3CW2C

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
266
structure length
266
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 63
structure length 266
sequence length 266
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00575 S1 S1 RNA binding domain
C PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3cw2C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cw2C01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3cw2C03
2Z6KA 1EIYB 5IYDG 1SRUA 2PI2A 4A3CH 4A3GH 2K14A 3J7ZC 2KCMA 3BZKA 4YY3L 4DK3C 1K73C 3FKIG 3HOXH 2C35B 1XNQL 3VDYA 4OONA 4A3CG 2RHQB 4A3GG 2UUAQ 1FJGQ 2UXCQ 1GKHA 2VQEL 4IPDA 4R4IA 4DV7L 4NXMQ 1TXYA 2HIXA 4YWLA 3HOXG 2NN6G 4BY7H 3KDFB 1LM0A 2A19A 2PNHA 4AYBE 1O7IA 2K50A 1K3RA 2K5VA 1WOCA 3TS2A 3QSYB 4PMWA 1Y1VH 1YJ9A 4AIMA 4BY7G 4MTNA 1XMOL 1IBML 4DUYL 2R6GA 2NN6I 1PV4A 2F52A 5IYCH 4GOPA 1GVPA 1LUZA 4IFDJ 1Q1EA 1CKNB 1Y1VG 3U4ZA 2VQFL 2UUCL 4L5RC 4JBWA 4LF7L 4IFDI 1KD1C 3CMAA 4L5SA 2MO1A 1WJJA 2KHIA 5IYCG 3M4OH 2YYZA 1N9WA 1VQ6A 4JI4Q 2JA6H 1PYBA 3K8AA 3TS0A 3CC2A 2LSSA 3IRBA 3STBC 2JE6I 1X3GA 3G4SA 1I3QH 2ZJQA 3WWVA 4JI7L 4B3TL 2ZTDA 4GKJL 4AQYL 2JA6G 3J81c 5IWAQ 1S72A 4HJAA 1PHJA 4YCVA 3I7FA 1PVOA 3CCQA 2BH8A 4JV5L 5JJLA 1Q82C 1WI5A 4UP7A 3PF4A 3A5UA 4GNXC 1KRTA 4MZ9A 3RN5A 2IY5B 4ME3A 2JEBI 1Q7YC 1I50H 1AE3A 4P71A 1XJVA 2OTLA 2VQFQ 2R7ZH 4K0KL 5M5YH 5DLQE 4DR3Q 4LF7Q 4AYBG 4JI6L 1VQHA 4C3IH 1HZAA 4DV0L 4DR6L 2R7ZG 1WYDA 1IBLL 1HNXL 1MJEA 2ZM6Q 4DR5L 3S1MH 4QQBX 4GNXA 4LFCQ 1X65A 3JAMc 4A3MH 4QIWE 2ALYB 4DV6L 4JI7Q 1J6QA 3AFQA 1VQCA 3BJUA 4OWTB 4AQYQ 2K4KA 1HNZL 3J7A5 3HKZE 4B3MQ 1HR0Q 4HJ8A 4A3MG 2R7DA 1YZ6A 1D8LA 2OCEA 4JV5Q 3J81j 2GVBA 3CW2C 4JCVE 3RNUA 4IOAA 4WJ4A 4A3LH 4JI2Q 4IPCA 3HOZH 2D0PA 1RIPA 4LW1A 1N33L 1FVIA 2QEXA 3SGIA 3D0FA 2UUBQ 1WCMH 3UDFA 4OWXB 1PH9A 1BBWA 4LF6Q 3HOZG 4JOIC 2EXDA 4BBSH 4A3LG 4DV0Q 3U58A 4DR6Q 3A5ZB 1IBLQ 3CXCA 4FDBA 4DR4L 1L2FA 1NE3A 2GVAA 1WCMG 3BZCA 4GN4B 4BBSG 5H1SE 4UP9A 1J5EQ 4DV6Q 1HH2P 1WFQA 3G6EA 4LF4Q 3CCVA 1QVFA 1W2BA 2RF4A 2HHHL 2EIFA 3PCOB 4P75A 3RLOA 4JOIA 3I56A 3PIPA 5GAGC 1X3EA 1E22A 1SE8A 4HIOA 3UE0A 1VQAA 2WP8J 1AH9A 1K0RA 3JAMi 4HJ9A 3GDEA 1KC8C 1YJWA 4JI5Q 2ZJRA 3A0JA 3HKZG 1TWHH 4XTCS 4BXXH 4DR1Q 3HOVH 4H02A 3BU2A 5JEAJ 1K8GA 1KIXA 4LF5Q 1XPRA 3M3YH 3HOUH 1N8RC 1L1OC 2CKZB 3M4PA 4BXXG 2UXCL 3G48A 1VQOA 1X6OA 1Q46A 4UPAA 3RN2A 4NXML 3HOVG 4A3IH 3Q8DA 2UU9Q 1EYGA 1TWGH 3HOUG 3AQQA 3I2ZA 4HIMA 1TWCH 1R9TH 3GTKH 3KFUA 1VQEA 1CSPA 4JBKA 2VL6A 3STBD 4A3IG 4LNQA 2IX1A 3PIOA 5LMNW 4NPSA 4X64Q 1L1OA 4IPHA 1PH8A 1VCIA 1VQIA 3F1ZA 1IXRA 2D62A 1VQFA 3K80C 4LWCA 1VQKA 1E1TA 2YTYA 2CFMA 1KHIA 1B8AA 1QZGA 1E3PA 2AKWB 1PH4A 1IYJB 5BR8Q 1YBYA 1EQQA 1PH7A 4JI4L 5IT9c 1QZHA 4KHZA 4LF8Q 5M3MH 4A3BH 4OO1G 1T9HA 2L15A 1EOVA 1E7ZA 5C3EH 2QMUB 1V43A 4EQ5A 1N32L 2K52A 1B70B 3RR5A 4WJ3M 2WAQE 5IWAL 5M3MG 1PFSA 5ELNA 2HT1A 4A3BG 4B3RL 3NBHB 1FL0A 4OO1I 5C3EG 3K0XA 2OWOA 4BY1H 4B3SQ 4IJHA 5M3FH 3OW2A 3ULLA 5JJKA 3DLLA 4A75A 2N3SA 4X65L 4R4OA 1PH2A 3S1QH 4JI0Q 3CC4A 4DR3L 4JBJA 4BY1G 4GOPB 5K36G 5M3FG 1PH6A 3HKSA 1U5KA 3AFPA 2ATWA 1QUQA 4QL5A 4DV2Q 2F3IA 2LXKA 2WB1E 1LYLA 2IHFA 4GS3A 4X62Q 2I5MX 3NELA 2ZM6L 3F8TA 2E5LQ 1SR3A 3PGZA 2IHEA 1K83H 3M9BA 4LFCL 4LF9Q 4RMFA 4YHHQ 2PQAA 2YU9H 1N32Q 1SROA 3K7UC 1VQPA 4UY8C 4JI8Q 1NJIC 3OYYA 3T1YQ 2YTVA 4B3ML 2IX0A 3MXNB 4L5TA 1HR0L 4B3RQ 1BVSA 1OXXK 1OXVA 5HY6A 1XNRQ 1XTDA 4JI2L 1HZ9A 1L0WA 3TQYA 1VQLA 4X65Q 1OXUA 3H0GH 3CD6A 3S1RH 5E7NA 2NVQH 3K7AH 4R4TA 1JJ2A 4OXPA 2WAQG 2UUBL 2Q2HA 1DGSA 1QVCA 4A3EH 1A63A 1IBKQ 4LF6L 3U50C 1EFWA 4C2MH 3UE1A 3H0GG 2E2HH 5IE8A 3PF5A 3T1HQ 1Q12A 3CCUA 3H3VH 2JA7H 1D7QA 4A3EG 3ULPA 3MEFA 5IY0A 3GO5A 1NMFA 3CCLA 5GQOA 1J5EL 4BA1I 3RZOH 2QN6B 4LF4L 1E24A 2MFIA 3CCMA 4NXNQ 2JA7G 2NZOA 2WB1G 3S14H 3KLWA 2VY3A 3FHWA 2I5HA 3I4MH 3ERSX 2UXBQ 1KRSA 1VQBA 4R1JA 1AE2A 4GN3B 5C0XG 4EX5A 1VQ8A 2A1AA 3H3VI 4J15A 3I4MG 3KYHC 2ZTEA 4XIGS 4JI5L 2NZHA 2VS1A 4HJ7A 4DR1L 1YI2A 3B6YA 3J81i 3GD7A 1GD7A 4R4CA 5C0XI 4Y52H 3PV0A 5EAYA 4DR2Q 2AMCB 1PA6A 4LF5L 3S17H 3HOYH 3HFZB 4DV3Q 4NB3A 5GADC 4MNOA 4PZ6A 4A3JH 3ULJA 4C3JH 2BA1A 2WFWA 3M4QA 1KL9A 3CPWA 2UU9L 3S15H 3S2HH 3HOYG 2N78A 3I55A 1CUKA 2K5HA 1N34Q 1UE1A 3CCRA 5FLXc 4LFBL 3M7NA 2E2JH 5M5XH 4A3JG 1XMQQ 1A62A 4GLAC 5C44H 2QA4A 4X64L 2OQ0A 4JI3Q 2NVYH 4DNIA 3L2PA 1VQJA 1IZ6A 4LUZA 1MJCA 4YCWA 1YJNA 3GTOH 2R93H 2B63H 4KI0A 4L5QA 1RL2A 3HOWH 3E0EA 3AYHB 1G6PA 4GKKQ 5C44G 2K5NA 1KAWA 2B3GA 2RHSB 1SFOH 5HGQA 2RCNA 2B63G 2R93G 3PO3H 5BR8L 4JG2A 3HOWG 4LF8L 2PMZE 2KENA 4BA2I 4DV1Q 4O0AA 2JJQA 1UEBA 2E8GA 4KLKA 3KF6A 2Y0SE 3PO3G 5JJIA 2CQOA 3S2DH 3PO2H 3F2BA 2VUMH 4P74A 1CSQA 4LFBQ 1NMGA 3H15A 3NEMA 1YNXA 3U4VA 4B3SL 1EUJA 2XGTA 1UWVA 2XTIA 4Y7NH 3PO2G 4GLXA 2Q2UA 4DV4L 2VUMG 5FJ8H 4JI0L 1L1OB 4DKAC 4X66Q 3W1BA 2JA5H 4DV5Q 4ALPA 3KJOA 3S16H 2KBNA 3PUWA 4PZ8A 1Q86C 1XPUA 5FJ8G 4DAYB 2JA5G 3I4OA 2DGYA 3S24A 2B29A 5ELOA 4X62L 2OQKA 4APVA 3KJPA 2MO0A 1GO3E 3EIVA 1N36Q 3CCSA 2Z6KC 2E5LL 4JBMA 1X55A 4LF9L 3DM3A 3W1GA 4YHHL 2JA9A 5J3BA 4A76A 4A3KH 2VNUD 1X3FA 4JI8L 1M90C 3T1YL 1OTCA 4DR7L 4A3KG 1OXSC 5C4JH 1UE6A 1SMXA 4TVAB 4QGUA 1Q1BA 4YWMA 4P73A 3TEHB 3UDIA 1XNRL 4X6AH 3I4NH 5LMNQ 4DV4Q 5IP9H 1NY4A 2JA8H 2Y0SG 4JYAQ 4RG1A 2NVXH 1GM5A 2UXDQ 2JEAI 1G291 4IOCA 1IBKL 3I4NG 1P8LA 4LFAL 2AHOB 1MIUA 5IP9G 3CPFA 1QUQB 3K81C 3OTOQ 1YEZA 4GOPC 2JA8G 3KDFA 3PUZA 3CAMA 3T1HL 1OXTA 3J80c 1E1OA 2JQOA 2V1CC 2MNAA 4DUZL 2F4VQ 4OX9Q 3L0OA 1G51A 2H5XA 2PQAB 3RZDH 4IFDG 4NXNL 1YVCA 3L7ZC 4JC0A 3CQZH 3D31A 3S1NH 4KHPQ 1CKNA 3PUVA 3RLFA 3F2CA 1Q8KA 1A0IA 1VQDA 1JMCA 2NVTH 4DR7Q 2UXBL 1Y14B 4JI1Q 5LMUL 1PH3A 4A3FH 2K75A 4DK6C 1JT8A 1A8VA 3GTLH 3CMEA 2LXJA 4YWKA 4YY3Q 3GTMH 1CKOA 4POFA 3NENA 1S3OA 1UE5A 1XNQQ 1SN8A 4A3FG 3CP0A 4UP8A 4LFAQ 4DR2L 1TWAH 5C4XH 2KCTA 4IJLA 2VQEQ 2N8NA 4DV7Q 1H95A 1VQ9A 1W3SA 4DV3L 4DUZQ 2AWOA 3CCJA 3KOJA 1HNWL 1C9OA 2DUDA 1HR0W 1QVGA 4GNXB 4GLVB 3ZJYC 2I5LX 5C4XG 3EN2A 3CCEA 4IPGA 1XMOQ 3GTJH 1N34L 2ID0A 1IBMQ 2I0QA 3F2DA 4DUYQ 4DPGA 4A93H 3A74A 1XMQL 3PUYA 1IL2A 1BBUA 2R7FA 1YZ7A 4QY7A 4AH6A 1I94L 2ASBA 1Y1WH 5LMUQ 4JI3L 2ES2A 2UUCQ 4A3DH 3J80i 4POGA 1C0AA 1BKBA 2YV5A 4A93G 4TQUS 5AJ3L 2JK8A 5GAHC 5C0XJ 4GKKL 5GROA 1YITA 4C3HH 4HIDA 1Y1WG 4A3DG 1XPOA 2Z0SA 4A4IA 3GTPH 3E9HA 1HZCA 1PYSB 2Q2TA 2Q2IA 1P16A 4DV1L 1EIFA 1ASYA 4B3TQ 4GKJQ 1HNWQ 2YTXA 3TRZA 1S40A 1JJGA 1LTLA 3TREA 2N49A 1V1QA 3ICEA 5M5WH 2VW9A 4PG3A 2CCZA 3PUXA 3JC66 1PH5A 1I94Q 3GTQH 4K0KQ 2MQHA 3G71A 4JI6Q 1KQSA 1VQNA 4X66L 1K8AC 1FGUA 3FP9A 5AJ3Q 4DV5L 1K9MC 4OWWB 3PSIA 1Z9FA 4YCUA 2IT1A 3E9IA 3M85A 1HNXQ 1JB7A 4DR5Q 2HIVA 3RLNA 1B7YB 3KF8B 2D0OA 1ASZA 1YIJA 1EQRA 1I6HH 4IO9A 1EWIA 1N36L 2UXDL 4R4QA 1HJPA 1M1KC 2ZTCA 5IP7H 1HNZQ 2HQLA 1X9NA 1PH1A 4HIKA 3KF6B 1X54A 4GN5A 3EBEA 5IP7G 1N33Q 1Z47A 2E2IH 1I5FA 4DV2L 1TWFH 3UDGA 1V9PA 2PI2E 5LMNL 4BBRH 4DAMA 5JEAG 3W5OA 1JJCB 1NBWA 1VQ4A 4JYAL 1VS0A 1VQ5A 4LUVA 2CWPA 2ZJPA 2OTJA 1C7YA 5GAEC 1VQ7A 2R92H 3AEVA 4BBRG 1X56A 4O2DA 3CC7A 2BH2A 4DR4Q 2UUAL 1FJGL 5FLMH 3OTOL 1KXLA 1YHBA 1CKMA 3GTGH 2CWAA 3ER0A 1YHAA 1YHQA 2A8VA 4LUOA 1MKHA 2VZAA 1SLJA 3UDXA 4OX9L 2F4VL 2AWNA 2R92G 2EQSA 2HHHQ 1Q81C 5FLMG 2BA0A 4QJFA 1UE7A 2FXQA 5IYBH 1VQGA 1VQMA 1JE5A 1U0LA 2KHJA 5IYDH 3CF5A 4KHPL 4HJ5A 4P72A 1NTGA 2QGQA 1HZBA 3FKIH 3LGJA 5IYBG 4JI1L 4PZ7A 2GN5A
chains in the Genus database with same CATH superfamily
2HPUA 2EYPA 4YHHJ 3KLVA 2ZHBA 5L9XA 4FE3A 3J7ZC 3GZFA 1TR5A 3BSAA 4WFAQ 4OONA 2B8FA 1TKWB 1WC5A 4Q2MA 5JJBA 2DGXA 2H54B 3K5OA 4IPDA 4DV7L 2EYMA 4DCCA 4RO0A 1O7IA 1MHWC 1ICWA 1QJOA 1TS3A 8ICJA 4UOHA 2XMJA 1WWHA 2C3UA 1AZQA 1Q8LA 4UUWA 3TVYA 1V8QA 4K7QA 3MM9A 3CCTA 2RCFA 1WJJA 3T5LA 3ZDDA 1S1VA 1XQIA 1B4SA 2HKEA 4LF8F 3H4DA 5E2QA 5KFPA 3EJMA 3T1AA 4K4VA 2WK4A 2GJ2A 1L8OA 3VAHA 3JSMA 2CFXA 2E5IA 3H94A 4CLWA 3UNYA 3A5UA 1SXEA 1D8BA 2KVCA 5DKWA 4I69A 3T41A 2KZZA 5KRUA 5DLQE 9ICPA 4M1UB 1HZAA 4AP9A 2OEJA 1TMMA 1QUVA 3EVOA 1VRQC 4ZVUB 4DR5L 2O6KA 2WVEA 4KC5A 1Y8OB 4A3MH 4UBBA 3RFAA 4M04A 3CD6S 5DS7A 1KLMA 2DCUB 2OPRB 3TUIC 3I4LA 1ZPVA 3QATA 2GHWA 4HDGA 1RWOB 4DFAA 2IYIA 4LR8A 5BYRA 2E8MA 1IIPA 2C2EA 3JQJA 1U0HB 5CD4H 5IS2A 2E2JB 1XNRF 1ZQHA 3R7NB 4RNNA 1WG1A 2YWKA 3K75D 2R8JA 4F5PA 4KKSA 1OSCA 5EUHA 4FVMA 3P45B 4UB1A 3HOZG 4BBSH 1RT1B 4IRCA 1XX8A 1EYAA 4FF3A 2KG0A 3M32A 3LDAA 3V4MA 4C11A 1WFQA 1HARA 1YDLA 3CCVA 3JTOA 4PQUA 4X66J 1UP1A 1KQFB 2RQMA 2DPIA 4DG1A 5I4DA 5KT2A 3I6PA 5LMUF 5D49A 2ZXIA 2W7OA 4WFXA 5C3WA 2OPPA 1Z4NA 3VR2A 2G1HA 2HG4A 3QU2A 3R2CJ 1YNND 3HKZG 4RHRA 3ZDCA 3CCRS 3KKAA 4ZVFA 1KIXA 3MR7A 2ASJA 3I1YA 3NXWA 1ZD2P 2CKZB 3Q8UA 5J2FA 4AYBD 1APSA 4R65A 1U2CA 1S77D 3AJDA 1L5UA 2J9DE 1VR6A 1FKOB 5J1EB 2QLJB 2Y9HA 2EJMA 5CRXA 5AJ3F 3RBEA 2FINB 2VKRA 4NCGB 2F4IA 3NGTA 4JI4L 2AJQA 2P5VA 2RUSA 4BS2A 1FXLA 2GC8A 5KFSA 3CRKC 4A3BG 4IFVA 1S6OA 2XSJB 4F92B 3G82A 4KLFA 3ULLA 2KA7A 3ILIA 5CZVA 1S7HA 3DN9A 3SMZA 3Q2TC 2DUYA 9ICJA 1RT7A 5H9FK 2EY6A 1Z00A 1N6QA 3PYDA 3ISBA 5J0OA 2JX2A 5IXUA 4LF9Q 1OJ4A 4B3OA 2OYYA 1N32Q 4JI8Q 1NJIC 3N6MA 2YTVA 3GTJB 3CDEA 4A93B 2SXLA 4O23A 1IBCB 4ZK9B 3BPSP 2H48B 4CM2A 4K4UA 3ZZRA 5J2GA 1XMBA 3KBBA 1IBKQ 3U50C 1E6VB 3RTVA 3GDXA 2KKHA 5KFZA 1HXYD 3FSXA 2ROGA 2MJ8A 1WELA 4ED3A 3CMES 4WFNQ 1R31A 2R8IA 5EKLA 2QL5B 3H98A 2APOA 3W63A 2LYBA 2D3DA 4F3QA 1U1MA 4TURA 2EW9A 3HOZB 4RUCA 1BQXA 3GV5B 4KGKA 4Q8EA 1SEBD 3L9ZA 3AY0A 2NSCA 1IKWB 3O8WA 1YI2A 5EAYA 2HVDA 2Y0SD 3UD3P 1WUDA 3O2IA 4Y2KA 2KH9A 3G6VA 4ID5B 1XO0A 4Q0FA 1XC9A 1JI7A 4OYIA 5B0AA 4A3JG 4PGXA 3EYZA 4PWWA 2VQFF 4LRFA 2CXYA 1MMDA 1IYVA 3HOWH 2K33A 5GAHU 2E9ZA 3BYPA 4UBCA 1JXVA 1M90T 5IGCA 1GMWD 5D0HA 2F63A 4CH0S 3WK8A 2K1RB 3B82A 3MURP 1TU2B 3G7LA 4JI7F 4DV2J 2RVJA 3KF6A 5KFTA 4OZ0A 4FZNA 3NAIA 3NGRA 2QYGA 2CJBA 1F2GA 4DV4L 4U9RA 2VUMG 5FJ8H 4CP5A 4JI6F 4GC7A 2YPZA 3BQTA 1UEUA 3KLIB 5F0WA 1IBLF 4A8SA 1XSLA 1Q0NA 5IIJA 4A3BB 3CJQA 4UAWA 1CQVA 2XBPA 2V68A 3JTPA 3RB6A 1V5VA 5FLXU 3PX0A 1ZQDA 1V97A 3RAMA 3K57A 4K6DA 4ZPBA 1EU3A 8ICZA 3QUQA 4QGUA 2YKQA 1HWJA 1RAJA 1RB0A 1RWWB 2FHOB 3I9V9 8ICGA 1LT3D 2F0WA 2W11A 4C4WA 4KD3A 3W9HA 1GMVA 1Y3KA 5IWAJ 4RW8A 4AL7A 4KLJA 1WTRA 5IP9G 2ICEC 2B2YC 3SAFA 5T1GA 1UJ4A 2EYHA 1PZNA 3MM5B 8ICRA 4IQMA 2H4YB 1VC6A 3GONA 4NXNL 1Z1ZA 3V6HA 3CQZH 4JC0A 3J80E 2NYVA 3F2CA 4DR7Q 1A0IA 2UXBL 2P66A 1C4QA 1A8VA 3UPFA 3JPQA 2HAFA 1YJ9S 2HFOA 4OYOA 3KLRA 4YR0A 3EUB2 4UF4A 1VMPA 2H3ZA 4C6AA 3JSBA 3M4XA 3AD8C 4IG3B 2GHVC 2N8NA 2VFSA 2FYXA 1RQLA 1QVGA 2GQ2A 5JMNA 3EDQB 1WG4A 2J9EA 3CHBD 4LF6J 1FXRA 3PUYA 2ASBA 2NXCA 1V3ZA 8RUCA 3RRHA 1SIWB 5C0XJ 1Q5VA 1Y1WG 1NB7A 2I9SA 3BH6B 4R8NA 1G2EA 2JLEA 1WUUA 4B3TQ 2K01A 2ZJ8A 1S40A 2ASYA 1JJGA 4HKQA 2F0SA 4DR1J 3GWCA 1S1XA 5M5XB 1JLEA 2SNSA 1I94Q 4K4YA 1JLGA 2ZXOA 3ET6B 2J8AA 5BPCA 4K2XA 2PCFB 4CDFC 4M1KA 1F2YA 5H9FJ 3M8QB 5GAHI 2EE1A 2DN8A 1MSHA 4R4QA 4NXNF 1PH1A 4XK8C 3H4BA 2XTJP 2W9AA 2NB0A 2PFQA 4ZVGA 1YIJS 4KN7C 3RD4A 5JEAG 1NBWA 1VQ4A 1RJTA 1X7VA 4NX9A 5J2KA 1IJEB 1RWUA 3DYAB 2P35A 1BNPA 3OTOL 3OSPA 4NMLA 2FHJD 4HDHA 3VYSA 3FMCA 2HHQA 2AWNA 4K5XA 1F9FA 3MCSA 2EQYA 5IYBH 3DOKB 3ZDAA 1VQOS 3FKIH 5AK5A 3LGJA 2GN5A 3KZXA 2Z6KA 1TL5A 1KQGB 4KV6A 3NE5B 1K73C 4WFN3 4LF5F 2XNAC 2FPMA 4NXMQ 4BY7H 3KG4A 1B0XA 1FFSB 1WF1A 1EY0A 2GMHA 5KG0A 3DLBA 1K3RA 2K5VA 4ED8A 3RGIA 3OTCA 4I2QA 4MTNA 4KKTA 2NN6I 3LVVA 2DNHA 4P4OA 2CPRA 1QTNB 3HEJA 3DLGB 3DM1A 2KHIA 1F9EB 2GAHC 2GIFA 1SGGA 1U8SA 5BR8F 5A8KB 3N79A 3CC4S 1IKVA 2KTQA 4RGOS 2XYGB 4GKJL 3J81c 1BQQT 3RZOB 1A0PA 2BH8A 2VJUA 1WI5A 4WZQA 4B3SF 2KCNA 2F1MA 1KRTA 1N5WA 1RHQB 2HCFA 2F0VA 3WX8A 2VC1A 2XVSA 1MJEA 2ZM6Q 4QQBX 4LFCQ 1DTQA 4QIWE 2LPEA 2XNRA 4KPYA 4DV6L 1HNZL 1SE4A 2KXHA 3NTHA 4I2HA 4A3MG 3NGDA 1YZ6A 4ECXA 1S1UB 3DMJB 3M1YA 4USUA 1HWKA 3BQ0A 3QGHA 3C1EA 1N33L 1S49A 4XXEA 1LV9A 4QIWC 3QR8A 3ZZYA 3J81L 1IKXA 2EXDA 4DAVA 4J9PA 2KEEA 2KXNB 1SFOB 4FDBA 1Y3JA 4BBSG 3LP1A 4M5LA 4CLYA 1LWFB 4WYLA 3OLBA 2QDLA 2DNYA 2M7SA 3ETOA 2F0HA 1BC6A 4L75A 2CQ0A 4DX7A 2WP8J 1NJYA 5KG4A 2NPIA 1RUSA 4NZ7A 4RJVA 2D69A 2DKXA 2QLWA 1L1OC 5EPKA 4XDDA 1ZD3A 5HO4A 1RT3B 2ZZTA 2E5SA 1TWGH 4HIMA 2XSCA 2K03A 2HS3A 2KJWA 3EWAA 2DJFC 3STBD 3WZ0A 2CWXA 1XMQF 2WACA 2UUAJ 1PH8A 1NM2A 4KRWA 4DL3A 4LWCA 4OX9J 4OO1H 4Q2LA 2CJXB 2W9BB 3K59A 8ICXA 4LZGA 3SDEA 1EFID 2ABYA 3G96A 4JI1J 3JSYA 3AOBA 2AH5A 2MA1A 5AK3A 4C8LA 1OY9A 4O4RA 4PGYA 5K36H 2DHXA 3OW2A 3NOGA 3BO2A 3H2LA 4I64A 2XZDB 2ATWA 3DUZA 4KBIA 3AMUA 2L9DA 1RDFA 3AQOA 5D4LA 4DUTA 5KL1B 4DSFA 1XMOJ 1N36F 4NI2B 4U6PA 2B5JB 3HWTA 1F9QA 2DGVA 3GE9A 2MQNA 3BVZA 2HFVA 3AH6A 3KG0A 1C0TB 2AIRB 2OO4A 4P2FA 3FKBA 2UVVA 3CD6A 4UDUC 2LDIA 1JJ2A 4U673 2QL9B 4A3EH 4U7CA 5C6AA 1SL1A 4A3MB 3PO5A 2TMPA 2RU9A 2NUUG 1JN3A 1YQHA 4OJ6A 1ZQ1C 3G87A 4MHEA 2OXPA 5CD4A 5ALFA 3I96A 3QJPA 3ZYYX 2CG8A 2XQCA 1ZAVA 4BBSB 4F87A 5E79U 4O44A 1IWAA 1LW2B 3MGHA 1YG0A 1XSPA 3CCRA 7ICHA 1BQNB 4BDPA 1S6QA 1V38A 4DUYF 1RT5B 2Y1LB 1A62A 4GLAC 4URGA 3GFZA 1IZ6A 2IMWP 2D5DA 2BKEA 3QIDA 3HVTB 2VONA 1G6PA 4ED0A 2QA2A 2ZZMA 5F2DA 1KABA 3HGBA 1G1XA 3HOWG 2PMZE 2EFPA 3MXGA 1WC1A 2GIQA 2AQ2B 3MPDA 2HBRB 2FVCA 5HATA 5T7LA 5RUBA 1Q3UA 2CJQA 3D1QA 3MECB 2PMZC 9ICIA 3UCZP 2EDGA 4DKAC 3G6YA 2ZH8A 2KB2A 3EVWA 5EE0A 4EI2A 5FJ8G 2QIFA 3KKFA 2EPBA 4DPUA 3WK6A 3KUEA 5HVFA 1JQYD 4LF9L 3MCMA 1DY3A 1VQ5S 3ISNC 4JI8L 1X9SA 2G2OA 2JC0A 2F0PA 2PYKA 2RKIA 1LKYA 3NMAA 3MFIA 2A6HD 4M8LA 5J2JA 2JFKA 5J2NB 1EKSA 2VA2A 4I4BA 1VQMS 5FLXY 1ZPWX 3M6VA 1OSDA 1IBKL 5LXYA 2FUG9 3RMHA 1RABB 2B6AB 1MMNA 1OXTA 2EFGA 1KNAA 2M00A 2B3TB 1X4AA 4A8QA 5AKEA 1WD1A 2RDFA 2DB1A 4Q0BB 4PWDA 1JMCA 4M6WB 5FO8B 1RCXB 2C2OB 1JT8A 1SNPA 3CMEA 5BYQA 2G2YA 2IA0A 4LBPA 4OZNA 3HDSA 4R0JA 4TUPA 5EE3A 4IJLA 2ZOGA 1HPZA 1HA1A 2DY7A 1AFIA 2KYZA 2IM2A 1RISA 2V0NA 2RA4A 3CIZA 2WONB 1F2LA 5ALNA 1BMQB 1R8HA 3IV6A 2F0QA 4URSA 1SXLA 4OLOA 4QY7A 4AH6A 3Q83A 4IQTA 1SH3A 1JROA 1EY4A 2CQGA 2V8HA 2CPDA 4LF4J 2Q8RE 3TI0A 3C1FA 4Y2VA 5CB1A 4PQAA 1TS5A 4A4IA 5KAKA 5IILA 4BC7A 2OTLS 4ZVHA 1ZD4A 1AP0A 1VYAA 2HMIA 4M47A 3CP8A 1SYBA 1N32F 1MC8A 4HAEA 1KHWA 2HWTA 1UWBB 1TKTA 2EOTA 4QIWB 4DDFA 5A8WB 3M8ZA 1W2BR 1HPCA 1JIHA 4P4PA 4RBTA 1EL0A 1WEYA 3PFEA 1IKYB 5DLFA 3PEJA 5HSPA 5G3LD 1SC6A 1CJKA 2HIVA 2RD5C 4LFBJ 2D0OA 2PPBC 4K4TA 4X64J 5BOMA 3NQTA 5IGEA 1S6PB 4ICLA 3UDLA 1ZQGA 2EDUA 1TL7B 2WBMA 2JJ4D 2LU2A 1EQMA 1Q7LB 4J9OA 4RNHA 3RJEA 1BXTA 3FQKA 3IL8A 5ALTA 4NE9C 1TVRB 4LUVA 2AJ0A 3H8JA 2VODA 4CH7A 4LSNB 3CB4A 4OFZA 3GTGH 2CWAA 1YHAA 3OTDA 1DOQA 2QZ8A 2XEXA 3UDXA 2I07B 4TU8A 5AE2A 2BE7D 3MGVA 1JE5A 2DVIA 1A2TA 3CE8A 2FMQA 1TY2A 2F0GA 1HBNB 5M3FB 1HZBA 5IYBG 3R6LB 4FYVB 1KVKA 3HX9A 2ZXRA 3KK7A 3LWEA 1G2TA 5DAUA 3FKIG 1FKPA 3T1YJ 4NA3A 3CCZA 3KBGA 1RTJA 3L3FX 1G8ZD 3EQLC 1EETA 3MC0B 5F0UA 4YWLA 3DWAA 3TVKA 1LM0A 1KN6A 2AP6A 2NXEA 4QWEA 1YJ9A 3VYUA 1N5YA 4BY7G 3WDNA 4ZA1A 3TVZA 1OO9B 3CQZB 3E2EA 3S6EA 2Q66A 3E6ZX 3BR8A 1ZQOA 1CKNB 1WSRA 2MQ8A 3H59A 1KD1C 2F0LA 1NO8A 4ITSA 3DU6A 2YYZA 2E1AA 2YX1A 1L8LA 1RBAA 1FWLA 3LGHA 2E74C 3DGPB 4OV1A 2M88A 4OZ1A 4I1TA 4B3TL 3NBIA 1RHUB 1JORA 5AKXA 2HQEA 2WV6D 1AB8A 1PVOA 4JV5L 1L3KA 4Y2YA 4HCEA 2LKZA 3CEDA 2ILZA 2WF6A 2GV1A 3S14B 3GQBA 4PYAA 4DR2J 5I3UA 4P71A 1U4PA 1QNKA 5KFBA 4I2EA 1RI7A 3G86A 1I4HA 5FKAC 5IT4A 3W5ZA 1NHUA 2VPXB 3GB0A 3N5FA 2E5HA 1DBDA 4R64A 3OXGA 3EMTA 4J6HA 1ZQKA 2OCEA 3WDOA 4DR7F 4B9SA 3MMCB 2EH9A 2AXTU 4LAAA 5C24B 2JEJA 3F2UA 1FF2A 4I6AA 3OPOA 4NWBA 3QU9A 2NZ4A 4DR6Q 4I2PB 4K5VA 3V7KA 1NE3A 5CYMA 1VQ8S 4YB6A 5H1SE 4UAZA 2C42A 4P0PA 2R42A 1HH2P 2RF4A 2VBYA 4WTYA 1QY7A 4EU0A 2P9GA 2RSQA 1GXUA 2QLFB 1SMYC 4HIOA 1C2PA 3K1RB 4MK7A 2UXDJ 4L63B 4Y7NB 3GDEA 3FBEA 2ZJRA 2ATLA 3A0JA 2I6WA 1GUSA 1RTNA 3W9JA 1XPRA 1B22A 2QA4S 2V6AA 2L4NA 1TS2A 1VQOA 3BGRB 1DOMA 4B3TF 4NXML 2AEFA 2UU9Q 1FK9A 3AFGA 2FY1A 1B64A 2PMZB 1ZAWA 3I2ZA 4UB2A 3FC9A 1N34F 1NZ8A 2FPLA 2K32A 6FD1A 2B4UA 3MUMP 3ICLA 1HQRD 1I94F 5G0RB 1VCIA 2JR5A 2ZIVA 1V5IB 2XSFA 3MAQA 5J2MA 1RSCA 2VBXA 1JOOA 1CG2A 3MGJA 2KSOB 3CCWA 3MGIA 4OO1G 5KFNA 4BY7B 1E7ZA 3UNGC 4ALZA 4OO1J 3RR5A 5ELNA 4B3RL 3NBHB 5K8OA 5H9EK 4C8KA 3Q6SA 1XN9A 3CC4A 4DV7J 5K36G 3CJ5A 3HKSA 4E8UA 3OVSA 2F3IA 2BDOA 1JUDA 4O3QA 4Q7AA 2ZM6L 2JDJA 2E5LQ 4LFCL 1FX4A 3EW9A 4Q45A 3K6OA 1YJRA 2W8LA 4UAUA 2NR0A 3F53A 4OQJA 7ICJA 4OJ1A 3PX4A 1CT1D 4C8ZA 4PZVA 2WAQG 4PJ0U 4PHAA 5KNIA 2VH7A 1PYTA 3I0RB 3R5BA 3H3VH 1PIEA 4NXMF 3MOJB 2DF4B 4A3EG 4MFFA 3H8YA 4LF2A 1E24A 1ED1A 1K9MT 1TL1A 5LJ5Y 3I82A 1RK8A 1WNEA 2WB1G 1OMSA 1U7LA 4DR5J 1CJTA 4MF8A 3RG6A 4NA1A 2OXOA 3R6GB 3HP6A 1XR6A 4YY3F 1KQSR 3FJ2A 4M5IA 2PEHA 3QIPA 2MZTA 1S9EB 3HOYH 4LJXA 2WHEA 3BDLA 1ENCA 1U8WA 3QUCA 3CTRA 2KJ5A 4C56C 2MZQA 2Y1JA 5LL6X 3T16A 1ZOLA 3L2PA 3IR6B 4M5JA 3FBFA 4DU9A 4Y2AA 2B3GA 3P8BB 3IN5A 2ZM6F 2Z30B 4KY6A 3DNCA 2EVBA 4BA2I 2MKKA 2E8GA 3BS9A 1BWVA 1NMEB 1PC5A 2HFNA 1G2SA 1PLFA 1FJCA 1Y88A 3MMBA 2YY3A 3SEIA 5A6PA 3H15A 1YNXA 4DOAA 1FJ7A 4DSEA 4DQSA 5ALXA 3TP5A 1XSNA 4AL6A 2CPIA 4RWSC 3S16H 1HNXF 3GG0A 3QU7A 4I28A 2Y9UA 3NL0A 1F3FA 5AM4A 3I4OA 1ZQVA 2HBMA 1WOPA 3KDOA 1DXSA 3CJ4A 2CZVC 3HG9A 4DXFA 4A76A 2CQ4A 1LW0A 4Z37A 2QCPX 5J2QB 1VFJA 4ILLA 5A76A 3PDNA 1NK6A 2KG5A 1S4EA 3OLAA 4JI4J 1M5HA 1P1TA 4I2FA 2GVZA 1YKWA 1TV6B 3J7AN 4OJGA 3TP6A 2RRBA 2LYVA 2AHOB 1ZBTA 1WSVA 1ET9A 2F4VQ 1RDPD 2MNAA 2XY5A 3L0OA 5AXLA 3RZDH 1UEKA 3RLFA 1DLOB 1Y10A 5J2DA 2HSZA 4A3FH 2KFYA 1NZAA 3FAHA 4JI7J 4A3EB 1UE5A 3A7LA 1W2IA 4LRCA 1VQSA 2ZH6A 3Q8PB 3QU4A 2Q79A 5DQGA 3NBPA 1HNWL 5ETKA 3A3PB 1EJ7L 3S8SA 2KEYA 2WF7A 2FFKB 5AXKA 8ICBA 2PZWA 2WVFA 2MLZA 1S1WA 1VK3A 2UUCQ 2MUTA 1X32A 4WJWA 1ACMB 1IL8A 2W4DA 1X5PA 5GAHC 1FD7D 3RUBL 4UHVA 3D3BJ 5EX3A 3PYGA 1GEHA 3CRLC 3OVAA 4C11B 2HHVA 1RHRB 3R3TA 1QVFR 1X5OA 2W9MA 5HMLA 1SYGA 3OL8A 4JK1C 3HPOA 1NNLA 5H9EJ 2OPPB 1HTPA 5A6WA 3E9IA 1Z2ZA 3HOVB 2XRSD 5SUHA 3RLNA 1B7YB 3TAMB 2C3OA 3IM1A 5ETVA 3EFXD 1Z1VA 3W66A 3UMGA 4CZCA 4JI2F 1YSJA 4YS2A 3UDGA 3QRPA 5L1LA 4A8KA 1R0AB 2GJFA 3UQSA 2HRTA 3L4BC 1VQ5A 3TFRA 3GLJA 1HEKA 3AB2B 1X5TA 1S48A 4KGMA 4DV4J 1SLJA 1UE7A 2FXQA 1VQMA 2Y3YA 5CGKA 2BJ3A 2E9RX 2PXIA 5AKLA 3TZYA 5ALIA 1QSYA 4PZ7A 1HI0P 1B4FA 3SK4A 2HQDA 3ENWA 3TZUA 5TISU 4DK3C 1K0TA 4WORA 5EX0A 2LCWA 1GKHA 3IRUA 3FPPA 3BS1A 4M9HA 3V96A 2OD6A 4ZAIA 4AYBE 2Y8WA 4UQTA 4B3OB 1Y1VH 1H9JA 4QUCA 3CU7A 3Q8MA 4OLPA 1Q1EA 3TSSA 4ELTA 2BOAA 3FZBA 4L5SA 4AYBC 1A6SA 8AT1B 2ZKUA 4RL1A 4NXNJ 3FBBA 2OSRA 4QPTA 2R7SA 4IO1A 2H5EA 3TS0A 1F0MA 3C14B 2UXBJ 1SZPA 1VJWA 3RJIA 3PY8A 4WP9A 1VQ6S 4Y2JA 2M70A 2VL1A 2OTLA 3J81E 4I29A 2L48A 2C9OA 3FNNA 9ICHA 2FPKA 1PK3A 1VQHA 1SQGA 3W8GA 5J2IA 3OMGA 1DYQA 2F0UA 4CRXA 2CQ1A 3MEHA 2HBZB 3OUYB 1RHJB 3KXDA 2E2DC 4AQYQ 5LSLA 1WTVA 1I4RA 3KK2B 2R7DA 2VG5B 1UJ6A 2ZBCA 2GVBA 3IR5B 4NXZA 1XTCD 4NLQA 5E3AA 2R93B 4C3KA 2MAXA 1X6IA 4WFYA 1F9RA 2Z4IA 2PA8D 2IJNA 5CBAE 3D67A 3UVJB 4XYOA 3CULA 3N28A 1HBMB 5G5HA 4KLEA 3WC0A 3ZD9A 1VHIA 3OT9A 4QUFA 3JQKA 2QL7B 4N41A 1SE8A 3H5SA 2NQPA 4I6WA 1MWZA 3A1YG 4M9JA 1TWHH 4O1NA 3QG1A 1RADB 3BU2A 4PG5A 1QM9A 4MTKA 1PBAA 3M3YH 5C2CA 1S9GA 4XPEA 2HQIA 4RQ3A 3ENAA 1PCAA 2GAGC 5KFVA 3FK4A 1YBAA 3VVTA 7FDRA 3S6JA 3OTOJ 2F76X 1Z3EB 1NKCA 3MFGA 4HR7B 2M5YA 1O7ZA 5M3MH 1X60A 2WINB 4DV1F 2IW3A 2BGWA 2YMLA 3ONNA 5AFWA 2YKNA 4FYWB 4NZ6A 1J2MA 1Q53A 3TYTA 4DF4A 4NDXA 3ONQA 4GVBA 3HI9A 3OWEB 1URNA 1PH2A 2KQ3A 3TZDA 3TX0A 4EENA 3X3NA 4M63A 1FFUA 4DCOB 1FDAA 4LRAA 3PGZA 4ANCA 5I3QA 1SNMA 2YU9H 4UY8C 2IVYA 3RAXA 2ZE2A 1A7GE 3M2UB 4KFBA 2BDUA 4X65Q 5LMNF 3H0GH 4JV2A 1BY9A 1VIOA 2QE5A 4PWUA 4OXPA 4QIFA 4GKJJ 5AK4A 3GV6A 1MROB 2IPOB 4ZOSA 2XB2D 4PMCA 2VFVA 2W1BA 3LWUA 1X0PA 4DL0C 1JICA 4QZAA 4ZP6A 2WVDA 4X5VA 3OQ2A 4K5RA 1SB3C 2DQNB 1WD6A 1STEA 4ECTA 3I4MH 5HP1A 5M5WB 3IG8A 2ZIUA 1VQBA 4V19X 1ZQJA 4U7UD 1VQ8A 3GTQB 4C4TA 4P2HA 1BUVT 3CIMA 2J7WA 1HNZJ 4RKBA 8ICCA 4Y52H 1C4CA 2X3GA 3OSOA 2K7VA 1HBOB 2P6UA 2EK1A 4WE1B 2W8KA 1N33J 1WJ9A 2BOPA 2UU9L 3RW6A 3HOYG 2VBWA 3M7NA 1TFWA 5M2UA 2QA4A 3QAEA 1VQJA 1M1GA 1RL2A 4A48A 2ZXHA 5CV7A 2KCCA 2K5NA 4ES3A 3T3FA 4LMZA 2V50A 1BF4A 4O0AA 4ILRA 2L41A 1UA0A 2RKSA 3MAAB 4XDCA 1WKKA 4K6LA 1CSQA 3NWSA 2DCLA 2XS2A 1U6BA 1P8GA 2HBLA 4GLXA 3EGNA 5C7PA 4DR6F 9ICCA 2QARA 2PT0A 1F2MA 1HRJA 4QCLA 1JKHB 2E5LL 3M7VA 3C46A 1QTMA 2JA9A 5J3BA 4CLZA 3UCUP 3CC7S 3HS0C 1A76A 3TEHB 4I2QB 4X6AH 5LHY1 2LA6A 3V6DB 4F04B 3H7HB 2KOLA 2Y0SG 2HK3A 2GGPA 4HYKA 2RQXA 2EBGA 4LFAL 1MIUA 4ICAA 2YWGA 2FZCB 3HILA 3TA2A 1W6JA 2HYIB 4OX8A 2PQAB 5B0EA 1TVAA 1EZZB 4V19J 2E8PA 1VQDA 4AYBB 1S97A 2KEDA 1PH3A 1UEVA 3ZC4A 5D78A 3QX7A 4OIXA 1T9YA 1CJVB 1EX8A 4ANDA 1PFBA 4A3FG 1X2IA 2MUYA 4N8FA 2P8IA 2QRRA 1W3SA 1SPBP 2F1IA 2CNNB 5J2CA 5DDRC 1SV0C 1IBMQ 2X6GA 2CVIA 3A74A 2RU3A 3HHKA 2M0GB 1OYEA 1SWWA 4ZVOB 3W2VB 5EDWA 2DYAA 1N56A 3OL6A 2DGSA 4ID8A 5ETTA 2HZCA 1REVA 4NLUA 3MMAA 2E5LF 2O5DA 5KFHA 1PYSB 2Q2IA 2KIVA 4KIAA 3FCWA 1FEHA 1R6VA 1RA6A 2L5YA 5C25B 1Y5IB 2EZZA 1SSOA 4FYYB 5JXSA 4P2XA 2BRKA 2VFRA 3A3NB 4NPOA 2CQAA 2ZTCA 3BG3A 1V6HA 3J7ZT 4US9A 2L5TA 2BW2A 3OPXA 2XYPB 2P6RA 4C4SA 2X69A 3JAML 4IOAQ 1JWUD 1H72C 3IAYA 2F3NA 2B4VA 1EWCA 2H3FA 3T5JA 2MRLA 2VXWA 3S16B 3V4IA 4DA2A 2A8VA 2F4VL 1HQEB 1MKHA 2VZAA 2BPFA 5AXMA 3H91A 1U0LA 2Y0SB 1B0PA 4IFYB 1FXDA 4LF9J 4HAIA 1MU2B 4JI8J 2DNCA 4H7BA 4LRDA 3OR1A 1YVFA 3VGVA 2JFDA 3IGVA 5I42B 1RXOB 2CUYA 2BE2A 1TXYA 4EO8A 1VQKS 2B2WC 5IODA 5AM1A 3RZDB 1NSKL 1NKBA 2IM3A 3VAJA 2G13A 1IBKJ 2CQ3A 3NEKA 2NZ1D 1PV4A 1RGVA 3I70A 2HNDA 1Y1VG 2UUCL 4L3KA 2UUTA 2H3QA 4PPXA 4DOZA 2MO1A 3FGVA 2HD3A 2CPYA 2MZJA 2JSOA 1CBKA 1UZDA 5G4DA 2DNGA 3STBC 1H9SA 1WG8A 3A12A 5F8IA 3F73A 4P0QB 4G1QA 2KI2A 1ENAA 1EY9A 3DLKA 2EYLA 3TP7A 3L4PA 1KNEA 3KMQA 2GS8A 3GR1A 4DR3Q 1C0UA 1FEZA 4IQUA 4C3IH 2CPJA 4DV0L 2QFIA 7ICTA 4LMQD 5HROA 8ICVA 5HQMA 3BDOA 2NYZD 3MPYA 1RAOA 4CLKA 3J7A5 3O44A 3F5AA 1H9MA 4C3JB 3T13A 4XRHA 4B3MQ 3GPAA 4O44B 4RPFA 3R2DJ 4TKTA 2MXYA 4WJ4A 8ICSA 3Q23A 4Y6IA 1ULRA 4DN4M 2O3DA 4NP5A 2VZ9A 4FNHA 1N54B 3CYMA 2JH1A 3J7Z5 3FCVA 2G5DA 4IS7A 3I73A 2XMMA 1K0SA 4OJ3A 3BZCA 2K4EA 5KFDA 2HDMA 1DURA 4CO1A 4Z6DA 3M8WA 2HMXA 9ICAA 2ZC4A 3PCOB 4ED6A 1S6UA 4JOIA 2LQ9A 3SYZA 4FF4A 4F7VA 5KNDA 4EZ9A 5JPNC 3B4MA 3RB4A 2WSFC 4OJLA 1NK5A 4C3LA 1ZRNA 2CH4W 1N8RC 1ROFA 4DX5A 4DV3F 3AB4B 2OF1A 1RQ0A 4E98A 4B02A 3Q8DA 5KFQA 1VDVA 2LBOA 3GTKH 1QG7A 1UT8A 2IX1A 3WKBA 1GHJA 4ZLLA 1WF2A 3AN1A 3PMLA 1VQIA 4RNMA 1R6YA 5DJBA 2D62A 3DRPA 3D7SB 5CP2A 1KHIA 1PUZA 3QO9A 3NVYA 1VHFA 2DHHA 1ELOA 5C3EH 3EJIA 2K52A 2DBYA 5FP0A 5M3MG 4TLRA 4DZDA 4EELA 1AN8A 3TP8A 6FDRA 3Q8KA 4N9TA 1ZQMA 5JJKA 1GXLA 2NVTB 4ED4A 5DM6Q 5B66U 3S1QH 2ES6A 3CJSA 1RTIA 3M8RA 1QUQA 1ZXIA 1C1CB 4GS3A 1ITPA 3JSRA 1K83H 2YQ1A 4USAA 1A6XA 3CD0A 5CQGA 3NG8A 2BZFA 3NUCA 1HPZB 1HUZA 1GK8A 3D0GE 1B0TA 4IQXA 4UB5A 1NZPA 1B43A 5IV3A 2ACYA 1OXXK 5DB9A 4HTIA 5HY6A 3I87A 3Q8RB 2GIRA 3HM9A 3W2WB 4B3TJ 1FVQA 2GQCA 2RJZA 5IT9U 2GW8A 3KJNB 3H0GG 3BV8A 2XZTB 7ICUA 2J7UA 1Q12A 1T05A 1GUTA 3ULPA 2WFAA 3QGPA 2A0FB 3D6TB 1I94J 1X3PA 3D68A 1W6KA 1TAQA 1Y5NB 3ZXWA 3KUHA 1TK5A 5BXIA 1KRSA 2RH3A 2OP5A 2NRWA 4R1JA 1B2TA 3KK3B 2YB1A 1F6TA 3N4WA 3BO4A 4K2JA 4J15A 3I4MG 1RWNB 1KDAA 2VS1A 4KGZB 4DCPB 1WCNA 1QUPA 3BKTA 2E7WA 4O5CA 5K8PA 5IGGA 3D2SA 1ZS6A 3C2MA 2BA1A 3ZDBA 3OFHA 1XXGA 3BSCA 4M5DA 2Z56B 2ACMA 5AKKA 3RU0A 2E2IB 1MJCA 3FQLA 9ATCB 3I4HX 3A8IA 5K5MA 2EAPA 4GKKQ 2RHSB 3UMCA 5EOZA 2LXUA 3V81B 4YXJA 1SNCA 2RVLA 2HEKA 3M6XA 2CJYB 3GFHA 4K8RA 5A8RB 1PJ7A 2JJQA 2RQ4A 3RBDA 3I3CA 4AQYF 1EEID 1FD8A 1E0BA 1E2WA 2A1JB 5ALLA 3MR5A 1BDOA 4R8UB 2KO1A 3GSIA 3MEGA 2B51A 2D2CC 4FXDA 1I5OB 2Z4PA 3VQTA 4NXMJ 5ISRA 1Q86C 1GHKA 1RLDA 3VWSA 3DGVA 4OYZA 5DG7A 4C8MA 2OQKA 5M3MB 3QYYA 1A3TA 2OPQA 4JBMA 3FFIB 3DRRB 4NY8A 1GTEA 3AD7C 3VV2B 1HNIA 2HS4A 4Z6EA 2VBZA 4FDFA 2CQPA 5C5MA 4DO9A 4MIAA 5F41A 3SXLA 3PIPQ 3QT7A 1QH9A 2EKYA 5FD1A 4EQNA 2YNGB 1C20A 4PUOB 1U09A 4C1NI 3GYGA 1P7DA 2GO7A 2IM1A 4DX6A 2RILA 3DFEA 4B3RJ 1Q78A 3PJ9A 1RWPB 3PW2A 2F0OA 4BS9A 3C8YA 1I3QB 3NP8A 1ZQQA 2YU9B 3LA0A 3QQCD 1MW7A 4WIIA 1KLUD 1NDLA 1DQAA 4ZUJA 4KHPQ 1Q8KA 2ZM6J 4BWGB 4LFCJ 3H0GB 5E33A 1N0UA 2ZUDA 1V1PA 2J7KA 4POFA 3U1MA 1RAHB 2M4MA 1VLOA 1TWAH 2KCTA 4X84A 1URRA 3QXGA 1CEZA 3CMAS 3I32A 1M5KC 4FYDA 2MQMA 2I0QA 3I4MB 1AT1B 2FGOA 1SYFA 4I2DA 4HACA 3SFUA 1K1SA 1U2FA 1VS3A 4A3DH 9ICFA 3MWYW 4ZK7M 2IRUA 4ANEA 2JK8A 1WCMB 2CKWA 4W98A 4DQIA 1BD6A 2N3OA 2BJ9A 3M4YA 4QJVA 4C0HA 4QZFA 5J2PB 3HKWA 5DQHA 1GMUA 2YTUA 1TY0A 8ICOA 2GQQA 1LT6D 2D6FC 4X65F 2V8PA 2R7VA 1EYDA 1WACA 1FTCA 4K8IA 3I0SB 4XA5A 4H4MA 1U49A 4YMNA 1M0SA 3C6UA 4N47A 1GX6A 2KOBA 3O3LA 3POTA 4I27A 4KE5A 1SKRA 3NS5A 1EAYC 1GO3F 2OUGA 2ZWOA 4KY5A 5KFMA 1K8MA 2QLBB 5D8HB 1DK2A 1FI4A 3LP2B 2YQEA 3EBEA 2G0JA 4DV2L 1CA5A 4H0LC 5AICA 5BYSA 1HMVB 2LU1A 1I4GA 1GOZA 3MM7B 2E8NA 4DL4A 3CC7A 1JWSD 4F50A 1L7MA 2VJ4A 2L1BA 4FVCA 1J5OB 4DEZA 2LQ5A 1YHBA 5AE1A 9ICLA 1J5EF 4DFJA 3AJ1A 4C48A 1NDCA 4UZBA 4PPDA 3C19A 1X4EA 1NK4A 2Z2LA 1BXNA 4RQ5A 2EKNA 1LWXA 5ELDA 2WVBA 1CPZA 4ZCMA 1ZXTA 1FJGQ 1HKAA 2UXCQ 4R4IA 1KKHA 2HIXA 5AI8A 4IZ8A 1T11A 2GJIA 3CJ3A 3MFHA 4LJZC 3D4RA 2M2BA 1IBML 2F52A 4GOPA 2BYCA 1X4FA 2D3ZA 1U02A 2W25A 4LF7L 2DEJA 4ZS6A 3S1RB 1EYCA 1X0FA 1FRMA 3LPYA 4C2MB 3K8AA 4WKYA 3IBCB 4F02A 4ED1A 4DF7A 2H3VA 2BANA 2J5AA 5CYQB 2PFNA 1PTOF 1U4RA 4ERDA 1EP4A 1ZQUA 5E4WC 2V2ZA 3NRWA 3GR0A 3P20A 1TL1B 3QU5A 1KR4A 4KKUA 2HOIA 3K2YA 1VQPS 4O4GA 2J6TA 5KFWA 4CDIA 2JXMB 5ETOA 4C3IG 3S1MH 2H4WB 3R3OA 1AZSB 2HI0A 2B2UC 2A69D 3ETMA 1FFVA 3BJUA 1FE0A 1MLAA 3SIPB 3GV3A 4CRJA 4IOAA 1ZQZA 2HURA 1HHVA 4A3LH 3MPWA 3GCXP 2D0PA 4LW1A 5I4MA 1ET6A 2DHGA 2ASLA 3CRXA 4TN2A 3EVMA 4ZP7A 2QSWA 3W7BA 4F0MA 4P2CB 2EIFA 1IBMF 3WK4A 2OJ3A 8ICMA 2MQPA 4UOFA 1WTXA 2WF5A 4KD4A 2WB4A 1ML0D 3RJFA 1PGZA 2JZBA 1HYSA 2QB0B 2NUCA 4YDXA 1WTBA 2LP4A 4IKAA 1I4QA 3MXHP 2CHBD 3QOLA 3K5NA 2X1AA 2B7CB 3VAFA 4HVZA 1R4PB 2GVDB 4MFBA 1QDUB 1G7CB 3D6HB 3PIOA 5F8GA 3TWZA 4DBQA 4JI3F 3EX7B 1PZKD 4QZGA 4HHHA 3CO0P 1SAPA 1VQKA 3CJ0A 5FOBB 2G09A 4DAYA 1GXDC 1SB6A 5DDQC 4LF8Q 2Y0BB 3DI6B 3DV9A 5AI0A 1QZHA 2PD1A 1CVJA 3SVMA 2DTJA 1D09B 2SNMA 4ZVPB 1PFSA 5C3EG 1WCLA 4IJHA 5IIFA 3BVMA 1CZWA 4OZ3A 4A75A 1S0VA 3UWTA 3KLFA 4DR3L 3TNVA 4J9UE 3C16A 4CKEA 3GTMB 1STAA 2I5MX 2XM3A 1P9YA 1PVQA 3CJKA 2KYXA 5I2YA 3OYYA 4F3MA 4B3ML 1NK0A 3IG5A 1WI6A 1XNRQ 1EZ6A 2WHOA 3DRXA 1S12A 4D3HA 4C3IB 2MUTB 1BCPF 1M4VA 1E6YA 4PYDA 3U26A 4HTHA 2V69A 2NZCA 4CWBA 4ZRZA 1S5CD 4HEDA 1DD2A 1K8AT 3TOQA 3HJFA 1RKNA 1N61A 2AUKA 3KWMA 4AFFA 5IT9Y 3P1HA 3K8VA 2N3LA 2BX6A 3J80L 1UKUA 1Y0HA 4KLTA 2RSOA 1L3TA 3B6YA 1WHVA 1QQ5A 2A2DA 1BGXT 5C4HA 1O0PA 4F5OA 2E76C 3HFZB 4R5PB 2RDIA 4GXIA 7ICLA 1RTHB 3TW0A 1IWGA 3CPWA 2KK0A 2ZKTA 2HCCA 5A0YB 2N78A 2KNJA 4CE6A 2AQ1B 2HFUA 4ATNA 2KHVA 2E2JH 3TJ9A 4F67A 2C28A 1SJED 2NVYH 3ISND 9ICRA 2B63H 2DY8A 1Q81T 3E0EA 1A9NB 4Z7CA 3KHHA 3QIAA 3NK9A 2RCNA 1M6YA 2XC9A 4PXDA 2VANA 2DNLA 2NYIA 1R8PA 3QPIA 3D4DA 2BCQA 3LVWA 3X3MA 3GTKB 1RWVB 2A6EC 4DOCA 4CF3A 2DNKA 2DBBA 4J91A 1UWVA 3T4AC 1D0EA 3W1BA 3MEKA 4H4OB 2L3MA 2K06A 1HL6A 3LP0A 2DNPA 3GJTB 3J7YW 3E01A 1XEZA 1L6NA 4OZJA 3ZDEA 1FO1A 1H7XA 1EXNA 1X3FA 4CLUA 2FJEB 3ZTOA 3IBWA 1B53A 1UE6A 1UPPA 1HFEL 4XUSA 2IL8A 2ZH2A 1WTOA 1GQEA 3KD3A 1X9XA 4UASA 4EX6A 1G291 4IOCA 4QYZK 4IH7A 3BGOP 1K83B 2VB6A 2CWKA 3TO8A 1X9MA 1WTWA 1G51A 5E3FA 3MEDB 7ICEA 4MIBA 2F0FA 4LK1C 1S76D 1HD1A 4DK6C 2DO0A 1F3VA 5M5YB 1KVIA 4WF9Q 1VC5A 4WWSA 4RGTA 1KONA 3DOMA 2JEGA 5IQQA 2QW7A 3TACB 3BREA 1BNOA 4DUZQ 2DUDA 4DXGA 4XT3B 3GMGA 1CC7A 2EBEA 1M8AA 3EN2A 2NO4A 3AUOA 4UOCA 3GTJH 4ECSA 4DR6J 4A93H 4G1PA 4FZVA 2CN1A 5IGBA 4HSVA 4DK0A 8ICQA 4IURA 4ZP8A 4GKKL 5CV6A 3SQGA 4A3DG 2BKNA 3EZOA 3A8JA 2N4CA 1P16A 1EIFA 1TKXB 2QMWA 3MR2A 4N76A 5ALDA 3BSNA 5J2BA 1LTLA 3DWPA 4R8IA 1HQUA 1VJQA 2FZGB 3RH6A 4RQ4A 1O03A 1UL3A 3ZFVA 4JI6Q 2LQJA 5C2GA 5I9OA 2HNZA 4KH0B 5D15A 2UU9J 5J0WA 1D1IA 2NBFA 2CG4A 1OQ6A 2QEXS 1FNWA 2EFNA 4IO9A 4R0EA 3GYNA 5IP7H 5J0YA 5IIIA 4PZOA 1HR0F 3DHWC 5KEEA 1X54A 5CV5A 5IIOA 3SEBA 3JPSA 1HCZA 2IOFA 3KNGA 2XO7A 4RNFA 2ZJPA 4PNYA 2RE1A 3D3RA 2H1YA 5AKJA 2A18A 3ER0A 3TUPA 4MFCA 1N4LA 1KD1T 3RJKA 4K4GA 4QJFA 4J9LA 5JPMC 5CWRA 4KHPL 3TFSA 3IDWA 3GV7B 2E5LJ 1EIYB 3K5LA 2LYHA 1H2VZ 3R5DA 2ASDA 4QWAA 3DDHA 5D0GA 2BJ1A 3LAKA 5AXNA 1Z6HA 1XWEA 1PBUA 1JLAB 4FXKC 1GTHA 4XQNA 4USHA 4AXIA 2ZD1A 1KHVA 3NKYA 3GYXB 4O3PA 4LFAJ 4J90A 2W43A 3LAMA 2ZE2B 4IFDJ 2NRXA 3I28A 3CMAA 5A2QU 5M9OA 4LQ3A 1CHPD 1ZM4A 2B9WA 4F5QA 4P9SA 4J9RA 1MGSA 1HBUA 1KQQA 2MJNA 2YPYA 3EGVA 2ZOMA 1JLBB 3H5UA 2DK2A 2LEPA 2VHGA 1CS4B 1S8OA 5HBMA 4DAPA 3L95X 4NCAA 3SMVA 5HHHA 4N8NA 4J03A 3M2VB 3JXOA 3LTOA 1SMYD 5AK6A 2HBJA 3SV4A 4HH0A 1T8EA 2OMLA 4A8XA 4NLPA 1N2XA 4U7UK 3L7PA 1KEKA 4EYHB 3RAQA 4K4IA 4OWTB 5KYLA 3DXBA 1PJ5A 1WVLA 3Q2SC 3KLEB 3JYTB 3AA9A 5BN3A 4YVZA 3OHBA 1TV9A 5C44B 2PEBA 5IIMA 5AIBA 4O3MA 4YCXA 2ZBRA 1LTSD 1XR7A 4A3LG 4JOIC 3HULA 3K0YA 1BR9A 2FDRA 3F5EA 1UVMA 1EIHA 1XJWB 3RJHA 2C2MB 4QYZJ 2V34A 3SV3A 4CT9A 1JLFB 4FKYA 1AYEA 1EY7A 2A2CA 4K4XA 4KO0B 3S2DB 1SYEA 3LWLA 5CV4A 3DDIA 4BXOB 1X3EA 4QZVB 5IFMA 2BDNA 1S5BD 3QUBA 5F9LA 1RP5A 4ZITA 4H02A 5BJRA 4M0AA 1DJ0A 4LF5Q 2AT1B 3V7JA 3JAMU 4IRDA 4M2YA 4MIWA 3UR0A 2UXCL 1YJNS 5HLFA 3MUTP 1AXQA 8ICLA 4QWBA 1ENFA 4ZKCB 3N5BA 3IP4B 1VQEA 1U0SA 4IG0A 1DJRD 4KV8A 2G9HD 1L7NA 2FHTA 4QYRA 3L09A 2F4VJ 5CV8A 2B2TA 2YTYA 1H6KX 5KOWA 1H73A 1Q3VA 1FNXH 1ILPA 1PH4A 5BR8Q 2GGPB 4CLFA 1WDTA 1WEZA 1T9HA 1BUXA 3TJAA 3HSDA 1B70B 5KNBA 3TADA 3NNHA 3C6TA 4B3SQ 2RB7A 4MIUA 2BCRA 1LEOA 2HAIA 4RW6A 4F2RA 3FDTA 3P49B 5M2PA 3BS5A 3MTSA 4J9VA 4WBFA 4X62Q 2DR7A 2JLGA 2H1EA 2K4HA 2UUCJ 4Z6CA 3MM6B 3HKZD 3KK1B 1VQPA 3HHLC 2CQ2A 4OIKA 3B78A 2F65A 2WW8A 5DNFA 1EARA 3A8KA 3H2UB 1XTDA 5T41A 1L0WA 2YKMA 2IYGA 4WPAA 1OXUA 2W9CA 3NRZA 4R4TA 4CT8A 2MHEA 1STNA 4ILMA 3VYRA 4H4KA 1FJGF 4FF1A 2HBKA 3T1HQ 2JA7H 4K4SA 5HVHA 2CW0D 3GO5A 3MMAB 3RZOH 5C0XH 3R5CA 4DV0J 1ZKOA 1Y5LB 1Z7TA 5I2XA 3KOOA 3AHPA 4NLGA 3KLSA 3DRSA 3J81i 3F41A 1UW9A 5KG6A 1ZQYA 1RKIA 4NASA 1JC7A 3V6KA 2PGCA 4F4AA 1HWLA 1I6HB 5AM5A 3NCQA 4NB3A 1EQTA 1UE1A 2ZBIA 1XMQQ 5IC6B 3DEEA 2YNFA 5DETA 3NGSA 4DNIA 3UQ2A 1DCZA 2HVIA 1UVKA 2DITA 5BOLA 2DHAA 4BBRB 3AYHB 1MWYA 3D6MB 1ZQSA 5EJWA 3FEYB 3IS9A 3NWRA 2D3OR 3KF8A 1SFOH 2B63G 4WK1A 4LF8L 2C2NA 3JPNA 4ENOA 1D3WA 1VIXA 4KLKA 4F93B 1B7FA 2OMOA 2YWEA 1VF5C 3IGNA 5D6GA 3ZNJ1 1NMGA 5FJ4A 3DRYA 3E0JA 1T5XD 1SWVA 4K0KF 3UFCX 1P6TA 2V8DA 4C98A 2DL0A 3FRPB 3PRVA 4TQRA 3PUWA 5JVHQ 3UD4P 2JOQA 1SYCA 1N36Q 2MO0A 1GO3E 5FDLB 3K4GA 2DWQA 2EXUA 3IAM9 3LW5C 1U4MA 4TKOB 2CQHA 4IYQA 1OTCA 1TTHB 4RQMA 1FERA 4UZCA 3VVUA 4KX5A 1XNRL 4USMA 4UTGA 1EY8A 5CH7B 1EY6A 1Q82T 3D1HA 2MGZB 1E1OA 1ZQWA 4KYZA 1SE2A 2JWNA 1ZM9A 3OFEA 1H9SB 1R3NA 5LJ3Y 1T3NA 2UUWA 1D2BA 4OI6A 3DC2A 1ZQPA 3LYSA 3KLHB 3CVKA 1CZGA 5LMUL 3NTUA 2HGNA 3VAIA 3NENA 1ZA1B 1C0UB 3D0IE 3V2TA 2V2QA 2WVCA 2VQEQ 5T14A 1MI2A 4GLVB 2ALZA 3OHXC 4DUYQ 2LXFA 3G4SS 4K2KA 5L37A 5DEHA 1U1LA 2Z2ZA 4MKYA 4XAKA 1S72S 4A93G 1SNOA 5AJ3L 1X8DA 1YBUA 4KQZA 8ATCB 3M8PB 3AU2A 4J37A 4RT3A 2OPRA 5DLGA 3IRXB 3L5KA 1COKA 2DKOB 2OAUA 4E6IA 4M5HA 1U0HA 4I2CA 1ZH5A 4PG3A 3UDVA 1NPKA 4RW7B 3ED5A 2NVYB 4HI1A 1PTOC 2MQHA 3MM8B 2B63B 3UM9A 1RT1A 3FP9A 5D3IB 4DS5A 2KICA 2LFVA 1ASZA 1RT6B 1YLXA 1RE1B 2HBYB 4QZIA 1IR2A 1R9TB 4J9KA 5IP7G 1HFNA 1UFWA 2UVWA 3P5TL 3SSSA 4ZHRA 5D3GB 3FDSA 2HCIA 4NMZA 4DFKA 5JJZA 2CWPA 2BBEA 2VG6B 4UUXA 3BSOA 3MA2B 4DSKA 4NLVA 3W62A 4DPTA 4F0KA 2EQSA 2HHHQ 4CLLA 2M52A 1FKOA 5J1EA 1VQGA 1IVZA 4LR9A 1U47A 4KGXB 3ILLA 4BY1B 2OI2A 3QEAZ 1GFWB 4NCGA 5C4ZA 1DQ9A 4RLEA 4QBUA 2KCMA 3ISDA 4JB3A 3VDYA 3HXMA 4EEYA 1CQFA 2UUAQ 2KDOA 4X4NA 2NREA 2XSJA 4X65J 2JV3A 1NSQA 2F44A 2AJ4A 2HLTA 2Q4TA 2QMXA 4PL1A 1HA5A 3OJUA 2VQFL 3GV8B 3MTJA 1BPBA 3A13A 2G0AA 4FN5A 3M4OH 2X6LA 5J0XA 3HHLB 4ZVEA 3IRBA 3K5MA 4JI7L 2ZTDA 2FQQB 4LT6A 5B0CA 3TAQA 5A2QY 5JJLA 3PF4A 1ZOTA 5KT3A 3CGIA 1OUQA 2NCKL 2MSNA 4TY8B 4JI6L 2I5JB 2CJKA 3KUGA 1E6VA 1FYCA 2HHTA 1SQEA 5KFKA 1IBLL 1RWMB 4A47A 1O6XA 2R7UA 2PFFB 2ZIWA 1W25A 4OYMA 3THPA 1WKJA 4YHHF 4M5GA 1HUMA 2FMMA 2ERRA 1TKZB 4XQJA 4OHVA 2KU7A 2O5JC 3NXZA 1RIPA 3RJMB 2QEXA 3K89A 1IKWA 1O78A 4RT2A 5JVH3 5ITHA 1B3QA 1FD2A 4OWXB 2W2NP 1BBWA 1T9XA 3IM9A 1RQNA 3A5ZB 2K89A 3WKCA 1NCLA 2F8EX 5KFJA 2GVAA 1VQYA 5AT1B 4DUZF 1O8BA 3QGIA 4UP9A 1S5ED 5DGBA 5EBDA 4ID5A 4A8YA 1BCPC 3PO2B 1CULB 5EWGA 5GAGC 2X3DA 3RR8A 3HMJG 4YR3A 3CUNA 3WIUA 5J8YC 2IJFA 3NSWA 1S5DD 1RTDB 3D6CA 2K1RA 1KRPA 5HANA 1U1PA 2B6GA 1KDHA 4MK8A 3R1HA 2QTWA 1FIQA 3ISCA 3GIMA 3U1LA 2K8AA 2XWYA 4YFUA 1YK9A 4IH5A 4MTPA 2W7AA 2FJDB 3KFUA 3JAMY 1P1LA 2VDHA 5ETQA 4NPSA 5C4JB 1OYDA 2L08A 2KJ9A 3PG9A 4LVNP 3KLIA 5E0OA 4RAUC 2JA8B 5HMMA 2AKWB 4HTJA 2VICA 1MSWD 5C42B 2B0CA 2AW0A 2ZHOA 4EQ5A 3VR1A 2WZ1A 3QE9Y 1CI3M 2YQ0A 2R3VA 5CAAA 5M3FH 3S1NB 1D5ZC 3NVVA 3DLLA 1U9RA 1P9QC 3GTLB 1PH6A 3SK5A 4J9SA 3P7JA 3DKDA 1FHTA 1SV5B 1SNDA 2IHFA 1IHZA 1V1PB 3ZO7A 3PFOA 1IBMJ 3MM5A 5C0YA 2BJ8A 1NR2A 1VRUB 1HW8A 4LF7J 1M5VC 1DTTB 4Y2IA 2IX0A 3HKZF 2BV3A 4DX8H 5I6YA 1OXVA 7ICPA 2Q43A 5CXTA 4OD0A 3CT9A 9ICOA 1UWAA 2YNIB 3TA0A 5E7NA 2V9KA 1F2HA 2TSSA 1N5XA 4IG3A 1C1BB 3PF5A 9ICWA 3QJLA 3A54A 1ECWA 2OEHA 2FGCA 2ZUGA 2ZIXB 2EWHA 2I8EA 2JA7G 2NZOA 3S14H 2M2LA 3KLWA 2XMUA 2I5HA 3EWGA 3Q8QB 5C0XG 4RWXA 1SQFA 4R25A 1M1KT 5KFYA 3AA8A 1SIZA 2YX8A 3RBZA 3HJVA 5A35A 1RU2A 4LF5L 1BE4A 3EE3A 4H4MB 1TUWA 2ISPA 4PZ6A 4PG4A 1PTOB 2EY2A 1N34Q 5FLXc 2YWFA 1SJ4P 3R8YA 1JNRB 3US5A 1HWUA 3ITHB 1YJNA 3FMBA 5E41A 2MKJA 1CQNA 3BN7A 1T3OA 2LMCB 2EI5A 2EK6A 2FIUA 2QX0A 4YMEA 1WORA 4HHUA 1MN7A 3M8QA 2GMLA 4U67Q 5BR8L 4JG2A 1FTRA 2BJEA 2A3VA 4UY85 1Z19A 4RZRA 4F8RA 2RF2A 3BYRA 1GUWA 3BYTB 2DXFA 2QC3A 4LFBQ 4B3SL 3IMQJ 2LQ8A 5DO2A 4AD6A 4Y7NH 3DYAA 1ZQRA 1JLQB 1FJEB 4A3GB 1SBRA 2L55A 3NNCA 1I4XA 1K3BC 5FLXL 1R43A 1ZEQX 3HOXB 1TR0A 1NAPA 2FMSA 4X62L 3SAHA 3T53B 2DEIA 5GMKa 4NLNA 2VOPA 3DOKA 3EPGA 2C2ZB 4LF1A 2IHNA 4WFZA 2KZ3A 1C48A 1OXJA 2H65B 2J9DA 1SMXA 1F44A 2I38A 4YWMA 4IH6A 1N48A 2ZJRQ 4Q8FA 4G4KA 2PE8A 2DHSA 4CBVA 2GX8A 1KWMA 3T1HL 4DXLA 1AUDA 4JW0A 9ICVA 8ICKA 2M9KA 4DR3J 4LZDA 2A10A 4O3OA 2XHWA 1UAPA 2EYJA 1KDNA 1EP4B 4IDKB 3DLGA 3FEXB 3H0MB 1I50B 3BEGB 2VKZG 1JOKA 4DL7A 1HLWA 5J29A 4YY3Q 1PRTF 3ND8A 2VC0A 5A8KA 2EJGC 1HUNA 4B3MJ 2H9ZA 2JA7B 4QZ9A 2F9DA 3S9WA 1T94A 4UB6U 2M8DB 1CI4A 1CJUB 1VGYA 4CTAA 4XIUA 2OT2A 1XMQL 2N1RA 5SZTA 2WIIB 2YV5A 3GU0A 2BDPA 2IRYA 2D74B 3N6RA 2OELA 3ZTSA 5MAOA 5BN5A 1KSPA 1FRKA 3GCWP 2H3IA 4G1IA 4X62F 3J80U 5FO7B 2J0XA 1S1UA 3IAS9 1NR4A 4NL9C 1OWXA 3ICEA 1E2ZA 2G0IA 2F03A 5LOQA 1YNJC 5HP4A 3AOCA 5D65A 3UE2A 3HHDA 3VCDA 1K9MC 3QLHB 1HNXQ 2IVFB 3T1HF 4E0DA 1VRTA 1N36L 5C5JA 1A3VA 2L9WA 3I4PA 2OPSB 2Z58B 3BKUA 1S0NA 1Z47A 1UW4A 3PNCA 3EROA 1V9PA 2A69C 3QOJA 2GMJA 3VHQA 3HHEA 2AX0A 4X4QA 4O5KA 5AKYA 1LV5A 4TLQA 4DHVA 4FNFA 5FLMH 1RT3A 1MG7A 2O4XA 3TR5A 3B0YA 2E66A 5IYDH 1H9RA 2V4JB 5F8HA 2LMRA 3W5XA 3KG1A 2NUHA 1JB3A 2W9BA 1KOOA 3CO9A 1JR0D 1S59A 1REGX 2IOHA 2VQEL 3OSNA 2IJRA 2CPHA 3G8SA 2OFHX 3TS2A 1WOCA 4DUYL 2B2YA 4JV1A 4Y2UA 4FXWA 2IX3A 4YN4A 1KTQA 2MDAA 2J4XA 3R8BA 5HI7A 4NI2A 1BPDA 4CF4A 4H13C 2B5JA 3MI7X 3G4SA 5C3XA 1E6YB 3WWVA 3MEEB 1PHJA 1S72A 1PO6A 2D1CA 1C0TA 2FHMA 5JOBA 1FT8A 1UTAA 3J7A1 3Q8VA 4UP7A 4C0ZA 4F4ZA 3R5JB 1C4AA 3A0HU 2ODGA 1JJ4A 1LT4D 1ZQEA 4NA2A 4XQQA 4C3MA 4OV6A 3M7DA 4IQZA 4KHVA 2CRLA 4NKLA 2JC1A 1GNKA 3IG1B 1FNOA 4KPCA 1E2VA 7FD1A 1LWEA 4CDCC 3S2HB 4GKKJ 3CNHA 1W26A 2KRRA 3NS1A 4JCVE 3KJVB 4JI2Q 2H5IB 1N8RT 1LWCB 4A8EA 3GTOB 2H5JB 5KFIA 3TDQA 5CHCB 3U58A 3TP2A 4M9LA 1LW2A 2VQEF 3PO3B 4Z6FA 3AOAA 1G3OA 2EC2A 1COOA 3WKDA 5DBBA 1CQMA 1TFRA 2HHHL 3BZQA 1BQNA 1RT5A 2RSNA 3UMBA 2W03A 4HJ9A 1DK3A 1ESRA 1UA1A 4DPOA 3IBFB 3TUJC 2VF3A 3I55S 3HOVH 2OH2A 4RW4B 1K8GA 5J2HA 3HOUH 1QE1B 7ICRA 1N63A 1U1OA 5HL7Q 3I76A 1SKUB 4A3KB 1SC1B 2EY1A 1FEEA 2MHNA 2EZYA 3MECA 4QNLA 5DZ7A 2BA9A 2MPMA 1SL2A 3I4NB 1FX2A 2WSCC 3F44A 1R7IA 3MCOA 1I51B 1QQ6A 1M5OC 4KHPJ 1RU1A 3EDRB 1KLGD 1N32L 2YVSA 4WJ3M 4QQBA 2IC3A 1NNXA 2QLTA 3UCGA 5HVGA 3THVA 5J2NA 1AA1B 2M3DA 3E51A 4G3IA 2Z8LA 3VAGA 5M3FG 4JMUA 1HA6A 3M2RB 2FJVA 3M4OB 2B6AA 2YNHB 2LXKA 5L39A 3HSZA 2XULA 2K5WA 2O1PA 1JCKB 2A1BA 1D8ZA 4QOTA 1HNVB 2HHHF 3TAPA 1FKAF 4Q0BA 2ADBA 1JLCB 3MXNB 3E5SA 3X3UA 1K8OA 5B0DA 1YJTA 2VJVA 4ED2A 1Y00A 3QJJA 3AU7A 1KBUA 2UUAF 1NUCA 4N8X1 5E4XA 3BDEA 3GTPB 4NYZA 4USJC 2WONA 4OX9F 4RX6A 5LL6S 3CJ8A 5AM3A 2MFIA 2B9YA 4LSLA 2FE9A 2JRZA 2KG1A 5IGDA 4NJ8A 4I68A 2KT2A 4JB8B 1HHTP 4DPWA 2NZHA 4KLOA 5EBCA 2EY5A 3UN5A 4B9MA 1T7PA 1PYOB 2JHEA 3VR4A 2DD8S 4FNIA 2O01C 2ZT9C 5DDMA 1UWBA 2YKPA 4ZKBB 1QNUA 2EVZA 2BQRA 4MNOA 5A8WA 4I0WA 1Q86T 2V4DA 1IKYA 1T03B 3DOLB 4USVA 1WOOA 5GMEA 3OGUA 2R93H 4L5QA 3S1TA 4X4TA 1NOMA 3QFWA 1FR3A 2E29A 4QZCA 2W3RA 1UETA 3LF0A 1S6PA 2EG2A 4DV1Q 1OO0B 1TL7A 3M1VB 2VJ5A 1OY8A 2WAQD 3C15B 2R4FA 1SI9A 4RBVA 1I6VC 2LEBA 4FS2A 2DRDA 1STYA 2J8SA 1FJGJ 3QB3A 2R18A 4HH1A 2UXCJ 4NLWA 1L1OB 3LNNA 3D0HE 3KOAA 3MTKA 4QIEA 3M8YA 4ALPA 2MY7A 3KJOA 4KAIA 1U45A 2KBNA 4LSNA 3PRDA 5D0RA 2VFUA 4J9MA 2XMVA 1AFPA 3ILJA 2HOQA 5J2EA 2SOBA 4BWJA 2OTJS 1NDKA 4EFAC 1HBNA 3IO1A 4DR7L 3T5HA 1Q1BA 1VMBA 5LMNQ 3OR2B 4HL9A 4DV4Q 4RQ8A 3FEZA 4QWCA 5I3PA 2IAJB 1GX5A 3PX6A 4RQ0A 2FMCA 3I72A 3V5RA 1FWKA 2K5DA 4O0NA 5BN4A 1RA7A 4Y65A 3MPUB 1O80A 2QG9B 4RW9B 4OGQC 2G5HB 4FO2A 5IINA 5K8NA 3NS6A 1CKNA 1P27B 2RNEA 4KLGA 2XMTA 8ICEA 4MEYA 1Y14B 2HK2A 4K59A 4OYXA 2R7ZB 1PKUA 5HBMB 1DXMA 4GO7X 2ZFHA 3FC4A 3R5GA 3DGPA 2HS0A 5KFAA 4NM2A 4YB1P 3C1ZA 3IFEA 4ECQA 1I1GA 2BE5D 3KLGB 4C0BA 3GG1A 4PV1C 1TP7A 1N34L 1AQ6A 2IM0A 3CC2S 3GIKA 2HQGA 1IL2A 1LK5A 1YZ7A 1I94L 3GILA 4YG2A 2F40A 3MOZA 4R66A 3SDZA 1BKBA 2D41A 1ZQXA 4TQUS 3EA6A 2PZTA 4Y00A 4C8NA 1ZQFA 2DT9A 2CXEA 4JOUA 3C5GA 3DLJA 4KKOB 3A8EA 2GO9A 1AROP 3GIIA 5M5WH 5C24A 4QWDA 3J80Y 3W60A 1TUVA 1PH5A 3CKIB 3GTQH 1VMCA 2QO3A 2DNMA 4UB4A 4ZPVR 3M05A 3NTKA 3M9NB 2I9GA 4OHJA 4I2PA 2R7QA 1JRPA 1PMRA 3PSIA 4EYIB 4UW2A 1YJUA 1WOSA 4Y0FA 3DHQA 1RWKB 1YIJA 4ELVA 1EWIA 2R2UA 1H9KA 3OHAA 1X9NA 3B6BA 3KKAC 4CDGA 3G6JB 5IV4A 1BQMB 4LF8J 4M5MA 2ZH3A 3M30B 2XY7A 4NW2A 4IUUA 3UDEA 2XI3A 2R92H 5KAFU 5J0RA 1LNQA 3CJTA 1AUSL 4DR4Q 1S1TB 4ULLA 2BABA 3UPQA 1SVDA 1S4ZA 1VQ4S 1HW9A 1KTKA 5FLMG 4EMDA 3VAMA 5HQLA 1IM4A 3MHBA 4RQ6A 4ZCLA 3NUQA 5J0SA 2ATCB 2MQOA 3BM7A 1RT4B 4HT7A 5IYDG 4KMUA 2PI2A 5DQIA 2K14A 4QR2A 4YY3L 4P2MA 2KSOA 2NN6H 1NK9A 1RODA 4UB3A 2DNZA 2RHQB 2LKYA 4KLSA 4P7TA 1Q4RA 1XNRJ 3KDFB 2PNHA 3NBHA 1DONA 3QSYB 2E75C 2VPWB 4LFBF 1RM6C 2UZAA 1J2VA 2HQCA 3PW4A 4X64F 2VDIA 2F0EA 4ODGA 4MYTA 4KN4A 2W9CB 2DR8A 4FFDA 3TN2A 2LSSA 2WOMA 1UEAB 4OHYA 5LMUJ 4OJOA 1YJVA 5ALZA 4JUZA 2OEOA 2R2TA 8ICHA 2F0NA 5IOLA 4EBCA 2IDLA 1AE3A 2C1EB 1NJWA 3N0VA 3I0RA 3BB5A 2HVZA 3SAGA 1D9FA 5J1PA 4MN3A 1HNXL 3HRDD 3W8PA 3S17B 1QCKA 1UVNA 2MZ1A 1FDDA 2K4KA 2GH1A 3HKZE 3S01A 5AJ3J 2EFQA 3MDAA 3ILOA 3ZZPA 2PW7A 3H2VE 2PA3A 4IPCA 1FE4A 1SXTA 2AEJA 5EPLA 4F7XA 3D0FA 3AJ2A 5F8LA 3DM2B 4RFBA 5J22A 3HKZC 2FJBB 3T51B 2ZWPA 2VG7B 1L2FA 4H44C 4ZJQA 1IV8A 2GA4B 2J0TD 1Q79A 4PL2A 4ECYA 3E3XA 4DV6Q 1QD1A 1W2BA 2K7KA 4P75A 4O42A 2XNQA 4M9NA 4IQVA 2JEFA 4J5OA 3K17A 3JAMi 4JI5Q 2CW0C 4KK7A 4BXXH 1NK7A 2JA5B 2AYEA 2RDDA 5HMYA 5KFLA 2HRUA 4DR2F 3SE0A 3ONAB 3PKYA 2EEYA 3HOVG 1Q46A 5EKKA 2F0IA 1PSDA 2CDQA 3HOUG 2F3VA 1Z4OA 4FYXB 4S3SA 4OEMB 4CKCA 2ZC3A 2EFVA 3K80C 2PMHA 2PNRC 2R8KA 2NVXB 1B8AA 3JS9A 1QZGA 1UPMB 1YBYA 1PH7A 3QT5A 4KHZA 2EJFC 4K4WA 4K2LA 2QMUB 4PXBA 5J2QA 1PJ6A 4MEXA 4OO1I 1L7OA 5I9PA 3OFFA 1VLBA 4HEA9 4YR2A 1TV6A 4JI0Q 2YKAA 4DUZJ 1U1NA 2DGWA 5ETMA 3MM9B 1RTOA 5LSOA 1S1VB 5ETLA 2JHDA 1H98A 2UXDF 2JGAA 2D9UA 4EBEA 4F0HA 2G5IB 2VQFJ 4OI2A 4QR1A 4KTAA 2RQKA 1QVGR 1DLOA 3Q24A 1LK7A 1T5EA 5K14A 3V2UC 3JSMB 5DB8A 4JI2L 4F2SA 1S99A 3T19A 4C80A 1Z1BA 2PI5A 2MB0B 4K4ZA 3HP3A 2POKA 3UE1A 2E2HH 4KJOA 4UQGA 4DZ6A 2EG1A 2D9OA 5ALHA 2PFDA 1J8IA 3ZI4A 4JI6J 1KLMB 3VF0B 3OW7A 3HD1A 4CQ1A 4DI6A 1IBLJ 4OYPA 4I67A 4HN7A 5KIXA 2ZTEA 1ZQTA 2A6ED 1C8CA 1WC4A 3DLEA 1LO5D 4HJ7A 5TZVA 2PDAA 4ABNA 3GD7A 1GD7A 2VD3A 4HI2A 3D28A 3IWNC 2IDEA 1QLNA 2ZUCA 3LK9A 4DV3Q 1KDCA 2AJFE 4DV7F 2X1FA 3UW1A 2FLOA 4C3JH 3M32B 1RCVD 1PRTC 3I55A 2ZNZA 4L74A 4IL6U 2CADA 4PQUB 3M7GA 3B0XA 3K1ZA 4DG1B 4UT4A 3SZ2A 4LUZA 2IRXA 5AM0A 2GNKA 5HK4A 2BPCA 2E7VA 5FLXE 3E0FA 1X4BA 2B7BB 1JX4A 4ZHRB 3TAMA 4KMOB 1Y8PB 2R93G 4N5SA 3PACA 3HOUB 2KL8A 4OJPA 1KTVA 1R8AA 3NASA 2DO4A 3PTWA 2B56A 2WAQF 3LH2S 2XIWA 3D6WA 3C28A 2FVSA 1UVJA 1R0AA 5IIKA 3AL0B 2KUMA 1MSGA 4WCEQ 3H0PA 1ZM3A 3IWXA 4TUQA 4DR5F 2Y8YA 1YTYA 2WB1F 5ELOA 3KJPA 4APVA 1J9OA 2Z6KC 1X55A 2I0XA 4J9NA 4K8JA 1T9UA 2W2MP 3WHIA 5GTIU 1WEXA 5KOXA 4IFVB 3G82B 1RAEB 5K5PA 1FESA 2K8CB 1B99A 1NY4A 4JYAQ 1EQVA 4RG1A 3NVWA 1GM5A 1Q8BA 3U02A 1RT2A 2MMYA 2OSQA 1RT7B 4CLSA 1Q7YT 1Z00B 1YITS 1N6QB 4G7ZC 2VOOA 1FGBD 2H5XA 2XICA 3T79A 1R8CA