1U47A

Cytosine-8-oxoguanine base pair at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u47A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u47A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u47A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u47A01
1S9GA 4TUQA 5D46A 3HSTB 4FLUA 1RT5A 3Q8SB 3QEWA 4BE2A 3B6OA 4ECRA 3PW4A 1JX4A 5CJ7A 4NLNA 1HUZA 3RJEA 2XY8A 3OYFA 1J5OA 2VWJA 1S0MA 3CQ8A 1Z00B 1JXLA 4UAYA 4IFYA 4MFCA 3P83D 5DQIA 1K1SA 1N56A 2GV9A 3OGUA 3C6UA 4CJEA 1GOCA 2AU0A 4M3XA 2YNGA 4DF4A 5HHHA 2VG5A 3OYEA 2KW4A 3V7KA 4OKJA 4M45A 3NGYA 3JPSA 1ZYQA 1L3SA 5J0QA 4FJKA 3ZSZA 4CHYA 3C6TA 4Q0BA 4NYNA 4DTMA 2G8IA 2VWKA 8ICEA 3AA2A 2HHQA 4P4MA 1CXQA 3MEDA 3QEPA 4IR9A 4GW6A 1GOBA 3D45A 1ZQQA 3VQ7A 5KFBA 1HQEA 4FZYA 5KFMA 3GQCA 3KHGA 2C28A 1RT3A 1SKSA 4YFUA 4I2PA 2P5OA 4M9HA 2HW3A 4DOAA 3AVCA 4LY7A 5EWEA 3IM1A 5HLFA 1ITGA 5CZ1A 4CF1A 2E4LA 3AA4A 1S1WA 2YHBA 3Q8QB 4BXOA 2XY6A 4O4GA 1ZBFA 1W9HA 4M3ZA 3UQ0A 3ORYA 2HHVA 2IHMA 9ICEA 2IHNA 5J2DA 3GV5B 1TKZA 4DQQA 1KVAA 4IG3A 3GFKB 3UXOA 3KK3A 3ISBA 3RB0A 1ZQWA 9ICHA 3VQ4A 3K5NA 2GWSA 3UXNA 4RQ2A 4O9MA 3IG1A 4AHVA 5DQGA 4M3YA 3OS1A 5KFTA 4KLSA 2DY4A 1WSGA 3E01A 8ICCA 2UVWA 3LWLA 5J2GA 1ZQHA 4IRCA 1QE1A 4QZCA 1RBSA 4FLZA 3C95A 1MQ2A 5CB1A 4YMMA 3O3FA 1WSFA 1REVA 3V6DA 3SQ4A 5CWRA 4Z0UA 4G3IA 4CJQA 3ISCA 4JUZA 4QZGA 4EYHB 3HT3A 3RRHA 2BCRA 4JLHA 1QQCA 5J2CA 1TL1A 4FJXA 1B9DA 4FW1A 4KKOA 4PGXA 2WTFA 4K4GA 2ITGA 4CGGA 1KLNA 4BXOB 4JV0A 2DFFA 2ZD1A 3NH2A 4QZDA 3U3YA 1A76A 3MXJA 2MUTA 9ICJA 4RQ5A 1KFTA 3KLHA 4N47A 4K8XA 3EY1A 3HYFA 5BOLA 4W5OA 3AVJA 1J53A 2DPIA 1A77A 2KZZA 4DSIA 2NRXA 4O5EA 3V1OA 3LDSA 1RILA 1ZQBA 1S6PA 3EW9A 4UAZA 9ICKA 1NK5A 1NOZA 5CP2A 4FM2A 1ZQKA 8ICPA 4BDZA 4CJUA 3V9ZA 4RW4A 2OZMA 4EP4A 1SZPA 4HHTA 1DGSA 1JN3A 3BGRA 1CLQA 3LANA 4DTJA 3UXPA 1HJPA 5J0OA 4CJ3A 3RRGA 9ICQA 3K59A 3OYMA 4JWNA 4I2QA 8ICNA 2WOMA 1ASUA 2ASJA 3CM6A 3L3VA 1U45A 2YNHA 3K4GA 3IAYA 3WNEA 3HL8A 4FXDA 3AVKA 3BQ1A 4YVZA 2XGPA 3ZCMA 4KLEA 2MUTB 5J0YA 4Z4CA 5DBBA 1B43A 4M3WA 4FJGA 3QEBZ 2BANA 3S3NA 4R65A 4Z4FA 3T5JA 5IINA 1UT5A 4XRHA 4DS5A 4KHQA 1IKWA 1WAFA 3MR6A 4J9SA 3RMAA 2UVUA 2Q3SA 3WNFA 4FM0A 3QEVA 2VANA 4GVMA 1VRTA 3GIIA 3GV7B 1ZQXA 3MBYA 4JWMA 1YTUA 4HUEA 1PZNA 2R8JA 3NH0A 2BCVA 3RJHA 1VSLA 4O3OA 4YXMA 2D0BA 4KFBA 4I29A 2NRTA 2PFQA 4DFJA 3QEIA 4DTUA 1Q9YA 4DS4A 3ZD9A 1X9WA 4FJ8A 4MEYA 3QO9A 2F1IA 1TAUA 4ZTJA 2W9CA 4RW8A 1L3UA 2HNZA 3QEXA 4DU4A 3PX6A 4B9SA 1FXXA 3M9OB 4CIEA 4ELUA 1K1QA 4DTSA 3KLIA 1C6VA 4LZGA 1JXBA 4RQ0A 1CZ9A 4DG1A 5KFNA 3LP0A 4Q5VA 3AVMA 4CGHA 2BGGA 3H4BA 5KT7A 4UBCA 4J9MA 1LV5A 3GILA 4N56A 1BI4A 3SI6A 3T5HA 4PHDA 4FJJA 3RH6A 3L2UA 1NOYA 1ZQMA 4PUOA 2PXIA 3NCIA 4Z4GA 3NF6A 3V6KA 1ZJNA 8ICBA 2FC0A 3ZDAA 3PR4A 3QE9Y 1C0UA 4FS1A 3V9XA 1FKPA 4B9LA 3THVA 3NF7A 1BPXA 3Q8KA 3I8DA 4FZZA 5KG0A 5J29A 5FDLA 1TKXA 2W9CB 2KTQA 5HRNA 4CJFA 7ICLA 3RH5A 4LVSA 1RTJA 4RQ7A 5KG6A 3K2PA 4F91B 2FLNA 9ICFA 3AVLA 3MXMA 5BPCA 2XCAA 4Y1DA 4GMJB 2HNDA 5KFXA 4FLWA 3AO2A 4ELVA 4CERA 1X1PA 4OGCA 5KFZA 4Q43A 1HQUA 4DEZA 4KLMA 1BI4B 3VQ5A 4FS2A 4B8AB 3VQEA 4EBDA 2IGIA 1JLBA 1EXNA 1UA1A 4ED6A 1WSHA 4MF8A 4HCBA 2ZJ5A 3TI0A 2C2RA 1KDHA 2JGUA 4PGYA 4RG8A 5HP4A 1BCOA 2H5XA 5D49A 3TAQA 4EP5A 8ICRA 4LSNA 9ICUA 2KZ3A 5KFYA 4QZBA 4FZXC 2ALZA 4M3TA 3QEAZ 4UB5A 3LK9A 4O3SA 5DB7A 4PWDA 1AROP 1EXQA 4HTUA 3P1GA 9ICIA 5KT3A 4FLXA 4RQ8A 1U04A 2F1HA 5CZ2A 2OA8A 3SPZA 4J9QA 1COOA 1NJZA 4ID1A 1QS4A 3OYIA 4YD2A 1ZQFA 3RTVA 3Q8MA 4YFKA 4RQ6A 4TUSA 4JRQA 4E89A 2DFHA 2XRIA 3IHQB 2B6AA 4F2RA 3V81A 3QZ7A 8ICXA 4M04A 2BDPA 4CFDA 3AO1A 3HVRA 4DTRA 3H8JA 4TQSA 3SYZA 3G10A 2W9AA 1ZBIA 1BL3A 5FRNA 1RCHA 5KG2A 3ZDBA 2P51A 3OYGA 4FJMA 4EYIB 4GC6A 3AVIA 4OGEA 2YHAA 1T05A 2JZBA 2ZUDA 5HRRA 1KEJA 2HB5A 8ICQA 4H4MA 4PHEA 4YN4A 1T8EA 3LZIA 1RYRA 1NK9A 4K4HA 1ZQAA 1WSIA 1BPYA 3B6PA 4P4PA 4YR3A 4M0AA 9ICTA 4W5QA 3WNGA 4CEDA 1ZQPA 1HNIA 3LAKA 3JPTA 1RT6A 5KFGA 2AGQA 3NE6A 4DL5A 3C5GA 3AO3A 4RUCA 3G6XA 4M47A 3KIOA 3RWUA 5DG7A 2ATQA 3OYHA 5DGBA 1WSJA 3C23A 1BISA 1T3NA 1LWEA 3ZT3A 1ZQDA 1J54A 2G8WA 2BE2A 5HMLA 2ETJA 2KFZA 5SZTA 3QETA 4DL4A 5KRTA 1S1TA 1TFRA 4TUPA 4M9NA 4AHSA 4FYDA 4F8RA 1TK0A 4I2BA 5KFIA 1XC9A 4K8ZA 2FBVA 1D8LA 5KFDA 4NY8A 2Z1GA 1S0OA 1YTAA 4DSFA 3TAMA 3T1AA 5J0XA 4IRKA 3V9SA 4FJHA 1BPDA 3OSPA 4H8KA 2JEGA 4NCAA 2AGPA 1LW0A 4Q45A 5EU7A 1IG9A 1XSNA 4QZHA 1ASVA 4CFBA 2JZBB 1IKXA 4E1MA 4O0JA 3LP1A 5KFKA 3HVTA 2PI4A 4O44A 3PX0A 4N5SA 4R8UA 4KI4A 3SV3A 2VA8A 2IC3A 4KHUA 2OPPA 2HVIA 4E1NA 3AU2A 4F5NA 3CFPA 9ICLA 7ICIA 5J0RA 4JK1A 2XC9A 2PZSA 7ICGA 1WLJA 4RNOA 3DRPA 3M8PA 3ITHA 1DOQA 2P5GA 1ZJMA 4UB4A 4ED3A 2UVRA 4DSLA 2HHXA 4O5KA 4IRDA 4AHCA 2F8SA 5C42A 2X6SA 3C1ZA 2DTUA 4DSJA 1TVRA 3KLEA 1UT8A 3TARA 4ZHRA 4ECQA 3L8BA 4QWBA 4OKEA 2FLPA 4UB2A 3V7JA 5KG4A 4RW9A 2J6SA 4YXJA 4CGDA 4QOZB 3QERA 1WNSA 5IIMA 4FLYA 1IM4A 3TAEA 5CR0A 3ZT2A 3V1QA 7ICTA 3C5FA 4KTWA 3ZSOA 9ICPA 2E6MA 2IBKA 2AJQA 2ZQBA 5D3GA 2P66A 4CGFA 4B9VA 4R8UB 4KHNA 5BOMA 3K75D 1S6QA 3I0SA 5J2MA 1X9SA 1DTQA 3MDCA 4KLHA 5DDYA 3VA3A 1S5JA 5DDMA 4B3OA 3WNHA 4FK0A 4IBNA 4JS4A 1IKVA 2IAJA 2PY5A 2YKNA 4YD1A 4EBEA 3SUOA 3LZJA 4DU3A 4DLEA 2HHTA 3OJUA 1IKYA 1TKTA 1CXUA 5J2QA 3NGZA 4GXJA 4NCBA 3OYAA 2HHWA 4CCHA 4KTZA 4RNNA 5JS2A 3AVAA 1N5YA 2ZJ8A 3ISNC 3RB3A 4RW6A 3RH4A 4CJTA 2FBYA 3OYNA 4AHRA 3L2VA 4KLUA 4KAZA 2RF2A 3GIKA 3B0XA 1KLMA 3QNOA 4FJ9A 7ICSA 1HJRA 4F5QA 3DLHA 3JPOA 2ASLA 1HYSA 4M42A 5KT6A 4CEOA 2P6RA 4HCCA 4UBBA 5KFSA 2Y1IA 5HHIA 1NK7A 4BWMA 1KVBA 4DTPA 3M8QA 5J0WA 1BVSA 5C5JA 4YQWA 3GIMA 4CF8A 3VQBA 1ZQTA 2OZSA 5KFRA 3KK2A 4DTNA 3M8RA 4B9UA 4CJSA 2FPMA 3OYDA 3G6VA 2HHSA 3FYHA 3DOLA 3HPGA 4PQUA 4O5CA 1S76D 4KV8A 4CK3A 4NLGA 2RDJA 1XU4A 1HPZA 5CYMA 1ZQOA 1EKEA 4M41A 3OYBA 1S0VA 4K4IA 3JYTA 3RBEA 1RYSA 4GXIA 3TQ1A 1T4GA 3ZDDA 1BHLA 4C8LA 3V4IA 4J9NA 3C94A 1TAQA 4CJ4A 3V7LA 5HP1A 4F5PA 3NH1A 3DMJA 2HVHA 1UWBA 4ZH4A 4O3RA 4DFKA 1T03A 3OY9A 2UVVA 4C8MA 3RJKA 3ZD8A 2ZUBA 1ZETA 4QZIA 4W5TA 9ICSA 8ICTA 5JS1A 1N48A 4ED1A 3C2LA 3SUQA 2F8TA 2A1RA 4GC7A 3MFIA 3RJIA 4FO6A 4DTXA 1HYZA 2ATLA 4BE0A 4EZ9A 4P4OA 3GDXA 4BGDA 2XY5A 1L3VA 4ED2A 2AGOA 4Z4HA 5CY4A 4ICLA 4I2HA 1BIUA 2J6UA 5DG9A 1RPLA 3BQ0A 4CE9A 4J9LA 2X6NA 1ZBLA 2ZTDA 3TWHA 1EX4A 2QXFA 1RBTA 3IS9A 1LWCA 4R5PA 2D0AA 3PMNA 2RDIA 1QSYA 4KB1A 2ISPA 3LDAA 4RPYA 5J2EA 3MGHA 3JPPA 3LP3A 4J2AA 4WE1A 2RPIA 1Z26A 2OWOA 3OS0A 2IOCA 3V72A 1ZQLA 2QKBA 3PW7A 5KFVA 1RBVA 4FW2A 1KSPA 4C8KA 4FBUA 4FLVA 4Z6FA 3V1RA 4I7FA 3N4MB 1CZBA 4QZEA 3CM5A 5I3UA 4J2DA 3SI8A 4M3UA 1VK0A 1RDAA 3ZSRA 4I27A 5DQHA 2B4JA 1L5UA 7ICPA 3PO5A 4UAWA 4QZ8A 8ICSA 2EHGA 1GOAA 3H40A 3OS2A 3MAQA 5IIOA 1BPZA 5L9XA 2W8LA 4W5RA 2BKEA 4JRPA 3RMDA 4CF0A 2PYJA 4J2EA 1NJWA 4KLDA 2VA2A 3OJSA 3A2FA 1SKWA 4CGJA 3LWMA 3SUPA 3B0YA 5DMRA 4QWAA 4GLXA 1XI1A 4I2FA 4RZRA 1VSKA 3BJYA 4CFAA 7ICKA 2W42A 4QWEA 1RXVA 2I5JA 4FBTA 3HP6A 1EETA 3DLEA 4TURA 4R66A 1JLAA 4RPXA 4DSKA 2FMSA 3G0ZA 3RAXA 2ZUCA 4IQTA 4PPXA 3F73A 4MFAA 1S77D 4OKKA 4KRFA 1I39A 4M6WA 1C1CA 3MFHA 3BQ2A 4F50A 2YNIA 4F93B 4XQ8A 1VSDA 5HMMA 5L1JA 4CJVA 1ZQIA 1ZQEA 4CJKA 5KFHA 1UAXA 4I2IA 5DB9A 3DLRA 3HK2A 1MSWD 4DL7A 4CFCA 3K57A 4RUAA 4NXZA 7ICRA 1LAVA 1ZQCA 1LW2A 1RT2A 3ISDA 3AVGA 3PVXA 1X2IA 3NHGA 4UQGA 4KLOA 3SNNA 4I2CA 2GUIA 1WCLA 1RDBA 2C2DA 2G8VA 4BE1A 3HP9A 4KLQA 8ICWA 4J9PA 2IS3A 1VSJA 1KCFA 3KTQA 1XSPA 2F96A 3H8WA 1JLQA 2PFNA 2FBXA 4E7IA 1MQ3A 3KD5E 4PA1A 4I9QA 5DB6A 4CEQA 4KLGA 2DFEA 5F9NA 3LP2A 2HNYA 4KI6A 4KB0A 1SV5A 4F4KA 3OVNA 1KFDA 1BPBA 4CJWA 4M6WB 2BCSA 3OHBA 3EPGA 3S3OA 3D0PA 2Z1JA 4IDKA 4DL3A 3C2KA 1WN7A 4ID5A 3AA3A 4F5RA 2C22A 3PO4A 4FJNA 3LPTA 3QLHA 1VRUA 2Q0ZX 5L1KA 3NDKA 2R8KA 4KLIA 4MFBA 4UB3A 1W0HA 4OPJA 4E0DA 7ICVA 2G8KA 3EPIA 2KQ2A 3U6FA 1S97A 3V6JA 3Q8LA 3M8SA 3CYMA 3KLFA 4ECZA 3L3UA 1IH7A 3I0RA 1HNVA 4LH5A 4F4XA 3EYZA 3ZT4A 5J2FA 3JPRA 3F9KA 5KFUA 1B22A 1U48A 2BCQA 4I2GA 3FFIA 2BPGA 5FROA 1LAWA 1NK6A 5KG3A 2JLEA 4ECWA 4Q44A 5J2NA 3QIPA 4O3QA 3DYAA 4CIGA 2IA6A 3OYKA 3PY8A 3HXMA 1KVCA 3BDPA 5DBAA 3AVFA 3DRSA 3KHHA 4CHOA 1S9FA 3AUOA 3VN5A 3TAGA 2OPSA 3FDSA 1VSHA 4DMNA 4YG2A 4IQVA 1NJYA 2LYHA 4IQUA 3RR7A 2IDOA 2Y1JA 3ETLA 3MDAA 5C25A 5KFLA 3RB6A 1CUKA 8ICOA 1LB2B 3ZSVA 4LD0A 1C1BA 1RT1A 4Q8EA 4KN7A 3SV4A 4DQPA 4CEZA 2HMIA 1RZTA 4DQRA 5CA7A 4UB1A 2BPFA 2V9WA 5SWMA 4CESA 2RN2A 3H4DA 4HYKA 3AO4A 1VSEA 1RT7A 4DU1A 3ZT0A 9ICRA 3KHLA 3K5MA 5KFEA 5KT2A 3HO1A 3AA5X 1RT4A 3HM9A 1SL1A 1QHTA 7ICNA 1Q8IA 4O0IA 2OPQA 3RMCA 7ICUA 4M3RA 3AO5A 1QSSA 4N41A 1IXRA 3GIJA 3DLKA 4HUFA 1JL2A 1Y88A 4B9MA 3Q8PB 3V9WA 4PHAA 1R0AA 1TVAA 1HUOA 1RTIA 4ECTA 3OYJA 5KFPA 1T7PA 2X78A 3TFRA 4DF8A 1JLFA 5TZVA 4ECVA 3QZ8A 2P1JA 1ZQUA 3QIOA 2G8HA 3MECA 4DFPA 4DOBA 4RQ1A 4FJ7A 1KRPA 5FRMA 5J2HA 1ZQZA 3AVNA 5DLFA 3JPNA 1BGXT 5KFFA 1NKCA 3MXIA 2FPKA 4KLFA 4FJIA 3AV9A 7ICEA 1IO2A 1JL1A 4PHPA 4CF2A 4RT3A 2ASDA 3DLBA 3ZSXA 1ZQVA 4C8NA 4YP3A 5KRSA 5J2KA 4CF9A 3KK1A 4FK4A 4BDYA 4CIFA 4EZ6A 4DO9A 1ZQYA 1A5XA 3C1YA 4IQWA 4CECA 1ZBUA 3RJJA 5J0SA 7ICMA 5IILA 4FK2A 1TV9A 3RB4A 4F92B 2R8IA 3KHRA 4I2JA 2BPCA 4KITB 4FJ5A 4FCYA 3MR2A 4QCLA 4RQ3A 3SQ0A 1RNHA 3O3GA 3PW5A 9ICMA 8ICMA 3NAEA 4DQIA 9ICNA 4NLKA 1NK0A 4OPKA 1U49A 4M9JA 5L1IA 4XIUA 4NYFA 1NKEA 3OYLA 4I2DA 4RNMA 3DLGA 3NF8A 2M9NA 3SQ2A 7ICQA 3MR5A 4KO0A 4QW9A 2AQ0A 1F21A 2R7YA 7ICJA 1ZBHA 4JV2A 2B21A 1HYVA 1NK4A 4RPZA 1S1UA 3OSNA 1N6QA 4QZAA 4CK2A 1D9DA 4BACA 4O3NA 1TK5A 3NTUA 4QZ9A 3N97B 1TKDA 5DGAA 4CHQA 3VQAA 5KFCA 3EWAA 1S0NA 3SUNA 2G8UA 4DWIA 4M9GA 4L8RB 4J9OA 4AHTA 2FLLA 3HPHA 3K5OA 8ICFA 1JLGA 4JV1A 3KD1E 3P5JA 4CHZA 5DLGA 5EOZA 5HNKA 3M9NB 4LSLA 4NLZA 3CG7A 7ICFA 4CJRA 4Z6DA 3TR8A 3K58A 4DLGA 2JEJA 5HRPA 1S1VA 3SJJA 4KHYA 3MR3A 4RU9A 1VSMA 4CEFA 3AVBA 3CFOA 8ICVA 1D9FA 4YNQA 3SZ2A 2G8FA 3EZ5A 1C1AA 4CHPA 2BGWA 3LAMA 4DOCA 4F4YA 8ICZA 2BQUA 5KG5A 1BQNA 2BCUA 3ZT1A 4J9KA 2NRVA 9ICGA 2XHBA 9ICAA 4HUGA 4ECYA 4QWCA 3ZSYA 5J0UA 4NM1A 3DOKA 4CK1A 4MFFA 5CHGA 2ZTEA 5DG8A 3PW0A 3RR8A 4N76A 4I2AA 1QTMA 1UOCA 5KGXA 4C8OA 4EEYA 4TQRA 5C24A 5J2IA 7ICOA 3OHAA 1XHZA 5J2JA 3UQ2A 4FM1A 1D8YA 1MC8A 4F3OA 4CEAA 3VA0A 1BPEA 4KLLA 3TAFA 5DK5A 3G6YA 1NJXA 1RBUA 4B9TA 1KFSA 4GXKA 3LPUA 2KN7A 3MGIA 4Z4EA 2JEIA 2Z1IA 1J9AA 1C0TA 1DTTA 1V9PA 9ICWA 4PY5A 4XUSA 1RDCA 4CJLA 3K5LA 9ICVA 5J2AA 4YR2A 2ISOA 4MEXA 2C2EA 4MF2A 4IFVA 1XO1A 4RT2A 1VSIA 2A1JA 4PGQA 1H38A 1B9FA 2FMPA 1ZQJA 4I2EA 2VG6A 2PFOA 2WONA 2YV0X 1A5VA 5J0PA 1K6YA 3DRRA 2KFNA 1U9LA 4B9NA 5IIKA 4O5BA 3ZSQA 3NBPA 4RQ4A 2EX3A 3M9MB 5KT5A 3UIQA 4ECSA 1U47A 4YCXA 2D5RA 8ICAA 4QWDA 2MAXA 2XCPA 4KHSA 2I1QA 1HMVA 4OVLA 1ASWA 3KKSA 4OLAA 2E6LA 4FJLA 1YT3A 4CEBA 2P6UA 5IIJA 4KLJA 3KJVA 5KTQA 3C2MA 3PX4A 4ED8A 2O4GA 8ICUA 1YVUA 3HX0A 3V9UA 1JLCA 2V4RA 5HRSA 2FPLA 2YNFA 1UA0A 1XWLA 2KZMA 2BQ3A 3HWTA 2BR0A 3VQ9A 5KFOA 4DSEA 2PFPA 4ED7A 4Y1CA 3L2WA 3HJFA 1TV6A 1FKOA 4CHNA 1B92A 1Z25A 1EP4A 3T19A 1G15A 4OJRA 4AHUA 4EBCA 1S9EA 3RBDA 2ZTCA 9ICBA 5J1EA 1LWFA 3L2QA 1SKRA 4QAGA 3O4NA 1WAJA 1U4BA 2A1JB 4J2BA 1Q9XA 3TABA 3NGDA 3ZDEA 4F2SA 5T7BA 9ICCA 1SUQA 4KREA 3VQ8A 3ZSWA 5KFWA 8ICIA 2W8KA 1ZQNA 5KI6A 5EWFA 1RBRA 4F4ZA 1JIHA 5J0TA 2I9GA 3H7IA 3Q8RB 2Z1HA 4W5NA 2V4QA 3H8SA 1I3AA 1NKBA 2JEFA 3SPYA 3ALYA 3NFAA 8ICGA 3O3HA 2HHUA 2OYQA 4E3SA 5J2PA 4R63A 5KGWA 1TK8A 4DTOA 4AH9A 1XHXA 3LALA 5E41A 3S9HA 5JUMA 3SQ1A 2GBZA 3MABA 5EWGA 3H08A 5KG1A 2FBTA 4LZDA 3NF9A 8ICJA 4E7HA 1S1XA 4AILC 3L2RA 3AU6A 4M2YA 4I9LA 4E7JA 4YR0A 4ECUA 4HVJA 4F5OA 1SL0A 2AQ4A 1NK8A 2B5JA 4I28A 1FK9A 3PNCA 5I42A 1BIZA 3TFSA 5HBMA 2D0CA 2FMQA 2R8GA 4LH4A 4DQSA 3PMLA 3ASMA 3QESA 1WCNA 3DI6A 4QZFA 4ELTA 3TAPA 4IG0A 3VQCA 1HRHA 4DL2A 4KTQA 3E2EA 1ZQSA 4Z6CA 3V6HA 3PR5B 4OLBA 3IRXA 3RJFA 3C21A 2IMWP 8ICKA 4QW8A 1RTDA 4BDPA 5F9LA 3MEGA 2NUBA 4FLTA 4H4OA 3HPOA 5KFJA 5J2BA 3MEEA 4NCGA 1QSLA 2YKMA 2QK9A 4NM2A 4KMUA 3RJGA 4KLTA 1JMSA 1Z3EB 4BWJA 4ECXA 2ZE2A 4R64A 4FVMA 7ICHA 3QINA 3O4QA 3TANA 3JPQA 2LSNA 3VQDA 5L1LA 2XO7A 1JKHA 5D4BA 2ZJAA 1RDDA 1TL3A 1A5WA 4E7KA 3SCXA 1O1WA 4Z4IA 3T5LA 2XY7A 8ICYA 1BCMA 2QKKA 5KFQA 3ZDCA 1JLEA 4O55A 3OYCA 3CFRA 2W9BA 3RMBA 4ZTFA 9ICXA 2DFLA 4B8CA 2J6TA 1JXEA 2PI5A 2A1SA 3U3GA 3RAQA 4Z6EA 1C7YA 1Y97A 1VSFA 5DBCA 1BQMA 2PYLA 2X74A 4M9LA 2BHNA 4PH5A 5KT4A 2XGQA 1ZQRA 5K14A 1D5AA 4RW7A 4Q8FA 3S3MA 5IIIA 1RXWA 3GV8B 4YMOA 2BQRA 4CJPA 4CEEA 4MQ3A 4F4WA 1SL2A 1L3TA 3ULDA 1C0MA 3PV8A 2VG7A 3VQQA 3PUFA 5DKWA 5HROA 1QLNA 1Z00A 4B08A 4J9RA 4E19A 1RTHA 1ZQGA 1MU2A 3VQ6A 1NOMA 4ED0A 2F1JA 4F3TA 3T3FA 3BQTA 4KN4A 4DL6A 2O4IA 4X5VA 3JSMA 4E7LA 3KKRA 4DFMA 1XSLA 5KG7A 4JS5A 3KLGA 8ICLA 1TGOA 3AVHA 4KHWA 4XA5A 3PW2A 1WSEA 3VQPA 3NGIA 4YMNA 2W9BB 2NRWA 8ICHA 1XS9D 5DB8A 2VA3A 5KFAA 4IKFA 3UPQA 2R8HA 1S10A 3HW8A 4CGIA 3QNNA 2W9MA 1X9MA 3T5KA 4IR1A 9ICOA 2OPRA 3DM2A 4G1QA 5CYQA 2RKIA 2NRZA 1KTQA 1CEZA 2DPJA 4TSXA 4P2HA 4CJ5A 4O3PA 4KPYA 1DLOA
chains in the Genus database with same CATH superfamily
1S9GA 3D7SB 3JB9k 4P72A 3HSTB 2E5IA 3Q8SB 4YEAA 2BACA 8ATCB 5A2QU 5CRXA 1JX4A 5CJ7A 3RJEA 1VI7A 2N4DA 2XY8A 3OYFA 4OZNA 1NB2A 2BM1A 1QCKA 4HHJA 3GIRA 1HBOA 1N8RT 1X66A 1SV4A 2RJZA 4MFCA 2IVFB 4HDGA 2D41A 1RTHB 5DQIA 5LJ3Y 1IXKA 3DDIA 2I1RA 2GV9A 1KHWA 1PAUB 4WFAQ 3EX7B 3QRQA 4ERDA 1SXEA 3C6UA 2OEJA 3QSIA 4M3XA 3GP9A 2YNGA 5HHHA 4O8KA 1FJ7A 4YY3K 1ZAWA 3ZETB 3JPSA 3SFUA 1YJNS 5AKJA 3OL9A 2ZJRL 3OBYA 4FZLA 4QJFB 4ITSA 4CHYA 4CLYA 2KRRA 2DXEA 5LJ5Y 2DGQA 2VFRA 4PYDA 2YJFA 4DTMA 2OH2A 2OPRB 2HHQA 2OLWA 4HACB 4DV3K 4LFCJ 2QWNA 2QN6B 2O8FB 5A2QO 1K73O 2E1YA 2UUBK 2C2ZB 3H0PA 1SKSA 2QE5A 3NVVA 4F04B 1J5OB 4M9HA 2QLFB 2HW3A 4DOAA 1IBMF 1UZDA 3VEVA 4YOTA 3HVAA 3G71S 5AI6A 2ZITA 4DV4K 2E4LA 1T3OA 2VBXA 1S1WA 4E8UA 4AQYF 2YHBA 4X66K 4O23A 4BXOA 4N8NA 3A5NC 2PMZC 1T9XA 1ZD5A 1P8GA 4M3ZA 4LFBF 2R9LA 3MX5A 4OJOA 9ICEA 3AGRA 2FIUA 2HYIB 2EC0A 2JDJA 3ONQA 4ZVEA 2DL0A 3GV5B 1TKZA 1DQ9A 3ITHB 6FD1A 3KK3A 3ISBA 2HBJA 1MROA 3PZPA 9ICHA 1NM2A 3PEJA 1Z05A 2J9CA 1IBLF 4O9MA 2AP6A 3P4IA 1B4FA 4F67A 4Y00A 4M3YA 2RP5A 2KEYA 1WSGA 3E01A 3MEDB 4R79A 1NGBA 1G99A 4QZCA 2BJEA 3BO4A 4XO0A 1HQEB 3CDAA 2BJDA 3V6DA 4G3IA 1JNZB 3ISCA 4KGMA 4M5HA 3U1LA 5ETSA 3HT3A 2BCRA 2QWPA 3THXB 4RQNA 1S6QB 1K0TA 4USWA 1RZMA 1IJJA 4H5WA 1FRIA 2DBYA 1NEEA 2CUYA 1NGFA 4K4ZA 2DGOA 2MQQA 4TYAA 4JV0A 1UTAA 4QZDA 2AIRB 9ICJA 4RQ5A 2BUPA 3EE8A 1C4AA 3AQEA 1IKYB 1TKTB 1RLCL 3A0HU 1WUAA 3AVJA 4WK3A 4P7VA 3SSRA 4C8YA 3MCNA 2KZZA 2MDAA 4JYAJ 2ASYA 1Y0HA 4O5EA 3V1OA 4RBVA 1UQVA 2MKHA 1N5YB 3PM9A 3EW9A 9ICKA 4RW6B 2ZJPL 2V8VA 2OYYA 5E79U 3NKYA 2HEKA 4RW4A 5K8NA 4EP4A 1TE2A 3F5AA 2GW8A 4CZKA 3I9V9 4HHTA 3BGRA 3FZHA 2HGMA 4RPFA 4GKJJ 4PAAA 1CLQA 1REVB 4GKKK 3GE9A 3K59A 4JWNA 2HOFA 4H5VA 1DGKN 1HNXK 2JC0A 2P9NA 2DK2A 4L3NA 4QQBA 3L3VA 1U45A 4ZCLA 1ZXOA 4OHXA 3MPYA 2YNHA 4G1IA 3WNEA 3LGNA 3D0HE 3MDFA 4FXDA 3AVKA 2KICA 3NVKA 4YB1P 2MUTB 2BW7A 3M1YA 3NS1A 1Q8LA 3OD2A 3LPEA 3NVWA 3R1XA 4XRHA 4KHQA 1S6PB 1IKWA 1WAFA 3MR6A 4J9SA 1YIJN 5FLXU 3I56S 2FI1A 2QZ8A 2HHHK 4B3MF 2RB7A 4KH5A 4UZBA 4HT7A 1TUUA 3GV7B 2IRUA 5AK4A 2QFIA 3FGVA 3WK9A 1KDNA 3R1LA 1PZNA 5M1KA 4K7QA 1VSLA 3NH0A 2D0BA 4KFBA 3MM8B 3D9BA 1H73A 1RWOB 4DS4A 2KIVA 1SIWB 2R7TA 4BR9A 4PZNA 1XNQF 1S7IA 1X9WA 3UB5A 3CJ0A 4ANDA 2BYCA 5A2QY 2HNZA 2Q6CA 1HX1A 2CPHA 1FXXA 2P9SB 1K1QA 4NLDA 1ZH5A 4LZGA 2D1KA 2COLA 1JXBA 1PJ7A 3AVMA 2P35A 3TRGA 4LF4K 3HJEA 2VV5A 4UBCA 4J9MA 1LV5A 4N56A 1BI4A 3CD0A 2NPFA 2XWYA 4PHDA 2PBDA 3KG1A 3L2UA 3ZTRA 4BHQA 3VTIA 2RQMA 1AZSB 3M2UA 2PXIA 4ZMMA 4Z4GA 3AQOA 3CPWR 5E33A 4WJ3B 1PJ5A 2Y3YA 1VHXA 3B54A 5CEHA 4DR5J 2KJVA 3VAJA 1TYQA 1VQ7S 2GQQA 1ZS6A 2Q4TA 4B02A 4NL9A 5M1OA 3CCVN 3B9JA 2GMJA 2ZVIA 4N7TA 2P9KA 1X4HA 3CULA 2IFXA 3L4PA 3QO9B 1YITS 3K0SA 3R9PA 2MKYA 5ETPA 2KTQA 1RWUA 3RH5A 2BE7D 1RTJA 1WC3A 2QMUB 3T6JA 4ZVRB 2PE8A 4AYBF 3QJJA 3KLIB 9ICFA 2G2ZA 3RF9A 2R2TA 1SC4B 2QB0A 1A6SA 3LP0B 4CERA 1NAQA 1FNXH 5HL7L 1HQUA 4DEZA 3CIPA 3I76A 3C2PA 4FS2A 3PSFA 2RAQA 2HBZB 4IOXA 5ALJA 2M2BA 3VQEA 2E7VA 5GADP 3BPSP 3QJLA 2ROGA 1EXNA 3GOIA 1UA1A 1RG6A 3DAWA 1S22A 1KDHA 2C2RA 1GX5A 3LH2S 2A10A 4PGYA 1XNRJ 2UUAK 2KYXA 4URSA 1BCOA 4Y2UA 4ILRA 2H5XA 5D49A 3TAQA 2O66A 4EP5A 4K5RA 8ICRA 1KWMA 3A3PB 5GAGI 1SXDA 3G25A 1PK1A 2MGZB 4M3TA 1ZXIA 4UB5A 4WZMA 1QQ5A 4U8VA 4PWDA 1FFUA 5GTIU 4ACOA 2A3JA 2ZZNA 3MM6A 1Y9OA 2F1HA 2HIQA 1AW0A 5CZ2A 2RD5C 1COOA 4YHHJ 4C97A 1ZQFA 1Z4OA 3AY9A 4RQ6A 4WJBA 4F4AA 1U7LA 4JI3K 2DFHA 1S6OA 2HNDB 4F2RA 1PBUA 3DXMB 4IFEA 3TEHB 4U9RA 4C2MA 4LC9B 2M70A 8ICXA 5HMXA 2R7RA 2BDPA 4CFDA 5ALSA 1WOOA 1NBWA 3C66A 3CJRA 4ER8A 1JNRB 2UUCK 3H8JA 3SYZA 5FRNA 3A3OB 2VQFK 3BGLA 1R3NA 4WQ5C 5KG2A 2ZHBA 4KHRA 1VBXA 3AVIA 5BR8K 1T05A 1SZ2A 2ZUDA 5AXLA 1KC8T 2XI2A 2XI9A 8ICQA 2YHWA 2YY3A 1JQGA 3D66A 3LZIA 4US9A 1YI2N 4Y34A 3T1YK 4DX6A 2K7KA 2NZTA 4UTGA 2PC6A 3CCQN 1F0MA 3OR2A 4K8RA 3CMAN 1RT6A 3KJNB 5KFGA 4KYZA 5JMVA 4NLUA 4J9UE 3VGSA 3AO3A 4RUCA 3MMBB 2Z58B 3G6XA 1U2VA 1HR0K 5BYRA 3E66A 2LXUA 5DGBA 5JXSA 4JI2F 3C23A 5ITHA 3C14B 4NL5A 3E51A 1BISA 4YDUC 1LWEA 3ZT3A 1ZQDA 2DGVA 3AHPA 2BE2A 4A8YA 2G8WA 2DGSA 3UFCX 4K4XA 2ETJA 2KFZA 4DL4A 1S1TA 3SIPB 3AN1A 4AHSA 1TK0A 1U0SA 4I2BA 2DNPA 2W24A 1QY7A 1D8LA 5D4OA 3IBCB 2LM1A 2Z1GA 4DSFA 3AMZA 3T1AA 3WDOA 4DR2J 1BPDA 3OSPA 2JNJA 3KVGA 2YX6A 2VD3A 1HHTP 4NCAA 1LW0A 4Q45A 4X64F 1XSNA 4QZHA 2PGCA 4OQJA 2I0XA 3TOQA 4LRAA 2MQ8A 1IKXA 5KL1B 2BOPA 3LP1A 2CJYB 3L09A 2HZVA 4L72B 3T69A 4ENOA 4HWIA 1X0FA 2D3DA 3QU5A 5FLXY 4DQ8A 4KI4A 1WF2A 3I4HX 3QT8A 3BQ7A 7FDRA 2CPRA 4F5NA 1MN9A 5AKHA 2OPSB 4P74A 5A6WA 2OP5A 2RHKA 2ZC4A 2ZXIA 4TY8B 4N77A 4KGZB 2ZOFA 2WZ1A 2XWXA 3PTWA 5AQNA 1S4EA 3HM8A 1OH5A 3TZXA 4HTLA 1CS4B 1ICEB 2J7UA 3GU3A 4UF4A 1Q82O 3Q83A 4K4SA 2NLWA 3SENA 2DTUA 3M8ZA 4DSJA 1TVRA 3CJ3A 3I33A 1WC5A 1YZ7A 4LF9J 2SXLA 1UT8A 3TAMB 4ECQA 3L8BA 4OKEA 4U95A 3CJ8A 3V7JA 4RW9A 4USIA 2FHJD 4RJVA 1CZAN 2FGCA 1VDVA 1I3OB 4M63C 3ZT2A 4ED4A 2FJEB 1RWKB 5IS2A 5C0YA 2DR7A 2KMDA 4B9VA 3BKUA 4USUA 3QFUA 3BGUA 2OPQB 5J2MA 2YMQA 4Y2JA 4KLHA 3C65A 1U1RA 2ZUGA 2UXDJ 1S5JA 3WNHA 2QYGA 4FK0A 3AFGA 4ZVOB 4IBNA 1IKVA 3H5UA 2L08A 4AM7A 1WELA 4EBEA 3LZJA 3OJUA 5K8PA 1KD1T 4OHZA 4ES3A 3E0FA 3JTPA 4X2BA 2OHDA 3QGHA 1XJWB 3G82A 5J2QA 2XLJA 2CQDA 2IMOA 3PJWA 3QUTA 3DLJA 1KN5A 4NLRA 4RNNA 2CJ9A 5TISU 3S8SA 4H5NA 5JS2A 4NLCA 3UCGA 2ZJ8A 3ISNC 4GV6A 1VQMN 4CZCA 2QL7B 4ZP8A 2H3VA 1HNWJ 4KLUA 4KAZA 1VQ8S 4ZVSB 2FSKA 2F1FA 4FPBA 1N5TA 4XEIA 2KT2A 1HJRA 5B0FA 2ZOGA 3CIZA 3G86A 2OELA 1J5EK 2ASLA 4M42A 3B8AX 4CEOA 4JMUA 3W2VB 2AA4A 4WU2A 4HCCA 4KJIA 2WW8A 4C3LA 3A0IX 3NOGA 4BWMA 3MR7A 1HL6A 1M5KC 2KJ8A 2K4PA 3M8RA 2H65B 4CJSA 4JI7J 5AQLA 4P0QA 4UOHA 1UL3A 4M5KA 3G6VA 2HHSA 3FYHA 2HRYA 3ETOA 2I9SA 3LOUA 3WIVA 5LMUF 2OMOA 1YJNN 4IJNA 2DHXA 4A4JA 1UHUA 4KV8A 4CK3A 5K5MA 1KVIA 2ADBA 1Q81O 1ZQOA 1EKEA 4RL1A 1FRJA 3ZDDA 1A7GE 4B3TJ 2NXNA 3FZKA 1ZZFA 1TAQA 2CNKB 4CJ4A 5BJRA 4DPWA 4YDUA 3AEVA 5ALMA 4DU8A 5D0RA 1GT8A 3NH1A 2HVHA 4ZH4A 3HKWA 3CDBA 1R43A 1V5VA 2RSQA 2UVVA 1RWPB 1XEZA 3P8BB 3EUNA 2ZUBA 2BH1A 3U9ZA 4QZIA 3T7ZA 4B1ZA 3OL7A 3LVVA 2F4VJ 2UU9K 2W1BA 2F8TA 2DGWA 2DNRA 2HQCA 5IQ6A 4CZJA 2W4CA 3MFIA 3RJIA 5FPMA 5AZIA 3I5AA 4CTAA 4LJXA 1Y5IB 4K25A 3OFEA 3H5YA 2AGOA 1WEXA 3QAEA 4QR2A 4KSEB 2OFGX 1HW8A 4PQUB 3MTKA 2P8IA 3PLAA 5IQQA 4KH6A 2R4FA 1ZBLA 4UY8O 3ETRA 2A2DA 3BO2A 3IS9A 1LWCA 4CM2A 5CYMB 2D0AA 4KB1A 1GQEA 2QLBB 2WB1D 3G8SA 1W26A 3JYTB 2ISPA 3LDAA 4RPYA 3JPPA 1JK9B 3HD1A 3O3LA 1CRXA 5CZVA 5HP1B 1QQMA 1Z26A 2PMHA 3OS0A 1UWBB 1PVRA 1T03B 4NLVA 2HFZA 3TSUA 3PW7A 2VWBA 4B3SJ 1H74A 5LSOA 2KVCA 2IRYA 3GB0A 3WKCA 3DGPB 3V1RA 1H0HB 1RLDA 1OH6A 2HK2A 2A19A 1EKRA 1FE0A 1VK0A 4AXIA 5I3QA 3JQMA 1OY8A 3ZZPA 4QZ8A 8ICSA 1P6TA 2EHGA 1WKKA 3MAQA 2QV6A 1YRXA 5L9XA 4OZ0A 4ICLB 4LFAJ 2V4JB 4JRPA 4FF3A 1V97A 3RMDA 3K2YA 1RAHB 3D6TB 2VA2A 1WHWA 2DBBA 1OMSA 1V3RA 4OZLA 5F8LA 3PIPQ 4EWTA 3SUPA 4K2JA 1X9XA 1S49A 2UP1A 2W42A 3T1HK 4QWEA 4L73A 4W98A 4K4WA 7AT1B 2I5JA 2ZGZA 4R66A 2QXLA 5JVGQ 4LIRA 1PCAA 2WAQC 1V9OA 4U6PA 5AQGA 3MN5A 4MFAA 1S77D 2W4DA 3ELHA 3O8WA 5H2FU 3J81j 4OI6A 4DV1K 2ZIXA 1GTEA 1C1CA 3MFHA 3BQ2A 1AUSL 4WF9Q 1P7DA 1JCGA 5AZJB 4CJVA 2W03A 1M1KO 1ZQEA 5KFHA 4A62A 4I2IA 5IWAJ 1X3NA 4DL7A 4CFCA 2CAJA 3K57A 3J7YP 2KM8C 2GHVC 1LAVA 2ODGA 1ZQCA 2E29A 4CW7B 5EX5A 1X2IA 4QIWF 1Q86T 1IJEB 4EFHA 4UQGA 3GSIA 4WPAA 3PKMA 1RDBA 1KQSM 1GLEG 4PL2A 1RI7A 2C2DA 1UJ5A 4I1TA 2LBOA 3M4XA 1OVQA 5CCMA 1BOTO 3UI3A 3FVYA 4I6WA 3KTQA 1XSPA 3I56N 1EETB 1YHQS 2FBXA 1MQ3A 1JLAB 5F8GA 4F7VA 2WRMA 4PA1A 3QXGA 4JI1K 2D4WA 3R3LA 5EUHA 4CEQA 2RU9A 5I3PA 2FHMA 5HSPA 3LP2A 3AY0A 1VQOS 3MMJA 2HHPA 1SV5A 1PIEA 2B0CA 2B43A 5EX3A 1BA0A 4ZLPA 4DUZF 3VAKA 5ALEA 4ID5A 2H48B 1WN7A 4B6JA 4FJNA 4NA1A 1ILYA 3QLHA 4CNZA 3D68A 1RDUA 4LVNP 2BJ3A 2GHPA 3TTDA 3VV2B 4DV2K 4UB3A 4E0DA 7ICVA 1TTHB 5AT1B 5C7PA 3A8EA 2DHHA 2ZM6K 2FVPA 3QNWB 1FFVA 2Z30B 1S97A 4TN2A 4ZPWR 1M90O 3JS6A 1XIQA 1M0SA 1R6YA 3BREA 1GEHA 4ECZA 3VCBA 1IH7A 1I5OB 1VC6A 4F4XA 1K8AT 5B08A 2UXBF 1SIJA 4BRPA 4ZLNA 4A2AA 4GVBB 2BCQA 2BPGA 1A0PA 5I42B 2CPYA 3J80O 4OCZA 3PFOA 3MMCA 4AE5A 1VQ7N 2J7WA 2DY9A 4Q44A 2QG9B 4A8FA 3CJKB 3DYAA 3IR7B 5ALNA 2E5LK 4DR4J 3BDPA 2ZH9A 3AM9A 4A8QA 4CHOA 4IDKB 4DV0K 1YITN 2E2OA 1XR7A 1C0FA 2VL1A 1FFSB 5E26A 2ZIUA 3IMXA 3ADAC 2W6LA 3FLCO 4ETXA 2YBVA 3MDAA 1WJ9A 4OX9K 3IWXA 2PKEA 2HQFA 4LD0A 4BQLA 2ZE2B 1SJ3P 1NLKL 5M2RA 5GAEI 2Q0UA 4ID8A 3NVMA 2HMIA 4V19S 3N28A 3CJ7A 1JKHB 5DDPC 4Y2YA 3CJ9A 2KNJA 2Q36A 2V69A 1QUVA 4BVOA 1BQXA 4HYKA 3R6GB 4NYPA 4DU1A 9ICRA 2W43A 2KK0A 4NI2A 3TW0A 3M30A 5HO4A 2W3SA 4IJAA 3M32A 2P9PA 3AA5X 5AQZA 3QIPB 2QC3A 4K4UA 5AJ3F 1RHKB 1BNPA 1K0VA 7ICNA 1IJFB 3RMCA 1VQLN 7ICUA 3ID6A 4BC3A 3NGKA 2M4MA 3DLKA 2PN6A 4PHAA 3FZ2A 4CD3A 3CE8A 2V0NA 2YXLA 2KU7A 1X4GA 3IBPA 3UQSA 3D2EB 4A8MP 3FKBA 4C7YA 3EWGA 1BDGA 5CH7B 2V7YA 2FC8A 4UB8U 2DGZA 4ECVA 2M88A 3RJMB 1JCEA 1FD2A 1RADB 3QZ8A 1HWKA 1ROFA 3HLUA 4HHUA 2AEFA 4JNEA 1ZM2A 4IC9A 2X1GA 4QS7A 4FJ7A 1KRPA 3ICXA 3Q86A 5CYJA 2HRTA 5DLFA 4CH0S 3JPNA 5KFFA 2EKYA 4O3MA 1YG0A 4KLFA 3MAHA 4I4BA 4AQYK 2RMLA 2HK3A 1IO2A 3VHQA 4C6AA 1F3FA 4NPOA 1RT4B 3DM2B 4YP3A 4OHYA 4ZVTB 5J2KA 1MG7A 2U2FA 3EN9A 1N52B 1YSJA 4BRIA 3GMGA 1IBLK 3Q8VA 3SFGA 2IM3A 1R0AB 3IGVA 2UV8G 3SLCA 3RJJA 3R2DJ 1FI4A 2XICA 4C1NK 2NNWA 4FJ5A 4FCYA 4QCLA 4RQ3A 2CPFA 1HBOB 3SQ0A 1SGGA 9ICMA 4GMKA 1JLFB 3NAEA 4DR1K 4NLKA 3DWLA 4OPKA 4M9JA 3IFRA 1VJWA 2JVRA 2YQ3A 4DB3A 1XNSA 3NS6A 4ZN1A 5AQHA 1KOOA 3DLGA 2BM0A 4USMA 2R7SA 3RUBL 1OXJA 3SQ2A 3R5CA 4KO0A 3JAMU 2AQ0A 2R7YA 3QUQA 2O5DA 4U7UK 3EE3A 1HLUA 2B21A 4JI0K 4QIEA 3BGOP 1LEOA 4RPZA 4PL1A 1N5VA 1S1UA 5LJWA 3HHLB 3NLCA 3OSNA 1N6QA 4YB7A 5DM6Q 4USVA 1D9DA 1BE4A 1T9WA 3UR0A 1TK5A 2MKKA 2BDUA 1SXLA 2XMMA 4DR3F 2WVDA 1RAFB 2VFVA 3EWAA 1WC6A 2WHEA 4BRLA 2GFFA 4M9GA 4AHTA 1TZ0A 3KD1E 5EOZA 3CNHA 2CA9A 7ICFA 4CJRA 4FF1A 2IJFA 4LJMA 4DLGA 2QTWA 2X3GA 2HIYA 2EAPA 4FL9A 3SJJA 2K1RA 3NAHA 1P1TA 3K1ZA 3N6MA 4WQ4A 3AVBA 8ICVA 3GBTA 1S1WB 3SZ2A 4A8EA 1R89A 2FVCA 4CLKA 4H0XB 4F4YA 1I94J 2BQUA 2B56A 5KG5A 4C3MA 4ZVFA 2EZZA 2KXNB 4J9KA 1TKZB 4PPZA 4C48A 4F71A 2ACMA 5AK3A 1UPMB 3L3CA 3DOKA 3M6GA 3IRUA 1F9EB 5CHGA 1HNZF 3UDEA 3HHLD 3TYTA 4CBXA 1KQSR 3LPYA 1OW5A 5GAHP 3CC7S 1XHZA 3OTOJ 4A8SA 2LCWA 2VOOA 4DZDA 1NJXA 4JK7A 3V6DB 1XTZA 3VESA 2GO9A 4LSLB 1H98A 4GXKA 2E9TA 3FBCA 5B0BA 2KN7A 4IO1A 1V9PA 4PY5A 4C1NI 1KKXA 2CQ0A 4PEOA 1KQFB 5J2AA 1VQ8N 4PXDA 3WXLA 4IFVA 2E7WA 4RT2A 3TUJC 3WZ0A 2E5GA 2A1JA 5AXNA 1XNQK 1BQNB 1H38A 4FP9A 1ZQJA 3C8YA 3T6BA 3H20A 2KFNA 3R9LA 3CCJN 4B9NA 3MWTA 2DEIA 3KKAA 3ED5A 3NBPA 2H3ZA 1EHWA 1WC1A 4RU2A 2ZIVA 2VF3A 2QT7A 5J8YC 2D5RA 4QWDA 1TAMA 2GGPA 1LNQA 3ULHA 2IIRA 4FJLA 3CP8A 4RW4B 5AKZA 4NXNF 4Y2CA 4NLYA 5C2FA 1CQNA 3BF3A 2BV3A 3BGRB 4KLJA 3GG1A 5KTQA 3QB0A 4L74A 4ED8A 2IJRA 2V4RA 1TR0A 3VPZA 4ZJOA 5C10A 2YNFA 4C23A 2CRXA 2KZMA 1UFWA 3GZ7A 3HWTA 4CT8A 2IYIA 2PFPA 5DETA 1U1LA 2I7PA 2P9NB 4Y1CA 3J7AN 5CA5A 1FKOA 4DV3J 1B92A 3THTA 3G4SN 4FWPA 1M5PC 2CJXB 2YNHB 1S9EA 1YRUA 1SKRA 1EKSA 2J5AA 3L3FX 1U4BA 4J2BA 2F9TA 3L9ZA 4EGLA 3TABA 3SQOP 8ICIA 2W8KA 5KI6A 3MM5A 3FZFA 2DEJA 2B4OA 5J0TA 4AFFA 5ALXA 1Q1KA 4NASA 3Q8RB 2CPDA 2Z1HA 4DV4J 3VC8A 1IV0A 4KT0C 4LREA 3H8SA 4BR7A 3ALYA 1HMVB 1JWWA 4BR4A 2HHUA 5F8HA 1FX2A 1X4CA 2N1RA 4R63A 3NGRA 4C4TA 3HRDD 2F8EX 4U67Q 2GBZA 4KFBB 3MABA 1WOPA 1EQMA 3SR6A 2G1DA 4E98A 3RBZA 1Q7YO 4A59A 8ICJA 4MYTA 3M05A 1EAYC 3QT7A 1TUWA 4M2YA 4I9LA 4C0ZA 1YQHA 3A8IA 4BRHA 1TV6B 4XTTA 1KXPA 2UUTA 1EP4B 4IEEA 1SL0A 1ULRA 3O9UA 4WFNQ 3IAM9 5J1EB 3PNCA 4DR7J 4N8OA 2BRLA 5HBMA 2FMQA 5G4DA 4Z94A 3CJTA 1WCNA 4LFCF 3DI6A 4ELTA 4IG0A 3CD5A 2YWKA 2ZDPA 1HRHA 5GADI 4NXMJ 1WTFA 2XIDA 3PYFA 3E2EA 1FJGJ 2Z0GA 3PR5B 3ILIA 2E8NA 2B51A 2ZBIA 3JAMY 4OYIA 4IOAQ 4EU0A 5J2PB 3HPOA 5KFJA 1NU4A 2IM1A 3F2DA 1QM9A 4L6V3 2I6WA 4JEPA 2RRDA 4KMUA 5B0CA 2PFDA 2RQ5A 2D1CA 1JALA 2ASOA 2EZXA 4R64A 1YWXA 3KNGA 1K73T 1S1XB 4FVMA 7ICHA 3JPQA 5AQPA 1U8SA 3WKDA 1HEKA 3TACB 2C2NA 2LLZA 4OLOA 1RTJB 1N4LA 4MN4C 1BCMA 1ZQ1C 2G5IB 5KFQA 3ZDCA 2Q97A 5I9EB 2W9BA 1RXOB 2R18A 2LFVA 4OIXA 5D0GA 4ZTFA 9ICXA 3C46A 4B8CA 2J6TA 5AK6A 2PI5A 2C2OB 2A1SA 3BBCA 4ILHA 1HQUB 5DDQC 1C7YA 1GAOA 2NO4A 3Q89A 4JI2K 2BHNA 4K0KJ 4RW7A 2J7KA 3CCSN 1E3MA 3IRXB 4YMOA 1X5OA 2JWLA 2YWGA 3WUHA 5ETMA 4A5AA 4CEEA 2DT9A 4ZVGA 4F4WA 5EE1A 3MEGB 1VHIA 4C98A 4Y2RA 3AAPA 4WYWA 3VQQA 1SWWA 2O6KA 4UY85 3HHKA 4B08A 1PK1B 4X64K 1RTHA 1ZQGA 3BH7B 2NV3A 3VQ6A 1M6YA 4ED0A 2F1JA 3EXYA 4J7CA 1I1GA 3GWCA 2QI2A 4DL6A 1QAXA 3JSMA 4QYZK 4K5SA 4Q2LA 3TPQA 1XSLA 3OTBA 2WF7A 4FXWA 3ZX3A 2HHHJ 4QIFA 2G0AA 4XA5A 4JYAF 1FEHA 1WSEA 1VQON 1S79A 1V3ZA 8ICHA 2G9OA 1UJ4A 1RGVA 3ZNJ1 3UPQA 1NUEA 1WEYA 4DCJB 4NV0A 2H9ZA 5AM0A 3SCLE 5LY3A 1X9MA 1N33K 2OPRA 2I5HA 4HACA 1EO1A 5BPNA 5K14B 4TSXA 2WTUA 4P2HA 2O01C 2AMCB 4CJ5A 4O3PA 1D9AA 2O8FA 4HH1A 4CLWA 1KAZA 2DXDA 2EXUA 1NDCA 2QKQA 2JLGA 3NL0A 3PW4A 4DR6K 3UDLA 1J5OA 4YOWA 1TL4A 1Z00B 4UAYA 1SPBP 3UD5A 3P83D 3OR2B 2YMLA 1QUPA 1RT6B 1N56A 5BREA 1MWYA 5JLHA 1UPPA 3FQKA 5T7LB 2VKRA 3ENHA 1FNOA 2GIFA 3OYEA 1KNZA 1F5CA 3V7KA 2HLTA 4M45A 1LWEB 3VF0B 1O08A 2BE2B 3UKRA 1VQ5S 3VTHA 3FK4A 1S1TB 1KS2A 3M1VB 4OPAA 4FJKA 3EM1A 4Q0BA 1Z2ZA 4JKAA 4NYNA 1QQOA 2G8IA 2O8DA 8ICEA 5CYQB 1SZHA 3NGSA 2EG2A 2B9WA 3RFAA 3MEDA 3K9KA 3QEPA 4IR9A 1GOBA 2HBYB 1ZQQA 4DN9A 4DV7J 3VQ7A 3HX9A 1HQEA 1R7IA 4LBHA 1RT5B 5D0HA 4FZYA 3TSPA 3GQCA 4CVNE 4U7CA 4JKCA 5A8RB 4OI4A 2JC1A 4I2PA 2P5OA 5EWEA 5CE3A 4LMZA 5KPZA 3THXA 2WHOA 4IFYB 2RT3A 5HLFA 3ET6B 5EDWA 3Q8QB 1IM6A 5L38A 1NO8A 4ZVPB 2Y8YA 1W9HA 2D74B 4DOZA 2HHVA 2VG5B 1SJFA 3SBMA 3H3OB 4DV5K 4FYYB 3ZO7A 3GFKB 3UXOA 1ZQWA 2J0XA 1CLFA 1XR5A 4Y0FA 2DNMA 2RRAA 1NWKA 5L9NA 2IM2A 3FUYA 2IM0A 3UXNA 2MMYA 4CE6A 2XM3A 1SJ1A 4AHVA 1BO5O 5LMUK 5KFTA 1TVRB 5TKYA 4DCOB 3LWLA 4DR5F 3EXCX 5J2GA 1ZQHA 1BD6A 1RBSA 4FLZA 2JX2A 4JB8B 4YMMA 4PG8A 1REVA 2RE2A 2F8MA 5CWRA 1RT3B 5C2DA 2CQBA 4ZLLA 3HI0A 4EYHB 4JLHA 3DN9A 4P2FA 3N6LA 3CCRS 1M5OC 5J2MB 3D28A 4FW1A 4KKOA 2ITGA 3ALRA 2XYHB 4FOIA 1RUSA 3M3ZA 1FWPA 1NMNA 4KBOA 1KW4A 2C3MA 2B3TB 4NLBA 3EGVA 2VQFJ 3A5LC 2DFFA 1S5ZA 2AV5A 5A8KB 1J6ZA 3U3YA 1A76A 3MXJA 2MUTA 1KFTA 4QBUA 2YTCA 4H0YB 3EY1A 5BR8J 3KZIU 5BOLA 3QYYA 2KOBA 3GCXP 3UKUA 5J2QB 1UVMA 3R5DA 2DPIA 1KQQA 3T1YJ 2QW9A 3Q8YA 2NRXA 3TWZA 3FZLA 1ZQBA 1S6PA 3VF4A 1IIPA 5H9EK 1XNRF 1D8BA 2LVWA 1XR6A 4FSVA 1HBUB 4BDZA 5ALTA 3V9ZA 1QE1B 1SZPA 1GO3F 2OSQA 4OD0A 1JN3A 4HR2A 3LANA 5BPMA 4DTJA 2AJ1A 3MM8A 1NHKL 1KHVA 4JV5J 4CJ3A 3DDNA 2POKA 2VIXA 1T44A 1TL1B 2F8KA 4YHHF 2ASJA 3JSRA 2FJ6A 2Z2MA 3ISZA 4P0QB 5HQ8A 5M2PA 3K4GA 2P9SA 3IAYA 2ZD1B 4A2BA 3HL8A 4KLEA 4ES1A 5DDOC 4WFBQ 4Z4CA 3Q23A 4KV8B 4KC5A 1XMQJ 2PD1A 3PSPA 3RSEB 3LO3A 1W97L 3QEBZ 2JHDA 2ZJRQ 5EGYA 1B7FA 1Q5YA 1ZAXA 5F8NA 3T5JA 4DS5A 1AZSA 1D0EA 3RMAA 2OTLS 2DCLA 5BYSA 1MLAA 3UMGA 4GVMA 3BZCA 2CWXA 3JS9A 1VRTA 3GIIA 5ALHA 5T14A 4ZVQB 2LU2A 4DCPB 5IFMA 2NO5A 1YTUA 3RJHA 4O3OA 4UW2A 1U6ZA 2KIWA 4CDIA 2NRTA 4DFJA 3QEIA 3P4UB 4DTUA 2QLJB 5AZIB 4CTAB 1RBAA 2HBQB 2FPHX 2XZWA 4I2QB 2WOMB 3QO9A 3DXSX 2B6GA 3VETA 5IC4B 3IG5A 1RQLA 2WBRA 1YJ9N 4A8KA 4NRUA 3KMSA 3CCMS 3KLIA 4CBUA 4CJ7A 4FZNA 2BZ2A 4RQ0A 4X62J 3MURP 3LP0A 4Q5VA 3IS9B 3NNCA 3H4BA 4JHDB 5E3CA 4DR2F 4HDHA 3GILA 4FXVA 3SI6A 3T5HA 4O4RA 3M6VA 1W7WA 3RH6A 5HJYA 5D4PA 3BO3A 3BF4A 8AT1B 3S6JA 4PCQA 2NRRA 3NCIA 3NF6A 4H0OA 8ICBA 4JN4A 2FC0A 3OTEA 5AQXA 4XDCA 2W41A 5E7OB 3W3DA 5CQGA 2YX7A 1IUJA 4ANEA 3CXCM 2XBPA 1FVQA 2VC0A 3THVA 3NF7A 1X4BA 4ILJA 1BPXA 4F0HA 1A6LA 1YJ7A 3I8DA 1HI0P 5KG0A 2JV3A 3ZTPA 4RO0A 2EG1A 1RA7A 3SMPA 3M8WA 1TKXA 1S7HA 1ZTTA 4LVSA 4RQ7A 5KG6A 3O9RA 4DUZK 1UVJA 3AVLA 3MXMA 2XCAA 2HNDA 2BA9A 1J5EJ 3DXMA 4H5RA 4QNLA 4ELVA 3GFZA 2KVSA 1X1PA 4QPTA 1WG4A 2FVSA 4LF9F 2VC1A 4Q43A 4MDAA 1RAIB 2WFAA 4X4QA 3VQ5A 5H1SQ 2I5JB 3MPVA 3N5BA 3VF6A 3QFHA 1NBEB 4IH5A 3ZZTA 2ZJPQ 1DQ8A 3D1OA 2H5IB 5DZ7A 2PT0A 1Q82T 2UXBK 3WK4A 5HP4A 5D4NA 4MYUA 1C1CB 4OI2A 3KUHA 1C0UB 3VEZA 1T9VA 2UXDF 2ALZA 3O4WA 4AM6A 4NJ8A 2E1RA 3UPFA 3ENOA 3FNNA 2FB0A 1Q0NA 3M2VA 5GAGP 4OV1A 1FFGB 1EXQA 1BG3A 1KOHA 1NGHA 1R6VA 3IN5A 1SAZA 5KT3A 4FLXA 5F41A 4WTOB 2EQYA 4J9QA 1NJZA 3TX0A 1QS4A 5KL8B 3C14A 3Q8MA 4K4VA 4JRQA 3WK7A 2XRIA 3IHQB 3DOMB 2B6AA 3F44A 5AE3A 4M04A 4CIOA 4DTRA 5AKYA 2FHJA 2YQ0A 3G10A 4ZITA 4CI6A 1VLYA 4NMLA 2KFYA 4C0BA 1JLBB 4FJMA 2MQMA 4BUGA 3LP2B 4YOUA 1SV5B 2HB5A 2B4PA 1NZPA 1T8EA 5THWA 5SUHA 2JGAA 2NSBA 2V2QA 1HWJA 4CH1A 1XC3A 4LSNB 1PK3A 1BPYA 4CZGA 4W5QA 4JI7F 5ETLA 1YVFA 4ID5B 3BSNA 4C7QA 2ROEA 2Z7JA 3QLHB 2AWZA 3NOCA 3L95X 1ZD3A 2HBLA 3C5GA 4KX3A 3CD7A 4M47A 2ZWOA 4A47A 4TY8A 5DG7A 3PYEA 3K1RB 2ATQA 2F65A 3JXOA 1CC7A 1K8KA 1QVFM 4B3TF 2IDLA 5AI0A 5MLCQ 3AD8C 5SZTA 3QETA 3IR6B 1TFRA 1CS4A 3BS9A 4F8RA 2HWTA 1F60B 2CYYA 5KFIA 2VPWB 2FBVA 4H0PA 5KFDA 4NY8A 1YTAA 1NGDA 2JOQA 2NCKL 3TAMA 3IGNA 4PYAA 2VQEK 5J0XA 3V9SA 2F4VF 3EVOA 1Q81T 2PA3A 2AGPA 3GPAA 1ASVA 3DNCA 2JZBB 4O0JA 2NXCA 4H4MB 5KFKA 3ENWA 3HVTA 2C1EB 1WHYA 2PI4A 2H3GX 4XPCA 3QWUA 2E5SA 2VA8A 1GLAG 1S3XA 4KHUA 2E9ZA 2HVIA 2W54A 3CCTA 4E1NA 4P10A 2Y0SC 3CFPA 4JK1A 5AI9A 3TADA 4OYPA 2FY1A 3RYLA 7ICGA 5AQMA 2HCFA 4RNOA 2ZDOA 3K7RA 5A0YB 3CDEA 3ILLA 3UNGC 3DV9A 4BS2A 1IN0A 2QIFA 4ED3A 3O5BA 4DV1J 4YS2A 2UVRA 4DSLA 2HHXA 1REGX 2WF9A 3EVWA 1D1UA 1DT9A 5HL7Q 1HUXA 2F8SA 3BUZB 3E9PA 3W5YA 1YJVA 1O6XA 3C1ZA 4B3SF 1UFLA 4UY8T 4CRXA 2RILA 1S72S 2KE7A 3TARA 1GLBG 4QWBA 5RUBA 4LF7K 2VPXB 4YXJA 3TP2A 1TUGB 1G3OA 3QERA 1WNSA 2DWQA 5B0DA 5CR0A 2IVYA 3W2VA 2MSTA 2NR0A 7ICTA 2OAUA 3ZSOA 2CQGA 2P9PB 2KG1A 3IWNC 2IBKA 2AJQA 4WXOA 3MWPA 5D3GA 4CGFA 5GVQA 1T3QA 1SB6A 4LFAF 3H7HB 2IC3B 1E6VB 3C29A 1FEZA 3M6WA 2E9RX 1TUVA 2XTJP 3VA3A 4L3KA 5CAAA 5AQJA 2P9CA 4Y6IA 4JS4A 2V8HA 2PY5A 1N61A 4YD1A 3TUPA 4DDFA 2HOQA 2HHTA 3FZMA 1HIWA 2WVCA 1VQKS 3A4TA 2CJKA 3QFWA 1NPRA 2HZAA 1H2TZ 3P96A 4NCBA 2HHWA 4PKDB 2B4VA 1KR4A 4V19J 1MDUB 4UT4A 3RB3A 4ZVUB 3RH4A 3HSJA 4CJTA 3OYNA 1N5QA 3HSDA 4AHRA 4DPTA 3GIKA 2LXFA 4DX8H 1KLMA 4H5TA 3ZTOA 4DV2J 4J8FA 3QNOA 7ICSA 1P9YA 4X65K 3IKMA 3IAS9 1NGJA 2ROPA 2DISA 2FF3B 3CCZA 3CSKA 1S4FA 1X5SA 3JPOA 1H1VA 4JI5K 5KT6A 3CVKA 5IWAF 4BRQA 1RACB 4ZCKA 2NXJA 2GELA 1WG8A 4YQWA 1ZPWX 3FRZA 3I0SB 4F9OA 1EX8A 2OZSA 4CGZA 1OS5A 5KFRA 1Y3KA 2DPNA 5FP0A 2YKPA 2LKYA 4PQUA 2GS8A 3DU5A 2PIIA 1M1KT 3AB4B 2HMPA 1ZM4A 1LK5A 4NLGA 1ZRNA 5CYMA 3NCPA 3A5MC 4URQU 3N9UC 4ED5A 1S0VA 4K4IA 3JYTA 4BROA 4GXIA 2J0QD 3V4IA 2E7XA 3CXCR 2E1AA 4DV0J 5ALPA 3V7LA 5HP1A 1UWBA 2DF4B 1MMNA 1T03A 5IOLA 2HBMA 2E1PA 4TVAB 4W5TA 1WNEA 3DGPA 1S1UB 1J97A 3C2LA 2PAVA 1X5TA 2A1RA 4FWRA 2LP4A 4FO6A 2ATLA 2XSFA 3AL0B 4BE0A 1ZD2P 3OBIA 3VGKA 4EZ9A 3GDXA 2XY5A 1L3VA 5CY4A 1VQ6S 4ALZA 1GX6A 4ICLA 2LA4A 3KK2B 4I2HA 2V4JA 1VR6A 3LDLA 5M2UA 2HVDA 3DOLB 2J8AA 4HTIA 4GY2B 5AICA 4J9LA 4J5OA 2CQ3A 2ZTDA 3D3CJ 3UCZP 1EX4A 2QXFA 4PR6A 1PVPA 2Z2YB 1RBTA 4US8A 4AD6A 5AI4A 3D3BJ 4S0MA 3CTRA 3NGUA 4A5BA 5J2EA 1J2VA 2QWOA 4WIIA 2WB1F 4WE1A 2RPIA 2A5XA 2BABA 2CRLA 2K3IA 2GOLA 1M90T 1O8BA 4ZP6A 4YOVA 1ZQLA 2ZH7A 2ZH3A 1EQ0A 5KFVA 2MHNA 4DR4F 2NZCA 3TNVA 5HR7A 4C8KA 4XPEA 4Y2KA 1ITPA 4RQMA 4OYXA 4ZPTR 4Z6FA 4F0MA 5ALLA 1N36J 3B4DA 3N4MB 3CM5A 3SSSA 4KHPK 3SI8A 1YTYA 5AZJA 4C4SA 1N32K 4M3UA 4H4KA 1RDAA 2LI6A 1RJJA 2EFVA 7ICPA 3UN5A 2A6MA 4UAWA 1SJRA 4RBUA 3H40A 3OS2A 5IIOA 1F2HA 2P9IB 4WP8A 3VAHA 1N88A 5E3RA 1NPKA 4OZ5A 4W92B 3OPKA 3UMCA 3R7NB 2PYJA 4J2EA 1NJWA 4KLDA 4RUHA 3OJSA 1RP5A 1TP7A 3FSYA 3ZC4A 4CGJA 1U1KA 1XN9A 3LUYA 5GINA 3TKAA 3BJYA 3NEKA 3A8KA 3K89A 3I9ZA 5AE1A 4EENA 1SJ4P 1H7XA 2VFTA 1EETA 3DLEA 4EAHD 3J81U 1N5XA 3CDWA 1JLAA 4IFVB 2B9EA 2FMSA 5DM7L 2ZUCA 4IQTA 1U6FA 2AZ1A 4Y2TA 4YOEA 5K8MA 1OH7A 3SMSA 2VGNA 1LCUA 4PPXA 2K8GA 3F73A 2QWQA 4OKKA 1PAEX 4B3RK 3UE5A 5IV4A 1VHFA 3GLJA 5I3UB 5L1JA 4DR1J 1QVFR 2ZIVB 3QU4A 1WBDA 1WF1A 1OSDA 5DB9A 4LIWA 4LFCK 4FYWB 3TU5A 3VEYA 3EVMA 2K3KA 2YHXA 4NXZA 2GX8A 1RT2A 2DNYA 1B70B 3F0NA 2OEKA 1VBZA 2GO7A 3ZZOA 1WI6A 3GR1A 4RUBA 3NHGA 4KLOA 4FFDA 5K9FA 4CO1A 1WCLA 4JI0J 2QA1A 3P39A 3O8MA 2EEYA 3TZZA 1OIAA 3IV6A 2H1YA 3HP9A 4KLQA 1VSJA 1H6KX 1KCFA 3AJDA 2QLWA 3J81O 1JLQA 5BRFA 2OTLN 3ENAA 1S9EB 4E7IA 3O1WA 3KD5E 1T94A 4JI8J 4I9QA 5K20B 3HHNB 2UUWA 5DB6A 1T6DA 3FBFA 4Y65A 1RB0A 2RQ4A 2K8AA 3M7DA 4KB0A 4TY9A 1BPBA 3IM8A 1NZAA 3MM5B 4HEA9 2G09A 3QT6A 4M6WB 2BCSA 2YNIB 3EPGA 2Y1RI 2CQ4A 1EARA 2CPIA 5FPEA 4IDKA 1YJRA 3C2KA 5L8RC 4F5RA 2C22A 4XH4A 3OA9A 1JJ4A 3MCOA 1PYOB 3P49B 2I6XA 3HZEA 2RVJA 3NDKA 2R8KA 4KLIA 4QYRA 1Z19A 1CJKB 3CCMN 4DJBA 7FD1A 1ESVA 1VQ4N 1UP1A 4M5GA 3U6FA 2HG4A 3Q8LA 3CYMA 4CH7A 3H45C 3UE2A 3L3UA 4M95A 1TFWA 3T9NA 4OO1J 3SBTA 2V34A 2LYBA 2PMZD 3ZT4A 3JPRA 3FM9A 4BRAA 3PCOB 2KG0A 1JJHA 5ETVA 2W7OA 1HWUA 2Q43A 2D3UA 3H42A 2YHYA 3DFEA 3P31A 1NK6A 1FDAA 2HNYB 1VQYA 4PKIA 5D78A 4TKTA 2WW4A 3HCXA 3QIPA 4O3QA 4OJHA 5LSRA 2IA6A 3OYKA 5H9FK 4JYAK 5DBAA 3DRSA 1UMJA 1GLCG 1Y11A 3LTOA 4WYLA 4DX5A 4JAXA 4DMNA 4MMOA 4KAIA 1ATNA 2LYHA 4IQUA 2M5YA 4R0EA 3G2XA 1U2FA 3N79A 4CLTA 5C25A 1O0PA 3RB6A 2ESEA 1UW4A 1I94F 4RKUC 2A1BA 2MZ1A 2VICA 3UD3P 2V6AA 3CPWM 2EK6A 1E4GT 1E6YA 3DEEA 2HWIA 4DQRA 5GAEP 4MIWA 2HFVA 3QATA 5KPRA 2ZGYA 1GXUA 2AD9A 2V9WA 4TU8A 3FFIB 2DH9A 5SWMA 4CESA 2RN2A 3H4DA 2RIJA 1LOTB 5F8JA 2ZWHA 4A8WA 1VCTA 3EJMA 3ZT0A 3KHLA 4FPIA 3K5MA 3D2NA 3OL8A 3QQCD 2DNQA 1RT4A 2H5JB 2BJ9A 3VERA 1FVSA 3QPIA 3HM9A 1Q3UA 1QHTA 4PHTX 2A6AA 3OTOF 1Q8IA 3ATVA 3U02A 2CG4A 4O0IA 3J8AA 4RW7B 3RW6A 3ZNUA 2HOEA 4J03A 2LXIA 4NEZA 4B9MA 2APOA 3V9WA 2QWLA 4AYBC 1UETA 2Z2ZA 1R0AA 4EI2A 3D2SA 1YRTA 5EE3A 4UZCA 2KDOA 2FC9A 3K5PA 2ZVSA 3RG6A 3R8EA 2QA4S 2X78A 4DF8A 1JLFA 2NYHA 3PHEA 5TZVA 1RDWX 1R8AA 3I28A 2W7PA 2P1JA 1ZQUA 3KUEA 2NYIA 2IDEA 2Q3PA 3JSMB 4DOBA 4ZCMA 4X4SA 2J4RA 3DHXA 3WHIA 4PZOA 3H5SA 3IBFB 3FQLA 1NKCA 2JWKA 4ISFA 4UOGA 1FD8A 3ULEA 2XULA 3HHLA 3CJ4A 4KE5A 1JL1A 3H46O 4CF2A 4HL9A 3W8PA 2ASDA 3DLBA 5L46A 4IH7A 3J81Y 4F36A 3L5KA 3MUMP 4CF9A 2GVDB 2JH1A 5HR6A 3ILJA 1CC8A 3C16A 4BDYA 3N4PA 2O8CB 2KKVA 1ZQYA 2GO8A 3JTOA 3KXDA 4NOHA 1A5XA 3C1YA 3WC0A 4M5JA 4CECA 1Y7PA 1TV9A 3RB4A 1Q79A 4MKAA 2KHQA 3P6YC 4F92B 3M6ZA 4I2JA 3Q0AA 2FSJA 1U1OA 3MR2A 2NS1B 4DQIA 3NCQA 2DD8S 4EK2A 5HATA 1U49A 1SIZA 3D5MA 3QBCA 4XIUA 1R31A 1B0TA 1NKEA 2BBEA 4G1PA 5IXUA 3N7SC 1BMQB 3VAIA 4QW9A 3CETA 1VRQC 3US5A 4DZ6A 3UKRB 2LMIA 1HYVA 4DV4F 1CJVB 3BR8A 4Q0BB 4OJ5A 4QZAA 4BACA 1ZOTA 3ZEUB 2O8DB 1VOMA 2XMKA 4Z2XA 2DR6A 3N97B 3O6WA 4CHQA 3KK1B 4NL9C 5C2CA 3K0JA 4L8RB 2VBYA 3HPHA 4OMFG 4L76A 5CABA 3GYXB 4CHZA 5DLGA 5AQVA 5HNKA 4LSLA 1HFEL 3CDUA 4DX7A 4Z6DA 3K58A 3KK7A 2MJNA 4I2PB 1URJA 2JWNA 4MAKA 4USTA 3MR3A 5M1FA 1QVGM 4CO2A 5HLFB 4CEFA 3CFOA 2VUGA 2CVEA 2G0JA 3UDVA 4DR7F 4GIBA 2Q31A 1RKIA 3EZ5A 3I87A 5AM3A 4CHPA 5JVHL 3LAMA 4DOCA 2D0OA 1BQNA 2KKPA 1Q7YT 1IVZA 4NXMF 3NY0A 5ADXH 4UARA 2XHBA 1FJGF 4ECYA 1YJWS 1KTVA 4DHYA 2FHKA 5GIPA 3KOOA 4RTFD 3D54A 4DL0C 4C4RA 3PEHA 2ZTEA 4BRDA 4C8OA 4TQRA 5J2IA 1G2EA 3VEXA 2DIVA 5AIAA 3OHAA 3SK3A 4PABA 1D8YA 1MC8A 4OJ3A 3HZ6A 5AFUH 3VVUA 2Z56B 4CEAA 3VA0A 2QLTA 1BPEA 2VPZB 2VBWA 5DK5A 1VQKN 3CCLS 3CCUS 1FESA 4B9TA 1GH8A 2KKHA 1JCFA 1QQNA 4JI4K 2KHVA 3D6RA 2J8SA 3KFWX 4WYBA 1S1VB 2Z1IA 1ZTWA 2KHCA 2BMBA 3V5RA 1N33J 4KKOB 9ICWA 1H7WA 1VJ5A 4CJLA 3GG0A 2IVMA 2XNQA 3K5LA 3WK6A 4YR2A 2ISOA 2LQ5A 2C2EA 1FRXA 2QMWA 2V68A 1HBMB 3T79A 2FMPA 4CLZA 4I2EA 2VG6A 2F7VA 5BPLA 3UKUB 2P9LB 5J0PA 4DR6J 1K6YA 3DRRA 1U9LA 4K0KF 1OO0B 2VONA 2H5EA 4CF3A 5A8WB 4RQ4A 3M9MB 1ZAVA 4ECSA 2DVIA 4TLQA 5AM4A 4YCXA 4NLWA 3CRXA 8ICAA 2I1QA 1SH3A 1HMVA 2HMXA 3LGHA 4QR0A 1ASWA 4OVLA 2E6LA 1UVIA 2GNKA 1TL5A 2P6UA 3EGZA 1RDRA 1M5HA 1W7AA 3BBBA 3C2MA 5ETNA 2CNNB 3HX0A 3V9UA 2CQ2A 1TU0B 2VZ9A 1RHJB 1R8HA 1XWLA 2ZFHA 4DI6A 3VQ9A 3EE9A 2HHHF 4DSEA 4MKBA 1U09A 2B8QA 4DUTA 3L2WA 1TV6A 2J0SD 1FRLA 1Z25A 1EP4A 3T19A 2KI2A 3NVZA 5J1EA 8RUCA 2O8BA 3BZKA 3O4NA 2G2OA 2YWHA 2E5JA 4O5FA 5D6GA 4FWOA 3O80A 4BG9A 3NGDA 3PJXA 3ZSWA 3HHEA 4JD2B 1JIHA 4X4RA 3IDHA 3H7IA 3MD3A 3TUZC 1J27A 5ETQA 1VQ6N 2DO4A 2JEFA 3O3HA 3HZGA 3M6KA 1VRTB 5FPNA 4LR7A 5J2PA 1DEJA 1MNEA 4DV5J 5KGWA 2HI0A 4DPOA 3HILA 2D6FC 3LALA 1XHXA 2ZBQA 1X9JA 3S9HA 1U1MA 3SQ1A 3OV7A 2FJDB 1N5WA 4AF1A 1N2XA 5EWGA 2ACYA 3MN7A 2MZQA 4NO7A 3CI5A 4LZDA 5BN8A 3HVWA 1DXSA 1S1XA 3L0QA 3VEOA 4CLFA 4E7JA 2LU1A 4ECUA 4PWUA 4Y2PA 2YY6A 3L7PA 2UXDK 1VQNS 1LWFB 1YF5L 3NMAA 4GO7X 2ZKTA 2R8GA 2KO1A 5D77A 4LH4A 3FFKB 3OXLA 3PMLA 1IWGA 2CNOB 4FYVB 5AM1A 3TZWA 1SUQB 3TAPA 3VQCA 2D8CA 4DL2A 2O3DA 1K9MO 4DV7F 2A3VA 1WTBA 5AR0A 4XK8C 2X1FA 1NHVA 4AL7A 4ZLJA 4P7TA 3IRXA 2IMWP 1FRKA 8ICKA 1Q16B 2DHSA 1RTDA 2GTDA 5F9LA 3MEGA 1APSA 3P38A 2WCXA 2AJ4A 2A6OA 2NUBA 4H4OA 1PSDA 5HQMA 4X4OA 2RE1A 4OYBA 4CZIA 2QK9A 1QSLA 2LDIA 2NREA 3N6NA 4WK1A 2G07A 4KLTA 3I55N 1Z3EB 4ECXA 1YKWA 2F9DA 4KH0B 3W9JA 2FD2A 1CI4A 5H9EJ 3OFGA 4GVEA 2F40A 2EC2A 1TKXB 3TA2A 2E1EA 2ZJAA 3CJ5A 4HI1A 1LKYB 3AQFA 3SCXA 8ICYA 1U2CA 2B5JB 1HKBA 2WF5A 2GHWA 3RMBA 1KONA 2P9GA 4ISGA 4TU7A 3EKSA 4A57A 3IUCA 2K4IA 2A40A 3RAQA 3GONA 1ZZNA 4JKDA 3S41A 5F1XA 1Y5NB 1Y97A 1BQMA 4M9LA 5K14A 4B3TK 1D5AA 3S3MA 1B7YB 1RXWA 3R5AA 4CJPA 1CJTA 2Q1NA 1HD0A 1V3SA 4NRTA 3ULDA 4YMEA 1UCNA 3A0BU 3MEEB 5DKWA 4NCGB 1QLNA 2QLXA 4IQMA 1Z00A 2FTRA 2GMLA 4J9RA 1WF0A 2P6SA 1GNKA 5IZHA 2H3EB 2VQFF 1MU2A 3FGUA 3M2VB 1HJOA 1PVQA 2O4IA 3BGFA 2JLFA 4NA3A 3MDQA 4E7LA 5T7LA 5BR8F 4F3MA 2LDYA 4PZVA 5KG7A 4MKVA 4JS5A 1TL7A 4U96A 1HWLA 3AVHA 3T1YF 3PW2A 1AA1B 3WC2A 3VQPA 1KAXA 4RWTA 4Z37A 3L4IA 1XS9D 4UB6U 3VAGA 1F2GA 2B6AB 4IKFA 4NLOA 3M1VA 1QAIA 1F5SA 2R8HA 4AUKA 3OVSA 3HW8A 4CGIA 1Q8KA 2ZXHA 2OFHX 1XERA 5CYQA 4OPHA 1SCJB 3HKZF 1CEZA 4JP8A 1QVGR 1NLVA 1DLOA 4TUQA 4QIWC 5D46A 1BWVA 2MPUA 4FLUA 1RT5A 3FJ2A 3KZBA 4JV5F 5LJVA 4BE2A 3SEIA 2FLOA 3B6OA 2KRBA 4OI1A 2UYTA 1HUZA 5A8RA 1NDKA 2D3ZA 2CPJA 3B82A 3QGGA 3AA8A 4IFYA 2X1BA 3FCVA 3MN9A 3ET6A 2CNLB 3VF2A 1K1SA 4C9DA 4H0VB 3RGIA 1DJ0A 3MAAB 2HAIA 1XMQF 4UW9A 2RQCA 4ZA1A 4DF4A 2VG5A 2KXHA 3WKBA 4LFAK 5M1PA 2Q1LA 4OKJA 1K8KB 4M5DB 1ZYQA 5CXTA 3WEEA 1L3SA 2CJAA 5AQOA 1IBKK 5JLFA 4YOXA 3GFYA 3ZZYA 1ATRA 5LMNK 2OJ3A 2JVOA 4QZVB 3AA2A 4A8XA 1CXQA 1XO0A 1RWNB 4WFZA 3M7VA 4GW6A 4WU3A 3D45A 4EFAC 5KFMA 4BQZA 4UAUA 1D09B 1OPIA 4M5LA 2C28A 1RT3A 1HWIA 3HVTB 4YFUA 1NZBA 4LY7A 2XNRA 3IM1A 5CD4A 3TTCA 1ITGA 1R8BA 2KM8B 3AA4A 1Y64A 4JI6K 2MSNA 5AQSA 4ZN3A 5A8KA 4X62F 3ORYA 3MMAB 4KGKA 2OKQA 4O8UA 2IHNA 4UUXA 4DQQA 3AGKA 3F53A 2LQBA 5F8IA 4RWWA 3RB0A 4HI2A 4IWVA 3MGJA 2MRLA 3LVWA 1U25A 3VQ4A 3K5NA 4YN3B 2O8EA 3D6JA 3QU2A 2OO4A 4YUDA 1AUDA 3C6TB 3IG1A 1U1NA 4KLSA 2EBGA 2UVWA 1HBUA 4IRCA 1QE1A 3LF0A 3C95A 4X4VA 3O3FA 5CB1A 4IS7A 2FVQA 1WSFA 4YDXA 4U67L 3MCMA 4Z0UA 4CJQA 1PUZA 5D3GB 1K47A 1S48A 4DPXA 1QQCA 5J2CA 1TL1A 4KRWA 4QIVA 1RAJA 1B9DA 2M3DA 4EX7A 4E2FB 3TQEA 4C3KA 4LF8J 2Q6BA 3E8OA 2D3OR 4O4GB 4I0WA 1HW9A 2ZD1A 5FIIA 3NH2A 3MTJA 1OQ3A 4N47A 2ZEJA 3NXZA 3HYFA 2H4WB 4W5OA 3R7BB 4IG3B 3MXHP 3RSEA 4HVZA 4OI0A 1A77A 4U7BA 4DSIA 1IR1A 4HT5A 3Q7BA 4NWIA 4BRMA 1FF2A 2D7SA 3LDSA 5BR9A 2CQHA 4JOUA 1WI8A 1N63A 1VLOA 4FM2A 2KD1A 3J7Z5 1ZQKA 2VJ4A 2XS5A 1KLMB 2K4HA 4WZQA 2DCUB 2OZMA 3BSCA 2VB6A 2ZH6A 2CGKA 3QGIA 2DNOA 5IM0A 4LF2A 4XAKA 3UXPA 3G71N 1U0HA 1HJPA 2HAFA 9ICQA 2CQIA 1X7VA 4I2QA 8ICNA 2PDAA 2WOMA 4DR4K 3CCVS 2VOPA 1KQKA 2AH5A 2ZKUA 2VCPA 2ZNZA 4UAVA 3MF5A 1SI9A 4ZJLA 1NXIA 2F8LA 2VQEJ 1NDLA 3FEXB 4YVZA 2XGPA 2RHQB 4KGVB 3TJ9A 5J0YA 3KLHB 5IT9O 3IXQA 2M0NA 1RDFA 2GV1A 3H1VX 1B43A 4JHDA 4BX9C 2B7CB 2E1FA 4IQXA 3GR0A 4Z4FA 3V4IB 1UT5A 4DUYJ 2HQGA 2HWHA 3QBXA 2XO6A 3QU7A 4MIAA 2Q3SA 3WNFA 4LQ9A 2UZAA 2VANA 1FX4A 1Q8BA 3C15B 1ZQXA 2R3VA 2VJ5A 2G4BA 2R7XA 1QQ6A 2R8JA 2BCVA 3BR9A 3DXKB 2BKPA 3B4MA 4USKA 4I29A 2PFQA 1N34J