2M9NA

Solution structure of (hhh)2 domain of human faap24
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2m9nA00
3AU2A 3PX6A 4M6WB 1TK5A 4F2SA 1KDHA 4Z6EA 4F4WA 4KLEA 2AGOA 2Y1JA 5KFCA 4QWCA 3SV4A 4FO6A 3ZDBA 4EZ9A 2BDPA 4IRKA 2VANA 4DL7A 4R8UB 5IIIA 1UT5A 1RZTA 2DPIA 2UVUA 3M9OB 1NK7A 4BXOB 4QW9A 5HP4A 3Q8KA 4C8KA 4O5CA 5KFZA 9ICNA 4LVSA 3JPSA 1LB2B 4B9SA 1XSLA 4PHEA 9ICTA 2ZUCA 5DB8A 2BQRA 5J0OA 4MFCA 2HHTA 1SKWA 4O3PA 4DQRA 4ECZA 3GILA 3BQ2A 4ECVA 5L1IA 4KLTA 2AGPA 1ZQNA 4YD1A 4ECXA 3K75D 1ZQQA 4DOBA 3H4BA 3JPRA 4B9MA 4KN7A 4RU9A 4YR2A 4ED6A 1S0NA 4YD2A 1BPXA 4DLEA 3EW9A 3PV8A 2C2RA 5DDYA 3GV5B 2ALZA 4NLKA 2W9AA 4I2JA 4DS5A 3SYZA 5IIKA 4F4XA 5DGAA 5J0UA 3ETLA 5JUMA 1S10A 4FBTA 2AGQA 3ISBA 4TQSA 2ASLA 3MR2A 4DFMA 3EZ5A 5IIJA 1Z00A 1NK6A 1H38A 4ELUA 3GIIA 5DG7A 1Y88A 5KFJA 2W9BA 4NM1A 2WTFA 3RH4A 5KG0A 2BQ3A 2JEGA 3RRHA 5KG2A 5J2DA 2R8IA 4G3IA 2B21A 4DFKA 4O5KA 3MDAA 9ICPA 1MC8A 5KFRA 1RXVA 4UBCA 2NRXA 3ORYA 4KLHA 1ZQDA 1SZPA 4KLSA 4RQ1A 1ZQTA 9ICCA 3G6YA 2BR0A 4YR0A 3PNCA 5KFTA 4I2CA 1TV9A 1JX4A 4F5NA 4KLGA 4YVZA 8ICLA 3ZD8A 3JPPA 5KFYA 3THVA 5KT5A 4I2AA 2XGQA 4O3QA 3PR4A 5D4BA 1HUOA 4J9OA 1ZQVA 5D46A 4JWMA 3PW2A 2W9BB 1ZQRA 1XC9A 4KLOA 4KLJA 4DL2A 3H8JA 7ICJA 2W9MA 5J0RA 3Q8MA 1N56A 3RH5A 4QZAA 2UVRA 4B9LA 4YMOA 3V72A 3MBYA 2HHUA 1NK8A 5KFFA 3JPTA 4I28A 2XC9A 3G6XA 1K1QA 2I1QA 1C7YA 2ZTEA 2Y1IA 2W9CB 9ICEA 4JK1A 1KRPA 1JIHA 4XUSA 4DWIA 3OGUA 3QZ8A 2BQUA 3TAQA 4RQ5A 4EBCA 4E0DA 9ICIA 1ZQKA 3RJEA 5KFBA 2HHSA 4F93B 4YN4A 2IMWP 4DQPA 1QSYA 4O5EA 5CJ7A 3AUOA 4F92B 4DL5A 5HMLA 8ICHA 4IQVA 1NK9A 2IA6A 4ECUA 4Z6CA 2PXIA 4YP3A 1EXNA 1NJYA 3RJIA 5J2KA 3K4GA 5DB6A 2ZUBA 5KG3A 3C2LA 2XY6A 2C28A 4IR1A 9ICWA 5HNKA 3Q8LA 1S0VA 2R8JA 4IRDA 4QWAA 4DSIA 4O3OA 3V6HA 1TAUA 4ECYA 2FPLA 3NGDA 7ICIA 4RUCA 5KFNA 4F91B 4M0AA 1S9FA 3C21A 2PFQA 1X2IA 1D9DA 4ECTA 3KTQA 3IHQB 4BGDA 4ED0A 1NKEA 3PR5B 2VA3A 1ZQXA 5CA7A 4DQQA 3TI0A 8ICBA 4F4KA 1ZQIA 4LZGA 7ICUA 1D8LA 1SKRA 1ZQHA 4RPXA 4PGQA 4R63A 4MEYA 1XSPA 3GFKB 5DBCA 5DQGA 5KT7A 3TARA 4DSJA 3RJKA 8ICPA 9ICHA 3UQ2A 4O3NA 3PW7A 3JPOA 1RYRA 3UPQA 4NM2A 1CUKA 4PHDA 1QSSA 1AROP 3V6JA 3FYHA 8ICIA 3QEAZ 4Z6FA 4F5QA 2FLLA 4XA5A 9ICRA 2BPFA 3M9NB 4QZHA 3PVXA 3MGIA 4FS1A 4X5VA 1ZQLA 8ICVA 4F4ZA 4I2EA 1ZQFA 4C8OA 3V7LA 4ECQA 4Z6DA 4DSLA 1MQ2A 4KLIA 8ICKA 2FLPA 1KFDA 4RNNA 3GIJA 3ZDDA 4DQIA 8ICSA 9ICLA 4PHAA 5DB9A 2C2EA 5J0WA 4NLZA 4J9KA 4F8RA 1Z3EB 1L3SA 3T3FA 4F5RA 5J0SA 4R64A 4ED2A 3N97B 2J6UA 3MGHA 4UAZA 2MAXA 1V9PA 2ZJ8A 4P4OA 5HHIA 5L1LA 4I2GA 4LZDA 2BCUA 4TURA 1ZQAA 5HHHA 2BPCA 4ZH4A 5IIOA 1U47A 4KLFA 2FPMA 3MFIA 1ZQPA 2BPGA 2JEJA 4KLMA 5CP2A 2NRWA 4M9GA 5KG1A 3Q8QB 4KLDA 4KMUA 4ELVA 3T5JA 4M9NA 4XRHA 2ATLA 1QTMA 3C1ZA 4I2HA 7ICPA 3BQ1A 4DFJA 1T8EA 3NTUA 2F1HA 3BQTA 3MR6A 3PW0A 5DBBA 2FPKA 2HHWA 9ICKA 1LV5A 4MF8A 5EWFA 2MUTA 4EBEA 3RJGA 4O9MA 4ECWA 4DSFA 2ASJA 4YFKA 3JPQA 4EBDA 4RT3A 1ZQEA 4DL4A 5D49A 3TAPA 1XWLA 3V7KA 2XO7A 1SL0A 3UQ0A 3C1YA 4I2FA 3KHLA 4J9PA 4J9NA 7ICHA 7ICFA 4HYKA 1BPBA 3KHGA 1SL2A 4I29A 4RT2A 2FMSA 3N4MB 1L3TA 1JXLA 4J9SA 4DS4A 2BKEA 1QSLA 8ICQA 4QWEA 4DF8A 2FMPA 5DLFA 4DEZA 5J0XA 5KFVA 3T5HA 1KSPA 2PFNA 5J2HA 5KFPA 3HW8A 2PI4A 3H7IA 9ICSA 5KG5A 3HWTA 4YR3A 4K4HA 3HT3A 1MSWD 4EYIB 4R66A 1RYSA 5J2CA 1TAQA 2XCAA 4FS2A 4PHPA 4QZCA 5DQHA 1Z00B 4PH5A 3T5KA 3OJUA 4QZIA 1BPEA 5KFGA 1NK5A 2V4RA 1L5UA 4UB2A 4DSKA 1KFSA 4PGYA 4ED7A 1PZNA 3OSPA 1RPLA 3RRGA 4IQWA 2IHMA 8ICXA 5CR0A 4DOCA 2RDJA 5KFXA 1X9SA 2R8HA 3C5FA 2AJQA 3RBEA 4C8LA 5J0TA 4ED8A 1DOQA 5KT6A 2F1JA 4JV1A 2RDIA 5KFEA 5KG7A 1IM4A 1T4GA 1L3VA 9ICOA 2A1JA 4NXZA 4YXJA 2J6SA 1RXWA 3GIMA 4TUPA 4JV0A 3LDAA 4KLQA 4Q8FA 4YCXA 3QE9Y 5EWEA 1ZQZA 1S76D 5EOZA 3MFHA 4K4IA 3LWLA 1N48A 4RQ2A 4XQ8A 2XCPA 5L1JA 4Q45A 4Q43A 1U4BA 3Q8RB 2F1IA 5J2IA 5IIMA 2KTQA 4MF2A 4RNOA 4UAYA 1X9WA 4PPXA 4GXIA 2PFOA 7ICVA 3GV8B 4DO9A 1BPZA 2J6TA 1K1SA 3KHRA 4B9UA 7ICQA 4DQSA 8ICTA 1B43A 2XY7A 4NLGA 4M2YA 2BCQA 5KFUA 4UB1A 4QWBA 8ICMA 1NJWA 5KFQA 1ZETA 4GC7A 5KFHA 2ZJAA 5TZVA 4M47A 4DL3A 4ED3A 1NKBA 4J9MA 1D9FA 5BPCA 1SKSA 2UVWA 2ASDA 2HVIA 1NKCA 5KFSA 1NJZA 2HW3A 4YG2A 3UXOA 5J2BA 5KFIA 4MEXA 5DG9A 1NOMA 1ZJNA 2NRZA 2ZTDA 4I27A 3EPIA 3TQ1A 3M9MB 3RB0A 1NJXA 5BOMA 1ZJMA 1ZQMA 4M6WA 5KFKA 3RBDA 3PO5A 4I2BA 2M9NA 4J9RA 2KZMA 2R8GA 1ZQYA 1XS9D 2IHNA 3T5LA 3PX0A 3MR5A 3C2MA 2H5XA 5J0PA 4QWDA 4PGXA 7ICMA 3M8RA 4F5PA 2XY5A 3HP6A 4QZ9A 5KTQA 3PW5A 2DPJA 5DDMA 1KTQA 2PFPA 3TFSA 3UXNA 2AQ0A 4TQRA 1U9LA 1U48A 1XU4A 4M9JA 5DGBA 4I2IA 4FBUA 4DOAA 2FMQA 1TK8A 2ISPA 2VA2A 2C22A 4M9HA 2IBKA 5IINA 4MFFA 3PMLA 1KLNA 3FDSA 1COOA 4F5OA 3RH6A 3ZD9A 4ELTA 4QZBA 4DFPA 3ZDEA 5J0YA 4KLUA 7ICRA 4K4GA 3ISDA 9ICVA 8ICUA 4EZ6A 2KZ3A 4BWJA 1JN3A 4RNMA 1XO1A 4DL6A 2P6UA 4F3OA 2DFLA 5DB7A 5J29A 4ECSA 8ICYA 1ZQOA 8ICWA 1KFTA 1ZQBA 4C8NA 3PY8A 4IQTA 3E2EA 3V6KA 9ICGA 5KG4A 2FLNA 5F9LA 3V7JA 5DLGA 1NK4A 3MDCA 2ISOA 4NY8A 5KFLA 1S0OA 9ICJA 4M9LA 2R8KA 2LYHA 3LWMA 1IXRA 2UVVA 5KFOA 1L3UA 5CHGA 3UXPA 2KN7A 4J9LA 1QLNA 3IM1A 4UB5A 2W8KA 4DLGA 3C5GA 9ICBA 4CCHA 3PO4A 4TUSA 4R65A 4ED1A 3RTVA 4JV2A 7ICLA 4RQ7A 3JPNA 1U49A 4YQWA 3RJFA 5KT4A 5L1KA 4ECRA 3EYZA 1BPDA 1ZQJA 9ICMA 3B0YA 3HX0A 2V4QA 4JWNA 4RPZA 1MQ3A 2MUTB 4GXJA 1BPYA 2AQ4A 2NRVA 1TFRA 5HMMA 1CEZA 4P2HA 4IRCA 1JXEA 2V9WA 3ISCA 5J2GA 3RAXA 2I9GA 5DQIA 1ZQSA 4RQ3A 1S0MA 2HVHA 5KT3A 3EWAA 2ZUDA 4C8MA 4O0IA 4P4PA 3PMNA 3H8WA 4QW8A 1JMSA 1ZQUA 4RQ0A 2GWSA 2W9CA 4JUZA 4QZ8A 1TVAA 4UQGA 7ICNA 1ZQWA 4YMMA 2HHVA 1ZQGA 1ZQCA 1X9MA 1S77D 2BHNA 3Q8PB 3C2KA 4RZRA 3ZDAA 4B9NA 9ICXA 8ICRA 3QEBZ 4GLXA 3H40A 1XSNA 4O3RA 3GQCA 3BDPA 2P6RA 2KFNA 5DBAA 4YXMA 3BJYA 5BOLA 4F50A 2BCSA 4QZFA 3C23A 3MABA 3LK9A 1SL1A 4F2RA 3G6VA 3RR7A 2P66A 5KFAA 3PX4A 1HUZA 1T7PA 3OJSA 5CWRA 1A77A 1KEJA 1UA0A 1NK0A 4B9TA 4O3SA 4EEYA 3QZ7A 5CB1A 3SV3A 4DF4A 2BCVA 5DG8A 3RAQA 2HHXA 3OSNA 9ICAA 2JZBA 5KT2A 1B22A 2VA8A 4QZGA 4Q44A 3EPGA 5J2JA 4M04A 4TUQA 5J2EA 5KFWA 4UBBA 3ZDCA 2JEIA 8ICZA 1S97A 3GV7B 3TANA 2NRTA 7ICKA 5IILA 8ICOA 1A76A 1WCNA 1HJPA 8ICCA 4IQUA 4YMNA 3KHHA 2W8LA 4B9VA 3Q8SB 4QZDA 4BWMA 1T3NA 7ICGA 2A1JB 4UAWA 5KFMA 8ICGA 4RPYA 3RR8A 3GIKA 2BCRA 9ICQA 3H8SA 3TFRA 4GXKA 3BQ0A 3RB4A 3RJHA 4RQ4A 5L9XA 1UA1A 4KN4A 3HPOA 5J2FA 5J0QA 3H4DA 2JZBB 2ZJ5A 4GC6A 2BGWA 3RB3A 3PW4A 3GDXA 3SZ2A 4KITB 4J9QA 2OWOA 4Q8EA 3SI8A 2KZZA 5J2AA 8ICAA 1ZYQA 1U45A 2ZTCA 4KTQA 7ICOA 7ICTA 1WCLA 5DKWA 8ICJA 4EYHB 4KLLA 4QZEA 5EWGA 2KFZA 4UB3A 1TKDA 5C5JA 4NLNA 4P4MA 4UB4A 4R8UA 1D8YA 3M8SA 4BXOA 2AU0A 4BDPA 9ICUA 1TK0A 4I2DA 3RB6A 9ICFA 3MR3A 3OHAA 4RQ6A 3RJJA 2Q0ZX 4MFAA 4RQ8A 8ICEA 4DSEA 2JEFA 8ICFA 1BVSA 1BGXT 1UT8A 7ICEA 5KG6A 8ICNA 4IR9A 3B0XA 7ICSA 2HHQA 4RUAA 2PI5A 3OHBA 4F4YA 2C2DA 3AU6A 2XGPA 5F9NA 1DGSA 5KFDA
chains in the Genus database with same CATH superfamily
4F2SA 4Z6EA 5GTIU 2Z7JA 2DPIA 1UT5A 4QW9A 3Q8KA 4O5CA 4G9BA 1XSLA 1BNPA 5DB8A 5J0OA 1UHUA 2KE7A 4ECZA 4KLTA 3DEEA 1ZQ1C 3K75D 2CXYA 4B9MA 1N5WA 1BPXA 4NLKA 4NL9C 5IIKA 3ETLA 3ISBA 2ASLA 3MR2A 1OUQA 1H38A 4ELUA 3GIIA 2WTFA 2BQ3A 2VKQA 4C7ZA 5AHXA 5KG2A 2LPEA 4OJ5A 9ICPA 3ORYA 4KLHA 4KLSA 3QU7A 2BR0A 3PNCA 4NV0A 4QNLA 2E3TA 1TV9A 1FIQA 4KLGA 8ICLA 3JPPA 5KFYA 5KT5A 2XGQA 2LHTA 2QB1A 1HUOA 4JWMA 2DUYA 4J9OA 1ZQVA 4P0QB 3WK9A 2W9BB 4KLOA 4KLJA 2H3VA 2W9MA 3RH5A 4QZAA 2UVRA 1NK8A 3G6XA 3BS5A 1K1QA 2I1QA 2W9CB 4XUSA 4DWIA 9ICIA 4J03A 1ZQKA 2OM6A 2KK0A 2IMWP 4DQPA 1QSYA 5CJ7A 4EELA 4DL5A 4ECUA 4Z6CA 2FE9A 2WFAA 3RJIA 5ALVA 2ZUBA 9ICWA 3QU2A 3Q8LA 2YN4A 4US9A 4Y2TA 3V6HA 1FFUA 7ICIA 4RUCA 3QX7A 4F91B 5KFNA 1SWVA 4PL2A 2W55A 5ALFA 4OJOA 1Z4OA 2VA3A 2YB1A 4F4KA 1ZQIA 4RPXA 4R63A 5DBCA 3QUBA 5ALDA 3TARA 9ICHA 2FDRA 3JPOA 1CUKA 1SIJA 4PHDA 4C0ZA 3FYHA 2FLLA 9ICRA 1LVHA 3M9NB 4X5VA 3VCBA 2W04A 2FLPA 2HBJA 1KFDA 4PZOA 3N7SC 4RNNA 3ZDDA 9ICLA 4PHAA 1L7PA 1YZ6A 2JH1A 4J9KA 4F8RA 1Z3EB 1CRXA 2EQYA 4ED2A 4UAZA 2ZJ8A 3SD7A 3HJEA 5HHIA 2EAPA 4TURA 1JALA 1U47A 2BPGA 2E8PA 5CP2A 5ALQA 4M9GA 4CE6A 1CI4A 5TISU 2KJ9A 1T8EA 3NTUA 3MR6A 2BDUA 9ICKA 3RJGA 2FI1A 4RT3A 2PMZF 5JTIA 4QIWC 2XO7A 3UQ0A 4HYKA 4NLCA 4NLBA 4I29A 4RT2A 3N4MB 4KX5A 4J9SA 8ICQA 2QB0A 1O08A 4DF8A 1GO3F 3HW8A 9ICSA 3H7IA 4K4HA 3ED5A 1MSWD 4R66A 1PK1A 1RYSA 2KD1A 3E58A 4FS2A 2AHOB 2JXJA 1BPEA 2K4PA 4UB2A 1KFSA 3OSPA 3RRGA 1UPHA 2JV3A 3GU3A 3IV6A 5FP0A 2IHMA 8ICXA 2LMRA 1S8OA 4ED8A 3F2DA 3SMVA 1UCVA 1L3VA 4NXZA 2WHEA 2J6SA 4TUPA 2EANA 2KIVA 4OJ6A 4YCXA 3LWLA 5L1JA 3Q8RB 5IIMA 2KTQA 1X9WA 4PPXA 7ICVA 3GV8B 1K1SA 4B9UA 2KVSA 4M2YA 8ICMA 5KFQA 1F5SA 5TZVA 4DL3A 4ED3A 1NKBA 1X66A 4J9MA 2EAOA 2UVWA 1SKSA 2KNJA 1NJZA 2HW3A 3UXOA 5AM4A 5DG9A 3RB0A 1NJXA 3MGVA 2WB1F 1ZQMA 3C29A 5KFKA 4J9RA 1ZQYA 4EX7A 3PX0A 5J0PA 4F5PA 2DPJA 1Q8KA 5DDMA 1U9LA 1SZHA 4FBUA 2FMQA 2VA2A 2C22A 4M9HA 3DDHA 1COOA 4F5OA 3QUTA 3ZD9A 4QZBA 4DFPA 4ELTA 4KLUA 4EZ6A 4RNMA 2P6UA 2LI6A 1PUZA 2G5HB 5AM3A 5AI4A 4IQTA 3V6KA 9ICGA 3H0RB 1O03A 5DLGA 3BZKA 3OTQA 9ICJA 1IXRA 3UXPA 1ECWA 1QQ6A 4UB5A 2W8KA 5ALKA 9ICBA 4CCHA 5ALRA 4UB8U 3D2NA 4RQ7A 1U49A 5AKZA 1J97A 2EZZA 4JWNA 1WWUA 1WUDA 2AQ4A 1CEZA 1TFRA 2V9WA 3RAXA 5DQIA 1ZQSA 1S0MA 4BUGA 2WF9A 2B6GA 4O0IA 3PMNA 3H8WA 2E8NA 1ZQUA 3BQ7A 4C4TA 2W9CA 1TVAA 7ICNA 1V97A 4Y2PA 5AI5A 2BHNA 3WKCA 3QEBZ 1LKYA 3IG8A 2YMMA 4Y2RA 2QLTA 2BCSA 2VIXA 5G5GA 3C23A 5KFAA 1HUZA 1T7PA 2I6XA 1KEJA 2OYYA 4O3SA 2HHXA 3OSNA 9ICAA 2YMLA 2JRZA 5AKKA 4MHVA 4M04A 2CPRA 4TUQA 4UBBA 3TKAA 1S97A 3TACB 1Z1BA 4B9VA 7ICGA 1T3NA 2K8BB 4UAWA 4FE3A 4RPYA 3TFRA 2ZIUA 4RQ4A 1L7NA 4KN4A 4JB3A 5J0QA 2JZBB 4C7YA 3PW4A 5AKGA 3SZ2A 4J9QA 2OWOA 2KZZA 3SI8A 5ALPA 2ZTCA 7ICOA 2RP5A 4C4RA 8ICJA 3KBBA 5CEHA 4QZEA 4UB3A 1TKDA 4P4MA 4BXOA 9ICUA 1TK0A 1ZOLA 9ICFA 3OHAA 3RJJA 8ICEA 4DSEA 1UT8A 1YT3A 2PI5A 5AK6A 4F4YA 2C2DA 2GO7A 1KL9A 3PX6A 1RQLA 4F4WA 3SENA 2RRDA 2YQEA 4R8UB 1NK7A 3LVWA 5EE3A 1TE2A 9ICNA 3JPSA 1LB2B 2ZUCA 3TADA 2MA1A 4DQRA 4EENA 3BQ2A 4ECVA 4YD1A 1ZQQA 4DOBA 3H4BA 1Z4NA 4RU9A 4CF5A 1S0NA 1X6JA 3EW9A 2C2RA 4DS5A 3SYZA 5DGAA 2D6FC 5J0UA 2EH9A 2AGQA 4PL1A 4TQSA 4DFMA 3WK6A 5DG7A 5AM1A 3RRHA 4O5KA 3MDAA 1MC8A 5KFRA 1Z1VA 4UBCA 1ZQDA 4RQ1A 9ICCA 4YR0A 4I2CA 1PK3A 2W7PA 4YVZA 3THVA 4I2AA 2F3NA 1ZQRA 1XC9A 4DL2A 1V85A 7ICJA 3Q8MA 2WB1C 3QU5A 2HHUA 5KFFA 3JPTA 4I28A 1C7YA 9ICEA 3OGUA 2BQUA 3TAQA 4RQ5A 4EBCA 2H3IA 4F93B 2K8AA 4FFDA 2HDOA 3D2QA 4F92B 4IQVA 1NK9A 4EX6A 2EZYA 2ODGA 3FAHA 5J2KA 2XY6A 4O3MA 3CP8A 2R8JA 4O3OA 4ECYA 1WG8A 4NJ8A 4M0AA 2ZIWA 1S9FA 3C21A 2PFQA 1A6SA 2W54A 4A8EA 5AI0A 2JMGA 4BGDA 4FZNA 4ED0A 1SB3C 3WK4A 3WKBA 3PW7A 8ICIA 2L5YA 3V6JA 1RM6C 3N7PD 4Z6FA 4F5QA 2YX8A 2IOFA 4DFDA 4Y2YA 4C8OA 4ECQA 3GIJA 3RFAA 4DQIA 4UW9A 3H0LB 2C2EA 5J0WA 4NLZA 3T3FA 4F5RA 4R64A 1ED1A 3OPXA 3MGHA 2MAXA 1V9PA 5L1LA 4I2GA 1PVRA 2BCUA 1ZQAA 3IP4B 5HHHA 2BPCA 4F71A 3MFIA 1ZQPA 2JEJA 2NRWA 4WJ3B 2ZIXB 4KLDA 4KMUA 2K4IA 3T5JA 4ELVA 4M9NA 2ATLA 3C1ZA 7ICPA 5L1MA 2F1HA 3BQTA 1SXEA 2D8CA 1JUDA 4EBEA 4O9MA 4ECWA 1PVPA 2ZG6A 3CNHA 2ASJA 1Q3VA 4DL4A 5D49A 3TAPA 1SL0A 3KHLA 4J9NA 7ICHA 7ICFA 4P0PA 1BPBA 4CF4A 2ESEA 2RLTA 1JXLA 4DS4A 4QWEA 1F0MA 5DLFA 4DEZA 5KFVA 1KSPA 2BZFA 2DKZA 4YR3A 3K1ZA 5AIAA 2XCAA 4QZCA 2G09A 3WK7A 3OJUA 5AIBA 5KFGA 1NK5A 4DSKA 4PGYA 4ED7A 5JU5A 4IQWA 2WF5A 2RDJA 3C5FA 2JGAA 2AJQA 3WKEA 3RBEA 4C8LA 3IRUA 5KT6A 5KFEA 2YB4A 1IM4A 1KKXA 1T4GA 4YXJA 3GIMA 3LDAA 4KLQA 5EWEA 3H0MB 3S6JA 2XCPA 3AQEA 5AKJA 1JROA 4Q43A 2F1IA 5T14A 2PFOA 2DF4B 3T79A 2BCQA 4QWBA 4PZNA 2I5HA 2ZJAA 4M47A 2XI9A 2A3VA 2M0NA 2AH5A 1ZJNA 2NRZA 3M9MB 1MN8A 5EE0A 1L8LA 3PO5A 1XS9D 3C2MA 2LYBA 4QWDA 7ICMA 2XY5A 2PFPA 2HCFA 1V38A 4TQRA 1U48A 1XU4A 4M9JA 5DGBA 3PSTA 4I2IA 4DOAA 3AL0B 2EZXA 2CN1A 4MFFA 2K8CB 3I1YA 4UARA 1HEKA 1N60A 3ISDA 9ICVA 1X40A 2F8KA 8ICYA 1ZQOA 2XICA 3IG5A 3B9JA 5F9LA 3V7JA 1NK4A 3MDCA 1S0OA 2R8KA 2LYHA 1PVQA 2NO4A 5ALLA 4DLGA 2GLEA 3U26A 3SAGA 5ALIA 4ED1A 3RTVA 3JPNA 3QXGA 1YZ7A 1ZQJA 1BPDA 3B0YA 3L4PA 4RPZA 2E5SA 2MUTB 3BS7A 4GXJA 2KHQA 4IRCA 5GTHU 3ISCA 2I9GA 2HVHA 2ZUDA 2KKVA 4C8MA 1NZBA 4NWIA 4RQ0A 2GWSA 4JUZA 4UQGA 2ZIVA 1D8BA 1S77D 3KKAA 4RZRA 3QYPA 8ICRA 3NVZA 4OJPA 1XSNA 3BDPA 2P6RA 4YXMA 5BOLA 1B0XA 3MABA 1SL1A 4F2RA 3G6VA 3PX4A 3OJSA 1L7OA 5CWRA 4B9TA 4DF4A 5CB1A 2G0AA 1B22A 3BZCA 2PKEA 2KHVA 2VJ5A 2VA8A 8ICZA 5J2EA 2G08A 3TANA 7ICKA 8ICOA 1A76A 1HJPA 4IQUA 4Y2XA 2W8LA 3Q8SB 2Y9UA 4BWMA 5KFMA 8ICGA 3AM9A 9ICQA 2MRLA 3H8SA 4GXKA 3RJHA 3MC1A 4OCZA 5AM5A 3H4DA 3D6JA 4GC6A 4DCCA 2JH7A 3RB3A 3UMCA 2B0CA 1U45A 1N5XA 1WCLA 4EYHB 4KLLA 5EWGA 3D2SA 5C5JA 4BDPA 1D8YA 2Q0ZX 4MFAA 1X6IA 5AKXA 3I76A 3B0XA 2HHQA 5ALUA 3M6ZA 2HI0A 5EE9A 3AU6A 4M6WB 1TK5A 1IV8A 2QARB 4KLEA 2AGOA 2Y1JA 5KFCA 4QWCA 3SV4A 1L6NA 3ZDBA 4IRKA 5IIIA 1SV0A 2UVUA 4C8KA 5KFZA 1P7DA 4LVSA 4B9SA 4PHEA 1RDFA 2HHTA 1QH9A 5L1IA 4Y2VA 4ECXA 3L5KA 3ONNA 2AXTU 4KN7A 4ED6A 4DLEA 3PV8A 5DDYA 2ALZA 4I2JA 1MA7A 4CRXA 5JRTA 2KOBA 4UATA 4P0QA 5IIJA 1NK6A 4UAUA 1Y88A 5KFJA 2W9BA 3RH4A 3QU9A 5J2DA 2HBMA 1X42A 2R8IA 2B21A 4DFKA 2K4EA 2OHFA 2XVTA 3SAFA 1SZPA 2YMPA 1KBUA 3G6YA 2WAQF 5KFTA 2MU2A 1JX4A 1DXSA 3A0HU 3IN5A 5J0RA 2YY6A 2XC9A 2KJ5A 2LKYA 2ZTEA 2Y1IA 4JK1A 1JIHA 3RJEA 2HHSA 2F44A 4YN4A 3QUQA 3R9KA 3AUOA 4Y2UA 2EDUA 5HMLA 8ICHA 2IA6A 3IDWA 1NJYA 1EXNA 3K4GA 5KG3A 3C2LA 2C28A 5HNKA 5ALGA 4QWAA 1TAUA 3BS5B 3TADC 3NGDA 2NV3A 2WF8A 5KL1B 2F77X 1X2IA 1D9DA 3KTQA 3IHQB 3UMGA 4DQQA 3TI0A 1SKRA 1ZQHA 2HBKA 4FZMA 1XSPA 5KT7A 4DSJA 3UQ2A 2KEYA 4O3NA 1A0PA 4NM2A 2Q4TA 2OXOA 5ALWA 3KFUF 3QEAZ 3PZPA 3PVXA 3MGIA 5ALSA 5AI8A 4DSLA 4Z6DA 3KZIU 3F53A 4U6PA 1SV4A 5AKIA 3EUB2 2R18A 5J0SA 2J6UA 4GIBA 5J8YA 2HOQA 4P4OA 3KD3A 4ZH4A 2FPMA 4KLMA 5KG1A 2WF6A 2KVCA 4XRHA 1J2NA 3PW0A 2P35A 2KSOB 2N1RA 2FPKA 2HHWA 1LV5A 5EWFA 2MUTA 4LJXA 3L3FX 4DSFA 4IC9A 3JPQA 2OH2A 4BX9C 1XWLA 3V7KA 2DWQA 4J9PA 3GZFA 3I28A 3KHGA 1L3TA 5AKYA 2PI4A 3T5HA 5J2HA 5KFPA 4CGZA 5ALMA 3K1RB 2IOHA 5J2CA 2KIWA 4PHPA 2D3DA 1Z00B 3T5KA 2KICA 1L5UA 4C80A 5C0YA 2K60A 1RPLA 4DOCA 5ALYA 2F2AB 3LVVA 5KL8B 1T3QA 1PK1B 1NNLA 2F1JA 2RDIA 5AK5A 4JV1A 5KG7A 2HBLA 2E8MA 3NVWA 9ICOA 1M6YA 2W43A 3QE9Y 3F2CA 3MFHA 3A0BU 4XQ8A 4Q45A 1U4BA 2O6KA 1NI3A 4MF2A 1DK3A 4GXIA 2W7OA 2J6TA 7ICQA 1ZD4A 4DQSA 8ICTA 1B43A 5KFUA 1ZETA 1D9FA 2ASDA 2HVIA 2G06A 2HOFA 3AMZA 1T94A 4MEXA 1NOMA 2FJ6A 2ZTDA 3EPIA 3TQ1A 4U7CA 1ZJMA 4M6WA 3RBDA 2M9NA 3F2BA 3HKZF 2EAMA 3T5LA 1TAMA 3MR5A 2E1FA 2H5XA 4PGXA 3M8RA 4QZ9A 2AQ0A 4FZLA 3WKDA 4UASA 4UB6U 3NUQA 2ISPA 3PSIA 3SQIA 4PJ0U 4ACOA 2IBKA 5IINA 1KLNA 3FDSA 3RH6A 7ICRA 2WAQC 8ICUA 1XO1A 4DL6A 4F3OA 2DFLA 3HRDD 2ES6A 5J29A 4ECSA 8ICWA 1ZQBA 4C8NA 3PY8A 5AI6A 1N63A 3ICXA 5KG4A 2ISOA 4NY8A 3UMBA 4M9LA 1ZD2P 1Z19A 2UVVA 5KFOA 1DGJA 5H2FU 5CHGA 2KN7A 4J9LA 1QLNA 3IM1A 3SEIA 1OW5A 2DBYA 3C5GA 7ICLA 4JV2A 3LYSA 3N28A 4ECRA 2V4QA 1MQ3A 5HR6A 2F76X 3WK8A 2NRVA 5J2GA 5EE1A 5K4LA 4RQ3A 5KT3A 4P4PA 4QW8A 1JMSA 2DL0A 3SR6A 4EEKA 4QZ8A 1X9XA 5AICA 4YMMA 2OEHA 1ZQGA 3AN1A 3Q8PB 3ZDAA 5AKLA 2H3FA 4GLXA 3H40A 3GQCA 5AKHA 2KFNA 3KZXA 5DBAA 3BJYA 3LK9A 1QCKA 3RF9A 3RR7A 2P66A 1IG6A 1A77A 1UA0A 1NK0A 4EEYA 3QZ7A 2BCVA 5DG8A 4NL9A 3RAQA 2JZBA 1C20A 3ALRA 4QZGA 4Q44A 3EPGA 5KFWA 2MSNA 1LKYB 3GV7B 2NRTA 5IILA 1WCNA 2JR5A 2XIDA 4YMNA 3KHHA 4QZDA 2A1JB 3RR8A 3BQ0A 4OD0A 5L9XA 1UA1A 1ZRMA 3ZI4A 1L8OA 2BGWA 3N7RC 3GDXA 5KNIA 5J2AA 4KTQA 2KG5A 2E1EA 2KFZA 4RQNA 1COKA 4UB4A 4R8UA 3M8SA 2ZXIA 3QUCA 2DKXA 3MR3A 2ZIUB 1BVSA 1BGXT 1KN5A 5KG6A 8ICNA 2G07A 5KAFU 1N62A 2ZXHA 3AU2A 1KDHA 2NO5A 5E79U 4FO6A 4AYBF 4EZ9A 2BDPA 2VANA 4DL7A 4BXOB 2KSOA 1RZTA 3M9OB 5HP4A 2Y0SF 2W03A 3KKAC 9ICTA 2BQRA 4MFCA 2IOFK 1SKWA 4O3PA 3GILA 5B66U 3NRZA 2AGPA 3NRWA 1ZQNA 3M1YA 3JPRA 4YR2A 4YD2A 3GV5B 2W9AA 4F4XA 5ALXA 5JUMA 1S10A 4FBTA 3NASA 2CRXA 1QQ5A 3EZ5A 1Z00A 5AM2A 1FEZA 4NM1A 5KG0A 2JEGA 4US8A 2RQ5A 5B5EU 3SAHA 2H3ZA 4G3IA 3DV9A 1RXVA 2NRXA 1N61A 1ZQTA 3AQFA 4F5NA 3ZD8A 2YTUA 4O3QA 3PR4A 5D4BA 2LBOA 5D46A 3C28A 4CF3A 3PW2A 3H8JA 2Y9TA 1N56A 4USAA 4B9LA 1L7MA 4YMOA 3V72A 3MBYA 4C4SA 1RQNA 1Q3UA 3HKZC 3F5AA 3M6KA 1AQ6A 2KP7A 1KRPA 3QZ8A 3O0FA 4E0DA 1ZRNA 5KFBA 3VC8A 4O5EA 2PXIA 4YP3A 2HSZA 1SV0C 5DB6A 4IR1A 1URJA 1S0VA 4IRDA 4DSIA 2FPLA 1WWVA 4ECTA 1ZXIA 1NKEA 1XNSA 3PR5B 1VJ5A 2OCEA 1ZQXA 5CA7A 8ICBA 1J2MA 4LZGA 7ICUA 1D8LA 4PGQA 4MEYA 3GFKB 5DQGA 3RJKA 8ICPA 1RYRA 3UPQA 1QSSA 1AROP 4XA5A 2A1AA 2BPFA 4QZHA 1ZQLA 8ICVA 4FS1A 2F8LA 4UAVA 2ZIWB 4F4ZA 4I2EA 1ZQFA 3V7LA 4KLIA 2DQNB 1MQ2A 2ZIXA 8ICKA 8ICSA 5DB9A 1L3SA 4AP9A 3NVVA 3N97B 3CYMA 3WU2U 4LZDA 5IIOA 4KLFA 2KJ8A 2NYVA 3Q8QB 2A19A 5AK4A 2VJ4A 1QTMA 5KAIU 4I2HA 3BQ1A 4DFJA 1RG6A 2G5IB 5DBBA 4MF8A 1UQVA 4YFKA 2DGZA 3J81j 4IS7A 3PSFA 5G5HA 4CDGA 4EBDA 1ZQEA 1VLBA 3CW2C 3C1YA 4I2FA 1ZD5A 2KV2A 1SGGA 1SL2A 2FMSA 4HAIA 3UM9A 4KX3A 2BKEA 1QSLA 2FMPA 5J0XA 2PFNA 3NS1A 5KG5A 3PSPA 3HWTA 3HT3A 4QJFB 4EYIB 1TAQA 5ALJA 1OXJA 5DQHA 4PH5A 4IL6U 3NVYA 3F5EA 4QZIA 2V4RA 4ICAA 1PZNA 4P0PB 5CR0A 1X9SA 5KFXA 2R8HA 2RHFA 4RQMA 5J0TA 1DOQA 5ALOA 2A1JA 1RXWA 4JV0A 3HILA 4Q8FA 1ZQZA 1S76D 5EOZA 4K4IA 5A0LA 5J8YC 1N48A 4RQ2A 4CNQA 4AYBC 1HIWA 5J2IA 5ALHA 5HR7A 4RNOA 4UAYA 2HOIA 4DO9A 1BPZA 3KHRA 2Y0SC 5AK3A 4BJQA 2XY7A 4NLGA 4UB1A 1NJWA 4GC7A 5KFHA 5BPCA 1NKCA 5KFSA 4YG2A 2LM4A 5J2BA 4GFJA 5KFIA 4B6JA 1SXDA 4I27A 3FC4A 5BOMA 1QQ7A 4I2BA 2KZMA 2R8GA 4JMUA 1NZPA 2IHNA 5ALZA 2KMDA 1N2XA 2PMZC 3HP6A 3PW5A 5KTQA 1KTQA 3TFSA 3UXNA 3QNMA 3WKAA 2JHDA 1B4FA 1TK8A 3PMLA 3ZDEA 5J0YA 1FO4A 4K4GA 3CRXA 2KZ3A 4BWJA 1JN3A 2WF7A 2YMQA 5DB7A 1S5LU 1KFTA 2KKPA 3H8MA 3E2EA 1IIPA 2HMXA 2FLNA 2LYAA 5ALTA 5KFLA 3LWMA 2QKQA 5AKEA 1L3UA 1RYUA 4ZOHC 3PO4A 4TUSA 4R65A 3RJFA 4YQWA 3FM9A 5KT4A 5F3XB 5L1KA 3EYZA 5CRXA 9ICMA 3HX0A 1XO0A 5AM0A 2W11A 1BPYA 1VDVA 5HMMA 1JRPA 4P2HA 1JXEA 4OO1J 3EWAA 2GOLA 1F44A 1ZD3A 1ZQWA 1WYGA 4KMOB 2HHVA 2K4HA 2QB0B 3ETRA 1ZQCA 1X9MA 3C2KA 4B9NA 2W3SA 9ICXA 4O3RA 3E0FA 1SWWA 2E8OA 1K5OA 4F50A 4QZFA 1KW4A 5ALEA 4QIWF 3SV3A 3QU4A 2ZIVB 5KT2A 1FFVA 3KOOA 5AI9A 5J2JA 3ZDCA 2JEIA 3WK5A 2GH1A 8ICCA 3GIKA 2BCRA 4Y2SA 3RB4A 4OJLA 3HPOA 3AEVA 5J2FA 2ZJ5A 4Y2QA 1Q46A 4KITB 4Q8EA 8ICAA 1ZYQA 7ICTA 2QARA 5DKWA 1KQQA 1DRGA 4NLNA 2K89A 5ALNA 2AU0A 1BNOA 2W3RA 4I2DA 3RB6A 2LM1A 4F72A 4RQ6A 2H3QA 4RQ8A 1DK2A 2JEFA 8ICFA 3M7DA 7ICEA 4Y2JA 4IR9A 7ICSA 4RUAA 3OHBA 1JI7A 2XGPA 5F9NA 1DGSA 5KFDA
chains in the Genus database with same CATH topology
3AU2A 3PX6A 4M6WB 1TK5A 4F2SA 1KDHA 4Z6EA 4F4WA 4KLEA 2AGOA 2Y1JA 5KFCA 4QWCA 3SV4A 4FO6A 3ZDBA 4EZ9A 2BDPA 4IRKA 2VANA 4DL7A 4R8UB 5IIIA 1UT5A 1RZTA 2DPIA 2UVUA 3M9OB 1NK7A 4BXOB 4QW9A 5HP4A 3Q8KA 4C8KA 4O5CA 5KFZA 9ICNA 4LVSA 3JPSA 1LB2B 4B9SA 1XSLA 4PHEA 9ICTA 2ZUCA 5DB8A 2BQRA 5J0OA 4MFCA 2HHTA 1SKWA 4O3PA 4DQRA 4ECZA 3GILA 3BQ2A 4ECVA 5L1IA 4KLTA 2AGPA 1ZQNA 4YD1A 4ECXA 3K75D 1ZQQA 4DOBA 3H4BA 3JPRA 4B9MA 4KN7A 4RU9A 4YR2A 4ED6A 1S0NA 4YD2A 1BPXA 4DLEA 3EW9A 3PV8A 2C2RA 5DDYA 3GV5B 2ALZA 4NLKA 2W9AA 4I2JA 4DS5A 3SYZA 5IIKA 4F4XA 5DGAA 5J0UA 3ETLA 5JUMA 1S10A 4FBTA 2AGQA 3ISBA 4TQSA 2ASLA 3MR2A 4DFMA 3EZ5A 5IIJA 1Z00A 1NK6A 1H38A 4ELUA 3GIIA 5DG7A 1Y88A 5KFJA 2W9BA 4NM1A 2WTFA 3RH4A 5KG0A 2BQ3A 2JEGA 3RRHA 5KG2A 5J2DA 2R8IA 4G3IA 2B21A 4DFKA 4O5KA 3MDAA 9ICPA 1MC8A 5KFRA 1RXVA 4UBCA 2NRXA 3ORYA 4KLHA 1ZQDA 1SZPA 4KLSA 4RQ1A 1ZQTA 9ICCA 3G6YA 2BR0A 4YR0A 3PNCA 5KFTA 4I2CA 1TV9A 1JX4A 4F5NA 4KLGA 4YVZA 8ICLA 3ZD8A 3JPPA 5KFYA 3THVA 5KT5A 4I2AA 2XGQA 4O3QA 3PR4A 5D4BA 1HUOA 4J9OA 1ZQVA 5D46A 4JWMA 3PW2A 2W9BB 1ZQRA 1XC9A 4KLOA 4KLJA 4DL2A 3H8JA 7ICJA 2W9MA 5J0RA 3Q8MA 1N56A 3RH5A 4QZAA 2UVRA 4B9LA 4YMOA 3V72A 3MBYA 2HHUA 1NK8A 5KFFA 3JPTA 4I28A 2XC9A 3G6XA 1K1QA 2I1QA 1C7YA 2ZTEA 2Y1IA 2W9CB 9ICEA 4JK1A 1KRPA 1JIHA 4XUSA 4DWIA 3OGUA 3QZ8A 2BQUA 3TAQA 4RQ5A 4EBCA 4E0DA 9ICIA 1ZQKA 3RJEA 5KFBA 2HHSA 4F93B 4YN4A 2IMWP 4DQPA 1QSYA 4O5EA 5CJ7A 3AUOA 4F92B 4DL5A 5HMLA 8ICHA 4IQVA 1NK9A 2IA6A 4ECUA 4Z6CA 2PXIA 4YP3A 1EXNA 1NJYA 3RJIA 5J2KA 3K4GA 5DB6A 2ZUBA 5KG3A 3C2LA 2XY6A 2C28A 4IR1A 9ICWA 5HNKA 3Q8LA 1S0VA 2R8JA 4IRDA 4QWAA 4DSIA 4O3OA 3V6HA 1TAUA 4ECYA 2FPLA 3NGDA 7ICIA 4RUCA 5KFNA 4F91B 4M0AA 1S9FA 3C21A 2PFQA 1X2IA 1D9DA 4ECTA 3KTQA 3IHQB 4BGDA 4ED0A 1NKEA 3PR5B 2VA3A 1ZQXA 5CA7A 4DQQA 3TI0A 8ICBA 4F4KA 1ZQIA 4LZGA 7ICUA 1D8LA 1SKRA 1ZQHA 4RPXA 4PGQA 4R63A 4MEYA 1XSPA 3GFKB 5DBCA 5DQGA 5KT7A 3TARA 4DSJA 3RJKA 8ICPA 9ICHA 3UQ2A 4O3NA 3PW7A 3JPOA 1RYRA 3UPQA 4NM2A 1CUKA 4PHDA 1QSSA 1AROP 3V6JA 3FYHA 8ICIA 3QEAZ 4Z6FA 4F5QA 2FLLA 4XA5A 9ICRA 2BPFA 3M9NB 4QZHA 3PVXA 3MGIA 4FS1A 4X5VA 1ZQLA 8ICVA 4F4ZA 4I2EA 1ZQFA 4C8OA 3V7LA 4ECQA 4Z6DA 4DSLA 1MQ2A 4KLIA 8ICKA 2FLPA 1KFDA 4RNNA 3GIJA 3ZDDA 4DQIA 8ICSA 9ICLA 4PHAA 5DB9A 2C2EA 5J0WA 4NLZA 4J9KA 4F8RA 1Z3EB 1L3SA 3T3FA 4F5RA 5J0SA 4R64A 4ED2A 3N97B 2J6UA 3MGHA 4UAZA 2MAXA 1V9PA 2ZJ8A 4P4OA 5HHIA 5L1LA 4I2GA 4LZDA 2BCUA 4TURA 1ZQAA 5HHHA 2BPCA 4ZH4A 5IIOA 1U47A 4KLFA 2FPMA 3MFIA 1ZQPA 2BPGA 2JEJA 4KLMA 5CP2A 2NRWA 4M9GA 5KG1A 3Q8QB 4KLDA 4KMUA 4ELVA 3T5JA 4M9NA 4XRHA 2ATLA 1QTMA 3C1ZA 4I2HA 7ICPA 3BQ1A 4DFJA 1T8EA 3NTUA 2F1HA 3BQTA 3MR6A 3PW0A 5DBBA 2FPKA 2HHWA 9ICKA 1LV5A 4MF8A 5EWFA 2MUTA 4EBEA 3RJGA 4O9MA 4ECWA 4DSFA 2ASJA 4YFKA 3JPQA 4EBDA 4RT3A 1ZQEA 4DL4A 5D49A 3TAPA 1XWLA 3V7KA 2XO7A 1SL0A 3UQ0A 3C1YA 4I2FA 3KHLA 4J9PA 4J9NA 7ICHA 7ICFA 4HYKA 1BPBA 3KHGA 1SL2A 4I29A 4RT2A 2FMSA 3N4MB 1L3TA 1JXLA 4J9SA 4DS4A 2BKEA 1QSLA 8ICQA 4QWEA 4DF8A 2FMPA 5DLFA 4DEZA 5J0XA 5KFVA 3T5HA 1KSPA 2PFNA 5J2HA 5KFPA 3HW8A 2PI4A 3H7IA 9ICSA 5KG5A 3HWTA 4YR3A 4K4HA 3HT3A 1MSWD 4EYIB 4R66A 1RYSA 5J2CA 1TAQA 2XCAA 4FS2A 4PHPA 4QZCA 5DQHA 1Z00B 4PH5A 3T5KA 3OJUA 4QZIA 1BPEA 5KFGA 1NK5A 2V4RA 1L5UA 4UB2A 4DSKA 1KFSA 4PGYA 4ED7A 1PZNA 3OSPA 1RPLA 3RRGA 4IQWA 2IHMA 8ICXA 5CR0A 4DOCA 2RDJA 5KFXA 1X9SA 2R8HA 3C5FA 2AJQA 3RBEA 4C8LA 5J0TA 4ED8A 1DOQA 5KT6A 2F1JA 4JV1A 2RDIA 5KFEA 5KG7A 1IM4A 1T4GA 1L3VA 9ICOA 2A1JA 4NXZA 4YXJA 2J6SA 1RXWA 3GIMA 4TUPA 4JV0A 3LDAA 4KLQA 4Q8FA 4YCXA 3QE9Y 5EWEA 1ZQZA 1S76D 5EOZA 3MFHA 4K4IA 3LWLA 1N48A 4RQ2A 4XQ8A 2XCPA 5L1JA 4Q45A 4Q43A 1U4BA 3Q8RB 2F1IA 5J2IA 5IIMA 2KTQA 4MF2A 4RNOA 4UAYA 1X9WA 4PPXA 4GXIA 2PFOA 7ICVA 3GV8B 4DO9A 1BPZA 2J6TA 1K1SA 3KHRA 4B9UA 7ICQA 4DQSA 8ICTA 1B43A 2XY7A 4NLGA 4M2YA 2BCQA 5KFUA 4UB1A 4QWBA 8ICMA 1NJWA 5KFQA 1ZETA 4GC7A 5KFHA 2ZJAA 5TZVA 4M47A 4DL3A 4ED3A 1NKBA 4J9MA 1D9FA 5BPCA 1SKSA 2UVWA 2ASDA 2HVIA 1NKCA 5KFSA 1NJZA 2HW3A 4YG2A 3UXOA 5J2BA 5KFIA 4MEXA 5DG9A 1NOMA 1ZJNA 2NRZA 2ZTDA 4I27A 3EPIA 3TQ1A 3M9MB 3RB0A 1NJXA 5BOMA 1ZJMA 1ZQMA 4M6WA 5KFKA 3RBDA 3PO5A 4I2BA 2M9NA 4J9RA 2KZMA 2R8GA 1ZQYA 1XS9D 2IHNA 3T5LA 3PX0A 3MR5A 3C2MA 2H5XA 5J0PA 4QWDA 4PGXA 7ICMA 3M8RA 4F5PA 2XY5A 3HP6A 4QZ9A 5KTQA 3PW5A 2DPJA 5DDMA 1KTQA 2PFPA 3TFSA 3UXNA 2AQ0A 4TQRA 1U9LA 1U48A 1XU4A 4M9JA 5DGBA 4I2IA 4FBUA 4DOAA 2FMQA 1TK8A 2ISPA 2VA2A 2C22A 4M9HA 2IBKA 5IINA 4MFFA 3PMLA 1KLNA 3FDSA 1COOA 4F5OA 3RH6A 3ZD9A 4ELTA 4QZBA 4DFPA 3ZDEA 5J0YA 4KLUA 7ICRA 4K4GA 3ISDA 9ICVA 8ICUA 4EZ6A 2KZ3A 4BWJA 1JN3A 4RNMA 1XO1A 4DL6A 2P6UA 4F3OA 2DFLA 5DB7A 5J29A 4ECSA 8ICYA 1ZQOA 8ICWA 1KFTA 1ZQBA 4C8NA 3PY8A 4IQTA 3E2EA 3V6KA 9ICGA 5KG4A 2FLNA 5F9LA 3V7JA 5DLGA 1NK4A 3MDCA 2ISOA 4NY8A 5KFLA 1S0OA 9ICJA 4M9LA 2R8KA 2LYHA 3LWMA 1IXRA 2UVVA 5KFOA 1L3UA 5CHGA 3UXPA 2KN7A 4J9LA 1QLNA 3IM1A 4UB5A 2W8KA 4DLGA 3C5GA 9ICBA 4CCHA 3PO4A 4TUSA 4R65A 4ED1A 3RTVA 4JV2A 7ICLA 4RQ7A 3JPNA 1U49A 4YQWA 3RJFA 5KT4A 5L1KA 4ECRA 3EYZA 1BPDA 1ZQJA 9ICMA 3B0YA 3HX0A 2V4QA 4JWNA 4RPZA 1MQ3A 2MUTB 4GXJA 1BPYA 2AQ4A 2NRVA 1TFRA 5HMMA 1CEZA 4P2HA 4IRCA 1JXEA 2V9WA 3ISCA 5J2GA 3RAXA 2I9GA 5DQIA 1ZQSA 4RQ3A 1S0MA 2HVHA 5KT3A 3EWAA 2ZUDA 4C8MA 4O0IA 4P4PA 3PMNA 3H8WA 4QW8A 1JMSA 1ZQUA 4RQ0A 2GWSA 2W9CA 4JUZA 4QZ8A 1TVAA 4UQGA 7ICNA 1ZQWA 4YMMA 2HHVA 1ZQGA 1ZQCA 1X9MA 1S77D 2BHNA 3Q8PB 3C2KA 4RZRA 3ZDAA 4B9NA 9ICXA 8ICRA 3QEBZ 4GLXA 3H40A 1XSNA 4O3RA 3GQCA 3BDPA 2P6RA 2KFNA 5DBAA 4YXMA 3BJYA 5BOLA 4F50A 2BCSA 4QZFA 3C23A 3MABA 3LK9A 1SL1A 4F2RA 3G6VA 3RR7A 2P66A 5KFAA 3PX4A 1HUZA 1T7PA 3OJSA 5CWRA 1A77A 1KEJA 1UA0A 1NK0A 4B9TA 4O3SA 4EEYA 3QZ7A 5CB1A 3SV3A 4DF4A 2BCVA 5DG8A 3RAQA 2HHXA 3OSNA 9ICAA 2JZBA 5KT2A 1B22A 2VA8A 4QZGA 4Q44A 3EPGA 5J2JA 4M04A 4TUQA 5J2EA 5KFWA 4UBBA 3ZDCA 2JEIA 8ICZA 1S97A 3GV7B 3TANA 2NRTA 7ICKA 5IILA 8ICOA 1A76A 1WCNA 1HJPA 8ICCA 4IQUA 4YMNA 3KHHA 2W8LA 4B9VA 3Q8SB 4QZDA 4BWMA 1T3NA 7ICGA 2A1JB 4UAWA 5KFMA 8ICGA 4RPYA 3RR8A 3GIKA 2BCRA 9ICQA 3H8SA 3TFRA 4GXKA 3BQ0A 3RB4A 3RJHA 4RQ4A 5L9XA 1UA1A 4KN4A 3HPOA 5J2FA 5J0QA 3H4DA 2JZBB 2ZJ5A 4GC6A 2BGWA 3RB3A 3PW4A 3GDXA 3SZ2A 4KITB 4J9QA 2OWOA 4Q8EA 3SI8A 2KZZA 5J2AA 8ICAA 1ZYQA 1U45A 2ZTCA 4KTQA 7ICOA 7ICTA 1WCLA 5DKWA 8ICJA 4EYHB 4KLLA 4QZEA 5EWGA 2KFZA 4UB3A 1TKDA 5C5JA 4NLNA 4P4MA 4UB4A 4R8UA 1D8YA 3M8SA 4BXOA 2AU0A 4BDPA 9ICUA 1TK0A 4I2DA 3RB6A 9ICFA 3MR3A 3OHAA 4RQ6A 3RJJA 2Q0ZX 4MFAA 4RQ8A 8ICEA 4DSEA 2JEFA 8ICFA 1BVSA 1BGXT 1UT8A 7ICEA 5KG6A 8ICNA 4IR9A 3B0XA 7ICSA 2HHQA 4RUAA 2PI5A 3OHBA 4F4YA 2C2DA 3AU6A 2XGPA 5F9NA 1DGSA 5KFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU2 A;  3PX6 A;  4M6W B;  1TK5 A;  4F2S A;  1KDH A;  4Z6E A;  4F4W A;  4KLE A;  2AGO A;  2Y1J A;  5KFC A;  4QWC A;  3SV4 A;  4FO6 A;  3ZDB A;  4EZ9 A;  2BDP A;  4IRK A;  2VAN A;  4DL7 A;  4R8U B;  5III A;  1UT5 A;  1RZT A;  2DPI A;  2UVU A;  3M9O B;  1NK7 A;  4BXO B;  4QW9 A;  5HP4 A;  3Q8K A;  4C8K A;  4O5C A;  5KFZ A;  9ICN A;  4LVS A;  3JPS A;  1LB2 B;  4B9S A;  1XSL A;  4PHE A;  9ICT A;  2ZUC A;  5DB8 A;  2BQR A;  5J0O A;  4MFC A;  2HHT A;  1SKW A;  4O3P A;  4DQR A;  4ECZ A;  3GIL A;  3BQ2 A;  4ECV A;  5L1I A;  4KLT A;  2AGP A;  1ZQN A;  4YD1 A;  4ECX A;  3K75 D;  1ZQQ A;  4DOB A;  3H4B A;  3JPR A;  4B9M A;  4KN7 A;  4RU9 A;  4YR2 A;  4ED6 A;  1S0N A;  4YD2 A;  1BPX A;  4DLE A;  3EW9 A;  3PV8 A;  2C2R A;  5DDY A;  3GV5 B;  2ALZ A;  4NLK A;  2W9A A;  4I2J A;  4DS5 A;  3SYZ A;  5IIK A;  4F4X A;  5DGA A;  5J0U A;  3ETL A;  5JUM A;  1S10 A;  4FBT A;  2AGQ A;  3ISB A;  4TQS A;  2ASL A;  3MR2 A;  4DFM A;  3EZ5 A;  5IIJ A;  1Z00 A;  1NK6 A;  1H38 A;  4ELU A;  3GII A;  5DG7 A;  1Y88 A;  5KFJ A;  2W9B A;  4NM1 A;  2WTF A;  3RH4 A;  5KG0 A;  2BQ3 A;  2JEG A;  3RRH A;  5KG2 A;  5J2D A;  2R8I A;  4G3I A;  2B21 A;  4DFK A;  4O5K A;  3MDA A;  9ICP A;  1MC8 A;  5KFR A;  1RXV A;  4UBC A;  2NRX A;  3ORY A;  4KLH A;  1ZQD A;  1SZP A;  4KLS A;  4RQ1 A;  1ZQT A;  9ICC A;  3G6Y A;  2BR0 A;  4YR0 A;  3PNC A;  5KFT A;  4I2C A;  1TV9 A;  1JX4 A;  4F5N A;  4KLG A;  4YVZ A;  8ICL A;  3ZD8 A;  3JPP A;  5KFY A;  3THV A;  5KT5 A;  4I2A A;  2XGQ A;  4O3Q A;  3PR4 A;  5D4B A;  1HUO A;  4J9O A;  1ZQV A;  5D46 A;  4JWM A;  3PW2 A;  2W9B B;  1ZQR A;  1XC9 A;  4KLO A;  4KLJ A;  4DL2 A;  3H8J A;  7ICJ A;  2W9M A;  5J0R A;  3Q8M A;  1N56 A;  3RH5 A;  4QZA A;  2UVR A;  4B9L A;  4YMO A;  3V72 A;  3MBY A;  2HHU A;  1NK8 A;  5KFF A;  3JPT A;  4I28 A;  2XC9 A;  3G6X A;  1K1Q A;  2I1Q A;  1C7Y A;  2ZTE A;  2Y1I A;  2W9C B;  9ICE A;  4JK1 A;  1KRP A;  1JIH A;  4XUS A;  4DWI A;  3OGU A;  3QZ8 A;  2BQU A;  3TAQ A;  4RQ5 A;  4EBC A;  4E0D A;  9ICI A;  1ZQK A;  3RJE A;  5KFB A;  2HHS A;  4F93 B;  4YN4 A;  2IMW P;  4DQP A;  1QSY A;  4O5E A;  5CJ7 A;  3AUO A;  4F92 B;  4DL5 A;  5HML A;  8ICH A;  4IQV A;  1NK9 A;  2IA6 A;  4ECU A;  4Z6C A;  2PXI A;  4YP3 A;  1EXN A;  1NJY A;  3RJI A;  5J2K A;  3K4G A;  5DB6 A;  2ZUB A;  5KG3 A;  3C2L A;  2XY6 A;  2C28 A;  4IR1 A;  9ICW A;  5HNK A;  3Q8L A;  1S0V A;  2R8J A;  4IRD A;  4QWA A;  4DSI A;  4O3O A;  3V6H A;  1TAU A;  4ECY A;  2FPL A;  3NGD A;  7ICI A;  4RUC A;  5KFN A;  4F91 B;  4M0A A;  1S9F A;  3C21 A;  2PFQ A;  1X2I A;  1D9D A;  4ECT A;  3KTQ A;  3IHQ B;  4BGD A;  4ED0 A;  1NKE A;  3PR5 B;  2VA3 A;  1ZQX A;  5CA7 A;  4DQQ A;  3TI0 A;  8ICB A;  4F4K A;  1ZQI A;  4LZG A;  7ICU A;  1D8L A;  1SKR A;  1ZQH A;  4RPX A;  4PGQ A;  4R63 A;  4MEY A;  1XSP A;  3GFK B;  5DBC A;  5DQG A;  5KT7 A;  3TAR A;  4DSJ A;  3RJK A;  8ICP A;  9ICH A;  3UQ2 A;  4O3N A;  3PW7 A;  3JPO A;  1RYR A;  3UPQ A;  4NM2 A;  1CUK A;  4PHD A;  1QSS A;  1ARO P;  3V6J A;  3FYH A;  8ICI A;  3QEA Z;  4Z6F A;  4F5Q A;  2FLL A;  4XA5 A;  9ICR A;  2BPF A;  3M9N B;  4QZH A;  3PVX A;  3MGI A;  4FS1 A;  4X5V A;  1ZQL A;  8ICV A;  4F4Z A;  4I2E A;  1ZQF A;  4C8O A;  3V7L A;  4ECQ A;  4Z6D A;  4DSL A;  1MQ2 A;  4KLI A;  8ICK A;  2FLP A;  1KFD A;  4RNN A;  3GIJ A;  3ZDD A;  4DQI A;  8ICS A;  9ICL A;  4PHA A;  5DB9 A;  2C2E A;  5J0W A;  4NLZ A;  4J9K A;  4F8R A;  1Z3E B;  1L3S A;  3T3F A;  4F5R A;  5J0S A;  4R64 A;  4ED2 A;  3N97 B;  2J6U A;  3MGH A;  4UAZ A;  2MAX A;  1V9P A;  2ZJ8 A;  4P4O A;  5HHI A;  5L1L A;  4I2G A;  4LZD A;  2BCU A;  4TUR A;  1ZQA A;  5HHH A;  2BPC A;  4ZH4 A;  5IIO A;  1U47 A;  4KLF A;  2FPM A;  3MFI A;  1ZQP A;  2BPG A;  2JEJ A;  4KLM A;  5CP2 A;  2NRW A;  4M9G A;  5KG1 A;  3Q8Q B;  4KLD A;  4KMU A;  4ELV A;  3T5J A;  4M9N A;  4XRH A;  2ATL A;  1QTM A;  3C1Z A;  4I2H A;  7ICP A;  3BQ1 A;  4DFJ A;  1T8E A;  3NTU A;  2F1H A;  3BQT A;  3MR6 A;  3PW0 A;  5DBB A;  2FPK A;  2HHW A;  9ICK A;  1LV5 A;  4MF8 A;  5EWF A;  2MUT A;  4EBE A;  3RJG A;  4O9M A;  4ECW A;  4DSF A;  2ASJ A;  4YFK A;  3JPQ A;  4EBD A;  4RT3 A;  1ZQE A;  4DL4 A;  5D49 A;  3TAP A;  1XWL A;  3V7K A;  2XO7 A;  1SL0 A;  3UQ0 A;  3C1Y A;  4I2F A;  3KHL A;  4J9P A;  4J9N A;  7ICH A;  7ICF A;  4HYK A;  1BPB A;  3KHG A;  1SL2 A;  4I29 A;  4RT2 A;  2FMS A;  3N4M B;  1L3T A;  1JXL A;  4J9S A;  4DS4 A;  2BKE A;  1QSL A;  8ICQ A;  4QWE A;  4DF8 A;  2FMP A;  5DLF A;  4DEZ A;  5J0X A;  5KFV A;  3T5H A;  1KSP A;  2PFN A;  5J2H A;  5KFP A;  3HW8 A;  2PI4 A;  3H7I A;  9ICS A;  5KG5 A;  3HWT A;  4YR3 A;  4K4H A;  3HT3 A;  1MSW D;  4EYI B;  4R66 A;  1RYS A;  5J2C A;  1TAQ A;  2XCA A;  4FS2 A;  4PHP A;  4QZC A;  5DQH A;  1Z00 B;  4PH5 A;  3T5K A;  3OJU A;  4QZI A;  1BPE A;  5KFG A;  1NK5 A;  2V4R A;  1L5U A;  4UB2 A;  4DSK A;  1KFS A;  4PGY A;  4ED7 A;  1PZN A;  3OSP A;  1RPL A;  3RRG A;  4IQW A;  2IHM A;  8ICX A;  5CR0 A;  4DOC A;  2RDJ A;  5KFX A;  1X9S A;  2R8H A;  3C5F A;  2AJQ A;  3RBE A;  4C8L A;  5J0T A;  4ED8 A;  1DOQ A;  5KT6 A;  2F1J A;  4JV1 A;  2RDI A;  5KFE A;  5KG7 A;  1IM4 A;  1T4G A;  1L3V A;  9ICO A;  2A1J A;  4NXZ A;  4YXJ A;  2J6S A;  1RXW A;  3GIM A;  4TUP A;  4JV0 A;  3LDA A;  4KLQ A;  4Q8F A;  4YCX A;  3QE9 Y;  5EWE A;  1ZQZ A;  1S76 D;  5EOZ A;  3MFH A;  4K4I A;  3LWL A;  1N48 A;  4RQ2 A;  4XQ8 A;  2XCP A;  5L1J A;  4Q45 A;  4Q43 A;  1U4B A;  3Q8R B;  2F1I A;  5J2I A;  5IIM A;  2KTQ A;  4MF2 A;  4RNO A;  4UAY A;  1X9W A;  4PPX A;  4GXI A;  2PFO A;  7ICV A;  3GV8 B;  4DO9 A;  1BPZ A;  2J6T A;  1K1S A;  3KHR A;  4B9U A;  7ICQ A;  4DQS A;  8ICT A;  1B43 A;  2XY7 A;  4NLG A;  4M2Y A;  2BCQ A;  5KFU A;  4UB1 A;  4QWB A;  8ICM A;  1NJW A;  5KFQ A;  1ZET A;  4GC7 A;  5KFH A;  2ZJA A;  5TZV A;  4M47 A;  4DL3 A;  4ED3 A;  1NKB A;  4J9M A;  1D9F A;  5BPC A;  1SKS A;  2UVW A;  2ASD A;  2HVI A;  1NKC A;  5KFS A;  1NJZ A;  2HW3 A;  4YG2 A;  3UXO A;  5J2B A;  5KFI A;  4MEX A;  5DG9 A;  1NOM A;  1ZJN A;  2NRZ A;  2ZTD A;  4I27 A;  3EPI A;  3TQ1 A;  3M9M B;  3RB0 A;  1NJX A;  5BOM A;  1ZJM A;  1ZQM A;  4M6W A;  5KFK A;  3RBD A;  3PO5 A;  4I2B A;  2M9N A;  4J9R A;  2KZM A;  2R8G A;  1ZQY A;  1XS9 D;  2IHN A;  3T5L A;  3PX0 A;  3MR5 A;  3C2M A;  2H5X A;  5J0P A;  4QWD A;  4PGX A;  7ICM A;  3M8R A;  4F5P A;  2XY5 A;  3HP6 A;  4QZ9 A;  5KTQ A;  3PW5 A;  2DPJ A;  5DDM A;  1KTQ A;  2PFP A;  3TFS A;  3UXN A;  2AQ0 A;  4TQR A;  1U9L A;  1U48 A;  1XU4 A;  4M9J A;  5DGB A;  4I2I A;  4FBU A;  4DOA A;  2FMQ A;  1TK8 A;  2ISP A;  2VA2 A;  2C22 A;  4M9H A;  2IBK A;  5IIN A;  4MFF A;  3PML A;  1KLN A;  3FDS A;  1COO A;  4F5O A;  3RH6 A;  3ZD9 A;  4ELT A;  4QZB A;  4DFP A;  3ZDE A;  5J0Y A;  4KLU A;  7ICR A;  4K4G A;  3ISD A;  9ICV A;  8ICU A;  4EZ6 A;  2KZ3 A;  4BWJ A;  1JN3 A;  4RNM A;  1XO1 A;  4DL6 A;  2P6U A;  4F3O A;  2DFL A;  5DB7 A;  5J29 A;  4ECS A;  8ICY A;  1ZQO A;  8ICW A;  1KFT A;  1ZQB A;  4C8N A;  3PY8 A;  4IQT A;  3E2E A;  3V6K A;  9ICG A;  5KG4 A;  2FLN A;  5F9L A;  3V7J A;  5DLG A;  1NK4 A;  3MDC A;  2ISO A;  4NY8 A;  5KFL A;  1S0O A;  9ICJ A;  4M9L A;  2R8K A;  2LYH A;  3LWM A;  1IXR A;  2UVV A;  5KFO A;  1L3U A;  5CHG A;  3UXP A;  2KN7 A;  4J9L A;  1QLN A;  3IM1 A;  4UB5 A;  2W8K A;  4DLG A;  3C5G A;  9ICB A;  4CCH A;  3PO4 A;  4TUS A;  4R65 A;  4ED1 A;  3RTV A;  4JV2 A;  7ICL A;  4RQ7 A;  3JPN A;  1U49 A;  4YQW A;  3RJF A;  5KT4 A;  5L1K A;  4ECR A;  3EYZ A;  1BPD A;  1ZQJ A;  9ICM A;  3B0Y A;  3HX0 A;  2V4Q A;  4JWN A;  4RPZ A;  1MQ3 A;  2MUT B;  4GXJ A;  1BPY A;  2AQ4 A;  2NRV A;  1TFR A;  5HMM A;  1CEZ A;  4P2H A;  4IRC A;  1JXE A;  2V9W A;  3ISC A;  5J2G A;  3RAX A;  2I9G A;  5DQI A;  1ZQS A;  4RQ3 A;  1S0M A;  2HVH A;  5KT3 A;  3EWA A;  2ZUD A;  4C8M A;  4O0I A;  4P4P A;  3PMN A;  3H8W A;  4QW8 A;  1JMS A;  1ZQU A;  4RQ0 A;  2GWS A;  2W9C A;  4JUZ A;  4QZ8 A;  1TVA A;  4UQG A;  7ICN A;  1ZQW A;  4YMM A;  2HHV A;  1ZQG A;  1ZQC A;  1X9M A;  1S77 D;  2BHN A;  3Q8P B;  3C2K A;  4RZR A;  3ZDA A;  4B9N A;  9ICX A;  8ICR A;  3QEB Z;  4GLX A;  3H40 A;  1XSN A;  4O3R A;  3GQC A;  3BDP A;  2P6R A;  2KFN A;  5DBA A;  4YXM A;  3BJY A;  5BOL A;  4F50 A;  2BCS A;  4QZF A;  3C23 A;  3MAB A;  3LK9 A;  1SL1 A;  4F2R A;  3G6V A;  3RR7 A;  2P66 A;  5KFA A;  3PX4 A;  1HUZ A;  1T7P A;  3OJS A;  5CWR A;  1A77 A;  1KEJ A;  1UA0 A;  1NK0 A;  4B9T A;  4O3S A;  4EEY A;  3QZ7 A;  5CB1 A;  3SV3 A;  4DF4 A;  2BCV A;  5DG8 A;  3RAQ A;  2HHX A;  3OSN A;  9ICA A;  2JZB A;  5KT2 A;  1B22 A;  2VA8 A;  4QZG A;  4Q44 A;  3EPG A;  5J2J A;  4M04 A;  4TUQ A;  5J2E A;  5KFW A;  4UBB A;  3ZDC A;  2JEI A;  8ICZ A;  1S97 A;  3GV7 B;  3TAN A;  2NRT A;  7ICK A;  5IIL A;  8ICO A;  1A76 A;  1WCN A;  1HJP A;  8ICC A;  4IQU A;  4YMN A;  3KHH A;  2W8L A;  4B9V A;  3Q8S B;  4QZD A;  4BWM A;  1T3N A;  7ICG A;  2A1J B;  4UAW A;  5KFM A;  8ICG A;  4RPY A;  3RR8 A;  3GIK A;  2BCR A;  9ICQ A;  3H8S A;  3TFR A;  4GXK A;  3BQ0 A;  3RB4 A;  3RJH A;  4RQ4 A;  5L9X A;  1UA1 A;  4KN4 A;  3HPO A;  5J2F A;  5J0Q A;  3H4D A;  2JZB B;  2ZJ5 A;  4GC6 A;  2BGW A;  3RB3 A;  3PW4 A;  3GDX A;  3SZ2 A;  4KIT B;  4J9Q A;  2OWO A;  4Q8E A;  3SI8 A;  2KZZ A;  5J2A A;  8ICA A;  1ZYQ A;  1U45 A;  2ZTC A;  4KTQ A;  7ICO A;  7ICT A;  1WCL A;  5DKW A;  8ICJ A;  4EYH B;  4KLL A;  4QZE A;  5EWG A;  2KFZ A;  4UB3 A;  1TKD A;  5C5J A;  4NLN A;  4P4M A;  4UB4 A;  4R8U A;  1D8Y A;  3M8S A;  4BXO A;  2AU0 A;  4BDP A;  9ICU A;  1TK0 A;  4I2D A;  3RB6 A;  9ICF A;  3MR3 A;  3OHA A;  4RQ6 A;  3RJJ A;  2Q0Z X;  4MFA A;  4RQ8 A;  8ICE A;  4DSE A;  2JEF A;  8ICF A;  1BVS A;  1BGX T;  1UT8 A;  7ICE A;  5KG6 A;  8ICN A;  4IR9 A;  3B0X A;  7ICS A;  2HHQ A;  4RUA A;  2PI5 A;  3OHB A;  4F4Y A;  2C2D A;  3AU6 A;  2XGP A;  5F9N A;  1DGS A;  5KFD A; 
#chains in the Genus database with same CATH topology
 4F2S A;  4Z6E A;  5GTI U;  2Z7J A;  2DPI A;  1UT5 A;  4QW9 A;  3Q8K A;  4O5C A;  4G9B A;  1XSL A;  1BNP A;  5DB8 A;  5J0O A;  1UHU A;  2KE7 A;  4ECZ A;  4KLT A;  3DEE A;  1ZQ1 C;  3K75 D;  2CXY A;  4B9M A;  1N5W A;  1BPX A;  4NLK A;  4NL9 C;  5IIK A;  3ETL A;  3ISB A;  2ASL A;  3MR2 A;  1OUQ A;  1H38 A;  4ELU A;  3GII A;  2WTF A;  2BQ3 A;  2VKQ A;  4C7Z A;  5AHX A;  5KG2 A;  2LPE A;  4OJ5 A;  9ICP A;  3ORY A;  4KLH A;  4KLS A;  3QU7 A;  2BR0 A;  3PNC A;  4NV0 A;  4QNL A;  2E3T A;  1TV9 A;  1FIQ A;  4KLG A;  8ICL A;  3JPP A;  5KFY A;  5KT5 A;  2XGQ A;  2LHT A;  2QB1 A;  1HUO A;  4JWM A;  2DUY A;  4J9O A;  1ZQV A;  4P0Q B;  3WK9 A;  2W9B B;  4KLO A;  4KLJ A;  2H3V A;  2W9M A;  3RH5 A;  4QZA A;  2UVR A;  1NK8 A;  3G6X A;  3BS5 A;  1K1Q A;  2I1Q A;  2W9C B;  4XUS A;  4DWI A;  9ICI A;  4J03 A;  1ZQK A;  2OM6 A;  2KK0 A;  2IMW P;  4DQP A;  1QSY A;  5CJ7 A;  4EEL A;  4DL5 A;  4ECU A;  4Z6C A;  2FE9 A;  2WFA A;  3RJI A;  5ALV A;  2ZUB A;  9ICW A;  3QU2 A;  3Q8L A;  2YN4 A;  4US9 A;  4Y2T A;  3V6H A;  1FFU A;  7ICI A;  4RUC A;  3QX7 A;  4F91 B;  5KFN A;  1SWV A;  4PL2 A;  2W55 A;  5ALF A;  4OJO A;  1Z4O A;  2VA3 A;  2YB1 A;  4F4K A;  1ZQI A;  4RPX A;  4R63 A;  5DBC A;  3QUB A;  5ALD A;  3TAR A;  9ICH A;  2FDR A;  3JPO A;  1CUK A;  1SIJ A;  4PHD A;  4C0Z A;  3FYH A;  2FLL A;  9ICR A;  1LVH A;  3M9N B;  4X5V A;  3VCB A;  2W04 A;  2FLP A;  2HBJ A;  1KFD A;  4PZO A;  3N7S C;  4RNN A;  3ZDD A;  9ICL A;  4PHA A;  1L7P A;  1YZ6 A;  2JH1 A;  4J9K A;  4F8R A;  1Z3E B;  1CRX A;  2EQY A;  4ED2 A;  4UAZ A;  2ZJ8 A;  3SD7 A;  3HJE A;  5HHI A;  2EAP A;  4TUR A;  1JAL A;  1U47 A;  2BPG A;  2E8P A;  5CP2 A;  5ALQ A;  4M9G A;  4CE6 A;  1CI4 A;  5TIS U;  2KJ9 A;  1T8E A;  3NTU A;  3MR6 A;  2BDU A;  9ICK A;  3RJG A;  2FI1 A;  4RT3 A;  2PMZ F;  5JTI A;  4QIW C;  2XO7 A;  3UQ0 A;  4HYK A;  4NLC A;  4NLB A;  4I29 A;  4RT2 A;  3N4M B;  4KX5 A;  4J9S A;  8ICQ A;  2QB0 A;  1O08 A;  4DF8 A;  1GO3 F;  3HW8 A;  9ICS A;  3H7I A;  4K4H A;  3ED5 A;  1MSW D;  4R66 A;  1PK1 A;  1RYS A;  2KD1 A;  3E58 A;  4FS2 A;  2AHO B;  2JXJ A;  1BPE A;  2K4P A;  4UB2 A;  1KFS A;  3OSP A;  3RRG A;  1UPH A;  2JV3 A;  3GU3 A;  3IV6 A;  5FP0 A;  2IHM A;  8ICX A;  2LMR A;  1S8O A;  4ED8 A;  3F2D A;  3SMV A;  1UCV A;  1L3V A;  4NXZ A;  2WHE A;  2J6S A;  4TUP A;  2EAN A;  2KIV A;  4OJ6 A;  4YCX A;  3LWL A;  5L1J A;  3Q8R B;  5IIM A;  2KTQ A;  1X9W A;  4PPX A;  7ICV A;  3GV8 B;  1K1S A;  4B9U A;  2KVS A;  4M2Y A;  8ICM A;  5KFQ A;  1F5S A;  5TZV A;  4DL3 A;  4ED3 A;  1NKB A;  1X66 A;  4J9M A;  2EAO A;  2UVW A;  1SKS A;  2KNJ A;  1NJZ A;  2HW3 A;  3UXO A;  5AM4 A;  5DG9 A;  3RB0 A;  1NJX A;  3MGV A;  2WB1 F;  1ZQM A;  3C29 A;  5KFK A;  4J9R A;  1ZQY A;  4EX7 A;  3PX0 A;  5J0P A;  4F5P A;  2DPJ A;  1Q8K A;  5DDM A;  1U9L A;  1SZH A;  4FBU A;  2FMQ A;  2VA2 A;  2C22 A;  4M9H A;  3DDH A;  1COO A;  4F5O A;  3QUT A;  3ZD9 A;  4QZB A;  4DFP A;  4ELT A;  4KLU A;  4EZ6 A;  4RNM A;  2P6U A;  2LI6 A;  1PUZ A;  2G5H B;  5AM3 A;  5AI4 A;  4IQT A;  3V6K A;  9ICG A;  3H0R B;  1O03 A;  5DLG A;  3BZK A;  3OTQ A;  9ICJ A;  1IXR A;  3UXP A;  1ECW A;  1QQ6 A;  4UB5 A;  2W8K A;  5ALK A;  9ICB A;  4CCH A;  5ALR A;  4UB8 U;  3D2N A;  4RQ7 A;  1U49 A;  5AKZ A;  1J97 A;  2EZZ A;  4JWN A;  1WWU A;  1WUD A;  2AQ4 A;  1CEZ A;  1TFR A;  2V9W A;  3RAX A;  5DQI A;  1ZQS A;  1S0M A;  4BUG A;  2WF9 A;  2B6G A;  4O0I A;  3PMN A;  3H8W A;  2E8N A;  1ZQU A;  3BQ7 A;  4C4T A;  2W9C A;  1TVA A;  7ICN A;  1V97 A;  4Y2P A;  5AI5 A;  2BHN A;  3WKC A;  3QEB Z;  1LKY A;  3IG8 A;  2YMM A;  4Y2R A;  2QLT A;  2BCS A;  2VIX A;  5G5G A;  3C23 A;  5KFA A;  1HUZ A;  1T7P A;  2I6X A;  1KEJ A;  2OYY A;  4O3S A;  2HHX A;  3OSN A;  9ICA A;  2YML A;  2JRZ A;  5AKK A;  4MHV A;  4M04 A;  2CPR A;  4TUQ A;  4UBB A;  3TKA A;  1S97 A;  3TAC B;  1Z1B A;  4B9V A;  7ICG A;  1T3N A;  2K8B B;  4UAW A;  4FE3 A;  4RPY A;  3TFR A;  2ZIU A;  4RQ4 A;  1L7N A;  4KN4 A;  4JB3 A;  5J0Q A;  2JZB B;  4C7Y A;  3PW4 A;  5AKG A;  3SZ2 A;  4J9Q A;  2OWO A;  2KZZ A;  3SI8 A;  5ALP A;  2ZTC A;  7ICO A;  2RP5 A;  4C4R A;  8ICJ A;  3KBB A;  5CEH A;  4QZE A;  4UB3 A;  1TKD A;  4P4M A;  4BXO A;  9ICU A;  1TK0 A;  1ZOL A;  9ICF A;  3OHA A;  3RJJ A;  8ICE A;  4DSE A;  1UT8 A;  1YT3 A;  2PI5 A;  5AK6 A;  4F4Y A;  2C2D A;  2GO7 A;  1KL9 A;  3PX6 A;  1RQL A;  4F4W A;  3SEN A;  2RRD A;  2YQE A;  4R8U B;  1NK7 A;  3LVW A;  5EE3 A;  1TE2 A;  9ICN A;  3JPS A;  1LB2 B;  2ZUC A;  3TAD A;  2MA1 A;  4DQR A;  4EEN A;  3BQ2 A;  4ECV A;  4YD1 A;  1ZQQ A;  4DOB A;  3H4B A;  1Z4N A;  4RU9 A;  4CF5 A;  1S0N A;  1X6J A;  3EW9 A;  2C2R A;  4DS5 A;  3SYZ A;  5DGA A;  2D6F C;  5J0U A;  2EH9 A;  2AGQ A;  4PL1 A;  4TQS A;  4DFM A;  3WK6 A;  5DG7 A;  5AM1 A;  3RRH A;  4O5K A;  3MDA A;  1MC8 A;  5KFR A;  1Z1V A;  4UBC A;  1ZQD A;  4RQ1 A;  9ICC A;  4YR0 A;  4I2C A;  1PK3 A;  2W7P A;  4YVZ A;  3THV A;  4I2A A;  2F3N A;  1ZQR A;  1XC9 A;  4DL2 A;  1V85 A;  7ICJ A;  3Q8M A;  2WB1 C;  3QU5 A;  2HHU A;  5KFF A;  3JPT A;  4I28 A;  1C7Y A;  9ICE A;  3OGU A;  2BQU A;  3TAQ A;  4RQ5 A;  4EBC A;  2H3I A;  4F93 B;  2K8A A;  4FFD A;  2HDO A;  3D2Q A;  4F92 B;  4IQV A;  1NK9 A;  4EX6 A;  2EZY A;  2ODG A;  3FAH A;  5J2K A;  2XY6 A;  4O3M A;  3CP8 A;  2R8J A;  4O3O A;  4ECY A;  1WG8 A;  4NJ8 A;  4M0A A;  2ZIW A;  1S9F A;  3C21 A;  2PFQ A;  1A6S A;  2W54 A;  4A8E A;  5AI0 A;  2JMG A;  4BGD A;  4FZN A;  4ED0 A;  1SB3 C;  3WK4 A;  3WKB A;  3PW7 A;  8ICI A;  2L5Y A;  3V6J A;  1RM6 C;  3N7P D;  4Z6F A;  4F5Q A;  2YX8 A;  2IOF A;  4DFD A;  4Y2Y A;  4C8O A;  4ECQ A;  3GIJ A;  3RFA A;  4DQI A;  4UW9 A;  3H0L B;  2C2E A;  5J0W A;  4NLZ A;  3T3F A;  4F5R A;  4R64 A;  1ED1 A;  3OPX A;  3MGH A;  2MAX A;  1V9P A;  5L1L A;  4I2G A;  1PVR A;  2BCU A;  1ZQA A;  3IP4 B;  5HHH A;  2BPC A;  4F71 A;  3MFI A;  1ZQP A;  2JEJ A;  2NRW A;  4WJ3 B;  2ZIX B;  4KLD A;  4KMU A;  2K4I A;  3T5J A;  4ELV A;  4M9N A;  2ATL A;  3C1Z A;  7ICP A;  5L1M A;  2F1H A;  3BQT A;  1SXE A;  2D8C A;  1JUD A;  4EBE A;  4O9M A;  4ECW A;  1PVP A;  2ZG6 A;  3CNH A;  2ASJ A;  1Q3V A;  4DL4 A;  5D49 A;  3TAP A;  1SL0 A;  3KHL A;  4J9N A;  7ICH A;  7ICF A;  4P0P A;  1BPB A;  4CF4 A;  2ESE A;  2RLT A;  1JXL A;  4DS4 A;  4QWE A;  1F0M A;  5DLF A;  4DEZ A;  5KFV A;  1KSP A;  2BZF A;  2DKZ A;  4YR3 A;  3K1Z A;  5AIA A;  2XCA A;  4QZC A;  2G09 A;  3WK7 A;  3OJU A;  5AIB A;  5KFG A;  1NK5 A;  4DSK A;  4PGY A;  4ED7 A;  5JU5 A;  4IQW A;  2WF5 A;  2RDJ A;  3C5F A;  2JGA A;  2AJQ A;  3WKE A;  3RBE A;  4C8L A;  3IRU A;  5KT6 A;  5KFE A;  2YB4 A;  1IM4 A;  1KKX A;  1T4G A;  4YXJ A;  3GIM A;  3LDA A;  4KLQ A;  5EWE A;  3H0M B;  3S6J A;  2XCP A;  3AQE A;  5AKJ A;  1JRO A;  4Q43 A;  2F1I A;  5T14 A;  2PFO A;  2DF4 B;  3T79 A;  2BCQ A;  4QWB A;  4PZN A;  2I5H A;  2ZJA A;  4M47 A;  2XI9 A;  2A3V A;  2M0N A;  2AH5 A;  1ZJN A;  2NRZ A;  3M9M B;  1MN8 A;  5EE0 A;  1L8L A;  3PO5 A;  1XS9 D;  3C2M A;  2LYB A;  4QWD A;  7ICM A;  2XY5 A;  2PFP A;  2HCF A;  1V38 A;  4TQR A;  1U48 A;  1XU4 A;  4M9J A;  5DGB A;  3PST A;  4I2I A;  4DOA A;  3AL0 B;  2EZX A;  2CN1 A;  4MFF A;  2K8C B;  3I1Y A;  4UAR A;  1HEK A;  1N60 A;  3ISD A;  9ICV A;  1X40 A;  2F8K A;  8ICY A;  1ZQO A;  2XIC A;  3IG5 A;  3B9J A;  5F9L A;  3V7J A;  1NK4 A;  3MDC A;  1S0O A;  2R8K A;  2LYH A;  1PVQ A;  2NO4 A;  5ALL A;  4DLG A;  2GLE A;  3U26 A;  3SAG A;  5ALI A;  4ED1 A;  3RTV A;  3JPN A;  3QXG A;  1YZ7 A;  1ZQJ A;  1BPD A;  3B0Y A;  3L4P A;  4RPZ A;  2E5S A;  2MUT B;  3BS7 A;  4GXJ A;  2KHQ A;  4IRC A;  5GTH U;  3ISC A;  2I9G A;  2HVH A;  2ZUD A;  2KKV A;  4C8M A;  1NZB A;  4NWI A;  4RQ0 A;  2GWS A;  4JUZ A;  4UQG A;  2ZIV A;  1D8B A;  1S77 D;  3KKA A;  4RZR A;  3QYP A;  8ICR A;  3NVZ A;  4OJP A;  1XSN A;  3BDP A;  2P6R A;  4YXM A;  5BOL A;  1B0X A;  3MAB A;  1SL1 A;  4F2R A;  3G6V A;  3PX4 A;  3OJS A;  1L7O A;  5CWR A;  4B9T A;  4DF4 A;  5CB1 A;  2G0A A;  1B22 A;  3BZC A;  2PKE A;  2KHV A;  2VJ5 A;  2VA8 A;  8ICZ A;  5J2E A;  2G08 A;  3TAN A;  7ICK A;  8ICO A;  1A76 A;  1HJP A;  4IQU A;  4Y2X A;  2W8L A;  3Q8S B;  2Y9U A;  4BWM A;  5KFM A;  8ICG A;  3AM9 A;  9ICQ A;  2MRL A;  3H8S A;  4GXK A;  3RJH A;  3MC1 A;  4OCZ A;  5AM5 A;  3H4D A;  3D6J A;  4GC6 A;  4DCC A;  2JH7 A;  3RB3 A;  3UMC A;  2B0C A;  1U45 A;  1N5X A;  1WCL A;  4EYH B;  4KLL A;  5EWG A;  3D2S A;  5C5J A;  4BDP A;  1D8Y A;  2Q0Z X;  4MFA A;  1X6I A;  5AKX A;  3I76 A;  3B0X A;  2HHQ A;  5ALU A;  3M6Z A;  2HI0 A;  5EE9 A;  3AU6 A;  4M6W B;  1TK5 A;  1IV8 A;  2QAR B;  4KLE A;  2AGO A;  2Y1J A;  5KFC A;  4QWC A;  3SV4 A;  1L6N A;  3ZDB A;  4IRK A;  5III A;  1SV0 A;  2UVU A;  4C8K A;  5KFZ A;  1P7D A;  4LVS A;  4B9S A;  4PHE A;  1RDF A;  2HHT A;  1QH9 A;  5L1I A;  4Y2V A;  4ECX A;  3L5K A;  3ONN A;  2AXT U;  4KN7 A;  4ED6 A;  4DLE A;  3PV8 A;  5DDY A;  2ALZ A;  4I2J A;  1MA7 A;  4CRX A;  5JRT A;  2KOB A;  4UAT A;  4P0Q A;  5IIJ A;  1NK6 A;  4UAU A;  1Y88 A;  5KFJ A;  2W9B A;  3RH4 A;  3QU9 A;  5J2D A;  2HBM A;  1X42 A;  2R8I A;  2B21 A;  4DFK A;  2K4E A;  2OHF A;  2XVT A;  3SAF A;  1SZP A;  2YMP A;  1KBU A;  3G6Y A;  2WAQ F;  5KFT A;  2MU2 A;  1JX4 A;  1DXS A;  3A0H U;  3IN5 A;  5J0R A;  2YY6 A;  2XC9 A;  2KJ5 A;  2LKY A;  2ZTE A;  2Y1I A;  4JK1 A;  1JIH A;  3RJE A;  2HHS A;  2F44 A;  4YN4 A;  3QUQ A;  3R9K A;  3AUO A;  4Y2U A;  2EDU A;  5HML A;  8ICH A;  2IA6 A;  3IDW A;  1NJY A;  1EXN A;  3K4G A;  5KG3 A;  3C2L A;  2C28 A;  5HNK A;  5ALG A;  4QWA A;  1TAU A;  3BS5 B;  3TAD C;  3NGD A;  2NV3 A;  2WF8 A;  5KL1 B;  2F77 X;  1X2I A;  1D9D A;  3KTQ A;  3IHQ B;  3UMG A;  4DQQ A;  3TI0 A;  1SKR A;  1ZQH A;  2HBK A;  4FZM A;  1XSP A;  5KT7 A;  4DSJ A;  3UQ2 A;  2KEY A;  4O3N A;  1A0P A;  4NM2 A;  2Q4T A;  2OXO A;  5ALW A;  3KFU F;  3QEA Z;  3PZP A;  3PVX A;  3MGI A;  5ALS A;  5AI8 A;  4DSL A;  4Z6D A;  3KZI U;  3F53 A;  4U6P A;  1SV4 A;  5AKI A;  3EUB 2;  2R18 A;  5J0S A;  2J6U A;  4GIB A;  5J8Y A;  2HOQ A;  4P4O A;  3KD3 A;  4ZH4 A;  2FPM A;  4KLM A;  5KG1 A;  2WF6 A;  2KVC A;  4XRH A;  1J2N A;  3PW0 A;  2P35 A;  2KSO B;  2N1R A;  2FPK A;  2HHW A;  1LV5 A;  5EWF A;  2MUT A;  4LJX A;  3L3F X;  4DSF A;  4IC9 A;  3JPQ A;  2OH2 A;  4BX9 C;  1XWL A;  3V7K A;  2DWQ A;  4J9P A;  3GZF A;  3I28 A;  3KHG A;  1L3T A;  5AKY A;  2PI4 A;  3T5H A;  5J2H A;  5KFP A;  4CGZ A;  5ALM A;  3K1R B;  2IOH A;  5J2C A;  2KIW A;  4PHP A;  2D3D A;  1Z00 B;  3T5K A;  2KIC A;  1L5U A;  4C80 A;  5C0Y A;  2K60 A;  1RPL A;  4DOC A;  5ALY A;  2F2A B;  3LVV A;  5KL8 B;  1T3Q A;  1PK1 B;  1NNL A;  2F1J A;  2RDI A;  5AK5 A;  4JV1 A;  5KG7 A;  2HBL A;  2E8M A;  3NVW A;  9ICO A;  1M6Y A;  2W43 A;  3QE9 Y;  3F2C A;  3MFH A;  3A0B U;  4XQ8 A;  4Q45 A;  1U4B A;  2O6K A;  1NI3 A;  4MF2 A;  1DK3 A;  4GXI A;  2W7O A;  2J6T A;  7ICQ A;  1ZD4 A;  4DQS A;  8ICT A;  1B43 A;  5KFU A;  1ZET A;  1D9F A;  2ASD A;  2HVI A;  2G06 A;  2HOF A;  3AMZ A;  1T94 A;  4MEX A;  1NOM A;  2FJ6 A;  2ZTD A;  3EPI A;  3TQ1 A;  4U7C A;  1ZJM A;  4M6W A;  3RBD A;  2M9N A;  3F2B A;  3HKZ F;  2EAM A;  3T5L A;  1TAM A;  3MR5 A;  2E1F A;  2H5X A;  4PGX A;  3M8R A;  4QZ9 A;  2AQ0 A;  4FZL A;  3WKD A;  4UAS A;  4UB6 U;  3NUQ A;  2ISP A;  3PSI A;  3SQI A;  4PJ0 U;  4ACO A;  2IBK A;  5IIN A;  1KLN A;  3FDS A;  3RH6 A;  7ICR A;  2WAQ C;  8ICU A;  1XO1 A;  4DL6 A;  4F3O A;  2DFL A;  3HRD D;  2ES6 A;  5J29 A;  4ECS A;  8ICW A;  1ZQB A;  4C8N A;  3PY8 A;  5AI6 A;  1N63 A;  3ICX A;  5KG4 A;  2ISO A;  4NY8 A;  3UMB A;  4M9L A;  1ZD2 P;  1Z19 A;  2UVV A;  5KFO A;  1DGJ A;  5H2F U;  5CHG A;  2KN7 A;  4J9L A;  1QLN A;  3IM1 A;  3SEI A;  1OW5 A;  2DBY A;  3C5G A;  7ICL A;  4JV2 A;  3LYS A;  3N28 A;  4ECR A;  2V4Q A;  1MQ3 A;  5HR6 A;  2F76 X;  3WK8 A;  2NRV A;  5J2G A;  5EE1 A;  5K4L A;  4RQ3 A;  5KT3 A;  4P4P A;  4QW8 A;  1JMS A;  2DL0 A;  3SR6 A;  4EEK A;  4QZ8 A;  1X9X A;  5AIC A;  4YMM A;  2OEH A;  1ZQG A;  3AN1 A;  3Q8P B;  3ZDA A;  5AKL A;  2H3F A;  4GLX A;  3H40 A;  3GQC A;  5AKH A;  2KFN A;  3KZX A;  5DBA A;  3BJY A;  3LK9 A;  1QCK A;  3RF9 A;  3RR7 A;  2P66 A;  1IG6 A;  1A77 A;  1UA0 A;  1NK0 A;  4EEY A;  3QZ7 A;  2BCV A;  5DG8 A;  4NL9 A;  3RAQ A;  2JZB A;  1C20 A;  3ALR A;  4QZG A;  4Q44 A;  3EPG A;  5KFW A;  2MSN A;  1LKY B;  3GV7 B;  2NRT A;  5IIL A;  1WCN A;  2JR5 A;  2XID A;  4YMN A;  3KHH A;  4QZD A;  2A1J B;  3RR8 A;  3BQ0 A;  4OD0 A;  5L9X A;  1UA1 A;  1ZRM A;  3ZI4 A;  1L8O A;  2BGW A;  3N7R C;  3GDX A;  5KNI A;  5J2A A;  4KTQ A;  2KG5 A;  2E1E A;  2KFZ A;  4RQN A;  1COK A;  4UB4 A;  4R8U A;  3M8S A;  2ZXI A;  3QUC A;  2DKX A;  3MR3 A;  2ZIU B;  1BVS A;  1BGX T;  1KN5 A;  5KG6 A;  8ICN A;  2G07 A;  5KAF U;  1N62 A;  2ZXH A;  3AU2 A;  1KDH A;  2NO5 A;  5E79 U;  4FO6 A;  4AYB F;  4EZ9 A;  2BDP A;  2VAN A;  4DL7 A;  4BXO B;  2KSO A;  1RZT A;  3M9O B;  5HP4 A;  2Y0S F;  2W03 A;  3KKA C;  9ICT A;  2BQR A;  4MFC A;  2IOF K;  1SKW A;  4O3P A;  3GIL A;  5B66 U;  3NRZ A;  2AGP A;  3NRW A;  1ZQN A;  3M1Y A;  3JPR A;  4YR2 A;  4YD2 A;  3GV5 B;  2W9A A;  4F4X A;  5ALX A;  5JUM A;  1S10 A;  4FBT A;  3NAS A;  2CRX A;  1QQ5 A;  3EZ5 A;  1Z00 A;  5AM2 A;  1FEZ A;  4NM1 A;  5KG0 A;  2JEG A;  4US8 A;  2RQ5 A;  5B5E U;  3SAH A;  2H3Z A;  4G3I A;  3DV9 A;  1RXV A;  2NRX A;  1N61 A;  1ZQT A;  3AQF A;  4F5N A;  3ZD8 A;  2YTU A;  4O3Q A;  3PR4 A;  5D4B A;  2LBO A;  5D46 A;  3C28 A;  4CF3 A;  3PW2 A;  3H8J A;  2Y9T A;  1N56 A;  4USA A;  4B9L A;  1L7M A;  4YMO A;  3V72 A;  3MBY A;  4C4S A;  1RQN A;  1Q3U A;  3HKZ C;  3F5A A;  3M6K A;  1AQ6 A;  2KP7 A;  1KRP A;  3QZ8 A;  3O0F A;  4E0D A;  1ZRN A;  5KFB A;  3VC8 A;  4O5E A;  2PXI A;  4YP3 A;  2HSZ A;  1SV0 C;  5DB6 A;  4IR1 A;  1URJ A;  1S0V A;  4IRD A;  4DSI A;  2FPL A;  1WWV A;  4ECT A;  1ZXI A;  1NKE A;  1XNS A;  3PR5 B;  1VJ5 A;  2OCE A;  1ZQX A;  5CA7 A;  8ICB A;  1J2M A;  4LZG A;  7ICU A;  1D8L A;  4PGQ A;  4MEY A;  3GFK B;  5DQG A;  3RJK A;  8ICP A;  1RYR A;  3UPQ A;  1QSS A;  1ARO P;  4XA5 A;  2A1A A;  2BPF A;  4QZH A;  1ZQL A;  8ICV A;  4FS1 A;  2F8L A;  4UAV A;  2ZIW B;  4F4Z A;  4I2E A;  1ZQF A;  3V7L A;  4KLI A;  2DQN B;  1MQ2 A;  2ZIX A;  8ICK A;  8ICS A;  5DB9 A;  1L3S A;  4AP9 A;  3NVV A;  3N97 B;  3CYM A;  3WU2 U;  4LZD A;  5IIO A;  4KLF A;  2KJ8 A;  2NYV A;  3Q8Q B;  2A19 A;  5AK4 A;  2VJ4 A;  1QTM A;  5KAI U;  4I2H A;  3BQ1 A;  4DFJ A;  1RG6 A;  2G5I B;  5DBB A;  4MF8 A;  1UQV A;  4YFK A;  2DGZ A;  3J81 j;  4IS7 A;  3PSF A;  5G5H A;  4CDG A;  4EBD A;  1ZQE A;  1VLB A;  3CW2 C;  3C1Y A;  4I2F A;  1ZD5 A;  2KV2 A;  1SGG A;  1SL2 A;  2FMS A;  4HAI A;  3UM9 A;  4KX3 A;  2BKE A;  1QSL A;  2FMP A;  5J0X A;  2PFN A;  3NS1 A;  5KG5 A;  3PSP A;  3HWT A;  3HT3 A;  4QJF B;  4EYI B;  1TAQ A;  5ALJ A;  1OXJ A;  5DQH A;  4PH5 A;  4IL6 U;  3NVY A;  3F5E A;  4QZI A;  2V4R A;  4ICA A;  1PZN A;  4P0P B;  5CR0 A;  1X9S A;  5KFX A;  2R8H A;  2RHF A;  4RQM A;  5J0T A;  1DOQ A;  5ALO A;  2A1J A;  1RXW A;  4JV0 A;  3HIL A;  4Q8F A;  1ZQZ A;  1S76 D;  5EOZ A;  4K4I A;  5A0L A;  5J8Y C;  1N48 A;  4RQ2 A;  4CNQ A;  4AYB C;  1HIW A;  5J2I A;  5ALH A;  5HR7 A;  4RNO A;  4UAY A;  2HOI A;  4DO9 A;  1BPZ A;  3KHR A;  2Y0S C;  5AK3 A;  4BJQ A;  2XY7 A;  4NLG A;  4UB1 A;  1NJW A;  4GC7 A;  5KFH A;  5BPC A;  1NKC A;  5KFS A;  4YG2 A;  2LM4 A;  5J2B A;  4GFJ A;  5KFI A;  4B6J A;  1SXD A;  4I27 A;  3FC4 A;  5BOM A;  1QQ7 A;  4I2B A;  2KZM A;  2R8G A;  4JMU A;  1NZP A;  2IHN A;  5ALZ A;  2KMD A;  1N2X A;  2PMZ C;  3HP6 A;  3PW5 A;  5KTQ A;  1KTQ A;  3TFS A;  3UXN A;  3QNM A;  3WKA A;  2JHD A;  1B4F A;  1TK8 A;  3PML A;  3ZDE A;  5J0Y A;  1FO4 A;  4K4G A;  3CRX A;  2KZ3 A;  4BWJ A;  1JN3 A;  2WF7 A;  2YMQ A;  5DB7 A;  1S5L U;  1KFT A;  2KKP A;  3H8M A;  3E2E A;  1IIP A;  2HMX A;  2FLN A;  2LYA A;  5ALT A;  5KFL A;  3LWM A;  2QKQ A;  5AKE A;  1L3U A;  1RYU A;  4ZOH C;  3PO4 A;  4TUS A;  4R65 A;  3RJF A;  4YQW A;  3FM9 A;  5KT4 A;  5F3X B;  5L1K A;  3EYZ A;  5CRX A;  9ICM A;  3HX0 A;  1XO0 A;  5AM0 A;  2W11 A;  1BPY A;  1VDV A;  5HMM A;  1JRP A;  4P2H A;  1JXE A;  4OO1 J;  3EWA A;  2GOL A;  1F44 A;  1ZD3 A;  1ZQW A;  1WYG A;  4KMO B;  2HHV A;  2K4H A;  2QB0 B;  3ETR A;  1ZQC A;  1X9M A;  3C2K A;  4B9N A;  2W3S A;  9ICX A;  4O3R A;  3E0F A;  1SWW A;  2E8O A;  1K5O A;  4F50 A;  4QZF A;  1KW4 A;  5ALE A;  4QIW F;  3SV3 A;  3QU4 A;  2ZIV B;  5KT2 A;  1FFV A;  3KOO A;  5AI9 A;  5J2J A;  3ZDC A;  2JEI A;  3WK5 A;  2GH1 A;  8ICC A;  3GIK A;  2BCR A;  4Y2S A;  3RB4 A;  4OJL A;  3HPO A;  3AEV A;  5J2F A;  2ZJ5 A;  4Y2Q A;  1Q46 A;  4KIT B;  4Q8E A;  8ICA A;  1ZYQ A;  7ICT A;  2QAR A;  5DKW A;  1KQQ A;  1DRG A;  4NLN A;  2K89 A;  5ALN A;  2AU0 A;  1BNO A;  2W3R A;  4I2D A;  3RB6 A;  2LM1 A;  4F72 A;  4RQ6 A;  2H3Q A;  4RQ8 A;  1DK2 A;  2JEF A;  8ICF A;  3M7D A;  7ICE A;  4Y2J A;  4IR9 A;  7ICS A;  4RUA A;  3OHB A;  1JI7 A;  2XGP A;  5F9N A;  1DGS A;  5KFD A; 
#chains in the Genus database with same CATH homology
 3AU2 A;  3PX6 A;  4M6W B;  1TK5 A;  4F2S A;  1KDH A;  4Z6E A;  4F4W A;  4KLE A;  2AGO A;  2Y1J A;  5KFC A;  4QWC A;  3SV4 A;  4FO6 A;  3ZDB A;  4EZ9 A;  2BDP A;  4IRK A;  2VAN A;  4DL7 A;  4R8U B;  5III A;  1UT5 A;  1RZT A;  2DPI A;  2UVU A;  3M9O B;  1NK7 A;  4BXO B;  4QW9 A;  5HP4 A;  3Q8K A;  4C8K A;  4O5C A;  5KFZ A;  9ICN A;  4LVS A;  3JPS A;  1LB2 B;  4B9S A;  1XSL A;  4PHE A;  9ICT A;  2ZUC A;  5DB8 A;  2BQR A;  5J0O A;  4MFC A;  2HHT A;  1SKW A;  4O3P A;  4DQR A;  4ECZ A;  3GIL A;  3BQ2 A;  4ECV A;  5L1I A;  4KLT A;  2AGP A;  1ZQN A;  4YD1 A;  4ECX A;  3K75 D;  1ZQQ A;  4DOB A;  3H4B A;  3JPR A;  4B9M A;  4KN7 A;  4RU9 A;  4YR2 A;  4ED6 A;  1S0N A;  4YD2 A;  1BPX A;  4DLE A;  3EW9 A;  3PV8 A;  2C2R A;  5DDY A;  3GV5 B;  2ALZ A;  4NLK A;  2W9A A;  4I2J A;  4DS5 A;  3SYZ A;  5IIK A;  4F4X A;  5DGA A;  5J0U A;  3ETL A;  5JUM A;  1S10 A;  4FBT A;  2AGQ A;  3ISB A;  4TQS A;  2ASL A;  3MR2 A;  4DFM A;  3EZ5 A;  5IIJ A;  1Z00 A;  1NK6 A;  1H38 A;  4ELU A;  3GII A;  5DG7 A;  1Y88 A;  5KFJ A;  2W9B A;  4NM1 A;  2WTF A;  3RH4 A;  5KG0 A;  2BQ3 A;  2JEG A;  3RRH A;  5KG2 A;  5J2D A;  2R8I A;  4G3I A;  2B21 A;  4DFK A;  4O5K A;  3MDA A;  9ICP A;  1MC8 A;  5KFR A;  1RXV A;  4UBC A;  2NRX A;  3ORY A;  4KLH A;  1ZQD A;  1SZP A;  4KLS A;  4RQ1 A;  1ZQT A;  9ICC A;  3G6Y A;  2BR0 A;  4YR0 A;  3PNC A;  5KFT A;  4I2C A;  1TV9 A;  1JX4 A;  4F5N A;  4KLG A;  4YVZ A;  8ICL A;  3ZD8 A;  3JPP A;  5KFY A;  3THV A;  5KT5 A;  4I2A A;  2XGQ A;  4O3Q A;  3PR4 A;  5D4B A;  1HUO A;  4J9O A;  1ZQV A;  5D46 A;  4JWM A;  3PW2 A;  2W9B B;  1ZQR A;  1XC9 A;  4KLO A;  4KLJ A;  4DL2 A;  3H8J A;  7ICJ A;  2W9M A;  5J0R A;  3Q8M A;  1N56 A;  3RH5 A;  4QZA A;  2UVR A;  4B9L A;  4YMO A;  3V72 A;  3MBY A;  2HHU A;  1NK8 A;  5KFF A;  3JPT A;  4I28 A;  2XC9 A;  3G6X A;  1K1Q A;  2I1Q A;  1C7Y A;  2ZTE A;  2Y1I A;  2W9C B;  9ICE A;  4JK1 A;  1KRP A;  1JIH A;  4XUS A;  4DWI A;  3OGU A;  3QZ8 A;  2BQU A;  3TAQ A;  4RQ5 A;  4EBC A;  4E0D A;  9ICI A;  1ZQK A;  3RJE A;  5KFB A;  2HHS A;  4F93 B;  4YN4 A;  2IMW P;  4DQP A;  1QSY A;  4O5E A;  5CJ7 A;  3AUO A;  4F92 B;  4DL5 A;  5HML A;  8ICH A;  4IQV A;  1NK9 A;  2IA6 A;  4ECU A;  4Z6C A;  2PXI A;  4YP3 A;  1EXN A;  1NJY A;  3RJI A;  5J2K A;  3K4G A;  5DB6 A;  2ZUB A;  5KG3 A;  3C2L A;  2XY6 A;  2C28 A;  4IR1 A;  9ICW A;  5HNK A;  3Q8L A;  1S0V A;  2R8J A;  4IRD A;  4QWA A;  4DSI A;  4O3O A;  3V6H A;  1TAU A;  4ECY A;  2FPL A;  3NGD A;  7ICI A;  4RUC A;  5KFN A;  4F91 B;  4M0A A;  1S9F A;  3C21 A;  2PFQ A;  1X2I A;  1D9D A;  4ECT A;  3KTQ A;  3IHQ B;  4BGD A;  4ED0 A;  1NKE A;  3PR5 B;  2VA3 A;  1ZQX A;  5CA7 A;  4DQQ A;  3TI0 A;  8ICB A;  4F4K A;  1ZQI A;  4LZG A;  7ICU A;  1D8L A;  1SKR A;  1ZQH A;  4RPX A;  4PGQ A;  4R63 A;  4MEY A;  1XSP A;  3GFK B;  5DBC A;  5DQG A;  5KT7 A;  3TAR A;  4DSJ A;  3RJK A;  8ICP A;  9ICH A;  3UQ2 A;  4O3N A;  3PW7 A;  3JPO A;  1RYR A;  3UPQ A;  4NM2 A;  1CUK A;  4PHD A;  1QSS A;  1ARO P;  3V6J A;  3FYH A;  8ICI A;  3QEA Z;  4Z6F A;  4F5Q A;  2FLL A;  4XA5 A;  9ICR A;  2BPF A;  3M9N B;  4QZH A;  3PVX A;  3MGI A;  4FS1 A;  4X5V A;  1ZQL A;  8ICV A;  4F4Z A;  4I2E A;  1ZQF A;  4C8O A;  3V7L A;  4ECQ A;  4Z6D A;  4DSL A;  1MQ2 A;  4KLI A;  8ICK A;  2FLP A;  1KFD A;  4RNN A;  3GIJ A;  3ZDD A;  4DQI A;  8ICS A;  9ICL A;  4PHA A;  5DB9 A;  2C2E A;  5J0W A;  4NLZ A;  4J9K A;  4F8R A;  1Z3E B;  1L3S A;  3T3F A;  4F5R A;  5J0S A;  4R64 A;  4ED2 A;  3N97 B;  2J6U A;  3MGH A;  4UAZ A;  2MAX A;  1V9P A;  2ZJ8 A;  4P4O A;  5HHI A;  5L1L A;  4I2G A;  4LZD A;  2BCU A;  4TUR A;  1ZQA A;  5HHH A;  2BPC A;  4ZH4 A;  5IIO A;  1U47 A;  4KLF A;  2FPM A;  3MFI A;  1ZQP A;  2BPG A;  2JEJ A;  4KLM A;  5CP2 A;  2NRW A;  4M9G A;  5KG1 A;  3Q8Q B;  4KLD A;  4KMU A;  4ELV A;  3T5J A;  4M9N A;  4XRH A;  2ATL A;  1QTM A;  3C1Z A;  4I2H A;  7ICP A;  3BQ1 A;  4DFJ A;  1T8E A;  3NTU A;  2F1H A;  3BQT A;  3MR6 A;  3PW0 A;  5DBB A;  2FPK A;  2HHW A;  9ICK A;  1LV5 A;  4MF8 A;  5EWF A;  2MUT A;  4EBE A;  3RJG A;  4O9M A;  4ECW A;  4DSF A;  2ASJ A;  4YFK A;  3JPQ A;  4EBD A;  4RT3 A;  1ZQE A;  4DL4 A;  5D49 A;  3TAP A;  1XWL A;  3V7K A;  2XO7 A;  1SL0 A;  3UQ0 A;  3C1Y A;  4I2F A;  3KHL A;  4J9P A;  4J9N A;  7ICH A;  7ICF A;  4HYK A;  1BPB A;  3KHG A;  1SL2 A;  4I29 A;  4RT2 A;  2FMS A;  3N4M B;  1L3T A;  1JXL A;  4J9S A;  4DS4 A;  2BKE A;  1QSL A;  8ICQ A;  4QWE A;  4DF8 A;  2FMP A;  5DLF A;  4DEZ A;  5J0X A;  5KFV A;  3T5H A;  1KSP A;  2PFN A;  5J2H A;  5KFP A;  3HW8 A;  2PI4 A;  3H7I A;  9ICS A;  5KG5 A;  3HWT A;  4YR3 A;  4K4H A;  3HT3 A;  1MSW D;  4EYI B;  4R66 A;  1RYS A;  5J2C A;  1TAQ A;  2XCA A;  4FS2 A;  4PHP A;  4QZC A;  5DQH A;  1Z00 B;  4PH5 A;  3T5K A;  3OJU A;  4QZI A;  1BPE A;  5KFG A;  1NK5 A;  2V4R A;  1L5U A;  4UB2 A;  4DSK A;  1KFS A;  4PGY A;  4ED7 A;  1PZN A;  3OSP A;  1RPL A;  3RRG A;  4IQW A;  2IHM A;  8ICX A;  5CR0 A;  4DOC A;  2RDJ A;  5KFX A;  1X9S A;  2R8H A;  3C5F A;  2AJQ A;  3RBE A;  4C8L A;  5J0T A;  4ED8 A;  1DOQ A;  5KT6 A;  2F1J A;  4JV1 A;  2RDI A;  5KFE A;  5KG7 A;  1IM4 A;  1T4G A;  1L3V A;  9ICO A;  2A1J A;  4NXZ A;  4YXJ A;  2J6S A;  1RXW A;  3GIM A;  4TUP A;  4JV0 A;  3LDA A;  4KLQ A;  4Q8F A;  4YCX A;  3QE9 Y;  5EWE A;  1ZQZ A;  1S76 D;  5EOZ A;  3MFH A;  4K4I A;  3LWL A;  1N48 A;  4RQ2 A;  4XQ8 A;  2XCP A;  5L1J A;  4Q45 A;  4Q43 A;  1U4B A;  3Q8R B;  2F1I A;  5J2I A;  5IIM A;  2KTQ A;  4MF2 A;  4RNO A;  4UAY A;  1X9W A;  4PPX A;  4GXI A;  2PFO A;  7ICV A;  3GV8 B;  4DO9 A;  1BPZ A;  2J6T A;  1K1S A;  3KHR A;  4B9U A;  7ICQ A;  4DQS A;  8ICT A;  1B43 A;  2XY7 A;  4NLG A;  4M2Y A;  2BCQ A;  5KFU A;  4UB1 A;  4QWB A;  8ICM A;  1NJW A;  5KFQ A;  1ZET A;  4GC7 A;  5KFH A;  2ZJA A;  5TZV A;  4M47 A;  4DL3 A;  4ED3 A;  1NKB A;  4J9M A;  1D9F A;  5BPC A;  1SKS A;  2UVW A;  2ASD A;  2HVI A;  1NKC A;  5KFS A;  1NJZ A;  2HW3 A;  4YG2 A;  3UXO A;  5J2B A;  5KFI A;  4MEX A;  5DG9 A;  1NOM A;  1ZJN A;  2NRZ A;  2ZTD A;  4I27 A;  3EPI A;  3TQ1 A;  3M9M B;  3RB0 A;  1NJX A;  5BOM A;  1ZJM A;  1ZQM A;  4M6W A;  5KFK A;  3RBD A;  3PO5 A;  4I2B A;  2M9N A;  4J9R A;  2KZM A;  2R8G A;  1ZQY A;  1XS9 D;  2IHN A;  3T5L A;  3PX0 A;  3MR5 A;  3C2M A;  2H5X A;  5J0P A;  4QWD A;  4PGX A;  7ICM A;  3M8R A;  4F5P A;  2XY5 A;  3HP6 A;  4QZ9 A;  5KTQ A;  3PW5 A;  2DPJ A;  5DDM A;  1KTQ A;  2PFP A;  3TFS A;  3UXN A;  2AQ0 A;  4TQR A;  1U9L A;  1U48 A;  1XU4 A;  4M9J A;  5DGB A;  4I2I A;  4FBU A;  4DOA A;  2FMQ A;  1TK8 A;  2ISP A;  2VA2 A;  2C22 A;  4M9H A;  2IBK A;  5IIN A;  4MFF A;  3PML A;  1KLN A;  3FDS A;  1COO A;  4F5O A;  3RH6 A;  3ZD9 A;  4ELT A;  4QZB A;  4DFP A;  3ZDE A;  5J0Y A;  4KLU A;  7ICR A;  4K4G A;  3ISD A;  9ICV A;  8ICU A;  4EZ6 A;  2KZ3 A;  4BWJ A;  1JN3 A;  4RNM A;  1XO1 A;  4DL6 A;  2P6U A;  4F3O A;  2DFL A;  5DB7 A;  5J29 A;  4ECS A;  8ICY A;  1ZQO A;  8ICW A;  1KFT A;  1ZQB A;  4C8N A;  3PY8 A;  4IQT A;  3E2E A;  3V6K A;  9ICG A;  5KG4 A;  2FLN A;  5F9L A;  3V7J A;  5DLG A;  1NK4 A;  3MDC A;  2ISO A;  4NY8 A;  5KFL A;  1S0O A;  9ICJ A;  4M9L A;  2R8K A;  2LYH A;  3LWM A;  1IXR A;  2UVV A;  5KFO A;  1L3U A;  5CHG A;  3UXP A;  2KN7 A;  4J9L A;  1QLN A;  3IM1 A;  4UB5 A;  2W8K A;  4DLG A;  3C5G A;  9ICB A;  4CCH A;  3PO4 A;  4TUS A;  4R65 A;  4ED1 A;  3RTV A;  4JV2 A;  7ICL A;  4RQ7 A;  3JPN A;  1U49 A;  4YQW A;  3RJF A;  5KT4 A;  5L1K A;  4ECR A;  3EYZ A;  1BPD A;  1ZQJ A;  9ICM A;  3B0Y A;  3HX0 A;  2V4Q A;  4JWN A;  4RPZ A;  1MQ3 A;  2MUT B;  4GXJ A;  1BPY A;  2AQ4 A;  2NRV A;  1TFR A;  5HMM A;  1CEZ A;  4P2H A;  4IRC A;  1JXE A;  2V9W A;  3ISC A;  5J2G A;  3RAX A;  2I9G A;  5DQI A;  1ZQS A;  4RQ3 A;  1S0M A;  2HVH A;  5KT3 A;  3EWA A;  2ZUD A;  4C8M A;  4O0I A;  4P4P A;  3PMN A;  3H8W A;  4QW8 A;  1JMS A;  1ZQU A;  4RQ0 A;  2GWS A;  2W9C A;  4JUZ A;  4QZ8 A;  1TVA A;  4UQG A;  7ICN A;  1ZQW A;  4YMM A;  2HHV A;  1ZQG A;  1ZQC A;  1X9M A;  1S77 D;  2BHN A;  3Q8P B;  3C2K A;  4RZR A;  3ZDA A;  4B9N A;  9ICX A;  8ICR A;  3QEB Z;  4GLX A;  3H40 A;  1XSN A;  4O3R A;  3GQC A;  3BDP A;  2P6R A;  2KFN A;  5DBA A;  4YXM A;  3BJY A;  5BOL A;  4F50 A;  2BCS A;  4QZF A;  3C23 A;  3MAB A;  3LK9 A;  1SL1 A;  4F2R A;  3G6V A;  3RR7 A;  2P66 A;  5KFA A;  3PX4 A;  1HUZ A;  1T7P A;  3OJS A;  5CWR A;  1A77 A;  1KEJ A;  1UA0 A;  1NK0 A;  4B9T A;  4O3S A;  4EEY A;  3QZ7 A;  5CB1 A;  3SV3 A;  4DF4 A;  2BCV A;  5DG8 A;  3RAQ A;  2HHX A;  3OSN A;  9ICA A;  2JZB A;  5KT2 A;  1B22 A;  2VA8 A;  4QZG A;  4Q44 A;  3EPG A;  5J2J A;  4M04 A;  4TUQ A;  5J2E A;  5KFW A;  4UBB A;  3ZDC A;  2JEI A;  8ICZ A;  1S97 A;  3GV7 B;  3TAN A;  2NRT A;  7ICK A;  5IIL A;  8ICO A;  1A76 A;  1WCN A;  1HJP A;  8ICC A;  4IQU A;  4YMN A;  3KHH A;  2W8L A;  4B9V A;  3Q8S B;  4QZD A;  4BWM A;  1T3N A;  7ICG A;  2A1J B;  4UAW A;  5KFM A;  8ICG A;  4RPY A;  3RR8 A;  3GIK A;  2BCR A;  9ICQ A;  3H8S A;  3TFR A;  4GXK A;  3BQ0 A;  3RB4 A;  3RJH A;  4RQ4 A;  5L9X A;  1UA1 A;  4KN4 A;  3HPO A;  5J2F A;  5J0Q A;  3H4D A;  2JZB B;  2ZJ5 A;  4GC6 A;  2BGW A;  3RB3 A;  3PW4 A;  3GDX A;  3SZ2 A;  4KIT B;  4J9Q A;  2OWO A;  4Q8E A;  3SI8 A;  2KZZ A;  5J2A A;  8ICA A;  1ZYQ A;  1U45 A;  2ZTC A;  4KTQ A;  7ICO A;  7ICT A;  1WCL A;  5DKW A;  8ICJ A;  4EYH B;  4KLL A;  4QZE A;  5EWG A;  2KFZ A;  4UB3 A;  1TKD A;  5C5J A;  4NLN A;  4P4M A;  4UB4 A;  4R8U A;  1D8Y A;  3M8S A;  4BXO A;  2AU0 A;  4BDP A;  9ICU A;  1TK0 A;  4I2D A;  3RB6 A;  9ICF A;  3MR3 A;  3OHA A;  4RQ6 A;  3RJJ A;  2Q0Z X;  4MFA A;  4RQ8 A;  8ICE A;  4DSE A;  2JEF A;  8ICF A;  1BVS A;  1BGX T;  1UT8 A;  7ICE A;  5KG6 A;  8ICN A;  4IR9 A;  3B0X A;  7ICS A;  2HHQ A;  4RUA A;  2PI5 A;  3OHB A;  4F4Y A;  2C2D A;  3AU6 A;  2XGP A;  5F9N A;  1DGS A;  5KFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...