4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
1YMQA 3FPSA 2HEGA 2ODAA 4Y2JA 2NYVA 2C88A 4I9GA 4B6JA 1U02A 3ZVLA 4UMDA 5ALUA 4FFDA 2WHEA 1L7PA 3FZQA 2MU1A 4NABA 1YS9A 1X42A 3AR9A 4XPZA 3DDHA 2W43A 1Y8AA 1U7PA 3AR7A 3HLTA 3ZWDA 1Z4MA 5ALIA 2ZG6A 5AVWA 4AP9A 4KNWA 3SKXA 3A1CA 2GHQA 2JARA 3OTQA 2NO5A 2FPXA 5AKYA 4NV0A 2IOFA 4CF5A 3ESQA 4L6CA 5ALEA 2JAOA 4BNDB 1QQ7A 3NAMA 5AI0A 3SMVA 1RKQA 3S6JA 3U7FB 5AVXA 2BDEA 1J8DA 5AKKA 2B8JA 3N07A 4PNHA 5A3SA 1XP5A 2FPWA 4MUMA 3WK8A 1L8OA 1WPGA 2YY6A 4KNVA 1RDFA 5ALPA 1PW5A 2YBDA 2FUEA 1JUDA 5AK3A 5ALDA 2C4NA 2G09A 3EPRA 2GHTA 4E88A 1O08A 2I33A 5ALZA 3U19A 4EX6A 2G06A 2R8XA 3K1ZA 3MN1A 2PQ0A 5AM2A 1SWVA 2C8LA 4DCCA 1QH9A 4FE3A 3L1VA 4BKMA 5AW6A 3ZVNA 2ZOSA 1TJ5A 2WM8A 1IWOA 2EAUA 1L7MA 2IOFK 2G1AA 3KD3A 4EZEA 2EARA 3L8FA 4O8CA 1WZCA 3L5KA 5AI5A 5ALLA 4OCZA 4CNQA 2B0CA 2IOHA 2YJ4A 2WF8A 4MWOA 5ALWA 5ALTA 3OPXA 3U7HB 2I34A 1L7NA 2ZBGA 3PDWA 5AVRA 3HYCA 3AR4A 1YJ5A 1L8LA 2ZBEA 5ALRA 3MMZA 4KYTA 3EF1A 2FUCA 1T5SA 2IYEA 3PGLA 5IS2A 5AW2A 1ZJJA 1N8NA 3L8GA 5AVVA 1ZOLA 1Z4LA 3U7GA 2HF2A 3N1UA 4ZEWA 3ZTWA 1Z5UA 3OCZA 5AVQA 3N28A 3BWVA 2G0AA 2D2VA 2AUTA 1Z88A 4EENA 3ET5A 4HYTA 4UARA 3E84A 4YIKA 5AIAA 3ZTYA 3R09A 5A3RA 2YFYA 5ALOA 4CF4A 4BNDA 2AH5A 3L0YA 5AKIA 5AW4A 1WR8A 4IFTA 4DFDA 2RAVA 2OBBA 3QXGA 5AKHA 3L8HA 5AK5A 3WK4A 4YIHA 4JDPA 1QQ6A 1ZD2P 5AICA 3AR8A 2P11A 3U7EB 3A1EA 5AM4A 1S2OA 5AHXA 5AW0A 3P96A 3AR3A 2WF5A 1RKVA 4YCMA 2R8YA 4GXTA 4UAUA 1NF2A 4DW8A 1U2SA 4ZEVA 1Q92A 2Q4RA 3FPBA 2OA0A 4XE5A 3KC2A 1XVIA 3RFUA 2JAWA 4YCNA 2O9JA 4BYGA 2W4MA 3R9KA 2I7DA 2GO7A 2YJ3A 5AKXA 5ALXA 3WKCA 1U2TA 2HHLA 4H1WA 2I55A 4UATA 1RQNA 3I28A 2FDRA 3QU7A 1ZD4A 1L7OA 2WF9A 5AI8A 3I1YA 5AVZA 1NNLA 2I6XA 1ZD3A 5ALYA 1TJ3A 1T9ZA 2ZBDA 1Z5GA 3E8MA 2I54A 3WKBA 4UASA 2HOQA 4JB3A 4HGQA 2B82A 3FGOA 3QNMA 2AMYA 2RBKA 3A3YA 3QUBA 4NAVA 1Z4OA 1YV9A 2W11A 3QGMA 4G63A 5AM1A 1YNSA 3I76A 5AI9A 2NO4A 2RARA 1VJ5A 5AKGA 3DV9A 4C4SA 3DAOA 3QX7A 2YMMA 4G9BA 1U7OA 3KOOA 2C8KA 1QQ5A 1TE2A 2P69A 3NIWA 3ZX5A 5E0OA 4J2TA 4Y2YA 3R4CA 5AK6A 3L7YA 1LVHA 2P9JA 4NWIA 3DNPA 3UMGA 2HO4A 2EATA 3I6BA 2YJ6A 3WKDA 3PGVA 3ZWKA 3SKYA 1LTQA 2IA5A 1TA0A 2R8EA 3ONNA 4CE6A 4UMVA 3QU2A 3UMCA 4FYPA 2CFRA 4L6AA 3W5AA 2HX1A 4YGYA 2PKEA 3MC1A 5ALVA 4YCLA 4F72A 4YH1A 4HGRA 1KYTA 1YDFA 5AVTA 1EK2A 5AI6A 2WFAA 1RKUA 2YN4A 3WKAA 5ALQA 5AKLA 4RESA 4QQFA 3RF6A 5AW9A 3OCWA 3UM9A 1RC8A 1CR6A 1ZS9A 2B8EA 5AKZA 4UU1A 2ZXEA 1K1EA 5AW1A 3ZI4A 3L1UA 1SWWA 2X4DA 3F9RA 4NFLA 5AESA 4UW9A 2OM6A 1RLOA 4UMFA 4F71A 1Z4JA 1MH9A 1Z4NA 4HGNA 2OYCA 3ZX4A 5A3QA 5JJBA 4UM5A 4BX2A 3AR2A 3M9LA 2C9MA 4Y2QA 4EELA 5ALFA 3QU4A 4Y2XA 3CNHA 5AK4A 3OCXA 3E58A 2R8ZA 1QYIA 4UU0A 4Y2TA 2YMPA 1RMTA 3WK9A 2JGAA 2O2XA 3B9RA 2HI0A 1RRCA 1AQ6A 1Q91A 5AKEA 2YJ5A 4Y3UA 4KX5A 2Q5EA 2GMWA 3WKEA 3QUTA 4C4TA 3GYGA 4IG4A 3E81A 3U26A 4Y2VA 3NALA 1SU4A 4GIBA 4Y2SA 1VFPA 2GFHA 3ZUPA 2FI1A 3TLMA 3QU5A 1RMQA 2ZBFA 1Z4QA 1CQZA 4XOUA 5AIBA 5FP0A 1NRWA 3KDPA 2DQSA 2HDOA 2QLTA 3M1YA 4OHFA 3FVVA 2HF7A 4XQ0A 2FPRA 2MU2A 3QUCA 3PCTA 5AVYA 1S8OA 3L0BA 3N5KA 1Z4KA 1L6RA 2BY4A 4UMEA 2B1QA 3UMBA 3N8GA 2YMQA 3OCYA 3ET4A 2Q4TA 2G80A 3U13A 3NRJA 1Z4IA 2G07A 3WK7A 1RLTA 4I9FA 2B30A 4HAIA 2CFSA 3KZXA 2P27A 5ALGA 1ZRNA 2FPSA 1WVIA 3QU9A 4ZEXA 5ALSA 4KN8A 3BA6A 5ALNA 5T41A 3MPOA 4CF3A 3SHQA 5AM3A 3OCUA 4HGPA 4EX7A 4DWOA 4QJBA 3NUQA 1RLMA 2QYHA 4C4RA 2CFTA 3L0CA 1N9KA 5ALMA 1J97A 3L8EA 5AW5A 3WGUA 5AM5A 3W5CA 1T5TA 1RPZA 4J03A 2B1RA 3ESRA 3B8EA 3EWIA 4AS2A 5IT0A 3WGVA 1VJRA 5AW3A 2FPUA 3OCVA 3FM9A 5AM0A 3W5BA 2WF6A 2PR7A 2FEAA 2VKQA 5AKJA 1XPJA 1RQLA 4Y2PA 2CN1A 1ZRMA 2RB5A 1ZD5A 2MSNA 5AVSA 5AW8A 3EF0A 1FEZA 1TJ4A 2JAUA 4OFZA 2G08A 4Y2RA 3AR5A 5AVUA 3IRUA 5AI4A 4BBJA 1Z4PX 1F5SA 3J7TA 3QYPA 2WF7A 3QUQA 2YMLA 4UAVA 3WK5A 5AW7A 1O03A 4EEKA 3WK6A 3CZ4A 3AR6A 3ZVMA 3KBBA 1RMYA 3A1DA 2BDUA 3D6JA 5ALKA 3VAYA 5ALJA 3ZW7A 2HCFA 4OD0A 3NANA 4AS3A 3SF0A 4HGOA 2AGVA 3ZU6A 3SLRA 4BEVA 5IT4A 3QLEA 1EK1A 4KX3A 3ED5A 3W5DA 5ALHA 3B9BA 4RETA 4Y2UA 4BX0A 3IB6A 4L57A 4BX3A 4UM7A 3SD7A 2HSZA 3NASA 4BEWA 3IJ5A
chains in the Genus database with same CATH superfamily
1T8EA 2HJ9A 2HWUA 3MOGA 1CRZA 1ZHFA 5CFMA 5BSHA 1TKDA 2IQ5A 3HJAA 3S29A 5T6MA 3W06A 1Y8AA 1VE3A 5DPMA 3OTQA 3V6KA 2IOYA 2SKEA 1WUHS 3TARA 4HAZA 3KT0A 4RKQA 5REQA 4D8WA 1VMIA 2AXEA 3HPRA 3IT1A 1QO7A 3MUOA 4YVZA 3OT5A 2BFBA 1CRPA 4GMXA 2PJRA 4K6GA 2HB6A 2AFVA 1NBME 1V1RA 3HU2A 1JDBC 4QOSA 4CMBA 5KFCA 1N5JA 3ETJA 3HBNA 5BOSA 1P0PA 4QSMA 3RROA 3G0IA 3I6YA 1WUDA 2DKXA 1ZIPA 4BFSA 4J9NA 4C4YA 4IIVA 3IUJA 5CFPA 3E9NA 1IQRA 1I2ZA 4BXOB 3PIIA 4ZRMA 4P54A 4JOQA 4JS0A 3R3XA 3KQHA 3M6FA 4PL2A 3VRHA 5KREA 5H3CA 5BYJA 4O1MA 3NATA 1F9EA 4N0MA 3GLGA 5JAMA 2OQVA 1JLSA 2GLEA 1E2KA 3G8CA 2RHOA 3FC4A 4UHFA 3OM0A 3FNGA 4K1XA 4LYAA 2YN2A 5BSUA 4O9MA 5GP1A 4ZAWA 3L0YA 2QRZA 1E7WA 1UBSB 1NAIA 2FLPA 2OESA 2P2GA 1P61B 1SULA 3JPPA 3U7JA 4BS9A 2LW7A 4ED1A 1UKBA 1VG8A 4B3HA 2VP0A 2NOAA 3V46A 3Q3VA 5FWXB 3AILA 4ECEA 4INOA 5CB4F 2CL6X 1Z9BA 5JPIA 3OMXA 4IHQA 3U4AA 4HGQA 1FTSA 3UAZA 5TR9A 2HH9A 2EAMA 3ZCPA 4V0KA 3GA5A 1O2DA 5LD2B 4Q4LA 2D2XA 3TRIA 2PO7A 3H0EA 3H4TA 5LSAA 2WWHA 4F3NA 3D8SA 3SEZA 2YY7A 5IDYA 4FEGA 1YOVA 2A1IA 3PBKA 4YFKA 3KWJA 3HWTA 1J4AA 4MXDA 4MIOA 4CCYB 1H69A 1NFFA 4YUXA 1RWNA 4JVMA 4BO2A 2WUVA 1QO0D 3Q8SB 1II8A 3OOSA 3O4VA 1RC8A 4IQTA 4BP9A 4KIGA 3QE3A 5FPHA 1CUAA 1L5SA 1OZGA 1PR3A 2PYIA 3TTXA 3CCFA 3VPGA 2C9YA 4YAWA 2HZBA 1WBDA 5C8ZA 4F5EA 3ZQ6A 4QUIA 4AKIA 4F45A 4Y2TA 5JJLA 5HUQA 4IC9A 3DUFB 1QHGA 2C3MA 4II2A 4DSLA 2IPNA 3JQAB 5J2IA 1JKXA 3L8MA 3UUFA 3TIIA 3NONA 2WTXA 2Z6UA 4R2IA 2XRMA 9MHTA 2D8CA 5AXDA 4EIWA 5L3VA 3I2JA 4AJ2A 3ELDA 5FP0A 4R64A 2E55A 4BNVA 1RZ3A 1SUEA 1GNTA 4A8JC 3GROA 3AEUB 2XDQA 3QNWA 3SS9X 2EW1A 4EHIA 4OSPA 4GLJA 2VDRB 1QIGA 2W6ZA 4P83A 4X62B 4RD2A 3TG2A 1WVIA 1BWPA 2PL3A 1ZR4A 2OZPA 1UH5A 3FNHA 1SNYA 4AM8A 2DCMA 2D59A 1QG6A 1T1RA 3ZXSA 4IJ6A 3I09A 1WV1A 4FONA 5FUVA 3E9CA 3L7JA 2JJ2A 2MSNA 3KAJA 2WU0A 3V3KA 1R3DA 1RU3A 4ND5A 1IY9A 1GZUA 5IC4A 3H11B 3U9TA 1ZLYA 2W2KB 2HNBA 1T29A 3B70A 3HN2A 4RZRA 3Q98A 3PR4A 3LPCA 1JR3A 3IBTA 1EK1A 1L5RA 3PF9A 1BROA 4AU1A 3L4EA 1RCTE 4CN8A 4HWRA 2HJGA 5HKAA 2OXOA 3PG5A 1KJZA 4GOLD 4JVOA 3O03A 2DUNA 1EAYA 4IDBA 3W6PA 2HMYB 4ETIA 3DV0B 3D8BA 4EFDA 2GYVA 5I9SA 4WLOA 4DDWA 3A9SA 1C3OB 4HVTA 3WHIA 4BATA 4DQQA 1WXHA 3OP4A 4EUFA 9ICLA 1OZFA 1L3TA 3NAMA 4PG5A 2Y76A 2G83A 2Y4OA 4KMOB 2P6MA 4HC4A 3WDMA 3R7AA 3W5VA 1XTQA 2M6KA 3RR8A 1H65A 5LIRA 3NBXX 1XDUA 2FCRA 2JEJA 2HSJA 1YBFA 1BPZA 4XQCA 4HGZA 4LKRA 4U7DA 4LX0A 1CB0A 1AM4D 3OSPA 2AF3C 2QHXA 4EJSA 4GP6A 2J5XA 2O7RA 4NZNA 1ECBA 2BI7A 1KRPA 3QBEA 2CHGA 2FMTA 1K98A 4FSHA 3MILA 4GKVA 1ZZGA 1JHAA 9ICAA 2H00A 2QZSA 1RPNA 3VH1A 4E7OA 4B6OA 3VMFA 3AKDA 3KG2A 2EDCA 3TI9A 5CHEA 4BWGA 1NLYA 5LU9A 4RIEA 1EP3B 4BE4A 5KFJA 1MJ5A 3DVQX 3CZRA 4U5QA 3FHOA 1I36A 2HQ1A 4R8UA 3N75A 3IAEA 1YZNA 1PIWA 2H9IA 2UVRA 2W2LD 4PHHA 3KZCA 3TYXA 4S04A 4LJLA 2RP5A 4GPIB 3HU3A 1S2OA 5LQJA 1J25A 3LNTA 5BNFA 4BCBA 2WF5A 4TZ0A 5T8KA 4X5OA 3OLYA 3ICVA 3KAPA 1O1YA 1V5IA 3T5GA 5YASA 1G5FA 3HE3A 3E18A 1Z6PA 1KOFA 1V8ZA 4DSJA 4BAZA 3AUSA 4C0QC 1PQYA 1WLYA 1CZNA 3T9BA 4JLWA 1X1BA 5L1MA 1MFZA 4F9GA 1Z2OX 3K92A 4KKVA 4PYMA 1H9AA 4ZO7A 3SBXA 3RC8A 3B2EA 2C2HA 2NAPA 2AOUA 1LVHA 2VUSA 1HBJA 3GVXA 3SAJA 1SCKA 2VAWA 1QF6A 3BSSA 4J90A 4DEYA 5CM9C 4ICIA 3VO8A 2X4IA 3Q0EA 6ADHA 2DFNA 3AV3A 5KJ6A 1UPUA 2AC2A 3W5AA 5TC4A 3EEOA 1TYZA 1OLOA 2YJTD 4ZICA 3GLHB 3A9VA 3EDMA 2ZXUA 3N0WA 5GINE 1XZQA 1RQ7A 5JSZB 4J2HA 1TMYA 4O4LF 1YRQA 1U7WA 4D0SA 3AWIA 3D3QA 5IEJA 1WDMA 2XH8A 3TLXA 5C8XA 3NLLA 4E30A 1JG3A 2YVUA 4MVJE 1YQXA 3GFRA 1IONA 5D00A 4OHRA 1E9BA 3EZ7A 2OORA 4PAQA 1U0LA 1W59A 1Q1ZA 1DT5A 2YDXA 4JLNA 2DGDA 4MW9A 5IBPA 4PX5A 5BMVA 4HR7A 2D7JA 3EISA 2R751 4MS1A 3HA2A 2UYQA 3JZMA 1WE2A 4N54A 4B3FX 3L4JA 2PI4A 4IUBS 3HXPA 1NK4A 1EP2B 5SY4A 3WGIA 4YXMA 1Z5WA 4EI2A 3HS3A 2V6BA 3PSFA 4LV6A 3JCZA 4U1RA 4S35A 1ZX1A 1UAGA 1X7ZA 3LC0A 1RYHA 3H2BA 2FE4A 2YHAA 3F96A 2GD2A 3I5MA 2ECKA 4JVNA 2JFOA 3LVRE 3JPSA 1VFNA 1HGXA 2YC4C 1JFLA 2C84A 4DV2B 4E0BA 1RI3A 5ALKA 2QJWA 4LY0A 4PGHA 4E2XA 3GJRA 1RM4A 1HE3A 2H2IA 4G81A 1W94A 3H9CA 4K26A 2H4ZA 2PZLA 4J75A 2BISA 1USGA 4BKRA 1KVUA 2FP3A 4ENQA 4GPBA 2FMXA 1VKNA 2ZQZA 3A6DA 4JB8A 5LOVA 5IYZA 2WJWA 3CG4A 2GT1A 1KARA 4LYGA 3OSNA 5E6SB 1GPDG 3C6BA 1O87A 1XTPA 4OHOA 3LOUA 2EZ4A 2NZWA 5FOWA 3CP8A 2HT1A 1R4ZA 1EEXB 4QXPA 3ILSA 5C7YA 3HWWA 4QUEA 4YROA 4QECA 2VDKB 5K2MA 1KP9A 4P84A 2VO1A 3RFFA 4F4WA 4D96A 1X9SA 1VMEA 1PVRA 4FHGA 1FFGA 2KZ3A 4C7BA 4XM2A 3WQBA 2QTAA 5IXJA 4UUNA 3BGDA 3LW7A 1HNXB 2QRPA 4PWYA 3CPJB 1UC4B 9ICNA 4FUQA 1URJA 1T24A 4O02B 1KR5A 3RT1A 1E2MA 1MO5A 2CXXA 4L73A 1EFCA 2D3TA 1T7PA 4YJDA 4GM1A 3FJYA 4DG5A 4A8TA 3T3EA 5DWQA 1NPYA 1SKWA 1XJCA 4PSDA 3BQ7A 3GFTA 1XZGA 4ARVA 4WK0B 1SMKA 1JEQB 3S70A 4R65A 3K4QA 1BWRA 1LF0A 1SELA 1G8FA 4I4CA 3AF1A 3Q87B 2VZ8A 3LFHA 4KQWA 4M46A 4IS3A 3U09A 3D4NA 3FUTA 3EPLA 3HGQA 1EEHA 4I9HA 2WHPB 1U0SY 2WPDD 2MSLA 3QZUA 3LWZA 3EGWA 2Q9CA 3OH8A 5B30A 1J09A 1EXMA 4U8HA 2RJNA 5EXPA 2HHLA 5HJ7A 3VYUB 4QO8A 4O3SA 1DBQA 5COAA 4P0PA 2ZE6A 2H5LA 3W2FA 1SUDA 4QVKA 4I2EA 2NZVG 5FL7D 2VH5R 4B4VA 1CUIA 5DTMA 4ENRA 3A4VA 2XYQA 3EQ2A 1R00A 2V7GA 3SZRA 2MUTA 3P32A 4DIBA 3I05A 4RK5A 4A8JA 3MWEB 3AUFA 2ZIFA 3K1TA 4XUEA 3OO0A 3STTA 3V1MA 1HFJA 2XKJE 1CS0A 1IM2A 1OXKB 1YR8A 1MT3A 3C4QA 4O2LA 2XI4A 4HH1A 4QQFA 3P9ZA 2AOTB 4LJ9A 1DGQA 2CZCA 4PZAA 1E4EA 1NIPA 4E4RA 3CE9A 3TZEA 4MKFA 1UC5B 3DTVD 2IF2A 4FYXA 1QIMA 2H1WA 1YC5A 2IYWA 4FKBA 3ZOZA 3GOHA 2I6TA 1JLRA 3NWPA 3UXMA 3DA8A 3GVPA 2CCJA 3P97A 3TL2A 1NI3A 3NALA 1DI0A 2WA1A 3TPZA 1V1MB 3ZE0B 5L8VA 1JJFA 3LXUX 4XJXA 5DLYA 2PH7A 4UBNA 1QAQA 4KMSA 1D4ZA 2XCUA 1Y89A 2XA2A 4QT0A 4DWVA 2Q2OA 3NIFB 2QL7A 3UFXA 3UOWA 1UBEA 3KYCB 1USIA 3MRTA 4I9FA 4NLKA 3V9AA 2V74B 1TUGA 3UMYA 1W1IA 1Y6RA 1NUUA 4K81B 1T5BA 3ZZMA 3HUFA 2PTHA 4QUGA 1ZQDA 3ORQA 8ICRA 3BCSA 5CX4A 4F04A 2QD3A 4BNJA 2XVAA 2NVBA 3QOYA 1BMQA 3HMKA 1FEZA 4AY5A 5HMMA 2EBHX 5HHHA 2W6IA 5DYTA 2EKLA 1I9CA 4ARIA 1K7EB 3G1WA 3GEGA 3N7RC 3QUQA 1SZHA 3JS5A 4XEUA 2AUMA 4QU8A 3ROMA 3DJYA 3UWMA 1I32A 5KNBD 3KQUA 1KBZA 4EY5A 3SAFA 4BRSA 3T52A 1G7SA 1P5RA 2GZRA 1JTFA 4D56A 2NO0A 3BIWA 1SPBS 4RNDB 3RJFA 4OK6A 1G9TA 2ZSIA 1C0PA 3BBPA 3IB6A 1NZPA 4PXYA 1OUQA 1JHYA 2ODEA 3TF5A 1JBKA 2WWWA 1NVKA 2JLXA 2ZTEA 1WU8A 1T9BA 5K8UA 2SCUB 3OIFA 3X1KA 3A9TA 4LF6B 4C4OA 3AR7A 3N53A 1UHUA 1P2GA 2P35A 5KNLA 3UJBA 3TBKA 3K1AA 4YAOA 1HI9A 4EPVA 5GIPE 4BTLA 3PUZA 3O8QB 8ATCA 1YB2A 5H8WA 2KTQA 4YD1A 2F43A 1NC3A 1COZA 4U00A 1VDZA 1GSAA 3L6RA 1G41A 2F17A 3H3XA 2D2FA 3WAKA 2BONA 1CUSA 7MDHA 4H17A 1PWYE 1VSVA 2GEKA 2JFVA 2XE8A 4L8GA 1G6OA 4TVOA 2P9TA 3PVXA 2ZOSA 4W5HA 2OZVA 2GAFA 4YV1A 2GN2A 4EPXA 3V4OA 3CY6A 4R8MA 4IOLA 2AE2A 4JC8A 3ZJ5A 3DTTA 4IH9A 1D2CA 3R7SA 3ZE2B 1KVTA 3PD7A 2QRHA 1A9XB 1PK1B 3ORSA 1O96B 1SD5A 2A0UA 2F9MA 3ZLJA 1GQOA 3DFIA 2EZZA 2KX7A 4B3SB 3KXIA 4F5YA 2HDHA 3SZUA 5G3ZA 3IX7A 4JA2A 4MKZA 4WNIA 4YIHA 4EMSA 1KFSA 1L4KA 3UB3A 4EHBA 4WAUA 3VYWA 2E6KA 3OTWA 4GC9A 1W76A 3CGGA 1QGDA 5BMVF 1CFJA 3KHLA 4K0KB 1TJYA 1QR2A 3DPIA 2XCTB 4DIMA 3MGAA 4C88A 2KKVA 1R4MA 1ZGCA 2C2KA 3ZU2A 1TM3E 3PE4A 2PRJA 4G5YA 3R9XA 3Q7QA 3BGSA 3C24A 4ARZB 1M9NA 4MS3B 3QNMA 2V4QA 2B2XA 3OU2A 3KJQA 4C4SA 3GT0A 1VBNA 3ENKA 1L5HA 1R4NA 4R0NA 2ONJA 2BGUA 1TE2A 5DRYA 1GSHA 5L4SA 4LXHA 2JGEA 4P4MA 2CSUA 3GG2A 4OX9Y 4PSVA 1KAMA 3T0FA 5JWRA 3ICPA 4UU7A 3QEKA 4QATA 1W4RA 3MK31 1SIBE 4YRGA 1EM8B 1I7LA 1EP9A 2C2RA 4L3VA 5K05A 3OJFA 4L5YA 4EJFA 3OP1A 5KS2A 5CITA 3TH5A 3EDQA 2NU9A 1GPUA 3I73A 4M8SA 4DCGA 3MWJA 3FPHA 5BR7A 2CLDX 2XXBA 4EKGA 2RIRA 3JATB 3U6KA 4LMPA 1BAPA 5JG7A 2C5SA 4N65A 4QAQA 1I2AA 2QI9C 1VL5A 4C0ZA 5ALFA 1EZZA 1SUFA 2PFNA 4BQRA 5LOVF 5K2OA 9ICFA 1HOTA 1Z6GA 4ZPXA 3G0HA 3TLYA 1JE0A 1ILWA 3F46A 3PNBA 1YZGA 1WDLA 1MT0A 2IS6A 4YRSA 3GLGE 5IVIA 5CBPB 5ES4B 2HUNA 5EVJA 4UOEA 3PB3A 4K0RA 3G2NA 3FVVA 2M6LA 3V8NA 4AUEA 5LUBA 4R81A 4R0MA 5H16A 1EQAA 3J81k 2HHXA 3X1XA 1HFKA 8ICUA 2I8AA 2NP6A 5B1DA 2VC2B 3MCVA 3JAWB 3SHQA 3BA1A 2VA3A 3MGHA 1KNQA 3SYLA 1D0IA 3E15A 5LWQA 2P0AA 3RARA 3SYNA 1LK0A 4KUHA 1J5XA 3MLBA 4TS4A 3EGVA 5JQGB 3L4KA 1KBQA 2P2CA 1QHXA 4X93A 4UE6A 3IRUA 2V97A 1L4FA 2QUBA 3EPHA 4U2GA 1Z26A 2UUAB 3QF7A 2XUDA 3MAGA 3K9WA 1J07A 1HR0B 1SOMA 1OYOA 5E4TA 1DK2A 1Y7TA 1H5QA 3Q2OA 4TYQA 4DIOA 1MR3F 2PSDA 4M7RA 1TC1A 2HM7A 4DPKA 5TF4A 2IXAA 4LMBA 3P94A 4G8BA 1T6ZA 4RTSA 3ZXXA 5ALIA 4AF7A 3H75A 3HMQA 4HTAA 3ZXYA 5C8YB 3A2LA 3DG9A 1J8DA 3CGWA 4DA4A 5FKJA 1YZKA 3H4MA 1KYZA 2X3UA 3HFRA 3OOEA 1T8SA 4GYKA 5J2BA 3AI7A 2YIDA 3H18A 3LXRA 4JUDX 4YRBA 1VLJA 1FJXA 4BJQA 4GS5A 4DQDA 1JBEA 1NBAA 1WIWA 3P27A 3OY2A 4WPGA 5KQPA 3EUEA 4CKCB 1N3IA 4EYHB 1I1OA 2CDBA 4BHTA 1OTXA 1R64A 3GNTA 2GTPA 2WSIA 3ISJA 1P0FA 1FNBA 5HEKA 1V38A 2EFGA 3QA9A 2BELA 8ICKA 1YRHA 3L3BA 9LDBA 1RQ2A 3ECCA 1QVWA 4JBNA 1KMCA 1BEEA 4HSGA 3UG6A 3WGHA 2I4NA 1N61A 5IMSA 3RYCB 2V0GA 3ZH9B 2B9VA 3HCBA 2O7VA 3FF4A 4PXSA 3UB2A 3QWAA 5FV7A 1NKCA 1JI0A 3AG5A 3TOZA 3E7PA 3KWFA 2F8SA 3VPAA 2MYNA 4LTMA 3HW8A 3LVFO 1TVCA 1KKXA 1NLZA 4UAUA 2VDUE 4IJUA 3DEJA 2V5VA 3F8TA 3AJ8A 3F2VA 1TIBA 1UDWA 1RLJA 3OHSX 2ZPAA 3U4GA 3BRCA 3D4IA 2O8DA 3IP8A 1JDNA 3A9CA 3I0MA 1YIOA 1MSWD 2O5EA 4EGJA 2O8NA 4DL6A 3EUB2 7YASA 1UKCA 2BZ0A 4XASA 1YKFA 3V1LA 1J1IA 3VUEA 2OCEA 1VJ5A 1OASA 3ZU3A 5FOUA 4R66A 5JY1A 2NSDA 4RA6B 3FNFA 4Z1MA 3F7OA 3KOWA 2IJGX 4ZYUA 1XBTA 2H31A 1LVUA 3ZH2A 4GMKA 4U2CA 3OOWA 2HNKA 3MGBA 1QLNA 3BDPA 3G2OA 4WKPA 5J0TA 4YN3A 1FQOA 4PLGA 3AEKA 1E2QA 3ENQA 3HGMA 5CR0A 3IEMA 4F72A 1FFEA 2PV7A 1OGJA 2X5KO 2XQIA 4NATA 2QDKA 2VQFB 1L5MA 4J1TC 1ZQAA 2BE7A 3WHKA 3LWLA 3USZA 3L0SA 5JQWA 5DZSA 2IHZA 3PW0A 3OCWA 4TKUA 1K0UA 3BE6A 2XW6A 4QGFA 4UQGA 2VAMA 2XZOA 4MR9B 1NHWA 4BX2A 2DPMA 2Y1OA 4ER6A 1E2GA 1J99A 5JCPA 5KFNA 2PWAA 3KO8A 1SOUA 4MVJM 2G17A 3HZHA 1T3QA 3M6KA 3L0OA 4HP8A 4MB6A 4H1VA 3OPVA 5J2JA 3B6MA 2XZPA 1WD5A 1RLUA 3E48A 3RAXA 5HX7A 3M81A 5FTMA 5ER6A 4UKDA 2B5VA 2VRBA 2VPZA 1V45E 1NDUA 2XYPA 3FYUC 3SE0A 3GRCA 3GMIA 5KG2A 3KZVA 2Y27A 2YOGA 3ETCA 3EEBA 4DF3A 2ZUSA 3GN1A 2XT0A 3PWZA 3LT5A 2C2WA 2QRGA 7ICOA 4PZPA 5C34B 3X1ZA 4PFSA 3P2YA 2GQ0A 5HUHA 3VO2A 1Q7BA 2QAGC 4AZ0A 1C81A 4W4TA 4IDQA 3CXUA 3Q3EA 3MWDA 3GQBB 2ZSAA 1XZFA 3HI6A 1GZ7A 1RFLA 4V02A 2P3LA 1EX1A 1TUBB 4XR4A 1ZQEA 3S7ZA 2VAPA 2H07A 4MWCA 1KGSA 1GCOA 1V9PA 3C85A 2BD0A 4DFKA 4Q3BA 4J2OA 2CVQA 2WM2A 1QH1A 2GCPA 3HVJA 1TEVA 1HFWA 3T1OA 1ONBA 2D00A 4KYIB 1YVUA 1BD3A 4NHOA 4ECSA 3TR6A 1DG3A 1WXEA 4R8VA 2IBTA 4ECYA 3K1YA 2RGBA 2CHFA 3OZIA 3IAXA 4NV0A 4LPSA 5KVAA 2VOJA 5ITZB 1TK0A 1XMXA 1WDWB 1E6KA 1LJUA 1K3FA 4FBTA 4KXMA 3L01A 3I39X 3LUBA 2PYZA 2UZ4A 2CLKB 4M9NA 5E9AA 3FLBA 1DNPA 1P9RA 3LHKA 3D7MA 4ZV7A 1SOVA 3NWJA 4B48A 5BRJA 2G09A 2H4YA 3JPOA 1HDGO 4JJFA 7AT1A 1SWVA 1J33A 4DSOA 1T3NA 3IP1A 4XYGA 5E6RB 1J9EA 1GUAA 3U44A 4Z3KA 3ZQ4A 2K87A 3VU9A 1QIKA 3VAZA 3LOPA 4RJIA 3TIFA 2H1RA 4CLOA 1Q44A 4LZDA 2VRCA 3AYZB 1EJ6A 5IAKA 5K3AA 4JUZA 1P80A 3OEHA 3WBKA 3WIEA 1RYSA 3SZ3A 3V9PA 2QPTA 4BASA 4BLVA 1XZEA 2C04A 3PPYA 4KYVA 3QUSA 1RXUA 2X5JO 5GTHU 2R8JA 4HDNB 1LPNA 1N2SA 4XRGA 2H54A 1YACA 5EIFA 3KETA 1O6GA 3N70A 4AIIA 4WASA 1A96A 3AJDA 2GVNA 3ZDAA 1XC7A 2XWPA 5D7NA 1J21A 1POWA 4XCXA 1GARA 4BNXA 3BMQB 3MTQA 4XE5A 2YB4A 1SZPA 4S1WA 1TM1E 4BWMA 1A2BA 1E98A 4B8WA 2W9AA 4JI0B 4F2HA 3QU7A 2VYCA 2W37A 5DXFA 1RSZA 1DXSA 2OV4A 3GMSA 5JJ5A 5IM4A 3D3JA 3VV3A 3S0JA 2JH8A 5IINA 4JBYA 4OUDA 4EP1A 1Z45A 4KGVA 4A2QA 4CDGA 2SBTA 3DM9B 2GPYA 4DV6B 4AJPA 2XNSA 2X2PA 1A8UA 3QQ5A 4GVLA 5IKMA 4J9QA 3F53A 1MX3A 5KTPA 3SQDA 4F5NA 1N1DA 3HXOA 1EUDB 4HQRA 1TA0A 3MLEA 2FE9A 3TNJA 3TOSA 1EGVB 4Y1EA 5ARBA 3EBLA 5AVTA 3GT4A 4FD3A 3E5HA 1J0XO 1QH0A 4UUOA 1FSZA 821PA 3SEQA 2WJIA 3LP8A 1B15A 4EOGA 3GH1A 1Y1QA 5B3JC 1KQNA 4RQMA 3KWLA 2RAUA 4CKBA 3LKDA 4CM9A 2OYCA 2QM8A 3VPHA 4C7KA 4EELA 2A5GA 1ND6A 1ECJA 3I64A 1V6SA 3E70C 1NQXA 2B92A 4XW2A 2ORYA 3NVKI 1TZJA 2XICA 1P9LA 1U7UA 5K6TA 5NULA 2B0JA 3EVZA 4XPIA 2ENWA 5EIWA 4GVPA 4PX3A 4QVGA 3HI4A 3T6KA 2PKQO 1BRMA 1Y6ZA 4S12A 4JSRA 3M7DA 2ZANA 5FOVA 3MUEA 3IP7A 1XHEA 1OI3A 1AN0A 3E0FA 3FMGA 1C30B 3ZWBA 1S1CA 4FDVA 3D54D 3AJAA 2LKCA 2B98A 5B58T 3C1TA 1KO7A 4BVGA 2PUHA 4JFAA 2C96A 1R66A 1I7QB 2B30A 5A06A 5L51A 1ODFA 1WB6A 1LX6A 3RIGA 5TQ0A 1IMOA 3PC8C 1N9ZA 2XMSA 3TZ6A 3PR2B 1U2DC 3RABA 1U9IA 1YB1A 3GJ8A 3G89A 4XSHA 2GOYA 4RQ0A 3MINA 1KETA 3LECA 2YMLA 1V7ZA 2ZYSA 5DSZA 3VKWA 1NXOA 3AO0B 3NDJA 4YR3A 2J6CA 4ZQFA 3HXKA 3I12A 1WPQA 4BO7A 1RPJA 1NYLA 4C8MA 4QZ8A 5DEOA 4C78A 4O2RA 5I4BA 1E99A 4DRYA 3FVWA 4KTTE 2O8CA 1X42A 1UXIA 5E8RA 4QELA 5J2HA 5A5DA 2ZSBA 3TZKA 3ZWDA 3HJRA 3OQ1A 3L05A 5ES3A 2X19A 2DRIA 2VXOA 3EXEB 4E2WA 4GE0A 2CLMB 2AYYA 2RGCA 4Z86A 4DQRA 3RH5A 3DONA 3LLCA 2LCIA 2ZP1A 2LNDA 3KM0A 4LNUA 4KLHA 2HWWA 1KI4A 3S1AB 1USVA 5EEGA 3H0RB 3NC0C 2AZXA 3HU1A 4CL8A 2QMQA 4I8DA 4YMNA 3K5PA 3UXOA 4ISCA 5B64A 4TTAA 2CBXA 4R7ZA 3N3BC 2EKPA 4J4BA 5LZ8A 2ZIAA 1PEDA 4OHMA 1ISIA 3AHFA 5AJHA 4YRMA 4Y6SA 3CVUA 1XRNA 2HQOA 2OKCA 1EFLA 3TIGA 1CF9A 2XLBA 1Z5UA 4W9RA 3RVKA 1RPLA 1PJ8A 3E4DA 3K70C 1BMTA 3B78A 3VKVA 4DA0A 1PL0A 3EZGA 4DCSA 2K7ZA 2LYHA 3UIEA 1T8UA 3H97A 1OY1A 3OQBA 4J1TA 4Q7MB 4B09A 1NJSA 4QDZA 3U3ZA 3OTHA 3TWOA 3WGOA 4Z6DA 1KI1A 1DKPA 3TQOA 4J6EA 1TZBA 1BWQA 1J22A 3Q5GA 4RJJA 4PFKA 1HNWB 1VPTA 3NHAA 3R5XA 2J59A 4XAQA 4HPJB 1TMKA 4MGEA 1KN5A 1GR1A 2W7PA 1TL7C 3L04A 1ZD3A 5L53A 1T5HX 3TXYA 4L4ZA 1UP4A 1PR2A 4IIXA 3ZY3A 2FPPA 3EIQA 3MOSA 5AM1A 1IK4A 3P52A 3JD0A 1E5QA 9ICMA 2DMRA 2QV0A 1CP3A 3LGXA 2JH7A 4DR2B 1H94A 5U1PA 3OZTA 3ILYA 1VMDA 4P9NA 3FGPA 1SL0A 1N0UA 1A7JA 2BF7A 2CVFA 2QYTA 2WU8A 4MZDA 5IP5A 2ECFA 5TRTA 3RV3A 1PQWA 2HA2A 3NIDB 2C5AA 2QU8A 3TLCA 5H7XA 3HJBA 3LQ4A 4YCXA 3RF6A 4PIPA 4F2WA 3IT2A 2QAGA 5ECDA 3KCNA 5DBOA 1Y5LA 3I2IA 3KQOA 4FZRA 1B0PA 3IEXA 2DH6A 2BPCA 1XZKA 5FBKA 5DF1A 2BKEA 3V6JA 2WG0A 3VM6A 3CF4A 2JGAA 1S4MA 1KS2A 2B78A 4I2GA 1F5NA 1DC7A 3NEPX 3QJ5A 4EFLA 4IY1A 3F6BX 5DW0A 1N9GB 1G6HA 5JWOA 4UAYA 1U49A 1XCPA 4FXOA 3Q7SA 3WOHA 4E5MA 4F56A 3W05A 1GPBA 621PA 3TX2A 1YR7A 4W9MC 4GH5A 3GEPA 4ABYA 2KQUA 3Q8WA 5JMPA 2CD9A 2XHZA 2D3DA 5FIUA 4JOBA 1SIJA 1G38A 3FNIA 5DOVA 4I3HA 3CVWA 2OKGA 1FRFS 1XA4A 2WF6A 4KEAA 4MKXA 2Z9DA 2R96A 3ZBPA 4R1TA 2W70A 3U37A 5GMOA 4OFZA 3IMCA 2HVHA 2X58A 1SXPA 4YA6A 1V8FA 2C9OA 3AI2A 3WK5A 2LIPA 3CX7A 1Y98A 4EEYA 2PKYX 1WZEA 3G0OA 1S2DA 5U4QA 4BJ6A 4F3KA 3SBEA 2BP7B 3WFIA 1J5EB 1H85A 2X1LA 4NLBA 2IZ0A 1Y0BA 3DH0A 4S1VA 1P3DA 5CNMA 5DQGA 2Q5QA 3CWZA 4H4CA 4EKNB 2O1EA 3QJGA 1QWSA 4UPVA 1MEJA 3RVOA 2PGJA 3MDAA 4WBNA 3AHJA 1WOYA 3CT6A 5HS4A 3UT0A 5HHIA 1Z7EA 3CRQA 4C8NA 1GITA 2XGOA 2QI9F 1MHTA 2H3QA 2FPIB 1NNUA 3BIFA 2WP8J 1JXMA 3HVKA 3BRSA 2CYAA 1KJWA 1MA3A 2W6PA 5IM4F 5KFSA 3QLTA 1KW4A 1T4DA 2VG8A 4GGMX 5AKKA 2UVUA 4PRKA 3C3PA 1QIFA 3A6FA 1I6WA 4X6XA 4Q19A 1ORIA 1NZBA 4OBEA 2O50A 1ODKA 3PQ6A 5K3FB 4H3SA 3U1TA 2PLAA 2RG7A 5IBQA 3PD0A 2J6TA 1DRWA 2P40A 3MB5A 3BD8A 1XDWA 3OIVA 3TQIA 4GWLA 4PZCA 4V0ME 3WHPA 5J43A 4JDUA 1JHMA 4YR0A 1L5VA 1G5HA 1X1SA 1ADCA 1KYQA 3JW8A 1L5NA 3PXCX 4NDAA 2C78A 1K3TA 3K35A 5KNBH 3HM9A 2QP3A 1L8XA 4KGZA 3A2NA 2B3DA 4J9SA 1AROP 5EWJA 2IC5A 4L76A 2OD7A 2QIOA 1XU4A 4F6CA 4JASB 2Y1XA 5EIHA 2XQVA 2ALZA 1N2HA 5JPCA 1W5EA 1FCJA 3AR8A 4X44A 3MJEA 3ZGYA 2H9AA 5IX8A 5B3JA 1NJ2A 1OV6A 2Q4RA 1PG2A 1A0PA 2CUNA 5LM3A 1SXEA 3AM1A 2YV5A 3WLSA 1DO2A 3P4UA 1X9XA 5K5EA 1FMLA 1R9NA 1CJSA 1ZIYA 1UIRA 1ZH2A 1TAGA 3I6IA 4GP7A 1U3FA 2WZDA 5HGJA 3BGVA 5GOZA 1DOQA 3KL4A 2GZ1A 1QBGA 1XUOA 1UK9A 4G9EA 2C4TA 3PE3A 4N41A 2C4HA 2CE2X 3KHTA 4H6PA 4MWDA 3FGNA 3P2MA 2VXBA 5CPFA 4DQPA 4DR1B 1TIKA 2C2ZA 4AKEA 2P3OA 4LK2A 1O0CA 4YGYA 5L4NA 2M6RA 5JSUA 2B21A 1Z36A 2YXPX 3E3MA 3ROQA 1PJRA 5DV9A 3HXQA 2X6QA 1D2HA 3PC8A 4GI2A 4DBVO 4RY2A 2GVZC 4JMPA 2WAMA 1U2DA 2H17A 1EFVB 1G98A 3KFVA 4B32A 1AB6A 1DUVG 3GJYA 1DIOB 4M1YA 1IAQA 5J0SA 4PNPA 5D3KA 4M8KA 3N7PD 1RBQA 2IVZA 4Y98A 3KKNA 2ZI6A 1KYIA 3JPYA 1D07A 3W6UA 4M55A 4TXNA 3OHMA 1WTCA 2HIHA 4CM3A 1ESNA 3INTA 5FDFA 1B14A 3FFBA 5EIEA 1X13A 4PWZA 4XFDA 1NUSA 1D2EA 1ZINA 1XSPA 3S8EA 3MCAA 3HO8A 2I4IA 4F93B 3JAMA 1NVWQ 5MN5A 1LY1A 2FWPA 5C3UA 1ANKA 4E08A 4DBLC 4FGJA 1NJYA 2QVCA 3T5KA 3SFVA 4EMUA 4M8IA 2WHRA 3JQ8B 3IURA 3H5AA 4LQ4A 3EWIA 3WO1A 2ISCA 5LQDA 1GD1O 5BUQA 4RXUA 2PR7A 2PAAA 4LY3A 2AXTU 5THXA 3GGPA 1MOZA 3BGOS 3B1XA 1ZRMA 4X71A 2BW0A 3FSRA 3O0FA 5JASA 4MCAA 4BNGA 4NCAA 2H2AA 2H1VA 2POQX 4J7CA 4RJ2A 5HRUA 3O95A 1LPPA 2EZYA 5IUJC 2CT8A 2NGRA 2UVWA 4MLDA 2X41A 1DEAA 3A3PA 2BDUA 1IZ0A 3IV6A 4D99A 2Y66A 1TZ2A 4J0HA 4OGKA 3GC6A 1ZHHA 3ZS8A 4L2IB 1R6DA 4BNTA 5KOYA 4H18A 3WLRA 1GQ2A 4MW4A 5C5CA 1FDRA 1QSGA 5IFKA 2KPOA 2OZLB 2LDBA 3GFGA 2ONCA 2H1OA 4L28A 4KXYA 2ZYRA 4P1ZA 3GAMA 2XIQA 2W9BA 1ZSVA 2II6A 3K2IA 4XX0B 5JD6A 3ESCA 3B1FA 4DMHA 5HE9A 4M1KA 1GL7A 4JH0A 3NBQA 1KO5A 2ODPA 5K3SA 4Q9LA 1TK8A 1KKLA 2IFTA 3SDSA 4DJDC 1IM5A 4RQ8A 1T9DA 3L5OA 4BDTA 4E5PA 1H6BA 4DLTA 1PWEA 4Y6QA 4RPGA 1VHQA 1IIPA 2VATA 1MTOA 1O08A 6LDHA 5G5HA 4F2GA 2G72A 2C8LA 3A58B 4K88A 3I0NA 1QTMA 2WM8A 4R1PA 4KLMA 3OAAD 1P62B 1TK5A 2Q2QA 3X2EA 2VDMB 4RD3A 1XTUA 1ZW1A 3OKFA 1B74A 1X7WA 4M0EA 4ENUA 4HPWA 4UXIA 4DRXA 3U0BA 5KG7A 1VSBA 4L0MA 4O1HA 4OJMX 3Q41A 5PNTA 1FFXA 1TB4A 1M2KA 3N1UA 2GXAA 2H18A 5DHUA 3UV6A 1JIIA 1XA3A 2GAJA 1NZDA 5KFEA 2BHTA 2AX3A 4NTZA 1JQDA 4RQTA 1W30A 1MGOA 4HZIA 1L7DA 1G21A 5ENVA 5FUBA 4K5QA 3GCZA 4Y7DA 3ZPXA 5IARA 5E2AA 3DE4X 1UIMA 2YH2A 3I72A 4BP3A 3KP1A 2HREA 3NDRA 2WTFA 4B4OA 4WW0A 1OGYA 1T2EA 4D9JA 1C1HA 1ZUNB 4BBZA 3G2LA 3USES 2GAIA 4TRNA 3LUFA 4NLGA 3BXPA 1WW3A 3I1YA 2HLDD 3EVDA 4K2AA 4BE9A 4OVKA 4Z7QB 3GJXC 3MUFA 4ZEOA 5EJ7A 3G2PA 5EZ6B 1OW5A 1KQGA 1NWHA 3KOZA 4HAOA 3BQNB 4AMYA 3EASA 3ZNOA 3G2KA 3OM9A 2C5GA 1OXVA 4FFBB 3FWKA 1ZQMA 2H3VA 5KQRA 1V3VA 3I6BA 4YRTA 2QNBA 3IBGA 3T5DA 3TSYA 8LDHA 4HJRA 2I29A 1AK1A 2GPAA 4UQPA 2E1PA 2W3RA 1LWOA 1MQAA 1T2FA 4GKJB 4TUPA 3L41A 3OTIA 3PQEA 2Q5LA 4QZAA 3FSJX 3GIJA 2D5LA 4KQHA 4ECZA 3B53X 3ZEAA 4V1CA 3KQQA 2FZKA 4I55B 2VPXA 5HNKA 3AH8A 4LFAB 3JTMA 4UVGA 2UYHA 2QN2A 1KOGA 2XRYA 1T9GR 3Q6NA 4GR4A 3RTVA 3OCXA 3QFTA 4NLZA 1BVHA 1OMOA 3L6BA 3TRHA 1A7AA 3DC7A 1CUVA 2LCFA 4WBNF 3DTYA 5AJUA 4F5DA 1GDHA 3PF8A 2VL7A 2XNCA 2ZDGA 4GIBA 1K8RA 1OBCA 2WNHA 1IC6A 1VLBA 3EXHC 2JD0A 3NBUA 1PTKA 5CXQA 5SY6A 3AVTA 5C1PA 4F1KA 5K0JA 1ZQRA 3HN7A 2CJWB 3DE5X 1CR1A 4G5QA 1E89A 3WO0A 1UK8A 4EH1A 1TCVA 3K20A 4ZEXA 1O4VA 2F1KA 3PJFA 3W2IA 3KVOA 4L15A 4N0DA 3D6HA 3AFMA 3IOEA 3DE2X 5DNDA 1S2LA 4C43A 2KK0A 2B69A 4ZVLA 5DEIA 1KL7A 3WY9A 3E3AA 3R0ZA 2L69A 5A9SB 2NUPA 3A1WA 4RF2A 1SHLA 2VT7A 3VR2A 3AERA 4OO1J 3MR6A 2J5KA 4YC7A 4ARUA 4YQZA 1OX4B 1O58A 3IYLW 4ZHQA 1V0JA 3QX3A 3ICEA 2ZSKA 4AMVA 1QHHA 2QTTA 5KTNA 1WHTB 3S27A 1VP3A 3SDBA 3T9DA 5C7IO 2KJQA 4EY6A 3LWBA 4CBVA 4I6JA 4FGZA 1GXSB 1JEOA 4G36A 4PHTA 1CDDA 1GP2A 3B1VA 3ILVA 2XI9A 2GPJA 4NYJR 2PPVA 4QA9A 2PT9A 5CLFA 1TYBE 3UK0A 5JRJA 3KLPX 3ZWYA 5I48A 3RC3A 4MQ4A 4MF2A 9ATCA 2FPGA 3BFXA 5FA5A 2HHWA 1VJ1A 4FOTA 1OWNA 5FTWA 3DO5A 4JXXA 2FMIA 2Y0PA 3GV7B 4C7OA 3A6HA 3MWGA 1MN6A 3NV9A 4W1RA 2C4NA 1JQLB 4UHDA 1VE6A 2B1JA 3QP9A 1QMPA 2GK6A 5KG4A 2Z3VA 5FWAA 3LUCA 2PWYA 4GKKB 3TQRA 2PKCA 4NS1A 4QBTA 1HG0A 2OFFA 2MMCA 3HB0A 1Y1KE 2M6SA 4HUQA 3WYNA 3Q88A 3TFQA 2VWPA 2RRDA 1DIRA 3A3NA 4WECA 2AXPA 2J7PD 4BNZA 4IGIA 1K6MA 2VTBA 3BRWD 3I1JA 1K0FA 5LLDA 3I37X 3U3XA 4F5PA 2CB9A 4RFSB 5LBUA 1IZ7A 1MJGA 2ZRMA 2R4UA 3HCWA 1V48A 1L6NA 3WBBA 2BCJQ 1OLXA 3MYYA 2QVZX 1E1CA 2HBMA 2C0QA 4TQUS 3ORHA 1YJCA 1ODLA 4DCPA 3EGOA 3U7IA 2J3JA 3FDJA 3W8FA 4B6QA 4RSGA 5BSRA 5HKBA 4GT1A 4YQFA 4K7JA 4YCNA 1U1GA 5I7OA 4GECA 1DUIA 1NVAA 3ZLVA 2K8CB 1LA2A 4P98A 2BMVA 2ZKIA 4Y6OA 1NASA 3H2ZA 4ML3A 2OHJA 2PCJA 3UPTA 1X8JA 4MVJP 2I4OA 2VTKA 4H2DA 5E1MA 3P0EA 4JX8A 1HE5A 1M0EA 3CUTA 3R24A 3D1JA 1EIWA 1B6SA 2VFAA 5I47A 3I5XA 3SC4A 3QM1A 1GPJA 1BX0A 2MDTA 2HYDA 1KI2A 4BOYA 1T9CA 2Q3CA 3RJZA 2RH9B 1GAWA 1LC3A 1SIOA 3IDZA 4DXHA 2IA6A 4GNKA 4RLQA 4PNZA 2ZLBA 2OQRA 1PW7A 2KICA 5ALVA 3H8JA 4M7WA 2WFAA 5L3QB 2WYVA 2O2JA 4UHKA 3LY8A 4LSMA 3FYDA 3U56A 4DYHA 5F23A 4MV4A 2P9FA 4PVCA 1UOOA 3HVHA 1CI4A 4NLCA 4QQKA 4F71A 4Z0HO 1HY3A 4F6LA 3OE7A 3LZDA 2P6RA 5F5NA 2CK3D 1HE8B 3HABA 3KV3O 4TQGA 2R8BA 3BTSA 2O2XA 5A6SA 3L7BA 4JKYA 3AFGA 5JMWA 1QOZA 3T7SA 3KKMA 3GLFB 4DJAA 4KV9A 5IIMA 2QT9A 3PEUA 3CUVA 1ZRHA 3V8RA 2HDOA 4OQLA 3HKDA 1U1CA 4LOLA 3PC3A 3QPVA 3RK0A 2ZVDA 3BFVA 3BTVA 2YVLA 2R11A 2VNSA 1MXHA 4IQ8A 4BWVA 4QJBA 4LISA 1RLMA 3CMCO 4RM2A 4EGFA 3NGXA 4M9QA 4XR9A 2K4IA 3LP6A 4BFZA 3L7MA 4C1BA 3C2QA 4G8JA 4HXGA 1R74A 2Q29A 5DCLA 1GTZA 3ZCVA 4LBZA 2CXHA 3T7RA 1KEUA 1U3UA 1XNQB 5HM8A 1V9LA 5C4MA 2M1XA 4GYJA 3TGWA 2PFGA 1EXWA 3KYJB 1PS9A 4DANA 1G63A 3UWOA 2VOEA 2OCAA 1YE5A 2B94A 4QIWC 5KKNB 4OK3A 4BQQA 3W9UA 1BDHA 2P5SA 2LBPA 1N57A 4NMWA 2JFHA 3M6ZA 4I50A 2OR3A 3S28A 4ME6A 3SS8A 2OXIA 4HHEA 2VNHA 2KWIA 3D9QX 4NECA 1ORVA 2RK6A 2CNWA 3H2IA 4UXHA 3ZVLA 3JYLA 4IOKA 4RVHA 4K6FA 2A0FA 1XP8A 5JAHA 5G0UA 3FKSD 3I2HA 3H86A 1JFFA 2BZ1A 1OLSA 1C41A 2YYYA 4GXIA 4UU8A 1YFZA 2GN9A 2LMRA 3KSDO 3UMJA 2OPHA 3QKRB 3UT6A 2V7WA 1THTA 4ZA2A 5ECGC 3AF6A 3N0RA 5B4VA 4KNVA 3KUKA 3FX2A 2XUAA 1ZQJA 3CHYA 3H9QA 4KR3A 5LFAA 2G06A 1JF8A 4F2DA 1P7PA 3O4RA 4WMLA 2LGJA 4EB0A 4ECVA 4R5MA 2VNKA 1XWFA 4Q18A 3WLQA 3UAXA 3R23A 3W6OA 2IHYA 3AY3A 1W4CA 3CF0A 3PFGA 1BPBA 3OPXA 2QAJA 1PT8A 1MN8A 1DZIA 3BAFA 5HP4A 3AG6A 2J32A 2ZUBA 1TK2A 3LQQA 3CZCA 4N7MA 3NZEA 3HPOA 1OIVA 3ZV6A 4BRWA 5D51S 2VS1A 2IPMA 5IYZF 1SCQA 2IP4A 4R8LA 5JVDB 4B40A 3IV7A 2A4MA 1J1UA 4WI1A 1F8FA 4QARA 5AOBA 4ID9A 2I7DA 5BPHA 4NONA 3FIUA 1YDWA 4I2NA 3VNAA 1TVKB 4RK1A 3KHUA 2AWOA 4OLHA 3CVYA 5BURA 2A9KA 1OJ7A 2C5FA 2JDIA 1T3HA 2F8MA 1JTEA 4RA9A 1IJEA 5IVHA 1YV9A 1Z5OA 4X3OA 1NJFA 4F85A 4DJEC 1NRJB 2JFNA 4I2IA 1S89A 2QMEA 2HCBA 2IS2A 2VJDA 3B20A 3BZWA 3EXHA 4RX1A 2VQDA 4JBLA 3WLPA 3TBHA 3TTYA 1PJCA 2OV6A 1DKLA 4LRTB 1PZNA 2GBCA 1DTSA 4YP0A 5KKCA 5B3KA 1BYUA 3DDOA 1S9FA 1XEXA 3AF4A 1LRLA 3KEOA 3I61A 2FTKE 4BAUA 5CRIA 4KN4A 5B6PA 1JLHA 1DVRA 2Z5LA 5BW4A 3Q1LA 2X8JA 1ZJWA 3WP1B 4FMCF 4DR4B 5DGTA 4Y9TA 4B4DA 1JMVA 1Q5PA 2LYBA 1GGHA 1CZKA 5F9MA 1EZ1A 4EAAA 1GFWA 4UM5A 3DLPX 3BKXA 4O6VA 1U5AA 4QRIA 2AUNA 1JKIA 2JIOA 1Q7EA 4Y1GA 3PXAA 4N49A 4YCAA 2YWJA 3IHQB 2XY6A 1Q91A 2PXIA 5AKEA 4QD3A 3R7WA 3E7WA 4NJMB 2B4QA 1PR5A 1MAAA 1FFYA 4EI9A 3C4VA 2JD2A 5L9AA 1QU2A 5C35A 2WHQA 3CVVA 3WU2U 2HHHB 4F4FA 1NKTA 3UPQA 2BGTA 3HDJA 5I51A 2YTUA 3QPCA 3A37A 4UCQA 2RI1A 3JU3A 3MMPA 4FMDF 3HNOA 3UAWA 3RHSA 1CV2A 4RNCA 1Y1SA 1JZTA 4DWWA 4EW6A 3FHTA 1ZKMA 1ZFNA 5HCNA 3T12A 3VVBA 1GTJ1 4QC2A 4MCIA 5D3QA 2WZCA 1D03A 5HTOA 2NXNA 4D4LA 5AVSA 3C8MA 2A84A 2DUYA 1YRWA 3U4IA 3MS4A 3WTBA 3D0QA 5FFFA 3TD6A 5C4GB 2WC1A 3LIPA 1JNXX 3M9OB 4EG8A 4PO3X 2XUFA 2PZEA 3KOUA 4YRNA 4AKTA 4REQB 1XVVA 3QLEA 5BSWA 2OO5C 3B36A 3UCFA 3OD1A 3M5DA 2KZMA 1HOXA 3VZBA 1G1AA 4Q3NA 2PCLA 4Q1DA 4NNOA 3DV2A 5F35A 4ND8A 2V7BA 4KDEA 1C3JA 2EWMA 1BIFA 2PH1A 2PUCA 3ORYA 1SURA 1UPTA 4DMMA 1MRSA 4XRHA 5K0TA 2VBGA 2ZJ4A 3FFTA 1EE1A 1YBHA 4WKBA 2OLKA 4EKYA 4WN9B 3DL2A 3SJZA 5JI2E 4RD0A 1JR3E 3ROGA 1QIHA 4ZI5A 1WF6A 4BU1A 3RE1A 3N07A 4PCLA 2ST1A 5JS2A 5EOZA 4OA5A 2BHSA 2QAIA 3KB1A 3I6QA 3K0EA 1TO6A 4QBFA 1RT9A 1PSZA 5K51A 1RD4A 1WMDA 4JITA 2ZB2A 2DWPA 3BXXA 5H2FU 2EFYA 4HB0A 4UTXA 1PKEA 3IESA 5JCOC 2B1GA 2XOXA 1A2KC 3PQ5A 4ZODA 2A0WA 5DNEA 2XGQA 3PRKE 4ITVA 1AS2A 1O9BA 4F2RA 5HPYB 4RF5A 4MWOA 1YHNA 3TZHA 4PYNA 3PDWA 2IY8A 3EC1A 2Y0SC 1H2ZA 1JHXA 4H9GA 4F97A 1ZAYA 2NPOA 4MAAA 1DUSA 4F3TA 2QQ5A 4TLEA 3TCNA 3KQPA 2QSYA 2PG3A 1C14A 5I7RA 2Q27A 4XB6B 1UWKA 3BSYA 4MQ5A 3MD9A 5M34A 3U3MA 3KUUA 5CLLA 3O4FA 5CTAA 3VR4D 2H48A 5EMKA 3CLKA 2COEA 1HUOA 4MS4B 3VQTA 3DZGA 3HJTA 2FZ5A 1Y4DE 3SKVA 4YCMA 3JWEA 5B57C 1I1HA 1A6SA 3HKCB 4AKHA 1HDRA 2B7LA 1F8XA 2Q1XA 4N3CA 1CP2A 3ZIDA 4UFNA 2XIJA 1KYXA 3T3OA 1DU4A 1CZHA 5DM1A 4OFXA 3QUBA 3KLOA 4R1QA 1E77A 1WQ1R 2CLCX 4Q4JB 1OPXA 1IL0A 3U60B 5IXYA 3GJ7A 3F8WA 2EIXA 4M9GA 2WKPA 2A0YA 3B13B 1DO0A 4A91A 2XQFA 4HYYA 1SKMA 3ZHZA 4K87A 4B81A 4H7FA 5FHRA 1WMSA 5F2OA 4NBRA 1E8NA 2WDZA 2QTBA 1QG4A 3A05A 5LZ2A 2O8BA 1G42A 1SOAA 4MUXA 4ESVA 1S10A 4NFLA 2UZIR 2EZ8A 2HUPA 2XJ4A 1QB7A 4ZK6A 2MSCB 4L5CA 4OFWA 4K6KA 2ZS8A 3PDJA 3ZBTA 7ICFA 5JCJA 3RSOA 3SX4A 4DR5B 4RQ6A 4KDFA 1PR0A 1NLFA 4P4PA 3HT3A 9GPBA 1DQPA 1LQTA 4QLAA 3CB2A 5AIBA 4ZC1A 3VR6A 3V6HA 3DOEA 3N2YA 3SXPA 2RHWA 1NKEA 2XWBF 3RYIA 4PHCA 3AQ4A 2GPSA 2BEUA 3AI1A 1F48A 1PWZA 1G21E 4AY6A 2ZBPA 3IQHX 5JECA 1JL3A 1TFRA 3OF3A 4WUVA 1RLTA 5FNVB 5DX1A 2XCOA 5AFSA 3IUYA 3PNMA 4MA5A 2HWXA 4QASA 2VJCA 4KWEA 3L0CA 5KYXA 1FMJA 5HJ2A 4AZ3A 3IDAA 4RD1A 3E7FA 1ZCAA 4KN5A 3F74A 2ZZKA 2EKQA 1JEYA 2GCEA 1Y5IA 2XUKA 5JJKA 2RB5A 2VJQA 3MFYA 1EUZA 2H4XA 1XRSB 5J2UB 4JV0A 4EA8A 1FRVA 2PM8A 4KPEC 3BIXA 1UXKA 3AY7A 1QAMA 5EE1A 5BSMA 5EERA 3G23A 4B84A 4MGKR 2V8OA 3RUAA 4QXOA 3B6KA 3LY9A 2PSSA 3SAHA 1ZL0A 3CLUC 1Z22A 1M2NA 3V2HA 3PTAA 2WP0A 4RXTA 3UQZA 4DLKA 1N7GA 4OQXA 2BL4A 4FFOA 4ER5A 2AEJA 3IPCA 1R37A 3BH7A 4IJ5A 4GD3Q 2B2CA 1EVIA 5ALUA 1LGYA 4YXFA 3DD5A 4H7DA 1FF9A 3SM3A 3DHVA 4BN5A 4RTJA 1NFQA 3S55A 4S24A 3FOZA 4EHJA 4F84A 3L8YA 2NZ8A 3P0HA 5IJ9B 1X80A 4PHAA 4FHCA 2XB9A 1FQJA 5ALPA 3PNOA 1OC2A 4FNAA 3O31A 2AKYA 1MAUA 3ZWCA 1US8B 3MTBA 1VIMA 3TECE 3A31A 1BDIA 3D3WA 3SR0A 4L9AA 1NF8A 1O94C 4IF6A 2VJPA 4INPA 4QEKA 1T6XA 4A82A 5KMGA 4ZAVA 5I4IA 2ZWOA 2TMGA 3HVRA 3VTKA 9ICOA 4QW9A 2IHNA 3PSAA 4FYYA 4HLCA 3CF2A 1JP7A 5FA6A 4CUJA 2COKA 2H9YA 3E4CA 2WI8A 3CVXA 3LXXA 3ERCA 3GJSA 2EERA 2CMGA 4GMGA 4U39A 4IGKA 4US1R 3OQJA 4NOJA 1CK4A 1KI6B 4X6YA 3FPBA 1XFDA 1Z8HA 2P4HX 3SEAA 4NVRA 4MRSA 3HXTA 4H6WA 3GZFA 3NBFA 5DI3A 4WX2B 3CF6R 3RO7A 3HJCA 1E2UA 4B33A 3WZMA 2KJ8A 2DTXA 3WV5A 1T1SA 2RBKA 1W36D 1UOEA 3PFFA 3IAAA 3SGLA 1MB4A 4G1MB 3KKQA 3KT3A 3U5ZB 3ESZA 2XUQA 3FCOA 2Q1TA 3NTOA 2W6JA 4FR2A 5JALA 1K08A 4BLOA 3K0BA 3UOAB 3D7LA 3N4MB 4QYIB 2ZJ0A 4F50A 3F78A 3IO5A 2Z9CA 1UFKA 2EKDA 4O4IA 5CD1A 5J8YC 3OE1A 4LYFA 3GNLA 4Q3KA 3QPBA 1AQJA 1RAGA 2JFPA 3V8PA 1QQTA 3ZHUA 2W9CB 1FX0B 4V0LA 4F3RA 2VNAA 1R8SA 5AI6A 4XD7A 5GVSA 3N7UA 3PWSA 5JZMA 1NRIA 4HLDA 4R6XA 2OVFA 1N1EA 2C9DA 4AXBA 3BH6A 2C28A 2C2EA 3LCCA 3RC7A 1JHQA 1Y1RA 1U8UA 2X4DA 2ZU0C 3C4JA 3GRZA 1PK9A 1LI4A 1XCLA 4H6VA 3I9OA 3K6SB 1IUPA 3U0VA 1XN4A 3CURA 4EGQA 3AHEA 3LYAA 3DBOB 2VYVA 1UOPA 3ADOA 3MQ2A 4QDUA 2OTCA 1IY2A 1XMQB 2R47A 2KN7A 5EY5B 4WK2B 3QUTA 2FSHA 3KJFA 1WAMA 4RH3A 1X39A 4D9FA 4UB1A 4JGGA 3M2PA 2ATLA 3R20A 1WB9A 1RMQA 3JVUA 1K5OA 3KVNA 4FYHA 3I9V6 2OO5A 1OBFO 3W04A 2KV2A 3X2SA 4EO4A 2GD1O 4CFYA 1XVAA 2QTWB 3CZQA 5GPBA 1C9YA 3NKLA 3L82B 4IQGA 1RACA 1XNSA 4DSIA 2FPSA 2FETA 4QU9A 4D42A 3LI2A 2BMEA 3FDIA 2XCSB 2YZKA 4RVFA 4LBYA 3AIKA 5AM5A 4EHLA 1K9SA 3CLVA 4F1WA 1VL0A 1KNXA 1ONNA 2VSFA 1Y8ZA 1KHHA 2CZGA 2FMUA 1QGUB 5TGTA 1J6UA 1PE0A 2RC5A 1J39A 3JSAA 3TEMA 3GV5B 3EWNA 3UWKA 9ICWA 3P19A 2AHOB 4H1TA 1KZ1A 5JCOA 1B1AA 1QCKA 4XDHA 5KFGA 1YVRA 2QL5A 2EFJA 5KYKA 5BYAA 3AKZA 2PZBA 4IMIB 4NYMR 1XALA 4HL6A 6YASA 2I6SA 1YMQA 2R6CA 4DBLE 1KHTA 9ICRA 1W9MA 1KSJA 2IZ7A 1BXGA 5K7SA 7ADHA 1ZI6A 2XDWA 4NABA 1KR2A 4K86A 3A9UA 4Z4IA 5DNVA 2R8KA 3ABIA 2EC5A 4HNQA 1TMOA 4DY6A 1NIJA 2H16A 4BNUA 1QAOA 3L92A 1TF2A 1BGWA 2FQQA 2QZ9A 1QRRA 3HFSA 1C7JA 2RKOA 3OFJA 4GMDA 4ALIA 4MFCA 4C3ZA 2GBGA 3LHSA 4D4KA 3OPQA 4D79A 3HQ4O 4A2WA 1OPRA 3EZ9A 1IN8A 1GKIA 1FUUA 4DCCA 1YZLA 3MS2A 3JALB 1H8HD 2IP2A 4KAFA 1JNYA 3B6EA 2W7TA 2DPLA 3FYUA 3OBBA 4ITRC 3F3YA 4PAGA 4RJKA 3BMXA 1OI4A 2VNJA 2BFEB 3AR4A 1JIXA 2FEWB 1ZK4A 4IFBA 3HRDD 2QTVB 2KEYA 2DFVA 3FMOB 4EG1A 4GXQA 2VN8A 5LMNB 1YQTA 1DELA 3GMTA 3OLQA 1XTBA 1IPHA 4FZJA 2R1ZA 4GQIA 4F4KA 4LC1A 2OFWA 1NWCA 2Q6LA 5EZYA 1WCLA 2VH2A 1VGQA 2IEBA 4K8RB 2HQBA 3FVQA 3K72B 4JYBA 1KWKA 3AHHA 5E1DA 4RY8A 1KK2A 1VYTA 1I3CA 3NUGA 1M0WA 1ZYUA 5BSEA 1QFJA 1VMAA 2WY2D 2RGDA 3HKEA 4TM8A 1U8CB 3IDWA 2B5WA 5I9BA 3T35A 4C7ZA 2BFCB 5BXQC 3HYSA 3WA6A 1JVSA 3G8BA 4EA9A 2W6CX 5CDSA 1FTYA 4UQLA 5JCZA 3JASA 3WX0A 3BMNA 5AQEA 2R7KA 1DGSA 2KLBA 5JAZA 3MBOA 5MHTA 1SVSA 3C0KA 3GIIA 3ZIAA 3TFRA 4J0JA 1P2TA 3GIDA 4LX8A 5AHRA 3SKYA 1NP6A 1UT5A 1AZWA 5E7MA 1HV8A 1A4IA 2BEWA 1AXRA 3SPXA 3EVNA 5G0VA 1G8GA 4S2EA 2QR2A 1GVNB 5AHKA 1B22A 1QG0A 2K8AA 3ETDA 1HK7A 5JT1A 3KXDA 3IRVA 3S2YA 5FORA 2XGMA 2ODWA 3B2NA 1K9VF 2VHTA 4ZZIA 3KFUF 3AFOA 4TRRA 4JROA 5CX1A 3EGEA 4ETNA 3AT1A 5JJBA 4ZREA 4LGVA 3AR2A 1PD0A 4I4IA 4X54A 1MCZA 4KLOA 4QUAA 3TLAA 3ZVKA 1U80A 2P2SA 4IDEA 4PZ9A 1SXIA 2OB1A 3X2FA 1ZWLA 3OMWA 2WU1A 3X1YA 4PLHA 1A3CA 4PC2A 3L0ZA 5JD3A 4ZU3A 1U0TA 4C2BA 3IXQA 3EFEA 4I9UA 2N0SA 4NEHB 4WZZA 5JAIA 1H4VB 1XF1A 4DSUA 2ZTDA 4IEFB 5LKAA 3CWCA 3WB1A 2OWDA 1HT2E 2CFOA 2JA2A 1THZA 4MMZB 4CF3A 2XEDA 4XGNA 1FZTA 2PS1A 4DSZA 3AKYA 2YCBA 4LHVA 4QXRA 2JLZA 1OKKA 1R0XA 1FXSA 1WB4A 2AG6A 5JJCA 2YWHA 4POAA 3LK6A 3K30A 1XSLA 3AEQB 1JIQA 3UGQA 1T6YA 2A59A 2YRWA 1HT3A 1DQNA 1S5LU 1UBMS 3W1VA 4GL2A 2AGPA 1D9ZA 2G08A 1NW5A 4TSKA 3PC2A 1A1SA 2NU8B 3LUDA 1OAOC 4TTQA 2QROA 1GT6A 3WMFA 4BLUA 4BZZA 2NVUB 1O94A 4F06A 3ZU6A 3Q6MA 4EPRA 4Q7LA 4LRWA 5C46F 4ECAA 1EJ2A 3TTUA 4LAFA 2XRFA 2H4FA 3O7WA 2FW6A 3KQTA 4RMIA 3WB2A 1WCXA 2GKSA 3GX1A 4HVCA 1Y5RA 3FUUA 3UTCA 4ARCA 3WSTA 5IK2D 4IHJA 4KIWA 4G5RA 2F3PA 2LI6A 4Z3OA 3GFKB 4Z6KA 4UEQA 2A1TR 4CVNA 3RB3A 2WTBA 4Z0TA 4IJKA 3L6CA 5FBLB 1MMFB 2QB5A 1E6UA 2XSZD 1NPDA 1Z74A 3OPNA 3GPDG 2O0JA 4RKEA 4FX2A 1DDIA 3NNSA 4FGLA 2OENG 2Q0XA 2HHAA 2Z8XA 5F76A 2IOHA 3QYAA 2EP7A 4HXFB 2DHEA 4DFMA 2MR6A 1WXWA 2ACKA 1NMSA 3MXTA 1I0ZA 4HEHA 1L5WA 1AQNA 1OFGA 5HM6A 5KU7A 4CQMB 1DEXA 2VCHA 5J8YA 5LKRA 2PFPA 4LJAA 4PYLA 1WABA 3HB4X 1NOJA 1X9MA 3GFFA 1QPGA 3H05A 4BO6A 3MRVA 4PQRA 4CEIB 5B37A 5J47A 3L8HA 1A4RA 1DJNA 4RZQA 2OO3A 4HWOA 5L6LB 2DWOA 3ZUGA 3L4BC 2GF0A 1XHLA 3H4VA 3B7GA 3RFVA 3GDXA 1CVLA 4YJFB 4YMWA 2BSQA 2ZWMA 3L7AA 5DIFA 3OESA 8ICLA 1C3XA 4F91B 5IIKA 1Z5ZA 3RAEC 5CLIA 1TJ3A 1PDVA 1PHPA 1DKQA 8OHMA 2ISOA 4ATNA 5KQGA 2FXVA 4JBXA 2NO4A 4GLXA 4KFUA 3H99A 3ISBA 1TO1E 2WUFA 1DP4A 2NLOA 1UKYA 3W3AD 4R8SA 5D5PA 1GT91 3O8LA 4K28A 4DLNA 1VKRA 5DP2A 2C07A 1Z18A 4NENA 4KU4A 3HUTA 1E59A 4EPWA 1H8EA 2EJVA 1BFDA 3VA7A 5H82A 4PSCA 4QRHA 1H5UA 3SU8A 1RZRA 4BVAA 4IZOA 4JGIA 2FMQA 2ZJZA 3HU5A 3NR2A 4CM4A 4HQLA 2HRZA 3FPKA 3C3CA 2K60A 4WUTA 2BH2A 1AK2A 1WCYA 1U2EA 2GO1A 4N3AA 2ZI3A 2AJLI 4U2FA 2GHRA 2Y0SF 5KQLA 1AO3A 1L1EA 5H3LA 3A1NA 3DAPA 5IZCC 4EBEA 5EINA 2GNPA 2C92A 4DSNA 4QWMA 3RS7A 4XUGB 5I7UA 3ZDCA 3KSMA 4ZOLB 1TT5B 3ELUA 1RJEA 3N0XA 4A1OA 1KKMA 3GJ3A 4YTEA 3N5CA 4UEWA 1JR4A 4KZPA 5K3OA 3N8GA 2LKYA 4E7PA 1AH2A 4YHBA 2EOAA 3H42B 4ND4A 4QDJA 1LXCA 1ZG3A 3NHWA 3DEIA 1N9KA 2CLIB 3M0EA 1QLWA 5EJGA 3RD5A 1V11B 2VUTA 3E61A 3FF1A 3LF1A 1WKBA 3E23A 4AO6A 1E9FA 1ZQIA 1NXVA 4XWYA 2QP4A 4RVOA 1WZIA 3MLAA 1VE5A 5DHTA 3K6RA 2REOA 4B1FA 1ORWA 4FFLA 2WHPA 2FWNA 4N9QA 4MIYA 4YJKA 3ZVMA 2PT5A 4IL5A 1G5IA 5KNDA 2QUKA 1KSGA 1XEWY 5CDTA 3ENWA 2ZTLA 5F2KA 1JEAA 2E82A 4HKTA 3KS9A 1NQTA 4UOQA 1DRUA 4BYMA 2Z9BA 5JZBA 5EZYF 3NOXA 3HKBB 2PUWA 3B1WA 5I5EA 2VJNA 1OH8A 1QH8B 4MDYA 5H0IA 1YQDA 4HS4A 2BH9A 4B0OA 2Q8QA 4NK4A 4C6TA 4Q12A 3B3JA 4IKEA 4E03A 2EWVA 2XDAA 4URZR 1M5RA 2W2MA 2GJKA 1ULUA 3DKRA 3NVVA 1SUIA 3ZLBA 1M6NA 2PN1A 3FDZB 1PQUA 3F2CA 4XVRA 4JBIA 1IQPA 5FUMA 1F0YA 4O4HA 1FLVA 4X7BA 2QTNA 2HMVA 4KLRA 3GAFA 3X43A 1ZM4A 3GLKA 3M9WA 3VZDA 1IM4A 4PM4A 4PHEA 3W8EA 1OUMA 2ZYWX 2EARA 3IR5A 1QBKC 5JO0A 1U9YA 1ULTA 1S8NA 4CNQA 5LA6A 1I5EA 2PMFA 1ZJ6A 1AD2A 2F7SA 3KQVA 4MHTA 1EHYA 2D2VA 3G79A 1M76A 2AMVA 4ZGBA 1FVXA 4R84A 1P18A 3IUNA 1ACJA 1NN1A 1H9CA 2OLJA 1YRBA 2FSVC 2OYSA 3D4LA 3VXKA 3N9IA 4Z4QA 1U1EA 3IJRA 3COVA 1KY2A 5CA0B 5CEEA 1QGED 3MJ4A 4GEGA 1J2JA 2FHPA 1I8TA 3CNEA 4FW8A 2WSLA 1D6NA 3F7NA 1GV0A 3H5NA 3PTLA 1K2VN 3WGQA 1ULAA 1KE1A 4BO4A 4CT0A 2NO1A 4C7XA 1CYDA 2I80A 2OWEA 2LDXA 4JB3A 3FRHA 4AP5A 1NJ8A 4I2JA 1BXZA 1ZUHA 2RARA 2VVTA 2R44A 5JD4A 1EUCB 4RU9A 2IU6A 3EFOB 2C8KA 2VANA 4CG2A 3JWIA 2XY4A 3LWDA 2GA9A 2XQKA 5CLHA 1WLSA 4UEJA 1BXRB 1P4RA 1JQ5A 4BZXA 3OEEA 2NTJA 3SZ2A 3FROA 1NF9A 3QU2A 1WCV1 5J58A 5F3XB 1X3SA 1F8UA 1SKYB 4RESA 5LLTA 1FK8A 4TN5A 2YV1A 1GKUB 1X6IA 4LDZA 2JH3A 3FHJA 4Q7JB 3ZDDA 5FYDA 3S1SA 3CUEF 2IEDA 3OCCA 3RSQA 4EQZA 1JDVA 4L4RA 3VR4H 2XVZA 2N1MA 4Q37A 4P8RA 1L6IA 1NBOA 3CWQA 4CCHA 3C23A 4NXMB 3CONA 5AP9A 1OAOA 2BMDA 2FZ4A 1YA6A 4IDNA 4IG4A 2XOEA 4C07A 3PRJA 2JGJA 4CRWB 3WBJA 2ZIVB 1Q0UA 2G9ZA 3NETA 4MI9A 2HFKA 4IHJF 2DKZA 1N5KA 3VC8A 4OHFA 1BNOA 1NULA 1ZUWA 1N5XA 1PUZA 3H5RA 5KQMA 3EYAA 1WMFA 4UMEA 4J94A 1ZM2A 3TAHA 1Z0UA 3U13A 5KYYA 5TS2A 1HO3A 1Q3VA 3C2MA 4P3NA 1U5CA 5JTIA 5CT6A 2DAPA 4JI1B 1NC1A 1RRVA 1RQLA 4YBRA 4J0CA 3RHZA 1HLFA 3UVEA 1ZSYA 1IZZA 1L3SA 3VYSB 2KM1A 1ZH4A 2RGEA 1T2NA 5B1HA 2QMHA 4BX9C 4YUYA 3RRGA 3KEMA 3KJHA 1SK9A 3QEMB 5SYNA 3C29A 1CRXA 2HPVA 3Q9NA 1NI4B 1W49A 3PQ8A 1QFYA 3DOOA 4BFXA 3QFRA 1RM3A 4XX1A 4CQJA 1C2YA 1Z6QA 2O3JA 4PPNA 1QZUA 4W82A 3A1VA 1IHYA 3RFCA 3ANLA 4XJSA 4LWZA 1I2MA 4MICA 2R18A 1T10A 1HKUA 4WZAA 4CR7A 4R5HA 4UZEA 2KMLA 5IJ0A 2BV3A 3NHKA 4RQ3A 3E5RA 2GNAA 1PKXA 1E2DA 5DU2A 2XZTA 2PXCA 5JD5A 3CA8A 2A5DA 3AMZA 2FJ6A 4QZEA 5TMPA 4DSKA 3L4BA 3CPHA 3JPTA 2G40A 2WWVD 4MF8A 4NE7A 2JGRA 3IALA 2G5CA 4LI3X 4BFCA 4FYVA 1SA0B 3UTDA 2IYXA 4KODA 5FEUA 3U19A 3E2EA 4MVJI 1JEJA 4MYRA 1BSVA 3T15A 1KVSA 1AKNA 1OXTA 3K9GA 4M0DA 4ZU6X 4YVFA 3FAZA 3NS1A 2A3VA 3CJTA 3EA0A 5KL8B 4K9MA 3PLRA 2JF0A 2VI5A 1C3LA 2GPNA 4IIEA 4X65B 4NU5A 1EFRD 4ZCPA 4B31A 1GPH1 1OE0A 2DFDA 1HDEA 2QLFA 1AJEA 4P53A 3RJHA 2NZJA 3DFZA 3V48A 3CRMA 1X7HA 2KIWA 3A6PC 4WK6A 4HWPA 4YIKA 2Z2KA 1CX9B 4HT3B 2YXDA 5EIOA 3B48A 1UFVA 1TTQB 1D4OA 4RL4A 2VJMA 3QXGA 1LF5A 3L2OB 2X23A 3AP2A 4YPVA 4EW3A 3V7YA 1TUEA 3BG5A 4P38A 4C22A 3NT5A 4YJHA 3LPDA 4QWAA 1DK3A 1Z62A 4P3XA 1NVTA 2GFQA 1ZGHA 5EJFA 4CRXA 4AAYA 3BHMA 2HJHA 4C4XA 3DE6X 2XBMA 2A3NA 2XYGA 3OJLA 4KO1S 3X0DA 5H02A 4FFWA 1E8DA 4G01B 2MHCA 2JATA 1A04A 1KP3A 4D45A 4DJFC 4MV6A 3ADCA 1OU0A 5IZCA 3NVYA 5CRXA 2VJOA 3QHQA 4M9UA 4LVUA 4WA7A 4GPD1 1N5OX 4WINA 1V3TA 3L7YA 1VSUA 4ZAZA 3F1KA 4A0SA 1GNQA 3VPBA 2W2QA 2IA5A 1K8XB 4JBWA 1T0BA 3VR3A 2XAAA 4RZSA 1NX9A 3W1EA 2BR4A 2PKEA 4YRLA 5ILGA 1NSFA 1EK2A 5J2DA 1TKAA 4AG3A 1N8KA 4MWTA 1BOOA 5FBRB 4WJZA 3NYWA 4JA0A 4HFNA 1YK0A 3CRW1 1BFUA 3ZGXA 1Z34A 3IDOA 4X1KB 1QYIA 1VE9A 4F4DA 4DCMA 5HJEA 4ZTZB 3EIOA 3FNQA 2QXYA 1DV2A 2QENA 3NHBA 5BN3A 4WNAB 4FFPA 1GPYA 2QR5A 3U40A 1JILA 2J3DA 3R5FA 4YJ3A 2YHBA 2QLTA 2QB0B 3S2SA 2HFJA 4C8LA 3WWEA 2E4WA 4TVSA 2A9JA 4O4HF 1UEIA 5KFXA 3ANTA 3TVDA 4MRMA 4KN8A 5T41A 4IBOA 4P08A 2OG1A 4P4GA 1YRAA 1G7TA 2YNMD 1GUFA 5ICSA 2VHWA 2XWJI 1P1BA 2VKQA 1CNFA 3HJEA 3UHOA 5H80A 3ICQB 5LA6F 1IXRC 6REQA 4LZJA 1JRLA 5G4KB 3ZD6A 4Q45A 1ZJNA 1H1LB 1FTWA 3V4ZA 1IY8A 2WSSA 8ADHA 1JAXA 4M98A 4B35A 2JZBA 4DCUA 1UMDB 1OILA 1IXSB 3QLVC 3MTDA 4AZSA 1YR9A 1O57A 3SF0A 1R50A 5DDMA 1SY7A 1G7RA 1XL1A 4MEBA 5DULA 3ZWPA 1LLDA 2QJTA 4F5WA 1W96A 1RIFA 4RTKA 4QX6A 2NYVA 2IU3A 2X2OA 3M6AA 4H1HA 1P4GA 2O3UA 1QE3A 4JLMA 5F2EA 2JLUA 4DNQA 3G1UA 3ZWMA 3OC0A 4MRAA 3CJRA 5HIJA 3NFYA 4OKNA 3C5VA 3D64A 4OKSA 5HRAA 2DQ4A 5E6UB 2Y99A 3THVA 2NVWA 8ICCA 2FSVA 1YC2A 3PVSA 1CW2B 1SXJC 2N3ZA 2YZGA 4X9XA 2B8JA 2HK8A 3QKSA 4F6RA 1DWQA 1PGJA 1MORA 1CBUA 1JFVA 5EJ6A 1RDFA 1YTUA 1I13A 4YRQA 4V2UA 3WQQA 9ICQA 1H2BA 4KLDA 3LDAA 1DCMA 2DFPA 1GJRA 2ZR0A 4AT1A 2I33A 5ALZA 4QTZA 2DE0X 2UZ0A 4ZZ1A 4TUQA 1IM8A 4OH7A 1H5NA 1ZNYA 5A5VA 1Q7TA 3LQRA 1PJZA 3I3SR 3W77A 3LU1A 4NMXB 3WXBA 3FHCB 4DSEA 3H84A 1A9PA 1Q7RA 1XXHB 4MEAA 2YZMA 3CNOA 1XTVA 3MMZA 4M37A 4YONB 5BT8A 1N1GA 4ZHQF 4ND7A 1V7PC 3RQIA 4AC9A 2ZJBA 4IM7A 3C74A 2R97A 4OL9A 4M36A 4KLAA 2O05A 4NFYA 4AURA 3WMRA 3CH4B 2GWRA 2RLTA 3UJ7A 5TY0A 3WFJA 3MHPA 3P1JA 2R6HA 2VEDA 1NAHA 3ETGA 4K9KA 1Z47A 2MINB 1N1MA 3AR3A 2WV7A 3DTVB 4G24A 3QXCA 3RFUA 1FTGA 3TUIC 4E5NA 1KFTA 1O89A 3AETA 2I5HA 3NDPA 4JJIA 1NE7A 2O2SA 4EO7A 1H2AS 1X70A 4ISBA 3OQMA 3AVYA 3BYZA 3GZNA 3HP7A 4AY4A 3IEIA 3IAS1 3F5FA 4PZUA 3JQ7B 1T8WA 2TS1A 1C5KA 3HADA 1GNPA 4KPUA 5L3SA 3EULA 3Q85A 1VXRA 4HYEA 2HRRA 1R15A 1KK3A 2Q7XA 2VK2A 3VZRA 2AYZA 5BOMA 2H57A 4ZT4A 2AW5A 3PCRB 3T7AA 1DJMA 3U2QA 1ODTC 3KKKA 1KEPA 2INGX 3LLUA 2DC1A 1N3YA 2O20A 2QL6A 4QEDA 2GLTA 4DUYB 5DJ5A 3OZXA 4I14A 2W83A 1C29B 4EJ0A 1HNZB 3GP3A 1TLFA 3DCYA 4X24A 1CR6A 5FA8A 4JJ7A 2IYSA 3STHA 3UJAA 1OHHA 3LL7A 3CIFA 2R6AA 3CEAA 4TXMA 4Z7NB 2QXTA 4RNOA 3TQHA 2W3SA 1QRDA 2YHUA 4HPX