2XO7A

Crystal structure of a da:o-allylhydroxylamine-dc basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Discrimination between Dc and 5Medc Via Their Hydroxylamine Adducts
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 195
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xo7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xo7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xo7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xo7A01
2AGOA 4GC6A 1D9FA 4CJWA 3KK2A 1NJYA 3V9XA 5KFYA 4M3TA 2HHVA 1J54A 5DBCA 3PW0A 3PMLA 1T3NA 4KHNA 3LPUA 4Z4GA 3U3YA 4QZAA 4PQUA 4YD2A 4DMNA 3PX6A 4M9NA 3AVHA 7ICLA 2PFOA 1GOCA 1L3SA 3H08A 3L2QA 4BGDA 2KTQA 3VN5A 3LZIA 4OKKA 1T4GA 1YT3A 1WCLA 2IGIA 4Z6EA 3NH2A 1MSWD 4DQSA 3P1GA 2ITGA 2Q0ZX 4Z4EA 3G6XA 3E2EA 4NM1A 4I2FA 3DM2A 1ZETA 3EYZA 1QE1A 2A1RA 3K58A 4KLEA 4CJTA 2HHSA 4RPYA 2FLPA 3IAYA 1A5VA 4J2EA 3BQ0A 4DOAA 2FBYA 4HUEA 2PYLA 4I2EA 4NY8A 3AVNA 4DLGA 2HNYA 4CEEA 4KAZA 2KW4A 1BIZA 3NH0A 3PY8A 4FXDA 4M9LA 9ICIA 3LP2A 4FJ8A 4QZGA 1ASWA 1K1SA 2W42A 2G8WA 4E1MA 8ICBA 5CYQA 2W9CB 1ZQPA 4JWNA 3RBDA 3N4MB 2BPCA 5IIKA 2B21A 4I2BA 4O9MA 3CFRA 5DLFA 2FPKA 2C2EA 4X5VA 2XCPA 4FLYA 3PO4A 1S0VA 3MXIA 3AVLA 2UVWA 1UT5A 4KLGA 1VSHA 2HMIA 3HPHA 3V1OA 4W5TA 4JRPA 4UB2A 4KB1A 1UWBA 4CGDA 1TV9A 4AHSA 4M45A 3JPTA 5HNKA 4RNNA 5BPCA 4FM1A 2V9WA 1TAQA 5HHIA 4ECUA 3NF8A 4CEBA 4QCLA 4E0DA 3CFPA 3T3FA 5DB7A 2JEGA 1LB2B 4DTUA 2AGPA 4ED2A 1RXWA 1Z00B 1KVBA 4H4OA 1REVA 5CA7A 3U3GA 7ICTA 4FZXC 2HHQA 4NXZA 3ZSQA 3OYLA 4CGIA 3CM5A 4JV1A 3ISDA 9ICLA 7ICKA 4E7HA 3OYEA 1KLMA 1IO2A 3RJGA 5DQGA 1TKZA 1UA0A 2ZJ5A 1JLFA 4AILC 4QZEA 8ICUA 2PFNA 3LK9A 5KFHA 1EP4A 2R7YA 3GIIA 2KZ3A 3AVFA 2DPJA 4RQ3A 1N56A 4RW9A 7ICIA 4YMMA 9ICKA 5DG8A 3HT3A 3OVNA 3B0XA 1QTMA 7ICGA 1ZQGA 3C2KA 3VQ9A 5HRSA 3K5MA 5EWEA 1A5XA 4FJGA 4IFYA 1A77A 4XRHA 5HMLA 3V6KA 4KLQA 4YCXA 5J2BA 3C23A 5KTQA 3RH4A 2ASDA 4OKJA 1GOAA 4LZGA 4QW8A 3AA4A 5CZ1A 2XO7A 2ZTEA 4DTJA 4CJRA 5D49A 3DLRA 1TK8A 2J6SA 1RTHA 3T1AA 4M9HA 4HUGA 2NRWA 8ICNA 4OGEA 3MBYA 5BOMA 3V4IA 4DTNA 1NK4A 3NGZA 4HHTA 1S10A 3OSNA 3Q8RB 2BCUA 4JV0A 3ZSVA 4BACA 4MFAA 3V6JA 2RKIA 3MGHA 5C24A 3VQ8A 1UAXA 1J9AA 1JL1A 4JUZA 4R8UA 2UVVA 1UT8A 4KREA 3Q8LA 4UAZA 4Q44A 3V6DA 1T8EA 2BCVA 4F4YA 5J2CA 3DRPA 1HYSA 5J0TA 1RT6A 3RMBA 2GV9A 2QXFA 4KHUA 1VSLA 3SI6A 5J0UA 4UBCA 3RMCA 3NF7A 1RT1A 2OPQA 3AO5A 2FBTA 1S1UA 4KO0A 1VSEA 2NRTA 2FPLA 4PY5A 4YXMA 3RAQA 1NJXA 4F5OA 3VQ7A 4RUCA 3CQ8A 1KTQA 1ZQWA 2OZMA 4O0JA 2D0BA 3CYMA 1HQUA 1DGSA 2XCAA 3BGRA 1ZQVA 2C22A 1TK5A 4Q45A 1JLAA 3KKSA 3PMNA 2O4IA 4DWIA 4P4MA 4MFCA 1FK9A 2DY4A 5KFUA 2VANA 4OKEA 4BE2A 2DTUA 4EBCA 3QE9Y 4C8KA 1SL0A 3TAEA 3PW7A 1KCFA 1JMSA 3NHGA 2R8HA 2FLNA 3AU2A 5KI6A 4B9UA 4J2BA 3LANA 9ICPA 1MC8A 4CK2A 4BDZA 1JXBA 4TSXA 1Q9YA 1VRTA 5J0OA 1ZQOA 4YD1A 4CF2A 5IIIA 1A5WA 5J2DA 2NRVA 3TR8A 3IM1A 3K4GA 2QKBA 5IILA 2IHNA 4F2SA 5HMMA 2FMSA 4KLTA 3C1ZA 3MDAA 4CFDA 4EZ9A 4Y1DA 4TUSA 3RRGA 5J2MA 4TQSA 4NCAA 2F8SA 4KB0A 4I2GA 3ZSYA 5KT3A 7ICNA 4ICLA 4C8NA 3L2RA 3MABA 4FLTA 4UAWA 3MXMA 3V7LA 4C8MA 3AA5X 4UB4A 4QZBA 2YKMA 3AVBA 4OPJA 1C7YA 9ICWA 3KKRA 4HCBA 1JLGA 3M8SA 1IKYA 1VSKA 3OYFA 4DS4A 4F3TA 4F5QA 3MFHA 1JX4A 3VQ5A 4YG2A 4TUQA 5C42A 4ECRA 4CFAA 4FK4A 4FS1A 3HPGA 1HYZA 1RNHA 5HRPA 3QO9A 5KGWA 4FK2A 1T05A 1H38A 1KDHA 9ICUA 3ISBA 9ICEA 3AVMA 4I7FA 1TV6A 2C28A 4BXOB 4H4MA 1LW0A 1EKEA 4I29A 3L2WA 3V9WA 2O4GA 5CJ7A 4ECWA 4K4IA 1G15A 1NK6A 3G10A 1L3TA 4M6WB 4HVJA 4M9JA 3T19A 4DTMA 2W9MA 4M3ZA 3RJIA 8ICTA 1RT3A 4O0IA 2F1HA 4QZFA 1WSGA 2X6SA 4FJ5A 5DK5A 8ICZA 1ZQMA 7ICUA 4RT3A 1BL3A 1N6QA 2RPIA 1J5OA 8ICWA 3H8SA 4FLZA 5KT5A 3RJHA 3Q8QB 1TFRA 3KLEA 1V9PA 4EEYA 1T03A 1T7PA 1J53A 4CF0A 3ZCMA 4I9LA 4KLHA 2RDIA 1LWCA 2Z1GA 4RUAA 7ICFA 4CHPA 4R63A 4CCHA 3QEPA 4Z4IA 4OLBA 4CK1A 3GILA 4XQ8A 1ZBFA 4P4PA 1TK0A 3ZT3A 4KLJA 3HP6A 1Y97A 8ICIA 3RJFA 2ZUDA 1LWFA 1ZQFA 3AO1A 1ASUA 3O4QA 3H4DA 4DS5A 2J6TA 2JLEA 1KLNA 4J9RA 3DOLA 5KT2A 4F8RA 3EW9A 4DU4A 2NRZA 7ICJA 4K8ZA 1EXQA 3VQDA 1C1CA 3AA3A 4FM0A 2PI5A 8ICSA 2F8TA 4BDPA 1KRPA 4IRDA 1KSPA 3ZSWA 2C2DA 3QEWA 1IH7A 3RB4A 4ID1A 5KFLA 4RQ5A 3QETA 2ZD1A 2W9BB 4Z6DA 4I2QA 2DFHA 2Y1JA 7ICHA 9ICOA 4BXOA 1BPXA 3TANA 4RPZA 2BCRA 3TARA 1WNSA 3GV5B 2ISPA 1SKWA 9ICQA 3HXMA 1JLCA 1JLEA 3ZSXA 4J9QA 3EY1A 4FBUA 8ICKA 1MQ3A 2WOMA 4OJRA 1XS9D 1IKWA 1BPYA 2PFQA 1S1VA 4LH5A 2AGQA 4DL4A 8ICQA 4K8XA 1ZBIA 5KFEA 2D5RA 4ECXA 4EYIB 4RQ6A 5IINA 5KFVA 2VA2A 2GUIA 4CGFA 5J0QA 2WTFA 4ED3A 2BGWA 1HUOA 3WNHA 3TQ1A 2W9CA 1FKPA 3PR4A 1S6QA 2VG7A 3S3MA 2PFPA 4DL6A 2JEJA 2C2RA 4KLFA 4EP5A 4F5PA 4QZDA 3RRHA 2MUTB 4M3XA 1RYSA 4FLXA 2HVIA 5JS1A 2W9BA 4Z0UA 3L8BA 3DLEA 3RH6A 2M9NA 1SV5A 2ZUBA 3ZDDA 5DB8A 4CJUA 5KFPA 2HVHA 5DDYA 3V72A 2EHGA 3OYDA 4JS5A 1CLQA 3MR2A 3AVAA 3ZSZA 5J2NA 4GVMA 1MU2A 4Q5VA 4B08A 4QZIA 4B8AB 4K4GA 1PZNA 3LWMA 4ID5A 9ICBA 3D45A 1ZJMA 3V9UA 3ISCA 4KRFA 4CJPA 4M2YA 1SUQA 4EZ6A 1JLQA 5DQHA 4KLMA 1XC9A 3K59A 2ZQBA 9ICJA 2BCSA 3S9HA 1N48A 4YN4A 1S6PA 4YR2A 3AVKA 4CJ4A 1QSSA 2UVUA 5J2KA 8ICYA 3GFKB 1WLJA 3F73A 1RT2A 2V4RA 2V4QA 3C1YA 3RB6A 4CEZA 4FM2A 4EYHB 2PY5A 3QZ8A 3C5GA 2IMWP 4ELUA 3JPOA 2UVRA 2ALZA 3AO4A 3V6HA 1RBTA 3E01A 1RT5A 4FVMA 4DSIA 3TAPA 1QQCA 4XA5A 1ZQTA 1RTDA 4CGJA 3M8QA 4F5RA 1S9EA 2YNIA 5KG6A 1ZQXA 4MF8A 1Q9XA 4JK1A 1Z3EB 3B6PA 2G8HA 1LW2A 3GIJA 2D0CA 4CJLA 4CIEA 4EBDA 5IIJA 3SV4A 3SYZA 3GIKA 3DLBA 1S1WA 2GWSA 4TUPA 1L3VA 4F4WA 3C21A 3N97B 5KG7A 1LV5A 1XSPA 3ZSOA 3RB3A 2VWKA 5KFTA 4JS4A 4E1NA 5CWRA 3BQTA 4MFBA 5EU7A 3M9MB 5DB6A 3MR5A 5FDLA 3VQ6A 5IIMA 4CEAA 3CG7A 2BQRA 4M04A 4J9MA 4H8KA 3KK3A 3AVCA 2OYQA 3FDSA 5J0YA 4B9NA 9ICMA 5T7BA 1TL1A 3HYFA 4EBEA 3UXOA 3ETLA 4DSLA 3T5HA 1CZBA 2B6AA 4IDKA 2OPSA 2J6UA 4TQRA 3KLIA 3AO3A 3OS0A 4IQUA 4KN7A 3TI0A 1SL1A 4CECA 1KFSA 3SQ1A 3SPYA 4IQVA 3ZDEA 3MDCA 4OLAA 3GQCA 9ICSA 1BPZA 3RR8A 1RYRA 3QERA 4O4GA 3O4NA 2IA6A 8ICCA 5J2PA 3OYKA 4ECZA 4O5BA 4DFMA 2FLLA 3DRRA 2FBVA 3IG1A 3MECA 3SQ0A 7ICQA 5J0RA 3SNNA 1C1BA 3B0YA 5DDMA 4M41A 3SUOA 3BQ2A 5KFRA 4F5NA 2YNGA 4YP3A 2I1QA 2ZJ8A 2XRIA 5IIOA 4QZ8A 4CJKA 4DL3A 4QAGA 4RZRA 4RQ1A 4G1QA 2AQ4A 1ZQHA 4YFUA 3RB0A 5HP4A 4PUOA 8ICRA 4HYKA 3C2MA 3RJKA 1EETA 3LPTA 4FLUA 2R8KA 4CJVA 5J0SA 2Z1JA 2YHAA 4KHYA 4UB3A 5HBMA 1TAUA 1ZJNA 1MQ2A 3SQ4A 3LP0A 4IR9A 1X9SA 2IS3A 4QW9A 2Z1IA 1B9FA 1ITGA 1ZQUA 3NFAA 1JXEA 4Q8FA 2MAXA 7ICRA 3Q8SB 2PXIA 3RJJA 2PI4A 3H4BA 3K57A 4KMUA 2G8UA 2BPGA 3HK2A 2RDJA 1BQMA 1CXUA 1W9HA 1BCOA 3TAQA 2QK9A 2XC9A 3RTVA 1F21A 5HROA 8ICPA 5KG3A 4KLSA 4YQWA 4CK3A 5D3GA 3MR3A 1U45A 3FYHA 1NK7A 3QEVA 4KHQA 3T5KA 3VA0A 4RQ8A 5J2IA 1EX4A 3ZT2A 4IG3A 3PUFA 3JPPA 2KZZA 5FROA 3LWLA 3D0PA 4IQTA 1VK0A 2HHWA 5L1JA 1BIUA 3F9KA 1XHZA 4QWDA 4W5OA 4F50A 4Z4FA 3BQ1A 4FJJA 4ED8A 5HHHA 3HSTB 4Z6FA 3C95A 4J2DA 2BE2A 5HLFA 3OYBA 3HL8A 4CHZA 2BHNA 1X2IA 3EZ5A 2VWJA 1QSLA 1K1QA 3FFIA 1ZQNA 4RNOA 1O1WA 4DTOA 1ZBLA 2BR0A 4KI4A 4NCGA 4KV8A 1U47A 2BDPA 3VQAA 2ASJA 4LZDA 5DMRA 4FJNA 1U04A 2R8JA 4RG8A 2P6UA 4AH9A 1TKTA 3VQ4A 2ASLA 3V9SA 2Q3SA 4RQ4A 5DKWA 3H8JA 4CJEA 3MEDA 3RWUA 3QNOA 3AU6A 1VSDA 4AHUA 4M3YA 3SUQA 4KLOA 3GV8B 5CR0A 2FMPA 9ICAA 3MEEA 4KLIA 3AVJA 4J9KA 5SZTA 3C6UA 4GXKA 4RW6A 1NKBA 5E41A 4QWBA 4O3NA 4B9LA 5KFIA 3TFSA 4MQ3A 4FLVA 2B5JA 3RJEA 2FC0A 2DPIA 4M3WA 5DG7A 3O3FA 2DFEA 2JEIA 2E6LA 4DFPA 9ICFA 3KLFA 2ZJAA 4NLKA 4IKFA 4O3QA 2PYJA 3GV7B 2HHXA 5KRTA 3PNCA 1TVRA 4CJFA 4CEQA 1NK8A 3MFIA 2P51A 4B3OA 3OYAA 3SV3A 1U4BA 4PHAA 3P5JA 3EPGA 1HRHA 5D46A 3NE6A 2G8FA 4R66A 4RT2A 3TFRA 3PVXA 1ZQSA 1ZQDA 5HRRA 1IKXA 3SZ2A 4ED7A 3KIOA 4KKOA 2YV0X 4M6WA 1U49A 4DSKA 3DLGA 3V81A 4I28A 4ZTJA 4FJKA 2WONA 3WNEA 3NF9A 2E4LA 1HQEA 2QKKA 4DL2A 3LAKA 4QWCA 1S97A 4I2CA 5KFOA 3RH5A 9ICVA 1VRUA 4FZYA 4N41A 5BOLA 2D0AA 1IG9A 2VG6A 2P66A 3NBPA 3OYHA 4KFBA 3JYTA 4ED1A 4CE9A 4B9MA 2Y1IA 4KN4A 5CZ2A 2NRXA 2JZBB 3L2UA 4FS2A 8ICGA 1C1AA 1TKXA 5KG4A 1XSLA 3L3UA 4CEFA 3OS2A 5KG5A 4F4XA 4E7IA 3WNGA 4I2PA 3OJSA 1JLBA 5CP2A 4QWEA 3ZD9A 1HJPA 4R65A 3B6OA 1ASVA 2E6MA 2R8IA 2W8LA 1ZBUA 4NLGA 1XSNA 3QIPA 1S5JA 1HUZA 5J2QA 1ZQZA 3IHQB 1RZTA 5DG9A 4RU9A 5EWFA 2R8GA 4CHOA 4Q43A 5KFSA 1COOA 4XUSA 4KLDA 4M3RA 3SPZA 4YMNA 4NM2A 5C5JA 1HYVA 1CZ9A 1BQNA 3QEAZ 1I39A 3QLHA 3PW4A 4J9SA 4Z4CA 3NTUA 3ZD8A 4FJMA 3G6VA 4F93B 4FJ9A 5KFGA 2BCQA 3OYCA 1TL3A 1JXLA 3OHBA 4Z6CA 4C8LA 3I0SA 2XHBA 4Z4HA 2ETJA 3ZT4A 1D8YA 3AVIA 4FJIA 4RQ7A 4I9QA 1WAFA 2X78A 1JN3A 3LDSA 2NUBA 3HVRA 1YVUA 3PX4A 4CFCA 4O3OA 3OHAA 4CFBA 3DLHA 1SKRA 3VQPA 5J2GA 2OZSA 3C94A 1RDBA 3ZDBA 4YNQA 4I2DA 3KHRA 4F4ZA 1RBRA 4DTPA 4QZCA 3K5OA 8ICOA 1CUKA 4R8UB 2KFNA 4FJHA 1ZQEA 1ZQQA 4O5CA 2KZMA 4ED6A 3DYAA 4I2AA 3QEIA 4R64A 5J0PA 7ICEA 4G3IA 4GXIA 1ZQAA 1B9DA 2P5OA 4DLEA 3SCXA 9ICTA 1NK5A 4ECTA 3OYIA 5KFZA 3UPQA 3GDXA 1ZBHA 4FYDA 2VA3A 4RW7A 3C5FA 5I42A 4M47A 4MEYA 4E19A 3KHLA 5HRNA 2FBXA 1WAJA 2X6NA 4KI6A 1BVSA 1C0TA 4KITB 3VQQA 1SKSA 4M3UA 3NGDA 4CESA 9ICGA 5L1IA 2ISOA 4L8RB 1ZQCA 4GC7A 1HNVA 4IQWA 1C0MA 8ICXA 4M42A 4DSEA 9ICNA 5KFMA 2ATQA 3AA2A 4UBBA 3DMJA 1YTAA 3RMDA 1C0UA 1DOQA 1Z26A 4KTWA 1XI1A 4EP4A 2HHTA 4QWAA 5D4BA 3JPNA 1ZQLA 3PW5A 4M9GA 4B8CA 4N5SA 4B9SA 1S9FA 3RR7A 3DOKA 3KTQA 3PW2A 4QOZB 1IXRA 7ICVA 3OYNA 2OPRA 3PO5A 1RT4A 5KT4A 4I27A 1RDAA 1ZQYA 4B9TA 4B9VA 3V1RA 4DSFA 9ICHA 5KFWA 4W5RA 4CIGA 2ATLA 5FRNA 4J9LA 3CM6A 1BPBA 3ZSRA 4UAYA 8ICEA 1K6YA 1RPLA 4DEZA 1BI4B 1RXVA 2IHMA 2XGPA 2XY5A 1I3AA 4CF1A 1X9WA 5J1EA 3HX0A 3DI6A 4W5QA 8ICMA 4CJQA 4P4OA 4AHRA 4HTUA 1ZQRA 1DTQA 5J29A 3DRSA 1D5AA 3OSPA 1NKEA 1SL2A 4RW8A 5KFJA 4YMOA 3KHGA 4F4KA 2FMQA 5KG2A 3OYGA 1XWLA 4BWJA 1BCMA 5JS2A 1UOCA 1RILA 2YNFA 4CERA 5F9LA 1VSJA 1Q8IA 4CHQA 5KFAA 3H7IA 3C2LA 1IKVA 1WSHA 3KJVA 2YHBA 3BDPA 4KHSA 4KTZA 3MR6A 3LDAA 4J9NA 4DOBA 1RBSA 2I5JA 1BPEA 2IBKA 4DL5A 4PGXA 4AHVA 4NLNA 5C25A 3KLHA 1RTIA 2BKEA 5KFBA 5KT6A 4CGGA 3V7KA 1XU4A 4OPKA 3KD1E 3PX0A 3T5LA 3V9ZA 4F91B 4O3SA 5KFFA 3SJJA 7ICMA 1WSFA 4O3PA 3KLGA 1ZQKA 4R5PA 3QNNA 3NAEA 1ZYQA 1L5UA 4FBTA 1RBUA 9ICXA 1BPDA 4YR3A 4FZZA 3QZ7A 1L3UA 2KN7A 2LYHA 4LSNA 3KK1A 4LD0A 3I8DA 4UB1A 2BQ3A 3OJUA 3QEXA 1WN7A 5KT7A 5SWMA 3P83D 3S3NA 5J2AA 1B22A 2HB5A 4DQQA 1QS4A 4DFJA 3H40A 2LSNA 1N5YA 9ICRA 4HCCA 4NLZA 4E7LA 3HM9A 4E3SA 1WSIA 4RQ2A 4DU3A 3VQBA 4O5KA 5L1KA 1FKOA 1S77D 4JV2A 5F9NA 4GXJA 4DQRA 5KFKA 1WSEA 3SI8A 5KG0A 3NH1A 1JIHA 4E7KA 3HJFA 5KGXA 1FXXA 8ICHA 3ULDA 4BE1A 3U6FA 3JPSA 3HO1A 3K5NA 3RMAA 1SZPA 9ICCA 5CB1A 1RDCA 3L2VA 4YFKA 4IG0A 5EWGA 3QEBZ 8ICFA 4OGCA 1B92A 3V1QA 3ZDAA 4Y1CA 2A1SA 2A1JA 2ZTCA 3GIMA 2XY8A 2OWOA 1TKDA 2KFZA 4ECYA 2BANA 3OY9A 4MEXA 1Z00A 1RDDA 2IAJA 3C6TA 2F1IA 2XY6A 4ZH4A 2OPPA 2A1JB 4KLLA 1BI4A 2BPFA 3OS1A 4YVZA 1WSJA 2RN2A 1DTTA 1NJWA 3AUOA 4FJ7A 5DLGA 5J0WA 1CEZA 4GW6A 1LAVA 1B43A 4NYFA 4GLXA 3HP9A 8ICAA 2MUTA 4CEOA 4FCYA 3QINA 3LP1A 3QIOA 3M8RA 2AJQA 1X9MA 2G8VA 3MAQA 2PZSA 3ZDCA 1RTJA 8ICVA 1ZQBA 3LAMA 4ECQA 5KFXA 4ELVA 3UIQA 4C8OA 2XGQA 1W0HA 4J9OA 3PV8A 3Q8KA 1BGXT 3HW8A 3CFOA 4O55A 2IOCA 3AVGA 4MF2A 4BE0A 4UQGA 2H5XA 4K4HA 4IRKA 1KVCA 1CXQA 4J2AA 5L9XA 4QZ9A 4BDYA 5KG1A 1WCNA 4CJ5A 4ELTA 1EXNA 1AROP 2W8KA 2IDOA 4PHEA 4DTRA 8ICJA 1S0NA 4CJSA 2YKNA 2G8KA 2OA8A 4IBNA 5J2JA 3DLKA 5CYMA 4CJ3A 2YNHA 3K75D 2RF2A 1ZQJA 4Q8EA 4IRCA 2KQ2A 5KFQA 4DSJA 4DFKA 2HW3A 1A76A 1IM4A 3ORYA 3KHHA 1RBVA 4FK0A 3AV9A 3NGYA 3O3GA 1NOZA 4N56A 1LAWA 4MFFA 2B4JA 4WE1A 2BGGA 2GBZA 4PGYA 3L3VA 4DOCA 3BJYA 3Q8MA 3LP3A 5I3UA 4PA1A 4DG1A 3ASMA 3S3OA 5EOZA 4PPXA 2XY7A 1C6VA 2DFLA 4RPXA 1KEJA 1Z25A 1D9DA 1XHXA 2IC3A 4F2RA 1NOYA 2X74A 4DO9A 4F92B 4PGQA 3OYJA 4KLUA 1VSMA 4CIFA 1VSIA 4LSLA 1HNIA 1TGOA 4LVSA 4M0AA 4E89A 3K5LA 5DGBA 1S0MA 3MXJA 2I9GA 4ZTFA 4AHTA 2JZBA 5L1LA 5K14A 1HMVA 3SUNA 4DU1A 3H8WA 4CHNA 4CF8A 4OVLA 4RQ0A 2W9AA 1DLOA 4LY7A 3ALYA 5JUMA 4DQIA 3RBEA 3NCIA 5DGAA 4O44A 3TAFA 7ICSA 3UQ0A 1JKHA 4ZHRA 4FW2A 1S9GA 4PHPA 3JSMA 5J0XA 1JL2A 1QHTA 3UXNA 2VA8A 3TWHA 4N47A 7ICPA 2P1JA 5DBAA 4FO6A 2AU0A 4ED0A 3OYMA 4Q0BA 1R0AA 3NGIA 2HNDA 1RT7A 3QESA 2JEFA 1NK9A 4ECSA 4DL7A 4N76A 4YR0A 4DTSA 1GOBA 5KFCA 3UQ2A 7ICOA 3WNFA 3K2PA 1XO1A 3EWAA 1ZQIA 1U48A 2BQUA 3TAGA 4W5NA 4RW4A 3G0ZA 4ECVA 1X1PA 4KHWA 4FJXA 2G8IA 3M9NB 4I2HA 1S1XA 4J9PA 4F3OA 3LZJA 3PR5B 3MGIA 4DF4A 8ICLA 4BWMA 2FPMA 4JWMA 4DF8A 1BISA 5KFDA 3KD5E 4P2HA 3AO2A 4IR1A 5CY4A 2F1JA 3MEGA 1KFTA 3IS9A 1D8LA 3HPOA 1S76D 5FRMA 2VG5A 4I2JA 5DBBA 4O5EA 5DB9A 1UA1A 3VA3A 2P5GA 3JPQA 2JGUA 4CHYA 5J2FA 4CF9A 3OGUA 1TVAA 3UXPA 4DQPA 3NDKA 1NJZA 1HJRA 4PWDA 2EX3A 3A2FA 3HVTA 3NF6A 3ZT0A 4GMJB 4JLHA 3ZT1A 4JRQA 2DFFA 4CEDA 4KPYA 1BHLA 3IRXA 1KFDA 3LALA 1NK0A 4LH4A 4HUFA 4FLWA 4QZHA 1NOMA 3HWTA 3I0RA 2P6RA 3VQCA 4RNMA 3RAXA 4KTQA 5KRSA 5J2EA 2F96A 1NKCA 3Q8PB 4FW1A 4PH5A 4NYNA 5DQIA 4XIUA 1S1TA 4IFVA 4UB5A 3ISNC 2HNZA 4E7JA 1QLNA 3SQ2A 5HP1A 1LWEA 1S0OA 3JPRA 1HPZA 2ZE2A 3G6YA 1QSYA 3EPIA 1RCHA 4FJLA 4TURA 3SUPA 2ZUCA 4O3RA 1Y88A 3TAMA 3VQEA 5CHGA 2ZTDA 4DTXA 3ITHA 4NCBA 4AHCA 4CGHA 4YXJA 5J2HA 1U9LA 3M8PA 2HHUA 1KVAA 5TZVA 2Z1HA 3V7JA 3THVA 1VSFA 3T5JA 1YTUA 3M9OB 4PHDA 3TABA 2AQ0A 5KFNA 4I2IA 3O3HA
chains in the Genus database with same CATH superfamily
5K5MA 1IKWB 3OL8A 4DV7J 5ALPA 1GAOA 1EQ0A 3CPEA 3J8AA 4OI1A 5ALUA 1F9EB 2EKYA 1WWVA 4OJOA 3DNCA 2RHQB 1J54A 1P6TA 4L72B 5DBCA 1W7WA 3HULA 1CQNA 3TZYA 4MLHA 2E9ZA 3R5AA 5DM7Q 5J1EB 3VALA 1D8BA 4YD2A 3AVHA 5B0BA 3SR6A 1RHUB 2D3O1 2IMOA 2CQIA 2DXEA 1IG6A 2HGLA 4TU9A 3HILA 1NM2A 4JV5K 3OTOK 3L2QA 4OO1J 3UD3P 3VN5A 3HZ6A 3LZIA 2BJ8A 1ELOA 3SDEB 4Z6EA 3UDVA 3EMTA 3W63A 1KVJA 3P1GA 3GONA 5ALYA 5HK4A 2V2KA 4JKHA 1SC3B 2PEBA 1SJ3P 2BTFA 4LF1A 2E5HA 2M7SA 3DM2A 3EYZA 2O01C 1D4XA 2A1RA 4KLEA 4CJTA 4JI1K 4OD0A 2FLPA 3B6BA 5A0YB 3IAYA 4UAUA 3G86A 4BR5A 1KQSM 1JCEA 2XIDA 1Y7PA 2FBYA 4I2EA 1RDWX 5G0RB 4ILRA 2JOQA 4CNQA 1Y4ZB 2D6FC 2RB7A 4CEEA 2ZBPA 2W3RA 1U8SA 4M9LA 9ICIA 5CA5A 1S9GB 2H51B 5AQIA 1VK3A 4R25A 5AIAA 3RBDA 3N4MB 2B21A 3M7DA 1I94J 1Q7YO 1S0VA 1AUSL 2JX2A 3HHKA 3HF5A 1TU0B 1EX8A 3KBBA 2MGZA 3J80O 3BKTA 2M5YA 1QE1B 4NXNJ 4UB2A 2V8VA 4EGLA 1TV9A 4DR7K 4FF2A 4RNNA 4FM1A 3TA0A 1WWUA 3ZTSA 3GYXB 4MTPA 2WB1D 4E0DA 2VKZG 2Q0RA 4YOTA 3M2VA 5IT9Y 2EI5A 3NUQA 2A42A 2VJ4A 3NCRA 1X6JA 3NVKA 4JI2F 4NRTA 4OYPA 5D4LA 2GUPA 5LY3A 2O66A 1UVIA 4FZXC 3G4SS 3W65A 1SGGA 3C15A 3BN7A 5AQVA 4CYUA 1YRUA 2OPQB 2WW4A 2DNPA 4CGIA 4Y2AA 2ZIWA 3OYEA 3DHXA 1KLMA 1ICEB 5IT9O 3MN9A 1SB3C 2HVZA 2W01A 3J81U 2OLWA 2ACMA 2FI1A 4QZEA 2HHHK 1T3QA 4KPCA 4DV0K 2HK2A 2LYVA 2OYYA 1SJRA 1NHVA 1F0MA 2QE5A 3R2DJ 2KT3A 3O9RA 5AKGA 1OO0B 5G0RA 3TX8A 5HOOA 3CGIA 2E5SA 4YMMA 7ICIA 2XWXA 2KJVA 2A18A 1WEXA 4OJLA 1NGCA 1BA1A 4FJGA 3QMQA 4IFYA 4XRHA 4WQ5C 5HMLA 2YQ1A 2AKWB 4ILMA 5J2BA 3C23A 4YHHF 2ZBCA 1WDDA 2WHOA 3GTYX 1GOAA 2BJ7A 3AEVA 3ILOA 1S1TB 3M4XA 4QW8A 1UWAA 3MCSA 1CJKA 4E98A 4NO7A 1FJCA 4CD1A 4DTJA 2ZZNA 1V38A 3O8MA 1UW4A 4W92B 3HI9A 2DH8A 2QN6B 3T1AA 3O08A 3QX7A 3IBWA 1BOTO 4RWTA 2X7IA 3M32A 4HHTA 1S10A 4A8XA 5BXIA 3ZSVA 3MD3A 2OPPB 3B54A 3NS7B 5AM2A 4M5JA 1HQEB 3QB0A 3C14B 4ZIVA 4KREA 5HJXA 5K4LA 3V6DA 3KYLA 2NXUA 2CZVC 3AOAA 3DRPA 5IWAK 1NLVA 1VSLA 1YVFA 3SI6A 4UBCA 3EM1A 2OPQA 2A2CA 4WXOA 4KO0A 1VSEA 3D6RA 1FT8A 5EOYA 2HFOA 5KOXA 2DNOA 5IQ6A 3CD6N 1U2CA 1VYAA 3M3ZA 3OR1A 2VQFJ 1IBLK 1AFJA 4UATA 3BGRA 2DXDA 2RE2A 2FHMA 4C80A 2K4IA 3KKSA 2ILZA 2VG5B 4P4MA 2F2AB 3CNQP 5IC6B 2V2QA 4OQJA 1FK9A 1PBAA 4OI2A 2E7VA 4OKEA 4WFZA 4BE2A 4LF4F 2GX9A 2DTUA 4G1PA 1ZC6A 1R8PA 3QJLA 2Y8YA 4A2BA 4C8KA 4CO3A 1SL0A 3DN9A 4A5BA 1JMSA 5AM0A 1NGEA 4ZVGA 2WF9A 2DNZA 1UKUA 4DR6K 2G2YA 3PNIA 5AQYA 4CK2A 3FEXB 1JXBA 5J0OA 4YD1A 3D2EB 2D41A 3J7ZT 1A5WA 1HHQA 3HHEA 5AI0A 3MEKA 4F2SA 4KLTA 3C1ZA 3MDAA 2RUGA 2JWLA 2BOAA 2YQ0A 4EK2A 4KB0A 4I2GA 1NSQA 4ZP9A 4YB7A 2QFIA 4UAWA 3Q7BA 3V7LA 3K5PA 4NLSA 9ICWA 2EC2A 3H2VE 1JLGA 4CQ1A 3ZZUA 2HFVA 5D8HB 4GKKK 3BO2A 5L46A 5AKHA 2CPXA 2W7AA 3FC9A 5EX3A 4ECRA 2H4WB 2DGQA 5D78A 3EGNA 1T05A 5AXNA 3H0PA 3ENBA 4ZPBA 9ICUA 3AVMA 2C28A 1FDAA 4H4MA 5EE9A 4MIAA 1MMDA 2Q97A 5H9EJ 4ZCMA 3H2UB 1OVYA 2UUBJ 1EKEA 1A0PA 4NYOA 5CJ7A 4ECWA 3D6TB 5HI7A 1SJFA 4ES1A 4PYDA 4M9JA 4B3RJ 3LTOA 1FA0A 3LGNA 3WX8A 2IA0A 4IQMA 1FTRA 4M3ZA 3W61A 2E1CA 3VOVA 2F1HA 4QZFA 2QC3A 2X6SA 3QGGA 5ALEA 4GVEA 1ZQMA 4BRNA 1H7XA 4ILGB 3IFRA 4RT3A 1BL3A 2CJBA 1N6QA 3Q22A 3D9BA 8ICWA 4B1WB 3P8BB 3PZPA 4FPIA 1V4TA 2WC9A 3H8SA 4LF5F 3RJHA 3A8IA 2BRKA 1LNQA 1VQSA 1B64A 2IVPA 2WK4A 3P96A 5I3PA 3HVTB 4OHWA 4DU8A 1A0OB 1BHNA 2OSRA 4KLHA 2RDIA 2ZUAA 5I9EB 3GE1A 3AJ1A 1XR6A 4IH5A 2O6KA 3PSIA 4U6PA 4BQLA 2KEYA 2ABYA 4R5PB 4CHPA 3HTVA 4B1XB 2E2OA 1S6PB 3C3LA 1MMLA 2I7PA 3E9LA 3GILA 4MDBA 3M30B 2GFFA 2W6KA 3ZT3A 4I64A 1Y97A 2R7OA 3RJFA 3IM8A 1DHMA 2H3GX 1LWFA 5IQQA 4AL7A 5LXYA 1FVSA 2F4FA 3CB4A 1VR6A 2JVRA 4QS7A 1IBLJ 7ICJA 2QA1A 3AA3A 1B0TA 4FN5A 4FM0A 4DV2K 2F8TA 1AT1B 2C2DA 5KNIA 4ISFA 2V2VA 4LF6J 1MDUB 4USKA 2DFHA 7ICHA 4RCHA 3P3DA 3TANA 3FRZA 5AXLA 4NLCA 6FDRA 1N36J 1F1BB 1WNSA 2OO4A 4JKAA 3QGPA 3D2SA 2BZ2A 4J9QA 5B7WA 3ZSXA 2WOMA 5ETRA 4WKYA 1HW9A 1LWEB 4DL4A 4K8XA 4PR6A 2FC9A 2Z57B 2OHFA 5IINA 5KFVA 2VA2A 2P9NA 5J0QA 2WTFA 2G0AA 4ED3A 2BGWA 4NZ6A 3TQ1A 2UUAF 1YJVA 3PR4A 2VG7A 5E33A 1X4HA 3O5TB 4DL6A 1X60A 4KKOB 2ZIUA 4FPAA 3J81j 4K2XA 2XMAA 3M1YA 2O8CB 4K25A 3CC4N 3FEZA 4WU3A 2ZJPL 1X40A 1R6YA 3NL0A 5AE1A 4DR2K 3RJMB 2ADCA 3RH6A 3CPWM 4ES2A 4CJUA 5KFPA 3OUYA 5DDYA 4JS5A 2W1BA 1TMMA 1CLQA 3MR2A 3AVAA 2COLA 3ZSZA 5ADXA 5AE3A 5J2NA 3O80A 1N5XA 4GVMA 1DFDA 1E6YA 4QZIA 4K4GA 1PZNA 4B3SK 4CBXA 3SCJE 4ID5A 4L3QA 2MLZA 2O8EA 4OHXA 1J2MA 1GLCG 1ZJMA 5DQHA 2MMYA 4JKFA 1XC9A 3K59A 2XNQA 1Q82O 4DCCA 2ZITA 3ZETA 3A3NB 1Q8LA 2P8IA 3LUYA 3AGKA 2AXTU 2CA9A 2M4MA 2GX8A 1QSSA 1FE4A 5D0HA 3GFKB 5ALFA 3SDEA 1WLJA 2MKHA 2V4RA 4IEIA 3C1YA 3QGIA 2PY5A 3NGSA 4ELUA 3JPOA 2ALZA 3K0SA 1RT5A 1WORA 2JL9A 1GLAG 1KW4A 1X0FA 3G4SN 4FF1A 4RNFA 1S1WB 3HLUA 5AZJA 5KG6A 4MF8A 2YI1A 1Q9XA 1JJCB 1M5KC 4CJLA 3K7RA 4CLLA 3GIKA 3UCZP 3M6XA 2A1BA 1S1WA 1VCTA 4TUPA 2WVCA 3SK3A 2P9SA 2X1AA 1HPZB 4WFAQ 1CBKA 2VUGA 3KUGA 3ZSOA 3DI6B 2WCXA 3VWSA 3HHLA 4NXNK 2E9TA 1SS6A 4JI0J 2CJXB 4FDFA 4DV1J 3ZNJ1 5EU7A 4I6WA 1EB0A 1LFWA 4K41A 5FDLA 2LKYA 2ZJRQ 4CDGA 2E8MA 2C3YA 2CG8A 1I94K 2KKPA 3EGVA 1VBKA 3G6EN 2GHWA 3CG7A 1HWUA 3H98A 4J9MA 2WBRA 3KK3A 3I55S 3IG1B 4AT1B 1NDPA 5T7BA 3CC4S 2HZCA 2LXFA 4B3MF 3ETLA 4NMLA 1AB8A 1HNIB 4QIWF 2QGFB 4YMEA 4IDKA 5LMNF 5AI5A 4DV0F 1S59A 2MY8A 1HYSB 3MM9A 4KN7A 1IM6A 4CECA 1KFSA 2DCUB 4YY3K 3MDCA 4ES3A 1RYRA 2RAQA 3SCIE 1S7HA 4O4GA 1P90A 4BGAA 2IA6A 1R6VA 8ATCB 3OYKA 4QYRA 5HMXA 4YOUA 1U6FA 3HFZB 3VEWA 2G0IA 4C8ZA 3JXOA 2WSCC 3SNNA 3D2NA 3B0YA 3KKAA 3BQ2A 4F5NA 1RE1B 2IOFA 2YNGA 2ASPA 4YB1P 5BPMA 2DNQA 3FRYA 3N4WA 4RZRA 4RQ1A 2DNYA 4WK1A 3G2XA 2D1CA 2DRAA 2UP1A 2B0GA 1SQKA 3C2MA 1EETA 3LPTA 3EVOA 3FQLA 4IWVA 1S1XB 3QRQA 1VQYA 3LA0A 4DV4K 5J0SA 3CIMA 3D7SB 2YHAA 5B0AA 3EGWB 3P4IA 2E7XA 4TLQA 4WZQA 5F8LA 2HQ3A 1WOSA 2V6AA 5HVFA 1ZA2B 1VS3A 3Q7CA 4WYBA 3LP0A 2KNJA 2F8EX 4M5KA 3LVVA 3TVYA 4PEOA 2LM1A 1ITGA 3KZBA 1ZQUA 3KKAC 2WFBA 4BQZA 3QFHA 3CQXA 3Q8SB 5BJRA 1URRA 2HMPA 1U0HB 4LF7F 4PWDB 3WU2U 2MGZB 4U7UK 5AK3A 1HI1A 1W2IA 2AEFA 5M1KA 3TTDA 3CD5A 1JI7A 1BCOA 3DFEA 8ICPA 5KG3A 1U7LA 3M1VA 1U45A 4UASA 3T5KA 4PL1A 1H3DA 5J2IA 3LF0A 4BHQA 1ZM9A 3QUTA 4H0XB 5FROA 3LWLA 4IQTA 1VLBA 2HHWA 1WC3A 4C7ZA 1KAXA 2PFDA 1NGIA 1BIUA 4DR6F 2BUNA 2L08A 2GMHA 1UEKA 4IFVB 3CCQN 4FJJA 4ED8A 2ZH6A 3O1WA 2EEYA 4WQ4A 2JRSA 3WIVA 5HLFA 4JI8K 2LDIA 1X2IA 2VWJA 1QSLA 4CO1A 2FVRA 3QT7A 4HTJA 1YGYA 4KV8A 1U47A 4ZOSA 2BDPA 3H7HB 1YAGA 1KQGB 1EETB 3N6MA 4OJ6A 4LZDA 2E1PA 1U04A 4PYAA 4WCEQ 4FNHA 4CGZA 3PJWA 1EARA 1VLOA 2B9XA 2HK3A 4RQ4A 4KBIA 1HR0F 3H8JA 1LQ9A 1HEKA 2QYGA 3RWUA 3QNOA 4AHUA 1Z1ZA 1NGBA 4WP8A 3SUQA 4M3YA 4WFAL 2DITA 1KD1O 1VQ7N 2PMZD 4CF5A 1X5OA 2JXJA 2XS2A 3JAMU 3AVJA 5BYSA 3ZXWA 2A3ZA 5FPDA 2DEIA 3DGVA 3SIPB 3GSIA 3C6UA 4RW6A 1NKBA 3NCPA 5E41A 1U6ZA 4NASA 1NCLA 4WFBL 4B9LA 4O3MA 4MQ3A 1FRXA 2G4BA 2MKSA 2DPIA 3W66A 5DG7A 4AQYJ 3IBCB 1F6TA 2ZH7A 4NLKA 2DL0A 4IKFA 1KDNA 1HL6A 2PGCA 1SQGA 2PYJA 2YPYA 3R5BA 2HQIA 3PNCA 2A6MA 4P7TA 3UCUP 3KJFB 2CWXA 2BJ9A 2P51A 4B3OA 1WF0A 3OYAA 1U4BA 4ALZA 2ZG6A 3TAMB 3MPWA 1HRHA 1FDNA 2QB0A 3HZGA 1DTTB 3NRZA 3PVXA 4DZDA 5AQJA 1ZQDA 4JV5F 5ETLA 3VAGA 2P9GA 4ATNA 5D3GB 3W2WB 3VERA 3SZ2A 3PEHA 2KHCA 3HZEA 2BDUA 1VDVA 2E5LF 2WW8A 5ETSA 5IC4B 5SUHA 3GFZA 4LRFA 1D8ZA 3ENQA 2APOA 3UDCA 2CH5A 4DL2A 1VQMS 2HZVA 3R7SB 4QWCA 4I2CA 5KFOA 1R0AB 1YZ6A 2P66A 4Y0FA 3KWIA 1LKZA 2IYIA 4LRAA 3KLGB 5CZ2A 2IVFB 2NRXA 4HACB 2ROPA 1OIAA 2K7JA 3SMSA 3L2UA 2LQBA 4PKGA 5KG4A 1MG7A 3OS2A 3BGFA 5ETTA 4GRSA 5FD1A 4I2PA 4QQBA 3OJSA 2DH7A 4JYAJ 4R65A 4QWEA 3C6UB 4RW6B 5CH7B 1QUVA 3I5CA 5GIPA 2MJUA 2R18A 2P9UA 5J2QA 3H46O 1ZQZA 1UMJA 3W1YC 1RGIA 4RU9A 5EWFA 1LWFB 2R8GA 5AR0A 4DHYA 5KFSA 3AD7C 1IBKK 1NWKA 3TOQA 4M3RA 4OJ1A 3D6JA 3OXLA 2ILYA 4NE9C 3QUCA 1U24A 3Q24A 1HYVA 2C3OA 4RWWA 2G08A 4Z4CA 2G0CA 4FJMA 4JI5J 2HFSA 2BCQA 3KWMA 2IJNA 5AK4A 1ZM3A 4CNYA 4Q2LA 1PAEX 3UD5A 4JB3A 4Z6CA 4C8LA 2A40A 2WF6A 3TW0A 1GT8A 3O9TA 3LM9A 1YJNN 4MKYA 5F1XA 2YTCA 4CZGA 4I9QA 4H5NA 2H3VA 2GMJA 2E3TA 1ZOTA 4RKUC 3HKWA 5F3XB 3M8PB 2O3DA 4Y2QA 4LF9K 3MM5B 1IBMJ 4CFBA 5AE2A 1SKRA 3VQPA 2I2YA 3O5BA 3N7PD 3MAHA 4P0QB 4F4ZA 2EFGA 1L7MA 1KKXA 4BRFA 2V50A 3ZEUB 1BWVA 4KH5A 4ILLA 3HDSA 2KSOA 3H6EA 3MR7A 4GXIA 2DY9A 4BVOA 1ZQAA 4K0KK 3CD6S 3M6WA 3G82B 2R7WA 3MF5A 1NO8A 3DGPB 3UPQA 3H20A 1UAWA 4FYDA 1S12A 4H5RA 2VA3A 3M6UA 5I42A 4M47A 2G5IB 4MEYA 5E79U 1CPZA 4U9RA 5A8RA 3KHLA 5HRNA 5IXUA 1Q46A 4KI6A 4YHHK 1SCJB 3VQQA 4JKGA 4NLUA 1VQ6S 2NXJA 1CC8A 5AQXA 3PYDA 4UB8U 4L8RB 4IQWA 1C0MA 4DX5A 4TY9A 4AXJA 3VF2A 4DSEA 3IV6A 4CZLA 1IQZA 1WOPA 4UBBA 3DMJA 4CO0A 1VOMA 4KTWA 1TP7A 4NCGB 2HHTA 4QWAA 5D4BA 3JPNA 3TA1A 3WUHA 4NWIA 4DV5J 1KNZA 4M9GA 3THWA 2C3PA 1N88A 3KNGA 4DHVA 3PW2A 4QOZB 4YS2A 2P2CB 3J7AP 2EFPA 2OPRA 1RT4A 5BPLA 1Y5LB 2LA6A 1ZQYA 3C16B 4B3MK 3V1RA 4CIGA 2ATLA 1DQ9A 3C29A 3D2FB 4JI0F 1RPLA 4DEZA 1U1OA 1RXVA 2CGKA 2KM8B 4I7FB 2AP6A 3CJ2A 3UE5A 3HX0A 3DI6A 3TACB 4CJQA 2Y9UA 3DWLA 1ZQRA 1MW7A 3DRSA 4NJ8A 1XNSA 1N63A 2ZE2B 4NWBA 3MMVA 4YMOA 2E88A 3EUB2 1QTNB 3JTOA 3KHGA 2EK1A 3BGUA 4CWBA 2AJ1A 2K4HA 1UVLA 1XWLA 1IR1A 1F0XA 4F26A 1NDCA 3DRSB 2PFUA 1ZH5A 2GZOA 2OIHA 3TZWA 5AQQA 3A4TA 3BKFA 1SAZA 2RHSB 3VCBA 3C2LA 4A8YA 2ZH3A 4X62K 3BDPA 1NJIO 4KTZA 1OPIA 3L4PA 4DOBA 4TU7A 3FSXA 1RBSA 4KX3A 1OWXA 1X66A 4JB8B 2MRLA 5AKEA 2RE1A 1NG9A 4J37A 1HX1A 2BKEA 2G9OA 4DX8H 1XU4A 4UF4A 3QWUA 3MM7A 3V9ZA 4F91B 1RM6C 7ICMA 1WSFA 3QNNA 3UN3A 1L5UA 4FBTA 2EW9A 1Q8KA 3B78A 3O6QA 5CR4A 4YR3A 2AJ2A 4KR0B 1TKTB 3ICXA 4ZJQA 2KN7A 2LYHA 4H4MB 4LBIA 4LD0A 4UB1A 4LR7A 3TP2A 3N5FA 1DBDA 3QEXA 4LREA 4P72A 5KT7A 1F3VA 1B22A 2BJDA 4DFJA 2VYPA 3TTFA 3H40A 1N5YA 2LSNA 5CAAA 2AYBA 1VQKN 4F3QA 2DIUA 2XG8A 3C16A 1WSIA 4P0PB 3AT1B 4O5KA 5L1KA 4ZA1A 3VPZA 2NXEA 3NS5A 1FKOA 4O5FA 2JNJA 3CDAA 3UKUA 1GMUA 2HF4A 3DLLQ 5EX5A 1R43A 5KG0A 5D15A 3QU5A 2CVIA 1CJVA 4WQ4C 4GKJK 2FSNA 2FHJA 1HBNB 2YH0A 4P2SA 4QIEA 2GQ2A 3FFIB 3HO1A 3K5NA 3DOLB 3QDKA 9ICCA 1UL3A 4ZPWR 3L2VA 4XDCA 4OGCA 3M5RA 3V1QA 3ZDAA 3KOOA 5AQHA 2MQLA 3VAMA 3OBIA 2KVIA 2AZ1A 2BANA 2KJ8A 3PG9A 3EVMA 4DR1F 1RDDA 1K8KA 2IAJA 3C6TA 2GHPA 3JTPA 1KAZA 4V19X 4EHTA 1WEYA 3QLHB 3LDNA 5J0WA 1KD1T 4FWLA 1RISA 4NYFA 3SMPA 3PTWA 4QIGA 5C7PA 2MUTA 4FCYA 1VHXA 3FZLA 5BRFA 3QINA 2V94A 2CQHA 1RWUA 3M8RA 3QIOA 2WAQF 2PZSA 8ICVA 1SH2A 3CHWA 4GKJJ 1J2NA 1B0VA 4YOWA 5T7LB 2AF6A 2M88A 3R1XA 2IHR1 4KJIA 1CJTB 1BGXT 3BH7B 1E4GT 2UXDF 2MKCA 3A8YA 3AVGA 1HR0K 2H5XA 4K4HA 4WYLA 3LGMA 4TNOA 2EG2A 4BDYA 2UXCK 2B51A 2B9YA 3ZYYX 4CJ5A 2E2NA 3LL3A 2L9WA 2IDOA 1XR5A 2ZH5A 1VMBA 4C6AA 2AV5A 5J2JA 3ISND 3DLKA 3ID8A 4CJ3A 2LKZA 3MTKA 2PA3A 1FX2A 2Z2LA 1OQ6A 2F8MA 4TLRA 3UKUB 2KQ2A 1YJ9S 2Q43A 2YB4A 4DUYF 4BRHA 3THYA 4Z7YA 5LMUF 4MK9A 1RBVA 1VQKS 1M5HA 1UWBB 1LK5A 2E1RA 3BPSP 2HIYA 3CXCR 3EKUA 3LO3A 4P2XA 3D6MB 3ET6A 1LAWA 3HHDA 4WE1A 4PGYA 2J0XA 4DOCA 2W2OP 3MI7X 3Q8MA 4WPAA 3G9CA 4PA1A 1FNMA 4C4RA 2VBWA 3S3OA 2AD9A 2XY7A 4LMZA 1KEJA 1Z25A 5BPNA 3R97A 4D3HA 1X5TA 1NGJA 2FDRA 4KLUA 4CIFA 4NYPA 1VSIA 4LSLA 1MWQA 3GJRB 2MY7A 4E89A 2MZ1A 3MXJA 4ZTFA 1SWVA 4ZMMA 2QJ3A 2HNZB 5K14A 3SUNA 1XC3A 2QSFA 4OZ0A 3NNCA 4X66K 1S57A 4BRQA 3ALYA 3RBEA 3NCIA 4O44A 3Q8UA 1KN5A 3I82A 4PCQA 4ZHRA 3ZZPA 1RWKB 3JSMA 5J0XA 2CKWA 3BO4A 1B99A 5DBAA 4B3MJ 4Q0BA 3CCEN 1RJJA 3V5RA 3M8YA 3NGIA 4QR1A 1F3FA 3QESA 2JEFA 3ILIA 4Z94A 5LJ5Y 4ECSA 1Q3VA 3S7RA 3C15B 1HNVB 2CQDA 4Q0BB 4PWUA 1GOBA 4JKDA 4M5NA 2GAGC 5KFCA 4IH6A 1O6XA 2XHCA 2BJ1A 3CJQA 3EWAA 3EZOA 4BRAA 2C3MA 2AHOB 3H59A 1PJ7A 3THYB 1R31A 2VPXB 4CH1A 3KZIU 4RW4A 1BDGA 5ALRA 2IFXA 3M9NB 2VFRA 4F3OA 1QQ5A 4DF4A 4X4VA 2LM4A 4PG5A 4P2HA 3AO2A 4IR1A 4M5MA 3ALRA 3IS9A 3BF1A 2CQBA 3IGNA 3HPOA 3AQFA 2FHOB 2P9PA 5DBBA 4O5EA 1RT6B 1JUDA 1SUQB 1RBLA 3VA3A 1Y3JA 3DRRB 5GADP 1YSJA 4CF9A 3OGUA 2KK0A 2AYMA 4MO4A 4DQPA 1XTZA 1FD8A 4O8KA 1HJRA 4OYOA 2WRMA 3NF6A 3PIPL 3F2BA 4JRQA 5HBMB 2DFFA 4CEDA 4PKDB 1BHLA 3WZ0A 3ETRA 5CYJA 3LALA 1WTFA 4ETZA 3G87A 2XYGB 3RF9A 4O4GB 3GG1A 3NVZA 3SENA 4ZVSB 3RAXA 2IM2A 3UW1A 2F7TA 3JSMB 1ROFA 2BKNA 1TAMA 1W2BM 1IJEB 3LW5C 1YJWS 4DV5F 5DM6Q 4UB5A 2FYXA 1TL1B 4GVLA 1T3VA 3SQ2A 4PJ0U 5HP1A 2A1AA 3F56A 1RCHA 2W04A 3SUPA 4ILHA 3BS5A 3CJ1A 1T03B 3TAMA 4NLDA 3OW2M 4NX9A 2ZD1B 4NCBA 4JI5K 1VBXA 2EWSA 3A5NC 4UQTA 4DV5K 3M8PA 2HHUA 1M90O 5TZVA 2KT2A 3A0BU 2Z1HA 4CVNE 1VSFA 1FVQA 3O3HA 1OYDA 1V97A 4GC6A 5L1MA 3D1OA 1VQLS 3MM8A 5HROB 2UU9K 5KFYA 1UFLA 2O8DA 2HHVA 3BR8A 4H5WA 3IBFB 2OUGA 4USVA 2GVZA 3PMLA 1T3NA 1NPKA 4Z4GA 2KU7A 4WP3A 5HJYA 2FJVA 5ALSA 1TMJA 2XI3A 4I6MB 4DDFA 4M9NA 7ICLA 1S72S 2PFOA 1FWLA 1YBAA 3WIUA 4EX7A 3MOJB 2CVEA 1GOCA 1YVNA 3WEEA 3BEGB 1TE2A 4AD6A 2F1FA 4IJAA 2ZGZA 4BR2A 1T9XA 3VTIA 2QT7A 4K0KJ 3JQJA 1X4DA 3MPDA 4ZLPA 4IOCL 1NDKA 1T4GA 2R7TA 2ZZMA 4HDHA 1YITN 4FVCA 4WF9Q 3D7EO 4K4UA 2HSEB 1U0SA 1MSWD 1U8WA 1RKJA 3O0FA 1QJHA 3QUBA 4Z4EA 2ZJPQ 2K8CB 1KOHA 3AN1A 3WXKA 3JAMO 2WB1C 3E2EA 1IBMK 4DR5K 4NM1A 4I2FA 4A48A 2PBDA 2EAPA 3J7YP 2K8GA 3H8MA 2R7SA 2Z8QA 2HHSA 1QY7A 3DV9A 2CPJA 3BQ0A 3SSQA 2PYLA 1RAIB 3U1MA 3W62A 2F3JA 2DD8S 3U9DA 1FO1A 5AM3A 4YOYA 4OL8A 1BIZA 1UJ6A 3LP2A 2E2PA 4FJ8A 1ASWA 4K4WA 4DR7F 3M8ZA 1PK3A 2G8WA 2M52A 2MLXA 1SH0A 4GV6A 1WELA 3RW7A 4IO1A 5IIKA 3CFRA 3N7RC 2FPKA 3N9UC 4X5VA 3ULEB 3SBMA 1YJRA 1VSHA 1FXLA 3HPHA 4TXSA 4JRPA 1RTHB 2ZOFA 4OLOA 3NMRA 4M45A 4C3LA 3NS6A 1EP4B 4DUZJ 5HHIA 1WC1A 5K8PA 3CF5L 4CEBA 3WHIA 4QCLA 4O4RA 2Z2ZA 3CFPA 2RS8A 3C0BA 2W41A 2YY6A 1RACB 3SCLE 2P9KB 3DCAA 1V3RA 1VQMN 1BXNA 4DTUA 4ED2A 2HRYA 4URQU 1YRXA 5ALOA 2KVQE 3L0QA 1KVBA 2JGAA 1REVA 5ALLA 1KS2A 4FP9A 4HL9A 3OL6A 3U3GA 2H1YA 5AQMA 1P1LA 4LSZB 3GR1A 4DB3A 1LW2B 3MWPA 3ISDA 2G07A 4E7HA 5AQFA 1IO2A 3RJGA 1ZD3A 4C9DA 5DQGA 3Q2SC 5GAEI 2ZXHA 4DN9A 4RX6A 5CYMB 8ICUA 2ZBRA 2PFNA 4Y2RA 1Q18A 3R3LA 2OH2A 2E44A 2E1YA 1QQ6A 1KWMA 4CM2A 1LEOA 2AJ0A 4F9OA 2VJ5A 2HOFA 3BYRA 4UOGA 3AD9C 3AJ2A 4YY3F 2K1RB 3GPAA 2J5AA 3EZWA 4Y2PA 4C4WA 5DG8A 5AZJB 3HT3A 3OVNA 3B0XA 7ICGA 1ZQGA 5HRSA 3R5CA 1WC6A 3K5MA 3GOIA 5EWEA 1A5XA 1A77A 2OPRB 4YCXA 1WUDA 3NGRA 2MSNA 3R5JB 1Q53A 2ASDA 1XNQF 2JLGA 4EI2A 4LZGA 3I0SB 3AA4A 2IRUA 1WC5A 1RLCL 2ZTEA 4AQYK 4JI4K 3GL1A 3JSRA 5D49A 3DLRA 2J6SA 1RTHA 4M9HA 3BDEA 1DK3A 8ICNA 2HURA 3OBYA 2UXDK 5LMNK 4LJMA 2HS0A 3GIRA 5AICA 5CHCB 4CLWA 3OVBA 3RGIA 1K8AO 4U7UD 3JTNA 1M6YA 5J2QB 2Y1RI 3V6JA 3E51A 3UDEA 4OX7A 3VQ8A 4YDDB 1UAXA 1J9AA 3CCTA 4R8UA 1UT8A 1LXNA 2XICA 3Q8LA 3NGKA 3P5TL 4Q44A 1T8EA 3CCQS 5J2CA 1HYSA 2CZ4A 2K06A 4UARA 4L3KA 4ZP6A 4P7VA 4DV4J 1UW9A 3OL7A 5J0UA 2DNMA 3JQKA 3NF7A 1Z1BA 3RSEA 1S22A 1YTYA 2QLTA 1RWPB 2QXLA 1W97L 5K20B 2ZDPA 4YXMA 4S0MA 4ZPAA 3D6FB 2DGOA 3X1LB 5DDOC 4O0JA 2KM8C 1HQUA 4LFCF 2HVDA 5ETOA 4V19J 1NGHA 1HWJA 4WYWA 3CULA 4DV3K 3PMNA 2O4IA 4MFCA 1REGX 1MWMA 4OX8A 5KFUA 5DZ7A 2VANA 1UETA 3L5KA 3L6QA 2I6XA 2KG5A 5B66U 2OEJA 4ZOHC 4EBCA 3QE9Y 4BS2A 2YCHA 1V5VA 2MKYA 3TAEA 3N6NA 2EC0A 3NHGA 4HTIA 1JLQB 2NYVA 3BO3A 5L38A 4J2BA 1ZBSA 2RP5A 2BM1A 9ICPA 2ROEA 5F0UA 1MC8A 4BDZA 4TSXA 1R8HA 1YF5L 2FGCA 1L8LA 5J2DA 2NRVA 4Q7AA 5AJ3J 2CJYB 3TWZA 3DM2B 4IZ9A 1Q16B 4Y1DA 5J2MA 3EVWA 3KDNA 5GVQA 2OFGX 4ICLA 4ZP8A 3R9KA 4FLTA 2QL9B 2CPFA 2C2ZB 3MXMA 3HX9A 3AA5X 3I5BA 5BRHA 3K1ZA 3BM7A 4UB4A 3AVBA 2H3FA 4A47A 3EXYA 5B0DA 3GCWP 1XERA 3UE2A 4B1UB 4K4XA 3AAWB 4Y34A 1S4FA 4DS4A 4F3TA 3RAMA 5AHXA 2NXNA 2HSZA 4YG2A 3UQSA 3SFUA 1ZBTA 4CFAA 5GAGP 3FC4A 4IDKB 1JJ2M 1HYZA 3QSIA 2IJFA 3QAUA 5KGWA 4FK2A 1H38A 1U1LA 4H4KC 3M32B 4GVBB 4N7TA 1LW0A 4KAIA 2XNRA 3L2WA 5B8HA 3S6EA 5EUHA 2Z30B 3G10A 3SLCA 4M6WB 4NLQA 3H8YA 3T19A 3ETOA 3V6DB 3DXMA 2W4PA 3UI3A 3R6GB 5IT9U 4IFEA 3QT6A 4K42A 4NLOA 3S6JA 1VJQA 4OYZA 3IRUA 2RPIA 3HKZD 5BYQA 3RBZA 1PO6A 3WXIA 4FLZA 5KT5A 2BXJA 1VISA 4KFBB 3LQVA 4EEYA 4CF0A 2AIRB 2KIVA 5ETVA 2OM6A 3FZKA 3OL9A 1LWCA 2Z1GA 4YY3J 4R63A 4XPEA 4CCHA 1OS5A 1Z6RA 1GQEA 4B3SJ 1O08A 1N36F 3SMVA 1G7CB 1LCUA 5JVHL 2H3IA 2E5LK 3IG5A 2EBGA 1ZBFA 4IH7A 2V8HA 4P4PA 3OBWA 1TK0A 4PZVA 4FXVA 1J97A 3F53A 3HP6A 2J9CA 8ICIA 1UPHA 5F0WA 3WX4A 2I9SA 5GADU 2UXCF 4BRCA 2NUUG 3MN6A 3ZTPA 3TKAA 3O4QA 1DZ5A 4DS5A 1RAFB 2CJ9A 1Q79A 2B8QA 1KQFB 1KLNA 4J9RA 4F8RA 2B4UA 8AT1B 3CPWR 4UAVA 1VRQC 2D3UA 1K9MO 3LP1B 1EXQA 3VQDA 4HH0A 3DXKA 2OAUA 2PI5A 4BDPA 4IRDA 1KSPA 4GV3A 1VIXA 4DV1K 2XEXA 1JQGA 5KFLA 5E3AA 1YJNS 3NOGA 4QOTA 5JVGL 1RLDA 3DLGB 4FKXA 3VAIA 4RPZA 2BVZA 1S79A 5AXMA 1H2UX 2ZBIA 1SVDA 3O8WA 3SJHA 3GV5B 3ZX2A 1SKWA 1VI7A 3EY1A 4FBUA 2YJFA 4CO2A 1XS9D 3BGOP 4LH5A 2AGQA 4K7QA 8ICQA 4MIWA 3FZFA 3BN4A 4IKAA 3IGVA 4RQ6A 4DPYA 3N79A 4CYUB 4J9VA 3IMQJ 2CZ9A 1ECWA 3T1HK 2BEFA 1HUOA 2R7VA 1T05B 4LFBJ 2W9CA 1SZ2A 5LL6d 1S6QA 1QQNA 4LF6K 4DKWA 1YITS 4FPBA 1PC4A 4KLFA 4F5PA 4DV2J 1HBNA 2ZF5O 3E3XA 4JKBA 3GJTB 3RRKA 2RUSA 1RYSA 4FLXA 2FJEB 2HVIA 5KOWA 4HI2A 3HVAA 3CC7N 2JLFA 2W9BA 1YI2N 4Z0UA 3MMCB 2AX1A 3R2CJ 2HOQA 3IDWA 3ZDDA 4M94A 2V9KA 3V72A 3OYDA 5F8HA 2DXFA 4EWTA 4I6YA 4Q5VA 3VVUA 4DPOA 5AK5A 3IWLA 1QH9A 4FWRA 3LWMA 3NXZA 3D0IE 4FYYB 2DCLA 4X4QA 3V9UA 1CJKB 4CJPA 1SUQA 4EZ6A 1M1GA 1IBKF 3RUBL 4KLMA 3PIOL 2ZXIA 2Q6CA 3H5XA 1JROA 4FYVB 4MKVA 1N48A 1BG3A 3HVWA 2LLZA 3TYTA 4YN4A 4YEAA 1S6PA 3QGHA 3AVKA 2UVUA 5J2KA 3GFYA 3A0HU 1RT2A 4DQ8A 1L7OA 4KGXB 1CULA 4CEZA 4FM2A 4EYHB 1HQ2A 3C5GA 3E01A 3AO4A 5KPZA 4FVMA 4C11A 1QQCA 3QFUA 2M8DB 2W25A 2DR9A 4CTAA 1FEZA 4XA5A 5CEHA 2HHHF 4CGJA 2YNIA 1ZQXA 2KJ5A 2CXYA 1Z3EB 3B6PA 2D0CA 5IIJA 1WJ9A 3K17A 3SYZA 1I94F 4B3OB 3H5YA 2V68A 3DLBA 1ZD5A 2QB1A 4ZVFA 2RDDA 1L3VA 3C6HA 2YNIB 3R1LA 3R6LB 4WQ5A 4DPUA 4CLPA 3CJ8A 2NREA 3FZHA 3RB3A 2BM0A 5KFTA 2F44A 1YUWA 4E1NA 2GWJA 5EHHA 1VDHA 3ATVA 5C24B 2QKQA 5DB6A 5ALMA 4IJNA 3H5SA 3PFOA 4GKKJ 2ERRA 2YMQA 5IIMA 1NJIT 1B7FA 4CEAA 2QWRA 2BQRA 4M04A 1ZAWA 3FDSA 5E26A 5J0YA 1R27B 3ZEUA 1D0EA 1B4SA 1M5VC 5GTHU 4JI4F 2X51A 1N32F 4HKQA 3UXOA 1CZBA 2YB1A 4B6JA 2XMKA 2QWOA 2J6UA 3J80U 4DPWA 1N6QB 2G13A 1YLXA 3ULHA 1HBMB 3MCMA 5CD4A 1QVGM 2P35A 3FVYA 2NO4A 3ZDEA 3PYGA 2D3DA 2V51B 3SBGA 5A8KB 1BPZA 2HBYB 2D1KA 4X4UA 3QERA 1Z1VA 5E3PA 3WEEB 2RRDA 8ICCA 4A2AA 2ZWOA 2I38A 2GO9A 4DFMA 2OTLN 4KGZB 2FBVA 4MH8A 4CTAB 5J0RA 1V9OA 3TEHB 1YWXA 1C1BA 2IIHA 5AM5A 5DDMA 1N0VC 4TU8A 1NMDA 2YMLA 3MMBA 2CNKB 5KFRA 2I1QA 1Q81T 3J81O 1FRKA 4NLYA 4WFNL 4CJKA 2HBRB 2JZ5A 4QAGA 3VF4A 4B3RK 1NZBA 3WK5A 1QCKA 2AQ4A 2B9EA 4YFUA 1V85A 5AKXA 4ZVRB 2UUBK 4HYKA 1NGGA 2V4JA 4MKAA 1YHQS 3LDLA 1WOQA 3R5GA 2FF3B 3MX2A 4ERDA 3J7YI 3OLAA 4IOCQ 4PXCA 4UB3A 1WOOA 5FLXO 2GMLA 1MQ2A 2LCWA 2ZKUA 1T9YA 3SEIA 3OPKA 1M90T 1Q7YT 4QW9A 2Z1IA 3UB5A 3THXA 2K7KA 5C2GA 4ZCIA 2DO0A 3NFAA 1JXEA 1TUYA 3NRBA 2MAXA 3CW2C 5M2RA 2PXIA 4G9ZA 2PI4A 4B3TF 2EANA 3VGVA 3K57A 1FWPA 1VLYA 1PK1B 5D4PA 1XMOJ 4BRKA 3L3FX 3I1YA 2Y9TA 1CXUA 3CMAN 3EJMA 2CJQA 2ZJQQ 3MR3A 4JHDB 3FYHA 1NK7A 3QEVA 2GEMA 2GJ2A 3CQYA 5DM6L 2LXIA 3VESA 3JPPA 2R2UA 5CABA 2KZZA 3D0PA 4LF7K 5L1JA 4WJBA 1XHZA 4IQXA 2VKRA 1REVB 4F50A 4H54A 1EHWA 5KL1B 2YX7A 4J2DA 1N60A 5F8GA 2B3TB 5ITHA 1RDFA 2VGNA 2OTLS 5G5HA 2MSSA 2B6GA 2YWHA 4NCGA 1U2RA 3CF5Q 3FJ2A 2VQFK 1SV4A 3VQAA 1Q3UA 4RTFD 4PG4A 4FJNA 3DLLL 1WSVA 4RG8A 2P6UA 2EDUA 4AH9A 3UKRB 4OZ5A 3V9SA 1WG1A 4IG3B 2E1FA 4WWSA 3T1HJ 1PJ5A 5DZ6A 1RT4B 3MEDA 4ZPDA 1HD1A 2VB6A 2GC8A 3MX5A 4MAKA 3TVKA 3A8EA 3H0RB 5IWAJ 4KLOA 3QJJA 3E66A 3JS9A 1IR0A 1WKJA 1YK9A 2FMPA 3MEEA 4KLIA 2VH7A 3BY5A 4EUVA 1TFYA 2EAOA 2R42A 3KLVA 1JLCB 1BUPA 4GXKA 2CIMA 2DGWA 4BC7A 9ATCB 2JWNA 2P9IA 3RJEA 2AA4A 2CPHA 4M3WA 1T6DA 3NEKA 2DFEA 4C0OC 2JEIA 2E6LA 3KHYA 9ICFA 3EICA 4XTTA 1BNPA 3F5TA 5GIOA 1NB2A 2YWFA 2RHKA 1RUSA 2OEKA 2HHXA 5KRTA 4U8YA 1XUPO 4DV1F 4NI2A 3EO3A 3SV3A 2AT1B 4PHAA 3EPGA 3NE6A 2G8FA 2FPHX 2YPZA 2DQNB 1W26A 2XB2D 5E3CA 3D67A 3NRWA 1IJFB 3RSEB 1CVJA 2Z0GA 3L7UA 1FKPB 1OJ4A 4DV7F 4KMOB 1E4FT 2VDHA 1X5PA 1NPPA 4M6WA 3OXFA 4DR4F 3VAFA 2VBYA 2YKOA 3DXMB 1OH5A 2BOPA 1T9WA 4DV0J 1Y64A 2DNLA 2WONA 3RZAA 3AAPA 3WNEA 1N33F 3LAKA 3BS9A 2NR0A 3MN7A 5HN0A 4FZYA 9ICVA 5AZIB 1FJGK 1DJ0A 3I31A 2ALYB 2D0AA 1IBMF 4P0PA 4KFBA 2DNKA 3JYTA 4CT9A 4OZ2A 4CE9A 4B9MA 1GXUA 2UZAA 4KN4A 3W9HA 1N5VA 2JZBB 2KRBA 2AJFE 2JH7A 2M8HA 4FS2A 3WK9A 1MWKA 2JWKA 1FRIA 4DR3F 2KXFA 4CEFA 5KG5A 4NV0A 1Y5IB 3HHLB 1IKXB 2NSBA 1YI2S 1JLFB 2IOFK 1TQLA 3FUYA 1HJPA 4OI6A 1ASVA 3KD3A 3QQCD 2R8IA 4DR7J 1SJ1A 2F76X 1NHUA 1JCGA 1WHWA 2POKA 5C12A 4CHOA 4Q43A 4CLSA 1L7PA 4KLDA 1SIJA 2D0PA 4NM2A 1Z19A 1XMQJ 3GFXA 4BC5A 4I68A 5HVGA 2XI9A 1CZ9A 2W4CA 3QLHA 1O03A 1I39A 2Y3YA 5BN8A 4O0NA 4CBWA 4J9SA 1IN0A 1TL5A 2H5JB 3ZD8A 2XMJA 4FJ9A 3TSUA 2V63A 4JI7J 5F3TA 4U67L 3MM6A 2KDOA 3OYCA 2MQOA 1TL3A 4UY8O 5FPEA 3OHBA 2ES6A 1WUUA 4DR2F 3AJDA 2Q1LA 1OKJA 1Q86O 3ZT4A 4KHMA 4NMXA 4MDAA 3AVIA 2DGVA 1TL3B 2QA4G 4RQ7A 4IXCA 2WTUA 1WAFA 4JI1J 2X78A 4UW9A 2NUBA 3HVRA 2P9LA 4CFCA 2R7QA 4MFBB 3OHAA 5K8NA 2OZSA 3C94A 2BH1A 3ZDBA 2HBKA 2P5VA 5TKWA 4MLEA 2P9LB 4B1YB 4XH1A 1GEHA 2W4DA 3K5OA 4GO7X 1V4SA 1CUKA 1R8CA 4KYZA 4FJHA 4ZITA 2DGUA 1NM1A 4ED6A 5AQWA 3VQSA 4LIRA 3KXDA 1KLMB 1NNLA 4LQ3A 2HFZA 4R64A 3HBTA 2N82B 7ICEA 1HKCA 2W40A 2ZOGA 2VASA 4FNIA 2O67A 2ASOA 4RBTA 5LL6Z 1DQ8A 4W90B 3J7AN 4DLEA 1X9JA 2G5HB 4ECTA 1RFQA 3GDXA 3VAHA 2OMOA 5EE3A 3C5FA 1HBOA 2X3GA 4LF8J 3DDNA 4MYTA 2L3MA 2V8DA 1RT3B 2FBXA 3IAM9 2UUCJ 1SV0A 5DRKA 3IRWP 1BVSA 3QU2A 5GAEP 5LT5A 3PIPQ 2YBVA 4F3MA 4M3UA 5JVHQ 5L1IA 4BC9A 4GC7A 4OPAA 3BBFA 2RQ4A 1GLJO 4M42A 4X65K 9ICNA 5KFMA 5AQSA 2Z4PA 3VGMA 5IV3A 2GJIA 3RMDA 4C1NI 5IT0A 5HMYA 2DRBA 3N0VA 4EP4A 2RLTA 1RA7A 2ASYA 1TV6B 5GAHP 4B17A 4RUHA 2UXBJ 3DXKB 1WHXA 4BJQA 3IBPA 4A46A 2VC0A 1TUWA 3RR7A 1SKUB 1UCVA 4C8YA 4YORA 4OV6A 3IN5A 7ICVA 4AM7A 5TKYA 1R89A 3CJAA 5IWAF 2I8EA 3BYPA 3R7NB 5GMEA 1SV0C 4A61A 4IL6U 1Z2LA 3IFEA 1HKGA 8ICEA 3WBZA 2HYIB 5ALQA 3DOMB 3CC2N 2E20A 1HI8A 1UEVA 1RWXB 2XGPA 3WKCA 2XY5A 3QICA 4CF1A 1YJ9N 4PQUB 8ICMA 5ALVA 4AHRA 2MEWA 3FBCA 4HTUA 1DTQA 3RVCA 5J29A 4M5DA 1D5AA 3T6BA 3MPVA 1DXSA 2YKQA 5CQGA 5L9NA 1BO5O 4DV2F 4F4KA 3VF6A 1F5SA 4BWJA 1WWHA 4M5DB 4LVOP 3W2VA 2YNFA 2RH3A 1FRJA 3I33A 1HW8A 1RB0A 2CNLB 4PPZA 5AQLA 4PQAA 3P31A 3MN5A 2W3SA 5ALNA 1WSHA 2VFSA 2RU3A 2BE2B 1S48A 2VC1A 2IBKA 2LBOA 2LU1A 3TVZA 3KLHA 1DEJA 1RTIA 4B3RF 5KT6A 4RLEA 2G06A 1S3XA 4CZMA 4OPKA 1DK2A 2U2FA 1A6LA 5KFFA 2C2OB 2BJ3A 4A8OA 4O3PA 3KLGA 2KP7A 4R5PA 3W9JA 3WDOA 3EWGA 2XZTB 2VHGA 5C0YA 2KG1A 5DS7A 1M1KT 2YWKA 3I9ZA 1NH8A 1L3UA 4QZVB 4R0EA 3CDEA 4K8RA 4LSNA 4Y2XA 1EIYB 3I8DA 4NL9A 4DR5F 5AI9A 3L95X 4JN4A 3BUZB 4BG8A 2CYYA 5J2AA 1V6HA 2HB5A 4P2MA 2BE7D 4DQQA 2EZZA 4LSNB 3PSTA 1MU2B 4HCCA 4ER8A 4JI8F 3VF0B 3GSDA 3MMBB 2A41A 4E3SA 3GYNA 2EVZA 2D0OA 3RG6A 3VQBA 4WIIA 3W3DA 2VD3A 1GLDG 3CWJA 4JV2A 4GXJA 4EO8A 4DQRA 4C97A 3I8BA 3CCSS 2VFVA 4QU6A 2Q31A 1M1HA 2AEMA 3ULDA 3U6FA 3UWTA 3MUMP 3CD7A 3I87A 1HIYA 3RMAA 4YFKA 1VHFA 3BSCA 3LP2B 5EWGA 2C42A 8ICFA 1F5AA 1TELA 2QV6A 2QWNA 2R7UA 4EFAC 4Y1CA 1HLUA 4CD3A 1XNRF 2ZTCA 3GIMA 1TKDA 2VCPA 4DR5J 3OY9A 1Z00A 1DY3A 2F5GA 1YBTA 3AHPA 5B0GA 3I4PA 4BUGA 4KLLA 2BPFA 5B0FA 3OS1A 5LSLA 4YVZA 2RN2A 2MQ8A 5DLGA 3JS6A 1CEZA 4Y2VA 3AGRA 4GW6A 2J9DA 4OHYA 3OFEA 1OW5A 1J5EK 5CCMA 8ICAA 2O8CA 3JSBA 4P0QA 1X4CA 3TADA 3LP1A 2AJQA 2G8VA 1X9MA 1RTJA 1ZQBA 4DR1K 3LAMA 3KZXA 1RHQB 2LA4A 1FIQA 5JMVA 2HQCA 3ZZRA 1W0HA 4J5OA 4DX6A 3CFOA 3WK8A 4KHPJ 4MF2A 2N4DA 4L3NA 5HR7A 3CVKA 1X8DA 4UQGA 2Z58B 2HLTA 2XMMA 3VVTA 1VQNN 1M5PC 2O8EB 2ZNYA 4X2BA 4ELTA 2N7CA 2IC3B 2W8KA 1AROP 5FJ4A 1Z4OA 8ICJA 2G8KA 3TUZC 5A6PA 1SC1B 5CYMA 3ZTQA 3DRYA 4OZ3A 1ZQJA 1SJ4P 4Q8EA 2FGOA 1FFSB 4YDXA 2JH1A 4DSJA 4DFKA 1GTEA 1A76A 4QBUA 3OPXA 4OHZA 4DMZA 3T69A 2HQFA 1NDLA 1K9MT 3OR1B 2WZ1A 2GELA 4N56A 1OH6A 1RHMB 1D9AA 1A7GE 5G5GA 1WHVA 1N5YB 4BRMA 3LP3A 3KG1A 4DG1A 3ASMA 1C6VA 3PEJA 1Q8BA 1K0TA 4ZVHA 1ATSA 1WG4A 4RR5A 2X74A 4F92B 4PGQA 2UUAK 1VSMA 1IV8A 2B6AB 4OZLA 1TGOA 5DGBA 1S0MA 1X5SA 3D1HA 3L3CA 3HSGA 3T6JA 1RWOB 1BE4A 4I56A 4CHNA 4CF8A 4RQ0A 5HMWA 4QIFA 4LY7A 3BQ7A 1VHIA 3OFGA 5A8WB 3VEZA 5DGAA 5L39A 3TAFA 3GMGA 7ICSA 3MCPA 4AFFA 3OXGA 3KVGA 1N2XA 4PHPA 1CULB 3D0HE 1U1RA 1JL2A 2A3VA 3UXNA 4GMKA 2WVBA 7ICPA 2P1JA 3M1FA 3LDOA 1Z4UA 4FO6A 2R7RA 3OYMA 2HF3A 3HHLC 3I76A 2B4OA 3M2UB 4V19S 1RT7A 2PA8D 2MKKA 4QYZK 1RDUA 3NAIA 3HJVA 3VTHA 3F0NA 3H25A 3NY0A 2KV2A 1XO1A 3F9MA 2IJRA 1U02A 3HSDA 2O8FB 3GG4A 4P74A 1Y5NB 2BQUA 3GCXP 3E9OA 4WCEL 2C2KB 3G0ZA 5JMNA 2LDYA 2QL7B 4J9PA 4OHVA 1RQ0A 1BA0A 3UO0A 2D3OR 4TVAB 4BWMA 2QI2A 3NAHA 2A19A 1S6OA 1TL4A 3A12A 1BISA 4DF8A 5KFDA 2MLYA 3TJ9A 1WG8A 2GW8A 2UXBF 5CY4A 2F1JA 1T95A 2BW2A 1ZXIA 3GU3A 2GJFA 4ISEA 2VG5A 3EEQA 1FCAA 4I2JA 4OZNA 3PYEA 3IA0A 2ODGA 1UA1A 2P5GA 3JPQA 2F8KA 2RS2A 4CHYA 4I67A 1TUUA 5A2QU 2QEXN 3NDKA 2DYAA 2F3NA 4W4MA 1VQ4N 4WTOB 2EX3A 2KXNB 4NXNF 5IT4A 3HVTA 3X3UA 2P9SB 3DOKB 3N01A 2CQ1A 5E2QA 2A6OA 1T0TV 1Y11A 1KFDA 3NASA 1NK0A 2U1AA 4X66J 1NOMA 4X4RA 1X31C 5AI4A 2R2TA 5A8RB 2CPZA 2WSEC 4X65F 3FZMA 2EPIA 2ZWPA 1NBWA 4GO5X 3BP8A 2BZFA 3ATUA 2HNZA 4L73A 4E7JA 4FO0A 3W8PA 1IXKA 1S4EA 4MT1A 3G6YA 1LW0B 3W0LA 4TURA 1Y88A 1HA1A 1PSDA 3VQEA 1OH8A 3M1VB 3J7Z5 2RMLA 2FHJD 1SJQA 2HRTA 2GAHC 3GZFA 3DJCA 5J2HA 1KQSR 3T1YJ 1HQUB 3VEOA 1KVAA 3THWB 1WACA 4NZ0A 2JC0A 4Y2IA 4JD2B 2YKAA 3T5JA 1HHTP 3M9OB 1QQMA 5HR6A 4PHDA 2UV8A 5KFNA 3BSAA 1UPPA 2PMZF 2PDAA 1X3NA 4CJWA 5AJ3F 5E3QA 1NJYA 2MQMA 3V4MA 3MUVP 3V9XA 4M3TA 2HBMA 4PL8A 3NWGA 3NOCA 1EWQA 1IKYB 2NZTA 1FESA 2QL5B 3UVJB 4Y2UA 4OYXA 1ZRNA 3GR0A 1WHYA 1BU6O 4PXDA 1H2VZ 2UXCJ 4KHNA 3LPUA 3N4PA 4I1TA 5HL7Q 3U1NA 3U3YA 1MA9B 4QZAA 3OLBA 1HR0J 5T14A 1FDBA 5AM4A 4C2MA 4P10A 4A8WA 2RSQA 2ZJQL 4OI3A 3EL2A 4X62F 2QLXA 1L3SA 2HFNA 1NXIA 3H08A 1IWGA 1F5BA 2DK2A 4EMDA 4BGDA 2LPEA 3DKDA 4BRPA 4ZKAA 2BX6A 1UVNA 1I51B 2HIQA 1HUXA 3VENA 4F36A 1YT3A 1HNXJ 1WCLA 2QFJA 4E1JA 3NH2A 3C6TB 1AUDA 3GB0A 2ITGA 4FWNA 4OYBA 2Q0ZX 1TYQB 3I6PA 3HRDD 4BRLA 1YX2A 1WC4A 4ZCKA 1QE1A 3K58A 4B1ZA 5RUBA 1U0HA 3CCWA 2HS4A 1Q82T 4RPYA 5AI8A 5BN9A 3M2RB 1A5VA 2OCEA 4TYAA 2D9PA 2SXLA 4HUEA 4NY8A 2GGPB 3CJ3A 3AVNA 2R2SA 2ZNZA 4AYBC 2HNYA 4KAZA 2VBZA 5IOLA 1HIWA 4FZMA 3PHTA 3NH0A 4I69A 3PY8A 1B0PA 3TSPA 4FXDA 4NPOA 5J1NA 4E1MA 8ICBA 2W9CB 1ZQPA 4I6AA 4GKJF 2BPCA 3UFCX 3N5BA 4O9MA 1VBYA 3FNNA 4DR3J 2YKPA 4CF4A 3FE1A 2KVCA 3UDLA 3OA9A 1UT5A 5JICA 2PN6A 2F9DA 4DUYJ 3O9QA 1HKAA 1U6BA 2EK6A 3NWRA 1UWBA 4KB1A 4AHSA 5A0YA 3HSCA 1SI9A 3JPTA 5HNKA 2DY1A 5BPCA 3M6ZA 2V9WA 3PLAA 4YOXA 1TAQA 4PABA 2A2DA 3NF8A 2DWQA 2M70A 4UUXA 2VIHA 1CZAN 4XH4A 2E1EA 4RQNA 5DB7A 4M95A 4NA2A 1LB2B 2YKNB 1RXWA 1GH8A 1FI4A 2MZTA 3M6KA 3M6GA 3V81B 2DJWA 4H4OA 3FBBA 5CA7A 3Q0AA 1NU0A 7ICTA 3MGJA 2HHQA 2GS8A 3LGHA 2CJAA 2MZQA 4X62J 1PVRA 4Y2JA 3CM5A 4CZCA 1P27B 2Q79A 1WD6A 1RBAA 1TKZA 1UA0A 1RHKB 2ZJ5A 3W3SA 1QUPA 4AILC 2XULA 3CCVN 2K60A 4C48A 5AQOA 2PMZC 1HNXF 3US5A 1N0UA 3E01B 4O44B 1PILA 4ZLLA 1IG8A 2R7YA 3G96A 2GGPA 1N8RO 4A8MP 4JI3K 3ZETB 4LBHA 3W64A 2DPJA 1SV5B 1HWKA 2JHEA 3DDIA 3DLEB 4TYBA 1N56A 3NVWA 4XH5A 1SWWA 3MEGB 3A8KA 1YBUA 1V3SA 3C2KA 4Y2CA 1Y0HA 3IWNC 2OKQA 3V6KA 4KLQA 1GLBG 3BB5A 2DKOB 2PSZA 1HNWF 2ZFHA 2YNGB 1U25A 1OMSA 3RH4A 2HG4A 3D4JA 2H5IB 3TUIC 3AODA 2NPIA 2MB0B 3MWTA 2XO7A 2FZCB 1H72C 1S6QB 1ZOLA 3Q86A 3BKUA 4CJRA 4Y2YA 4AP9A 4HUGA 2NRWA 4OGEA 3V4IA 4DTNA 2E1MC 4H03B 5JJBA 1Z05A 1UPMB 1WSRA 4FKYA 4OI0A 3OSNA 3Q8RB 2BCUA 1HNWK 4JV0A 3PRBA 2MKIA 4BVPA 2C2MB 1ZM2A 4MFAA 2VQEF 2CPDA 2RKIA 3MGHA 2QA2A 1O0PA 4KC5A 1JL1A 1XMBA 5JRTA 3JQMA 4F7VA 4UAZA 1R0BG 1M5OC 4ED4A 4F4YA 5J0TA 1RT6A 2D69A 3ZNUA 4X66F 2GV9A 3RMBA 2NXCA 3KMSA 3F41A 4KHUA 4KBOA 2PMHA 1C0FA 3RMCA 1XEZA 5E3RA 1S1UA 4FF3A 2NRTA 3UM9A 3AAQA 3P45B 4PY5A 3SSSA 3H90A 3CQ8A 1KTQA 5AKJA 2OZMA 2K89A 5AKYA 2D0BA 1WKKA 3CYMA 1RU2A 4Y65A 1T9VA 1J6ZA 2DEJA 1ZQVA 2K4PA 2C22A 1JLAA 3O4WA 1G4CA 4DWIA 1N62A 2OD4A 2VDIA 2DY4A 3SSRA 5G4DA 4USUA 4EELA 3AXMA 1GMWA 2YX4A