3CW2C

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
266
structure length
266
Chain Sequence
MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 63
structure length 266
sequence length 266
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00575 S1 S1 RNA binding domain
C PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3cw2C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cw2C01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3cw2C03
2BA1A 2K4KA 3PIPA 1WYDA 1BBWA 5FJ8G 2RF4A 1RIPA 4QJFA 4A3EH 3J80i 4X62L 4HIMA 1PH1A 3HOZH 4GOPA 4DV6L 4MZ9A 2NN6G 4PZ7A 3HOZG 1L1OA 3G4SA 2CKZB 1K9MC 2E8GA 4B3MQ 1IXRA 1OXVA 5M5WH 4BY1H 2HT1A 1NMGA 2PQAA 2K50A 1VQPA 2AKWB 1KQSA 4LF6L 4HIKA 3F2BA 2WAQE 5IYCG 1QVGA 2VUMH 5IYDH 1V1QA 1NE3A 4EX5A 4C2MH 1SE8A 3KJOA 1MJCA 1NBWA 3I55A 2E2IH 3CP0A 4JV5L 2KCMA 1HR0W 1XTDA 2IX0A 3K8AA 1WOCA 1A62A 1WCMH 3RLOA 1Y1VH 3FKIG 2RHSB 1TWGH 3CMAA 4DV0L 3VDYA 1XNRL 1PH3A 3Q8DA 1UWVA 4JI8Q 2KENA 3RLFA 1N34Q 3ER0A 1D8LA 4A3MG 3S2HH 1NTGA 3I4MH 5IYDG 1CKOA 5IYCH 4RG1A 1VQ9A 4LFBL 1YHBA 1M1KC 3TS2A 1L1OC 1TXYA 3JAMi 4BY1G 4GOPC 4BA1I 1IBLQ 4A4IA 1G6PA 3CCEA 3A5ZB 3HKSA 2BH8A 4GLVB 3I4MG 4LUOA 3EBEA 4DK3C 4JOIC 2ZJRA 3PCOB 4HJ9A 2YTYA 4NPSA 1XMOL 1CSPA 1WFQA 4H02A 4P74A 4POFA 3FKIH 4JI2Q 1CKNA 2NZOA 3T1HL 1PH7A 3IRBA 3KYHC 3J7A5 2LXKA 1IL2A 3CCMA 3CD6A 5J3BA 2ZTDA 3SGIA 1HNWL 2I5HA 3U4VA 1GD7A 3GO5A 2IT1A 2QA4A 4JI1Q 1Q1BA 1VQIA 2I5LX 2VUMG 1Q86C 3KF6A 1E1TA 1XMQL 2UXDL 4YWLA 2LXJA 2MNAA 2UU9Q 3KFUA 4OONA 1VQGA 3KDFA 3S1RH 2UUAQ 4IOCA 1P16A 2Q2HA 3OTOQ 5C0XI 2IHEA 4A3EG 3FP9A 4DAYB 1FJGQ 4YY3L 3HOXG 3ULLA 2F52A 4LF9Q 4DV2Q 4MNOA 5LMUL 4DV5Q 2NZHA 2CFMA 1U0LA 5C44H 4DR4L 4X6AH 2C35B 1LTLA 5M3MG 4WJ4A 3EN2A 2UUCQ 1VQ5A 4QL5A 3TQYA 4Y7NH 4HJ8A 4GKJQ 3A5UA 3H0GG 4LFBQ 4B3RQ 4YCVA 4KHPQ 1L2FA 3ULJA 1WCMG 4GKKQ 2R7DA 2UXBL 2QEXA 4HIDA 1I3QH 1YZ6A 2F3IA 4IPDA 1N32Q 3AFQA 3U4ZA 4A3CH 1JT8A 5IYBH 4R4QA 3W5OA 4DV7Q 3K0XA 2VZAA 1UE1A 2PNHA 3OTOL 3CAMA 1E22A 3CCUA 4HJ5A 4DR5Q 1N36Q 3CXCA 1VQ7A 4DR7L 1J5EQ 4DR3Q 3JAMc 4BXXG 1A63A 1CSQA 2WB1E 3FHWA 2FXQA 4JI1L 4P75A 3T1YQ 3HOVH 2K5VA 4LUVA 3OW2A 3GD7A 4JBKA 4UP8A 5BR8L 1T9HA 2XTIA 3E9HA 1Z9FA 1WJJA 4LF5L 5FJ8H 2YU9H 4DR6L 1C7YA 1PYBA 1QZHA 1Q82C 3RNUA 4JI3Q 3CW2C 1IBKQ 3LGJA 3S16H 2KHJA 3CCQA 1VCIA 1AH9A 1XNQQ 2RCNA 1CUKA 1X55A 1JJ2A 1K3RA 2CWPA 1GKHA 4R4TA 2Z0SA 1IBKL 2GVBA 3G48A 4YWKA 1I94Q 1NMFA 2F4VL 2JA8G 3CCRA 1K8AC 4A93G 2LSSA 1KRTA 5JEAJ 2UUCL 3ERSX 1YJ9A 2NVTH 2R93H 1ASYA 2A19A 1AE3A 3RN5A 5LMNQ 4NXNQ 3NEMA 1I94L 3HOYH 1J6QA 1PH9A 3J80c 4BBRG 4JBMA 3S14H 5K36G 3S1MH 4R1JA 3HOWH 3CC4A 1GO3E 3MXNB 1VQCA 1UE5A 1EYGA 4JI4L 5M5YH 4DUZQ 4GNXA 5GQOA 4B3SL 1EOVA 1VQ8A 2JA7G 1OTCA 2JEAI 1N8RC 4IFDG 2E5LL 4L5TA 2ALYB 2JJQA 4DR2L 1YITA 4LF7L 2VW9A 5C4XH 4OWXB 2VY3A 5FLMG 3CQZH 4DV1Q 1IBML 4A3KG 4JI0Q 4K0KL 4IFDJ 2JA6H 1TWAH 2I0QA 3BU2A 3L2PA 2V1CC 3H3VI 3S17H 1E3PA 1MKHA 1WI5A 2UXCQ 3U50C 3GTQH 3E0EA 3A0JA 3T1YL 1TWCH 4XIGS 3F2CA 1YIJA 1KXLA 2NVYH 1I6HH 2VS1A 3I4OA 1J5EL 4OX9Q 3W1GA 5C0XG 1B7YB 4JBJA 4P73A 4X62Q 1TWFH 3H15A 3ULPA 1CKMA 1HZBA 4LFCL 1B70B 4DR6Q 2KBNA 4IFDI 4JYAL 4X66Q 1PH4A 1PH2A 4LF4Q 4YY3Q 1E24A 2QGQA 4QGUA 4B3TL 2E2JH 4ME3A 4DV5L 1VQAA 2K75A 4DKAC 4DV4Q 1IZ6A 4QIWE 1A8VA 2GN5A 4FDBA 4JC0A 1IBLL 4LF5Q 2IX1A 4JG2A 4J15A 1QVCA 4JOIA 4YCWA 4A3GG 1E7ZA 1N9WA 1PYSB 2WP8J 1EIYB 4GKJL 3PF5A 4K0KQ 4DPGA 4LF8Q 4A3BH 5C3EG 2OQ0A 3PUWA 3I7FA 1HH2P 3M4OH 3TRZA 4YHHQ 5GADC 3JC66 2MO0A 3AYHB 2VQFQ 3L7ZC 5GROA 5JJLA 1JJCB 1YBYA 4LF9L 4JI6Q 1K0RA 4A3IG 4LFAL 4C3IH 3PIOA 3PO2G 3K7AH 3UDGA 1BKBA 3TREA 4DUYQ 4TQUS 2UUBL 1XPOA 1EQQA 4DR5L 4LUZA 1UE6A 1SROA 1EQRA 3A74A 1X3EA 2JEBI 4B3TQ 1VQMA 3CMEA 1XMOQ 4LFAQ 1JMCA 3DLLA 1EFWA 1OXUA 4A3LG 1P8LA 3L0OA 4OXPA 3WWVA 2UXBQ 2Q2IA 5M3FH 2KHIA 2N8NA 3D0FA 1S3OA 1X3FA 3PO3G 4A3DG 4NB3A 4DR1Q 3CPFA 4BY7H 1YEZA 3HOUH 1TWHH 1VQBA 3M4QA 1E1OA 4X65L 1YI2A 3I4NG 4BBSH 4LWCA 1NJIC 2OTLA 1B8AA 4DK6C 3K7UC 3G71A 4ALPA 4UP9A 1HZAA 5E7NA 2I5MX 3GTLH 1W2BA 5ELNA 5H1SE 2L15A 5DLQE 2E2HH 3PO3H 4A3DH 4JV5Q 4R4CA 4DR2Q 5M3FG 4A3JH 1Y1WH 4LF4L 5HY6A 4LF7Q 2OTJA 2Q2UA 2R92H 2UUBQ 1LUZA 3G6EA 4DV3Q 1Q46A 2WAQG 5GAGC 1PFSA 3GTOH 1SMXA 1YHAA 4IJLA 1W3SA 4OWTB 5EAYA 1PA6A 1DGSA 2ZTCA 1LYLA 1SRUA 2WB1G 4A3FH 5IY0A 4DV7L 4LF6Q 2JA9A 1UEBA 3CF5A 1X6OA 1C0AA 4PZ6A 4GLXA 1PVOA 1VQEA 2VQFL 4KI0A 1YZ7A 4GNXC 4A76A 2JQOA 2K5HA 2ATWA 3W1BA 3UDFA 2B63G 1HR0Q 4DR7Q 2QMUB 1PH5A 5IP7G 3M3YH 3M7NA 4PZ8A 2B3GA 2R92G 5IP9H 1D7QA 1G291 2JA5H 1YJNA 4A3BG 2B29A 4GN4B 4OWWB 3J81i 2PI2A 1I50H 3TEHB 2JA5G 2R7ZG 3PSIA 3CC7A 5IP7H 2AHOB 3TS0A 4JI7L 1K73C 4YWMA 1FGUA 4KHZA 4QY7A 4APVA 5HGQA 5LMUQ 1HZCA 5IWAQ 1VQJA 1CKNB 4BY7G 2Z6KA 4X65Q 5LMNW 4PMWA 1O7IA 4DR1L 1YHQA 4POGA 2NVXH 2Z6KC 5IE8A 3RN2A 2UUAL 4A3LH 3UE1A 1KL9A 3RR5A 2DGYA 1N34L 1VQHA 2ES2A 1GVPA 5M5XH 1X9NA 3S2DH 2DUDA 2H5XA 3KF8B 4XTCS 1K83H 3H3VH 3CCLA 4NXML 3NENA 3KOJA 2AWOA 3PO2H 5ELOA 5AJ3L 1MJEA 2HHHQ 1VQKA 1Y14B 4TVAB 4LF8L 3ZJYC 3ICEA 2AMCB 4GNXB 5C0XJ 4R4OA 3KDFB 2UU9L 3RZOH 4BBSG 3I4NH 1M90C 2ZJQA 2MQHA 3STBD 2R7ZH 4JI5L 4B3RL 3RLNA 2WFWA 4P71A 1Q7YC 1X65A 2EIFA 5IP9G 4BBRH 3CCSA 4DV6Q 2HIVA 1OXXK 3S1NH 1XJVA 1C9OA 2A1AA 1VQOA 2Y0SG 2YTXA 2B63H 1YNXA 3K81C 1GM5A 2OWOA 1QUQB 4OX9L 4DV2L 3I2ZA 4IOAA 2KCTA 1OXSC 4UY8C 4DR4Q 3NBHB 5GAHC 4R4IA 3BZCA 4KLKA 4IPHA 4DNIA 4A3FG 4YCUA 3STBC 3U58A 2PMZE 4JI7Q 4GOPB 1BVSA 3PUXA 3DM3A 3E9IA 2NN6I 4DV1L 4JI0L 2VL6A 4DR3L 1XPUA 4KHPL 1R9TH 3KLWA 2RHQB 2HIXA 3HKZE 4AIMA 4C3JH 1PV4A 2BH2A 2K5NA 4A3JG 1Y1WG 4AYBE 2HQLA 3S1QH 4LW1A 4DUYL 5C3EH 1IBMQ 3CC2A 4GLAC 1HNXQ 1PHJA 1EWIA 1KD1C 1KC8C 2CCZA 3J81c 2JK8A 1I5FA 1HR0L 1EIFA 1YVCA 2YYZA 1Q12A 3I56A 1ASZA 4A3GH 3CPWA 2N3SA 2ZTEA 2MFIA 1N36L 4JCVE 1VQDA 2OCEA 4C3HH 3AEVA 2N49A 3AFPA 2JA7H 3CCVA 3HOUG 4P72A 1Q8KA 2MO1A 2K52A 3KF6B 2F4VQ 4L5QA 4UP7A 3UDXA 4X64Q 1HNZL 2AWNA 4DAMA 2Y0SE 2PI2E 2UXCL 2R7FA 5IWAL 4IPGA 5JJKA 3KJPA 2VQEL 1JE5A 4B3ML 4GN5A 1VQNA 3S15H 3F1ZA 3D31A 1FJGL 1N33Q 4X64L 1L1OB 1IYJB 1XNQL 2JA8H 1Q1EA 4A3IH 1SR3A 4PG3A 4AQYL 1FL0A 1XNRQ 5FLMH 5C4XG 4EQ5A 3CCJA 5C4JH 4DUZL 1KIXA 3PUZA 5GAEC 4B3SQ 4AH6A 3PUVA 4IJHA 5M3MH 1SFOH 5JJIA 2OQKA 2D62A 3BZKA 4JI6L 1YJWA 5BR8Q 3HOWG 2EXDA 1FVIA 1VS0A 2GVAA 3UE0A 2HHHL 2N78A 1OXTA 4IPCA 2XGTA 3HKZG 4RMFA 3HOXH 4HIOA 4JI3L 3T1HQ 1JB7A 3HOYG 2R6GA 2A8VA 3RZDH 1HNWQ 1U5KA 1A0IA 4Y52H 4OO1G 2R93G 2D0OA 1QUQA 4A75A 3GTKH 3S24A 4LNQA 2YV5A 3GDEA 4DV3L 4JI4Q 3EIVA 4A93H 1XMQQ 1MIUA 1SN8A 2CQOA 2VQEQ 2UXDQ 5IT9c 1VQ6A 4YHHL 2VNUD 3GTJH 1SLJA 1JJGA 2EQSA 1QZGA 4X66L 1KHIA 2K14A 1G51A 1V9PA 2ASBA 4OO1I 5FLXc 1NY4A 4AQYQ 1Q81C 2ZJPA 3AQQA 5IYBG 3PV0A 1KAWA 2D0PA 4JI2L 4A3CG 4JBWA 2JE6I 3B6YA 1VQLA 1H95A 2IHFA 3BJUA 2NVQH 4IO9A 4JI5Q 3GTGH 1XPRA 3J7ZC 3GTMH 2JA6G 4A3KH 2CWAA 3H0GH 3QSYB 1BBUA 1HNZQ 3PGZA 4UPAA 4JYAQ 3HOVG 3HFZB 2E5LQ 3PUYA 4BXXH 3M9BA 1HJPA 5JEAG 2Q2TA 4NXMQ 4GS3A 5C44G 3GTPH 1S40A 5AJ3Q 1UE7A 4O2DA 2BA0A 1PH6A 1L0WA 3M4PA 1K8GA 4DV4L 3PF4A 4HJ7A 1X54A 3MEFA 3OYYA 4WJ3M 4DV0Q 1N32L 4NXNL 4L5RC 1LM0A 4JI8L 1V43A 4A3MH 4L5SA 3NELA 3F8TA 1VQ4A 3K80C 1X3GA 1X56A 2ZM6Q 5LMNL 4HJAA 1Z47A 4MTNA 1Y1VG 1VQFA 3J81j 1KRSA 3UDIA 4LFCQ 4QQBX 3M85A 1HNXL 3F2DA 1QVFA 2ID0A 1EUJA 1RL2A 1S72A 4AYBG 4BA2I 2IY5B 2QN6B 2ZM6L 1HZ9A 4GKKL 1N33L 2PQAB 2YTVA 1AE2A 1PH8A 4GN3B 4O0AA
chains in the Genus database with same CATH superfamily
1S1XA 2VF3A 3IR5B 3TI0A 2OFGX 2DH7A 4A48A 3PIPA 1BBWA 2JSXA 1XJWB 3MM5A 3J80i 3HOZH 2VV5A 3KKFA 3MAHA 4NWBA 3R6LB 2SXLA 3OR1A 1RXOB 3HCXA 4EK2A 3HOZG 3TVKA 4W4MA 1VMPA 5KFWA 5M2UA 2ZE2B 4BY1H 1S7IA 1X4CA 4PV1C 1A0PA 4U6PA 3M1VA 2WAQE 1QJOA 2QB0B 4ZPVR 1MJCA 5J39A 3I55A 4O3PA 2R3VA 1RAOA 2BDUA 4H13C 3BYPA 3QO9A 2DNHA 3OOCA 1N34Q 1FWLA 1VQ9A 2CWXA 5F3ZA 3MGHA 3JAMi 1MN8A 3VAFA 1Q16B 3HKSA 3C14A 3EBEA 3JPTA 3VGUA 1RP5A 1VC0A 3H0MB 2Q4TA 2AJ0A 4ZVFA 3T79A 3MHYA 4XYQA 1GD7A 2NYZD 4CP5A 2MDAA 1Q86C 1NK7A 3HD2A 5J0QA 2MMYA 2V68A 1QNUA 4E0DA 3O8WA 5CABA 3SCJE 2CDQA 2WHOA 4OI3A 4QUCA 1S6PA 3FP9A 1RLCL 2KJ9A 1ZQDA 3KF8A 1X60A 2HRUA 3MZIA 4ABNA 1PSDA 3BPSP 4IUFA 3S8SA 3EN2A 3S1RB 5C3EB 1VQ5A 3TQYA 4HJ8A 4GKJQ 1KS2A 4JP8A 3QRRA 2FVRA 3ZFVA 1GQEA 3L4BC 2NQPA 2KNJA 2G13A 3AFQA 1STGA 2QA2A 2H3IA 1X0PA 4AD6A 2X1FA 4M5DB 2J7WA 1BPXA 1DFDA 2VXWA 4HJ5A 3CXCA 4RHRA 1SH0A 4DR7L 4CH1A 4DPUA 1A63A 4I6AA 5HQ8A 2F44A 1EP4B 4P75A 1RF2D 1NR2A 1RT1B 2CZ9A 3P8BB 4DL4A 2VQFF 4FDFA 4US9A 1UEVA 3DGPA 2P6UA 3H5SA 4F36A 5BPCA 1NNXA 3FCHA 1IBMF 1IBKL 4BXOA 4M5HA 2NSBA 2XWBB 4ZPCA 5L1LA 4V19X 2B6GA 3LGNA 5G0RB 1ET9A 4JV1A 1PH9A 1TE2A 2WVCA 2QE5A 3S14H 9ICEA 2DJGC 3LA0A 5JXSA 2PFFB 2OH2A 1SV4A 2O5IC 2CQ3A 4DS5A 4IFDG 3R7SB 1EOVA 3T1AA 4F0KA 4E2FB 1TS3A 1U1RA 2BKEA 4OWXB 2XVTA 3CQZH 4IFDJ 4ZPDA 1NAPA 2I0QA 4NXMF 1BQMA 1E3PA 2YQ1A 3S01A 1TWCH 4P10A 4OYBA 3LWMA 3KUHA 2AJ2A 2KVSA 1VGYA 4LFCL 2Z7JA 1HTPA 4RFBA 2DGSA 4B3TL 2FJDB 3FZBA 1F9PA 5BR8J 5CWRA 4RU2A 4CBVA 3RH6A 3JQKA 3VF0B 3HI9A 3D2WA 1RWMB 2B56A 1E6YA 3PNCA 3H59A 1HNIA 3I0SA 4DF8A 4ZVHA 3OTOJ 5SUHA 4DUYF 3ELHA 3BBCA 3NXZA 2A68D 1RAHB 1FVQA 3V7JA 2B5JA 3AA8A 8ICIA 3GONA 3G7LA 4DR1J 1FJCA 1H9MA 2NO4A 1MWZA 3UXNA 4ECUA 2X3DA 1HQUB 2RRDA 1DURA 1GOZA 4KB7A 4NB3A 2MKSA 2KFZA 1IR2A 4WFBQ 3ENAA 3H5YA 1TQLA 5C4JB 1V38A 3GV6A 2R92H 2CQ4A 1WD0A 1WF1A 4HDHA 4Q2MA 1GTEA 1PA6A 3R7BB 4KLMA 3NMRA 4WFXA 3ZZUA 1WTVA 1CJVA 2BV3A 4P2FA 4JI3F 3WK9A 1E6YB 1S79A 2LM4A 2B63G 1FJGJ 4FF2A 1FX2A 5L1JA 1LOUA 2RS2A 1N34F 4ITSA 2BE7D 2PI2A 4C0HA 3PSIA 1RJTA 3DOLA 3FC9A 4QY7A 2QARB 4DU7A 1SGGA 4FZVA 3C23A 4NA1A 5DM6Q 2XZDB 4J6HA 1RXWA 1MA7A 3RJGA 4I2AA 1GVPA 1HXYD 4JOUA 4XTCS 3GV3A 2AWOA 2ZHBA 4CE6A 2HHHQ 1B99A 1UAPA 4G7OC 3KDFB 1LKYA 5KG6A 2R7ZH 2R7ZB 5J2AA 3I5AA 5CA5A 2DFLA 1KHVA 4I29A 1X9WA 4BBRH 2KSOB 5LL6d 7ICJA 2WF9A 3CIMA 4GKKF 2HQ3A 2I07B 3DXJC 2VDHA 3DRSA 4X3UA 2QMXA 3K17A 1GXUA 5HJXA 2A0FB 2BX6A 2VASA 3DM3A 2BJ9A 2U1AA 3DRRB 4DR3L 2PO4A 4IDKB 4A3JG 9ICSA 4X2BA 3HKZB 1KD1C 3V7LA 4F92B 1QAYA 2KCNA 2DRDA 1A2UA 4PXEA 2YYZA 2QLTA 5HMWA 3W1YC 3FGVA 5JJZA 3ICLA 1X5TA 5F8HA 5T41A 5JRTA 5C4XB 3GR0A 4WKYA 2K52A 4RQ2A 1DJRD 2HK3A 4R5PA 1Y8OB 3HJVA 4CM0A 4J9OA 2OD4A 1ZXIA 5KL8B 1ZM9A 1HW9A 4CKCA 3J7YI 2EFOA 1KD1T 3VA7A 2CQ0A 2JNJA 2E8MA 1UVLA 5IWAF 2UUTA 3OTEA 1L7PA 2WVEA 2OF1A 3IS9A 1S5ZA 4C8LA 1C1CA 3CJSA 4IH6A 5AKIA 2R7UA 2ZD1B 2Z4HA 2MQNA 4TYAA 3NWTA 2MQPA 4A75A 2YQEA 3DXSX 3R7NB 4A46A 3ISNC 2EYOA 1JLBA 4X4OA 2FY8A 4WE1A 5D8HB 2F0KA 2CNOB 3NBIA 2Z4PA 1N0UA 5I9OA 2MQLA 3AOAA 4OO1I 3OTBA 4ZA1A 1GFWB 1N32F 2ZJPA 2UXCJ 3K7AB 2ZJQQ 1SL0A 1SJFA 1TAMA 4WZMA 1ZQBA 4Q8FA 1ZQ1C 3UN2A 2NB0A 3LANA 3QNWB 3QLHA 4H4MA 1GNKA 3T19A 2HEKA 2UXBF 2QA4G 1S5CD 4YB7A 1Q7LB 3OXFA 5K36H 1UE7A 2BA0A 1VQMS 4DV4L 2ZZMA 4OYOA 4LZGA 1J27A 2FZCB 1JLBB 5LMNL 5ALIA 3F0NA 1VQFA 3U7JA 2EZXA 1HBOB 3OUYA 2ID0A 2LDYA 4RLEA 4Y2IA 4RGMA 3K57A 5ALLA 4YXJA 3E51A 1BHNA 1KQKA 4C1NI 3ZYYX 1R0AB 5KNIA 5ALVA 2KI2A 4CO1A 4OQJA 5K14A 2LEBA 2VJ4A 5M5YB 1ZYRC 4DV6L 3R3TA 4Y65A 2AZ3A 3UWTA 1SE4A 3UDLA 1KN6A 4Y00A 1K3BC 2PQAA 1U0SA 3NOGA 2A10A 4HHHA 2HURA 5IYCG 2E29A 3BDOA 1NJZA 2CQPA 3DDNA 1LABA 3DU6A 4RNMA 1XTDA 3DLKB 3ED5A 3NGTA 1Y1VH 1U1KA 1TWGH 3H4BA 4KGXB 4ERDA 2VIXA 4UAUA 1NB2A 1KLMA 1M4VA 1YHBA 3TS2A 4ZP6A 5HROB 4PEOA 2SOBA 1RXVA 3T1YF 1A9NB 1Z00A 1SXTA 2PMZB 5LXRA 3NCQA 2CJQA 2BJ8A 4C8OA 1WSVA 1FNMA 1WCMB 3VV2B 3BM7A 2YTYA 3W8GA 2Z4IA 4NPSA 2O3DA 2RKIA 2AD9A 5E2QA 4OLOA 3ONAB 3HW8A 4ZN1A 4O5CA 4NP5A 2I5HA 2BCOA 3LOUA 5KFUA 2QLXA 2WB1C 2IT1A 4MFBB 5AXLA 1I94F 3S15B 4Y2CA 2UXDL 4KHMA 2HW3A 3D4RA 1N0VC 1SIZA 2BKPA 3VTIA 8ICRA 1U2RA 4JI1J 3ITHA 4BS9A 3QJLA 2MUTB 2CWKA 3OTOF 2JC1A 4OJHA 3IWXA 1HPCA 4WORA 1TU2B 3D6MB 5ETTA 1M5KC 3K8WA 3IRWP 2EOTA 1KWMA 4KN7A 3ULJA 4DU8A 1WSRA 3P45B 4PCQA 2FVPA 2M2BA 4A3CH 3T5LA 2K4IA 3R93A 2H1EA 4LQ3A 4RWWA 4ZLLA 2HVEA 3W2VB 5KG1A 3HHDA 1UFKA 2Z58B 4K5XA 3T1YQ 2EYPA 1GHJA 2K5VA 2IBOA 3MECA 2YKOA 4WXWA 4AYBF 1Z9FA 4OCZA 3TA1A 3KLGA 2V69A 5LXYA 2PW5A 4EGVA 4RQ3A 3OL9A 1HWIA 2PFQA 1T9TA 3DNCA 7ICLA 1GKHA 1U2FA 4NWIA 2YNFB 4GZYC 1L7NA 2F1HA 4AUKA 3GB0A 5MLCV 3H40A 3ITPA 2RDIA 5J1ZA 4A8XA 1WYGA 1STHA 1Q95G 1IBMJ 1PYOB 2GMHA 3UXOA 3BO2A 5GQOA 1VQ8A 5I4DA 3ENVA 4I4BA 2X1AA 5AE3A 4ED0A 5C4XH 4FXDA 2RILA 2RKSA 5K8NA 1ZQRA 1JWSD 3H25A 1MKHA 4XT1B 8ICNA 2QTWA 5D4OA 3FRZA 1IBLF 3W1GA 4ZYSA 3TZZA 2HS3A 4Y2XA 1CZGA 3IL8A 3KLHA 2D3UA 4ICAA 4RO0A 3QT6A 3TJAA 5T1IA 4DV4Q 2FHOB 4UZBA 4JOIA 3TA2A 3SAFA 3KUPA 3BB5A 4F26A 4WTYA 3CB4A 2CDRB 3JB9k 1YTYA 1E0BA 2NZ4A 1DM0B 4KPCA 3DOMB 4BBRB 3KLSA 1BCPD 5T7LB 3PIO3 4PG8A 1PMRA 4M6WB 2F3JA 2K03A 1FKPB 4CLPA 5E4WC 2B2TC 3A8JE 4I2DA 1IKLA 2DNEA 2B8PA 3MAAB 1Q3UA 2XWJB 4QUFA 1EFWA 5GMDA 2I38A 4DSEA 4NV0A 4NASA 2RH3A 5M3FH 2N8NA 3SR6A 1ET6A 4X65L 2DR9A 5B08A 2ZXHA 2YX1A 4C3KA 5JVG3 3EGNA 3G71S 1KDAA 1TUGB 1W2BA 2QLBB 5A6PA 1NOMA 3PO3H 2MYFA 3CNHA 3BV8A 4Y2TA 1J5EJ 4ANDA 1JLFB 2ZBQA 5KFRA 5CZXA 1LYLA 3R1LA 4C0BA 3ZDBA 1C0AA 2GGPA 2QILA 5KFVA 3QOJA 1MWYA 4U95A 3KHRA 4LBPA 3CD6S 5ALUA 1RT2B 3L7UA 2Z56B 3C15A 5GAEU 5F0WA 4PZOA 3DWAA 1BCPB 1TV6B 3AD7C 4APVA 3MEGB 4AYBC 1H7WA 3CRXA 3KK3A 3HOUB 3MPWA 1SI9A 4A3LH 3S2DH 2PFDA 1R0BG 2HHHF 2H54B 3KOJA 3VGSA 1X2IA 3RB6A 1L8OA 2ZH8A 1HA6A 5CV9A 1LTAD 3V2TA 3NGUA 2YPYA 3A56A 4F25A 5D4NA 3GU3A 1SQGA 2B4UA 4M5NA 2HHWA 2ENBA 3E01B 2J5AA 1GTHA 3BQ0A 1UW4A 2CJYB 3FEWX 4DV6Q 1C9OA 4E98A 3PO2B 1F2GA 3ISDA 1V1OA 1LKYB 5E33A 1UWAA 3SDZA 5A8WB 1FKAF 3NBHB 4ECYA 4F7VA 1ZD3A 3M05A 4IO1A 1FFUA 3RRGA 2PMZE 5H9FJ 1I4HA 1PRTF 2NN6I 4CO0A 1DOMA 3HKZE 1IV8A 1EHWA 5LL6X 4BWMA 1TWCB 3JTOA 4S3SA 2AYBA 2E5IA 2QDBA 1A76A 2B2UA 1HD0A 2HQEA 3W8PA 5AM5A 4C4WA 1YI2S 3MXGA 2VFTA 3M8QB 4QZHA 5JTIA 1QLNA 2QRRA 2XRSD 7AT1B 4I2HA 3VYUA 2WF6A 3GPAA 4AXIA 2I1RA 3IP4B 3F1ZA 3THVA 8ICJA 1L1OB 1JXVA 3MBYA 4QB4A 2EYMA 4N77A 1PK1B 2RRAA 3QG1A 1KIXA 2JFKA 1PKUA 5LOQA 5AICA 4FVMA 4CLZA 5IS2A 2C2KB 1CC7A 1ITPA 2A6ED 1RYRA 4R25A 8ICEA 4F8MA 3HFVA 2KK0A 1SNMA 1YRXA 1TV6A 3SZ2A 3S24A 1GXTA 4IOAQ 1IM4A 1KHIA 1HKAA 1G51A 2CPFA 4DX5A 1V9PA 2RDHA 1EZZB 1UEKA 3J7AN 2CRLA 1FXLA 2M52A 3CCTA 1H95A 3EM1A 2CQBA 3GTGH 3K59A 3M6UA 4ANEA 1SEBD 2GX8A 4EX6A 2CWAA 4CH0S 3V7KA 1BBUA 4QR2A 3EZ5A 4NLOA 4B3RJ 2X7IA 3TWZA 2RF2A 2G9HD 1D5XC 3H94A 2FJ2A 1L0XB 1G6BA 2A69C 5D4PA 4TUSA 1FWPA 4LF8F 1ZQMA 4IUTA 2B4PA 1F1BB 4NI2B 2JH3A 1ZD5A 4UTGA 2HGLA 4JI1F 3JPSA 4GC7A 4IS7A 3AMZA 9ICCA 1SNPA 1R89A 2F0FA 2GMLA 4WFAQ 3MDFA 2QB1A 3ZZRA 2L9WA 4MFCA 1O0PA 4RW9B 1Q7YT 4A3EH 1RT5A 8ATCB 2KVQE 2CKZB 4JYAJ 2BE2B 2E8GA 1JB0C 5CV4A 2FDNA 4KC5A 3GZ7A 2XEXA 3MXNA 1S9EA 4G1QA 1TZ0A 3FQLA 3QO2A 1V1QA 1NE3A 3T1YJ 1WI6A 3W66A 5I9PA 3KJOA 3PKYA 2CQHA 1HQEB 1LTID 1S0OA 4YG2A 1IR0A 2RHSB 2QLFB 2J0WA 3IO1A 4JI8Q 4WK3A 5IYDG 3CJ5A 1F0MA 4RG1A 4DX8H 4F87A 4DPTA 4QR0A 1B2TA 1EETA 2DGUA 1IBLQ 4DX7A 2MGZB 1DOQA 4DK3C 2G0IA 1S6QB 1IBCB 2DD8S 3HSGA 1TR0A 3FKIH 2IA0A 3TO8A 5JAVA 4QWEA 3CD6A 3CWJA 1U9RA 4JI1Q 1SKSA 1NI3A 4W90B 4YWLA 2J7KA 1S49A 3MM8A 1X5SA 2E1AA 4O4RA 5B66U 1WD6A 3NTKA 2AUJD 1KP6A 3BDPA 1AZSB 1HNVA 2CKWA 2CRXA 3DGPB 3NCPA 3OR2A 1HA1A 4DV2Q 3RB4A 2CZVC 5JUMA 4J9QA 4IG0A 5KFHA 3N6LA 3L95X 2FHJD 1JOOA 3EWAA 4G3IA 1I4RA 4TUQA 4Y7NH 2UXBJ 2BOSA 2B3TB 4C3JB 3CJKA 5IGEA 3TQEA 4DOAA 1YZ6A 2AXTU 2DNCA 4R5PB 1F2ZA 4PYAA 2M8DB 1E22A 1YBTA 1N32J 5EGTA 4QIWB 5J8YA 3VZIA 2FXQA 3HOVH 3T5KA 2FTRA 3TUJC 1N5YB 3GD7A 4CRJA 1WVLA 3T51B 1F9EB 3RYLA 1QZHA 2IJRA 1IBKQ 3LPEA 4J37A 3CNQP 4C7YA 1CHPD 2HFUA 2K06A 3C46A 2AYEA 3W64A 3EVQA 4WU3A 5HNKA 3G48A 1D6EC 2F4VL 1O78A 4A3IB 2F3WA 4R8IA 3WOEA 1RA6A 2QGFB 4FKXA 2AJ1A 2PXIA 2FC9A 5K36G 1U6ZA 1K5OA 1EYGA 3TAPA 5J0OA 4B3SJ 1SQFA 4B3SL 2OMLA 2LFVA 5J0YA 1WEZA 2YX7A 1WNEA 4OIJA 2QF7A 4GO7X 4RQ0A 2BOAA 2D6FC 1ZQCA 3GTYX 4XIGS 3OBIA 2I6XA 1Y9OA 4F4XA 1NK0A 4XAKA 5KOWA 1T5EA 5F3XB 4A3MB 1L3SA 2FJVA 1VQAA 1HPZA 4DKAC 3MA2B 4LF5Q 1YIJS 1EIYB 3F5EA 3W9HA 5LSOA 1RU2A 4DR1F 3TRZA 4IR9A 1TL3B 3WZ0A 4N76A 1DTQA 1JKHA 4LFAL 5ETKA 1KVJA 1PIEA 2HNDB 2AUKA 2R42A 1XPOA 4K5RA 2L11A 9ICAA 3OWFA 2JEBI 1VQMA 1HL6A 1KLMB 4OX9J 5ALHA 3L0OA 2IM0A 3VCBA 1S3OA 1NDKA 4KN4C 2H5IB 1A6XA 1BR9A 4B9SA 2W2NP 1A0OB 5ETMA 1CULB 3OTQA 4QR1A 3Q8RB 3KJQB 3GTLH 4UB2A 5ELNA 1HQUA 2UUBF 1HUOA 4OHWA 2DXEA 4A8YA 4FYWB 3OW2R 3MGVA 1HMVB 5ALJA 2KO1A 2AF6A 1N34J 5E3QA 4JB3A 5HMMA 4K4XA 2JFDA 1HR0F 4J9VA 3TZDA 4J8QA 3UDFA 3NAIA 1S4FA 3K58A 2BW7A 2H9ZA 4PUOB 1RGVA 1NJYA 2A1JB 1T3OA 3LNNA 3NASA 4X65J 5HP1A 2XS5A 1GHKA 4DR6J 3JAMU 1FGUA 2MEWA 4K4ZA 4A8SA 1T11A 3IXQA 2XS2A 3BEGB 2BYCA 5B0DA 2Z1CA 5CBAE 2O5DA 4N9PA 3QQCD 1HYSB 2UU9F 2NRVA 4KLTA 1SJ4P 3CC7S 5EJWA 2KDOA 5AXKA 5B0EA 4IFYB 2CA9A 1VQKA 1GO3F 4LF8L 2AEFA 3ZJYC 2KHDA 3GLJA 3G6JB 1DK2A 4JI5L 2R8KA 1S9GB 4OZ1A 3MR6A 2C3YA 4XXEA 1Y0HA 3NAHA 1J2MA 2HBJA 3CCSA 1VRUA 3WKCA 2WHEA 2BJEA 5HP4A 5HJYA 1WI8A 3MAQA 1Y10A 4P7TA 8ICTA 5GAHC 4DWIA 1P1LA 5J22A 3BSCA 5DM63 4GOPB 2RHFA 2DGXA 2VL6A 1IQZA 2RHQB 2BH2A 2W43A 3T13A 1KQQA 5J2CA 1NO8A 1B4SA 1QVGR 3BGRA 2HHHJ 2AJ4A 4NDXA 3HOUG 3BO4A 4MKAA 4KX5A 1HNZL 2W4CA 3MGJA 5JJKA 4IPGA 2KEEA 2XULA 4CJ1B 1N5XA 1B3TA 1U6BA 3AXMA 4RHSA 2DITA 2GS8A 1QILA 1NPPA 1OY6A 1N5QA 2W55A 2GNKA 4JUZA 1UEAB 2VUGA 2RDDA 1HMVA 3BZKA 3PFOA 5AKJA 3HOWG 1GXLA 3DLHA 2HHHL 2XSFA 4KAIA 1PYWD 2JH1A 1G7CB 1L3TA 5C25B 1LKZA 2C3PA 2VQFJ 2ACMA 2D0OA 1QUQA 5HK4A 1RBLA 4PKDB 2YV5A 3I76A 3M6ZA 2H3QA 4R66A 3IM8A 1JMTA 3AUOA 5ALYA 3O2IA 1XNRL 1NY4A 2UP1A 3JSMA 3EROA 7ICVA 3GU0A 2XN9C 3RJEA 1RG6A 1F9RA 4K4SA 2RNEA 3IHQB 4QNLA 4RL1A 3VALA 1QCKA 3PGZA 2ISPA 2LEAA 3PUYA 5E4XA 2DVIA 2K04A 4I6WA 1RZTA 3ETOA 4RBTA 4OZ2A 2R7WA 2KFYA 4DV0Q 4DAPA 4HR7B 2UUBJ 4A3MH 4HCSA 3GJQB 2CPRA 3DWPA 1PC4A 5BYSA 3J81j 3PMNA 2NVYB 2GJ2A 1IWAA 1UPHA 1UFWA 2ZOMA 1BD6A 1NLKL 2VFSA 1REGX 3RH5A 1WYDA 2BGWA 3D6HB 1WTRA 2DXDA 2K28A 1PH1A 4RQ4A 2ZOFA 4DUZF 4FP9A 4YD1A 2J6TA 4M9LA 1H9KA 2L0CA 4Z6EA 2K50A 4EO8A 5A2QE 3KD3A 5IYDH 4D3HA 3VGVA 4ZJLA 4RZRA 4ECRA 2E2IH 3CP0A 3KK1B 1TR5A 4Z6FA 4JV5J 2KCMA 2NZ1D 3QU7A 2KM8C 1VBXA 1ACMB 2IX0A 4CGYB 2RDGA 3N4WA 1YX2A 3T16A 4DQRA 3U1NA 2AQ3B 3ZTQA 2PC6A 1D8LA 2HQGA 2VQEF 3DN9A 1JMSA 4IQWA 1L1OC 1O7ZA 3EUNA 4ED1A 3QT5A 4GOPC 4V19J 2LVWA 4NYOA 4GLVB 2NBFA 1IG6A 4JOIC 2JLFA 3GWCA 4EU0A 5EKIA 3HWTA 4POFA 1UJ6A 2ZBPA 2EKNA 4CDGA 2VD3A 4Y2VA 4PMCA 4FYVB 3ZNUA 2OJ3A 1SCJB 2Y1JA 3CCMA 5CORA 2LXUA 1AT1B 5ALPA 3SCLE 2VG6B 1RT7A 1RTJA 5J0XA 1JRPA 2MU2A 1NSKL 1XMQL 2XGPA 3I0RB 2CG4A 1KDHA 5IGDA 2UU9Q 4ZVPB 2ZUBA 2EFQA 2J4XA 4Y7NB 2CPZA 1N36J 4CF5A 4G1PA 3NRBA 4BXOB 3RRHA 4LREA 2HWTA 2ASDA 4FVCA 4UB3A 1NK4A 3MCMA 1P27B 2OPPA 2P66A 4C6AA 4ZOSA 5L8RC 1U4BA 1WC5A 1N33J 2PI4A 4YCVA 2CJXB 2FE9A 5DG9A 4C11A 1WHVA 2FFKB 1DRGA 3AH6A 5E7OB 2ZIUB 3UPFA 1O7LA 3M30B 2VANA 5CZVA 5G0RA 1KC8T 2ZVSA 3TADA 3KFUF 3CCUA 4BBYA 2ZWOA 1D5MC 1TIID 1HHTP 1C0TB 3I4NB 5IT9L 2JEGA 3EA6A 1LWEA 3GSDA 3I87A 4RWSC 2DNOA 4Q0BB 2D1CA 5IC4B 1IKXA 5DBAA 2Q6BA 1ZYRD 1V5VA 1DTTA 4AXJA 5J2FA 1RT1A 2GVBA 4YWKA 1UVNA 5I2XA 1NDLA 4PGYA 4A93G 4GXIA 3ERSX 2Z8LA 2E66A 2CAJA 1U8WA 5KTQA 1ZQFA 3RJKA 1TP7A 4DV3J 3RN5A 1J97A 1EY0A 4BBRG 4P2SA 3ZZ0A 1QDUB 1N8RT 2A1BA 1GO3E 2FD2A 2OHDA 4GNXA 3NTUA 4HSPA 4L5TA 2HCCA 4H4MB 4DV1Q 4JI0Q 3NY0A 2O5JC 3DXBA 4Y28C 1VHFA 1Q8IA 3R8BA 1ZAWA 3GCWP 1AZSA 2P8IA 4MFFA 1X9SA 1T7PA 4ZIVA 5FLXE 5AKXA 1Q1KA 1COOA 2KHCA 4LR9A 2KRBA 4RW7A 4UAZA 1XC9A 4QIWE 3DM2A 4NOHA 4J15A 2C2OB 3IG1B 1FCAA 1E7ZA 4HH1A 4OYZA 5IM0B 4EEKA 1XWLA 3O1LA 3W2WB 2DIVA 3PRDA 5B0FA 3L7ZC 1YLXA 4NRUA 2F8KA 1U24A 1FO1A 1KDNA 2PI5A 4A3IG 4C3IH 2FVCA 4C3LA 3TX8A 4DCOB 3K4GA 4TQUS 4K2XA 4B3TF 1D9AA 3D2SA 1F5CA 3UMBA 1APSA 1X3EA 1SYCA 4IQVA 3U26A 3R8YA 2Q2IA 2HZAA 4L74A 3QWUA 4DR1Q 4BY7H 3C6TB 3CCVS 4NI2A 2YB1A 3K7UC 2HVDA 1S1TA 1NK8A 1FR3A 5E7NA 1Q3LA 3TAMB 2YNFA 4LF8J 3DUZA 3MF5A 3QMQA 4P2MA 4RNOA 4NLDA 1SMXA 2BCUA 5BR8F 2OTLS 9ICRA 3RBXA 2WW4A 4A8QA 1Z1BA 5IY0A 4DV7L 4HEA9 3GIJA 1VQEA 3M2RB 2PGCA 1O03A 1S1XB 2OKQA 1PH5A 5AI4A 2B3GA 1G291 4MKBA 4YFKA 3MR5A 2ESEA 2L41A 1CJUB 4QJVA 3TX0A 2KVIA 5FK9C 1KABA 2V67A 5LMUQ 4Z6DA 5BYRA 4A8EA 1FNUA 2DY7A 3SQGA 3D1HA 4KJOA 4POGA 1EOTA 2EY6A 3LUYA 3DLJA 3UI2A 4ZVSB 1XQIA 1NU4A 1Q86T 3PO2H 2RS8A 4HT7A 1RTDA 4J9MA 1Y14B 1E6VB 2B2VC 2OP5A 1PTOC 2BQRA 5L37A 3RZOH 2WVFA 2UUAF 1M90C 1XSLA 4EBEA 1ENCA 3UFCX 5ALNA 4B3RL 3R5GA 2H4OA 4ZHRA 1VQ6S 5AI5A 5KG7A 3KBGA 4OHZA 2L4NA 2FY1A 4G65A 2RUSA 4KYZA 1QE1B 1YJVA 2BKOA 4ME5A 4OX9L 3CJTA 1HWKA 1U1MA 3MCSA 4DR4Q 2HMXA 4DNIA 3U58A 4JI7Q 3CDUA 2HVZA 3Q8SB 2DY8A 2KKHA 2K5NA 4AYBE 4GLAC 5D4BA 1YQHA 2GW8A 3SEIA 2AQ1B 1I6HB 2ASYA 2NV3A 4RGOS 4F02A 2B2WC 1J2NA 2V2ZA 2NSCA 2DN8A 1K1SA 1S76D 1Y5IB 2K1RB 4AL5A 4W98A 5CYUA 3CCVA 1JLCB 2KQ3A 4EMDA 5D3DA 7ICIA 3K0YA 3R5AA 3K5LA 4M5LA 1N33Q 2RKIB 3GTOB 1S6QA 4LUBA 3M9OB 3Q8MA 4IYQA 4ZP7A 5C4XG 4EQ5A 3CCJA 2QYGA 3FSIA 1UJ4A 3OMGA 5KFTA 1O08A 3SCIE 1VS0A 4C8ZA 1FJGF 2N88A 2A18A 4Y0FA 2CPIA 1I4PA 4RMFA 3CEDA 8ICUA 5ALDA 3IG1A 5CYQB 4LBIA 1NMEB 2UXDQ 2JN4A 3J7A1 5CD4H 2KD1A 1T9WA 3EDQB 3KK2A 4M1UB 4J03A 1ZQKA 1HIYA 2YU9B 4CLUA 4C2MB 3BQ7A 3BJUA 4R8UA 4F5PA 9ICXA 2MJNA 4YB5A 2FUG9 3IBWA 4PXBA 4FZNA 2KN7A 4I28A 4N8FA 5BN5A 3SDEB 2CW0C 1NRKA 3W5XA 2KEYA 3PF4A 2N7YA 1LW0A 3CT9A 3VZHA 3R2DJ 2KXNB 3NELA 2RRNA 4CNYA 4Y2UA 4KO0B 1KRSA 3L7OA 1RAFB 4U67Q 2E8OA 4DFPA 2FHMA 4BA2I 2YKMA 1PZNA 3NNCA 2NO5A 2EANA 3RJMB 3G9CA 1LWFA 3E58A 2YTVA 4GN3B 9ICLA 2W9CB 2BA1A 2M5YA 3QLHB 4K6LA 1VK3A 5HLFA 2JZBB 4HTIA 3L9ZA 4JI8F 5LSLA 5DEHA 4ZLJA 1JLEB 2IHNA 1JCKB 1ZQEA 2UVUA 2BA9A 1HI0P 3ZDEA 2Y0SB 3P20A 1VQPA 1MC8A 2B9XA 4UW9A 3EVWA 4I0WA 3B78A 1RT4A 2ZNZA 1XTZA 4NEYA 4WFNQ 1PG5B 4JV5L 5J2KA 2B8FA 1VC6A 1KEJA 3KLVA 5B0CA 2LKZA 4NLGA 3RLFA 3S1TA 1R7IA 2E8NA 3I32A 1NSPA 2DRAA 3G6YA 4USIA 1FFVA 2DF4B 3I4MG 4Z6CA 4DPOA 2ICEC 1S0VA 4X3KA 1EY8A 3C6UB 3TACB 2IM2A 2EH9A 3PRVA 4F5NA 2V9KA 5KFKA 1RM6C 1FNXH 2OGUA 4JI6F 5HL7Q 3L4PA 1F2LA 5FO8B 3J7A5 4I7FB 5LMUF 3DLGA 1IL2A 4X4NA 3N01A 1M0SA 5DQIA 4BWJA 5F8IA 3HP6A 4OONA 1ZQAA 1IYUA 1GXDC 2IOHA 3NQTA 1U45A 4M5JA 4IOCA 3M8YA 1R8AA 2R8HA 2IHEA 3IV6A 3BVZA 4USWA 1SUQA 4MT1A 3WDOA 1S77D 3T3FA 4PMBA 9ICPA 2UUCQ 3FVQA 3H0GG 3DLEB 3WKBA 3R5DA 4GKKQ 5KAIU 2OD6A 4RQ6A 2H4YB 2X1GA 4DK0A 3OTOL 5D78A 4GXKA 1KKXA 4NLPA 5J0UA 2CN1A 1F9SA 2OXOA 2CHBD 4LUVA 5BR8L 1UAWA 2BUNA 2XTIA 3E9HA 3E6ZX 5FJ8H 1AW0A 1PYBA 2WRMA 5KT5A 3GIRA 2W2PP 4PQUB 4OZ0A 4YMOA 2XMTA 1B3AA 4JVZA 1XNQQ 4QZFA 1R27B 4OHXA 4KGZB 5C4ZA 4DPWA 2XO6A 3BREA 4J9RA 3ETMA 4KD3A 5AE1A 3MTSA 4O3NA 1U7LA 1CFMA 2NCKL 3UM9A 5LMNQ 3NEMA 1RT4B 2YMQA 4I67A 2BANB 2XB2D 5JEAH 1S1WA 2G5IB 4WWSA 3SXHA 4Y3CA 4EYIB 2M9KA 2MHNA 4X4SA 3AJ2A 1FDNA 2SNMA 4M9NA 1OWXA 1WI5A 4K4YA 1IVZA 4F5QA 2XNQA 3MD3A 2F0DA 3OWEB 2KBNA 1R9TB 4HVZA 1TKZB 4X66Q 3LAKA 3AD8C 5CCMA 1JROA 4P7VA 4URSA 3FUYA 2K75A 4F0HA 2B51A 3RTVA 1QVCA 2K6AA 4H7BA 4UB8U 4GKJL 4PJ0U 2M2LA 3A12A 3VC8A 5C25A 4UY85 3C8YA 1HH2P 1FXRA 2DK2A 1PVPA 4X4QA 2ZUCA 2A2DA 3H8SA 4FS1A 3N7SC 3AU2A 2W9AA 3K7AH 4R0EA 5KFIA 1ML0D 1AZQA 4RT3A 1SROA 1EQRA 3BDCA 3F44A 1ZJMA 1PYTA 4WP3A 1T05A 3CMEA 1KOHA 1ZTWA 4QZGA 1DXSA 3UCZP 2PMWA 2W24A 3MXUA 4D3GA 2ZJRQ 1II3A 3SSRA 1A6LA 3FEZA 1H74A 1VLOA 1RB0A 4DOZA 4HSVA 1D9DA 3TYTA 2JLGA 1NDPA 5DLQE 3BO3A 2K8CB 4LF7Q 1W6KA 2UUBQ 5GAGC 2AV5A 3OW7A 1VBZA 3CF5A 2F4IA 2KVCA 2EK6A 5EBCA 1T02A 2K5HA 4RPYA 2KXHA 5ALTA 3C16B 1HR0Q 3MM6B 2RSQA 4HI1A 3I0RA 3JQJA 3O5TB 3J81Y 2VBWA 1BPDA 1I50H 1WOOA 3OVAA 4HACA 1SB6A 2F1JA 1WEYA 2KH9A 3B82A 4KHZA 2DR7A 4GXJA 3BSNA 2XYGB 3I1YA 2YMMA 5J2PB 1DRZA 3FCVA 4PABA 1WTQA 5C0XH 2VJVA 5B0GA 1W6JA 3TDQA 2PD1A 5DM7Q 2BCRA 2FJXA 4ZPAA 2HHUA 2JSOA 1YJWS 5F8JA 3NRZA 1MGSA 2E5GA 2AGOA 3UE2A 5FIIA 2J76E 1LFPA 1I4XA 3RLNA 2HUGA 4XQNA 1S1UB 1SB3C 3A8EA 4UASA 3G96A 2A3JA 3I2ZA 4R4IA 3BZCA 2H3VA 4KLKA 4IPHA 1T9UA 2JX2A 1LT4D 2CNNB 3STBC 3QE9Y 2L1BA 5IIJA 3U9OA 2OI2A 4KHPL 3WK8A 4CZCA 5E3AA 4EVOA 4PYDA 1RHPA 1EWHA 3GFHA 1COKA 4DV7F 4DR2J 2EYLA 1VBYA 1LTRD 5LM7E 2ZTEA 4HL9A 4NCGA 4P72A 2HFNA 1L3VA 1WF0A 4IG3A 2XIDA 1XR6A 4CDFC 4KY3A 4CYUA 4RQ7A 3DOKB 4OI4A 4BC9A 3C2MA 3S15H 4EI2A 1ZS6A 3MTJA 5GVQA 1S10A 2KZZA 4AQYL 1YDLA 1J8IA 2CQ2A 2R18A 1Q5VA 4XA5A 2BJ7A 1FEEA 3V5RA 2Q8IB 5M3MH 3GG1A 5HROA 3NOCA 1UHUA 3EXYA 3CDWA 1ZEQX 2HDOA 2XGTA 5IGBA 4P4MA 5A2QY 1PBAA 2UXDF 3MFYA 5EHHA 1JK9B 1MIUA 4M9HA 5E0OA 1VQ6A 1SLJA 1BF4A 2FGCA 4IQXA 5KFOA 2O67A 3IFEA 2KXFA 4YCXA 5FLXc 3M6KA 3DLGB 4KLUA 3CU7A 3C1ZA 2BDNA 1D1UA 4IO9A 3DGVA 4MJKA 3QSYB 1SVDA 1RWUA 4QYZJ 4UPAA 5AT1B 5DKWA 2VC1A 1QE6A 3HFZB 3EPGA 2PZUA 4HT5A 1SZHA 2I5JB 3M8WA 3JAME 5AJ3Q 2ZH1A 3I31A 1ED1A 2IMWP 1YNNC 4WJ3M 3CJ8A 1ZAVA 5ETPA 4L5SA 2IYGA 1RWPB 3B54A 1BPEA 2HDMA 3DOLB 3U1MA 2RAQA 2E9RX 3HVAA 4QQBX 1IKWA 4DV5J 1QVFA 2D3ZA 2YKNA 5C44B 3J80U 4LRBA 2BPCA 2JA6B 4DCPB 2DNGA 4QZAA 1GMWD 1AROP 4ZCMA 3RMHA 3AM9A 3WC2A 2NN6G 1NAQA 3UN5A 3G4SA 1SYDA 2YWWA 3FRPB 5I42B 1BBXC 2HMIA 4ZKBB 1PCAA 4HIKA 3F2BA 2P2CB 5ALMA 1QVGA 4EX5A 4NJ8A 3KZIU 1YJNS 2XHCA 4RGTA 3PKMA 1C8CA 1HR0W 1MMLA 1GX5A 4CKEA 4WJBA 1QH9A 2QX0A 3WK6A 2OEOA 4Y2QA 3T53B 3C2KA 3M32A 4YXMA 3AL0B 2ZJRA 2ZIWB 1RTZA 4US8A 2WB1D 1EYDA 1DJ0A 2GFFA 2BXJA 3GQBA 3TFRA 3LGHA 4PG7A 3U4VA 5HP1B 3GO5A 3ZTOA 4K2KA 5CCLA 1N63A 2QA4A 4FZLA 1Z4NA 5BXIA 4RQ8A 3HZEA 1KNEA 4HTJA 1ZQPA 1R4PB 3A8IA 3S1RH 2LYAA 2DKOB 3H90A 1FE0A 2P9GA 5J2MA 8ICVA 2Q2HA 1X6IA 5C0XI 4C7QA 1VR6A 1IYVA 4MNOA 3V6DA 3S7RA 1U0LA 2KN4A 3MR2A 1PVRA 1LTGD 1OYEA 1HYSA 3VAIA 3ILIA 2EZYA 2F1FA 3PQIA 3SBMA 4F67A 7ICOA 3FEYB 2K8AA 2IOFK 3N28A 5BOMA 3HLUA 3QO9B 1CK1A 4ILWA 4RWXA 5D0RA 4BCAA 4CDEC 1UE1A 2PNHA 1S9GA 2DHGA 5BN4A 5FLXU 3SQOP 3OTDA 2Y0SD 1ULRA 4DR3Q 8ICPA 5I42A 5CXTA 4X84A 1EKSA 3SQIA 1S97A 4OO1H 4UP8A 1ZA1B 2IMOA 1T9HA 1MROA 3D6JA 2XY5A 1X0FA 2YNIB 1EETB 2EC2A 3N52A 3GV5B 4V190 3HT0A 5J1NA 1IBKJ 2NRWA 5E1FA 4MTKA 3DEEA 4LF7F 2G5HB 1Q5YA 4IUNA 3QIPA 1I94L 4NLSA 3T5JA 3R6GB 4DL7A 4R1JA 4LF6J 4LF4F 4YS2A 2LHTA 2MRLA 2ZZTA 3R27A 2PKEA 2QJ3A 3MEKA 2JJQA 3H4DA 2BMBA 1H9RA 1J5OA 3BU2A 1RODA 4G7HC 1UETA 2IPOB 5ELFA 3GTQH 2CVEA 2VFRA 1KXLA 5A6WA 2F4VJ 1TKTB 3VR4A 2Y9HA 2FINB 1D0EA 1WDTA 4ECVA 4GVBB 1YHQS 2KE7A 1PH2A 2BACA 9ICQA 1GMUA 4YIJA 1X4FA 2RT3A 3BPDA 4CLTA 1JORA 4FDBA 4A3GG 1K0TA 2HFOA 1T5XD 1QCBD 1XK8A 3FBCA 2X1BA 1W26A 4KKOB 4ELVA 4A3BH 8ICWA 2WF5A 4WFZA 4NM2A 3H0PA 2J7UA 1JJCB 3QIDA 4N47A 4U7UD 4KT0C 3N97B 3PO2G 2F0UA 2XCPA 1SXLA 4LIRA 3P1HA 3QUTA 4PQXA 2I8EA 4FYYB 4KQZA 2UXBQ 3V6KA 4PHDA 9ICIA 2LCWA 3PO3G 3M8QA 3CPFA 2VKZG 1SNOA 1VQBA 3KLEA 2DY9A 1YI2A 1N54B 4BBSH 1B8AA 2W25A 2E5SA 4DV2F 4X4RA 3KG1A 1QVFR 9ICGA 3PEHA 1SV5B 4NRTA 4HAEA 2AT1B 2JA5B 3UCUP 4LRAA 4OWTB 2K3IA 3OR2B 1GUNA 1DCZA 4GLXA 1PVOA 1T3NA 2ATWA 1YZ7A 3W1BA 4S0MA 3UD5A 2NYIA 4MTPA 3OLBA 4BJQA 1G6ZA 1X31C 3PDNA 1XU4A 1SNDA 5AKYA 2RIJA 1KSPA 1FYCA 5CBEE 5HMZA 1YJRA 2R93B 3GMGA 4X65Q 1SE2A 2DNQA 1S0NA 5B0BA 4XYOA 2GA4B 2Z6KC 4DV7J 1N5SA 5KFYA 1VQ4S 1NZPA 3RR5A 3IP0A 3GFZA 4ZCKA 1FFWB 5K9FA 5KAFU 3D28A 3KZXA 3EVOA 1BUVT 1N5YA 3H2UB 2J8SA 1YJUA 2AMCB 1KAAA 5C0XJ 1WCLA 2IDEA 3TBIB 4U673 1IKYA 2V4QA 2WAQD 4ELTA 2ZC3A 4ZVQB 4U7UK 3NCRA 1MU2B 2DBYA 5C4HA 2A1AA 3CDEA 1GM5A 4LSNB 3LP0B 1FNVA 5C2GA 2Q3PA 3TADC 3EJMA 1S6OA 1PO6A 4CHTB 4PL2A 1NNLA 5EDWA 2Y1IA 1BVSA 5K14B 3SMVA 5C5LA 4IG0B 1N36F 4A3BB 5DRKA 2Z2ZA 4JI5F 4JWMA 4O5KA 2WCXA 2CCZA 2YVSA 3C3LA 4IC9A 8ICBA 4A3GH 3AD9C 4IRCA 3PW7A 2X69A 1BQXA 3BKUA 4DR3F 3MEHA 3MMAB 4WF9Q 1S1UA 2Q6CA 3MR7A 2F9JA 2Y0SE 2PI2E 3MM6A 1ZRNA 2F9DA 2G09A 1SKRA 1SIWB 1X3PA 3LGMA 1UEUA 3OHAA 4YR2A 2HCFA 2RF2B 2Y0SF 2IX3A 2JP1A 2J6UA 2IPKD 3QWNA 1XNRQ 5EGYA 3D67A 2ADBA 3BYRA 1FKPA 2VODA 5HANA 3BGUA 3AOCA 3ERQA 3EZUA 1AFIA 3IM9A 5CYMB 1HBNA 3HKWA 4NZ0A 2N78A 1NKBA 2E7WA 4KMUA 2B39A 3G6XA 3P3DA 4K5VA 3GDXA 4I2GA 3RZDH 1JLQB 1BGXT 1IKVB 4Y52H 1T95A 4OO1G 1ICWA 3C5FA 2CZ4A 4DV3L 5M3FB 4HR2A 3GTJH 1YNJD 2EC0A 3ZZPA 1WF2A 4RW6B 3W65A 4E8UA 1S9EB 1MQ2A 4IUQA 3AT1B 1VS3A 3UI3A 2D0PA 1NSQA 1VQ8S 3GJTB 3HO1A 3B6YA 3IRXB 4UAYA 8ICSA 3BJYA 2ZJAA 2CJKA 1HNZQ 2HWIA 3HHEA 2GOLA 4JI5J 4HMJA 4KPYA 4LF5F 5A2QL 2I9GA 3TP2A 4MHVA 5I6YA 4RGNA 4NCAA 3BDEA 3VQTA 4DSLA 2ROEA 3BQ2A 1EYCA 4ZK9B 4M1KA 1PFMA 1X3GA 1U0HA 1XBWA 1NPRA 5JOBA 4LF9J 4O5EA 3MUMP 7ICQA 4DV4F 4ZCLA 2ZM6L 4M63A 4UQGA 1N33L 4ZAIA 4N56A 2W8LA 4NLQA 4WK1A 1GEHA 3NXWA 2R9LA 1ZQSA 3HOWB 4UOHA 1PK3A 5IT9Y 4MK8A 1N56A 4KLGA 5DO2A 2HAIA 2A3VA 1FFGB 2GHPA 3MEDB 4KKOA 4NE9C 3BS9A 3I3CA 1JWWA 5KFMA 4K2JA 1KOOA 3ZDAA 4RUBA 1PH3A 1UL3A 1UWVA 2DHSA 5GADU 2RQ4A 4KR0B 1GT8A 2UV8A 5DGBA 2JV3A 3RJHA 4OI1A 1Q8BA 4KE5A 3CCEA 4Z2XA 4YD2A 1LWCA 1NBEB 5EPKA 3PG9A 1XTCD 3RJFA 4UUXA 3ETRA 3KYHC 2LQJA 3SGIA 4UBCA 4CM2A 3QEBZ 1NHKL 1Q1BA 1VQIA 2I5LX 2DQNB 3QNMA 2MKCA 1XMOF 4QIWC 3MCOA 1P6TA 4QIVA 5C24A 1UCVA 1C4CA 4DLGA 1R0CB 1FRMA 1IJEB 2W9BB 3CO9A 3ULLA 3Q8LA 1CJKB 3FMBA 5C44H 5ALWA 1LTLA 4KX3A 3J81L 3OVSA 1HLWA 1XMQF 3S1QB 4L72B 2R2SA 1TKXB 2W2OP 4KFBA 1FFSB 1D3WA 1Z4OA 3V05A 3JSYA 5EPLA 4L73A 1NSAA 1I3QH 2G2OA 3K7RA 1F2MA 5A8KA 3GTGB 1BUXA 3U4ZA 2WOMA 4RBUA 4JV2A 4KITB 3SAHA 1XSNA 1N36Q 1HBMB 4OYXA 2EY2A 2H3ZA 1VQ7A 3MMCB 1FNOA 1K8AT 3DM1A 3QYYA 4RW8A 4BUGA 5A0LA 2B2YA 4DG1A 3QZ8A 4JBKA 2ATLA 1V3RA 1P9QC 1RPLA 2R7TA 4JI3Q 3LGJA 2HQIA 1KN5A 3JTNA 1EZ6A 4ICLA 2E9TA 2M4MA 2Z0SA 3VR2A 1RK8A 3BGOP 2W7OA 4KY7A 4F50A 4UHVA 3DDKA 5C3XA 2VFUA 2DBBA 2R7XA 3NSWA 1K9MT 2GCFA 1H9SA 2YQ3A 2NTTA 4JBMA 9RUBA 3CC4A 2ZIXB 3ALRA 1SAPA 1OTCA 5J0TA 1YITA 3QIAA 2VY3A 1IBML 3OPXA 3MUTP 1FNWA 4NLXA 2JA6H 4IFYA 3TANA 1WKLA 2PEHA 1JE4A 1V8QA 3A0JA 1OPZA 3AAWB 2B6AA 2NRXA 2VG5B 1JALA 3HP3A 2PPBC 3AMUA 3P5BP 4A3FB 2JEIA 4UAVA 1HZBA 1S6PB 4F5OA 3CTRA 3I4PA 1M5OC 1XERA 8ICQA 2F2AB 1WC4A 4LF4Q 5DQHA 1E24A 2MZ1A 3SV3A 1Y8NB 4YB6A 2ISOA 7ICRA 1Q82T 1L3UA 3JPPA 3MPVA 5AI8A 2BDOA 3IBFB 1NUEA 1PYSB 3RF9A 2WP8J 2EVBA 4OELB 3NVYA 4LF8Q 3TVZA 4QZ8A 5C0YA 2OPQB 3C16A 2JRSA 2F5GA 1YBYA 2PMZD 4M04A 2M7SA 4QPTA 3PIOA 5IGGA 1OPIA 1HBUB 3FFIA 3OMCA 2JVOA 1D8ZA 4KH1B 5IT9E 3TW0A 2IM3A 4DJBA 2LA4A 2VKRA 3M4QA 1E1OA 2L3MA 3MMAA 4ACOA 4DK6C 2KHQA 1K83B 2F0LA 3QB3A 1HZAA 2Z0GA 1L6NA 4KKUA 1NEEA 2XLIA 3NS6A 2XQCA 4HCEA 1T05B 5L46A 3G6EA 3HVWA 3OHBA 4WZQA 3AQEA 4OL8A 2M70A 2FHKA 2XHWA 2XO7A 2ZBIA 3BVGA 4KLDA 1EB0A 5ETLA 2VKQA 2LU2A 2K33A 2F8LA 4DU9A 3M3YH 3J81U 2EBGA 1M5VC 2XWXA 4ZHRB 1HIWA 2DNZA 1XNRF 2AHOB 3TS0A 1K73C 2PN6A 3F73A 4I2CA 5DDOC 3MPYA 1A3VA 5IWAQ 1TKZA 5CV7A 4ZPBA 2A6HD 2HWHA 5LMNW 5D3GB 4TLRA 3OLAA 2WSCC 4ODGA 4DR1L 4OJ3A 3UMCA 3ISBA 2HHXA 2XGQA 1N34L 1VQHA 3MUVP 1X4HA 1WG1A 5DS7A 3H3VH 2XSCA 3D7SB 4DOBA 2W3SA 2HOFA 4TVAB 5F9NA 5L1IA 3DOKA 1HBMA 1OJ4A 4CLWA 2CADA 3DDHA 2D5DA 4DV5F 3ND9A 2VHGA 1LWXA 4W92B 1NPKA 3BSAA 1I3OB 3WKDA 1YT3A 5HATA 1KBUA 3TA0A 4DV1L 4JI0L 3KLWA 5ELBA 2K8BB 2RA4A 3NK9A 4DZDA 1H2TZ 5ETOA 4AYBB 1RWVB 1ONLA 1HNXQ 4CTAB 1EWIA 1C20A 1LQ9A 3BKFA 5ALXA 3IAM9 2V4RA 1HR0L 3VWSA 2HPUA 2D3OR 2MSNA 4C0OC 3AQOA 1EFID 2K7VA 2FPHX 2W9MA 2ZDPA 3MEEB 2FYXA 3KBBA 2HOIA 1TWFB 3FBBA 5J0RA 3O0FA 2AWNA 2CXYA 3BH6B 2VA8A 2A6OA 1SKUB 5J2QA 2VQEL 3GR1A 3I56S 2KOLA 1UVIA 3WX8A 5KFPA 4X64L 2HHTA 1O80A 2R92B 1UVJA 1FIQA 3IRXA 3DLBA 1SXEA 2PEBA 2W2QP 1R4QB 1PAUB 2EXDA 2JR5A 2P5ZX 3I9ZA 1DD2A 1A15A 3PHEA 2QL9B 3Q23A 1HNWQ 2R7RA 2IW3A 4DR7J 2ZXIA 2XLKA 1HBOA 3OUYB 2AX0A 2DNYA 1U2CA 2X6LA 1WTXA 5MAOA 3QGIA 3LO3A 3TVYA 3BH7B 5L39A 4LJMA 1U1QA 1HFGA 3LP2B 2B7BB 3EGVA 4JI2L 3IG8A 4A3CG 2MZTA 2F1MA 1TUVA 3DEOA 2JH7A 2XZTB 4OD0A 2R2RA 2Y8YA 1Q0NA 3FBEA 4MHEA 3RW6A 4X62J 3MABA 3D5MA 5M5WB 1CC8A 3IRUA 4UB4A 1PAEX 4R8UB 2UXCF 4GS3A 3GTPH 4WJWA 2C2DA 3VAMA 4LSZB 3SSQA 2GQ2A 1K8GA 3H42A 1N32L 1B7FA 3M8SA 4C8KA 2Y9UA 3NS5A 1VQ5S 1SJED 2EFGA 5I3QA 1W2BR 1Z19A 4Y2SA 2V8PA 3B6BA 3V6JA 2IY5B 2AQ0A 1VQKS 4MIBA 3A3NB 1T03A 2I2YA 3O3LA 3MAAA 2LI6A 2J9CA 4ID8A 1JWMD 3KUEA 2E3TA 4WYLA 4OYPA 2MA1A 5C5MA 1W25A 1C0TA 4PZ7A 5ISRA 1JJHA 1HW8A 2NR0A 4EENA 4B3MQ 4N41A 3BS1A 4RJVA 4KY6A 2XBPA 1SE8A 2PFPA 1T9YA 2DGOA 4DV3F 2Y0SC 5I2YA 2PMHA 1NUCA 4DV0L 2IDLA 1YRUA 1TWGB 3DMJA 1BCPF 2XS7A 3PFEA 3I4MH 5D14A 5D0HA 2IVMA 2RP5A 3CPWR 1M1KC 2RRBA 1XYIA 5E3CA 1TELA 2KZMA 2JZ5A 2IRYA 4NMXA 3PCOB 3AOBA 3WHIA 2U2FA 1V97A 2WAQF 2ZH3A 4GKKJ 1GUOA 3FPPA 2CVRA 2VJUA 4UARA 2ZC4A 1ICFB 1D2BA 1MU2A 2G2ZA 1G2TA 4HH0A 2ODGA 2XYHB 5AI6A 3KBXA 3ZZOA 2NTSA 1VQGA 3KDFA 4O44B 1U4LA 2GJIA 1S99A 3OTOQ 5AM0A 1H0HB 1FJGQ 3TP7A 4Q43A 3HOXG 2F52A 3KUGA 2R7QA 4C97A 1VFJA 3NKYA 2Z2YB 4DR4L 4Q0BA 1O7YA 4WJ4A 1PRTB 4I69A 3MM7B 1TFRA 2IJ0A 2CW0D 3TEGA 3EW9A 2RSNA 1N62A 5J2BA 4P0PA 4U8VA 1ZPWX 5FLXL 2P6TA 1K28A 3W63A 2B4OA 4PXCA 3HRDD 4RKBA 1EY7A 1Z3EB 1E6VA 1ZA2B 2MKJA 2N3LA 2BM1A 2CQGA 4R0JA 2F0JA 1WJJA 3MC0B 4QZCA 2B8GA 2F63A 4XIUA 2GAHC 2F3NA 1NNDA 5KT2A 3LW5C 2H1YA 1EU3A 2BJ1A 5KFFA 1SL2A 2FLLA 4RH6A 4USKA 2J9DE 3N4MB 1LNQA 1QJHA 2HKEA 1F3VA 2HRTA 4FNIA 5JEAJ 4BLGA 3A1YG 2EXUA 1X40A 2CPDA 1Q81T 5GAGU 3BGFA 2YY6A 2F4VF 3D0GE 1KTQA 9ICUA 2ZBCA 2O1PA 2AGQA 1PRTD 2GIRA 2V4JB 4A3KG 2ERRA 4DUZJ 4DXFA 2HS0A 4C8MA 2YQ0A 4RNFA 4IALA 1LFWA 1XEZA 3HKZD 3RZAA 1RTHB 5KFBA 2QDLA 4MIUA 2FI1A 3M8PB 4LF4J 4M0AA 4B9LA 1BQQT 1SUQB 4OMFG 1VMBA 4CGZA 1B7YB 7ICGA 4DR6Q 2K1BA 1F5AA 4OV6A 2OM6A 3QGPA 2CPJA 2YPZA 2P9CA 4Y2YA 4EZ6A 1VF7A 1EQ0A 3PNIA 5KT4A 1U25A 3HD1A 1UP1A 2VPWB 4RW7B 5BYQA 2IFXA 4QIFA 5C6AA 3OPKA 4A47A 3MDAA 2CNLB 3BSOA 3S1NB 4GIBA 1FEHA 2VBYA 3MEDA 2K7KA 2XVSA 2AYMA 1YWXA 2LS01 3WDNA 5ALGA 4CLSA 4K5WA 1ZZFA 1TTHB 4ZOHC 3ILJA 4FXKC 4OIXA 5LHY1 3TZXA 2D7SA 1EQQA 1HNIB 3PX4A 1P8LA 1KNZA 2EAOA 3DMJB 7ICHA 2KIVA 4B9WA 3RZOB 5CV8A 4F4WA 5AK3A 3GP9A 1O8BA 3CC2S 1EZ8A 1JOKA 4UOCA 4USAA 2AJQA 4PRFA 3CRLC 2GIQA 2Q0ZX 3TZYA 1UPPA 4A3DH 4JV5Q 3PX0A 4R4CA 1FTRA 3T4AC 5GTHU 4O0IA 3FFIB 2EEYA 2FC8A 4LF2A 4YDXA 4JI6J 3GTOH 4H4KA 2Z30B 5J0SA 1GMVA 4TNOA 3LALA 4OX8A 4DR6F 1ZZNA 1OIAA 1FJEB 2Q1LA 4X65F 5J0PA 2TSSA 4A76A 4DR7Q 4KHRA 2W9CA 5DZ6A 1ZQYA 1RHKB 3BBBA 3LP0A 1F2YA 3OTCA 3WKEA 4A3BG 4OWWB 1H7XA 3J7ZT 4YN4A 1SIJA 4JI7L 4RR5A 4KLLA 1VOMA 5CYQA 1ZQZA 3HKZC 4WFYA 4NZ7A 3OL8A 4KMUC 3P6YC 2XTJP 4GMKA 5IE8A 2MZSA 2CXEA 2F0VA 1HD1A 1IUJA 2DGYA 4K0KF 4PPZA 2M0NA 4L75A 3CXCR 3D3BJ 3KF8B 3CCLA 2DNKA 1VQYA 5J2JA 3DHXA 3RAMA 2G1DA 1RT6B 3CCMS 4QQBA 1B43A 2UU9L 4ED6A 4KRWA 4UUWA 4MK9A 2V4DA 4P71A 5U47A 4ETZA 2MP1A 4LSLA 1JJ2R 4MF8A 3TR5A 2OWOA 2MLXA 4C3IB 1VDHA 1OXSC 2DR8A 3MDCA 2IHMA 1XR7A 4QIWF 4CDCC 3QGHA 1HNXJ 5F8MA 2FHJA 2GHWA 2H5EA 3EQLC 1STYA 2FLNA 1N5TA 2OPPB 2D8CA 2HQLA 5C3EH 3THPA 2W9BA 7ICSA 3ZXWA 3OVBA 4Y2KA 2DEIA 1Y3KA 5KG2A 1EIFA 3RGIA 5HMLA 2ZZNA 3H8WA 2RQ5A 2B2WA 2VH7A 3MFGA 5CD4A 3LYSA 1C4AA 4YMEA 2K3KA 4M5DA 4DV0F 1CLFA 2B2TA 4ECXA 3HF5A 8ICGA 2IA6A 3PACA 3RUBL 3ZDDA 2XCAA 2OTJS 1JC7A 3L09A 1DQ9A 2C2ZB 1SMYD 3QJJA 2DB1A 2LQ9A 3PUZA 1TAQA 5GAEC 5I3UA 5KG4A 4L3KA 2E1MC 4ZVTB 2OQKA 5EUHA 4JI6L 3UE0A 4EBDA 1SPBP 2VOPA 3FCWA 2KHVA 2R6GA 1HEKA 4BY7B 5AM1A 4YQWA 1MBYA 1FD8A 4P2CB 2D9OA 3S2HB 3NE5B 3P75A 4ES3A 2WTFA 4YHHL 3HX9A 1TL7A 1QZGA 1Y11A 2E5JA 2PE8A 3OJUA 1S6UA 2ASBA 4NXNF 3MMBB 4EWTA 3VR6A 4OX9F 2MKKA 5AKLA 2BKNA 3LVVA 2W54A 2LFNA 1IJFB 4NL9C 4X66F 3H0GH 3R2CJ 4EQPA 4WP8A 5AK6A 3KHHA 1S40A 1FJ7A 1CQFA 1PH6A 1PFBA 4HTHA 3MEFA 3IFTA 3QATA 1GJXA 4ED5A 4DPYA 1BCPC 3C28A 1CQVA 1HUZA 4H4OB 5IILA 2BHNA 1ZQNA 1R6VA 4HJAA 2ZM6Q 5D65A 3QUCA 2J8AA 1CJUA 4UT4A 1PUZA 4FXGC 3M85A 1KR4A 4ZCIA 4P2HA 2KP7A 2BZ2A 1CZWA 2VFVA 2VZ9A 2WB4A 1U1PA 4KH0B 2K4KA 3LQVA 5H9EK 1A7GE 3DCAA 2W1BA 3H8YA 3CDAA 1ILPA 4M5GA 1X66A 2MKHA 4XDXA 4ED4A 1VQPS 3KWMA 1RWNB 7ICNA 4QW8A 1R8CA 4O3QA 3ICXA 4KIAA 3LF0A 1RCOB 2K2PA 2XSJB 5HQLA 1DLOB 1HUMA 1OUQA 3GTKB 3R97A 1AB8A 5FDLA 3P96A 3K6OA 3DYAA 1SH2A 1VLBA 2NXJA 3QUQA 4CF3A 2F0QA 4MKYA 2E2IB 3G86A 3C1FA 4U68A 3ZD9A 1P8GA 1XMBA 8ICAA 2HFZA 3RR7A 4IRDA 2ZHOA 2K01A 3KF6A 1E1TA 3K1ZA 3CYMA 5C42A 3NNAA 5KT6A 1DHMA 1DQ8A 2HLTA 1FRXA 3GP7A 2ZD1A 4CJ2C 3Q24A 1H2UX 2E1EA 1VRTB 3H8JA 1C1BA 3NBPB 4DR4J 2BZFA 5M3MG 2QFJA 3ZO7A 4B3TJ 3KNGA 2G06A 3H0LB 4KHPQ 2F0SA 2DCLA 2QO3A 5C3WA 1EIHA 4IPDA 9ICNA 1WCNA 1TMMA 2Q79A 4DF4A 4DZ6A 3W5OA 1VRUB 3QIPB 2UVVA 1KW4A 4KLIA 1B1ZA 4B6JA 2OELA 4IURA 1X8DA 1CSQA 2R8GA 1VQNS 3R9LA 4PG6A 3CJKB 5L9XA 5IT9U 5IQ6A 5AHXA 2KYXA 4UB1A 4MFAA 2E1FA 3CW2C 3BN7A 2DUYA 2F0HA 3NVWA 3PW2A 1HTLD 2FGOA 4RPZA 4NMLA 1F9HA 2UUCL 2G07A 4OL7A 2XWYA 4OJPA 1TVAA 4KHVA 1SXDA 2MPMA 4XQJA 3HHLD 5AI9A 1J6QA 5KL1B 9ICHA 3PV8A 4ALZA 3LWLA 1UE5A 2JEAI 3S6JA 2PA3A 3FC4A 2Z8QA 4C9DA 5KYIA 2JGAA 4XQQA 3P5TL 4RKUC 1SV0C 3CCJS 4DQSA 4OZNA 3VAGA 2K4EA 1STBA 4C3JG 4DL0C 1TWFH 2Q8RE 4PWWA 1T03B 4KKTA 4IFDI 7ICKA 5AKKA 4ZH4A 1BO0A 5B5EU 3WK4A 2MZJA 3TZUA 2F0IA 3G6VA 3VYRA 2L5TA 4JC0A 4PGQA 5IGCA 3Q6SA 4JBCA 2BRKA 2QKQA 4K0KQ 1WTHA 5J2HA 3PYEA 1P9YA 2BDPA 3PUWA 4F0MA 4KKSA 3TOQA 2VQFQ 5AXMA 1JLAB 2N7CA 2EZVA 2LQ5A 3CP8A 2RLTA 1WTPA 2GO7A 3C14B 3B4MA 1PK1A 1BKBA 4AL7A 1WHXA 5FDLB 2BJ3A 4RW8B 3W3AA 2L9DA 3CHBD 3WWVA 3D0FA 4DFMA 4LR8A 5TISU 2OTLA 2F03A 4JV0A 3G71A 3EGZA 4P0QB 1FKOB 4IL6U 2ZUGA 1FDBA 1JXEA 4MIWA 4DSKA 1Z6HA 5AM3A 2Q2UA 2E1PA 4ZQ3A 1YHAA 2QW7A 2ZTCA 2RJZA 1J5OB 2KG5A 3Q8QB 4HN7A 1UEBA 3JAMY 5A8RB 2IM1A 1DOKA 1S9FA 5J8YC 3MECB 3SFGA 4X64J 3PO4A 2F7VA 1E2WA 1Q53A 2VQEJ 2JA5H 3R3OA 2B29A 2JA5G 1TL7B 2R7ZG 4PHPA 4UAWA 5EWFA 2H5JB 3TP6A 5JVGQ 2DNNA 3WBZA 3N6NA 1CKNB 1FRLA 4A8KA 2B43A 2OSQA 5KRUA 1PVQA 2NVXH 2LXFA 1D1KA 3R9KA 3IKJA 4IFVA 2HVHA 3JSRA 2ZEJA 4C4RA 1QTNB 2EI5A 2FZGB 3PSFA 3E0FA 4EEYA 2B63B 3NQIA 1RDFA 2AU0A 3OD2A 3PO5A 2ZOGA 2ZFHA 3TUPA 1B4OA 3A8JA 2EY1A 1SJ3P 4ES1A 4CYUB 2MQHA 4HYKA 2JC0A 4ZJOA 2WFWA 4ZPTR 4C0ZA 5HGTA 1QUQB 1HWJA 3GILA 4UY8C 2YTUA 3JPQA 3PUXA 1H98A 1S12A 2LKYA 1LT5D 5HLFB 3CC2A 2ZNYA 4DN0A 3ET6B 1F60B 4F71A 3NBHA 4JI3J 2QEXS 3W3SA 3L3FX 2MFIA 3AQFA 4EO6A 1KTVA 1UVMA 3BDLA 3I73A 2NRZA 4OHYA 5B09A 4TQSA 4UP7A 3OT9A 3R5BA 3NNHA 4NCGB 1U1OA 2COLA 1U02A 2RU3A 2XRQD 1AUSL 2EAMA 5IWAL 8ICXA 7ICTA 2XIWA 3HOYB 4YDDB 3A8IE 3W61A 3BYYB 1XNQL 2V8HA 2DRBA 1B0XA 4BC7A 4NLTA 4RAUC 4FE3A 2B2VA 2UZAA 2YNGA 1M1GA 1FVIA 2GVAA 4M9GA 4FO6A 2FLOA 3KJNB 3MOJB 3HRZC 5J2MB 2M9NA 1FTCA 2BE9B 1EY5A 3ENWA 5HQMA 4DUYJ 3NPPA 3CCZA 4FN5A 2VNUD 2K4HA 2RCFA 3C2LA 1TKDA 4DMZA 2RQCA 2PFNA 1TL1B 2IJFA 5HMXA 1RKNA 4JBWA 1VQLS 2OLWA 4RNNA 1X4DA 4QW9A 2I46A 5CYMA 3V2UC 4JI5Q 3GTMH 5E3PA 4A3KH 3M4OB 1RISA 2MJUA 5F8GA 4IFDH 5J1EA 2JRZA 2QV6A 4C2MA 3GZFA 5J2DA 2TMPA 1X7VA 3QT8A 4O2DA 2F0NA 3CJ2A 1LEOA 4NXMJ 4OJGA 1WELA 5HMYA 2WZ1A 1KRPA 4K8RA 2KHSA 1N52B 1PJ7A 5IIOA 3DV9A 1RL2A 2X51A 2VBZA 4MN3A 4YOEA 1NK9A 1ZKOA 1FE4A 4LF5L 1IKXB 5LMNF 5FJ8G 4QJFA 4I7AA 3MM5B 3R5CA 1L1OA 2V8DA 4H0LC 3CD0A 4K4IA 3IAS9 3I82A 2AKWB 4ED3A 2CNKB 1F0XA 1XX8A 2YKNB 1FI4A 3UCGA 2F0MA 1PILA 1A2TA 3D6CA 3K1RB 4YHHJ 3W5YA 1IKYB 1SQEA 2B9YA 1UT5A 3RLOA 3FKIG 1ZQUA 3FDTA 1KHWA 1WOSA 1B0VA 1NZAA 3S16B 1NTGA 5EWEA 2VA2A 4QIGA 3TUZC 3MMJA 3NTHA 1TXYA 1RTHA 2B8QA 5GAEI 3BGLA 2NXCA 2CVIA 4LUOA 3DFEA 4DO9A 1B0PA 2K8GA 1JKHB 4HJ9A 1KLGD 1KDBA 4P74A 1TL3A 4KTAA 1SZPA 2R2TA 1BPBA 3QFWA 2ZH6A 1S5ED 3M6WA 4UDUC 3IRBA 3CJQA 1U8SA 2ZTDA 4CT8A 2YWFA 3H98A 4OJ5A 2HHPA 3IA0A 2W03A 2EK1A 1WWUA 4UY8T 4M5IA 5HN0A 2ZKTA 4NKLA 2QMWA 5AXNA 2FVQA 2AZ1A 2N4CA 4A3EG 4FS2A 7ICEA 1PZKD 1CEZA 4YY3L 5EN1A 1RQLA 3LP1A 2OPSB 2CFMA 3V4IB 4KHPJ 1Q79A 7FDRA 2FJEB 2MY8A 3QT7A 1Y3JA 2HVIA 2A69D 2ZT9C 2V8VA 3WOFA 5F41A 1MI2A 5G3LD 1TL5A 3D6FB 4A3KB 2HAFA 4FF4A 4UB5A 3W2VA 1JT8A 3I72A 4WRDA 1RT2A 1RAAB 2DXFA 2VZAA 4ENOA 5HURA 3PIOQ 3N5BA 3V4MA 1BPYA 2QL7B 3KXDA 2H48B 3FHWA 2LYHA 4K4WA 1RUSA 2H4WB 5IODA 3BQ1A 1X6JA 1YJ9S 4LVSA 1Q82C 1SC1B 1F77A 5CV5A 2NYHA 2N3OA 3G2XA 3QU2A 1URJA 3N9UC 4IO9Q 4FXVA 3TN2A 1IM6A 5DB7A 1U1LA 3B9JA 1NMFA 1QAJA 8ICYA 4JI7J 1S4EA 3G87A 1YJ9A 2KU7A 1NJIT 1SYBA 1ASYA 1UZDA 3HOYH 2KJWA 4NX9A 3TQ1A 4ZVUB 1H73A 1GX6A 3MFHA 5FO9B 5M2PA 1MHWC 4C8YA 4J9SA 3K8VA 4DCCA 5AE2A 4TU9A 4LVOP 4I2QA 2V1CC 1T9XA 3U50C 1OQ3A 5DNFA 2V9WA 2GJFA 3H5UA 3HULA 3V6DB 2XY7A 3EZOA 5G4DA 1HRJA 1OSDA 2ZIXA 4F4AA 4U96A 2Z2MA 1PH4A 4XK8C 5ITHA 3NP8A 1P1TA 3AB4B 4ZP9A 2W7AA 1J2VA 1FRJA 2GN5A 4F91B 1IBLL 4BDPA 2IX1A 1FT8A 4YCWA 3C15B 3KLHB 1H3DA 3ND8A 3AXKA 1UW9A 1VDZA 3ZD8A 2XG8A 3IFDA 3SDEA 2VG5A 3DC2A 5JPMC 1OQ6A 1R8HA 1VIOA 2V0NA 5BOLA 1Z2ZA 4M6WA 2KJXA 4RBVA 4CRXA 4LAAA 2QZ8A 4P4OA 2YH1A 1XMOQ 1JMCA 4A3LG 5M5XB 1TU0B 1LWFB 1OXUA 4OXPA 5FOBB 2YKMB 1KVIA 1YEZA 5DJBA 2KYZA 4WE1B 3TARA 5AIBA 4O1NA 3NG8A 1MSWD 4NW2A 2DNMA 3C1YA 1EQMA 1E2ZA 2L15A 4FF1A 2YNHB 1B4FA 1R8PA 4DR2Q 1I50B 1PZJD 4LF4L 5HY6A 2BR0A 2WKCA 1HBUA 2WAQG 2YY3A 3SCKE 1CS4A 5NUCA 1QWYA 2ATCB 3WU2U 4ECZA 4KGVB 3TNVA 4IH7A 4C3IG 2LA6A 5LJ5Y 3OFHA 5EBDA 2NYVA 5KFGA 5IP7G 2JHDA 1V6HA 2DNPA 1DBDA 3H7HB 2DCUB 2WOMB 5AJ3F 2KMDA 3DRPB 5HGQA 3NGDA 2MQ8A 4F88A 3ILLA 3D9BA 2Z6KA 4PMWA 3PMLA 5F3TA 4EQOA 1TL4A 3Q8UA 2W4DA 3JQMA 4QPXA 4QZ9A 4J9NA 1M5PC 1ZQLA 4UATA 2K5WA 2RSOA 3G82A 3ICEA 3IBCB 1U1NA</