4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
3IJ5A 5AI9A 2YMLA 1IWOA 2FPUA 5ALEA 2EAUA 4QQFA 3AR5A 4HGQA 1J8DA 4YIHA 2I7DA 1VJ5A 3SF0A 3DNPA 2PKEA 2FI1A 2YJ6A 3WGUA 3B8EA 2B0CA 2GHTA 2IA5A 4BX2A 2CFSA 1WZCA 3FM9A 2G06A 5AKYA 5ALPA 2G08A 4KNWA 4EEKA 4L57A 5ALGA 3WKBA 2FPXA 4O8CA 2ZBFA 1ZD4A 4F72A 4I9FA 1U2TA 4UW9A 3KD3A 5T41A 3OCZA 4NABA 3KBBA 4GXTA 3MMZA 2P69A 1SU4A 3KOOA 2I54A 2OBBA 4G63A 3OCWA 2HHLA 4XOUA 3I28A 2JAWA 4DW8A 2R8ZA 1RKUA 1YMQA 4KYTA 4AP9A 2W43A 1ZRNA 3PGLA 1O03A 3UMBA 2ZOSA 5AW4A 1ZD5A 1XPJA 1Z4PX 4EZEA 2YJ4A 3UMGA 2ZG6A 1TJ5A 3W5AA 3D6JA 4KNVA 1J97A 1RLMA 3B9BA 4XE5A 3QU5A 1ZD2P 3QUBA 1RKQA 4DCCA 2C8KA 1YJ5A 5AIAA 4UMEA 1LTQA 2HOQA 2RARA 1X42A 1RLTA 5AVTA 4PNHA 4ZEWA 4KN8A 3WKAA 3DDHA 4E88A 3N28A 2IOFK 5AI0A 2AGVA 5ALFA 4YIKA 1T5SA 1FEZA 2FPSA 4Y3UA 4JDPA 2QLTA 3PCTA 1U2SA 4FFDA 4FE3A 3U7FB 5AM4A 4KX5A 5ALUA 5E0OA 3WKDA 2CFTA 2ODAA 1Z4JA 4YGYA 4YCMA 3TLMA 1Z5UA 4UMFA 2WF5A 3QU7A 3QX7A 3WK4A 4XPZA 2WF7A 3WK7A 3WK8A 2G0AA 2IOHA 3RF6A 2EARA 3WKEA 2HO4A 2W4MA 3KZXA 4HYTA 3OPXA 2Q4TA 2JAOA 4HGNA 5ALKA 5IS2A 3A1DA 2AH5A 3M1YA 3I76A 3QU9A 4CNQA 5ALXA 2AUTA 5AK4A 2FUEA 4ZEXA 4YH1A 5AW8A 2YBDA 2R8YA 4DWOA 5AVRA 3AR9A 3A1EA 3EPRA 3DAOA 1Z4IA 1XP5A 2G80A 1SWWA 2YMMA 1XVIA 1WR8A 3NRJA 2FPRA 3R9KA 2YJ5A 3UMCA 5AVUA 2I33A 4QJBA 4Y2SA 5AVXA 1Y8AA 4UATA 4F71A 2D2VA 5AKEA 2YMQA 5AI6A 1RQLA 5AKLA 1TJ3A 4RETA 2C4NA 2RAVA 5AVQA 1Z4QA 4CF3A 1L7PA 3ZX4A 1K1EA 2ZXEA 4BYGA 1L8LA 3ESRA 4EELA 2JARA 4FYPA 3L0YA 2BDUA 4BX0A 2B82A 4G9BA 5A3SA 4XQ0A 2G09A 3NAMA 1JUDA 2BDEA 2Q5EA 5AKHA 3ZW7A 1VFPA 3BWVA 1QQ5A 3U7GA 2YJ3A 4Y2VA 2ZBGA 1NF2A 3EF0A 4UM5A 1TA0A 2C88A 4OFZA 2JGAA 3F9RA 3ZWKA 1N8NA 2P11A 2FPWA 3EF1A 1U02A 2HEGA 4B6JA 1S8OA 1WVIA 5AKJA 2YFYA 3ZTWA 3K1ZA 3MPOA 1RKVA 3L8GA 3N1UA 4BKMA 5AW3A 3U7HB 4UASA 3SLRA 3OCVA 3J7TA 4I9GA 3QUTA 3U13A 1F5SA 2MSNA 1PW5A 3ZVNA 1RMYA 2HF7A 5IT4A 3NIWA 4NV0A 3OCYA 3U19A 4CE6A 5AM2A 5AW7A 1L7OA 1Z4KA 4BEWA 3NASA 2R8EA 1ZRMA 2C9MA 3FVVA 2NYVA 5AW0A 3S6JA 5ALRA 4L6CA 2GO7A 1U7OA 2GMWA 3PDWA 3WGVA 2O2XA 4HGOA 4DFDA 1ZOLA 3ED5A 3WK5A 3IB6A 4L6AA 2Q4RA 5ALDA 3QNMA 5ALIA 3R09A 3N07A 3ZI4A 2R8XA 2YMPA 4Y2PA 5IT0A 5AI5A 1Z4NA 3L8EA 5ALMA 2CN1A 3OCUA 2G07A 1EK1A 3W5BA 5AIBA 1TJ4A 3L8HA 5AVWA 5AHXA 1S2OA 2I34A 2C8LA 1ZJJA 3CNHA 1KYTA 2DQSA 3L5KA 1QQ6A 2WFAA 4UMDA 4YCLA 5AK6A 1NRWA 3NANA 3HLTA 3ZU6A 3ZVLA 5AW2A 3PGVA 5AK3A 4UMVA 3SD7A 2WM8A 1Z4LA 3ESQA 3DV9A 4HGRA 2B8EA 5AI8A 2RBKA 2OM6A 5ALQA 1EK2A 3W5DA 2FUCA 2MU1A 3MN1A 4NAVA 4UU0A 5AICA 3ZWDA 3ZUPA 5FP0A 3ZX5A 2B30A 4UARA 5AW6A 3L8FA 3QU4A 1Z5GA 2HI0A 3RFUA 3L0CA 3WK6A 2IOFA 2X4DA 2HSZA 4JB3A 4OHFA 3BA6A 3GYGA 4CF4A 3U26A 4BNDB 4BX3A 3AR4A 2CFRA 3SKXA 1YDFA 5AKIA 1QQ7A 2YN4A 2GHQA 2ZBEA 4RESA 4UAVA 1U7PA 3E84A 3I1YA 3FZQA 3L0BA 3OCXA 4NFLA 3MC1A 3HYCA 5AKZA 1SWVA 3E8MA 4ZEVA 5AM3A 3R4CA 5JJBA 1L7MA 4CF5A 3A3YA 1O08A 2GFHA 3IRUA 4BEVA 5AVVA 5AW9A 1L8OA 1Z88A 3QYPA 4BBJA 2OYCA 2G1AA 3EWIA 1RLOA 2BY4A 2ZBDA 3SHQA 4Y2RA 5ALHA 5AM1A 4Y2QA 5ALYA 4UM7A 1TE2A 2EATA 3W5CA 4MUMA 4Y2XA 3WK9A 1QH9A 5AW1A 1RRCA 3UM9A 3VAYA 2HDOA 5ALSA 2OA0A 4OD0A 5AM5A 5ALVA 1RMTA 3AR6A 3ET5A 5AI4A 1YS9A 3L7YA 3A1CA 4IG4A 3ONNA 4YCNA 3QUQA 1ZS9A 1RDFA 2P27A 3QGMA 4AS2A 4AS3A 1L7NA 3FGOA 3QXGA 3AR7A 2NO5A 2PR7A 3N8GA 4H1WA 2WF8A 2PQ0A 3E81A 4UU1A 2WF6A 3U7EB 2B1QA 3I6BA 4Y2JA 2P9JA 1T9ZA 4IFTA 3ZTYA 4C4TA 5AK5A 2NO4A 1YV9A 2YY6A 3NALA 1YNSA 5AESA 4C4RA 2IYEA 1NNLA 1Q91A 4OCZA 3FPBA 2MU2A 1VJRA 3B9RA 4EX7A 2FEAA 4Y2TA 3SKYA 2W11A 1WPGA 3P96A 2QYHA 5ALOA 1T5TA 3KC2A 4J2TA 3AR3A 5AM0A 5AVZA 5ALJA 1L6RA 4EENA 4HAIA 3NUQA 4GIBA 4KX3A 1RC8A 3OTQA 1RPZA 1ZD3A 5ALWA 4Y2YA 1CQZA 3ZVMA 4Y2UA 2HCFA 2I6XA 1Q92A 2B8JA 1Z4MA 1N9KA 5A3QA 4HGPA 1RQNA 3QU2A 3ET4A 4C4SA 2I55A 2VKQA 4MWOA 5AVSA 3L1UA 4J03A 3E58A 5AKKA 5ALNA 1QYIA 5AKXA 2O9JA 4NWIA 3QUCA 1AQ6A 3QLEA 5ALTA 2WF9A 3AR8A 5AKGA 3SMVA 5A3RA 2HF2A 1RMQA 1CR6A 2AMYA 2HX1A 3AR2A 5AVYA 3N5KA 4EX6A 3WKCA 2B1RA 1Z4OA 2JAUA 2FDRA 3FPSA 1LVHA 1MH9A 3CZ4A 5ALLA 5ALZA 3M9LA 2WHEA 4UAUA 2RB5A 4BNDA 3L1VA 5AW5A 3KDPA
chains in the Genus database with same CATH superfamily
2EP7A 2OT3B 5A4DA 2GCOA 1P4JA 3H1GA 1NJWA 5DBHX 3WB9A 2O6LA 3CR8A 4DIUA 5JOQA 4B3FX 5J2HA 1FSGA 2A35A 1IY1A 2RKOA 1EKXA 1F48A 4ZV9A 5J4LA 3RFFA 1UOOA 1XDZA 3LGAA 5L95A 3UGQA 3CW8X 1E6WA 1BJTA 3O9MA 4BVAA 7MDHA 3I2YX 2GPWA 2BAGA 3DO6A 3PL1A 3QWIA 3WHKA 2VL7A 4TRRA 1RWBA 1WZIA 2VP3A 3F2VA 3GEIA 3IAFA 4NJEA 1JQ5A 1W76A 3H9JA 3R5SA 4Y9UA 4YP1A 4O8CA 3T5BA 2FFHA 2I99A 5IH7A 3WFZA 3DVQX 3QPVA 1GNRA 5DBEX 3EAFA 1LV5A 5IAKA 1IDN1 5K0NA 3QWBA 4UXHA 4C8KA 5CFRA 3KD3A 1D4AA 4G6ZA 2ZYUX 3EASA 1GRVA 1OBFO 2YRXA 4NABA 4LSGA 5DTJA 4JI0B 1JB1A 5DNEA 2O23A 3KQPA 2GQ0A 5EYPA 1YR3A 4P9NA 4DV4B 4TTJA 1VIVA 3C43A 1WS6A 3LA6A 2QD1A 1HE2A 3FDFA 4PPXA 3K2QA 4CTOA 4UHKA 3GHHA 4B9LA 3FI9A 1NQWA 2KWIA 3IQZA 2UZ4A 5JI3E 1DWUA 2M9MA 1IOVA 2R8ZA 3ZBUA 4JVMA 2DWOA 1HMPA 1G66A 4Q4JA 3GLGB 1XNRB 3C7KA 1PJ4A 1MAWA 2CNLA 1HLPA 3ADPA 4Q5IA 3TQFA 1ONSA 5ED0A 1I30A 3OLYA 2G1KA 4Y0NA 3WP1B 4LVNA 5BV1A 3W5VA 3PX4A 4N3NA 3Q9LA 4X7BA 4TYYA 2XGJA 4BZWA 5JUMA 2JIZA 2PSDA 1IVSA 1LSSA 1QRDA 1ZINA 4EGAA 3DDCA 5EWMA 1R9GA 2X22A 2WWHA 1QG0A 4DEYA 3GFVA 1M1XB 2IUTA 2VHTA 3A9WA 1V97A 5FUMA 3PLAE 2HK8A 1P2DA 1XZQA 1ZWKA 3QU5A 2O0MA 4O1HA 1U1FA 4TOIA 5BR7A 2EYQA 2O3TA 5ENZA 4KOAA 4RNDB 4CCYA 1NJ6A 2J9ZB 3PRYA 5L3RA 4QIWC 5TRTA 5AIAA 4JXXA 3GQBB 4I66A 4HR7A 4L0QA 4D02A 1J9GA 2H59A 4CLRA 3HVHA 2JHCA 3N2ZB 5EWLA 3R7LA 3DT8A 4NESA 3H6GA 4BKUA 1L5ZA 3BAFA 3I2IA 2JI9A 3OX1A 4KWCA 3TCXB 4MWBA 3TTYA 3VTFA 3UOGA 4G89A 3AERA 3U49A 4JBLA 1SD5A 5KNDA 2KVCA 1EAMA 1TW3A 2ZRQA 3HSKA 4C7ZA 1JHDA 2EGUA 1U2QA 3L7AA 2AEEA 2VZ9A 4KH1A 4OXKA 4PM4A 4EATA 1NQOA 1DBQA 2ZWMA 4NYIR 3OM0A 2KSOA 2HVIA 2IHKA 3E3OA 4M54A 5FL3A 1VRWA 5EINA 1HZJA 3W5JA 4E30A 5B7NA 1GKUB 4C6HA 2G88A 2GAAA 4MICA 2Q3HA 3NHZA 4PVCA 1YZ7A 3HL4A 1C3OA 2DCUA 4RSMA 3ZIAA 1ZQRA 2XMCA 4V3CA 5K7SA 3IG5A 1DWPA 2C78A 4Y2HA 3DE5X 1PV1A 4G5QA 3GJ0A 2PL3A 3LT2A 1LWNA 1U80A 1K5DA 1HYEA 1C3EA 3FLBA 4Q1AA 1VIDA 4YDSA 5EKDA 5I8WA 3WK4A 5BORA 5KKCA 1PAUA 4DNPA 1N57A 3C3DA 1VCMA 3CH7A 4NI5A 4KIFA 3QMWA 1G7RA 4LCJA 4WEQA 3TIIA 1P1BA 4YN4A 2D0DA 2Q27A 4CR7A 3HEBA 2ET6A 3HNOA 2AMVA 2JJMA 4QZHA 3CTMA 4JENA 4OQFA 1Z16A 2HF9A 3B70A 1Z3IX 4Y6QA 1M8PA 5KZMB 2FRDA 3U3KA 2W7OA 2Z56A 3NIFB 4LV8B 1IJBA 4UVHA 2VDMB 2Y1KA 5E4FA 5I9SA 3U40A 2P2DA 3I72A 4KQJA 5E4JA 3NBFA 4DQIA 3DD1A 4FILA 2IHVA 3MCAA 4J1QA 4NHOA 4RHXA 1RE0A 3TM5A 1T3SA 4LJSA 3RB0A 4C05A 6NULA 3MR5A 1X7ZA 5IASA 2VDPB 4JI4B 2JCXA 5CGQB 2VSYA 4GOXA 5JCXA 1OFIA 1XTBA 1VGRA 3LS2A 2YV5A 3COYA 3MWFA 4N9QA 4EHHA 1JMSA 4FYVA 1NBMD 1DL5A 3C3EA 2XYQA 4HQNA 2HCRA 3SHFA 2Z5VA 1KZ1A 1TEVA 2E82A 5KQGA 2UZ1B 3CUWA 4WECA 2QMEA 3S68A 1ML4A 1Z7WA 3SIWA 1NJFA 3LDUA 3QPDA 4M1WA 3S99A 2WQ6A 1QOPB 2BMAA 3HHEA 4BVKA 5DKWA 1TCAA 4DSNA 4H6WA 1Z6PA 3MFYA 4XCXA 1KKMA 3IHWA 1T4GA 4ZI7A 4EY7A 2PD6A 3BQTA 2PL1A 1ID1A 3SQNA 4BZZA 3N8KA 3F53A 4RETA 3EDOA 3GGJA 3CRW1 3E5NA 2X0DA 1A8HA 2ICAA 3CWQA 3ORRA 3HSYA 4PWZA 1BXZA 4MRMB 1J6UA 5FEUA 3OT1A 3OURA 4FDMA 3V4OA 1OMOA 1UJ5A 2PLRA 3PKJA 2HV9A 1FYWA 2V9PA 3IPAA 3U1VA 1FTSA 1SN7A 3FZGA 3C5FA 3ZJVA 2OXRA 3A9SA 4F3TA 1BS2A 2QN7A 1G20E 3SJCA 2OGUA 4EG1A 4TUPA 4OHZA 1FJGB 4BCBA 1XZEA 4MKFA 1X7XB 4ALMA 2VHXA 4UBNA 1UP4A 5BT9A 3S1SA 3K4QA 2QL5A 4H6VA 1FVXA 1JALA 1YZLA 3NS1A 3ZHQA 3GQCA 1TEXA 4M60A 1VCNA 1QQ5A 4KLFA 2OFPA 4Q01A 1EVJA 1Y5MA 3NHAA 2VTBB 1DAPA 1EFKA 2BRUA 2HPVA 4ZT4A 3VC7A 2CBGA 3I0MA 4QU0A 3ZQJA 3GILA 2AVDA 5DN6A 1Y1SA 2I8CA 5LA6A 4ASUA 1T9AA 1Z5WA 2AF3C 2O0HA 3G2LA 3BL8A 3N2YA 4PC3A 3INNA 3O0TA 5CLQA 1HTBA 2HEGA 1WD5A 1CP3A 3GN2A 3O38A 3PKZA 4IS7A 2GO1A 2H1CA 3TE7A 3HRIA 4DSOA 4ZI2A 4J0KA 1XNHA 2QNRA 4DE5A 3F5MA 4RIEA 2BN4A 4OHCA 2QUBA 4FM9A 1RKVA 5FYDA 4BVHA 4R7ZA 3ZS9A 4R8KA 1A77A 3OJCA 1J56A 2XGMA 3H4VA 4P84A 1VHJA 4RGVA 1FPQA 2H5EA 3I6IA 4MR7A 4RPZA 2PMZC 3BBPA 4HB3A 4ZCLA 1MGOA 4RK4A 2PGDA 4ZAYA 4ZOQI 1MA0A 4QRHA 3JYNA 2PWPA 4HWKA 1XALA 2VUTA 3VKFA 1U7UA 1VKNA 3EGVA 2WZQA 1A5BB 2YFQA 4LC1A 4LJKA 5THXA 5KYUB 4DSEA 1ZRMA 1ODFA 4PL2A 2XECA 3DVAA 4J75A 2WEKA 2VTKA 4BQRA 4CFSA 3QNUA 2OILA 2EFHB 4WSOA 4HDAA 3GJ3A 4M9HA 1DMSA 4TKLA 4ALLA 4E6PA 2JH3A 1IONA 1NNI1 2VZ8A 4F5OA 4KV7A 2ZSDA 5K9ZA 3F3MA 5KFGA 2B61A 3E1KA 1UR5A 3V8PA 1UMKA 1VIMA 3HGQA 3AEZA 3I5MA 2W2PA 4J0GA 4LSWA 2OHFA 2A57A 5FBRB 5FUXA 3N9IA 4C7OB 3PSFA 2YYYA 1WDTA 3GJ4A 4X1IA 1T2AA 2I03A 4EY6A 1PG2A 1G4UR 1NMQA 1J8YF 2CMHA 2YDYA 1TW2A 4HSGA 5T3UA 3SWWA 3L7BA 4ZDIA 4CM7A 5EFOA 3V72A 3TJZA 4C0HA 1L4GA 1R8JA 1QU2A 2OWOA 4KXYA 4PHFA 1QO9A 1C7IA 5E4TA 3DMHA 4V38A 3L8HA 3OJXA 4DLAA 4RT3A 2CMGA 2Q8NA 2AXTU 2QUZA 4ER3A 1DRJA 5CDFA 1T0UA 1OHHD 2Q5FA 3D6TB 4DF8A 2GBCA 2VF8A 4AKHA 1OVGA 3MJSA 3K1JA 3GFKB 4Q03A 4QNLA 5D00A 1ZQIA 3NANA 5C1IA 1R88A 4R2WA 2SCUA 4D41A 3CVWA 4LMPA 2CXUA 4YXMA 4OYYA 4OQ4A 5E7QA 4X54A 4ZQCB 2WJ6A 3OQIA 1VHDA 5ITSA 2KNJA 4GWGA 5JDIA 4B9NA 1BKYA 1FTGA 3ESQA 4HGRA 3RTGA 4KLGA 1JQJC 2CLDX 3DVRX 4F56A 3CVVA 1N2HA 1TO2E 5DGDA 4IQGA 2VJMA 2CHVA 5ALQA 1PK9A 1Q2XA 1AS3A 2M6RA 5KFTA 1KPGA 3N87A 3OP4A 1T1RA 4LDQA 1LDMA 2FPLA 2CLEB 2OC9A 4NCIA 4NECA 3OIDA 5JS7A 4ABYA 3V4SA 1B8UA 1U2ZA 3L6UA 1X86B 3MBOA 3T5PA 4PTYA 3LKVA 3QHQA 1COWA 1MOSA 2W6ZA 1DKLA 3QHAA 4JYPA 4DPLA 3PDCA 2AQ0A 5L7WA 2M32A 3WLIA 1PEDA 4JUZA 1VHTA 4OH1A 4RZIA 1XJQA 2IXAA 4OAQA 3GR6A 5CJJA 3I30X 4QHYA 3P0IA 4CKBB 4D9GA 4ZYLA 1NIPA 3MS4A 5HIIA 2ORYA 3RTAA 2HRDA 1D2NA 4LNUA 5DGHA 4AB1A 1U1GA 2HSZA 3AU8A 1GKYA 9ICAA 2O7VA 2GFQA 2O8FB 1Y7TA 2YV1A 2X0KA 2OYYA 5FUQA 3F9IA 3GEHA 1RAFA 1ADBA 4U7HA 3I3OA 2M0NA 4GZ5A 4BZQA 3PYLA 4TYPA 1P75A 2C61A 3HKZF 1BZYA 3WRWA 4BB5A 4BX3A 3LDAA 4EKEA 4UEOA 3IDOA 1PD1A 4L8YA 2JGRA 2X1LA 1ZUWA 2WZBA 3M9XA 4M86A 2ZRCA 3VDQA 1ZAYA 3BS7A 1KNQA 3KB8A 4TUQA 2C4VA 5AKZA 2NQTA 3WRXC 2NTVA 3ABSB 1QTIA 4HXYA 1ODKA 3H6KA 2O6HA 3ZDCA 3TI0A 2CXNA 2Z8YM 2OZEA 2R8RA 4UM8B 3UANA 1HT0A 4I8IA 4ZQIA 3EVDA 3DEJA 4NCXA 4XLLA 3A3YA 4RLHA 4AKGA 1NW3A 4WDQA 4OKNA 1ZQTA 3W2HA 3HTXA 2XPCA 4WUVA 3M9WA 3QYPA 1V39A 2ZREA 2GRUA 3R3HA 3T7JA 4BAZA 4BBJA 4B6EA 3A37A 2QJTA 1RLOA 2ZBDA 3DKVA 3EOZA 3HYTA 4JT9A 2WU4A 4XIJA 5BOLA 4AZ3A 2R1UA 3JAKB 4ZVQA 4DC9A 1FXWA 1T8SA 1LPSA 1YR8A 3QM1A 3W3AA 3PF9A 4GOOD 4I6GA 5KT7A 4N5MA 1YNOA 1K6MA 3WL6A 1NVBA 2OK7A 4YX9A 3W5CA 4G8JA 4WD3A 2G28A 3MJFA 3WK9A 5KNIA 3WLNA 1FYVA 5CB8A 3PSPA 4U7FA 5A71A 5TMEA 3KQKA 4I9NA 2V0GA 4MVJF 3PC2A 5IBQA 4BMDA 4CT5A 2NRZA 1Y3HA 1B7GO 4BMCA 2CJWB 1RNLA 2MHCA 3KLNA 3U60B 1V1MB 5AM5A 4BAGA 1A7JA 1M5TA 2G3YA 4FDUA 4WBNF 5WRFA 5K20A 3GA0A 4JVLA 2GKOA 3BSWA 3CZCA 3K8OE 3WYNA 1OI3A 1PV2A 5BR4A 2IYTA 1ZU4A 1PLLA 2WAYA 3KV3O 2QLFA 2J9YB 3G5AA 3KSRA 2JCYA 4IX1A 1N5RA 5AMXA 1E2IA 4DLBA 4PN7A 1K5OA 5EMHA 1XA0A 1E2QA 1YJBA 5JQGA 1Z8DA 4Y9TA 1Y7PA 2AJCA 1GGHA 1VI5A 2HDWA 4Z7QB 5H9WA 4X90A 2C83A 3BGIA 1J33A 1ZHFA 4GGPA 4HLDA 2LPEA 3WO1A 3Q88A 5DASA 4ZV7A 3AX6A 4IQWA 2C31A 5CM9C 4EHLA 1H5NA 5FOTA 3CVUA 2B1QA 2IF0A 4RPIA 4X1YB 4GI3A 4LJRA 1Z73A 3HVRA 1NVEA 3L04A 3ZE1B 2W8BA 5DQHA 2R6R1 2E37A 2QR2A 3SZUA 2V6MA 4C4TA 1F2DA 1P62B 2RFLA 3STHA 3I01A 4HWTA 3SJBA 5DWDA 4LHZA 5HS4A 1WEKA 2I9KA 3L3FX 2I5PO 3VR5D 3KETA 2XZDA 3UHAA 4LWPA 5FA5A 4BQOA 5L3ZA 3L2OB 3THYA 4Y9RA 3T3HA 2DR0A 4ZYVA 1ZMBA 4PXSA 1GOTA 4MR9A 1XPOA 1K6IA 1F4PA 3VJRA 3ICQB 9ICVA 3UB2A 2ES4A 5HUHA 4WIAA 5COQA 3K1YA 1R4NA 2V3VA 2V5UA 3HMKA 1WPGA 3OU6A 1DXYA 1OIVA 2IUEA 1O5TA 3EIUA 1TZJA 4ZO6A 5D1NA 3HXOA 1BA3A 3QMPA 2PS1A 2REQB 4XD7D 4IEEA 3W8RA 2PTHA 2PR2A 1Q11A 5IBPA 8ICZA 2CF6A 2XTNA 2YHAA 3DBVO 2GOYA 2BFMA 2X8WA 1I7PA 1QKJA 4FMCF 1IAVA 2YDXA 1L5SA 2GEBA 3CX3A 2X9VA 3CNBA 3LFTA 5EZ6B 1BRTA 4Q4CA 2VRBA 1ZD3A 1HYBA 1TYZA 3BIJA 3ESYA 4JZYA 1JXOA 1KVUA 2QV0A 4F8EA 2DETA 3ALRA 3AOEC 4CT4B 4YT8A 4QZ8A 3PW5A 3UG7A 4EYHB 4GXRA 4M9SA 3UJ6A 2CE7A 1I6WA 4M6WB 1E6EA 3DL4A 1JEEA 5CW2A 5ESRA 2HCFA 2QTZA 4R1MA 4V0LA 2YCLA 4CKBA 3S2ZA 4IGEA 3RJMA 4KK3A 1GUDA 2I6SA 1L7AA 2HZ7A 5CM2Z 5IAJA 3UXNA 1AGRA 3DLBA 1N0WA 1X9MA 2ZUEA 4G3XA 3SYLA 4Q4DA 2HYDA 2LKCA 3EXFA 4CM4B 3SAHA 2IMWP 3EIFA 4J03A 1CY4A 2BR5A 1MO3A 1TM1E 2XDYA 3S55A 3L6CA 1Q0HA 1YACA 5ALNA 2PMCA 5EKXA 1SELA 5IC6A 2IP2A 3UVEA 2O3JA 1CULC 2F90A 1Q1BA 1NAIA 3DFFA 3NHWA 4IOJA 4DCOA 2OLEA 3P9QA 4HGYA 5JR3A 4GXIA 4B4UA 1LQUA 1JKMA 1AQ6A 3RREA 1KMHB 4ZOEA 2CSUA 5J0WA 1A96A 3IKMB 4PCAA 3UJ9A 1U0TA 3WOHA 5JYCA 4IQUA 5FBQB 3DLHA 4FOPA 5A3RA 4ZEMA 5TXGA 4DQRA 3D5TA 5FA6A 1XSNA 1JHYA 2E21A 4JLBA 3QXXA 1YWGO 1GUFA 1GGEA 4H7PA 4KR0A 4AWAA 3LTNC 2AOUB 3HCOA 4C0BA 4L4SA 2KIVA 1NM5C 2ZTSA 3A1UA 2KG5A 2IXDA 1PLJA 3CSDA 1ODCA 4A0GA 4UZFA 2LUOA 3DA8A 1SXIA 3CZ4A 4E2WA 3W6OA 5JS6A 3P9IA 3GMTA 4KLQA 2JFZA 4WY5A 1IDOA 5EZYB 4ALIA 2WA1A 3KKKA 2XDQA 1FCJA 1V8FA 2PU7A 1IWOA 2BM9A 4LHWA 1SKAA 2H08A 1KAOA 1DFGA 4OHBA 4PLWA 1LRKA 1FRFS 7ICTA 1TM5E 1YS1X 2QW0X 3KWMA 4QQFA 4TMVA 1Z8NA 1M1UA 3OLQA 3I2JA 2VSQA 4GBGA 5BQPA 3RB8A 3SF0A 2B2NA 4DSKA 2XE7A 3E9QA 2KVSA 1X6VA 4D9FA 4BBZA 1SUEA 2BGJA 2R48A 2YS6A 3NUZA 1GL6A 1N8TA 3RTDA 4GXJA 1FQOA 1WA5A 4QPDA 2WI8A 2FEPA 1RXSA 3WB0A 1NPTO 4P31A 1LDYA 3MT7A 5FNVB 1NUSA 1JRPA 1ELOA 5J0SA 3RU3A 2VYNA 4J9VA 3LA8A 2YC2C 5HILA 4F2DA 4ITUA 1UK8A 2PLWA 3C15C 3CSSA 3OZDA 1IATA 4EKDA 1BO6A 1JHUA 1UJBA 1CV2A 3B2NA 3U3OA 1AS0A 1E2FA 3FCUB 2HHXA 3FMVA 3VZPA 1QCDA 3OCJA 3TD9A 1XLTC 5DIZA 3HKEA 5DYNA 3ZW9A 3R20A 1UDAA 4G63A 4WPGA 1XI2A 3S0JA 2CXOA 3B36A 2IXFA 3IAS6 3M70A 4P4LA 3RUEA 1GNSA 2R00A 2C3YA 4U2GA 4Q9JA 3X2EA 4YJFA 5IJ9B 3GLFA 2R4QA 2BEVB 4MARA 1M1YA 4EIWA 3BYZA 5CYGA 3WICA 2P9GA 2FMTA 3DV0A 3GARA 4DDWA 3PGLA 5JANA 3RJGA 1I32A 4IWXA 3GEBA 3H4BA 1O03A 4IRDA 1L5YA 2WHRA 5C8ZA 2JVIA 1DEXA 5K0CA 5JV5A 4WGGA 5HCUA 1G4AE 3QVXA 3VU0A 4MQ6A 1K89A 1L7BA 4R0VA 2QTBA 5K0TA 3EVFA 3V46A 1KXJA 2O8DA 1K8RA 4XTCS 3BMOB 2ZUWA 3G9QA 3IIMA 2DTXA 2QN6A 5JCOC 4UC0A 3D6JA 5JPIA 1JVBA 1P1KA 5H3HA 4Z5XA 2R79A 4AMYA 1L5OA 3QVMA 4JLPA 2NGRA 4OLFA 2JA2A 1OX5A 4I6JA 3NYRA 1O6GA 3BCSA 4NMXB 4NVRA 3U7RA 4BWYA 4EUSA 1ILWA 4KPGA 4ZTUB 1YA6A 4I0WB 4C9BA 5C0YA 1WVMA 4GKAA 2R7NA 4XGNA 1XRPA 2BUBA 3NYQA 2HHQA 3HP1A 3N2KA 1LPPA 5FPYA 3MOSA 2DHEA 5AVTA 3TG2A 2GYUA 1RM5A 4AMVA 3T99A 4G8DA 3SZMA 4EUFA 5KDLA 4Z6EA 2C4TA 3LM8A 1EE1A 5JEEA 4CFYA 1XG5A 3DAGA 1DLJA 3KUCA 4C1NA 4I36A 4BX9C 4RL6A 3GDGA 2XVXA 4R83A 4Y3UA 2Z30A 3LVRE 1Z2CA 1E5TA 4AW9A 1IMJA 5ELMA 3MXTA 4NTZA 3AM4A 3A7EA 1BMTA 1X14A 2Z58A 4NOLA 3RHZA 4FB4A 1SULA 5CITA 1PUIA 4XM2A 4EZBA 1BNCA 5JRZA 3AHCA 1Z2AA 3QJYA 4X20A 3SMQA 3NTXA 2A30A 3D8SA 1WKVA 3LQKA 2XYGA 5B4VA 1OT5A 1P44A 1IXKA 4HXGA 4YV0A 1Y4DE 4Q43A 2HV8A 1TM7E 2FJPA 2K5UA 1Z29A 3D7NA 4N9WA 8ICRA 1H2ZA 2W2OA 2WJAA 2YNMA 3AIKA 3O8LA 4FXOA 2D5CA 2AEFA 5JO0A 1MQ2A 1X40A 2EG5A 4RMIA 4HZGA 3GYBA 2H2FA 2QN9A 3WKEA 5JAZA 4G0WA 4YI5A 1X8XA 1ISSA 1RHQA 4GX5A 4P4OA 3EMKA 1D0SA 3COJA 5DP2A 2QDKA 2EBWA 4CQJA 5IIKA 1WD7A 2P9HA 4GNRA 1C30A 4NK5A 3LWNA 4YMWA 2F2TA 1HTWA 3QY9A 2WAAA 4G2NA 2OD7A 2VPIA 5EWEA 1GKLA 4C7YA 3IUSA 3EYZA 5JNSA 3SJAA 1WP4A 2J09A 5J63A 2JJ8A 2HIAA 3EXFB 3HR8A 5EXSA 1Q74A 3THWB 1IHYA 2W8KA 5DIFA 3B1XA 1Z4IA 3W8EA 1G16A 4PRYA 1SWWA 5HWSA 1G98A 1KI4A 3V7KA 1WWVA 4DJTA 2FCRA 4GL4A 3G02A 3MCUA 4N54A 4RHTA 1R5OA 1P74A 1HYGA 3AF3A 2JI4A 3UTCA 1G5RA 3WYFA 1AGPA 1DAKA 2I33A 1CUSA 2WBLC 3ASVA 3HFJA 4GM1A 3BS5A 3AHHA 3FHOA 3WBFA 4ZOHC 2V0CA 1RQLA 1B3RA 3OKAA 2PX3A 2PJUA 1YZUA 2ID8A 2O2DA 3RJIA 1WNFA 3KUXA 2JHFA 3NNNA 3WGYA 1ZNZA 4LK2A 1V5IA 2SKDA 1BGWA 4B8WA 4QGFA 3K31A 3B1VA 2FWMX 3HB7A 3HI6A 3AWDA 3WBKA 1SKQA 1QO0D 1MQ3A 2V7QD 1I36A 1EWTA 2J5RA 3F4KA 2IC5A 3C2QA 3JZIA 3WDKA 2D8MA 5DV9A 2IEGA 5LBUA 2BCQA 2OP1A 3ML1A 3ROKA 6Q21A 1PYDA 4XQ0A 3NYWA 4DO9A 1ZETA 4PZ0A 1R0YA 4L3WA 1A5ZA 5AVOA 1AB6A 1SD2A 1AQYA 1JA9A 2I2BA 5DNVA 4ER7A 1KFDA 3E0FA 2RC5A 3HP4A 1FP2A 2Z3ZA 5E6SA 4LBWA 1K7EB 1NF2A 1H2EA 1QWOA 1E2EA 1X38A 1TA0A 4GAEA 5KO2A 2QD5A 3P2YA 3EZGA 4PY2A 3VVMA 3OSPA 3UEOA 2XZPA 1EUDA 3E7PA 1FFYA 2IIBA 5SICE 5A06A 4ID9A 2BM1A 4GP9A 3OEYA 4PG7A 2NZWA 5H82A 3JTEA 1UBKS 3ONEA 3A26A 4TVBA 2NU9A 1K86A 1ULHA 4R2HA 1ADJA 3WNCA 5AKJA 1CJTC 5HJ2A 2XMSA 4LOLA 2MA1A 1PT5A 3ZTWA 4OHOA 4RT2A 4QZEA 2ZUTA 2FZLA 4O1IA 2GEJA 3AFHA 3MTDA 3E3MA 1MT3A 3MR3A 3K4GA 4HFMA 5AFSA 3OQMA 4I2GA 4G0MA 2Q3DA 1VE1A 3H5OA 3E7XA 5BSHA 1DJLA 3ZNPA 2YWFA 4M3NA 2QNIA 1DINA 4WXPA 1HQCA 5DOVA 4DMUB 3NMUF 1CYEA 1Z4KA 5F5XA 3S40A 4KR7A 1E2KA 4FW9A 3EJ6A 1GYRA 3V6KA 5F7ZA 5B1SA 4Q66C 4MQBA 3L02A 3S2SA 1T15A 2GDZA 3ZGNA 4DNQA 3FFXA 1DTWA 3LQ1A 4GI2A 1QGDA 3NPAA 4PHPA 3FYHA 3AYZB 1F9EA 3T0FA 1GGMA 4HT3B 4HADA 3F5EA 4DNXA 1W9HA 4W9NA 2AZTA 4LCBA 4HLUC 4AZ0B 1BXRB 3SBOA 4F91B 5JISA 2HWXA 5I4BA 1ZQLA 4F60A 2GN4A 1L9XA 4LDZA 3E48A 2E5LB 1P9OA 1V5WA 3TW8B 3SN6A 3P20A 2O2JA 3G17A 4JLNA 5DLDA 4WJKB 5GTHU 2OFOA 3KJQA 5BSVA 4Y2PA 4XVCA 3M3HA 2QIOA 3HKZC 1Z4NA 3HDVA 2CN1A 4G0NA 1IHDA 3AKCA 4P81A 1DAFA 2EW2A 3RBEA 4TRNA 4EHKA 4YMLA 2Y9PB 2V7GA 1EFRA 2HU2A 3PP8A 3QEMA 4H18A 3BREA 4HVLA 2ES6A 2FDXA 3KJXA 4F11A 3CUEF 4R68A 2LYHA 4CTKA 2UV8A 1Q16A 4NS4A 1BAPA 1RFLA 3BSSA 2H0AA 4EB3A 4RAOA 4ZMBA 1OTYA 3HLTA 3KG2A 3MGCA 16PKA 1UFKA 4UMVA 3UCFA 3OX4A 2H17A 4LF6B 2AMFA 4LXTA 4QTUB 2V7VA 3NVZA 2EERA 1TVKB 1Q0SA 4O4HB 5AJXA 1K8XB 1O8BA 3UTDA 2LTAA 3QEKA 1RRPA 2MUTB 2WB1F 3EFBA 3KTAB 4REQB 5DGIA 1UP7A 2ZYWX 4KPUB 2BBOA 5LNK6 3PSAA 5K3FA 5D7BA 1Q83A 1QSGA 5EE3A 5TR9A 4G84A 1FXWF 4G23A 3VYUB 3HWRA 4UAJA 4A0SA 1Y5NA 2EZYA 1U8YA 1CY2A 2Q41A 2W58A 4ZO8A 2GEUA 2ALZA 2MOKA 4KGVA 2LM1A 4EY4A 1IM5A 3EQ7A 1A8SA 2DVMA 3OMWA 3VPDA 3K9LA 1DXHA 3KKPA 3RVKA 2DFKB 3TQIA 1Y9ZA 1W2WB 4N5NA 4OG2A 4DA8A 5BUZA 5BNTA 3C3AA 3RK4A 3KVRA 3AV3A 5DBIA 5IK2D 5E3HA 1N1EA 4XVRA 1RZUA 4MS1A 5EP1A 3PPVA 3T9CA 3UA4A 3ELYA 1YQEA 1IYZA 3ZDAA 4U7GA 5HF6A 4BY9E 3GZFA 1JBKA 1N5JA 2DC1A 3JZAA 3PYMA 5T6MA 1GQFA 3CRRA 1Q95A 3NOQA 4BNDB 3Q3IA 3IPLA 4DKXA 4KFUA 1S0UA 2X5NA 3BQ9A 2I3ZA 3HY3A 4R3UC 3FN4A 1JDSA 2L0XA 5EOZA 2LBOA 4EJSA 5HRCA 2ZBEA 1C0LA 1V1JA 3KKZA 4QXAA 3NP9A 4G81A 4FLMA 3UAXA 4FD3A 2XBMA 2JZBA 4I14A 3OETA 4B71A 4DSJA 1XYVA 1JHXA 1SBNE 2X2PA 2JLSA 3FPFA 1TK5A 2Z43A 3JQQA 3R8XA 1MIOA 1K1SA 2FLNA 1O08A 3PT5A 3EG9B 4ZT5A 4JQYA 4UB4A 3JQPA 4N7BA 1PZFA 2AN9A 3L7CA 1UL1X 4GEGA 3DB1A 3M6KA 5CP8A 4L73A 4JQOA 2Y9TA 1TTPB 1X77A 3NEJA 5FBHA 1UXKA 1A9XA 5CCBA 1CUAA 1GCIA 5IANA 4ND8B 1GPBA 4NZ9A 4TRJA 2IE0A 4GE0A 2ODNA 3H1EA 5F9MA 4PPNA 4MEYA 3BBLA 5FULA 4EI2A 4QM6A 3NC4A 4CBVA 2CNDA 5G3ZA 2FEMA 3CNQS 1IN4A 4TYWA 1FUEA 4DCJA 1NDHA 4DIEA 2L82A 3CQ9A 1QVZA 2ZRKA 4JP5A 1N6IA 4KMSA 1W47A 2I2FA 3T7DA 1V3TA 1J8VA 4LJ6A 4NJOA 4X8HA 1P73A 1T4CB 4IG4A 1WG8A 2ZRGA 3SSMA 4BGIA 1P60A 1QK5A 3OEWA 1QZZA 1MF7A 4FZVA 3ZHCA 1TF7A 3PW7A 1O77A 2Y68A 3AJAA 3I5AA 4FWBA 3ZWYA 1PJBA 4O2BA 2AE1A 1YQQA 1MXHA 4F5QA 2QJRA 1DC7A 1JG3A 1KK1A 3MUNA 3QXGA 3OEHA 3O8NA 3PFNA 4Y9SA 3VZSA 4ZCRA 5BOSB 3OQNA 1X7ZB 3VZQA 4JT2A 4DFMA 3HA7A 1NI4A 4Q7LA 4EDHA 3L4PA 1EK5A 5TVGA 2EKQA 1AC5A 4TMYA 3OJ0A 1XFAA 1CK4A 2ATXA 2QPTA 3PK0A 4F04A 3TX2A 3I6BA 2A1IA 5IAGA 3SYTA 2FGKA 3ZBPA 3MJVA 4NLNA 1MB0A 1NR7A 3H5RA 4KRYA 3TANA 4QAJA 1AQJA 1QK3A 8ICSA 2NNWB 7ICVA 5J1TB 2YICA 5GWXA 2WNIA 4LBVA 4ZOBA 4XRGA 1Q91A 1QIKA 4LDJA 1PBNA 1IBCA 3I45A 4RMGA 2XBUA 2TYSB 4LC9A 2QVZX 2EGHA 3FLEA 4DS5A 3OIYA 1C8KA 3DC2A 2FEAA 3DBRA 3P0RA 2JV3A 2QTVA 1L5RA 2WIDA 2J3DA 5E2IA 1Z0UA 1H2BA 1Z6AA 5KJEA 2HRQA 5J2DA 2IEDA 2O2GA 2JKZA 1G8JA 3CONA 2N0SA 3FFTA 3TNLA 2A3NA 4QHTA 4BN0A 4FINA 1TQ2A 2PFOA 1QGAA 3GNSA 1C20A 1D6NA 4B45A 2HEIA 1T10A 2X6RA 1D2CA 1X9IA 2ID4A 3RVMA 3IR7A 4MI1A 1D4FA 4UD6A 3ZNOA 5KVVA 5FPSA 1V2HE 1YL6A 2QZZA 4ZCQA 3OTQA 1G8YA 2NTJA 5ALWA 2CVZA 4J9OA 4LKOA 3B9JA 1AVTA 1QYDA 2GFIA 1G8PA 1NZBA 1Z5VA 2REXB 3C8DA 1NXPA 3E1GA 3NEYA 1IJEA 3OTWA 4JELA 4LDPA 4QBHA 4ZDKA 1TUEA 2WTUA 1RU3A 1SBIA 2OLKA 1C5KA 2GSDA 4G9GA 4CMKA 4E5VA 1L4UA 1UBRS 2QX4A 2A0WA 3LW7A 2UZ3A 4ECSA 3GUCA 4RIGA 2O59A 4GW3A 2XUZA 1LRJA 2FUG1 3JXEA 3W0LB 3F4LA 1R6VA 3KQYA 2C7GA 2GB4A 5BQFA 2ZAMA 3JASA 4IDAA 4URXR 4B6GA 2EKLA 4KUGA 5GONF 2OD2A 5AKKA 2Z0MA 1S0NA 3N05A 3RVBA 4AU1A 4JXZA 3UHJA 3QA3E 5J43A 4BQEA 1JEYB 2HBJA 3LT0A 4MR7B 3NHRA 2HA7A 3QLUC 1P2UA 3CE6A 3GRKA 4TWBA 1E3MA 4RQ7A 2IW1A 2B5WA 4CCSA 4ZIRA 4YJ2A 1NT4A 3JQ8B 4CR6A 4S0ZA 1IRIA 4WINA 1FNCA 7ICGA 2R751 1CR6A 1PJLA 5HJ5A 1C4KA 2KBFA 4KHZA 3SEZA 4CMHA 5AVYA 1AKYA 1KZ7B 4I2BA 4Q7EA 4QBIA 2RIRA 4K9PA 4N18A 4CWAA 3OJUA 1L5UA 1F0NA 3WIEA 4EM6A 1AT1A 2W6QA 1F60A 2D0OB 4G37A 2CRXA 1BWRA 3UPQA 3FTQA 4WZ6A 2PUEA 3PE6A 1ZH2A 1NP3A 1SC4A 3PVZA 4BGVA 1KXZA 4HDMA 1P80A 3B51X 4G56A 4C0KA 4NBUA 1IQ0A 3Q15C 5EJ8A 9LDTA 3WLJA 2MSDB 2Y1GA 4UREA 1E7WA 3PXGA 2R1ZA 3DNPA 3GH1A 4S3MA 5HF8A 5DO9A 4R1OA 3I8SA 2HWKA 1U0OC 3PHBE 1PL0A 5FBZA 2JH7A 4IV8A 5KOHB 1TIBA 4UPDA 5FO1A 4KAAA 4TKUA 5ALPA 3OSZA 4KWIA 4PPGA 1SVWA 4Y6OA 1JBEA 1EZ4A 4PIMA 2C1ZA 2PLNA 4DL2A 2MWMA 2XWPA 3HVJA 3L3BA 3V1LA 5J4KA 4BNLA 4R2MA 4U7PB 3LUJA 1J7JA 2IK8A 2XMZA 1RYMA 4GMGA 4K1XA 4TKMA 3E9DA 5IXSA 1UC9A 4UB2A 2PT5A 2F55A 1NW7A 5I47A 2P4SA 4BIIA 5ERXA 1WDWB 2QLLA 3LUFA 3TNJA 3RVSA 1O95A 5CB4F 3K05A 3SPXA 1SHKA 1K06A 2RKBA 3DOEA 1O57A 2BGKA 4TZ0A 1YR2A 3WGTA 5LVAA 4AF7A 5EIBC 4CL8A 2JAWA 2VJMB 3SC6A 4B35A 1JIJA 5BMVA 1EXDA 1NFQA 4NCJA 5E7MA 1MN6A 3U48A 3CJRA 1V47A 2AOWA 1BHO1 1JJIA 2LCFA 3IE0A 2D6FA 2KKVA 3AW9A 2ZSIA 3PC8C 4MW0A 2X86A 3W1WA 5F78A 1QRUA 3ILSA 3N7AA 4PYOA 5DLEA 3WGNA 1T9KA 3FZNA 1HEYA 2YJ4A 1DTEA 4WN9A 3UMGA 4E2FA 4C2BA 4W1SA 5K6RA 4BRUA 4Q3EA 4BLTA 4B2IA 1IWPB 1NLUA 1ZD2P 4X7RA 5I7HA 2OMEA 5AOCA 3IEVA 5L1LA 1JDBC 2V59A 3H8WA 2WJPA 2VYCA 3KYBA 3P2EA 4NBLA 1XSLA 5FQOA 4R16A 4B75A 2NV6A 4MCHA 4Z2AA 4QODA 1Q2UA 4P80A 3V8QA 3B1WA 3RYFA 3OESA 1DBSA 4K6FA 4B3BA 2GBFA 2Z9BA 3GLQA 2HHCA 3KTQA 1R74A 1ZH4A 5HCNA 1KP3A 1U5BA 2GK4A 3N76A 5C34B 4EF4A 4DV5B 5DI3A 3RR7A 1E3SA 1H2FA 4YT4A 4ZC1A 2HWWA 1QLHA 2FZKA 4Z8YA 3W8FA 4E88A 1VRCA 1E1KA 1JIVA 3K0FB 4J2HA 2BONA 2AGVA 2VTEA 3HBLA 4KXLA 6AT1A 4ES6A 4AICA 8ABPA 5B7QA 1R6DA 4R8LA 4QOJA 4PR3A 2HUNA 3D6AA 4QWDA 3DYBA 4ZD6A 3F6PA 4DR3B 3GNTA 4OJTA 1XGKA 2GPBA 1U2SA 2GEVA 1RWNA 2ZQYA 5AM4A 2XYVA 2VPTA 3DBRB 3SFTA 4ALKA 1RPAA 2WHPB 4N5DA 1NBAA 2ENWA 4HBGA 1CPYA 1S2DA 1VZ2A 2VXYA 4PX9A 2HLDD 4Q47A 4QQKA 5C80A 4V0RA 1KI8A 4YB8A 4ECUA 1T2UA 1B1CA 4XDZA 4PL1A 4QW9A 4I4LA 3V7UA 1G20A 3X1XA 5JSKA 2X58A 4LY6A 3M4ZA 2X5JO 3RS5A 2EVWX 3CEMA 2B3TA 3R7WB 3R4VA 3J81k 4A8EA 4WOCA 5EE9A 1J2NA 2ECFA 2KBEA 4ARIA 4HBZA 5DP1A 2P5SA 4C4PA 1AUPA 3GRYA 1DO2A 1PSWA 4Z0PA 3FMFA 5JQGB 2TECE 3LP8A 4FS1A 5ICEA 5J0PA 3MGKA 3B6JA 3RFAA 1L5QA 1NURA 2Q6VA 3HKBB 1YVRA 4U7WA 1YAHA 2KEYA 4PLZA 5ETJA 1ZVMA 4RPXA 5FR2A 5GTIU 5A5GA 4LC0A 5IABA 3EEOA 4ZREA 4EHAA 3TNDA 2LE0A 4EW2A 1XKXA 2JFFA 3E0XA 4ED1A 2WB2A 4IKEA 3RSGA 3JD2A 2XVAA 5K8TA 3JPSA 1CC1S 2OZLA 3GNLA 3MGAA 2ZI6A 1L1EA 3GRCA 1P3JA 3AJ8A 4R1QA 5C8XA 2BFPA 3JSAA 5FB3A 3OM8A 4E21A 3CLUC 3GA7A 4WX2B 1PVOA 3EW7A 2FPRA 1QH1B 2G72A 4Q9IA 3B5IA 2DX7A 4YXJA 2GF9A 2RGYA 2CV2A 2UYHA 1BPEA 1TMKA 3QFCA 4X6YA 5CVVA 1IVNA 2BIFA 1E3DA 2EBFX 1A9SA 3MUEA 4A0FA 2GPYA 1Z00B 3DJFA 4IDNA 2WTEA 2EQ5A 1PJTA 3JYOA 3IQGX 1MGPA 4MIOA 4J16C 1KL9A 1E0SA 4DHEA 3DFMA 3DMRA 3HA2A 3ESRA 4OI2A 3W5HA 2OXOA 4G85A 4HEQA 1HK7A 2ZJ3A 3AXTA 4BP3A 2B82A 2ZZNA 3TADA 4FLEA 1IQUA 4O2LA 3NV7A 4LOAA 1E1CB 2XMPA 2ZWPA 3LX5A 4ZHQB 3O1LA 5AQ1A 3FNRA 1E7RA 2XF8A 2DMRA 5SY4A 2P2LA 2VQDA 4UB1A 4NP6A 4L4XA 3ZGOA 4MKRA 1Q22A 1R00A 1PFKA 3IOCA 3OZEA 4XB1A 3QZ8A 1CZLA 2UVRA 4X00A 1HLDA 4UUPA 1QAQA 5CXXA 1XJ0A 2WINI 4CV3A 1R4MB 5IMBA 4DEVA 3QQPA 3A25A 1GZHB 1ZL2A 2FRXA 4OFZA 1M6HA 1OA0A 3F9RA 2LYBA 1TDJA 3EUB2 2P11A 5EHZA 3A6FA 4GI5A 3ICPA 3CF6R 1M1ZA 2WT9A 2Z8YA 4Z7NB 1JL3A 3ZQ4A 3OLVA 4TWAA 4D0SA 4OM8A 2J6UA 2VUSA 3L6RA 1VPLA 3RIMA 1V7CA 3KXIA 3IDQA 2I3BA 4DLEA 1KK2A 4S1OA 1XMIA 2CYAA 2X15A 2CLKB 3GELA 1EK6A 1Q57A 2OO7A 3A4IA 4JLAA 3N2LA 4I2JA 4P83A 1IL0A 1F5SA 1TU3A 1VJCA 2Z4TA 3NBZC 3NI2A 4HDQB 3D8BA 5IINA 2GDJA 4RH1A 3D1VA 5AT1A 3SC3A 2H7XA 4KCGA 5TT0A 4JBXA 4RK5A 3U19A 4PICA 1GVNB 2HSWA 4PZCA 3DHEA 1L8XA 4DYVA 2R6AA 4E22A 4JLWA 4EA6A 1Y8ZA 4AF8A 1NKVA 4IFEA 1RLJA 3GBSA 7ICFA 1MDBA 3BCHA 4IYRA 1DK2A 1JWAB 1ZJZA 2XKAA 3ITDA 5DMXA 3T5KA 2GAJA 2GBPA 1E18A 5M34A 1IXYA 1T2DA 1WUJS 3G6WA 4NIMA 1QIMA 1R10A 2O2YA 4TSFA 1LLDA 1U7OA 3QUSA 1PR2A 1X1CA 4ZQFA 2DY0A 2GOLA 1I0IA 1SQSA 2MSEB 1EP1B 2J4FA 1PJ8A 3H0MB 3O26A 4HB2A 4TXLA 1KDRA 3EK2A 4DCNA 4CKZA 1SIJA 2XOXA 4FC6A 4N8DA 2ZGVA 2Q3CA 4L5CA 4KUHA 3PB3A 9ICRA 2N1MA 4M0PA 1YHZA 5D3MA 5CP2A 1LLUA 2PZ8A 3R09A 1QFXA 5JTIA 1XRRA 2QUKA 4AXBA 3ZI4A 3ZV4A 5BN5A 2QZ9A 2R1TA 2K2WA 1FFDA 1IXRA 5AHRA 2OY0A 3U4AA 1ZNXA 2X3UA 3TLGB 2GN2A 4ASUD 3U7QB 2OXTA 1E5DA 1S2OA 4KLSA 2FK7A 3JPOA 1RI5A 1Z18A 3QEOA 3VC3A 5A02A 1U8ZA 2GK3A 5GONB 5AYVA 1IIBA 3IEUA 4MS4A 3HWSA 5CA1A 1JMKC 4JODA 1QV9A 4UMDA 2CNNA 4H7EA 5EP4A 4J9RA 5F5NA 3ND7A 1TFRA 2B99A 1D2MA 3PGJA 4Q1DA 4RFVA 5EP3A 5AUPB 4RFSB 2B8WA 3FNHA 4C01A 2HU7A 4UHEA 2OCBA 4B80A 1Z4LA 4B85A 1GLGA 1QIDA 3K0BA 2JZNA 3O4RA 3PLNA 2YWRA 5LD2B 2RHLA 1I4LD 5AI8A 1XZIA 4XLTA 4BKRA 1RXWA 1KHTA 1PX2A 1SOUA 1KPIA 2J5BA 3IFSA 2VYVA 1R12A 3NJ4A 3ROEA 2GRJA 1Y3AA 2R8BA 3WRYA 5HIMA 2H54A 2PX8A 1YB1A 2P4HX 1RZRA 2IS1A 4KJXA 2OEPA 3EGXB 4UCQA 3G8AA 5EFZA 2O5RA 1OXJA 3AMVA 4YDQA 1TECE 1WCYA 4UE6A 2B30A 4BJ5A 3MA0A 3U1TA 3DYIA 2RI6A 4R81A 3ADOA 4QWMA 2E9SA 3NOVA 1R27A 3DWEX 1KRPA 3HCDA 3OVMA 4OHUA 3ZZ0A 3OOWA 3FF1A 5KTRA 3MZ0A 3ZD8A 4KXNA 4ALNA 5LFAA 3MF4A 2NXCA 3PQ4A 1W49A 1S8FA 3CX7A 3T52A 1JN0A 1DFHA 3NRZA 1J06A 4F86A 3EC2A 3UJ8A 1ZOSA 3I3SR 4ZJYA 2GAOA 2YHSA 1GARA 2FQYA 2CKDA 2P4QA 3BRCA 3I9V1 4RJJA 5FUWA 4DG5A 3UQ2A 4I55A 4N48A 1GDTA 2IA6A 1RIFA 2DLCX 1M72A 4QYSA 4X8OA 2NZJA 4R8RA 2ZXFA 3MWDA 4OGKA 5KNCD 5TQJA 4LF7B 5CPBA 2NQ8A 1SG0A 4Y67A 1EFCA 3E8MA 2IVZA 3R4CA 4LRSB 5KKAA 1T0BA 3JCZA 4NYJQ 4O3QA 1IQRA 1DXQA 5K05A 1CQXA 2RGEA 4O2AA 4XAQA 3NWOA 1DJOA 2JS7A 4UBCA 4PZDA 4QZFA 5AW9A 4ARZA 4PLPA 4FMBB 1Z88A 3QKSA 4HPXB 4RM3A 5KVAA 3R8CA 4G5SA 3FB4A 1XTKA 3EWIA 3PIIA 3HBMA 3T5GA 4BFCA 4PIVA 4MW9A 4H6PA 3C6KA 4X20B 5ALHA 4B9VA 1E3EA 1EB8A 3GJYA 1KBUA 3JVVA 4DBZA 3MK31 3C4VA 3D2QA 4KO1S 1UDWA 3ZY3A 3KEGA 4HLUA 5JBIA 1HDXA 5G0SA 2LVBA 1RRCA 4K6KA 3EMDA 1EJBA 1KGSA 1WUKS 2P68A 2CB0A 2EQBA 1ST2A 2R65A 3FETA 3TGPA 2V7TA 2LM4A 5BVHB 4UUMA 2PY6A 1F0MA 3HN6A 4N03A 2PFPA 3WGMA 3RF7A 4AT1A 5AUOB 4OLAA 1MJNA 1T9BA 2OA0A 3R7SA 1U1EA 4PCLA 3GLGA 2VJ4A 2GZ1A 2NZ8A 3QHPA 4W1RA 4FQ5A 4F9TA 1LTHR 3ONNA 1GDDA 1QR6A 2P1RA 2PGIA 5J0RA 1EZ1A 3VDRA 4D6YA 1UPTA 4XPIB 4XJTA 4Y6LA 4QICA 4RTSA 3IVGA 1H1LB 2PX2A 3U4HA 1WOMA 2DWUA 2PKYX 2ZYDA 1VL2A 2EW8A 4B6OA 2DBZA 2G1PA 5JNLA 1FTQA 1TU0A 4N47A 1S9HA 4W8OA 2JZCA 3ZV7A 4JP3A 2P7HA 4UEWA 4O3OA 8ICCA 1SR8A 1EFRD 5CLLA 1KRXA 2PUGA 3DE0X 4KLIA 3O74A 4BLRA 4G97A 4QPNA 4NDNE 4TV9B 2PAAA 2HMYB 3FFAA 3QLJA 3MVEA 4QXPA 2W9XA 4DY6A 3OJWA 3UCEA 3PDJA 4CLRB 3JQBC 5LZ2A 4TV8B 5B1IA 3QELA 1OILA 2PKQP 5H0IA 4AJLA 3BF8A 1KLNA 3PFWO 2UVUA 3K9NA 4KLTA 221PA 4ITRC 3I2GA 4OQEA 3S81A 2XE6A 3OLXA 1PWXA 5KG1A 5H4GA 3WDLA 1WZ2A 5DG7A 2ATEA 2NO4A 3NALA 1Y5LA 4N49A 4AY4A 1S8NA 2E85A 3TFOA 4ND5A 2ZSEA 4I5GA 1RACA 5EZSA 1WMBA 4U63A 2BF4A 2PGJA 3CA8A 3CZAA 2FMIA 3HBAA 2A4KA 2V4QA 4IJMA 2BR4A 4HAYA 3TXYA 4DV2B 5CH3A 1J09A 4CEIB 1DQYA 4R9SA 1SVUA 4MQUA 3JD1A 3D59A 2ZI9A 4REMA 2EG9A 3OZVA 2FSVC 4H1HA 3ONWA 2W11A 1QVWA 1UQTA 3UWMA 5M7EA 2RH4A 2UXDB 1Y81A 1X70A 7ICKA 3K9HA 1FFXB 1T5TA 4HFJA 2YQ5A 3HG7A 4J0CA 4LJXA 3WYDA 1CEEA 2YUIA 4DTCA 2O19A 3V3KA 1O4WA 2GM3A 3QMMA 1ECLA 3HE3A 2G0TA 4FNAA 4MR8A 4MROA 3JQDA 5KQRA 2BD0A 4HUQB 1B16A 3WRXA 1Q19A 4COKA 1RM4A 4NJ8A 2R7MA 5BW4A 3A32A 1N3LA 4V3BA 1OH8A 2CNWD 1DV2A 2P6UA 3DMTC 3KXDA 3U0VA 3VNAA 7YASA 1TJYA 8ICOA 4HZIA 5DT2A 1CQZA 1JVNA 1U0FA 4TZ6A 1TCBA 2VBFA 2H57A 2Q4DA 4IHQA 4HWRA 3FKJA 3A2MA 4UUOA 1AMOA 3MCWA 5K3SA 5KT4A 1B8PA 5K6TA 1Z5NA 3HSSA 4TLCA 5BV7A 3NTVA 5D46A 2VEOA 1U8AA 1TPZA 4XKJA 4Z51A 1II0A 1XZ8A 4I4IA 2VTDA 4XSGA 2QAIA 5FV4A 1HFWA 4MQEA 3TCNA 5HIKA 4Y9DA 1KP2A 7ICSA 4FKMA 1XYYA 2HCBA 3Q6MA 3EY9A 2ZAGA 1RC1A 4YJGB 3OZFA 4FR5A 1NUQA 4LKRA 4J16A 4BQFA 4QZVA 3M49A 5KFZA 2FSHA 5AKXA 1E9RA 2P3OA 3VZBA 2BEUB 5THQA 2VXBA 2ZZKA 3N7TA 2WSLA 3TRFA 1ZQJA 1YR7A 1XUOA 1B0ZA 2M98A 5ALTA 4I28A 1ZVJA 2MTBA 1SOWA 3AR8A 4WDRA 4RTPA 3GGSA 4HH0A 2PKXA 3ZI7A 2AVNA 4TURA 3H0RB 1G17A 2QF7A 3KQMA 1TJNA 2AMYA 2ILTA 3L82B 3QVOA 1KIAA 4RDCA 1FIUA 3R6DA 1S5LU 3DDUA 4C7OA 2C03A 2NO9A 2FV8A 1N34B 3FKSA 4IJ6A 5JSUA 2FDRA 3L4EA 2XYHA 3S5JA 4UHCA 1KS2A 2C28A 2Y67A 1APBA 2COEA 2WHEA 2K6GA 3ASYA 3O4GA 4N6NA 5LYJF 2BGWA 2P41A 1XWLA 3ZWNA 2VA3A 2JA1A 5NULA 4EUEA 1C0EA 1CETA 1MJ5A 1OGJA 4KEAA 4QUIA 3K96A 4Z49A 4M6WA 2QB5A 4H08A 1VP9A 2QQGA 1TD9A 4BECA 4RGQA 1VJ5A 5DTEA 5JAHA 1N6PA 3FE2A 3OUTA 4HVCA 1XAGA 1T91A 1WW2A 4BE7B 4J0EA 3V4FA 5J2UF 2FPMA 4F4YA 3PE4A 1ECWA 4X97A 5REQA 4V03A 2EFJA 1YQDA 1W4AA 4MUKA 5T4HA 2AXEA 2WSSA 5AKYA 4KNWA 4M1YA 2D7DA 3URMA 4EEKA 4L57A 1GV0A 2VHWA 1A3CA 1LVGA 2BE9A 4PAMA 3HDYA 3A4MA 2HIGA 3HPRA 3D3QA 3C28A 4ZQHA 1QPGA 3AB3A 4FJ2A 2CWDA 1E62A 3HWX1 1LPMA 1Z2DA 5J8YA 1Q1GA 4JMLA 3T9AA 3NEPX 4RV5A 2BPFA 4L75A 2P69A 3KOZA 4IPTA 4KQIA 4LZOA 3HQ4O 2Q0SA 1U5AA 2AHRA 3DTTA 3E82A 3V80A 1DC3A 2XUJA 4KPEC 4D25A 1MENA 1VECA 2AT1A 3DLTA 1GTL1 1NDQA 4QLAA 4XQGA 1FU8A 4AO6A 1E6UA 3USES 4J4BA 3QZ7A 3CXUA 3KSAC 4CM1A 1E3IA 4QW8A 5ICMA 1QHNA 5AD1A 3CISA 2C3OA 1MOQA 4V0NA 5TPWA 1KWGA 4OJNA 5LYYA 2IU4A 2ADOA 1FNSA 2LNDA 2Q1YA 4H2DA 3X1MA 4A1FA 5AW4A 5HK9A 2HNBA 4ND1A 1YHNA 1ODLA 4YRNA 3D4PA 4XIIA 4TQAA 2QRHA 3CLTC 4OHMA 4RVCA 3U9TA 4EJSB 4ZK6A 3C87A 3R0IA 4L6IA 3ZYCA 4PE5B 1FQWA 1OAOA 1F2VA 1WULS 3ZHBA 1I7NA 3NC0C 1J2RA 1M5UA 2Q2NA 1DG3A 1OLXB 4TTAA 3MJ4A 1U65A 2IHZA 3ZDEA 5FXMA 1ZW6A 4G1VA 1SURA 4O3SA 1LTQA 1MX3A 4IC9A 2WUDA 2PWAA 3BMQA 3U17A 3ONDA 1GAXA 1OW3B 3ZVKA 10MHA 5HF9A 1JDNA 1TCUA 3HFRA 1D2RA 5B12A 3PJGA 3KOUA 2WJWA 1P18A 4IXTA 4MPRA 4AO7A 2BGGA 5KPDA 2B6NA 3NS7A 5JC1A 3MDCA 1VLQA 3LC7O 2C84A 3OSNA 8ICMA 1GTMA 1SCAA 1VBKA 3F5FA 3M5WA 4H7FA 1NATA 4O2BF 3CLSC 5A7HA 3FOEC 5FI0B 1J8MF 4NYIQ 3O8OA 2W90A 1J0CA 2SCUB 2VLBA 4YQWA 1E9SA 3N2GA 3O0FA 2JGJA 5K3DA 5B2FA 1CIPA 1T3HA 2I6GA 4GL2A 3MLEA 4GSKA 3F6EX 1PJZA 1ZKMA 1QWSA 1YU9A 2BI4A 1DAEA 1GUBA 1GKKA 5H02A 2FMFA 3TLMA 4X5OA 5CXQA 3FUUA 3BHIA 5JS2A 4B4VA 1TZBA 2HNAA 2YCBA 3DO5A 1QYCA 3H13A 4J49A 1EM8A 4PZZA 3F0TA 3RABA 3OPVA 4XPZA 1V5FA 3NBXX 1XN1A 1ZUNA 1S3GA 1CUHA 2JIQA 1W34A 3ESCA 4DSFA 1IMOA 2O7QA 1KSGA 4DCTA 2YVAA 4R6WA 5FTKA 1MRZA 3DL7A 4FGLA 4NBRA 3JRNA 2VT7A 1KEKA 2Z57A 4JBWA 1LJ8A 1OV6A 2RGBA 3BSYA 2AJTA 3MD9A 2P2NA 2VNHA 3EVEA 3OPXA 1Q1NA 1PDVA 2W2XA 4DMRA 5BNFA 4RANA 1S4MA 3TBHA 2ZUBA 2AOVA 3VO9A 1QF6A 1E0AA 1BFKA 1CUXA 1OOEA 1REQA 1V8DA 2IY8A 1EHYA 4RF4A 4F9FA 3I09A 3T5HA 5A9TA 1R0XA 1LB2B 1Z2PX 2GESA 2VDLB 2IEZA 1MNAA 2Q2OA 3O4VA 3MSXA 5AO9A 4BWVA 3RF9A 3EWSA 3EIOA 4UDXX 4CM3A 4D9BA 4AM8A 5HOQA 2XXAA 3VNVA 1RYUA 2VJBA 2VK1A 4QOEA 3TIGA 4FOOA 4UM9D 4W5NA 4JCCA 4S2EA 1S77D 3ETEA 2YHBA 2Q07A 1N9GA 3JQAA 3OJLA 4FUQA 4Q0MA 3TLBA 3UYKA 4LG1A 2ZTEA 3P0EA 4XUEA 4XYEA 3S29A 3VZDA 5KC9A 3SQIA 1SK9A 2PXAA 2XTJA 4LYJA 4WOBA 8ICFA 4F3YA 5LQRA 1XEXB 1OXXK 5CPFA 2C4NA 2D00A 4HRYA 4TLEA 3W6UA 4JV5B 3RFVA 3BB3A 3TZLA 1L7PA 1MC4A 1WXHA 3BQ1A 4FGSA 4M1ZA 5DCLA 1JXMA 2Z7JA 5I7UA 1N9ZA 3MWYW 5LBIA 2FWNA 2X1HA 4QTZA 1JRLA 1SV0A 3DAPA 1ZITA 1B0XA 1P33A 2XNKA 1WLSA 2YXPX 3EZ2A 4ZJPA 5KOJA 1NOJA 3HB4X 3G6XA 2WWVD 5B7PA 5H9VA 1H9CA 2WHQA 3K73O 3WDMA 2HA4A 3O1IC 1D9ZA 4CDRA 5L3VA 1ORWA 3A2KA 4JQCA 5TSDA 4DBLC 2CJWA 3ZJTA 2E87A 2JGLA 3AEQA 5H16A 1N5IA 2IDZA 4FN4A 4FCTA 4YIKA 5CA0B 4DADA 3BQMB 4RU9A 1N5MA 4LRUA 2FN8A 4FPXA 2EP5A 1FFVA 5D3QA 4MRPA 8ICAA 3PNVA 4I6EA 4PRZA 4Q34A 4UNNA 5KREA 5L9AA 1DBPA 2YWCA 4NBVA 2IRWA 3SQDA 3VSBA 1QVAA 3OZUA 4Q02A 4B4OA 3PY8A 3AFMA 3SIXA 1JI0A 1X7YB 2IYNA 1IBRA 1D8TA 2O2CA 3KPJA 4MWTA 4D9MA 3GPLA 4XM1A 4S1TA 4BNFA 1ZQ9A 1U8CB 1UH5A 4GXQA 4IDBA 3SLRA 2NU8B 4RQ5A 3OCVA 5I7FA 2RGAA 4L02A 3OT5A 2KMDA 1S1MA 1VG0B 3AERB 3O1JC 3N6VA 3A3PA 5C5JA 2YVKA 3STVA 2WVHA 1A9PA 2H48A 2EJWA 2C2KA 5EJMA 2IV7A 4BLWA 1L7OA 1CUUA 1LSJA 4X85A 3O21A 2V6IA 4N65A 1ZN8A 3A11A 4RE5A 1P2GA 3NASA 2R8EA 3BZBA 3LHSA 1USWA 4QJFB 2ZB3A 3EA5A 3LK6A 3P19A 1PT8A 3ANXA 1HWYA 2WK1A 2YQEA 3FX2A 1NBME 3MWGA 2NYVA 4YMOA 3QUAA 4UVEA 2C9ZA 5CXSA 4CCWA 5KYYA 2A59A 5F7XA 5FBVB 4TMXA 1HOTA 4A23A 4DQSA 1G41A 4YJ2B 4ADSG 4ZIRB 5IT5A 1P8JA 4IIJF 4HGOA 1OI4A 2BCGY 1LS1A 1JAHA 2PNJA 4ARUA 4D56A 4R2IA 1KIMA 3WK5A 4LJ5A 1AURA 4KWTA 3G3EA 2H9YA 4HDMB 9ICGA 1QYRA 3Q1LA 4YWHA 1EZZA 4E31A 2NUAA 4A73A 3ZE8A 5B4UA 2REQA 3PO4A 2PA3A 2X3YA 3RI3A 2O2IA 4CN9A 2JFBA 1SG9A 3N07A 4MV8A 3MNFA 1K6XA 1N0HA 1ANKA 2AR9A 2PXHA 3BIXA 3U3ZA 4BN5A 5HUJA 1Y6GA 4AIRA 5CYOA 5EJ7A 4B3TB 2WU1A 4O2RA 1L4NA 1YFLA 1T9CA 2AG1A 3LWDA 4N7RA 1P5JA 4EZIA 3QPUA 5C5EA 5LM3A 3GJZA 5KFCA 1YRWA 7ABPA 2AJDA 1UMCB 1GL9B 1KJWA 1W5BA 1ZFNA 2ARKA 2HO5A 3CUUA 3GCDA 3LVBA 1BHQ1 2NXJA 3IQIX 3QPAA 5IH3A 2ZJ8A 1S8AA 5CNJA 1XXHB 2I22A 2BHTA 1W0KD 5GM1A 3ROPA 4IIFA 4L5AA 1E92A 5AK6A 4RELA 5KOHA 2HLNA 4P5DA 3ZGXA 3UBMA 3DLIA 3G0IA 3ETRA 5DLYA 2G82A 2N1RA 1FDTA 1WCNA 3V8RA 1HV8A 1PVVA 1M8JA 1OFHA 4L7VA 1K08A 2GK6A 5HF5A 4EF6A 2HTEA 1JDJA 1QHYA 3C29A 1Z0KA 3AUAA 2LCIA 2TMDA 3BMNB 1HX7A 3PTZA 2GM5A 2X9GA 4GVPA 1SK8A 1ZQKA 2EL9A 2GEDA 3CKYA 2A7XA 3HKCB 4JI7B 1ISJA 4BC1A 4E5DA 2EEPA 4DWJA 2QPAA 1GPMA 1Y3DE 3F3SA 5JYDA 4UU0A 1O94C 2FFAA 2XICA 2GH1A 3DUFA 3G7UA 4B4KA 4YCSA 2W71A 3KJNA 1N32B 3VTKA 1EYZA 2M1XA 3RS3A 1Y4AE 2Y0PA 5TLSA 2UXCB 1SKUA 2Y1XA 1D2GA 2M6SA 1CNEA 3H1BA 4CG2A 3COWA 3TD6A 4CLDA 4QKQA 5BXYA 4HDSB 4JL5A 4ZJUA 2YWBA 3K9QO 2BLNA 3DBLA 4MRVA 5CLIA 2YC4C 2ZE5A 4KQHA 1EQAA 3Q11A 3OIUA 2ADFA 3OX2A 1MTZA 1BROA 1U99A 1U0JA 2O1WA 2G1JA 2XB4A 4V0OA 1A69A 3HCPA 4ZCPA 2HSJA 2H9IA 4K4HA 4R40A 1PZEA 3IOEA 3GZNB 3BA6A 2ODGA 2AF4C 1X1RA 3OTGA 4Q7JB 3F5DA 2J8ZA 3S2UA 1NWCA 2AR7A 2JEIA 3C5EA 5AKIA 3IAM1 5HS6A 3GCXA 1VHWA 3O95A 4CDNA 5C1OA 1B2LA 5KG2A 4DXDA 5A6VA 4QDOA 4QUJA 1L5KA 4JOSA 1IHOA 3GP8A 1GQOA 1TI7A 4II2A 4M4SA 4O5CA 2A9PA 3IUBA 4ZK2A 4LDAA 5FX2A 4AYBC 3DHYA 5L1MA 3N39C 4PAOA 2V65A 4O02B 3JQGA 4DLXA 1LXCA 3FPHA 1ECBA 5BRAA 1VJGA 3LL7A 5KUTA 1DP4A 2IHTA 3OO1A 5K51A 4MJ3A 2NO7A 5EGSA 2WC1A 2WW8A 3H2IA 3BRWD 1DQPA 1KORA 1E7YA 3FWKA 3B52X 4R8SA 4XFDA 3GI1A 2H4YA 4GP6A 4BJHB 2QUAA 3BB1A 5DTRA 1T6ZA 4OM7A 3E3LA 4B3SB 4OFXA 4E3WA 4YAGA 4AY5A 3M6VA 2BZSA 2RBEA 3C8UA 1HDEA 4FT4A 4WZAA 4EHIA 4H0NA 1U0EA 4KP7A 4DNOA 2WHPA 3V1MA 1K88A 1EJ0A 1YUBA 3AVOA 3NORA 3PXCX 1UJNA 3VDMA 3WNVA 4ZYYA 5DJ5A 1NK5A 2YXLA 3EA4A 2HDOA 3CF2A 3EGDB 4ECYA 1FIQA 3RJEA 2V9CA 3I8OA 4OBWA 3R8FA 2H85A 1M1YB 2AQ4A 4YHBA 1WLYA 1G21B 2WYWA 4RCYA 1O1YA 4MQFA 3C3BA 3FRIA 4BQSA 1G5QA 1T5LA 3ANTA 3CSUA 3KB6A 2PRJA 3UFXA 1F8FA 3LCVB 3PU6A 5FTWA 1SIOA 4TVKA 3KT6A 1U5CA 4OFBA 2AU0A 4RL4A 5KTPA 3WIOA 1BDIA 2HT1A 3UJDA 2Z6UA 1PNQA 3KS9A 4MKGA 4OU4A 1HZZA 1SXJD 1VPDA 1XHFA 4FYYA 5DDIP 3A14A 3UK7A 4CIBA 1OPRA 2FE4A 2PR7A 1CJKC 3HKBA 1ID8A 4E70A 1LZKA 5KQLA 2I4TA 3CGGA 4KIJA 4LDRA 1A4IA 5GV7A 3AEKA 3GAAA 3HUTA 3RTBA 1MUUA 5IIJA 1NG1A 3AJ9A 3N75A 1P3Y1 3ZHYA 4OSEA 5F5LA 1ZEJA 1NLFA 3BD9A 3A9CA 3N2KB 2E89A 1BW9A 2C42A 4Y2GA 3WAGA 4DFKA 4BYGA 9ICUA 3ZXUB 3K2EA 1JKFA 1C80A 2FPPA 4EJMA 5KFDA 2BELA 1JA1A 3DEKA 1U98A 3LI2A 4MGEA 5DK4A 3WV4A 5ITZA 2WJZB 4J1TA 1K66A 1C7ZA 5HZHA 4C1BA 1V6CA 1UWKA 4HNSA 5LJIA 2CYCA 4ISBA 3VUFA 1B0PA 5JROA 2BMJA 3AHDA 4JWNA 2PUBA 3B85A 4IMRA 1JU4A 4K8OA 1FFUA 2GYVA 3X43A 4DV3B 1G38A 1E1CA 3IC5A 5C7YA 4OF4A 3LC2O 1KDYA 2QSZA 1E9BA 4BXOA 3RPEA 3G2KA 4XUDA 4BWFB 3O8BA 4MVWA 2K8CB 4EHDA 4XQ8A 3FUTA 3JAWA 3NUGA 5KJ1A 2FN4A 3HDQA 4P4SB 4X45A 1VLLA 4BGEA 5JIBA 4MZDA 1YBVA 4W5RA 2BSAA 2DGDA 3I2FA 1FDVA 4D46A 4ARBA 2HXGA 3KELA 4W9NC 1QANA 2K4IA 5HCIA 2F43B 4O4IF 4QOGA 2JAHA 1NE7A 1RQRA 2D8AA 2NPFA 3HBJA 1A98A 2OWEA 5CAEB 2O8FA 5JD3A 1UT8A 4MUXA 3MGBA 3BZWA 3VM6A 4OB7A 3HRDD 4JK3A 4A0RA 3ZVMA 1W8IA 2WKRA 3G2IA 4S24A 4IH4A 1AOXA 3TL6A 2AV6A 3W9SA 9MHTA 1OLOA 3Q4GA 3A0UA 4JYBA 2ZIWA 5FWYB 1XU7A 4NPHA 4ECWA 2OCPA 4OK6A 4CHTA 1V11A 2G4CA 3SYMA 3GLIA 2I55A 5HX7A 1XL1A 3Q0TA 1CW2B 3WV5A 1Y42X 2I3DA 4PR0A 3FFWA 4MWOA 4F4CA 5TQ2B 3SR6A 1WUHS 2JBAB 4EDFA 3MBIA 1ZQNA 4ECVA 2HLHA 4AP5A 4J9NA 3BORA 3ZLVA 3C6QA 2AI3A 3O8DA 2B8TA 1L5VA 1YDHA 4FNOA 2BCEA 1C1YA 1QO7A 7ICMA 2P91A 2O9JA 1DTWB 2JAXA 5DXAA 4ZAFA 3LP6A 4BGDA 4LUCA 3VO1A 1P17A 1XCLA 5KCMA 4EHFA 1PK7A 2VDQB 3KR0A 4I46A 5CDHA 5JQGF 3NOOA 5K4GA 3KALA 2PXCA 1TOAA 4EUNA 4MAFA 1D07A 2FQWA 3QG5A 3EW9A 3PEWA 3IT1A 3NIDB 1DJQA 3HBFA 2EV9A 3O92A 2DF8A 5FTJA 3AM1A 1UEXC 3N5KA 3SXPA 3PZPA 3EVGA 1OH5A 1N1MA 2KD1A 4EX6A 3KJHA 3PPXA 3WKCA 3GWZA 4WXRA 1IOZA 4C0SA 3O5AA 3DOJA 1EXNA 3SVZA 1MH9A 4QUHA 3GFPA 5CMLA 5JYBA 1UCVA 1KFKB 2CXHA 2UYQA 4V2UA 3TR5A 4A9AA 3GO4A 5KDOA 1G2IA 1EIWA 1R8YA 4DARA 2PJZA 2HRCA 3IAEA 3ZBTA 3ANYB 4KG7A 1I9GA 5ALEA 3G5TA 4WXYB 3RH0A 4DLRA 5F23A 3Q8RB 2G1UA 3BTOA 3OPNA 1PHPA 3BD8A 5DNUA 2I1QA 1TPYA 5H83A 1X7HA 4RK7A 1CQJA 5IJ0B 4YMMA 1JQAA 1NXOA 1RP1A 2CJPA 4NDZA 3WQHA 2PKCA 4MS4B 4DL7A 3EXEB 2NP6A 1N5XA 2ZJ5A 2JCGA 3H16A 1IB6A 3ORFA 1NT2A 1GTRA 2IEBA 2VRCA 1KMMA 2ZSKA 3LMKA 2NUPA 2FETA 4RQ2A 1MPTA 5CB0A 1S97A 1XD9A 2IQIA 4GKKB 3LZCA 4OOFA 1DG9A 1VI6A 4INAA 4BLQA 4YCAA 1A0PA 4L22A 3SHOA 1U2TA 1AKUA 2J6HA 5DYYA 3BFJA 3ST7A 2H7YA 1JDTA 2HGSA 4Q18A 1ZNYA 4GX1A 5HG0A 3W2IA 2IYAA 2WG1A 2G4LA 3IUMA 4C4XA 3INRA 2UVWA 1NVAA 2ONYA 4FUTA 4WAUA 4QJ3A 1Q17A 3UYLA 4AI6A 4EYSA 3OE7A 3L05A 1RCUA 5JRDS 2HADA 4FFBA 4NBTA 4CUJA 4MEBA 2RHHA 1P3DA 1UKZA 3I28A 1ORVA 2AEMA 7ICUA 3ORHA 4DL6A 5EEHA 4J91A 2C22A 1K0UA 3OLCX 1AV7A 3QVUA 2QMUA 2RHJA 2YXDA 3QOWA 2LWIA 1KO8A 4FLFA 1G6HA 1KZHA 5HPYB 5I4IA 1TK8A 4H3HB 1G5IA 2FW8A 2O07A 3ZDRA 1FMLA 4CQMD 1FVOA 4YASA 2RH5A 4BNHA 5FBLB 5HKBA 4V39A 4UB3A 1R4NB 4RQ1A 1E2DA 4MYTA 3UFXB 5DCUA 1JFFB 5LOVB 1W1UA 2JJ2A 3N8IA 4L72A 1G0OA 3BWDD 3M3PA 4K05A 4QRDA 4XLZA 4YWJA 3EZ7A 1N6NA 2PX5A 3PGXA 1SL0A 2K89A 3GMDA 1AXEA 2W2VA 4Q9KA 4RA6B 1XTIA 3PX6A 3E2EA 2BZGA 1M8FA 4JI6B 2YZNA 3RUDA 3IOBA 2KKPA 2FCAA 1EG7A 1IEXA 1FMFA 5EUBA 2YV4A 1Z63A 3O8CA 1W52X 4O4IA 3D3WB 2WAQC 1UBHS 3AHJA 1O6FA 4PZ9A 4QYMA 4U02A 3WA7A 3BTUA 5KNBH 2QVGA 2E8MA 1B00A 1U0GA 4LF5B 4Z2YA 2GBLC 2QI9C 2FMKA 3K8QA 4IIVA 3SQLA 4UAWA 4OATA 4U7JA 4DQDA 5CR0A 4YT5A 2ECOA 4WERA 3L07A 2VZEA 5DGAA 1C2YA 4FP9A 4RCZA 3U37A 3GIKA 2ZIVA 1WCV1 2DPGA 1UAYA 3A27A 2FPSA 4J0QA 2FP4A 4JOCA 3QLVA 4LXIA 4OYRA 5T8KC 3TQCA 4ZI3A 1Y6JA 4C4AA 1V45E 4Y7CA 1ZGAA 2ZB2A 4I50F 2AYXA 3HYSA 4MQLA 1TVKA 4QFCA 3UXMA 5LLDA 2AHOB 3FUWA 4QLBA 1CLEA 5H80A 2ODAA 3EGEA 5KFOA 3A6KA 1XD2A 1XDDA 4TLAA 9ICQA 5M3BA 3VH1A 1I01A 3G2PA 2QV7A 3SF8A 1IG6A 3K4PA 1PWHA 5KG4A 2JH8A 4WKCA 4KQFA 2WF7A 2K87A 1CEYA 5CCDA 1C9DB 1XTTA 3FYSA 3MD0A 1X92A 1YS6A 2WV9A 1X74A 3EARA 1WMFA 3UXHA 4WN9B 5L45A 2WILA 4DVGA 2FX2A 1XMQB 2QWXA 4KE8A 4WASA 4DQQA 3Q7RA 3II6X 5BO5A 1ODTC 3AO0B 2Y05A 1HL7A 2W3RA 4O3RA 4FONA 4HAZA 4WESA 1TU4A 2QQ0A 2R96A 3CPEA 4FJ0A 5JECA 2NU7B 1DCKA 3H2SA 1YBAA 4G4SO 2BGTA 1Y8RA 3VV2A 2C94A 3A9UA 4Q16A 4YAEA 1GZ7A 4ECAA 3K30A 2XDQB 3K9BA 1NJZA 3H9UA 1SMKA 4CNQA 5DM1A 3X2SA 5J58A 2P66A 4GMFA 2FUEA 2R1VA 5DB6A 1QV7A 3NT2A 1X7DA 1FVHA 2A9OA 2CXPA 4O08A 2HRRA 4TXJA 4YH1A 5KAMA 1KYWA 3B2QA 1V4BA 2KJ9A 3K6KA 5F1KA 4AUKA 5TQ2A 3HXTA 2BOVA 5AVRA 2HIHA 3IX7A 4E08A 3RWOA 1FNMA 3M4YA 3ZLJA 4KSCA 1S0MA 1G9TA 1GZ4A 1XT6A 1FRZA 1G2QA 5A0TA 1ZEMA 1M2GA 3MUFA 3HN7A 3KLOA 4W6ZA 5ED4A 4J9KA 3NHFA 3R0XA 1GWNA 4KQ6A 5IP5A 3BD7A 2E4VA 3LBIA 4D4KA 3L92A 4C7JA 5AKEA 2R8KA 4QGHA 2G5IB 1T24A 2RAVA 4RKFA 1HDIA 2AA3A 5AOAA 5T64A 3ABZA 5AJVB 4JUDX 4BBAA 4E15A 2YV3A 1MC8A 2VO1A 3WYAA 5CXUA 1NOMA 2DAPA 2P9BA 4LZJA 3GJQA 1L8LA 2Q0HA 1G3QA 2Z2KA 5ADHA 3LVFO 4FYIA 3VYTB 2H2HA 3WADA 2ZTHA 1N75A 3QLUA 4CFZA 3B1YA 3IPRA 4KODA 3ZH9B 4Z9YA 1VHQA 2ZJ1A 3GJRA 4TPKA 1ODJA 2NG1A 4ZA2A 2CDAA 2QGZA 2XITA 4IIXA 1GU0A 1B76A 1U3FA 2QRLA 2Q1SA 2WJHA 3NAMA 4BO5A 3NKVA 4HAVA 3GGDA 4LXUA 5KX5F 1GY8A 1V1MA 3QYJA 3VKVA 4F5YA 4BRSA 1L3IA 1SIWA 4QFBA 4F6CA 1I9CA 3ELDA 1TD1A 1TZCA 3TJMA 3FNIA 3L4BC 3AP1A 1II8B 3DEEA 3KFUF 2H4FA 3UK2A 4B44A 1N78A 3FOWA 1SUPA 3FFBA 3LLSA 3JVUA 1K3FA 1RFGE 4B9MA 2IWHA 5ADUS 3OEHD 2NU6A 3ACCA 1BE1A 5AQEA 1N2JA 2X14A 2Y0BA 5JATA 1WOYA 2A86A 4EA9A 2ZJ7A 1YS4A 4TSKA 3AUXA 1DRWA 3BPSA 4QATA 3RJ9A 1XCJA 3JASB 5H81A 2Z2YA 3CRNA 1KJ9A 1Z56C 2WNHA 3H7AA 3KPUA 3KTFA 1LKYB 4J1TC 4AK9A 4RD1A