3CW2C

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
266
structure length
266
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 63
structure length 266
sequence length 266
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00575 S1 S1 RNA binding domain
C PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3cw2C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cw2C01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3cw2C03
3K0XA 3U4VA 2ID0A 1GM5A 4DR6Q 1GKHA 5M3MG 4R4IA 1K9MC 2HQLA 5GAHC 1CKMA 3I7FA 3T1HL 2JA5G 2B63H 4KHPQ 1KQSA 4XTCS 1KIXA 2F3IA 1NMGA 1A62A 1IBKL 4JI0Q 1MJCA 4P75A 4BY1H 1XNQQ 1UE5A 2ES2A 1YZ7A 3I4MH 1SE8A 4X65Q 1FJGQ 3H3VH 3BZKA 2Q2HA 2JQOA 1SN8A 2JA8H 4L5QA 4IFDI 1YHAA 1N32Q 3TRZA 3KDFA 4GKKQ 4IPCA 4JI1L 1Y1VG 4LUZA 2NVYH 1PH3A 2PI2E 4LFCQ 4DUZQ 1VQHA 4DV3Q 4LF9Q 2OWOA 4JI8Q 5M3FG 2IX1A 3L2PA 4GOPB 4DK3C 1VQJA 4POFA 1KRSA 1QZGA 2JEAI 2JA9A 2Y0SE 1FVIA 3SGIA 2DUDA 2LXKA 1X3EA 3ER0A 3D0FA 2JA6G 2R7FA 4A3GG 4GKJQ 3S17H 3ULPA 2WFWA 3RLOA 1Q46A 1SR3A 3UE0A 4TQUS 2BA0A 3MXNB 4MTNA 4A3KH 1UE6A 4R4QA 4JI4L 3AFPA 3L7ZC 1YZ6A 1Q81C 2UUAQ 4BBSG 3M9BA 4YWMA 1E1OA 2CQOA 4R4CA 1V1QA 4C3IH 1B70B 4JYAL 1W2BA 2K5NA 1YHBA 2KBNA 5HGQA 1XPUA 4OX9Q 5DLQE 4LF9L 4DV3L 2R6GA 3F2CA 4A3MH 3VDYA 1M1KC 4PMWA 4P74A 1VQDA 4B3TL 4YY3Q 1YJ9A 3UDFA 1QVCA 3W1GA 1DGSA 4UP7A 1EYGA 3HOWG 3CCMA 2D0PA 1SLJA 2B29A 2UXBL 4LFBL 4A3LG 1OXTA 1TWHH 3CQZH 4DR2L 1NY4A 3UDIA 5FLMH 1WYDA 1KD1C 3W1BA 2OQ0A 3CCQA 3HOUG 1WOCA 2WAQE 3EIVA 3K8AA 3TREA 4A3DH 4A93G 2ALYB 5C0XG 1FL0A 4IO9A 4LFAQ 1X54A 1PH6A 1OXVA 2ATWA 2IHFA 2Y0SG 2YTYA 3KJPA 4IFDJ 4X66Q 1BVSA 2YV5A 2KENA 4GOPA 4BY7G 2RCNA 4DV0L 1K0RA 4HJAA 3W5OA 1HNWQ 2VS1A 4B3MQ 4BA2I 1X65A 4PZ8A 4WJ4A 1X6OA 3STBD 5LMNL 1O7IA 1TXYA 2OQKA 1N8RC 4QIWE 4HJ8A 5IP7H 3PO3G 1AE3A 1Y14B 4WJ3M 1P16A 1K83H 5J3BA 2AWNA 2BA1A 3UDGA 2RHQB 2QGQA 4O0AA 4DNIA 2R93H 1SROA 1E22A 1PYSB 2HHHQ 1L0WA 4BBRG 1D8LA 2K50A 4GN3B 3GTLH 3K7UC 1JB7A 3KDFB 1HJPA 1HZCA 5IP9H 4RG1A 2OTJA 4B3ML 4AQYQ 2WAQG 2JE6I 5H1SE 1I50H 4AYBE 5AJ3Q 2YU9H 3GO5A 2Q2UA 3FKIG 2NVQH 2A19A 1Q8KA 3HKSA 1IXRA 3HOXH 4A3CH 4BXXG 4QL5A 4R4OA 1KAWA 1PFSA 4A3JH 3S15H 1YNXA 4DV2L 2VQFL 3CMEA 4A3IG 3CCSA 1VQOA 3T1HQ 2VUMG 1IBKQ 5IT9c 3CPWA 3JAMi 4JI5Q 4LNQA 3GTMH 2XTIA 3HOZH 1QVGA 1HZ9A 1Z9FA 1VQ5A 2RHSB 2ASBA 4JI1Q 1VQMA 3CCLA 4JCVE 3CC2A 3J7A5 1EUJA 5C3EH 1V9PA 4AQYL 2K5HA 4JG2A 3RN5A 3PUYA 3TEHB 3J81i 3HOYG 1TWAH 1TWCH 2PI2A 5C44G 2JJQA 1VQIA 5GAEC 1C9OA 1Y1WH 2YTXA 5IY0A 2AHOB 2CWAA 4IOCA 2B63G 4K0KQ 3J80i 2CFMA 3BJUA 4A76A 1HZBA 4JOIC 4BY1G 3JAMc 3TS0A 3I4OA 4JI5L 3I4MG 2K14A 1JMCA 4JI4Q 2GN5A 2HIVA 3CCEA 3I4NH 3RZOH 1G6PA 4AYBG 3HFZB 3M4QA 2ZM6L 1RL2A 2KCMA 3CC7A 1OXXK 4GN4B 3AEVA 3OTOL 1VQ4A 3DM3A 3PUVA 1KRTA 1JE5A 2XGTA 1I3QH 1X9NA 2HT1A 5ELOA 4LF6L 1PH4A 3TS2A 4JYAQ 3M4PA 1E24A 3PIOA 1Q1EA 2OCEA 1EFWA 2UUCQ 3PGZA 1J5EQ 2KHJA 4UY8C 3PCOB 4X62L 4B3TQ 3CW2C 1E3PA 4EQ5A 3S16H 4C3JH 4LF5L 4IPHA 2NVXH 4KI0A 4DR5L 1Z47A 4JOIA 3EN2A 2N49A 4DKAC 2UXBQ 5JEAG 1QZHA 4LFBQ 4K0KL 2A8VA 5IYBG 2CKZB 2N78A 4J15A 3PO2G 4A4IA 4DR2Q 1YEZA 4A3KG 4DUYL 4P73A 4ME3A 2CCZA 2Z6KC 1B8AA 1CUKA 4YCVA 1YHQA 2QN6B 2I5HA 4JI6L 3PO2H 2AMCB 1M90C 3S1NH 4GLXA 4LFCL 4R4TA 4JI7L 3KYHC 1MIUA 2MFIA 4A3MG 2UXCQ 3JC66 2F4VL 2UUCL 1J5EL 4UP9A 1A63A 4DV4L 5LMNW 1Q12A 4B3RL 3CP0A 4DV0Q 3PF4A 4QQBX 4YHHL 1C0AA 1VQEA 4IPDA 5C4XH 3K80C 2Z6KA 1N9WA 3KOJA 3ICEA 5FLMG 3RNUA 3PIPA 1EWIA 1EOVA 4JC0A 5C0XI 5LMNQ 1JJ2A 3S1MH 1NBWA 1N34L 3AQQA 5GQOA 2GVBA 2BH8A 5HY6A 4A3DG 1VQAA 1HZAA 3K81C 3M3YH 1FGUA 2JA7H 3S1RH 4GLVB 1LUZA 4NXML 1Q7YC 3F1ZA 1KHIA 2VL6A 4XIGS 3PSIA 4JBJA 4JBWA 3S2DH 1L1OC 4C2MH 2R92H 2UXCL 1I94L 3EBEA 2NN6G 3GDEA 2JEBI 2VY3A 5GROA 2Q2TA 1GO3E 3S2HH 4OO1G 4H02A 3BU2A 3GTQH 4A3FG 2UXDL 1VQKA 3PUXA 1PH7A 1LTLA 1J6QA 1UWVA 1EQQA 2NVTH 2VZAA 1P8LA 3K7AH 3AFQA 4GNXC 3CF5A 1E1TA 5IP7G 1K8AC 3GTGH 4JI3L 1XPRA 4JV5L 1HH2P 1WCMH 2K5VA 3NEMA 3HOUH 3G4SA 4DV2Q 2VQFQ 1XJVA 4KHZA 4L5TA 1EIFA 1SRUA 2MO1A 4HJ9A 4GS3A 2FXQA 2N3SA 4A3BH 1L1OA 2UU9L 4YWKA 2R93G 2EXDA 2N8NA 4X64Q 4P72A 5IYDG 2YTVA 1PA6A 3KF6A 3F8TA 4NXNL 3CCUA 5BR8L 1PV4A 4KLKA 1S3OA 1VQ6A 4DR7Q 2VQEL 4X6AH 1AH9A 5FJ8H 2UUBL 2JK8A 3RLFA 1U0LA 1VQ7A 1WFQA 5IE8A 4GNXA 2R7ZH 2C35B 2I5MX 3LGJA 4HIMA 5IYCH 3E0EA 1IYJB 3HOXG 4A3CG 3U58A 1OTCA 1GD7A 3NBHB 2D0OA 4A75A 3AYHB 5ELNA 4GLAC 1NE3A 5GAGC 1VQLA 3HOVG 1VQCA 3IRBA 3ERSX 2OTLA 4AH6A 3HOZG 2VW9A 3ZJYC 1Q82C 4X64L 2ZJQA 3FHWA 4RMFA 1D7QA 4DV7L 4FDBA 2E2HH 2Q2IA 4DR7L 2IT1A 1PH8A 2ZM6Q 1EIYB 1HR0W 4YWLA 3RR5A 5M5XH 4MZ9A 3OTOQ 5C0XJ 1W3SA 3RLNA 5C3EG 1PH1A 2QEXA 1C7YA 4LF6Q 1EQRA 3GTJH 3HKZE 5M5YH 3DLLA 4DR1L 1QUQA 3UE1A 1CKNA 4X62Q 4NB3A 4LF5Q 4DV5Q 4DR5Q 3CCVA 3H3VI 4A3EH 4IJLA 4TVAB 4HJ5A 2WP8J 4PZ7A 2WB1G 4OWWB 5IWAQ 2V1CC 3KFUA 2H5XA 4DUYQ 3CAMA 3T1YL 3I4NG 1N36L 3PF5A 3S14H 4QY7A 2GVAA 2JA8G 2HIXA 1XMQL 4PG3A 4JI6Q 1NMFA 4C3HH 1KC8C 1U5KA 1VQ9A 1AE2A 2E8GA 3H0GH 4OWXB 4JI7Q 1A0IA 4LF8L 2F52A 4YCUA 4LW1A 3J81c 2F4VQ 1XMOQ 1I6HH 1HR0L 1IBML 4DR4L 4QJFA 4DV4Q 1IBLL 1Q86C 4B3RQ 3I2ZA 1N33L 3CD6A 3Q8DA 4LF7L 4DV6L 4DV5L 4YHHQ 2E5LL 2IY5B 1H95A 1NTGA 1VQNA 4JI2L 3U50C 5M3MH 3J80c 3A0JA 4OONA 1S72A 1WJJA 2DGYA 2L15A 1TWGH 1X3FA 5IWAL 3RZDH 1MJEA 2I0QA 1CSPA 2JA5H 1N34Q 2QMUB 2IX0A 1VQPA 3GD7A 3HKZG 5FLXc 4DR3L 1HNZQ 5C4JH 1YIJA 4NXMQ 2NZHA 1YBYA 1XNRL 5E7NA 1SFOH 1L1OB 2A1AA 3ULJA 2EIFA 3I55A 5JJIA 1Y1VH 4IPGA 4IFDG 2RF4A 1K8GA 3KF6B 5LMUL 2D62A 1LYLA 1K3RA 1HNXL 1I94Q 1XMOL 5M3FH 1PHJA 2YYZA 3D31A 4O2DA 4LWCA 1XNQL 5JJKA 2NZOA 5JJLA 1Q1BA 3NELA 1X55A 4OXPA 4GNXB 4DR6L 2UXDQ 2LSSA 5C4XG 1V43A 4LUOA 4DAMA 2QA4A 4KHPL 5IYBH 2JA6H 4A3GH 4JI0L 2CWPA 4DK6C 4JI3Q 4JV5Q 2AKWB 1FJGL 4X65L 3PUWA 2JA7G 3G71A 3CMAA 3TQYA 1HNZL 2R7DA 1ASYA 1N32L 4BBSH 4PZ6A 3GTOH 4GKKL 1BBUA 2NN6I 4R1JA 4HIDA 2UU9Q 1R9TH 1S40A 1UE7A 1PH5A 4DPGA 1L2FA 1UE1A 4DUZL 2R92G 4OO1I 2AWOA 1IZ6A 4JI8L 3CC4A 4NXNQ 1E7ZA 5BR8Q 1JJCB 1YJWA 2VQEQ 2KHIA 1VQBA 1OXSC 3A5UA 2UUBQ 4IJHA 4HIOA 1I5FA 3A5ZB 4GOPC 1YVCA 3OW2A 4P71A 3HOWH 3RN2A 1KL9A 2EQSA 4GKJL 2PQAB 1QUQB 3STBC 4OWTB 1CKNB 4A3LH 3A74A 1GVPA 2LXJA 5GADC 1WCMG 5M5WH 3MEFA 2ZTDA 1K73C 1CSQA 1TWFH 2UUAL 4A3BG 4LF4Q 5K36G 4A93H 2E2IH 5JEAJ 1X56A 3B6YA 4APVA 3I56A 3KJOA 3CXCA 1VQGA 4OX9L 2MNAA 3ULLA 3L0OA 1QVFA 4DV7Q 1UEBA 5EAYA 5FJ8G 3M85A 4HIKA 4YY3L 3GTPH 3KF8B 3CCJA 1YI2A 1KXLA 2WB1E 5IP9G 4HJ7A 3CPFA 2R7ZG 4GN5A 4BY7H 2K4KA 5IYCG 3CCRA 4A3FH 1CKOA 1PH2A 2MO0A 4UPAA 4DR1Q 3S1QH 2BH2A 3M7NA 3F2BA 3BZCA 1X3GA 1SMXA 4A3JG 4B3SQ 1A8VA 1WI5A 4Y7NH 1XPOA 3PO3H 3G6EA 1VS0A 4LF4L 4LFAL 4EX5A 4LUVA 4DV1Q 1JJGA 3T1YQ 5IYDH 1N36Q 1PVOA 4X66L 4UP8A 1PH9A 1BBWA 4BBRH 3H15A 1ASZA 1XMQQ 1VQ8A 4L5SA 1G51A 1HNWL 1IL2A 3E9IA 4LF8Q 1T9HA 3PV0A 4DAYB 2K75A 3G48A 2PQAA 3FKIH 4NPSA 1YJNA 4BA1I 1HR0Q 3J81j 1OXUA 1IBMQ 3E9HA 4JBKA 3UDXA 3M4OH 1Y1WG 1IBLQ 2E2JH 4DR4Q 1N33Q 4BXXH 2VNUD 4LF7Q 4A3EG 4B3SL 1JT8A 2KCTA 4DV6Q 2E5LQ 3HOVH 2B3GA 4IOAA 4JI2Q 2ZTCA 1RIPA 2Z0SA 1VQFA 4A3IH 3FP9A 3F2DA 1NJIC 2VUMH 2I5LX 4DV1L 1BKBA 3KLWA 1G291 3NENA 1YITA 4L5RC 4YCWA 2PMZE 2IHEA 2HHHL 3QSYB 2MQHA 4Y52H 3OYYA 1VCIA 2ZTEA 3U4ZA 3WWVA 4QGUA 2ZJRA 4DR3Q 3J7ZC 1XNRQ 2K52A 3H0GG 3S24A 1B7YB 2PNHA 3GTKH 1PYBA 4ALPA 5AJ3L 3PUZA 1XTDA 2ZJPA 1HNXQ 1MKHA 5LMUQ 4POGA 4MNOA 4JBMA 3HOYH 1LM0A 4AIMA 5C44H
chains in the Genus database with same CATH superfamily
2F0EA 5HSPA 2VJ4A 5AICA 1QILA 2WB1B 1NUEA 3RZOB 2C42A 3BO2A 2F3JA 4MK7A 2W9BB 2XNAC 1R0AA 3SEBA 5AE1A 1HXYD 3QAUA 3Q6SA 2Q2HA 4UZBA 1YHAA 1NDLA 5A0YA 2HLUA 2W4PA 4UBBA 2NVYH 4QZ8A 4JI8Q 9ICPA 2L4NA 2N55A 1QQ7A 1SJ1A 2LU1A 1F0MA 4WU3A 2V9WA 1JK9B 3I6PA 4GKJQ 4GXIA 2F40A 2DGQA 2BA0A 5IC4B 1KQSR 2JVRA 1B70B 3KLFA 2KBNA 2DHAA 4TURA 2RE1A 1PRTF 4DA2A 4OYBA 4B3TL 4UUWA 1WG5A 1C1BB 1EYGA 1LLRD 2XWBB 3CCMA 3M30A 4NL9A 5CV8A 3R2CJ 3S1RB 2BZ2A 1ZD4A 1NY4A 2YPZA 1WYDA 4DNRB 3HOUG 3WX4A 2XNQA 2FY1A 2VBYA 2E7WA 1MN9A 2HHWA 2CNOB 4ZPDA 2KA7A 3S2HB 3VGTA 4RNNA 2XSFA 4IQMA 2NN6H 3GTGB 3L95X 3W5OA 4QJVA 5AJ3J 4FPRA 3VR6A 5F41A 2WW4A 2XM3A 2KFYA 3H94A 3QRPA 2OPRA 1P16A 4UATA 5HMLA 4ZMMA 3KG4A 2GIFA 1ZJNA 3PMFA 3A12A 2J9DA 2PMZD 1JB3A 2B2UC 2CJKA 2JV3A 4DOCA 3VYSA 3PMNA 3K89A 4R4OA 3ISNC 4CDFC 1T11A 1T9WA 1YNXA 1R0BG 1KLGD 3NTUA 1EY9A 4OI1A 2B6GA 1DLOB 2DNNA 2BCUA 5C6AA 2Y0SC 2PI4A 3ND8A 2RDDA 3PIO3 2IVMA 1TL7A 2FGCA 3D6JA 4CDCC 5FP0A 3GB0A 1A0PA 3AJ1A 1X5TA 2B4VA 4KLUA 2AF6A 1ZXIA 3TUJC 2H9ZA 1LB2B 5AKKA 6FD1A 1BNZA 5CH7B 3UDVA 3J80i 1S7IA 2CFMA 4WP9A 3S17B 1ILQA 3N7PD 3H0RB 2ZUGA 3PSFA 2VFVA 2A74C 3OTOL 4X62F 2DRBA 2Z9HA 1PH4A 3MA2B 2MGSA 3HHDA 4RW8A 5F8NA 1VQ9S 3OR2B 1PBAA 3PIP3 3QMQA 3ZD9A 4DBQA 3RZDB 2UXDJ 4JOIA 1FK9A 3QEBZ 2I5JA 4K0KL 4USAA 4KSEB 2HWTA 1UNSA 1RCXB 1CA5A 1F9FA 2G9OA 4JI6L 2NV3A 1REVA 3B6BA 4K4ZA 1SI9A 3JC66 2BOPA 3MMAA 2AJ1A 3QFHA 4XDDA 4ZVQB 3PF4A 1KVKA 2HNDB 2J0WA 1N34F 3BQ1A 4DU8A 5C5MA 2ZBCA 3JPTA 3RJFA 2WFAA 1RWXB 4LRCA 2MQ8A 4RKLA 3MAAA 1VQAA 1LKYA 5D46A 3M6VA 3EQLC 5IV3A 1AT1B 1V8QA 4JBJA 1WWUA 1V5IB 1SL0A 2YQ3A 3MEGB 3SAHA 1HI8A 3MWYW 2YNIB 4RUBA 4OO1G 1B0VA 1PH7A 1UZHA 3K7AH 3K59A 2BGWA 1VYAA 1SZHA 1XWLA 2W7OA 3POTB 3NEMA 1GUWA 3M7DA 4L5TA 3A7AB 4OJHA 2CRXA 4YWKA 1CI4A 5ETKA 1CJKB 1LTAD 5ETMA 4WFBQ 1PV4A 2LI6A 3I56S 2JK8A 4J9UE 2LFVA 3OTOJ 4UT4A 1OTCA 3OTBA 4CF3A 4DOZA 2D0OA 3RZAA 4NI2B 1V97A 2GAGC 3C66A 2E5LJ 1ICWA 1XN9A 4FYWB 1LTID 3FHWA 2OO4A 3QZ8A 3OUYA 2ZM6Q 1BF4A 4JI6J 1S57A 1TVRB 5AI0A 1CZWA 1FGBD 2M8DB 2FMSA 2Y8YA 4DF8A 3UE1A 1XIQA 4MHEA 1EB0A 3VAHA 5IT9E 1G2SA 1RHPA 1KDNA 2KG0A 3CCVA 2B21A 4IL6U 1YJNS 4IJLA 2CPDA 4FKXA 2W11A 2ZH3A 4HJ5A 1RM6C 5THWA 5IWAQ 1B3QA 1LTTD 3S14H 5CD4A 3GIKA 4DOAA 3E58A 2W9CB 5F9NA 2RVLA 1FTCA 3E01A 2DPJA 3H0GH 2F0UA 2F52A 2XYGB 1S5ED 1FKOB 3OTEA 1U09A 3NBHA 4DV4Q 2KJ5A 3M8WA 1SE2A 4RQ1A 2H65B 5BXIA 1H95A 3IL8A 1R7IA 3A0JA 4OONA 4RPFA 3C16B 2DGYA 1NRKA 2E9ZA 3ZTQA 2Y1RI 3MDCA 3CU7A 1LACA 2BCQA 1RCOB 1TUGB 1X7VA 4IH7A 5JJKA 5DGAA 3NGUA 2E1FA 3D7SB 1ZRNA 4A3GH 2NCKL 5CZXA 5F0WA 1R6YA 4DK6C 3A7LA 4RWXA 1HNZL 3OWEB 4BBSH 3CUNA 1ZKOA 5A8WA 4R1JA 4YR3A 2VJ5A 4DS4A 1L2FA 4DUZL 4DG1B 3NL0A 3H6MA 2D9OA 4GIBA 2Z30B 2UUBQ 4PG6A 1EY8A 1HQ2A 3AA8A 2I46A 5LJ3Y 2PQAB 4EFAC 1HNIB 3Q8YA 4JV2A 2RVJA 2DBYA 2QFIA 1TWFH 4FP5D 4OZLA 1BQMB 4ZVGA 4N47A 3D6WA 1ZQJA 1GMWD 4KIAA 5AI5A 2I9GA 2OELA 3SIPB 1UPPA 2KYXA 2KHSA 3AU2A 1FE4A 4A8WA 3GDXA 2WF5A 2MO0A 1X42A 2KVSA 1WSVA 3IM1A 2ZIXA 2P2CB 5HP1A 1JLAA 1R43A 2W25A 3OW2R 2KZMA 3HVWA 3R7SB 1ULRA 2JVOA 4LUVA 1LW0B 2VG5A 4OJ1A 1G2TA 1I50B 1PRTB 2RH3A 4BBRH 3DLJA 1FFVA 3FDSA 3OL6A 3HSDA 3BF4A 4ED2A 3PJ9A 2GH1A 3C2KA 4F0KA 1C4CA 1H9SA 2EFPA 3RB4A 3CCSS 2YXLA 4UW9A 1TWCB 1SMYD 3C2MA 1B0TA 1EU3A 1Y5NB 2PNHA 4FNFA 1QNKA 4DUZJ 1XTDA 1HNXQ 4POGA 1S1TA 1NBEB 4MNOA 4JBMA 4DQPA 1R8BA 4ODGA 2HFVA 3DOMA 3TDQA 3CO9A 2JP1A 3S6EA 3NRBA 4CLTA 2F3IA 1WTFA 3NBIA 5IILA 4TN2A 4TKTA 5C4ZA 5G0RB 3L09A 2KXHA 5ALOA 4JUZA 4WXOA 4NRUA 4PMBA 2DNOA 4ZHRB 3DLKB 3M1YA 3JYTA 2JEAI 1PK1B 4I6AA 4M9HA 1SC3B 4URQU 4LF2A 5HVFA 3RLOA 1AB8A 3UE0A 4MTNA 3OL8A 3PVXA 1SL1A 2P9EA 3DFEA 2LKYA 1XEZA 1KDBA 2DEJA 3HWTA 1MN7A 3HHLC 5HGQA 4K14A 1XPUA 4K2LA 4QU6A 4M9NA 4U673 2J7UA 4ZDNA 4QBUA 2RP5A 1EEID 1WI6A 1F2LA 4I2AA 2LQ8A 2MY8A 2KHDA 5IM0B 3M3YB 1J27A 2B5JB 1Z19A 4PHPA 5EX3A 2I1RA 3W1BA 3UN3A 3RBXA 2VQFJ 3S2DB 3D2WA 1KDCA 5DM63 3NWTA 1UEUA 1IN0A 4LFAQ 1I4XA 5IGEA 2W54A 2CKWA 5ELCA 2PCFB 2R42A 3TZYA 2CZ4A 2RD5C 5FO9B 4KY3A 1EZ6A 3B4MA 1RWPB 5EOZA 5KFLA 4U7UK 2LS01 3DHQA 3HOUB 3GSDA 4F4ZA 1X6OA 5EPKA 8ICMA 4K4IA 3A8JE 1MSWD 2DYAA 4RW4A 1Y14B 4ZVOB 1VBXA 2CA9A 2RDJA 5IC6B 1IKWA 4O0AA 4F3OA 2HHHQ 4ES1A 3TWZA 3GTLH 4PG8A 3W63A 2Y3YA 4PEOA 1KNEA 4M04A 3CCUS 4NMXA 3D6MB 3C23A 3GU3A 5B0DA 5I4MA 4QL5A 5AKJA 1S6UA 3I82A 2J8SA 3M4XA 1X5SA 2E66A 3D0IE 2VUMG 4C97A 1TU2B 1VDHA 5IT9c 5M5XB 4I2QA 2DGUA 2UVVA 1A3TA 4AQYF 2AYEA 5EE1A 2LXIA 1QQ6A 5I3PA 1TWAB 1EY0A 3CCLA 3KK2B 3R2DJ 4I2PB 2CPZA 2QEXS 1FNOA 2YTXA 3SCJE 4MFFA 2DEIA 4IOCA 2IM3A 4KPYA 3V72A 3RUBL 4YB7A 1TTHB 3T3FA 3A13A 1VRTB 2CRLA 8ATCB 3ZTRA 3M4QA 5K8OA 1WTQA 4MJKA 9ICMA 2W43A 2OCEA 4MIBA 5H1SV 4UY8C 4X62L 3SD7A 4M9JA 2ASLA 3EZOA 5M9OA 2FHOB 4A3KG 2D41A 2HSEB 4M9LA 4OYWA 4UAIA 3IV6A 3AODA 3P49B 2MUYA 4X4OA 4A8MP 3THPA 4IG0B 3Q8VA 4R4TA 2W2PP 2K6AA 4WIIA 4LSNA 4A3MG 4KFBA 3IAYA 3QGPA 3EVMA 2IA0A 4V0BA 1BY9A 3D6TB 4K4UA 1O80A 3K80C 1JMTA 3ICEA 3RNUA 5L37A 2Z2LA 2O5JC 1JJ2A 3FUYA 1N34L 1MLAA 1XSNA 1I94F 5D0HA 1RAOA 3DHWC 4X64J 3W3SA 4QR0A 1CHQD 1BPBA 4X4RA 2R92H 3T5LA 5DBAA 2H5EA 4A8EA 4PQAA 3CD5A 5GROA 1SXDA 2Z2ZA 1YSJA 3EXCX 3KTQA 4USUA 2GMJA 3OJSA 9ICVA 2OYYA 1S1WA 5D65A 4MEYA 1E1TA 2HMIB 2NZ4A 3TKAA 2ILYA 2R2UA 4QCLA 4NXNF 5LL6d 1N0UA 1N6QB 1RTIA 4X6AH 4P7VA 4DU7A 4EO8A 3MUTP 5HVHA 4U7UD 3VAGA 3F53A 1SNPA 4GNXA 3RW7A 3S01A 3ADAC 4I67A 1IYJB 2MQQA 4CNQA 1JNZB 3PACA 2DD8S 2GVDB 5KFHA 1K0VA 3KZIU 1F9SA 3HOZG 2KMDA 4ES2A 3OV7A 2KOLA 4DAVA 2BKOA 4YWLA 3RR5A 1IKXB 1Q8BA 2K3KA 4CHTB 9ICAA 4WE1A 3QG1A 1B99A 5IIIA 1XMOJ 3QSIA 1MMDA 2B4PA 3BV8A 2HWHA 2FHKA 1VLOA 1XMQF 3HJEA 3NTHA 3TAQA 1N34J 4LF6F 4ZPWR 2KI2A 4PG3A 1D6EC 4HVZA 4ZLPA 4TYAA 3JTPA 3UD3P 1Y69U 2XLJA 1SC6A 4MKVA 2FMQA 4ED5A 1H73A 4O42A 1T95A 4DR3F 1D1IA 1OYEA 3BSNA 2I0QA 4RW9A 5AE3A 1UVLA 3TUZC 2E7VA 5LMUF 4PPDA 2D9UA 3HT0A 3R1LA 2NRZA 4J9SA 3RJMB 4WFZA 1DHMA 3FQKA 3VAFA 3QATA 3GFZA 3JSRA 3H0PA 2AX1A 2RKIA 4FZLA 4A8YA 1X4FA 1S99A 2APOA 1WHVA 3G8SA 1TL3B 2V0NA 3QU7A 4GKKL 4OIXA 2NN6I 2ZT9C 4GRSA 2JJ4D 2GIRA 2VG6A 2Q43A 2ZWPA 1NJIT 4H4OB 1TFWA 1YJWA 3RAQA 3CQZB 1OS5A 1STNA 1HBOA 2EQSA 2BPCA 2RUSA 4DN4M 2BA9A 2YNHA 1B4OA 4ID8A 5DZ7A 3RJGA 3MVVA 5J8YC 1GQEA 4AYBD 1B50A 2GLEA 1RHJB 1X56A 2OPPA 2FDRA 2K28A 2RNEA 3ULLA 4QIWF 1XERA 4HIKA 3GTPH 3GQCA 3DRXA 4LRAA 2PMZC 2E5HA 1PTOF 4C0ZA 1Z6HA 3MM6B 3BR9A 2XHWA 3T9ZA 4A3JG 2QA2A 1E6YA 1S5FD 3H90A 1QSLA 4ZCMA 8ICQA 3SZ2A 1VS3A 4IYQA 1HNWF 1KABA 2JRZA 1WF0A 3TAMA 4ELVA 2KJ9A 2OM6A 3AB9A 2YU9B 1VHIA 1RADB 3HOXB 3V7KA 4PJ0U 4LF8Q 2HLTA 2K75A 3HOVB 3M4OH 4J9MA 1BCPF 2LYAA 1Y1WG 3GTMB 5JVG3 4DV1F 4OO1J 4XRHA 4OZ2A 1WG1A 1M5PC 2GX8A 1CQFA 2I5LX 1XNQJ 4Z6FA 2M2BA 1K0TA 3WWVA 3J7ZC 2K52A 4GKKJ 5DB9A 2Z4IA 2QA1A 3GTKH 4IFYB 3L7OA 4O44A 5G3LF 4KY5A 2F0FA 1S1UB 4CH0S 3MTJA 4MFBA 1GM5A 1P7DA 2HQLA 4M2YA 1KIXA 5DM73 1N5TA 3UCUP 3WKBA 4YDXA 1ZAVA 5COYA 1PCAA 2OAUA 2Q4TA 5LJ5Y 1FD2A 1HQUA 3PMLA 1TAUA 3OBIA 2AQ4A 2V8VA 4DAYA 4CF4A 3G7LA 1KRSA 2FJDB 4F93B 2NUCA 1FVIA 2JLGA 1X3EA 3ER0A 2GMLA 3QO9A 1VMBA 3MZ5A 2D69A 1SJHD 1PG5B 3KLEA 2WSEC 2NS1B 3HGBA 2MZSA 1RT6A 4R4CA 4H4KA 2A6ED 5KGUA 3A0HU 4I28A 3ZO7A 3S1MB 3UR3C 1DGSA 2V6AA 1AUDA 2YKPA 4HAIA 2ZDPA 2IJ0A 3MGVA 1XSPA 1RT1B 5IT4A 2SEBD 2KCNA 3ISDA 4A93G 5IIOA 1SXLA 4C2MB 3QIDA 4B9LA 1PH6A 3ILLA 4ZK9B 4RQ3A 4KX5A 5ALXA 2KG5A 2OEJA 4X5VA 3U9SA 1WEYA 4BY7G 4OO1H 1ZD3A 4C98A 1TXYA 3SI8A 1O6XA 2LKVA 5M2UA 4WJ3M 1C1CB 2LECA 3EPIA 2EFGA 1KHWA 2HNYB 5CYQA 5F8HA 4DSEA 1C0TA 3KUHA 3UDEA 5D49A 3NVZA 1Q3UA 2KJXA 3MAHA 5GAEU 3CB4A 1RCVD 3FBFA 2XWXA 1C1BA 4KLSA 2HS0A 1RLDA 3P6YC 3SV4A 1HUZA 1RHMB 3FKIG 3OIPA 4DV2F 2ZJAA 2EYOA 4PUOB 2QZ8A 1NR4A 3EDQB 2AGOA 2ZJQQ 3A8EA 1A6XA 3UXPA 4A3IG 3GIJA 4CKBA 4LNQA 3MECA 1CS4A 2CZVC 2RRAA 1UQVA 5B66U 1SIJA 3MM5A 4ECQA 1EKSA 2F0LA 2PNRC 2HRUA 1SE3A 4AQYL 2QDBA 1JWMD 5JU5A 3RMHA 3HDSA 1W2IA 1DCZA 1J5EJ 3FBCA 2K05A 3I4PA 5J2QB 3HKWA 3HVTB 3BPSP 1BGXT 4U9RA 5L8RC 2KXNB 2RS8A 3NEKA 4BY1G 2F1JA 2A2DA 4C3HB 1ZQWA 2EFNA 2QLTA 1K8AT 5AKHA 4HT7A 1KRTA 2BJ9A 3IBWA 4JYAQ 1QVGR 2FVSA 2KRRA 4X84A 4RLEA 3OTQA 4RBVA 1SKSA 5KG4A 1F77A 4ECWA 2DTJA 2RDGA 4QZDA 4IPHA 3QFWA 1H9MA 3MR7A 4KLDA 2N78A 1SDFA 2AU0A 1DLOA 4P73A 4ME3A 1UJ6A 4YCVA 3NRWA 2OEOA 4GVBA 4I6WA 1M90C 4LFCL 5E7OB 4ZLNA 2ZXHA 3NHHA 2E8NA 4ED8A 1VQPS 1YIJS 1X4BA 4HLBA 4B3RL 2Z2MA 2QGFB 2V94A 4IOBA 1H2VZ 3NK9A 4I7ZC 5FLMG 1EWIA 5J1NA 5L1MA 3FDTA 3D9BA 1CPZA 2CPYA 3F73A 2QA4S 5AE2A 2G1HA 2MPMA 1HWJA 3IP4B 3BBCA 1FFGB 3Q8RB 1I94L 3QGIA 1BDOA 4JI3F 1MROB 3GTQH 4TYBA 3EX7B 2G9HD 3VCDA 3ETOA 4A8SA 2HOIA 2E9RX 2B8PA 2JWNA 1FYCA 4LR7A 4RNFA 1HH2P 2K5VA 2CVRA 3S9WA 4FF3A 1EIFA 1HI1A 2VPWB 4Y6IA 4O5EA 5IYDG 5AKYA 4NXNL 2AQ1B 2LU2A 5A76A 3FSIA 3U02A 2E5SA 1TKZA 1PBUA 2OMLA 4NEYA 1S5LU 3PO3B 2PPBC 3V2UC 3V6JA 5KNIA 3G9CA 1NAQA 5GAGC 4ZVSB 4C8KA 3DOKA 4FDBA 2E1CA 3W5YA 1SMYC 2YNIA 4LFCJ 2E2JB 4PNYA 3HVAA 1NCVA 4BC9A 2HCFA 2JXMB 1YJVA 3TYTA 2DR7A 3NS7B 3RJIA 7ICGA 4YMMA 2FJ2A 2R3ZA 1WKJA 4B3RJ 1WG4A 2O67A 5ALSA 3AN1A 3NGSA 2WF9A 1F9PA 1CJKA 1EXNA 2CW0D 4QIWB 1EAYC 3ZNUA 2HRTA 1XMQL 2P9GA 2FMMA 2WVFA 3OR1B 3BYTB 5C44B 3R1HA 1JALA 3PDNA 1PTOB 4B9WA 3MTSA 1I94J 1K0SA 1N4LA 3CD6A 2XC9A 2CNLB 3EVOA 4GKJJ 3J81L 2HFSA 1WJJA 1VDVA 3FBEA 4OGQC 3EGNA 2IX0A 4DR3L 3OL7A 4Y2TA 4F4KA 4ZCLA 5KAKA 2EI5A 5EKKA 2M9KA 4CNZA 1HBUB 1TVRA 5CYUA 3KF6B 5LMUL 1T3OA 2YYZA 3Q8LA 4NLDA 3NWGA 1BCPB 5C3WA 5JJLA 3MPVA 3GJSB 3QT5A 2F0TA 2XSCA 3TA1A 4DAMA 2FHTA 1UFLA 4RZRA 3GE9A 4UB5A 3GG0A 2I8EA 2XMTA 4OX8A 3P5TL 2DR8A 1ASYA 1LWXA 4M5HA 6AT1B 3GR1A 1V3SA 4DK1A 4WP8A 2UU9Q 1PH5A 4PABA 3CDUA 1B4FA 1Y8PB 2AWOA 2QLFB 4WJWA 2XI2A 4NLPA 3K5OA 2I6WA 3CJ2A 1IKYB 2VKZG 4P71A 4K8IA 1N88A 2ZEJA 5GADC 3DWAA 1F5BA 3QU4A 3I73A 3KJOA 2MKYA 5A8RB 2GVZB 5D4BA 4KN7A 1QAXA 4M5IA 4WJBA 5CR0A 1XMQJ 3PG9A 4LSZB 5D3DA 5CV4A 4ECSA 2R7ZG 4CLFA 4H4MB 1ZTTA 2FLLA 4OI4A 2EWHA 2PZTA 5D0EA 4QJFB 1LWEA 5GVQA 1WI5A 4EO6A 1VS0A 2CPHA 4F02A 2H3ZA 3RAXA 1OQ3A 4F5PA 4F87A 3JQMA 4H0LC 1N36Q 3I90A 5KT3A 4OL7A 4Q0BA 5KFIA 1HNWL 2CQ2A 1QJOA 1F9QA 1GJXA 1HTPA 4A3JB 4B3SF 3N97B 5LMUJ 4NY8A 2PQAA 4JBKA 1IBMQ 4MF8A 3UDXA 5ELEA 3BPDA 2VNUD 4QIEA 3QYYA 4A3EG 2N3OA 1ZH5A 2Z2YB 2H4WB 1QM9A 5I6WA 3F2DA 2VUMH 4DV1L 3CVKA 1G291 4L5RC 4R8UA 3AQOA 5T7LA 3MR2A 1S1XA 2GS8A 1V3RA 2CPJA 1Y1WB 4ED7A 4G1QA 2FI1A 7ICJA 1STEA 4CI0B 2FJAB 3CT9A 4X4VA 3KKFA 1KP6A 1MI2A 2IHMA 4USWA 2EYFA 1YJRA 2BV3A 3IM9A 5DLGA 4JI0Q 5DB7A 4JK1C 1UWBB 4U68A 1LW0A 4KN4A 4X65Q 2WZ1A 3A55A 4ICAA 2ZFHA 4RBTA 5BOMA 3BGOP 5T1GA 5AK3A 1ZAWA 2PI2E 4DV3Q 4NLBA 4DR6F 4M8LA 9ICKA 4V190 1T03B 1ZQCA 2EK1A 1LK7A 1MN8A 1UKUA 1MMLA 2DRDA 1DOQA 3KKAC 1SR3A 4DL7A 4A3KH 1UE6A 5K9FA 5KT7A 5DDYA 2GZOA 2Y9UA 4RU9A 1WOSA 1YHQS 2X3GA 5H9EK 2DO4A 4A3MH 4I1TA 4UW2A 2UXBF 3DRSB 4TKOB 1HNWJ 4B3MJ 4KGXB 1LV9A 4URSA 1OXTA 3P7JA 5ALNA 5KFTA 3T16A 1ZQQA 3BDOA 2CH4A 4TU8A 2KKPA 1JWSD 3CO0P 3TJ8A 3S1TA 3AXKA 1K9MT 1CC8A 3KJPA 4R0JA 1RDFA 1ZBTA 4I56A 4CIOA 4IUUA 5T41A 1WD0A 5LMNF 3RB3A 1W2BR 4I7FA 5DDRC 4KD3A 1GTHA 3MXHP 4A3BB 2HURA 1S77D 3CMQA 5JTIA 3QR8A 2D2CC 4X2BA 4DFAA 2HBRB 4CDEC 1UWAA 1D09B 5JJBA 4LMQD 3TZWA 2B2TA 3QGGA 1T9YA 2ZM6J 3K7UC 1ITPA 1R8CA 4HR2A 1N52B 4QZAA 4ILWA 3MXPA 2JZ5A 4IN3A 4DV2L 2XGQA 3NGDA 2ALZA 5IIKA 4EQOA 3JAMi 3HOZH 1VQLS 3K0JA 5A2QU 3DLBA 1IYVA 5M5YB 1Z9FA 1SEBD 2HYIB 3RG6A 2G06A 2K5HA 3I96A 2OPQA 5KOXA 2LQBA 2YNFB 3H5YA 1OYDA 2B56A 3GIMA 4DV4J 2QB1A 5EE9A 1CSJA 2L1BA 2MJ8A 2FVRA 2BCRA 2K4PA 3AY0A 1KDHA 2ESEA 4WKRA 4Y2IA 2ZUCA 3EWGA 2KCMA 1L3TA 3W65A 1I3QH 2E8MA 4K4XA 1F9EB 2E1PA 1S8OA 3NS1A 4QWCA 4HYKA 3DGPB 1A6SA 4ZKCB 5B0EA 2YKNB 2V2QA 1YEZA 2YB4A 2W4CA 2CCZA 3TVKA 2M7SA 4MN3A 2UUCF 4JB3A 4GLXA 5KFRA 5HANA 3BS7A 3NVWA 3KK2A 3A8IE 4U6PA 2UXCQ 5AKZA 1Q82T 3Q2TC 4QF4A 1A63A 2VG7A 4PG7A 3KK1B 5D3GA 3D3RA 5KL1B 4B3OB 1GEHA 3OL9A 4AYBC 4A3DG 4F67A 3NXWA 2BE9B 4DJBA 2BJDA 4ZP9A 3MM7B 5ETTA 3J81U 3CCZA 3H4BA 2C3UA 3GDEA 4RPZA 4P4MA 2NXCA 3DLGB 2R4FA 1VQKA 3PUXA 5GAEI 2PKEA 4CT9A 4DFDA 2EPIA 1RZTA 4JI3L 5KFWA 2K60A 4YMNA 1N5VA 3ONQA 1F5SA 1UJ4A 1SIWB 3FAHA 1RE1B 5J0SA 4WZMA 1VQ6A 2NWGA 3ETMA 1HD0A 1RAEB 4P0QB 5I4DA 4KMUC 3RLFA 5KFEA 2VFTA 2CZ9A 1YI2S 4O3OA 4QZIA 1AYEA 5ELNA 7FDRA 3C6UB 4DV5J 1T7PA 5DB8A 3OJUA 4OZJA 3RUZA 4C1NK 1MU2A 4FXWA 2CJXB 4KY6A 4C8YA 4R25A 1FVQA 5C3EG 2B0GA 2KE7A 1L3SA 3F44A 3TZDA 1CKNA 2JX2A 1UEAB 2XMKA 3D68A 4NB3A 3PR5B 1U4MA 4YVZA 3DU5A 5LSRA 3JPQA 4DR5Q 3MCMA 4WWSA 1YJ7A 2PIIA 2P6UA 2IDEA 4CTAB 2QLWA 2A5HA 1N6QA 1SH0A 3ZC4A 2HBYB 4DLEA 2QL5B 3F5AA 4DR4F 2EXUA 3VF0B 4IOCQ 5L1IA 3D1OA 2J9CA 1FRIA 4FXVA 5KFDA 2CPXA 3MXUA 4J9LA 3I4MB 3U50C 3RR7A 1OXJA 3F2UA 2NO5A 1XNRF 3OPKA 1M5SA 2VV5A 3I0SB 5IV4A 3HLUA 5D77A 1AZSB 2YTCA 1RYRA 3J80L 8ICZA 2O5DA 2EIFA 4TY9A 2A6EC 4IPGA 2A6HD 2X51A 4FVMA 4Y2AA 5J1EA 3HHNB 4O4GB 1Y00A 4X3TA 3C6TB 2XGPA 2P6TA 1ZZFA 2KEEA 4KYZA 3FZBA 2P5VA 5AHXA 4I2CA 4A8OA 4HCSA 2YWFA 1RISA 4OO1I 1DFDA 1HBNB 4ED0A 3KHRA 5F3TA 2Y8WA 5A8KA 3CJQA 1I5FA 2BKEA 1H9RA 4HH0A 4OHZA 1F9HA 1BD6A 4L74A 1QE1B 3N01A 1ET6A 5FO8B 1B3AA 5EE0A 2LXJA 2VC0A 4RHRA 2J5AA 2WVEA 4LF4Q 5AKXA 4A93H 5EJWA 3KBBA 1JIHA 5HVGA 4APVA 2C1EB 1AFIA 2K5WA 2CJYB 4KQZA 2DGVA 3MMBB 4DV7Q 4KR0B 2DGXA 2RRNA 8ICXA 2IJRA 1S9GA 2KHCA 4BY7H 4PWUA 1NH8A 4OYXA 3AU7A 2IIHA 3WK9A 1JKHB 3G6EA 4DO9A 1TL3A 2E1RA 2FMPA 3LWEA 3NWSA 2YMQA 2DKZA 3AQFA 2LYVA 2IRYA 2LQ5A 4H4OA 4I2EA 4I2HA 2WVCA 2JGAA 3VYUA 3C1ZA 3KUEA 1UZDA 3FKIH 2HFZA 5KFNA 4B3SL 3UCZP 4KLEA 4A3IH 4LMZA 1DGJA 5J0XA 4K5VA 1NXIA 2M0GB 2D8CA 1RT7B 2G07A 1VQ5S 5DLQE 3VA7A 2HK3A 5AKIA 4UAWA 1PZID 1KEKA 5T14A 1ZAXA 1P9QC 1RTDB 4KV6A 2LYHA 2IVYA 4JI1F 4BY1H 2J76E 3BZKA 2JA8H 2DNCA 1N32Q 4O4RA 5JPNC 4OV6A 3G96A 4ZP6A 1U1KA 2DY1A 3C1FA 2DXFA 2YWEA 4OI3A 3V96A 1RT2B 5FDLA 3D66A 3GIIA 2AJQA 5FLXL 4R8NA 4POFA 2FJBB 2VF3A 3SGIA 4CLPA 4K4YA 1T8EA 1RA7A 3BGRB 2R7FA 3LVVA 1CJVA 2O2LD 2WFWA 3PO2B 1COOA 4NL9C 3MXNB 3LQVA 4QUCA 4WXWA 4QR2A 2W4DA 2F1IA 4XQNA 3BGUA 5AT1B 5D0GA 5B0AA 4LFBF 2E9TA 3IN5A 2WTFA 1S1UA 2I1QA 3HOWG 4J9NA 1KQGB 2UXBL 1WTBA 1PZKD 1B7FA 2LDYA 4OZ3A 5FLMH 3CNQP 1WSRA 1ZQSA 2RDIA 5KAIU 5M2RA 1N54B 4PG5A 1V9OA 3HSZA 1FDNA 1IQTA 8ICFA 2GQ2A 3G6YA 1B22A 2VD3A 2A1JB 3DMJB 2NVTB 3D2SA 3IM8A 2VS1A 1CJTB 1WTHA 2F0JA 3PHTA 1X65A 4KH0B 3ILIA 2F9DA 3GG1A 5LMNL 2Q66A 1IQZA 4QIWE 2I9SA 1TFRA 2MKKA 3UMGA 7ICRA 4QYZJ 1G7CB 2R7RA 1K5OA 3WOFA 3ZZRA 1BPDA 4JI5J 4USIA 3D0HE 1NNLA 2X3DA 2NSCA 3KLGB 2ZKTA 5ALGA 1XQIA 2FINB 2BVZA 1DYQA 1SYBA 4NE9C 3K0YA 3ZZOA 2ZHOA 5AJ3Q 3B9JA 1MC8A 4PG4A 3HKSA 3WDNA 1JLFA 4NLYA 3W8PA 3S15H 2CQHA 3CMEA 5J2GA 4DLGA 3V5RA 3KJVB 3KK3B 2XLKA 2CW0C 2OTLS 2GIQA 3W7BA 1EQTA 3TX0A 4KLHA 2HWIA 2VZ9A 4EBCA 4X3SA 3D0GE 1TU0B 2PMZF 1U25A 1R4PB 2PFOA 1YNNC 3M8PB 2CN1A 1C1CA 4PWWA 2UXBJ 3DOLB 4LVNP 4DL6A 4JOIC 3MFGA 2HNYA 2PZUA 1KTQA 3J7AV 2DHHA 3HHLB 4EGVA 3M4PA 3IP0A 4NZ6A 2IAJB 5M3MB 4B3TQ 2W03A 3S16H 1B9MA 3P45B 1NLKL 2G08A 3IWNC 5I3QA 2ZE2B 4A4IA 2FPHX 4Y2MA 5LMNJ 2R7OA 5I2YA 4JI7F 2DO0A 2R7SA 2WW8A 4NV0A 2G2YA 4RQ4A 3DDNA 2H3QA 2R18A 4FBTA 1VCTA 1GMUA 3CWJA 4MAKA 4KAIA 2UUCL 1GHJA 3PYGA 2DUYA 2H4YB 3QU9A 4NLUA 2R7WA 4IQZA 1HMVA 3LW5C 4NXMF 2OFGX 1XBWA 1R9TB 1NI3A 4O3NA 1EYDA 4HDGA 3RYLA 2ZD1B 4QIWD 3OQ2A 1PJ6A 3PSIA 3CMAS 3S7RA 5J2NB 2CQ1A 4OIKA 2ZIUA 4OEMB 3HHKA 4J03A 3V6DB 1PXUA 4A3FG 1YLXA 3PX6A 3EYZA 2NTTA 2K3IA 4IFDJ 4AXIA 3AFQA 3CF5A 3LALA 1PILA 5LL6S 1G1XA 3O1LA 2BKPA 1R3NA 4DSIA 2C2EA 1X3PA 1TY0A 3GFYA 1WD6A 4ZVUB 4HJ9A 2VOPA 2ZBIA 2DR6A 4LREA 5F8LA 3DDKA 4DPWA 4L63B 4LF8J 1ZXTA 2R7ZH 4E2FB 3UMBA 3RGIA 3UQ0A 3U58A 2K8CB 3UR0A 3W9HA 1F3VA 4DXLA 1NK7A 4EUVA 3HJFA 1MD2D 5LSLA 3M8SA 1JWUD 2WIIB 4KGKA 2Q2IA 5A0LA 2NYVA 1GUNA 3OTOQ 1ZJMA 4NCAA 1OY6A 4DS5A 3D3BJ 1RTHB 2B9EA 1QUQA 2OXOA 2BANB 2F8EX 5J2PB 3IS9A 4A3EH 4WFNQ 2VIHA 2PT0A 4A46A 2H5XA 4Y65A 3UDLA 3D28A 3ELHA 5B0FA 1XNSA 4JI6Q 3HOYB 5KG1A 1KC8C 1U5KA 2M9VA 1IBLF 2C2RA 1FFSB 4KJOA 3I4LA 5EGYA 4LF7F 4YCUA 3J81c 1NPKA 4DR4L 3I2ZA 5IWAF 3L9AX 2HGLA 3T53B 1B43A 1QH9A 2CXEA 9ICIA 4XO0A 1TWGH 1MJEA 2VKQA 3EMTA 3H25A 4XPCA 2BJ1A 1XNRL 4ACOA 4C3IG 1KFSA 4P6QA 3CCES 3I55A 4CO5A 2X1AA 4UF4A 4IRCA 3CYMA 3ZZZA 3WK8A 3M2VB 4O2DA 3KHGA 3MPWA 1Q1BA 2H51B 4F0MA 3DI6A 3DM2B 2Q8TA 1HCZA 5C24B 1AW7A 1JOQA 4XDCA 4CYUB 3FMWA 3LP2B 2DNPA 4MYTA 3G71A 2QLXA 5A6WA 1NZAA 1PVQA 4DL2A 3ED5A 2RU9A 3OR1A 2VPZB 5HROB 1E7ZA 3CNHA 1HW9A 2AIRB 5K14A 4IJHA 2DNLA 3AD8C 4YD2A 4HHHA 1RHQB 1WCMG 2V2VA 3URYA 2QYGA 4M0AA 2MQOA 5HK4A 1K47A 3CCQS 2A18A 1QNUA 1VQGA 2R9LA 1XWEA 3CE8A 1S5DD 2ODGA 4J37A 2RUGA 3BGLA 5IP9G 4GN5A 2F3NA 2X1FA 1CKOA 2QLBB 1Y5IB 5DQIA 5AKEA 2XY7A 1SV5B 4ETXA 5K8NA 4YFUA 5E33A 1XS9D 1SKRA 4Y7NH 5DZ6A 4ZVRB 2V50A 5DG8A 1O7YA 4EX6A 2K7JA 3H91A 2WRMA 9ICEA 3TJAA 2ZIWA 1VQ8A 3GFKB 3RH6A 5ELBA 1WC1A 2W7PA 1BHNA 3C21A 2B2VA 3J81j 3EE3A 2OTJS 3TVYA 4YS2A 3IC1A 1ENCA 2ZTCA 4KLOA 2IL8A 3IAM9 1KFTA 4JPBW 5KFSA 1CG2A 1I51B 2ZHAA 1YITA 4KH1B 4EX7A 1VJQA 2IHEA 4GO7X 3KOOA 1VQOS 1PYOB 2RF2B 4TLQA 2MSSA 1NK0A 2JH7A 2CQ4A 4JYAJ 4H4MA 1SV0A 4Q8FA 1SQGA 2IYGA 2BBEA 4RKBA 3NAHA 7ICPA 3PUZA 1HL6A 3ZZPA 1Y10A 1L5UA 1NJWA 1N0VC 4OHVA 3SXLA 5BYRA 3TQ1A 4AIMA 2KNJA 3U4VA 2A73B 4OJ6A 4F4XA 2HBZB 3I4NB 3I7FA 2PFPA 3VV2B 2RS2A 1NKEA 5AM4A 1EKRA 2N82B 4IZ8A 5E3RA 4C8NA 1CJUB 2DNKA 1IR1A 1D5XC 8AT1B 4JI1L 1Y1VG 1OW5A 4AXJA 1FWPA 1DQAA 4DUZQ 3J80E 4EGLA 3QIPB 1RHKB 1D1UA 1WVLA 3GPAA 2PA3A 2Y0SE 2WSFC 4TUQA 2P6SA 2IOFA 3D0FA 1A3UA 3UN2A 3ULPA 1ESFA 3WX8A 1DBDA 4DFMA 1DTQB 1KAAA 4PXDA 1FDBA 1DAXA 4DSJA 2YNGA 5EHHA 2QSWA 2PMZB 4P74A 4Y34A 4CRJA 2ZNZA 3I9ZA 2M0NA 4OELB 2D0PA 1IG6A 1CRXA 4LFBL 4DN9A 1X5OA 2F2AB 2JA7B 2B8QA 5HI7A 2K2PA 3UDIA 1RQLA 2WONA 1FFUA 1UWBA 1GO3F 3TREA 4A3DH 3RU0A 5EE3A 3ZD8A 1HPZB 4G7ZC 4ZN3A 3K75D 3GV3A 3MM8B 4F4YA 2ATWA 2C5CA 1VF5C 3HD2A 3SSRA 5EWEA 1QB5D 1CBKA 2H3VA 1YBAA 2HFOA 3NBPA 1TVXA 3QE9Y 4NYZA 2GQQA 3OFGA 3TR5A 1C48A 4RW6B 4WJ4A 1OY8A 2MDAA 5B5EU 4LFAF 4N8NA 2OT2A 2AWNA 4ERDA 1IWAA 4AE5A 2P9CA 9ICLA 1BWVA 3M1VA 1D8LA 1VQYA 2B8GA 1HZCA 1JLBB 3HFKA 2BHNA 3KNAA 2J7WA 3MPDA 1FE0A 3T41A 3PEJA 4LQ3A 1IXRA 1LWCA 1ZEQX 1TKTB 1AQ6A 3WK4A 2A3VA 3LPYA 3OSNA 2HVEA 5CV5A 3EDRB 1N62A 3E51A 4QU7A 1S76D 2KDOA 2ZVSA 3MZIA 1RAGB 1BPYA 1X4EA 3TADA 4UTGA 4KLTA 2LKZA 2HVHA 3RFAA 4C11B 1VRUA 1U1OA 4MF2A 3CC2A 3QEAZ 1HYSB 4DSKA 5C3EH 1RG6A 2P35A 2LPEA 1TY2A 2A68D 2XI3A 4BWGB 4Y2XA 2KSOA 2V4QA 1B3TA 2BE2B 1SL2A 1Z00A 2W2QP 1JLEB 5KNCA 1A2TA 4OZNA 1T5EA 1REGX 4LFBJ 4DXGA 1S6QB 3MHYA 1QG7A 4CZCA 3I4OA 3CRKC 2IRUA 2Y0SD 5IINA 2GO9A 2YMPA 5KFKA 4J8QA 3CC7A 4V1Ak 2O5IC 1I6HB 3CPWR 1JE5A 5HR7A 1HHTP 1FO4A 4O9MA 5E3PA 5ALPA 1O78A 5ALDA 2WOMA 2ZUBA 4MHVA 3DLEB 1HW8A 3M7GA 5D3IB 5FLXE 5CJ7A 4YXMA 4UOGA 4YG2A 3V4IB 4FS2A 9ICRA 3OLBA 5J1PA 5HNKA 2IBKA 1KVJA 3GIRA 1E6VB 4JI7L 3EWAA 2DNZA 4YD1A 2OI2A 1DTTA 3QU5A 2CQPA 4O3QA 1Y0HA 4QWAA 2OGUA 1HFEL 2JA6B 3KMSA 3V6HA 2BMBA 4OYOA 4BBYA 4CDGA 1P1LA 1X6IA 2FVQA 3FMCA 1NBWA 2EOTA 1Y5LB 4X4SA 3AQQA 1RT5A 2RAQA 3QGHA 4NXML 3FRYA 3N0VA 2V2ZA 2VBZA 2HQCA 2V34A 1NZPA 4ICLB 2R8JA 2R3VA 1Z2ZA 1TMJA 2C3MA 3OPXA 3OVSA 3CC4S 3PX0A 3DGPA 1MWZA 3FKBA 4GNXC 4CH1A 1PAUB 4JV5L 3ZTPA 3RAMA 4KHZA 7ICQA 1PC5A 3AU6A 2BE5D 2R93G 4X64Q 2N8NA 2OUGA 4MMOA 4A3FB 4XT1B 4OHXA 2F7VA 4R8IA 1BO0A 2HVDA 5TISU 1WF2A 1H7WA 2KT3A 1GD7A 2MYFA 1IBMJ 1UCVA 1RKIA 1J97A 1J9OA 3AD7C 3UPQA 4YN4A 2FUG9 4OYIA 5I42B 2E2DC 3MMCA 2E2HH 2JH1A 2VB6A 4J9KA 2F63A 1BUXA 3MEDA 2HGNA 4JI7J 3IBCB 4I68A 5BN3A 3M8QB 4UB8U 4X62Q 3SQGB 4DPXA 1T05A 3T1YF 2XS5A 5G5GA 2WB1G 4OWWB 2YH1A 4ZITA 2B4OA 4JI0J 3CCWA 5AI9A 1DXMA 2E44A 3VHQA 3CJKB 2R7TA 2KFNA 4K5WA 4ZPVR 3ILJA 4DV6F 4YR0A 1XMOQ 2LXFA 1CTMA 4FPIA 5FO7B 1KQKA 2ASDA 1IBLL 2BJEA 2HZAA 4LF7L 4KO0A 3C6UA 3LO3A 2HVIA 1NTGA 3J80c 1YNJD 3OHBA 5IWAL 4DX6A 4JV5J 1N34Q 3C46A 2H1EA 1O0PA 3ZDDA 1SFOH 2BPFA 2PW5A 4OYPA 2HG4A 2D9PA 4ZJLA 2QARA 1PHJA 1SH3A 3DYAA 4KHPF 4O3SA 3KOAA 2AZ3A 3W9IA 3AAWB 1Y7PA 1E0BA 4C3IB 2B51A 4HN7A 3S8SA 1J2MA 3T9NA 2IC3B 4DQIA 2QV6A 2VB3X 3CIMA 2MGZA 1ENAA 1QD1A 5IGCA 1KR4A 1TMMA 3BN7A 3PYEA 3BSAA 1TWHB 3N6LA 4ECTA 4GOPC 1EOTA 2IPKD 4N5SA 3HOWH 2UUAF 1Q95G 2DR5A 3J7AN 4XK8C 3OXGA 3HKZC 3QYPA 4ZIVA 5HR6A 3CXCA 4CKEA 1RB0A 3HM9A 2VC1A 2MNAA 1F44A 5FJ8G 3KF8B 3AJDA 1UVIA 5CD4H 3C6TA 3ZFVA 3S1QH 2AW0A 2RCFA 1IBLJ 1CM9A 3TVZA 3NTKA 1VMCA 3NS5A 1HNVA 3HJVA 4AYBF 1BQNB 1FVSA 4UB6U 2J6SA 1SJED 4UB2A 4IO1A 5CHGA 2UVUA 5KT6A 3LUYA 4NA3A 2FHJA 1TK0A 2FPMA 3H20A 3M32A 4R5PA 4BHQA 1WYGA 5E2QA 1PYTA 4ED4A 3WIVA 5KL8B 1VCIA 3R27A 1ZQLA 2RRBA 2OEMA 1ZOLA 1F9RA 4QR1A 4LF9J 5C5JA 4RQ5A 2P6RA 2KN7A 2F77X 2M88A 4QQBA 3T1HF 5ALUA 1I4GA 1MQ3A 2K1RA 3LF0A 1IBKF 1GHKA 3BDLA 4I29A 1K9MC 3BSCA 1JKHA 1NNDA 1BMQB 1KQSA 1NMGA 1XNQQ 1EL0A 3PIOQ 2PEBA 2JQOA 4TXSA 3BKUA 3R5CA 4ZKAA 4GKKQ 3FQLA 2JL9A 8ICOA 2O6KA 4NMZA 4LVSA 1VQ4S 4F0HA 4H4KC 2L55A 4ZN1A 4K4GA 4I2IA 2WB1C 2ZHBA 3R5GA 5ETNA 2IHR1 1NHUA 2GNKA 2GA7A 1HUNA 3N5BA 1VJWA 2PW7A 4XXEA 1X31C 2XO7A 3LDAA 5J0QA 4IKAA 3F2CA 1RT7A 2W2OP 3N9UC 3H8MA 4FF1A 1ZM9A 5J0TA 5C42A 4LRBA 4OI6A 3FCHA 5CAAA 1EP4B 2VOOA 3K7RA 3LGMA 3QPIA 1Q8LA 3DU6A 2KZ3A 1U47A 1UUPA 1RTDA 1KD1C 2OQ0A 5EQ0A 3EIVA 2Q6CA 2QSFA 3PZPA 1DOKA 3BVGA 2U1AA 3WBZA 3HHLD 1X54A 2JC1A 2SNMA 4DV0F 4IUPA 2IHFA 2K7VA 2ASJA 4KKOB 4DOBA 3CULA 1CULB 1ZQFA 1B0PA 4MTKA 2NYZD 3BGRA 1MWYA 5HLFB 4F8RA 4IR9A 5JUMA 1N5YB 4EBDA 3NRZA 3FJ2A 1PUZA 5EX0A 3EJMA 4HTHA 1E22A 1ILPA 5CV6A 3ORYA 1SNCA 2EDGA 1L0WA 4LVOP 2FJVA 3EUB2 4PWDB 2LXUA 2XMVA 5CA7A 2A19A 1Q8KA 3S15B 3UQ2A 1VQ7S 1KAWA 4DR5J 1NJYA 3CDEA 2LHTA 3JSMB 2JNJA 3GFHA 1W26A 5I3UB 4K4VA 4HKQA 3TEGA 4Z2XA 1UVNA 2X1BA 3J7A5 3HW8A 2DGZA 1VC6A 1RI7A 4IDKA 3CHBD 3LVWA 2YPYA 3FFIA 1HHSA 2YQEA 2KEYA 4ILRA 1F5AA 3QT6A 2RLTA 2NRXA 1DOLA 2F8HA 3D67A 4K50A 3KLGA 2D3O1 3WKCA 4RGMA 3BKTA 4LBHA 1I6JA 4A47A 2XEXA 4HEA9 2WAQC 2EDUA 3NUQA 3TP8A 2PXIA 1O8BA 1EFWA 3JSBA 1J5EQ 2K8AA 4FE3A 2HNZA 2JA5B 4DUYF 1NJXA 2W24A 2PYKA 4ANEA 1JLGB 4FFDA 5JEAG 1G3OA 4TY8B 2CKZB 1KFDA 4BX9C 1B8AA 1WCLA 1FEEA 4DEZA 3HFVA 3S1NH 1NSPA 5C2CA 2YKOA 1WOOA 1YRUA 1Q7LB 4I27A 1EFID 4K5SA 3CP0A 1MBYA 3UD4P 3M8PA 1SPBP 3JPNA 3KNGA 3DOLA 3QNWB 1GNKA 4QOTA 3LOUA 5HY6A 3O0FA 4NL5A 5AXNA 4M6WA 4GLVB 3T51B 7ICKA 1PZJD 2WB4A 4IFVA 2XWJB 2E1MC 3TACB 3D8GA 3DXJC 4DV7J 2YKAA 4DR7J 3AB2B 3JPPA 2WACA 1EETB 2Q2TA 2IJFA 2HKEA 2IWHA 1EQQA 1X8DA 1WCMH 2KN4A 2RDHA 3PRDA 1XJVA 3GQBA 2MO1A 2HK2A 4NLNA 1CZGA 1L1OA 2DISA 1C2PA 3TN2A 1S1VB 3HILA 1VBZA 5FIIA 2OLWA 1JC7A 5EPLA 1A77A 4HIMA 3CCJS 2XTJP 1L7OA 2KICA 3NGRA 4GLAC 4IUFA 3E6ZX 2ZD1A 2F0VA 4KK7A 2L9DA 2ZJQA 2DL0A 3QJPA 1S6PA 2WINB 2F3WA 4USJC 4M5LA 1TKXA 1B53A 3A8KA 4USHA 4IOAQ 4KBIA 2ZG6A 5KG5A 4NYPA 5J2MB 5B08A 1WC5A 3B4DA 1D1KA 2W3RA 2OD6A 3T1YL 2HMXA 2C3YA 3PF5A 2EVZA 2MZ1A 3M6KA 4R63A 1TV6A 1RU2A 4M5DA 4LFCQ 4OCZA 4KV8A 3JAML 2WVDA 1S59A 2HW3A 2B63B 2W04A 4B3RQ 2J8AA 4ES3A 4ZUIA 4DV6L 5ELFA 4M5MA 1VQNA 2DBBA 1TIID 3EA6A 2KL8A 2PFQA 4AYBB 1AP0A 2Z58B 2F0KA 1HBMA 4C3LA 2DJGC 5ALRA 3BBBA 1ZQOA 1NNXA 5CORA 3C14A 2F03A 4KY7A 1Y1VH 2C3OA 5KIXA 1I94Q 4QWEA 4MIUA 2F0QA 2LFNA 2BANA 3K6OA 1LXJA 2FJXA 3NLCA 1L7PA 5G4DA 5IT9U 1RTJB 1HWKA 4KHPL 3JQJA 4DK0A 1YK9A 3IG1B 4ULLA 2MLYA 4J7CA 4CO2A 2E5IA 2B7CB 3TQYA 4RW7B 1SUQA 2LEAA 4PZ6A 3PXGa 2F0DA 1MMNA 1VI7A 5KFUA 5K5MA 5TZVA 4NXNQ 5KFXA 4DSFA 1DK3A 3CTRA 1U49A 2OF1A 3MM9A 4MEXA 1VQBA 4HSPA 4KN7C 2YVSA 3OW2A 4Y2PA 3RN2A 1KL9A 2QEJC 1FESA 3CCMS 2ADBA 5M5WH 3BZQA 2UU9F 3SQIA 8ICRA 2ZITA 5LSOA 2UUAL 3ZDAA 2L9HA 4G9BA 1Q53A 3B6YA 2VUGA 1EZ8A 2H3FA 3BGFA 5EKLA 4ATNA 4CLYA 5BN4A 9ICJA 3CF5Q 1BC6A 1KXLA 4X4QA 3M2VA 4MFAA 1DY3A 3NXZA 1ESRA 5JPMC 4Y00A 4AL6A 3M2UB 1QTNB 2IVFB 2OXPA 2V4JB 3WDOA 1UT5A 2MQNA 4OHWA 2R2SA 3TA0A 2A10A 1JI7A 3OVAA 3SFGA 3GILA 3UWTA 3I87A 3WKDA 4RPYA 2FC9A 1M0SA 2ERRA 2ZKUA 1EY7A 1OQ6A 4N7TA 2WF6A 2IFXA 4G6VB 1XMQQ 2G0JA 5GAHU 4BA1I 2A68C 2PZWA 1RA6A 2CNKB 4Y2SA 1DONA 2J7KA 2Z0SA 4KHPJ 1KKXA 2J0TD 4K4SA 4ZIWA 5CA5A 5KFVA 3KBXA 3LP1A 4M8AA 1QY7A 4DR3Q 2PDAA 4KN4C 4U8VA 1KLUD 1IW7D 1UVMA 4MK8A 2JN4A 2VBWA 4WKYA 5LMUQ 3HZEA 1X9MA 4B3TJ 2QT7A 1SJ4P 3O2IA 2BABA 3MEKA 2BQRA 2E76C 4R4IA 2RJZA 3FEWX 4YIJA 3T1HL 2SOBA 3DRRA 3SXHA 1EWCA 1IBKL 7ICVA 2BXJA 2NYHA 2IOFK 4Q2MA 2KJWA 3R8BA 5L9NA 5EWFA 2XY6A 2UUAJ 1TL1B 1Q3VA 3TRZA 3KDFA 4LUZA 3TI0A 2Z4HA 5CC4A 2B2YA 3KLIB 5GADU 4JI4F 2FFKB 4X65F 3H09A 3U26A 4PAAA 2Y1LB 5CV9A 4EWTA 1DOMA 4DV3F 3HF5A 2RF2A 1J2NA 2IRXA 3BS9A 2K5NA 3H2VE 4DI6A 1J5OB 5HMZA 4DSLA 2AUKA 5C4XB 3RRKA 1VQDA 2DGSA 4RGTA 2DVIA 1QVCA 1OSDA 4PL2A 2ZBQA 4DL0C 2JR5A 3FYHA 3IBFB 1Q90A 2CQIA 2AEJA 2CQGA 2UUTA 3PYDA 5C0XG 2BKNA 5DGBA 2BE5C 4RNMA 1SAPA 2W2NP 1I4QA 1VK3A 4DV0L 2B2TC 1HNWQ 2VH7A 4B3MQ 2DFLA 3R7NB 1O7IA 3T5KA 4ED1A 3KLHA 1H98A 5IS2A 4DFJA 2MJUA 3T1HJ 1R0AB 1IBKJ 2QGQA 2R93H 4TU9A 4E8UA 2GGPB 3C19A 1QJHA 2KT5A 3SK5A 3A56A 5A0YB 5KFPA 3KUPA 3D4DA 4Y2YA 2W9AA 3NG8A 2NVQH 2SNSA 1HWLA 2HHTA 1B9NA 4WIQA 2MRLA 1KTVA 3M05A 4K0KJ 1K8MA 2YY3A 1IVZA 3D4JA 1CEZA 1FO1A 4KGVB 1K44A 1IR2A 1VOMA 4Q0FA 2LEPA 1RBLA 3I5AA 3Q8SB 1S0VA 1J8IA 4US9A 2MP1A 1QLNA 4CKCA 3NAIA 3KLFB 2OP5A 2FZKB 3RN5A 2DQNB 4P52A 3QWNA 2XMJA 3RJEA 2AX0A 1W6JA 1X0FA 5GAEC 2CQ3A 2BE7D 1MNEA 3M30B 1RGVA 1YNJC 4Q8EA 2ATCB 4LSLA 3CCVS 2K14A 1FRKA 2LEBA 3RZOH 3CCEA 4HTJA 1U1QA 3M9MB 1JLBA 3V6KA 3PGZA 1WD1A 2KHJA 1JLCA 1E3PA 2MY7A 1ROFA 4RQ7A 4FYDA 5DNFA 5IYBG 1VDZA 4MH8A 4DUYL 3VR5A 3OWFA 2A1BA 1B64A 5KYIA 3OHXC 2XSJB 3NCQA 1U4PA 3AD9C 1RPLA 4ZLTF 3ENAA 1TS5A 3NCPA 5HBMA 3K5LA 1HHQA 3G8QA 4RKUC 2GAHC 4OZ0A 4QQBX 3SDEA 2R7UA 2KU7A 2BE2A 2C2ZB 1ZM4A 1II3A 1SNMA 1ZPWX 3AA9A 5CXTA 1SVDA 5D4PA 2UXCF 3S1RH 1XXGA 1LUZA 1XR6A 4N41A 3U9OA 4UB4A 1G8ZD 2XZWA 3MDAA 2Y9TA 2VB2X 2VY3A 1GO3E 4M1UB 3S2HH 1LW2A 4QW8A 5AXMA 1OJ4A 3CJ8A 3GTGH 2PFDA 3W2VB 3SENA 4DV2Q 1UHUA 3C3LA 2ZC3A 2A0FB 5LXRA 2XRQD 2LMIA 5BR8L 4CDDC 5D78A 1T9XA 5ALWA 5FJ8H 1SC4B 1Z4NA 5CBEE 4FYYB 3E0EA 3B0YA 1FRJA 3HOXG 1EQ0A 3H8JA 2YX8A 2XWYA 4X4PA 1PDQA 4A75A 4LBPA 3G8TA 3HOVG 3HO1A 1FK9B 2QE5A 2I5JB 4Z6EA 3BO4A 3ZJYC 4RMFA 4DHVA 3IMQJ 2JEIA 1D7QA 3VYTA 3K8VA 1UTAA 4DR1F 1B0XA 3QUCA 2FGOA 2Z1CA 1CK1A 3JTOA 3BO3A 3MMAB 3M6XA 2QMWA 3ETLA 2MA1A 2FYXA 3I0RB 1NB2A 4DV5Q 3EVWA 3SCLE 2QL9B 3GCWP 1PK3A 5ELDA 2DIVA 3MAAB 5K8PA 5HQLA 5AXKA 1HNZJ 1LKYB 3AXMA 2XIDA 1HR0F 2XNRA 3S17H 5AI8A 1RT4A 4OWXB 3Q86A 2ES6A 5EPJA 5GTHU 4IUQA 3VR1A 4JVZA 4JI2F 5AK5A 5AI6A 4F04B 1X6JA 4NRTA 1OSCA 4JOUA 2G5IB 1GUGA 3TARA 3AM9A 2F1HA 2QMUB 3RZDH 5F0UA 4RQ8A 4IQUA 2B9YA 3O6QA 4DDFA 2LY7A 1IYUA 2IYIA 4TU7A 3R9LA 5BR8J 3W5XA 1E2ZA 3F0NA 1X55A 2LSSA 5CYMA 1FJGF 4LUOA 1SJRA 3OTDA 2H5IB 2F8MA 3G82B 4JI3Q 4L6TB 1V3ZA 6FDRA 1M8AA 3N5FA 3CJKA 3Q24A 4OJLA 2VIXA 1S40A 7ICSA 2KQ3A 1AZPA 3MFYA 3OUYB 1ZYQA 1STBA 1ZQPA 1YVCA 4OI0A 1U2FA 3I91A 2JH3A 1JN3A 1U4LA 3ET6A 3LH2S 3PNIA 1FA0A 1MG7A 4H54A 1U02A 4OX9F 3FEZA 1FX4A 5JEAJ 4YY3F 1HUMA 4LZGA 5AI4A 3DXBA 4ID5A 2PSZA 3R7BB 1UEBA 3M85A 3F56A 3O3LA 2MUTA 3QO2A 3E01B 1OUQA 4OJPA 3CCRA 2DXDA 4O3RA 1PH2A 3H40A 1Q78A 4UPAA 1K83B 4LF4F 2Q1LA 1L7MA 4M94A 1U4RA 1SMXA 3R97A 2M2LA 3B78A 1XPOA 1VLYA 2NSBA 4X66F 2EQYA 4RT2A 2I38A 2KVCA 4FYXB 1IKVA 4ANDA 2CYYA 3SSQA 4UP8A 3K5PA 3FBBA 3K2YA 5ALHA 5EBDA 1QVFR 4DGZA 3UI3A 1YT3A 1SE4A 3VVTA 3UE2A 4FDFA 4FVCA 1LFWA 1JT8A 1NU4A 3T79A 3CGIA 4PQXA 3Q8QB 3SYZA 4JBCA 2XMMA 3KLWA 1NB7A 1MW7A 5DKWA 4C3HG 2CVIA 3UQSA 4IRKA 5HO4A 2YKMA 2QMXA 3O5TB 3IGNA 4P7TA 3CCLS 3MR5A 3K0XA 3JAME 4C8MA 2CJAA 1GKHA 2NBFA 4P2FA 1CKMA 2EJMA 1RKNA 2IA6A 4XTCS 4IS7A 1S4EA 5LXYA 1NZBA 3VQSA 3H3VH 2D1CA 2VFSA 2B8FA 4K2JA 4Z7CA 4ED3A 5GMKa 3NP5A 4RH6A 3PHEA 1PH3A 4C3JB 2PC6A 4YEAA 2NVXB 2IX1A 5C25A 2M3DA 3GJRB 1ECWA 1RHRB 4F71A 2AH5A 4N8OA 3RRGA 4OIJA 2EE1A 4ID6A 5JEAH 2K5QA 3NASA 1IKMA 1U8SA 4BXOB 3MWBA 5HP1B 4TLRA 4JI4L 5TSSA 1CQNA 5KNBA 3L7ZC 1LQ9A 1PYWD 1DRZA 1WHYA 1PIEA 2VG5B 4URGA 1VHFA 4ZPCA 4DV3L 4DWIA 3NNHA 2JEJA 1T9UA 4FXKC 1VFJA 1W25A 4DR2F 1LT5D 3D3CJ 1NUCA 5B7WA 4FN5A 1NSAA 3BB5A 4A3LG 4ZPBA 4NCGA 2CQDA 3LAMA 5ALIA 4NYOA 2QTWA 1HRJA 2MXYA 1GXDC 3I9V9 1KS2A 1T94A 5KFYA 1H9SB 1FTRA 2YTYA 3QLHA 2HHQA 2KENA 4YMOA 1AA1B 2BJ8A 2MAXA 4GFJA 4F92B 7ICTA 1S1TB 1DJ0A 1P27B 1U4BA 5GAHI 2LBOA 3PO3G 2EYHA 3ERQA 2BA1A 2LVWA 3TP2A 1NKBA 1BPZA 3BZDB 8ICUA 3DMUA 2HS4A 1RAIB 4KGMA 2ZOGA 2C9OA 1EP4A 2L08A 2K4IA 1I50H 4AYBE 5IT9Y 3GO5A 3GWCA 4X62J 3KHLA 1DARA 2FHJD 5KFAA 3JYTB 3V7JA 1F0XA 1EY5A 2W9MA 1M5KC 1WKLA 2B43A 4JI5Q 3VA5A 2XTIA 2CIMA 1QVGA 3W9JA 3IG5A 2EY1A 2NZ1D 4NW2A 5AJ3F 3GTJB 3DLLQ 3VGSA 4ZPTR 2DKOB 1KLMB 1LXNA 2EBGA 1R0CB 1V9PA 1ZQNA 3M2RB 1FNWA 3TEHB 1TWCH 2L5TA 5C44G 2JZBA 1S9EA 3OXLA 4NLVA 4PZOA 3GCXP 5GADI 1RDPD 2GO8A 1HZBA 1RQNA 1V1PA 1QUVA 4AD6A 2GMHA 2RQ4A 4Y2VA 4DCCA 1ZZNA 2K89A 1RL2A 1N60A 2JMGA 4DFKA 4KLMA 4PWDA 4DNTB 2JHEA 1W7WA 4NLCA 4F8MA 4EQ5A 4ETZA 4JV0A 2R7QA 1SBBB 3BG3A 2UXBQ 2AYGA 3RR8A 4J15A 3JSMA 2EZYA 2BX6A 4RW4B 4ZAIA 2XN9C 4CWBA 1MSHA 2QN6B 2MKSA 2AJ2A 4Z7YA 5M3FB 4PZNA 1IKWB 1HHVA 1YRTA 3OIQA 4R65A 4WTOB 1TAMA 5ALZA 2NPFA 1S4ZA 2K4EA 1WC0A 4ECZA 3NQIA 2RT3A 1AROP 1H0HB 3HHEA 5LMNQ 3GTOB 1UEKA 2EG1A 3EROA 5AK4A 2ROGA 3GFXA 2PEHA 2GVBA 3A8JA 1RBAA 1NAPA 3M3YH 3A3PB 1BWEA 3MFHA 2MPUA 1Q7YC 3UN5A 1KWMA 1JMSA 1ZS6A 4I2QB 1LV5A 1NK8A 2UXDF 2IHNA 3S2DH 4NX9A 3P96A 2UXCL 1L8OA 4HL9A 4OLOA 3EZ5A 1CLFA 3T56B 2JRSA 4XT3B 5D4NA 2KJ8A 4G3IA 1CC7A 1YJWS 1LTLA 1KC8T 3D1QA 2G5HB 2C2NA 2VZAA 5I9OA 2E2IB 2F1MA 1FX2A 2NXEA 3AJ2A 1JJ4A 3HOUH 1SKWA 4G1IA 4BS9A 4GS3A 4CE6A 2NYIA 5EWGA 3L4BC 2YTVA 2BRKA 3AOCA 1EQVA 4RU2A 1DZ5A 3N6MA 2L3MA 4UB3A 5KTQA 4NP5A 1XMBA 1M6YA 3KG0A 4OJ3A 3IRBA 2Q3PA 2VFUA 1NDKA 2CQCA 1HWUA 2VBXA 2NRWA 2ZXPA 2QA4G 1VBYA 5M5XH 1RT3B 1IW7C 5C0XJ 3C1YA 4LSNB 1PH1A 4DR1L 2EANA 2F0PA 4L8JA 4Q5VA 3L9ZA 4PRFA 3M8ZA 1A2UA 5E3CA 3SBMA 4DPYA 3CAMA 3MEHA 1S1VA 1XR5A 4RJVA 3LP0A 2Q8RE 1BBXC 2KJVA 3B82A 1AE2A 2E5LF 4LW1A 3E5SA 2XYHB 1HR0L 1S97A 1PAEX 2KG1A 2HHUA 3NGTA 1TK5A 2IY5B 3HULA 4JI2L 1S1WB 1S72A 4CO1A 2JXJA 1HIWA 3QWUA 2NVYB 1BPXA 2BDOA 4F4AA 2HGMA 4RX6A 4UOCA 5DDOC 1FKPA 4KKUA 1RTIB 1LYLA 5CEHA 2W3SA 3OD2A 3D31A 1ICEB 4UBCA 2XS2A 1TS4A 2EW9A 2PMHA 4GNXB 1RTZA 2YQ0A 3KLSA 4KKTA 1C20A 5H9EJ 1QAIA 2QX0A 3SK4A 3AUOA 2DR9A 1FJGL 3SMVA 2H1YA 4W92B 4P4OA 3NVYA 4AL7A 3CJ3A 1IV8A 5HHHA 2AQ0A 3GJTB 4RCOA 2WAQF 1S12A 1ED1A 1N5WA 4HIOA 3MGIA 1U45A 4XYQA 4WE1B 5AM3A 2W9BA 4OWTB 2KP7A 4NA1A 2HZVA 1KLNA 2YMMA 2BM0A 2ZTDA 3CJRA 3WOEA 2D3OR 1X4CA 4A3BG 1Q86T 4LR8A 5C0XH 1TKDA 2AXTU 3IFTA 4OX9L 3KJFB 3HRDD 4YY3L 5I2XA 2K4KA 3QOLA 2LQ9A 2Z57B 2DH9A 5IXUA 2BDNA 3IG1A 3GSIA 2B2VC 4YQWA 3L5KA 2B3TB 1WWVA 4LF4L 3LWLA 3SR1A 3QT8A 1JRPA 1ML0D 3G4SS 3ZZTA 2A3JA 4X66L 3WC2A 3H15A 1ASZA 2VANA 2R2RA 1SV0C 5J0RA 4DR4Q 3ENQA 3OW7A 2ZC4A 2HHSA 3PFEA 3FP9A 2Q0ZX 2J9DE 1D9DA 2ZTEA 2JDJA 1N48A 1XNRQ 2UV8G 3W62A 2KKVA 2ZZTA 1B7YB 2ROEA 3PW2A 5KFJA 2ZJPA 3E3XA 2FE9A 3OMCA 4EYHB 1AFJA 1IKLA 2ID0A 1HBOB 4PXCA 3CRXA 3TBIB 5K4LA 5AXLA 1YZ7A 1SN8A 3NVVA 2DNQA 3J7YW 2BDUA 4OX9J 2C2KB 2ACMA 5J1ZA 1JOKA 3KDNA 3K8WA 4QZFA 4GOPB 1R6VA 5J2IA 2KO1A 2BCOA 3DLHA 3U1NA 5DB6A 4O5CA 4O1NA 2UVRA 1BE4A 3D5MA 2L0CA 1X4AA 3HXMA 1E6YB 4KLFA 4HH1A 2KK0A 4NLSA 5LOQA 4YWMA 5CP2A 1V1QA 5KFOA 1W2BA 1BQQT 1YHBA 3IWLA 3TAMB 2A2CA 1M1KC 4X66J 4GMKA 3BEGB 1NZ8A 1YJ9A 3UDFA 1Q16B 4M5KA 2RQKA 4CLWA 4OJGA 3CQZH 4DR2L 2CPRA 1X9SA 3ITHB 1WOCA 2L12A 1RACB 1TK8A 2TSSA 4IALA 2ALYB 2QB0B 1FL0A 3SDZA 2AEFA 5JVH3 1TL1A 3LGNA 2R8HA 2P8IA 1XSLA 2Y0SG 1FD8A 1BVSA 3OR2A 3TRGA 2RCNA 3K7AB 3PRVA 2WV6D 4AQYJ 1XO0A 3QIAA 4USTA 4K2KA 4O44B 1O7ZA 2W8LA 1BXTA 5KG7A 2EYMA 3BVMA 2DHGA 2AP6A 4MFBB 2J0SD 1AE3A 3ONNA 1TL4A 3MHBA 4RGOS 2JEGA 2Z56B 2FPKA 4I2FA 3LWMA 2JEFA 5DBBA 3RRHA 1UVKA 3TADC 1HQUB 2HNDA 3NOCA 4WK3A 2Y0BB 2YU9H 5H1SE 3QOJA 4HI2A 2A6MA 2VQFF 3HOXH 1U1LA 3ZI4A 1WUDA 1V38A 3QNMA 9ICGA 3QO9B 3GTMH 3H59A 3KLEB 3MEGA 5JAVA 3VCBA 2BW7A 2G5DA 1RT6B 1EJ7L 1WELA 2MZJA 4JI1Q 3RB6A 2RU3A 3ZZYA 2JJQA 3A0BU 2ZVIA 3POTA 3ENWA 4KGZB 1ACMB 3S14B 2HOQA 3F41A 3G87A 1EWHA 2K03A 3BS1A 4KLGA 4DR2J 3I4MG 2G0CA 3V4MA 1JMCA 3H0GB 1G6PA 3UDCA 2GGPA 4QZGA 3HFZB 3WK6A 1OXXK 4GN4B 2EAMA 3CJSA 4LF6L 2AV5A 4IQWA 3IRUA 1UFKA 3QUBA 1YNND 3UXOA 3R5BA 5J2FA 4NI2A 4N77A 5BYQA 4QZHA 1Z47A 2FLOA 2HBJA 4LFBQ 1Q5VA 3D6HB 2E29A 4OYMA 3CD6S 1YTYA 4O3MA 3M7VA 5D4LA 2Y0SF 2F4VF 2K04A 5CYQB 1C0TB 1FWKA 4DPTA 4Y2UA 3MURP 4NXNJ 4F5NA 2FB0A 4LRDA 4OV1A 2J7ZA 1JXLA 2F8KA 3LX0A 4CLSA 4A3GB 1SNQA 1C0AA 5BOLA 1U1MA 4NLWA 4KD4A 3KOJA 2V69A 2BZFA 2FMCA 4WF9Q 3S1MH 4BBSB 1ZQZA 3D6FB 1G6ZA 2XB2D 2W9CA 3CIZA 1SKUB 4XYOA 3NNAA 1TV9A 3GYXB 3MECB 1L0YB 4P2CB 4ECYA 1CS4B 4JBWA 2QILA 4C2MH 1FKOA 3K17A 3MM5B 3F5EA 2UXDL 3JB9k 1TWFB 2CPIA 3C16A 2YWHA 2XBPA 4OYAA 1R27B 8ICPA 2XSJA 5I6YA 2K7KA 2XVTA 2DJFC 2FXQA 2L9WA 3LANA 4Z37A 3DRPB 2R61A 3IFEA 1YJUA 2F0WA 3LAKA 4UY85 3CD0A 3N7RC 5IE8A 2QIFA 4BC7A 3S6JA 2EFOA 4LF6J 4A3CG 5A35A 4F7XA 2HQGA 2N88A 1CHPD 4BWMA 4BUGA 4X64F 3W3AA 1NE3A 1PJ7A 4RPXA 2D3UA 1Y9OA 1DQ8A 5C0YA 3UW1A 4CP5A 4GC6A 4BBRB 2VW9A 3R3TA 5AM0A 5AM2A 4DG1A 9ICXA 3ZXWA 4DR3J 4GVBB 2WAQB 4ZOSA 2WSCC 5T1IA 3DEOA 4RA8A 1UFWA 1HNIA 1SCJB 2YBVA 2J9EA 4XQ8A 3K57A 4HHUA 3PW5A 1Y3JA 2KT2A 3H3VI 3W2VA 4FNHA 3CP8A 1BQMA 3WKAA 3WU2U 3R2TA 2B2WA 2WP8J 2V1CC 3BDPA 3O13A 5KG2A 4C3HH 1VQ9A 4JI7Q 5HQ8A 1LVHA 3AOBA 2HQ3A 1SNOA 2EKNA 1O51A 3D4RA 1ONLA 2E5LL 1T0TV 3FCWA