3CW2C

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
266
structure length
266
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 63
structure length 266
sequence length 266
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00575 S1 S1 RNA binding domain
C PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3cw2C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cw2C01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3cw2C03
2UU9Q 1PH6A 2E2HH 4A3DH 1XNQQ 1E1TA 1HNXL 2DUDA 1Y1VG 5BR8L 4A3MH 3AEVA 2WP8J 2AWOA 4PZ7A 2UU9L 1OXTA 1YNXA 4R4OA 2K5HA 2ZJPA 4DV2Q 3D31A 3KF6A 4LFAQ 2VUMH 1E3PA 3HKZG 4OXPA 4MNOA 4DR5Q 3T1YQ 1CUKA 2I5HA 3A5UA 4DUZQ 1VQ4A 1KIXA 4PG3A 1IBLL 3HOUH 3UDFA 4A3MG 3E9HA 1YHAA 4HIOA 1WCMH 2D0OA 1YEZA 4QL5A 4A3LH 3TS2A 3G71A 1QZHA 3HOYH 3EN2A 4ME3A 1LYLA 4RG1A 4NXNL 4A3JH 1SRUA 4JI3Q 4X6AH 1JJ2A 4A3GG 1A63A 3CCQA 2LXKA 3I4MG 4IJHA 5HGQA 1C7YA 4NXNQ 5IYDG 2RF4A 1V1QA 4YCUA 4OX9L 4QQBX 4B3TL 3RZDH 1VCIA 4ALPA 1FL0A 1WCMG 2DGYA 5LMNQ 2NN6G 2EQSA 1XMOQ 2MFIA 3PGZA 3HOYG 3ULLA 5IYBH 4A3BG 2VW9A 2OWOA 4UP8A 2ID0A 3CCVA 4JBMA 4A3GH 3HOWG 4BY1H 2KHIA 3CF5A 3HOZG 5IYDH 1XNRQ 2A19A 1C9OA 2AKWB 4DV3Q 1MJCA 4IFDG 1EOVA 3CMAA 4DR1L 4BXXG 3PUWA 4DV0Q 3U4ZA 1YBYA 1IL2A 2QN6B 2F3IA 1L1OB 4LF8Q 4K0KL 2B63G 4BBRH 3CCLA 1B7YB 4YY3Q 3F2DA 4LFBL 2H5XA 5IWAL 4GKKQ 4LF8L 1SMXA 2E2IH 5JJKA 2B3GA 2ZTDA 4HJAA 5IP9H 3HOXH 2JEAI 3K8AA 1Q82C 1SE8A 3UE1A 1K83H 3PUXA 2JE6I 1VQ9A 4JI0L 3U50C 1AE2A 2KBNA 3CC7A 1HR0W 1FGUA 4LFAL 3I2ZA 3ZJYC 1QZGA 2IX1A 3I4NH 4DR7L 4JI8L 2CFMA 5J3BA 2L15A 3GTPH 1OXUA 1OXSC 1E22A 1QVGA 2Z6KA 3BZCA 2VQEL 3S2HH 4YY3L 4AQYL 4OO1I 2I5LX 1PH8A 1JJGA 5E7NA 1JMCA 3OTOL 2C35B 4JI3L 3EIVA 4DR1Q 1X54A 1N33Q 4GOPC 4GN4B 3I4NG 3HKZE 1N32L 1K73C 1HZ9A 1QUQB 1TWAH 5JEAG 4DKAC 2R7DA 1EIYB 2QGQA 2LSSA 1I5FA 1KQSA 1GO3E 3GTGH 4YWLA 1PFSA 3RN5A 3CCEA 5LMNL 4P71A 2E5LQ 3S17H 1TXYA 4X64Q 4GLXA 5IP7G 1QVCA 1WFQA 2JK8A 4YWKA 4GN5A 1YJ9A 4DR2Q 2PMZE 2ES2A 4X66L 4DV0L 3OW2A 3BJUA 5BR8Q 2Z6KC 3A5ZB 3NENA 4NB3A 3I56A 4NXML 2D62A 1KD1C 5C0XG 3VDYA 5M3FG 4QGUA 2B29A 1XNRL 1WYDA 4KLKA 1HNZL 2AMCB 1T9HA 1IBLQ 4DPGA 4A3KH 4EX5A 2Z0SA 2K14A 4DUZL 4DK6C 5ELOA 1XMQL 4MTNA 2K50A 5JJIA 2OQ0A 3H15A 1Y1WH 3AQQA 1VQLA 1TWHH 5IYCG 1TWFH 1RIPA 2VY3A 4DV5L 3S1MH 2PI2E 5FLMH 1X65A 4JBWA 2A1AA 5IY0A 3OYYA 1VQJA 4A4IA 4YCVA 4A3KG 1HJPA 1HNXQ 4JOIA 1WI5A 2NVXH 1X3GA 2JA9A 3PO2G 3DM3A 1WOCA 4NPSA 2I0QA 1O7IA 1HNWQ 2VNUD 1ASZA 4P73A 4JI2L 4BBSG 2UUBQ 2PQAA 1SFOH 2K4KA 4DR3L 3W1BA 4JI6Q 2R6GA 4Y7NH 2ZTEA 5C3EG 4DK3C 4P72A 3K7UC 3PO2H 4DUYQ 3CC4A 4PZ8A 4LF4Q 1VQDA 2UUCQ 3G6EA 1W3SA 4LFCL 3RZOH 3UDGA 3ERSX 1EYGA 4B3MQ 3K7AH 4X62L 3KJPA 3M9BA 3M3YH 1VQGA 1Q12A 1TWCH 5GAEC 5GADC 2BH8A 2HT1A 3AFQA 4IPCA 1X9NA 4DAMA 1Q8KA 3PUYA 4A3LG 1HR0L 1P16A 2OCEA 3KDFA 4A3JG 2Y0SG 1K8GA 1MKHA 3S14H 4DV6Q 3HFZB 1SLJA 3UDXA 2MNAA 1HNZQ 3GTQH 1KAWA 3B6YA 5GAHC 1X3FA 4AYBG 5C0XI 4JOIC 4TQUS 1UE6A 2XGTA 1LM0A 1U5KA 4GKJL 3CP0A 2UUAL 3GTLH 4GNXC 4DV5Q 1XTDA 4LWCA 4BY1G 3GDEA 4O0AA 4R4QA 1VQEA 3CCUA 4IO9A 4JYAL 2BA0A 2YTYA 1X55A 4A3IH 4LFCQ 3M4QA 3NBHB 4X64L 4JI4Q 4FDBA 4PZ6A 1FJGL 1CSPA 3MEFA 5FJ8G 4HIDA 2RHSB 1CKOA 4A76A 1KHIA 4R4IA 1Q86C 2R93G 2K5NA 3HOVH 1VQOA 2UUBL 4JBKA 1K3RA 1Q1BA 2BA1A 1E7ZA 5IP9G 2GVAA 4JI1L 3HOXG 4NXMQ 1HNWL 4DV1Q 4JI7L 1S40A 4POGA 2WB1G 4DR2L 4IPDA 1EQRA 1Z9FA 1YIJA 1FVIA 4B3ML 3CW2C 1Q1EA 1JJCB 1VQCA 4LF5L 1N36Q 4DUYL 3STBD 4DR4L 4X65Q 4TVAB 4WJ4A 1UE5A 1PA6A 2KCTA 2JA6H 1A0IA 5GQOA 1N32Q 4GNXB 1FJGQ 4DV4L 1I94Q 1A8VA 2HIVA 2KENA 3J81j 4R4CA 4JI2Q 3GTKH 4HJ8A 3GTMH 4UY8C 4YWMA 4GS3A 1Y14B 1Q46A 3S15H 3UE0A 4OWXB 1PV4A 5AJ3L 3KF8B 1LUZA 3S1NH 4KI0A 4LF9Q 3J7A5 3KLWA 3AYHB 2I5MX 1OTCA 5IP7H 2N78A 4GLVB 5C3EH 5LMUQ 3H3VI 3W1GA 1W2BA 1YJNA 1VQ6A 1AE3A 4DR3Q 4JI6L 3I55A 4LF6L 2E8GA 3K81C 2UXBQ 3CPFA 5IE8A 1N33L 3GD7A 2YV5A 1PH7A 4LF7Q 2ATWA 2F52A 4H02A 4BY7G 1YHBA 3UDIA 2JQOA 2R92H 5M3FH 2VZAA 5C4XG 1BBUA 4OX9Q 3ER0A 2YU9H 1S3OA 3ULPA 2PQAB 3RLNA 2JJQA 1B70B 4X66Q 2E2JH 2R93H 1HZCA 4O2DA 2ZM6L 3FKIH 4OONA 4DAYB 1XNQL 3A74A 2CKZB 3CXCA 3F8TA 4LUOA 5IYCH 2QA4A 4DV7L 4HJ5A 1IBMQ 3NEMA 2HHHQ 1Q81C 5C4XH 5FLMG 1J5EL 3F1ZA 4OWTB 1XMQQ 2UXDQ 1XMOL 4QJFA 1J5EQ 1C0AA 4GOPA 1VQ5A 3LGJA 4DV7Q 2UXCL 3FP9A 3M4OH 5IWAQ 1HH2P 5M5XH 1P8LA 1V9PA 2NVYH 1IZ6A 1S72A 4BBSH 4XIGS 4HIKA 4A3IG 3I7FA 4UP9A 2JA6G 4IFDJ 4PMWA 3ULJA 2EIFA 4GKKL 1AH9A 5FJ8H 2R7FA 2IT1A 2AHOB 2CWAA 4POFA 1K0RA 4P75A 2Q2TA 2ALYB 4QY7A 3ICEA 3F2CA 3IRBA 1ASYA 3HOVG 3TEHB 5IT9c 1YZ7A 1KL9A 1G291 3M7NA 5DLQE 4JI0Q 2JEBI 4L5QA 4LW1A 4R1JA 1RL2A 2VQFL 1EFWA 2V1CC 4DV2L 3CAMA 2MO1A 1QUQA 4A75A 2N3SA 4LUVA 4LFBQ 4B3SL 4OO1G 5K36G 2YTXA 4LF9L 2RCNA 3CC2A 3KDFB 4A93G 1G6PA 5FLXc 1J6QA 2UXCQ 1MIUA 2Q2IA 3PUVA 3K0XA 1N8RC 2IY5B 2JA8G 2R92G 1PH3A 1E24A 3PIPA 2GVBA 3S1QH 2F4VQ 4QIWE 1JT8A 2Y0SE 5C44H 2KCMA 3I4OA 1QVFA 1BKBA 5ELNA 4IJLA 4YHHQ 4JG2A 3PSIA 4DR5L 1JB7A 4IPHA 3FKIG 1B8AA 2ZJQA 2AWNA 2CQOA 4KHPL 5M3MG 2K5VA 1IBML 1UWVA 1L2FA 1EIFA 4AQYQ 2YTVA 1PH1A 4IOCA 1GVPA 4UPAA 4GKJQ 3J81i 4K0KQ 2WAQE 1JE5A 4R4TA 4JI7Q 4L5SA 4IFDI 1DGSA 1YHQA 4KHPQ 4JCVE 1EUJA 4GLAC 1KRSA 1NJIC 4LF6Q 3CD6A 2R7ZG 1UE7A 5C0XJ 4LF7L 4IOAA 1CKMA 2JA7G 2EXDA 2ZTCA 2NN6I 3STBC 1YI2A 2NVQH 4HJ9A 1CSQA 1CKNB 1VQKA 1L1OC 2IX0A 4BA1I 4HJ7A 4A3FG 4EQ5A 2ZM6Q 1SR3A 3BZKA 5C4JH 3J7ZC 1LTLA 3T1HL 3TS0A 1HZAA 4B3SQ 2BH2A 5HY6A 1GM5A 1TWGH 4DV3L 1N9WA 3PCOB 5JEAJ 5M5YH 3CMEA 1VQ7A 1NE3A 1IXRA 2JA5G 4LF4L 3D0FA 4AYBE 4GNXA 4A3DG 2WFWA 1G51A 4B3RQ 1UE1A 1GKHA 1A62A 2UXBL 3L0OA 4KHZA 3W5OA 1OXVA 4JV5Q 3M4PA 3M85A 3JAMc 3KF6B 1VQMA 2JA8H 3FHWA 4JI5Q 3JC66 3CQZH 3MXNB 2JA5H 1N36L 3SGIA 5C44G 1R9TH 4A3CG 1H95A 2YYZA 3EBEA 2XTIA 3L7ZC 1M1KC 4APVA 3HOUG 3K80C 4IPGA 4DV1L 3RNUA 3S16H 4BY7H 4JBJA 5LMNW 1PH9A 3KOJA 3GTJH 1VQ8A 3HKSA 4UP7A 1IBKL 5M5WH 1UEBA 4L5RC 1SN8A 1EQQA 2UXDL 3G48A 3I4MH 3KYHC 1PH5A 1VQBA 2QMUB 4HIMA 1NTGA 4P74A 1OXXK 2HHHL 4DR4Q 1PH2A 2IHEA 4A93H 3E0EA 2K75A 1D7QA 4XTCS 3PF5A 4LF5Q 2A8VA 2WB1E 3J80i 4YCWA 4DR6L 1YZ6A 1I3QH 3RLOA 3KFUA 4JYAQ 3PF4A 2JA7H 1X3EA 5H1SE 2UUAQ 3J80c 3KJOA 3F2BA 1I6HH 1BBWA 1X56A 1VQFA 1IYJB 2CWPA 3E9IA 1YITA 1VQAA 3H3VH 4JI1Q 4RMFA 3TRZA 1Y1VH 4BXXH 2HQLA 1EWIA 3TREA 1L1OA 4J15A 5M3MH 1E1OA 1I50H 2PNHA 1M90C 1KC8C 3GTOH 4MZ9A 3RR5A 3S2DH 3NELA 1HR0Q 4C3HH 4DV6L 3H0GH 5LMUL 1D8LA 1V43A 4LNQA 1XPOA 2VUMG 1N34L 1GD7A 3OTOQ 3CCRA 1Q7YC 5AJ3Q 3CPWA 1XJVA 1KXLA 4Y52H 4BA2I 1PYSB 4GOPB 2FXQA 1Z47A 2VL6A 1YJWA 3JAMi 4AH6A 3PIOA 1CKNA 4WJ3M 1N34Q 4OWWB 1K8AC 4DV4Q 1I94L 4DR7Q 3WWVA 2ZJRA 4L5TA 3A0JA 1PHJA 4A3FH 4YHHL 2NZOA 4X65L 2RHQB 1MJEA 3PUZA 3CCMA 4C3IH 1VQHA 1L0WA 3L2PA 3S1RH 1VQIA 4A3BH 2WAQG 1PYBA 2PI2A 3T1HQ 2OTLA 1BVSA 2N8NA 3HOWH 5GROA 4X62Q 2VS1A 3QSYB 4DR6Q 1WJJA 4C3JH 2E5LL 1XPRA 2UUCL 1U0LA 4BBRG 4JI5L 2ASBA 2MQHA 1PVOA 1NMGA 4JV5L 3TQYA 2CCZA 4LUZA 3U58A 4A3EG 1XPUA 3RN2A 4A3CH 1NMFA 4JI4L 2F4VL 2HIXA 2MO0A 3GO5A 5EAYA 1IBKQ 4C2MH 2D0PA 1HZBA 3J81c 3G4SA 1VQNA 1YVCA 3PO3H 3AFPA 4AIMA 4DNIA 1SROA 2N49A 2R7ZH 2GN5A 3Q8DA 5IYBG 2Q2HA 2VQEQ 3H0GG 1Y1WG 2Q2UA 3HOZH 4A3EH 1NBWA 4JI8Q 3PV0A 1VQPA 3DLLA 2QEXA 2IHFA 2NZHA 3S24A 4JC0A 5JJLA 2OTJA 4GN3B 2OQKA 3BU2A 2LXJA 3PO3G 2VQFQ 1K9MC 5GAGC 3RLFA 2NVTH 2B63H 1VS0A 3CCSA 3T1YL 2K52A 1KRTA 1PH4A 4B3RL 3U4VA 1NY4A 1X6OA 2KHJA 3CCJA 4B3TQ
chains in the Genus database with same CATH superfamily
5BR8L 4WIIA 2WKDA 3G6VA 2F0GA 4CO4A 5HMLA 2PMZF 3OIPA 4R4OA 1TL3A 2BCOA 3J81L 1JXLA 1RHJB 1NUCA 3E9HA 2OD4A 5AT1B 2D0OA 1FDAA 3IRWP 4QR1A 2DNCA 4ME3A 4N41A 4C8KA 3I4MG 3I6PA 3MDFA 2HFVA 2VBWA 1TKDA 1T11A 2ZT9C 4ICLB 1Q3VA 2BDPA 3ULLA 8ICWA 1AW0A 1XU4A 4HDHA 1I51B 3D4JA 2IJFA 3R5CA 1Q5VA 1I6HB 2F3IA 2WF9A 2B63G 2L4NA 4ANDA 2MMYA 4FO6A 2ASJA 5ALSA 2CPRA 2WZ1A 4JI3J 5AKXA 5KNDA 2BOAA 1Q82C 2VBYA 2DNLA 4PQUB 1FNVA 4I2EA 2LPEA 1SC3B 3O2IA 1SV5B 3BZCA 5J2DA 3G87A 2EPIA 2PSZA 4Y2YA 3N7RC 3MUTP 2XMTA 3NNHA 2VG5B 2OPQA 3TJ9A 2JK8A 4KV6A 1R8AA 4G7OC 4KLHA 3HF5A 1Z00A 5F8NA 5G3LF 5J0WA 3HRDD 4C7YA 2D62A 4CDCC 4NXML 2M8DB 5M3FG 2EZYA 2XLJA 5KFPA 2ZIWB 2VV5A 3ET6B 2EW9A 4FZVA 1T9XA 1HWUA 3GQBA 4KGXB 1G6BA 4BCAA 1K47A 3PVXA 5IC6B 4JOIA 4DAPA 2CG4A 2H3EB 3G6ES 1ZPVA 1ASZA 4R8UA 4OIKA 1IKYA 1S9GB 4M5GA 2KOLA 4DR3L 4UB6U 2JVRA 4Z2XA 1N34F 2KVSA 2EYJA 1Y5NB 3CC4A 4PZ8A 2L3MA 4IO9Q 4OJPA 2EPBA 4KO0A 2XC9A 3PYGA 3VTIA 2I5JA 3TKAA 2BJ3A 2L5TA 4UW2A 2OKQA 2B5JA 3K59A 3U27A 4A3LG 2A18A 2BE5C 3NXWA 2OPPA 4ZPCA 1JKHA 3SEIA 1SKUB 1V5IB 2F0NA 2NYIA 2GOLA 3V6KA 1V1PA 2DGWA 3CJTA 1KAWA 1JLEB 2W7AA 3VVUA 2HAFA 3UD5A 2X3DA 3DV9A 1U26A 4JI8F 2HQEA 2J0WA 1XS9D 5DNFA 4P6QA 1LT6D 2BA0A 5AE3A 3NBHB 2R7QA 2QILA 2RHSB 2RRNA 4K6DA 3M4XA 4B08A 2BGWA 2ZBIA 9ICQA 1TVRA 4KKTA 2XMKA 1NBEB 3HOXG 2GMLA 3V7LA 2NSCA 8ICAA 5COYA 4OJ6A 1F3FA 4UY85 3DEPA 3MEGB 5E33A 3AHPA 4DR4L 2KHSA 1M0SA 1HNVB 1A0IA 4C4RA 1JJHA 4QIWF 3EZ5A 3MM9A 2HFOA 4UAUA 9ICOA 2CJBA 2FLOA 3EJMA 2KD1A 5KFZA 4LF9Q 2C3PA 4V19X 2UUWA 5KNIA 2M0GB 5AFWA 1W2BR 1EEID 3VR2A 3H0MB 2J4XA 2ZJRQ 2A2CA 4FZMA 1UVMA 2NS1B 2YKNA 5C0XH 1NSNS 2R92H 5M3FH 2QMWA 3NRBA 3P3DA 1Q7LB 1HZCA 2ENBA 1XNQL 3Q8LA 2HHHQ 1S1TB 4DV7L 4ZCMA 2NO5A 3RG6A 3Q8KA 1IKMA 7ICMA 1S97A 2XY7A 2V2VA 3BH7B 2L0CA 5IWAQ 2NVYH 4QPXA 4JI1F 3I7FA 2JA6G 3FSXA 4YB7A 3ND9A 3C1FA 1F9EB 1HBNB 3C2LA 4M5NA 3DLHA 5CA7A 2MP1A 5DLQE 4JI0Q 2JEBI 1HHQA 2P9EA 4TKOB 3HKZB 1LW2A 1D8BA 1ZRMA 2E2HB 3TO8A 2XMUA 1X9WA 1ET9A 4E0DA 2HHQA 4WFNQ 3K6OA 2G2OA 1DJRD 2LU2A 3KJVB 3LWEA 5AXMA 1VRTB 5IIFA 2ZDPA 2V69A 4ZJLA 2CQOA 2K5VA 1Z6HA 1CZWA 2HMIA 1NK7A 1GVPA 1TKTB 1JE5A 3H09A 4JCVE 3BDPA 1CHQD 2WINB 2HS3A 2GAHC 4F8RA 2D9UA 1C2PA 2F0QA 3VAKA 1X31C 2YNHA 1VQKA 2CQHA 4LIWA 1XEZA 2H5JB 1N54B 2R18A 4DFDA 2RU3A 5M2UA 2ESEA 1WOSA 2XNAC 1RXOB 2AQ4A 3GLJA 5J2PA 1VQ7A 3WC0A 4H4OA 2W9AA 2OP5A 3DDIA 1SYBA 4ZVSB 4QIGA 2A6HD 1A62A 1HNXJ 3ZDEA 4WZMA 3CIZA 3W62A 3FHWA 3K17A 1S79A 2ICEC 5C44G 2G5HB 4DV6F 2VIHA 3WK9A 1IR0A 4YDXA 1RJTA 1VHFA 2XNQA 3DGVA 5AJ3F 4J9UE 1PFMA 1WELA 4L72B 2DH7A 4V1Ak 4P74A 4B9SA 3PF5A 4BUGA 3RLOA 3SEOA 1M5VC 3J80c 3W9IA 2NPIA 3F2BA 3P45B 5JUMA 1LKYA 1SL0A 1TUGB 2E1FA 2HSEB 2HQLA 2YX8A 1VFJA 4J15A 1KC8C 5ALKA 3GIIA 4K8JA 1C1BB 1NHVA 2I6WA 2G1HA 2M70A 4Y2PA 3CU7A 3A3PB 3FRZA 1PC5A 3DRSA 2W9CA 1JLAB 4FYWB 2JNJA 1OO9B 1XJVA 4RW7A 4C4SA 4WKRA 4GOPB 2VICA 3PSFA 4R63A 2B4VA 2YNHB 4ABNA 2B6AA 1DK2A 3IXQA 2Z4PA 1F2HA 4A3FH 1B64A 3X3NA 1JROA 1Q4RA 3I82A 3D9BA 4JI6F 4LUBA 2PI2A 3Q6SA 5CCMA 3IBWA 1HQRD 5FJ4A 3C28A 1KFSA 4TQSA 4NYPA 1MHWC 1AZSB 8ICRA 1VQNA 5E3AA 5HROA 2ZJPQ 3AFPA 1WSVA 1WKKA 4P2XA 2GIFA 2M0NA 2Q2HA 5DM73 2BX6A 4CE6A 2XZWA 1NK6A 5JJLA 5F3TA 2FPLA 1YJNS 4Y2CA 3A8IE 1T5EA 5J39A 3WKCA 4ZAIA 1WI8A 1R31A 4V19J 1A6LA 1E6YB 4PZVA 4XQNA 3RH4A 4MK8A 1WTXA 3ZTOA 1T05B 5B0GA 4B9VA 4NCAA 3B6BA 1KP6A 8AT1B 3FEXB 5IGGA 3IA0A 1KIXA 1EZZB 4DR5Q 1QJHA 2DXDA 4YB5A 3V6DB 3MPDA 1PLFA 3TN2A 4KV8B 4M95A 4KHMA 2YKMB 4UQTA 1QCKA 3P75A 2BPFA 3MCNA 5A2QY 2HCCA 4NDXA 3C23A 2IAJB 5EGTA 4CGZA 2VW9A 3I0SA 3TZZA 3KD3A 2HNZA 5AIAA 2AKWB 2RRAA 3G8SA 3R8YA 4JI4F 1S4EA 5EE1A 3KHGA 2KEEA 2EAPA 3D6WA 3UCGA 4HJAA 1RTHB 2QLBB 3CCMS 4ZVEA 4BC7A 1CJVA 2UP1A 4OZ2A 3HKZC 2LQBA 4J90A 4QJVA 8ICIA 1QZGA 4W98A 1MGSA 3GR0A 1PYWD 4UASA 3S17B 3F2UA 1GH8A 4ILWA 4CJ2C 2VPZB 2O5DA 1TWAH 2DEJA 3M8YA 2B8PA 2QSWA 4GLXA 1QNUA 1M5HA 4XDDA 1WFQA 1WC3A 2PNRC 3VGSA 3OV7A 4R0JA 1OUQA 4HR2A 2MHNA 3S16B 2LU1A 5IT0A 2YPZA 2ZDOA 4K4VA 5HMYA 2MQQA 4M5HA 4HLBA 2OQ0A 1Y1WH 1W2IA 3RB3A 5LL6S 2IJRA 3GSIA 2QB0A 2KHQA 1UZDA 2ZEJA 4CO1A 2DUYA 4Y2QA 3A55A 2N55A 2NVXH 1Y9OA 2B6GA 1XMQJ 2H3IA 1S4ZA 2HAIA 5LSOA 2R6GA 4Y7NH 5HURA 1CBKA 3Q0AA 3PO2H 4K5SA 2OH2A 4LF4Q 2BH8A 3JPOA 2E9TA 2ADCA 4A3JG 1MMDA 4MKAA 1MI2A 2BCQA 4KPYA 3RRGA 3MWBA 2GVDA 3UN5A 1WEYA 3A1YG 4WYLA 2QYGA 3TADA 4RQNA 1WD1A 2UZAA 2F8KA 5LXYA 2E5SA 3OPXA 5JPNC 1DY3A 4KJIA 1I3OB 4BY1G 1WF0A 3GDEA 2OPQB 2VG5A 1U1RA 1TIID 1JLBB 4TYBA 9ICKA 1QE1B 2CDRB 1PAUB 1YNNC 1Q86C 2WF8A 2F40A 2PPBC 2GHWA 4JI7L 1UVNA 1RAHB 1U1NA 1ZJMA 3TVZA 1FVIA 3CW2C 4LF5L 1KQFB 1ZOTA 4TVAB 1UE5A 4LFCJ 1CM9A 2XZTB 3WU2U 2PCFB 2O5IC 2E76C 2X1FA 4LBIA 2R7UA 3M2VB 4A3EB 3DU5A 2NCKL 1J9OA 2GHVC 2FDRA 3S15B 3G9CA 2N78A 4EZ6A 4LQ3A 4NLCA 4R66A 4ICLA 2PFQA 4FBUA 2RH3A 1OPIA 3UR3C 5K8MA 1RJJA 5IIMA 1PRTD 3AY0A 3DLEA 4NYZA 1HR0J 5AXKA 2EE1A 1PYTA 2R93H 1V6HA 4O2DA 5C4XB 2LKYA 1X4FA 2NREA 3F8TA 1YX2A 1K8OA 3KFUF 1N5QA 3ENAA 4PXDA 2WW4A 3NL0A 2IVYA 3ISZA 1XMQQ 3OFHA 7ICTA 2EDGA 5LMNJ 3FP9A 1JRPA 2DGOA 5J2CA 5M5XH 2YQEA 4MFBB 4WK3A 4C4TA 4Y00A 3AU6A 2FMCA 2RDGA 4LF4J 1V3ZA 3K5OA 5LHY1 3C5FA 4POFA 2HBKA 2VANA 4ID6A 4OHJA 3FKBA 4DL5A 1S9EB 5DLGA 3BYPA 4PG6A 1C20A 5D4PA 1G291 3M7NA 4RKLA 2E44A 2Z56B 1ZQKA 3MTKA 3OR1B 4LVOP 2WSFC 3AQOA 4OZJA 2OELA 4WORA 4LRDA 2HFZA 2GLEA 1ZQCA 2R9LA 2WOMA 1U4BA 2QL7B 2X1AA 1N8RC 2CXEA 3K0XA 4OX6A 2DY1A 3PW7A 2LQ8A 3TP2A 1DRGA 4JG2A 4DR2J 1NSPA 4KSEB 3V5RA 4YFUA 1FFWB 3QJJA 4NE9C 4BHQA 1U2RA 2KNJA 1HWLA 5ALGA 1UE7A 4IOAA 4DLEA 3JYTB 4CLTA 4HJ9A 2MZRA 1UUPA 3CTRA 4F0KA 5CYJA 5J2QA 1K0TA 1M6YA 1HUZA 2L48A 3MR5A 3ISCA 3N01A 4ZYSA 4LFBJ 1GM5A 2WONA 9ICWA 2AJ2A 3Q8PB 3AOAA 4FP9A 2K32A 1LKYB 1KNZA 2BOSA 1X6IA 4JV5Q 4QZBA 3JAMc 2HHTA 4RQ7A 2EAMA 5MAOA 2KK0A 3EBEA 5ALHA 2VFRA 2EXUA 1NK4A 1SDFA 4KD4A 3LGHA 1D0EA 4BY7H 2VB3X 1VRUB 2KO1A 4RW6A 1WDTA 3KYHC 5C5JA 2R8JA 3SK4A 5G5GA 3R5DA 1STEA 4KGMA 3KFUA 4CDGA 4IRDA 2IHR1 4QYZJ 2YNGA 3I87A 2G0AA 1Y1VH 1FK9B 3I70A 2PT0A 4LF7J 5J0QA 1LW0B 5KFJA 4RQ0A 4AYBF 1CS4B 1H9SA 1D09B 1AN8A 1F6TA 1NK9A 1RAEB 1UQVA 1HA6A 2ISPA 4JK1A 3CKIB 1Z47A 2VL6A 5CR3A 4B3MJ 1AFIA 5SZTA 4ZPBA 2H9ZA 3TQEA 3PHEA 5T1GA 3WWVA 3DMUA 2XLKA 3GCWP 4KMUA 3M6WA 1F9RA 4FKXA 1VK8A 1QNKA 1PYOB 2BE5D 2VQEJ 5IT9L 1VQIA 1APSA 2W3SA 1C8CA 2EFOA 1KNAA 3HOWH 4DR7J 1LVHA 2V8HA 1VRTA 1T94A 3EZOA 4IQZA 4UB4A 5I4MA 4ZQ3A 3R3TA 3RB0A 1PTOF 1WOOA 2VC0A 5J8YA 3RH6A 4LK1C 5EAYA 3HDSA 2K1BA 4KLJA 7ICHA 1X4AA 3H0GG 5BYRA 4CH0S 2IRXA 4M5DB 3CCZA 4P7TA 3QZ7A 9ICEA 3KUGA 3T6BA 1PTOC 5F8LA 4O3OA 2DHGA 1RWNB 2VQFQ 3PFEA 1EY7A 1Y00A 1KDBA 4YQWA 1QQ6A 2ZUGA 4HCSA 5D4BA 1FJEB 2PFFB 3K57A 1B50A 3JTPA 1D8YA 4KB7A 4IRKA 3SXLA 4K2LA 4YR3A 5I4DA 1K8AT 3TUJC 2KB2A 5J2HA 3MXNA 3H0LB 1UW4A 4KD3A 1E3PA 4CQ1A 4MNOA 4DU9A 4PG3A 1IBLL 2IMWP 4HIOA 4A3LH 1BMQB 3IM8A 3EN2A 1N5VA 2D41A 4WFBQ 1GFWB 3ZNUA 2HOFA 1O08A 1BPXA 1UL3A 2J9EA 3BGRB 2AQ3B 2RF4A 4V0BA 2UU9F 2MKJA 3PW0A 2B2UA 3HHLA 1U8WA 1CC7A 1STBA 5IWAL 1T95A 1WHWA 2JH1A 3HOXH 2JEAI 1PRTB 1Y8OB 2JXMB 1TY0A 3FSIA 2R7TA 2Y9TA 1FNXH 5HBMA 7ICJA 2IX1A 1FFUA 2L15A 1E22A 4K8RA 4CNYA 1ESRA 4TUQA 3MXGA 3BN7A 1A0OB 5BN3A 2DGVA 2B2WC 1LT4D 2QB1A 4GOPC 1DZ5A 4IUTA 3HKZE 2HD3A 5JEAG 2R7DA 3SEBA 4F4YA 1DOQA 2PN6A 4YWLA 3MEDA 3G8TA 3NGSA 3MXUA 4YWKA 3R7NB 2DXFA 4IS7A 4WRDA 2MSSA 2Y9HA 2M00A 3WIUA 1JKHB 3RBDA 5C4JB 3KFWX 4RUBA 5E41A 3OR2B 3H42A 4LF5F 4X4VA 2G9DA 2AMCB 2K14A 4DK6C 2SXLA 1WEXA 2H3QA 1I3QB 1VQLA 1TKZB 3GG1A 2GWSA 2ROGA 3T51B 4K5RA 3LO3A 2ZJ5A 3M8QB 4CLFA 1WTQA 4R8UB 2VPWB 3I1YA 2E75C 1KFTA 1PK3A 2RD5C 1YBTA 1IG6A 1BBXC 4BBSB 4DUYQ 3ZDAA 3M6VA 3FK4A 3HW8A 1R0CB 1X5SA 2ZHOA 4DWIA 1II3A 4X3SA 2HT1A 1DOMA 3RUBL 2R3VA 3V81A 5DLFA 3TVYA 2D8CA 1DZ1A 2M2LA 1S1XA 3S14H 4LF6J 3VAFA 1HNZQ 2UUBJ 4K8IA 2YX1A 1BCPB 1NB7A 2QRRA 4KY3A 2HBZB 2B51A 3D5MA 1ZD2P 4QUFA 2Z2YB 4GNXC 3VCBA 4I6YA 3AB4B 3ILLA 1FJGL 5AI4A 4R4IA 2P35A 2ZOMA 5F9NA 2AJQA 1K3RA 4DLGA 5DBBA 2NZ1D 4ODGA 9ICPA 1X3PA 3N4WA 5F8GA 1CSJA 4O44B 2V4DA 3AU7A 3PJ9A 1N33J 1IW7C 2L41A 3A3OB 1YI2S 4LSNB 1ZQSA 1FKOB 3OW7A 3V4MA 3STBD 4WJ4A 3CDBA 1UFWA 3G7LA 5CEHA 5EQ0A 4U7UK 5E3PA 4R4CA 3GTMH 4X4PA 1RP5A 5HP1A 2RDHA 2EC0A 3TW0A 1MU2A 3TYTA 4DX5A 4OZ5A 2QFJA 4KT0C 5C6AA 2U2FA 3S1NH 1A6SA 1Q79A 3IGNA 1SXEA 3MGVA 1WG8A 1HIWA 2Z2MA 4A3MB 5B0DA 2D3ZA 2WSEC 2APOA 2FVRA 1G3OA 3CPFA 8ICNA 4IG0A 2D3O1 1WHXA 3C15A 2E2JH 1TK5A 4K2XA 4FNFA 4M94A 3G6XA 2MPMA 3B78A 3R27A 2JLFA 5F0WA 1NDCA 3MM6B 1J5EL 1K44A 8ICPA 3IDWA 1NRKA 2GW8A 3O44A 4QJFA 5CYQB 2FI1A 2Q4TA 4ZVFA 1VQ5A 3W2WB 3ILIA 1LWFB 1VF5C 2P6SA 4ZLTF 4FYXB 1CJTB 1N33F 5D14A 1SQEA 2Q2TA 2JC0A 3CJRA 3EUB2 2LECA 3OWEB 3QATA 4ZCIA 2I07B 1ROFA 3G86A 3TEHB 1HI0P 4I29A 5IT9c 4BS2A 1XR7A 3IC1A 1TY2A 1QUQA 5T7LB 1COOA 4ID5A 4DI6A 1PTOH 4LUVA 1VMBA 1B44D 4P0PA 2IC3B 5ETMA 2BJ9A 4ER8A 1DRZA 3K1RB 4F92B 1PCAA 1CJKB 4C0BA 1C4QA 1FD8A 1RAJA 2Y0SE 1KHVA 5ELNA 4YHHQ 4WXWA 1ZZNA 1JB7A 4OYAA 2L1BA 2MQ8A 4BJQA 3V2TA 3WOEA 1N0UA 3J81i 1T3OA 2A5HA 2IYIA 1N60A 3WDOA 1VHIA 4DG1B 1FJGJ 4KFBB 2C3MA 1JMSA 8ICQA 1ITPA 1Z1BA 3NPPA 3QU5A 2MSNA 2RQ4A 4DFKA 1YJWS 5F8JA 3T1HL 3PR4A 4AP9A 4AYBE 4LF7F 4A3DG 3M1YA 1FKPB 4F5NA 1SNOA 3V6JA 9ICUA 3F44A 2F0LA 2MLXA 5E0OA 3QUTA 3W5OA 1CQMA 1RCOB 2IL8A 3MWYW 2JA8H 1RDFA 5KIXA 1WTBA 3V72A 4C3JB 4NV0A 3MFYA 3W5YA 2E5LF 4USUA 1N88A 1S12A 3S16H 4NLRA 1PH9A 1UEBA 3IG8A 1JLGB 2MQOA 4ED2A 4FKYA 1R9TB 5A8RB 1H6KX 4DQSA 2E2JB 3GV3A 2YH0A 4UOHA 2AU0A 2BCVA 4IH7A 4CM0A 5H1SE 2HK3A 1MW7A 1PTOD 3NMAA 1Q95G 2W9MA 3BGLA 2CWPA 2BABA 3QGPA 2XM3A 2AJFE 1TVXA 5AJ3J 2CKWA 4F5QA 2HCIA 2RAQA 3QIDA 3J7AF 4A3BB 2BR0A 4X66J 4ED3A 4CYUA 5KFDA 1KOOA 4BA2I 2KI2A 5I3PA 2PGCA 1V3SA 5A8WA 1DCZA 3GV6A 4YEAA 1E2VA 4ZPDA 1PHJA 4DAYA 4YHHL 3LGNA 4ES3A 5AXNA 4C3KA 1MMLA 3D7SB 2DO0A 2GGPB 1TS5A 3D0HE 4USTA 4PHEA 3P1HA 2B8FA 2K5QA 3O13A 2OTLA 2ZH2A 4DL0C 2MU2A 4IUVA 2BUNA 4CM2A 2B9EA 3IMQJ 2VS1A 3GJRB 4NRUA 4C11A 2R7WA 4O1NA 3O0FA 4NP5A 4YMMA 2WB1F 3BR9A 9ICVA 4JI5L 4OHYA 4DPTA 2P9CA 7ICQA 1W25A 3BF4A 2W04A 5H9EK 3TUPA 5GVQA 1O78A 2BW7A 4LUZA 3Q2SC 2KN4A 1I50B 5ETKA 4DNIA 5FLXU 2LMCB 1T02A 5KOXA 1ZQJA 3CDWA 2VZ9A 2XB2D 4JI3F 3ITHB 1FE4A 2ACMA 2P6TA 2CJYB 2B63H 5D3GA 2V4RA 2HHXA 3BN4A 3SIPB 4A3DH 9ICMA 1CK1A 4RNMA 3QO9B 2NRVA 2AYEA 3AEVA 2WP8J 3MM8B 1UT8A 1AP0A 2BE2A 4PGYA 4DV3F 3EGVA 2CNNB 2KHVA 5KT5A 2M2BA 4RWXA 4I7ZC 4KY5A 2CRXA 1F60B 3KBGA 3CQZB 3A5UA 1RUSA 2HQ3A 1YHAA 1YEZA 4IH6A 1H73A 4XT1B 3HHLC 2MKKA 3HT0A 1FXRA 1RT6A 4P2SA 1HNIA 3I31A 5FIIA 1QE6A 3GJQB 2A19A 4J9RA 2WVDA 3UQSA 1B9MA 1RT6B 1IL2A 2I1RA 4LF8Q 2E1PA 3VR3A 1GUGA 4NCGA 3MABA 1SMXA 2E2IH 3ZTRA 5J8YC 3PQIA 2EY2A 2EVZA 3K8AA 2FVQA 3F0NA 1H38A 2PFOA 2OHDA 2K8BB 4CLKA 3GTPB 2YX4A 4N77A 1HR0W 2LS01 1EY4A 3K5PA 2EJFC 4JI8L 1QAJA 1VR6A 4JI0J 4YR2A 3I90A 1F2GA 1PH8A 4QWDA 3T5JA 4KY7A 1CULA 2KT2A 2H1EA 1DQ9A 5EGYA 1HNWF 1VQ4S 2KOBA 2VKQA 2UUBF 1EZ6A 4IQTA 2PMZE 1CC8A 1PUZA 4KMUC 3Q8SB 1O7YA 4DR3F 4YHHF 5D3IB 4DR4F 1CJUB 2JP1A 3NVYA 4QGUA 2GAGC 1EHWA 3OL7A 1WYDA 1RBAA 2Z8LA 4DPGA 3R1HA 2F0WA 5ELOA 2O01C 1O03A 3W61A 1UETA 3AQQA 2DISA 1D8ZA 2EFQA 1RIPA 1ZQPA 2F4FA 3OYYA 3KK3B 1FVQA 1VBKA 1MC8A 5AI6A 1N5YB 3MEKA 4N47A 4E98A 4A48A 3A56A 1WHYA 4KLSA 2DNRA 3A8KA 1FO1A 2FLLA 3C1EA 3KNGA 1RTZA 3QAUA 1IIPA 3WIVA 4K4YA 3R1LA 2OO4A 7ICIA 1Q12A 3EDRB 4M8LA 1K73T 1HUMA 1P1TA 1Q8KA 1KLMB 4PWUA 1HR0L 2YH1A 2LYHA 2BM0A 2H54B 2QLJB 3UQ2A 4C2MB 2B3TB 1EOTA 4ETZA 2PMZB 1F9FA 2QZ8A 1FEZA 1U5KA 2UUAL 4M6WA 1VQEA 2EYPA 3M4QA 2Y9UA 5KFBA 2JFDA 4Y3CA 2CUYA 1QAYA 3W64A 2BA1A 3KJQB 1JLFB 3WX8A 2VONA 1LV5A 4QR2A 3DUZA 2MKSA 1PILA 1YIJA 1TK8A 2YNIA 2GC8A 2ATLA 2AEJA 1R6YA 2KE7A 3D8GA 4USJC 1J97A 2JEFA 5EPJA 1N32Q 2MZ1A 2KENA 1OY6A 3QX7A 4JI2Q 4X62J 1FDNA 3AXMA 1ZA2B 4OWXB 3ORYA 1V9OA 3ISNC 4W90B 2WV6D 2I5MX 2HQGA 1RYUA 4QWBA 4WFYA 2GVZA 1SWVA 2B4UA 3OJUA 2FHKA 3N5FA 3N7SC 1FX2A 1DHMA 4DG1A 2BDUA 5CYMA 2PQAB 3BQ1A 3MEEB 5AKIA 3CD7A 1RHRB 2OSRA 4LUOA 5K5MA 4JOUA 5KFFA 4ZITA 4YG2A 3UXOA 4NXNJ 4X4NA 2JSOA 1QDUB 1C0AA 3U26A 3LGJA 4DPXA 3GYXB 1ZQ1C 5I42A 1KQQA 1CJKA 4C80A 3QIAA 1IZ6A 3BKTA 3VALA 4MKBA 3CNQP 2RF2B 1AH9A 1GHKA 5IT9U 2R7FA 2CNLB 4LF4F 1E2WA 2IW3A 4ID5B 2MJUA 1EIHA 4NMXA 5T7LA 3CF5Q 2UXCJ 5BJRA 4I7FA 1NKCA 2M7SA 3H4DA 2GHPA 2JH7A 4JV1A 2N3SA 3UXNA 5AKYA 4OO1G 4LF9L 5FO9B 4DV7J 2RCNA 2C22A 4K4IA 2XMJA 8ICMA 3CJ3A 3QUBA 3ICXA 3PIPA 3GV8B 4C8LA 1JI7A 2F4VQ 1LXNA 3W2WA 1CI3M 1Z19A 2HI0A 2D7SA 4KHPJ 3NP8A 3LAMA 3BQ2A 4GKKJ 4ZCKA 5IIKA 2X1GA 1BPDA 2C3OA 1K83B 1XTZA 4FDFA 3G6YA 1TL7B 1KRSA 3CD6A 1TUWA 3GIJA 1HD1A 1S5BD 3QG1A 1YI2A 4WJ3B 2FHJA 3NTUA 3T5LA 2AD9A 2ZHAA 1OJ4A 3M9NB 2KXFA 3GIKA 2HDOA 3D2NA 1UEVA 5HR7A 3EXCX 2ZJQQ 3PCOB 1CZGA 2RB7A 3FMBA 1QQ7A 4KN7A 9ICGA 4GKKF 1MSHA 3L0OA 3MMCA 5HMZA 1TQOA 2RRDA 4KTAA 3WZ0A 5F8MA 3KF6B 1WWUA 4FFDA 5DG7A 5C2GA 2JA5H 2YWKA 4K4WA 4LSNA 1XR6A 2O3DA 2F9DA 4APVA 4B3RJ 4O3PA 4LMQD 4BWGB 1NHUA 5KL8B 4HEA9 4E8UA 2KYXA 2C42A 4LR9A 2C2NA 5M5WH 4L5RC 2XULA 2BE9B 4C4WA 3CDUA 1JQYD 1A3UA 1OXXK 4M6WB 1X6JA 2E8NA 4JPBW 4A93H 3W65A 2HNYA 2A8VA 1KFDA 2FMMA 2X51A 2IPOB 1ZQBA 4DJBA 4ACOA 5AM0A 1I6HH 2Y1LB 1VQFA 3EVWA 4QW8A 2W8KA 3RBXA 1EYDA 3HVTA 1SL2A 3IBCB 4NXMJ 1BC6A 5EBDA 1AUSL 2YKAA 1XNQJ 7ICLA 1U8SA 2OPRA 3V81B 4EK2A 4CH1A 4EBEA 3EFXD 1TWFB 4CDIA 4PUOA 3V96A 5C42B 4I64A 2FXQA 3D1HA 3M8RA 2HHWA 1FD2A 3HZGA 3VHQA 1NK0A 2RHQB 2V8VA 4XA5A 1G8ZD 2VJVA 3ZTQA 5KFVA 3MR6A 4EI2A 3T9NA 2FJXA 4DV2F 1RSCA 2VXWA 1CVJA 2WF5A 4GC6A 4NLKA 3U9SA 4IG3A 4C48A 4BS9A 2UUCL 4J5OA 2CIMA 5L1LA 4OJ1A 3BSNA 1PRTF 1PVOA 1SYCA 3C29A 3HHLD 4R65A 2EXZA 3RJGA 4A8SA 4DUTA 4F3MA 1IBMF 3WX4A 3RZDB 1RE1B 4QZGA 4RGTA 3ZDBA 4Z6DA 5DDMA 3HP6A 2J6TA 1NY4A 3KLGA 4B3TQ 1S9FA 1A77A 2I0XA 2XWXA 3SCJE 1TU0B 2XRQD 1KTQA 3ZDDA 2PDAA 3K5NA 1UPMB 4QYZK 2UU9L 1QD1A 3CYMA 5JPMC 3D31A 4DL7A 4I2CA 1BPEA 2UU9J 2QKQA 1VQ4A 1VQYA 2J9CA 3QLHA 4GKJF 3OTCA 2K6AA 1RT1B 2LHTA 1R8HA 1SRUA 4DL2A 4A3GG 1WCMB 2VOOA 1RF2D 4RNFA 4US8A 3G4SS 4A8WA 3C16A 2Z4IA 3RZDH 4NL5A 2JXJA 2EQSA 3PGZA 4R9WA 4MN3A 4DA2A 3PW5A 3CF5A 1C4CA 2AW0A 1N63A 1VCTA 3IFDA 1KR4A 4DDFA 1EOVA 4DV0Q 3U4ZA 4Y6IA 4Y2XA 1B7YB 3F2DA 4YY3Q 5K5PA 3OXLA 2H5XA 3TZWA 5DGBA 2ZTDA 2EG1A 1UZHA 2Q66A 2SNMA 3UE1A 1YRTA 4RJVA 3I72A 1SBRA 3C46A 2BE2B 2Q43A 2QARA 3MM8A 3BR8A 5FLXE 2V67A 1BQXA 2Z6KA 4OO1I 4KLEA 3DLGA 3SSQA 2PFPA 4J9NA 1OY8A 1QY7A 4ED7A 1N33Q 3I4NG 1N32L 3RBEA 4RNHA 2XS2A 3E5SA 4QYRA 3L7UA 2F0FA 4X64Q 1RU1A 3HM9A 4DR2Q 5TISU 5ETPA 4DN9A 3FQLA 3QRQA 3RW7A 1MD2D 5A35A 3R8BA 3QPIA 1BWVA 4IOBA 3B0YA 5TSSA 5HGTA 2RJZA 5AM4A 5JRTA 3KK7A 1W6KA 2HOIA 1G2TA 1NU4A 4R25A 1FEHA 4DCPB 3SFGA 5FLMH 1RT5B 3C6TB 4L75A 5M2PA 4DV3J 1BY9A 4RQ6A 1ZQZA 4Z6EA 1LT3D 1JX4A 1X3GA 4C8MA 2RUGA 1DONA 1CA6A 1DBDA 4CO5A 2Q0ZX 3LOUA 3VVTA 4CT8A 3SQIA 4DF8A 3OHXC 9ICJA 4DK3C 2RHFA 1NPPA 4OYXA 3RZOH 5BOMA 1VJWA 3QSIA 1QTNB 5KG4A 3M3YH 2IM3A 9ICTA 1URJA 1SNQA 4PZNA 3M32B 9ICAA 1J8IA 1NOMA 1JWWA 1WC6A 1QVFR 2GJFA 3R5GA 4DF7A 3UDXA 2EK6A 3EDQB 2DFLA 2YMMA 5G4DA 5A6WA 2WVFA 3HD1A 4WTYA 2E1EA 2F65A 3GFXA 3LYSA 4GKJL 4F2SA 4NZ7A 2OEHA 5I3QA 3T1YJ 1X55A 4A3IH 5A8RA 4DQPA 1HFGA 4YHHJ 1VRUA 5DBCA 3NWTA 5IP9G 3EVQA 2DR5A 1IKVB 2I9SA 5DDYA 4XYOA 4KK7A 4GXJA 3TAPA 4I2IA 5GQOA 1FJGQ 1WG5A 2HIVA 1JB0C 3QNWB 2B9WA 2HHPA 3NVWA 1NSKL 3HSDA 5AXLA 4WFAQ 2E5GA 2XWBB 5B08A 1IYUA 4KI0A 1WC5A 4NW2A 5G5HA 1RT4A 2M88A 3MEHA 1VQ6A 4M47A 3DXJC 2O2LD 4RU2A 3I55A 3NK9A 3QNMA 2UXBQ 1DAXA 4BBRB 3DRPA 1TL1B 1RZTA 5DO2A 1YHBA 1HTPA 2W2NP 1S3OA 2D3DA 5E3FA 5KAFU 2H4YB 2HMXA 4LREA 3RH5A 3T4AC 2CKZB 1MN7A 3MR2A 1S10A 1STHA 3V7KA 2F8EX 1LWCB 2UXDQ 3HXMA 2A6EC 3DOLB 1Q53A 3PSTA 2VQFJ 4EX6A 4GMKA 4NM1A 5KYLA 5AM5A 5HATA 3EYZA 4GO7X 2X6GA 2HDLA 4ECWA 1F5SA 1PXUA 5HQLA 2XO7A 2MO1A 4O4GB 5E3QA 3EM1A 4OI0A 3WK8A 1OSCA 1QH9A 1RBOB 4I4BA 1OMSA 1ZD3A 2HVIA 2WB1C 4LZGA 1HRJA 3KDFB 1GUTA 1SMYC 1VF7A 3QUQA 1MIUA 2Q2IA 3PUVA 2IY5B 1RU2A 3MFGA 1SC4B 3Q83A 2GZOA 3T6JA 4IH5A 1LOUA 3PSIA 2V2QA 5HANA 1ET6A 2YTUA 4I2QA 3GILA 2DNKA 1A0PA 8ICEA 1MSWD 3T1HF 4IG0B 3VYRA 4KITB 3R93A 2A3JA 2W4DA 2VIXA 2Z7JA 2DITA 2HS4A 3CE8A 2LFNA 3STBC 3PW4A 3HJVA 5ETRA 2E8MA 4ZVQB 1ZEQX 1KEKA 4IURA 3HS0C 1IW7D 2KA7A 2YWWA 1Q3LA 2ZM6Q 2LBOA 3J7ZC 4PXBA 3D3RA 5LL6d 1LTLA 3PIO3 1ZAVA 3GTJB 1K9MT 3CJ8A 2WFAA 5IGBA 3D0FA 2WFWA 3EZUA 2F1HA 2ZUBA 1ED1A 1B53A 4Y2KA 2HNDB 4HT5A 2XIWA 1VQMA 3CP8A 4JI5Q 4US9A 1N52B 4FXKC 2KRRA 4U67Q 1UCVA 2LKVA 1N36J 1VQSA 4RZRA 3K80C 1C48A 5DG8A 4B3TF 1ZQMA 1SE2A 3I4MB 3RNUA 3VC8A 1GT8A 2DBYA 3QU9A 1VQ8S 3H98A 1X40A 1LWEA 4QIWC 2UXDL 2CPEA 3M2RB 5U47A 2OTJS 1E6VA 4WF9Q 4DR4Q 3UI2A 2F2AB 1S6PA 2KJVA 3HZEA 3MECB 4DV5J 1JLBA 1I3QH 2YX7A 2GIRA 4JWMA 5JVG3 4W92B 3J81U 2Q3PA 1JQGA 4NWBA 3AQPA 4JI1Q 1FWPA 2FGOA 3MPYA 5EPKA 5IQQA 3KLFB 2MGZA 4IKAA 2F1FA 3H40A 2HWIA 4OX9J 3H0GH 1CA5A 2AJ0A 1S5LU 4J9MA 4UAVA 3KG0A 4X4QA 4K6LA 2VUMG 2F8LA 1GUWA 3OTOQ 4HT7A 2J6SA 3SBMA 4E6IA 1FI4A 2RNEA 4PWDB 1RT3B 2ZJRA 4G7ZC 1N48A 4ECTA 1UEAB 3PUZA 1KDHA 1HW8A 4MKVA 2XI3A 4A8MP 1ZQIA 4M9NA 1REVB 3TARA 2A74C 4IFYB 2HHSA 2BVZA 2HWHA 3DDNA 1T9VA 1D1UA 1T3QA 2QB0B 3EA6A 2ASBA 1FTRA 2XZDB 2EJMA 1V3RA 2QGFB 2V6AA 4PH5A 1RTIB 1S5ZA 3BGUA 2MO0A 4C2MH 4DR6J 2R7ZH 3IRXA 1SROA 1RWXB 1NI3A 2F1IA 3FC4A 4JI8Q 1SMYD 3DLLA 3MEDB 1IBKJ 5LSLA 4GN3B 4WJBA 1NMEB 2XYPB 1V38A 2VUGA 4P0QB 1RLDA 2HQIA 5C5MA 3M9OB 5F0UA 1KEJA 3D1QA 2RRBA 5BYQA 1SJHD 1Y1VG 2R2RA 1HMVA 3IWXA 5IV3A 1HQEB 4HI2A 4C9DA 2CQ3A 2CRLA 1F9QA 1N0VC 4H7BA 2HBRB 1QWYA 3MAHA 2E8PA 4QZEA 4A3MG 2UUAF 2J5AA 4CO0A 3HJFA 4ILMA 2IRYA 1QZHA 4RG1A 4ECVA 5JEAH 1TAMA 4NLTA 1H2UX 4B3TL 3L7PA 2NXJA 4IUFA 3GIMA 4NXZA 3CMES 4FPRA 4HDGA 1DD2A 4M5MA 3JS9A 4DR1L 3BGRA 4DR5J 2W25A 1FWKA 3D0GE 4A8KA 3LP2B 3V6DA 2V94A 3QFWA 5ETOA 3PUXA 1ZAXA 1AE2A 2OGUA 2OXOA 1BQNB 4JYAJ 1FGUA 4WP3A 5J3BA 2ZZMA 3KG1A 2PI4A 4DXGA 1UWBA 1QVGA 4U8VA 1S1VA 4B17A 5L37A 3KLIA 1S1UA 5DM63 4USKA 1JMCA 2C35B 3M7GA 1X54A 1NDPA 2B8GA 1E6YA 4GVBA 4CTAB 2A1JA 1KQSA 2RMLA 4OGQC 3MAQA 5LM7E 3C1ZA 2E5LQ 4CKCA 2J7ZA 1JALA 1OQ6A 4Q2MA 6FD1A 5ALZA 2NUHA 2K89A 5BR8Q 4FYYB 3W7BA 5CD4A 2QLFB 4CP5A 1HNZL 4HAIA 5CV5A 4MIAA 3ADAC 3D3BJ 3CULA 3NWRA 1L8OA 3IFEA 1A9NB 4ZVUB 4QUCA 4DPYA 4ZMMA 5KAIU 3DGPB 1M5SA 4JBWA 2Z4HA 1UJ4A 4YIJA 3O8WA 5L1MA 1VQMS 3FM9A 1O0PA 4UAIA 1H7WA 4NZ6A 5L9XA 3JPTA 1BCPF 1B3TA 1SNCA 3VCDA 4DK1A 5C3EB 2A6ED 4RWWA 1NZPA 1NK5A 3VZIA 4FS1A 5FOBB 1RAOA 5H9EJ 4QWCA 1VISA 2W9CB 4BLGA 5DJBA 4KLQA 3MMAA 1W7WA 1K0VA 1OO0B 2Q8RE 3MR7A 1IBLF 1OWXA 2WB1D 5AKKA 3F53A 4OEMB 1X3FA 2IIHA 1JK9B 3FDSA 4FS2A 3ICLA 3PIP3 2LI6A 4O0AA 2K7JA 4R4QA 2KT3A 4EFAC 1BWEA 4OHWA 2F3VA 3IRUA 1XC9A 3QWPA 4CLPA 2PFDA 3D1OA 3RAXA 3CCQS 4JI1L 2RQ5A 4YD2A 1WSRA 3IWLA 2GCFA 2HVZA 4DNTB 2V34A 3DI6A 4JBCA 5CH7B 4EELA 4EENA 5IQ6A 2Q6BA 2LFVA 3J81j 4P2HA 2WONB 1EIGA 2DN8A 1R6VA 4WWSA 1LUZA 3JB9k 2UVRA 3J7A5 5ALXA 4URSA 3AYHB 2ZC4A 5IP7H 4GLVB 5HLFA 2ATCB 4OI4A 2OYYA 4JI5F 3I91A 4Z37A 4I2FA 2LEAA 1OYDA 2ATWA 2K04A 5DS7A 3N7PD 2JQOA 2ZITA 3DU6A 1YJ9S 3H5UA 4LRAA 3RLNA 2JJQA 3MAAA 1N32F 4Z6FA 1NZ8A 3A74A 2HMIB 3X3UA 3PNCA 2HZCA 3RYLA 5C4XH 1Y88A 5J0YA 3L95X 2ZHBA 3IGVA 1D9AA 4NLUA 3DWQA 1FHTA 3KHLA 2WOMB 2MEWA 1DK3A 2VQFF 2L55A 5J0PA 5M5XB 3UCUP 4F26A 3V2UC 2W7PA 1J5OA 2IM1A 3ONNA 2MYFA 1LW2B 1XNSA 5GAGU 2M9NA 1G91A 3BBFA 1X0FA 1ZD5A 3DMJA 3AH6A 4ES1A 3M30A 2HBMA 2X6LA 2JRZA 2EFVA 1ZM4A 3SYZA 5LJ3Y 4E2FB 4MFBA 1G6PA 3TJ8A 5IODA 1UJ6A 4MJKA 3F5EA 2JA8G 4WK1A 2BEFA 1SBBB 5A0YA 4KPCA 2CPFA 2BCUA 2EYHA 3NQTA 1A2UA 3I56S 4DR5L 2B43A 4DR1J 5CV7A 4F04B 3UNYA 1HTLD 2O5JC 3D4RA 4OD0A 3DOMA 4MT1A 3KKAA 1VDZA 1YHQS 3UQ0A 2KG0A 3DLEB 2AXTU 2MKIA 1UFKA 3PJWA 2G08A 2CQ2A 3O6QA 4LF7L 3FZ2A 5FLXL 3MPUB 4OI3A 2NRXA 1RTOA 1CKNB 5D49A 2KMDA 4A3FG 4RW4B 4FF2A 4M5IA 5TZVA 2ROPA 5K14B 2DGXA 1Y1VB 4DUYF 8ICHA 4XQQA 4A8EA 4JI6J 2FJEB 1ULRA 2R2TA 3FCHA 1G51A 3MM9B 1JIHA 2B2VA 2OM6A 1YKWA 4H13C 1OXVA 4B9XA 1BPYA 1U45A 2QG9B 3CQZH 2NBFA 2XTIA 4RT2A 3R2TA 2LEBA 2GIQA 2D9PA 2B39A 3EJIA 3GP9A 3OL6A 2J6UA 5LXRA 4QCLA 8ATCB 1NTGA 1T5XD 2C9OA 2B2TA 2HUGA 3T5KA 1RTDB 2E74C 1DXMA 5G0RB 1Y10A 3CC4S 5K8NA 3IO1A 5J2MB 1RWUA 3A8IA 3MPWA 1BR9A 1RM6C 2WF6A 1TELA 4CLWA 1TWGB 4O5EA 3RJHA 2FY8A 1I50H 2LM1A 2BA9A 4MZ9A 4HHHA 2O67A 2DKOB 3M05A 3D66A 4USIA 1V43A 2OPPB 1Y69U 4LNQA 1GK8A 2XYGB 2ZNZA 1O8BA 3C14B 1L6NA 1FRJA 1R0BG 2W11A 2KM8B 4ULLA 3BVZA 4L8JA 2A3VA 3PIOA 4KO0B 1HQMC 4IFYA 1YWXA 5ELDA 2YMLA 1MQ2A 5IIOA 4C3IH 5JMNA 3S1RH 3G8QA 4UB1A 4I28A 2EJGC 2WKCA 4ZS6A 5IT4A 2DHAA 5AKJA 5GROA 2KCCA 4S3SA 3ALRA 3QSYB 8ICCA 1U1OA 4OJ3A 4K2JA 3QWUA 4R5PA 1EXNA 4XXEA 4P7VA 2KRBA 1SYGA 2R42A 1T0TV 3S6EA 1P6TA 1RHKB 4A3EG 1TU2B 1KKXA 1NMFA 4U8YA 3D6JA 3WDNA 5BR8F 3G4SA 2N49A 2VQEQ 4DU7A 3TDQA 2QA2A 4K4HA 2GO9A 4WFXA 2J76E 3D6FB 1SJQA 3UCZP 2FJ2A 4LJZC 2NVTH 4GKJJ 3D3CJ 2RBMA 1WF2A 4EBDA 3CCSA 2CN1A 1KRTA 4M9GA 2F0SA 3I0RA 1SIWB 3DLJA 7ICFA 1LWEB 2KHDA 1NHKL 3FQKA 3PRBA 5JAVA 3VAIA 1BDOA 8RUCA 2XMVA 2FC8A 2XMWA 2ZH1A 2G2YA 3HHDA 4NOHA 1TR0A 5KFHA 4UARA 5FDLB 4C3JG 2DJWA 3TS2A 2J0TD 1VLYA 2CQ0A 2F7VA 3BYRA 4MH8A 5A0LA 4J9PA 3G96A 2W2OP 2A68C 1TV6A 1MNEA 2HNZB 4ALPA 2PO4A 3BKFA 2HSZA 4JP8A 1HI8A 5HVHA 4ZLLA 5CHCB 1YBYA 2SOBA 3CCJS 4J9VA 4JI4J 5KT2A 1M1KT 3UMGA 2DNQA 3MHYA 1EQMA 5LT5A 3GFKB 1VQ9A 1S7IA 4NWIA 3C6UB 2HDMA 3CC7A 4QZ9A 3DOKA 1JWMD 1U9RA 3ZJYC 2M8HA 1TL3B 1DOKA 1B0VA 4ZKAA 2DL0A 2Y1IA 2MSTA 4USWA 2KQ3A 2HQFA 3EIVA 3NEKA 1U48A 2YVSA 1JB3A 4ME5A 2KJXA 3SK6A 2EBGA 3HK2A 3RJEA 2QGQA 2V4QA 4NI2A 3OTQA 1I4QA 2KKPA 1QVCA 4Q0BB 3BQTA 3L3OC 5HROB 4DQIA 3A13A 7ICKA 1ZQDA 3AB9A 1YJTA 3OVAA 2E5JA 4A3KH 3ISDA 1WI6A 1IM4A 4XRHA 2UXBJ 1HFNA 5ADZA 1TWFH 3WK4A 1PC4A 2RIJA 4KC5A 2DXEA 1X65A 4PXEA 7ICRA 1D5ZC 3FCVA 1NPRA 2XI2A 2KXNB 3GZ7A 5RUBA 4YXMA 1UEUA 2F9JA 3THTA 1YITS 2ZTEA 2ZXPA 2KEYA 4J9KA 1VMPA 2G2ZA 5HLFB 3RJJA 4X62L 1VQGA 1TWCH 3DRSB 1EWHA 4CF4A 4ZN1A 3AOBA 3KUPA 3NOGA 3J7AN 3NCPA 4CDDC 1NH7A 4DSFA 2KVQE 4QIWD 2MAXA 1IHZA 2VFSA 3HFZB 3CO9A 3R9KA 2Y1JA 1EEFD 2RSOA 2IX3A 3OTEA 3HSGA 4ZLPA 4OL7A 3K0JA 1NJWA 2XGTA 2PQEA 1H72C 1FF2A 5DB7A 4JI4Q 2D9OA 1U9LA 1IKVA 3DHWC 4GXKA 4QIEA 3HKZF 1RXVA 2VG7A 4NXMQ 5KG6A 3TUIC 5GMKa 3FEZA 3F5AA 1HEKA 4M5KA 5H9FJ 2KECA 5HJXA 1EQRA 2ZXRA 3VV2B 1RLCL 3MF5A 4DUYL 2CQDA 8ICOA 3DWPA 2JA7B 1H0HB 2MJ8A 1U24A 3TEGA 1I94Q 4L63B 5J2PB 3UD4P 2NZCA 3R2DJ 1TAQA 5AJ3L 5AKEA 1EY0A 2ZM6J 2WRMA 1RQNA 1ZKOA 1KBUA 4KAIA 3IL8A 1AE3A 4JI6L 2PYKA 4EQPA 4LF6L 1RGVA 2HGLA 2Y8YA 3D2SA 2Z0GA 4MYUA 4F4AA 1Z2LA 4NLVA 4HYKA 2ZUDA 1GJXA 5KOWA 4DOCA 1B70B 3MFHA 3KBBA 2QMXA 2M52A 3K8WA 3DGPA 3NEMA 4FNIA 4DV0F 2AJ4A 3VGVA 3SMVA 1MWYA 3LWLA 3D2WA 4U68A 1SH0A 3M4OH 3U7JA 2W1BA 3ZO7A 1URRA 2XMAA 3QZ8A 3CDEA 5FJ8H 2ZVSA 2H4OA 2CA9A 4ZN3A 4FNHA 4F91B 1VI7A 2IJNA 3GTQB 2VQFL 2X7IA 4ZUIA 3PYFA 4AL5A 1CQNA 4RCOA 3H6MA 2FQQB 3FBCA 3ZD8A 4DV4F 5IIIA 3U9OA 4OELB 4FZNA 5CBAE 3DC2A 2SEBD 1X4EA 4D3GA 5JOBA 1TS2A 4ZKCB 1QVFA 3ENQA 7AT1B 4KH0B 3FKIG 1EY6A 5A76A 2KFYA 1X4GA 1D9DA 4B9NA 4O3RA 1EYCA 3LP2A 4USMA 4ZA1A 1WWVA 1XO1A 2K33A 4GKJQ 1L3TA 1R27B 5BN4A 3NTKA 2CJAA 4DV6J 1HUNA 1NDLA 3MDCA 1Y4ZB 4MTPA 4F3QA 4UBCA 2ZTCA 1OXJA 3HVWA 1GMWA 1XN9A 4P2CB 5GADU 2HG4A 2IX0A 1L7OA 4Q43A 4RW8A 2BKEA 3UO0A 5D15A 2H5IB 2EFGA 1SAPA 3B82A 1JWUD 4O3NA 4B9TA 3L3CA 1STNA 3B0XA 2DJGC 2Z2ZA 4X66F 2LKZA 5HHHA 2D74B 1QSLA 1HA1A 5E5NA 2BV3A 4X64J 3HHNB 3HOUG 3NY0A 1H74A 4OJLA 1T4GA 2ZBRA 4U9RA 2VJ4A 5C25A 4A8XA 3NRZA 1O7LA 1BNOA 1D7QA 2JC1A 2WB1E 4NRTA 2DRBA 4J9SA 4Y65A 2CQCA 5E7OB 2QSFA 5ALDA 3TRZA 3S2DB 8ICVA 1D6EC 2BCRA 1EL0A 4DOBA 1NCVA 3Q8VA 3NELA 1S6QB 2B5JB 3M6KA 1QUVA 3BSOA 1RA6A 1ICEB 4QIFA 3JSMB 1SJFA 1R4PB 3M9MB 1Q16B 4LSLA 1SJED 3H8SA 3LP0A 1K8AC 1S7HA 2DNGA 2FB0A 3S6JA 2Z6BA 3OPKA 1WD6A 3N9UC 3BSCA 1Z7TA 4DFJA 4M63A 5CZXA 2NSBA 1PZJD 4PWDA 4OZ1A 2WHEA 3IR5B 2UXBF 5HVGA 3E0JA 3E01A 3ZZRA 2GQ2A 2E5LL 8ICZA 3WBZA 3TQYA 1AEXA 2CCZA 3U58A 3OL9A 2V8GA 3RN2A 2AUKA 3GO5A 4DV5F 3ITPA 1IN0A 3PO3H 3G82B 1JOOA 1B43A 1Z1VA 3V7JA 1DGJA 2OSQA 5KFLA 1AZPA 3OFGA 1M90T 3MECA 1SH3A 1S6PB 2LXJA 3G82A 1QCBD 1VS0A 2MUTA 2ADBA 2QF7A 4CHTB 5FK9C 2G5IB 1ILQA 3Q8QB 5J2FA 3NNAA 1OYEA 5D3DA 2GX8A 1SNPA 4A8YA 4D3HA 2JOQA 4QQBA 5L1KA 3THPA 1U1LA 3MHBA 3F56A 3SDZA 2K8CB 4WXOA 3KTQA 2QJ3A 2BHNA 3I55S 3I5AA 1QILA 4QB4A 4UZCA 4QZAA 1BNZA 2J9DE 4LSLB 2JV3A 4V190 3D54A 3CCVA 2M3DA 2IFXA 3RAMA 2KHIA 2Y0SF 1ENFA 1VDHA 1MJCA 3CMAA 3PUWA 1ZAWA 2E1MC 5GAHU 3T79A 5JJKA 4F2RA 1HD0A 4RPYA 5ALOA 1R4QB 4KE5A 3H25A 4I6AA 2KBNA 2K4HA 4LFAL 3BO2A 1SYEA 4CIOA 1SPBP 5AI9A 2ZH5A 3T41A 4NXMF 5E7NA 2NYHA 3GFHA 3IV6A 1S0MA 2XSFA 4HL9A 3QIPA 5IZHA 4ZVOB 1VJQA 3UPQA 1VOMA 1OW5A 5K8PA 3H0RB 3S9WA 3UN3A 1XBWA 3A0BU 1BF4A 2MRLA 2ES2A 1VMCA 3LVVA 4TUSA 1U4LA 2QL9B 1DTQA 2LMIA 3AL0B 3IG1B 5C24A 5L39A 1PJ5A 1IBLQ 2HQCA 2CFXA 2UVUA 3NGDA 1XMQL 4G1QA 1WUDA 2WIIB 5AK3A 3H15A 2HRUA 2RKIA 3JAMU 1KOHA 4CO2A 5BYSA 4YCVA 2Q6CA 4FF3A 3PO2G 2PMHA 5NUCA 1A76A 4KLFA 1O7IA 5B7WA 5KFNA 4BBSG 4RGNA 2J7KA 2PQAA 2PEBA 3SR1A 1T8EA 3W1BA 2C2KB 4F25A 3PKYA 2BYCA 3C2KA 4O23A 2UUCQ 4PNYA 2IOFK 2XMMA 3GTGB 3K0YA 3TP8A 3LVWA 1CRXA 2F77X 3CNHA 5D4NA 2YB1A 2G9OA 4ILRA 3MC0B 5AK6A 3UN2A 1X3QA 1VQ9S 4KR0B 2OCEA 3ZFVA 4EEKA 5E4XA 3HOVB 4DSKA 5FD1A 5C0XI 3BJYA 4JOIC 2WHOA 4KGKA 3CP0A 1TWHB 3KWMA 4DV5Q 1XTDA 2F0OA 4DO9A 2QT7A 2V2ZA 4FZLA 2KJ8A 1PAEX 4PKDB 1TKWB 1J2VA 1PFBA 3MR3A 1VYAA 1NNDA 4U673 3PR5B 2ZIVB 1IJEB 3N79A 3TQ1A 2WB1G 3AB2B 3HO1A 1J2NA 2K1RB 2G09A 1VLOA 4DX6A 2YB4A 4TKTA 4ZP8A 4B02A 4J8QA 3N4MB 2CVEA 2BANA 3NBPB 2HQDA 5LMUJ 4M9LA 1UCNA 4YWMA 1CI4A 1VDVA 2FHJD 4DR3J 4FF4A 3IHQB 1U09A 2H48B 4C8YA 2GQCA 3POTA 4Y2UA 4RQ1A 2C2EA 3GU0A 2J7WA 2FIUA 1BBUA 2UXCF 4OIXA 3FKIH 4OONA 1RT5A 4N8X1 3MUMP 1Q86T 3KK3A 3J7AV 5BPCA 1NZAA 5CAAA 1PJ7A 5LOQA 3S8SA 1KNEA 5CHGA 9ICNA 3FAHA 1QJOA 3P4UB 4A3IG 5GMDA 4F02A 1G7CB 3LA0A 4QY7A 4OJGA 4NA1A 3MXHP 9ICXA 3ENWA 1FERA 7ICNA 1GQEA 5C2CA 5AI5A 4AYBC 2VB2X 3SSRA 3K5LA 4WU2A 4I67A 3SR6A 4B3SL 1U2FA 3ZI4A 4I2BA 4QIVA 3Q8MA 4PEOA 3EVMA 2WTFA 1X0PA 2R92G 3QU7A 3QUCA 4F0HA 2KCMA 3K8VA 4IQMA 3DRRA 5J2NB 1ENAA 1KQGB 4IQXA 4O0IA 3URYA 5M3MG 4DFPA 4C3IB 2JR5A 2DGQA 2E29A 2LP4A 3IAYA 2CVRA 4B3RF 1COKA 3BDCA 1F9PA 4NL9A 5DDQC 4IOAQ 4YMOA 5ETVA 5ALNA 4ZRZA 4ZJOA 2XWYA 2MZTA 1CKMA 2Y0SC 4KTQA 3ISBA 3F41A 5ELBA 2KVIA 3KG4A 4DEZA 3GIRA 3QBCA 1RHQB 1SR3A 1JWSD 1Q1KA 1ZQWA 5HY6A 4A3FB 2IDLA 2VG6B 1U4MA 5JEAJ 1RT1A 3P5BP 1KDNA 3LH2S 1B22A 2JHDA 1URNA 5CP2A 4ZP6A 4WU3A 1UE1A 1VRQC 4Q2LA 4KHZA 4IUPA 3CD5A 3OSOA 2XVTA 1RYRA 3W66A 5K9FA 1S5CD 5AICA 2DKZA 4B3OA 3MM5B 1KS2A 5GAEU 4UOGA 4P2MA 5KFYA 3WK5A 7ICUA 4KKSA 5DB8A 2JL9A 4QF4A 1KONA 7FDRA 1VQ8A 3HKSA 2AT1B 5HHIA 1QOHA 3CHBD 3GB0A 4HN7A 1PH5A 1TMJA 2QMUB 1U0HB 2RQKA 1X4HA 3D4WA 3E0EA 5A2QU 2ZE2A 5ALWA 2NV3A 4YCWA 2G13A 1N5SA 9ICRA 4IQWA 3BDEA 3U1LA 1PK1A 1ZQUA 4J03A 2OUGA 5HAOA 4LFBF 3VGUA 3HPOA 3FC9A 4C1NI 3QEAZ 2PNHA 4AYBB 3D6HB 3I4HX 4MKYA 2GS8A 2VOPA 3WKAA 4PPXA 1GX6A 1UPHA 3M2UB 5DDRC 1Q7YC 4C97A 2E3TA 4OZ0A 1IBMJ 1EETB 3DLKB 1YJWA 5KG2A 1SB6A 3CUNA 4DS5A 3I28A 3A0JA 3Q8YA 1M8AA 4X65L 4N56A 1JOQA 1X32A 1UJ5A 1RQLA 3H0GB 4ILLA 3T1HQ 5ALYA 5GAHI 2XQCA 4PYDA 4F0MA 3WKDA 2F3WA 5T1IA 2K2PA 4MYTA 2MQHA 2OPRB 2B7CB 1WHVA 2R8GA 4CYUB 2W9BA 1BQMB 3HVTB 4RKUC 4WZQA 1YVCA 4BWMA 2PZUA 4LRFA 3Q8DA 4H4KA 1WCNA 1I4RA 1GXUA 3M1VB 4A3EH 2HPUA 4DUZJ 1Q8IA 2HNYB 4KQZA 1K9MC 2OEOA 2K1RA 2W4PA 2NB0A 1XYIA 1ZTTA 1GXLA 2KHJA 3LQVA 3SI8A 3NGKA 1E1TA 3HOUB 2DNEA 1WYGA 5IGDA 2F4VF 1HHSA 1QUPA 4OHZA 2BDOA 3MMJA 4MK7A 1R8PA 4KJNA 3U02A 3MDAA 3KF6A 4OZLA 1JN3A 3OBIA 1U1KA 4KLTA 1CFMA 2A0FB 4QL5A 2OF1A 3SAHA 1EP4A 4KIAA 2RUSA 1I94F 2F44A 2ZKUA 1KSPA 3JTNA 3KHHA 4K4ZA 2OJ3A 1S76D 4ECZA 1LTRD 2HFUA 4M1UB 1WCMG 4BY1B 2NN6G 2KJ9A 2EVBA 3ZNJ1 2ID0A 2RU9A 3KF8A 1M1GA 1FIQA 4DCJB 2EC2A 4IFDG 1N5TA 4TU9A 4BXXG 4K0KJ 1KW4A 5DEHA 2HRYA 4K0KL 1KQKA 4UUXA 1QAIA 1P1LA 2EBEA 1UVIA 3QT8A 3GTYX 1UFLA 1GMVA 3AODA 5G0RA 2JE6I 2DGTA 1A7GE 1RTDA 2ZH6A 1DYQA 8ICXA 3I4NH 2XI9A 3Q22A 5J1EB 9ICCA 5A2QE 1HPZA 3P6YC 3AJ1A 4N5SA 2RQCA 2XYHB 1VC6A 5EOZA 4AQYL 2I5LX 1JJGA 3TFSA 3NUQA 2ZWPA 1S0VA 4I2PA 4WP8A 2KV2A 2VHGA 2ZIUA 4EQNA 1K73C 4P0PB 1N62A 4KRWA 5LSRA 1I5FA 1F3VA 2XLIA 3S17H 1TXYA 2WCXA 2JN4A 2P66A 2RP5A 1KDCA 5KFSA 2CH4A 1QQ5A 4DV0L 1HWJA 4KJOA 4DL3A 3BJUA 2W2QP 3I56A 5HP4A 4YY3F 2DH9A 5I42B 5K14A 1CJTA 2F1MA 1TP7A 3OIQA 4MTNA 4RW4A 3WKEA 2K50A 3NP5A 4C98A 4DAVA 2DYAA 3DWAA 3K7RA 4QJFB 1X4CA 2K3KA 2JX2A 3MM6A 4A3KG 1U49A 4RHRA 4DF4A 3BDLA 3DM3A 3I8ZA 1REGX 4NLSA 5CYMB 4GZYC 2BQRA 2B7BB 4NMLA 3DOMB 3C15B 4OLPA 2ZH9A 5M3FB 4JI6Q 2N3OA 2BM1A 3FYHA 5D65A 1YSJA 3FMCA 1CTMA 1W3SA 5A0YB 3OPOA 3T3FA 3QJYA 1T9YA 3AMZA 1IKLA 1SUQA 5GAEC 2DHXA 3BPDA 3IS9B 4IPCA 2NXNA 2MLYA 3LDAA 4I2JA 1JLQB 2CWKA 1X5TA 4OHVA 1SNMA 4HTHA 2F0UA 5J2JA 1D2BA 2DB1A 3GJTB 3B6YA 3QE9Y 5DQIA 4TQUS 2PZTA 2YNIB 2E7VA 1ILPA 2B2YA 1SIJA 4IO9A 2ZUAA 2XS5A 1BXNA 2NUUG 1CSPA 3MEFA 2W2MP 2O1PA 1TFWA 4FXDA 3JAME 3K89A 4JBKA 3M8PB 2FZCB 4ZIWA 1S40A 2R7SA 3TVKA 4IPDA 2MUTB 3J81E 2CNKB 3FFIB 3MA2B 4IO1A 3T1YF 2J0SD 2LMRA 1B0PA 1S6UA 3MTJA 2PC6A 3CDAA 2BMBA 2KKVA 2VBXA 1A15A 1HYSB 2KH9A 4LZDA 1NR2A 3BZDB 1S1XB 1KLMA 1EY8A 1Q46A 4USVA 1N61A 4UB3A 2HURA 1NJXA 4QW9A 1JLCA 5L1IA 2KZMA 1YJVA 3QJLA 1XERA 2RA4A 3MGJA 5AI0A 1RWWB 4KLUA 1PFNA 1U1PA 3I96A 1W2BA 5MLCV 2E66A 3SENA 5KGUA 2HYIB 4H4MA 3M8ZA 3T56B 1PH7A 4LF7Q 2NVTB 1EYAA 2Z8QA 2AZ1A 4LJMA 1P9YA 3DI6B 3K4GA 3BYYB 5IV4A 4G9BA 2G1DA 2QA4A 1LB2B 4AL6A 5B09A 1HHTP 3M8QA 1L7NA 3HGBA 2FPHX 4LF8F 2ROEA 4LF9F 2DQNB 1Y11A 1V9PA 4F4ZA 1LFPA 4UP9A 4GKKL 3E3XA 4PRFA 2CWAA 3N5BA 2ALYB 4OX8A 1EB0A 1YTYA 1ASYA 2JRSA 3PACA 2YWHA 4KLGA 1YG0A 3LP1A 4R1JA 3SK5A 2R4FA 2R8HA 1LTAD 2F0DA 1FRLA 1FRHA 3J7YW 1RI7A 3DYAA 4RW9B 1RPLA 5L38A 4DV4J 3SCLE 1PH3A 1WTFA 1YRXA 3AM9A 3S1TA 5C7PA 3AD8C 2PKEA 4IRCA 4USHA 2VPXB 2DIVA 3N52A 2ZJ8A 1ZETA 4C3HG 3S1RB 4F72A 4FXGC 4L76A 3Q8RB 4JI7Q 3QU4A 1ZQGA 4Q8FA 2EXDA 1TS3A 2DNZA 1U1QA 3D28A 1HFEL 4IR9A 1EARA 4PWWA 5C4JH 1RWKB 4ZVHA 4KX3A 3MCMA 2MKCA 2A73B 2F8HA 5CCLA 3CC7S 4EX7A 4B9LA 4NEYA 1H9JA 5ETNA 4LF4L 2ZZTA 4HHUA 4K5WA 3FCWA 2XSJB 2B56A 1MROB 4UTGA 4WCEQ 3H8MA 2PFNA 2OFGX 3ND8A 3SGIA 4CTAA 2C1EB 4GVBB 1XWLA 1ZRNA 4PCQA 4IPGA 5IM0B 5ALTA 5E3CA 5D0EA 4C3LA 3GTJH 3KLIB 1S1VB 3MCOA 1UWBB 3LX0A 2QCPX 3K7AB 4XTCS 3LK9A 4DR6L 3VZHA 4RT3A 5J2AA 5DDPC 5ALUA 2Z2LA 1X3EA 1YRUA 3VAGA 2UUAQ 2LEPA 4MK9A 4JI5J 4CZCA 2G0IA 1MROA 1OY9A 3TREA 2JFKA 2DNMA 4BC9A 1M90C 3R2IA 1XNRJ 1C0UB 2AP6A 2OPSB 1NR4A 1JJ4A 2CQ4A 3DKDA 4UQGA 4HHJA 4QZCA 1KXLA 2WBRA 1RB0A 1XK8A 4X65J 3KUEA 1FESA 4DV4Q 4ZK7M 1M5OC 2CWXA 2GGPA 1SVDA 4OX9F 2HHVA 1UW9A 3G6JB 2Y0SB 3LTOA 1RT2B 2IA6A 1H9RA 1S48A 2ICIA 5A8WB 1F2ZA 4IN3A 1YK9A 2UV8A 4BX9C 4C3JH 1U0LA 4A47A 4BBRG 2KZ3A 3Q8UA 3PYEA 2GMHA 1EQ0A 4ED0A 3VQTA 3US5A 5KFEA 5DQGA 3DYAB 4DX7A 1HZBA 3EXYA 2JH3A 3BDOA 2HGMA 2ZBCA 2NYVA 2X69A 3MM7A 4DR5F 2EYFA 3ONAB 1Y1WG 2W55A 4ZCLA 1LTID 2ZH3A 2IHFA 2NZHA 4AFFA 2HGNA 2OTLS 3IRXB 1MBYA 2G9HD 2U1AA 2FTRA 1JLGA 3RR8A 2EG2A 1RTIA 2FMPA 1XNQQ 3WC2A 4RW6B 2N4CA 4F5PA 1HPCA 1V5VA 5EPLA 2XEXA 3TFRA 1KLNA 9ICIA 4BBYA 2ZJPA 3B4MA 3R7SB 4G4KA 1REVA 4OXPA 3DM1A 2I5HA 3UDCA 1BXTA 5E79U 3UDFA 4I2GA 1FKPA 5ALQA 1UWAA 4WE1B 4A3JH 2VL1A 5FKAC 4X6AH 4CJ1B 2A6MA 1JJ2A 2EH9A 4K7QA 1BOSA 2UUCJ 1VQ6S 3PFOA 3HX0A 3AU2A 4RGMA 5IYDG 1RAAB 2LYVA 1VQNS 4LR7A 4RWSC 3O5TB 4H4MB 1RD9D 3KBXA 5KFGA 3NGTA 4N8FA 3FBBA 4NLNA 2MKYA 2RS2A 4RX6A 4F87A 3L5KA 2OWOA 5EX3A 4BY1H 3B9JA 3MMBB 1XNRQ 5C0YA 4A4JA 2E1RA 2MGZB 2WAQF 5IGEA 2HWTA 3W3AA 2HVDA 3A8JE 1UTAA 2J0QD 1X42A 3NOCA 1HYSA 3NTHA 2X1BA 3SD7A 3I4LA 2K8AA 1CLFA 3V05A 3CIMA 4OO1J 2QEJC 5EJWA 4ZOSA 2ZIXA 4MFCA 4DR7L 4QIWB 3FFIA 3QT5A 3OMGA 1OXUA 1OXSC 3H5SA 3DHXA 4YXJA 2BJDA 4JI3L 1JJ2R 1R0AB 5JJZA 1ZJNA 4KN7C 4OHXA 4RNNA 4FVCA 1QUQB 4DKAC 4EUVA 1PFSA 2ZG6A 5HK4A 4TURA 2KL8A 1M4VA 2HIQA 3OWFA 1IKWA 3IP4B 5B0EA 4KKOA 5KT3A 4NI2B 3NENA 1KD1C 3AXKA 4F4KA 3NGUA 2B29A 1LWFA 4IDKB 1WVLA 1SKRA 1XR5A 3OTOF 5JJIA 2WVBA 4UW9A 1MWQA 2FJ6A 5IYCG 1NH8A 3KLHB 4Q8EA 3OUYB 3S1MH 5IINA 3M4YA 1ZYRC 1NB2A 3DOKB 1HNXQ 4OYOA 1S49A 1WOCA 1K28A 2I0QA 3DDHA 4YY3J 5BR8J 2JVOA 1CPZA 3R9LA 4I2QB 1YJUA 2NXEA 1DLOA 2YU9B 4EEYA 4UAWA 3OOCA 3G6EA 2AGQA 1QTMA 3UDGA 1EYGA 1RABB 2F3NA 3H20A 5GADC 7ICGA 4K4UA 3NSWA 5LL6X 2C5CA 1MU2B 2QO3A 1PSDA 3KDFA 2EAOA 4RBTA 1RHPA 5AM2A 3M2VA 1MKHA 1TV6B 2FUG9 4PL2A 4KKOB 5IOCA 4G3IA 1U4RA 3BS9A 1KWMA 1LM0A 2VASA 4XO0A 4X4SA 1IQZA 1SKWA 3CCUA 2YY3A 4KYZA 5KG0A 5KFXA 2DGSA 1HNZJ 4PZ6A 3MTSA 2FHOB 5FJ8G 1CKOA 1Q81T 5M3MB 1VQOA 1Q1BA 1LWCA 5DG9A 3S1QB 4DR2L 1HPZB 2JEIA 4UZBA 5J1EA 3W2VA 1VQCA 1WTOA 2P6UA 4TUPA 4GNXB 3GDXA 3W1YC 3GTKH 3HMJG 3DEEA 1ICWA 2KFZA 4ZIVA 3LANA 3NGRA 3S15H 3S7RA 3ZZYA 3NAIA 4R0EA 5CD4H 3C1YA 2F0KA 3KLWA 3QB3A 2YWEA 3WHIA 3KLSX 3NTIA 2KXHA 3D0IE 2ASYA 4JV5F 4CI0B 2ZBQA 2XICA 5EKIA 2AIRB 4TYAA 3GD7A 2F52A 2OHFA 4BY7G 2EYOA 2P8IA 5ETLA 4XPEA 3KNAA 4USAA 3BKUA 5C4XG 2AYGA 3QT6A 4X66Q 3PX4A 3ETOA 5ALEA 2IA0A 3N0VA 4XK8C 2JEGA 4YFKA 2WAQD 2Y0SD 4Y2AA 3UI3A 4DS4A 4IUQA 4O3SA 1QG7A 3FMWA 1SJ1A 3TP5A 3F1ZA 1V85A 2M9VA 2W43A 2UXCL 4UB8U 3C14A 2E1CA 2ZXOA 2Q79A 4HIKA 2AHOB 3AQFA 5HVFA 2RDIA 3HOZB 3F2CA 4KKUA 1R8BA 3IRBA 3HOVG 2DJFC 3PW2A 4P9SA 1YZ7A 2K7VA 4L5QA 4NMZA 3J80L 9RUBA 4Z9CB 2KVCA 3M1VA 4PPZA 2ZNYA 1PG5B</