2M9NA

Solution structure of (hhh)2 domain of human faap24
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Fanconi anemia-associated protein of 24 kDa
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2m9nA00
3C1YA 4Z6DA 1KFDA 5D49A 4I2IA 3MR2A 4YMOA 3GIIA 2BPFA 1T7PA 4PHAA 4RNNA 4QWCA 4CCHA 1AROP 1ZQKA 5KFBA 3MFHA 5HP4A 5KT3A 1Z00B 4YVZA 3KHHA 3THVA 3RBEA 3RJKA 2J6TA 1SKRA 1MQ3A 4YXMA 1U47A 5J2HA 4Q45A 2H5XA 4UAZA 2XY6A 3LDAA 5KFEA 4J9LA 5DB9A 3KHRA 2Y1JA 2MUTB 9ICPA 3C1ZA 2GWSA 3MBYA 3BDPA 4FBUA 4DSLA 1SL2A 5CP2A 4DQPA 2DFLA 2VA8A 3BQ0A 5CHGA 4XRHA 1SL1A 3RJGA 3OHAA 4JK1A 9ICTA 2I1QA 4C8OA 3RRHA 2ASDA 1QSYA 2W8LA 2R8HA 2Y1IA 3HPOA 1BPYA 2PFOA 2ZUCA 3V7JA 2HHXA 2KZZA 1QLNA 4UB5A 1K1QA 3V7KA 1T4GA 4ZH4A 5J2KA 2R8IA 3UXPA 4PPXA 4MF2A 4O3OA 3ETLA 4F91B 5J0RA 1TK0A 4RNOA 4RQ0A 2MUTA 4TURA 3TFRA 1ZQAA 1D9FA 4P4MA 3MGIA 3ZDAA 4QZAA 4GC6A 3FYHA 5KFCA 4ECZA 3T3FA 3C5GA 2PI5A 4YFKA 9ICKA 7ICVA 4UB3A 2NRZA 3C23A 4NLGA 4PHEA 4TUSA 2FMQA 4KLQA 4KMUA 1S0OA 4RPXA 4JUZA 4RT2A 3HT3A 4IRDA 8ICIA 3PVXA 3T5LA 1S0NA 4JWNA 4Z6FA 4C8MA 3TFSA 4DFKA 5J2BA 1WCNA 1KRPA 1QSSA 4PGYA 8ICPA 1ZJNA 2ZJAA 4QW9A 4ED8A 2NRTA 5KFHA 5DGBA 4QZBA 3T5JA 1NJXA 2FLLA 2AQ0A 2XCAA 7ICLA 5DQHA 3HX0A 3HWTA 5TZVA 4KLIA 5IIOA 4B9SA 1HJPA 4ED0A 3KHLA 7ICGA 1A76A 5KFMA 3Q8MA 3G6VA 4KLJA 1JXEA 5IIKA 3GV8B 4EYIB 1KEJA 4NLZA 3Q8LA 3RB3A 1XWLA 5C5JA 5KFNA 5J2IA 1JXLA 4BXOB 8ICTA 5J0PA 4UB2A 2J6SA 4RQ5A 4FBTA 2ALZA 9ICLA 1JN3A 2FLNA 2PFNA 2B21A 4IQWA 4FO6A 3GV5B 4M47A 4Q8EA 3RB0A 5J0XA 1ZQRA 4NLKA 3IM1A 2PFPA 4NM1A 2AU0A 5KG6A 4JWMA 1B22A 5F9NA 4DLGA 3RJJA 4F4XA 3GV7B 4DQQA 3RJEA 4G3IA 4DF8A 3TQ1A 2IMWP 5IINA 4I2BA 4R8UA 4BXOA 4DEZA 4QZIA 2W9BA 9ICWA 4ED6A 1UA1A 2KN7A 1RYSA 5KG3A 2ATLA 4QZGA 4O0IA 4MF8A 2C2RA 1ZJMA 2BCSA 2JEJA 1TV9A 4F93B 4O3SA 3TAQA 3MABA 4J9MA 4TUQA 8ICVA 2BCVA 3IHQB 4BGDA 5DBAA 7ICNA 4EZ9A 4C8NA 4F2RA 2KFZA 2C2DA 2W9AA 3SI8A 5DDMA 4DL7A 1ZQWA 1SZPA 4ECRA 5EWEA 4DOAA 2VANA 4Q43A 5DB6A 1T3NA 4YXJA 1ZQCA 3UXOA 4UAWA 4IR1A 4YMMA 4RT3A 3SV3A 9ICFA 4ECTA 9ICJA 4K4IA 2V4QA 1HUOA 4J9KA 3M8SA 1RYRA 8ICGA 1XU4A 8ICOA 2KZ3A 3RH6A 4DSKA 4KTQA 5DQIA 4RQ4A 4QZCA 5J29A 3QE9Y 3RH5A 7ICIA 5KFYA 4J9RA 4M6WA 8ICUA 4B9TA 2UVRA 1K1SA 5DG9A 3EPGA 2IBKA 1V9PA 4IQUA 4ELTA 5L1IA 5DDYA 3GQCA 4QZDA 4DSFA 1UA0A 1QTMA 4ECWA 2HVIA 5D46A 4TQRA 2W9CA 4M04A 2C28A 4IRKA 4PHPA 4GXJA 2ZTEA 4DLEA 2JZBB 1KLNA 2I9GA 1L5UA 3NTUA 4O9MA 4F92B 7ICHA 5CR0A 4UB4A 1ZQOA 3OHBA 3H4DA 2R8KA 4QZHA 3Q8QB 1X9SA 1LV5A 2WTFA 3Q8KA 7ICSA 3M8RA 8ICFA 4EBEA 1KDHA 5KG2A 1TK8A 2PXIA 5DGAA 1RXWA 4YMNA 3K75D 4EBDA 4DS4A 2UVVA 3M9NB 4UB1A 5KFAA 3PW5A 4YG2A 3ZD8A 3JPQA 1L3SA 2HW3A 7ICJA 1UT5A 1TVAA 3RJFA 1TKDA 3PO5A 2C2EA 3GIMA 2AGPA 1SL0A 1ZQZA 5HMLA 8ICRA 4I2GA 2VA2A 5L9XA 3EYZA 1Z3EB 2ZJ5A 5J2AA 7ICEA 1U49A 1U48A 1BGXT 5BOLA 1IXRA 1ZQUA 2ZTCA 3OSNA 2XGPA 1S0MA 5CB1A 1ZQGA 3GIJA 4GXKA 4P4OA 4NM2A 4I2FA 5KFIA 4B9MA 4F4WA 3HW8A 1XSPA 8ICBA 4K4GA 3RAXA 4F4ZA 4ECSA 1NOMA 1BVSA 3V6HA 4DS5A 4I29A 2DPJA 9ICHA 4JV0A 3Q8SB 5J2DA 1ZQLA 4ELUA 4KLHA 1X9WA 3RBDA 2BCQA 4M9NA 5KFOA 5J2GA 2BCRA 4R64A 2W9MA 4Q44A 4ED7A 3Q8PB 2XC9A 4DQRA 4RU9A 2XY5A 1ZYQA 7ICKA 3BQ2A 5KFTA 5DQGA 4DL4A 4IQVA 2JEFA 5DB7A 5KFWA 3PV8A 1S10A 4I2AA 1H38A 4LZDA 4EBCA 4RPYA 8ICCA 1ZQTA 3BJYA 4F8RA 4ECXA 3TARA 9ICAA 1NKCA 1ZQDA 3RR8A 7ICMA 3FDSA 4F5RA 4DFJA 5EOZA 8ICNA 1ZQVA 5KFJA 4UQGA 5DLGA 4PGXA 3EW9A 4DFMA 7ICFA 1RPLA 3TI0A 3RAQA 2JEGA 3LK9A 5KFFA 3AU2A 4HYKA 1NJYA 4MFCA 4M9GA 1S9FA 4R66A 4RQ3A 4KN4A 4ECVA 3H4BA 4DL3A 4PGQA 2W8KA 3C2MA 1SKSA 1N56A 9ICGA 1NK6A 4YQWA 1WCLA 4QWAA 2HHVA 7ICPA 4ELVA 3EZ5A 1BPEA 3Q8RB 5J0TA 1D8YA 3C21A 3GFKB 5DB8A 3JPRA 4F5PA 3RB4A 3MR5A 9ICOA 5KTQA 2IHMA 2F1IA 2DPIA 2RDIA 2FMPA 2HHUA 4J9OA 1ZQQA 2M9NA 3M9MB 2FPKA 1XO1A 4M6WB 9ICSA 5DBCA 3HP6A 1RZTA 5KFKA 4F5QA 4KLMA 4MEYA 4DO9A 4NLNA 3V72A 3H8WA 2UVWA 1Y88A 9ICIA 4PH5A 4DWIA 5IIJA 1NKEA 2A1JB 4EYHB 4KLDA 4YN4A 1L3TA 4PHDA 4I2HA 4I2JA 3SV4A 1N48A 1S0VA 5KFSA 4MEXA 1QSLA 5J0OA 1CEZA 3SYZA 4NXZA 3H8JA 5KG1A 4FS1A 3RTVA 2LYHA 1NJZA 4X5VA 2BHNA 1ZQIA 3RH4A 4J9NA 1Z00A 4BWMA 4QWEA 4I2CA 2BKEA 1D8LA 3UPQA 3GIKA 1S76D 4YP3A 1TFRA 4R65A 1ZQJA 2PFQA 1C7YA 2V4RA 5HMMA 5DG8A 3KTQA 3ZDBA 4RNMA 2R8JA 4NY8A 4RQ8A 4B9LA 2NRXA 5KG4A 5HNKA 8ICHA 2C22A 1ZQBA 4DOBA 5EWGA 5J2FA 9ICCA 1BPBA 2ZUBA 3ISCA 1BPXA 1ZETA 1BPDA 1TK5A 1ZQHA 4I2EA 4KLLA 2NRWA 5CJ7A 1U45A 4O5EA 1JX4A 5DG7A 4B9UA 4FS2A 1MSWD 4F50A 4BWJA 3G6YA 2BPGA 3PR5B 8ICEA 2XO7A 4E0DA 4KLOA 9ICXA 1TAQA 3PW2A 4Q8FA 1NK0A 3PMNA 1SKWA 4JV1A 2A1JA 5DLFA 4C8LA 1ZQXA 2NRVA 3MDCA 3LWLA 3GDXA 1KSPA 5KG0A 5BPCA 4XQ8A 2OWOA 5KFRA 4F5OA 3ZDCA 1B43A 3N4MB 3NGDA 4DL6A 4B9NA 4I28A 4JV2A 5KFUA 4ECQA 3M9OB 7ICOA 1XSNA 5HHIA 2BDPA 1LB2B 2BQ3A 5KFVA 3OJUA 2FPLA 3AU6A 3OGUA 2UVUA 8ICKA 1ZQPA 8ICYA 2ZTDA 1UT8A 5J0QA 4M9LA 3QZ8A 4DL5A 1NJWA 3C5FA 1JIHA 4DQSA 3OSPA 5KT2A 2ZJ8A 4M2YA 4RZRA 1U9LA 2FPMA 2BCUA 2J6UA 3RRGA 4M0AA 3T5HA 2P66A 7ICQA 4KLFA 4R63A 5KFQA 1XS9D 1TAUA 3ORYA 4YD1A 4RPZA 3G6XA 9ICMA 3UXNA 3PX6A 5KG5A 5J0SA 4ED3A 3MGHA 4ED2A 2BGWA 5HHHA 5IIMA 4UAYA 4DQIA 3BQTA 3MDAA 2IA6A 2F1JA 2ASJA 4YR0A 4O3NA 2Q0ZX 3C2LA 5KFPA 4J9SA 2V9WA 3RJHA 1HUZA 2JEIA 1KFSA 1X2IA 4R8UB 3SZ2A 4KLSA 1DOQA 5BOMA 5KT4A 2MAXA 3K4GA 8ICLA 5DKWA 4RUCA 9ICUA 3E2EA 4MFFA 9ICVA 4Z6EA 3RJIA 2XY7A 2AGOA 3MR3A 3RR7A 3ISDA 4F4YA 5J0YA 2FMSA 5J0WA 3UQ0A 5IIIA 4C8KA 9ICNA 5EWFA 4UBBA 4O3RA 7ICTA 1NK9A 5KFGA 1ZQSA 3ZDDA 1CUKA 8ICSA 2XCPA 4ECYA 4QZ8A 4EEYA 5L1LA 8ICWA 4I2DA 2AQ4A 3JPOA 4J9PA 4RQ6A 2R8GA 3ZD9A 4TUPA 3V6KA 1S77D 4IRCA 2PI4A 4YR2A 5D4BA 5DBBA 5JUMA 5F9LA 2BR0A 3H8SA 3KHGA 3PW0A 2P6UA 3AUOA 8ICAA 4XUSA 4O3QA 1IM4A 3UQ2A 4QZEA 2IHNA 2ISPA 4ED1A 1L3UA 3JPSA 3QZ7A 2VA3A 2BQUA 4DSEA 2F1HA 3QEBZ 5J2CA 4DSIA 1COOA 7ICRA 1EXNA 2ASLA 4RQ7A 4RUAA 1KFTA 3QEAZ 4QZ9A 4LVSA 5J2JA 5L1KA 3EPIA 9ICRA 1A77A 4GLXA 2HVHA 2AJQA 1ZQMA 5IILA 5L1JA 4M9JA 4P2HA 1X9MA 2KTQA 2ZUDA 9ICEA 3B0YA 1NK7A 3EWAA 5CA7A 4YR3A 2HHQA 9ICBA 1ZQEA 4F2SA 2KFNA 4KITB 4DF4A 1XSLA 4RQ1A 1MQ2A 3PR4A 2JZBA 3PO4A 5KG7A 3ISBA 4B9VA 4F5NA 4LZGA 2ISOA 4KLUA 3V6JA 4QW8A 5J0UA 3V7LA 3LWMA 3ZDEA 2HHWA 2KZMA 3TANA 5KT6A 1T8EA 3MR6A 1U4BA 3B0XA 5J2EA 1S97A 4DSJA 3PX4A 4QWBA 3JPTA 5KFXA 1L3VA 8ICXA 3H7IA 4QZFA 3PNCA 3H40A 4KLTA 3RB6A 4BDPA 3TAPA 4TQSA 4QWDA 4DFPA 4MFAA 4IR9A 1RXVA 2FLPA 9ICQA 4Z6CA 4K4HA 2HHTA 4KLGA 1ZQFA 4RQ2A 5KFZA 4UBCA 4EZ6A 8ICZA 4J9QA 3C2KA 2RDJA 3GILA 4DOCA 3PW7A 1PZNA 3OJSA 7ICUA 4GXIA 1MC8A 4O5CA 3MFIA 2P6RA 8ICQA 2BQRA 4I27A 3JPPA 1KTQA 4F4KA 1JMSA 2BPCA 5KT5A 1XC9A 4KLEA 8ICMA 2AGQA 2W9CB 4DL2A 1NK8A 1DGSA 5CWRA 1NKBA 1BPZA 3JPNA 4P4PA 3PY8A 4O5KA 5KT7A 2HHSA 4F3OA 4IQTA 2W9BB 1D9DA 2XGQA 1ZQYA 3N97B 4YCXA 5KFDA 3PMLA 3PX0A 4ECUA 4M9HA 8ICJA 1NK4A 4GC7A 4XA5A 5KFLA 1NK5A 4KN7A 3PW4A 3BQ1A 4YD2A 3T5KA 1ZQNA 4O3PA
chains in the Genus database with same CATH superfamily
5H2FU 3C1YA 2A1AA 5J8YA 1GO3F 2EZZA 4RNNA 3SQIA 5KFBA 5HP4A 4NL9A 3THVA 2J6TA 2XY6A 2GWSA 1SL2A 5EE1A 2VA8A 4XRHA 4C8OA 3WKAA 5G5GA 4QJFB 2W8LA 3HPOA 1BPYA 2PFOA 4QNLA 3QYPA 1K1QA 3V7KA 1RG6A 4MF2A 4TURA 4CGZA 1ZQAA 2WF7A 4P4MA 4QZAA 2PI5A 7ICVA 4UB3A 4CF3A 3F5AA 4KMUA 3HT3A 8ICIA 5JTIA 4JWNA 2WF6A 4C8MA 1KRPA 4PGYA 1ZJNA 4QW9A 1FEZA 4QZBA 4OD0A 7ICLA 1NJXA 2AQ0A 2XCAA 3CYMA 3HX0A 4KLIA 5IIOA 1HJPA 7ICGA 3Q8MA 1CRXA 4KLJA 1JXEA 3Q8LA 2JGAA 5E79U 4UB2A 2B6GA 2DGZA 2FLNA 4M47A 5CRXA 4NLKA 1NZBA 3BS5A 1MA7A 3TQ1A 2IMWP 2K4PA 4C0ZA 9ICWA 1UA1A 3RF9A 2K4EA 9ICBA 2C2RA 1ZJMA 1V97A 3KBBA 3QUCA 2JEJA 4O3SA 2W7PA 3LVVA 4EZ9A 5G5HA 1SZPA 2FI1A 3QU7A 2VANA 3ONNA 5C0YA 4YMMA 3WKEA 4PZNA 9ICFA 4K4IA 2V4QA 1X6JA 4HAIA 3SAGA 3WKCA 2ZIXA 4KTQA 3RH5A 4J9RA 2KJ8A 4B9TA 2JV3A 4ELTA 3NVVA 5L1IA 2LYAA 2YQEA 4PHPA 4DLEA 1L7OA 5AI9A 2HBJA 4RQNA 2JH7A 4CRXA 2GOLA 2JH1A 3WK8A 5A0LA 1NNLA 5J8YC 3Q8QB 1YT3A 3Q8KA 4P0QA 1TK8A 2KSOB 2NO5A 4EBDA 2W03A 1L3SA 3PSTA 5KFAA 4YG2A 1TVAA 2CN1A 2EANA 2JRZA 3GIMA 3HJEA 3QUBA 2ZJ5A 7ICEA 3QNMA 3M6KA 3OSNA 4NM2A 3HW8A 8ICBA 4DS5A 2OHFA 3RBDA 3QUTA 5KFOA 3WK5A 2JEFA 5KFWA 1S10A 4I2AA 2WHEA 4ECXA 2HDOA 7ICMA 5EOZA 3H0RB 5KFJA 1K5OA 3TI0A 3WKBA 3LK9A 5KFFA 4UB6U 5ALJA 5ALLA 4KN4A 4DL3A 3DV9A 3IN5A 3ETRA 1NK6A 2EAOA 4QWAA 2HHVA 1BPEA 2K4HA 3MR5A 2RDIA 2FMPA 3QXGA 3M9MB 1KL9A 1XO1A 5DBCA 3HP6A 2YB1A 3NVWA 1RZTA 2H3VA 9ICIA 4CDGA 2W7OA 3RFAA 4YN4A 4CF4A 3NS1A 3D6JA 3E0FA 4MEXA 1QSLA 2F77X 1OUQA 5ALGA 4C7ZA 4J9NA 4FE3A 3DEEA 2BKEA 4QWEA 1S76D 5AM3A 5AK3A 1UHUA 2V4RA 5DG8A 4RQ8A 8ICHA 2YMLA 5ALQA 5J2FA 3M1YA 1BPDA 2AXTU 2W55A 5CJ7A 1U45A 2EAMA 1JX4A 1ZRNA 2EDUA 4BWJA 3G6YA 5AKLA 4EENA 1TAQA 2D6FC 1NK0A 3PMNA 3QUQA 5DLFA 3U26A 2NRVA 3MDCA 2DKXA 4F5OA 1PUZA 5EE3A 3NGDA 4DL6A 2YTUA 1Q3UA 4I28A 5KFUA 8ICKA 2GH1A 1ZQPA 8ICYA 5J0QA 4M9LA 4DL5A 1NJWA 3NVYA 4PJ0U 2J6UA 2FPMA 2P66A 3M6ZA 4C80A 4R63A 4YD1A 4RPZA 3G6XA 1F44A 4CNQA 3NUQA 4U6PA 1IG6A 5ALNA 4ED2A 2ASJA 3C2LA 2V9WA 2FJ6A 5KFPA 2JEIA 4R8UB 1L8LA 1VDVA 2MAXA 4RUCA 9ICUA 4MFFA 4B6JA 3RJIA 1TE2A 2XY7A 2ZXHA 2GLEA 2KKPA 4F4YA 4P0QB 7ICTA 1NK9A 1ZQSA 2BZFA 4ECYA 4QZ8A 4BJQA 4EEYA 2AQ4A 4Y2VA 3JPOA 4J9PA 1S77D 3PW0A 2P6UA 1T3QA 8ICAA 1N63A 2ZIVA 4QZEA 1L3UA 3JPSA 4NLBA 3QEBZ 2ASLA 1S8OA 3LVWA 3PSPA 4IL6U 1AQ6A 5J2JA 3EPIA 3UMBA 9ICRA 2AJQA 1ZQMA 5IILA 2KTQA 2ZUDA 3EWAA 1ZQEA 1ZD3A 4KITB 4FZLA 1MQ2A 4OJLA 3PR4A 4B9VA 2W04A 3AEVA 2KICA 4KLUA 5J0UA 5AKXA 5KT6A 1S97A 3JPTA 3TAPA 4TQSA 2HOIA 2FLPA 4KLGA 1ZQFA 1J97A 2AHOB 4DOCA 3PW7A 1PK3A 2FE9A 4O5CA 8ICQA 2YMQA 2P6RA 1JMSA 1XC9A 5KT5A 1PVQA 2Z7JA 3A0HU 2AGQA 2W9CB 4DL2A 3NRWA 1DGSA 4KLQA 4P4PA 5KT7A 1B4FA 5AKHA 2W9BB 4C4RA 5ALYA 4M9HA 4ECUA 4DCCA 3PW4A 2QARB 1KFDA 4I2IA 5HR7A 2BPFA 4CCHA 1ZQKA 4UASA 5KT3A 3KHHA 5AKEA 3OPXA 1MQ3A 1U47A 4Q45A 4PL2A 2K89A 5DB9A 2Y1JA 4J9LA 1NI3A 3C1ZA 2VJ5A 3QU2A 1QH9A 5CP2A 4DQPA 3BQ0A 1SL1A 3OHAA 3LYSA 3RRHA 2ZUCA 2HHXA 4UB5A 3IDWA 5J2KA 4F91B 3ETLA 2ZIWA 4RNOA 3TFRA 3ZDAA 4UW9A 5KFCA 3C5GA 2LI6A 2DQNB 1DRGA 4PHEA 2FMQA 2VKQA 4RT2A 2HCFA 1SXDA 4Z6FA 3TFSA 3WKDA 1SWWA 5J2BA 4ED8A 5TZVA 1RYUA 2PMZF 4ED0A 2KVSA 5ALRA 1KEJA 3FC4A 3RB3A 1XWLA 5C5JA 4BXOB 5J0PA 4RQ5A 4EELA 2ALZA 2W43A 4FO6A 3RB0A 2NV3A 4CE6A 4GIBA 5ALZA 1O03A 3AQEA 5AKKA 1SIJA 4DF8A 1SZHA 5IINA 4I2BA 4R8UA 2W9BA 2XICA 3F5EA 2F3NA 1Q3VA 1RYSA 3N28A 5KG3A 2ATLA 4QZGA 4DSJA 1TV9A 3MABA 4J9MA 4EEKA 5AM0A 8ICVA 2HBLA 4BGDA 7ICNA 2ZIVB 2KFZA 2C2DA 2W9AA 3SI8A 5DDMA 2CPRA 1ZQWA 5EWEA 4A8EA 2YMMA 4Q43A 1UQVA 1T3NA 5ALKA 4UAWA 3IG8A 4RT3A 3EUB2 4ECTA 9ICJA 1HUOA 8ICGA 1XU4A 8ICOA 2DWQA 5DQIA 4RQ4A 5KFYA 5JRTA 1K1SA 3E2EA 1V9PA 3GQCA 4QZDA 1QTMA 2HVIA 4ECWA 4UARA 1RM6C 1OW5A 2QB0B 4IRKA 2HBKA 4GXJA 3GZFA 1KLNA 3NTUA 4F92B 5CR0A 1ZQOA 3OHBA 3MC1A 5HR6A 2E1FA 2KOBA 1VLBA 2OCEA 5AK5A 7ICSA 1PVRA 2PXIA 3K75D 1SWVA 4DS4A 3M9NB 3PW5A 1JI7A 2VJ4A 2Y0SC 3RJFA 3WK9A 4I2GA 2VA2A 5J2AA 1U49A 5EE9A 2GO7A 5BOLA 1IXRA 2XGPA 1ZQGA 3GIJA 3FAHA 4I2FA 2Y9UA 3RAXA 4F4ZA 1BVSA 4I29A 1KKXA 2DPJA 2D8CA 1MN8A 5J2DA 4ELUA 2EZYA 1X9WA 2BCQA 1N5XA 1X66A 2DL0A 3Q8PB 3KFUF 3BZCA 4RPYA 1ZQTA 3BJYA 4DFJA 1ZQVA 4UQGA 2H3ZA 5DLGA 2KHQA 3EW9A 4PGXA 5K4LA 4IC9A 4HYKA 3D2QA 1S9FA 4M9GA 3H4BA 2WFAA 3KKAA 5AIAA 5AICA 4YQWA 3EZ5A 5AHXA 1WWUA 3JPRA 4UAUA 2IHMA 2DPIA 5ALOA 4J9OA 2LM1A 2M9NA 3SMVA 2O6KA 9ICSA 1VJ5A 2ZIUB 4MEYA 4ACOA 1XO0A 5IIJA 1NKEA 2CRXA 5ALIA 1KBUA 3BS5B 4I2HA 3D2SA 1N62A 3M7DA 3J81j 5KFSA 3SYZA 3H8JA 4FS1A 5AM1A 1NJZA 2M0NA 1ZQIA 3RH4A 1Z00A 4KX3A 1D8LA 4US8A 3GIKA 3UPQA 4YP3A 1TFRA 1PK1B 2RLTA 4R65A 1ZQJA 2PFQA 1C7YA 4DFDA 1IV8A 2NRXA 5HNKA 5ALEA 5EWGA 3F2DA 3UMCA 1BPXA 1ZETA 1TK5A 1JALA 3AMZA 4B9UA 4FS2A 2PKEA 4US9A 2H3QA 3PR5B 1J2MA 4C4SA 4KLOA 9ICXA 5AI6A 4Q8FA 2JHDA 2K60A 3GDXA 3LWLA 2XVTA 2F76X 1BNPA 1B43A 2K8AA 3PSFA 2IOFK 4JV2A 7ICOA 1XSNA 3OGUA 2ZTDA 1UT8A 1F0MA 3QZ8A 4RQMA 3C5FA 1JIHA 1FIQA 3CP8A 3OSPA 5KT2A 2OH2A 1XNSA 1O08A 4M0AA 3T5HA 2EH9A 2E5SA 4JB3A 5KFQA 1XS9D 3ORYA 5ALWA 2LKYA 3UXNA 1A6SA 5KG5A 2BGWA 5HHHA 5IIMA 1FFUA 4AP9A 4DQIA 2IA6A 2KIVA 2Q0ZX 2W3SA 3RJHA 1N60A 1KFSA 1X2IA 3SZ2A 1DOQA 5KT4A 8ICLA 5DKWA 2F8LA 4Z6EA 5L1MA 2AGOA 3MR3A 3RR7A 1T94A 3ISDA 5J0YA 5J0WA 5EWFA 4UBBA 3ZDDA 2XCPA 4Y2YA 3SR6A 4KX5A 2JR5A 5L1LA 8ICWA 3L3FX 2W54A 2XI9A 1UPHA 4RQ6A 1KN5A 1Q8KA 2A3VA 2KKVA 4FZNA 5D4BA 2G09A 1KW4A 3H8SA 4QIWC 1Z4OA 2IHNA 2BDUA 2VA3A 2BQUA 1N61A 2F1HA 4DSIA 1EXNA 4RUAA 4NL9C 5ALHA 4QZ9A 5L1KA 1A77A 4GLXA 1NK7A 5CA7A 3HRDD 3TACB 2JZBA 2I5HA 3ISBA 2ZIWB 3V6JA 3VCBA 4QW8A 5B66U 2HHWA 3MGVA 1RDFA 5AK6A 1QQ6A 3PX4A 1L3VA 1SV0A 1YZ6A 2ZG6A 3NRZA 5ALPA 3PNCA 1L7PA 3RB6A 3NVZA 3PSIA 2G5IB 1X9XA 4Z6CA 3C29A 4J9QA 1SGGA 3GILA 7ICUA 2DUYA 4OJ5A 4Y2SA 3TADA 2BPCA 2H3FA 1NK8A 2KJ5A 3PY8A 2E8OA 2G07A 1ZQYA 5ALXA 3IRUA 1WYGA 1NK4A 4GC7A 4XA5A 2LPEA 4KN7A 3BQ1A 4O3PA 1L8OA 2KHVA 3MR2A 4YMOA 4USAA 4PHAA 1AROP 4Y2QA 4AYBF 1Z00B 4YVZA 1SKRA 4YXMA 3VC8A 2H5XA 4UAZA 3LDAA 2E8PA 5KFEA 3ALRA 3KHRA 9ICPA 2MUTB 3MBYA 4DSLA 2DFLA 3RJGA 9ICTA 5CHGA 3A0BU 4FZMA 2I1QA 4QIWF 5FP0A 5KNIA 3SENA 3CW2C 2Y1IA 3V7JA 1X40A 1T4GA 4ZH4A 2R8IA 4Y2RA 3UXPA 4O3OA 5J0RA 1TK0A 2L5YA 4RQ0A 4GC6A 3FYHA 3T3FA 2E1EA 2YX8A 4YFKA 3C23A 3ICXA 2HOFA 4TUSA 1S0OA 4JUZA 4IRDA 3PVXA 1ZD2P 3R9KA 3T5LA 5ALDA 8ICPA 5GTIU 3T5JA 5KFHA 2OM6A 2QARA 1A76A 5IIKA 3GV8B 2HMXA 4EYIB 5ALVA 1X6IA 3K1ZA 2WB1F 5KFNA 1JXLA 8ICTA 1TAMA 9ICLA 2CXYA 2PFNA 3GV5B 4Q8EA 2IOFA 3IM1A 1CI4A 2B0CA 2PFPA 2AU0A 5KG6A 1B22A 5F9NA 4DLGA 3T79A 3I28A 5AKGA 3GV7B 3RJEA 1ZQ1C 4F72A 2W11A 4ED6A 2KMDA 1ED1A 2BCSA 2KV2A 2BCVA 2D3DA 5DBAA 4C8NA 4DL7A 4Y2XA 3D2NA 2E3TA 5DB6A 4YXJA 4IR1A 4J9KA 3M8SA 1RYRA 2WB1C 4PZOA 2KZ3A 4DSKA 3AM9A 4NLCA 8ICUA 7ICIA 3EPGA 1JROA 5DG9A 9ICHA 4IQUA 7ICKA 5DDYA 1UA0A 4DSFA 4UB8U 2W9CA 1SV0C 5KAFU 2ZTEA 2JZBB 1C20A 1L5UA 4O9MA 7ICHA 5KL1B 2R8KA 2WTFA 3M8RA 4EBEA 4JMUA 5KG2A 2UVVA 4UB1A 3ZD8A 3JPQA 5ALSA 3AQFA 1UT5A 1TKDA 2G0AA 4BUGA 1YZ7A 2C2EA 1SL0A 5AKYA 8ICRA 5L9XA 2KNJA 3EYZA 1Z3EB 1BGXT 1ZQUA 5CB1A 4GXKA 4OJ6A 4P4OA 3KZIU 4K4GA 4ECSA 4CF5A 4G9BA 4M9NA 5J2GA 4ED7A 2W9MA 2XY5A 3HKZC 1ZYQA 4RU9A 3BQ2A 1DGJA 2VIXA 4DL4A 4IQVA 3PV8A 4Y2TA 8ICCA 4F8RA 9ICAA 1NKCA 1DXSA 2E8MA 2QLTA 8ICNA 4NJ8A 3FM9A 7ICFA 1SV4A 4MHVA 4R66A 1ZD5A 4RQ3A 4ECVA 2W8KA 1SKSA 2EQYA 1ZD4A 3F2BA 2XIDA 3Q8RB 5J0TA 1D8YA 3C21A 4F5PA 3RB4A 9ICOA 5KTQA 2F1IA 1ECWA 2FPKA 5KFKA 4F5QA 2ZIXB 4KLMA 4DO9A 4NLNA 3V72A 3H8WA 2UVWA 4PH5A 4DWIA 2A1JB 4KLDA 1L3TA 4PHDA 3SV4A 1N48A 3HKZF 5J0OA 4NXZA 3RTVA 2E8NA 4X5VA 2WF8A 1LVHA 2LBOA 3IV6A 3ZDBA 4NWIA 4RNMA 2HI0A 5KG4A 1L7NA 2P35A 9ICCA 2ZUBA 3ISCA 4I2EA 4KLLA 2NRWA 4EX7A 4F50A 2F44A 1N5WA 3C28A 2KJ9A 2LYBA 1COKA 2H3IA 2KIWA 4JV1A 2A1JA 1ZQXA 3N7SC 5BPCA 4XQ8A 2OWOA 3ZDCA 4B9NA 3K1RB 3M9OB 5HHIA 2BDPA 1LB2B 5KFVA 2OXOA 4O3MA 2FPLA 3AU6A 2UVUA 1J2NA 4WJ3B 4RZRA 1U9LA 2BCUA 3RRGA 2HOQA 2F8KA 1TAUA 1URJA 2KP7A 3KKAC 5J0SA 2NYVA 4UAYA 3BQTA 2F1JA 4YR0A 4O3NA 4J9SA 1IIPA 1HUZA 4KLSA 2RQ5A 4J03A 9ICNA 4O3RA 5KFGA 1CUKA 3DDHA 2ZXIA 2R8GA 3ZD9A 4TUPA 3V6KA 3I76A 5AKZA 2PI4A 4YR2A 5DBBA 3KD3A 5JUMA 2YB4A 2OYYA 3N7PD 4XUSA 4O3QA 1IM4A 3UQ2A 2ISPA 1NZPA 4ED1A 4DSEA 1COOA 2OEHA 2QKQA 4RQ7A 1KFTA 3QEAZ 2K8CB 4LVSA 4P2HA 2KD1A 1X9MA 5ALFA 9ICEA 4YR3A 1WUDA 2KFNA 4RQ1A 4LZGA 4F5NA 2ISOA 3V7LA 3ZDEA 2KZMA 1F5SA 3MR6A 1U4BA 3ZI4A 2I6XA 5J2EA 2YMPA 4PL1A 5KFXA 8ICXA 3H40A 4KLTA 2KVCA 2FDRA 3F53A 5AM5A 4BDPA 4QWDA 4MFAA 1RXVA 4K4HA 4RQ2A 5KFZA 4UBCA 2MA1A 3WK7A 8ICZA 1PK1A 4EX6A 1A0PA 1PZNA 3OJSA 4I27A 3BZKA 4KLEA 5CWRA 1LKYA 1NKBA 3JPNA 1ZOLA 4IQTA 2WAQC 1D9DA 3IP4B 3N97B 3PX0A 3PMLA 1Q46A 8ICJA 4OJOA 2DBYA 1NK5A 5B5EU 4YD2A 3T5KA 1ZQNA 5AKJA 4Z6DA 5D49A 4C4TA 1SB3C 3GIIA 1T7PA 5ALMA 4QWCA 4GFJA 3MFHA 5EE0A 3RBEA 3RJKA 1SXEA 5J2HA 3BS7A 2G08A 3WK4A 3BDPA 4FBUA 4JK1A 2KEYA 2ASDA 1QSYA 2R8HA 2KZZA 1QLNA 4PPXA 2MUTA 4C7YA 1D9FA 3MGIA 2WAQF 4ECZA 9ICKA 2NRZA 4NLGA 3QU5A 3N7RC 4ICAA 2JXJA 2K4IA 4RPXA 1S0NA 4DFKA 1WCNA 1QSSA 2LHTA 2ZJAA 2FLLA 4O5EA 2NRTA 5DGBA 5DQHA 3HWTA 4B9SA 3KHLA 5KFMA 2A19A 3G6VA 1LKYB 5AKIA 4NLZA 5J2IA 2J6SA 2AH5A 4FBTA 1JN3A 4IQWA 2B21A 3PZPA 5J0XA 1ZQRA 4NM1A 4JWMA 3RJJA 4F4XA 4DQQA 3I1YA 4G3IA 3CRXA 4BXOA 4DEZA 3WK6A 4QZIA 1RQLA 5AI5A 2KN7A 3SD7A 4O0IA 4MF8A 4F93B 3TAQA 4TUQA 3IHQB 4ZOHC 4F2RA 2KG5A 4ECRA 2QB1A 4DOAA 1ZQCA 3UXOA 3SV3A 2RP5A 1L6NA 2LM4A 5T14A 4LJXA 4UAVA 3TKAA 3RH6A 4AYBC 2ZIUA 4QZCA 5J29A 3QE9Y 4M6WA 3H0MB 4FFDA 2Y0SF 2UVRA 2IBKA 2KE7A 3WU2U 1V38A 5D46A 4IS7A 4TQRA 2YN4A 1JRPA 4M04A 2C28A 2I9GA 3NASA 4UB4A 5TISU 3H4DA 1ZXIA 1KQQA 4QZHA 1X9SA 1LV5A 2RRDA 1V85A 8ICFA 2EAPA 1KDHA 5DGAA 1RXWA 4YMNA 4OO1J 3BQ7A 2HSZA 3L4PA 2HW3A 7ICJA 3KZXA 1P7DA 1X42A 5AI8A 3PO5A 1JUDA 3AL0B 2AGPA 1QQ7A 1ZQZA 5HMLA 1U48A 2ZTCA 1S0MA 3F2CA 5AK4A 2KK0A 4KMOB 5KFIA 4B9MA 4F4WA 1XSPA 3V6HA 1NOMA 1N2XA 4JV0A 3Q8SB 1ZQLA 4KLHA 5AI0A 2BCRA 4R64A 4Q44A 4DQRA 5CEHA 2XC9A 5KFTA 5DQGA 5DB7A 2MU2A 1H38A 4LZDA 4EBCA 3TARA 1ZQDA 3RR8A 3FDSA 4F5RA 1Z1BA 1QCKA 4DFMA 1RPLA 3RAQA 2JEGA 3QX7A 1HIWA 1DK3A 2G5HB 3AU2A 1NJYA 4MFCA 4PGQA 3C2MA 3SAHA 1N56A 9ICGA 1WCLA 7ICPA 4ELVA 3GFKB 5DB8A 2HHUA 1ZQQA 4M6WB 1WWVA 2DKZA 2EZXA 1Y88A 3IG5A 3O0FA 4EYHB 3QU9A 4I2JA 1BNOA 1QQ5A 1S0VA 4Y2PA 4F71A 1CEZA 5KG1A 2LYHA 2BHNA 4BWMA 4I2CA 2ES6A 4P0PA 3KTQA 4NY8A 5HMMA 2R8JA 3B9JA 4B9LA 2C22A 1UCVA 1ZQBA 4OCZA 4DOBA 1BPBA 4UATA 4BX9C 1ZQHA 2Q4TA 2DF4B 5DG7A 5JU5A 1MSWD 1ZRMA 2BPGA 8ICEA 2HBMA 2XO7A 4E0DA 1Z1VA 3PW2A 1Z4NA 2ESEA 1SKWA 4C8LA 1KSPA 2N1RA 2QB0A 5KG0A 3AN1A 5KFRA 3N4MB 1PVPA 4ECQA 2R18A 3H8MA 3UM9A 4OJPA 5AI4A 2BQ3A 3OJUA 3CNHA 4P0PB 2F2AB 2K8BB 1D8BA 3S6JA 2Y9TA 3TADC 4DQSA 3GU3A 3L5KA 2ZJ8A 4M2YA 1RQNA 7ICQA 2YY6A 4KLFA 9ICMA 3OTQA 3PX6A 3UMGA 4ED3A 3MGHA 1DK2A 3MDAA 5GTHU 2PMZC 5BOMA 3K4GA 5AM4A 1FO4A 9ICVA 2FMSA 4C8KA 3UQ0A 4NV0A 5IIIA 3SAFA 1OXJA 8ICSA 5ALTA 2W3RA 4I2DA 3KOOA 4IRCA 1S5LU 2BR0A 5F9LA 1Z19A 3KHGA 3AUOA 3QZ7A 1L7MA 5J2CA 5KL8B 2RHFA 7ICRA 5KAIU 2NO4A 1HEKA 3E58A 3SEIA 2MRLA 2HVHA 1WG8A 5L1JA 1M6YA 4M9JA 1B0XA 2ODGA 3B0YA 2HHQA 4F2SA 4DF4A 3ED5A 1XSLA 3PO4A 3HILA 5KG7A 3QU4A 2JMGA 3LWMA 5AIBA 2WF5A 5AM2A 3TANA 1T8EA 3B0XA 4Y2JA 3H0LB 2G06A 4QWBA 3H7IA 4QZFA 1FFVA 2KSOA 4IR9A 4DFPA 9ICQA 2HHTA 4U7CA 4EZ6A 3C2KA 2RDJA 2LMRA 4GXIA 1MC8A 3MFIA 2BQRA 2WF9A 3JPPA 1KTQA 4F4KA 2IOHA 8ICMA 1BPZA 4O5KA 4Y2UA 2HHSA 4F3OA 2XGQA 4YCXA 5KFDA 5ALUA 5F3XB 5KFLA 2MSNA
chains in the Genus database with same CATH topology
3C1YA 4Z6DA 1KFDA 5D49A 4I2IA 3MR2A 4YMOA 3GIIA 2BPFA 1T7PA 4PHAA 4RNNA 4QWCA 4CCHA 1AROP 1ZQKA 5KFBA 3MFHA 5HP4A 5KT3A 1Z00B 4YVZA 3KHHA 3THVA 3RBEA 3RJKA 2J6TA 1SKRA 1MQ3A 4YXMA 1U47A 5J2HA 4Q45A 2H5XA 4UAZA 2XY6A 3LDAA 5KFEA 4J9LA 5DB9A 3KHRA 2Y1JA 2MUTB 9ICPA 3C1ZA 2GWSA 3MBYA 3BDPA 4FBUA 4DSLA 1SL2A 5CP2A 4DQPA 2DFLA 2VA8A 3BQ0A 5CHGA 4XRHA 1SL1A 3RJGA 3OHAA 4JK1A 9ICTA 2I1QA 4C8OA 3RRHA 2ASDA 1QSYA 2W8LA 2R8HA 2Y1IA 3HPOA 1BPYA 2PFOA 2ZUCA 3V7JA 2HHXA 2KZZA 1QLNA 4UB5A 1K1QA 3V7KA 1T4GA 4ZH4A 5J2KA 2R8IA 3UXPA 4PPXA 4MF2A 4O3OA 3ETLA 4F91B 5J0RA 1TK0A 4RNOA 4RQ0A 2MUTA 4TURA 3TFRA 1ZQAA 1D9FA 4P4MA 3MGIA 3ZDAA 4QZAA 4GC6A 3FYHA 5KFCA 4ECZA 3T3FA 3C5GA 2PI5A 4YFKA 9ICKA 7ICVA 4UB3A 2NRZA 3C23A 4NLGA 4PHEA 4TUSA 2FMQA 4KLQA 4KMUA 1S0OA 4RPXA 4JUZA 4RT2A 3HT3A 4IRDA 8ICIA 3PVXA 3T5LA 1S0NA 4JWNA 4Z6FA 4C8MA 3TFSA 4DFKA 5J2BA 1WCNA 1KRPA 1QSSA 4PGYA 8ICPA 1ZJNA 2ZJAA 4QW9A 4ED8A 2NRTA 5KFHA 5DGBA 4QZBA 3T5JA 1NJXA 2FLLA 2AQ0A 2XCAA 7ICLA 5DQHA 3HX0A 3HWTA 5TZVA 4KLIA 5IIOA 4B9SA 1HJPA 4ED0A 3KHLA 7ICGA 1A76A 5KFMA 3Q8MA 3G6VA 4KLJA 1JXEA 5IIKA 3GV8B 4EYIB 1KEJA 4NLZA 3Q8LA 3RB3A 1XWLA 5C5JA 5KFNA 5J2IA 1JXLA 4BXOB 8ICTA 5J0PA 4UB2A 2J6SA 4RQ5A 4FBTA 2ALZA 9ICLA 1JN3A 2FLNA 2PFNA 2B21A 4IQWA 4FO6A 3GV5B 4M47A 4Q8EA 3RB0A 5J0XA 1ZQRA 4NLKA 3IM1A 2PFPA 4NM1A 2AU0A 5KG6A 4JWMA 1B22A 5F9NA 4DLGA 3RJJA 4F4XA 3GV7B 4DQQA 3RJEA 4G3IA 4DF8A 3TQ1A 2IMWP 5IINA 4I2BA 4R8UA 4BXOA 4DEZA 4QZIA 2W9BA 9ICWA 4ED6A 1UA1A 2KN7A 1RYSA 5KG3A 2ATLA 4QZGA 4O0IA 4MF8A 2C2RA 1ZJMA 2BCSA 2JEJA 1TV9A 4F93B 4O3SA 3TAQA 3MABA 4J9MA 4TUQA 8ICVA 2BCVA 3IHQB 4BGDA 5DBAA 7ICNA 4EZ9A 4C8NA 4F2RA 2KFZA 2C2DA 2W9AA 3SI8A 5DDMA 4DL7A 1ZQWA 1SZPA 4ECRA 5EWEA 4DOAA 2VANA 4Q43A 5DB6A 1T3NA 4YXJA 1ZQCA 3UXOA 4UAWA 4IR1A 4YMMA 4RT3A 3SV3A 9ICFA 4ECTA 9ICJA 4K4IA 2V4QA 1HUOA 4J9KA 3M8SA 1RYRA 8ICGA 1XU4A 8ICOA 2KZ3A 3RH6A 4DSKA 4KTQA 5DQIA 4RQ4A 4QZCA 5J29A 3QE9Y 3RH5A 7ICIA 5KFYA 4J9RA 4M6WA 8ICUA 4B9TA 2UVRA 1K1SA 5DG9A 3EPGA 2IBKA 1V9PA 4IQUA 4ELTA 5L1IA 5DDYA 3GQCA 4QZDA 4DSFA 1UA0A 1QTMA 4ECWA 2HVIA 5D46A 4TQRA 2W9CA 4M04A 2C28A 4IRKA 4PHPA 4GXJA 2ZTEA 4DLEA 2JZBB 1KLNA 2I9GA 1L5UA 3NTUA 4O9MA 4F92B 7ICHA 5CR0A 4UB4A 1ZQOA 3OHBA 3H4DA 2R8KA 4QZHA 3Q8QB 1X9SA 1LV5A 2WTFA 3Q8KA 7ICSA 3M8RA 8ICFA 4EBEA 1KDHA 5KG2A 1TK8A 2PXIA 5DGAA 1RXWA 4YMNA 3K75D 4EBDA 4DS4A 2UVVA 3M9NB 4UB1A 5KFAA 3PW5A 4YG2A 3ZD8A 3JPQA 1L3SA 2HW3A 7ICJA 1UT5A 1TVAA 3RJFA 1TKDA 3PO5A 2C2EA 3GIMA 2AGPA 1SL0A 1ZQZA 5HMLA 8ICRA 4I2GA 2VA2A 5L9XA 3EYZA 1Z3EB 2ZJ5A 5J2AA 7ICEA 1U49A 1U48A 1BGXT 5BOLA 1IXRA 1ZQUA 2ZTCA 3OSNA 2XGPA 1S0MA 5CB1A 1ZQGA 3GIJA 4GXKA 4P4OA 4NM2A 4I2FA 5KFIA 4B9MA 4F4WA 3HW8A 1XSPA 8ICBA 4K4GA 3RAXA 4F4ZA 4ECSA 1NOMA 1BVSA 3V6HA 4DS5A 4I29A 2DPJA 9ICHA 4JV0A 3Q8SB 5J2DA 1ZQLA 4ELUA 4KLHA 1X9WA 3RBDA 2BCQA 4M9NA 5KFOA 5J2GA 2BCRA 4R64A 2W9MA 4Q44A 4ED7A 3Q8PB 2XC9A 4DQRA 4RU9A 2XY5A 1ZYQA 7ICKA 3BQ2A 5KFTA 5DQGA 4DL4A 4IQVA 2JEFA 5DB7A 5KFWA 3PV8A 1S10A 4I2AA 1H38A 4LZDA 4EBCA 4RPYA 8ICCA 1ZQTA 3BJYA 4F8RA 4ECXA 3TARA 9ICAA 1NKCA 1ZQDA 3RR8A 7ICMA 3FDSA 4F5RA 4DFJA 5EOZA 8ICNA 1ZQVA 5KFJA 4UQGA 5DLGA 4PGXA 3EW9A 4DFMA 7ICFA 1RPLA 3TI0A 3RAQA 2JEGA 3LK9A 5KFFA 3AU2A 4HYKA 1NJYA 4MFCA 4M9GA 1S9FA 4R66A 4RQ3A 4KN4A 4ECVA 3H4BA 4DL3A 4PGQA 2W8KA 3C2MA 1SKSA 1N56A 9ICGA 1NK6A 4YQWA 1WCLA 4QWAA 2HHVA 7ICPA 4ELVA 3EZ5A 1BPEA 3Q8RB 5J0TA 1D8YA 3C21A 3GFKB 5DB8A 3JPRA 4F5PA 3RB4A 3MR5A 9ICOA 5KTQA 2IHMA 2F1IA 2DPIA 2RDIA 2FMPA 2HHUA 4J9OA 1ZQQA 2M9NA 3M9MB 2FPKA 1XO1A 4M6WB 9ICSA 5DBCA 3HP6A 1RZTA 5KFKA 4F5QA 4KLMA 4MEYA 4DO9A 4NLNA 3V72A 3H8WA 2UVWA 1Y88A 9ICIA 4PH5A 4DWIA 5IIJA 1NKEA 2A1JB 4EYHB 4KLDA 4YN4A 1L3TA 4PHDA 4I2HA 4I2JA 3SV4A 1N48A 1S0VA 5KFSA 4MEXA 1QSLA 5J0OA 1CEZA 3SYZA 4NXZA 3H8JA 5KG1A 4FS1A 3RTVA 2LYHA 1NJZA 4X5VA 2BHNA 1ZQIA 3RH4A 4J9NA 1Z00A 4BWMA 4QWEA 4I2CA 2BKEA 1D8LA 3UPQA 3GIKA 1S76D 4YP3A 1TFRA 4R65A 1ZQJA 2PFQA 1C7YA 2V4RA 5HMMA 5DG8A 3KTQA 3ZDBA 4RNMA 2R8JA 4NY8A 4RQ8A 4B9LA 2NRXA 5KG4A 5HNKA 8ICHA 2C22A 1ZQBA 4DOBA 5EWGA 5J2FA 9ICCA 1BPBA 2ZUBA 3ISCA 1BPXA 1ZETA 1BPDA 1TK5A 1ZQHA 4I2EA 4KLLA 2NRWA 5CJ7A 1U45A 4O5EA 1JX4A 5DG7A 4B9UA 4FS2A 1MSWD 4F50A 4BWJA 3G6YA 2BPGA 3PR5B 8ICEA 2XO7A 4E0DA 4KLOA 9ICXA 1TAQA 3PW2A 4Q8FA 1NK0A 3PMNA 1SKWA 4JV1A 2A1JA 5DLFA 4C8LA 1ZQXA 2NRVA 3MDCA 3LWLA 3GDXA 1KSPA 5KG0A 5BPCA 4XQ8A 2OWOA 5KFRA 4F5OA 3ZDCA 1B43A 3N4MB 3NGDA 4DL6A 4B9NA 4I28A 4JV2A 5KFUA 4ECQA 3M9OB 7ICOA 1XSNA 5HHIA 2BDPA 1LB2B 2BQ3A 5KFVA 3OJUA 2FPLA 3AU6A 3OGUA 2UVUA 8ICKA 1ZQPA 8ICYA 2ZTDA 1UT8A 5J0QA 4M9LA 3QZ8A 4DL5A 1NJWA 3C5FA 1JIHA 4DQSA 3OSPA 5KT2A 2ZJ8A 4M2YA 4RZRA 1U9LA 2FPMA 2BCUA 2J6UA 3RRGA 4M0AA 3T5HA 2P66A 7ICQA 4KLFA 4R63A 5KFQA 1XS9D 1TAUA 3ORYA 4YD1A 4RPZA 3G6XA 9ICMA 3UXNA 3PX6A 5KG5A 5J0SA 4ED3A 3MGHA 4ED2A 2BGWA 5HHHA 5IIMA 4UAYA 4DQIA 3BQTA 3MDAA 2IA6A 2F1JA 2ASJA 4YR0A 4O3NA 2Q0ZX 3C2LA 5KFPA 4J9SA 2V9WA 3RJHA 1HUZA 2JEIA 1KFSA 1X2IA 4R8UB 3SZ2A 4KLSA 1DOQA 5BOMA 5KT4A 2MAXA 3K4GA 8ICLA 5DKWA 4RUCA 9ICUA 3E2EA 4MFFA 9ICVA 4Z6EA 3RJIA 2XY7A 2AGOA 3MR3A 3RR7A 3ISDA 4F4YA 5J0YA 2FMSA 5J0WA 3UQ0A 5IIIA 4C8KA 9ICNA 5EWFA 4UBBA 4O3RA 7ICTA 1NK9A 5KFGA 1ZQSA 3ZDDA 1CUKA 8ICSA 2XCPA 4ECYA 4QZ8A 4EEYA 5L1LA 8ICWA 4I2DA 2AQ4A 3JPOA 4J9PA 4RQ6A 2R8GA 3ZD9A 4TUPA 3V6KA 1S77D 4IRCA 2PI4A 4YR2A 5D4BA 5DBBA 5JUMA 5F9LA 2BR0A 3H8SA 3KHGA 3PW0A 2P6UA 3AUOA 8ICAA 4XUSA 4O3QA 1IM4A 3UQ2A 4QZEA 2IHNA 2ISPA 4ED1A 1L3UA 3JPSA 3QZ7A 2VA3A 2BQUA 4DSEA 2F1HA 3QEBZ 5J2CA 4DSIA 1COOA 7ICRA 1EXNA 2ASLA 4RQ7A 4RUAA 1KFTA 3QEAZ 4QZ9A 4LVSA 5J2JA 5L1KA 3EPIA 9ICRA 1A77A 4GLXA 2HVHA 2AJQA 1ZQMA 5IILA 5L1JA 4M9JA 4P2HA 1X9MA 2KTQA 2ZUDA 9ICEA 3B0YA 1NK7A 3EWAA 5CA7A 4YR3A 2HHQA 9ICBA 1ZQEA 4F2SA 2KFNA 4KITB 4DF4A 1XSLA 4RQ1A 1MQ2A 3PR4A 2JZBA 3PO4A 5KG7A 3ISBA 4B9VA 4F5NA 4LZGA 2ISOA 4KLUA 3V6JA 4QW8A 5J0UA 3V7LA 3LWMA 3ZDEA 2HHWA 2KZMA 3TANA 5KT6A 1T8EA 3MR6A 1U4BA 3B0XA 5J2EA 1S97A 4DSJA 3PX4A 4QWBA 3JPTA 5KFXA 1L3VA 8ICXA 3H7IA 4QZFA 3PNCA 3H40A 4KLTA 3RB6A 4BDPA 3TAPA 4TQSA 4QWDA 4DFPA 4MFAA 4IR9A 1RXVA 2FLPA 9ICQA 4Z6CA 4K4HA 2HHTA 4KLGA 1ZQFA 4RQ2A 5KFZA 4UBCA 4EZ6A 8ICZA 4J9QA 3C2KA 2RDJA 3GILA 4DOCA 3PW7A 1PZNA 3OJSA 7ICUA 4GXIA 1MC8A 4O5CA 3MFIA 2P6RA 8ICQA 2BQRA 4I27A 3JPPA 1KTQA 4F4KA 1JMSA 2BPCA 5KT5A 1XC9A 4KLEA 8ICMA 2AGQA 2W9CB 4DL2A 1NK8A 1DGSA 5CWRA 1NKBA 1BPZA 3JPNA 4P4PA 3PY8A 4O5KA 5KT7A 2HHSA 4F3OA 4IQTA 2W9BB 1D9DA 2XGQA 1ZQYA 3N97B 4YCXA 5KFDA 3PMLA 3PX0A 4ECUA 4M9HA 8ICJA 1NK4A 4GC7A 4XA5A 5KFLA 1NK5A 4KN7A 3PW4A 3BQ1A 4YD2A 3T5KA 1ZQNA 4O3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1Y A;  4Z6D A;  1KFD A;  5D49 A;  4I2I A;  3MR2 A;  4YMO A;  3GII A;  2BPF A;  1T7P A;  4PHA A;  4RNN A;  4QWC A;  4CCH A;  1ARO P;  1ZQK A;  5KFB A;  3MFH A;  5HP4 A;  5KT3 A;  1Z00 B;  4YVZ A;  3KHH A;  3THV A;  3RBE A;  3RJK A;  2J6T A;  1SKR A;  1MQ3 A;  4YXM A;  1U47 A;  5J2H A;  4Q45 A;  2H5X A;  4UAZ A;  2XY6 A;  3LDA A;  5KFE A;  4J9L A;  5DB9 A;  3KHR A;  2Y1J A;  2MUT B;  9ICP A;  3C1Z A;  2GWS A;  3MBY A;  3BDP A;  4FBU A;  4DSL A;  1SL2 A;  5CP2 A;  4DQP A;  2DFL A;  2VA8 A;  3BQ0 A;  5CHG A;  4XRH A;  1SL1 A;  3RJG A;  3OHA A;  4JK1 A;  9ICT A;  2I1Q A;  4C8O A;  3RRH A;  2ASD A;  1QSY A;  2W8L A;  2R8H A;  2Y1I A;  3HPO A;  1BPY A;  2PFO A;  2ZUC A;  3V7J A;  2HHX A;  2KZZ A;  1QLN A;  4UB5 A;  1K1Q A;  3V7K A;  1T4G A;  4ZH4 A;  5J2K A;  2R8I A;  3UXP A;  4PPX A;  4MF2 A;  4O3O A;  3ETL A;  4F91 B;  5J0R A;  1TK0 A;  4RNO A;  4RQ0 A;  2MUT A;  4TUR A;  3TFR A;  1ZQA A;  1D9F A;  4P4M A;  3MGI A;  3ZDA A;  4QZA A;  4GC6 A;  3FYH A;  5KFC A;  4ECZ A;  3T3F A;  3C5G A;  2PI5 A;  4YFK A;  9ICK A;  7ICV A;  4UB3 A;  2NRZ A;  3C23 A;  4NLG A;  4PHE A;  4TUS A;  2FMQ A;  4KLQ A;  4KMU A;  1S0O A;  4RPX A;  4JUZ A;  4RT2 A;  3HT3 A;  4IRD A;  8ICI A;  3PVX A;  3T5L A;  1S0N A;  4JWN A;  4Z6F A;  4C8M A;  3TFS A;  4DFK A;  5J2B A;  1WCN A;  1KRP A;  1QSS A;  4PGY A;  8ICP A;  1ZJN A;  2ZJA A;  4QW9 A;  4ED8 A;  2NRT A;  5KFH A;  5DGB A;  4QZB A;  3T5J A;  1NJX A;  2FLL A;  2AQ0 A;  2XCA A;  7ICL A;  5DQH A;  3HX0 A;  3HWT A;  5TZV A;  4KLI A;  5IIO A;  4B9S A;  1HJP A;  4ED0 A;  3KHL A;  7ICG A;  1A76 A;  5KFM A;  3Q8M A;  3G6V A;  4KLJ A;  1JXE A;  5IIK A;  3GV8 B;  4EYI B;  1KEJ A;  4NLZ A;  3Q8L A;  3RB3 A;  1XWL A;  5C5J A;  5KFN A;  5J2I A;  1JXL A;  4BXO B;  8ICT A;  5J0P A;  4UB2 A;  2J6S A;  4RQ5 A;  4FBT A;  2ALZ A;  9ICL A;  1JN3 A;  2FLN A;  2PFN A;  2B21 A;  4IQW A;  4FO6 A;  3GV5 B;  4M47 A;  4Q8E A;  3RB0 A;  5J0X A;  1ZQR A;  4NLK A;  3IM1 A;  2PFP A;  4NM1 A;  2AU0 A;  5KG6 A;  4JWM A;  1B22 A;  5F9N A;  4DLG A;  3RJJ A;  4F4X A;  3GV7 B;  4DQQ A;  3RJE A;  4G3I A;  4DF8 A;  3TQ1 A;  2IMW P;  5IIN A;  4I2B A;  4R8U A;  4BXO A;  4DEZ A;  4QZI A;  2W9B A;  9ICW A;  4ED6 A;  1UA1 A;  2KN7 A;  1RYS A;  5KG3 A;  2ATL A;  4QZG A;  4O0I A;  4MF8 A;  2C2R A;  1ZJM A;  2BCS A;  2JEJ A;  1TV9 A;  4F93 B;  4O3S A;  3TAQ A;  3MAB A;  4J9M A;  4TUQ A;  8ICV A;  2BCV A;  3IHQ B;  4BGD A;  5DBA A;  7ICN A;  4EZ9 A;  4C8N A;  4F2R A;  2KFZ A;  2C2D A;  2W9A A;  3SI8 A;  5DDM A;  4DL7 A;  1ZQW A;  1SZP A;  4ECR A;  5EWE A;  4DOA A;  2VAN A;  4Q43 A;  5DB6 A;  1T3N A;  4YXJ A;  1ZQC A;  3UXO A;  4UAW A;  4IR1 A;  4YMM A;  4RT3 A;  3SV3 A;  9ICF A;  4ECT A;  9ICJ A;  4K4I A;  2V4Q A;  1HUO A;  4J9K A;  3M8S A;  1RYR A;  8ICG A;  1XU4 A;  8ICO A;  2KZ3 A;  3RH6 A;  4DSK A;  4KTQ A;  5DQI A;  4RQ4 A;  4QZC A;  5J29 A;  3QE9 Y;  3RH5 A;  7ICI A;  5KFY A;  4J9R A;  4M6W A;  8ICU A;  4B9T A;  2UVR A;  1K1S A;  5DG9 A;  3EPG A;  2IBK A;  1V9P A;  4IQU A;  4ELT A;  5L1I A;  5DDY A;  3GQC A;  4QZD A;  4DSF A;  1UA0 A;  1QTM A;  4ECW A;  2HVI A;  5D46 A;  4TQR A;  2W9C A;  4M04 A;  2C28 A;  4IRK A;  4PHP A;  4GXJ A;  2ZTE A;  4DLE A;  2JZB B;  1KLN A;  2I9G A;  1L5U A;  3NTU A;  4O9M A;  4F92 B;  7ICH A;  5CR0 A;  4UB4 A;  1ZQO A;  3OHB A;  3H4D A;  2R8K A;  4QZH A;  3Q8Q B;  1X9S A;  1LV5 A;  2WTF A;  3Q8K A;  7ICS A;  3M8R A;  8ICF A;  4EBE A;  1KDH A;  5KG2 A;  1TK8 A;  2PXI A;  5DGA A;  1RXW A;  4YMN A;  3K75 D;  4EBD A;  4DS4 A;  2UVV A;  3M9N B;  4UB1 A;  5KFA A;  3PW5 A;  4YG2 A;  3ZD8 A;  3JPQ A;  1L3S A;  2HW3 A;  7ICJ A;  1UT5 A;  1TVA A;  3RJF A;  1TKD A;  3PO5 A;  2C2E A;  3GIM A;  2AGP A;  1SL0 A;  1ZQZ A;  5HML A;  8ICR A;  4I2G A;  2VA2 A;  5L9X A;  3EYZ A;  1Z3E B;  2ZJ5 A;  5J2A A;  7ICE A;  1U49 A;  1U48 A;  1BGX T;  5BOL A;  1IXR A;  1ZQU A;  2ZTC A;  3OSN A;  2XGP A;  1S0M A;  5CB1 A;  1ZQG A;  3GIJ A;  4GXK A;  4P4O A;  4NM2 A;  4I2F A;  5KFI A;  4B9M A;  4F4W A;  3HW8 A;  1XSP A;  8ICB A;  4K4G A;  3RAX A;  4F4Z A;  4ECS A;  1NOM A;  1BVS A;  3V6H A;  4DS5 A;  4I29 A;  2DPJ A;  9ICH A;  4JV0 A;  3Q8S B;  5J2D A;  1ZQL A;  4ELU A;  4KLH A;  1X9W A;  3RBD A;  2BCQ A;  4M9N A;  5KFO A;  5J2G A;  2BCR A;  4R64 A;  2W9M A;  4Q44 A;  4ED7 A;  3Q8P B;  2XC9 A;  4DQR A;  4RU9 A;  2XY5 A;  1ZYQ A;  7ICK A;  3BQ2 A;  5KFT A;  5DQG A;  4DL4 A;  4IQV A;  2JEF A;  5DB7 A;  5KFW A;  3PV8 A;  1S10 A;  4I2A A;  1H38 A;  4LZD A;  4EBC A;  4RPY A;  8ICC A;  1ZQT A;  3BJY A;  4F8R A;  4ECX A;  3TAR A;  9ICA A;  1NKC A;  1ZQD A;  3RR8 A;  7ICM A;  3FDS A;  4F5R A;  4DFJ A;  5EOZ A;  8ICN A;  1ZQV A;  5KFJ A;  4UQG A;  5DLG A;  4PGX A;  3EW9 A;  4DFM A;  7ICF A;  1RPL A;  3TI0 A;  3RAQ A;  2JEG A;  3LK9 A;  5KFF A;  3AU2 A;  4HYK A;  1NJY A;  4MFC A;  4M9G A;  1S9F A;  4R66 A;  4RQ3 A;  4KN4 A;  4ECV A;  3H4B A;  4DL3 A;  4PGQ A;  2W8K A;  3C2M A;  1SKS A;  1N56 A;  9ICG A;  1NK6 A;  4YQW A;  1WCL A;  4QWA A;  2HHV A;  7ICP A;  4ELV A;  3EZ5 A;  1BPE A;  3Q8R B;  5J0T A;  1D8Y A;  3C21 A;  3GFK B;  5DB8 A;  3JPR A;  4F5P A;  3RB4 A;  3MR5 A;  9ICO A;  5KTQ A;  2IHM A;  2F1I A;  2DPI A;  2RDI A;  2FMP A;  2HHU A;  4J9O A;  1ZQQ A;  2M9N A;  3M9M B;  2FPK A;  1XO1 A;  4M6W B;  9ICS A;  5DBC A;  3HP6 A;  1RZT A;  5KFK A;  4F5Q A;  4KLM A;  4MEY A;  4DO9 A;  4NLN A;  3V72 A;  3H8W A;  2UVW A;  1Y88 A;  9ICI A;  4PH5 A;  4DWI A;  5IIJ A;  1NKE A;  2A1J B;  4EYH B;  4KLD A;  4YN4 A;  1L3T A;  4PHD A;  4I2H A;  4I2J A;  3SV4 A;  1N48 A;  1S0V A;  5KFS A;  4MEX A;  1QSL A;  5J0O A;  1CEZ A;  3SYZ A;  4NXZ A;  3H8J A;  5KG1 A;  4FS1 A;  3RTV A;  2LYH A;  1NJZ A;  4X5V A;  2BHN A;  1ZQI A;  3RH4 A;  4J9N A;  1Z00 A;  4BWM A;  4QWE A;  4I2C A;  2BKE A;  1D8L A;  3UPQ A;  3GIK A;  1S76 D;  4YP3 A;  1TFR A;  4R65 A;  1ZQJ A;  2PFQ A;  1C7Y A;  2V4R A;  5HMM A;  5DG8 A;  3KTQ A;  3ZDB A;  4RNM A;  2R8J A;  4NY8 A;  4RQ8 A;  4B9L A;  2NRX A;  5KG4 A;  5HNK A;  8ICH A;  2C22 A;  1ZQB A;  4DOB A;  5EWG A;  5J2F A;  9ICC A;  1BPB A;  2ZUB A;  3ISC A;  1BPX A;  1ZET A;  1BPD A;  1TK5 A;  1ZQH A;  4I2E A;  4KLL A;  2NRW A;  5CJ7 A;  1U45 A;  4O5E A;  1JX4 A;  5DG7 A;  4B9U A;  4FS2 A;  1MSW D;  4F50 A;  4BWJ A;  3G6Y A;  2BPG A;  3PR5 B;  8ICE A;  2XO7 A;  4E0D A;  4KLO A;  9ICX A;  1TAQ A;  3PW2 A;  4Q8F A;  1NK0 A;  3PMN A;  1SKW A;  4JV1 A;  2A1J A;  5DLF A;  4C8L A;  1ZQX A;  2NRV A;  3MDC A;  3LWL A;  3GDX A;  1KSP A;  5KG0 A;  5BPC A;  4XQ8 A;  2OWO A;  5KFR A;  4F5O A;  3ZDC A;  1B43 A;  3N4M B;  3NGD A;  4DL6 A;  4B9N A;  4I28 A;  4JV2 A;  5KFU A;  4ECQ A;  3M9O B;  7ICO A;  1XSN A;  5HHI A;  2BDP A;  1LB2 B;  2BQ3 A;  5KFV A;  3OJU A;  2FPL A;  3AU6 A;  3OGU A;  2UVU A;  8ICK A;  1ZQP A;  8ICY A;  2ZTD A;  1UT8 A;  5J0Q A;  4M9L A;  3QZ8 A;  4DL5 A;  1NJW A;  3C5F A;  1JIH A;  4DQS A;  3OSP A;  5KT2 A;  2ZJ8 A;  4M2Y A;  4RZR A;  1U9L A;  2FPM A;  2BCU A;  2J6U A;  3RRG A;  4M0A A;  3T5H A;  2P66 A;  7ICQ A;  4KLF A;  4R63 A;  5KFQ A;  1XS9 D;  1TAU A;  3ORY A;  4YD1 A;  4RPZ A;  3G6X A;  9ICM A;  3UXN A;  3PX6 A;  5KG5 A;  5J0S A;  4ED3 A;  3MGH A;  4ED2 A;  2BGW A;  5HHH A;  5IIM A;  4UAY A;  4DQI A;  3BQT A;  3MDA A;  2IA6 A;  2F1J A;  2ASJ A;  4YR0 A;  4O3N A;  2Q0Z X;  3C2L A;  5KFP A;  4J9S A;  2V9W A;  3RJH A;  1HUZ A;  2JEI A;  1KFS A;  1X2I A;  4R8U B;  3SZ2 A;  4KLS A;  1DOQ A;  5BOM A;  5KT4 A;  2MAX A;  3K4G A;  8ICL A;  5DKW A;  4RUC A;  9ICU A;  3E2E A;  4MFF A;  9ICV A;  4Z6E A;  3RJI A;  2XY7 A;  2AGO A;  3MR3 A;  3RR7 A;  3ISD A;  4F4Y A;  5J0Y A;  2FMS A;  5J0W A;  3UQ0 A;  5III A;  4C8K A;  9ICN A;  5EWF A;  4UBB A;  4O3R A;  7ICT A;  1NK9 A;  5KFG A;  1ZQS A;  3ZDD A;  1CUK A;  8ICS A;  2XCP A;  4ECY A;  4QZ8 A;  4EEY A;  5L1L A;  8ICW A;  4I2D A;  2AQ4 A;  3JPO A;  4J9P A;  4RQ6 A;  2R8G A;  3ZD9 A;  4TUP A;  3V6K A;  1S77 D;  4IRC A;  2PI4 A;  4YR2 A;  5D4B A;  5DBB A;  5JUM A;  5F9L A;  2BR0 A;  3H8S A;  3KHG A;  3PW0 A;  2P6U A;  3AUO A;  8ICA A;  4XUS A;  4O3Q A;  1IM4 A;  3UQ2 A;  4QZE A;  2IHN A;  2ISP A;  4ED1 A;  1L3U A;  3JPS A;  3QZ7 A;  2VA3 A;  2BQU A;  4DSE A;  2F1H A;  3QEB Z;  5J2C A;  4DSI A;  1COO A;  7ICR A;  1EXN A;  2ASL A;  4RQ7 A;  4RUA A;  1KFT A;  3QEA Z;  4QZ9 A;  4LVS A;  5J2J A;  5L1K A;  3EPI A;  9ICR A;  1A77 A;  4GLX A;  2HVH A;  2AJQ A;  1ZQM A;  5IIL A;  5L1J A;  4M9J A;  4P2H A;  1X9M A;  2KTQ A;  2ZUD A;  9ICE A;  3B0Y A;  1NK7 A;  3EWA A;  5CA7 A;  4YR3 A;  2HHQ A;  9ICB A;  1ZQE A;  4F2S A;  2KFN A;  4KIT B;  4DF4 A;  1XSL A;  4RQ1 A;  1MQ2 A;  3PR4 A;  2JZB A;  3PO4 A;  5KG7 A;  3ISB A;  4B9V A;  4F5N A;  4LZG A;  2ISO A;  4KLU A;  3V6J A;  4QW8 A;  5J0U A;  3V7L A;  3LWM A;  3ZDE A;  2HHW A;  2KZM A;  3TAN A;  5KT6 A;  1T8E A;  3MR6 A;  1U4B A;  3B0X A;  5J2E A;  1S97 A;  4DSJ A;  3PX4 A;  4QWB A;  3JPT A;  5KFX A;  1L3V A;  8ICX A;  3H7I A;  4QZF A;  3PNC A;  3H40 A;  4KLT A;  3RB6 A;  4BDP A;  3TAP A;  4TQS A;  4QWD A;  4DFP A;  4MFA A;  4IR9 A;  1RXV A;  2FLP A;  9ICQ A;  4Z6C A;  4K4H A;  2HHT A;  4KLG A;  1ZQF A;  4RQ2 A;  5KFZ A;  4UBC A;  4EZ6 A;  8ICZ A;  4J9Q A;  3C2K A;  2RDJ A;  3GIL A;  4DOC A;  3PW7 A;  1PZN A;  3OJS A;  7ICU A;  4GXI A;  1MC8 A;  4O5C A;  3MFI A;  2P6R A;  8ICQ A;  2BQR A;  4I27 A;  3JPP A;  1KTQ A;  4F4K A;  1JMS A;  2BPC A;  5KT5 A;  1XC9 A;  4KLE A;  8ICM A;  2AGQ A;  2W9C B;  4DL2 A;  1NK8 A;  1DGS A;  5CWR A;  1NKB A;  1BPZ A;  3JPN A;  4P4P A;  3PY8 A;  4O5K A;  5KT7 A;  2HHS A;  4F3O A;  4IQT A;  2W9B B;  1D9D A;  2XGQ A;  1ZQY A;  3N97 B;  4YCX A;  5KFD A;  3PML A;  3PX0 A;  4ECU A;  4M9H A;  8ICJ A;  1NK4 A;  4GC7 A;  4XA5 A;  5KFL A;  1NK5 A;  4KN7 A;  3PW4 A;  3BQ1 A;  4YD2 A;  3T5K A;  1ZQN A;  4O3P A; 
#chains in the Genus database with same CATH topology
 5H2F U;  3C1Y A;  2A1A A;  5J8Y A;  1GO3 F;  2EZZ A;  4RNN A;  3SQI A;  5KFB A;  5HP4 A;  4NL9 A;  3THV A;  2J6T A;  2XY6 A;  2GWS A;  1SL2 A;  5EE1 A;  2VA8 A;  4XRH A;  4C8O A;  3WKA A;  5G5G A;  4QJF B;  2W8L A;  3HPO A;  1BPY A;  2PFO A;  4QNL A;  3QYP A;  1K1Q A;  3V7K A;  1RG6 A;  4MF2 A;  4TUR A;  4CGZ A;  1ZQA A;  2WF7 A;  4P4M A;  4QZA A;  2PI5 A;  7ICV A;  4UB3 A;  4CF3 A;  3F5A A;  4KMU A;  3HT3 A;  8ICI A;  5JTI A;  4JWN A;  2WF6 A;  4C8M A;  1KRP A;  4PGY A;  1ZJN A;  4QW9 A;  1FEZ A;  4QZB A;  4OD0 A;  7ICL A;  1NJX A;  2AQ0 A;  2XCA A;  3CYM A;  3HX0 A;  4KLI A;  5IIO A;  1HJP A;  7ICG A;  3Q8M A;  1CRX A;  4KLJ A;  1JXE A;  3Q8L A;  2JGA A;  5E79 U;  4UB2 A;  2B6G A;  2DGZ A;  2FLN A;  4M47 A;  5CRX A;  4NLK A;  1NZB A;  3BS5 A;  1MA7 A;  3TQ1 A;  2IMW P;  2K4P A;  4C0Z A;  9ICW A;  1UA1 A;  3RF9 A;  2K4E A;  9ICB A;  2C2R A;  1ZJM A;  1V97 A;  3KBB A;  3QUC A;  2JEJ A;  4O3S A;  2W7P A;  3LVV A;  4EZ9 A;  5G5H A;  1SZP A;  2FI1 A;  3QU7 A;  2VAN A;  3ONN A;  5C0Y A;  4YMM A;  3WKE A;  4PZN A;  9ICF A;  4K4I A;  2V4Q A;  1X6J A;  4HAI A;  3SAG A;  3WKC A;  2ZIX A;  4KTQ A;  3RH5 A;  4J9R A;  2KJ8 A;  4B9T A;  2JV3 A;  4ELT A;  3NVV A;  5L1I A;  2LYA A;  2YQE A;  4PHP A;  4DLE A;  1L7O A;  5AI9 A;  2HBJ A;  4RQN A;  2JH7 A;  4CRX A;  2GOL A;  2JH1 A;  3WK8 A;  5A0L A;  1NNL A;  5J8Y C;  3Q8Q B;  1YT3 A;  3Q8K A;  4P0Q A;  1TK8 A;  2KSO B;  2NO5 A;  4EBD A;  2W03 A;  1L3S A;  3PST A;  5KFA A;  4YG2 A;  1TVA A;  2CN1 A;  2EAN A;  2JRZ A;  3GIM A;  3HJE A;  3QUB A;  2ZJ5 A;  7ICE A;  3QNM A;  3M6K A;  3OSN A;  4NM2 A;  3HW8 A;  8ICB A;  4DS5 A;  2OHF A;  3RBD A;  3QUT A;  5KFO A;  3WK5 A;  2JEF A;  5KFW A;  1S10 A;  4I2A A;  2WHE A;  4ECX A;  2HDO A;  7ICM A;  5EOZ A;  3H0R B;  5KFJ A;  1K5O A;  3TI0 A;  3WKB A;  3LK9 A;  5KFF A;  4UB6 U;  5ALJ A;  5ALL A;  4KN4 A;  4DL3 A;  3DV9 A;  3IN5 A;  3ETR A;  1NK6 A;  2EAO A;  4QWA A;  2HHV A;  1BPE A;  2K4H A;  3MR5 A;  2RDI A;  2FMP A;  3QXG A;  3M9M B;  1KL9 A;  1XO1 A;  5DBC A;  3HP6 A;  2YB1 A;  3NVW A;  1RZT A;  2H3V A;  9ICI A;  4CDG A;  2W7O A;  3RFA A;  4YN4 A;  4CF4 A;  3NS1 A;  3D6J A;  3E0F A;  4MEX A;  1QSL A;  2F77 X;  1OUQ A;  5ALG A;  4C7Z A;  4J9N A;  4FE3 A;  3DEE A;  2BKE A;  4QWE A;  1S76 D;  5AM3 A;  5AK3 A;  1UHU A;  2V4R A;  5DG8 A;  4RQ8 A;  8ICH A;  2YML A;  5ALQ A;  5J2F A;  3M1Y A;  1BPD A;  2AXT U;  2W55 A;  5CJ7 A;  1U45 A;  2EAM A;  1JX4 A;  1ZRN A;  2EDU A;  4BWJ A;  3G6Y A;  5AKL A;  4EEN A;  1TAQ A;  2D6F C;  1NK0 A;  3PMN A;  3QUQ A;  5DLF A;  3U26 A;  2NRV A;  3MDC A;  2DKX A;  4F5O A;  1PUZ A;  5EE3 A;  3NGD A;  4DL6 A;  2YTU A;  1Q3U A;  4I28 A;  5KFU A;  8ICK A;  2GH1 A;  1ZQP A;  8ICY A;  5J0Q A;  4M9L A;  4DL5 A;  1NJW A;  3NVY A;  4PJ0 U;  2J6U A;  2FPM A;  2P66 A;  3M6Z A;  4C80 A;  4R63 A;  4YD1 A;  4RPZ A;  3G6X A;  1F44 A;  4CNQ A;  3NUQ A;  4U6P A;  1IG6 A;  5ALN A;  4ED2 A;  2ASJ A;  3C2L A;  2V9W A;  2FJ6 A;  5KFP A;  2JEI A;  4R8U B;  1L8L A;  1VDV A;  2MAX A;  4RUC A;  9ICU A;  4MFF A;  4B6J A;  3RJI A;  1TE2 A;  2XY7 A;  2ZXH A;  2GLE A;  2KKP A;  4F4Y A;  4P0Q B;  7ICT A;  1NK9 A;  1ZQS A;  2BZF A;  4ECY A;  4QZ8 A;  4BJQ A;  4EEY A;  2AQ4 A;  4Y2V A;  3JPO A;  4J9P A;  1S77 D;  3PW0 A;  2P6U A;  1T3Q A;  8ICA A;  1N63 A;  2ZIV A;  4QZE A;  1L3U A;  3JPS A;  4NLB A;  3QEB Z;  2ASL A;  1S8O A;  3LVW A;  3PSP A;  4IL6 U;  1AQ6 A;  5J2J A;  3EPI A;  3UMB A;  9ICR A;  2AJQ A;  1ZQM A;  5IIL A;  2KTQ A;  2ZUD A;  3EWA A;  1ZQE A;  1ZD3 A;  4KIT B;  4FZL A;  1MQ2 A;  4OJL A;  3PR4 A;  4B9V A;  2W04 A;  3AEV A;  2KIC A;  4KLU A;  5J0U A;  5AKX A;  5KT6 A;  1S97 A;  3JPT A;  3TAP A;  4TQS A;  2HOI A;  2FLP A;  4KLG A;  1ZQF A;  1J97 A;  2AHO B;  4DOC A;  3PW7 A;  1PK3 A;  2FE9 A;  4O5C A;  8ICQ A;  2YMQ A;  2P6R A;  1JMS A;  1XC9 A;  5KT5 A;  1PVQ A;  2Z7J A;  3A0H U;  2AGQ A;  2W9C B;  4DL2 A;  3NRW A;  1DGS A;  4KLQ A;  4P4P A;  5KT7 A;  1B4F A;  5AKH A;  2W9B B;  4C4R A;  5ALY A;  4M9H A;  4ECU A;  4DCC A;  3PW4 A;  2QAR B;  1KFD A;  4I2I A;  5HR7 A;  2BPF A;  4CCH A;  1ZQK A;  4UAS A;  5KT3 A;  3KHH A;  5AKE A;  3OPX A;  1MQ3 A;  1U47 A;  4Q45 A;  4PL2 A;  2K89 A;  5DB9 A;  2Y1J A;  4J9L A;  1NI3 A;  3C1Z A;  2VJ5 A;  3QU2 A;  1QH9 A;  5CP2 A;  4DQP A;  3BQ0 A;  1SL1 A;  3OHA A;  3LYS A;  3RRH A;  2ZUC A;  2HHX A;  4UB5 A;  3IDW A;  5J2K A;  4F91 B;  3ETL A;  2ZIW A;  4RNO A;  3TFR A;  3ZDA A;  4UW9 A;  5KFC A;  3C5G A;  2LI6 A;  2DQN B;  1DRG A;  4PHE A;  2FMQ A;  2VKQ A;  4RT2 A;  2HCF A;  1SXD A;  4Z6F A;  3TFS A;  3WKD A;  1SWW A;  5J2B A;  4ED8 A;  5TZV A;  1RYU A;  2PMZ F;  4ED0 A;  2KVS A;  5ALR A;  1KEJ A;  3FC4 A;  3RB3 A;  1XWL A;  5C5J A;  4BXO B;  5J0P A;  4RQ5 A;  4EEL A;  2ALZ A;  2W43 A;  4FO6 A;  3RB0 A;  2NV3 A;  4CE6 A;  4GIB A;  5ALZ A;  1O03 A;  3AQE A;  5AKK A;  1SIJ A;  4DF8 A;  1SZH A;  5IIN A;  4I2B A;  4R8U A;  2W9B A;  2XIC A;  3F5E A;  2F3N A;  1Q3V A;  1RYS A;  3N28 A;  5KG3 A;  2ATL A;  4QZG A;  4DSJ A;  1TV9 A;  3MAB A;  4J9M A;  4EEK A;  5AM0 A;  8ICV A;  2HBL A;  4BGD A;  7ICN A;  2ZIV B;  2KFZ A;  2C2D A;  2W9A A;  3SI8 A;  5DDM A;  2CPR A;  1ZQW A;  5EWE A;  4A8E A;  2YMM A;  4Q43 A;  1UQV A;  1T3N A;  5ALK A;  4UAW A;  3IG8 A;  4RT3 A;  3EUB 2;  4ECT A;  9ICJ A;  1HUO A;  8ICG A;  1XU4 A;  8ICO A;  2DWQ A;  5DQI A;  4RQ4 A;  5KFY A;  5JRT A;  1K1S A;  3E2E A;  1V9P A;  3GQC A;  4QZD A;  1QTM A;  2HVI A;  4ECW A;  4UAR A;  1RM6 C;  1OW5 A;  2QB0 B;  4IRK A;  2HBK A;  4GXJ A;  3GZF A;  1KLN A;  3NTU A;  4F92 B;  5CR0 A;  1ZQO A;  3OHB A;  3MC1 A;  5HR6 A;  2E1F A;  2KOB A;  1VLB A;  2OCE A;  5AK5 A;  7ICS A;  1PVR A;  2PXI A;  3K75 D;  1SWV A;  4DS4 A;  3M9N B;  3PW5 A;  1JI7 A;  2VJ4 A;  2Y0S C;  3RJF A;  3WK9 A;  4I2G A;  2VA2 A;  5J2A A;  1U49 A;  5EE9 A;  2GO7 A;  5BOL A;  1IXR A;  2XGP A;  1ZQG A;  3GIJ A;  3FAH A;  4I2F A;  2Y9U A;  3RAX A;  4F4Z A;  1BVS A;  4I29 A;  1KKX A;  2DPJ A;  2D8C A;  1MN8 A;  5J2D A;  4ELU A;  2EZY A;  1X9W A;  2BCQ A;  1N5X A;  1X66 A;  2DL0 A;  3Q8P B;  3KFU F;  3BZC A;  4RPY A;  1ZQT A;  3BJY A;  4DFJ A;  1ZQV A;  4UQG A;  2H3Z A;  5DLG A;  2KHQ A;  3EW9 A;  4PGX A;  5K4L A;  4IC9 A;  4HYK A;  3D2Q A;  1S9F A;  4M9G A;  3H4B A;  2WFA A;  3KKA A;  5AIA A;  5AIC A;  4YQW A;  3EZ5 A;  5AHX A;  1WWU A;  3JPR A;  4UAU A;  2IHM A;  2DPI A;  5ALO A;  4J9O A;  2LM1 A;  2M9N A;  3SMV A;  2O6K A;  9ICS A;  1VJ5 A;  2ZIU B;  4MEY A;  4ACO A;  1XO0 A;  5IIJ A;  1NKE A;  2CRX A;  5ALI A;  1KBU A;  3BS5 B;  4I2H A;  3D2S A;  1N62 A;  3M7D A;  3J81 j;  5KFS A;  3SYZ A;  3H8J A;  4FS1 A;  5AM1 A;  1NJZ A;  2M0N A;  1ZQI A;  3RH4 A;  1Z00 A;  4KX3 A;  1D8L A;  4US8 A;  3GIK A;  3UPQ A;  4YP3 A;  1TFR A;  1PK1 B;  2RLT A;  4R65 A;  1ZQJ A;  2PFQ A;  1C7Y A;  4DFD A;  1IV8 A;  2NRX A;  5HNK A;  5ALE A;  5EWG A;  3F2D A;  3UMC A;  1BPX A;  1ZET A;  1TK5 A;  1JAL A;  3AMZ A;  4B9U A;  4FS2 A;  2PKE A;  4US9 A;  2H3Q A;  3PR5 B;  1J2M A;  4C4S A;  4KLO A;  9ICX A;  5AI6 A;  4Q8F A;  2JHD A;  2K60 A;  3GDX A;  3LWL A;  2XVT A;  2F76 X;  1BNP A;  1B43 A;  2K8A A;  3PSF A;  2IOF K;  4JV2 A;  7ICO A;  1XSN A;  3OGU A;  2ZTD A;  1UT8 A;  1F0M A;  3QZ8 A;  4RQM A;  3C5F A;  1JIH A;  1FIQ A;  3CP8 A;  3OSP A;  5KT2 A;  2OH2 A;  1XNS A;  1O08 A;  4M0A A;  3T5H A;  2EH9 A;  2E5S A;  4JB3 A;  5KFQ A;  1XS9 D;  3ORY A;  5ALW A;  2LKY A;  3UXN A;  1A6S A;  5KG5 A;  2BGW A;  5HHH A;  5IIM A;  1FFU A;  4AP9 A;  4DQI A;  2IA6 A;  2KIV A;  2Q0Z X;  2W3S A;  3RJH A;  1N60 A;  1KFS A;  1X2I A;  3SZ2 A;  1DOQ A;  5KT4 A;  8ICL A;  5DKW A;  2F8L A;  4Z6E A;  5L1M A;  2AGO A;  3MR3 A;  3RR7 A;  1T94 A;  3ISD A;  5J0Y A;  5J0W A;  5EWF A;  4UBB A;  3ZDD A;  2XCP A;  4Y2Y A;  3SR6 A;  4KX5 A;  2JR5 A;  5L1L A;  8ICW A;  3L3F X;  2W54 A;  2XI9 A;  1UPH A;  4RQ6 A;  1KN5 A;  1Q8K A;  2A3V A;  2KKV A;  4FZN A;  5D4B A;  2G09 A;  1KW4 A;  3H8S A;  4QIW C;  1Z4O A;  2IHN A;  2BDU A;  2VA3 A;  2BQU A;  1N61 A;  2F1H A;  4DSI A;  1EXN A;  4RUA A;  4NL9 C;  5ALH A;  4QZ9 A;  5L1K A;  1A77 A;  4GLX A;  1NK7 A;  5CA7 A;  3HRD D;  3TAC B;  2JZB A;  2I5H A;  3ISB A;  2ZIW B;  3V6J A;  3VCB A;  4QW8 A;  5B66 U;  2HHW A;  3MGV A;  1RDF A;  5AK6 A;  1QQ6 A;  3PX4 A;  1L3V A;  1SV0 A;  1YZ6 A;  2ZG6 A;  3NRZ A;  5ALP A;  3PNC A;  1L7P A;  3RB6 A;  3NVZ A;  3PSI A;  2G5I B;  1X9X A;  4Z6C A;  3C29 A;  4J9Q A;  1SGG A;  3GIL A;  7ICU A;  2DUY A;  4OJ5 A;  4Y2S A;  3TAD A;  2BPC A;  2H3F A;  1NK8 A;  2KJ5 A;  3PY8 A;  2E8O A;  2G07 A;  1ZQY A;  5ALX A;  3IRU A;  1WYG A;  1NK4 A;  4GC7 A;  4XA5 A;  2LPE A;  4KN7 A;  3BQ1 A;  4O3P A;  1L8O A;  2KHV A;  3MR2 A;  4YMO A;  4USA A;  4PHA A;  1ARO P;  4Y2Q A;  4AYB F;  1Z00 B;  4YVZ A;  1SKR A;  4YXM A;  3VC8 A;  2H5X A;  4UAZ A;  3LDA A;  2E8P A;  5KFE A;  3ALR A;  3KHR A;  9ICP A;  2MUT B;  3MBY A;  4DSL A;  2DFL A;  3RJG A;  9ICT A;  5CHG A;  3A0B U;  4FZM A;  2I1Q A;  4QIW F;  5FP0 A;  5KNI A;  3SEN A;  3CW2 C;  2Y1I A;  3V7J A;  1X40 A;  1T4G A;  4ZH4 A;  2R8I A;  4Y2R A;  3UXP A;  4O3O A;  5J0R A;  1TK0 A;  2L5Y A;  4RQ0 A;  4GC6 A;  3FYH A;  3T3F A;  2E1E A;  2YX8 A;  4YFK A;  3C23 A;  3ICX A;  2HOF A;  4TUS A;  1S0O A;  4JUZ A;  4IRD A;  3PVX A;  1ZD2 P;  3R9K A;  3T5L A;  5ALD A;  8ICP A;  5GTI U;  3T5J A;  5KFH A;  2OM6 A;  2QAR A;  1A76 A;  5IIK A;  3GV8 B;  2HMX A;  4EYI B;  5ALV A;  1X6I A;  3K1Z A;  2WB1 F;  5KFN A;  1JXL A;  8ICT A;  1TAM A;  9ICL A;  2CXY A;  2PFN A;  3GV5 B;  4Q8E A;  2IOF A;  3IM1 A;  1CI4 A;  2B0C A;  2PFP A;  2AU0 A;  5KG6 A;  1B22 A;  5F9N A;  4DLG A;  3T79 A;  3I28 A;  5AKG A;  3GV7 B;  3RJE A;  1ZQ1 C;  4F72 A;  2W11 A;  4ED6 A;  2KMD A;  1ED1 A;  2BCS A;  2KV2 A;  2BCV A;  2D3D A;  5DBA A;  4C8N A;  4DL7 A;  4Y2X A;  3D2N A;  2E3T A;  5DB6 A;  4YXJ A;  4IR1 A;  4J9K A;  3M8S A;  1RYR A;  2WB1 C;  4PZO A;  2KZ3 A;  4DSK A;  3AM9 A;  4NLC A;  8ICU A;  7ICI A;  3EPG A;  1JRO A;  5DG9 A;  9ICH A;  4IQU A;  7ICK A;  5DDY A;  1UA0 A;  4DSF A;  4UB8 U;  2W9C A;  1SV0 C;  5KAF U;  2ZTE A;  2JZB B;  1C20 A;  1L5U A;  4O9M A;  7ICH A;  5KL1 B;  2R8K A;  2WTF A;  3M8R A;  4EBE A;  4JMU A;  5KG2 A;  2UVV A;  4UB1 A;  3ZD8 A;  3JPQ A;  5ALS A;  3AQF A;  1UT5 A;  1TKD A;  2G0A A;  4BUG A;  1YZ7 A;  2C2E A;  1SL0 A;  5AKY A;  8ICR A;  5L9X A;  2KNJ A;  3EYZ A;  1Z3E B;  1BGX T;  1ZQU A;  5CB1 A;  4GXK A;  4OJ6 A;  4P4O A;  3KZI U;  4K4G A;  4ECS A;  4CF5 A;  4G9B A;  4M9N A;  5J2G A;  4ED7 A;  2W9M A;  2XY5 A;  3HKZ C;  1ZYQ A;  4RU9 A;  3BQ2 A;  1DGJ A;  2VIX A;  4DL4 A;  4IQV A;  3PV8 A;  4Y2T A;  8ICC A;  4F8R A;  9ICA A;  1NKC A;  1DXS A;  2E8M A;  2QLT A;  8ICN A;  4NJ8 A;  3FM9 A;  7ICF A;  1SV4 A;  4MHV A;  4R66 A;  1ZD5 A;  4RQ3 A;  4ECV A;  2W8K A;  1SKS A;  2EQY A;  1ZD4 A;  3F2B A;  2XID A;  3Q8R B;  5J0T A;  1D8Y A;  3C21 A;  4F5P A;  3RB4 A;  9ICO A;  5KTQ A;  2F1I A;  1ECW A;  2FPK A;  5KFK A;  4F5Q A;  2ZIX B;  4KLM A;  4DO9 A;  4NLN A;  3V72 A;  3H8W A;  2UVW A;  4PH5 A;  4DWI A;  2A1J B;  4KLD A;  1L3T A;  4PHD A;  3SV4 A;  1N48 A;  3HKZ F;  5J0O A;  4NXZ A;  3RTV A;  2E8N A;  4X5V A;  2WF8 A;  1LVH A;  2LBO A;  3IV6 A;  3ZDB A;  4NWI A;  4RNM A;  2HI0 A;  5KG4 A;  1L7N A;  2P35 A;  9ICC A;  2ZUB A;  3ISC A;  4I2E A;  4KLL A;  2NRW A;  4EX7 A;  4F50 A;  2F44 A;  1N5W A;  3C28 A;  2KJ9 A;  2LYB A;  1COK A;  2H3I A;  2KIW A;  4JV1 A;  2A1J A;  1ZQX A;  3N7S C;  5BPC A;  4XQ8 A;  2OWO A;  3ZDC A;  4B9N A;  3K1R B;  3M9O B;  5HHI A;  2BDP A;  1LB2 B;  5KFV A;  2OXO A;  4O3M A;  2FPL A;  3AU6 A;  2UVU A;  1J2N A;  4WJ3 B;  4RZR A;  1U9L A;  2BCU A;  3RRG A;  2HOQ A;  2F8K A;  1TAU A;  1URJ A;  2KP7 A;  3KKA C;  5J0S A;  2NYV A;  4UAY A;  3BQT A;  2F1J A;  4YR0 A;  4O3N A;  4J9S A;  1IIP A;  1HUZ A;  4KLS A;  2RQ5 A;  4J03 A;  9ICN A;  4O3R A;  5KFG A;  1CUK A;  3DDH A;  2ZXI A;  2R8G A;  3ZD9 A;  4TUP A;  3V6K A;  3I76 A;  5AKZ A;  2PI4 A;  4YR2 A;  5DBB A;  3KD3 A;  5JUM A;  2YB4 A;  2OYY A;  3N7P D;  4XUS A;  4O3Q A;  1IM4 A;  3UQ2 A;  2ISP A;  1NZP A;  4ED1 A;  4DSE A;  1COO A;  2OEH A;  2QKQ A;  4RQ7 A;  1KFT A;  3QEA Z;  2K8C B;  4LVS A;  4P2H A;  2KD1 A;  1X9M A;  5ALF A;  9ICE A;  4YR3 A;  1WUD A;  2KFN A;  4RQ1 A;  4LZG A;  4F5N A;  2ISO A;  3V7L A;  3ZDE A;  2KZM A;  1F5S A;  3MR6 A;  1U4B A;  3ZI4 A;  2I6X A;  5J2E A;  2YMP A;  4PL1 A;  5KFX A;  8ICX A;  3H40 A;  4KLT A;  2KVC A;  2FDR A;  3F53 A;  5AM5 A;  4BDP A;  4QWD A;  4MFA A;  1RXV A;  4K4H A;  4RQ2 A;  5KFZ A;  4UBC A;  2MA1 A;  3WK7 A;  8ICZ A;  1PK1 A;  4EX6 A;  1A0P A;  1PZN A;  3OJS A;  4I27 A;  3BZK A;  4KLE A;  5CWR A;  1LKY A;  1NKB A;  3JPN A;  1ZOL A;  4IQT A;  2WAQ C;  1D9D A;  3IP4 B;  3N97 B;  3PX0 A;  3PML A;  1Q46 A;  8ICJ A;  4OJO A;  2DBY A;  1NK5 A;  5B5E U;  4YD2 A;  3T5K A;  1ZQN A;  5AKJ A;  4Z6D A;  5D49 A;  4C4T A;  1SB3 C;  3GII A;  1T7P A;  5ALM A;  4QWC A;  4GFJ A;  3MFH A;  5EE0 A;  3RBE A;  3RJK A;  1SXE A;  5J2H A;  3BS7 A;  2G08 A;  3WK4 A;  3BDP A;  4FBU A;  4JK1 A;  2KEY A;  2ASD A;  1QSY A;  2R8H A;  2KZZ A;  1QLN A;  4PPX A;  2MUT A;  4C7Y A;  1D9F A;  3MGI A;  2WAQ F;  4ECZ A;  9ICK A;  2NRZ A;  4NLG A;  3QU5 A;  3N7R C;  4ICA A;  2JXJ A;  2K4I A;  4RPX A;  1S0N A;  4DFK A;  1WCN A;  1QSS A;  2LHT A;  2ZJA A;  2FLL A;  4O5E A;  2NRT A;  5DGB A;  5DQH A;  3HWT A;  4B9S A;  3KHL A;  5KFM A;  2A19 A;  3G6V A;  1LKY B;  5AKI A;  4NLZ A;  5J2I A;  2J6S A;  2AH5 A;  4FBT A;  1JN3 A;  4IQW A;  2B21 A;  3PZP A;  5J0X A;  1ZQR A;  4NM1 A;  4JWM A;  3RJJ A;  4F4X A;  4DQQ A;  3I1Y A;  4G3I A;  3CRX A;  4BXO A;  4DEZ A;  3WK6 A;  4QZI A;  1RQL A;  5AI5 A;  2KN7 A;  3SD7 A;  4O0I A;  4MF8 A;  4F93 B;  3TAQ A;  4TUQ A;  3IHQ B;  4ZOH C;  4F2R A;  2KG5 A;  4ECR A;  2QB1 A;  4DOA A;  1ZQC A;  3UXO A;  3SV3 A;  2RP5 A;  1L6N A;  2LM4 A;  5T14 A;  4LJX A;  4UAV A;  3TKA A;  3RH6 A;  4AYB C;  2ZIU A;  4QZC A;  5J29 A;  3QE9 Y;  4M6W A;  3H0M B;  4FFD A;  2Y0S F;  2UVR A;  2IBK A;  2KE7 A;  3WU2 U;  1V38 A;  5D46 A;  4IS7 A;  4TQR A;  2YN4 A;  1JRP A;  4M04 A;  2C28 A;  2I9G A;  3NAS A;  4UB4 A;  5TIS U;  3H4D A;  1ZXI A;  1KQQ A;  4QZH A;  1X9S A;  1LV5 A;  2RRD A;  1V85 A;  8ICF A;  2EAP A;  1KDH A;  5DGA A;  1RXW A;  4YMN A;  4OO1 J;  3BQ7 A;  2HSZ A;  3L4P A;  2HW3 A;  7ICJ A;  3KZX A;  1P7D A;  1X42 A;  5AI8 A;  3PO5 A;  1JUD A;  3AL0 B;  2AGP A;  1QQ7 A;  1ZQZ A;  5HML A;  1U48 A;  2ZTC A;  1S0M A;  3F2C A;  5AK4 A;  2KK0 A;  4KMO B;  5KFI A;  4B9M A;  4F4W A;  1XSP A;  3V6H A;  1NOM A;  1N2X A;  4JV0 A;  3Q8S B;  1ZQL A;  4KLH A;  5AI0 A;  2BCR A;  4R64 A;  4Q44 A;  4DQR A;  5CEH A;  2XC9 A;  5KFT A;  5DQG A;  5DB7 A;  2MU2 A;  1H38 A;  4LZD A;  4EBC A;  3TAR A;  1ZQD A;  3RR8 A;  3FDS A;  4F5R A;  1Z1B A;  1QCK A;  4DFM A;  1RPL A;  3RAQ A;  2JEG A;  3QX7 A;  1HIW A;  1DK3 A;  2G5H B;  3AU2 A;  1NJY A;  4MFC A;  4PGQ A;  3C2M A;  3SAH A;  1N56 A;  9ICG A;  1WCL A;  7ICP A;  4ELV A;  3GFK B;  5DB8 A;  2HHU A;  1ZQQ A;  4M6W B;  1WWV A;  2DKZ A;  2EZX A;  1Y88 A;  3IG5 A;  3O0F A;  4EYH B;  3QU9 A;  4I2J A;  1BNO A;  1QQ5 A;  1S0V A;  4Y2P A;  4F71 A;  1CEZ A;  5KG1 A;  2LYH A;  2BHN A;  4BWM A;  4I2C A;  2ES6 A;  4P0P A;  3KTQ A;  4NY8 A;  5HMM A;  2R8J A;  3B9J A;  4B9L A;  2C22 A;  1UCV A;  1ZQB A;  4OCZ A;  4DOB A;  1BPB A;  4UAT A;  4BX9 C;  1ZQH A;  2Q4T A;  2DF4 B;  5DG7 A;  5JU5 A;  1MSW D;  1ZRM A;  2BPG A;  8ICE A;  2HBM A;  2XO7 A;  4E0D A;  1Z1V A;  3PW2 A;  1Z4N A;  2ESE A;  1SKW A;  4C8L A;  1KSP A;  2N1R A;  2QB0 A;  5KG0 A;  3AN1 A;  5KFR A;  3N4M B;  1PVP A;  4ECQ A;  2R18 A;  3H8M A;  3UM9 A;  4OJP A;  5AI4 A;  2BQ3 A;  3OJU A;  3CNH A;  4P0P B;  2F2A B;  2K8B B;  1D8B A;  3S6J A;  2Y9T A;  3TAD C;  4DQS A;  3GU3 A;  3L5K A;  2ZJ8 A;  4M2Y A;  1RQN A;  7ICQ A;  2YY6 A;  4KLF A;  9ICM A;  3OTQ A;  3PX6 A;  3UMG A;  4ED3 A;  3MGH A;  1DK2 A;  3MDA A;  5GTH U;  2PMZ C;  5BOM A;  3K4G A;  5AM4 A;  1FO4 A;  9ICV A;  2FMS A;  4C8K A;  3UQ0 A;  4NV0 A;  5III A;  3SAF A;  1OXJ A;  8ICS A;  5ALT A;  2W3R A;  4I2D A;  3KOO A;  4IRC A;  1S5L U;  2BR0 A;  5F9L A;  1Z19 A;  3KHG A;  3AUO A;  3QZ7 A;  1L7M A;  5J2C A;  5KL8 B;  2RHF A;  7ICR A;  5KAI U;  2NO4 A;  1HEK A;  3E58 A;  3SEI A;  2MRL A;  2HVH A;  1WG8 A;  5L1J A;  1M6Y A;  4M9J A;  1B0X A;  2ODG A;  3B0Y A;  2HHQ A;  4F2S A;  4DF4 A;  3ED5 A;  1XSL A;  3PO4 A;  3HIL A;  5KG7 A;  3QU4 A;  2JMG A;  3LWM A;  5AIB A;  2WF5 A;  5AM2 A;  3TAN A;  1T8E A;  3B0X A;  4Y2J A;  3H0L B;  2G06 A;  4QWB A;  3H7I A;  4QZF A;  1FFV A;  2KSO A;  4IR9 A;  4DFP A;  9ICQ A;  2HHT A;  4U7C A;  4EZ6 A;  3C2K A;  2RDJ A;  2LMR A;  4GXI A;  1MC8 A;  3MFI A;  2BQR A;  2WF9 A;  3JPP A;  1KTQ A;  4F4K A;  2IOH A;  8ICM A;  1BPZ A;  4O5K A;  4Y2U A;  2HHS A;  4F3O A;  2XGQ A;  4YCX A;  5KFD A;  5ALU A;  5F3X B;  5KFL A;  2MSN A; 
#chains in the Genus database with same CATH homology
 3C1Y A;  4Z6D A;  1KFD A;  5D49 A;  4I2I A;  3MR2 A;  4YMO A;  3GII A;  2BPF A;  1T7P A;  4PHA A;  4RNN A;  4QWC A;  4CCH A;  1ARO P;  1ZQK A;  5KFB A;  3MFH A;  5HP4 A;  5KT3 A;  1Z00 B;  4YVZ A;  3KHH A;  3THV A;  3RBE A;  3RJK A;  2J6T A;  1SKR A;  1MQ3 A;  4YXM A;  1U47 A;  5J2H A;  4Q45 A;  2H5X A;  4UAZ A;  2XY6 A;  3LDA A;  5KFE A;  4J9L A;  5DB9 A;  3KHR A;  2Y1J A;  2MUT B;  9ICP A;  3C1Z A;  2GWS A;  3MBY A;  3BDP A;  4FBU A;  4DSL A;  1SL2 A;  5CP2 A;  4DQP A;  2DFL A;  2VA8 A;  3BQ0 A;  5CHG A;  4XRH A;  1SL1 A;  3RJG A;  3OHA A;  4JK1 A;  9ICT A;  2I1Q A;  4C8O A;  3RRH A;  2ASD A;  1QSY A;  2W8L A;  2R8H A;  2Y1I A;  3HPO A;  1BPY A;  2PFO A;  2ZUC A;  3V7J A;  2HHX A;  2KZZ A;  1QLN A;  4UB5 A;  1K1Q A;  3V7K A;  1T4G A;  4ZH4 A;  5J2K A;  2R8I A;  3UXP A;  4PPX A;  4MF2 A;  4O3O A;  3ETL A;  4F91 B;  5J0R A;  1TK0 A;  4RNO A;  4RQ0 A;  2MUT A;  4TUR A;  3TFR A;  1ZQA A;  1D9F A;  4P4M A;  3MGI A;  3ZDA A;  4QZA A;  4GC6 A;  3FYH A;  5KFC A;  4ECZ A;  3T3F A;  3C5G A;  2PI5 A;  4YFK A;  9ICK A;  7ICV A;  4UB3 A;  2NRZ A;  3C23 A;  4NLG A;  4PHE A;  4TUS A;  2FMQ A;  4KLQ A;  4KMU A;  1S0O A;  4RPX A;  4JUZ A;  4RT2 A;  3HT3 A;  4IRD A;  8ICI A;  3PVX A;  3T5L A;  1S0N A;  4JWN A;  4Z6F A;  4C8M A;  3TFS A;  4DFK A;  5J2B A;  1WCN A;  1KRP A;  1QSS A;  4PGY A;  8ICP A;  1ZJN A;  2ZJA A;  4QW9 A;  4ED8 A;  2NRT A;  5KFH A;  5DGB A;  4QZB A;  3T5J A;  1NJX A;  2FLL A;  2AQ0 A;  2XCA A;  7ICL A;  5DQH A;  3HX0 A;  3HWT A;  5TZV A;  4KLI A;  5IIO A;  4B9S A;  1HJP A;  4ED0 A;  3KHL A;  7ICG A;  1A76 A;  5KFM A;  3Q8M A;  3G6V A;  4KLJ A;  1JXE A;  5IIK A;  3GV8 B;  4EYI B;  1KEJ A;  4NLZ A;  3Q8L A;  3RB3 A;  1XWL A;  5C5J A;  5KFN A;  5J2I A;  1JXL A;  4BXO B;  8ICT A;  5J0P A;  4UB2 A;  2J6S A;  4RQ5 A;  4FBT A;  2ALZ A;  9ICL A;  1JN3 A;  2FLN A;  2PFN A;  2B21 A;  4IQW A;  4FO6 A;  3GV5 B;  4M47 A;  4Q8E A;  3RB0 A;  5J0X A;  1ZQR A;  4NLK A;  3IM1 A;  2PFP A;  4NM1 A;  2AU0 A;  5KG6 A;  4JWM A;  1B22 A;  5F9N A;  4DLG A;  3RJJ A;  4F4X A;  3GV7 B;  4DQQ A;  3RJE A;  4G3I A;  4DF8 A;  3TQ1 A;  2IMW P;  5IIN A;  4I2B A;  4R8U A;  4BXO A;  4DEZ A;  4QZI A;  2W9B A;  9ICW A;  4ED6 A;  1UA1 A;  2KN7 A;  1RYS A;  5KG3 A;  2ATL A;  4QZG A;  4O0I A;  4MF8 A;  2C2R A;  1ZJM A;  2BCS A;  2JEJ A;  1TV9 A;  4F93 B;  4O3S A;  3TAQ A;  3MAB A;  4J9M A;  4TUQ A;  8ICV A;  2BCV A;  3IHQ B;  4BGD A;  5DBA A;  7ICN A;  4EZ9 A;  4C8N A;  4F2R A;  2KFZ A;  2C2D A;  2W9A A;  3SI8 A;  5DDM A;  4DL7 A;  1ZQW A;  1SZP A;  4ECR A;  5EWE A;  4DOA A;  2VAN A;  4Q43 A;  5DB6 A;  1T3N A;  4YXJ A;  1ZQC A;  3UXO A;  4UAW A;  4IR1 A;  4YMM A;  4RT3 A;  3SV3 A;  9ICF A;  4ECT A;  9ICJ A;  4K4I A;  2V4Q A;  1HUO A;  4J9K A;  3M8S A;  1RYR A;  8ICG A;  1XU4 A;  8ICO A;  2KZ3 A;  3RH6 A;  4DSK A;  4KTQ A;  5DQI A;  4RQ4 A;  4QZC A;  5J29 A;  3QE9 Y;  3RH5 A;  7ICI A;  5KFY A;  4J9R A;  4M6W A;  8ICU A;  4B9T A;  2UVR A;  1K1S A;  5DG9 A;  3EPG A;  2IBK A;  1V9P A;  4IQU A;  4ELT A;  5L1I A;  5DDY A;  3GQC A;  4QZD A;  4DSF A;  1UA0 A;  1QTM A;  4ECW A;  2HVI A;  5D46 A;  4TQR A;  2W9C A;  4M04 A;  2C28 A;  4IRK A;  4PHP A;  4GXJ A;  2ZTE A;  4DLE A;  2JZB B;  1KLN A;  2I9G A;  1L5U A;  3NTU A;  4O9M A;  4F92 B;  7ICH A;  5CR0 A;  4UB4 A;  1ZQO A;  3OHB A;  3H4D A;  2R8K A;  4QZH A;  3Q8Q B;  1X9S A;  1LV5 A;  2WTF A;  3Q8K A;  7ICS A;  3M8R A;  8ICF A;  4EBE A;  1KDH A;  5KG2 A;  1TK8 A;  2PXI A;  5DGA A;  1RXW A;  4YMN A;  3K75 D;  4EBD A;  4DS4 A;  2UVV A;  3M9N B;  4UB1 A;  5KFA A;  3PW5 A;  4YG2 A;  3ZD8 A;  3JPQ A;  1L3S A;  2HW3 A;  7ICJ A;  1UT5 A;  1TVA A;  3RJF A;  1TKD A;  3PO5 A;  2C2E A;  3GIM A;  2AGP A;  1SL0 A;  1ZQZ A;  5HML A;  8ICR A;  4I2G A;  2VA2 A;  5L9X A;  3EYZ A;  1Z3E B;  2ZJ5 A;  5J2A A;  7ICE A;  1U49 A;  1U48 A;  1BGX T;  5BOL A;  1IXR A;  1ZQU A;  2ZTC A;  3OSN A;  2XGP A;  1S0M A;  5CB1 A;  1ZQG A;  3GIJ A;  4GXK A;  4P4O A;  4NM2 A;  4I2F A;  5KFI A;  4B9M A;  4F4W A;  3HW8 A;  1XSP A;  8ICB A;  4K4G A;  3RAX A;  4F4Z A;  4ECS A;  1NOM A;  1BVS A;  3V6H A;  4DS5 A;  4I29 A;  2DPJ A;  9ICH A;  4JV0 A;  3Q8S B;  5J2D A;  1ZQL A;  4ELU A;  4KLH A;  1X9W A;  3RBD A;  2BCQ A;  4M9N A;  5KFO A;  5J2G A;  2BCR A;  4R64 A;  2W9M A;  4Q44 A;  4ED7 A;  3Q8P B;  2XC9 A;  4DQR A;  4RU9 A;  2XY5 A;  1ZYQ A;  7ICK A;  3BQ2 A;  5KFT A;  5DQG A;  4DL4 A;  4IQV A;  2JEF A;  5DB7 A;  5KFW A;  3PV8 A;  1S10 A;  4I2A A;  1H38 A;  4LZD A;  4EBC A;  4RPY A;  8ICC A;  1ZQT A;  3BJY A;  4F8R A;  4ECX A;  3TAR A;  9ICA A;  1NKC A;  1ZQD A;  3RR8 A;  7ICM A;  3FDS A;  4F5R A;  4DFJ A;  5EOZ A;  8ICN A;  1ZQV A;  5KFJ A;  4UQG A;  5DLG A;  4PGX A;  3EW9 A;  4DFM A;  7ICF A;  1RPL A;  3TI0 A;  3RAQ A;  2JEG A;  3LK9 A;  5KFF A;  3AU2 A;  4HYK A;  1NJY A;  4MFC A;  4M9G A;  1S9F A;  4R66 A;  4RQ3 A;  4KN4 A;  4ECV A;  3H4B A;  4DL3 A;  4PGQ A;  2W8K A;  3C2M A;  1SKS A;  1N56 A;  9ICG A;  1NK6 A;  4YQW A;  1WCL A;  4QWA A;  2HHV A;  7ICP A;  4ELV A;  3EZ5 A;  1BPE A;  3Q8R B;  5J0T A;  1D8Y A;  3C21 A;  3GFK B;  5DB8 A;  3JPR A;  4F5P A;  3RB4 A;  3MR5 A;  9ICO A;  5KTQ A;  2IHM A;  2F1I A;  2DPI A;  2RDI A;  2FMP A;  2HHU A;  4J9O A;  1ZQQ A;  2M9N A;  3M9M B;  2FPK A;  1XO1 A;  4M6W B;  9ICS A;  5DBC A;  3HP6 A;  1RZT A;  5KFK A;  4F5Q A;  4KLM A;  4MEY A;  4DO9 A;  4NLN A;  3V72 A;  3H8W A;  2UVW A;  1Y88 A;  9ICI A;  4PH5 A;  4DWI A;  5IIJ A;  1NKE A;  2A1J B;  4EYH B;  4KLD A;  4YN4 A;  1L3T A;  4PHD A;  4I2H A;  4I2J A;  3SV4 A;  1N48 A;  1S0V A;  5KFS A;  4MEX A;  1QSL A;  5J0O A;  1CEZ A;  3SYZ A;  4NXZ A;  3H8J A;  5KG1 A;  4FS1 A;  3RTV A;  2LYH A;  1NJZ A;  4X5V A;  2BHN A;  1ZQI A;  3RH4 A;  4J9N A;  1Z00 A;  4BWM A;  4QWE A;  4I2C A;  2BKE A;  1D8L A;  3UPQ A;  3GIK A;  1S76 D;  4YP3 A;  1TFR A;  4R65 A;  1ZQJ A;  2PFQ A;  1C7Y A;  2V4R A;  5HMM A;  5DG8 A;  3KTQ A;  3ZDB A;  4RNM A;  2R8J A;  4NY8 A;  4RQ8 A;  4B9L A;  2NRX A;  5KG4 A;  5HNK A;  8ICH A;  2C22 A;  1ZQB A;  4DOB A;  5EWG A;  5J2F A;  9ICC A;  1BPB A;  2ZUB A;  3ISC A;  1BPX A;  1ZET A;  1BPD A;  1TK5 A;  1ZQH A;  4I2E A;  4KLL A;  2NRW A;  5CJ7 A;  1U45 A;  4O5E A;  1JX4 A;  5DG7 A;  4B9U A;  4FS2 A;  1MSW D;  4F50 A;  4BWJ A;  3G6Y A;  2BPG A;  3PR5 B;  8ICE A;  2XO7 A;  4E0D A;  4KLO A;  9ICX A;  1TAQ A;  3PW2 A;  4Q8F A;  1NK0 A;  3PMN A;  1SKW A;  4JV1 A;  2A1J A;  5DLF A;  4C8L A;  1ZQX A;  2NRV A;  3MDC A;  3LWL A;  3GDX A;  1KSP A;  5KG0 A;  5BPC A;  4XQ8 A;  2OWO A;  5KFR A;  4F5O A;  3ZDC A;  1B43 A;  3N4M B;  3NGD A;  4DL6 A;  4B9N A;  4I28 A;  4JV2 A;  5KFU A;  4ECQ A;  3M9O B;  7ICO A;  1XSN A;  5HHI A;  2BDP A;  1LB2 B;  2BQ3 A;  5KFV A;  3OJU A;  2FPL A;  3AU6 A;  3OGU A;  2UVU A;  8ICK A;  1ZQP A;  8ICY A;  2ZTD A;  1UT8 A;  5J0Q A;  4M9L A;  3QZ8 A;  4DL5 A;  1NJW A;  3C5F A;  1JIH A;  4DQS A;  3OSP A;  5KT2 A;  2ZJ8 A;  4M2Y A;  4RZR A;  1U9L A;  2FPM A;  2BCU A;  2J6U A;  3RRG A;  4M0A A;  3T5H A;  2P66 A;  7ICQ A;  4KLF A;  4R63 A;  5KFQ A;  1XS9 D;  1TAU A;  3ORY A;  4YD1 A;  4RPZ A;  3G6X A;  9ICM A;  3UXN A;  3PX6 A;  5KG5 A;  5J0S A;  4ED3 A;  3MGH A;  4ED2 A;  2BGW A;  5HHH A;  5IIM A;  4UAY A;  4DQI A;  3BQT A;  3MDA A;  2IA6 A;  2F1J A;  2ASJ A;  4YR0 A;  4O3N A;  2Q0Z X;  3C2L A;  5KFP A;  4J9S A;  2V9W A;  3RJH A;  1HUZ A;  2JEI A;  1KFS A;  1X2I A;  4R8U B;  3SZ2 A;  4KLS A;  1DOQ A;  5BOM A;  5KT4 A;  2MAX A;  3K4G A;  8ICL A;  5DKW A;  4RUC A;  9ICU A;  3E2E A;  4MFF A;  9ICV A;  4Z6E A;  3RJI A;  2XY7 A;  2AGO A;  3MR3 A;  3RR7 A;  3ISD A;  4F4Y A;  5J0Y A;  2FMS A;  5J0W A;  3UQ0 A;  5III A;  4C8K A;  9ICN A;  5EWF A;  4UBB A;  4O3R A;  7ICT A;  1NK9 A;  5KFG A;  1ZQS A;  3ZDD A;  1CUK A;  8ICS A;  2XCP A;  4ECY A;  4QZ8 A;  4EEY A;  5L1L A;  8ICW A;  4I2D A;  2AQ4 A;  3JPO A;  4J9P A;  4RQ6 A;  2R8G A;  3ZD9 A;  4TUP A;  3V6K A;  1S77 D;  4IRC A;  2PI4 A;  4YR2 A;  5D4B A;  5DBB A;  5JUM A;  5F9L A;  2BR0 A;  3H8S A;  3KHG A;  3PW0 A;  2P6U A;  3AUO A;  8ICA A;  4XUS A;  4O3Q A;  1IM4 A;  3UQ2 A;  4QZE A;  2IHN A;  2ISP A;  4ED1 A;  1L3U A;  3JPS A;  3QZ7 A;  2VA3 A;  2BQU A;  4DSE A;  2F1H A;  3QEB Z;  5J2C A;  4DSI A;  1COO A;  7ICR A;  1EXN A;  2ASL A;  4RQ7 A;  4RUA A;  1KFT A;  3QEA Z;  4QZ9 A;  4LVS A;  5J2J A;  5L1K A;  3EPI A;  9ICR A;  1A77 A;  4GLX A;  2HVH A;  2AJQ A;  1ZQM A;  5IIL A;  5L1J A;  4M9J A;  4P2H A;  1X9M A;  2KTQ A;  2ZUD A;  9ICE A;  3B0Y A;  1NK7 A;  3EWA A;  5CA7 A;  4YR3 A;  2HHQ A;  9ICB A;  1ZQE A;  4F2S A;  2KFN A;  4KIT B;  4DF4 A;  1XSL A;  4RQ1 A;  1MQ2 A;  3PR4 A;  2JZB A;  3PO4 A;  5KG7 A;  3ISB A;  4B9V A;  4F5N A;  4LZG A;  2ISO A;  4KLU A;  3V6J A;  4QW8 A;  5J0U A;  3V7L A;  3LWM A;  3ZDE A;  2HHW A;  2KZM A;  3TAN A;  5KT6 A;  1T8E A;  3MR6 A;  1U4B A;  3B0X A;  5J2E A;  1S97 A;  4DSJ A;  3PX4 A;  4QWB A;  3JPT A;  5KFX A;  1L3V A;  8ICX A;  3H7I A;  4QZF A;  3PNC A;  3H40 A;  4KLT A;  3RB6 A;  4BDP A;  3TAP A;  4TQS A;  4QWD A;  4DFP A;  4MFA A;  4IR9 A;  1RXV A;  2FLP A;  9ICQ A;  4Z6C A;  4K4H A;  2HHT A;  4KLG A;  1ZQF A;  4RQ2 A;  5KFZ A;  4UBC A;  4EZ6 A;  8ICZ A;  4J9Q A;  3C2K A;  2RDJ A;  3GIL A;  4DOC A;  3PW7 A;  1PZN A;  3OJS A;  7ICU A;  4GXI A;  1MC8 A;  4O5C A;  3MFI A;  2P6R A;  8ICQ A;  2BQR A;  4I27 A;  3JPP A;  1KTQ A;  4F4K A;  1JMS A;  2BPC A;  5KT5 A;  1XC9 A;  4KLE A;  8ICM A;  2AGQ A;  2W9C B;  4DL2 A;  1NK8 A;  1DGS A;  5CWR A;  1NKB A;  1BPZ A;  3JPN A;  4P4P A;  3PY8 A;  4O5K A;  5KT7 A;  2HHS A;  4F3O A;  4IQT A;  2W9B B;  1D9D A;  2XGQ A;  1ZQY A;  3N97 B;  4YCX A;  5KFD A;  3PML A;  3PX0 A;  4ECU A;  4M9H A;  8ICJ A;  1NK4 A;  4GC7 A;  4XA5 A;  5KFL A;  1NK5 A;  4KN7 A;  3PW4 A;  3BQ1 A;  4YD2 A;  3T5K A;  1ZQN A;  4O3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...