4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
3U7FB 3WK5A 3PDWA 1JUDA 5AK4A 1YJ5A 3NANA 2C9MA 2WF7A 3IJ5A 5T41A 1RMYA 4UMVA 1RMQA 2BY4A 5AW7A 4B6JA 1XPJA 2YMMA 2YY6A 5AKJA 5ALDA 1U2SA 2OBBA 4NFLA 3L8FA 5AW5A 4HGRA 2FI1A 3QXGA 2P27A 1U7OA 2WHEA 5ALWA 4OD0A 5AW2A 3E58A 3WK9A 3RF6A 3SKXA 4EEKA 3KZXA 1WPGA 3NUQA 2OA0A 3WK7A 5AW3A 3B8EA 1SWWA 1PW5A 2EATA 4BKMA 4YH1A 3D6JA 5JJBA 4KX3A 3I1YA 1L8LA 2YJ4A 2G08A 1XVIA 1Z4JA 2HX1A 4KYTA 3UMBA 1Q92A 3KOOA 1YV9A 2JAUA 3SLRA 3K1ZA 5AM2A 2G80A 2FPSA 1FEZA 4HGNA 2PQ0A 4Y2SA 2ZBDA 1SU4A 3HYCA 4KNVA 5AVQA 2FPUA 3SHQA 1Z4MA 3AR4A 3MN1A 3OCYA 4H1WA 4FFDA 4O8CA 2GHTA 1T5SA 3W5CA 1ZS9A 3N1UA 2R8XA 4Y3UA 2B0CA 1ZOLA 4YCMA 5AK6A 3U7GA 3NRJA 3ET5A 3FGOA 5AI8A 3E84A 2IOHA 5IT4A 5AIAA 2CN1A 3ZUPA 5ALHA 4QJBA 2QLTA 2G0AA 3J7TA 2G06A 3L0BA 1Z4PX 3BWVA 4CF3A 2C8KA 3WKBA 4L57A 5ALGA 2HDOA 3M9LA 2CFRA 3CNHA 1T9ZA 4UMFA 3WKDA 2B30A 4E88A 5AW9A 2C4NA 5AKYA 2NO5A 1Y8AA 2P11A 2MU1A 4RETA 3A1DA 3FVVA 1RLOA 1TJ5A 5AW8A 5A3QA 4UU1A 2R8ZA 4I9FA 1SWVA 4AS3A 1ZD2P 2MSNA 1CR6A 1RQLA 3I76A 1QH9A 4BNDB 3I28A 5AM3A 1Q91A 1RLMA 4HGPA 1J8DA 4PNHA 4GXTA 3ET4A 4IG4A 3AR7A 2HO4A 1ZD5A 4YCNA 3MC1A 5AW6A 3R4CA 3BA6A 3OCVA 4NABA 2I34A 1EK2A 3ESQA 2Q5EA 3L0YA 5AM5A 3VAYA 2WF8A 4DWOA 4BEWA 2CFSA 1U2TA 4Y2QA 2Q4RA 4EENA 4KN8A 5ALFA 3OCUA 2YJ6A 1QYIA 5ALKA 4DW8A 3DAOA 3OCWA 3ONNA 1TJ4A 4Y2YA 2ZG6A 1K1EA 3WK4A 2QYHA 1Z88A 3AR8A 2RBKA 1YMQA 4OFZA 4UM5A 3U13A 3W5AA 5ALPA 4NV0A 4HYTA 3B9RA 3U7HB 1L8OA 1XP5A 4C4RA 4F71A 2B8JA 2YJ3A 2I6XA 3ZWKA 2FUEA 5AHXA 2ZBFA 3L8GA 1VFPA 4Y2TA 4UATA 5ALYA 3L0CA 5AVTA 2O2XA 3GYGA 5AVYA 5ALTA 2I7DA 4UMEA 3EPRA 2RAVA 2IOFA 3WK6A 3OTQA 3N07A 1O03A 2C8LA 2FPWA 3DV9A 2PKEA 1QQ7A 2AUTA 5AK5A 3ZX5A 2RARA 3U19A 3KDPA 1MH9A 2EAUA 4DCCA 5AM1A 2GFHA 3MPOA 3NIWA 4Y2RA 3SMVA 4CE6A 3WGUA 5ALUA 5AKZA 4NAVA 2P69A 4MUMA 2R8EA 4BEVA 2WF6A 2HSZA 5AVSA 3A1EA 3N5KA 5A3SA 3ED5A 1RC8A 2ODAA 5AKKA 1X42A 2AH5A 2GO7A 5AIBA 1LVHA 4CF5A 2JGAA 2YFYA 4YIHA 1LTQA 4UASA 1IWOA 4EELA 3L8HA 3KC2A 5ALLA 5ALSA 3SF0A 4AS2A 4YCLA 5ALMA 4DFDA 2JAOA 1N8NA 2EARA 4J03A 4G63A 5ALQA 4YGYA 4BX0A 1Z4IA 3AR6A 3SKYA 1YDFA 4Y2JA 2WF5A 4F72A 1Z4LA 1RPZA 3W5DA 3FPBA 3NASA 3KD3A 4HGOA 1Z4QA 5ALZA 3QUCA 3OCZA 2W4MA 4XOUA 5AKLA 3ZVNA 5A3RA 2HOQA 3WGVA 1L6RA 5AI6A 4Y2VA 5AKHA 2ZXEA 3UM9A 1YNSA 3L1VA 4AP9A 1RLTA 2W11A 2G1AA 3U7EB 3AR2A 3ZU6A 2YMPA 4UM7A 2FPRA 4I9GA 4MWOA 2B82A 3EWIA 3N8GA 3QU2A 4J2TA 5AVZA 1Z4KA 1RDFA 3WKEA 2VKQA 3ZX4A 3UMGA 1J97A 2P9JA 2X4DA 1VJRA 1CQZA 2DQSA 2I33A 3R9KA 3B9BA 1ZRNA 2B1RA 3QU4A 2HF2A 2ZOSA 1O08A 4OCZA 3QX7A 1L7MA 5AVXA 2NYVA 1RRCA 1QQ6A 3M1YA 2ZBEA 4XE5A 3S6JA 4FYPA 3ESRA 4BX2A 3A1CA 3NALA 5IT0A 4QQFA 3E81A 3KBBA 4BYGA 2IOFK 3A3YA 1QQ5A 5AVUA 1RMTA 3QUBA 3UMCA 4UMDA 4EZEA 5AI4A 2FDRA 2IA5A 4UARA 4JDPA 2NO4A 3QUTA 1L7NA 2YBDA 2W43A 5AI5A 1U7PA 4L6AA 3AR9A 2BDUA 3QU5A 3PCTA 5ALEA 1TE2A 4BBJA 2YJ5A 2I54A 2ZBGA 3ZTYA 4KNWA 5ALXA 3QUQA 1Z5GA 5AM4A 3ZI4A 5AI0A 5AVWA 3ZWDA 2HI0A 4Y2XA 3FPSA 3FM9A 2WM8A 3NAMA 4UAVA 2FUCA 3TLMA 1U02A 4G9BA 3ZVMA 2BDEA 1KYTA 1ZRMA 5AW4A 4KX5A 3PGLA 3QNMA 5ALOA 2MU2A 2IYEA 3F9RA 1NNLA 2D2VA 5AKIA 3WKAA 4JB3A 3EF0A 3L5KA 4NWIA 3EF1A 2C88A 1T5TA 3DNPA 1AQ6A 4EX6A 2GHQA 1TA0A 2O9JA 4C4SA 3RFUA 1RQNA 5AVVA 3ZW7A 5ALRA 3CZ4A 4Y2UA 2YMQA 3L7YA 2OYCA 4HAIA 5AVRA 5AKGA 4RESA 3QYPA 1S2OA 3E8MA 2YMLA 4L6CA 2G09A 4BNDA 1WR8A 2WFAA 1ZD4A 4Y2PA 3AR5A 1NRWA 1YS9A 2B8EA 3HLTA 4C4TA 4HGQA 3WK8A 3DDHA 3PGVA 5AM0A 4GIBA 4ZEWA 2AGVA 1L7PA 5AICA 1L7OA 3FZQA 1RKQA 3L1UA 4ZEVA 3QGMA 1NF2A 4BX3A 3W5BA 2B1QA 1WVIA 5FP0A 3L8EA 5IS2A 2YN4A 2FEAA 5ALIA 3QU9A 1TJ3A 2GMWA 3IB6A 1S8OA 2R8YA 3P96A 5AKEA 2PR7A 3QLEA 3U26A 5AW1A 4ZEXA 3AR3A 3I6BA 2HF7A 4CF4A 3IRUA 2CFTA 1RKVA 1Z4OA 4UU0A 3QU7A 1N9KA 2I55A 1F5SA 5AKXA 2JARA 4OHFA 4CNQA 3N28A 3ZVLA 1Z5UA 3OCXA 1Z4NA 4EX7A 2WF9A 2HHLA 3WKCA 2Q4TA 5ALJA 1WZCA 5AESA 3SD7A 2FPXA 4FE3A 5AW0A 2AMYA 3MMZA 3R09A 3ZTWA 1VJ5A 5AK3A 4XPZA 4XQ0A 4IFTA 2JAWA 4UW9A 2RB5A 2HEGA 5ALNA 4YIKA 5E0OA 5AI9A 1ZJJA 1ZD3A 4UAUA 3OPXA 1RKUA 2G07A 2OM6A 1EK1A 2HCFA 5ALVA
chains in the Genus database with same CATH superfamily
3U3JA 5EOZA 1HWYA 4BO0A 4GOND 1LNZA 5J2UA 3BMCA 4LVSA 4KP7A 4GZMA 2GZ2A 2PE5A 5DNYB 2X76A 3V97A 5C52B 2WKPA 1N2CB 1RBMA 3LO5A 3NYWA 1ZQEA 3T99A 2OCLA 5JJBA 5E2BA 3SK0A 2KS6A 3ECCA 3KOOA 5KWVA 5REQB 2OZEA 3U4GA 1JIUA 3PSHA 2DWPA 5TMDA 1P1IA 1WB5A 4GPZA 5KSPA 4FT4A 7MHTA 5F5XA 2D7DA 1R0RE 1N2EA 2IUFA 4V1CA 1QWOA 2MR5A 3EPJA 2QNRA 1A7KA 5EOVA 5LQJA 2F43A 5JAZA 4Z3DA 1IB6A 4Y9TA 4DS3A 3QTLA 3PW4A 3MWEA 5CW1A 1JMKC 1U0LA 1MZVA 4M7PA 5L4SA 3D2LA 5KVSA 1U2TA 1MXHA 3LC2O 4S05A 2JD0A 5ED0A 5CHGA 5A6SB 3I5UA 4QOIA 3UCXA 5KS2A 3RJEA 2VYVD 2QD2A 5L3ZA 4ZOLF 3DEYX 1CVIA 5HKLA 5DNEA 5K8IA 1M83A 4NH4A 4XWYA 1YRYE 3ANMA 3MPUA 1EXVA 3UGJA 4EB6A 4H0CA 1RYEA 3BS5B 1O6CA 4AJJA 1U63A 4CPDA 5CAEA 5ALUA 1EIWA 4HLUA 4G86A 4EY7A 8ICAA 2PSSA 3NPAA 3MTBA 4YBZA 5CIQA 2EXXA 2VZ0A 4EA8A 1GG9A 3CKLA 2Y6UA 1P8JA 1Q2XA 2PD6A 5AK0A 1SRQA 1F51E 1KDOA 2R11A 2VXYA 2JCSA 4B3BA 4EB8A 4JV5B 4EYOA 2C99A 5IHPA 1H8HA 4FMPA 1LBSA 4DWVA 5IPFA 3LMKA 2I3DA 3ZZNA 4P3NA 7ABPA 4WCFC 4M88A 1YQTA 3EWAA 4CLOB 4QBIA 3H5TA 4X62B 2OK7A 3IBTA 4HSGA 3G1UA 2R2GA 1N2CA 4LEIA 3CR7A 3OOWA 3EZLA 2JATA 2PLNA 1EFRA 3PSFA 3NDIA 2RRDA 5REQA 1ORRA 2OQRA 1Z75A 2JLYA 2BL4A 2MHCA 1V4VA 2NO0A 2WV9A 4FX2A 1SVIA 3STWA 4BECA 3TLMA 1NIJA 1SC3A 4DXDA 3GG2A 4UPDA 3TOVA 4JI6B 5IKMA 1D4AA 4TL9A 4O6VA 4Q3KA 3ICCA 1KAGA 2J3DA 1IBRA 1ECGA 3RFFA 2G28A 3DULA 1DUSA 2QTFA 2BGWA 2IUSA 5K0SA 2FQ1A 5MF6A 3C5WP 5FIUA 3G8YA 4NE2A 1E3WB 1VMIA 1X14A 1QTQA 2Q45A 1XX6A 2ZS8A 2FCRA 1PTJA 1JDZA 4Q9IA 2HJVA 2XBUA 1X40A 1RXUA 5F1YA 2BM1A 3HS3A 3CT6A 1EUCB 2LZ0A 1M8PA 3OT1B 3ROGA 5A6SA 4BBPA 1Z38A 5HCIA 4LCEA 5EXDA 4GLFA 2WFLB 2YDYA 2JXJA 3RVSA 1U98A 3D2QA 4YCJA 2BBWA 1HYEA 1HTTA 1B16A 3VU8A 3KDSE 3PC7A 4PPYA 1KRPA 1IOWA 1UJ6A 4EEZA 3VDRA 1Z63A 3RH5A 2HA3A 1AK1A 3NO4A 2OM6A 5EE1A 1GG5A 1OFTA 2PMKA 1DTWA 4DJFC 3I05A 4IJQA 4G3XA 1ZU4A 3R7LA 4HEA1 4X6YA 3W9BA 3L6CA 4EHLA 4UPEA 1ZM9A 3ZCSA 2KYRA 1QLJA 3GW8A 13PKA 4PIVA 2HGZA 1I3NA 3L79A 2WHQA 4A92A 5H68A 2QENA 3OIDA 3I04A 4FMCF 5CG2A 3N59A 1V41E 3WL7A 1M8GA 1XNJA 4Y6RA 1U0NA 3ECAA 4O33A 4TT3D 3U80A 5A0VA 2R5WA 3VU9A 5HCNA 4KZPA 3ZU5A 3QKUA 2O3SA 4Q1AA 1BH6A 1UPBA 2Y1KA 4C0LA 2WAQC 4G5HA 3U9SA 2GBPA 1Y4AE 4DJEC 1OLXB 3PE6A 3O93A 4DR4B 2XCUA 2JF0A 1XA0A 3GCGA 3LZ6A 4G9GA 1G4HA 1Q5PA 4BBZA 2A7QA 4MLZA 3WKDA 3V4OA 4IV5A 4TQGA 4AXBA 4OIFA 2PZAA 3K9LA 4MVJA 3B1JA 1P91A 5K5EA 3AOEA 4C80A 4G26A 3FZGA 5ICFA 2OOSA 5DF1A 4L8GA 3B6JA 4FINA 4OI4A 4D6PA 2ZS7A 3A9VA 5CU7A 1G64A 3WGHA 3ACDA 1GP2A 3DWFA 2J9GA 5DX1A 3DKVA 4D0RA 1WMDA 2ZG6A 3ISBA 3NT5A 4XVCA 5F21A 3NOQA 2BT4A 3U13A 1VGRA 2Y9TA 1V8OA 4M54A 2OYRA 1QKKA 1KYIA 1H6DA 3HYNA 3VZRA 1NVXQ 4NCNA 3ZCVA 1GD1O 3H83A 3SAGA 4UJ5A 3NHWA 2A9KA 4UQOA 1B3BA 3F5QA 4A15A 5B7PA 3GIDA 8ICKA 1E3WA 2Q6TA 3SMQA 3VV2A 5IKOA 2BPGA 4LYJA 4ZV7A 1CFJA 1Z00B 1EUCA 7GPBA 3OT1A 5LCXA 1NVMB 4LBYA 4ZQBA 2WFLA 4CI9A 5KAIU 2HF9A 5K8UA 4ED1A 2VJQA 2PX8A 4ZVOA 3KKOA 3PBKA 2BGUA 3C2LA 4EG1A 3RQIA 3TQOA 2GN8A 5LYYA 2P1ZA 5C34B 4B3RB 1GT6A 2A7XA 5AKHA 3T54A 3EJ6A 2BCRA 3RBVA 4IFBA 2C2YA 3EISA 3TADA 4NRDA 2QOEA 3GN2A 3BT7A 1RDFA 1KH2A 5EI5A 1AQJA 3GFFA 1M5RA 3KTFA 1LQUA 1HEYA 4XFKA 2HOIA 1MEEA 2BGIA 1IUOA 3NP7A 3FF4A 2DFLA 5JROA 3HQ4O 3F8WA 2CV2A 3RTEA 5CTJA 2RJ3A 1QAMA 4QO8A 2WWVD 2ZPTX 4MUJA 3QUTA 1ED1A 4QNRA 3QU5A 1K9SA 1SBTA 1EA7A 5CNKA 1NW6A 3I9V1 3H3FA 5JLJA 1W76A 3HYRA 1OLXA 3MGKA 2HBJA 3IBSA 4LIPD 1BYIA 2R79A 4A03A 3GVCA 1CJSA 3MJSA 1JXQA 1ZN8A 3G2JA 2IU3A 4ITRC 4ZMRA 2RCNA 5JZMA 1T5OA 1EWKA 1GNLA 4NFHA 1BXGB 2N1RA 3LQ4A 1NMQA 4D45A 3BAFA 3DDHA 4DQ0A 1E2PA 2D2IA 2FW6A 4AKEA 1T1IA 1TAMA 4RH3A 2IYUA 1JDPA 1E1QA 1RYDA 1GL7A 2W7OA 3L8YA 1YS6A 2ODWA 3S68A 3WNCA 2J3EA 1KJZA 3IRUA 3PFWO 1JJ7A 2C9CA 1VPWA 3NJRA 1UT5A 3FY4A 4KRFA 3WRYA 3VSAA 5JRJA 1KRWA 1S0UA 4JXKA 2PMWB 1JG7A 3LF2A 1QNLA 3USCS 4PQGA 3T3DA 4WDRA 1NW4A 4B0PA 1H6AA 1I5OA 1J70A 3IPAA 3AM1A 4ARIA 2IODA 3CC8A 2JKZA 2CYCA 1Z00A 4BVBA 2NYAA 2WT9A 4YGXB 2EJCA 1XPOA 5JV5A 4Q34A 4DNOA 2NYRA 1WM1A 2P67A 2Q8NA 2XWJI 3HO8A 2P2NA 1UCFA 1IN8A 5JVDF 3RARA 2HRRA 4PG4A 5LNK1 4EJSC 3RSGA 1N1DA 2RLTA 2A0FA 3C7CB 3IE0A 4P4TA 1N8KA 5BW6B 1Y7IA 5ETJA 4NR0A 1ZQ9A 1IH8A 1QQTA 4GWLA 4DQKA 1SV4A 1MJGA 2IYYA 5A5DA 5DT2A 4M99A 4QHTA 3ZXYA 2QUBA 2OCAA 2R84A 2WZCA 3FGOA 4RY2A 2QRMA 3CLHA 4RQTA 5TQ0A 4FJ2A 2G9VA 3TTYA 1XQXA 1O6FA 2ARKA 4L0MA 4QL3A 3E5NA 3IS3A 4BP3A 1XCBA 2RFLA 1VCHA 1ZAYA 5AMXA 1FO4A 1ECPA 1J8DA 3E82A 5TPWB 1NLMA 1GYQA 3EXAA 3IEIA 2DOKA 3COYA 4ZGWA 4E1AA 4DA9A 3M6UA 4BGEA 2JGNA 3ZHOA 3SLKA 3U3ZA 3K6JA 3I9JA 2MTBA 5H83A 4BQPA 2DG2A 4P4GA 1PQYA 1LRJA 4RK1A 2XCQA 3SYLA 4MGIR 1BXGA 3DZCA 5KFYA 5DNAA 3CX4A 2QLMA 3KUCA 5HWSA 2C8LA 3R9IA 3UC5A 3AWDA 3O8LA 1Z37A 1KI7A 4CMHA 1RR6A 3HJFA 3ZZ0A 3LYAA 3FVQA 2O6LA 2IH4A 4IQWA 2QN7A 1Y8RB 1YIAA 1WS6A 3R8CA 3GEMA 1T4DA 3DKRA 3BQ2A 2VPXA 3QENA 4I5EA 2YYYA 2WM3A 3MD9A 3NNSA 3B60A 2DKNA 4HAYA 2Q4BA 1CETA 2G82A 5EQFA 5AJXA 2CEAA 2O6KA 2NX2A 4YJGB 2F64A 3WADA 2VSNA 3PUKA 4MWGA 1J2TA 1EH5A 1IHXA 4DILA 1FVHA 4TZ0A 5FTKA 2VWHA 3LBHA 4XWAA 4M4SA 3OF2A 2VDOB 2P4EA 3ZX4A 4RMHA 2NU7B 3GP8A 3OJLA 2DJ5A 1XNRB 1Y3HA 3CQ9A 3R5TA 1AKMA 3LGSA 1QJCA 3TCXB 1MX5A 2W9MA 4RD3A 3P4UA 2GLTA 1Q7RA 5L7YA 2FDRA 1ZJ4A 2CNOA 2NQ2C 4C0AC 4Q1EA 1OPRA 1EE9A 5HF9A 3QZ8A 3MDCA 2KSQA 4OJ5A 2EAPA 2YZKA 4DNXA 3CR8A 5EINA 3LWBA 2G36A 3OO0A 5KNBH 4JEMA 3ZNOA 3KSAC 4M55A 3HEAA 2JEIA 1ZD9A 1TI7A 1EUQA 1TMKA 1N2GA 3SR6A 4QICA 2FSSA 1ZU5A 4HH1A 4YPVA 2HB6A 4QATA 3TRKA 3OY7A 3PUYA 3G82C 1U4SA 2J30A 3MIZA 5TPWA 2B8EA 1MH1A 2W2PA 3K2IA 3TZKA 3PX7A 5KT6A 3H11B 4E4RA 6Q21A 3UA3A 1W4ZA 3AQFA 3TZEA 1RFGE 3OOJA 2C3MA 3W2HA 2ZJ6A 2DSNA 3G5UA 3KQNA 1G2QA 3D3JA 4BNYA 5EMHA 5JCXA 2C2WA 1ULAA 4BMPB 3LS2A 1MX9A 3T0IA 1XPRA 4B6GA 1K7XB 1ZGCA 1JEEA 5KG0A 4H35A 4OLFA 5I7OA 2PZEA 2Q7XA 4RXMA 2AC7A 3W05A 1EK1A 3MQ2A 3HWX1 1JMSA 3ZBTA 3ZVRA 1M6WA 3KXDA 1X1CA 1UK9A 3SLGA 1PD1A 1OZ0A 4TWAA 3JZAA 2OCEA 3KIPA 5ALDA 5C1OA 3L8FA 5LB4A 4V0KA 1Y8RA 4LXIA 2JHDA 4US1R 2ZTMA 1HFWA 2D5CA 3BL6A 4LJ6A 2R8KA 1YL7A 3L6RA 4MEAA 5K0EA 1PZXA 3A0RB 4XIJA 1BJKA 1ILWA 3MJDA 1RM6C 3IDOA 3DZHA 1J6UA 4AUMA 2G80A 4RIGA 4WINA 2ISPA 4YJGA 2QRQA 1VG1A 4HS4A 3KALA 2OCYC 3FOEC 3I62A 1Z06A 1PWYE 1KSFX 1P7YA 4IRMA 4JUBA 1AMUA 2KJ8A 2VDPB 3WWPA 2D13A 2XCTB 3D54D 2NU7A 4RK5A 4DDTA 1Q1GA 3WYDA 3ZD7A 3I2YX 1VYUA 4CL8A 4EBBA 4OJYA 3BGWA 4KREA 4PTYA 1JKFA 1QE3A 4UU1A 2UDPA 5AQ1A 1I2MA 1XFAA 5M7EA 3M8SA 4LBVA 1EVKA 2WSBA 4RPJA 4TYMA 2WHRA 3P9IA 3PZRA 2WF8A 1BA2A 1RSZA 3GLVA 2G1JA 3HKCB 5DW0A 4B0OA 4D9HA 4EG3A 5L3SB 4OJKA 4L85A 4KO1S 2B36A 5DXFA 4R05A 3WA6A 4CR8A 2CCJA 3WZ2A 3B9RA 5ENVA 3DP7A 2NAPA 4W9RA 4XJXA 3D6TB 2IHTA 3L8GA 3TEFA 3I39X 5AVTA 2I2WA 5FA6A 4IIJF 3PQCA 1JEAA 5CR9A 1HIWA 3PRYA 3CW2A 4UAWA 3H11A 2QT9A 3ZHQA 1C7FA 4F7WA 4R64A 2GFHA 521PA 2ZS9A 4MS4B 2FW7A 4HC4A 1LI7A 1L3CA 1T2VA 1X9GA 2PAFA 4A8JB 3JQ6A 2F3NA 1TUGA 1SXGA 1K5DA 1EBUA 3OMWA 1U9YA 2VG8A 2ZRQA 4ICIA 3V7WA 4IS7A 1USGA 2FGKA 1Z7GA 2K2QB 4U7HA 3KR0A 4AKHA 1NHWA 2PFQA 1JL3A 3ZGVA 1YGPA 2ZROA 4NOLA 1DQYA 1ZGAA 2HCJB 1FQOA 1G7TA 2NSJA 4HZUB 3M6FA 2CZGA 4C7KA 4DIUA 3U7EB 2YJTD 4B9MA 2YMPA 1V45E 4YJHB 2WABA 2E4YA 3V9AA 5F4ZA 2QV7A 4PV7A 4D9GA 1CLEA 4BHTA 4YMOA 3ZXIA 3ZV5A 2GRJA 2DY0A 2RAUA 1H2WA 4Y6PA 3KOYA 1REQB 4RTNA 4OXYA 4AMYA 3EDYA 4LJ9A 3UXYA 3ZQKA 1U7UA 4Y1EA 1H9AA 3G8DA 5EVCA 3PYLA 3INRA 3AZQA 3ZWDA 2QVXX 2CNWD 4V38A 2C2MA 1W46A 1Z6XA 1YB4A 4O59O 3GG9A 3NM5A 5J47A 3NI2A 3KSRA 3LA6A 3UJNA 3PXCX 2ACEA 4RMIA 3OCCA 1SB3C 1YDEA 4K87A 2YQZA 3LDGA 2WG2A 2E4XA 1JT9A 2CWDA 1D04A 3MR6A 5KNCH 3S99A 4BFLA 1R4NB 3A04A 4KZKA 2DQKA 1BZYA 3P0RA 1A5AB 1A5SB 3R44A 2BQRA 5GJWC 1W85B 3LT0A 3OQNA 1NXSA 1OXXK 3F3KA 1XKLA 4DUPA 4WZZA 3U3RA 3OF5A 4CTKA 1LDMA 4JI1B 2X6RA 4RSGA 1AO0A 4NYMQ 5JQWA 3BJZA 3IHLA 2K87A 4CIBA 1A77A 3MS4A 4FE3A 3C3MA 4JXJA 2I1VB 3RR7A 4A16A 2CBZA 3OC6A 5CVJA 2HHAA 5CD1A 1KYYA 3EY9A 5F9MA 4JOBA 1TTHA 1LB1B 2VOJA 4MS4A 4BMYA 4B4KA 1EPUA 4HGRA 4UHCA 3H4MA 2I5PO 1HUQA 2GKGA 2VOEA 3MW8A 2J6CA 5AW3A 3B8EA 3T7TA 1AHHA 3C6MA 1FJGB 2RGRA 2VJMB 3GDOA 5AJTA 3MB8A 4CT5A 4L5BA 4ZOEA 4F5WA 4JR2A 4OQZA 1Q92A 5AM2A 4ZDJA 4NC9A 3U1VA 1FDUA 1HE2A 2ZYSA 1IJBA 4HZUA 4WKCA 4YJHA 3E7FA 4WK2B 1IZ9A 4JUIA 1EB9A 1V1MB 1CY8A 2QSZA 2EBUA 2Q0ZX 3M5PA 1E1DA 2C8KA 1Z45A 2IEYA 2CV0A 1GQRA 1H8HD 2X58A 4AZSA 5JZVA 4BJ5A 3HXKA 1ZX1A 1REQA 4FFNA 5DSZA 1IQRA 1JKXA 2PKWA 3WSVA 3PUHA 1QH9A 3WAGA 4DRXB 1E6LA 3BREA 1T3ZA 1H0HA 2LE0A 3T5KA 4G5SA 2PCLA 4JLBA 3BC1A 3CLUC 3H7AA 3E35A 2GXUA 1VRCA 1E2UA 1EFRD 4ESVA 5HRAA 3I9MA 1EP1B 2GOLA 1TQDA 4CCSA 2XR1A 4IR9A 4BZXA 3TTXA 2C20A 3M82A 1DOZA 4B8WA 4CIAA 3ILVA 3R1IA 1L7XA 4P08A 2C94A 3UMFA 1V16B 2IOFA 2CK3D 1H0KA 2CLHB 3LUCA 3M5DA 1GAJA 4IPTA 1XZHA 2DCMA 3AVPA 1R4NA 1N0IA 2XE4A 3UK0A 4S12A 1N5LA 4Q44A 2QLLA 5F78A 1W85A 4WLFA 3T0GA 3WLJA 4IUDS 4M0AA 1N92A 3CWCA 4KUGA 2HT6A 3S7TA 1KYXA 3TQCA 5IW8A 4P7KA 3DOHA 2Q3CA 1MW9X 1XA3A 1BYUA 2HA4A 4OHCA 4DDHA 2JV3A 1RADA 3VOTA 2AD1A 4CM4B 2K8AA 3FSRA 1OWOA 3HLKA 1L5WA 4RCYA 5FX2A 1EVIA 2CYAA 4OQXA 3O1LA 4N65A 1OU0A 4KHPB 1EXDA 4A26A 5B1DA 1AHPA 4DA4A 4UDOA 1COOA 5KTPA 1IVYA 1JF8A 3ZGZA 4KAXA 3TVYA 4MW0A 2WWGA 1GTG1 4N3NA 3UKDA 1DZ3A 1J8QA 1ZCAA 4MPTA 4OGLA 4XYGA 1O08A 5I9SA 2GM9A 2VJMA 3EMBA 1KSPA 5KYKA 3K9BA 1T1RA 4EJ6A 1UODA 4EUSA 2D1YA 2JK0A 2CLFB 7MDHA 1AURA 4MMYB 4MHOA 3JAWB 2W43A 2D0PB 3VPFA 1I7PA 1MRNA 3EBLA 3U3DA 3O9ZA 3BHNA 5KSOA 2XMQA 3QX9A 3WVNA 2ZJFA 4MWSA 4NLGA 1ZITA 2EHJA 3DOUA 1JHUA 3GGJA 3ADPA 2Q0HA 4TWZA 4W6QA 2HXYA 1V1MA 3UJBA 3RM3A 1C7YA 2Q49A 3BXHA 1E2JA 4D9FA 2Z83A 2VHQA 3PNVA 2FEWB 1LTHR 1F4PA 2EX4A 1A69A 1GPJA 3TLXA 1DAPA 1YCFA 3C98A 3EPLA 3QYPA 5BSHA 3RH4A 1T9KA 4DRXA 5LZ2A 3WK8A 2LV8A 1SURA 2ZZKA 4Q9DA 2OQIA 3J81k 3RYFB 5LQRA 2I6FA 4MROA 4BX3A 2BI8A 3F3MA 3FNEA 4XJTA 2G71A 4LSGA 2I22A 4OMDA 3L7IA 2EOAA 1GSAA 4QBKA 3KQVA 2H57A 1WQ1R 3AM3A 2W2XA 2GPWA 3F7TA 1JI3A 4BP8A 1CY1A 2Z4RA 5J40A 1RPJA 3TD6A 5AESA 4B3CA 5MHTA 3AUFA 4WUTA 4UNQA 5CXUA 2JGJA 1V16A 4PPFA 2RB5A 3PD7A 1Q95A 4YS6A 4FBMA 2WIGA 2PSFA 4N6NA 2NT3A 4A5OA 4DBZA 1KN5A 1ULBA 4B9LA 2PZBA 1TRKA 2BY4A 1TXGA 3PA8A 3W3ZB 4NFLA 3UPDA 3NHSA 3ZI0A 4EMTA 2P27A 3TBFA 1SBQA 3HJNA 2C1EA 5D5HA 1EVJA 5DVZA 2P1DA 5FHQA 4OA8A 4XWWA 2ATVA 3BULA 3ILXA 1NG1A 3GYBA 1E60A 4RPKA 4TVBA 3PJFA 4CM4A 5C81A 5IXSA 4JL8A 5GAJA 3SVZA 3TQQA 2MSLA 4BZPA 4JS0A 3N6VA 5HRUA 4GPTA 4O4LF 5COAA 1EP9A 2VF4X 2Q1YA 1KJYA 1HO3A 4FR0A 4WNCA 4RHFA 3EK2A 2I4NA 2Q2OA 3WKBA 5CLLA 3LP5A 4QOSA 4X97A 4CMAA 2ZIXB 2W54A 1W6RA 1K7EB 4C43A 3RVKA 5IUKC 3RPEA 1PGPA 3OX4A 4UB3A 1JFTA 1GZVA 1X9XA 1FYDA 2FEOA 5EJEA 5AOCA 3JAWA 3H3JA 4XA5A 3IR5A 1QB8A 1FP4B 3FZYA 1XQWA 3G8CA 1KO5A 3OTIA 5AR1A 3H5RA 3D2AA 2YN2A 1F8XA 3IBFA 1N2BA 4ZAFA 4FQ8A 3W9YA 1SKBA 1T9DA 1GFZA 8ICZA 5CDSA 4V0QA 1TJPB 3AI1A 2IZ7A 2A1AA 1FTQA 3EDOA 2RHWA 3LE8A 3KJHA 3OLYA 2HHVA 2WAXA 3NNNA 5ULLA 4GDFA 1NYLA 3C7AA 3G7NA 5LQKA 2JGEA 2ZRJA 1KK3A 4URHA 5EYPB 3RYFA 4AC9A 3Q8RB 4KXMA 1FDSA 1W2GA 5K7SA 1QP8A 1NAIA 1XVTA 3CZCA 1U1DA 4ILKA 1RAGA 3BZKA 3Q8XB 1GG8A 2WZDA 8ICTA 2ONZA 3UAYA 1PFUA 1JR6A 4Y2JA 2GUWA 2JS7A 4KBGA 5C37A 2AXPA 2B35A 4JA0A 3UA4A 2MCFA 3LFHA 4J94A 1RM0A 2ATXA 4UTRA 1XTVA 5DBBA 1F4VA 4BEBA 2OY0A 2XODA 3NHAA 2D0DA 3T79A 3G2LA 2WVGA 4I2IA 2CY0A 3G9UA 4IIUA 4WK4B 2EF0A 1AXEA 4AJKA 3I92A 1RZUA 2GWSA 3KV1A 3DAYA 1VKOA 1E79D 4M21A 5DULA 4G65A 5IK2D 1U7PA 3SOPA 3RSLA 4HVLA 4TKMA 3F6YA 3PC8C 5H9WA 3Q5EA 1F2UB 3ISDA 4Q4AB 3UK6A 3F1KA 1BHJA 3ABQB 4FZ3A 3AHCA 2VJLA 4XSVA 1ONSA 3MMPA 3E5HA 4IMRA 4JWNA 4LS3A 1MAUA 2K89A 3UPQA 3BX1A 3JY6A 3S5JA 3V2HA 2MRLA 3G6YA 2DBYA 1Q84A 2ZIXA 3EGEA 4PLFA 2GF2A 4RF2A 2Q1XA 5A9SB 1VXRA 4M7OA 3TLEA 4YUWA 1M2VB 4UZFA 1ZGJA 5ALRA 2JZCA 3D4NA 3VO9A 1GPKA 4RT2A 2LP4Y 2GPJA 4RKFA 5A7GA 2WINI 3MGVA 1FP4A 1ZM3A 2ZB8A 3INGA 4ER7A 1FRNA 2I7TA 2BZFA 4TZ6A 3NR2A 1MAHA 4J0EA 2WIKA 1VCOA 2C4HA 8ABPA 1KE1A 1DEOA 1TYDE 1TJ3A 3ACCA 3TN7A 4FOTA 1VSTA 4R7ZA 4TXJA 3ZCRA 1NBWB 1CQPA 1H5QA 5JCOA 3MB5A 4E31A 5KAFU 1EX9A 1N9KA 5E3IA 4DJJA 1O4WA 5E2IA 4DQVA 4PC7A 1CJKC 4GM4A 3CYFA 2J3IA 1N5RA 3DL0A 4F5DA 3JQCA 4BN5A 3IAFA 5GIOE 3WK5A 4B5KA 4DJDC 5EYPA 5LBUA 1XMVA 3VNVA 1NQWA 5FL7D 3S2EA 3ZZTA 4NCHA 4HDKB 1TM7E 1EE2A 1ZCZA 1KTVA 4TV9F 4KO4S 4A36A 4ARCA 2PRYA 3SS8A 4B6PA 3WGJA 3UF0A 5TMPA 1LJ8A 1ID1A 2F00A 3JTEA 5TJ9A 2ORIA 1EUZA 1VI6A 1NBMD 3F5SA 3GXOA 5B57C 2OP0A 3Q0TA 1DSSG 1I9CA 4NE7A 5KVQA 4ASUD 4CG0A 2ZXIA 2P91A 3L6EA 2FMUA 2C7GA 3PDUA 4L57A 4EZIA 5K8JB 3EG5A 5AW9A 3LSTA 2CXPA 4JV0A 3OZCA 5DG8A 3MRTA 1UIMA 4P3OA 5B64A 4JFRA 1GLVA 3OM0A 4XM0A 3ZH9B 4PZLA 3O26A 2GH1A 1F2UA 1Y37A 3KZOA 4Q4AA 3II6X 1XYVA 1NYTA 3RUFA 3F4BA 3AF5A 5CJ2A 2FRXA 2F43B 3ND7A 1XWWA 5IEBA 3VPHA 3N75A 1D1QA 3W5AA 1N78A 3T4PA 3A4YA 5A9SA 1WKVA 3RQSA 5TPZD 3OE5A 1M2VA 8OHMA 2REQB 3WBJA 4KXXA 3LCMA 3MAAC 1S77D 4XUDA 3I5XA 3ZDRA 1K97A 2HBLA 1P5HA 4MICA 5IIKA 4K86A 3KETA 4DUGD 1Y9AA 1H65A 1F17A 2BSXA 4LG1A 3LNTA 1VE7A 1Q44A 2AR7A 3NTUA 4IKEA 3CT4A 1PJRA 4CWAA 2QTZA 5A9RA 1KBOA 2G67A 3KJZA 3OU2A 1P0CA 4G63A 4L3VA 3ELBA 4KMUA 1QGED 1NBEA 4B79A 2CMKA 4WX2B 3V2UA 2EU8A 1LC3A 1PS8A 3V5NA 1MTZA 4REMA 3KZ1E 4G97A 3V4FA 1LDBA 4E5VA 4RVNA 4EZ6A 3NDPA 2I03A 4N49A 3C2KA 1VMDA 2VPZA 3GMDA 2E49A 4HDKA 1U2GC 4Q6BA 2AFHA 1N61A 3CLTD 1SB9A 2O3QA 3QX7A 1Y5MA 5DHTA 3WAJA 1SKQA 1M0SA 3NALA 3E81A 1FVXA 4L2IB 2ASDA 4HXYA 1QV9A 1A8UA 2GCOB 5FI0B 4JDPA 2O19A 4LDRA 2FFHA 1AGNA 1N0UA 4PG8A 3IKJA 4BVHA 3BYZA 2HO5A 5HRCA 5JISA 1YB5A 3NXSA 4DXAA 3S81A 1XGKA 4PF1A 2BDEA 5ED4A 1AX9A 1XR3A 2WJAA 1G8MA 1Y98A 1PJAA 4DOBA 2D2VA 3CUEF 4KHZA 1LS6A 4X24A 2AX3A 2KVSA 2R68A 2CMFA 1S4MA 1FU7A 4C0BA 4A9AA 2P6OA 5K8CA 4TRNA 2YMQA 5CBPA 3R3VA 2XO7A 1AMNA 2WFAA 3HBAA 4I08A 2QJOA 4PVDA 1B0AA 2EBWA 5J58A 2ZB2A 4E70A 1TA9A 3ABZA 1KZ4A 3LRTA 3BTSA 1I13A 1FFDA 4TQ9A 1QG6A 2JHPA 3BMXA 1PQWA 4M37A 3KD2A 5KO2A 4LTNA 3VKVA 3OAAA 1NLUA 3IUSA 2A78A 2REQA 2Q1WA 1S2DA 4GXKA 4IL5A 4QX6A 2QVLA 3EVFA 4KFUA 2QI9F 1RXIA 5BPFA 4U6QA 4JLUA 1DQZA 3KKQA 2AYZA 3ZK8A 4Z4EA 3UPUA 2YOHA 4YRTA 2HWYA 4OK6A 3LU1A 1R0CA 2J6IA 5BUZA 1R8XA 2KBEA 1XBTA 3GZFA 4Q3OA 1ZQFA 5CMLA 1E89A 1T8YA 3GHYA 3LPAA 1LSJA 4TT8A 1L5GB 1C3XA 5EMKA 1LVGA 4KX3A 1QMPA 1DTWB 2HX1A 5DCLA 4LISA 4JYZA 3C85A 5B7NA 3AYZB 1JROA 4QG3A 1K8RA 1N2IA 1G2PA 3BIOA 2NLOA 3CMCO 3B9PA 2P9GA 2PHZA 4MO2A 1QO0D 4AS1A 1G5RA 1HLGA 3KFUF 3NTQA 1L3IA 1VMAA 1A2QA 3M3PA 4XOIA 1N9GB 3IV9A 2QMUA 2QLTA 9ICJA 2KIVA 5BVHB 3GT0A 2BKEA 4E88A 3VU9B 4DEYA 4NFYA 3EY4A 5CLFA 1H5UA 5LPNA 2AB0A 4KVGA 2QRVB 1Q7TA 2PUHA 3QLUC 4L2IA 1C14A 2CDRA 2I7XA 2GCOA 5KJFA 2R5NA 5F76A 3VBCA 1GPDG 3KR1A 1XRMA 4HQ6A 3RVPA 3DMPA 1VTKA 1PDOA 3LNCA 2MDTA 3K16A 4CQMB 3AEXA 2XWBF 2VRCD 4LCBA 5B1HA 1YK1A 1J39A 1FF9A 4Q4LA 5EJ9A 3T3IA 4GZ3A 4OFZA 3RDPA 2PUFA 2NO6A 3K6SB 3HPOA 2QGNA 4F71A 2OQ2A 1OFGA 3K1RB 2FUEA 4E5YA 3ZDXB 1N7IA 1UOQA 2F3RA 2I7DA 2RAVA 1WCWA 3R3YA 2VHYA 5SYMA 4UBIA 2YFHA 3CH7A 4N7MA 2RARA 1YZLA 4IVQA 1HFEL 3MCVA 2JFPA 4GECA 5G1PA 5E7JA 1P60A 3AUXA 1GSHA 4EJMA 4WJKB 4I8DA 3BH6A 4P7GA 3KVVA 5HR7A 4YQFA 2YFYA 4PZPA 2JIZA 2VHCA 2X3FA 3TBHA 4QJ4A 2CHEA 1YJQA 2KP7A 1KJWA 3SKYA 1MA3A 1UK6A 4RZIA 1JA9A 3HE3A 4ZO7A 1OD6A 1FCJA 2JD1A 1Q2UA 7ADHA 1PT9A 3SSOA 3ZVNA 3EXFB 2D2FA 2W8LA 1EEHA 1E59A 1HFKA 3K5HA 4QJ3A 1EDDA 3LK7A 4HYEA 5TQVA 2AE1A 2RCYA 2H16A 1U31A 2I33A 3ZXSA 1FSGA 4ETWA 2B1RA 3K3PA 1RABA 3UT0A 3LHDA 2Z7JA 1I36A 4QAJA 4OCZA 2ZYWX 2H08A 8ICPA 1T5IA 1T35A 4P2GA 1ZMOA 5I7WA 3R9WA 2CFOA 3RLIA 2L19A 1KAHA 4F4DA 1T5LA 4DOAA 4M0EA 3IEMA 3SC2B 2R7NA 1Z5GA 2VFAA 4UXHA 4LGMA 3D4OA 5KC8A 2Z5LA 2EL7A 1N9GA 3ZJ4A 2DC1A 4L5AA 1ZPDA 2BF4A 5JFOA 1ZOSA 1PVDA 5BVHA 2YW9A 2Y99A 2HF8A 4G1CA 3H1BA 2XB2A 2AF4C 4MGKR 5DKWA 3PNCA 4XXHA 4TWIA 2QRVA 4QPZA 5BWMA 1W9HA 2WSSD 2OYCA 4H6PA 3P2EA 5JEEA 1E9AA 1CERA 5EG5A 3OICA 1DIBA 4AUKA 1GTJ1 1J8FA 1ULHA 4TRJA 1G18A 5PNTA 4B9VA 5EQTA 4P83A 1P1KA 1VDMA 4I50B 1FRQA 2F4VB 4IV0A 3PD0A 3CXUA 4FZRA 4FC6A 2BCQA 3VFDA 4CQMA 1ADJA 4DJTA 5LQNA 1Z74A 3IB6A 3FLAA 3DHVA 1SV0A 2GESA 4CRXA 4CTOA 3J80A 3PCXA 3KEOA 3I6BA 2OO3A 4F2WA 3I34X 4QPCA 3K6SA 1S0NA 4GC9A 1U0GA 1IFXA 3PJDA 3UGTA 3LLVA 2WIJA 4CGZA 4EPVA 1V5IA 3VNSA 1V85A 4EL5A 2BH9A 3QPCA 4C76A 3I1JA 3TANA 1GWNA 1I0LA 2EIXA 4G89A 2IUYA 1J33A 3TFQA 3NORA 5EXEA 2JJYA 1DEAA 5EMMA 4Y9RA 2CF5A 1I7NA 1H69A 5JNLA 3BDAA 2VUTA 1VLLA 4O2AB 1ETHA 4YXFA 2J48A 2OG1A 4V03A 5H59A 4DOCA 4F2DA 1L3TA 5JAUA 1SUDA 2WBLC 1VOTA 1YVDA 4EJFA 3OE4A 1PK8A 3EXFA 2ZUDA 1NTOA 1SVLA 4EBFA 2Q6IA 4W8OA 2V7BA 3GELA 1J21A 1LD3A 2OFXA 1ZMBA 4ECWA 1IQ0A 3K1TA 3J7TA 2ZQ5A 2DUUA 5ALGA 1KNXA 4IDGA 1N1EA 2EV9A 4TTIA 5KAPA 1FA9A 4IWXA 2H7VA 5FORA 1E4OA 1N3BA 2GM3A 3DMGA 1JAXA 1ODLA 3QBTA 1B0ZA 2A5FA 2ZYIA 3UWDA 3SC2A 1ODIA 1S7CA 5KFJA 3OA2A 5TQ0B 3TMYA 4Z0NA 1ZQHA 5F77A 3ONDA 2W2MA 2X7HA 2DH5A 4AY2A 2XDAA 5SYAA 2C5AA 4ZHQB 3DMRA 4FD3A 1VLJA 3PDHA 4IZ6A 2FR0A 3VC1A 3PFCA 4CM6A 2BFAA 3PEVA 1XSPA 3RABA 5JR3A 1X6JA 1YCHA 4II3A 4G1FA 3EH1A 1C80A 1HY3A 2PMFA 3CH6A 1P2BA 3PEFA 3IL2A 4I50A 1FSSA 1HDYA 4Y2RA 4B7AA 1F0KA 1W4RA 1XHLA 3AHHA 1X2IA 2OLEA 1BX0A 1G9TA 4KPYA 3IH5A 3HV0A 4G3IA 1X7XB 4ZVUA 4X7RA 2OHHA 1M9NA 3G1TA 3LHSA 2ZBPA 1INLA 3QMMA 4F72A 2UZAA 4FKMA 3RRYA 2O3UA 1M7HA 2E4ZA 3TLBA 3A2LA 4D9JA 1A5BB 1Z4QA 3TGLA 1NXQA 2ZDQA 4GI3A 4FX5A 5EPUA 3THWB 4XIYA 4KV7A 5K2OA 4Q21A 5L9AA 3CB2A 4PR3A 2BC9A 3SQIA 3HB9A 1YJCA 1OOEA 9ICBA 3DB1A 4YXWD 1TEXA 1ABBA 4RIFA 2UUAB 1CQJB 4O2AA 4AO8A 4PTZA 4YAEA 2GYWA 2XIJA 4V02A 2EZXA 3LF1A 2ZATA 4TWRA 4KMMA 2IHZA 4HQ0A 3N2GB 4ZZ2A 1TT7A 5JADA 4BNFA 5EIOA 3DXYA 1WXEA 1SHTX 3UJDA 2JH7A 1MAWA 3GLFB 5EE0A 2JFQA 3ZTYA 1JPVA 1QHGA 3JR3A 3NDJA 4E15A 4QFMA 1MT3A 4OBXA 3U2QA 4A6XA 3KPWA 5BR8B 3MK31 5CA1B 4I66A 2C88A 1HF3A 4TL8A 5JXJA 1TYEB 5B5SA 4X7BA 1YI8A 5CDFE 2NU8B 4YY3B 4HX5A 1OMOA 4MUBA 3H4BA 3HFJA 2A3RA 1XMSA 4DARA 2DQZA 1YRWA 4KQWA 3OECA 4XZ3A 2EQAA 3KEQA 2PH3A 3ZWYA 1L7PA 4G0XA 1CV2A 2IYRA 3RWOA 4NJEB 1V4NA 4URUR 4KIUA 2XVXA 1X8JA 4JJ7A 3AHEA 4FGUA 2VDMB 1Q3TA 4PC1A 2R85A 2YNMA 4FGZA 4BFXA 4ZHQA 3OFND 2MMCA 2B9VA 5I9IA 6ADHA 4FBUA 5EZ5A 3LDFA 3FN4A 2DLCX 2HFKA 3UAGA 4X1IB 4M04A 2H7YA 1TQ2A 5HQ3B 5T41A 3OO1A 1MNQA 2QB5A 3JSXA 3PK0A 4FOPA 4B09A 3AVTA 2QNIA 3HSSA 3K8YA 3OTOB 1BOOA 3OZUA 1ZVMA 2Q21A 2QS9A 2I2CA 1TF5A 2ONYA 1X7XA 3LG2A 1YS1X 3O84A 2X7XA 1LQTA 3WYAA 2OHXA 3MT9A 4R8MA 3V80A 2FZVA 4GMFA 5LLDA 3E9DA 3G2QA 1Q12A 3ISVA 3RRBA 4YO7A 1JBKA 4IXDA 5CGZA 4D79A 4FE4A 5H9VA 1PJ3A 3THWA 4PN7A 3QYFA 4B6FA 4AO6A 3VU0A 5D3QA 2VJYA 1E7SA 1T5SA 7ICTA 4YR7A 1D2CA 2E21A 2Q6OA 2PSEA 2YHUA 4LRWA 2GZDA 3HRDD 4MV6A 4CF3A 1CQJA 1Y9DA 4INAA 4A3SA 4TMFA 1XD8A 5HOQA 5KFVA 1TJ5A 5B58T 3N2GA 1DXYA 5LQMA 3MJTA 2W7TA 2NPOA 1QR6A 1ST2A 1L3VA 1GNTA 1HTBA 1ZUWA 1YZUA 3GLFA 5DB8A 4BN0A 1UK8A 1A9RA 3INNA 1H9CA 5EJ4A 4WOCA 3OJXA 3Q3JB 2G17A 4WE3A 4AIIA 1WULS 4DW8A 3PVZA 3WGQA 3GLGB 2IYXA 4CM8B 1K6MA 2PX5A 2Q0XA 6CHYA 5CCBA 4AYTA 5CA1A 4AI6A 4PGYA 2WTBA 3S70A 2FAXA 2W22A 3QHQA 2PYZA 2XB4A 2G6TA 2NU8A 2HEIA 2ZB4A 4QWEA 5ALYA 3C1TA 3H5IA 5ALTA 1MN6A 4W8HA 1P81A 3QMPA 1BVYF 2KFNA 1W36D 3BQ0A 1B1CA 5EPEA 5CPBA 2P65A 2VTDA 4NJEA 3BFKA 1KZYC 3WYCA 5FLEX 1NW9B 1W581 2BGNA 4OHXA 1BGXT 2DE0X 3DMTA 4LI3X 1PUXA 4E2ZA 1PGQA 1JG4A 1RXVA 2JVIA 1DOAA 1YDFA 2KI5A 4DQXA 1FU8A 1NW7A 3U1BA 4X1IA 2IZZA 5KIAA 4Q16A 4OU5A 2QA5A 3OPVA 3ZD9A 4OVKA 2XBMA 5HQ3A 4M83A 5KWSA 4X1YB 4LY9A 3JYQA 2AKEA 3ICEA 3PHJA 1ZIPA 3WKEA 2L2QA 5H4GA 4QGFA 2VYCA 1AZSC 3IIEA 5M2QA 1A3CA 3MUEA 1S8NA 5ENZA 1IHYA 2REOA 3TH5A 3ZWMA 1VDZA 3HN7A 4KKXB 5AI4A 2NWQA 2IA5A 4ZCMA 3O9VA 2VVTA 3E53A 2H31A 1HE5A 2R00C 4DLNA 4NYIR 5FQNA 2QP3A 1U3DA 2E0IA 5COQA 2XIQA 3FPJA 4ECSA 3AYXB 4DG8A 4M9QA 2ZI3A 1DC4A 1JEJA 5T6MA 5HHHA 2PMZC 2LPMA 2B6NA 1SGWA 5C53B 4LMPA 1H3EA 5K4LA 4ZGGA 1CD5A 4XRHA 3HBJA 4PAMA 1CUBA 4UBLA 4QUEA 4XYMA 2W48A 1ZQZA 3UOWA 4Y2PA 1U2ZA 4QHYA 1RYRA 5C5IA 2KFZA 2WP8J 5FL3A 5CYGA 1GAXA 1KDYA 3TINA 4B3GA 1M2GA 3U4QB 1Z29A 5JFTA 4NK4A 2HLHA 4UNPA 2OCPA 4AX8A 5ARDA 2W9AA 3FWNA 3GLGA 4CM8A 4J6FA 4Y9SA 2OESA 3V6HA 4ND6A 3MAJA 4GLJA 4ZI7B 3PT5A 4JOCA 5CYPA 4MVJI 4US0R 3NBMA 1BGWA 1FDVA 3BWCA 3RBXA 2YIJA 2OAGA 3SM3A 4R2XA 3C48A 3ELUA 5BT9A 1ISFA 5JYEA 1QFXA 1IMJA 2IK8A 2H3FA 4M36A 3NANA 2LR0A 3GP3A 3QZ7A 3JPOA 2V98A 4ZHSA 4RFLA 1U2SA 2IYVA 3A1VA 1EFHA 4QECA 1GGFA 2FRVA 3C3YA 5CX4A 3U17A 5KTQA 3CPJB 3PPYA 4PLTA 1TTQB 1OAAA 1E6UA 3WIDA 4ENTA 3GPLA 3IURA 3KKLA 4KLEA 2QG4A 3IUEA 1S4QA 4M87A 4ZI3A 3EDQA 2OHIA 1ISSA 1R4MB 5KTNA 4AG3A 1C7EA 2QVBA 1CUDA 2ZYTX 2ODQA 5J0XA 3GH1A 3A2KA 4X1YA 5J23A 4HBGA 2BH2A 4AYBC 2YTUA 3ET5A 1BN6A 1TECE 2HZBA 1IXRC 3ORQA 1Z6AA 4DM4A 4RTLA 1WYGA 2HDOA 4EDHA 1M34E 4C3OB 2XTJA 1XQVA 5AXAA 4IG9A 1UOEA 2LCIA 1XU7A 4WCFB 3H2IA 1ZD2P 4XRGA 2GI4A 4I6JA 4R83A 4ND8B 1B1AA 3I52A 2C2DA 1YZGA 4KXWA 4Y18A 3VNRA 2G9QA 1D6SA 1GQYA 3D1VA 2H2DA 2WWXA 1CRWG 4DMGA 3U3OA 1XTSA 4B9NA 1E0AA 2Y0SF 3S5UA 1H4VB 3WGKA 1Q83A 1ISGA 4TXNA 4DEXA 3HUTA 4GBJA 1C3LA 1DB3A 3BZBA 4UUMA 5DI9A 3AIOA 5EWMB 4ZYLA 4N5DA 2GOYA 3N5CA 3VYSB 5HXAA 4PC2A 4ZJUA 4M9RA 1NUTA 3IOCA 5D87A 3LPNA 2BCEA 3TLKA 3D5EA 3EFBA 2M2IA 1RE1A 3GLTA 3U4QA 4BE7B 3TSAA 4GVXA 2VF5X 1CY4A 1YI0A 3LY9A 4QYIA 5C32A 4REOA 3LVWA 2SNIE 2HPZA 3UVEA 3T7DA 1MZPA 4B71A 1G8KA 1SQFA 5BV0A 1WPXA 3CS3A 2HRDA 3LJKA 4ZI7A 3BK1A 4YRGA 4X3OA 4FFVA 4G23A 5EXPA 2ZIAA 2CJWB 3PDIB 3FR7A 5ICSA 3OQ6A 1DGQA 5EWJB 4LV6A 4LE2A 2RQ5A 1T2DA 5K09A 1WMFA 2VR1A 4KQ1A 3DZDA 4QXAA 2FMXA 1R18A 2NTJA 4OQYA 4HXGA 4YT4A 2PX0A 1R8SA 3K20A 3EG9B 3CLRC 3LQ1A 1JWAB 4UC0A 4H3HB 4S2EA 4QODA 3PRHA 4KEAA 2OB2A 2EG9A 3WS7A 4DCPA 5LFAA 4BYGA 4B32A 2CNDA 3NWBA 1IY0A 3IHQB 1BQ3A 3PTAA 1U3VA 3E4DA 2KWIA 2HLPA 1R4MA 3CG0A 1O87A 2XD9A 5EQDA 1NP3A 2VYFA 4YRKA 5BMVF 1LA2A 1NF3A 5DX0A 1BVUA 2FEKA 5LZ5A 2W0MA 3NVYA 2XSZA 1PR3A 2WNIA 3OVMA 1YE3A 1G41A 1M8JA 1ZK3A 2VDJA 3ICQB 1RNLA 1H2EA 5FR1A 1XJWA 4BXOA 2GT1A 5AUOB 1UMDB 2LXNA 2P35A 3SDBA 3M89A 2XE6A 4F8JA 4WCFA 5F7ZA 3DDUA 4L0DA 3FTFA 4ND8A 1ZD4A 3BGSA 3C6YA 1E1YA 5D51S 2QP4A 2A19A 4JJGA 2Z30A 1OTXA 4WAUA 4WLOA 4C88A 4MHTA 2IS2A 5K3FB 1U0RA 3HDQA 2I8LA 2B98A 2UKDA 1ECJA 2CFTA 1SKRA 2B21A 3ROZA 3WQSB 5FAXA 3KOWA 4BQRA 1B00A 4U6NA 4ZK2A 4IRKA 4RU9A 3KYJB 4RHEA 2BONA 1RCTE 3GQVA 5EWMA 5IBQA 1WTCA 2Y4NA 3MJFA 3M6IA 1S1MA 4NQRA 2QX7A 1HDXA 2IELA 4AG6A 4NX2A 3MGBA 4NJ8A 2AZ4A 2MSWA 3QVXA 1Z17A 5IH3A 2RC6A 2JNWA 5LQDA 1UZAA 3ETLA 1XHFA 5IM4A 1R9GA 5JMPA 4GBGA 3VHLB 4BMOB 5DXAA 4B84A 1TAQA 1A2OA 4TUYB 3FFWA 1RWOA 2XYHA 3HM2A 2CJWA 3P27A 3OUUA 2PMCA 3PDIA 5JO9A 3O7MA 2R66A 3PQDA 2HJ9A 5EWJA 1TK5A 1QFMA 2ZBQA 4I2VA 3L7CA 4JVNA 3DHYA 2WZQA 4X63A 3C3AA 3CRRA 4C7VA 6YASA 2GFIA 7ICQA 2VPQA 4RVSA 3QUSA 4Q7LA 3PWKA 4ZU6X 2QARB 4I19A 4DA0A 1MA0A 1E1NA 3EG9A 1GQQA 3AOGA 3DF7A 3RAFC 4L08A 4C0HA 4RBNA 2EKQA 2CFRA 5KT2A 3ONEA 4D8YA 3AX6A 2RGWA 3GCZA 3EVAA 5BOSB 1N5DA 2AN9A 3QE2A 1T4CB 1ZL0A 1NUUA 1ZJNA 2PUGA 4CV0A 5BT8A 4B6QA 2Z08A 1UQVA 1XKXA 1GM5A 2WZBA 3SY8A 3KQWA 4GKVA 5EP1A 4QPNA 4AN0A 4AWXA 5AM5A 2ZCUA 3H6HA 2XT6A 1SM4A 4RENA 4KN8A 5C8YB 3OCUA 4NULA 9ICQA 1WV1A 1RVV1 3O94A 4H17A 4Y2YA 3UZUA 3V1UA 5BO5A 5G0VA 2OD7A 2J07A 3B1XA 1N77A 3RO7A 3M9WA 1UMDA 1F48A 2Q2VA 5I7UA 4WH0A 3D4IA 4IIFA 1MV5A 5ENDA 4OB6A 5CB6A 5KKCA 1DO0A 3W1VA 4DAEA 4M9ZA 2PL5A 1SO8A 2ZJAA 2IXBA 4FFPA 4NL9C 3N3BC 4LMBA 4UE3S 3IMKA 1RXWA 3RUHA 3PLRA 3ROEA 5D3ZA 5K3FA 4DMMA 4DREA 2J41A 1KZHA 3JQEA 3KT3A 4L9RA 1D2HA 1Y3CE 4DF4A 4B1FA 2YASA 3BCRA 4KLCA 3UANA 1OH6A 5F2EA 3FMGA 2MSDB 5L8VA 1SKWA 2OBFA 4FGWA 4X54A 1X7ZB 3DR3A 3RC8A 3PKIA 3Q8KA 1Z8FA 2PWYA 1P9NA 4FOLA 4E3WA 2HBYA 3FI0A 2HBRA 4PSAA 4MVJD 4I4IA 3ANLA 3FCXA 4C06A 5DGBA 4P93A 4QBTA 5KTOA 1GJRA 1VJRA 3L4PA 1D6NA 1OJ7A 1QHSA 4FHFA 1FVOA 4TUYA 2NTEA 2LPEA 4KKVA 2KSOB 1QHHB 4AB1A 4MVWA 4F2PA 4PX2A 2KHZA 3EODA 4Q5IA 1YS2X 5SY6A 5HFJA 4N0MA 3AR9A 1YU6A 4JYPA 1C8VB 5DCUA 8ICNA 2L0XA 3VU1A 5KVAA 3W6ZA 4O5CA 4L3WA 2QARA 4U00A 3SYMA 4MX8A 1EDBA 4AJHA 4EJSB 3HCNA 1M0WA 2QBYB 2SBTA 2GUGA 1KKUA 3EPHA 1MB4A 3V9PA 4G4SP 4V3BA 1MO3A 5BOSA 3GC6A 3ZW7A 1T4CA 4MKRA 1UBKS 4Z0PA 1WXFA 3T1TA 3HN6A 3FWYA 5JRDS 621PA 1FUYB 4GLOA 3QOWA 2QRZA 2BP7B 5H4HA 3IOEA 5C8YA 4ENPA 3N2IA 3CUWA 2W5UA 4LCJA 1BVSA 3T7IA 1AKVA 2H1RA 4RU1A 4N9QA 1QONA 4MFAA 5AKXA 1LI5A 2C22A 1S3IA 3FSEA 1MC4A 1V8FA 4HKTA 3DE7X 3HYSA 3CO0S 2ZPAA 1RHUA 3CX3A 2XA2A 4G8DA 1YB1A 3RJMA 1K7YA 1BKDR 5MFZA 4A4DA 2B5WA 3V8NA 3RFAA 3VR4H 2B94A 4NNPA 4QA9A 2VN8A 3ASZA 1QBGA 2EKPA 2J46A 4NNOA 1XTQA 1E99A 1EVLA 4ECRA 4QZBA 4AKTA 4YBRA 3VGPA 2BR3A 2E6UX 3THRA 4RPLA 2I6SA 4IIBA 3M3DA 1FFYA 5DHFA 5G4LA 1RWMA 1X7ZA 1VPLA 5IIMA 5EJ2A 2IY8A 1OBVA 3PQEA 3EARA 1IXKA 2YQ5A 4DKJA 4CLEA 1ZOLA 4BGDA 3A37A 3T5MA 4UHBA 3OD5A 1NK7A 1NATA 4P4OA 5HQTA 1JTFA 1AHIA 5D3KA 3PI7A 5JYDA 2FWAA 2AEJA 1VLQA 2RD2A 1XRQA 3MYRA 2KSOA 3BXPA 1QHHA 3K0FB 5A3QA 3E9RA 3BD6A 1E1QD 2LYHA 4DQIA 3FIJA 5FPPA 1BS2A 2G63A 4PZCA 4A5SA 4R1PA 3ETCA 4WXHA 1HQDA 3PQ4A 3T7CA 4D99A 3CVXA 2PUWA 3FYDA 1LBEA 1SUPA 4DDMA 5EHXA 2A8YA 2GEUA 4EJSA 2QBYA 3U4HA 1U99A 1XQYA 1I10A 1YE8A 1FLNA 2Z5GA 2BHNA 3Q3EA 3K0HA 2GXAA 3RR2A 1PT8A 3HHEA 2GR9A 1TK2A 2Y2UA 3GI1A 4DV1B 2CL6X 2NRXA 4FMBB 2ERYA 1RYZA 1KEVA 2DM6A 1FLAA 1SH7A 1DIOB 2BP7A 3U61B 4YAJA 2HA6A 3F2DA 3K2EA 2EZUA 4Q12A 4E09A 4K40A 1RWPA 2JH8A 1DTEA 3O8RA 1UBJS 1JN3A 2OLKA 1DINA 4Y8VA 3KP1A 4KU4A 5CFNA 5IWAB 3AETA 3ETJA 1KEJA 3HDHA 2HM7A 4OMFG 1G20B 8ICQA 5LYJB 3PLNA 2H9YA 5GADl 2EDCA 5C7YA 1ML3A 2IYAA 3UOAB 3D7RA 3EA5A 2PYDA 3IPCA 3AI7A 1KP2A 2HHQA 3O4HA 2AXNA 5EWLB 3K2BA 1NX9A 4GC6A 2CXNA 3MJHA 1JVSA 4J8PA 4KWEA 3RK0A 3TQTA 1KFSA 2BFPA 2HMAA 1YZTA 3BTOA 4TN1A 3OZVA 2YNMD 2BUAA 4DIBA 4GQIA 3S44A 2QD5A 3T5LA 2Z2JA 2PV7A 2IYNA 3A0BU 5MGBA 3V7KA 2C9ZA 1RBYA 1F06A 3I6YA 4NATA 4GOLD 4UEWA 3OJUA 1SQGA 4UCWA 1D2EA 2H7CA 3E9NA 4QUGA 3D81A 3RS0A 3OZFA 2XZLA 1H94A 5AJVB 1UAYA 4Q03A 1QYDA 2Z8YA 1MC8A 2QRLA 2QL5A 4BWFB 2VEOA 4YK7A 1GKYA 2P9YA 3DOJA 4LK3A 5JS1A 4QGHA 2AFHB 1SUAA 3FM9A 5D5QA 2JLSA 4GICA 5ADWA 4XM2A 3WJ7A 1GL6A 2VQ6A 4CFSA 4PO1A 3NMUF 2X40A 3MM4A 4EUNA 3WGMA 1P80A 3C29A 4GGOA 4Q6WA 1W59A 3K0FA 4LK2A 3QI7A 1OFVA 2HRQA 3U60B 4C6TB 3UFBA 1NRWA 5LQSA 4MQBA 5D01A 3SJUA 4LE1A 2OP1A 2QMYA 1SXJC 3AEYA 2YXBA 3GNTA 3NV9A 1DKQA 1H2BA 3IMGA 4EM6A 9ICFA 2MINB 3AHJA 3R5JA 2C3UA 4PXAA 4NBTA 2W4IA 4R2IA 2IEIA 2CE7A 3LGXA 3SBOA 3Q11A 5CBPB 2NUPB 1EIZA 3B3AA 4UTXA 5JAOA 3OWHA 1CUYA 2FGJA 3F8SA 4BKQA 1XB2A 1WHTB 4C2AA 3SZ3A 2B92A 2A57A 2YWFA 3H1AA 2JCVA 3U7RA 3TDNA 2VXOA 4RUAA 3R76A 1Y3IA 1CDZA 4JBYA 4OTZA 4S1OA 5B6IA 4CKXA 3FPEA 4YRPA 2PRJA 1G20A 5LYJA 4JXZA 4BKMA 4PPXA 1EKXA 3ETDA 4Q7QA 2EX0A 1M6NA 4HMQA 2H65A 3SLRA 5DYYA 2ZBDA 5ESRA 1X3LA 3T61A 4QLAA 4HRVA 5K0GA 1C50A 2VBFA 2YIVX 4D4GA 5EWLA 3ZG6A 5D5PA 2OT3B 5E95A 3IUNA 1RZRA 3IALA 4FC7A 1Z6YA 1R0ZA 1L5RA 3ZS8A 2JGKA 4RVFA 2ZWMA 3PB3A 4N01A 3OZSA 3GDHA 1BNOA 3CEPB 4FDAA 1ZKDA 2GHIA 4C2TA 3TL3A 4AIRA 2VSFA 2IX9A 5EIHA 4JLSA 4GMHA 2VTBB 2VJ4A 4HR7A 3DJYA 3KHTA 1K6EA 5HF6A 3JQAB 3RC7A 3FLBA 1YQWA 1XC7A 4OREX 3WHLA 4CETA 1QPGA 3SS7X 1DG9A 4PHHA 4UHDA 2A1IA 2GQ0A 3S2FA 2DUYA 4Z8XA 1QZZA 3U7HB 3GRZA 3BJEA 4BCCA 4EECA 3QXJA 5KCMA 2ODBA 4GMKA 3ZWKA 2NZYA 5BQFA 3TF5A 1JPUA 1UBSB 5B7QA 4C6TA 4UBBA 3A28A 1WPQA 3DE1X 5CLIA 3K4QA 3WZLA 2PKQP 4N40A 2KX7A 2V1UA 1YB6A 2RGDA 5D86A 2FZKA 4PO3X 2EF1A 1VYTA 2ZGVA 2O7QA 1YQQA 4ZCIA 3PU6A 3QKWA 4DL3A 1NJWA 2MINA 4CM1A 2J6BA 3FMOB 4N7BA 3S2IA 4INZA 1GUDA 4PQEA 1G21E 1P0IA 3L8HA 4GSKA 1X9WA 3HXPA 1OFUA 4JLPA 3RREA 2ROQA 2QTTA 3UATA 2NUPA 3PW0A 3Q12A 1FMJA 3REFA 3B89A 3KD3A 3N7UA 5KINB 4N6GA 1WB9A 1WXIA 1BRTA 1WHTA 5IDYA 4AJNA 4W9NC 3OPYB 1VXOA 2WU1A 2D2XA 1I4TD 4NAHA 2N47A 1KI2A 5DMXA 1Z6PA 3GAFA 2ET6A 3V32A 3QP9A 2GTPA 1ZLYA 3KL2A 3V00A 4P4LA 1XQ6A 1CEEA 4FNMA 4AF8A 1KQGA 1K6XA 2DQSA 1AS2A 2ESRA 4J43A 3M34A 3HMKA 5KU1A 2JFOA 1A2BA 1X7DA 3FC4A 4BX2A 1RC0A 5EL0A 4JJ6A 3PX3A 4OAOA 3O4FA 3BHIA 3TTUA 5F9NA 2A33A 1JR2A 3A6FA 3T4XA 3U4CA 1JHRA 4G8BA 3MXTA 4Z6FA 3K70C 3TFOA 4DXHA 1DAFA 4ZI2A 4HJXA 3CG4A 3KK0A 3H8WA 3FFAA 3RGGA 2PO7A 2C7RA 1G6Q1 3RFXA 2ISOA 3D3KA 3TEMA 3KUXA 3X0DA 1ZUIA 1Y0BA 4G9BA 1IUNA 1SBIA 3DP9A 3MJ4A 3X43A 2UVRA 1UJBA 3H8SA 1SZJG 4M6WA 1Z56C 5F4BA 2RHBA 2VTBA 5LOVA 3L7BA 4IQGA 1ZJZA 1N3YA 2FPGB 3HA5A 2VTEA 1LLFA 2WTXA 4IF6A 3JQAA 2ZUSA 5HF8A 4JELA 5DSTA 1RHQA 1PS9A 1C0PA 1VJTA 2NTVA 2ECKA 2Q6KA 2XLBA 3FTCA 4BAUA 2DTDA 2NTYC 2I99A 1PP4A 1PWXA 1GRRA 5FTWA 3OBBA 2PLWA 1X1RA 2PFKA 1X1QA 1P4GA 3HCEA 4RQMA 5JSZB 3LWNA 4LJ8A 2IBTA 4NOJA 4P38A 4JL5A 1YRLA 2JIBA 3GJQA 4S35A 4WBNB 3OFVA 1QP0A 3L0DA 2WF9A 1ZLXA 1UPUA 3HFSA 1U7DA 5ITVA 1JEDA 4EG6A 1NQAO 2XQKA 3NEJA 4PLYA 4F8EA 3A4TA 2YMMA 1WWVA 3PLAE 3NXKA 3R0VA 5M29A 5J29A 4J9QA 1XTZA 4BPBA 4NU8X 2P78A 1P62B 2G4VA 2VTKA 3GZ4A 4R8RA 4M98A 4LVOA 3U4IA 4QTUB 2H5XA 4B73A 3QHAA 1X92A 3FGNA 3OPYA 4KDEA 4QLBA 1RRPA 5EJGA 2DFPA 1P7ZA 4J9OA 1NJ8A 5GIPE 2DKFA 3FTEA 3U7GA 3LOQA 2C98A 3RHTA 2IZ5A 4TL7A 1WWKA 3I0ZA 1X1DA 2W3SA 3BWVA 5JECA 5E0KB 5T67A 1QIFA 2IEDA 3WYBA 5KNLA 3FPHA 4B6SA 3IGFA 1OFHA 5JJLA 2JFGA 3G6KA 3H9JA 2Q4DA 1KMCA 3AONB 3E70C 3EA4A 1A8SA 4QWMA 2FLLA 2ZR0A 3U7JA 3WOVA 4LWPA 3QE9Y 4H3VA 4GLLA 4HNAB 1B74A 2VK2A 2X2FA 3V8BA 1J1UA 3JWJA 4NG4A 2EG5A 4R0VA 1WDMA 5KYYB 3QXSA 4Z6DA 4DSFA 2ZRPA 3GJ3A 2EIHA 4C5CA 3BHJA 2FW1A 4H1UA 5J2CA 2Z5VA 4Q9AA 1Q1EA 3THYB 2VSQA 1W6UA 4FD2A 2PCJA 2FPGA 4JYAB 1ONPA 2JRCA 3HILA 1MQ2A 4Y7CA 1LSOA 2FQYA 4IXWA 2WOOA 1GDDA 1P2GA 1O9BA 4LZNA 1GRCA 3ER9A 4NOKA 1GQSA 2XSZD 4URXR 1ML4A 1FNSA 4CDNA 4DTCA 2LKDA 1DKRA 1NQ5A 3LX4A 3FCYA 1UC8A 1YDWA 3I6IA 3RYHB 1I0IA 3GRFA 3PV8A 1V1JA 5DHRA 1RBZA 1DDGA 3WBBA 2ICAA 3N8HA 5JSZA 2VP3A 3AI2A 2PMBA 2QPLA 4WBNA 2UVDA 1HDEA 2QX4A 3EWSA 3PNLA 3EDMA 3RS2A 1XHEA 5HTKA 2GRAA 5AI6A 1T0BA 3IJEB 3K1AB 3OQBA 4GOJA 4NMXB 2QTMA 4B9SA 4V0LA 4QFBA 4C4AA 1RI1A 4Q3AA 1OX5A 1XDSA 2XCIA 2BSQA 4KI7A 1TDJA 2LRHA 4F5ZA 2GAAA 3IQXA 4C78A 4MWDA 1KAQA 4YHHB 4KLLA 3L06A 3KTAB 2QM0A 1Z3IX 4OHMA 1G19A 4D3ZA 2HIMA 1JSZA 1P8AA 2ZJZA 1NU8A 1QF9A 1KY3A 4GL2A 4NDZA 1MIOB 4AN1A 1T9CA 1JJFA 3GGDA 5G40A 4EFNA 5C4GB 3ZW8A 1XQ9A 3NCTA 2DLNA 1AG9A 5H3HA 2FPPB 4UAYA 4E5SA 4YRLA 1R15A 5B30A 4F1KA 2J87A 3L7AA 4DLLA 1F2VA 1KI8A 4U1RA 1UBCA 4BNHA 3C21A 4B34A 3SSAA 3M6LA 3K4PA 3AF3A 4G5QA 4WN9B 5JWRA 1L5ZA 4M9CA 1Q0RA 1W0CA 4FIZA 3L01A 4HWKA 3VR6H 2PG3A 1MB2A 3TW6A 3TJMA 3T5CA 1Q74A 2RH4A 5KFMA 4ZYTA 2C0PA 1W4LA 3TUIC 1O5IA 4M1QA 5C1DA 4RX1A 1JFLA 1ZJMA 4HNAA 1H6CA 2NTNA 5BSTA 5G41A 2FZWA 4ZVTA 4YMMA 2YYSA 3D7SA 2A88A 2GXSA 5KYYA 4LHVA 4URYR 5HHTA 3ITEA 1SY7A 1A4XA 1RYHA 4BVJA 2PWAA 2CEKA 2XXAB 3THYA 5KQPA 4QUJA 1XXHB 1QTRA 4TMTA 4MUIA 4IIYA 1M7BA 4U2FA 3MMZA 1FC0A 2JAWA 4TTTS 3GEBA 3HUEA 3MWDB 2PL1A 2Y1CA 2GAFA 4N0QA 1G2OA 3ZCTA 4ECYA 3NVZA 3COVA 4RJTA 3T95A 4C3UA 5KX5B 1IY8A 2QE7A 2EAOA 3RYHA 4IHJB 1DAMA 2QDXA 2HC9A 3EQ6A 3MOGA 4HFNA 1I2CA 2BVNA 3LCJA 4CM3A 5HDQA 1ECWA 4GWKA 3TECE 3KX2A 5K3AA 3EC2A 2X5KO 5BSEA 5ITWA 5D6OA 3D8BA 4UTNA 3HTXA 4MW1A 4Y6QA 5EPOA 1ZQGA 1ZUHA 1JYEA 3K1AA 5JCJA 1XJCA 2O52A 2C4VA 2VP6A 2PRIA 4X94A 3M9XA 1T8TA 1DLJA 3QQ5A 2V6GA 3NRJA 2WA2A 5K8TA 4R3NA 7ICLA 2DWOA 4HVTA 1G3MA 1IG6A 5DQHA 1T9ZA 2ETXA 3X2FA 1YR7A 3KTAA 2O5CA 5HUHA 4NP6A 3LQKA 2XY6A 1MOQA 2QKQA 2RGUA 4LC0A 1U28C 1MIOA 1EESA 4RKWA 5H70A 2IE0A 4YUVA 4D82A 4KJZA 2F1HA 2ZCJA 5TV2A 3OOYA 4UQLA 5AHRA 1IEVA 4U7TB 4LNHA 1NWHA 3OLQA 4XVRA 2FPPA 2PX2A 2YXPX 3QVLA 1KJ9A 4R1MA 2V58A 4QPDA 1UZMA 2RK4A 3LX8A 1E69A 4QWCA 1SR8A 4WN9A 2GCGA 4CNBA 1S3GA 1TZKA 2KVCA 3N8KA 5CVTA 2B20A 2XEXA 5LP6C 4QZDA 3MSCA 9ICAA 3CW8X 2H54A 1RD4A 1VG0B 2I2FA 2IPNA 4PFKA 1OAOC 2O2XA 1SL1A 2FUNB 3C3PA 1XVUA 3WGTA 4R9RA 2NVUB 1XRLA 3ME5A 2X1HA 2WSIA 4DKXA 3TRIA 4MJ3A 1AD2A 3HBFA 4J16C 3DZ8A 3RTGA 3ORYA 2ZTHA 1C3VA 4EFMA 1E7QA 2POCA 4OB7A 3VH1A 5ALMA 3IQZA 3SP1A 2XXAA 1Q3HA 1N25A 3I5MA 3K71B 1XXHA 3K9WA 4YLGA 5B36A 5GTHU 4QQNA 3WA7A 1ACMA 5M5BA 4GUDA 2AD5A 3QFTA 2E8MA 3W6PA 2ZREA 5KKNB 3M2TA 3MWDA 5DGXA 5TX7A 2VTVA 4V1CI 3W04A 1TZBA 4YCAA 2E4UA 3U5TA 4UHKA 4DQPA 2YVAA 5KX5A 3U09A 4CMIB 3GFVA 4IHJA 1A4RA 4JUDX 4BNKA 3I5YA 1Z7EA 1SHKA 2O3JA 1P7WA 4LJAA 4Z5XA 5CHEA 5HMMA 3IM1A 3Q6MA 4L4RA 1JS1X 3AL2A 1U49A 3ZGLA 2C0QA 3WLQA 1J49A 1DBQA 1BFKA 3JPQA 1BTOA 3HU1A 4AULA 4UVEA 2IHKA 3RAGA 4C08A 3VTZA 1L1QA 2HA2A 5DHAA 1ZBQA 2Q2QA 4ES6A 4KPGA 3BA1A 1P75A 4CDMA 1XSLA 3TIIA 3NAZA 3TUJC 4JNKA 2PSDA 1LH0A 5LDDC 3O8QB 1O0SA 4F4ZA 1H85A 2XCRB 3CKMA 4V24A 4NHOA 5KUTA 1BROA 5EZQA 2O9JA 1VBFA 4P4PA 5NULA 5BSUA 2XDWA 1EK0A 1IRIA 2AGVA 1KMNA 4ED6A 3GEGA 4RWEA 1QZ3A 3PVXA 1WVIA 3FMVA 2C78A 2GMWA 3UMRA 1B3RA 3BBPA 4UB1A 2CXRA 1AS0A 3VJKA 1BX1A 4M38A 1T5HX 1HETA 1IC6A 4TYYA 1F5SA 1E7YA 4EA6A 9LDBA 2Y3IA 2UYHA 3PC8A 4ID3A 3H65A 4FMDF 4X1OA 3HHPA 1M66A 1K6IA 3OI7A 1OHHA 4KLSA 3ELWA 3EW7A 4WI1A 1QSYA 3E6AA 2NVUA 4Q05A 4Z4CA 1IN1A 2R8HA 2Y93A 2NYUA 4EKNB 3Q15C 1SPXA 3GN1A 1WXDA 4HN9A 4MK4A 4ME6A 1UINA 1O8CA 1KFTA 3ZNQA 3HVUA 4G8JA 1POWA 1Q50A 4HDAA 4FE7A 4RPIA 2OCGA 2XMCA 5F7XA 1ZY2A 4F4YA 3GF4A 1KXJA 4LJXA 1IHUA 4OHWA 4QXRA 1ZO8A 4IQVA 1GPUA 3UQ0A 3RU9A 3VKFA 1U3FA 1GXSB 3I01A 1W19A 2JFYA 1DJPA 1YVUA 1XCGB 4EGAA 1NONA 4MPJA 4TUSA 2PRSA 4EHDA 4CMIA 3H0RB 4KN6A 4AYXA 4TLCA 3OT5A 5J3JA 3OPNA 2QTVB 5K0FA 3EX7C 5TRTA 1QU2A 4IZOA 1G4UR 4RH0A 2BZGA 1OGIA 3VCBA 2OHOA 2BEJA 2XB6A 3OU7A 2FVXA 2IHBA 4DV6B 1RWVA 2JFUA 3ZHRA 5CA7A 2BDTA 4YRSA 2QTAA 3SX4A 4MR7A 1Y8ZA 1U48A 1U0OC 4NYJR 2FOLA 3OCVA 1P1JA 4TXLA 5DBHX 3ANTA 3M4ZA 2ACVA 2XRMA 2C8JA 3DFFA 1E2QA 2RH8A 4U63A 5L1KA 4B4DA 1JTVA 2J1LA 1ESDA 3O8QA 5IIOA 2G4LA 2XI9A 2KOBA 2X8AA 5EJ5A 4JUZA 1XZBA 1H93A 3LAWA 3E15A 1AGXA 3QY0A 3KLOA 2H51A 4Y2TA 5KFKA 2QRNA 3G2OA 2YWDA 2VCEA 3NBKA 5DX8A 4F92B 5JQGF 1IRXA 3DJFA 9ICKA 3KWFA 4X7PA 3RB6A 2ISSD 2R25B 1LDGA 4R51A 2VSYA 3HWWA 3DWEX 5JPCA 4JIMA 3SZMA 3NTXA 1TIKA 4XLLA 1O94C 1GUZA 5KVCA 3KR9A 2A5GA 1UDRA 4O4JF 2V0CA 1N5WA 5ALQA 4KNYA 2QN9A 5EZYF 4IILA 4YMNA 1Z6GA 4MUNA 2NRZA 3ZLVA 2X6TA 2CDBA 1G8HA 4ZFNA 3WFJA 4N7RA 2HSDA 4X8HA 3ND8A 5DNDA 1C41A 3U1TA 4QYIB 1VRVA 4YVZA 4YR0A 3WGYA 3PQ3A 3VYUB 4MWOA 4Y1RB 2FN7A 3SX0A 4AN4A 3ENNA 1UFOA 2OOKA 1C81A 3CSUA 2Q7OE 1GV0A 2ZLBA 1NZPA 1DJOA 4NZZA 4X0EA 3Q7PA 4IO1A 1ADYA 1MMFB 1DU4A 2RGGA 3MAGA 3M0EA 1TM2A 2O14A 1S02A 1LEHA 1GXSA 3ZI7A 2NUAB 3MMNA 4OXRA 3W4KA 1EGAA 1OTYA 4CTMA 3AHFA 4BMCA 3VJLA 2PFOA 2H07A 4H4CA 5F5NA 5TB5A 2YRXA 1PG0A 2W6JA 1NNLA 2X1LA 2ODPA 2KJ5A 2QTVA 3W5HA 4KQ6A 4G0UA 3GAZA 2PMDA 3H2KA 2BOVA 2WJVA 5TEWA 4G0QA 2GAIA 1C5KA 5CDHA 1BPBA 4LXQA 3GVIA 2OXOA 4DIMA 4OSPA 1U2GA 1E0DA 1B73A 1XCMA 1PUIA 2VK1A 1XSNA 4K0RA 3T7KA 3UJ3X 3W5BA 2JKVA 5UKDA 4R7TA 1YFJA 3DO6A 4HOYA 1PVRA 4BXOB 4M9UA 5GWXA 5H80A 2UUOA 4ER5A 4ENSA 3D1JA 2K4HA 3ALRA 1H2RS 4L5JA 3P0IA 4RQBA 4F4WA 1PKXA 2IC5A 3FSGA 1R74A 1A7AA 4KVFA 3PMNA 1Y3AA 4UUQA 1FY2A 1OU4A 4BTEA 5KG3A 3GA5A 2AW3A 5JY6A 1TUBA 2AZMA 4WLVA 2NVOA 1OI3A 4ZODA 2IEGA 4M1WA 4BYMA 4PNEA 3IC5A 4ZVRA 4KGZA 3Q8QB 3HB1A 3IQGX 4RFSB 4LOJA 1G8FA 1XELA 2LBPA 4Z4GA 1H3FA 4QWBA 1D2AA 3IXQA 4IIDA 1K5OA 4RVGA 1IU9A 2A30A 1BE6A 4E6PA 1SJ9A 3RRNA 3H84A 5DT9A 1ZS9A 4BNIA 3M8RA 3SOZA 3NCHA 3RYCB 4Y1RA 2DKOA 4H2DA 3DBHA 1FW8A 1WSDA 5KQRA 4RQ4A 4BASA 5HE8A 3E3MA 3I8SA 1T6BY 2RBEA 4AKIA 1RLOA 1ZI9A 4ARZB 2HR1A 3IP8A 2C96A 4NH0A 5E8JA 3FCOA 3AUUA 2NUAA 5FPTA 2VBCA 2RHTA 2R6CA 2BFWA 3KB2A 3SHOA 3NATA 3TQ1A 1PZHA 2WMDA 3TAUA 1G60A 3I9KA 3OAAD 1THMA 3OCWA 3ONNA 4P2BA 3UXHA 1NN5A 4JEIA 3LDAA 2I62A 4I3GA 4CQJA 5KG5A 2AG1A 5ALPA 1KR5A 4A7PA 3B7WA 2GTHA 3BE6A 4GH5A 1XU9A 2GAJA 2HMXA 4K3UA 4P58A 1VSVA 4RJKA 3A25A 1ZM7A 4DV5B 4R7GA 1JSXA 3RE1A 4W1QA 1ZQUA 4MCAA 1PR2A 3CGWA 3AFNA 3WISA 2UXBB 1UIRA 4YR3A 2Q50A 1YA4A 1W8IA 2A0XA 1L0BA 4FLFA 2EDUA 2FWJA 3QLUA 2D1SA 4JGBA 1UPAA 4OL9A 4V0RA 1XWLA 1H2ZA 3JQAD 1Z4IA 3SYNA 4JWKA 2WD8A 4OQQA 2PD4A 3D2SA 4Q93A 3HI6A 3DEJA 3GLIE 1D8BA 1P9LA 2ZIUB 3KTDA 3RD5A 2ZIWB 2Q3EA 2QB1A 1JB1A 2W98A 2P8JA 3UQYS 3H5OA 4B45A 5J0OA 2JFVA 3CO5A 2OG2A 5DTJA 1OV6A 1GOTA 3ROMA 1TFRA 3GGGA 1LUAA 4FNOA 4LZWA 4K03A 4BFUA 2ZAGA 4KRYA 4RFSA 1RIFA 3RU2A 1OTHA 5FD8A 4R3WA 2W6CX 3RVJA 1XTRA 1VMKA 3AG6A 3BXXA 3JPWA 5JD6A 1RAAA 2YBDA 5BSKA 1D6JA 4MKFA 1R9NA 1QRTA 1RJFA 2WVAA 3IAHA 2XZDA 1G7SA 3QWBA 5AM4A 5LXTF 5K6AC 1HTWA 5G0UA 3RYCA 1CS4C 4M49A 1ZRMA 1Z7BA 2YOGA 2HNKA 2JJ1A 1Z1VA 2H63A 4FGKA 4E5NA 2P2SA 2F8MA 5AXBA 2TSYB