4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
3B9RA 3M1YA 2RB5A 3OCZA 4L6CA 3AR2A 2C88A 3ZTWA 3I76A 4EELA 2GFHA 4HGPA 4NV0A 3QUCA 3FGOA 4RETA 3OCXA 1WR8A 3FM9A 2FPSA 2W4MA 3RFUA 2YMLA 3R4CA 4EEKA 2YMQA 3WK5A 3L0YA 5ALJA 5AKYA 1Z5UA 1EK2A 4CF3A 1O08A 4BNDA 4I9FA 4CF5A 2OA0A 5AI4A 3ESRA 1O03A 2CN1A 2OBBA 2O9JA 2NYVA 2GHQA 5AM5A 5AKXA 1FEZA 1RMQA 3AR8A 5AKIA 4YCLA 3NAMA 3L1VA 1TJ4A 4J2TA 3IB6A 3W5CA 4AS2A 3L7YA 4YCNA 3ZVLA 3W5DA 1RMYA 5ALNA 2YFYA 5AESA 3ED5A 1RLTA 3NIWA 1L7OA 2YBDA 2IOHA 1L7NA 3PGVA 4UATA 3IRUA 4KX3A 2IOFK 2B0CA 3MN1A 3BA6A 1XP5A 3WKAA 2MU2A 4Y2VA 1TJ3A 5AW7A 5AHXA 1ZD2P 2NO4A 5ALKA 2PKEA 3QU2A 5IS2A 2AGVA 2MSNA 4UM7A 5FP0A 3SKXA 3N07A 4YIHA 3WKDA 5AM3A 1WVIA 2JGAA 4UW9A 4C4TA 2I33A 2ODAA 3FVVA 3DNPA 4XQ0A 2WF9A 3N1UA 3SMVA 2QLTA 3QU5A 4Y2YA 1XVIA 4L57A 4UMEA 3R9KA 1ZD3A 4GIBA 5IT4A 4DFDA 3VAYA 3CZ4A 1TA0A 1EK1A 3S6JA 3WK4A 2EAUA 2JAUA 4Y2RA 1U2SA 3QU4A 1J97A 2FPWA 2YJ4A 4AS3A 3HYCA 2CFTA 3KD3A 1WZCA 3ESQA 4YCMA 2C9MA 2MU1A 2G1AA 1Z4OA 1U02A 5ALEA 1QYIA 2FPUA 3B8EA 2X4DA 4KN8A 1RC8A 2IA5A 4G9BA 2WM8A 3E81A 2WHEA 3B9BA 2HHLA 5ALOA 2O2XA 3MMZA 2CFRA 2ZG6A 4YH1A 4EZEA 2HSZA 5AVWA 4QQFA 3DDHA 2P69A 3AR7A 4NWIA 2C4NA 2ZXEA 4Y3UA 4JB3A 5AKKA 4YIKA 3L8GA 3AR4A 5AKJA 3OTQA 2JAOA 4OFZA 2ZBDA 3J7TA 4NFLA 4B6JA 3N8GA 3AR3A 3WGUA 2QYHA 4O8CA 2Q5EA 1MH9A 4NAVA 4ZEVA 2AH5A 1QH9A 3UMGA 2B82A 1XPJA 3L0CA 1Z4IA 2FPXA 4ZEXA 1RRCA 2G06A 2HDOA 2I34A 4EENA 5ALPA 3L5KA 3KBBA 1U7OA 3EWIA 3A1CA 4HYTA 4UMFA 5AI0A 2FPRA 3RF6A 4XPZA 1YDFA 2ZBFA 4CF4A 3ZX5A 3AR5A 1Z4NA 3GYGA 5AKGA 3QGMA 1QQ5A 2Q4RA 3ONNA 3U7GA 3ET5A 3N5KA 5ALHA 2YMMA 4XOUA 1PW5A 3L8FA 1ZS9A 3SLRA 3ZTYA 1Z4MA 1L8OA 2HCFA 3K1ZA 1ZJJA 2JARA 4OD0A 1Z88A 2PQ0A 4HGNA 1T9ZA 5AM0A 2G08A 3L8HA 4BYGA 5ALLA 3QUTA 5AW9A 1VJRA 5A3QA 1Z4QA 2GMWA 3N28A 3WGVA 2HOQA 4JDPA 2R8YA 5AIBA 3QU9A 2R8EA 1L7MA 5AKEA 2WFAA 3E8MA 3NUQA 2I7DA 3OCVA 3FZQA 3ZW7A 3PDWA 1CR6A 2C8LA 2BY4A 1Q91A 4ZEWA 4BX2A 5JJBA 3NALA 4MUMA 4BBJA 3W5AA 1RLMA 5AW3A 4J03A 4HGOA 3U7HB 2WF8A 2P27A 3M9LA 4E88A 4UAUA 3PCTA 4OHFA 4Y2JA 3KDPA 1JUDA 1LTQA 1YMQA 5AW6A 5AICA 1RQNA 2RARA 4Y2SA 2FUEA 5AI9A 4FYPA 3SKYA 3EF0A 3MC1A 3SF0A 5IT0A 3W5BA 3OPXA 2DQSA 5ALTA 4DW8A 3ZU6A 1YNSA 4UMVA 2P11A 3ZWKA 2FI1A 1RKQA 3EF1A 4EX7A 1T5TA 3A1DA 3SHQA 5AI8A 3U13A 3ZVMA 5AKZA 2B30A 4GXTA 4AP9A 2AUTA 2FUCA 2HF2A 1ZD4A 2R8XA 4PNHA 2EATA 1U7PA 3I6BA 2YN4A 3A3YA 1RDFA 2WF7A 4BKMA 3QYPA 5AI5A 3FPBA 5AW2A 3QX7A 3ZI4A 4DWOA 4BEWA 3NASA 2B8EA 1TJ5A 1S8OA 3A1EA 3QUBA 1VJ5A 3U7FB 1NRWA 5AVTA 1LVHA 1RKVA 5AVZA 4UASA 3E84A 1S2OA 4FE3A 4I9GA 2IYEA 4F71A 5AVYA 3WK7A 1L6RA 4RESA 4XE5A 3QNMA 1RPZA 2OYCA 2GO7A 5AW5A 3EPRA 2HI0A 2IOFA 1YS9A 4KYTA 4MWOA 4CE6A 3IJ5A 1ZD5A 2HF7A 4KX5A 4BX0A 2Q4TA 3DAOA 4QJBA 3ZX4A 4HGQA 1K1EA 5ALGA 3CNHA 4FFDA 1U2TA 1SU4A 2WF5A 4HGRA 2G0AA 3KOOA 2HX1A 3NRJA 5ALRA 5ALUA 1T5SA 5E0OA 4Y2UA 1Z4PX 1NF2A 4OCZA 2BDEA 3PGLA 1Q92A 5AVQA 4C4RA 3DV9A 3WKCA 2RAVA 4YGYA 4UARA 4UMDA 1YJ5A 2B1RA 2C8KA 5AVRA 3UMCA 4NABA 3D6JA 5AVUA 2B1QA 2BDUA 2I54A 5AI6A 2I55A 4G63A 4UU1A 4BNDB 5AW8A 2W11A 5ALVA 3AR6A 1Z4KA 5AKHA 3HLTA 3ZVNA 4IG4A 3SD7A 4C4SA 2D2VA 3L0BA 3P96A 1WPGA 5ALSA 3I1YA 1ZOLA 1IWOA 3MPOA 1Z5GA 3KC2A 5AKLA 2HO4A 1SWVA 3ZUPA 3ZWDA 5AVXA 1QQ6A 3TLMA 2FDRA 3KZXA 5A3RA 2G09A 3QLEA 1SWWA 5AM2A 2CFSA 3WK6A 2JAWA 5AW4A 3L8EA 2R8ZA 5AK4A 4BEVA 3I28A 2WF6A 3L1UA 4IFTA 3U26A 3OCWA 2FEAA 5A3SA 2ZBGA 4EX6A 1X42A 1Z4LA 3UMBA 2AMYA 2GHTA 1F5SA 4Y2XA 1TE2A 5AM1A 1VFPA 3U7EB 2G07A 5ALYA 5AIAA 1ZRMA 5T41A 1NNLA 2ZOSA 3UM9A 3WKBA 1AQ6A 1CQZA 3F9RA 1Z4JA 5ALFA 1ZRNA 1L8LA 1J8DA 5AVSA 1RQLA 5ALDA 3WKEA 4UAVA 5ALWA 1RLOA 2P9JA 2W43A 2YY6A 3NANA 4KNWA 4BX3A 5ALXA 2G80A 1L7PA 5AM4A 2RBKA 3QXGA 4DCCA 1RMTA 2HEGA 1YV9A 4KNVA 3WK9A 1N8NA 5AW0A 1Y8AA 4L6AA 2I6XA 2YJ6A 5AK3A 3OCYA 3BWVA 2NO5A 3FPSA 3WK8A 4F72A 1KYTA 4H1WA 1N9KA 5ALZA 3AR9A 5AW1A 3ET4A 2OM6A 5AVVA 5AK5A 1QQ7A 3E58A 2ZBEA 5ALMA 4UM5A 4Y2QA 4Y2TA 5ALQA 4HAIA 3U19A 2VKQA 4Y2PA 3QUQA 2YJ3A 2YMPA 2YJ5A 3R09A 2EARA 3OCUA 2PR7A 5ALIA 4UU0A 3QU7A 5AK6A 1RKUA 4CNQA 2B8JA
chains in the Genus database with same CATH superfamily
4FFMA 3WSWA 3K9FC 1IE3A 3D4LA 3OCZA 2G4CA 4PWZA 1DBPA 3OLYA 4FFSA 2FMSA 4HP8A 4ED2A 2NUTA 3BL5A 3I8OA 3K5PA 1Q77A 4ON9A 4EK9A 3TI7A 4Z7NB 3COVA 4NV3A 3NBQA 4XX0A 5B7GA 2A5LA 2IHVA 2FK8A 4KDFA 1S97A 3HXLA 1K6IA 4USAA 1MTOA 1PYOA 1F0YA 2QD1A 5DSZA 1TTPB 4WUTA 2OYRA 1PUZA 1AE1A 2BZGA 3VNVA 4HNQA 5CLFA 4NBUA 3RUIA 2O8DB 2LCFA 4ARIA 5L4SA 4AKHA 2PS9A 3RU2A 1JE0A 2B4TO 2X2EA 1SVOA 2O3RA 3BULA 3Q88A 3W04A 5JSHA 3A3OA 3L0YA 3OSUA 1I1NA 3ZUGA 1I4EB 3L6EA 2D2XA 3AP1A 3ZEIA 1WMFA 3CUKA 1XRLA 4OUDA 2HZBA 1L5YA 1QGZA 1AQNA 2DF4B 3FH0A 1H9AA 1FBTA 5EAIA 3P4YA 1TAMA 4F93B 3MGGA 4X1IB 1ZQUA 2O1XA 2VTVA 2X13A 2XDWA 1E2DA 2OT3B 4JLWA 3L1VA 3ENWA 4O2AB 4GM0A 5JOQA 3OKPA 4HDSA 2IEIA 2C04A 1P17A 4ME6A 3LBNA 1XVUA 4IR1A 5F76A 3G6VA 1UMCB 2OCPA 3ZZNA 3BCUA 4DM3A 4YCNA 3W5DA 1JR2A 2IE0A 2UKDA 2HPVA 5HZMA 5AUOB 2W8KA 1QK5A 3JARA 4BLOA 2Q0SA 2VUSA 2Z2ZA 4UATA 4FHGA 5GQSA 3KSAC 1XMVA 5HQJA 2B0CA 1FSGA 2O3SA 2O7QA 1U7UA 1NJZA 3C5HA 4Y6QA 1NLMA 2EEZA 4B33A 4BL5A 2AG8A 1OWMA 3G2KA 3T06B 4CUZA 1A9RA 1AKEA 3BMNB 9ICEA 1AHHA 3UC9A 1DQSA 3MOSA 1RYZA 1CVRA 1G5IA 1Z47A 3H05A 4X1YB 5HF8A 3UY4A 1KMHB 4B83A 4EJSB 4JI5B 4YHHB 4BNWA 4C0JA 4DR7B 4CEHB 3CB2A 3JAWA 2VUHB 2XIQA 5EQDA 3UIEA 3K70C 5KINB 4JLMA 2YV2A 1WKVA 3BPSA 4D98A 5HZGA 1EVYA 3IHLA 5DNVA 1PT6A 5FUYA 2JGAA 1CUJA 3P97A 5KVQA 3ZHQA 3P9ZA 1T7PA 3RS2A 2G71A 1U9IA 2GD0A 1KEKA 4AYXA 3U6BA 1RLIA 3DKRA 5C2JB 4LF4B 2W9BB 3FVVA 3OUTA 4LRUA 1DKOA 1N0HA 3BGSA 1KPIA 3PVZA 1XJCA 3IAS6 1N4AA 3TLZA 1EHCA 1SA0B 3D7MA 3T5KA 3R3JA 4D4IA 3AHCA 1DP4A 1FXWF 2Z08A 4LYGA 4XFKA 4D97A 2JEJA 3RRNA 3NETA 3FYUC 1NATA 3O82A 3VZQA 4Y1FA 1NOJA 2HLHA 3C97A 4I6GA 2CJYA 4C9BA 1CQIB 4KL8S 3WNQA 4BWGA 1FFAA 1LW7A 1QGUA 5JT1A 2EG9A 2WU4A 2PRZA 3PNVA 1ZYUA 4U7HA 5KTQA 3OTWA 5CD9A 1R37A 3CRZA 3RD5A 1TZJA 5CIYA 4EG8A 3CNBA 4RPGA 1TQ6A 3PEUA 2JHCA 3QELB 4RMJA 3WBJA 4K6GA 5KDOA 3W79A 3OLWA 2CL5A 3F1KA 5KL8B 2WU0A 2BEKA 4OYHA 4L4YA 1BGXT 4DMLA 1ETHA 1FNBA 1SFRA 2BFMA 3R74A 4TV9F 3RYIB 3LKDA 1EGMB 3VUFA 2QNBA 2J3DA 1DAPA 1J8QA 1LC3A 2IIBA 2QLFA 2HBKA 2RHRA 2OFWA 3L06A 4EGQA 5IDVA 4G97A 3GLRA 2QUKA 4P33A 4BRWA 1X86B 3WL7A 1TLTA 5JNSA 4RVHA 1ZRHA 4HVLA 1GQQA 2K4HA 1MN8A 1RS0A 1W2GA 2ID7A 4YH1A 3ESZA 2DP4E 1QHHA 8ICVA 3RWOA 5HNKA 4NWIA 2DFPA 1Q0SA 1XZBA 1PTJC 2IHYA 3I4LA 3JD1A 1L5GB 4EKNB 2MYNA 5BSGA 2TMYA 2D3TA 1DMSA 1FS6A 3QKUA 5CP8A 3AR4A 4FCVA 4H9GA 1DC4A 1L4MA 4NFLA 3DVLA 2DH5A 4JB0A 8ICPA 1H2ZA 1P7DA 4FCTA 3LAWA 5JS8A 3HB7A 1SVMA 3NORA 3D2CA 2BZSA 3ZDAA 4X5OA 4FSDA 4JQZA 4NIMA 5I7RA 2EU8A 4XYGA 3U2QA 3E3LA 2VPTA 3FHOA 4ND8A 5FA8A 1ETUA 1XHLA 2CC2A 3ZE8A 4BHTA 2AH5A 4F11A 1ZN9A 4NPHA 5CLJA 4A73A 1BU8A 5HRCA 1XXHA 2B82A 3X1WA 3T7EA 3QEBZ 1KQ3A 4CM8A 2YTZA 1DVRA 4GRAA 5JD5A 1Q1ZA 3O1JC 1C20A 1RQ2A 2NXNA 4ARZB 5IX8A 1GDTA 3S1AB 4GECA 1CP3A 4XCXA 3AVUA 1NBHA 1ARZA 4KH0A 3ETNA 1CUGA 4Z86A 2GZ3A 3VXKA 5ES4B 3QENA 2FLWA 1COWA 4X45A 1K3TA 4LJXA 1P4HA 3QH4A 2H11A 1Z4NA 5EMMA 2WBLC 5K6AA 3OQOA 1SGWA 1GRQA 3OOEA 3KHLA 4MLCA 4XI9A 5KNBA 4MRRA 3G9QA 2ZSDA 1E2EA 2ZWMA 1MVOA 3LT0A 4GEKA 1T36A 4WLNA 1GYQA 2QL6A 4AP6A 4EUSA 2QK4A 3X1MA 5CBPB 1SVLA 4FT4A 1TT7A 4N6NA 1L8OA 2C4VA 1ECGA 1UMDA 1D4OA 3O8CA 4L76A 1CJBA 1X7YB 2HWWA 1KYQA 1OLOA 1DXQA 2IXTA 3EGDA 3IUYA 2JARA 4PY2A 2J0SA 2QVXX 2ZJ2A 2V0CA 4J0GA 1J42A 2ZIZA 2UVDA 3P5SA 3KFUF 1CUUA 1U8FO 3DBLA 4Q1BA 4XGNA 3UHAA 1S1CA 5A6SA 5JQWA 4YCBA 3BHNA 5AW9A 1GGNA 1ZH2A 2JAPA 1NVDA 4PL2A 3SFVA 3W9YA 5AVYA 3N28A 1O6GA 1HBJA 3VNUA 4P93A 1NBMA 1FTNA 2WU1A 3E2EA 1TJPB 1R64A 2B92A 5IM4F 1EZ1A 4UTRA 5BXQC 2R2AA 2ZRAA 1LDGA 4BQPA 4R69A 4OX9Y 4DT1A 3G1WA 1QIGA 2DKXA 3UWKA 3PBKA 1BE0A 1CRQA 1U3FA 3PHJA 1U1IA 2ACEA 3WGZA 3HKBB 5CYGA 2M6KA 3G0BA 4ITRC 1B4DA 1URJA 3NALA 1SD5A 5ADHA 2VHTA 1G41A 1Y5RA 1QR6A 1G7RA 3KHHA 3PC2A 4NAUA 3ZYCA 1GV0A 3V9AA 3WY9A 3FFBA 3ZGLA 4E14A 8ICMA 1B93A 1E98A 1VKOA 3QKSB 3E35A 1XL1A 2ZYUX 1G8FA 5HILA 3OIWA 4Q7MB 5EE0A 3AILA 4AW9A 4Y2JA 3KDPA 5ICGA 3QVUA 3CRXA 2G9QA 3L7KA 2ZGVA 1VQ1A 3BRQA 3M2PA 4Y6PA 1S8FA 2QF7A 3SEIA 1D1PA 2VVTA 1FVOA 1F2VA 3AEXA 4RVFA 3STUA 1O97D 1YZLA 2IELA 2YYYA 3KV3O 3KEMA 2Q4DA 3OPXA 5F9LA 4I2AA 5JPIA 1WRBA 3NAQA 4HH4A 4ZCIA 2NAFA 4UJ3A 2ERXA 4PYQA 1VPVA 1NVVR 1NW9B 1YNOA 2B2CA 2NU9A 4QXMA 2QTBA 4J9SA 4C87A 5FOXA 3AJEA 3U3XA 2QX4A 1COWD 3PQDA 4YNBA 4R8LA 3FA2A 5LZ5A 2JG3A 4YI5A 4G0OA 2R60A 5L3QA 4HB0A 2AMFA 3SQOA 4DF4A 2J3QA 5FYDA 1J70A 1LGYA 1I7QB 4GI2A 4TTQA 3UN1A 1KVTA 1JHRA 3AU9A 2ZZKA 1XBTA 4LE2A 3SFZA 1FLVA 3BE6A 4HOYA 4BEBA 2W9CB 2ZJ1A 2VA3A 4OO3A 2Y0PA 2W54A 4MA5A 3ZBUA 4AJJA 3GJ3A 2ETVA 2MIIA 1NFRA 2LDXA 1FDRA 4LSZA 5FLXA 4H7KA 3QW2A 3ZV7A 2AYYA 2XNCA 3NS1A 3F5QA 1GU0A 1SAYA 3JRWA 1OB2A 1XU9A 4J9MA 1W96A 3GGCA 5KI6A 1GCAA 2NTVA 3PVCA 3CYMA 6REQB 5ELXA 4KUGA 1B4FA 2Q0ZX 5LSAA 4TXHA 1XZEA 2IY8A 2F90A 3S2ZA 3TFOA 1QBGA 3PDIB 2H1HA 4EYHB 1Z39A 4P81A 1UJ5A 1Q57A 2GJ9A 4N5IX 10MHA 4G37A 4BTLA 2J08A 4FINA 5I4IA 3QUBA 2XGGA 1N78A 1CR2A 2DEUA 3VSCA 2HSDA 1F3LA 3CLKA 1RJGA 1O57A 3KL4A 3J7AC 2W03A 1RKVA 4HH0A 3NUGA 3WQSB 1YQUA 3TR6A 4MS4B 3WAKA 1WY5A 1U0BB 3M9NB 3G8DA 3GLHE 4P58A 2BH9A 4RSMA 4ZI7B 1KFDA 4ED1A 4N8SA 5SY6A 1HG1A 3K6KA 5I3CA 1AM4D 4IS3A 4PC6A 3TXXA 2VSFA 3ETRA 3RH0A 1Z0ZA 4CKBB 1AKYA 1QM5A 4FHDA 5HMLA 1DX9A 3HVKA 3KYJB 3WRYC 3WYDA 4TYYA 2GO7A 2WPNA 4HS9A 2FSUA 1TA4A 3D8SA 2RKWA 3IH5A 2Q3FA 4CE6A 1GCIA 3IJ5A 4H6XA 4X93A 4MQFA 4LRTB 5LP6C 8ICUA 5DZSA 3UGKA 4IO1A 3Q3IA 3GNLA 4ZICA 3EXFA 3RC2A 4F5PA 4YFYA 3IPAA 7REQA 2QIOA 3AXSA 1N2OA 3CNHA 2WJ4A 4NICA 2HRBA 2VK2A 2IV7A 2G0AA 3OTOB 4JWTA 3SBEA 2Q62A 3LSTA 3WWDA 3GLIB 1KH1A 4ENUA 3Q8PB 2IPXA 3H8VA 4GEGA 4NENA 4RYLA 2IZ1A 1SKQA 5EYPA 3RRXA 4XCVA 5IASA 3KUCA 3A1VA 1Y0BA 3AVTA 2ZWVA 3HPOA 3U4DA 2VHEA 4N54A 1A69A 1Q1NA 2BMJA 4TQ9A 4QZVA 1C4KA 2C9ZA 2RD2A 2W2VA 1DC8A 1MW9X 4RTNA 5E0KB 4NULA 1NP6A 5KFKA 4HY3A 2GK4A 3DMDA 3EXEA 3D3NA 2ZB4A 3QA9A 4JR1A 3ZKWA 3PFHA 1FP1D 1VE3A 4NABA 2WT4A 4PPNA 1G59A 3N4MB 1KBZA 4JBGA 5GMOA 3K8ZA 1W8DA 3A6LA 2K2WA 1RYMA 2H07A 1QVVA 3TARA 4L7VA 4BVHA 1A9YA 5JZ9A 5J4YA 3KKEA 5C8XA 1NYRA 2VZEA 1D5CA 4Z4HA 4PX9A 1EFAA 1J56A 5G4KB 5CDYA 1GRRA 2QN7A 2XUZA 4M6WA 1IY0A 3D43A 3GN2A 4GXQA 4HEA6 4P6VF 3RU9A 3WGVA 2Y68A 3PQ2A 5IJ9A 1FK8A 3NWPA 4DOCA 3PSPA 3KT0A 5EOZA 2LKCA 4H4DA 1M1UA 2KQUA 1MC8A 5EWLB 3B3AA 3T4XA 1TECE 1O4WA 1ND5A 3RF9A 1J5PA 3GAMA 5TQ2B 1EFLA 3D2BA 3EE6A 2D4AA 1N5IA 1Z7YA 3PS9A 4JT9A 4LDRA 1O95A 5H9WA 1HE3A 4YJ3F 4YRFA 2BGKA 4ASUD 3GLHB 4QOHA 1AURA 4FM9A 2AGOA 4AY5A 1P4AA 4Q8FA 2WP0A 4R0MA 4D7AA 3CLUD 3SQIA 3TIXB 4URVR 1FQKA 1FOEB 1O95C 1U0NA 1ZK3A 1GGFA 3GD5A 3AIKA 3D31A 1T2NA 1R4NA 2CFOA 2L0XA 1LBQA 3EG9A 3EJ6A 3ZWAA 2AB0A 3E61A 2G25A 3GEDA 3L6CA 3NEPX 4J0IA 4M89A 4BNJA 4O1HA 5LQKA 3IOBA 2ZAIA 3G0HA 1M8KA 1ODCA 3AOGA 5CNIA 4B0OA 1KYXA 1LF0A 1DE0A 2GD1O 3OT5A 2BONA 2IYWA 2WJ3A 3H86A 5ILQA 5H02A 5CNKA 2B99A 4WDRA 4MFFA 2KZZA 1QIJA 2E82A 2NNWB 4IHJB 1R6XA 1UFKA 2ZJ6A 5LU8A 2GM4A 3LO8A 2YVKA 2FCAA 3I2GA 4JQYA 4PSAA 2VK4A 1JG6A 3VYUB 1NMEA 3NC1C 3C41J 4K9LA 3BWYA 4FZVA 3NU1A 5DYNA 3HBAA 1F8UA 2OCEA 4HXEB 1EFUA 2QB5A 2HHTA 4KLHA 3F9RA 2R86A 3HWWA 4PONA 3OIYA 4DSJA 1PGPA 2HJGA 2XMQA 3F8WA 3GIJA 3TBFA 2ZXFA 4N5DA 4MWDA 4CG0A 1H9BA 1KNXA 1VIMA 3FTPA 4J3NA 2GOYA 5G0UA 5GVSA 1F5NA 4ZHSA 5A9SA 4PRKA 1OPRA 1RWKA 1HEKA 1ZKDA 4MHSA 2Y76A 1XCOA 2ZBRA 3HI4A 1JB9A 3P52A 4Q05A 2W43A 2YY6A 3C15C 3ZE0B 1SCIA 5T3YA 1Y7LA 3UJBA 4G0XA 3IESA 4DVJA 5DCLA 2GYUA 2RBKA 4H27A 3G2NA 3SQWA 4Z6FA 4HH3C 5L9AA 5K8LA 4UHBA 3C4VA 1AQYA 1X2BA 3EISA 3M5CA 1OAOA 3D7KA 4E3ZA 3F9CA 4ECRA 4RM2A 3IIIA 2VOJA 3OCYA 3PNKA 2P7IA 1W75A 3FFTA 5L1KA 4F3NA 3A25A 1QOZA 3U4QB 1QX4A 4C7KA 2C3OA 5BUSA 3NTXA 4IEEA 3UB4A 2WY2D 2C97A 5COAA 1DUSA 5AVVA 2PZKA 2CLCX 2X9QA 5CPFA 2ZSJA 5CDFE 3EEYA 3H4MA 1ZVVA 4DMRA 2W4IA 4UBJA 1K7XB 1CYDA 4IGFA 4IH1A 9ICIA 1FFCA 5H0IA 3A0HU 1H8EA 5AOVA 3WGYA 4E2ZA 5C8DA 4HAIA 4WI1A 1MNAA 1BHJA 1QZUA 4IF6A 4ECXA 3WJAA 4JV2A 3ML1A 3IHQB 2RAFA 4WGGA 4EY8A 1W9MA 3QY0A 2B4QA 4Y98A 4M87A 5FNVF 4GZ5A 1OZFA 3D5QA 2ADOA 3C5GA 4DV4B 1O6FA 1WIWA 2GNOA 4RXTA 2OXTA 3R24A 4BCCA 4YMUA 2PIDA 3GB9A 1J0CA 2YVLA 4LYYA 1EWTA 2OXFA 3SAFA 3LK7A 3ZHYA 2KG5A 3R5KA 4X1IA 5A7GA 5LDGA 1UT6A 2FZEA 2VJLA 3I4CA 1AQIA 1FUUA 3ZQKA 3AR2A 2GCOA 1XTJA 5KKAA 4CL3A 1IH8A 5M7EA 1R4MA 2C61A 3ND6A 1ZUNB 3VRHA 3UA4A 3OBIA 2KJQA 4UEOA 5I7OA 4DDKA 1ED1A 4DSFA 4F21A 2HWUA 3F2BA 2BFNA 3QV2A 2QM3A 4C7OB 4JD5A 4QPZA 3AVPA 1EIZA 1ODJA 2IZZA 3AL2A 4Z99A 3V55A 4B2YA 1Q3VA 1LS6A 3QQPA 3QYJA 3DB1A 3V1YA 1C7FA 4UD6A 3A2LA 1MO4A 2A1TR 3LWZA 2FVYA 1EK2A 3E15A 4I9HA 3W8NA 2QPOA 4W7IA 4RDXA 3O8OA 1NJ8A 4LHWA 4MLDA 4BNDA 2WTMA 4YXMA 4ECEA 1V8DA 4ZWNA 3NIFB 4G09A 2JJYA 6YASA 5K2OA 1DARA 4P4NA 3CEJA 5DW3A 1QS0A 3KZNA 5AKIA 1UL1X 3H8MA 2ACVA 3C6MA 1KIFA 1R5OA 1KVSA 4Q9JA 4UVDA 3R7BA 3HS3A 4YK7A 1RJ9B 4CMIA 4KLTA 1HYHA 1E4VA 2ZR7A 4L15A 1A8SA 1J9GA 4B9LA 2Q9AA 3RC9A 1PIWA 4H59A 4EUKA 3L6OO 3AVOA 3IMKA 3ANXA 4NYJR 3E5HA 5DYYA 4Y0NA 5T5QA 4DOMA 9ICKA 2QM8A 3KSZO 3O94A 2J9XB 3NVAA 4KMMA 2HQSA 2O7RA 3A6EA 2HT6A 3JVDA 4ZOLF 3TMKA 3DZCA 1SBYA 1WZ2A 1N36B 5JY1A 2A3NA 2X8LA 4P3KA 4QKQA 1H6DA 1LNZA 3SYTA 2MU2A 3QEMB 3ADPA 1D9ZA 3COPA 4H0NA 4PHDA 1TJ3A 4GH5A 4DTCA 2ZPAA 4FYJA 5EKDA 2P0EA 4JJIA 4HK4A 4NL9C 3RROA 4B4OA 1SL2A 5KYTA 2C00A 1GN9A 3EPLA 2VA2A 1J0BA 4WSOA 2WINI 1DZIA 4BIMA 5B4VA 2X5KO 5LQRA 2OWOA 5DRTA 4EY3A 1CS4C 3O4GA 4JKOA 5JTIA 5AYVA 3RJ9A 2ZJBA 2YV4A 3ZQ4A 2V4QA 5DKWA 1S3IA 2PX3A 2WQ6A 3TANA 2GYWA 1QCCA 4C3ZA 1B8OA 1DEXA 1EU1A 5KX5A 4W5TA 2FLVA 3H6KA 1ZQQA 4KOAA 4KWIA 5ED0A 5HE8A 4C4TA 4Q3CA 1S7GA 2VG8A 3DNPA 3X1JA 2JHAA 1MGPA 2Q6VA 2QUIA 1YQXA 4JYZA 4UC0A 1JHOA 2Z8YA 3KJXA 1J1UA 3HFSA 4IZ6A 1MIOA 1R6BX 4QUAA 2ZKLA 5E6RB 2Z43A 2PVPA 1NASA 3KR1A 5JWHA 1JILA 1EUQA 1Y6RA 3RJGA 1N8TA 1Q7BA 1RW4A 1E1YA 4GI5A 3AKEA 1VL2A 3AUTA 4I4TB 4UU7A 3W8DA 1FCJA 4UPDA 3ZD8A 1YU6A 4PXYA 4Q7EA 5LL6P 1ULHA 2HO5A 1PR5A 1WMAA 4CLRB 1XVAA 1MNQA 1TA0A 2HLPA 3FOWA 4QD3A 3ECCA 4HS4A 5EIFA 4AMYA 4EGSA 4AYBC 4RA6A 1A4UA 1NF8A 4J6FA 5IN5A 4TWBA 2AFIA 4ZOLA 3B9PA 2C7PA 4O3SA 1Z5ZA 5JFTA 1T0HB 3DEAA 4GWGA 2PI5A 4DR3B 3B3QA 3HYCA 2BLNA 3V7LA 5J0WA 2XLBA 4DYHA 2O19A 1FTGA 2AUNA 1E2GA 4H1HA 5A4AA 2VUTA 5FLEX 4IIBA 3IOCA 1FIUA 1XA4A 2KV2A 3T7DA 3KEFA 1U4BA 3ZCQA 3R7WB 5BP7A 1RYFA 2RGBA 3LBFA 4I8IA 4FLMA 3F6CA 2TMDA 1CR4A 2BKAA 3MINA 3ZIAA 2PWYA 3C39A 1KOJA 3ZNQA 4KPUA 3HHPA 5ALOA 1SBIA 3LKZA 1NI4A 4OXKA 1JSZA 4YP0A 5E6SB 2E55A 4PR3A 3EVNA 3O9ZA 2JCXA 2NUAB 3NWEA 4EG6A 1KMQA 4K05A 4QATA 2H5IA 2NXEA 5DULA 3PR4A 4QQFA 1K8ZB 3IHKA 3VHLB 2Z1NA 4BFTA 8ICFA 4OGGA 3OICA 4D43A 3DXYA 2I80A 2W2LA 5FI0B 4N76A 2C7VA 4Z6CA 3BQ0A 2VK8A 3ZDDA 2XWBF 4D9IA 1U0JA 4R0NA 4F5WA 5BOSB 2VQEB 5DM1A 2Y1GA 4UHJA 3KOUA 3P4XA 3OTQA 3K0FB 3QG5A 4HX5A 4WZBE 3T5AA 3J7TA 1J0EA 221PA 1L5QA 2VRBA 4MV3A 4JP8A 1AHNA 1WHTB 1KMCA 5FEUA 2ODGA 4AO6A 3QTTA 1ULSA 2JGKA 3RTBA 2BHRA 2SKDA 1DC7A 3IMEA 4TLCA 4BNXA 4WKOA 2FQXA 5L53A 3ZGYA 4FFRA 2B1GA 1L3IA 3KVYA 1QH9A 1D2MA 1O94A 3LGXA 4KU4A 4WNAB 4YJ2B 1TB4A 1DAGA 3VR6H 1ZJNA 1XYGA 1I14A 2D13A 2SBTA 2UZ1A 2UVQA 2V74B 1AB5A 1KJIA 1JPVA 3PXXA 4H1UA 2NVUA 1SOWA 4Q7LA 4XB6B 5TRTA 3JQ7B 5J1SB 3ELBA 5HR6A 1HIWA 1WAMA 3OE5A 4HYTA 1KJQA 4A5SA 3ILVA 4B4KA 3N9IA 4MQ4A 4OIFA 5ECGC 5JMOA 3TF5A 3DT8A 1Y3AA 4MX8A 1J24A 1JN0A 1QFMA 2DWOA 2JLSA 3I23A 3MBIA 5DU2A 5DYTA 1X7DA 5K0GA 2HIMA 1VHJA 4M7WA 4BWJA 1FP4A 2OCYC 2P9BA 1QQ5A 1BFDA 2JK0A 3SOPA 4HUQA 2RK3A 3W34A 2Z9CA 4RDIA 1CNEA 1SVKA 2IP1A 2VPYA 2J0UB 3D3QA 3IUNA 2IYOA 1Q2UA 1BH6A 2QNIA 2WSIA 5DNUA 3PUXA 3EPPA 5AXBA 5C4GB 4U39A 4JLSA 2CHUA 2OENG 1A82A 2HBLA 4G0QA 1VLBA 3ND7A 4HDCA 3QVWA 4LI0A 1VSQA 5ENVA 3V8NA 4C0BA 1EJ2A 1P5RA 1XTQA 1Z5VA 4MR9A 1A2OA 4DNOA 3EDRA 3EBPA 4UUQA 5BN3B 1FFYA 3JQQA 1TLFA 3S55A 1PI3A 4MS3B 1ZI6A 1T29A 5EE9A 3KQMA 1KORA 5AMXA 3TSYA 3E3AA 3I6YA 3JWPA 2G5HB 3SZLA 3ZK7A 3QPWA 2PLRA 1E2MA 2VJAA 2B4AA 1XLUA 3Q7PA 3DMNA 1S5LU 1FJ2A 9ICPA 4DSLA 1G6HA 3BZUA 3WLSA 2ZJ7A 3C1AA 4E1BA 1TK8A 1ZICA 4P53A 3BFXA 2RB4A 2PUWA 1ISIA 3HB5X 2C1ZA 3ZE1B 2PH7A 3HV0A 4EW1A 1N3BA 5T7BA 2NQ2C 4PCLA 1PWXA 2WIDA 2GCNA 4NARA 3UATA 1L7XA 2NUPA 4TKMA 1A1VA 2Y1WA 4CDRA 3ELDA 3NTUA 2DUMA 1DCFA 3HVUA 3LFUA 4GL2A 3CX3A 3K5IA 5A3JA 4MUAA 1VDZA 1WVMA 3G13A 3PE4A 2QT9A 4L9SA 4LXHA 2O6LA 2AZ4A 4DYVA 1RRVA 2FQQA 2H7CA 1KFTA 1Q50A 4NY8A 4HTFA 5PNTA 3WZLA 3ZBQA 4MCAA 3H9GA 5CB4A 3DPSA 3EGVA 4FYPA 4NMMA 3U3JA 2QR2A 5AXAA 3WNVA 5HIMA 4A0FA 5IT0A 4HV4A 4QWWA 1WXIA 4XVCA 1RQPA 2D1TA 3GK3A 1YMVA 1BCRB 2IUUA 1SK8A 4QUJA 4BMOB 2OHGA 1V7ZA 1HEYA 2CDAA 2Z2YA 4KAJA 3KYBA 4MMXB 4W5RA 4N3CA 5DRYA 1RFGE 2OOKA 1ANKA 2ZE6A 2PSEA 4RNOA 3OQBA 3A1DA 1M2GA 5E4JA 2OG2A 3P9XA 1ZC3A 5AJXA 5FT9A 1VGQA 1VMKA 4JK3A 3PKZA 4WKGA 3RYCA 3L02A 1OLXB 3AB3A 2BFAA 2H4ZA 5AJYA 3RUFA 4HNTA 2O06A 4ECYA 1LRJA 1VYHA 4OI1A 4HDOB 1QSSA 2FYTA 5L3RA 5CFMA 1NK7A 3R3HA 3QUSA 3M9MB 4Y30A 3FTQA 4EY6A 3AWDA 2I4LA 4QFCA 1X2IA 1K5HA 1X39A 4TT3D 3RBXA 2ZJ8A 2PX2A 1KY2A 1JJAA 3DGEC 2HM7A 3DFIA 3WO1A 4BEJA 3HNPA 4GX2A 4X91A 1OGIA 2WOOA 4ACOA 4OGFA 1HZJA 4M0MA 3V5NA 5AI5A 5AW2A 3ESCA 4YBRA 2WI8A 5G0VA 1ZU4A 2WV7A 2BISA 1RZVA 1YS1X 4BEWA 3AGPA 4D82A 1PG2A 5LJLA 3A9SA 4TUSA 2NO1A 5SICE 2PAAA 3V46A 2EJCA 1G2PA 1UOPA 1DIBA 1N2ZA 5CNMA 4EZBA 2HMVA 3RDPA 1FRFS 4WZ6A 1TD9A 3F4LA 3FAHA 1RHUA 2CGEA 3A27A 2VIIA 2ZCUA 4AY3A 2IBSA 4DQLA 2NSYA 3KRTA 4Q45A 3KJZA 1XTBA 4PTZA 2V45A 2XD4A 3H5OA 8ICZA 1XNGA 3FBTA 3LTEA 1LH0A 1DIHA 1SUCA 3L7OA 3F2DA 1IU9A 4AY4A 4IL6U 1IOZA 1B1CA 2IUSA 2DHCA 1L6RA 1LPAB 1Z7BA 1MB9A 1WTCA 1NULA 2VN8A 4GX1A 4XE5A 1LLQA 4QWAA 1U8UA 3PEFA 3AI7A 3PNOA 2IL1A 4PYNA 4DWVA 5JZVA 5KFDA 3HPQA 5KAMA 4B0PA 1ZQMA 1XE3A 1UBLS 1ULTA 4JSRA 2BUAA 5AW5A 1SXDA 1ZD5A 2N42A 1MEOA 4C3UA 1H38A 3O8NA 3WO0A 2JFPA 3NKLA 1TKRA 3GNTA 1B42A 4H17A 5T67A 3TQQA 1ZSVA 3HDVA 4Y9TA 3TZCA 3N7PD 1KPGA 2BEWB 4RK7A 3OO0A 3GRCA 3V7FA 4J29A 3UJ8A 5FQNA 4HGRA 3HN6A 1ZJMA 2C1XA 2ZIXB 1JIXA 1NRJB 2ZIWB 4CODB 1MLDA 1WDLA 1ICEA 4NCHA 4HO1X 1YBAA 3LQQA 1LU9A 2HC9A 2E2WA 4AFNA 2GN8A 2AW5A 3PQ3A 4AZVA 3K4QA 1HY3A 4BZQA 4X62B 3I0MA 2JLZA 2ZWAA 3PMNA 4WY2A 4V0NA 2A86A 1Y8QA 3WKCA 2N47A 3TOVA 2HPZA 1CUSA 1XZIA 2WFZA 5DX8A 1QR2A 3VAAA 1IUPA 2PS1A 4UARA 1DXYA 3FMIA 4UMDA 4CMKA 5K99A 3R3ZA 4L4RA 4R31A 1XF9A 1TIKA 5E7MA 3ZI7A 4RTSA 4JJ6A 1GVHA 4FHZA 4V2UA 2V6MA 1RC0A 1U2QA 2DGZA 1EH5A 3R0VA 3R2JA 3WLKX 3K1JA 4UUPA 4BNFA 3BCHA 3F5AA 4I6JA 5EL0A 3DZGA 1OI7A 2J0VA 2VK1A 3UBMA 4W82A 2IT1A 2CD7A 2CLOB 2I9GA 1RWVA 3KQQA 1AV6A 2RIPA 3CRVA 3ZJUA 1E60A 1LPSA 1TCUA 4YV7A 4LI3X 2PMCA 4L2IB 5L6MB 4LZPA 4IR9A 4YCSA 3WYNA 3S28A 1JFFB 2C84A 2FN8A 2PTHA 3DBVO 5JARA 1YK0A 3OZVA 3MPOA 4US0R 1Z5GA 3DAFA 4BLVA 2W2PA 5JHGB 2RJ3A 3BUSA 3VA7A 4RPHA 3R23A 2I66A 1S3FA 3EY4A 16PKA 4M0LA 1JQJC 4WUVA 1D5WA 3KCQA 5CRIA 3OX3A 4FGKA 4EYOA 1ZQBA 4DLWA 3FSJX 3KJFA 5CWRA 4JYMA 2JVKA 4NBSA 2CE7A 3UJ6A 3WA7A 1YT3A 3G9XA 2PEZA 2G5IB 2XA2A 2ZT7A 4UZSA 2WJZB 2YN0A 3RBVA 1DXSA 3K32A 2ATXA 3FBWA 1JKXA 2C9BA 2ZEJA 3UUFA 2P30A 1TQDA 4KLIA 3IIEA 4UB4A 4HDNA 2EAMA 4KREA 4K1LA 1WB4A 4XM2A 4QVGA 1XC9A 4B80A 4XWAA 1TUBA 1Y6QA 2PZLA 4Y1RA 5IN4A 3VDRA 4LZDA 4TUYA 4RZRA 4B9UA 2I2AA 3IXQA 3QLUA 4MWCA 4QC2A 4ZT5A 3IDAA 4LHVA 6Q21A 4CQJA 4UJ5A 4MF8A 1KDOA 2XWQA 5AVRA 1FW8A 3CNLA 3PUKA 3RKSA 7MHTA 5DIZA 3LT5A 4OHMA 4E2YA 5JH7B 4L6IA 4DQ0A 5JNLA 3A4IA 5JD4A 4IIYA 1L5KA 4MQ5A 4C43A 1JQ5A 4DA9A 5IAAA 3G82C 2M32A 3LI2A 3PVXA 4KLQA 4ID9A 3IP3A 3NAGA 3TLBA 5F9HA 3TL2A 5DB8A 5M04A 5HR5A 2IYZA 3F47A 4B4WA 2LGJA 4QLAA 4M99A 4NBVA 3OC6A 4P31A 5BYJA 4TTAA 1R4AA 4BQOA 2GN6A 3N8NA 5G1PA 3S2EA 5JYDA 2BOVA 4DIEA 2KBFA 4DBZA 1NTOA 5DB6A 2C4UA 3TW8B 4JB8A 2AS0A 2JCGA 2FR1A 4AMUA 3H5NA 5JLJA 3OU6A 4DRYA 5BPFA 2CLLB 1EFRD 5KG7A 3LXMA 4R83A 1CIVA 4XIFA 3HCDA 1NVKA 1KZGB 1YBVA 1Z37A 4QFBA 1U1FA 1QKIA 3MGIA 2IYAA 3MTBA 4L8YA 4BP9A 1YQGA 2EGHA 2O8FB 3LQ1A 4YWJA 1EM8A 4R40A 9ICMA 1YV9A 2KMLA 3LP5A 2C20A 1N8NA 4WPGA 4MYUA 1QPBA 1P2BA 4QUKA 1TQHA 3HPRA 1EP2B 4QU9A 3UAYA 4ZJPA 4GDMA 4M1WA 5JV5A 2QMHA 5BT8A 1NUQA 3LMKA 5DGBA 3KYCB 3HZZA 4I19A 3AOEC 3FGPA 3KKQA 5C5IA 2PYIA 2EIXA 1J2JA 4NCIA 5AW1A 4A5OA 1AMUA 3PNCA 2NTEA 2NVBA 5FYQA 4YJFA 5A4KA 5KC9A 2FR8C 3DG9A 1FNSA 1EGQA 2YOFA 4NFYA 1IN4A 4RPLA 4B45A 4DHEA 2HHXA 5ALMA 1G8MA 1KDTA 3NTOA 4YGXB 1XB2A 2AYXA 5K8TA 1RI3A 1CUBA 3GUHA 4D8VA 5IYZB 3FPCA 3VPBA 1WKBA 1AQUA 2VKQA 3MTDA 3QOWA 3U4HA 2AF4C 2I2CA 4B82A 4CN8A 1E79A 2YWGA 4K9OA 3JQDA 3MK31 5J0UA 5KG1A 1RYYA 2DBYA 1Z3IX 3K1TA 2PU7A 3AF1A 3SHFA 1DNPA 1YR2A 2PFOA 4XUDA 3IMFA 5ALIA 2I03A 3RNLA 4LZAA 1NC1A 1OX5A 1I9CA 1NYLA 1BEZA 1SK9A 4LMAA 4H3VA 1H0HA 1Q0PA 4XVUA 3K92A 1NXQA 2WU3A 3UMSA 2F9LA 3MSXA 3RGWS 1MT0A 3P0FA 4DBLE 4HGPA 2EJTA 3C48A 4E46A 1DCTA 5LP6F 4QZBA 3IUJA 2O8CB 1KSHA 2JBAB 1H8HA 3A05A 1HQKA 4G8JA 2BJVA 1OLUB 1JXLA 1U45A 2WG2A 3M3DA 1IK4A 2WTNA 3L7IA 3JVIA 3PXCX 1WR8A 5IC4A 1L1RA 2MCFA 4K6OA 2NV6A 3PUVA 4Q9LA 1P1CA 5CXSA 4CR7A 4DLTA 2P9HA 4DYDA 3JD3A 4A8TA 3CXUA 3UUWA 3WYBA 2ZULA 3MJEA 4IVQA 3SYLA 5BWOA 4MAFA 1Y1KE 3FRIA 1L3TA 4NNOA 1U6IA 4ZT4A 4IWXA 3TZLA 2ZSUA 5LA6F 4DDVA 3CEAA 5KMGB 5KQPA 9ICJA 1Z34A 3UPQA 4M04A 1O03A 1P31A 3QE0A 4TVKA 2NYVA 1FYFA 2ZTDA 4FYWA 1GGVA 3UAVA 1B15A 2FMTA 1IBRA 2X7XA 2IZ7A 3OZFA 2IHUA 5FLYA 4DDMA 3GA5A 4NXNB 1SCUB 1DDIA 3WHPA 3NAMA 2G40A 4B3XA 4JUAA 5F23A 2IXAA 2Q0QA 4L5JA 3ZWPA 1KOFA 2A67A 4R8MA 3KKNA 3DZJA 5C46F 5C9ZA 1XHEA 6CHYA 2IXFA 2XNSA 1XYYA 3F7TA 3MJVA 1PQPA 2F55A 5EJ5A 3EUAA 1S3SA 2OP0A 4HPXB 4LWPA 2X9GA 4IKOA 3TQRA 1UOQA 3STTA 1ZCZA 4TYWA 3DBRB 2MUTB 2Y1DA 3KDSE 1NUHA 4UNSA 2C83A 2P8SA 2F7SA 4IC9A 4B3BA 4JLVA 1FTSA 4M9JA 1KO1A 2EZ9A 4NYIR 2R5NA 3HB9A 4CMIB 1JDNA 4EKEA 2YX8A 4H7PA 4N39A 4B35A 2NO4A 3G8BA 3JWEA 4FYMA 1KQQA 1ZD1A 4G6ZA 5E79U 2C3YA 2I1VB 3E7FA 3JQBA 2PS0A 3JWIA 5TPWA 4DIUA 5LPNA 3RAFC 4JI0B 1W8IA 3BGIA 4S1WA 4U9HS 4HGZA 1EG7A 2GTIA 4MF2A 4DNPA 2YZ2A 2C3UA 7ICVA 5BYKA 2LTAA 3EZ6A 4EB6A 1RYUA 5B1EA 4EKYA 1R5JA 2GF9A 4PZZA 2VP9A 2H1LA 1RLUA 2JIZA 3QEMA 1NN0A 2WYWA 4MYHA 3FZGA 4MITA 3BDPA 4H6WA 1Y5NA 4Q6WA 5ERXA 1LX7A 3RVBA 3ZCVA 4Y2YA 3BS7A 5T3UA 1Y7TA 3SXUB 1IWBB 2EQAA 2QRPA 3LDUA 3MD0A 4P4UA 3IP5A 2JA2A 3RSGA 1N6KA 3WB0A 1SOMA 4C6TA 4BX9A 1EUDB 3B0YA 3QPAA 5JLAA 1JVBA 4ZEOA 3EGXA 1KS9A 1UDAA 2W0MA 1IMJA 3BMNA 3DM5A 3IBYA 1IN5A 4GHWA 4JLBA 4US1R 5JSKA 5ECYA 4XQCA 2DJIA 3FLMA 5TS2A 2J9RA 3L8MA 4BU0A 1ZQXA 2AXQA 4FZLA 2XJ4A 2YV1A 5SZIA 4Z2YA 2ZIUA 4IQWA 1VHWA 4RSGA 5JAOA 3RC3A 1C8BA 5BRAA 1FS5A 4GLFA 5CK5A 4MPJA 5C7IO 4GICA 2COEA 2ISCA 2IOQA 1QGDA 3W2TA 3H6GA 5C81A 3M3HA 1GKLA 2AVDA 5KWIA 2HWXA 1M72A 4FNGA 4YAKA 4RTOA 3NBZC 3B1JA 4X8MA 5GTHU 1VIDA 2C07A 3FIUA 2L69A 3WLQA 4TS3A 1J1IA 1WF3A 1IJFA 2R6R1 3B5EA 3R77A 4CKWA 2GLUA 4G3XA 2FEXA 2ZIXA 2QMZA 2RI6A 2CK3D 3DTTA 2EKPA 1XRNA 4Q4LA 5KKNB 4AUEA 3SE0A 4MLPA 8ICOA 3CVXA 2FZ4A 2SKEA 3C23A 2EBUA 5IF9A 2Z1DA 3CRNA 3EFBA 4OI0A 4O0IA 3KJEA 1VE7A 4DIMA 4F4YA 3NHAA 2HOFA 1WOYA 4GRIA 2YXPX 5JY6A 5FPTA 2XDAA 4JB3A 1Z5WA 2B9VA 3FY4A 5U4QA 1JIIA 1JT2A 4D25A 3D6AA 1B26A 3L8GA 3N6XA 3QELA 1EGHA 3PFFA 2BGRA 2OZLA 3M6VA 3PJRA 1Q7RA 5HVNA 5C5JA 1Z00B 4ECQA 1E2HA 1K7FB 5HDQA 1QHFA 3LDFA 2EW2A 5LR6A 3V8MA 4KTVE 3U7GA 2AHRA 2HDHA 4QZFA 3A1WA 5FBVB 5FADA 1KAGA 4C0QC 1XSPA 2IZ0A 3GI1A 3LY8A 4MV8A 2C4TA 4LK2A 4QUGA 4TTRA 5FUWA 4FDLA 1SJ9A 2HK9A 3HEBA 3I05A 4FT2A 4JEIA 5FWXA 4B4UA 5KG0A 3UXEA 1FFXA 2E8MA 4EBBA 4RD6A 3H8SA 4YA6A 4MGIR 4CI9A 3NS7A 4FYXA 4PFQA 1BX3A 4U4AA 4NDNE 1M5TA 5JWOA 1JNXX 1ECPA 1PFWA 2OO5C 1E7WA 2H3FA 3H2HA 4N8EA 4ERNA 3NJ8A 1GU1A 4LC0A 3JYLA 2YNMD 4Q6BA 5BNFA 2XY5A 4Z4IA 1SXJA 2C5FA 2J1LA 4WX2B 5M29A 1FUYB 4KHZA 3AVXA 4LEIA 5G5GA 1GNSA 2YR0A 4D0RA 3O21A 2DUYA 4HJRA 1GAWA 3D8BA 1VTKA 3KKMA 4FGLA 4KO3S 3JPWA 3D8RA 1X1SA 3NNSA 3NNNA 4PGAA 3RSFA 2YMMA 3N6VA 3V34A 2H7XA 4Q44A 4JN6B 2UZ1B 1RAIA 3C14C 5KHOC 1FMFA 4ZXFA 3VPGA 1QGOA 3GEEA 3CLSD 4GI7A 3JQ7A 5BUCA 1XNJA 1BFUA 1C3LA 2D06A 4J0DA 2JBWA 1SCBA 1JE1A 5K4GA 2DC1A 3VV3A 1KI7A 1L1EA 1O5IA 4MWEA 3W7AA 1M6NA 2ETXA 4R3WA 4M53A 1E2FA 4GFJA 2HXGA 3DTVD 5CU7A 4KGZA 5ALLA 1QG4A 4WLVA 3QUTA 2QRQA 4OHBA 4MV4A 4WL0A 2H59A 2QYOA 5P21A 4AMZA 1LSSA 3NVZA 5LM3A 5KNBH 3ICXA 1HWYA 1SR8A 4HWSA 2FMUA 5K3DA 5KX5F 5LDHA 2HYIC 4HATA 1K92A 3KUXA 2RP5A 1E6UA 1B8NA 2V6GA 3PPVA 3LYUA 1CZLA 1VLQA 3DVAB 3FGZA 5G53C 1PR3A 1V6CA 3UK7A 1BPYA 1Z16A 1D2CA 3PF9A 1BXZA 4JXXA 1H5UA 2B3DA 3E4CA 1X1AA 1E6MA 4FXOA 1RPLA 2PMFA 1UANA 3WDLA 4DTIA 1JFTA 4G3IA 1H2XA 2QX8A 1XFAA 2ZROA 4QHSA 4DHWA 3HR8A 5JJBA 1W581 3ZCSA 1KJZA 1OLXA 4F4KA 4UHHA 5L3SB 4P7KA 5GM2A 3OCJA 1OTXA 3H2SA 3OZGA 1PDOA 3STWA 1MJHA 5D5HA 2ZTSA 4OFBA 4D3XA 1NVMB 1OLSA 3V8PA 4UBCA 1JDVA 3AERA 3KFXA 1OXXK 2GXQA 1R6DA 2WVHA 1KZ4A 3PJFA 2I5HA 1T4DA 1AKQA 3HNRA 4H1VA 4JGIA 1EVIA 3TDKA 1NIJA 2XMZA 3HN2A 2IUEA 1KK1A 3EVEA 1XROA 1A7AA 4Q48A 1HZZC 3UWOA 3IAAA 4Q24A 4YUZA 3MCUA 4UD2A 4ZYXA 1GAEO 5ECWA 2FRDA 4PRLA 3T15A 5JAZA 4BB0A 2A9VA 4U7CA 2GYYA 3ONDA 4M88A 4PQGA 2CMDA 1KPHA 4UMVA 2EW1A 1SVIA 3NVVA 1VXOA 2R6DA 3LQKA 4ZEMA 2E5SA 5CJPA 1P72A 3F90A 5IC6A 4BP3A 2VRCD 2FZCA 3F53A 1SXJD 1IBSA 1TGVA 4AJ4A 1JTVA 1QHEA 2NU6B 2YXNA 3LHFA 1BHO1 3PB3A 5ICFA 4IICA 3K8YA 1CBUA 3L8CA 1DUIA 4ZJZA 3WRXA 3MB5A 1J6UA 1Z82A 3HABA 1S01A 1Y4ZA 1Y1RA 1BCRA 4NI5A 4ZYTA 3DEFA 3UJAA 1U2RA 4BLSA 1QVWA 3QFTA 2E4UA 2NUTB 4YX9A 3OT1A 3BWCA 4Q1EA 1RWNA 3H6HA 1Y8ZA 3KWFA 4J94A 2ZRKA 2RJNA 1ZNWA 4GVPA 5JI3E 1V16B 2ES4A 4J9RA 4XQGA 2Q2QA 4D74A 2HV8A 2PI4A 2PPLA 3ZI4A 3ESDA 3UMJA 3WMGA 2ZRLA 1NM5A 1ZG3A 2GK7A 4MQUA 5K45A 3TMYA 2AX3A 4B44A 2R7NA 2DXIA 4UBKA 1C41A 3J81j 4M9CA 1U48A 3G59A 5JNUA 2ZS9A 1P0MA 5DSXA 3H9JA 4KQWA 3GH3A 2DX7A 4M9ZA 1MDBA 4GL4A 2MR5A 1ULBA 3SIRA 4D9HA 4ED9A 1KSPA 1DKPA 3F98A 5AVZA 1EXVA 2GI4A 1I4OA 1UOEA 2QAGB 2XGSA 4EHLA 4LVOA 5L4NA 1NNSA 1G5RA 1GHTA 1W4BA 4AICA 2EIHA 1RPZA 2I1QA 1Y37A 3KE8A 3U31A 3VU3A 2PUDA 2TYSB 2OD7A 2J3MA 5LQNA 4OQNA 4I50F 1M2HA 4X6XA 3KU4A 3VR1A 4D81A 3SQDA 5EQFA 5A4IS 1TOAA 3OF2A 2VEOA 3D2AA 3GRPA 5K5EA 4BX0A 4BYMA 3U5TA 2VF7A 3H0CA 2QB1A 3P2JA 1ODSA 1GLGA 1F51E 1U8AA 4WCFC 2ORED 1K68A 5G0WA 3AFGA 2E6KA 5ALGA 3L0SA 4A8EA 5KNIA 5D46A 2BRUA 2HX1A 2O3JA 2OPBA 2PNJA 4GVLA 1WX1A 3JAWB 2VF4X 4NH4A 3K96A 2OK8A 4M9NA 2GX6A 3Q7IA 1Z2DA 4HRXA 1SC1A 4YP7A 2I7XA 4ALMA 5CFNA 5KNDD 3OHPA 2NMVA 1OFHA 3EMBA 4GI3A 2XOKD 5T4FA 3KLNA 5DGIA 3I92A 3USCS 5HTKA 1T9DA 2H1RA 4WK2B 2YB1A 3KJIA 4KUHA 1SZCA 2HGZA 2OVBA 1FSPA 1T10A 3ZD7A 1TK2A 1ZLXA 4ARVA 2Q9CA 4Z9BA 1F4VA 2JAHA 4ZC1A 2V9CA 3HQ4O 3O9MA 1ND6A 4G8DA 3RSHA 4JYAB 1K1QA 2BFPA 1QAOA 5HHHA 3QE2A 2HGSA 4JEMA 4CJXA 4MVJM 3E9ZA 4RSHA 1KP9A 5B30A 1POWA 4Y0VA 2Y9UA 4NE9A 1CB7A 3HVIA 4WXYB 1ZNXA 2MDTA 2RQ5A 4I4IA 5ALVA 2Z1MA 3EZ7A 3EGCA 5I47A 4W9NA 4AKEA 1OTHA 1PR4A 1VJ0A 3GDOA 2PCLA 1XCPA 2VSOA 2H1OA 3WADA 4MW1A 2WW8A 2CVHA 4K81B 2XZLA 1G9TA 2RHJA 4CI0B 4QT4A 1UPCA 2B25A 5CJ2A 4PZOA 4KB5A 4O2AF 1KK3A 4NV1A 2FW8A 4LVNA 4YROA 3S8EA 2ZQZA 3N74A 5EUBA 4L3OA 4L8GA 4D0SA 2C2OA 2VEDA 3P27A 4EJ0A 5KFZA 2MSEB 3RF7A 2PFKA 5HBRA 3O1HB 1L5MA 1IXRA 4HUJA 4J1TC 1G42A 5JG7A 1NZPA 3BQ7A 1EX9A 3MILA 4FMCF 2PA3A 2J41A 1ZIYA 5DBGA 3DMHA 2WT8A 5G41A 1JFFA 4L1KA 3RJHA 1KZ6A 4AWBA 3ETGA 2P79A 1KC3A 3DL0A 4W7SA 3SZUA 2FHPA 2YJTD 4C7XA 4MKGA 4XEHA 1AS3A 3WE7A 1HM5A 2ZSEA 3LS2A 3AM9A 3N5CA 1IZ8A 1VMDA 4F4IA 5M5BA 3N53A 3F74A 4NU6A 2ZYTX 4ZFNA 2PMDA 1UZMA 1CSEE 1VL8A 2V4UA 2VFAA 3SX2A 2UZIR 2ADMA 1AN0A 3IULA 4J0KA 1UK7A 5IUJC 2HSWA 3LOPA 4J2HA 2A9JA 1C1XB 4NQZA 5EZQA 3ZZMA 4EEXA 2Q7XA 2C4HA 2EKDA 3UJ3X 2PUVA 3CYFA 3VR5A 4DVGA 1IM5A 3TE7A 2QL9A 3TD6A 2VWGA 1MB4A 1G64A 1Y3FE 2YHIB 3GJ4A 4YEDA 2L2QA 4RGBA 4CEJA 1GCOA 4MV1A 4U63A 2YS6A 4ARZA 4DPLA 4OBBA 3L7DA 3R9IA 1PK1A 1E6LA 4BWYA 1NONA 3WLMA 3I64A 4BBPA 4JMLA 3WKEA 1CULC 2W71A 2H0QA 2VTBB 2X4LA 4L50A 1XMIA 2K87A 3MJTA 3ESYA 3PA6A 4INAA 3RREA 2JGLA 3MWEA 3AM1A 4RENA 2VUIB 2Z5FA 3R76A 4YN4A 2XYVA 1CIPA 3WLRA 1RXUA 5JC8A 5T14A 1HUQA 2IS1A 4F2SA 1L7QA 1PL8A 2NZWA 4JQCA 4NLZA 3IQIX 3W3AA 3VKVA 3I52A 3PJEA 2W9MA 2OCLA 4HRAA 4TMKA 1BD4A 4UUNA 4XWGA 2GPTA 4Z53A 4XVHA 3SBDA 1GM5A 1TIPA 4KVAA 3D6FA 1HT2E 1E69A 3OOHA 4HH1A 3EHEA 3Q85A 1BO6A 1OLUA 1OX4A 1SMKA 1JEEA 3G85A 1N6OA 3HJGA 4LGMA 4MW4A 4QOEA 4WY5A 5AVJA 5CA1A 1CQJB 1NXVA 2G1KA 2EFYA 4MIYA 1HNWB 2JHGA 4XLLA 3K3PA 4WZBB 4MW0A 3VH1A 5FBKA 3LYLA 2QR5A 5ALQA 3T7RA 3Q98A 1EDEA 1M83A 3NFYA 4Y2PA 2H1SA 4UCQA 2YMPA 3LF2A 3Q12A 3KZOA 1J7JA 2WJVA 3PFIA 1Q7GA 4IOKA 1QIEA 4J4HA 1DO8A 4L78A 2P78A 4HZUA 5FORA 1KA9H 2FFQA 3CW8X 4E5PA 5AUQA 4CNQA 2V8BA 3GCWA 4OBWA 3D2QA 4IIVA 1F48A 1XCGB 2QMEA 1L4HA 1A9OA 1NPDA 4REMA 4C7MA 3D6MA 1FFDA 2XZOA 3OLCX 4MW2A 3MJSA 4HDKA 1JIUA 1QP8A 1JVNA 3ZTWA 4QIWC 3BKXA 1XNHA 3PC3A 1A2QA 1OZAA 2WT9A 4L7QA 4YRDA 3RFCA 1M8FA 3PSAA 4PX3A 3DKIA 3WHIA 3U44B 2GD6A 2Q4BA 1C1HA 3FUCA 3FDZA 4BPRA 5AWFC 4K0KB 4YRTA 5E6UA 5LUAA 3WGQA 4YAGA 4R6XA 3S2FA 3ZE9A 4GE3A 2WV9A 4YVFA 1YZTA 2JIRA 2IK8A 1MX5A 2PL3A 2JEIA 2YN2A 3L1JA 4KYUA 4DV5B 5AKYA 4M22A 4DANA 2IMWP 1KYIA 4CF3A 3BFJA 1KDVA 3W2HA 1W4ZA 4XUCA 1KHTA 2CXYA 1HSZA 5ESRA 3RC1A 3T3EA 5JZOA 2X7JA 2AWOA 2VIXA 3K9GA 4Q21A 4ZI2A 2IYUA 1YR3A 1X1RA 5HW0A 2G7ZA 1SIBE 4RLHA 1UWVA 2EW8A 1RQRA 1PL7A 2LE0A 1Q21A 1F2UB 5DBOA 2CL7X 4OKNA 4Q03A 1IJBA 4MGEA 1VPDA 3Q7RA 5TQJA 4P4GA 3UQ0A 5L51A 2XF2A 1N92A 2J31A 2IA6A 4QPDA 4C76A 3JYPA 3WWEA 3LLSA 3NH6A 5JRZA 3HXMA 2IOHA 2B4RO 3G1TA 4TMXA 1QRAA 3IP8A 3MN1A 4ECSA 3LUBA 1MB2A 2IJGX 4XFDA 3T3GA 2WTUA 2WP8J 3I6ZA 1NOMA 4JUZA 1X7XB 2VZLA 2C94A 3NHMA 2QARB 1IPHA 1MA0A 1FE8A 3JRXA 2GWHA 4IVPA 5YASA 5BWMA 1B0UA 1KI6B 3REQB 1VECA 3IUBA 4D3SA 3KOZA 3L1HA 5JALA 1U2DA 3HKEA 4KCGA 1TGYA 1W9HA 1Z3CA 5D3ZA 4DLZA 2O2JA 2Q3LA 2XZDA 4RPYA 4J90A 2XTNA 1QIDA 3DP9A 3L7AA 2AG5A 2GLEA 3GOQA 4FEGA 3L4KA 1U2DC 1QU3A 3TSWA 2AOTA 1PZEA 4TVOA 4URUR 4TZ6A 3CISA 3GZ4A 1K7YA 3A2KA 1I0ZA 3EMDA 5HXAA 4Q9IA 1XZCA 1YIAA 2PUHA 4IDEA 4YV0A 3K70D 2D6FA 3HXPA 2BRUC 1BFKA 3B20A 3QU5A 1A5BB 3BG5A 3M8RA 5FBLB 3WIBA 4BWFB 5BMVF 5GJVC 5KFIA 4OHOA 1JTEA 1U65A 3MLEA 1ZD3A 2ZJ5A 2P9EA 2BHTA 2QRUA 3K6RA 1M2VB 2MTBA 1H2AS 2XUIA 2FV8A 3K1RB 1E1RA 1D8BA 4OHVA 4EB6B 4HDQB 2XRMA 3S8YA 1K3FA 3L82B 2FSHA 3Q3VA 3IEIA 3FCAA 1COOA 4B85A 3AP3A 5LQAA 2PD6A 2X0KA 3AY3A 5TQ0B 3X2SA 3F3MA 2J07A 4N7JA 3B85A 3SF8B 2PV0A 3PTZA 4M4SA 4E94A 4NZMA 3MT8A 3GLIA 1BKDR 5A1TA 2VHVA 1CZOA 1KU0A 2JD2A 2C0QA 2ATCA 3EXAA 3IAUA 2I4IA 4O02B 2DTXA 2R84A 2A8YA 2YFKA 5KTMA 3TEJA 2UUCB 2HT1A 4ZVSA 2IEZA 2IIPA 3DE1X 1Q20A 4YMVA 1WBBA 1ZGGA 4RK4A 5IW8A 2B20A 2QSYA 2Z6QA 2AJCA 2BFDA 3ST7A 1VIVA 3KZVA 1U8EA 3QTBA 2O2XA 4F6LA 2PUCA 2BZFA 1UBOS 4TL6A 1P61B 1T8SA 4J0HA 2WQZA 3FFWA 3HN7A 3MUEA 2RIRA 1ZUD1 4AKSA 3RAPR 3N0RA 1CJMA 5HSGA 3ENVA 3QPDA 4LY9A 1HO3A 3C3KA 3AR7A 4NU5A 5CCXA 3BQMB 3S5JA 4K7JA 2C7BA 2L18A 2Z8YM 3A2MA 1G2IA 1SRQA 3I2FA 5DBAA 3HRIA 1NLFA 1P44A 4Q1FA 3WBKA 3MD9A 3Q8RB 1TK5A 2BDPA 3EVGA 3CE6A 4U7DA 2JAOA 4NG5A 4TVSA 1R27A 1HMYA 1UBRS 4OK6A 4V0OA 1QTMA 3L4SO 4UAGA 2FG7C 4PANA 1II8B 2Z2XA 3P9SA 3T9EA 5AK0A 3C5FA 4BLRA 4LVSA 4R1QA 4WDQA 3KT6A 3CHYA 2DBZA 4FMBB 1QMGA 3O95A 3ZXSA 1ZLYA 1P6UA 4G1VA 2RC6A 1I5OA 1NVTA 3O38A 1IOWA 3DDSA 1OFIA 3DZKA 4X1YA 4DMMA 4ZGWA 1OAAA 4KLRA 2JLBA 2V65A 5KNCH 3ZU3A 3MW8A 1S76D 3RT1A 4UMFA 1NW8A 1Z00A 1DIOB 4RPXA 1MT3A 4DPMA 2P2NA 1VOTA 1GQRA 3VTZA 4HXYA 1R4NB 1CF2O 2P75A 2JFWA 1RU3A 3ZX5A 3BK7A 1ZOSA 5AKGA 3N0WA 1T6NA 1NTRA 1DIAA 1RYDA 2B6NA 3I32A 4HG2A 2X5XA 3E6AA 3H5IA 4HBGA 4MCHA 1B76A 2ZIAA 4R3UC 1KFCB 1NW6A 4KIGA 4RHTA 4P9NA 5EMLA 4NOLA 4Y1GA 1NSFA 1W88A 1W35A 4DMCA 4JYBA 1JR3E 5HWSA 1ODIA 4E3WA 1XZDA 3M8SA 2VNHA 2W5UA 3GGPA 5C8YA 2H08A 4EYKA 4BX8A 4HQRA 4EA6A 1GTG1 1MAWA 3KAKA 4OD0A 1M8GA 1Z88A 4QGBA 4R1OA 5E1BA 1T9ZA 9ICOA 1JHAA 1WDWB 3B6EA 3EQ2A 2NVUB 2AIRA 1ADBA 1KDYA 2BCRA 5I9BA 2LBOA 4NXMB 1GQYA 1VJRA 4EMUA 2PCJA 3FYCA 1WG8A 2EQYA 1JDZA 4B3FX 4R64A 1U9LA 1MPXA 3L40A 3DE6X 3N2ZB 3IUPA 8ATCA 4G85A 4DBVO 4UTVA 5JZMA 2KEYA 1HDCA 3GDHA 2F59A 3DXZA 1U6KA 1V38A 2JZBA 4CTOA 1E8MA 1IVYA 4Q4CA 2GILA 1SL1A 3G68A 2Y4NA 5J23A 1YZ6A 1A9SA 3O4IA 1D03A 5DHUA 1YC2A 4ZQIA 1XN4A 1K6JA 5DBCA 3HR4A 4BX2A 3NNDA 1EFKA 2QNRA 4KXUA 1IIBA 5DBFA 3WTCA 5MN6A 3Q9UA 3GC6A 1O96B 4U8HA 1GAQA 3PVSA 2M6RA 2XYPA 3LNCA 4HGOA 4MUNA 1AZLA 3CF2A 2CNLA 4QZIA 1ONBA 2K2QB 2WPDA 4ROTA 1X15A 1Z5NA 1ZMTA 2LPEA 1CDOA 1HEIA 3EDYA 3JS5A 3PI7A 4L8WB 4PU0A 3HH8A 4R8UB 2UVVA 2FUEA 3HWRA 4U2GA 1NK6A 2A88A 1R0ZA 2OZKA 3PXDA 4TSKA 4DC1A 1SXJC 1PYGA 3OLXA 2I29A 2J5XA 2BMVA 3PL5A 2DQSA 1EM6A 3JU3A 4XGRA 4BB5A 2CNOA 4RDHA 2HWYA 1KF0A 3HP6A 1YNSA 2MSKA 4NONA 3ZE6A 1F2TB 1TDJA 1HDRA 1FRVA 4RHUA 5BSRA 1RPTA 5EXEA 4CG1A 3PGJA 2NAPA 4QJ4A 4W1PA 3RRGA 3WGOA 4W9MC 1U0LA 3ONEA 1DJLA 5AKZA 2PSHA 1HL3A 4TQGA 5K3OA 4PFKA 3KZIU 1NBWB 2VH1A 4AP9A 4R8RA 3H8JA 5IK2D 1IXYA 1DOZA 1H8ED 1DTWB 4ELUA 4MEJA 2V7EA 5SYMA 1B73A 1J06A 1D6NA 2BW0A 1AS0A 5J2BA 1UBNA 2FJ0A 4EGFA 3DJYA 4AG3A 4FZ3A 3MWJA 2ZRIA 2EATA 2JHFA 2PKQP 4FFWA 5EERA 5CB4B 3PC8C 4D57A 3JAKA 4QZGA 4FJ2A 3SV3A 1HFWA 1M2KA 2Q0XA 2UZAA 4BKMA 4XYBA 5SZHB 4TLBA 4U8GA 3UWMA 4O2RA 1AT1A 1TX4B 4RJ2A 5JE8A 2ZCVA 2APJA 2FPMA 3GGJA 4TSFD 2UYHA 3I9V6 4JLDA 1H0SA 5DN9A 4DQKA 5AJHA 3FMVA 1Z25A 2W2KA 3AJ8A 3G79A 3OKCA 2XE7A 1FVHA 4E33A 3D6NB 3UUEA 4AWAA 2BQUA 4L02A 4WGFA 2WUDA 3OZRA 5K03A 3MYRA 1ZQKA 1NN1A 1U3VA 1WBJB 3ECAA 3R1IA 5KNCA 3QFSA 4C0HA 1XQWA 3I0NA 5B5EU 5H7XA 4YQEA 4HQNA 4DR5B 4UQPA 2PMZF 4JNKA 4FFVA 5T4EA 1LVHA 2GBCA 3U9LA 3IAXA 1N6HA 4OVKA 4YRJA 1NC3A 2JIBA 4BNLA 5H5JA 1E2UA 2F1IA 1XZFA 1ZMBA 2R7AA 3I2IA 3KUUA 3O0TA 4HDMA 4NBTA 1S9HA 4QYWA 3T12A 3T0FA 4E31A 2ZAGA 2H2WA 5EESA 4AC9A 4R81A 5AJUA 4C5AA 2GK6A 3OOSA 5BMVB 3LRTA 4ZO4A 1JLHA 4JL5A 3AO0B 1LW6E 2W6ID 1IEVA 3ER9A 4M0AA 2WJAA 4H0CA 4MO2A 3VYTB 2BTQA 3KETA 5HM6A 4BFWA 1ZHOA 2OHVA 2R00A 3AKYA 3BGWA 4EPXA 4NHOA 3GLSA 4TKVA 1V97A 2OCKA 2HBMA 3ZX4A 3E27A 1OI4A 4DQXA 4US2R 3L6DA 1ZJYA 2CJXA 1U3TA 2A7QA 4GNRA 5FPKA 2WF5A 4MDFA 1E5DA 3FCSB 2Q7OE 3FNRA 4L75A 1L5SA 5H80A 3NRJA 4B81A 5HIKA 4XOIA 3IJRA 4M0CA 4EG0A 2ACKA 3TX2A 3WWYA 1GQOA 3C2LA 1MG0A 3NM6B 3V80A 4EDHA 3VI3B 1IBCA 3CX6A 4QBKA 5A2QA 2HFKA 1KI6A 3B9QA 3HR7A 3KYDB 3REQA 4CTNA 3DO8A 4MUBA 5CT6A 1TEZA 1YZGA 1K2VN 2RAVA 5IP5A 4XYLA 4YGYA 1NK0A 2DMRA 4HFJA 5FF9A 5A3VA 8ICKA 1E6CA 1XRJA 1ZQJA 3BJIC 4MOWA 2W48A 2I87A 4Q9AA 1Q74A 3BREA 1M2OB 1NT4A 2JZNA 2R97A 4UDXX 2R9VA 2C8VA 4LXYA 2OBFA 3AUXA 3HB1A 3W6NA 3Q7QA 1YONA 1N48A 2O0HA 3A6ZA 4UU1A 2Z4TA 1P80A 3AFHA 5D1NA 4B74A 1CFJA 1UEXC 2TSYB 4BMDA 4C0AC 2P35A 4X6UA 5FB3A 4CLRA 4KXYA 4N18A 2NW6A 1N6RA 2AG6A 4ZC8A 1QQBA 1DJNA 4IMIB 1JIHA 4C4SA 4I3FA 4DXDA 3PW0A 4WK0B 1GPBA 2CZCA 2FW0A 2ID8A 3CINA 4HPWA 1H1TA 4GZMA 3TW4A 2VATA 4JXZA 3KNZA 4R1LA 1ZISA 3WWCA 5K3CA 1QGUB 1USVA 2KVSA 5B2ZA 1FNNA 4S1OA 2XCSB 3O26A 3KKOA 2JVJA 3RQIA 4G0PA 2Q9BA 1LBIA 3UBTA 3L1IA 4ZDJA 2WRZA 1E1NA 3A6DA 3EH1A 1DAHA 3H2IA 3SIXA 5HZHA 1UP4A 1JXAA 2ALZA 1P1RA 3KTFA 5A1JA 1IY2A 4CG2A 3CS3A 2ODTX 1EK6A 4LOLA 2IV3A 1ECFA 5HS6A 3T9AA 4PPFA 2R96A 3TADA 3FHJA 2PBLA 3IQEA 1HSOA 3ESAA 3K0AB 1CJTC 1Y3HA 4HLDA 4X6LA 3TN7A 4AF8A 2PD4A 1NOKA 3BEDA 4UE2A 4EVIA 1JFRA 2P66A 3B7PA 5C8VA 2JAWA 2Q4OA 2REQB 1CV2A 1I3KA 3V4RA 5C5EA 4R68A 1PLJA 2X6QA 3OG9A 4MH0R 4B40A 2WZQA 3RBEA 4F06A 4PM4A 4R2WA 1Z7EA 4GMHA 4H2DA 2QW1A 4EX6A 3M6MD 4L2IA 4G86A 2FWNA 3MIZA 3VMMA 2QTVA 4NYMR 5EZYB 5JMTA 4LWOA 5KAFU 1S0VA 3B82A 3IQHX 4MS1B 1U6JA 4X20A 2ZJ4A 4FONA 2GHTA 3E82A 1UKVY 2ZB7A 3HYRA 2ONCA 3NFRA 4LZLA 1I3CA 4RZIA 1XNSA 3VISA 1NK9A 1CXZA 1ZK1A 3KSUA 1BWSA 2BBWA 4CHTA 5KVAA 1YB5A 4EGJA 2NPIA 2Q2WA 4K4IA 1RAAA 4BNZA 2H2DA 4W4TA 3N70A 1UPAA 2NU7B 1NXXA 1LBEA 1JDTA 2CXTA 3UICA 3IIKA 1CQZA 3H4IA 4EFKA 1KRWA 4G5YA 3BWEA 3LY9A 4HVAA 4BJHB 1E3SA 2JCSA 3DZBA 4I2JA 1KJJA 1PEKE 1T24A 1Y3IA 3E3MA 3KT3A 3ANMA 1ZVJA 3N2KB 4J0FA 4UNPA 4Y1RB 3K8QA 2BR5A 5EZ5A 2EDCA 4ZOHC 2Q5HA 3PE6A 1ELOA 3ZLVA 4G5GA 1Y63A 4K9KA 4UZFA 3O4HA 3AF4A 3TRFA 2LUOA 3U0BA 5F3WB 3I9KA 4M9UA 2WHPB 3PK0A 4RHEA 4UHDA 4BX3A 4EYSA 2WB2A 4O2BA 2AJ8A 1ZITA 4AS1A 2XLCA 1Q7TA 2HRZA 4DCCA 4E2FA 1IPEA 2VP4A 2FFAA 1H5NA 3DHNA 3JYNA 5A4DA 4RTLA 2QMUA 5HHTA 5KSOA 3DA8A 3NTLA 2I6XA 4XRRA 3F6EX 1ZQ9A 2G28A 3CRW1 3K31A 2AZMA 3DOFA 1P9WA 2JS7A 4D9FA 4FLFA 1FZQA 3GQCA 3KHUA 4PGXA 5J5CA 2Z98A 3IP7A 4K4GA 4DZZA 2XMGA 2ZIGA 3TTTA 1PV4A 3LXRA 2Q1XA 3LHIA 1E0SA 3TAUA 1L3VA 2Z4SA 3B5JA 3KQPA 5HUJA 5JSZA 1DBVO 3ILHA 5AK5A 4RV5A 3KPUA 3W2GA 4BGVA 2P4HX 1HDIA 1DELA 5LZ4A 4J4BA 4MO9A 1AKWA 4M2LA 3HGMA 3FZNA 3MABA 1DL5A 1YCHA 4HAXA 4L4UA 4P4LA 4LYFA 1QHYA 3D6VA 2WG1A 3PJGA 2DE0X 4HWTA 4LHSA 5CHEA 3RSZA 5LD2C 4CIYA 3EG5A 4YAOA 4YHBA 2ZJAA 1BCSB 1ESDA 3T6KA 4DV3B 5EFOA 4H7EA 4LF5B 1HDYA 1TUEA 2V97A 1XVTA 4L07A 4FFPA 1VYTA 2JH8A 3SLKA 3JWJA 2CCGA 2XW6A 2FW6A 4HLUC 4MAAA 2CEKA 4OHKA 2O3TA 5ITSA 4P5EA 2GEDA 3VC2A 1R3UA 1T6BY 5JAHA 1DAIA 4BKPA 3LWBA 2YL2A 2AR9A 2ZUSA 3BMOA 3CC8A 3GFBA 4IHQA 3I76A 3ORRA 2AFHE 4GF5A 1IHDA 4BJ6A 4QECA 4YP3A 1AKMA 3P20A 4J9VA 1JH9A 3LO5A 5BSEA 5H4HA 1BROA 1EA7A 1OC2A 1XHFA 1K06A 2QD3A 1W1WA 2TMKA 1SKYE 2EL7A 3G5LA 1MJNA 4P38A 4RHCA 1Y9EA 5B36A 3BIXA 3FOFC 3V6JA 1N0VC 4FN4A 4H7FA 2YMQA 4RAOA 3GLFA 3TLGA 2PWAA 1FL9A 1QX3A 4JC8A 2OAQ1 1QO0D 3EPIA 5AP9A 3VR2D 4AO7A 3VR4D 3UA3A 5IT9A 2PUGA 3P9NA 3BS4A 5EA2A 3EBOA 3A10A 2UXBB 2VNSA 1V3TA 3RYCB 5HIAA 3GJTA 5U9CA 3GF4A 5IAJA 1DMRA 4YRLA 1V9CA 4ZVNA 3IKTA 1FBNA 3DFUA 4NNPA 3RTDA 2XGOA 1LB2B 2REXB 1AQJA 4FX5A 1ZK4A 1D8LA 3EXG2 3FPEA 2I78A 4EJSC 5HQ3B 3L7YA 1KZ1A 3U39A 1OHHD 4DILA 2BSXA 4LY0A 4A36A 2QZJA 5AESA 3KFVA 3PUYA 2P6UA 1GQFA 1P0IA 1G8HA 3PUHA 5FLKA 4YAFA 3RKUA 5GIPE 3V8VA 4XRHA 5LBTA 4JCCA 4NQRA 5EVCA 2VP0A 1N4DA 4DCTA 1FXUA 2X1VA 5BW8A 4KR3A 1ZL0A 3HZHA 2XXAA 4QQ8A 3V1UA 2XC9A 2H3VA 2X2FA 3GVCA 5K0ZA 5HKAA 3JALB 5L3VA 3DFFA 1YQ9A 2QIPA 1ENPA 2PKEA 3U17A 3VDXA 3ZY4A 5KTSA 4CU2A 4ARCA 3GIKA 2KSQA 2Q49A 4OGWA 5LQSA 1CY7A 1EP3B 1N56A 2MSLA 1XALA 3DOUA 5CYOA 4UM7A 1M0SA 1DWPA 3JSXA 3N0TA 1N75A 3QKSA 5LBIA 1RHJA 3ZVRA 5HCUA 2KVCA 1YI8A 1NP7A 2DECA 4H7JA 4BO6A 5K0SA 1IUNA 3HCFA 1P0QA 3QBEA 4H7IA 1QSYA 1NV9A 4XM1A 4A8HA 4UB1A 3SYKA 3EAFA 3WL8A 2J6UA 3OC0A 4MRVA 4C7YA 3I04A 4LX8A 4RAQA 1GLVA 1A9PA 4HHEA 3BE4A 4BO3A 4GXJA 1YFLA 1FC0A 4J7XA 1DX4A 3UCFA 4R5HA 3UK6A 2AKYA 1JEQB 1ZK0A 3ORQA 3QPBA 3PUZA 4JROA 5DLQC 3OHAA 2AOWA 3QPCA 4M1EA 2NU9B 4EFMA 5C53B 1W36D 2E5LB 1AUQA 2CXHA 3QMWA 3M6FA 3P94A 3FYHA 4QASA 5G0SA 5HIIA 5GJBA 4MUYA 4MV9A 5B1IA 1ZY2A 1QJ4A 2DUJA 3GN1A 2BPFA 3S68A 5BW5A 3OOJA 1NXOA 2GASA 2VTBA 2MT9A 2IS2A 1SUEA 5SYAA 2C54A 1UXJA 3SYRA 2ZQ5A 4RF2A 1U2SA 2HB6A 2J0EA 3I73A 3WV4A 3QU4A 1G2QA 1P75A 1V5GA 2CXOA 4Z3OA 3C74A 1ZQHA 3FCCA 4IIJB 5A2GA 1ORTA 5I9LA 1IQRA 3M33A 3USZA 4RQNA 1I51A 2Q0HA 4RCZA 4FW9A 4FOLA 3WLFA 1XWWA 5CA0A 3PE3A 2VBIA 4BO7A 3TFQA 3E0QA 1W0CA 3LQ2A 3FHTA 2PYDA 3TKAA 4IOLA 3PV0A 4HMOA 4YDHB 3T9CA 3UOWA 3GOHA 1Y82A 2J6CA 3KZMA 5JS2A 4D9GA 5BN4B 2HW8A 1VLHA 5A0VA 1U4NA 5HMMA 5J2AA 1T9GS 3EOZA 2GESA 4EZEA 3T3FA 2GPSA 3HCOA 2HSZA 3FNQA 2OZPA 1XL0A 1XJWA 4IGEA 4TZKA 4AZSA 2JEZA 4D8WA 1YZHA 2OH2A 2QPAA 5C7YA 3DKVA 4JEUA 1DC3A 3TRHA 2FMXA 3KQVA 3WOHA 2H3ZA 1UADA 421PA 3PC4A 1JG1A 1T1EA 3SN6A 4JI4B 3IBCA 3PTAA 1N1MA 2QZPA 1SUPA 3GWGA 4LTNA 2G0NA 3N2LA 1IN8A 2ODPA 3D0QA 3K2QA 5FH9A 4XW2A 1TZMA 4TVBA 2Z58A 1I4WA 1FDWA 1E9DA 2BWJA 3HVJA 5DNDA 4MQMA 4B31A 1P9LA 1PD0A 5IZCA 3K0CC 5M34A 3IURA 5ICSA 3B9JA 1BS9A 4Q00A 4XGQA 2Z3VA 4PO8A 2X4GA 4MR7A 3PQEA 3V3KA 5L8VA 1PQYA 1X80A 2IPMA 3OESA 1QCYA 1JROA 1T3SA 3K0CA 4IUYA 3T54A 4HGYA 2B2NA 5CA1F 1JHDA 2EQBA 3EXFB 2XT6A 3GJZA 3IC5A 1Q12A 4IZHA 4XM0A 5FI1B 3GW8A 1LLDA 3WIEA 3TXAA 4BKRA 4CF4A 1UC8A 3E9DA 3IPYA 4ESOA 1DADA 2WKWA 4RZ3A 3QHAA 1ENOA 3WB2A 4DLLA 1CUWA 5J2UA 2IYTA 1T1RA 5ER6A 1ZQVA 4EHAA 3OHBA 5EZYF 2AOVA 4OIMA 4IEFB 1XXHB 4KW7A 3DMTC 4DO9A 1OWPA 1HDXA 1ZS9A 1KYYA 1XTSA 3QHQA 1Q3KA 2A0FA 1Y81A 4HMQA 3TLAA 1UFQA 2XCPA 3DE4X 2D0OB 3FF4A 3H65A 3K1ZA 4HEJA 4NLGA 2W83A 3D0RA 5GV8A 4UKDA 3R7DA 1FSSA 2QVYX 3V1TC 4NJMA 3HP4A 1RWPA 5IWCA 1E96A 1I4TD 3DJFA 4ZQHA 2G9ZA 1U0TA 3NW9A 2VH2A 4H60A 2ARKA 2BLLA 3RASA 5K8IA 3JXEA 1F0PA 1JQEA 3E22A 4D9NA 4U7TB 3DFMA 4DNXA 2ZRBA 5I7HA 2Z2JA 2H17A 1RBMA 3KHSA 4KKVA 1H0RA 2OV2A 5EE3A 2BV3A 5HR7A 1LZLA 2V7TA 3PYXA 4LOHA 2OO7A 3RYFA 5BV1A 5ISMA 4DG9A 3BSSA 3T8YA 4CIDA 4C4XA 4EIWA 3BRWA 4IYJA 2IYVA 2K7FA 4E2XA 4L72A