2XO7A

Crystal structure of a da:o-allylhydroxylamine-dc basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Discrimination between Dc and 5Medc Via Their Hydroxylamine Adducts
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 195
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xo7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xo7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xo7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xo7A01
4E7HA 4PHDA 1K1SA 1LW2A 1J53A 2JZBB 4M2YA 4KKOA 2R8IA 8ICGA 4DSJA 2DFFA 1XSLA 4DQQA 3BJYA 1X9WA 4K4IA 4O3OA 3ZDAA 2ITGA 3LP3A 4CK1A 5HNKA 4J2BA 2UVVA 4DWIA 3D0PA 2G8HA 3ZD8A 9ICGA 1BCMA 1BPZA 4OKJA 4Z6CA 4JUZA 1BPDA 1S9EA 4ZTJA 4M0AA 4NLGA 4OGCA 4TURA 9ICIA 5JS2A 3SCXA 4F4KA 1ZQMA 4DQRA 3KHGA 1LWEA 1JL2A 3AVKA 2BCVA 3Q8LA 4O3NA 2RF2A 4Z4FA 3AO5A 3PW4A 3ISNC 5KFWA 4Q8EA 1DOQA 3AVCA 3V6HA 4DU3A 8ICNA 3RR8A 4GVMA 2ISOA 5CY4A 4ECVA 3PW0A 3ZDEA 3VQCA 4I2HA 4CF9A 4F4XA 2IGIA 1RPLA 2LYHA 4F3OA 4I2EA 4O3RA 3NGIA 4I7FA 3LPTA 4HUEA 2IOCA 1ZQFA 3DLBA 1RXVA 3NTUA 3B6OA 4M9JA 4KLHA 3QIOA 3KLIA 2BPFA 4KFBA 3VQAA 4KPYA 3QEAZ 2D0CA 1JLFA 1I39A 3OYHA 2G8FA 3ZSWA 4O55A 2F1JA 3RB0A 4I2GA 1S9GA 1ZQGA 3O4NA 4C8KA 4BXOB 1D8YA 1JLEA 3V1RA 2RPIA 4KN4A 1JXBA 4W5QA 2YNHA 3V9WA 3DYAA 5KFEA 4PQUA 4KTWA 4J9QA 4CJLA 9ICTA 5L1IA 3SNNA 4WE1A 4I2AA 5IIKA 9ICHA 2NRVA 3L2QA 3NF7A 3LDAA 3DLEA 3S3OA 4M9GA 3TAQA 3GIKA 3HK2A 1ZQSA 2C2RA 1N56A 4RW8A 5DQGA 4FJKA 1H38A 3DLRA 4HUGA 4FJ9A 5J0OA 3ISCA 3N4MB 2G8UA 1Z3EB 3H08A 2H5XA 8ICIA 4FJNA 5KFOA 5J2DA 7ICEA 8ICVA 1NK6A 4QZEA 1UT8A 4Y1CA 3AA3A 5KI6A 1ZQJA 4CE9A 3T5JA 4I2FA 4QZIA 4DF4A 4QZAA 3SUQA 1WCLA 5CB1A 4NY8A 4HVJA 1N48A 2G8VA 2XY5A 4DF8A 4PY5A 1K6YA 5KFVA 4KN7A 4QZCA 3RMBA 2BCSA 3RJEA 4CGJA 4IG3A 4ED2A 3RBEA 3OYLA 4DFMA 7ICFA 4DU4A 4EBDA 4CHPA 4O3PA 3MR5A 4UB2A 4IRDA 3H8JA 2P66A 2P6UA 3OYBA 3K5LA 4NM1A 5IIJA 1NK9A 1YVUA 3HP6A 2I5JA 2X74A 2ZJ8A 1SKSA 3ITHA 3ZDCA 5HRSA 3AA5X 3G6YA 4IRKA 1HQUA 1A5VA 4RUCA 2IMWP 1NOYA 2P5GA 2UVWA 4RQ0A 3KK3A 4Z0UA 3MDAA 1VSMA 1MQ2A 3HJFA 3QESA 1L3VA 3NBPA 4MF8A 4IRCA 1IM4A 1ZQXA 4MEXA 1TV9A 3CYMA 3AVIA 4PWDA 3SUNA 3AO1A 1XSPA 2OZMA 2O4IA 3DLGA 3KLHA 4CF1A 4RW7A 5KFQA 2ATLA 4UB5A 1HNVA 4KAZA 3FDSA 4F93B 3ZSZA 3AU6A 4IBNA 5J1EA 4RNOA 3CFRA 3KHRA 3PY8A 3KHLA 1RT1A 3OS1A 3VQ8A 1C1AA 5T7BA 4FM1A 4TQRA 1HUOA 4M04A 3QLHA 3L2WA 5HLFA 3PX6A 4RQ1A 1RBTA 4OKEA 1C0UA 4RQ7A 2AU0A 1ZBIA 1TL1A 1MQ3A 3V9UA 2VA8A 2RDJA 4JV0A 4N5SA 3NGZA 3VQPA 3OHAA 4C8NA 3EW9A 2IDOA 3TAEA 1JXEA 3TAGA 4QOZB 9ICCA 3QZ7A 4BACA 1LAWA 5KG7A 7ICTA 4HUFA 1TV6A 3M9OB 3S9HA 3VQQA 3O3FA 4CJTA 5SWMA 4DS4A 4YXMA 3QE9Y 4ID1A 4CECA 4KHYA 1Q9YA 4RQ5A 2ZUDA 3G6XA 3OJSA 2XO7A 3O4QA 2J6SA 4CEEA 4M9HA 4OVLA 3SZ2A 1IKXA 1BPXA 1RBSA 4YR2A 2ZJ5A 3QEBZ 1XU4A 4AHRA 4QCLA 9ICLA 5KFSA 2IS3A 3JYTA 5L1KA 5HRNA 4B3OA 4FYDA 4JK1A 4GXKA 1MC8A 4CGDA 4KLUA 1RT5A 4PHAA 2YKNA 2W42A 4FLXA 4ECTA 4CHQA 5IIIA 1WSHA 2G8IA 3AO3A 4DTRA 3TABA 3PW7A 1UT5A 1B92A 5KG1A 3RMCA 2VWKA 5DBAA 4I29A 3ZT1A 1WSIA 4LH4A 1TK8A 4AILC 2E6MA 2BPGA 5DB9A 2F8SA 1JLBA 2XY8A 3RH6A 5DDMA 7ICHA 2KTQA 1Q9XA 1VSJA 4FBUA 1N5YA 1ZBUA 4I2BA 3DRRA 3RAXA 2ZUBA 2Z1HA 4IDKA 4CIGA 1S9FA 4YMNA 3RBDA 4C8LA 3JSMA 3M8PA 4Z4EA 4F3TA 5J2MA 4K4HA 4ICLA 1T4GA 2IAJA 4KLTA 4N56A 4EYHB 2W9AA 4I2PA 5J2AA 4B8AB 1D9DA 9ICWA 5DKWA 4IQUA 3VQ6A 5FRNA 2BKEA 2VG7A 1XC9A 5J2HA 8ICOA 2BQUA 4NCGA 2F1HA 3LDSA 7ICSA 1DLOA 4ECYA 1C6VA 3C94A 4FJ5A 1NKCA 1JL1A 1S1TA 4F2RA 1VSLA 3MR2A 1HYVA 5BOLA 3Q8MA 3KLEA 1ZJNA 5KRTA 1HQEA 3VQEA 1TKTA 4KLJA 1U9LA 4PHPA 4KI6A 3UIQA 3TFSA 3DMJA 3TARA 1NKEA 4DTPA 2R8HA 1U04A 4EP5A 4KLIA 2AJQA 3SQ2A 2DTUA 3ISDA 4N41A 5KG0A 4B08A 3B6PA 1ZQYA 2Z1GA 3DRPA 3U6FA 2HNZA 5C25A 1NJXA 3L8BA 4IQVA 2BCQA 1HRHA 3QEWA 4CHOA 2ETJA 3PO4A 2RKIA 2DY4A 4E7KA 5J29A 4UB4A 2BE2A 4JS5A 1S0OA 2NUBA 2MUTB 2VA3A 5KG5A 4F5PA 1QHTA 4YMMA 5FROA 3M9MB 4FXDA 1KRPA 3C6UA 3Q8PB 4QWBA 3NHGA 3IAYA 4OPJA 5DLGA 2NRZA 5J0WA 3PVXA 5KFGA 4CJFA 1IKYA 4YXJA 1EXQA 3KD5E 4M45A 2NRXA 2ZUCA 5C42A 4RNNA 3TFRA 2W9BB 1S5JA 3K75D 4K4GA 4KLMA 2DPJA 4ED6A 4DSLA 3ZSXA 1HJRA 4I9LA 1ZQWA 2PYJA 1ASWA 1XO1A 5HBMA 3E01A 3OYIA 2Z1JA 4KHNA 2PI4A 1F21A 2FMPA 4JV1A 8ICCA 4CERA 1TKXA 4AHUA 3UXOA 1KDHA 4CK2A 5DGBA 1RT2A 3ZT3A 3DLKA 3DRSA 3KKRA 1A77A 5EWEA 5CWRA 4LZGA 4DU1A 4KLEA 5CA7A 1QSLA 3ZT2A 4BWMA 4RG8A 3WNHA 7ICVA 1U45A 3MR6A 5EU7A 4CJSA 3C2LA 4DSKA 3VQBA 1LV5A 4RNMA 4MF2A 1FXXA 1QQCA 4ELTA 8ICRA 4ECSA 2FMQA 5CJ7A 4IQTA 1IXRA 1ASUA 4YG2A 1ZJMA 1HYZA 3HL8A 4HTUA 2FBTA 1TFRA 1RILA 2YNIA 4XRHA 3LALA 4DFJA 3RR7A 4DLEA 3UQ2A 1J5OA 4BDPA 3HYFA 1SL1A 4B9UA 2AQ4A 5K14A 2EHGA 5L9XA 5CZ2A 3CG7A 4CEQA 3RJFA 4JRPA 3K59A 4JWNA 3NAEA 3H4BA 3JPPA 1HNIA 4FK4A 1EETA 1BIUA 3B0XA 1ZQZA 3MEEA 5KFUA 3PX0A 7ICMA 1VSEA 5BPCA 4FJ8A 2KZZA 1NJZA 2C2EA 4UAYA 4CF2A 4KLFA 3OVNA 4LSNA 3QO9A 1T7PA 5JS1A 3M8QA 4J9LA 3RTVA 4E19A 1HUZA 9ICFA 5KFXA 4NCAA 4KLDA 1VSKA 5BOMA 1UA1A 5J0QA 9ICUA 4I28A 2BQ3A 4HYKA 3AA2A 4B9TA 9ICSA 3AVJA 5J0PA 5DBBA 8ICPA 1RDDA 3HP9A 4F5RA 3SPYA 3UQ0A 4Q43A 3GIMA 2XRIA 4OGEA 3TI0A 2B21A 4G3IA 1J9AA 2R8JA 1W9HA 4PGXA 4QZ9A 3GILA 1NKBA 5J2BA 4LY7A 4BXOA 1ASVA 3V6JA 3PW2A 1RTHA 3RH5A 4FLZA 5KFYA 1D5AA 2QXFA 3Q8KA 2ZTDA 4DL3A 3K4GA 2QK9A 3JPTA 9ICPA 1TGOA 3CFPA 3M9NB 4CJ3A 4CJWA 4CEFA 4TQSA 4CFAA 4CIFA 1LAVA 5KT5A 8ICHA 4UB1A 4KHWA 3SI6A 4OKKA 3TAFA 4KHQA 4QWEA 4DOAA 8ICFA 1HMVA 1Z00A 2X6NA 4CJVA 4E7IA 3RWUA 4FM2A 1RT6A 3LANA 4M41A 2D5RA 3G6VA 3OYAA 4LD0A 3RJKA 3ZSVA 4KTZA 9ICJA 1JLGA 5F9LA 3AVNA 2I1QA 5J2GA 1SL2A 4CJUA 5KFMA 3ZDDA 5C24A 4F4ZA 4RU9A 2YV0X 1RTIA 5HRRA 3OYGA 3AVHA 3V72A 2YHBA 4KI4A 1MSWD 9ICKA 4ED0A 4FCYA 4QZHA 1QSYA 2HNDA 3OSNA 4ECRA 3KIOA 2ASDA 8ICUA 4FW1A 4FZXC 5CYQA 4YCXA 2AGPA 1S6QA 4NXZA 2XCPA 2ZD1A 4CIEA 4DO9A 8ICZA 3AUOA 3LWLA 1TVAA 4FLTA 3RMDA 5KFJA 4ECXA 1BQNA 4W5RA 5KT3A 3DOLA 5HMMA 2W9MA 2JEIA 4IR1A 3H7IA 3SPZA 4F92B 7ICOA 5IIOA 5KFNA 4YFUA 3HPHA 1JKHA 2YKMA 4CGFA 4DL5A 3KTQA 3GDXA 5KFPA 1XS9D 1S97A 2J6UA 2HHQA 4QZGA 4ED1A 1KFTA 1C1BA 4M3UA 4P2HA 4ZH4A 3Q8RB 8ICSA 1RNHA 4EBCA 2IA6A 3OYMA 3MEGA 4R64A 4I2JA 1S0MA 3C5GA 4UB3A 4QAGA 4QWCA 1CXUA 3JPRA 4ZHRA 1RDBA 2B6AA 1ZQIA 1WSFA 4LH5A 4M6WB 4RZRA 4DTJA 5KT4A 4ED8A 4DMNA 5C5JA 4W5TA 1LWCA 5KT6A 3QNOA 1VK0A 2JGUA 2EX3A 2E6LA 3ISBA 1ZQOA 1KVBA 3BQTA 2PFPA 1L3TA 2BHNA 4PHEA 2AGOA 4PH5A 1DGSA 5HHHA 4F5OA 4CJQA 3IRXA 3KLFA 4J9KA 1T3NA 4YR0A 2IBKA 3LAMA 2XC9A 1WCNA 4H8KA 4M47A 1V9PA 2OPSA 4KO0A 4J9SA 3TAPA 2XHBA 1IH7A 3NF8A 2ALZA 9ICOA 4O0JA 3LK9A 4XUSA 4C8OA 8ICBA 1RTDA 2Y1JA 3AVGA 4G1QA 4M3ZA 4DTOA 1X9SA 1TL3A 4MFFA 5KFTA 4E89A 3NF9A 1NOMA 3MDCA 4W5OA 9ICQA 3GV5B 7ICGA 3H8WA 4UQGA 3LPUA 5HROA 1FKOA 3HW8A 1JLQA 2JZBA 1KEJA 4F5NA 4DL2A 2F96A 3HM9A 4DSEA 4BDYA 1QLNA 2A1SA 4DL4A 3T1AA 3UPQA 2KQ2A 5FDLA 1SUQA 2ATQA 1WSEA 3NFAA 2IC3A 1WSGA 1K1QA 1BCOA 5KFHA 1FK9A 4BDZA 5L1JA 2P6RA 1JN3A 3V1OA 4AHSA 3MBYA 4KREA 1U48A 1ZQBA 5DB7A 1BQMA 4DTSA 2XGPA 2KFZA 5D3GA 5KFIA 3WNEA 1Q8IA 3NDKA 3BDPA 3SV3A 1RTJA 2BQRA 3OYNA 4ED3A 2BPCA 4I9QA 3CM6A 3OGUA 1G15A 3OYEA 1U49A 3AVFA 3MXJA 3SYZA 4M9NA 4RPZA 2HHSA 4CGGA 2W9BA 5J2FA 4IQWA 4CFCA 2VA2A 4J2DA 4X5VA 3L2RA 1RT3A 2JLEA 3QZ8A 4CFBA 3V4IA 1WNSA 5CYMA 3H8SA 4RW4A 3K57A 4ECQA 3HWTA 5HRPA 3ZDBA 2E4LA 1JLAA 5E41A 1S1UA 4DS5A 4B9MA 4DSFA 2X78A 5J0RA 4FJGA 2OA8A 4AHTA 3IG1A 2JEFA 1T8EA 4KTQA 5KFAA 4RQ4A 5J2NA 4B9VA 1JX4A 4RT2A 5J2IA 4CJKA 2VG6A 2W8KA 4AH9A 1S1XA 3NGDA 3ZCMA 5J0UA 4F91B 2J6TA 4PA1A 3UXPA 4TUPA 1JIHA 4FJXA 1TAQA 4CGIA 3OS2A 4ECUA 1ZQVA 2OPRA 1S0NA 4K8ZA 3C1ZA 4FZZA 3C1YA 4M3XA 2ZJAA 5D4BA 3P1GA 3SUPA 4AHVA 2ZTCA 5J2KA 2DFLA 4CEZA 2QKKA 2QKBA 3LZJA 1D9FA 3RJIA 4QW9A 3LP0A 4DOBA 2V4QA 4DTMA 7ICKA 2BGWA 9ICMA 4ECZA 4KB1A 2KW4A 5KT7A 3SV4A 4KLOA 4FZYA 4PGYA 1C0MA 3HVRA 2BCRA 2GUIA 3AV9A 3V1QA 2UVUA 1EXNA 3QERA 4FJJA 4E7JA 1CLQA 4DQSA 1BPYA 2AGQA 2WOMA 1RYRA 4JLHA 8ICAA 2B4JA 3ZT4A 1ZQPA 4O5BA 3ALYA 2UVRA 4NLZA 2W9CA 2HHTA 4CHZA 8ICLA 1NK8A 2PFNA 4TUSA 2XY7A 2YHAA 3ULDA 3GQCA 4B9LA 3ZT0A 2HW3A 3MFHA 1YT3A 4O5CA 3HXMA 4NM2A 1TK5A 2X6SA 4J9NA 1GOAA 3PMNA 1WSJA 3GFKB 3VQ9A 2HVIA 5KGWA 1J54A 3VQ7A 3N97B 8ICKA 3AVMA 3G0ZA 4AHCA 4MFBA 1XI1A 3KLGA 4DOCA 4B9SA 2ISPA 3H40A 1BGXT 2VWJA 4NCBA 3I0SA 1SZPA 1KFDA 1ZBHA 4KHSA 1T03A 3KHHA 4YFKA 3KJVA 2ASLA 1HYSA 3BQ1A 8ICXA 2FBVA 4JS4A 4ECWA 4HCCA 4YVZA 4E0DA 4KLQA 4CJEA 5DMRA 3C21A 4DTUA 5DQHA 1JLCA 1RBRA 3Q8QB 1RBUA 3GIIA 9ICNA 3OY9A 1TKDA 3OSPA 4BGDA 1NK5A 4CFDA 1SKWA 3U3GA 5KFRA 1UA0A 4E1NA 4OLBA 3VQ5A 5KFDA 4C8MA 5IIMA 3THVA 7ICLA 2Y1IA 4CJ4A 1RT4A 4FJHA 3FFIA 1PZNA 3V6KA 2MAXA 4PPXA 2A1JA 4OLAA 2KFNA 3EYZA 3T3FA 4UAZA 5DBCA 4QW8A 1TAUA 3G10A 4YP3A 4YNQA 3V81A 2R8GA 1ITGA 3MFIA 4ED7A 2OYQA 1NK4A 2D0AA 3NH1A 5J2PA 5DGAA 3RJGA 4FLYA 3EPIA 2HHWA 1ZQTA 3NE6A 3L3VA 1UOCA 3FYHA 7ICNA 2AQ0A 4Z4IA 3PR4A 3ZSRA 4GLXA 1RYSA 4YQWA 4CEBA 4CEOA 5KFLA 3AVLA 2ZQBA 1Y97A 4KHUA 4N76A 4F5QA 1GOCA 4MFAA 4Q0BA 4DTNA 4FK0A 3S3NA 1RBVA 4O3QA 4YN4A 3DI6A 3OYDA 2RDIA 2PXIA 2OZSA 7ICRA 3MABA 3TAMA 3D45A 1S10A 3KK2A 3EY1A 4I27A 4P4MA 5J0YA 4GXIA 3QNNA 4CESA 4DTXA 3C95A 3RRHA 1XSNA 4Z6FA 5IINA 3K58A 4MEYA 1TVRA 3EWAA 3VA3A 3SQ4A 4R5PA 5KFZA 4YR3A 1KSPA 3TWHA 5HP4A 1Y88A 1BPEA 4MFCA 2M9NA 4DLGA 3SUOA 2B5JA 7ICPA 1B9FA 3JPNA 1SKRA 5J2JA 3GV7B 3ZSYA 4ID5A 2HHUA 9ICRA 3MAQA 4M42A 3F73A 5HMLA 5DG9A 4QWAA 4BWJA 4EP4A 5KG6A 4FJIA 3LP1A 3CM5A 4O5EA 3QEIA 4I2IA 3I8DA 2V4RA 2WONA 2F8TA 5CHGA 4RPXA 4OJRA 3RJHA 3L2VA 4ZTFA 2XY6A 4Z4HA 1CEZA 2NRWA 3M8SA 2FLPA 4B8CA 3AVBA 5DDYA 4IR9A 3CQ8A 3NH0A 7ICJA 3V9XA 2FPLA 3HSTB 1KVCA 1LW0A 3ZSQA 4E7LA 5EOZA 3H4DA 4QZBA 5D49A 3VN5A 3MXIA 1S1WA 1BISA 4FO6A 4YD2A 3HPGA 2HNYA 5I42A 3T5LA 5I3UA 3ASMA 4FJ7A 1ZQAA 1IG9A 1ZQHA 3C23A 3I0RA 3L3UA 3JPQA 5J0TA 4RUAA 1C1CA 7ICQA 5EWGA 3AVAA 8ICMA 4F50A 1HJPA 1D8LA 3RMAA 1BI4A 1SL0A 1RCHA 2FLNA 1ZQRA 1O1WA 4H4OA 1B22A 4OPKA 4F8RA 9ICBA 4QWDA 1WAJA 4Z4GA 3RAQA 1RXWA 3PUFA 4DQPA 3OYCA 1ZQUA 8ICJA 1UWBA 2ZTEA 4DG1A 4DEZA 4J9PA 5DLFA 4LSLA 3K5MA 1X2IA 3OYKA 4HHTA 5KFCA 1SV5A 4YMOA 4H4MA 1KCFA 3IS9A 1TKZA 4F4YA 1YTAA 3S3MA 1RDAA 4DFKA 4CJRA 4J9RA 1GOBA 1BL3A 3IM1A 3BGRA 4PUOA 7ICUA 4I2QA 2RN2A 4IFVA 4JV2A 4GC7A 4FS1A 4FLVA 8ICWA 5KG2A 4KITB 1CXQA 1FKPA 3EPGA 1NOZA 3TANA 4NLKA 2Q3SA 2A1RA 3K5OA 3U3YA 3RRGA 3KK1A 2XGQA 2YNGA 4E3SA 5KTQA 3AU2A 4LZDA 4O44A 9ICEA 4GW6A 4CK3A 4DL6A 4I2DA 2YNFA 5CP2A 3V6DA 4P4PA 3K2PA 3LAKA 4KRFA 3GV8B 2FBYA 5J2QA 4M6WA 1ZQQA 4R8UA 1WAFA 3QIPA 2C22A 3NGYA 3QETA 3SQ0A 4FBTA 1EKEA 3B0YA 1EX4A 2I9GA 4EZ9A 1NK7A 5DG8A 4R63A 2HVHA 4UBBA 4GMJB 3V9ZA 3V7JA 3RB4A 1B9DA 1CUKA 4QZFA 3MGHA 2Q0ZX 5TZVA 3PNCA 2PFQA 2OPQA 2WTFA 1NJYA 4O9MA 1A5XA 4O0IA 4E1MA 2FPKA 5DB8A 1KFSA 4LVSA 4IG0A 1KLNA 4N47A 3WNFA 4CJPA 4W5NA 3MGIA 1S1VA 4B9NA 4KLGA 9ICXA 5SZTA 1DTTA 3LZIA 4FK2A 4NLNA 4R65A 1JMSA 2OPPA 4FM0A 3DLHA 3HO1A 3E2EA 3HPOA 4O4GA 1LB2B 4EZ6A 3VQ4A 3PR5B 2HHVA 4RW9A 1A76A 3ZSOA 3RB3A 1A5WA 4M3RA 4UAWA 3KKSA 4BE2A 4R8UB 4ELVA 2NRTA 3PO5A 5F9NA 4RQ6A 4K8XA 4Q5VA 4ELUA 1BVSA 4XA5A 2ZE2A 2ASJA 1IKWA 3T19A 3QINA 5KRSA 2HMIA 3AO4A 2XCAA 4KLLA 1CZBA 3OYFA 5KGXA 3GIJA 4CCHA 1C0TA 2BR0A 4CF8A 4BE0A 7ICIA 4O5KA 1N6QA 4KMUA 1XWLA 3PX4A 2HHXA 1QE1A 3OS0A 3MR3A 2OWOA 4F2SA 4DL7A 3CFOA 1ZETA 3NH2A 2BCUA 2IHMA 4NYNA 4CEDA 3NCIA 2V9WA 1MU2A 4Q44A 3MECA 2Z1IA 4Z6DA 4DSIA 3ZD9A 4UBCA 2C28A 4R66A 2A1JB 4QZ8A 5FRMA 3SI8A 1RDCA 3Q8SB 5KG3A 3JPOA 2BDPA 1Z25A 3DOKA 4IKFA 5CZ1A 1WN7A 1L3UA 4F4WA 3DM2A 8ICYA 3UXNA 1ZQNA 8ICEA 1ZQKA 3O3GA 5D46A 4RQ3A 5J0XA 3OJUA 1VRUA 4GXJA 1BIZA 3PV8A 2HB5A 1DTQA 2LSNA 4RT3A 4KV8A 3NF6A 4RW6A 2PZSA 3HVTA 3T5KA 1XHZA 2FPMA 1NK0A 1QTMA 1Z26A 1LWFA 4GC6A 3QEPA 3V7LA 3TR8A 5KT2A 3M8RA 9ICAA 2MUTA 4L8RB 5DK5A 2PYLA 4Y1DA 8ICQA 4KLSA 1S0VA 3RB6A 5DQIA 2FMSA 3AA4A 2KN7A 4Q8FA 3WNGA 2D0BA 3VQDA 5KFKA 2O4GA 2IHNA 2VG5A 4YD1A 1B43A 3RH4A 4CF0A 1NJWA 4NYFA 4JWMA 4I2CA 4M3YA 3JPSA 3C2KA 1QS4A 4TSXA 3OHBA 5J2CA 4FJMA 5KG4A 4MQ3A 4FLUA 1IKVA 3L2UA 4HCBA 4DFPA 4TUQA 3A2FA 1X9MA 1ZBFA 1VSFA 1QSSA 4FJLA 1ZQLA 1BHLA 1KVAA 3C6TA 3TQ1A 1AROP 1Z00B 1ZBLA 1REVA 2PFOA 4FS2A 9ICVA 1VRTA 4FVMA 4RQ8A 1HPZA 3P83D 4M3TA 4J9OA 2GWSA 1VSHA 3BQ2A 4DQIA 1I3AA 2JEGA 3SJJA 5DG7A 5HP1A 3RJJA 1X1PA 2R7YA 4J2EA 4M3WA 1L5UA 2G8WA 3AO2A 2W8LA 3PMLA 3HT3A 1RZTA 4J2AA 1EP4A 4PGQA 5J0SA 4FLWA 1ZQCA 1RT7A 5KFFA 4O3SA 2R8KA 3ORYA 1KTQA 1VSDA 3VA0A 2C2DA 5EWFA 3BQ0A 1IO2A 4XIUA 3QEVA 3QEXA 1U4BA 3LWMA 2KZMA 2P51A 3HX0A 5HHIA 8ICTA 2PI5A 1ZQDA 2KZ3A 4IFYA 3EZ5A 1W0HA 1R0AA 3OYJA 5J2EA 2DFHA 2GBZA 4Z6EA 2PY5A 3KD1E 2P1JA 4Q45A 2F1IA 3V7KA 1U47A 2FC0A 1WLJA 1ZYQA 1TK0A 4P4OA 4Z4CA 3LP2A 1COOA 5L1LA 1KLMA 2DFEA 1C7YA 1T05A 2G8KA 1L3SA 5JUMA 5IILA 4CJ5A 2JEJA 3C5FA 4EEYA 3K5NA 2P5OA 2DPIA 5CR0A 3P5JA 1ZQEA 1BI4B 1BPBA 3PW5A 3MXMA 1JXLA 4JRQA 5DB6A 2FLLA 1XHXA 2GV9A 1YTUA 4CHYA 3T5HA 2FBXA 4EBEA 4CGHA 3C2MA 1S6PA 5KFBA 4M9LA 4BE1A 4KB0A 1S76D 4QZDA 2BANA 3O3HA 4XQ8A 1S77D 3F9KA 2BGGA 4RQ2A 4CEAA 3V9SA 4EYIB 4RPYA 1VSIA 1UAXA 3MEDA 3ETLA 4J9MA 4FW2A 2W9CB 4CHNA 1CZ9A 3SQ1A 2VANA 3IHQB
chains in the Genus database with same CATH superfamily
4MKYA 4PHDA 1I5OB 4Y0FA 1WACA 3QJJA 2JZBB 1I94K 3HFKA 2R8IA 1RTHB 1SJ1A 4Z2XA 1T3VA 3I4HX 1XSLA 4CH1A 3TYTA 3T9NA 4O3OA 3ZDAA 2ITGA 4CK1A 2CQHA 4DWIA 4UOHA 2G8HA 2GMHA 1VBXA 5AQPA 1TL7B 9ICGA 2GC8A 4Z6CA 1BPDA 4NASA 3G8TA 4NLRA 2ZFHA 4M0AA 1TL3B 3KJNB 4ZPTR 9ICIA 3A0HU 5C0YA 2BW2A 4OV1A 3HHLA 3SFUA 1Z1VA 2ZZMA 3QUTA 4XEIA 2UXBJ 2X1FA 1S9GB 1RTJB 4ID5B 3EE8A 4CLFA 1N36F 3PW4A 3NCRA 1YITS 3ISNC 2F8LA 3IWLA 5A2QU 3BZKA 2DGSA 2G07A 3L6QA 4CNQA 3AVCA 2VGNA 4DU3A 1KS2A 2IC3B 5AM3A 3FRZA 4K4ZA 5AZJA 1PYOB 5HMXA 3PW0A 1UMJA 5AQHA 4OZ5A 4PG6A 3TUZC 4F4XA 4JI7K 3UE5A 2IGIA 4PEOA 2F4FA 3M1YA 3VVUA 4I2EA 5BYSA 5EE9A 3LPTA 4Y34A 5A8RB 2FUG9 1Q16B 4HUEA 5CYQB 1X5SA 4KIAA 4FWRA 5ALHA 2XMUA 1KQQA 2HOFA 1O03A 3CEDA 4PG4A 2HQGA 2NYIA 2BPFA 4CZCA 3UKRB 3QEAZ 1VK8A 1I39A 2PE8A 1TKTB 1CRXA 2C42A 2Y9HA 2E1CA 3HSDA 5JLHA 4UUWA 2ZIUA 4WYWA 4ZPAA 4KH5A 1A6SA 3HVAA 5T7LA 4OHWA 2OAUA 4LBIA 3V1RA 2RPIA 4PXDA 2GO8A 1MG7A 4RQMA 3VMFB 4CJLA 5AQMA 3SNNA 3NBPB 1X0FA 1QVFM 4H4KA 3TWZA 2KV2A 4FF3A 1WNEA 1OKJA 3DXKB 3M30B 3LVWA 4C2MA 5D0RA 4FWMA 2UP1A 2W25A 3HK2A 5DQGA 1H38A 1MLAA 3QFUA 3FGUA 1UZHA 1KAXA 4HUGA 4FJ9A 2I7PA 2DGQA 2IJRA 4XPEA 1ZXIA 3PLAA 4HTIA 4ERDA 4CYUB 1TKZB 3H08A 2H5XA 4OZNA 2D7SA 1D4XA 2FVCA 1JMTA 4USMA 3OHRA 4Y1CA 1YSJA 1SQEA 2MKYA 3BGRB 4I2FA 3DYAB 1KBUA 5E2QA 3SUQA 3DGPB 2QMXA 2D3OR 4F3QA 3MECB 2GEMA 2UU9J 2BXJA 4KJIA 4EENA 4TNOA 4KN7A 4GKJF 5CQGA 3BR8A 4ZPCA 4DPXA 2BCSA 2ACYA 2EXUA 4ED2A 2XMVA 4CLTA 3PRBA 7ICFA 3PHTA 4DU4A 2QA4S 3IM9A 4IRDA 3RW7A 2R7RA 1FRIA 3OPXA 1RT1B 5AKHA 4JI1J 1YJ9N 1F5BA 2EFQA 5D0GA 1L3KA 4YB7A 2FJBB 4YN3B 3UN5A 4I69A 3FCHA 1SKSA 1Q78A 2E5SA 1F44A 4ED4A 4K0KJ 2JX2A 4ES2A 3RBZA 3VEVA 1K5OA 4ZK7M 5JRTA 1IR2A 3FNNA 4RUCA 2LQ9A 1VQ9N 4X4PA 3HMJG 3PEJA 4RQ0A 2V34A 4Z0UA 3BYRA 1VSMA 3BKTA 2M0GB 4A46A 3HJFA 1L3VA 3NBPA 4YMEA 4JK9A 1IM4A 1ZQXA 3K17A 3I4PA 2V6AA 2Z2ZA 1ATRA 4X64K 1DQ8A 4K42A 2ZIWB 3DLGA 2R4FA 5CAAA 4B9QA 3OFFA 3THXA 2H3VA 2ATLA 2CJKA 1IBMK 3HD2A 4DR6F 4KAZA 1N34J 3WXMB 2NQPA 1Y64A 2CPRA 2LQ8A 4M63A 4TY8B 2HCFA 3KHRA 5AI6A 4TU7A 3H3NO 4LR7A 5T7BA 2DXFA 1HHQA 4AT1B 2YWFA 4OKEA 4RQ7A 4WCEQ 1ZBIA 2XS2A 1MQ3A 5K9FA 3V9UA 5ALJA 4XH4A 4Y2SA 4JV0A 3CB4A 4J9VA 5M2UA 3P96A 2E2OA 2A3JA 3CJRA 2H5IB 2IDOA 2B9YA 2B4UA 2C2ZB 3IG1B 4EI2A 1VQPS 4B1WB 4XK8C 2F76X 4PWDB 4RUBA 4QOZB 2UXCJ 3EEQA 9ICCA 1S6PB 3ZX3A 4TY9A 4B6JA 3LYSA 3QZ7A 1HMVB 7ICTA 3MMBA 3VQQA 4NEZA 4ZPVR 2YWHA 4CJTA 4OPAA 4ID1A 4YXMA 3MAHA 2ASOA 3OJSA 2E20A 1RISA 2KHVA 4M9HA 4H5VA 2DKXA 3JSMB 1HA1A 6FD1A 1U09A 2BKOA 2J9EA 2G2YA 1RBSA 2QMWA 4PXBA 3H90A 1XU4A 4AHRA 2Y9TA 9ICLA 5HRNA 4GXKA 1DXSA 5ELZA 4ANCA 2KLAA 4AQYJ 2W42A 2K2PA 4FLXA 2GTDA 2KK0A 1PK1A 1FTCA 1IN0A 2B5JB 2CN1A 5AXKA 4IOAQ 4P2FA 4GIBA 5GAEU 1AW0A 1DGKN 5DBAA 4LC9B 3ZT1A 2FGCA 4AILC 2LQ5A 4TU9A 3RH6A 5AE2A 3J7AP 4B17A 2FF3B 2YPZA 1ZBUA 4I2BA 4QIGA 3DRRA 3CWJA 1VQ8S 2ZUBA 2RRBA 4C8LA 2MLXA 3JSMA 2KN4A 2B9WA 2ZJRQ 2VL1A 4DX6A 4IOBA 4DV2F 1CQMA 4I2PA 1HBNB 4B8AB 4JEPA 2HWIA 2O8EA 9ICWA 2ZHBA 4JI5J 2YKNB 3M2VA 8ICOA 2DCUB 5KAFU 1ZA2B 3OW2R 2F1HA 4LF6K 1DLOA 4ECYA 5ALVA 2Y0SD 3ADAC 4DV6K 4FJ5A 1JL1A 4ZVQB 2CADA 3ILLA 2KYXA 5IXUA 3KLEA 2Q1NA 1ZJNA 2YKOA 1HX1A 5LSOA 1SV5B 4K5RA 1U9LA 4PHPA 4HI2A 1NKEA 1U04A 4EP5A 1Q8KA 2U1AA 3AM9A 3X1LB 3DRRB 4N41A 4OHYA 4K4XA 2R2RA 1VDHA 3L8BA 2F3NA 2E1YA 2GNKA 1HRHA 2WFBA 4BR5A 1YIJN 2DY4A 4P0QB 3N28A 1SH2A 4YB1P 4USUA 3DGVA 1ZD3A 4P74A 3JB9k 2FSJA 3MOZA 4DPWA 3VESA 2B8QA 1NSQA 4TN2A 5KG5A 1QHTA 3D1HA 4YMMA 1GXUA 5JJBA 4PL8A 1SCJB 3T9ZA 2Z2LA 4OHVA 3TA0A 5GAHU 2VBYA 1WJ9A 4JN4A 3FRYA 3Q8PB 4QWBA 2KJ9A 2HFUA 3IAYA 5EHHA 2COLA 5T7LB 5KFGA 2NXCA 4YXJA 3CJBA 4KO0B 1ZQ1C 4H4KC 3K89A 2V63A 4K4GA 4KLMA 2VFVA 1TYQA 4ED6A 2OSQA 3D0IE 1HJRA 4I9LA 4PWUA 3AD8C 2E8PA 2LDIA 1YVNA 2DHGA 2HI0A 3MPWA 2PI4A 5AQKA 1BG3A 4HL9A 3BO2A 3LOUA 2PIIA 1TKXA 3R5GA 4CK2A 4OYMA 3ZT3A 3I0SB 1N60A 1TVRB 2YKQA 3ONQA 3M2VB 4CP5A 2LHTA 1A77A 2B4PA 4WU3A 4DU1A 2WVCA 3PACA 1FERA 1QSLA 5HP1B 4RG8A 3WZ0A 4JI1F 1VQ6S 4YOXA 3KMSA 3DU5A 3C2LA 1F6TA 3VQBA 1LV5A 4RNMA 4L75A 2G08A 3WQUA 2CXYA 3UO0A 1OXJA 3A8KA 1VR6A 1ZJMA 2RVJA 4AUKA 1GLAG 3CERA 5C42B 1TFRA 1EAYC 4FKXA 2E8MA 5BYQA 4AQYK 3RR7A 4DLEA 1RA6A 2CVEA 5ALRA 1FJGF 4PL2A 1GXLA 4QJFB 2E5GA 1N6QB 4B9UA 3W2WA 1KD1T 5K14A 3GFXA 2L3MA 1FXDA 1RZMA 2UXBK 3QJPA 3CJ2A 4JV5F 5CZ2A 1O51A 4CEQA 3RJFA 4JRPA 4JWNA 2G2OA 3AARA 3NAEA 2AZ1A 2MJUA 2NZCA 3TQEA 1RHJB 2QA4G 5LMUF 3B0XA 1ZQZA 3MEEA 1RT3B 3ENBA 2E8NA 3PX0A 1VSEA 4OJ5A 4CZEA 2KZZA 2C2EA 4UAYA 1HQ2A 2P9PA 4CF2A 3ZZYA 1CQNA 3OVNA 4X64F 4LSNA 2P9LB 3R6LB 1GMWA 2CGJA 1NG9A 4J9LA 5FLXU 3FSXA 1HUZA 2VWBA 5C2DA 5CH7B 3T1HJ 1K8AO 3RU0A 5BOMA 2UU9K 9ICUA 1EKSA 5DDOC 3AA2A 2WAQC 1K73O 3HVTB 9ICSA 4WPAA 5J0PA 5DBBA 1VIOA 3GG0A 2AJ2A 5E0OA 1W25A 2MSNA 3UQ0A 1JLFB 3GIMA 2IOFA 4ZVFA 4OGEA 1VMBA 2B21A 2ZWHA 1J9AA 5AI5A 3A5MC 4QZ9A 8RUCA 3GILA 1HHSA 1RU1A 1NKBA 3TJAA 4C80A 3BBBA 1SGGA 4BXOA 3ZZRA 2AKWB 3L09A 3AAQA 3MTJA 4X4TA 2OXOA 1BOTO 2ILZA 3MM9A 1D5AA 2O5DA 2ZTDA 3M8QB 3D1OA 4HACB 4URSA 2HBLA 1CJTB 2WMMA 3CFPA 5E3CA 1U6FA 3E1YA 4H0XB 4B3MK 3LUYA 4CWBA 3THXB 4OI1A 1HW9A 2RQMA 4DOAA 8ICFA 4CJVA 3VAIA 1YJ9S 5BXIA 4IJAA 3RWUA 3N79A 4DJBA 5T14A 1ZRMA 1ZXOA 5KAKA 4M41A 4JV5K 3C15A 3AOBA 1RAIB 4G6VB 2YTCA 3QFHA 4O8UA 1CJUA 4X84A 4FWKA 1PVPA 1JLGA 2ZDOA 2WF8A 2MGZB 3AVNA 2I1QA 1SL2A 4CJUA 4BRCA 5C24A 4RU9A 1C0FA 4DV2J 2YV0X 5HRRA 4I6YA 1U1KA 1PC4A 1WKJA 2IM3A 4KI4A 1XC3A 1UVIA 2NUHA 3C16A 1XNRK 3RYLA 1GEHA 4FW1A 1S99A 2ZBCA 4FZXC 5CYQA 2Y1LB 1S4FA 3FKBA 1S6QA 3OL8A 2B3TB 2ZD1A 2J0QD 2QB1A 4CIEA 4DV7J 4DO9A 2QFJA 4BGBA 1TVAA 4FLTA 3H42A 1ITPA 1ZD2P 3RMDA 4ECXA 1BQNA 3MDQA 3ZTPA 4F9OA 2R7XA 1N52B 3WKEA 4Y2JA 5HMMA 1VQYA 2W9MA 2FDNA 4BJQA 2WVFA 3HTVA 2MXYA 1NMDA 4D3HA 3M6WA 5IIOA 1IBKK 2IM0A 5B0BA 4LFCK 2YKMA 3ZTRA 4CGFA 3NGKA 3E66A 3ULEA 1WORA 3UKUA 2J6UA 1BWFO 1H3DA 2E5LK 1KFTA 1NGAA 4ZH4A 5C24B 2HS4A 4FZMA 3Q23A 3AOCA 8ICSA 4X4QA 1J2NA 4KR0B 2IA6A 1PK1B 2D3DA 2I6XA 3U8XA 1S0MA 3DDIA 1RYUA 4BR2A 1HPMA 2PEHA 3C5GA 4GVLA 4QAGA 4GVEA 3JPRA 3NS7B 1RDBA 2B6AA 2YQ3A 4KQZA 5B0FA 3QIPB 4DTJA 5KT4A 4DV0F 3D2FB 4IQMA 1EQ0A 2RH3A 4A47A 3J81U 5B5EU 4OJLA 4FZVA 5AKGA 3ISBA 1U02A 2EX3A 1GMWD 1NWKA 5E26A 3ILJA 2PMZC 4OYOA 2BHNA 4WZMA 2ABYA 4WP9A 3THTA 3VF0B 5D0EA 3KLFA 5JVHL 1T3NA 2LM4A 4EELA 1VRUB 3NRWA 3EZWA 3CCQS 1HBUB 4OZ3A 2B4VA 4BR4A 2RJZA 4CJ7A 2XHBA 2HVEA 5F3ZA 3NOGA 2ZZTA 4YY3J 5LXYA 3VERA 3NEKA 3AVGA 5EX3A 4B1XB 1X9SA 4TYBA 1NCLA 2VU5A 4BC5A 2O01C 5KFTA 5GAHI 3IR7B 4U9RA 2AWZA 3VQTA 9ICQA 2VG6B 2ROEA 2X7IA 1I94F 5BR9A 5HROA 3LPUA 1KEJA 2JZBA 2QX0A 3M8ZA 2F96A 3HM9A 2KL8A 2VBXA 4W90B 3QT7A 3P5BP 3VAKA 5KPTA 1SUQA 2EFPA 4P52A 3NFAA 2W2PP 3O3LA 2H54B 5L38A 3CJ1A 3SSRA 2OGUA 3F9MA 1K1QA 3JTOA 2HBRB 1BCOA 2W2OP 3EGZA 5I9EB 1FK9A 3NGSA 4YDDB 1WYGA 5EUHA 3ETMA 1DZ5A 4AHSA 1ZRNA 1U48A 5F8GA 3NASA 2OD6A 4DTSA 3C14B 2RHSB 3L3CA 3H5XA 2MKKA 3AT1B 3VGUA 2F7VA 3TO8A 2J4RA 2RF2B 4AL6A 3OYNA 4ED3A 4RR5A 3OYEA 2ODGA 2H1YA 1PKUA 3HSZA 1T3OA 2DR8A 4C0ZA 3SYZA 1UEUA 4M9NA 3D2EB 4CGGA 5AQXA 2HFZA 1YF5L 3PM9A 1T9YA 4JKGB 1FKOB 4BRQA 2VA2A 3O1WA 3IRXB 3OTEA 3L2RA 4OPHA 3QGIA 4EAHD 4CFBA 1DKGD 1WB9A 1Z4OA 1VDVA 5AI0A 1JRPA 1S7HA 5B0DA 5DRKA 4LSNB 2ZJQL 1TQLA 1H6KX 2O8EB 3KLIB 3AJ1A 1MWKA 2X78A 2OA8A 4RU2A 2E1PA 2JEFA 3MAAB 2KT2A 3MN5A 1LKYA 2XZDB 1F2HA 2DXDA 3BYPA 2FE9A 1N36K 5J2IA 2VG6A 3MEEB 2FJXA 3POTB 4E8UA 4DV3F 4OYXA 2MYFA 3ONNA 4TUPA 2W03A 1E4GT 1ZQVA 3BF3A 3EUNA 2FVSA 3WC0A 5D4BA 4H54A 4OD0A 2RAQA 3OR2A 1WOOA 4BC2A 1M1KO 1D9FA 3ICLA 3QYYA 3WHIA 3DLLQ 3VZHA 4LF9J 2JVOA 7ICKA 1PYSB 3QMLA 3GYGA 5KT7A 1FFSB 1TZ0A 1RBOB 4PGYA 3DHWC 1C0MA 3I82A 2BE7D 3W5XA 3NXZA 1MWMA 4KT0C 3N7SC 2ADCA 1Q7YT 2UVUA 2PGCA 4GV6A 5D0HA 4DQSA 1VCTA 1V3ZA 2OCEA 1RYRA 8ICAA 4JLHA 2B4JA 3FMWA 4FNIA 4O5BA 5AFUH 4RUHA 2UVRA 5HVHA 2PFNA 3S8SA 2XY7A 2YHAA 1TELA 3OXGA 5K8NA 3GQCA 3ZT0A 4BLGA 3PSIA 5HJYA 2HURA 3F41A 1WG5A 3GFKB 2DYAA 2P9KA 3N97B 1YJUA 4OLOA 8ICKA 1FT8A 3G0ZA 3LM2A 3T1HK 1DTQB 4MFBA 3TVZA 2NXEA 4US8A 1EZZB 4B9SA 4B3RK 1BGXT 1KFDA 1ZBHA 4CBUA 4OQJA 1MMNA 4NLTA 1S3XA 4JI3F 5A0LA 8ICXA 1VQ5S 4JS4A 1P9QC 2HIQA 3KLEB 4UARA 5DMRA 3PHEA 5DQHA 1JLCA 1Q4RA 3ZZTA 1XQIA 4DV3K 5G0RA 1ULRA 1VQ4S 1K0TA 2DNQA 3UVJB 1NK5A 4CFDA 2RD5C 5KFRA 1UA0A 4E1NA 3N6NA 5KFDA 7ICLA 2WFAA 1YRTA 3VAHA 5F8NA 1RT4A 1J27A 5C25B 1PZNA 3V6KA 4PPXA 1C1BB 2KFNA 3JQKA 4K2JA 2ZH6A 5CZVA 2R8GA 3HCXA 4AE5A 3MFIA 4UAVA 3C15B 2N4DA 5G4DA 1JB0C 5J2PA 4JI8J 3EPIA 2HHWA 1FI4A 3D6FB 3ZSRA 4GLXA 4YQWA 2BH1A 1EO1A 4YOUA 5KFLA 2HVDA 2E5LF 1Y97A 4KHUA 3EL2A 2W54A 5A0YA 4DV5J 3D2FA 3WK7A 3M32A 3CO9A 1LWCB 4FK0A 1L6NA 2FJDB 4UT4A 3BPDA 4PPZA 4NLSA 1KVIA 3OYDA 1WC5A 4WU2A 5G0RB 1XMBA 2ZH8A 2DF4B 3D45A 1C0GA 4ZMMA 3GWCA 5BRHA 3CJ0A 4P4MA 3F53A 4GXIA 3FBEA 4L3NA 4PL1A 1T6CA 2DJWA 4ZCIA 3L4PA 4M5GA 1Y0HA 1KHVA 2DNYA 1NRKA 2ZC3A 4OYIA 2VQEK 4RJVA 4Z6FA 1V38A 2OFGX 3VA3A 2J0XA 2CPJA 1VQKS 2B5JA 2I0XA 4RCHA 4FF1A 3D2NA 3GV7B 2HHHF 3FM9A 3KLVA 3C7NA 2K8BB 2ZH9A 5BR8F 2WC9A 4M42A 5DDRC 4OCZA 2J0SD 4H5NA 2GZOA 3F73A 3PYEA 1J5EK 2LMRA 3UPFA 3I8BA 1M5VC 2KOBA 4BWJA 2JOQA 2KHOA 5KG6A 2XYHB 3LP1A 4DI6A 1WDDA 2D6FC 3FBBA 3IXQA 2V4RA 1VHIA 2WF5A 5CHGA 2ZEJA 4OJRA 3RJHA 1OY8A 2Q97A 1BO5O 4JKEA 4USHA 3BF1A 4URGA 2XY6A 1CEZA 1JXVA 5LJWA 3M8SA 1VBYA 2NXJA 3ZZZA 4B8CA 5ETPA 3CQ8A 5F3TA 3TVKA 4FWLA 3KWMA 2A1BA 1HD0A 3V9XA 3HSTB 2YWGA 1DT9A 4C7ZA 2IPOB 5EOZA 4YY3F 4IOAL 2DH9A 3U4LA 3G6ES 4DV6J 4FO6A 1RA7A 3ZX2A 4YD2A 1VHXA 2IIRA 3PZPA 2E88A 3CJTA 4W98A 2FC8A 5HANA 1T05B 1IG9A 2P9PB 2QSWA 1DURA 2JWLA 2EDUA 4NJ8A 3ED5A 3O6QA 3B8AX 3AVAA 2XZTB 1ZOTA 4ILMA 3RMAA 1SL0A 5ALEA 2H3GX 2YHXA 1B22A 5AXLA 4XH1A 2VQFJ 4IH5A 4OPKA 1XR6A 3G82A 4Z4GA 3H0LB 3GFZA 3BS5A 1BA0A 3PUFA 4DQPA 2HSTA 2M3DA 4WIQA 4W92B 1HWKA 4DG1A 2XMTA 1HR0J 5KFCA 5ALKA 3QU2A 2CJXB 1VISA 4CRJA 1CJKA 2W04A 4M5HA 2JLGA 1RXOB 4BRAA 3IS9A 2U2FA 2YB1A 2A42A 1SUQB 1KAZA 1FFWB 1GNKA 2QO3A 2ZUAA 3CHWA 1LW2B 4G9BA 1GOBA 3IM1A 5CYMB 2P9EA 3BGRA 1HARA 2BJ9A 2ITMA 1JALA 1WWHA 4IC9A 5L39A 4KBIA 3OTOK 4I6AA 1CXQA 1VQ6N 1NOZA 4WQ4A 1W2BR 3K5OA 3U3YA 3TUIC 5KAIU 3RAMA 3EGNA 4O44A 4CK3A 3CCVN 4DL6A 5A8RA 3K2PA 3GV8B 5J2QA 4CLPA 1ZQQA 1WAFA 5EE3A 2C22A 4CZKA 3QETA 3BPSP 4B3MF 3DLJA 3UD4P 4ZVRB 1WTBA 1FO1A 4FBTA 1Q8LA 4DXLA 3B0YA 1EX4A 3FLCO 5F41A 4KX5A 1OY9A 4IS7A 3G71N 4GMJB 3TSUA 2Z4PA 2VOOA 5AK5A 1OO0B 5D15A 2RP5A 3CPWR 1T94A 2F77X 3WIUA 3QUQA 2PFQA 2OPQA 2ZH1A 4OYPA 2CQGA 4ED5A 2V69A 3I9V9 1KLNA 4OZ0A 2CJQA 1S1VA 1M90O 1SC3B 2HS0A 4KLGA 3LZIA 3AXMA 3OTBA 2DNNA 4BRKA 3H98A 5ALLA 2CGLA 3E2EA 1U1OA 4WQ5C 3HPOA 2HQFA 1KEKA 3CW2C 1LB2B 1N2XA 3VQ4A 4GKJK 1F9HA 3ZSOA 2ZVIA 1A5WA 2IMOA 2NRTA 1U2RA 5F9NA 1YBAA 3PKYA 4ELUA 3W9IA 1KDNA 2VG5B 4EHUA 4JI0F 4FXWA 2ZE2A 2ASJA 3T19A 5ALPA 4P2XA 2HMIA 4QPTA 2M52A 3PXGa 3K8WA 4CM0A 3M8PB 3OBYA 1QAIA 2V2QA 1CZBA 3OYFA 2AYMA 3GIJA 3RRKA 4IO1A 6AT1B 7ICIA 1N6QA 2UXCF 1HBNA 1Y3KA 1XWLA 3PX4A 5MAOA 1Q86O 4AYBD 1QE1A 1HIYA 1FDBA 1Y00A 2DRBA 2ZH2A 4PZVA 4DL7A 2KEYA 4NYNA 3SD7A 2V9WA 1MU2A 4LJMA 2EFOA 4Q44A 2Z1IA 2M0NA 4UBCA 1IWAA 2F4VF 1OYEA 4OZLA 2AD9A 2ZIUB 3MI7X 1WELA 3QU7A 3KWGA 3R5DA 3JPOA 2GLEA 2CPYA 3TJ8A 3N6MA 2CNOB 4H5TA 4IKFA 2MQQA 4KHPF 5C2CA 3VCBA 4F4WA 1NPKA 8ICYA 1NNEA 3TX8A 1ZQKA 1Z4NA 5HSPA 3O3GA 3D3BJ 1QUPA 2CZ4A 1VRUA 2GVZB 3MF5A 2E1EA 1BIZA 1IQZA 1DTQA 5AKXA 2HB5A 2LSNA 4KV8A 2VIXA 1VAZA 1L7MA 3GJSB 3OVBA 1IBLK 4MDBA 3D2QA 5KQ8A 3ZNJ1 5K8PA 1N5QA 1HPZB 3BY5A 1NK0A 1MROA 1Z26A 1LWFA 2JGAA 3V7LA 3M8RA 5LJ5Y 1B7FA 3C6AA 4O3MA 1VS3A 8ICQA 1RAHB 1Q95G 5EE1A 3LQVA 3CQYA 5B7WA 4K8RA 3AA4A 5KFKA 2WSFC 4ISGA 4OHZA 2HS3A 2AEMA 3P8BB 1N32F 1NGEA 1LNQA 3AFGA 2OELA 4M3YA 2HBKA 1M1HA 1CJUB 4FJMA 3VGLA 3CVKA 2DH7A 2Q43A 1K9MO 4UY8O 1MN7A 3JAMO 3DWLA 1ZBFA 3Q8YA 4FJLA 3C6TA 1YJVA 4FZNA 3OUYA 4FS2A 4ILLA 2MY8A 4RQ8A 3OL6A 1HPZA 3B9JA 3CNQP 3X3UA 4LMZA 4M3TA 4MYTA 2GWSA 4IXCA 5GINA 4QR0A 3BQ2A 4PAAA 2UUCJ 1I3AA 2JEGA 4F72A 4DV4F 4DV1F 1GTEA 1N5TA 1Q79A 2ERRA 2R7YA 5A76A 4IOXA 3WXLA 2KVQE 1KQKA 3DOKB 4FNHA 4M3WA 3DI6B 1T95A 3AO2A 4EX7A 2F8MA 1EP4A 2POKA 5B09A 3PSPA 5AQUA 1ZQCA 3A13A 1FEZA 1HNWK 1KTQA 5AQNA 2ASPA 2IA0A 1IO2A 4XIUA 1RABB 4RWTA 2FJAB 3LWMA 2KZMA 4PYAA 3MMAA 3D1QA 2LA4A 2ZUGA 1KWMA 5HHIA 4KGZB 8ICTA 5TKWA 2KZ3A 1H74A 5IWAK 3MZIA 4ZVPB 2DFHA 3DOLB 2OEKA 2F5GA 3DNCA 3MDFA 2F1IA 3V7KA 3ENHA 3DCAA 3DLLL 2B6AB 1SIZA 3HKZF 3LP2A 1X4DA 1X5PA 4HLBA 2KHCA 4IEEA 4M63C 5CXTA 1RM6C 4K59A 3MM8A 3P6YC 4P10A 4QR2A 3DV9A 4I68A 1XMOK 2MU2A 1QM9A 2BX6A 3I96A 1HWJA 1RGIA 3KLFB 2EG2A 3GIRA 1BPBA 3PW5A 3MXMA 1VQNS 5DB6A 2GV9A 4CHYA 1D8ZA 3W5ZA 4CGHA 4BBYA 5CCMA 4F4AA 4WTOB 4YHHJ 3DJCA 2WSEC 4ZOSA 1TV6B 2K7JA 3O6WA 3CJ3A 1S77D 3DDHA 1Y5IB 2YKAA 3V9SA 2V68A 4EYIB 1UAXA 4A2AA 1FEEA 4J90A 3ETLA 2G0IA 3QYPA 3L7OA 4KH0B 2Q6BA 3JSRA 1JCEA 2Z58B 2VANA 1UWAA 3HBTA 1KOHA 3J7YI 3UDLA 3LDQA 1HBOB 3BJYA 4J2BA 4KE5A 3VPZA 2CNKB 4WE1B 3GSIA 3HHNB 3QGPA 1BCMA 1BPZA 4OKJA 1HNXK 1Y7PA 1S9EA 3AAWB 3FSYA 2W43A 4ZTJA 2IBOA 4I56A 4NLGA 2O8CA 3PRDA 1QTNB 1PC5A 5JS2A 3G6EN 4DCPB 3SCXA 2GQCA 4F36A 4DQRA 3KHGA 2F2AB 1JL2A 4UOFA 1QAXA 3JXOA 1HNIB 3OLBA 3LM9A 3Q8LA 4HI1A 4L73A 4Z4FA 3MGVA 2CXEA 1NGFA 1NSPA 3Q83A 4Q8EA 3CD5A 1DOQA 3IP0A 3QNMA 1LOTB 8ICNA 3HRDD 3QB0A 1X4GA 3TW0A 4GVMA 4F0HA 1M5KC 4NXMJ 2XB2D 1RHMB 1Y9OA 5HVFA 3F2BA 4C48A 5CY4A 3ZDEA 2DNGA 1ZM2A 4CF9A 2KJ8A 2VUGA 5BN8A 4F3OA 3R9PA 3K2YA 4X62J 3NGIA 4I7FA 5JVGQ 4DOZA 4HKQA 3I56N 4KLHA 5AKIA 4KPYA 4NLCA 4KFBA 2ES6A 1JLFA 3KNAA 3OYHA 3G8QA 2G8FA 3ZSWA 1C4AA 2K7KA 2W2MP 1VIXA 3ZTOA 4O55A 2UYTA 3MCAB 2WVDA 4O0NA 1W97L 4OI3A 3M4XA 2O8BB 4K7QA 4ZN1A 4Y2RA 1OPIA 3CIZA 2O8DB 1UVLA 4H0TB 4C8KA 4BXOB 3DXMB 4NO7A 1WG8A 5HR7A 4KN4A 4NL9A 4ZVSB 3PIPQ 3TJ9A 3DYAA 3VTHA 3MR7A 4PQUA 1Y10A 1TL5A 2BKPA 4GMKA 4WE1A 3KWIA 1B0XA 4LR9A 4JI0J 5BRFA 2PN6A 4IL6U 3ZTSA 5JMNA 3LDAA 3DLEA 4M1KA 1UKUA 1N8RO 4BR0A 2M70A 1CJVA 2HKEA 1OQ6A 3AHPA 1HR0K 2VHGA 1Z19A 4USAA 3GB0A 4OI0A 2P9NB 1N56A 4RW8A 5AKLA 1FESA 2RE1A 4FJKA 4DPYA 3D3CJ 2WAQF 3DLRA 2DY1A 1VQMS 2DBBA 2AYGA 2XWYA 1YGYA 5J0OA 3ISCA 2MB0B 2CJ9A 5LXRA 8ICIA 2L9WA 2F65A 5KFOA 3QUCA 2KH9A 2ZIXB 4Y28C 2LEPA 3UMCA 2QEXS 4DR4F 5F8LA 1MN8A 2RQCA 3CC4S 4QZIA 4QZAA 2XBPA 2V50A 1J5EF 4KHPJ 3QBCA 4DF8A 5B8HA 5BPLA 3WKAA 1E6YA 1VRQC 1XNRF 3OTCA 2W6LA 5BPMA 2BJ7A 5F0XA 4LF8J 3RJEA 4CGJA 1VQ4N 2AJ4A 2M9KA 4HHJA 1CJVB 2DR5A 2HF3A 2VPXB 4ANDA 2ZKTA 2KT3A 5J1EB 4O3PA 3MR5A 4UB2A 4C9DA 3H8JA 2P66A 4MK7A 4RW8B 3OXLA 1XQSC 2YMPA 2I5JA 2X74A 2H3EB 4E2FB 2CJYB 4WIIA 2Y3YA 5HRSA 2OLWA 4Y2TA 2PBDA 3Q0AA 3CIMA 1HLWA 4QYZK 2HAFA 2WBNA 1MQ2A 3QESA 1NGIA 2HGNA 4U7BA 1GLDG 4DV4K 5C2FA 4MEXA 4Z7CA 3AVIA 3WKCA 4PWDA 4BR9A 3SUNA 1NDKA 2BJ3A 4IO9L 2YB4A 4DN0A 2R7QA 3UDVA 1XSPA 4LF1A 4CTAA 3KLHA 4RW7A 4CNYA 5KFQA 4UB5A 2P9NA 3T1YK 3FDSA 2K3KA 2OD4A 4DV7F 2HQCA 1K8AT 5E3RA 2MKHA 3DDNA 3O5TB 3ZSZA 3AU6A 4IBNA 1NHUA 2BM0A 4RNOA 1U0HA 2FC9A 3IN5A 2FPHX 5ADXH 2BUNA 4C6AA 3OS1A 3VQ8A 2E66A 1C1AA 5C15A 5T41A 2WAQD 4TQRA 4M04A 4P73A 5M1PA 3PRVA 1RBTA 3IAS9 4BVPA 2AU0A 1AQ6A 3QICA 4RW4B 1SV0A 4LF7J 2RDJA 4NWBA 2RQ4A 3SQOP 4B3SK 3VQPA 4K50A 4ES3A 3EW9A 1R0AB 3TAGA 4DV1K 4DR7J 4BRHA 3TR5A 2XMKA 4JKHA 4DZ6A 1F0MA 1V5IB 3IC1A 4DV5F 4DS4A 3CGIA 4CECA 4FF4A 4JI7F 4RQ5A 1RTZA 3RVCA 3EX7B 1SC1B 2XO7A 3MWPA 4DV0K 4M7XA 2CQ3A 5F8JA 4OVLA 3SZ2A 4KGVB 1IKXA 2P2CB 4K0KK 1KBRA 2QSFA 2IRUA 2KD1A 2ZJ5A 3QEBZ 3MMAB 4PG8A 4QCLA 2QA1A 3ZEUA 5L1KA 3KD3A 4FYDA 3M1FA 1P90A 3AGKA 3V4MA 1RT5A 4DX5A 2VG7B 2YKNA 2B6GA 2CYYA 3R27A 4Y2UA 3G87A 4G1IA 5IIIA 4IH7A 4NLOA 4U8YA 3CCSN 2CPIA 4PL7A 1NXIA 3CC7S 1B92A 5KG1A 1HBMB 2J9DA 1KP6A 4I29A 3IBFB 3AMZA 2LKYA 3A12A 2E6MA 4KPCA 4KC5A 3HI0A 4B02A 3A3OB 1XMOF 3O9RA 3P31A 1B70B 1SC4B 2NXUA 4CIGA 4CDGA 2FHOB 1FWLA 3M8PA 3V4IB 4KB7A 4LFBF 4Z4EA 4KHPK 5J2MA 4LRDA 4ZVOB 4ICLA 3O80A 4EYHB 2MZRA 3GYXB 3HKZD 3FAHA 3CC2S 3KK7A 2AYEA 2R7VA 3FZKA 3H2VE 3VQ6A 5ETKA 4FOIA 2BKEA 2VG7A 1XC9A 1EIYB 3THWA 4NCGA 3FCWA 3TZYA 2QWLA 2HFVA 7ICSA 3SEOA 1C6VA 2J9DE 1QVFR 3NCPA 4Y2MA 2EAMA 2WRMA 4IEIA 4F2RA 3Q8MA 3J81Y 2ZBQA 1HQEA 4LSLB 1URJA 4RNHA 1ZH5A 4ZJOA 1VQNN 1YZ6A 2JVRA 3P39A 2IM1A 1C1CB 4WFXA 1KOOA 3TARA 5HROB 4NI2B 1NGBA 4DTPA 2R8HA 3SQ2A 2AJQA 3H20A 3KDNA 2CNLB 4B08A 3M6UA 3VGKA 1ZQYA 3DN9A 2Z1GA 3S41A 2VD3A 1H2VZ 1YJTA 5AQRA 3GG4A 1AFJA 2ZM6K 1H72C 4RW6B 4IQVA 4ETXA 4ZHRB 3HM8A 1RT5B 5KL8B 3MWBA 2ETJA 2W11A 3PO4A 4E7KA 2Q79A 4C4SA 5J29A 3OTOJ 4JS5A 4J5OA 3A0IX 3CJQA 2YWWA 1EB0A 1Z1ZA 1HBMA 4WJBA 2WOMB 4Y2KA 5EX5A 3VGVA 3MWTA 4FXDA 3NNAA 3C6UA 2ZH7A 3ID6A 4WCEL 5AQZA 3NHGA 1S1TB 4CJFA 3CCES 1SI9A 1IKYA 1UVJA 1YJNS 2J8AA 3EM1A 4BC3A 3TFRA 2W9BB 2V67A 3VTIA 4QOTA 4IFEA 3J81j 2V0NA 1UETA 4YB5A 2PYJA 3KG1A 3OYIA 2PO4A 4U96A 2Z1JA 4KHNA 2MPUA 3IG8A 8ICCA 4IJNA 4CERA 3EDQB 1KDHA 5DGBA 3DLKA 4OX9K 3DRSA 3KKRA 1F9FA 2VASA 2BTFA 5CA7A 3IUCA 7ICVA 1U45A 1BE4A 4JHDB 3MR6A 1HNZF 5EY4A 3TEHB 5A8KA 4KGKA 1FXXA 2ZVSA 8ICRA 5LOQA 2EC2A 3P45B 1H2TZ 3ZTQA 4IQTA 1IXRA 3QO9B 4BUGA 4C11B 4LFCJ 1SJQA 4YG2A 3GLJA 3LP1B 3D68A 2FBTA 3UMBA 1NAQA 2VFSA 3C14A 5AM5A 3DLEB 4UOCA 1J5OA 3CCLN 2WUSA 4CO2A 5BN9A 2I8EA 4JI2F 1YXQA 3P38A 3CP8A 3CSKA 1TMJA 1NDPA 2GUPA 2F63A 5AZIB 3IV6A 2IJNA 3CG7A 4Z7YA 4Y2PA 2HWTA 4B3RF 3CTRA 3NGTA 2YXLA 4X64J 3JPPA 5H1SQ 4BRLA 1HNIA 1C2PA 3MXHP 1RWXB 2YQ0A 1NJZA 2DXEA 2RLTA 2W2QP 3FC9A 3O5BA 1SZ2A 5AZJB 2MMYA 5JS1A 3IBWA 3RTVA 4E19A 5AM2A 2P9SB 1G6BA 4K5SA 5KFXA 2ZIVB 2HSEB 3PJXA 1ICEB 1UA1A 2QXLA 5J0QA 3UQSA 4DR5J 5J8YA 4A8FA 2BQ3A 2EZYA 3SMSA 2ZNZA 4HYKA 2Q31A 4B9TA 4NLVA 4MFBB 8ICPA 2E5IA 3SAFA 2ZNYA 3R2DJ 4H0OA 4F5RA 4LF4K 2FJEB 2OEJA 2XRIA 2ZWOA 5AICA 4GRSA 3AY9A 2QWMA 2FB0A 4QQBA 4Z37A 3IS9B 4PGXA 1HYSB 2KM8B 2EKNA 3CDWA 5FPDA 3FBCA 3V6JA 1RTHA 5IS2A 2W3RA 4NYPA 3UVJA 2XSFA 3K4GA 4QYZJ 3Q2SC 4CJWA 4TQSA 1LAVA 2L9NA 2LM1A 1LK5A 4OKKA 3ZEUB 2O8CB 4KHQA 3W8GA 4QWEA 1HMVA 1NDLA 4IDHA 1Z00A 2HGMA 4E7IA 3J7A1 5M2PA 5EE0A 1RT6A 4WTYA 3WU2U 1SQGA 4RO0A 1G7CB 3G6VA 1RHRB 1S5LU 4N8OA 2IJFA 2VJVA 1NGGA 3RJKA 1JKHB 2BA9A 3ZSVA 4KTZA 2R7OA 1QZ6A 5J2GA 1KC8O 5IV3A 3CNHA 4DUTA 2FHJD 3ZDDA 3EGWB 3D28A 1S8OA 3MX2A 2VZ9A 8ATCB 3AVHA 4DR2K 2CPEA 4ED0A 2E1ZA 4K4YA 4QZHA 1QSYA 2IOFK 4ECRA 1Z2LA 3KIOA 1SVDA 1I6JA 1TUVA 2NZTA 2VPWB 2YY6A 3FFIB 1ZC6A 1DTTB 2BJEA 3F2CA 4KHMA 8ICZA 3AUOA 3BSNA 2LXFA 4OZ1A 3D0GE 2HRTA 5KFJA 4CDIA 2EEYA 4ZLLA 1GXTA 2R2SA 2ROPA 4CI6A 2LVWA 1N36J 4PKIA 4IR1A 5AKEA 3H7IA 3IMQJ 3SPZA 5B0EA 7ICOA 3HPHA 1JKHA 2J7UA 3CCUN 5J2MB 1S97A 2Y0SF 3AXKA 2HHQA 2NPIA 4QZGA 4ED1A 2D8CA 2NCKL 3MM5A 3Q8RB 3ELHA 3JSBA 5D4PA 4A59A 3AA8A 3JSYA 4X4NA 1JUDA 1QDUB 1CXUA 2RUGA 1RG6A 4ZHRA 4AYBC 1YI2N 4IZ9A 4LH5A 2NO4A 1JK9B 4JD2A 4ED8A 3UN3A 5C5JA 4W5TA 1U24A 3GMGA 4B3TJ 1AUSL 2F9WA 1V4SA 2E6LA 3C19A 3O0FA 2PFPA 3LDLA 1L3TA 3J7ZT 4Y0WA 4PHEA 1HR0F 1FJGK 2H3QA 4JI5K 1HD1A 1CVJA 5HHHA 4OYZA 4CJQA 3IRXA 2LLZA 2JH3A 3C6HA 3NRZA 3LAMA 4H8KA 3H59A 2BW7A 3OD2A 4RWWA 2GIFA 2QARA 3ENAA 4YDUC 4J9SA 3KG0A 3TAPA 4X62K 2VF3A 2UUBF 3THWB 5ALWA 1R89A 1IH7A 4JI8F 2ALZA 2GO7A 2DR6A 3RFAA 4DU7A 3C29A 5LMUK 3CMES 4JI1K 3EE9A 5CE3A 4G1QA 4DTOA 5AR0A 2WF9A 4W5OA 5C2GA 3GV5B 2NRRA 7ICGA 1U1PA 2VYPA 2O6KA 4DSEA 1GLJO 4BDYA 3TVYA 2CQ2A 3N7RC 3T1AA 3H46O 3BZQA 3DAWA 3QATA 5FDLA 2KQ2A 1CC7A 1WSEA 3R1HA 3CULA 3TA1A 2E1MC 2DRDA 2DBYA 3D2WA 5KFHA 3E9OA 2Q3PA 4CF5A 3NMRA 3S6EA 4KREA 1FA0A 1ZQBA 4L3KA 5DB7A 1BQMA 5K8MA 4NLQA 1RLDA 1LW0B 3B6BA 4BG9A 4DR1F 1UJ6A 3NDKA 3SV3A 2BQRA 2V4JA 1M90T 1V4TA 2BPCA 3POTA 4QU7A 3CM6A 1G15A 5J2QB 4FP9A 3HSGA 2HHSA 3FEXB 1T02A 1O0PA 1D0EA 4IQWA 2MRLA 3CDUA 2G5IB 2XWXA 4LT6A 1CSJA 4X5VA 1X9XA 4FKYA 3QZ8A 1WKKA 3V4IA 1D8BA 1Q5VA 3H8SA 3BBFA 2KHQA 3I33A 1OH5A 5HRPA 3NUQA 5E41A 1Y5NB 5HATA 2GGPA 3IR5B 3H0MB 1VFJA 3UKRA 2X1GA 3IG1A 4C7YA 3JS9A 4KTQA 3L9ZA 5KFAA 2KDOA 2OEHA 3CCEN 5ALIA 4B9VA 4MYUA 4K25A 1PSDA 2ZGYA 2X1AA 4BRIA 2C3OA 4CJKA 2PMZF 4IOCQ 3ZCMA 5J0UA 4F91B 4CZLA 2J6TA 2R2TA 5M1NA 3R2CJ 2JR5A 2V8VA 2W01A 3MM8B 2V8GA 2JFDA 1JIHA 4FJXA 3RSEA 3ZETB 4QS8A 4FZZA 1HI8A 4M3XA 2ZIXA 1BA1A 5BJRA 3SUPA 4HHUA 3CD6N 1PAEX 2C3PA 4LIRA 4CEZA 2QKBA 3H5SA 5J8YC 1AFIA 2ZOFA 3LVVA 2B43A 5TKYA 2IFXA 4K0KF 9ICMA 1VRTB 4KLOA 4FZYA 5GMKa 1H1VA 2JFKA 2BCRA 3THYA 5CHIA 3ILIA 2GUIA 5HMYA 2R7UA 4CVNE 4E7JA 4FJJA 1T3QA 1K44A 1CLQA 1UEKA 2FJWA 2AGQA 3UM9A 2DD8S 3T1YJ 2DO4A 1UVMA 2XMAA 2Y0BB 3IG5A 4DDFA 4NLZA 4TUSA 2QL7B 3MPYA 2FIUA 1W7AA 2XM3A 1EP4B 3WDOA 4HVZA 4N77A 4PR6A 4B9LA 4KKOB 3ATUA 1YT3A 2YTUA 1WHYA 2X6SA 1N32J 3M2UB 2DHAA 1GOAA 3DKDA 5B08A 4WYLA 1WSJA 2YPYA 2HVIA 5HL7L 3NG8A 4J03A 2HBQB 1NBWA 4Y2QA 2B51A 4AHCA 2E1RA 2C3MA 1PBUA 1Q18A 3D6RA 4DOCA 4V19J 4QS7A 1WI8A 1TKXB 5LJ3Y 4NCBA 4YEAA 3HJEA 4DR7K 2HWHA 3KHHA 1A6LA 2GQQA 4F0KA 2HOEA 1S48A 2AZ3A 2EQYA 1RLCL 2FBVA 5AJ3F 2XZWA 4ECWA 3C3LA 4YVZA 4E0DA 3E9PA 2ZZNA 4DTUA 4EGLA 3GIIA 1OSDA 1NO8A 1OW5A 9ICNA 5ETTA 3JAMU 3QNWB 3M1VA 3VQ5A 4OLBA 3P5TL 1RWWB 4OJ1A 4C8MA 5IIMA 2GX8A 1CPZA 2HNZB 5A2QY 2AJ1A 3OR2B 4FJHA 3FFIA 1UFKA 3UD5A 2MAXA 2QV6A 2A1JA 3OR1A 3EYZA 4DX8H 4OI6A 2D1CA 2E5LJ 4DR4J 2LYVA 4YP3A 4DX7A 3NAHA 2B9XA 4YNQA 3VC8A 3VZIA 4ED7A 2LFVA 3KUEA 2D0AA 3NH1A 4BRGA 4LRBA 1V9OA 3FYHA 1CULB 2AQ0A 1NI3A 4FDFA 1G2EA 4CEOA 1WC1A 1S72S 3QJLA 4F5QA 3BDEA 1GOCA 2ADBA 1YJWS 5AQSA 4JI6K 3T6JA 4DTNA 3S3NA 1VOMA 2V2ZA 4O3QA 3DI6A 3CCSS 3GBTA 4B3SF 2C2MB 7ICRA 4LF5J 4C0OC 4DUZJ 3G9CA 2AEJA 3WK6A 4NMXA 2E2PA 4CESA 1ROFA 3CJKB 2V7YA 3MN6A 1R6YA 3RRHA 3VEXA 1WUUA 4MEYA 5IM0B 3SQ4A 4YR3A 1KSPA 5AKKA 3VEYA 1Y88A 1BPEA 4DLGA 2VDIA 4NLXA 3OFHA 3JPNA 3H2LA 4JI0K 5J2JA 3R8YA 3BR9A 4RBUA 4AM7A 5BRDA 1CJKB 1N5SA 3W1YC 3D6MB 1U6BA 3WC2A 4EP4A 3TTFA 3L3FX 3EO3A 1F5CA 1IM6A 3TNVA 1QY7A 2M4MA 2GAHC 3CM5A 2YNIB 3D54A 4I2IA 2BMBA 2AIRB 1UAWA 1J5OB 4CLWA 2I1RA 4ZTFA 2XTJP 4Z4HA 2NRWA 1LXJA 3PFOA 2FLPA 3MM7B 2ESEA 2WB4A 2X1BA 3NH0A 7ICJA 3CMQA 2FPLA 1KVCA 4HR2A 3O08A 5GAHP 2UUBJ 3R1XA 3H4DA 2VPZB 3OBIA 5A2QO 2GIQA 1WWVA 1KVKA 5CZXA 2FD2A 3T5LA 3ASMA 1JCFA 4ZP6A 1WHWA 3AJ2A 4OJ3A 3PCOB 3N6LA 3BGFA 2V5HG 7ICQA 5EWGA 1WF1A 4HEA9 1HJPA 1BI4A 3F44A 2FDRA 1BDGA 2AXTU 4H4OA 1FO4A 1GTHA 3NP5A 4F8RA 3BKUA 3TTDA 2ZM6J 3FZLA 1OWXA 5AI9A 2RKIB 2ZIWA 1YK9A 1JROA 3OYCA 2KM8C 1Q82O 2V4JB 8ICJA 4WXOA 1S4EA 4ZIWA 1H0HB 2ZTEA 4PYDA 1NHKL 4J9PA 5DLFA 2W7OA 2N7YA 1X2IA 3OYKA 1BHNA 4FPRA 2OEMA 2QL9B 2YJEA 4UATA 3GCWP 3N7PD 4M5NA 4H4MA 1KCFA 2Q0UA 4F4YA 5AQTA 2F8EX 4A5BA 3WXKA 3QLHB 3R7SB 2A19A 5JVHQ 3U26A 4PUOA 3KKAC 1RAOA 4JV2A 4BR7A 4NB4A 3CMEN 5I3QA 8ICWA 5CABA 2J9CA 4HACA 4ETZA 3TANA 2Q3SA 2BZFA 2HYIB 3KHYA 3RRGA 4BRNA 5F0UA 2YNGA 4E3SA 2KKPA 4LZDA 4GW6A 4ILJA 2M8DB 2NV3A 2YNFA 3FZMA 5CP2A 3V6DA 2VKQA 4A48A 2RMLA 4NZ6A 4FWPA 4M6WA 3MMCB 2W4PA 2L08A 2I6WA 1UP1A 4K4WA 4JI6J 2HDOA 2W41A 1ZAVA 2GAGC 3H6EA 1EKEA 3QT6A 2WF7A 1JJ2R 1VI7A 5A8KB 4UBBA 3CI5A 2O1PA 3V7JA 1IV8A 5AIAA 2O8BA 1IV0A 1ZPVA 1CUKA 1F2GA 3C66A 3MPUB 4AF1A 2Z2MA 4MDAA 1A5XA 2CA9A 4Y2YA 2FPKA 4KX3A 3RUBL 5DB8A 3JQMA 3M8WA 2ZC4A 5GAGP 3WNFA 4CJPA 1S12A 2UUTA 2APOA 4DR5K 5E7OB 1FDDA 4FK2A 2CDQA 4NLNA 2V8HA 4MK8A 2Z8QA 1FEHA 3IR6B 3BS5B 3C46A 2CQDA 2XMMA 4EZ6A 1XBWA 4LF8F 5AJ3J 3SQGB 1A76A 4I67A 4M3RA 4LFAF 4UAWA 3KKSA 1JWWA 4UQTA 3PO5A 3DXBA 5HN0A 4K8XA 4Q5VA 3GZFA 1B4SA 2MSSA 3QINA 2QA4N 1NU0A 3AO4A 1KQGB 2VFTA 2XCAA 3I76A 2B4OA 2K3IA 4FPBA 4I2QB 3GL1A 4CCHA 1F1BB 3GPAA 3A3PB 1NPPA 2NLXA 4ICAA 1H98A 3LPEA 2HHXA 1KVJA 3OS0A 3HKWA 2UUAK 4PG5A 3MR3A 4F2SA 1UPPA 3NH2A 4IG0B 2JSXA 4CEDA 1Q53A 3NCIA 2LQBA 5AZIA 3FMBA 3MECA 3CD0A 4YHHK 2DGVA 1P7DA 1S1VB 2B9EA 4JI7J 2YMLA 3GDQA 2UUBK 4QZ8A 5D3GB 1R0BG 3SI8A 3H45C 1RDCA 2G09A 2O8FA 5DJBA 3FZ2A 4F67A 3JTPA 4P7VA 1Z25A 1JLEB 3CJ7A 4DCHA 5CZ1A 3IWNC 3I1YA 5AQFA 3DM2A 3FR0A 1ZQNA 2HEKA 8ICEA 2KXFA 3MN9A 1GFWB 1RWUA 1HNXF 3OJUA 3HULA 2SXLA 2HBMA 1HKGA 3IA0A 5KOWA 5ETLA 4HT7A 3HVTA 2QN6B 2UZAA 3MUTP 3T5KA 4OZ2A 1T6DA 3KZBA 5KT2A 1ACMB 3CCTA 3W2VB 2L41A 2GMJA 2MUTA 1KHWA 3Q7BA 5DK5A 3MD3A 2K4PA 4NL9C 2I5HA 1NJIT 3H8MA 4CYUA 2KN7A 3FBFA 1K0VA 4Q8FA 3WNGA 2IHNA 1KKXA 3H1VX 5EDWA 1BNPA 3J81O 4YD1A 1B43A 4USWA 1U0HB 4IDKB 1DFDA 1WG1A 3CRXA 1K9MT 1X6JA 4UY8T 1WSRA 3IFEA 5J2CA 4MO5A 4MQ3A 1QQMA 2OPRB 4ZJQA 4NLBA 4HCBA 2EG1A 1IVZA 3CJKA 4FPIA 4A8QA 4ER8A 4A8MP 2KJWA 1N32K 3VOVA 1ZQLA 1BHLA 4LUBA 1TL1B 3QT5A 3TQ1A 1ELOA 1ZBLA 1REVA 2PFOA 4ZPWR 5GMDA 4FVMA 4LF5F 4X65J 2ZGZA 1NMEB 3P83D 3A5NC 3CCUS 4JKCA 1W2BM 4DQIA 4FYYB 3HHDA 1OJ4A 2A3VA 3RJJA 3D4JA 2VKRA 1TFYA 1X1PA 2EK1A 3CQXA 1L5UA 2G8WA 7AT1B 3GR0A 2I9SA 2A6AA 3E3XA 3CO0P 1KC8T 3M3ZA 3W0LA 3OTOF 2CNNB 2C2DA 2OO4A 4DUZK 4A8WA 3QEVA 1C0UB 4RBVA 2AX1A 2P51A 3CPWM 1WDTA 2PI5A 4NEYA 3DFEA 2ATCB 4IFYA 4L72B 1R7IA 1U8WA 3BP8A 3BO4A 1S72N 4Z6EA 2RUSA 1FX2A 4Q45A 3EJMA 1YJWN 1WLJA 4OO1J 2EZZA 3MPVA 4QPXA 1ZYQA 1JCGA 1C20A 4Z4CA 4DR3F 4JD2B 1X4BA 4PKGA 3SBMA 1YDLA 3A0BU 1C7YA 3WKBA 2L9DA 2OMLA 5JUMA 2QLTA 3NGUA 5IILA 4EEYA 2QRRA 2DR7A 2NREA 2EI5A 2DPIA 3DEEA 2CPZA 4M8LA 1JXLA 4JRQA 1OVYA 1XHXA 1NUEA 3GJRB 2VBWA 4BRMA 4EBEA 3JQJA 3FC4A 1S76D 4QZDA 2E9RX 2ZH4A 4XQ8A 2BGGA 1Q3UA 1NH8A 2KYZA 3GE9A 4CEAA 1U26A 2HZVA 2NSBA 2E3TA 1VC6A 3F5AA 1RDRA 4JI4K 3MEDA 1L8LA 1PYTA 4FW2A 1SXDA 3SMZA 3IDWA 3UI3A 2DEIA 3SQ1A 2CG4A 1HNZK 4E7HA 1K1SA 1LW2A 5HR6A 4C11A 1BU6O 1J53A 3KKFA 4IFVB 1SZHA 4J91A 8ICGA 3B54A 4DSJA 3U1MA 1PUZA 1X9WA 3LP3A 3CCWA 5HNKA 1VQLS 4K4VA 3ZZ0A 3ZD8A 2QLFB 1NGDA 3LGNA 2H51B 5D6GA 4LRFA 4JUZA 3IKMA 1Y4ZB 1VK3A 4USKA 2AJ0A 4IFYB 4TURA 4IO8A 1PJ5A 2DVIA 4X66J 2OUGA 1SH0A 4R5PB 5LSLA 1ZQMA 1GH8A 3P3DA 4O3NA 4RLEA 4CLLA 4EEKA 4NLUA 1O6XA 3AO5A 2NUUG 2XVTA 1X40A 1WC3A 4AL7A 1WC4A 4B1VA 1RDUA 2YNHB 3RR8A 2ISOA 1RGVA 4O23A 4ECVA 3VQCA 4FWOA 4I2HA 1QD1A 1T9UA 3DGPA 1JJHA 1RPLA 4NXNK 1VJWA 5ALFA 3CT9A 4QBUA 5IT4A 1ZQFA 3DLBA 5KNIA 1RXVA 3NTUA 4OYWA 2BANB 3KLIA 3CD7A 1P9YA 3H0PA 4IUFA 2V2VA 2H4WB 2KIVA 2WB1C 5D4NA 5AM1A 5FLXY 4KY3A 3R6MA 5CR4A 3AOAA 3TUPA 3RB0A 1APSA 1S1WB 1MWQA 3G25A 4G9ZA 1ZD4A 1ZQGA 3KOOA 3O4NA 3Q22A 2B0GA 3RBXA 3U27A 1J6ZA 1JLEA 1GAOA 1HHTP 5HK4A 2WHOA 2RB7A 3VENA 4NWIA 1Q81T 2VQEJ 4KTWA 4J9QA 2V52B 9ICTA 1Q82T 5IIKA 2ZBRA 3AEVA 2W3SA 2CPDA 1KR4A 4CZMA 3UNYA 4KV8B 1AT1B 1WC0A 3BB5A 3TAQA 4UF4A 1IR1A 3GTYX 2QWRA 1ZQSA 3ZZOA 3VCDA 2C2RA 2XMJA 1YHQS 5ADXA 4FVUA 1BUXA 3AQPA 3FJ2A 3EZUA 1UJ5A 1EHWA 2NS1B 1FE4A 2EFNA 2M5YA 3N4MB 2G8UA 1Z3EB 1FRKA 3BF4A 3F5TA 2E8OA 4CLUA 5J2DA 1SB3C 2JNJA 1NK6A 1LVHA 2GVZA 9RUBA 1FDAA 4EO8A 1ZQJA 5GVQA 3T1HF 4DF4A 2BJ8A 2DIUA 4IO9Q 1HWIA 1NZ8A 3RJMB 4DUYK 4HVJA 1DHMA 1I1GA 5HI7A 4NZ0A 2FJ6A 4TLQA 4QZCA 1PCAA 2ACMA 2IRXA 1S6QB 3M2RA 2ZD1B 2CH6A 2O8FB 1F9EB 4CO3A 2MKIA 3C2PA 3R9KA 2KRRA 3PDNA 1XJWB 3OYLA 3N4QA 4DFMA 3IRWP 4PRFA 4BX9C 1DEJA 4NM1A 5IIJA 1NK9A 2CZVC 3PJ9A 3HP6A 1EQYA 2Z2YB 4HDHA 4DZDA 3TP2A 3D67A 2ZJ8A 2AJFE 4DCCA 4DFDA 4F02A 3ULEB 4L6V3 3IGNA 1X4AA 5F3XB 1U2FA 1R43A 5KQDA 3G6YA 4CLKA 4IRKA 1A5VA 3RW6A 2IMWP 2P5GA 1YRXA 2UVWA 1BXNA 4A57A 3KK3A 4B3OB 3MDAA 2IVYA 3CCRN 4ZCKA 1S22A 1J5EJ 1TV9A 1BQMB 5AI8A 2MQLA 3S01A 1FF2A 2O4IA 3KUHA 4UW9A 1HEKA 2Y8WA 3CXCM 4CF1A 1U2VB 2XI9A 3UDCA 2R18A 1HNVA 2YX1A 2OTLS 3BV8A 2C3UA 3UCGA 4IWVA 2P35A 1GX5A 4RQNA 1S6OA 3K9KA 1WF2A 4QIFA 1RT1A 2OJ3A 2GQ2A 3A4TA 4FM1A 1HUOA 3QLHA 5GADU 1R59O 1X5OA 4ITSA 4FZLA 3ITHB 4I6WA 4IKAA 3VGSA 4HH1A 3EVWA 4BC4A 3QX7A 4RQ1A 3OA9A 4YOEA 2UUAJ 5AK4A 1C0UA 1AYEA 2NYHA 3J7ZO 2VA8A 1YWXA 2FZCB 2DISA 2VH7A 2R7WA 4MMOA 1PIEA 2NRHA 3NGZA 2KG1A 4WZQA 5K20B 3OHAA 2GGPB 4LIWA 3VF2A 1ZS6A 4DHYA 5J2PB 3NNCA 3OL7A 3BZCA 1LAWA 5KG7A 2KVCA 2MQNA 3PIOQ 2UXDF 4HUFA 5IQ6A 3M9OB 3S9HA 5HJXA 4HWIA 3QE9Y 1LFWA 4C3MA 3SAHA 2ZKUA 3HHLC 1Q9YA 3GFYA 2ZUDA 3G6XA 4ZIVA 2CDRB