2M9NA

Solution structure of (hhh)2 domain of human faap24
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2m9nA00
4E0DA 5KT6A 3KHRA 9ICKA 1NK6A 1ZQWA 4QZDA 5DBAA 1KDHA 3AU2A 1L5UA 4KMUA 4RUAA 8ICUA 3NGDA 4YMMA 1NKCA 8ICXA 5DGAA 4UQGA 4YQWA 3UQ0A 9ICWA 4UB3A 4M6WA 8ICOA 2Y1IA 4I2CA 4ED3A 2UVVA 1BPEA 5L1LA 5KFXA 4ECSA 4P4OA 1CEZA 5L1JA 1ZQHA 3RJGA 2W9MA 2KTQA 7ICUA 7ICSA 4EZ9A 4UAWA 3ZDBA 4YR3A 4IQUA 5J0YA 4KLLA 4C8KA 4I2HA 4YMNA 2W9CB 7ICJA 2BKEA 4YXJA 4ECZA 2GWSA 5J2JA 1SL2A 5KFBA 4PHAA 1NK5A 1IXRA 2ASJA 1BPXA 2IBKA 1S9FA 2NRXA 4JV0A 1XO1A 9ICAA 5KFYA 3PV8A 3SYZA 4F5NA 2ALZA 1BGXT 7ICVA 2BCRA 1T3NA 1S76D 2W9BB 4MF2A 1S77D 1NK9A 3HPOA 1U4BA 2AQ4A 1L3UA 7ICEA 3H40A 4Q44A 4DSEA 1TK0A 4RQ7A 2XO7A 4MFCA 4RNMA 1CUKA 5J0OA 5EWEA 5KFOA 3OGUA 5KT5A 4J9RA 3N4MB 1ZQFA 2PFQA 5J2CA 5IIKA 1BPZA 3PR4A 2W8KA 9ICXA 2ZUBA 4B9MA 3PNCA 4ECYA 4O9MA 4DS5A 3V72A 5J0PA 2UVWA 2MAXA 4KTQA 1TKDA 2HHQA 2XY6A 3TAQA 1NKBA 4RNNA 1MQ2A 4KLFA 3MR3A 4I2GA 3T3FA 2BCQA 3ZDCA 5DLGA 4B9LA 3T5JA 2KN7A 4QWCA 3PW0A 2A1JA 4KLJA 1NK7A 2C2DA 3EPGA 4O3RA 3ISDA 4DOAA 4FO6A 3ZDEA 4Q45A 2XY5A 4J9OA 1SKRA 1RYRA 2PFPA 4ELUA 3ISCA 2ZUCA 4M0AA 5CWRA 8ICMA 4TUSA 2IHMA 4DSIA 2MUTA 3T5KA 4UAYA 4DQQA 2BQRA 5KFAA 2P6UA 4MFFA 5BOMA 3QEAZ 3PW4A 4P2HA 4RPZA 2BPGA 1KEJA 4DL2A 2IHNA 1S97A 2BDPA 4JV1A 4G3IA 8ICJA 5HHIA 3TAPA 3EW9A 1U48A 3Q8SB 4ECUA 3OHAA 3Q8MA 4O5CA 5J2KA 4EYHB 5DB6A 5KFCA 1B43A 1QSLA 4PGYA 2C28A 4FBUA 4LVSA 3KTQA 4I2JA 4KITB 2RDJA 2ASDA 2PI5A 4EEYA 5BOLA 7ICTA 1ZQRA 1L3SA 3FDSA 7ICOA 3RB0A 9ICNA 4DL3A 3PVXA 2DPIA 2XC9A 4F50A 3QZ7A 5L9XA 4IQWA 2M9NA 2HHUA 2HHWA 5TZVA 4RZRA 2IA6A 2AQ0A 4P4MA 4FBTA 2FMPA 3T5HA 1NKEA 8ICPA 4J9MA 1ZJMA 9ICGA 3UQ2A 5KT7A 3SV4A 1HJPA 2XGQA 3RJEA 5KT4A 3V7LA 4I2BA 2NRTA 5DQGA 5KFFA 4XQ8A 4F4YA 5DG7A 3IHQB 3PMLA 3M9OB 1NK0A 2ZTCA 1NJWA 8ICHA 5DDYA 4BXOA 7ICPA 4I2AA 4YFKA 3EWAA 5KG4A 1JX4A 1K1SA 4DOCA 5KG2A 4NY8A 1ZQPA 5KG5A 4NLNA 5KG1A 5J2AA 4DFJA 4KLEA 3MGHA 2HHTA 1U9LA 2BPFA 3M8RA 4EYIB 3G6YA 4UBBA 3M9MB 5KG6A 1S0OA 3QE9Y 3GV5B 3GDXA 3MABA 1X2IA 4IRKA 4F93B 3V6HA 1ZQQA 8ICVA 1TAUA 3B0YA 1ZQVA 1IM4A 3GIIA 5L1KA 1TV9A 4CCHA 3V7JA 3MFIA 4LZGA 3M8SA 4QZ9A 1JN3A 4QWAA 3JPOA 2J6TA 4PGQA 1S0VA 4YCXA 3LK9A 9ICBA 5J29A 4ED1A 3TANA 2VA3A 4RQ1A 1V9PA 3OSNA 2C2RA 7ICFA 5CA7A 4O5KA 8ICQA 3GV7B 5DDMA 3MDCA 3MDAA 4EBCA 4IQVA 2HHXA 2KZZA 9ICLA 1Z00B 1TVAA 4I28A 4FS1A 4K4IA 3C2KA 5KFDA 3ETLA 5IIIA 4O3QA 5J2FA 1NJXA 2PI4A 9ICMA 4DQIA 4RQ5A 4YD2A 4B9VA 4ED8A 4IR9A 3Q8QB 1MQ3A 4F2SA 5D4BA 2PFNA 4YMOA 4DSFA 3PX0A 8ICBA 1RXWA 1X9SA 4DLEA 1LV5A 2JEFA 3C1ZA 5IINA 5IILA 2VANA 5CR0A 4BGDA 4TQRA 4TUPA 4M2YA 4RUCA 3RBDA 3HX0A 1T4GA 1ZQJA 4KLQA 3C5GA 4ECTA 1TK8A 1S0NA 3PW7A 5KFEA 1SL1A 3UXNA 1XSLA 3PR5B 4DL5A 2V4RA 2J6SA 5DLFA 4PH5A 4DQPA 4F92B 5KFPA 4JWNA 5IIOA 1KFDA 4UBCA 3RAQA 2FMQA 1NK8A 4YR0A 4B9UA 5J2IA 9ICTA 3TFSA 5J0UA 2FPMA 5DQIA 3H4BA 4ECQA 2JZBB 3KHHA 4MEXA 4M9LA 4QZCA 4NM1A 1ZQIA 3SV3A 4O3SA 3THVA 4KLGA 3GIMA 4R66A 7ICGA 5DBCA 1QSSA 3RJJA 2P6RA 4KLMA 4KN4A 5IIJA 2FLLA 3H8WA 2XCAA 3K4GA 1ZQCA 1ZQXA 4MFAA 2PXIA 1QSYA 5KFLA 4QZ8A 5KG7A 4Z6FA 3MR2A 2FMSA 4IRCA 8ICLA 9ICVA 3G6VA 1Z3EB 4PPXA 8ICFA 2BGWA 5JUMA 4DL6A 1UT5A 2FLNA 4M9GA 3C21A 4C8NA 1UA0A 2R8IA 4F4KA 1T7PA 5HNKA 9ICPA 4PGXA 1A76A 2AU0A 2JEGA 2OWOA 1ZYQA 2IMWP 5KFWA 5L1IA 2ZTDA 1ZQOA 4BDPA 2KZMA 4Q43A 3KHLA 4MF8A 3K75D 5DGBA 2Q0ZX 4MEYA 4J9KA 4RNOA 3TARA 4YP3A 4QZBA 7ICRA 3OSPA 3BQ2A 4I2EA 3PMNA 4NLGA 2H5XA 3JPTA 1ZQBA 4F5RA 5J2EA 3KHGA 2BCSA 1U47A 5KFNA 5KFGA 5J0QA 5KT3A 5KFIA 3MR6A 4F5OA 2ZJAA 1ZQEA 2PFOA 3E2EA 5KFMA 5DB9A 4RPYA 5CJ7A 5KTQA 4F2RA 2DPJA 1RXVA 9ICSA 4YD1A 2V4QA 3UXPA 3SZ2A 8ICCA 1HUZA 3M9NB 7ICLA 1ZQUA 4M6WB 1XWLA 5DBBA 1MC8A 3JPPA 3EPIA 4DEZA 5BPCA 4DFMA 7ICMA 4M9NA 4QWEA 5J2GA 3V6KA 3RTVA 1NJZA 8ICKA 4J9PA 1AROP 4I2IA 5CHGA 4DOBA 3HT3A 4FS2A 2FPLA 3UXOA 1RYSA 4XUSA 4F8RA 3BQ0A 3HWTA 3UPQA 9ICUA 4ED7A 1X9WA 4UB4A 4UB5A 3Q8KA 2ZJ5A 4RQ2A 9ICRA 4RQ4A 1UT8A 4YN4A 2KFZA 4XA5A 8ICZA 4JWMA 3FYHA 4NXZA 4QZAA 2WTFA 4JV2A 4KLOA 4QZGA 1WCNA 4Q8EA 1HUOA 4QZHA 5IIMA 4Z6CA 1KRPA 2ISOA 4B9SA 2BQUA 4BWJA 1ZQKA 3RB6A 5CP2A 2AJQA 4RPXA 4R8UA 1ZQYA 5HMMA 2W9AA 5EOZA 4RT3A 5J0TA 2W9BA 4GXJA 4ED6A 2J6UA 3PX4A 3RJKA 4KLDA 1H38A 3C2LA 4ZH4A 4QZEA 5C5JA 1ZQMA 2NRZA 5DG8A 3RRHA 2BR0A 4C8MA 1XS9D 1L3TA 1D9FA 1RPLA 3PO4A 4C8OA 4K4GA 4GLXA 5EWFA 4J9LA 4C8LA 4BWMA 2RDIA 1TAQA 2BCVA 4LZDA 3C1YA 4DS4A 3MR5A 5KFKA 1XC9A 9ICHA 4F3OA 2A1JB 3MGIA 4GXKA 3RH6A 4M47A 2C2EA 5J0SA 2FPKA 2JEIA 8ICIA 2VA8A 2ZUDA 3B0XA 3EZ5A 1T8EA 2AGQA 4KLUA 2HW3A 2MUTB 3NTUA 3JPRA 4UB1A 4RT2A 3JPSA 2FLPA 2NRWA 1BPDA 3ZDDA 1S10A 5DB8A 1XU4A 4DFKA 2UVUA 3LDAA 3PX6A 4DF4A 4J9NA 1D9DA 2F1HA 5DB7A 4F4XA 3C23A 4R65A 4PHDA 4J9SA 2I1QA 3T5LA 3C2MA 2ASLA 3V6JA 4J9QA 4GXIA 3RR8A 3RJHA 2XY7A 1RZTA 3BQTA 1K1QA 1KFTA 1JXEA 3PO5A 3V7KA 5KT2A 3HW8A 5D46A 1SKWA 3C5FA 4EBEA 7ICKA 4ECRA 1ZQLA 5KFHA 5F9LA 4M9JA 4I2DA 3GV8B 3RB4A 1SL0A 1D8LA 7ICIA 3QZ8A 1KFSA 3QEBZ 3IM1A 2DFLA 5EWGA 4DSJA 3GIKA 4IR1A 9ICJA 9ICOA 1ZQSA 4KN7A 1TFRA 3H8JA 3PW5A 1Y88A 2R8GA 4BXOB 3ZDAA 4M04A 4RQ3A 3EYZA 3TQ1A 8ICSA 4KLTA 1U45A 2ISPA 2V9WA 4R8UB 3HP6A 7ICNA 1WCLA 1JIHA 5KG0A 4YVZA 9ICFA 2B21A 1PZNA 4YG2A 5J2BA 4IRDA 4QWDA 2Y1JA 3ORYA 3G6XA 2HHSA 3OJUA 3GILA 1D8YA 1ZQZA 1N56A 1ZQDA 4DSLA 2AGOA 4O3PA 5HMLA 2JEJA 1KTQA 4QW9A 5HP4A 1KLNA 4ECXA 1ZQNA 8ICYA 4TURA 4QZIA 2HHVA 3RH4A 3H8SA 3ISBA 2BPCA 8ICAA 9ICQA 3TI0A 1NJYA 1BPBA 4F5PA 2HVIA 4DLGA 5D49A 3LWMA 3MFHA 3RAXA 4X5VA 4O5EA 1SZPA 4GC6A 4ECWA 2F1JA 1NK4A 2UVRA 5J2HA 4RQ0A 3N97B 2W8LA 4EBDA 4EZ6A 3BDPA 4K4HA 3Q8RB 4DO9A 1DGSA 4Q8FA 1U49A 4ELTA 1Z00A 8ICNA 4NLKA 4R64A 3RH5A 3H7IA 5CB1A 4R63A 4GC7A 1XSPA 4ELVA 2R8HA 3OHBA 2I9GA 4B9TA 4DFPA 2R8JA 1QTMA 3RJFA 1LB2B 1A77A 4ECVA 2ZJ8A 1ZETA 4KLIA 4P4PA 8ICWA 3GQCA 1XSNA 1L3VA 3BJYA 2P66A 4NLZA 4F91B 1N48A 2W9CA 9ICEA 4TUQA 1EXNA 5KFVA 4O3NA 4TQSA 3JPQA 4PHPA 1NOMA 5KFRA 5KFQA 3RR7A 3H4DA 1SKSA 3GFKB 4F4ZA 3RB3A 4ED2A 4QWBA 4JK1A 1ZQAA 2KZ3A 5DKWA 4DQSA 2BQ3A 8ICTA 3LWLA 3PY8A 2ATLA 1ZJNA 4XRHA 3SI8A 4DL7A 5DG9A 5KFTA 1UA1A 5J0WA 4Z6DA 5KFJA 3OJSA 5F9NA 5KG3A 5DQHA 2XGPA 3BQ1A 4DL4A 1ZQTA 5J2DA 2VA2A 2JZBA 4I2FA 3TFRA 2C22A 4M9HA 3JPNA 4QW8A 3RJIA 1DOQA 1C7YA 4O0IA 4ED0A 1TK5A 1JXLA 8ICRA 7ICHA 4F5QA 4YR2A 4DWIA 5KFZA 3RBEA 9ICIA 4UB2A 1S0MA 8ICEA 4YXMA 4JUZA 2BHNA 4B9NA 8ICGA 2BCUA 4HYKA 4NM2A 1JMSA 3ZD8A 2XCPA 7ICQA 1QLNA 2KFNA 1X9MA 4KLHA 1COOA 4O3OA 2HVHA 4Z6EA 1ZQGA 4RU9A 4KLSA 5KFSA 1B22A 2ZTEA 3RRGA 4DQRA 3ZD9A 4I27A 4DF8A 3AU6A 3AUOA 3PW2A 5J0RA 9ICCA 2F1IA 3Q8LA 3MBYA 2AGPA 2R8KA 4RQ6A 3GIJA 1KSPA 4I29A 1MSWD 2LYHA 4QZFA 5J0XA 5HHHA 4DSKA 4RQ8A 5KFUA 2NRVA 1BPYA 1BVSA 4UAZA 4PHEA 3Q8PB 4F4WA 4IQTA
chains in the Genus database with same CATH superfamily
4E0DA 1NK6A 1KDHA 4YMMA 1O08A 5DGAA 4UQGA 1Z1VA 2E1FA 1CEZA 2W43A 5ALLA 4KLLA 3QNMA 4YXJA 2GWSA 2D3DA 2OYYA 4PHAA 1S9FA 4B6JA 5EE3A 4JV0A 3S6JA 3SAGA 4A8EA 4F5NA 2ALZA 7ICVA 1URJA 5ALTA 3AQEA 1T3NA 1S76D 5AK6A 1NK9A 5E79U 2AQ4A 5J8YA 2AXTU 2JMGA 4RQ7A 5EWEA 4QIWF 5KFOA 3OGUA 2PFQA 3N7SC 5IIKA 1BPZA 1KQQA 4CNQA 4ECYA 3TADA 4O9MA 3WKBA 4KTQA 1TKDA 5AI8A 3QXGA 2ESEA 4DCCA 5DLGA 2E5SA 3KOOA 3B9JA 1FO4A 4QWCA 3F5AA 3SAHA 3J81j 2OEHA 3H0MB 4J9OA 1SKRA 4HAIA 1OUQA 2K4IA 2ZUCA 2IHMA 3T5KA 2BQRA 2PMZF 5KFAA 2W03A 4J03A 3PW4A 1JALA 3D2SA 3IP4B 5DB6A 1B43A 5AI4A 4LVSA 3KTQA 3M6ZA 2ASDA 4EEYA 4P0QB 3RF9A 7ICTA 2RHFA 3FDSA 2KJ8A 9ICNA 3PVXA 2XC9A 4F50A 3QZ7A 2HHUA 2M9NA 2HHWA 5TZVA 5ALUA 2WHEA 4P4MA 2WFAA 2ZG6A 5ALKA 2FMPA 2KMDA 4FBTA 8ICPA 3UQ2A 2B6GA 2XGQA 3RJEA 4F4YA 1NK0A 4UAVA 3M9OB 1NJWA 5AI9A 1Z4OA 4I2AA 5KG4A 2ZIUB 5AI6A 1LVHA 4NLNA 5J2AA 1F5SA 3HKZF 2BPFA 3M9MB 3GV5B 3GDXA 3MABA 5KAIU 1ZQQA 3B0YA 3GIIA 5L1KA 1TV9A 3V7JA 4QZ9A 3JPOA 9ICBA 4PGQA 2PKEA 3LK9A 4ED1A 2VA3A 5DDMA 5AKXA 4EBCA 2W3RA 5AIBA 4I28A 4FS1A 3SAFA 5IIIA 5J2FA 1NJXA 2KICA 1MQ3A 5D4BA 3PX0A 2KJ9A 1X9SA 1RG6A 4DLEA 1LV5A 2JEFA 5IINA 4BGDA 1ECWA 4RUCA 1T4GA 4KLQA 1TK8A 2BDUA 5KFEA 3UXNA 3PR5B 4DL5A 2V4RA 2DGZA 4F92B 4JWNA 5IIOA 1KFDA 3RAQA 1WWUA 1NK8A 3TACB 4C7YA 3GU3A 4ECQA 4O3SA 4R66A 3RJJA 5GTIU 2P6RA 2XCAA 3K4GA 1ZQCA 2PXIA 2F77X 5KFLA 4Z6FA 3MR2A 1ZD3A 3G6VA 1Z3EB 4DL6A 1UT5A 3C21A 1UA0A 2R8IA 2WB1F 2JEGA 2JH1A 5KFWA 4BX9C 3FM9A 3WK4A 3TARA 5DGBA 3DEEA 4Y2PA 3OSPA 4I2EA 2EH9A 2BZFA 4NLGA 3EUB2 4F5RA 1U47A 5KFGA 5KT3A 3MR6A 3E2EA 2F76X 2JRZA 9ICSA 4YD1A 3UXPA 8ICCA 5AI0A 1HUZA 3M9NB 1ZQUA 3JPPA 5KL1B 3EPIA 4DEZA 2DBYA 4M9NA 5J2GA 4QIWC 4J9PA 4DOBA 3HWTA 3UPQA 1FIQA 4ED7A 1X9WA 2ZJ5A 4RQ4A 4YN4A 8ICZA 4QZAA 2ODGA 5TISU 1HUOA 4Y2VA 4QZHA 2XI9A 1M6YA 4RT3A 2Z7JA 2W9BA 4GXJA 5F3XB 2PMZC 2J6UA 3IDWA 4KLDA 3C2LA 1ZQMA 3NUQA 5DG8A 3RRHA 2KHQA 5AHXA 1RPLA 4C8OA 1WG8A 5ALPA 1TAQA 3RH6A 3MGIA 2K4HA 1D8BA 3B0XA 5AKLA 3EZ5A 1T8EA 3UMBA 2HW3A 3QUBA 3JPRA 5AKZA 4PZNA 3WK7A 3ZDDA 4WJ3B 5ALEA 1S10A 1XU4A 2UVUA 3ZI4A 3LDAA 4DF4A 3N7RC 4EENA 5HR6A 4F4XA 1S8OA 3O0FA 3WK8A 3C23A 2DL0A 1X42A 3C2MA 2ASLA 4J9QA 3HKZC 3VC8A 3RJHA 2WF7A 2F44A 1K1QA 5KT2A 5D46A 5ALZA 2G09A 4M9JA 5F9LA 2HHTA 3QZ8A 4Y2XA 1KFSA 3IM1A 2DFLA 4DSJA 4KN7A 3H8MA 3H8JA 1J2NA 1V97A 4M04A 3TQ1A 2JXJA 4R8UB 7ICNA 1WCLA 1JIHA 4IL6U 2MRLA 4IRDA 4QWDA 2Y1JA 3ORYA 2E3TA 5AKHA 4JB3A 2AGOA 3NVYA 2KIVA 3SQIA 2EZYA 2JEJA 4QW9A 2F2AB 4ECXA 4QZIA 3RH4A 1ZD5A 1KN5A 2YMPA 1N5XA 3D6JA 3WK6A 2H3IA 4QNLA 4Q8FA 1U49A 1Z00A 4NLKA 5CB1A 4R63A 1YZ6A 5CEHA 3BJYA 4NLZA 4F91B 9ICEA 2KD1A 5KFVA 3K1RB 5KFRA 4CRXA 2KZ3A 2WB1C 4DQSA 2BQ3A 3PY8A 5ALSA 3H0RB 4DL7A 5KFJA 3BQ1A 4DL4A 2JR5A 2XGPA 2JZBA 4M9HA 4UATA 2C22A 1DOQA 4ED0A 5H2FU 3PSFA 3RBEA 1OXJA 1QQ5A 3PZPA 4B9NA 1JMSA 1X9MA 4KLHA 2HVHA 4OJ6A 1B22A 1T3QA 3PW2A 1XNSA 9ICCA 2QKQA 5J0XA 3DDHA 3K1ZA 5KFUA 2NRVA 5KT6A 3KHRA 1ZQWA 1DK3A 3AU2A 1L5UA 4KMUA 8ICXA 1WWVA 3UQ0A 1CI4A 4M6WA 4I2CA 2VIXA 4P4OA 5A0LA 5L1JA 1S5LU 2HDOA 4YR3A 4C8KA 1UHUA 2BKEA 4ACOA 2NO4A 4F72A 3AEVA 1MN8A 1OW5A 1ZD2P 2W9BB 4U6PA 2ZIUA 3HPOA 2XO7A 4MFCA 5J0PA 3A0HU 2XY6A 3TAQA 3T3FA 2BCQA 3F2DA 3T5JA 2A1JA 4KLJA 1IIPA 1NK7A 2C2DA 3ISDA 4FO6A 3ZDEA 1PK3A 4Q45A 4M0AA 5CWRA 8ICMA 2MUTA 1L8LA 2P6UA 2BPGA 1KEJA 4DL2A 2IHNA 1S97A 2BDPA 8ICJA 3TAPA 1JRPA 1U48A 3OHAA 2HOQA 3IRUA 3CRXA 5J2KA 4EYHB 3WK5A 1PVPA 2HSZA 1X6IA 2YMQA 5EE0A 2RDJA 2PI5A 5BOLA 5AI5A 1QQ6A 1ZQRA 2G0AA 3RB0A 1SWVA 5L9XA 4IQWA 2XVTA 1NZPA 1NKEA 5KT7A 3SV4A 1HJPA 2HOFA 5ALQA 3V7LA 3KD3A 4ICAA 5DG7A 3IHQB 5DDYA 4YFKA 1K1SA 3HILA 4NY8A 2DKXA 4KLEA 3MGHA 1U9LA 3CYMA 3E0FA 2KK0A 4Y2TA 1ZXIA 5KG6A 3IV6A 3IG5A 1X2IA 4IRKA 3NVWA 1C20A 4ZOHC 4CCHA 3BS5A 1JN3A 1S0VA 3OSNA 4RQNA 2C2RA 4AP9A 5CA7A 4O5KA 8ICQA 3NASA 3MDAA 4IQVA 1MA7A 1Z00B 2LYAA 3C2KA 5KFDA 4O3QA 2KG5A 4EX6A 3UM9A 4YD2A 1ZQ1C 4IR9A 2CPRA 1RXWA 4CF4A 1Z4NA 2VANA 2KHVA 5AK5A 3VCBA 1S0NA 1SL1A 1XSLA 3KZIU 2J6SA 3GZFA 5KFPA 4UBCA 3LYSA 3TFSA 1L7OA 4MEXA 5DQIA 3H4BA 2JZBB 4M9LA 4NM1A 9ICHA 3SV3A 3THVA 1QSSA 4KLMA 4KN4A 2I5HA 2KVCA 1ZQXA 4MFAA 1N62A 5K4LA 5KG7A 4IRCA 3SR6A 2FMSA 9ICVA 2DF4B 1N63A 5AK4A 5AM2A 2BGWA 4M9GA 1T7PA 1COKA 1RQLA 4PGXA 1A76A 2OWOA 1ZYQA 2IMWP 1KW4A 2K89A 3K75D 4BUGA 2HBKA 2H5XA 3JPTA 1ZQBA 5J2EA 2BCSA 5KFNA 4F5OA 2ZJAA 2ZIXA 4RPYA 5CJ7A 1RXVA 3SZ2A 5DBBA 4M6WB 5BPCA 2EANA 4C0ZA 1N61A 3V6KA 3RTVA 2KJ5A 4I2IA 2ZXIA 2FPLA 4F8RA 3BQ0A 3Q8KA 9ICRA 4XA5A 4C4SA 3KKAC 4OJ5A 4KLOA 4NXZA 1N2XA 1WCNA 5IIMA 1KRPA 2Y0SF 3NVZA 3RB6A 5CP2A 2AJQA 1HEKA 4R8UA 1ZQYA 2LBOA 2D8CA 3PX4A 3RJKA 2K4EA 5T14A 2K4PA 5C5JA 2NRZA 4P0PA 1XS9D 1D9FA 1PVRA 4BWMA 2A1JB 4UASA 2FPKA 3U26A 2ZUDA 4KMOB 2AGQA 4KLUA 3QUCA 2MUTB 1JI7A 3JPSA 2I6XA 3PSTA 4DFKA 2GOLA 4GIBA 5DB7A 4R65A 4PHDA 4DFDA 4GXIA 3RR8A 4OJLA 1RZTA 3BQTA 1KFTA 2G5IB 2IOFA 2EAMA 2JV3A 3PO5A 1Q8KA 3HW8A 3C5FA 2VKQA 5KFHA 1JUDA 4G9BA 3QEBZ 5EWGA 9ICOA 1TFRA 3ZDAA 4RQ3A 3F2CA 3HP6A 2YN4A 5KG0A 2B21A 4YG2A 3G6XA 3OJUA 1X9XA 3GILA 1ZQZA 1N56A 4O3PA 5HMLA 3BZKA 3BS5B 3QU9A 1YZ7A 8ICYA 9ICQA 8ICAA 1IG6A 2QLTA 3ISBA 1NJYA 1FFUA 1BPBA 4UARA 2E8PA 4DLGA 3RAXA 4X5VA 3MFHA 4ECWA 2F1JA 3KKAA 5GTHU 4RQ0A 4EBDA 4EZ6A 4K4HA 1DXSA 4R64A 3H7IA 2KE7A 2I9GA 2ES6A 2OCEA 1L7NA 4P4PA 2YQEA 1VDVA 3AN1A 1EXNA 4TUQA 4O3NA 3JPQA 5KFQA 1SKSA 3RB3A 4USAA 5AK3A 4ED2A 1TAMA 4QWBA 5DKWA 3LWLA 2HBJA 5KFTA 2Q4TA 5DG9A 1UA1A 4MFFA 5DQHA 3QU2A 5J2DA 3JPNA 1C7YA 4O0IA 1TK5A 4UW9A 4UB2A 2BCUA 3OTQA 3ZD8A 3KZXA 2ZXHA 2KFNA 4O3OA 4Z6EA 1ZQGA 4GFJA 5G5GA 3ZD9A 3AU6A 5J0RA 2NO5A 3MBYA 3GIJA 1MSWD 2LYHA 4OO1J 4RQ8A 1UPHA 2ZIXB 3F2BA 1HIWA 4IQTA 2Y0SC 9ICKA 4QZDA 5DBAA 4RUAA 3M1YA 2W7OA 1XO0A 8ICOA 2Y1IA 2UVVA 1BPEA 5KFXA 1Q46A 3RJGA 2HMXA 4EZ9A 4IQUA 5J0YA 3M7DA 4I2HA 2W9CB 7ICJA 4ECZA 3F5EA 3N7PD 1SL2A 1NK5A 1IXRA 2ASJA 1PK1A 1BPXA 2IBKA 2KIWA 2RLTA 2A19A 3SYZA 2BCRA 1S77D 1U4BA 2JGAA 5ALXA 4Q44A 4DSEA 1ED1A 5AM4A 5J0OA 4P0PB 3PR4A 2OHFA 2ZUBA 4DS5A 1NKBA 5EE1A 4PJ0U 4I2GA 1Q3VA 2O6KA 2KN7A 3PW0A 3IN5A 3A0BU 1VJ5A 3EPGA 4UAUA 4O3RA 2XY5A 4ELUA 1RYRA 2NYVA 2F8KA 4TUSA 4DSIA 2W3SA 1RM6C 4UAYA 4DQQA 9ICGA 1J97A 1SXEA 4P2HA 2D6FC 4G3IA 4JV1A 5HHIA 2RQ5A 1X40A 4O5CA 1L6NA 3KFUF 5KFCA 2C28A 4Y2YA 4KITB 5KAFU 1V85A 4QJFB 4DL3A 3AMZA 1WUDA 4RZRA 2IA6A 2EZZA 1Z19A 4O3MA 4PL1A 4PL2A 1RYUA 1ZJMA 5EE9A 2WAQF 2OH2A 4JMUA 4I2BA 1ZQTA 3PMLA 2ZTCA 3C29A 7ICPA 2G07A 1JX4A 5KG2A 5KG5A 1YT3A 2MSNA 3M8RA 4EYIB 3AQFA 3G6YA 3QE9Y 1IM4A 3MFIA 3M8SA 4QWAA 4YCXA 3N28A 5J29A 1V9PA 2H3VA 4CF5A 5ALWA 3MDCA 2HHXA 5ALJA 2KZZA 1TVAA 2EDUA 2YY6A 3ETLA 2KVSA 3R9KA 2E8OA 4B9VA 4ED8A 4F2SA 4YMOA 4IS7A 4DSFA 3C1ZA 4TQRA 4M2YA 3RBDA 3HX0A 1ZQJA 4ECTA 3ICXA 3NRWA 5AICA 2AHOB 4DQPA 3ED5A 1GO3F 2FMQA 4B9UA 5J2IA 9ICTA 3FAHA 2FPMA 2F8LA 4KLGA 4QZCA 1ZQIA 2KKVA 5DBCA 2VJ4A 4Y2SA 5IIJA 2FLLA 1PUZA 1UQVA 1A0PA 1QSYA 2DQNB 3WKAA 8ICLA 3L5KA 5AKJA 8ICFA 1ZD4A 2FLNA 4C8NA 2F3NA 4NLCA 4F4KA 9ICPA 2XIDA 4CE6A 5L1IA 4BDPA 1ZQOA 2IOFK 2KZMA 4J9KA 4MF8A 4MEYA 4YP3A 4QZBA 2DWQA 4F71A 3PMNA 3BS7A 4OJOA 4AYBF 5J0QA 1ZQEA 5KFMA 5DB9A 4F2RA 2DPJA 3D2NA 7ICLA 1MC8A 2DUYA 4DFMA 5JRTA 2LKYA 1NJZA 2WF5A 8ICKA 5CHGA 3UXOA 9ICUA 4UB4A 2EAPA 1PK1B 1UT8A 3FYHA 4JV2A 4QZGA 2BQUA 4BWJA 3KBBA 4ED6A 5AM1A 2YB4A 4ZH4A 4QZEA 3SD7A 4C8MA 2BR0A 5B5EU 3PO4A 2HOIA 4GLXA 5EWFA 2W55A 5G5HA 3AM9A 2RDIA 2BCVA 4LZDA 3C1YA 3MR5A 2K60A 1XC9A 2GH1A 2C2EA 2ZIWA 2JEIA 2VA8A 1SV4A 3NTUA 4C4RA 4UB1A 4RT2A 1F0MA 4NLBA 4Y2UA 2FLPA 2WAQC 1Z1BA 3BZCA 3QYPA 1WYGA 2KSOA 3PX6A 4J9NA 1D9DA 1SIJA 2F1HA 2P35A 3MC1A 2I1QA 3T5LA 4KX5A 3V6JA 1T94A 1RQNA 3I28A 1JXEA 2W11A 3V7KA 2QARA 5AKYA 4EBEA 5HR7A 4ECRA 1ZQLA 4I2DA 3GV8B 1SL0A 7ICIA 4IR1A 9ICJA 2QB0A 3PW5A 1QQ7A 8ICSA 2ISPA 4YVZA 9ICFA 1PZNA 2H3FA 4LJXA 3PSIA 1D8YA 1KL9A 1ZQDA 4DSLA 2YB1A 4CF3A 3UMCA 1KTQA 5HP4A 1ZQNA 4TURA 2HHVA 3F53A 3H8SA 2WF8A 2BPCA 1ZRMA 3TI0A 1X66A 4F5PA 4O5EA 2CN1A 4GC6A 1LKYB 2UVRA 2W8LA 4FZLA 4DO9A 4C7ZA 2WF9A 4Y2QA 4ELTA 8ICNA 3RH5A 1XSPA 4DFPA 1A77A 4ECVA 8ICWA 3GQCA 1XSNA 2W9CA 2KV2A 3RR7A 2G5HB 2GO7A 4RQMA 3GFKB 3SEIA 4FE3A 3C28A 2ATLA 5ALDA 3SI8A 5J0WA 3OJSA 4UB8U 4Z6DA 5ALFA 3TFRA 2E1EA 4FZNA 4AYBC 3QU5A 3RJIA 2FI1A 8ICRA 4F5QA 4YR2A 4DWIA 5KFZA 2OM6A 4JUZA 5ALYA 4HYKA 4C80A 5ALMA 3OPXA 2XCPA 4RU9A 3IG8A 4KLSA 5KFSA 2ZTEA 3RRGA 1SB3C 4I27A 4DF8A 3AUOA 2F1IA 2AGPA 2R8KA 2A1AA 3I76A 3HJEA 4DSKA 1BPYA 1BVSA 4UAZA 3Q8PB 2E8NA 3QUTA 8ICUA 2ZIVB 3NGDA 1NKCA 5CRXA 3SMVA 5AKEA 4YQWA 2LPEA 9ICWA 2K8CB 4UB3A 3HRDD 5AM0A 4ED3A 5L1LA 4ECSA 1FFVA 1ZQHA 2KTQA 7ICUA 2W9MA 7ICSA 4UAWA 3ZDBA 3WU2U 4YMNA 2EQYA 5J2JA 2EZXA 5KFBA 2NRXA 1XO1A 9ICAA 5KFYA 3PV8A 2MA1A 2N1RA 1BGXT 1L3UA 7ICEA 1B0XA 3H40A 2B0CA 1TK0A 3TKAA 4RNMA 1CUKA 5KT5A 4J9RA 3N4MB 1ZQFA 5J2CA 4NWIA 1NI3A 2W8KA 9ICXA 2H3QA 4B9MA 1QH9A 3CP8A 3QX7A 3PNCA 3V72A 2UVWA 2MAXA 2H3ZA 2HHQA 1MQ2A 2ZIWB 3WKEA 4RNNA 4KLFA 3MR3A 1ZOLA 3ZDCA 3NS1A 4B9LA 1L7MA 2HCFA 4DOAA 4MF2A 2PFPA 2Y9UA 3ISCA 2NV3A 2XICA 4US9A 5BOMA 3QEAZ 4RPZA 2R18A 2KSOB 3EW9A 2G08A 3Q8SB 4ECUA 3Q8MA 2YMLA 4C4TA 1QSLA 4PGYA 4FBUA 1SV0C 4I2JA 1KBUA 1L3SA 7ICOA 2QARB 1CRXA 2FJ6A 3T79A 2DPIA 2W54A 2AQ0A 5C0YA 2LYBA 3T5HA 3WKCA 4J9MA 2QB0B 5FP0A 1J2MA 5KT4A 2NRTA 5DQGA 5KFFA 4XQ8A 8ICHA 1AQ6A 4BXOA 1BNOA 3EWAA 5ALOA 4DOCA 3NRZA 1ZQPA 5KG1A 4DFJA 2HBLA 1FEZA 4UBBA 2K8BB 4Y2JA 2VJ5A 1S0OA 4F93B 3V6HA 8ICVA 2GLEA 3ALRA 3WKDA 5KNIA 1TAUA 1ZQVA 3QU7A 4LZGA 4OCZA 2J6TA 1DK2A 3TANA 4RQ1A 7ICFA 5AM5A 3GV7B 4PZOA 1F44A 4NL9C 2KNJA 9ICLA 1PVQA 4K4IA 2FDRA 5AKIA 5AKGA 2PI4A 9ICMA 3QUQA 3DV9A 4DQIA 4RQ5A 3MGVA 3Q8QB 2PFNA 2LM1A 8ICBA 1ZRNA 5IILA 5CR0A 1SXDA 4TUPA 3C5GA 5JTIA 2KP7A 3PW7A 2YMMA 1A6SA 5DLFA 4PH5A 1Q3UA 4YR0A 3AL0B 5J0UA 3KHHA 2YTUA 9ICIA 4KX3A 3GIMA 7ICGA 1DGJA 2K8AA 3H8WA 2LHTA 5ALNA 3FC4A 1QCKA 2CRXA 4QZ8A 2A3VA 4PPXA 5JUMA 1SV0A 1K5OA 3QU4A 3E58A 5HNKA 2AU0A 2RRDA 2ZTDA 4NV0A 4Q43A 3KHLA 2Q0ZX 2L5YA 4RNOA 7ICRA 5ALHA 3BQ2A 1UCVA 1RDFA 3KHGA 5KFIA 1BNPA 2PFOA 5JU5A 5KTQA 2E8MA 1JROA 2V4QA 1TE2A 3D2QA 1XWLA 7ICMA 4QWEA 1VLBA 1AROP 4MHVA 3HT3A 4FS2A 2AH5A 1RYSA 4XUSA 3L3FX 2YX8A 4UB5A 2HI0A 1V38A 4RQ2A 2QB1A 2KFZA 4JWMA 4EX7A 4BJQA 2WTFA 4Q8EA 2ISOA 4Z6CA 4B9SA 5AKKA 1ZQKA 2JHDA 4RPXA 4OD0A 5HMMA 1DRGA 2W9AA 5EOZA 5J0TA 1H38A 1L8OA 4NL9A 1N5WA 5KL8B 4CGZA 1L3TA 4K4GA 1NZBA 2WF6A 1NNLA 4J9LA 4US8A 5ALGA 4C8LA 4DS4A 5KFKA 3H0LB 4F3OA 4GXKA 4M47A 5J0SA 8ICIA 2EAOA 1LKYA 3RFAA 4CDGA 3LVVA 2NRWA 1BPDA 2HBMA 5DB8A 2RP5A 3NVVA 4J9SA 3CW2C 4NJ8A 2XY7A 4P0QA 4Y2RA 2OXOA 1SKWA 7ICKA 5ALIA 3RB4A 1D8LA 3GIKA 1ZQSA 1Y88A 3LVWA 2R8GA 4BXOB 3EYZA 2KEYA 2M0NA 4KLTA 1U45A 2V9WA 3PSPA 4U7CA 5J2BA 5AM3A 2HHSA 3L4PA 1B4FA 2CXYA 1O03A 4UB6U 2IOHA 3UMGA 5ALRA 1KLNA 2LMRA 2W7PA 2HVIA 5J8YC 5D49A 3LWMA 1X6JA 1SGGA 1P7DA 1SZPA 2MU2A 1NK4A 5J2HA 3N97B 2ZIVA 5AIAA 3BDPA 3Q8RB 1DGSA 4OJPA 3ETRA 1IV8A 3TADC 5B66U 2LM4A 3I1YA 3CNHA 4GC7A 4ELVA 2R8HA 4FFDA 1L7PA 3OHBA 4B9TA 2R8JA 1QTMA 3RJFA 1LB2B 1ZETA 2ZJ8A 4KLIA 1L3VA 3SENA 2P66A 5ALVA 1N48A 2Y9TA 5L1MA 4TQSA 4PHPA 1NOMA 3H4DA 1KKXA 3WK9A 4F4ZA 4IC9A 3ONNA 2DKZA 2JH7A 4JK1A 1ZQAA 3BQ7A 8ICTA 3M6KA 1SZHA 1ZJNA 4XRHA 1SWWA 2KOBA 5F9NA 5KG3A 4I2FA 2VA2A 4QW8A 7ICHA 1JXLA 2LI6A 1S0MA 8ICEA 4YXMA 2BHNA 8ICGA 4NM2A 2FE9A 7ICQA 1QLNA 1COOA 4DQRA 1N60A 2W04A 2G06A 3Q8LA 4EELA 4RQ6A 1KSPA 4I29A 4QZFA 5HHHA 2KKPA 4EEKA 4FZMA 4PHEA 4F4WA
chains in the Genus database with same CATH topology
4E0DA 5KT6A 3KHRA 9ICKA 1NK6A 1ZQWA 4QZDA 5DBAA 1KDHA 3AU2A 1L5UA 4KMUA 4RUAA 8ICUA 3NGDA 4YMMA 1NKCA 8ICXA 5DGAA 4UQGA 4YQWA 3UQ0A 9ICWA 4UB3A 4M6WA 8ICOA 2Y1IA 4I2CA 4ED3A 2UVVA 1BPEA 5L1LA 5KFXA 4ECSA 4P4OA 1CEZA 5L1JA 1ZQHA 3RJGA 2W9MA 2KTQA 7ICUA 7ICSA 4EZ9A 4UAWA 3ZDBA 4YR3A 4IQUA 5J0YA 4KLLA 4C8KA 4I2HA 4YMNA 2W9CB 7ICJA 2BKEA 4YXJA 4ECZA 2GWSA 5J2JA 1SL2A 5KFBA 4PHAA 1NK5A 1IXRA 2ASJA 1BPXA 2IBKA 1S9FA 2NRXA 4JV0A 1XO1A 9ICAA 5KFYA 3PV8A 3SYZA 4F5NA 2ALZA 1BGXT 7ICVA 2BCRA 1T3NA 1S76D 2W9BB 4MF2A 1S77D 1NK9A 3HPOA 1U4BA 2AQ4A 1L3UA 7ICEA 3H40A 4Q44A 4DSEA 1TK0A 4RQ7A 2XO7A 4MFCA 4RNMA 1CUKA 5J0OA 5EWEA 5KFOA 3OGUA 5KT5A 4J9RA 3N4MB 1ZQFA 2PFQA 5J2CA 5IIKA 1BPZA 3PR4A 2W8KA 9ICXA 2ZUBA 4B9MA 3PNCA 4ECYA 4O9MA 4DS5A 3V72A 5J0PA 2UVWA 2MAXA 4KTQA 1TKDA 2HHQA 2XY6A 3TAQA 1NKBA 4RNNA 1MQ2A 4KLFA 3MR3A 4I2GA 3T3FA 2BCQA 3ZDCA 5DLGA 4B9LA 3T5JA 2KN7A 4QWCA 3PW0A 2A1JA 4KLJA 1NK7A 2C2DA 3EPGA 4O3RA 3ISDA 4DOAA 4FO6A 3ZDEA 4Q45A 2XY5A 4J9OA 1SKRA 1RYRA 2PFPA 4ELUA 3ISCA 2ZUCA 4M0AA 5CWRA 8ICMA 4TUSA 2IHMA 4DSIA 2MUTA 3T5KA 4UAYA 4DQQA 2BQRA 5KFAA 2P6UA 4MFFA 5BOMA 3QEAZ 3PW4A 4P2HA 4RPZA 2BPGA 1KEJA 4DL2A 2IHNA 1S97A 2BDPA 4JV1A 4G3IA 8ICJA 5HHIA 3TAPA 3EW9A 1U48A 3Q8SB 4ECUA 3OHAA 3Q8MA 4O5CA 5J2KA 4EYHB 5DB6A 5KFCA 1B43A 1QSLA 4PGYA 2C28A 4FBUA 4LVSA 3KTQA 4I2JA 4KITB 2RDJA 2ASDA 2PI5A 4EEYA 5BOLA 7ICTA 1ZQRA 1L3SA 3FDSA 7ICOA 3RB0A 9ICNA 4DL3A 3PVXA 2DPIA 2XC9A 4F50A 3QZ7A 5L9XA 4IQWA 2M9NA 2HHUA 2HHWA 5TZVA 4RZRA 2IA6A 2AQ0A 4P4MA 4FBTA 2FMPA 3T5HA 1NKEA 8ICPA 4J9MA 1ZJMA 9ICGA 3UQ2A 5KT7A 3SV4A 1HJPA 2XGQA 3RJEA 5KT4A 3V7LA 4I2BA 2NRTA 5DQGA 5KFFA 4XQ8A 4F4YA 5DG7A 3IHQB 3PMLA 3M9OB 1NK0A 2ZTCA 1NJWA 8ICHA 5DDYA 4BXOA 7ICPA 4I2AA 4YFKA 3EWAA 5KG4A 1JX4A 1K1SA 4DOCA 5KG2A 4NY8A 1ZQPA 5KG5A 4NLNA 5KG1A 5J2AA 4DFJA 4KLEA 3MGHA 2HHTA 1U9LA 2BPFA 3M8RA 4EYIB 3G6YA 4UBBA 3M9MB 5KG6A 1S0OA 3QE9Y 3GV5B 3GDXA 3MABA 1X2IA 4IRKA 4F93B 3V6HA 1ZQQA 8ICVA 1TAUA 3B0YA 1ZQVA 1IM4A 3GIIA 5L1KA 1TV9A 4CCHA 3V7JA 3MFIA 4LZGA 3M8SA 4QZ9A 1JN3A 4QWAA 3JPOA 2J6TA 4PGQA 1S0VA 4YCXA 3LK9A 9ICBA 5J29A 4ED1A 3TANA 2VA3A 4RQ1A 1V9PA 3OSNA 2C2RA 7ICFA 5CA7A 4O5KA 8ICQA 3GV7B 5DDMA 3MDCA 3MDAA 4EBCA 4IQVA 2HHXA 2KZZA 9ICLA 1Z00B 1TVAA 4I28A 4FS1A 4K4IA 3C2KA 5KFDA 3ETLA 5IIIA 4O3QA 5J2FA 1NJXA 2PI4A 9ICMA 4DQIA 4RQ5A 4YD2A 4B9VA 4ED8A 4IR9A 3Q8QB 1MQ3A 4F2SA 5D4BA 2PFNA 4YMOA 4DSFA 3PX0A 8ICBA 1RXWA 1X9SA 4DLEA 1LV5A 2JEFA 3C1ZA 5IINA 5IILA 2VANA 5CR0A 4BGDA 4TQRA 4TUPA 4M2YA 4RUCA 3RBDA 3HX0A 1T4GA 1ZQJA 4KLQA 3C5GA 4ECTA 1TK8A 1S0NA 3PW7A 5KFEA 1SL1A 3UXNA 1XSLA 3PR5B 4DL5A 2V4RA 2J6SA 5DLFA 4PH5A 4DQPA 4F92B 5KFPA 4JWNA 5IIOA 1KFDA 4UBCA 3RAQA 2FMQA 1NK8A 4YR0A 4B9UA 5J2IA 9ICTA 3TFSA 5J0UA 2FPMA 5DQIA 3H4BA 4ECQA 2JZBB 3KHHA 4MEXA 4M9LA 4QZCA 4NM1A 1ZQIA 3SV3A 4O3SA 3THVA 4KLGA 3GIMA 4R66A 7ICGA 5DBCA 1QSSA 3RJJA 2P6RA 4KLMA 4KN4A 5IIJA 2FLLA 3H8WA 2XCAA 3K4GA 1ZQCA 1ZQXA 4MFAA 2PXIA 1QSYA 5KFLA 4QZ8A 5KG7A 4Z6FA 3MR2A 2FMSA 4IRCA 8ICLA 9ICVA 3G6VA 1Z3EB 4PPXA 8ICFA 2BGWA 5JUMA 4DL6A 1UT5A 2FLNA 4M9GA 3C21A 4C8NA 1UA0A 2R8IA 4F4KA 1T7PA 5HNKA 9ICPA 4PGXA 1A76A 2AU0A 2JEGA 2OWOA 1ZYQA 2IMWP 5KFWA 5L1IA 2ZTDA 1ZQOA 4BDPA 2KZMA 4Q43A 3KHLA 4MF8A 3K75D 5DGBA 2Q0ZX 4MEYA 4J9KA 4RNOA 3TARA 4YP3A 4QZBA 7ICRA 3OSPA 3BQ2A 4I2EA 3PMNA 4NLGA 2H5XA 3JPTA 1ZQBA 4F5RA 5J2EA 3KHGA 2BCSA 1U47A 5KFNA 5KFGA 5J0QA 5KT3A 5KFIA 3MR6A 4F5OA 2ZJAA 1ZQEA 2PFOA 3E2EA 5KFMA 5DB9A 4RPYA 5CJ7A 5KTQA 4F2RA 2DPJA 1RXVA 9ICSA 4YD1A 2V4QA 3UXPA 3SZ2A 8ICCA 1HUZA 3M9NB 7ICLA 1ZQUA 4M6WB 1XWLA 5DBBA 1MC8A 3JPPA 3EPIA 4DEZA 5BPCA 4DFMA 7ICMA 4M9NA 4QWEA 5J2GA 3V6KA 3RTVA 1NJZA 8ICKA 4J9PA 1AROP 4I2IA 5CHGA 4DOBA 3HT3A 4FS2A 2FPLA 3UXOA 1RYSA 4XUSA 4F8RA 3BQ0A 3HWTA 3UPQA 9ICUA 4ED7A 1X9WA 4UB4A 4UB5A 3Q8KA 2ZJ5A 4RQ2A 9ICRA 4RQ4A 1UT8A 4YN4A 2KFZA 4XA5A 8ICZA 4JWMA 3FYHA 4NXZA 4QZAA 2WTFA 4JV2A 4KLOA 4QZGA 1WCNA 4Q8EA 1HUOA 4QZHA 5IIMA 4Z6CA 1KRPA 2ISOA 4B9SA 2BQUA 4BWJA 1ZQKA 3RB6A 5CP2A 2AJQA 4RPXA 4R8UA 1ZQYA 5HMMA 2W9AA 5EOZA 4RT3A 5J0TA 2W9BA 4GXJA 4ED6A 2J6UA 3PX4A 3RJKA 4KLDA 1H38A 3C2LA 4ZH4A 4QZEA 5C5JA 1ZQMA 2NRZA 5DG8A 3RRHA 2BR0A 4C8MA 1XS9D 1L3TA 1D9FA 1RPLA 3PO4A 4C8OA 4K4GA 4GLXA 5EWFA 4J9LA 4C8LA 4BWMA 2RDIA 1TAQA 2BCVA 4LZDA 3C1YA 4DS4A 3MR5A 5KFKA 1XC9A 9ICHA 4F3OA 2A1JB 3MGIA 4GXKA 3RH6A 4M47A 2C2EA 5J0SA 2FPKA 2JEIA 8ICIA 2VA8A 2ZUDA 3B0XA 3EZ5A 1T8EA 2AGQA 4KLUA 2HW3A 2MUTB 3NTUA 3JPRA 4UB1A 4RT2A 3JPSA 2FLPA 2NRWA 1BPDA 3ZDDA 1S10A 5DB8A 1XU4A 4DFKA 2UVUA 3LDAA 3PX6A 4DF4A 4J9NA 1D9DA 2F1HA 5DB7A 4F4XA 3C23A 4R65A 4PHDA 4J9SA 2I1QA 3T5LA 3C2MA 2ASLA 3V6JA 4J9QA 4GXIA 3RR8A 3RJHA 2XY7A 1RZTA 3BQTA 1K1QA 1KFTA 1JXEA 3PO5A 3V7KA 5KT2A 3HW8A 5D46A 1SKWA 3C5FA 4EBEA 7ICKA 4ECRA 1ZQLA 5KFHA 5F9LA 4M9JA 4I2DA 3GV8B 3RB4A 1SL0A 1D8LA 7ICIA 3QZ8A 1KFSA 3QEBZ 3IM1A 2DFLA 5EWGA 4DSJA 3GIKA 4IR1A 9ICJA 9ICOA 1ZQSA 4KN7A 1TFRA 3H8JA 3PW5A 1Y88A 2R8GA 4BXOB 3ZDAA 4M04A 4RQ3A 3EYZA 3TQ1A 8ICSA 4KLTA 1U45A 2ISPA 2V9WA 4R8UB 3HP6A 7ICNA 1WCLA 1JIHA 5KG0A 4YVZA 9ICFA 2B21A 1PZNA 4YG2A 5J2BA 4IRDA 4QWDA 2Y1JA 3ORYA 3G6XA 2HHSA 3OJUA 3GILA 1D8YA 1ZQZA 1N56A 1ZQDA 4DSLA 2AGOA 4O3PA 5HMLA 2JEJA 1KTQA 4QW9A 5HP4A 1KLNA 4ECXA 1ZQNA 8ICYA 4TURA 4QZIA 2HHVA 3RH4A 3H8SA 3ISBA 2BPCA 8ICAA 9ICQA 3TI0A 1NJYA 1BPBA 4F5PA 2HVIA 4DLGA 5D49A 3LWMA 3MFHA 3RAXA 4X5VA 4O5EA 1SZPA 4GC6A 4ECWA 2F1JA 1NK4A 2UVRA 5J2HA 4RQ0A 3N97B 2W8LA 4EBDA 4EZ6A 3BDPA 4K4HA 3Q8RB 4DO9A 1DGSA 4Q8FA 1U49A 4ELTA 1Z00A 8ICNA 4NLKA 4R64A 3RH5A 3H7IA 5CB1A 4R63A 4GC7A 1XSPA 4ELVA 2R8HA 3OHBA 2I9GA 4B9TA 4DFPA 2R8JA 1QTMA 3RJFA 1LB2B 1A77A 4ECVA 2ZJ8A 1ZETA 4KLIA 4P4PA 8ICWA 3GQCA 1XSNA 1L3VA 3BJYA 2P66A 4NLZA 4F91B 1N48A 2W9CA 9ICEA 4TUQA 1EXNA 5KFVA 4O3NA 4TQSA 3JPQA 4PHPA 1NOMA 5KFRA 5KFQA 3RR7A 3H4DA 1SKSA 3GFKB 4F4ZA 3RB3A 4ED2A 4QWBA 4JK1A 1ZQAA 2KZ3A 5DKWA 4DQSA 2BQ3A 8ICTA 3LWLA 3PY8A 2ATLA 1ZJNA 4XRHA 3SI8A 4DL7A 5DG9A 5KFTA 1UA1A 5J0WA 4Z6DA 5KFJA 3OJSA 5F9NA 5KG3A 5DQHA 2XGPA 3BQ1A 4DL4A 1ZQTA 5J2DA 2VA2A 2JZBA 4I2FA 3TFRA 2C22A 4M9HA 3JPNA 4QW8A 3RJIA 1DOQA 1C7YA 4O0IA 4ED0A 1TK5A 1JXLA 8ICRA 7ICHA 4F5QA 4YR2A 4DWIA 5KFZA 3RBEA 9ICIA 4UB2A 1S0MA 8ICEA 4YXMA 4JUZA 2BHNA 4B9NA 8ICGA 2BCUA 4HYKA 4NM2A 1JMSA 3ZD8A 2XCPA 7ICQA 1QLNA 2KFNA 1X9MA 4KLHA 1COOA 4O3OA 2HVHA 4Z6EA 1ZQGA 4RU9A 4KLSA 5KFSA 1B22A 2ZTEA 3RRGA 4DQRA 3ZD9A 4I27A 4DF8A 3AU6A 3AUOA 3PW2A 5J0RA 9ICCA 2F1IA 3Q8LA 3MBYA 2AGPA 2R8KA 4RQ6A 3GIJA 1KSPA 4I29A 1MSWD 2LYHA 4QZFA 5J0XA 5HHHA 4DSKA 4RQ8A 5KFUA 2NRVA 1BPYA 1BVSA 4UAZA 4PHEA 3Q8PB 4F4WA 4IQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0D A;  5KT6 A;  3KHR A;  9ICK A;  1NK6 A;  1ZQW A;  4QZD A;  5DBA A;  1KDH A;  3AU2 A;  1L5U A;  4KMU A;  4RUA A;  8ICU A;  3NGD A;  4YMM A;  1NKC A;  8ICX A;  5DGA A;  4UQG A;  4YQW A;  3UQ0 A;  9ICW A;  4UB3 A;  4M6W A;  8ICO A;  2Y1I A;  4I2C A;  4ED3 A;  2UVV A;  1BPE A;  5L1L A;  5KFX A;  4ECS A;  4P4O A;  1CEZ A;  5L1J A;  1ZQH A;  3RJG A;  2W9M A;  2KTQ A;  7ICU A;  7ICS A;  4EZ9 A;  4UAW A;  3ZDB A;  4YR3 A;  4IQU A;  5J0Y A;  4KLL A;  4C8K A;  4I2H A;  4YMN A;  2W9C B;  7ICJ A;  2BKE A;  4YXJ A;  4ECZ A;  2GWS A;  5J2J A;  1SL2 A;  5KFB A;  4PHA A;  1NK5 A;  1IXR A;  2ASJ A;  1BPX A;  2IBK A;  1S9F A;  2NRX A;  4JV0 A;  1XO1 A;  9ICA A;  5KFY A;  3PV8 A;  3SYZ A;  4F5N A;  2ALZ A;  1BGX T;  7ICV A;  2BCR A;  1T3N A;  1S76 D;  2W9B B;  4MF2 A;  1S77 D;  1NK9 A;  3HPO A;  1U4B A;  2AQ4 A;  1L3U A;  7ICE A;  3H40 A;  4Q44 A;  4DSE A;  1TK0 A;  4RQ7 A;  2XO7 A;  4MFC A;  4RNM A;  1CUK A;  5J0O A;  5EWE A;  5KFO A;  3OGU A;  5KT5 A;  4J9R A;  3N4M B;  1ZQF A;  2PFQ A;  5J2C A;  5IIK A;  1BPZ A;  3PR4 A;  2W8K A;  9ICX A;  2ZUB A;  4B9M A;  3PNC A;  4ECY A;  4O9M A;  4DS5 A;  3V72 A;  5J0P A;  2UVW A;  2MAX A;  4KTQ A;  1TKD A;  2HHQ A;  2XY6 A;  3TAQ A;  1NKB A;  4RNN A;  1MQ2 A;  4KLF A;  3MR3 A;  4I2G A;  3T3F A;  2BCQ A;  3ZDC A;  5DLG A;  4B9L A;  3T5J A;  2KN7 A;  4QWC A;  3PW0 A;  2A1J A;  4KLJ A;  1NK7 A;  2C2D A;  3EPG A;  4O3R A;  3ISD A;  4DOA A;  4FO6 A;  3ZDE A;  4Q45 A;  2XY5 A;  4J9O A;  1SKR A;  1RYR A;  2PFP A;  4ELU A;  3ISC A;  2ZUC A;  4M0A A;  5CWR A;  8ICM A;  4TUS A;  2IHM A;  4DSI A;  2MUT A;  3T5K A;  4UAY A;  4DQQ A;  2BQR A;  5KFA A;  2P6U A;  4MFF A;  5BOM A;  3QEA Z;  3PW4 A;  4P2H A;  4RPZ A;  2BPG A;  1KEJ A;  4DL2 A;  2IHN A;  1S97 A;  2BDP A;  4JV1 A;  4G3I A;  8ICJ A;  5HHI A;  3TAP A;  3EW9 A;  1U48 A;  3Q8S B;  4ECU A;  3OHA A;  3Q8M A;  4O5C A;  5J2K A;  4EYH B;  5DB6 A;  5KFC A;  1B43 A;  1QSL A;  4PGY A;  2C28 A;  4FBU A;  4LVS A;  3KTQ A;  4I2J A;  4KIT B;  2RDJ A;  2ASD A;  2PI5 A;  4EEY A;  5BOL A;  7ICT A;  1ZQR A;  1L3S A;  3FDS A;  7ICO A;  3RB0 A;  9ICN A;  4DL3 A;  3PVX A;  2DPI A;  2XC9 A;  4F50 A;  3QZ7 A;  5L9X A;  4IQW A;  2M9N A;  2HHU A;  2HHW A;  5TZV A;  4RZR A;  2IA6 A;  2AQ0 A;  4P4M A;  4FBT A;  2FMP A;  3T5H A;  1NKE A;  8ICP A;  4J9M A;  1ZJM A;  9ICG A;  3UQ2 A;  5KT7 A;  3SV4 A;  1HJP A;  2XGQ A;  3RJE A;  5KT4 A;  3V7L A;  4I2B A;  2NRT A;  5DQG A;  5KFF A;  4XQ8 A;  4F4Y A;  5DG7 A;  3IHQ B;  3PML A;  3M9O B;  1NK0 A;  2ZTC A;  1NJW A;  8ICH A;  5DDY A;  4BXO A;  7ICP A;  4I2A A;  4YFK A;  3EWA A;  5KG4 A;  1JX4 A;  1K1S A;  4DOC A;  5KG2 A;  4NY8 A;  1ZQP A;  5KG5 A;  4NLN A;  5KG1 A;  5J2A A;  4DFJ A;  4KLE A;  3MGH A;  2HHT A;  1U9L A;  2BPF A;  3M8R A;  4EYI B;  3G6Y A;  4UBB A;  3M9M B;  5KG6 A;  1S0O A;  3QE9 Y;  3GV5 B;  3GDX A;  3MAB A;  1X2I A;  4IRK A;  4F93 B;  3V6H A;  1ZQQ A;  8ICV A;  1TAU A;  3B0Y A;  1ZQV A;  1IM4 A;  3GII A;  5L1K A;  1TV9 A;  4CCH A;  3V7J A;  3MFI A;  4LZG A;  3M8S A;  4QZ9 A;  1JN3 A;  4QWA A;  3JPO A;  2J6T A;  4PGQ A;  1S0V A;  4YCX A;  3LK9 A;  9ICB A;  5J29 A;  4ED1 A;  3TAN A;  2VA3 A;  4RQ1 A;  1V9P A;  3OSN A;  2C2R A;  7ICF A;  5CA7 A;  4O5K A;  8ICQ A;  3GV7 B;  5DDM A;  3MDC A;  3MDA A;  4EBC A;  4IQV A;  2HHX A;  2KZZ A;  9ICL A;  1Z00 B;  1TVA A;  4I28 A;  4FS1 A;  4K4I A;  3C2K A;  5KFD A;  3ETL A;  5III A;  4O3Q A;  5J2F A;  1NJX A;  2PI4 A;  9ICM A;  4DQI A;  4RQ5 A;  4YD2 A;  4B9V A;  4ED8 A;  4IR9 A;  3Q8Q B;  1MQ3 A;  4F2S A;  5D4B A;  2PFN A;  4YMO A;  4DSF A;  3PX0 A;  8ICB A;  1RXW A;  1X9S A;  4DLE A;  1LV5 A;  2JEF A;  3C1Z A;  5IIN A;  5IIL A;  2VAN A;  5CR0 A;  4BGD A;  4TQR A;  4TUP A;  4M2Y A;  4RUC A;  3RBD A;  3HX0 A;  1T4G A;  1ZQJ A;  4KLQ A;  3C5G A;  4ECT A;  1TK8 A;  1S0N A;  3PW7 A;  5KFE A;  1SL1 A;  3UXN A;  1XSL A;  3PR5 B;  4DL5 A;  2V4R A;  2J6S A;  5DLF A;  4PH5 A;  4DQP A;  4F92 B;  5KFP A;  4JWN A;  5IIO A;  1KFD A;  4UBC A;  3RAQ A;  2FMQ A;  1NK8 A;  4YR0 A;  4B9U A;  5J2I A;  9ICT A;  3TFS A;  5J0U A;  2FPM A;  5DQI A;  3H4B A;  4ECQ A;  2JZB B;  3KHH A;  4MEX A;  4M9L A;  4QZC A;  4NM1 A;  1ZQI A;  3SV3 A;  4O3S A;  3THV A;  4KLG A;  3GIM A;  4R66 A;  7ICG A;  5DBC A;  1QSS A;  3RJJ A;  2P6R A;  4KLM A;  4KN4 A;  5IIJ A;  2FLL A;  3H8W A;  2XCA A;  3K4G A;  1ZQC A;  1ZQX A;  4MFA A;  2PXI A;  1QSY A;  5KFL A;  4QZ8 A;  5KG7 A;  4Z6F A;  3MR2 A;  2FMS A;  4IRC A;  8ICL A;  9ICV A;  3G6V A;  1Z3E B;  4PPX A;  8ICF A;  2BGW A;  5JUM A;  4DL6 A;  1UT5 A;  2FLN A;  4M9G A;  3C21 A;  4C8N A;  1UA0 A;  2R8I A;  4F4K A;  1T7P A;  5HNK A;  9ICP A;  4PGX A;  1A76 A;  2AU0 A;  2JEG A;  2OWO A;  1ZYQ A;  2IMW P;  5KFW A;  5L1I A;  2ZTD A;  1ZQO A;  4BDP A;  2KZM A;  4Q43 A;  3KHL A;  4MF8 A;  3K75 D;  5DGB A;  2Q0Z X;  4MEY A;  4J9K A;  4RNO A;  3TAR A;  4YP3 A;  4QZB A;  7ICR A;  3OSP A;  3BQ2 A;  4I2E A;  3PMN A;  4NLG A;  2H5X A;  3JPT A;  1ZQB A;  4F5R A;  5J2E A;  3KHG A;  2BCS A;  1U47 A;  5KFN A;  5KFG A;  5J0Q A;  5KT3 A;  5KFI A;  3MR6 A;  4F5O A;  2ZJA A;  1ZQE A;  2PFO A;  3E2E A;  5KFM A;  5DB9 A;  4RPY A;  5CJ7 A;  5KTQ A;  4F2R A;  2DPJ A;  1RXV A;  9ICS A;  4YD1 A;  2V4Q A;  3UXP A;  3SZ2 A;  8ICC A;  1HUZ A;  3M9N B;  7ICL A;  1ZQU A;  4M6W B;  1XWL A;  5DBB A;  1MC8 A;  3JPP A;  3EPI A;  4DEZ A;  5BPC A;  4DFM A;  7ICM A;  4M9N A;  4QWE A;  5J2G A;  3V6K A;  3RTV A;  1NJZ A;  8ICK A;  4J9P A;  1ARO P;  4I2I A;  5CHG A;  4DOB A;  3HT3 A;  4FS2 A;  2FPL A;  3UXO A;  1RYS A;  4XUS A;  4F8R A;  3BQ0 A;  3HWT A;  3UPQ A;  9ICU A;  4ED7 A;  1X9W A;  4UB4 A;  4UB5 A;  3Q8K A;  2ZJ5 A;  4RQ2 A;  9ICR A;  4RQ4 A;  1UT8 A;  4YN4 A;  2KFZ A;  4XA5 A;  8ICZ A;  4JWM A;  3FYH A;  4NXZ A;  4QZA A;  2WTF A;  4JV2 A;  4KLO A;  4QZG A;  1WCN A;  4Q8E A;  1HUO A;  4QZH A;  5IIM A;  4Z6C A;  1KRP A;  2ISO A;  4B9S A;  2BQU A;  4BWJ A;  1ZQK A;  3RB6 A;  5CP2 A;  2AJQ A;  4RPX A;  4R8U A;  1ZQY A;  5HMM A;  2W9A A;  5EOZ A;  4RT3 A;  5J0T A;  2W9B A;  4GXJ A;  4ED6 A;  2J6U A;  3PX4 A;  3RJK A;  4KLD A;  1H38 A;  3C2L A;  4ZH4 A;  4QZE A;  5C5J A;  1ZQM A;  2NRZ A;  5DG8 A;  3RRH A;  2BR0 A;  4C8M A;  1XS9 D;  1L3T A;  1D9F A;  1RPL A;  3PO4 A;  4C8O A;  4K4G A;  4GLX A;  5EWF A;  4J9L A;  4C8L A;  4BWM A;  2RDI A;  1TAQ A;  2BCV A;  4LZD A;  3C1Y A;  4DS4 A;  3MR5 A;  5KFK A;  1XC9 A;  9ICH A;  4F3O A;  2A1J B;  3MGI A;  4GXK A;  3RH6 A;  4M47 A;  2C2E A;  5J0S A;  2FPK A;  2JEI A;  8ICI A;  2VA8 A;  2ZUD A;  3B0X A;  3EZ5 A;  1T8E A;  2AGQ A;  4KLU A;  2HW3 A;  2MUT B;  3NTU A;  3JPR A;  4UB1 A;  4RT2 A;  3JPS A;  2FLP A;  2NRW A;  1BPD A;  3ZDD A;  1S10 A;  5DB8 A;  1XU4 A;  4DFK A;  2UVU A;  3LDA A;  3PX6 A;  4DF4 A;  4J9N A;  1D9D A;  2F1H A;  5DB7 A;  4F4X A;  3C23 A;  4R65 A;  4PHD A;  4J9S A;  2I1Q A;  3T5L A;  3C2M A;  2ASL A;  3V6J A;  4J9Q A;  4GXI A;  3RR8 A;  3RJH A;  2XY7 A;  1RZT A;  3BQT A;  1K1Q A;  1KFT A;  1JXE A;  3PO5 A;  3V7K A;  5KT2 A;  3HW8 A;  5D46 A;  1SKW A;  3C5F A;  4EBE A;  7ICK A;  4ECR A;  1ZQL A;  5KFH A;  5F9L A;  4M9J A;  4I2D A;  3GV8 B;  3RB4 A;  1SL0 A;  1D8L A;  7ICI A;  3QZ8 A;  1KFS A;  3QEB Z;  3IM1 A;  2DFL A;  5EWG A;  4DSJ A;  3GIK A;  4IR1 A;  9ICJ A;  9ICO A;  1ZQS A;  4KN7 A;  1TFR A;  3H8J A;  3PW5 A;  1Y88 A;  2R8G A;  4BXO B;  3ZDA A;  4M04 A;  4RQ3 A;  3EYZ A;  3TQ1 A;  8ICS A;  4KLT A;  1U45 A;  2ISP A;  2V9W A;  4R8U B;  3HP6 A;  7ICN A;  1WCL A;  1JIH A;  5KG0 A;  4YVZ A;  9ICF A;  2B21 A;  1PZN A;  4YG2 A;  5J2B A;  4IRD A;  4QWD A;  2Y1J A;  3ORY A;  3G6X A;  2HHS A;  3OJU A;  3GIL A;  1D8Y A;  1ZQZ A;  1N56 A;  1ZQD A;  4DSL A;  2AGO A;  4O3P A;  5HML A;  2JEJ A;  1KTQ A;  4QW9 A;  5HP4 A;  1KLN A;  4ECX A;  1ZQN A;  8ICY A;  4TUR A;  4QZI A;  2HHV A;  3RH4 A;  3H8S A;  3ISB A;  2BPC A;  8ICA A;  9ICQ A;  3TI0 A;  1NJY A;  1BPB A;  4F5P A;  2HVI A;  4DLG A;  5D49 A;  3LWM A;  3MFH A;  3RAX A;  4X5V A;  4O5E A;  1SZP A;  4GC6 A;  4ECW A;  2F1J A;  1NK4 A;  2UVR A;  5J2H A;  4RQ0 A;  3N97 B;  2W8L A;  4EBD A;  4EZ6 A;  3BDP A;  4K4H A;  3Q8R B;  4DO9 A;  1DGS A;  4Q8F A;  1U49 A;  4ELT A;  1Z00 A;  8ICN A;  4NLK A;  4R64 A;  3RH5 A;  3H7I A;  5CB1 A;  4R63 A;  4GC7 A;  1XSP A;  4ELV A;  2R8H A;  3OHB A;  2I9G A;  4B9T A;  4DFP A;  2R8J A;  1QTM A;  3RJF A;  1LB2 B;  1A77 A;  4ECV A;  2ZJ8 A;  1ZET A;  4KLI A;  4P4P A;  8ICW A;  3GQC A;  1XSN A;  1L3V A;  3BJY A;  2P66 A;  4NLZ A;  4F91 B;  1N48 A;  2W9C A;  9ICE A;  4TUQ A;  1EXN A;  5KFV A;  4O3N A;  4TQS A;  3JPQ A;  4PHP A;  1NOM A;  5KFR A;  5KFQ A;  3RR7 A;  3H4D A;  1SKS A;  3GFK B;  4F4Z A;  3RB3 A;  4ED2 A;  4QWB A;  4JK1 A;  1ZQA A;  2KZ3 A;  5DKW A;  4DQS A;  2BQ3 A;  8ICT A;  3LWL A;  3PY8 A;  2ATL A;  1ZJN A;  4XRH A;  3SI8 A;  4DL7 A;  5DG9 A;  5KFT A;  1UA1 A;  5J0W A;  4Z6D A;  5KFJ A;  3OJS A;  5F9N A;  5KG3 A;  5DQH A;  2XGP A;  3BQ1 A;  4DL4 A;  1ZQT A;  5J2D A;  2VA2 A;  2JZB A;  4I2F A;  3TFR A;  2C22 A;  4M9H A;  3JPN A;  4QW8 A;  3RJI A;  1DOQ A;  1C7Y A;  4O0I A;  4ED0 A;  1TK5 A;  1JXL A;  8ICR A;  7ICH A;  4F5Q A;  4YR2 A;  4DWI A;  5KFZ A;  3RBE A;  9ICI A;  4UB2 A;  1S0M A;  8ICE A;  4YXM A;  4JUZ A;  2BHN A;  4B9N A;  8ICG A;  2BCU A;  4HYK A;  4NM2 A;  1JMS A;  3ZD8 A;  2XCP A;  7ICQ A;  1QLN A;  2KFN A;  1X9M A;  4KLH A;  1COO A;  4O3O A;  2HVH A;  4Z6E A;  1ZQG A;  4RU9 A;  4KLS A;  5KFS A;  1B22 A;  2ZTE A;  3RRG A;  4DQR A;  3ZD9 A;  4I27 A;  4DF8 A;  3AU6 A;  3AUO A;  3PW2 A;  5J0R A;  9ICC A;  2F1I A;  3Q8L A;  3MBY A;  2AGP A;  2R8K A;  4RQ6 A;  3GIJ A;  1KSP A;  4I29 A;  1MSW D;  2LYH A;  4QZF A;  5J0X A;  5HHH A;  4DSK A;  4RQ8 A;  5KFU A;  2NRV A;  1BPY A;  1BVS A;  4UAZ A;  4PHE A;  3Q8P B;  4F4W A;  4IQT A; 
#chains in the Genus database with same CATH topology
 4E0D A;  1NK6 A;  1KDH A;  4YMM A;  1O08 A;  5DGA A;  4UQG A;  1Z1V A;  2E1F A;  1CEZ A;  2W43 A;  5ALL A;  4KLL A;  3QNM A;  4YXJ A;  2GWS A;  2D3D A;  2OYY A;  4PHA A;  1S9F A;  4B6J A;  5EE3 A;  4JV0 A;  3S6J A;  3SAG A;  4A8E A;  4F5N A;  2ALZ A;  7ICV A;  1URJ A;  5ALT A;  3AQE A;  1T3N A;  1S76 D;  5AK6 A;  1NK9 A;  5E79 U;  2AQ4 A;  5J8Y A;  2AXT U;  2JMG A;  4RQ7 A;  5EWE A;  4QIW F;  5KFO A;  3OGU A;  2PFQ A;  3N7S C;  5IIK A;  1BPZ A;  1KQQ A;  4CNQ A;  4ECY A;  3TAD A;  4O9M A;  3WKB A;  4KTQ A;  1TKD A;  5AI8 A;  3QXG A;  2ESE A;  4DCC A;  5DLG A;  2E5S A;  3KOO A;  3B9J A;  1FO4 A;  4QWC A;  3F5A A;  3SAH A;  3J81 j;  2OEH A;  3H0M B;  4J9O A;  1SKR A;  4HAI A;  1OUQ A;  2K4I A;  2ZUC A;  2IHM A;  3T5K A;  2BQR A;  2PMZ F;  5KFA A;  2W03 A;  4J03 A;  3PW4 A;  1JAL A;  3D2S A;  3IP4 B;  5DB6 A;  1B43 A;  5AI4 A;  4LVS A;  3KTQ A;  3M6Z A;  2ASD A;  4EEY A;  4P0Q B;  3RF9 A;  7ICT A;  2RHF A;  3FDS A;  2KJ8 A;  9ICN A;  3PVX A;  2XC9 A;  4F50 A;  3QZ7 A;  2HHU A;  2M9N A;  2HHW A;  5TZV A;  5ALU A;  2WHE A;  4P4M A;  2WFA A;  2ZG6 A;  5ALK A;  2FMP A;  2KMD A;  4FBT A;  8ICP A;  3UQ2 A;  2B6G A;  2XGQ A;  3RJE A;  4F4Y A;  1NK0 A;  4UAV A;  3M9O B;  1NJW A;  5AI9 A;  1Z4O A;  4I2A A;  5KG4 A;  2ZIU B;  5AI6 A;  1LVH A;  4NLN A;  5J2A A;  1F5S A;  3HKZ F;  2BPF A;  3M9M B;  3GV5 B;  3GDX A;  3MAB A;  5KAI U;  1ZQQ A;  3B0Y A;  3GII A;  5L1K A;  1TV9 A;  3V7J A;  4QZ9 A;  3JPO A;  9ICB A;  4PGQ A;  2PKE A;  3LK9 A;  4ED1 A;  2VA3 A;  5DDM A;  5AKX A;  4EBC A;  2W3R A;  5AIB A;  4I28 A;  4FS1 A;  3SAF A;  5III A;  5J2F A;  1NJX A;  2KIC A;  1MQ3 A;  5D4B A;  3PX0 A;  2KJ9 A;  1X9S A;  1RG6 A;  4DLE A;  1LV5 A;  2JEF A;  5IIN A;  4BGD A;  1ECW A;  4RUC A;  1T4G A;  4KLQ A;  1TK8 A;  2BDU A;  5KFE A;  3UXN A;  3PR5 B;  4DL5 A;  2V4R A;  2DGZ A;  4F92 B;  4JWN A;  5IIO A;  1KFD A;  3RAQ A;  1WWU A;  1NK8 A;  3TAC B;  4C7Y A;  3GU3 A;  4ECQ A;  4O3S A;  4R66 A;  3RJJ A;  5GTI U;  2P6R A;  2XCA A;  3K4G A;  1ZQC A;  2PXI A;  2F77 X;  5KFL A;  4Z6F A;  3MR2 A;  1ZD3 A;  3G6V A;  1Z3E B;  4DL6 A;  1UT5 A;  3C21 A;  1UA0 A;  2R8I A;  2WB1 F;  2JEG A;  2JH1 A;  5KFW A;  4BX9 C;  3FM9 A;  3WK4 A;  3TAR A;  5DGB A;  3DEE A;  4Y2P A;  3OSP A;  4I2E A;  2EH9 A;  2BZF A;  4NLG A;  3EUB 2;  4F5R A;  1U47 A;  5KFG A;  5KT3 A;  3MR6 A;  3E2E A;  2F76 X;  2JRZ A;  9ICS A;  4YD1 A;  3UXP A;  8ICC A;  5AI0 A;  1HUZ A;  3M9N B;  1ZQU A;  3JPP A;  5KL1 B;  3EPI A;  4DEZ A;  2DBY A;  4M9N A;  5J2G A;  4QIW C;  4J9P A;  4DOB A;  3HWT A;  3UPQ A;  1FIQ A;  4ED7 A;  1X9W A;  2ZJ5 A;  4RQ4 A;  4YN4 A;  8ICZ A;  4QZA A;  2ODG A;  5TIS U;  1HUO A;  4Y2V A;  4QZH A;  2XI9 A;  1M6Y A;  4RT3 A;  2Z7J A;  2W9B A;  4GXJ A;  5F3X B;  2PMZ C;  2J6U A;  3IDW A;  4KLD A;  3C2L A;  1ZQM A;  3NUQ A;  5DG8 A;  3RRH A;  2KHQ A;  5AHX A;  1RPL A;  4C8O A;  1WG8 A;  5ALP A;  1TAQ A;  3RH6 A;  3MGI A;  2K4H A;  1D8B A;  3B0X A;  5AKL A;  3EZ5 A;  1T8E A;  3UMB A;  2HW3 A;  3QUB A;  3JPR A;  5AKZ A;  4PZN A;  3WK7 A;  3ZDD A;  4WJ3 B;  5ALE A;  1S10 A;  1XU4 A;  2UVU A;  3ZI4 A;  3LDA A;  4DF4 A;  3N7R C;  4EEN A;  5HR6 A;  4F4X A;  1S8O A;  3O0F A;  3WK8 A;  3C23 A;  2DL0 A;  1X42 A;  3C2M A;  2ASL A;  4J9Q A;  3HKZ C;  3VC8 A;  3RJH A;  2WF7 A;  2F44 A;  1K1Q A;  5KT2 A;  5D46 A;  5ALZ A;  2G09 A;  4M9J A;  5F9L A;  2HHT A;  3QZ8 A;  4Y2X A;  1KFS A;  3IM1 A;  2DFL A;  4DSJ A;  4KN7 A;  3H8M A;  3H8J A;  1J2N A;  1V97 A;  4M04 A;  3TQ1 A;  2JXJ A;  4R8U B;  7ICN A;  1WCL A;  1JIH A;  4IL6 U;  2MRL A;  4IRD A;  4QWD A;  2Y1J A;  3ORY A;  2E3T A;  5AKH A;  4JB3 A;  2AGO A;  3NVY A;  2KIV A;  3SQI A;  2EZY A;  2JEJ A;  4QW9 A;  2F2A B;  4ECX A;  4QZI A;  3RH4 A;  1ZD5 A;  1KN5 A;  2YMP A;  1N5X A;  3D6J A;  3WK6 A;  2H3I A;  4QNL A;  4Q8F A;  1U49 A;  1Z00 A;  4NLK A;  5CB1 A;  4R63 A;  1YZ6 A;  5CEH A;  3BJY A;  4NLZ A;  4F91 B;  9ICE A;  2KD1 A;  5KFV A;  3K1R B;  5KFR A;  4CRX A;  2KZ3 A;  2WB1 C;  4DQS A;  2BQ3 A;  3PY8 A;  5ALS A;  3H0R B;  4DL7 A;  5KFJ A;  3BQ1 A;  4DL4 A;  2JR5 A;  2XGP A;  2JZB A;  4M9H A;  4UAT A;  2C22 A;  1DOQ A;  4ED0 A;  5H2F U;  3PSF A;  3RBE A;  1OXJ A;  1QQ5 A;  3PZP A;  4B9N A;  1JMS A;  1X9M A;  4KLH A;  2HVH A;  4OJ6 A;  1B22 A;  1T3Q A;  3PW2 A;  1XNS A;  9ICC A;  2QKQ A;  5J0X A;  3DDH A;  3K1Z A;  5KFU A;  2NRV A;  5KT6 A;  3KHR A;  1ZQW A;  1DK3 A;  3AU2 A;  1L5U A;  4KMU A;  8ICX A;  1WWV A;  3UQ0 A;  1CI4 A;  4M6W A;  4I2C A;  2VIX A;  4P4O A;  5A0L A;  5L1J A;  1S5L U;  2HDO A;  4YR3 A;  4C8K A;  1UHU A;  2BKE A;  4ACO A;  2NO4 A;  4F72 A;  3AEV A;  1MN8 A;  1OW5 A;  1ZD2 P;  2W9B B;  4U6P A;  2ZIU A;  3HPO A;  2XO7 A;  4MFC A;  5J0P A;  3A0H U;  2XY6 A;  3TAQ A;  3T3F A;  2BCQ A;  3F2D A;  3T5J A;  2A1J A;  4KLJ A;  1IIP A;  1NK7 A;  2C2D A;  3ISD A;  4FO6 A;  3ZDE A;  1PK3 A;  4Q45 A;  4M0A A;  5CWR A;  8ICM A;  2MUT A;  1L8L A;  2P6U A;  2BPG A;  1KEJ A;  4DL2 A;  2IHN A;  1S97 A;  2BDP A;  8ICJ A;  3TAP A;  1JRP A;  1U48 A;  3OHA A;  2HOQ A;  3IRU A;  3CRX A;  5J2K A;  4EYH B;  3WK5 A;  1PVP A;  2HSZ A;  1X6I A;  2YMQ A;  5EE0 A;  2RDJ A;  2PI5 A;  5BOL A;  5AI5 A;  1QQ6 A;  1ZQR A;  2G0A A;  3RB0 A;  1SWV A;  5L9X A;  4IQW A;  2XVT A;  1NZP A;  1NKE A;  5KT7 A;  3SV4 A;  1HJP A;  2HOF A;  5ALQ A;  3V7L A;  3KD3 A;  4ICA A;  5DG7 A;  3IHQ B;  5DDY A;  4YFK A;  1K1S A;  3HIL A;  4NY8 A;  2DKX A;  4KLE A;  3MGH A;  1U9L A;  3CYM A;  3E0F A;  2KK0 A;  4Y2T A;  1ZXI A;  5KG6 A;  3IV6 A;  3IG5 A;  1X2I A;  4IRK A;  3NVW A;  1C20 A;  4ZOH C;  4CCH A;  3BS5 A;  1JN3 A;  1S0V A;  3OSN A;  4RQN A;  2C2R A;  4AP9 A;  5CA7 A;  4O5K A;  8ICQ A;  3NAS A;  3MDA A;  4IQV A;  1MA7 A;  1Z00 B;  2LYA A;  3C2K A;  5KFD A;  4O3Q A;  2KG5 A;  4EX6 A;  3UM9 A;  4YD2 A;  1ZQ1 C;  4IR9 A;  2CPR A;  1RXW A;  4CF4 A;  1Z4N A;  2VAN A;  2KHV A;  5AK5 A;  3VCB A;  1S0N A;  1SL1 A;  1XSL A;  3KZI U;  2J6S A;  3GZF A;  5KFP A;  4UBC A;  3LYS A;  3TFS A;  1L7O A;  4MEX A;  5DQI A;  3H4B A;  2JZB B;  4M9L A;  4NM1 A;  9ICH A;  3SV3 A;  3THV A;  1QSS A;  4KLM A;  4KN4 A;  2I5H A;  2KVC A;  1ZQX A;  4MFA A;  1N62 A;  5K4L A;  5KG7 A;  4IRC A;  3SR6 A;  2FMS A;  9ICV A;  2DF4 B;  1N63 A;  5AK4 A;  5AM2 A;  2BGW A;  4M9G A;  1T7P A;  1COK A;  1RQL A;  4PGX A;  1A76 A;  2OWO A;  1ZYQ A;  2IMW P;  1KW4 A;  2K89 A;  3K75 D;  4BUG A;  2HBK A;  2H5X A;  3JPT A;  1ZQB A;  5J2E A;  2BCS A;  5KFN A;  4F5O A;  2ZJA A;  2ZIX A;  4RPY A;  5CJ7 A;  1RXV A;  3SZ2 A;  5DBB A;  4M6W B;  5BPC A;  2EAN A;  4C0Z A;  1N61 A;  3V6K A;  3RTV A;  2KJ5 A;  4I2I A;  2ZXI A;  2FPL A;  4F8R A;  3BQ0 A;  3Q8K A;  9ICR A;  4XA5 A;  4C4S A;  3KKA C;  4OJ5 A;  4KLO A;  4NXZ A;  1N2X A;  1WCN A;  5IIM A;  1KRP A;  2Y0S F;  3NVZ A;  3RB6 A;  5CP2 A;  2AJQ A;  1HEK A;  4R8U A;  1ZQY A;  2LBO A;  2D8C A;  3PX4 A;  3RJK A;  2K4E A;  5T14 A;  2K4P A;  5C5J A;  2NRZ A;  4P0P A;  1XS9 D;  1D9F A;  1PVR A;  4BWM A;  2A1J B;  4UAS A;  2FPK A;  3U26 A;  2ZUD A;  4KMO B;  2AGQ A;  4KLU A;  3QUC A;  2MUT B;  1JI7 A;  3JPS A;  2I6X A;  3PST A;  4DFK A;  2GOL A;  4GIB A;  5DB7 A;  4R65 A;  4PHD A;  4DFD A;  4GXI A;  3RR8 A;  4OJL A;  1RZT A;  3BQT A;  1KFT A;  2G5I B;  2IOF A;  2EAM A;  2JV3 A;  3PO5 A;  1Q8K A;  3HW8 A;  3C5F A;  2VKQ A;  5KFH A;  1JUD A;  4G9B A;  3QEB Z;  5EWG A;  9ICO A;  1TFR A;  3ZDA A;  4RQ3 A;  3F2C A;  3HP6 A;  2YN4 A;  5KG0 A;  2B21 A;  4YG2 A;  3G6X A;  3OJU A;  1X9X A;  3GIL A;  1ZQZ A;  1N56 A;  4O3P A;  5HML A;  3BZK A;  3BS5 B;  3QU9 A;  1YZ7 A;  8ICY A;  9ICQ A;  8ICA A;  1IG6 A;  2QLT A;  3ISB A;  1NJY A;  1FFU A;  1BPB A;  4UAR A;  2E8P A;  4DLG A;  3RAX A;  4X5V A;  3MFH A;  4ECW A;  2F1J A;  3KKA A;  5GTH U;  4RQ0 A;  4EBD A;  4EZ6 A;  4K4H A;  1DXS A;  4R64 A;  3H7I A;  2KE7 A;  2I9G A;  2ES6 A;  2OCE A;  1L7N A;  4P4P A;  2YQE A;  1VDV A;  3AN1 A;  1EXN A;  4TUQ A;  4O3N A;  3JPQ A;  5KFQ A;  1SKS A;  3RB3 A;  4USA A;  5AK3 A;  4ED2 A;  1TAM A;  4QWB A;  5DKW A;  3LWL A;  2HBJ A;  5KFT A;  2Q4T A;  5DG9 A;  1UA1 A;  4MFF A;  5DQH A;  3QU2 A;  5J2D A;  3JPN A;  1C7Y A;  4O0I A;  1TK5 A;  4UW9 A;  4UB2 A;  2BCU A;  3OTQ A;  3ZD8 A;  3KZX A;  2ZXH A;  2KFN A;  4O3O A;  4Z6E A;  1ZQG A;  4GFJ A;  5G5G A;  3ZD9 A;  3AU6 A;  5J0R A;  2NO5 A;  3MBY A;  3GIJ A;  1MSW D;  2LYH A;  4OO1 J;  4RQ8 A;  1UPH A;  2ZIX B;  3F2B A;  1HIW A;  4IQT A;  2Y0S C;  9ICK A;  4QZD A;  5DBA A;  4RUA A;  3M1Y A;  2W7O A;  1XO0 A;  8ICO A;  2Y1I A;  2UVV A;  1BPE A;  5KFX A;  1Q46 A;  3RJG A;  2HMX A;  4EZ9 A;  4IQU A;  5J0Y A;  3M7D A;  4I2H A;  2W9C B;  7ICJ A;  4ECZ A;  3F5E A;  3N7P D;  1SL2 A;  1NK5 A;  1IXR A;  2ASJ A;  1PK1 A;  1BPX A;  2IBK A;  2KIW A;  2RLT A;  2A19 A;  3SYZ A;  2BCR A;  1S77 D;  1U4B A;  2JGA A;  5ALX A;  4Q44 A;  4DSE A;  1ED1 A;  5AM4 A;  5J0O A;  4P0P B;  3PR4 A;  2OHF A;  2ZUB A;  4DS5 A;  1NKB A;  5EE1 A;  4PJ0 U;  4I2G A;  1Q3V A;  2O6K A;  2KN7 A;  3PW0 A;  3IN5 A;  3A0B U;  1VJ5 A;  3EPG A;  4UAU A;  4O3R A;  2XY5 A;  4ELU A;  1RYR A;  2NYV A;  2F8K A;  4TUS A;  4DSI A;  2W3S A;  1RM6 C;  4UAY A;  4DQQ A;  9ICG A;  1J97 A;  1SXE A;  4P2H A;  2D6F C;  4G3I A;  4JV1 A;  5HHI A;  2RQ5 A;  1X40 A;  4O5C A;  1L6N A;  3KFU F;  5KFC A;  2C28 A;  4Y2Y A;  4KIT B;  5KAF U;  1V85 A;  4QJF B;  4DL3 A;  3AMZ A;  1WUD A;  4RZR A;  2IA6 A;  2EZZ A;  1Z19 A;  4O3M A;  4PL1 A;  4PL2 A;  1RYU A;  1ZJM A;  5EE9 A;  2WAQ F;  2OH2 A;  4JMU A;  4I2B A;  1ZQT A;  3PML A;  2ZTC A;  3C29 A;  7ICP A;  2G07 A;  1JX4 A;  5KG2 A;  5KG5 A;  1YT3 A;  2MSN A;  3M8R A;  4EYI B;  3AQF A;  3G6Y A;  3QE9 Y;  1IM4 A;  3MFI A;  3M8S A;  4QWA A;  4YCX A;  3N28 A;  5J29 A;  1V9P A;  2H3V A;  4CF5 A;  5ALW A;  3MDC A;  2HHX A;  5ALJ A;  2KZZ A;  1TVA A;  2EDU A;  2YY6 A;  3ETL A;  2KVS A;  3R9K A;  2E8O A;  4B9V A;  4ED8 A;  4F2S A;  4YMO A;  4IS7 A;  4DSF A;  3C1Z A;  4TQR A;  4M2Y A;  3RBD A;  3HX0 A;  1ZQJ A;  4ECT A;  3ICX A;  3NRW A;  5AIC A;  2AHO B;  4DQP A;  3ED5 A;  1GO3 F;  2FMQ A;  4B9U A;  5J2I A;  9ICT A;  3FAH A;  2FPM A;  2F8L A;  4KLG A;  4QZC A;  1ZQI A;  2KKV A;  5DBC A;  2VJ4 A;  4Y2S A;  5IIJ A;  2FLL A;  1PUZ A;  1UQV A;  1A0P A;  1QSY A;  2DQN B;  3WKA A;  8ICL A;  3L5K A;  5AKJ A;  8ICF A;  1ZD4 A;  2FLN A;  4C8N A;  2F3N A;  4NLC A;  4F4K A;  9ICP A;  2XID A;  4CE6 A;  5L1I A;  4BDP A;  1ZQO A;  2IOF K;  2KZM A;  4J9K A;  4MF8 A;  4MEY A;  4YP3 A;  4QZB A;  2DWQ A;  4F71 A;  3PMN A;  3BS7 A;  4OJO A;  4AYB F;  5J0Q A;  1ZQE A;  5KFM A;  5DB9 A;  4F2R A;  2DPJ A;  3D2N A;  7ICL A;  1MC8 A;  2DUY A;  4DFM A;  5JRT A;  2LKY A;  1NJZ A;  2WF5 A;  8ICK A;  5CHG A;  3UXO A;  9ICU A;  4UB4 A;  2EAP A;  1PK1 B;  1UT8 A;  3FYH A;  4JV2 A;  4QZG A;  2BQU A;  4BWJ A;  3KBB A;  4ED6 A;  5AM1 A;  2YB4 A;  4ZH4 A;  4QZE A;  3SD7 A;  4C8M A;  2BR0 A;  5B5E U;  3PO4 A;  2HOI A;  4GLX A;  5EWF A;  2W55 A;  5G5H A;  3AM9 A;  2RDI A;  2BCV A;  4LZD A;  3C1Y A;  3MR5 A;  2K60 A;  1XC9 A;  2GH1 A;  2C2E A;  2ZIW A;  2JEI A;  2VA8 A;  1SV4 A;  3NTU A;  4C4R A;  4UB1 A;  4RT2 A;  1F0M A;  4NLB A;  4Y2U A;  2FLP A;  2WAQ C;  1Z1B A;  3BZC A;  3QYP A;  1WYG A;  2KSO A;  3PX6 A;  4J9N A;  1D9D A;  1SIJ A;  2F1H A;  2P35 A;  3MC1 A;  2I1Q A;  3T5L A;  4KX5 A;  3V6J A;  1T94 A;  1RQN A;  3I28 A;  1JXE A;  2W11 A;  3V7K A;  2QAR A;  5AKY A;  4EBE A;  5HR7 A;  4ECR A;  1ZQL A;  4I2D A;  3GV8 B;  1SL0 A;  7ICI A;  4IR1 A;  9ICJ A;  2QB0 A;  3PW5 A;  1QQ7 A;  8ICS A;  2ISP A;  4YVZ A;  9ICF A;  1PZN A;  2H3F A;  4LJX A;  3PSI A;  1D8Y A;  1KL9 A;  1ZQD A;  4DSL A;  2YB1 A;  4CF3 A;  3UMC A;  1KTQ A;  5HP4 A;  1ZQN A;  4TUR A;  2HHV A;  3F53 A;  3H8S A;  2WF8 A;  2BPC A;  1ZRM A;  3TI0 A;  1X66 A;  4F5P A;  4O5E A;  2CN1 A;  4GC6 A;  1LKY B;  2UVR A;  2W8L A;  4FZL A;  4DO9 A;  4C7Z A;  2WF9 A;  4Y2Q A;  4ELT A;  8ICN A;  3RH5 A;  1XSP A;  4DFP A;  1A77 A;  4ECV A;  8ICW A;  3GQC A;  1XSN A;  2W9C A;  2KV2 A;  3RR7 A;  2G5H B;  2GO7 A;  4RQM A;  3GFK B;  3SEI A;  4FE3 A;  3C28 A;  2ATL A;  5ALD A;  3SI8 A;  5J0W A;  3OJS A;  4UB8 U;  4Z6D A;  5ALF A;  3TFR A;  2E1E A;  4FZN A;  4AYB C;  3QU5 A;  3RJI A;  2FI1 A;  8ICR A;  4F5Q A;  4YR2 A;  4DWI A;  5KFZ A;  2OM6 A;  4JUZ A;  5ALY A;  4HYK A;  4C80 A;  5ALM A;  3OPX A;  2XCP A;  4RU9 A;  3IG8 A;  4KLS A;  5KFS A;  2ZTE A;  3RRG A;  1SB3 C;  4I27 A;  4DF8 A;  3AUO A;  2F1I A;  2AGP A;  2R8K A;  2A1A A;  3I76 A;  3HJE A;  4DSK A;  1BPY A;  1BVS A;  4UAZ A;  3Q8P B;  2E8N A;  3QUT A;  8ICU A;  2ZIV B;  3NGD A;  1NKC A;  5CRX A;  3SMV A;  5AKE A;  4YQW A;  2LPE A;  9ICW A;  2K8C B;  4UB3 A;  3HRD D;  5AM0 A;  4ED3 A;  5L1L A;  4ECS A;  1FFV A;  1ZQH A;  2KTQ A;  7ICU A;  2W9M A;  7ICS A;  4UAW A;  3ZDB A;  3WU2 U;  4YMN A;  2EQY A;  5J2J A;  2EZX A;  5KFB A;  2NRX A;  1XO1 A;  9ICA A;  5KFY A;  3PV8 A;  2MA1 A;  2N1R A;  1BGX T;  1L3U A;  7ICE A;  1B0X A;  3H40 A;  2B0C A;  1TK0 A;  3TKA A;  4RNM A;  1CUK A;  5KT5 A;  4J9R A;  3N4M B;  1ZQF A;  5J2C A;  4NWI A;  1NI3 A;  2W8K A;  9ICX A;  2H3Q A;  4B9M A;  1QH9 A;  3CP8 A;  3QX7 A;  3PNC A;  3V72 A;  2UVW A;  2MAX A;  2H3Z A;  2HHQ A;  1MQ2 A;  2ZIW B;  3WKE A;  4RNN A;  4KLF A;  3MR3 A;  1ZOL A;  3ZDC A;  3NS1 A;  4B9L A;  1L7M A;  2HCF A;  4DOA A;  4MF2 A;  2PFP A;  2Y9U A;  3ISC A;  2NV3 A;  2XIC A;  4US9 A;  5BOM A;  3QEA Z;  4RPZ A;  2R18 A;  2KSO B;  3EW9 A;  2G08 A;  3Q8S B;  4ECU A;  3Q8M A;  2YML A;  4C4T A;  1QSL A;  4PGY A;  4FBU A;  1SV0 C;  4I2J A;  1KBU A;  1L3S A;  7ICO A;  2QAR B;  1CRX A;  2FJ6 A;  3T79 A;  2DPI A;  2W54 A;  2AQ0 A;  5C0Y A;  2LYB A;  3T5H A;  3WKC A;  4J9M A;  2QB0 B;  5FP0 A;  1J2M A;  5KT4 A;  2NRT A;  5DQG A;  5KFF A;  4XQ8 A;  8ICH A;  1AQ6 A;  4BXO A;  1BNO A;  3EWA A;  5ALO A;  4DOC A;  3NRZ A;  1ZQP A;  5KG1 A;  4DFJ A;  2HBL A;  1FEZ A;  4UBB A;  2K8B B;  4Y2J A;  2VJ5 A;  1S0O A;  4F93 B;  3V6H A;  8ICV A;  2GLE A;  3ALR A;  3WKD A;  5KNI A;  1TAU A;  1ZQV A;  3QU7 A;  4LZG A;  4OCZ A;  2J6T A;  1DK2 A;  3TAN A;  4RQ1 A;  7ICF A;  5AM5 A;  3GV7 B;  4PZO A;  1F44 A;  4NL9 C;  2KNJ A;  9ICL A;  1PVQ A;  4K4I A;  2FDR A;  5AKI A;  5AKG A;  2PI4 A;  9ICM A;  3QUQ A;  3DV9 A;  4DQI A;  4RQ5 A;  3MGV A;  3Q8Q B;  2PFN A;  2LM1 A;  8ICB A;  1ZRN A;  5IIL A;  5CR0 A;  1SXD A;  4TUP A;  3C5G A;  5JTI A;  2KP7 A;  3PW7 A;  2YMM A;  1A6S A;  5DLF A;  4PH5 A;  1Q3U A;  4YR0 A;  3AL0 B;  5J0U A;  3KHH A;  2YTU A;  9ICI A;  4KX3 A;  3GIM A;  7ICG A;  1DGJ A;  2K8A A;  3H8W A;  2LHT A;  5ALN A;  3FC4 A;  1QCK A;  2CRX A;  4QZ8 A;  2A3V A;  4PPX A;  5JUM A;  1SV0 A;  1K5O A;  3QU4 A;  3E58 A;  5HNK A;  2AU0 A;  2RRD A;  2ZTD A;  4NV0 A;  4Q43 A;  3KHL A;  2Q0Z X;  2L5Y A;  4RNO A;  7ICR A;  5ALH A;  3BQ2 A;  1UCV A;  1RDF A;  3KHG A;  5KFI A;  1BNP A;  2PFO A;  5JU5 A;  5KTQ A;  2E8M A;  1JRO A;  2V4Q A;  1TE2 A;  3D2Q A;  1XWL A;  7ICM A;  4QWE A;  1VLB A;  1ARO P;  4MHV A;  3HT3 A;  4FS2 A;  2AH5 A;  1RYS A;  4XUS A;  3L3F X;  2YX8 A;  4UB5 A;  2HI0 A;  1V38 A;  4RQ2 A;  2QB1 A;  2KFZ A;  4JWM A;  4EX7 A;  4BJQ A;  2WTF A;  4Q8E A;  2ISO A;  4Z6C A;  4B9S A;  5AKK A;  1ZQK A;  2JHD A;  4RPX A;  4OD0 A;  5HMM A;  1DRG A;  2W9A A;  5EOZ A;  5J0T A;  1H38 A;  1L8O A;  4NL9 A;  1N5W A;  5KL8 B;  4CGZ A;  1L3T A;  4K4G A;  1NZB A;  2WF6 A;  1NNL A;  4J9L A;  4US8 A;  5ALG A;  4C8L A;  4DS4 A;  5KFK A;  3H0L B;  4F3O A;  4GXK A;  4M47 A;  5J0S A;  8ICI A;  2EAO A;  1LKY A;  3RFA A;  4CDG A;  3LVV A;  2NRW A;  1BPD A;  2HBM A;  5DB8 A;  2RP5 A;  3NVV A;  4J9S A;  3CW2 C;  4NJ8 A;  2XY7 A;  4P0Q A;  4Y2R A;  2OXO A;  1SKW A;  7ICK A;  5ALI A;  3RB4 A;  1D8L A;  3GIK A;  1ZQS A;  1Y88 A;  3LVW A;  2R8G A;  4BXO B;  3EYZ A;  2KEY A;  2M0N A;  4KLT A;  1U45 A;  2V9W A;  3PSP A;  4U7C A;  5J2B A;  5AM3 A;  2HHS A;  3L4P A;  1B4F A;  2CXY A;  1O03 A;  4UB6 U;  2IOH A;  3UMG A;  5ALR A;  1KLN A;  2LMR A;  2W7P A;  2HVI A;  5J8Y C;  5D49 A;  3LWM A;  1X6J A;  1SGG A;  1P7D A;  1SZP A;  2MU2 A;  1NK4 A;  5J2H A;  3N97 B;  2ZIV A;  5AIA A;  3BDP A;  3Q8R B;  1DGS A;  4OJP A;  3ETR A;  1IV8 A;  3TAD C;  5B66 U;  2LM4 A;  3I1Y A;  3CNH A;  4GC7 A;  4ELV A;  2R8H A;  4FFD A;  1L7P A;  3OHB A;  4B9T A;  2R8J A;  1QTM A;  3RJF A;  1LB2 B;  1ZET A;  2ZJ8 A;  4KLI A;  1L3V A;  3SEN A;  2P66 A;  5ALV A;  1N48 A;  2Y9T A;  5L1M A;  4TQS A;  4PHP A;  1NOM A;  3H4D A;  1KKX A;  3WK9 A;  4F4Z A;  4IC9 A;  3ONN A;  2DKZ A;  2JH7 A;  4JK1 A;  1ZQA A;  3BQ7 A;  8ICT A;  3M6K A;  1SZH A;  1ZJN A;  4XRH A;  1SWW A;  2KOB A;  5F9N A;  5KG3 A;  4I2F A;  2VA2 A;  4QW8 A;  7ICH A;  1JXL A;  2LI6 A;  1S0M A;  8ICE A;  4YXM A;  2BHN A;  8ICG A;  4NM2 A;  2FE9 A;  7ICQ A;  1QLN A;  1COO A;  4DQR A;  1N60 A;  2W04 A;  2G06 A;  3Q8L A;  4EEL A;  4RQ6 A;  1KSP A;  4I29 A;  4QZF A;  5HHH A;  2KKP A;  4EEK A;  4FZM A;  4PHE A;  4F4W A; 
#chains in the Genus database with same CATH homology
 4E0D A;  5KT6 A;  3KHR A;  9ICK A;  1NK6 A;  1ZQW A;  4QZD A;  5DBA A;  1KDH A;  3AU2 A;  1L5U A;  4KMU A;  4RUA A;  8ICU A;  3NGD A;  4YMM A;  1NKC A;  8ICX A;  5DGA A;  4UQG A;  4YQW A;  3UQ0 A;  9ICW A;  4UB3 A;  4M6W A;  8ICO A;  2Y1I A;  4I2C A;  4ED3 A;  2UVV A;  1BPE A;  5L1L A;  5KFX A;  4ECS A;  4P4O A;  1CEZ A;  5L1J A;  1ZQH A;  3RJG A;  2W9M A;  2KTQ A;  7ICU A;  7ICS A;  4EZ9 A;  4UAW A;  3ZDB A;  4YR3 A;  4IQU A;  5J0Y A;  4KLL A;  4C8K A;  4I2H A;  4YMN A;  2W9C B;  7ICJ A;  2BKE A;  4YXJ A;  4ECZ A;  2GWS A;  5J2J A;  1SL2 A;  5KFB A;  4PHA A;  1NK5 A;  1IXR A;  2ASJ A;  1BPX A;  2IBK A;  1S9F A;  2NRX A;  4JV0 A;  1XO1 A;  9ICA A;  5KFY A;  3PV8 A;  3SYZ A;  4F5N A;  2ALZ A;  1BGX T;  7ICV A;  2BCR A;  1T3N A;  1S76 D;  2W9B B;  4MF2 A;  1S77 D;  1NK9 A;  3HPO A;  1U4B A;  2AQ4 A;  1L3U A;  7ICE A;  3H40 A;  4Q44 A;  4DSE A;  1TK0 A;  4RQ7 A;  2XO7 A;  4MFC A;  4RNM A;  1CUK A;  5J0O A;  5EWE A;  5KFO A;  3OGU A;  5KT5 A;  4J9R A;  3N4M B;  1ZQF A;  2PFQ A;  5J2C A;  5IIK A;  1BPZ A;  3PR4 A;  2W8K A;  9ICX A;  2ZUB A;  4B9M A;  3PNC A;  4ECY A;  4O9M A;  4DS5 A;  3V72 A;  5J0P A;  2UVW A;  2MAX A;  4KTQ A;  1TKD A;  2HHQ A;  2XY6 A;  3TAQ A;  1NKB A;  4RNN A;  1MQ2 A;  4KLF A;  3MR3 A;  4I2G A;  3T3F A;  2BCQ A;  3ZDC A;  5DLG A;  4B9L A;  3T5J A;  2KN7 A;  4QWC A;  3PW0 A;  2A1J A;  4KLJ A;  1NK7 A;  2C2D A;  3EPG A;  4O3R A;  3ISD A;  4DOA A;  4FO6 A;  3ZDE A;  4Q45 A;  2XY5 A;  4J9O A;  1SKR A;  1RYR A;  2PFP A;  4ELU A;  3ISC A;  2ZUC A;  4M0A A;  5CWR A;  8ICM A;  4TUS A;  2IHM A;  4DSI A;  2MUT A;  3T5K A;  4UAY A;  4DQQ A;  2BQR A;  5KFA A;  2P6U A;  4MFF A;  5BOM A;  3QEA Z;  3PW4 A;  4P2H A;  4RPZ A;  2BPG A;  1KEJ A;  4DL2 A;  2IHN A;  1S97 A;  2BDP A;  4JV1 A;  4G3I A;  8ICJ A;  5HHI A;  3TAP A;  3EW9 A;  1U48 A;  3Q8S B;  4ECU A;  3OHA A;  3Q8M A;  4O5C A;  5J2K A;  4EYH B;  5DB6 A;  5KFC A;  1B43 A;  1QSL A;  4PGY A;  2C28 A;  4FBU A;  4LVS A;  3KTQ A;  4I2J A;  4KIT B;  2RDJ A;  2ASD A;  2PI5 A;  4EEY A;  5BOL A;  7ICT A;  1ZQR A;  1L3S A;  3FDS A;  7ICO A;  3RB0 A;  9ICN A;  4DL3 A;  3PVX A;  2DPI A;  2XC9 A;  4F50 A;  3QZ7 A;  5L9X A;  4IQW A;  2M9N A;  2HHU A;  2HHW A;  5TZV A;  4RZR A;  2IA6 A;  2AQ0 A;  4P4M A;  4FBT A;  2FMP A;  3T5H A;  1NKE A;  8ICP A;  4J9M A;  1ZJM A;  9ICG A;  3UQ2 A;  5KT7 A;  3SV4 A;  1HJP A;  2XGQ A;  3RJE A;  5KT4 A;  3V7L A;  4I2B A;  2NRT A;  5DQG A;  5KFF A;  4XQ8 A;  4F4Y A;  5DG7 A;  3IHQ B;  3PML A;  3M9O B;  1NK0 A;  2ZTC A;  1NJW A;  8ICH A;  5DDY A;  4BXO A;  7ICP A;  4I2A A;  4YFK A;  3EWA A;  5KG4 A;  1JX4 A;  1K1S A;  4DOC A;  5KG2 A;  4NY8 A;  1ZQP A;  5KG5 A;  4NLN A;  5KG1 A;  5J2A A;  4DFJ A;  4KLE A;  3MGH A;  2HHT A;  1U9L A;  2BPF A;  3M8R A;  4EYI B;  3G6Y A;  4UBB A;  3M9M B;  5KG6 A;  1S0O A;  3QE9 Y;  3GV5 B;  3GDX A;  3MAB A;  1X2I A;  4IRK A;  4F93 B;  3V6H A;  1ZQQ A;  8ICV A;  1TAU A;  3B0Y A;  1ZQV A;  1IM4 A;  3GII A;  5L1K A;  1TV9 A;  4CCH A;  3V7J A;  3MFI A;  4LZG A;  3M8S A;  4QZ9 A;  1JN3 A;  4QWA A;  3JPO A;  2J6T A;  4PGQ A;  1S0V A;  4YCX A;  3LK9 A;  9ICB A;  5J29 A;  4ED1 A;  3TAN A;  2VA3 A;  4RQ1 A;  1V9P A;  3OSN A;  2C2R A;  7ICF A;  5CA7 A;  4O5K A;  8ICQ A;  3GV7 B;  5DDM A;  3MDC A;  3MDA A;  4EBC A;  4IQV A;  2HHX A;  2KZZ A;  9ICL A;  1Z00 B;  1TVA A;  4I28 A;  4FS1 A;  4K4I A;  3C2K A;  5KFD A;  3ETL A;  5III A;  4O3Q A;  5J2F A;  1NJX A;  2PI4 A;  9ICM A;  4DQI A;  4RQ5 A;  4YD2 A;  4B9V A;  4ED8 A;  4IR9 A;  3Q8Q B;  1MQ3 A;  4F2S A;  5D4B A;  2PFN A;  4YMO A;  4DSF A;  3PX0 A;  8ICB A;  1RXW A;  1X9S A;  4DLE A;  1LV5 A;  2JEF A;  3C1Z A;  5IIN A;  5IIL A;  2VAN A;  5CR0 A;  4BGD A;  4TQR A;  4TUP A;  4M2Y A;  4RUC A;  3RBD A;  3HX0 A;  1T4G A;  1ZQJ A;  4KLQ A;  3C5G A;  4ECT A;  1TK8 A;  1S0N A;  3PW7 A;  5KFE A;  1SL1 A;  3UXN A;  1XSL A;  3PR5 B;  4DL5 A;  2V4R A;  2J6S A;  5DLF A;  4PH5 A;  4DQP A;  4F92 B;  5KFP A;  4JWN A;  5IIO A;  1KFD A;  4UBC A;  3RAQ A;  2FMQ A;  1NK8 A;  4YR0 A;  4B9U A;  5J2I A;  9ICT A;  3TFS A;  5J0U A;  2FPM A;  5DQI A;  3H4B A;  4ECQ A;  2JZB B;  3KHH A;  4MEX A;  4M9L A;  4QZC A;  4NM1 A;  1ZQI A;  3SV3 A;  4O3S A;  3THV A;  4KLG A;  3GIM A;  4R66 A;  7ICG A;  5DBC A;  1QSS A;  3RJJ A;  2P6R A;  4KLM A;  4KN4 A;  5IIJ A;  2FLL A;  3H8W A;  2XCA A;  3K4G A;  1ZQC A;  1ZQX A;  4MFA A;  2PXI A;  1QSY A;  5KFL A;  4QZ8 A;  5KG7 A;  4Z6F A;  3MR2 A;  2FMS A;  4IRC A;  8ICL A;  9ICV A;  3G6V A;  1Z3E B;  4PPX A;  8ICF A;  2BGW A;  5JUM A;  4DL6 A;  1UT5 A;  2FLN A;  4M9G A;  3C21 A;  4C8N A;  1UA0 A;  2R8I A;  4F4K A;  1T7P A;  5HNK A;  9ICP A;  4PGX A;  1A76 A;  2AU0 A;  2JEG A;  2OWO A;  1ZYQ A;  2IMW P;  5KFW A;  5L1I A;  2ZTD A;  1ZQO A;  4BDP A;  2KZM A;  4Q43 A;  3KHL A;  4MF8 A;  3K75 D;  5DGB A;  2Q0Z X;  4MEY A;  4J9K A;  4RNO A;  3TAR A;  4YP3 A;  4QZB A;  7ICR A;  3OSP A;  3BQ2 A;  4I2E A;  3PMN A;  4NLG A;  2H5X A;  3JPT A;  1ZQB A;  4F5R A;  5J2E A;  3KHG A;  2BCS A;  1U47 A;  5KFN A;  5KFG A;  5J0Q A;  5KT3 A;  5KFI A;  3MR6 A;  4F5O A;  2ZJA A;  1ZQE A;  2PFO A;  3E2E A;  5KFM A;  5DB9 A;  4RPY A;  5CJ7 A;  5KTQ A;  4F2R A;  2DPJ A;  1RXV A;  9ICS A;  4YD1 A;  2V4Q A;  3UXP A;  3SZ2 A;  8ICC A;  1HUZ A;  3M9N B;  7ICL A;  1ZQU A;  4M6W B;  1XWL A;  5DBB A;  1MC8 A;  3JPP A;  3EPI A;  4DEZ A;  5BPC A;  4DFM A;  7ICM A;  4M9N A;  4QWE A;  5J2G A;  3V6K A;  3RTV A;  1NJZ A;  8ICK A;  4J9P A;  1ARO P;  4I2I A;  5CHG A;  4DOB A;  3HT3 A;  4FS2 A;  2FPL A;  3UXO A;  1RYS A;  4XUS A;  4F8R A;  3BQ0 A;  3HWT A;  3UPQ A;  9ICU A;  4ED7 A;  1X9W A;  4UB4 A;  4UB5 A;  3Q8K A;  2ZJ5 A;  4RQ2 A;  9ICR A;  4RQ4 A;  1UT8 A;  4YN4 A;  2KFZ A;  4XA5 A;  8ICZ A;  4JWM A;  3FYH A;  4NXZ A;  4QZA A;  2WTF A;  4JV2 A;  4KLO A;  4QZG A;  1WCN A;  4Q8E A;  1HUO A;  4QZH A;  5IIM A;  4Z6C A;  1KRP A;  2ISO A;  4B9S A;  2BQU A;  4BWJ A;  1ZQK A;  3RB6 A;  5CP2 A;  2AJQ A;  4RPX A;  4R8U A;  1ZQY A;  5HMM A;  2W9A A;  5EOZ A;  4RT3 A;  5J0T A;  2W9B A;  4GXJ A;  4ED6 A;  2J6U A;  3PX4 A;  3RJK A;  4KLD A;  1H38 A;  3C2L A;  4ZH4 A;  4QZE A;  5C5J A;  1ZQM A;  2NRZ A;  5DG8 A;  3RRH A;  2BR0 A;  4C8M A;  1XS9 D;  1L3T A;  1D9F A;  1RPL A;  3PO4 A;  4C8O A;  4K4G A;  4GLX A;  5EWF A;  4J9L A;  4C8L A;  4BWM A;  2RDI A;  1TAQ A;  2BCV A;  4LZD A;  3C1Y A;  4DS4 A;  3MR5 A;  5KFK A;  1XC9 A;  9ICH A;  4F3O A;  2A1J B;  3MGI A;  4GXK A;  3RH6 A;  4M47 A;  2C2E A;  5J0S A;  2FPK A;  2JEI A;  8ICI A;  2VA8 A;  2ZUD A;  3B0X A;  3EZ5 A;  1T8E A;  2AGQ A;  4KLU A;  2HW3 A;  2MUT B;  3NTU A;  3JPR A;  4UB1 A;  4RT2 A;  3JPS A;  2FLP A;  2NRW A;  1BPD A;  3ZDD A;  1S10 A;  5DB8 A;  1XU4 A;  4DFK A;  2UVU A;  3LDA A;  3PX6 A;  4DF4 A;  4J9N A;  1D9D A;  2F1H A;  5DB7 A;  4F4X A;  3C23 A;  4R65 A;  4PHD A;  4J9S A;  2I1Q A;  3T5L A;  3C2M A;  2ASL A;  3V6J A;  4J9Q A;  4GXI A;  3RR8 A;  3RJH A;  2XY7 A;  1RZT A;  3BQT A;  1K1Q A;  1KFT A;  1JXE A;  3PO5 A;  3V7K A;  5KT2 A;  3HW8 A;  5D46 A;  1SKW A;  3C5F A;  4EBE A;  7ICK A;  4ECR A;  1ZQL A;  5KFH A;  5F9L A;  4M9J A;  4I2D A;  3GV8 B;  3RB4 A;  1SL0 A;  1D8L A;  7ICI A;  3QZ8 A;  1KFS A;  3QEB Z;  3IM1 A;  2DFL A;  5EWG A;  4DSJ A;  3GIK A;  4IR1 A;  9ICJ A;  9ICO A;  1ZQS A;  4KN7 A;  1TFR A;  3H8J A;  3PW5 A;  1Y88 A;  2R8G A;  4BXO B;  3ZDA A;  4M04 A;  4RQ3 A;  3EYZ A;  3TQ1 A;  8ICS A;  4KLT A;  1U45 A;  2ISP A;  2V9W A;  4R8U B;  3HP6 A;  7ICN A;  1WCL A;  1JIH A;  5KG0 A;  4YVZ A;  9ICF A;  2B21 A;  1PZN A;  4YG2 A;  5J2B A;  4IRD A;  4QWD A;  2Y1J A;  3ORY A;  3G6X A;  2HHS A;  3OJU A;  3GIL A;  1D8Y A;  1ZQZ A;  1N56 A;  1ZQD A;  4DSL A;  2AGO A;  4O3P A;  5HML A;  2JEJ A;  1KTQ A;  4QW9 A;  5HP4 A;  1KLN A;  4ECX A;  1ZQN A;  8ICY A;  4TUR A;  4QZI A;  2HHV A;  3RH4 A;  3H8S A;  3ISB A;  2BPC A;  8ICA A;  9ICQ A;  3TI0 A;  1NJY A;  1BPB A;  4F5P A;  2HVI A;  4DLG A;  5D49 A;  3LWM A;  3MFH A;  3RAX A;  4X5V A;  4O5E A;  1SZP A;  4GC6 A;  4ECW A;  2F1J A;  1NK4 A;  2UVR A;  5J2H A;  4RQ0 A;  3N97 B;  2W8L A;  4EBD A;  4EZ6 A;  3BDP A;  4K4H A;  3Q8R B;  4DO9 A;  1DGS A;  4Q8F A;  1U49 A;  4ELT A;  1Z00 A;  8ICN A;  4NLK A;  4R64 A;  3RH5 A;  3H7I A;  5CB1 A;  4R63 A;  4GC7 A;  1XSP A;  4ELV A;  2R8H A;  3OHB A;  2I9G A;  4B9T A;  4DFP A;  2R8J A;  1QTM A;  3RJF A;  1LB2 B;  1A77 A;  4ECV A;  2ZJ8 A;  1ZET A;  4KLI A;  4P4P A;  8ICW A;  3GQC A;  1XSN A;  1L3V A;  3BJY A;  2P66 A;  4NLZ A;  4F91 B;  1N48 A;  2W9C A;  9ICE A;  4TUQ A;  1EXN A;  5KFV A;  4O3N A;  4TQS A;  3JPQ A;  4PHP A;  1NOM A;  5KFR A;  5KFQ A;  3RR7 A;  3H4D A;  1SKS A;  3GFK B;  4F4Z A;  3RB3 A;  4ED2 A;  4QWB A;  4JK1 A;  1ZQA A;  2KZ3 A;  5DKW A;  4DQS A;  2BQ3 A;  8ICT A;  3LWL A;  3PY8 A;  2ATL A;  1ZJN A;  4XRH A;  3SI8 A;  4DL7 A;  5DG9 A;  5KFT A;  1UA1 A;  5J0W A;  4Z6D A;  5KFJ A;  3OJS A;  5F9N A;  5KG3 A;  5DQH A;  2XGP A;  3BQ1 A;  4DL4 A;  1ZQT A;  5J2D A;  2VA2 A;  2JZB A;  4I2F A;  3TFR A;  2C22 A;  4M9H A;  3JPN A;  4QW8 A;  3RJI A;  1DOQ A;  1C7Y A;  4O0I A;  4ED0 A;  1TK5 A;  1JXL A;  8ICR A;  7ICH A;  4F5Q A;  4YR2 A;  4DWI A;  5KFZ A;  3RBE A;  9ICI A;  4UB2 A;  1S0M A;  8ICE A;  4YXM A;  4JUZ A;  2BHN A;  4B9N A;  8ICG A;  2BCU A;  4HYK A;  4NM2 A;  1JMS A;  3ZD8 A;  2XCP A;  7ICQ A;  1QLN A;  2KFN A;  1X9M A;  4KLH A;  1COO A;  4O3O A;  2HVH A;  4Z6E A;  1ZQG A;  4RU9 A;  4KLS A;  5KFS A;  1B22 A;  2ZTE A;  3RRG A;  4DQR A;  3ZD9 A;  4I27 A;  4DF8 A;  3AU6 A;  3AUO A;  3PW2 A;  5J0R A;  9ICC A;  2F1I A;  3Q8L A;  3MBY A;  2AGP A;  2R8K A;  4RQ6 A;  3GIJ A;  1KSP A;  4I29 A;  1MSW D;  2LYH A;  4QZF A;  5J0X A;  5HHH A;  4DSK A;  4RQ8 A;  5KFU A;  2NRV A;  1BPY A;  1BVS A;  4UAZ A;  4PHE A;  3Q8P B;  4F4W A;  4IQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...