2M9NA

Solution structure of (hhh)2 domain of human faap24
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2m9nA00
1JN3A 1RPLA 5J0PA 3ORYA 4YN4A 1XO1A 2IHNA 5DB9A 2W9CA 8ICAA 1NK7A 1ZJMA 4M6WB 4QZIA 4KLDA 7ICJA 1BPEA 3PR4A 1X9SA 1D9DA 1U47A 1IXRA 4F93B 4B9UA 4FBUA 2KTQA 4PHEA 1ZQGA 2Q0ZX 3RH6A 1QSSA 1KLNA 2VA2A 3PMNA 3QE9Y 4K4GA 5TZVA 9ICQA 3OJUA 4PGXA 2F1HA 5J2CA 4C8NA 5J0XA 3TFRA 1KDHA 1ZQDA 2IA6A 2HW3A 5KG2A 4ED1A 5DQIA 4XUSA 5J2IA 1ZQHA 2BCVA 3ZDCA 8ICGA 8ICZA 4RQ4A 5KFWA 1C7YA 4ED2A 1MQ3A 4MFFA 4Q8FA 1BPZA 4UAYA 3H4BA 3EPIA 3BQ0A 4F4KA 4UQGA 2KZ3A 1UT8A 4YR2A 1BPBA 5EOZA 2JZBB 4F4ZA 3V6KA 4M9JA 4Z6CA 4O3RA 4B9LA 3C23A 3V7JA 4DQRA 4RU9A 4QWDA 4RUAA 3HWTA 1TV9A 4B9SA 8ICBA 1BPXA 3ISCA 4GC6A 9ICAA 2JEIA 2HHQA 4KLQA 5CA7A 1K1QA 3PNCA 3ZDEA 3GILA 5J2HA 4P4OA 4DEZA 4UB4A 1ZQVA 4O3OA 5KFSA 4RZRA 2FPLA 5F9LA 2I9GA 1L5UA 5DB8A 4YCXA 1H38A 3ZD8A 1QSYA 4DL6A 4G3IA 9ICJA 2ZTEA 4DWIA 4I27A 2MAXA 4J9PA 4O3NA 1X2IA 3GV7B 4O5EA 2I1QA 4QWEA 1L3SA 4DF4A 9ICVA 4M47A 4YMMA 4IRCA 1Z00A 2BGWA 2DPIA 9ICIA 3KHGA 4JUZA 4IQVA 1HJPA 4C8LA 4B9VA 3OSNA 3RH4A 4I2BA 2NRZA 3UXOA 4DOBA 4DSEA 7ICEA 2C2EA 4I29A 4ECZA 4FO6A 4KLFA 3PW5A 1T8EA 3AU2A 2BQ3A 1AROP 4FBTA 5KT2A 4EBCA 3V72A 1JXEA 4M9GA 4UAZA 2XC9A 4PHAA 4F5PA 1TK8A 1DGSA 4NXZA 1ZQFA 1NK8A 3TANA 9ICCA 1NKBA 1D9FA 5DQGA 4J9MA 3FYHA 4J9NA 7ICGA 7ICQA 2W9BA 3EZ5A 2M9NA 7ICLA 4DL3A 3KHRA 2H5XA 2HHTA 4KLJA 5J0UA 5BOLA 3Q8PB 7ICOA 4DOCA 9ICRA 3Q8MA 4M2YA 1XU4A 9ICBA 7ICTA 4QZCA 1NJWA 4ECTA 1KRPA 4QZGA 5KT7A 3MR2A 3MDCA 4MEXA 4F8RA 3NTUA 2PFPA 2PFQA 4IRDA 3MR6A 1T4GA 5CWRA 1KFDA 4F50A 3ZDAA 8ICNA 8ICTA 4YP3A 1QSLA 2F1IA 4LVSA 9ICXA 4I2JA 4RQ2A 2W9BB 4PPXA 9ICPA 2B21A 1COOA 5KT4A 1HUOA 3JPNA 1QLNA 4DL4A 4YXMA 2AQ4A 5EWEA 4ED7A 4Q43A 3JPSA 3MBYA 3GDXA 8ICMA 4M0AA 3RB6A 5DBBA 4I2EA 4DFPA 1L3UA 3JPPA 3KHHA 4ECVA 3RRGA 8ICRA 3ZDDA 4YR3A 3G6YA 3LDAA 5C5JA 5KG5A 2ASLA 4ECQA 3C1ZA 4Z6EA 3C2MA 2ZUCA 4Q44A 4X5VA 5CJ7A 2BCUA 4QZAA 4EZ6A 5KFGA 9ICSA 2XGPA 1JIHA 4K4IA 2BR0A 2UVWA 2VA3A 4MF2A 8ICIA 7ICNA 2F1JA 4TUQA 3T5LA 2FLLA 3H8WA 2BPCA 1TKDA 3SV4A 4JV1A 4UBBA 2C2DA 3EYZA 5J2KA 2XY7A 4UB1A 5KG0A 4DQQA 4O3SA 8ICPA 1A76A 3RTVA 1ZQOA 1ZQQA 1T3NA 4QZFA 3H4DA 4ELVA 5KT5A 3THVA 7ICFA 4F92B 4R66A 4FS1A 3T5KA 2ASJA 4RQ1A 8ICXA 3QZ8A 2J6UA 4LZGA 3UPQA 3RR8A 8ICFA 3EPGA 4YR0A 1RYSA 3MFHA 3PY8A 4KLEA 5KG4A 3Q8QB 2P6RA 1MSWD 1KFSA 5KT6A 5J0RA 3SV3A 5KFCA 3V6HA 2UVUA 2FLPA 1ZQIA 4I28A 3UQ0A 2W9AA 4O5KA 3PX6A 3PW7A 1BPYA 1S76D 5IIJA 4P2HA 4E0DA 2HHVA 2A1JA 4RNNA 4LZDA 2W9CB 1KTQA 5J2EA 1XSPA 3MGHA 9ICTA 5EWFA 4RT3A 3GIKA 4DL5A 5DLGA 2AGQA 4KTQA 4DOAA 4M04A 8ICEA 8ICYA 4ECUA 4R65A 4CCHA 4RNOA 5DBAA 3GIJA 3PW0A 5HMLA 2XCPA 4QZHA 1ZQNA 4GXJA 3Q8KA 2ZUDA 1XC9A 4ECRA 4YQWA 5DB6A 3M8SA 1ZQBA 4I2AA 2ZJAA 3C21A 4NLNA 2ZTDA 7ICSA 2HHUA 3RB4A 5J2GA 3TI0A 4O9MA 4PHDA 4R63A 4KLTA 1NJYA 1U49A 3OSPA 1S77D 2HHWA 2FPMA 5J2BA 5CB1A 5BOMA 4TQRA 3TQ1A 1S0MA 4EYIB 2R8JA 3MGIA 3ZDBA 5L1LA 3OGUA 2R8HA 4ED6A 5DG9A 4KLUA 4KLHA 1NK9A 1ZJNA 4C8KA 1Y88A 4P4PA 1NKCA 2NRWA 3K75D 4EBEA 4DF8A 8ICKA 4EYHB 3JPRA 1U48A 4F5NA 4KN7A 3RJIA 3M9NB 5L9XA 4ELTA 1RZTA 4I2CA 4ED0A 4RNMA 4ED3A 5DGBA 5J0QA 3MFIA 9ICUA 3LWMA 1ZQXA 5J2FA 4DSJA 8ICLA 1ZETA 2VA8A 3GFKB 5JUMA 1NKEA 5J29A 1CUKA 4TUSA 5HP4A 4B9TA 5CR0A 4NLKA 4KLMA 2XO7A 3RB3A 1A77A 5KFLA 2AJQA 3MDAA 4RQ6A 1NK4A 4IR9A 1RXWA 2ZJ5A 3Q8RB 4YMOA 4DS4A 8ICWA 1TFRA 4FS2A 4DQPA 4J9LA 2BCSA 3H40A 1Z00B 5KG7A 5J2DA 4B9MA 3SZ2A 8ICJA 5L1JA 2ZTCA 4GXKA 1S9FA 1BPDA 4RPYA 4J9SA 2HVIA 4R8UA 1ZYQA 4M9HA 5DQHA 3HW8A 3ISDA 2BCQA 4UB3A 3PO5A 3T5HA 2IHMA 4ELUA 9ICEA 5KFVA 2R8KA 9ICLA 4TUPA 2ISOA 2JEGA 1ZQRA 1IM4A 1NJXA 4F4XA 2FMSA 4KLOA 5J0OA 2Y1JA 1X9WA 2IMWP 2ZJ8A 1Z3EB 5KFOA 4J9QA 5KFFA 3AU6A 4DQIA 4DSIA 3E2EA 4B9NA 4QZ9A 4XA5A 4M9NA 2JEFA 4J9RA 4NM2A 2ZUBA 5KFKA 4F3OA 4P4MA 4F4WA 1B22A 1N56A 4QWAA 4UBCA 4QWCA 3KHLA 2AU0A 4I2GA 4YXJA 4F4YA 1ZQLA 5CP2A 3TAPA 3AUOA 2RDJA 4NLGA 3EW9A 4F5OA 4I2HA 3UXPA 2V9WA 5L1KA 4I2IA 4IQUA 5KFPA 5KFDA 5KT3A 1ZQMA 3GV5B 3RAXA 1NK5A 2VANA 2P66A 4JV0A 9ICFA 3PX4A 1ZQYA 3RBDA 4YMNA 3OJSA 2W9MA 3C5FA 4DFJA 3H8JA 3QZ7A 3GIIA 3T5JA 2ATLA 4RPXA 4DFKA 1XS9D 4TQSA 4UAWA 4R64A 3B0YA 3LWLA 5IIOA 5J0YA 2BKEA 1HUZA 2Y1IA 7ICVA 2HVHA 3JPOA 5IIIA 1WCLA 2MUTA 3HP6A 2KZZA 2KZMA 4J9OA 3H8SA 5DG7A 2GWSA 4M6WA 8ICUA 1D8YA 1L3VA 1SKRA 1BVSA 4F2RA 3HX0A 1NJZA 4C8OA 5J2AA 3NGDA 7ICMA 4BWJA 3K4GA 4RQ5A 4HYKA 5J0WA 5KFEA 1ZQCA 1WCNA 1ZQEA 4QWBA 1TAQA 5HHIA 3RBEA 3Q8LA 4ZH4A 4O5CA 3RJEA 4YG2A 4BXOA 1TAUA 7ICRA 5KFZA 3PV8A 2R8GA 5DLFA 4RQ0A 4DS5A 1S0OA 5KG3A 1TVAA 4ECWA 2C2RA 7ICPA 3MABA 3PVXA 4MFCA 5EWGA 2PFNA 5D4BA 3BJYA 4YVZA 2MUTB 2V4QA 3RRHA 1X9MA 3PO4A 4ECYA 4F2SA 4JWMA 2BHNA 3M9MB 4F5RA 4NLZA 4PGYA 4M9LA 2JZBA 4BWMA 5DBCA 2FMQA 2BPGA 5DGAA 1B43A 3G6VA 1V9PA 7ICHA 8ICSA 9ICKA 5KFXA 5F9NA 3C2LA 2V4RA 4K4HA 3RH5A 4YFKA 3BDPA 4MF8A 4QW9A 3OHAA 4DL2A 1XSLA 3PW2A 5HNKA 3RR7A 2J6TA 4BXOB 1S97A 3IM1A 5CHGA 8ICOA 9ICWA 1DOQA 1D8LA 1NOMA 2NRVA 3B0XA 5KFTA 5KFMA 4UB2A 3PX0A 1N48A 1ZQJA 7ICIA 3TAQA 3RJGA 3V7KA 3TARA 2HHXA 5KFIA 2HHSA 2A1JB 4I2DA 1T7PA 2KN7A 3SYZA 9ICNA 1ZQWA 4QZEA 2DFLA 4IQTA 4KN4A 3C1YA 4JK1A 4PGQA 4DLEA 1UA1A 1U45A 4RPZA 3UQ2A 5IIMA 9ICOA 2ALZA 1KSPA 2C28A 2FMPA 4O3PA 2XY5A 3BQ1A 4KMUA 4KITB 3Q8SB 4QZBA 2ASDA 5J0TA 3LK9A 2BDPA 1ZQPA 4RQ3A 1S10A 1ZQSA 8ICHA 4I2FA 4IR1A 5J0SA 5KFRA 2AQ0A 2W8LA 1SL1A 3TFSA 1U9LA 1ZQKA 1SL2A 1BGXT 1QTMA 1LV5A 3BQTA 1ZQTA 5BPCA 1ZQAA 1JMSA 4EZ9A 1JXLA 7ICKA 5D49A 9ICMA 5KTQA 4XQ8A 3EWAA 4F91B 4C8MA 2P6UA 3RJHA 8ICVA 3V6JA 4EEYA 4ECSA 3ETLA 4Z6FA 1MC8A 2PI5A 4PH5A 3M9OB 1LB2B 4F5QA 7ICUA 5KG1A 1TK0A 8ICQA 1SKSA 4Q8EA 2R8IA 3RJKA 2NRXA 2AGPA 4RT2A 3N4MB 3ZD9A 4MEYA 2UVVA 1SKWA 2ISPA 3M8RA 5J2JA 3RJJA 4DSLA 3RAQA 3MR3A 2XY6A 3C5GA 3H7IA 4IQWA 5IIKA 4IRKA 1SZPA 2LYHA 3GV8B 3FDSA 4DO9A 5KFBA 4O0IA 3JPTA 1RXVA 3IHQB 5KFUA 5KG6A 4ED8A 3HPOA 3GIMA 1TK5A 4GC7A 3V7LA 2RDIA 1RYRA 1UA0A 3BQ2A 4MFAA 1U4BA 5L1IA 3T3FA 1KFTA 5KFAA 4QZDA 4R8UB 4QW8A 1NK6A 4JWNA 3RJFA 2XCAA 4ECXA 1PZNA 4XRHA 5DB7A 4RQ8A 3PW4A 5DG8A 1MQ2A 4RQ7A 3C2KA 5HMMA 5KFNA 4RUCA 2XGQA 2KFNA 1XWLA 2FPKA 2PXIA 5IILA 2C22A 3UXNA 5IINA 2JEJA 4J9KA 4GLXA 3HT3A 4DQSA 3SI8A 4KLIA 4KLSA 1ZQZA 4GXIA 4YD1A 4JV2A 5HHHA 1L3TA 1UT5A 1KEJA 5D46A 2IBKA 1JX4A 5KFJA 3ISBA 4QZ8A 4TURA 1XSNA 2UVRA 9ICHA 2BQUA 9ICGA 1NK0A 3G6XA 3N97B 3QEBZ 2AGOA 1S0NA 4PHPA 4NM1A 2OWOA 2FLNA 2PFOA 5DDMA 2WTFA 2PI4A 1EXNA 3MR5A 4DFMA 1ZQUA 4Q45A 2BQRA 5KFHA 1SL0A 1S0VA 4UB5A 3PR5B 5KFYA 3PMLA 2DPJA 3OHBA 4BDPA 8ICCA 4BGDA 1CEZA 2KFZA 4DL7A 4KLGA 1K1SA 4O3QA 2BPFA 2BCRA 2J6SA 2NRTA 2W8KA 3RB0A 3GQCA 3QEAZ 3KTQA 4DSKA 4EBDA 5KFQA 5DDYA 5DKWA 4DLGA 4DSFA 4NY8A 3JPQA 4KLLA 4YD2A 4Z6DA
chains in the Genus database with same CATH superfamily
1JN3A 2W7PA 2IHNA 3SENA 8ICAA 1NK7A 4KLDA 2G06A 5AI8A 4F93B 5ALDA 5KAIU 4PHEA 2Q0ZX 3D2SA 3U26A 3QE9Y 3DEEA 2HW3A 5J0XA 1ZQDA 4ED1A 3KOOA 5J2IA 8ICZA 3UMBA 1QCKA 3ZDCA 1WYGA 3IG5A 1UT8A 4YR2A 1BPBA 4M9JA 2JZBB 4QWDA 4RUAA 1BPXA 3ISCA 9ICAA 2EZXA 2YMMA 3ZDEA 5J2HA 3M7DA 2NO4A 2OXOA 3QNMA 5AK4A 1UPHA 1L5UA 2I9GA 1H38A 2IOFK 3H0MB 3AQEA 4G3IA 4I27A 2W7OA 3OPXA 1X2IA 4QIWF 3GV7B 2I1QA 9ICIA 4JUZA 4U6PA 3IRUA 3UXOA 1N5WA 4DOBA 7ICEA 4FO6A 5AM0A 3AU2A 2HCFA 3V72A 1JXEA 2K4EA 4NXZA 2PMZC 2MSNA 3PSIA 5DQGA 7ICQA 2W9BA 3KHRA 2H5XA 1WG8A 5J0UA 1F5SA 1O03A 4M2YA 1XU4A 7ICTA 1KRPA 2RQ5A 5KT7A 3MR2A 3D6JA 1N62A 5AIAA 2PFQA 2E5SA 4F50A 5EE1A 5ALEA 4YP3A 4LVSA 4PPXA 2KVCA 1HUOA 3AQFA 3MBYA 8ICMA 1L3UA 1DRGA 3JPPA 3KHHA 2WAQC 3LDAA 2ASLA 4ECQA 4BUGA 4EZ6A 3CNHA 4U7CA 2VA3A 1JROA 2BPCA 1JUDA 5AI5A 4JV1A 5ALZA 1C20A 2XY7A 4UB1A 4O3SA 4QZFA 4ELVA 5KT5A 3THVA 1HEKA 5ALGA 2J6UA 2VJ5A 8ICFA 3EPGA 1OW5A 5J0RA 3SV3A 2UVUA 1J2NA 4O5KA 5IIJA 5GTHU 2DF4B 2W9CB 2MA1A 1KTQA 5J2EA 3MGHA 4EX7A 4RT3A 4KTQA 4DOAA 8ICEA 8ICYA 4ECUA 2LI6A 3GIJA 3PW0A 5HMLA 2XCPA 2F2AB 4GXJA 4ECRA 4YQWA 5DB6A 4NLNA 3RB4A 4O9MA 4R63A 5BOMA 3TQ1A 1S0MA 1Q3VA 5JRTA 3SAGA 2R8HA 4ED6A 4KLUA 1Y88A 2KHQA 4EBEA 3JPRA 1J97A 2W04A 3IDWA 2E8NA 4ELTA 4ED3A 4JB3A 2PMZF 1ZETA 4UASA 4G9BA 2QB0A 3RB3A 5KFLA 2R18A 2ZJ5A 2OH2A 2QARB 2G5IB 1Z00B 5KG7A 3H40A 3SZ2A 8ICJA 4CGZA 2ZTCA 4GXKA 1S9FA 5JTIA 2HOQA 4J9SA 4RQMA 4M9HA 2BCQA 1RM6C 4CF5A 2R8KA 5ALMA 2FMSA 1OUQA 5ALQA 1SB3C 4B9NA 4XA5A 1V97A 5KFKA 4F3OA 4C4TA 1N56A 4QWCA 4I2GA 4DCCA 3KHLA 3LVWA 3AUOA 2IOHA 4F5OA 1V38A 5L1KA 5KFDA 2VANA 2FJ6A 2P66A 4JV0A 4Y2QA 1T3QA 2P35A 4DFJA 3AEVA 4RPXA 4DFKA 4UAWA 7ICVA 2HVHA 3KZXA 3HP6A 4J9OA 3H8SA 8ICUA 4F2RA 5AIBA 5J2AA 4BWJA 5ALWA 3PSPA 1ZQEA 5T14A 4QWBA 1TAQA 4ZH4A 2KKPA 5AM4A 1TAUA 3PV8A 2R8GA 4DS5A 5KG3A 3MABA 1XO0A 2OHFA 2MUTB 3FM9A 3PO4A 4ECYA 4F5RA 4M9LA 5DGAA 2HBLA 5EE3A 3QUTA 3C28A 9ICWA 2RRDA 2H3QA 4UB2A 1N48A 1ZQJA 3TAQA 3RJGA 3PSTA 2D8CA 1L7MA 1ZQWA 1N5XA 1U45A 4IQTA 4KN4A 4JK1A 2EZZA 2CXYA 5ALYA 4O3PA 2XY5A 3BQ1A 4KMUA 3Q8SB 4P0PB 2CRXA 3LK9A 1ZQPA 3AMZA 2YN4A 1URJA 8ICHA 4I2FA 5J0SA 4PZOA 1RYUA 1SL1A 3TFSA 1BGXT 2KD1A 4KMOB 1JMSA 4EZ9A 1JXLA 7ICKA 9ICMA 2XI9A 5KTQA 3EWAA 4F91B 3HKZC 4EEYA 2PI5A 3M9OB 1TK0A 8ICQA 4BJQA 1SKSA 1JI7A 4US9A 4EEKA 2R8IA 2NRXA 4RT2A 3ZD9A 4MEYA 3WK7A 2KOBA 5HR6A 4UB8U 5IIKA 1RXVA 1RDFA 5KFUA 2I6XA 2KSOB 3HPOA 5ALJA 1TK5A 2RDIA 4MFAA 2W03A 5KAFU 1CRXA 3QX7A 3VC8A 5KFAA 4ECXA 1PZNA 5KFNA 4RUCA 2ZIUA 1XWLA 5IINA 4J9KA 3SI8A 2K4IA 3WK4A 5HHHA 1KEJA 2E3TA 1JX4A 4QZ8A 4TURA 9ICHA 1NK0A 5ALOA 3G6XA 2OWOA 2WTFA 2PI4A 1EXNA 1ZXIA 2OYYA 4Q45A 5KFHA 1PK1B 1LVHA 2K89A 3ICXA 2LYBA 1P7DA 3OHBA 2AH5A 2RHFA 3NS1A 2NRTA 3KTQA 4DSKA 4EBDA 5DDYA 4DLGA 4DSFA 4KLLA 4Z6DA 1SWWA 3ETRA 1XO1A 1HIWA 3F5EA 4M6WB 4QZIA 2G5HB 7ICJA 2KIVA 1BPEA 3PR4A 3QUCA 4B9UA 3D2NA 1NNLA 2OEHA 4EENA 9ICQA 3OJUA 2F1HA 5J2CA 1FFUA 3KFUF 1LKYA 2JMGA 4XUSA 2BCVA 5AKYA 1NI3A 3SEIA 4RQ4A 5KFWA 4ED2A 4F4KA 4UQGA 4BX9C 3AN1A 3NVVA 2MU2A 4KX3A 3C23A 4UAVA 3CYMA 1KBUA 2HHQA 4CDGA 3RF9A 4KLQA 3KBBA 4P4OA 4DEZA 4UB4A 4USAA 3SR6A 4RZRA 3LYSA 4PL2A 3HKZF 4DL6A 1ZRMA 1ZD4A 2MAXA 4J9PA 4O3NA 4O5EA 1Z4NA 2NV3A 2XVTA 4YMMA 2BGWA 4NL9C 4DFDA 1HJPA 3OSNA 3RH4A 4I2BA 2F76X 2EZYA 4ECZA 1S5LU 5AI6A 3PW5A 4FBTA 1TK8A 1DGSA 2GLEA 3DDHA 1ZQFA 1YT3A 1D9FA 4J9MA 4J9NA 2M9NA 3BS5A 1SGGA 7ICLA 2HHTA 9ICRA 3Q8MA 2M0NA 3FAHA 2RLTA 1X6JA 1FFVA 4QZCA 2F44A 2ES6A 1DK3A 2DGZA 3MR6A 1T4GA 4I2JA 5ALNA 4RQ2A 2W9BB 4PL1A 5EWEA 4A8EA 4Q43A 1L7OA 3ZI4A 1PK3A 4YR3A 3G6YA 3WKDA 4Z6EA 3C2MA 2ZUCA 5ALFA 4X5VA 4QZAA 5KFGA 2XGPA 1VJ5A 2UVWA 2F1JA 4TUQA 3H8WA 3SV4A 4UBBA 5J2KA 5KG0A 5ALKA 8ICPA 3RTVA 1T3NA 4C4SA 3NVWA 8ICXA 3UPQA 3PY8A 2P6RA 1MSWD 2QKQA 1KFSA 2FLPA 1ZQIA 1S76D 1O08A 1BPYA 2A1JA 2EAOA 4DL5A 3K1RB 2ZG6A 4R65A 2OM6A 4CCHA 5DBAA 2ZUDA 2ZJAA 5AKKA 2ZTDA 5J8YA 3QU4A 1B0XA 1NJYA 3I76A 1U49A 3OSPA 2GOLA 5J2BA 4TQRA 1X9XA 2ZXHA 3SAFA 4KLHA 1NK9A 4C8KA 4UARA 3K75D 4Y2XA 4EYHB 2KKVA 2QB1A 4I2CA 4ED0A 2A19A 5AK6A 2KICA 3L5KA 5ALIA 2F8LA 3F2DA 2VA8A 1NKEA 4TUSA 1CUKA 4B9TA 2XO7A 1A77A 3MDAA 1SXDA 1SV0A 4IR9A 1DXSA 1NZPA 1TFRA 4FS2A 4B9MA 3ED5A 1BPDA 3NVYA 4R8UA 2HVIA 2AXTU 4ELUA 9ICEA 5KFVA 9ICLA 4TUPA 2ISOA 2JEGA 1V85A 3A0HU 1ZQRA 4GFJA 1ZRNA 2QB0B 5J0OA 2ZJ8A 3E2EA 4M9NA 2JEFA 2ZUBA 2D3DA 4NJ8A 4P4MA 4HAIA 4F4WA 1B22A 3AM9A 1ZQLA 4C4RA 3EW9A 2JR5A 3HILA 5A0LA 3CW2C 1ZD2P 1ZQMA 3RAXA 3TADA 1NK5A 9ICFA 4P0QB 3HRDD 2W9MA 1UHUA 2WF8A 5L1MA 2ATLA 4TQSA 5IIOA 2BKEA 2BDUA 3QU7A 3AL0B 2HSZA 1Q8KA 5IIIA 2GWSA 1SKRA 1BVSA 3WKBA 1NJZA 4NWIA 3NGDA 3K4GA 2ZIXA 5J0WA 1WCNA 2H3IA 3RBEA 3Q8LA 1D8BA 3TKAA 2QLTA 3KKAA 1ZQ1C 3C29A 2C2RA 7ICPA 3PVXA 3BJYA 3RRHA 1X9MA 2BHNA 3E0FA 4PGYA 2JZBA 4BWMA 2H3ZA 2FMQA 2BPGA 8ICSA 7ICHA 5F9NA 2HBKA 3QU9A 2KJ8A 3C2LA 3RH5A 4Y2PA 4JMUA 4UATA 1XSLA 3IM1A 5CHGA 2OCEA 8ICOA 1NOMA 5KFTA 4QNLA 3PX0A 4QJFB 3TARA 2HHSA 1BNPA 3SYZA 3QUBA 4OO1J 1ZQOA 4Y2YA 2WB1C 3IN5A 4QZBA 2BDPA 3F5AA 4J03A 1S10A 2WHEA 1ZQKA 1SL2A 3QU2A 4CNQA 1ZQTA 5D49A 4C8MA 2P6UA 3RJHA 3CRXA 1MC8A 4F5QA 7ICUA 3S6JA 3RJKA 3N4MB 3M8RA 5J2JA 2W55A 3H7IA 1L8LA 4IQWA 1SZPA 4FE3A 3GV8B 5KG6A 4ED8A 3GIMA 4GC7A 2CPRA 3MC1A 2WAQF 3T3FA 4QZDA 2ZIWB 1MA7A 4RQ8A 1MQ2A 2Q4TA 2C22A 2PXIA 2JEJA 4YD1A 2JH1A 1L3TA 1DK2A 4F72A 2KP7A 3ISBA 5KL8B 2YMQA 5J8YC 3QEBZ 5AKEA 2FLNA 2BQRA 1SL0A 2DWQA 2KVSA 2DPJA 2JGAA 2ZIUB 4BDPA 8ICCA 4IC9A 4O3QA 2BPFA 2BCRA 2W8KA 2LHTA 3GQCA 3QEAZ 1XNSA 1WWUA 4NY8A 3QYPA 1RPLA 5J0PA 1FO4A 2W9CA 3UMCA 2DQNB 2VKQA 2A1AA 1ZJMA 3OTQA 1X9SA 1U47A 1T94A 4FBUA 5AI4A 3ONNA 1X42A 5AICA 3RH6A 1KLNA 2VA2A 2HOIA 5AKHA 5JU5A 4C8NA 1KDHA 2IA6A 4O3MA 5KG2A 2KE7A 5DQIA 1N63A 2DL0A 1C7YA 4MFFA 4Q8FA 1BPZA 4UAYA 3H4BA 3BQ0A 5ALLA 4F4ZA 2W11A 4B9LA 1SV4A 1TV9A 3HWTA 1WWVA 3KD3A 4GC6A 2JEIA 4CF3A 1K1QA 3H0RB 2YTUA 1ZQVA 4O3OA 1LKYB 5F9LA 2A3VA 5DB8A 4YCXA 3ZD8A 1QSYA 5B5EU 9ICJA 4QWEA 9ICVA 2QARA 5G5GA 4M47A 1Z00A 3KHGA 4IQVA 4ZOHC 4C8LA 4B9VA 4NLCA 1IV8A 4DSEA 5AKLA 4I29A 5AKZA 4KLFA 2HMXA 2LPEA 4ACOA 3F53A 1AROP 4CF4A 5KT2A 4M9GA 2O6KA 5AM3A 1NK8A 3WKAA 7ICGA 4C7YA 5BOLA 7ICOA 2LYAA 3WKCA 2W54A 9ICBA 1NJWA 4QZGA 3MDCA 4F8RA 3NTUA 2PFPA 4IRDA 5ALTA 8ICNA 2E1EA 3BS5B 1COOA 1QLNA 1PUZA 4DL4A 4YXMA 2AQ4A 5E79U 3GDXA 1QQ7A 4M0AA 5DBBA 4DFPA 5AM5A 4ECVA 3ZDDA 3C1ZA 1F0MA 9ICSA 2FDRA 4K4IA 7ICNA 3T5LA 2FLLA 1TKDA 1KN5A 4EELA 3EYZA 4DQQA 1UQVA 2I5HA 4OJOA 7ICFA 4F92B 2FE9A 3T5KA 2ASJA 4RQ1A 3QZ8A 4LZGA 5KL1B 3Q8QB 5KT6A 5EE9A 3V6HA 4I28A 3BQ7A 3UQ0A 2W9AA 3PW7A 1A6SA 4P2HA 2HHVA 4RNNA 2KJ5A 2KNJA 1XSPA 9ICTA 5EWFA 3GIKA 2AGQA 4M04A 4UB6U 4RNOA 4P0PA 2F8KA 3K1ZA 4RQNA 4QZHA 3Q8KA 3QUQA 1XC9A 3C21A 2K4PA 5AK3A 2YY6A 5EE0A 4KLTA 1RQNA 1S77D 2HHWA 1RQLA 1S8OA 5CB1A 4EYIB 3H8MA 3ZDBA 3OGUA 5DG9A 3SMVA 1Z4OA 2PKEA 4P4PA 8ICKA 2DBYA 1U48A 3NUQA 5CEHA 5ALXA 3M9NB 5L9XA 1X6IA 2XIDA 1RZTA 2JRZA 5HR7A 1KQQA 5DGBA 5J0QA 3LWMA 1L7NA 2Y9TA 5J29A 3WK9A 4KLMA 3I28A 3DV9A 1NK4A 2KSOA 1RXWA 2LBOA 3Q8RB 2EQYA 5AI0A 5J2DA 3J81j 5L1JA 1SWVA 1BNOA 2YX8A 5ALPA 4RPYA 2G0AA 4UB3A 3PO5A 2NYVA 3T5HA 2G07A 4Y2UA 4F4XA 4KLOA 2Y1JA 1X9WA 1Z1BA 4DQIA 4IS7A 4DSIA 5C0YA 4NM2A 4QWAA 2HBMA 4UBCA 4YXJA 4F4YA 3TAPA 2RDJA 2KG5A 4I2HA 2H3FA 3UXPA 2V9WA 4I2IA 4FZMA 4IQUA 4WJ3B 3SAHA 5KFPA 2L5YA 3PX4A 4YMNA 2JHDA 4F71A 3H8JA 3QZ7A 1M6YA 3GIIA 1XS9D 4R64A 3LWLA 5J0YA 1HUZA 3ALRA 2Y1IA 1TAMA 2KZZA 2KZMA 5DG7A 2KMDA 4M6WA 1L3VA 3BS7A 1KW4A 2LM1A 4HYKA 1ZQCA 4Y2VA 5HHIA 3NASA 4YG2A 4BXOA 1SXEA 5DLFA 3WK8A 2EAMA 1TVAA 4ECWA 2GH1A 2Y0SC 2DKZA 5EWGA 1PVQA 3GZFA 2KHVA 5DBCA 3G6VA 2HOFA 1V9PA 5KFXA 2ZIXB 4K4HA 3N7PD 4YFKA 3BDPA 1SZHA 4MF8A 4QW9A 3OHAA 2J6TA 2G08A 1D8LA 5KFMA 2YB4A 2HHXA 2JH7A 2LM4A 2DFLA 1S97A 1UA1A 2D6FC 4RPZA 2ALZA 1KSPA 2FMPA 1RG6A 4KITB 5J0TA 5TISU 1ZD5A 4Y2JA 1ZD3A 3PSFA 5KFRA 4OJ5A 2W43A 1LV5A 3BQTA 1SIJA 3WU2U 1Z19A 8ICVA 1COKA 1IG6A 5CRXA 4Z6FA 1QQ5A 3IV6A 5B66U 1TE2A 3L3FX 5ALSA 2Z7JA 2AGPA 2XICA 4UW9A 5AKXA 2UVVA 3RJJA 4DSLA 1FIQA 2BZFA 2LYHA 4DO9A 5KFBA 3JPTA 5AK5A 3IHQB 2ZIVA 3I1YA 3V7LA 1UA0A 2ZXIA 1U4BA 5L1IA 2W3SA 4QW8A 2WFAA 1NK6A 3RJFA 3IP4B 2XCAA 4XRHA 3PW4A 3NVZA 5DG8A 2AHOB 4RQ7A 5HMMA 2FPKA 3UXNA 3HT3A 4DQSA 4KLIA 3A0BU 4GXIA 2MRLA 1UT5A 5D46A 2LKYA 2YMLA 1YZ6A 2UVRA 2BQUA 5GTIU 4NM1A 1X40A 5DDMA 2K8CB 1CI4A 4DFMA 1ZQUA 1S0VA 3PR5B 3GU3A 3QU5A 4BGDA 1CEZA 2KFZA 3HJEA 4KLGA 5ALUA 2J6SA 2B6GA 2Y0SF 5DKWA 3JPQA 3ORYA 4YN4A 1A0PA 5DB9A 2KIWA 3F2BA 1D9DA 1IXRA 2KTQA 1X66A 1ZQGA 1QSSA 3PMNA 4K4GA 5TZVA 5KNIA 3MGVA 3N28A 4PGXA 3TFRA 5ALHA 4PZNA 2K8AA 1ZQHA 8ICGA 1MQ3A 3EPIA 2KZ3A 5EOZA 3V6KA 4Z6CA 4O3RA 3V7JA 4DQRA 4FZLA 4RU9A 4B9SA 8ICBA 5CA7A 3PNCA 3GILA 5KFSA 2FPLA 3WKEA 1YZ7A 1J2MA 2Y9UA 4LJXA 1PVPA 2ZTEA 4DWIA 4ICAA 2EAPA 1L3SA 4DF4A 4IRCA 2LMRA 2DPIA 1VDVA 1F44A 2NRZA 2WF5A 2ODGA 3SD7A 1VLBA 2C2EA 1T8EA 2BQ3A 4EBCA 2DKXA 4UAZA 2XC9A 4PHAA 4F5PA 4OD0A 3TANA 9ICCA 1NKBA 3FYHA 4OJ6A 3EZ5A 2DUYA 3E58A 4DL3A 4IL6U 2E8PA 2YMPA 1GO3F 3Q8PB 4DOCA 2W3RA 5AHXA 4ECTA 3M6ZA 4MEXA 4AYBC 5AM1A 1QH9A 4P0QA 5CWRA 3ZDAA 1KFDA 8ICTA 3WK6A 1QSLA 2F1IA 9ICXA 2E8MA 9ICPA 2B21A 5KT4A 4PJ0U 3JPNA 4ED7A 3JPSA 3RB6A 4I2EA 3RRGA 8ICRA 5C5JA 5KG5A 5ALRA 4Q44A 3WK5A 5CJ7A 2BCUA 1JIHA 3FC4A 2BR0A 4MF2A 8ICIA 1L8OA 3UM9A 5AM2A 1ECWA 2C2DA 4NL9A 1UCVA 4Y2TA 1SV0C 1A76A 3N7RC 1ZQQA 3H4DA 3CP8A 2JV3A 4R66A 4FS1A 1KL9A 4AP9A 1MN8A 3RR8A 2ESEA 4YR0A 1RYSA 3MFHA 4KLEA 4UAUA 5KG4A 3TACB 4Y2RA 5KFCA 2VJ4A 2GO7A 3NRZA 3PX6A 4E0DA 2WB1F 4LZDA 3QXGA 5AKIA 3LVVA 5DLGA 4GIBA 1IIPA 3T79A 1ZQNA 3M8SA 4I2AA 1ZQBA 5AKGA 3H0LB 3M1YA 7ICSA 2HHUA 5J2GA 3TI0A 3TADC 4PHDA 2F77X 4US8A 2FPMA 2JXJA 2R8JA 4B6JA 3MGIA 2KJ9A 5L1LA 5G5HA 3KZIU 3UMGA 2EANA 3EUB2 1ZJNA 1NKCA 2NRWA 4DF8A 4F5NA 4KN7A 3RJIA 4RNMA 4OCZA 3MFIA 9ICUA 4FFDA 1ZQXA 5J2FA 4DSJA 8ICLA 1L7PA 3GFKB 5JUMA 5HP4A 5CR0A 4NLKA 2AJQA 4RQ6A 4NV0A 3KKAC 8ICWA 4YMOA 4DS4A 1B4FA 4DQPA 4J9LA 2BCSA 4C7ZA 2ZIWA 1ZYQA 5DQHA 3HW8A 4AYBF 3ISDA 2IHMA 2K8BB 1IM4A 1NJXA 1DGJA 3BZCA 2IMWP 1Z3EB 5KFOA 4J9QA 5KFFA 3AU6A 4MHVA 4QZ9A 4J9RA 2AU0A 5AI9A 1N60A 2KEYA 5CP2A 4C80A 4EX6A 3D2QA 4NLGA 1FEZA 2B0CA 2H3VA 4NLBA 2HI0A 5KT3A 3GV5B 1ED1A 3PZPA 4FZNA 1ZQYA 3RBDA 3OJSA 3C5FA 2HBJA 4C0ZA 1PVRA 3T5JA 2F3NA 1L6NA 3B0YA 2WF9A 3JPOA 1WCLA 2MUTA 1JALA 1D8YA 3HX0A 4C8OA 3F2CA 7ICMA 2E8OA 4RQ5A 5KFEA 2IOFA 3M6KA 4O5CA 3RJEA 7ICRA 5ALVA 5KFZA 2E1FA 3R9KA 4RQ0A 4CRXA 1S0OA 2YQEA 4MFCA 2PFNA 5D4BA 4KLJA 4YVZA 2V4QA 4F2SA 4JWMA 3M9MB 4NLZA 1OXJA 2G09A 1B43A 2NO5A 9ICKA 2V4RA 2WF6A 5AKJA 4DL2A 3PW2A 5HNKA 3RR7A 4BXOB 3RFAA 1DOQA 3B0XA 2NRVA 1JRPA 3N7SC 1Q3UA 7ICIA 1NZBA 3V7KA 5KFIA 2A1JB 4I2DA 1T7PA 2KN7A 9ICNA 5FP0A 4QZEA 4PGQA 3C1YA 4DLEA 3UQ2A 5IIMA 9ICOA 2C28A 1ZOLA 1K5OA 4OJPA 2ASDA 2WF7A 3B9JA 4CE6A 4RQ3A 5H2FU 1ZQSA 4IR1A 2KK0A 2AQ0A 2W8LA 1U9LA 2YB1A 2CN1A 1WUDA 4Y2SA 1QTMA 2FI1A 5BPCA 1ZQAA 2K4HA 3SQIA 4XQ8A 3V6JA 4ECSA 2EDUA 3VCBA 3ETLA 4PH5A 1LB2B 4QIWC 5KG1A 1N61A 1N2XA 1Z1VA 1Q46A 5K4LA 4Q8EA 1KKXA 1SKWA 2ISPA 4KX5A 3RAQA 1QQ6A 3MR3A 2XY6A 3C5GA 4IRKA 3FDSA 3L4PA 4O0IA 3NRWA 3O0FA 2N1RA 2RP5A 1RYRA 3BQ2A 1KFTA 4R8UB 4JWNA 1PK1A 5DB7A 3C2KA 2KFNA 3IG8A 2XGQA 5IILA 4GLXA 4OJLA 4KLSA 1ZQZA 4JV2A 2VIXA 2IBKA 5KFJA 1XSNA 2KV2A 2ZIVB 9ICGA 2EH9A 3N97B 2AGOA 1S0NA 4PHPA 2PFOA 5F3XB 3MR5A 3BZKA 2HDOA 4UB5A 5KFYA 3PMLA 1AQ6A 4DL7A 1K1SA 3RB0A 5KFQA 2K60A 4YD2A
chains in the Genus database with same CATH topology
1JN3A 1RPLA 5J0PA 3ORYA 4YN4A 1XO1A 2IHNA 5DB9A 2W9CA 8ICAA 1NK7A 1ZJMA 4M6WB 4QZIA 4KLDA 7ICJA 1BPEA 3PR4A 1X9SA 1D9DA 1U47A 1IXRA 4F93B 4B9UA 4FBUA 2KTQA 4PHEA 1ZQGA 2Q0ZX 3RH6A 1QSSA 1KLNA 2VA2A 3PMNA 3QE9Y 4K4GA 5TZVA 9ICQA 3OJUA 4PGXA 2F1HA 5J2CA 4C8NA 5J0XA 3TFRA 1KDHA 1ZQDA 2IA6A 2HW3A 5KG2A 4ED1A 5DQIA 4XUSA 5J2IA 1ZQHA 2BCVA 3ZDCA 8ICGA 8ICZA 4RQ4A 5KFWA 1C7YA 4ED2A 1MQ3A 4MFFA 4Q8FA 1BPZA 4UAYA 3H4BA 3EPIA 3BQ0A 4F4KA 4UQGA 2KZ3A 1UT8A 4YR2A 1BPBA 5EOZA 2JZBB 4F4ZA 3V6KA 4M9JA 4Z6CA 4O3RA 4B9LA 3C23A 3V7JA 4DQRA 4RU9A 4QWDA 4RUAA 3HWTA 1TV9A 4B9SA 8ICBA 1BPXA 3ISCA 4GC6A 9ICAA 2JEIA 2HHQA 4KLQA 5CA7A 1K1QA 3PNCA 3ZDEA 3GILA 5J2HA 4P4OA 4DEZA 4UB4A 1ZQVA 4O3OA 5KFSA 4RZRA 2FPLA 5F9LA 2I9GA 1L5UA 5DB8A 4YCXA 1H38A 3ZD8A 1QSYA 4DL6A 4G3IA 9ICJA 2ZTEA 4DWIA 4I27A 2MAXA 4J9PA 4O3NA 1X2IA 3GV7B 4O5EA 2I1QA 4QWEA 1L3SA 4DF4A 9ICVA 4M47A 4YMMA 4IRCA 1Z00A 2BGWA 2DPIA 9ICIA 3KHGA 4JUZA 4IQVA 1HJPA 4C8LA 4B9VA 3OSNA 3RH4A 4I2BA 2NRZA 3UXOA 4DOBA 4DSEA 7ICEA 2C2EA 4I29A 4ECZA 4FO6A 4KLFA 3PW5A 1T8EA 3AU2A 2BQ3A 1AROP 4FBTA 5KT2A 4EBCA 3V72A 1JXEA 4M9GA 4UAZA 2XC9A 4PHAA 4F5PA 1TK8A 1DGSA 4NXZA 1ZQFA 1NK8A 3TANA 9ICCA 1NKBA 1D9FA 5DQGA 4J9MA 3FYHA 4J9NA 7ICGA 7ICQA 2W9BA 3EZ5A 2M9NA 7ICLA 4DL3A 3KHRA 2H5XA 2HHTA 4KLJA 5J0UA 5BOLA 3Q8PB 7ICOA 4DOCA 9ICRA 3Q8MA 4M2YA 1XU4A 9ICBA 7ICTA 4QZCA 1NJWA 4ECTA 1KRPA 4QZGA 5KT7A 3MR2A 3MDCA 4MEXA 4F8RA 3NTUA 2PFPA 2PFQA 4IRDA 3MR6A 1T4GA 5CWRA 1KFDA 4F50A 3ZDAA 8ICNA 8ICTA 4YP3A 1QSLA 2F1IA 4LVSA 9ICXA 4I2JA 4RQ2A 2W9BB 4PPXA 9ICPA 2B21A 1COOA 5KT4A 1HUOA 3JPNA 1QLNA 4DL4A 4YXMA 2AQ4A 5EWEA 4ED7A 4Q43A 3JPSA 3MBYA 3GDXA 8ICMA 4M0AA 3RB6A 5DBBA 4I2EA 4DFPA 1L3UA 3JPPA 3KHHA 4ECVA 3RRGA 8ICRA 3ZDDA 4YR3A 3G6YA 3LDAA 5C5JA 5KG5A 2ASLA 4ECQA 3C1ZA 4Z6EA 3C2MA 2ZUCA 4Q44A 4X5VA 5CJ7A 2BCUA 4QZAA 4EZ6A 5KFGA 9ICSA 2XGPA 1JIHA 4K4IA 2BR0A 2UVWA 2VA3A 4MF2A 8ICIA 7ICNA 2F1JA 4TUQA 3T5LA 2FLLA 3H8WA 2BPCA 1TKDA 3SV4A 4JV1A 4UBBA 2C2DA 3EYZA 5J2KA 2XY7A 4UB1A 5KG0A 4DQQA 4O3SA 8ICPA 1A76A 3RTVA 1ZQOA 1ZQQA 1T3NA 4QZFA 3H4DA 4ELVA 5KT5A 3THVA 7ICFA 4F92B 4R66A 4FS1A 3T5KA 2ASJA 4RQ1A 8ICXA 3QZ8A 2J6UA 4LZGA 3UPQA 3RR8A 8ICFA 3EPGA 4YR0A 1RYSA 3MFHA 3PY8A 4KLEA 5KG4A 3Q8QB 2P6RA 1MSWD 1KFSA 5KT6A 5J0RA 3SV3A 5KFCA 3V6HA 2UVUA 2FLPA 1ZQIA 4I28A 3UQ0A 2W9AA 4O5KA 3PX6A 3PW7A 1BPYA 1S76D 5IIJA 4P2HA 4E0DA 2HHVA 2A1JA 4RNNA 4LZDA 2W9CB 1KTQA 5J2EA 1XSPA 3MGHA 9ICTA 5EWFA 4RT3A 3GIKA 4DL5A 5DLGA 2AGQA 4KTQA 4DOAA 4M04A 8ICEA 8ICYA 4ECUA 4R65A 4CCHA 4RNOA 5DBAA 3GIJA 3PW0A 5HMLA 2XCPA 4QZHA 1ZQNA 4GXJA 3Q8KA 2ZUDA 1XC9A 4ECRA 4YQWA 5DB6A 3M8SA 1ZQBA 4I2AA 2ZJAA 3C21A 4NLNA 2ZTDA 7ICSA 2HHUA 3RB4A 5J2GA 3TI0A 4O9MA 4PHDA 4R63A 4KLTA 1NJYA 1U49A 3OSPA 1S77D 2HHWA 2FPMA 5J2BA 5CB1A 5BOMA 4TQRA 3TQ1A 1S0MA 4EYIB 2R8JA 3MGIA 3ZDBA 5L1LA 3OGUA 2R8HA 4ED6A 5DG9A 4KLUA 4KLHA 1NK9A 1ZJNA 4C8KA 1Y88A 4P4PA 1NKCA 2NRWA 3K75D 4EBEA 4DF8A 8ICKA 4EYHB 3JPRA 1U48A 4F5NA 4KN7A 3RJIA 3M9NB 5L9XA 4ELTA 1RZTA 4I2CA 4ED0A 4RNMA 4ED3A 5DGBA 5J0QA 3MFIA 9ICUA 3LWMA 1ZQXA 5J2FA 4DSJA 8ICLA 1ZETA 2VA8A 3GFKB 5JUMA 1NKEA 5J29A 1CUKA 4TUSA 5HP4A 4B9TA 5CR0A 4NLKA 4KLMA 2XO7A 3RB3A 1A77A 5KFLA 2AJQA 3MDAA 4RQ6A 1NK4A 4IR9A 1RXWA 2ZJ5A 3Q8RB 4YMOA 4DS4A 8ICWA 1TFRA 4FS2A 4DQPA 4J9LA 2BCSA 3H40A 1Z00B 5KG7A 5J2DA 4B9MA 3SZ2A 8ICJA 5L1JA 2ZTCA 4GXKA 1S9FA 1BPDA 4RPYA 4J9SA 2HVIA 4R8UA 1ZYQA 4M9HA 5DQHA 3HW8A 3ISDA 2BCQA 4UB3A 3PO5A 3T5HA 2IHMA 4ELUA 9ICEA 5KFVA 2R8KA 9ICLA 4TUPA 2ISOA 2JEGA 1ZQRA 1IM4A 1NJXA 4F4XA 2FMSA 4KLOA 5J0OA 2Y1JA 1X9WA 2IMWP 2ZJ8A 1Z3EB 5KFOA 4J9QA 5KFFA 3AU6A 4DQIA 4DSIA 3E2EA 4B9NA 4QZ9A 4XA5A 4M9NA 2JEFA 4J9RA 4NM2A 2ZUBA 5KFKA 4F3OA 4P4MA 4F4WA 1B22A 1N56A 4QWAA 4UBCA 4QWCA 3KHLA 2AU0A 4I2GA 4YXJA 4F4YA 1ZQLA 5CP2A 3TAPA 3AUOA 2RDJA 4NLGA 3EW9A 4F5OA 4I2HA 3UXPA 2V9WA 5L1KA 4I2IA 4IQUA 5KFPA 5KFDA 5KT3A 1ZQMA 3GV5B 3RAXA 1NK5A 2VANA 2P66A 4JV0A 9ICFA 3PX4A 1ZQYA 3RBDA 4YMNA 3OJSA 2W9MA 3C5FA 4DFJA 3H8JA 3QZ7A 3GIIA 3T5JA 2ATLA 4RPXA 4DFKA 1XS9D 4TQSA 4UAWA 4R64A 3B0YA 3LWLA 5IIOA 5J0YA 2BKEA 1HUZA 2Y1IA 7ICVA 2HVHA 3JPOA 5IIIA 1WCLA 2MUTA 3HP6A 2KZZA 2KZMA 4J9OA 3H8SA 5DG7A 2GWSA 4M6WA 8ICUA 1D8YA 1L3VA 1SKRA 1BVSA 4F2RA 3HX0A 1NJZA 4C8OA 5J2AA 3NGDA 7ICMA 4BWJA 3K4GA 4RQ5A 4HYKA 5J0WA 5KFEA 1ZQCA 1WCNA 1ZQEA 4QWBA 1TAQA 5HHIA 3RBEA 3Q8LA 4ZH4A 4O5CA 3RJEA 4YG2A 4BXOA 1TAUA 7ICRA 5KFZA 3PV8A 2R8GA 5DLFA 4RQ0A 4DS5A 1S0OA 5KG3A 1TVAA 4ECWA 2C2RA 7ICPA 3MABA 3PVXA 4MFCA 5EWGA 2PFNA 5D4BA 3BJYA 4YVZA 2MUTB 2V4QA 3RRHA 1X9MA 3PO4A 4ECYA 4F2SA 4JWMA 2BHNA 3M9MB 4F5RA 4NLZA 4PGYA 4M9LA 2JZBA 4BWMA 5DBCA 2FMQA 2BPGA 5DGAA 1B43A 3G6VA 1V9PA 7ICHA 8ICSA 9ICKA 5KFXA 5F9NA 3C2LA 2V4RA 4K4HA 3RH5A 4YFKA 3BDPA 4MF8A 4QW9A 3OHAA 4DL2A 1XSLA 3PW2A 5HNKA 3RR7A 2J6TA 4BXOB 1S97A 3IM1A 5CHGA 8ICOA 9ICWA 1DOQA 1D8LA 1NOMA 2NRVA 3B0XA 5KFTA 5KFMA 4UB2A 3PX0A 1N48A 1ZQJA 7ICIA 3TAQA 3RJGA 3V7KA 3TARA 2HHXA 5KFIA 2HHSA 2A1JB 4I2DA 1T7PA 2KN7A 3SYZA 9ICNA 1ZQWA 4QZEA 2DFLA 4IQTA 4KN4A 3C1YA 4JK1A 4PGQA 4DLEA 1UA1A 1U45A 4RPZA 3UQ2A 5IIMA 9ICOA 2ALZA 1KSPA 2C28A 2FMPA 4O3PA 2XY5A 3BQ1A 4KMUA 4KITB 3Q8SB 4QZBA 2ASDA 5J0TA 3LK9A 2BDPA 1ZQPA 4RQ3A 1S10A 1ZQSA 8ICHA 4I2FA 4IR1A 5J0SA 5KFRA 2AQ0A 2W8LA 1SL1A 3TFSA 1U9LA 1ZQKA 1SL2A 1BGXT 1QTMA 1LV5A 3BQTA 1ZQTA 5BPCA 1ZQAA 1JMSA 4EZ9A 1JXLA 7ICKA 5D49A 9ICMA 5KTQA 4XQ8A 3EWAA 4F91B 4C8MA 2P6UA 3RJHA 8ICVA 3V6JA 4EEYA 4ECSA 3ETLA 4Z6FA 1MC8A 2PI5A 4PH5A 3M9OB 1LB2B 4F5QA 7ICUA 5KG1A 1TK0A 8ICQA 1SKSA 4Q8EA 2R8IA 3RJKA 2NRXA 2AGPA 4RT2A 3N4MB 3ZD9A 4MEYA 2UVVA 1SKWA 2ISPA 3M8RA 5J2JA 3RJJA 4DSLA 3RAQA 3MR3A 2XY6A 3C5GA 3H7IA 4IQWA 5IIKA 4IRKA 1SZPA 2LYHA 3GV8B 3FDSA 4DO9A 5KFBA 4O0IA 3JPTA 1RXVA 3IHQB 5KFUA 5KG6A 4ED8A 3HPOA 3GIMA 1TK5A 4GC7A 3V7LA 2RDIA 1RYRA 1UA0A 3BQ2A 4MFAA 1U4BA 5L1IA 3T3FA 1KFTA 5KFAA 4QZDA 4R8UB 4QW8A 1NK6A 4JWNA 3RJFA 2XCAA 4ECXA 1PZNA 4XRHA 5DB7A 4RQ8A 3PW4A 5DG8A 1MQ2A 4RQ7A 3C2KA 5HMMA 5KFNA 4RUCA 2XGQA 2KFNA 1XWLA 2FPKA 2PXIA 5IILA 2C22A 3UXNA 5IINA 2JEJA 4J9KA 4GLXA 3HT3A 4DQSA 3SI8A 4KLIA 4KLSA 1ZQZA 4GXIA 4YD1A 4JV2A 5HHHA 1L3TA 1UT5A 1KEJA 5D46A 2IBKA 1JX4A 5KFJA 3ISBA 4QZ8A 4TURA 1XSNA 2UVRA 9ICHA 2BQUA 9ICGA 1NK0A 3G6XA 3N97B 3QEBZ 2AGOA 1S0NA 4PHPA 4NM1A 2OWOA 2FLNA 2PFOA 5DDMA 2WTFA 2PI4A 1EXNA 3MR5A 4DFMA 1ZQUA 4Q45A 2BQRA 5KFHA 1SL0A 1S0VA 4UB5A 3PR5B 5KFYA 3PMLA 2DPJA 3OHBA 4BDPA 8ICCA 4BGDA 1CEZA 2KFZA 4DL7A 4KLGA 1K1SA 4O3QA 2BPFA 2BCRA 2J6SA 2NRTA 2W8KA 3RB0A 3GQCA 3QEAZ 3KTQA 4DSKA 4EBDA 5KFQA 5DDYA 5DKWA 4DLGA 4DSFA 4NY8A 3JPQA 4KLLA 4YD2A 4Z6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN3 A;  1RPL A;  5J0P A;  3ORY A;  4YN4 A;  1XO1 A;  2IHN A;  5DB9 A;  2W9C A;  8ICA A;  1NK7 A;  1ZJM A;  4M6W B;  4QZI A;  4KLD A;  7ICJ A;  1BPE A;  3PR4 A;  1X9S A;  1D9D A;  1U47 A;  1IXR A;  4F93 B;  4B9U A;  4FBU A;  2KTQ A;  4PHE A;  1ZQG A;  2Q0Z X;  3RH6 A;  1QSS A;  1KLN A;  2VA2 A;  3PMN A;  3QE9 Y;  4K4G A;  5TZV A;  9ICQ A;  3OJU A;  4PGX A;  2F1H A;  5J2C A;  4C8N A;  5J0X A;  3TFR A;  1KDH A;  1ZQD A;  2IA6 A;  2HW3 A;  5KG2 A;  4ED1 A;  5DQI A;  4XUS A;  5J2I A;  1ZQH A;  2BCV A;  3ZDC A;  8ICG A;  8ICZ A;  4RQ4 A;  5KFW A;  1C7Y A;  4ED2 A;  1MQ3 A;  4MFF A;  4Q8F A;  1BPZ A;  4UAY A;  3H4B A;  3EPI A;  3BQ0 A;  4F4K A;  4UQG A;  2KZ3 A;  1UT8 A;  4YR2 A;  1BPB A;  5EOZ A;  2JZB B;  4F4Z A;  3V6K A;  4M9J A;  4Z6C A;  4O3R A;  4B9L A;  3C23 A;  3V7J A;  4DQR A;  4RU9 A;  4QWD A;  4RUA A;  3HWT A;  1TV9 A;  4B9S A;  8ICB A;  1BPX A;  3ISC A;  4GC6 A;  9ICA A;  2JEI A;  2HHQ A;  4KLQ A;  5CA7 A;  1K1Q A;  3PNC A;  3ZDE A;  3GIL A;  5J2H A;  4P4O A;  4DEZ A;  4UB4 A;  1ZQV A;  4O3O A;  5KFS A;  4RZR A;  2FPL A;  5F9L A;  2I9G A;  1L5U A;  5DB8 A;  4YCX A;  1H38 A;  3ZD8 A;  1QSY A;  4DL6 A;  4G3I A;  9ICJ A;  2ZTE A;  4DWI A;  4I27 A;  2MAX A;  4J9P A;  4O3N A;  1X2I A;  3GV7 B;  4O5E A;  2I1Q A;  4QWE A;  1L3S A;  4DF4 A;  9ICV A;  4M47 A;  4YMM A;  4IRC A;  1Z00 A;  2BGW A;  2DPI A;  9ICI A;  3KHG A;  4JUZ A;  4IQV A;  1HJP A;  4C8L A;  4B9V A;  3OSN A;  3RH4 A;  4I2B A;  2NRZ A;  3UXO A;  4DOB A;  4DSE A;  7ICE A;  2C2E A;  4I29 A;  4ECZ A;  4FO6 A;  4KLF A;  3PW5 A;  1T8E A;  3AU2 A;  2BQ3 A;  1ARO P;  4FBT A;  5KT2 A;  4EBC A;  3V72 A;  1JXE A;  4M9G A;  4UAZ A;  2XC9 A;  4PHA A;  4F5P A;  1TK8 A;  1DGS A;  4NXZ A;  1ZQF A;  1NK8 A;  3TAN A;  9ICC A;  1NKB A;  1D9F A;  5DQG A;  4J9M A;  3FYH A;  4J9N A;  7ICG A;  7ICQ A;  2W9B A;  3EZ5 A;  2M9N A;  7ICL A;  4DL3 A;  3KHR A;  2H5X A;  2HHT A;  4KLJ A;  5J0U A;  5BOL A;  3Q8P B;  7ICO A;  4DOC A;  9ICR A;  3Q8M A;  4M2Y A;  1XU4 A;  9ICB A;  7ICT A;  4QZC A;  1NJW A;  4ECT A;  1KRP A;  4QZG A;  5KT7 A;  3MR2 A;  3MDC A;  4MEX A;  4F8R A;  3NTU A;  2PFP A;  2PFQ A;  4IRD A;  3MR6 A;  1T4G A;  5CWR A;  1KFD A;  4F50 A;  3ZDA A;  8ICN A;  8ICT A;  4YP3 A;  1QSL A;  2F1I A;  4LVS A;  9ICX A;  4I2J A;  4RQ2 A;  2W9B B;  4PPX A;  9ICP A;  2B21 A;  1COO A;  5KT4 A;  1HUO A;  3JPN A;  1QLN A;  4DL4 A;  4YXM A;  2AQ4 A;  5EWE A;  4ED7 A;  4Q43 A;  3JPS A;  3MBY A;  3GDX A;  8ICM A;  4M0A A;  3RB6 A;  5DBB A;  4I2E A;  4DFP A;  1L3U A;  3JPP A;  3KHH A;  4ECV A;  3RRG A;  8ICR A;  3ZDD A;  4YR3 A;  3G6Y A;  3LDA A;  5C5J A;  5KG5 A;  2ASL A;  4ECQ A;  3C1Z A;  4Z6E A;  3C2M A;  2ZUC A;  4Q44 A;  4X5V A;  5CJ7 A;  2BCU A;  4QZA A;  4EZ6 A;  5KFG A;  9ICS A;  2XGP A;  1JIH A;  4K4I A;  2BR0 A;  2UVW A;  2VA3 A;  4MF2 A;  8ICI A;  7ICN A;  2F1J A;  4TUQ A;  3T5L A;  2FLL A;  3H8W A;  2BPC A;  1TKD A;  3SV4 A;  4JV1 A;  4UBB A;  2C2D A;  3EYZ A;  5J2K A;  2XY7 A;  4UB1 A;  5KG0 A;  4DQQ A;  4O3S A;  8ICP A;  1A76 A;  3RTV A;  1ZQO A;  1ZQQ A;  1T3N A;  4QZF A;  3H4D A;  4ELV A;  5KT5 A;  3THV A;  7ICF A;  4F92 B;  4R66 A;  4FS1 A;  3T5K A;  2ASJ A;  4RQ1 A;  8ICX A;  3QZ8 A;  2J6U A;  4LZG A;  3UPQ A;  3RR8 A;  8ICF A;  3EPG A;  4YR0 A;  1RYS A;  3MFH A;  3PY8 A;  4KLE A;  5KG4 A;  3Q8Q B;  2P6R A;  1MSW D;  1KFS A;  5KT6 A;  5J0R A;  3SV3 A;  5KFC A;  3V6H A;  2UVU A;  2FLP A;  1ZQI A;  4I28 A;  3UQ0 A;  2W9A A;  4O5K A;  3PX6 A;  3PW7 A;  1BPY A;  1S76 D;  5IIJ A;  4P2H A;  4E0D A;  2HHV A;  2A1J A;  4RNN A;  4LZD A;  2W9C B;  1KTQ A;  5J2E A;  1XSP A;  3MGH A;  9ICT A;  5EWF A;  4RT3 A;  3GIK A;  4DL5 A;  5DLG A;  2AGQ A;  4KTQ A;  4DOA A;  4M04 A;  8ICE A;  8ICY A;  4ECU A;  4R65 A;  4CCH A;  4RNO A;  5DBA A;  3GIJ A;  3PW0 A;  5HML A;  2XCP A;  4QZH A;  1ZQN A;  4GXJ A;  3Q8K A;  2ZUD A;  1XC9 A;  4ECR A;  4YQW A;  5DB6 A;  3M8S A;  1ZQB A;  4I2A A;  2ZJA A;  3C21 A;  4NLN A;  2ZTD A;  7ICS A;  2HHU A;  3RB4 A;  5J2G A;  3TI0 A;  4O9M A;  4PHD A;  4R63 A;  4KLT A;  1NJY A;  1U49 A;  3OSP A;  1S77 D;  2HHW A;  2FPM A;  5J2B A;  5CB1 A;  5BOM A;  4TQR A;  3TQ1 A;  1S0M A;  4EYI B;  2R8J A;  3MGI A;  3ZDB A;  5L1L A;  3OGU A;  2R8H A;  4ED6 A;  5DG9 A;  4KLU A;  4KLH A;  1NK9 A;  1ZJN A;  4C8K A;  1Y88 A;  4P4P A;  1NKC A;  2NRW A;  3K75 D;  4EBE A;  4DF8 A;  8ICK A;  4EYH B;  3JPR A;  1U48 A;  4F5N A;  4KN7 A;  3RJI A;  3M9N B;  5L9X A;  4ELT A;  1RZT A;  4I2C A;  4ED0 A;  4RNM A;  4ED3 A;  5DGB A;  5J0Q A;  3MFI A;  9ICU A;  3LWM A;  1ZQX A;  5J2F A;  4DSJ A;  8ICL A;  1ZET A;  2VA8 A;  3GFK B;  5JUM A;  1NKE A;  5J29 A;  1CUK A;  4TUS A;  5HP4 A;  4B9T A;  5CR0 A;  4NLK A;  4KLM A;  2XO7 A;  3RB3 A;  1A77 A;  5KFL A;  2AJQ A;  3MDA A;  4RQ6 A;  1NK4 A;  4IR9 A;  1RXW A;  2ZJ5 A;  3Q8R B;  4YMO A;  4DS4 A;  8ICW A;  1TFR A;  4FS2 A;  4DQP A;  4J9L A;  2BCS A;  3H40 A;  1Z00 B;  5KG7 A;  5J2D A;  4B9M A;  3SZ2 A;  8ICJ A;  5L1J A;  2ZTC A;  4GXK A;  1S9F A;  1BPD A;  4RPY A;  4J9S A;  2HVI A;  4R8U A;  1ZYQ A;  4M9H A;  5DQH A;  3HW8 A;  3ISD A;  2BCQ A;  4UB3 A;  3PO5 A;  3T5H A;  2IHM A;  4ELU A;  9ICE A;  5KFV A;  2R8K A;  9ICL A;  4TUP A;  2ISO A;  2JEG A;  1ZQR A;  1IM4 A;  1NJX A;  4F4X A;  2FMS A;  4KLO A;  5J0O A;  2Y1J A;  1X9W A;  2IMW P;  2ZJ8 A;  1Z3E B;  5KFO A;  4J9Q A;  5KFF A;  3AU6 A;  4DQI A;  4DSI A;  3E2E A;  4B9N A;  4QZ9 A;  4XA5 A;  4M9N A;  2JEF A;  4J9R A;  4NM2 A;  2ZUB A;  5KFK A;  4F3O A;  4P4M A;  4F4W A;  1B22 A;  1N56 A;  4QWA A;  4UBC A;  4QWC A;  3KHL A;  2AU0 A;  4I2G A;  4YXJ A;  4F4Y A;  1ZQL A;  5CP2 A;  3TAP A;  3AUO A;  2RDJ A;  4NLG A;  3EW9 A;  4F5O A;  4I2H A;  3UXP A;  2V9W A;  5L1K A;  4I2I A;  4IQU A;  5KFP A;  5KFD A;  5KT3 A;  1ZQM A;  3GV5 B;  3RAX A;  1NK5 A;  2VAN A;  2P66 A;  4JV0 A;  9ICF A;  3PX4 A;  1ZQY A;  3RBD A;  4YMN A;  3OJS A;  2W9M A;  3C5F A;  4DFJ A;  3H8J A;  3QZ7 A;  3GII A;  3T5J A;  2ATL A;  4RPX A;  4DFK A;  1XS9 D;  4TQS A;  4UAW A;  4R64 A;  3B0Y A;  3LWL A;  5IIO A;  5J0Y A;  2BKE A;  1HUZ A;  2Y1I A;  7ICV A;  2HVH A;  3JPO A;  5III A;  1WCL A;  2MUT A;  3HP6 A;  2KZZ A;  2KZM A;  4J9O A;  3H8S A;  5DG7 A;  2GWS A;  4M6W A;  8ICU A;  1D8Y A;  1L3V A;  1SKR A;  1BVS A;  4F2R A;  3HX0 A;  1NJZ A;  4C8O A;  5J2A A;  3NGD A;  7ICM A;  4BWJ A;  3K4G A;  4RQ5 A;  4HYK A;  5J0W A;  5KFE A;  1ZQC A;  1WCN A;  1ZQE A;  4QWB A;  1TAQ A;  5HHI A;  3RBE A;  3Q8L A;  4ZH4 A;  4O5C A;  3RJE A;  4YG2 A;  4BXO A;  1TAU A;  7ICR A;  5KFZ A;  3PV8 A;  2R8G A;  5DLF A;  4RQ0 A;  4DS5 A;  1S0O A;  5KG3 A;  1TVA A;  4ECW A;  2C2R A;  7ICP A;  3MAB A;  3PVX A;  4MFC A;  5EWG A;  2PFN A;  5D4B A;  3BJY A;  4YVZ A;  2MUT B;  2V4Q A;  3RRH A;  1X9M A;  3PO4 A;  4ECY A;  4F2S A;  4JWM A;  2BHN A;  3M9M B;  4F5R A;  4NLZ A;  4PGY A;  4M9L A;  2JZB A;  4BWM A;  5DBC A;  2FMQ A;  2BPG A;  5DGA A;  1B43 A;  3G6V A;  1V9P A;  7ICH A;  8ICS A;  9ICK A;  5KFX A;  5F9N A;  3C2L A;  2V4R A;  4K4H A;  3RH5 A;  4YFK A;  3BDP A;  4MF8 A;  4QW9 A;  3OHA A;  4DL2 A;  1XSL A;  3PW2 A;  5HNK A;  3RR7 A;  2J6T A;  4BXO B;  1S97 A;  3IM1 A;  5CHG A;  8ICO A;  9ICW A;  1DOQ A;  1D8L A;  1NOM A;  2NRV A;  3B0X A;  5KFT A;  5KFM A;  4UB2 A;  3PX0 A;  1N48 A;  1ZQJ A;  7ICI A;  3TAQ A;  3RJG A;  3V7K A;  3TAR A;  2HHX A;  5KFI A;  2HHS A;  2A1J B;  4I2D A;  1T7P A;  2KN7 A;  3SYZ A;  9ICN A;  1ZQW A;  4QZE A;  2DFL A;  4IQT A;  4KN4 A;  3C1Y A;  4JK1 A;  4PGQ A;  4DLE A;  1UA1 A;  1U45 A;  4RPZ A;  3UQ2 A;  5IIM A;  9ICO A;  2ALZ A;  1KSP A;  2C28 A;  2FMP A;  4O3P A;  2XY5 A;  3BQ1 A;  4KMU A;  4KIT B;  3Q8S B;  4QZB A;  2ASD A;  5J0T A;  3LK9 A;  2BDP A;  1ZQP A;  4RQ3 A;  1S10 A;  1ZQS A;  8ICH A;  4I2F A;  4IR1 A;  5J0S A;  5KFR A;  2AQ0 A;  2W8L A;  1SL1 A;  3TFS A;  1U9L A;  1ZQK A;  1SL2 A;  1BGX T;  1QTM A;  1LV5 A;  3BQT A;  1ZQT A;  5BPC A;  1ZQA A;  1JMS A;  4EZ9 A;  1JXL A;  7ICK A;  5D49 A;  9ICM A;  5KTQ A;  4XQ8 A;  3EWA A;  4F91 B;  4C8M A;  2P6U A;  3RJH A;  8ICV A;  3V6J A;  4EEY A;  4ECS A;  3ETL A;  4Z6F A;  1MC8 A;  2PI5 A;  4PH5 A;  3M9O B;  1LB2 B;  4F5Q A;  7ICU A;  5KG1 A;  1TK0 A;  8ICQ A;  1SKS A;  4Q8E A;  2R8I A;  3RJK A;  2NRX A;  2AGP A;  4RT2 A;  3N4M B;  3ZD9 A;  4MEY A;  2UVV A;  1SKW A;  2ISP A;  3M8R A;  5J2J A;  3RJJ A;  4DSL A;  3RAQ A;  3MR3 A;  2XY6 A;  3C5G A;  3H7I A;  4IQW A;  5IIK A;  4IRK A;  1SZP A;  2LYH A;  3GV8 B;  3FDS A;  4DO9 A;  5KFB A;  4O0I A;  3JPT A;  1RXV A;  3IHQ B;  5KFU A;  5KG6 A;  4ED8 A;  3HPO A;  3GIM A;  1TK5 A;  4GC7 A;  3V7L A;  2RDI A;  1RYR A;  1UA0 A;  3BQ2 A;  4MFA A;  1U4B A;  5L1I A;  3T3F A;  1KFT A;  5KFA A;  4QZD A;  4R8U B;  4QW8 A;  1NK6 A;  4JWN A;  3RJF A;  2XCA A;  4ECX A;  1PZN A;  4XRH A;  5DB7 A;  4RQ8 A;  3PW4 A;  5DG8 A;  1MQ2 A;  4RQ7 A;  3C2K A;  5HMM A;  5KFN A;  4RUC A;  2XGQ A;  2KFN A;  1XWL A;  2FPK A;  2PXI A;  5IIL A;  2C22 A;  3UXN A;  5IIN A;  2JEJ A;  4J9K A;  4GLX A;  3HT3 A;  4DQS A;  3SI8 A;  4KLI A;  4KLS A;  1ZQZ A;  4GXI A;  4YD1 A;  4JV2 A;  5HHH A;  1L3T A;  1UT5 A;  1KEJ A;  5D46 A;  2IBK A;  1JX4 A;  5KFJ A;  3ISB A;  4QZ8 A;  4TUR A;  1XSN A;  2UVR A;  9ICH A;  2BQU A;  9ICG A;  1NK0 A;  3G6X A;  3N97 B;  3QEB Z;  2AGO A;  1S0N A;  4PHP A;  4NM1 A;  2OWO A;  2FLN A;  2PFO A;  5DDM A;  2WTF A;  2PI4 A;  1EXN A;  3MR5 A;  4DFM A;  1ZQU A;  4Q45 A;  2BQR A;  5KFH A;  1SL0 A;  1S0V A;  4UB5 A;  3PR5 B;  5KFY A;  3PML A;  2DPJ A;  3OHB A;  4BDP A;  8ICC A;  4BGD A;  1CEZ A;  2KFZ A;  4DL7 A;  4KLG A;  1K1S A;  4O3Q A;  2BPF A;  2BCR A;  2J6S A;  2NRT A;  2W8K A;  3RB0 A;  3GQC A;  3QEA Z;  3KTQ A;  4DSK A;  4EBD A;  5KFQ A;  5DDY A;  5DKW A;  4DLG A;  4DSF A;  4NY8 A;  3JPQ A;  4KLL A;  4YD2 A;  4Z6D A; 
#chains in the Genus database with same CATH topology
 1JN3 A;  2W7P A;  2IHN A;  3SEN A;  8ICA A;  1NK7 A;  4KLD A;  2G06 A;  5AI8 A;  4F93 B;  5ALD A;  5KAI U;  4PHE A;  2Q0Z X;  3D2S A;  3U26 A;  3QE9 Y;  3DEE A;  2HW3 A;  5J0X A;  1ZQD A;  4ED1 A;  3KOO A;  5J2I A;  8ICZ A;  3UMB A;  1QCK A;  3ZDC A;  1WYG A;  3IG5 A;  1UT8 A;  4YR2 A;  1BPB A;  4M9J A;  2JZB B;  4QWD A;  4RUA A;  1BPX A;  3ISC A;  9ICA A;  2EZX A;  2YMM A;  3ZDE A;  5J2H A;  3M7D A;  2NO4 A;  2OXO A;  3QNM A;  5AK4 A;  1UPH A;  1L5U A;  2I9G A;  1H38 A;  2IOF K;  3H0M B;  3AQE A;  4G3I A;  4I27 A;  2W7O A;  3OPX A;  1X2I A;  4QIW F;  3GV7 B;  2I1Q A;  9ICI A;  4JUZ A;  4U6P A;  3IRU A;  3UXO A;  1N5W A;  4DOB A;  7ICE A;  4FO6 A;  5AM0 A;  3AU2 A;  2HCF A;  3V72 A;  1JXE A;  2K4E A;  4NXZ A;  2PMZ C;  2MSN A;  3PSI A;  5DQG A;  7ICQ A;  2W9B A;  3KHR A;  2H5X A;  1WG8 A;  5J0U A;  1F5S A;  1O03 A;  4M2Y A;  1XU4 A;  7ICT A;  1KRP A;  2RQ5 A;  5KT7 A;  3MR2 A;  3D6J A;  1N62 A;  5AIA A;  2PFQ A;  2E5S A;  4F50 A;  5EE1 A;  5ALE A;  4YP3 A;  4LVS A;  4PPX A;  2KVC A;  1HUO A;  3AQF A;  3MBY A;  8ICM A;  1L3U A;  1DRG A;  3JPP A;  3KHH A;  2WAQ C;  3LDA A;  2ASL A;  4ECQ A;  4BUG A;  4EZ6 A;  3CNH A;  4U7C A;  2VA3 A;  1JRO A;  2BPC A;  1JUD A;  5AI5 A;  4JV1 A;  5ALZ A;  1C20 A;  2XY7 A;  4UB1 A;  4O3S A;  4QZF A;  4ELV A;  5KT5 A;  3THV A;  1HEK A;  5ALG A;  2J6U A;  2VJ5 A;  8ICF A;  3EPG A;  1OW5 A;  5J0R A;  3SV3 A;  2UVU A;  1J2N A;  4O5K A;  5IIJ A;  5GTH U;  2DF4 B;  2W9C B;  2MA1 A;  1KTQ A;  5J2E A;  3MGH A;  4EX7 A;  4RT3 A;  4KTQ A;  4DOA A;  8ICE A;  8ICY A;  4ECU A;  2LI6 A;  3GIJ A;  3PW0 A;  5HML A;  2XCP A;  2F2A B;  4GXJ A;  4ECR A;  4YQW A;  5DB6 A;  4NLN A;  3RB4 A;  4O9M A;  4R63 A;  5BOM A;  3TQ1 A;  1S0M A;  1Q3V A;  5JRT A;  3SAG A;  2R8H A;  4ED6 A;  4KLU A;  1Y88 A;  2KHQ A;  4EBE A;  3JPR A;  1J97 A;  2W04 A;  3IDW A;  2E8N A;  4ELT A;  4ED3 A;  4JB3 A;  2PMZ F;  1ZET A;  4UAS A;  4G9B A;  2QB0 A;  3RB3 A;  5KFL A;  2R18 A;  2ZJ5 A;  2OH2 A;  2QAR B;  2G5I B;  1Z00 B;  5KG7 A;  3H40 A;  3SZ2 A;  8ICJ A;  4CGZ A;  2ZTC A;  4GXK A;  1S9F A;  5JTI A;  2HOQ A;  4J9S A;  4RQM A;  4M9H A;  2BCQ A;  1RM6 C;  4CF5 A;  2R8K A;  5ALM A;  2FMS A;  1OUQ A;  5ALQ A;  1SB3 C;  4B9N A;  4XA5 A;  1V97 A;  5KFK A;  4F3O A;  4C4T A;  1N56 A;  4QWC A;  4I2G A;  4DCC A;  3KHL A;  3LVW A;  3AUO A;  2IOH A;  4F5O A;  1V38 A;  5L1K A;  5KFD A;  2VAN A;  2FJ6 A;  2P66 A;  4JV0 A;  4Y2Q A;  1T3Q A;  2P35 A;  4DFJ A;  3AEV A;  4RPX A;  4DFK A;  4UAW A;  7ICV A;  2HVH A;  3KZX A;  3HP6 A;  4J9O A;  3H8S A;  8ICU A;  4F2R A;  5AIB A;  5J2A A;  4BWJ A;  5ALW A;  3PSP A;  1ZQE A;  5T14 A;  4QWB A;  1TAQ A;  4ZH4 A;  2KKP A;  5AM4 A;  1TAU A;  3PV8 A;  2R8G A;  4DS5 A;  5KG3 A;  3MAB A;  1XO0 A;  2OHF A;  2MUT B;  3FM9 A;  3PO4 A;  4ECY A;  4F5R A;  4M9L A;  5DGA A;  2HBL A;  5EE3 A;  3QUT A;  3C28 A;  9ICW A;  2RRD A;  2H3Q A;  4UB2 A;  1N48 A;  1ZQJ A;  3TAQ A;  3RJG A;  3PST A;  2D8C A;  1L7M A;  1ZQW A;  1N5X A;  1U45 A;  4IQT A;  4KN4 A;  4JK1 A;  2EZZ A;  2CXY A;  5ALY A;  4O3P A;  2XY5 A;  3BQ1 A;  4KMU A;  3Q8S B;  4P0P B;  2CRX A;  3LK9 A;  1ZQP A;  3AMZ A;  2YN4 A;  1URJ A;  8ICH A;  4I2F A;  5J0S A;  4PZO A;  1RYU A;  1SL1 A;  3TFS A;  1BGX T;  2KD1 A;  4KMO B;  1JMS A;  4EZ9 A;  1JXL A;  7ICK A;  9ICM A;  2XI9 A;  5KTQ A;  3EWA A;  4F91 B;  3HKZ C;  4EEY A;  2PI5 A;  3M9O B;  1TK0 A;  8ICQ A;  4BJQ A;  1SKS A;  1JI7 A;  4US9 A;  4EEK A;  2R8I A;  2NRX A;  4RT2 A;  3ZD9 A;  4MEY A;  3WK7 A;  2KOB A;  5HR6 A;  4UB8 U;  5IIK A;  1RXV A;  1RDF A;  5KFU A;  2I6X A;  2KSO B;  3HPO A;  5ALJ A;  1TK5 A;  2RDI A;  4MFA A;  2W03 A;  5KAF U;  1CRX A;  3QX7 A;  3VC8 A;  5KFA A;  4ECX A;  1PZN A;  5KFN A;  4RUC A;  2ZIU A;  1XWL A;  5IIN A;  4J9K A;  3SI8 A;  2K4I A;  3WK4 A;  5HHH A;  1KEJ A;  2E3T A;  1JX4 A;  4QZ8 A;  4TUR A;  9ICH A;  1NK0 A;  5ALO A;  3G6X A;  2OWO A;  2WTF A;  2PI4 A;  1EXN A;  1ZXI A;  2OYY A;  4Q45 A;  5KFH A;  1PK1 B;  1LVH A;  2K89 A;  3ICX A;  2LYB A;  1P7D A;  3OHB A;  2AH5 A;  2RHF A;  3NS1 A;  2NRT A;  3KTQ A;  4DSK A;  4EBD A;  5DDY A;  4DLG A;  4DSF A;  4KLL A;  4Z6D A;  1SWW A;  3ETR A;  1XO1 A;  1HIW A;  3F5E A;  4M6W B;  4QZI A;  2G5H B;  7ICJ A;  2KIV A;  1BPE A;  3PR4 A;  3QUC A;  4B9U A;  3D2N A;  1NNL A;  2OEH A;  4EEN A;  9ICQ A;  3OJU A;  2F1H A;  5J2C A;  1FFU A;  3KFU F;  1LKY A;  2JMG A;  4XUS A;  2BCV A;  5AKY A;  1NI3 A;  3SEI A;  4RQ4 A;  5KFW A;  4ED2 A;  4F4K A;  4UQG A;  4BX9 C;  3AN1 A;  3NVV A;  2MU2 A;  4KX3 A;  3C23 A;  4UAV A;  3CYM A;  1KBU A;  2HHQ A;  4CDG A;  3RF9 A;  4KLQ A;  3KBB A;  4P4O A;  4DEZ A;  4UB4 A;  4USA A;  3SR6 A;  4RZR A;  3LYS A;  4PL2 A;  3HKZ F;  4DL6 A;  1ZRM A;  1ZD4 A;  2MAX A;  4J9P A;  4O3N A;  4O5E A;  1Z4N A;  2NV3 A;  2XVT A;  4YMM A;  2BGW A;  4NL9 C;  4DFD A;  1HJP A;  3OSN A;  3RH4 A;  4I2B A;  2F76 X;  2EZY A;  4ECZ A;  1S5L U;  5AI6 A;  3PW5 A;  4FBT A;  1TK8 A;  1DGS A;  2GLE A;  3DDH A;  1ZQF A;  1YT3 A;  1D9F A;  4J9M A;  4J9N A;  2M9N A;  3BS5 A;  1SGG A;  7ICL A;  2HHT A;  9ICR A;  3Q8M A;  2M0N A;  3FAH A;  2RLT A;  1X6J A;  1FFV A;  4QZC A;  2F44 A;  2ES6 A;  1DK3 A;  2DGZ A;  3MR6 A;  1T4G A;  4I2J A;  5ALN A;  4RQ2 A;  2W9B B;  4PL1 A;  5EWE A;  4A8E A;  4Q43 A;  1L7O A;  3ZI4 A;  1PK3 A;  4YR3 A;  3G6Y A;  3WKD A;  4Z6E A;  3C2M A;  2ZUC A;  5ALF A;  4X5V A;  4QZA A;  5KFG A;  2XGP A;  1VJ5 A;  2UVW A;  2F1J A;  4TUQ A;  3H8W A;  3SV4 A;  4UBB A;  5J2K A;  5KG0 A;  5ALK A;  8ICP A;  3RTV A;  1T3N A;  4C4S A;  3NVW A;  8ICX A;  3UPQ A;  3PY8 A;  2P6R A;  1MSW D;  2QKQ A;  1KFS A;  2FLP A;  1ZQI A;  1S76 D;  1O08 A;  1BPY A;  2A1J A;  2EAO A;  4DL5 A;  3K1R B;  2ZG6 A;  4R65 A;  2OM6 A;  4CCH A;  5DBA A;  2ZUD A;  2ZJA A;  5AKK A;  2ZTD A;  5J8Y A;  3QU4 A;  1B0X A;  1NJY A;  3I76 A;  1U49 A;  3OSP A;  2GOL A;  5J2B A;  4TQR A;  1X9X A;  2ZXH A;  3SAF A;  4KLH A;  1NK9 A;  4C8K A;  4UAR A;  3K75 D;  4Y2X A;  4EYH B;  2KKV A;  2QB1 A;  4I2C A;  4ED0 A;  2A19 A;  5AK6 A;  2KIC A;  3L5K A;  5ALI A;  2F8L A;  3F2D A;  2VA8 A;  1NKE A;  4TUS A;  1CUK A;  4B9T A;  2XO7 A;  1A77 A;  3MDA A;  1SXD A;  1SV0 A;  4IR9 A;  1DXS A;  1NZP A;  1TFR A;  4FS2 A;  4B9M A;  3ED5 A;  1BPD A;  3NVY A;  4R8U A;  2HVI A;  2AXT U;  4ELU A;  9ICE A;  5KFV A;  9ICL A;  4TUP A;  2ISO A;  2JEG A;  1V85 A;  3A0H U;  1ZQR A;  4GFJ A;  1ZRN A;  2QB0 B;  5J0O A;  2ZJ8 A;  3E2E A;  4M9N A;  2JEF A;  2ZUB A;  2D3D A;  4NJ8 A;  4P4M A;  4HAI A;  4F4W A;  1B22 A;  3AM9 A;  1ZQL A;  4C4R A;  3EW9 A;  2JR5 A;  3HIL A;  5A0L A;  3CW2 C;  1ZD2 P;  1ZQM A;  3RAX A;  3TAD A;  1NK5 A;  9ICF A;  4P0Q B;  3HRD D;  2W9M A;  1UHU A;  2WF8 A;  5L1M A;  2ATL A;  4TQS A;  5IIO A;  2BKE A;  2BDU A;  3QU7 A;  3AL0 B;  2HSZ A;  1Q8K A;  5III A;  2GWS A;  1SKR A;  1BVS A;  3WKB A;  1NJZ A;  4NWI A;  3NGD A;  3K4G A;  2ZIX A;  5J0W A;  1WCN A;  2H3I A;  3RBE A;  3Q8L A;  1D8B A;  3TKA A;  2QLT A;  3KKA A;  1ZQ1 C;  3C29 A;  2C2R A;  7ICP A;  3PVX A;  3BJY A;  3RRH A;  1X9M A;  2BHN A;  3E0F A;  4PGY A;  2JZB A;  4BWM A;  2H3Z A;  2FMQ A;  2BPG A;  8ICS A;  7ICH A;  5F9N A;  2HBK A;  3QU9 A;  2KJ8 A;  3C2L A;  3RH5 A;  4Y2P A;  4JMU A;  4UAT A;  1XSL A;  3IM1 A;  5CHG A;  2OCE A;  8ICO A;  1NOM A;  5KFT A;  4QNL A;  3PX0 A;  4QJF B;  3TAR A;  2HHS A;  1BNP A;  3SYZ A;  3QUB A;  4OO1 J;  1ZQO A;  4Y2Y A;  2WB1 C;  3IN5 A;  4QZB A;  2BDP A;  3F5A A;  4J03 A;  1S10 A;  2WHE A;  1ZQK A;  1SL2 A;  3QU2 A;  4CNQ A;  1ZQT A;  5D49 A;  4C8M A;  2P6U A;  3RJH A;  3CRX A;  1MC8 A;  4F5Q A;  7ICU A;  3S6J A;  3RJK A;  3N4M B;  3M8R A;  5J2J A;  2W55 A;  3H7I A;  1L8L A;  4IQW A;  1SZP A;  4FE3 A;  3GV8 B;  5KG6 A;  4ED8 A;  3GIM A;  4GC7 A;  2CPR A;  3MC1 A;  2WAQ F;  3T3F A;  4QZD A;  2ZIW B;  1MA7 A;  4RQ8 A;  1MQ2 A;  2Q4T A;  2C22 A;  2PXI A;  2JEJ A;  4YD1 A;  2JH1 A;  1L3T A;  1DK2 A;  4F72 A;  2KP7 A;  3ISB A;  5KL8 B;  2YMQ A;  5J8Y C;  3QEB Z;  5AKE A;  2FLN A;  2BQR A;  1SL0 A;  2DWQ A;  2KVS A;  2DPJ A;  2JGA A;  2ZIU B;  4BDP A;  8ICC A;  4IC9 A;  4O3Q A;  2BPF A;  2BCR A;  2W8K A;  2LHT A;  3GQC A;  3QEA Z;  1XNS A;  1WWU A;  4NY8 A;  3QYP A;  1RPL A;  5J0P A;  1FO4 A;  2W9C A;  3UMC A;  2DQN B;  2VKQ A;  2A1A A;  1ZJM A;  3OTQ A;  1X9S A;  1U47 A;  1T94 A;  4FBU A;  5AI4 A;  3ONN A;  1X42 A;  5AIC A;  3RH6 A;  1KLN A;  2VA2 A;  2HOI A;  5AKH A;  5JU5 A;  4C8N A;  1KDH A;  2IA6 A;  4O3M A;  5KG2 A;  2KE7 A;  5DQI A;  1N63 A;  2DL0 A;  1C7Y A;  4MFF A;  4Q8F A;  1BPZ A;  4UAY A;  3H4B A;  3BQ0 A;  5ALL A;  4F4Z A;  2W11 A;  4B9L A;  1SV4 A;  1TV9 A;  3HWT A;  1WWV A;  3KD3 A;  4GC6 A;  2JEI A;  4CF3 A;  1K1Q A;  3H0R B;  2YTU A;  1ZQV A;  4O3O A;  1LKY B;  5F9L A;  2A3V A;  5DB8 A;  4YCX A;  3ZD8 A;  1QSY A;  5B5E U;  9ICJ A;  4QWE A;  9ICV A;  2QAR A;  5G5G A;  4M47 A;  1Z00 A;  3KHG A;  4IQV A;  4ZOH C;  4C8L A;  4B9V A;  4NLC A;  1IV8 A;  4DSE A;  5AKL A;  4I29 A;  5AKZ A;  4KLF A;  2HMX A;  2LPE A;  4ACO A;  3F53 A;  1ARO P;  4CF4 A;  5KT2 A;  4M9G A;  2O6K A;  5AM3 A;  1NK8 A;  3WKA A;  7ICG A;  4C7Y A;  5BOL A;  7ICO A;  2LYA A;  3WKC A;  2W54 A;  9ICB A;  1NJW A;  4QZG A;  3MDC A;  4F8R A;  3NTU A;  2PFP A;  4IRD A;  5ALT A;  8ICN A;  2E1E A;  3BS5 B;  1COO A;  1QLN A;  1PUZ A;  4DL4 A;  4YXM A;  2AQ4 A;  5E79 U;  3GDX A;  1QQ7 A;  4M0A A;  5DBB A;  4DFP A;  5AM5 A;  4ECV A;  3ZDD A;  3C1Z A;  1F0M A;  9ICS A;  2FDR A;  4K4I A;  7ICN A;  3T5L A;  2FLL A;  1TKD A;  1KN5 A;  4EEL A;  3EYZ A;  4DQQ A;  1UQV A;  2I5H A;  4OJO A;  7ICF A;  4F92 B;  2FE9 A;  3T5K A;  2ASJ A;  4RQ1 A;  3QZ8 A;  4LZG A;  5KL1 B;  3Q8Q B;  5KT6 A;  5EE9 A;  3V6H A;  4I28 A;  3BQ7 A;  3UQ0 A;  2W9A A;  3PW7 A;  1A6S A;  4P2H A;  2HHV A;  4RNN A;  2KJ5 A;  2KNJ A;  1XSP A;  9ICT A;  5EWF A;  3GIK A;  2AGQ A;  4M04 A;  4UB6 U;  4RNO A;  4P0P A;  2F8K A;  3K1Z A;  4RQN A;  4QZH A;  3Q8K A;  3QUQ A;  1XC9 A;  3C21 A;  2K4P A;  5AK3 A;  2YY6 A;  5EE0 A;  4KLT A;  1RQN A;  1S77 D;  2HHW A;  1RQL A;  1S8O A;  5CB1 A;  4EYI B;  3H8M A;  3ZDB A;  3OGU A;  5DG9 A;  3SMV A;  1Z4O A;  2PKE A;  4P4P A;  8ICK A;  2DBY A;  1U48 A;  3NUQ A;  5CEH A;  5ALX A;  3M9N B;  5L9X A;  1X6I A;  2XID A;  1RZT A;  2JRZ A;  5HR7 A;  1KQQ A;  5DGB A;  5J0Q A;  3LWM A;  1L7N A;  2Y9T A;  5J29 A;  3WK9 A;  4KLM A;  3I28 A;  3DV9 A;  1NK4 A;  2KSO A;  1RXW A;  2LBO A;  3Q8R B;  2EQY A;  5AI0 A;  5J2D A;  3J81 j;  5L1J A;  1SWV A;  1BNO A;  2YX8 A;  5ALP A;  4RPY A;  2G0A A;  4UB3 A;  3PO5 A;  2NYV A;  3T5H A;  2G07 A;  4Y2U A;  4F4X A;  4KLO A;  2Y1J A;  1X9W A;  1Z1B A;  4DQI A;  4IS7 A;  4DSI A;  5C0Y A;  4NM2 A;  4QWA A;  2HBM A;  4UBC A;  4YXJ A;  4F4Y A;  3TAP A;  2RDJ A;  2KG5 A;  4I2H A;  2H3F A;  3UXP A;  2V9W A;  4I2I A;  4FZM A;  4IQU A;  4WJ3 B;  3SAH A;  5KFP A;  2L5Y A;  3PX4 A;  4YMN A;  2JHD A;  4F71 A;  3H8J A;  3QZ7 A;  1M6Y A;  3GII A;  1XS9 D;  4R64 A;  3LWL A;  5J0Y A;  1HUZ A;  3ALR A;  2Y1I A;  1TAM A;  2KZZ A;  2KZM A;  5DG7 A;  2KMD A;  4M6W A;  1L3V A;  3BS7 A;  1KW4 A;  2LM1 A;  4HYK A;  1ZQC A;  4Y2V A;  5HHI A;  3NAS A;  4YG2 A;  4BXO A;  1SXE A;  5DLF A;  3WK8 A;  2EAM A;  1TVA A;  4ECW A;  2GH1 A;  2Y0S C;  2DKZ A;  5EWG A;  1PVQ A;  3GZF A;  2KHV A;  5DBC A;  3G6V A;  2HOF A;  1V9P A;  5KFX A;  2ZIX B;  4K4H A;  3N7P D;  4YFK A;  3BDP A;  1SZH A;  4MF8 A;  4QW9 A;  3OHA A;  2J6T A;  2G08 A;  1D8L A;  5KFM A;  2YB4 A;  2HHX A;  2JH7 A;  2LM4 A;  2DFL A;  1S97 A;  1UA1 A;  2D6F C;  4RPZ A;  2ALZ A;  1KSP A;  2FMP A;  1RG6 A;  4KIT B;  5J0T A;  5TIS U;  1ZD5 A;  4Y2J A;  1ZD3 A;  3PSF A;  5KFR A;  4OJ5 A;  2W43 A;  1LV5 A;  3BQT A;  1SIJ A;  3WU2 U;  1Z19 A;  8ICV A;  1COK A;  1IG6 A;  5CRX A;  4Z6F A;  1QQ5 A;  3IV6 A;  5B66 U;  1TE2 A;  3L3F X;  5ALS A;  2Z7J A;  2AGP A;  2XIC A;  4UW9 A;  5AKX A;  2UVV A;  3RJJ A;  4DSL A;  1FIQ A;  2BZF A;  2LYH A;  4DO9 A;  5KFB A;  3JPT A;  5AK5 A;  3IHQ B;  2ZIV A;  3I1Y A;  3V7L A;  1UA0 A;  2ZXI A;  1U4B A;  5L1I A;  2W3S A;  4QW8 A;  2WFA A;  1NK6 A;  3RJF A;  3IP4 B;  2XCA A;  4XRH A;  3PW4 A;  3NVZ A;  5DG8 A;  2AHO B;  4RQ7 A;  5HMM A;  2FPK A;  3UXN A;  3HT3 A;  4DQS A;  4KLI A;  3A0B U;  4GXI A;  2MRL A;  1UT5 A;  5D46 A;  2LKY A;  2YML A;  1YZ6 A;  2UVR A;  2BQU A;  5GTI U;  4NM1 A;  1X40 A;  5DDM A;  2K8C B;  1CI4 A;  4DFM A;  1ZQU A;  1S0V A;  3PR5 B;  3GU3 A;  3QU5 A;  4BGD A;  1CEZ A;  2KFZ A;  3HJE A;  4KLG A;  5ALU A;  2J6S A;  2B6G A;  2Y0S F;  5DKW A;  3JPQ A;  3ORY A;  4YN4 A;  1A0P A;  5DB9 A;  2KIW A;  3F2B A;  1D9D A;  1IXR A;  2KTQ A;  1X66 A;  1ZQG A;  1QSS A;  3PMN A;  4K4G A;  5TZV A;  5KNI A;  3MGV A;  3N28 A;  4PGX A;  3TFR A;  5ALH A;  4PZN A;  2K8A A;  1ZQH A;  8ICG A;  1MQ3 A;  3EPI A;  2KZ3 A;  5EOZ A;  3V6K A;  4Z6C A;  4O3R A;  3V7J A;  4DQR A;  4FZL A;  4RU9 A;  4B9S A;  8ICB A;  5CA7 A;  3PNC A;  3GIL A;  5KFS A;  2FPL A;  3WKE A;  1YZ7 A;  1J2M A;  2Y9U A;  4LJX A;  1PVP A;  2ZTE A;  4DWI A;  4ICA A;  2EAP A;  1L3S A;  4DF4 A;  4IRC A;  2LMR A;  2DPI A;  1VDV A;  1F44 A;  2NRZ A;  2WF5 A;  2ODG A;  3SD7 A;  1VLB A;  2C2E A;  1T8E A;  2BQ3 A;  4EBC A;  2DKX A;  4UAZ A;  2XC9 A;  4PHA A;  4F5P A;  4OD0 A;  3TAN A;  9ICC A;  1NKB A;  3FYH A;  4OJ6 A;  3EZ5 A;  2DUY A;  3E58 A;  4DL3 A;  4IL6 U;  2E8P A;  2YMP A;  1GO3 F;  3Q8P B;  4DOC A;  2W3R A;  5AHX A;  4ECT A;  3M6Z A;  4MEX A;  4AYB C;  5AM1 A;  1QH9 A;  4P0Q A;  5CWR A;  3ZDA A;  1KFD A;  8ICT A;  3WK6 A;  1QSL A;  2F1I A;  9ICX A;  2E8M A;  9ICP A;  2B21 A;  5KT4 A;  4PJ0 U;  3JPN A;  4ED7 A;  3JPS A;  3RB6 A;  4I2E A;  3RRG A;  8ICR A;  5C5J A;  5KG5 A;  5ALR A;  4Q44 A;  3WK5 A;  5CJ7 A;  2BCU A;  1JIH A;  3FC4 A;  2BR0 A;  4MF2 A;  8ICI A;  1L8O A;  3UM9 A;  5AM2 A;  1ECW A;  2C2D A;  4NL9 A;  1UCV A;  4Y2T A;  1SV0 C;  1A76 A;  3N7R C;  1ZQQ A;  3H4D A;  3CP8 A;  2JV3 A;  4R66 A;  4FS1 A;  1KL9 A;  4AP9 A;  1MN8 A;  3RR8 A;  2ESE A;  4YR0 A;  1RYS A;  3MFH A;  4KLE A;  4UAU A;  5KG4 A;  3TAC B;  4Y2R A;  5KFC A;  2VJ4 A;  2GO7 A;  3NRZ A;  3PX6 A;  4E0D A;  2WB1 F;  4LZD A;  3QXG A;  5AKI A;  3LVV A;  5DLG A;  4GIB A;  1IIP A;  3T79 A;  1ZQN A;  3M8S A;  4I2A A;  1ZQB A;  5AKG A;  3H0L B;  3M1Y A;  7ICS A;  2HHU A;  5J2G A;  3TI0 A;  3TAD C;  4PHD A;  2F77 X;  4US8 A;  2FPM A;  2JXJ A;  2R8J A;  4B6J A;  3MGI A;  2KJ9 A;  5L1L A;  5G5H A;  3KZI U;  3UMG A;  2EAN A;  3EUB 2;  1ZJN A;  1NKC A;  2NRW A;  4DF8 A;  4F5N A;  4KN7 A;  3RJI A;  4RNM A;  4OCZ A;  3MFI A;  9ICU A;  4FFD A;  1ZQX A;  5J2F A;  4DSJ A;  8ICL A;  1L7P A;  3GFK B;  5JUM A;  5HP4 A;  5CR0 A;  4NLK A;  2AJQ A;  4RQ6 A;  4NV0 A;  3KKA C;  8ICW A;  4YMO A;  4DS4 A;  1B4F A;  4DQP A;  4J9L A;  2BCS A;  4C7Z A;  2ZIW A;  1ZYQ A;  5DQH A;  3HW8 A;  4AYB F;  3ISD A;  2IHM A;  2K8B B;  1IM4 A;  1NJX A;  1DGJ A;  3BZC A;  2IMW P;  1Z3E B;  5KFO A;  4J9Q A;  5KFF A;  3AU6 A;  4MHV A;  4QZ9 A;  4J9R A;  2AU0 A;  5AI9 A;  1N60 A;  2KEY A;  5CP2 A;  4C80 A;  4EX6 A;  3D2Q A;  4NLG A;  1FEZ A;  2B0C A;  2H3V A;  4NLB A;  2HI0 A;  5KT3 A;  3GV5 B;  1ED1 A;  3PZP A;  4FZN A;  1ZQY A;  3RBD A;  3OJS A;  3C5F A;  2HBJ A;  4C0Z A;  1PVR A;  3T5J A;  2F3N A;  1L6N A;  3B0Y A;  2WF9 A;  3JPO A;  1WCL A;  2MUT A;  1JAL A;  1D8Y A;  3HX0 A;  4C8O A;  3F2C A;  7ICM A;  2E8O A;  4RQ5 A;  5KFE A;  2IOF A;  3M6K A;  4O5C A;  3RJE A;  7ICR A;  5ALV A;  5KFZ A;  2E1F A;  3R9K A;  4RQ0 A;  4CRX A;  1S0O A;  2YQE A;  4MFC A;  2PFN A;  5D4B A;  4KLJ A;  4YVZ A;  2V4Q A;  4F2S A;  4JWM A;  3M9M B;  4NLZ A;  1OXJ A;  2G09 A;  1B43 A;  2NO5 A;  9ICK A;  2V4R A;  2WF6 A;  5AKJ A;  4DL2 A;  3PW2 A;  5HNK A;  3RR7 A;  4BXO B;  3RFA A;  1DOQ A;  3B0X A;  2NRV A;  1JRP A;  3N7S C;  1Q3U A;  7ICI A;  1NZB A;  3V7K A;  5KFI A;  2A1J B;  4I2D A;  1T7P A;  2KN7 A;  9ICN A;  5FP0 A;  4QZE A;  4PGQ A;  3C1Y A;  4DLE A;  3UQ2 A;  5IIM A;  9ICO A;  2C28 A;  1ZOL A;  1K5O A;  4OJP A;  2ASD A;  2WF7 A;  3B9J A;  4CE6 A;  4RQ3 A;  5H2F U;  1ZQS A;  4IR1 A;  2KK0 A;  2AQ0 A;  2W8L A;  1U9L A;  2YB1 A;  2CN1 A;  1WUD A;  4Y2S A;  1QTM A;  2FI1 A;  5BPC A;  1ZQA A;  2K4H A;  3SQI A;  4XQ8 A;  3V6J A;  4ECS A;  2EDU A;  3VCB A;  3ETL A;  4PH5 A;  1LB2 B;  4QIW C;  5KG1 A;  1N61 A;  1N2X A;  1Z1V A;  1Q46 A;  5K4L A;  4Q8E A;  1KKX A;  1SKW A;  2ISP A;  4KX5 A;  3RAQ A;  1QQ6 A;  3MR3 A;  2XY6 A;  3C5G A;  4IRK A;  3FDS A;  3L4P A;  4O0I A;  3NRW A;  3O0F A;  2N1R A;  2RP5 A;  1RYR A;  3BQ2 A;  1KFT A;  4R8U B;  4JWN A;  1PK1 A;  5DB7 A;  3C2K A;  2KFN A;  3IG8 A;  2XGQ A;  5IIL A;  4GLX A;  4OJL A;  4KLS A;  1ZQZ A;  4JV2 A;  2VIX A;  2IBK A;  5KFJ A;  1XSN A;  2KV2 A;  2ZIV B;  9ICG A;  2EH9 A;  3N97 B;  2AGO A;  1S0N A;  4PHP A;  2PFO A;  5F3X B;  3MR5 A;  3BZK A;  2HDO A;  4UB5 A;  5KFY A;  3PML A;  1AQ6 A;  4DL7 A;  1K1S A;  3RB0 A;  5KFQ A;  2K60 A;  4YD2 A; 
#chains in the Genus database with same CATH homology
 1JN3 A;  1RPL A;  5J0P A;  3ORY A;  4YN4 A;  1XO1 A;  2IHN A;  5DB9 A;  2W9C A;  8ICA A;  1NK7 A;  1ZJM A;  4M6W B;  4QZI A;  4KLD A;  7ICJ A;  1BPE A;  3PR4 A;  1X9S A;  1D9D A;  1U47 A;  1IXR A;  4F93 B;  4B9U A;  4FBU A;  2KTQ A;  4PHE A;  1ZQG A;  2Q0Z X;  3RH6 A;  1QSS A;  1KLN A;  2VA2 A;  3PMN A;  3QE9 Y;  4K4G A;  5TZV A;  9ICQ A;  3OJU A;  4PGX A;  2F1H A;  5J2C A;  4C8N A;  5J0X A;  3TFR A;  1KDH A;  1ZQD A;  2IA6 A;  2HW3 A;  5KG2 A;  4ED1 A;  5DQI A;  4XUS A;  5J2I A;  1ZQH A;  2BCV A;  3ZDC A;  8ICG A;  8ICZ A;  4RQ4 A;  5KFW A;  1C7Y A;  4ED2 A;  1MQ3 A;  4MFF A;  4Q8F A;  1BPZ A;  4UAY A;  3H4B A;  3EPI A;  3BQ0 A;  4F4K A;  4UQG A;  2KZ3 A;  1UT8 A;  4YR2 A;  1BPB A;  5EOZ A;  2JZB B;  4F4Z A;  3V6K A;  4M9J A;  4Z6C A;  4O3R A;  4B9L A;  3C23 A;  3V7J A;  4DQR A;  4RU9 A;  4QWD A;  4RUA A;  3HWT A;  1TV9 A;  4B9S A;  8ICB A;  1BPX A;  3ISC A;  4GC6 A;  9ICA A;  2JEI A;  2HHQ A;  4KLQ A;  5CA7 A;  1K1Q A;  3PNC A;  3ZDE A;  3GIL A;  5J2H A;  4P4O A;  4DEZ A;  4UB4 A;  1ZQV A;  4O3O A;  5KFS A;  4RZR A;  2FPL A;  5F9L A;  2I9G A;  1L5U A;  5DB8 A;  4YCX A;  1H38 A;  3ZD8 A;  1QSY A;  4DL6 A;  4G3I A;  9ICJ A;  2ZTE A;  4DWI A;  4I27 A;  2MAX A;  4J9P A;  4O3N A;  1X2I A;  3GV7 B;  4O5E A;  2I1Q A;  4QWE A;  1L3S A;  4DF4 A;  9ICV A;  4M47 A;  4YMM A;  4IRC A;  1Z00 A;  2BGW A;  2DPI A;  9ICI A;  3KHG A;  4JUZ A;  4IQV A;  1HJP A;  4C8L A;  4B9V A;  3OSN A;  3RH4 A;  4I2B A;  2NRZ A;  3UXO A;  4DOB A;  4DSE A;  7ICE A;  2C2E A;  4I29 A;  4ECZ A;  4FO6 A;  4KLF A;  3PW5 A;  1T8E A;  3AU2 A;  2BQ3 A;  1ARO P;  4FBT A;  5KT2 A;  4EBC A;  3V72 A;  1JXE A;  4M9G A;  4UAZ A;  2XC9 A;  4PHA A;  4F5P A;  1TK8 A;  1DGS A;  4NXZ A;  1ZQF A;  1NK8 A;  3TAN A;  9ICC A;  1NKB A;  1D9F A;  5DQG A;  4J9M A;  3FYH A;  4J9N A;  7ICG A;  7ICQ A;  2W9B A;  3EZ5 A;  2M9N A;  7ICL A;  4DL3 A;  3KHR A;  2H5X A;  2HHT A;  4KLJ A;  5J0U A;  5BOL A;  3Q8P B;  7ICO A;  4DOC A;  9ICR A;  3Q8M A;  4M2Y A;  1XU4 A;  9ICB A;  7ICT A;  4QZC A;  1NJW A;  4ECT A;  1KRP A;  4QZG A;  5KT7 A;  3MR2 A;  3MDC A;  4MEX A;  4F8R A;  3NTU A;  2PFP A;  2PFQ A;  4IRD A;  3MR6 A;  1T4G A;  5CWR A;  1KFD A;  4F50 A;  3ZDA A;  8ICN A;  8ICT A;  4YP3 A;  1QSL A;  2F1I A;  4LVS A;  9ICX A;  4I2J A;  4RQ2 A;  2W9B B;  4PPX A;  9ICP A;  2B21 A;  1COO A;  5KT4 A;  1HUO A;  3JPN A;  1QLN A;  4DL4 A;  4YXM A;  2AQ4 A;  5EWE A;  4ED7 A;  4Q43 A;  3JPS A;  3MBY A;  3GDX A;  8ICM A;  4M0A A;  3RB6 A;  5DBB A;  4I2E A;  4DFP A;  1L3U A;  3JPP A;  3KHH A;  4ECV A;  3RRG A;  8ICR A;  3ZDD A;  4YR3 A;  3G6Y A;  3LDA A;  5C5J A;  5KG5 A;  2ASL A;  4ECQ A;  3C1Z A;  4Z6E A;  3C2M A;  2ZUC A;  4Q44 A;  4X5V A;  5CJ7 A;  2BCU A;  4QZA A;  4EZ6 A;  5KFG A;  9ICS A;  2XGP A;  1JIH A;  4K4I A;  2BR0 A;  2UVW A;  2VA3 A;  4MF2 A;  8ICI A;  7ICN A;  2F1J A;  4TUQ A;  3T5L A;  2FLL A;  3H8W A;  2BPC A;  1TKD A;  3SV4 A;  4JV1 A;  4UBB A;  2C2D A;  3EYZ A;  5J2K A;  2XY7 A;  4UB1 A;  5KG0 A;  4DQQ A;  4O3S A;  8ICP A;  1A76 A;  3RTV A;  1ZQO A;  1ZQQ A;  1T3N A;  4QZF A;  3H4D A;  4ELV A;  5KT5 A;  3THV A;  7ICF A;  4F92 B;  4R66 A;  4FS1 A;  3T5K A;  2ASJ A;  4RQ1 A;  8ICX A;  3QZ8 A;  2J6U A;  4LZG A;  3UPQ A;  3RR8 A;  8ICF A;  3EPG A;  4YR0 A;  1RYS A;  3MFH A;  3PY8 A;  4KLE A;  5KG4 A;  3Q8Q B;  2P6R A;  1MSW D;  1KFS A;  5KT6 A;  5J0R A;  3SV3 A;  5KFC A;  3V6H A;  2UVU A;  2FLP A;  1ZQI A;  4I28 A;  3UQ0 A;  2W9A A;  4O5K A;  3PX6 A;  3PW7 A;  1BPY A;  1S76 D;  5IIJ A;  4P2H A;  4E0D A;  2HHV A;  2A1J A;  4RNN A;  4LZD A;  2W9C B;  1KTQ A;  5J2E A;  1XSP A;  3MGH A;  9ICT A;  5EWF A;  4RT3 A;  3GIK A;  4DL5 A;  5DLG A;  2AGQ A;  4KTQ A;  4DOA A;  4M04 A;  8ICE A;  8ICY A;  4ECU A;  4R65 A;  4CCH A;  4RNO A;  5DBA A;  3GIJ A;  3PW0 A;  5HML A;  2XCP A;  4QZH A;  1ZQN A;  4GXJ A;  3Q8K A;  2ZUD A;  1XC9 A;  4ECR A;  4YQW A;  5DB6 A;  3M8S A;  1ZQB A;  4I2A A;  2ZJA A;  3C21 A;  4NLN A;  2ZTD A;  7ICS A;  2HHU A;  3RB4 A;  5J2G A;  3TI0 A;  4O9M A;  4PHD A;  4R63 A;  4KLT A;  1NJY A;  1U49 A;  3OSP A;  1S77 D;  2HHW A;  2FPM A;  5J2B A;  5CB1 A;  5BOM A;  4TQR A;  3TQ1 A;  1S0M A;  4EYI B;  2R8J A;  3MGI A;  3ZDB A;  5L1L A;  3OGU A;  2R8H A;  4ED6 A;  5DG9 A;  4KLU A;  4KLH A;  1NK9 A;  1ZJN A;  4C8K A;  1Y88 A;  4P4P A;  1NKC A;  2NRW A;  3K75 D;  4EBE A;  4DF8 A;  8ICK A;  4EYH B;  3JPR A;  1U48 A;  4F5N A;  4KN7 A;  3RJI A;  3M9N B;  5L9X A;  4ELT A;  1RZT A;  4I2C A;  4ED0 A;  4RNM A;  4ED3 A;  5DGB A;  5J0Q A;  3MFI A;  9ICU A;  3LWM A;  1ZQX A;  5J2F A;  4DSJ A;  8ICL A;  1ZET A;  2VA8 A;  3GFK B;  5JUM A;  1NKE A;  5J29 A;  1CUK A;  4TUS A;  5HP4 A;  4B9T A;  5CR0 A;  4NLK A;  4KLM A;  2XO7 A;  3RB3 A;  1A77 A;  5KFL A;  2AJQ A;  3MDA A;  4RQ6 A;  1NK4 A;  4IR9 A;  1RXW A;  2ZJ5 A;  3Q8R B;  4YMO A;  4DS4 A;  8ICW A;  1TFR A;  4FS2 A;  4DQP A;  4J9L A;  2BCS A;  3H40 A;  1Z00 B;  5KG7 A;  5J2D A;  4B9M A;  3SZ2 A;  8ICJ A;  5L1J A;  2ZTC A;  4GXK A;  1S9F A;  1BPD A;  4RPY A;  4J9S A;  2HVI A;  4R8U A;  1ZYQ A;  4M9H A;  5DQH A;  3HW8 A;  3ISD A;  2BCQ A;  4UB3 A;  3PO5 A;  3T5H A;  2IHM A;  4ELU A;  9ICE A;  5KFV A;  2R8K A;  9ICL A;  4TUP A;  2ISO A;  2JEG A;  1ZQR A;  1IM4 A;  1NJX A;  4F4X A;  2FMS A;  4KLO A;  5J0O A;  2Y1J A;  1X9W A;  2IMW P;  2ZJ8 A;  1Z3E B;  5KFO A;  4J9Q A;  5KFF A;  3AU6 A;  4DQI A;  4DSI A;  3E2E A;  4B9N A;  4QZ9 A;  4XA5 A;  4M9N A;  2JEF A;  4J9R A;  4NM2 A;  2ZUB A;  5KFK A;  4F3O A;  4P4M A;  4F4W A;  1B22 A;  1N56 A;  4QWA A;  4UBC A;  4QWC A;  3KHL A;  2AU0 A;  4I2G A;  4YXJ A;  4F4Y A;  1ZQL A;  5CP2 A;  3TAP A;  3AUO A;  2RDJ A;  4NLG A;  3EW9 A;  4F5O A;  4I2H A;  3UXP A;  2V9W A;  5L1K A;  4I2I A;  4IQU A;  5KFP A;  5KFD A;  5KT3 A;  1ZQM A;  3GV5 B;  3RAX A;  1NK5 A;  2VAN A;  2P66 A;  4JV0 A;  9ICF A;  3PX4 A;  1ZQY A;  3RBD A;  4YMN A;  3OJS A;  2W9M A;  3C5F A;  4DFJ A;  3H8J A;  3QZ7 A;  3GII A;  3T5J A;  2ATL A;  4RPX A;  4DFK A;  1XS9 D;  4TQS A;  4UAW A;  4R64 A;  3B0Y A;  3LWL A;  5IIO A;  5J0Y A;  2BKE A;  1HUZ A;  2Y1I A;  7ICV A;  2HVH A;  3JPO A;  5III A;  1WCL A;  2MUT A;  3HP6 A;  2KZZ A;  2KZM A;  4J9O A;  3H8S A;  5DG7 A;  2GWS A;  4M6W A;  8ICU A;  1D8Y A;  1L3V A;  1SKR A;  1BVS A;  4F2R A;  3HX0 A;  1NJZ A;  4C8O A;  5J2A A;  3NGD A;  7ICM A;  4BWJ A;  3K4G A;  4RQ5 A;  4HYK A;  5J0W A;  5KFE A;  1ZQC A;  1WCN A;  1ZQE A;  4QWB A;  1TAQ A;  5HHI A;  3RBE A;  3Q8L A;  4ZH4 A;  4O5C A;  3RJE A;  4YG2 A;  4BXO A;  1TAU A;  7ICR A;  5KFZ A;  3PV8 A;  2R8G A;  5DLF A;  4RQ0 A;  4DS5 A;  1S0O A;  5KG3 A;  1TVA A;  4ECW A;  2C2R A;  7ICP A;  3MAB A;  3PVX A;  4MFC A;  5EWG A;  2PFN A;  5D4B A;  3BJY A;  4YVZ A;  2MUT B;  2V4Q A;  3RRH A;  1X9M A;  3PO4 A;  4ECY A;  4F2S A;  4JWM A;  2BHN A;  3M9M B;  4F5R A;  4NLZ A;  4PGY A;  4M9L A;  2JZB A;  4BWM A;  5DBC A;  2FMQ A;  2BPG A;  5DGA A;  1B43 A;  3G6V A;  1V9P A;  7ICH A;  8ICS A;  9ICK A;  5KFX A;  5F9N A;  3C2L A;  2V4R A;  4K4H A;  3RH5 A;  4YFK A;  3BDP A;  4MF8 A;  4QW9 A;  3OHA A;  4DL2 A;  1XSL A;  3PW2 A;  5HNK A;  3RR7 A;  2J6T A;  4BXO B;  1S97 A;  3IM1 A;  5CHG A;  8ICO A;  9ICW A;  1DOQ A;  1D8L A;  1NOM A;  2NRV A;  3B0X A;  5KFT A;  5KFM A;  4UB2 A;  3PX0 A;  1N48 A;  1ZQJ A;  7ICI A;  3TAQ A;  3RJG A;  3V7K A;  3TAR A;  2HHX A;  5KFI A;  2HHS A;  2A1J B;  4I2D A;  1T7P A;  2KN7 A;  3SYZ A;  9ICN A;  1ZQW A;  4QZE A;  2DFL A;  4IQT A;  4KN4 A;  3C1Y A;  4JK1 A;  4PGQ A;  4DLE A;  1UA1 A;  1U45 A;  4RPZ A;  3UQ2 A;  5IIM A;  9ICO A;  2ALZ A;  1KSP A;  2C28 A;  2FMP A;  4O3P A;  2XY5 A;  3BQ1 A;  4KMU A;  4KIT B;  3Q8S B;  4QZB A;  2ASD A;  5J0T A;  3LK9 A;  2BDP A;  1ZQP A;  4RQ3 A;  1S10 A;  1ZQS A;  8ICH A;  4I2F A;  4IR1 A;  5J0S A;  5KFR A;  2AQ0 A;  2W8L A;  1SL1 A;  3TFS A;  1U9L A;  1ZQK A;  1SL2 A;  1BGX T;  1QTM A;  1LV5 A;  3BQT A;  1ZQT A;  5BPC A;  1ZQA A;  1JMS A;  4EZ9 A;  1JXL A;  7ICK A;  5D49 A;  9ICM A;  5KTQ A;  4XQ8 A;  3EWA A;  4F91 B;  4C8M A;  2P6U A;  3RJH A;  8ICV A;  3V6J A;  4EEY A;  4ECS A;  3ETL A;  4Z6F A;  1MC8 A;  2PI5 A;  4PH5 A;  3M9O B;  1LB2 B;  4F5Q A;  7ICU A;  5KG1 A;  1TK0 A;  8ICQ A;  1SKS A;  4Q8E A;  2R8I A;  3RJK A;  2NRX A;  2AGP A;  4RT2 A;  3N4M B;  3ZD9 A;  4MEY A;  2UVV A;  1SKW A;  2ISP A;  3M8R A;  5J2J A;  3RJJ A;  4DSL A;  3RAQ A;  3MR3 A;  2XY6 A;  3C5G A;  3H7I A;  4IQW A;  5IIK A;  4IRK A;  1SZP A;  2LYH A;  3GV8 B;  3FDS A;  4DO9 A;  5KFB A;  4O0I A;  3JPT A;  1RXV A;  3IHQ B;  5KFU A;  5KG6 A;  4ED8 A;  3HPO A;  3GIM A;  1TK5 A;  4GC7 A;  3V7L A;  2RDI A;  1RYR A;  1UA0 A;  3BQ2 A;  4MFA A;  1U4B A;  5L1I A;  3T3F A;  1KFT A;  5KFA A;  4QZD A;  4R8U B;  4QW8 A;  1NK6 A;  4JWN A;  3RJF A;  2XCA A;  4ECX A;  1PZN A;  4XRH A;  5DB7 A;  4RQ8 A;  3PW4 A;  5DG8 A;  1MQ2 A;  4RQ7 A;  3C2K A;  5HMM A;  5KFN A;  4RUC A;  2XGQ A;  2KFN A;  1XWL A;  2FPK A;  2PXI A;  5IIL A;  2C22 A;  3UXN A;  5IIN A;  2JEJ A;  4J9K A;  4GLX A;  3HT3 A;  4DQS A;  3SI8 A;  4KLI A;  4KLS A;  1ZQZ A;  4GXI A;  4YD1 A;  4JV2 A;  5HHH A;  1L3T A;  1UT5 A;  1KEJ A;  5D46 A;  2IBK A;  1JX4 A;  5KFJ A;  3ISB A;  4QZ8 A;  4TUR A;  1XSN A;  2UVR A;  9ICH A;  2BQU A;  9ICG A;  1NK0 A;  3G6X A;  3N97 B;  3QEB Z;  2AGO A;  1S0N A;  4PHP A;  4NM1 A;  2OWO A;  2FLN A;  2PFO A;  5DDM A;  2WTF A;  2PI4 A;  1EXN A;  3MR5 A;  4DFM A;  1ZQU A;  4Q45 A;  2BQR A;  5KFH A;  1SL0 A;  1S0V A;  4UB5 A;  3PR5 B;  5KFY A;  3PML A;  2DPJ A;  3OHB A;  4BDP A;  8ICC A;  4BGD A;  1CEZ A;  2KFZ A;  4DL7 A;  4KLG A;  1K1S A;  4O3Q A;  2BPF A;  2BCR A;  2J6S A;  2NRT A;  2W8K A;  3RB0 A;  3GQC A;  3QEA Z;  3KTQ A;  4DSK A;  4EBD A;  5KFQ A;  5DDY A;  5DKW A;  4DLG A;  4DSF A;  4NY8 A;  3JPQ A;  4KLL A;  4YD2 A;  4Z6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...