2EAMA

Solution structure of the n-terminal sam-domain of a human putative 47 kda protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
GSSGSSGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 47 kDa protein
publication title Solution structure of the N-terminal SAM-domain of a human putative 47 kDa protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eamA01
4RQMA 5L1MA 1SXEA 2F44A 1SV4A 1LKYB 2KE7A 3BS5A 3TADC 1WWUA 2E8PA 4MHVA 1OXJA 2QKQA 3KKAA 4NJ8A 4NL9C 2EANA 5J8YC 1PK3A 2D8CA 2ES6A 2DL0A 2DKXA 1UCVA 3KKAC 2ESEA 2KSOB 3TADA 1KW4A 2Y9TA 5JTIA 1V38A 2QB0A 1WWVA 1X40A 2D3DA 4NL9A 5J8YA 1X66A 2F8KA 1B4FA 1JI7A 1V85A 3BQ7A 1UQVA 1B0XA 2FE9A 3H8MA 1DXSA 5F3XB 1OW5A 4PZNA 3IDWA 3BS7A 3SEIA 1SXDA 1Z1VA 2LMRA 2B6GA 3TACB 2QARA 2KMDA 1SV0C 2F3NA 3BS5B 2JV3A 4PZOA 2EAMA 2K60A 3SENA 2L5YA 1COKA 2E8MA 2GLEA 1LKYA 2EAOA 2K4PA 4RQNA 1SGGA 2Y9UA 2LPEA 2KG5A 1SV0A 2E8OA 2QB0B 3HILA 1PK1A 5KNIA 2KSOA 2QB1A 1X9XA 2EAPA 2E8NA 5JU5A 4IS7A 2KIVA 2YTUA 1F0MA 5JRTA 3K1RB 2DKZA 1PK1B 2QARB 1RG6A
chains in the Genus database with same CATH superfamily
3V7LA 4F5PA 3GIMA 1ZQXA 1ZQOA 3SI8A 1NJZA 1WWUA 4I2CA 2C2DA 8ICOA 2KIWA 1OXJA 2MUTA 4DFKA 1C20A 1NI3A 3HKZC 1TE2A 3UM9A 1ZQLA 2VA2A 4PJ0U 4C7ZA 4UB6U 2JR5A 3PX4A 1X40A 2H3VA 5J0PA 1TAMA 9ICGA 2VA8A 1QQ5A 5J0UA 4FZMA 3F2BA 4MFFA 4ECTA 3ZD8A 2LM1A 4O3RA 5D4BA 1NK5A 3D2NA 2XO7A 4U6PA 4PHEA 5G5HA 1ZQFA 8ICBA 5CB1A 4GC7A 4FBTA 8ICLA 2JXJA 3C2MA 1AROP 1NOMA 2K89A 1KQQA 5EE9A 2WF5A 1T3NA 3BS5B 3NVWA 4ZH4A 3H0RB 5BPCA 1JXEA 3QUCA 4ED8A 2BQRA 2QLTA 1S9FA 3C5GA 5AK3A 4IC9A 2YMPA 4RQ2A 1DRGA 2FI1A 1N63A 4RQ6A 2LKYA 4X5VA 1N5WA 5AK4A 3QE9Y 5J0YA 4JB3A 3NTUA 5KFZA 1A76A 2ZIUA 2JZBA 2YMLA 5BOMA 2KD1A 4F5OA 5AKGA 2HHXA 2J6TA 3G6YA 1XC9A 1ECWA 2HBKA 3SR6A 1L7MA 2EZYA 4QZ9A 3ZD9A 5L1MA 1NJWA 2PFPA 2OM6A 2HBJA 4UAZA 2ISOA 5IIMA 1ZQHA 2E8PA 3Q8RB 2C22A 5ALYA 4NLBA 1B22A 3D2SA 5KG1A 2W04A 2BZFA 2DKXA 2R18A 4I2FA 5KFXA 2BDUA 2W9AA 4UAWA 3AN1A 4DOAA 1TV9A 1L5UA 3ETLA 3PW2A 2PFQA 2GO7A 2KFNA 3LDAA 2OHFA 2C2RA 4EEYA 3OHBA 3NVZA 2P6UA 5KFYA 4F8RA 3ZI4A 1QSLA 3CRXA 9ICQA 2LBOA 4IRCA 1Z1VA 5HMMA 4KMUA 4OJPA 3TACB 5KFRA 3RB4A 3E58A 5AKKA 4ECSA 4C7YA 2F1JA 3SD7A 4C8OA 3T3FA 4FE3A 5J2GA 2OEHA 5DLGA 4M0AA 2E8MA 3KTQA 2OYYA 5KT2A 4J9LA 4US9A 2XY5A 5J2FA 4UAUA 4B9UA 4I2HA 1VDVA 4NLGA 8ICQA 1CI4A 2ZUCA 2E5SA 1RYSA 2LYBA 1TK5A 5KT4A 8ICXA 7ICJA 3EWAA 2ZJAA 2BR0A 4RT3A 3UMCA 3L3FX 1ZQAA 3PSPA 3PW4A 5TISU 1Z3EB 3Q8LA 5KFHA 5AKXA 1PK1B 3K1ZA 3SAGA 3IG8A 5KT6A 2H5XA 2BHNA 1QQ7A 2FMQA 1FEZA 1ZXIA 1SV4A 1QTMA 2ZJ8A 5KL8B 1RZTA 3GILA 4ECRA 5GTIU 3M8RA 5J8YC 2ZIXB 2ALZA 3B0XA 1XSPA 2ZUBA 4KX5A 5KT5A 4KITB 4O3QA 2HSZA 2K4HA 2HBMA 3IV6A 2J6UA 7ICQA 2WB1F 2JHDA 3D2QA 1X66A 1L8LA 2EH9A 1JIHA 2W9BA 2HOQA 1HUZA 3BQ7A 1UQVA 3RH6A 3UPQA 1NK7A 9ICPA 2WAQC 2OCEA 5ALRA 4RNMA 3C2KA 4Y2JA 3RR7A 1S0MA 4UB1A 7ICLA 1ZQCA 2IOFA 3H8SA 1XSLA 4YD1A 3H40A 1SL2A 4NY8A 3F5AA 3NRZA 1IIPA 4DSKA 3ZDDA 5KFQA 3C29A 2HHVA 4QZDA 1C7YA 4BUGA 2LM4A 4RQNA 4DWIA 2HMXA 2ZIWA 2E8OA 2W9CB 3TQ1A 4QZEA 1J97A 3I28A 3AQFA 4QZAA 3FC4A 3K75D 4QWCA 3PR4A 4EZ9A 3HP6A 2A19A 2WF6A 4YG2A 3CP8A 2ASDA 3DV9A 5HHHA 1KFSA 2B0CA 1ZYQA 5EE1A 3AUOA 1ZQDA 4I2EA 2KP7A 3C2LA 4AP9A 2IBKA 3FDSA 1D8YA 4RQMA 2YMQA 4I29A 2AGOA 1BPBA 1Q46A 4JUZA 2KV2A 2FPLA 3KHRA 3EPIA 3A0BU 5DB6A 1UT5A 2D8CA 3RJEA 4DLEA 3WKCA 4YFKA 1NKEA 5J2JA 4JV2A 1KL9A 3N7RC 5J0QA 5ALEA 4DSEA 5L1IA 4ED3A 2XVTA 4J9QA 4NLZA 4NL9A 4F5NA 4I2IA 3WK4A 3H8JA 5J2CA 2IOHA 3ZDAA 2BCVA 3WK7A 2YN4A 4PZNA 1RXVA 3F53A 2RDJA 4M9HA 4R65A 2VA3A 5FP0A 1D9DA 1JROA 4RNNA 2ZTEA 2XGQA 3PR5B 5F9LA 2JV3A 9ICAA 3AMZA 2PI4A 2H3FA 4DOCA 3N4MB 2HCFA 1A6SA 2NO5A 2VIXA 5KFLA 2KKPA 5AK6A 4Y2QA 4Y2XA 1O03A 5CEHA 3C1ZA 4OO1J 2K4IA 3PV8A 3ISDA 2LI6A 1N61A 2K8CB 2E8NA 1KSPA 4IS7A 1ZD3A 4C4TA 2BQ3A 5ALMA 3WKBA 4DQRA 3MGHA 4M6WB 4R8UB 1XWLA 4TUQA 2PMZC 5CJ7A 2PI5A 9ICNA 1U45A 3PSTA 1RM6C 2DKZA 2HW3A 2VJ5A 3BQTA 4FZNA 2ZXIA 1S0VA 4XA5A 1BPXA 4NWIA 3KHGA 1SXEA 1HEKA 4JMUA 1BVSA 5GTHU 4Z6FA 2WF8A 1NJXA 3PZPA 4YMOA 3UQ2A 4PH5A 8ICWA 4DQQA 3PO5A 4C80A 5BOLA 1UA0A 1S0OA 2OWOA 2OH2A 5JTIA 4Y2RA 4DL6A 3OTQA 4AYBC 5AM1A 2EZXA 2FJ6A 2UVRA 8ICVA 5DLFA 4M9GA 4PGXA 4JK1A 3PY8A 3NVYA 3M6KA 4M9LA 4J9PA 2K4EA 5ALZA 2JRZA 4U7CA 9ICLA 2DUYA 2BGWA 3N7SC 3C5FA 2F3NA 7ICHA 4YR0A 3TANA 2PFNA 4QZHA 1N2XA 2F1IA 1TFRA 5K4LA 1XO0A 2RRDA 4J9KA 3SAHA 4DQIA 5DBBA 1YZ6A 4I2BA 2AGPA 2YMMA 4Q8FA 3THVA 5L9XA 2DPJA 9ICOA 5IIKA 4QJFB 4ECUA 4Y2SA 4GC6A 3KFUF 1XNSA 8ICGA 2XC9A 4Q43A 4B6JA 2KZZA 4DL2A 4RPYA 5DQIA 2YTUA 3ONNA 1YZ7A 3LVVA 3PNCA 3KHHA 1X9MA 4QW9A 5EWGA 3BZCA 5AI5A 3WKAA 5AM5A 1SKRA 3GIJA 3LK9A 1ZD4A 4TURA 9ICJA 1ZJNA 4NJ8A 5J0SA 4UQGA 4YMMA 1N62A 8ICRA 4IRKA 3A0HU 1UCVA 4M9NA 4F4YA 4YXJA 2ZIVB 4DL4A 3WKDA 1ZQVA 4FFDA 2KK0A 1V38A 1B43A 4F72A 1KDHA 1NKCA 4KLGA 4BWMA 8ICKA 1QCKA 4ACOA 4RUAA 2OXOA 2HHSA 8ICHA 4Y2TA 2F77X 4HAIA 2MSNA 4NLCA 4IR1A 1ZQUA 3EPGA 3GIKA 2JEGA 4ECZA 2W43A 1N48A 3LYSA 5B66U 1ZQTA 1L3TA 4YN4A 1CRXA 4MFCA 1IXRA 2NRWA 4NXZA 2P35A 3N7PD 2YB1A 3TARA 3QX7A 5AK5A 9ICUA 4YQWA 4EZ6A 2LHTA 5AKLA 4KLJA 3J81j 5KFWA 9ICHA 3ALRA 5H2FU 3RJHA 5CA7A 3Q8PB 2UVVA 4R66A 1X9WA 4KLQA 1U9LA 2Y0SF 1F0MA 5J2HA 3TFRA 1L7NA 3GZFA 2QARB 3PW5A 3ICXA 4Y2VA 4EEKA 1TK8A 2WFAA 3GFKB 4ZOHC 4O9MA 4F91B 2HOIA 3UMGA 4QZFA 8ICEA 1ZQIA 1SZPA 5KFFA 4DSIA 2GH1A 3GDXA 1QQ6A 5KG2A 2K8AA 3WK6A 8ICNA 1X6IA 4ED1A 8ICPA 4DQSA 4RQ4A 5ALTA 4KLUA 5AICA 2Y1IA 3RJIA 1O08A 3QZ8A 3GIIA 5KFKA 1Q3UA 1J2NA 3TADA 5ALPA 2W55A 4RU9A 2ZTCA 1V97A 2DGZA 4MF8A 4F5RA 1MN8A 1ZQBA 3T5JA 4YMNA 1LVHA 4RPZA 3IN5A 3ORYA 4ECQA 3UMBA 4M04A 2HHQA 4DS5A 1ZQSA 4FO6A 1HJPA 4JWNA 3PSIA 2Z7JA 4IQVA 2KN7A 2IHNA 1CUKA 5ALHA 4MEXA 3EUB2 4GXIA 2Q0ZX 5J29A 4YR3A 3EW9A 1KFTA 2G5HB 5DG7A 3H4BA 2GLEA 1JX4A 1SIJA 2EAOA 3RF9A 4ELUA 1SV0A 4RQ7A 1PVRA 3BQ2A 3QXGA 4Y2YA 7ICSA 3O0FA 3AL0B 3KBBA 3N28A 4GLXA 4BXOB 2PKEA 2DF4B 1ZQYA 2A1AA 2ZIWB 1JALA 2JEFA 1NNLA 1X2IA 3MR5A 2V4QA 3NVVA 2V9WA 2B21A 2DBYA 3F2DA 3QZ7A 2RP5A 2CXYA 4C4SA 5CR0A 3PW0A 3OSPA 1N5XA 3BDPA 2F44A 4UASA 3NASA 1S76D 1RYUA 3BS5A 5KFSA 2W11A 9ICEA 3LWMA 1RQLA 4DL3A 2H3ZA 2JH1A 2W54A 1PK3A 8ICUA 1S0NA 1T7PA 2DL0A 4P0PB 4IRDA 8ICYA 2HVIA 5KFIA 7ICKA 1MQ2A 8ICFA 4GIBA 2DPIA 4DL7A 1WWVA 4E0DA 4OJ5A 5AI4A 1ZD2P 3FM9A 5AI9A 4O3PA 1KEJA 2XCAA 3IG5A 3H4DA 1ZQJA 3K4GA 4XRHA 1DOQA 4DSFA 4B9SA 5J2AA 3D6JA 3L4PA 2KICA 1JXLA 2RQ5A 3C23A 3RRHA 3MABA 1P7DA 5B5EU 2CPRA 4K4IA 5ALFA 7ICFA 4J9SA 4NLKA 1COOA 1RDFA 2I5HA 3M8SA 2R8JA 5J0OA 8ICMA 1ED1A 3JPRA 3CYMA 4UAVA 4UB3A 3C1YA 3HT3A 5ALOA 3AQEA 3NRWA 5C0YA 5KFPA 3V72A 1S10A 3RFAA 2QB0B 2BPGA 4Z6CA 3QEAZ 1Z19A 3SAFA 2XGPA 2XY6A 9ICXA 5C5JA 4K4GA 1TKDA 1NKBA 5EE0A 2PFOA 3G6VA 5ALLA 1N56A 1T3QA 1UHUA 9ICFA 2G5IB 3T79A 8ICJA 4O3OA 1NZBA 2WTFA 3RRGA 3WK5A 3RAXA 3UXNA 3JPPA 3RAQA 2KE7A 4QZCA 2UVUA 1QSYA 2UVWA 1KTQA 3MBYA 1KFDA 2XIDA 1M6YA 4R64A 3RTVA 1A77A 1AQ6A 4P4MA 1LV5A 3SZ2A 4ECVA 2KSOB 5A0LA 5DG8A 3AU2A 4OJLA 2KHQA 3PSFA 4I2JA 2DFLA 2ATLA 3ZDCA 5IIOA 2F8KA 4MF2A 3ZDEA 3PO4A 4YXMA 2FMSA 4JWMA 1ZQQA 4CE6A 1SL1A 3OPXA 1XO1A 2M9NA 4EBDA 4YP3A 5F3XB 9ICKA 3BS7A 2BCUA 3NS1A 1SXDA 4RQ3A 4P0QA 2B6GA 4RZRA 5EWFA 4KLTA 4C8LA 4PL2A 4CCHA 4F2SA 3V7KA 2O6KA 5J0WA 3QU5A 1WUDA 2P66A 1UPHA 3TKAA 1FFUA 2WB1C 3JPOA 3IM1A 4ED6A 2VANA 5AKHA 2ZIXA 1Q8KA 3JPSA 3RR8A 3I1YA 2W9MA 3KD3A 2LYAA 3FYHA 5DB9A 1SZHA 5ALQA 3HILA 4FS2A 2LYHA 2QB1A 4I27A 2EAPA 2M0NA 3M9NB 1Z00B 4QWDA 5IIIA 8ICCA 5AIAA 7ICMA 2K8BB 3PW7A 3G6XA 1ZETA 3KZIU 3HWTA 1VJ5A 3OHAA 3H7IA 2WF9A 4IL6U 5KG5A 1LKYB 2G09A 5DGAA 1L3VA 4EENA 2E3TA 2A1JA 5DKWA 4CGZA 2V4RA 5ALVA 3KKAC 3MR2A 4EBEA 1X42A 2GWSA 4M47A 4YVZA 2W9CA 1KW4A 3M9OB 1NK0A 2D3DA 3WK8A 5J8YA 3RBDA 1K5OA 1B4FA 4DFDA 1B0XA 4DFJA 2NRVA 3RB0A 2NO4A 3I76A 1QSSA 2FE9A 4M2YA 2PXIA 4F2RA 4B9VA 9ICWA 2AH5A 3UXPA 4KLHA 2EQYA 4F4XA 3NUQA 4DLGA 4F4KA 4EYHB 4JV0A 4KLIA 1Q3VA 5ALUA 4QIWF 4KLDA 4J9MA 5AKIA 2C2EA 4B9MA 2MUTB 4KX3A 1L7PA 2HOFA 7ICOA 4CNQA 3BQ1A 1ZQGA 3GU3A 4ELVA 3H0MB 5CRXA 5KG4A 1PVPA 3E0FA 3GV8B 2KHVA 1S97A 4ED2A 2YY6A 5CP2A 5AI0A 4UATA 5DQGA 5KL1B 3GV5B 1Z1BA 1PVQA 2KIVA 2J6SA 5DGBA 5KFCA 4QZBA 2ZJ5A 4BWJA 4RUCA 1XS9D 5CWRA 4PHAA 4O0IA 3U26A 1L3SA 4ECWA 3KHLA 4DEZA 4UARA 4ED0A 4TUPA 2VKQA 1IG6A 5EWEA 2P6RA 4DF8A 2QKQA 4QZGA 3TFSA 4KN7A 2E1EA 1HUOA 4O3MA 3Q8KA 4O5CA 4NM1A 4ELTA 4O5KA 1U49A 8ICAA 3GQCA 1N60A 4NLNA 2W3RA 4OJOA 5AKJA 3HRDD 5AM3A 5DBAA 3ISBA 5KFEA 1ZJMA 2ZIUB 1U4BA 2JZBB 1K1QA 4Z6EA 2HDOA 5AKZA 2XI9A 3MFIA 4TQSA 4MEYA 4FZLA 2ZTDA 3Q8QB 4I2GA 4M6WA 4R8UA 2Q4TA 4OD0A 1PUZA 2KVSA 3NGDA 4KLFA 1ZQZA 3OJSA 2LMRA 4IR9A 1LB2B 2KMDA 3DEEA 1H38A 4QNLA 5KFDA 3QUBA 2K60A 9ICIA 3JPQA 2L5YA 3BJYA 1T8EA 1F5SA 3S6JA 3V7JA 2KEYA 2GOLA 3RB3A 1ZQNA 2FMPA 2FLLA 2FLNA 3JPNA 5J2KA 1SKSA 5KNIA 4PGQA 4B9LA 4K4HA 2G07A 5E79U 5JU5A 4PPXA 4MFAA 3PVXA 2YQEA 4P4PA 8ICSA 1RXWA 2KJ9A 4DO9A 2W3SA 4TQRA 3KZXA 7ICNA 2ZXHA 4ED7A 5JRTA 4USAA 2F2AB 2BCRA 4RQ5A 2KOBA 5J2EA 3V6HA 2ISPA 4FS1A 2NRXA 4QWBA 3PX0A 3V6JA 1IV8A 2IHMA 2R8HA 3AM9A 3PMLA 2W03A 1UT8A 2WF7A 3KKAA 2ODGA 3H8WA 5ALGA 4PHDA 3IP4B 2ZG6A 4UW9A 4CF3A 3L5KA 2AGQA 3ZDBA 4Y2UA 3QU4A 3TAPA 1WYGA 1S8OA 2EZZA 3PMNA 4CRXA 1JI7A 3RJJA 5KFVA 2AXTU 3WKEA 2BPCA 4C8KA 1Y88A 1S77D 4EELA 1L6NA 3MDAA 5KFAA 5CHGA 4RQ8A 3KOOA 2IMWP 1TVAA 1TK0A 5TZVA 3BQ0A 4Z6DA 2NV3A 1U48A 4QWEA 2N1RA 4P4OA 3SENA 2EAMA 3QU9A 1ZQRA 1KLNA 1BNOA 3CW2C 2NRZA 2HBLA 2C28A 2HHUA 1SGGA 1YT3A 2F8LA 5KFTA 5DQHA 4Y2PA 2KG5A 2RHFA 3M1YA 2Y1JA 4CF4A 5EOZA 4EYIB 4KLMA 2ASLA 2ZIVA 1URJA 4P2HA 7ICVA 2W9BB 4DOBA 3OGUA 3IRUA 5IIJA 4C4RA 1Z4NA 1KRPA 4F4ZA 5JUMA 5ALSA 5HP4A 3K1RB 4PGYA 1XU4A 4NV0A 5L1LA 1T94A 3MFHA 3MGVA 1T4GA 5AKEA 2MRLA 5KG6A 1KKXA 2BQUA 2WAQF 2KTQA 3M9MB 4NL9C 1JUDA 2JH7A 5J2DA 2D6FC 5J0XA 1JN3A 4DF4A 5J0TA 1J2MA 3MR6A 2EDUA 2I9GA 2Y9TA 2Y0SC 5KFNA 1SL0A 1MSWD 2KNJA 4KLOA 2W8LA 5AKYA 1DK3A 4Q8EA 5EE3A 3AEVA 3OSNA 4IQUA 4B9NA 1MQ3A 4YR2A 4DFPA 1DXSA 1V9PA 1OW5A 3DDHA 3HJEA 3SEIA 4YCXA 3QUTA 9ICBA 5DB7A 3RH5A 4LJXA 3EZ5A 4BDPA 2QARA 4C8NA 1BPDA 5F9NA 1L3UA 3QU7A 4QZIA 4C8MA 4UB4A 7ICEA 1COKA 4DCCA 4ECYA 2VJ4A 5IINA 1BPEA 4RQ1A 1ZRMA 2Y9UA 2LPEA 4RNOA 2W8KA 5D46A 4NM2A 4P0QB 5KG7A 2JEIA 4J9NA 2MA1A 4UB2A 4XUSA 4Q45A 1X9XA 2H3IA 1NK6A 4F92B 7ICUA 1K1SA 3JPTA 3M6ZA 5G5GA 1ZD5A 2W7PA 5L1KA 1D9FA 1OUQA 7ICTA 4QZ8A 1ZQEA 1DK2A 4KLSA 3F2CA 2HVHA 4BJQA 3MGIA 1BPYA 1S5LU 1ZQPA 4O3SA 5KG0A 2G0AA 2AU0A 4IQTA 1RPLA 1RQNA 2YB4A 4F4WA 3GV7B 3TAQA 3Q8SB 5AM2A 1X6JA 4GFJA 3SMVA 3QUQA 9ICCA 5AI6A 1KN5A 4I28A 3T5HA 2ES6A 2RDIA 5DG9A 2RLTA 2FPKA 2BDPA 4ICAA 1GO3F 3T5LA 3ED5A 3SV3A 5ALNA 4A8EA 3RBEA 1NK4A 2A1JB 3RH4A 2MU2A 4B9TA 8ICTA 1X9SA 2BPFA 4J9OA 1MC8A 5HNKA 4BXOA 3H8MA 5KFJA 3T5KA 1SWWA 5HHIA 2JGAA 5DDYA 4EX6A 4J9RA 3B9JA 1NK9A 1L8OA 3HPOA 4O5EA 2PMZF 2E1FA 3BZKA 3LVWA 3FAHA 2XICA 4RPXA 4PHPA 2XY7A 4I2AA 4F50A 4KLLA 4I2DA 2KZMA 4DL5A 4P0PA 4IQWA 4KN4A 5ALWA 4BGDA 4DSJA 4F93B 4LVSA 1PK1A 5J0RA 3ISCA 4JV1A 2IA6A 3N97B 2DQNB 4R63A 4TUSA 1ZQMA 2DWQA 5D49A 9ICMA 2KJ5A 5KG3A 4CDGA 8ICZA 2F1HA 5ALDA 3UQ0A 4AYBF 7ICPA 2WHEA 2F76X 2AHOB 5HMLA 3VC8A 4UAYA 4US8A 9ICTA 2NYVA 1QH9A 4O3NA 2KFZA 3HX0A 4XQ8A 5HR6A 5L1JA 5ALKA 1D8LA 4MHVA 1WCNA 4QW8A 3HW8A 2CN1A 1QLNA 5T14A 2G06A 2I6XA 3QEBZ 1WG8A 1KBUA 4PL1A 3F5EA 3TI0A 5AI8A 5KFUA 2AJQA 2QB0A 2R8IA 3CNHA 1BNPA 3AU6A 1BGXT 1WCLA 1BPZA 2BCSA 4UB5A 5ALJA 4UBBA 1HIWA 4KLEA 2FPMA 3B0YA 4F3OA 2HHTA 4Q44A 2H3QA 3IDWA 4RQ0A 1F44A 5HR7A 2W7OA 3WU2U 5DBCA 3EYZA 9ICVA 1RYRA 4DSLA 4GXKA 4PZOA 3RJKA 2AQ0A 2ASJA 5AM4A 3VCBA 1FFVA 1IM4A 1ZQ1C 4HYKA 1A0PA 4KTQA 4RT2A 4DFMA 5DDMA 3E2EA 4FBUA 1DGSA 3SYZA 5AHXA 2KSOA 1NK8A 4EX7A 4EBCA 1PZNA 1ZOLA 1ZQKA 7ICGA 7ICRA 2CRXA 2AQ4A 2R8GA 5ALXA 1JRPA 3IHQB 4F5QA 2BCQA 4LZGA 1DGJA 3SV4A 5AM0A 3RJFA 3HKZF 5KFGA 2KJ8A 1NZPA 5KTQA 3QU2A 4UB8U 5DB8A 3TADC 1VLBA 2MAXA 2FDRA 4KMOB 2EANA 5KAFU 3OJUA 5KT3A 4UBCA 2ESEA 4QWAA 4BX9C 1JMSA 2JEJA 9ICRA 3MDCA 4DS4A 1ZQWA 1V85A 2BKEA 1SB3C 2KKVA 4J03A 3WK9A 3C21A 1Z00A 1L7OA 2NRTA 5ALIA 1SKWA 1MA7A 3PX6A 1FO4A 1SWVA 1NJYA 1XSNA 1D8BA 4G9BA 2R8KA 1EXNA 4WJ3B 4M9JA 4OJ6A 1SV0C 2G08A 4YD2A 5AIBA 3MR3A 1Z4OA 2I1QA 2HI0A 5IILA 1CEZA 2A3VA 1LKYA 3QNMA 2K4PA 9ICSA 4CF5A 1TAQA 2JMGA 5J2IA 1U47A 2KVCA 3SQIA 4F71A 4DQPA 3RJGA 5KAIU 3M7DA 1UA1A 5KT7A 5KFMA 3H0LB 3UXOA 4OCZA 5KFBA 3R9KA 3ETRA 2KZ3A 3C28A 2HHWA 2ZUDA 3Q8MA 2FLPA 4LZDA 1TAUA 1ZRNA 3RB6A 2XCPA 4C0ZA 4QIWC 3V6KA 8ICIA 1FIQA 2IOFK 5KFOA 4ECXA 3LWLA 5J2BA 2YX8A 3QYPA 7ICIA 4G3IA 4GXJA 1RG6A 3MC1A
chains in the Genus database with same CATH topology
4RQMA 5L1MA 1SXEA 2F44A 1SV4A 1LKYB 2KE7A 3BS5A 3TADC 1WWUA 2E8PA 4MHVA 1OXJA 2QKQA 3KKAA 4NJ8A 4NL9C 2EANA 5J8YC 1PK3A 2D8CA 2ES6A 2DL0A 2DKXA 1UCVA 3KKAC 2ESEA 2KSOB 3TADA 1KW4A 2Y9TA 5JTIA 1V38A 2QB0A 1WWVA 1X40A 2D3DA 4NL9A 5J8YA 1X66A 2F8KA 1B4FA 1JI7A 1V85A 3BQ7A 1UQVA 1B0XA 2FE9A 3H8MA 1DXSA 5F3XB 1OW5A 4PZNA 3IDWA 3BS7A 3SEIA 1SXDA 1Z1VA 2LMRA 2B6GA 3TACB 2QARA 2KMDA 1SV0C 2F3NA 3BS5B 2JV3A 4PZOA 2EAMA 2K60A 3SENA 2L5YA 1COKA 2E8MA 2GLEA 1LKYA 2EAOA 2K4PA 4RQNA 1SGGA 2Y9UA 2LPEA 2KG5A 1SV0A 2E8OA 2QB0B 3HILA 1PK1A 5KNIA 2KSOA 2QB1A 1X9XA 2EAPA 2E8NA 5JU5A 4IS7A 2KIVA 2YTUA 1F0MA 5JRTA 3K1RB 2DKZA 1PK1B 2QARB 1RG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQM A;  5L1M A;  1SXE A;  2F44 A;  1SV4 A;  1LKY B;  2KE7 A;  3BS5 A;  3TAD C;  1WWU A;  2E8P A;  4MHV A;  1OXJ A;  2QKQ A;  3KKA A;  4NJ8 A;  4NL9 C;  2EAN A;  5J8Y C;  1PK3 A;  2D8C A;  2ES6 A;  2DL0 A;  2DKX A;  1UCV A;  3KKA C;  2ESE A;  2KSO B;  3TAD A;  1KW4 A;  2Y9T A;  5JTI A;  1V38 A;  2QB0 A;  1WWV A;  1X40 A;  2D3D A;  4NL9 A;  5J8Y A;  1X66 A;  2F8K A;  1B4F A;  1JI7 A;  1V85 A;  3BQ7 A;  1UQV A;  1B0X A;  2FE9 A;  3H8M A;  1DXS A;  5F3X B;  1OW5 A;  4PZN A;  3IDW A;  3BS7 A;  3SEI A;  1SXD A;  1Z1V A;  2LMR A;  2B6G A;  3TAC B;  2QAR A;  2KMD A;  1SV0 C;  2F3N A;  3BS5 B;  2JV3 A;  4PZO A;  2EAM A;  2K60 A;  3SEN A;  2L5Y A;  1COK A;  2E8M A;  2GLE A;  1LKY A;  2EAO A;  2K4P A;  4RQN A;  1SGG A;  2Y9U A;  2LPE A;  2KG5 A;  1SV0 A;  2E8O A;  2QB0 B;  3HIL A;  1PK1 A;  5KNI A;  2KSO A;  2QB1 A;  1X9X A;  2EAP A;  2E8N A;  5JU5 A;  4IS7 A;  2KIV A;  2YTU A;  1F0M A;  5JRT A;  3K1R B;  2DKZ A;  1PK1 B;  2QAR B;  1RG6 A; 
#chains in the Genus database with same CATH topology
 3V7L A;  4F5P A;  3GIM A;  1ZQX A;  1ZQO A;  3SI8 A;  1NJZ A;  1WWU A;  4I2C A;  2C2D A;  8ICO A;  2KIW A;  1OXJ A;  2MUT A;  4DFK A;  1C20 A;  1NI3 A;  3HKZ C;  1TE2 A;  3UM9 A;  1ZQL A;  2VA2 A;  4PJ0 U;  4C7Z A;  4UB6 U;  2JR5 A;  3PX4 A;  1X40 A;  2H3V A;  5J0P A;  1TAM A;  9ICG A;  2VA8 A;  1QQ5 A;  5J0U A;  4FZM A;  3F2B A;  4MFF A;  4ECT A;  3ZD8 A;  2LM1 A;  4O3R A;  5D4B A;  1NK5 A;  3D2N A;  2XO7 A;  4U6P A;  4PHE A;  5G5H A;  1ZQF A;  8ICB A;  5CB1 A;  4GC7 A;  4FBT A;  8ICL A;  2JXJ A;  3C2M A;  1ARO P;  1NOM A;  2K89 A;  1KQQ A;  5EE9 A;  2WF5 A;  1T3N A;  3BS5 B;  3NVW A;  4ZH4 A;  3H0R B;  5BPC A;  1JXE A;  3QUC A;  4ED8 A;  2BQR A;  2QLT A;  1S9F A;  3C5G A;  5AK3 A;  4IC9 A;  2YMP A;  4RQ2 A;  1DRG A;  2FI1 A;  1N63 A;  4RQ6 A;  2LKY A;  4X5V A;  1N5W A;  5AK4 A;  3QE9 Y;  5J0Y A;  4JB3 A;  3NTU A;  5KFZ A;  1A76 A;  2ZIU A;  2JZB A;  2YML A;  5BOM A;  2KD1 A;  4F5O A;  5AKG A;  2HHX A;  2J6T A;  3G6Y A;  1XC9 A;  1ECW A;  2HBK A;  3SR6 A;  1L7M A;  2EZY A;  4QZ9 A;  3ZD9 A;  5L1M A;  1NJW A;  2PFP A;  2OM6 A;  2HBJ A;  4UAZ A;  2ISO A;  5IIM A;  1ZQH A;  2E8P A;  3Q8R B;  2C22 A;  5ALY A;  4NLB A;  1B22 A;  3D2S A;  5KG1 A;  2W04 A;  2BZF A;  2DKX A;  2R18 A;  4I2F A;  5KFX A;  2BDU A;  2W9A A;  4UAW A;  3AN1 A;  4DOA A;  1TV9 A;  1L5U A;  3ETL A;  3PW2 A;  2PFQ A;  2GO7 A;  2KFN A;  3LDA A;  2OHF A;  2C2R A;  4EEY A;  3OHB A;  3NVZ A;  2P6U A;  5KFY A;  4F8R A;  3ZI4 A;  1QSL A;  3CRX A;  9ICQ A;  2LBO A;  4IRC A;  1Z1V A;  5HMM A;  4KMU A;  4OJP A;  3TAC B;  5KFR A;  3RB4 A;  3E58 A;  5AKK A;  4ECS A;  4C7Y A;  2F1J A;  3SD7 A;  4C8O A;  3T3F A;  4FE3 A;  5J2G A;  2OEH A;  5DLG A;  4M0A A;  2E8M A;  3KTQ A;  2OYY A;  5KT2 A;  4J9L A;  4US9 A;  2XY5 A;  5J2F A;  4UAU A;  4B9U A;  4I2H A;  1VDV A;  4NLG A;  8ICQ A;  1CI4 A;  2ZUC A;  2E5S A;  1RYS A;  2LYB A;  1TK5 A;  5KT4 A;  8ICX A;  7ICJ A;  3EWA A;  2ZJA A;  2BR0 A;  4RT3 A;  3UMC A;  3L3F X;  1ZQA A;  3PSP A;  3PW4 A;  5TIS U;  1Z3E B;  3Q8L A;  5KFH A;  5AKX A;  1PK1 B;  3K1Z A;  3SAG A;  3IG8 A;  5KT6 A;  2H5X A;  2BHN A;  1QQ7 A;  2FMQ A;  1FEZ A;  1ZXI A;  1SV4 A;  1QTM A;  2ZJ8 A;  5KL8 B;  1RZT A;  3GIL A;  4ECR A;  5GTI U;  3M8R A;  5J8Y C;  2ZIX B;  2ALZ A;  3B0X A;  1XSP A;  2ZUB A;  4KX5 A;  5KT5 A;  4KIT B;  4O3Q A;  2HSZ A;  2K4H A;  2HBM A;  3IV6 A;  2J6U A;  7ICQ A;  2WB1 F;  2JHD A;  3D2Q A;  1X66 A;  1L8L A;  2EH9 A;  1JIH A;  2W9B A;  2HOQ A;  1HUZ A;  3BQ7 A;  1UQV A;  3RH6 A;  3UPQ A;  1NK7 A;  9ICP A;  2WAQ C;  2OCE A;  5ALR A;  4RNM A;  3C2K A;  4Y2J A;  3RR7 A;  1S0M A;  4UB1 A;  7ICL A;  1ZQC A;  2IOF A;  3H8S A;  1XSL A;  4YD1 A;  3H40 A;  1SL2 A;  4NY8 A;  3F5A A;  3NRZ A;  1IIP A;  4DSK A;  3ZDD A;  5KFQ A;  3C29 A;  2HHV A;  4QZD A;  1C7Y A;  4BUG A;  2LM4 A;  4RQN A;  4DWI A;  2HMX A;  2ZIW A;  2E8O A;  2W9C B;  3TQ1 A;  4QZE A;  1J97 A;  3I28 A;  3AQF A;  4QZA A;  3FC4 A;  3K75 D;  4QWC A;  3PR4 A;  4EZ9 A;  3HP6 A;  2A19 A;  2WF6 A;  4YG2 A;  3CP8 A;  2ASD A;  3DV9 A;  5HHH A;  1KFS A;  2B0C A;  1ZYQ A;  5EE1 A;  3AUO A;  1ZQD A;  4I2E A;  2KP7 A;  3C2L A;  4AP9 A;  2IBK A;  3FDS A;  1D8Y A;  4RQM A;  2YMQ A;  4I29 A;  2AGO A;  1BPB A;  1Q46 A;  4JUZ A;  2KV2 A;  2FPL A;  3KHR A;  3EPI A;  3A0B U;  5DB6 A;  1UT5 A;  2D8C A;  3RJE A;  4DLE A;  3WKC A;  4YFK A;  1NKE A;  5J2J A;  4JV2 A;  1KL9 A;  3N7R C;  5J0Q A;  5ALE A;  4DSE A;  5L1I A;  4ED3 A;  2XVT A;  4J9Q A;  4NLZ A;  4NL9 A;  4F5N A;  4I2I A;  3WK4 A;  3H8J A;  5J2C A;  2IOH A;  3ZDA A;  2BCV A;  3WK7 A;  2YN4 A;  4PZN A;  1RXV A;  3F53 A;  2RDJ A;  4M9H A;  4R65 A;  2VA3 A;  5FP0 A;  1D9D A;  1JRO A;  4RNN A;  2ZTE A;  2XGQ A;  3PR5 B;  5F9L A;  2JV3 A;  9ICA A;  3AMZ A;  2PI4 A;  2H3F A;  4DOC A;  3N4M B;  2HCF A;  1A6S A;  2NO5 A;  2VIX A;  5KFL A;  2KKP A;  5AK6 A;  4Y2Q A;  4Y2X A;  1O03 A;  5CEH A;  3C1Z A;  4OO1 J;  2K4I A;  3PV8 A;  3ISD A;  2LI6 A;  1N61 A;  2K8C B;  2E8N A;  1KSP A;  4IS7 A;  1ZD3 A;  4C4T A;  2BQ3 A;  5ALM A;  3WKB A;  4DQR A;  3MGH A;  4M6W B;  4R8U B;  1XWL A;  4TUQ A;  2PMZ C;  5CJ7 A;  2PI5 A;  9ICN A;  1U45 A;  3PST A;  1RM6 C;  2DKZ A;  2HW3 A;  2VJ5 A;  3BQT A;  4FZN A;  2ZXI A;  1S0V A;  4XA5 A;  1BPX A;  4NWI A;  3KHG A;  1SXE A;  1HEK A;  4JMU A;  1BVS A;  5GTH U;  4Z6F A;  2WF8 A;  1NJX A;  3PZP A;  4YMO A;  3UQ2 A;  4PH5 A;  8ICW A;  4DQQ A;  3PO5 A;  4C80 A;  5BOL A;  1UA0 A;  1S0O A;  2OWO A;  2OH2 A;  5JTI A;  4Y2R A;  4DL6 A;  3OTQ A;  4AYB C;  5AM1 A;  2EZX A;  2FJ6 A;  2UVR A;  8ICV A;  5DLF A;  4M9G A;  4PGX A;  4JK1 A;  3PY8 A;  3NVY A;  3M6K A;  4M9L A;  4J9P A;  2K4E A;  5ALZ A;  2JRZ A;  4U7C A;  9ICL A;  2DUY A;  2BGW A;  3N7S C;  3C5F A;  2F3N A;  7ICH A;  4YR0 A;  3TAN A;  2PFN A;  4QZH A;  1N2X A;  2F1I A;  1TFR A;  5K4L A;  1XO0 A;  2RRD A;  4J9K A;  3SAH A;  4DQI A;  5DBB A;  1YZ6 A;  4I2B A;  2AGP A;  2YMM A;  4Q8F A;  3THV A;  5L9X A;  2DPJ A;  9ICO A;  5IIK A;  4QJF B;  4ECU A;  4Y2S A;  4GC6 A;  3KFU F;  1XNS A;  8ICG A;  2XC9 A;  4Q43 A;  4B6J A;  2KZZ A;  4DL2 A;  4RPY A;  5DQI A;  2YTU A;  3ONN A;  1YZ7 A;  3LVV A;  3PNC A;  3KHH A;  1X9M A;  4QW9 A;  5EWG A;  3BZC A;  5AI5 A;  3WKA A;  5AM5 A;  1SKR A;  3GIJ A;  3LK9 A;  1ZD4 A;  4TUR A;  9ICJ A;  1ZJN A;  4NJ8 A;  5J0S A;  4UQG A;  4YMM A;  1N62 A;  8ICR A;  4IRK A;  3A0H U;  1UCV A;  4M9N A;  4F4Y A;  4YXJ A;  2ZIV B;  4DL4 A;  3WKD A;  1ZQV A;  4FFD A;  2KK0 A;  1V38 A;  1B43 A;  4F72 A;  1KDH A;  1NKC A;  4KLG A;  4BWM A;  8ICK A;  1QCK A;  4ACO A;  4RUA A;  2OXO A;  2HHS A;  8ICH A;  4Y2T A;  2F77 X;  4HAI A;  2MSN A;  4NLC A;  4IR1 A;  1ZQU A;  3EPG A;  3GIK A;  2JEG A;  4ECZ A;  2W43 A;  1N48 A;  3LYS A;  5B66 U;  1ZQT A;  1L3T A;  4YN4 A;  1CRX A;  4MFC A;  1IXR A;  2NRW A;  4NXZ A;  2P35 A;  3N7P D;  2YB1 A;  3TAR A;  3QX7 A;  5AK5 A;  9ICU A;  4YQW A;  4EZ6 A;  2LHT A;  5AKL A;  4KLJ A;  3J81 j;  5KFW A;  9ICH A;  3ALR A;  5H2F U;  3RJH A;  5CA7 A;  3Q8P B;  2UVV A;  4R66 A;  1X9W A;  4KLQ A;  1U9L A;  2Y0S F;  1F0M A;  5J2H A;  3TFR A;  1L7N A;  3GZF A;  2QAR B;  3PW5 A;  3ICX A;  4Y2V A;  4EEK A;  1TK8 A;  2WFA A;  3GFK B;  4ZOH C;  4O9M A;  4F91 B;  2HOI A;  3UMG A;  4QZF A;  8ICE A;  1ZQI A;  1SZP A;  5KFF A;  4DSI A;  2GH1 A;  3GDX A;  1QQ6 A;  5KG2 A;  2K8A A;  3WK6 A;  8ICN A;  1X6I A;  4ED1 A;  8ICP A;  4DQS A;  4RQ4 A;  5ALT A;  4KLU A;  5AIC A;  2Y1I A;  3RJI A;  1O08 A;  3QZ8 A;  3GII A;  5KFK A;  1Q3U A;  1J2N A;  3TAD A;  5ALP A;  2W55 A;  4RU9 A;  2ZTC A;  1V97 A;  2DGZ A;  4MF8 A;  4F5R A;  1MN8 A;  1ZQB A;  3T5J A;  4YMN A;  1LVH A;  4RPZ A;  3IN5 A;  3ORY A;  4ECQ A;  3UMB A;  4M04 A;  2HHQ A;  4DS5 A;  1ZQS A;  4FO6 A;  1HJP A;  4JWN A;  3PSI A;  2Z7J A;  4IQV A;  2KN7 A;  2IHN A;  1CUK A;  5ALH A;  4MEX A;  3EUB 2;  4GXI A;  2Q0Z X;  5J29 A;  4YR3 A;  3EW9 A;  1KFT A;  2G5H B;  5DG7 A;  3H4B A;  2GLE A;  1JX4 A;  1SIJ A;  2EAO A;  3RF9 A;  4ELU A;  1SV0 A;  4RQ7 A;  1PVR A;  3BQ2 A;  3QXG A;  4Y2Y A;  7ICS A;  3O0F A;  3AL0 B;  3KBB A;  3N28 A;  4GLX A;  4BXO B;  2PKE A;  2DF4 B;  1ZQY A;  2A1A A;  2ZIW B;  1JAL A;  2JEF A;  1NNL A;  1X2I A;  3MR5 A;  2V4Q A;  3NVV A;  2V9W A;  2B21 A;  2DBY A;  3F2D A;  3QZ7 A;  2RP5 A;  2CXY A;  4C4S A;  5CR0 A;  3PW0 A;  3OSP A;  1N5X A;  3BDP A;  2F44 A;  4UAS A;  3NAS A;  1S76 D;  1RYU A;  3BS5 A;  5KFS A;  2W11 A;  9ICE A;  3LWM A;  1RQL A;  4DL3 A;  2H3Z A;  2JH1 A;  2W54 A;  1PK3 A;  8ICU A;  1S0N A;  1T7P A;  2DL0 A;  4P0P B;  4IRD A;  8ICY A;  2HVI A;  5KFI A;  7ICK A;  1MQ2 A;  8ICF A;  4GIB A;  2DPI A;  4DL7 A;  1WWV A;  4E0D A;  4OJ5 A;  5AI4 A;  1ZD2 P;  3FM9 A;  5AI9 A;  4O3P A;  1KEJ A;  2XCA A;  3IG5 A;  3H4D A;  1ZQJ A;  3K4G A;  4XRH A;  1DOQ A;  4DSF A;  4B9S A;  5J2A A;  3D6J A;  3L4P A;  2KIC A;  1JXL A;  2RQ5 A;  3C23 A;  3RRH A;  3MAB A;  1P7D A;  5B5E U;  2CPR A;  4K4I A;  5ALF A;  7ICF A;  4J9S A;  4NLK A;  1COO A;  1RDF A;  2I5H A;  3M8S A;  2R8J A;  5J0O A;  8ICM A;  1ED1 A;  3JPR A;  3CYM A;  4UAV A;  4UB3 A;  3C1Y A;  3HT3 A;  5ALO A;  3AQE A;  3NRW A;  5C0Y A;  5KFP A;  3V72 A;  1S10 A;  3RFA A;  2QB0 B;  2BPG A;  4Z6C A;  3QEA Z;  1Z19 A;  3SAF A;  2XGP A;  2XY6 A;  9ICX A;  5C5J A;  4K4G A;  1TKD A;  1NKB A;  5EE0 A;  2PFO A;  3G6V A;  5ALL A;  1N56 A;  1T3Q A;  1UHU A;  9ICF A;  2G5I B;  3T79 A;  8ICJ A;  4O3O A;  1NZB A;  2WTF A;  3RRG A;  3WK5 A;  3RAX A;  3UXN A;  3JPP A;  3RAQ A;  2KE7 A;  4QZC A;  2UVU A;  1QSY A;  2UVW A;  1KTQ A;  3MBY A;  1KFD A;  2XID A;  1M6Y A;  4R64 A;  3RTV A;  1A77 A;  1AQ6 A;  4P4M A;  1LV5 A;  3SZ2 A;  4ECV A;  2KSO B;  5A0L A;  5DG8 A;  3AU2 A;  4OJL A;  2KHQ A;  3PSF A;  4I2J A;  2DFL A;  2ATL A;  3ZDC A;  5IIO A;  2F8K A;  4MF2 A;  3ZDE A;  3PO4 A;  4YXM A;  2FMS A;  4JWM A;  1ZQQ A;  4CE6 A;  1SL1 A;  3OPX A;  1XO1 A;  2M9N A;  4EBD A;  4YP3 A;  5F3X B;  9ICK A;  3BS7 A;  2BCU A;  3NS1 A;  1SXD A;  4RQ3 A;  4P0Q A;  2B6G A;  4RZR A;  5EWF A;  4KLT A;  4C8L A;  4PL2 A;  4CCH A;  4F2S A;  3V7K A;  2O6K A;  5J0W A;  3QU5 A;  1WUD A;  2P66 A;  1UPH A;  3TKA A;  1FFU A;  2WB1 C;  3JPO A;  3IM1 A;  4ED6 A;  2VAN A;  5AKH A;  2ZIX A;  1Q8K A;  3JPS A;  3RR8 A;  3I1Y A;  2W9M A;  3KD3 A;  2LYA A;  3FYH A;  5DB9 A;  1SZH A;  5ALQ A;  3HIL A;  4FS2 A;  2LYH A;  2QB1 A;  4I27 A;  2EAP A;  2M0N A;  3M9N B;  1Z00 B;  4QWD A;  5III A;  8ICC A;  5AIA A;  7ICM A;  2K8B B;  3PW7 A;  3G6X A;  1ZET A;  3KZI U;  3HWT A;  1VJ5 A;  3OHA A;  3H7I A;  2WF9 A;  4IL6 U;  5KG5 A;  1LKY B;  2G09 A;  5DGA A;  1L3V A;  4EEN A;  2E3T A;  2A1J A;  5DKW A;  4CGZ A;  2V4R A;  5ALV A;  3KKA C;  3MR2 A;  4EBE A;  1X42 A;  2GWS A;  4M47 A;  4YVZ A;  2W9C A;  1KW4 A;  3M9O B;  1NK0 A;  2D3D A;  3WK8 A;  5J8Y A;  3RBD A;  1K5O A;  1B4F A;  4DFD A;  1B0X A;  4DFJ A;  2NRV A;  3RB0 A;  2NO4 A;  3I76 A;  1QSS A;  2FE9 A;  4M2Y A;  2PXI A;  4F2R A;  4B9V A;  9ICW A;  2AH5 A;  3UXP A;  4KLH A;  2EQY A;  4F4X A;  3NUQ A;  4DLG A;  4F4K A;  4EYH B;  4JV0 A;  4KLI A;  1Q3V A;  5ALU A;  4QIW F;  4KLD A;  4J9M A;  5AKI A;  2C2E A;  4B9M A;  2MUT B;  4KX3 A;  1L7P A;  2HOF A;  7ICO A;  4CNQ A;  3BQ1 A;  1ZQG A;  3GU3 A;  4ELV A;  3H0M B;  5CRX A;  5KG4 A;  1PVP A;  3E0F A;  3GV8 B;  2KHV A;  1S97 A;  4ED2 A;  2YY6 A;  5CP2 A;  5AI0 A;  4UAT A;  5DQG A;  5KL1 B;  3GV5 B;  1Z1B A;  1PVQ A;  2KIV A;  2J6S A;  5DGB A;  5KFC A;  4QZB A;  2ZJ5 A;  4BWJ A;  4RUC A;  1XS9 D;  5CWR A;  4PHA A;  4O0I A;  3U26 A;  1L3S A;  4ECW A;  3KHL A;  4DEZ A;  4UAR A;  4ED0 A;  4TUP A;  2VKQ A;  1IG6 A;  5EWE A;  2P6R A;  4DF8 A;  2QKQ A;  4QZG A;  3TFS A;  4KN7 A;  2E1E A;  1HUO A;  4O3M A;  3Q8K A;  4O5C A;  4NM1 A;  4ELT A;  4O5K A;  1U49 A;  8ICA A;  3GQC A;  1N60 A;  4NLN A;  2W3R A;  4OJO A;  5AKJ A;  3HRD D;  5AM3 A;  5DBA A;  3ISB A;  5KFE A;  1ZJM A;  2ZIU B;  1U4B A;  2JZB B;  1K1Q A;  4Z6E A;  2HDO A;  5AKZ A;  2XI9 A;  3MFI A;  4TQS A;  4MEY A;  4FZL A;  2ZTD A;  3Q8Q B;  4I2G A;  4M6W A;  4R8U A;  2Q4T A;  4OD0 A;  1PUZ A;  2KVS A;  3NGD A;  4KLF A;  1ZQZ A;  3OJS A;  2LMR A;  4IR9 A;  1LB2 B;  2KMD A;  3DEE A;  1H38 A;  4QNL A;  5KFD A;  3QUB A;  2K60 A;  9ICI A;  3JPQ A;  2L5Y A;  3BJY A;  1T8E A;  1F5S A;  3S6J A;  3V7J A;  2KEY A;  2GOL A;  3RB3 A;  1ZQN A;  2FMP A;  2FLL A;  2FLN A;  3JPN A;  5J2K A;  1SKS A;  5KNI A;  4PGQ A;  4B9L A;  4K4H A;  2G07 A;  5E79 U;  5JU5 A;  4PPX A;  4MFA A;  3PVX A;  2YQE A;  4P4P A;  8ICS A;  1RXW A;  2KJ9 A;  4DO9 A;  2W3S A;  4TQR A;  3KZX A;  7ICN A;  2ZXH A;  4ED7 A;  5JRT A;  4USA A;  2F2A B;  2BCR A;  4RQ5 A;  2KOB A;  5J2E A;  3V6H A;  2ISP A;  4FS1 A;  2NRX A;  4QWB A;  3PX0 A;  3V6J A;  1IV8 A;  2IHM A;  2R8H A;  3AM9 A;  3PML A;  2W03 A;  1UT8 A;  2WF7 A;  3KKA A;  2ODG A;  3H8W A;  5ALG A;  4PHD A;  3IP4 B;  2ZG6 A;  4UW9 A;  4CF3 A;  3L5K A;  2AGQ A;  3ZDB A;  4Y2U A;  3QU4 A;  3TAP A;  1WYG A;  1S8O A;  2EZZ A;  3PMN A;  4CRX A;  1JI7 A;  3RJJ A;  5KFV A;  2AXT U;  3WKE A;  2BPC A;  4C8K A;  1Y88 A;  1S77 D;  4EEL A;  1L6N A;  3MDA A;  5KFA A;  5CHG A;  4RQ8 A;  3KOO A;  2IMW P;  1TVA A;  1TK0 A;  5TZV A;  3BQ0 A;  4Z6D A;  2NV3 A;  1U48 A;  4QWE A;  2N1R A;  4P4O A;  3SEN A;  2EAM A;  3QU9 A;  1ZQR A;  1KLN A;  1BNO A;  3CW2 C;  2NRZ A;  2HBL A;  2C28 A;  2HHU A;  1SGG A;  1YT3 A;  2F8L A;  5KFT A;  5DQH A;  4Y2P A;  2KG5 A;  2RHF A;  3M1Y A;  2Y1J A;  4CF4 A;  5EOZ A;  4EYI B;  4KLM A;  2ASL A;  2ZIV A;  1URJ A;  4P2H A;  7ICV A;  2W9B B;  4DOB A;  3OGU A;  3IRU A;  5IIJ A;  4C4R A;  1Z4N A;  1KRP A;  4F4Z A;  5JUM A;  5ALS A;  5HP4 A;  3K1R B;  4PGY A;  1XU4 A;  4NV0 A;  5L1L A;  1T94 A;  3MFH A;  3MGV A;  1T4G A;  5AKE A;  2MRL A;  5KG6 A;  1KKX A;  2BQU A;  2WAQ F;  2KTQ A;  3M9M B;  4NL9 C;  1JUD A;  2JH7 A;  5J2D A;  2D6F C;  5J0X A;  1JN3 A;  4DF4 A;  5J0T A;  1J2M A;  3MR6 A;  2EDU A;  2I9G A;  2Y9T A;  2Y0S C;  5KFN A;  1SL0 A;  1MSW D;  2KNJ A;  4KLO A;  2W8L A;  5AKY A;  1DK3 A;  4Q8E A;  5EE3 A;  3AEV A;  3OSN A;  4IQU A;  4B9N A;  1MQ3 A;  4YR2 A;  4DFP A;  1DXS A;  1V9P A;  1OW5 A;  3DDH A;  3HJE A;  3SEI A;  4YCX A;  3QUT A;  9ICB A;  5DB7 A;  3RH5 A;  4LJX A;  3EZ5 A;  4BDP A;  2QAR A;  4C8N A;  1BPD A;  5F9N A;  1L3U A;  3QU7 A;  4QZI A;  4C8M A;  4UB4 A;  7ICE A;  1COK A;  4DCC A;  4ECY A;  2VJ4 A;  5IIN A;  1BPE A;  4RQ1 A;  1ZRM A;  2Y9U A;  2LPE A;  4RNO A;  2W8K A;  5D46 A;  4NM2 A;  4P0Q B;  5KG7 A;  2JEI A;  4J9N A;  2MA1 A;  4UB2 A;  4XUS A;  4Q45 A;  1X9X A;  2H3I A;  1NK6 A;  4F92 B;  7ICU A;  1K1S A;  3JPT A;  3M6Z A;  5G5G A;  1ZD5 A;  2W7P A;  5L1K A;  1D9F A;  1OUQ A;  7ICT A;  4QZ8 A;  1ZQE A;  1DK2 A;  4KLS A;  3F2C A;  2HVH A;  4BJQ A;  3MGI A;  1BPY A;  1S5L U;  1ZQP A;  4O3S A;  5KG0 A;  2G0A A;  2AU0 A;  4IQT A;  1RPL A;  1RQN A;  2YB4 A;  4F4W A;  3GV7 B;  3TAQ A;  3Q8S B;  5AM2 A;  1X6J A;  4GFJ A;  3SMV A;  3QUQ A;  9ICC A;  5AI6 A;  1KN5 A;  4I28 A;  3T5H A;  2ES6 A;  2RDI A;  5DG9 A;  2RLT A;  2FPK A;  2BDP A;  4ICA A;  1GO3 F;  3T5L A;  3ED5 A;  3SV3 A;  5ALN A;  4A8E A;  3RBE A;  1NK4 A;  2A1J B;  3RH4 A;  2MU2 A;  4B9T A;  8ICT A;  1X9S A;  2BPF A;  4J9O A;  1MC8 A;  5HNK A;  4BXO A;  3H8M A;  5KFJ A;  3T5K A;  1SWW A;  5HHI A;  2JGA A;  5DDY A;  4EX6 A;  4J9R A;  3B9J A;  1NK9 A;  1L8O A;  3HPO A;  4O5E A;  2PMZ F;  2E1F A;  3BZK A;  3LVW A;  3FAH A;  2XIC A;  4RPX A;  4PHP A;  2XY7 A;  4I2A A;  4F50 A;  4KLL A;  4I2D A;  2KZM A;  4DL5 A;  4P0P A;  4IQW A;  4KN4 A;  5ALW A;  4BGD A;  4DSJ A;  4F93 B;  4LVS A;  1PK1 A;  5J0R A;  3ISC A;  4JV1 A;  2IA6 A;  3N97 B;  2DQN B;  4R63 A;  4TUS A;  1ZQM A;  2DWQ A;  5D49 A;  9ICM A;  2KJ5 A;  5KG3 A;  4CDG A;  8ICZ A;  2F1H A;  5ALD A;  3UQ0 A;  4AYB F;  7ICP A;  2WHE A;  2F76 X;  2AHO B;  5HML A;  3VC8 A;  4UAY A;  4US8 A;  9ICT A;  2NYV A;  1QH9 A;  4O3N A;  2KFZ A;  3HX0 A;  4XQ8 A;  5HR6 A;  5L1J A;  5ALK A;  1D8L A;  4MHV A;  1WCN A;  4QW8 A;  3HW8 A;  2CN1 A;  1QLN A;  5T14 A;  2G06 A;  2I6X A;  3QEB Z;  1WG8 A;  1KBU A;  4PL1 A;  3F5E A;  3TI0 A;  5AI8 A;  5KFU A;  2AJQ A;  2QB0 A;  2R8I A;  3CNH A;  1BNP A;  3AU6 A;  1BGX T;  1WCL A;  1BPZ A;  2BCS A;  4UB5 A;  5ALJ A;  4UBB A;  1HIW A;  4KLE A;  2FPM A;  3B0Y A;  4F3O A;  2HHT A;  4Q44 A;  2H3Q A;  3IDW A;  4RQ0 A;  1F44 A;  5HR7 A;  2W7O A;  3WU2 U;  5DBC A;  3EYZ A;  9ICV A;  1RYR A;  4DSL A;  4GXK A;  4PZO A;  3RJK A;  2AQ0 A;  2ASJ A;  5AM4 A;  3VCB A;  1FFV A;  1IM4 A;  1ZQ1 C;  4HYK A;  1A0P A;  4KTQ A;  4RT2 A;  4DFM A;  5DDM A;  3E2E A;  4FBU A;  1DGS A;  3SYZ A;  5AHX A;  2KSO A;  1NK8 A;  4EX7 A;  4EBC A;  1PZN A;  1ZOL A;  1ZQK A;  7ICG A;  7ICR A;  2CRX A;  2AQ4 A;  2R8G A;  5ALX A;  1JRP A;  3IHQ B;  4F5Q A;  2BCQ A;  4LZG A;  1DGJ A;  3SV4 A;  5AM0 A;  3RJF A;  3HKZ F;  5KFG A;  2KJ8 A;  1NZP A;  5KTQ A;  3QU2 A;  4UB8 U;  5DB8 A;  3TAD C;  1VLB A;  2MAX A;  2FDR A;  4KMO B;  2EAN A;  5KAF U;  3OJU A;  5KT3 A;  4UBC A;  2ESE A;  4QWA A;  4BX9 C;  1JMS A;  2JEJ A;  9ICR A;  3MDC A;  4DS4 A;  1ZQW A;  1V85 A;  2BKE A;  1SB3 C;  2KKV A;  4J03 A;  3WK9 A;  3C21 A;  1Z00 A;  1L7O A;  2NRT A;  5ALI A;  1SKW A;  1MA7 A;  3PX6 A;  1FO4 A;  1SWV A;  1NJY A;  1XSN A;  1D8B A;  4G9B A;  2R8K A;  1EXN A;  4WJ3 B;  4M9J A;  4OJ6 A;  1SV0 C;  2G08 A;  4YD2 A;  5AIB A;  3MR3 A;  1Z4O A;  2I1Q A;  2HI0 A;  5IIL A;  1CEZ A;  2A3V A;  1LKY A;  3QNM A;  2K4P A;  9ICS A;  4CF5 A;  1TAQ A;  2JMG A;  5J2I A;  1U47 A;  2KVC A;  3SQI A;  4F71 A;  4DQP A;  3RJG A;  5KAI U;  3M7D A;  1UA1 A;  5KT7 A;  5KFM A;  3H0L B;  3UXO A;  4OCZ A;  5KFB A;  3R9K A;  3ETR A;  2KZ3 A;  3C28 A;  2HHW A;  2ZUD A;  3Q8M A;  2FLP A;  4LZD A;  1TAU A;  1ZRN A;  3RB6 A;  2XCP A;  4C0Z A;  4QIW C;  3V6K A;  8ICI A;  1FIQ A;  2IOF K;  5KFO A;  4ECX A;  3LWL A;  5J2B A;  2YX8 A;  3QYP A;  7ICI A;  4G3I A;  4GXJ A;  1RG6 A;  3MC1 A; 
#chains in the Genus database with same CATH homology
 4RQM A;  5L1M A;  1SXE A;  2F44 A;  1SV4 A;  1LKY B;  2KE7 A;  3BS5 A;  3TAD C;  1WWU A;  2E8P A;  4MHV A;  1OXJ A;  2QKQ A;  3KKA A;  4NJ8 A;  4NL9 C;  2EAN A;  5J8Y C;  1PK3 A;  2D8C A;  2ES6 A;  2DL0 A;  2DKX A;  1UCV A;  3KKA C;  2ESE A;  2KSO B;  3TAD A;  1KW4 A;  2Y9T A;  5JTI A;  1V38 A;  2QB0 A;  1WWV A;  1X40 A;  2D3D A;  4NL9 A;  5J8Y A;  1X66 A;  2F8K A;  1B4F A;  1JI7 A;  1V85 A;  3BQ7 A;  1UQV A;  1B0X A;  2FE9 A;  3H8M A;  1DXS A;  5F3X B;  1OW5 A;  4PZN A;  3IDW A;  3BS7 A;  3SEI A;  1SXD A;  1Z1V A;  2LMR A;  2B6G A;  3TAC B;  2QAR A;  2KMD A;  1SV0 C;  2F3N A;  3BS5 B;  2JV3 A;  4PZO A;  2EAM A;  2K60 A;  3SEN A;  2L5Y A;  1COK A;  2E8M A;  2GLE A;  1LKY A;  2EAO A;  2K4P A;  4RQN A;  1SGG A;  2Y9U A;  2LPE A;  2KG5 A;  1SV0 A;  2E8O A;  2QB0 B;  3HIL A;  1PK1 A;  5KNI A;  2KSO A;  2QB1 A;  1X9X A;  2EAP A;  2E8N A;  5JU5 A;  4IS7 A;  2KIV A;  2YTU A;  1F0M A;  5JRT A;  3K1R B;  2DKZ A;  1PK1 B;  2QAR B;  1RG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...