2M9NA

Solution structure of (hhh)2 domain of human faap24
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Fanconi anemia-associated protein of 24 kDa
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2m9nA00
1D8YA 4P4OA 2DFLA 1KRPA 5J0QA 5KFKA 1NOMA 3LK9A 2P66A 4YD1A 1IXRA 3N4MB 1NK8A 1ZQNA 1SL0A 3H4DA 2IBKA 4PHDA 2FPKA 4R8UA 4ECXA 3RRGA 2PI4A 2W9BB 3PW7A 8ICZA 4F2SA 3V7JA 5KFMA 2XO7A 3PX6A 2AJQA 8ICJA 2P6UA 3OJSA 3RAXA 4ED0A 2ZTCA 4ZH4A 5KG7A 4IR1A 4DS4A 4DQIA 4YMNA 1ZQIA 5KFDA 5KT3A 5DB6A 4EZ6A 4PH5A 5KFHA 5BOMA 4JV2A 9ICJA 5KFIA 4YQWA 4P4PA 3C1YA 2XY6A 3RH5A 1SKSA 1T7PA 5KFZA 2RDIA 4YR0A 2IHMA 2DPIA 3RR7A 3RJIA 4ECQA 4EBEA 1C7YA 4MEYA 4C8OA 4O0IA 4M9HA 3G6XA 4FBUA 3GIIA 5J0WA 3PX4A 2F1HA 4O3OA 2XY7A 4ECVA 1B22A 5DBBA 2V4RA 1ZQAA 3V6JA 4KMUA 4E0DA 2J6SA 4F4KA 4KLLA 3EW9A 5D46A 5JUMA 4GXKA 1KFSA 5CA7A 3T5JA 2AGQA 1T8EA 4DSKA 4QWEA 3TQ1A 4TURA 4IQWA 2DPJA 5DQHA 1ZQTA 3RJHA 4DSLA 3RR8A 5DLGA 3MR3A 1BPEA 5J0OA 5J0YA 4PGXA 3M9OB 3TFRA 3JPTA 3JPRA 5DGAA 3QEAZ 1ZJNA 9ICOA 2MAXA 4O3NA 3KTQA 4JWMA 9ICSA 4BXOB 1JIHA 3UXOA 5CP2A 4ELTA 3PW0A 5EWEA 4YVZA 4J9MA 4DOCA 1EXNA 1U9LA 3ORYA 5HHIA 4ECRA 1MQ2A 4M2YA 2HHSA 4UBCA 8ICYA 4RT3A 1ZQRA 2PFOA 5KT4A 4YD2A 5J2AA 8ICBA 3C2MA 2WTFA 1XC9A 2IA6A 4F93B 4UB4A 4LZDA 4RQ0A 5J2GA 1XS9D 3HW8A 5KG3A 5KFLA 4FBTA 3ZDEA 4NY8A 2V4QA 1TK0A 9ICCA 2W9CA 4ECSA 5DQIA 4DOBA 3ETLA 2ZTEA 3SZ2A 4ECZA 3NTUA 3THVA 4K4HA 4I2CA 4RT2A 4BXOA 4RU9A 4MF8A 5KFSA 2BCQA 1NJZA 3GQCA 1ZQFA 3HPOA 3FDSA 5J29A 2HHUA 3Q8LA 5EWFA 3HX0A 4JV1A 4NLNA 7ICRA 4IRCA 4EEYA 5J2HA 4PGYA 4R63A 4I29A 2AGOA 3IM1A 1XSPA 4GXIA 1SZPA 2C22A 4Z6EA 2HHTA 5DKWA 3LWLA 2IMWP 3OHBA 5CJ7A 2JZBA 4NXZA 5L1JA 4F4YA 3PW5A 3C21A 5KFYA 4F5QA 5DLFA 1XO1A 3E2EA 4RQ2A 4F5PA 1NKEA 5HMLA 1L3SA 4FO6A 1ZQDA 5C5JA 2BCUA 1QSSA 4MF2A 1K1SA 1UA1A 4K4GA 2J6UA 5EOZA 4B9NA 2PFNA 4YR2A 1S0OA 1X2IA 5IIIA 4B9TA 1S0VA 3PW2A 3RBDA 5KFJA 1UT5A 5BOLA 3V7KA 3SV3A 2BQUA 1RPLA 1HUZA 1ZQHA 4M6WA 4UB3A 9ICBA 3TI0A 2Y1IA 1ZQMA 1SKWA 1H38A 5D4BA 5DB9A 1XSLA 5KFTA 5HHHA 4R64A 3ISDA 4DQQA 2C28A 4I2AA 9ICUA 3BQ1A 3KHLA 4RNOA 3UQ2A 5KFCA 4FS1A 1JMSA 2ZUCA 4KLFA 4Q8FA 2ZJ8A 1ZQVA 4DL7A 3Q8MA 3MFIA 1COOA 4KN7A 4EYIB 1X9MA 2PI5A 1HJPA 4DL2A 1A77A 3ZDAA 3MR5A 1T3NA 2NRXA 1ZQYA 5IIJA 3TARA 4YFKA 4JV0A 3QZ7A 3V6KA 8ICIA 4YN4A 5L1IA 2AGPA 4QZHA 4M9LA 2FLPA 4Q8EA 3OSPA 1QSYA 2ASLA 1CEZA 5KT2A 2FPLA 3T5HA 1ZQKA 1UA0A 2MUTB 4YCXA 3GV8B 4NLGA 3G6VA 3C1ZA 7ICNA 4ECWA 1U4BA 4R65A 4DO9A 1ZETA 2FMQA 1Z3EB 4KLJA 1UT8A 3IHQB 4RQ4A 2FLNA 5IIMA 3H8JA 3OGUA 8ICGA 2R8HA 1ZQJA 3PMNA 2FLLA 3MR2A 1BGXT 9ICRA 4MFCA 4DQPA 4UAZA 3KHGA 4B9LA 4B9SA 8ICLA 3OSNA 2AU0A 8ICKA 4DL4A 2W9MA 5J0SA 2LYHA 3PY8A 4UAYA 4I2BA 4O5CA 1NK0A 3TANA 5KFEA 5BPCA 4PHEA 8ICQA 3HT3A 1NK4A 5KT5A 4F5RA 7ICOA 5KG6A 5CR0A 4DLGA 3PX0A 3JPOA 4ED3A 2ATLA 4XRHA 4J9NA 3H40A 5KFWA 8ICPA 1ZQCA 3RB4A 2M9NA 4YR3A 4ECUA 1KLNA 3C5FA 4P2HA 4QZAA 1KTQA 4YXMA 1DGSA 2BR0A 4Q43A 2XY5A 4F91B 2FMPA 1AROP 3ZDCA 3PO5A 7ICIA 4DFMA 4YG2A 2Y1JA 4I2EA 3TFSA 3V6HA 1PZNA 4I2DA 7ICLA 4YP3A 1SL2A 5DDMA 1KFTA 1ZQQA 2ASDA 4QZFA 1D9FA 2B21A 3EZ5A 5J2JA 2JZBB 3EWAA 4M6WB 1IM4A 4RNNA 3EPGA 4ELVA 4RNMA 5KFRA 4O3QA 4IQTA 1X9WA 4I2JA 1BPYA 3JPQA 2JEIA 5KFNA 5KTQA 4R8UB 1S97A 2KZMA 5KT7A 4IRDA 3H7IA 1LB2B 1ZQBA 2V9WA 4MFFA 4ED2A 4KLTA 4O3PA 4RQ1A 4UB1A 4F5NA 2NRZA 3PNCA 3C23A 5DGBA 4QZDA 4B9MA 4O9MA 2KFNA 9ICFA 5EWGA 1QTMA 9ICGA 5KG5A 4RPXA 2KN7A 2R8JA 1S77D 2XCPA 1KSPA 3EPIA 2XGPA 4BGDA 2W8KA 2BCRA 1LV5A 1D9DA 3GFKB 2UVRA 8ICCA 3C5GA 2RDJA 3AU6A 5KFOA 4F92B 4QZCA 3MDCA 5DBAA 3BQTA 5J0RA 4QW9A 7ICPA 3H8SA 4K4IA 9ICHA 9ICQA 4O3RA 5J0TA 2BHNA 1Z00A 4YMMA 4JWNA 1U49A 1MC8A 1ZQPA 4KLSA 4GLXA 1HUOA 2PFPA 2IHNA 1V9PA 3MFHA 4DSFA 3RB0A 3RJGA 4C8KA 3PW4A 2VA2A 3H8WA 1NKCA 4Z6FA 4XA5A 3RH4A 4J9RA 1XWLA 1T4GA 5J2IA 5J0XA 3UXPA 7ICTA 1D8LA 4P4MA 4O5KA 4Q45A 3KHHA 9ICXA 2BPCA 1S76D 1CUKA 9ICPA 4UBBA 4XQ8A 5F9NA 9ICLA 1XU4A 5KFBA 2BQRA 4F8RA 9ICAA 4ECYA 4QW8A 3RJJA 4RPYA 3RJKA 2C2EA 3ZDDA 4TUSA 9ICIA 4DL3A 4NM2A 3T5KA 4DFPA 5F9LA 5HP4A 4KLIA 4EYHB 2UVWA 4M9JA 4GC6A 5IINA 5KFVA 4MFAA 3JPSA 3RB3A 3EYZA 1SKRA 4I2GA 4NLKA 3MBYA 5DBCA 3T3FA 1XSNA 3AU2A 4B9UA 2P6RA 2KZ3A 3JPNA 4I28A 3RB6A 4KLHA 1KFDA 4QZEA 2PXIA 1RXVA 1NK9A 5KG4A 1RYRA 4CCHA 3MABA 4RQ3A 2ZTDA 3UPQA 8ICMA 7ICHA 1A76A 2BCSA 5J2BA 3MDAA 1ZQEA 3PR4A 2ISPA 2BCVA 4JK1A 1X9SA 7ICGA 4UAWA 5HMMA 1QLNA 2BPFA 3Q8PB 4I2HA 4JUZA 5J2KA 4J9KA 4M47A 8ICUA 7ICQA 5DB7A 3C2KA 3C2LA 2UVUA 2I1QA 2HHWA 8ICXA 1JN3A 8ICHA 4O3SA 1BPZA 3BJYA 9ICKA 7ICMA 7ICKA 4DQRA 2XCAA 2NRVA 4YXJA 4IR9A 1U45A 2BGWA 1TV9A 3LDAA 4F4XA 1BPBA 3BQ0A 2W8LA 4RZRA 2BPGA 3K4GA 5CB1A 4RPZA 3ISCA 1ZJMA 4PGQA 3GV7B 2C2DA 1N56A 3PMLA 5KFAA 3RTVA 4B9VA 8ICFA 1NKBA 4HYKA 4TQRA 1U47A 2VANA 1JXEA 3BQ2A 4DSEA 5KFQA 1JXLA 5IIKA 4DL6A 3RAQA 4I27A 2HVHA 4IRKA 4DSJA 4QZ9A 4DFJA 9ICMA 3H4BA 2A1JA 2KZZA 4DSIA 4DS5A 4J9SA 4KLOA 2HW3A 2HHXA 4NLZA 2KTQA 5CHGA 5L1KA 4M9GA 5KG1A 3GILA 3V7LA 2BDPA 4KN4A 5DG9A 3HP6A 4GC7A 3T5LA 3SYZA 1TVAA 4QZIA 4KLMA 5CWRA 3HWTA 2ISOA 3ZDBA 3B0YA 4QZBA 4YMOA 4DFKA 7ICUA 2HVIA 1TAQA 5HNKA 1NJXA 5J0UA 3MR6A 4ED6A 4ED7A 1BVSA 4ECTA 3RJEA 3UQ0A 4C8LA 1B43A 4RQ5A 1NK6A 4PHAA 2ASJA 4QWAA 2KFZA 5DB8A 4M0AA 2XGQA 1TKDA 5KG2A 4RQ6A 3JPPA 4RQ8A 1KEJA 4LVSA 2R8KA 2NRTA 4Z6DA 2NRWA 4O5EA 2BKEA 3RBEA 1MSWD 8ICNA 3V72A 3SI8A 1BPXA 1Y88A 2R8GA 2Q0ZX 2A1JB 7ICJA 4LZGA 3TAQA 4QWCA 5IILA 9ICTA 3GIJA 1SL1A 3MGHA 7ICVA 2AQ0A 4PHPA 1S0MA 3M9NB 2W9AA 4RQ7A 2UVVA 2ZUDA 4EBDA 1DOQA 4XUSA 4DL5A 1NJYA 4C8NA 1WCNA 4J9PA 4RUCA 1JX4A 3M8RA 4KLUA 8ICSA 5J2FA 9ICVA 4DLEA 9ICNA 2VA8A 4X5VA 3RJFA 3KHRA 4QWDA 4FS2A 4KLQA 9ICWA 4BWMA 1TFRA 1ZQWA 3TAPA 4MEXA 4G3IA 3RH6A 4J9OA 4J9LA 2BQ3A 4DWIA 5J0PA 1S10A 3RRHA 1K1QA 1ZQZA 5J2DA 4KTQA 5L9XA 1ZQLA 3GDXA 7ICEA 2FPMA 4DF4A 4PPXA 3PVXA 1ZQGA 5D49A 2ZJ5A 1WCLA 1NK5A 4F5OA 4DOAA 3QEBZ 5KT6A 4C8MA 2W9BA 5IIOA 4UB5A 1U48A 2HHQA 4TUQA 2W9CB 1ZYQA 3GIKA 1KDHA 3NGDA 4EBCA 4KLGA 3N97B 2H5XA 3GV5B 2JEFA 7ICFA 4Q44A 3ZD9A 5L1LA 4DQSA 5DG7A 1RXWA 5TZVA 2F1JA 1L3UA 4F2RA 3UXNA 3Q8RB 4IQUA 3Q8QB 2F1IA 4KLDA 3PO4A 4QZGA 4F3OA 2OWOA 4ED8A 1L3VA 4F4ZA 4J9QA 1RYSA 5KG0A 3SV4A 4KITB 1MQ3A 2HHVA 3ISBA 3PR5B 2R8IA 2JEGA 4IQVA 1ZQUA 4TQSA 2J6TA 4BWJA 2ZUBA 3AUOA 3OHAA 2I9GA 4ED1A 2PFQA 4GXJA 4M04A 4UB2A 8ICEA 5KFPA 5KFFA 2FMSA 2AQ4A 5DG8A 4KLEA 3MGIA 5J2EA 4I2FA 8ICAA 4M9NA 1NK7A 8ICWA 4QWBA 5DQGA 1NJWA 2C2RA 4TUPA 8ICOA 1RZTA 3GIMA 1TK5A 4Z6CA 3QZ8A 1S0NA 5KFGA 8ICTA 3Q8SB 7ICSA 4BDPA 4F50A 3M9MB 4DF8A 4I2IA 1L3TA 1ZQOA 4F4WA 2ALZA 4EZ9A 1N48A 1TAUA 3G6YA 1L5UA 1Z00B 3M8SA 2VA3A 5J2CA 1S9FA 2ZJAA 4RUAA 4R66A 3K75D 4UQGA 4ELUA 1ZQXA 4NM1A 3ZD8A 8ICVA 4QZ8A 1BPDA 3OJUA 3BDPA 3QE9Y 9ICEA 3Q8KA 3B0XA 2XC9A 8ICRA 2GWSA 1TK8A 1ZQSA 2MUTA 3LWMA 5KFXA 2JEJA 3PV8A 3FYHA 4DEZA 5KFUA 5DDYA 1QSLA
chains in the Genus database with same CATH superfamily
5ALRA 1KRPA 3LK9A 2KE7A 1HEKA 4Y2VA 2IBKA 2FPKA 3IN5A 2W9BB 8ICZA 3V7JA 1XO0A 2Y0SC 2W03A 3RAXA 5KG7A 2K4IA 4PH5A 5KFHA 4JV2A 1WYGA 1A6SA 2HSZA 2RDIA 4YR0A 3RJIA 4EBEA 4C8OA 3E58A 3G6XA 4OJOA 4NL9C 5AK4A 4E0DA 1OW5A 4GXKA 1KFSA 5CA7A 3I1YA 2AGQA 5AKGA 4IQWA 4NWIA 4PGXA 3M9OB 3JPTA 2MAXA 9ICSA 4QJFB 4BXOB 2IOFK 5CP2A 1AQ6A 3PW0A 2G06A 4DOCA 3QU2A 3A0HU 1VDVA 3ORYA 5KT4A 1ZOLA 1HIWA 2WTFA 2KK0A 2ZXIA 3ZDEA 1TK0A 3PSIA 4ECZA 3NTUA 5KFSA 3H0LB 1NJZA 3FDSA 2HHUA 3Q8LA 2AGOA 3IM1A 2RP5A 2IMWP 3PW5A 2JZBA 4F4YA 1L8OA 4HAIA 1NKEA 1C20A 1X9XA 2R8KA 2BQUA 4F72A 4UB3A 3TI0A 2JH1A 2Y1IA 1H38A 1J2NA 5D4BA 1P7DA 5KFTA 5HHHA 4R64A 2JGAA 2G09A 2C28A 4IS7A 4RNOA 3UQ2A 4FS1A 1JMSA 4Q8FA 1ZQVA 5AI8A 3MFIA 2KMDA 1COOA 1HJPA 4DL2A 3SEIA 5IIJA 2R18A 3RF9A 8ICIA 2FLPA 1QSYA 4NV0A 1CEZA 5CRXA 3NASA 1ZETA 4RQ4A 2CRXA 3IG8A 2FLNA 3OGUA 3PMNA 1BGXT 2KD1A 9ICRA 4DQPA 3KHGA 1NZPA 2W9MA 2LMRA 3PY8A 5KFEA 1D8BA 4PHEA 4OCZA 8ICQA 3HT3A 5KT5A 7ICOA 4NLCA 5KG6A 3JPOA 4ED3A 2W7OA 3H40A 3RB4A 2M9NA 4YR3A 1PUZA 4ECUA 3BS5B 1KTQA 1X6JA 3BQ7A 5HR6A 2CN1A 7ICIA 4I2EA 2QB0A 1D9FA 4QZFA 2KEYA 3UMCA 4O3QA 1BPYA 2KZMA 1S97A 3H7IA 4O3PA 4RQ1A 2LI6A 3C23A 3L4PA 4QZDA 5AM1A 5KG5A 2GO7A 2F8LA 1S77D 5J8YA 2XGPA 2FDRA 1N60A 3AU6A 2NO4A 3MDCA 5ALPA 3K1ZA 4O3RA 5J0TA 1Z00A 2F76X 4JWNA 1ZQPA 4KLSA 3IV6A 3SD7A 2RQ5A 1HUOA 5ALUA 2DWQA 1QH9A 5AM0A 4Y2UA 3RH4A 4J9RA 1T4GA 4P4MA 2QB1A 9ICPA 2BQRA 3DV9A 9ICAA 2ES6A 4QW8A 1SXDA 5AKKA 4RPYA 3RJKA 4DFPA 2DGZA 2E8MA 5IINA 4FZLA 3AEVA 3EYZA 4NLKA 3MBYA 1XSNA 4B9UA 4KLHA 1RXVA 3MABA 4GIBA 3LVWA 3EUB2 1X66A 2BCVA 5CEHA 4I2HA 4P0QA 3C2KA 3AN1A 2VJ5A 4QIWC 8ICHA 2NRVA 3F2DA 3LDAA 4F4XA 1TV9A 4PJ0U 2BPGA 3K4GA 4US9A 1ZJMA 4PGQA 1DK3A 3NRWA 3RAQA 4I27A 5ALHA 4IRKA 3D2NA 3AM9A 4Y2XA 5AKLA 2KZZA 2HW3A 1JALA 2KTQA 1RDFA 4B9VA 2BDPA 5DG9A 4GC7A 2EH9A 4KLMA 2JXJA 5ALQA 2G5IB 3B0YA 2HVIA 4CGZA 3RJEA 1B43A 1NK6A 4PHAA 2ASJA 2KFZA 5KG2A 1KEJA 1V38A 1VJ5A 1JI7A 2EANA 2LPEA 1QCKA 2NRWA 3RBEA 1YZ7A 3V72A 1KL9A 3SI8A 1Y88A 5G5HA 1F44A 4LZGA 1B0XA 5IILA 3M6KA 1SL1A 1QQ5A 2H3QA 3LYSA 2EZXA 4EBDA 3F5AA 4XUSA 5AI9A 1WCNA 4RUCA 1JX4A 3M8RA 4DLEA 3RJFA 3KHRA 4QWDA 9ICWA 1O03A 4MEXA 3HKZC 4DWIA 5J0PA 4ICAA 5AM5A 1S10A 2YB1A 4KTQA 2G07A 3WKCA 4CNQA 3IP4B 3H0RB 4DF4A 4PPXA 4FZMA 3HJEA 2ZJ5A 4F5OA 3QEBZ 2W9BA 2HHQA 3U26A 4EBCA 2H5XA 2JEFA 5TISU 3ZD9A 5L1LA 2QKQA 1RXWA 2F1JA 4PZNA 2LYAA 4J03A 4IQUA 5AI5A 5ALSA 5KG0A 4KITB 2HHVA 1VLBA 2R8IA 5ALFA 2J6TA 2ZUBA 5AK6A 2GH1A 2KOBA 2KP7A 8ICEA 4C7YA 1WWVA 1V85A 2AQ4A 2QARA 4KLEA 1N5WA 4I2FA 4M9NA 2HI0A 2C2RA 3N28A 3GIMA 5A0LA 1S0NA 3WK9A 3Q8SB 4BDPA 4F50A 3M9MB 1L3TA 4I2IA 3KZIU 1N48A 1L5UA 1SV0A 3M8SA 2OYYA 1LKYB 3SAFA 2WHEA 4UQGA 8ICVA 3ZD8A 4QZ8A 3B0XA 2FJ6A 4NL9A 3FYHA 2NO5A 2DFLA 4OD0A 4YD1A 3SR6A 3N4MB 3HILA 1NK8A 4R8UA 2PI4A 3TADC 2G5HB 5ALKA 2AJQA 4DFDA 3NRZA 3OJSA 2DQNB 4ED0A 2ZTCA 4YMNA 1ZQIA 5KFDA 5DB6A 9ICJA 3CW2C 1Z1BA 5KFIA 3RH5A 1SKSA 2E8OA 2IHMA 2DPIA 4ECQA 4MEYA 4O0IA 2D8CA 3BZCA 4FBUA 5J0WA 4O3OA 4KMUA 4F4KA 3EW9A 1SB3C 2BDUA 3IRUA 3T5JA 1T8EA 4DSKA 5GTIU 3TQ1A 4DSLA 2GLEA 3RR8A 3MR3A 3TFRA 3SAHA 3QEAZ 3KTQA 2HOFA 5EWEA 2H3ZA 4CF4A 1U9LA 2WB1F 2WF7A 3AQEA 8ICYA 1MQ2A 2YX8A 3SENA 4RT3A 2PFOA 8ICBA 2OCEA 1XC9A 4LZDA 2E1EA 4CE6A 5KAFU 3HW8A 2P35A 2V4QA 9ICCA 2W9CA 5DQIA 2ZTEA 3THVA 1NI3A 4K4HA 3GZFA 4MF8A 1SXEA 5B5EU 5AKZA 3HPOA 1COKA 2DUYA 2K8AA 4IRCA 4EEYA 1Q46A 4JMUA 1SZPA 5DKWA 3OHBA 5CJ7A 2LKYA 5L1JA 1SGGA 2KJ9A 3R9KA 1KQQA 5DLFA 1XO1A 4F5PA 2BCUA 1FFUA 1QSSA 4K4GA 1UA1A 4B9NA 4YR2A 2KSOA 1UT5A 5BOLA 9ICXA 3V7KA 2K4HA 4M6WA 2ZIXB 5ALIA 3UM9A 1XSLA 2W3SA 3ISDA 3KHLA 2ZUCA 2EAPA 1Z1VA 4DL7A 4Y2JA 5AI6A 2PI5A 1X9MA 4Y2RA 3ZDAA 2NRXA 3WK4A 3TARA 4YFKA 3V6KA 1N2XA 4YN4A 5L1IA 2ASLA 2FPLA 1ZQKA 2MUTB 4YCXA 2CPRA 3C1ZA 3K1RB 4R65A 2KIVA 1IG6A 1LKYA 1DK2A 5AK5A 4B9LA 3OSNA 2AU0A 2DKZA 1M6YA 2LYHA 4I2BA 4GFJA 2AXTU 4DLGA 2YY6A 2ATLA 4RQNA 1KLNA 2Y9TA 1DGSA 4Q43A 4O3MA 2XY5A 2YB4A 2Y1JA 4NLBA 4YP3A 5KAIU 5DDMA 2LBOA 2B21A 3QUCA 5ALEA 1IM4A 1B4FA 4ELVA 2WF5A 5KFRA 5J8YC 4IQTA 1X9WA 4I2JA 5KFNA 5KTQA 2MSNA 5KT7A 4KLTA 1Q3VA 3NVWA 2BZFA 1PVRA 4F5NA 5AHXA 1GO3F 4O9MA 9ICFA 3FC4A 4C4RA 2KN7A 2F3NA 2YMPA 1KSPA 3D6JA 5ALVA 3GFKB 1S5LU 8ICCA 3C5GA 7ICPA 5B66U 1PK1B 2KG5A 9ICHA 2BHNA 2ODGA 3I28A 4GLXA 2KJ8A 2AHOB 2IHNA 2MA1A 5EE1A 4C8KA 3PW4A 3AL0B 2VA2A 1NKCA 3H0MB 4XA5A 4MHVA 3M1YA 4UASA 5J2IA 7ICTA 4O5KA 1S76D 3ETRA 4XQ8A 3PSTA 1LVHA 4QIWF 5K4LA 2OM6A 4ECYA 3RJJA 5EE3A 2C2EA 2KNJA 3ZDDA 3CP8A 3QUBA 3F5EA 3ICXA 3MC1A 1SKRA 4I2GA 3JPNA 3RFAA 3RB6A 1KFDA 2ESEA 2PXIA 5C0YA 5KL1B 1RYRA 4CCHA 4CF3A 2BCSA 4Y2SA 2QB0B 1WWUA 3MDAA 1ZQEA 3TADA 2BPFA 3Q8PB 4DCCA 5J2KA 4J9KA 2KIWA 5DB7A 2UVUA 2I1QA 1BPZA 9ICKA 7ICMA 1MA7A 2KKVA 2A19A 4DQRA 4YXJA 1BPBA 2W8LA 4RPZA 2C2DA 3PMLA 5KFAA 8ICFA 4HYKA 4TQRA 1JXEA 1RM6C 4DSEA 5KFQA 2LHTA 5IIKA 4DL6A 2HVHA 4KLOA 2HHXA 1TE2A 5CHGA 5L1KA 4M9GA 2HBLA 4KN4A 3SYZA 3FM9A 4QZBA 4DFKA 1TAQA 5HNKA 1NJXA 5J0UA 4ED7A 1BVSA 1CI4A 5AK3A 5ALZA 4RQ5A 3WKBA 2XGQA 1TKDA 4RQ6A 4LVSA 1MSWD 3ALRA 1L6NA 2Q0ZX 1TAMA 7ICJA 3TAQA 4QWCA 2EDUA 9ICTA 3GIJA 1YT3A 7ICVA 2AQ0A 1S0MA 1DOQA 4P0PA 4C8NA 2KHVA 1MN8A 4KLUA 8ICSA 5J2FA 4EELA 9ICNA 4X5VA 4KLQA 2I5HA 4BWMA 1TFRA 1ZQWA 4G3IA 4J9OA 4J9LA 4UAUA 3RRHA 5J2DA 1K1QA 2M0NA 3QU5A 1ZQLA 7ICEA 3D2QA 1NK5A 4A8EA 2K60A 1U48A 4UB5A 2W9CB 2HOQA 1ZD2P 7ICFA 4Q44A 5JTIA 2WF6A 3Q8QB 4FE3A 5AIAA 4KX3A 1RYSA 3WK6A 1MQ3A 3PR5B 2G0AA 4IQVA 4BWJA 3B9JA 3QU7A 3OHAA 1X42A 4GXJA 4UB2A 2MU2A 5KFPA 3MGIA 5J2EA 1NK7A 8ICWA 1NJWA 8ICOA 3QU9A 8ICTA 3QZ8A 5KFGA 7ICSA 4EZ9A 2ALZA 5J2CA 4R66A 4UB8U 4ELUA 3KKAC 3QE9Y 3WK7A 8ICRA 1FFVA 2MUTA 3LWMA 1FO4A 5AM2A 3PV8A 5KFUA 4EX7A 4CRXA 1D8YA 4P4OA 5J0QA 1NOMA 2P66A 1IXRA 1ZQNA 3H8MA 3IG5A 4PHDA 3RRGA 3PW7A 3L5KA 2XO7A 8ICJA 2P6UA 1S8OA 4ZH4A 4C80A 2H3IA 4IR1A 1NNLA 4UARA 2K8BB 4YQWA 3C1YA 3F2CA 1T7PA 3N7RC 2ZIUA 5KFZA 5H2FU 2KV2A 3I76A 1C7YA 4M9HA 5E79U 3PX4A 2F1HA 2XY7A 2JH7A 3CRXA 1B22A 5DBBA 2V4RA 3V6JA 4PL1A 2J6SA 2F8KA 3S6JA 3LVVA 5JUMA 2ZIVA 2ZIWA 3ZI4A 4QWEA 2RHFA 2DPJA 5DQHA 1ZQTA 1ZQ1C 5DLGA 2HBJA 5J0YA 4O3NA 4JWMA 1PVQA 1L7NA 3UXOA 2E5SA 2E3TA 4YVZA 3QYPA 4B6JA 5HHIA 4ECRA 2HHSA 4UBCA 1ZQRA 3NVVA 4F93B 4UB4A 5J2GA 2JR5A 5KG3A 5KFLA 4NY8A 3QX7A 4ECSA 4RT2A 4BXOA 3TACB 2BCQA 3GQCA 5J29A 5EWFA 3HX0A 3PSFA 2DKXA 4PGYA 4I29A 4GXIA 2C22A 2HHTA 3LWLA 1BNPA 3HRDD 3C21A 5HMLA 5ALJA 1L3SA 1X6IA 5EOZA 2D3DA 1S0OA 3WKEA 2DBYA 2K8CB 5IIIA 1S0VA 3PW2A 3RBDA 5KFJA 1ZQHA 2N1RA 1JUDA 3T79A 1ZQMA 1SKWA 2OEHA 4DQQA 4CDGA 9ICUA 3BQ1A 4KLFA 2ZJ8A 5AM4A 3Q8MA 2XVTA 4BJQA 2OXOA 3IDWA 1A77A 3MR5A 1ZQYA 2FI1A 4JV0A 2AGPA 4QZHA 4Q8EA 5KT2A 3F2BA 3T5HA 3G6VA 7ICNA 5ALXA 4OJ5A 1OXJA 1ZRNA 2YTUA 1Z3EB 3QU4A 3IHQB 1PK1A 2YMLA 5AICA 2R8HA 1ZQJA 3MR2A 2W55A 2DF4B 4MFCA 1DGJA 8ICKA 5J0SA 4O5CA 3TANA 5CR0A 3PX0A 4J9NA 5KFWA 1ZQCA 1UHUA 1KW4A 2A1AA 4P2HA 4QZAA 1JROA 2XI9A 4F91B 2FMPA 1AROP 3PO5A 1N61A 4YG2A 3DEEA 3V6HA 4I2DA 7ICLA 5JRTA 1ZQQA 5KL8B 3EZ5A 5J2JA 2JZBB 2ZIXA 4M6WB 5L1MA 4RNNA 4RNMA 3JPQA 2JEIA 4R8UB 3OTQA 5KNIA 2V9WA 1ZQBA 4MFFA 4PL2A 4UB1A 1SIJA 3QUTA 4B9MA 2F77X 5EWGA 5AKJA 9ICGA 4RPXA 2R8JA 2UVRA 5ALDA 2RDJA 2K89A 4QW9A 3H8SA 4K4IA 1SV0C 9ICQA 2EZZA 3N7SC 4DSFA 3RB0A 3RJGA 1N62A 3H8WA 4Z6FA 2E8PA 5J0XA 1D8LA 4Q45A 3KHHA 2BPCA 1CUKA 4UBBA 5F9NA 2PKEA 1XU4A 5KFBA 2OH2A 4F8RA 3AQFA 2B0CA 4TUSA 9ICIA 4NM2A 2KVCA 2YQEA 4CF5A 3GU3A 2UVWA 4M9JA 4GC6A 3JPSA 3RB3A 1JRPA 3M6ZA 5DBCA 3T3FA 4I28A 2EQYA 1QQ7A 2KSOB 8ICMA 2ZTDA 5J2BA 1A0PA 2W04A 4US8A 4LJXA 1X9SA 7ICGA 4UAWA 2H3FA 3BS5A 8ICUA 4M47A 1JN3A 3BJYA 7ICKA 2XCAA 3KD3A 4IR9A 2BGWA 5FP0A 2YN4A 2PMZF 3ISCA 1N56A 4USAA 5EE9A 4C4SA 1U47A 3BQ2A 1JXLA 4FFDA 4DSJA 4QZ9A 4DFJA 3H4BA 3CYMA 4DSIA 4DS5A 4NLZA 5KG1A 3GILA 2KICA 3V7LA 1SZHA 2VKQA 5CWRA 2ISOA 1IV8A 1L8LA 1ED1A 3MR6A 1BNOA 3UQ0A 3C28A 1SV4A 5G5GA 5ALOA 4QWAA 3JPPA 2LYBA 2G08A 4Z6DA 4G9BA 2BKEA 8ICNA 2MRLA 2R8GA 2ZIVB 2ZIUB 4Y2YA 3M9NB 2W9AA 4F71A 2UVVA 3FAHA 4EENA 4DL5A 3VC8A 4J9PA 4Y2TA 2EAMA 4FS2A 3O0FA 1ZQZA 5L9XA 1SWVA 4JB3A 4Y2QA 1RQNA 1ZQGA 5D49A 4DOAA 4C8MA 3C29A 4TUQA 3VCBA 3GIKA 1KDHA 4F2RA 3Q8RB 1V97A 4KLDA 3PO4A 4QZGA 2OWOA 4ED8A 1L3VA 3A0BU 4F4ZA 1XNSA 3N7PD 2JHDA 3ISBA 2JEGA 1ZQUA 1L7PA 1KBUA 1DXSA 5KFFA 8ICAA 4BUGA 2HCFA 5DQGA 4TUPA 1PVPA 3KFUF 3KOOA 1TK5A 4Z6CA 3L3FX 2ZXHA 2HMXA 5AKIA 4DF8A 1ZQOA 4F4WA 2AH5A 3G6YA 2VA3A 2W3RA 4AP9A 1S9FA 3QUQA 5ALLA 4OJLA 4NM1A 3BDPA 3OJUA 9ICEA 1RG6A 3WK5A 5JU5A 2GWSA 1F5SA 1ZD5A 5ALMA 1ZQSA 2JEJA 4DEZA 5DDYA 2VJ4A 2NV3A 2O6KA 5KFKA 2OHFA 2ZG6A 1SL0A 3H4DA 4ECXA 3HKZF 2WFAA 4F2SA 5KFMA 3PX6A 2IOFA 1F0MA 4EX6A 1ECWA 4DS4A 2RRDA 4DQIA 5KT3A 4EZ6A 5BOMA 4P4PA 2XY6A 4P0QB 1KKXA 2VIXA 5EE0A 3RR7A 3J81j 1Z4OA 3GIIA 4ECVA 1ZQAA 4KLLA 4Y2PA 1T3QA 2DL0A 5D46A 3OPXA 4TURA 3SQIA 3RJHA 1ZRMA 1BPEA 5J0OA 1UCVA 2K4EA 2EAOA 3JPRA 2FE9A 3PSPA 5DGAA 1ZJNA 9ICOA 1OUQA 1JIHA 4ELTA 3ONNA 4FZNA 4J9MA 1EXNA 5HR7A 4M2YA 4ACOA 4YD2A 5J2AA 3C2MA 2D6FC 2IA6A 2KJ5A 4RQ0A 1XS9D 4FBTA 2EZYA 4DOBA 3ETLA 3SZ2A 2LM4A 4I2CA 4WJ3B 4RU9A 2XIDA 3M7DA 3SAGA 1ZQFA 4KX5A 2I6XA 4JV1A 4NLNA 1L7OA 7ICRA 5J2HA 4R63A 1XSPA 3PZPA 4Z6EA 4NXZA 2RLTA 5KFYA 4F5QA 3E2EA 4RQ2A 3TKAA 1ZQDA 4MF2A 4FO6A 5C5JA 2WB1C 1K1SA 2J6UA 5ALTA 3MGVA 2PFNA 1X2IA 4B9TA 1FEZA 3SV3A 1HUZA 9ICBA 1RPLA 3E0FA 5DB9A 1J2MA 5AKEA 4I2AA 5KFCA 3QNMA 2WF9A 2KHQA 2HDOA 1NZBA 4KN7A 4EYIB 5F3XB 5ALGA 3ED5A 1T3NA 2W7PA 2XICA 3QZ7A 1T94A 4M9LA 3F53A 3OSPA 4UW9A 1UA0A 3GV8B 5ALYA 1KN5A 4NLGA 4ECWA 1U4BA 4DO9A 2FMQA 4KLJA 1N63A 1UT8A 5IIMA 3H8JA 1UQVA 5AIBA 8ICGA 2FLLA 1ZXIA 4UAZA 4B9SA 8ICLA 4DL4A 4UAYA 1NK0A 5BPCA 1WG8A 1NK4A 4F5RA 1RYUA 4XRHA 1QQ6A 4IC9A 8ICPA 2E8NA 3C5FA 4YXMA 3KZXA 2ZIWB 4OJPA 4AYBF 2BR0A 3ZDCA 4DFMA 3TFSA 1PZNA 1YZ6A 1SL2A 1KFTA 2ASDA 3EWAA 3EPGA 2WAQF 3D2SA 2JV3A 3UMBA 4IRDA 4EEKA 1LB2B 4ED2A 2NRZA 3SMVA 3PNCA 5DGBA 3BS7A 2KFNA 1QTMA 1URJA 2XCPA 1UPHA 3EPIA 1D9DA 4BGDA 2W8KA 2BCRA 1LV5A 2KKPA 2H3VA 5KFOA 2Y0SF 4F92B 4QZCA 5DBAA 3BQTA 5J0RA 2CXYA 5ALNA 4YMMA 1ZD4A 1U49A 1MC8A 1L7MA 2PFPA 1Q3UA 1PK3A 1V9PA 2F44A 3MFHA 1FIQA 4C0ZA 3WU2U 2Z7JA 1XWLA 3NVYA 3UXPA 9ICLA 2A3VA 1Z19A 2QLTA 4DL3A 4KMOB 3T5KA 5F9LA 5HP4A 4C7ZA 4KLIA 4EYHB 5KFVA 4MFAA 5AKXA 4UATA 3DDHA 3AU2A 2YMQA 2HBKA 2KZ3A 2P6RA 2NYVA 4QZEA 2WAQC 1NK9A 5KG4A 3AMZA 1WUDA 2JMGA 2IOHA 4RQ3A 3UPQA 7ICHA 1A76A 4OO1J 4IL6U 3PR4A 2ISPA 2JRZA 4JK1A 5HMMA 1QLNA 4JUZA 4C4TA 7ICQA 2B6GA 3C2LA 3WK8A 2HHWA 8ICXA 4O3SA 1U45A 3BQ0A 4RZRA 5CB1A 3GV7B 5ALWA 3RTVA 1NKBA 2VANA 5AI0A 5T14A 3QXGA 9ICMA 1O08A 1X40A 2A1JA 1CRXA 4J9SA 2PMZC 3HP6A 3T5LA 2E1FA 1TVAA 4QZIA 3HWTA 3ZDBA 4YMOA 7ICUA 4ZOHC 4ED6A 4ECTA 4UAVA 2F2AB 4C8LA 2W11A 2KVSA 1Z4NA 4AYBC 5DB8A 4M0AA 5AKYA 4RQ8A 2NRTA 4O5EA 4PZOA 1BPXA 2A1JB 1K5OA 1SWWA 2Q4TA 3CNHA 3MGHA 4PHPA 4RQ7A 2ZUDA 1ZD3A 2W43A 1NJYA 3UMGA 9ICVA 2LM1A 2VA8A 2K4PA 3NVZA 3TAPA 3RH6A 2BQ3A 4UB6U 3KKAA 3KBBA 3GDXA 2FPMA 3PVXA 1WCLA 5AM3A 3NUQA 5KT6A 5IIOA 1ZYQA 3NS1A 3NGDA 4P0PB 4U6PA 4KLGA 3N97B 4OJ6A 3GV5B 4DQSA 5DG7A 3BZKA 5TZVA 1L3UA 3UXNA 2F1IA 4F3OA 4RQMA 2GOLA 4J9QA 1N5XA 2L5YA 3SV4A 1IIPA 4U7CA 2HBMA 4TQSA 3AUOA 2I9GA 5GTHU 4ED1A 2PFQA 2HOIA 4M04A 3WKDA 2FMSA 2YMMA 5DG8A 4QWBA 2Y9UA 4QNLA 2WF8A 1RZTA 3WKAA 2QARB 1TAUA 4NJ8A 1Q8KA 1Z00B 2ZJAA 4RUAA 3K75D 1J97A 5AI4A 1ZQXA 1RQLA 1BPDA 3Q8KA 5AKHA 2W54A 1DRGA 4BX9C 2XC9A 1TK8A 5KFXA 1QSLA
chains in the Genus database with same CATH topology
1D8YA 4P4OA 2DFLA 1KRPA 5J0QA 5KFKA 1NOMA 3LK9A 2P66A 4YD1A 1IXRA 3N4MB 1NK8A 1ZQNA 1SL0A 3H4DA 2IBKA 4PHDA 2FPKA 4R8UA 4ECXA 3RRGA 2PI4A 2W9BB 3PW7A 8ICZA 4F2SA 3V7JA 5KFMA 2XO7A 3PX6A 2AJQA 8ICJA 2P6UA 3OJSA 3RAXA 4ED0A 2ZTCA 4ZH4A 5KG7A 4IR1A 4DS4A 4DQIA 4YMNA 1ZQIA 5KFDA 5KT3A 5DB6A 4EZ6A 4PH5A 5KFHA 5BOMA 4JV2A 9ICJA 5KFIA 4YQWA 4P4PA 3C1YA 2XY6A 3RH5A 1SKSA 1T7PA 5KFZA 2RDIA 4YR0A 2IHMA 2DPIA 3RR7A 3RJIA 4ECQA 4EBEA 1C7YA 4MEYA 4C8OA 4O0IA 4M9HA 3G6XA 4FBUA 3GIIA 5J0WA 3PX4A 2F1HA 4O3OA 2XY7A 4ECVA 1B22A 5DBBA 2V4RA 1ZQAA 3V6JA 4KMUA 4E0DA 2J6SA 4F4KA 4KLLA 3EW9A 5D46A 5JUMA 4GXKA 1KFSA 5CA7A 3T5JA 2AGQA 1T8EA 4DSKA 4QWEA 3TQ1A 4TURA 4IQWA 2DPJA 5DQHA 1ZQTA 3RJHA 4DSLA 3RR8A 5DLGA 3MR3A 1BPEA 5J0OA 5J0YA 4PGXA 3M9OB 3TFRA 3JPTA 3JPRA 5DGAA 3QEAZ 1ZJNA 9ICOA 2MAXA 4O3NA 3KTQA 4JWMA 9ICSA 4BXOB 1JIHA 3UXOA 5CP2A 4ELTA 3PW0A 5EWEA 4YVZA 4J9MA 4DOCA 1EXNA 1U9LA 3ORYA 5HHIA 4ECRA 1MQ2A 4M2YA 2HHSA 4UBCA 8ICYA 4RT3A 1ZQRA 2PFOA 5KT4A 4YD2A 5J2AA 8ICBA 3C2MA 2WTFA 1XC9A 2IA6A 4F93B 4UB4A 4LZDA 4RQ0A 5J2GA 1XS9D 3HW8A 5KG3A 5KFLA 4FBTA 3ZDEA 4NY8A 2V4QA 1TK0A 9ICCA 2W9CA 4ECSA 5DQIA 4DOBA 3ETLA 2ZTEA 3SZ2A 4ECZA 3NTUA 3THVA 4K4HA 4I2CA 4RT2A 4BXOA 4RU9A 4MF8A 5KFSA 2BCQA 1NJZA 3GQCA 1ZQFA 3HPOA 3FDSA 5J29A 2HHUA 3Q8LA 5EWFA 3HX0A 4JV1A 4NLNA 7ICRA 4IRCA 4EEYA 5J2HA 4PGYA 4R63A 4I29A 2AGOA 3IM1A 1XSPA 4GXIA 1SZPA 2C22A 4Z6EA 2HHTA 5DKWA 3LWLA 2IMWP 3OHBA 5CJ7A 2JZBA 4NXZA 5L1JA 4F4YA 3PW5A 3C21A 5KFYA 4F5QA 5DLFA 1XO1A 3E2EA 4RQ2A 4F5PA 1NKEA 5HMLA 1L3SA 4FO6A 1ZQDA 5C5JA 2BCUA 1QSSA 4MF2A 1K1SA 1UA1A 4K4GA 2J6UA 5EOZA 4B9NA 2PFNA 4YR2A 1S0OA 1X2IA 5IIIA 4B9TA 1S0VA 3PW2A 3RBDA 5KFJA 1UT5A 5BOLA 3V7KA 3SV3A 2BQUA 1RPLA 1HUZA 1ZQHA 4M6WA 4UB3A 9ICBA 3TI0A 2Y1IA 1ZQMA 1SKWA 1H38A 5D4BA 5DB9A 1XSLA 5KFTA 5HHHA 4R64A 3ISDA 4DQQA 2C28A 4I2AA 9ICUA 3BQ1A 3KHLA 4RNOA 3UQ2A 5KFCA 4FS1A 1JMSA 2ZUCA 4KLFA 4Q8FA 2ZJ8A 1ZQVA 4DL7A 3Q8MA 3MFIA 1COOA 4KN7A 4EYIB 1X9MA 2PI5A 1HJPA 4DL2A 1A77A 3ZDAA 3MR5A 1T3NA 2NRXA 1ZQYA 5IIJA 3TARA 4YFKA 4JV0A 3QZ7A 3V6KA 8ICIA 4YN4A 5L1IA 2AGPA 4QZHA 4M9LA 2FLPA 4Q8EA 3OSPA 1QSYA 2ASLA 1CEZA 5KT2A 2FPLA 3T5HA 1ZQKA 1UA0A 2MUTB 4YCXA 3GV8B 4NLGA 3G6VA 3C1ZA 7ICNA 4ECWA 1U4BA 4R65A 4DO9A 1ZETA 2FMQA 1Z3EB 4KLJA 1UT8A 3IHQB 4RQ4A 2FLNA 5IIMA 3H8JA 3OGUA 8ICGA 2R8HA 1ZQJA 3PMNA 2FLLA 3MR2A 1BGXT 9ICRA 4MFCA 4DQPA 4UAZA 3KHGA 4B9LA 4B9SA 8ICLA 3OSNA 2AU0A 8ICKA 4DL4A 2W9MA 5J0SA 2LYHA 3PY8A 4UAYA 4I2BA 4O5CA 1NK0A 3TANA 5KFEA 5BPCA 4PHEA 8ICQA 3HT3A 1NK4A 5KT5A 4F5RA 7ICOA 5KG6A 5CR0A 4DLGA 3PX0A 3JPOA 4ED3A 2ATLA 4XRHA 4J9NA 3H40A 5KFWA 8ICPA 1ZQCA 3RB4A 2M9NA 4YR3A 4ECUA 1KLNA 3C5FA 4P2HA 4QZAA 1KTQA 4YXMA 1DGSA 2BR0A 4Q43A 2XY5A 4F91B 2FMPA 1AROP 3ZDCA 3PO5A 7ICIA 4DFMA 4YG2A 2Y1JA 4I2EA 3TFSA 3V6HA 1PZNA 4I2DA 7ICLA 4YP3A 1SL2A 5DDMA 1KFTA 1ZQQA 2ASDA 4QZFA 1D9FA 2B21A 3EZ5A 5J2JA 2JZBB 3EWAA 4M6WB 1IM4A 4RNNA 3EPGA 4ELVA 4RNMA 5KFRA 4O3QA 4IQTA 1X9WA 4I2JA 1BPYA 3JPQA 2JEIA 5KFNA 5KTQA 4R8UB 1S97A 2KZMA 5KT7A 4IRDA 3H7IA 1LB2B 1ZQBA 2V9WA 4MFFA 4ED2A 4KLTA 4O3PA 4RQ1A 4UB1A 4F5NA 2NRZA 3PNCA 3C23A 5DGBA 4QZDA 4B9MA 4O9MA 2KFNA 9ICFA 5EWGA 1QTMA 9ICGA 5KG5A 4RPXA 2KN7A 2R8JA 1S77D 2XCPA 1KSPA 3EPIA 2XGPA 4BGDA 2W8KA 2BCRA 1LV5A 1D9DA 3GFKB 2UVRA 8ICCA 3C5GA 2RDJA 3AU6A 5KFOA 4F92B 4QZCA 3MDCA 5DBAA 3BQTA 5J0RA 4QW9A 7ICPA 3H8SA 4K4IA 9ICHA 9ICQA 4O3RA 5J0TA 2BHNA 1Z00A 4YMMA 4JWNA 1U49A 1MC8A 1ZQPA 4KLSA 4GLXA 1HUOA 2PFPA 2IHNA 1V9PA 3MFHA 4DSFA 3RB0A 3RJGA 4C8KA 3PW4A 2VA2A 3H8WA 1NKCA 4Z6FA 4XA5A 3RH4A 4J9RA 1XWLA 1T4GA 5J2IA 5J0XA 3UXPA 7ICTA 1D8LA 4P4MA 4O5KA 4Q45A 3KHHA 9ICXA 2BPCA 1S76D 1CUKA 9ICPA 4UBBA 4XQ8A 5F9NA 9ICLA 1XU4A 5KFBA 2BQRA 4F8RA 9ICAA 4ECYA 4QW8A 3RJJA 4RPYA 3RJKA 2C2EA 3ZDDA 4TUSA 9ICIA 4DL3A 4NM2A 3T5KA 4DFPA 5F9LA 5HP4A 4KLIA 4EYHB 2UVWA 4M9JA 4GC6A 5IINA 5KFVA 4MFAA 3JPSA 3RB3A 3EYZA 1SKRA 4I2GA 4NLKA 3MBYA 5DBCA 3T3FA 1XSNA 3AU2A 4B9UA 2P6RA 2KZ3A 3JPNA 4I28A 3RB6A 4KLHA 1KFDA 4QZEA 2PXIA 1RXVA 1NK9A 5KG4A 1RYRA 4CCHA 3MABA 4RQ3A 2ZTDA 3UPQA 8ICMA 7ICHA 1A76A 2BCSA 5J2BA 3MDAA 1ZQEA 3PR4A 2ISPA 2BCVA 4JK1A 1X9SA 7ICGA 4UAWA 5HMMA 1QLNA 2BPFA 3Q8PB 4I2HA 4JUZA 5J2KA 4J9KA 4M47A 8ICUA 7ICQA 5DB7A 3C2KA 3C2LA 2UVUA 2I1QA 2HHWA 8ICXA 1JN3A 8ICHA 4O3SA 1BPZA 3BJYA 9ICKA 7ICMA 7ICKA 4DQRA 2XCAA 2NRVA 4YXJA 4IR9A 1U45A 2BGWA 1TV9A 3LDAA 4F4XA 1BPBA 3BQ0A 2W8LA 4RZRA 2BPGA 3K4GA 5CB1A 4RPZA 3ISCA 1ZJMA 4PGQA 3GV7B 2C2DA 1N56A 3PMLA 5KFAA 3RTVA 4B9VA 8ICFA 1NKBA 4HYKA 4TQRA 1U47A 2VANA 1JXEA 3BQ2A 4DSEA 5KFQA 1JXLA 5IIKA 4DL6A 3RAQA 4I27A 2HVHA 4IRKA 4DSJA 4QZ9A 4DFJA 9ICMA 3H4BA 2A1JA 2KZZA 4DSIA 4DS5A 4J9SA 4KLOA 2HW3A 2HHXA 4NLZA 2KTQA 5CHGA 5L1KA 4M9GA 5KG1A 3GILA 3V7LA 2BDPA 4KN4A 5DG9A 3HP6A 4GC7A 3T5LA 3SYZA 1TVAA 4QZIA 4KLMA 5CWRA 3HWTA 2ISOA 3ZDBA 3B0YA 4QZBA 4YMOA 4DFKA 7ICUA 2HVIA 1TAQA 5HNKA 1NJXA 5J0UA 3MR6A 4ED6A 4ED7A 1BVSA 4ECTA 3RJEA 3UQ0A 4C8LA 1B43A 4RQ5A 1NK6A 4PHAA 2ASJA 4QWAA 2KFZA 5DB8A 4M0AA 2XGQA 1TKDA 5KG2A 4RQ6A 3JPPA 4RQ8A 1KEJA 4LVSA 2R8KA 2NRTA 4Z6DA 2NRWA 4O5EA 2BKEA 3RBEA 1MSWD 8ICNA 3V72A 3SI8A 1BPXA 1Y88A 2R8GA 2Q0ZX 2A1JB 7ICJA 4LZGA 3TAQA 4QWCA 5IILA 9ICTA 3GIJA 1SL1A 3MGHA 7ICVA 2AQ0A 4PHPA 1S0MA 3M9NB 2W9AA 4RQ7A 2UVVA 2ZUDA 4EBDA 1DOQA 4XUSA 4DL5A 1NJYA 4C8NA 1WCNA 4J9PA 4RUCA 1JX4A 3M8RA 4KLUA 8ICSA 5J2FA 9ICVA 4DLEA 9ICNA 2VA8A 4X5VA 3RJFA 3KHRA 4QWDA 4FS2A 4KLQA 9ICWA 4BWMA 1TFRA 1ZQWA 3TAPA 4MEXA 4G3IA 3RH6A 4J9OA 4J9LA 2BQ3A 4DWIA 5J0PA 1S10A 3RRHA 1K1QA 1ZQZA 5J2DA 4KTQA 5L9XA 1ZQLA 3GDXA 7ICEA 2FPMA 4DF4A 4PPXA 3PVXA 1ZQGA 5D49A 2ZJ5A 1WCLA 1NK5A 4F5OA 4DOAA 3QEBZ 5KT6A 4C8MA 2W9BA 5IIOA 4UB5A 1U48A 2HHQA 4TUQA 2W9CB 1ZYQA 3GIKA 1KDHA 3NGDA 4EBCA 4KLGA 3N97B 2H5XA 3GV5B 2JEFA 7ICFA 4Q44A 3ZD9A 5L1LA 4DQSA 5DG7A 1RXWA 5TZVA 2F1JA 1L3UA 4F2RA 3UXNA 3Q8RB 4IQUA 3Q8QB 2F1IA 4KLDA 3PO4A 4QZGA 4F3OA 2OWOA 4ED8A 1L3VA 4F4ZA 4J9QA 1RYSA 5KG0A 3SV4A 4KITB 1MQ3A 2HHVA 3ISBA 3PR5B 2R8IA 2JEGA 4IQVA 1ZQUA 4TQSA 2J6TA 4BWJA 2ZUBA 3AUOA 3OHAA 2I9GA 4ED1A 2PFQA 4GXJA 4M04A 4UB2A 8ICEA 5KFPA 5KFFA 2FMSA 2AQ4A 5DG8A 4KLEA 3MGIA 5J2EA 4I2FA 8ICAA 4M9NA 1NK7A 8ICWA 4QWBA 5DQGA 1NJWA 2C2RA 4TUPA 8ICOA 1RZTA 3GIMA 1TK5A 4Z6CA 3QZ8A 1S0NA 5KFGA 8ICTA 3Q8SB 7ICSA 4BDPA 4F50A 3M9MB 4DF8A 4I2IA 1L3TA 1ZQOA 4F4WA 2ALZA 4EZ9A 1N48A 1TAUA 3G6YA 1L5UA 1Z00B 3M8SA 2VA3A 5J2CA 1S9FA 2ZJAA 4RUAA 4R66A 3K75D 4UQGA 4ELUA 1ZQXA 4NM1A 3ZD8A 8ICVA 4QZ8A 1BPDA 3OJUA 3BDPA 3QE9Y 9ICEA 3Q8KA 3B0XA 2XC9A 8ICRA 2GWSA 1TK8A 1ZQSA 2MUTA 3LWMA 5KFXA 2JEJA 3PV8A 3FYHA 4DEZA 5KFUA 5DDYA 1QSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8Y A;  4P4O A;  2DFL A;  1KRP A;  5J0Q A;  5KFK A;  1NOM A;  3LK9 A;  2P66 A;  4YD1 A;  1IXR A;  3N4M B;  1NK8 A;  1ZQN A;  1SL0 A;  3H4D A;  2IBK A;  4PHD A;  2FPK A;  4R8U A;  4ECX A;  3RRG A;  2PI4 A;  2W9B B;  3PW7 A;  8ICZ A;  4F2S A;  3V7J A;  5KFM A;  2XO7 A;  3PX6 A;  2AJQ A;  8ICJ A;  2P6U A;  3OJS A;  3RAX A;  4ED0 A;  2ZTC A;  4ZH4 A;  5KG7 A;  4IR1 A;  4DS4 A;  4DQI A;  4YMN A;  1ZQI A;  5KFD A;  5KT3 A;  5DB6 A;  4EZ6 A;  4PH5 A;  5KFH A;  5BOM A;  4JV2 A;  9ICJ A;  5KFI A;  4YQW A;  4P4P A;  3C1Y A;  2XY6 A;  3RH5 A;  1SKS A;  1T7P A;  5KFZ A;  2RDI A;  4YR0 A;  2IHM A;  2DPI A;  3RR7 A;  3RJI A;  4ECQ A;  4EBE A;  1C7Y A;  4MEY A;  4C8O A;  4O0I A;  4M9H A;  3G6X A;  4FBU A;  3GII A;  5J0W A;  3PX4 A;  2F1H A;  4O3O A;  2XY7 A;  4ECV A;  1B22 A;  5DBB A;  2V4R A;  1ZQA A;  3V6J A;  4KMU A;  4E0D A;  2J6S A;  4F4K A;  4KLL A;  3EW9 A;  5D46 A;  5JUM A;  4GXK A;  1KFS A;  5CA7 A;  3T5J A;  2AGQ A;  1T8E A;  4DSK A;  4QWE A;  3TQ1 A;  4TUR A;  4IQW A;  2DPJ A;  5DQH A;  1ZQT A;  3RJH A;  4DSL A;  3RR8 A;  5DLG A;  3MR3 A;  1BPE A;  5J0O A;  5J0Y A;  4PGX A;  3M9O B;  3TFR A;  3JPT A;  3JPR A;  5DGA A;  3QEA Z;  1ZJN A;  9ICO A;  2MAX A;  4O3N A;  3KTQ A;  4JWM A;  9ICS A;  4BXO B;  1JIH A;  3UXO A;  5CP2 A;  4ELT A;  3PW0 A;  5EWE A;  4YVZ A;  4J9M A;  4DOC A;  1EXN A;  1U9L A;  3ORY A;  5HHI A;  4ECR A;  1MQ2 A;  4M2Y A;  2HHS A;  4UBC A;  8ICY A;  4RT3 A;  1ZQR A;  2PFO A;  5KT4 A;  4YD2 A;  5J2A A;  8ICB A;  3C2M A;  2WTF A;  1XC9 A;  2IA6 A;  4F93 B;  4UB4 A;  4LZD A;  4RQ0 A;  5J2G A;  1XS9 D;  3HW8 A;  5KG3 A;  5KFL A;  4FBT A;  3ZDE A;  4NY8 A;  2V4Q A;  1TK0 A;  9ICC A;  2W9C A;  4ECS A;  5DQI A;  4DOB A;  3ETL A;  2ZTE A;  3SZ2 A;  4ECZ A;  3NTU A;  3THV A;  4K4H A;  4I2C A;  4RT2 A;  4BXO A;  4RU9 A;  4MF8 A;  5KFS A;  2BCQ A;  1NJZ A;  3GQC A;  1ZQF A;  3HPO A;  3FDS A;  5J29 A;  2HHU A;  3Q8L A;  5EWF A;  3HX0 A;  4JV1 A;  4NLN A;  7ICR A;  4IRC A;  4EEY A;  5J2H A;  4PGY A;  4R63 A;  4I29 A;  2AGO A;  3IM1 A;  1XSP A;  4GXI A;  1SZP A;  2C22 A;  4Z6E A;  2HHT A;  5DKW A;  3LWL A;  2IMW P;  3OHB A;  5CJ7 A;  2JZB A;  4NXZ A;  5L1J A;  4F4Y A;  3PW5 A;  3C21 A;  5KFY A;  4F5Q A;  5DLF A;  1XO1 A;  3E2E A;  4RQ2 A;  4F5P A;  1NKE A;  5HML A;  1L3S A;  4FO6 A;  1ZQD A;  5C5J A;  2BCU A;  1QSS A;  4MF2 A;  1K1S A;  1UA1 A;  4K4G A;  2J6U A;  5EOZ A;  4B9N A;  2PFN A;  4YR2 A;  1S0O A;  1X2I A;  5III A;  4B9T A;  1S0V A;  3PW2 A;  3RBD A;  5KFJ A;  1UT5 A;  5BOL A;  3V7K A;  3SV3 A;  2BQU A;  1RPL A;  1HUZ A;  1ZQH A;  4M6W A;  4UB3 A;  9ICB A;  3TI0 A;  2Y1I A;  1ZQM A;  1SKW A;  1H38 A;  5D4B A;  5DB9 A;  1XSL A;  5KFT A;  5HHH A;  4R64 A;  3ISD A;  4DQQ A;  2C28 A;  4I2A A;  9ICU A;  3BQ1 A;  3KHL A;  4RNO A;  3UQ2 A;  5KFC A;  4FS1 A;  1JMS A;  2ZUC A;  4KLF A;  4Q8F A;  2ZJ8 A;  1ZQV A;  4DL7 A;  3Q8M A;  3MFI A;  1COO A;  4KN7 A;  4EYI B;  1X9M A;  2PI5 A;  1HJP A;  4DL2 A;  1A77 A;  3ZDA A;  3MR5 A;  1T3N A;  2NRX A;  1ZQY A;  5IIJ A;  3TAR A;  4YFK A;  4JV0 A;  3QZ7 A;  3V6K A;  8ICI A;  4YN4 A;  5L1I A;  2AGP A;  4QZH A;  4M9L A;  2FLP A;  4Q8E A;  3OSP A;  1QSY A;  2ASL A;  1CEZ A;  5KT2 A;  2FPL A;  3T5H A;  1ZQK A;  1UA0 A;  2MUT B;  4YCX A;  3GV8 B;  4NLG A;  3G6V A;  3C1Z A;  7ICN A;  4ECW A;  1U4B A;  4R65 A;  4DO9 A;  1ZET A;  2FMQ A;  1Z3E B;  4KLJ A;  1UT8 A;  3IHQ B;  4RQ4 A;  2FLN A;  5IIM A;  3H8J A;  3OGU A;  8ICG A;  2R8H A;  1ZQJ A;  3PMN A;  2FLL A;  3MR2 A;  1BGX T;  9ICR A;  4MFC A;  4DQP A;  4UAZ A;  3KHG A;  4B9L A;  4B9S A;  8ICL A;  3OSN A;  2AU0 A;  8ICK A;  4DL4 A;  2W9M A;  5J0S A;  2LYH A;  3PY8 A;  4UAY A;  4I2B A;  4O5C A;  1NK0 A;  3TAN A;  5KFE A;  5BPC A;  4PHE A;  8ICQ A;  3HT3 A;  1NK4 A;  5KT5 A;  4F5R A;  7ICO A;  5KG6 A;  5CR0 A;  4DLG A;  3PX0 A;  3JPO A;  4ED3 A;  2ATL A;  4XRH A;  4J9N A;  3H40 A;  5KFW A;  8ICP A;  1ZQC A;  3RB4 A;  2M9N A;  4YR3 A;  4ECU A;  1KLN A;  3C5F A;  4P2H A;  4QZA A;  1KTQ A;  4YXM A;  1DGS A;  2BR0 A;  4Q43 A;  2XY5 A;  4F91 B;  2FMP A;  1ARO P;  3ZDC A;  3PO5 A;  7ICI A;  4DFM A;  4YG2 A;  2Y1J A;  4I2E A;  3TFS A;  3V6H A;  1PZN A;  4I2D A;  7ICL A;  4YP3 A;  1SL2 A;  5DDM A;  1KFT A;  1ZQQ A;  2ASD A;  4QZF A;  1D9F A;  2B21 A;  3EZ5 A;  5J2J A;  2JZB B;  3EWA A;  4M6W B;  1IM4 A;  4RNN A;  3EPG A;  4ELV A;  4RNM A;  5KFR A;  4O3Q A;  4IQT A;  1X9W A;  4I2J A;  1BPY A;  3JPQ A;  2JEI A;  5KFN A;  5KTQ A;  4R8U B;  1S97 A;  2KZM A;  5KT7 A;  4IRD A;  3H7I A;  1LB2 B;  1ZQB A;  2V9W A;  4MFF A;  4ED2 A;  4KLT A;  4O3P A;  4RQ1 A;  4UB1 A;  4F5N A;  2NRZ A;  3PNC A;  3C23 A;  5DGB A;  4QZD A;  4B9M A;  4O9M A;  2KFN A;  9ICF A;  5EWG A;  1QTM A;  9ICG A;  5KG5 A;  4RPX A;  2KN7 A;  2R8J A;  1S77 D;  2XCP A;  1KSP A;  3EPI A;  2XGP A;  4BGD A;  2W8K A;  2BCR A;  1LV5 A;  1D9D A;  3GFK B;  2UVR A;  8ICC A;  3C5G A;  2RDJ A;  3AU6 A;  5KFO A;  4F92 B;  4QZC A;  3MDC A;  5DBA A;  3BQT A;  5J0R A;  4QW9 A;  7ICP A;  3H8S A;  4K4I A;  9ICH A;  9ICQ A;  4O3R A;  5J0T A;  2BHN A;  1Z00 A;  4YMM A;  4JWN A;  1U49 A;  1MC8 A;  1ZQP A;  4KLS A;  4GLX A;  1HUO A;  2PFP A;  2IHN A;  1V9P A;  3MFH A;  4DSF A;  3RB0 A;  3RJG A;  4C8K A;  3PW4 A;  2VA2 A;  3H8W A;  1NKC A;  4Z6F A;  4XA5 A;  3RH4 A;  4J9R A;  1XWL A;  1T4G A;  5J2I A;  5J0X A;  3UXP A;  7ICT A;  1D8L A;  4P4M A;  4O5K A;  4Q45 A;  3KHH A;  9ICX A;  2BPC A;  1S76 D;  1CUK A;  9ICP A;  4UBB A;  4XQ8 A;  5F9N A;  9ICL A;  1XU4 A;  5KFB A;  2BQR A;  4F8R A;  9ICA A;  4ECY A;  4QW8 A;  3RJJ A;  4RPY A;  3RJK A;  2C2E A;  3ZDD A;  4TUS A;  9ICI A;  4DL3 A;  4NM2 A;  3T5K A;  4DFP A;  5F9L A;  5HP4 A;  4KLI A;  4EYH B;  2UVW A;  4M9J A;  4GC6 A;  5IIN A;  5KFV A;  4MFA A;  3JPS A;  3RB3 A;  3EYZ A;  1SKR A;  4I2G A;  4NLK A;  3MBY A;  5DBC A;  3T3F A;  1XSN A;  3AU2 A;  4B9U A;  2P6R A;  2KZ3 A;  3JPN A;  4I28 A;  3RB6 A;  4KLH A;  1KFD A;  4QZE A;  2PXI A;  1RXV A;  1NK9 A;  5KG4 A;  1RYR A;  4CCH A;  3MAB A;  4RQ3 A;  2ZTD A;  3UPQ A;  8ICM A;  7ICH A;  1A76 A;  2BCS A;  5J2B A;  3MDA A;  1ZQE A;  3PR4 A;  2ISP A;  2BCV A;  4JK1 A;  1X9S A;  7ICG A;  4UAW A;  5HMM A;  1QLN A;  2BPF A;  3Q8P B;  4I2H A;  4JUZ A;  5J2K A;  4J9K A;  4M47 A;  8ICU A;  7ICQ A;  5DB7 A;  3C2K A;  3C2L A;  2UVU A;  2I1Q A;  2HHW A;  8ICX A;  1JN3 A;  8ICH A;  4O3S A;  1BPZ A;  3BJY A;  9ICK A;  7ICM A;  7ICK A;  4DQR A;  2XCA A;  2NRV A;  4YXJ A;  4IR9 A;  1U45 A;  2BGW A;  1TV9 A;  3LDA A;  4F4X A;  1BPB A;  3BQ0 A;  2W8L A;  4RZR A;  2BPG A;  3K4G A;  5CB1 A;  4RPZ A;  3ISC A;  1ZJM A;  4PGQ A;  3GV7 B;  2C2D A;  1N56 A;  3PML A;  5KFA A;  3RTV A;  4B9V A;  8ICF A;  1NKB A;  4HYK A;  4TQR A;  1U47 A;  2VAN A;  1JXE A;  3BQ2 A;  4DSE A;  5KFQ A;  1JXL A;  5IIK A;  4DL6 A;  3RAQ A;  4I27 A;  2HVH A;  4IRK A;  4DSJ A;  4QZ9 A;  4DFJ A;  9ICM A;  3H4B A;  2A1J A;  2KZZ A;  4DSI A;  4DS5 A;  4J9S A;  4KLO A;  2HW3 A;  2HHX A;  4NLZ A;  2KTQ A;  5CHG A;  5L1K A;  4M9G A;  5KG1 A;  3GIL A;  3V7L A;  2BDP A;  4KN4 A;  5DG9 A;  3HP6 A;  4GC7 A;  3T5L A;  3SYZ A;  1TVA A;  4QZI A;  4KLM A;  5CWR A;  3HWT A;  2ISO A;  3ZDB A;  3B0Y A;  4QZB A;  4YMO A;  4DFK A;  7ICU A;  2HVI A;  1TAQ A;  5HNK A;  1NJX A;  5J0U A;  3MR6 A;  4ED6 A;  4ED7 A;  1BVS A;  4ECT A;  3RJE A;  3UQ0 A;  4C8L A;  1B43 A;  4RQ5 A;  1NK6 A;  4PHA A;  2ASJ A;  4QWA A;  2KFZ A;  5DB8 A;  4M0A A;  2XGQ A;  1TKD A;  5KG2 A;  4RQ6 A;  3JPP A;  4RQ8 A;  1KEJ A;  4LVS A;  2R8K A;  2NRT A;  4Z6D A;  2NRW A;  4O5E A;  2BKE A;  3RBE A;  1MSW D;  8ICN A;  3V72 A;  3SI8 A;  1BPX A;  1Y88 A;  2R8G A;  2Q0Z X;  2A1J B;  7ICJ A;  4LZG A;  3TAQ A;  4QWC A;  5IIL A;  9ICT A;  3GIJ A;  1SL1 A;  3MGH A;  7ICV A;  2AQ0 A;  4PHP A;  1S0M A;  3M9N B;  2W9A A;  4RQ7 A;  2UVV A;  2ZUD A;  4EBD A;  1DOQ A;  4XUS A;  4DL5 A;  1NJY A;  4C8N A;  1WCN A;  4J9P A;  4RUC A;  1JX4 A;  3M8R A;  4KLU A;  8ICS A;  5J2F A;  9ICV A;  4DLE A;  9ICN A;  2VA8 A;  4X5V A;  3RJF A;  3KHR A;  4QWD A;  4FS2 A;  4KLQ A;  9ICW A;  4BWM A;  1TFR A;  1ZQW A;  3TAP A;  4MEX A;  4G3I A;  3RH6 A;  4J9O A;  4J9L A;  2BQ3 A;  4DWI A;  5J0P A;  1S10 A;  3RRH A;  1K1Q A;  1ZQZ A;  5J2D A;  4KTQ A;  5L9X A;  1ZQL A;  3GDX A;  7ICE A;  2FPM A;  4DF4 A;  4PPX A;  3PVX A;  1ZQG A;  5D49 A;  2ZJ5 A;  1WCL A;  1NK5 A;  4F5O A;  4DOA A;  3QEB Z;  5KT6 A;  4C8M A;  2W9B A;  5IIO A;  4UB5 A;  1U48 A;  2HHQ A;  4TUQ A;  2W9C B;  1ZYQ A;  3GIK A;  1KDH A;  3NGD A;  4EBC A;  4KLG A;  3N97 B;  2H5X A;  3GV5 B;  2JEF A;  7ICF A;  4Q44 A;  3ZD9 A;  5L1L A;  4DQS A;  5DG7 A;  1RXW A;  5TZV A;  2F1J A;  1L3U A;  4F2R A;  3UXN A;  3Q8R B;  4IQU A;  3Q8Q B;  2F1I A;  4KLD A;  3PO4 A;  4QZG A;  4F3O A;  2OWO A;  4ED8 A;  1L3V A;  4F4Z A;  4J9Q A;  1RYS A;  5KG0 A;  3SV4 A;  4KIT B;  1MQ3 A;  2HHV A;  3ISB A;  3PR5 B;  2R8I A;  2JEG A;  4IQV A;  1ZQU A;  4TQS A;  2J6T A;  4BWJ A;  2ZUB A;  3AUO A;  3OHA A;  2I9G A;  4ED1 A;  2PFQ A;  4GXJ A;  4M04 A;  4UB2 A;  8ICE A;  5KFP A;  5KFF A;  2FMS A;  2AQ4 A;  5DG8 A;  4KLE A;  3MGI A;  5J2E A;  4I2F A;  8ICA A;  4M9N A;  1NK7 A;  8ICW A;  4QWB A;  5DQG A;  1NJW A;  2C2R A;  4TUP A;  8ICO A;  1RZT A;  3GIM A;  1TK5 A;  4Z6C A;  3QZ8 A;  1S0N A;  5KFG A;  8ICT A;  3Q8S B;  7ICS A;  4BDP A;  4F50 A;  3M9M B;  4DF8 A;  4I2I A;  1L3T A;  1ZQO A;  4F4W A;  2ALZ A;  4EZ9 A;  1N48 A;  1TAU A;  3G6Y A;  1L5U A;  1Z00 B;  3M8S A;  2VA3 A;  5J2C A;  1S9F A;  2ZJA A;  4RUA A;  4R66 A;  3K75 D;  4UQG A;  4ELU A;  1ZQX A;  4NM1 A;  3ZD8 A;  8ICV A;  4QZ8 A;  1BPD A;  3OJU A;  3BDP A;  3QE9 Y;  9ICE A;  3Q8K A;  3B0X A;  2XC9 A;  8ICR A;  2GWS A;  1TK8 A;  1ZQS A;  2MUT A;  3LWM A;  5KFX A;  2JEJ A;  3PV8 A;  3FYH A;  4DEZ A;  5KFU A;  5DDY A;  1QSL A; 
#chains in the Genus database with same CATH topology
 5ALR A;  1KRP A;  3LK9 A;  2KE7 A;  1HEK A;  4Y2V A;  2IBK A;  2FPK A;  3IN5 A;  2W9B B;  8ICZ A;  3V7J A;  1XO0 A;  2Y0S C;  2W03 A;  3RAX A;  5KG7 A;  2K4I A;  4PH5 A;  5KFH A;  4JV2 A;  1WYG A;  1A6S A;  2HSZ A;  2RDI A;  4YR0 A;  3RJI A;  4EBE A;  4C8O A;  3E58 A;  3G6X A;  4OJO A;  4NL9 C;  5AK4 A;  4E0D A;  1OW5 A;  4GXK A;  1KFS A;  5CA7 A;  3I1Y A;  2AGQ A;  5AKG A;  4IQW A;  4NWI A;  4PGX A;  3M9O B;  3JPT A;  2MAX A;  9ICS A;  4QJF B;  4BXO B;  2IOF K;  5CP2 A;  1AQ6 A;  3PW0 A;  2G06 A;  4DOC A;  3QU2 A;  3A0H U;  1VDV A;  3ORY A;  5KT4 A;  1ZOL A;  1HIW A;  2WTF A;  2KK0 A;  2ZXI A;  3ZDE A;  1TK0 A;  3PSI A;  4ECZ A;  3NTU A;  5KFS A;  3H0L B;  1NJZ A;  3FDS A;  2HHU A;  3Q8L A;  2AGO A;  3IM1 A;  2RP5 A;  2IMW P;  3PW5 A;  2JZB A;  4F4Y A;  1L8O A;  4HAI A;  1NKE A;  1C20 A;  1X9X A;  2R8K A;  2BQU A;  4F72 A;  4UB3 A;  3TI0 A;  2JH1 A;  2Y1I A;  1H38 A;  1J2N A;  5D4B A;  1P7D A;  5KFT A;  5HHH A;  4R64 A;  2JGA A;  2G09 A;  2C28 A;  4IS7 A;  4RNO A;  3UQ2 A;  4FS1 A;  1JMS A;  4Q8F A;  1ZQV A;  5AI8 A;  3MFI A;  2KMD A;  1COO A;  1HJP A;  4DL2 A;  3SEI A;  5IIJ A;  2R18 A;  3RF9 A;  8ICI A;  2FLP A;  1QSY A;  4NV0 A;  1CEZ A;  5CRX A;  3NAS A;  1ZET A;  4RQ4 A;  2CRX A;  3IG8 A;  2FLN A;  3OGU A;  3PMN A;  1BGX T;  2KD1 A;  9ICR A;  4DQP A;  3KHG A;  1NZP A;  2W9M A;  2LMR A;  3PY8 A;  5KFE A;  1D8B A;  4PHE A;  4OCZ A;  8ICQ A;  3HT3 A;  5KT5 A;  7ICO A;  4NLC A;  5KG6 A;  3JPO A;  4ED3 A;  2W7O A;  3H40 A;  3RB4 A;  2M9N A;  4YR3 A;  1PUZ A;  4ECU A;  3BS5 B;  1KTQ A;  1X6J A;  3BQ7 A;  5HR6 A;  2CN1 A;  7ICI A;  4I2E A;  2QB0 A;  1D9F A;  4QZF A;  2KEY A;  3UMC A;  4O3Q A;  1BPY A;  2KZM A;  1S97 A;  3H7I A;  4O3P A;  4RQ1 A;  2LI6 A;  3C23 A;  3L4P A;  4QZD A;  5AM1 A;  5KG5 A;  2GO7 A;  2F8L A;  1S77 D;  5J8Y A;  2XGP A;  2FDR A;  1N60 A;  3AU6 A;  2NO4 A;  3MDC A;  5ALP A;  3K1Z A;  4O3R A;  5J0T A;  1Z00 A;  2F76 X;  4JWN A;  1ZQP A;  4KLS A;  3IV6 A;  3SD7 A;  2RQ5 A;  1HUO A;  5ALU A;  2DWQ A;  1QH9 A;  5AM0 A;  4Y2U A;  3RH4 A;  4J9R A;  1T4G A;  4P4M A;  2QB1 A;  9ICP A;  2BQR A;  3DV9 A;  9ICA A;  2ES6 A;  4QW8 A;  1SXD A;  5AKK A;  4RPY A;  3RJK A;  4DFP A;  2DGZ A;  2E8M A;  5IIN A;  4FZL A;  3AEV A;  3EYZ A;  4NLK A;  3MBY A;  1XSN A;  4B9U A;  4KLH A;  1RXV A;  3MAB A;  4GIB A;  3LVW A;  3EUB 2;  1X66 A;  2BCV A;  5CEH A;  4I2H A;  4P0Q A;  3C2K A;  3AN1 A;  2VJ5 A;  4QIW C;  8ICH A;  2NRV A;  3F2D A;  3LDA A;  4F4X A;  1TV9 A;  4PJ0 U;  2BPG A;  3K4G A;  4US9 A;  1ZJM A;  4PGQ A;  1DK3 A;  3NRW A;  3RAQ A;  4I27 A;  5ALH A;  4IRK A;  3D2N A;  3AM9 A;  4Y2X A;  5AKL A;  2KZZ A;  2HW3 A;  1JAL A;  2KTQ A;  1RDF A;  4B9V A;  2BDP A;  5DG9 A;  4GC7 A;  2EH9 A;  4KLM A;  2JXJ A;  5ALQ A;  2G5I B;  3B0Y A;  2HVI A;  4CGZ A;  3RJE A;  1B43 A;  1NK6 A;  4PHA A;  2ASJ A;  2KFZ A;  5KG2 A;  1KEJ A;  1V38 A;  1VJ5 A;  1JI7 A;  2EAN A;  2LPE A;  1QCK A;  2NRW A;  3RBE A;  1YZ7 A;  3V72 A;  1KL9 A;  3SI8 A;  1Y88 A;  5G5H A;  1F44 A;  4LZG A;  1B0X A;  5IIL A;  3M6K A;  1SL1 A;  1QQ5 A;  2H3Q A;  3LYS A;  2EZX A;  4EBD A;  3F5A A;  4XUS A;  5AI9 A;  1WCN A;  4RUC A;  1JX4 A;  3M8R A;  4DLE A;  3RJF A;  3KHR A;  4QWD A;  9ICW A;  1O03 A;  4MEX A;  3HKZ C;  4DWI A;  5J0P A;  4ICA A;  5AM5 A;  1S10 A;  2YB1 A;  4KTQ A;  2G07 A;  3WKC A;  4CNQ A;  3IP4 B;  3H0R B;  4DF4 A;  4PPX A;  4FZM A;  3HJE A;  2ZJ5 A;  4F5O A;  3QEB Z;  2W9B A;  2HHQ A;  3U26 A;  4EBC A;  2H5X A;  2JEF A;  5TIS U;  3ZD9 A;  5L1L A;  2QKQ A;  1RXW A;  2F1J A;  4PZN A;  2LYA A;  4J03 A;  4IQU A;  5AI5 A;  5ALS A;  5KG0 A;  4KIT B;  2HHV A;  1VLB A;  2R8I A;  5ALF A;  2J6T A;  2ZUB A;  5AK6 A;  2GH1 A;  2KOB A;  2KP7 A;  8ICE A;  4C7Y A;  1WWV A;  1V85 A;  2AQ4 A;  2QAR A;  4KLE A;  1N5W A;  4I2F A;  4M9N A;  2HI0 A;  2C2R A;  3N28 A;  3GIM A;  5A0L A;  1S0N A;  3WK9 A;  3Q8S B;  4BDP A;  4F50 A;  3M9M B;  1L3T A;  4I2I A;  3KZI U;  1N48 A;  1L5U A;  1SV0 A;  3M8S A;  2OYY A;  1LKY B;  3SAF A;  2WHE A;  4UQG A;  8ICV A;  3ZD8 A;  4QZ8 A;  3B0X A;  2FJ6 A;  4NL9 A;  3FYH A;  2NO5 A;  2DFL A;  4OD0 A;  4YD1 A;  3SR6 A;  3N4M B;  3HIL A;  1NK8 A;  4R8U A;  2PI4 A;  3TAD C;  2G5H B;  5ALK A;  2AJQ A;  4DFD A;  3NRZ A;  3OJS A;  2DQN B;  4ED0 A;  2ZTC A;  4YMN A;  1ZQI A;  5KFD A;  5DB6 A;  9ICJ A;  3CW2 C;  1Z1B A;  5KFI A;  3RH5 A;  1SKS A;  2E8O A;  2IHM A;  2DPI A;  4ECQ A;  4MEY A;  4O0I A;  2D8C A;  3BZC A;  4FBU A;  5J0W A;  4O3O A;  4KMU A;  4F4K A;  3EW9 A;  1SB3 C;  2BDU A;  3IRU A;  3T5J A;  1T8E A;  4DSK A;  5GTI U;  3TQ1 A;  4DSL A;  2GLE A;  3RR8 A;  3MR3 A;  3TFR A;  3SAH A;  3QEA Z;  3KTQ A;  2HOF A;  5EWE A;  2H3Z A;  4CF4 A;  1U9L A;  2WB1 F;  2WF7 A;  3AQE A;  8ICY A;  1MQ2 A;  2YX8 A;  3SEN A;  4RT3 A;  2PFO A;  8ICB A;  2OCE A;  1XC9 A;  4LZD A;  2E1E A;  4CE6 A;  5KAF U;  3HW8 A;  2P35 A;  2V4Q A;  9ICC A;  2W9C A;  5DQI A;  2ZTE A;  3THV A;  1NI3 A;  4K4H A;  3GZF A;  4MF8 A;  1SXE A;  5B5E U;  5AKZ A;  3HPO A;  1COK A;  2DUY A;  2K8A A;  4IRC A;  4EEY A;  1Q46 A;  4JMU A;  1SZP A;  5DKW A;  3OHB A;  5CJ7 A;  2LKY A;  5L1J A;  1SGG A;  2KJ9 A;  3R9K A;  1KQQ A;  5DLF A;  1XO1 A;  4F5P A;  2BCU A;  1FFU A;  1QSS A;  4K4G A;  1UA1 A;  4B9N A;  4YR2 A;  2KSO A;  1UT5 A;  5BOL A;  9ICX A;  3V7K A;  2K4H A;  4M6W A;  2ZIX B;  5ALI A;  3UM9 A;  1XSL A;  2W3S A;  3ISD A;  3KHL A;  2ZUC A;  2EAP A;  1Z1V A;  4DL7 A;  4Y2J A;  5AI6 A;  2PI5 A;  1X9M A;  4Y2R A;  3ZDA A;  2NRX A;  3WK4 A;  3TAR A;  4YFK A;  3V6K A;  1N2X A;  4YN4 A;  5L1I A;  2ASL A;  2FPL A;  1ZQK A;  2MUT B;  4YCX A;  2CPR A;  3C1Z A;  3K1R B;  4R65 A;  2KIV A;  1IG6 A;  1LKY A;  1DK2 A;  5AK5 A;  4B9L A;  3OSN A;  2AU0 A;  2DKZ A;  1M6Y A;  2LYH A;  4I2B A;  4GFJ A;  2AXT U;  4DLG A;  2YY6 A;  2ATL A;  4RQN A;  1KLN A;  2Y9T A;  1DGS A;  4Q43 A;  4O3M A;  2XY5 A;  2YB4 A;  2Y1J A;  4NLB A;  4YP3 A;  5KAI U;  5DDM A;  2LBO A;  2B21 A;  3QUC A;  5ALE A;  1IM4 A;  1B4F A;  4ELV A;  2WF5 A;  5KFR A;  5J8Y C;  4IQT A;  1X9W A;  4I2J A;  5KFN A;  5KTQ A;  2MSN A;  5KT7 A;  4KLT A;  1Q3V A;  3NVW A;  2BZF A;  1PVR A;  4F5N A;  5AHX A;  1GO3 F;  4O9M A;  9ICF A;  3FC4 A;  4C4R A;  2KN7 A;  2F3N A;  2YMP A;  1KSP A;  3D6J A;  5ALV A;  3GFK B;  1S5L U;  8ICC A;  3C5G A;  7ICP A;  5B66 U;  1PK1 B;  2KG5 A;  9ICH A;  2BHN A;  2ODG A;  3I28 A;  4GLX A;  2KJ8 A;  2AHO B;  2IHN A;  2MA1 A;  5EE1 A;  4C8K A;  3PW4 A;  3AL0 B;  2VA2 A;  1NKC A;  3H0M B;  4XA5 A;  4MHV A;  3M1Y A;  4UAS A;  5J2I A;  7ICT A;  4O5K A;  1S76 D;  3ETR A;  4XQ8 A;  3PST A;  1LVH A;  4QIW F;  5K4L A;  2OM6 A;  4ECY A;  3RJJ A;  5EE3 A;  2C2E A;  2KNJ A;  3ZDD A;  3CP8 A;  3QUB A;  3F5E A;  3ICX A;  3MC1 A;  1SKR A;  4I2G A;  3JPN A;  3RFA A;  3RB6 A;  1KFD A;  2ESE A;  2PXI A;  5C0Y A;  5KL1 B;  1RYR A;  4CCH A;  4CF3 A;  2BCS A;  4Y2S A;  2QB0 B;  1WWU A;  3MDA A;  1ZQE A;  3TAD A;  2BPF A;  3Q8P B;  4DCC A;  5J2K A;  4J9K A;  2KIW A;  5DB7 A;  2UVU A;  2I1Q A;  1BPZ A;  9ICK A;  7ICM A;  1MA7 A;  2KKV A;  2A19 A;  4DQR A;  4YXJ A;  1BPB A;  2W8L A;  4RPZ A;  2C2D A;  3PML A;  5KFA A;  8ICF A;  4HYK A;  4TQR A;  1JXE A;  1RM6 C;  4DSE A;  5KFQ A;  2LHT A;  5IIK A;  4DL6 A;  2HVH A;  4KLO A;  2HHX A;  1TE2 A;  5CHG A;  5L1K A;  4M9G A;  2HBL A;  4KN4 A;  3SYZ A;  3FM9 A;  4QZB A;  4DFK A;  1TAQ A;  5HNK A;  1NJX A;  5J0U A;  4ED7 A;  1BVS A;  1CI4 A;  5AK3 A;  5ALZ A;  4RQ5 A;  3WKB A;  2XGQ A;  1TKD A;  4RQ6 A;  4LVS A;  1MSW D;  3ALR A;  1L6N A;  2Q0Z X;  1TAM A;  7ICJ A;  3TAQ A;  4QWC A;  2EDU A;  9ICT A;  3GIJ A;  1YT3 A;  7ICV A;  2AQ0 A;  1S0M A;  1DOQ A;  4P0P A;  4C8N A;  2KHV A;  1MN8 A;  4KLU A;  8ICS A;  5J2F A;  4EEL A;  9ICN A;  4X5V A;  4KLQ A;  2I5H A;  4BWM A;  1TFR A;  1ZQW A;  4G3I A;  4J9O A;  4J9L A;  4UAU A;  3RRH A;  5J2D A;  1K1Q A;  2M0N A;  3QU5 A;  1ZQL A;  7ICE A;  3D2Q A;  1NK5 A;  4A8E A;  2K60 A;  1U48 A;  4UB5 A;  2W9C B;  2HOQ A;  1ZD2 P;  7ICF A;  4Q44 A;  5JTI A;  2WF6 A;  3Q8Q B;  4FE3 A;  5AIA A;  4KX3 A;  1RYS A;  3WK6 A;  1MQ3 A;  3PR5 B;  2G0A A;  4IQV A;  4BWJ A;  3B9J A;  3QU7 A;  3OHA A;  1X42 A;  4GXJ A;  4UB2 A;  2MU2 A;  5KFP A;  3MGI A;  5J2E A;  1NK7 A;  8ICW A;  1NJW A;  8ICO A;  3QU9 A;  8ICT A;  3QZ8 A;  5KFG A;  7ICS A;  4EZ9 A;  2ALZ A;  5J2C A;  4R66 A;  4UB8 U;  4ELU A;  3KKA C;  3QE9 Y;  3WK7 A;  8ICR A;  1FFV A;  2MUT A;  3LWM A;  1FO4 A;  5AM2 A;  3PV8 A;  5KFU A;  4EX7 A;  4CRX A;  1D8Y A;  4P4O A;  5J0Q A;  1NOM A;  2P66 A;  1IXR A;  1ZQN A;  3H8M A;  3IG5 A;  4PHD A;  3RRG A;  3PW7 A;  3L5K A;  2XO7 A;  8ICJ A;  2P6U A;  1S8O A;  4ZH4 A;  4C80 A;  2H3I A;  4IR1 A;  1NNL A;  4UAR A;  2K8B B;  4YQW A;  3C1Y A;  3F2C A;  1T7P A;  3N7R C;  2ZIU A;  5KFZ A;  5H2F U;  2KV2 A;  3I76 A;  1C7Y A;  4M9H A;  5E79 U;  3PX4 A;  2F1H A;  2XY7 A;  2JH7 A;  3CRX A;  1B22 A;  5DBB A;  2V4R A;  3V6J A;  4PL1 A;  2J6S A;  2F8K A;  3S6J A;  3LVV A;  5JUM A;  2ZIV A;  2ZIW A;  3ZI4 A;  4QWE A;  2RHF A;  2DPJ A;  5DQH A;  1ZQT A;  1ZQ1 C;  5DLG A;  2HBJ A;  5J0Y A;  4O3N A;  4JWM A;  1PVQ A;  1L7N A;  3UXO A;  2E5S A;  2E3T A;  4YVZ A;  3QYP A;  4B6J A;  5HHI A;  4ECR A;  2HHS A;  4UBC A;  1ZQR A;  3NVV A;  4F93 B;  4UB4 A;  5J2G A;  2JR5 A;  5KG3 A;  5KFL A;  4NY8 A;  3QX7 A;  4ECS A;  4RT2 A;  4BXO A;  3TAC B;  2BCQ A;  3GQC A;  5J29 A;  5EWF A;  3HX0 A;  3PSF A;  2DKX A;  4PGY A;  4I29 A;  4GXI A;  2C22 A;  2HHT A;  3LWL A;  1BNP A;  3HRD D;  3C21 A;  5HML A;  5ALJ A;  1L3S A;  1X6I A;  5EOZ A;  2D3D A;  1S0O A;  3WKE A;  2DBY A;  2K8C B;  5III A;  1S0V A;  3PW2 A;  3RBD A;  5KFJ A;  1ZQH A;  2N1R A;  1JUD A;  3T79 A;  1ZQM A;  1SKW A;  2OEH A;  4DQQ A;  4CDG A;  9ICU A;  3BQ1 A;  4KLF A;  2ZJ8 A;  5AM4 A;  3Q8M A;  2XVT A;  4BJQ A;  2OXO A;  3IDW A;  1A77 A;  3MR5 A;  1ZQY A;  2FI1 A;  4JV0 A;  2AGP A;  4QZH A;  4Q8E A;  5KT2 A;  3F2B A;  3T5H A;  3G6V A;  7ICN A;  5ALX A;  4OJ5 A;  1OXJ A;  1ZRN A;  2YTU A;  1Z3E B;  3QU4 A;  3IHQ B;  1PK1 A;  2YML A;  5AIC A;  2R8H A;  1ZQJ A;  3MR2 A;  2W55 A;  2DF4 B;  4MFC A;  1DGJ A;  8ICK A;  5J0S A;  4O5C A;  3TAN A;  5CR0 A;  3PX0 A;  4J9N A;  5KFW A;  1ZQC A;  1UHU A;  1KW4 A;  2A1A A;  4P2H A;  4QZA A;  1JRO A;  2XI9 A;  4F91 B;  2FMP A;  1ARO P;  3PO5 A;  1N61 A;  4YG2 A;  3DEE A;  3V6H A;  4I2D A;  7ICL A;  5JRT A;  1ZQQ A;  5KL8 B;  3EZ5 A;  5J2J A;  2JZB B;  2ZIX A;  4M6W B;  5L1M A;  4RNN A;  4RNM A;  3JPQ A;  2JEI A;  4R8U B;  3OTQ A;  5KNI A;  2V9W A;  1ZQB A;  4MFF A;  4PL2 A;  4UB1 A;  1SIJ A;  3QUT A;  4B9M A;  2F77 X;  5EWG A;  5AKJ A;  9ICG A;  4RPX A;  2R8J A;  2UVR A;  5ALD A;  2RDJ A;  2K89 A;  4QW9 A;  3H8S A;  4K4I A;  1SV0 C;  9ICQ A;  2EZZ A;  3N7S C;  4DSF A;  3RB0 A;  3RJG A;  1N62 A;  3H8W A;  4Z6F A;  2E8P A;  5J0X A;  1D8L A;  4Q45 A;  3KHH A;  2BPC A;  1CUK A;  4UBB A;  5F9N A;  2PKE A;  1XU4 A;  5KFB A;  2OH2 A;  4F8R A;  3AQF A;  2B0C A;  4TUS A;  9ICI A;  4NM2 A;  2KVC A;  2YQE A;  4CF5 A;  3GU3 A;  2UVW A;  4M9J A;  4GC6 A;  3JPS A;  3RB3 A;  1JRP A;  3M6Z A;  5DBC A;  3T3F A;  4I28 A;  2EQY A;  1QQ7 A;  2KSO B;  8ICM A;  2ZTD A;  5J2B A;  1A0P A;  2W04 A;  4US8 A;  4LJX A;  1X9S A;  7ICG A;  4UAW A;  2H3F A;  3BS5 A;  8ICU A;  4M47 A;  1JN3 A;  3BJY A;  7ICK A;  2XCA A;  3KD3 A;  4IR9 A;  2BGW A;  5FP0 A;  2YN4 A;  2PMZ F;  3ISC A;  1N56 A;  4USA A;  5EE9 A;  4C4S A;  1U47 A;  3BQ2 A;  1JXL A;  4FFD A;  4DSJ A;  4QZ9 A;  4DFJ A;  3H4B A;  3CYM A;  4DSI A;  4DS5 A;  4NLZ A;  5KG1 A;  3GIL A;  2KIC A;  3V7L A;  1SZH A;  2VKQ A;  5CWR A;  2ISO A;  1IV8 A;  1L8L A;  1ED1 A;  3MR6 A;  1BNO A;  3UQ0 A;  3C28 A;  1SV4 A;  5G5G A;  5ALO A;  4QWA A;  3JPP A;  2LYB A;  2G08 A;  4Z6D A;  4G9B A;  2BKE A;  8ICN A;  2MRL A;  2R8G A;  2ZIV B;  2ZIU B;  4Y2Y A;  3M9N B;  2W9A A;  4F71 A;  2UVV A;  3FAH A;  4EEN A;  4DL5 A;  3VC8 A;  4J9P A;  4Y2T A;  2EAM A;  4FS2 A;  3O0F A;  1ZQZ A;  5L9X A;  1SWV A;  4JB3 A;  4Y2Q A;  1RQN A;  1ZQG A;  5D49 A;  4DOA A;  4C8M A;  3C29 A;  4TUQ A;  3VCB A;  3GIK A;  1KDH A;  4F2R A;  3Q8R B;  1V97 A;  4KLD A;  3PO4 A;  4QZG A;  2OWO A;  4ED8 A;  1L3V A;  3A0B U;  4F4Z A;  1XNS A;  3N7P D;  2JHD A;  3ISB A;  2JEG A;  1ZQU A;  1L7P A;  1KBU A;  1DXS A;  5KFF A;  8ICA A;  4BUG A;  2HCF A;  5DQG A;  4TUP A;  1PVP A;  3KFU F;  3KOO A;  1TK5 A;  4Z6C A;  3L3F X;  2ZXH A;  2HMX A;  5AKI A;  4DF8 A;  1ZQO A;  4F4W A;  2AH5 A;  3G6Y A;  2VA3 A;  2W3R A;  4AP9 A;  1S9F A;  3QUQ A;  5ALL A;  4OJL A;  4NM1 A;  3BDP A;  3OJU A;  9ICE A;  1RG6 A;  3WK5 A;  5JU5 A;  2GWS A;  1F5S A;  1ZD5 A;  5ALM A;  1ZQS A;  2JEJ A;  4DEZ A;  5DDY A;  2VJ4 A;  2NV3 A;  2O6K A;  5KFK A;  2OHF A;  2ZG6 A;  1SL0 A;  3H4D A;  4ECX A;  3HKZ F;  2WFA A;  4F2S A;  5KFM A;  3PX6 A;  2IOF A;  1F0M A;  4EX6 A;  1ECW A;  4DS4 A;  2RRD A;  4DQI A;  5KT3 A;  4EZ6 A;  5BOM A;  4P4P A;  2XY6 A;  4P0Q B;  1KKX A;  2VIX A;  5EE0 A;  3RR7 A;  3J81 j;  1Z4O A;  3GII A;  4ECV A;  1ZQA A;  4KLL A;  4Y2P A;  1T3Q A;  2DL0 A;  5D46 A;  3OPX A;  4TUR A;  3SQI A;  3RJH A;  1ZRM A;  1BPE A;  5J0O A;  1UCV A;  2K4E A;  2EAO A;  3JPR A;  2FE9 A;  3PSP A;  5DGA A;  1ZJN A;  9ICO A;  1OUQ A;  1JIH A;  4ELT A;  3ONN A;  4FZN A;  4J9M A;  1EXN A;  5HR7 A;  4M2Y A;  4ACO A;  4YD2 A;  5J2A A;  3C2M A;  2D6F C;  2IA6 A;  2KJ5 A;  4RQ0 A;  1XS9 D;  4FBT A;  2EZY A;  4DOB A;  3ETL A;  3SZ2 A;  2LM4 A;  4I2C A;  4WJ3 B;  4RU9 A;  2XID A;  3M7D A;  3SAG A;  1ZQF A;  4KX5 A;  2I6X A;  4JV1 A;  4NLN A;  1L7O A;  7ICR A;  5J2H A;  4R63 A;  1XSP A;  3PZP A;  4Z6E A;  4NXZ A;  2RLT A;  5KFY A;  4F5Q A;  3E2E A;  4RQ2 A;  3TKA A;  1ZQD A;  4MF2 A;  4FO6 A;  5C5J A;  2WB1 C;  1K1S A;  2J6U A;  5ALT A;  3MGV A;  2PFN A;  1X2I A;  4B9T A;  1FEZ A;  3SV3 A;  1HUZ A;  9ICB A;  1RPL A;  3E0F A;  5DB9 A;  1J2M A;  5AKE A;  4I2A A;  5KFC A;  3QNM A;  2WF9 A;  2KHQ A;  2HDO A;  1NZB A;  4KN7 A;  4EYI B;  5F3X B;  5ALG A;  3ED5 A;  1T3N A;  2W7P A;  2XIC A;  3QZ7 A;  1T94 A;  4M9L A;  3F53 A;  3OSP A;  4UW9 A;  1UA0 A;  3GV8 B;  5ALY A;  1KN5 A;  4NLG A;  4ECW A;  1U4B A;  4DO9 A;  2FMQ A;  4KLJ A;  1N63 A;  1UT8 A;  5IIM A;  3H8J A;  1UQV A;  5AIB A;  8ICG A;  2FLL A;  1ZXI A;  4UAZ A;  4B9S A;  8ICL A;  4DL4 A;  4UAY A;  1NK0 A;  5BPC A;  1WG8 A;  1NK4 A;  4F5R A;  1RYU A;  4XRH A;  1QQ6 A;  4IC9 A;  8ICP A;  2E8N A;  3C5F A;  4YXM A;  3KZX A;  2ZIW B;  4OJP A;  4AYB F;  2BR0 A;  3ZDC A;  4DFM A;  3TFS A;  1PZN A;  1YZ6 A;  1SL2 A;  1KFT A;  2ASD A;  3EWA A;  3EPG A;  2WAQ F;  3D2S A;  2JV3 A;  3UMB A;  4IRD A;  4EEK A;  1LB2 B;  4ED2 A;  2NRZ A;  3SMV A;  3PNC A;  5DGB A;  3BS7 A;  2KFN A;  1QTM A;  1URJ A;  2XCP A;  1UPH A;  3EPI A;  1D9D A;  4BGD A;  2W8K A;  2BCR A;  1LV5 A;  2KKP A;  2H3V A;  5KFO A;  2Y0S F;  4F92 B;  4QZC A;  5DBA A;  3BQT A;  5J0R A;  2CXY A;  5ALN A;  4YMM A;  1ZD4 A;  1U49 A;  1MC8 A;  1L7M A;  2PFP A;  1Q3U A;  1PK3 A;  1V9P A;  2F44 A;  3MFH A;  1FIQ A;  4C0Z A;  3WU2 U;  2Z7J A;  1XWL A;  3NVY A;  3UXP A;  9ICL A;  2A3V A;  1Z19 A;  2QLT A;  4DL3 A;  4KMO B;  3T5K A;  5F9L A;  5HP4 A;  4C7Z A;  4KLI A;  4EYH B;  5KFV A;  4MFA A;  5AKX A;  4UAT A;  3DDH A;  3AU2 A;  2YMQ A;  2HBK A;  2KZ3 A;  2P6R A;  2NYV A;  4QZE A;  2WAQ C;  1NK9 A;  5KG4 A;  3AMZ A;  1WUD A;  2JMG A;  2IOH A;  4RQ3 A;  3UPQ A;  7ICH A;  1A76 A;  4OO1 J;  4IL6 U;  3PR4 A;  2ISP A;  2JRZ A;  4JK1 A;  5HMM A;  1QLN A;  4JUZ A;  4C4T A;  7ICQ A;  2B6G A;  3C2L A;  3WK8 A;  2HHW A;  8ICX A;  4O3S A;  1U45 A;  3BQ0 A;  4RZR A;  5CB1 A;  3GV7 B;  5ALW A;  3RTV A;  1NKB A;  2VAN A;  5AI0 A;  5T14 A;  3QXG A;  9ICM A;  1O08 A;  1X40 A;  2A1J A;  1CRX A;  4J9S A;  2PMZ C;  3HP6 A;  3T5L A;  2E1F A;  1TVA A;  4QZI A;  3HWT A;  3ZDB A;  4YMO A;  7ICU A;  4ZOH C;  4ED6 A;  4ECT A;  4UAV A;  2F2A B;  4C8L A;  2W11 A;  2KVS A;  1Z4N A;  4AYB C;  5DB8 A;  4M0A A;  5AKY A;  4RQ8 A;  2NRT A;  4O5E A;  4PZO A;  1BPX A;  2A1J B;  1K5O A;  1SWW A;  2Q4T A;  3CNH A;  3MGH A;  4PHP A;  4RQ7 A;  2ZUD A;  1ZD3 A;  2W43 A;  1NJY A;  3UMG A;  9ICV A;  2LM1 A;  2VA8 A;  2K4P A;  3NVZ A;  3TAP A;  3RH6 A;  2BQ3 A;  4UB6 U;  3KKA A;  3KBB A;  3GDX A;  2FPM A;  3PVX A;  1WCL A;  5AM3 A;  3NUQ A;  5KT6 A;  5IIO A;  1ZYQ A;  3NS1 A;  3NGD A;  4P0P B;  4U6P A;  4KLG A;  3N97 B;  4OJ6 A;  3GV5 B;  4DQS A;  5DG7 A;  3BZK A;  5TZV A;  1L3U A;  3UXN A;  2F1I A;  4F3O A;  4RQM A;  2GOL A;  4J9Q A;  1N5X A;  2L5Y A;  3SV4 A;  1IIP A;  4U7C A;  2HBM A;  4TQS A;  3AUO A;  2I9G A;  5GTH U;  4ED1 A;  2PFQ A;  2HOI A;  4M04 A;  3WKD A;  2FMS A;  2YMM A;  5DG8 A;  4QWB A;  2Y9U A;  4QNL A;  2WF8 A;  1RZT A;  3WKA A;  2QAR B;  1TAU A;  4NJ8 A;  1Q8K A;  1Z00 B;  2ZJA A;  4RUA A;  3K75 D;  1J97 A;  5AI4 A;  1ZQX A;  1RQL A;  1BPD A;  3Q8K A;  5AKH A;  2W54 A;  1DRG A;  4BX9 C;  2XC9 A;  1TK8 A;  5KFX A;  1QSL A; 
#chains in the Genus database with same CATH homology
 1D8Y A;  4P4O A;  2DFL A;  1KRP A;  5J0Q A;  5KFK A;  1NOM A;  3LK9 A;  2P66 A;  4YD1 A;  1IXR A;  3N4M B;  1NK8 A;  1ZQN A;  1SL0 A;  3H4D A;  2IBK A;  4PHD A;  2FPK A;  4R8U A;  4ECX A;  3RRG A;  2PI4 A;  2W9B B;  3PW7 A;  8ICZ A;  4F2S A;  3V7J A;  5KFM A;  2XO7 A;  3PX6 A;  2AJQ A;  8ICJ A;  2P6U A;  3OJS A;  3RAX A;  4ED0 A;  2ZTC A;  4ZH4 A;  5KG7 A;  4IR1 A;  4DS4 A;  4DQI A;  4YMN A;  1ZQI A;  5KFD A;  5KT3 A;  5DB6 A;  4EZ6 A;  4PH5 A;  5KFH A;  5BOM A;  4JV2 A;  9ICJ A;  5KFI A;  4YQW A;  4P4P A;  3C1Y A;  2XY6 A;  3RH5 A;  1SKS A;  1T7P A;  5KFZ A;  2RDI A;  4YR0 A;  2IHM A;  2DPI A;  3RR7 A;  3RJI A;  4ECQ A;  4EBE A;  1C7Y A;  4MEY A;  4C8O A;  4O0I A;  4M9H A;  3G6X A;  4FBU A;  3GII A;  5J0W A;  3PX4 A;  2F1H A;  4O3O A;  2XY7 A;  4ECV A;  1B22 A;  5DBB A;  2V4R A;  1ZQA A;  3V6J A;  4KMU A;  4E0D A;  2J6S A;  4F4K A;  4KLL A;  3EW9 A;  5D46 A;  5JUM A;  4GXK A;  1KFS A;  5CA7 A;  3T5J A;  2AGQ A;  1T8E A;  4DSK A;  4QWE A;  3TQ1 A;  4TUR A;  4IQW A;  2DPJ A;  5DQH A;  1ZQT A;  3RJH A;  4DSL A;  3RR8 A;  5DLG A;  3MR3 A;  1BPE A;  5J0O A;  5J0Y A;  4PGX A;  3M9O B;  3TFR A;  3JPT A;  3JPR A;  5DGA A;  3QEA Z;  1ZJN A;  9ICO A;  2MAX A;  4O3N A;  3KTQ A;  4JWM A;  9ICS A;  4BXO B;  1JIH A;  3UXO A;  5CP2 A;  4ELT A;  3PW0 A;  5EWE A;  4YVZ A;  4J9M A;  4DOC A;  1EXN A;  1U9L A;  3ORY A;  5HHI A;  4ECR A;  1MQ2 A;  4M2Y A;  2HHS A;  4UBC A;  8ICY A;  4RT3 A;  1ZQR A;  2PFO A;  5KT4 A;  4YD2 A;  5J2A A;  8ICB A;  3C2M A;  2WTF A;  1XC9 A;  2IA6 A;  4F93 B;  4UB4 A;  4LZD A;  4RQ0 A;  5J2G A;  1XS9 D;  3HW8 A;  5KG3 A;  5KFL A;  4FBT A;  3ZDE A;  4NY8 A;  2V4Q A;  1TK0 A;  9ICC A;  2W9C A;  4ECS A;  5DQI A;  4DOB A;  3ETL A;  2ZTE A;  3SZ2 A;  4ECZ A;  3NTU A;  3THV A;  4K4H A;  4I2C A;  4RT2 A;  4BXO A;  4RU9 A;  4MF8 A;  5KFS A;  2BCQ A;  1NJZ A;  3GQC A;  1ZQF A;  3HPO A;  3FDS A;  5J29 A;  2HHU A;  3Q8L A;  5EWF A;  3HX0 A;  4JV1 A;  4NLN A;  7ICR A;  4IRC A;  4EEY A;  5J2H A;  4PGY A;  4R63 A;  4I29 A;  2AGO A;  3IM1 A;  1XSP A;  4GXI A;  1SZP A;  2C22 A;  4Z6E A;  2HHT A;  5DKW A;  3LWL A;  2IMW P;  3OHB A;  5CJ7 A;  2JZB A;  4NXZ A;  5L1J A;  4F4Y A;  3PW5 A;  3C21 A;  5KFY A;  4F5Q A;  5DLF A;  1XO1 A;  3E2E A;  4RQ2 A;  4F5P A;  1NKE A;  5HML A;  1L3S A;  4FO6 A;  1ZQD A;  5C5J A;  2BCU A;  1QSS A;  4MF2 A;  1K1S A;  1UA1 A;  4K4G A;  2J6U A;  5EOZ A;  4B9N A;  2PFN A;  4YR2 A;  1S0O A;  1X2I A;  5III A;  4B9T A;  1S0V A;  3PW2 A;  3RBD A;  5KFJ A;  1UT5 A;  5BOL A;  3V7K A;  3SV3 A;  2BQU A;  1RPL A;  1HUZ A;  1ZQH A;  4M6W A;  4UB3 A;  9ICB A;  3TI0 A;  2Y1I A;  1ZQM A;  1SKW A;  1H38 A;  5D4B A;  5DB9 A;  1XSL A;  5KFT A;  5HHH A;  4R64 A;  3ISD A;  4DQQ A;  2C28 A;  4I2A A;  9ICU A;  3BQ1 A;  3KHL A;  4RNO A;  3UQ2 A;  5KFC A;  4FS1 A;  1JMS A;  2ZUC A;  4KLF A;  4Q8F A;  2ZJ8 A;  1ZQV A;  4DL7 A;  3Q8M A;  3MFI A;  1COO A;  4KN7 A;  4EYI B;  1X9M A;  2PI5 A;  1HJP A;  4DL2 A;  1A77 A;  3ZDA A;  3MR5 A;  1T3N A;  2NRX A;  1ZQY A;  5IIJ A;  3TAR A;  4YFK A;  4JV0 A;  3QZ7 A;  3V6K A;  8ICI A;  4YN4 A;  5L1I A;  2AGP A;  4QZH A;  4M9L A;  2FLP A;  4Q8E A;  3OSP A;  1QSY A;  2ASL A;  1CEZ A;  5KT2 A;  2FPL A;  3T5H A;  1ZQK A;  1UA0 A;  2MUT B;  4YCX A;  3GV8 B;  4NLG A;  3G6V A;  3C1Z A;  7ICN A;  4ECW A;  1U4B A;  4R65 A;  4DO9 A;  1ZET A;  2FMQ A;  1Z3E B;  4KLJ A;  1UT8 A;  3IHQ B;  4RQ4 A;  2FLN A;  5IIM A;  3H8J A;  3OGU A;  8ICG A;  2R8H A;  1ZQJ A;  3PMN A;  2FLL A;  3MR2 A;  1BGX T;  9ICR A;  4MFC A;  4DQP A;  4UAZ A;  3KHG A;  4B9L A;  4B9S A;  8ICL A;  3OSN A;  2AU0 A;  8ICK A;  4DL4 A;  2W9M A;  5J0S A;  2LYH A;  3PY8 A;  4UAY A;  4I2B A;  4O5C A;  1NK0 A;  3TAN A;  5KFE A;  5BPC A;  4PHE A;  8ICQ A;  3HT3 A;  1NK4 A;  5KT5 A;  4F5R A;  7ICO A;  5KG6 A;  5CR0 A;  4DLG A;  3PX0 A;  3JPO A;  4ED3 A;  2ATL A;  4XRH A;  4J9N A;  3H40 A;  5KFW A;  8ICP A;  1ZQC A;  3RB4 A;  2M9N A;  4YR3 A;  4ECU A;  1KLN A;  3C5F A;  4P2H A;  4QZA A;  1KTQ A;  4YXM A;  1DGS A;  2BR0 A;  4Q43 A;  2XY5 A;  4F91 B;  2FMP A;  1ARO P;  3ZDC A;  3PO5 A;  7ICI A;  4DFM A;  4YG2 A;  2Y1J A;  4I2E A;  3TFS A;  3V6H A;  1PZN A;  4I2D A;  7ICL A;  4YP3 A;  1SL2 A;  5DDM A;  1KFT A;  1ZQQ A;  2ASD A;  4QZF A;  1D9F A;  2B21 A;  3EZ5 A;  5J2J A;  2JZB B;  3EWA A;  4M6W B;  1IM4 A;  4RNN A;  3EPG A;  4ELV A;  4RNM A;  5KFR A;  4O3Q A;  4IQT A;  1X9W A;  4I2J A;  1BPY A;  3JPQ A;  2JEI A;  5KFN A;  5KTQ A;  4R8U B;  1S97 A;  2KZM A;  5KT7 A;  4IRD A;  3H7I A;  1LB2 B;  1ZQB A;  2V9W A;  4MFF A;  4ED2 A;  4KLT A;  4O3P A;  4RQ1 A;  4UB1 A;  4F5N A;  2NRZ A;  3PNC A;  3C23 A;  5DGB A;  4QZD A;  4B9M A;  4O9M A;  2KFN A;  9ICF A;  5EWG A;  1QTM A;  9ICG A;  5KG5 A;  4RPX A;  2KN7 A;  2R8J A;  1S77 D;  2XCP A;  1KSP A;  3EPI A;  2XGP A;  4BGD A;  2W8K A;  2BCR A;  1LV5 A;  1D9D A;  3GFK B;  2UVR A;  8ICC A;  3C5G A;  2RDJ A;  3AU6 A;  5KFO A;  4F92 B;  4QZC A;  3MDC A;  5DBA A;  3BQT A;  5J0R A;  4QW9 A;  7ICP A;  3H8S A;  4K4I A;  9ICH A;  9ICQ A;  4O3R A;  5J0T A;  2BHN A;  1Z00 A;  4YMM A;  4JWN A;  1U49 A;  1MC8 A;  1ZQP A;  4KLS A;  4GLX A;  1HUO A;  2PFP A;  2IHN A;  1V9P A;  3MFH A;  4DSF A;  3RB0 A;  3RJG A;  4C8K A;  3PW4 A;  2VA2 A;  3H8W A;  1NKC A;  4Z6F A;  4XA5 A;  3RH4 A;  4J9R A;  1XWL A;  1T4G A;  5J2I A;  5J0X A;  3UXP A;  7ICT A;  1D8L A;  4P4M A;  4O5K A;  4Q45 A;  3KHH A;  9ICX A;  2BPC A;  1S76 D;  1CUK A;  9ICP A;  4UBB A;  4XQ8 A;  5F9N A;  9ICL A;  1XU4 A;  5KFB A;  2BQR A;  4F8R A;  9ICA A;  4ECY A;  4QW8 A;  3RJJ A;  4RPY A;  3RJK A;  2C2E A;  3ZDD A;  4TUS A;  9ICI A;  4DL3 A;  4NM2 A;  3T5K A;  4DFP A;  5F9L A;  5HP4 A;  4KLI A;  4EYH B;  2UVW A;  4M9J A;  4GC6 A;  5IIN A;  5KFV A;  4MFA A;  3JPS A;  3RB3 A;  3EYZ A;  1SKR A;  4I2G A;  4NLK A;  3MBY A;  5DBC A;  3T3F A;  1XSN A;  3AU2 A;  4B9U A;  2P6R A;  2KZ3 A;  3JPN A;  4I28 A;  3RB6 A;  4KLH A;  1KFD A;  4QZE A;  2PXI A;  1RXV A;  1NK9 A;  5KG4 A;  1RYR A;  4CCH A;  3MAB A;  4RQ3 A;  2ZTD A;  3UPQ A;  8ICM A;  7ICH A;  1A76 A;  2BCS A;  5J2B A;  3MDA A;  1ZQE A;  3PR4 A;  2ISP A;  2BCV A;  4JK1 A;  1X9S A;  7ICG A;  4UAW A;  5HMM A;  1QLN A;  2BPF A;  3Q8P B;  4I2H A;  4JUZ A;  5J2K A;  4J9K A;  4M47 A;  8ICU A;  7ICQ A;  5DB7 A;  3C2K A;  3C2L A;  2UVU A;  2I1Q A;  2HHW A;  8ICX A;  1JN3 A;  8ICH A;  4O3S A;  1BPZ A;  3BJY A;  9ICK A;  7ICM A;  7ICK A;  4DQR A;  2XCA A;  2NRV A;  4YXJ A;  4IR9 A;  1U45 A;  2BGW A;  1TV9 A;  3LDA A;  4F4X A;  1BPB A;  3BQ0 A;  2W8L A;  4RZR A;  2BPG A;  3K4G A;  5CB1 A;  4RPZ A;  3ISC A;  1ZJM A;  4PGQ A;  3GV7 B;  2C2D A;  1N56 A;  3PML A;  5KFA A;  3RTV A;  4B9V A;  8ICF A;  1NKB A;  4HYK A;  4TQR A;  1U47 A;  2VAN A;  1JXE A;  3BQ2 A;  4DSE A;  5KFQ A;  1JXL A;  5IIK A;  4DL6 A;  3RAQ A;  4I27 A;  2HVH A;  4IRK A;  4DSJ A;  4QZ9 A;  4DFJ A;  9ICM A;  3H4B A;  2A1J A;  2KZZ A;  4DSI A;  4DS5 A;  4J9S A;  4KLO A;  2HW3 A;  2HHX A;  4NLZ A;  2KTQ A;  5CHG A;  5L1K A;  4M9G A;  5KG1 A;  3GIL A;  3V7L A;  2BDP A;  4KN4 A;  5DG9 A;  3HP6 A;  4GC7 A;  3T5L A;  3SYZ A;  1TVA A;  4QZI A;  4KLM A;  5CWR A;  3HWT A;  2ISO A;  3ZDB A;  3B0Y A;  4QZB A;  4YMO A;  4DFK A;  7ICU A;  2HVI A;  1TAQ A;  5HNK A;  1NJX A;  5J0U A;  3MR6 A;  4ED6 A;  4ED7 A;  1BVS A;  4ECT A;  3RJE A;  3UQ0 A;  4C8L A;  1B43 A;  4RQ5 A;  1NK6 A;  4PHA A;  2ASJ A;  4QWA A;  2KFZ A;  5DB8 A;  4M0A A;  2XGQ A;  1TKD A;  5KG2 A;  4RQ6 A;  3JPP A;  4RQ8 A;  1KEJ A;  4LVS A;  2R8K A;  2NRT A;  4Z6D A;  2NRW A;  4O5E A;  2BKE A;  3RBE A;  1MSW D;  8ICN A;  3V72 A;  3SI8 A;  1BPX A;  1Y88 A;  2R8G A;  2Q0Z X;  2A1J B;  7ICJ A;  4LZG A;  3TAQ A;  4QWC A;  5IIL A;  9ICT A;  3GIJ A;  1SL1 A;  3MGH A;  7ICV A;  2AQ0 A;  4PHP A;  1S0M A;  3M9N B;  2W9A A;  4RQ7 A;  2UVV A;  2ZUD A;  4EBD A;  1DOQ A;  4XUS A;  4DL5 A;  1NJY A;  4C8N A;  1WCN A;  4J9P A;  4RUC A;  1JX4 A;  3M8R A;  4KLU A;  8ICS A;  5J2F A;  9ICV A;  4DLE A;  9ICN A;  2VA8 A;  4X5V A;  3RJF A;  3KHR A;  4QWD A;  4FS2 A;  4KLQ A;  9ICW A;  4BWM A;  1TFR A;  1ZQW A;  3TAP A;  4MEX A;  4G3I A;  3RH6 A;  4J9O A;  4J9L A;  2BQ3 A;  4DWI A;  5J0P A;  1S10 A;  3RRH A;  1K1Q A;  1ZQZ A;  5J2D A;  4KTQ A;  5L9X A;  1ZQL A;  3GDX A;  7ICE A;  2FPM A;  4DF4 A;  4PPX A;  3PVX A;  1ZQG A;  5D49 A;  2ZJ5 A;  1WCL A;  1NK5 A;  4F5O A;  4DOA A;  3QEB Z;  5KT6 A;  4C8M A;  2W9B A;  5IIO A;  4UB5 A;  1U48 A;  2HHQ A;  4TUQ A;  2W9C B;  1ZYQ A;  3GIK A;  1KDH A;  3NGD A;  4EBC A;  4KLG A;  3N97 B;  2H5X A;  3GV5 B;  2JEF A;  7ICF A;  4Q44 A;  3ZD9 A;  5L1L A;  4DQS A;  5DG7 A;  1RXW A;  5TZV A;  2F1J A;  1L3U A;  4F2R A;  3UXN A;  3Q8R B;  4IQU A;  3Q8Q B;  2F1I A;  4KLD A;  3PO4 A;  4QZG A;  4F3O A;  2OWO A;  4ED8 A;  1L3V A;  4F4Z A;  4J9Q A;  1RYS A;  5KG0 A;  3SV4 A;  4KIT B;  1MQ3 A;  2HHV A;  3ISB A;  3PR5 B;  2R8I A;  2JEG A;  4IQV A;  1ZQU A;  4TQS A;  2J6T A;  4BWJ A;  2ZUB A;  3AUO A;  3OHA A;  2I9G A;  4ED1 A;  2PFQ A;  4GXJ A;  4M04 A;  4UB2 A;  8ICE A;  5KFP A;  5KFF A;  2FMS A;  2AQ4 A;  5DG8 A;  4KLE A;  3MGI A;  5J2E A;  4I2F A;  8ICA A;  4M9N A;  1NK7 A;  8ICW A;  4QWB A;  5DQG A;  1NJW A;  2C2R A;  4TUP A;  8ICO A;  1RZT A;  3GIM A;  1TK5 A;  4Z6C A;  3QZ8 A;  1S0N A;  5KFG A;  8ICT A;  3Q8S B;  7ICS A;  4BDP A;  4F50 A;  3M9M B;  4DF8 A;  4I2I A;  1L3T A;  1ZQO A;  4F4W A;  2ALZ A;  4EZ9 A;  1N48 A;  1TAU A;  3G6Y A;  1L5U A;  1Z00 B;  3M8S A;  2VA3 A;  5J2C A;  1S9F A;  2ZJA A;  4RUA A;  4R66 A;  3K75 D;  4UQG A;  4ELU A;  1ZQX A;  4NM1 A;  3ZD8 A;  8ICV A;  4QZ8 A;  1BPD A;  3OJU A;  3BDP A;  3QE9 Y;  9ICE A;  3Q8K A;  3B0X A;  2XC9 A;  8ICR A;  2GWS A;  1TK8 A;  1ZQS A;  2MUT A;  3LWM A;  5KFX A;  2JEJ A;  3PV8 A;  3FYH A;  4DEZ A;  5KFU A;  5DDY A;  1QSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...