4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
2CN1A 3QU2A 4OFZA 1JUDA 4AS3A 1ZD3A 3OCWA 4YH1A 5AICA 1Z4JA 3J7TA 4KN8A 2GHQA 4Y2VA 5ALOA 3FVVA 3HLTA 4UM5A 5ALQA 2HCFA 3BA6A 1S8OA 1WVIA 5JJBA 5IT0A 2YMQA 2FDRA 2C8LA 3QUTA 3QUBA 4HGQA 5ALNA 1Q92A 2O2XA 3KDPA 2GMWA 1RLMA 1Z4MA 2GO7A 4ZEXA 2FPSA 1XPJA 4YCNA 3UMGA 3AR6A 3MPOA 2IOFK 5AKGA 2ZBFA 1ZD4A 3UM9A 1QH9A 2NO4A 3QGMA 4AS2A 5AIAA 2PKEA 4DWOA 3AR4A 4L6AA 3OCUA 2ZBDA 3ZX5A 5AM4A 3P96A 2GFHA 3I6BA 2HO4A 4HAIA 3WKDA 1O08A 3WKBA 2ZG6A 3KBBA 3DAOA 1X42A 1Z4NA 2WF7A 5AM1A 1U02A 1RMTA 1L6RA 3KZXA 1TJ4A 1L7NA 2RBKA 3F9RA 4XQ0A 3W5DA 1TJ5A 3M9LA 3DDHA 2HF7A 2HSZA 1LTQA 4XPZA 4DW8A 1PW5A 4CF4A 1RMYA 3OCXA 2HX1A 3PGLA 3QX7A 3ZWKA 5ALFA 2ZBEA 4DFDA 4AP9A 5AW5A 5AK5A 3PCTA 3NIWA 4YCLA 1ZD2P 1RRCA 1LVHA 3MN1A 5T41A 3QYPA 3S6JA 4G63A 4Y2JA 3A1EA 4HYTA 4QQFA 1RLTA 1Z4PX 4C4RA 3I28A 1SU4A 2P11A 4DCCA 4EENA 1RDFA 2R8YA 5AVVA 2FPXA 4YIHA 5A3QA 3N1UA 4FE3A 1SWVA 5A3SA 1Z4OA 2WFAA 3TLMA 1F5SA 3UMBA 3A1CA 4Y2TA 1L8OA 2OM6A 5AKHA 2ZOSA 5ALPA 2G0AA 4IG4A 5ALTA 2VKQA 3QU5A 1Z4LA 3WK7A 2I54A 4GXTA 2ZBGA 2RARA 4CE6A 2WF9A 3DNPA 4EZEA 2FI1A 2CFSA 1S2OA 4RETA 3ZWDA 1TE2A 4F71A 2YFYA 2WF6A 1YMQA 3U13A 3U7FB 2EARA 1QYIA 4XE5A 5AKLA 1QQ7A 4KNWA 2YJ3A 1YNSA 2FEAA 2HHLA 5A3RA 4EEKA 2IOFA 3A3YA 4OCZA 3AR2A 1WPGA 3RFUA 4EELA 2P9JA 3E84A 5AKXA 3NASA 2AGVA 1O03A 2IA5A 2B0CA 3OCYA 2YY6A 5AM2A 3SHQA 2WHEA 2C8KA 3FPBA 3OCVA 1T5TA 1Z5GA 4BNDA 5AVWA 5AKIA 3UMCA 3L1UA 1U2TA 4E88A 2BDEA 5ALWA 1Z4IA 2FPRA 1U7OA 2I7DA 3ONNA 3L8HA 3NRJA 3AR7A 5ALEA 4CNQA 1N9KA 3EF0A 3L0YA 2G07A 3KC2A 1L7MA 3QXGA 5ALUA 4BX0A 2R8XA 3L5KA 3BWVA 1VJ5A 2NO5A 2WF5A 4Y2RA 3ZTYA 1VFPA 4NV0A 1L7OA 4Y2XA 4PNHA 1QQ6A 5ALZA 3CNHA 2OYCA 5ALRA 3U7GA 3EWIA 4HGNA 4KX5A 5AW3A 4C4SA 5AIBA 4UU1A 2W43A 3PDWA 4H1WA 4Y2UA 5AK4A 3FZQA 5AM5A 2G06A 3ZX4A 3W5BA 2P27A 5AK6A 3WK5A 2G08A 3EF1A 2AMYA 2I34A 3ET4A 3SKYA 3ESQA 5AW0A 1YV9A 1RQLA 4BEVA 5ALIA 2EATA 1NRWA 3N28A 5ALHA 2FPWA 2D2VA 5ALSA 5AVSA 4UMVA 4BEWA 2MU1A 3B8EA 1ZD5A 2G1AA 3ZVNA 2IYEA 1EK1A 1YS9A 2JAWA 5IT4A 2I6XA 3QUCA 5E0OA 5AVTA 4Y2YA 1YJ5A 5AW4A 3FM9A 3U26A 3IRUA 1VJRA 3ESRA 3D6JA 2G80A 3IJ5A 1ZRMA 1RQNA 2W4MA 3NALA 4NABA 1SWWA 5AI4A 5AVYA 3I1YA 3L0CA 5AESA 1IWOA 3DV9A 5ALKA 5AVXA 1RKQA 3ED5A 4O8CA 4YGYA 3WKAA 3RF6A 1L8LA 2B8EA 3NUQA 3SKXA 5ALJA 2W11A 3L7YA 2ZXEA 1RLOA 5AKKA 5AVRA 3N5KA 5AVQA 3L8EA 4IFTA 1U7PA 4QJBA 3B9RA 5ALLA 5AI9A 3CZ4A 3AR9A 4HGRA 4UAVA 3EPRA 4YIKA 3WKCA 2QLTA 4Y2PA 2Q5EA 4I9FA 3W5CA 5AVZA 4UATA 4NWIA 5AM0A 3ZW7A 1XVIA 2MU2A 2X4DA 3WK9A 5AVUA 3NANA 5AI0A 4ZEWA 2OBBA 1ZS9A 2YJ6A 2MSNA 4GIBA 2FUCA 2B8JA 3M1YA 4BX2A 2C4NA 5AM3A 2YMMA 4FFDA 1ZJJA 2HF2A 4FYPA 4F72A 2JAOA 4KNVA 3NAMA 5ALGA 4BKMA 3WKEA 2R8ZA 5AI6A 1Z88A 3R9KA 1T9ZA 1TJ3A 3QLEA 1J8DA 4KX3A 3ZTWA 5AKEA 3FGOA 3WK8A 3E58A 2FUEA 5ALXA 3FPSA 2WF8A 5AK3A 3WGUA 2HI0A 3N8GA 4OHFA 1WZCA 2YN4A 3L8FA 5AW7A 3QU7A 2GHTA 5AHXA 3MMZA 5AW1A 1Q91A 4Y3UA 5ALYA 1NNLA 1KYTA 1NF2A 1QQ5A 2AH5A 4KYTA 1ZRNA 3ZI4A 2BY4A 2YMLA 3AR3A 3WGVA 3ZU6A 3WK6A 2RB5A 4HGPA 1WR8A 3ZVMA 5AW6A 3I76A 4UU0A 2PR7A 4YCMA 4I9GA 1RKUA 1TA0A 2B30A 3ZVLA 2C88A 2JGAA 4BX3A 1RMQA 3L8GA 1YDFA 4J03A 3E81A 2CFRA 4ZEVA 5AW8A 4BNDB 1N8NA 1MH9A 2JAUA 2CFTA 2RAVA 4UW9A 5AI8A 3VAYA 4UMEA 4EX6A 1RKVA 2O9JA 1Y8AA 3KOOA 4NAVA 4EX7A 5AW9A 1XP5A 2YJ5A 3U19A 4UASA 2B82A 2I33A 1RC8A 2YBDA 1FEZA 5AKJA 3HYCA 4RESA 3U7EB 3PGVA 4OD0A 2P69A 2Q4TA 5AI5A 4CF5A 5IS2A 4L6CA 4MWOA 4JDPA 1J97A 1CQZA 3SMVA 3ZUPA 2B1QA 2FPUA 1AQ6A 2DQSA 3R4CA 5ALVA 4BYGA 4C4TA 5AKYA 3U7HB 2HDOA 4JB3A 4L57A 2PQ0A 4B6JA 3OPXA 5FP0A 3E8MA 4UARA 1L7PA 5AW2A 4UAUA 4NFLA 3N07A 4UMDA 2HOQA 2R8EA 2IOHA 2YJ4A 1ZOLA 5AKZA 3QUQA 2NYVA 2BDUA 3L1VA 4J2TA 2YMPA 4MUMA 3OTQA 3WK4A 1K1EA 3SD7A 2C9MA 2EAUA 4BBJA 5ALMA 1RPZA 3W5AA 4Y2SA 3GYGA 3IB6A 4G9BA 3AR8A 1Z5UA 3R09A 1EK2A 1Z4QA 1CR6A 1U2SA 1T5SA 4UM7A 2WM8A 3OCZA 2Q4RA 3ET5A 3B9BA 4CF3A 2HEGA 2QYHA 2OA0A 3KD3A 3QNMA 4Y2QA 4HGOA 3K1ZA 3L0BA 4UMFA 1Z4KA 2AUTA 3QU9A 2B1RA 3QU4A 2ODAA 3SLRA 4XOUA 2JARA 2I55A 3A1DA 5ALDA 3MC1A 3AR5A 2G09A 3SF0A
chains in the Genus database with same CATH superfamily
4LPKA 2WUFA 3CSDA 2W3SA 4NCHA 1LV8A 2EFCB 4OFZA 5AHOA 1C8VB 1I9CA 4QW9A 3U4QA 3WRYA 1Q2UA 2PLFA 4OXIA 3D6AA 1NUSA 2WZQA 1WV1A 3OOYA 3H87A 5A5FA 1DFHA 4L5YA 1ECPA 4B9TA 5JUMA 3EMKA 4B4WA 1NY6A 1V11A 5ICEA 1NOIA 1T0HB 4P92A 5C37A 5KX5A 1DBRA 3PVSA 1ZH4A 2RI6A 3Q72A 3CNNA 3EASA 2HHXA 3S7ZA 2JJ1A 1DTEA 2RDIA 2JEYA 5JEEA 3V4SA 2PMZC 1EM8A 1MX9A 5FOSA 4KXVA 4PYIA 4MHOA 1W76A 2Q3HA 2XQFA 1FU4A 2YVQA 5CA1B 1RLMA 2F3QA 3TTYA 4C0ZA 1K5PA 4UAZA 3UG6A 1DRJA 2P2GA 2Y1GA 1XPJA 1OFTA 1ISPA 3VH2A 4YCNA 5BSHA 4JWNA 1WG8A 4JLAA 1T1IA 3QHAA 5HR5A 1M2FA 2C2XA 2NU9B 3DTNA 4AZVA 3TRFA 4DF8A 3CLVA 4QASA 2J41A 3MSCA 2XUQA 5K6RA 3TLYA 2C2OA 2W6OA 5JOQA 2IE8A 4OOFA 3DTVD 1Y9AA 2HHJA 4X54A 3COJA 5AM4A 1KVSA 4UE3S 5DN6D 1YK1A 4Z8XA 3ASUA 5A9SA 1WJGA 4XUCA 4N8DA 5CGZA 4P7KA 5CW1A 1BOOA 3TVYA 3GEGA 1CQIA 4KRFA 1FJHA 4P3YA 3GDXA 2HADA 2XY4A 5FA6A 4N5IX 3Q7SA 4HDSA 5CA1F 2Y1JA 4BKPA 5IC4A 2O5EA 5FKJA 1J23A 4AP6A 3VHXB 3VC3A 3RUEA 4CDNA 1NK4A 1M2JA 3WXMA 1XAIA 2VJ4A 3IBFA 2IOQA 4EI2A 4P0PB 3GMSA 4ZKEA 5JSQA 1EX7A 3ZY2A 5AOAA 3WIEA 3BWDD 3IP1A 4OJPA 2GBGA 2BELA 1GA6A 2GBCA 2ZULA 3JR7A 5HHTA 3QWFA 2FLNA 4QDUA 3TOXA 1IAQA 5K0JA 2ZBEA 3TF5A 3ZHTA 2VHWA 3OLYA 3FYHA 4QZBA 4RE5A 1SOUA 1W1IA 1YCHA 2ORED 2W2NA 1L5HA 2Y9MB 4CKBB 5IVIA 1CBUA 4KLOA 2H54A 3S27A 4AUEA 1C81A 3EEBA 1SPBS 3I9V1 5IC6A 3ZWPA 5JDIA 2UXCB 5T41A 4DLLA 4PG8A 2JC3A 4Y6SA 3QYPA 2B69A 2NRWA 3EQZA 2YS6A 1WXIA 3DB2A 3U7IA 1EFLA 4P83A 4ZP1A 4I9UA 5CDHA 2P11A 2X1HA 8ICSA 5JWOA 5A4FS 1ED1A 1D09A 3TLZA 3OKFA 5K8CA 4HNSA 5JD6A 1IBRA 3ETJA 3EQ2A 4AN0A 1KEVA 5A3SA 2AFIE 1QGUA 1W5SA 1AQYA 2RH8A 3KEFA 3MJEA 3GRPA 4PQYA 1P4AA 5KFWA 1SCUB 1Z33A 1JJAA 1I13A 2P4UA 1RTTA 1C3OB 3HR8A 4RA9B 1SL2A 2C3MA 5G5HA 1FS5A 4KLRA 4MWSA 4KPFC 3VVLA 5LYYA 3EDMA 2WQ7A 3U09A 4C3UA 1M8PA 5HGXA 1W34A 3M6XA 4M1ZA 5DVZA 4PYNA 4J0CA 3WGJA 1TTTA 5GVRA 4MW2A 4N9WA 1VHQA 3ISTA 4MA5A 1QIJA 2QA5A 2W2VA 3ZXUB 3TX2A 4U2BA 1GLVA 5JUWA 2Q1UA 3MWYW 1QOZA 4NVRA 1PK8A 1YDGA 2E21A 1YXMA 3BMCA 1UFKA 2QN2A 4WKOA 2GN8A 3PVXA 4OLJA 1ADFA 2E1FA 3GJ7A 3AHHA 4L5BA 2L69A 2XMRA 3H8VA 1GIAA 1QVRA 4A8EA 1TZKA 4GQBA 1BHQ1 1NA5A 1VG0B 3KWMA 4LYJA 5EXEA 1KPHA 2ECKA 5K8IA 4DIFA 3NQ41 4NHEA 2ZUDA 1CRZA 4LRQA 5IJ9A 3I9KA 5T8KA 5BVHB 1KQQA 2NRXA 1R7RA 4GRIA 3RFVA 4DSUA 1J2YA 2AKYA 2ISQA 4M37A 4MGIR 5TX7A 2J30A 2XMZA 1H1LA 2BMWA 2CD7A 3D2LA 4PLZA 3CXRA 1I9GA 2OV4A 3IP9A 4Y8VA 1QUEA 2A1JB 2XUFA 2DUMA 3IR6A 2OCIA 1WPGA 4R8KA 4WACA 1CUAA 4CPDA 1WP9A 2G8NA 5KFYA 4MULA 1WZUA 3NASA 1L4FA 4J0DA 5L53A 3AQEA 1P0IA 4TMXA 3MDAA 3KKQA 3LP6A 1WHSB 2X8JA 3T5CA 2AK3A 3U3KA 3F90A 4B84A 4EY3A 5K0TA 4EKIA 5LQAA 1IZ7A 1HFKA 1CVRA 2GESA 4JI4B 1A5TA 2BKAA 3G2OA 4MCJA 3PBKA 4BNZA 1E5VA 4GAEA 2W9XA 2EKDA 1DX9A 1XF9A 3DEHA 4S1OA 4EHKA 1K7CA 1I4OA 1F2TB 1OC4A 1TYZA 3AMVA 5HDBB 2FNAA 5FBZA 4DGSA 1OBHA 1K3FA 7ICNA 3O3CA 4TVBA 2ADMA 4K9KA 3OIUA 1XCPA 1PSZA 4EQ6A 1GPNA 2PE5A 3UWOA 4AG5A 3HLKA 4ONEA 3AR7A 2GWSA 4LRYA 4YRCA 4H6XA 4PWYA 4RK5A 1MB0A 5KQPA 2IT1A 4JI1B 2M9NA 1BS2A 4US1R 1V9PA 4WASA 1QS0B 3FPCA 5CHYA 3V32A 5KTOA 2QY6A 5M29A 4FBLA 4JWKA 1IWBB 3A9SA 3L07A 2O1WA 2V6IA 2O8DB 1WMAA 2FWMX 2M6SA 3E3LA 1R5BA 1VKHA 3NHBA 4N0PA 4PHFA 5CIQA 2Z3VA 2DLDA 2NO5A 1XJCA 3PK0A 2GCGA 4TV9B 3ZQ4A 3BWYA 3OO1A 4PBRA 3MK31 5FUYA 1I4EB 4IIHA 2PD4A 3DUWA 4XRRA 3KV3O 1Z38A 4B48A 5CLQA 5A6VA 2JRCA 1HE3A 5DN6A 1JPJA 1YR2A 4G5QA 1GVNB 2C82A 4K6HA 1AHNA 4LSZA 4WZAE 1BXKA 2DQYA 2VH5R 4OATA 5K3FA 5KX5B 1LI4A 3FNQA 3FHOA 5CPBA 5DYNA 5DPMA 5DBCA 3WZ2A 2OBYA 3ZCTA 1GNRA 4EFNA 4BKRA 2A5LA 5JSZA 1XC7A 2P5TB 1U9LA 4ZYTA 4LVOA 2QTCA 1XWFA 1UBJS 1F0PA 1YMVA 2DY0A 3C3YA 1EQAA 2CXTA 4LA4A 4G86A 3V9AA 3F2VA 4LJXA 4EJFA 1PW7A 1XRNA 2QN3A 4INZA 1ZQYA 4RHXA 3EUEA 1F9AA 3PC4A 1DRKA 5CX1B 5KNLA 3I2YX 2NU9A 3LWMA 3NVWA 1N5LA 4P84A 2IPMA 1J09A 4M9SA 5T3UA 3OTHA 3WRXA 4B3XA 4IV0A 1NDUA 4O6VA 3IP5A 5HKBA 5K3EA 3BWMA 1OXKB 3EIUA 4NMMA 2BHRA 1U7WA 2PPLA 3PTZA 4HGYA 3D2NA 1EJBA 1D4AA 1AVTA 1OWPA 1Z15A 2YXDA 3EEYA 3F98A 4I55F 2QV0A 4BPBA 1F5NA 1P1KA 1KBZA 5LVAA 4TTSA 3RBVA 1KWKA 4WFKA 4CV1A 2J3LA 2I66A 3NR2A 3HU3A 5F77A 3U31A 1Z8HA 2IGTA 1PS0A 3KKKA 4LF6B 2CPRA 4MGYR 1J2TA 1U0OC 4IWYA 1XTRA 3NIBA 3AFNA 1Z00A 1OYWA 2BGUA 4UBIA 1ENOA 2XD4A 3BSSA 3LVRE 4A8JB 5K0GA 1QFSA 1ADYA 1B41A 1JAZA 2I6GA 2O1EA 4IXNA 1NJ6A 1UMDA 3MJHA 4RVOA 5DKFA 3G3EA 4PVDA 5EVCA 4CCHA 1XAJA 3LT2A 3U49A 1U98A 4P35A 3KQHA 2XCRB 3IO5A 1H2YA 4CXMA 2D2XA 2C98A 4ZT3A 4LVUA 3SHVA 2ZXFA 5CM9C 2ZITA 4K05A 4MA4A 4BECA 1GAJA 5A04A 2E5LB 2JIZD 5AXBA 2ZB3A 3ZD8A 3II6X 5BW5A 1G8MA 3Q6MA 4CI0B 4UBBA 4IVRA 2GN0A 1YIAA 2QAGB 5KMGA 5LP6A 2VYFA 4C8NA 1OAKA 3QVVA 3RRZA 5I3CA 3PUYA 5KOJB 1M8KA 1ZN7A 3DQZA 3PRJA 5ALJA 2PG3A 4YCSA 1BDHA 2XAAA 3L7YA 3IERA 1O4WA 2XTZA 4CDGA 3B52X 3JQBC 3SBDA 5DLFA 1ZK3A 2ECQA 5DHUA 3AQFA 4H60A 1D6JA 4IFTA 3CNBA 2GVNA 1HOXA 3B9RA 3ECCA 4G67A 1NBAA 2OMEA 2XI4A 3OZCA 5I5EA 4MKFA 1EG7A 2F8SA 3PRHA 4AKIA 1PJSA 1WCLA 2B35A 2DU8A 2A5JA 2I6UA 2XUKA 5H5JA 2PMZF 2LWIA 5J2CA 1CJCA 4QU5A 4E0DA 4NFSA 4FS1A 1FP2A 3PF8A 3M89A 4YJ3B 2VSXA 5CW2A 1CZRA 4ER7A 5FL7D 4AULA 5IYZB 4D25A 3G8BA 2BOVA 1K68A 5L7TA 2ZJBA 1JYEA 1KFEB 2O23A 3EXHB 3MT7A 3ETRA 3W5UA 5BY2A 3NANA 5CLJA 3FWPA 5KKCA 3N75A 4UZFA 2BUBA 2O1XA 5EYPB 2IP4A 1CEQA 1EFTA 3QFFA 2JH1A 1XSPA 1EQ2A 1P1HA 1Y4AE 4FGSA 4KQGA 4UVIA 3CVXA 1IN5A 1TL7C 4B5KA 4BLVA 2H18A 1MQ3A 2KKVA 5JU5A 5I7FA 4FXOA 3DBHA 3UBMA 4FFSA 1QP7A 9ICVA 4TV8F 4YXFA 3AVYA 1TIKA 2G04A 3T34A 3KM0A 4F6RA 3T95A 1A69A 5ES4B 1QWSA 4BTEA 2YZ2A 2XVYA 3OUTA 3QOXA 4BMNA 1YUMA 4DDWA 1X9XA 2ZREA 2COKA 2XIDA 1BU8A 3NWEA 1KDYA 3M81A 4DV3B 4GWLA 1X6JA 4R9UC 3JARA 3RS0A 2VP3A 1ACLA 2FOLA 1JBKA 1QG2A 2UYOA 4M04A 2H3QA 2HUNA 2YH2A 3TSZA 3GJRA 3M6LA 5BW8A 3GLIE 2J3EA 4XVCA 5CPFA 1B73A 4QSMA 5IVHA 1G5IA 1SM4A 4WMLA 1NP7A 2GBLA 3ZXYA 3K71B 4EM6A 3FXAA 2J9XB 3STTA 1GPMA 4I81A 5C8YA 4C21A 4BV2A 4K7JA 4K9DA 2C7PA 4WCFB 4JI8B 3CZ5A 5D3MA 4D9GA 5EJ8A 3F73A 4R81A 5EE3A 4CM7A 2GAJA 1HFEL 1QQ5A 4YRPA 1HR0B 3ZZMA 5IPFA 3VM6A 4ACBA 4YP6A 5KL8B 1TTPB 1JXOA 4J2OA 2QF7A 4BUZA 3PW2A 3IV7A 2PSEA 3HHEA 1U45A 1RKUA 3V6KA 4O4LF 4QGGA 2FMTA 5EMHA 1CT9A 1L0BA 4US9A 3IVXA 4JVNA 1NYTA 1UINA 2O05A 4M1TA 4ZO4A 3TW4A 2VDNB 4BMCA 4DDHA 5C7YA 4PSCA 1VCNA 4EG8A 1R4NB 3JZDA 3UK6A 5BWLA 3VKGA 4ENTA 3MVEA 2I7VA 2KHZA 1GCUA 2R6R1 3PNYA 5I9LA 1Z0KA 3MUEA 3EFOB 1HE2A 1G7RA 2AXPA 4MKXA 4MDYA 4B0OA 2KFZA 5BUCA 5F2KA 3QM1A 3EGWA 1FC0A 3WGOA 2HSWA 3RC1A 4BLOA 4QZ9A 1RSZA 4DQVA 2X40A 1Q50A 1J07A 1ORDA 1I5EA 1YS4A 1S4QA 3L92A 4K81B 4PAQA 1SBNE 2JFOA 5IJAA 4NAVA 2BT4A 4EX7A 2PT5A 1VP3A 1OGJA 3KT0A 2R751 4P0QA 1Z35A 3TB6A 1K88A 2P9HA 1LRKA 2VNHA 3IIIA 5ESWA 1ZW1A 4HJXA 3T9BA 2OBLA 5KTQA 3OX4A 1MJNA 2Z98A 4C5AA 3JYQA 4CHGA 2BFDB 4EMSA 5JTUA 3C1OA 1JT2A 3CTMA 2QENA 1RWOA 2BUCA 3CR8A 4RQ6A 4IMPA 2ZATA 5HSGA 3EB9A 4RVGA 5DHRA 4DQDA 4L15A 4PZEA 2HQRA 2PKQP 2R8HA 1RFGE 2X1MA 4J9RA 4JIGA 3G6XA 2VP6A 1FJGB 4ABYA 1Q16A 3JVVA 2G9NA 4D8UA 4EY6A 621PA 4I2BA 2FJUA 5TGDA 4CQMA 1E3MA 4W5TA 4Z2YA 1PNRA 1SG0A 4XUDA 2R4TA 3MXOA 4RQ0A 3C97A 5AKYA 2QRKA 1A76A 4OHPA 2X7HA 4PBSA 3SXUA 4K5QA 3VO9A 1A2KC 2BQUA 1N5OX 2RHOA 3Q87B 3TCKA 2Y27A 2X14A 2E48A 3Q3VA 2XDAA 4UAUA 2AJQA 1XK6A 2BGNA 3VR6H 3K15A 2QUAA 1UZAA 4PFKA 4GZMA 1JE1A 1R9MA 2GN1A 4HWTA 4PRLA 1RQXA 4F46A 2BMFA 3VTFA 1J0BA 3CG4A 3OOSA 3G6VA 1N6IA 4OHCA 4I1SA 1X9SA 1XLVA 2PXAA 5E9WA 1JX4A 3LQYA 4RQ8A 2RSLA 3ZCPA 1FMTA 1Z5PA 2BEUA 2K4HA 3SR3A 3I8XA 2D00A 5EMNA 3P19A 1JKJB 1Z73A 4PYRA 2Q6TA 1DJNA 2W0SA 2Z7JA 3EY9A 2BTQB 4FJ2A 4MMXB 4RNDB 5FWNA 5JAIA 2UVVA 4KPGA 1CV2A 2XNJA 4ACOA 3B60A 1NK8A 4JJZA 4B17A 8ICUA 4FM9A 3D2BA 4O5AA 5BN5A 3MLBA 1V85A 2MSLA 3F8SA 4YJFA 2LYAA 4HNHA 2MMCA 3CLRD 4M0FA 5THKA 1HLDA 4DXAA 5EIBD 4I8DA 1ZVKA 1S2NA 2OHFA 3QZ7A 1BXRB 1R16A 1YSCA 3ILXA 1L5YA 2Z30A 1YCDA 2YNMA 4Y2QA 1U2PA 1GU0A 2CUNA 4L5CA 3QEMA 2BR4A 4E14A 4EMBA 5CLFA 1XTQA 1K7EB 1YS6A 3ABSB 3HMKA 3COVA 1K92A 2NYAA 3QU4A 3D4OA 3UMFA 1TD1A 3OJFA 1TAGA 3VHXA 4DB4A 2GEVA 4JGGA 1TU4A 3KKAA 4BB9A 5BNTA 5C8VA 5LM3A 4L8GA 4XJTA 1CF9A 3IEXA 1WP4A 5DU2A 1C30B 4H7DA 5JCOA 5JAPA 5JIBA 2O4UX 1DMRA 1U0LA 2C61A 4OL0A 4M49A 4IQ0A 1JU4A 2YL2A 2ZI7A 2QAJA 1WV0A 2GOLA 2AXQA 2PYIA 1U5AA 1CR1A 3EWSA 3V48A 1S3SA 2ANBA 4L07A 6LDHA 3DQQA 5C32A 4RFSA 4V0RA 3P9KA 1GAQA 2V7UA 1JEYB 5KHAA 2XA2A 2BMEA 3QHQA 2ACEA 3ORYA 2JI7A 3PUIA 1QIFA 2M98A 1UBUS 2CZQA 4JBWA 1FMFA 2BFBA 3GWGA 2HCBA 2GYWA 1PFQA 2W6JA 1LPOA 5FOXA 4D9CA 3KOMA 3UW3A 1OI4A 3DMFA 1M33A 3HVHA 1LX6A 1XYYA 4L28A 3G02A 1NM5A 2C8LA 1NTOA 4P93A 2I7TA 5LMCA 1Z5OA 4IIFA 4FN4A 3KSMA 1LUAA 3IVCA 4URFA 2G1PA 2ZSAA 1G3QA 4X71A 7ICLA 3WTBA 1R9GA 3DLTA 3FWNA 5IINA 1LBSA 1P8JA 4S1NA 4EEXA 3D1LA 4RKEA 1W581 1AOXA 5DSTA 2CDCA 5FLXA 2Q6LA 5AKGA 4NE9A 4UNSA 2Q4EA 3FROA 1UL1X 1QH9A 4EEZA 1M73E 1GG9A 4FEEA 1XC9A 4DKXA 5JJKA 1FYFA 4DMMA 2J0SA 4G23A 1UXKA 4PSVA 4J9SA 4OUDA 1FDWA 4QWMA 3T7TA 3RYHB 4EYKA 2WTUA 4N0EA 1FTSA 2EIXA 1XF1A 3B3JA 2NU8B 4ER0A 1U65A 5ILOA 1H4TA 3O94A 3O21A 4M88A 1N62A 5F2OA 3FVTA 4N40A 4F5PA 3KBBA 1JHOA 1W0JA 2JA1A 3GGGA 4URZR 1E3IA 5IEBA 1H9BA 4F7WA 4JI7B 1C14A 1YQQA 1Z8DA 2OXFA 1TJ4A 1IMOA 4MKRA 1FTWA 3UH1A 3OMWA 4F96A 3NOXA 5CEJA 1UODA 3LLVA 4YMLA 3SAHA 4LF8B 2WI8A 1LKZA 4QZFA 4NU0A 1A9TA 3PJRA 1KHTA 2EG5A 2ZUCA 3AU6A 1HFJA 4CF4A 2P5YA 4IIJF 4RYDA 1O6ZA 4Q82A 5FTKA 1OW5A 4OJNA 3K1TA 3DNFA 3H2IA 4CEHA 4JBLA 4LTNA 1JHRA 2XLBA 3SSMA 2Z57A 1E7SA 4QBGB 3PX3A 3F3SA 3BIXA 2R25B 1VCOA 1A5BB 2ZRNA 2MINB 5HOQA 2QJRA 4L02A 3D3KA 4CQMB 2IPXA 1ACMA 3DXZA 1LVHA 2AVDA 2H85A 3AOGA 2DT8A 5J2EA 2HHTA 4AXBA 3A6FA 2Y6UA 2VFAA 3H5LA 5J40A 2NT4A 4D9KA 2IQ5A 2Z1DA 4G5HA 4DCCA 4C8MA 1ESZA 1W0CA 3B2NA 2E85A 2JCVA 5TF0A 1YQTA 2R96A 2IXEA 5DLGA 3PC8A 4MQMA 4RQBA 5JH7A 4LYAA 5FD8A 3NRCA 3CRXA 2QGFA 1RJWA 2VHQA 3FDZA 2PPVA 3C4QA 4WLNA 2RGNC 5HS4A 3ROQA 2CUZA 2XBUA 1QU2A 4WEQA 4RQ2A 3A0BU 1WUJS 1D6SA 3AY6A 3GG2A 3GNQA 2N1MA 1IXYA 2AMJA 5ALPA 1D9ZA 2NT3A 4Q7JB 2UV8A 4X91A 3TQHA 1VHWA 4LBVA 1BA2A 3ICCA 1NI4A 1M66A 2Q4DA 2WPNA 4RIGA 5FQOA 1XRJA 3CEHA 1LBIA 1IN4A 3HVUA 4PXSA 4EDHA 3HJGA 4XJXA 1RXWA 4YAJA 1F6BA 2RARA 3RIYA 3W6OA 4CE6A 2VDLB 4DYVA 1J4AA 4IDOA 2KBFA 2VDKB 1NF3A 5JR3A 4ED3A 3TQIA 1LC0A 1N6HA 1XGKA 1YIDA 4WHMA 2AYYA 2KM1A 3SS8A 4BKOA 3KVOA 4Z3KA 5IVPA 1HEKA 2Y76A 4K9RA 4EMTA 3O4HA 4KK4A 3EPHA 3BILA 1E2UA 3EIQA 4KO1S 1E3EA 3ASYA 4YA6A 1JDUA 1T35A 1ZGHA 2W6IA 4IUBS 4ODIA 5AUNB 5KNBD 4BO7A 3V46A 1AUQA 1VIVA 4HDRB 4IS2A 5DULA 2J9FA 4MQ4A 3FGZA 2KG5A 4GI3A 4LC0A 4CKEB 4QJ5A 1LPNA 3TZQA 1I6MA 2P79A 2PQ6A 2HK6A 2JGFA 3OE7D 4LRUA 5D8DA 1JW9B 4OCZA 3GFGA 5FNVF 3TDKA 5ICGA 3NTUA 3DKPA 4GBGA 1Q0ZA 1DS6A 3MPUA 2M6RA 4RFSB 2CLLB 2Q28A 2O3RA 4CIDA 4Z5XA 3TOVA 5KU1A 3AVTA 3JALB 2IELA 4IVQA 4TOIA 4BNFA 3GNTA 1WWUA 1O6GA 2WKRA 1I80A 3W8DA 1DQYA 4IH4A 3PWKA 1X66A 3DPIA 1Y8RA 5DP1A 4BO9A 3I23A 4Y6LA 2A5YB 4MVJF 4KPUB 3IALA 2FP3A 4IS7A 3O8BA 3MWDB 5EKUA 3C14C 3UXYA 1H2FA 2DR3A 3WB0A 2DWPA 1UCFA 2IBKA 3JRXA 1NLYA 4MV3A 2OWDA 2PUVA 4CTJA 4D0LB 1YHYA 3KQTA 1JG2A 1QLWA 2MJLA 1G19A 4OHVA 3C24A 2R1TB 4BFUA 2HOFA 4HRYA 2QE6A 5I8WA 3OGUA 5GV8A 3EZGA 4EGQA 3JW8A 4DSOA 3JQ9A 1MOZA 4UD2A 2O06A 1OF1A 5SZHB 3E7PA 1AT1A 1UT8A 3OWHA 3KYDA 4JBGA 4K6GA 4Y2RA 4RQ3A 1YQ9A 2A59A 2P0AA 1Y3FE 5ESXA 3V7FA 3KAQA 1USWA 2VEDA 4R69A 1L7OA 3E9DA 4F2RA 1WZEA 3A6JA 2C5BA 4KO8A 1HTWA 4MAAA 2XW6A 3TO5A 4DA0A 2KOBA 4KDCA 1CFJA 3K0EA 3RFXA 1XQ1A 4I55B 4B9NA 1E3QA 4F5OA 3UJDA 3SF8B 1GUYA 4QOIA 3GDGA 4TSRA 3TUZC 1UM8A 2JZNA 3DHWC 3W2TA 1ZONA 1BSVA 4CKWB 2ST1A 5LQCA 2QMEA 2YHUA 4JP2A 5BSTA 1NKTA 1GUAA 1SVMA 4ESOA 5LPNA 4BVJA 4H15A 3FCAA 2KICA 1A9QA 2VDWA 2ESRA 2RAFA 3P5SA 2OLJA 3PDWA 1Z2EA 4RK0A 4WNYA 3CLSD 5LBTA 1ZNWA 1VZ2A 3OETA 4P08A 1BEZA 1W75A 1W9HA 2JV3A 2XC9A 2OZKA 3GAMA 3M6KA 2AGQA 3K0CC 3OCJA 4RVSA 3UUWA 4AQDA 3T9CA 2MINA 3VKUA 1RVV1 1SCDA 4NXNB 2I34A 1LW6E 3ET4A 3GFRA 4RQ4A 3CO0S 2WT9A 1L2TA 2E0IA 1A88A 1KQOA 1LLCA 2V6FA 2YWJA 1ZQJA 1BJTA 3CNQS 1OFIA 3DVLA 1HSZA 4WFQA 5AXAA 3WL3A 1ZUHA 2AMVA 3PC8C 1D2RA 4NDAA 5ER6A 1F3OA 4ZWNA 3ZJVA 1UQRA 4O1MA 5GOTA 2GYYA 3RCBA 3B5EA 2HHQA 3GLVA 4FYHA 3WIBA 3UZUA 1E9SA 4M83A 3ENWA 5D01A 4MR7A 4NMLA 2X5OA 2UUAB 4KTQA 3LP5A 1JEJA 5GONF 3E82A 1VMAA 2Q8NA 4EJ6A 3DKRA 4RUKA 4WVFA 3C4JA 5IUKC 4EYHB 4IQFA 3BRWA 4Q4AA 3RYCA 2KZ3A 1NFFA 1EXNA 1ZX1A 1R3UA 5DBIA 4KJZA 2JIQA 3PFBA 4OGFA 2R5WA 5IT4A 4WEOA 2NO9A 5CB1A 1K4KA 1KNXA 2FR8A 3AEUB 1TQ4A 4ND8B 5AWFC 3ZV3A 5CVEA 5AVTA 5JANA 1TQHA 4LFAB 1DO0A 4X1YB 3MNFA 1OBVA 5FWXA 1NPDA 1E3WB 5GJCA 1D8TA 4F4HA 2F62A 3KHLA 4ZOEA 3DH0A 3T1TA 3QOYA 1YS7A 2P2NA 1U8ZA 2AMLA 1TZBA 1VMKA 2FWNA 2VJQA 5I45A 1DPGA 4TYYA 3TXYA 2FX2A 2V7QA 3IUJA 2PZMA 3MWEB 4MYDA 1E77A 1TA4A 2MDTA 2PN1A 1LXCA 1BCRA 2Y1WA 3I9NA 3OFSA 4O8CA 5LL6P 1IQRA 1IQUA 1DXOA 1BWRA 1UBRS 2CVQA 4HNRA 5DT2A 6REQB 1ZH0A 5T64A 1SQ6A 1VQ1A 1X8JA 2X2FA 3WYGA 1UDAA 2DFPA 4B6RA 3DT8A 3HCAA 3OC6A 3PXAA 3D0RA 4XLTA 3MT8A 5FBKA 3O95A 1NR1A 1LDMA 2P0EA 1OZ0A 2B3DA 1XA0A 2K8CB 3FFTA 5HF8A 2PT9A 1YDMA 4J0QA 5JD4A 1FA9A 1X6VA 1EUDB 4CKZA 4LJ7A 4YYEA 4IICA 3W6NA 1Q8KA 3KK0A 3IDZA 3KG2A 2HMAA 1T8PA 4MUEA 2LTAA 3ZW7A 1H38A 5CAEA 2W2MA 3CURA 2X4DA 5HZMA 4M2LA 3NBFA 3RTGA 1NPYA 3BGDA 3FRIA 4XX1A 3DMTC 1R66A 1KSGA 1ZVJA 1R37A 1I1OA 2XUOA 3A36A 4UBLA 1W47A 3W2HA 2B8NA 3M1YA 2B8JA 3MGAA 3P71T 3RGWS 2B5WA 2IYFA 2YMMA 1TMOA 3PLAE 2CVZA 2IZ5A 1QYCA 1YHZA 4QJ3A 1KOGA 3JQGB 1FQOA 2JAOA 1VHTA 1M1UA 3M9MB 1S5PA 3BZBA 1ZIPA 3NAMA 5EWLB 3ZCVA 3LRTA 5AI6A 1SVSA 2DSTA 2RK3A 2A0FA 3A4LA 2CNDA 3WP1B 4N0QA 1J5PA 1QTIA 2EF1A 4EL0A 3NAZA 2BZ1A 4KXQA 4B7ZA 4IVNA 3RW9A 2I29A 3U3MA 3WLIA 1TKBA 3CH6A 3G85A 3PI6A 4YS6A 1YJQA 3W3ZB 1KDRA 3CW9A 4Z4HA 5KWEA 1NVMB 3EVFA 3ND7A 4YI5A 4YREA 4DLWA 1DWUA 2AEFA 2NVWA 2W2TA 3FGOA 2RCYA 4QNNA 4OI0A 3D6VA 2PFKA 1NQWA 4B82A 1TRHA 4DNFA 2QGNA 4MW7A 1WZCA 2IPNA 3AFHA 1V48A 3K9LA 4EJSB 4J4TA 2CV2A 1RYZA 4YMMA 1IB6A 2HLPA 1O5OA 1HRKA 1RQ7A 3LOUA 2O2ZA 3MMZA 4HEQA 4K6MA 5G0WA 5TDHA 2AHOA 2CZCA 4JMUA 3R1IA 4CDMA 3WYAA 1H9CA 4A6PA 2ZI6A 1I8TA 2FGKA 1IV8A 2WT8A 3MD9A 3DYBA 3GJ5A 4JLMA 1EVIA 1SB8A 3DWFA 2KS6A 2QTFA 3HUFA 5JATA 3KB6A 3OKPA 4DT1A 4Y6RA 5COQA 1WDKA 1TZ2A 4A2PA 3K4PA 4ZHQB 5JTTA 5JXIA 1KEEA 3BRSA 5TQ0B 1ZQCA 4L74A 1XL0A 2A1JA 3SYKA 3HUTA 4Y9SA 5CM8B 4ZEMA 3FNIA 2JZBB 4CIYA 5IYZF 3UWSA 5I48A 4IFIA 4RA9A 2ISSD 1PVDA 2Z2JA 5A03A 3BKWA 4JL6A 2C88A 2RJOA 4H0NA 2XRYA 3B53X 3BS7A 5FI5A 2BDPA 1H4QA 1EFPA 1U3VA 1DAEA 1WX1A 3BGOS 4I1UA 1B8OA 4U2EA 4PAOA 2BFAA 3D2QA 1N36B 2IRWA 2GCNA 1F17A 1N2GA 3CRZA 4IS3A 2WJIA 3M7DA 3I2GA 1AKYA 3KPWA 2JI9A 3SG0A 2CNKA 4ZEVA 1E3TA 4D26A 3BSWA 4JEMA 3VFDA 5JI2E 1XFDA 5JZVA 1JFFA 4GUDA 3L6CA 3WLAA 4CHTA 1VKZA 2FJ0A 5B53A 4R1SA 3AVVA 1HT1E 3GI1A 1OY1A 4WNIA 3ZWOA 1PNOA 4PX5A 4NG4A 4L95C 3KOOA 5F1OA 3SF8A 2IZOA 1X9IA 5FQNA 1S10A 1FSFA 4BMSA 1M6NA 2X6TA 3T54A 1OQAA 1FDRA 1R0CA 3CLSC 1SOVA 3OEWA 1ONOA 4Q9AA 2GCPA 3ZV6A 5TLSA 1DNPA 2HXGA 1V37A 3HBNA 4LSGA 4R2HA 4FZJA 5J0PA 2GCOA 3F5DA 3WV5A 2OPBA 4OD0A 2QS9A 3QK7A 4ID9A 3OURA 2JVIA 3EZLA 2LMRA 5DTIA 2ZIZA 3DMDA 1B6TA 3TQFA 4MWOA 1MA3A 3TZCA 5CYGA 4L0QA 3ZJ4A 2A9QA 5IXJA 1MXFA 4TLEA 4X6LA 421PA 4UDOA 4X24A 5BOLA 2P9CA 2Y92A 2IUFA 4CMKA 4KIUA 5FPKA 5LU9A 2PZ8A 4IINA 2LKCA 2NZWA 2QUKA 3GJ0A 4UNIA 3V7WA 4EZIA 2JKYA 1U2DC 4AJKA 1I2DA 1O77A 2ZZKA 2ZM5A 4UHFA 3RRNA 3GEIA 2AN5A 3GW8A 4ALNA 5BSGA 3WYEA 1ZRSA 2M6KA 1KMIY 1DKPA 3GQCA 1F8YA 1IY0A 1QRAA 4CCYB 4R6WA 1GTZA 2YJ4A 4WLOA 2RH4A 3UJPA 2JLWA 1HY3A 1KQ3A 3Q9UA 1VPTA 3TPCA 4A6XA 1ULBA 1EE2A 1RWXA 2R79A 5T7BA 2B2XA 1PR3A 2QZJA 3P9RA 4JP1A 3Q1LA 2NP7A 2CXPA 2AN4A 2CCGA 3ORQA 4Q24A 5JLJA 3DGEC 4ZRNA 4E7PA 3VR5A 1N32B 3NOQA 1CDEA 1VJ0A 3HDTA 4JC5A 1TV9A 3BGWA 4RELA 3RVPA 3VDXA 3KSUA 2WB1C 1NURA 2P0YA 2XDYA 4X8MA 5T4EA 4BATA 4N3BA 2PMDA 5I7RA 3AF6A 3HE3A 4TQRA 4DSEA 5DCUA 4E5YA 5IIMA 4ASUD 1QJCA 2P2DA 5F7ZA 3DAGA 1KIAA 4LS3A 3GNSA 3TNFA 3HXOA 1RS0A 1S6YA 2Q6VA 3RWMB 3H7AA 1VPEA 3SC6A 3VKVA 1JTEA 4I2NA 4F85A 1RRPA 1JN0A 3GZFA 2HF9A 2WC1A 3HUUA 2VVTA 3L0BA 3LIIA 3MCWA 4M1OA 4F9EA 1FRNA 4MINA 1CUKA 4TMVA 2J6IA 3LBIA 3VPGA 1EFUA 4F84A 2FLLA 3OX3A 4Z9XA 2D1FA 5EXXA 5C81A 3QBDA 3QV2A 4OHXA 1CG6A 1A96A 1JDBB 4MVXA 4G0WA 1K5GA 2P6MA 4IUYA 4WJKB 2G09A 1A8SA 4X94A 3VO2A 3AUUA 4UM9B 1IOLA 4REOA 1AIPA 1NZJA 3LCMA 3LYSA 1BPZA 3OI7A 4C01A 4HYYA 4YH1A 4E12A 4JUDX 4YRIA 4BX9C 2ZJ2A 2RDJA 1MJHA 1GNQA 2EV9A 3CUKA 4HH1A 5MF6A 1S2IA 4A82A 4D9JA 4QHSA 3OU2A 4KQEA 3N3AC 4QUGA 2OVBA 1T4MA 9ICCA 1C0LA 1NE7A 4P31A 3UJCA 4WKNA 3G1UA 1NQXA 4O3OA 3Q8WA 2PWAA 3DM9B 4LOHA 3EGOA 4ZJPA 1PR1A 1ZEJA 3HU2A 1FXWF 2ZTLA 3NNSA 5DM2A 1KI8A 4OTZA 3EVZA 4A4DA 4AC9A 1ZQWA 2XOKA 4HQRA 3QUBA 1I4DD 5GM2A 2DCMA 1UADA 4R01A 4LQ4A 2IV3A 2W90A 2RKOA 5DEIA 3VCBA 2IZZA 4AF8A 4HQ6A 3SZ3A 1JI0A 1GGEA 2I3BA 4H27A 4AYWA 2DQ4A 2WJAA 5AJXA 3ZD6A 2ASLA 4P33A 2QI9C 4RPXA 4RJIA 3IV6A 1QYDA 5LB2A 4BP3A 2H3FA 4FJ1A 2D0PB 4HFMA 2IOFK 1U31A 1HF3A 1UWKA 3TI7A 2AC7A 2RGEA 4N01A 1WSWA 1ZOIA 4GG1A 1ZK4A 5IHXA 2BD0A 4OIFA 1N9ZA 2PLNA 3B2EA 3AKZA 3LPLA 2XB9A 2GD0A 5LN1A 4PLCA 2WIKA 1KO4A 1CB0A 1QVVA 1IHUA 4XIJA 2LBOA 2P2SA 5DTJA 4DR3B 2HO4A 2ASDA 5CDFA 2CCKA 1N61A 3H4MA 2FSGA 4AO8A 5CBPA 4GLLA 1NX6A 2PZJA 1C9MA 3U4AA 1NK7A 1C3OA 1R6AA 3K31A 1Y8CA 3KZXA 1YL5A 4PZZA 5KCZA 1RPTA 1QF6A 4R7TA 2FOIA 3NXSA 5FDFA 4FBUA 3MR5A 4FOOA 3VZPA 3EHEA 3KHSA 4UNRA 2Q3JA 1MO2A 2CY0A 3KEQA 5BN4A 3GV8B 4A0RA 3B9QA 3R74A 3G2KA 5KQRA 1Z2OX 2Q8PA 1HK7A 1W5AA 4C4AA 1TYEB 4IRKA 2QN8A 3OT5A 1U1FA 2WV9A 1R9NA 1XA4A 5K1ZA 1SKSA 2O6LA 3ZWKA 3E8XA 3ESYA 2L18A 1I4LD 3PA8A 1T9BA 4CTKA 2O1SA 1IPEA 1FTNA 2P40A 4M8LA 1LRJA 4FGZA 4MWZA 2O54A 3BE6A 2EWVA 5IRCD 1F9EA 4MFAA 1ZD2P 1N6LA 3BH7A 3QP9A 3ETHA 3K9FC 4MARA 4L0MA 4Q16A 3RJMA 2FHSA 4DRZA 2JAPA 1N0IA 1H5UA 5HIAA 2FPKA 1CFZA 1JHUA 1LH0A 4QOGA 5IKMA 3PD7A 2NAFA 4ZPXA 3G9TA 1VKJA 2FFQA 4KFTA 4NZYA 1SXQA 4MR8A 1U9ZA 4G24A 2PIDA 1WDTA 4F3TA 5EPOA 1NWCA 4B09A 1ULHA 4DNOA 1JG3A 3N6VA 4GP7A 3TTWA 3C2MA 1PJ3A 3QFCA 1KOLA 2WD8A 1DZ3A 3ZE0B 1SWVA 1ANKA 1QMGA 3PQ4A 1YB2A 3B12A 4MIKA 4Q7EA 4EDFA 1F5SA 4GPAA 2E89A 1HX7A 4GBJA 2NUTA 5IDXA 2KZMA 3KIPA 5BN1A 1Q3KA 1GAXA 4BMXA 1KP2A 1EXMA 2ZS7A 3E9RA 4INAA 2M1XA 1LJUA 2NV6A 2WIBA 4Y98A 5AOBA 4BMOB 1NFQA 2HWUA 4DIBA 2QLMA 4EUFA 5KDOA 1UQVA 4KLJA 5IIKA 2P90A 3DP7A 2WM3A 3C98A 3LLUA 1BFKA 4OK6A 1QRDA 1E1KA 1SUCA 1T9KA 3HEAA 3Q5EA 3FAHA 3TSYA 3U48A 2X8LA 1RBZA 2VAPA 3GD7A 1TO1E 3JQEA 2BGGA 3TLAA 2HV9A 5E2BA 3O4RA 4V0QA 4D44A 1L5LA 4UEWA 4YPOA 4A23A 3RH5A 3MCAA 3WBJA 4FKZA 1ST3A 4JOSA 2FWPA 1O87A 4KE7A 1IIRA 2BE7A 4F5YA 4CM9A 2V59A 2BCSA 1CUGA 5CM2Z 2X4GA 1QQAA 4J9LA 3KQSA 4C3VA 4JK3A 1DBSA 3VZBA 3RFCA 1SUSA 3KUUA 4CCYA 5L1KA 3KLNA 3MWLA 4H59A 4MPTA 5HTKA 2WE7A 1MZPA 1RWWA 2W2LD 5ELMA 5IVDA 3A3YA 1GZ7A 1GD1O 3CX8A 4KWCA 5LQDA 4ECEA 4EELA 3ISJA 2Z9DA 4AX4A 4DDKA 4I50F 1TEXA 5B1HA 1B8NA 4RNOA 3L46A 2OB2A 4QEKA 3F6PA 4NARA 2BH9A 3WYFA 1R27A 5B1DA 3H8JA 4BRSA 4J75A 1G63A 4RDHA 4NPAA 3OZUA 4GU5A 3GIIA 1W0KD 5ENZA 5FHRA 1RRKA 3UCEA 5EWGA 2NIPA 1BVUA 3FMIA 1C3JA 5I7WA 2JG3A 2AJ8A 3U6BA 1T5TA 1R15A 1RJ9B 3JV7A 3E35A 7REQB 4LE0A 5HK8A 2HBZA 3C3KA 1XMQB 5FBWB 1QV6A 3O8CA 1YUNA 5BWNA 3OCCA 3HR7A 3MTGA 4PZAA 1K7SN 4ZMSA 2XHEA 5HKAA 1K1QA 1M5TA 4UUMA 4BFTA 1OTHA 4Z4FA 1N2CB 3LZCA 4WERA 1YH3A 1E18A 1JG4A 4P38A 1XRLA 2BEUB 1EKXA 4PW0A 1TXGA 4DARA 3ZHYA 1MGPA 1HORA 2IBMA 8ICMA 1HH4A 1WPRA 4QYWA 1TVAA 2DFDA 4TS9A 4CG1A 1T0IA 1I33A 3AN1A 1H9AA 4WNCA 1SGWA 1WMFA 1J99A 3HP4A 4D74A 4N6GA 4ZQBA 4PTLA 3SDSA 3C8DA 4A10A 5H1YA 2P66A 2WF5A 2DHQA 3I73A 4O4IB 5JZ9A 2OCBA 3EVAA 1XTUA 2CDRA 3P52A 2GM9A 3B89A 2EXXA 5EJMA 5BOMA 3IDAA 2QLBA 1A2QA 1A8UA 8ICTA 2AA3A 1QQ6A 1V41E 4UB6U 4DOBA 2R86A 5EFOA 3GRVA 4FZLA 2WP0A 1ZR4A 3S4YA 2VYQA 4M98A 4AY5A 2HBRA 5K8LA 2KVSA 5KFSA 2HSEA 2WSBA 1XNGA 3A6GA 1F20A 3JPYA 1R8JA 3B7GA 3EWIA 1P77A 2Q45A 4FYWA 1D9DA 3F6RA 3IILA 2G5IB 4QVKA 1CEEA 3DWEX 3ME5A 1KAHA 3SDBA 5GINE 3K35A 1GCOA 4LMRA 3ZDAA 4IMRA 4R1LA 5K8JB 3IMGA 1XJ0A 2JJ2D 1ADJA 1PR9A 2RHTA 3THVA 1DLJA 3ESAA 3H84A 1QC5B 2GM5A 4A6DA 2H7YA 1Z8FA 1NUHA 3SHWA 3V6MA 1QR6A 1GZVA 5HCUA 2AOUB 2AMYA 4CZ2A 5B4UA 2FV8A 3KSBC 3D3JA 5FO0A 2ZJ1A 8ICJA 1F6DA 1T36A 2W8BA 2EL7A 3GT0A 1W2HA 3Q8QB 4RD6A 1KPIA 3FN4A 4WXYB 4LPSA 1HA3A 4M2YA 3WO0A 4YRZA 2ZIFA 4KH1A 4LOKA 2JBWA 5B3AA 3DO6A 5U4XA 1EEHA 5KFEA 1S2DA 1DUVG 2B1IA 3GH1A 2C3OA 4GEGA 2FE4A 1PZMA 3MCVA 4OU5A 3L9XA 4Q0MA 2QPTA 2KX7A 2KK0A 4JT8A 4RFLA 3G9ZA 3LPCA 4IEFB 4HCJA 3D81A 1JSXA 1ZQHA 2WNSA 3KCNA 1RJGA 1UFRA 2B1JA 3LY5A 1FPQA 1HLPA 1XEXB 3HO6A 3PSTA 3LY9A 1GSAA 1H65A 1SUAA 2C42A 3LCUA 2XYQA 4QPDA 1S7GA 2J1LA 4PCVA 5REQB 5BUQA 1YRBA 1RM0A 1MAHA 3NRBA 4MTCA 4ND5A 4KITB 1JT9A 1X13A 2KV2A 4BB5A 2QM3A 1NMEA 4PL1A 4D02A 4DV4B 4WBXC 1KGDA 2P6UA 4LF4B 1VIDA 3EX7C 3GEDA 2X0KA 3C41J 1EESA 4HLQB 5KDDA 4KVAA 4RQ1A 1K0FA 2PD3A 4C0WA 5GWXA 1L5GB 5LUAA 3D9QX 3A0HU 4NBKA 1VLQA 1KN5A 1XPRA 3ZNPA 3EA5A 1ZIDA 3IA7A 5KBYA 1KEUA 1PSDA 2D13A 3HZZA 2CK3D 1RRGA 3GLKA 5B2ZA 5JD3A 5J4LA 4QVGA 3R7NA 5DDYA 3ZZUA 2E4UA 3I1JA 3SX4A 1E6WA 1G17A 2UAGA 3E9QA 3W2EA 2IBTA 3N4MB 5I7VA 4GMHA 1QPGA 1PJCA 2O7NA 4JODA 3CPSA 2DHRA 4XQ9A 1JX6A 4ED9A 4YIKA 4JV5B 3BFJA 2ZT5A 5HMLA 4JV0A 2X3UA 3A3NA 4I9NA 5MGBA 3IMCA 1QAOA 3G9XA 3AHEA 3OIYA 2JBHA 2YV1A 3OC0A 1FXUA 4XXHA 4LY0A 4YAKA 1KC3A 5BSMA 3UEOA 1K6JA 3ZHOA 5FWYA 5FYQA 3PNCA 4MVYA 4ICAA 3W5HA 3DOUA 1WHTA 3T5TA 1E2MA 4XB6B 4PSAA 4RACA 3UV3A 4ETNA 2LKYA 1IRXA 4MV4A 4CKYA 3LOPA 4FIZA 2P3SA 4PO9A 3IE0A 4ZEWA 5TGZA 5BW4A 2MSNA 4P7GA 5C1PA 1SIJA 4LJAA 1VIYA 1CY4A 1Y80A 4FILA 4G1EB 3SC2A 2FW0A 5LLTA 3I9MA 2O2YA 2G9QA 4FS2A 4ZOLA 2BCQA 3S44A 1WWVA 1TEHA 1IZ8A 3HFSA 4RZUA 5FNZA 4CMJA 4YDHB 4NEGA 1ZSNA 2DC1A 4C80A 4BNHA 4KUGA 3PC7A 2CB9A 2L0XA 3V8NA 5I01A 4U7DA 3OQNA 2DGDA 1XT6A 2JRLA 3GEEA 3PZRA 1PZEA 1A98A 2C8JA 2HWYA 4LHZA 3FUWA 4K87A 4L7QA 2ONJA 3QLVA 3V8RA 4ZCIA 1TJ3A 1U8CB 3GBSA 4KTTE 1TM7E 3G8CA 5FV4A 1FDUA 2ZIUA 2NXWA 4H3VA 4E94A 5L8VA 4PO1A 2HA2A 2A3RA 4J7XA 4XYBA 4YUVA 3TTTA 1J8YF 4YRAA 2JATA 1QSGA 1WPXA 1S96A 2HCRA 5ALXA 1F14A 3TSAA 1T24A 1J25A 2WZBA 2ZUEA 5KYVA 1T3GA 3V33A 4HVCA 4DF4A 4NYJR 3ZHXA 3JYNA 3KYBA 1DWQA 4J43A 1S02A 2VR1A 4DAEA 3LK9A 2I4TA 1F8UA 3BTUA 4OB7A 5AVJA 1PL7A 3CJQA 4B6PA 1JF8A 1E4EA 4YRSA 1BD3A 3MBIA 1MQ8B 3VHQA 1ZINA 2QJOA 3SEZA 1W96A 4JBIA 5KFAA 4MKIA 5EIWA 4EVQA 1ORIA 1PAUA 2VUSA 3R24A 4NLCA 5EHZA 4F7DA 1M5RA 4GZ5A 4N1AA 1M67A 2I4MA 4G9GA 4LF5B 4L3OA 5BV7A 3HCOA 2O14A 4C7XA 2C5GA 2CBGA 3AR3A 1UPCA 4KAJA 4KYVA 1R6DA 3W8EA 3GUHA 4C0QC 1KJJA 2PQ2A 2FY8A 2Z4TA 3R40A 4H6PA 1RC0A 3VGPA 4AWAA 3A9VA 2ODWA 1MOSA 2EDAA 3ITNA 4OX9Y 2WMNB 3D5QA 3QTBA 3NS1A 2VLIA 1UQTA 3FGPA 1IG0A 3QEJA 4FGWA 2JGAA 1RI3A 4NU5A 3H16A 1MV8A 4TTVA 1P7WA 4WKBA 5CXXA 3TCNA 4L5AA 1ESMA 3HCNA 4X8LA 2WWTA 3PIIA 4IIVA 3EFEA 2WABA 1YA6A 1LZLA 4ZCTA 2NPIA 5HPYB 1J1IA 3KAPA 4Z4GA 1SUDA 4GT1A 1L7AA 4JJIA 4C7JA 3IPLA 4R9SA 3EPKA 1KK0A 3SENA 2PFPA 1PL8A 2QR5A 4L2IB 3IN5A 4YMTA 4ZQEA 1KDPA 4WK2B 2OBFA 4JI2B 4KN4A 3QYFA 4TKLA 3G17A 4IOLA 3OQVA 3W7BA 1VKOA 4HQKA 4ZV7A 4F2SA 1ZQDA 5D3QA 1XCLA 1AS2A 3KKMA 4EHHA 4G5SA 5FA8A 4P0PA 4BUGA 2FW6A 5JDCC 2BGTA 3B6EA 4L9WA 4E5UA 1HTTA 1TMYA 1L5MA 3CRVA 4MGHA 3V97A 1DX6A 1L1RA 1EIWA 4LIPD 4BNLA 3KQPA 1N7GA 5SICE 3FOBA 4C4OA 4Q39A 2C5HA 3G89A 3U4GA 1V4BA 5JNUA 1CVLA 4V24A 2PBZA 1OI3A 4EH1A 1I2AA 2H08A 4E5KA 2KFNA 5HJ5A 2AB0A 5IJ0A 4MW1A 4EUHA 4JKOA 1ICIA 1XROA 4N82A 2HK9A 5FEMA 4BYGA 5KT4A 2Y0BA 4NV3A 4J16C 1JMKC 4GO1A 4L57A 4DA8A 2C8VA 2CXRA 2Q9BA 1SULA 2XYGA 5FP0A 1YBVA 4HFNA 5JWHA 3EQ8A 5KQMA 3L4SO 3QNUA 4HWPA 3NGDA 4UULA 1GILA 1AB5A 1M34A 1EWRA 3EIEA 4TRMA 4XTCS 5ECDA 3HU1A 5LMNB 1KVRA 1X8LA 3BMQB 5JVDA 2P35A 1NVKA 2FN7A 3MWDA 4JOQA 1JHDA 4URVR 1CX9B 2I8AA 2ZRBA 1E2EA 4CL3A 4KL8S 3HA5A 1SC3A 1F0KA 2JZCA 4OGGA 4DB2A 1ZOPA 2PH1A 1XZBA 3Q2IA 1M7GA 3OE1A 4ECAA 3ADBA 5H81A 4DV6B 2FPMA 3GCWA 1M54A 4E5SA 1M2EA 3PR1A 3P94A 2JLUA 2DWUA 4TWZA 5EWMA 1GFZA 3PEYA 3PCRB 2VNKA 4PG6A 5CJ2A 4X00A 2BFBB 4MS4B 4Q1BA 1EK0A 4OU4A 4BGIA 1G42A 2Q21A 5D86A 4HDOB 4EYSA 2BGKA 2LCIA 4NS4A 5JS8A 1EHIA 3VPCA 2FDXA 5FTJA 1DAKA 1T15A 1HDXA 2FUG6 4GM0A 1ECJA 2WYWA 2YY5A 2QRLA 3BX1A 4HH4A 4LCBA 1M1YA 2FP4B 1T5DX 4OJ6A 1U2SA 2YHSA 3NBXX 3AG5A 4HB2A 2GH1A 3L4BC 3C85A 4I2GA 3NVAA 4DCTA 4R40A 4XEUA 2BPCA 2H2FA 3UY4A 3HACA 4PX3A 1SD2A 721PA 1ZBQA 2BISA 3R4VA 3MBOA 4WDQA 5CLIA 1EFPB 2ZWMA 3LAWA 3C6KA 2JLVA 2HSDA 4AMYA 1ES9A 2FSVA 3AESB 1QQTA 3OZ7A 1ID1A 3AR5A 1C9JA 2WE8A 5A7HA 5C34B 1M5UA 2FAXA 1DC4A 2JGDB 1W4ZA 1UXIA 1JUDA 1XEAA 1MLDA 1M6VB 3K73O 4MICA 3PKIA 1V4NA 4U2FA 3RB4A 1NDHA 1LD3A 1X0VA 2ZSDA 1M10A 1XK7A 5D00A 2HWXA 3H5IA 1JU3A 4KXMA 1UP7A 4JBHA 5ALOA 2CHUA 2ZSUA 3HLTA 4R68A 2DOKA 4URUR 3SC3A 8OHMA 1A4UA 1S9HA 2TSYB 3UJNA 4I8XA 3AVXA 4TXLA 1BYIA 4RPKA 2YMQA 1YR1A 2C9BA 3VYSB 4KVGA 2VTKA 4C03A 3KALA 2JIOA 1P61B 1GRQA 1MQAA 4NC9A 1RP7A 3ZV7A 2Z09A 4PXYA 2DPMA 3H1FA 4B4DA 3H9GA 3GPIA 2NXEA 3H1TA 3KRTA 3GLGB 3KXDA 3G2LA 4HGQA 5ALNA 2AN9A 2X0IA 4DNXA 2O2XA 3UKOA 1QCDA 5B3KA 4AT1A 1QU3A 1MMFB 2W3RA 4P5EA 2OXEA 2QOEA 3C5WP 3HMQA 1UBKS 2PAFA 5DLEA 1C41A 4UTXA 2IFTA 2QG9A 1FP7A 2QTAA 3DOFA 3VVBA 4B43A 5JAQA 2K60A 1FE8A 2AI1A 2GPNA 3Q8XB 1FLVA 3QFSA 4LE2A 4OAQA 3VC1A 4AROA 2F9LA 4G5XA 4LZNA 3AWDA 5LZ2A 2WAYA 5J2TF 3SXPA 3SZUA 2CHEA 3K0BA 4CM4B 4EF4A 5B12A 5KVSA 3ZE9A 3WWPA 1LBTA 1NZPA 2GR9A 1FFBA 3GJTA 3IPYA 1IFXA 2XITA 3SV3A 3UWKA 2Y4NA 4M87A 5L9AA 1FZQA 4YUAA 5KOJA 4JUZA 3RC7A 3I1IA 3MB5A 1V3UA 2J0UA 3Q9NA 5AJUA 1KH2A 1S7CA 2R8KA 3K30A 3LZDA 4BFSA 2CMGA 3AOEA 4BMYA 4Z9AA 1UJ2A 1M3SA 3BXGA 1UJ4A 5D4BA 2C1EA 2GTHA 3N58A 1EZ4A 4MIYA 1TJ5A 4HZGA 4BX9A 4ZI2A 2PU7A 3GGCA 5K3FB 1FX0B 3PE4A 3HJFA 3NVZA 4K1LA 4G0OA 2V45A 2RGAA 2HRZA 1GSOA 1PW5A 2B21A 1YA8A 1E2IA 5EIHA 3W90A 3IAFA 4G65A 3PGLA 1P7VA 4BLTA 1O58A 7MHTA 3CEJA 1DUIA 2PD6A 4JJAA 2ZRIA 4UHJA 1OLSB 3RVMA 2LBPA 1WNFA 3FDJA 4RDCA 4HMQA 1CERA 3M3HA 1XUOA 1NBWB 5M34A 3KVYA 4O4JF 4YCLA 4S05A 5TJ9A 4YUXA 1KH1A 3MEQA 3AI1A 4L5JA 1AXRA 3E3OA 2P6PA 2PS1A 4HC4A 2W4IA 4AZ3B 2VZ0A 4HYTA 4B7CA 3MERA 3HLYA 1Z5WA 4BWFB 3O8DA 3LC1O 1IQPA 1U6IA 4DM4A 4J0EA 5KYYB 2FOXA 2Y1LA 3BMQA 5JVDB 3U81A 1N6RA 2R8JA 4QO8A 3AILA 1XALA 2VP5A 3ELDA 3G0OA 3I9LA 3LL4A 1OLSA 1T6BY 4GLBA 3WC4A 1U7HA 2DWQA 5CEEA 4P32A 3KKPA 3NIDB 4KR2A 4E30A 2UU9B 4RZHA 3PO4A 1YBMA 3O4IA 3V1NA 4MDEA 1K9VF 3DBRA 3LUAA 1QGZA 3UMBA 3UAYA 2F9MA 4QTXA 4ND7A 3LTEA 4MRNA 3I6ZA 1VE6A 4ID3A 4OHWA 1JJVA 2QJTA 1ORTA 4S1VA 5KFXA 3KTDA 5ARDA 2RIRA 3ZZTA 2ZJYA 2VHXA 2B92A 1IN1A 3DONA 1QF7A 3K9NA 3U6KA 3EXG1 3D8BA 4WLEA 1U49A 4WZAA 3T7DA 3VR2A 3KQOA 5HQJA 1QPZA 3GUUA 3TI9A 1RI5A 2GKGA 5EKXA 3K3PA 4DGQA 2XB6A 2GD1O 3FPKA 4LSMA 2WF9A 2H65A 1E60A 4TS3A 1KXZA 1M2OB 5TE9A 3CRQA 2KQUA 3GXOA 2NM0A 2P3QA 4X7MA 1P2BA 5FBQB 3YASA 5K5EA 2IXAA 3DJYA 4FDMA 1JFVA 3C43A 5E6SA 4HPWA 4Q3CA 5CR0A 2AE2A 2JD0A 3KKLA 3GK3A 1FYWA 3L4PA 4DCPA 4FMBB 2GZHA 1JR6A 3MW8A 2HXSA 5DISB 4IQWA 1SVIA 4KBGA 4X85A 1UZNA 2NXNA 3AIKA 2HYIC 1YKSA 2WAXA 3IQFA 2YCBA 3B2QA 3NC0C 5KNIA 4LXIA 1DAPA 4NDZA 4E2YA 1P3Y1 3FNHA 5A3RA 4B76A 2PX8A 2DJ5A 1MPTA 2OBXA 2VHVA 1ZYUA 1V5EA 3LPMA 1X2IA 2W9BA 9ICRA 1EP3B 2DBRA 3CZMA 4NS1A 4PSKA 3Q9SA 4ZAWA 3RUCA 3ICXA 2HD4A 3SIXA 3UVEA 3TD9A 2FCAA 5MN5A 1KQGA 4Q4JA 2AQ4A 3N8KA 4HWOA 4KEAA 2HHWA 1Y5MA 4DABA 1U3TA 2X15A 4AURA 4BIMA 2H1OA 1IULA 1C1XA 3Q0TA 2DPXA 4CLHA 4PQGA 3VZRA 3EJ6A 2RE8A 4D43A 4QPNA 1RYHA 1XVTA 1IBSA 2C9DA 4W9RA 5C1IA 5K2OA 3IS3A 3MS2A 4ECVA 1F6WA 4AN1A 1EE9A 6PFKA 2YOGA 2PBRA 1TF7A 2FP4A 1QBGA 1P1JA 5I7OA 2C2EA 1E7MA 1NXPA 5E4JA 3NYIA 3DBLB 4WLFA 4OMDA 4M0KA 4AF6A 3F6BX 1BCSB 3AF2A 5JRTA 1UBCA 2WG1A 3LQFA 5IG2A 3TG2A 2LI6A 4MGKR 3QNWA 4X7PA 1OLUA 1YQXA 3T8YA 2G07A 1B7GO 4BGVA 4F5WA 2HC9A 4FWIB 1DB3A 3E3MA 4R0NA 4FS3A 4PIVA 3ZDQA 4K46A 4ZPJA 3DMRA 1ZI9A 1TAMA 2VATA 3AP1A 3H13A 4RC9A 1KARA 5JPIA 2VTDA 3NXKA 4CLRB 1YU6A 3K70D 3OP4A 3FVRA 4REMA 1M8GA 3RB8A 2NU7B 3OX2A 1TYAE 1GQ2A 2C57A 1O95D 3N2GA 4PNHA 4WDRA 4ZV4A 2IS1A 4YVZA 3LBAA 1WXFA 1NVFA 2DG2A 2V6MA 4QX6A 5H68A 5J8YA 2AD1A 4E4RA 3B9JA 3T3FA 1F06A 4MUYA 3PPYA 3AXSA 1M2GA 2FW7A 2BQRA 3B51X 4HAVA 1I2ZA 3CTPA 4S35A 3V55A 1GNVA 4E09A 5HQ3A 4QJ4A 2OLEA 1CUYA 2QP9X 2VHEA 3R5JA 4IR7A 1UBNA 3EVBA 1BS9A 2CW5A 4HUTA 4PYJA 1IM2A 3T6KA 4FCCA 4QLOA 2KMDA 1FZTA 2W58A 4L50A 4BO1A 3QLUC 1V8ZA 4KH0A 1LNQA 2HXYA 5DX8A 3RHTA 5KT7A 4CMIA 2BVNA 2PKCA 4MV6A 5KOYA 3W5BA 4YCXA 4L4UA 2BYTA 9ICEA 2VQ6A 2DSNA 5EHGA 2QT1A 5G0SA 3DDWA 1XA3A 4B2PA 1UEJA 1V8DA 1JIQA 5DXAA 3VHRA 4NLGA 1I0ZA 5BP7A 5LXTA 4PLWA 2DBYA 4S1PA 4HPJB 2H52A 1YV9A 4QUIA 3H3JA 3SYTA 4IO0A 1SVLA 1II8A 3HZHA 4EB8A 2LD4A 3JPSA 4ZIRA 4DR5B 2P2LA 4C0BA 1WKCA 1COKA 1Q2XA 3Q3JB 3K92A 4IC9A 3AM1A 5IARA 2G0TA 1Q1GA 4I3GA 3IJRA 3CKMA 5JD5A 5DJ5A 5J63A 5MDHA 3H42B 3PXXA 1SXGA 1ZXXA 2Y67A 3HPRA 3B8EA 3LLCA 3DKKA 4HZIA 5EUQB 4XM2A 2JS7A 3LKBA 2EZYA 4MX8A 1ZQRA 1GO3F 1E58A 3M5PA 5D3ZA 5BNWA 3ZVNA 2GNOA 3TQ1A 1CVIA 1NV8A 2XOKD 4NE7A 2VK4A 4PO3X 1E2QA 1FNBA 4JGIA 4NATA 3LPNA 5LIPA 4DSNA 5LXTB 2I6XA 1DC5A 3E48A 1DT5A 2QTHA 3DOHA 1TO2E 3SSAA 1DEKA 4K0RA 3VR4D 2GVZC 3AU9A 4IQVA 4A8JC 1AQJA 4BHTA 1BVYF 2GLEA 3D6JA 2G80A 2J6SA 4XSGA 2H3ZA 1MVLA 4PZYA 2OV2A 3LW8A 2QT0A 3RC9A 4KN9S 4DWVA 3RK0A 5I6DA 4ARIA 2REXB 2ET6A 4TQGA 4C9BA 1G5HA 3DFMA 1N6KA 4OXKA 3V8EA 1MAUA 1Q14A 2UDPA 1JMYA 4UEJA 5EWJB 3RB6A 4KLGA 2Q2WA 2PMKA 3H0MB 3HILA 3ABIA 3L8MA 3U3ZA 3WLKX 3ZBTA 2QTMA 1D6MA 4DS4A 4Q9NA 5KTYA 1WCV1 3R0VA 3FI9A 4OG2A 1OXBB 2ZXEA 3IAS6 1S77D 1DELA 2P3LA 2Q07A 3I04A 4LVCA 4BU0A 1LJLA 1WBBA 1MABB 3DE0X 4FNMA 3ZXXA 1IVYA 3PD1A 3JQFA 3RBAA 4KPYA 4JYBA 1QHXA 3QV1A 2JCYA 8ICIA 2NZ2A 2Z9BA 5LSAA 4WADA 4TRJA 4FYYA 1XLTA 2FW9A 2Z08A 3RLFA 3DDCA 3AERA 3JAKB 3JD4A 2X76A 3HGMA 4XCXA 3KB8A 2BJHA 5ECYA 3W5CA 1U1IA 3IDWA 2FMPA 3KHGA 2QMQA 3BAZA 3F53A 3C1UA 3KZMA 4MUIA 4UHKA 1FDOA 4GP9A 1DUSA 4IRUB 1P7CA 1XMPA 1VCMA 4BJ5A 3ZWMA 1KIFA 4OSPA 9ICQA 1TW3A 3K20A 3HDJA 9ICWA 3WLJA 4EKNB 3KQKA 3W1WA 4Q47A 2BTQA 5I7AA 3RODA 1R9JA 4JD5A 4W1RA 1JQ5A 2A1TR 1VCHA 1JEQA 1K98A 2G40A 2IU6A 2OBBA 2ZRCA 3SR0A 3IX7A 1E94E 3GDHA 1XQWA 1PO7A 1AJEA 4JK1A 3MOIA 2FRVA 2Y68A 3N97B 3WGLA 3G0IA 3OZWA 4FYPA 3B3QA 3FOZA 4KGDA 5ELLA 2PBFA 2ZSIA 3OJWA 2IUUA 1AZLA 1JIHA 3WKEA 4RU1A 2QM0A 2HJHA 1KJZA 2P67A 4GKBA 4OXQA 5BN4B 2UXBB 3QPVA 4KIGA 2QQGA 3PNPA 5KYXA 8ATCA 3QUSA 5K8VA 3C5EA 2DL0A 3TFRA 1T9ZA 1UM9B 1V45E 5J29A 2BM1A 3LMKA 3GAFA 4RJJA 3SJZA 3ZZ1A 4UB3A 1JLSA 2A1UB 3QVSA 3ZW8A 5B2FA 4OIMA 4EECA 4X5VA 5AKEA 2RG7A 2VDUE 2OFOA 3ANLA 3NPMA 1T3NA 2PBLA 1Y33E 2Q6KA 4FHCA 4GPD1 4QD3A 3X3HA 1C7RA 5BURA 1ZGJA 3AI7A 4QDOA 4WGGA 1KSJA 3N74A 3EPLA 7ICEA 1USGA 2FN4A 2G5PA 2JANA 3L8CA 5BSFA 3AL0C 3WLRA 1IPFA 4ARAA 1G8GA 2V4MA 4LJKA 5HOEA 3JD3A 4KQ1A 1DIBA 1FVHA 4PSUA 3PNSA 4R9RA 5CDTA 3GUYA 1T3SA 3JQ8A 1WCXA 1TA9A 1YU9A 3IP8A 5LBIA 1GTMA 1JWAB 2H1LA 4DTIA 5KG5A 3DQPA 4N54A 3GA5A 2DH6A 3TQSA 1GGHA 2R7AA 4CTNA 4TUPA 1QX4A 3F67A 3WK6A 1RAFA 2C9ZA 1WR8A 3DAFA 5CVJA 3O1IC 2WAOA 3ZQ6A 1DXHA 1TZCA 4EHBA 5C5CA 1YTUA 3T1OA 4R83A 4MVCA 1E2BA 2JHDA 3E5RA 4NEQA 2ID4A 5EZ5A 3SAJA 4ABTA 2LVBA 1VL6A 3E27A 3MJCA 4C2BA 4F86A 3DD5A 9ICBA 2VQFB 1Q0LA 4C43A 4E32A 3BF7A 3FUCA 1DXYA 3I4LA 4I8IA 3UWMA 2OD7A 2UYGA 2DP4E 2NPFA 1G64A 1O8CA 2RB4A 3QEKA 5IJXA 5FFNA 3VJLA 2XZOA 3EVTA 1N1DA 5EE5B 1U0JA 2XMPA 3ISVA 1OZGA 1T10A 1N5WA 3P27A 4QYIA 4DG5A 4PTZA 1B3BA 4TN1A 1A8IA 2HWWA 2H9YA 4FX2A 3DOJA 3A1WA 1BA3A 3PUHA 4DF3A 1TFRA 1W35A 1WEKA 2FZVA 3AM5A 4TZ0A 2GKSA 2I3ZA 3Q6IA 4FBTA 2Z2XA 3PQ7A 1FUIA 1V6SA 4H08A 5DWDA 4LN1A 4ZXPA 1CZOA 3MT0A 5E6UA 3IAUA 5TEWA 4ALLA 4DLKA 5D87A 4TKVA 9ATCA 2OESA 4N8SA 1H0SA 5CEHA 2G1JA 3RSFA 2CT8A 1QGYA 1NHWA 1T0JB 4QGHA 5HF5A 3A2NA 4EAQA 2G7ZA 4HFRA 5F5LA 3DFZA 2IZ1A 3P9YA 3TJMA 2VANA 1J56A 3VSCA 3IMEA 3QE3A 3VUFA 3AYZB 5FUXA 1MR3F 1V5WA 2OT3B 1RZRA 4R63A 2F4VB 2XB2A 3WDKA 2BZSA 2AX3A 4KZKA 3EQ7A 1K6XA 2JCGA 2Z8XA 9LDTA 5HBGA 2XUGA 1XKQA 5GVSA 5CVVA 3F3MA 3N7TA 1PZXA 1TB4A 3CF0A 1L7PA 4LG1A 2EVWX 5CFQA 1GDTA 4IGKA 1SQGA 4A0HA 2FEWB 2JCBA 3MS4A 4L8YA 4R66A 2ZSFA 3PR4A 4FFPA 4UXJA 5DX0A 3UAXA 5LYJF 3EISA 1QBKC 3F5SA 4DQXA 2QTTA 2R00A 3BTOA 2ETVA 1G291 5K3CA 1G8KA 2PH5A 4CTMA 4YRMA 5EY5B 3RLIA 3FDZB 1YDHA 3D8UA 2BGRA 3VPFA 1A3CA 1JMSA 4G25A 3AX6A 3RRBA 5L4SA 1GOTA 4QNMA 1X7HA 3UCXA 1ZD1A 3MYYA 1L3UA 4XB2A 2KSOB 1CIPA 4MS1A 3EIHA 4C8KA 1H2XA 2FW1A 4OXNA 1QJ4A 4WAUA 5J0UA 1MG0A 1ODCA 2DBVO 3BRWD 5KTMA 2CKMA 4LNHA 5FJJA 5BXYA 3A26A 8ICEA 3QVWA 1V26A 3HQ4O 3T7JA 2WD7A 2LPEA 3OPYB 3L7KA 1BPEA 1XD2A 3D7NA 1MC8A 1QHGA 2ZVPX 4HN4B 4JVMA 2J6HA 3EZ9A 3KJQA 4I08A 5CDUA 2A6PA 4I2DA 4PHPA 4MW0A 4J1TA 4PV7A 3HJAA 4ND6A 5BOVA 3FZEA 4FCTA 4UBOA 3U1VA 3W6ZA 4EI8A 5G4KA 4ZGBA 3WAJA 3I6MA 2B6NA 1ZQZA 1QXSA 4XOUA 3PPVA 3L8YA 2P1DA 3UUFA 5HXAA 1G3IA 3FHLA 1IJKA 4EA8A 3DLPX 2A3VA 5HQTA 4Z4EA 1QB8A 3I2IA 3KFXA 2CLFB 1I7QB 3U3XA 5DM70 3QZUA 3EY4A 4WOCA 1YKFA 1LSJA 2PX5A 4MKZA 1NX9A 1QVZA 5TT1A 3A4TA 2HAEA 2PT6A 5I3ZA 4K6OA 1A8QA 4GKAA 4KN8A 4XWGA 5JT1A 1FIUA 1NYRA 1DCMA 1MENA 1CETA 2WTBA 1WVIA 3S2SA 1REQA 3M6MD 2OILA 1DJPA 1AKUA 2A9JA 4EZ9A 3UMSA 5KYKA 5I8ZA 1ONSA 4K03A 5BRAA 1KTQA 4TWAA 1Q7GA 1RACA 4U2CA 4NBVA 3WNCA 1FFYA 1ATIA 2GI4A 1EJ0A 1Q3TA 3PHIA 3GEPA 1JDZA 1HG0A 1DFGA 2YTUA 1EP1B 1Q92A 4G4SP 3AVUA 2GERA 4QXQA 1QFYA 1MO6A 4MQBA 2GT1A 3UH0A 4JFRA 1MCZA 3DF9A 5LUBA 3RTAA 3RFFA 2YWRA 3BB3A 1AE1A 2DR2A 3FOCA 4MEYA 4J07A 2JEZA 2CB0A 3KPJA 4PQFA 4TXMA 4EHFA 1J2JA 1IOWA 4QICA 5AIAA 1QK5A 1SBHA 3O4VA 3WSWA 2EAPA 3C5HA 2KN7A 2NQTA 4NJ8A 2PEZA 3DR3A 1AHIA 4I19A 3TBKA 3UWPA 1G59A 1A5SB 3P96A 1YQWA 1E5TA 1T9GS 3I6BA 2IEGA 1IEWA 4PC2A 5A1JA 5JDCA 3GX1A 5LZ4A 5KPDA 1MAVA 3RNOA 3SEIA 1C0EA 5BOSA 2I67A 4ELTA 4LHVA 3RM3A 2Q99A 1KBUA 1AMUA 2IV2X 3TNYA 1L6RA 1W73A 2ZB2A 1PJBA 2RBKA 4M8NE 3ZGYA 3C2QA 3JYLA 2RBGA 3X1KA 4FBMA 5L3SA 1D8AA 4W1QA 2WZDA 2OZLA 4TKVB 3TZLA 4UOEA 4JLOA 4NJMA 4K4GA 2JVKA 6NULA 2HSJA 1D2GA 4LKRA 3VA7A 2C0QA 1NJZA 3SYLA 2KJ5A 1NAIA 1PNTA 2VJDA 4V0SA 1XNHA 2PUHA 5H83A 3AEKB 1JALA 5ALFA 2PK3A 4PINA 2HU2A 3LC2O 1LS6A 2FZ4A 1TZJA 2DKNA 2Z2YA 2HQSA 1PGPA 4OJKA 3WAKA 1X1RA 4TUQA 4YAIA 5LA6A 2O3QA 5GGXA 4N6NA 4QGAA 3WMRA 4ZOAA 2P78A 1BCRB 1A9ZA 1GLNA 1A9YA 1PT8A 3LNCA 4NENB 1G8AA 2HBYA 4NYIQ 5IIJA 1XZEA 2W54A 3HXQA 1USIA 1DE0A 2GUGA 1T34A 3T0IA 3QHPA 1EIZA 1XWWA 4LMBA 2QQ5A 4TTTS 4O5EA 4EO4A 1Z7WA 5D5HA 3ZI7A 4AS1A 3QBEA 3EZFA 4QXMA 3QVMA 4IZOA 4YIHA 1Z13A 3T3OA 1P5HA 3IURA 4JQOA 1OAAA 4F21A 3QXJA 1DPFA 3V9PA 3I30X 3ICPA 4C7KA 3W5JA 2GB4A 2LNDA 3K1RB 2G70A 3SY8A 1V3TA 4XWOA 4OFWA 1JRLA 5IU6A 5FI3A 1N5KA 3E5NA 3A1CA 5CFMA 3PKJA 3MTQA 4UZEA 4KP7A 4HXGA 5FL3A 4TMFA 2O52A 3DHVA 1NQTA 4IIBA 1VLBA 1A9XB 2XGOA 4CI9A 3K8YA 1F7VA 3M1AA 3M9NB 1QG0A 4LZDA 1QK3A 3VYTB 5FBHA 2OZPA 1K6IA 1Z3EB 3C3CA 4MMZB 1Z4LA 2FSVC 3CPHA 3NIGB 3MQFA 1ZM3A 4P4SA 1Y7IA 3HJRA 3PT5A 4HDKB 1AMNA 2IH2A 1N2CA 1DJQA 2ZSEA 4BE7B 3I92A 3MHPA 2C07A 5AXCA 4WW0A 3KSAC 4CU2A 7ICPA 1N7JA 2OO3A 1ZK0A 3JQAA 4FUQA 3IHWA 4R2WA 1LKYB 4TTJA 3V7NA 2BBWA 4CV0A 5BV2P 3U7FB 2H5EA 2OD2A 4FZ5A 3GY0A 2UZ4A 1E63A 2XKAA 3K09C 2WJPA 4ENUA 4DR6B 4PJ0U 4EHLA 3IESA 3USZA 4UUPA 4B6FA 1D07A 4P2BA 3W9UA 1ZNQO 2ZB8A 2H4JA 1V35A 3UW1A 3MR6A 1U4NA 2QSJA 1QOPB 1G9TA 4H17A 2ZWVA 1GTVA 1GNSA 3VH4A 3ONDA 2MSWA 5AKXA 5G41A 3RUDA 3VNRA 4EVIA 1CQPA 2GWHA 4EJSA 1RFLA 2UZAA 5IP5A 1R1DA 4NCAA 3AUFA 4OHYA 2BZFA 4OHBA 3ZXIA 4C7MA 1H94A 1H5QA 3AP2A 4O5OA 5KWJA 4IGFA 3E7WA 5DF1A 3GLSA 2WHEA 1DG9A 2Y1IA 2R7MA 2PL5A 3MJRA 2PTGA 2NZVG 3CUTA 4QDKA 4QQ8A 4TZKA 5BQOA 5FUBA 1O96B 1WUKS 5AVWA 4YWJA 1R18A 3PW5A 2AV6A 4RS4A 4TQ9A 4MJXA 1E1RD 5KSZA 1SRQA 4LV8B 4OB8A 3GDWA 3H1BA 2FPRA 2P30A 4Q9LA 3MGCA 4JCOA 1SH7A 4MUXA 4ZU3A 4CNQA 1C2YA 1XRPA 2OHOA 2O0JA 2QTNA 4PICA 1EK5A 3PE6A 2I2BA 3E3AA 4W5WA 3SQMA 4EF5A 3HNRA 2PHZA 2PZBA 3QXGA 3JWGA 3RG2A 1S8AA 2AI3A 3DZHA 4UQGA 2MUTB 2LKDA 2C5LA 5K0BA 3TKYA 1KGSA 1V71A 1IH8A 3QKIA 1HGXA 5LP6C 3SQDA 5JXJA 2WQ6A 2BFFB 3BJZA 1NQOA 2KIVA 2Z3WA 4O0IA 3KKAC 1ONNA 3PL5A 4RTPA 4YDQA 1KXJA 3CWCA 4IYJA 4FNAA 1EVKA 1GUZA 1Z47A 4G4GA 1J7KA 1AHHA 1L9KA 4IHJF 4Q9JA 5EP4A 5DNYB 3BB4A 5GTHU 2RI1A 4KMOA 1QMPA 3K9HA 2B6GA 2QW8A 5FEUA 5L3SB 1R4MA 1G5RA 4ZJYA 1XNSA 2JKZA 4JV2A 1G6HA 1N5DA 2O0HA 1E5DA 4MDHA 1Q7TA 3QY0A 4UU1A 2B5OA 2I9PA 2QMOA 4L27A 3ZWBA 1M83A 3GA0A 2XY5A 2QVBA 5IJWA