1U47A

Cytosine-8-oxoguanine base pair at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u47A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u47A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u47A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u47A01
4KKOA 5KFVA 9ICJA 3AV9A 1AROP 4EP5A 2R8KA 4IR1A 3AO1A 3LP1A 3ZT3A 2AU0A 4PHEA 4AHUA 2A1JB 3C21A 2W8KA 8ICTA 3VN5A 4DQSA 1SKRA 3ISNC 5KT2A 2GV9A 3JPNA 3SUQA 1KDHA 3AA5X 3PW0A 1J5OA 3F73A 1NOMA 1RT3A 7ICTA 1TAQA 7ICPA 4CEZA 4IQWA 2NRTA 2VG6A 2UVWA 1ASVA 4I2QA 2OYQA 5HHHA 9ICNA 1UOCA 1YTAA 3OS0A 4W5TA 3NGDA 3SQ1A 3N97B 3GIJA 1QQCA 4FJ9A 1VSFA 4O3RA 2IHNA 3MFHA 3V7KA 1D8LA 4IRKA 3B6PA 3U6FA 3RJEA 3K75D 3NFAA 2X74A 4FJMA 2G8FA 2PI4A 3T5LA 3LZIA 3PW4A 3CFOA 4N5SA 2HNZA 5IINA 4KLSA 3PV8A 3MR3A 3PW5A 2ASLA 1GOCA 2FBTA 4RPYA 7ICIA 4FW1A 3ISCA 2KW4A 4PHPA 4C8MA 3CM6A 4Q5VA 4KHWA 2YNFA 3RMAA 3RJKA 4UBBA 4DU4A 3UPQA 3TANA 3V9SA 3H8SA 4DQQA 4FLWA 4DO9A 3HYFA 4Z4CA 3DRPA 3EPGA 2G8KA 4AHSA 5DGBA 1EXNA 5KG4A 2Y1IA 4FLXA 3QETA 4ECZA 3V81A 1TL3A 5CB1A 4CGDA 4JS4A 2KZZA 4I2DA 3P5JA 1S1VA 3QIOA 4O3SA 2BE2A 4PQUA 4ZTFA 1LWCA 4ECYA 4RQ6A 2I9GA 4O5EA 3OYHA 3HSTB 5KT3A 3RR7A 5KFQA 4CFAA 1Y88A 2ALZA 4KMUA 4GLXA 2FBVA 4DQIA 2E4LA 3PX6A 2ASDA 3V9WA 4FJXA 2J6TA 4HCCA 1IH7A 5J2CA 3PVXA 4DSFA 4PGYA 3NE6A 3OYJA 4BDYA 3VQ5A 4F92B 4LY7A 4IQUA 3T3FA 2BKEA 4J9MA 2R8HA 1U49A 1QSSA 4O3QA 1SUQA 1Q9XA 1S0VA 2G8WA 2PFNA 1IG9A 3HP6A 4KHYA 5FRNA 4QCLA 1RZTA 3O3HA 3OS2A 4NXZA 3V4IA 1UT5A 4KTZA 4HUEA 2RF2A 4F5RA 3SQ2A 1JLCA 4YFKA 1MQ2A 4KLLA 5J2EA 4NLNA 2FMQA 1TV6A 3G6YA 4ECXA 5KFMA 5CYQA 4DTUA 9ICIA 1MSWD 2KZMA 4ID5A 4CEAA 4I28A 1RPLA 3GV7B 4DL2A 3NH0A 3Q8LA 3H4BA 2ISPA 4MEYA 2RPIA 4M3RA 1XS9D 1S9EA 9ICHA 4Z4FA 3V72A 3KJVA 2VANA 1BCMA 4DEZA 3BGRA 4E0DA 2J6SA 4IFVA 4L8RB 5DLFA 4UB5A 1CZBA 1Q8IA 4ED7A 5HP1A 3C1ZA 3H8WA 4CJEA 2DFLA 2NRXA 3VQPA 4P4OA 5KFWA 2R8GA 2OZMA 4UAZA 5J2IA 3EZ5A 1HNIA 4ICLA 1KLMA 7ICJA 3LANA 1D9FA 4QZ9A 4CCHA 3NBPA 1C0UA 1RYRA 4F5OA 1ZQHA 5I3UA 3JPRA 1ZQUA 2C2EA 2JLEA 2HHQA 4JUZA 5KG7A 1WSEA 4I9QA 4RUCA 3KHRA 4ELTA 1QLNA 2FC0A 3BQTA 3DM2A 4CJ3A 1XSPA 2YHAA 7ICSA 3F9KA 3RMBA 4KLFA 3ZSQA 4J2EA 3RH6A 1C1CA 2IS3A 1IXRA 4FLTA 8ICJA 4FLUA 1J9AA 2BPFA 2OPQA 1JL1A 5FRMA 2AJQA 3MDAA 4F4KA 9ICLA 3K4GA 1HNVA 4DL7A 3MXMA 2B6AA 1Q9YA 2FPKA 4JV2A 4KLMA 2JEIA 9ICEA 3DYAA 1ZQWA 3OYMA 1T8EA 3PR5B 2C2RA 3DLHA 5KG6A 3KLFA 2VA3A 4IG0A 1QSLA 4DQPA 3K57A 3ULDA 3RJGA 2D0CA 4F50A 4KLDA 3G0ZA 4DS4A 4NYFA 1NJXA 1C7YA 2ZJ8A 3GV8B 4KTQA 3U3GA 3UXNA 4FJNA 3SPZA 3IAYA 5HRSA 2R8IA 3SV4A 1ZQSA 5D46A 2DFEA 3RRGA 5J0YA 1GOBA 4C8NA 4JV0A 3L2VA 5CHGA 1QSYA 1VRUA 3SUNA 1VSMA 1EKEA 3MABA 2WOMA 3SQ4A 5IIJA 2F8TA 1VSJA 2MUTB 1WAFA 4I9LA 3K5MA 2YNHA 2HHUA 7ICQA 2XY8A 3CQ8A 4QOZB 2KFZA 4EYHB 5KFEA 4BWJA 3RTVA 9ICMA 4M9LA 4OKEA 1CEZA 2HVHA 3IG1A 5J2KA 4KLGA 2X6NA 4PA1A 3BQ1A 2B5JA 3OSPA 3AO5A 3M9NB 3MECA 3HP9A 1L5UA 4NCBA 1D8YA 3OHAA 3T5HA 3ZSRA 2BR0A 1VSHA 3OJSA 2H5XA 3PX4A 1S6QA 4DTMA 1JX4A 3GIIA 3SYZA 4CEDA 4DTOA 4I29A 9ICKA 4C8OA 3MDCA 3AVKA 4AHTA 5EWGA 2P1JA 4LSNA 4CJPA 1TKTA 3LAKA 3LP2A 4M45A 2W9AA 4CFCA 5J2AA 8ICCA 4IFYA 4CGGA 3TAQA 3AVHA 8ICKA 4Z6DA 4UB1A 3EWAA 3V6HA 4FBTA 4QAGA 1RT4A 1ITGA 1I3AA 4O5KA 5HROA 2DFHA 5F9LA 2IOCA 4RQ5A 4FJ5A 5IILA 4FXDA 4FW2A 2PXIA 3NAEA 4NLGA 3MR2A 4IRCA 5KG0A 2ZE2A 3AVCA 4N41A 5J2NA 3LDAA 1SKSA 4KLUA 4KRFA 3S3OA 1WSIA 1NOZA 4J2BA 3JPSA 2BQ3A 3KD5E 1WSFA 4GXKA 3VQDA 3SV3A 4CJUA 5KT5A 1ZQCA 3S3NA 1VSDA 4CJFA 2D5RA 1Z3EB 3C94A 2ISOA 3T1AA 4RW9A 1VRTA 3H7IA 3NTUA 4QZGA 4MFBA 2W9CA 2FPMA 3RBDA 4UB2A 2DPIA 1DTQA 4HUGA 4KN7A 4K4IA 1BISA 1UA0A 4J9OA 2ZUBA 4UQGA 3DI6A 1XHXA 1A5VA 5CZ1A 1NOYA 3UQ2A 5K14A 1D5AA 4Q8EA 1VSLA 3RB0A 7ICRA 1RT2A 2PZSA 3MEDA 2UVVA 3LWMA 4CF8A 3MFIA 4DFJA 4MQ3A 1RBTA 1VSKA 3ZT1A 1IO2A 1BQNA 3L2WA 3KKSA 3MEGA 3JSMA 2G8VA 2P6UA 1U4BA 4KV8A 4RQ7A 3TQ1A 4ED0A 2W8LA 3N4MB 1KVCA 1JLBA 4DOCA 8ICFA 3SQ0A 4KHSA 1BPZA 4BE2A 4QZIA 2XY5A 1MC8A 9ICVA 1CUKA 4YMMA 5CA7A 1TGOA 3OJUA 9ICAA 3RJJA 3MGIA 4EBDA 4ID1A 1T03A 4E7KA 2XO7A 3TAPA 1TKZA 4F5QA 3PMNA 5EOZA 4KLOA 3PW7A 1J53A 3OYCA 3VQQA 2VG5A 1VSIA 2OPRA 2YNIA 4DS5A 4OKJA 5KFIA 5DLGA 4KB0A 1UT8A 3HPHA 3AU6A 4PWDA 4CHZA 5HP4A 3Q8QB 4RQ1A 1WN7A 4M3TA 3OYGA 8ICYA 4MF2A 4B3OA 5SZTA 2M9NA 4QWBA 4J9LA 3I8DA 5EWFA 4J9NA 2ATLA 3V6JA 5HMLA 1S6PA 2GUIA 3HO1A 4FK2A 3RJIA 3ZSYA 5DKWA 2OPSA 3MXJA 4M9NA 3L3VA 1ZJNA 3E2EA 3LP0A 3V1QA 2VG7A 4BXOB 4CJWA 3H40A 1ZQBA 4FJKA 2P5OA 3RAQA 3NF9A 3MEEA 2E6MA 1CZ9A 2NRZA 4CGJA 4RPZA 3OY9A 3NH2A 8ICHA 1A77A 3UXPA 5DG9A 3RH4A 2IC3A 3T5KA 4CFDA 2F8SA 4CEEA 3PW2A 1A5XA 4E7LA 1JN3A 5C42A 4CE9A 4KLTA 1TL1A 3VQ7A 3OYIA 3RBEA 5SWMA 1TV9A 3QNOA 2O4GA 2I1QA 1U47A 4FZZA 9ICQA 1NK6A 2VA2A 1ZETA 2Z1IA 1ZQJA 1IKWA 4UAYA 4CECA 4M3YA 4HCBA 3AVGA 1NK9A 4E7JA 4LZGA 4OPJA 5J0UA 5KFLA 4CHPA 4E89A 4E7IA 4RNNA 2FMSA 2XGPA 3LAMA 2NRVA 1F21A 4UBCA 3FYHA 5DB8A 2JEJA 4NLKA 4H4MA 1KFSA 1FKPA 1EXQA 2HHWA 1X2IA 3K5NA 3KLGA 1TVRA 8ICPA 2UVUA 1QS4A 5KG3A 3ZSVA 3HM9A 5L1JA 1WCNA 3C6UA 5HMMA 4OGEA 3EYZA 1T05A 5KFUA 2ZUCA 4UB3A 4HVJA 4QW8A 1CLQA 1HQEA 3ZT2A 2PY5A 3E01A 9ICPA 4CF0A 1TAUA 1ZQDA 2QKKA 5KFRA 5J29A 3QO9A 4I2IA 3AVNA 8ICGA 3BQ0A 3SUPA 4EZ9A 4FJHA 4YXJA 1S10A 3ZT4A 4K4GA 2YKMA 4F4ZA 5CP2A 4DTRA 2P51A 3HK2A 1SZPA 5J2DA 5KFSA 5DQGA 4NCAA 4W5NA 1ZQZA 1JIHA 2R8JA 3AO2A 1B92A 4F3OA 1N56A 1NK5A 1RYSA 4YNQA 4E19A 1ZQEA 3JPTA 4CIFA 1UA1A 2XCPA 3UIQA 4R8UB 4DG1A 4F93B 4FJJA 4ZHRA 4DL3A 3HPGA 2BHNA 4R8UA 1FK9A 3RR8A 1Z25A 2OWOA 3QIPA 3O3GA 5DQIA 4XRHA 1BPYA 3NH1A 1NK7A 1ASUA 3Q8PB 4J9PA 4M3WA 3AU2A 4EZ6A 1JLAA 3KLHA 1D9DA 1S1XA 3AA2A 3OSNA 4CF2A 2ZTDA 2XHBA 1JXEA 3VQ4A 5KFAA 2ZQBA 3Q8RB 3M8RA 2BCUA 1EP4A 1REVA 2KQ2A 3SCXA 4KLHA 1NK8A 2ZD1A 1XSNA 1XC9A 4Q8FA 4M0AA 3OYDA 4TUSA 4DFMA 3TAEA 4KHQA 3LPUA 4EEYA 2JZBB 1RTIA 3RMDA 4J9RA 3WNGA 4DFKA 4O44A 4ED6A 2OPPA 4K4HA 3HL8A 4ED1A 3PUFA 3THVA 5J0XA 5KT6A 3OS1A 1ZBLA 4DF4A 3ZD8A 4BACA 1R0AA 4CERA 4I2BA 1SL0A 5DQHA 1ZQYA 3WNFA 4Z4GA 5IIMA 2RDIA 4O3NA 3VQ8A 2AQ4A 3AUOA 1JXBA 4Q0BA 4B08A 3V7JA 4XIUA 3VQ6A 1G15A 4RNMA 4RG8A 8ICAA 2JEGA 2ATQA 4Z4EA 5CYMA 9ICOA 1ASWA 4JWMA 3V7LA 4C8KA 4HUFA 5J2GA 4KREA 2HNYA 4I2EA 4DL4A 5EWEA 1NJYA 4AH9A 4BGDA 4ECRA 3P1GA 1UWBA 4TURA 3KK1A 2A1SA 1BPEA 1ZQIA 3C5FA 4LD0A 4RQ2A 3RB3A 4QZBA 1BI4A 4CF9A 4H4OA 1RDAA 1RDBA 1BIUA 3JPOA 2BCVA 4FJ8A 3G6XA 9ICCA 1BPDA 7ICOA 3B0YA 4J9QA 4QWEA 3KIOA 4C8LA 1LAWA 1JKHA 3DRSA 1XWLA 5KFJA 4YR2A 2BANA 4I2FA 2XC9A 3S3MA 4YXMA 3PMLA 8ICVA 2P5GA 3HWTA 4RW8A 4F2RA 1SKWA 5J0TA 3OVNA 4OGCA 4BWMA 5KFHA 4QZDA 1QTMA 5DB7A 1BVSA 5CR0A 4R5PA 3KHHA 5IIOA 1S0OA 4DSKA 3Q8KA 3OHBA 5KFGA 5J0OA 2XY6A 3OYLA 3NCIA 5J2JA 4BXOA 7ICVA 3OYNA 8ICBA 1BPXA 4DSIA 1KLNA 4RUAA 4CJRA 1BPBA 3L2RA 4RQ8A 1RBUA 2KZ3A 3H8JA 4G1QA 3A2FA 4FM0A 1W9HA 4OKKA 2BPGA 3QEPA 3Q8SB 5L1IA 3ZSWA 3SI8A 3DOKA 1LWEA 1WAJA 2DTUA 4QZ8A 4YR0A 5T7BA 3ZSOA 2BGGA 1KSPA 5KFXA 3AO3A 4CJSA 1ZQVA 2G8HA 4YG2A 3K59A 2ITGA 2IA6A 3HXMA 4Y1DA 4CHYA 4NCGA 1FKOA 4YMOA 3ISBA 1LWFA 5CWRA 4FM2A 8ICOA 4Y1CA 2BDPA 2P6RA 4Z6EA 2OZSA 4Q44A 4PY5A 4YCXA 4F8RA 1NJWA 4CGHA 1RT1A 5L1LA 2B21A 4KAZA 4ZTJA 9ICBA 3NF6A 4KITB 2HHSA 1TK8A 3HX0A 1RBVA 3TFSA 2O4IA 3AVMA 4QWDA 3QEWA 4K8XA 2BGWA 1TVAA 4H8KA 3VA0A 4CJLA 4Z0UA 4AILC 4PHAA 4CJVA 3C2MA 3QINA 1ZBIA 2HB5A 9ICGA 1ZQRA 4I2JA 8ICZA 4QWAA 1XO1A 2X78A 3SZ2A 3HT3A 1HYZA 2ZJAA 5KFPA 3G6VA 4KHUA 5DK5A 4ZH4A 4IQVA 5HNKA 2YNGA 2WTFA 2PYJA 4M3XA 5BOLA 4CGFA 3O4NA 2Z1JA 3MXIA 1ZQAA 4KPYA 3LZJA 5FROA 1WCLA 2VA8A 1MU2A 4DSEA 2P66A 4DL5A 4I2AA 3EPIA 1K1QA 4QW9A 4IRDA 4M2YA 3TWHA 2A1JA 3DLGA 4I2PA 4RT3A 3QESA 4ECTA 4JS5A 4YD1A 5DGAA 1JMSA 5DMRA 1Z26A 4OLAA 4MFAA 4YR3A 4DFPA 1LW0A 4KHNA 5J2QA 3UQ0A 1I39A 4PUOA 8ICIA 4BE0A 1O1WA 1A5WA 1LV5A 3JYTA 3HVRA 4XQ8A 4EP4A 2NRWA 2C28A 5J2FA 4ECSA 4CK3A 4O3OA 4Q45A 4IKFA 2IMWP 3EY1A 2XY7A 1IM4A 1RXWA 1HJRA 4EBCA 3KHGA 3UXOA 4NLZA 2I5JA 3KKRA 2HNDA 5C24A 3RB4A 2AGQA 4DF8A 4M47A 5KG1A 3TAMA 4HTUA 4NY8A 1U45A 3H08A 1J54A 1T3NA 3CG7A 1K1SA 4CJTA 4B9NA 4M42A 3O3FA 4DSJA 4Z6FA 5J0RA 3AO4A 3TR8A 3K5OA 1S77D 4DOAA 3PX0A 4TUQA 3DLBA 4DWIA 3QEAZ 1ZQXA 9ICFA 3TARA 2PI5A 4FS1A 5KFDA 3KLIA 5C5JA 4FZXC 2KFNA 4CEQA 3RJFA 1XI1A 4GC7A 1COOA 4O5BA 1ZQFA 1BI4B 4LVSA 4P4PA 3GV5B 1HUOA 3I0SA 4KFBA 5BPCA 2WONA 3KD1E 3LWLA 4ECQA 3ZDEA 4B9MA 3VA3A 2HW3A 3ALYA 3Q8MA 3MGHA 1DTTA 4BDZA 4ECWA 2DPJA 5DBBA 2D0AA 1VSEA 3V1RA 3RH5A 7ICGA 3RJHA 1T4GA 3V6KA 1EX4A 1ZQNA 4JWNA 3C23A 2G8IA 4MFCA 4O9MA 3AVAA 1FXXA 5HRNA 3D45A 1HPZA 2MUTA 3NF7A 4RW6A 4DTXA 5JS1A 3C2LA 4O3PA 4PPXA 2BQUA 3V6DA 1ZBUA 3BJYA 2DFFA 5KFYA 1BL3A 4N47A 7ICFA 2YKNA 1S0MA 4ED8A 4IDKA 1KCFA 3OYKA 3GIMA 4FM1A 3K2PA 4DTSA 5BOMA 2B4JA 3QLHA 3FDSA 4TUPA 4RW7A 1ZBHA 4M6WA 3MR6A 1RXVA 5DBCA 4FJIA 1YVUA 5D3GA 4EYIB 1RT7A 4DU3A 4KLJA 5KFOA 4RW4A 3OYEA 3ZSZA 2J6UA 5DDYA 2AGOA 4TSXA 5KT7A 3JPQA 4GVMA 2XCAA 5CZ2A 4RQ3A 2IHMA 2W42A 1ZQQA 3L2UA 3IM1A 3KTQA 4AHVA 2V4RA 1VK0A 3PY8A 3L3UA 4JV1A 5HBMA 1RT6A 1K6YA 4M9HA 4ELVA 3WNHA 5IIIA 1S9GA 5J2BA 4F5NA 4O55A 4CJQA 5KFTA 1TKDA 1C0MA 4JRQA 3MR5A 3M9MB 1MQ3A 5KGXA 3QEVA 3IS9A 4LH4A 5HLFA 1HMVA 3KK3A 5DG7A 4O0IA 3G10A 1CXQA 2IDOA 1HYSA 4CHNA 4F2SA 3RMCA 1SL2A 5JS2A 4B9UA 2X6SA 4KLEA 1S76D 5J2MA 1U04A 3AVIA 2JGUA 2R7YA 4RPXA 8ICQA 3LALA 2Q0ZX 3L8BA 1JL2A 8ICWA 1PZNA 4K8ZA 1KFDA 2F96A 2F1HA 3AVJA 2XGQA 3CFPA 4CHOA 1ZBFA 4O4GA 4DSLA 3V9ZA 4PGQA 4DU1A 3IHQB 5KFFA 1ZQMA 5L1KA 2RN2A 4FLYA 1UAXA 4GXIA 1NK0A 9ICWA 3O4QA 4HYKA 3TI0A 1HUZA 3ZDDA 2BQRA 1BIZA 1U9LA 2HHXA 4ED2A 1X9WA 7ICKA 1JLGA 2LSNA 3AVBA 2KN7A 3B6OA 1TK5A 4GW6A 3AVLA 4FZYA 2EX3A 1YT3A 1YTUA 4FCYA 1GOAA 4FJ7A 4J2AA 1RBRA 1EETA 1L3SA 1TK0A 1KTQA 1L3VA 2HVIA 5KG2A 3KHLA 3ZT0A 2G8UA 4HHTA 5F9NA 1Z00B 1NKBA 3M8SA 3M9OB 4E1MA 4QZFA 3D0PA 4B9TA 1Z00A 5KRTA 1LAVA 3K58A 8ICUA 3ITHA 2BCSA 8ICNA 5E41A 4IQTA 4J2DA 3L2QA 4CJ4A 1XHZA 3QZ8A 1DLOA 3HPOA 7ICEA 3OYFA 1NJZA 4KN4A 2FLNA 4CK2A 4CEFA 2F1JA 4F5PA 1B9FA 1S97A 1S1WA 1ZQGA 1XU4A 8ICMA 1BCOA 1RILA 3ETLA 3VQEA 3GDXA 1N5YA 4BDPA 1S9FA 4TQSA 4PHDA 5D49A 3SPYA 3ZD9A 5IIKA 1QHTA 4G3IA 5KI6A 4YMNA 4UAWA 1Y97A 4AHCA 4F91B 1WSJA 4R63A 5I42A 1LW2A 4OPKA 1C0TA 3VQAA 3TAGA 5L9XA 4QWCA 4CF1A 4YP3A 1U48A 2W9MA 5D4BA 4FBUA 4KI6A 3GQCA 4F4WA 3TABA 1RT5A 1NKCA 5KFNA 7ICNA 4O0JA 4B8CA 5HRPA 4F4YA 1ZQTA 4FVMA 2C22A 3NHGA 4P2HA 2A1RA 2ZUDA 3VQ9A 1L3TA 4CJKA 3KK2A 8ICXA 4KLIA 4YN4A 4Z4HA 4IG3A 3QEXA 3ZDBA 5KFKA 2QK9A 4KTWA 3DLEA 8ICLA 4E3SA 3TAFA 3LPTA 1WSGA 3PO5A 4QZEA 3DRRA 1ZYQA 4OJRA 4MF8A 5FDLA 4DL6A 3NF8A 5DB6A 3I0RA 2FPLA 2Z1GA 2W9CB 4RNOA 1BHLA 3NGYA 4NM1A 3OGUA 1HRHA 9ICTA 3C1YA 2MAXA 4UB4A 3GFKB 4DLGA 1RCHA 2Q3SA 3LK9A 5HHIA 2PFOA 4B9SA 2ZJ5A 4FO6A 1JLEA 1W0HA 3EW9A 1RNHA 4B8AB 2BCQA 1B43A 4ECVA 5KRSA 4R65A 1RTDA 1SL1A 1B22A 1B9DA 3HJFA 2FMPA 3V1OA 3M8QA 1NKEA 7ICHA 4DLEA 1ZQOA 2DY4A 4F3TA 4XUSA 4N56A 2XRIA 2VWKA 2D0BA 2IBKA 5HRRA 2EHGA 2JEFA 8ICSA 3HVTA 4Z4IA 4CEOA 3DLKA 2C2DA 4M3ZA 5KGWA 2JZBA 3MAQA 4W5QA 2FLPA 2QXFA 4M3UA 2LYHA 1ZQLA 5EU7A 4GXJA 3C5GA 4YQWA 2UVRA 4CJ5A 1RBSA 3QE9Y 3SUOA 1N48A 4GMJB 4MEXA 5JUMA 3ZCMA 4CESA 1ZQPA 5DDMA 1C6VA 7ICUA 4FLZA 1C1AA 4X5VA 2IGIA 1X9SA 3AA3A 3NGIA 2PYLA 1JLFA 4CEBA 3V9XA 1T7PA 4ECUA 2BPCA 2V4QA 5J0PA 1HYVA 3QNNA 1WNSA 3WNEA 5DG8A 5DB9A 2E6LA 4J9SA 1KVAA 5KFCA 4R66A 4Q43A 1IKYA 3PNCA 4E1NA 5C25A 3S9HA 4DQRA 3TFRA 9ICUA 1WLJA 2HHVA 4CHQA 2ZTEA 4CFBA 2ETJA 3M8PA 1RTJA 4XA5A 4F4XA 3QERA 3QEBZ 4ED3A 1S1UA 2KTQA 1LB2B 4YVZA 3QEIA 4PGXA 4RQ4A 1ZQKA 4CIGA 1C1BA 1S5JA 3B0XA 4ELUA 4OVLA 4JK1A 3CM5A 2FBYA 7ICMA 3MBYA 8ICEA 4O5CA 1HQUA 4KO0A 2GWSA 1JLQA 4R64A 3VQBA 1KFTA 3ZSXA 1QE1A 3K5LA 3ISDA 3U3YA 2PFPA 2W9BB 1RTHA 4M04A 3C6TA 4I2CA 2ASJA 2YHBA 4MFFA 5KFZA 4W5OA 4KLQA 2GBZA 2AQ0A 3LDSA 4FJLA 4FLVA 5TZVA 3HW8A 2HMIA 4PH5A 3RAXA 2RDJA 1S1TA 4B9VA 1L3UA 1SV5A 1X9MA 5J0QA 1ZJMA 4TQRA 5CY4A 4I27A 5KG5A 3P83D 1S0NA 4QZHA 1KRPA 1RDCA 3NGZA 3C2KA 1HJPA 4RZRA 4WE1A 5J2HA 4YD2A 4M41A 4CGIA 2HHTA 5J2PA 1RDDA 3OYBA 1DGSA 4B9LA 4IR9A 3IRXA 3OYAA 4QZAA 3ZDCA 3JPPA 3QZ7A 4M6WB 3FFIA 4E7HA 1A76A 3PR4A 4P4MA 4RU9A 4I2GA 4M9JA 4AHRA 4KI4A 2W9BA 1V9PA 2VWJA 3DMJA 2NUBA 5DBAA 3T19A 3AVFA 1BGXT 5KT4A 3C95A 4I2HA 4FK0A 3GIKA 3DLRA 4EBEA 1BQMA 4DTJA 1XSLA 3ZDAA 3NDKA 1CXUA 2Z1HA 3ORYA 3RWUA 4LZDA 3RRHA 3BDPA 4FJGA 2QKBA 4W5RA 1IKXA 2F1IA 4NYNA 4I7FA 2BCRA 4DTPA 4JRPA 2V9WA 3H4DA 4N76A 3VQCA 5KFBA 5J0WA 4DTNA 4NM2A 4FS2A 1NK4A 3GILA 3DOLA 4Z6CA 2PFQA 4LH5A 3T5JA 5CJ7A 1WSHA 1DOQA 2Y1JA 4CIEA 4DMNA 5J0SA 2YV0X 5KTQA 2FLLA 4GC6A 3V9UA 1KVBA 1IKVA 3ASMA 8ICRA 7ICLA 3LP3A 4YFUA 4CK1A 3PO4A 3CFRA 1TFRA 3CYMA 4M9GA 3SJJA 4KB1A 2ZTCA 4RQ0A 3KLEA 3BQ2A 9ICSA 4IBNA 2IAJA 2OA8A 4RT2A 1TKXA 1N6QA 1JXLA 5J1EA 1KEJA 2FBXA 3SNNA 9ICXA 3RB6A 4OLBA 3SI6A 4JLHA 3AA4A 4QZCA 1X1PA 4BE1A 4J9KA 4DOBA 9ICRA 2RKIA 4FK4A 4LSLA 4FYDA 2AGPA 1H38A
chains in the Genus database with same CATH superfamily
5KFVA 2GFFA 3U4LA 2GTDA 3AV9A 4CLZA 2E1FA 3TZWA 4PHEA 3CTRA 3DLGB 1ZD3A 1VCTA 1ACMB 5KL1B 1LFPA 2QT7A 2C2OB 3VN5A 2EZZA 4BC7A 1SKRA 3ISNC 4O4GB 2ACMA 4NEZA 2XSFA 2GV9A 3CPWM 3SUQA 4LIRA 3RSEA 1IJJA 2N3OA 1TAQA 3J81O 3BS7A 2O66A 3VZIA 4IOCQ 3FC4A 4PCQA 3N28A 5EX0A 2NRTA 2JVOA 3UPFA 5IV4A 2SXLA 4PPDA 2G4BA 1OPIA 4I2QA 5ITHA 2RHKA 3W60A 1WWVA 2KXFA 3FSYA 1YITS 5BRHA 2MSSA 1XMQJ 1QQCA 1N62A 3MFHA 5JMVA 2OM6A 4K4ZA 3V7KA 1D8LA 4IRKA 3B6PA 2WVEA 1ULRA 4EGLA 3NFAA 3H5YA 5FD1A 1APSA 2UV8A 3QWUA 2YNIB 2CZ4A 4HTIA 1REGX 5IINA 4XH4A 3ZEUB 4RPYA 7ICIA 1S48A 4B17A 2R2RA 2KW4A 2I38A 3JSMB 3GJQB 4C8MA 3CJ8A 3J81U 2NZTA 3RMAA 3CO0P 4UBBA 3MDFA 1EHWA 3MI7X 1VLBA 1CC7A 3V9SA 4NRUA 2K8GA 1MA9B 2F3JA 3S6EA 1N32F 1JWWA 3AXKA 1WI6A 1RAIB 3LH2S 2AKWB 3CCQS 1EXNA 5KG4A 3V81A 4YOEA 4BR0A 2N82B 4A8KA 4EENA 2BE2B 4CE6A 5ALSA 1PVQA 3QIOA 1R8HA 3HTVA 2H5JB 2KL8A 5FP0A 4DZ6A 3OTOJ 1LWCA 4ZTFA 2HHHK 1Q53A 4RQ6A 4WQ4C 1JKHB 4K42A 1NI3A 4E1JA 1YG0A 4RWWA 1ZA1B 3KVGA 3TUZC 5KT3A 3RR7A 1RTHB 4JI5F 4KMUA 5EX3A 1QHAA 1Q7YT 2DHAA 3V9WA 1NGGA 4DR1K 5GMKa 1FKOB 4HCCA 3TVYA 2O8EA 2BJ9A 4DSFA 1W2BM 3DN9A 3V5RA 4CLWA 1XNQK 2OTLN 1RSCA 4AF1A 2VHGA 1DHMA 4O3QA 1WHWA 2NZCA 3L4BC 4ZA1A 3IG5A 2Y9UA 2G8WA 1CSJA 2QI2A 2ZIXB 2Z8QA 1KDNA 4NXZA 4WFAL 5LJWA 3VEWA 4PQUB 2YY6A 2RF2A 2BM1A 1J6ZA 1JLCA 1MQ2A 1V3RA 4DTUA 2HS4A 3L5KA 2FF6A 9ICIA 2W01A 4CZCA 1H98A 1KLMB 2FUG9 4DV0F 3VQTA 4KQZA 3HSGA 2MLYA 3ATVA 1RPLA 3CJ7A 4DL2A 4A61A 4ALZA 4CLFA 2FZKB 4F02A 2IFXA 2CJAA 2ISPA 2XSJB 4RO0A 3ZTSA 4DR6F 2YMLA 5KAIU 5A8WB 4BG8A 3T9ZA 4YB1P 1BCMA 3BGRA 4I6MA 2KJ8A 4PXCA 2XLJA 2DH8A 4HDHA 4NEYA 3ILOA 3M8QB 3BGUA 1YZ6A 4PZNA 1CZBA 2IRYA 3VGMA 3MCMA 3GG0A 3D54A 3BZCA 4ED7A 1WOOA 3RZAA 4DV4K 3N4PA 2EZXA 2VQEF 4JKFA 3FCVA 5B0EA 3E9OA 1OQ3A 2M0GB 4BC5A 3MURP 3UCGA 4UAZA 3W1YC 5D3GB 2Z2LA 5J2IA 2ZBPA 3PXGa 2CRXA 2XMAA 3QUTA 2Z2ZA 2GVZA 4PHTX 4F5OA 2FVQA 1HHQA 5I3UA 1OIAA 2OFGX 1KAYA 3TA0A 2M70A 3JPRA 4WFBL 4K0KF 5D77A 3E9LA 3W62A 4RUCA 4FYVB 4B1UB 3T6JA 3POTB 4BRNA 3HKZC 1X40A 2P9PB 4GVEA 2Y9TA 3TO8A 5IC4B 1IBKJ 3KUHA 2ZZNA 1IXRA 1JJHA 4DB3A 4FLUA 2VPYB 1N34F 2E1YA 1ZRMA 2LMRA 2KFYA 2MKYA 1O08A 2E2QA 1JL1A 2KJ9A 1RG6A 1VLOA 1WDDA 3QRPA 2G2YA 1CJKB 3BEGB 2BEFA 5LL6Z 2BTFA 1VRUB 2B6AA 3QUQA 3AJDA 3THYB 1XR6A 1UTAA 2JEIA 3D9BA 5KG6A 3K57A 2JV3A 1MA7A 1SWWA 2QTWA 5ALPA 4MJKA 8AT1B 1IBCB 2ZHOA 2D0CA 3CCSN 3ISND 3QGHA 2AJFE 3ZTPA 4DS4A 1BWVA 1VRQC 1FJGF 2IM2A 2FD2A 3GV8B 3AA9A 3U3GA 2ZXIA 1N8RT 2CPJA 3CP8A 4NZ0A 2IJFA 3IAYA 2FTRA 2ZHBA 5HATA 1VQSA 2D3ZA 4LF1A 2XZTB 4C8NA 1UJ5A 2BOAA 3FEXB 2LA6A 2A6AA 4L72B 2MYFA 2YX8A 2F8TA 2G08A 1BOTO 2MUTB 2HYIB 3SQOP 2YNHA 2HHUA 3C6UB 4OYPA 4H0VB 1URRA 2QA4G 4B3SK 3IGNA 4EYHB 3SSQA 4RTFD 4Y2MA 9ICMA 3LDLA 4OKEA 3E01B 2RHQB 2FHJD 2PMZF 3N9UC 5J2KA 1RGIA 1Q82T 4DFDA 4AT1B 4PA1A 4CF3A 3BQ1A 3OSPA 4G1QB 4IH5A 1S7HA 3HP9A 4NCBA 1PAEX 3QT7A 2FJWA 1SGGA 4M5HA 3H2LA 1VSHA 2H5XA 2GMLA 1JX4A 2HKEA 3DRSB 9ICKA 4C8OA 2ZWPA 4AHTA 3R3TA 4LSNA 5BRDA 4CTAB 2H3QA 5BN9A 2C2ZB 4CFCA 4NOHA 3OTDA 4PRFA 3BS5A 1ZA2B 5BRFA 4DHVA 3TAQA 3AVHA 2CG8A 4X62F 3ED5A 3BH6B 2UXDJ 4JEPA 4QIFA 1FXLA 2ZNZA 4P74A 4QAGA 2RJZA 4U95A 3FZHA 4AP9A 2A3VA 3PKYA 2W2MP 4LSLB 3AA8A 4FJ5A 2PXIA 3Q22A 3V4MA 1RBLA 1VQ9S 3MR2A 2ZE2A 4PWUA 3M30B 3CJ3A 1VBYA 3ETRA 2AXTU 1VQ6S 4DR2F 3D6MB 3KNGA 4G65A 4DV5J 2GHPA 1MROA 1WSFA 1G4CA 1NPPA 1OS5A 2LHTA 3S3NA 3QICA 1QJHA 2D5RA 2PFDA 3MMBA 2B51A 2CIMA 3HHLC 3I56S 1VRTA 1VJ5A 5AQOA 5AQUA 3UB5A 3H7IA 4CT9A 1KBUA 4DR4F 4QYZJ 2FPMA 4CGZA 2DPIA 4X2BA 4HUGA 2MMYA 3R5BA 3JAMU 1Q79A 1YJ9S 2AYEA 3HILA 1WOPA 1R89A 3SCIE 3DI6A 5CZ1A 1NOYA 4G9BA 7ICRA 5K4LA 1UAWA 3DU6A 3DXKB 4NE9C 4CF8A 3VTIA 3WKAA 3A0IX 3MCNA 4DFJA 4MQ3A 1MMDA 3ZZYA 4AFFA 1IO2A 3UN2A 1ZTTA 3KKSA 3MEGA 5GMDA 1YTYA 1LFWA 5FLXO 4IH6A 2ZUGA 2J76E 3W2WA 1ZM9A 5RUBA 2P6UA 1YHQS 3VHQA 2HHHF 2AF6A 3N4MB 4JB8B 3SQ0A 2FI1A 1BPZA 1DK3A 4QZIA 2XY5A 3BS9A 3HHNB 3W0LA 1CUKA 1ESVA 1NUEA 5CA7A 1VQYA 9ICAA 3RJJA 3MGIA 1R43A 3J7YP 4F5QA 3PMNA 4KLOA 3NCRA 1Q78A 3PW7A 1XQSC 1FRHA 2FE9A 2FJDB 3VQQA 3L9ZA 2QWRA 5IT9U 2GW8A 4ER8A 1Q8KA 5D4PA 1KAZA 2B3TB 1U26A 3HPHA 5HP4A 2VODA 4M3TA 3R6LB 8ICYA 2K7JA 2WBRA 2C3OA 4RJVA 3W65A 5LMNK 4HHHA 2KICA 3I8DA 4QWBA 2D3UA 5G0RA 3CMEN 1S6PA 4FK2A 3RJIA 1L7OA 2LEBA 3U8XA 1ILYA 4JKGB 1XNRK 1ZJNA 3E2EA 2DNOA 2GIQA 3G6ES 1B64A 4BXOB 4CJWA 3GFHA 4X66K 4FJKA 4HAIA 3M1VA 1LNQA 3ZZUA 3VALA 3LP0B 4PABA 1BE4A 1CZ9A 2NRZA 4CGJA 3NUQA 1S49A 4CWBA 2F8KA 4ETXA 3C3LA 5DG9A 5C42B 3ZTQA 4CLPA 4DR6K 2IIRA 3IFRA 2L08A 4KFBB 4FWPA 4B1WB 1VFJA 2G2ZA 3TEHB 3IAM9 3CC2N 3QNOA 2I1QA 1U47A 4YEAA 1HX1A 3S7RA 4B02A 2Z1IA 1ZQJA 1IKWA 2V67A 1BQMB 3OUYB 5HO4A 1NK9A 4E7JA 2E20A 4E7IA 4NL5A 4JMUA 3TTFA 3QNMA 3R7SB 3PSPA 3WEEA 1FVSA 4NLKA 1NLKL 4H4MA 1UETA 1FKPA 4NI2B 4WP8A 3NNCA 3K5NA 4YHHJ 3GL1A 2FDNA 4K4YA 4OYOA 1QS4A 5KG3A 2A42A 2CXEA 3PJ9A 3HM9A 4ZP7A 5L1JA 1RKIA 5HMMA 5KPTA 5KFUA 3IP0A 1FE4A 2HRYA 4EAHD 3QO9B 1TV6B 1CLQA 2GAGC 4LBIA 1HBUB 3ZT2A 3SAHA 4Y2XA 4CF0A 1TAUA 1MDUB 5KFRA 2E2OA 2HFZA 4NJ8A 8ICGA 4FXVA 3WZ0A 2XB2D 2B5JB 1FCAA 4FJHA 2HFOA 5E2QA 3CJKA 4JAXA 2D0OA 2W4DA 1ZBTA 2YKMA 4Y2YA 3I0RB 1SZPA 3R9KA 1XNSA 4NCAA 2UUWA 3M6XA 4M63C 3IN5A 4E19A 5HMWA 5I9EB 4USHA 2CN1A 3EE9A 1UA1A 4H4KA 4USTA 4OI6A 4F93B 2OEMA 4G1IA 5IOLA 4CZHA 4QOTA 2QLBB 1UJ4A 3KLHB 3P5TL 1NGBA 3KDOA 4DV2K 1R8PA 3AU2A 4YDDB 1X4HA 3RW6A 3M3ZA 1D9DA 5GAHI 2BZ2A 4CF2A 2ZTDA 2HIQA 1IM6A 2OP5A 3RAMA 1JXEA 2PN6A 3VQ4A 3GCWP 1HNIB 4BRPA 1X6IA 2BCUA 1EP4A 3SCXA 2MXYA 4KLHA 5BPNA 4M0AA 1TUGB 3NNAA 4JI3J 4XTTA 1S12A 3EVMA 1OWXA 3NRBA 4J9RA 4OHXA 5IM0A 3DM2B 4K4HA 2YX7A 3QPIA 1KN6A 5AQHA 4DR3K 2MKIA 3EUNA 1ZBLA 2W40A 5AM1A 4BACA 3QDKA 4I2BA 1SL0A 3PCOB 5DQHA 4NXMF 3WNFA 1DARA 5BYSA 1YBUA 3MD3A 3A4TA 3MM6B 3ALRA 4PJ0U 2KKPA 4XIUA 4W4MA 3VQ6A 5H9EK 4UASA 2FQQB 3BBFA 2O5DA 1QY7A 3LM2A 3CETA 2ATQA 4Z4EA 2EZYA 4IYQA 4C7QA 1Z2LA 2KRBA 4CNYA 2FJBB 2EDUA 4C8KA 3GBTA 2G5IB 4MH8A 4P10A 3UMBA 3S6JA 4I2EA 4DL4A 1SS6A 2QWPA 3CJ0A 1OVYA 3BN4A 4QJVA 3F2BA 4ECRA 5JVGQ 4HWIA 1BPEA 1ZQIA 1SC4B 3HD1A 2VWBA 2NXNA 4RQ2A 5CZXA 3MHYA 4H4OA 2H5IB 4URQU 1DJ0A 2HG4A 3LDPA 4CBWA 1RAAB 3AGKA 4LF4K 2QE5A 2BCVA 3G6XA 3N7PD 2YN4A 7ICOA 1WF2A 5KQ8A 4ZLJA 2QB0A 4AYBF 3KDNA 2I5HA 5JU5A 1RAHB 1LAWA 1JKHA 3M05A 4YR2A 2A41A 1WEYA 2EAPA 2W3RA 2P5GA 4OLOA 2VIHA 4L73A 4RW8A 4F2RA 2NYHA 3FK4A 3ZZTA 1M1GA 4ZCIA 2E88A 4DUYK 4QZDA 1XNQJ 1VK3A 2O8EB 1COKA 2G1DA 4AL6A 1B0XA 3SBMA 3KHHA 2ZOMA 4EO8A 5CQGA 1PIEA 4QIGA 3O9SA 1WF0A 1UWBB 3OHBA 2CH6A 3OYLA 2HLTA 1U1RA 4HACA 1FJEB 5F1XA 5IWAK 2RUGA 1KLNA 3MN6A 1SWVA 3M1YA 5E26A 3WKCA 3O9QA 2YTCA 2Y1RI 1U0SA 2RF2B 3OT9A 4OKKA 2XNRA 1N5YB 3HHEA 2GMHA 3Q8SB 3DOKA 3CC2S 2OSRA 3MC1A 2CPEA 4RW9B 3TUIC 1X4FA 3R8YA 5AI4A 2LM1A 2JX2A 4M95A 3AO3A 1U2VB 4CJSA 1ZQVA 4YG2A 3SLCA 2IA6A 3DEEA 4Y1DA 3M4XA 1TL7B 1NMNA 1UZDA 1SB3C 2LM4A 5EN1A 5AM5A 2BDPA 1MN7A 3AOBA 4Z6EA 4ZJOA 2ACYA 3MPDA 4F8RA 4ZVQB 4DMZA 1XMOF 3FZBA 1CS4B 4TY9A 3CO9A 5EE1A 4LF6K 2CQCA 2HHSA 5DETA 1VAZA 2W2NP 2AYBA 3CF5Q 1RBVA 2Y1LB 4U67Q 4K25A 4QWDA 2BGWA 1TVAA 2YI1A 3VA0A 3WXKA 4CJLA 4OYAA 3JAMY 3G82A 1M0SA 1HBOB 2VKZG 3C2MA 1QD1A 4BR9A 2HZVA 2W03A 3NS7B 3M6KA 1ZQRA 4M63A 1HR0K 5AQXA 3FMWA 3H20A 5AZIB 2GO7A 3HT3A 1T03B 3TADC 1L7NA 1RXOB 2C3UA 4NLWA 5KAFU 2YNGA 2WTFA 2HS0A 3MEDB 4LF2A 2DCUB 5BOLA 4CGFA 2ITMA 2Z1JA 5HAOA 3TTDA 2JRSA 1LQ9A 4KPYA 4GNIA 4LFAK 2R7SA 3LZJA 5FROA 4DV3J 2F8HA 1MU2A 2ZH8A 1UEVA 1NGJA 4ZHRB 1L6NA 1NHUA 3PSTA 4DL5A 1K1QA 1KQSM 4QW9A 3CCUN 3AJ1A 1XR5A 5ADZA 2A1JA 4RT3A 5M1QA 1JJ2R 4ECTA 4J91A 2YKOA 5DGAA 2J7UA 3K89A 5J2QB 1Z26A 2CPYA 3FZKA 2QB1A 3JS9A 4ACOA 3JSRA 4KHNA 4NLSA 2QWLA 4BE0A 4OZ5A 1LV5A 3OTEA 3ZO7A 3HVRA 2L5YA 3Q2TC 2XI2A 2YBVA 4NYZA 3IR6B 1MWYA 3BR9A 2FJVA 3VF4A 3CMAS 4IKFA 2XY7A 1RXWA 3M7VA 4EWTA 1YKWA 4US8A 1UQVA 3KKRA 5EXWA 2AGQA 3TAMA 3CNQP 4JOUA 4CJTA 3CMES 3UR0A 4M42A 2MJNA 3O3FA 2J0SD 1C0GA 2G06A 1NAQA 3Q8VA 1R3NA 3VAGA 2LQBA 1CULA 4IFEA 1R8AA 4TUQA 4DHYA 1ZQXA 1A0PA 9ICFA 2WB1C 3W2VA 3ID8A 4FS1A 4LF9F 5AJ3K 5KFDA 1FVQA 1WC1A 2CJBA 3KLIA 5C5JA 2Y0SD 1N52B 4A46A 4DV4J 2KFNA 2V52B 1V3ZA 3LDNA 2YKNB 4JI4J 2JVRA 1XI1A 4NZ6A 4GC7A 1COOA 1NM2A 2HAIA 2XG8A 5CHCB 1ZQFA 4UTGA 5L8RC 3V2UC 3CPWR 4LVSA 4P4PA 3GV5B 4FYWB 5LXYA 2WONA 4GV9A 3LWLA 2J9DE 4ECQA 4B9MA 3HOSA 3CD6N 4U7CA 3MGHA 3WK7A 3P8BB 4ECWA 2DPJA 2H3VA 5JLFA 3SMVA 3V1RA 1KVJA 4NA1A 5FPDA 2BRKA 3BS5B 1QAXA 2QL5B 3L6QA 1JLEB 4MFCA 5ALRA 1F5BA 1OMSA 1FXXA 4K4WA 3ETOA 3MM7A 1SZ2A 2DEIA 4O3PA 2YPZA 4IKAA 2XEXA 2DFFA 3FE1A 2P9LB 3J81Y 4BRLA 4C48A 3R5DA 5BN8A 3O4WA 4MYUA 1M5HA 7ICFA 1S0MA 3OD2A 4IDKA 1G99A 2DISA 3HHDA 5BOMA 3UKUB 4TUPA 1OPZA 1H74A 4M6WA 1RXVA 2E29A 2OI2A 2E1ZA 2UU9F 4DU3A 5HMZA 2GV1A 4RW4A 3OYEA 5ALZA 2KU7A 2J6UA 1HKCA 4IS7A 2QA4S 1GK8A 2CKWA 3GDQA 5G4DA 3JPQA 3H7HB 1H2TZ 2R3VA 2IHMA 4JI2F 1ZZNA 3L2UA 3BO3A 3DGVA 2MSTA 3H46O 4JK9A 4RNFA 3PY8A 2VFSA 2UXBK 1K6YA 1QQMA 2EG1A 3WNHA 5IIIA 1S9GA 5J2BA 4USWA 4DUYF 1WB9A 1C0MA 5HBMB 4RW6B 2DGUA 1HARA 3TJ9A 2V8GA 5KNIA 4LVOP 2XI3A 4IOAQ 4RBUA 3IS9A 3CJBA 5HLFA 1X60A 2OFHX 3KK3A 4O0IA 2GOLA 2LFVA 1LKYA 4F2SA 1SL2A 5JS2A 2F7VA 2R7YA 4RPXA 2E44A 2MKKA 1PZNA 2H65B 2XGQA 2QSFA 3QUBA 4CHOA 1A6SA 4PGQA 3WHIA 1ZQMA 1Q86T 4LFBJ 1NG9A 3T1HK 2VFVA 5AK3A 3O4QA 2WAQF 1KKXA 2BJDA 4ENOA 3C65A 2Z56B 3ZDDA 1C0FA 4JHDB 1BIZA 2UZAA 4X65J 2IM1A 4JI1F 2M52A 2E1EA 3F2KA 3CCJS 4FZYA 2EX3A 3EZOA 1JCFA 4J2AA 1HI1A 1EETA 2EANA 2HVIA 4XH1A 1SV5B 5IWAF 4PXDA 2XHCA 5KG2A 3FVYA 3I82A 3KHLA 2GJ2A 5F9NA 3HHLA 3EVWA 1CLFA 3NGRA 4JKGA 3KLFB 2DGXA 2A3ZA 4B9TA 5J2PB 2KK0A 2EBGA 1YJUA 2N3LA 8ICNA 4K7QA 1FERA 1RWKB 4CD3A 1GNKA 3V81B 3TACB 1MWMA 3L2QA 3L4PA 5D0HA 7ICEA 4IOXA 4CK2A 2F1JA 1B9FA 1T9WA 3SQIA 3BY5A 1S1WA 8ICMA 2KT2A 2KH9A 3ETLA 4HH1A 2OH2A 1S9FA 4DR5F 4ZLLA 3ZD9A 4C0HA 1NNLA 2R7RA 2CG4A 4G3IA 3I55S 4YMNA 1HBMB 1CI4A 2YQ3A 3NGKA 1WSJA 1VIXA 3C14B 4WFBQ 3MWTA 2XHWA 2QL7B 1LW2A 1C0TA 3VQAA 2QW9A 4CF1A 2O8FB 4ITSA 1LEOA 5D4BA 5AM0A 2RSQA 1QZ5A 4LFCJ 1IV0A 3TABA 2EW9A 2RU3A 2F77X 3NP5A 4F4YA 1ZQTA 3P5BP 2AJ0A 3KK2B 4P2HA 2ZUDA 1FRJA 2EPIA 3VQ9A 3CNHA 1L3TA 4F3MA 1FJ7A 2PMZD 2AT1B 2EC2A 8ICLA 4E3SA 4HT5A 3BM7A 2N7YA 4K59A 2KG0A 3CJKB 1ZYQA 4X64K 4V19S 4MF8A 3B6BA 4DL6A 2FB0A 3I0RA 4GKKF 4A57A 2WVBA 1HRHA 2FSKA 4CM0A 4QS9A 1W97L 4EIAA 3IM9A 4K4VA 1FDNA 3LK9A 1X5TA 1UVNA 2PFOA 1S9EB 2XBPA 3U1MA 3EW9A 2AMCB 3QIDA 2NR0A 1B43A 4ECVA 3F53A 1N2XA 2O1PA 1J2VA 1NU0A 4XH5A 1CG2A 2X1BA 2BKNA 1NB7A 3D2WA 7ICHA 4U96A 1XN9A 2DY4A 2WRMA 1V4TA 3TUJC 2E1MC 2E7WA 4N56A 3IFEA 1Y0HA 2GNKA 3OR2B 4KH5A 2JFKA 2KHQA 2IBKA 5E7OB 2DY9A 2EHGA 3G4SN 1AFIA 2BUPA 3HSCA 3DHWC 4OZNA 3QBCA 2E1RA 3DLKA 2QEXN 3FCWA 4M3ZA 5LOQA 2FLPA 5DO2A 1Q95G 1H2UX 2VC0A 3M6GA 3AODA 3FNNA 1Q7LB 4C3LA 3C5GA 3FLCO 1ITPA 4K0KJ 3VGTA 1RBSA 3QE9Y 4CJ5A 1N48A 3SUOA 4X4OA 2MGZB 3SMZA 3CJQA 4X4TA 2ZGZA 1E3MA 2MZQA 5DZ7A 2HURA 2XM3A 4CH7A 1N33K 3TTCA 2ZIUA 1RHRB 2LKYA 3TSPA 4GO7X 5DG8A 3GFXA 1IBKF 2E6LA 2WSEC 3SQGA 2DUYA 1IKYA 3N7RC 2UXBJ 2W43A 3WIUA 3UDVA 1V5VA 2IVOA 4OJ5A 2HHVA 4LF4J 1TFYA 3CF5L 2ETJA 1S1UB 3I9V9 3M8PA 2X1FA 3QERA 4JI8K 3OR1B 5AQJA 2FVCA 4ED3A 1AZSB 2OLWA 4NRTA 2UUBF 3H5XA 3CCTA 1RU2A 1LB2B 3QEIA 4PGXA 1ZQKA 3VAFA 1C1BA 1S5JA 4M7YA 5AKEA 2DKOB 4MIAA 3NASA 3VVTA 2ZBIA 5G5HA 4RX6A 4KO0A 1VQNS 3K5PA 2GWSA 1OO0B 4FSVA 3D5MA 3VQBA 3ZSXA 3TZZA 4GRSA 1Y3JA 2I9SA 1YK9A 2ASJA 5AKHA 4KLQA 3C6HA 2HNDB 3E58A 4Y3CA 5C25B 4FLVA 5TZVA 3NWGA 4OMFG 7FD1A 2HHPA 1J97A 2VH7A 2L9DA 1SH2A 2B4OA 2WFAA 2IOFA 4B9VA 2JMGA 1EJ7L 1AUSL 4BR4A 2IVFB 2ZHAA 1NM1A 2RD5C 2YNHB 3GCXP 5J0QA 4TQRA 3VR1A 3A3OB 1S0NA 4TYAA 3FEYB 3NGZA 3C2KA 5M1KA 4MK7A 4RZRA 3D2FB 4C11B 4PQAA 4JKBA 5E79U 2PAVA 2V8PA 1S99A 3IRXA 2FJXA 2V0NA 4PEOA 3QZ7A 3OFFA 4RU9A 4I2GA 2EFGA 2VWJA 1SJ1A 5JVGL 4A5BA 3I0SB 3T19A 4YS2A 1KVKA 1BGXT 2JC0A 3UM9A 3H3NO 5AKIA 3AB2B 5AE2A 1DGKN 2YJEA 4DTJA 5A2QO 2DGSA 4CLKA 3NDKA 2WHEA 4YY3K 2DR8A 1QQ7A 4MIWA 1HWLA 4KMOB 2CQBA 5EHHA 1QQ5A 5AKGA 4X62J 1QZ6A 5T14A 1V9OA 1PVRA 3OVAA 4YOVA 3OHRA 2CPDA 1DRGA 3D1HA 3IMQJ 4YDUA 4Y34A 2BCRA 4A8XA 2V9WA 1HR0J 3E66A 3GTYX 4N76A 4LF6J 3VQCA 3BYRA 4PYAA 5J0WA 3A3PB 4FPAA 4GV3A 4CRJA 3DOLA 2DHSA 1KBRA 4ED5A 1DEJA 3GSIA 3MMCA 1IBLJ 1NDKA 4AD6A 1X31C 3QU5A 2Y1JA 2YV0X 5KTQA 3X1LB 4GC6A 2EQYA 3G9CA 3GJRB 3IWLA 5HI7A 3V9UA 2ZJPL 4QS7A 3PO4A 1EARA 3UE5A 1F2GA 3W3SA 3CYMA 1X42A 2BKOA 2CJKA 3KLEA 3BQ2A 9ICSA 1E4GT 2FXUA 3NVVA 3HKZD 2A40A 1VQNN 1KEJA 1GO3F 4KH1B 2G1HA 2E9TA 3AJ2A 2NREA 9ICXA 2XWYA 3HM8A 3CCMN 4M5LA 1HNZJ 2DNGA 1KTVA 4FWRA 1PYOB 2LXUA 1PSDA 2QKQA 1HNWK 3PIOL 2RE2A 4DOBA 2D9OA 2C1EB 2WAQD 5DRKA 2AGPA 4WF9L 3A3NB 4NMLA 3I4HX 1IIPA 9ICJA 4U9RA 4CZIA 1AROP 2HNZB 4IR1A 1LXJA 2A1JB 4BJQA 1VIOA 2DY1A 3C21A 2WW8A 2W8KA 2O8CA 2DGWA 2ZD1B 5KT2A 3NOCA 4MAKA 3JPNA 3SFGA 3AA5X 3PW0A 1J5OA 4MKVA 3O2IA 4WCEL 1UEKA 3E9PA 5J1EB 4DCPB 5CABA 4L3KA 7ICPA 1XQIA 4GKKK 5I4MA 1XMQK 1VMBA 1SV4A 2ZBRA 3DV9A 2VG6A 3E51A 1OQ6A 1ROFA 2XMVA 4LT6A 2CADA 1UOCA 3LDQA 4NXNK 4XAKA 2B9WA 3N97B 4B3SF 1EZZB 1VSFA 2QFIA 3RJEA 3MWPA 5M1OA 4R0JA 2X74A 3I96A 2G8FA 1BNOA 3T5LA 3TAMB 3PW4A 1S3XA 2E1PA 2KIVA 4KLSA 4C7YA 3PW5A 1KL9A 4FW1A 3ISCA 3P4UB 1LKZA 2QX0A 2KKZA 2JNJA 4JYAK 3C46A 2YNFA 2H4WB 3TANA 1F9HA 1FRIA 3H8SA 2Z57B 4C98A 4NYPA 4ZP6A 4DQQA 4DO9A 3UD4P 3DNCA 2KP7A 3FBCA 1TMMA 1XERA 4FLXA 3W66A 3M8YA 5KOWA 1KWMA 4ECZA 1VISA 3E8OA 1FRKA 3CPEA 3TU5A 1X8DA 2KZZA 2E8PA 1QVFR 1S1VA 2G07A 5A8KA 3THTA 2M3DA 3R8EA 1K5OA 2KG5A 4WFXA 4Y2IA 4HI1A 3OYHA 5L9NA 3HSTB 4OYBA 5AQFA 4K2XA 5KFQA 3T1YF 1Y88A 4CFAA 3EUB2 4GLXA 3QFWA 3VF6A 2G9OA 5ADXA 1UJ6A 2ASDA 3TSUA 4D3GA 2WW4A 1G7CB 2OMOA 2J6TA 2XQCA 3AY9A 1QQOA 1IH7A 3ZC4A 3PVXA 2I1RA 5ETTA 4JI6K 2A18A 1VBZA 3DRPB 5ALUA 3T3FA 4FYYB 3CB4A 3R97A 4DV3K 3D2NA 3RJMB 1SQFA 2JGAA 1Q9XA 1TL3B 1S0VA 3FR0A 1N0VC 1PO6A 4OIXA 2XTJP 3P6YC 3R6MA 4IDKB 2JLFA 1TVRB 5F0UA 3O3HA 5CRXA 1TYQA 2L3MA 1UT5A 3ULHA 2DHHA 1I6JA 4KLLA 4NLNA 3JB9k 5KFMA 1OY9A 4DX8H 1RCOB 3LPEA 1PK1B 4RW4B 2KZMA 4ID5A 2K1RA 3I9ZA 1NPKA 1EB0A 2DITA 1A9NB 2I2YA 2GVDA 3H4BA 3DC2A 4I6MB 1GEHA 2CNOB 1S9GB 4Z4FA 3V72A 4DEZA 4C0BA 4AL7A 4NPOA 4LFCF 2IM0A 4IFVA 4M5IA 2PGCA 4L8RB 2D1KA 4UB5A 4C4WA 3KKAC 2AV5A 2O8BA 2DL0A 2DHXA 1Q18A 3ZYYX 4YDUC 1Q8IA 3I31A 5HP1A 1NGFA 3C1ZA 4K43A 4CJEA 1MMNA 4PL2A 2KKVA 4P4OA 2V5HG 1S72S 3THWB 4GVBA 2OMLA 3SCKE 3C7NA 3KMQA 3EZ5A 3AH6A 1KD1T 3SD7A 4BRFA 1GLFO 3WX4A 4CCHA 2EFOA 2EKNA 1ZQHA 3BSOA 1HW9A 1N4LA 3O08A 3TJAA 2PC6A 4QU7A 4ETZA 5AXLA 5DDOC 2C2EA 2HHQA 1WSEA 3MM9A 1DQ8A 2RRNA 3OW2R 2W6KA 4JI4K 2NPIA 1QH9A 1RTIB 1QLNA 2HSEB 5GAEU 2LKZA 1S59A 1SC6A 4M8LA 2M7SA 4DOZA 4Z94A 3H1QA 3RBXA 4JHDA 1MWQA 3T9NA 3F9KA 5B08A 3ZSQA 3NWRA 3LVVA 4L76A 1Z4UA 4FLTA 1K0VA 8ICJA 3J7AN 3QBXA 2CH5A 4JBCA 3D4JA 2HRTA 4NLCA 2XZDB 3MDAA 2VQFK 3K4GA 1HNVA 4K4XA 2ZKTA 4DL7A 2KHCA 1OY8A 3MXMA 2KVSA 3D68A 4UW2A 9ICEA 3DYAA 1FWPA 3HHLD 2BYCA 1H7XA 3G6EN 3KLFA 4IG0A 1QSLA 4CDIA 1P8ZA 3R9PA 4BRQA 3IRWP 1BUXA 1UFKA 3UCZP 1UL3A 4YY3F 5IT4A 3MPVA 3GJTB 5GADP 3PYDA 1NJXA 4DBQA 1C7YA 1HQUB 1Q86O 1S1WB 2KSOA 4KTQA 2WHOA 3PHEA 3UXNA 2AH5A 1R27B 4EHTA 4QYRA 2ZH9A 3SPZA 3FEZA 4S0MA 4XDDA 3NEKA 5HANA 1YJ9N 4F26A 1UFWA 3O8WA 1P6TA 5AM2A 1S6OA 5D46A 3JTPA 2QSWA 3D3CJ 4YMEA 5E0OA 3M2VB 3EGVA 1QSYA 4KH0B 1EKEA 1SVDA 3BF1A 1HNXF 3SQ4A 5K20B 3VQSA 2VPWB 4Y2JA 1VSJA 5F8GA 3ZZOA 3K5MA 4DV7F 1IKXB 2GMJA 2X1GA 3DOMA 4DV1J 1D4XA 3K17A 1RAGB 2XULA 3F56A 3CQ8A 4QOZB 3CXCR 3AM9A 2KFZA 1MWKA 3RTVA 5FIIA 4M9LA 1CEZA 4ZMMA 2HVHA 4GV6A 2DYAA 1S72N 4RW7B 2X6NA 4JI2K 2KJWA 4AQYK 1RT7B 4OHVA 3OHAA 3PJXA 2E9RX 1KC8O 4X64J 3Q7BA 2CGLA 1S6QA 3DLLL 3WQTA 3CJCA 3TKAA 2MDAA 2RB7A 2NS1B 2BANB 3AVKA 2YWHA 4RQNA 1DTTB 2RS2A 5FPEA 1K47A 4CJPA 1TKTA 3CCES 3RBZA 4LFBK 2WF6A 4IFYA 4CGGA 2DRDA 2GZOA 2C2NA 1N33F 3CD7A 4P72A 2RQMA 1EWQA 2J8AA 5EE3A 1RT4A 4WJBA 5HROA 5B0AA 4M5MA 1JXVA 1CRXA 1EWRA 5A8RB 3AFGA 3UO0A 4FXDA 1RA7A 3NAEA 2E8OA 4L74A 4N41A 2N4DA 1RT5B 4LRFA 1SKSA 4KLUA 4L3QA 1MROB 2AJ2A 1WSIA 1T95A 1NOZA 5AK6A 4NLTA 4G1PA 4GXKA 3VQDA 2HGNA 5LJ3Y 2Z4PA 2EI5A 1VSDA 1LWEB 3DLKB 1Z3EB 2ISOA 1RISA 3T1AA 4DKWA 3Q83A 4OYMA 4NLXA 3NTUA 3BP8A 2R7XA 4WIQA 2VFTA 3TQEA 2H3ZA 2VBYA 4KN7A 1B99A 2UXCF 1WG5A 5IQ6A 1BISA 1NCLA 1UA0A 2ZUBA 4A8EA 3WK6A 1XHXA 3UQ2A 2HWTA 1MU2B 1VSLA 3D7SB 3BGRB 3S1TA 2RQCA 1EKRA 3EE8A 4OZ2A 3WQUA 1ZOLA 5ETOA 1RBTA 1WNEA 1VC5A 3ZT1A 3L2WA 3OBYA 2X51A 3B8HA 1KQGB 2ASPA 3B82A 1UP1A 5FLXY 3DJCA 4UT4A 1BQNB 3NS6A 2ZH5A 2YX4A 3IO1A 1URJA 1KVCA 3OR1A 2QWNA 2O8DB 4B6JA 4OZ1A 4I64A 3GB0A 4MLHA 9ICVA 2D3DA 4XEIA 1TGOA 1N0UA 1FJGK 1WC4A 3I87A 4EBDA 4J37A 2WFBA 1TKZA 2KDOA 4A8WA 3L09A 2ABYA 2VG5A 2C2KB 3M2RB 1VSIA 4C8ZA 2YNIA 1YWXA 1VJQA 1JLFB 5DLGA 1H3DA 4P2MA 4O3MA 5K8PA 4KB0A 2OPRB 3AU6A 4PWDA 4MDBA 1WN7A 2Q0RA 1SB6A 3OYGA 1K9MO 2E9ZA 2FHJA 5SZTA 3HI9A 1KR4A 2M9NA 2DPNA 5EWFA 2ATLA 2OPSA 3MXJA 3LP0A 4WZQA 1X4DA 3H40A 2WSFC 3QU7A 5FJ4A 3MX2A 1FA0A 3H90A 4PUOB 3MEEA 4MN4C 4EELA 3A5MC 2DKXA 1FDBA 3M6ZA 4RPZA 3OY9A 3A5NC 3GYGA 4GO5X 3G96A 3NH2A 3PZPA 3VERA 1A77A 3CCSS 3FFKB 3GZ7A 5GAGP 2IC3A 1FEZA 5B5EU 1Y7PA 3EDQB 4DV6K 3QAEA 3WC2A 2BE9B 4KJIA 1A5XA 2NRRA 3TR5A 4KX3A 2ZFHA 5HMYA 3OYIA 4C3KA 1RWMB 3RBEA 1KP6A 5CA5A 4DPWA 2KJVA 3JQMA 2JWLA 1G3OA 1GXLA 4UAYA 4DDFA 4H0PA 3MDQA 4WFZA 5J8YA 4P73A 1IR2A 4CO2A 3Q2SC 4Y2CA 4X4VA 3ZTOA 4Z7CA 3JTNA 4CHPA 4E89A 2X7IA 5EVZA 3MF5A 1JJCB 3LAMA 2NRVA 1F21A 4UBCA 5DB8A 2CQHA 4ILGB 3LGHA 2RQ4A 2FY1A 5AKYA 1EXQA 3KLGA 1NZ8A 4XDCA 8ICPA 3BB5A 2GEMA 3JXUA 4OI1A 2D3OR 3C6UA 1YJWN 3ETMA 4OGEA 3EYZA 3A13A 4Y2VA 2ZUCA 3OTOK 4HVJA 4QW8A 2HOFA 4FZVA 4JI0J 1ZXIA 2PY5A 3E01A 9ICPA 4NLPA 2P9UB 5G5GA 2QKKA 2XMWA 1TL1B 2KT3A 2KG1A 3BQ0A 3C16A 2UU9J 1JB0C 1NNEA 1EQYA 2HFVA 3T1YJ 5CP2A 4DTRA 2HBJA 2BA9A 1VQ5N 2VBZA 3PSIA 1S8OA 2HFSA 5KFSA 1NSPA 4ISGA 3ZETA 2ADBA 4W5NA 4RNHA 1SQKA 2QLXA 4F3OA 1N56A 3C15A 1NK5A 4NXNF 3KBBA 3VAKA 4IDHA 3MEKA 4YNQA 4CIFA 1M90T 3ONQA 3DLLQ 2XCPA 1R6VA 5J1NA 3UIQA 4B3MJ 3HBTA 3GU0A 3H5UA 4DG1A 5ALDA 3CJ1A 4USKA 3UCUP 3L4IA 1N60A 2MQMA 3B54A 1DBDA 2XS5A 4R8UA 3VF2A 1Z25A 3QIPA 2LP4A 5DQIA 5AK4A 4K50A 1T05B 2K60A 1ASUA 4B1YB 4GIBA 4EZ6A 1JLAA 1S1XA 5D4OA 3O8MA 3CEDA 1UPMB 4KSEB 3F5EA 3IV6A 5KFAA 3M30A 2WB1D 3Q8RB 2KQ2A 1QVFM 2V69A 3N01A 3TJ8A 5I3UB 1FHTA 1NK8A 2ZD1A 4BRAA 3W5XA 1XC9A 3HFKA 5F3XB 3OYDA 4TUSA 2ZVIA 4DFMA 4LVNP 4LF7F 2XLIA 3LPUA 1OH8A 2JZBB 3VAIA 1N36J 3TA2A 2OGUA 5JJBA 3O1LA 4DR6J 4O44A 4ED6A 3TX8A 3BV8A 4MK9A 3MN9A 1YQHA 1U1PA 4ED1A 3NRWA 3THVA 1ATSA 5J0XA 5KT6A 1FRLA 3HF5A 4DF4A 2V7ZA 3ZD8A 1B0TA 4I56A 4KHPF 1ZQYA 4KB7A 5IIMA 2RDIA 2AJ4A 4O3NA 4A8SA 2AYGA 3QFUA 3AUOA 2V2ZA 4Q0BA 1JXBA 3V7JA 4RNMA 1TUYA 3SENA 8ICAA 2YHWA 3OL6A 3QJLA 4YB5A 3TPQA 3PFOA 5GMEA 3OBWA 3D6RA 2CGKA 4B1XB 9ICOA 1HYSB 2ZBCA 1GLBG 3DXKA 3CCVN 5GIPA 1GMWD 2B7CB 4WPAA 5J1PA 1T11A 4JWMA 3V7LA 1N8RO 1U1OA 4HUFA 1DT9A 2HQFA 1IG6A 2HNYA 3MMJA 2QL9B 4L6V3 2PIIA 5E3PA 2B4VA 1BU6O 2QA2A 4AH9A 4DR1F 3P1GA 4WU3A 3Q8YA 3JAMO 2BOPA 4OQJA 3KK1A 4LD0A 1YBTA 3K9JA 3RB3A 3WXIA 4QZBA 3FBFA 1WBBA 1BI4A 2ILYA 5FPMA 4BR2A 1PJ7A 2KIWA 2DR5A 4YOTA 3MGJA 1F1BB 1SQEA 1NGIA 4UZCA 3M8ZA 1XWLA 2XYPB 1YJTA 3OLAA 1ZZFA 4WBFA 4BG9A 4HT7A 2J9EA 2FC8A 2VJUA 1SKWA 3SSSA 2D41A 4ZITA 1BHNA 3C29A 5DB7A 1BVSA 4DV1F 5CR0A 4R5PA 3GU3A 5IIOA 2EXUA 1S0OA 2NXUA 2DTJA 4NASA 5ETLA 3CC7N 3G25A 5ALEA 5J2JA 4BXOA 8ICBA 2FVRA 4V19J 4CJRA 4RQ8A 4QZVB 5BYQA 2WC9A 1V4SA 2GC8A 3H8JA 4Q2LA 3SCLE 1W9HA 4TU8A 1OJ4A 3PYFA 4JI1K 5CAAA 3ILJA 3QEPA 1LK7A 3M1FA 5L1IA 4AL5A 2JJ4D 3SI8A 4XK8C 3SEOA 4ISFA 2L41A 2E1CA 2ZH7A 1SV0A 4O23A 1VDHA 2BGGA 5AQPA 1DXSA 5F3TA 3SCJE 3K59A 3HJEA 3HX9A 4LF5F 3GOIA 5F3ZA 5AE3A 1UMJA 1FKOA 2ZJRQ 1K8AO 8ICOA 2V63A 2P6RA 4NMXA 2MQ8A 4KGXB 2OZSA 3RFAA 1CS4A 4KGKA 4YCXA 1NJWA 4CGHA 5L1LA 2J0QD 4KAZA 3U1NA 4ZTJA 4ICAA 4NI2A 3AXMA 3QUCA 9ICBA 2EAOA 1UFLA 3HX0A 1DQAA 1XJWB 1ZM3A 3HCXA 2R7TA 4AM6A 3T1HJ 1S7IA 1K8AT 1TQLA 4Z0UA 4PHAA 1URNA 3W63A 3QINA 2HF3A 2BBEA 3AARA 3LGMA 2YB4A 5D0GA 4OO1J 9ICGA 8ICZA 4TU9A 1BWEA 2ZZMA 3WBZA 2P9KB 6FDRA 3SZ2A 2P9SB 5KFPA 1RDFA 3G6VA 4OCZA 1Q82O 2QGFB 2MQQA 4KHUA 3K8VA 2N7CA 2MGZA 3HT0A 3ZX3A 4IL6U 2F7TA 2PYJA 3O4NA 3W8PA 2BM0A 5E84A 4OI4A 3D66A 4G6VB 1ZQAA 3QSYB 4A8YA 4BRCA 4TU7A 1WCLA 2G0AA 1OXJA 4DSEA 4I2AA 3EN9A 1CQNA 1FO4A 1RUSA 1SJ4P 5B09A 2QWQA 1FJCA 2Q79A 1QDUB 3R6GB 2YMMA 3QESA 4LF4F 3VETA 4YD1A 2Q1LA 4JS5A 3BKUA 2IY5B 3QXGA 4U67L 3MTKA 4KV8B 1HJOA 4YR3A 4DFPA 4LBHA 2MPUA 2UUBJ 3JYTA 1M5SA 4FF4A 4EP4A 4IZ9A 4YUDA 5J2FA 4JI1J 4M5DA 4IXCA 3OL9A 5B66U 1F60B 2YQEA 1SC1B 2UP1A 2VC1A 3BKFA 4HR2A 2XMUA 2I5JA 2PT0A 1M1HA 2HNDA 1U1KA 4D3HA 4A8MP 3I76A 5C24B 1ZPVA 1J54A 4ILMA 4UY8T 3J8AA 2WF5A 3ELHA 4WKRA 4F25A 1I94J 2CPHA 2KYZA 5J0RA 3M1VB 2DIVA 2MRLA 1WWHA 5CR4A 2UV8G 1S77D 4DOAA 3MMAA 3PX0A 2Z58B 5AQVA 3DOMB 3IMXA 1VC6A 4C2MA 1BDGA 2YH0A 4IOAL 3MWBA 1UZHA 3A12A 4C11A 1DFDA 1FESA 2UUAJ 3CIMA 5ETVA 4EFAC 3D6HB 4A8QA 5LL6d 2HOQA 3VWSA 4DR5J 4FPBA 3W3DA 2IOHA 2QRRA 1WWUA 4O5BA 5AQKA 4BQLA 2RDDA 1HUOA 4QIEA 3I0SA 1F2HA 2DR9A 4KHPK 3KD1E 3I4PA 3M6WA 3QAUA 3ZDEA 3UKRB 4HHJA 2HW3A 1W7WA 2R4FA 4FZMA 2VQEJ 3SIPB 1DTTA 1TKTB 1YJNS 2UXDK 3RH5A 4DV5K 4GY2B 1T4GA 9RUBA 1EX4A 5FLXU 2Y9HA 3CDBA 4OI3A 4OJLA 4RW8B 3D1OA 5HRNA 3D45A 2MUTA 3NF7A 5TISU 3C2LA 5HR7A 3UMGA 4P0QA 3V6DA 1ZBUA 5I3QA 1U1QA 3CJ9A 2Y0SF 2RRAA 4N47A 1BQXA 4B3TF 4M5KA 3KWIA 4QYZK 4FM1A 1HHTP 4JD2B 4IO8A 3UE2A 1HQEB 1ZBHA 4LFAJ 2F3NA 2F2AB 3MR6A 5AKLA 1KN5A 2YKPA 1YVUA 4EYIB 3GYNA 3S41A 3Q89A 4U8VA 5KL8B 1B0VA 3ZSZA 5B0BA 2AGOA 1T6CA 4DR7K 5KT7A 2M0NA 5CZ2A 2RUSA 2W42A 1RU1A 1BY9A 2MQLA 2XWXA 4LSNB 3RU0A 3KTQA 3M32B 2YMQA 2V4RA 4P0PB 1E6YA 5HBMA 1FFSB 2VGNA 3D1QA 4FN5A 3ICLA 2WAQC 4O55A 4CJQA 1TKDA 2XNQA 3CWJA 3MR5A 4AUKA 3MOJB 5LY3A 4NA2A 4DV1K 3BZQA 1MQ3A 1WSRA 5H9FJ 5CYMB 4IO9Q 4YOUA 3R5JB 4MKBA 1FTCA 2ZE2B 5EUHA 5ALVA 4LJXA 3OL8A 3PM9A 4B9UA 1OH6A 2X6SA 2Z0GA 2AEJA 1FO1A 5J2MA 2JH7A 1U6FA 1HL6A 1BA1A 3AVIA 3NCQA 5A0YB 3CCLN 8ICQA 2Q0ZX 2FGOA 3L8BA 4K8ZA 3CJ2A 2JHDA 5LSOA 2F96A 2DNLA 3AVJA 3CFPA 4F9OA 3LOUA 3VENA 2ASYA 2NUHA 4PG7A 4X66F 5A2QU 4FLYA 1N5XA 2W54A 4GVLA 1NK0A 1X0FA 2WF7A 5D4LA 4HYKA 5AZIA 4CD1A 1HUZA 1ZBSA 2BQRA 3KLVA 4ED2A 4TXSA 7ICKA 2PE8A 3M2RA 2LSNA 3W64A 3AVBA 3B6OA 2OHDA 4FWOA 4GW6A 1TTHB 3DI6B 1FNMA 1B7YB 2MB0B 2YHXA 1GOAA 4FJ7A 1XK8A 3W5YA 4USJC 3U27A 1TK0A 1L3VA 5M2PA 4PWWA 1GXTA 1IWAA 3DHXA 1KQFB 3FMBA 5IZHA 2ZH4A 2DRBA 1U8SA 4WTOB 2XMKA 2OEKA 1NJIT 3PSFA 4QZFA 1M5KC 1Z00A 1X4AA 3HVAA 3G4SS 3MPYA 4IQTA 1O13A 3BQ7A 4DR3J 4CJ4A 1G6BA 2OIHA 2FLNA 4CEFA 3WIVA 4DI6A 1FRXA 2ZH3A 4KRWA 2MKHA 1XU4A 3GDXA 4DCHA 2UUCK 5AKKA 4TQSA 2DO4A 2J8SA 3SPYA 4O5FA 1RM6C 2O3DA 1HBMA 1HWJA 1BUPA 1QHTA 2J7KA 3GFYA 4CBXA 5AKXA 4UAWA 2NQPA 1I1GA 1RWXB 3GZFA 3BO4A 3IBCB 5I42A 2Q2RA 1NHKL 2H5EA 4BCAA 1SQGA 1N61A 4HACB 1DZ5A 4CLSA 3C66A 1U48A 2W9MA 1IR0A 4FBUA 3BN7A 4EMDA 2BJEA 5H9FK 5AQYA 2OTLS 4FL9A 1H2VZ 2VJVA 2CRLA 1MWZA 3FBBA 4UOGA 5AI6A 3K2YA 1NKCA 5KFNA 7ICNA 2F4FA 4O0JA 4B8CA 5C10A 3IG1B 1E6VB 1KEKA 3AOAA 2CQDA 4LF8F 3KLIB 1SUQB 8ICXA 2IM3A 2UU9K 2OUGA 5KFKA 3AQPA 2OYYA 2K3IA 2J7WA 3QRQA 1ED1A 1PKUA 2UXCK 1WSGA 4CYUB 1VHXA 4DV2J 5FDLA 2AJ1A 4ZS6A 2FPLA 2KO1A 5TKYA 3LP2B 2W9CB 4RNOA 1KVIA 1QCKA 3NGYA 1YJNN 4NM1A 3OGUA 2ZBQA 4AYBD 1OW5A 3NKYA 4KE5A 4H03B 4DLGA 2IVYA 5K14B 3CQYA 3T79A 3WEEB 2DH9A 4B9SA 2ZJ5A 4ZCMA 4JI3K 1IBLF 1JLEA 4H4MB 3BO2A 1W0HA 3LA0A 1RQ0A 4CF5A 1FKPB 4B8AB 4QNLA 2E2PA 5KRSA 3GE9A 3C2PA 4H5RA 3AOCA 2AEMA 1RTDA 3ET6B 4P75A 3AL0B 2BJ8A 4NLVA 1NKEA 4DLEA 4YB6A 2NUUG 3OR2A 4X4RA 4LJMA 2HF4A 4K2JA 3OXFA 3N7SC 2E5SA 2DWQA 2VWKA 3N5FA 5E3AA 2CVIA 8ICSA 4H5NA 2DR7A 2QMXA 4Z4IA 5KGWA 4K5SA 4DL0C 3AN1A 2JZBA 3MAQA 2PDAA 3OFEA 2HQ3A 4CRXA 3W9IA 2LYHA 1SCJB 3BUZB 4WK1A 5EU7A 3H59A 2XSJA 4JV5K 2V7YA 2F4VJ 1KC8T 7ICUA 2JL9A 1X0PA 2IGIA 1X9SA 2E5LJ 4CEBA 5DJBA 3GE1A 1HWIA 1AUDA 1RB0A 5J0PA 4NWIA 2E7VA 2V2KA 5DB9A 4Y2TA 2W2OP 4J9SA 3QQCD 4Q43A 3UDEA 3PNCA 5AM4A 3S9HA 5U47A 2CPRA 3R5GA 3TFRA 3T1HF 2D3O1 2DVIA 3KK3B 9ICUA 3TW0A 2RLTA 3BDEA 1U6ZA 1NHVA 1WUDA 3WUHA 1BXNA 2KVCA 3CCLS 2W04A 3QEBZ 1HHSA 2K8BB 4YVZA 1SIZA 2QMUB 2GQCA 3B0XA 2QN6B 2RNEA 5BPMA 4OVLA 4JK1A 3CM5A 2ASOA 4XPCA 3MBYA 8ICEA 3UD5A 4O5CA 5IM0B 5ALQA 3D2EA 1HQUA 1K8KB 4R64A 4QR2A 3H0PA 4PKHA 4LC9B 3H8MA 3ISDA 4P2XA 4NB4A 2GX8A 3CGIA 4DV3F 2P9PA 3C6TA 2CJ9A 2VL1A 4MFFA 5KFZA 4W5OA 2PFFB 2WB1F 3M2UA 3CCJN 1YI2N 2AQ0A 4EHUA 4B3TK 1N32J 1NGDA 2MQOA 3RAXA 1IN0A 2RDJA 1C4AA 1L3UA 2PA3A 1RTJB 1VQ7N 1SV5A 5EE9A 1S1TB 3JS6A 1ZJMA 3H0RB 4Q2MA 4I27A 3HHLB 4QZHA 1RDCA 1QTNB 1N36K 2MY8A 4LR9A 4WE1A 5J2HA 2HMPA 4M41A 4CGIA 2B7BB 5J2PA 1OSDA 1C20A 3FRZA 3OYAA 3ILIA 3ZDCA 3JPPA 1QE1B 4E7HA 3PR4A 4P4MA 4AHRA 4M9JA 2W9BA 1QVGR 3DMJA 3HZEA 2HMXA 3NAIA 1NDPA 5CE3A 4I2HA 4FK0A 1VHIA 3VMFB 3WK5A 1WYGA 4JV5J 1ZS6A 3RWUA 1SIJA 3RRHA 1NJIO 1YZ7A 4EU0A 3M6UA 1N33J 2HFNA 2EEYA 4KYZA 5JRTA 2KHDA 3ZFVA 3TADA 2AP6A 4H54A 3QT8A 1VYAA 4LF9J 1LW2B 2UUAF 3H4DA 4OFZA 4ZP9A 2O8FA 3BPSP 1RBAA 1KHVA 5KFBA 3J7YI 4ZIWA 4DTNA 4CNQA 4NM2A 2Y3YA 1NK4A 3DXSX 3ZLJA 2KNJA 2VJ5A 2PFQA 1CJTB 1YVNA 4UUWA 4LMZA 3T5JA 5CJ7A 2OJ3A 5GAGU 4LFAF 4DMNA 2Q36A 2FLLA 2ZIWA 1WG4A 1HKGA 4FVCA 4YFUA 2AX0A 2R7QA 2W1BA 4KB1A 4RQ0A 4R25A 4X4QA 4DN0A 3NVWA 3CJRA 2B9EA 1PC5A 5AFUA 2K89A 2IAJA 4IWVA 3SAGA 2MZ1A 4I6WA 1N6QA 1JXLA 4A8OA 5HOOA 5HQMA 1GLLO 1ATNA 3SI6A 4JN4A 2BACA 4FPRA 1ZC6A 3QU4A 2UXCJ 2FVSA 1A7GE 2YPYA 1FK9B 1JLGB 3ENVA 2RKIA 1VQMN 2HBKA 2VGMA 4FK4A 4LSLA 4DQ8A 3D7EO 4RR5A 1HMVB 4KKOA 1PK3A 1VQ8S 3M5RA 2DGVA 2HAFA 3AO1A 2W4CA 3ZT3A 2AU0A 2O8CB 2IYIA 1R0CB 2RRBA 1PCAA 2KJ5A 3R2DJ 2LDYA 8ICTA 4AYBC 1WOSA 2UUCF 3B78A 3VGLA 1KDHA 1LK5A 3IAS9 1RT3A 7ICTA 1JLBB 4PXEA 4CEZA 4JKHA 4OJ6A 1FXDA 2K7KA 3D67A 2K8AA 1TKZB 1EIYB 2DHGA 1ASVA 2OYQA 1WC5A 2IJNA 5HHHA 1T9TA 4OJ3A 1R0AB 3PACA 1YTAA 3J7A1 2AIRB 4BGAA 3FUYA 2HBZB 3NGDA 5L46A 3FRYA 1ELOA 2IHNA 1OSCA 4OX6A 3U6FA 3K75D 2FHMA 3WKBA 5TKWA 1Z6RA 4FJMA 2PI4A 3GP9A 2NLXA 3LZIA 3CFOA 4ZIVA 5HVHA 2QARA 2DBBA 2B9XA 4NLUA 1RI7A 3LGNA 3FCHA 2VKQA 4Q5VA 1P7DA 3RJKA 4DU4A 4LSZB 3UPQA 1TP7A 3GR1A 3O44A 2LI6A 3UR3C 1YXQA 4FLWA 5AJ3J 3EPGA 1W26A 2G8KA 4Z2XA 3J81j 2VG7B 3MECB 1V85A 5CB1A 2ZUAA 4CGDA 2KHVA 3QNWB 4I2DA 2ZIXA 3P5JA 4F0KA 4WYWA 3TZXA 1IBMF 1JK9B 4X65F 4PQUA 4ECYA 2XLKA 1C2PA 3NGSA 4GKJJ 5ALXA 5T41A 2EK1A 3GR0A 3US5A 2NRHA 5AZJB 4JK8A 1ZTWA 2RMLA 2I9GA 4ZPVR 1XMOJ 1RABB 4O5EA 5LMNF 4UOHA 1H0HB 1IXKA 5DM6L 2FBVA 4DQIA 2OD4A 3EXYA 1XNRF 4CO1A 3PX6A 1F44A 4FOIA 4P7VA 1N54B 1Z05A 4LRDA 1K73T 2RHSB 5AHXA 5J2CA 3ZZRA 2GWJA 1VQMS 4RWTA 3NE6A 2HK3A 4NLQA 3OYJA 1FFUA 4CH0S 3THXB 3VQ5A 4Y2KA 4LY7A 4BUGA 2BKEA 2NXJA 2R8HA 1EKSA 1QQNA 1MW7A 1IG9A 4KHYA 2LPEA 3ADAC 1N5VA 4PKDB 4QCLA 1RZTA 4ZVPB 1D1UA 3OS2A 4JD2A 3GWCA 3V4IA 4JI0F 3SQ2A 4F5RA 4H5TA 4YFKA 1FFWB 3C16B 2B8PA 4WQ5A 2LQ5A 4ZOSA 3G6YA 4ID5B 3T69A 3DLEB 2VASA 5CYQA 3QU2A 4LQ3A 4ZPDA 2FC9A 2HZCA 4C97A 1MSWD 3MN5A 4O8UA 1TELA 2DNYA 4DPUA 3NH0A 3Q8LA 5ADXH 2CXYA 4NXNJ 2XICA 3QSIA 4MEYA 4NL9A 2RPIA 3N6LA 1XS9D 1S9EA 9ICHA 2H4YB 2CVEA 4ZVUB 1HNWF 2G0JA 5DS7A 1LCUA 4E0DA 1OYEA 4BRGA 5ETKA 3P3DA 1TUWA 4DR2J 3HHKA 4OPAA 4PL1A 4PG6A 2XS2A 2DCLA 2DNZA 3H8WA 1Q16B 3MCPA 2MZRA 2NRXA 3QT5A 1PYSB 3MPUB 3DXBA 3C7NB 2R8GA 4DX7A 1M5OC 2QLWA 1K9MT 2DEJA 2OZMA 4ZOHC 4WXOA 5AQMA 4UAVA 3D0IE 1KD1O 4ICLA 3R1HA 1KLMA 7ICJA 2PFUA 4BC4A 2XS7A 2CZ9A 3NBPA 1YLXA 1C0UA 2YTUA 3GLJA 5F0WA 5MAOA 2X3DA 3NAHA 5LT5A 4F72A 1ZQUA 2JLEA 4A47A 4JUZA 5KG7A 3KLEB 5KOXA 3OV7A 4FP9A 2D1CA 1Y00A 4ANDA 3CIZA 4WQ5C 1VQ4N 2BZFA 5MLCQ 3KHRA 2FC0A 3BQTA 3ZI4A 2OPPB 3I8BA 5CCMA 7ICSA 4MT1A 3RMBA 1UPPA 4OL8A 5ALM<