4P0PB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna, and mg2+
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
328
structure length
278
Chain Sequence
RMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
total genus 85
structure length 278
sequence length 328
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0pB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0pB01
4P0PA 2ZIVB 2JNWA 1J24A 4BXOB 2ZIVA 2ZIUB 1J22A 4BXOA 2ZIUA 2M9MA 1J25A 1J23A 2ZIXB 4M6WB 4P0QB 2ZIWB 2ZIXA 4M6WA 2JPDA 4P0QA 2ZIWA 2BHNA 2BGWA 2A1IA 4P0PB
chains in the Genus database with same CATH superfamily
3GNLA 1K1QA 3BJZA 5L1IA 1ESZA 3LPDA 2WF7A 4RK7A 1Y80A 1GU1A 1MB9A 2OHJA 4ZV7A 3JQGA 1IATA 4QUHA 1D2MA 4ZYWA 4CG2A 3IVMA 3MTJA 4KPFC 3U6KA 2GJAA 4OBEA 1U0TA 1AHPA 1AG9A 5E3IA 2JCSA 4AWAA 2AEEA 4LGVA 3KOXA 3B7PA 1XNGA 2WJHA 1NJWA 3FUVA 3MT8A 4F4XA 1YRLA 5JCOA 1ZEJA 1QTQA 1CHDA 1VC2A 2EC5A 4FJ0A 3AYZB 6NULA 1UDWA 2GEBA 2G1UA 3HUUA 3TSWA 5F98A 2IEYA 2CJWB 1R0ZA 4BP3A 2Q7DA 4JZYA 3BM5A 1QYIA 3R0JA 3QEOA 1E6CA 4LRYA 4DLXA 5JAZA 4URZR 2R8KA 5FX2A 1QCKA 5FHQA 3PXGA 2HLPA 4LRUA 2LBPA 4DC0A 3GZFA 2QEQA 1Q19A 1QM5A 3VPFA 3TQQA 1RYRA 1NJGA 4G97A 3RJHA 4R1PA 3NIGB 2RHWA 2XEXA 4X41A 2NQ8A 1VKOA 5KEIA 3WBBA 1I0ZA 3IPYA 4TWJA 3JPPA 4XFJA 1VSTA 3HFJA 3ENNA 4UAWA 5TVGA 3A26A 4OHYA 4L4UA 4U7TB 2FX5A 4M21A 3KPJA 4AJEA 3GY0A 1OLXA 2R11A 3ZI0A 1C9KA 5E9JA 1WXWA 5EMKA 2Q1WA 1XVVA 4O0MA 1KOFA 2EF0A 3CM0A 4CTOA 1THMA 4I2AA 3K6RA 1WDMA 1J0XO 4F3KA 2GASA 1DQSA 2G9NA 2C84A 1D4ZA 5I9SA 3LWZA 3PRHA 2EJCA 3RJMA 4V3CA 4EPTA 1T3LA 1WQ4A 1FO4A 1NXPA 1NJZA 3GRKA 1KJQA 3RSGA 4DM4A 1CY2A 3K0FA 3CH4B 2UXCB 2FW7A 1O95A 1X8XA 5DTJA 4MKXA 4QZIA 3S3TA 1J8QA 4WXYB 3LUDA 1BE1A 3NH6A 4DANA 5KFIA 4IQUA 4RK1A 4FDVA 3BJEA 1IM2A 4HQNA 3QX9A 3PEUA 5AWFC 2V65A 1DC6A 3GO4A 2HIHA 1OLSB 3ADOA 3L5OA 5LBUA 2E89A 1L5UA 1Y1KE 3R7WA 2NO9A 3TW8B 4F5WA 2J4CA 5KNCA 4RPHA 3I83A 3GJSA 1ZQHA 3CN7A 3JPNA 4A4DA 4NLNA 1LTQA 3H75A 1E9FA 2VPYA 1PJTA 1EDDA 3EVGA 1T6NA 4XM2A 1U1IA 2GZHA 3ZEIA 4YCBA 3P4YA 5EMNA 4DLEA 1A5BB 1JXOA 4BO2A 3D1VA 4N0EA 4BPRA 4UHEA 2W2TA 4MVJE 2Q6KA 1S9HA 3ET5A 2W2NA 4B6GA 3ZHRA 4HKTA 5FL7D 4XIYA 4X00A 4C4RA 1E0KA 1KC1A 4MUFA 4QTZA 5F64A 1MZPA 4IS2A 4ESHA 3L0PA 4DJDC 3KKNA 4XWTA 4G5FA 2ZYTX 2YW9A 4U7FA 1HYBA 1MO5A 2J0VA 4MVJI 3IP9A 2BP7A 1SCDA 3CVOA 3VR4A 4DCVA 2SKEA 4TKUB 3CX6A 2MMGA 3SQLA 1AB5A 1FIQA 2QRJA 4QZCA 3P20A 4RHFA 1QGDA 3UAYA 1COKA 1YHNA 3H11B 5AVKA 2Z8XA 2REQB 5ALKA 4FSDA 2HK7A 3HKBB 1VGRA 3MILA 3GG9A 1PWHA 1BVSA 3O8DA 3RB6A 5K3OA 3A3PA 3GEPA 1NUPA 5NULA 5DQHA 1AE1A 2Z9CA 3JVEA 2WAOA 1SBTA 3QEMB 5IYZB 4M9QA 2Q7OE 4TVOA 2VHYA 2VP4A 2WPDA 5E7MA 3MJDA 5HZMA 1AN0A 1M2VB 5KWEA 4HY3A 4QTYA 3GPIA 3PC8A 1CU1A 1YOVA 4KTQA 3OWHA 3BGIA 1QSLA 1P1JA 4J94A 4AROA 2FVXA 1LSOA 2YW2A 1CY4A 1VMKA 3O93A 2CE2X 3A4IA 3OQJA 4ZOAA 1MT0A 3DQQA 2OC4A 5FL3A 2I0FA 4TZTA 1ZUIA 3MTAA 2QAGB 2R86A 3IN5A 1C1YA 5H02A 1MF7A 3F74A 2VSOA 4B45A 5A9TA 2W9CA 2HVHA 1UXGA 3IQWA 5IBQA 1MXHA 1WCNA 2WAAA 4NS1A 3QG5A 2ISCA 3RK4A 1DOHA 2P4HX 5L3QB 3BTSA 2IZ0A 3K09C 3FIUA 3CF4G 3FVQA 3PJGA 3RCBA 1OU0A 4YUVA 1Z1VA 3U1TA 3MYYA 3TFWA 4RZXA 1TDJA 4CMKA 3GDGA 2IX3A 1TIKA 1XZFA 5D3KA 4YMTA 2ZANA 2ASJA 3WP0A 3HM2A 1GUAA 2FSUA 4YJFA 4INJA 1BOFA 3BQNB 2K8AA 4X5OA 4KR3A 3V7UA 1M67A 1SK9A 4B3IA 1SUDA 1AKWA 1J8VA 4LYHA 2A3NA 2C4MA 2IV2X 4PS1A 3OUTA 1QPBA 4NJMB 4TYWA 1JWBB 1EM8A 2GA9A 1SXJA 1SH7A 4Y0VA 1L4LA 4M9JA 4PC7A 4IEIA 2RBKA 3BB1A 1QFXA 3UWOA 3MR6A 3TRKA 4E2XA 2VDWB 4RBNA 2XIJA 4Q43A 4B81A 1TYDE 3H0MB 2FUG6 8ICFA 3HR8A 1M6HA 2Z98A 4E1BA 3LFHA 5BORA 1YVRA 3FI9A 1E1CA 3PUHA 1GR0A 1SC1A 4YGYA 1I6WA 4MTCA 1K8ZB 2HU2A 3PCXA 5HJEA 1MX9A 4KXUA 1KJJA 3ER9A 2X7JA 4X8HA 2E8NA 3EYAA 5ENVA 2R1UA 2QXYA 5DBFA 3B6EA 2OXTA 4HEQA 2C1ZA 1GL9B 3OM8A 4YMIA 4AQDA 1Q17A 5EJGA 3HDQA 4YRZA 1CUHA 2FPKA 1YFZA 3KZKA 3R3XA 2O8DB 2KN7A 3UH1A 4AO7A 4WY5A 1KJIA 1CE8A 4FHCA 4GZMA 2NZYA 3PEYA 2IW1A 3E1SA 2HU8A 4IO1A 1SKQA 1FRQA 3A58B 2BZ1A 4QWEA 2V54A 5IAKA 3LC2O 1GWNA 4G01B 3TL6A 3Q4GA 4UTVA 2YHBA 3I6IA 1W5SA 1MAHA 2J9RA 3BZKA 1Y7IA 4ZHQF 3IP1A 3LTNC 4LDRA 1FLNA 2P7IA 1WPQA 3MNFA 5MN4A 2HXGA 2NUPA 4P82A 1T25A 1FQOA 1Y4ZA 1FU4A 5GJBA 3N70A 3D8UA 2D62A 1RXCA 4X85A 3NETA 4D5GA 3IEVA 1SIUA 4AY3A 2RGNC 1VL6A 2NPOA 1IM4A 3NIDB 5KTPA 4BWJA 3MAJA 1ZVVA 3G2HA 3QOXA 3DOJA 1BPDA 4DILA 3SQXA 2LKCA 3RGGA 2UYHA 4GZ3A 3ECAA 3AQ4A 2QTAA 2IEBA 2NSDA 3TX2A 4YRAA 2X8WA 2PO7A 1XTKA 2B92A 4OQMA 4UAUA 1OFGA 1SXJE 3R09A 1G17A 1CF4A 4PZ0A 3O5AA 4L8GA 2NRZA 4NEHB 3LYLA 1A8SA 4AZVA 3BSYA 1SCNE 4EYEA 3RIYA 1DXSA 2IF0A 1OBCA 3G5TA 1N5IA 2LPMA 3W05A 4KQKA 1OWOA 1NAHA 2BFAA 1ZQCA 1DK2A 4DRXB 3QY9A 4ITVA 1DDOA 1Q0ZA 4G0NA 4NYMR 4MV0A 5I8PA 1X3SA 4XIGS 1K5GA 1HFEL 3X1YA 1X0VA 3L46A 3QQPA 1J22A 1RPJA 1AZWA 1QE3A 3IBSA 2JCBA 5EE1A 3EAFA 2EJUA 3KR2A 4MP8A 5F1PA 4KE6A 2G7MC 3DVQX 2CDRA 3B9QA 4L0QA 3RQSA 3W90A 3MERA 4M0EA 2GCGA 1Z0FA 1VL2A 1L5VA 4F93B 2J0QA 4DS4A 2O0KA 3BICA 3DEAA 4TWZA 4U6PA 3H8MA 1YMVA 3BH7A 4EZBA 2JMGA 2OBMA 3KQWA 1MJ5A 1TYBE 1XE3A 1UJCA 4GIBA 2WKWA 2KZZA 1DKNA 3TQOA 3Q9UA 3GNSA 4TWAA 3WKDA 1E6WA 2N75A 4OGKA 3DD5A 4IEEA 3HTXA 3DTVA 1CQXA 4K6KA 1FDWA 3RROA 2YXNA 2ZR0A 1YJAA 3H0RB 4YDSA 5CJ2A 1NFRA 5BNZA 3UK6A 4YCSA 4S3MA 2ODQA 3B53X 2RH4A 3SJCA 3GJ7A 1WSBA 2V5UA 4MYTA 2XZDA 1ND5A 5HCUA 4MVCA 1IDOA 3EH2A 2HHUA 2AFHA 5BSWA 3ND5A 4RA9A 1IY9A 2Q0XA 5G40A 2WJ6A 1AC5A 2JJQA 4RCZA 3TAHA 1DNPA 5J0UA 5DWQA 1W5AA 2XQKA 1HQDA 5TJ9A 1YZKA 2HH9A 1ZSNA 1NDQA 2V74B 4CQMA 3RBXA 5KTSA 4NBRA 1KAQA 3TLZA 1ZJZA 3QWAA 4PZEA 4UXJA 4I8DA 5JE8A 4MRMB 4GXKA 2Q99A 4MDEA 1J5XA 3HY4A 4BUZA 4GKKB 3NAGA 5JTIA 4ZU3A 4AYTA 3G0DA 2WHEA 3G1WA 5KKAA 3L7IA 3VRHA 1BX1A 4WL0A 4ZCMA 2JHDA 3WWCA 4QHSA 2BH9A 3RH6A 3SENA 1E2GA 2ZZMA 3OZTA 4I81A 3WRWA 2RHMA 1LX7A 9LDBA 2L17A 2OE2A 2YV3A 3GFSA 4MLZA 1BRMA 5JMOA 3HNOA 3AQIA 3HBMA 4CIDA 2EX4A 4KKXB 4I2VA 2Z83A 4QJFB 1UK9A 2GJSA 4G25A 4PHDA 4IRCA 3SX4A 3PKJA 5TVKA 5AKYA 1YB4A 2QL6A 3P94A 3ISBA 4ABTA 5CVCA 1PK7A 5JQGA 3AG5A 3H3XA 1N9GA 4HRYA 3E23A 4F1WA 3OHSX 3V2HA 1M6NA 3GLSA 1F48A 1NR1A 4Q1VA 4QZVA 1XYVA 4G3XA 3N76A 1RXEA 1JQAA 4RQ2A 3C6ZA 2WC1A 3TIVA 3ETJA 2JFWA 5L53A 2P5YA 3HCOA 4N7JA 5EJ7A 2PH7A 1OWMA 1E5VA 4MEJA 4UCXA 4CL2A 4MICA 4AKEA 1AQIA 1Z4LA 4BWMA 1UPAA 4WXRA 5J2UB 4EHNA 5C9ZA 5JASA 4CMAA 3TI0A 4F2SA 2DWQA 3CP8A 4H3KB 2V4MA 1XLWA 1RAEA 1W94A 4BLQA 1IWBB 2QR5A 3O75A 3TE6A 1U48A 4BNGA 4MOWA 5DN6A 1DQPA 2GN9A 2Y1OA 2X6RA 2QKQA 2ENWA 2JDIA 2AFHE 1NA5A 4GVLA 3CQ9A 3U81A 2Q27A 3C5FA 4AP6A 4TWIA 2XCLA 4OF4A 1ONPA 2PX6A 1IUOA 1SBZA 3S7TA 3AZPA 1JPVA 2R7NA 2C4HA 3MRTA 3FFXA 4MCHA 3HO1A 4PHCA 2BPGA 4MVJM 1H5UA 4GX1A 1ZSYA 5KL8B 3OTHA 3OI7A 5LA6A 1J49A 2ZRCA 4TV8A 3KSBC 2BM8A 1GEEA 4W6QA 4DBLC 2FUCA 3KPWA 1QKKA 2RDJA 2OQRA 1YC2A 5G1NA 2C4VA 1II0A 2BKLA 4H2DA 4BNLA 1IN6A 4F2DA 5IZ4A 3W78A 2HK9A 1O89A 3PGLA 4OFWA 2WFZA 2DULA 4BRUA 3D54D 2AOVA 3CNOA 2F9MA 3IODA 3WA7A 1JHMA 4EX6A 1K6IA 3S68A 1L9KA 1MQ3A 3CISA 1BA2A 1X70A 1A77A 4IIVA 1E20A 3WYBA 1W85B 2MYNA 1Q57A 4GKBA 3I05A 1TIPA 3HEAA 5E7QA 1VJ1A 4AJPA 3ER8A 4CZ2A 4YWHA 4YMUA 4Z0PA 1DXHA 2ZQ5A 4B48A 1SUIA 1UZLA 1YRHA 1ONBA 2H3HA 4Z1OA 5HCIA 5EMLA 1V37A 2ZAIA 2AHOA 2A9JA 1R0KA 2D4HA 1ZQUA 2HMAA 3UG6A 4D4KA 5FWNA 1JLLB 4WZAB 4BXOA 3CT6A 1XEXB 1EG2A 3WU2U 4ZVRA 4XQEA 3N8KA 4DARA 3UN1A 2C2XA 4D41A 3BYZA 3ICWA 1W75A 2A5JA 2VF4X 1PQYA 2IU0A 4LWOA 2XA2A 2NTYC 3F3MA 3Q41A 5DBAA 2IU4A 4LEIA 4MR9B 1OB5A 5EINA 2XE7A 3LA6A 2ZYDA 1VRCA 4P5PA 3PD1A 1TZCA 2DTDA 1BVRA 2RGXA 1PV1A 4DIBA 3UAOA 2VQDA 4LOLA 4D4LA 5GY7A 1QG0A 2ZT5A 4R1LA 1YIOA 2ZT7A 3ZV5A 3FX2A 2X5XA 3OEHA 4JU9A 3AI1A 1TM2A 2QN8A 2Q2QA 1C9MA 3CPSA 2C7BA 1SOAA 3JASA 4YS6A 2J3KA 2PZMA 2HWXA 2RGUA 4ZT6A 4ICAA 1FFYA 4N1AA 1WZEA 1H6BA 3EF0A 3PF8A 3TCXB 1GGVA 3WYAA 2WMYA 1KI7A 3AM9A 5AJXA 4ZALA 5KNBD 4I1RA 4EI8A 3OM9A 1Y8RA 1WR8A 3CE6A 1T5OA 3N6RA 2I4TA 1IXRC 1T2FA 4KQCA 3ZHZA 4LZZA 3M89A 4H7IA 3E5NA 2W3RA 1USIA 1OE0A 2WR8A 1NM5A 4IDQA 3W9YA 3I9JA 4NV3A 3E9CA 1A8PA 5EQTA 4KXNA 3TCKA 3X43A 1GRQA 5AJWA 2NUBA 2ZSIA 4WUVA 4KVAA 2ZWOA 1KO7A 3IUEA 3GLKA 5K3CA 3UFBA 2BWJA 2ATIA 2FX2A 3G5AA 3V7LA 3GFQA 4NDAA 4LGMA 2F59A 5EZSA 2P9YA 3ZQUA 3LLMA 2ECOA 5HYVA 4C5CA 1ZQKA 3PFHA 3MWKA 2M6SA 4ESEA 3WYNA 2VNIA 4AJ9A 4LMRA 4CETA 4PN7A 1B8VA 2IUYA 4YBZA 3RS5A 2OHFA 3N7RC 5G5GA 2AXEA 4I99A 2XC9A 1PV4A 4EL5A 2HSEA 4AECA 1ZH2A 2QRZA 1T5TA 1U2PA 4QZHA 3A2LA 2BV3A 2B1IA 2H1VA 2PSSA 3DFUA 2CFCA 2CMDA 2FMFA 3PMLA 5ADUS 4J90A 4TYQA 1BCRA 3OOYA 3OLWA 3QENA 1KGSA 4ZOQI 1U1FA 3HVKA 1QIGA 4EVQA 2I34A 1EGMB 4V2IA 1PG0A 2YKGA 5J0XA 2Y9PB 3MIIA 1J0DA 1JQJC 3DB1A 5IZCA 1L5ZA 3GEBA 4S12A 3AU2A 3K9HA 1XCBA 3D7RA 1RHRA 3OZRA 1N5MA 4KPUB 1P0FA 3M4XA 1JR6A 1W0JA 3EZYA 1AUPA 4Z9AA 5I9NA 3DAGA 1KP2A 1YDFA 4P4GA 3U44B 1K5OA 1H23A 2YYZA 2DG2A 1JJBA 2GYUA 1RYHA 4EVSA 4ARIA 4QFMA 1LCIA 5L4NA 4DB2A 4S04A 4DA8A 3HACA 4TMZA 2YMLA 2OZVA 3RTBA 4D6PA 7ICFA 2W8KA 1GTL1 4DDKA 2EFDB 3GLHA 3A32A 4PAWA 4RANA 4YRGA 4PC3A 4EY8A 5DULA 2AXPA 1XCGB 1MVLA 2G7ZA 3M6UA 1CNEA 1TJ3A 4N4AA 3I6MA 2GRUA 2XBUA 3N3AC 1JKMA 5A62A 3CB4A 5LMUB 3VH4A 2B7BA 1SBNE 5DNYB 1Z2PX 2FZLA 2GM9A 4CM8B 1E2UA 2F67A 1QHYA 5T4HA 3WK7A 4LFAB 2PRKA 3OETA 2OAQ1 5K8TA 3DAOA 3H1BA 3NORA 3RWMB 1CLUA 2XADA 5K3AA 3RVSA 4DLBA 3H1PA 3NKVA 4FPXA 3F7MA 4XOIA 3TQ1A 2X8JB 3AR7A 3GFOA 5IC6A 1TVKA 3RU7A 4HNQA 3HP7A 4V0QA 2IYFA 2F77X 5BN4A 3N2KA 2WMOB 4ZO4A 3CKKA 3IO5A 5TC4A 5CB0A 3OHPA 4UZSA 1D6SA 3UCEA 2PXCA 5BUCA 2PUWA 421PA 1GARA 1XHLA 3E58A 1XMQB 1SRQA 1CUKA 3FMVA 3P9SA 3ICEA 1YR3A 4J1TC 1Q1BA 5FWDA 1E92A 4OEHA 3FSJX 2JANA 1OXVA 1KDYA 4J9KA 1N1DA 3ANNA 2Y3IA 4WMLA 5IFLA 1T5LA 4K2HA 5BOSB 1JG2A 2VA3A 2CLKB 2YUIA 4O2RA 4RM2A 5EIHA 2H5EA 4JD5A 5D85A 1BEZA 2K8BB 4EGSA 3ZD9A 3TZCA 5EYPB 1CTQA 4CL3A 3W1VA 1GZ3A 5JMTA 1EDEA 1YK0A 5FA6A 1SKYB 2P4UA 4R40A 2RGCA 5DN6D 2NZJA 1WP9A 5T64A 3EZFA 2EF1A 1ZC3A 4IH9A 4DRZA 1QZXA 1NJ6A 2V9ZA 3RKSA 3WWYA 2IVFA 4KU4A 2QYSA 3ZE7A 2HCJB 3MK31 3BJIC 3L9XA 5F5XA 3HVJA 1QU2A 2GHRA 3PEVA 1D4FA 4IFEA 4PSVA 3T41A 3C87A 5JNLA 1SPXA 4KG7A 5GZ6A 3AVQA 4MLDA 3T9BA 3IAAA 3F2DA 3DDSA 3T8YA 3ME5A 5GTDA 3GLHE 2H1HA 1DT5A 4CTNA 4CDGA 1JLSA 1DMSA 1YB5A 3KYIB 4C8MA 2JAQA 2EG9A 1FRVA 4PFJA 2YVQA 1T9ZA 5FQOA 2BN4A 3G1TA 1E1DA 3ANYB 3EDMA 1Q1AA 4QJ3A 3DW3X 5A4MS 2F62A 2G9RA 5AW4A 4F4DA 4B3XA 4ZHQB 3PJDA 1NKVA 3FNGA 2P3SA 1RKBA 5ALNA 1GTVA 3P9QA 2FRVA 1BXRB 1QHSA 2HDHA 2J6CA 2X5OA 3DEYX 3HLKA 1L1EA 5KFBA 3EZXA 3HBFA 4HWTA 5TY0A 2E1PA 4HUJA 4ZIRB 1FTQA 3IOCA 3SOPA 4IL6U 1U7PA 3QU7A 3C6MA 1MV5A 2JAUA 1PR2A 3A4TA 3GFFA 4L2IB 1Z2DA 1UJ6A 3SGLA 4PV7A 5DNVA 3KOOA 3RFVA 3ETGA 3OWXA 3PUXA 5EE5B 2J3HA 3LF1A 4ZCRA 3CW9A 1W88B 1QYCA 4AJJA 2FPRA 4BYGA 4AURA 3KYCB 7REQA 1GNTA 3Q1KA 3GCWA 3PT5A 5JTUA 4Q45A 3FNQA 4BTEA 4G8DA 3KAPA 4IX9A 1G6Q1 4NBKA 2Q5FA 4HQKA 1ZWLA 3PCRB 2WICA 2W8BB 4MS4B 5HJ5A 5KX5B 5J0TA 4Y2UA 3HFRA 5TZVA 5K05A 2FPPA 3NHBA 2CEKA 2R7AA 3VC1A 4CI9A 5CK5A 2CC2A 1FS4A 4XD2A 3G8BA 1I1QB 3SEAA 3BRCA 1Q5PA 1BPBA 1CUZA 1KHTA 2HMXA 3KOWA 2BPCA 1BXGA 1SCUB 1V2HE 1XQXA 1YU9A 1CZUA 2H1SA 1IQPA 3OEHD 4XPIA 1F1BA 2OC9A 3OZDA 1Z7YA 5LZ5A 3LL4A 4WOPA 9ICBA 4GXIA 3WISA 1ZOIA 3ZZ1A 5AH0A 2BIFA 1XEWY 3E53A 5ALVA 2LXNA 3JD3A 4BBPA 4KQ9A 5E7JA 5DHRA 4D9FA 3PEWA 1VDZA 3D1JA 2NTJA 5D87A 2JLRA 4F4KA 3F3SA 2J3DA 4A0QA 1RKXA 2RDIA 1X7YA 1IY8A 1ADFA 2FQQA 4GLFA 4BQFA 2ZKIA 1TTTA 2GD6A 3R40A 4NAHA 3JY6A 2H1IA 4L16A 4B6QA 1OY1A 1Z62A 4O3SA 1NASA 5CEEA 3HYCA 4PHHA 1LS1A 4ZYVA 2IHBA 3ZWDA 4LDPA 3EQ7A 1HPLA 1JEQB 4EJ0A 1ZQGA 1P7DA 3AG6A 5LXTA 4JIMA 1GPH1 1NBAA 5A5VA 2A58A 2XQIA 4MXDA 1DRVA 1Q21A 2A5LA 9ICMA 1QGZA 4Q66C 3FOEC 2IYQA 3DMTC 1RXWA 4E11A 1GVHA 1EUCB 2Q5QA 3LBFA 1DCFA 1G291 5JSZB 4XEUA 3X1XA 4B3BA 3P0JA 1T24A 4E08A 3L3FX 4EKGA 3TQRA 1MPTA 1SIWA 4GKAA 3ZXUB 4RFSB 4RH0A 4HQLA 1A8IA 3REGA 3ESBA 2AW5A 3IB3A 2OCAA 1B43A 3EZNA 4IDAA 5B5EU 2PZEA 2PKEA 9MHTA 2QMHA 2C57A 4BMSA 2DPYA 2EZZA 2PG3A 4NL9C 1A5AB 1PFYA 2H06A 1GDTA 5CT5A 2G6TA 4K9QA 3HJTA 4D0NA 1E9EA 3K9WA 3L79A 3C3BA 2A5FA 3IB6A 4MCIA 3C3YA 5DEOA 2VXOA 2IYAA 5K3SA 3QEJA 1U0BB 4O9MA 4WJKB 1M0WA 2C00A 5FL7A 1ABFA 2UYCA 3GJYA 5HX7A 5AOCA 3D7MA 4CCSA 3ZV3A 1GNVA 5AJVB 1PW5A 3KVYA 2IDZA 1HEYA 2Z2IA 5JYBA 1VPDA 1Y1LA 2ZIWB 5YASA 2PUBA 4PWYA 1CR2A 3ZZ0A 3DCIA 3K6SB 2WB2A 4EFKA 4E5UA 1TT5A 3ZLBA 2XI4A 2YJGA 1HQYE 1IXKA 4P93A 4KPEC 2Q4TA 4QDTA 1WCXA 4TSRA 2DWPA 3MJVA 2CLEB 5HRUA 3E8SA 4ZCIA 4HL6A 3T9FA 2G9ZA 2HF2A 4YJHA 1WHSA 4N3CA 4Q1AA 5HBGA 1U2EA 3L92A 2M0NA 4L8VA 4YJ3F 1S10A 5DASA 2WINI 4R2LA 2G5IB 4GU5A 4BLUA 3TTUA 1AN9A 4G84A 3PFBA 4FYYA 3SQOA 5J58A 2W0SA 2VNJA 5K03A 1J0AA 1ZEMA 3TOXA 2JR5A 2H3VA 4Y30A 5J59A 4Z6CA 5G1PA 2Q3DA 3GOQA 3HL4A 2PS3A 2FW1A 1TA0A 3EEQA 1AMUA 3EZ7A 2ON6A 1VKNA 4WDRA 1SBCA 1UKAA 4ARZA 4KIUA 3RE1A 1I3NA 2GERA 5AVVA 1RAFA 4QM6A 4QECA 4JXJA 4IAOA 3GJ4A 1ZVMA 4DV3B 5TX7A 3IFSA 3GHYA 2JFHA 1XDDA 4IYJA 1H2BA 1ZMOA 4Q7JB 4O6VA 3H4BA 1CRZA 3CUKA 4HDNB 2LPEA 1I32A 1J8FA 2D1YA 1P77A 1BYIA 4GVPA 4KGVA 3P2JA 1T5SA 4Q9LA 2ZB4A 3KJEA 4RO0A 3KT3A 2XT6A 1JGTA 1MA0A 5CP2A 5ERXA 2QT9A 1XSNA 1L7EA 3R5FA 1ZETA 2V5AA 3OUUA 3DMYA 3P2IA 4LRSB 4MRNA 1T6ZA 1I3CA 2H0AA 1MG0A 4R2XA 1CRWG 2Y0SC 3FC4A 4JQYA 8ICNA 5LR6A 2PRYA 4G63A 2A78A 3IJRA 5F3RA 2G5GX 3DOFA 3H4IA 2QS9A 4KLZA 3L4EA 2OEPA 4POAA 4E2WA 4AMYA 3A3NA 2XYQA 1QHIA 4XQ8A 1ZH0A 1JKIA 2QJOA 4B9NA 4JLWA 1UJMA 5J3JA 4EGQA 3DMNA 4IMJB 1EUYA 2JW5A 1PJLA 3FLBA 1PLJA 4IVRA 3T7TA 5E1MA 2ZR7A 1I4WA 4ND5A 8LDHA 1AQ6A 5KJEA 3WL6A 4IQVA 2W6JA 1YFKA 4QXRA 4CEJB 1PN3A 3ZJ5A 4C7ZA 4ZT5A 1DXOA 4F45A 1K5HA 3Q88A 4P32A 3WLEA 3HRKA 1B6TA 1AURA 1GN9A 3FUXA 2RGNA 2CZGA 1VJRA 2XGSA 4RZUA 1SY7A 4PNEA 2HHCA 1LV7A 1TXGA 3DKIA 2IOQA 5L1MA 4DQXA 4A36A 1ZWKA 2O3SA 2HR1A 5C3UA 1XKQA 3MT0A 5DKFA 1HV8A 5CW2A 1P0IA 4MWZA 4ZAYA 3IQFA 1KMIY 2GJKA 4HOYA 3UJBA 2FH5B 3KHGA 2R48A 2YB1A 2A9PA 4EATA 2C2DA 5BYKA 1H3EA 2QAGC 3LDFA 2IBTA 3AHJA 1PG2A 4OH1A 3HMKA 4OFBA 3DTYA 2R68A 4BN0A 2LKDA 2WJJA 5LQKA 3ETNA 3SLKA 2O1XA 4FZRA 2IHMA 2GLEA 3A9UA 5ECWA 4I2HA 2JAXA 3LYSA 5BMVF 3JPWA 1Z15A 4F0JA 5KTTA 2QB1A 2W2PA 3W5UA 3DYIA 3WIVA 4JU8A 3EPIA 1FXUA 3ENZA 4N7RA 5EJ5A 3GZJA 2E1EA 2CFIA 5EE3A 2KBFA 3LC7O 4JVSB 1CX9B 2WJ4A 4MA5A 1JG1A 2OILA 3V72A 1PEKE 1IBSA 2JZCA 2NZXA 4KV9A 4O4HF 4C0AC 4UPEA 2J3JA 3HZZA 4KLQA 2OGWA 5FWAA 3TMAA 2GRAA 4H7JA 4R16A 1XD2B 1AO3A 3TI9A 2WT9A 3KHLA 4CIYA 4I9UA 4EG4A 3EULA 3W1WA 5JTTA 2GPJA 1Y5LA 3WOVA 4FYXA 4K05A 1Y3BE 4RE5A 2QY6A 4R5HA 2NV6A 1SB9A 2IHKA 4MYSA 2WYUA 4EMBA 3DMHA 1OZ0A 5D1NA 3PNVA 4I3FA 1LI4A 4XDYA 4XJSA 3U3XA 1X9IA 2Q1TA 4BRZA 5CUQA 1FDRA 4PGXA 4BGIA 1V2GA 4FDTA 4BNJA 3WR5A 4EEXA 1L4UA 4XAQA 3SEZA 5AJZA 1WV0A 3UPUA 2DPJA 1GPJA 4LSMA 3R3HA 1PZGA 3R7LA 3RDPA 2QN7A 3T15A 3LCUA 2DM6A 1T3ZA 2BGMA 1AF7A 3M1YA 5AM0A 2XGJA 2XQFA 1A6SA 3QELB 1NTOA 4PY2A 4OJKA 4JLUA 1U63A 1F4PA 2J6UA 3OZXA 1RRCA 2VNSA 5HDQA 1ZQXA 1GO3F 3MOSA 1N5JA 2FYTA 5I5GA 3TLGB 1Z47A 5A7GA 2HLNA 2QLFA 3RU9A 4UBLA 2J48A 2BFCB 4UM8B 4QFBA 3N2IA 3P2EA 1HFKA 5CDHA 4BAZA 2OBXA 3ULKA 1EVJA 2BKVA 2OV6A 1U9JA 3ACDA 3PCTA 3W9UA 2NUTA 5KMGA 1NVXQ 4UQPA 3BSSA 3F5DA 2ZVDA 1Q1QA 2G83A 4P2HA 4G26A 1E5QA 2FZKA 3H1FA 3RT1A 1YT5A 2HF9A 4LZNA 2RMKA 1KEEB 1BWSA 2HA7A 3GA5A 4IUDS 3Q7QA 5SY6A 4MMYB 4KSBA 4DUPA 4OPMA 1AY0A 3OU7A 1H8HA 5DISB 4ID9A 5ALUA 2A0FA 5J2DA 4RJKA 4RWZA 2P2ZA 1J1IA 3ABRB 3E9YA 1L5HA 2V3WA 3QZ7A 5JXHA 2XA9A 4ZARA 2E7ZA 3E35A 1DCTA 1BQEA 3K30A 2IS2A 2YWJA 2FEMA 1PHPA 2JBWA 3P0RA 2O2DA 3DFFA 4NIMA 4PQYA 1FSSA 3UUGA 3S1LA 3W9BA 4FM9A 3QHPA 2W7TA 1EK1A 4JJZA 1I6LA 3MELA 3N0RA 4IMIB 2IPOA 1NMZA 3LTEA 2FR1A 4Q44A 3N86A 3H5RA 1RBYA 4F7DA 2WWFA 3JAWB 4OCZA 2LE0A 3G7SA 2V6GA 3TOVA 3VO2A 3C6QA 4RK4A 2EANA 1RADA 3AR5A 3QLEA 2XVXA 1BDJA 2DXIA 1IY1A 3E5HA 3SQIA 5GONB 4R2IA 5KFXA 4I6JA 4MULA 4E21A 5EHXA 1W29A 2OCKA 4K88A 3RWBA 1RR6A 2FRDA 3PWZA 1NBWB 1JMSA 2O2XA 1XHFA 3IEKA 4X65B 3F53A 3EOZA 1BWPA 2VSYA 5DB4A 2B9VA 1V9SA 3JAMA 1FDOA 5C52B 1QGYA 1YUMA 1H9CA 5B30A 4BX0A 2OGSA 1JX6A 3NDJA 5DG8A 2O8BA 1RYBA 2PMWB 2V9PA 4ZOLF 1W2WB 4RNOA 2QYOA 4RHUA 4MGHA 1D2CA 4P4OA 2YXEA 5FPYA 3KLBA 3HKZF 2GBPA 4KQFA 3VHXA 5CITA 2OCLA 3WQQA 3T9DA 1VMAA 3L7BA 2P66A 1B6GA 2EH9A 3OPXA 2QY9A 5SV2A 3R6LA 4F9TA 1ZRHA 1JSCA 5DLQC 1B1AA 2W2KA 1EFPB 1SJ9A 3NGDA 2ZRKA 3Q9LA 1F8FA 3OSUA 1VOTA 4W5NA 3MM4A 1GRCA 1AA6A 3EUB2 5JV5A 1W19A 2QLTA 4FR2A 3G8DA 3FF1A 3U3RA 1ZQYA 3K9NA 4JI5B 3ZQJA 1M8FA 2FWJA 5HGJA 3OPVA 5BN5B 4BQRA 2JVKA 3PFIA 2JJMA 4ADSG 1IJBA 2W58A 1CHNA 1HYQA 5HGXA 5T6MA 3A6ZA 3NNNA 1X1AA 3AIOA 1OLOA 1D6MA 5EJ2A 2JH1A 4ZEOA 4CRWB 4W4TA 4U2GA 2PXHA 4L50A 3VZRA 4ZYTA 4DMUB 1WQ1R 4QNMA 4UCQA 2AC2A 1CS4C 1FUKA 1X80A 4UUMA 4WCDA 2X19A 4WUTA 3DLCA 2OHGA 3B2EA 3CX8A 2YIMA 4PVDA 5K4GA 4KLDA 4QVKA 4NSNA 2ZRLA 4D02A 3GA0A 2ZRNA 4HVLA 3OT1B 2ZJ6A 4Z3OA 1J8MF 1PVOA 1QWOA 2V7QD 1TQDA 2BAGA 3ZTTA 3UWDA 4EMSA 3AERA 2Z6QA 3B0XA 3OG9A 4H0NA 1BMDA 4MKZA 4JLAA 4KMRA 1N0VC 1ZGZA 3GLGA 2LV8A 4Q47A 4BATA 1RWNA 1YZ7A 3FA2A 5IVIA 1AXEA 4GT1A 1L5FA 2BFDA 3EGEA 1JT2A 1QNLA 1AB6A 2W6JD 3PVXA 3PD0A 3LBNA 2X86A 2I7DA 1CUCA 1GAQA 4OGFA 2IXGA 2PKCA 3BULA 2ZRDA 3ZJVA 4J0GA 5I7SA 1V38A 9ICSA 3EXHA 3W9SA 4MFCA 2WTBA 3LZCA 5CG1A 1KNQA 1TIBA 2D1SA 2N9UA 5ALZA 3ZW8A 2DBYA 3X0DA 4M83A 3CVUA 2IYNA 2DB3A 2DBQA 3HSSA 2ETVA 5EIBD 1W36D 4ZVNA 4R01A 2B98A 3SOZA 1QRDA 2XUKA 4B73A 3QU4A 4PLGA 1GKYA 4KMSA 4J03A 4BUGA 1YHZA 3FVTA 3TD6A 4N41A 1VJCA 2BELA 4IFBA 2FQYA 4MDHA 3INNA 4OLJA 3W2EA 2NU7B 4ZCTA 1S02A 2NP7A 2R8IA 3KV3O 1KZ9A 2JCVA 3DP7A 4QZEA 3U9LA 4DBLE 2AS0A 3P2YA 1CEXA 2O2CA 2V0CA 1ICIA 1G7CA 4NLLA 1JIUA 3J81j 4GPZA 3EGWA 1AV6A 2QRVB 3PIRA 3MG9A 5LVAA 1IXRA 3RYFA 3DMPA 5DPMA 1ENYA 1J6UA 4HK4A 1SM4A 4HVTA 1HSZA 1QGUA 1GT6A 4B34A 2W6NA 1E7YA 1B41A 2VBGA 2IV3A 4GL4A 1WMAA 2Q2OA 4O63O 1ADCA 1VLMA 2ZWPA 1S4MA 3TR6A 1UBGA 3E2IA 4QREA 3U4CA 1ZD8A 2R18A 3E3AA 3VUFA 1XRRA 4B17A 4AN1A 2QTFA 4NLBA 4KLOA 3C1ZA 8ICQA 3PSAA 1YZ3A 8ICXA 4XB1A 1YQ9A 4LXXA 1VE1A 5K4AA 1KY4A 2C7GA 4ED2A 3BHMA 5EIBC 1W36C 3OIUA 5KSYA 3P2KA 1IOZA 1CQZA 2VUIB 1EB9A 2VF5X 4CM6A 4RQNA 5JVDB 5HS4A 1K63A 4OI0A 3ZIDA 1L8OA 1W1IA 1Z7EA 2EQBA 2W8ZA 2OAEA 3F5QA 3I2IA 2IYEA 1E2LA 3K8OE 4J7XA 3ZJYA 2XITA 5AM1A 3DMDA 4N7MA 4U6SA 2JIQA 1EFKA 3EFBA 3CNQS 5KNBA 1IJKA 5J2AA 4I0WB 1ZHOA 4WEOA 1VG1A 5EUMA 5JMWA 5KT2A 5K0EA 3RFUA 3RYHA 2BF7A 2CDNA 4M9LA 2W4IA 2QI9F 3ZNPA 1GPDG 1T8TA 3ZE1B 3MGBA 3KKOA 3VU3A 4BZWA 3IV7A 5IEJA 3RABA 4KUGA 1IONA 1V7QA 2XSZA 1KLNA 2EAMA 3RSZA 3PGVA 3IAM1 5CM9C 2VWGA 3TSCA 4WINA 3ROQA 3OQPA 2CHGA 4EABA 1D7OA 3ZQ6A 2IU6A 2YDXA 3N39C 2QT0A 1GTG1 1EK2A 4HQRA 3C8MA 4TRNA 4YVZA 4RKRA 3A1WA 2Y1DA 3RC8A 1OD6A 2Q4EA 2NXNA 4MYCA 3LY5A 4W1SA 2MSWA 5A9SA 1OI3A 4XTRA 4MLCA 3LO5A 3ET4A 4LV6A 4P4NA 4HS4A 3ZVLA 3L18A 2P2YA 1NBIA 1KYVA 4B3FX 4J1NA 2NXEA 4NR0A 1JJIA 3A37A 1RYFA 1DTWB 4CCAA 5BQFA 3B3QA 4LOJA 2II6A 1H8HD 4PNHA 1S5LU 3RF9A 3RTDA 1XPOA 1YC5A 3JCZA 2NO7A 2QL5A 1QSSA 4IHJB 2J9FB 3I58A 1RRFA 4DF8A 4RTOA 3L06A 4IZIA 4KMOA 5EJ8A 3C14C 4IDGA 3QKTA 4QOGA 4P1ZA 3V4LA 3RANA 1AKEA 3DVSX 3DNPA 3OICA 5B3AA 4B6SA 1C7ZA 1TZ2A 3MS4A 4KXVA 3HJBA 1O08A 2A59A 3V4FA 4OJMX 4TTJA 1VCHA 1WB9A 1ZN7A 4CODB 4UD2A 3UMMA 4NBUA 1UT5A 4J1TA 4A8TA 1A4RA 2MRLA 4ZEXA 4FFRA 4QEDA 4FZVA 4ENVA 3SZ3A 4KXQA 2A94A 1OC4A 3QW4B 1E1RA 3SR3A 1BN7A 1T4MA 5KFGA 2JASA 2B78A 3NVKI 5D84A 2CZQA 3L4SO 4FYPA 3QVJA 5BNIA 1GZHB 4F9GA 3M5WA 3N9IA 3NBAA 4I1UA 2NMVA 4XD7D 1G7SA 1KEUA 1NT2A 3EG9B 2NO6A 1T4GA 2C1EA 1HRKA 3CWZA 3DWEX 4G0PA 3LUPA 1TO2E 4JLPA 5AIAA 3SJAA 2W3SA 4BY9E 2XIDA 3OMXA 4EKIA 4FOPA 1AQYA 5HUHA 1ZISA 4KLIA 4H1UA 4A92A 1X9WA 1DBPA 2V6JA 2BT4A 1PT7A 1XFDA 3KOYA 1Z4KA 3Q6NA 5FBQB 4U7WA 1HMPA 4GOND 1Y6ZA 2NSLA 3BWEA 4I36A 4PBRA 1NK9A 5C4MA 4ZD6A 2W90A 3HSYA 3MGCA 3UMGA 2MU2A 1CNFA 3ZHSA 4GI3A 1DV1A 1EVIA 1U8XX 3A6JA 4PO9A 4F3RA 1G5QA 3GWGA 1JHUA 2EIHA 1RI3A 2WKPA 4KN5A 4RTLA 1QO0A 1EESA 2VT6A 1G3UA 1GXSA 1VMEA 2P91A 4DHEA 2PUDA 1FFUA 4C4OA 3NYIA 4OXNA 5GTHU 4M7RA 4P4UA 1P5HA 5AK4A 4G0QA 3Q15C 3R74A 1DELA 4RTRA 3E7WA 4QU8A 3MA0A 2FRDC 4BLSA 2WTFA 5J2GA 2QROA 2FNAA 2HHQA 1E5XA 4E4RA 4CKZA 1A1SA 2LI6A 1U3GA 2R47A 3F2BA 1ISMA 5FAXA 3AOGA 3PUJA 4Y1FA 1MVNA 3DEJA 1VCOA 3UUWA 1NBOA 2K5UA 1Y8QB 5TQVA 4PL2A 3FZNA 3THWA 2MSLA 4F6LA 2O59A 4WA8A 3A4NA 3EVDA 5BVGB 1TYCA 2F3SA 4I8IA 2PSHA 3UGTA 1B7GO 1CJBA 3MJRA 4II3A 4M2YA 1TK3A 2AJBA 3AP3A 5B6JA 4QQRA 1OJ7A 1Q11A 5H3CA 3G9TA 4RD3A 5G2OA 2MUTB 4UE6A 4UE2A 4C7OB 3JVDA 2PRZA 2YWRA 5E6RA 1CUAA 1FA9A 1IPEA 5JH7F 4XE5A 4XWYA 1JEYA 4F3CA 2VK1A 2JLXA 3KR1A 3I5MA 4KLCA 2R2AA 5T7BA 3AEVA 4EB6B 2BCUA 4CLDA 1H0SA 2B34A 4MR7B 2D1QA 2NPIA 1T26A 1ENPA 1VSQA 2Z58A 4WLEA 2I9PA 5BMVB 1KY3A 4J76A 3THSA 4L51A 4M37A 3PU6A 2XGGA 3T9EA 1R6DA 1I10A 4S1PA 5BOMA 2IBMA 1OPXA 1NFFA 1T1RA 5J43A 1VJ5A 2FQ1A 3SU8A 2NQ2C 1CQWA 3TM5A 1FX0A 3QE0A 4QBGB 4DLVA 4XM0A 4YCJA 3NAMA 4KYUA 4R7TA 2ZIZA 2R2GA 2EBHX 3FYUB 1Y7PA 2Q3HA 5K8CA 2P6OA 2W2MA 1AS2A 1O5TA 4QVIA 5C37A 1CRLA 2ACKA 4OFZA 2ZYWX 1T6YA 4HXEB 5EP1A 5DNCA 5DGIA 3AFGA 1DOAA 2Y4NA 2F76X 2E9SA 2FPSA 5BSVA 1RZ3A 3IUSA 3DE4X 4EHLA 1I5RA 2EGUA 3QTLA 3FRHA 4XSVA 4EB0A 1Y0BA 4L74A 5IX8A 3E7XA 4GX0A 3G7UA 3TQCA 1LUAA 1PD1A 4MV4A 3HS3A 5JARA 2FF5A 2PS9A 2ZRIA 1KPGA 4RK5A 2D8MA 1XHEA 3K8YA 5G3ZA 5EFZA 3SZ2A 5HILA 1V16B 3OF3A 3DZCA 2QQFA 3GQBB 2IEIA 3MAGA 5IVPA 4Q00A 2I8AA 4LJ5A 1L6IA 3VM6A 3EXHC 3PFCA 4FFMA 1S7GA 3WSWA 1U6KA 4G85A 4D9MA 3RLFA 4U4AA 5GAJA 3GJ5A 1PJ8A 3ZW9A 2JI9A 2WU0A 1XA0A 3FUCA 3DMTA 4FT2A 3IDAA 1PLLA 2A1TS 4NJOA 2QD3A 3H0LB 3ZE9A 3KL2A 5GZ1A 1QOZA 5EY5B 4Y7CA 1JA1A 2ZUCA 1QLNA 3VSAA 1IN4A 4MQEB 3SAJA 2KLHA 2ZS9A 4H3VA 3L6BA 3NAQA 1UKZA 3L43A 2HW8A 2ZBFA 4NL9A 2BUCA 3COSA 2KZ3A 2W4QA 4Z54A 3FYHA 4JCCA 5DP2A 1DDIA 5DM60 3KJIA 4DLGA 1MIOB 4Y6RA 2YWDA 2OD7A 1DV2A 1DC7A 9ICWA 3HJFA 4PNPA 4FJ1A 3R6GA 1TPZA 2VIXA 3H0CA 1Z3CA 2YWXA 5TS2A 3BVPA 1J0EA 1HTTA 2HNAA 2KMDA 3HXOA 2XSZD 3O7MA 2VDPB 4OB6A 5CDTA 2YJ5A 1RI5A 1IHOA 4M1QA 1ZA1A 2FPXA 4TLDA 2PUHA 3LG2A 4RE6A 4UMVA 4FNMA 2YOFA 3CLKA 1X1BA 2EBFX 3KKMA 1ECLA 4K2AA 3QBDA 3SHWA 3WG9A 4UTRA 5JCXA 4DQRA 3DR3A 4BQEA 1J2NA 4B7UA 3NEPX 2G5TA 4AX8A 2C8JA 3FPFA 1X39A 4H6VA 2QLMA 5IDVA 5FAKA 1G64A 2GTPA 4OJYA 2EYQA 3AUAA 3V8EA 2MWMA 2QSUA 1GZDA 4CMBA 2PWZA 4B82A 1DAIA 1TF2A 3JQDA 3M2TA 1G2QA 4FX2A 4Q9NA 3LCCA 3K8ZA 5BYAA 4YRIA 4OU4A 1DIHA 3EARA 4WBXC 1M66A 4YMLA 1T5DX 1OIVA 3CLSD 1P81A 2H2IA 2O2SA 2JPDA 1E9SA 4DFMA 5EIOA 4DOMA 2Y77A 3A70A 3G5MA 5FBWB 1CR4A 3QIVA 1CDZA 1A4XA 4M99A 3TIIA 2EHDA 3JQCA 3UPTA 1MJHA 1OLSA 3GBVA 3HDJA 3V6JA 2ONCA 1RSZA 3TW8A 1KPHA 1XSPA 2DUMA 1E2EA 5KQGA 4WLNA 2CDCA 3IP4B 3R0ZA 4AO6A 4YO8A 1XL0A 4D8UA 3GUYA 3ADPA 3UAWA 4C7BA 1DBVO 1U8ZA 1ZLYA 2H4ZA 3WK5A 4CR8A 3PX0A 2E6UX 2YC2C 3GVHA 4MUBA 4HWKA 1HNZB 2WKSA 2GEKA 4D8WA 3UZUA 1GCGA 2E3JA 1E1RD 1XN4A 3OMWA 5KT7A 3KAQA 2ZSFA 1O4WA 5HHTA 3JZAA 3FBTA 4REMA 1WETA 1YQTA 3FHLA 2BBSA 4GM1A 3HCCA 3FTFA 1E66A 3UMFA 1KK2A 1I6MA 5DU2A 1YZGA 5K0FA 4AMZA 6REQB 3AHIA 4KQJA 1FTSA 3AGPA 4CFYA 2CPRA 3CF4A 4TKUA 1H38A 1U2RA 5JD4A 3T5KA 4DQ0A 4BOYA 1KKXA 3F1KA 5I4KA 2XE6A 3E9QA 1KQPA 3H11A 3CLSC 2HQBA 2BSXA 2H57A 4MA4A 3HKBA 1UBTS 2WJGA 3I1YA 4G07A 4MVJH 2I3GA 4DCCA 4W8HA 4XRRA 3DE2X 1FDSA 1KARA 3BQ0A 1S0OA 3QEMA 5IYZA 1V8ZA 2OWEA 6AT1A 3LRXA 4OH7A 1M2VA 2QOEA 2OV4A 2F1KA 2X9LA 3UT5B 4JEIA 4MV3A 5P8WA 1KWKA 4MKFA 4YA6A 3GJXC 3L1IA 1S0VA 4F91B 3MQ4A 2ZUTA 4E07A 4WOKA 1LV8A 3L1VA 3H97A 3M81A 4E5VA 2ZWAA 3R0IA 1QO0D 4HFMA 1H65A 4IGAA 1H85A 2BHNA 3KEQA 4UEKA 2Y76A 4DNPA 4HGZA 1LA2A 3RW9A 3RIEA 3F9IA 3LX6A 2VPQA 3U3MA 4TSKA 9ICJA 2GLUA 1Z3EB 2QAGA 4TX1A 3PX4A 2Y0PA 4Y6LA 1I2ZA 2FZCA 4LNAA 2O7NA 1G16A 1GA6A 3HN2A 2ADOA 1ATIA 1AKYA 3GRUA 2ZKLA 1Q3HA 1GPAA 2J6SA 4EHDA 1X8JA 3PIDA 1RFLA 2I2XB 3WY9A 5L3QA 3CBGA 5CJPA 4F04A 4F8JA 2CDAA 4MR8B 1MUUA 4UJ5A 3SICE 4LYYA 5F4BA 3HB1A 3HH8A 2VR1A 2A0XA 4UFOA 2HY7A 1FXWA 3FPCA 2HD4A 2OPHA 3EIEA 4JI4B 1LKYB 2JD0A 2ZRQA 4OJ5A 2CFRA 1U9ZA 5C7IO 3IUQA 2QVBA 1JEJA 2VXCA 1WAMA 1E3DA 4BMZA 3MUFA 3T3DA 3DTNA 1UZMA 4RAOA 3AYXB 2VEOA 4MFAA 3UJHA 4NJMA 2JLAA 5EMJA 1QO9A 1DOQA 1XD9A 2D7DA 1GCIA 2GZDA 3Q2KA 2B3TA 2OUKA 4RZIA 3A1FA 1CNMA 4LVUA 5BPFA 4ZOEA 2Y99A 3C43A 1E32A 2VDWA 3FFBA 5KNCH 2YJTD 4R84A 3REQB 4TURA 2VTVA 4L85A 2YS6A 3CSUA 3FKJA 4AMBA 3UA3A 1DKRA 4QU9A 3BQ1A 1QG6A 2MIIA 2Y6UA 3LY7A 3NONA 2FWIA 1O9BA 3U4QB 1Z5WA 1YTLA 5DG9A 3UUEA 4UQGA 4BBZA 3ROEA 2PGJA 3JQPA 4JJEA 4TZKA 4WKPA 3B1JA 3PQ8A 1RM0A 1Z0UA 3G2PA 4ZGBA 3NOOA 5D6NA 2X3UA 5PGMA 3N7TA 4FYVA 3LHKA 4K86A 4UB8U 5CMLA 4LGCA 4RKFA 8ICVA 4G1CA 2E1RA 3VR4H 2HU7A 2A30A 3UAGA 4HH0A 3E5MA 1NZDA 1ZXBA 3BK2A 2P77A 5A0TA 3T9AA 3LPMA 2G1AA 3LE8A 4AZ3B 4D4IA 2O8DA 3MAAC 4M38A 1GKLA 3JTMA 3TLBA 1O5IA 1V5IA 2OZLB 4JB0A 2P90A 3JYOA 1SAYA 1X9HA 5TARA 4P81A 3NLLA 1HSOA 2BMFA 1I3OA 3IDOA 2R1VB 1NOMA 2W48A 3QBEA 2IX9A 5IWAB 3PXCX 3UKOA 5B6IA 5HRAA 3JTEA 4F06A 5FI5A 4C06A 3CUEF 3SYMA 2D2IA 5C80A 2A9OA 3D2AA 2ZJ4A 4TLLB 3EQ9A 4DNFA 1PYDA 5TT0A 1WB6A 3F2IA 3O82A 3TBHA 2WSMA 3DBIA 5JJ5A 1A9PA 5DRTA 4FDAA 4O1MA 4TS3A 3RSOA 5HDBB 3NHFA 2JEOA 1HURA 4H18A 4JQSA 2YJZA 4HNRA 4NBTA 2DL0A 1MHPA 2B36A 3QVWA 5T14A 3TG2A 3F6BX 3K0CA 3TGLA 4Q7LA 2SKDA 1QLHA 4HF7A 4I4TA 1DO8A 2DFTA 2QTRA 1I7SB 5DB6A 3Q7PA 1NL3A 5F5LA 5BR7A 3GPCA 3MR5A 1U99A 4UTXA 4HZUB 3IHLA 2BFEB 1SUWA 4PZYA 3GC6A 3A05A 2OM2A 3H4VA 5T4EA 2QUJA 4IXTA 2O2YA 4LHZA 1TZKA 4M47A 4GI1A 3VKGA 3WE7A 4HGQA 4ZDJA 4BQQA 4FWTA 4DRXA 5BRJA 4L9WA 4DLPA 1HTWA 3H4MA 3B9JA 1QVWA 2R6ZA 1F0PA 3T3GA 2LP4Y 4DF4A 4RF5A 4QOEA 3C74A 2D0OB 3Q11A 4EQ6A 1WEHA 3IG8A 2C2KA 3A04A 4INOA 2BI7A 2Z3VA 4Q9IA 3JD2A 5DV9A 1BPZA 2C82A 1WS6A 4WY2A 4D8XA 3NOQA 3HR7A 4O8CA 3ITKA 4BTVA 4GO1A 3W5AA 3F9RA 1L7BA 2BCJQ 3K9FC 2XY7A 4JHXA 3BGWA 5B64A 4W9RA 4K6FA 4E3WA 1VHTA 2H92A 4CDNA 1XEAA 2AQ0A 3W5JA 3I6QA 1QUFA 4PO1A 2XDQB 2WWHA 3ED5A 3V6LA 3Q0EA 1R9MA 1WJGA 4PZAA 2RGAA 2VSFA 5BWMA 4JI3B 3SVLA 2GM4A 1Q1NA 1MQ9A 2X0DA 3OD5A 4OATA 1DRWA 1YBFA 4DE5A 1Y98A 4X97A 2XYVA 1BJRE 1QIMA 3RAGA 4P34A 3ASVA 3OJSA 3F3KA 2UYGA 2RKOA 3ELWA 4M9GA 1NQVA 5JAUA 2Q8NA 1YQXA 2JK0A 3ITEA 1GM5A 1ORWA 1OZHA 3TKLA 3TZQA 2H29A 2PN1A 4RVOA 4ISBA 1T34A 5DG7A 4KJZA 1ADGA 1Q1EA 4G0ZA 2JJ1D 3JYQA 3VU9B 2IHVA 1JKFA 2YV5A 4UOEA 4UB2A 3EIFA 2V7VA 1TEXA 1FFXB 1M3SA 2O1EA 3KKZA 2XUPA 2ZLBA 1OBFO 3NRBA 4N7BA 3VKVA 1C4OA 4WK0B 4WNIA 3LXMA 2CVPA 4YMWA 4F1JA 3UJ3X 2WFLB 2P8SA 3TIFA 1P4SA 1W44A 2XMRA 4ZFNA 3OO1A 4GF5A 3IDFA 1SOMA 1P9WA 2O0HA 4MRMA 3LYUA 5CVEA 1R0XA 3LKBA 5GJWC 4XVQA 5EJEA 2GEVA 3O0TA 4IO0A 3ROTA 1HUQA 2WI8A 1UKVY 3S2GA 3VKHA 1QVZA 3OTQA 2B6GA 5LOVF 3GT4A 3C1UA 4IKOA 2J07A 2F4VB 5HCNA 4NPAA 5B53A 3JYLA 2H1RA 2CXXA 2YFHA 1U3TA 3AUTA 1BGVA 1KDPA 3C0KA 2APJA 3PDCA 2ZULA 2RAUA 3Q40A 1M8PA 5FJIA 4G1BA 3A4MA 3X44A 1GGNA 5CYPA 1GQOA 1QAQA 2R8BA 1B0AA 2DX7A 1EXWA 2AT1A 3PA6A 5EE0A 2WYVA 2FI1A 3IE2A 4UCFA 3MSXA 5I47A 2LIPA 2RHHA 4HQ0A 4U5XA 2WT8A 3AY3A 4QWBA 3BWMA 4H4DA 3NBUA 3B1WA 3KJZA 4Q4AB 4OA8A 4JODA 3WZLA 4QQNA 3KZNA 2V7BA 4Z2AA 1UC5B 1WXIA 1AUVA 10MHA 4DSEA 4HEHA 4OKIA 2IYLD 3RJTA 4YWJA 4W63A 2XRMA 1BC5A 4L72A 4HTAA 1VGVA 5F9HA 3DEEA 4Q9HA 4C0XA 1I1OA 3QF4B 2V7QA 1T9DA 3X1ZA 4REQB 3TECE 5CDGA 5J2UA 4H4CA 5AKHA 4EEZA 2ZOSA 3EPKA 2ARKA 1E3WB 1NJ5A 3C7DB 4X0EA 2BY4A 4R3NA 2AG6A 3A0RB 1EHIA 1JVNA 3LIIA 5TGTA 2WAQF 2GZ2A 3ML1A 4NDNE 2DP4E 2IEAA 4DTIA 1XYYA 1XZDA 1DX9A 1U2QA 4EZEA 4DDVA 2NP6A 4P6VF 2LTAA 3LQ1A 3WKEA 4FUQA 1NW8A 3QVOA 2YRWA 3LT5A 3DWGA 1R16A 3E0FA 4LNHA 3EWAA 4OAPA 4E09A 5TMDA 2C29D 4EY7A 1Z73A 3VX3A 3WNVA 1AKNA 1P8JA 4YV0A 1E99A 2DQYA 1W4BA 4IINA 3F2CA 4RA6B 3KP1A 3RT7A 2CWDA 1F6BA 1LC3A 3PG5A 3BWVA 4M1EA 2NU8B 3RWOA 1I1HA 1P7CA 4WT7A 3IQEA 5K3EA 1JTVA 5L7YA 2PX4A 5CD9A 4O1HA 3PZPA 2MOKA 1BH2A 4AJIA 4AG3A 5KREA 3GH3A 1XRNA 3RSLA 4TPKA 1A0PA 2C98A 3F67A 2H59A 4A6PA 4JYPA 2Q1XA 4ZHSA 3IGFA 4QG7A 5KFMA 3QLVA 1DRGA 1TTPB 3DZIA 2QRMA 3MQFA 3GFBA 4HEA1 1MB2A 2TMKA 5JJIA 3BMCB 1RJFA 2M98A 3EFEA 4EY3A 1H2AS 3W2TA 4H4EA 5L6LB 3KYDB 5FV4A 4E2FA 3OU2A 3DV0B 1W85A 4DDMA 3V7YA 1W4CA 4ZQIA 5AM2A 4J4TA 2H3IA 5GJVC 1QPGA 2XTAA 2Z5LA 1FLVA 3E2EA 4DCJA 3F73A 3NANA 3FGNA 1NVUQ 4TMTA 4I1VA 5AW0A 1FMFA 4UEJA 5JS2A 3M0EA 4Q21A 5H0IA 2FVYA 4D9EA 1LW6E 4KDEA 4PYOA 4LJ7A 4Z49A 3KQHA 1J39A 3EPGA 1N2OA 2ORIA 3S2ZA 4WZAA 4ZRNA 3M4NA 4HWOA 1MENA 4Y2QA 1XEXA 4TRJA 4CKWB 1U0FA 2QWXA 3PC6A 2FMSA 2GF9A 5CXXA 2LIVA 3EEBA 1C1DB 2CJYA 4HJXA 3DE6X 4UHKA 3S2UA 4MKRA 1I94B 1IM8A 4MR9A 2LGJA 5BPCA 4H3SA 2B35A 3I9FA 5EVCA 1TCUA 4DRYA 2AK2A 5ALQA 2VHTA 2QRLA 5AVOA 3RAXA 1N7GA 5BR8B 5AR1A 1U4NA 1XZHA 5HSGA 5EXDA 2ZR8A 3RVOA 1V7ZA 4F4YA 1RBQA 3NUQA 3SXUB 1GU7A 4EF4A 2LD4A 1A9ZA 1LPMA 3R77A 2OXCA 4LG1A 2PWYA 4FONA 2YZGA 1CDEA 2X9GA 1LC0A 4D3XA 1Z8HA 1G8GA 4RTPA 1BGWA 3SHVA 2DEUA 4ZGWA 4AC9A 1M1NB 4Z51A 5DYTA 3G23A 4NCJA 3LK6A 3A6FA 1UWCA 2Q5JA 3SD7A 1NJ1A 3AY0A 4DG9A 3T5HA 1NP6A 2B6NA 4HAYA 4RL4A 1I5EA 4URUR 2VJBA 3AM3A 4GBMA 1F06A 4FZLA 4BRSA 3HA2A 4ED0A 3W8FA 4LDJA 4DJ5X 4C4AA 1T9GS 1WF6A 1UPFA 3CG0A 4ZH4A 1JDBB 4BNYA 4KWEA 3QKWA 5KG2A 2HTFA 4GI2A 6GPBA 4R8SA 1G18A 3ZGVA 1WW2A 5DRYA 2PZKA 3N2LA 3LVWA 4UFNA 1RLUA 2I80A 3A1VA 2VP0A 2EAOA 1N62A 5JY6A 3BQMB 4DG5A 2XO7A 1V35A 3AUXA 2QZ9A 3KJQA 1MRZA 2QVYX 5JCJD 3NHRA 4BKOA 4RULA 3K0CC 1HX7A 3U9TA 1JA9A 4KHZA 3ZIAD 4U9IS 1ZG3A 2QSJA 3ZR4B 4C8LA 2H2DA 2XF2A 2W0MA 5IINA 2XKJE 1R74A 5FOQA 3NBFA 2ZSUA 1EWTA 1G2PA 1RRVA 1BTOA 4LISA 1IHPA 1T8PA 4IRKA 3K1JA 3V3TA 4HDQB 2XX3A 1RWOA 1Z0KA 5JWHA 4L4YA 1C30B 3IP5A 1NQUA 1H6DA 1ZOSA 3UO8B 4UHDA 1WW3A 2DFDA 1QZTA 1DX6A 1YBAA 3E1GA 1AH2A 1LB2B 2P0EA 2WYOA 2WUVA 1R0YA 2G8NA 3BIFA 3ZDEA 3CUWA 4PZPA 5P21A 3CNEA 4XD7A 1RP1A 4KAAA 1NE2A 1VCNA 4MA0A 2FW0A 2KB0A 2JIPA 1I7PA 4HNVA 2QUKA 4KPUA 4YQZA 1QIHA 1IEWA 2PIDA 2EU8A 2CN1A 4Q3NA 4Y2HA 3U44A 3FDXA 3R0XA 4WPGA 4J29A 2C83A 4AJOA 3AB7A 1VQ1A 1GTSA 1YDWA 2JEFA 1K3UB 2AJDA 5IF9A 4L95C 1SZHA 2R8RA 1VB5A 3LBHA 4AG5A 4B31A 3H4TA 2VHZA 1DFGA 5LMZA 1T36B 3GCXA 4HN2A 1UIRA 1AUOA 4O25A 1TAMA 5D7NA 4O3PA 1U0JA 1KKLA 1ZM3A 2I6QA 4NFLA 5CEFA 1JXEA 1RWMA 2NWQA 1MEOA 1YRYE 2Q9UA 4H7DA 2Y0CA 2VIIA 1H42A 4KUEA 3INTA 4RJIA 1RCTE 3T5TA 2KSQA 1J5PA 5JS6A 3NG1A 4GLOA 4CM8A 3IEMA 1II9A 1N2BA 4JC0A 5TQ0B 4A6EA 3HYTA 2X0KA 1SB8A 4NH4A 3OHMA 2P6RA 4ETIA 3AUSA 1Z0ZA 1Z6XA 1WWVA 2X8JA 2PDAA 4JB3A 4IMPA 3T7IA 1IHDA 1XZLA 2XNSA 4O3OA 2CRXA 5DM0A 2PD3A 3O31A 2XCOA 3CRZA 1K6EA 3KB6A 2JAOA 4E5NA 4JC8A 1THZA 1DIAA 3H9BA 4C9BA 5F9FA 4HB2A 2YQEA 1GA1A 2ISPA 1V6CA 4TMWA 1T2NA 2IDMA 1ETHA 3QFFA 1V25A 2P4EA 1JQ3A 2AUNA 4J0KA 1FYWA 4Y1RB 2QP3A 3IJEB 5AT1A 1WZCA 1SXIA 5BOSA 5HMLA 1YZHA 1RJ9B 3GIDA 2WABA 1XYGA 4UATA 4R31A 1ZHHA 1P2BA 3VOTA 1ZUWA 2X15A 3TYXA 3LBIA 4J4BA 4M8NE 2X2EA 4OYLA 5KT5A 1PJZA 1KSJA 3EVZA 2BR4A 1XI2A 5EYPA 2V1UA 2I4OA 1RMTA 1YI0A 4UMEA 1CVLA 2BEWB 1GP2A 1VKZA 4JLJA 1YASA 3PEEA 4EJ6A 1PYOA 1YA6A 2Q5EA 3RS7A 2ZZNA 3N3BC 1C3JA 2H07A 4B0PA 3SN6A 3RG8A 3ZKWB 4TVKA 4RT3A 3ZHXA 3IAUA 1UZNA 2PL5A 4BWGA 1KYQA 1R5NA 4RTSA 4QL3A 1J9ZA 3D8RA 1AX9A 1SUFA 3L7CA 3T1NA 1ONSA 1QHFA 3RJZA 4J6EA 1TQ6A 1IG0A 4AJNA 1H94A 3H2SA 4FYJA 4UUAA 3RQIA 2Z8ZA 1U2DA 2FSIA 5CNKA 4ND7A 3FMPB 4I9GA 3TQIA 3DMGA 2GJ9A 4HAXA 3G2NA 3GROA 2GUWA 3K2IA 4I4NA 3MIZA 1W9MA 4MUMA 2OQVA 1L7XA 2X0JA 3EC2A 3ADKA 3K4QA 4WIAA 5IUNC 5LKRA 4ZHQA 2C5AA 4NEQA 1ZD5A 3MLEA 4BFCA 1E3EA 3KOUA 4COOA 2VG8A 4BFUA 1BXRA 4ZYYA 3CWQA 1X6IA 2FDCA 4QATA 4ZQHA 1OYWA 2F8TA 1YBVA 2WM3A 4LBZA 2BZFA 2FPIB 2OORA 3DSRA 5D4BA 4ARBA 5BXQC 4LUCA 4QYIB 5BWNA 4QO8A 4XA5A 4ZIRA 2N42A 1PT8A 2Z5GA 3RAQA 5ITWA 1LWNA 3PNOA 3UBTA 1ISSA 2B4TO 4L2IA 2R79A 4LA4A 4I5IA 1V1RB 1JWAB 3JWGA 3M7DA 1M2HA 1T1IA 4F5RA 3BB3A 1W88A 4NQZA 3EG5A 3KYCA 4H60A 4EG3A 1NW9B 4J8PA 1YS2X 4A8JB 5BSEA 3SZOA 2AI2A 1WUDA 1EP3B 4N47A 2EFHB 5DGBA 2HHSA 2HBRA 1U0NA 3COJA 3VU0A 2ET6A 4G5HA 1QANA 2BCVA 2HM7A 1Q14A 5HKKD 3TANA 4I2GA 1JAXA 3BMXA 1WCYA 3HPQA 2PZGA 3GLGE 2W8BA 2O7QA 4MS4A 3B3FA 1VYUA 5KX5A 5HFJA 3HZHA 2WUGA 2DERA 2FG6C 4PQFA 2J6BA 2AMFA 4C4PA 5L95A 1N5OX 3BHNA 1HORA 4ER3A 5AK0A 2GF0A 2Z95A 4AG6A 2IYRA 4MIEA 2FE9A 2RK6A 1P91A 1WKVA 1X1DA 4X71A 1JH9A 3QLVC 4DL3A 1TA4A 2R0QC 3H0EA 4RQBA 4AULA 1NYLA 4QGGA 3F4LA 3BORA 3MRXA 2HBJA 5IU6A 3VC7A 2DPXA 1SCUA 3K2BA 4LZPA 3TDMA 3C6YA 3TG8A 4DEYA 2FW6A 2J6IA 1NSFA 3ORYA 4TUYF 1J42A 3W3AH 3PNBA 1YNSA 4HGPA 5J0SA 4BU0A 4IJ6A 3ZZUA 5IJXA 5AO9A 4UTZA 2XJ4A 1YJCA 3ZHVA 1LPSA 4JENA 4JQZA 1LQ2A 3ID6C 2EHJA 3HYLA 1C7EA 1WKCA 4JP1A 1VSUA 5SZHB 5LU9A 3ZBPA 1G98A 4LI3X 1XWFA 4GR9A 3L6CA 3CX4A 3N8NA 1GYRA 2BBOA 2QTMA 1P1HA 4LF9B 1ZM4A 3PUKA 4J2OA 1M5UA 4MWSA 3W5IA 3R0VA 1P9RA 3OF2A 3OE4A 4LQDA 1KS9A 2X7HA 1JEQA 2KYRA 3A6GA 2ZPUA 4KK3A 3RVJA 3BPSA 4EHHA 1IC6A 4YJ2F 5IM4F 5E8JA 3MGAA 3PYXA 4ZRMA 3S1SA 1Z2CA 3CNHA 5FUVA 3P9XA 1KDVA 4Y2SA 2O1SA 4WFQA 1NI4B 1EUCA 3E7FA 2IGTA 4KREA 5JSZA 3DO5A 2QRKA 4TWBA 1EYZA 3GIJA 5K0SA 3Q8KA 1FU7A 1Y6JA 4YJ3B 3T3HA 4RFSA 4EO7A 3RNLA 1VIDA 3VAZA 4NCNA 2QE6A 4NXZA 4IJWA 4YCAA 3W5SA 4ZMBA 2CVQA 4QO7A 4M8IA 2XWPA 3V00A 1MAVA 2WSBA 3RRBA 4Z86A 3RRJA 2FN8A 1KKUA 3K94A 4O02B 4UVEA 2Z1DA 2XVAA 4FOTA 2GPYA 4YPOA 3WTBA 4C0BA 5CFMA 3T7JA 1UP4A 2F00A 2QPTA 1K66A 2PV7A 3WL3A 3GK3A 1MVOA 3DE1X 1E9VA 3RNOA 3FTNA 4ZT2A 1SGGA 5DP1A 3AEYA 3O1LA 1MP0A 4NI5A 4G0WA 2YX8A 4FHEA 2ZIWA 4C6TB 3BMOB 4EB8A 2MAXA 3R7BA 2D5AA 3DEKA 1PDOA 3VZPA 3K6SA 3H2YA 3BJMA 2XUAA 1P6QA 3D0KA 3ADCA 1KO8A 4I2EA 3L6UA 1V0JA 1L6RA 2QLNA 3DS8A 3Q8WA 1T2DA 3O83A 2EWWA 3DZBA 1KI2A 4UAGA 3R9KA 1BQ4A 1V11A 1IIBA 2X2OA 5FV7A 3EGIA 1UJ4A 1X2IA 1OH7A 2D1TA 3ZHTA 3CZ5A 2Z5VA 4B9UA 4MUKA 3TOSA 4E7PA 1E3MA 3UV3A 1Q1ZA 3G0GA 3I9V1 4B33A 4LJ9A 3IULA 3TOZA 1GRNA 2JAWA 3EZ5A 1I36A 2QIPA 1FDUA 2VNHA 3DA8A 1DAGA 3IR6A 2WPNA 2AIRA 4I5FA 4INPA 1W1UA 4EKEA 3QG1A 2H5JA 3TSZA 3EGDA 1N57A 3IQDB 2B4RO 3OPQA 3RS9A 4FZNA 1S3SA 3AETB 2KE7A 4FFPA 5JO9A 1CUEA 3IERA 1JIKA 3OLZA 3KJGA 4J7CA 4IIJF 4BGUA 2HA6A 1D1QA 1YJBA 1DC5A 4XWKA 1WX1A 3GN2A 3U7FB 5EEHA 3OSNA 1IVNA 4QGHA 4CF6A 5GP1A 4JYMA 3TRHA 4JWTA 3UY4A 4UBKA 5JD6A 1CEZA 3H65A 3UUFA 4EMUA 5CA1F 4RWEA 2JIDA 2PWBA 1A71A 2J5XA 3T06B 1LBIA 1VL8A 1OUMA 2QNIA 3UJCA 1SG6A 1TQ8A 3CGWA 3IXMA 1EUQA 1ETUA 2COUA 3M3PA 3U0BA 4YRMA 1RLIA 3FRJA 2P9CA 4KW7A 3WX0A 3N5CA 4WLVA 3C3WA 2IXEA 4Q4HB 1MQ2A 2QV7A 2ZI3A 3VDXA 2ODGA 4E0BA 4YLEA 3AHGA 3WNCA 2NADA 2IIPA 4OI4A 4BMYA 3N07A 4C0KA 4ZJZA 1M2KA 2ZAMA 1FZQA 5D46A 2AN1A 3CLHA 4CNQA 3M3HA 3RADC 4R69A 2QW8A 4ZZ0A 5IUKC 2GNOA 4CEJA 1SG0A 2H5IA 2X42A 5JWRA 3IBGA 3NATA 5E2IA 1O3YA 3JAKB 5ARBA 3EJWA 1B93A 4I1IA 3D3JA 1XZ8A 2WZBA 4PEVA 1TK9A 3NWPA 1D9DA 4ARSA 2NO1A 1QUEA 4KGDA 2P40A 3C1TA 2XYRA 3QNWA 2RHLA 4AY2A 2W55A 4MO2A 3GH1A 1QP7A 1EMDA 1MIHA 2SECE 2Y92A 3C3EA 3HP4A 4EG7A 3NFRA 4O4HB 3L1HA 5F76A 3DCJA 1B00A 4FD3A 2WOOA 1P1FA 3J80A 3LLUA 4PGGA 4R2KA 2GPBA 1EVYA 2W6QA 4IDPA 3H1TA 1VI2A 2CEAA 4X93A 3GJTA 1L7NA 3ZVNA 5F33A 4CM1A 1Y7HA 4BDSA 4WJZA 1UBSB 1R6AA 3G13A 2ZYRA 3A9CA 1WCLA 2IU3A 5DHFA 4J49A 1HIWA 4YT4A 2F90A 4LK2A 4FEYA 2HMTA 4MUYA 2IELA 3AIIA 2XGQA 5F12A 1OT3A 3H17A 4BCDA 4L8WB 1KH2A 2WBLC 3DHNA 5HS6A 4PFQA 5A5GA 1CQIB 3CS3A 5F2KA 3I61A 4OA5A 3T95A 2F48A 3SC4A 2EGGA 4QZGA 3ZCXA 2L5YA 1PK9A 5B7NA 5AUQA 1LY1A 3EPPA 1ZAKA 1ZK3A 1HYHA 1Q7EA 3P5BA 3UK0A 1XLUA 1OYOA 3WBFA 4WKOA 5FTMA 1NI5A 4EPWA 4F6RB 1ECGA 1U2DC 5JSHA 2XLCA 3K1RB 4MIKA 1XD2A 1B0XA 3C8DA 4OJPA 2XNDA 2CJWA 2OENG 4M1ZA 2WTNA 4RKWA 3GUZA 4S2UA 1GUFA 7ICHA 4UE3S 4P98A 5J2TF 1THTA 1ORHA 1PJCA 9ICGA 2ZTEA 1QYDA 3PJRA 3EY4A 4B3MB 3PQ7A 1N63A 4Z0NA 1UOQA 5I7VA 5E4FA 4YD2A 1VL0A 4IRDA 2F1JA 4QNNA 4MS3B 3VOAA 4DOCA 1KBZA 4RACA 4NC9A 2Z09A 3K1AB 1JE0A 3ISDA 1XQYA 2OORC 1MR3F 7ICTA 4ME6A 5JYCA 2VAMA 1AJEA 2BE7A 5K3DA 4UOZA 5CNIA 4DOAA 4ZWNA 3DR5A 4WRRA 4FSHA 3NTLA 1J2YA 2C9OA 2JBAB 1Q16A 1Q8KA 1NU6A 4B7XA 3AR3A 1AGNA 1AUQA 4CCYB 1BZYA 3JR3A 3TLGA 4NE7A 4C88A 5HR5A 1IBCA 3FPAA 2BFCA 3KXDA 1SUEA 5B1IA 1WBBA 1EWKA 3EYZA 3N2GB 2JRZA 4RK0A 4Q3BA 4ALLA 4G4JA 1PGPA 1B2RA 1WMDA 2VJPA 4B4VA 1FP2A 2ALJA 3I0NA 1KEEA 2OG1A 1GTZA 4NCHA 3P97A 5CFZA 3QI7A 3O2NA 3OFSA 1ZQTA 4ARVA 2ECQA 3EMVA 1YS4A 2HLDD 3D1LA 1XX6A 3JRWA 3G6XA 2PYZA 3H2IA 1IWOA 4LHVA 4MWGA 2OXIA 1CIVA 4RABA 4ZOLB 2AD1A 4Q3DA 4FZJA 4QWDA 1KC3A 3QLUA 3KXIA 3UT6A 4EYKA 4MJ7A 4KVGA 9ICTA 3K5WA 3ZWOA 4X7RA 3PGKA 3A11A 1GFIA 2AC7A 4Z0HO 2JJ1A 3FPJA 4YP6A 4QZ9A 4A0FA 5H70A 1FVXA 4FBMA 4EA8A 1ZN8A 5K0JA 2WIAA 4RDHA 1K4YA 3PUZA 2QSYA 3T0FA 3TR0A 1IH8A 2XDAA 4KLNA 4K9KA 1QZZA 3T9CA 2FUEA 3L84A 4GAEA 4NP6A 2RRDA 1KERA 1OZFA 4U63A 3G02A 3JAWA 1KZ6A 4LY3A 3F4KA 4P22A 5GINE 2I6SA 4BNZA 4C2AA 4LI0A 5FTNA 2PZBA 4TMKA 2ID4A 3F9CA 3H8VA 1GNSA 1PFVA 4MYDA 1T1JA 3GPLA 3W6OA 5B1DA 5JI2E 2B5WA 5GONA 1N3YA 1OMOA 4K0RA 4QXMA 2J5BA 1G2IA 2O2JA 3PC3A 2V45A 3IBCA 2I2CA 1BE6A 5EWLB 1DWPA 3I2HA 3SSAA 1OTXA 1EP1B 4JQOA 1XFAA 4M8KA 1E0AA 1HR0B 3D81A 2G04A 4DVGA 4RHCA 5M34A 2REQA 2XE4A 4FU0A 4F12A 1JFSA 4CXMA 3PQDA 1EJ2A 5JAQA 5K2OA 3RGWS 1NW5A 2QG9A 1TV9A 1F0YA 2B1QA 4UUBA 4UU7A 2A84A 2HTEA 1TZBA 4CHTA 2OLKA 2EW1A 5ITVA 5B6PA 3EXG1 3FIJA 2VDLB 4G86A 5EXTA 4G6ZA 5JBQA 2CUKA 4W1QA 3TLYA 4KLTA 4US0R 2NRXA 2LR0A 4EI7A 2YBEA 3D4IA 2IOFK 2UVPB 1VJDA 2G72A 1WF3A 1JQDA 2JB9A 4EPVA 4ZO6A 3NVWA 4OBWA 1F14A 3FLAA 5ECDA 2VOJA 1Y6FA 4CV3A 2JI8A 1LDMA 4YAJA 5CB4F 5HRCA 3KJFA 3P32A 1EFPA 2QKYA 4YGXB 5F77A 1U28A 3RS8A 4P4PA 3WRVA 4PINA 4E1AA 2G9UA 4OQDA 3EPJA 2POCA 5AK5A 2XDWA 1V41E 9ICPA 2BCSA 1CUUA 5LBTA 4KLMA 2AX4A 4D3ZA 1A8QA 4YQWA 3SC2B 5KNDD 4OLFA 4HD8A 1PBNA 3ABSB 5LZ4A 1PV2A 1E8NA 2BMDA 1S9DA 5CYOA 5BN5A 1Y3AA 4Y3UA 5NLLA 3PQCA 3K32A 4BLVA 3OQNA 3F47A 1UPTA 4RPGA 4NAVA 4I4LA 3HQ4O 4QT0A 3SX0A 1RHMA 3ZGZA 4DMGA 2AGOA 1LPOA 5K0TA 1RZTA 1T0PA 1P4GA 1KK1A 2EDCA 3PPXA 5JFTA 2GHTA 4OHUA 1B26A 4XARA 3INYA 3HMQA 1RRPA 4WK6A 5BWBA 4L0DA 2JV3A 5JBIA 4ZT7A 1L5QA 2X0IA 1CPYA 4RV9A 3FUUA 4K6GA 3OT1A 3TLJA 3C29A 4FCCA 1L4BA 3D2CA 4HSEA 1B8PA 1E3TA 1BQ3A 1KBQA 2DECA 3UAXA 3QW2A 4IG9A 2R7KA 3FZGA 1KEZA 1Z19A 5AVSA 5BSGA 4UU8A 4DLTA 2F1IA 3ISCA 4UU1A 1DBQA 1W7AA 2ZXIA 5IM5A 4MTLA 1K7XB 5KOYA 4HAVA 1QJ4A 3GIIA 4TN5A 3RUCA 4LZLA 2VYFA 4DUGA 2W9XA 1BS1A 3ILXA 3S5UA 1XKLA 2OCIA 1FYEA 3KX2A 4TXNA 4DSJA 3EQZA 4PLYA 1G4UR 1YB1A 4O33A 1WKBA 4LNUB 1QXSA 5DBBA 2ZRFA 3KG2A 4RD1A 2PMEA 3HX0A 1F5NA 1G38A 3E8MA 4PSKA 1X1SA 1SVKA 4L57A 2RB5A 1H8ED 3PX6A 4JP2A 4A1FA 2P1ZA 2VK4A 3HCEA 1ESNA 3LXXA 1CUBA 1GV1A 4RTNA 3L0OA 3W2HA 4Y2PA 1J1ZA 1SC3A 4O08A 4Z6KA 4BC0A 7ADHA 4IRMA 1RM4A 4DWIA 2NU7A 2A1AA 2XY6A 4NYIQ 3EB9A 4M9XA 3VJKA 1PR0A 4GYYA 1ZNZA 2CMKA 5G41A 3PNPA 3Q0TA 1YUNA 4WKGA 5C34B 1IG3A 3SNKA 1DAMA 1PZNA 2P2NA 2PI5A 2QRVA 2HJHA 3VPHA 3MCTA 3E61A 1I0IA 4KRYA 3BZBA 3BE4A 1R0LA 4MNTA 2WWXA 3N8DA 3BRSA 2ZB2A 5I8ZA 5DHAA 3DL2A 2GNPA 1QE0A 3KWJA 5SYMA 1SQ5A 5FPQA 1U3WA 3D7KA 1SVNA 2J7PA 4BNVA 1RT9A 3RF6A 1ZAYA 1XSLA 2PA0A 2P2CA 3B3JA 2FN4A 2QM3A 2QX6A 2ZWVA 5BSMA 3BHIA 4BO5A 4EYQA 1QIFA 1C2TA 1E5DA 4HDAA 3HXQA 2K87A 1KQQA 1IY2A 4IIFA 1Q84A 2XNDD 2XBLA 4JV2A 2QBYB 2GBFA 2WWRA 4NK5A 5KTOA 1ZCJA 1DLJA 1PL8A 3U31A 3IKLA 4B3DA 3QVLA 2D00A 4NECA 5JVDA 3IAM6 3O7WA 2ETXA 3GVPA 3UXPA 2G36A 3HJGA 5ESWA 1WUJS 3BGOS 4CQNA 4KR7A 3VNRA 2XY4A 1Z0DA 4X5VA 4BLPA 2H17A 1UBHS 4UUQA 2VVTA 2JZOA 2Y1IA 1KFSA 2QPLA 2JRCA 3VNQA 5C2JB 2IIVA 3O38A 2WTUA 4LYFA 1FC0A 1SU4A 3G85A 3WGMA 1PT5A 3PHGA 1VA5A 4FFWA 4DYVA 4N3NA 4D25A 1T8EA 1NOKA 4LOHA 5DQGA 3OLXA 3ZDYB 3DQPA 3UCFA 3QJ5A 1C3OB 4DAEA 2P9BA 1ZQDA 1FRZA 1Q15A 4HJRA 2DUYA 2C2OA 4B85A 4XWOA 3RK0A 3NIBA 3OQ6A 3IPLA 4FFBB 1JVBA 5FFMA 2WHXA 1K7YA 1C7RA 3BF8A 2IA5A 1P75A 1KFCB 3WRYC 1Z5VA 2OCDA 1YR8A 3NHMA 2KEYA 2O52A 1DJNA 4M9UA 2VQEB 1FSGA 1CBUA 1GILA 5AVJA 3RTEA 2ONYA 2P27A 1UQUA 5JCJA 1PL0A 1MD9A 4XJXA 1SD2A 4JJ7A 2YVLA 2C77A 3ZIAA 4JYCA 1JWLA 2QUZA 4YFKA 2XQVA 4KE9A 4IZ6A 1U1GA 3W5CA 1KYTA 5FPPA 4RJLA 2AOXA 1DTWA 5AKJA 1ZH6A 2QTWB 1NKTA 4DS5A 5BQPA 1DJPA 1NLUA 4LSWA 3BMNB 5DHSA 3RH5A 3LLSA 4MWDA 3P19A 3IE0A 4QLOA 4EF5A 1IXSB 1C3LA 1ZCBA 3VVMA 1N2IA 3L6RA 2PFNA 4LVCA 1P72A 4UBCA 3V4SA 4GM4A 2JFFA 1PTJA 1U7ZA 1IXZA 2H3ZA 4IHJA 5CHGA 2J9FA 1S2OA 4RY8A 2W43A 4ZK6A 7ICGA 3T3MB 1BPEA 5LSAA 1T9KA 4UUNA 1NLMA 2WUFA 2XAUA 5LUAA 1Q20A 1KQOA 2H7XA 1LDYA 4ED9A 3GJRA 2CD9A 2R85A 1HE2A 1HT3A 2KE5A 3OZBA 2BRUA 4TOIA 1NULA 5JROA 2RQ5A 3HWX1 3AKYA 3NT4A 3FTPA 5LU8A 2PFQA 4NPHA 2IYUA 3OJCA 3ESAA 2QNRA 3M70A 1HTBA 3F6CA 2FWMX 4HLUC 1M34B 3U40A 1FYDA 5TXGA 3SM9A 2D2VA 3KZOA 3VCBA 4DT1B 1BHJA 4YR3A 4G0YA 3W77A 4ECTA 1X6VA 3EGXB 1D0SA 4FYMA 1K1SA 4JT8A 2XMZA 1U4SA 5J4HA 2JGKA 3EVCA 4KI0A 2CNDA 5JPDA 4AUNA 3QX8A 1RM3A 3DDNA 3AHFA 3EG9A 1P4HA 2LVBA 1AKQA 2GEJA 1FLAA 1U0SY 2G63A 5HG0A 1BPYA 1GAEO 2Y1LA 2XTZA 4ER5A 1JROA 4ENWA 4IIJB 1NJYA 2GKOA 4ZKDA 1PQ4A 4FVTA 1A2OA 4MH0R 5JZBA 2AD5A 4Y98A 4JEUA 3RHFA 4WA7A 3NHZA 4W7IA 3OBBA 4WZ6A 2J59A 3AFMA 3ZNOA 4E5YA 2JIMA 2RHTA 3FI0A 3T4UA 3NH9A 3QLUC 3ZDCA 1R50A