4JB3A

Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron VPI-5482, TARGET EFI-501083, with bound sodium and glycerol, closed lid, ordered loop
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 80
structure length 218
sequence length 218
ec nomenclature ec 3.1.3.104: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4jb3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4jb3A01
3U7GA 1VFPA 2AUTA 5ALWA 3WKEA 4HAIA 1RRCA 2YJ5A 3QU9A 2RBKA 3OCZA 3OCXA 3EWIA 2I34A 2HOQA 5AVQA 1QQ7A 5A3SA 4Y2QA 3ZI4A 4UARA 3AR8A 5AI8A 1F5SA 2IA5A 4JB3A 1EK1A 4UMFA 2HF2A 3R9KA 3A1CA 4KN8A 3QNMA 3WGVA 1ZD4A 4CF5A 3A3YA 3AR6A 3EF0A 5AW6A 2B1RA 3QGMA 3UMBA 2WF8A 2PQ0A 1TE2A 3OCWA 1Z4PX 4QJBA 3U7EB 1U7PA 3W5AA 5A3QA 3PDWA 3IJ5A 5ALOA 4RESA 2C8LA 1FEZA 4ZEWA 2MU1A 3QUQA 1N8NA 4G63A 1NRWA 3OPXA 4YIKA 3ZWDA 1YJ5A 3M9LA 4HYTA 1TJ5A 2B1QA 3IRUA 1Z4MA 4Y3UA 3GYGA 4HGPA 2OBBA 3SD7A 1RQLA 1U2TA 4UMDA 1WR8A 5ALVA 5T41A 3B8EA 3FPBA 4DW8A 1J97A 4NABA 2Q4RA 2B30A 2CFRA 4YGYA 4E88A 4L6AA 3B9BA 1RMYA 4Y2SA 4AS3A 3U7HB 1LTQA 5AK5A 5ALLA 2C4NA 4BBJA 5AVWA 5AVTA 3AR7A 3QU4A 1U2SA 4YCNA 5AI9A 3P96A 3OTQA 3N8GA 2R8YA 5AKZA 2CFSA 3HLTA 4C4RA 3ZUPA 2NYVA 4UMVA 5AI4A 4MWOA 5AK6A 3ZTYA 1Z4JA 1YV9A 1SWVA 5ALXA 2I6XA 3N28A 3QU7A 4Y2YA 1L7OA 2B8JA 3L1UA 3KBBA 1O08A 5ALTA 5AK4A 5ALDA 3ZW7A 2G1AA 4OFZA 1RKVA 4MUMA 3W5BA 3WGUA 4OD0A 3AR5A 4EENA 1L7PA 5AW1A 2GHTA 4NFLA 2FPXA 2AGVA 2IOFK 4C4TA 4UASA 3WKAA 3SHQA 5ALJA 2I55A 2W11A 2YBDA 1ZD3A 3I28A 5E0OA 3WK6A 2HEGA 1YNSA 4ZEXA 3W5CA 1NF2A 5AKEA 2G07A 4AP9A 5AIBA 5AW3A 4UU0A 2ZG6A 1L6RA 2WF6A 3ZTWA 3WKDA 5AICA 2EARA 3I6BA 3ZWKA 4GIBA 5AVXA 3BWVA 3B9RA 4YCMA 2IOHA 2AH5A 4XPZA 1L7MA 3UM9A 3E58A 3NALA 4HGOA 5A3RA 3U7FB 1RKQA 2PKEA 4DCCA 4BNDA 3QXGA 3L8GA 2C9MA 3S6JA 1QYIA 3N1UA 1RLTA 2YJ6A 5AW8A 3DNPA 1IWOA 4FE3A 1TA0A 4RETA 2I54A 5AIAA 2W4MA 3MPOA 5AVZA 3QUTA 3L1VA 2D2VA 3RF6A 2I33A 2Q5EA 2YN4A 3QU2A 3SKXA 5ALHA 5AM5A 4KYTA 4JDPA 4ZEVA 1RDFA 1XPJA 4AS2A 4EX6A 1EK2A 3ZVNA 2HDOA 1N9KA 2OA0A 4Y2PA 3DDHA 1SU4A 3KOOA 2B0CA 1Z88A 1XP5A 2YMPA 2NO5A 5ALZA 1S2OA 2HX1A 3WK5A 2AMYA 3R09A 2GFHA 3J7TA 3FZQA 3MC1A 5AKLA 5ALRA 4HGQA 3QX7A 3OCYA 5FP0A 2EATA 3L7YA 2WF9A 2BDEA 5ALKA 3KZXA 4Y2JA 2G08A 4L6CA 5ALPA 5AKIA 2ZBFA 3E81A 5AKGA 2R8XA 3NAMA 4XE5A 3E8MA 1T5SA 3M1YA 2MSNA 1MH9A 4Y2RA 1U02A 1Z4OA 2G06A 5IS2A 1Z5UA 2C88A 2R8EA 3AR3A 2ZBGA 2HI0A 4IG4A 5AW2A 4Y2TA 5AM0A 2FDRA 1L7NA 2G0AA 4KNVA 3SF0A 5AM4A 4EELA 2B82A 3SMVA 1RPZA 2GHQA 4UM7A 3EF1A 1Z5GA 3WKCA 3SLRA 4UW9A 2B8EA 2WF7A 3ONNA 2YMMA 2HF7A 3ZVMA 4HGRA 5ALFA 4XQ0A 3ZX5A 1ZD2P 2FUCA 1VJ5A 3E84A 3ED5A 2ODAA 1Y8AA 5AKKA 3TLMA 2FPRA 5AI5A 1XVIA 3AR9A 5IT0A 1WPGA 3PCTA 3RFUA 2OYCA 3OCUA 4FFDA 4EEKA 2JAOA 4KNWA 3HYCA 3AR2A 3NASA 1JUDA 2DQSA 3AR4A 1VJRA 4FYPA 3QU5A 3VAYA 5ALGA 1KYTA 3L8HA 2W43A 4YH1A 1QQ5A 1RKUA 1ZRMA 1T5TA 1ZJJA 5AVUA 4OHFA 2NO4A 3L0CA 2IYEA 5ALUA 2QLTA 3QUBA 4F71A 1TJ3A 3NIWA 4UMEA 2C8KA 5AI6A 4NAVA 5ALEA 2FPWA 2ZBDA 3MMZA 4B6JA 3PGVA 5AM1A 2HO4A 5AKYA 2X4DA 3ET4A 3FGOA 2MU2A 2FEAA 3L8FA 1RMTA 1Q91A 3U19A 3R4CA 3L5KA 4UAVA 5AVYA 4IFTA 4J03A 1U7OA 3ESQA 3NRJA 5AKXA 1T9ZA 2P9JA 3I76A 4GXTA 5AW9A 5ALQA 2HSZA 2RARA 2P11A 1ZS9A 2PR7A 3DV9A 1K1EA 2QYHA 3U13A 4BX2A 1WVIA 3NUQA 2JAWA 3KC2A 2YJ4A 3QLEA 4QQFA 2WHEA 4BEVA 1RC8A 1AQ6A 1O03A 3A1DA 4Y2XA 2WM8A 1RQNA 3N07A 2OM6A 4KX3A 3IB6A 2BY4A 4NWIA 2WF5A 1CQZA 4G9BA 5AVSA 2YFYA 1Z4KA 2I7DA 5AVRA 1YMQA 5AI0A 3U26A 2BDUA 2FPUA 3WKBA 3L8EA 3L0BA 2FUEA 1Z4NA 1Z4QA 3D6JA 2O9JA 3A1EA 5AKHA 3DAOA 4DFDA 4BX0A 2P69A 2YJ3A 4CE6A 2FI1A 5ALYA 4BX3A 1X42A 3OCVA 5JJBA 4CNQA 5AW4A 3UMCA 1CR6A 3QYPA 4I9FA 2JARA 5AK3A 1SWWA 4OCZA 4UATA 3KD3A 5AKJA 4Y2UA 2EAUA 3ESRA 5AVVA 2YMQA 5AW5A 1RLMA 3L0YA 1Z4LA 1J8DA 2YY6A 5AM3A 1LVHA 2P27A 3EPRA 4BYGA 4YCLA 5AW0A 1RMQA 4Y2VA 4BNDB 5AESA 3FM9A 1Z4IA 3F9RA 1RLOA 3BA6A 3ZVLA 4EZEA 4CF4A 3FVVA 2R8ZA 4F72A 2YMLA 5ALMA 2G09A 2ZBEA 4NV0A 2GMWA 1YDFA 3WK7A 3ET5A 5IT4A 1ZOLA 2HCFA 4KX5A 4L57A 3UMGA 4UU1A 3FPSA 4O8CA 5ALIA 3ZU6A 2ZXEA 3SKYA 2O2XA 3WK9A 5AW7A 4UAUA 2CN1A 4I9GA 2RB5A 4UM5A 1QH9A 5ALSA 4PNHA 4J2TA 3K1ZA 3WK8A 1TJ4A 2GO7A 4C4SA 3NANA 2FPSA 4CF3A 5AM2A 3CNHA 5ALNA 2WFAA 5AHXA 3PGLA 1ZRNA 4EX7A 3ZX4A 3W5DA 2ZOSA 1WZCA 2Q4TA 4DWOA 2JGAA 1S8OA 4BEWA 4YIHA 1ZD5A 1PW5A 2RAVA 4XOUA 4BKMA 1YS9A 3KDPA 3MN1A 1Q92A 2HHLA 3CZ4A 3QUCA 2CFTA 1NNLA 1L8LA 4H1WA 4HGNA 1QQ6A 3WK4A 2G80A 3I1YA 2VKQA 3N5KA 1L8OA 2IOFA 2JAUA
chains in the Genus database with same CATH superfamily
1RWQA 1H22A 1OV6A 2B2XA 3OKPA 3SYLA 1CY7A 4I08A 1K8XB 4XXHA 2DY0A 4BWYA 4W9RA 2EEZA 3T5BA 1KIAA 1K0UA 3D7MA 1Z06A 3PIDA 4HBGA 1Z39A 3PWZA 4X85A 1Z28A 4J29A 2IYSA 4PCVA 2AUMA 4BLWA 1XHEA 2QMZA 4YIKA 5KTSA 4Q1VA 4YMLA 1L7QA 3L1HA 3VA7A 5IAAA 5J0RA 2Y0EA 2HNKA 2ZE6A 2NPIA 2XRMA 3VNVA 4LF8B 3IMGA 3E3LA 5AVTA 1R0CA 4KE8A 2PSDA 3IQDB 3KYDB 1HUOA 3AY7A 5B7PA 1WPRA 2WZQA 3N2YA 3KUXA 3Q1KA 3OICA 3BRWD 2REBA 3U7JA 2OY0A 1UOEA 2H51A 5LB2A 4J9SA 2DUMA 3W5BA 2P1DA 1ZM4A 2O2GA 4RH0A 1LV8A 1YNSA 1C0LA 4OM7A 1UXIA 5HGXA 4H7DA 5BSUA 1KEWA 2SICE 4YK7A 4B9NA 9ICNA 3OJLA 4CRWB 5IMBA 4AY3A 3I6MA 2PMEA 1JSZA 1SQ0A 1J90A 1ENYA 3TW0A 1W0JD 1ACLA 4KYTA 4F3YA 2LP4Y 2HKIA 4G3XA 4IF4A 3L0DA 3Q8SB 4LJAA 2BCVA 1F12A 3V2IA 3CMMA 1XTBA 4NCKA 3TNJA 4N9WA 3SEAA 3P97A 1HMPA 2XB4A 4LVNA 4I2JA 4JLJA 1RWWA 3HBJA 4MWBA 3SJBA 3R20A 3TTTA 4U7TB 2O7QA 3VR2D 4QFBA 2P9GA 4ME6A 2G1JA 2OE2A 1TTPB 5EKUA 4X20A 3OPNA 3D6VA 2KV2A 3WNQA 3F1KA 2Y4OA 4KLQA 4ZD6A 3GGSA 2EBHX 4P7KA 4DB4A 1XVIA 4IOLA 1ZISA 5LM3A 1JGTA 2RI1A 3LPAA 1DLJA 3FXAA 3NASA 1E8NA 1FMLA 1SV0A 2P2ZA 1ZXBA 3AXTA 2D4AA 5BR4A 5JBQA 2X3YA 4JI7B 1DAIA 2D8AA 5AVUA 3T5TA 3SS7X 1VL5A 3GLHE 3GLGA 3H4BA 3ORSA 3FLMA 1QQBA 1XDWA 1U3CA 3OOEA 4FDTA 3OFJA 2I03A 2ZR7A 1QCZA 4BNIA 2GM5A 1KJJA 4QNNA 1P2SA 2B69A 3A4VA 2EDAA 3TCXB 2R18A 4E31A 3N39C 3WB1A 7ABPA 3H1FA 3GNLA 4YP3A 3EZGA 3GBPA 3LBIA 1A9TA 3VGPA 2CPRA 1VXRA 1NQWA 2DBQA 2KBEA 3HDQA 1DE0A 2Q0HA 4MW5A 2QR5A 4EUEA 1Z7YA 1PN3A 3O9MA 2CZCA 2JKVA 4B0PA 3LX5A 4FKMA 3G85A 4HAOA 4MVJG 4IJQA 3V8VA 1GFZA 1DWQA 1FE8A 5LJLA 5AM3A 1SHZA 3ID6C 4HDSB 3KXIA 5I4CA 4NXNB 2BDPA 5FL7A 3B2EA 4PQFA 3TE7A 4MEAA 4H7PA 2NUAA 4P53A 3GN2A 2IIQA 4RH3A 3PFBA 4YLEA 1GYQA 4KWIA 4NIMA 1Z33A 2PBZA 1E69A 3TO5A 3TQOA 1M2VA 4OMFG 3SFZA 1X9MA 5K3SA 1TZMA 2WFAA 4R63A 5KFIA 2ZOSA 1ZKMA 3D9QX 1PLJA 1SK9A 2VKTA 3DJYA 4O25A 4L28A 3CS3A 2BWJA 2G77B 3HACA 3I4FA 3N0TA 3QZUA 3I23A 1ZK2A 1ZBQA 1XD2B 4K7JA 1Z63A 1GNSA 2HOQA 1U4NA 3MMNA 4UVDA 2I2WA 2QPAA 4FXPA 1Z75A 1NV8A 3LUGA 5I8PA 3L07A 1DZ3A 4EFKA 2Y68A 3FPJA 4AY6A 1CHDA 1ZD4A 4WECA 4DEYA 2ZAYA 1AQNA 1E5QA 1HYEA 1N8NA 4JJ4A 3IN5A 1GUYA 4GDFA 5JADA 3Q88A 3B12A 1SOMA 3ZW8A 5L3SA 2WT4A 4KDEA 4I46A 3FIUA 4LVSA 3ROEA 5KX5B 3U5TA 3EFOB 2D5LA 2GCPA 4Q9KA 1R15A 2VT6A 4EYEA 3GARA 4D4LA 1IK4A 1U7TA 2VCHA 1KK0A 3WBKA 2H17A 3FNRA 4PANA 3WGUA 5C34B 3JXEA 3NHRA 4P83A 1YR2A 2QF7A 1YVUA 2PJRA 3T9FA 1WXIA 4A73A 1NJZA 3JVEA 3WL7A 3TG2A 1V1JA 3SOPA 2XTAA 5COQA 2D1YA 4QHSA 2AZDA 1RWPA 4WGFA 2KN7A 1A50B 3X1MA 4RMNA 4M9ZA 3RROA 3U09A 2ZUFA 2CLFB 1N62A 4MS1A 3VI4B 4LCBA 1RQXA 2FRVA 2BJWA 5CCXA 1KZ7B 4RS4A 4D43A 1T8YA 3R0XA 2FZEA 3EUAA 1JLMA 4ZVTA 1XTPA 4BLPA 1Y80A 4F5RA 3GG9A 4R2JA 3ADPA 3MAJA 3EWNA 4MPJA 4OFBA 2R79A 4WY2A 2H2AA 1VZ2A 2DBYA 2C2EA 4P4NA 1GNRA 3LTEA 2R1TA 1COWD 1Y8RB 4RD6A 3LM8A 3BB4A 3HJAA 3RAGA 5B37A 4QTTB 5CU7A 3CLKA 5JU6A 2WV9A 5JVDB 4F93B 2O2HA 3C3XA 3SFVA 2LUOA 2D1RA 1GTMA 2ZRKA 2GRJA 4IWYA 1EIZA 4ECTA 1PZNA 3VPAA 2VPXA 3KFVA 4G5GA 1ZEMA 2ONZA 3A2MA 3W9UA 3BDIA 3NWPA 3PUKA 3V8PA 2BEJA 3TLGA 4F8RA 4EHAA 3PL1A 3B0XA 4W1QA 2K8AA 1IJBA 4Z4QA 5KT4A 4V38A 2NSYA 1BE1A 3EF3A 5ALUA 1ZM9A 2C9ZA 1U6KA 5AI6A 1IH8A 3GGCA 1OAAA 1VTKA 3U31A 1EHYA 2BCEA 5JNRA 5IM5A 3DZKA 3UT5B 2Q3HA 4EW1A 1OFUA 4PR0A 2YCBA 2Y1XA 3D2NA 4ZVKA 5M7EA 3PXXA 2OV8A 2SKCA 2KHZA 3EMVA 4GR9A 1LC3A 4LNUA 3QENA 5DM2A 3AESA 1AV6A 4UAYA 2GZHA 3VO2A 4RM2A 3TK1A 3T5AA 1WV0A 5DB7A 3UA4A 3UJDA 2RIPA 3MWYW 4OK6A 1XA3A 3ORRA 7YASA 4LBWA 1D6MA 4B73A 5EP3A 3IHTA 1VKNA 4I9HA 3NP9A 2KKPA 4GPEA 4F72A 5JMTA 1BYUA 1VL8A 5EWLA 1SRQA 1SVOA 2Q2NA 3ILYA 5JC1A 2NYRA 1KWGA 2ZDGA 3O8QA 1QIHA 5JFOA 5DCYA 3OD1A 2H2IA 1E2DA 3K1JA 2YASA 4DQXA 4FLMA 3R9XA 1FW8A 1WDTA 3G0IA 3HPOA 1KYQA 2RBEA 4R0MA 1EZ1A 2VQ6A 3WX0A 4MULA 1KS2A 1Q92A 3LG2A 5HILA 2IS2A 4HGNA 5KVQA 1O97D 2B8TA 1GL6A 4OBXA 1JBKA 3EMDA 1ZQKA 1PZHA 5AUOB 3W3ZB 1EX1A 1K5HA 4ZQCB 3UC5A 3UUFA 3L82B 1O89A 1ADCA 4WN9B 2I2CA 3AR8A 3K7EA 1SCNE 2JV3A 3HKDB 2FVXA 4U5QA 3PDWA 2PTHA 1V2HE 1HNWB 3CB2A 4QW9A 1PZXA 3HUFA 3LUAA 8ICHA 4XSGA 5ARBA 3RV3A 5CXQA 1ESNA 1M1YE 3DZ8A 3IRUA 2B4QA 4K6GA 1U7HA 1CZUA 1PQPA 5HUHA 4FIZA 1NULA 2C1XA 4EKNB 1QHHA 3T99A 4UB5A 5TJ9A 3HCWA 4ARIA 3YASA 2WLSA 2WU0A 3G8BA 2WNSA 3DAGA 3THYA 5TC4A 3AX6A 3UC9A 4RT2A 2D2FA 4JI5B 3HCFA 1GSIA 2GH1A 4OD0A 4F5DA 5IC4A 1WCLA 3H13A 1R88A 1HEUA 2Q27A 3HB7A 4WNYA 1GRQA 3N8DA 4A10A 2FVYA 2F4NA 1CIJA 3PC2A 3RBZA 2W6JA 3CH5A 2XMDA 1WYGA 2CMHA 2VQ3A 1NI5A 5MDHA 5CIWA 1UZMA 3OJXA 4KWTA 4V0LA 8ICNA 7ICPA 2ZIUB 3K0FB 2PXHA 3AOGA 3UM9A 1SQ6A 4FQ5A 3MA0A 4Q3KA 4DN6A 2M0NA 2CXYA 5JQWA 1YCGA 2MOKA 2W48A 2IEDA 5BWMA 3I52A 1S3FA 3JQAB 3KOYA 3AKDA 2PQ2A 1RFLA 5K8LA 1CZNA 1DIAA 2DT5A 4KBGA 3FOZA 3GA7A 2VZ0A 3ZCSA 2WFLB 2HLDA 4YRFA 2ZGVA 4P4SA 4RM3A 1R37A 3DFFA 3L6EA 5CG2A 2DF8A 5CB6A 4K0RA 4URFA 4Y6OA 2JRCA 3DDSA 3OEWA 1I3LA 1R0SA 4L9AA 4F6CA 1KHHA 2HJSA 1BKSB 1Z1VA 3TXXA 4DCVA 2YXLA 4EELA 2DC1A 3VX4A 4F2DA 3WICA 2WTBA 5CJ2A 4IMPA 4C4YA 3FSGA 5IT9A 3H11A 3GOHA 3OTWA 2WIKA 2B7BA 4L2IA 4TTAA 4EIWA 1PK1A 2FG7C 1A82A 4MQFB 3AONB 2F62A 4QFCA 1ZJYA 2B2CA 4HDNB 3IR6A 5LDHA 2RJ3A 1ZL0A 2ODEA 2D62A 1VE3A 2G7ZA 4FFBB 3FFTA 1QC5A 5KX5F 1U99A 3QMMA 1Q5PA 1Q0HA 4LISA 5AKYA 3A6KA 3L8CA 4KZKA 2WTXA 3S8YA 1E0SA 5KJCA 5AW9A 3HMQA 4E22A 3NHMA 3EQ6A 3NUQA 3EQ9A 3ZU2A 2JJ2D 3CLTC 4ZOCA 2JPDA 1GUAA 2IGTA 3VOTA 3OZAA 3DF7A 1EEXB 1IMJA 3IO5A 3U7IA 2ZRPA 1PR2A 2N0SA 4O4HA 2FSGA 3FTEA 4US9A 2YQ5A 1IBLB 2OHOA 1MJNA 5E95A 4O5OA 3LD9A 3DR5A 4FBLA 1ZI8A 5CNIA 5KTNA 3SXUB 3EMBA 4DQSA 5AW0A 1QE0A 2JGKA 1KBZA 4D9EA 1Y37A 4YMMA 1YA8A 1ZD9A 1RM6C 2BGNA 3RVNA 4MYHA 4RQ3A 1VMIA 5I01A 2AN5A 4XW2A 4EA7A 3WNVA 3QH4A 4MQEB 5J2TA 1Q0PA 4H7IA 4NZ9A 2KOBA 4PZDA 1FFVA 1DUSA 4HCJA 3DO5A 4JMUA 4PYKA 1DX6A 1OXSC 5JVDF 3CZ4A 1JN3A 2O2DA 4AURA 2FRXA 1YUBA 3Q10A 3PTAA 3WK4A 3MWEB 4HDMA 3HT3A 1WDMA 1ZN8A 1BN6A 3KLNA 1MX9A 4U2CA 1F0MA 1NVKA 2EF1A 1K7XB 4UXHA 2HDWA 2QKQA 4DL5A 2BSXA 5BSGA 4XA5A 4H7EA 3PEEA 1B1CA 1PV2A 2QLNA 2FZKA 2Z08A 3EGEA 4K40A 3QJGA 1KZ6A 3R8CA 8MHTA 5DP2A 4EF6A 4NCXA 4RBNA 2AN3A 1NXVA 2BHSA 1K4YA 1OU4A 2FEMA 3PVZA 1TVKA 4GWLA 3SQOA 4RESA 3S8EA 1LSSA 5JCOA 4E6PA 4HWKA 2HY7A 1WO8A 5T4FA 5C7OO 3BT7A 4COOA 3BFVA 1P0IA 5EY5B 3RC8A 1I3CA 3IV6A 4LQCA 2JLRA 3GMSA 4L5JA 4BLQA 2O8BA 4AW9A 2O0KA 2R8OA 1VIAA 9ICUA 4CHGA 1CP2A 3TZKA 4B3MB 1KQ3A 2PGJA 3JZIA 4NU6A 2WOJA 4MPDA 2WTMA 1QX4A 3M6WA 2FTKE 5NULA 4KN6A 1DAKA 3M8RA 4FHGA 2GHTA 3LBAA 5HCIA 1O94C 1KMIY 1ILWA 2ZT6A 3ICPA 1D8LA 2OAP1 3ONVA 5L3ZA 4MA4A 1G9XA 2OV1A 4WKBA 4BRWA 3AU6A 1BH2A 1B0ZA 1C30A 3GLUA 5CVVA 5H02A 5TPWB 4UQLA 5ER9A 5LQDA 5JU5A 5KT2A 3A6ZA 1YKGA 1FIQA 2PMWB 4JASB 4CMJA 5HPYB 2QTVA 5TDHA 2HQSA 2DUNA 4NATA 3NLLA 1JP7A 1OA0A 1X7ZB 4LXGA 1PD0A 4TZTA 1P1FA 1QF7A 1TTHA 1YI1A 2KJQA 4GICA 5SZIA 1HL7A 4YC7A 3WQBA 3ZVNA 1AKTA 3J81j 2WWVD 4R1LA 3IOBA 1QSGA 1TIKA 4RQ4A 1UMBA 2J6UA 1VG9B 4GLXA 1Y1QA 3DKVA 4GOND 7ICFA 3DQPA 3KZXA 1ZK0A 2EX4A 3RVMA 4E33A 3E4DA 4JLNA 9ICOA 3K94A 5AW2A 1IB0A 2QM7A 1LI4A 1N33B 2LXNA 2CK3A 3UV7A 2KZZA 1B42A 4PIPA 3OHMA 4OXRA 2C2MA 3CUVA 4UKDA 4INZA 2VDNB 4FS1A 3EZXA 2I2XB 2UVWA 3H6GA 5B3JA 2IYNA 4BLUA 2Q2WA 2X9NA 2IXEA 4DUZB 4LXUA 1E9CA 3LRXA 3PGA1 5I7UA 3ITKA 1NUQA 4FHFA 3R7FA 4GX0A 2ZAGA 2XBUA 3DBLB 2DWUA 3LQ4A 5GJVC 2ZZMA 4OJOA 1KO1A 3EC2A 1E1KA 3T1NA 2XECA 3ESXA 2GD1O 3O2SB 1QH8B 4RXMA 3KO8A 3B6MA 1IXZA 2WWIA 1PE0A 5JJLA 3PS9A 4BNUA 4X9XA 4MR8B 2G28A 3X1DA 1EX9A 2WIJA 3ND6A 3NYRA 3OU2A 3RRNA 4QUGA 5FA8A 1L1QA 1OHHA 3C97A 4KDFA 3A4IA 2ZB4A 2QRNA 1UH5A 1Z45A 2QDKA 5KC8A 4ZO7A 3D6JA 2GM9A 4BJQA 2I71A 4DLUA 3TDNA 3QYPA 2H4XA 1F44A 3FD8A 3C3KA 3ETDA 4U2FA 3BYZA 4JBHA 5FEMA 3MLEA 2JH8A 2W8LA 4Z53A 3KT6A 4OOEA 1M0WA 3R9IA 1SIOA 2EWVA 5KAMA 3TPFA 2PFPA 4QWBA 1LTHR 5JTTA 3SKYA 3T3IA 3K92A 5KDLA 4IO1A 4EA8A 1W0CA 4YD2A 2DKZA 1QYRA 5L40A 2F76X 4FFWA 1AIPA 1DXHA 4FZVA 4JLBA 1YBFA 3NANA 2I4RA 4W8GA 5IJXA 2K8BB 1NPTO 1GN8A 2OD9A 3GJ5A 4RZSA 2UZ1B 4BV9A 5DH9A 3GO4A 1KOJA 3PMLA 4PAOA 1RRFA 4CM3A 3BZUA 1HJPA 5K3EA 2IH2A 3GDGA 1L3TA 3IXMA 2RGEA 5K6RA 2NU7B 3ZHQA 4LKOA 5CNJA 3ZKAA 1UZAA 1GPKA 5KYTA 1ZEJA 3IQGX 2XY5A 4Z0TA 2WQ6A 4NONA 3I1FA 4FI3F 2I80A 1C3EA 5AUNB 3EBPA 3EISA 3VDQA 2PSJA 4Q01A 2H92A 4ZGGA 4ZQGA 3JQFC 3FLBA 1NVVQ 2XCPA 1MRZA 2AN9A 1B1AA 2QXYA 3ZNOA 3SIXA 2GTIA 3UGTA 4WACA 3LUFA 1ZKDA 4IQFA 2OGUA 3ZGLA 8ABPA 1F7UA 3ZQUA 4ZOLB 4E5DA 4WLVA 4YVZA 2JRZA 1GAEO 2PKQP 2VJ4A 2N3ZA 4NCHA 2P3LA 4O2BB 2WJ4A 1QIKA 4IIXA 2ZRQA 2NYVA 4QPCA 1H1LB 4QIWF 4G67A 1SWVA 5BVHB 2V7PA 3AEXA 4S1OA 4EG0A 4JI4B 2SCUB 2PEZA 4ALMA 2J4CA 3SVLA 4EO9A 3K0BA 1PNRA 1EX6A 3M6UA 4PNEA 2PX5A 4RVGA 5BQXA 4CEHA 2HTEA 2QX4A 3UFXB 4UU0A 4I5IA 2W5UA 3LOUA 2KLHA 2CJPA 1L1EA 2AGOA 5J1SB 3C1TA 7ICNA 4IHQA 4YPOA 1VIMA 3BQMB 3QXGA 1XZ8A 4XUDA 2QU7A 2COKA 4Z7QB 2KHVA 4D3ZA 2C4UA 1G1AA 1G4UR 5KDOA 4Q1BA 5CJ7A 3DAHA 4MW0A 3PYXA 4YNBA 1WXWA 1NRXA 3FZNA 4RELA 1YT3A 5KB3A 4M83A 1DKUA 2AMLA 3BK1A 1E99A 1XL1A 3LDFA 1W87A 5F64A 2VOJA 5EIHA 1X19A 1TU4A 3LY8A 3ADBA 3ZS8A 5AKGA 2R8XA 5D84A 4FWTA 1GM5A 2C88A 2OV2A 2H9IA 4YROA 3B5EA 3L4SO 1FMFA 2QTHA 1JVSA 3FOFC 1C41A 4WZ6A 3NHPA 2YWHA 3MCTA 1YQDA 1CUAA 5KVAA 3CINA 3FWKA 4R1SA 5LXTA 1RC0A 2DGDA 1BTOA 3E22A 5F51A 4INJA 4DXDA 1N5DA 2J48A 4CM5A 3W79A 3V5NA 1JQ5A 4XGKA 3MABA 1L1FA 2KTQA 4K2AA 2MAXA 1KAGA 4MHSA 1QJ4A 2Z6QA 1B14A 2GLEA 1MC5A 1TCUA 3U19A 1YZ6A 2BTEA 2A78A 3T7SA 1GP2A 4LSWA 3QFTA 3EQ7A 2Q0QA 3TLZA 4TXHA 4BEVA 5J0OA 2VJBA 4DCNA 5LMZA 3UBTA 2GPYA 3GLHB 1YMQA 2O2YA 3EDCA 4R40A 3ANXA 5JWOA 1NOJA 3S27A 1ZNZA 4AZSA 4UE2A 4ZYVA 3S3TA 5AOAA 1TEHA 2YXNA 3GC6A 1TCVA 1G6OA 1ZOPA 1DBWA 5L3QB 1TXGA 1V1MB 1S3GA 5J8YC 2O1SA 1PR9A 4N47A 1UPHA 1A3CA 1E9SA 1HDGO 3TLXA 1UEJA 4B4OA 3T5GA 2I2DA 1RMQA 1Q3UA 7REQA 1ZJMA 3AQFA 1JQBA 3QF4A 4HZIA 5C0YA 3LDGA 5BRNA 2GLUA 1PP4A 2VF2A 4E09A 3EOBI 4OO1J 1O6ZA 5G40A 2IY8A 3V42A 3O8RA 2WWTA 2HU8A 2WMNB 5GIPE 1EDEA 3AV3A 3CRMA 3H2HA 4PNHA 2BFFA 4F4FA 4IDPA 1ZNXA 1D7OA 3KV3O 4QJ4A 1X0VA 1H8HA 3T7IA 1ZRNA 1M1NB 3IEXA 3BMCA 5T3YA 4C0BA 5G2OA 4OHWA 1AKEA 2B34A 2Y4NA 3LS2A 4GFDA 5L8VA 5E7IA 1XCJA 4GKVA 1CF2O 2I6GA 5A71A 1O0CA 2FN7A 2V4ZA 2AL7A 3DPUA 4MV0A 1XYVA 1DI0A 3MR2A 4DUGA 1A71A 2A9OA 1OGJA 1C3OA 4CLRA 4Z54A 5FWYB 4TSRA 5B58T 2YV3A 2XF2A 4N8SA 8ICUA 4OJYA 2GYWA 1J1ZA 1P61B 3OZWA 1CJCA 3OEEA 4DA6A 1OWOA 1YAHA 3TD9A 4QJBA 1U7PA 2L18A 4AZ3B 1M2EA 3WZ2A 1TJ5A 3PWKA 4D74A 3QVLA 5HTKA 3OZUA 4ENSA 2VDWB 2A1TR 4KB5A 3UW1A 4MGZR 5F5XA 3E2PA 1EJBA 3P2OA 3ENNA 4A1OA 2ENWA 4EOGA 1IVYA 4AS3A 1AXGA 2QM3A 1MC1A 1LEHA 2I6TA 5K8CA 3NM4A 2UUOA 4FU0A 3OFKA 3IP3A 4E1BA 2XZOA 2NUPB 1PEYA 2JA2A 2C7OA 4BJHB 3E53A 4GNRA 1TQ8A 5F3XB 3AEYA 1JR3E 2GZMA 2PX8A 2Q45A 4FP9A 4EARA 1N8KA 1RYMA 1HKHA 2RB4A 3AKCA 1AQYA 5SY6A 2VJMA 1VJ0A 4AZ0A 1NMXA 2PGIA 2XQGA 4EHDA 2J5RA 3BIXA 5HSGA 1IUKA 2AH5A 4F6RB 1W9MA 1GQRA 4DMFA 4AJJA 5KOJB 1KU0A 3PI6A 2RIRA 4G8CA 3HBMA 3BWMA 3QA3E 3ZYZA 2IH5A 2GF2A 4EY5A 1P81A 5KINB 3O26A 2HCTA 3AEKB 2ZI9A 1QG0A 3AG6A 3FDFA 3C41J 5BQFA 3JRWA 1U7UA 1M1UA 3VYVA 2Y67A 1W0KA 3J7TA 2XGQA 3KCQA 5ARCA 5A4MS 5JH7B 4EVQA 2FRDC 1WB9A 3UKOA 4IXNA 3CZPA 1QIJA 4EJSC 3TEMA 3QFRA 4IG4A 3VRHA 1E2MA 4DQLA 3L4PA 3LFUA 1J8QA 1X6VA 5IDVA 2OHFA 1FUUA 4FB5A 4L5YA 2L17A 5ECDA 1XAIA 2XCRB 3ZX5A 2AXQA 4W82A 2WHQA 2ENUA 3C43A 121PA 2Y1KA 1PJQA 4N6NA 4C3OB 2YZMA 3F9CA 4KJXA 4M0FA 4ESEA 5JRJA 3OLXA 4REQB 2X8AA 3R7LA 1L3BA 4ZOLF 1K5GA 4HB2A 1HDEA 4BO0A 3K0SA 2GJ9A 1LZLA 1K9VF 1RXWA 3QXCA 2X4DA 1BN7A 3L8FA 5HM8A 4O2BF 5FTKA 2H1HA 2ZSAA 1ND5A 1RW4A 2EOAA 1I7SB 1WUTA 4BUJA 2C98A 4KV7A 3T5PA 3JQGB 1O95A 5LQJA 3C5EA 4JXKA 3VH1A 4QO7A 2V9CA 1WHTB 3GVXA 2OB2A 2WK1A 3ZHSA 5ED4A 4IDBA 3LT2A 2JIBA 3ZE0B 3TLKA 1JJ7A 3TH5A 1XMIA 3B51X 3H19A 1CUKA 1E2NA 4MOWA 1ZJNA 3A0UA 1BFDA 2HPZA 4CM4B 2EDCA 2OQRA 5C31A 3U26A 2RGRA 1QFYA 5FA6A 4WA7A 3WLKX 1AHHA 4JXZA 4IVNA 1P9NA 1MNQA 1ZQMA 2PEYA 1C7EA 1NGSA 2RGWA 2I9KA 4JAVC 3FUTA 4LE1A 2P75A 1BDHA 4JFRA 1EFPB 2DKNA 5DX0A 4J91A 1THGA 2FPMA 4GQBA 3RJTA 3SI7A 2F8SA 5JRZA 4UFOA 3ZIDA 3DTYA 3O1HB 1L5UA 1XELA 2XUGA 2F44A 1UPBA 4MR7A 1QK3A 4Y9RA 2IA6A 2VHUA 4X6XA 2WJ6A 5JNUA 3AUJB 1UC8A 3R2JA 3BCHA 3AUTA 4BFYA 1RQ2A 1M2KA 5IAJA 5BQ5A 1Z35A 4JI2B 2JBHA 4AZVA 2K7FA 4N7MA 1ZUIA 2W6PA 3FDJA 2M9NA 3EPPA 3DFZA 2WTEA 2C9CA 1RZRA 3KHHA 3PC4A 4AKHA 4KAJA 1WDKA 1ZQRA 2W2KB 5IG2A 2V6BA 1XSLA 1MJGM 3GDXA 3HVHA 1THTA 4GBMA 3B5IA 4LHZA 4F8JA 3QPBA 4RJJA 1MT3A 1N0IA 3KKAA 3CNBA 4BN5A 2ZWMA 5K8TA 5AR1A 4HQNA 1JG2A 3E9MA 3MVEA 1XKLA 2R85A 1UJNA 1K3TA 2H85A 3BAFA 4I2EA 4L02A 2BN4A 2VA9A 4W5OA 3SEZA 1A4IA 2B4RO 4FMDB 2REQB 1LJUA 4Q4HA 3AGQA 2RGNA 4JH0A 3P4UA 2H2FA 3BC1A 4OLJA 3RK0A 1G8GA 1E3MA 5ALLA 5AVWA 4GT1A 1ICEA 4RUCA 3M1IA 3TD6A 3F5QA 2BCGY 1F9AA 2JZNA 4MF8A 2GZ1A 4F5YA 1M1YB 1B8UA 4DM7A 3G7NA 5I47A 1I6MA 3EGWA 4EUHA 3MELA 5EIWA 1A1SA 1W49A 4X92A 2DBVO 4D9GA 3ZS9A 1NDUA 5J59A 1FX1A 1GG5A 1C0IA 2QRHA 4HR7A 4U5XA 4OV6B 3D6MA 5KI6A 4QBGB 4LMRA 4IDAA 3R44A 1I1OA 4M89A 1ZCAA 4JP1A 4B2PA 3S28A 2WTNA 3AUYA 4F0JA 4EYIB 3IMFA 3CYMA 4MRMA 1PR4A 2AQ4A 2Q8PA 4IUBS 4WNAB 4QSHA 3W6UA 2SECE 3MT9A 3PLAE 1IWBB 1IEWA 5FOWA 3UJAA 1GTZA 1K0FA 2Q4DA 2HJHA 2XIQA 1Z88A 3KOUA 2WDZA 3ZVKA 2NO5A 2R62A 1KC1A 2O0HA 3V2UA 2WPDA 5F4BA 4QJFB 3I61A 5J1TB 2XVTA 4KODA 3P0FA 3DEJA 4ZZ2A 5LZ8A 1YJBA 3C45A 1FK8A 3T5DA 2W00A 5COAA 4Z9BA 2JATA 3D3NA 3F6EX 1EX7A 4M1SA 1A2KC 4Q19A 5HKKA 1OI3A 3KJEA 1C1YA 2Q21A 4CCYB 3U61B 4IYJA 4E5YA 2YTUA 1W30A 4XVQA 3CXRA 3FDZA 3GRFA 4TKUA 3EGVA 1GNPA 5FBRB 4Y9UA 1QDEA 3C5FA 2WYOA 1BPYA 2OQIA 3R3VA 4YAGA 3EBLA 5K6AA 4MQLA 3MINB 2VH2A 1Q1NA 2YWXA 1X7YA 4OHKA 2RCNA 2RG1A 2BCSA 4UAVA 1G64A 1ZNYA 3TOVA 4NCNA 4QM6A 3S68A 4JI3B 1KYWA 4KFUA 2MMCA 5E0KB 2NSDA 1MQ8B 2BH9A 3L6RA 5EIOA 4IIGA 3VFDA 3BWYA 4GWKA 3O8DA 2R1VA 2DFVA 3RF9A 1JDVA 2XKKA 5E4TA 2BDUA 4C4XA 2E48A 2PX6A 1E6UA 2NADA 1XTQA 1N7GA 3M5PA 5AKJA 1KYIA 1W4RA 2HMTA 3L0YA 5JAPA 2XWSA 1EFAA 2FE4A 1K7CA 1P31A 3BJEA 4IO0A 2R8ZA 4Q4LA 4WESA 2VIXA 3VR1A 1OLXA 3UMGA 1YONA 1WKVA 3QYJA 3ZU6A 4PSAA 2AQKA 3JAWA 4YHBA 2PLWA 5ALSA 1BWRA 4PSUA 3NT2A 2KHQA 1FS4A 4NY8A 4MO2A 5L3RA 2K4IA 3FUUA 4OQEA 5ALNA 5JH7F 4JOCA 2H3FA 4Z4GA 2KNJA 1KPHA 4J90A 4BLOA 3L92A 2E18A 2L0XA 1QLWA 1AROP 3REGA 2HBLA 2XHZA 4G23A 3UWKA 3A1VA 2FP4A 2Y27A 4Z8YA 1R27A 1RRCA 1GAXA 1P75A 2H18A 5DM60 4LDJA 6GPBA 4BY9E 1IDOA 2V4RA 3H5IA 3RE1A 1L8XA 4N40A 3G2QA 2IBSA 2DPYA 1RU3A 1NASA 4LOIA 1RPAA 1K3FA 1JDUA 4PSVA 1ADYA 3FY4A 4JB2A 5CDFE 4OA8A 2RHJA 4EQ6A 1NNI1 5BVGA 4JEUA 1PL8A 2AEEA 4G26A 5AK0A 5G1OA 1LQTA 5C0OE 4B9LA 5LDGA 1E9AA 2Q4RA 4RIGA 3W5SA 3IP1A 4UTPA 3RM3A 1ESMA 3QXHA 4G65A 2GWRA 3MRTA 3LI2A 1I6KA 1JAHA 1TAMA 2QL9A 4UBBA 1V6CA 2OKCA 4RV9A 2WHRA 1XB2A 5H0IA 3MT8A 3VC7A 3QU7A 3S81A 4ITRC 4JUIA 4YRRA 3KTAB 1Z07A 5EJGA 2B5VA 4JLUA 4GECA 2WSSD 3TJZA 2FZ4A 2GZAA 2HA5A 1ZM2A 3I28A 1U0TA 3MNFA 2Q4EA 5IDQA 1XO1A 3KQUA 1YI8A 1O5TA 1J0XO 1SNYA 2I1WA 4KLAA 3ZWBA 3MOIA 4GIBA 2E2WA 3LUKA 3Q2OA 5CT4A 4HH4A 4WBXC 1NYTA 1WM1A 4J0KA 1V7QA 4WCFC 5F1OA 1L3UA 4CM1A 1DC8A 3KSUA 4QYSA 1PDVA 1ZMBA 2WA1A 3SENA 5BYKA 4CIVA 4H35A 1W47A 4X00A 1PQWA 4P81A 4LQ4A 1CRPA 3N3BC 3R6TA 5K8UA 1NF9A 2RHBA 4O59O 2X2OA 3L77A 2B0CA 1FNMA 1UK9A 4M1YA 1F0YA 3WYAA 4X1IA 1QR6A 1L5ZA 3CUKA 2XZLA 5G4KB 3OCYA 3EA0A 2AW5A 2OHVA 1NAIA 1CJMA 3USZA 3T35A 4CMEA 1G3UA 3L0SA 2C7VA 4H27A 1V16A 1YWGO 3I73A 1FNCA 3NWOA 2G06A 1EZZA 1CUEA 4UAWA 1GUBA 1V47A 3MCUA 4F84A 1FLDA 4NOJA 1KDRA 1ETHA 1NXOA 1U04A 2PR2A 5G02A 2CXSA 5DGCA 4RVDA 1MX3A 3SKVA 4OJ5A 1ORRA 4GZLA 2O2JA 4TUYB 5DEIA 3H1PA 3S1AA 3ABOB 5EMJA 4QAQA 1LDMA 4UM8B 3ENVA 3IIJA 4FMDF 4X1KB 1DJPA 3L7KA 2QAIA 4D4IA 5KPDA 4FYHA 4Z1OA 1KK3A 2FMHA 4LY0A 4KLJA 1NR7A 1IXRA 4UAJA 3OFNA 4BE7B 2CJWA 4M47A 4O8ZA 4WVFA 4F4UA 4B9VA 1F2TB 4QWAA 1H2ZA 2W70A 5FF9A 2IY9A 1RS0A 3IIKA 2VUSA 3J81k 1IXYA 4MINA 3WJAA 2XLCA 4ALIA 2DLCX 3PC8C 2MCFA 2P11A 2GBIA 3RAPR 1ZQTA 3LYHA 1E2IA 1SQFA 1T5DX 3OJSA 3HO1A 3S55A 1HE4A 2NU6A 3KJHA 2DTDA 1RE1A 4FDVA 1RYFA 3WV5A 5HK8A 3DE6X 1UC4B 2YHBA 3N8KA 2ACEA 3PQDA 2AWNA 3GD5A 1TYDE 3EWSA 4WNCA 5EQJB 3LCVB 1SO8A 3AB8A 2G71A 1RPTA 3NDBB 2W4IA 3H3XA 4IUDS 1UC9A 1U2DC 4RJLA 2W90A 3B1JA 2QP3A 3AI1A 4NK4A 4G5OA 1MO5A 4IQGA 3HCRA 2NVOA 1UBLS 1RKXA 2W8KA 4GMXA 2J1LA 3WRVA 3KHRA 1N5WA 1UKCA 1WEKA 1LB1B 2Y92A 4QULA 3M34A 2YQEA 3WSVA 5BWNA 2QMQA 3RUHA 2QRLA 4J0GA 4USAA 4CM8A 1DUVG 3WB2A 2YC4C 4FS2A 1XCPA 1EFHA 4K6FA 2J0EA 2Q99A 4AD8A 3QEBZ 1J25A 621PA 1X70A 3CF6R 1UBUS 4CI9A 1MZPA 3L0IB 1C7QA 1DJNA 5AVJA 3NTRA 4OXQA 2HHWA 4ID3A 4AYBC 4PZOA 2F8LA 1N8SA 1PZGA 3TNDA 4DTCA 4RE5A 4WK4B 1UBRS 2GKOA 2I34A 2ISOA 2IT1A 3PNKA 3BE6A 5KT7A 1JG4A 4REOA 4LZZA 4CQJA 1JB9A 3BE8A 5BMVB 5JSKA 4WX2B 3NJ8A 1OUQA 3E9YA 3RC3A 3PFNA 2J4FA 3HFRA 3OT4A 1M1ZA 2G9NA 1H3NA 2A0UA 1N61A 4M0PA 4FD3A 3WGKA 3DPSA 1OZGA 3RFTA 4YRDA 3MDCA 1XRMA 1WXFA 1NSFA 4NM1A 2ZBVA 5C52B 3VCBA 2K6GA 2G1AA 3MB5A 5BV2P 2C96A 1DKNA 1TF5A 3AL0B 3OO0A 1Y4ZA 3KKMA 4JP5A 2UVRA 4MNTA 4NL9A 3BL6A 2I1LA 2IIBA 5HE9A 2YUTA 2IZ6A 2OCBA 2QG9A 1THZA 2JHCA 3WA6A 3ZWKA 2UYOA 1U2ZA 4DLSA 4LYHA 3SZGA 3IV9A 4DMGA 5BORA 3EGOA 3VH3A 3P9RA 2GBLC 2E4YA 1KJYA 3E6AA 2WJVA 4J16C 4C9BA 2BEUB 4KO8A 1NK6A 3O4FA 5C7YA 4B5LA 2Q6IA 3ANYB 4LCEA 2Z2JA 3CKMA 2V1UA 2EAMA 3D8TA 1ONOA 1DQRA 1U9YA 4G25A 3RABA 2QORA 3U3JA 5HRUA 2ZRMA 3STUA 2MUTA 1J7KA 4OEHA 1CQWA 3G2LA 1CS0B 2Q6KA 2D06A 4M9XA 4FN4A 4DVJA 1DSSG 2FP3A 4Q44A 3OE7A 1GILA 1AF4A 3TFSA 5CLJA 4IQ8A 3B7PA 2BW0A 1JPVA 2GSDA 3NBMA 1OT5A 2YWDA 1PX2A 2WWYA 3ZTTA 2FMXA 2ZB8A 2G9QA 3OHAA 2C7RA 1NI4B 4PR3A 1BPBA 1ZITA 2B82A 3U48A 3BEDA 4YTEA 4NZOA 1E32A 5KYWB 1A9RA 4DDTA 5K4AA 4FW9A 3CLUC 1KZHA 1NYRA 4CKZA 1V3QE 4FOOA 1BKDR 2FZWA 2XUIA 4L9WA 5CB1A 5BOLA 3WLMA 4A4DA 3HXTA 5E7QA 4UFPA 4CLHA 3HJRA 3H4DA 5EXSA 5EQTA 1NJYA 5ALGA 2H3VA 4B4DA 1QCYA 2W7PA 1ZJJA 5CAEA 1DO8A 5C8YA 2QN7A 4ZQEA 5IKMA 4AAYA 1WL8A 3D4LA 3DVSX 3EBOA 1Z5OA 1A76A 3M0EA 1OLSB 1U6IA 4DSFA 4MITA 4OKIA 4XDGA 3ZWPA 5B55A 1FDOA 4OY3A 5H2FU 1I8TA 1Z47A 4ZVVA 4Z4EA 3CIOA 4C7JA 3B3AA 4P0PA 1HLPA 3MHPA 3P7MA 5JAHA 1QH1B 4ND2A 4IKOA 1UZNA 1U0RA 2QT0A 1RYEA 3TVDA 4OAQA 5A5FA 2QRZA 4B6FA 3I8SA 3D1JA 2O9JA 4MP6A 5DGHA 3UMMA 3T79A 1MAWA 5G1NA 1CR6A 3GT4A 1S3IA 5C37A 4CL3A 5KFXA 3M7IA 5EN4A 2G0TA 5JZMA 3HKZF 5EJ4A 3IILA 1J2TA 4CG0A 2PXAA 4PIMA 5IANA 5DI9A 5B3JC 1M2OB 3AP3A 5ER6A 3GLRA 3QX8A 3OMWA 4KSBA 2DL0A 2XRFA 2NO1A 4R65A 3PFIA 1QRDA 1WCXA 1WSAA 5CGQB 3MN1A 3UFBA 3L3FX 1BW9A 4CMIB 2PV0A 5DF1A 1ILEA 1U5AA 4WXPA 5LOVB 2RSLA 1A8UA 2C03A 5AO9A 1B93A 2ZIWA 5ANRB 4RW0A 4C0XA 3N59A 2IX9A 1QGED 4NLNA 3F5AA 4E03A 4TUYF 3C6XA 4N5MA 1QG6A 3PC6A 2V7XA 2GS9A 3R3UA 4PLHA 1R6UA 1RWKA 2XNKA 4Q93A 3LOPA 3AYXB 3WGNA 3PW7A 4IH4A 3GP8A 2PMZF 5DB4A 2OBBA 3U4GA 2BPFA 4LJLA 2O8EA 4P54A 5GTIU 1JLRA 3PXGA 1ED1A 4YGYA 1EJ6A 1VIYA 4QBHA 2JFUA 1C4XA 3L9XA 2CFSA 3C5WP 2C42A 3ZI0A 3ZTYA 3DMTA 3WXBA 3DTTA 5CUQA 2W55A 1WP9A 3BM5A 3G0DA 4QZFA 2QTFA 3MUEA 1LW7A 4YRIA 4XQ9A 3TACB 3QVGA 4JGIA 1JEQB 2QL6A 3JQBA 3RRHA 4LRTB 3KJNA 5TVGA 1NP6A 2FKNA 3ANMA 5D01A 3B6EA 5CYGA 1BPEA 4ARVA 4KRXA 5EWMB 2XDWA 4QPNA 3EVEA 3M9NB 2QRUA 4XASA 4D9KA 2JVKA 1F8GA 3ER9A 4QNRA 4Q1FA 1JF8A 4IHJB 5FIUA 1NQUA 3HM2A 3AJ9A 4CLXA 2ZWVA 3MWJA 2CXXA 2YYAA 2LI6A 1SHJA 2V7UA 2E1RA 5EPEA 4L4SA 2H5LA 3PK0A 3F2VA 3IKLA 4RPHA 1V95A 1YR3A 1ZL2A 4QPDA 3E7FA 2I99A 1RHRA 4BP8A 1XZFA 3VNUA 3GRRA 5HNKA 3ECAA 1UP7A 1Y89A 1VDZA 1JHYA 1W5AA 2Z83A 2FSHA 2QRQA 1WOYA 3L7YA 5C5EA 1UANA 1SVLA 2ESRA 3E81A 1GGKA 4I2DA 1WUDA 2MSNA 3HKEB 4MP3A 4CMGA 5DBHX 5A7GA 4E94A 3LVFO 1XKQA 1IZ7A 1PDWA 1TPZA 3WKCA 4X6LA 3ZGVA 1JYEA 2O3UA 4RTMA 3ROKA 2D7JA 3K20A 4BMDA 3KAQA 3G5AA 5BMVF 1Y48E 5KBYA 3QVUA 1ZMTA 4ASUD 4HRYA 1BE0A 4EJ2A 3C3JA 1ULZA 2J9ZB 3AVPA 3ZHOA 3GT7A 4B31A 3FBTA 1INLA 4NE2A 3QYAA 4BO3A 5KFQA 3ETRA 3KYCA 4RQ6A 4IX1A 2Y71A 4Z4IA 4NS4A 4KCGA 1DTWA 4ZOBA 1MJ5A 3IUYA 3WRXC 3W3AD 4RQUA 2I3BA 5ALQA 5HBRA 3X1YA 1ZS9A 4RACA 4RNDB 5DHSA 2JAWA 3D3EA 4PLPA 3Q3EA 4RF4A 4LXXA 4GLOA 2J0SA 2HGZA 4I6JA 1LPPA 4FFNA 4UOEA 2Y2VA 3BHMA 3B1KA 1FP6A 1VJGA 4B40A 3EEIA 3JQ8A 2ABWA 3MLBA 1Y9AA 3CUTA 5KWSA 2FUEA 2C22A 4EVIA 4Q1AA 3K09A 3S29A 3OA2A 3ZE7A 3JQEA 2VP4A 1JBQA 1EI9A 5F9FA 1EM6A 3RG8A 5JSZB 1I94B 1VHWA 1KIFA 2PX0A 4D9FA 1B8VA 1QHGA 2ZDQA 1XYYA 4G81A 8ATCA 2IP4A 5DE3A 1XZPA 3LXUX 5KNCD 1SK8A 3OF5A 2GJ4A 4KX5A 4LMPA 3HXKA 2QD2A 1PZEA 5I4IA 4BCDA 5JYBA 4W5TA 1TK5A 3GWZA 2GO7A 2BAGA 1I7NA 5DSTA 4FZ5A 2DT8A 3ZX4A 4ZYXA 4D6PA 3KE8A 3AIKA 2K5UA 4BUCA 1SN7A 1UPCA 4UB2A 4ZT2A 3KQSA 1H69A 3K05A 1Y6ZA 3UCEA 4OA5A 1CSEE 4LZPA 1TYZA 3GJZA 1O94D 4WL0A 4EMUA 1GNQA 3JYQA 3HCNA 2OO5A 4HKTA 1Z36A 4ZT6A 5G3ZA 5D1NA 1YR6A 5T7BA 2AOTA 2CCKA 4DTIA 4FYJA 2JDIA 4U7DA 1G98A 4BU1A 3WMEA 5ALOA 3ED1A 3RAEC 3S4YA 2G70A 2O8NA 1LNZA 4X8HA 3F78A 2CZQA 4OVKA 4O4LA 2BSAA 5E8RA 3Q8RB 2VZLA 2ZI5A 2B3TA 2CFRA 2GKGA 3GV5B 2QL5A 4UHDA 1L4HA 4MCJA 3JAKA 4IIUA 4MV3A 5J2UB 2ALZA 4EYHB 3FIJA 3O82A 3CGGA 2ZVJA 3ZQ6A 4TQSA 2Q28A 1L7PA 4US1R 1KARA 1XTUA 3OJWA 1M66A 4RQ0A 3UAOA 4EGAA 3JATB 2H5XA 1SZCA 2JBAA 2VUHB 1ACMA 5FR2A 1NF2A 4C07A 1CRQA 4NCIA 1P5FA 2WJZB 2WKPA 4I2HA 4II7A 5HKBA 2QB0B 4OBWA 5C35A 4FE7A 3AF1A 3RBVA 3JWHA 5LIRA 5BSRA 4DCCA 3C7CB 5DDIP 2BGGA 3LUBA 4DV1B 2ASVA 3BFKA 1G20E 2YXDA 1T0BA 2OYRA 1COZA 2M1ZA 3MSCA 5AM5A 1J0DA 1V9PA 1R5NA 4B3HA 1YBMA 3TB6A 3LC7O 8LDHA 1Q3KA 2WEKA 4HN9A 1BD3A 2PUEA 5TV2A 4JU8A 1U9IA 4ZQHA 2QTRA 4L8GA 4Q43A 1EJ0A 3B2NA 1CC1S 5ALPA 4EJ6A 1GD1O 3D6HA 4M37A 5DOVA 3ILXA 1N6PA 5LP6C 3TUIC 5LOVF 1O58A 3W5VA 2R8EA 5U4QA 3DW1X 1T29A 1XRPA 4WJKB 5HIIA 1EFKA 4DFJA 1ND6A 1P6QA 1M6YA 3JPYA 2QK4A 5DXJA 2Y6VA 3RJIA 2GAFA 2YJGA 5AI5A 1G1MA 1M8PA 3VPBA 4A0HA 3MCVA 4HEJA 3OCUA 4BIMA 2JGLA 9ICHA 1LKYB 3UICA 1G5RA 4TYWA 1JS1X 2QV7A 1OWPA 5LQRA 1NMYA 1Y6QA 2IYOA 4JBLA 2O1XA 3IDZA 2QSZA 2OLEA 3P9NA 5KMGB 3LXMA 4LAFA 4O4JA 5DRYA 2QYHA 4RA6B 1Y3IA 3AFNA 2BCQA 4MEJA 3LLMA 4C0LA 2DY1A 3WYDA 4D8YA 4XFDA 3QFHA 4CN9A 2JEFA 4FZJA 2Q0SA 4YYZA 3K9FC 5DFAA 4U9HS 3QOFA 1TT7A 5HOQA 3GQBB 2GA8A 4IRXA 1DG1G 2JIZA 1ODFA 5FD8A 4KE6A 3FI0A 5K0GA 4IHJF 4QRDA 5K0ZA 3D3WB 4ARSA 3IE2A 4K9OA 2P9TA 3FMFA 1II9A 3GRPA 2BKAA 1DGQA 3UOGA 4ESHA 4BLRA 2XVYA 4O1HA 1DAHA 1S0OA 1UOQA 4D26A 4C14A 4YLGA 4NL4H 1PG5A 3HR8A 2NVUB 1E60A 2ZJ1A 4P58A 5DYIA 3IV7A 4DV3B 3O2NA 2LD4A 4R83A 3P9QA 4ZICA 3F8SA 1SPXA 3Q2IA 5IJ0B 5EI5A 4M8NE 2INGX 3SYZA 1K66A 4QZDA 3HGQA 8GPBA 4RA9B 2HT6A 5H8WA 5C8DA 4OATA 4BRUA 5H59A 1OJ7A 1RIIA 1NQAO 5KCZA 4MA0A 3G5UA 2IYVA 4XOUA 5KOIA 3E9QA 4LY3A 4X1YB 1E5DA 1WA5A 5EE3A 3HJBA 1Q1GA 4FM9A 1NBMA 4WZZA 1OX4A 3VZSA 1ZK4A 3HB5X 2FXIA 2W6ID 1CR1A 2OEPA 1ZQZA 3T5HA 1TB4A 4E6EA 1O95C 3UAZA 3ZIUA 2PZBA 2Q7XA 3RRBA 3U37A 2ZSIA 3KL2A 4UARA 1FTQA 4OUDB 1N2BA 1UQVA 3U7QB 3QE3A 1O8CA 2JFQA 3NIGB 1WB6A 3TR6A 2GPTA 5EE0A 1UQRA 5LD2B 4BNWA 1IQPA 1IV8A 1HZZA 2R2AA 2J67A 1ZQHA 4JNKA 4LOAA 1NVVR 1XQ6A 3C6ZA 4EKYA 4LTDA 1MW8X 1T34A 1N2ZA 1V9LA 5GOZA 3RARA 2RK3A 3RS4A 1P7WA 4OIMA 1F38A 4Y18A 1N0VC 3KG2A 4D4MA 1C9DB 1MO3A 4C4RA 3GDHA 4F4ZA 1Z0DA 4WKNA 4BQQA 4DEXA 3N28A 5EWEA 4Y2YA 1CUXA 5AK4A 4HZUA 2QVZX 1T1RA 1J22A 4LA4A 4H6PA 2X7XA 3ZKWA 4B81A 4QEKA 2GF9A 1P4SA 4EFMA 5EMMA 4EZBA 3ZZTA 1SIJA 5IARA 4ZHSA 4V0ME 4Z9FA 2HHHB 1DLIA 1LVGA 1KJZA 1DKQA 3O94A 1V8OA 3Q7QA 4B0OA 3G49A 4PY2A 1TX4B 3V6LA 4QOEA 3OF2A 4Z7OB 4BIIA 2I54A 4UD6A 5IVIA 1NLZA 3OQJA 4M0AA 2HXYA 3LNCA 5IK2D 3LIIA 1U8XX 1L9XA 3IS3A 1GRNA 2RE8A 3ZDQA 4KPUB 4BMCA 4BVHA 3ZLBA 2J09A 5LB4A 4PGQA 2FUKA 4DFPA 1I5OA 4ZODA 4W5NA 4NJEB 1JR2A 2CD9A 2EJUA 5EGSA 3WLHA 2XEXA 3PUWA 2ASJA 3DQQA 3OIYA 1S10A 2EKZA 3ZNQA 2LPEA 4FZNA 3RTAA 1ZYUA 1KU6A 1WMDA 3DBHB 3UHJA 2RGNC 4G1CA 3IXQA 4EEZA 1E7RA 2EKDA 2XDQA 1L5QA 3WP1B 3LKZA 1B8OA 4I4LA 4PC6A 3KR9A 4OH1A 2CNWD 3AWIA 3D8UA 3NW9A 5JAZA 4AJIA 2AVNA 1TDJA 1AVTA 3D81A 1SUAA 1Y81A 3H04A 4YRGA 1EFVA 4HX9A 1ZZGA 3LQFA 4RNNA 3LGSA 1S02A 2JJQA 3COSA 4YB8A 3FPKA 1VPDA 4QPZA 2G82A 1AB6A 3O92A 1AMOA 4LX0A 4L0CA 3OLYA 1TO6A 3WI7A 3D8HA 2X9GA 4JDUA 2CLDX 3L2OB 1JDBB 1MD9A 4B09A 4KXUA 3VSDA 5J2UF 2J9RA 4Q8FA 3GUUA 3GK3A 3ZH2A 2YXEA 1TK3A 5CEFA 3D6UA 2FR8C 4QDUA 2MT9A 3HQ4O 3DV9A 2PA3A 1II0A 3ZD8A 1AZTA 2WHEA 3JV7A 1YDMA 4RY8A 4HNAB 3V00A 1ZIDA 4MWDA 4CKYA 4I4TA 2Z5GA 2VWPA 1A95A 5KTRA 2VYQA 1N0UA 3COPA 1HFWA 5KKAA 5FL3A 4CV0A 2VYVA 1MJGA 4LYDA 3MTAA 1ZQ9A 2PTGA 1PS0A 1RWNA 7ICEA 4RYDA 1GPWB 3NHSA 5DKFA 5BNWA 1UMDB 5BUZA 4XM0A 5BUQA 4MQ4A 5JOQA 5K0JA 4EABA 1T10A 4WY5A 16PKA 3KQOA 4GWGA 2XDAA 1R9GA 2HW3A 2O4UX 1I4TD 4F4YA 1NJSA 4R0VA 1E89A 5C5JA 4OQLA 2DJ5A 3DEAA 1CUUA 4UULA 1P7ZA 1DFIA 5MN4A 5H7XA 5AW7A 4QGFA 1U0SY 1EZ4A 4FMPA 1SKAA 5L53A 4M0DA 1LH0A 1LDEA 4OLBA 3N76A 1HC7A 1KJ9A 3HW8A 1WZIA 2HK7A 3FFWA 2AZMA 1R9MA 3REQB 4JKYA 4RQMA 1SL2A 2XE4A 1MEJA 4CQLA 3OQVA 2Y1CA 4D8UA 3ER6A 2PUJA 2AMFA 4UD2A 1QXSA 4ALJA 5DQIA 2QN1A 2B35A 2AXNA 4NNPA 5IVKA 4XDYA 2W6NA 5EZ6B 4XIJA 4W7SA 2XGMA 3O1LA 5SZJA 1FF9A 2WIFA 2A1JA 1DU4A 4A8JB 1RD4A 2R68A 4OGLA 5C1PA 3GAZA 3T3DA 1WXQA 1XZQA 2KP7A 4C76A 2PQMA 1OLUB 3QKRB 2Y1IA 1KR2A 3JQPA 2NO7A 4NBWA 1XMVA 4CR6A 2JJ1A 5JAOA 2Y99A 1XLTA 2AZ4A 1T5LA 5J2IA 4RQTA 1T3NA 3UW3A 4QYIA 1DXOA 2C2HA 1ZN7A 1YZ7A 4AJKA 1R3DA 4PS1A 3L6BA 1JXEA 1ODIA 3H5LA 5ECYA 3DE4X 4B17A 4PLTA 5IUJC 3OQHA 1LFAA 1ZD3A 1Q7BA 4J1SA 5B64A 3UOAB 1S4QA 3KSZO 3DJFA 2VS1A 5BOSB 5JNWA 1QR2A 4BMXA 2PZJA 1QPZA 4ZZ0A 2ECPA 2EARA 3EH2A 2WYWA 3HZRA 5B5EU 1K1QA 4OKNA 1E1CB 4EMSA 4UUBA 2A9PA 4QBKA 5CXUA 4KK4A 2R48A 1G5PA 4YJHA 4DILA 1SOWA 2AA3A 1MJHA 3HNRA 1IN1A 4FPXA 1WVGA 3BHJA 1ZM7A 4R1NA 4J0CA 4BO9A 1V3VA 2JHPA 3L04A 3W2TA 4J0FA 2P41A 1U98A 3RF7A 3IQWA 4B9MA 3FWYA 5CVEA 5B1EA 1I9GA 4UTVA 3RJGA 3AJDA 2OHXA 5LQUA 4TUSA 2QTAA 3PIIA 3UMJA 3K31A 3ORFA 1T5SA 2UZ0A 3TEJA 3Q9UA 5AOBA 5KFJA 4Y0VA 3TI0A 2XTNA 2VJDA 1R5BA 1Y8QB 1U7DA 4EBEA 2D6FA 8ICYA 1U0EA 3DTVD 1U94A 5IM4F 4BASA 1M1XB 4D9BA 3QE4A 5FX2A 2OYCA 1Y7LA 3EHDA 1ZAKA 1SVIA 4FYPA 2X22A 2JEYA 4MI6A 1SV0C 4J9QA 2W9MA 2RHGB 4TXJA 4RZIA 4BFCA 1FDVA 1NJFA 4NV3A 4D98A 3U9TA 2GZDA 2HADA 1PJRA 1AS3A 3NONA 5T64A 1RI4A 4KLEA 4HUTA 1R6AA 2HMSA 2CUNA 5JDIA 2O48X 2C2ZA 1ZQEA 4XM2A 3I76A 1UKZA 2O8CA 2V9PA 5GINE 3OY7A 4EBCA 1FDWA 2QB1A 5FNVB 5JZ9A 2XOKD 3ZHZA 2GT1A 2ZJ8A 1VG8A 1KKUA 3K1RB 3ON5A 3EIWA 4PXAA 3GLKA 3SDSA 1SU6A 1UBKS 1JU3A 5EKXA 5GGYA 3O91A 4W6QA 2A5GA 1Q95A 4CF6A 5CPFA 3TDKA 1W1UA 5DGXA 3I3SR 2R44A 4TV8B 5IAEA 4URXR 1VRVA 1NK5A 1KFBB 5LLDA 5DLFA 4FBUA 4DQRA 1ZQAA 4D4GA 1KSFX 4DDUA 4PN3A 2FLLA 3C3WA 4CT5A 5FOTA 5BR8B 4DDKA 4GM0A 1E4EB 2IZ0A 3KTOA 1NUAA 2HW8A 1R6TA 3RTBA 5E6UA 2ISPA 4TYMA 3GFQA 5IWAB 2C31A 4PZAA 2AFHE 2JHDA 4RK5A 1SHUX 2QHXA 4QL3A 5AM2A 3CF2A 2C2KA 4B3FX 4TRRA 5KFKA 4ZMSA 4DSKA 4OHZA 3VKVA 3FZYA 1S0UA 5J0YA 4LV8B 5E9WA 1IATA 1DHTA 4OG2A 3VR4H 2FQYA 3WL6A 4CIYA 1MAAA 3SYKA 1WSWA 2EQYA 3WL3A 4FFPA 3I5MA 3ROTA 5KG4A 1NW9B 3PRYA 4HAIA 1IHPA 1Y9JA 2V3VA 2HNBA 3KDSE 3V33A 2RHRA 3I5YA 4BL5A 1F5SA 3IDAA 3M4ZA 3T7AA 4GF5A 1HTBA 4BWGA 1J2EA 2WHPB 3W1VA 4AUMA 3V3KA 3WIEA 1BVYF 4EA9A 4J9LA 1C4WA 2W6MA 2YQZA 5H80A 1NK7A 4MKIA 1MXHA 2Q3BA 4QDOA 1NUHA 1PUIA 1AKYA 1F14A 2OQ2A 4YASA 4YWJA 5C4MA 4NFSA 1QO0A 1XZBA 1H3EA 3EYAA 3ITDA 1NTOA 2XICA 1U6JA 4ATNA 4B85A 4MHVA 2PL5A 3VC2A 4B2LA 4OO3A 1CR0A 4RFSB 4Z9XA 5CB0A 4I1OA 1WDLA 4HWSA 2V45A 3O7MA 4QGHA 3AFGA 3H83A 3M83A 3GROA 2I4IA 2Q2QA 2OFWA 1JHAA 2YRXA 3DMDA 3NAZA 4INOA 1O9HA 4W7IA 4PLFA 1WW8A 1XNRB 4AULA 5A6VA 1EAYA 2OHGA 5B30A 3KPVA 1Y1RA 3OX4A 1DAOA 4GOLD 1M76A 4B45A 4NV1A 3O31A 3LC2O 4RF2A 2VBFA 3QUTA 5DNAA 4MIOA 2V0GA 2VNSA 1PFQA 4WFKA 2F1IA 2B1IA 4OYHA 3AEUA 1MGOA 2XOXA 1DQSA 3SJ7A 3VKUA 2H63A 3EYWA 2VTBB 3TECE 3HEMA 2D4HA 4F1KA 1C7FA 2AR0A 1SA0A 3E1SA 1XMQB 4JJEA 3JARA 4YRAA 2IHJA 1HE2A 2KJ5A 1DKLA 3EODA 2OZPA 1OCEA 4PGGA 1RC1A 4EB6B 3M1YA 1RKBA 3COYA 3GG2A 4EITA 1QJCA 3QVKA 2PSEA 5B4VA 4ZGBA 3OQNA 4F5OA 1QUFA 4DQ0A 5CLLA 4QASA 2G83A 2B99A 4WVLA 1TPYA 5K0CA 4UM7A 2VC2B 4WQMA 4C6TA 4KXMA 4YDSA 5ALFA 2C1EA 3Q3CA 5CB4B 4MW6A 3GDOA 2EJWA 1N0WA 1HYHA 5IT0A 4TSFD 2KQUA 3C28A 2WNIA 1UADA 2XY6A 4BS9A 4X84A 3KZCA 3LHSA 4BMSA 3CWQA 5GTHU 1I2DA 1Y82A 4H4CA 3N8HA 4ZA2A 1L5HB 3IQFA 3PB3A 3TNLA 3C85A 3EGDA 2IWRA 2QJWA 2IZ7A 3WGOA 3PXUA 3CLRC 4QIHA 2IE8A 3W6PA 4JI0B 9ICVA 1VLZA 1ZH4A 4NPHA 2XSZA 1L5KA 3KVYA 1CEZA 1AMNA 3LQYA 4DR2B 1N32B 3GN1A 3W2HA 4RULA 1QGDA 3U4MA 2OCDA 4R8KA 1O87A 1I0LA 1NVMB 1XQWA 3B1ZA 3RSGA 1Z4NA 3A1EA 1P9RA 3W90A 2FOIA 2J3EA 5ADWA 4BO5A 2OGWA 5JAUA 2YMQA 4ALNA 5LSAA 3LL7A 1J8DA 5KQGA 3MRVA 1LY1A 2QMOA 4BV3A 2VAVA 4WKGA 2PWZA 4TRNA 4EJFA 1IHDA 1UFKA 1C3XA 2FX3A 2NUTB 4J4TA 3R5KA 3FCCA 3S5UA 3WK9A 3W6NA 1XMPA 2P5UA 1G7SA 2HFKA 4RYLA 4OXXA 4HGYA 3ICEA 5TMDA 3D6FA 5DT2A 5C81A 1OBOA 3T3GA 3PE4A 2TYSB 2PUCA 3A6FA 1C5KA 4A91A 4I50B 3ZN2A 4G85A 3LMKA 1X80A 2FWNA 4EY6A 5IC6A 2DQ4A 3H5TA 3SBDA 1GZ7A 4LF5B 3B5JA 3D5EA 4Z6KA 1W85B 1D0VA 2J3DA 3ISCA 4LI0A 4Z49A 3JQ6A 2V7TA 4BFZA 1X9XA 1NQVA 2H4HA 4RJIA 4L75A 4DCMA 4B7AA 3AUUA 5BN3B 2IPNA 2CD7A 2VF4X 5TGDA 4ZAZA 5ETJA 2CDRA 4XJSA 2J59A 1UM9B 2B61A 1N5XA 2OZEA 3ZWDA 2C29D 4XDHA 2YNMA 5CW1A 4BDPA 2ZTMA 5CFZA 1IVSA 4KRYA 1BCRB 5AYVA 4H60A 2QN2A 1K1SA 1Z08A 1Q84A 4Q48A 5L6MB 1V3UA 4L0MA 3PWSA 5FNVF 4HYYA 3DFUA 5KWVA 1EBFA 4QSMA 2PUDA 1U2PA 2YYSA 5G5HA 3PSIA 2I6XA 3UWMA 2GO1A 4PRYA 1AX9A 1I4WA 1ODCA 5SYMA 1I4LD 5T57A 5BO5A 2OCLA 4MI9A 4QBIA 3TWOA 3A7DA 4DMMA 2A4KA 2ZIAA 1NXSA 1AURA 4R84A 1KI9A 3OUTA 1F06A 4LDZA 3SHWA 4JMPA 1JNXX 4TV8F 1M8KA 1X1BA 1XTJA 1A2OA 4RPIA 1U2EA 3PFWO 1X86B 3OFVA 5A4IS 4JROA 3M6AA 5D3MA 2X4GA 3L05A 4RTOA 2CLKB 3SV4A 3BH7A 3MLAA 1GZ5A 2OBXA 3MGCA 3SX4A 1Y1SA 1VMEA 1LBSA 2JFPA 1H9AA 3S1SA 3A4LA 4JBGA 3FVQA 4AS2A 4DMHA 2G8LA 2NZWA 3LVRE 3EZNA 2ZIZA 4FJ2A 1WETA 4HDRB 4ZH4A 4M9RA 2FMIA 5AJZA 3EZLA 1EGAA 2C5EA 4LSGA 2QZPA 1G20B 2OXRA 1BMDA 3DBRB 3GBSA 2PV7A 4QYMA 4KMMA 5LWHA 3AFMA 4D96A 3EAQA 3W6OA 2R8RA 1M0TA 3CO0S 3RYCA 3KB6A 1JDTA 4PWZA 5TLSA 3WB9A 5JUWA 1E5LA 4ZDKA 1LPMA 2EYUA 2F9MA 2JH9A 3FTQA 3DVRX 3DMTC 4XQEA 1XMJA 2FK7A 1N2GA 2CKMA 4BLTA 2DFPA 3UPTA 4LOJA 4US2R 4PAQA 1BOOA 4I1SA 1KEEA 5K0NA 1K6IA 4JBXA 1DJOA 3KJZA 3AR2A 4RSMA 1MIOB 1F0NA 1VJRA 5EWJA 1H4QA 5J3JA 4X61A 8ICXA 4KIJA 4EG6A 4WUVA 2YVQA 3OTOB 3PNVA 3QK7A 4PVDA 2KMLA 4MVJH 3N2IA 4KXLA 3GV8B 1T3LA 3UJ8A 2DUUA 3FGOA 3ZLTA 3N7TA 4IGKA 4UCXA 4KLLA 4ECYA 1H2XA 5AKXA 2RGGA 1T6XA 1KYXA 4TX1A 3CNQS 3RH0A 2CEAA 2PZMA 5CX1B 4KLGA 3IBGA 3NC0C 3M6ZA 1DRVA 3VTFA 4ZO6A 4QOJA 1X1CA 2OG2A 3ZNPA 1GGHA 1BDMA 1MBZA 3R6LA 1SGWA 3EXEA 3VJLA 2AD1A 4UEWA 2WF5A 3QM1A 4CKCB 4WKCA 3VU0A 3EVTA 3QVMA 3WKBA 3AEQB 5TQVA 7ICJA 1MVNA 4DSUA 2HL6A 2AB0A 2P0AA 1XDDA 3LQ1A 2AJBA 2J9XB 3D6NB 3RS0A 3NGXA 5FOXA 1YZHA 3THWA 1B6RA 2O7RA 2W2NA 2I22A 5JS2A 4KMSA 3FAKA 5IAGA 2HIHA 3LOQA 2AZTA 2OXEA 3JQRA 2CVZA 3Q0TA 2JCSA 1C1XB 3DO8A 4PHDA 1O54A 1LX7A 5F1KA 4TT3D 3F6PA 4JJ7A 5L1JA 4HOYA 3ABQB 1G7TA 3WSWA 1NYLA 2VA8A 4HS9A 4ALLA 4AP5A 5AHXA 2X5KO 2XUFA 5ERYA 2PX4A 1DO2A 2G72A 1EE2A 3EG9B 4HF7A 1M6VB 3K6SB 3C2QA 1E61A 5KTMA 2ZUVA 3INNA 2ZFUA 1E6MA 3TX6A 3AG5A 2O7SA 3ETLA 2H7CA 4FT2A 4ZQIA 3X3HA 4G1UC 5CB4F 1OXUA 2TMKA 1Z0JA 3SQLA 2YCLA 4G4SP 1BYIA 3E1KA 1YU6A 4G56A 2EQBA 2JCXA 3ABZA 3ENZA 3OHBA 4RPGA 1JN0A 2FPOA 1H3FA 3Q7IA 4FGSA 4EHBA 3UK0A 1FEZA 4DV7B 2GCEA 4JGGA 3H87A 3EMKA 2NV2B 1SG6A 5JCOC 2V0NA 1YE3A 5A5GA 3DBOB 5A5VA 5A3JA 4Z1MA 3BKWA 2Q6VA 3ICWA 4C8NA 5EUMA 5DTIA 5DIFA 1NF8A 4UC0A 1JIKA 3AR7A 3T3PB 1JAZA 4G0VA 3AK4A 2VCYA 5HMMA 2QE7A 4CCAA 3X1WA 2GDJA 2WQZA 3HDTA 1YOVA 5A9SA 4MRSA 3UH1A 3BA1A 2AD5A 4TV9B 3MDAA 3OLWA 3IRVA 3HS3A 2UUPA 4ENRA 4B4WA 1KAHA 1F48A 4ZAFA 1P8JA 1UKAA 1SXEA 4HXFB 2Q62A 1ENZA 2FSFA 1UFVA 3I0ZA 1KDPA 1XIVA 4IRDA 2H1IA 2C07A 5CEHA 3I83A 1RE0A 2PGOA 3NM6B 5FNZA 2HBZA 2F3TA 4LV5B 5TVKA 1OUMA 1XZKA 3J80A 4BC1A 1X2IA 2FEWB 3RJ5A 2PK3A 3N2GB 4R81A 4ILKA 3FNIA 5I9NA 3Q15C 2A33A 4GBJA 3EVGA 3R8XA 2MINB 3ZR4B 4KVZA 3TNFA 2JLCA 4I50F 3OPYI 1W8DA 2X1HA 3L0ZA 3A4MA 5DASA 3GEDA 2R5FA 2Q1SA 3H8WA 3ESDA 3UHPA 4AMYA 1X7XB 4K9MA 4V02A 4ND8B 2AJDA 1VLJA 3ONNA 4IWXA 4BMOB 4BKUA 2AQ8A 5TQ0B 2C3UA 3ZLJA 2WAMA 2WVGA 2PMKA 4R0NA 2KYRA 4PG6A 3UK6A 2PN1A 1YUMA 4MP8A 3E5NA 1J5PA 2PH1A 4EECA 4FMBB 1MQ2A 2VP0A 3DLAA 1PFYA 5KG7A 4R66A 2LIPA 3RO7A 1EP2B 3NIWA 2KZ3A 1OGYA 1BX3A 3WWEA 5KFAA 1UQUA 1SBIA 5CK5A 1I4EB 1T4DA 3OTGA 1DARA 4GC6A 5KWJA 3RRXA 4G0WA 4JSRA 6CHYA 5BW6B 4J03A 1ZU5A 3HB4X 1XI2A 1XEWX 4JN6B 4Z3KA 3NVAA 2LIVA 2Q5IA 3BS4A 4ABTA 1T1GA 2V7BA 4EYKA 4YACA 3QLEA 3WAGA 3QWFA 4J0EA 1NKEA 4X45A 5T5QA 3H2BA 1GKUB 2KVCA 3BL8A 3BREA 1C7ZA 4G24A 5KNDD 2EFGA 2I7DA 2HTFA 4ZI2A 3TSZA 5GADl 1SVMA 5DWQA 4HP8A 4Z5XA 1U9IC 1P19A 4YUYA 3M49A 3LSTA 2Q1TA 3PEVA 1IBCA 4IUCS 2QOEA 5D00A 3FNFA 2NXCA 4TURA 4YAUA 1YS6A 3KRTA 3WYGA 1KFEB 2ZSKA 3D1LA 3HP4A 5CURA 4UB6U 1O6BA 4AKIA 2WP8J 4HRAA 1RQGA 5LBUA 4K81B 5ULLA 2BFEB 1E0JA 3SLGA 4IDNA 3RB3A 4MWCA 4GGPA 1ST3A 1GN9A 4W1PA 1J42A 3E9RA 4HXYA 4RTJA 3FW1A 2E85A 1JX4A 3DZGA 2E5SA 4LYJA 3IESA 3H9QA 2C78A 3MRSA 2ODTX 4O2AB 5KCMA 1GG9A 2GCOB 3U7GA 2N47A 2EZUA 2YJ5A 3EWIA 2QBYB 4N39A 1PIWA 3DLBA 1FSGA 1W34A 3K16A 4X91A 1WBDA 1Y4UA 2GN4A 2CKDA 4Q3BA 4AWBA 3AUFA 5IULC 3MQ2A 4GX5A 3WL8A 4A8EA 1BJKA 1YOBA 1VKOA 4C0KA 3LXRA 1R6DA 2XA9A 3KVRA 3C3PA 2YOGA 3L7CA 2C8LA 1X9IA 2O3TA 2HMVA 3FE2A 1N2EA 1Q46A 5E6SA 2R25B 5DM4A 4K6KA 2I8CA 4K9PA 3ZIAA 2ACWA 2YR0A 1XDGA 3AU8A 4HMPA 5MGNA 4A15A 3G8AA 2Z0MA 1UBFA 1QTNA 4LJYA 2FWIA 1XNSA 4YN3A 4NP6A 2PDAA 3CLTD 2D1SA 3PFGA 1MKYA 4EGSA 2WWFA 3FPGA 1HF3A 3F8WA 1N57A 3T1OA 1U1EA 3PP8A 1VOTA 1NPYA 3OEHD 3PU6A 2V7WA 5L51A 2I5PO 1H66A 4UBCA 4LUCA 3MWDB 5JSFA 1S7CA 5LBTA 5E0OA 4HEHA 4ARBA 3MW8A 2YDYA 1AN9A 3OT5A 4TYPA 1GTG1 3PUVA 3LAWA 1Y63A 2IXDA 3PC7A 4KXVA 2QRPA 2X3UA 3D0QA 3DOJA 3V7JA 3SIWA 5J4YA 2JXJA 5CDTA 4DT1B 3F6RA 4RHUA 4UNRA 1XJCA 4TSKA 4DLKA 3BWEA 2G67A 7ICLA 1E6LA 1WCIA 1W5FA 1JEJA 2E9SA 1UAGA 3BMQB 5J0QA 3H0RB 4KGVA 2RH9B 1EK2A 5BPFA 2Q8QA 4DR5B 2OA0A 2PZKA 2GD2A 4GOXA 3CE6A 3DMRA 2YMPA 4U2KA 2FMUA 3K9HA 4MCIA 5DN9A 5H4GA 1EA5A 3MC1A 1M75A 4CVNA 4EM6A 4YT4A 4LBYA 2HU2A 4RABA 1CKEA 3W2GA 2BDEA 4A2PA 4XGIA 3T7EA 4QU0A 2BP7B 1PWYE 2IRWA 4ZO9A 2GEVA 2VYNA 1GAWA 4BJ3A 1FRNA 4ITUA 3AJAA 4S2UA 3CX4A 3WLTA 2GQ0A 3AQ4A 3ESCA 1YBHA 4TWRA 3CW8X 1V26A 1PK8A 1KY3A 2FDRA 3RYTC 2NYAA 1USIA 1NT4A 4BO2A 3Q3IA 1Q16A 1YZNA 4BZZA 2BC9A 2E8PA 2XUKA 1CX9B 1C9KA 3G6KA 4IIEA 4L76A 1FJ2A 5J4HA 4DOAA 1SC6A 5F3RA 4MUNA 1QZXA 1V48A 4O3RA 5ICSA 1ISSA 1CUWA 1F51E 1GARA 3ZWNA 4I29A 4BX9A 2HN9A 3TAUA 5EYPA 2CLSA 2PMFA 3LO8A 4KPFC 2FEAA 3VHXA 4K6CA 2BR4A 4M9JA 4BVKA 4ZANA 1P5JA 1F4LA 4B8YA 4YR2A 1J5XA 4LYGA 1U3UA 2GETA 3A36A 2OOKA 2VJNA 1HE8B 1Z6QA 1JDNA 4Q1EA 4TV9F 4G9BA 1AO3A 1S2IA 4LWQA 2YB4A 1S8AA 4DA8A 1ZNQO 1GPAA 1M34A 2GM4A 4A2CA 2JANA 1H42A 2ZBQA 4BX0A 3BS5B 4C5BA 1VHDA 4PGHA 3S99A 3FB1A 2YHUA 4YR0A 2ZPAA 1XPRA 4H1VA 2C3YA 1CK4A 5AVVA 1YHNA 8ICRA 4FDMA 2HF8A 4F3CA 2JAHA 2CXHA 4NFHA 2BR0A 1ZONA 3FWNA 1OZFA 4UE3S 1ORWA 3BXOA 2OBNA 3LP8A 3AW8A 4TOIA 2CJXA 3C1ZA 2QN6A 2F4VB 1D9FA 3H7AA 4I5GA 4NBKA 3ESYA 3SZOA 4EWLA 1QWOA 4HDCA 4C4SA 4NMHA 2HMUA 1Q0ZA 3EFBA 4DDVA 1WBJB 5E7MA 3RAJA 1I3NA 4PC3A 3D4IA 2GPBA 4I1IA 1T9DA 4YIHA 3QXXA 1KLNA 2BE7A 4YLYA 4TMVA 3HB0A 2JFFA 5I9SA 5IINA 1US8B 3N8NA 2YXBA 3AERA 1Q0UA 3RYHA 2AFHB 5EESA 3GEPA 4D0RA 2VWQA 1UBHS 9ICQA 1RHJA 3UMRA 2JZBA 3LYAA 1J6UA 1P9WA 2XYHA 3KHLA 3NO4A 3IMCA 2KPOA 3EVDA 3NBFA 1CEEA 2SHKA 3TUZC 5JFTA 3D31A 5HDQA 4YPVA 1QQTA 3R74A 3BH6A 2D7DA 1YO6A 1Z6PA 1G7CA 3B78A 2ZAIA 4U3JB 1FFWA 4ZJYA 4MB2A 1SVWA 2VJ5A 5E9QA 5A62A 5FI5A 1X3SA 2FU5C 5LZ2A 1DMSA 3B8EA 4DW8A 1M0SA 1VPLA 4D45A 1RAHA 1PEKE 3C4QA 2H1FA 2UVVA 3HVKA 1JLLB 3VR5H 1U48A 4QATA 1BWSA 2CUKA 3FZEA 4TLDA 3C3DA 3ZW7A 3W5IA 5KYGA 3JD4A 4MZDA 1BEZA 4RQBA 3D02A 3NU1A 4WOBA 3WK6A 1FXSA 3T34A 3FTCA 1E6WA 1WG8A 2D5IA 2JIDA 4KXFB 3HXQA 1HH4A 1PW7A 2V97A 1LS6A 2QJRA 1T0IA 2ILTA 2FZVA 3QPAA 1W88A 1SBNE 3E58A 2LMRA 1ECCA 1AGNA 3H8MA 4QD3A 3OSNA 3UJCA 1HDRA 1OV4A 4I66A 2XR1A 1TA0A 4PLGA 2ZUEA 2CJYA 4EB8A 4WSOA 4H16A 1IN8A 5J43A 4RORA 3DLHA 3SDBA 3DT8A 4X44A 1ECJA 1BEUB 4P5EA 1LLFA 3AFHA 2XI9A 3W05A 5K1ZA 1XU4A 4GSKA 3CWZA 3RUFA 1XP5A 4LQLA 3KALA 1OBHA 5DIZA 3ZDXB 1N5LA 5ISMA 1AS2A 1D1SA 4IV0A 4QJ3A 1H0RA 4CQMA 6LDHA 1C7IA 1Q74A 4BWMA 5DMXA 3LBNA 1XLTC 1MQAA 2Z98A 2YVUA 4PYLA 4O2AF 2VT2A 2VEDA 3BX1A 5AM0A 2XC9