4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
b'VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
2MU2A 5AIAA 3QU4A 3QUTA 3KBBA 3SHQA 1ZJJA 1CR6A 5AW4A 5AW3A 4XPZA 1U7OA 2O9JA 2PKEA 3BA6A 4Y2VA 3EF1A 3QX7A 3SD7A 2FPUA 5ALYA 4UAVA 1N9KA 2HF7A 1S2OA 5AI8A 1XVIA 1F5SA 1T9ZA 5AM4A 4QQFA 4XQ0A 2FUCA 1ZS9A 1L7PA 3WK5A 2NO4A 5AW6A 4E88A 2GO7A 4BBJA 1KYTA 1XP5A 2B8JA 3GYGA 3R09A 4OHFA 3IJ5A 5AKJA 5AVUA 4H1WA 2EAUA 2ZXEA 1RLTA 4I9GA 1T5SA 3ZWDA 1ZOLA 2W43A 2B1RA 5AW1A 2W11A 2ZBDA 1O08A 4BKMA 5FP0A 5AESA 3L0YA 5AKEA 1Z4LA 2NO5A 2AUTA 2OA0A 5AI4A 3U26A 3A1EA 5T41A 2RBKA 3QYPA 2AH5A 5AKHA 2R8XA 4KNVA 2GMWA 4G63A 2CN1A 3CZ4A 5AI0A 3B9RA 5AIBA 3L5KA 1WVIA 1AQ6A 3A3YA 5AKIA 5AKXA 3I1YA 5ALJA 4C4RA 3QGMA 4KX5A 2MSNA 5AKYA 2FI1A 3M9LA 3N28A 1WPGA 1Z4NA 2Q5EA 2WF7A 4G9BA 3ET5A 2G80A 2FPXA 5ALUA 1Z88A 1U7PA 5JJBA 4KYTA 3OCUA 3NIWA 4UAUA 3R4CA 4UU1A 3IB6A 1JUDA 3E58A 4BEVA 5ALOA 2BDUA 2IOFA 3SKYA 2YJ6A 3E84A 3N5KA 2I7DA 3WGUA 4JB3A 4CF3A 1Z5GA 2OBBA 4DWOA 5AKLA 3AR9A 1Z4OA 2IOFK 2JAUA 4EENA 2YMPA 2ZBEA 2CFTA 5AI5A 1CQZA 1RDFA 4Y3UA 1RLOA 1SWWA 3NRJA 5A3SA 5AW8A 4I9FA 4DCCA 2BDEA 2C4NA 2ODAA 5AW9A 4UMVA 3ZX4A 5ALKA 3OCYA 1ZRNA 5AK3A 3S6JA 3U7GA 3WKEA 3FGOA 2W4MA 3ZVLA 3DV9A 3E8MA 3ZX5A 5E0OA 5AK5A 4EELA 2FDRA 1Q92A 4KN8A 4GXTA 3W5BA 4UW9A 3KOOA 3F9RA 4YGYA 4XE5A 5AVVA 2C8KA 4HGOA 3NANA 4YCMA 3A1CA 1QYIA 4L57A 1Z4JA 3WKBA 5AICA 4UM5A 4RESA 3OCWA 3HLTA 1K1EA 3OPXA 5AVZA 1EK1A 3FPSA 2BY4A 2ZOSA 3L8EA 3FZQA 3QU2A 2R8YA 1Y8AA 3CNHA 4DFDA 2G06A 3ZVMA 3AR8A 5AM0A 2FUEA 1O03A 3E81A 5AKGA 5IT4A 1RQLA 4XOUA 3UMBA 1RPZA 2YFYA 2YBDA 1RLMA 3NUQA 3QU9A 1Z5UA 1ZD4A 2NYVA 2I6XA 1RC8A 2OM6A 2HCFA 1ZD3A 2JAOA 3QXGA 1NF2A 1Z4KA 4YIKA 4Y2SA 4F71A 3KDPA 4UU0A 5ALZA 1X42A 2B82A 1QQ7A 3ED5A 2O2XA 1WR8A 1TJ3A 2GHQA 1RMYA 3TLMA 4CF4A 3MPOA 2YJ5A 3KC2A 4Y2YA 1U2SA 5A3QA 3L0CA 4BNDA 5AVXA 2DQSA 2PR7A 1QQ6A 1TA0A 2RB5A 3ZWKA 4RETA 4NFLA 1YJ5A 5AK4A 2JAWA 4HGRA 2HX1A 1YMQA 3QUQA 4Y2XA 2G1AA 3J7TA 1L7MA 4AP9A 2HHLA 1S8OA 3IRUA 2IYEA 1L6RA 2FPSA 3QUCA 3L1UA 5AM2A 1LTQA 5AVTA 4MWOA 3VAYA 3U7HB 4C4SA 2D2VA 4BNDB 1VFPA 4Y2TA 2WF5A 5AI9A 3KZXA 5ALRA 2R8EA 1VJRA 2HEGA 3SF0A 3RF6A 5AW5A 4Y2QA 1RQNA 2MU1A 3W5DA 4GIBA 2I55A 4ZEXA 1NNLA 4OFZA 4HAIA 1WZCA 2CFRA 5ALFA 3ZUPA 3MN1A 4KX3A 3QU7A 1SWVA 3RFUA 4YIHA 3L8GA 4NWIA 5ALSA 3NASA 2GFHA 5AW7A 3L8FA 3OTQA 3ESQA 3SMVA 3FM9A 2X4DA 3AR5A 1RKVA 1TJ5A 1Z4PX 1RMQA 2I54A 5ALWA 1EK2A 2B0CA 2ZBFA 3ZTYA 5AW2A 3W5AA 4Y2RA 3ONNA 4IG4A 5IT0A 4UARA 5A3RA 3K1ZA 4FE3A 1QH9A 2YMLA 3AR6A 2WM8A 2EARA 3WKCA 4FYPA 1Z4IA 3D6JA 1PW5A 2I33A 3AR7A 3U19A 3FPBA 5ALMA 3PCTA 2QYHA 2Q4TA 4YCNA 2EATA 1YDFA 2QLTA 1J8DA 1L7OA 3ZTWA 4C4TA 2WF9A 2G08A 4CNQA 3SKXA 5AVQA 5ALLA 3QU5A 4HGPA 2ZG6A 5AM3A 4EX7A 1XPJA 3DNPA 5ALIA 4NABA 3MMZA 3I28A 3DDHA 2HOQA 2JGAA 5ALNA 3WKDA 3EF0A 4CF5A 4OD0A 4BX0A 4J2TA 3HYCA 4HYTA 2RAVA 3FVVA 2ZBGA 5ALEA 1ZD2P 1TJ4A 5IS2A 2YMQA 4Y2JA 2P11A 4UM7A 1YV9A 1L8OA 5ALQA 3N07A 3EWIA 2HI0A 3WK4A 5ALTA 4KNWA 3NAMA 1N8NA 2YJ4A 3WK7A 4MUMA 4F72A 1RMTA 2AMYA 4EEKA 2I34A 3WKAA 1ZD5A 3OCZA 2P69A 4UMEA 4BX3A 2WHEA 3ZU6A 4AS2A 3OCVA 5AKKA 4CE6A 4DW8A 4UASA 3U7EB 2Q4RA 3KD3A 2G09A 5AW0A 2AGVA 2WFAA 3WK8A 3W5CA 2PQ0A 3PDWA 2YJ3A 3ZVNA 1RKQA 4IFTA 1Q91A 4YH1A 1NRWA 3A1DA 3PGVA 3I6BA 2B8EA 2YN4A 4BEWA 1SU4A 1FEZA 3U7FB 4ZEWA 3ESRA 5AM5A 2IOHA 4B6JA 5ALXA 5AVSA 2B30A 2P27A 5AM1A 3U13A 4YCLA 3QLEA 1MH9A 3MC1A 2HO4A 4L6CA 3L7YA 2JARA 3R9KA 2HF2A 3PGLA 1RKUA 2YMMA 4Y2PA 1YS9A 2HDOA 2YY6A 2WF6A 5AI6A 1IWOA 5ALPA 4UATA 3N1UA 2IA5A 4BYGA 2HSZA 3UMGA 2GHTA 5AVYA 3WK6A 3UM9A 5ALDA 3ET4A 2CFSA 4EX6A 5AVRA 5AK6A 3P96A 4HGNA 1ZRMA 1U2TA 2FPRA 5AHXA 2G0AA 2FEAA 3ZW7A 4NAVA 1L8LA 3UMCA 3N8GA 3OCXA 2FPWA 3QNMA 3AR2A 1Z4MA 1J97A 4AS3A 4O8CA 3AR3A 1QQ5A 5AVWA 4UMDA 2C88A 2VKQA 5ALHA 3WK9A 5AKZA 5ALGA 1L7NA 2C8LA 4JDPA 2WF8A 3SLRA 1T5TA 4EZEA 4J03A 3BWVA 1YNSA 2G07A 2C9MA 4OCZA 4ZEVA 1LVHA 1VJ5A 4L6AA 4BX2A 3QUBA 3L0BA 4NV0A 3L8HA 4QJBA 4PNHA 3EPRA 4UMFA 1RRCA 3AR4A 3B9BA 3B8EA 1Z4QA 2R8ZA 4Y2UA 3ZI4A 3DAOA 3WGVA 1U02A 5ALVA 4HGQA 1TE2A 3M1YA 3NALA 2B1QA 2P9JA 2RARA 3I76A 2OYCA 3L1VA 4FFDA
chains in the Genus database with same CATH superfamily
2MYTA 1RI3A 1UBNA 1P0CA 3OIVA 5I7SA 3L1KA 3E9QA 1YZ6A 3IGFA 4EY6A 4FM9A 1HQYE 1T2VA 3VTZA 2B4KA 2NSHA 1Y9DA 3R2JA 1EMDA 4I1SA 1TF7A 3ROKA 1CUEA 4QWCA 1YE3A 3VKFA 4QXQA 3AH8A 4WA7A 3KU1A 2HGZA 1OY1A 4LBWA 2C7RA 4DCPA 4MS3B 1P80A 3WGOA 1KRPA 4KR3A 1IQPA 2AZXA 1NAIA 5C5EA 1SAYA 1YZQA 2CFIA 5BR4A 2VA8A 1HM5A 2INGX 1FXSA 3ZWQA 3A1FA 4YWHA 5H59A 5LYJF 3U17A 3H0EA 4KEAA 3VR1A 4IYRA 3F8SA 1LLDA 1FP2A 2BFPA 2LDXA 2D00A 5G2OA 4GZLA 1USIA 4TKUB 1ZGZA 2VYVD 4G9BA 1D2RA 2ZUBA 3R41A 4TXHA 1IOVA 3OFKA 1KDVA 3V6HA 2HCJB 3R4CA 4H9GA 3V1UA 1CRPA 1ZBDA 4QZHA 2J3IA 5J0YA 3N2LA 4DL4A 1YJXA 3PK0A 2DR3A 1Q3KA 1KMQA 1NKCA 1ZOPA 4YROA 4EPRA 1HEKA 5CB4B 1CUKA 4DVJA 5ILQA 5IEJA 2LXNA 4IDAA 1NV9A 1V6AA 1SXQA 1SVMA 4CM8B 4NBVA 3PTZA 3ZQJA 3SLKA 3CNHA 3ZDRA 4QASA 3VNUA 2WM2A 5KAFU 1WCV1 3GGOA 4EFKA 4RTPA 3O4FA 2QR2A 4O3MA 2HD4A 1P2SA 4RM3A 4YIKA 2LYHA 3U6KA 1FQKA 4X1YB 2BGIA 5D1NA 3R5XA 2FE4A 1ENYA 5A3QA 1SXJC 4FFMA 5DDMA 3H9CA 3DM5A 1DRWA 5DGCA 1XR3A 2YZKA 2ZXHA 2X6QA 5C1DA 5KFYA 4MKXA 4EFNA 2HLHA 4MW2A 3OOSA 4A8EA 2HK6A 3IMFA 3LGAA 1A7KA 3RLIA 4GOKA 3VAYA 3GLIA 4OYLA 3E53A 2WF5A 3SF0A 1ZQAA 2IEIA 4WECA 1ZNXA 1H1TA 1LXCA 1UMBB 1ZQ1C 2OOKA 4TUSA 1KMMA 4U2CA 3F9CA 2XSZD 1WQ1R 3ZJYA 2I9GA 3NDIA 3HJUA 3NONA 1U0FA 2J1LA 2JJQA 4IZHA 3GJ3A 1CUDA 2AN3A 3T0GA 1PX2A 3U60B 4GQAA 2R0QC 1BCRB 3WRWA 1QPGA 2M9MA 5AOBA 2I2WA 1EFPB 5IBPA 2IZ6A 4MGEA 4UB5A 4KAFA 5HILA 2FPKA 1GG9A 6NULA 1ES9A 1YS4A 4ZRDA 3M34A 4RADA 3C3JA 1ZD2P 1JZQA 4F92B 2D06A 5ALTA 1KE2A 1Y7PA 2GBCA 1WVMA 2BCRA 4BX3A 5HP4A 4CUZA 3KJIA 4N3NA 4DW8A 4YP9A 1T15A 1K4YA 4C7KA 5J8YA 2HSJA 2FPLA 1YZ7A 2JLVA 1MO6A 3ESRA 4PG8A 2Q45A 3WQBA 4FGSA 5EWLB 4JBIA 3QIAA 3IVRA 5GTHU 4Q9IA 2RKOA 3UBMA 3E9YA 3BJMA 2AG0A 1NBHA 3GJ0A 1S01A 2CZGA 3AKZA 5A7FA 5CFZA 5LNK1 4HGNA 1X87A 2QTAA 2FPRA 2WSBA 1UM8A 3HEMA 4CV3A 4G41A 5JD4A 4TV8B 3U31A 4JWMA 1E89A 4KSYA 3AR3A 2NLOA 3PUKA 1JDPA 1T26A 3PFBA 4WBSA 1IONA 3PMLA 3GWGA 4JL8A 4MRMA 2J5RA 3WLEA 3T3EA 1UUFA 3AV3A 1Q3HA 4NH4A 4ZT7A 3HU5A 5PGMA 3HBFA 2ZRHA 1K9SA 1FPQA 4MROA 4Q4LA 2X0DA 4EYIB 4ZHQA 5GIOE 3PY8A 7ICSA 1G63A 1N9KA 1PZFA 3LKZA 4H0CA 4ON9A 2POCA 1QWOA 5KB3A 2VQEB 1AZTA 2FCAA 1KS9A 1WPXA 1G8YA 2XKAA 4H1WA 1ED1A 3AW8A 2A4MA 3ZK9A 3KHKA 1ZOLA 2W43A 1XEXB 2QG6A 3IQEA 4D0LB 1IUNA 1W5TA 5F77A 3Q2OA 3B85A 2MR5A 4LRWA 3HG7A 1QH1A 2GHRA 1KQQA 3ZY5A 4CG3A 1GFIA 2O5EA 1BFKA 1JA9A 4ZJUA 1XAJA 4OI4A 1KVRA 9ICQA 2BF7A 2VCEA 1LS6A 3RFTA 3L6UA 2BFFA 4GM1A 2D3DA 3UBTA 2ZITA 3RB0A 1SA0A 3SCZA 4YRIA 4I55A 2I7TA 4KN8A 3ZXUB 4GBMA 4ID9A 5KWIA 2BBSA 2ONCA 5CX1A 2ZBRA 2FW7A 4PXYA 4PHPA 1MFZA 1U1EA 3KVYA 4GI5A 4FI3F 2OCGA 2YFYA 2PRZA 5EP2A 2JBHA 3LC7O 1XNQB 4QBGB 1BHJA 4JMUA 3O2JA 3GEBA 1PTJA 4XW2A 1UJNA 4G5XA 1BXGB 2IPXA 2SKEA 3MAAC 3PUJA 1YBFA 1M2WA 1SV4A 5CJPA 2J07A 2O0HA 1Y37A 1EVKA 2ZUTA 3H5TA 1NXOA 4ND4A 1XXHB 4GSYA 3VPCA 5DM70 2H3ZA 3U81A 3CLKA 4GVPA 3W5HA 4BFWA 3ELBA 1X8JA 3MD0A 2QX8A 1WUTA 1WZNA 1IHOA 4BNFA 4CUJA 4B2IA 4HGYA 4LECA 5ALRA 4JVNA 1Y5RA 1XHFA 1JG4A 4EZ6A 1P9OA 2XDAA 1ZR2A 1XTZA 3Q1LA 3RYCA 4KLDA 1JS1X 1G8SA 2EFGA 1F9EA 5FLEX 2IF0A 3UJ3X 3G88A 4C29A 3COYA 3KAJA 3ONNA 4ECTA 3TJMA 3UH0A 3RIYA 4MRPA 3VHXB 1FA9A 4TLMB 3JAWA 5M29A 4C87A 1QV6A 2JLRA 3I4CA 3K9BA 2XNCA 3PFFA 3A6GA 2Q4BA 5JPCA 4I4NA 3PFWO 2ID9A 4HDNA 3SIPA 4PZLA 5EE0A 1GVHA 3JRNA 4FXPA 4QPZA 1CF4A 2WEKA 3T38A 4I2HA 1QZ3A 1N9GA 3W3AD 4O8ZA 1G18A 3BIWA 1S5LU 2FEOA 3OEWA 1QZUA 3C1ZA 4Y2GA 1HMPA 2Y99A 3N87A 1ENOA 2XZTA 3LK9A 3MERA 4QDKA 3ROFA 1HFWA 1KGSA 1S9FA 4C0JA 5AUNB 1QUFA 1OBOA 4G23A 1XO0A 4GLJA 1RXSA 2V5UA 2H4YA 2QNBA 4TWRA 4F5DA 3DBIA 2Q3BA 3NJRA 2GEBA 4WNAA 1JHMA 1QQAA 2BGMA 1Z5NA 2IDZA 1NKSA 2E8OA 3Q10A 4MYRA 5TMDA 4KPGA 1A9OA 3KZKA 5JXHA 4LCBA 3BL8A 3R77A 3N2IA 1MO5A 2C20A 1INLA 3BRWA 3ZHOA 3IQWA 1PDWA 3GFPA 2WM9B 1U5CA 2WHRA 3B1YA 4BQFA 1OZ0A 4KZPA 4ABYA 2ODTX 1DQRA 4EG8A 4HNGA 1JIKA 3QWHA 2C04A 4ZYXA 4G0NA 3VV3A 2DUUA 1VYUA 4Y9TA 1IHYA 1BEUB 2H1OA 1NYQA 3PRJA 5H16A 5JCZA 4LV6A 3COPA 4B87A 4ACBA 1IE3A 3PQ2A 3ZE9A 3AI7A 5EVJA 2W98A 2CEAA 3LX6A 3QX7A 4BQRA 1HDGO 4RK1A 3KUDA 3OQMA 1YBHA 4FGUA 4XQ0A 2J0SA 2YWRA 3B1ZA 3IJ5A 3I52A 3T61A 1VSTA 1PX0A 1XCBA 2Q0XA 2C9YA 2XWJI 3ZWWA 4MLCA 3SHOA 3V46A 5EIWA 2YTUA 2ZBDA 3A2LA 5FP0A 4ZIRB 4LFAB 4OP1A 1OGIA 4Y0NA 3TRFA 3CQ9A 3C6ZA 1KL9A 5JTTA 1ZCAA 1I6KA 1GILA 3BCUA 4MS4A 4A16A 1WPGA 1E4YA 3TRJA 1T8PA 1NPYA 2HJVA 3LHKA 4FU0A 3ZCRA 2RGWA 3E05A 5CP2A 1HDRA 2XIQA 3RVDA 1L4YA 4KGXA 2ZR8A 2QMOA 3FLBA 4HNAA 4YXMA 2NNLD 4B40A 5I7OA 1HETA 5MF6A 3G2IA 5BV8A 5L4NA 2RHBA 3FVWA 2EU8A 4KDFA 1TX4B 2ZIEA 1SRQA 1JIVA 4U7GA 4YPVA 4FZ3A 3BMNB 3W8RA 3IH5A 4Q3CA 4F84A 4EO9A 4RVCA 3DEZA 1XEAA 4RHTA 1F5NA 3MJ4A 1CE8B 1EWKA 5HGJA 5K0NA 2WJPA 2FUG1 2OXFA 1QGOA 4FX2A 1W36B 1Y6JA 2V74B 4YQYA 5CFPA 1XTPA 5A4FS 621PA 3K2BA 4BLQA 3LUHA 5G0SA 3CISA 3AIKA 3L7CA 1CXZA 4DMLA 2HW8A 3IPAA 4INOA 3DEEA 4CKCA 3LQFA 3GH1A 4WLEA 4ILEA 3RVLA 2I6SA 3LRXA 4G0ZA 4NYMR 4ER5A 4JB2A 2VAWA 1W46A 4FOTA 2KICA 1LY1A 2FPSA 3EVGA 2VC2B 5L3SA 1XCLA 5M04A 2KVCA 1GUFA 4ENTA 1F2VA 1LK0A 2EBFX 4NLNA 2HHAA 1Z2EA 4LYFA 3O8DA 5SZHB 1KMCA 4C0ZA 2JFGA 1UQVA 4AMBA 3TARA 1Z08A 3LF1A 3BIJA 5FFFA 5IVPA 5IHXA 3R75A 4OFBA 1RKVA 2D1SA 2P2CA 3FVTA 5FYQA 3CJQA 1YB1A 1T1GA 3FVQA 2O3QA 1HE3A 3FMPB 2B99A 4BO1A 8GPBA 2GAIA 4LE2A 4X8OA 5FR2A 1UH5A 2BLNA 3T0IA 4EG1A 3ESDA 1D0VA 1UC8A 1K7CA 2QTRA 1JLLA 2DSNA 2R1VA 1Y1SA 4F4CA 4U8HA 3HI6A 2UZ1B 3WLQA 1Y5IA 5JE8A 2JH9A 3KKPA 2NSJA 4IV5A 4J2TA 4LY3A 1D8LA 1CNFA 4U7TB 5JCJD 4O4JA 5KFBA 5FBWB 4L9AA 3JWPA 5A4JA 3C3BA 4J7UA 4NCAA 1GV1A 3NAMA 4DDMA 1SUDA 4PC6A 3BQ0A 3SQXA 1US8A 4DYVA 4S0XA 2VJMB 1T6NA 4L0CA 3NT5A 4C06A 3I53A 3G0CA 1XIVA 2DRIA 5EXEA 1NZPA 2QGFA 2WIKA 3ZZ1A 2P27A 2ZZMA 2O7RA 3IURA 3QLEA 2HO4A 2AR7A 3ZNNA 1M6VA 3PNQA 4PR3A 5IAKA 3URKA 3JR3A 5HIJA 4QRHA 1CG6A 4WXYB 3R7NA 2QRMA 4GLFA 4K9DA 4IM7A 3FN4A 3BEOA 3HUFA 2Q6LA 3DHNA 2NXJA 4EO4A 5J2TB 5JNUA 3R3WA 4X6LA 5TVGA 1WF3A 3TLGA 3ACBA 4OQNA 3T5HA 2WF8A 1E9RA 1LVGA 1PFQA 4OSOA 4KN4A 5JD3A 1OH7A 1K66A 5F2NA 4QZ9A 5IIIA 3ANYB 2A88A 4PAQA 5ALVA 3EXFA 5SZIA 2XAUA 4KTTE 1V48A 1U63A 2QD1A 4R0MA 4P0TA 5CHEA 2VJDA 1LBTA 1QO9A 4HVCA 5KSOA 2O9JA 1KOLA 5BN3B 3IQFA 4DSNA 1EG2A 1GCIA 2HLPA 1Z2NX 4WPGA 2FVYA 4CMIB 1U47A 1YR2A 2PFGA 2GO7A 1M0WA 4YASA 4DV5B 1GZ7A 2GPNA 2ZXEA 2NU7A 1E62A 4M04A 3ZE0B 1TT5A 3LHFA 4DG5A 2GVZC 5TSDA 1CZOA 1RBZA 3GDWA 1U0SY 4YCAA 4YHBA 5JC8A 2IXAA 1ECJA 1TM1E 3N58A 2GN0A 3C5EA 1BW9B 5DLGA 3CPHA 1P5FA 1HA3A 5BORA 4OJTA 4ESEA 1VKNA 4JB3A 2GYUA 2FOXA 5KFWA 3ABOB 3FTQA 2OK7A 5BWOA 3IQGX 1U4OA 3PFNA 1H2AS 3KZOA 3H3FA 1QX4A 3LLSA 9ICVA 2WIDA 2GGSA 2JANA 1J2TA 3DTNA 4X63A 2Q1UA 1RWXA 4M1SA 3H4MA 5F1OA 3ENQA 3SE7A 3K2QA 3NQ41 5AVVA 1KARA 2XITA 1GAEO 2O8BA 4HH3C 1QYIA 2H3HA 3BE8A 1D2EA 3K35A 4C7ZA 1NKVA 4LSGA 4HBZA 1YS1X 4FC6A 5FWYA 1BX1A 3BVPA 2PBZA 4RNDB 5EEGA 4CIDA 5KNCH 4OH7A 3AINA 3M33A 2XE6A 1UZNA 3RWBA 4JZYA 4GF5A 1RJWA 4Z6FA 2OV6A 4JYCA 2ANCA 4ZVVA 3HU1A 5LZ8A 2XCSB 3IUBA 1KI6B 4I3GA 2J46A 1SL0A 3L0CA 4QKQA 1M8KA 4QU5A 2W42A 3IEVA 3TSAA 2FWIA 4V0OA 5B3JA 4C3VA 4IIYA 4XLLA 3ISCA 1PF7E 2AXNA 3HXMA 3AY6A 1L3CA 3T7CA 1QHEA 1K6MA 1VPWA 3ENVA 2HN9A 4NMWA 2GM4A 1B1AA 2CJWA 2QUIA 2VJNA 1ND5A 4OTZA 1E8MA 1K68A 2PANA 3F2BA 2ESRA 5JOQA 3DVSX 4GH5A 9ABPA 2ZUFA 3N2NA 2MU1A 4IL5A 2YIMA 4TXLA 1QVWA 3I9JA 3HDJA 1I1HA 4XTRA 3TLYA 1KVSA 1GPNA 3PSAA 2Z95A 3PWTA 2XY7A 3PKJA 3TTTA 3CR7A 3WBKA 1SG9A 2WHQA 4H7HA 1SXEA 2X77A 1N6KA 4IFBA 4V38A 1B15A 1Z47A 4DYDA 1E2EA 4AZ0B 4WASA 4X65B 3AR7A 2H1FA 3K94A 1VPEA 3QX3A 7REQB 2V7UA 4WEOA 4B9VA 4M7PA 3GJZA 4EMSA 5HIIA 5IC6A 2NAPA 1SCNE 3FNGA 2H16A 4CFYA 3PUHA 2QSUA 3CZAA 3IO3A 1U11A 1A7JA 1LKYB 1Y8RB 1SEVA 2M0NA 1WP9A 4MRVA 5GY7A 1ISFA 1RRKA 2Q2QA 5C8YA 4IIXA 1ZUWA 3WK8A 3KLBA 1JWAB 2GPJA 3QVXA 4OGWA 1EFRA 2O8DB 5LD2B 2CWDA 2H7CA 1ZD1A 2FFAA 2JG3A 1P7ZA 2AF3C 3CX4A 1RWKA 5ALXA 4FJ2A 5J23A 3B9JA 4ZAGA 3UMVA 3EOBI 3GPCA 2NIPA 3E2MA 4JN6B 4Y2PA 4QWBA 1J39A 3P2IA 3R5JA 3N76A 3R7WA 1RD4A 3QZUA 1ZIPA 2MSEB 1R4MB 3DOFA 1G8GA 3NAZA 1PJBA 3WNQA 5GJVC 1J0XO 2D5IA 1LPNA 5GAJA 1FFXB 4M38A 2G0NA 1NWCA 5FL7A 3NU1A 1UAGA 4V0KA 3WR5A 1A27A 3N0TA 3RUHA 5A6SA 4LE0A 1OYWA 3UWMA 4Q7QA 2GN1A 5D2CA 2KIVA 4NNPA 1R4AA 3CR8A 1X1SA 3A1TA 2Z2ZA 3QZ7A 4NFYA 5DX0A 3C3AA 3NIFB 4IF6A 4KLZA 3QTBA 1W88A 3RYIB 2D1TA 4NJMA 3DZBA 1KIAA 4ED9A 1CLEA 3FTPA 4FZLA 1YQUA 3WK5A 4IVQA 5KYXA 5DSXA 1MC1A 2W7OA 3OT1B 2V7QA 2NWQA 1TO2E 5E2BA 1Y33E 3QOWA 1DVRA 2H4XA 4KTVE 4RZXA 3LU1A 2QM0A 4UUNA 3KUCA 2GLXA 3TBKA 3HA2A 1E5VA 1DC4A 4NZMA 3T99A 2Q0ZX 2W6QA 2XTAA 1DQZA 1HG0A 4PHHA 4FONA 2BJVA 3RUFA 4D4JA 1FRNA 1HI9A 3L7KA 2X0JA 1P2UA 2ATEA 5E1OA 4MYCA 4M1MA 4OHPA 4U7PB 5EKDA 2PSDA 4AKHA 4FYIA 1M0EA 2BFCA 4G1FA 2TMYA 3N8KA 2ORYA 2I6FA 1OAKA 4CDRA 1S6YA 1X1TA 4GMHA 5K6RA 3EIUA 1OXSC 1BA2A 5FOVA 5KNLA 2ZJBA 5IM5A 4TSFD 5IW8A 5IAAA 1XRRA 4E31A 2NV3A 4WK0B 4YLGA 4HQOA 5CK5A 2R8JA 4OG2A 2V3VA 3WDKA 1QVAA 2PL9A 2VDUE 2ZB2A 1UWKA 2F8LA 4XRGA 3UIEA 2DU8A 4OJQA 3TZKA 1S8NA 3SM9A 5IVIA 2WFMA 5DW0A 1K5OA 4HAVA 4N9WA 5L1JA 3N3AC 2GLEA 4B3SB 4FYXA 1R10A 1E4EA 4KQWA 1PQ4A 4NG4A 5G53C 4YMVA 4Y6LA 2GWRA 2R7MA 4IS3A 5HZMA 3DBVO 4NDNE 3UICA 1I3LA 2JBAA 2D74A 4Z7JA 2QBYA 4DDVA 3NT4A 4MUKA 3G7UA 2RB5A 4M0LA 1W73A 4YREA 5IDXA 2Z9DA 5FULA 1YC5A 4FYHA 4JI3B 4YJFB 1UT8A 2DWQA 5GONB 4DSIA 3TIVA 5D6OA 4IQ8A 2JCBA 3IAS6 4NARA 3U4IA 1FLAA 1M2KA 3VR5D 2WV9A 1M1UA 3C39A 4TKVB 4OFXA 2YFQA 2Q1TA 4I9NA 4Q9LA 5G40A 5J0TA 2NP7A 1CNMA 1T1EA 2UYGA 2M6RA 1EE2A 2DMRA 1QH9A 1AGYA 4ALMA 1J24A 1FP4B 4FYPA 3FUVA 1O58A 5TEWA 2F7SA 2C2EA 2GDZA 5KFVA 2PN1A 2D1QA 4CMGA 1YZ3A 4G0VA 3S40A 4C6TB 3JSAA 1U45A 3TG2A 4DQRA 4PQEA 5JS2A 4EDFA 3CINA 3HDVA 3B60A 5LUBA 3VAAA 4KREA 3C5VA 1QIDA 4MYSA 3DBLA 3I2IA 4HDKB 1ZAKA 3AFNA 2NVUA 1CULC 1X86B 2P11A 2ILTA 3UZUA 4KNWA 3DO6A 1SK9A 1A9XA 3HABA 2C28A 5JIBA 3D6NB 4QJIA 5L6LB 5DSZA 3RH4A 1T3NA 4DIKA 4EG6A 2REXB 5FL3A 3JYQA 1SL1A 4QDOA 3C8ZA 3ZXXA 1T4MA 2CE7A 2JAHA 4HWOA 5DPMA 4K9SA 4L6CA 4W1PA 1D4AA 1WW3A 2HXSA 1XD8A 4M8SA 2YMMA 3GMIA 1YGPA 1I0LA 4JK3A 3WGGA 4B3FX 5AVYA 4KLIA 1XXHE 3DB1A 2FDCA 5M5BA 5BV1A 4UU8A 1ZQLA 1EI9A 3HW8A 3UXNA 2E4YA 4FLFA 3T54A 1GIAA 4L0QA 4A8HA 1Q12A 2AFVA 1A3CA 2ZYTX 2A94A 1TZCA 1Y7TA 3AIOA 4P4OA 1PK9A 3O4VA 3FOAA 1ODLA 2YQEA 5DGAA 3STVA 2OWDA 1Q22A 2C5FA 1CIPA 4LJRA 4EG4A 2O57A 3ZV5A 4GOJA 4LY0A 5GGXA 1TAMA 3V1KA 3AUYA 2R6CA 3M70A 4AF6A 4UXIA 5BP7A 2WA2A 2FSHA 8ICBA 3EOZA 4KMMA 4POOA 4JLNA 1ZG3A 3QIVA 4AJEA 4ALJA 2EEZA 4RK0A 3IVAA 4QZAA 1IZ7A 3H1AA 5AJUA 4URZR 2XGQA 4PSUA 4OHMA 2A19A 2ZYDA 4WY2A 4DMUB 3ZOZA 2I4NA 3E1KA 2XQIA 2YB1A 1HFJA 1QF6A 3INRA 4NS1A 4CKWB 2YNMC 4DJJA 4HS4A 2IU6A 4R68A 1NONA 1DRKA 4GBJA 1H0HA 4XFDA 4QLBA 2JKZA 2P1RA 1FW6A 3C48A 1TMOA 5HFAA 4IRKA 1IIPA 2FJUA 3H7AA 4KQ2A 3JQPA 4GP7A 2GN6A 2JGIA 2QNIA 4PYKA 4O5EA 1ZKDA 5ITZB 4TWIA 2YYZA 5LC1A 4DV1B 3VVLA 3W3ZB 5CT6A 2PFOA 3H0MB 2ODAA 5EUMA 5AQ1A 1RLUA 4BV2A 5KT4A 1YOVB 3GLIE 2DQZA 1YVEI 4QZGA 1WDLA 4B85A 3P4XA 3MJEA 2XUIA 1NG9A 4ECRA 2DL0A 3IQZA 3QNUA 4CI0B 1DCMA 3EGXB 3LP8A 2BKUA 3SEFA 1JAYA 4OI0A 3QQPA 2WUFA 3LZ6A 3O84A 3AN1A 3IDSA 4LMRA 3CZPA 1WB6A 4QHSA 2A35A 1Q0RA 4P83A 3KDPA 3ZJ5A 1G4HA 2JLSA 3UFXB 1NKTA 2XDQB 3C5WP 3GCXA 2PGAA 3FE2A 4MARA 1BVYF 3TQOA 1ZWLA 1YQEA 2YWGA 4ZAYA 1OAOA 3ZGLA 4FWIB 3CWCA 4HZUB 5GJWC 2OXIA 2XGGA 1YB5A 3QUCA 4ARVA 1OF1A 1G16A 3KUXA 3LK6A 1I3NA 4R9UC 1MO4A 5DISB 3I72A 5LOVB 4ENVA 5K3FA 3L0PA 2ONYA 4BBAA 5AW7A 4D0RA 4NBUA 1E1QA 2ORVA 2XUZA 3BE5A 3P9NA 4IVNA 4EZBA 5BQ5A 5EHGA 2ZIUB 1W30A 5HQ3B 1WETA 4MFCA 4TT3D 3M2PA 5CTJA 3A0UA 1PG2A 5K4HA 5KIAA 5JSZA 2QTNA 1LS1A 5KG4A 1JIUA 1Z8HA 2YXEA 2QMYA 1WSAA 3U3DA 1SC9A 4OLAA 3GCGA 1DGQA 3AILA 1WB9A 3X1MA 4G07A 3CRRA 6GPBA 2UUAB 4LVSA 2BPOA 3FPLA 2WYIA 3RRHA 4I3HA 2OGWA 4LSMA 2YV1A 5JNWA 1Q91A 2EJUA 2J9RA 3B36A 3JPQA 4XIJA 4B3HA 3OT4A 2EKZA 1SB9A 2FHSA 2QJTA 5IT9A 1G7CA 4EA6A 1HGXA 1G6KA 4XJSA 2ACWA 3GIIA 2WVGA 5DKFA 2LUOA 2EL7A 1A1SA 2Y1DA 4NG5A 4NYIQ 4EBDA 3FC4A 3ZQ6A 2M98A 1TEHA 1L8LA 5LUAA 1E77A 1T8RA 1BDHA 1Z3CA 4INAA 1X7WA 4H77A 2PXCA 1U7TA 4G0QA 5DQGA 4R8RA 2YX1A 3Q8XB 2H2DA 1H4TA 1E1YA 4Z49A 4D9MA 2NUPA 2YV2A 4ZZ2A 5EEHA 5F4ZA 5DTQA 4Z4CA 2B1JA 2AXTU 2PH7A 4ZAVA 1DEAA 3NYQA 4YRAA 1NW9B 1UMKA 4IGAA 2ZT5A 3SQMA 2EG9A 2EFCB 2P41A 1UC9A 4IQVA 3K09C 4DLVA 4AFNA 1JILA 1FS5A 2NM0A 1QLWA 2IHYA 4WMLA 1QYRA 3I2GA 5B1IA 2ZRKA 4ZQHA 4B6EA 3DQPA 3DBRA 3NVMB 2RFLA 1EA5A 5CFLA 3QPAA 1A2KC 5L3RA 4PAWA 2BP7A 4QDTA 2DLCX 1S8AA 1RJDA 1TLTA 2NT3A 4R4JA 2V0CA 2R1TA 4YDSA 1U4SA 3WL6A 1CQXA 1M74A 3LWLA 1XN1A 2PH5A 3KHUA 4D3YA 4CU2A 5C3MA 2C03A 3P9QA 3DO8A 1G21B 1G2OA 4DR6B 3F6SA 1EVZA 5E1DA 2PZJA 3FTDA 5F1KA 1WOMA 3KUKA 4LHWA 3FTCA 3C3XA 3TLZA 1CS0A 1MO3A 1ZW6A 2IXBA 2ZYUX 1OVGA 4M8KA 4MJ3A 3EIWA 4PSAA 3E5RA 4OQQA 1RQRA 4KQHA 1W4CA 4F56A 1N5RA 4CZ2A 1PJ8A 4PG6A 2FDRA 4JELA 3S2FA 2BKXA 5AH0A 3GLTA 4GX2A 2YV4A 1TK5A 1GPBA 2C1XA 3ILYA 4ARSA 1TM2A 2DWOA 2C8KA 2YY7A 3NANA 3JQBC 1QSGA 2OHFA 4Q21A 1K1EA 1XI2A 2HK9A 3NHJA 2VWHA 4RHXA 4K9KA 2NRVA 3LQ4A 2V55B 3BQ1A 1TAGA 1RPZA 4P08A 1IN5A 5I9BA 2I6XA 1YR7A 4BVEA 2HSDA 3L84A 1U2GA 3HSKA 4YHHB 4LTNA 2QL5A 3TLMA 1SXJD 4ZQFA 2YJ5A 5YASA 4CEJB 1Z2CA 2EL9A 5J5VA 2R7KA 3EA4A 2JF0A 2NO0A 4BV3A 3TO5A 1NW5A 2OV4A 2VK4A 5I48A 3TLBA 4GUDA 4OJNA 2YHAA 8ICTA 3PO4A 2RJNA 3G5MA 2CXOA 1NIPA 3VMFA 3PJRA 5EHZA 1YZKA 2P4UA 4IQ4A 3BDVA 1KZYC 1TRHA 4FBGA 4G0XA 2D5LA 2IVFA 1O0CA 1VPLA 3UJPA 2VAPA 4G01B 3VV2A 2B0CA 3HKBA 5L40A 1U6IA 2GF9A 4BMSA 3NBFA 1H0RA 1JDUA 1PWEA 1J9GA 4NLCA 1AGRA 3ELYA 2WSIA 2RCYA 4ODIA 3N74A 2YZMA 4XWWA 1AOXA 3AVPA 1LTHR 1BA3A 2JH7A 3T3IA 4KNYA 4KAAA 4IDOA 4UTNA 1DKUA 5IF9A 3HVHA 3IKJA 2B3DA 5I4BA 1OWLA 3AJEA 2D7JA 2X2PA 2ACKA 2Q4RA 1C1DB 4MFFA 1QM5A 3I01M 2ZSFA 4N18A 1QFZA 5KTKA 4YA6A 4BEWA 1N6RA 4B3DA 1C80A 1E0AA 2B30A 3O95A 4DUYB 4D9HA 3SX4A 4HFRA 4P53A 2XGSA 5H4HA 3AVTA 3EVZA 3HUDA 1WULS 5U1PA 4B44A 1WUIS 1J06A 4IC9A 1OW3B 3BMOA 3ROXA 5D6NA 1NOJA 1GKIA 1T3SA 1E1LA 5KG0A 1R5NA 1SZJG 1Z4MA 2WTEA 1MCZA 5ALHA 1WD5A 3NBYC 4A2CA 4BMDA 4JDPA 2NU6A 2F4NA 5H81A 4BX2A 3ZGXA 4NV0A 1T1RA 1SKBA 1SN7A 1N57A 1PJ4A 4XVQA 4UVDA 4BLWA 3PVSA 1Z35A 1ZVQA 3WMFA 1MX9A 3RRMA 2O1SA 3U3OA 2B2NA 2D8MA 4J4HA 4DSFA 1K06A 1NWHA 3SHQA 4JLKA 1S7GA 2G8LA 3NUGA 5BRAA 4IDEA 4R9RA 1NL3A 2B5OA 1F2DA 1C7FA 2QRZA 2FPGB 1XC9A 3UUWA 4XGKA 3N3BC 2O4UX 3ENNA 4JNKA 1H8HD 3EPIA 4AJLA 4HEA6 1OCEA 4FGLA 5IJ9A 5GP1A 4NOMA 4YRNA 4DLKA 1YS7A 1RI5A 1KZ4A 3SVTA 1KQOA 1SR8A 2Z8XA 3CE6A 7ICNA 1MABA 3FWZA 2R751 1LU9A 4I1RA 1GPUA 3VKUA 2XD9A 1XZLA 2QN3A 5HVNA 3NM6B 1HG1A 4RD4A 4QFDA 3HU2A 2P9QA 3TW4A 1X9WA 1L1RA 2PU5A 4NDAA 2V4RA 1RYSA 4R6XA 1CQJB 1OLSB 1T2AA 2HLNA 4QWAA 1T2UA 5UKDA 4U7DA 4QPDA 2F43B 1Z37A 5L3ZA 1KORA 3C6MA 4DV7B 4UAUA 1PN3A 2W7PA 3ZHUA 4UHFA 5C37A 4MV7A 4FKBA 1WB5A 1XD2B 3EPLA 4AUNA 1BD3A 4Y9UA 2WI8A 2QRNA 2BFNA 3UJ7A 1A9YA 1EWRA 1FOEB 1CT9A 3S6JA 1Y48E 3JCZA 2C2KA 2O8CA 6REQA 5FOQA 1B00A 5DSTA 2I6GA 2IJGX 3L9XA 4YV2A 4FBLA 3AERB 4R40A 4PAMA 1S0OA 2O8EB 3NVZA 3QU2A 5EKUA 5A2GA 5D7BA 3ZHBA 4DMKA 2C5GA 3DZGA 1JQ3A 2H29A 4O2RA 4BQOA 1I33A 3DT9A 2E6KA 1QB8A 4RQMA 2R4UA 3L8CA 1II8B 1UPUA 1C7ZA 2LMRA 2P9FA 3TIGA 5EMKA 1AH2A 2IZ0A 4TTRA 1XQ6A 1ZQCA 4ZODA 4MSUA 1KDPA 1UANA 1X6VA 1UQRA 3VR2D 2YJZA 5BRJA 5JISA 1XZBA 2QTMA 2ARKA 1FNSA 2I6TA 2O1XA 1FSZA 4EJ6A 2BYTA 2HHLA 1RM5A 3WLTA 1JPVA 2HPVA 4PNPA 5TF0A 1W75A 1R8QA 4UQOA 7ICGA 5JRZA 4BO2A 3D1JA 4O9MA 5DMXA 1N2HA 3ROEA 2XUOA 2PWAA 4GIBA 4UFNA 1GNSA 1OLOA 1PVQA 4AKIA 1ODSA 2VAXA 4AKTA 4QXAA 1YXMA 4FW8A 3YASA 4DQUA 3T94A 4I2JA 4TT8A 2OSVA 5ILGA 2A9FA 5DM2A 3USES 3GFQA 3GROA 3DHEA 3ZN2A 3GDXA 4RY2A 5EFZA 2EW8A 4U9HS 5TGTA 3W9SA 4RZIA 4AMUA 1L4LA 3D0OA 3T5DA 3EUB2 2EDAA 2QX6A 3ZWCA 4LRUA 2C3UA 2ZBUA 5ES3A 2QN8A 2CL7X 1PFWA 4BX0A 4D8YA 1CYEA 2HA2A 3WSVA 5DB7A 3GP8A 3E4CA 4MEJA 5DVZA 8ICNA 2PRIA 1YDWA 2C31A 2YDYA 1P17A 4AS2A 1MVNA 4TN5A 3TQ1A 3ZVNA 2HMVA 1JI7A 5L3VA 3F47A 3IOMA 4Z86A 2B69A 4BEBA 1I80A 1MOZA 3P9SA 3B1XA 4KO3S 5HCNA 4OQXA 1J0DA 3E9DA 2H5XA 3SJZA 5F23A 1QJCA 3EUWA 1ATIA 4A1FA 2EJWA 5BQ3A 2QD3A 3IR5A 4FDVA 3A1WA 5HRUA 1R6BX 2VTKA 1VECA 3UNXA 3K20A 4E5UA 4BO6A 1MG5A 2X40A 3QNMA 1E0SA 5BW8A 4KODA 5JSFA 2B6GA 1COOA 1SL2A 4CM4B 3NGLA 2JFXA 3BWMA 4R8UA 3BK7A 3UT5A 1MSWD 2CJYA 5J2UF 1UZUA 1NU8A 4X7PA 5LZ2A 2BZSA 2E37A 1VIDA 1MA0A 4Z51A 2H2HA 1YRQA 4I2CA 2PS0A 2PH3A 4NY8A 4XRHA 1WW8A 5DLFA 2VQDA 4YCXA 4FD3A 4XIYA 4QU9A 2NOAA 1N5MA 4A23A 3CEAA 2FMFA 421PA 1EB9A 4DOBA 4QG7A 2A9QA 3H42B 5B5EU 2W00A 5AW6A 2PJUA 5CM2Z 1RWWA 4BBJA 4G65A 3KTOA 1FLVA 2VHUA 3R20A 3VTAA 1Z5VA 3BF8A 1Y3BE 1GQFA 2BJHA 3HBNA 3D4LA 4PYQA 4UTOA 1L5KA 1LNSA 1GZDA 1NW6A 1ULHA 3FCOA 2BBTA 3SJ7A 3FCEA 3IALA 3L6CA 2WTAA 4E3WA 2WPDD 2OXTA 5K0TA 1AXGA 3AP3A 3DDCA 4K7JA 4OLJA 2PT5A 3BJZA 4IDDA 4XM0A 2WFLA 2XDWA 1V7ZA 2I4OA 4A0GA 3SFZA 1ZQOA 4DR1B 5LYJA 1C4KA 4P7FA 1N56A 3KEOA 4DJ5X 3I8SA 5TGZA 3D59A 3PRYA 5E4TA 3Q11A 4TL7A 4MW5A 2FWNA 1QRAA 2Z9BA 2O0MA 1P61B 1THTA 3ZH9B 4YV1A 3M6KA 3P9XA 1N2EA 2C2OA 1RE1A 3G8DA 1JTFA 1J8MF 5EJ5A 1ZD9A 4DSEA 1G8JA 1M2VA 4GDMA 1N2SA 1SO8A 4L4SA 4M1QA 1A95A 1NR1A 2ZROA 4L5AA 4TV9F 4IDHA 5EKSA 1NJ5A 2O54A 3DAYA 3VCBA 1KJQA 3UAGA 1B0PA 1N0WA 1YZVA 3EARA 1YVPA 2P3QA 4LCEA 4BJ3A 3UCFA 4LJYA 4C80A 2WM3A 3DPUA 3E6AA 1VJDA 2HTEA 1QTRA 1ZXXA 3TRHA 5H2FU 5FUQA 2PLRA 4A92A 3G8BA 1GUYA 4BN4A 3C2KA 3HM9A 5J1TB 4P4UA 5H8WA 3WWDA 4PIPA 1T1SA 3ZLUA 1MX3A 2H2WA 1J90A 4DSOA 2Y27A 1SG6A 2Q5IA 4DARA 3FAHA 2EDUA 4LMBA 2HVIA 2CD7A 1VJRA 4TVOA 3ENWA 2VT7A 3RODA 4HAIA 2IYAA 5P21A 5EJ6A 3KYCA 3TEMA 2ZJ2A 1BNCA 1WU8A 2AC7A 1ZQQA 3GLIB 3V9AA 1AKUA 3KEQA 4HVTA 2SNIE 1N5IA 2PPVA 2KZMA 3TRKA 5IIMA 5CVCA 3TQFA 1B26A 1JFFA 1VLQA 2BVNA 2FUKA 2ZG6A 3EAQA 4NMHA 3GARA 3ENZA 3EIXA 4CQMA 4EOGA 2GJSA 4OX9B 1HTTA 3MYYA 2ZT6A 4E32A 2O8NA 4V39A 1YJ8A 4F21A 2XB6A 1M0TA 4I2EA 3SICE 2VP4A 2OB1A 4N39A 1R8XA 1OBVA 3RUCA 3QBTA 1ZBQA 1RW4A 3QXCA 2D6FC 2JVKA 2PWZA 1O2DA 4FYVA 1TC1A 3GV7B 2WWTA 3PYXA 1H42A 2O2GA 3PXDA 1XMOB 3NHYA 2VXBA 1N8KA 5IH7A 2R85A 2W48A 1TQDA 3FAKA 4JI1B 2FY8A 1V9SA 1AN9A 1YTLA 5AJXA 4OHZA 4L3WA 3OHBA 2YWFA 1GL7A 5DEIA 4E03A 2HUNA 3EIHA 5CYGA 3OTWA 1AU9A 3T9EA 2CKDA 4F2GA 4TYWA 1EFAA 3D3NA 1F0NA 4OV6B 3H3JA 4N3AA 4GICA 3ZVKA 3E3MA 1QRSA 3S2UA 4FB4A 3JXEA 4OHVA 4FOPA 3IOYA 3SDZA 4I1YA 3PV0A 1R6VA 3QZ8A 3U2QA 1HLPA 4KW7A 3RU7A 2WNIA 1TJYA 3DAOA 1FDRA 5KQLA 2XWPA 2RARA 5CA0F 2QTCA 5WRFA 1ZLYA 1L8QA 3JATA 2CBGA 1GDDA 4GL2A 4D4HA 3P2JA 4MRMB 2WQ7A 2Q8NA 2CMHA 4Z5XA 3NIDB 4RMIA 1Q6ZA 1JT9A 5E2IA 2NO4A 4PZEA 3INYA 4WY5A 5G4KA 4C4AA 1FIQA 1MDFA 4DYHA 4ZHQB 1UBEA 3MT0A 3RADC 3DWEX 1RYMA 3GEMA 5C4MA 2XNDA 3A9RA 1G8PA 2GHIA 3PIDA 3U44A 2BV3A 3T6KA 2ACVA 2PL1A 1HRDA 3PEWA 3IAM1 2Q6VA 2XE7A 2X4IA 2DULA 4GI7A 2FH5B 2Z2JA 1OAAA 3OGUA 3UMJA 3BRCA 4WCFA 1T6ZA 1OXUA 1P7WA 2JLAA 2O48X 3BE6A 4BEVA 4X6XA 5HOQA 1GSOA 2O05A 3X1YA 3IB3A 2BH9A 3V7YA 1NFFA 1JROA 1QH1B 5LB2A 3S1SA 4J2HA 2HJRA 4UMVA 2C5HA 2WAYA 3E3AA 4YRTA 2ZR9A 4QZEA 4EJ2A 1JE1A 1GZ6A 5KPDA 1ECWA 4PGMA 1FFYA 2IH5A 5ED0A 3A3PA 4S1PA 5BSRA 3IA7A 2BFFB 1Z7YA 4H3KB 1FUEA 4YMLA 4YCMA 5J2UA 2FGJA 4UM5A 4RQNA 3B2EA 1HT2E 1G98A 1QHIA 1SA0B 2XW6A 4I55B 3HU3A 1XF1A 3RJJA 3GBSA 1I14A 3L79A 2EYQA 3HYNA 3RAPR 4B1FA 4ZC1A 2ERCA 2UZ3A 3PXBA 1YCDA 3KZ1E 3ICQB 5CX1B 4Z4EA 4YMWA 2B82A 1W85A 4X1KA 4MRRA 1XMIA 1CB7A 1ZIXA 1O6BA 5C0OE 4LI3X 2ZSKA 3V2IA 5K3EA 2PD3A 4BO3A 4H7EA 2R6DA 3GRUA 3EQ6A 2NT4A 1AROP 3STUA 1ISGA 5K0BA 1WV1A 3CX6A 4Y2HA 2LZ0A 1L5QA 1DAFA 2GCOA 4GRDA 1V4BA 1GQRA 1EXNA 4MGHA 2B21A 2AXPA 2GD0A 1MHPA 1NK8A 4TUYF 4FN5A 5COAA 5B4TA 1N3LA 2JV3A 3H86A 3KYJB 2OGTA 2XQFA 4Q9HA 2O1EA 3BQMB 2WLSA 4G1UC 1G21E 4UARA 1T4GA 3RYCB 4YRPA 4EMBA 4TXMA 2PMFA 3E70C 4W8GA 5BR8B 1C9KA 4EK9A 5EIFA 4HGPA 2IX9A 1E1RA 4A82A 3JAWB 3MMZA 4L16A 1YR3A 2IKSA 2VTEA 1JFTA 4C2TA 4H15A 4UD6A 1RWBA 1XLTC 4RLFA 1OFVA 2W8LA 1SHKA 2JGEA 4HDNB 4TV9A 1J0AA 5FTNA 3X3HA 5H5JA 1C9EA 4JI5B 5CK4A 1WHSA 3EWIA 2VXYA 2LCFA 3S27A 2GM5A 5KFGA 1YZFA 1N9GB 2IIPA 4NBSA 3DTYA 3H8JA 5BUSA 4EVIA 2P9TA 5GMOA 1JU9A 1FFDA 5CBPA 3ZHZA 1IBCA 4RGQA 2CDAA 2JK0A 4TM8A 4QPJC 4M21A 2NTJA 1MH9A 5ADHA 4HB3A 5ENZA 3GV5B 1S3FA 1E69A 1T35A 2DETA 4JI6B 3E82A 3P96A 1Z2OX 5BW4A 2J6HA 3QG5A 2E8PA 3UB2A 3V9PA 4QPPA 2ERYA 3IQXA 4TWAA 5F9FA 4WNAB 4KO8A 3AR2A 3ZWBA 2FSUA 4ZZ0A 1Z17A 4G8CA 3NHLA 2O6HA 2VT3A 4F5EA 5BWLA 2P77A 1LVHA 4JC8A 2V7TA 1R2QA 2BMJA 2Y77A 5DIZA 5T7BA 2ZUDA 2VZEA 3DWGA 5F51A 2P5UA 5IZCC 5EWMA 1H8ED 2MU2A 1RRMA 5C1BA 2GBLC 3DZ8A 1N7IA 1G291 2Y1WA 4CIYA 4FXOA 2X0FA 4CXMA 2WKSA 3IHWA 1S2LA 1Y81A 3PQCA 5IIKA 2Q0QA 4MDHA 4S1OA 3CYFA 4IH1A 2WZDA 3KBOA 4M6WA 3RB6A 2HXGA 3KQLA 3A0RB 1FYWA 4JOQA 1Y8QA 4K9MA 4FS1A 2ZJ6A 3ZIDA 3KK0A 3ND9A 3Q4GA 4YV7A 2A9JA 1DIOB 1LPSA 4XRRA 2PSHA 1JDNA 3L06A 1QCKA 5DHUA 4DQXA 4OOEA 2CLOB 5KKCA 3HO6A 3AY0A 5GZ1A 2R8XA 5HCUA 3AHGA 5LNK6 4F97A 2F3UA 4FZMA 1SKQA 5FOUA 1I30A 2PMWB 5ALUA 1G3RA 1N7HA 3MRSA 4OATA 9ATCA 4GPZA 4MEXA 4ELTA 3TI0A 4EENA 1V11A 1N63A 2LR0A 5KFDA 4MS4B 4XQ9A 3DKVA 4I50B 2X5KO 2YB4A 3NB0A 4JWKA 3ZGOA 2ZQYA 5G3YA 4EKIA 4LX8A 4O63O 4H6PA 4HNAB 5JUWA 3G23A 1QZTA 2VJ5A 5LZ5A 1Y5NA 2O14A 8LDHA 4EARA 3V2HA 4BDPA 3ZIAA 4QWMA 1KL7A 3DEJA 1FP6A 2ALJA 1Y0BA 1P4HA 2WU8A 4DLNA 3H9QA 1I7LA 4CR7A 1BYUA 1JKXA 5F3XB 3QXGA 4Y2SA 5D5HA 2MT9A 5JSKA 1JJFA 4IRXA 1ZQYA 2M1XA 5JH7F 1LX6A 4WVLA 4F4JA 1IJBA 1T8EA 3NTOA 1E1CB 5ELXA 1T3LA 3S8YA 4ECQA 5TMEA 3X2EA 1V16A 2D62A 3M2TA 2XCQA 4G09A 4MVJE 4B5KA 3E5HA 1G5HA 2HMAA 4MCHA 4FKMA 4NCHA 5M34A 1XF9A 3N2GA 4CKCB 3H4BA 1J2NA 3A14A 2RAUA 3RJ5A 3E5NA 5CJ2A 4ZEXA 4AUKA 5BV2P 3TXXA 4U7HA 3QU7A 4YJ2F 4TYYA 1XKLA 2NO1A 3ESAA 3LCCA 1XALA 1H2XA 1PZXA 5L3SB 1J0BA 3KL2A 5T3UA 4FR5A 5AD1A 4LF7B 3EFBA 2QN6A 2C4HA 2OWOA 1H0KA 1ULTA 3LXRA 4Z9AA 3H1BA 4M0EA 3ZPXA 5CU7A 4N6GA 4M86A 1EP1B 3K3PA 2X15A 1ZJ6A 9ICOA 2JD2A 4EUNA 3AF2A 5DEOA 1B8NA 2KW5A 3FZNA 2ZYSA 2G1JA 3AQ4A 4DREA 1QRTA 2R6FA 2PIDA 3AM9A 3ZBPA 1JLLB 2R1VB 2XCPA 2YMQA 3KUUA 1TM3E 1XMXA 1WAMA 1ZMXA 4QRDA 1CRQA 3ZHQA 1PZMA 2PZEA 2WSSD 3GZNA 3ITNA 4UCXA 1ZJ4A 3MJVA 2VQSA 2W37A 1MJNA 2HL6A 5CYFA 1PKEA 3IT0A 4U6SA 5K6AC 3K16A 2KKPA 4O4JB 2AMFA 4U2DA 1OZHA 2RG7A 3EZ6A 1UBMS 4HTAA 4G24A 3U1BA 3AEUA 2YIDA 3GRVA 4HH0A 1EVEA 5EXTA 2ZRJA 3IKMB 1A9ZA 1US8B 4LOAA 4TLBA 3WBJA 1ZGGA 5LZ9A 4OVKA 4GHWA 1B16A 3BYZA 3D3EA 4OM7A 4E2XA 2IEAA 5CFQA 1KTIA 5D5PA 2RHWA 3HTXA 1O87A 2ZB4A 1VMDA 1M6VB 4PCVA 3EIQA 3SAHA 1ZFNA 4YD1A 2IP2A 2W8BB 3HP6A 3ZZNA 4J90A 3WAKA 3LP6A 1YNSA 2C9MA 2J3EA 3DE4X 5AXCA 2WLTA 1Q0UA 4XUEA 1OWOA 5MFPA 1LB1B 4PGGA 3OZSA 5IJAA 5GJCA 3PC6A 3JZMA 4RBNA 3RS0A 3TLGB 1UODA 5KI6A 1ZPDA 2WYUA 2XKJE 4BLTA 1TKDA 2GZDA 3EA0A 4E15A 3N8HA 1E6KA 2W2XA 2E4WA 1NXSA 1R66A 4NJ8A 2P5YA 2HHVA 5HF6A 3EXFB 4G86A 2GLUA 1L5OA 3F2IA 4RPIA 3UV7A 3KU4A 3K8OE 4LJLA 3SJUA 3OE7D 4DRYA 1AS2A 1FBTA 5B7GA 2QVCA 2F9FA 4RZQA 3G2QA 1GFWA 1JL3A 1MJ5A 3U4GA 1I3CA 1C8KA 1FC0A 1QOQB 2YNMD 3C2MA 2AZ4A 3B9RA 2NU7B 5LZ7A 3PRHA 1TT5B 3VC1A 4JQCA 5TRTA 4YJHB 3AXSA 2WF7A 1ID8A 4YMHA 3N9IA 3ZWOA 2GEFA 5F5XA 2VTBA 4F4ZA 2FV8A 1RYBA 1EDEA 2GZAA 1K1SA 2E3TA 1L9XA 3B6MA 3L46A 3KT8A 3GIMA 5K8UA 2ZB3A 1ECGA 1QU3A 1T9GS 4IJUA 1V71A 1VCMA 1APBA 3KYIB 4RPCA 2FPPB 5J2FA 1OGYA 2W6ZA 5CEEA 4PYJA 2V4UA 1R16A 5ISMA 4TWBA 5B4VA 1N1DA 4L57A 2NO9A 2PBLA 4JGGA 2FPIA 5HKAA 1Z73A 3ZXSA 4Z54A 2KZ3A 3H2YA 2GVDC 3LBAA 3WBBA 1AZWA 2ALZA 1ST3A 5J0PA 2PUVA 5U4XA 2O8BB 2VDRB 1Q16A 2H11A 5BYJA 2O06A 4EM6A 1KDOA 4XWKA 5FWYB 3I9LA 3KC2A 4CRWB 2UZAA 1U2SA 4HP8A 1YHYA 3PSFA 3CRXA 2DQSA 1Y7HA 4ERXA 1HKUA 4C0KA 2ONZA 4JODA 3S29A 3V7KA 3OF3A 1T0UA 3GA7A 2JHCA 4V0NA 4R3WA 2DY0A 3GT7A 1RQPA 3JY6A 1UIRA 3U5TA 4C4SA 3M5WA 1U3UA 5AI9A 5JRDS 4NCBA 1IYZA 1NFQA 2PAAA 1PT9A 4D02A 4BX8A 4REMA 1EZZA 2CJWB 1T3GA 1E9SA 2QRUA 1XKXA 4HXEB 1UXJA 3I6YA 1X9HA 4IDFA 3JZDA 4LOIA 3IUYA 4H6XA 1Z0FA 5ERYA 4WBNF 2YQ5A 3PWSA 5DYGA 2OCKA 4BKOA 3KQYA 5FPYA 1L1EA 1XU7A 3GH3A 3AETA 1FJHA 5IJ0B 4PRKA 4EL0A 4EYQA 2DY1A 2WB2A 2AA3A 4WSOA 5FI0B 2BMFA 3RIHA 1NATA 5HHIA 4MCJA 2ST1A 3U4DA 4DLLA 4G6ZA 3V8PA 4HYTA 4M87A 5HZKA 3GEPA 2AJTA 3ZHVA 3Q88A 2VUSA 3UKOA 3ACCA 3LWBA 2EFJA 3WLLA 4RJ2A 2PK3A 1F8UA 4C8KA 1ZC4A 5EKTA 1DEKA 2VG8A 3HPRA 3TOZA 1K4KA 2GJ9A 5CCEA 3JASA 1IIBA 3L0SA 5C8YB 2OYRA 2H9AA 2C5AA 1OHHD 1ZONA 2VZLA 4G67A 1E1KA 4KB5A 2D1RA 5E3HA 4LOKA 1H4VB 3EIEA 4A9AA 5JXIA 2ATXA 3ZU2A 2P65A 3FROA 2QYOA 5A0TA 4JKOA 1SCDA 1XTJA 2O8VA 1W5FA 2KG5A 3KT6A 1YQGA 3H9BA 1HIWA 1SPXA 3VXKA 3PLRA 5TEVA 4U02A 5KVAA 1MJGM 4J6EA 1QYWA 1NE2A 1JSXA 1NIJA 1X1CA 3HDYA 5SV2A 3DOEA 3SF8A 2RE8A 4A73A 4KPEC 4QM6A 1DX6A 2NU8A 1WEKA 2P5TB 3RBZA 2HB6A 3CUUA 4J0GA 4ZOEA 2OXOA 3VDXA 4JROA 4YECA 1ZJJA 4H3SA 2VLIA 4ED3A 4QM7A 5AOVA 3EF1A 3ON5A 5A6SB 8ICKA 2ESEA 1IY8A 3ZXYA 2C5BA 2PKQP 1AJEA 3FDZA 3QLJA 2VYVA 3AVVA 4M0FA 3RVSA 5ED4A 5JDIA 3RHSA 4BN0A 1XP5A 1J1UA 5FTLA 1QHHA 4KG7A 4BKRA 2G5IB 1O0BA 2YRFA 4JP3A 1W88B 1T5SA 3IERA 3LYUA 3BGOS 3L7AA 3H5AA 3NETA 2H17A 2P2LA 3O8BA 4NYJR 1ZM9A 5KYXB 1PE0A 5F9HA 1EQAA 3A0HU 1DV1A 4C3ZA 4FQ5A 1XLVA 3O8NA 3QKSB 1GCOA 2VANA 2AEFA 1KJIA 1LBIA 2P2SA 3DVLA 1LPPA 2AN9A 1BJRE 3KM0A 3VPHA 3ZTTA 1EAMA 4W9MC 2J5XA 4QD3A 5TNXA 5DASA 1XVVA 2Z83A 4NCJA 1E9DA 4BMCA 1E4VA 4MYTA 2F62A 3SJCA 4YXFA 3VC8A 1G60A 3W4IA 4ELUA 1V37A 1UBOS 1WDKA 1FZTA 3W05A 3OCYA 2DF4B 3L5OA 3SBEA 1Y5MA 4LMPA 1EJ0A 1MA7A 2BFCB 1PVOA 9ICAA 1Y1TA 4RCYA 3FR7A 5IJZA 3K9CA 3P0JA 4CT0A 5BMVF 1SULA 2YIVX 1EK1A 3GFBA 3RV4A 4GRAA 3F2VA 2JCYA 4GP6A 3VH2A 4O33A 3NVKI 3DOOA 2FMIA 4ZT5A 3ZVMA 2BKAA 2PGIA 4HUQA 3UWPA 5A7GA 3VNAA 4LZGA 3REOA 3TAHA 5HJ5A 1NQOA 2JAOA 2AZDA 5A9TA 2XB4A 4ACOA 1GFSA 4UZSA 3I05A 2XSZA 1FLDA 5I7VA 5LPNA 2RLTA 4F3TA 1E4EB 1PS9A 3PDUA 4CNBA 3I12A 1KC1A 3UQ0A 3G9QA 1JA0A 2BHLA 2JBAB 1LRKA 3O8CA 2BGTA 2QBYB 3OQPA 3IKTA 1LBQA 5J2EA 2E5LB 2C0QA 2F77X 2W2TA 4LFCB 3FHOA 4L5IA 4P5DA 1KFKB 521PA 4OQEA 2RHMA 2JHAA 1CR2A 3T4XA 3OHMA 3OIWA 1TU0A 2QVZX 2G9UA 1O0SA 5KWJA 3TOXA 4XWTA 4NPHA 4LJ8A 4ZI3A 4LNHA 1DQPA 3MXOA 1EK2A 2J6SA 4DL2A 2IH2A 2PBFA 1SCQA 4B8ZA 4ELVA 1XZEA 3OEED 1R6AA 1CJCA 2KP7A 3PNMA 5I8ZA 5HKBA 1J07A 1NRJB 1XQYA 1VTKA 4BUGA 4ND8A 1NDQA 3WGMA 1FB5A 3OJOA 3WKDA 3IDZA 4J9OA 1ZH0A 3PUWA 3DFMA 4N65A 4PYOA 2W0SA 4FOOA 4TQUS 3UCXA 4UM9B 4ZGWA 3OC6A 3KT3A 3HUEA 3WK7A 1OFHA 2VPIA 4M2YA 1I1NA 3IP1A 3LPDA 3VNQA 3LNCA 3QEOA 4NU8X 3DBLB 4BZXA 3I6BA 1LFAA 2NVUB 4W9NC 5CD1A 1AA9A 5DI3A 4OJPA 3TLXA 2JCGA 3MJCA 3FETA 1HDIA 1S89A 1VYTA 3CNBA 4UZEA 1VE6A 2VUUA 5K0ZA 1P81A 7ICIA 5FI1B 4I2NA 4M99A 3WNDA 1QTIA 2FEAA 2XCUA 4UU7A 2BFDA 3ILSA 2ZTLA 2JCXA 1D6MA 1O57A 1KK3A 1PVDA 2JDID 3I9NA 2VKQA 2H54A 2WJYA 1L7NA 1SCAA 4WD3A 3PQ3A 4YYEA 4JP8A 1CUAA 3NDRA 3HKZC 3OMXA 4HT3B 1GKLA 4XUDA 1ZYQA 4ZJPA 2X0IA 4L22A 3B1VA 2E21A 2HDHA 4KFTA 1ZHFA 4TLEA 3CEJA 5BVHA 1IMJA 3PQDA 2IYOA 1EHYA 1AXEA 4WNIA 5AMXA 2WDZA 4K88A 2DJ5A 4DOAA 1RM4A 4WKCA 1DV2A 1QQBA 3T1OA 4I6EA 3WDSA 2X1LA 4I9GA 3GUZA 5LJIA 4KYIB 4NPCA 3SXPA 1CZHA 3ZZUA 4CL0A 2HCBA 4JT2A 5DCYA 1DC3A 3B0XA 2XBUA 1JE0A 3ZCUA 3JD4A 4KNVA 4CM1A 4RV4A 4AJ1A 2ZTDA 3K1TA 2JLXA 3U7QA 3QLUC 1O95C 2A5YB 2ZSIA 3H2GA 3SX0A 3OZCA 3WHLA 3BB1A 1ZQDA 2HCRA 1PK7A 3DR3A 3OJUA 2ADOA 5K5EA 2X6RA 5B2EA 1XRQA 1JKIA 4D46A 1ITZA 4PHTA 4DLZA 1WABA 3HACA 3FKSD 2JAUA 2L2QA 5JTIA 1XYYA 3TD2A 2JJYA 4I9FA 3I8OA 4MHVA 2JKVA 2PO7A 5DX1A 5FO0A 1U3TA 5ITVA 4E4RA 5FUXA 1KEVA 3FOWA 4Q4HA 3EBLA 4DDKA 4YFYA 4C7VA 1YQDA 4H31A 5IDWA 1YIAA 3KR2A 3SAGA 3HDTA 4UBIA 2EFYA 2NZUG 5DW3A 1UKYA 2WJIA 3LSYA 3QYAA 4QECA 1U2PA 3KVVA 4PZPA 3VU0A 3FSGD 4XVHA 4L3OA 4B74A 9ICFA 2P8JA 5IT4A 2W71A 3C3EA 1GQSA 2D8AA 3QA3E 2PYIA 3IQIX 3MCVA 3S8MA 5DBFA 5H70A 1E3JA 4WEQA 2EW1A 3UAYA 4R2HA 3GD7A 4PW0A 2ERXA 5DGDA 4DR5B 1T4DA 1YS2X 4Y2YA 3Q9SA 3H97A 4YUZA 4QC2A 4DTIA 4C7OA 5KNCD 2KSQA 3FF4A 5JSUA 1YJ5A 3GT4A 4MVJI 4PC7A 4NZPA 2R2AA 1IM4A 2F90A 1VI5A 5M3BA 2K60A 1SVOA 5KWVA 5LU9A 4ZPJA 5J2CA 4DGSA 3PS9A 2WW8A 2Q3JA 1KP2A 1J99A 4CM9D 1O6ZA 1ADJA 3KKZA 1RQNA 1K2WA 3W0LB 3O75A 3K6KA 4RWEA 3UAOA 4EG0A 1E1DA 1P4SA 3W3AA 3V2GA 3ELWA 1ZR4A 5ER9A 5BPFA 2Q07A 5J0QA 1ZY2A 1TQ6A 3FHTA 4G2TA 3BIFA 5MN6A 3AL0C 5BRNA 2FP4A 4RHEA 3GFFA 3UVEA 3VO8A 1T8YA 4B46A 3WISA 1TQ4A 5K3FB 1XCPA 1HUOA 3P0RA 4LC0A 4DFMA 1MQ8B 1QF9A 5KYKA 4D3ZA 4B7ZA 3T4UA 1GGNA 5A06A 3ORFA 1ZQHA 1QG2A 1CBUA 1L5LA 4K3VA 4YPFA 1BWSA 5B6PA 4RZSA 2W4IA 2G77B 3K0BA 9ICXA 5J63A 1V95A 2VCYA 3PWKA 1DL5A 4AZ3A 5JSZB 3RRYA 3DPSA 3L8DA 1SC1A 1VE3A 1Q3UA 2GAOA 1IDN1 1PR0A 1XJCA 3WKAA 3JVDA 5BVGA 1PVPA 3Q0IA 3BORA 1DDOA 3DKIA 5HWSA 3RBEA 2E1PA 4A3SA 2DB3A 4BO7A 2QTBA 4FIDA 2X2EA 2X13A 1EUDA 2ZDQA 1G7RA 1C0PA 3LTEA 2QMHA 3IELA 1DP4A 2Q4OA 3OM1A 1J21A 3IMKA 1DG1G 1PYOA 1L8XA 3FNQA 2PYZA 4HZGA 3O4IA 5KX5F 2DT8A 1PJ2A 4YK7A 3MW8A 2CEKA 4PYLA 1RPAA 4FYJA 3IP7A 5L4LA 1LQ2A 3LP5A 2QDXA 4K9PA 3JPWA 4CDNA 4QQKA 3OQOA 5A02A 1ODCA 1TF2A 4KITB 4X62B 1ZRHA 2AD1A 4LXYA 2G9RA 3RUPA 1SZDA 4KXXA 1WNTA 4YAEA 2XMPA 1Y9EA 3SSAA 1H4QA 3WWYA 3T1HB 4HGQA 5GWXA 1Q1AA 1S02A 1X7WB 5ADVA 1ZUNA 4Y1EA 3N5CA 1AUVA 4LDZA 3JALA 4CLDA 3HZOA 1CETA 3VNVA 4Y6PA 1RM0A 1O6CA 1W5EA 4J0FA 1SUWA 3RE1A 4LDNA 2I29A 4Z7QB 2NUPB 3CZRA 3NBXX 4ETIA 4GXNA 3BTUA 3V7FA 9LDTA 3HYTA 3KS9A 4ZVPA 2VHXA 2R11A 4BE7B 2ODGA 2BFMA 3HHPA 2LKCA 4ZAWA 2C9DA 1C81A 5AESA 2W2KA 1L5RA 4CTJA 4EKGA 4QTZA 4CDMA 5IXSA 4K6FA 4MWGA 3RNOA 3QLVC 3BREA 3VR3D 5AKXA 3I1YA 4LDQA 1NV8A 3W5JA 3DBRB 1Q2UA 4RACA 3S5UA 2WA1A 1UP6A 4IHQA 4UU1A 1BZYA 1O8BA 1VKHA 5DO9A 5I01A 2R1TB 1X7DA 1CR1A 4ZOAA 2QE6A 2CXPA 2BQ3A 3L2OB 2NYUA 5FOXA 4XYLA 2F76X 5JWRA 2ZSUA 3ZVLA 3ETGA 2XMCA 4ZI7F 4QOSA 3TW8A 3GFGA 3PDHA 3K70B 5TGDA 1ESDA 3E61A 3QF4A 2V3WA 1CS0B 3NXKA 1LUAA 4LQCA 3HBMA 2PZFA 3AI1A 3TBFA 3NJ8A 4HN2A 2P0AA 1VLHA 1R18A 4LRYA 1O5IA 2WAOA 1RLMA 4U5QA 4DT1A 5L7WA 4YP6A 2NYVA 4B43A 3RVRA 2BCVA 3V6MA 4L8WB 2PS3A 2J67A 1WUDA 4D99A 1JGTA 1C8LA 1P1HA 4ZYTA 2VJ4A 5C9ZA 2XVMA 3GDHA 3EVNA 2ONKA 2QQEA 4IZOA 3HB0A 3GJ5A 4OHCA 3EQ9A 1BPEA 2HRZA 2OBLA 1MOSA 1EWTA 3L1UA 5AM2A 4BRUA 1M2GA 4R66A 4GPBA 2OXRA 1MX1A 3N2EA 2Q29A 4AY3A 3LPNA 2CDBA 3GELA 3U09A 3UMYA 3KG2A 4DDTA 2C07A 5JAMA 3AK4A 2ZIXA 5JCJA 2KIWA 3EPKA 3OOWA 4DV0B 4FE3A 3G6XA 3AR6A 4DQDA 4L15A 3TEJA 1Z4IA 4OJ5A 5J4KA 1I2MA 4HEHA 4EGSA 2IU0A 4BRWA 1GO3F 4NBRA 3C2QA 4OK3A 4YAIA 1U90A 1R64A 4UXJA 3CHYA 2WU4A 2KHQA 2OD2A 4FR2A 2I66A 3HKBB 1E9CA 3CUTA 4ZDKA 3KSZO 2QPTA 7AT1A 2D13A 4K28A 2G7MC 1VGVA 4H59A 2GI4A 3VSEA 1ESCA 2P6PA 2VP2A 2WV7A 2P90A 3B2QA 5IIJA 5LBUA 3I5MA 3RC8A 1RP7A 4NE2A 5AJHA 4XSVA 4Q37A 4NBLA 1YCFA 1Y6ZA 2XWBF 5H68A 4ABTA 4BGDA 2CSUA 1BU5A 4X92A 5KNBD 5KFSA 3C3KA 2V7BA 4H08A 2M32A 1GPDG 1Q2XA 2YRXA 4YR9A 2HDOA 1A9SA 1KAGA 5J2BA 4KQFA 5BT9A 1KBQA 5CYOA 5IDVA 3L4BC 2VP0A 2WIGA 2X8JA 3F3MA 2OCXA 3PJEA 5AXAA 3X2SA 4M0AA 4PCLA 3FDXA 2F2TA 2ZIAA 3M4XA 2OC9A 1ZKMA 4JBLA 3BMOB 3CCCA 2M6KA 3T34A 4AI6A 5LQDA 3T3HA 3I83A 4R2LA 1Y3HA 3GFTA 4J16A 1SFRA 3G2JA 3EWSA 3JYLA 2CNBA 3VDQA 1A9QA 2Q5JA 5A7HA 3HNPA 2KSOA 2J0EA 1TK2A 2NU6B 4JYMA 1GSIA 2ODNA 1JJIA 1AA6A 2QXUA 1XA4A 2OO5C 1Z28A 1G20A 3SHVA 1ZH6A 4Q7KA 5TB5A 4HXFB 1KJWA 2QTFA 2G6TA 4U6PA 1D8TA 1IXRC 1GZVA 1YRLA 2OBMA 8ICJA 1ZUHA 3RRBA 3A1EA 4D7AA 3AQIA 4ZYZA 5IJ9B 3I61A 4WJKB 3WMEA 4Y0VA 3HY4A 4MV6A 4B31A 2V0GA 3T9DA 3PWZA 1PWZA 3I1IA 4U63A 1MABB 3GQVA 1HE8B 3GJSA 4KYTA 1W0CA 2QN2A 4RIIA 2XICA 5C3UA 1ESEA 3PG5A 4ZO9A 5KX5A 1Z5GA 3A70A 4QHYA 1VHDA 1U1DA 4MVWA 3RRXA 2G5PA 2RGBA 4M53A 4GLBA 3CO5A 1EFVA 3UN1A 5GIPE 4B7AA 4U3JA 1PL8A 4JNCA 4DBVO 1J00A 2NQTA 5CNIA 1ANKA 3GBPA 4ZXPA 4NXMB 3V72A 1BMFD 1Z45A 2WKWA 3PXGA 3DDSA 2X1HA 4BKQA 1QP0A 2CMGA 2SCUA 2O8CB 2AGQA 6REQB 2IYTA 1DBRA 1M9NA 3X43A 3UMBA 4U8GA 1E59A 1BG6A 1W4BA 2QJRA 2R3SA 4XI9A 4YR3A 3OOHA 5TT1A 1VBNA 3I01A 1FVXA 4XUSA 4TZ6A 4RDIA 5CNKA 3QENA 2A9RA 1DJOA 3ILHA 2IZ7A 2NG1A 5FTWA 5KFFA 1E5XA 2MSLA 1ZCBA 4E0BA 7ICEA 3MZ0A 4Z6KA 4DKJA 4NYMQ 2Z3VA 1VIMA 4PYNA 1R0LA 1MX5A 3KKAC 3CF6R 3EJWA 2ZRBA 5HIKA 5DLPA 2Z2YA 2Z8ZA 4PFQA 4UHHA 2J6CA 1X14A 1KPHA 3L3BA 4Q4JA 5DLYA 2X7HA 1OE0A 4Y2QA 1H2EA 5LYYA 1LRJA 3ORQA 2HCTA 3SWWA 1U1CA 2LVBA 3TUIC 1W2WB 821PA 2P6MA 3DUFA 3SC3A 4BNWA 5LQCA 2IW3A 3F6PA 5J1SB 3KZMA 2F1KA 1CZRA 2X4DA 4JJIA 1VRVA 1HLDA 3PC8A 3AG5A 3RUIA 3VTFA 4ND7A 1E1NA 2H1RA 1Z0AA 3ASVA 5E7JA 5KUTA 4U2BA 3C8HA 1XZCA 2IUTA 2XUJA 3OKAA 3SIWA 3DLIA 3U6BA 4IDBA 4PPYA 2JLWA 4ZI7A 1TQ2A 1OU4A 4NK5A 1YFJA 2IUFA 3BS4A 1XSPA 3T1QA 3UMFA 5K3OA 2Y4OA 3MMPA 1NZFA 2X4LA 2VAVA 1NSFA 4TQAA 3JW8A 1DWPA 3KXKA 2KKVA 1TIKA 4RUKA 1IM8A 1R9GA 3I58A 1XQXA 2I62A 1LZKA 2X0KA 3WSTA 4EZ9A 4B9EA 2EX0A 2TMKA 3PGVA 1T9GR 1CRZA 3AUSA 4PJ0U 3ITEA 1Q95A 1SOWA 3OSNA 4Q82A 1DXQA 3TX6A 5JR3A 1BWQA 5KFLA 2FTKE 3GEGA 4BNMA 2C4UA 2HBZA 4FJ0A 5FUMA 5T8KC 5L7TA 1XB2A 4BO5A 3CLRC 4UREA 2J3JA 3JWEA 1MGPA 1RABA 1IVYA 4JQOA 1CUBA 1AKTA 4OLHA 4FGZA 3OU2A 10MHA 3PR5B 4LY6A 3Q6NA 4D41A 3AP1A 5JHHB 4RA9A 4UNPA 3PNLA 2HT1A 2PKRA 1JQDA 3TGPA 2OC4A 4TL9A 1NW8A 1FYXA 2E5SA 4HNVA 1UDWA 3FZGA 2WUGA 3I4FA 4JOBA 2PLNA 2J3LA 1X2BA 1FRFS 3Q2KA 3DOHA 4ITVA 3HN6A 2FZEA 4BV8A 5LQUA 2G5CA 3L40A 5DB6A 2B4AA 2P7HA 2BD0A 3L7MA 1R15A 1LDBA 3IUJA 3ELDA 3UT5B 2ISOA 4L8LA 3QLTA 3RSQA 2BGLA 4K6MA 3RAQA 1IM5A 3V8EA 1CVLA 4US0R 1GA6A 2QN7A 4DFPA 2ZJAA 5DBHX 1E7MA 3AEXA 1ECFA 4F5OA 4C7BA 1RWVA 3Q8QB 4RSRA 3FGPA 4Q3KA 2ASDA 4GI2A 4JJZA 5KC8A 4EGJA 1JWBB 1P33A 4WOCA 1OQAA 1KOGA 2K4PA 3C3CA 3N6XA 3GZJA 5CLLA 4IX9A 1WSBA 4TSFA 1LFDB 1TMGE 3I5UA 2Y3IA 4BPRA 2FMHA 5KT3A 3FSRA 1R0YA 1VE9A 1XELA 3IB6A 4XQGA 3IMEA 1JNYA 1ZMTA 3LFUA 2Q0HA 1GGJA 3MWFA 4PSDA 1Z4OA 3RJ9A 4XFJA 4TTTS 1CQZA 1H93A 3VVBA 4RAOA 4Q16A 4NC9A 3TYXA 2IHMA 3VGPA 4CFSA 1C3XA 1R9NA 2WFLB 1BQ4A 1SOUA 3JQAD 4NFSA 5LYJB 3CVOA 1WXWA 2I9KA 2NYRA 2IUYA 4KUHA 3HLYA 1QLJA 2J30A 1EK0A 1Q3TA 4D42A 1R4NA 2P4EA 1VA5A 4JC0A 3DTVD 1B7GO 3PJDA 1J70A 4M9JA 5BNWA 2CMDA 3D7SA 3RARA 2AWOA 4IKPA 2JCVA 3ZZ0A 5CBKA 4KPYA 2RONA 3ZV3A 4S1VA 5J2DA 4W99A 3LKDA 3NG1A 4EYKA 4RQ1A 2FZLA 3W6UA 1RPLA 1M2VB 1K6IA 5DT2A 4WADA 3CG4A 5DM4A 4G5GA 4FFOA 2VF5X 4ZTBA 2G6BA 3VR5A 2NU9A 2J7KA 1N6OA 3FYCA 1M5UA 3UJHA 1H2FA 3RUAA 4J76A 4F5WA 4QNRA 2VHQA 3CVWA 2WWFA 2XXBA 2Z04A 2IITA 1EFKA 4DA7A 3EX7C 1N7JA 1ISJA 1U0NA 1R74A 2XWQA 3F6RA 2NUAA 1R6TA 4IX1A 1OB5A 2PR2A 3G79A 4NPAA 1HNZB 4BVJA 3UWDA 2RGRA 1L6IA 4R2JA 1FSGA 5DMHA 1NVVR 3FCAA 1BS9A 3WX0A 1R0RE 2WOJA 1G59A 3QFCA 4B3MB 2ZWVA 4IWYA 3KELA 3JQCA 3KYCB 4IHKA 3DEFA 3HC7A 5KPJA 3PEUA 1Y3FE 2V1UA 4ALKA 2DGZA 3C43A 3L7JA 4EX7A 1MXHA 3FB1A 3G1TA 1GHTA 3FVRA 4MKHA 1W5BA 4F45A 3K4QA 1CZUA 3KQPA 2VBGA 5HOEA 2ZE6A 1JFFB 3GGSA 1KEEA 1HYBA 4LXUA 2EWWA 1SUCA 3ZW8A 4O0IA 4AWXA 4FHDA 4MPTA 1M1NA 4DUPA 4Q00A 2CXNA 4CQMB 4PVCA 3IL2A 2G09A 3IHQB 2X2FA 2DFNA 1CRLA 5K9ZA 1OH5A 4J9SA 4MFAA 3E7DA 3GIKA 1G64A 3IDAA 2CVPA 3VR6H 1KU0A 3PSPA 4PNZA 4C0XA 4MI3A 3C97A 4UNIA 4RD3A 3C3MA 3INTA 1S4MA 4PLZA 4UQLA 4EYGA 2ZJYA 2QR3A 4Q24A 2PKQO 1N34B 3E1GA 2GN8A 3HPOA 2YX8A 4MV4A 5BNIA 1Z7EA 4IG9A 3IUNA 2QRPA 3PQFA 2FEPA 3KJEA 3DWIA 1KAEA 5KTMA 5IMBA 1JR2A 4MRAA 1KY3A 2JEIA 4DEZA 1SKMA 4JJAA 3TJZA 3A3KA 2GVNA 4H18A 4BNVA 2KOBA 2GKSA 2KLBA 8ICFA 4BASA 3B9BA 3Q0TA 2WU1A 1TE2A 3WMGA 4K6CA 5HE8A 1ZUD1 4ZZIA 3R3HA 3ABRB 3ZHRA 3M6MD 2EBUA 1HYHA 3KOWA 5CGQB 2WT8A 1V5FA 4RVNA 3T9CA 4KE6A 3MINA 1XQWA 4O0LA 5ULLA 1DLIA 3P9PA 3EVFA 1AKYA 2PUBA 5CA0A 5HZGA 1LVUA 3DBOB 2Z57A 3PHJA 1CX9B 2IYVA 3C5FA 4RFVA 5E4YA 4OKNA 4AN1A 4GO1A 2HWWA 3EGVA 1H22A 4NZNA 5CNJA 4RHUA 2Z9CA 3MHPA 2KHZA 4U39A 2H5LA 5KJ6A 1PEKE 2YHSA 1USVA 3U26A 5C5JA 3ZLTA 1UA1A 5G4KB 5FPHA 5AKHA 4B8YA 2OBNA 1GPH1 4EKDA 3WV4A 2JVIA 5FBVB 1XNSA 2CNDA 1K7YA 2XT0A 4RE6A 1RE0A 2ZCVA 4LF5B 3PD7A 3R7LA 1OT5A 1IY9A 3U44B 2H7XA 2QQ0A 3I6IA 4OYRA 2YVQA 4CKBA 4F5PA 4DQVA 1ISPA 2SHKA 3DG9A 1XT6A 1QRUA 4C03A 2A3NA 2H2IA 1TQHA 1WLYA 4WCFB 1ZRNA 3BXFA 2BSQA 4CLHA 3MXTA 3TSZA 2YYYA 2PLWA 2J09A 1UDRA 2PE5A 1QP8A 4YT4A 3T5GA 2MUTA 3BGVA 5DBGA 4DQLA 3LYHA 2QX7A 1WQ4A 4JX9A 4LDJA 4CCSA 2KM1A 2R1UA 4DFDA 2XD4A 3FCSB 4L1KA 1F8FA 3NM4A 3T3FA 3F5MA 5L6MB 2UVUA 5J2UB 2X76A 3RJIA 4F71A 1RHQA 4YRRA 4DMGA 3S3TA 2PMEA 3ZD7A 3SM3A 3BQ9A 3AEYA 2I4TA 4L4RA 3SYTA 2HA6A 3FTEA 4AN4A 5D87A 4DJDC 1Z18A 4KIWA 3N7PD 1NXWA 2AD5A 1U7UA 1L7DA 3PNVA 4TT3A 1W85B 3GWZA 2IBSA 1TUEA 1Z6TA 3G8YA 2NZ8A 4DQIA 1DJQA 3ASYA 5CDUA 4Q3NA 4QYTA 2JD0A 1YACA 4B6OA 4P22A 2J7PD