2XO7A

Crystal structure of a da:o-allylhydroxylamine-dc basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Chemical Discrimination between Dc and 5Medc Via Their Hydroxylamine Adducts
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 195
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xo7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xo7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xo7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xo7A01
5HMMA 2AGPA 2Y1JA 4O9MA 4FO6A 4BDZA 3RRHA 4NLKA 1NJWA 2XGPA 2IHMA 1TK0A 3M9OB 4IRCA 2FLPA 3AV9A 1X9SA 4FJLA 3JYTA 3SV4A 3RR7A 1K1SA 3CFOA 3K57A 2IBKA 1YT3A 3AVLA 1KVCA 1MC8A 1B22A 4EBCA 4I29A 4YXMA 3QNOA 4AHRA 4CEEA 1ZQBA 1T7PA 4OLBA 1ZQQA 5E41A 2OWOA 1TKXA 4CJUA 4Z4EA 1RT7A 8ICCA 1C0UA 4P2HA 1B9FA 4Z4HA 4KRFA 1S0VA 1RNHA 3AA4A 4EBEA 5KFHA 4CECA 1J54A 3RB6A 1WLJA 1G15A 4I9LA 3ZDCA 1BCOA 3QEPA 2YKNA 1MSWD 4PQUA 4M3XA 1HYZA 3ZD9A 1HQEA 4RQ4A 2ATLA 3KD5E 4CGFA 3AVKA 3HK2A 4FS1A 4E19A 2KTQA 2BQ3A 4J9OA 1RT3A 1BIUA 4PY5A 4NLNA 4CJRA 4FLTA 4FJGA 3MR5A 4DTOA 3OJSA 5DB8A 5J2KA 4DL4A 3HP9A 5KRSA 1KDHA 1R0AA 3SV3A 5KFJA 4Q8FA 4KTZA 3GIJA 4DO9A 1JXLA 4W5NA 5J2NA 4O3PA 2W9CB 1N5YA 1SZPA 1COOA 3THVA 4OKKA 4CJ4A 4DF8A 1ZQCA 3DLHA 1ZQTA 4FLYA 3AVJA 3UPQA 2KZZA 1I3AA 3RBDA 3LP1A 3V9UA 2Q3SA 3I8DA 1VRUA 3ZSXA 5J0QA 4K8XA 2J6SA 1EETA 4J9MA 1U49A 2JZBB 9ICUA 1YTAA 4RW9A 4KLFA 5KFAA 5HHHA 3H08A 4M0AA 4M04A 3QLHA 3PW5A 1NOZA 3V6HA 4Q0BA 1VRTA 3RJGA 3MXIA 1S6QA 4GXIA 4N41A 4XIUA 3FDSA 1K6YA 3KK2A 1L3SA 1BGXT 1VSFA 2B21A 3S3MA 3RB4A 9ICAA 1ZBIA 3GIKA 4H4MA 4B08A 3SZ2A 4O3SA 1XHXA 1HYSA 3QNNA 4PA1A 1QSSA 3LDSA 2ISPA 3NF7A 4CE9A 3LANA 4PHAA 1ZQIA 4DSLA 5D49A 1NJXA 4CF8A 3ZT1A 3OYKA 2P5OA 5HRRA 1ZQEA 1S76D 4MEXA 4QZFA 3RH4A 1ZQLA 5IIJA 4CJ5A 3OS2A 1HUZA 4KB1A 3HT3A 3LPTA 3E2EA 1VSHA 5IIIA 2P6UA 5KFTA 4TUSA 9ICXA 2C2EA 1NK0A 3C1YA 1TKDA 1RTHA 4NLZA 2GBZA 2PFNA 1ZQZA 1TL1A 3Q8SB 3M8RA 5KT2A 4L8RB 1WSFA 4CEDA 4OPKA 2E4LA 2YV0X 1C1CA 1L5UA 3QETA 2UVUA 5DQGA 3G10A 3H8WA 3GIMA 4M6WA 3WNFA 3DOKA 5HHIA 5HLFA 4J9NA 1ASWA 3KKRA 4CERA 2G8FA 2M9NA 3HVRA 4IFYA 1T8EA 1PZNA 1Q8IA 4KO0A 1KFTA 1Z3EB 3OGUA 4PGQA 4CJLA 3F73A 3QEXA 3RB0A 2ATQA 5L1LA 1IKYA 1ZQYA 3V7LA 4B9LA 4ID5A 4KHSA 1JLGA 4F4WA 4FLVA 5J0RA 3JPSA 3QESA 4CJQA 3PW0A 3LP3A 2F96A 5EWFA 3AA5X 5BOLA 3QIOA 4LSNA 3WNGA 1RT6A 4OPJA 1L3TA 4Q8EA 4UBCA 3LK9A 4Q44A 3ZCMA 4J9SA 3KK3A 1JLEA 3SUPA 4F3OA 2G8HA 5L1KA 5KI6A 3DYAA 1BPYA 4JV1A 1WCNA 2FPKA 2DFLA 5CB1A 4KLTA 3Q8MA 5FROA 5KTQA 4R63A 2OA8A 5CA7A 2HHQA 3I0SA 9ICBA 1TKTA 1U47A 4M9LA 4MF8A 1XS9D 4IFVA 3H8JA 3HVTA 3OYEA 4CJVA 2KZ3A 5DMRA 1D8YA 4KLDA 4F5QA 3RTVA 3RJEA 4KB0A 5J1EA 4M41A 4DL3A 3UXNA 4KHYA 4Z4CA 1RPLA 3MBYA 3OJUA 7ICEA 4LY7A 2G8IA 2VWJA 3Q8LA 2RN2A 4ECTA 1Y97A 4DTPA 2A1SA 2XCAA 3HXMA 1SKWA 3RJIA 4R8UA 3UXOA 4GC7A 4RNOA 4CIFA 2V4RA 3OYAA 1TV6A 2ITGA 2Z1JA 4YVZA 3OVNA 4X5VA 2EX3A 2E6MA 4E7JA 2HNDA 2HMIA 2C2DA 3ALYA 2UVRA 5JS2A 5DBAA 1NOMA 3AUOA 2DPIA 4TUQA 1N48A 1UWBA 3NF8A 4IRKA 4DTUA 3V6JA 8ICRA 3JPNA 1ZQRA 2FLLA 3M8SA 4E7HA 2ZTCA 4ECQA 3AO1A 3CM6A 8ICIA 4EP4A 5J2BA 3DLKA 3JPQA 3PO5A 2R8HA 1DTQA 1EP4A 4I2JA 3I0RA 3UQ0A 5DB9A 2V4QA 4YNQA 4I7FA 3VA0A 3V1QA 4M9GA 4OKEA 1SKSA 4OVLA 4P4OA 5J0PA 1N56A 5D4BA 2R7YA 1GOAA 2RPIA 4YCXA 5KT4A 2B6AA 4AHUA 2RDJA 2W8KA 4DMNA 3DI6A 4HUGA 4UAYA 4YFKA 8ICKA 4PWDA 4K8ZA 2FC0A 4M3ZA 2HNYA 1SL2A 4DTMA 3FYHA 4KLSA 2ASDA 3PMLA 5CP2A 3KLFA 4DWIA 3MEEA 1S1XA 1S1VA 2QXFA 1ZQAA 1RYRA 3GIIA 1RT4A 5HROA 2HB5A 2IOCA 1SUQA 2GV9A 2XY6A 4KITB 4CFCA 5JUMA 1S1UA 2VG5A 3OYGA 2HHWA 1QHTA 4AILC 3VQ9A 4O44A 1KLNA 1WN7A 4RQ7A 4E7KA 4QWEA 4JRPA 5CHGA 3RJHA 3LWLA 3NH1A 1ZQJA 4B9VA 2PFOA 2XHBA 3MEDA 4EYIB 3V9WA 2GWSA 4E0DA 3OYFA 7ICUA 1KFDA 2W9BA 3C6UA 4EZ6A 3MR6A 1DOQA 2A1JA 1VSJA 4KHWA 2RF2A 4F8RA 1KVAA 3ITHA 3N4MB 2G8KA 1MQ2A 5EU7A 2ZUBA 3NGIA 4RPYA 1CUKA 1D8LA 2HHXA 5KG5A 3ZDDA 4J9QA 4K4IA 1JL2A 4DTJA 3RJFA 5KFWA 4GXJA 2A1RA 4C8NA 3IAYA 4TURA 4R66A 4EBDA 3U6FA 3CFRA 3IRXA 3AO3A 2R8JA 3S3NA 5I3UA 4EEYA 1BCMA 2P5GA 1CXUA 4KHQA 1XO1A 3OYJA 1HNIA 2XY8A 2PYLA 4RQ5A 3VQ4A 3GV8B 4CHYA 2X6SA 3FFIA 2OYQA 2XC9A 3TFSA 3OYDA 2FMPA 3NF9A 3MABA 2DFFA 3ZD8A 3QINA 2VANA 5J2IA 1JX4A 5J2EA 1WSEA 4Q45A 3SYZA 3M8QA 2EHGA 4M3RA 3OYMA 4DFPA 4I2AA 4QCLA 1RCHA 4KREA 9ICRA 4O3QA 3C95A 3K75D 5J29A 4CGJA 3V1OA 3JPPA 4Z6EA 3GILA 1RTIA 1XSLA 4JRQA 1B92A 2NRVA 1NKCA 5K14A 5J0WA 4CGGA 2P66A 3KJVA 4FW2A 2DFHA 2ZQBA 4NXZA 4H4OA 4NLGA 5KFLA 7ICQA 4GVMA 3ZSQA 2DTUA 1BPXA 2W42A 3C6TA 2B5JA 4HCBA 3LDAA 1JXBA 2YKMA 4RW4A 4ED7A 5D3GA 3BQ2A 8ICAA 4JS5A 5DB7A 3HPHA 4KPYA 4JS4A 4YG2A 3T3FA 1RTDA 4O3NA 4ECUA 3C2MA 3T19A 4FJKA 3PX0A 5I42A 4FVMA 3C94A 1KRPA 1WSGA 4M47A 3RAQA 3IG1A 4IDKA 4E1MA 7ICNA 4FLXA 1XC9A 5KFMA 8ICJA 3VA3A 2MUTB 2LYHA 4DQQA 3TAMA 3AVFA 3HPOA 1ITGA 3HPGA 4J9RA 4QZHA 4FJXA 5J2CA 1KCFA 4GC6A 4DOAA 3LAKA 1ZQKA 2X6NA 1JLFA 4B9TA 1HQUA 3PY8A 3RR8A 2G8UA 3U3GA 2HVIA 2R8IA 2FLNA 5J0OA 1BI4B 3MECA 4B9SA 5JS1A 1L3VA 4J2DA 4UAWA 1JLQA 4F92B 5KFIA 1VSMA 1Q9YA 4GW6A 2Z1HA 4KLJA 1S0NA 3L2QA 4IQUA 1IKXA 3DOLA 2DFEA 2WONA 3PVXA 3Q8QB 1LV5A 4LZDA 4N56A 4FLZA 3LPUA 3L2RA 5CWRA 1QQCA 1SV5A 4DSFA 4CEZA 3L8BA 5J2DA 1KLMA 5KT5A 5C42A 3TAPA 3OSPA 4DG1A 4KTWA 3C1ZA 5KFSA 2Q0ZX 4H8KA 3AO5A 3VQBA 4E3SA 9ICGA 1MQ3A 4N47A 3V72A 4YMMA 1ZETA 4YR3A 3NFAA 5KFFA 4RPXA 4CHOA 9ICPA 4PHDA 7ICOA 1TK8A 9ICHA 1REVA 4AHCA 1ZQUA 2ALZA 5BOMA 1ASVA 4PGXA 4FLUA 3SUNA 1ZQSA 1TVAA 4PH5A 3V9XA 1JL1A 1D5AA 1XSPA 1U9LA 3AVAA 4JLHA 3IS9A 4DFJA 4CESA 5KFBA 2GUIA 2YHBA 3M9NB 2YNGA 4RW6A 2BCUA 3DLBA 3NE6A 1ZYQA 4M6WB 2ZUCA 4YXJA 8ICPA 2F8TA 9ICJA 3KLEA 3VQCA 2VA2A 1C1BA 7ICFA 4FK2A 1UT8A 1S10A 2JEIA 4IQVA 4N76A 4J9KA 5DLFA 4BACA 5EWEA 4XRHA 2HHUA 4FCYA 5KFYA 5J2HA 5IIKA 4R64A 1JIHA 2ZUDA 1C0TA 1TGOA 4RG8A 4JWMA 1TAQA 2BQUA 4F2RA 1FXXA 4M3YA 2XY5A 5C25A 3L2VA 2PYJA 8ICFA 4IR1A 3PW7A 4KMUA 4KN7A 3AVNA 1X2IA 2JZBA 1FKPA 1SL1A 3ZT3A 5KT7A 3TI0A 1W0HA 2DPJA 1B43A 1TVRA 5KFNA 5KG3A 4RUCA 1X9MA 3DLGA 8ICZA 4DU3A 4QZ9A 1V9PA 5DKWA 1ZQOA 1ZJNA 3V4IA 4F2SA 3NGZA 4NYNA 5J0XA 5HRNA 1NOYA 3MFIA 4BXOB 5KFKA 2HVHA 4CJ3A 3ZT0A 3RH5A 3DRPA 4I2FA 2IS3A 4I2BA 1A77A 1C0MA 4G3IA 4O3OA 3EWAA 4TQSA 2Z1GA 3QZ8A 4IG0A 2FMQA 3SI8A 3EY1A 4DQRA 4DL6A 3TARA 4KLEA 5L1IA 4KI6A 1S0OA 2NRZA 4ELTA 4HYKA 9ICIA 1ZBUA 2B4JA 5DK5A 1Z00B 3C5FA 4NCBA 5DQHA 2PFPA 2KFNA 4KI4A 4M3WA 3CQ8A 5HRPA 5KFXA 4KTQA 3H7IA 3DMJA 2W9MA 3T5KA 1XU4A 3NBPA 4FJ9A 5KFEA 1J9AA 4R8UB 3G6XA 4KLIA 4I2CA 3C23A 4ECZA 1S9FA 1GOBA 2BANA 4I2PA 3ZSYA 4OLAA 4Y1DA 5J2GA 4F5RA 1UOCA 3T5LA 4J2EA 4QZGA 4ELVA 1LAVA 3DLRA 4NCAA 4YMOA 5KG6A 2XY7A 4FM0A 4QZIA 5HNKA 2ZE2A 3C2LA 1S1WA 2D0BA 4CJTA 1QSYA 5J2MA 4FJIA 4CCHA 1Z26A 1LWEA 3ZSRA 5J0UA 4I9QA 8ICNA 3QIPA 1HJPA 5IIOA 4RNNA 5HP4A 2I1QA 7ICMA 7ICTA 2BPFA 7ICGA 3NH0A 4IKFA 4TQRA 4PHEA 7ICRA 1A5VA 1IXRA 4DTSA 3DRSA 4RU9A 4DSIA 1ZQNA 4ED0A 3MEGA 4EYHB 4RQ1A 4HCCA 4FBTA 4YFUA 4IBNA 9ICLA 1RTJA 5CY4A 5KFOA 2PY5A 2BKEA 4AHTA 1QE1A 1RBRA 3V9ZA 4R5PA 8ICUA 2BGWA 1WSIA 1RDCA 2FPMA 2ASJA 2Z1IA 4AHVA 3VQ8A 3K5LA 1U48A 2G8WA 4O4GA 3ISDA 2BQRA 4KAZA 1VSDA 4BWJA 4NYFA 5CYMA 5DG7A 5KFDA 1T03A 3UXPA 2C28A 4FM2A 3QZ7A 3EPGA 4I2DA 1S97A 2HW3A 4UAZA 4F93B 4KV8A 4CK2A 3AVHA 3ZDEA 2NRXA 3BJYA 4B9MA 3PW4A 4M9JA 4XUSA 1JLAA 1UAXA 1BPEA 3AVMA 1ZQFA 3OY9A 4KKOA 5DDMA 3LALA 3OYNA 3KHGA 4RNMA 1ZQVA 1BPDA 3G0ZA 3OS0A 2C2RA 4OGCA 2HNZA 3PR5B 3TFRA 5HRSA 4MF2A 5CYQA 3OYLA 4HTUA 5DB6A 3H4DA 3D0PA 3OHBA 1RT2A 3HO1A 4CJWA 4CJFA 3CYMA 3RBEA 4C8LA 4RQ2A 4F4ZA 3ZT4A 4CIEA 4FXDA 4CHQA 4FJNA 4CHZA 4KLUA 1F21A 4DL7A 4IG3A 3B6PA 4I2QA 3L3VA 3RJKA 4DEZA 2BCVA 3Q8RB 3TANA 3C21A 3C2KA 7ICIA 3RMBA 4DS4A 4KHUA 3EPIA 4CGDA 1HYVA 4B9NA 3RWUA 3AA2A 5EOZA 1YVUA 3QEWA 4I27A 5DDYA 5CR0A 8ICLA 4EP5A 3CG7A 2O4IA 5DBCA 9ICWA 3AO2A 4ED2A 2QK9A 1JMSA 4CK1A 5J2AA 4CIGA 3QEVA 3SUOA 3OYIA 3EZ5A 4O0IA 4F4KA 1LWCA 2JEGA 1S6PA 4ZTFA 3ORYA 2OPSA 5EWGA 3GDXA 3OHAA 4ED6A 2FBYA 4RW8A 2I5JA 4MFBA 1WCLA 4FJ5A 3SQ2A 3PR4A 7ICKA 2WOMA 1IKVA 3VQEA 3KTQA 1RILA 1RT1A 4HUFA 3PV8A 7ICSA 3RB3A 4RPZA 1D9DA 5SZTA 5C24A 3K4GA 1MU2A 3QERA 4CFBA 1JXEA 1Y88A 3BQTA 5SWMA 3PW2A 1X1PA 3PMNA 3MGIA 4O55A 4ED1A 4KLOA 3WNEA 4JK1A 1WAFA 4J2BA 2FMSA 5KFUA 3NGYA 3HM9A 4JWNA 3K5MA 4GMJB 3KKSA 4ED8A 4QW9A 1ZBLA 4YR0A 1ZQDA 3HW8A 4YD1A 4DQPA 4F5NA 1VK0A 4FK0A 5F9LA 5DGBA 5KG7A 3NGDA 9ICEA 5J0YA 3T5JA 2BHNA 3AVGA 8ICXA 3KK1A 4ECWA 4CGHA 1T3NA 4CF9A 9ICNA 4RUAA 4P4PA 1ZQXA 4F4XA 4LD0A 4F3TA 1RXWA 4FZYA 4E89A 5IIMA 4FZZA 5FRMA 3MAQA 4MEYA 5KFZA 4I28A 3ZSZA 1S0MA 2G8VA 4E1NA 3TAGA 8ICTA 2UVVA 3K2PA 2H5XA 3OYHA 2D0AA 1IM4A 3Q8KA 1NK5A 4C8OA 3O4QA 1C1AA 3ISNC 5KGXA 1NK7A 3TR8A 3RRGA 4QWCA 1BQMA 4CEFA 4CEAA 2FPLA 1KEJA 4CJKA 2KW4A 3OYCA 5J2JA 3ETLA 3HYFA 3O3GA 4F5PA 4DOCA 4ECYA 4AHSA 4ECVA 9ICMA 3Q8PB 2KN7A 4ED3A 1RDDA 8ICBA 4KFBA 1HJRA 3DLEA 4ZH4A 2HHSA 4DLGA 1ZBHA 2VG6A 4PHPA 2ZJ5A 4ECSA 1QS4A 2OPPA 1KTQA 4QWDA 1H38A 4EZ9A 4OJRA 4M9NA 3ISBA 1RXVA 1BPBA 3KHRA 8ICGA 1TL3A 1NK9A 1EXQA 5KG2A 4LSLA 1HMVA 4F5OA 1NKEA 4QWAA 2XCPA 2IHNA 5J0TA 4MQ3A 2HHTA 5KG1A 3ZSOA 2PI5A 1S1TA 2D0CA 4MFAA 3T1AA 3EYZA 2P6RA 4QW8A 4DL5A 3LWMA 4OGEA 3U3YA 4F91B 4DLEA 4P4MA 4FYDA 4KLMA 4CHNA 4RZRA 1RDBA 5KGWA 4BE1A 2BE2A 4M42A 2O4GA 3M9MB 1ZQWA 1U04A 4QAGA 4UB1A 4NY8A 4O0JA 4I2GA 3GFKB 4CFDA 4BE0A 1DGSA 2OPQA 1NK8A 3BQ1A 2DY4A 2BCQA 2ZJAA 3ULDA 5L9XA 3RJJA 1QLNA 2OZSA 2BPCA 9ICTA 3B0YA 4O5BA 3SNNA 1K1QA 1XI1A 4Z4IA 3HSTB 4HUEA 3SQ4A 3PUFA 4IQWA 1C7YA 1U4BA 1TKZA 8ICQA 1BVSA 4RQ6A 1UA0A 4YMNA 3KLGA 1DTTA 3AVIA 3P83D 2YHAA 4CJSA 5DG9A 1A5XA 2BR0A 2MUTA 4TUPA 1BISA 3P1GA 2OZMA 5J2PA 3GV5B 4NM1A 4YQWA 3SUQA 4F50A 4K4GA 2VA8A 3RMAA 1ZJMA 2AGOA 1I39A 3VQDA 2J6UA 1XWLA 3NAEA 3OS1A 2VG7A 4DF4A 1VSIA 4G1QA 1BI4A 7ICLA 5J0SA 5HP1A 4J9PA 3NTUA 4DSJA 4XQ8A 4TSXA 2I9GA 4HVJA 1SKRA 3N97B 1T4GA 2WTFA 8ICHA 2ZTEA 2AQ0A 3MR2A 3PX6A 1QTMA 3K5NA 2UVWA 4UBBA 5KT6A 2BCRA 3HX0A 2BDPA 3CFPA 4AH9A 3HJFA 1LB2B 3MXMA 2HHVA 1WAJA 1CZ9A 3VQ6A 1HPZA 2W9CA 3BQ0A 4B3OA 5DGAA 2KFZA 5FRNA 3LZJA 4FJ8A 3MXJA 5CZ2A 4JV0A 1IKWA 4IQTA 3MDCA 4Y1CA 2F8SA 5KFGA 2ASLA 4O5KA 4IR9A 1FK9A 2P1JA 4DQIA 3PX4A 4K4HA 8ICYA 1LWFA 3H8SA 3NCIA 3KLHA 4Z6DA 3S3OA 9ICOA 5C5JA 2PXIA 3KD1E 4M9HA 4WE1A 1LW2A 4CGIA 4C8KA 2XGQA 4M45A 4Q5VA 3TABA 4FJMA 2F1JA 4UQGA 3AU2A 1BHLA 3MDAA 1BQNA 3ISCA 1TAUA 4UB4A 3ZT2A 3A2FA 4YR2A 2NUBA 4B8AB 3L2UA 3MR3A 1BIZA 2MAXA 4IRDA 1S9EA 3OSNA 3KHLA 2P51A 1AROP 2R8GA 2NRTA 4J9LA 2AJQA 3V81A 3RH6A 4QWBA 3VN5A 4CF1A 4KLGA 2YNIA 5HMLA 2FBTA 1JLCA 4ICLA 4O5CA 2ZD1A 4DU4A 4YD2A 1GOCA 3VQQA 3KLIA 1EXNA 4PGYA 5KFPA 3B6OA 3CM5A 2KZMA 2JGUA 5KT3A 1LW0A 4DFKA 1EKEA 2IMWP 1WSHA 4UB2A 3E01A 4ID1A 4M3UA 3RMDA 8ICWA 2Y1IA 5KFCA 1HUOA 4ZTJA 3HP6A 1A5WA 2E6LA 4E7LA 2FBVA 3VQ5A 1W9HA 3ZSWA 1KFSA 1X9WA 4I2IA 1QSLA 1BL3A 2W9AA 4QZ8A 2QKBA 4XA5A 4LVSA 4FW1A 3PO4A 4UB3A 4QZAA 4E7IA 4CF0A 3ZDBA 5DQIA 2C22A 4BE2A 4QZCA 4FJHA 3SQ0A 1IG9A 5D46A 1KSPA 4BGDA 4FBUA 4BXOA 2YNHA 4B8CA 2YNFA 4FZXC 5L1JA 3G6VA 3O4NA 4ELUA 1Q9XA 3AU6A 1ZQMA 2X78A 3O3FA 4DTXA 1ZQPA 5J2FA 3VQAA 1WNSA 7ICPA 5FDLA 4FK4A 1NJZA 1JLBA 3V7JA 1KVBA 3K59A 4W5QA 4M2YA 2PZSA 4RQ0A 4BDPA 4DSEA 1ZQHA 1CZBA 3IM1A 4DFMA 1Z00A 1RBTA 1XSNA 4FJ7A 5KG4A 3KHHA 1HNVA 5DBBA 9ICQA 3AA3A 3V6KA 4CHPA 4FM1A 1JN3A 4RQ8A 4DS5A 2RDIA 3NDKA 1BPZA 4FJJA 2J6TA 4PUOA 4Q43A 5BPCA 2IC3A 1Z25A 1NJYA 9ICKA 2AU0A 3F9KA 3SQ1A 3ZSVA 3C5GA 4R65A 3MGHA 4CK3A 4NM2A 4JUZA 2NRWA 1RT5A 3GQCA 3HL8A 4DTNA 1A76A 2FBXA 1S5JA 2R8KA 5KFVA 1EX4A 4UB5A 1RBSA 2F1IA 4GLXA 8ICMA 4BDYA 1JKHA 1J53A 2F1HA 1RBVA 1RBUA 2JEJA 4DU1A 1RYSA 3UIQA 4Z6CA 1S77D 3TAQA 8ICSA 7ICVA 4KLQA 3V6DA 4ECRA 1S9GA 1ASUA 3GV7B 4F4YA 4GXKA 3QEBZ 3SCXA 1RDAA 2QKKA 2AQ4A 5CZ1A 4I2EA 1VSEA 9ICCA 3V7KA 3NHGA 9ICVA 2W9BB 4O3RA 2IDOA 2A1JB 1FKOA 3VQPA 4M3TA 1SL0A 5HBMA 4HHTA 5KFQA 3KIOA 4CEQA 3H40A 4DOBA 3NF6A 3EW9A 2BCSA 4QOZB 1O1WA 3QEIA 4FS2A 4KHNA 1NK4A 1IO2A 2AGQA 5DLGA 3VQ7A 4Z4GA 7ICHA 2PFQA 4OKJA 4ZHRA 1D9FA 3V1RA 2JEFA 4YN4A 4KN4A 5F9NA 3SPYA 1CEZA 3AVCA 3JSMA 5KFRA 1VSLA 4QZBA 3AO4A 3QE9Y 1C6VA 4DQSA 4CJEA 1J5OA 1ZBFA 3ZDAA 1LAWA 3SI6A 4Z4FA 4KLLA 4QZDA 1DLOA 4CF2A 1NKBA 4JV2A 4O5EA 3K58A 4LH4A 5KRTA 2D5RA 3OYBA 2V9WA 3TQ1A 4LH5A 2PI4A 8ICEA 7ICJA 4W5TA 1T05A 3JPTA 3LZIA 1TFRA 2RKIA 3AVBA 1L3UA 8ICOA 4BWMA 5CJ7A 8ICVA 3B0XA 3D45A 4PPXA 1CLQA 3SJJA 4Z6FA 4QZEA 3L2WA 4NCGA 3LAMA 3LP2A 1VSKA 1UA1A 3ASMA 1U45A 3O3HA 3RMCA 4J2AA 1TK5A 4FLWA 3SPZA 3PNCA 4DTRA 2BGGA 2X74A 4YP3A 2KQ2A 3BGRA 3JPOA 3L3UA 3M8PA 3TAEA 5DG8A 4CEBA 1IH7A 3T5HA 3RAXA 5IILA 1NK6A 2XRIA 5TZVA 4DL2A 4DSKA 3QO9A 3JPRA 4CFAA 4N5SA 3MFHA 4I2HA 2ETJA 5J2QA 2JLEA 2IA6A 3G6YA 3NH2A 3BDPA 4RT3A 3IHQB 4C8MA 3WNHA 2W8LA 2XO7A 4W5RA 3S9HA 4W5OA 4RW7A 4RT2A 1B9DA 4MFFA 1CXQA 2IGIA 4MFCA 3TAFA 4CEOA 4B9UA 3LP0A 1YTUA 3K5OA 4KLHA 5IINA 4LZGA 9ICSA 1ZQGA 2VA3A 2VWKA 3DRRA 2ZTDA 1N6QA 1WSJA 2ISOA 1RZTA 3V9SA 2OPRA 3HWTA 5T7BA 5KG0A 4Z0UA 2LSNA 1XHZA 3TWHA 3P5JA 4ECXA 4RQ3A 3H4BA 1UT5A 1HRHA 4CJPA 9ICFA 2ZJ8A 2IAJA 3UQ2A 2BPGA 3DM2A 3QEAZ 1TV9A
chains in the Genus database with same CATH superfamily
1JLQB 5HMMA 2DGQA 4C9DA 4RQNA 1YF5L 1J27A 3BS5A 2PIIA 1IKXB 2BE9B 1NJWA 1CJVA 3MN6A 1H2VZ 3MCSA 1TK0A 1YVFA 4JKGA 3SV4A 1N54B 3CFOA 1YT3A 5GAEU 4EBCA 4CEEA 2KJ5A 4JV5K 4URQU 4JV5F 4L75A 2GV1A 5EOYA 4Z4EA 2BRLA 3WT0A 3OA9A 1SJ3P 4WK1A 2IIHA 3AJ1A 3ZTQA 3C2PA 4B3RJ 3POTB 1DURA 2BMBA 2KU7A 2JC1A 1G4CA 3P5BP 4HACB 4Z4HA 1S0VA 1RNHA 2QA4S 2B51A 2V2VA 3C15B 3G87A 3AA4A 4EBEA 3AARA 5KFHA 3MUVP 3MPWA 3ZDCA 3QICA 4PQUA 2FJWA 1X3MA 1X3NA 2J9DE 1GQEA 1NNDA 2NV3A 5KL1B 1K8KB 2ZIUA 1RAOA 3QUBA 1XNQF 2BJ9A 3HK2A 5AQXA 1O6XA 3VWSA 4J91A 1JJCB 3MR5A 5AXMA 3LDOA 2G1DA 4X4RA 4DL4A 3KLEB 1C1BB 5F8NA 2FPHX 3PJ9A 2AD9A 1VQ4N 1ZPWX 3LDLA 3W66A 3SV3A 4BG9A 3CDBA 3MCOA 4KTZA 3GIJA 2L3MA 1JXLA 4GIBA 5J2NA 2W9CB 1BG3A 1N5YA 4H0VB 5M1NA 3OTOJ 1Z6RA 3THVA 2JRSA 1VC6A 4OKKA 1GFWB 3L09A 2E1CA 5AI5A 4GO7X 1ZQCA 3DLHA 3AVJA 3NS1A 1GLDG 1I3AA 3RBDA 2W2PP 3I8DA 2KYXA 4IOXA 5LMUK 1EETA 2OI2A 1VQMN 1V4TA 4NLUA 5LMUF 3WXMB 1T44A 5KFAA 4B3SJ 4FWNA 2DNMA 5HHHA 4DR3K 3MM7A 1Z1VA 4DR3F 2DRDA 2ODGA 1S6QA 4NL5A 2EC0A 2VBZA 5A0YB 2QWPA 3PDNA 1CQNA 4OFZA 2JOQA 4OI3A 5AKEA 1BGXT 2OH2A 4OYWA 3K1ZA 1FDNA 5AI0A 3L3CA 3GIKA 3ZZZA 2IYIA 2H51B 4OV1A 2E8NA 5LMNJ 4A2AA 4O3SA 1HYSA 3QNNA 4PA1A 3SBGA 2YKOA 4CZFA 2ES6A 3A12A 2V8GA 1ZQIA 4BR2A 4DSLA 2P9SA 1NJXA 4X66K 4CF8A 1OWXA 2JL9A 4X66F 5JVHQ 2RRAA 1YJRA 2P9KA 1NH7A 3DMJB 1KC8O 1SQEA 2XMMA 2Q79A 3BO4A 4OIXA 3RH4A 4WF9L 4CO4A 3E01B 3EGNA 4IXCA 2QMWA 3EVOA 2JNJA 1XMQJ 4JN4A 3WHIA 3HT3A 1F1BB 2D3DA 3LPTA 2GIFA 5IIIA 2R7XA 2HOIA 5KFTA 2BANB 2ACYA 4TUSA 2JH7A 4BRNA 1HARA 3C1YA 1ZXOA 3UKRB 4GFJA 1FRLA 2MSTA 2GBZA 3L95X 2PFNA 3QJPA 3Q8SB 3FZ2A 4MMOA 1L5UA 3QETA 5ALMA 1P9QC 1LWEB 3EWGA 3NS6A 2XS5A 3WNFA 3ENWA 3VV2B 2QARA 1ELOA 3BPDA 5DZ7A 1Y64A 2W04A 2O8EB 1T8EA 1SJ1A 1JNRB 3W7BA 2YQ0A 4KO0A 3H1QA 5BYRA 2KLAA 3F73A 1VOMA 3FNNA 4JEPA 3AQFA 2KT3A 4KHSA 3ZTPA 2HKEA 4FLVA 3O9RA 5J0RA 2GQCA 3QESA 3PW0A 3DOMA 4BBYA 5BOLA 4H5RA 4ZA1A 4CNQA 3EDRB 3IBPA 1V5IB 4PUOB 4UBCA 1R6VA 1PVPA 4WCEL 3IO1A 5GIPA 2MSNA 2IC3B 1CI4A 4MYTA 2AIRB 3ZCMA 4Z37A 4J9SA 1BMQB 2Z58B 1L3KA 3D2QA 4F3OA 4KV8B 3OL8A 1OJ4A 5B0FA 3OL9A 2DFLA 2FPKA 1FNXH 4R63A 2OA8A 5CA7A 3DXMB 3I0SA 1Y5IB 9ICBA 3EGWB 1WG4A 1N5QA 2RUGA 3HVTA 3OYEA 2KZ3A 5DMRA 2P9UA 4F5QA 3GZFA 2KXHA 3RTVA 2Q66A 4G6VB 3SFUA 1URRA 4JK8A 2GMLA 4KHYA 1RPLA 2CIMA 2DISA 4KH4A 4ZLPA 3NAHA 1R6YA 5CZXA 3W5ZA 3CCRN 3I56N 2R9LA 2PEBA 3UXOA 4YEAA 3NXZA 4AXJA 4RNOA 1NZ8A 3BF1A 4A61A 1D8BA 3VPZA 3NVYA 4YVZA 4X5VA 1WDDA 1HLWA 3AOCA 2OSQA 2WVCA 2RU3A 1GEHA 4Y2SA 5ADZA 2N7YA 2MHEA 3HLUA 5FP0A 3AQPA 1P6TA 3PG9A 4I1TA 4EWTA 2YTUA 1N48A 3CC2S 2LFVA 2ZIWB 3V6JA 2V8DA 1D8ZA 3M8SA 4U7UK 2BE7D 4E7HA 5EUHA 3MM8B 5KAKA 1UKUA 4ECQA 4TKTA 5KL8B 2HBZB 8ICIA 4EP4A 3DLKA 3J7Z5 3JPQA 5CHIA 3US5A 4CVNE 1M1KT 3VA0A 3D2SA 1WUAA 5AQHA 4EIAA 2R18A 3HFVA 2RKIB 5AQKA 2QA2A 3J80O 1HNXJ 3LGHA 2XSJB 3M30A 4K41A 5DM7Q 2KG1A 1HBOA 1SL2A 4KLSA 1CS4A 2OHFA 1S1XA 5A8RB 2QXFA 4I4BA 4NMLA 1TAMA 2BKNA 3FEXB 4DR2K 4K0KJ 4DR2F 5D4LA 3UDEA 3M8PB 4ED4A 5U47A 3J7ZO 4FXVA 3FCWA 3J80Y 4P0QB 2VG5A 2KSOB 3D6MB 3OYGA 3G6ES 3W3DA 4IDHA 4DV5K 4AILC 5JLFA 4DV5F 4O44A 8ATCB 4RX6A 2DGUA 1WN7A 3ZETB 2ZOMA 4E7KA 4QWEA 3ETRA 4USIA 2KN4A 2CJAA 3OTEA 3QGGA 4X65K 4GMKA 3V9WA 2GWSA 4X65F 2OTJS 1C0FA 1F9EB 4JI2J 5AK4A 2A1JA 1VSJA 4USTA 1RI7A 2RF2A 2GO8A 2PO4A 3HCXA 3FAHA 4NWBA 3NGIA 2OPRB 3PJXA 3E51A 2AP1A 5ALYA 2HHXA 5KG5A 1BU6O 1JL2A 3WXIA 1VFJA 4DTJA 3KJFB 7FD1A 5KFWA 1NGEA 4AQYK 2A1RA 4KFBB 3DLEB 3IAYA 2K89A 4EBDA 3U6FA 4AQYF 1OQ3A 2MGZA 3S3NA 3UR0A 5I3UA 4BR0A 1BCMA 4LFBJ 2EFOA 3CJKB 4FPIA 3TVYA 1KHVA 1F3VA 1NU4A 2WBMA 1WSRA 3OXFA 4UASA 2DNNA 3FFIA 3LO3A 2B8QA 1TL3B 1KW4A 3L4PA 5HL7L 3AD7C 1YJWS 4JKGB 3QINA 3VAHA 5E3PA 3GCXP 2DR8A 1SKUB 3U9DA 5G4DA 1S1TB 1NH8A 3SYZA 3M8QA 3E58A 1XNSA 4FVCA 3KOOA 3FJ2A 2ZF5O 5B0CA 1NAQA 1QUVA 5AQQA 2MSSA 4CLWA 2JHDA 3UMGA 3ICXA 4KT0C 4GV6A 4KREA 3DV9A 1SZ2A 1JCFA 4O3QA 3SFGA 2RRNA 4CGJA 1K9MO 1RTIA 4C3KA 3CWJA 1LK7A 2D3ZA 4JNEA 4C80A 1TU0B 2NRVA 1NKCA 1E6VA 5J0WA 3T79A 2EVZA 3KJVA 2DFHA 5F0WA 2YKPA 2K8CB 4EO8A 4C7YA 5M1PA 4NXZA 2ZIUB 2WC9A 1KKXA 3EGVA 4CO0A 4BRHA 4GVMA 1S7HA 1NSKL 4QQBA 3CB4A 3MX2A 1DFDA 4HCBA 3LDAA 2VBYA 3L7UA 3ONQA 4U7CA 5D3GA 1P7DA 3UE5A 4JS5A 5AQNA 4FWOA 2HBQB 2BXJA 3T3FA 3Q2TC 1RTDA 1Q86O 2PKEA 4FVMA 3J8AA 1DTTB 2BJ8A 3ZYYX 4ILHA 1YX2A 1N5YB 3W8PA 3DXKB 5J8YA 3RAQA 1F3FA 2ZIVA 3IG1A 4GVLA 2C3PA 4KBOA 4FLXA 4MIAA 4NLOA 5ETPA 1OYEA 1RDRA 2LYHA 2XSFA 1F5AA 1FWKA 3R7SB 3HPGA 3ZTOA 3P3DA 4QZHA 4U7UD 3CJBA 1VLYA 1DZ5A 4AFFA 5J2CA 1KCFA 3LAKA 5CD4H 1X9XA 2HS0A 1GNKA 3IAS9 2R3VA 3VVUA 5HK4A 2X7IA 3S1TA 3MM7B 2VQEF 2P9LB 5HP1B 4B9SA 4P2FA 4ZVRB 2OMOA 1B7FA 5JS1A 1L3VA 4J2DA 3T9ZA 1SV0C 3MN9A 4DPXA 1Q9YA 2Z1HA 5C2FA 3MCNA 3R9PA 2DRBA 2WVEA 3DOLA 3FZKA 2WONA 3Q8QB 4Y2JA 2W11A 4DJBA 3DDNA 1WKLA 3EKUA 4UY8T 4FLZA 3L2RA 1JRPA 4BUGA 1HYSB 3LQVA 3U1LA 2QA4G 4RWXA 1RBLA 5KFSA 2HI0A 1YK9A 2Q0ZX 3NMAA 3JB9k 4H8KA 1MQ3A 4N47A 4DPYA 1LWFB 2P9KB 4M1KA 1GT8A 1HWJA 4RPXA 2B7BB 2V8VA 1LW2B 1SC1B 9ICPA 5JRTA 7ICOA 2GAGC 2NQPA 3D6TB 1K0TA 2P9PA 2ALZA 2UXCK 4FLUA 2DH9A 2UXCF 1VAZA 4PH5A 3TJ8A 3CDUA 2ZITA 4G1IA 4JI5K 3IS9A 1D9AA 5T41A 4A8KA 3R9LA 4JI5F 4PKIA 2RQ5A 1U24A 4LF1A 2YNGA 1N33K 4C0ZA 2BTFA 3V81B 2XI3A 1N33F 2M3DA 2Z2YB 2QARB 1DRGA 4CLYA 1FJ7A 4HTJA 5F3TA 4N76A 3QT5A 4XRHA 1QM9A 4FCYA 4R64A 4C7QA 1S48A 2ZUDA 1XR7A 1IQTA 2VQFK 1V4SA 1FXXA 2FIUA 5J1NA 3T7ZA 3QNMA 2VQFF 2XM3A 3MN5A 1CVJA 2CNNB 2ILZA 3OHRA 1HNZJ 4IR1A 3DOMB 1UJ4A 4CNYA 4KMUA 2MZ1A 3AVNA 2QYCA 3K1RB 2XNQA 1VBKA 5KT7A 3SMZA 1W0HA 1MMLA 2DPJA 1B43A 1TVRA 1YHQN 3FVYA 1U0HA 3W9IA 2W3SA 8ICZA 2ERRA 4DU3A 1ZQOA 1ZJNA 4F2SA 3NGZA 4TU7A 1NOYA 4YB5A 4BXOB 1I1GA 1UL3A 1N5TA 5KFKA 2YNFB 2ZBCA 1HNWJ 5AM0A 3RH5A 2ZKTA 4I2FA 3I9V9 2IS3A 3PJWA 2ZDOA 4A5BA 3GOIA 2ITMA 4G3IA 1YIJS 4O3OA 4YHHK 2ZUGA 3ZLJA 2RHFA 4YHHF 3SI8A 4RR5A 3EY1A 4QIWD 3H8YA 1JLBB 3NCPA 1Q4RA 2AEJA 4DR7K 1AUSL 1ZBUA 4X64K 1HEKA 5A76A 2FVPA 1Z00B 5DQHA 4M3WA 3CQ8A 3H7IA 1FRHA 1XU4A 3NBPA 4QZVB 5B8HA 2UV8G 4QYZK 2L5YA 3G8SA 3C23A 4ECZA 1S9FA 1GOBA 2F3NA 3IWXA 4Y1DA 3M2VB 2KHOA 4F5RA 4J2EA 1RT5B 5KG6A 4FM0A 2IVPA 3NNCA 2VL1A 3C2LA 2ZE2A 1QSYA 2WSCC 5G0RA 1FJGJ 3WK6A 2VGNA 5J0UA 4L3NA 4M8LA 1JKHB 3KG4A 5IIOA 4QIEA 4DV1F 7ICTA 3AL0B 2RRDA 1CBKA 1HBUA 1IXRA 3DLKB 3DRSA 3H98A 3CCTA 4DSIA 4BQZA 4A48A 4V19S 3MEGA 2CPYA 2Y0SF 1PC4A 3AXKA 3UCGA 4EYHB 2FHOB 4FBTA 1VK8A 2AJ4A 2A41A 2CJKA 1KS2A 3EZOA 2PY5A 2BKEA 3MM5B 1T6CA 1QE1A 3HFKA 4ZVGA 3V9ZA 1EKSA 2OIHA 1WSIA 1RDCA 2ASJA 5E3RA 2Z1IA 4DV6J 3M30B 1J2NA 2VZ9A 5CXTA 2G8WA 2JWKA 3ISDA 4JB3A 4KAZA 1CPZA 4DU7A 2CJYB 4YB1P 4ZHRB 3C7NB 4P9SA 1UQVA 4WBFA 3MHYA 2FI1A 4JI4J 2B9EA 3UXPA 2C28A 4TY9A 3C16A 3JSMB 3QZ7A 2YQEA 5D8HB 3FKBA 4ZN3A 5HATA 2P5VA 3IV6A 1YBTA 2NRXA 3BJYA 4B9MA 4Y0FA 2E9ZA 1FE0A 1KKHA 4JK9A 3Q2SC 3UN2A 3HHKA 4WFZA 1JI7A 2JSXA 3R7NB 1VLOA 3LALA 2ZIXA 1SQKA 3UKUA 3OS0A 3BEGB 2BM1A 1DY3A 2C2RA 2HFVA 3EM1A 5BPLA 4O44B 3OYLA 4HTUA 5DB6A 3H4DA 1RT2A 2ADBA 1Z2ZA 2MZRA 3OTCA 4IEEA 4CD3A 4FPRA 2XLKA 4F4ZA 3CIZA 4BLGA 4M63C 2EFNA 4FJNA 3CCVS 1F21A 2HOFA 5ETNA 3LP2B 2W1BA 4IO9L 3CRXA 3L3VA 1T11A 3DDIA 3IR7B 3RJKA 1VQ8N 3Q8RB 2MKIA 3D2FA 3C2KA 3C65A 4DS4A 4B9QA 5D4NA 3RWUA 4CF5A 1GLFO 3QEWA 2JHEA 4JV5J 8ICLA 2E8MA 2E5HA 1FRXA 1RWNB 3OR1A 2UXDK 2YI1A 4WXWA 3AXMA 2MGZB 2UXDF 4ED2A 4JI0K 2DKOB 5F0UA 3QEVA 3E9OA 3SUOA 2WTUA 2F76X 5GAHI 3CPWM 4ZCLA 3QU2A 1LOUA 2XO6A 5ALXA 1WNEA 1LWCA 3ORYA 4XPEA 1I94K 1BUXA 4ED6A 4RW8A 1R8BA 1I94F 4K2JA 4P6QA 3VCDA 1NDCA 4H0TB 7ICKA 3EZWA 5E3QA 2FJEB 1W2BM 2E29A 1EQMA 1JJ4A 2DNKA 2WF7A 4PYDA 4CE6A 2BOPA 5D0EA 1A0PA 2R2SA 1D9DA 1KXPA 5SZTA 4FL9A 1MU2A 3DRRB 4CFBA 2DXEA 4KHPK 5SWMA 4KHPF 3W2VA 5D4OA 1QH9A 1X1PA 3QGIA 3MGIA 4FWRA 4KLOA 2GJIA 3CJRA 3VAJA 1JQGA 3P6YC 3O1WA 4AT1B 3NGYA 3K5MA 4ED8A 1N63A 3OFGA 1QCKA 4QW9A 4YR0A 3JSYA 4YD1A 4DQPA 4R79A 3KJVB 2QWMA 4ENOA 2W7PA 1WB9A 1NJIO 3NGDA 4GVEA 4O8KA 2RHQB 1R59O 3O08A 5T7LA 4KR0B 4ZN1A 2WAQC 2BHNA 3IM9A 4MH8A 1QAIA 1URNA 2E1MC 5HN0A 3R1HA 4OPAA 3WK7A 2OANA 1WI8A 2D9OA 2PFUA 4FZZA 3H5SA 4H0PA 5LJWA 1L7OA 1RTDB 4I28A 4B1VA 4BRAA 1N0UA 2G8VA 1C0UB 3TAGA 2DGXA 3CD6N 2D1CA 3HI0A 2D0AA 3OYHA 1NK5A 1NNLA 3O4QA 3ISNC 1MMNA 1NK7A 4R0JA 3RRGA 1ZBSA 4QWCA 4A59A 2NPFA 4CEAA 1JALA 4C1NK 4ZPAA 3WUHA 3O3GA 4DOCA 4AHSA 2NZ4A 3Q8PB 4P52A 2BJ7A 8ICBA 4EI2A 2JXJA 4DUYK 2IJRA 3ATVA 4DUYF 2OEHA 2HHSA 1NUEA 1QAJA 1B0PA 4F0MA 1NB2A 2OPPA 1QS4A 1U26A 1XQSC 1DQ8A 1Z1BA 4W98A 3BEXA 2CG4A 2WW4A 2HFUA 4KGMA 3I56S 1BPBA 2KNJA 1RLCL 4IS7A 2LECA 2KRRA 3DHWC 5AM4A 3UPFA 3FGUA 4U8YA 3H59A 2X1BA 3O9UA 4QWAA 2AJ1A 4FZNA 4MQ3A 5ETTA 2HIYA 4H54A 3SCKE 2DBYA 2P6RA 2QN6B 4M5IA 3U26A 4DL5A 3LWMA 4C11B 2QC3A 3O1BA 4F91B 1Q95G 5BRFA 1Z05A 4MO5A 2LM4A 2CZ4A 4RW9B 3HSDA 3PYDA 3GFKB 4ZLLA 3QLHB 1AQ6A 3QU7A 4NV0A 3T1YK 2XWXA 2DY4A 1VRTB 3QUTA 3VAGA 5GAEI 3T1YF 3N4QA 3ULDA 4F9OA 4JI6J 3QGPA 5L9XA 3K17A 2YMPA 3RJJA 1QLNA 3RU0A 5BXIA 3SCIE 2BPCA 1TFYA 3BO3A 4BC5A 4O5BA 1IJEB 4DR5K 5I3QA 1XI1A 4DR5F 2DO0A 3IS9B 5CD4A 3N9UC 3HSTB 3UFCX 4EU0A 4KH5A 3SQ4A 3C19A 1SB6A 2GNKA 3WEEA 3UMBA 3PSTA 4XH1A 4ILGB 4Y0WA 1N52B 1U4BA 5A8WA 1TKZA 3M3ZA 5IWAK 3TSUA 5ALDA 2F9JA 5IWAF 2EG1A 3KLGA 1NLVA 1NPKA 5DG9A 2OFHX 3M2RA 4ANDA 1DQ9A 2CJ9A 4GVBA 1VQLS 4F50A 2C2NA 2VA8A 4RU2A 1IBKK 4KGKA 2AGOA 1I39A 1IBKF 1XWLA 2VU5A 1TL1B 2FJXA 3NAEA 4ES2A 1U0HB 4UQTA 1FESA 4G1QA 1Q16B 4J37A 8AT1B 2DEJA 2KVQE 4A62A 2PN6A 5HLFB 4LSZB 4DPOA 1F60B 1OH8A 3PX6A 4CO3A 3UQSA 4WFBL 4O5FA 1RAHB 3SDEA 4C4WA 2XMUA 5ITHA 1O5JA 2BCRA 2BDPA 4IFYB 3NVWA 2CQBA 2KD1A 4AH9A 3HJFA 2KIVA 4B1UB 2DNOA 3VQ6A 2DH8A 2FY8A 3I87A 4DI6A 1RKJA 2MKYA 5FRNA 4HDHA 1HR0K 2CYYA 3ILLA 1HR0F 3MDCA 4Y1CA 5BRHA 3QWUA 2F8SA 2Q6CA 5KFGA 5EHHA 1YZ7A 2P1JA 3MPUB 1TL7A 3R5JB 2KI2A 2RS8A 1EKRA 2HWIA 3KLHA 4ZPTR 2D8CA 3NBPB 3JXUA 2CPDA 1JK9B 4M9HA 4ISFA 3GLJA 1C0GA 4Q5VA 2F1JA 3TTCA 2XYPB 3MDAA 1BQNA 3FMWA 1JJHA 2AMCB 4UB4A 4HAIA 3MM9B 3ZT2A 4YR2A 3LL3A 4B8AB 3L2UA 4U67Q 2LU2A 3OVSA 5DDQC 3OSNA 2KG5A 3KHLA 2ZE2B 1AROP 4FYWB 2PA3A 1SPBP 4LRDA 1N34J 4AM7A 3MWBA 1SIJA 1FF2A 5J1EB 2M4MA 1VQ5S 2ZD1A 4DU4A 2V2ZA 5DDPC 4PGYA 2CXYA 1CQMA 3HRDD 4KH6A 2KZMA 3CDWA 5KT3A 4OJ1A 2JVRA 3BN7A 3KLVA 4DR2J 4FE3A 2M9KA 2Y1IA 2YCHA 5A2QU 1TUYA 1CJTB 1Y0HA 1QE1B 4PZVA 4QU7A 1YQHA 4DV5J 2HZAA 4I2IA 2IM2A 1X5SA 1EWQA 2HNDB 1BL3A 4QZ8A 3NWRA 4DCOB 4PL8A 4KHMA 4LVSA 3JTOA 4UB3A 5EY4A 4CF0A 4BE2A 4WXOA 2FD2A 5FD1A 4X65J 1DBDA 5ALZA 4YDXA 4BGDA 3W62A 4USVA 1KP6A 3D6JA 4CT8A 1TUWA 4ELUA 1X4FA 4DV0K 3BZKA 1ZOLA 2PE8A 5A6PA 3NNHA 4DV0F 3OPKA 3L7PA 3BQ7A 4OHXA 4M94A 1UAWA 2CAJA 3VQAA 2QI2A 3LM9A 5HVGA 2G08A 1KVBA 2NS1B 4M2YA 3Q24A 3U8XA 3B9JA 1VDVA 2GOLA 1NHKL 2CQIA 1RT2B 1CZBA 3IM1A 4NYPA 3VEZA 3L4BC 3AA3A 4FOEA 3V6KA 4FM1A 1JN3A 4RQ8A 4DS5A 1GLLO 2P6TA 1BPZA 4FJJA 3KZIU 1B4FA 2ZH5A 4Z7YA 3EJMA 5T14A 1WJ9A 2O8DB 3P31A 2DGWA 2CQ2A 3GG4A 3D2FB 2FB0A 4R65A 4H4KA 2J9DA 3S6EA 4NM2A 4JUZA 2G5IB 2O5DA 3I76A 3F5TA 4FWQA 2Q1NA 3GQCA 1A76A 2FBXA 5GAHP 2HHHF 2ACMA 3ZX2A 3OR1B 2FGOA 2AEMA 2KV2A 1U8SA 1EX4A 3BGOP 4ERDA 1RBSA 2F1IA 1S1UB 3HM8A 4DR1K 4OX6A 3Q83A 3M6WA 4DR1F 4AL7A 3BDEA 1RBVA 3N6MA 2A6MA 3TAQA 8ICSA 4WQ5C 4KLQA 5KNIA 4OYBA 1ASUA 3EX7B 1KTVA 1N61A 1RDAA 4I2EA 2LEAA 1B4SA 3NHGA 4O3RA 2IDOA 2RJZA 1UW4A 2KXNB 2R2TA 4ZPDA 3ITHB 4F4AA 3HTVA 5HBMA 4LREA 4FKXA 4CEQA 4Y2CA 4OX9J 3H40A 3D2EB 3W2VB 3O9QA 4FPBA 2IOFA 3EW9A 4TNOA 4OJ5A 3SAGA 2DGSA 1ZAVA 4QOZB 2RQ4A 2BV3A 2EPIA 2AGQA 5F8GA 1UFWA 4K59A 3BY5A 4KN4A 3SPYA 2JLGA 1HNIB 2UUWA 2HSTA 1T6DA 1XC3A 2HG4A 1GLJO 2K8GA 3BV8A 1J5OA 2LKYA 4DUZJ 3I1YA 4Z4FA 5T7LB 3TA1A 4HI1A 4KLLA 4QZDA 4ZCMA 3SAFA 1NKBA 1WKKA 3K58A 4LH4A 3N01A 3N4WA 5AQVA 8ICEA 2OTLS 5HVHA 1HWIA 4URGA 1T05A 2PT0A 2KDOA 4R25A 2Z7JA 3B4MA 3CCSN 3PSFA 2LQ5A 3BPSP 1KQSR 3EXCX 3IKMA 4GNIA 1R8CA 1IBMK 4UTGA 2POKA 3L9ZA 2W3RA 3F56A 1T9XA 4J90A 2IRYA 4BWMA 1IBMF 1VIXA 3LW5C 1NHVA 3LVWA 3D45A 1CLQA 5K9FA 1LFPA 1FVQA 2FSKA 1HKAA 1YI2S 3FBCA 3FBFA 4IJAA 4QZEA 3CP8A 2OYYA 1KQFB 2Z8QA 2DBBA 4EX6A 1VSKA 3A8KA 3HZEA 3O2IA 4OI1A 3FCHA 2GHWA 4J2AA 1EARA 1YJ9S 1R27B 4FYYB 2ZGZA 1ZAXA 3I5AA 1XMOK 4H4OB 1WOOA 1ZH5A 2X74A 4Y2MA 3Q8UA 3JPOA 5DG8A 2EAMA 1IH7A 3E1YA 1H73A 1F0XA 2YKMB 2NPIA 3DDKA 2MQMA 5CYJA 2QYGA 2O8CA 2CQ3A 5TZVA 2OPPB 3JPRA 2GX9A 3MFHA 5J2QA 2JLEA 2HQDA 1WHVA 1QVGR 4CD1A 3BDPA 2Y8WA 4W5RA 5E3AA 1FFVA 3S9HA 4W5OA 2KMDA 3MZIA 5HJXA 4RW7A 4DV3K 1DGJA 4RT2A 1B9DA 1EWRA 2IGIA 1Y11A 1Y9OA 4DV3F 4C8YA 4BROA 1X7VA 2MKKA 2XI2A 1M6YA 4YOTA 4BC7A 4B9UA 4JI5J 3LP0A 1YTUA 3K5OA 1Y5LB 1RAJA 3I8BA 5IINA 4OQJA 4LZGA 2RDDA 2VA3A 5HMWA 1N33J 2EDUA 3UWTA 2YHXA 4FWLA 2ZTDA 1N6QA 2ISOA 3D4JA 3WC2A 4IUFA 5KG0A 3R5BA 2M52A 1JLFB 4IYQA 3CJSA 3TWHA 2VFVA 1OMSA 1VQ7N 1UT5A 1LWXA 2EBGA 3P96A 4CJPA 4WFAL 3RJMB 2QB1A 2EFQA 2OELA 2Z57B 9ICFA 1RAEB 1VQSA 2IAJA 1QAYA 1FJCA 3DM2A 4I6WA 2JGAA 2AGPA 3OUYB 2VQFJ 4O9MA 2XLIA 1FFUA 4BDZA 3RRHA 3H5UA 4NLKA 2HBRB 3Q89A 1WKJA 3I5BA 1MMDA 1X9SA 3CXCR 3WEEB 2ZC3A 2YXLA 4DCJB 2HK2A 3AVLA 1MC8A 4I29A 4YXMA 2ZHOA 4RBUA 4AHRA 2FVQA 1C4CA 4OLBA 1ZQQA 2E3TA 1AZSA 1IR2A 3KYLA 2OWOA 4DG1B 3PHEA 4NLSA 1TKXA 2Z2LA 1RU2A 2ROEA 3A5OC 2MZQA 2V4JA 2M5YA 3J81U 3BGLA 2ZJPQ 1B9FA 2QE5A 1WELA 5DM6Q 2ASPA 1HD0A 2LDYA 4P7VA 3RB6A 1WLJA 4ETZA 4I9LA 4YDUC 4GVBB 1MWZA 3QEPA 2YKNA 4YHHJ 1MSWD 4UOHA 4M3XA 1HQEA 5AI9A 4RQ4A 2ATLA 1IWGA 4PWWA 4UB6U 1ULRA 1BUPA 3AH6A 3AVKA 2LEBA 4AYBF 4KGZB 4DR7J 2F9WA 4C0HA 4X64J 2OUGA 1SJ4P 5ALHA 3WIVA 3PSIA 3CPEA 4J9OA 3JAMO 1BIUA 4LIRA 4K4SA 4PY5A 3BREA 4NLNA 3C3LA 2XTJP 4FJGA 1HA1A 4P71A 4MKVA 2CGKA 3OJSA 5J2KA 2EAOA 3SDEB 3M1VB 2VFUA 3T1HJ 4DR4K 4DO9A 1NGAA 2AH5A 3C8YA 2QT7A 4NEZA 4W5NA 4WP8A 1TE2A 1VRQC 1D4XA 2QFJA 3RBZA 1V38A 4O23A 1M5OC 4DF8A 1IV8A 4K25A 1ZQTA 4FLYA 3LP1A 5C0YA 1UEVA 3JAMY 3V9UA 1WC3A 2Q3SA 1M5HA 1VRUA 5J0QA 3N7SC 1T02A 2E7XA 4J9MA 1TL7B 2DY9A 4Y65A 2W43A 4KB7A 3KLHB 1X6JA 1W26A 3MC1A 5MLCQ 4KLFA 3A3OB 4KC5A 1UCVA 2DH7A 3TUZC 4M04A 1PCAA 3DLGB 3WDOA 1NBEB 4ZP6A 3PW5A 1NOZA 3V6HA 4Q0BA 5ETOA 2ZZNA 4LIWA 1BQNB 3PFEA 4GXIA 2VFTA 1BE4A 4V19J 4XIUA 3K7RA 2J0SD 3FDSA 4BR4A 1L3SA 2VKZG 2B21A 3S3MA 1Z2LA 3H0LB 4TU9A 4A8MP 5HOOA 9ICAA 4B08A 2J7WA 2BEFA 4ZJLA 1F2HA 2IFXA 4NRTA 3LDSA 5K8NA 2I5HA 2ISPA 5A8KB 2H5EA 4A5AA 1HKCA 3LOUA 4NMXA 3OFHA 4RJVA 1RK8A 3EVMA 3W60A 2P5OA 2ZVSA 4FN5A 2IVOA 4RWTA 5GMDA 3TJAA 3OS2A 3IBCB 3BYPA 2RS2A 2E8AA 4KB1A 1WOPA 3P4UB 5BN8A 4M5KA 4DOZA 9ICXA 2C2EA 1UFLA 3I96A 4JYAK 4NLZA 4WZMA 3DLLQ 1ATNA 2RUSA 2GCFA 4XH5A 3CJ4A 5KT2A 2MQOA 4XDDA 4CEDA 4OPKA 4PPDA 3QU9A 4MK9A 5GADU 4MIWA 1Q8KA 4LF9K 4USAA 2BZFA 2WSFC 4YOWA 1HKBA 4LF9F 3UM9A 5BR8K 3H8WA 3GIMA 1BHNA 1FDBA 2NZTA 3GTYX 3TU5A 3DOKA 2KICA 5HHIA 5BR8F 1PBAA 1N5XA 3KKRA 4JKDA 4CERA 2WHEA 2M9NA 4F67A 4K4UA 1PZNA 1EQYA 4C3LA 1Z3EB 3N7RC 1NGFA 4CJLA 4ZK7M 4MO4A 3QEXA 3RB0A 3LYSA 5L1LA 1ZQYA 3V7LA 4B9LA 4CLZA 3QJJA 2HBMA 4ISGA 3VF4A 4F4WA 1PIEA 4C7ZA 2UXDJ 3JPSA 1DEJA 3K9JA 4CJQA 3ZXWA 4KBIA 4JI0J 1U2FA 3RVCA 1FFWB 3OT9A 2CZVC 1RT6A 4OPJA 1L3TA 4CW7B 2XYHB 4A8OA 1I94J 5CAAA 3IAM9 4HHJA 3EDQB 2GMJA 1NWKA 2KKPA 2K1RA 3CO9A 1U6BA 4NXNK 3SEIA 4JKEA 3GJRB 5GAGI 4P7TA 4NXNF 1G7CB 3KK3A 1JLEA 3KG0A 2HPUA 3ZZOA 1Y5NB 5L1KA 5KI6A 2G8HA 4JV1A 5FROA 5KTQA 2BW7A 4U8VA 2F63A 2HHQA 3E0FA 5M1KA 4FOIA 1T9WA 3AQOA 2E1RA 3H8JA 1OO0B 1GTHA 2EXUA 4CBWA 1PVQA 1D8YA 4KLDA 1HWUA 2RRBA 3AEVA 4CQ1A 4M41A 1C20A 4DL3A 4Z4CA 2I2YA 3BKFA 2QKQA 4LY7A 2VJVA 4UAUA 2G8IA 3Q8LA 2KT5A 4ECTA 1Y97A 3CJ5A 2XCAA 3P39A 1PG5B 1K0VA 1SKWA 1HKGA 1RHRB 4R8UA 2HSZA 2FY1A 4CIFA 2E2QA 3M05A 4FYXB 5AZIB 4BR9A 4CBUA 2IYGA 2NXUA 1DAXA 1S59A 4LRAA 2Z1JA 3OVNA 4X4PA 1XNRK 3H46O 2EX3A 4TYBA 1RQLA 5AQMA 2NO5A 1Q7YT 2C2DA 3R2CJ 5JS2A 5DBAA 1NOMA 2Q2RA 4Q7AA 4ILRA 3LTOA 3K0JA 2DPIA 4QPTA 2GWJA 3N5BA 1OYDA 1WC0A 3VESA 1UWBA 3NF8A 1A7GE 2H48B 5JU5A 3M2UA 3JPNA 3VF6A 5FJ4A 3TACB 1Q81T 2ZTCA 1S79A 1Q8LA 1J5OB 2QA4N 3AO1A 2VJUA 3THYA 5J2BA 4OHYA 3JTPA 3L4IA 2R8HA 1DTQA 1EP4A 3Q23A 2LQ9A 2P9NB 2OEMA 2WOMB 1DARA 1A6SA 2VDHA 3V1QA 2LBOA 4M9GA 1E4FT 4P4OA 5AQJA 5D4BA 1WC4A 1GOAA 2Z2MA 3JXOA 4YCXA 5KT4A 5BYSA 3OXGA 3C14A 2ZGYA 1KD1O 1RSCA 4DMNA 3DI6A 2HRYA 2H54B 4UAYA 2VOPA 3VMFB 4PWDA 1FRJA 3ETMA 2GFFA 5EE9A 1IN0A 4F3MA 1KWMA 4JHDA 5CA5A 3G25A 1XR5A 3CMQA 3KLFA 3U02A 3MEEA 1T3QA 3QRPA 4LF8K 1S1VA 1RYRA 1RT4A 4IC9A 5HROA 3U27A 2DR5A 4LF8F 2IOCA 5M1FA 4M7XA 2QEXN 4PABA 2YJEA 1LXJA 1RGVA 3KK1B 4CFCA 3HHLD 1LCUA 4C3MA 3EUB2 2B9YA 5ALNA 5IQ6A 2N4CA 1NDLA 1DRZA 2H3VA 4JRPA 2AJ2A 1JCGA 2H1YA 2PFOA 2HCFA 3OYFA 4CLSA 4DR5J 1KFDA 2E1PA 2H4WB 5F3XB 1DOQA 2NCKL 4G9BA 2QMUB 1KVAA 2YH1A 2YY6A 5EU7A 2ASYA 4RPYA 1GMVA 4RWWA 2QLJB 4PG5A 1RWVB 2V63A 3RJFA 1SXDA 2K4IA 5M1OA 4GXJA 2RIJA 4M5GA 4TURA 2ATCB 3O9TA 3CFRA 5AKLA 4XK8C 1A0OB 3FZBA 1MROA 5LT5A 3PIPL 4EEYA 1T9UA 2IAJB 2YHWA 2P5GA 1X31C 4KHQA 3OYJA 4RQ5A 4FWPA 3GV8B 4LVNP 4CHYA 2X6SA 1RACB 3OYDA 1JXVA 2FMPA 2E66A 3L3FX 3E9LA 2V68A 3M8YA 4CRXA 3ZD8A 3ZO7A 2VANA 5J2IA 3X1LB 4NXMK 1SV0A 1FX4A 5E7OB 4JI7J 1IBKJ 4ACOA 3B54A 4CZCA 5K8PA 4NXMF 1VQNS 2LP4A 7AT1B 4F0HA 3CVKA 3NOCA 2YB4A 1WSEA 3R1LA 4JKAA 4DU8A 1AFJA 2V8HA 1GMWD 2XEXA 4M3RA 3QSIA 4WKRA 4X4QA 3MDFA 4DFPA 4EGLA 4YB7A 1RCHA 9ICRA 2ZWPA 3ONNA 1SH0A 5JVGQ 3UNGC 3U4LA 2CJXB 1U1QA 4Y2RA 5BYQA 1U25A 2OPQB 1ZBTA 1B92A 2YKNB 2KHDA 3VEYA 3GE9A 1HR0J 1X4GA 5K8OA 5B09A 1WOQA 5KFLA 4IH7A 1BPXA 2N7CA 3IWLA 2P9CA 4RW4A 1TMMA 1HBMA 4MLHA 2ZBQA 2L48A 1Q46A 3WKEA 3HPHA 4KPYA 3CT9A 2PD1A 4PCQA 3FMBA 1B0VA 4O3NA 2D1KA 3T19A 2MQLA 1QQOA 2Y0BB 1KRPA 4CLTA 4QYRA 5AK3A 3ADAC 4ALZA 4OZ3A 1QVFR 4CLKA 4E1MA 2DVIA 3VOVA 1K73O 3VERA 5KFMA 5LSOA 5LSLA 3VA3A 4DQQA 2CQPA 3DHXA 3GG1A 1NGJA 2LI6A 4YS2A 2MLYA 5LL6Z 1N5SA 4GC6A 5HMXA 5L9NA 1ZQKA 2ZH4A 2X6NA 2GW8A 3MR7A 4B9TA 3PY8A 4WP9A 1EQ0A 3OXLA 4KH1B 5JLHA 1BI4B 4Q0BB 3MECA 4LF7J 1GLCG 1XK8A 4UAWA 3NMRA 1G1XA 1JLQA 1HBNB 2EZYA 4F92B 2HGMA 2A2DA 4KLJA 1S0NA 3THWB 4NJ8A 3L2QA 1IKXA 4L74A 4OHZA 2J7KA 5CWRA 1QQCA 3E8OA 4DSFA 4DBQA 3B8AX 1ZOTA 4NYZA 2ZBRA 1S4EA 1IKWB 3BS9A 3C6AA 3OSPA 4QIWC 1WG1A 2J4RA 4UUXA 4YORA 3AM9A 4PPZA 2E8PA 3CC2N 4IOAQ 3VQBA 3AN1A 4LJXA 3ISND 4ZPVR 4YMMA 3OFEA 1Z4NA 3IP4B 4YOXA 5AR0A 5KFFA 3QT7A 3C15A 2DYAA 4WE1B 4DV0J 5LOQA 1REVA 1TK8A 2V2KA 4IZ9A 1ZQUA 1IQZA 5BOMA 5C10A 1KBRA 3OBWA 1ZQSA 4PXCA 3NLCA 4DB3A 2A3ZA 4RBTA 5HVFA 2J9EA 3LGNA 1U9LA 3NRZA 3TUIC 3IDHA 4JLHA 3IXQA 4DFJA 3HSGA 5KFBA 2GUIA 3EXYA 2YHBA 2ZJRL 4US9A 2BCUA 3NE6A 1ZYQA 2XIDA 1C2PA 8ICPA 3DOKB 2NREA 3HJEA 1K8AT 4LF2A 3KLEA 4KSEB 2VA2A 1C1BA 4FK2A 2YKAA 3VQSA 3BZCA 5DDRC 4BACA 3TEHB 1B64A 2HHUA 1JIHA 1X40A 4JWMA 3WKCA 5CCLA 2MHNA 3L4QA 2Y1RI 4RUBA 5AKGA 4M3YA 2XY5A 3NGKA 5C25A 1R0CB 3L2VA 2PYJA 5GADP 3PW7A 2OSRA 4KN7A 4DR1J 3H1VX 2G2OA 2FF6A 1X2IA 3G6EN 4QS7A 1SL1A 1RT6B 1YRUA 3QPIA 1TELA 1T3VA 3ZT3A 4RCHA 5GAGP 3TI0A 4HKQA 4JAXA 4X4NA 2KP7A 3I4HX 1NM1A 5KG3A 4A8FA 2AX1A 5F2RA 4QZ9A 1V9PA 4YOUA 3G9CA 5DKWA 1E6YB 4YOEA 3N79A 4DL0C 2WF8A 4NYNA 5J0XA 3QAUA 5HRNA 4WZQA 1NM2A 2L9DA 1JLEB 4YY3J 5BN9A 4CJ3A 2W4CA 1SCJB 2G0CA 4I6AA 2DGZA 2J5AA 3DRPA 2ZM6J 1M90T 2AW0A 1C0MA 4USHA 3EWAA 1HD1A 2Z1GA 2XNRA 3HT0A 5H9EK 4DV7K 2X1AA 1GLAG 2PMZF 4DQRA 4DL6A 4GRSA 4DV7F 3TARA 1TMJA 4KI6A 1S0OA 2NRZA 4LF4J 2B4JA 1BWVA 3MX5A 1IR0A 3C5FA 4NCBA 5KFXA 1ZD4A 3DMJA 2YPYA 4HTIA 2KT2A 4NL9C 3CF5Q 5H9FJ 5KFEA 2AZ3A 1QJHA 4KGXB 4R8UB 3G6XA 4P72A 2UYTA 5AQPA 4Y2UA 1YJWN 4I2CA 3GSIA 2VPWB 2MLZA 3AMZA 2ZJQL 2J0QD 2BANA 4HTLA 3EUNA 2RE1A 3UN3A 4OLAA 4M63A 3D66A 1I6JA 2CN1A 4ZP8A 3T5LA 3VC8A 4X4VA 2JR5A 2U1AA 4NCAA 3MWPA 4H0YB 3FC9A 2ILYA 1IBMJ 4CLFA 3LPYA 2P9IB 4CCHA 2XMKA 1LWEA 1WSVA 5C15A 4I9QA 1H1VA 3M2UB 3QIPA 4RNNA 4S0MA 2I1QA 7ICMA 3TZYA 1ZA2B 2C2MB 7ICGA 4IKFA 5MAOA 4TQRA 4PHEA 1ZZFA 3THYB 2HYIB 2O8EA 1DTQB 3TR5A 4ED0A 2Q1LA 2C3MA 3ZTRA 4JB8B 2P2CB 1BNOA 4RQ1A 1XMOJ 4QS9A 4HCCA 4YFUA 2F4VK 9ICLA 2GHPA 3CI5A 5CY4A 5FPDA 2F4VF 1IG6A 3TVKA 4BC2A 4AHTA 4JI8F 8ICUA 2Z2ZA 2AYBA 1Q3VA 4O4RA 3CQXA 3DI6B 1U48A 1IM6A 1YRXA 1N8RO 2CPZA 4PWDB 4O4GA 2J8SA 2HEKA 2IHR1 4HLBA 2W4PA 3AQEA 4DV3J 2GA7A 5DG7A 2V5HG 3MEEB 5B0EA 1T03A 1YJNN 2Y9UA 1D1UA 2A1BA 5HROB 4I2DA 2HW3A 1PC5A 4FWSA 4F93B 4KV8A 5HAOA 2E5LK 3ZDEA 3QJLA 3VCBA 2E5LF 1BPEA 2B4UA 2N3LA 3JTNA 3DXMA 5DDMA 5KAFU 1A9NB 3NGTA 2ZHBA 4RNMA 1ZQVA 3H20A 4X62F 1SC6A 3CDEA 2XMVA 4ZP7A 4HL9A 5IT9U 1XBWA 3SMPA 3R6GB 4CJWA 3WIUA 2V7ZA 5ALKA 1RWWB 4RQ2A 3CNQP 2Q0UA 1N62A 2X3DA 4CIEA 5CRXA 5AIBA 4JD2B 4OZ5A 4CHZA 5IC6B 4NCGB 3D54A 1X5TA 3B6PA 1WG5A 3MAHA 2R7QA 3NS5A 3A1YG 1TP7A 2BVZA 2QFIA 7ICIA 4EX7A 3H7HB 4CIOA 4IO1A 3AA2A 5EOZA 3H25A 4I27A 5DDYA 2G0IA 1Q82O 5CR0A 3PKMA 4EP5A 2R2RA 2ZJPL 4O3MA 5HO4A 3RF9A 2RT3A 5GINA 4WIIA 4DV2K 2VV5A 4OHVA 2W25A 3FZHA 4CK1A 3GBTA 4DV2F 3QO9B 2ZIWA 4K4XA 2NYVA 2EWHA 4ID8A 4NA3A 3MM8A 1L8OA 5EWGA 2FBYA 4N77A 1EB0A 4FJ5A 3THPA 3SQ2A 3PR4A 4ANCA 1FEHA 2Q97A 1GO3F 4HUFA 3ET6B 1KEKA 4Y2KA 5E5NA 4Z7CA 4RPZA 3AGRA 3F5EA 2B43A 2CPHA 3FRZA 1PO6A 2RQKA 1URJA 4ED1A 2K06A 3WNEA 2A3VA 4H4KC 3MAAA 3QFWA 3PCOB 4J2BA 1LOTB 5ALTA 4AL6A 4CH1A 3HM9A 3DEEA 4JWNA 3KKSA 4DR4J 2PMZD 3AODA 3TEGA 1ZBLA 1ZQDA 3HW8A 5A8RA 2WBRA 3SAHA 4F5NA 4BRCA 4FK0A 5F9LA 2MRLA 2HZCA 3VQTA 5J0YA 2ZHAA 1G2EA 3QT8A 8ICXA 1KR4A 2CQCA 4G1PA 1XR6A 5ALWA 2Z0GA 4J03A 2E7WA 4K4VA 4ECWA 2VASA 3JYTB 4CGHA 2KSOA 4CF9A 3Q8VA 4IOCL 4F3TA 4UF4A 3LH2S 4I69A 4MEYA 3ZETA 3HKZD 5EDWA 3ZSZA 5F8LA 4JK7A 3BBCA 1VBZA 8ICTA 4CRJA 3AOBA 3J7YP 3CJ9A 1FEEA 4LFCK 1IM4A 5ALOA 3Q8KA 1H7WA 2MQPA 1FWLA 4CEFA 2KW4A 5B7WA 1YIJN 2F3JA 5GIOA 5C12A 3HYFA 4ECYA 3BF4A 5J1PA 9ICMA 3RZAA 2KN7A 3FSYA 2YY3A 1RDDA 1WG8A 3NRBA 4KFBA 3DLEA 1HJRA 3B78A 3BSNA 3D9BA 2OCEA 3D28A 1RT3B 2PA8D 4DLGA 4YOYA 2D69A 2EBEA 4PHPA 1O03A 3CJKA 4USJC 2OJ3A 4PKGA 3AY9A 1RXVA 1TL3A 1TL5A 2ESEA 1NKEA 4DX8H 4JYAJ 1OXJA 5KG1A 4O0NA 3ZSOA 2W55A 4Y2QA 1S1TA 2DD8S 4MFAA 3OFFA 3D7SB 2Q43A 3NL0A 2HOQA 4C48A 1NRKA 3N0VA 2VOOA 4XTTA 4OGEA 2EFVA 4ISEA 2Q36A 3U3YA 4P4MA 2CGJA 1T95A 4CHNA 4BE1A 3HOTA 3SQOP 2O4GA 4QAGA 1V6HA 2YMQA 1VCTA 4NY8A 5JXSA 4O0JA 4I2GA 2E1AA 2GVDB 1PBUA 1NK8A 1REVB 2DNRA 4LJMA 3R3TA 4KHRA 2IJFA 3C0BA 1F9HA 3DXSX 1NBWA 4ZIVA 2K7JA 3B0YA 2F8KA 2DNPA 2D9PA 2PC6A 1XNQK 5A2QO 3BKTA 2YX8A 2DGTA 3QT6A 4Z4IA 5TISU 3A5LC 2A42A 1O51A 4PYAA 1C7YA 2K60A 3MMBB 1BVSA 3BZQA 4RQ6A 4NXNJ 1DKGD 3F5AA 1DTTA 3OR2B 5F1XA 4DHYA 1RGIA 3DXKA 3HHLB 1U2RA 1RHMB 3MM6B 5A2QY 2BR0A 2QEXS 2I0XA 5C25B 3GV5B 4NM1A 2G0AA 1FNOA 2QJ3A 2WBNA 4L76A 3HRGA 3RMAA 1SQGA 3VQDA 2GAHC 3FSXA 3OS1A 2U2FA 1C1CB 2FZCB 2P9LA 4YOVA 5HP1A 3PFOA 4J9PA 4PZOA 2LMIA 3TOQA 5HQMA 5F8MA 1H6KX 2Q0RA 2ZTEA 2AQ0A 2ZC4A 3CCVN 3ZZUA 2QO3A 3G96A 4UOFA 3CC7N 5KT6A 3DRPB 3CFPA 1XNRJ 1YBAA 2SXLA 5DGAA 3F2BA 1O8BA 4ID5B 5CZ2A 3BR8A 3TVZA 4C0OC 3IGVA 2G13A 1JB0C 1M0SA 1FI4A 4FYVB 1RB0A 1L7PA 5B08A 3PX4A 1LWFA 1UJ6A 3SR6A 1J5EK 1HIWA 3H5XA 4WTYA 1J5EF 2ASMA 4NASA 1B3TA 2HFNA 3LPEA 2B0CA 1LW2A 4CGIA 2C2ZB 3W9HA 4M45A 3OLAA 3AU2A 5L38A 1GH8A 1BHLA 3WK5A 1PJ6A 3F2DA 2V51B 4WYBA 2H3ZA 2NUBA 2VIHA 3MR3A 2MAXA 4IRDA 2P51A 4OLOA 2R8GA 4J9LA 5M2UA 3KUHA 1LQ9A 3V81A 5EXWA 3V2UC 1S3XA 3CO0P 1F5BA 3QIPB 2YNIA 5ALUA 1FT8A 2I7PA 2IA0A 1KN5A 1Y7PA 5AE3A 5E33A 3QU5A 4YD2A 2M8HA 3VQQA 3KLIA 2R7VA 1U6ZA 2JGUA 2HIQA 1EKEA 1I3OB 1RAIB 2WVBA 3MN7A 4UB2A 4ID1A 5C2GA 4WQ5A 3S41A 4M3UA 3RMDA 2QB0B 3CE8A 1KVJA 1TR0A 1BC6A 1KVKA 2E6LA 2NLWA 2KJ8A 3KDNA 4JKCA 1XMBA 3VQ5A 2NUUG 4IH6A 3ZSWA 4WYWA 1H72C 3AGKA 5ALGA 1X9WA 1SWVA 2GZOA 1K47A 3CCQS 4O4GB 4HH0A 1Q3UA 2QKBA 4XA5A 3OTOF 1X66A 4FW1A 3PO4A 4QZAA 2C22A 4QZCA 4FJHA 1O13A 3SQ0A 2A40A 1T03B 2DHXA 1B0TA 1KSPA 4FBUA 4BXOA 2FF3B 2FZGB 4B8CA 4BR5A 1WC1A 2VJ5A 2YNFA 4ER8A 4JKBA 2MA1A 4FZXC 2GQQA 3G6VA 4OHWA 1Q9XA 1OVQA 3AU6A 2NSBA 4ED5A 1FEZA 1KC8T 3CJ1A 5KPRA 3I0RB 2UZAA 4ZITA 1APSA 4KX3A 1CG2A 4DZ6A 2GO9A 1WNSA 5FDLA 1JLBA 2YWEA 1VC0A 2AJ0A 2BM0A 3NGSA 2HQIA 5M1QA 4BDPA 1ZQHA 1Z00A 2JVOA 3QGHA 4FJ7A 9ICQA 3KHHA 4DX7A 3TTDA 2VPXB 4CHPA 4OYXA 4Q43A 4PXEA 3VGLA 5BPCA 3CHWA 1NZAA 3RG6A 4NXMJ 1NJYA 4IQMA 2BDUA 3M2VA 4CZEA 2AX0A 5CQGA 4H5TA 4FVUA 4EELA 1RT5A 3A3PB 3D3CJ 3D6RA 1S5JA 1R43A 1QHAA 1WUDA 4F02A 3MMVA 1SB3C 3R9KA 4OD0A 5SUHA 2C42A 4ES1A 5AKKA 1VJWA 4BDYA 3QATA 1JKHA 1NO8A 1RAGB 4ILJA 1L7NA 2NYHA 1QQ6A 4UUWA 5ALQA 2JEJA 5HQ8A 1B7YB 2MQQA 2W6LA 2MKCA 2WAQF 2JDJA 4WFNL 3TYTA 3H90A 4F4YA 2W54A 1A6LA 4GXKA 3QEBZ 2IDLA 3MEDB 5I9EB 1Q7LB 1PUZA 1VSEA 9ICCA 4XAKA 9ICVA 2W9BB 1SV4A 2J7UA 1FKOA 4IQXA 3MM5A 1UTAA 1NI3A 2CPXA 1LVHA 3I55S 5KFQA 3NGRA 3KIOA 4HHTA 2YPZA 2E1ZA 4DOBA 3CNHA 2K2PA 3VEOA 4CT9A 4TXSA 2KJ9A 3MAAB 1O1WA 3OTDA 3QEIA 3VGVA 2AA4A 1NK4A 4QS8A 2H4YB 3J81O 2QG9B 3IRXB 4OKJA 4ZHRA 5EE3A 3C7NA 5F9NA 2HLTA 4FWKA 1CEZA 4K42A 2CG8A 3JSMA 5AQYA 1DK2A 1VSLA 2Y9TA 3KDOA 3UVJB 4B3MJ 4DQSA 4CJEA 5D0RA 5G5HA 3ED5A 5A6WA 3G8TA 1DLOA 4JV2A 1VQLN 2E5SA 2V9WA 2OXOA 3PRVA 4LH5A 1RBOB 4WCEQ 2DR7A 1U02A 4W5TA 1B0XA 2HGNA 3UD3P 2GQ2A 3JPTA 2N82B 3LZIA 1S99A 1N32K 3J81Y 3KWGA 3AVBA 1N32F 3FLCO 1L3UA 4J5OA 2KM8B 1AB8A 4GV9A 4PPXA 1FO1A 2AHOB 1YWXA 3WXLA 1MA9B 4Z6FA 1S12A 1TUGB 2WF9A 2FJVA 1HFEL 2KG0A 3LP2A 4M7YA 1F44A 3H8MA 2EEYA 1N60A 3WKDA 4QIFA 5K14B 3O3HA 5CEHA 4H03B 3EGZA 4FLWA 2WRMA 3QX7A 4B1ZA 3M8WA 1SGGA 2MXYA 2UUBJ 4YDUA 4C97A 3TAEA 2B5JB 4CEBA 1QUPA 5D78A 1NK6A 2XRIA 4DL2A 1RG6A 1L8LA 3FBEA 4H5NA 3LF0A 4M5MA 3MURP 3HVAA 4B02A 4HT7A 1U1KA 3CCJN 4I2HA 3K0SA 2Y8YA 2CPFA 3G6YA 3OLBA 1SXLA 4ILLA 4RT3A 2QLFB 3ZZYA 2W8LA 3D1HA 4TY8B 2FQQB 1GK8A 2KE7A 2MLXA 4MFFA 2A2CA 1X4CA 1N0VC 2E1EA 3QMLA 3TAFA 3GCWP 4IDKB 2IRXA 3HZ6A 3NGUA 2FJ6A 3F2CA 5E26A 2QWLA 2P6SA 4OJLA 1X4DA 5AZJB 4KJIA 3DRRA 2DR6A 3GWCA 3QFUA 4JI1K 1WTBA 3WZ0A 1HX1A 1JMTA 1LFWA 1WSJA 4JI1F 1RZTA 3V9SA 3HWTA 2LSNA 3M6XA 4ZVQB 2D0PA 4ECXA 3H2UB 4RQ3A 3H4BA 3J7ZT 2KL8A 3R3LA 1HRHA 4NLTA 1VQ5N 2O01C 2K8BB 4M95A 2CDQA 1FXLA 3W2WA 3O3LA 5FPEA 2BPGA 2VODA 3QEAZ 2OEJA 1TV9A 4KE5A 1COOA 3UB5A 1ROFA 4FKYA 2JRZA 1VMBA 2JWLA 2MY8A 3GFZA 1S72N 3PHTA 3T6BA 1YDLA 1MDUB 4W4MA 4DN0A 4FO6A 1MWKA 2QTDA 3M7VA 4J7CA 4IRCA 1F5CA 3FSIA 1S6UA 3AV9A 4FJLA 2YQ3A 5IT0A 3RR7A 1K1SA 5D0HA 1UPHA 1KVCA 1T7PA 4BRKA 4ZLJA 2OGUA 5E41A 4LR8A 3J7AP 1GXTA 4K0KF 2E5GA 4CJUA 5AI6A 4PHTX 5AKHA 1RT7A 2GX8A 8ICCA 2V0NA 5MLCV 1C0UA 4OZLA 1P8ZA 4KQZA 1YJNS 1UPMB 3TZXA 4LF6K 5IC4B 3CCLS 1SJFA 5AHXA 1L6NA 4LF6F 2ZEJA 2GS8A 2HVZA 1VYAA 2MJNA 4CECA 1NMEB 1J54A 1G15A 1VQPS 2O8BB 4OI0A 1BCOA 3VGSA 5D77A 2H5JB 1HYZA 5FPNA 3ZD9A 5H9EJ 1EIYB 4YDDB 3A0IX 2AV5A 4CGFA 2CNLB 5ALSA 2ZWHA 4FS1A 1UMJA 2VDIA 4E19A 2VQEK 3CF5L 5B0GA 4CJRA 4FLTA 3WU2U 1F9FA 1KNZA 4DTOA 5BRDA 1LXNA 5DB8A 2HURA 1SAZA 1Q18A 3HP9A 5KRSA 1R0AA 4IEIA 4Q8FA 3IGNA 2DCUB 2KO1A 2DNGA 2Q6BA 3R5AA 3H0RB 1C0TB 3NVVA 3VAFA 4O3PA 4LFBF 1SZPA 1K9MT 1Y00A 4CJ4A 1UP1A 4CP5A 1OH6A 2GELA 3G2XA 4OV6A 3UPQA 3DRXA 5DJBA 1G3OA 4C11A 3VALA 2JJ4D 4K8XA 2J6SA 3JSRA 2HS3A 3G4SS 3N4PA 5LJ3Y 2JZBB 1KQSM 5HL7Q 4USMA 4RW9A 2UUCK 2OHDA 1KN6A 1F6TA 2FJDB 1UEUA 2UUCF 3H08A 4M0AA 4GY2B 3QLHA 3D0IE 2KYZA 3V4IB 1VRTA 3RJGA 3AA9A 3FQKA 4H0XB 2F4VJ 1Q86T 1K6YA 3KK2A 4QIGA 3ZNUA 1SZHA 1FRIA 3RB4A 4WKYA 3CJ3A 4FZMA 1DK3A 1X0PA 2DWQA 2CZ9A 2GHVC 1ZTTA 3RW7A 4A8WA 2NUHA 2YNIB 3TTFA 3NF7A 2YX1A 3OD2A 3R2DJ 5D49A 1WBBA 1SXEA 5AK5A 3ZT1A 1OKJA 3KLIB 1ZRNA 3OYKA 1YITN 1QVGM 4BQLA 1S76D 4CZGA 1ZQLA 4CJ5A 2E5LJ 5L1MA 1N5VA 1UVJA 2V52B 1QD1A 2HLUA 4OZ2A 1VSHA 1SH2A 2VH7A 5AKYA 1TKDA 1UFKA 5D4PA 3OL7A 1IBLK 2LVWA 3K89A 2OTLN 5IT4A 1IBLF 1ZQZA 3OBYA 1TL1A 1Y3JA 3NY0A 1WSFA 2YV0X 2MPUA 5CABA 3P49B 2KHQA 3G10A 4M6WA 3RBXA 1G99A 5AE2A 3R8YA 1ZD5A 5HLFA 4J9NA 2LDIA 4BC9A 1YI2N 4NLDA 3IA0A 4FF2A 2QLWA 1R0BG 1NGBA 2G8FA 2VD3A </