRZA 3MWDB 4UTXA 2VANA 3FCEA 4ZO8A 3MXTA 2NMVA 4UTPA 4WJ3B 4ITVA 3DTTA 1OXTA 1YB1A 2IZ0A 4OHWA 3N07A 5B57C 1GAJA 4IJUA 3SEIA 1WP9A 3GN2A 1P7DA 2V7BA 1O9HA 2VBGA 1H66A 4WV3A 1E6MA 2WHPB 3OQHA 5T3YA 3H1AA 2FQXA 4FS3A 4D9FA 3KUKA 4N3CA 3WWYA 1SBCA 4PFSA 3RJFA 1CETA 4EFMA 3MDCA 5BVGB 2XHZA 1ZRNA 2N3ZA 1FXWF 3BE6A 1GUBA 1RYZA 3QLEA 2ZJ8A 4LA4A 4GSLA 5F3WB 2EG5A 3FMPB 3M4YA 5AVYA 4WY2A 2D5LA 2J45A 4W5WA 4LXXA 3GVXA 1GZ6A 1M2VB 5EUCA 1L6IA 3I8SA 3CUYA 1C4OA 3W5HA 4QVIA 5DGTA 1ZGAA 3HCPA 1Z0ZA 2CLHB 3A1EA 4OVKA 1DJNA 8ICYA 1FX0B 3RIMA 1W9MA 1P91A 4MGEA 3NHJA 4J07A 3WGNA 3DMDA 1ZQBA 5KYXA 3GLHA 4BJHB 2W2LA 4NBSA 3R3SA 3AUKA 3IMFA 2I65A 3OCWA 3FUXA 1NQXA 3LBYA 3PGKA 4ZXFA 3QFRA 1FIQA 1AUQA 3D5QA 4HDKA 5SZHB 2R7NA 2IX9A 3VTZA 3L8HA 5IVDA 5UKDA 2RFLA 4JUIA 4OU5A 1ECPA 1JJBA 3H5IA 1KXJA 2QV7A 4GMHA 1WNFA 1PVDA 4OJPA 2ZXFA 2HDWA 4KIWA 1JIUA 5D6NA 2KNJA 1NVKA 9ICNA 3ZWMA 3O93A 1YVUA 1KY5A 3VZDA 1JEJA 4LS3A 1SG9A 3F49S 1D8YA 5KOJB 3OUZA 4PLCA 3TDKA 2JASA 4JROA 3TLBA 3AUTA 5CVUA 2Z09A 1QQ6A 5AXAA 3BWXA 3K0KA 4DUYB 3NX4A 2E18A 4AF7A 1T91A 4TTPA 3F96A 1QYVA 3KELA 4PTLA 4QGHA 4DL2A 3SHVA 4ZARA 2JLRA 1V7QA 3GRCA 3ZU3A 1MR3F 1TYZA 1LGYA 5LP6C 2RHGB 4MUBA 1NZDA 3P0RA 5LQDA 2ES6A 4LJYA 4CIXA 1JEEA 1FFXA 1QX4A 1ZM3A 4IF6A 1B74A 3AM3A 5F7XA 4BFXA 3V00A 4IQUA 4MR8B 2HADA 2FR8A 5A1JA 3BGSA 1N5JA 4GC9A 2CDRA 5KQMA 1PFYA 1M6NA 3KD3A 1ML3A 1SD1A 3N53A 4YMHA 4IV5A 2ZWPA 5C8ZA 2KBFA 3OM1A 3VO9A 4M55A 1SHZA 1I7LA 4Q34A 1ZN8A 4WFKA 4CMBA 1D1PA 4LISA 1XVIA 4JP3A 3W5IA 4DILA 2MHCA 2WB2A 4UVDA 1II8A 3DDHA 1Y1KE 4HMQA 5K3BA 4GSYA 2VUIB 2WIFA 2FUCA 3E0XA 3CB4A 3WGYA 1ATIA 1QQ7A 5ECYA 3URKA 3HCNA 2V9WA 1PG0A 4LZNA 4P5EA 1T9HA 3CX8A 2KJ8A 1KGDA 5BR1A 3VH2A 3JD1A 1S2IA 3DDNA 9ICGA 1AKUA 2XGJA 2KD1A 3C6MA 4UCFA 1ZSNA 3SBEA 4QDTA 1R6AA 4LJ7A 3AETA 3BQ9A 1X7ZA 4TSFA 5U4XA 5ALGA 3SZLA 4PHHA 3MCVA 2BD0A 1PK1B 1XA3A 3L7OA 1I2BA 4TS1A 5HR7A 2VYNA 3TJRA 4PYKA 3PDIB 2YWJA 2KE5A 5FV4A 2P2YA 3NHPA 2WY2D 2HWYA 1Z4MA 4H1HA 3D2CA 4COOA 2XVXA 4OB7A 3VVBA 4CIDA 2F2TA 5JZMA 3A9WA 5BSTA 3V9PA 4LV6A 1LPBB 4Y2XA 1CJMA 2G25A 3IHQB 1LX7A 1DRUA 3BA1A 2AFIE 2XWQA 1KEKA 4JL8A 4PHFA 4TKLA 1IBCA 5IWAB 5U9CA 4HJXA 1Q19A 1LLUA 2OBLA 2AHOB 2IY9A 4G84A 2XITA 3DLCA 2WTBA 3PJFA 3QVOA 1KTIA 1D9XA 2QAGC 2ENWA 4XYEA 2L0XA 4IMPA 4X71A 2P3SA 3B3AA 4FNOA 3F5EA 1B6RA 3DHNA 3DXXA 4M1TA 3AUUA 1VPEA 1FBTA 3C98A 3UKDA 3BOSA 4FYHA 4WNYA 1Z19A 4BLUA 1ZJJA 1NVBA 3FTPA 4MTLA 2MJLA 5AESA 2YJNA 5GIPE 4DSOA 1BH6A 4RD6A 2BZ1A 2FW8A 1TC2A 3KQVA 5LM3A 1MAHA 3ISCA 4PSDA 4HDMA 4EYOA 1XF1A 2QKQA 3FH0A 2VCYA 2E5FA 4M36A 3RB4A 3WAKA 4OHVA 2P5TB 4OMDA 1COOA 4JBXA 1O0SA 2YXPX 3QEKA 1XFAA 1FDUA 3SN6A 3TARA 2PCJA 1N0UA 1RWKA 3B48A 3NRWA 3EVTA 5T41A 4JIGA 2IE0A 2Q5IA 4HRVA 3M9MB 4UVEA 2D1FA 3MLBA 1Z7YA 4ERNA 5GZ1A 4ER0A 3R0QA 2OZLB 3QPCA 5DTMA 4DJ5X 2Y9MB 3EWIA 1PGNA 3M4XA 2Z57A 4HGQA 1E5VA 3TKYA 1II9A 5J2CA 5IT4A 1LPNA 3SNKA 1V8OA 4V0LA 2II6A 5L6LB 1IZ0A 4K9KA 2W2XA 4IVNA 3W3AA 1EZ4A 3S6JA 4Z9YA 2XO7A 5LP1A 2EGUA 3AFMA 4TRNA 1U0NA 4NBTA 4IZHA 4LQ4A 3E5HA 4Q39A 1XZKA 2XI4A 2HPVA 2EYQA 2WJWA 3PHCA 4KHZA 2CYCA 2O23A 4IKPA 5EMKA 3FCXA 3IG5A 4QRIA 1M8FA 4U1RA 5E6RA 4CIWA 3U5TA 4GP6A 1K6XA 1J1ZA 3ER9A 5FBRB 3KALA 2AV6A 3WQHA 4R9UC 1QPGA 4CV3A 2GN2A 5I7SA 4MDFA 4B43A 4GXRA 3JATB 1SBNE 3FTCA 4OI0A 5HIIA 4F6LA 1CS4C 1M74A 3Q2IA 4WVLA 5AK0A 1XPRA 4JJAA 3LHKA 2YIJA 4CXMA 3BULA 1E2NA 4ZAFA 4ZRMA 3RS8A 1C14A 2QRMA 1M5UA 3IE2A 4AROA 1L3CA 2I4MA 1XMOB 8ICFA 1DAHA 4OSEA 2ZTCA 2Y77A 3LBAA 5EY5B 2B6GA 5KFXA 4BVKA 4HDSB 4RVNA 4BGDA 1QIJA 2WAXA 4KUEA 1O94A 1ZAKA 1G8HA 4YJHB 4BLOA 3I73A 5CHEA 3F2IA 1GA1A 2HA2A 3BSSA 1NP6A 1RKQA 4GS5A 4Q4HA 1GDHA 3T61A 4MIYA 2EZXA 2UZ4A 2FQYA 1MTOA 2GJAA 2MYNA 4L2IB 3ORRA 3QEMA 4JC0A 4UEJA 1JAZA 4G1MB 1SBQA 4C7ZA 1W0CA 4FI3C 1WXQA 4OPMA 1E64A 3KKKA 2MOKA 2ASDA 3REGA 2Y1EA 3DEAA 2IU0A 3TL2A 2I9KA 4DDUA 1XYYA 1N4AA 1ZHHA 2I3GA 1Y8CA 2W00A 4CT4B 5GJVC 4IOKA 2IZ1A 4D80A 4Z3OA 3DHEA 1UOOA 1E79D 4FWTA 2BY4A 4NZOA 1CHDA 2Y0CA 2VTDA 2HK7A 3ZHOA 3EMDA 3BC1A 5DGCA 3FAZA 2ZIWA 4RQ0A 2WMNB 3CUSA 4P2GA 3ITEA 4DCVA 4GPBA 4OD0A 4BGEA 4HXFB 3IUBA 2VDLB 1K6EA 4PFKA 4IR9A 3U60B 5JDIC 3MWJA 2DTDA 1M10A 1JPUA 4EUSA 3FHLA 1THGA 1J8QA 3KWLA 4KI7A 4O5OA 5CFPA 3AY6A 4OHZA 1JKMA 2J3JA 3GG2A 2ZE6A 1V48A 2V6IA 4IICA 2J1LA 5EXDA 4YP7A 4D9JA 1UPUA 3KTAA 4B09A 2CFIA 1BC5A 4AYTA 1ELOA 2YQ5A 1WAMA 1Z4QA 3UF0A 1PEDA 2FCRA 2XZDA 5F77A 4GI5A 1HDGO 3BFPA 1MAAA 4LYYA 4KXFB 2J59A 4OI1A 4MV4A 3V4VB 9ABPA 1YRLA 1T1JA 4XPIA 1W2HA 3MR6A 3OCVA 4XOUA 1PYDA 4UD2A 1HTTA 3HKZF 4PXYA 1JHYA 4TV9A 4EOGA 3B9RA 4JOBA 1P4HA 2JXJA 3D6JA 1OFVA 3S1AB 2YQ4A 4K6CA 4KR7A 1PV4A 4HQLA 1IATA 3V3TA 2W9MA 1YKSA 3RH4A 2GBLA 4PCAA 1QSGA 3ZU5A 4II3A 3WGLA 5DNUA 1T8WA 1UP7A 3WQRA 2YMPA 3VPBA 3QU4A 4CVNA 2QP9X 1A72A 2A9OA 1ECCA 1CQPA 4QATA 4N8EA 1LQUA 1XAIA 4ZHQF 1UK7A 1YAJA 4PLZA 2YFKA 4TKVB 3LT2A 1SR8A 3RG8A 3NVWA 3KVRA 2EHJA 1U81A 4M2LA 4PX5A 5EFZA 5CTAA 4R8MA 4WOBA 2IYLD 3OIFA 1PLLA 3BD9A 4EDHA 1CW2B 3EPKA 4XKJA 2XXAA 2PUDA 2IFTA 4CUKA 1PDVA 2BGUA 4IV8A 1DEXA 3AGQA 7ICTA 1Q7EA 3GDHA 3R6DA 1OXKB 5C32A 2O2JA 5JD3A 4KIJA 5EHQA 3AKYA 2FZ5A 4BU1A 1FLAA 5CLQA 2OZKA 2DTXA 1O7JA 5HJ7A 3C5EA 4H35A 2X1VA 4BO5A 2PWYA 1T2NA 1DRWA 2R5NA 2I7VA 3KWMA 2IOHA 4NI5A 2V7GA 3TIGA 2JAXA 2PT7A 4R05A 4WD3A 1P3Y1 1SKUA 3BZCA 3IN5A 1UOPA 1TF2A 2YX8A 2DY1A 1O95D 2AQ0A 4KQWA 1XZFA 3NTRA 4MS1B 1NX9A 1HSOA 3RRJA 2NUBA 5EN4A 2Q1UA 1W0KA 4L8FA 2O3SA 1B8OA 3T1QA 5AH0A 3SAGA 4BVLA 1NXVA 4PXAA 4KTQA 3PYMA 2YWHA 3MMNA 3RBXA 4D0NA 1EBUA 2EKLA 4F4WA 3T7RA 1GUYA 1P4JA 3KVOA 4YAFA 3ME5A 1U2PA 1V45E 4MPJA 1JDBB 1IOVA 3TK1A 4GMFA 3UG6A 4FZMA 4OAOA 1VSUA 3CW2A 2CB9A 3IFSA 4FWBA 4N76A 2DZDA 3L82B 3DMRA 1WV0A 2AEEA 2YHAA 1U02A 1OHHA 4F5YA 5JLAA 3ZGZA 3OOYA 3DV9A 4TUYF 3TVDA 3LLVA 3WL5A 4K0KB 4X85A 3SKXA 3CYMA 3EUB2 3GJSA 3HDJA 1DV1A 5DHQA 2WJ4A 1VKOA 4WBNB 4Z4FA 4TL9A 2YJ4A 4NENA 4DRXA 1WHSB 2KW5A 4ZOLB 3W6PA 1YZLA 3BBPA 1VE6A 3ZK8A 3GZNA 4P7BA 1ZMTA 4P82A 3FB1A 1J2YA 2VZ9A 4A8HA 2HMUA 5ESDA 1ETHA 5ED0A 2AG1A 2O8CB 4CIYA 4OUDA 5J2KA 4MKIA 5DYYA 3M4JA 4WCFC 2YJZA 4UUAA 3HDGA 3OKAA 3H0EA 5ABPA 3VPSA 5EIBD 4C4RA 1FJXA 4EYSA 4MRPA 4GP9A 3VHLB 3G23A 4F1JA 2PGDA 3ZW7A 1I4LD 1JKJA 3C7AA 3H2BA 2P6RA 3GAMA 4X84A 5BYKA 2VHEA 5B36A 4I5GA 4FMPA 2GPSA 3PS9A 3IDAA 1P74A 5LZ9A 1SA0A 5IBCA 1ZP6A 4MS3A 3JALA 1WD7A 3R6WA 3ONFA 3T9FA 3GD7A 1Y6RA 2F00A 5CIYA 3PHGA 4YR2A 2A6PA 1MW8X 1RLTA 1DEKA 1LBIA 1GKYA 1SC3A 2WJ3A 4TT8A 4OH7A 3RPEA 1U1CA 3VR6A 4DSAA 5T4BA 2IOFK 1NJXA 4YHBA 3M34A 1L5HA 4HUQA 2R65A 3HCCA 5CRXA 2HN9A 3T99A 3BIXA 4CCHA 4EJ2A 2QN8A 2QXTA 4DFKA 3AEKA 4DVGA 3AKZA 1GIAA 5AVOA 5LJLA 1TDJA 4BAGA 3U6KA 3PW4A 1Q1GA 2CT8A 3CFYA 2VHCA 4ONEA 1NVTA 1KWGA 2J41A 1QS0A 2MAXA 4ED7A 1H6AA 3JZIA 4OKSA 3DEEA 3DJYA 1EWQA 4DCMA 3P94A 2Q50A 4AJNA 3NBYC 2OENG 2ZJFA 5HK8A 3CW8X 4LDJA 3H1PA 1C7IA 3M6FA 4M9HA 5TVGA 1XDWA 4ZVLA 3BGWA 1PNQA 5J59A 2ZJ5A 3ZKWA 3FSGA 3L3BA 4YCDA 2QI9C 3EDRA 2HGZA 2QVLA 1UC5B 4RD2A 4QNMA 1P31A 3NV9A 2E4YA 1G7SA 4CIVA 1YHZA 1OB5A 4H17A 3NOXA 2NQ2C 4FZ3A 4RW0A 3SM9A 3DR5A 2O8BA 3THXA 1G9TA 2P67A 3OPMA 1IBRA 3D4NA 2QR2A 3MJVA 3GV7B 4GVXA 2NSYA 2VDPB 4RKYA 1XSEA 3D7MA 2PE5A 1ARZA 1KMIY 3X2SA 4KIGA 1A7JA 3ZG6A 3B7GA 2P4HX 4UASA 2WKPA 4M0PA 2ZKIA 1LWNA 3I2GA 1MABA 4TLMB 5DM1A 3KQTA 4ZVMA 4KHPB 2P9GA 5JSZB 3EUWA 2HXGA 1TAQA 3BFKA 4IEIA 4UMEA 1W25A 5DV9A 5DBOA 3WVNA 4TZKA 3H1EA 4I7EA 1LDYA 1U7HA 5DBBA 1JPVA 2EANA 4HAVA 5LQUA 5DEIA 1HUZA 2PFOA 5IF3A 1PJLA 4IXMA 3H5NA 4GPTA 2VJQA 1JLHA 1UM8A 5E2BA 1KFDA 2ZWMA 4NDAA 1RYUA 1F1BA 3S8MA 3U5ZB 4DCOA 5TISU 4C1BA 3WDSA 4EABA 3QPWA 3Q3JB 2A84A 1U8FO 2A0YA 3JWEA 1KOLA 5ICEA 3LQ1A 2ZTVA 4NK5A 3ECCA 3HJTA 1T4DA 2VHZA 1IOWA 4QDXA 2RAVA 5CURA 1FUUA 1XRLA 5EXPA 1K7CA 2OC4A 4DS4A 5AI4A 4NEQA 4WNAB 3LW8A 2IS1A 4S3MA 1B00A 1GEEA 4BATA 1XXHA 3GY0A 1E6UA 4IGIA 5JAOA 3M6MD 3GLHE 4CMAA 3QTBA 2WRZA 3PNQA 2VDNB 5KYXB 2HA5A 5EWMB 4JI1B 4B80A 1BPBA 1MFPA 3OQJA 4FYMA 3OOJA 1QBGA 2O2DA 5L3SA 3RVNA 3CCCA 1JQJC 1CJKC 2QMOA 4RY2A 4ZOAA 2HXSA 2ZSBA 2ZU0C 4BLVA 3MGGA 3LC1O 5FPSA 3TYXA 1VLZA 5HEKA 3UMJA 4DZRA 2Y93A 2V97A 2NPIA 3SKVA 1NG1A 2GA8A 4DOBA 2AWOA 4IIUA 5AFSA 5JTUA 2F8SA 4MDHA 1TKRA 4QUGA 2E4WA 1G5HA 1IEVA 2JVJA 1ZQDA 3Q88A 3RRFA 4C78A 3S2GA 3COVA 2I2FA 4BTVA 5F78A 3I52A 1JEDA 2C2OA 4WFIA 2ZS7A 5DTIA 4BO0A 5LQCA 3LNTA 3BD6A 4DDVA 1JFFA 3LLMA 1IG0A 1DPFA 4I5FA 3P2EA 2UVRA 3GMIA 3EGWA 1NXWA 4US9A 4TS9A 5JPCA 2IPXA 3R77A 3W5JA 4Q3NA 1KI6A 1Z17A 3UMVA 4XB2A 1DRJA 1TEXA 1UBFA 1FFXB 2HDNB 3TI9A 1X66A 1FBNA 3I2HA 2YS7A 4GU5A 4YFYA 3HL0A 1T9BA 4LRXA 3BQTA 2H51A 4RMNA 4QZBA 2E89A 4G89A 3SOPA 3WIDA 2I29A 1Y48E 1WW2A 2XA1A 3V4OA 4Q02A 4PFJA 4IHKA 1ZK3A 4UBJA 1FFAA 1MQ3A 3RTCA 3VMFA 4HGPA 2HF7A 1T9GS 3LUGA 1NXTA 2EKZA 1BWSA 1F6WA 3NHSA 5BV2P 1MSWD 2HW8A 4Q8EA 5H82A 2GAIA 2C5BA 3DO8A 4RVDA 8ADHA 5CYPA 2VUTA 5E3IA 2X5XA 4RTPA 1V4VA 4HXYA 3DUWA 2KBEA 3LCMA 1VHQA 3BK2A 4C04A 1E3DA 1P4SA 5E2AA 4EATA 3SWWA 2QVYX 2HRRA 4KCGA 5CIWA 1E6KA 2ZQ5A 4RU1A 3LDAA 4PO9A 4KU4A 2B3DA 5H81A 4UPDA 1YASA 2FPMA 2O5RA 4E94A 1Q3TA 5JR3A 3EZ2A 3QVKA 3N87A 3DBVO 3OP4A 2DCUA 4QICA 1KJWA 1X7ZB 1CIPA 3UAGA 4BV3A 2WM9B 4HZUA 5KFZA 2C88A 1NURA 1P1FA 4B32A 4MXDA 1C7ZA 4KH0A 1ORTA 2AGPA 4GH5A 4E4YA 3I09A 5FA6A 2QARA 2JD0A 2JARA 3TD2A 3L4SO 4UVGA 4GX0A 2LV8A 4JI8B 2CVHA 3QV2A 1RM6C 2F9FA 1XZNA 1ZYQA 1ZQHA 4E14A 1NQUA 4X1YB 1A2OA 1N56A 2YXEA 1GSAA 4RJIA 5TMPA 3LF2A 1XZQA 5DKWA 4RFSA 3UJHA 2WFAA 5J2IA 4NAUA 3O8RA 1W5FA 4HD8A 3TFSA 2DHDA 4G0XA 1UDXA 4DABA 2FX2A 1OWMA 5EJGA 5A5EA 4EZ9A 4P9NA 2GB4A 4OM7A 4I2BA 1UJ2A 5AWFC 3KT3A 3PL5A 1IVSA 2WHRA 1E0SA 1FSGA 3QYFA 4NU6A 3PE6A 1U9ZA 1XU9A 5I9MA 1C4XA 1JJAA 4JEUA 3WQQA 4KB5A 4ALKA 3WBBA 2XDQA 3E70C 1THTA 4PLPA 3IUJA 5C34B 2YZ2A 3B6ZA 3RVDA 3ZE0B 5DM2A 2WA1A 4LYJA 1KK2A 4DCCA 2QX6A 2PK3A 3TOSA 1S2MA 1OLSB 3MEQA 3UNXA 2DH5A 9ICKA 3QYAA 3BK7A 3G8DA 4F2HA 4R54A 2P9YA 2OG1A 4EHKA 3DBRB 5KWSA 2A1UB 4Q7LA 3I1FA 4OFWA 5SY6A 1NAHA 1NV8A 1A2BA 3OIWA 3WYCA 1L3VA 3SX4A 4Z86A 2EDUA 2XIDA 2EHDA 4LF8B 5FOVA 5J43A 3TGLA 4QWBA 3JVIA 2RCNA 1E2EA 5BR8B 2GK6A 8ICKA 4C8OA 1S8NA 3K3PA 4U2EA 5C37A 2AOUA 5DHSA 1Y1QA 1I4WA 3I76A 2DPIA 1FFUA 5EYPB 2OYRA 3PFBA 2E55A 3RB6A 3SSOA 3Q8SB 5AM4A 2CSXA 2WBLC 5IM5A 2IHMA 5KNLA 2NPOA 3BUSA 2FPPA 7AT1A 4C21A 1JV2B 3E4DA 3IQWA 3K96A 3QEOA 1D2GA 4DG5A 3WDLA 1E6WA 3WLIA 1AZSC 3H0CA 4EJFA 4WDRA 5J29A 2X4DA 5CLLA 4GZ3A 1CU1A 3LA6A 2QTLA 3AR3A 4ZQEA 5H7XA 1BDBA 1E1YA 2IUSA 3QLVC 3ISJA 2L5YA 3NHUA 4KE8A 5IUJC 4WLUA 1WZIA 1RWWA 4K3UA 1HYQA 3CNNA 2CXYA 4GPIB 2IA5A 2Q2OA 1XMJA 5BR7A 2QXUA 2I3ZA 4DPLA 3TVYA 3M5PA 2XOEA 1RQGA 3ND8A 5DNWA 4MITA 1NJSA 3VAYA 2CXQA 1AA9A 1U8TA 2PZLA 3SYRA 2GYWA 2X86A 3RFCA 3K1RB 4NCAA 1SXHA 3OMLA 3N8IA 3QZ7A 4HWKA 5JMPA 3AVOA 1YI1A 4Z49A 2VF5X 4ZU1X 5IZCA 4E08A 3TM5A 3ACCA 2X8AA 2HIMA 2EYUA 3EDYA 1JTVA 4AURA 1VRCA 4ZP1A 2HHAA 5JUWA 1PK8A 5JS1A 5C8DA 3NBFA 4K46A 3OJEA 2V5VA 5AUQA 4Z1MD 4IG9A 4I4NA 3UYKA 1Y1TA 5BOSA 1XMQB 9ICIA 2Q9BA 4NJMA 2BCSA 1AC5A 2YH2A 1PVOA 1X7WA 4DFDA 4OKIA 3RYIA 5TZVA 2IXAA 2LWIA 2IIQA 4MF8A 3FHOA 3LUPA 3C8DA 2OORC 2AZ4A 4RTKA 4R7TA 3BMNA 3LWLA 2C9MA 4IXWA 1ZQSA 3L07A 1VXOA 4J1QA 3ZDDA 4WLVA 4OJQA 2NSDA 4Q4AA 2Y0SF 2Z4TA 3ZDZB 4XW2A 3UMCA 2C9CA 4JODA 1A7UA 1IXZA 1I9GA 2GEDA 3DBLA 1ZIOA 4AFNA 2J0UB 2LDBA 4GZMA 5SYAA 3VR5H 1BPYA 1HFJA 3RK0A 4JLOA 4MCHA 3ZV5A 4K9RA 1D04A 3OSNA 5GVSA 1CY2A 4CMHA 1KW4A 3QKUA 4JJZA 2ZIWB 4IH1A 4RQ7A 1BEUB 1E0KA 1X40A 4EJSB 1EB8A 1KN5A 4KQGA 2WWFA 1XMVA 4GWLA 3L7BA 4EYIB 1POXA 1VCMA 1RM5A 4PWYA 2VLBA 2WMOB 4KLFA 3C1TA 3ACDA 4Y2QA 4LE1A 1T0HB 1KOGA 1X80A 3L6RA 3PG5A 8LDHA 3DVQX 2G8NA 1N60A 3ZE6A 1BOOA 3JZAA 4Y2VA 5AK3A 3RJMA 3DMHA 4FSXA 3EQ6A 2QLFA 5DOZA 4IW3B 1I5EA 5J63A 4KLHA 1E89A 3ISTA 3KTAB 1PGQA 3E61A 2HSZA 4HKTA 1F6BA 8ICIA 1D6NA 4DL3A 1N1GA 5B7GA 4OJLA 3RUCA 3C3DA 1Z62A 3PTZA 4ZU3A 1PDWA 4CV0A 1A9OA 3QVSA 5K09A 3MW8A 1TAUA 1Q77A 4MCJA 5DIFA 4PAGA 1DC6A 4TV9B 1AGNA 1XZMA 3UWDA 1C8BA 5FTMA 3BWEA 2ZW9A 3QP9A 4FPXA 3T3IA 2H2GA 2ZZNA 2QLTA 4AO8A 1G64A 3DLPX 1T6YA 3AR8A 3IBGA 3A1UA 4TMWA 2Y9TA 3PQEA 1BHSA 4D96A 2NAPA 3AY7A 3K70C 3IEXA 1FFHA 1EJ0A 1I8TA 4BJQA 2ZQZA 4IJMA 3PWKA 1WETA 2NWQA 5BRNA 1I0ZA 3H5RA 2WJZB 2MTBA 4BX9A 5ISMA 2K6GA 4TWAA 3UPTA 1JHUA 3IB6A 4G9EA 3C24A 1SRRA 3UAWA 3DFFA 5B1IA 5FR2A 2VTBA 1M2JA 3F5MA 4XGKA 4KMMA 1NI3A 1GAEO 3D6HA 5B1YA 1DINA 2X15A 2QVZX 3G5MA 2AI2A 3TX6A 4LXYA 3JYOA 4Y2SA 4O4IB 3OAAD 3ZIAD 1J0DA 5EKDA 3O1LA 2IBMA 3LSTA 1NJFA 1RI5A 1W75A 2HM7A 4AP5A 2FG7C 2IPNA 2IE8A 4I2EA 5JDCC 2OO3A 3LIPA 3E7PA 5ELLA 4NE2A 4JB8A 1T5IA 5BSUA 4AO7A 2HQBA 1P17A 3QFSA 3TDNA 1N5MA 4O3RA 5AVZA 1M73E 4JWNA 1U3TA 5IBQA 1DUSA 1OF1A 1V11A 2VHUA 3LK7A 1JECA 1PNTA 3K75D 3ZLUA 2H06A 2R44A 3TGWA 4YP9A 3OZUA 5BYAA 2H2HA 3TAQA 2WE8A 4ZT7A 3RH6A 3DMPA 2FFBA 4BQSA 1UAYA 1DRGA 3VSAA 3DE2X 2FSIA 2G5CA 4F4XA 3KJFA 4ALJA 4DCUA 4EHLA 1OXXK 1ZJ6A 2CDCA 5AJWA 3A6EA 3L7KA 1NR1A 2YHSA 2EFJA 3OHSX 3ED5A 4QBFA 3DDZX 1SIOA 3A26A 2MSWA 1SQ5A 5EIOA 3EC7A 2FQWA 2BM8A 3F9CA 2W6QA 2TMYA 1ZITA 2OXOA 3H5WA 1NK5A 1V8ZA 3MTJA 5ALPA 2RGBA 1XFDA 2Z8XA 2F1RA 4TROA 4AVYA 5AOCA 5IDWA 1RJDA 4XQ9A 1X39A 3QUAA 5JADA 5BY2A 5GIOE 4HQ0A 2VYFA 3KXIA 2FGJA 2C9YA 3SIWA 5K4GA 3PHLA 2JI9A 1L5RA 1N5LA 1OBCA 5JAQA 2CNNA 3O3OB 5H1YA 4UB1A 4YFVA 3VM6A 4WPGA 4G0UA 4DL7A 2AKYA 3DE1X 3CF4G 1WBJB 3IV6A 4CLEA 3CY6A 1G6Q1 4GBGA 3D6AA 5FOSA 4AUEA 2A3RA 4NENB 4RKFA 4DRXB 4JC8A 1DELA 1KE1A 2YVKA 3C1UA 4YWHA 2AC2A 3S99A 1U0JA 5FI0B 4LRWA 2PTGA 4ERXA 5AK6A 3E22A 3HDHA 2I99A 5DMXA 4UUNA 4AMYA 5MFZA 5AW3A 4MVJA 5G0SA 5TV2A 3IO5A 2AEMA 4HFMA 2H48A 4DCPA 5A2GA 3DOHA 3ZS9A 4MW5A 3PXUA 5CMLA 2OFFA 2DHCA 3D9QX 1SELA 1NK0A 2ORWA 1QYRA 4W8HA 1H8HD 4EGCB 3JTEA 2NU7A 1AQUA 1NQTA 4FS1A 2Z43A 5B64A 4F86A 1UEJA 2NADA 2IBSA 3TG8A 5F9LA 1WG8A 3WWZA 4DMFA 4YXMA 4LTDA 1MAUA 2PZEA 5JATA 1P19A 4QL3A 3T1NA 5FJIA 1G291 4G36A 1Z39A 3N05A 2HSWA 1R6BX 2O5CA 2VEDA 1G7CA 1X87A 5ALLA 1IZ8A 4V38A 1PS0A 3O8LA 3ZCUA 2EOAA 4BZQA 1QQ5A 5EHGA 5L51A 3K15A 2GM9A 2I71A 1K97A 3IDOA 3RO7A 3P9SA 1C9NA 2ODTX 4JUDX 2OHVA 4KQ6A 5F2OA 4HUQB 4JLJA 5JCXA 3GVCA 2NZUG 2GEBA 2IOYA 3KEQA 1M0TA 3GYBA 2W43A 1FRZA 3DPIA 2OHHA 1N5XA 1AS2A 1NOIA 2DT5A 1QS0B 4ZFNA 1WB6A 2WHYA 3GQCA 1H85A 1I6KA 3KIPA 4RPZA 4KQFA 4AJKA 1FRNA 1FJHA 3WWEA 3VPFA 3V32A 2EDCA 1R5OA 2QUAA 1BMTA 5J2BA 2WKRA 2HA4A 4K3VA 2HEGA 2I6SA 3OTWA 1JXQA 4UOZA 1XMIA 1DFHA 4ZOLF 4IILA 4QBKA 2GM3A 4ZI7A 4JA0A 3HBAA 4BLQA 2XCAA 2XAAA 1XYVA 4MMZB 2N75A 4BMXA 2VBIA 4PONA 4DF3A 1SV0A 5CU7A 1YRYE 2B9VA 2DOKA 3SYZA 4PGQA 1J70A 3H0MB 2J4CA 4LXTA 1OXVA 1CR2A 5AKIA 5KOHA 2RGYA 2YWXA 4ZYLA 1PT6A 5KDDA 4BP1A 2NXEA 3MMSA 2IP2A 2WU4A 2LD4A 3MJSA 2E6KA 1MX1A 5CT5A 4CG1A 3KQNA 3ER8A 1P62B 5HSGA 2AXQA 3CUWA 1FOEB 1W52X 1MABB 3IKLA 1OXUA 2PN1A 4LXUA 1YE3A 3H13A 2Q3BA 2WINI 2ZIVB 3SNHA 4U7TB 1U9JA 3T3MB 4PCVA 2AIRA 4S35A 3TCXB 4O1HA 1N1EA 4Z2YA 1YJQA 4TL8A 4UNIA 3COZA 4P22A 3ZBPA 3GO4A 2WD7B 1RYSA 1DIGA 4AX4A 3P9RA 5J1TB 1XTZA 3WIEA 3CSUA 3NBXX 1NOJA 2I2CA 5AJVB 4Q3DA 4AY4A 1V3VA 2GARA 4QIWC 5C18A 3G8AA 2XWJI 2V7TA 2AQIA 2GKGA 5EJFA 2ZE8A 4G1BA 2ZTMA 2O06A 3SVTA 3KP1A 2BM9A 2VPQA 1TECE 4YXWD 1XXHE 3M6KA 1YT5A 2OY0A 3QENA 4QDKA 4GHWA 4D3ZA 5ALSA 4WY5A 2FX3A 5TNXA 1CCWA 4KLRA 1A77A 4LV5B 4EKYA 2YZMA 2OD2A 2V3CC 1PJ2A 3Q11A 1IY1A 3FMGA 4PHPA 4MEXA 1UAAA 4ISCA 1FU8A 3OX4A 2XEXA 4KV7A 3UWOA 5G1PA 2HLPA 3V1KA 2OWOA 1MLDA 2E6UX 4E7PA 3DCIA 3NRBA 4DV1B 2AZMA 4Y6PA 4GRAA 3W78A 1VA4A 4FSHA 3QMPA 1Q1QA 1P7VA 4BVFA 4NPAA 1SUAA 2ZXIA 4RQNA 1ZQRA 4RQ4A 2A1AA 3UQ0A 4XYBA 1PX0A 3H5TA 6CHYA 3CX7A 2Y4NA 2QX4A 2ZI3A 1Q12A 2BGMA 3HCAA 5KVAA 5IC5A 2JLZA 4QTXA 4W5RA 3NHWA 3OKCA 2C98A 1OYOA 3WMFA 2DX7A 3BTSA 3F9RA 5TQ2B 1RKBA 1BA2A 4R2JA 1KFCB 2ZFUA 4WN9A 1TK5A 1V9SA 3N2EA 3KZCA 4ARVA 1MO5A 5K9ZA 1E6LA 1L7AA 3NG1A 2CNWD 1JEQA 3OPYI 3WGKA 3EZNA 1Y8AA 4YV2A 3VDNB 3EPIA 3GT3A 2F1HA 3RJHA 1SMKA 4F5DA 2BDPA 1ONOA 3WRYC 4I50A 4IHAA 2F4NA 3M82A 3QOFA 3WI7A 2PI5A 4Q1FA 1JKFA 4YC7A 1JFFB 5ESRA 3BJMA 1P1KA 5AHWA 2EERA 4B6GA 2GN0A 4JLWA 2GWHA 5K8CA 1ZD3A 1LA2A 3OETA 1H42A 9ICEA 4FB4A 5KPDA 2AFIB 1U3VA 4MVJM 1R4MB 3ET5A 2ZRIA 3GLIA 2OT3B 3EW9A 4HEJA 1KI6B 5L7YA 1GQYA 2IZ6A 2OVFA 1XRRA 2JJMA 1C0KA 3WV4A 1FSZA 1YNSA 3TFOA 1J0XO 1PK3A 1W5EA 4RA9A 3QELA 1RXVA 1XNRB 1CIJA 5KTMA 4IXNA 1RWMA 2VF4X 2PXHA 4M4SA 1ACMA 4UMVA 4OA8A 1M1YA 4MGIR 1I4OA 1DCMA 4JMUA 2EJBA 3STYA 2D3WA 5HF6A 4QDOA 2HHUA 2DKNA 4ENVA 3GH1A 3IXLA 2YWCA 4GXKA 1Z63A 3IUEA 5EMLA 3KYDA 4C01A 4L73A 3EH1A 1BPDA 4ZAGA 3L8GA 3FUVA 2KG5A 1P4AA 3ABZA 4LRUA 2PLFA 1NMZA 1ISSA 1KVUA 4L16A 3OLVA 2DQ4A 3HCOA 3MZ0A 4GEGA 3EXFB 3OTOB 2RI1A 1E7RA 4IJVA 4HNVA 2MA1A 3I64A 1CEZA 3A3KA 5C7YA 2CKMA 4J9KA 3AI2A 1K6IA 3DO5A 2FW1A 5TQJA 9LDBA 2D5BA 1AZWA 4CM6A 2OLEA 4Y6OA 3I2JA 3FNFA 5LDHA 6ADHA 3M6UA 4PR0A 1UXGA 3TN7A 2ERYA 2XGMA 4GQBA 4CTNA 4R2XA 1V4BA 2DL0A 4B9LA 4K9DA 1Y8QA 4OP2A 2OQVA 4DANA 5C51B 4QNNA 4WUTA 2CJFA 3BK1A 2YJGA 3ZHUA 2UUAB 4ND4A 2FG5A 1MV8A 4HYYA 3QW2A 4YECA 3TXAA 3TNFA 4XRHA 4BRWA 4C6HA 1JI7A 2XY5A 4KQHA 2BGNA 2VJMA 2FVYA 1EZ1A 7ICUA 4L5CA 4H7FA 3OEED 1PGJA 2WABA 2VQSA 4FLEA 4KWTA 4X41A 3VX4A 4KK4A 4YI3A 4Z51A 5GONA 2Z98A 5CFLA 3AIMA 3PW0A 4Q5IA 3DV2A 4RFSB 2OE2A 2R2GA 1NE2A 3SC4A 1XI2A 4Y7CA 4E09A 3DDUA 1A9XA 5AVWA 4D6YA 4R8UA 1SU4A 2NT4A 4WZ6A 3ND9A 1FVOA 4GT1A 1CQZA 4P7GA 3GU3A 4F97A 4ED0A 1K27A 3HYTA 4LYEA 1EA5A 1RWPA 3Q7EA 4I5IA 5AKEA 3BWMA 3V4FA 2B8NA 2VDRB 1DEAA 4MQBA 3AR2A 4HX2A 3HYCA 4BDTA 3IP3A 2XVAA 3BKXA 4MFFA 4H7IA 4BNMA 3LPDA 5K0SA 4M9SA 3O92A 4R1LA 1Z07A 1JRLA 4Y9RA 4AJPA 1DP4A 3I4LA 4P0QB 1ADGA 1KPHA 1ECFA 2CMGA 4N5HX 2P9FA 4RENA 1E5DA 4E2FA 4QREA 2DXIA 4BXOB 4I3FA 3QSGA 3WTBA 1JR6A 1T2FA 1HDIA 1YXMA 1WUHS 3G8YA 3VKUA 4OGKA 3ZW9A 5GZ3A 3RB8A 3FC4A 1TK2A 3MRSA 3R8CA 1UPXA 1IWBB 2V8BA 5C9ZA 4XEHA 3H9CA 3D7NA 3AVYA 3D2BA 1VJTA 1U4BA 4KPGA 5I7HA 3U09A 1EDEA 3KAJA 5AW1A 4X5VA 1UA0A 3E2PA 1ZK4A 4OQFA 1PZHA 3ZU2A 2AOUB 3C6XA 4LX0A 4QE3A 1LVHA 4QLAA 3VNAA 2BI7A 3WLLA 3KTFA 4FWIB 3HSKA 5IN5A 1QYDA 4NLKA 3CPEA 5KSZA