2XO7A

Crystal structure of a da:o-allylhydroxylamine-dc basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Chemical Discrimination between Dc and 5Medc Via Their Hydroxylamine Adducts
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 195
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xo7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xo7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xo7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xo7A01
3NHGA 4DOBA 4JK1A 3BQ2A 3GIIA 3DLEA 4QAGA 1R0AA 4RUCA 4GC7A 4FJMA 4G3IA 2KFZA 4IRDA 4DTJA 4CESA 5EOZA 1CZBA 4Z4EA 3C1ZA 4YD1A 2HB5A 4E0DA 1S5JA 2YNGA 1JLCA 3MXJA 4M47A 2MAXA 5KFMA 1Z00B 3V9ZA 4PY5A 2XCAA 2I9GA 2DFEA 4O55A 1S1WA 2AGOA 3WNFA 4Q8EA 2Z1GA 3ETLA 3QEWA 2IGIA 4H4MA 5L1LA 5KRTA 4FJKA 1CXUA 5KFCA 5L1KA 4DL3A 5KI6A 4IG3A 2HVHA 5DDYA 3V6KA 2P6RA 3M8RA 2ZE2A 1JX4A 4YFUA 3KK3A 3KLGA 5KT3A 4AHVA 3C2LA 3H8SA 1TK8A 1ZQRA 4I2EA 1S1UA 2G8WA 3B6PA 4Z4GA 5J0YA 1S9FA 2NRVA 3PW4A 3RRGA 1KVCA 4CK3A 5J2HA 1W9HA 5DMRA 3T5HA 4E7KA 2UVUA 4CIFA 4E7LA 5DLFA 1SKRA 4FW1A 4EZ6A 4O9MA 4M42A 1JIHA 5JS1A 4CJEA 1A77A 2G8UA 3V81A 3UQ0A 2B4JA 3RJIA 1X2IA 2NRWA 1ZQGA 4O5KA 3QEIA 4JV0A 3V9UA 3ZT3A 3TAEA 3HT3A 1ZQEA 3HPGA 3TR8A 5KFJA 3ZT2A 5FRMA 4ED8A 5CR0A 5DQIA 2NRZA 4KLMA 1F21A 4YVZA 3TWHA 4RQ1A 2NRXA 2FC0A 3K58A 3H7IA 4HUEA 4F5RA 4F92B 4HYKA 1UWBA 3OYBA 4K4HA 1HQEA 4RPZA 4KN7A 3OYKA 8ICKA 2VA3A 4MF8A 1EX4A 1C1BA 2ASDA 3M9MB 1Y88A 1ZQDA 4C8KA 4RQ2A 9ICAA 5E41A 1HMVA 5KT4A 3QO9A 4CEOA 4TQRA 3V1QA 2PI4A 2A1JA 4J9PA 2W9MA 2BR0A 2G8FA 4NCAA 3V6JA 3ZD8A 3HWTA 4KLOA 7ICJA 1NK6A 1JLQA 1RYRA 3VQCA 2BPGA 4M41A 3AO4A 4OKEA 7ICVA 4KAZA 3ZSZA 4DSKA 1JXEA 3PY8A 1S77D 5BOLA 1IH7A 1RCHA 4CJKA 3GV7B 4MFFA 2W8KA 1ITGA 5J2KA 5BPCA 3SQ0A 1ZBHA 4ECVA 3GIJA 3EW9A 3GIKA 2ZTDA 1RZTA 1LAWA 1JLAA 3AO1A 2W9CB 4CF8A 4DTRA 4DSJA 3P5JA 1BCMA 4FLWA 1T05A 1HPZA 3ZSQA 4RQ8A 3PW7A 5I3UA 4M0AA 4AHTA 3LAMA 4J9RA 3AVNA 4QCLA 3VQEA 2W42A 4Q8FA 5D49A 1LV5A 9ICIA 3HO1A 3OHAA 4NCGA 2ZUDA 2ATLA 4KHYA 5DG7A 5J2EA 3PR5B 2C22A 4LZDA 2ZUBA 5KFWA 3D45A 3KLFA 4KPYA 4CGHA 3JPPA 1XHZA 3LALA 4FJ5A 4IQTA 2R8IA 4XA5A 2DFHA 4B9TA 4KLIA 3G10A 3IG1A 4YMNA 3SPZA 2R8KA 3OYFA 3S9HA 5HP1A 3OSPA 2JZBA 5KFEA 3DRPA 7ICQA 8ICJA 1BPXA 1X9MA 1RT2A 4M3UA 3N97B 3HL8A 4DL2A 1D5AA 5FROA 3AU6A 4CJPA 4KHWA 2PFOA 4KB0A 1RT6A 4CHNA 3VQDA 3JPSA 3DM2A 3IS9A 5KFVA 4HCBA 1VSHA 4KV8A 4CGGA 5HRPA 3RAQA 1X9WA 3ZDAA 4JWMA 1B9FA 4IQVA 1NOZA 3QIOA 5KFGA 4IQWA 3Q8QB 1KLMA 5FRNA 7ICSA 3BDPA 3RR7A 4E7JA 3TAGA 4C8NA 3QZ8A 5C25A 1LWEA 1UT8A 1HNVA 3SQ4A 4LH5A 3ZSXA 3HVTA 4PHAA 4PHPA 3AUOA 1JKHA 4ID5A 4Y1CA 3DLBA 1N6QA 2F8SA 1XU4A 3JYTA 3KKRA 1S97A 3ZSRA 4IR1A 5CHGA 5J2FA 4UB3A 3DMJA 1Z3EB 3FYHA 3GDXA 2IDOA 4KLQA 4YR3A 4R66A 2BHNA 4J9QA 7ICOA 4N76A 4KLLA 4J9NA 8ICEA 2IBKA 4QWEA 3LK9A 4R63A 3M9NB 1IG9A 2OWOA 2R8GA 4BE1A 3V9SA 5IIJA 5DBCA 2BKEA 2BGGA 1BI4A 3KHGA 1TL1A 1XSNA 3AO5A 3KK2A 1AROP 2ZTCA 3H4DA 3RJJA 5J0XA 5EWFA 1S0OA 5KTQA 1TV9A 1ZBUA 3V1RA 5J0UA 4DL6A 5IILA 3LWMA 4DOCA 4ID1A 4FXDA 2BE2A 5J0SA 4O5EA 5DB7A 3RH6A 2ETJA 4CGDA 3L8BA 4FZZA 4FJXA 4KLFA 3SCXA 1RTDA 7ICMA 1IKXA 3SJJA 5J0PA 3U3YA 3MXIA 2ZTEA 2MUTB 7ICKA 1S1TA 4CGJA 4YMMA 2EX3A 2PXIA 1RT4A 4DOAA 2JGUA 4ECTA 4DU1A 4IRKA 4DTXA 1RTJA 3HSTB 2BQ3A 9ICJA 1X9SA 5KG3A 1ASUA 2VG7A 1ZQMA 3KD1E 8ICMA 1LWFA 3A2FA 5SZTA 2ASLA 1YVUA 4KLTA 1MSWD 4OGCA 3NH1A 1C0TA 1HYSA 3TI0A 2VA8A 4M3ZA 1QTMA 3EWAA 3QNOA 4RG8A 2KW4A 1NJYA 4YMOA 3MABA 3KHHA 4B8CA 3ISDA 4W5RA 1KDHA 4OVLA 2HNYA 4J2DA 2QK9A 1Z00A 3H08A 3TABA 4YP3A 1I39A 2V9WA 4K4IA 4HCCA 5KFHA 3GQCA 3MAQA 2YV0X 3JPNA 2OA8A 4FZYA 1S6QA 1T8EA 4I2DA 3S3MA 4IDKA 2XY6A 4RPXA 4W5TA 4GW6A 2M9NA 3MR3A 5HBMA 5IIMA 4DEZA 4P4PA 2HHSA 2AGPA 4FJIA 2WOMA 5HP4A 3TQ1A 5DB6A 2GV9A 1XC9A 2G8HA 3KHRA 1X1PA 4O5CA 5EWEA 4CF9A 3DLGA 9ICLA 5KT7A 3MGIA 1RBRA 3IM1A 2RDJA 1VSMA 5HHHA 4CHPA 3NH0A 2RF2A 3LWLA 3GV5B 1TFRA 4EEYA 4DU4A 4RW9A 3WNHA 5KFDA 3KTQA 1KRPA 1LW2A 4KMUA 3I0SA 1S0NA 5DG8A 5KRSA 4CJVA 5KFYA 4R8UB 3ZSWA 1IM4A 5JS2A 4GXJA 2P1JA 1JXBA 3SPYA 3U3GA 4RW7A 3K5NA 4ED3A 1T3NA 2HHTA 4JWNA 3UPQA 4M9JA 4N47A 3TAFA 2FPMA 4DFPA 3RJEA 3AVKA 4W5NA 2BCVA 4ZHRA 4CGIA 3V9XA 4QWDA 2Z1HA 4CEQA 3L3UA 1A5WA 3OHBA 1KFDA 4TUPA 7ICPA 4RQ0A 4PQUA 1NJXA 1I3AA 4O0JA 4IR9A 1NK7A 3OYIA 4B9SA 4MF2A 2KTQA 1T7PA 3MEGA 1NK4A 2W8LA 4GXIA 5KG6A 2G8IA 4KLUA 4DS4A 1LB2B 4QZFA 2IMWP 3UXNA 1LWCA 4O3OA 5D4BA 1NK8A 4FLUA 4J9KA 5IIOA 1RT5A 4LY7A 3VA0A 1S6PA 4H8KA 1W0HA 3T1AA 4RUAA 3TANA 1A5XA 3QE9Y 9ICKA 1N56A 1ZQUA 4NY8A 4DQPA 5J2DA 3BJYA 5J2GA 1T4GA 5L9XA 1RYSA 2HHWA 4I2QA 8ICFA 2E6MA 1JMSA 4FLYA 4GXKA 2FLNA 3UIQA 4ED7A 1TKDA 4O4GA 3NDKA 4RNNA 1BPEA 3FFIA 3SUPA 5T7BA 1JN3A 1IO2A 2WTFA 2ISPA 3V7KA 5EWGA 4IFVA 4HUGA 2P5OA 2DPIA 3CFOA 3ULDA 3C5GA 1Z25A 4XUSA 5FDLA 4JS5A 1WSHA 2HNDA 4ECXA 3S3OA 3RTVA 4OGEA 4CHZA 1NOMA 8ICRA 5KFPA 2RPIA 2FBXA 3PUFA 4ECYA 3RRHA 4ELUA 2XGQA 3OYEA 1ZBIA 5J2CA 4E89A 2J6TA 4LVSA 5KFSA 3IHQB 4MEXA 2GWSA 2IC3A 1L3SA 7ICRA 4E7HA 3C21A 3AVBA 1Y97A 2ZD1A 2VANA 4O3QA 1JLFA 3RB4A 3HP6A 1VSJA 3V7LA 2AGQA 4NCBA 3QEPA 1NKEA 9ICGA 5J2AA 1SUQA 3OS2A 1J5OA 1TAQA 4IG0A 1EXNA 1IKYA 3KLEA 4FK4A 3SYZA 5IIKA 1J53A 4RQ3A 3RJFA 1UA0A 2HHUA 1HUZA 4RW4A 3ZDEA 4MEYA 3KD5E 4BWMA 5HHIA 9ICUA 3PMLA 4J9MA 2R7YA 4KHUA 3O3FA 3L2VA 1ZQVA 1TL3A 3C2KA 4DFJA 3V4IA 2ZJAA 4DL7A 5KG2A 5DGAA 2EHGA 4DL5A 4QZ9A 3NTUA 4EYIB 4CJ5A 4IRCA 1WCLA 1UA1A 1XSPA 2HNZA 1BHLA 2Y1JA 3OS0A 4JV1A 1G15A 4KTZA 4TURA 4Q5VA 4KHSA 2OPSA 5CYMA 1S9EA 1ZYQA 4CF1A 5HRSA 1XHXA 3DLHA 5KGXA 3V9WA 1FKOA 3JPOA 3L3VA 4KB1A 3PMNA 2AU0A 5KFIA 3AVGA 4I27A 2PI5A 4JRPA 9ICOA 5J0QA 8ICVA 2G8KA 1C1CA 4I2JA 3F73A 3CFPA 4QWBA 5DQHA 4PPXA 4KO0A 1VSIA 3VQAA 3ISBA 2JEIA 1CUKA 4Z4HA 3RMBA 3SZ2A 3OYNA 4FJ8A 1KFTA 1ZBFA 4E3SA 1S1VA 4FS1A 1WNSA 1KSPA 3N4MB 5EU7A 5J2QA 3PX0A 3SUQA 1XS9D 4F4KA 3MR2A 1XWLA 4I2FA 4KLGA 4B3OA 3PV8A 4ICLA 1CZ9A 2HW3A 4YFKA 4DLEA 3T5JA 4CEFA 3V6DA 1WLJA 4X5VA 2BQRA 5C42A 3UXPA 4YN4A 1JLBA 3CM6A 3NF8A 4FM1A 5J2NA 4UQGA 4LH4A 5HNKA 4O5BA 4ECQA 5K14A 4QZEA 4CK2A 3NAEA 2IA6A 9ICFA 4EBDA 4F2SA 5DG9A 2JEGA 2D5RA 2VWJA 3SNNA 3RR8A 1VSEA 2MUTA 3LPTA 4DO9A 5KG1A 1JLEA 3NF6A 3RMDA 5BOMA 3T5LA 2W9AA 4FJJA 4Q43A 5KG0A 4RQ7A 3V72A 4KLSA 1KEJA 7ICTA 1RT1A 5SWMA 3QZ7A 2XRIA 3MXMA 4J9OA 2JEFA 3AO2A 4UBBA 4RQ5A 3DRRA 3M8QA 1NK0A 3VQ9A 4CF0A 3HK2A 4UAZA 2G8VA 1DGSA 2XGPA 4AHSA 3D0PA 1SL1A 2VG6A 4Q0BA 4FJNA 4QWAA 2PYLA 2IS3A 1ZJNA 3ZSVA 1TKXA 4PHDA 4IFYA 3SI8A 3OYLA 2LSNA 3VQ5A 4RU9A 3SUOA 1U49A 5KFFA 1BVSA 1MC8A 4DFMA 4O3PA 3HPOA 5DGBA 1JXLA 4DSEA 3AV9A 4E1MA 1JL2A 4CFDA 2X74A 1TK0A 4CCHA 3MR5A 3ZSOA 4O44A 3RB6A 5DK5A 5F9LA 2XC9A 4UB5A 3PX4A 3VQ8A 1BQMA 5J2MA 3NGDA 4L8RB 4PWDA 4CJTA 5KFLA 7ICNA 1U48A 1RTIA 1MU2A 4LSLA 1BL3A 2YKNA 3G6VA 4FJGA 2X78A 9ICMA 2F1IA 2C2EA 5J0OA 1B22A 4FO6A 4OPKA 8ICYA 3K4GA 4BE2A 3HX0A 1S0VA 1C7YA 2B5JA 4M6WB 1K1SA 3C1YA 3MFIA 3B0XA 5DBAA 3VN5A 1VRUA 1DTQA 2B6AA 5KFUA 4OLBA 3JPRA 4ZTFA 4R8UA 3VQBA 3S3NA 4ZH4A 1BGXT 3AVMA 4PHEA 4JS4A 3AVAA 2ZJ8A 3ZCMA 3NH2A 4ED2A 5DQGA 3C2MA 2KZZA 3GFKB 3PNCA 5TZVA 3OGUA 3JSMA 3P83D 4I2PA 2PFNA 1SKWA 1H38A 3V6HA 1QE1A 7ICLA 4I28A 4F2RA 4KTWA 1CLQA 4NLKA 1ZQFA 1N5YA 3LANA 8ICNA 3LDAA 4IKFA 3UXOA 3DOLA 3DLRA 4FCYA 9ICHA 4JRQA 4UB4A 1L5UA 3MDCA 3QETA 4RW8A 3K5OA 3RJGA 4ELTA 3OS1A 3NGYA 4KITB 2BQUA 1TAUA 7ICUA 4DLGA 1S0MA 4FK2A 2ZQBA 1RBVA 3AVJA 4YCXA 4I2BA 3NF7A 2V4QA 4PGXA 3HP9A 1VSLA 2RN2A 1RT3A 4FM0A 4FLTA 4KI4A 3CM5A 4M3WA 4FJ7A 5J2JA 1D8LA 1EP4A 4KI6A 2HVIA 9ICSA 1NJWA 2QKBA 4XRHA 2XO7A 4F8RA 3QEBZ 3G6YA 5J2PA 3L2RA 4I2IA 4UB1A 2KZMA 3AVIA 3B6OA 2UVWA 1Z26A 4E1NA 1GOBA 4CHQA 4F5PA 3SUNA 4CEDA 3CG7A 4I2HA 4MQ3A 1TVAA 3DI6A 3OSNA 4F4WA 2NRTA 4CFAA 4E7IA 2DPJA 4M2YA 2D0BA 3RH5A 2FLLA 5F9NA 4FLVA 4OKJA 3ZT1A 4RPYA 3TAMA 4PGQA 1WCNA 9ICTA 3HYFA 3MFHA 4FLZA 4M3RA 4TUQA 1SL2A 5KFBA 4KLDA 4DSLA 1ZQZA 2O4IA 2I5JA 1HUOA 4I9LA 4CIEA 1VK0A 2OPPA 3OY9A 2ASJA 4CHOA 5CA7A 2HHQA 1N48A 2PY5A 4K8XA 4Q45A 4KLHA 5KFOA 4YXMA 1A76A 1MQ3A 8ICOA 9ICBA 1GOCA 3M9OB 1DLOA 1TGOA 2E4LA 3KLIA 7ICGA 7ICIA 1BCOA 4ED1A 5DB8A 4J9SA 3Q8RB 2W9BB 5J0RA 8ICQA 2IAJA 4NYFA 4ED0A 4QZDA 1TVRA 4YNQA 8ICTA 1U4BA 3AU2A 3RH4A 1ZQHA 2BDPA 4WE1A 1BPBA 4KRFA 2VA2A 4DF8A 4NYNA 1U45A 1RBSA 4FJHA 3E01A 1KFSA 1D8YA 4M3TA 4B8AB 2E6LA 3C6UA 1D9FA 1QLNA 2IOCA 1QHTA 1BPZA 3HW8A 3RB3A 2OYQA 3AA5X 5J2IA 3SQ1A 4Z4CA 2ZUCA 1NKBA 2Q3SA 1ZQYA 4FBUA 4UBCA 9ICQA 5L1IA 3K75D 1B9DA 4EP4A 7ICEA 2OZMA 1TKZA 1NJZA 4Z4FA 2B21A 1RDDA 2PFPA 4C8MA 8ICCA 2VG5A 1WSJA 3LP0A 1WAFA 4NLZA 1J9AA 8ICAA 3ALYA 4CEZA 1COOA 4ECSA 1VSFA 1KVAA 2AQ4A 3OYMA 2BCUA 4PGYA 4QWCA 1BI4B 3HVRA 3ZT0A 9ICXA 5KT5A 3ZD9A 1RDAA 4F3TA 2ZJ5A 1SZPA 4M9HA 4CFCA 1S9GA 2PFQA 1B92A 4I2AA 3SI6A 3OYAA 4G1QA 4B08A 3PVXA 2KFNA 1JLGA 4PH5A 4DWIA 1HJPA 2X6NA 5KG4A 3MECA 2YNFA 2BPCA 2PYJA 4TQSA 5KFNA 4CE9A 3OYCA 2XY8A 2NUBA 3O3HA 4I9QA 1RXVA 2WONA 4LD0A 4GVMA 4NM1A 4DQQA 4OPJA 8ICZA 1L3UA 2W9CA 3TFRA 2FBVA 2YHBA 1UT5A 2F96A 1K1QA 8ICSA 4Y1DA 3M8SA 3C6TA 8ICWA 3K5MA 4XIUA 5KT2A 4EYHB 3BGRA 3T3FA 2R8JA 1QQCA 2J6SA 1TV6A 4RW6A 3MBYA 3LP1A 4KHQA 4K4GA 4HUFA 5DKWA 3PR4A 4W5QA 3VQPA 4YG2A 2YKMA 5HMMA 3EYZA 3MGHA 3JPTA 4PA1A 2XHBA 3IAYA 4MFBA 3AO3A 2BPFA 4CJ4A 2FPLA 4DQSA 1BPYA 2OZSA 1C0UA 1RBTA 4QZGA 2XCPA 3QEAZ 2BGWA 5HMLA 5CZ2A 3U6FA 3H40A 3LP2A 4F4XA 4EBEA 3NE6A 1LW0A 4CJ3A 1A5VA 9ICWA 4ED6A 3ZDCA 2C28A 4K8ZA 4CJWA 3K59A 1LAVA 1J54A 2F8TA 1XSLA 2YNHA 3NF9A 1U47A 3MDAA 8ICBA 3O3GA 3CYMA 4CEAA 1C1AA 2X6SA 1B43A 1HYZA 4YR2A 1YTUA 3OVNA 4I7FA 2BCQA 2PZSA 5KFAA 3TAPA 4AH9A 2KZ3A 5J0TA 2GBZA 2D0AA 9ICVA 3VA3A 1ZBLA 2ITGA 3ISCA 3THVA 3RB0A 3PO4A 3KKSA 3QERA 3NGZA 2BCRA 3JPQA 4E19A 3KHLA 1NK9A 1CXQA 5D3GA 1WSIA 4F4YA 4CHYA 3RMCA 1ZQQA 4R65A 3M8PA 1FKPA 4DU3A 3RMAA 4N41A 3PX6A 1ZQXA 2F1HA 1HQUA 4M6WA 4R64A 4F50A 5DDMA 1RNHA 4TSXA 2BCSA 4DSFA 3ZT4A 4MFCA 3L2WA 4OLAA 3LZJA 5KFZA 3DYAA 2OPQA 4FW2A 1S76D 4QZBA 4JV2A 5CWRA 9ICRA 3QEXA 3C94A 4F93B 1CEZA 3GILA 4KLJA 1ZETA 2DFFA 4ELVA 2HHXA 4HHTA 1WSFA 4F3OA 3O4NA 1BIZA 4DTUA 3H8JA 4BACA 1UOCA 4O0IA 2DFLA 4RQ4A 3QINA 4UAYA 3I8DA 2DY4A 5D46A 5CY4A 4AILC 4DQRA 4JUZA 1ZJMA 1KCFA 1EKEA 2P5GA 3EPGA 4P2HA 3PO5A 2F1JA 1RDCA 4DMNA 4Z4IA 4CECA 4EZ9A 4C8OA 3RWUA 3LPUA 4BWJA 4BDPA 1FK9A 1WSGA 1U9LA 4FLXA 4Z0UA 4KFBA 4J9LA 1TKTA 3OYDA 2FMSA 5I42A 4ECWA 3T19A 4QZIA 4BXOB 5J29A 3GIMA 4AHUA 1BQNA 4IQUA 4ZTJA 3KJVA 1ZQWA 2GUIA 5KG7A 4YD2A 3NGIA 1KTQA 1KVBA 9ICNA 3SQ2A 3TAQA 4M9LA 3C5FA 3C95A 4Z6DA 3ORYA 1BIUA 4H4OA 3Q8LA 4BDYA 1L3TA 2I1QA 2FPKA 2DTUA 1VRTA 1FXXA 4O3SA 2IHMA 4KLEA 4ECZA 1MQ2A 1QSSA 3PW0A 2J6UA 5KFKA 1BPDA 1ZQTA 3LDSA 4F5NA 3VQ7A 3TARA 4DQIA 4CJRA 1HYVA 1L3VA 4FZXC 7ICFA 3LP3A 3DOKA 3FDSA 4CK1A 4EP5A 1RXWA 7ICHA 1GOAA 3ZDBA 5IIIA 8ICUA 2KQ2A 1HNIA 1IKWA 3DLKA 2RKIA 5KFXA 4QZHA 5J1EA 1ZQNA 3EZ5A 2Q0ZX 1VSKA 4CFBA 2P51A 3KIOA 4M9GA 4GLXA 4IBNA 5KFRA 4J2AA 1XI1A 4BDZA 4DTPA 1C6VA 3EY1A 3G0ZA 3PW2A 1K6YA 4GC6A 3AA3A 4I29A 2W9BA 3OYGA 4QW9A 3SV4A 3VQ4A 2FMPA 4TUSA 4NXZA 4YQWA 3O4QA 5CYQA 1D9DA 4B9MA 3OYHA 8ICIA 3OJSA 5CP2A 3F9KA 3E2EA 4PUOA 3GV8B 2XY7A 2HHVA 3KK1A 4F5OA 4MFAA 2Z1IA 1ASVA 5KT6A 4KREA 2C2RA 2OPRA 4UAWA 4QZAA 2RDIA 3MR6A 4I2CA 4N5SA 4FYDA 4M3YA 4EBCA 5DB9A 5JUMA 8ICXA 2Z1JA 3NBPA 5L1JA 1NOYA 2LYHA 3ISNC 2R8HA 3K5LA 2A1JB 1RDBA 1QSYA 4CGFA 1NK5A 4C8LA 1ZQIA 5C5JA 4CJLA 3C23A 4RT3A 4DL4A 1WAJA 4Z6EA 2XY5A 3QESA 2ALZA 9ICCA 3NFAA 8ICPA 5HLFA 3AVHA 1XO1A 4RNOA 2QKKA 1KLNA 4CEEA 3QNNA 1SL0A 3LAKA 4FM2A 3MEDA 4FJ9A 9ICEA 3OJUA 3H8WA 3H4BA 5IINA 3HPHA 2UVRA 5HRNA 5KFQA 4YR0A 3AVLA 4FVMA 1Q9XA 2FBTA 4CJFA 5HRRA 4LZGA 1ZQJA 4J2BA 3VQQA 5CJ7A 4CIGA 3WNGA 3EPIA 4AHCA 1BISA 4DG1A 3Q8KA 3UQ2A 3QIPA 3MEEA 1C0MA 4CF2A 4O3RA 3PW5A 4F5QA 2ATQA 2YHAA 1RILA 1VSDA 4Z6CA 4FS2A 3NCIA 3AA4A 2FLPA 4NM2A 4HVJA 2VWKA 4NLGA 5KG5A 3TFSA 3ITHA 2FMQA 3BQ0A 4DTNA 3LZIA 2UVVA 1O1WA 1EXQA 3Q8SB 3ASMA 3AVCA 3L2UA 3G6XA 4ECRA 1Q9YA 2AQ0A 1DTTA 3Q8PB 3RJHA 4F91B 3RBEA 5C24A 3P1GA 4GMJB 3I0RA 5J0WA 4M45A 1T03A 1IXRA 2JZBB 4NLNA 1Q8IA 1ZQCA 2H5XA 1SKSA 4DFKA 1ZQPA 4Q44A 4KTQA 4B9LA 5J2BA 4R5PA 4F4ZA 4O3NA 3DRSA 4JLHA 1SV5A 3T5KA 2FBYA 4DS5A 4KHNA 4KKOA 4DTOA 1S10A 2JLEA 3HM9A 4Z6FA 4LSNA 1ZQSA 4DF4A 3RAXA 4CJUA 8ICHA 9ICPA 3BQ1A 5DLGA 1EETA 4M9NA 4KN4A 1HRHA 5HROA 2A1SA 2ISOA 3AVFA 4W5OA 1ASWA 2AJQA 3K2PA 4OKKA 4QZ8A 2P66A 4B9NA 1TK5A 1NKCA 3RJKA 1ZQBA 4J2EA 3B0YA 3Q8MA 5CZ1A 3QEVA 4QOZB 4CEBA 2KN7A 8ICGA 3ZSYA 1ZQOA 2A1RA 1ZQLA 3IRXA 4M04A 4DTSA 4YXJA 2Y1IA 4B9VA 1QS4A 3V1OA 4RT2A 5KFTA 3ZDDA 1U04A 2YNIA 2HMIA 3RBDA 4XQ8A 5DBBA 1RTHA 4P4OA 1RT7A 4FJLA 4DSIA 8ICLA 1WSEA 4I2GA 4M3XA 4CJQA 2IHNA 4QZCA 4P4MA 1HJRA 1WN7A 3OYJA 1YTAA 3CFRA 3WNEA 1IKVA 1YT3A 1S1XA 2QXFA 3AA2A 4UB2A 3HXMA 4BE0A 3QLHA 2JEJA 4DTMA 1REVA 4RQ6A 1PZNA 1ZQKA 4HTUA 4RNMA 3HJFA 1RBUA 1ZQAA 1DOQA 4BGDA 2C2DA 4ECUA 4B9UA 3V7JA 3CQ8A 3K57A 4FBTA 3VQ6A 3SV3A 3L2QA 1QSLA 2V4RA 4N56A 1RPLA 4CERA 4OJRA 4FK0A 5CB1A 4AHRA 2P6UA 4BXOA 5KGWA 4QW8A 1JL1A 1V9PA 4CJSA 2O4GA 2BANA 4RZRA 2D0CA 1UAXA 3BQTA 3KLHA
chains in the Genus database with same CATH superfamily
2HBKA 1XEZA 4DOBA 3BQ2A 4QAGA 4KBIA 3ZFVA 1PC4A 1VQMN 2IVNA 4GC7A 4IXCA 4FJMA 4K42A 3HKZD 1SXEA 1W25A 2CPEA 2G0AA 4E0DA 3C15B 2R2RA 4DR7J 1G7CB 1DZ5A 5AQQA 1JLCA 3MXJA 2AMCB 2QE5A 1JROA 4LF5F 3BN7A 1TTHB 3QU7A 4PY5A 4V1Ak 2ASMA 2V51B 3A1YG 2PIIA 3C2PA 1Q86T 3EWGA 3GSDA 3SAGA 2CPXA 2NSBA 2IGIA 3B8AX 3WQUA 2EC0A 5M1KA 2OPPB 3OUYA 1M90T 3IWNC 3HT0A 5HBMB 2WVCA 2B3TB 2P6RA 3U02A 2B8PA 4KGZB 4LF6K 3MURP 2ZWPA 4YFUA 4CI0B 1SH2A 5KT3A 4ZVOB 1CJKA 3BY5A 1MA7A 3THXA 1FX4A 3B6PA 4KH5A 4Z4GA 2CQPA 2V6AA 4MIWA 2NRVA 3RRGA 5J2HA 3KWGA 2Q0RA 2KJ5A 3T5HA 2IAJB 5DLFA 1TVRB 4EZ6A 2PKEA 1SJRA 3JQJA 2G8UA 3AEVA 2A2CA 2MZQA 1JJ2M 2C3MA 1X2IA 3HOSA 1RWMB 2UXCJ 3SQGA 1BMQB 5AQPA 3D0IE 5F3TA 4DUYJ 1FJCA 1E6VB 2V67A 5KFJA 3FFKB 3ZT2A 3PIOL 4K8RA 4ED8A 5DQIA 3I32A 2RQ5A 2B8QA 4Y2IA 1F21A 3TWHA 1PO6A 1VQKN 2ZBQA 3H5SA 3UWTA 4FE3A 1HBUB 4HUEA 4HYKA 1UWBA 4FZLA 2FSNA 4HHUA 3CMAN 4RPZA 4MH8A 4H5VA 4C0OC 2VA3A 1EX4A 4L76A 2FJAB 1PJ5A 3W8PA 2DO4A 4RKUC 1NDKA 3TJ9A 2VG5B 3OPKA 2YTUA 5E41A 1PGZA 2G9OA 1H72C 3VERA 5DZ7A 1RXOB 3K17A 1CZAN 3RFAA 4U6PA 3M1VB 1LXJA 5EE3A 2CQCA 2B4OA 1B64A 2QEXN 3ELHA 5D0HA 5DM6Q 4JI8J 4M41A 2O8EA 4OYXA 4DXLA 3HHDA 4KAZA 4OX6A 4G1QB 3H1QA 2Q0UA 1NDLA 2YNFB 4DPTA 1H7WA 4CLWA 4DR6J 3ZYYX 1ITGA 4WYLA 1HX1A 2OXOA 2IM0A 2KD1A 3EW9A 3JSYA 3BSOA 3S6EA 3AO1A 3VHQA 3HHLB 3P5JA 1N36K 4IFVB 3PDNA 3DLLQ 3PW7A 4HHJA 2ZH1A 4AHTA 3LAMA 3AVNA 5C7PA 3VQEA 5F8JA 2GAHC 1W2IA 1LV5A 3AQOA 1WHYA 3Q89A 2ATLA 4UY8O 1K44A 3J81O 5AM4A 2C22A 4M5KA 4MFBB 4IQMA 3CB4A 3IC1A 2ZUBA 1H6KX 4YB5A 1UKUA 2BDUA 2RIJA 3JPPA 2QLTA 5A8WA 5EX5A 4V19S 3SMPA 2CIMA 3LALA 4JV5F 4A57A 3O5TB 4IQTA 5GMEA 3N6MA 1JJ2R 1UTAA 2W7PA 2DFHA 4BR5A 3G71N 3S9HA 5HP1A 5JVHL 1V6HA 4MKBA 1QAIA 5KFEA 1MN7A 2BBEA 8ICJA 4OHWA 3N97B 1VQ4S 3HL8A 1WC1A 3MPDA 5FROA 3BDEA 3IMXA 1VQNS 4CJPA 1QTNB 3LF0A 4DI6A 2KNJA 1RCOB 4DPWA 1IXKA 4CGGA 5HRPA 2DK2A 3QPIA 1B9FA 4YOUA 3QU5A 3T41A 2GO7A 1FTCA 2CQ0A 5FRNA 3PG9A 2O8BB 3CCLS 2QARB 3ZLJA 4BC9A 3CEDA 3BDPA 5ETOA 2QRRA 2QMXA 3RR7A 1B0PA 4C8NA 3QZ8A 2QLWA 2P9UB 4LH5A 4PHAA 1KHVA 2K3KA 1KAXA 1CULA 1N6QA 2CN1A 3SMVA 1SZ2A 1ZAWA 2W40A 2GV1A 1S97A 2R2SA 5CHGA 4B3TJ 3MX5A 3FYHA 1NGFA 4FWQA 2F9WA 5ALKA 2IBKA 2YWEA 2Q6CA 1IJJA 1D4XA 2F4VK 1BUPA 2YWFA 4R63A 2KK0A 2P9PA 3BGOP 4HI1A 1MWZA 4LMZA 3PSTA 4AQYJ 5IIJA 5DBCA 2BGGA 1CJTB 1XSNA 2RRBA 1ZM2A 1AROP 5HMXA 1BWVA 5J0XA 1Y00A 2RILA 1AZSB 4MKYA 2DKXA 1TV9A 3VZIA 3KMQA 4AT1B 2CPIA 5J0UA 4DL6A 4CBUA 3O44A 3IRWP 3EGVA 1WF1A 2ZGZA 4KB7A 2YY6A 3J80Y 4HLBA 2VFRA 5DB7A 2ETJA 3FRYA 4CGDA 4FZZA 1MA9B 1HD1A 3DEEA 1NRKA 3F53A 2DPNA 1X60A 7ICMA 4EU0A 1IWGA 4L72B 3SQIA 1IKXA 3I87A 3D2FB 4JI3K 1S1TA 1NH8A 3FBBA 4ECTA 3UDLA 1WG4A 1PBUA 1S48A 4MK9A 3HSTB 2Z2MA 4CZCA 2MQQA 5CR4A 4F3MA 5F0XA 2MB0B 1ASUA 2VG7A 1LWFA 5ALMA 1RJJA 2GVZB 5HL7Q 3FEYB 3SENA 3NH1A 3M8QB 4OZ1A 2M5YA 3OTOF 3KJFB 3TI0A 3GYNA 2LPEA 1V3RA 3EVWA 3THPA 3CT9A 1YDLA 3QNOA 2P5VA 1TKXB 3ZNJ1 4YMOA 2OELA 3FZKA 5GAGI 3KHHA 1NLKL 4UUXA 3ISDA 4W5RA 4J2DA 4PWUA 2HNYA 4OJ6A 4Y2XA 1Z00A 2W7OA 4JI1K 4YDDB 1BDGA 3G6EN 1YIJN 4FNHA 4QYZK 5KFHA 2GIQA 3JPNA 4TU9A 3BZKA 1S6QA 4DR3F 4YY3F 4I2DA 4LR8A 2OM6A 4RPXA 2XY6A 3QU4A 4GW6A 2M9NA 3MR3A 2GA7A 5IWAF 3NRWA 1VQMS 4R79A 4GV3A 2D3ZA 3FLCO 2ACMA 4IDHA 4KGMA 3AXMA 4UQTA 4CJ7A 1X1PA 1XMBA 2BEFA 4CF9A 1AUSL 3DLGA 9ICLA 2KKZA 3LDQA 1RAOA 2AF6A 2EDUA 5KT7A 2RDJA 2JGAA 4CHPA 1B7YB 2RU3A 3GV5B 3Q7BA 2HK2A 5E79U 3BKTA 5FJ4A 3B78A 4AE5A 2B5JB 1TUGB 2ZBRA 1YG0A 5KFDA 1R0BG 1C4CA 3C8YA 4NLOA 4CBWA 1LW2A 1TYQB 3PXGa 3I0SA 3WKAA 5DG8A 5KRSA 1PYTA 1S99A 3ZSWA 2A3JA 1JXBA 2XS5A 2DCLA 3VMFB 3BBBA 2HHTA 2UV8G 5B0CA 2GMLA 3SBGA 5B08A 4M9JA 1PSDA 4FVCA 1WC3A 1BA0A 2HF3A 3RJEA 1HIWA 2X1GA 4XH1A 1S3XA 3FZLA 5E7OB 1QE1B 1UAWA 1Y3KA 1U0HA 1LKYA 2OYYA 2GWJA 2Q97A 4MO4A 2X51A 7ICPA 4RQ0A 1DK3A 2NLWA 2IVMA 2VICA 3D6RA 2E1MC 4YEAA 2IJFA 4USUA 2KTQA 4U95A 1T7PA 1DFDA 4CZHA 4O8KA 2OUGA 3CIZA 4DV5K 2Q43A 4KLUA 4XDDA 3I1YA 5CCLA 5EE9A 3TZYA 4JK9A 3D1QA 1N32F 1GLAG 4O3OA 3I55S 1RT5A 5E5NA 4ZVSB 3ET6A 1VQKS 4NY8A 4DQPA 3BJYA 1RYSA 2GZOA 4I2QA 5F8GA 4FLYA 2E6MA 5J1PA 4GXKA 4O3MA 3CC4S 1BPEA 1NU0A 3CMAS 5T7BA 3VETA 1IO2A 4NXNJ 1VQ8N 5AKXA 3V7KA 1QUPA 3SAHA 3CVKA 4M94A 3ULDA 2KJVA 3C5GA 1HWJA 3CJ3A 4JS5A 1F6TA 1WSHA 2HNDA 3KMSA 2JJ4D 3S3OA 3MEEB 4LQ9A 1SIWB 5E0OA 4CHZA 4WK3A 1AQ6A 4DU7A 2R7VA 4ECYA 2XGQA 2ZVIA 3Q23A 2YKOA 2FVCA 3UMGA 2P6TA 3EZWA 2IC3A 4JI2F 3W7BA 4A8WA 2ZD1A 4GKJF 4O3QA 2EPIA 2FJWA 1JLFA 5C24B 5E84A 2RHKA 3HP6A 3V7LA 3J80U 4NCBA 3FZBA 3A0HU 3EEQA 4ZVRB 2MEWA 3K0SA 4ED4A 2V7ZA 1NKEA 4R5PB 1FFUA 2OD4A 5LMNF 1RGIA 4P0PB 2Z4PA 1TAQA 2ZBPA 5BRFA 1EXNA 3NNHA 3KLEA 3DLJA 3SYZA 2XSJA 3ZXWA 2W2MP 4LSNB 4RQ3A 3KLIB 3T1HF 3ATVA 1UA0A 1HUZA 1I94K 1EETB 3EKUA 2E88A 2V9KA 4BWMA 3M8ZA 1YF5L 5HHIA 4EAHD 9ICUA 4KHUA 1HW9A 3U1LA 4WFAL 3C2KA 1NU4A 3KBBA 4QZ9A 3NTUA 3WK6A 4WJBA 2HNZA 2HURA 1BHLA 2Y1JA 4ZIVA 3OS0A 5DM7L 3G71S 3ICXA 1G15A 4KTZA 1WBDA 4Q5VA 1ZYQA 1XHXA 1OY6A 3VGLA 5KGXA 4OJ3A 1FKOA 2QLXA 2HRTA 1HHTP 1YXQA 4Y2JA 3HVWA 3EVMA 4DN9A 2CAJA 3EO3A 2I1RA 3KHYA 2DNGA 4IEEA 2YMMA 3DXMB 4B3RF 3H3NO 2CXEA 8ICVA 2G8KA 3KKAC 1A0OB 4PABA 3TQEA 4I2JA 2YNIB 1Q4RA 1Z1BA 4KO0A 3EN9A 3ISBA 3O8MA 3G8TA 1FD8A 2XIDA 2FB0A 3OXFA 4Z4HA 1ECWA 1WTBA 3G25A 1RWNB 4IUFA 3N4MB 4I56A 2HWHA 2GMHA 1K0TA 2DXFA 3PX0A 1IKVB 3C3LA 3QLHB 1CZ9A 3PZPA 1REVB 4YFKA 4CEFA 4I6YA 1JLGB 1WLJA 3DXKA 4QIEA 1T9UA 3CM6A 3NF8A 2BA9A 4JI6J 4FM1A 5J2NA 5AQWA 1K9MT 4JV5K 4ECQA 2AJ1A 3SEIA 2G5IB 3NAEA 3WK9A 2DRBA 5B09A 5DG9A 3FKBA 2JEGA 2D5RA 2DITA 1VSEA 4URSA 4K4XA 3FUYA 3BGRB 3QBXA 3RMDA 4FZNA 3QNWB 5BOMA 1WC5A 3LP1B 2W9AA 3GL1A 4Q43A 3N01A 1XNRK 4DR5K 4RQ7A 3V72A 1PK1B 4NI2A 4CZJA 2CDQA 2KSOB 1HLUA 5AM3A 5LMUJ 3W61A 3KD3A 3MMAB 2CPYA 3HHEA 2G2OA 4ZA1A 3DGPB 3ILIA 1NK0A 5H9FJ 2VBZA 3VQ9A 4CF0A 2ZWOA 1DGSA 1SL1A 2VG6A 3O1WA 3O1LA 2YNGB 3FEXB 2IOFA 2BRLA 1HWUA 4IFYA 3VAKA 2R7UA 3T69A 3SI8A 3LP2B 5C2CA 3HSJA 1BVSA 4DV2J 2XNQA 4AM7A 2YWHA 2GMJA 1P27B 4O3PA 4JI4F 4H4MB 3S41A 3NVYA 1JL2A 2D4WA 4IG3B 2WVDA 5AJ3F 3DC2A 3CC2N 5DK5A 2XC9A 4FKYA 5IT9Y 5BN9A 3VQ8A 5J2MA 2IVOA 4DPOA 2E9ZA 3ICLA 1U48A 1RTIA 4LSZB 2ZE2B 3BEXA 2YKNA 1BL3A 3G6VA 5AQZA 2HBYB 2QSFA 2F8LA 3BPSP 4DUZK 2MPUA 3VF0B 2A5XA 4NYZA 1JB0C 4URGA 5D3GB 4YOXA 4FPRA 1VR6A 2B9WA 4PKGA 3D9BA 4NV0A 1FEHA 3FBEA 5GAHU 2B4PA 1C7YA 3ENWA 5CYJA 5JMNA 1K1SA 3DRXA 2QYGA 3MFIA 3B0XA 2NUHA 3VN5A 1YRTA 1DTQA 2ZVSA 4ES2A 4WJ3B 2DRDA 3HF5A 1VK8A 3MTKA 3JPRA 3VQBA 3VV2B 5ETRA 4C98A 3Q7CA 4DR2F 4WQ5C 4PHEA 4JS4A 3RG6A 3AVAA 1YX2A 3ZCMA 1PAUB 1ROFA 4FYYB 4X4PA 1NGAA 4FOIA 1MG7A 5KOWA 2OPQB 4ED2A 5DQGA 4LF4J 2KZZA 1IBMJ 3CI5A 3WXLA 3GFKB 2E5JA 2R9LA 4FF1A 1Y64A 5L38A 4QS9A 1EHWA 1T11A 2PFNA 4C7QA 1X5TA 1H98A 4NLKA 2GJ2A 4WCEL 2RS2A 5G5HA 3LDAA 4PCQA 4WP3A 1HMVB 9ICHA 4A59A 4OD0A 1S4FA 2F7TA 2XYGB 4UB4A 2KB2A 3OTOK 4P7TA 1LFWA 2FZGB 1EX8A 2CKWA 4ELTA 3OD2A 3OS1A 3NGYA 4KITB 3R27A 3UD3P 3ZZ0A 4FK2A 1RBVA 3VTHA 4ZS6A 3KUGA 1YTYA 4PGXA 2XMTA 1YWXA 4ETZA 2FHJA 4CZIA 1VJ5A 1VSLA 4PYDA 3W3DA 1GT8A 2M88A 4C3LA 1E6YB 4FJ7A 1SIZA 2UUBK 5HMWA 3H1VX 1WTFA 9ICSA 1NJWA 3KZBA 4DV1J 9ATCB 2E3TA 1JLAB 4ZITA 2HF4A 3QGIA 2XO7A 4LF8F 4F8RA 4OZ0A 1NPRA 5J2PA 4BRDA 5IWAK 3GR0A 4EWTA 2HK3A 2JWLA 4DHVA 3B6OA 2EH9A 2UVWA 2XICA 5AKZA 4GKKF 4E1NA 4CHQA 1NHKL 3C15A 2ASPA 4CEDA 2W04A 3CG7A 1VRTB 4MQ3A 4FWRA 1WB9A 3TADC 4CFAA 4UZCA 1S79A 4GVBB 4DZDA 4M2YA 3CCSS 1FX2A 2Z2YB 1NSPA 1ZZFA 3D6TB 3KJNB 3CIPA 1GLLO 2OEMA 1LFPA 1UVJA 3L4QA 4C8YA 5KFBA 1K73O 4KLDA 2CPJA 3D2WA 1F5CA 2I5JA 2OGUA 3DJCA 4USIA 4I9LA 4CIEA 3IA0A 2RKIB 3HJEA 4G9BA 2DWQA 2OPPA 1XTZA 4JI5F 2ROPA 3BQ7A 2HGNA 4LVOP 3ZZTA 2P9GA 2BJDA 4K8XA 1XBWA 3TKAA 3D0HE 2N3LA 3TSPA 9ICBA 3M9OB 1Z6RA 2OANA 2GAGC 4QOTA 4BR7A 1JCEA 3SFUA 1Q0NA 2IAJA 3WEEB 1TVRA 1DY3A 4YN3B 4CO0A 2YKPA 1U4BA 1RHUB 2VB6A 2O01C 2NYHA 1FJGK 4WE1A 4KRFA 2HG4A 1QDUB 3EM1A 2LU2A 2OEJA 3GG1A 4DF8A 1DQ9A 5AE1A 3HTVA 4FJHA 4JI0F 1JWWA 4C48A 2DEJA 1E6VA 1QLNA 2EK1A 3HW8A 2OYQA 1N32K 1RHKB 3FK4A 4WWSA 4Z4CA 2ZUCA 3BSCA 4URQU 2Q3SA 2KKVA 2MKSA 9ICQA 3VF4A 3K75D 3D2EB 4EP4A 2OZMA 3CDAA 1NJZA 4KYZA 2NQPA 4RUBA 5C10A 1U26A 4F7VA 2PFPA 8ICCA 3FGUA 2VG5A 1WC0A 3GBTA 2I5HA 3R5BA 3NCRA 5EX0A 4CEZA 1COOA 1CJVA 3M1VA 4X66F 2OTJS 3JTOA 1VSFA 3JAMY 3OYMA 4YUDA 2WFBA 2HHHJ 3H0RB 2CQDA 1BI4B 3DHXA 1TL1B 4UARA 3KK2B 1RDAA 3NAIA 2ZJ5A 4M9HA 1N34F 8ATCB 4CFCA 3LDPA 4IO9L 5A6WA 4G1QA 2OKQA 3NGUA 4DWIA 5JTIA 5KG4A 3MECA 2YNFA 5CEHA 4TQSA 1R6VA 1S4EA 3HHKA 2CRLA 1KQFB 2BE2B 4F0HA 4I9QA 4DCPB 3ENQA 2RNEA 4GVMA 4NM1A 1A6LA 4OPJA 3TFRA 2XLKA 3HHLA 4C97A 4IO8A 2YHBA 5IT4A 3ZI4A 1U2FA 3ENHA 1K1QA 1UETA 4USAA 4OYIA 2COLA 4EYHB 2E8NA 2R8JA 3SAFA 2J6SA 2Z7JA 3QIPB 2IIRA 4HUFA 4MN4C 1RTJB 3GFYA 4YG2A 2XYHB 5G0RB 2K8AA 3JPTA 2XEXA 3CCUS 4DV0J 4PA1A 1T9TA 3IAYA 2HEKA 4MFBA 1HYSB 3US5A 4ZCIA 2DO0A 2OZSA 3N7SC 4QZGA 1BE4A 3U4LA 2BGWA 5D78A 5CZ2A 2VQEK 1AFIA 4KR0B 3J7ZT 1ACMB 2F9DA 2C28A 1X0PA 1YHQN 4K8ZA 3H90A 4CJWA 3K59A 3W0LA 1LAVA 1XR5A 4PG6A 3IG5A 1TUWA 1YZ6A 2KT2A 4LF7K 3CO9A 2H48B 3MDAA 3RBZA 5ALHA 8ICBA 3O3GA 3LOUA 4I6MA 3JXUA 4YR2A 1YTUA 4B3RK 2YMLA 2PZSA 3GFXA 4AH9A 2MGZA 3HSZA 9ICVA 3OFFA 3VA3A 1B0VA 4NLPA 3ISCA 3MMBB 4LFBK 2QARA 2LECA 3PO4A 2BCRA 3JPQA 2MZSA 1C0FA 4NPOA 3KHLA 1NK9A 4F4YA 4CHYA 4R65A 3J7Z5 3R5CA 3RMAA 5FPDA 2BKOA 1K8AO 3AGKA 4RW9B 1HJOA 2D8CA 3L4BC 1YJRA 4JKEA 4R64A 5A8KB 4LFCF 1RAFB 3EKSA 5GTHU 5F1XA 1RNHA 3KKAA 3TNVA 1M5VC 5L46A 2W55A 3CDEA 2CWKA 4NRUA 3CULA 5CH7B 2DEIA 3TEGA 1WOOA 1X6JA 4FW2A 1S76D 1ATNA 4FWSA 4JV2A 1WD6A 4XAKA 5CWRA 3ULHA 1L3KA 4F93B 2MHNA 4ZJOA 5CXTA 3HZGA 4F25A 3QFPA 1WSFA 4D3HA 2Y8YA 4HACB 1VISA 3H8JA 2XI2A 1O08A 3OTEA 3SMSA 4BACA 3F5TA 2H3EB 4RQ4A 1XJWB 2VQFK 4DX6A 4UAYA 1CJTA 3NXZA 5GADU 1HARA 1WBBA 3TO8A 4A8SA 2E1RA 1KCFA 2ZOMA 1AZSA 2WF7A 2CJYB 3A3NB 2GCFA 1T3OA 1ZQ1C 2R7XA 1RDCA 1V97A 4JHDB 4Z4IA 1VQ9N 2UUAK 4CECA 2VHGA 1S6UA 4C8OA 2CFXA 2GX9A 3BN4A 2DR8A 4BWJA 2EI5A 5B0EA 5JVGL 3GOIA 4KFBA 2K2PA 1LWCB 5LL6Z 3T19A 4KH0B 4Y3CA 1Q18A 4BXOB 3W2VA 4AHUA 3D2FA 1Q81O 4PKIA 5AZJB 1LEOA 4JKGB 5B0DA 4HI2A 3DLEB 4DV7F 1R0AB 4C1NI 1KTQA 4RPFA 2PEBA 1ZRMA 2MA1A 5ALVA 2I6WA 2A1AA 3ORYA 2GHVC 3UDEA 4PHTX 2Q2RA 1X4CA 4H4OA 1RLDA 2GO8A 2I1QA 3D7SB 5CHCB 2ZUGA 4LRAA 4LFAF 3JAMU 1HNWF 1U8SA 1VQOS 1H73A 2J76E 3LDSA 4F5NA 3W1YC 1FWLA 2GO9A 1S1WB 1FXRA 3IWLA 5E3QA 4OYOA 1TE2A 3G4SS 5IIIA 8ICUA 3T6BA 4B9QA 1HNIA 3UCZP 2KG0A 2LMRA 1YUWA 5H1SQ 2AJ2A 4U7UK 1Z05A 4DR2K 1X4BA 3MM6A 3PTWA 1ZQNA 5BN8A 1M6YA 1GLFO 2FVSA 3AJDA 1N5XA 3EZ5A 4N8NA 4BHQA 2P51A 1SUQB 1J5OB 1D0EA 3CCEN 4M9GA 1YBAA 2VODA 4UF4A 2RHQB 2OH2A 1UL3A 4H03B 3UNGC 4TN2A 4I29A 4RW4B 5KPZA 4P74A 4K4UA 3AJ2A 3FCHA 4WF9L 3N6NA 2WSCC 2FMPA 2LXFA 1TL3B 2DD8S 3PIPL 1W7AA 4WQ5A 2Z0GA 1NMDA 3CJQA 4NXZA 2VKQA 2WVBA 4EO6A 1Z19A 1HLWA 2F8KA 1VQLN 5JLHA 1TYQA 3P6YC 1D9DA 1NSAA 2KHVA 3L7PA 3OYHA 1J2VA 2Q31A 3MN6A 4FDFA 2OIHA 2D6FC 3E2EA 4PUOA 2Y0SC 3VAHA 2R7TA 3HCXA 2F3NA 2FI1A 2XY7A 2HHVA 4TU7A 2H4WB 5A0YA 2QB0B 1IWAA 2Z1IA 5KT6A 3UB5A 2NYVA 5M2UA 3TEHB 1KXPA 4QZAA 2H65B 4KY3A 3MR6A 1RCXB 4I4BA 2O3DA 3PHEA 1C1BB 2UP1A 4U96A 4ZCMA 1DKGD 5E26A 4GO7X 1SB3C 2Y8WA 2Z1JA 4LF8K 4NWBA 4OFZA 3EZOA 3D2NA 2O8CA 1R6YA 5L1MA 4KE5A 2A1JB 1RDBA 1SKUB 1Y0HA 1TZ0A 3M6UA 4P2FA 4JD2B 4CJLA 1IBKJ 3C23A 4GFJA 4Z6EA 2XY5A 2AD9A 3AMZA 9ICCA 4B3OB 3AVHA 4RNOA 1SBRA 4EIAA 2HIYA 2WHEA 3CGIA 4CEEA 3QNNA 4ZPCA 1BUXA 5IQ6A 3J81Y 1DEJA 2UUWA 1CPZA 3LAKA 4FM2A 4FWOA 4M7XA 4FXVA 4FJ9A 3SDEB 2J9DA 4DN0A 3H4BA 1VBKA 2UVRA 3NS5A 3FVYA 4YR0A 4OIXA 1FJ7A 1KAZA 1GXUA 4XDCA 4CW7B 4LZGA 2KM8B 2RD5C 2NRHA 5TISU 4MT1A 4AHCA 3UR0A 3UQ2A 3B8HA 3JTPA 3MEEA 1BLUA 5A76A 2L9NA 2Y3YA 1TFWA 1OW5A 1X4DA 3EJMA 3H8YA 2D3DA 3HOTA 1IG6A 4LBHA 1MN9A 1RU2A 1VC6A 2DYAA 2FLPA 2YJFA 2VWKA 4NLGA 4ZLNA 2AHOB 1G99A 1BO5O 1SQKA 1TUYA 4NX9A 3MAAB 2KRBA 4QR0A 1RHJB 4ECRA 2WRMA 4A2BA 3Q8PB 1M1GA 2YCHA 3O5BA 4F91B 3RBEA 5C24A 1MDUB 2FTRA 4GMJB 2EAMA 1SKSA 1N61A 4B9LA 2VUGA 4R5PA 4F4ZA 4O3NA 1FFVA 2FBYA 1AA1B 4RLEA 3KNGA 1QAYA 1KBRA 4DTOA 2GJFA 2JLEA 3HM9A 4LSNA 4DR7K 2P9SA 3RAXA 4CJUA 3CPEA 1S5ZA 1EETA 1BQMB 2BXJA 3C14B 1LNQA 3HZ6A 4M9NA 1TFYA 1OH8A 1EWRA 1VQ7S 1MU2B 1N62A 2CWXA 1KLMB 2ISOA 2R7WA 3AVFA 2E5LF 2JV3A 4DV3J 4QZ8A 2XMVA 2P66A 4X66K 3WKBA 3GFHA 5M1PA 2IYIA 2J8AA 3BS7A 1Q7LB 2JH7A 2H4YB 2F4VJ 3O9TA 1HNVB 3Q8MA 1YITN 1N34K 1J27A 4P71A 4MJKA 5HATA 2DNRA 4H4KA 1ULRA 1JCFA 8ICGA 1VRUB 3ZSYA 3JYTB 5JJBA 1NDPA 2E8PA 4DX5A 1YVFA 1TL4A 2CNLB 5GAHP 2MQOA 2Y1IA 3D4JA 4UOCA 2ZZTA 3HZEA 1W97L 3DMJB 4HTLA 1FNMA 3N4PA 4RT2A 3H25A 1T9WA 2ZUAA 2KICA 2DISA 2ZBIA 2HRUA 2IY5B 5KFTA 2YNIA 2K7KA 4XQ8A 1HBNB 2AX0A 1RT7A 4BC2A 4I2PB 4FJLA 2CPFA 1WSEA 3SBTA 2JDJA 4R0EA 4BRIA 4P4MA 1Y9OA 4OJHA 5HANA 3CNHA 3JTNA 1XNQJ 5K8MA 2XI3A 3P38A 1IKVA 2LMIA 4DUYK 1U24A 3QLHA 2JEJA 2QL9B 1REVA 4AFFA 4LR9A 1PZNA 4Y2PA 1ZQKA 4RW8B 4HTUA 4DV6F 1WSRA 2DQNB 4ECUA 4NOHA 2JRSA 4DOZA 1UW9A 2MLXA 3L2QA 1RFQA 1QSLA 2LQ5A 2KT5A 5CB1A 2P6UA 3POTB 4Y00A 2OTLN 4JB8B 4DKWA 2E1CA 2O4GA 3BQTA 3MM5B 5GTIU 3CCRS 4YHHJ 1HD0A 4BLGA 2ZNYA 2WZ1A 4UB8U 2AEFA 3TVYA 2QTDA 1OQ3A 4QPTA 3MMAA 4IRDA 1WI6A 4PKHA 3PYFA 1WWVA 2HB5A 3MWTA 5C2GA 2BW2A 1X42A 5TKWA 1YBUA 2YNGA 4OPHA 4RWWA 4DQ8A 3CF5Q 3GU3A 4M47A 4FL9A 4DR6K 5KFMA 1SJQA 3ZTSA 1TUUA 1N33F 4B02A 2I9GA 1ZM4A 4O55A 3Q0AA 2AGOA 4Q8EA 1B70B 4H4MA 3J81U 1HKBA 1YRUA 5KFCA 1NM2A 3C7NA 4DL3A 4IG3A 4UY85 1YJWN 4PG5A 2D0OA 2FD2A 2EFPA 3FE1A 2HWTA 3MN9A 3KWIA 5K5MA 1UFLA 2ZE2A 1H7XA 3WUHA 3EE9A 4AHVA 1M1KO 2I0XA 3AD9C 4JBCA 3NGTA 1S1UA 1ZQRA 1HWKA 5J0YA 1KVCA 4CK3A 3BR8A 4OHXA 1W9HA 4H0PA 4E7KA 4CIFA 4L3NA 4WU3A 5F8LA 3E9OA 2ZJPL 2DBBA 2VC1A 5TKYA 4FPAA 3V81A 1HNZF 2B4JA 3W65A 4FSVA 2NRWA 4U7UD 4O5KA 4BRCA 4JV0A 4F3QA 4RQNA 3HT3A 2WB1F 4CD1A 5KAFU 2B56A 5CR0A 3OL6A 4YVZA 2JR5A 3AY9A 1T44A 1ZBTA 3FZ2A 4ZPWR 1S5LU 4HTJA 4F5RA 4UW9A 4ZHRB 3OYBA 4LF5J 1S6OA 3PLAA 2JZ5A 2W6KA 2ODGA 1O13A 1R27B 3ILLA 2GGPB 2F5GA 2K4IA 1Y88A 1ZQDA 1PJ7A 2MLYA 2PMZF 2ZWHA 5CRXA 1HMVA 3R7NB 3J7YI 3V1QA 2HFNA 3MEGB 4EMDA 1R0CB 3HWTA 4KLOA 1JLQA 1NK6A 1VQLS 4CE6A 1RYRA 3VQCA 2ZOGA 1HNWK 3AO4A 7ICVA 3UDCA 5GIPA 4B3TK 4F04B 1FXLA 1JXEA 2K60A 2J8SA 1FNXH 3CCQN 1S77D 5BOLA 1IH7A 5ALTA 3ONQA 1E6YA 5CHIA 3IGVA 4RX6A 5J2KA 4PWWA 3SQ0A 1ZBHA 4WQ4A 4OI0A 3GIJA 1UEUA 4B3SF 1LAWA 1JLAA 1FEZA 3B4DA 3EVOA 3ZSQA 2ZKUA 4RQ8A 2ROEA 1RU1A 4M0AA 2GW8A 4J9RA 2C3PA 4X4QA 3TTCA 4RW6B 3AGRA 5ALZA 1KKHA 2ZIXB 9ICIA 2CQ4A 4A8EA 3IWXA 3OHAA 1SI9A 1NB2A 2G4BA 1Z4NA 1WJ9A 2LQJA 2M8DB 4LZDA 4XK8C 3PSFA 3FR0A 4RBVA 1LKZA 5BR9A 3ZNUA 5KFWA 1Q5VA 2DGQA 3ZZOA 1XHZA 3IP0A 4B3MF 4FJ5A 1NH7A 2HMPA 3BGFA 4PZOA 1QQ7A 2R8IA 2Y0SD 1V3ZA 4B9TA 4KLIA 3IBCB 3G10A 3GB0A 1X4GA 2OSRA 3M5RA 1X3NA 2JZBA 1X9MA 2A6AA 4M3UA 2V4JB 3OVAA 4IG0B 2P8IA 3TOQA 3M30B 1FI4A 3Q2TC 4NL5A 3VQDA 3DM2A 3SCLE 2FJ6A 2RDDA 5EUHA 5F8MA 3MM8B 2XSFA 1MWYA 4X64F 2JX2A 3WEEA 1X9WA 4JWMA 4IQVA 4OMFG 4FYXB 5AIAA 1X9JA 2EAPA 3E9PA 5KFGA 4IQWA 2VPYB 3ZTPA 1WEYA 1U1KA 1HW8A 2XZDB 7AT1B 3C65A 1GEHA 3TAGA 1HKCA 5ITHA 1ICEB 1WF2A 2E1AA 5B0BA 2Y0BB 3SQ4A 3ZSXA 4NO7A 1BNOA 1HQUB 2E29A 4ID5A 3DLBA 2F8SA 3KKRA 5BYRA 3EE8A 1ZD2P 4J5OA 3D2EA 5G4DA 3IR5B 2C2ZB 4NRTA 3GDXA 4KLQA 4R66A 4J37A 4ZLLA 3CTRA 5GAEI 3RSEA 8ICEA 3I9ZA 4RWTA 4QWEA 4JV5J 2F7VA 3M9NB 2W03A 5A2QY 2V2ZA 4DU8A 1L8LA 3V9SA 2BKEA 4X65F 1BI4A 5J2QB 1TL1A 2JFDA 3KK2A 3RJJA 2WW8A 4O23A 3R7SB 1CC8A 3K5PA 4O0NA 1S0OA 1EKRA 2XB2D 1BHNA 3V6DB 2VJUA 1YITS 1ZBUA 2XNRA 4KGXB 3C6AA 2YB1A 1R8BA 5A0LA 3LWMA 1LOTB 2LEBA 5A8RB 2BE2A 2E1PA 4CH0S 4O5EA 5K14B 4CYUB 3RH6A 2ZC3A 2LYVA 3R97A 9RUBA 3L8BA 5BPMA 5AT1B 3SCXA 2D3OR 1VRQC 5AE2A 3MXIA 2I6XA 7ICKA 3KJVB 4CZLA 4DOAA 3R1LA 2NS1B 1RTJA 2M70A 2X3DA 3DDKA 4C80A 1RT1B 2BQ3A 9ICJA 2LDIA 3MX2A 3NCQA 3KD1E 2KV2A 2J9DE 5SZTA 1YVUA 3A2FA 4OGCA 3DRRB 4YS2A 5BXIA 1YJ9S 4QIWF 1HYSA 3TTFA 5AI5A 2ZM6F 2RLTA 2P2CB 3BYPA 4HHHA 4M3ZA 3QU2A 2ABYA 4Q0BB 5ETPA 1J5EF 3K9JA 3K7RA 2MQMA 2G07A 2A19A 4NZ6A 1NJYA 1S7HA 5ALEA 5ALPA 1FT8A 3E58A 4B8CA 4WBFA 1NNEA 3IAS9 1W26A 1U1PA 2V68A 5IXUA 2XZWA 2DGWA 1GLEG 3TABA 2X3GA 4NXNK 4ICAA 4K4IA 4BRKA 4XH5A 2AEJA 2OTLS 1NB7A 3MAQA 3QJLA 2DJWA 3GG0A 1IKWB 2HBJA 2QXLA 1T8EA 4IDKA 4EX6A 5IIMA 2LP4A 3MCAB 2DGVA 1TMJA 4QIVA 3UKRB 2Z56B 4DEZA 4P4PA 4W4MA 4EGLA 4BRAA 5AQKA 2W41A 4WTYA 3IM8A 1QH9A 3TQ1A 1YLXA 3H6EA 3MI7X 3MMBA 5EWEA 1ZM3A 3QRRA 2B4UA 2N1RA 3MGIA 2G1DA 4NL9A 5HHHA 3JQKA 4WU2A 3LWLA 4S0MA 4MDBA 2K8CB 3G87A 1HBMA 2X7IA 1TFRA 2MSTA 4DU4A 4RW9A 5ETVA 3TTDA 4TY8B 3KTQA 1KRPA 2LQ8A 2W24A 4DV6K 1QAJA 1O03A 3JSBA 4Q2MA 4A46A 3UD5A 1X4EA 2LFVA 3UR3C 5F8HA 3SPYA 5M2RA 1SC4B 3ZTQA 3U3GA 3OTOJ 1T3NA 4FN5A 4JWNA 1WUUA 2MKCA 1YJWS 2KEYA 3KK1B 3TAFA 1RWPB 3AVKA 4W5NA 5AQVA 4CH7A 2ASOA 4CGIA 3R9KA 1IBLF 3FBFA 3L3UA 4BREA 4BR0A 3OHBA 1UCNA 3HFZB 1NJXA 3A8KA 3F2DA 3R5GA 1OSDA 1VHFA 3DOLB 2V63A 4WZQA 2BMBA 2NUUG 4C7ZA 3R2DJ 5DJBA 4MF2A 1GAOA 1RLCL 4DR3J 4YY3J 4H54A 3H8MA 4ISEA 1EIYB 1JRPA 5IWAJ 1KQGB 2D0PA 4DS4A 2WB1C 1LB2B 5GINA 3UXNA 1LWCA 5D4BA 4X4TA 4J9KA 2ADBA 1K8KB 4H8KA 3DXBA 3D5MA 5LSOA 1W0HA 4KC5A 3CXCM 5AKEA 2R7OA 1N56A 5AZJA 5J2DA 2HHWA 1T4GA 4ZJLA 2B4VA 4Q7AA 5U47A 8ICFA 4JKGA 5AZIA 4AXIA 4O4GA 4FZVA 4RNNA 2HDOA 3W63A 3SUPA 3CCTA 2WTFA 2CJKA 5EWGA 1YJTA 2PMZC 2P5OA 2JVRA 2DPIA 1V5VA 5AIBA 2QJ3A 1YK9A 1Z25A 3TA0A 2PO4A 4ECXA 5HR7A 4OGEA 2E2PA 5A2QU 3K2YA 4PZVA 1WHVA 2FHMA 2FBXA 4GRSA 2OAUA 2R42A 1VBXA 1ZBIA 3CPWM 4W92B 4Y0WA 5J2CA 4E89A 4TXSA 5KFSA 2GWSA 1L3SA 3P3DA 4FPBA 3GYXB 3H2VE 1EJ7L 2XHWA 3C21A 3AVBA 3B82A 1Y97A 4U7BA 2Z30B 4MIBA 1T03B 3FZFA 4J91A 1OPIA 3EGNA 5LMUK 3NLCA 4CT8A 5CCMA 1SUQA 3Q22A 2N4CA 1J5OA 1SV5B 3P4UB 4KKOB 1R3NA 2NLXA 4UOHA 2MYFA 2QV6A 1WEXA 1J53A 1ESVA 1N32J 3M3ZA 3K0JA 3FQLA 4RW4A 4K50A 3ZDEA 3OL8A 3QUTA 3IR7B 4IOCQ 3HRGA 4Y2AA 1ZA1B 3O3FA 2LBOA 1HQ2A 1RG6A 2ILZA 2NSCA 1TL3A 3M05A 1QVGM 4DV2K 3V4IA 2ZJAA 4IS7A 2EHGA 3UN2A 3UM9A 2Z57B 5FLXY 5AE3A 1U2CA 3E01B 1APSA 1WCLA 5DRKA 5AQRA 3T1YF 3CW2C 2AW0A 4TURA 5CYMA 2VZ9A 1NGHA 3WIVA 2ZHAA 2LCWA 4U9RA 2KHCA 4EK2A 2HMXA 1MROB 4OJGA 3CXCR 2DGTA 5KFIA 2F77X 3P39A 4UB6U 3CJTA 1YQHA 5JXSA 2MJNA 3HFKA 4YOWA 2WSFC 2QL7B 2A1BA 3LGHA 3AARA 4JI2J 2H3ZA 1C1CA 3DV9A 4QWBA 1RTHB 1VSIA 3VQAA 2JEIA 4IOAL 4Y2VA 1UPHA 4GNIA 2H3GX 4GKJJ 1QAXA 4I6WA 4BCAA 1KFTA 4I1TA 4JD2A 1S1VA 4FS1A 1KSPA 5EU7A 2KN4A 2X1AA 4CO1A 3SUQA 3B4MA 4B3OA 5LMNJ 3PV8A 3THWB 1R8AA 2DHHA 4X5VA 5AQOA 3CPWR 4OZJA 1N4LA 3M6ZA 1IBMK 3T1HJ 4CLPA 2W43A 1IR0A 4B3MK 4LH4A 5HNKA 2BJ8A 2WONB 4O5BA 1WG1A 4LJXA 2M8HA 4CK2A 2W2NP 2IA6A 4F2SA 3MOJB 3RR8A 2MUTA 4PQAA 3LPTA 5ALFA 2KYXA 1E4GT 2ZJRQ 2F8MA 4KLSA 7ICTA 3PRVA 5SWMA 4Y2UA 2YKMB 2XRIA 3MXMA 4K7QA 4J9OA 3AO2A 4WIQA 2L48A 4RQ5A 5F3XB 2F40A 4KHPF 1HI0P 1GMUA 3SSRA 2MY8A 3MAHA 3D0PA 1ZJNA 1HHQA 2OHFA 3QUBA 3ZSVA 3G82B 5K9FA 1QVGR 4B3RJ 3GTYX 2UU9F 3UD4P 2HKEA 3OYLA 3LPEA 5DDRC 2AZ1A 2PGCA 4RU9A 4N7TA 3SUOA 1U49A 4DV1K 1Q86O 1XMQF 4DFMA 4ISGA 1ZH5A 2HQDA 3D1HA 1N5WA 2Z2ZA 3TVKA 4DSEA 3NRZA 3EGWB 2Y1LB 4JNEA 4FOEA 1RA7A 4E1MA 1D3WA 2ILYA 3R5DA 2V94A 2X74A 4RU2A 3MR5A 3ZSOA 2XLIA 4WFBL 2EFNA 3A3OB 3CC7N 2QLFB 3DOMB 4UB5A 2V8VA 2FZKB 1BQMA 2DH8A 3V2UC 4L8RB 3C14A 4CQ1A 4CJTA 3A12A 5KFLA 4F72A 1MU2A 4QIWC 4UAUA 3VZHA 3UI3A 2WBMA 2OD6A 1IV8A 3NOCA 2C2EA 1ELOA 4ACOA 4QU6A 2ZOFA 1Y3JA 1UJ6A 3K4GA 1N5TA 1KQKA 4B1WB 1EZZB 2GQQA 1BWFO 4U7CA 1XMOF 1NGBA 4BE2A 4UASA 4M6WB 4CLTA 1WKLA 3K9KA 1VRUA 3GWCA 1PAEX 2A40A 4OLBA 2ROGA 4BJQA 4R8UA 4KHMA 2EZXA 4ZH4A 2BZ2A 2M9KA 2FDNA 4ZOSA 2ZJ8A 3C2MA 4Y0FA 3PNCA 2BW7A 1HBNA 3P83D 1QQNA 1SC3B 1PCAA 4I2PA 5AR0A 3FCWA 4QYRA 4NXMF 1HQEB 3G96A 4F2RA 3M2UB 1WDDA 3I76A 2IM2A 4JI4J 2A18A 4FCYA 3QO9B 1U0SA 3BH7B 5BYQA 2VOOA 4USVA 4RW8A 4C9DA 2HZVA 3VAGA 3SSSA 5MAOA 5M2PA 5AJ3J 1B7FA 3AD8C 2NNWA 1FKAF 1FK9B 1S0MA 3AVJA 3THYB 5FLXU 4I2BA 2V34A 4PG8A 2V4QA 4BBYA 3ZEUB 4NLTA 4QIGA 4FM0A 4KI4A 4A2AA 5LJWA 3POTA 3CM5A 4M3WA 3H3OB 5J2JA 1VC0A 4V19J 4KI6A 2HVIA 3MM5A 1NGDA 1KN6A 2V0NA 4C6AA 4JB3A 2QIFA 2DR6A 4Z7CA 1N54B 1FWPA 2HHHK 2J5AA 2YTCA 4ZVPB 5I3UB 1SPBP 4UB1A 5EXWA 1RQNA 3GJTB 2DUYA 4ILRA 2XG8A 1VQNN 3P5TL 2XWYA 4F5PA 2R7SA 4I2HA 5HK4A 4DR2J 2FSJA 3N7RC 5KAIU 2FLLA 5F9NA 3R3TA 4OKJA 5EHHA 4K43A 3ZT1A 2LLZA 1WCNA 4FLZA 3MFHA 4RNHA 2VPXB 3CCLN 5RUBA 5LJVA 1SL2A 2Q1NA 1YJUA 2O4IA 1ZQZA 1ZS6A 1AUDA 2FY1A 3MPVA 1HUOA 2A3VA 3PYEA 1BNPA 3NEKA 1VK0A 2P9NB 3OY9A 3R8YA 3UVJB 2GVDB 2QO3A 3I4PA 3ZETA 2XVTA 5AQXA 1N48A 2XWXA 1F1BB 2YH1A 4Q45A 5AKYA 2A6OA 4Y2KA 2RQKA 3A8IA 1A76A 4MHVA 2E5GA 2KJ8A 1KVJA 4WKYA 1RT6B 2MZ1A 3PFEA 5HSPA 5KL1B 1TGOA 2GEMA 1N60A 2E4LA 3WK7A 3D67A 1BCOA 1TL7B 3UKUA 2G1HA 2P9LA 3Q8RB 2W9BB 4JI7F 4NB4A 4HL9A 1B4SA 3AU2A 3RH4A 4HDGA 1ZQHA 2VA2A 4JK7A 3UNYA 4NYNA 3SD7A 3BZQA 4DPYA 2APOA 4LF8J 4P6QA 4PJ0U 1KFSA 3HI0A 3FRZA 3KLVA 5C25B 4B8AB 4IOBA 3PHTA 1D9FA 3OXGA 4FWPA 2AJFE 1BPZA 2J0QD 5J2IA 2FC9A 4GKKJ 3MHYA 3SQ1A 2ZH4A 2ZKTA 3CO0P 4OI2A 3VTIA 1DT9A 4Y2RA 1NZ8A 1B99A 4CLUA 5AI0A 7ICEA 4Z4FA 1ZRNA 2B21A 2VJ4A 1UMJA 1VIOA 2GGPA 5ALOA 4C3KA 1WSJA 4HT7A 2HRYA 1WAFA 1J9AA 2WAQF 4LF9F 1KOHA 4ECSA 3MPYA 4LF2A 4OZ3A 2AEMA 2AQ4A 3FCVA 2WF9A 4JI5J 4PGYA 3FNNA 3OR1B 4O4RA 3NNCA 1ZPWX 3ZT0A 2KP7A 2X1FA 4CTAB 5KT5A 3ZD9A 2HOIA 4K0KF 2CQ2A 4P52A 1SZPA 4I2AA 3OYAA 3QFHA 2E2NA 4PH5A 1HJPA 2H5EA 2BPCA 5H2FU 2PYJA 3BGLA 1Q81T 3L5KA 4CE9A 5JVHQ 4DCCA 1RXVA 4LD0A 1FRKA 4HT5A 3KYLA 1U8WA 3ZZZA 4DQQA 2MSNA 1L3UA 1G3OA 1RTDB 1RWVB 4FF4A 4NEYA 1N5QA 1UT5A 3W3SA 4Y1DA 2D7SA 2YX8A 4RW6A 4JI0J 4K4GA 2HS3A 3H0PA 2HAIA 2IM1A 2ZIXA 2Q36A 4W5QA 2DB1A 3EZUA 3IUCA 2R4FA 4K5RA 2IMOA 2VPZB 2JHEA 1VQ6S 4OYWA 2BPFA 1C0TB 4CJ4A 3ITHB 4DQSA 1X4AA 2Y9TA 2O8DB 1BPYA 4MK8A 5J8YA 4US8A 1C0UA 1RBTA 3IMQJ 1B0TA 3C46A 4HWIA 2XCPA 2D3O1 4IL6U 3HD1A 2AX1A 4F4XA 4EBEA 5JLFA 3NE6A 1KC8O 2KG1A 3S1TA 1LW0A 3I0RB 3R6GB 1ZD4A 2L08A 4K4VA 4FYWB 4X66J 2W2OP 1O8BA 2V4JA 5JRTA 2E8MA 1J54A 4RWXA 2F8TA 1XSLA 2YNHA 3NF9A 3N79A 3QGGA 1N34J 5LL6d 3GE9A 2QW9A 4K41A 1S72S 4EHTA 3UE5A 3CYMA 2WF6A 3MM8A 1C1AA 2VBWA 1B43A 3DWLA 3OVNA 4KBOA 4I7FA 5D8HB 1ZM9A 2GBZA 2D0AA 1WC6A 2ITGA 4NLUA 3IAM9 3RB0A 4BC3A 3NGZA 4ES3A 2LVWA 3RMCA 3M8PA 1HWIA 4N41A 2A2DA 2F1HA 1HQUA 2JH3A 2M0GB 4F50A 4OL8A 3ZZRA 4OYAA 5DDMA 2FF3B 2DNMA 3IRXB 4TSXA 1QZ6A 3MM7B 4ZCLA 3C0BA 3I55N 5IOLA 4QS8A 3DYAA 2CQIA 1KR4A 3FEZA 3CC7S 3OXLA 3BF3A 3C94A 1YZ7A 1CEZA 4KLJA 3CC4N 4B1XB 1FFSB 4DTUA 2YQ0A 2V8GA 2XBPA 4O0IA 2AP6A 3DDIA 3I8DA 2DY4A 3I96A 4NLDA 4DQRA 4JUZA 4X4OA 3TJAA 3MCSA 4DB3A 1ZJMA 2ITMA 4NLXA 4JKCA 4P2HA 5D4LA 4MKVA 3UMCA 3KDOA 4DMNA 1YJ7A 5HAOA 3LPUA 1GNKA 3MZIA 2CNKB 1WSGA 3WKCA 1ZAXA 2FJXA 5AICA 5BJRA 3CCJS 1TKTA 1RACB 1RBAA 2FMSA 3NMRA 1TAMA 1WDTA 2H54B 3HD2A 3B54A 1EAYC 1XMQK 3GIMA 2YX7A 1VS3A 3ID8A 3NVZA 4ZTJA 2OEHA 3KJVA 1N8RO 3KLHB 4ZVGA 2GUIA 4M5HA 2AV5A 4OJLA 3HI9A 1GQEA 2NZTA 3A8JA 3BV8A 5HO4A 1IBKK 3SQ2A 3TZXA 2HCFA 5K4LA 4LFCJ 3UDVA 5DDPC 3LW5C 3C95A 3MCPA 2KG5A 4X4VA 3G9CA 3RRKA 1FF2A 3J80O 3BO3A 1P7DA 4EUVA 3Q8LA 2CJQA 1T02A 3HKZF 4A5AA 4A8QA 3VESA 5AKGA 4QIFA 2NXJA 1BPDA 2YI1A 4OJPA 2PEHA 5LOQA 3TARA 5AM0A 4AUKA 4CJRA 3ENVA 1L3VA 1DAXA 1XMOK 2E8AA 3LP3A 4R25A 5T41A 2KLAA 3DOKA 4JP8A 5F8NA 1ZBSA 2NV3A 4Z37A 2KQ2A 3CQXA 1IKWA 1NJIO 3FM9A 4OYPA 3OUYB 1UPPA 2JMGA 4M5DA 5ETQA 3GE1A 1VSKA 2NZ4A 2N4DA 2XMAA 2NZCA 2YQ1A 2YKQA 1IKYB 4IBNA 4J2AA 1CJKB 4YOTA 1XIQA 4ZVUB 3THXB 2AJ0A 3PW2A 3AA3A 1G2EA 2EG2A 3TUPA 2RUSA 2DIVA 3BH6B 5F3ZA 1T9XA 3MMCB 3ISND 4H5RA 1BA1A 3BS5A 3VQ4A 3MN7A 1SH3A 4KGKA 4ZVFA 3J7YP 3V5RA 2ZH9A 4MO5A 3HILA 4DV7J 5CYQA 2UUCF 4Y2CA 3D66A 1URJA 4B9MA 3SQGB 1S57A 5CP2A 3GMGA 3W5YA 1MLAA 1FO1A 1RP5A 3WX8A 3TSUA 1U6FA 3KK1A 3CCVS 1IUJA 4LFAJ 4KREA 1JNZB 1HNWJ 1NUEA 4I2CA 3WT0A 4FYDA 3MGVA 4DV3K 4EBCA 5AQHA 1IM6A 5DB9A 1FE4A 3NBPA 1NOYA 2IOFK 1IJFB 3GDQA 3KNAA 3QATA 1OS5A 4CGFA 2GUPA 3BP8A 2O8EB 2ALZA 3SCIE 3HX9A 4CLKA 4ICLB 2QKKA 1B4FA 4GO5X 2IPOB 1HR0F 1K8KA 2FXUA 4U8VA 2LM1A 1P9YA 1UFWA 5C42B 2KXNB 3NOGA 1JLBB 3MEDA 2JVOA 2PBDA 3IXQA 1K9MO 1YBTA 4EO8A 3H8WA 5IINA 5HRNA 5DS7A 4ZCKA 2K89A 4CIOA 2KJ9A 4G1IA 1KTVA 2HFZA 1Z4UA 1XNQK 1V38A 4CJFA 2DHXA 1ZQJA 2ZXIA 4OO1J 1IR1A 3VQQA 2BOPA 3EPIA 2IDLA 1JLEB 4DG1A 3Q8KA 2PA3A 2WAQC 1KEKA 2QWLA 4CF2A 4OX9F 1SGGA 4O3RA 5AM5A 1H2UX 2ATQA 3W60A 1BWEA 1A9NB 1WHWA 2FUG9 1X66A 4WFAQ 1DK2A 3NCIA 4LIWA 3UCUP 4NM2A 3RAMA 5FIIA 2QFIA 3VALA 4JI7K 4YB6A 3CCZA 2MKIA 3VR1A 2FMQA 5GMKa 1TL5A 1E4FT 1MWQA 1Q79A 3O4WA 1O1WA 3L2UA 3R6MA 5DM7Q 1Q9YA 2D3UA 2YHWA 1Q82T 1Z2LA 1T3QA 1KOOA 4YHHK 2V7YA 3P1GA 2RB7A 1T03A 4DV4F 1OKJA 1S59A 4Y2YA 3A4TA 3CMQA 1ZQPA 1QCKA 4KTQA 4JLHA 2LYAA 3E3XA 2R7RA 1SV5A 3T5KA 3WU2U 3F56A 4MKAA 3QYPA 4KKOA 2J9CA 2CPRA 1S10A 1ZQSA 4TLRA 8ICHA 3WIUA 4DR1F 9ICPA 3BQ1A 3M2VA 4QBUA 3WHIA 1HRHA 5HROA 3BB5A 5GAEP 4KRWA 2IRUA 3RW6A 3ULEB 3JS6A 4W5OA 2QWQA 2U2FA 4C11B 3AOBA 3A5NC 3KJQB 2FIUA 3IGNA 3K89A 3AY0A 4OI6A 4U67L 1ZQBA 3DAWA 4J2EA 4MTPA 3CJ4A 4K0KK 3VGUA 3OBWA 3R6LB 4RBTA 3TA2A 3QEVA 5AKIA 1CULB 4CEBA 2KN7A 1N6QB 2XTJP 2VASA 4I69A 5IC4B 1C0GA 4OYZA 1MROA 3CD6N 1OVQA 3QDKA 4DTSA 2VD3A 4FWKA 2JFKA 1QS4A 3V1OA 4O8UA 4GIBA 4WFNL 2ZBCA 1WYGA 3MM9B 3LL3A 4AF1A 2MLZA 1RTHA 2XMKA 3I5BA 5AQIA 1T9YA 2ZF5O 4JKHA 5K8OA 2P9PB 1NGEA 4L6V3 4OZ2A 3RJMB 3H7HB 4QZCA 1CI4A 1WN7A 1N5YB 2P6SA 5I3PA 3U7JA 2RQMA 3VAJA 3QT8A 4BE0A 2VJVA 5D4PA 4DTMA 1XK8A 1T6CA 3MWPA 3HSCA 1U7LA 2G08A 2HS4A 4ILJA 1GMWD 3AH6A 3CCSN 1HIYA 4BGDA 3V7JA 3CQ8A 4FBTA 1OWXA 2UXBF 4D3GA 3SV3A 4LF5K 2BM0A 4FP9A 4CERA 1SV4A 1RAAB 5IM0B 1RT3B 1X5OA 2YH0A 3RYLA 2E5LJ 5KGWA 4QW8A 3CETA 2EFOA 4NJ8A 1S1TB 1JL1A 1V9PA 2PT0A 4CJSA 3LM2A 1EP4B 4RZRA 3A0IX 4RTFD 1O5JA 3NHGA 2CQBA 2DKZA 4JK1A 3GIIA 2FLOA 4RUCA 2VL1A 1RDRA 4ILGB 1CJUA 4ATNA 3CCWA 2HSTA 4G3IA 1LWFB 4PPZA 4Z7YA 1T9VA 4DTJA 4CESA 1GXLA 4RQMA 1UZDA 4Z4EA 3C1ZA 2G0CA 3DI6B 3HHLC 2QA2A 2F9TA 4O5FA 1H2VZ 4IH6A 3VGVA 3WBZA 2E7WA 3G82A 1VIXA 2GIFA 2HNYB 3TZWA 2YWWA 3I56S 1Z00B 3V9ZA 2XCAA 4Y65A 2C2MB 3F41A 1P8GA 5FPMA 4X4NA 3PCOB 3WNFA 2B7BB 3ETLA 1HNXF 2OO4A 3P8BB 5L1LA 4FJKA 1CXUA 2RUGA 4KAIA 2KHDA 2FF6A 5ETSA 5E33A 1FDDA 3OTCA 5DDYA 5I3QA 3GCXP 5EDWA 4ILMA 3E66A 4BR2A 4DV6J 3MMJA 2IVFB 3KK3A 3KLGA 1WNEA 3C2LA 3H8SA 2LQ9A 2J0SD 4X2BA 4WCEQ 3SLCA 1DLOB 4I2EA 2I38A 3ID6A 3PW4A 4PL7A 2EKYA 3T7ZA 2X1BA 2YHXA 5L39A 3QMLA 4CNQA 4DFDA 4M42A 4DR4F 1JIHA 1TU0B 1A77A 2OTJN 4OX7A 3QJPA 1N52B 2DHSA 2F8HA 1NHUA 5IT9O 1ZQGA 1FDAA 2BZFA 4OYBA 3V9UA 3TAEA 5LJ3Y 3CJAA 4C4RA 3TR8A 1RI7A 3C6UB 1PYSB 1Z1VA 2H3QA 1N5SA 5EY4A 2M2BA 2AP1A 4RQ1A 3EMTA 4LF6F 2A42A 2FC0A 5ETTA 2C3YA 3K58A 3FSIA 2W1BA 2W4DA 4PXEA 4K4HA 1HQEA 4KN7A 2QA4S 1U0HB 3OYKA 1LKYB 8ICKA 3VAIA 1N33J 3M9MB 4Y6IA 3AOCA 2KU7A 3P96A 2J7KA 1M5OC 3VGKA 5KT4A 3QO9A 2VBXA 3NY0A 4CEOA 2LYBA 2PI4A 4QZVB 1MWKA 2W9MA 2ZZNA 4NCAA 3PSPA 3K8WA 2QSWA 2C3UA 3RBXA 7ICJA 2LXUA 3QX7A 5KAKA 3CCUN 5JICA 1NNDA 4OKEA 1Z1ZA 2NR0A 4EI2A 1S9GB 3ZEUA 3ZSZA 4DSKA 3PY8A 1KKXA 3TWZA 2CVIA 1RCHA 2Q4TA 2DGZA 4I2QB 4P10A 5KPRA 5BPCA 2EFQA 3GIKA 3CJCA 4JEPA 1JJ4A 4ZVEA 2LEPA 2W9CB 3EGZA 4DSJA 3BBFA 1BCMA 3U1MA 3KG1A 1JK9B 4FLWA 5I3UA 1HNZJ 2JC1A 5D4OA 2DGUA 1OVYA 1Q8BA 4JN4A 1TV6B 4Q8FA 3HO1A 1BU6O 4NCGA 2DVIA 2ZUDA 1PUZA 1VLYA 3QFWA 2L3MA 5DG7A 2OCEA 3PR5B 1R8PA 2HLUA 2VKRA 3D45A 1HWLA 4KPYA 2IC3B 3WX4A 3L4PA 4CGHA 4L3QA 2E20A 2G2ZA 3BF1A 2YPZA 2UUCK 3M2RA 2HGLA 4XA5A 1JLFB 4QJVA 2JH1A 3CQYA 2M7SA 1JMTA 4YMNA 1NGCA 3SPZA 2GVDA 3OYFA 1N36F 2ZDPA 2C1EB 3CJBA 4AXJA 5AXKA 2E1FA 2MZJA 3DRPA 2D9OA 7ICQA 2K06A 3JQMA 1VAZA 1BPXA 1RT2A 1R89A 1N0UA 1PC5A 4LBIA 4DL2A 2HIQA 1SXDA 4P72A 1D5AA 3F2KA 3E51A 2HFOA 2PMWA 1KQQA 2XSJB 4KHWA 1OSCA 3BSAA 4KB0A 1RT6A 4CHNA</