1U47A

Cytosine-8-oxoguanine base pair at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
b'AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u47A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u47A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u47A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u47A01
4CERA 4ED3A 1COOA 1QE1A 2MUTA 1ZQEA 4QWDA 4IQVA 2BGGA 1ASWA 4I2IA 1TAQA 5KTQA 1WNSA 1NKBA 1VSJA 4CJUA 3LP2A 2VWJA 5C24A 5J0YA 2Q0ZX 1S76D 3C6TA 3C2LA 2KFNA 2I5JA 1XC9A 3MXIA 1MQ2A 3QEIA 1XSPA 3ZD8A 3C5GA 2ZD1A 3HW8A 3QIPA 2ZTCA 3Q8QB 2VA3A 4K4HA 4GXJA 2KTQA 5DB6A 3SYZA 3V9ZA 4O44A 4DF8A 4KAZA 3VQAA 2XRIA 1FKOA 1UA0A 3HPOA 3S9HA 2O4IA 1TAUA 4MFCA 2DFHA 5DLFA 2F8TA 3MFIA 1TK0A 8ICPA 4CFDA 5CP2A 2KFZA 4NLGA 2OZMA 4DS5A 3G10A 3OYGA 2VG6A 1S9EA 4QWBA 3CQ8A 4O3OA 4Z4CA 4DU3A 3GV5B 4UB5A 3V72A 1MU2A 2E6MA 3ZSXA 4RQ4A 1HMVA 2G8WA 5DG7A 3LP3A 4FS2A 4FO6A 4M9GA 3RJHA 1CXUA 1HQEA 3QINA 5L9XA 4RT3A 4JK1A 2F8SA 1NOYA 3IM1A 5J2CA 5J0QA 1LWCA 4GLXA 1I3AA 3S3OA 2AQ0A 4AHRA 1Q9YA 3PMNA 9ICKA 4OJRA 4IDKA 3UQ2A 5EWEA 2Y1JA 3RMCA 4CK2A 2W9MA 2ITGA 5KFSA 5KFDA 3KHRA 3B6OA 2E6LA 1XHZA 3AA3A 4ECRA 5L1JA 4UQGA 4QWCA 3MGHA 4GC7A 3G6YA 2P5OA 1BIUA 3EYZA 4DL4A 1S1WA 4KMUA 4ED7A 8ICCA 1SL1A 3JSMA 1V9PA 1KSPA 3RH6A 1Z00B 3KLEA 4F3TA 2J6SA 4TUSA 2PFNA 4CFBA 2BCVA 3KK2A 4CIFA 3FDSA 5KT2A 4F50A 1GOBA 4ECWA 4PA1A 4DFKA 1JLQA 7ICQA 3V81A 4AILC 5KFJA 4PUOA 5DB8A 4YMNA 4FK4A 3SUNA 9ICLA 4YXMA 3L2WA 5HROA 4DQSA 4EZ6A 1JIHA 1UOCA 1VSIA 3RWUA 4J9RA 4B9VA 3MECA 4RQ8A 3ZSVA 8ICVA 5J2IA 3SPYA 3MGIA 1S10A 4J9OA 3SV4A 3VQ5A 5KT6A 4CEBA 1NK8A 3F73A 2XCAA 4BWJA 4IQWA 1C1BA 1ZQBA 1WCLA 9ICQA 1X9SA 3T5JA 1RBUA 3MR2A 3IS9A 4Q43A 4FLYA 9ICCA 1IXRA 4TSXA 3SQ1A 2V4QA 4J2DA 4PGQA 4OVLA 3E01A 3SJJA 9ICAA 4CJLA 1RCHA 2PZSA 3THVA 1SV5A 4H4OA 2QKBA 3RMBA 3NCIA 2RF2A 1L3TA 3CM5A 9ICXA 4CF1A 4M2YA 8ICAA 3SI8A 4O0IA 5J29A 2JEIA 4I7FA 4O3QA 8ICSA 4CGJA 2HHUA 4B3OA 4CEAA 1S1VA 4IRDA 2P5GA 1NJZA 2GUIA 3EZ5A 3PV8A 2HB5A 3AO1A 8ICBA 3LP1A 1RT6A 2P51A 1YTUA 1PZNA 1BGXT 3BGRA 5KFCA 1IO2A 2ZJAA 2YNGA 3JPRA 1UA1A 7ICVA 1CLQA 3OVNA 4YQWA 4DSLA 9ICGA 1S6PA 5IIOA 3PX0A 4F4YA 1RTHA 1QSYA 2W8KA 5DKWA 1WLJA 4O9MA 4CHOA 1BQMA 4C8NA 3RAQA 4J9QA 3HX0A 5D46A 3KLFA 1KVAA 2RDJA 9ICJA 4C8OA 5KFVA 4M3RA 3ALYA 3SQ4A 5J2JA 2W8LA 3ZSRA 3O3FA 5KFHA 4N41A 1B9DA 4QZCA 3ORYA 2XY5A 5F9NA 4GMJB 3T5HA 5CYMA 4FJGA 1S97A 4FJLA 4KPYA 4DG1A 3NH0A 3MXMA 5KFEA 1RZTA 4C8KA 4YN4A 4NYNA 4B9MA 3LALA 5KFOA 3KLGA 5KRTA 3VQ4A 4DQRA 4EZ9A 4F4KA 3MR6A 4JLHA 1C6VA 1NK9A 1MSWD 3OYJA 4M0AA 3DI6A 4EEYA 4ELUA 1RNHA 8ICXA 4RU9A 2OWOA 8ICRA 1BPBA 3NF8A 2OPQA 4CEOA 4YVZA 2FC0A 4KHYA 4ED0A 4M47A 4K8ZA 3OYLA 1ZQZA 2IOCA 1B22A 4YD1A 3ZDBA 5J0PA 3D0PA 2KZZA 5EWFA 2MUTB 3AU2A 1ZQLA 5J2GA 1SUQA 1N6QA 4BDZA 4RNMA 1VRUA 4LZDA 2YNHA 2PI4A 3ZDAA 4CJKA 1HJRA 3AO4A 4TQSA 4J9KA 4DL5A 4DQIA 4OPKA 2YNIA 3ZSQA 4QZHA 3VQPA 3BDPA 3RH5A 1KFTA 2IHNA 2A1JA 3IRXA 4LD0A 1TFRA 1BI4A 3OYHA 3SQ0A 4CGDA 1JLBA 1JL2A 1KFDA 2ISPA 1ZJMA 1XI1A 7ICUA 4RQ1A 1RT2A 1Z3EB 3NFAA 3L3UA 2OYQA 1R0AA 4W5NA 2C2EA 2HVIA 4FK0A 3UXNA 1EKEA 4P2HA 3ZSYA 1LAVA 4FJ5A 4O3PA 3AVBA 1WN7A 3RBEA 5KT7A 3HPGA 4G3IA 3MDAA 1ZQCA 4EYHB 3QESA 3O3GA 4W5RA 1HYZA 1RTDA 4CEQA 2VA2A 3C2KA 1EXQA 2ASDA 4DLEA 1RDBA 1T03A 4JWNA 1FK9A 1S0NA 3DLRA 2R8GA 4OGCA 4CHYA 1ZQAA 3RB4A 5J0RA 2RKIA 4KHWA 5CYQA 4AHSA 3QEPA 4M3TA 3ZD9A 4ECYA 4BDYA 2DTUA 2C2RA 1X9MA 4H4MA 3EPGA 4KLMA 1A5VA 5DBBA 4NY8A 3PW7A 4IRKA 4F3OA 4I2JA 4OLAA 4F4XA 1ZBIA 3ZT1A 2OPSA 3H40A 4CE9A 3OYAA 3C23A 2V9WA 2F96A 3SUOA 5CY4A 4E7KA 3VQ7A 4Z4EA 3O4NA 1A77A 1ZYQA 2I9GA 3NGDA 1CEZA 3Q8SB 2ASLA 1QSSA 1JKHA 4FZXC 2XY7A 3OS1A 1KRPA 8ICWA 4KLGA 3QZ8A 4IRCA 3BQ1A 3AVLA 5KI6A 4M9JA 2PXIA 3C21A 3V7JA 2GV9A 4CEZA 4RQ3A 1RDCA 9ICIA 4RQ2A 3CFPA 3VQ8A 4R66A 4QZAA 2VANA 2X6SA 1JXBA 3QEWA 4XIUA 3SI6A 4BE2A 4ZTJA 4B08A 2W9AA 1IKYA 4KFBA 4OKJA 4Z4IA 5KT5A 2AQ4A 2FLLA 3AVFA 3RRGA 3UIQA 4NXZA 4RPXA 1SL2A 3HM9A 4KLEA 3AO2A 3OYCA 1ZQRA 1LW0A 2FPKA 3FYHA 3PVXA 4F2RA 5EWGA 4JRQA 4HHTA 3H8SA 4F5PA 1RT4A 1N48A 4KI6A 3V9WA 4IFYA 4P4PA 8ICNA 4I9QA 1WSEA 3QO9A 1ZBHA 4DFJA 3ZT0A 3V7KA 1ZQHA 4L8RB 2HNDA 3LP0A 4KLDA 1D5AA 5J2EA 5CWRA 1ZJNA 5HRRA 4ELTA 3AU6A 2V4RA 3KKSA 4O5BA 2BANA 3M9OB 2FLNA 4DTOA 2KZ3A 1EETA 4FW1A 4QW8A 2E4LA 2J6UA 2ZUBA 8ICOA 4F91B 1MQ3A 4FLZA 2BPGA 1BHLA 2BQUA 9ICTA 4DFPA 1ZBUA 1YVUA 4CEEA 2HNYA 1WAJA 3P83D 3ISNC 4DSFA 4ELVA 2FBVA 3LPTA 3WNGA 8ICMA 2RPIA 2FMQA 1N5YA 4ECSA 3JPQA 9ICVA 4UAZA 2RDIA 1ZQNA 4CIEA 1XWLA 3DRSA 4FJNA 3OYIA 5HRPA 3RB3A 4YXJA 3HWTA 3SUQA 3EPIA 4B8CA 3TFSA 2JEJA 3OS2A 4FJ9A 4CEFA 4UBCA 3M8PA 3JPOA 1ZQGA 4CIGA 3SNNA 3K75D 3PR4A 4DTUA 3MR5A 3CG7A 4R8UA 4KLHA 4I9LA 4CJ5A 4ED2A 1Q8IA 3LPUA 3LANA 1NOMA 1LWEA 1WSHA 2XGPA 5KFYA 3OYMA 4KI4A 4I2BA 4JV1A 4KLFA 3GV8B 3KK1A 3NAEA 4JS5A 1BQNA 5J2KA 3GV7B 2C2DA 3LZIA 3AVNA 4FJXA 4R5PA 4ED6A 4FBUA 4KHUA 4KITB 1TKZA 5FRNA 4UB3A 4G1QA 1AROP 4Z4HA 2YKMA 1S5JA 4NLKA 1B9FA 4DL6A 1HQUA 4Y1CA 4I2PA 3OJSA 4DTXA 4YR2A 4GC6A 4E1MA 2BCRA 3NTUA 1C0MA 3QIOA 1RBVA 3HO1A 3VA3A 4RQ0A 4J2BA 4CF9A 2BPFA 4XA5A 2YHBA 5HRSA 3DLBA 1NK4A 5KFTA 4PH5A 7ICIA 1QTMA 1ZBFA 1ZQPA 2A1JB 1SKRA 1BI4B 5DDMA 4M3ZA 2ATLA 4QAGA 1ASUA 3OGUA 5DBAA 4J9LA 2PI5A 3OYKA 4TUPA 3RMAA 4W5TA 3HT3A 2W9CA 4DSKA 3HSTB 7ICFA 2A1RA 5J0XA 1KLNA 4O55A 1XU4A 4KLIA 1JLFA 4FK2A 1W9HA 4Z4FA 4I2FA 1KTQA 3UXPA 3RRHA 2JZBA 7ICPA 4IBNA 8ICZA 4EBEA 1LW2A 2BPCA 2WONA 4UB1A 1D8LA 4CJRA 1KVCA 4PHAA 4FLXA 9ICEA 1VSMA 5BOLA 2JEGA 2F1IA 1VK0A 4KHQA 1JL1A 5KFKA 1UWBA 1U47A 3L8BA 4DSIA 2XGQA 2KN7A 1TK8A 1NKCA 3S3MA 1HJPA 4B9LA 5HLFA 4XRHA 3RTVA 4PHPA 3GIJA 3VQEA 3N97B 4B8AB 2NRXA 8ICUA 1S1XA 4MEYA 5BOMA 2G8UA 4J9SA 3ZDEA 3KKRA 2HHTA 4FJ7A 3V1RA 2HVHA 3NF9A 1S0VA 3F9KA 3L2VA 9ICPA 3GILA 5KFZA 1RILA 1CZ9A 4KLLA 4BACA 5KFXA 2X74A 3OJUA 1HPZA 4NCAA 4M45A 4ZHRA 3IAYA 3KD1E 1S77D 4CHZA 3TAEA 5KFNA 3RR8A 1VSFA 4MFBA 2UVWA 2Z1GA 5KFUA 2G8FA 3JYTA 4DL7A 2O4GA 3OYNA 4DMNA 4CFCA 3OYFA 1BL3A 1EXNA 1RXWA 3PR5B 1HNVA 1I39A 3K58A 5KG7A 2FLPA 3OHAA 2BQRA 2IHMA 4EYIB 4FJHA 5KFFA 5DQIA 5KFPA 4EBDA 3RAXA 4Q5VA 5DBCA 4TURA 5DDYA 2PFOA 4YCXA 8ICFA 2R8JA 5J0SA 5KG3A 5J0TA 2HHVA 4M04A 4O3RA 5I42A 4RW6A 3CFOA 4I2DA 1ZQTA 4CK3A 1JLCA 4F92B 3H7IA 3PO5A 3HVRA 3Q8PB 4CJ4A 3M8QA 3Q8LA 1TVAA 3ZDCA 2C22A 3VQDA 7ICNA 1LB2B 2XY6A 5KFGA 5L1KA 3MDCA 4CFAA 3ITHA 2D0BA 4KRFA 3K5OA 1ZQOA 1IKWA 9ICBA 4PGYA 3V6JA 2B5JA 4PY5A 4E3SA 1C0UA 3V6KA 1X2IA 4AHTA 5J2MA 5KFQA 5HMLA 3H4DA 1BPDA 3BQ0A 4HTUA 5I3UA 1U48A 1HUZA 4BDPA 1JN3A 4KTQA 3I8DA 4DTMA 4XUSA 1YT3A 2ZJ8A 3PY8A 1S0OA 1KEJA 1L3VA 3G6VA 1CUKA 2DFFA 1IKVA 1S0MA 5SZTA 1L3UA 3AVCA 2YNFA 5DLGA 4RT2A 3TAPA 4O3NA 1SKSA 4E7HA 2QKKA 2WTFA 4IKFA 1DLOA 2I1QA 4YMOA 3T19A 1ZQSA 4RNOA 4NM1A 4KKOA 4FJMA 3MR3A 4PHDA 1JX4A 3BQ2A 5IILA 3CM6A 4DL3A 4DQPA 3KLHA 4KV8A 4CCHA 2BR0A 1UT8A 1XSLA 5DMRA 4FLVA 2WOMA 3P5JA 2ZJ5A 4JUZA 4RPYA 5F9LA 4R8UB 2AGOA 3V9XA 9ICHA 5KFAA 1JMSA 3UPQA 7ICGA 1RYRA 4ID5A 5DB7A 2VWKA 3L3VA 2B6AA 3AO5A 7ICHA 3ZSOA 5HHIA 4RUCA 2PFPA 7ICOA 5KG4A 1ZQYA 1HNIA 4NYFA 1EP4A 2BCUA 4FM0A 4ZTFA 2XHBA 5HBMA 4DTSA 1RBRA 4FJKA 5J2HA 2G8KA 2XY8A 4AHVA 4QCLA 1U4BA 2C28A 1ITGA 5JS1A 4CJ3A 3TAFA 4QZ9A 4KHSA 5DGBA 2ALZA 1KLMA 1LAWA 3HL8A 1ZQMA 2BQ3A 5D49A 1QSLA 3ZT2A 4Z6CA 3JPTA 4RQ6A 3M8SA 3G6XA 3RH4A 4RG8A 3GDXA 3WNFA 2X6NA 4E7JA 1NK5A 4IR1A 2HW3A 3C1YA 2DFLA 4B9UA 3AVJA 2DPJA 4NM2A 1KVBA 3EWAA 1UT5A 1BIZA 4LSNA 5DQHA 3KD5E 3PW0A 3SPZA 5SWMA 2IBKA 2HHQA 5KG5A 2PYLA 4FM2A 3ZCMA 3VQ6A 4M3XA 5KG6A 7ICSA 3AV9A 3WNEA 4OKKA 4QWAA 3HP9A 4Z0UA 1KCFA 2W9CB 4LVSA 3LAMA 4DU4A 3AA5X 1A5XA 3ETLA 4BE0A 5D4BA 1Q9XA 1IG9A 1TGOA 1S6QA 4YR3A 2BDPA 8ICYA 9ICSA 1D8YA 4I28A 2JZBB 5DQGA 1TV6A 1JXEA 4N56A 5L1IA 3V4IA 1WCNA 3ASMA 3LAKA 4QZFA 1ZQKA 3HJFA 4QOZB 4ED1A 3PW5A 4M3UA 1LWFA 4GW6A 1ZQDA 2QXFA 4RW8A 3K5NA 1XS9D 4CF2A 2M9NA 4JWMA 1ZQIA 4N76A 7ICTA 2BCSA 5KFLA 5E41A 3DOLA 1FXXA 3KJVA 3OS0A 3H8WA 3DOKA 4E89A 3GQCA 3RJFA 5D3GA 1S1TA 4CJVA 1JLGA 1TL1A 3NGIA 3TQ1A 1VSHA 2MAXA 3WNHA 1L5UA 4O4GA 4M3WA 4DTRA 3H08A 2YHAA 5DB9A 4J9PA 3NHGA 5HP1A 4ECXA 4E0DA 4HCCA 4FYDA 4PQUA 1T8EA 1SKWA 1T3NA 4DO9A 3KHGA 1NJWA 5J1EA 1S9GA 3QEXA 1RBSA 1BCOA 4KLJA 1HRHA 1ZQVA 3ZDDA 3V1QA 3RB6A 4QZGA 4CJTA 4K8XA 4KLSA 5FRMA 2W42A 4YP3A 2HNZA 4JRPA 4EBCA 3QZ7A 4F2SA 1Y88A 1DGSA 2HHWA 1BCMA 3T3FA 3QETA 4FJ8A 3DRPA 1S9FA 4Z6EA 4RQ7A 7ICLA 4DF4A 3S3NA 1TKXA 2HHXA 4DTNA 3TFRA 4CJWA 4Q8FA 4I2CA 5EOZA 3DLKA 4Q45A 2RN2A 4KTZA 3DLEA 8ICQA 4TUQA 4PHEA 5T7BA 1XO1A 5IIIA 3K5MA 5KG0A 9ICUA 5J2DA 3SCXA 3FFIA 2KZMA 3RJGA 1UAXA 2JEFA 3TAQA 3OSNA 4YG2A 4F5QA 4ICLA 5J2NA 1BPZA 1JLAA 4IQUA 4QZIA 2D0CA 4I2QA 1HYSA 3PO4A 1XSNA 3HPHA 4FJJA 5HMMA 2YKNA 8ICGA 4YR0A 2NRTA 4M9NA 3EY1A 4DOBA 1WSFA 5KFWA 2H5XA 7ICKA 2UVVA 4EP4A 4CHNA 9ICOA 3AA4A 2R7YA 4CF0A 5J2PA 2LSNA 4BE1A 2OPPA 4CJSA 8ICIA 4RW4A 5IIKA 1VSDA 3RMDA 4W5QA 1QS4A 2JLEA 3CYMA 4QZDA 1T7PA 1O1WA 2JGUA 4J9NA 3GIKA 4HUGA 3PUFA 3I0SA 1W0HA 3RJKA 4E19A 4IG0A 3V9UA 3OYEA 1A76A 2HHSA 1YTAA 3T5LA 1REVA 3JPSA 4LZGA 3U3GA 1N56A 1SL0A 3N4MB 3OHBA 3TWHA 2NUBA 5HP4A 3HK2A 1K6YA 1NK6A 3VN5A 5HHHA 3C5FA 2YV0X 4CGFA 3RBDA 1C1AA 3RJEA 1J53A 4I27A 2BE2A 4UB2A 2NRZA 7ICJA 3HXMA 4RUAA 1WSIA 5DGAA 2R8HA 3UXOA 4P4MA 1QQCA 3ZSZA 5FROA 2ZUDA 4R63A 3AVMA 3MXJA 4DU1A 1Z26A 1CXQA 5J2FA 4AHCA 1GOCA 3NH1A 3Q8MA 4HVJA 4FVMA 2ZTEA 3QEAZ 4OLBA 4JV0A 4CF8A 3AVIA 1IM4A 1WAFA 2IS3A 1ZQQA 1TVRA 5IINA 3JPPA 1DOQA 4CHPA 4YD2A 3U6FA 2GWSA 1IH7A 3KHHA 4AH9A 4QZ8A 3QE9Y 4M9LA 1RXVA 4KB0A 2Q3SA 4RW7A 3L2UA 1RDDA 2ASJA 3BQTA 3DRRA 2ZE2A 1JXLA 3ISCA 8ICLA 4M6WA 3OSPA 4CGIA 3SQ2A 4Z4GA 3M9MB 1RBTA 1RYSA 3QLHA 3KIOA 4IQTA 1VSEA 9ICMA 3L2QA 3MEGA 3NDKA 3IHQB 1ZQXA 5KT4A 2FBYA 4P4OA 3AVKA 4MFAA 4W5OA 1QLNA 2GBZA 4RPZA 4K4IA 4E7LA 4OKEA 3NBPA 2OZSA 1U04A 2PFQA 1ASVA 5KG2A 3AO3A 5CA7A 3SV3A 1RT1A 4YFUA 5HNKA 1KDHA 4N47A 2HMIA 1NK0A 2OPRA 4O3SA 2BKEA 1CZBA 4DTJA 3I0RA 3OYDA 2DY4A 2IMWP 8ICJA 1ZQUA 4Z6FA 4PPXA 3PW2A 4R64A 3QERA 4F5OA 2FMPA 4RZRA 1FKPA 4CECA 3V6HA 4O5CA 5KT3A 3T5KA 1NOZA 2W9BA 3C95A 4XQ8A 4HCBA 2D5RA 1DTTA 4UB4A 2BHNA 1VSKA 4CGGA 1GOAA 1RDAA 4JV2A 3PX4A 3HYFA 2IGIA 1C0TA 1BPYA 2FBXA 4BXOA 3ULDA 3KK3A 3LZJA 3EW9A 4Z6DA 2J6TA 3NF7A 1TKTA 4C8LA 5C25A 1RTJA 5CR0A 3HVTA 4F5RA 2D0AA 2FPLA 4ED8A 3VQCA 4DWIA 1TK5A 2VG7A 4O5EA 3PX6A 2UVRA 3NH2A 4NCBA 2ETJA 4F5NA 1NKEA 2A1SA 4KHNA 3LK9A 4Q0BA 3LDSA 4UAYA 5CB1A 9ICNA 1Z25A 1HYVA 1BPXA 4MQ3A 3AUOA 5CJ7A 3T1AA 4LY7A 3GFKB 2ZTDA 3C2MA 3AVGA 3VQBA 1TV9A 1J9AA 4KLUA 4IG3A 3RB0A 4I2AA 3L2RA 1K1SA 4FBTA 2KW4A 3QNNA 7ICMA 9ICRA 1SZPA 2ZQBA 4F4WA 5DK5A 3DLHA 3TANA 9ICFA 5KFIA 3H8JA 4M3YA 3V7LA 4B9NA 4FJIA 2VA8A 1J5OA 2IDOA 4QW9A 4ECUA 5KG1A 4B9TA 3MBYA 4OPJA 3DMJA 3LDAA 1ZETA 4I2EA 4K4GA 5L1LA 3K59A 4DSEA 5BPCA 2R8KA 1MC8A 1ZBLA 4DOAA 5KFMA 1K1QA 2P66A 2AGQA 2XC9A 4ECZA 4H8KA 3OYBA 4DFMA 5IIJA 4M41A 4QZBA 5JUMA 3TAMA 4FZZA 3QEBZ 4DS4A 4CJPA 2G8HA 4KLQA 2NRWA 3A2FA 3GIMA 4LH4A 1NK7A 4X5VA 3ZSWA 5J2AA 2EHGA 3B6PA 1D9FA 4LH5A 4UAWA 1ZQJA 3UQ0A 3MABA 3KHLA 5EU7A 4ECVA 3NE6A 1WSGA 4LSLA 1WSJA 1ZQFA 4ID1A 3TR8A 4O0JA 5DG8A 2AU0A 4MF2A 4KB1A 2LYHA 4R65A 7ICRA 3C1ZA 4F4ZA 5IIMA 4ECTA 3V9SA 2X78A 1T4GA 4HUFA 3VA0A 1TKDA 4MEXA 2B4JA 3H4BA 3ZT3A 3DLGA 4KLTA 3B0XA 4M9HA 3VQ9A 4FW2A 5FDLA 2F1JA 4NLZA 2FPMA 2P6UA 1QHTA 3V1OA 3K5LA 4CK1A 3PNCA 3ZT4A 3HP6A 2OA8A 4GXKA 1U45A 3RR7A 2ZUCA 4BWMA 1EX4A 2FBTA 3GIIA 1Z00A 4J2EA 7ICEA 4TQRA 4E7IA 5J0OA 5C42A 4DSJA 3JPNA 5CZ2A 1DTQA 4FLTA 1T05A 3MEEA 1B43A 1RT3A 3U3YA 2Y1IA 3VQQA 3P1GA 3QEVA 4DEZA 3TARA 3LWLA 4JS4A 3OY9A 1Y97A 1L3SA 4Y1DA 3QNOA 4Q8EA 2Z1HA 5K14A 1KFSA 4J9MA 3SZ2A 4IFVA 2P1JA 4RW9A 4CHQA 8ICTA 1C1CA 4F8RA 4WE1A 2XO7A 3NGZA 4FZYA 4GVMA 1LV5A 1G15A 1BVSA 1X1PA 1ZQWA 4I2HA 4CJQA 4FLUA 4DTPA 3TABA 4O5KA 1RPLA 3KTQA 5KFRA 5CZ1A 5HRNA 3AA2A 1VRTA 2QK9A 3DYAA 4PGXA 1D9DA 3SUPA 3PW4A 3LWMA 5KGWA 1H38A 2Z1JA 4M6WB 3Q8RB 4CEDA 3Q8KA 3K57A 3M9NB 9ICWA 2BGWA 4AHUA 5J0UA 1BPEA 2P6RA 2IA6A 5CHGA 3C94A 1RTIA 3M8RA 1XHXA 4CJFA 3G0ZA 3TI0A 3AVAA 2AJQA 4KO0A 1J54A 1HUOA 1C7YA 3NGYA 4YMMA 4PWDA 1JLEA 3CFRA 2BCQA 1IKXA 3D45A 1U49A 4I2GA 1NJXA 4KN4A 4CGHA 4Q44A 4FS1A 4KLOA 2G8VA 5DG9A 2DFEA 1TL3A 4CJEA 1A5WA 3C6UA 5C5JA 2Z1IA 4DOCA 2AGPA 4HUEA 4NCGA 2F1HA 2VG5A 2PYJA 3E2EA 4B9SA 1VSLA 1S1UA 1RT5A 2B21A 3K4GA 2ISOA 3DM2A 3K2PA 2W9BB 2R8IA 4N5SA 2DPIA 1B92A 4ECQA 8ICEA 4QZEA 4RQ5A 4IR9A 4MFFA 5J2QA 3B0YA 2ATQA 2NRVA 5KRSA 1BISA 3ISDA 3V6DA 2XCPA 4YFKA 3PMLA 4BXOB 3O3HA 1U9LA 4DL2A 4DLGA 1X9WA 1RT7A 3TAGA 4QWEA 4KTWA 4FCYA 3IG1A 2G8IA 2UVUA 4HYKA 3BJYA 3KLIA 2IC3A 1F21A 2EX3A 8ICHA 5J2BA 4BGDA 4C8MA 4M42A 8ICKA 4CESA 4KREA 3O4QA 2PY5A 4FXDA 4DQQA 4EP5A 4OGEA 3MFHA 4NLNA 4J2AA 3MEDA 4MF8A 3ISBA 3RJIA 2FMSA 5JS2A 4ZH4A 3AVHA 4UBBA 3MAQA 5KFBA 4YNQA 4I29A 4F93B 4KN7A 4E1NA 1NJYA 4GXIA 4FM1A 2KQ2A 2IAJA 5TZVA 4RNNA 3RJJA 3NF6A 5KGXA 4FLWA 5J0WA
chains in the Genus database with same CATH superfamily
1MWKA 1XNRK 4CERA 4ED3A 1COOA 1QE1A 1YZ7A 1QQ7A 3G71N 3ZEUB 2QLFB 1U1PA 4I2IA 2H65B 4J7CA 5IM0B 4CJUA 2YWEA 2HS0A 2HI0A 2Q0ZX 1ZRNA 4OHZA 3C2LA 2IOFA 2ZFHA 1UP1A 3J7Z5 2XZDB 5E33A 1XC9A 1RHJB 3CJ4A 1TL7B 1N5XA 4LF8K 3I5BA 1J5EK 1OY8A 2KP7A 1FERA 3R6MA 2ZD1A 4DPUA 2VA3A 4B1ZA 2GV1A 2KTQA 4CLPA 1NJIO 1HNXK 2DNMA 4O44A 4KAZA 3KVGA 3KKAC 1SXDA 2LKYA 2O4IA 1TAUA 5LJ3Y 1GO3F 1PBUA 2C2KB 3CMAS 4X65F 1RHRB 2DH8A 2ZM6K 5DLFA 1Y9OA 3HHLC 5F8MA 4YHHK 2W54A 5CP2A 1YWXA 2PSZA 2OZMA 3W1YC 3G10A 4KH5A 4CD3A 3CQ8A 3RBXA 3M6XA 3VGTA 1YQHA 3J81j 3UE2A 1MU2A 4K50A 2E6MA 4FF4A 3LP3A 4MK8A 4F72A 2QGFB 1CXUA 5JU5A 1I94J 3QUTA 2RQ4A 4QOTA 3QT7A 5AXKA 4BRPA 1QZ5A 1LWCA 4GLXA 3NMAA 3DLGB 2AQ0A 3WEEB 2Q1LA 1PJ6A 1Q9YA 2A41A 2ZKUA 2LDYA 3IMXA 3DXSX 3RMCA 2W9MA 3QGGA 2MSNA 3AA3A 4ECRA 4QWCA 2O66A 5CD4H 2OMLA 1YVNA 3R9LA 3MMCB 2CJAA 3F2BA 3RH6A 1YDLA 2WF9A 4LT6A 4M5DB 2LEAA 2J6SA 2ZJRL 4X4PA 3QRPA 2HOIA 2BCVA 3MM6A 4F50A 4PA1A 4A8SA 4DFKA 1JLQA 3WKEA 4RJVA 2ROEA 4JI0K 3FC4A 3NVVA 2F1FA 2MZ1A 1JI7A 2MJNA 2RUSA 4P0QB 4IFVB 2RQMA 4CBWA 8ICVA 3NCQA 3UD3P 4JI6K 1UETA 4IH6A 5SUHA 4UARA 3SV4A 1YI2N 4HVZA 4CEBA 1NK8A 1EJ7L 3CCVS 4BC4A 5AKIA 4FVUA 1MN9A 3K9JA 1QUPA 3F44A 1B7YB 2OFGX 4BWJA 4IQWA 1TUYA 1G7CB 3DYAB 4LFCF 3FUYA 3T5JA 1RBUA 3IS9A 3RAMA 2C42A 4FLYA 1BWEA 2VPZB 1XNQF 1IG6A 1X60A 2YTCA 4KGKA 5D15A 4E1JA 4UUWA 3G8TA 3SQ1A 3HRDD 1F3FA 4PGQA 2ZC3A 1RB0A 4R0JA 9ICAA 3E01A 5B08A 1HJOA 3SJJA 2E5LK 3TRGA 2PZSA 4Y00A 2OAUA 4YB1P 3NCIA 2GC8A 3QRRA 2XI2A 2F8KA 1Q81O 3W8GA 1LOTB 4PPDA 2YQEA 8ICSA 4IRDA 2P5GA 2GUIA 4YY3F 4ZPCA 1JJCB 3VGSA 3LP1A 5J8YC 3FEYB 1WEYA 2DNNA 4H0OA 4ISGA 4C7ZA 3LL3A 4ZP8A 2QARA 3C14B 4BLGA 3CGIA 2W8KA 3I33A 4CHOA 1FFUA 2V8VA 1VQ9N 1CLFA 1HNZJ 3DM2B 2RDJA 3J7YP 1KONA 3KZIU 4LF8F 4DV7J 2FYXA 1J5EF 3SQ4A 1YRUA 1R8AA 3J8AA 2WTUA 4ZCKA 3VGMA 3CF5Q 3VEOA 5KFHA 4I0WA 5G0RB 4CYUA 4BHQA 2E1CA 2KJ5A 3ORYA 2XY5A 3WXMB 4GMJB 2K8AA 4FJGA 2DKXA 4Y0FA 2ZM6F 4KPYA 3EGNA 3IG1B 2OTLN 2KHCA 4YHHF 1RQ0A 2IC3B 4B9MA 3RSEB 2MY8A 2H3ZA 1VC0A 1RLDA 1T0TV 2CQDA 2F7VA 2C2MB 1J2MA 3D7SB 1C6VA 1V4TA 1MSWD 4M0AA 2FVRA 4U9RA 4EEYA 4ELUA 2OWOA 4FWNA 4FWOA 1BPBA 4FWQA 4HAIA 2F4FA 1NJIT 4YVZA 4BC7A 2GJFA 5J2NB 2FC0A 4ED0A 2NQPA 2WFBA 4ZMMA 2OXOA 5TISU 1ZQZA 3IKMA 1UFKA 2RT3A 3SMPA 3OTOJ 2MUTB 5J2GA 5AZIA 4ICAA 3KG1A 4LZDA 2PI4A 3EMTA 1FJGK 1RDUA 3O1BA 4CJKA 3AO4A 5EOYA 4IO9L 4A8MP 2CGLA 2WF7A 5ALMA 4OPKA 5C24B 3CD7A 3UMGA 2Q79A 4MYTA 1S4FA 2GJIA 1NZBA 4I64A 3MMBB 3IRXA 4LD0A 3QAUA 1BI4A 3OYHA 2XMTA 4KHPJ 2MKJA 4W4MA 5B8HA 2ISPA 7ICUA 3DWLA 2XLKA 1K47A 2CNLB 3TADA 1PILA 2OYQA 5T7LA 2QIFA 1R0AA 1ITPA 2O8BA 1FKOB 2B4OA 1ZXOA 4Y2JA 1LKYB 3TTFA 2VPWB 3ZSYA 4FJ5A 4BG8A 4BR5A 4JI6F 3TR5A 3RBEA 3A5NC 4EYHB 4NXMJ 2WB1C 3QESA 4OD0A 4W5RA 1H7XA 1RTDA 1HYZA 4BRAA 3DN9A 3HULA 2W4DA 4DPOA 2ASDA 1QQOA 1WG4A 1XEZA 1B0PA 2DJWA 1T03A 4CP5A 4OGCA 3HSZA 1RU2A 1ZC6A 1HWIA 1HQEB 2RKIA 4EIAA 1J2VA 3S1TA 4B9QA 2ZH2A 2UV8A 3IAM9 3ZD9A 4ECYA 1X9MA 3US5A 3W9HA 4Z2XA 2CPEA 4Y2PA 5F8JA 1IUJA 1X4DA 5KPRA 2BZ2A 4RW7B 3ZI4A 4KGXB 1OW5A 3GU3A 4OLAA 2OEJA 2E5LF 4GV9A 1SV0C 1ZBIA 3K1RB 1KC8O 4KMOB 2E7WA 2HG4A 4IYQA 3ZNUA 1YTYA 3HMJG 5JMVA 2V9WA 2W03A 1OQ3A 3GLJA 1OY6A 2YJFA 1UJ4A 4X64J 5CY4A 1DFDA 2LXIA 1S1WB 2VYPA 1T6CA 3RBZA 3JSMB 2ZNYA 1A77A 4OJ6A 2GFFA 4X62J 2ASLA 1JKHA 1QSSA 1RJJA 4ZCMA 2LEBA 3O9SA 3THXB 2YWHA 2LP4A 3WK6A 2EFNA 1HR0K 1VBKA 4KLGA 1SH0A 3HZEA 4PUOB 3BQ1A 2A6OA 2QV6A 3GIRA 3PFEA 4RUBA 3V7JA 4Y2XA 3TP2A 2BMBA 3ZNJ1 2XS7A 1RDCA 3SSRA 3QGHA 2OMOA 4RQ2A 1S7IA 3CFPA 2IHR1 2VANA 3QEWA 2IM1A 1Z4OA 4XIUA 1S6UA 4BE2A 3M7DA 1H2UX 3MPWA 1RCOB 2GHPA 2FHJD 4F71A 4OKJA 1HARA 4Z4IA 2AQ4A 2CQIA 2BKOA 3M2RB 2CQ0A 1C1BB 2V2QA 3GU0A 4GVEA 4WFAL 1FRIA 3ZC4A 3FYHA 4OX8A 4RPFA 4F2RA 1NM2A 2F9DA 3NGUA 3R7SB 2W41A 3TKAA 4B3TK 5EWGA 3ZZOA 3R5DA 5LJVA 2GWKA 4JRQA 1QVGM 4DR3K 1SC4B 1BQXA 3BH6B 2OP5A 2FJBB 4R0EA 2BJ8A 5AK3A 4I9QA 4PG4A 2FXUA 1ZQHA 1MN7A 2BW2A 2RF2B 3MPYA 5K5MA 3LP0A 2F8MA 3JSBA 1ZJNA 1N5WA 2V4RA 4B3OB 3UNGC 1S1VB 2BX6A 1K44A 2LDIA 4ETZA 2XULA 1EETA 2B6GA 2R7WA 2DNZA 3OT9A 2E4LA 4LF5K 4CH0S 1MQ3A 4JKFA 1FJGF 4WFNQ 2M8DB 1S6PB 1RTHB 4KH0B 2FBVA 4JB8B 4DV1J 3WNGA 3M1YA 4IOAQ 2K8GA 4UAZA 2RDIA 4CIEA 1XWLA 4OX9J 1X4CA 1DY3A 2BOAA 3P5TL 4LIWA 3RB3A 4EEKA 3SJHA 1H2TZ 1X4HA 3D2WA 2ZJQL 3G86A 4CEFA 5AQVA 3M8PA 1ZQGA 4PL2A 4CIGA 3SNNA 3K75D 1RHQB 5FJ4A 5H1SV 2DR9A 4BRHA 5CA5A 1VQ6S 2I5HA 3LPUA 3LANA 4DG1B 1OSCA 4P74A 4QS9A 1NOMA 5EX5A 3F53A 1LWEA 2WVCA 2KM8B 5JLHA 4KHRA 1K5OA 5KFYA 3OYMA 3GPAA 2MU2A 4DR2J 3MCSA 4DXLA 3GV8B 3F2KA 2ZGYA 4JS5A 1WYGA 3HKWA 3GV7B 2JL9A 2C2DA 3DI6B 2G0AA 5EVZA 3LZIA 1YHQN 3HHLD 4B3MJ 2OPQB 1V3ZA 2RRBA 3U1LA 3W2WA 2HHHK 3E58A 4WXOA 5EE1A 2QKQA 5M2RA 4Z4HA 4KSEB 3QBCA 3DGPB 2E44A 4Y1CA 1HQUA 3OJSA 4FYXB 3RVCA 2BCRA 3QUQA 3TYTA 3NVZA 2AWZA 3HO1A 2AZ3A 2YNHB 3Q8YA 4ZVEA 1N36K 2W2QP 3TO8A 2BPFA 2QTDA 5E3PA 4KGZB 2FJWA 3ZZTA 3VALA 3DLBA 1NHKL 2KG1A 1ZA2B 2CDRB 5H1SQ 4ILLA 2A1JB 4PR6A 5HQMA 2ATLA 3BUZB 4QAGA 2VFRA 4M5MA 1HR0F 4MYUA 1ASUA 3OGUA 2JHDA 1X7VA 2DH7A 2F3JA 5AQFA 2IDLA 3H42A 3JQKA 2YXLA 2A1RA 5J0XA 1KLNA 4DHVA 1KC8T 4OV6A 1W9HA 4I2FA 3UXPA 1VDVA 3VVTA 3RRHA 2JZBA 4IH5A 2L41A 2PT0A 4EBEA 1OH7A 4F67A 3ENBA 3J80O 2FF3B 4NX9A 2FHJA 4RQMA 2FJ6A 5BOLA 4BJQA 4USKA 1UWBA 5KQ8A 2AZ1A 3LO3A 3Q22A 4DSIA 2XGQA 4OX7A 4JV5K 4JKGA 3VF2A 1C4CA 3FRYA 3F5TA 2B0CA 4B9LA 4B3TF 4FWRA 1ZD2P 4DR4K 2UUCK 3VQEA 4DR3F 4OYIA 2J0QD 1YJRA 5BOMA 3JAMO 6FD1A 4C7QA 5ALZA 3OTDA 3HD1A 2QWOA 3V1RA 2YHWA 3NF9A 2Y0BB 5KFZA 2VOPA 4KLLA 1A6SA 5A2QO 1R59O 5A6PA 5KFXA 2J76E 3S01A 2X74A 2LM4A 4NCAA 4WYLA 2NRHA 2F7TA 1R43A 2YQ1A 2PO4A 1QQ5A 4OJGA 2XYPB 5KOWA 2HYIB 2Z1GA 3MN5A 1H2VZ 5AI8A 4WF9L 3N7RC 4H5TA 4LF5F 4NYPA 3M30A 3GJRB 1FHTA 3RJMB 1BL3A 1EXNA 3PKMA 5ALTA 2Z2YB 2GH1A 1MDUB 5EN1A 3HHKA 4OHVA 1I39A 2FLPA 2NYIA 2BQRA 2V8GA 3A8KA 4EYIB 4QBUA 5KFFA 3HFVA 5DQIA 1WB9A 1UFWA 5DBCA 2PFOA 1RFQA 1TL5A 2HMPA 2Z30B 2NRRA 3MD3A 4DV4K 3QYYA 3DLLL 1SQEA 3R5GA 1IKYB 4KFBB 5AQWA 1VHFA 3CTRA 1S12A 3H7IA 1JJHA 1JRPA 3KG0A 1B0XA 4WQ5C 3W7BA 4CJ4A 1TVAA 2LCWA 2HURA 3VESA 2NLXA 7ICNA 1LB2B 4JNEA 1XC3A 3MDCA 1M5PC 4CFAA 4MK7A 3ITHA 3I55N 2V7YA 1ZQOA 1RT7B 1IKWA 1WUUA 1MROA 1XJWB 2IJFA 3IN5A 4IFYB 5BYQA 3QXGA 1XTZA 1YSJA 3QO9B 3HHLA 5J2MA 4GVBB 2E9TA 1K8KA 2UUBK 1GXLA 2ILZA 2QEXS 1BPDA 4RWWA 3AJ2A 4LMZA 2J9EA 2HHHF 2UXBJ 3PACA 1FFVA 3FZFA 2FF6A 4KTQA 1ED1A 3PIPQ 1H1VA 1Q3UA 3PY8A 1KEJA 1L3VA 3G6VA 3BKFA 2ZHAA 2LBOA 1I6JA 3IR7B 3PJXA 3AVCA 3TOQA 1FXDA 2ZH3A 4M94A 4DUYJ 1HW9A 5B0DA 4YMOA 1N36F 1U0HA 3H5UA 2CQ1A 1ZQSA 2HNYB 4RNOA 4NM1A 4KKOA 2UP1A 2HOFA 3CCJS 3MR3A 4WFBL 4PHDA 3BQ2A 3MMAB 1KW4A 3OL6A 4DL3A 2EC2A 1KVJA 2FE9A 3CW2C 2E29A 2CNNB 3KLHA 4CCHA 2MSTA 4BRFA 2WVBA 3QBXA 1MNEA 1TQLA 3P5JA 2ZJ5A 1EAYC 4DR1F 4EUVA 3WIUA 5D0HA 4R8UB 1RWPB 9ICHA 4DV5K 5HK4A 5BRHA 1KOHA 1JMSA 2LMRA 4ILJA 5HI7A 1ZPVA 4OX6A 1RYRA 1Q5VA 5DB7A 4CW7B 2DGTA 3VF4A 2GMJA 1OH6A 2PFPA 4GKJK 2R42A 5AKLA 1U02A 1HNIA 5DZ6A 1BQNB 1IR1A 4FKXA 2FVQA 1HD1A 2HWHA 5A2QU 4CLFA 4JV5F 1RBRA 1JCEA 4FJKA 2ZIUA 5J2HA 4DR4F 1VQ8S 3UKRA 2P9KA 2WB1D 2HQFA 2XY8A 2A1BA 1NGGA 4EX7A 2C28A 1ITGA 1B0VA 3KD3A 2YKMB 2ALZA 2QX0A 2G0CA 1LAWA 2COLA 5D49A 4Q7AA 2A3VA 1TUWA 2UUWA 2YCHA 4DBQA 2XMMA 4BRDA 3N6LA 3WNFA 4IR1A 2HW3A 1Q8LA 5LL6Z 4P7TA 4B9UA 2DPJA 3CO9A 3ZX3A 1UT5A 4KC5A 4LSNA 1BIZA 5DQHA 4EHTA 7FD1A 1WKKA 4CM2A 3R8EA 5JVGQ 2HHQA 1QHAA 4FM2A 3ZCMA 4JYAK 2AF6A 3AV9A 1AW0A 3HP9A 4UOHA 5F8IA 2F8EX 3LAMA 2V94A 2K2PA 3BYRA 4FN5A 1I94K 4ZPBA 5J8YA 2BDPA 8ICYA 1JLFB 2HBLA 2PAVA 3NY0A 1D8YA 1G99A 2OTJN 1AA1B 2DO4A 3F2CA 4DV4F 4WJBA 2E7VA 1LWFA 3UN2A 1Y00A 3BS5A 2V63A 1IG8A 1RBOB 1MA9B 2BCSA 2F76X 3ZZUA 5KFLA 3CMEN 4GV6A 3DOKA 4KQZA 5CH7B 2NXJA 3RJFA 2BA9A 1OIAA 2E7XA 1TL1A 3OR1A 1VSHA 1RAHB 3WNHA 1L5UA 9RUBA 4O4GA 2FSNA 2CPXA 2Q43A 4PZVA 1IQTA 4J9PA 3THPA 5CCLA 3BGUA 2UUBF 4TU7A 2P9LA 4HCCA 2PIIA 1T3NA 3C15B 2NZTA 3LOUA 4QR2A 1Q18A 1N54B 4MKYA 2G0JA 1S9GA 1BCOA 1HRHA 4P2XA 4ZDNA 4CNQA 3V1QA 3RB6A 4QZGA 5FRMA 4DR5K 1QQ6A 2HNZA 2PGCA 2ZOFA 3OVSA 4Z7CA 1BCMA 1SJ4P 3T3FA 3QETA 4Y2SA 3TUPA 1GMVA 3CSKA 2CQBA 1TKXA 2DUYA 2W55A 1HNVB 5LT5A 2GW8A 4I2CA 3MTJA 4KTZA 8ICQA 4TUQA 2VJ5A 5T7BA 2GA7A 5G4DA 2P9IA 4ZVPB 3TSQA 2ZIWA 1FRHA 1F0XA 4WFZA 3GDQA 1WDDA 4FDFA 1HBNB 4FF3A 2PDAA 2JEFA 3HLUA 4LBIA 4F5QA 4QJFB 1BPZA 1JLAA 1HKBA 4QZIA 4I2QA 1OYEA 3PO4A 4FJJA 2YKNA 3WKCA 4DV5F 3TSUA 2WSCC 3EY1A 3NASA 2H5XA 2UVVA 3ZTQA 2EH9A 3OXFA 4DDFA 2CQGA 2OEKA 2LSNA 2OPPA 3NS5A 3JS6A 4GKJF 3RMDA 4JI2K 4O8UA 2OEHA 1YJ9N 3CYMA 4QZDA 2HQDA 4CLWA 4Q2LA 2HMXA 3ZETB 4HH0A 3GIKA 3D9BA 1FRJA 1LK5A 3QSIA 4IG0A 3V9UA 1C4AA 3M3ZA 3KWGA 4M8LA 1REVA 4KBIA 1HNZK 4LZGA 2JWKA 4BR9A 3N4MB 3TWHA 5D0GA 1BY9A 3RG6A 5ETVA 1IKVB 2GO8A 1U1MA 4ES2A 4A2AA 3C5FA 1OVQA 2YV0X 1DLOB 3RBDA 3RJEA 1Z1BA 5J1NA 5JLFA 1IV0A 2CA9A 3ATVA 4ZVGA 7ICJA 3QFHA 3VZIA 2ITMA 3P5BP 2DY9A 3UPFA 1BA0A 2XM3A 3AVMA 3MXJA 5M1FA 1WOOA 4DU1A 4Y2AA 4DCOB 1SV0A 2ZWPA 5J2FA 4AHCA 1HL6A 1GOCA 5BYRA 3Q8MA 4P71A 1VQ5S 4FVMA 4JYAF 2EZXA 4CF8A 1Q7YO 3AVIA 5GMEA 1UQVA 4HTIA 3SR6A 3OLAA 3G6ES 3U6FA 2DKOB 3KHHA 2ABYA 2QWPA 4KB0A 2YMLA 3L2UA 1RDDA 3R3LA 3TZXA 3BQTA 4I6MA 2ZE2A 2A10A 2W6LA 4ZVUB 4Z4GA 4IQTA 1VSEA 3BB5A 2VIHA 1VCTA 3IRUA 3UM9A 2VL1A 3HX9A 4JI3F 1R6VA 3MEGA 3N4QA 3IHQB 5LJWA 1XQIA 2WAQC 2FBYA 5HBMB 1CULA 5HMWA 1SBRA 2VODA 4ZVHA 1QLNA 3P39A 3WK5A 2DGQA 4K4IA 4E7LA 1GMWD 4EFHA 4LVOP 1ASVA 1PAUB 5LOQA 4DR7F 4KHPK 4YFUA 1PIEA 2I9SA 4N47A 4EFAC 2BKEA 1S6OA 3IM8A 4OZ5A 3OYDA 2IMWP 1EIYB 1ZQUA 3PW2A 3DXKA 1MW7A 3QERA 4F5OA 2FMPA 1FKPA 2MKHA 4BY9C 5KT3A 4K5RA 4DR5F 5AQXA 4HCBA 4YDXA 1YLXA 2KIWA 1VSKA 4NLBA 3AOAA 2MLYA 1GOAA 3EE3A 3WXKA 1RDAA 3CT9A 1NGEA 2Q0UA 3PX4A 4HKQA 3HYFA 4CT9A 3CDWA 2QWQA 1S57A 2PA3A 1BUPA 4YB5A 3DJCA 3OBYA 2MY7A 1K0TA 3LZJA 4EGLA 1WI6A 4IS7A 3NF7A 2AJ1A 5HR7A 1B0TA 1NDCA 1HBUA 5ETNA 5E79U 1TV6B 2D0AA 5A8WA 4LF6J 2FPLA 3V4IB 1TK5A 3UE5A 1U6ZA 3CCVN 4IOCL 2A1SA 4KHNA 3LK9A 4UAYA 2XMWA 2WB1F 1VQMS 4DN0A 4ETXA 3T1AA 1R8PA 4LY7A 3GFKB 2ZG6A 2M70A 3MX2A 3HCXA 4K25A 3CJBA 3GMGA 4QJVA 4P2MA 1J9AA 3LA0A 1IXKA 2KRBA 1S1TB 1JLGB 4LRAA 4PEOA 3JAMY 2KW4A 4FWMA 1ZD3A 2WRMA 1PVQA 5GAHI 7ICMA 4JI2F 1F2HA 3ATUA 2ZQBA 4C4TA 4V19X 5AQNA 3NGTA 4BGBA 4M3YA 3V2UC 5A2QY 4PQUB 5ALFA 5KG1A 1M1GA 2QB0A 3K0JA 2AT1B 4B9TA 4ZVSB 3BH7B 3DMJA 1ZETA 3TQEA 4OZNA 4RQNA 2HK3A 2WCXA 2VGMA 2HQ3A 1HW8A 2E8PA 4JI1J 2X51A 4UOCA 3C16B 1N5SA 3K59A 5AQQA 2DEJA 1OQ6A 4P73A 3MMJA 1DURA 5BPCA 2R8KA 3ED5A 1FRMA 2FHKA 1X31C 4DOAA 2M5YA 2C3UA 2XC9A 4MDAA 4F7VA 2CADA 4NLOA 3PDNA 2QZ8A 1U1OA 5JUMA 3TAMA 1L3KA 3DLEB 3F9MA 1XN9A 4DS4A 4CJPA 3EE9A 5AQGA 3A2FA 1T9VA 2E8OA 3GIMA 2OCEA 2E2QA 4ZOHC 3NXZA 3R5JB 1NK7A 3ZSWA 3KDOA 3PG9A 3VMFB 3B6PA 1NUEA 2V4JA 2BABA 3CRXA 1VAZA 2D7SA 3CWJA 3ZYYX 3K2YA 3D68A 5AQKA 1CJKA 1FX2A 2VQEF 5EU7A 4ECVA 3NE6A 2JWLA 1NNEA 3CO0P 4O0JA 1YKWA 3UMCA 1JALA 4KB1A 4IC9A 4TXSA 5F8HA 4FWLA 4HTLA 5J2PB 4F4ZA 3EEQA 3E0FA 2B56A 3PXGa 4FOIA 3VA0A 3SBGA 1UEVA 1TKDA 1RADB 4AUKA 3OTQA 1L6NA 5FDLA 1B64A 4AP9A 3SQOP 3A0BU 3CQXA 4RCHA 1CJUA 1XMOJ 2O8CB 3PNCA 4RR5A 3MK6A 2EXUA 5IZHA 1GMWA 2GVDB 1U45A 1S72S 4NLVA 4BWMA 1OY9A 3R27A 4OX9K 2OH2A 2QLXA 3GIIA 4PZNA 2V0NA 1R89A 5AKZA 2G2YA 1R3NA 3JPNA 4FLTA 1T05A 1VGYA 4FL9A 4RWXA 1B43A 2Y1IA 5C2FA 2DXFA 5ETMA 3QEVA 3W8PA 1N0UA 2BE2B 4JS4A 2CZ9A 5EE9A 1LNQA 3DFEA 1DQAA 3FBEA 2Z1HA 3AFGA 1RXOB 4G6VB 5LJ5Y 5M1PA 5ALVA 4CHQA 3L4PA 1C1CA 4PKGA 1XO0A 1Q0NA 2XO7A 1OH5A 1S5LU 1TYQA 4GVMA 4FZYA 3MDFA 2GMLA 2DGOA 3H3OB 1ZQWA 2LQ8A 4CJQA 2P9NA 4DTPA 3TABA 4MMOA 4O5KA 2HGNA 5KFRA 2LKZA 4A47A 4NB4A 3BF1A 2QK9A 3L6QA 2P2CB 3DRRB 5L39A 4OL8A 4OMFG 2XB2D 1NG9A 1HBMA 3Q8KA 1O03A 4N8NA 3KOAA 3H0LB 3K7RA 3DC2A 4QNLA 5D77A 3RRKA 2BGWA 5J0UA 2CPRA 2ROPA 2IA6A 4H03B 4FVCA 3VC8A 5A0YA 3CETA 2PFUA 4TKTA 3OHRA 3AXMA 4JI4F 3CFRA 4LFAK 2BCQA 1NI3A 2XVTA 3NRWA 3O9UA 1U49A 3NBPB 4Q44A 2LA4A 1FJEB 1YBUA 5AJ3J 4WQ5A 5DG9A 1RAOA 3BYPA 1BNOA 2HMIB 1ILYA 5C5JA 4URQU 5TKYA 4P0PB 2FSJA 5H9EK 4HUEA 4NCGA 1T9YA 4UQTA 4B9SA 2UXDJ 5L8RC 4XDDA 4BC3A 3DU5A 2G07A 1M1HA 4FE3A 1RT5A 2HIQA 2ISOA 4W90B 3KUHA 3FAHA 1WF2A 1DTTB 4ECQA 8ICEA 3EN9A 1BWVA 3N4WA 4RQ5A 4MFFA 5AFUA 1I5OB 5J2QA 3RFAA 2C1EB 1BISA 2LM1A 3V6DA 3O3HA 4BXOB 1G6BA 2HQCA 3R1XA 1KR4A 1X9WA 4ES3A 2DHGA 3N79A 4QWEA 4CH1A 4CQ1A 2R2SA 3QMQA 2ZITA 3BJYA 3ZZZA 3MXHP 5ALWA 2NCKL 3HVTB 2RE2A 2VOOA 1F21A 5AKHA 4C8MA 1E6YB 1W97L 3P4IA 2BBEA 2YQ0A 3IBFB 3H2UB 6AT1B 1NPPA 3O4QA 4C23A 1K9MO 2PY5A 4Q0BB 4OGEA 4IQMA 3J7YU 2L9NA 3ISBA 3RJIA 3W0LA 1RUSA 3AVHA 1X66A 4YNQA 3PHTA 3FVYA 3TZWA 2LLZA 4J5OA 2GIQA 4D3GA 4F0HA 3CCRN 2IAJA 3RJJA 3HRGA 4NYZA 3T6JA 3QRQA 2FVPA 2ZGZA 3GG0A 4L76A 5B7WA 2P9UB 2WW8A 2ZDPA 4KYZA 2F44A 3AQEA 2KI2A 4JHDA 2H3IA 1XR7A 1J5OB 1ZQEA 2QO3A 1ZAVA 2MQLA 2FJDB 3X3UA 5KTQA 4BROA 1WNSA 1Q8BA 3LP2A 5AM3A 3DDNA 3CJ2A 1S76D 3C6TA 2R7TA 4NLSA 4OX9F 1WWUA 1W2IA 1ZBSA 1H98A 5AQZA 4AYBC 2KFNA 2K3KA 2I5JA 2VKRA 3J81O 1S8OA 4LFBF 3MXIA 4PWUA 2O8EB 1SB6A 3UQSA 1MQ2A 3AGKA 4ZN1A 5AQJA 5E3RA 3C5GA 3QIPA 2ZTCA 1XNSA 2O8DB 1NZPA 2HFOA 3CMQA 3NOCA 5DB6A 3SYZA 3V9ZA 4HR2A 4DF8A 4UAUA 1REGX 3S9HA 1S5ZA 2WBNA 4X66F 1YJNN 1IBMK 4DV6K 3BO4A 4BRQA 4NLTA 8ICPA 4U7UK 4CFDA 3HZGA 1YRXA 3W5ZA 2O3DA 2CG4A 1YJTA 4TLRA 4QU7A 1F2GA 1URRA 4O3OA 1DHMA 1PVPA 1URJA 4CBXA 4UB5A 2D0PA 3K9KA 2XMVA 3V72A 5ETKA 2XI3A 1S22A 4MO4A 2CJXB 4DUZK 1HMVA 2G8WA 5DG7A 3THWB 2KKVA 3I1YA 4FO6A 2EBGA 4C80A 2DNPA 4NEYA 2IMOA 2F8SA 3MM8A 4MJKA 2ZKTA 2G5HB 2DVIA 3PMNA 9ICKA 2FZCB 3QGPA 3KWMA 1FWPA 4IDKA 2BOPA 1ROFA 2HSEB 2Y1JA 2LQ9A 4CK2A 4NPOA 3CD6N 5KFDA 3KHRA 3B6OA 5L1JA 2JWNA 4LFAF 1BIUA 4ILHA 4DL4A 2IRYA 3M2UB 3TACB 1OWXA 2FB0A 2L48A 4DCHA 3BEXA 2WAQD 1GLLO 2H1YA 1DTQB 3KK2A 3NAHA 2P9KB 4CIFA 3FDSA 3H0RB 2HS3A 5IV4A 2ZIVB 2W2MP 4BRKA 3V81A 2VICA 3U1NA 3A5OC 5DB8A 2KNJA 3FSYA 4FK4A 2DITA 5HROA 2K1RB 3D6MB 1VIXA 5K14B 5I4MA 1VSIA 3QFPA 3RWUA 3BQ7A 4B9VA 3ZTRA 1X6JA 3E8OA 1V38A 1O6XA 2O1PA 2YKOA 3AEVA 3V5RA 3SPYA 4WE1B 1S10A 1CS4A 5KT6A 2ZIXB 5F3XB 3O1LA 2KT3A 4DV3J 3F73A 5LY3A 1VQ7S 1QAXA 4ZVRB 5E3AA 1EHWA 1RKJA 9ATCB 3NVWA 2GZOA 2VV5A 3SEOA 2NXCA 4IH7A 4CD1A 3M1VB 5FPDA 1UMJA 3EL2A 1ZZFA 4J2DA 3B82A 3HSCA 1ZOLA 3FCHA 2RJZA 2FHMA 4CJLA 2JVRA 1BDGA 3L3FX 1RCHA 3M6GA 3THVA 1SV5A 2KG0A 1VQ9S 4KO0B 3CM5A 1L3TA 3NLCA 1A7GE 3NG8A 1N32F 4O0IA 1KN6A 1IKXB 4I7FA 2HDOA 4O3QA 3Q8VA 2FIUA 1YJVA 1JNRB 5ETOA 1NJZA 2CWKA 3EZ5A 3AO1A 8ICBA 2R7VA 1TL3B 4OI3A 1WD6A 1R0CB 5AI5A 1BGXT 3BGRA 2R7RA 4ERDA 1IO2A 3JTNA 2YNGA 2UXCJ 3JPRA 1UA1A 1K9MT 2XSJA 1CLQA 2VG5B 3OVNA 3D2FA 2KSOB 3UDVA 1T94A 1S1UB 1F0MA 5DKWA 2O8FA 3M8ZA 5D46A 1K8AO 2HOQA 3KLFA 1KVAA 5KFVA 3G82A 4IL6U 2MLZA 2CQ4A 3OTCA 5ELZA 3H2LA 3ZSRA 1Y3KA 4N41A 1WUAA 2F5GA 3C29A 4QZCA 1F5SA 1UAWA 2F9TA 5D0EA 3DEEA 4DX6A 3GOIA 4X4TA 1IBMF 4DV6F 1RZTA 5D6GA 2MTLA 2RHKA 4ED5A 4B3RK 3GONA 3VQ4A 1FDDA 3MR6A 1NLKL 3OYJA 1N62A 4B1XB 3KDNA 3MEDB 4Y0WA 1RNHA 4DUZF 8ICXA 4XH1A 3MCOA 2AEJA 3GE1A 3A3OB 5E3CA 2A2CA 3U27A 3AH6A 1WF1A 3PSIA 1PAEX 8ATCB 4TYBA 4I1TA 2ZBIA 1LK7A 2EWHA 3EVOA 4CZCA 2IOCA 2XTJP 1CJTB 3IC1A 2N4DA 4OV1A 4YD1A 3QBWA 4G9ZA 2IJNA 2RS8A 4HACB 1IR2A 4GIBA 3VVUA 4OYAA 2QN6B 2QEXN 2OEMA 1ZQLA 1SUQA 2VBXA 4RNMA 1VRUA 4K4YA 4MH8A 2Q36A 2V7ZA 4NXNJ 2VFUA 3OUYB 4NA3A 4TQSA 4DL5A 4LBHA 1JJ2R 2JNJA 3ZSQA 4BRGA 2XICA 3SCKE 2ZVIA 1KFTA 5HVGA 2DGSA 1M5SA 1TFRA 2DNRA 2DH9A 2P9CA 4USHA 3MPUB 4WU3A 1JLBA 1JL2A 1KFDA 1FFGB 1P90A 1ZJMA 1XI1A 2CAJA 4CIOA 3L3UA 3CCJN 4DZDA 4H0VB 3D6FB 1RHUB 3FSIA 3QSYB 2CYYA 4Q2MA 4P6QA 2JLFA 5IS2A 2P9SA 3THYB 1AZSA 4O3PA 3PKYA 3QAEA 1WN7A 3CPWM 2L9WA 3L5KA 3JQJA 1T02A 2YBVA 4J37A 2VG6B 1S9EB 3O3GA 1HFEL 4AQYJ 4CEQA 1MA7A 2G4BA 2V50A 2PMHA 4BR0A 3IWNC 4CLKA 2IJRA 1S0NA 2R8GA 1S4EA 1ZQAA 3U26A 3RB4A 2VONA 4KHWA 5CYQA 2ZH7A 3QEPA 1UVKA 4M3TA 3WQTA 3E9OA 4NA2A 2EEYA 2DTUA 2NSCA 3KUGA 4H4MA 3AM9A 4QQBA 4KLMA 5DBBA 3PW7A 3I76A 4F3OA 4U67Q 1ZTTA 4BX9C 5AM0A 2KV2A 2KHQA 3R9KA 3H98A 1Z1VA 2OPSA 2E88A 2XYHB 3WK9A 1IBKJ 4UW2A 3NNHA 2V68A 3VQ7A 4Z4EA 2CJBA 3CF5L 2I9GA 3KLEB 3SEIA 4GNIA 3Q8SB 4JI7J 1RYUA 1J27A 3QU4A 1FEEA 2RMLA 1KRPA 3QZ8A 2QG9B 4CF5A 3AVLA 3IWLA 2PXIA 2AXTU 2K7KA 3S41A 4CEZA 4RQ3A 1C0GA 1FTRA 1P7DA 2ZH4A 9ICIA 1HKCA 4LBPA 3ETRA 3VWSA 3MECB 3MM7A 4JBCA 3T1YJ 4QZAA 1TUVA 3CJKA 3ZZRA 2G1HA 3BKUA 3SI6A 1Y0HA 1AUDA 3O0FA 3D0HE 4Y6IA 2QM1A 2P6TA 5I9EB 3QWPA 2YX7A 3MM5A 5KT5A 4TY8B 1VK8A 2PFFB 4NXZA 4RPXA 1S99A 1RDRA 2JC1A 3GFYA 4F25A 4PXDA 2Z7JA 4JK9A 4Z94A 2KG5A 2JR5A 1DQ9A 2QMUB 2M52A 2LXFA 4B3RF 1VQNN 4HHTA 3ULEA 2VKZG 5LMNK 1RT4A 2KO1A 1N48A 1K8AT 4KI6A 4B17A 4P4PA 8ICNA 4M63C 2E8AA 2KVCA 1ZBHA 1QAJA 1AB8A 4H4OB 3ZT0A 5DDRC 1Z1ZA 2HNDA 2VJ4A 3UDCA 3NCRA 3VAJA 3KKSA 1DXSA 2BANA 4DTOA 4LJMA 1SC6A 1RT6B 2B9XA 2R7OA 2J6UA 2ZUBA 8ICOA 3KZXA 4F91B 4FLZA 2AX1A 1X40A 5A0LA 2CJ9A 2EZZA 2BQUA 1BHLA 1QAIA 2NV3A 1BO5O 2EI5A 1F44A 1ZBUA 2JZ5A 2UUAJ 4F4AA 3P83D 2EG2A 1BQMB 4NLYA 2RPIA 1N5YA 1O08A 9ICVA 1YBAA 3R5BA 5FP0A 4IZ9A 4KGMA 2W2NP 4TN2A 3IDHA 3DRSA 4FJNA 4ANEA 5HRPA 1QAYA 2QB1A 4DPWA 3SUQA 3EPIA 4B8CA 2JEJA 3PRDA 2ZUAA 2VCPA 2X1FA 3TPQA 4F36A 2ATCB 3JXUA 4DR6J 1KOOA 1TU0B 2W2OP 4AYBD 4DTUA 1WHVA 4HDGA 4CJ5A 3IWXA 5CYMB 5JJBA 5AKXA 1NBEB 1ZPWX 3ENVA 2CIMA 1OMSA 2D3O1 6FDRA 2A40A 4BRCA 2WF5A 3NNCA 1RA7A 4JN4A 1VC5A 4X4SA 4DX5A 4UF4A 2XGPA 3I4HX 3KLGB 3ET6B 5AKJA 3DXMA 4KLFA 1N60A 3W5YA 3D7EO 4XH5A 3KK1A 3FMWA 1Z19A 2ILYA 5J2KA 2BRLA 5LM7E 2E5SA 3G2XA 4L3NA 2KOBA 3D6TB 2VHGA 2AMCB 2GOLA 1IIPA 1V85A 4ER8A 3CJAA 1OJ4A 5FRNA 1ZBTA 4UB3A 4G1QA 2V2VA 2DB1A 2CPYA 2AX0A 1V3RA 4NLKA 1B9FA 4DL6A 4I2PA 4E1MA 3NTUA 1N6QB 2WB4A 4NMXA 3FR0A 1ZXIA 3SMSA 3VA3A 2BV3A 4RQ0A 1UVNA 3A4TA 5IWAK 3NNAA 2F4VK 2YNIB 3J81Y 5HRSA 2LYVA 5IOLA 1RP5A 5BR8J 1U6BA 1FA0A 7ICIA 4MKAA 1ZBFA 1ZQPA 4FPIA 4OLOA 2MYFA 2IVOA 3MN9A 5DDMA 5M1OA 1NNLA 3O3LA 3QQCD 3AQPA 5DBAA 4J9LA 2PI5A 2J5AA 1KTVA 4FZMA 3T1HJ 2W9CA 1RT2B 2HF4A 3HSTB 2B9WA 3O8MA 2QLWA 4O55A 3CDAA 4JB3A 3GSIA 1VQ5N 5EE3A 7ICPA 3T9ZA 3IV6A 4C11B 2DR8A 2ACYA 3CJ5A 1LW2A 4FZVA 1RWUA 4UB1A 4CLUA 4PG5A 1D8LA 1ZH5A 1NH8A 3G6EN 4FLXA 1V6HA 4H0PA 3VAMA 1JL1A 2HAFA 1PO6A 1PK1A 4EELA 1UVJA 1XMOK 5AI4A 4GO7X 1DKGD 1WKJA 1FK9B 1U1KA 4J90A 3DOMB 2XBPA 3N0VA 2KN7A 1TK8A 3I5AA 1NKCA 1LCUA 4GV3A 2UU9F 4F9OA 4PHPA 3GIJA 3AJDA 5LMNF 2W7PA 2KHDA 4B8AB 2Z8QA 2G8UA 3ZDEA 3KKRA 5IXUA 1KEKA 2E5IA 3MM9A 4LF7K 2Y3YA 2Z57B 9ICPA 3GILA 2V8PA 4IOAL 1EQ0A 4JD2A 3WKDA 1HPZA 2CVIA 1BWFO 4C8ZA 4WJ3B 1K73O 1YAGA 1S77D 2M9KA 2BM0A 3N28A 2BEFA 1NRKA 3RR8A 2UVWA 1HNWF 4USJC 4FPBA 4EENA 1N34J 3K0SA 1XK8A 2MGZB 4Z7YA 3H0MB 3RU0A 2XEXA 3DAWA 2J0WA 3P8BB 2VZ9A 2IM0A 1KWMA 2R3VA 1U1LA 2M4MA 2O6KA 1KHVA 2M2BA 1RXWA 2EBEA 3QUBA 3CXCR 4PKIA 5KG7A 2HHPA 3OVBA 3OHAA 3W60A 2IHMA 4YOYA 2E1ZA 4FJHA 5F3TA 1V3SA 3TSPA 1FESA 2GMHA 4V19J 4WQ4C 5CRXA 4Q5VA 4TURA 4YCXA 5LMUK 5J0TA 3DLJA 2W4PA 1RWNB 5KPTA 5K8PA 2RAQA 3K8VA 2RU9A 4CZKA 4O3RA 4I2DA 1ZQTA 5DETA 1JK9B 1JLCA 4F92B 3WHIA 2Y8WA 3PO5A 3DRXA 5K20B 2HQGA 3AA8A 3VQDA 1LW0B 2XY6A 2W04A 4CZHA 4KRFA 5AQSA 1VQMN 4K0KJ 1PG5B 2B5JA 4PY5A 1C0UA 3TUZC 3KHYA 2H5IB 5H9FJ 3MUMP 3A1YG 2F65A 3U4LA 5HMLA 1FNOA 1HWKA 5I3UA 4HTUA 1U48A 1HUZA 1FFWB 2CVEA 1XMQF 4FSVA 1RZMA 1HA1A 1UKUA 3VOVA 2H3FA 3GFHA 2NPIA 1NDLA 3CCUS 4B3SJ 1UHUA 2YNFA 5DLGA 3OLBA 4E7HA 4IKFA 3UD5A 2POKA 2IVYA 5IWAF 2OM6A 4WFAQ 5BR9A 2F4VF 3IP4B 5THWA 1TFYA 4I56A 1HWJA 1IR0A 1JX4A 2LU2A 3UVJA 2XS2A 2D3UA 1XSLA 1WWVA 2E1FA 4KR0B 2WOMA 2ACMA 1FWKA 1SXLA 3WX8A 1T9TA 3C7NA 4L3QA 5F9LA 2AGOA 4DV0F 2QWRA 2N82B 5B0GA 1AFJA 4BR7A 1Q4RA 1JJ4A 2CXYA 4HHUA 5CAAA 4QIEA 7ICHA 1WF0A 2K4PA 2ES6A 5KG4A 2MZTA 4HHHA 3O9QA 4OJHA 3PLAA 5DM7Q 1EP4A 2I1RA 2MZJA 4ZTFA 1X6IA 1HWUA 2XHBA 4NZ7A 4DTSA 4R5PB 1VBZA 3GG4A 1TKZB 2KKZA 3EVWA 5CHIA 4A57A 1VHXA 3TX8A 5JS1A 2QW9A 4QZ9A 4OZ2A 4LF7F 1VS3A 1QSLA 2AJ4A 3HDSA 4USUA 2GUPA 4LF4J 3JPTA 4RQ6A 4HWIA 3M8SA 4A8KA 3G6XA 3VEVA 3MHYA 3B78A 1KBUA 3BSOA 3MI7X 4M7XA 3AMZA 2BJ7A 2Z2LA 4F04B 1LXJA 1N52B 2IIRA 4AL5A 2MHEA 3QU9A 7AT1B 3FQLA 3GE9A 3UR0A 1D4XA 4AYBF 1NO8A 1LWXA 3PW0A 2C3MA 1WSVA 1NMEB 5KG5A 1SJFA 2RILA 3VQ6A 3D2QA 4M3XA 7ICSA 1CC7A 3CMES 3WNEA 1FCAA 4QWAA 1ZM2A 4ZVOB 2DPNA 2QMXA 3QNWB 2DEIA 4C3LA 1ECWA 5EX0A 1A5XA 2HFSA 1Q9XA 1X4GA 4PYAA 1MMLA 3F41A 4A8YA 4DV2J 3D3CJ 2DNGA 3LYSA 4CLLA 5LMUF 1EB0A 5DQGA 2F63A 3MTKA 1K73T 2WC9A 3GJTB 4LSZB 2WONB 2HK2A 3LAKA 4QZFA 3HJFA 4M3UA 3DHXA 3LVVA 1TMJA 4A59A 4HHJA 3SK3A 2VQFJ 1ZQIA 7ICTA 1CQNA 3DOLA 5E41A 4DCPB 2HIYA 3HILA 3KNGA 4U96A 5HLFB 4OI1A 3SBTA 2CH5A 2XWXA 1IJJA 1C20A 3W64A 1EKSA 5ALHA 1S1XB 3AXKA 3P49B 4DTRA 4M3WA 2RRAA 5JRTA 5DB9A 2K89A 1Q16B 4IDHA 3VGVA 2CFXA 1F6TA 1M6YA 1UZDA 5HP1A 4MK9A 4ECXA 3M4XA 5ADZA 1K0VA 4MKVA 4FYDA 1T8EA 2W1BA 1SKWA 1J97A 2DXEA 2HZCA 3R6LB 3KHGA 1NJWA 2YX8A 3MZIA 3L3CA 2DRBA 4ZHRB 3OL7A 1RBSA 4KLJA 3ZDDA 2LHTA 4JI8J 3FEZA 1BUXA 4PABA 4KLSA 2Q1NA 4MFBB 2L08A 3R97A 5AR0A 4JRPA 2H9ZA 1QQMA 2E1PA 3QZ7A 2HHWA 1J6ZA 3JYTB 3DRPA 5A8KA 1S9FA 4RQ7A 7ICLA 5CEHA 4G1PA 3S3NA 3TFRA 4Q8FA 3DLKA 4PPZA 4Q45A 4CNZA 2EFPA 4A8FA 4PHEA 1XO1A 5KG0A 2DQNB 3QMLA 5J2DA 5B0CA 1RTZA 3AY0A 5GAEP 4K2XA 3O1WA 4N7TA 3RJGA 4K4ZA 1UAXA 5HSPA 4FWKA 4MTPA 5CR4A 4GVLA 4JEPA 5I42B 4YG2A 4RW6B 2D0CA 2C2ZB 1N5VA 3WIVA 3HPHA 1EWRA 4YR0A 4ID8A 2NRTA 3M8QB 1OSDA 1UWAA 3NGRA 3SFUA 2R7YA 3NVMA 1WC3A 5A76A 3GB0A 1VC6A 3CJ3A 1KD1O 3MCMA 1VSDA 1UZHA 1ULRA 2JLEA 3WK8A 2JMGA 2RHFA 2ZBCA 2SXLA 1T44A 2DNQA 2UXCK 4X65J 3OA9A 3PUFA 3I0SA 4X84A 3DDHA 5BPNA 4KIAA 3OYEA 1X4AA 1L7PA 4RX6A 3J7AN 1N56A 5JVGL 4D3HA 3MDQA 5I3QA 2I0XA 3OHBA 2NUBA 2VBWA 3QICA 4OZ0A 2EAOA 1LQ9A 1KVIA 5HHHA 4GKKF 3BM7A 2ASPA 4QYZK 2FSKA 4CGFA 1FO1A 2AYBA 1J53A 4I27A 2E2OA 4UB2A 2AW0A 2BJ1A 2KM8C 1EWQA 4RUAA 5DGAA 2R8HA 1W2BM 4P4MA 2HRYA 2JLGA 3ZSZA 3QT6A 5LXYA 3CVKA 1QQNA 3KLVA 1Z26A 1GLFO 3S7RA 3BV8A 1FRKA 4KV8B 4ZN3A 2GVZA 4HVJA 2M0GB 2KJ8A 3BZCA 3QEAZ 4UAVA 4NLPA 1TP7A 2FJVA 1QVGR 1HD0A 1TVRA 5IQ6A 5IINA 3JPPA 4CHPA 3ENWA 3FKBA 4YD2A 1IH7A 5BRDA 4DU8A 3HOTA 4JP8A 3W2VB 1E6VA 4RLEA 1S3XA 4BRMA 4ID5B 2YJEA 5HAOA 3ISCA 3M5RA 2B6AB 4O5FA 3M9MB 2ZBPA 4XPEA 4ZA1A 4URSA 3SQGB 2OD4A 4KAIA 2CRLA 3O8WA 1N33K 5FLXU 3L2QA 4CE6A 1VBYA 3D2EB 5KT4A 2BJ3A 1XBWA 3M2VB 2KT5A 1Q95G 3R3TA 4MFAA 4WCEQ 1YJ7A 2DO0A 2VC1A 4AE5A 3M6ZA 4RPZA 2QJ3A 2AEMA 3VETA 1ZZNA 4OKEA 4C7YA 1U04A 2PFQA 4C4WA 5F0XA 5HNKA 1KDHA 1IBLK 1KLMB 2W3SA 2DY4A 4USAA 4LFCJ 8ICJA 4PPXA 2Y0SC 2QRRA 4ZKAA 2QWLA 4R64A 1AYEA 5ETLA 3NUQA 1CVJA 2KK0A 4GMKA 1XNQJ 3TZZA 2LVWA 2NUHA 1NOZA 4M63A 4XQ8A 4ATNA 4FYWB 1QD1A 2FJAB 2OPSB 4UB4A 1LVHA 4CGGA 3IBWA 4OYOA 1DJ0A 1TELA 2KEYA 3KFUF 3Q23A 2IGIA 3UKUA 2N3OA 4AQYK 5C2DA 1Y5NB 1BPYA 3Q8UA 4Y28C 3TTDA 5AXMA 3SFGA 3TVKA 3NAIA 4YY3J 1S6QB 2EK6A 3IBPA 5C25A 4MN4C 3SDEA 3M32B 4US8A 3THTA 5LSRA 4DWIA 1CPZA 1U2VA 3S6JA 4O5EA 2UVRA 1PYOB 1Z2ZA 4F5NA 1NKEA 4I6AA 1Q8KA 2ODGA 3OR2A 4RW8B 1VQ7N 5RUBA 2DYAA 2XNRA 3Q24A 1NCLA 1RDWX 3PSPA 2DNKA 2YMQA 4QIFA 3U9DA 4LF8J 1VJQA 3CDBA 4P10A 1J5EJ 3KJVB 4FNIA 2ZTDA 4C0ZA 1XNRF 4MHVA 5HMXA 4CTAA 3C6AA 4CI6A 1IBKK 4UATA 4IG3A 4A8QA 5D3GB 3RB0A 3ZFVA 3L2RA 1VQPN 1K1SA 4FBTA 3BN7A 3KJQB 2X3DA 3I6PA 2CRXA 4WK1A 5AM4A 5EDWA 5GINA 1U2FA 1GH8A 3TANA 3H8JA 4M5IA 2UXCF 2XLIA 4B9NA 2ZM6J 3ZEUA 4FJIA 2VA8A 3HKZC 4IO1A 2IDOA 2JX2A 3OW2M 4ECUA 4C8YA 4YHHJ 2MKCA 3MAAB 4OPJA 3D6RA 5IM0A 5J1EB 3LDAA 2WBMA 4NLXA 3GCXP 1DK2A 1NSPA 4AD6A 4K4GA 1F60B 3H0PA 2QA4S 1SZ2A 4RBTA 5CD4A 1HNXF 4DKWA 1TL7A 1U26A 2K8CB 1ZBLA 1KD1T 5KFMA 2Q66A 4KE5A 2P66A 3L0QA 2F40A 3GYGA 3GFZA 4M41A 2Y9UA 4YOEA 5FPEA 1GX5A 3QEBZ 1N0VC 2G8HA 4KLQA 2NRWA 4OYMA 3C6HA 4HDHA 4MT1A 4CF3A 2BDUA 4X5VA 2XHWA 2HBZB 3FFIB 2BJEA 2VBYA 2EHGA 4JI5K 1RI7A 1NDKA 5H2FU 4UAWA 3W66A 4ICLB 3BGLA 3MCAB 1HYSB 5KAFU 3KWIA 2HFZA 1WSGA 5BPMA 1WSJA 4ID1A 1V9OA 2OUGA 4FF1A 4MF2A 4ZCLA 2LYHA 4NA1A 2DBBA 3SCJE 4R65A 3ENQA 3C1ZA 4H5NA 3QJLA 1EARA 4WP3A 3BKTA 3R8YA 1X9JA 4H5VA 4HUFA 5GADP 2W43A 4RW4B 3U1MA 3H4BA 3DLGA 2EAMA 1N33F 3WEEA 3JQMA 1DEJA 5DM6Q 2F1JA 2KICA 4NLZA 2FPMA 1FJCA 1VLOA 1QHTA 3V1OA 5AZJB 3SCLE 2B0GA 4UB6U 3IUCA 4CK1A 2YPZA 4JI6J 3ZT4A 2CG8A 2MKSA 3POTB 4B1WB 2YHXA 1GT8A 5AM2A 2RSQA 3RR7A 1FRLA 2DNLA 4WTOB 1CG2A 2JFKA 5B0FA 5LXRA 2HSTA 3C0BA 1EX4A 1WTFA 3MF5A 3MMCA 4JI0F 2FBTA 4J2EA 1HHQA 4M5DA 4LF1A 7ICEA 1HBOB 4TQRA 1I1GA 3EUNA 1IBLF 3EXCX 4FNHA 4DSJA 4DL0C 5CZ2A 1OH8A 4BBYA 2GO9A 3U3YA 4RBUA 1P8GA 2AP1A 4DR6K 3MWPA 4DEZA 3TARA 1CQMA 4XO0A 3OY9A 4C6AA 3PSFA 1L3SA 3AB2B 2DR6A 1SJ3P 4FO0A 1ICEB 2K7JA 4Q8EA 3CI5A 5BYSA 1Z2LA 3J7YI 2GELA 2OELA 3SSSA 1SQGA 4WZQA 4P0QA 4IFVA 4C4RA 3PIOQ 8ICTA 5G5HA 4ZOSA 4ISFA 1XUPO 4AQYF 3NGZA 1WSRA 1G15A 1BVSA 3ZLJA 4ZITA 3KTQA 5AQTA 1BD6A 3O2IA 3DYAA 1QCKA 2P9GA 3LDOA 4OYWA 3DXBA 3LWMA 4FP9A 1H38A 3K8WA 4M6WB 2MB0B 4ILGB 3WQPA 3Q8RB 2NYHA 3K57A 2MKKA 3QLHB 3M9NB 4ILRA 4NRTA 4WQ4A 3C94A 4WXWA 3M8RA 4CJFA 1FFSB 3G0ZA 3AVAA 2AJQA 5AICA 1GX6A 1HUOA 1IBKF 4KHMA 1MWQA 4DCCA 5A8RB 5BR8K 3VCBA 3DDKA 1RT1B 1RBAA 1XQSC 4MKBA 2DFEA 2OPRB 4ALZA 4O4RA 4AT1B 2PMZC 3R9PA 4CJEA 3I0RB 2IYGA 2WBRA 5JMNA 4JKBA 4DOCA 3N6NA 3I5CA 2ZJPQ 1RWWB 1RG6A 3C14A 2O67A 2P8IA 3B4MA 3H2VE 5HATA 4CZJA 3K4GA 4OJLA 5L46A 3DM2A 2W9BB 1FI4A 4LR7A 4CO0A 3R5CA 4QZEA 4BR2A 3ALRA 4IR9A 1CBKA 2R2RA 4QR0A 5ALOA 2GGPB 5ETTA 3B0YA 2DRDA 1BNPA 2ATQA 4FPAA 4J03A 5G0RA 4IOBA 3ISDA 1C0TB 3PMLA 1D8BA 3KK3B 3OL8A 2ASOA 4DL2A 3AA9A 4DLGA 2LPEA 4OYBA 3CCRS 1SIWB 4FCYA 3IG1A 1TKTB 1EO1A 2V67A 1RTJB 2BKNA 1CJVB 2QWMA 4JI5F 2IC3A 2AKWB 3RSEA 2FDNA 4ZJQA 3IFRA 2VG7B 3QUCA 4H0YB 8ICKA 4K41A 4KREA 5AQOA 4ZS6A 1U1RA 2EPIA 4O8KA 1OPZA 2KXNB 4J2AA 1FE4A 4MIWA 1WHWA 4UUXA 4B6JA 4EI2A 4K4SA 2JOQA 4PXCA 5KFBA 2VBZA 2KU7A 2WF6A 3WKBA 5AM5A 1JCGA 3IDWA 2KQ2A 2B4PA 3UCZP 3NF6A 5KGXA 3D1QA 2C3OA 1NEEA 4QR1A 4FWPA 4FLWA 5J0WA 1N34K 2EW9A 5FLXY 2BUNA 3G96A 1TUUA 3TVYA 2RDDA 2MUTA 2W01A 3CNHA 1N5TA 1R7IA 3MOZA 5AQIA 1IWAA 4IQVA 2BGGA 1U1NA 2MDAA 2XS5A 3C19A 1VQYA 3WUHA 1BXNA 4U7BA 1VSJA 5BREA 1YJNS 2A0FB 2PN6A 5J0YA 5C24A 4KH4A 2HFNA 2ADCA 4IOCQ 4US9A 1B7FA 3MMBA 2YMMA 1XSPA 4L74A 3HW8A 2YY3A 3HI9A 3Q8QB 2VPXB 2NO4A 2H51B 2EFVA 1YIJN 5CYJA 1NAQA 1KQQA 4BRNA 1EQYA 4V1Ak 1UCVA 5AM1A 3W5XA 3HHNB 5LL6d 2RS2A 1FKOA 3HPOA 2G5IB 3MPDA 2DFHA 1LKYA 2QXLA 2F8TA 3MFIA 1TK0A 3WKAA 5C0YA 2KFZA 4NLGA 4DS5A 1H74A 3OYGA 4RUHA 5H9FK 1P27B 3Q7CA 4Z4CA 4DU3A 3RUBL 3GV5B 3CD6S 2OIHA 4NI2B 4LR8A 1WG5A 2ZH9A 3ZSXA 2HBJA 4LSLB 3H3NO 4M9GA 3QATA 1WJ9A 3RJHA 1HQEA 3QINA 3NS6A 2W7OA 4PXEA 5L9XA 1HR0J 1QTNB 3IXQA 4IOXA 4JK1A 1AQ6A 3IM1A 1YITN 3KBBA 5J0QA 3P31A 2LMIA 2K3IA 4X4OA 1M5HA 1NB2A 1MWZA 3S3OA 2IVMA 2UUTA 4LVNP 3IA0A 3PM9A 2A3JA 4QIWC 3UQ2A 3A5LC 3E9PA 5EWEA 5KFSA 4PRFA 1XHZA 2KYXA 3MGHA 2RIJA 5BR8F 4L6V3 5IFMA 1RAFB 1S1WA 4KMUA 2D69A 8ICCA 2CPDA 3JSMA 5HANA 1KSPA 1Z00B 2DD8S 1W25A 2PFNA 4TNOA 5C42B 1X3MA 1KL9A 2HOEA 3THXA 4LF9J 2DGVA 4CFBA 3MEEB 5KT2A 5U47A 4ECWA 1RT3B 4B3TJ 4AILC 4PUOA 3A5MC 4YMNA 4DR3J 2C2OB 3SUNA 4EWTA 3ZXWA 1UOCA 2GQ2A 1AFIA 2HSZA 5AE1A 5GAGP 2Y0SD 3JXOA 4RW9B 1G4CA 1QY7A 4J9OA 3RYLA 2GX8A 3VQ5A 4CZLA 2Q6CA 2JFDA 4EK2A 2FVCA 4WP9A 3M2RA 3OFHA 1C1BA 1ZQBA 1VRTB 1WCLA 4LF5J 1X9SA 3MR2A 2GX9A 2ZH1A 3OXGA 4Q43A 2YB1A 4HT5A 3E9LA 3AHPA 9ICCA 1F1BB 1IXRA 1RM6C 2D3ZA 4P2FA 2V4QA 4LF4K 2W11A 3B9JA 1RTIB 1SH2A 3EE8A 2P9PB 5E84A 4O3MA 2QKBA 2RF2A 2MQ8A 9ICXA 4PWDB 8ICAA 1T3QA 1JLEB 5J29A 2HGMA 3VF6A 5ALNA 2JEIA 1JB0C 2HHUA 4B3OA 1KAXA 5EY4A 1S1VA 4CEAA 4I68A 1IJEB 2QL9B 3PV8A 1WG8A 1TMMA 2DBYA 2P51A 3C6UB 1YTUA 1PZNA 3QU5A 5K8MA 2YY6A 3D2SA 4USIA 3CJSA 2ZJAA 1P9QC 3A8JA 1SQKA 4L72B 1S6PA 3PX0A 1RTHA 1QSYA 3QX7A 2BH1A 1WLJA 4C8NA 4DV2K 3RAQA <