2XO7A

Crystal structure of a da:o-allylhydroxylamine-dc basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Chemical Discrimination between Dc and 5Medc Via Their Hydroxylamine Adducts
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 195
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xo7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xo7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xo7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xo7A01
4KLHA 1ZQKA 1N5YA 3MAQA 4CJPA 4O3SA 5D49A 3NFAA 1QS4A 1BQMA 4JWMA 3RBDA 4DL2A 3KHLA 4B9UA 5J2PA 3C5FA 4PUOA 9ICIA 4CJVA 3TAPA 3IAYA 3C1ZA 2HNDA 1Z25A 5CHGA 1XC9A 4RQ4A 4YCXA 2I5JA 3K5NA 1RYRA 3V7KA 4CE9A 1ZQGA 3QNOA 4Q43A 1L3UA 4MF8A 5EOZA 3ZDDA 7ICVA 4P2HA 4IQWA 1RTIA 3CYMA 3VQQA 3RJJA 4HCCA 2EX3A 4DFJA 4BXOA 1BI4B 3NF9A 3EYZA 1C0UA 3V1OA 3SV3A 4YN4A 1S0NA 4MFAA 2RPIA 2XC9A 2WONA 1QE1A 1XHXA 3VA3A 3RBEA 9ICPA 1VSMA 4ED3A 4LD0A 2P5OA 2BANA 3L3UA 2XCAA 1UT8A 2Q3SA 5DG8A 3LANA 4DL4A 2C22A 5KG4A 1S1UA 1NK5A 2W9CB 3RRGA 5DLGA 3QEXA 9ICRA 3NGZA 4CFDA 3T3FA 3H4BA 1NJWA 4QZGA 3TFRA 5KFLA 1ZJNA 3C23A 4XRHA 4TUSA 2ZUDA 4RNMA 4IRCA 3KTQA 1QTMA 1VSLA 2F8TA 4CK2A 1BGXT 2R8JA 1XS9D 3K4GA 4KN4A 2BPFA 5CP2A 4BGDA 3DOLA 4G1QA 4FK0A 1RT4A 1TKXA 3RH5A 5KT7A 1NK7A 4H4OA 4H8KA 4HUGA 3Q8LA 4GLXA 1RILA 3TABA 2XY8A 7ICNA 4F5RA 4BDYA 3PX6A 2FLNA 1U4BA 3OJUA 4CJEA 4ED0A 4CK1A 4CFBA 4FM2A 3DOKA 1VRUA 2UVWA 5IINA 4RUCA 2VWKA 4NYNA 9ICWA 1U47A 5KG0A 1KLMA 3NH1A 4DTMA 4DSKA 4FLZA 3K57A 8ICWA 3NHGA 4R65A 3NF6A 4J2DA 1IXRA 3H08A 1RCHA 3FDSA 1Z26A 8ICAA 3BQTA 4M3TA 1NK0A 4CJ4A 2W9BA 3RJFA 5FRNA 1SL2A 9ICCA 4KB1A 4CJ3A 4DS4A 5DGBA 4FJXA 3WNFA 1COOA 5JS1A 4RQ1A 2JEGA 5KG2A 5J0RA 3V72A 3NAEA 1PZNA 5KG1A 1JLQA 2JLEA 1SKSA 1TK0A 3AA4A 1VSJA 3QETA 3T19A 3HPOA 4N41A 4XUSA 1HUOA 3TFSA 4FJ9A 2VA8A 2F1JA 3MABA 4IDKA 2B5JA 2XRIA 1D9DA 3ZDCA 4M9HA 4J9KA 3IRXA 3T5KA 1XO1A 4LH5A 4NCAA 3AA3A 3HO1A 9ICGA 5KGWA 4I27A 1ZBFA 4DL7A 4O3NA 1KLNA 4RQ5A 2NRZA 4KITB 3TR8A 1IKVA 3Q8PB 1HMVA 4OKEA 4M45A 4PGYA 5KFJA 3SUQA 1DTQA 2LSNA 5DQGA 4FZZA 4OVLA 4DS5A 3AO5A 5HP1A 1RDAA 4GVMA 5HRPA 4DWIA 2DFHA 5DLFA 4E7LA 2PFOA 4QZ9A 1JXEA 7ICQA 3P83D 1KDHA 4DFMA 1GOCA 7ICIA 1MQ3A 2V4RA 8ICMA 2ZQBA 4DSJA 4AHTA 5IILA 2Y1JA 1ASVA 1XSNA 4DQIA 3JPOA 3SZ2A 3B0YA 4NLNA 3ORYA 1CXQA 4UBBA 1IKYA 3Q8MA 4I7FA 2IC3A 1FXXA 4I9LA 4BWMA 3ZSRA 4DU3A 3TI0A 4KHUA 1KSPA 2FPMA 3NGYA 4KV8A 4JS5A 4OLBA 1D9FA 1VSEA 4FZXC 4FS1A 4KKOA 1HJPA 2P5GA 4EEYA 4XQ8A 2BE2A 3OYHA 3GIKA 3UQ2A 1ZQRA 4TUQA 1TAUA 4P4OA 4M3UA 4RW7A 3ZD8A 4GW6A 1Y97A 4LZDA 4QOZB 3VQCA 1SUQA 2J6TA 1MU2A 4R8UB 4TURA 3AO4A 3SQ0A 3ASMA 2DFEA 2W9BB 4FJNA 7ICUA 8ICBA 1H38A 1ASWA 5J0WA 5KG7A 1JLFA 2H5XA 2Z1HA 2NRTA 3RAXA 4FLXA 4DSEA 3VQ8A 4OLAA 1U45A 4PPXA 4QZCA 5J2DA 3KLHA 5DBCA 4I2GA 3AVJA 2KZ3A 3C94A 3KHRA 3DRRA 3C21A 4CEAA 1NKCA 4QZEA 2WOMA 4ED7A 5KTQA 2KZZA 2Z1IA 3QEWA 1B22A 1UA0A 3HPHA 4UB4A 2IA6A 2KZMA 4DFKA 3DM2A 4M41A 4F91B 4O3RA 3H8WA 1RBVA 1RBSA 3MXJA 4CEOA 5CZ2A 3EZ5A 3M8RA 1LW2A 3PMLA 8ICPA 2ALZA 4WE1A 3GIIA 4RZRA 4NLZA 2BDPA 4F3TA 1HYVA 4PHDA 3QEBZ 3V9WA 4QWAA 4O55A 4YMOA 2AJQA 3U3YA 4C8LA 2OZMA 4KLUA 5CY4A 4RQ8A 4F5QA 2F8SA 4UQGA 3NGDA 4NCGA 5KFVA 4I2HA 2E6LA 9ICEA 4LSNA 1LB2B 2E6MA 1FKOA 1C1BA 2HHTA 4DTOA 3KLEA 2B6AA 3OJSA 5L1KA 3JYTA 5CJ7A 3C1YA 5BOMA 4CEDA 1XWLA 4QW8A 4FJIA 1L3SA 2YHBA 4CF2A 2KFZA 3WNEA 4I9QA 2C2DA 3V9ZA 4RU9A 4FJ7A 4M3XA 4DFPA 4CFAA 4I2IA 1JLCA 4J9PA 4Z4FA 5C25A 5KFPA 4Z4IA 5J2FA 4F4YA 5HMLA 1BL3A 4Q44A 4J2EA 4CJQA 4ZHRA 4KAZA 5KFIA 4ECXA 3VQ4A 3AVFA 3U6FA 3LAKA 4R63A 4M6WB 4CGFA 1R0AA 4M2YA 1D8LA 4RPXA 4CJLA 3L2UA 4F93B 3RB6A 3MXIA 2IAJA 4M3YA 1KTQA 4KHQA 2G8WA 3RJGA 4Z6FA 1A76A 1ITGA 4YR2A 3KLGA 5SWMA 4M3WA 1JXBA 3ZSXA 4M0AA 5C42A 4HYKA 4QZ8A 3UQ0A 4XIUA 4IQUA 3PX4A 4O9MA 3CFOA 3K5OA 4KTWA 3OYGA 1UT5A 3DMJA 1NJYA 3VQ9A 4PWDA 3QESA 2W9AA 4KN7A 3ZSYA 1BI4A 4UB3A 4HVJA 4K4IA 1TV6A 2F1HA 4BACA 1IKWA 1ZQUA 2YNFA 1BIZA 3NF7A 3M9NB 4FLWA 2KW4A 5KFBA 3LPTA 1WSGA 4Q5VA 5HRNA 2BKEA 3NF8A 1TK5A 4N76A 3HW8A 1RT7A 3QIOA 1RXVA 1BCMA 5KG3A 1BISA 1TKTA 1XSPA 1TKZA 3PY8A 2FC0A 3D0PA 5BOLA 4MQ3A 2YNGA 3C2KA 4M3RA 1ZQDA 4DTXA 4I2PA 2ASDA 3PNCA 9ICKA 4DOBA 3QO9A 1NKBA 3LPUA 4RQ7A 4ICLA 3MFIA 2BCRA 3AVHA 4PH5A 4ECWA 4NM2A 5EWFA 1UWBA 4E7KA 1Z00B 3PX0A 1KVCA 9ICAA 1HJRA 4CJ5A 2WTFA 2G8UA 3OYDA 2HVIA 1J9AA 5KFFA 3DLBA 2C2RA 4CJKA 4CERA 4RUAA 4KHSA 3KK1A 2PYJA 1YVUA 3WNGA 4W5QA 3MR5A 2F1IA 1DGSA 2J6UA 3QIPA 4IG0A 3I0RA 1EXNA 2MUTA 2P66A 3EY1A 5KFAA 3PR5B 4KLDA 5DQIA 3U3GA 4CGIA 4E89A 1S9EA 2BCSA 2VG7A 3K2PA 3ZDAA 3B0XA 2XY6A 1HNVA 3PMNA 4CJUA 5DB6A 1RT6A 1S6QA 3V81A 1A5WA 4BWJA 1SL1A 7ICMA 1L3TA 3OSPA 4X5VA 3NGIA 3RTVA 2PFPA 5DDMA 1VSKA 2ZUBA 4J9SA 3DYAA 5KFGA 2IDOA 2IOCA 4CEEA 1YT3A 3BGRA 1S1TA 3S3NA 1XHZA 3VQPA 2P6RA 4Z6DA 5BPCA 3DLHA 3BQ0A 2BQRA 4OKKA 3AVCA 4M9JA 1GOBA 4YXMA 2BCQA 1HNIA 2OYQA 3ISBA 3ZDEA 4O44A 1S1WA 3ZSOA 3OSNA 1BPZA 4F5OA 4W5RA 3AVGA 3RH6A 4ED2A 3V1RA 2PI5A 4PQUA 3OGUA 4W5OA 4DLGA 5CWRA 4RQ3A 2ZJ8A 3VQAA 4QZDA 2W8KA 3OS2A 3CQ8A 2ATLA 2ZE2A 3JSMA 3SQ4A 3RB4A 5K14A 1ZQTA 2OPSA 5KT2A 3KIOA 1BCOA 3H4DA 1ZQQA 2HHUA 3HJFA 3A2FA 1I3AA 4Z6CA 1MQ2A 3LP2A 4ED6A 1X1PA 3OYCA 3V9SA 2UVUA 7ICLA 2E4LA 4EYIB 4TQRA 1W0HA 4CF0A 5J0SA 9ICXA 1TVRA 1WLJA 3K75D 3RMCA 1NJZA 1ASUA 5CYMA 1IG9A 3C5GA 2FBXA 9ICSA 1EKEA 3GILA 5JS2A 1N48A 1S9GA 1BPYA 3SPZA 2G8HA 1K1SA 5J2AA 3UXNA 4R66A 1RBTA 4CJRA 4JK1A 5KT4A 1UA1A 5IIIA 1BPEA 3V7JA 3HSTB 3L3VA 4FM1A 4ECRA 4Q0BA 3HK2A 2KQ2A 1NK8A 5J2EA 3GV7B 2PXIA 3O4QA 2W8LA 2JEJA 1SV5A 5L9XA 1IO2A 3FFIA 3V1QA 3O4NA 3MDAA 2MUTB 3B6OA 1S77D 3SI8A 1WN7A 3GV5B 3RMDA 4IQVA 3AVNA 3FYHA 5KFYA 5DGAA 1YTAA 7ICPA 7ICOA 5T7BA 1TL1A 2QK9A 3AVBA 4BE0A 4R8UA 3SUPA 3B6PA 1KCFA 2M9NA 4LH4A 5IIJA 1MC8A 3I0SA 4O5EA 1KRPA 3AU6A 4FJMA 1QHTA 4DU4A 2BGGA 3DLGA 1RBRA 3VQBA 3SNNA 4I29A 2XGQA 1GOAA 2HHSA 4C8MA 3G6VA 8ICTA 2AGOA 4IR1A 1UOCA 1W9HA 2IGIA 5J0QA 1RPLA 4M9NA 2PY5A 1JKHA 1S5JA 5F9LA 4DMNA 4ECQA 5D46A 4F5NA 3RRHA 1ZQBA 9ICNA 2GUIA 2YNHA 4I2FA 4JS4A 2ATQA 4MF2A 8ICUA 4LY7A 4NY8A 4UB2A 4IG3A 1RDCA 5KG6A 5L1LA 3VQ5A 4AHVA 1ZQHA 4ECUA 4CIEA 1TVAA 3HP6A 5IIMA 3C2MA 1X9SA 3ZT3A 5L1IA 4GMJB 3DRSA 1XI1A 4YP3A 2R8KA 1TGOA 1ZQXA 4R5PA 3QZ7A 5JUMA 1N56A 1ZETA 1REVA 1KVAA 4KLOA 2HHWA 4DTPA 4B8AB 4F4ZA 3ZT1A 1C6VA 5DB9A 5J2IA 4JWNA 5FROA 3AVIA 2A1SA 4RG8A 1S0MA 2JEFA 2PFNA 3SUOA 4DTRA 4I2CA 3HL8A 4HUEA 4FLYA 4YR0A 4B9TA 4DF8A 2BQ3A 3RJKA 4ELUA 3NBPA 4RW4A 4UAWA 1FKPA 3ZSQA 2QKKA 2OA8A 1T7PA 1JL2A 3C6TA 4EBEA 4O5CA 4M6WA 1JLAA 4FBUA 4OPJA 3SPYA 9ICQA 5KRTA 3IG1A 2EHGA 4QAGA 4CHYA 8ICGA 3KHGA 4KLJA 2ZTEA 4RT3A 2C2EA 3EPGA 4RQ0A 1ZYQA 1QSLA 4ED1A 4DL5A 5KGXA 4RW9A 2HMIA 4N56A 3MEDA 4KPYA 2B21A 4AHSA 4I2JA 1QLNA 4E19A 4F50A 1BPXA 4KO0A 5D3GA 1HYSA 2PI4A 4KLSA 3T5JA 4KI4A 2G8KA 3V9UA 3QINA 3NH2A 2ITGA 3PW5A 4KLQA 1JL1A 3E2EA 5J2MA 1NJXA 1S6PA 1B43A 3MECA 3RR7A 3RJHA 2QXFA 1ZQIA 2FBVA 3IHQB 4O5KA 3C2LA 4ELTA 4M42A 3E01A 4J9MA 1TAQA 1X9MA 2YHAA 4KREA 1ZJMA 3O3HA 2HB5A 2HHXA 1WSJA 1X2IA 3VA0A 5CZ1A 3DLKA 2C28A 1IM4A 3OS1A 3M8QA 1CUKA 4JRPA 3QE9Y 4F92B 1U49A 4K8ZA 4CIFA 2HHQA 4JLHA 4F2RA 2YKMA 4CHZA 4ECYA 1T4GA 2VG5A 1Q9YA 4LVSA 5HHHA 3JPRA 5HLFA 3AVAA 2XO7A 3ZSWA 4J9NA 3V6HA 3L2WA 4M9GA 1C1CA 3TAGA 5HMMA 4CJSA 3HXMA 1ZQPA 9ICLA 2FLPA 3OS0A 4CHNA 3JPTA 4P4MA 3JPPA 2O4IA 5KFXA 4ECZA 1JXLA 2X6SA 4YXJA 4O3OA 5DK5A 4MFCA 1Z00A 4EZ6A 3AO3A 4DL3A 5I42A 4Z4HA 3PO4A 4M9LA 4P4PA 1ZQSA 2W42A 5F9NA 2Z1GA 1JN3A 4NXZA 2VG6A 4L8RB 5C5JA 1CZBA 2D0AA 2DFFA 4Z4EA 3PW4A 1NK6A 2A1JB 1ZQVA 3RAQA 4MEXA 3BQ1A 1HQUA 3PW2A 1WSIA 2FBTA 4I2EA 5HRRA 1WCNA 5TZVA 9ICFA 9ICHA 1V9PA 4J2AA 3F73A 2OPQA 4CJWA 5KFCA 4FO6A 4F3OA 4F4WA 4IKFA 4CEZA 5HRSA 2YKNA 2JEIA 3KK2A 1BPDA 3AO1A 4FLVA 3PO5A 3OHBA 8ICJA 3I8DA 3H40A 1ZQAA 1S1VA 1NOZA 1A77A 5J2NA 3N97B 3S9HA 1G15A 1L3VA 4QZBA 4BDPA 2RN2A 1Q9XA 5CR0A 1WCLA 2BR0A 4B9MA 4B08A 3Q8QB 3P5JA 4E7HA 2FMSA 4JRQA 3DLRA 1EP4A 3CM6A 3JPNA 4CJFA 5FDLA 1BHLA 1VRTA 1ZQCA 1Z3EB 2DTUA 2BPCA 3SV4A 2ZJAA 4RQ2A 3TWHA 4ID5A 3PR4A 3V9XA 5J2GA 3VN5A 4ZTFA 4GXJA 2LYHA 4F4KA 4AILC 2BGWA 2BHNA 1RXWA 2ISPA 4KHWA 1TL3A 3KJVA 2PZSA 3LAMA 2D0BA 4E3SA 1WSEA 1A5VA 1B9DA 4DOCA 4I2DA 4XA5A 5I3UA 4B9NA 2BPGA 3VQDA 1CXUA 3N4MB 5KI6A 1TKDA 3OYJA 1VSHA 4QZHA 3RB3A 3CM5A 2XCPA 4YFKA 2ASJA 4M3ZA 4CECA 3V6DA 1L5UA 1D8YA 1NOMA 3ZSZA 3TARA 3KHHA 4KLFA 3UXPA 2Q0ZX 2IBKA 5J2QA 4E1NA 4CHQA 4I2QA 2I1QA 4CHPA 5KFMA 4EP5A 4KLLA 3HVRA 4UB1A 4DQRA 1B9FA 4KMUA 1RT2A 4YMNA 1JLBA 2F96A 4C8OA 3MEEA 4ZTJA 5DQHA 4YVZA 3Q8RB 5HP4A 3K58A 4HTUA 4OGEA 4Y1DA 5J0OA 3H7IA 3KKRA 3VQEA 1JLEA 1J53A 5J0UA 4BDZA 1ZQOA 3PUFA 1S9FA 5CA7A 3PVXA 4KI6A 4DU1A 3ZT0A 3L8BA 3GIMA 4YG2A 4G3IA 4E0DA 1F21A 4C8NA 4RNOA 3RH4A 3QERA 1EX4A 3LK9A 3ZSVA 5HHIA 3RJEA 1KFTA 3LZIA 1HPZA 3MXMA 3ZDBA 1J5OA 5KT6A 5KRSA 3DRPA 3OYNA 3KK3A 1UAXA 4BE2A 2J6SA 1IH7A 4ECSA 5DKWA 4E1MA 3UPQA 2UVRA 3ZD9A 4AHUA 8ICOA 4I2AA 4O5BA 4J9RA 1WAJA 9ICOA 3H8JA 4E7IA 3JPQA 1TK8A 2ZTCA 4YNQA 1LAVA 3S3OA 2QKBA 4PHPA 4OKJA 4JUZA 1K6YA 3HYFA 1DLOA 4RQ6A 2D0CA 3V6JA 1LV5A 3HM9A 8ICYA 2ZUCA 8ICSA 1AROP 1RDDA 1S0VA 3OYIA 4AHCA 1RTDA 5J29A 4QCLA 2AU0A 8ICEA 3TAFA 4FYDA 1HRHA 9ICTA 4QZIA 5EU7A 3EWAA 5J0TA 2AGQA 5J2HA 4YR3A 3KLIA 4CF1A 4KHNA 4KLEA 4B9LA 2DFLA 4OPKA 1KFSA 2ISOA 8ICKA 5C24A 2HNZA 3UIQA 1HYZA 3ITHA 7ICKA 1BQNA 3RB0A 3Q8KA 4E7JA 3THVA 1NOYA 5KFZA 4FLTA 3LWMA 4ED8A 4LZGA 4EP4A 4PHEA 1RTHA 3CFRA 5J2KA 2FMQA 4F8RA 5J1EA 3P1GA 3BQ2A 1Y88A 4KFBA 2P6UA 4QWEA 3HVTA 4YFUA 1SZPA 2NUBA 4FS2A 3LDSA 3CFPA 1DTTA 1LAWA 5DG7A 3AVKA 4FW2A 3MDCA 2VWJA 1VSFA 3QZ8A 4I28A 2Y1IA 1ZQMA 4DSIA 2MAXA 4N47A 4RPYA 4PA1A 2IMWP 5KFKA 1QSYA 8ICRA 1LWFA 2UVVA 4CEFA 4Q8FA 5HBMA 1NK9A 3SQ2A 1C0TA 2FBYA 4FLUA 5KFSA 2XY7A 3L2VA 1C1AA 1ZQNA 4DLEA 1WSFA 4IRDA 2OWOA 3SUNA 3QEAZ 4FJJA 3RMAA 4DQPA 3TAQA 4DSLA 4HUFA 3O3GA 2R7YA 3ZT4A 4MFBA 4FM0A 1ZQLA 2BCUA 5KFRA 4EBDA 3KD5E 4CGJA 4N5SA 5DB7A 2IHMA 2OZSA 3OYAA 5KFWA 5DG9A 3TQ1A 4QW9A 3UXOA 3NCIA 4DQQA 4B9VA 1EXQA 1VSIA 4NM1A 4IR9A 3QNNA 4CIGA 4PGQA 4CESA 1HQEA 4J9LA 3PV8A 3MGHA 1QQCA 4IRKA 4O0JA 1C7YA 4ZH4A 4CEBA 4I2BA 3SQ1A 3T1AA 1I39A 2XHBA 2AQ0A 7ICFA 3PW7A 3LP1A 3G6YA 3K59A 1CEZA 4UBCA 3M9MB 5FRMA 2BCVA 4YD2A 4FZYA 3F9KA 4YMMA 1S10A 3ISCA 4YD1A 3BDPA 1JLGA 1RDBA 8ICZA 2O4GA 4JV0A 3IS9A 4BE1A 4QZAA 4M47A 1S97A 1U48A 5CYQA 4O0IA 3L2QA 4B3OA 3V4IA 2RF2A 3HWTA 2VANA 3M9OB 2DY4A 3Q8SB 3M8PA 4B8CA 5CB1A 4CF9A 1CLQA 3GDXA 1KVBA 4OJRA 4CHOA 4UAYA 9ICVA 3OYBA 3MBYA 4FK4A 4B9SA 4CGHA 3HPGA 4LSLA 3EW9A 1NKEA 5DB8A 4BXOB 3QEVA 3V6KA 4KLTA 3ISDA 2A1JA 4QWBA 2AQ4A 1S0OA 3ULDA 3JPSA 1RT5A 1SKRA 4DSFA 7ICHA 3T5HA 4KTQA 2JZBA 4K4GA 4Z6EA 1B92A 4JV2A 3M8SA 1ZBIA 4DEZA 3GQCA 2ASLA 4AHRA 2AGPA 4F5PA 3OY9A 5E41A 9ICJA 1ZBUA 2XY5A 5KFHA 3MR3A 3S3MA 1ZQJA 4YQWA 1RTJA 4Z0UA 4MEYA 4O3PA 4DQSA 1A5XA 2V9WA 3ISNC 4NCBA 2PFQA 1U04A 4NLKA 2R8IA 1S1XA 1T05A 5KFQA 1ZBHA 2P51A 4O4GA 1CZ9A 3C6UA 4QWDA 2HVHA 1T03A 3SYZA 2RDJA 2VA2A 4IFVA 4KRFA 8ICHA 3WNHA 8ICQA 4KLIA 3MR2A 3AV9A 1NK4A 2G8IA 8ICNA 5DMRA 3OYMA 2RDIA 3GFKB 3MFHA 3ALYA 3OVNA 4TSXA 3LP0A 4RPZA 4DTUA 4ID1A 4GC6A 4HCBA 9ICMA 2GWSA 4NLGA 4O3QA 5J2JA 1MSWD 3LP3A 4Q45A 3PW0A 3LWLA 5HNKA 8ICCA 4ELVA 3QEIA 4M04A 4DTSA 3LDAA 4DTJA 4IBNA 8ICVA 4FJGA 3OYLA 1ZQZA 3G0ZA 4IFYA 1LWCA 4QWCA 1ZBLA 5SZTA 2RKIA 3RWUA 1SL0A 1D5AA 5EWGA 3BJYA 3K5MA 5J2BA 4QZFA 2D5RA 4J2BA 1K1QA 4AH9A 2NRXA 3V7LA 1ZQFA 2NRVA 1RBUA 9ICUA 3RR8A 3RMBA 4GC7A 3HP9A 2IHNA 1YTUA 4EBCA 4ECTA 2NRWA 1U9LA 3MGIA 1T8EA 3OYFA 3SCXA 1BPBA 3KD1E 2X78A 3T5LA 4GXIA 1FK9A 5KFDA 5IIKA 5KFNA 2DPIA 5HROA 5KT3A 4FXDA 4J9OA 4KLMA 2ETJA 3ZCMA 2KTQA 3D45A 4FW1A 1ZQEA 3VQ6A 2B4JA 3VQ7A 3HT3A 3G6XA 3G10A 2JZBB 3AO2A 4DF4A 1Q8IA 4Y1CA 4ECVA 3TAMA 4OGCA 3DI6A 1RT1A 3H8SA 4CCHA 7ICEA 7ICSA 4JV1A 3MEGA 3CG7A 3NH0A 1SKWA 4KB0A 4CK3A 5L1JA 4HHTA 1C0MA 3C95A 8ICIA 5KFEA 2IS3A 5DDYA 2BQUA 2P1JA 3KKSA 1WSHA 3HX0A 3TAEA 2YNIA 3ZT2A 3AUOA 1T3NA 2GV9A 1JIHA 4FJHA 1ZQYA 5KFTA 4C8KA 3GV8B 3AVMA 4TUPA 5IIOA 1TFRA 3O3FA 2OPRA 2OPPA 4DL6A 4H4MA 2HHVA 3QEPA 2ZD1A 7ICTA 1KFDA 4KLGA 9ICBA 3NTUA 3OYKA 4PY5A 5J0YA 4F4XA 4RW6A 2Z1JA 1BVSA 4CFCA 4FJ5A 3DLEA 1VK0A 3K5LA 3LZJA 2G8FA 2R8GA 1RZTA 4CJTA 4IQTA 1JX4A 3QLHA 4RT2A 4J9QA 4PGXA 4W5TA 1RNHA 2HNYA 3AA5X 3ETLA 3AU2A 2DPJA 7ICGA 4Z4GA 1LW0A 4Q8EA 4FK2A 2JGUA 1XU4A 2X6NA 1QSSA 7ICJA 4Z4CA 4FJLA 1RYSA 7ICRA 5KG5A 4DTNA 2FPLA 3LALA 2G8VA 1DOQA 1J54A 2W9CA 3AA2A 3NDKA 1S76D 4FBTA 4RW8A 2XGPA 1XSLA 4FCYA 4FJKA 4K8XA 8ICFA 1WNSA 2I9GA 2VA3A 3NE6A 2FPKA 4FJ8A 1JMSA 4UB5A 2PYLA 1RT3A 1X9WA 2KFNA 3IM1A 1KEJA 1LWEA 2FLLA 4KHYA 3KLFA 8ICXA 4EZ9A 5J0XA 5DBAA 3RJIA 5KFUA 5D4BA 4GXKA 4MFFA 1BIUA 2FMPA 4UAZA 4R64A 1WAFA 3SI6A 4NYFA 3SJJA 2YV0X 4KTZA 1IKXA 4DOAA 4EYHB 3L2RA 2HW3A 4RNNA 2ZJ5A 4TQSA 5KT5A 3AVLA 3MR6A 5EWEA 4W5NA 1VSDA 2ZTDA 4FVMA 1TV9A 3OHAA 3GIJA 8ICLA 5J2CA 4CEQA 4CF8A 1EETA 1N6QA 2GBZA 2V4QA 4PHAA 4K4HA 2R8HA 5J0PA 4CGGA 5DBBA 1HUZA 3EPIA 2X74A 1O1WA 3TANA 4F2SA 2KN7A 2W9MA 1ZQWA 4CGDA 3OYEA 4DG1A 4DO9A 5KFOA 2A1RA
chains in the Genus database with same CATH superfamily
2CQIA 4W92B 1BC6A 3MM6A 1QHAA 3MAQA 1O6XA 3LL3A 5LMUK 2GO7A 4UF4A 4H0XB 3NFAA 1BQMA 4JWMA 1WUUA 3KBBA 4DL2A 2HWTA 4PUOA 3OVBA 4X4RA 2X1GA 4H4MB 4Y0WA 2ZD1B 2I5JA 4K5RA 2CRLA 1YIJS 2Y0SF 1VLYA 4Q43A 2JLFA 4P2HA 3VQQA 4ZPVR 4HCCA 2ZVSA 2KIVA 2CGKA 2CFXA 3EYZA 1C0UA 2FXUA 4CZEA 4MFAA 3PSIA 2XC9A 3KJNB 3IP0A 1JJ4A 1NMDA 1XHXA 3U7JA 3IBWA 1UVNA 1LFPA 9ICPA 2YY6A 2P9SB 1MWMA 1NZBA 2AJ0A 5DG8A 4DDFA 4U8VA 3QRRA 1NSQA 1S1UA 3SMZA 1NK5A 2NXUA 4CFDA 3H4BA 2DIVA 5BR8J 3C23A 4O0NA 2ROPA 5D4OA 2FHOB 2PFDA 1WUAA 1VSLA 3PZPA 2W54A 4CK2A 3TUJC 1BGXT 1HPMA 3CT9A 2VZ9A 2P9EA 1RT4A 4AL6A 1BU6O 2W4PA 5BN8A 5ETLA 3R27A 1E4GT 2HSZA 5HSPA 3T9ZA 7ICNA 1IKXB 4B3TK 2FLNA 3OJUA 4ANCA 4FF2A 3DOKA 4UOFA 1HWUA 4IG0B 4URGA 5AIBA 1RHQB 1KLMA 4DTMA 4ZLLA 8ICWA 1S5LU 3NF6A 3KUHA 2V67A 1HNVB 1X5SA 3DOMB 4K4XA 1IXRA 2WVDA 2B3TB 3BQTA 1GFWB 5AT1B 2W9BA 4HH1A 1K8AT 1DK2A 1SL2A 2P9IA 3UCGA 4FJXA 4X66K 4NMXA 4RQ1A 3W65A 5KG1A 2QLJB 1JLQA 5AM5A 3RUBL 3AA4A 1U2FA 4CO1A 2EAMA 1HUOA 4DL0C 4NXMJ 3HMJG 3GR1A 2F1JA 4HHHA 4B3SK 4IDKA 2EAOA 1ZM3A 2X3GA 1D9DA 4ED5A 5F41A 3T5KA 1HL6A 4OZ1A 5CE3A 3KYLA 1Y5NB 4OI3A 5AKYA 1IBCB 5K4LA 5IXUA 1B64A 5ETTA 1RAOA 1FWLA 4R0JA 1RLDA 5C2DA 5A2QU 4M5LA 1IKVA 1QE1B 1NMEB 3JAMY 3Q8PB 3I96A 3O6WA 5GAGI 5K14B 2K3IA 1VC5A 4FZZA 5HP1A 3LP2B 3OVSA 1N34J 2DFHA 5DLFA 2Z58B 3L7OA 3VGTA 7ICQA 1TVRB 4DFMA 1OWXA 5GAGU 3CJ0A 1MWKA 1Z1VA 1J6ZA 2V68A 8ICMA 4DSJA 4AM7A 4YUDA 2R7RA 3W9HA 2GMJA 1VQON 4DQIA 2W7PA 2IM0A 4OI2A 1XC3A 2GVDB 3IUCA 1IKYA 3Q8MA 3SMSA 3VAKA 2IC3A 4FZLA 2OYYA 2JWKA 3NS1A 3S6JA 3CCES 1TKXB 1HLUA 2PC6A 1D9FA 3EVOA 4QYZJ 4FS1A 4P2SA 1RQ0A 2KHVA 4WKRA 4EEYA 2QTDA 2DR7A 2ZM6K 4YDUA 5DDOC 4YB1P 3FFIB 5BR8K 4N8OA 3UQ2A 3OTQA 4TUQA 1FDAA 2JLGA 3FUYA 4U7CA 4P4OA 3CCUS 1HNXJ 5B8HA 4GW6A 1K47A 2LMIA 1WEZA 4Y3CA 3T41A 4PG7A 4WCEL 1SUQA 1N33J 1MU2A 4TURA 1WDTA 2HKEA 1N0VC 4DR4J 5AHXA 4DV3F 4LQ3A 4OYPA 2DFEA 1YBAA 3IGVA 3FAHA 2DPNA 2W7AA 4Y2MA 4JI4F 5JVGL 1CJKB 1DAXA 3VQ8A 4C98A 3QJJA 3ENAA 3H5YA 5DBCA 3B54A 3MDFA 3DLGB 4YOUA 1VQKN 2WOMA 3IMQJ 4X64J 2DRDA 2YHWA 2FHJA 2O8DB 4BC5A 1B22A 4JYAJ 3Q8YA 1H6KX 3ZXWA 3DNCA 1RBSA 2BZFA 2W41A 3O8MA 3VALA 3M8RA 1LW2A 2GUPA 1FA0A 2YNHB 4WE1A 2WF6A 3ENOA 2VUGA 4IG3B 2M0GB 4L3NA 5A2QO 1MN9A 4C8LA 2DNPA 3W8GA 2E3TA 5JMNA 4NCGA 3VAFA 4DUZF 3N79A 1R0BG 2WF8A 4QQBA 4GKKJ 1LB2B 1HMVB 4NXMK 5H2FU 2HHTA 3KLEA 2RRDA 5AQFA 4P52A 5M1FA 3JYTA 5CJ7A 3C1YA 2DH8A 2W2NP 4CEDA 2D4WA 2AZ1A 1L3SA 3D2QA 2KFZA 1X4GA 3V9ZA 2NXEA 2R4FA 4CFAA 2PA8D 2QMWA 3EZUA 2LDYA 5KFPA 5J2FA 3BY5A 4F4YA 5EN1A 5EHHA 5LMNJ 4Q44A 1FKPB 2F8KA 2Q6CA 4CT9A 2BXJA 3AVFA 4M6WB 2IDEA 2LHTA 4WF9Q 4I6YA 4X4SA 1H1VA 1P8ZA 4FO0A 1U6BA 3M30B 1D8LA 2VQEJ 1Q1KA 2O1PA 4BR9A 5FLXY 4MKVA 1FRMA 2W01A 5LM7E 2V8GA 3L2UA 4OLPA 3RB6A 1OXJA 3MXIA 1KTQA 4UY8T 2G8WA 4KHQA 3RJGA 2IRYA 3SENA 4YR2A 1JXBA 3ZSXA 2WW8A 2Z7JA 1ZRMA 4LREA 4FYWB 4ZS6A 2DYAA 3OR2B 4J90A 3UQ0A 1R3NA 4KTWA 3BBCA 1W7WA 4K4WA 2FZGB 1NJYA 3VQ9A 3GG1A 3N01A 2BUNA 3DXMA 5M1PA 2LFVA 3PHEA 3EE9A 1JLFB 3HKZF 3IG8A 2QGFB 5LY3A 4FPAA 3MECB 4GO5X 3BPSP 2RB7A 2N1RA 1HWJA 2P9SA 1UHUA 4Q5VA 2A0FB 3M7VA 5HRNA 1V85A 3NF8A 3GR0A 2HF4A 1M90T 2UUCF 1ZZFA 4ZVGA 3W64A 3ZZYA 2BRKA 3WC0A 4IJNA 3HRGA 1M5OC 2KG0A 2CH6A 3EVWA 4RNHA 4RUHA 3K7RA 2BBEA 4RUBA 2ADBA 1HKGA 4DOZA 1YBTA 2F4VJ 2OM6A 2D41A 2G0CA 1J2VA 4UB6U 2W2OP 3TEGA 5HMZA 3H0LB 2J7WA 1CJUA 4X64K 1NAQA 1L3KA 1VC6A 4PH5A 2HFUA 2K06A 3NS5A 1NPRA 4C3LA 3VGKA 9ICAA 1VJQA 5GADI 3OXGA 3MTKA 3MN9A 3H8YA 5I42B 5KFFA 2CKWA 2CQPA 4CJKA 3HTVA 4CO0A 3E1YA 3H3NO 3GMGA 1YVUA 3WNGA 5LSRA 2F1IA 3GZFA 1DGSA 4IG0A 8AT1B 4DX5A 3EY1A 3K1ZA 5GADU 3M2RB 5E79U 2LYVA 1FI4A 2CIMA 2EC2A 2BCSA 3K2PA 3VPZA 1A6LA 3B0XA 1HNVA 2K7KA 3WQTA 3Q24A 1DT9A 4CJUA 5KAIU 2A19A 2MPUA 1A5WA 4QR1A 2MSSA 1RCXB 7ICMA 3G82A 2RUGA 2OCEA 1RCOB 5A6WA 3TP2A 1FE0A 1WTFA 3NGIA 5SUHA 4WQ4A 5DDMA 1VSKA 3NMRA 1VQ5N 3NP5A 4H0VB 2P9PB 2H48B 1Q18A 2X3DA 4ALZA 1YITS 2P6RA 1NRKA 3PSPA 5DDQC 1NM1A 4Z6DA 3SXLA 4WK3A 3DLHA 4A59A 5ETVA 2BQRA 3AVCA 3EDQB 2IAJB 1U6ZA 4M9JA 1JJCB 2BCQA 1EP4B 1HNIA 5H9EK 2IMOA 3H42A 1K73T 4O44A 3Q8UA 3UR0A 5AICA 1IBLJ 1HIYA 1N5QA 4QS9A 4MK9A 4OI4A 3OUYB 3VQSA 3AVGA 3RH6A 3DMJB 1B0VA 3KZIU 1YJ9S 4LC9B 2ZJ8A 6AT1B 1PJ5A 4ATNA 3VQAA 3T6BA 2FHKA 2N4CA 2CJXB 3EE8A 5JXSA 1VIOA 3OS2A 2XZTB 2G5IB 3SQ4A 3CIZA 1TL5A 4JKDA 5K14A 3T1HJ 3KWMA 1VQ9N 3H4DA 3JQMA 5HQMA 3LP2A 2ACMA 1ZM9A 3V9SA 2UVUA 4WFYA 3J7YI 4EYIB 1GMVA 3QU4A 1SXEA 4CF0A 1TVRA 2QZ8A 3K75D 5B0AA 3THYB 2UXDJ 4QR0A 1IG9A 3FGUA 2VJVA 5J2QB 1N48A 3AARA 3HOTA 1K1SA 1IBMK 3H0MB 5GAEI 3J7YU 2EQYA 5LMUF 5J2AA 4L3KA 4CJRA 3QT8A 2EFVA 2EFOA 1I3OB 1Q82T 3LM9A 3HM8A 1YKWA 1HR0J 2G07A 3MX2A 5GAEU 1BPEA 1E4FT 4JB8B 4NB4A 3FQKA 1JLEB 1FX4A 4WJBA 5AQOA 2VOPA 4RQMA 1NPPA 2DIUA 1M5PC 3O4QA 1ZZNA 2JX2A 1VQNS 2YH1A 2DQNB 4UAVA 3FFIA 3M6VA 3V1QA 3LVVA 3QIPB 5GMKa 3BO3A 2MUTB 1XR6A 1S77D 3GV5B 2Q0RA 3P39A 7ICPA 2VG7B 1UVIA 3SUPA 3R9KA 1T9WA 1RT6B 2ACYA 2VL1A 1S6QB 4LH4A 4F7VA 2E1MC 3KNGA 2B7CB 2LYBA 3MCNA 4O5EA 1CJKA 4PKGA 4FJMA 1ZXOA 4DU4A 2LQJA 3ILOA 3KMSA 3ISZA 4F4AA 3DLGA 4BLGA 4FF4A 3DYAB 3ZTSA 5AI0A 2GELA 4CZIA 4WFNL 4C8MA 1YHQS 8ICTA 2O8DA 4Y2VA 2AGOA 2W25A 4Y2JA 1UOCA 1X5OA 2O8EA 1BE4A 3R6MA 4G1PA 1S5JA 2H3FA 4DMNA 5T41A 5D46A 4M5KA 3R5DA 2YNHA 2G5HB 4I2FA 1UVKA 3CDWA 2O5DA 1Q8BA 2VFTA 2WBMA 2KFYA 8ICUA 3Q7CA 2I6XA 4LY7A 3ATVA 5AK4A 2P9UB 2AIRB 2QA2A 3FRZA 2VGMA 4IG3A 3GFXA 4J5OA 4KX3A 1ZQHA 4FXVA 2VFRA 4CIEA 3FZKA 3EZOA 4B3TF 1TVAA 4J7CA 5IIMA 1OIAA 1M1KO 2MZTA 1NU4A 3ZTQA 5L1IA 2O66A 2ZUGA 3LGMA 2EC0A 3J81U 3NCRA 3GJSB 1N56A 1REVA 1BNOA 3ITHB 2OPSB 2Q6BA 4DTPA 4ER8A 3CJ5A 1YG0A 3TX0A 3NUQA 4LF6K 3DHWC 2QA1A 7FDRA 4RG8A 4X62J 4WP9A 4F3QA 4KFBB 5D8HB 1VQLN 1UPHA 1WWUA 1S9GB 2HQ3A 4FLYA 1NGIA 4FKYA 4X66F 1DJ0A 2BDUA 2PMZC 3CJ2A 5IFMA 4H5NA 1IBKJ 1FKPA 3ZSQA 2QKKA 2E5HA 3A3OB 4BR2A 4A8YA 3UVJB 4EBEA 2A5XA 4M6WA 4CGZA 3GCXP 1RDWX 3VEOA 1ZC6A 1X6IA 2EG1A 3SPYA 1N4LA 9ICQA 2N3LA 4B3SF 3M30A 1Z4NA 1FJCA 8ICGA 1RAHB 3KHGA 3CQYA 2D0OA 3PFOA 2UXDK 2CWXA 2GVZB 2DY1A 1U6FA 3UE5A 1WC5A 1M5HA 2EEYA 4I2JA 2X51A 1RFQA 1BPXA 2BJ7A 4KO0A 5J1NA 1AFIA 2PI4A 5CD4A 4KI4A 1LNQA 2V51B 3TSUA 3NH2A 3ETMA 3R7SB 1WDDA 4OMFG 3PW5A 4KLQA 1NJXA 3MECA 2XO6A 2YQ3A 3RJHA 4WJ3B 2FBVA 2ZJPL 3C2LA 1MWQA 3VCDA 3BH6B 1OH7A 5DDRC 5GVQA 3GDQA 1TR0A 1WSJA 1X2IA 4UATA 2HBZB 1TFWA 1W2BR 1KVKA 1M1HA 1G4CA 3HVWA 2VQFK 4JRPA 3OTEA 3CO0P 1U49A 2HWIA 2Y9UA 4F3MA 3O3LA 4JLHA 1VHFA 1S7HA 4ECYA 1T4GA 3HFVA 3L9ZA 1W25A 5HHHA 2QKQA 2CZ9A 3ZSWA 4J9NA 3V6HA 2FJ6A 2JVRA 3FC9A 5HR7A 1WC6A 3GSDA 5M2UA 5HMMA 1OMSA 5CHIA 1LXNA 4CHNA 2ZM6F 4P4MA 2O4IA 5KFXA 3J81O 1WD6A 5DK5A 4EZ6A 1IG8A 3CCLN 3DRSB 5BR8F 2DO4A 5I42A 4ZPAA 3PO4A 3E51A 3KDOA 2ZJQQ 2XZDB 3DU6A 2HZVA 3DDHA 4V19J 3CP8A 4AYBC 4L8RB 2KB2A 5C5JA 2D0AA 4Z4EA 1QVFR 1NK6A 3M2RA 1K8AO 1L8LA 4MEXA 3WEEB 2VD3A 2LEAA 1WSIA 2O6KA 1RT5B 1YVFA 4I2EA 3ATUA 4CD1A 5TZVA 5A8KA 2RHKA 1F5AA 2LECA 4F3OA 4F4WA 4IKFA 5AXLA 3CCJS 2PSZA 1AB8A 3C6TB 2DHGA 2KT5A 1KOOA 3VENA 1NPKA 4HDGA 1KC8T 5ETKA 3UMBA 5AFUA 2W2PP 3OHBA 3HSGA 4CNYA 2PMHA 4DR1J 2VFSA 1NOZA 1F3VA 1WC3A 4LSZB 3BSNA 4LVNP 2P9PA 3I56N 5KOXA 2I0XA 1L3VA 2N82B 5CR0A 2BJEA 2BR0A 3Q8QB 3D2FB 2DR6A 2P35A 1EP4A 4DR6K 4OIXA 1F2GA 2DCUB 4FYVB 2ZBIA 5G5HA 4CWBA 1IBKK 1CBKA 3D7EO 3O9RA 1VQYA 4RJVA 2V5HG 2ZJAA 1BWEA 3OUYA 5D3GB 1WKKA 3PR4A 3V9XA 3VN5A 4NXMF 1JK9B 3VF2A 2BJ1A 3CJ7A 4GXJA 2JH7A 2PE8A 4P6QA 5J2MB 3LA0A 1B9DA 3PRDA 3OL8A 3SFGA 4USKA 4KQZA 3GFYA 2VYPA 5KI6A 4NXNK 5BXIA 3E01B 4QZHA 3GL1A 3HI9A 2B56A 4Q2LA 4YFKA 5F3XB 2DHXA 4ES1A 1VISA 2E2NA 3VR1A 2DR9A 1D8YA 3UDCA 1FWPA 2HCFA 2XSFA 4KLFA 2HAIA 1VBKA 3UXPA 1YGYA 2Q0ZX 5J2QA 2ZEJA 4E1NA 4CHQA 4OHWA 2ZIXB 1B7FA 5KFMA 2WVCA 4UB1A 4KMUA 4P0QA 1VQ8S 1RT2A 2NO4A 3KUGA 4CZFA 2F9JA 4C8OA 4FZNA 4YVZA 1Y00A 3SEIA 4TKTA 2DR8A 2M70A 5HP4A 2EWSA 4HTUA 5A2QY 1FVQA 4DV1J 2J5AA 2ILZA 1KD1T 4A8KA 3AM9A 1JLEA 1J53A 5E7OB 4BDZA 3PUFA 3NNAA 1FRLA 1KDNA 3PVXA 2IM1A 4NL9A 2NXNA 4MO4A 3Q0AA 3G71S 1HKBA 3U27A 4JBCA 1FK9B 1V3RA 1F21A 4C8NA 4PKHA 3R1LA 4I6WA 3MM7B 2CQHA 3QERA 3LK9A 2VB6A 1UAWA 3RBXA 2VOOA 1BDGA 1GX5A 1HQUB 3MXMA 4DHVA 1U1KA 3N6MA 2BH1A 1O03A 5I3QA 5T7LB 1GTEA 1N61A 3OYNA 4BE2A 3OL6A 1K0VA 2J6SA 4AQYJ 4UOHA 2HGLA 4KT0C 1SJFA 4E1MA 3UPQA 5AQKA 1AA1B 2XMVA 2UVRA 3K9KA 2OXOA 1V4SA 3C66A 4NYOA 4I2AA 2OTLN 4NMLA 2AMCB 3JPQA 4OYAA 1OSCA 2YKNB 3CPWM 4N7TA 4DV6K 2ZTCA 3MEGB 5D4NA 3JTPA 5ETQA 2IYGA 4F71A 1R8AA 3WXIA 3CD6S 2QKBA 4L76A 4OHVA 5DDPC 1K6YA 2XLJA 1NWKA 2DGZA 2ZUCA 2OI2A 2IY5B 1RDDA 1S0VA 3OBYA 3FZHA 3BS5B 2XG8A 1NHKL 3ID8A 2CPEA 4X64F 2P9UA 1DQAA 3P4UB 9ICTA 4QZIA 3ED5A 3EWAA 2FJDB 2BVZA 4URSA 4DR1K 3A4TA 4RW6B 4OD0A 1S59A 4KHNA 2ASPA 3DLEB 4B9LA 3RU0A 2FVPA 2D9PA 1KFSA 8ICKA 4WP3A 2KN4A 3UIQA 3ITHA 1GLLO 3O4WA 7ICKA 2KT3A 4L6V3 1NGHA 4PXEA 2A10A 2J4RA 4EP4A 4CP5A 4ILHA 4ZPWR 4F8RA 2FMQA 1T3OA 4KFBA 3WT0A 3D28A 4YMEA 2F8HA 2PDAA 5AM4A 1ZTWA 4WXWA 2AYGA 3KKAA 1LAWA 3AT1B 5LXYA 3UQSA 3F5EA 3MDCA 2EG2A 4RW8B 5GIOA 2G2OA 4DSIA 3ILJA 1ZAXA 3ULEB 2OLWA 4USMA 2C42A 4UY8O 2KLAA 4CLLA 2AEJA 2CADA 4Q8FA 3GYXB 5HN0A 2DRBA 2ITMA 3MPUB 5KFSA 4RBUA 2XY7A 4KGKA 3L2VA 1GX6A 2OWOA 2LEBA 3PJ9A 3TAQA 3AB4B 1S48A 4P7VA 1VQPN 1WOSA 2EFNA 4DR7K 1ULRA 1ZQLA 1RK8A 2GJFA 5ALGA 4ISGA 1JB0C 3IDWA 5HVGA 2A18A 3EGVA 3O08A 3MN5A 3OYAA 5DG9A 3TQ1A 1BLUA 4CNZA 3NS7B 4URQU 3UXOA 1Q8KA 3NCIA 4HTLA 3FZLA 4NM1A 3QNNA 4CIGA 1RBOB 4K50A 4J9LA 1OY9A 3DRYA 2J0SD 3MAAB 4USVA 1QQCA 1C7YA 3K1RB 4I2BA 3SQ1A 1I39A 5F8NA 2ZH9A 2KM8B 1IBMF 3G6EN 7ICFA 2RS8A 1ESVA 4B3RK 5ALUA 1U0HB 3K59A 1CEZA 4UBCA 3M9MB 4IO9Q 1N36K 3ZZRA 5ALEA 1UKUA 3F9KA 4YMMA 1S10A 2HSEB 3FCVA 5DO2A 3M2UB 2Z2MA 2DISA 4DCCA 3CMAS 4M5JA 4QZAA 5ADXA 4MIBA 4LFAJ 4F67A 3V4IA 1EQ0A 1PKUA 2VANA 3KLIB 4FYXB 2DNLA 3M8PA 4B8CA 3GBTA 1G1XA 5CB1A 1CLQA 4BQZA 2YWKA 3OLBA 3OYBA 4O3MA 1KQQA 1AYEA 4HR2A 3HSJA 1URNA 1CS4B 2DGUA 3P6YC 2XNRA 3MC1A 3ISDA 2AQ4A 3WEEA 3THWB 1SH3A 3MCAB 3IWLA 4C1NK 1KONA 3ZNUA 1KL9A 1RT5A 3SSRA 3HZ6A 1MMDA 1B4SA 9RUBA 2HK3A 5M1NA 1SXLA 2X1FA 2MJNA 3MMVA 3TJ9A 4JV2A 4F02A 2HOQA 1R7IA 3M8SA 3BF4A 2ASLA 1LK5A 5M1OA 2AGPA 3MMAA 3MMBA 3T7ZA 2WRMA 3A8IA 3I76A 3KJFB 2XY5A 1D8BA 4RX6A 3CWJA 2IVOA 1K73O 3S3MA 1SQEA 2VFUA 1E6VB 3RFAA 2MQOA 3UDEA 1C0TB 5E5NA 1A5XA 4LF1A 4FP9A 1RISA 1KWMA 3CCRS 4KR0B 2VV5A 2P51A 1WG1A 4ZVPB 3PXGa 1QAXA 3A1YG 3J7YP 2BE9B 3KLVA 4CYUB 2HHHK 2HI0A 4JI8J 3SYZA 2RRBA 2ES6A 3ZFVA 3BZKA 1BO5O 4IFVA 4PZOA 1PVRA 3MWPA 8ICQA 4KLIA 1VRUB 3W9IA 1DGJA 1NK4A 2G8IA 2FDNA 5LSOA 4WU2A 2GHVC 3DDKA 4LF6F 3MFHA 1TL7B 3OVNA 1Z19A 1FRJA 1HD0A 1AFJA 2NRRA 4HCBA 2LKYA 1MSWD 3AODA 3T69A 2ZGZA 3G96A 8ICCA 3F5TA 2PA3A 4M04A 4UZBA 3I8BA 4BRFA 5GIPA 2NCKL 4DTSA 5AQYA 1Q82O 2H1YA 8ICVA 4EO8A 2IVFB 4F25A 2DK2A 3QFPA 3W2VB 1JLGB 3PIPL 2HVDA 1ZBLA 3IS9B 2WVBA 5EWGA 3S41A 5CYQB 3K5MA 5AKHA 2LVWA 5CEHA 4PR6A 1K1QA 5HI7A 1UVLA 4CF3A 4Z37A 2POKA 2NRVA 9ICUA 2UXDF 1JNZB 4GC7A 3IRXB 1YTUA 3NWGA 4EBCA 3OYFA 2GOLA 1OS5A 1PGZA 3T5LA 1FK9A 2DH7A 5KFDA 4LSLB 4G9ZA 4PXDA 5IIKA 2C3OA 2VBZA 4ZIWA 1ZPVA 2RT3A 3D6FB 2JV3A 4J9OA 1Q7LB 4K0KJ 2KTQA 4IOCQ 4JHDA 4I4BA 4OFZA 4LFAK 3G6XA 2QTWA 2V8VA 1DTQB 4FZVA 1HNZJ 3UN3A 2WHOA 3R7NB 1OYDA 2EPIA 3FBEA 4ZDNA 4OGCA 3BM7A 2P5VA 7ICSA 2VQFF 4JV1A 3MEGA 2XULA 4K59A 1GLEG 2O8FA 4CK3A 3TR5A 1H7WA 4LF4K 3RW6A 5DDYA 2CJBA 3ZLJA 5HATA 3R5CA 1NLKL 1WSHA 4ISEA 2NZTA 3ZT2A 4OJHA 1OY6A 1J5EK 3AUOA 3BS5A 1T3NA 4PABA 4FJHA 5HK4A 1ZQYA 3WK6A 3PM9A 4TUPA 1HIWA 2H4WB 3C6UB 2CQGA 2OPRA 2OPPA 4LFBK 2QB0B 3OYKA 2W1BA 2ZZNA 4U7UD 5HJXA 1M1GA 3TA2A 4RW6A 1NXIA 2J8AA 1M0SA 2HQGA 4FJ5A 3DLEA 4RW7B 5AXKA 1LFWA 2QA4N 2LMRA 2R8GA 2X1BA 4KIAA 3MTJA 3QLHA 2W04A 1CULA 4RT2A 2NSBA 4G65A 4PGXA 4W5TA 2FC9A 2MQLA 4Q8EA 3C14A 4FK2A 3AJ2A 3CC7N 3LQVA 1VIXA 4P74A 2KEYA 3OFEA 4Z4CA 4FJLA 3MWBA 2CPRA 4JI3K 3D67A 2RLTA 4BS2A 4OJ5A 3SFUA 3H5SA 3NDKA 4M5GA 1HBMA 2XGPA 4RW8A 3CCWA 4IQMA 4L3QA 3ULEA 4IXCA 2MZ1A 1YRUA 2I9GA 3QUTA 4DR6F 2AH5A 1YWXA 3J81Y 1JMSA 4RTFD 1IBKF 5AKEA 1VQMS 1LWEA 3P8BB 4K4UA 1RHKB 3HJEA 1OW5A 2YQEA 3MM5B 2RU3A 1WWHA 5EVZA 4UAZA 1FKOB 3WIUA 4KTZA 5AQPA 1FFUA 2HW3A 3LTOA 3BB5A 5KT5A 2VC1A 1NGDA 5EWEA 4W5NA 2QRRA 1VC0A 1X8DA 4R0EA 4NXNF 1PVPA 4FVMA 3GIJA 5J2CA 2P6SA 4LMZA 1APSA 3DI6B 1WI6A 5DZ6A 2A2CA 1FE4A 1X40A 4PHAA 4M5DB 4K4HA 4JI6J 2R8HA 5J0PA 1JLCB 4CGGA 5DBBA 1HUZA 3TVYA 3MAAA 2X74A 1O1WA 2OGUA 1PYTA 3WKDA 2F3NA 2WMMA 3LPYA 3D4JA 1RWXB 4UY85 3CMEN 1WC0A 5KFOA 3P3DA 1U0HA 1Q8LA 2JR5A 2F9TA 2VICA 4NLTA 1QS4A 3RBDA 3M2UA 2HZAA 4PG6A 1RU2A 5EUHA 5J2PA 3DEEA 2GJIA 3BH7B 4CJVA 3TAPA 3C1ZA 4GNIA 1Z25A 3TZXA 1XC9A 1SWVA 1RYRA 1SWWA 2NR0A 4CE9A 1ZQGA 3QNOA 1HBNB 4CF4A 2MZQA 1TYQB 2B9XA 3AY9A 4DV4J 3F2BA 3WXLA 2ZITA 3RJJA 2PMZF 1AZSB 2K7JA 4DFJA 2BW7A 2DHSA 4YY3J 3OD2A 1CS4A 2YHYA 2E5GA 3NLCA 1TV6B 5AE3A 2V63A 1S3XA 5IC6B 5CYJA 2RP5A 2RPIA 2RHQB 2KKPA 4GRSA 4CZLA 5I9EB 1X4FA 2G13A 1DKGD 4H4KC 3GYNA 2HFNA 3L3UA 3PLAA 4DV6F 2F4FA 4NLQA 2A3JA 1U8SA 2RS2A 2W9CB 2Y0BB 3RRGA 1K0TA 3T3FA 2CUYA 3TACB 1Y11A 4OYOA 4QZGA 1ZJNA 4TY8B 1EQYA 2YTCA 1YIJN 5BJRA 4NYPA 1NB2A 1CG2A 5U47A 3U1MA 2K4IA 5A0LA 2R2RA 2EFQA 3NRBA 1DHMA 4KN4A 2BPFA 4BGDA 5FPEA 4KHRA 2P2CB 3DOLA 3KLFB 1ZD2P 3OBWA 3CJCA 4K43A 4G1QA 2HFOA 1FO1A 4IKAA 1YZ7A 3K89A 4XH4A 2UUWA 4DR1F 4DV7K 1NDKA 2VF3A 2K8BB 4GLXA 1WELA 4CYUA 3NRZA 4F5RA 3PX6A 3RG6A 5F0XA 4K4YA 1BUPA 1F0MA 2R7TA 1GXUA 3MX5A 4CFBA 1VRUA 3QGGA 4NYNA 4RUCA 9ICWA 5KG0A 3FJ2A 1EETB 3CJRA 3NHGA 4R65A 1S9EB 2DT9A 3AEVA 1NO8A 3I6PA 3N28A 3H08A 1LK7A 2L41A 3FDSA 4M3TA 1NK0A 1T3QA 1QUVA 1A6SA 2QWRA 3BQ7A 2FGCA 1OPZA 2HIYA 2ZWPA 3H0RB 4CJ3A 4DS4A 5DGBA 2XSJB 2FF6A 3NVYA 3NASA 2WAQC 1RQLA 5BPMA 2DUYA 3BDEA 2HOEA 1COOA 3C6HA 5JS1A 2JEGA 1NJIT 4JI5J 3NAEA 4ZPCA 1SKSA 1TK0A 3QT6A 1ILYA 3QFHA 3T19A 4J03A 3TFSA 3I87A 4AYBF 2HNDB 4BRIA 2QLBB 4A8WA 3KFWX 4YOTA 4M63C 3ZDCA 4M9HA 4J9KA 1U1OA 1S1WB 3IRXA 1JWWA 4LH5A 4CO4A 1RTIB 3TZYA 4UARA 3MD3A 1T9YA 4I27A 3OTOK 4O3NA 5LXRA 4I56A 4DR7F 2V69A 4KITB 3TR8A 2WSEC 4K4ZA 3VGVA 2WONB 1XMQK 1D3WA 4OKEA 1DTQA 1R6YA 1UVMA 1GTHA 3A12A 3DAWA 4DS5A 3AO5A 5F1XA 3IFRA 1RDAA 3A0BU 5HRPA 1V9OA 1KAYA 4QZ9A 1JXEA 1WHYA 3RGIA 3P83D 1GOCA 2H3ZA 7ICIA 1ZOLA 2MKCA 1SXDA 2V4RA 4YY3K 2BKOA 4B3RF 5IILA 1N36F 1J97A 3JPOA 2G0JA 1ZA1B 3B0YA 2RQ4A 3ORYA 1UETA 4UBBA 4FWQA 3PHTA 4FN5A 3CD0A 1FXXA 3CI5A 2XI2A 4BWMA 3PCOB 4DU3A 2GIRA 4KHUA 3H1QA 2Q1LA 3WK9A 4JS5A 3K9JA 3U9ZA 1VSEA 4KKOA 4UUXA 3UW1A 4HI2A 3DHXA 4XQ8A 3OYHA 1VBYA 1OSDA 2Q66A 3GIKA 4C4RA 2ZOFA 2F76X 4F0MA 3A8JA 1TAUA 1WWVA 4MK7A 4M3UA 4RW7A 2Y8WA 2DEJA 3ZD8A 2HS4A 5ALQA 1Y97A 1RP5A 1CSJA 3EVMA 4LZDA 3VQCA 4R8UB 3QIDA 3QJPA 3I9V9 1X60A 2GQ2A 1NH7A 1U24A 3NGSA 7ICUA 1S72S 2DCLA 1H38A 4CLFA 2XMAA 1MN7A 5J0WA 5KG7A 3OFHA 4CLUA 3UO0A 4QZCA 2VU5A 3C94A 3LDPA 3PKYA 2IHR1 1LKYB 4LF5J 5E3RA 4CEAA 1X66A 4FPBA 3CCEN 5KTQA 4ZVOB 2ZH3A 2XMWA 4NL9C 4BR5A 4DFKA 2Z56B 4O3RA 2WSFC 1V5VA 3MXJA 2B5JB 3OT9A 2Q36A 4KHPK 8ICPA 2ZOGA 4GKJJ 3HZEA 4NLZA 1KHWA 2BDPA 4F3TA 1HYVA 1PC5A 5AKGA 4IYQA 4U67L 3CCUN 3TZZA 4YMOA 4Y2AA 4JI5K 2HHHF 5JLHA 2F8SA 4UQGA 4NOHA 5LL6Z 4I2HA 4LSNA 2E6LA 3ADAC 3GB0A 4WCEQ 1FKOA 5D4LA 4R5PB 5AIAA 3I33A 5L1KA 2DKZA 2XHCA 2AP1A 3VAMA 4M1KA 3MOJB 1LOUA 3LH2S 2R2TA 1U8WA 1U1LA 4BRQA 5JVGQ 2EAPA 4LVOP 1FD8A 1XWLA 2J7UA 4CZJA 3D9BA 4DZDA 2CVEA 1V6HA 4FPRA 4I9QA 1FFGB 4E98A 4RU9A 4EFAC 1JLCA 4Z4FA 2JRZA 2LXFA 1KQSR 1Q86T 2Q3PA 1NG9A 2BV3A 5HMLA 1BL3A 4CJQA 4KRWA 5H1SQ 2O01C 5KFIA 3N9UC 4I7FB 2E5LJ 4NLPA 5L46A 3TJAA 1RG6A 4CGFA 2CNKB 1UCVA 2CH5A 1SV4A 3LM2A 3MN7A 4MMOA 1VGYA 1R0AA 4KV8B 3NRWA 4XO0A 4M2YA 3N5BA 1W2IA 3R9LA 4CJLA 4LRCA 5F0WA 4QBUA 2KXNB 1WOQA 4BRPA 1NGJA 1S79A 3OLAA 4M3YA 5HR6A 2HBJA 5SWMA 4DV0K 4M3WA 2KKHA 3VTHA 3ZX0A 3C15A 2D3UA 2YKAA 4BRGA 4AP9A 4QZ8A 4JKCA 2XTJP 4ANEA 4XIUA 2U2FA 4O9MA 4K2XA 2FD2A 2WB1D 4ZVUB 2W9AA 1DZ5A 2EK6A 4UB3A 1DRZA 4LFAF 1TV6A 2F1HA 4BACA 1ZQUA 2YNFA 1BIZA 3NF7A 2F7VA 4M5HA 3I5CA 1QZ5A 2KW4A 5KFBA 3FZMA 3DRRB 2G2ZA 1WSGA 1RA6A 4FF1A 2KJ5A 4AXJA 3W5YA 2BKEA 3TVKA 4BRLA 1TK5A 3OTCA 4P0PA 4N76A 5E3CA 3HW8A 4ILLA 4LF4F 4C1NI 5KG3A 3QNWB 3CETA 1TKZA 1TKTA 2VODA 3PY8A 4TY8A 2QLXA 3C2KA 5ETMA 1ZQDA 1YJNS 1J5EF 4DTXA 5HLFB 3PNCA 2HBRB 1UZDA 3VETA 4R25A 3C46A 1NKBA 4NLDA 4RQ7A 4ZMMA 3LPUA 3H0PA 3J80O 4LF5K 2VONA 4LFBF 2BCRA 1EJ7L 4QJVA 3S1TA 4ECWA 5EXWA 5EWFA 4PEOA 1KVCA 2VIHA 2LPEA 4CJ5A 3H8MA 4OCZA 2G8UA 3OYDA 1RA7A 4KC5A 1FJEB 5BRFA 3DLBA 2B6AB 2AJ2A 3TTCA 2GX9A 3VWSA 3A0HU 4CNQA 4KHSA 3M4XA 2PYJA 2LP4A 1EXNA 5HANA 5AJ3J 3DKDA 4KLDA 1Z1BA 3U3GA 5AQNA 4A5AA 3M32B 1RBLA 1S9EA 1DEJA 1KQGB 1N60A 5EX5A 2E1PA 4DV2J 3HHLC 4BWJA 1SL1A 2OPQB 2KG5A 3O0FA 3IR7B 5D0RA 3D0GE 4JI3F 4MKAA 5BREA 2PFPA 5KPRA 4CT8A 4J9SA 2IDOA 4FWMA 1Q79A 2IOCA 3C65A 1YT3A 1LEOA 1SZ2A 5J2NB 2D6FC 3IR6B 2KVSA 1N54B 1XHZA 1PBUA 4AT1B 3UD4P 3VQPA 3GJQB 2QA4G 5BPCA 2C2KB 3AXKA 3IBPA 1S12A 1MDUB 3BQ0A 4OKKA 1QD1A 4YXMA 5B5EU 2HBQB 3TADC 3ZDEA 2KJWA 1S1WA 5M1KA 2KI2A 2EZXA 5C42B 2F2AB 3IGNA 2QFJA 3R3TA 3UKRB 4PXCA 4W5RA 4ID5B 4ED2A 1YZ6A 2PFFB 4NA1A 4PWDB 2CAJA 4PQUA 3OGUA 3PSTA 3FMWA 4RQ3A 2DNMA 3F2DA 2GMLA 3MURP 2ATLA 2M9KA 4QS8A 1RWPB 1XBWA 1UZHA 1N8RT 2KHQA 5AQSA 1ZQTA 3WDOA 3F2KA 3HHEA 3RSEA 1GXLA 1BCOA 3QUQA 1HBUB 1MQ2A 3HULA 3KWGA 1SIWB 4ZCIA 7ICLA 3V6DB 1JALA 2XS5A 4DKWA 1EWRA 5J0SA 4YHHJ 1YITN 3RMCA 3HHLD 2VKZG 1NJZA 4UTGA 1KQFB 3C5GA 2IOHA 1WI8A 4A8FA 3NXZA 5TKYA 3KZBA 4AM6A 3Q2SC 3SPZA 2ZBPA 4Y2IA 3UXNA 1HNZF 1RBTA 5E0OA 2ZH5A 4JK1A 1R31A 3THXA 5KT4A 1L8OA 4OYBA 3B82A 3QO9B 4Y65A 4HLBA 4ICLB 2DXEA 3DRXA 1UA1A 2L9DA 4ZVSB 3V7JA 1YJ9N 4FM1A 2PEBA 3HK2A 2XB2D 1SGGA 4HTJA 5C15A 4LRBA 5J2EA 4OI0A 4HWIA 2ZH4A 2GIFA 5L9XA 3KK1B 2KU7A 4WTOB 4LF8J 2KYXA 3D2NA 4K2JA 2MDAA 1FDDA 1V3SA 1BY9A 1KP6A 2YMMA 3SI8A 2OTJN 3ZZ0A 3AVNA 1YTAA 1HPZB 2ZG6A 5T7BA 7ICOA 1NHVA 4R8UA 4CJ7A 2XYPB 1NLVA 4ZVTB 1KCFA 1V4TA 2MKIA 1RAAB 2ALYB 2XI3A 1MC8A 5GAHI 1KRPA 4QIGA 1QHTA 4TN2A 2FSNA 4QPTA 1L7MA 3SJHA 4P73A 1XMBA 3A8KA 2BGGA 2ROEA 1RDRA 3M1VB 2GW8A 1LOTB 1GLDG 1RBRA 3VQBA 4I29A 4OHYA 3BGRB 5G0RB 1BHNA 5GAHU 1RE1B 1S1TB 4RL1A 3BF1A 4IR1A 2M8HA 4BVPA 2E29A 4IO8A 4KH0B 2EW9A 5IWAJ 5F9LA 1VCTA 4TYBA 4KGMA 5CZXA 2ZNZA 1N2XA 3SIPB 4DN9A 2GUIA 1VQNN 4JS4A 4MF2A 1UW4A 3VQTA 1QVGM 5MLCQ 1RDCA 4DV7F 5L1LA 1HI8A 3VQ5A 3AGRA 2J0QD 2X1AA 2FVRA 4RU2A 2YJEA 4OJGA 4PPDA 1S57A 3UNYA 2LM4A 2K8CB 1X9SA 4X65J 4GMJB 3BYRA 4BC3A 1TGOA 4R5PA 3N4PA 2NO5A 6FD1A 1UL3A 1UJ6A 3MN6A 4KLOA 2HHWA 1L6NA 4B8AB 3ZT1A 5DB9A 2DNHA 4B6JA 1C0FA 1YHQN 3AVIA 2A1SA 3WX8A 2LQBA 2GLEA 3KZXA 1SZHA 1TUWA 4HI1A 3FSIA 3HHKA 4PL7A 2UU9K 2HDOA 5IQ6A 4B9TA 4DF8A 2BQ3A 3RJKA 4ELUA 3TQEA 4NPOA 2ZBQA 5LJ5Y 3QB0A 3ALRA 1XNQJ 3UKUB 1VQKS 1O51A 3KXDA 2OIHA 1SB3C 1JLAA 4FBUA 2ATCB 4PG5A 1N5TA 3QYYA 4OPJA 2EHGA 4CHYA 4Y2YA 2IJRA 4ZVQB 4JNEA 5BRDA 1LWFB 2YX8A 5KPZA 5G5GA 3SQIA 4HT7A 4YHHK 2RUSA 4ZIVA 1BQXA 4LT6A 2E1YA 4ZVRB 2C2EA 1ZYQA 1JCGA 3OTOF 4TVAB 4ED1A 4DL5A 1VQ4N 5KGXA 3DN9A 2HMIA 3R1XA 3EEQA 5THWA 4ACOA 2MSTA 1Q81T 4E19A 4WKYA 1RB0A 3PYDA 1XMQF 1QVGR 1MMNA 2G8KA 1T0TV 1ZD4A 4DPXA 2RIJA 3QINA 4C4TA 5CAAA 2ITGA 3D0IE 3E2EA 4K4SA 1S6PA 1B43A 3BBBA 3KG4A 4NLRA 2C3PA 2CA9A 1WYGA 1MROA 1ZQIA 2CPDA 4DV4F 1S22A 1PBAA 2DR5A 4O5KA 4ELTA 4P7TA 1RACB 1TAQA 4B3MK 1ZJMA 3O3HA 4ZLJA 1TL4A 4YY3F 3VA0A 3QMLA 2OHDA 4XDCA 4DU8A 2C28A 4P71A 3OS1A 1CUKA 4US9A 4F92B 4U96A 3WIVA 3HSZA 1X9JA 1JJ2R 1OO0B 3S8SA 3LDQA 3VVTA 2AJ1A 3FE1A 4CHZA 2VG5A 4LVSA 2B0GA 5HLFA 1UCNA 2AYMA 4M9GA 4GV3A 3HXMA 1ZQPA 9ICLA 3FCWA 2FLPA 3WKBA 4OX7A 1KR4A 1KVJA 5ETSA 1A7GE 2X6SA 1JXLA 4ZPTR 3PYGA 3HCXA 4YXJA 3GJTB 4MFCA 5L8RC 1U02A 4KH1B 3D7SB 1M5SA 4HACA 4Z4HA 2XYGB 4OL8A 2W42A 2LDIA 5AQXA 3C29A 5KL8B 2DD8S 1TUVA 1CZBA 2KM8C 4DR5J 4Y2XA 3PW4A 1IR1A 3UN2A 3E8OA 1ZQVA 3RAQA 3CJKB 3R2CJ 2ZHBA 3M32A 2ZJPQ 3HHNB 5B66U 1PILA 3OW2R 2FBTA 9ICHA 3NY0A 4EHUA 5ALXA 1PK3A 1NJIO 2M8DB 2OPQA 1HLWA 4FO6A 2FIUA 4X65K 4CEZA 2GZOA 3POTA 4JK8A 3CNHA 4OI6A 4OX6A 8RUCA 1RADB 2W4DA 5HRSA 2JEIA 3AH6A 2AZ3A 4USWA 4BROA 4CZKA 4FLVA 3G9CA 8ICJA 1SC3B 2B4OA 4M5NA 1S1VA 3NL0A 5J2NA 1SCJB 4KHPF 3N97B 1RTJB 1Q3VA 4BDPA 3HFKA 2E20A 3IBCB 2HQIA 1WCLA 1UPMB 3LDLA 5AXNA 2JVOA 4QIFA 3DLRA 3LOUA 1S1XB 4O5FA 4CJFA 4KAIA 4EELA 3P49B 4JI5F 3W61A 3SK3A 1XNQK 3UKRA 3SDEB 3TWHA 1T03B 3I31A 4ID5A 3W2WB 1K8KB 2EVZA 2G2YA 1TL3A 2PZSA 3LAMA 4DV5K 2D0BA 5B0CA 1WSEA 1N32J 3MGJA 1N5WA 3CCJN 1FKAF 1TKDA 2P9NA 3E0FA 4CTAA 2MKYA 3CM5A 3B8HA 3DLKB 3V6DA 2FJWA 1K9MO 4PPZA 1NOMA 3TARA 5D77A 3CJ8A 3OBIA 2M52A 3ZZZA 2LI6A 3WXMB 3L3FX 1RLCL 3GE9A 4IFYB 2OD6A 1R59O 3OQ2A 4KLLA 3HT0A 3HVRA 1LWCB 3SBGA 4BCAA 3QWUA 3I5AA 3VERA 2DNKA 5AQRA 4YMNA 2KSOB 4IL6U 2KDOA 5AI4A 5DQHA 3MD1A 3K58A 2BM1A 4CD3A 4DCJB 4Y0FA 4Y1DA 3H7IA 2QV6A 3KKRA 3VQEA 4DV0F 1S9FA 5CA7A 4KI6A 1T9XA 4DU1A 3ZT0A 3CJTA 3PKMA 1YX2A 4G3IA 4CH0S 1NHUA 2R7XA 4RNOA 4F26A 2N3OA 3RH4A 4CIOA 2WAQF 3TTDA 3NGUA 5CZVA 2FJAB 1HPZA 5B0FA 5KT6A 5KRSA 3DRPA 2MKKA 3KK3A 1UAXA 2XMTA 2UV8G 5AQUA 2YVSA 1S99A 4ZLPA 3LF0A 3ZD9A 5AM3A 1VQ8N 1Z6RA 3H8JA 3OHRA 2GQCA 1JI7A 5EY4A 1VQ9S 3V2UC 3I28A 4YNQA 4YOWA 5G0RA 2UUTA 3QUBA 4PHPA 1U2VA 4MIWA 3HYFA 5HOOA 3HM9A 3HSDA 2K4PA 4G1IA 1NBWA 3G71N 1AROP 2OHFA 2CJ9A 1RABB 1L7OA 5J29A 3MM9A 1NGBA 4LF5F 5F3ZA 5HQ8A 1F9HA 4FYDA 5C2FA 3D68A 1HRHA 4DU7A 3U8XA 4FSVA 4A57A 3D1QA 2AGQA 4ILJA 4J8FA 5EX3A 3KJVB 1X4DA 4DR3K 2DGQA 2G9OA 3PFEA 8ATCB 4OPKA 5M1QA 3CQXA 3JSBA 2XVTA 2HNZA 1HYZA 4WYWA 1S7IA 1VS3A 3RB0A 2YH0A 4E7JA 2HNYB 3THVA 1Q86O 2DKXA 1TAMA 4P2XA 5KFZA 3CD6N 3PRBA 5ALSA 4JI7J 3DCAA 4X4NA 2W3RA 2P6UA 5KNIA 5AI5A 2NPIA 4QWEA 3FGVA 3HVTA 5A8WB 3PSFA 3ZTPA 1SZPA 2W6KA 2CGLA 4V19X 3CFPA 4NV0A 1DTTA 3TEHB 1BOTO 4Z7YA 5DG7A 4X2BA 2AV5A 3AVKA 4FW2A 1N32K 3UKUA 3L0QA 1U1MA 1EARA 2Y1IA 2I9SA 4CLPA 1ZQMA 2B0CA 3MZIA 3T1YK 4RPYA 5ALDA 4PA1A 3TA0A 1QSYA 1LWFA 1C4AA 4CEFA 5AQQA 3A3PB 3A5OC 2NSCA 2FBYA 3MR7A 4JD2A 4RCHA 3ILIA 3HZGA 4JI2J 2WF5A 1C1AA 3D5MA 2GS8A 4IRDA 2LQ5A 3QEAZ 2BX6A 2DGSA 4FJJA 2PEHA 4DQPA 1RAFB 5L1MA 2VCPA 2R7YA 1HARA 4FM0A 4BY9C 2QM1A 2BCUA 3CF5L 4CZMA 5AK5A 4CGJA 2OMOA 2IHMA 2R7OA 2NXCA 5KFWA 3H2UB 3CSKA 5AE2A 1R8BA 4DQQA 2GHPA 2LM1A 1S4EA 1RXOB 1QCKA 2ZIUB 3VF4A 1VLOA 3MGHA 4O0JA 4CEBA 2FJXA 1SV0C 2XHBA 1DLOB 3M3ZA 1VQLS 1M6YA 2UP1A 1QAYA 5IOLA 5FRMA 2GGPB 2B8PA 4FZYA 2B8QA 4A48A 3BDPA 1RDBA 3DGPA 3NOCA 8ICZA 2O4GA 1D1UA 4Q2MA 2V9KA 2UXCK 1P1TA 1UJ4A 1NNEA 4OX8A 1ACMB 2M88A 3HWTA 2RH3A 3M9OB 4NEYA 2DY4A 4K41A 4OYXA 2DNOA 4CF9A 4DPTA 4A8XA 4UAYA 9ICVA 5C24B 1U1RA 3I1YA 4WK1A 4NZ0A 2J76E 4BXOB 2AWZA 3QEVA 1ZAVA 3PACA 2CPXA 2KJ9A 4U9RA 1X31C 2R3VA 4QWBA 1VJ5A 2CXEA 4XPCA 3CJKA 1GXTA 3BREA 3SQGB 2BANB 5A8RB 2KVIA 3T5HA 1SJRA 1PYSB 4EUVA 1Q46A 4O8KA 2R2SA 2DBYA 2YCHA 2O8CA 5A0YA 1Z4UA 1ZBIA 1X4CA 1F44A 1WEXA 1GQEA 2E1CA 2I2YA 2K8AA 2CDRB 1HQ2A 3N4WA 9ICJA 4EWTA 2Y8YA 1ZBUA 2WVEA 4KSEB 3F9MA 5KFHA 2AEFA 4KJIA 2BACA 3UMGA 1RTJA 3PTWA 1ZS6A 3OTBA 4MEYA 4O3PA 2ZKTA 4DQSA 1KOHA 1JRPA 5ALJA 1FDNA 2V9WA 2MLYA 3NNHA 2J9CA 2PFQA 4NLKA 1S1XA 2H3QA 1ZBHA 3IFEA 4QOTA 1RAEB 2D69A 1KEKA 4ZP9A 4H4OB 5D78A 3L6QA 3SDEA 4MIAA 1T03A 4MFBB 2VA2A 4CZHA 4XH5A 4XH1A 3MR2A 3AV9A 8ICNA 2H5IB 4YB7A 5HJYA 3GFKB 2M4MA 4TSXA 3EUNA 2VFVA 1HQEB 9ICMA 1IJEB 4NLGA 4JI2K 4Y2KA 4O3QA 2Y0SD 3ZETA 4FWLA 4BR7A 2UU9F 1HEKA 3KD3A 2V50A 3CJQA 4XPEA 3QSYB 2QYGA 3LWLA 3MXHP 4ELVA 1EO1A 3H98A 3C3LA 2W40A 4IBNA 4KGZB 4KGVB 2BA9A 3WKEA 4QPXA 4C4WA 5C0YA 3G0ZA 2XNQA 4IFYA 2J7KA 3CCRN 1CC8A 4X84A 4IOXA 2MKJA 1LWCA 1QH9A 4QWCA 2RE2A 2B6GA 3KG0A 3ZZPA 2ZJRL 2KSOA 5J2BA 1EKSA 4YHHF 1PO6A 4AH9A 4J2BA 2NRXA 3CJBA 1PVQA 2RF2B 1RBUA 5AKXA 2IHNA 1TP7A 2WF9A 5GAHP 4C2MA 3KD1E 2HRUA 4GXIA 5KFNA 4ERDA 2DPIA 5HROA 1UEVA 3VESA 5JICA 2FQQB 2RU9A 3ZCMA 5DM7L 2MQQA 3CJSA 4FW1A 1ZQEA 2NUHA 3V5RA 1VAZA 4ES2A 3VQ6A 4OYMA 3CD5A 2QLWA 2F8MA 2JZBB 4DF4A 1Q8IA 3MUVP 4ECVA 3TAMA 4B3MF 1HHQA 1U1PA 3ILLA 3BP8A 4H5RA 1IXKA 3FMBA 2BUPA 3R97A 2KKVA 3CIPA 1VHIA 2MHEA 2GAGC 1QQOA 4OJ6A 1REGX 3PIPQ 1YK9A 4WZMA 1ATRA 4KB0A 4HHTA 1C0MA 8ICIA 3RW7A 5KFEA 2IS3A 3CERA 4ZP6A 1M5VC 3KKSA 3P96A 2MLXA 4M95A 4DUYJ 1FRKA 5A6PA 1T05B 4A2BA 3AD9C 3Q86A 4PYAA 4O4GB 2LQ8A 1G6BA 2BZ2A 4WWSA 3QU2A 2HS0A 2YKPA 1N34K 5KFTA 4C8KA 3O3FA 2I7PA 4DL6A 1G3OA 4H4MA 1HKCA 4MLEA 2ZD1A 6FDRA 1KFDA 2BE2B 3HI0A 4KLGA 9ICBA 3NTUA 2KHOA 1B70B 1HWIA 3BGLA 3GPAA 5J0YA 2RSQA 3M8ZA 4F4XA 3VTIA 1ELOA 4CFCA 4L72B 2FUG9 4NL5A 3LZJA 3EDRB 1RZTA 4WXOA 2NQPA 1X5TA 5ALNA 1JX4A 3W0LA 4QIWF 2R7VA 2F8LA 4MKYA 2HNYA 3AA5X 1UEKA 3AA8A 4Z4GA 1NCLA 4QYZK 2HRYA 4X65F 3SAGA 5A8WA 2P9CA 2VBXA 5KG5A 3QICA 2ZWHA 2IIHA 2RKIB 2B51A 5D4PA 3DM2B 1FWKA 2JSXA 2YX1A 1HNXK 5F8IA 4DZ6A 4FBTA 1HBOB 4CI0B 1N33K 4YB5A 8ICFA 4OZNA 4Y00A 4DR4K 4LBHA 3W5XA 1Y10A 5FD1A 2VA3A 1H2VZ 3AN1A 2GC8A 3C6AA 4PKIA 2QMXA 1KAXA 2I1RA 2BTFA 3EZWA 2KFNA 4H5TA 1R0CB 3IM1A 1XNQF 4KHYA 2IYIA 8ICXA 4EIAA 1FFVA 5J0XA 5G4DA 3LGHA 3QBXA 3QYPA 5L38A 1N62A 5D4BA 1VQ6N 4MFFA 5F0UA 4JYAK 3HFZB 3SI6A 1OH5A 2KHDA 4DV5F 2KJ8A 1IKXA 3CXCR 4RNNA 1RU1A 3BV8A 1VK8A 3MR6A 2LU2A 2Q2RA 1V3ZA 2ZTDA 5ALRA 2EZZA 3OHAA 3VEZA 8ICLA 3H46O 4CF8A 4PQAA 4HVZA 2LEPA 4FDFA 5EE3A 1X42A 1S6UA 4AD6A 2DL0A 3DOMA 3M05A 3EMTA 2ZIUA 3EPIA 3PNIA 3SBTA 4CGDA 2F1FA 4GKKK 3BN4A 2WFBA 2A1RA 4CZGA 4KLHA 1ZQKA 4WTYA 1N52B 3DFEA 3EGNA 2HVZA 2JC0A 2NZCA 4E8UA 3CW2C 2F9DA 3IAYA 3L4BC 4C7YA 5CHGA 2MQNA 4YCXA 4TLQA 3K5NA 5ALZA 2Z2LA 4JI4J 5I4MA 2KL8A 1L3UA 4MF8A 3BR9A 3HX9A 2ZH7A 2FZCB 5LMNK 3CYMA 3CC4S 2EX3A 3ONQA 2V2QA 4OZJA 4DUYK 4BXOA 1BI4B 4LBPA 3NF9A 1WOPA 3V1OA 4YN4A 2PGCA 2VQEK 1S0NA 3QU7A 3AY0A 1VQPS 4FWNA 1QE1A 2DO0A 4LF7J 1V38A 3R7BB 3NVKA 3SQGA 3R5AA 1VSMA 4ED3A 4LD0A 2BANA 2Q3SA 2HQCA 3EGZA 2BKPA 1MMLA 3O5BA 1VDHA 3QFWA 4DL4A 2VDHA 2C22A 5KG4A 3UDLA 3HD2A 2ZIVB 3I32A 2XBPA 9ICRA 3QEXA 4C80A 4DUZJ 2MB0B 3HKZC 4B9QA 5JLFA 1NJWA 1DFDA 5KFLA 2AYEA 3MPWA 4TUSA 5B0EA 2ZUDA 2OMLA 4RNMA 3KTQA 2GVDA 2F8TA 4ZP7A 2R8JA 3FEXB 1RT3B 2R7QA 5CP2A 2GA7A 4NRUA 4MKBA 4CH7A 1ATNA 2NYVA 2CQ2A 2CYYA 2GHWA 1RYUA 1TKXA 4J91A 3RH5A 5KT7A 1IQTA 1NK7A 1UWBB 4H4OA 4H8KA 3D2WA 4CLZA 3Q8LA 5K8MA 4DBQA 4ZVHA 1YRTA 1WG4A 4IUFA 2NREA 4DR3F 2JJ4D 2E1FA 3B4DA 3CJ1A 2HYIB 1GT8A 4BHQA 5GTIU 3OPKA 4ED0A 1S5ZA 2UVWA 5IINA 1OPIA 1U47A 3NH1A 2WK4A 3QBCA 3I9ZA 4GO7X 1N6QB 4J37A 3QBWA 1QM9A 3MHYA 1TE2A 2F4VK 2CQCA 1RCHA 4W4MA 4DFDA 8ICAA 4CJ4A 3RJFA 2P8IA 3N7PD 3PYFA 4DG1B 3WNFA 1YBUA 5HVHA 3ZTRA 3LVWA 1N32F 5ALVA 1U09A 3V72A 5DS7A 1PZNA 2K1RB 2JLEA 4F0KA 1FEEA 1BWVA 2D0PA 5HAOA 1VSJA 3QETA 2WVFA 3HKZD 4N41A 3T1YF 4XUSA 2I6WA 4HKQA 3MGVA 1UP1A 4FJ9A 1XN9A 3VGMA 3L09A 2VA8A 4WIIA 2APOA 3FNNA 2GNKA 3MABA 4JKFA 4WIQA 2I5JB 2IRUA 3LPEA 2XRIA 2LCWA 3P5BP 4K4VA 3QXGA 3S6EA 1P1LA 1WSRA 1XO1A 4NCAA 1F9EB 2E8MA 3AA3A 3TOQA 2GFFA 1BXNA 3DXSX 2OFHX 4UW2A 1WC1A 4U7BA 1GMUA 1T9VA 1ZBFA 4DL7A 4Y2UA 5IC4B 4WFAL 3PIOL 4DR2J 1H7XA 1KBRA 4V1Ak 1C0UB 4EAHD 4CLYA 2JWNA 4OV6A 3EWGA 1HMVA 4NWBA 4USHA 4M45A 2ZE2B 3SUQA 3JSMB 3O80A 4NZ7A 3O6QA 3GOIA 4JKAA 1A9NB 2YKOA 3UM9A 5DQGA 1W2BM 3ZZTA 1XUPO 4GVMA 4DPWA 4O23A 1ECWA 2PFOA 1S1UB 1IBLK 4L74A 1IVZA 1MQ3A 2F3JA 5CYMB 3CJ9A 4P2MA 5HO4A 1Q53A 2OAUA 1PJ7A 3SR6A 3SZ2A 4NLNA 1CXQA 4LF7K 1NDLA 4X4UA 2F77X 1BNPA 3ZSRA 3T1HK 4H4KA 5C2GA 2UXCF 3WU2U 2Q4TA 1KAZA 2CNNB 1TELA 5AM2A 4OLBA 1G2EA 4CBXA 2ASYA 5ETRA 4C11B 3QU9A 1HJPA 1Y5LB 1NZAA 4NX9A 2BE2A 2HFSA 3PJWA 4ENOA 3OA9A 4DCHA 1VI7A 1MWZA 1PC4A 1QVFM 3IRWP 3F5AA 3DOKB 1ZQRA 2J0WA 2DGVA 2OELA 3D2SA 4EU0A 5B08A 1KLMB 2LYAA 5J8YC 3OR2A 2FY1A 2GWJA 1WF0A 2J6TA 1UFWA 2BJ8A 1HR0K 5ALOA 1EZZB 2Z2ZA 1EWQA 1JXVA 3ASMA 1MN8A 3K5PA 2W9BB 3J8AA 4FJNA 8ICBA 3B6BA 2B4UA 1JL