3CW2C

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
266
structure length
266
Chain Sequence
b'MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 63
structure length 266
sequence length 266
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00575 S1 S1 RNA binding domain
C PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3cw2C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cw2C01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3cw2C03
1LTLA 3E9HA 1PH3A 5M3MG 3K7AH 2B63G 4OWXB 4DV0L 3GTMH 2NVQH 3CXCA 1VQ5A 1J5EQ 1H95A 4GLVB 1CKNB 4ME3A 3CCLA 1L0WA 1YVCA 4AYBE 4DPGA 3CPFA 1PA6A 2VS1A 4LUVA 4A76A 2JA6H 4A3GG 3OW2A 1SR3A 3AFPA 5IP7H 2E2IH 2LXJA 3PUWA 2LSSA 4BA1I 3J80i 2B29A 5E7NA 1GKHA 5IY0A 2JEBI 3CCQA 3STBD 4HJ9A 3S1QH 2F4VL 4LFCQ 2JJQA 4PZ8A 3OYYA 3HOVG 2HIVA 1Y1WH 1PFSA 2WP8J 1Q8KA 2AMCB 4JG2A 5IYDH 5IP9G 4A75A 1MKHA 3ULLA 1N8RC 4KLKA 2E2HH 1T9HA 4X6AH 1VS0A 1E1OA 3RLFA 2E5LQ 2D0OA 4B3TQ 1VQ7A 3TEHB 2AWOA 1TWHH 3UDFA 1EQRA 3A5UA 4JI7Q 1KAWA 1LUZA 4HJ7A 3T1HQ 4LNQA 3I4NH 2K75A 2C35B 2VQEL 5JJIA 3U4VA 3K80C 4MNOA 1FJGL 1K0RA 2EQSA 3KOJA 4YHHQ 2Q2TA 2KCMA 4AIMA 3I2ZA 2F3IA 3HOWH 4QIWE 1JJ2A 2Z6KA 4LF6L 4FDBA 1XNRL 2PI2E 4OO1G 3HKZE 4UP8A 4NXNL 1DGSA 4YY3L 4A3MH 3D0FA 1X54A 1QVFA 1P16A 2KHJA 1U0LA 2AKWB 4NB3A 3FKIH 3KF6B 5AJ3Q 3CCSA 4A93H 4JI3L 4P71A 2WB1G 3A5ZB 4YWLA 1WFQA 2KCTA 4JV5L 4X62Q 5K36G 1VQHA 2UUCL 4B3RL 4K0KL 4WJ3M 3CD6A 5BR8Q 1YZ6A 4GKKL 1UE1A 2Y0SE 3CP0A 4LW1A 4X66Q 4AQYQ 4DR7Q 3UDIA 1R9TH 3ER0A 1JB7A 3IRBA 4A3MG 4JI6Q 4XIGS 1VQOA 1PH7A 4YCUA 1M90C 5C3EG 2YU9H 1VCIA 1EUJA 5FLXc 3PIOA 2H5XA 5JJLA 1HJPA 2A19A 4BXXH 2ES2A 1GO3E 2N49A 1JMCA 1VQPA 2R7DA 2Z0SA 4IJHA 4DV7L 1QZGA 2K4KA 4LF4Q 2NZOA 2I5HA 1HR0Q 3CCEA 3I4MH 4BY7H 1GD7A 4GOPB 3M7NA 4IFDI 2RF4A 5JEAJ 2VQFL 2JA8G 1C9OA 5J3BA 2IHEA 1X9NA 3S2DH 2BH8A 4DR3L 2ID0A 2UXBQ 4DUZL 3KFUA 3ULJA 4DK6C 1V43A 1WYDA 2K5VA 3HFZB 3HOXH 3EBEA 4DV1Q 3G6EA 1HNWL 2UUBL 5M5XH 2RHSB 4A3FH 4OX9Q 3KF8B 4DNIA 2HT1A 1HNXL 5C44G 1VQ6A 3S16H 3S24A 1OTCA 2UXCL 1IBML 3RLNA 1VQEA 3A74A 3T1HL 1HNZQ 2VUMH 4IOAA 3Q8DA 4GNXC 2EXDA 3MEFA 4DAMA 4X64Q 3I56A 3J81i 1L1OB 2K50A 1VQCA 2QEXA 3M4PA 1QUQB 3ULPA 5ELNA 3J7ZC 4HJ5A 2ALYB 3DLLA 4DV4Q 1EIFA 1RIPA 2DGYA 3G4SA 4P75A 1JJCB 2OTLA 4JI2L 3H3VH 4LWCA 4A3IH 3PGZA 1CSPA 1KRTA 1TWAH 4IOCA 3PO2H 5M3FG 3S14H 3CMAA 5LMNQ 1K73C 3AFQA 4JBJA 2NVTH 2OTJA 2IT1A 3U50C 2VUMG 2D0PA 5FLMG 2PQAB 4R4IA 1WI5A 1X56A 4DUYQ 4GLAC 1Q1BA 4HIDA 1Q7YC 4HIKA 2JEAI 2ZM6Q 4BA2I 3M4OH 4DR1Q 4TQUS 3U4ZA 4GN5A 4X66L 4ALPA 2R6GA 3K7UC 3S1RH 1I94L 4R4QA 3PUZA 4OONA 2JA7H 2YTVA 2NZHA 4R4TA 3G71A 5IYCH 1YI2A 1TWGH 1D7QA 1G291 3PO3H 2MNAA 3OTOQ 2AHOB 1PYBA 3HKSA 1N34Q 3BZKA 4DR4L 4QY7A 4L5SA 3FHWA 3S1NH 4IJLA 3M85A 3KF6A 1VQAA 1MJEA 1CKOA 1B70B 4PMWA 4J15A 3GTJH 4DV5L 4GNXA 4DR5L 1EFWA 1CKMA 1XNQQ 1E22A 2R7ZH 4LF5Q 2HHHQ 3BJUA 1BBUA 2JE6I 3NBHB 3HOUG 4A3KH 3K8AA 1IBLQ 2JQOA 1I5FA 2Z6KC 2CFMA 4A4IA 1VQ8A 1HH2P 4BBSG 3I55A 1X55A 4OX9L 2VL6A 1J6QA 2YTXA 1IZ6A 1VQFA 3H15A 3GTLH 2Q2IA 3F8TA 2CWPA 2I0QA 2Q2HA 4IPHA 4B3RQ 3KDFA 4JI8Q 3K81C 1TXYA 1D8LA 4JI5L 4X65Q 4P72A 2BA0A 1PH1A 4A3KG 2VY3A 1KQSA 2JA6G 2XGTA 4P74A 5IP7G 1K3RA 1U5KA 5LMNL 4A3DH 2K5NA 4LFAL 4QJFA 2UUAQ 1UWVA 3WWVA 1VQIA 5GROA 4JI1Q 4JI0Q 4DV2Q 4L5TA 3RR5A 4A3JH 3EN2A 3GTPH 2QGQA 1NJIC 2ZJRA 3F2DA 4JBMA 1Y1WG 5C4XH 4R1JA 5IYDG 3T1YQ 1Q12A 1BKBA 1YJ9A 3KJOA 3OTOL 5LMUL 4NXMQ 2K14A 3UE0A 1IL2A 4IPGA 4DV6Q 1N34L 2KBNA 1N32Q 1CSQA 2NN6I 3JAMc 1HZCA 1IBKQ 5IYBH 1KL9A 1KHIA 4JYAQ 3BZCA 1XMOL 1K8AC 4A3JG 1EQQA 4LF9Q 3I4NG 3JC66 4IPDA 1OXVA 1NMGA 2OCEA 3GTOH 2N3SA 2GVBA 4PG3A 3L0OA 4JOIC 1J5EL 3HOWG 1WOCA 2QN6B 1UE7A 2JA9A 2CCZA 3CQZH 5JEAG 1G6PA 4A93G 3H0GH 3J81j 2B3GA 1TWCH 3FKIG 4A3EH 3A0JA 1PH6A 4APVA 1HZ9A 2I5MX 3BU2A 4B3SQ 5EAYA 4C2MH 1RL2A 4KHPQ 1YNXA 3QSYB 3TREA 4DKAC 4QL5A 2R7FA 2OQKA 1EWIA 4LFCL 4GKJQ 4JI4Q 4P73A 4IFDJ 1KRSA 2ZTDA 2RHQB 3AYHB 4EX5A 1N36Q 1HZBA 2PNHA 3GD7A 3CCJA 1TWFH 3UDGA 1XMQQ 3RZOH 3HOZH 2E8GA 3CMEA 4LUOA 3B6YA 2KHIA 4A3EG 3S1MH 1OXTA 3HOYH 2VNUD 1E7ZA 2PMZE 1CKNA 3EIVA 2E5LL 2I5LX 4B3TL 5IWAQ 2JA5H 4B3MQ 4BXXG 4LF8Q 4KI0A 4UP7A 4JI1L 4C3IH 3TRZA 4DV2L 5GAGC 4JI7L 4BY7G 1A8VA 1PH9A 4BY1H 3I4MG 1IXRA 1SRUA 4GN3B 2OQ0A 2NVYH 4JC0A 1PV4A 2R92H 4Y52H 3I4OA 4DR6Q 4HJ8A 1HZAA 2GVAA 4YHHL 4JOIA 1FL0A 2BA1A 4YWMA 4BBRH 5IE8A 1NMFA 3CPWA 1Q86C 2UU9Q 3PSIA 5HY6A 3HOXG 4DV0Q 2QA4A 1NBWA 3CCVA 3CC2A 1E1TA 2HIXA 2WB1E 4DAYB 3FP9A 4QGUA 5AJ3L 4A3FG 4POGA 2R93G 4IPCA 2VW9A 3DM3A 3RZDH 3F1ZA 2L15A 2VZAA 4L5RC 4BY1G 4X62L 1MIUA 4OWWB 1Q82C 4A3LH 1X3GA 2RCNA 5BR8L 4O2DA 5ELOA 4AQYL 4DR7L 2F4VQ 1Q46A 3CW2C 1YIJA 1X3FA 1Z47A 5GADC 5C0XJ 5C0XI 4DV3Q 4A3IG 1XJVA 3GTGH 4JI6L 3CCUA 3PO2G 1SFOH 3CCMA 1I50H 1IYJB 5IT9c 4A3CH 3S17H 2KENA 4XTCS 4H02A 3M4QA 2QMUB 2D62A 4LF4L 4A3BH 1AH9A 1SN8A 4R4CA 1HR0L 1YZ7A 4JI4L 3KLWA 4OXPA 4PZ7A 1WCMH 1NY4A 1NTGA 1N36L 1SE8A 2V1CC 2JA7G 2CWAA 2UXBL 2VQEQ 3PF4A 3MXNB 1PHJA 2ZTEA 5IYCG 1L1OC 1FJGQ 5M3MH 3PO3G 2MFIA 1Q1EA 2B63H 4LF7Q 4DV1L 1G51A 1YJNA 5HGQA 2MQHA 1YITA 1PH8A 4LF6Q 3CAMA 4B3ML 1XNRQ 1UEBA 1ASYA 3JAMi 4NXNQ 4LF8L 3CF5A 4YY3Q 4UPAA 3K0XA 3SGIA 4A3BG 1VQLA 1HNZL 2Q2UA 1LM0A 2OWOA 4JI3Q 4X64L 1EOVA 2R7ZG 1WCMG 3LGJA 3PV0A 4DV4L 2UUCQ 1VQ4A 2A1AA 4YCWA 3M3YH 4LFBQ 4K0KQ 2XTIA 3AEVA 4RG1A 4GOPA 1LYLA 3NENA 3HOVH 4GKKQ 5JJKA 3GTQH 1YJWA 2YYZA 1KXLA 1B8AA 1QZHA 2Y0SG 5IP9H 4GS3A 4GLXA 4IO9A 5M5WH 2NN6G 4DR2Q 3NELA 4UY8C 5M5YH 4DUYL 4EQ5A 2CKZB 1BVSA 3G48A 2ZM6L 1S72A 2EIFA 4R4OA 1PVOA 4DR1L 1X65A 4DV7Q 3AQQA 4YCVA 4JCVE 3NEMA 3E9IA 4DV3L 3H3VI 1MJCA 2K52A 1L1OA 2VQFQ 1YBYA 1QUQA 5C4JH 4A3DG 4MZ9A 1UE5A 1GVPA 3W1GA 4NPSA 4DUZQ 4DR3Q 1O7IA 3RNUA 1VQMA 1ASZA 2K5HA 3GO5A 2DUDA 1HNWQ 2UUBQ 1FVIA 1I6HH 1HNXQ 3F2CA 1S3OA 3E0EA 4TVAB 1W3SA 3PIPA 3GDEA 1W2BA 2UXCQ 1XNQL 3UE1A 1IBMQ 5C4XG 4LF5L 2HHHL 3L7ZC 4Y7NH 1X3EA 2PQAA 2ASBA 1OXUA 1VQGA 1K8GA 1UE6A 3CCRA 1GM5A 1IBLL 4IFDG 4C3HH 1C7YA 1YHQA 1KD1C 2WAQG 2NVXH 4LF7L 1A63A 4JI2Q 1QVCA 5GAEC 5IYBG 1VQBA 3PUYA 4HIOA 1WJJA 2R93H 1NE3A 1Z9FA 1N9WA 3J80c 1K83H 2WFWA 4GN4B 5C3EH 4JI8L 4OWTB 3J7A5 3W1BA 4L5QA 1YHAA 5H1SE 4GNXB 1CUKA 1C0AA 4HIMA 1X6OA 4YWKA 4X65L 1XPUA 4LFBL 1P8LA 3VDYA 1OXSC 1Y14B 3I7FA 4C3JH 1N33Q 1I94Q 3H0GG 4OO1I 2JA8H 2LXKA 1AE2A 1A62A 2ATWA 2UUAL 3U58A 4KHZA 2YTYA 5DLQE 4DR2L 1JJGA 1AE3A 1K9MC 4JI0L 3KDFB 1L2FA 3CC4A 3GTKH 3UDXA 4DR4Q 3PF5A 1XTDA 5C44H 2UXDQ 4PZ6A 2ZJPA 2A8VA 2IY5B 2IX1A 3M9BA 3ERSX 1EIYB 5GQOA 3HOZG 4JBKA 3T1YL 4DV5Q 1E3PA 3D31A 2CQOA 4DR5Q 3RN5A 4JBWA 2MO1A 1PH4A 3HOYG 4NXML 3HOUH 5C0XG 4DV6L 3S2HH 1N32L 2ZJQA 4WJ4A 1Y1VH 1IBKL 3TS0A 2JA5G 1BBWA 4JYAL 1OXXK 5M3FH 4AYBG 1SROA 1JE5A 1E24A 2JK8A 1YHBA 4LF9L 2GN5A 1B7YB 1V1QA 1JT8A 2R92G 4O0AA 2HQLA 2IHFA 2FXQA 2BH2A 1VQNA 4POFA 5FLMH 1Q81C 4BBRG 3PUVA 2WAQE 4AH6A 3F2BA 1EYGA 4JI5Q 2E2JH 2MO0A 4GOPC 1HR0W 2F52A 1VQDA 1V9PA 1VQJA 2YV5A 1Y1VG 1PYSB 3PUXA 4MTNA 4UP9A 4B3SL 1QVGA 3TS2A 4DK3C 3KJPA 2AWNA 5FJ8H 1S40A 1PH5A 4KHPL 4A3LG 3TQYA 3ZJYC 4LFAQ 3STBC 3RLOA 4GKJL 3S15H 3L2PA 1KC8C 1I3QH 1XPRA 1VQKA 2N8NA 1M1KC 1XMQL 4HJAA 1SMXA 1N33L 1A0IA 1PH2A 3KYHC 2PI2A 3PCOB 2ZTCA 4RMFA 5GAHC 4A3CG 3W5OA 3CC7A 1XPOA 2N78A 4LUZA 5IWAL 5FJ8G 5LMUQ 4QQBX 1FGUA 4BBSH 4A3GH 1VQ9A 2IX0A 3HKZG 5LMNW 3RN2A 3ICEA 1XMOQ 1KIXA 2UXDL 1YEZA 4JV5Q 4DR6L 1SLJA 2UU9L 3J81c
chains in the Genus database with same CATH superfamily
1WNEA 2YWHA 2NVQH 2JC0A 4GLVB 3BQ1A 1BXTA 1RTDA 3VZIA 3ITHB 1HW9A 3CPFA 3HOXB 2KZZA 1GMWA 2CNKB 2R93B 1YJNS 5D77A 4OX9J 3STBD 4M63A 1AQ6A 1ZXIA 4FYXB 5CA7A 1JR0D 4PZ8A 1JLBA 2MKJA 3Q89A 3Q8VA 4O5KA 5F3TA 1CJTA 2RKIA 2E2JB 2J7KA 3OW7A 1VS0A 3D6HB 5KT3A 3JAML 1G4CA 4HHHA 5CYQB 4MKAA 4AT1B 1KAWA 5I4DA 3L4PA 4KGMA 3R27A 1ZQPA 4OQJA 2BJ8A 2KCMA 4AIMA 3IM8A 3WIUA 2ZM6J 2XMWA 2F3IA 2HDOA 5G3LD 3D0FA 3MM7B 1YGYA 2KHJA 4ZVHA 4O23A 4QUCA 3OTOJ 4YOEA 4LSLB 4M5KA 1CULA 2G07A 3BGRB 2H5EA 1HKAA 5BR8Q 3MCOA 1GOZA 4FF1A 3UN5A 4C8MA 3IRBA 2HHHJ 2LKYA 4IFVB 1MU2A 4Y2MA 2IW3A 4Q45A 2GMHA 3DRYA 5JJLA 2B6AA 1TKZB 1W25A 2Z0SA 2YQEA 1TVRB 4BY7H 2P5VA 5AKJA 1B99A 4I64A 2HIYA 4DR3L 1B0XA 1NZ8A 2MQMA 3HFZB 9ICKA 3M2UB 2Y9TA 3QUBA 3MZ5A 1HNXL 1ENFA 5C44G 1IBML 3RLNA 3T1HL 2JHEA 3IWXA 5FO9B 2HMIA 4IOAA 2VB3X 5B7WA 4G9BA 2JZ5A 3J81i 4JB3A 4JI0J 3ULPA 3J7ZC 4CE6A 3DLLA 4LFCF 1L3UA 4NLBA 1GXTA 5D4PA 1HI0P 2GA4B 4ZVEA 2P6RA 1SI9A 1TTHB 2HGLA 4DSEA 5D3IB 2D0PA 1S6QB 1ZQCA 2EAOA 4KJNA 4DUYQ 1PZJD 1J2MA 4JI7F 2DNHA 1C4CA 5EJWA 1DOKA 2CPYA 2Y8YA 1KEJA 3K7UC 1IKYA 1GAOA 1DD2A 2YTVA 4F4KA 1ZQTA 3VHQA 2MNAA 3H6MA 1S4FA 3IS9A 3W66A 5T7LA 2MUTB 4QY7A 1JORA 2A6HD 4IJLA 3QU7A 1SB6A 1C4QA 2E75C 4NLWA 4PMWA 4G7ZC 4FPRA 4F0KA 5KT5A 2SXLA 1F2LA 1J8IA 7ICQA 4S3SA 4PR6A 4DR7F 4X66F 4BDPA 5J2MA 1FFVA 3RJIA 2V4JB 3FC9A 2RNEA 3G6JB 2ZD1B 3RG6A 4WORA 2QCPX 2YKAA 3PIPQ 2DGUA 5T1GA 5J0RA 2BE2A 4Q7AA 4I7AA 1WG5A 2QB0A 2H1EA 2JEGA 1V6HA 2ESEA 3QIAA 8ICRA 4KKSA 2XZWA 2BJDA 1FNMA 4P74A 1RHRB 1U5KA 3DRSB 1VQ4S 3BR8A 1IIPA 3PO2B 2JLFA 3H91A 3NMAA 3HG9A 5IIKA 1MW7A 3HP3A 2K4PA 1FESA 2QGQA 3OWEB 2W9CB 3F2DA 3WX8A 4J90A 1JLAB 4F71A 1PLFA 4FXKC 1SL1A 3QX7A 1YT3A 3RJMB 2JOQA 1F9HA 1Z00A 3FC4A 2CYYA 4USVA 1R27B 1Y5LB 5IV3A 1JLFA 3MWYW 2PFNA 3R8YA 3AOCA 2ZC4A 3G6XA 1K1QA 3FBCA 3L0OA 3EUB2 1J5EL 3HOWG 4UBBA 3TJ9A 1N88A 1COKA 1PKUA 3AOAA 4DZ6A 4B3SQ 4OJ6A 4RNFA 4KHPQ 1AFPA 1N2XA 2J7ZA 4QR2A 1VC6A 1UHUA 1EWIA 2AQ0A 3CJTA 3A3OB 1DRGA 4B9TA 5J1EA 2GH1A 1PZKD 4M5JA 1N36Q 3C1EA 1F9SA 3NS5A 1CBKA 1C1CA 1HI8A 3FSIA 4K0KJ 2V4DA 4WPAA 5HP1B 5K14B 2MJUA 4RR5A 1A8VA 2YTUA 4Q0BA 3LPYA 4DU9A 1NO8A 2R92H 3MMBB 2BW7A 5A8KB 2UU9Q 1Q86C 1NMFA 4ZS6A 4BX9C 1T9XA 1E2VA 1JN3A 3ZDEA 3TP7A 2CAJA 2DY9A 1NBWA 3CC2A 4DAYB 1B22A 4A3FG 1EYDA 2VBZA 1NB7A 4X62L 4PPZA 4B3TF 5C5MA 1YNNC 4Y2VA 1UEKA 3JYTB 1XS9D 1O80A 1DQAA 1EKSA 5DBCA 4PJ0U 1RUSA 5DB7A 2I0XA 2K04A 3FPUB 1DZ1A 3A8JE 3TEGA 1IYJB 5IT9c 4C3LA 2YH1A 1RHJB 3M4QA 2GHVC 2D62A 2OTLS 2Z0GA 3K58A 2JZBA 4ITSA 3MM9A 3E8OA 1IYVA 4V190 1IQZA 4P9SA 3E3XA 4KLFA 1GUTA 1I94J 1QILA 3CF5A 4R8UB 3JTPA 4IR9A 3ONAB 9ICRA 1EOVA 1WCMG 2HRTA 3KDOA 1TKXB 5I3PA 5J1NA 2P5ZX 5CQGA 1U49A 4RAUC 3MXGA 2MHNA 4DR2Q 4PMBA 3AQEA 2GOLA 1RA6A 1X65A 3TARA 4DV7Q 5KG4A 4J9RA 1SH2A 2C28A 4FKXA 1FNWA 2R7UA 1BQMA 3KLFA 1UE5A 4DV0F 4Q8FA 4ZVOB 2K5HA 4C6AA 1RODA 4QPTA 3NP5A 1TL4A 4I56A 1R4PB 1RHUB 5HN0A 4DL2A 2DR9A 2EZYA 1V3SA 3LP0B 2EKYA 2B9WA 4IFDG 1X3QA 3C15B 1QVCA 1M5KC 4DBQA 1KFSA 1Z9FA 3OIQA 3GYNA 3UFCX 5E3FA 4QU7A 8ICIA 1X6OA 1XPUA 2LYHA 1Q3VA 1WCNA 4C3JH 2V68A 2JA8H 3BPDA 4E8UA 4QOTA 1SV4A 5IINA 3C8YA 1VBYA 4F5NA 2MQQA 2DY8A 5M5WB 3G96A 3DHQA 5C2GA 4JI3F 3D2WA 4NMLA 3M9BA 3AFGA 1HBOB 2V4RA 3D31A 4RGOS 4G7HC 5KNDA 2MHVA 4YEAA 5C0XG 4JWMA 4H7BA 1Y1VH 1BBWA 4ZMMA 3MZIA 2B8FA 3I5AA 2OELA 3D6MB 2FXQA 2W55A 1WTBA 2Y0SC 3F2BA 4H4OA 4JI1J 2XO6A 4LUBA 2MO0A 3BYPA 1E6VB 1CQFA 3T6BA 1M8AA 1VQDA 4UP9A 4NZ6A 5HR7A 4PXEA 3TS2A 4LJXA 1FVSA 3QUQA 5KFVA 2WINB 2PQEA 1DBDA 3RLOA 5LHY1 3KXDA 1HMVA 1I3QH 4PZOA 2FYXA 2HKEA 4M5NA 3MMCB 4CCHA 4EBEA 3DDNA 4JI2F 1JJ2R 4O4GA 4FYVB 1FEEA 1EYCA 3SIPB 3RN2A 2EKNA 4P2HA 4DR6L 1TQOA 1RT6A 4DL3A 3J81c 2GJFA 4Y2IA 1VQ5A 1P27B 4UAUA 1TY2A 4ME3A 3IRXA 3MFIA 1YVCA 2BMBA 3HOUB 4YXMA 3ZDAA 1A6LA 3FVQA 2BKOA 3C6TB 5ELEA 2FQQB 4R63A 1V38A 2E2DC 1UA0A 3HULA 1A6XA 1WI8A 4FDFA 1N8RC 3KHLA 3QYYA 4GMKA 2ZHAA 4DU7A 2GAHC 3MTKA 3KOAA 4HAEA 3C19A 1TWAB 4R0EA 3ZI4A 2AWOA 4KLTA 2IVMA 1SE3A 2VG7A 2BDUA 5C42B 2EBEA 2DKXA 7ICJA 4F0MA 3DDKA 9ICIA 1U1QA 4QIWE 1X54A 4DV3J 3TW0A 3FKIH 1U4LA 5DJBA 2PFQA 4HI1A 3VAJA 3VGVA 4F72A 2ZEJA 3PSTA 2Y0SE 1OXJA 4ZKBB 2HNZB 2NVQB 3J80U 3TADC 1VQOA 1LTSD 1IBLJ 2ZXHA 1S1WA 4F4WA 1Z4NA 3FRPB 3IM1A 2N49A 2XI2A 2BM1A 3THVA 3BB5A 4OV6A 1LLRD 2I5HA 3HGBA 2VU5A 4IFDI 2H3VA 4CLPA 1X9NA 7ICSA 5CH7B 4CO5A 3ULJA 1WTHA 2YH0A 3KLEA 4FYWB 2JR5A 5ALUA 1ET9A 3U7JA 3P6YC 1TL7B 1HEKA 1VQ6A 2IOHA 2DHAA 4A3DB 2JJ4D 4ZUIA 3PW4A 1SJRA 5IIJA 4ECSA 2NSBA 1PK1B 4HDHA 3PYFA 1VQCA 1QUQB 3MEEA 3QMQA 1Q4RA 1UW9A 4NZ7A 5M3FG 5LMNQ 5L1KA 2OFHX 2NVTH 2VASA 4DJBA 2A1BA 3QFWA 4R4IA 2XZDB 1IBKJ 1X56A 1FD7D 1Q7YC 2D9OA 4YCXA 2HDMA 4F5QA 3T1HF 1MA7A 4G4KA 5U47A 4QWCA 4K4VA 4F5OA 4YHHF 1TWGH 3PO3H 2AHOB 3OQ2A 3M4YA 4OHYA 5DETA 3SR6A 4O1NA 3T56B 5M2UA 3CULA 4I2IA 4ULLA 4HKQA 5IGEA 2KA7A 4BY7B 1DONA 5ETRA 4F4ZA 1G2EA 1H9SB 1U02A 4OX9L 4X3SA 3KK3A 1B64A 5EN1A 2HQDA 3PX6A 1Y9OA 4HLBA 4C7YA 1HR0F 4P72A 1M1GA 5C4HA 4A3KG 1WSRA 2XMKA 2VY3A 2V63A 4ES1A 1B4OA 2OUGA 3LYSA 1S9EA 4DAPA 3HHDA 5DDQC 1FKAF 3WWVA 2QA2A 5B0DA 2IYIA 4BS9A 1Y10A 7ICLA 1R4QB 1JLEA 4FS1A 2EFNA 3MDFA 1GTEA 3BBFA 1BKBA 2XHWA 3CPWR 2UUTA 3OTOL 3B6BA 1IL2A 2FLPA 4DV6Q 1N32Q 1WKJA 4FN5A 1F2GA 1LOUA 4N8NA 1HZCA 1X5PA 2LLZA 3BZCA 3HVTA 1EHWA 3JC66 1T3NA 5ALQA 4QIWB 3WKDA 3VR5A 1U4BA 4ZLTF 5AKEA 5JEAG 1RWKB 3UVJA 2M0NA 2OEOA 1QUPA 3R5BA 2KSOB 4I27A 1RWMB 3HHLA 1WHWA 3M8SA 3O0FA 2C9OA 1Q8LA 5GAHI 3QSYB 2Y0SB 3TREA 1XNRJ 4QL5A 2FD2A 1FHTA 3I70A 3NTHA 4WKRA 1CM9A 1GXUA 3GYXB 1HZBA 3ZTPA 1RTDB 3HZXA 3RZOH 3P75A 2WW8A 1RDRA 4O3PA 1CKNA 2O2LD 2RAQA 1SRUA 3PNCA 5C5LA 1L3KA 2MQ8A 3B82A 3P45B 1CJTB 2RKIB 3IFDA 3LO3A 2RDHA 5G0RA 3ILOA 5C25A 2W03A 5AJ3L 2AZ3A 4NYPA 3DM3A 1S5CD 2MZJA 4B6JA 2QDBA 4WYWA 1FTRA 3CD7A 3FSXA 3G82A 4M1KA 3CW2C 3RGIA 2H5JB 1EY5A 4A8YA 3HKWA 1NNDA 1NPPA 1SFOH 4X4PA 4IN3A 3AJ2A 2MUYA 5ALOA 3IWNC 3GFZA 1CULB 2BOAA 3JPSA 1T9UA 4LF4L 4X62F 4FNFA 2VFVA 4EYHB 3A8EA 4R65A 4O3RA 2UXBL 4CLZA 5H9FK 3DRRA 2DK2A 4DV1L 1MU2B 1G51A 4IOBA 5CEHA 2B6AB 3V6HA 3HEJA 4DFPA 3ZC4A 2Q2UA 2PFDA 1JC7A 1HFGA 2ZH8A 3BDOA 4U95A 4DV4L 2XY6A 5I2YA 2R92B 3KK7A 3WZ0A 3K8WA 2IRXA 1AZQA 1SE4A 3PEHA 2EFOA 3ZZPA 4IO9A 4NEYA 2NQPA 5HJXA 2HMIB 2EEYA 2OXPA 1VQ8S 1PBUA 1RP5A 3FMCA 2IPKD 1Q0NA 4DPOA 1L1OA 5ETKA 1KOOA 2DIUA 2LQBA 3D2NA 8RUCA 4A8KA 1WDDA 5IGDA 1IKYB 4LFAJ 4RW6A 3JXOA 4C1NI 1NBEB 4ID5A 1HHTP 5T7LB 1JXLA 2MZTA 1VQBA 1DTTA 1NAQA 2ZH4A 1RJTA 2L41A 5GTHU 2F63A 3AA8A 5L9XA 4N8OA 1GUOA 5H9EJ 1T03A 1LTTD 3OUYA 4C2MA 5G4DA 5J2MB 5LL6d 4UB8U 1XO1A 5CV4A 1WG8A 2ZH6A 5DLGA 5HLFA 3EMTA 1HYSA 9ATCB 5CB1A 5DM7Q 4KFBA 8ICYA 4YY3F 2BE2B 4NMXA 3QT5A 2QB0B 1II3A 2AV5A 2CXEA 4DR5Q 4NLDA 4EQOA 3MR2A 1IKXA 4QW9A 2MY8A 4AYBD 1Y1WB 3LTOA 2CJXB 1JE5A 3LW5C 2GN5A 2ZZNA 4WFYA 2FMPA 1P7DA 2AP6A 2QT7A 2FINB 1O51A 1VQNA 5FLMH 2NXJA 3R9LA 4AH6A 2GLEA 2F0NA 4DSFA 5MAOA 1EU3A 3QIPA 1Z00B 2N4DA 1AZSA 1H0HB 4OYPA 1WTPA 3HSDA 2QEXS 2LMIA 1JLFB 2R3VA 2MY7A 3TQYA 3ZJYC 3UO0A 3PW2A 3BSOA 3M9OB 3HRDD 3VVUA 5AXNA 3WKEA 2QMXA 1RXWA 3BS9A 2VUGA 4YR2A 3TQEA 2QZ8A 2PI2A 3ONNA 4PABA 3NGDA 4C3JB 3KYLA 3CD5A 2AXTU 2KK0A 3HKZD 1F2MA 1TELA 3PR5B 1FX2A 8ICPA 3ICEA 1XMOQ 2UXDL 3PO4A 3EFXD 4Z6FA 3IDWA 1PH3A 5C3XA 3A56A 1C1CB 1RJJA 3I9ZA 2B0GA 1N36J 2VS1A 5A0LA 3AFPA 8AT1B 4LQ3A 4Q0BB 2B29A 1BF4A 2W4CA 2VJ5A 3TNVA 2XVTA 4USHA 5CRXA 1ZQRA 5CBEE 5HMZA 5AKKA 4Q2LA 2HCIA 1GEHA 5IYDH 3PJXA 4QW8A 1MN9A 3SEBA 4IURA 3NVVA 1J2VA 3MCMA 3UN2A 3KLHA 5AI6A 3HF5A 3Q8RB 3GR0A 3I4NH 4O44A 3GLJA 2SNSA 5JJZA 3FBEA 1MI2A 1UVLA 1QDUB 5K8OA 2LYBA 5DDYA 1EKRA 4XA5A 2EG2A 7AT1B 3GJTB 4LF6L 4OO1G 4Y2KA 4F5PA 1UL3A 4J9MA 2E29A 4A93H 4PQXA 4DOAA 2CNOB 2QARA 1A3UA 3LWMA 2JLGA 2JZBB 4K4ZA 3V72A 3MM9B 1KONA 1Y8OB 5ETPA 1AROP 3CP0A 3NWGA 3GG0A 1R9TH 1FFUA 5J8YA 4KTAA 5HVFA 3IR6B 1VCIA 4PG5A 3OTEA 4KH1B 1N62A 2ES2A 1DJRD 4MTPA 4BXOA 2RQ4A 4IJHA 5L37A 4KGKA 4MKVA 2K5WA 1K9MT 2FPMA 3S2DH 4RQ1A 3FEZA 4KN4C 1URNA 3S24A 2WF5A 2FDNA 3A74A 4XQJA 1UVIA 2EXDA 4DR2J 4A3JB 2E7VA 1BQMB 3KLFB 1ONLA 2ALYB 4QQBX 4C8KA 4N41A 3PIP3 2HHWA 1SIWB 4NYZA 1U1MA 4EVOA 4RU2A 3U50C 2R7XA 1OPZA 4J37A 3FKIB 4OYWA 5E3PA 4DQSA 2WSEC 1XQIA 3BH6B 5KFEA 4ID8A 1KC8T 5JPNC 3ENVA 1L7PA 3EROA 4ZPBA 4DR4L 2E5HA 1OJ4A 1EZZB 2IYGA 5B08A 1W2IA 3M2VA 3K4GA 1SBRA 2N88A 5GAEI 2XBPA 2VKRA 3D6JA 1XNQQ 2R7ZH 1H7XA 3R1HA 2GIRA 4KD4A 2JQOA 4ILMA 4ECQA 4BBSG 4P7VA 3D67A 4JI6F 1STEA 1BHNA 1VQFA 2KIVA 1RE1B 4O3QA 3K5PA 4HL9A 2NWGA 4PV1C 4ZP8A 3TR5A 4IQVA 1X40A 1WCLA 1BXNA 2Y9UA 1KQSA 3KKAC 3RMHA 2QLXA 4Y2JA 4EEKA 3R97A 3SEOA 3HHLC 2F0SA 4ED5A 4OZNA 4OX9F 3HHEA 4FP9A 2NVTB 4M9NA 4DL6A 1R8HA 4LQ9A 1ZRNA 4JBMA 2EZZA 5ALSA 2RE1A 5NUCA 4TUSA 3DI6A 4Y2TA 4URSA 2PXIA 2F2AB 2V5HG 4GRSA 1ZQ1C 5ETQA 3M9MB 3TI0A 1HMVB 2G06A 2I46A 2ZM6F 3O1LA 4H54A 4YS2A 2EW9A 1AW0A 1OQ6A 4O4GB 4I2BA 5LSOA 1FJGJ 3OTOF 3W2VB 1RT6B 1JLGB 3QGPA 3BQ0A 2X3DA 4JI4Q 1QQ6A 4PQUA 1D3WA 3OWFA 1XMQQ 2HHHF 3TWZA 4DSIA 3MR6A 3PYDA 3AB2B 2N82B 1QAXA 5A2QE 2Y3YA 4LAAA 3VGUA 1E7ZA 1QY7A 3THTA 4DWIA 1U26A 2DF4B 4UP7A 3PEJA 2PMHA 2RLTA 4X3KA 3W3SA 4DSJA 4KLOA 2R7QA 1N60A 4JOUA 1QTMA 4YFUA 4OHJA 2A18A 3EVWA 3RB0A 5D6GA 3FP9A 2MQPA 2VG7B 1NK0A 4ILLA 2Z2MA 1L8OA 4JI0F 4GVLA 4F8RA 2KHSA 1WOPA 3GTGH 2ZH3A 3EZOA 3FCWA 1WDTA 3AY0A 1DURA 4TN2A 2CH4W 5AJ3F 4LRBA 1SCJB 2WONA 1ZQSA 1SN8A 3KUEA 1QCBD 4OXPA 1NTGA 3L3FX 2RUGA 4X4QA 3PF4A 3WIVA 1PHJA 4ELTA 5J0XA 1L1OC 2FPKA 3TJ8A 1S1WB 3BDEA 2BQUA 4CNYA 2NN6H 4K5VA 3MABA 2SNMA 1VJ5A 2E9ZA 3NHHA 1YI2S 4CF4A 3F53A 5DG9A 2E8OA 1OO9B 2GO9A 4LF4F 3BQ2A 4TU8A 5B5EU 2XTIA 3KLEB 4K2XA 4GKKQ 1Q8BA 2FHKA 4JBCA 3N28A 3GU3A 1TAQA 4GLXA 4DV1F 2HQEA 3VR2A 3FQLA 5A8RA 1RK8A 4R4OA 3CJRA 1SZHA 3LANA 3MEEB 1COOA 3E9IA 3RJHA 1JMTA 2FLOA 4ZKAA 3CDBA 5C4JH 3W1GA 1VQMA 5HMMA 2NRXA 5C4ZA 1SFOB 2CJYB 2WF6A 1HNWQ 2LI6A 3M8QB 1SPBP 2KHDA 1S3OA 3E0EA 5LMNJ 3GIJA 1W3SA 2UXCQ 3KTQA 5HHHA 5J2HA 3CCRA 1VGYA 1OMSA 1YHQA 1YJVA 1XN9A 4HMIA 4K59A 3I1YA 3LWUA 1OSDA 1FE0A 2M70A 2W4DA 4X65L 3UD3P 4FF4A 3U02A 2EK6A 5HQMA 1RAAB 2KFZA 2CQIA 1RZMA 5J2PA 2ZIUB 2IHMA 2C3PA 3Q86A 3KK3B 1NZPA 1ZRMA 1HHSA 3H5UA 3DGVA 4DF7A 2WHEA 2MZQA 2ZJPA 2NZCA 2O01C 9ICAA 1RTJA 1E3PA 3CRKC 2BVZA 2JWNA 3U9SA 5L1LA 1CFMA 3UI3A 3I8ZA 3M32A 1X9XA 1E24A 4LF9L 4KGVB 4O0AA 5J2AA 1J97A 2ASDA 1JLEB 3NCPA 1FRIA 2GWSA 2YB4A 2OFGX 1Q82T 4ZP9A 4K14A 2DIVA 3C5GA 3W5YA 3GFKB 1RQ0A 3W62A 2D5DA 1QVGA 3HVTB 3HOWB 4P2MA 1SXEA 1TS3A 1B43A 1H9JA 2AJ2A 1RSCA 1IR0A 4HDGA 4F25A 3OR2A 3ZNUA 4GKJL 3S15H 1YQHA 3IP4B 2FVQA 3R1LA 5E5NA 2B21A 4KY7A 3UVJB 1A0IA 4D3HA 5GAHC 1U4MA 1YBTA 3HHLB 3MGJA 1GT8A 1RT3A 3ITPA 4PH5A 1RHQB 1UMJA 4CRXA 1EY6A 1MWZA 1DARA 2HFNA 5F8HA 2GO7A 5M3MG 4PXBA 3ZZYA 1CKNB 3NUQA 1L0WA 4R25A 1I94F 1LTRD 3QYPA 4A76A 4RPXA 5IP7H 3UNGC 4B3OA 4IUPA 4OEMB 5M5XB 3E01B 1YBUA 2UXDF 3S1QH 2F4VL 4ZOSA 5G0RB 4LFCQ 2NRWA 3HOVG 5C25B 2RKSA 4HSPA 4X64J 5J8YC 3GCXP 4M95A 2IL8A 1T9HA 4CYUA 1E1OA 1RHPA 1NH7A 4JI7Q 2LCWA 4C7ZA 3G82B 5CHGA 2K75A 3ILLA 2VQEL 5H9FJ 2WOMA 1ZQXA 4DR1J 1SKRA 2WVBA 2PI2E 3AL0B 4ILWA 1SC4B 1P16A 1WTVA 2HNDB 3HI9A 4PYAA 4K8JA 3AJDA 1GHJA 4F26A 1WEYA 3DGPA 4DR7Q 1FD2A 4X66Q 3MWBA 3UDIA 4DLGA 4LF5J 4EZ6A 4NLXA 3MECB 4MHEA 4M6WA 3IP0A 2DFLA 2HD3A 3O3LA 1RKJA 3AMZA 1RLDA 3B54A 4JI8J 1ICEB 3GJRB 2IHEA 2J6TA 3ZZRA 4FZNA 3LAKA 3L95X 2NYIA 3OXLA 1WYDA 4A8QA 2WB1F 3QPIA 1STYA 5F8GA 3RRKA 4ELUA 3S16H 3EXCX 4Y2UA 1QSLA 2H4WB 1L1OB 1G6BA 4RW8A 2YKNA 5KG7A 1MC8A 3CIMA 3OJSA 2A6MA 5KFXA 3AFQA 2F0TA 3V7LA 1W6JA 4A93B 1H74A 2QW7A 2JEAI 4RW6B 1Q1BA 3M7GA 1IG6A 1TMMA 4A8SA 4FE3A 2KEYA 4ECUA 1CZWA 3VR6A 4WFNQ 1DTTB 3Q6SA 2LDYA 3PYGA 2K8BB 2BCUA 2CJKA 3FHWA 1VDVA 4A3EB 1TL1B 2RRAA 2NREA 1T03B 3OUYB 4C2MB 3S7RA 2F8HA 4QWDA 4XT3B 1SNQA 3T6JA 3TP8A 2RQ5A 2WB1C 3GR1A 4EO6A 4XQNA 1HYSB 3S2DB 4S0MA 2CZVC 3K0YA 4KFBB 2RRBA 1KHVA 1X4EA 2Q2IA 3VYTA 2E5SA 3BVMA 5EWFA 1L7NA 4A46A 2DNLA 1FKOA 4NLQA 4P7TA 3IGNA 2NVYB 1VI7A 1A7GE 3WK8A 3FCVA 5KFGA 2JA6G 5BYQA 4ELVA 3W7BA 1KEKA 2HVDA 3GB0A 4MIWA 4R64A 4NL9C 5CWRA 2G2ZA 2Z58B 1W26A 3CHBD 4M5GA 1D1UA 2BZ2A 4M2YA 3H7IA 3G87A 1DCZA 3BZDB 3T1YQ 5I42B 1YJ9A 5J39A 4IL6U 4OIKA 2A2CA 3UXOA 1LT3D 3TSSA 9ICHA 2H5IB 1VIXA 4QZ8A 3KNGA 2OMOA 4PG6A 2B43A 5KT6A 4RBVA 3ILIA 3K2YA 3H0GH 4F91B 4APVA 1JI7A 9ICUA 1RT4A 1IJEB 1TL3A 2EK1A 2J0WA 2WF8A 2CPJA 2RHQB 2B7BB 3QZ8A 4IZ8A 2F0KA 1H38A 2P2CB 3R5GA 1P1TA 2UUCJ 1IBLF 1WD1A 3M8RA 1SC6A 5FLXU 3HDSA 1K0SA 4NV0A 4BXXG 4LBPA 4OYMA 2NXNA 2DNZA 5LOQA 4FZLA 4BY1H 3I4MG 4EQNA 3DHWC 3Q8KA 5HMXA 2OD4A 1CI3M 3LK9A 5BPCA 1B53A 4DV0Q 1KKHA 4NY8A 3CCVA 5G5HA 1TT2A 4BS2A 2WB1E 4URQU 1NR2A 4HH0A 3KLHB 3RZDH 2WB4A 1A0PA 4XDCA 4O44B 2TSSA 5DG8A 2P6SA 4FBTA 1U1NA 9ICXA 2WCXA 1GMVA 2P9GA 1AUSL 2P8IA 3BS5A 2QARB 5KFNA 2KENA 4Y34A 2QMUB 2KMDA 4R4CA 4A8XA 4Y2SA 5ALZA 1I5OB 1NUCA 1S77D 2OTJS 2FJVA 1F5AA 1HQUA 2C2ZB 1YJNA 3AU6A 4KK7A 2EYHA 4ZVUB 1UEBA 4CM2A 1EQVA 4BXOB 1O7YA 1HNZL 2RBMA 4JI3Q 2OP5A 3PG9A 2QO3A 1U24A 1LV9A 2O66A 3SCJE 4CQ1A 3LGJA 1TFWA 2ILZA 3PV0A 2E9TA 3OXFA 1L8LA 1RHKB 2V69A 2E9RX 5FOBB 3MD1A 2R8IA 2JFDA 1AT1B 3QFHA 3B4MA 5DO2A 2QC3A 5M3FB 3I87A 2L3MA 3CEDA 3L5KA 5DM73 3F2UA 2KYXA 5HURA 2ASYA 3VQSA 2H3QA 5J0SA 2DNEA 1HFNA 2VQFQ 5DDOC 1YSJA 3M8WA 4OI6A 1C0UB 1FCAA 3PYEA 4DQRA 1FVIA 2C3MA 3U1MA 4CLYA 1LO5D 5A8WA 3I90A 3CP8A 2ZH1A 1LACA 2GW8A 5A6WA 5K36H 5C7PA 2E74C 2M9VA 2CQAA 1R8BA 4IALA 1UVMA 4WFXA 3CNQP 4JI2Q 5GAEC 3PUYA 3ZTOA 1K8MA 5EUHA 1NE3A 2HURA 4I4BA 1K83H 5KT4A 4B3RL 4OWTB 3OL8A 4L5QA 5LMUJ 1N54B 1CUKA 4HIMA 2AGPA 4IOAQ 1Z2ZA 3EA6A 3I7FA 1F9EB 1S1XA 3IAS9 2EFQA 3JSMA 1TP7A 4KKUA 2BE5D 3DLLQ 3HLUA 2LXKA 3GTMB 1WUDA 2B8GA 1ITPA 1X5OA 2XO7A 3MC1A 5KT7A 1XNRF 3GTKH 9ICNA 1OY8A 3KJFB 1ZQYA 4JBKA 5AXLA 8ICKA 4CDGA 2BJ1A 4KHRA 4CP5A 4NXML 1TU0B 5C4JB 1Y11A 4C3IG 5ELBA 4AYBG 3QJPA 1IHZA 5KFIA 3ZDBA 1TS5A 1FIQA 4BBRG 2BPFA 2WB1B 1VS3A 3OBIA 3UPFA 3MHYA 3DI6B 1CK1A 2IFXA 2W04A 5IT9Y 3MPDA 4DNRB 1NM2A 3R2DJ 1BUVT 3I56S 3R2IA 2DGZA 3GJQB 1EFID 3STBC 1B9MA 4LF9F 4PGXA 2HOFA 2EAMA 2W11A 3PIO3 3V7KA 4I0WA 3PMLA 1SMXA 3GJSB 2H1YA 2KKHA 3PCOB 2HYIB 1U9RA 5KFPA 1KDBA 3CO9A 2EJFC 4I2DA 5IWAL 1K0VA 3HKZG 3DOMA 2YU9B 3CDUA 4QIFA 9ICGA 3OSOA 4PQUB 3CCMS 1ZQOA 1QD1A 2I6XA 4OWXB 4NLSA 3E6ZX 4JI4J 1DOLA 4LUVA 4WK3A 5J2EA 4QZAA 3A12A 1EZ6A 1GKHA 2G0AA 3T4AC 1YJRA 2JJQA 2VUMB 4UY8T 2LEBA 5C6AA 4OMFG 3X3MA 1Q8KA 5D78A 5F8IA 2MJNA 1LW2A 1JICA 1VQ7A 2W2MP 2AJFE 2RQMA 4RWXA 1LWFA 3T1HQ 2D74B 1UEAB 5EE3A 3S15B 2F3JA 4E2FB 2XRSD 1Z1ZA 2EQSA 4YHHQ 2KIWA 2F4VF 2CPFA 1PO6A 1A2TA 3H94A 4PRFA 4OGQC 3AD7C 4NB3A 3KF6B 2WONB 1CT1D 1K5OA 1GO3F 3VR4A 5IT4A 4LFAF 1ZQGA 3RUZA 7ICKA 4BC9A 4P0PB 1YZ6A 3SSSA 2F03A 1VBXA 4AQYQ 1STAA 2MB0B 2KD1A 2AQ4A 2GV1A 4A3MG 4XIGS 4NLPA 2L5YA 2R4FA 3FMWA 3UE2A 4PGYA 4YB7A 1EUJA 2VJVA 3UQ0A 3VAIA 1HR0Q 2XHCA 2M8DB 4UW9A 2OD6A 2PW7A 5J3BA 4QWEA 3US5A 4O9MA 1MROA 2HRUA 4NA2A 2XS5A 1H9MA 1PRTF 2A6HC 2JEIA 5A8RB 3VAFA 2RHSB 1RDFA 3H0MB 1N5WA 3NBPA 2WV6D 4CLUA 4UAZA 4CNQA 4EBCA 3G4SA 2OTLA 1BQXA 1CQMA 1EY0A 4A3IH 1DHMA 9ICQA 3CMAA 4FVMA 3CF5Q 1PMRA 1SUQB 7ICOA 4IQZA 3NCQA 3O5TB 3NPPA 4MIBA 4US9A 1UJ6A 2FLNA 3DOKA 1K44A 1RBOB 2ZIXA 3VA7A 4MF2A 3PUZA 4OONA 2HLUA 1U1KA 3OJUA 4C0ZA 1PJ7A 2E1AA 5IYCH 2CH4A 1LEOA 3EZ5A 1C8CA 3C14A 1ZAWA 4CO2A 1X4DA 2B4VA 1JALA 1YIJS 5K5PA 2HBJA 3S1NH 2JGAA 1ZAXA 3J81Y 3V6DA 1ULRA 1BCPD 5KFCA 3TN2A 2RSOA 1VRUA 1RWVB 1HQEA 1PRTC 1ZM2A 3H0RB 2CQ0A 4YUDA 1YKWA 2U2FA 2B2UA 1J6QA 2YTXA 4RKLA 2H3IA 2KXFA 2Q2HA 3UCGA 3S16B 1RTJB 1WF0A 1EETA 1VQLS 5DDMA 5KNIA 2B6GA 3NS1A 4MFAA 3ZZTA 2XGTA 3M32B 1WTFA 3QBCA 4ZCIA 4ES3A 1B7FA 1QM9A 1HLWA 1HRJA 4ICLA 3RR5A 3CCLS 3EN2A 2FGOA 3BKFA 3I31A 1UPHA 4M47A 2EY2A 1L3TA 2KT2A 2YWGA 3V6KA 3OHXC 2F44A 4U8YA 4KY5A 4KLUA 3RD4A 2Q6BA 3OR2B 5LJ3Y 3ZDCA 1JWUD 4OYBA 5JVHQ 3EVMA 1FDDA 1Q95G 3FVYA 1OXVA 4HACB 3B8HA 2CFXA 3K57A 3SENA 3CRLC 3C1ZA 1PAUB 3WK6A 3DLKA 5CZXA 1JJHA 4GFJA 4Z6EA 2MZSA 2AH5A 3MM8A 2CVRA 2AYBA 2R7FA 4NXNJ 2VPWB 2GMJA 5AK6A 1S7HA 1LTAD 3UDGA 1UPMB 4UOHA 2YQ3A 2D41A 4OV1A 1PFMA 2KN7A 4B3OB 2E5LL 1IWGA 2FZGB 3E5SA 2QG9B 3R8BA 1NI3A 4JK1A 3TJAA 1TK5A 3J80E 2F0PA 2BA1A 4I65A 2ROGA 4CYUB 1BNZA 4IPCA 4W92B 5JTIA 5KFYA 2VZAA 2CPRA 2QA4G 4C8ZA 3KZIU 5DNFA 1X3GA 2UUBJ 2WOMB 2DBYA 1RKIA 1P9YA 2F8KA 3H5YA 1SIZA 2BKNA 3QIDA 1TV6A 4DA2A 5GVQA 4CKEA 3PO2G 5KTQA 2HGNA 2ROEA 4KLSA 4WIQA 2DXDA 4LR7A 1B44D 4MYUA 2PC6A 3DMJA 1SE2A 1X4FA 2HVIA 8ICAA 4OJOA 4ZKCB 8ICLA 3ISCA 1WCMH 1WHYA 9ICBA 2OSQA 5IILA 4UB3A 1HD1A 1D6EC 1TE2A 4GVBA 2B63H 2F1MA 4FZMA 5IIFA 5D3GA 5HGQA 2JXMB 5KFBA 4X66J 4YY3Q 1SYDA 2DN8A 4M6WB 2HBYB 1NDPA 2OWOA 1PVQA 1KNAA 3CYMA 3BGFA 3R5CA 2HZVA 2A1AA 1HBMA 5JJKA 2LQ5A 4OYOA 1SMYD 4EFAC 5IP9H 4M1UB 4B9VA 2C2OB 5AFWA 2KHCA 2CZ9A 3DHXA 5L46A 1SQGA 4XO0A 3QRQA 5AE1A 2CPDA 3RZDB 3T51B 4ZCKA 2YKNB 3R5JB 4RW8B 4RBUA 2HS3A 1XX8A 3NEMA 1FK9A 4CTAA 3FSYA 3KOOA 2ISOA 1D5XC 1ZA2B 1Q78A 3GP9A 1NJIT 2A68D 4IUFA 3C23A 3QU9A 3HM9A 4TURA 3D0GE 3QZ7A 3N6RA 3L7ZC 1XK8A 4C3HH 3J7YU 3LDAA 1WWVA 1VDHA 3HD1A 3JAMU 4WXWA 2LA6A 4WIIA 1ZPVA 1BPDA 2WFWA 1NZBA 4TSSA 3J7AN 4O5CA 4BBSB 4RZRA 3MEDA 3OTCA 4M5IA 4RPFA 2K7VA 1P8LA 3D54A 2V2KA 3OXGA 5EE1A 3PHTA 3DU6A 2MTLA 2J8AA 1WYGA 1STGA 5J1ZA 4QNLA 4YMNA 1S5DD 1QLNA 1QTNB 3LALA 4AP9A 1FKOB 5J29A 1QE1A 4B3RF 4IDKA 2MGZA 5GQOA 1S79A 3H40A 1Q1KA 4Z37A 3EPIA 2ZJQA 5LL6S 4JYAL 4DCOB 2XYHB 3DDHA 3CCJS 5CGKA 1VQYA 1V1QA 1NK6A 2HQLA 4B9LA 3RAMA 2IHFA 4B3TJ 2HMXA 2PEHA 2ZBCA 1XJWB 4ED6A 2EE1A 3L9ZA 2F1HA 3VVTA 5IODA 4RGNA 1SNPA 3DWPA 4HEA9 2AGQA 1FKPA 1K83B 3V2TA 2E8MA 4LMZA 1JOOA 3ALRA 4F92B 2KCNA 1U47A 5ADZA 3PQIA 2RT3A 1RT4B 3MM6B 4KN7C 1XPOA 4LUZA 5FJ8G 2W7OA 2W01A 3D9BA 1QVFR 1XSLA 4PAAA 5KFKA 1FO4A 4DGZA 1IM4A 3H42A 2EZXA 4KB7A 1S0MA 1BGXT 5IS2A 2KUMA 2JV3A 3CXCA 2NRTA 4JV0A 5L39A 3T3FA 2FVSA 3UD4P 3J80i 5IWAF 3EVQA 5THWA 5IY0A 2PO4A 3ICLA 4RNHA 3MCNA 1CJKA 1QSSA 4U7UK 1ZQBA 3UWTA 4OZLA 1U09A 3PJWA 3RFAA 1L0XB 4OIXA 1OW5A 4QR0A 4U7UD 1UETA 2LHTA 1QJHA 2KXNB 5AI0A 1MMNA 1NUEA 3SSRA 5K8MA 1K0RA 3BS5B 4EEYA 3M4OB 3IA0A 3NVZA 4KMOB 3LWEA 1ICFB 4UP8A 1DGSA 3HSJA 5HVGA 3BN7A 5SUHA 3RJJA 4HMJA 2B56A 4JV5L 1S0NA 1FYCA 2GQCA 2PFOA 5KFZA 1UE1A 5CJ7A 3ER0A 2TMPA 3URYA 2GHPA 4JI6Q 2HPUA 2B0CA 5DZ7A 4ODGA 3DOLA 2IDEA 3PIOA 3QT7A 1HJPA 2XZTB 1V1PA 3H98A 3NKYA 2KEDA 4QMGA 1ZYQA 1ILQA 2Z8QA 1UFWA 4JWNA 4I2PA 4DUZL 4DK6C 3EX7B 2BPGA 4Q44A 1Y5IB 2H54B 1X32A 1PFBA 9ICLA 4OX9Q 3GE9A 4ENOA 2KRBA 1VK3A 3SFGA 1AFJA 5AK5A 2UUAJ 1TFYA 3M4XA 1GQEA 2HQ3A 2J0TD 1UKUA 4FXWA 3HOUG 3TANA 2R7WA 1CSPA 3S14H 2B2UC 3CIZA 5A8WB 2HCFA 3PKYA 2GVDA 2QYCA 4C9DA 4UAIA 2LM1A 3PRDA 4HIDA 8ICMA 5AKXA 5CV6A 4K5RA 3HT3A 4USUA 2ZM6Q 2XLIA 5LM7E 5DG7A 3IWLA 2FJ2A 3KK1B 4F4YA 5J0YA 5F3XB 3OTOQ 4DN4M 2KECA 4YDDB 1PYBA 4DL5A 2EYFA 1MD2D 1RCXB 2AQ2B 1WF2A 4IO9Q 2DJGC 5DRKA 3DV9A 3CCUS 4Y00A 1S1XB 3H3VI 4DV5L 1ICWA 1Y8NB 2HG4A 2HHHQ 2NBFA 2X6GA 4A3KH 2I38A 3BGRA 1U1RA 3PFEA 4A4IA 1VQ8A 1TWFB 3BO2A 4QIVA 4IFVA 1RADB 5KFHA 5AKHA 1NSKL 3IFTA 4JI5L 3M2RA 1X9WA 5JAVA 3TVYA 3MOZA 2B4PA 3SK5A 2UVRA 2XMUA 4RQ5A 2JLEA 2MDAA 2PMZD 3NRWA 3EXYA 9ICOA 4A3IB 1EZ8A 5IGFA 4ZPWR 5KL8B 4Z7CA 4JI0Q 3QG1A 3HSZA 3J7Z5 5ALMA 1R3NA 3MGHA 4ZRZA 3HMJG 2GA7A 1CLFA 2W8KA 2ZIWA 4YD2A 2UV8G 1ZEQX 3ADAC 3V7JA 2W2OP 3P20A 2B9XA 4U67Q 2YWFA 2G5DA 4OZ0A 2J7UA 2XNAC 2R42A 4JK1C 2MXYA 4IPDA 3HW8A 3S1NB 2NYZD 1NJWA 4PG3A 1X8DA 1RT2A 5F0UA 4DR1F 1ZJNA 1MHWC 1UE7A 2JA9A 2QN6B 4CRJA 5HQ8A 4A48A 2IHNA 4EQPA 4OI2A 3J81j 1PVPA 2B3GA 1O08A 3W2DA 3CJ8A 1NDCA 3ZYYX 3HD2A 1VC0A 5EAYA 8ICUA 1TAMA 5FLXL 3SMZA 2MUTA 2RDIA 2VIXA 2O6KA 3JQMA 2OPQA 2HQFA 2BX6A 3OFEA 4XTTA 3IRWP 1URRA 4LF5F 5KYLA 4KHMA 4LJZC 3IM9A 2EVZA 4KLGA 4NLGA 2Z7JA 2E1RA 4J9VA 5JJBA 3ZZZA 3TRZA 4K2JA 4BY7G 1FF2A 4LT6A 1REGX 1ZD3A 2XLJA 2DKOB 4JI8F 2DISA 3D1HA 2F0LA 1FL0A 3FRYA 5HANA 5HY6A 1JX4A 3EYZA 2QA4A 3DKDA 4WU2A 4K4HA 2DGXA 4UY85 3LH2S 5CP2A 4DR3J 1LWFB 4A3LH 1NHKL 2KKVA 1WTRA 4I2HA 5BR8L 4ECVA 4O2DA 1HNXJ 2X1BA 3N6MA 1X66A 2PNRC 1Z47A 1IBMJ 5EQ0A 4HSVA 2JYOA 5JPMC 2QLBB 3CJ0A 3FRZA 4TY8A 1S1TA 3OR1B 1HARA 3OL7A 3UMCA 2AQ3B 3IR5B 3L3OC 4IUTA 1DFDA 1OQ3A 1YRUA 3BG3A 2KT5A 5CR3A 5IGBA 1B3TA 1VLBA 5EPKA 4OCZA 3MEHA 5K20B 1GXDC 2CRXA 1GNKA 1TR0A 1NSQA 3G71S 4YMOA 1VCTA 3NS7B 1MROB 2AF6A 3DDIA 2DWQA 4K0KQ 1YTYA 2OJ3A 3MR7A 2HWIA 1B8AA 1QZHA 1OIAA 2Y0SG 1VRTA 2N4CA 1X4BA 3NBPB 2DCLA 4DUYL 4KIAA 2CKZB 2BANA 4X84A 1WC6A 1S72A 5IQ6A 5K14A 1ZD5A 2XG8A 3IG8A 3H8WA 4HHJA 3I55S 3TUJC 1B4SA 4RHRA 5A8KA 4MZ9A 3UMBA 5J2BA 1NR4A 1FERA 5DAUA 4C4WA 3S6EA 2CPXA 4M5MA 5AKLA 1I6HH 3QGIA 4A8OA 1DLOB 1S9FA 4QR1A 4C11A 2ZIXB 3T13A 1UW4A 1NDKA 1K8GA 3JYTA 1UE6A 2HWHA 1G91A 3C14B 4CLSA 1H2UX 2DNNA 2B63B 3ETRA 3CJ3A 3J80c 3BGUA 4I2FA 5F8JA 3V6DB 4OJPA 4R8NA 4A3GB 1X5SA 1J2NA 2L5TA 1VRUB 3SI8A 4M8AA 5D0RA 1HQEB 5H1SV 1I1GA 2J4XA 4QJVA 4OYZA 3OL9A 2BJEA 2EY1A 1I94Q 4BWJA 1T5EA 4CI0B 2VKZG 3A4TA 1J5EJ 1KAAA 5D8HB 5I3UA 4ES2A 2EPBA 2YY3A 1EETB 2UXDQ 2OGUA 3HJFA 2A8VA 1RGVA 4P4PA 3QJYA 4NPOA 2UUCF 2R8KA 1HA5A 2PYKA 1IN0A 1ILPA 1JWSD 4ICLB 1S0OA 1SROA 2R92G 1YX2A 1T8EA 1XSNA 3JSBA 1C1BA 4F67A 1NRKA 4AL5A 4GOPC 3GV6A 3CCTA 4C3HB 3KNAA 1J9OA 4MTNA 2H4OA 4B3SL 2DO0A 4KHPL 1Z3EB 2K89A 2R18A 2Z2YB 2C3YA 1KQGB 1N5SA 1S12A 1N33L 3DLKB 4X62J 1C48A 2MGSA 1QQ5A 4RMFA 1D5MC 2ZITA 3MM8B 3FAHA 2QIFA 1UPPA 1QJOA 3K1ZA 1RYSA 4NCBA 1XMBA 2R61A 2A73B 1IKWB 2HFUA 3X3UA 1HA1A 5D46A 3DEPA 2RVLA 1FDNA 2UU9L 3QWNA 1F1BB 4PEOA 3EW9A 3PR4A 2AYGA 4DMZA 1RF2D 1EWCA 1RTIA 4AYBE 2VL1A 2VZ9A 1B2TA 3KG4A 4LK1C 4IUNA 2Z30B 3LUYA 3DM1A 2JH1A 1WSVA 5IT9E 8ICNA 3M1YA 2AUKA 2JSOA 3TFSA 4JPBW 2CG8A 3SXHA 1CJUA 4OO1H 1HPZA 2D0OA 2DXEA 3A5UA 4I2QB 1LUZA 4HJ7A 4FXVA 4OI3A 5J0QA 2RU9A 1F2ZA 1NK7A 5JJIA 3TAMA 3UW1A 3CCZA 2FZKB 1E6VA 1SXTA 3HKZE 3ISNC 2EYMA 2LFNA 3E58A 3DMJB 1U0LA 1KD1T 2UVUA 9ICVA 1PZID 3G7LA 2DRBA 2BUNA 1LV5A 2MP1A 2LYVA 2EC0A 4DX5A 5MLCV 4GVBB 4NLUA 3EWGA 3ELHA 1ZQIA 5D3GB 3UMGA 3P8BB 4JV2A 2ICIA 4RGMA 5BYRA 4I68A 4L3KA 2EDUA 3PW5A 4C80A 1STNA 2R7DA 4DV7L 1QG7A 2NZOA 4QBUA 1HHQA 4JV5F 1CSJA 4C3JG 4DF4A 3M7NA 2JA8G 4MEXA 1C9OA 4NKLA 2L9NA 4YDXA 3CMQA 1UNSA 3ZNJ1 1NXIA 5J2KA 5AM5A 3SAGA 3C6TA 3CJQA 1KLNA 4K8IA 1FK9B 4CTAB 3TACB 3IR7B 1BR9A 3CDWA 5T41A 4DS5A 3FCHA 3H3VH 2FVRA 2VV5A 1V8QA 1FWLA 4PZNA 3PGZA 2FC8A 2HFSA 2EFGA 1PXUA 2IOFK 2JVOA 4JBJA 2ZNZA 1G7CB 2CPZA 3IMQJ 2FHJD 1ZZNA 5KNBA 1SC3B 3GTOB 2JA7H 2NZHA 3KBGA 1YI2A 5KFLA 4MJKA 3RB6A 3MPWA 1F9RA 4O0NA 3MEDB 4AL7A 4YQWA 2MRLA 3RZAA 3MUMP 1UT5A 3KWMA 3RYLA 5T1IA 1KRPA 4TKOB 5JVH3 1LKYA 1M5PC 1LNQA 3K8AA 1IBLQ 3IAYA 1HIYA 1V3ZA 1HH2P 2RD5C 2VPZB 4ED0A 2HNZA 1X55A 1ELOA 4PNYA 2IC3A 1IZ6A 3H15A 2IJ0A 1QE1B 4UF4A 2CWPA 4I7ZC 3Q0AA 1XR6A 3BKUA 5B0AA 2XULA 2KJVA 3K81C 1URJA 1VMPA 4C3IB 2CQ1A 2Y1LB 1PH1A 2YN4A 1WHVA 8ICOA 1VQ9S 3AB9A 5CMDA 5E41A 3IKJA 3WKCA 4DR6J 1VLYA 3NRBA 1UVJA 4OYAA 4C8YA 4NLRA 5JUMA 3D1QA 3QU4A 4CH1A 2L1BA 4JI5F 3TZZA 3O8WA 4MT1A 2NPFA 2VOOA 2DH9A 1IXKA 1E6YB 2W2QP 1HQMC 3HFVA 4J8QA 4KH0B 1TQLA 1N34L 4ZK9B 1IBKQ 1KBRA 2FGCA 2LQ8A 2IM1A 5HATA 4PXDA 4A3JG 2EOTA 3GP7A 5KG6A 2QGFB 4A3BB 1M5VC 2A0FB 3HKZB 5TISU 3HRZC 2EWHA 3I9V9 3D3RA 4F3MA 2MAXA 2VA8A 1PK3A 3FKIG 1HZ9A 1IW7D 3CGIA 4LF7J 2NUHA 3AU7A 3DLEA 4RUAA 3CCSS 4EX5A 3KJVA 1RYUA 1TS2A 4CBVA 4YR3A 1JLQA 5KG3A 4L63B 6AT1B 4TXSA 3N6NA 3DM2A 2JA5H 5EBCA 4KKOA 4N8FA 4GN3B 2OQ0A 2ATLA 1YBAA 3I5CA 4JOIA 3PSIA 1ZKOA 4DK0A 4QGUA 2B9EA 3EE3A 1EQTA 3N5BA 1SKWA 5CV7A 3TA1A 4DOZA 1K73T 4M9JA 5IOLA 4PG4A 2BOPA 1CJVA 1HNVA 5ALYA 5E3CA 3UN3A 3BO3A 1GUSA 1F6TA 3RBDA 4TNOA 3OPOA 3S17H 1QCKA 1BQNA 3K59A 5KG1A 3RU0A 4C98A 3G86A 4TU9A 2E1PA 4QZFA 3QJLA 4WU3A 3PO3G 2J8SA 1APSA 3W9HA 3DOLB 3BN4A 2GJ2A 1XNRQ 2N3OA 2NTTA 1KVKA 3VR3A 4ZAIA 3UDCA 4OZ1A 4H4KA 3H4BA 2NTSA 3OLBA 2P9CA 4I2PB 5KIXA 5AE2A 4UARA 2F9DA 5ITHA 4UUXA 1K0TA 1NAPA 4EX7A 1KR4A 4ETZA 5HMYA 4ZJLA 4PG8A 1EJ7L 4US8A 2R3ZA 3AQQA 3C2MA 2BXJA 8ICCA 3W64A 2CRLA 4A4JA 3AD9C 1KDHA 2A1JA 2GVDB 3GO5A 5CXTA 1FXLA 2H51B 5KNCA 1RZTA 3RAXA 4DUYF 3NE5B 4ICAA 3Q22A 1MWQA 1PDQA 2GVZA 3TVKA 3PW0A 2Z1CA 2C2NA 2BCVA 5E79U 1Y7PA 4KSEB 1C0TA 2NZ4A 1N61A 4Q0FA 2KVSA 2HBQB 3H3VC 1RCOB 1X9MA 5C3EH 2KRRA 2ZVSA 3M8PA 3NG8A 1KLMA 2BKPA 2YMQA 3D0HE 4NLVA 4B9NA 2P35A 2HI0A 4X5VA 2BJ9A 3WC0A 4I1TA 1P1LA 3P1HA 2FDRA 2MLZA 3K7AB 2F3NA 1D2BA 4CT9A 2M7SA 3WOEA 2RCFA 2PMWA 1AE3A 4YIJA 1L2FA 1XXGA 1OS5A 4NXNF 3CUNA 2IBKA 3M2RB 2CQCA 2WAQF 5I3QA 4BUGA 3ZZUA 4PWUA 1XR5A 2F0VA 3W60A 1SL0A 4DV6L 1N32L 3NGKA 4Q8EA 3FMBA 3LP1B 2XSCA 1YHBA 3W8PA 3NVYA 2F0MA 1QUVA 2QV6A 2VG5A 2JXJA 1FFGB 2ZIWB 1XYIA 3M8ZA 2OEJA 1VQ6S 3H4DA 2OH2A 3JQJA 4DF8A 4H44C 2K8GA 1H73A 4DN9A 3MD3A 3TADA 2HAIA 2LBOA 3QEAZ 4LFAQ 3K5NA 4IQXA 1IV8A 2UUBF 2XGPA 3M7DA 2FFKB 5AJ3J 1XPRA 1RT2B 5GMKa 1Z6HA 2OEMA 3I32A 3KJNB 2N78A 4ANCA 7ICMA 1H9RA 4RCNA 3U1LA 4FF2A 4B3SF 1O6XA 2B2YC 2PFFB 2LYAA 4BLGA 2WAQC 2OPQB 2AYEA 2HVHA 1NK8A 1VJQA 3UCUP 4M5DA 4IS7A 4LF4J 2OMLA 2UZAA 4FNHA 1N33F 5CR0A 4JP8A 2V8DA 2UXBJ 2XSFA 1D8YA 2LSSA 5ETOA 2R2RA 3NWTA 4DV1J 1T05A 4FF3A 4TRDA 2X7IA 2YKOA 3H8JA 3MAAA 1MSHA 5H9EK 1WC5A 2VFUA 4GC6A 2AMCB 4JG2A 4I6AA 4ZCMA 4RQ3A 4G1IA 1DXSA 3M6KA 2A5HA 1RU1A 4DV4J 2QL7B 4OJ3A 1QB5D 2IWHA 4ZIWA 1GFWB 1EQRA 4NRTA 3Q8MA 2XMTA 5A2QY 4C56C 5K8PA 2C35B 4TUQA 1X0PA 3RH6A 3I2ZA 4TY8B 1S1TB 4YN4A 3FKBA 2EAPA 1M5SA 1PRTD 2V8GA 2PIIA 4ZVSB 5KFAA 5IM0A 2DYAA 1VQHA 3TZDA 1RT5A 2ISPA 4W4MA 2BKEA 3R7BB 1FT8A 1RAJA 2LY7A 1GXLA 3FQKA 1N5YB 4ZLPA 3AB4B 4CZCA 2A19A 4RGTA 2VIHA 3NAIA 3TZYA 2R7SA 2K4KA 1YWXA 2RF4A 2XCPA 4OYXA 2VB2X 1EARA 1VRTB 1XIQA 1R0AA 3GIKA 1BUXA 2PZWA 2M8HA 2VA3A 5KYIA 2BANB 2KTQA 2K6AA 4I67A 2Z4IA 1SH3A 2OHFA 4K50A 5ALWA 1F60B 2K50A 1LFWA 3WX4A 2CG4A 5IC4B 1TUVA 1Q81T 2YWEA 4DUTA 1V1OA 5KOWA 2H3EB 1OPIA 2OTJA 2IT1A 4C11B 1JQYD 4TLRA 5FLMG 5CZVA 3GFYA 1EY7A 4OJHA 3V2UC 1ED1A 1U2CA 3MPYA 4O4RA 1A76A 3NXZA 3U4ZA 2F4IA 3H90A 1FWKA 2Q8TA 2OEKA 3HK2A 1Q53A 8ICZA 1T9WA 4DPTA 2XMJA 2ZOFA 2W2NP 2J7WA 3MMJA 5AI4A 3NTKA 2VBWA 4U673 2G4BA 1UFKA 3GTJH 3HJVA 2XS7A 4DR5L 1CKMA 2CDQA 3ULHA 3WK5A 3E2EA 3BDCA 1RISA 2I5JA 1F9QA 1FGBD 4FXDA 1VISA 4XYQA 4ECTA 5DQIA 5I3UB 1REVA 2GS8A 1R31A 2VL6A 3GTLH 1EWHA 1E2WA 2F0HA 1U2RA 3KHHA 1NK4A 2KJ9A 3FGVA 4LF8J 3UQ2A 4QZ9A 4C4TA 2ZUAA 1ZQQA 2WFAA 2UXDJ 4NM2A 3Q8PB 5GAGU 1K3RA 3WK9A 5FP0A 4UB2A 2XVSA 5EBDA 4WJWA 5F3ZA 3IG1B 2VG6B 1H2TZ 1C1BB 2RSNA 1BBXC 4KGZB 2KG0A 2HOQA 2V8HA 5IYDG 2JVRA 4F87A 1Q12A 4MK8A 3UE0A 2JA7B 3JPRA 2K01A 1PYWD 2M9NA 1XMOL 2Y1RI 1EQQA 3I4NG 2B4OA 5GADU 1KFTA 2GVBA 2XWBB 4JOIC 4QIGA 4KE5A 4A93G 3C1FA 2JRZA 3MURP 1HUNA 1N34F 4OHVA 1HFEL 4LF6J 4PL1A 2D8CA 1M90T 1Z1VA 4M9LA 1FDBA 3CDEA 1L7MA 2LXFA 1Z4UA 1RTIB 2PNHA 3HOZH 3GV5B 2C22A 2RH3A 4A3EG 1WEXA 3HOYH 3ZTQA 2GFFA 3EIVA 1I3OB 1BD6A 4DV2L 4IRDA 4TYBA 3VYUA 8ICXA 3MPUB 5L8RC 1PV4A 4DCCA 4CF5A 1HZAA 2E76C 4OHWA 4L73A 4WFBQ 3C1YA 4EENA 2HBMA 2L0CA 1CJUB 3VGTA 1HPZB 2MMYA 1H72C 4X4TA 4POGA 3QO2A 2CHBD 3BBCA 1RBAA 2UUAF 1KQKA 4H4KC 3NLCA 2RCNA 5K4LA 3SE0A 3TAMB 1JROA 3A0HU 3HZEA 3EWAA 3SQGA 3T9ZA 1Q46A 1X3FA 1TV9A 3OPXA 1BOSA 4IG3A 3CCMA 4OI1A 1KABA 1Y4ZB 3UQSA 4PHAA 4H02A 3LVVA 2HZCA 1SNDA 3BS7A 3D2SA 1YZ7A 2K4IA 2BEFA 4N77A 1W2BR 4AXJA 1K28A 2V1CC 3J81L 5AM0A 1ACMB 5DDPC 1FJGQ 2F0IA 4P10A 1HNIA 9ICEA 5KFFA 1XC9A 3SGIA 3P96A 1WUUA 2JA5B 3V05A 3VV2B 3W2VA 4ZPVR 2R7ZG 3P4UB 2HSZA 4GIBA 1JLGA 4DR4J 2D2CC 4J03A 1UCNA 1NHVA 1YJWA 8ICJA 2ZJ5A 5H2FU 1JIHA 1LXJA 4K6DA 2EJMA 5M5YH 1TUGB 4C3KA 1NCLA 2L55A 3I4LA 2CZ4A 1AUDA 2BE5C 3NTUA 1SXDA 4CH0S 1G8ZD 4BHQA 2J6UA 1MMLA 5AM4A 4N8X1 1GVPA 1H2VZ 1D9FA 3LGMA 3TX8A 4DL7A 2DBBA 1WVLA 1ENCA 3I0RA 2R2TA 4EYIB 1TVXA 4CKBA 2E8PA 3LP2A 3ZTRA 1XNQL 3UE1A 5A35A 4Y7NH 2PQAA 4QZEA 3M30A 1EOTA 1C7YA 4LF7L 2QFIA 2YNGA 1UAPA 4UHVA 3GU0A 3FFIA 1FEZA 3DUZA 8ICFA 1N9WA 5EKLA 4KC5A 4DFJA 5D0EA 1WTOA 5D4BA 4UDUC 1LKYB 2BDPA 1WELA 3FM9A 2K3KA 4KT0C 4ACOA 2I9GA 2FZCB 1KTQA 3IAM9 2YKPA 2IC3B 1L5UA 2F0FA 2DHHA 2CKWA 7ICGA 4O3NA 4NYOA 4ZP6A 2W9AA 1K9MC 2ZDOA 1WI6A 4J5OA 2IY5B 1VHFA 4C0OC 2AZ1A 2YMMA 2XMAA 1TKWB 2YTCA 2C2DA 1RAFB 4ZDNA 1WOOA 1RQLA 3N01A 3RJEA 3OW2R 2GCFA 3CMES 2CN1A 1WG4A 1UJ5A 1EYGA 5AXMA 1A77A 2G0CA 5BYSA 4F04B 1PYSB 4DR3F 2AWNA 2P6UA 5AIBA 3B78A 9ICCA 1KC8C 1HNXF 2DR8A 1LXNA 3M8QA 1IBMF 1XMQL 2EFPA 2A6ED 2JN4A 2ZTCA 3F5EA 2PZTA 2KU7A 4KN4A 2ASLA 4C0HA 1Z19A 3DLEB 4P2XA 2MYFA 1SLJA 5D65A 4IUVA 5HMLA 3KJVB 1UVNA 4HTJA 3L9AX 4ZPTR 1JLQB 5FK9C 3CCLA 3DM2B 4QPXA 2PD1A 3CKIB 4Y2AA 4KKOB 5AM3A 2ZIUA 9ICJA 2EFVA 4Y2YA 2K3IA 3H5XA 1MGSA 5ALRA 3KHGA 4K5WA 5GTIU 2AWZA 4TU7A 3FNNA 2CQ3A 1ZQDA 1FRLA 1HWIA 2WVDA 4XXEA 3TQ1A 1TWHH 1BCPF 2FMQA 1CJVB 1NB2A 3BBBA 1U0HB 1HNVB 5ALNA 3KOJA 1JJ2A 2QLTA 5J2CA 4A3MH 2DXFA 3QSIA 3KUPA 3HHKA 1BQNB 2GZOA 2ZXRA 2WB1G 3MOJB 4P2CB 2XICA 2ZJAA 4GKKL 1PUZA 3PACA 1U6ZA 4R0JA 5L38A 2V2QA 2VFSA 1NJZA 4R8IA 4AD6A 3B9JA 3KKAA 2A10A 5IIIA 4QZBA 3BO4A 5FLXc 1RXOB 4ZK7M 4X4UA 3NTIA 4ZQ3A 4Q2MA 3VZHA 1VQPA 3JAME 1PFNA 2G5HB 1QNUA 3D3BJ 3CU7A 2KCCA 1RG6A 4X65J 1J5EF 3HOXH 3G6EA 1HNWL 2R93H 3LX0A 2EANA 1BCPC 2UXCL 2DRAA 4G6VB 3L7OA 3LPEA 2I8EA 3UXNA 5EWEA 1JOKA 2E44A 4X64Q 1NSAA 1WTWA 3E01A 1ZPWX 5ELNA 2KVCA 2OPRB 4ZVPB 2A1JB 1VIOA 5B09A 1IR2A 4Y6IA 3CJ4A 1KRTA 4A47A 4LVNP 1NLKL 1HBNA 2QE5A 2VUMG 4NI2A 4YXJA 2MKIA 2GVZB 4OJ1A 1R6VA 2VOPA 4DQPA 4DR1Q 4LF9J 1R7IA 4ALPA 4M5LA 1B4FA 1C0TB 2ACYA 3UDVA 3W65A 1Y00A 1M1KT 3KFUF 1AYEA 3M8PB 1KLMB 1FXDA 2JRSA 4NCGA 2HNDA 1Y0HA 1MJEA 5I6YA 2JL9A 4EZ9A 4LF5Q 2LDIA 3NQIA 4Y28C 4RA8A 4GKJJ 5E4WC 2Z6KC 3RTVA 2B4UA 3Q2SC 1YJ7A 1RWPB 3AHPA 1SJED 2AJQA 4JI8Q 3MECA 1TXYA 2WK4A 2EYOA 1YRTA 2D3UA 4KLIA 4OELB 4UUWA 4DR5F 5ALKA 2ERRA 3K1RB 1M4VA 5IP7G 4ECXA 3HP6A 1KP6A 2VG5B 3I96A 2M9KA 1FXRA 1AFIA 4WP9A 4ZLJA 2ZJRA 4WTOB 5C4XH 1TY0A 4CHTB 4K6LA 1KLGD 4ANDA 2E1FA 1KWMA 1M5HA 3N4MB 3KJOA 2F4VJ 2ZFHA 2NN6I 3HSGA 4RFBA 9RUBA 3PTWA 2AJ0A 3PFOA 2QKIC 2M4MA 2OCEA 5ALFA 4QQBA 1JLCA 3KK2B 1ECWA 3GTJB 1LWCB 2F5GA 2OT2A 2ZZMA 3C2LA 3JQKA 3H2LA 2ZJQQ 2VQEJ 5IGGA 2I5MX 3BU2A 4E0DA 3CCRS 1NMEB 4ZLNA 3SK6A 1RL2A 1YNXA 3CD0A 1RCVD 3KLRA 4M5DB 3GTLB 1RWUA 2OQKA 3M1VA 1TL1A 4LFCL 3JTNA 1MQ2A 3SK8A 3A3PB 3CCJA 3GD7A 4RO0A 3POTA 2R7RA 2J5AA 3DWQA 3GIMA 1JXVA 1F9PA 5D14A 3HX9A 3OTBA 2R8GA 1T05B 4DG1B 4JI7L 2WTFA 2DGQA 3MAAB 3O44A 1Q5VA 1PVRA 1AXQA 4WWSA 2CJ9A 5ISRA 4HJ8A 2V9WA 4FO6A 4K4SA 3CPWA 3SEIA 4C8LA 4ZVTB 3W2WA 3IBFB 3QGHA 3AQPA 2L15A 4L5RC 4GO7X 1F2YA 4UZCA 5LXYA 5FD1A 1Q82C 2Z4HA 5I4MA 5IIMA 3HVAA 4OI0A 4DV2F 3Q83A 2XGQA 2NB0A 1EX8A 1IBCB 4DR7L 1SMYC 4UAWA 2H9ZA 2ROPA 4LRDA 3C66A 3DRPA 5I42A 1EY8A 5IM0B 3EGNA 3CJSA 2JEJA 1WD0A 3W9IA 2BCRA 1BO0A 1RT5B 2WKCA 4PZ7A 2W9BA 1TVAA 3HCXA 4P4OA 4LVOP 3D2QA 3W61A 2ZWPA 2A68C 1RTHA 1T95A 3HOZB 3RJGA 3QAEA 4B3ML 2JA8B 3JAMi 4LF8L 3HOYB 4OYIA 5CD4A 3F0NA 3NAHA 5AK4A 1LM0A 2E1MC 4LIRA 1PYTA 2C2KB 2UUCQ 2W1BA 3DXSX 4IYQA 1R0AB 4B08A 2MKHA 2LQJA 4RG1A 2DRDA 3LNNA 1UEUA 2Q6CA 1R8PA 1NPRA 3TP5A 1Y1VB 2E5JA 3GTYX 8ICWA 2EIFA 4L76A 4Y2XA 3P7JA 2HNYA 3M6WA 4M8LA 3SHLA 4DR6F 3W8GA 5EHHA 1MJCA 4I69A 2G09A 2F1JA 2YB1A 2ZUBA 1F9FA 4RW4B 4NPSA 2KYZA 4UT4A 3T53B 5HL7Q 2CQPA 3NGUA 3VGSA 1PZNA 3PIOQ 1T9VA 2AX0A 3W63A 4TVAB 3FJ2A 3GDEA 2WBRA 4PPXA 1N5QA 2IRYA 4ZVQB 1I3QB 1WC0A 2E66A 4I6YA 3ISDA 4WTYA 3SCKE 4ED3A 4H4MB 5FKAC 2RMLA 2RF2A 2O4XA 4ZVRB 1OWXA 1BCPB 4FYDA 3TAPA 2WHOA 3NQTA 3CE8A 3VDYA 2I5JB 1XNQF 9ICSA 2MA1A 1TK0A 4N7TA 4HHUA 3H0GG 4A8WA 4UASA 2W43A 1REVB 4HN7A 4LF7F 2YWWA 3MR3A 1JRPA 1Q90A 5CYJA 3CC4A 4YB1P 3CRXA 3QT8A 4O42A 2AD9A 5IFMA 4RH6A 5M5YB 2F0JA 2GQQA 3KUHA 3T1YL 2KG5A 2CQOA 1S57A 1NK5A 5BN3A 5KAFU 2YMPA 1LW0B 4F0HA 2RDDA 2A3VA 1HHVA 1ZQJA 4F2SA 3ISND 4XK8C 3FBBA 4ED1A 3T41A 3ETMA 5HR6A 2NCKL 1C2PA 2F0EA 4N9PA 2PSZA 2F0DA 2RQXA 3BYRA 3NEKA 1D5ZC 1H6KX 5FJ8H 2H3ZA 7ICEA 4WBFA 1C0UA 5CYUA 3ZZOA 4DN0A 1TS4A 2KKPA 3VC8A 1LTGD 2N8NA 1G6ZA 3DCAA 2PT0A 3OT9A 5LL6X 2LM4A 1UUPA 1XTCD 1PC4A 1ENAA 2G5IB 5LMUQ 2NS1B 2DNGA 3MXPA 2RRDA 3RJKA 4JV5Q 2AYMA 1IKLA 2UUWA 3A7LA 2Z9HA 4DV0L 1NHUA 5CD4H 1T9TA 2FJ6A 3H5SA 2HOIA 4KY3A 4B17A 4F36A 5T14A 1SR3A 2E2IH 4PPDA 3THPA 2LXJA 2J0SD 4J6HA 4QZGA 1FJ7A 3CT9A 2X51A 4HJ9A 4MYTA 2HVEA 1HNZJ 4X4SA 2HIVA 4A75A 3ULLA 1S10A 2DCUB 4EGVA 1W6KA 2G9HD 3ND8A 3TO8A 1DRZA 4WRDA 3SQGB 1TFRA 7FD1A 5C24A 2G0IA 5A76A 2RJZA 4FXGC 3RR8A 1RA7A 4IG3B 1GHKA 2OKQA 4CO0A 1U1OA 3TVZA 2BJ7A 1IJFB 3VR1A 3J80Y 1U4RA 1UT8A 2KOLA 2AKWB 3ICXA 1TWGB 2B2VA 4J9NA 3PO3B 4JI3L 3GSIA 1G1XA 1YJ9S 3EDRB 5K36G 3DEEA 3T5JA 4K2LA 5GAHU 4NM1A 3CD6A 5BN4A 2RS8A 4JV1A 2HW3A 1HNIB 2DHXA 2W2PP 1FJCA 2PMZF 1X4GA 3UNYA 1RB0A 1H98A 2XWYA 2XIWA 4RQ7A 1RLCL 2DITA 4ECZA 4IQMA 3GDXA 4NL9A 1TU2B 2JH7A 5EE9A 2G9DA 3QU2A 2VQFL 2HWTA 4B3RJ 4GKKF 4BWMA 1FDAA 2YX1A 2OPSA 3EBEA 1SJ4P 4MF8A 1V5IB 3SAFA 4CO4A 1JKHB 1TWHB 1N6QB 4NEZA 5B66U 3M4PA 3FZBA 2DGYA 1JJCB 4JI2L 1LKZA 2DNYA 2E3TA 2F76X 2KVMA 2YX8A 1TWAH 4IOCA 1F5SA 3I0RB 2ALZA 2HK2A 2WVCA 3LP2B 7ICTA 4NXMJ 2FHJA 3R93A 1HNWF 1B3AA 4ZP7A 2PQAB 1BWEA 3M30B 5KFMA 1K1SA 4DQQA 3MDAA 5A6PA 4MFBA 3OVBA 1FO1A 5ALXA 1YG0A 2IOFA 2R6GA 5K9FA 2YNGB 4R4QA 2PMZC 3FFIB 2YKQA 2BE7D 3G71A 1D7QA 3AU2A 1G291 4YB5A 2LKVA 3QWUA 1F5BA 4YMMA 3ISBA 2CW0D 3KF6A 5KFTA 4GNXA 4J15A 2JE6I 5AM2A 4E6IA 2D1CA 4P0PA 4U96A 3RZOB 3I55A 1LWEA 4OL7A 4YP3A 5F9LA 1BPXA 3GPAA 1WWUA 2ASJA 4YG2A 1RACB 1PJ5A 5IWAJ 3CC7S 2UP1A