1U47A

Cytosine-8-oxoguanine base pair at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u47A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u47A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u47A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u47A01
4DO9A 3GDXA 5DGAA 1X2IA 2A1JB 3QZ7A 4LSNA 3ZDEA 1MQ2A 3IAYA 4CF9A 3TAPA 3C6UA 2IA6A 3OHBA 5FRMA 1NK4A 4O3SA 5HHIA 1BI4A 4Q8EA 2XO7A 4I9QA 3OYLA 3GV5B 3IHQB 4CIGA 4DOAA 3RBDA 7ICQA 3JPNA 9ICSA 3V7KA 4GC7A 5KT5A 3VN5A 4Q0BA 4F4KA 5EOZA 3H40A 4M6WA 4YFKA 9ICQA 3DLGA 3CFOA 4O3OA 8ICLA 5HP1A 1VSLA 3AO4A 5DB6A 1VSFA 1Y97A 3NE6A 3RH5A 4FZZA 4EBEA 1KTQA 4MFAA 2FC0A 4CGFA 4AHUA 2FLPA 4DTMA 3S3NA 4JWMA 1RBUA 1JKHA 4DSIA 5KG6A 3AO1A 2UVUA 3AV9A 4UQGA 4ED1A 1KVAA 3ALYA 1JLGA 1SL1A 3UQ2A 4E7JA 2P5OA 2G8WA 1NJZA 4PWDA 3LWMA 2PY5A 4OGCA 4HUEA 1KRPA 3ISCA 4YD1A 1ZQRA 4J9KA 4KHQA 3GIJA 4RW7A 4FLTA 3KKSA 4TSXA 5KFHA 3VQ4A 1JLCA 3RR8A 4PGQA 2VWJA 4X5VA 8ICSA 1NK9A 4ECXA 3KKRA 1JIHA 4NLKA 1TAUA 4M3XA 3AVNA 1C0MA 4N56A 5J2KA 5FRNA 3SUNA 4QWBA 1D5AA 1JLQA 1T8EA 2YKMA 3HSTB 3PW2A 3CM5A 1HPZA 1TVRA 4F2SA 3WNFA 1BL3A 4XUSA 4P4PA 5DG8A 3C2KA 2PFOA 1I39A 9ICBA 3RJJA 2A1SA 4ELVA 4O0JA 4FK0A 4DFKA 2PYJA 2KQ2A 4FCYA 2I5JA 1A5WA 5HHHA 3RB3A 2DFHA 2IS3A 4RW4A 2D0CA 4AH9A 2JEFA 2FBYA 4RPZA 3BQ1A 5KT7A 1RZTA 4Z4EA 3SUQA 1EXQA 5J2DA 1C1BA 4CIEA 4XA5A 3SQ0A 4DFPA 3T19A 2E4LA 4F50A 4FBTA 5DBCA 4B8CA 3U3YA 7ICVA 3AVBA 1FXXA 4OKJA 3TARA 3PMNA 2KN7A 4RW9A 1Q8IA 1ZQHA 2O4GA 7ICJA 4FLYA 2BCVA 4N76A 2E6LA 4E3SA 4IBNA 5C24A 4CK1A 3OYIA 4Q43A 9ICUA 2BCQA 3OJSA 4I2FA 2D0BA 2NUBA 4FW2A 1YVUA 4I2HA 5HBMA 4I2AA 2R8JA 4QZ8A 9ICKA 1ZQNA 3V7LA 3LWLA 5J0QA 4RQ3A 3TR8A 2DPIA 5F9NA 1BPDA 3NGDA 1A5VA 3NDKA 3Q8MA 1L3TA 2IBKA 1A76A 2ASJA 1T4GA 1V9PA 3DYAA 4KHWA 4BE1A 5KFJA 3FYHA 3TFSA 5KFGA 3V9ZA 4CGHA 1TVAA 1ZQFA 1C1AA 4ECZA 5DB7A 2ITGA 3NFAA 4J9MA 1ASUA 1A5XA 3VQEA 5DLFA 5KTQA 2OA8A 2R8HA 1LWFA 3ZSXA 4Z4IA 4DF8A 4M9NA 4M3UA 1S10A 4RT3A 3DLRA 3O3FA 2W9MA 3PW5A 4QW9A 4O55A 1W9HA 1IG9A 4FLZA 4KLDA 1IM4A 5CY4A 4DEZA 2W9BB 2ZTCA 1R0AA 3VA0A 4DL3A 3UXOA 4RNMA 5DQHA 4DQRA 2UVWA 3AVIA 3JYTA 5J0WA 2QKBA 3SQ4A 1KLMA 3B0YA 3ZDCA 3DLKA 1BVSA 2RN2A 3NGYA 3AU6A 2FMPA 4MQ3A 3AA5X 4EEYA 4BDZA 4RUCA 4RQ8A 4J9RA 5DQIA 1WSHA 4FBUA 4IFYA 4FW1A 2G8VA 2P66A 3C5FA 2BHNA 1BPBA 2ASLA 4EYIB 2ZUCA 4ID1A 1DGSA 4CEOA 1BPXA 5DB9A 4O5KA 4QZDA 2ATLA 2P5GA 5SWMA 4CFBA 4ZTJA 3H08A 4Z6FA 3KTQA 2YNFA 3JPOA 2W42A 3AVAA 2NRWA 4KLTA 4HTUA 4CGJA 4UAYA 2YNIA 2W9CB 2UVVA 1K6YA 4O5CA 5J2JA 2X6SA 4B9TA 4CJUA 1XI1A 3KD1E 1SUQA 4P4OA 3OSNA 1HNIA 5KT6A 4ECQA 4F92B 4UB4A 3GV8B 2V9WA 3HP9A 4DL4A 3N4MB 3LPTA 2FLLA 4B9MA 1UWBA 1N56A 5CZ2A 2IHNA 1JN3A 4IQTA 4YFUA 3TANA 5J29A 4H4MA 3HX0A 3HW8A 3SV3A 2BPFA 1S1VA 4QCLA 4QAGA 5C5JA 4PUOA 4IKFA 3RJKA 4CJTA 3QESA 3TQ1A 4FM1A 4F91B 3LK9A 4XIUA 4KAZA 2FPLA 2NRTA 8ICRA 4CESA 4RW8A 8ICOA 1JXEA 4B9LA 1KFSA 4R65A 4KLGA 4OGEA 3V6KA 1KLNA 4KO0A 4MF8A 5KFIA 4FLVA 4KLSA 1IXRA 4JLHA 1RBRA 4LY7A 3OYCA 1ZQKA 3AA2A 4YQWA 4I28A 2KW4A 2HVHA 3ZT4A 3PY8A 2FBVA 5KFLA 1XWLA 1S0VA 4O0IA 4FO6A 5J0RA 1RTDA 1MC8A 1EETA 5DB8A 3TFRA 4FYDA 1WCLA 4NLNA 2GBZA 4JS4A 2DFFA 4W5OA 4ECRA 2QXFA 4FJ7A 4GXJA 3GILA 1J5OA 3PX4A 4KHYA 2Y1IA 3ZSYA 2WONA 3DRPA 4RG8A 3RR7A 1VRTA 1WSGA 5KFPA 3RB4A 1REVA 2BE2A 5J2PA 4C8OA 3PW7A 8ICXA 1BQNA 3RJEA 1VSJA 8ICPA 3HYFA 2QK9A 4CJWA 3RRGA 2AGOA 1ZQWA 1S0OA 3K5LA 3EYZA 3BQ2A 3RMAA 3AVJA 4J9PA 4EBDA 2BCUA 3SUOA 4DTXA 8ICKA 4FJ5A 3RB0A 4I2EA 2ZD1A 4YMNA 4M3YA 3OYAA 4FJXA 3NGIA 5KI6A 3KLEA 1TK0A 3V1OA 4KN4A 1JLEA 1JXLA 2XY8A 4M3RA 4FLXA 3LP3A 5KFRA 1S0MA 3LANA 4KLEA 3MGHA 1U45A 4YVZA 1TV9A 1G15A 4NYNA 1IKVA 1XHXA 1RT6A 2FPKA 3CG7A 5JS1A 4AHTA 4DU3A 4M04A 3ZDDA 3VQAA 3ZD8A 3LDAA 2PFQA 2FMQA 4F5PA 3LAKA 4ZH4A 1QSLA 1XO1A 1IKXA 2RDJA 4IQVA 3ISDA 1LB2B 8ICJA 4CGGA 1UT5A 4HYKA 1TK8A 3PO4A 1S97A 4QZCA 5KGWA 4E7KA 4FK4A 3V81A 3NAEA 3AVKA 2PFPA 5FROA 5T7BA 4CFDA 4NXZA 1VSHA 3V4IA 4RT2A 3B0XA 2PYLA 4O5BA 7ICFA 3QERA 2BGGA 2DFLA 1NK8A 3S3MA 1LWCA 5KG2A 8ICIA 2HW3A 1HQEA 3V1QA 3A2FA 3IRXA 4M45A 1J53A 4CF1A 9ICJA 4CERA 4E19A 3QETA 5KG5A 1VSMA 1BCOA 4B08A 5CYMA 1NJYA 2BQRA 4RQ0A 5TZVA 7ICSA 1EKEA 4JV1A 3RMCA 4JWNA 4CGDA 2C22A 3RAXA 5KFOA 4MFCA 4LZGA 8ICQA 2YNHA 2ISOA 5KFBA 3RMDA 2F8TA 5KFAA 3KJVA 2Q0ZX 4YXJA 4IR1A 3ISNC 5J0OA 3VQPA 3CFRA 4UAWA 5DBAA 1ZQCA 3SCXA 4ID5A 2ALZA 1HUZA 3L2WA 1C6VA 4ECUA 3T5KA 2BDPA 4ELTA 4RU9A 3OYBA 1NOYA 1SL0A 3K5NA 2P6UA 4M41A 1K1QA 2R8KA 3C95A 1LW2A 2G8FA 1JLFA 1XHZA 3LP2A 3VQCA 2HHTA 3QNOA 3KLHA 1RPLA 3M8QA 1S6PA 1NK6A 2KZ3A 1RDBA 1BCMA 4O3PA 1LWEA 2FLNA 1QLNA 1KFTA 4IRCA 2D0AA 7ICUA 4BWJA 3T5LA 4CHNA 3MR5A 4M0AA 4NLZA 4F4WA 3RH4A 4F5RA 2AGQA 3HP6A 7ICIA 2OPPA 1Z00B 4PGYA 3Q8SB 4N5SA 1UT8A 5DQGA 3G0ZA 3F9KA 2IGIA 2IC3A 4ED0A 4O5EA 4GW6A 5HMMA 3MGIA 1RT7A 3ZSZA 4DU4A 1BGXT 2W9AA 1RDDA 2ZUDA 1VK0A 4M3ZA 4QZIA 4QZFA 3I8DA 4R63A 1DLOA 3KD5E 4DL2A 1S76D 4BE0A 1IO2A 4FJJA 4KI4A 1QHTA 1YTAA 2VG7A 5KG0A 5DDMA 1S9GA 3IG1A 2B5JA 4ECWA 9ICOA 3NF6A 4DL5A 2BR0A 4GXIA 2JEJA 1K1SA 2AQ4A 1SKWA 2AGPA 4DS4A 1HNVA 3PR5B 8ICEA 2ATQA 4OVLA 4M9HA 3NF8A 4Q44A 1JLBA 5JUMA 2O4IA 3BDPA 4K8XA 4HVJA 4I2JA 2ZTDA 4O3QA 5J2BA 4Z6EA 3HWTA 4MEXA 1RCHA 3TI0A 2F8SA 5L9XA 3M9NB 3KHGA 4QZAA 2W8LA 3SYZA 3MDAA 2ETJA 3EW9A 9ICAA 2YHBA 4Q5VA 4CEDA 4KLQA 3VQQA 2HB5A 4CJLA 5KRSA 5DLGA 4FJLA 4H4OA 3L2UA 1CUKA 3ZDBA 3SI6A 2JEIA 1QSYA 5KFTA 9ICMA 3C21A 5L1LA 3VA3A 4LD0A 3QIOA 1ZJNA 3MFIA 1TAQA 4YR0A 3ZSRA 3PV8A 3TAGA 4DSEA 5KFEA 5IIIA 4M9LA 4DG1A 1ZQLA 3HVRA 4DL6A 2P6RA 4LVSA 4F2RA 4KTQA 5J0XA 5KT3A 1KDHA 1B9FA 2BQUA 2F1HA 2MUTA 3Q8LA 3P5JA 1CZ9A 3SJJA 3OJUA 1TGOA 4AHRA 4OLAA 4KLFA 2VG6A 4ED2A 1X9WA 1JL2A 4M2YA 1ZQZA 5KFWA 3L3UA 4YG2A 2J6UA 1RILA 3PUFA 2M9NA 5CWRA 4HCBA 1ASVA 4Z4FA 1O1WA 3QEVA 4M47A 3V72A 3FFIA 1CZBA 3ZT2A 3LZJA 4RNOA 4I29A 3JPTA 2ZJAA 2Y1JA 3K5OA 5KFFA 4LH4A 4CHOA 4QZHA 4J2BA 2KZMA 1C0TA 3QEXA 4KLLA 3G10A 3G6XA 4KPYA 3K59A 4E89A 3TAMA 1S1WA 4ED7A 1ZQIA 3LPUA 1NK0A 4OKEA 2XY5A 4HCCA 1T7PA 2ISPA 2BGWA 4B9SA 4CCHA 1JLAA 3QO9A 3SPZA 4C8NA 4YCXA 3H8JA 4BGDA 4W5NA 4KB1A 1NOZA 3MEDA 2KFNA 3JPSA 3SI8A 4CJPA 5HRPA 4NCAA 3RBEA 3LAMA 3T3FA 4FJGA 4FZYA 1NOMA 1YTUA 5J2IA 4JV2A 7ICHA 5KFUA 3QZ8A 2VA2A 2I9GA 4TQSA 2A1JA 4K8ZA 2V4QA 3C2LA 4E7LA 5I42A 3VQDA 8ICAA 4Y1CA 1UAXA 3H7IA 4FS2A 5L1IA 3ULDA 5HROA 2R8GA 1WSFA 1XSPA 4CGIA 2OZSA 2VA8A 3AU2A 3KK1A 2HNDA 1CXUA 1JX4A 3EWAA 1H38A 3NHGA 4FJHA 9ICEA 4UB2A 5IIKA 1JXBA 4KLUA 2DFEA 1S1XA 4CE9A 4QWAA 2F1IA 3RB6A 2WOMA 5CB1A 1NKCA 7ICLA 1N6QA 2H5XA 3NH0A 4JUZA 4MF2A 4XQ8A 3AA3A 3ZDAA 4HUGA 2G8IA 5DDYA 1DTQA 4FVMA 4R8UA 3WNHA 5KT4A 3PNCA 4XRHA 5HNKA 3QE9Y 3JSMA 3OYNA 4PHDA 1VRUA 3GIKA 1ITGA 2BCRA 4K4GA 4PHAA 3UPQA 2WTFA 4MFFA 1RT4A 3D0PA 5CHGA 2P51A 4KB0A 1U47A 1ZQMA 2Z1GA 1HQUA 3DMJA 2BPCA 3UXPA 1ASWA 3KHHA 4OPJA 2C2DA 1RTJA 3C23A 3MXIA 2X74A 2R8IA 5KG4A 1RBTA 3UXNA 3MR2A 2V4RA 8ICVA 4B3OA 3VQ5A 5IILA 2AJQA 4EP5A 5IIMA 3Q8PB 4DU1A 5C42A 2YHAA 1XSLA 4Z0UA 3EPGA 3OS2A 1Z26A 4YR3A 4F3TA 4CF8A 1FKOA 5F9LA 1WAFA 3K58A 5KFMA 1RNHA 4QZBA 3V6JA 3WNEA 3O3GA 2OPSA 4Y1DA 3L3VA 2OWOA 5BOMA 4DOCA 4O44A 4FK2A 1SKRA 3DOKA 3V1RA 3QEBZ 2JZBB 4UB1A 3KLIA 1D8YA 3LALA 4BDPA 4QWCA 1ZQSA 4C8MA 3AO5A 4JS5A 2DTUA 4KI6A 4QZEA 4ED8A 3DLBA 4YP3A 2DY4A 4KTZA 4KMUA 2OZMA 2IOCA 3ORYA 2G8UA 2W8KA 4IDKA 4CK2A 4CEEA 3O3HA 4R64A 4LH5A 3MEEA 4CJKA 2XY7A 3IS9A 5DKWA 1KVBA 2JEGA 4DQIA 4YN4A 1L3SA 4PY5A 4CHPA 1HYSA 5DMRA 4ZHRA 4KLJA 4NYFA 1ZQJA 7ICOA 5KFNA 3NBPA 4CEZA 4KRFA 2J6SA 1N48A 4LSLA 4ICLA 1XU4A 2XRIA 4ECYA 4B9UA 3RJFA 5JS2A 4I27A 4UBCA 2OYQA 2G8KA 3NH2A 2LYHA 4RPYA 1YT3A 4EZ9A 3VQBA 2RDIA 3RJIA 2KTQA 4OKKA 4J2AA 3ZT1A 3AA4A 1TFRA 4C8LA 4CJ4A 4TUSA 3PVXA 1SL2A 3QEAZ 1Z00A 1EXNA 4B9VA 1U4BA 4I2DA 1D9DA 8ICFA 3QLHA 3MXMA 1ZQOA 2EHGA 7ICTA 1F21A 1L5UA 3OY9A 1X1PA 1XS9D 2HHXA 1ZBFA 2YKNA 1TL1A 4DMNA 5HLFA 1Q9XA 3LP1A 9ICPA 3P1GA 3HPGA 1WCNA 4ED6A 3DRRA 4NY8A 3M8RA 3OYGA 4P2HA 4CK3A 4UB3A 3V6DA 4YXMA 4IQUA 3P83D 3AUOA 4FJ9A 1U9LA 4J2DA 3B6OA 1IH7A 2JLEA 4R66A 3HPHA 1KCFA 3L2QA 5IINA 4H8KA 3ZCMA 2C2EA 3S9HA 3V9WA 4L8RB 3DRSA 3PW0A 4ELUA 4M9GA 4N47A 3UQ0A 1C0UA 4JRPA 3OYDA 4PGXA 8ICTA 3OHAA 3SNNA 7ICNA 3NF9A 5J2QA 1U04A 3TABA 2FBXA 5DG7A 4CEQA 1RXVA 4IRDA 5EWEA 1LW0A 1RTIA 4ZTFA 2GWSA 2MUTB 4QWDA 3NGZA 3G6VA 4FJIA 4DQSA 2ZE2A 4EP4A 5IIOA 5C25A 1BIUA 2W9BA 3O4NA 3M9OB 4W5TA 4N41A 2Z1HA 4CJFA 3KHRA 2AQ0A 4E1NA 3NF7A 4F5OA 4M3TA 4UBBA 2NRXA 1S1UA 2QKKA 4YMOA 1S9EA 4CEBA 4O3NA 1TKXA 1ZBIA 1L3UA 5DGBA 3WNGA 3KLFA 1BQMA 4W5QA 4DS5A 4C8KA 4CHZA 1Q9YA 2IMWP 4RQ1A 1J54A 4FM0A 1RBVA 2Q3SA 3ZT0A 1SV5A 4Z6DA 4F4ZA 3EY1A 5FDLA 1WNSA 5KFYA 1FKPA 4E7IA 1B43A 5KFKA 2ASDA 4FXDA 4ECTA 2HNYA 3OYJA 7ICRA 4DSFA 4B8AB 2FPMA 1GOBA 2E6MA 4G3IA 1VSKA 1HJRA 4DTRA 3H8WA 4JV0A 3RH6A 3TAQA 3JPPA 3RWUA 2MAXA 8ICZA 3GIIA 3BJYA 1BPZA 4LZDA 5J2GA 1NK7A 1WSIA 4O4GA 3V9XA 2KFZA 1UOCA 1ZBLA 1NJXA 8ICGA 9ICTA 2ZTEA 4F3OA 1IKWA 2IDOA 1W0HA 5CA7A 8ICYA 7ICEA 3L8BA 1BPEA 8ICUA 3DM2A 1HYZA 3HXMA 3TAEA 4PHEA 5L1KA 4J9NA 2HHWA 3GIMA 4CJ5A 4KTWA 3AVMA 3OYEA 3U6FA 3OYKA 3OYHA 3PO5A 2G8HA 4I2PA 2RF2A 5KG7A 8ICBA 1NK5A 1D8LA 5BPCA 3MABA 2R7YA 1N5YA 4QZGA 4KN7A 1RXWA 4NM2A 5CR0A 1A77A 1C1CA 4R5PA 1MQ3A 5J2HA 3E2EA 5KG1A 2OPRA 5D49A 3DOLA 2ZJ5A 2A1RA 4KHSA 4Z4GA 1U48A 3L2VA 1ZBUA 2AU0A 5L1JA 2YV0X 2J6TA 1NKBA 4DQQA 1RDCA 4EZ6A 3TWHA 1JMSA 5KT2A 1U49A 4DTOA 3GQCA 4DQPA 3LZIA 5KFVA 4YD2A 1B22A 5EWGA 8ICMA 3GV7B 4M9JA 7ICKA 4W5RA 4FJNA 4IR9A 5J2CA 3M9MB 4F5NA 3JPRA 4EYHB 5D3GA 4BACA 1J9AA 4CF2A 1AROP 3TAFA 3OSPA 5SZTA 2BPGA 3ZSWA 1TKTA 4FM2A 5J0SA 1GOAA 2NRZA 4IQWA 5J1EA 4F93B 4RQ2A 1T05A 2I1QA 4NM1A 5EWFA 3NCIA 2LSNA 4I2IA 3K57A 3K4GA 2HHVA 9ICVA 4CJVA 9ICNA 4PA1A 3MR6A 1I3AA 3AVFA 4IG3A 4K4HA 4NCGA 1TKDA 3E01A 9ICLA 2FMSA 2ZJ8A 8ICNA 1QQCA 1QE1A 2VA3A 2HMIA 4CHYA 1TK5A 1RT3A 4E7HA 3OGUA 3IM1A 4FJKA 3AO3A 4RPXA 5KFXA 4GMJB 3DLEA 3HVTA 2DPJA 2BANA 4M42A 2B21A 1TL3A 2HHSA 3MECA 4AHSA 5K14A 4J9OA 3M8SA 2Z1JA 1SZPA 1KVCA 4KHNA 1VSEA 4KLIA 3AVLA 2VANA 3AVGA 2JGUA 2HHQA 4RQ5A 1UA1A 3K75D 3U3GA 4QZ9A 5J2AA 1BI4B 3SQ2A 4DSLA 4CIFA 3OYMA 2RPIA 1VSIA 1BHLA 1RT1A 1DTTA 4J9SA 4IFVA 3KLGA 2HHUA 4GLXA 4DTNA 1Z25A 3KK3A 3K5MA 1COOA 5DK5A 4TQRA 3ITHA 3BQ0A 4RUAA 4F5QA 5D46A 3NTUA 2XC9A 1ZQPA 1WSJA 3EPIA 1T03A 4PPXA 1CXQA 2XHBA 4YMMA 1B9DA 4DLEA 7ICMA 4KFBA 4BDYA 3KHLA 3C5GA 4IRKA 3Q8KA 1UA0A 1RDAA 5HMLA 3QEPA 2B4JA 3GFKB 9ICIA 4I2QA 3OS0A 2F96A 4NCBA 3H4DA 5E41A 3AO2A 3QEWA 4RNNA 1NJWA 4M3WA 7ICGA 5I3UA 4PHPA 1RT2A 3MDCA 2FBTA 4Z4CA 3HJFA 5KFCA 3RJHA 4DLGA 1ZQQA 3D45A 1B92A 2XCPA 2PXIA 1LAVA 1VSDA 4JK1A 9ICHA 4IG0A 3S3OA 4ED3A 1ZQYA 3Q8QB 3PW4A 1TKZA 4DTUA 3ZSOA 4J9QA 2D5RA 1RYRA 3RTVA 1ZQTA 4Q8FA 1S6QA 2BKEA 3V7JA 5J2EA 5DG9A 4KV8A 4UAZA 3PMLA 3MXJA 2NRVA 1HMVA 1T3NA 5HRSA 4GXKA 3BQTA 3RMBA 4R8UB 5CZ1A 3MEGA 4YNQA 4OPKA 3THVA 5CP2A 4CJ3A 2UVRA 2YNGA 5IIJA 3VQ7A 2PZSA 4I7FA 3KIOA 3C1ZA 4KLMA 4FLWA 4NLGA 7ICPA 2GV9A 5J0UA 2P1JA 2PI4A 1KFDA 4QOZB 3F73A 5KFSA 4FZXC 5J0PA 4HHTA 4J9LA 3VQ6A 3CM6A 1ZQBA 3C1YA 3ETLA 3SZ2A 1SKSA 5EU7A 1XC9A 3PR4A 4E1MA 4QW8A 4F8RA 3HT3A 1ZQAA 4K4IA 4MFBA 4B9NA 4DSKA 4JRQA 3OVNA 4FLUA 2C28A 4M6WB 3V9UA 4CJRA 1HRHA 4P4MA 4FJMA 5J2FA 4G1QA 1BPYA 4DFJA 3V9SA 4BE2A 4RZRA 1Z3EB 2BCSA 5HRNA 4KLOA 5HRRA 4GVMA 1BIZA 2VG5A 4MEYA 4O3RA 3MAQA 3B6PA 2IAJA 9ICCA 4CEAA 2ZQBA 1HUOA 4AILC 4KLHA 3HPOA 2IHMA 3RRHA 3C6TA 3ZT3A 1S1TA 3QINA 1QSSA 4TUQA 4CECA 4YR2A 4I2BA 1DOQA 1LV5A 4F4XA 4CJQA 1Y88A 4TURA 3M8PA 3NH1A 3JPQA 9ICWA 9ICGA 1JL1A 2EX3A 4HUFA 1MSWD 4CHQA 4KKOA 4DOBA 1KEJA 3VQ8A 2XY6A 5D4BA 3HM9A 1D9FA 1HJPA 1EP4A 2GUIA 3KK2A 4AHCA 5KFZA 2XGQA 4DF4A 5KFQA 4AHVA 9ICRA 3MR3A 3T1AA 1WAJA 4I9LA 4TUPA 4EBCA 3LDSA 4KITB 1X9MA 3HK2A 4UB5A 3HO1A 1ZQVA 3T5JA 3RJGA 4CFAA 3MFHA 3OYFA 1FK9A 9ICFA 4ECVA 3SPYA 1LAWA 1ZJMA 3LP0A 8ICHA 3PX0A 3DLHA 4I2GA 1QS4A 3K2PA 3ISBA 3CQ8A 4FJ8A 4E0DA 4KREA 3QIPA 4I2CA 3MBYA 1S77D 4DWIA 2RKIA 3H4BA 1ZQGA 4WE1A 1ZQXA 2X78A 3SQ1A 2PFNA 2PI5A 4RQ6A 2F1JA 5CJ7A 3C2MA 1NKEA 3VQ9A 5J2MA 4DL7A 4DFMA 4RW6A 3CFPA 2X6NA 8ICWA 3FDSA 3QEIA 3SUPA 4ECSA 3C94A 5CYQA 5KGXA 3V6HA 3ZSQA 1X9SA 3PX6A 1L3VA 4FS1A 3SV4A 3EZ5A 2HNZA 1TV6A 1S9FA 1IKYA 2ZUBA 2XCAA 4DTSA 3Q8RB 1ZBHA 1RBSA 4Q45A 3BGRA 5HP4A 4O9MA 2XGPA 4KHUA 2HVIA 1XSNA 3G6YA 3N97B 9ICXA 4OJRA 5KRTA 1ZYQA 8ICCA 1RT5A 4BXOB 3QNNA 4BWMA 5DBBA 1ZQEA 3I0SA 2W9CA 1HYVA 5J2NA 3T5HA 1WSEA 4RQ4A 3CYMA 5BOLA 1S5JA 3L2RA 4GC6A 3ZD9A 4PH5A 1CEZA 3ASMA 2C2RA 5KFDA 2Z1IA 5J0TA 4DTPA 4QWEA 4CFCA 2BQ3A 2OPQA 1ZQUA 1RYSA 4CJSA 1S0NA 1MU2A 4RQ7A 1PZNA 1ZQDA 4J2EA 4F4YA 2VWKA 3H8SA 4CJEA 3O4QA 4Z6CA 3I0RA 3AVCA 3HL8A 4DTJA 4DSJA 3OS1A 1WN7A 4CEFA 4Z4HA 1RTHA 3UIQA 2KZZA 1WLJA 1EX4A 4CF0A 4BXOA 3AVHA 5J0YA 1KSPA 5KG3A 1ZETA 3RAQA 1C7YA 4OLBA 1GOCA 3ZSVA 1CLQA 4PQUA 2B6AA 2JZBA 1BISA 3DI6A 1QTMA
chains in the Genus database with same CATH superfamily
3F53A 3N79A 3QT7A 4X64F 4K4VA 3QZ7A 2ESEA 3ZDEA 2MKSA 3EE8A 4GNIA 4P0QA 4CH1A 3NWGA 4LF4K 4CLZA 3UN3A 4KMOB 3H7HB 4Q8EA 4WFAQ 2XO7A 4DV2K 3OYLA 3GV5B 3MWPA 4ZVSB 3SBGA 1CBKA 3G82B 2P5VA 7ICQA 3H5XA 4JI8F 9ICSA 4R79A 2FLOA 3A0HU 4GVBB 4OYXA 1X60A 2ILYA 3DLGA 4JI2F 5ALOA 4O3OA 2HQ3A 3M32B 2QWQA 1Q46A 3NE6A 3RH5A 4EBEA 1CJTA 3J81U 3W9JA 2YTUA 3AA9A 3GCWP 4JB8B 2FC0A 2F77X 3EKUA 4AHUA 2KMDA 2EANA 2M2BA 1QAIA 5KG6A 3AO1A 2RLTA 2F44A 3VGKA 2HCFA 1VHFA 5TKYA 1VBXA 1SL1A 4H5NA 2VASA 4DR3F 7FD1A 3UQ2A 5AE2A 2P5OA 3ISCA 3S8SA 3WT0A 3QLHB 1ZQRA 2E2NA 3L7UA 2CQCA 4S0MA 3GIJA 4PR6A 5A8WA 1U6BA 4RW7A 2IBOA 2VWJA 1NK9A 4ECXA 3KKRA 1JLBB 4NOHA 4OX9F 1TAUA 3MECB 3UD4P 1U1OA 1SQFA 1YJUA 1KQSR 3HHNB 5J2KA 1JLQA 5BREA 2LM4A 2EAMA 3CO9A 2AIRB 4F2SA 3WNFA 2DL0A 5AQOA 3VAMA 4P4PA 5DG8A 1KN5A 4KHPJ 2VB6A 3C2KA 3RJJA 4DFKA 3IFRA 2WBRA 1EQYA 5HHHA 4UASA 4XDCA 5AKJA 4RW4A 2D0CA 1DRZA 4RPZA 3BQ1A 2R7SA 4WKRA 3J8AA 1RQLA 2HNYB 3A8IA 1EXQA 3M2UB 3O0FA 5J2DA 3J80Y 5LL6Z 3SQ0A 5CH7B 1PJ5A 7FDRA 4B8CA 2FHJD 4OKJA 1TL5A 2FZGB 3PMNA 4LIRA 2E1PA 5FPNA 1Z1VA 7ICJA 3W61A 2YNGB 2EWHA 1PYSB 2E6LA 1BUPA 1NMNA 2GWKA 3IRUA 4IBNA 4AF1A 3O80A 1GLFO 9ICUA 3PIPL 3CGIA 3U1MA 5AQNA 1SBRA 4JAXA 2DNZA 2OD4A 2V2QA 3OJSA 5AKXA 5CQGA 3R27A 3MCNA 3W2VB 2DNGA 2D0BA 5F2RA 4FW2A 4I2HA 3BYPA 1X3NA 1OWXA 4KHRA 4X4RA 1D3WA 2MY7A 5J0QA 3AT1B 3J7ZT 1BPDA 1RAFB 2I38A 1Q7YT 3ICLA 5BYQA 1VJ5A 2P9KA 2KJVA 3FYHA 4C4RA 3KK7A 3Q89A 4CGHA 5LMUF 4YDUA 1I51B 1ZQFA 2ITGA 3BS5A 3NFAA 2E8PA 3VQEA 5DLFA 3LP1B 3JSYA 2F8EX 3KUHA 3ZZZA 3R8YA 4Z4IA 3ZSXA 3HULA 4TU9A 1ZH5A 4DF8A 4CP5A 4M9NA 4M3UA 2KHDA 2W2OP 4BRLA 4FL9A 3G87A 4G6VB 2I7NA 2EKYA 1V6HA 1WHWA 3QGGA 3VQSA 3D7SB 3IN5A 3ZX3A 1I1GA 3IXQA 4RW9B 1IM4A 4A62A 1HD1A 3RRKA 2G0JA 2YB1A 5ETMA 3JYTA 4PJ0U 5J0WA 4QJVA 2QTDA 3H0LB 3D6FB 2F65A 3H46O 4TXSA 5IC4B 2FMPA 4MQ3A 3F2KA 4DCHA 4KYZA 4BDZA 4RUCA 2BKOA 5IT9O 4IFYA 1HIYA 2UUBK 4EYIB 1T0TV 2ZUCA 4B3OB 4CEOA 3L4PA 3CEDA 1BPXA 5DB9A 4O5KA 2ATLA 2HFZA 3H08A 2CPDA 2QTWA 4Z6FA 2R7RA 3TNVA 1NGEA 4X66K 2KU7A 2DWQA 3AVAA 2AH5A 4DPXA 4LF6F 3DGPA 4ZPBA 4KGXB 1Y5IB 5J2JA 4OZ0A 1SC1B 4CJUA 1XI1A 2ROGA 3OSNA 3HP9A 3N4MB 3LPTA 2IJRA 1TL7A 2JVRA 1UWBA 7AT1B 4YFUA 1TMMA 1LWEB 5ALFA 5J29A 5KQDA 3CJ3A 3N5FA 1MWQA 3AAQA 3ZO7A 1S1VA 2ADCA 5FD1A 5C5JA 1RADB 2G2OA 2RNEA 1HNIB 3R7SB 1SJRA 3I6PA 3R1HA 3BB5A 1NGIA 3RJKA 2HF3A 4CJTA 3WZ0A 1NNDA 3FK4A 1N52B 4ILLA 2CADA 3LK9A 4XIUA 4P74A 4CESA 2XZTB 3KOAA 2H3EB 1JXEA 8ICOA 4B9LA 3R8EA 3V6KA 4ZPAA 2HWIA 5KFIA 4CRJA 3CCTA 3CCQS 1B7FA 4ANDA 4FLVA 4UOGA 1HWUA 1IXRA 4JLHA 4CI6A 2M52A 1BLUA 3MM8A 4FPBA 1YI2S 2KW4A 3SXLA 1B3TA 3O9UA 1R8AA 4JKGB 5GAGP 3SBMA 2YCHA 1MC8A 1OYDA 5DB8A 2LECA 3OHRA 3W3DA 4FYDA 4ZPWR 2GBZA 1QCKA 3CW2C 2DFFA 1HNZK 3ZFVA 1P9QC 1DLOB 1L7OA 3W60A 2HLUA 1KQKA 4DN9A 2AP1A 4B1YB 2QA4G 3MC1A 3DRPA 4ILJA 2KP7A 4NL9A 4RG8A 1ZRNA 3I31A 3T1YF 3UE5A 4LFBK 2CQ4A 3N01A 2KO1A 1REVA 3LO3A 8ICXA 1N32F 4TVAB 1VSJA 4OHVA 3RRGA 2P9SA 1ZQWA 1S0OA 3M8WA 3K5LA 1WEYA 4JMUA 3C28A 4OJ5A 3I82A 1CJUA 2W2PP 5I3QA 4DTXA 8ICKA 4FYWB 5HJXA 3RB0A 4I2EA 1Q82T 3O08A 4M3YA 4ZCKA 3GSIA 1MNEA 4FJXA 2EI5A 3VVUA 3VF6A 1KN6A 4H0OA 3KLEA 2C3MA 3KFWX 1WSRA 4J03A 1VQ8S 2BZ2A 2AYGA 2F7TA 4M3RA 4FLXA 3LP3A 3KVGA 3D5MA 1GMVA 1K47A 4TNOA 3GDQA 3NY0A 3ETMA 3F5TA 4KLEA 3CCQN 4C0ZA 2HGMA 3KWIA 2CQPA 4DKWA 4NYNA 1XHXA 1FJCA 2CVEA 3M6WA 2V7YA 5JS1A 1JUDA 3OL8A 1VRQC 4BRNA 1XNRK 4AE5A 3AB2B 1R8PA 2MQQA 2EFNA 3LDAA 4E98A 1DGKN 2YX8A 1QSLA 5EE1A 3MX5A 1JLEB 4ANCA 3KUGA 2X51A 3IUCA 3PSIA 1VGYA 1LB2B 4CE6A 2VJVA 4DV7K 3C8YA 1JQGA 3IG8A 4BR7A 3QU2A 4CGGA 1MLAA 3UPFA 3PO4A 1S97A 4QZCA 4E7KA 5CYMB 1MN8A 2CQ2A 2PFPA 3P6YC 2QWNA 5DM7L 1F5BA 4CFDA 1VSHA 4PRFA 4RT2A 3L4BC 3PIOL 4O5BA 2HBQB 3G6EN 3VZIA 3CIZA 4KKOB 4RBVA 1NK8A 4ZDNA 5KG2A 2VFUA 4M45A 3BS7A 4US8A 4U7CA 9ICJA 1YBUA 4USJC 2Q66A 4MO4A 4CERA 4YOWA 1QHAA 2YY6A 2BQRA 2KH9A 2QA4N 3ZTPA 4RQ0A 4M7YA 1EKEA 3RMCA 2C22A 2Z30B 2C3UA 4H0VB 4JYAJ 5KFBA 3HKZD 3TOQA 2VFRA 3D67A 4YXJA 3OTOJ 1EQ0A 5A76A 5J0OA 3FJ2A 1YJNS 2YBVA 4HACA 3I4PA 3R6GB 2KHOA 2N82B 3DKDA 5E5NA 5EX5A 1BY9A 1HUZA 5ALDA 4ECUA 5U47A 2BDPA 4ELTA 4RU9A 2D3DA 2BOPA 1P8ZA 2FJVA 4DX7A 1K1QA 1LW2A 2GIQA 1S57A 3LP2A 2JSXA 2HHTA 3QNOA 2F2AB 1RPLA 3FEXB 1BCMA 4ZP9A 4O3PA 2LKYA 1L7PA 3MOZA 1QLNA 3T69A 1KFTA 7ICUA 3T5LA 5FLXU 1WG4A 5F3TA 1EX8A 2IDLA 3RH4A 4P10A 1WWUA 2QC3A 2CGJA 1XMOF 3D6RA 5CHIA 3NEKA 2IVYA 2OPPA 1UHUA 2YQ0A 2IGIA 1R0CB 3L6QA 1HHSA 1RLDA 1Q0NA 2OI2A 1XTZA 2D69A 3G25A 3FEYB 4ITSA 1RZMA 3Q24A 2WHOA 1VK0A 4DV3J 4DV7J 1WKKA 4RNHA 2VU5A 3J7Z5 5KPTA 2W04A 3EKSA 2OELA 3J7YI 1X5PA 4PG7A 1OPZA 3VEWA 5DDMA 2IAJB 1S9GA 2Y0SF 5AZJA 4DV7F 3UW1A 2B5JA 5E79U 1S9EB 3VCDA 4URSA 3DRSB 3SMSA 1TAMA 1TV6B 4JP8A 3B9JA 4NMLA 1TFYA 2K60A 2AQ4A 5AKLA 1HBMB 3W9IA 3HOTA 2VQFF 4C1NK 3MHYA 2XICA 5HMYA 2AGPA 1HBNA 2WVEA 4LF9J 1RHUB 2O4IA 3G71S 3PFEA 1F60B 1DT9A 4HVJA 1YG0A 4I2JA 1GLDG 1J5EJ 4O3QA 5J2BA 2OIHA 4ZIVA 4DUTA 2NXNA 1RWVB 2A5XA 4Y2PA 3L9ZA 4B1WB 4QZAA 2W8LA 3SYZA 1HBNB 1U2FA 2B8QA 2UP1A 4KBIA 4QPTA 2KYZA 4KLQA 2LCWA 2DO0A 3IR6B 4FJLA 1OVYA 4H4OA 4CZJA 3L2UA 1CUKA 3ZDBA 1SH3A 3ZC4A 4LR7A 5GAEU 2F9WA 2QWRA 4PKIA 1X6JA 2ZIUA 1NGCA 4K4XA 5D0HA 1CJVB 3QIOA 4LD0A 5F0WA 5AZIB 3MPUB 1BMQB 5GVQA 3OTOF 3TAGA 1N5WA 1RTJB 1R8HA 1LW2B 3BBFA 2VHGA 3CCUN 5KFEA 1HNWJ 3EUB2 4M9LA 4HWIA 4WF9L 4P2FA 3MM5B 2CPYA 1LOTB 2GVDA 1F0MA 2KI2A 4F2RA 4KTQA 3AJ2A 3HRDD 5KT3A 2D74B 2OMOA 2WAQC 4G1IA 4C0HA 2MUTA 2Z2YB 3ADAC 4P7VA 1RTIB 1CZ9A 1NZPA 3QBXA 1N34J 4KLFA 5CRXA 2LA4A 2GO7A 4NXMF 1WI8A 3KLGB 1KXPA 2K4HA 1PYOB 3M2RB 5KFWA 3L3UA 2DEJA 2P6SA 1S22A 4H0PA 4M5GA 1XEZA 3BM7A 1KKXA 1JI7A 2UUAK 3NAIA 2OUGA 3CULA 1JCEA 4QYRA 1UJ5A 1VQSA 1RAAB 5KFFA 4LH4A 4QZHA 1Q81O 1SKUB 4USAA 3C16B 4MFBB 2CJQA 3V4IB 1NK0A 1X7VA 4OZLA 2ISPA 2CPIA 3R97A 1RP5A 3QO9A 4MN4C 3E8OA 2WBNA 2FE9A 2OHFA 5HLFB 2JLGA 3DLLQ 2KKZA 2KFNA 3JPSA 3SI8A 3NMRA 1LK7A 2Y9HA 3MMAB 4CJPA 4NCAA 3RBEA 1H1VA 4Z94A 3T3FA 2MZRA 2D41A 3ID8A 4FZYA 1FDAA 1YTUA 3NRBA 3M1FA 5KFUA 3QZ8A 2VA2A 2A1JA 4K8ZA 1BOTO 3K0JA 3C2LA 4E7LA 5I42A 1U1PA 8ICAA 2ODGA 1VHIA 2R4FA 4N7TA 4C11A 2EVZA 1FJGJ 3GZ7A 3ULDA 3I0SB 4BRFA 2E3TA 2MLZA 4RWXA 1ZD3A 3EWAA 2YX1A 4M63C 2DB1A 1JXBA 1OH7A 2DFEA 1PVPA 3JTPA 4CE9A 3IR5B 4QWAA 1PAEX 3RB6A 5TISU 2CDRB 3U02A 3AH6A 2CQIA 2EK1A 1NKCA 2XZWA 1YBTA 5M2PA 3CPWM 1VQ8N 1NMEB 3IKMA 3NH0A 1U24A 4KHPF 4JUZA 3I0RB 4FKYA 4TY8A 1MN7A 1YQHA 5DDYA 4FVMA 4R8UA 2VC1A 3WNHA 4XRHA 5HNKA 4U7UD 3O9SA 4DR7J 1VLYA 2GA7A 3R1XA 4PHDA 4JI4F 2E5LJ 2BCRA 2LEBA 4PHAA 3ZEUB 3CCZA 4MFFA 4B1XB 1W2IA 3D0PA 4ID8A 5K8MA 2P51A 1KEKA 3QFPA 2M4MA 3J7A1 3FSYA 4P9SA 3KOOA 4NO7A 1HHTP 1RTJA 4PKHA 4ZVEA 3UCUP 2R8IA 3F56A 1RBTA 5C7PA 5DJBA 4MLHA 3TJ9A 1EETB 1S6OA 2AJQA 2B0GA 1E4GT 1RWOB 2QFIA 5IIMA 5H1SQ 3Q8PB 1WF2A 1IG8A 2OAUA 4RJVA 2BJ1A 2YHAA 2HS4A 3A1YG 3DXMA 3OS2A 1Z26A 1KTVA 4YR3A 2B9EA 2P9SB 3CQXA 5F9LA 5KFMA 3BGFA 3WNEA 4USTA 3W63A 4Y1DA 1NGDA 3L3VA 2GJFA 4JI1F 4DOCA 1NJIT 4WTYA 3MOJB 2G1HA 4FK2A 2MZSA 1SKRA 5D4NA 4K59A 3V1RA 3WK6A 3NWRA 1NBWA 3HFVA 1YRUA 1OH5A 2LFVA 2APOA 4YP3A 4NLBA 3DHXA 5HR7A 3TVZA 4WFBQ 1SJFA 4KTZA 2K3IA 1S1TB 1FJ7A 5D4LA 2IOCA 3HTVA 4NA1A 5KOXA 1MROA 2PMZC 3SCJE 3JQJA 4KH5A 4XH5A 4CEEA 5CCLA 4ICLB 4CJKA 2J7WA 3IS9A 3MDFA 4FWLA 4C4WA 3MUTP 2GTDA 1L3SA 3RJMB 4RNFA 4OZ1A 1VQYA 3SJHA 3CC4S 5DMRA 4ZHRA 3MMAA 3ENAA 5KFNA 3DRYA 2J0SD 2EDUA 4CEZA 2J6SA 4LSLA 2WTUA 3TU5A 2XRIA 3ENWA 3QIDA 5G5GA 2N4DA 1GMWA 2UU9F 2G8KA 1BU6O 2W4CA 3NH2A 2LYHA 4NA3A 4LF4J 3CC2N 3TA2A 5KQ8A 2EC0A 5IQQA 4BY9C 2VICA 4DR4J 3QUQA 4ZPTR 2AKWB 2ZHAA 2A6OA 3AA4A 2IVPA 3QSYB 1SL2A 3NVYA 3QUBA 1Z00A 2CJYB 3GJSB 1X5TA 4I7FB 3VWSA 1XK8A 2QW9A 3C15B 4OJLA 2W2NP 1P90A 1IBLK 2RIJA 1F21A 1FO1A 3CCLN 1L5UA 1NHKL 1VIXA 2L41A 2YKNA 2P9PA 5AJ3J 5HLFA 3LP1A 5J2PB 1RHJB 5ALGA 4DPYA 4ED6A 4CO5A 4C4SA 3UD3P 5IWAJ 4WJ3B 1SJQA 3M05A 4WFNL 1CI4A 5ALEA 5ADZA 1FRHA 2C3OA 3P83D 4YEAA 2YNIB 2MKIA 4DR1K 4J2DA 4C7ZA 5A0LA 2JLEA 4R66A 3FNNA 1P8GA 3UKRB 2EBEA 5BPNA 5GINA 4CLUA 1FVQA 1NSQA 3CERA 4BC4A 2WB1C 3TVYA 4DV0K 5D0RA 4L8RB 3M4XA 4BR2A 3EZOA 3S41A 2FYXA 1S1UB 4M9GA 1ZA1B 3KYLA 1T6DA 4BR9A 2Y0SD 3FSIA 4JI7F 5LJ3Y 1CG2A 3RF9A 3OHAA 1NWKA 5J2QA 5AIBA 4OZ5A 2FBXA 2HFSA 5DG7A 3JYTB 2JJ4D 2E44A 3A8KA 2F4VJ 5BRFA 3KK2B 2MUTB 3RBXA 2A18A 3G6VA 3NNCA 4FJIA 2C3PA 3ULEB 3EXYA 3NNAA 5C25A 1BIUA 2QIFA 3BYRA 3HHDA 5KPZA 5GAEP 1NBEB 4W5TA 2Z1HA 2HK2A 4HHJA 1UMJA 4ID5B 2UV8G 2V34A 4UBBA 3ED5A 2XMKA 4IOCL 2QL9B 4I6YA 1YJNN 1TKXA 1PJ6A 5ETQA 1L3UA 3EEQA 2V8HA 1R89A 4I6MA 4W5QA 4CHZA 3TTDA 2V2ZA 4NLCA 1IBMK 4WK1A 4FM0A 5HMXA 4X64K 1F0XA 4F4ZA 3HI9A 2E1AA 4JI6F 4DU7A 4IS7A 1X42A 3FM9A 1T9WA 2ASDA 4DV1J 7ICRA 4CNZA 2G13A 4UY85 3CHWA 4B8AB 2VPWB 2FPMA 1XBWA 1RT7B 4G3IA 2IJFA 3C2PA 4X62K 4OZ3A 1ZAVA 4DV6F 1U2RA 1A0OB 2MQLA 2JVOA 1Q5VA 2YNHB 4USVA 8ICZA 3O44A 4FWMA 1WSIA 1Z6RA 4I6AA 3BO2A 2L08A 2K8AA 2OLWA 1UOCA 4ISEA 1NCLA 2IDOA 5CA7A 8ICYA 1FRLA 1HNXK 3HFKA 4FVUA 2F63A 2X7IA 1UEKA 5IT9U 3HXMA 4BG8A 1NUEA 3H2UB 4NLSA 3DC2A 4PG8A 5AKKA 2YWWA 2HHWA 3GIMA 1WDTA 4G65A 3OYHA 1W2BM 2GNKA 2JV3A 2RF2A 4ZA1A 4RQNA 1N5YA 1PG5B 3R6LB 5CR0A 1ILYA 1C1CA 2UUBJ 4GKJJ 5J2HA 3E2EA 2IOFK 4ETZA 3NG8A 1WB9A 4Z4GA 5D49A 3AEVA 4KHSA 1U48A 3C7NB 3VENA 1FRKA 2BJ3A 2BDUA 4DQQA 5AE3A 4EZ6A 4DTOA 3T9NA 2HOFA 3G4SN 4PCQA 1B22A 4ZN1A 1NB2A 4IQXA 5EWGA 3LW5C 3GV7B 1VQ6S 4M5HA 4XDDA 4CD1A 4F5NA 4EYHB 5D3GA 2WOMB 3DLGB 2QXLA 1J9AA 2J8AA 4YHHF 2Z2MA 4CF4A 3U8XA 3TAFA 3ZSWA 4FVCA 1JLFB 3NS5A 3UMBA 4FM2A 1N36K 2FY8A 4F93B 4RQ2A 1D09B 2ZUGA 3M6UA 3LM2A 1LFWA 1S1VB 1T95A 1YJVA 2VKQA 4LMZA 5BR8J 3SQGB 3A0BU 3NCIA 5T41A 4P52A 2LSNA 4I2IA 3H42A 4K50A 4QR2A 1KQFB 3VF4A 1PSDA 9ICNA 3S6JA 3QDKA 4PA1A 1Y4ZB 4FWRA 3IR7B 3RVCA 4H5VA 1TKDA 1H98A 1KBUA 2FMSA 3U1LA 4WU2A 4U96A 2OM6A 8ICNA 5M2UA 2HMIA 5EOYA 4CHYA 1TK5A 1T11A 3AOAA 2QN6B 4OYBA 1AUDA 1XR7A 4Y2KA 1YXQA 1L8OA 3B4DA 2HNDB 1AT1B 5LSRA 1V3RA 1YJWS 2XQCA 2BANA 1TL3A 2VODA 3O5BA 5A2QO 2X3GA 4V19S 1FRMA 4Z7YA 4ILMA 2ZGYA 5K14A 2CNLB 2Z1JA 1SZPA 1VSEA 1RWKB 1ACMB 4RQ5A 3D68A 1UZHA 1R8CA 5J2AA 1BI4B 3SQ2A 1FKOB 3VPZA 3OR2A 3WQTA 2RPIA 1ZBSA 2PT0A 4P2XA 2VFSA 5L46A 4GLXA 3KK3A 3K5MA 5DK5A 3AOCA 1NSAA 3BQ0A 1PVRA 4BRAA 3LM9A 3PG9A 2WVCA 4OHZA 5D3GB 2XC9A 3TUZC 4WBFA 1IBKJ 2XS5A 1RM6C 4NWIA 4DLEA 4LJXA 2QYCA 2KT5A 1T3OA 1Q4RA 5E33A 1UA0A 5HMLA 3LGHA 3GFKB 2B7BB 5AM3A 2V7ZA 2F96A 4F67A 1KKHA 2GQQA 3TADA 3VEXA 3AY0A 1NJWA 1CSJA 1RBAA 1RT2A 3PLAA 3MDCA 1CJUB 1W7AA 5JXSA 1Y9OA 5ADXH 2D8CA 1KQGB 4BBYA 3A8YA 4C1NI 3PIOQ 4K7QA 3BBCA 3ETRA 1O08A 2E9TA 4JK1A 4IG0A 3GIRA 5T7LA 3HSGA 2ZH6A 4DTUA 3ZSOA 2HLTA 1CC7A 3GBTA 2MZJA 3V7JA 5J2EA 3D0GE 3CO0P 4KV8A 1JJ2M 1C4AA 4YY3J 4K43A 1T3NA 1FJGF 1VRUB 4BVOA 1X4GA 4JI0K 4PYAA 4WXWA 4IZ9A 1FFWB 4OX8A 5CE3A 4JN4A 3WQPA 5IM0A 3MEGA 2V94A 4IUFA 5KAIU 1SPBP 4O8KA 3THVA 2BZFA 5AQSA 4JI6K 5CP2A 1PC4A 4ATNA 2B8PA 2YNGA 3VQ7A 3KIOA 4DX5A 4FPAA 1URJA 3BSAA 4NI2B 4C3MA 2HFOA 4WP9A 4IYQA 2C2NA 1NG9A 1VQKN 2ZH7A 3T1HF 4FZXC 1QM9A 1VJWA 5BXIA 2IRXA 1SUQB 3M30A 3C1YA 2I1RA 3PR4A 2I9SA 1NM1A 4ICAA 1Q53A 3MCSA 2HGLA 2GJIA 3HT3A 4GKKJ 2XNRA 3OVNA 3DLJA 1XJWB 5F0UA 1VR6A 3V9UA 4CJRA 2P9UB 4AFFA 4FJMA 5JMNA 4ZOHC 4BE2A 4RZRA 4Y3CA 5AQTA 1GLEG 4DR2K 2VG5A 4O3RA 3UB5A 2DCLA 3B8AX 9ICCA 1HBUA 3GFHA 4I67A 2OTJS 2ZQBA 1HUOA 4AILC 4DB3A 2ZM6J 2IYGA 1NSPA 1TFWA 4NL5A 4CECA 1DOQA 1V38A 1Y88A 2RU9A 2PFFB 3NH1A 2QLTA 5GIPA 4GKJF 1N60A 2R7WA 4USHA 2BBEA 3GG1A 1BQXA 4RTFD 3TEGA 2XY6A 1HJPA 2CZ4A 2PBDA 4AHCA 3ENBA 1RACB 4PXEA 4ZLLA 2YVSA 4DR4F 4DCJB 4EX6A 2N4CA 3T1AA 1C0UB 2O01C 3ZI4A 4O4GB 1X9MA 3T5JA 3RJGA 4PL7A 4HEA9 5CYJA 3CJKA 1MA9B 2AX1A 2C3YA 2V9KA 1Q8BA 2BUNA 5AZJB 1IBLJ 1FD8A 3M32A 4W90B 4KX5A 4U7BA 3CJ4A 2OH2A 5LMUJ 4RQ6A 1Z2LA 3C2MA 4MAKA 1NZAA 3EX7B 1QE1B 4FYXB 3G8SA 1HR0J 2UXCK 3Q8UA 2HOEA 3SUPA 4WYLA 2HQGA 3OLAA 4Y2XA 3J7YU 2WVFA 5D8HB 3M8ZA 1L3VA 5JU5A 5CZVA 3IV6A 1IKYA 2O67A 5AKZA 1YSJA 2MY8A 4F3MA 3PJXA 3LGMA 3AD9C 1TYQA 4Q45A 2HS0A 6FDRA 2HF4A 2KJWA 2ZJRQ 2U2FA 2PMHA 1WBDA 1NDCA 2HVIA 3G6YA 3N97B 4OJRA 1VISA 1RT5A 3RFAA 3LF0A 3BSNA 1YTYA 4BWMA 2W9CA 3VEOA 4DR2J 4EWTA 4OYPA 2DGXA 1XN9A 3H0PA 2XO6A 3T5HA 2POKA 2RRNA 3JAMO 4IOAL 4NZ7A 1ATRA 3U4LA 3L2RA 3ZD9A 4WZMA 1Q78A 1FJGK 3UDVA 1XR5A 4K4SA 1H73A 1LEOA 3MAHA 3DAWA 2OJ3A 3JAMU 2Z1IA 1X4CA 2QLXA 3THXA 3MUVP 4A8EA 4C0OC 4GKKK 2QKQA 5GAEI 4J2EA 4F4YA 4NCGB 4NEYA 1M5PC 4JV5F 3HVAA 2ZH8A 3AVCA 2CQ1A 2D3OR 1RT6B 4Z4HA 3VF0B 5CXTA 1MW7A 2A2CA 4CO3A 4LF5K 1SV0C 2DNQA 1TU0B 1ZETA 4Z7CA 4U67Q 1V3SA 2XI2A 2Q6CA 2RRDA 4LQ9A 1CLQA 2KG0A 5MLCV 1SXLA 5AHXA 2VBYA 1HNZJ 5DS7A 5ALVA 5DGAA 1X2IA 3A4TA 1MQ2A 4FXWA 3D2EA 3TAPA 1RTDB 2IA6A 1EAYC 2VOOA 4O3SA 3KMSA 1KD1T 2Q0RA 4I9QA 2ZJRL 3IHQB 4UARA 4CIGA 4R0EA 2FF6A 3VEVA 3V7KA 5KT5A 1U1LA 2G4BA 4OX9J 3HHLD 4B3RF 3T9ZA 4M6WA 2RKIB 2UV8A 1UEUA 3HD1A 9ICQA 2LXFA 4DG1B 2E5LF 3CFOA 4JKCA 2H3VA 3PIPQ 2HWTA 4JI8J 4FZZA 3GG0A 1KTQA 5SUHA 2E2QA 2DNMA 4JWMA 1JKHA 1RDWX 2Y8WA 3BZQA 3CD5A 3AV9A 4UQGA 1KVAA 1VK8A 3QFHA 4G9ZA 1H72C 1SQGA 1COKA 1VOMA 2G8WA 1XR6A 4PWDA 2PY5A 4OGCA 1KRPA 5CZXA 1QY7A 3EE9A 2LQJA 3PRBA 3VQ4A 1JLCA 3RR8A 1R0AB 8ICSA 3F44A 2I7PA 3UMCA 3JXOA 1JWWA 3BY5A 3WIVA 5ALNA 4A4JA 1HBOA 2R7XA 4LF8J 3G71N 1WHYA 1HIWA 4CIOA 1RHRB 2VQEF 2UXDF 3A0IX 3MMCB 5F41A 1HPZA 4A47A 3UKUA 1LNQA 2X3DA 3C65A 1BL3A 1UPMB 3A3NB 2F40A 9ICBA 1DTQB 3FVYA 3D2FB 4O0JA 4FF4A 1IBKK 2BACA 2O8DB 1CPZA 3JTNA 4HT7A 4PZVA 3IS9B 3RB3A 4LF8K 1XMQJ 1RWMB 5KT7A 2J8SA 4BC9A 4Z4EA 4IL6U 1BA1A 2QM1A 5E0OA 1T6CA 1C1BA 5E2QA 4CIEA 3EGNA 5AK6A 4F50A 2FJXA 2IRUA 3WKAA 5HATA 1VYAA 2Z8QA 1C0GA 3AVBA 2KN7A 2HQCA 2XNQA 3NMAA 5F8JA 2E9ZA 2O4GA 2KKVA 4RBTA 4NLUA 4TU7A 4N76A 3C3LA 1HI8A 4ZCMA 4CK1A 5ETLA 1S3XA 4Q43A 3I96A 3JS6A 4NEZA 4M8LA 2XSJA 3TRGA 2HRUA 1BO5O 2H5IB 3J80U 4I2FA 4UZBA 2AZ1A 1REVB 4LIWA 4QZ8A 2XI3A 2V68A 1QQNA 4QS7A 1IJFB 2ZH2A 1UFLA 3TR8A 1WDDA 1A5VA 1F9EB 5KPRA 3CTRA 2W2QP 1DK2A 2IBKA 4DBQA 1HNXF 2ASJA 2CWKA 1VQ9S 1T4GA 1PIEA 4PG5A 3DYAA 4JKBA 5ALZA 5KFJA 3OR1A 4DCPB 4PPDA 1TVAA 5DB7A 2A3JA 2KKPA 4ZHRB 4KT0C 4J9MA 3OL9A 1CJVA 1ZM9A 1WTFA 2GQCA 3F5AA 5KTQA 3OD2A 2ROEA 4O8UA 5F8HA 4F7VA 1LWFA 3SEIA 3L5KA 4ED5A 1BDGA 2K2PA 3VEYA 4F25A 1S10A 4I64A 3L7OA 4UATA 3CCWA 4DV2F 3LPEA 3DLRA 1Q7YO 2W9MA 2WMMA 5ALKA 2FDNA 2OTLS 4QW9A 4KPCA 1IG9A 4Q2MA 3WXIA 1FWPA 4IC9A 2H65B 5JVGL 1KOOA 5JLHA 5RUBA 1U0HB 2YB4A 5ALSA 4EX7A 3RSEB 1F2GA 3VA0A 3C6HA 2VDHA 4DL3A 3VV2B 5KL8B 4RNMA 3TJAA 4DQRA 2LEAA 3CIMA 3AVIA 2MTLA 2P9IA 3K9KA 1E4FT 2CA9A 1F3VA 1TR0A 2V63A 1NAQA 3DLKA 5B7WA 2RN2A 3NGYA 3N6NA 2DGQA 3AA5X 4EEYA 3WXJA 4J9RA 5DQIA 2ZOFA 2P66A 4DMZA 4YOUA 1GTHA 1BPBA 2L9DA 2ASLA 2E5IA 3I56N 4KB7A 5FIIA 1DGSA 4DR1J 3QT5A 4J90A 2NPIA 1VCTA 3L3CA 2F8MA 4Y00A 3HHLB 4DL0C 4RWTA 1GX5A 4DR6F 3KTQA 4LFAJ 1RGVA 1HPMA 2W42A 3MMBA 4KLTA 2P9IB 2YNIA 4LF7F 2UVVA 4O5CA 3QNWB 2DNHA 2LQ5A 4B9TA 4JD2B 4K41A 3KD1E 2YXLA 1Y3KA 1PUZA 5F0XA 4ECQA 2QZ8A 4F92B 1PJ7A 2XSJB 4UB4A 1AFIA 3QMQA 5C2GA 3OL7A 2F4FA 3EGWB 1K8KA 3ICXA 1CULB 4B9MA 2LU2A 3OQ2A 3SMPA 2IHNA 3I5AA 4IQTA 4CD3A 5A0YB 2YWFA 1FCAA 1IKYB 2QLFB 3HX0A 2B9YA 2RJZA 4OI0A 4X4UA 2JRSA 4CBWA 4NXNK 5AQHA 4PKGA 3T7ZA 1RWPB 4XTTA 4FM1A 3FCVA 2D3UA 1S6QB 4NASA 3D7EO 2K1RA 4JI5K 4KAZA 1IBLF 5IWAF 4RW8A 1YITN 5H1SV 5EVZA 3BEXA 4KLGA 1KFSA 4R65A 1UL3A 2WW4A 4OGEA 3GU3A 4KO0A 2F9JA 2P9NA 1FRXA 2E1FA 4GVBA 1RBRA 5B09A 4LY7A 2DNNA 2AV5A 4EIAA 4JI3K 3P4UB 4LSLB 2P9GA 1JJCB 4LF8F 2FBVA 3AARA 2NV3A 2QL5B 4O0IA 1JK9B 1JLAB 3TFRA 1WCLA 2E5GA 4NLNA 4C80A 1XC3A 4F0KA 1W25A 2M0NA 5ALYA 4ECRA 2K1RB 3GILA 2XM3A 1CQMA 4KHYA 2B51A 3ZSYA 1V97A 2ZWPA 3ITHB 3RR7A 4OYMA 4ZS6A 1VRTA 1RE1B 1WSGA 3HD2A 3RB4A 5J2PA 2KXNB 4Y2CA 3M6XA 4H4KC 3R6MA 5AQUA 2FJWA 4Z37A 2QK9A 5ETRA 3FQKA 1WD6A 3TEHB 4M1KA 4MH8A 2C42A 3GCXP 2EC2A 4J91A 3AVJA 3RMAA 4J9PA 3SUOA 2C2ZB 1WBBA 2ZD1A 1LKZA 2OPQB 5BR9A 2V2KA 3SAGA 3CPEA 2ZOGA 3EM1A 3V1OA 1TMJA 1JXLA 1ATNA 3IBCB 4QR1A 1NHUA 5HP1B 2BA9A 1C20A 1S0MA 3LANA 3OTCA 5K8OA 2XMWA 4ZVRB 2WSCC 4YVZA 4QBUA 4IG0B 3NL0A 4GMKA 1J6ZA 1RT6A 2FPKA 4A61A 4U9RA 4DU3A 1S72N 2HMIB 1IWGA 2WB4A 3NBPB 2ZM6K 4F5PA 3M2VA 3N9UC 2Y9UA 2KFYA 1GMUA 3WC2A 3MUMP 2E7VA 8ICJA 5AFUA 4KX3A 4LSZB 3IAS9 1HWKA 4HYKA 4DUYK 3FGUA 1TK8A 1WTBA 3TTCA 5ALQA 4U6PA 1WG8A 4WP8A 5ALIA 3V81A 5ALRA 5FROA 4P71A 4FOIA 1ZM2A 1R27B 2PYLA 3NS7B 4JI4K 1F5AA 1QAYA 2DKOB 2DFLA 4YOVA 2DXFA 1LWCA 1AXQA 1SB6A 1M1HA 3V1QA 5CD4A 1UQVA 4DCCA 2LQ8A 4E19A 3QETA 2PSZA 5KG5A 1VSMA 5HMZA 1I94K 4KSEB 2DKXA 3KFUF 2QGFB 1ROFA 7ICSA 4JV1A 4CGDA 1H7XA 4LJMA 8ICQA 2ISOA 1KQSM 2F8TA 1KBRA 2GMJA 3GE9A 4UQTA 4F4AA 2GEMA 2MKCA 3QYPA 4FYVB 3WKCA 1SAZA 1OQ6A 3MEEB 1ZQCA 5ELZA 3SCXA 2ZC4A 3W5XA 1C6VA 4WU3A 2MKJA 1MMDA 2CH5A 2HSZA 2V0NA 1VBYA 1S72S 2A6AA 3W2WB 3OYBA 5AI8A 1NOYA 4NZ6A 3K5NA 2BOAA 4M41A 2G8FA 1XHZA 3GE1A 2DNRA 2BABA 3BN7A 3E9OA 3IGVA 3VQCA 2GAGC 2Q3PA 4O23A 1S6PA 3H20A 2KZ3A 5ALPA 2BKNA 1RDBA 3D0HE 4YDUC 5DZ7A 1B4FA 1LWEA 1WC0A 5F8GA 5MLCQ 4BWJA 5I42B 5J2QB 4M0AA 4F4WA 5F8NA 3HRGA 4F5RA 2G0CA 2BUPA 3HP6A 1X5OA 7ICIA 2XLJA 3CE8A 4B3TJ 3Q8SB 3UN5A 3QB0A 3OL6A 5ETTA 4DUZJ 4USWA 3LUYA 4DU4A 1BGXT 1X0FA 4LVNP 2W9AA 1N5XA 2GUPA 1F9HA 1WC5A 3DN9A 1I94F 2AEJA 2AP6A 2QWLA 4R63A 4OYWA 3PCOB 4GVEA 3Q0AA 1IO2A 1YF5L 4C3KA 4KI4A 4QIVA 2QA2A 2KV2A 1QHTA 2E8MA 3FUYA 3GMGA 3P5TL 4JI7J 2PEHA 3OFEA 4CZHA 3EGVA 2MJNA 4ECWA 1YZ7A 3N7RC 1FD2A 2BR0A 2PFDA 4OX9K 3C7NA 4GXIA 1AZSB 4CZMA 2K89A 2JEJA 1K1SA 1FI4A 4Y2VA 4K4ZA 2WW8A 2ERRA 4URQU 3G8QA 4DS4A 1HNVA 3PR5B 4A8XA 2ATQA 2M0GB 4UZCA 3NF8A 2VZ9A 2W7PA 1RLCL 4Q44A 3BDPA 4K8XA 2XI9A 4X4SA 3D4JA 4Z6EA 2ZM6F 1RCHA 4BRPA 4GKKF 2UUAJ 5L9XA 1UKUA 2ZE2B 2Q79A 5AQVA 4X4PA 3MDAA 1ZD4A 2ETJA 1HNVB 1VQ6N 1GXTA 2EFPA 4Q5VA 3AMZA 1F1BB 3ILIA 3PYEA 4PWDB 1ITPA 5KRSA 2DUYA 3NASA 2NUUG 2WBMA 4NRTA 3HVWA 1JROA 1N4LA 4C8ZA 4PABA 5CYQB 5JVHL 3E9PA 5L1LA 3VA3A 4A5BA 3H5UA 2OTLN 3AGKA 4UTGA 1SWVA 3MFIA 4BR5A 4YR0A 3ZSRA 1UAWA 3HLUA 4Y2RA 1S6UA 5AKGA 1XQIA 5IIIA 1U6FA 2HVEA 3BSOA 2HSTA 3GP9A 3PSTA 1ZQLA 3HVRA 4LVSA 2I0XA 4K4WA 5J0XA 3PZPA 2BQUA 3GG4A 1RA6A 2CPRA 1T9VA 4USUA 1VHXA 1XO0A 2J0WA 2NYVA 1F6TA 1PK1B 1HNXJ 4OLAA 5JLFA 3FQLA 1WNEA 2VG6A 5HVGA 4ED2A 4DV3F 1JL2A 2RQ4A 4KJIA 4Y6IA 2J6UA 4DXLA 2ZIWA 1WG1A 4AXIA 1RILA 5EE9A 1HHQA 2V4JB 2M9NA 2V8DA 4HCBA 2JRZA 1ASVA 3DLKB 4AYBD 3OV7A 4M47A 4CZCA 3FFIA 3DXSX 3QJJA 3ZT2A 3LZJA 4RNOA 1J5EF 4I29A 4YHHK 3K5OA 4J2BA 2KZMA 3DDKA 2YWKA 2VJ4A 4CDGA 3DWLA 3LP2B 3K59A 4E89A 4AQYJ 4P2SA 1ZQIA 5BPMA 4NXMK 3EUNA 3AY9A 4HCCA 2HHHK 4B9SA 2V67A 1RT1B 3VTIA 1OUQA 4C8NA 2UUTA 1NOZA 3I32A 5LOQA 5C10A 2O8DA 1ZBTA 3F2CA 2NQPA 5HRPA 3LAMA 1NRKA 5M1OA 3QBCA 1NOMA 2QJ3A 4EAHD 7ICHA 3JSBA 1M90T 2OFHX 3OR1B 1N6QB 1T3VA 2MKYA 1NGJA 1FDBA 1P27B 1NHVA 2JNJA 3FAHA 5L1IA 2DH8A 1IQTA 3VC8A 2R8GA 2JWKA 3ZZ0A 1RKJA 1XSPA 4GY2B 3D6TB 4CGIA 4RW7B 3KWGA 1CXUA 2FHOB 1JX4A 3NHGA 9ICEA 2P9CA 1LWXA 1DTTB 4KR0B 3SAHA 3C14A 5EE0A 4LREA 2OFGX 5BYSA 3LOUA 4JI2K 1WSVA 2O8FA 2HNZB 2LYBA 2Y1LB 4MF2A 3MN7A 4XQ8A 3ZDAA 3G2XA 4NLRA 2QA1A 5AFUH 4KAIA 1DTQA 3D2FA 3PNCA 4P73A 3QRRA 4L75A 4ISGA 1IIPA 2FSKA 3OYNA 2H3ZA 3VAHA 4DHYA 3HOSA 5BN9A 1YLXA 3K7RA 1RT4A 1Q3VA 3BH7B 1ZQMA 3I28A 1UEVA 1HQUA 3DMJA 1IWAA 4PQAA 3UXPA 2P9KB 2DIVA 4LBHA 3C23A 2E9RX 3ZEUA 1RWWB 3MXIA 3B8HA 4B1UB 5K9FA 2PAVA 2OCEA 2B4OA 3MR2A 3VQ5A 3AQEA 5IILA 3J7AN 4C48A 4X64J 4EP5A 1EJ7L 2OEMA 2QRRA 3A8JA 2G0AA 1ZPVA 5AJ3K 2KD1A 1NZ8A 1IBMJ 5C42A 1UVIA 3V5RA 4TY8B 3EPGA 4K5SA 1BE4A 2HFNA 3OBIA 2VGNA 1K0TA 3IWXA 1YZ6A 2P9NB 2QEXS 1T9XA 3O3GA 2OPSA 3QFUA 4Y2QA 2OWOA 3PJWA 2LDYA 1FTRA 3VGLA 3CDUA 4J8FA 3HSZA 3QEBZ 3LALA 3KLIA 2KM8B 4BDPA 3FMWA 1JNZB 1ZQSA 3NS6A 2ZXIA 3DLBA 2G2ZA 1A7GE 3OLBA 3BDEA 2P8IA 5AQJA 3MPYA 2OZMA 2BX6A 2W8KA 5AT1B 4YHHJ 1MDUB 4IDKA 3ZTQA 3N28A 1IN0A 1WC6A 2MXYA 2HBZB 1FW6A 1YJ7A 4FPIA 2ZNYA 4AT1B 4DDFA 1KVBA 4DQIA 2BE9B 4QYZK 1QH9A 3WX4A 3NVWA 2GGPB 4CHPA 1HYSA 3A3OB 2HVZA 4KLJA 1FERA 4NYFA 1NEEA 2KHCA 3BGOP 4CYUB 2HIQA 3GLJA 2A2DA 1N48A 3KKAC 2KXFA 4ICLA 4ECYA 2H54B 4B9UA 3SQGA 2IVMA 3P31A 2OYQA 3TTFA 3NOCA 2QYGA 1HWJA 3VGUA 2IIRA 2RQCA 3QWPA 3VQBA 2XZDB 3K9JA 2QSFA 1HQEB 3BF3A 2E5HA 4J2AA 2QL7B 4IQMA 1TFRA 4C8LA 2LPEA 4TUSA 4PHTX 3QEAZ 1K9MT 1RXOB 4FZVA 3VEZA 4U67L 1XNQF 8ICFA 3QLHA 3V4MA 1N33J 3MXMA 1CULA 2EHGA 3THYA 3K89A 2H1YA 2ZIVA 1SS6A 1X1PA 2YMQA 2HHXA 1B7YB 4Y0FA 1TL1A 3I4HX 3OT9A 4DMNA 4IH7A 1O5JA 4DX8H 5F8LA 3P1GA 3IAM9 4DI6A 3N4WA 1RWXB 4AYBF 3W5ZA 4NY8A 5L38A 1RAGB 4PG4A 5BR8K 3OYGA 4P2HA 3WDOA 3O6WA 3V6DA 4IQUA 1WKJA 3AUOA 4FJ9A 4OHXA 3B6OA 5AI0A 3WKEA 5GMKa 2YWGA 1YJWN 4DV1F 4ER8A 3E58A 1OQ3A 3NAHA 2F4VF 2RAQA 1RJJA 1XNRF 5C2FA 2GOLA 2MB0B 2HWHA 4KGKA 3PW0A 5LM7E 1N61A 4V1Ak 4QIEA 3LP0B 4N47A 5B08A 2RE2A 2KG5A 1QQ6A 2YKPA 3UQ0A 1T9TA 3OYDA 3DOLB 1AW0A 8ICTA 3PYGA 1UWBB 3SNNA 3EWGA 3MXHP 1B4SA 4CEQA 1RXVA 4C9DA 3QU9A 4BREA 2QWPA 5AQKA 2G1DA 2DISA 2GWSA 1H2TZ 5E3PA 1FEEA 5AQRA 2ZE2A 3POTA 3KHYA 4CZEA 4HR2A 3GONA 2W9BA 2E5LK 2WUSA 1WKLA 5AM5A 4CJFA 2KOBA 1N5SA 4F5OA 3Q22A 4JKHA 2GQ2A 1S1UA 1SZ2A 4YMOA 2KT3A 2FVQA 3M2RA 3CCMS 1BQMA 2DNOA 1WUUA 2H3FA 1RA7A 4YB5A 4DS5A 4MHVA 2E2OA 2IMWP 4RQ1A 2ZZNA 1QZ6A 1RGIA 4Z6DA 3EY1A 5FDLA 1VQON 4ZCIA 3CJBA 1FKPA 1GT8A 3MM5A 2VGMA 4DSFA 4MIBA 4IFEA 4BC2A 2CXYA 1GOBA 2ATCB 3CDWA 1HJRA 4X4TA 5AK4A 3H8WA 2ZDPA 3QATA 2KG1A 1YRXA 1FHTA 4X62F 2YH0A 3GIIA 5J2GA 3FZHA 1OVQA 4ED4A 8ICGA 4HI2A 2ZTEA 1IKWA 3MTJA 3OXFA 3EVOA 1DARA 3L8BA 1BPEA 5LT5A 1FE4A 3TAEA 2ZDOA 1XUPO 2BRKA 4C3LA 3WEEA 4MK9A 2VG7B 4CJ5A 1OJ4A 5EE3A 3AVMA 3HDSA 1JMTA 4CT9A 2KXHA 3THWA 2R7VA 2EWSA 1NH8A 2G8HA 2HMPA 4OLPA 4A8KA 4I2PA 3O2IA 3OTEA 3DU5A 1HKCA 2R7YA 1DY3A 1RXWA 3DV9A 4NM2A 1A77A 2Y8YA 5AQPA 3H90A 3O9RA 2FVPA 4FZNA 2K4IA 3KJQB 3HJEA 2QMWA 3MWBA 3BQ7A 4M63A 3DOLA 1EZZB 5ADXA 2A1RA 3CJRA 1N5VA 2AJFE 3GJTB 3L2VA 2MQ8A 5L1JA 3W7BA 2YV0X 2J6TA 4JHDB 4NE9C 3OVAA 1RDCA 2Z57B 3TWHA 1JMSA 1U49A 2MPUA 3GQCA 2UXCF 3LZIA 2GV1A 3KBBA 2ZHOA 2K4EA 5KFVA 4ZJLA 5K8NA 4ZVPB 2YMMA 3C46A 2IA0A 5C0YA 4HKQA 1HW9A 2CFXA 2B0CA 2CJBA 4GVLA 4IR9A 4EHTA 3M9MB 4IJNA 1QVGM 3LTOA 5IOLA 3UWTA 4CF2A 1AROP 1V5IB 1FESA 3P45B 1VQ5N 4YDXA 5J0SA 5KAKA 2VYPA 2NRZA 4OI4A 3ID6A 2XMUA 1HI1A 1FF2A 2I1QA 4BRQA 4M5KA 3HHKA 4UT4A 2ZD1B 4EFAC 3K4GA 5IWAK 1K73O 2HHVA 3D2EB 2XIDA 4CJVA 4JI1K 3MR6A 1RCXB 2F76X 2EEYA 1BXNA 3QRQA 2Y9TA 9ICLA 2ZJ8A 1RAJA 2VA3A 4UUXA 1RT3A 4MK8A 2I6WA 4ZVOB 3OGUA 2HYIB 3AO3A 4KGZB 3OXGA 2Q97A 5LSOA 3MMJA 2AD9A 2HS3A 2MLYA 4HHUA 4M42A 4LR8A 2B9XA 4OYIA 4LFCF 2CXEA 3MECA 3TZWA 1BWFO 1LFPA 3DMJB 3MM6A 3PDNA 2Q4TA 3CVKA 3HBTA 1ZTTA 2PIIA 3DRRB 2JGUA 4HH1A 2ZJPQ 2P6TA 3IM8A 5BJRA 1X4DA 3CJAA 2YH1A 3D66A 3U9ZA 4DQ8A 4CIFA 2HBJA 1VSIA 3ILJA 3VAJA 4P2MA 4WFYA 2JXJA 2EKNA 2Z0GA 4V19X 3SQOP 1YJ9N 3A8EA 2CH6A 4XPEA 2EFGA 1Y7PA 3T41A 4O0NA 3DI6B 1DK3A 2FXUA 4QS9A 4RUAA 2F8LA 2BE2B 3KLIB 5AI9A 5D46A 1M5OC 1ZQPA 1T03A 3AJDA 1WSJA 3DGPB 1VRTB 4JEPA 4YMMA 4OJGA 4BDYA 4OPHA 1K5OA 3KHLA 1P7DA 2GW8A 3SEOA 3CCLS 3C5GA 1UVKA 1L3KA 3H5YA 1RDAA 2CPZA 3D0IE 2B4JA 4QIWD 4ISFA 3H4DA 5E41A 5CD4H 4UF4A 2RE1A 1NB7A 3P8BB 4RNNA 1NNEA 4BRCA 1EKRA 5I3UA 4PHPA 3ETOA 2FBTA 3UNYA 5KFCA 1SXDA 5BR8F 4LQ3A 3D45A 3IWLA 4JI2J 4B9QA 3F2DA 1Z19A 2XCPA 1SV0A 4OJ1A 1SQKA 2K06A 2ZIXA 3MM7A 4OD0A 4LF6J 3Q8QB 2YI1A 1B64A 2GCFA 4J9QA 1VDHA 1S6QA 2JOQA 3BKUA 1NDKA 1GTEA 4PKDB 1HMVA 1ZAWA 2R3VA 1FTCA 2OXOA 3RMBA 1SIJA 2OO4A 4YNQA 3WK5A 3FFIB 4I4BA 3BN4A 2W2MP 2MYFA 2B4VA 4B6JA 4I7FA 1FRIA 7ICPA 4WQ4C 1UZDA 4UY8T 3MD3A 1S6PB 2KEYA 3RAMA 2P1JA 1FJEB 5EY4A 1U0SA 2I5HA 5KFSA 1RUSA 4HHTA 2NLWA 1U2VA 4PWUA 1ZQBA 2D6FC 5G0RB 2OGUA 1OSDA 1XC9A 4QNLA 2XS7A 1DHMA 4QW8A 3MGVA 4K4IA 1FEZA 5EGYA 2DY1A 4M95A 3OPXA 3TSQA 2Z56B 4Q0BB 4KGVB 3QU7A 2RILA 5J2FA 4G1QA 4QPXA 2ZKTA 2YN4A 4K42A 4ES2A 2IRYA 2BCSA 4FOEA 3AL0B 3TUPA 2BEFA 4H4OB 3OFFA 3VAFA 2FIUA 4BR0A 4M94A 3I76A 3HPOA 3HSDA 4WFNQ 4B3SK 3RRHA 2R7QA 1S1TA 1EHWA 3VR1A 1LKYB 1RU1A 2D3ZA 3CIPA 4I2BA 4RL1A 4LF7J 4CJQA 4TURA 3M8PA 5LMNF 3JPQA 1TQLA 3TA1A 4JD2A 2ZH1A 1L8LA 3SCLE 4J9UE 4OJHA 1KEJA 3CCRS 4MMOA 4BJQA 1IG6A 5LL6d 1H6KX 2ZG6A 1OY6A 3KK2A 5EHHA 1HKAA 2P9LB 2NZCA 4NI2A 3FC9A 1AB8A 1WAJA 4I9LA 4KITB 3MX2A 3HK2A 3ILLA 3ZZYA 4UB5A 3H8YA 3HO1A 1ZQVA 2XYPB 3L7PA 4B3MF 1NO8A 3HSCA 3OYFA 5C15A 3DOMA 1FK9A 4ECVA 3TVKA 1HKGA 2E1MC 4RW6B 4X65F 1KVKA 4ZP6A 4A57A 2MHNA 3PX0A 3RW7A 5EUHA 3AXMA 3MM8B 3QIPA 4PPZA 1DBDA 2DGVA 1S77D 4CT8A 3CCJS 1Q7LB 1N34K 4DWIA 2GX9A 2GHWA 4YOTA 1M1KT 1N5QA 1ZQGA 4WE1A 1FVSA 3SQ1A 2PFNA 3AJ1A 4LRFA 4I68A 3O9QA 4JI1J 5G5HA 3J81j 2BXJA 2F1JA 3PNIA 3VQ9A 3NGRA 1UCNA 4WFAL 4LFAK 5HANA 1RWUA 1N88A 8ICWA 1X4EA 4C4TA 3QEIA 5CYQA 2GVZB 1YIJN 1RAHB 3PX6A 1AQ6A 5IT4A 3SV4A 3EZ5A 3TJ8A 3ATVA 1QQ5A 3M5RA 1TV6A 1WORA 4FPRA 4CF5A 1JJ4A 1V3ZA 3E51A 3CUNA 2FZCB 3R5DA 4JYAF 1WWHA 1ZBHA 4EHUA 4HAIA 4RUHA 4K0KJ 2XGPA 1KR4A 4N8NA 3WX8A 4WPAA 5GADU 9ICXA 2HSEB 5KRTA 1NXIA 8ICCA 3DNCA 1KL9A 1X4AA 3VETA 5DBBA 1ZQEA 1LQ9A 5AI4A 3M8PB 2PEBA 1HI0P 1HQUB 4RQ4A 4CWBA 4C7YA 3CYMA 5BOLA 1Y0HA 2JC0A 3MMVA 2QSWA 4PH5A 1CEZA 4FWOA 1RKIA 1SJ1A 4RWWA 1VQ4S 3VGSA 2FJDB 3DLLL 1IQZA 5J0TA 4Y2IA 4QWEA 2O8EB 1ZQUA 3Q83A 4CJSA 2LBOA 1S0NA 1MU2A 4RQ7A 4YY3K 1ZQDA 2N1RA 2QX0A 3QT8A 5AXMA 2VONA 3ZZTA 2VWKA 3QYYA 4Z6CA 4ZLJA 2VC0A 2VL1A 1RQNA 3HL8A 4DTJA 2AJ4A 2K7KA 5JMVA 4XEIA 1WN7A 4CO2A 1WI6A 1RTHA 1WG5A 1EX4A 4CF0A 3AVHA 2ZBCA 2DBBA 5AJ3F 1FFGB 3WEEB 2DR7A 3NLCA 3HMJG 1BWEA 1V4TA 2LHTA 3C0BA 2JZBA 3M1YA 3CB4A 3BR8A 2ZIXB 5LJWA 1QTMA 5F1XA 4DO9A 3T79A 4Y2SA 3GDXA 4LSNA 3VMFB 3NP5A 2HURA 3IAYA 1IBMF 1HBUB 5AKIA 2YMLA 2VQEJ 1QAXA 2UXDJ 2KB2A 3H45C 4NX9A 5LMNK 4Y2JA 3RBDA 5DM6Q 1N5TA 2ABYA 3P5BP 4PQUB 3KLHB 4GC7A 3D6JA 2KICA 1MWZA 5EOZA 1X9XA 2J9DA 3H40A 2OYYA 5EN1A 3AO4A 5DB6A 1VSFA 3PSPA 2OD6A 4OLOA 4CGFA 5E3QA 2FLPA 4ZPVR 2AT1B 3RG6A 3S3NA 1JNRB 4CZLA 1HNWK 3PFOA 4OMFG 3CD0A 3NCQA 4FWSA 1ESVA 2PA3A 1QAJA 2UVUA 2Q1NA 4ED1A 3CPWR 2HRYA 4I0WA 1JLGA 1K9MO 1B0TA 2YKOA 2M5YA 3QGPA 5M2RA 2BW7A 3QSIA 3THYB 3LWMA 5D6GA 3AB4B 2NYIA 1OH8A 3HKWA 1YI2N 3M6ZA 3BS9A 2DRDA 4OZJA 4KHQA 2FVCA 2Z4PA 4FNIA 4RLEA 1H0HB 4WQ5A 2EZYA 3UR0A 4Y2UA 2MQPA 3KKSA 4TSXA 4DCOB 1I3OB 1TELA 1OYEA 4H0TB 3PHTA 3AM9A 4PGQA 1NGGA 4KV8B 1JIHA 4NLKA 1DFDA 4NLOA 4M3XA 3AVNA 4N56A 2XWXA 3ZZPA 3HZEA 1S79A 5FRNA 4WCEQ 3SUNA 2B7CB 4DJBA 4QWBA 1D5AA 1BHNA 4JKFA 1T8EA 3QIPB 3HSTB 1DAXA 4NZ0A 4U8VA 1ULRA 2V8GA 3PW2A 1SIWB 3TZZA 3KMQA 2P35A 2MQOA 4DR6J 4XAKA 2PFOA 1I39A 1HR0K 4FK0A 2F3NA 1FNOA 4L76A 2PYJA 4FCYA 3KNAA 2I5JA 2A3ZA 1UVLA 1A5WA 2IS3A 4AUKA 2BYCA 4AH9A 2H48B 4CTAB 1JLQB 2UUCK 2IDEA 3SUQA 2RUSA 2P9LA 1N8RO 1FXLA 4XA5A 4DFPA 1UW4A 1WELA 4FYYB 4FBTA 3CD6N 1RB0A 7ICVA 3FZBA 2KIVA 1RT3B 1FXXA 4IO8A 3TARA 3EMTA 3ZX2A 1R7IA 3ZLJA 3DXBA 2CPXA 2LA6A 5AR0A 4FLYA 3WBZA 2QG9B 4BRKA 6FD1A 1TL7B 3DRXA 3WXMB 3OYIA 3SLCA 3LDOA 2DD8S 1E6VB 3T1HK 4C7QA 2H4WB 2BCQA 3EDRB 1LXJA 4MIAA 2NUBA 2DHHA 4I2AA 2QE5A 2R8JA 9ICKA 1PBUA 1ZQNA 2J7KA 4PWWA 3V7LA 3LWLA 2DPIA 5F9NA 4M5LA 3BUZB 2YX6A 3N4PA 2IVNA 1NLKL 3D3BJ 3C66A 2KSOA 5AM2A 3Q8MA 1PC5A 4EO6A 3LA0A 1S12A 1V9PA 2BMBA 2WVDA 4BE1A 4WFZA 3KG1A 3TFSA 5KFGA 1XERA 2VH7A 3GR1A 3VCBA 1C1AA 4NJ8A 2ASYA 2DXDA 3J81Y 2XYGB 2HHPA 1URRA 1PAUB 3DJCA 1B70B 4CJ7A 4M5JA 2OA8A 5CEHA 3U1NA 2R8HA 4H4MB 4CM2A 4DR4K 3WXKA 4X62J 1BA0A 2RSQA 2XMMA 4RT3A 1J27A 4ZMMA 3VERA 4M5MA 2GZOA 2RVJA 3O3FA 3FMBA 1W9HA 3UD5A 4FLZA 4KLDA 4DEZA 4TLRA 2W9BB 3FZMA 1R0AA 1ZAXA 4F26A 2MMYA 2PO4A 2RHKA 2WF7A 3UXOA 4TU8A 4MKVA 2QKBA 1U2CA 5D0GA 3SQ4A 4X4OA 1JRPA 2GVDB 1KLMA 4KH0B 4A8WA 3ZDCA 1M1KO 2EFQA 1BVSA 4FF3A 3BP8A 4LF5F 3AU6A 4KHMA 3FZ2A 1YDLA 4C23A 4FBUA 4FW1A 2BHN<