1U47A

Cytosine-8-oxoguanine base pair at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u47A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u47A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u47A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u47A01
1JN3A 4M45A 3G6VA 1MU2A 4E7IA 3DLBA 1LB2B 3OYCA 1NOZA 1Z00A 3HXMA 3EZ5A 3JPQA 3VQPA 3MXIA 3NFAA 3TFRA 5FRMA 1RYRA 3JSMA 7ICTA 4GC7A 1U47A 1KCFA 3MABA 3NBPA 3OVNA 4FCYA 2XCPA 4FM1A 3V6KA 4FZZA 1C0MA 3PNCA 3HT3A 2VG7A 4OGEA 4GXIA 4Z0UA 4DTUA 3ORYA 1U45A 2XY7A 1RTDA 1GOCA 3PW0A 1EX4A 4W5TA 3LP2A 2PFNA 3ZT0A 3GFKB 4I2EA 1C0TA 1ZQGA 3QETA 2RKIA 5KG0A 3NF6A 3M8QA 1IG9A 3NH2A 3K5NA 5DGBA 1BI4A 4I2GA 3DLGA 3PUFA 3TQ1A 3IG1A 1V9PA 3MR2A 3UQ0A 4CJWA 3VQCA 3G6XA 4M42A 4JV1A 3AA2A 3SQ4A 2I9GA 3NGIA 1ZQJA 2DTUA 4QW9A 4FLZA 4RQ5A 1IM4A 1MSWD 3S3MA 1JLEA 3GIIA 2RF2A 3TANA 4DSLA 4FK4A 5KG5A 4RT2A 1NOMA 4CGHA 4KITB 5KRSA 4M2YA 4B8CA 5DQGA 3TFSA 3C1YA 3TAGA 5KFDA 3P1GA 3GV5B 2AQ4A 2GUIA 3CYMA 9ICXA 2YHBA 3V1QA 4QZFA 3KLFA 4I2AA 3T5HA 4CGDA 4DOAA 1IH7A 1ZQVA 4F2SA 4CHYA 4LZDA 1BCOA 4E19A 5DQIA 4KN7A 4AHSA 2BPCA 1U4BA 1S10A 2HB5A 1L5UA 3CM5A 5HROA 1DOQA 1ZBUA 5JS2A 1RXWA 4ZTFA 3JPRA 2A1RA 2OZSA 4FJMA 5SWMA 3IHQB 3ZDEA 9ICIA 4UAWA 2JEFA 1RTJA 4RT3A 4KHQA 4DSFA 4AILC 1LWEA 4F93B 3JPPA 1LWCA 3KHRA 4ECWA 2W9CB 4F4KA 4KKOA 3OHAA 5IIOA 3OS2A 1FKOA 2X74A 1KFTA 2B4JA 4C8LA 1ZQEA 4NLGA 3HPOA 2BCVA 9ICQA 2IMWP 4RPYA 1NK8A 3RMAA 2BHNA 2YNIA 3OYAA 1BIZA 3C94A 4DQRA 5IIJA 4O4GA 3L8BA 3ZD8A 3AVLA 4I2IA 4GC6A 1X1PA 3KLHA 3OSNA 3G10A 3SV3A 4I2HA 1ZQQA 1HQUA 9ICKA 1ZQZA 4KRFA 3ISDA 1B43A 3EW9A 3N97B 1CUKA 3MAQA 2P51A 3NF7A 4AHRA 5BPCA 4CJUA 3NCIA 5D3GA 1HNIA 2Z1GA 3L2QA 1K6YA 4YR0A 3V72A 3NF8A 3DLRA 5CY4A 2G8UA 3CQ8A 5J2NA 1KDHA 4J9KA 5CYQA 1WSHA 1S0NA 3VQ7A 3KKSA 4F91B 4I2PA 1PZNA 3LZJA 2M9NA 3T3FA 4CJSA 4DTPA 2D0BA 2HNZA 3ZCMA 1S97A 1ZQRA 4J2BA 4Z6EA 4DQPA 4LZGA 1XU4A 4F4ZA 7ICGA 4CEAA 2RDIA 1NKBA 1C1CA 4DOBA 4G1QA 5HHHA 8ICBA 4KB1A 4KTZA 4RG8A 4OKJA 3CFPA 5KFYA 2X78A 1HQEA 3AO2A 3AVKA 4CGFA 1S5JA 4ZH4A 1JMSA 1RT4A 2X6NA 4F5PA 4DEZA 1L3UA 1B92A 2PI5A 4I2FA 2VA3A 3NGZA 2IC3A 3SI6A 4O9MA 1RDBA 1VRTA 4I28A 3KK2A 3G6YA 2MUTB 1RBSA 4EBDA 3L2VA 4CE9A 2F1JA 4ECZA 3OYMA 1WCLA 1JL1A 1RT6A 3QEVA 1RILA 2PFOA 7ICEA 5KFNA 3RJIA 4RQ3A 4YR3A 4AHCA 5T7BA 1Q9XA 1BI4B 2W8LA 3OS1A 4FJKA 2ZE2A 4M6WB 2MUTA 3N4MB 4RNNA 3VQ9A 2P5GA 1VSMA 1T4GA 3C1ZA 1JL2A 3DLEA 3WNGA 4CFDA 1S77D 3OHBA 3CFRA 3LZIA 3MGHA 2OPRA 3MEDA 5KFXA 4HUGA 2IHMA 4RQ0A 5HMMA 4PWDA 5J2FA 2R8HA 3C2LA 1WNSA 2KZ3A 1TFRA 4W5QA 4M9LA 1SZPA 1B22A 1C0UA 4KV8A 1CEZA 2RPIA 1EKEA 4CJ3A 3O3HA 3MEGA 4RPZA 4DO9A 4FK2A 1U49A 3H7IA 3NAEA 2NRVA 1LV5A 4RQ1A 5DB6A 4MF2A 3K5LA 4FS2A 2Z1JA 4DTRA 3SJJA 4DSKA 1QSSA 4Z6FA 3NE6A 1BPYA 1ASVA 5J29A 1I39A 4ED1A 2FMQA 2UVRA 4RQ2A 4FLWA 1KLMA 4DU4A 4UB2A 2IAJA 4HCCA 4DU3A 4MFCA 1W9HA 1WSEA 4RQ6A 2FBXA 4HUFA 4M9HA 5J0YA 3L2WA 3NH0A 1LW0A 4QWEA 4FJLA 4Q44A 1J9AA 1QHTA 1DGSA 4QZ8A 4ED8A 4FJNA 3TI0A 1S1XA 5DLGA 4W5NA 3M9OB 1ZQAA 2F8SA 2ASLA 2F1IA 4CHOA 3VA0A 1RBTA 4ECVA 3NDKA 4QZAA 1LWFA 2JEIA 2JZBB 2BCUA 2XY8A 3B6PA 3AVMA 3CFOA 2FLNA 7ICKA 3EY1A 3AA4A 2ZJ8A 1Z26A 4GMJB 2BDPA 5J2BA 1FXXA 2W9CA 2C22A 2G8HA 2UVWA 2F8TA 3DI6A 3V9XA 4DFJA 8ICUA 4J9PA 4EP4A 9ICGA 4KLGA 5KT6A 2RDJA 4I2CA 5KFSA 2P66A 5HRNA 1UA1A 1N5YA 3CM6A 2XGPA 3LWLA 4TUQA 3V1OA 1C6VA 1REVA 2OZMA 3WNFA 1C7YA 4CK1A 4F3TA 2O4IA 1VSIA 8ICYA 5KG4A 4FM0A 1ZYQA 4ID1A 5L9XA 3ISCA 5KT3A 4KLQA 3MGIA 3RJJA 3T5JA 3TAMA 1IKWA 4EZ6A 3P83D 3KK3A 5DBCA 1RTIA 5IIKA 3AVBA 3PW5A 4NY8A 5KRTA 4M47A 1ZBLA 5DG8A 4I29A 4EYIB 3VQDA 3AO4A 2ZJ5A 3KLIA 4QZGA 3GDXA 1KEJA 2BGGA 3HPGA 3ZDCA 3KD5E 1RPLA 1NKCA 2XRIA 5CJ7A 4KLEA 5KG6A 4QWBA 3SQ2A 1ZQFA 1WSGA 4F50A 4OKKA 4M3UA 4PQUA 5DMRA 4KHYA 1NK9A 4FJ7A 9ICEA 1RNHA 5J2QA 4OGCA 8ICNA 4RPXA 1Q9YA 4YFKA 1XSNA 4LSLA 5EOZA 3DM2A 5HLFA 1XWLA 4E7JA 1X9MA 4JWMA 5EWFA 4O0JA 4I2JA 1BPXA 5DB9A 3PMLA 3LAMA 3DYAA 3ZSXA 4F4WA 1T8EA 2HVIA 3DLKA 1TKXA 8ICQA 8ICWA 3ASMA 2IHNA 4DFKA 1IO2A 2KFNA 2KFZA 4H4MA 1T3NA 4B9LA 3SPZA 1JXLA 8ICHA 3OYDA 1QLNA 1CZ9A 2ITGA 2YKMA 3C6TA 5J0SA 4DTNA 5TZVA 7ICLA 4W5RA 4DU1A 1WSIA 5J2HA 5CZ1A 3TARA 4FJ8A 2R8JA 3B6OA 3VA3A 2G8WA 5C42A 3QO9A 1TK5A 4K4GA 4EYHB 3ZDAA 4IBNA 5KT5A 1A5XA 1S0VA 2HHUA 2A1JB 5HP1A 4B9NA 1KVBA 3V81A 2KTQA 2W9AA 1ASUA 2PY5A 2OPPA 2G8KA 3V6JA 5KFJA 2JZBA 3M8PA 1ZQDA 3BQ0A 4E0DA 1RBUA 3DOLA 3AVFA 2FC0A 3NF9A 2F96A 4YP3A 4N56A 3MDAA 3RRHA 5DGAA 1FK9A 4DMNA 1SV5A 4RQ7A 3ITHA 1B9FA 5EWEA 4IFVA 4CF1A 4NCGA 1HRHA 3PO4A 3ZSZA 4QZDA 4Z4CA 2P6UA 3LP1A 2JEGA 4K8XA 4K4HA 4MFFA 2PFPA 2R8KA 3U6FA 3OY9A 3QIOA 1NJWA 3S9HA 3K57A 1WN7A 4DTXA 4IRKA 1Y97A 2LSNA 5KI6A 3HL8A 4YG2A 2DFEA 3ZSRA 1HUOA 1UWBA 3K4GA 4QZEA 1ZQXA 3VQQA 5D4BA 3ZSVA 4O3NA 1BQMA 7ICJA 7ICPA 1EETA 3S3OA 4M0AA 1WLJA 3AO5A 4RW8A 4M3YA 4FBTA 7ICQA 8ICXA 1Q8IA 4FW2A 1JIHA 8ICSA 3IAYA 1XI1A 1ZBFA 3V4IA 4K4IA 1ZQWA 8ICFA 3KKRA 4IG0A 1BISA 5HBMA 2XO7A 2PXIA 3LP0A 4KLTA 8ICIA 4DFPA 1ZQTA 4E7KA 2RN2A 4NXZA 4KLMA 1RZTA 4IRCA 1U9LA 5CYMA 5J2CA 4CESA 3MR3A 3H8JA 4FM2A 7ICSA 8ICRA 1TAQA 1GOAA 2Y1IA 1WSFA 9ICMA 4FO6A 3AA3A 1RBRA 2Z1HA 3C5FA 4BXOB 2FMPA 3E01A 3HP9A 3C2MA 3OYNA 2YHAA 5CHGA 4PPXA 2YKNA 3AVHA 7ICRA 5EWGA 4M3WA 2OPQA 2IGIA 4UAYA 4I2BA 5J2MA 4PHEA 4M6WA 4IG3A 2F1HA 1XC9A 4QZBA 4KO0A 1ZQSA 1D9DA 1IKXA 1WSJA 3ZSWA 3VQ5A 2P1JA 3PW2A 4EEYA 3ZSYA 5J2KA 4QWCA 1W0HA 3U3YA 2WTFA 2G8VA 5J2IA 2FBYA 4LSNA 4H4OA 3UIQA 3T19A 3L3UA 3D45A 4OLBA 5CR0A 3M9MB 3HWTA 3SZ2A 2AGOA 1ZQMA 3VN5A 5D49A 3Q8QB 5KG2A 1VK0A 4PHAA 2G8FA 1N48A 4FJ5A 3UQ2A 1D8LA 1TV6A 3Q8RB 2H5XA 3RWUA 3V1RA 3V7JA 4KLUA 3Q8KA 1HNVA 8ICCA 3LPTA 1JLFA 5KFPA 1N56A 3AA5X 3AU6A 3L3VA 5L1JA 2BQRA 1JX4A 5KFZA 5J0QA 4LY7A 4BE0A 2W9MA 1RDAA 4YMNA 3HPHA 3ISBA 4IQUA 1S0MA 4F8RA 4J9QA 2R8GA 4YXJA 1RYSA 4MQ3A 4N5SA 2NRXA 5L1LA 1K1QA 3MXMA 2P5OA 5C5JA 2ZTCA 1VSEA 3MDCA 3T5LA 5HRPA 4FYDA 4M04A 3ALYA 3LANA 5J1EA 2JEJA 4K8ZA 3RMCA 4J9NA 4B9UA 5KFBA 5HP4A 5I3UA 4P2HA 2WONA 4R5PA 8ICZA 7ICMA 5CP2A 4M3ZA 2FPMA 3I0RA 1NK0A 4PGYA 2HVHA 4UBBA 3BQTA 5IINA 3KK1A 2C2DA 2C2EA 1GOBA 4FZYA 2QKKA 1BPEA 1A76A 3JPSA 4CIFA 2R8IA 4ECXA 5DB7A 3RJHA 2EHGA 5DK5A 4JS5A 1J5OA 3FYHA 1KFSA 4KLJA 4MEXA 3HVTA 7ICVA 4PGXA 3SPYA 5DDYA 8ICTA 4KHNA 3JPTA 1S1UA 3QZ8A 4DSEA 4LVSA 5KT2A 3PW4A 3SUNA 4ELVA 4JK1A 1U04A 3PO5A 2VG6A 9ICRA 2PZSA 2E6LA 4F2RA 4C8MA 4CF8A 1SKWA 1U48A 4DL2A 4Z6CA 1SL0A 1JLQA 1T05A 3OYIA 2UVVA 4ECRA 5JS1A 5KFTA 5IIIA 2W9BA 1JLAA 2VA8A 1HJRA 2VG5A 1AROP 3F73A 5J0PA 4Q45A 2PYJA 4CJTA 4BWJA 4RU9A 5J2GA 4FW1A 3DLHA 1JLCA 5J0WA 8ICGA 4RUAA 4Y1DA 4CEOA 1ZJMA 3LDAA 2QXFA 4I2DA 3LAKA 5KG1A 3V6DA 3C5GA 3RJKA 5HMLA 4DS5A 1VSHA 4YQWA 2ZD1A 1UT5A 4YR2A 1J53A 2IBKA 1S76D 5KFOA 3RMDA 2A1SA 4AHTA 3M8RA 5DG7A 4O5CA 3SUQA 3SQ0A 2PFQA 3RB4A 2KZMA 4O0IA 4DL4A 4E7HA 5J2AA 5BOMA 4IR1A 1HYVA 4KAZA 2IS3A 3MECA 4CF0A 1DLOA 3QEAZ 3DRSA 4F4XA 2ZTDA 4QZCA 9ICBA 3GILA 1S6PA 5KFQA 3HW8A 4MFAA 3KTQA 4IQTA 4EZ9A 2E6MA 9ICOA 3RH6A 4M9JA 4TQSA 4BACA 5FROA 3IRXA 4TSXA 4QWDA 3EPIA 3MXJA 4FLXA 1JLGA 3QINA 1RXVA 3ZSQA 1XS9D 1KRPA 5KFGA 4QZIA 5DDMA 4QZ9A 4ECQA 4J9RA 3S3NA 2AQ0A 4BDZA 4KI6A 5DB8A 4FBUA 3RAXA 2IA6A 2V9WA 2BCQA 2ZTEA 4M9NA 1ITGA 3O4NA 4YMMA 4B9SA 3LK9A 4XQ8A 4FXDA 1D5AA 4CIGA 4R66A 4O3PA 2C28A 3GIMA 2ZUDA 1ZBHA 3GQCA 3OGUA 4QZHA 4M41A 1S9FA 4TUSA 3BQ1A 1WAFA 1BQNA 3RRGA 1A5WA 4C8OA 1L3TA 4O44A 2ZUBA 2BKEA 4CF9A 4ED3A 1J54A 3K5OA 1B9DA 4KN4A 2D0CA 4OVLA 4CGJA 1LAWA 5FRNA 2NRWA 4UBCA 4I9QA 3HVRA 9ICTA 3JPOA 3C21A 5DKWA 4Q0BA 5KFIA 1JXEA 2B21A 1ZQYA 4G3IA 2ZQBA 3RAQA 5KFAA 3HP6A 1DTQA 9ICWA 4B9VA 4J2DA 3SI8A 3KLEA 3TAEA 4CERA 1RT2A 4FZXC 1XO1A 4CJ4A 1BPBA 4ICLA 4KFBA 4YVZA 3OYEA 5SZTA 1EP4A 2ASJA 5HNKA 3JPNA 2ASDA 1ZQBA 4KLIA 1LW2A 1ZQIA 3PR5B 1KTQA 4DQQA 1TVAA 4Q8EA 1S9EA 3LALA 2P6RA 4KHWA 1A5VA 3AVNA 4YCXA 3WNHA 4UB4A 3AO1A 4BXOA 3F9KA 1S1WA 2D0AA 3ISNC 1I3AA 4KI4A 4X5VA 3RR8A 1JKHA 4F5OA 4DG1A 3LDSA 3ZT2A 4KPYA 4JV2A 8ICOA 5FDLA 3K5MA 3AV9A 5KT7A 2XGQA 4NLKA 3HM9A 4RNOA 3B0YA 1O1WA 4I2QA 4CGIA 2BPFA 4FLUA 4PY5A 2KN7A 4UB1A 4NCAA 5KFVA 3RBEA 1JXBA 2GV9A 4CEFA 4I27A 2KW4A 4DSIA 4FLYA 3UXNA 2VWKA 3RR7A 4LD0A 2QK9A 4J9SA 3HYFA 3SNNA 4C8KA 8ICPA 4KTWA 2KZZA 4KLFA 8ICKA 3MR5A 4DLEA 3RJGA 9ICJA 3EWAA 9ICUA 3BJYA 1ZQPA 3VQ4A 4HHTA 4P4MA 5F9NA 1NK7A 1NK4A 2VANA 5KFRA 3QEPA 1EXQA 5J0UA 2BQ3A 1DTTA 4PA1A 4B9MA 3LP3A 3TWHA 2YNGA 4YXMA 4DTSA 2IOCA 4Z4EA 4N47A 4IR9A 4CK2A 1COOA 4R64A 4B9TA 5K14A 4O5KA 2ALZA 9ICVA 4E1NA 4ED7A 2YV0X 4O3RA 1WCNA 8ICLA 4GVMA 2FLLA 3SUOA 2DPIA 4DFMA 4BE1A 5J0RA 4CJLA 8ICMA 5KTQA 1RDDA 4NLZA 4PUOA 3KIOA 4WE1A 3ZD9A 4JLHA 3KHLA 4RQ8A 5C25A 2IDOA 3DMJA 4GXJA 4ECYA 3OYKA 1BIUA 3M8SA 3NH1A 4CFBA 2OYQA 2XY5A 1VSLA 1TK8A 4CHQA 3OYHA 3TAPA 2J6UA 5I42A 3JYTA 4XIUA 1KVAA 4BDPA 4DL3A 3C2KA 2DFLA 4AHUA 4DQIA 1TKTA 3DRPA 1QSLA 4DTJA 2WOMA 1SUQA 2AU0A 1VSDA 3U3GA 4RZRA 4FJIA 3V9SA 1NJZA 4EP5A 1VRUA 4RUCA 2W9BB 3OJUA 3OJSA 3PX6A 9ICCA 2XC9A 3BGRA 1WAJA 3LWMA 4IRDA 4KHUA 4BWMA 9ICNA 4ECTA 1CXQA 5CZ2A 3T5KA 3T1AA 2YNHA 2HHVA 5HRSA 3HJFA 3DOKA 3I8DA 1BVSA 9ICHA 1T7PA 4HYKA 5KGXA 3PVXA 1IXRA 4DS4A 1S1VA 2FPKA 5HHIA 2O4GA 3OYFA 5CA7A 3ZT1A 5KFFA 5J0OA 4P4PA 4XA5A 1BPZA 1L3VA 7ICUA 2FLPA 3FFIA 4UQGA 4DQSA 1YT3A 4KLOA 3O3FA 3QE9Y 3C95A 4O5EA 2Q3SA 1TKZA 4KLLA 4KLHA 3ZT3A 3VQAA 4C8NA 5D46A 3SV4A 3SCXA 3KJVA 5CWRA 2AGPA 4CJKA 4QAGA 3DRRA 1NK6A 4YD2A 5J0XA 4FVMA 4NM1A 3UXPA 3TAQA 1HYZA 3MFHA 5CB1A 4DSJA 4DTMA 2Y1JA 3AVIA 2I1QA 3H40A 4MEYA 2X6SA 1QSYA 7ICNA 4ELUA 2FBVA 4GLXA 4CEZA 3VQEA 4QW8A 1S0OA 1K1SA 3H8WA 4EBEA 4N41A 3M9NB 4O3QA 2BR0A 2ETJA 1EXNA 4CHZA 2DPJA 3NGDA 2R7YA 3VQ6A 1BL3A 4CGGA 4RNMA 3VQ8A 3K59A 4FJJA 4O55A 1Y88A 1TL1A 1XSLA 4OPJA 4DF8A 1IKVA 2DY4A 7ICFA 3ZDDA 3RH5A 4CIEA 3V9WA 1XHXA 4NYNA 1LAVA 1BGXT 1NJYA 3QIPA 1G15A 3UPQA 4CK3A 3ULDA 2NRZA 2HHTA 2FMSA 4YN4A 4I9LA 5DLFA 4UB5A 2G8IA 3HSTB 4YD1A 4KLSA 2BQUA 1ZQCA 2I5JA 7ICIA 4HTUA 3TABA 4PH5A 2BCSA 4B08A 4F5RA 4ED0A 3AVJA 3ETLA 3L2RA 2V4QA 2BPGA 5IIMA 5KFCA 1S6QA 3V7LA 1JLBA 3BQ2A 4RW7A 1ZQKA 9ICAA 3A2FA 4OLAA 4CCHA 1HJPA 4RQ4A 1C1AA 1RTHA 4JS4A 4UB3A 1RT5A 2BGWA 4IDKA 4F3OA 2HNYA 3ZT4A 4CJQA 2HHXA 8ICVA 3KLGA 4R63A 2V4RA 2HMIA 3B0XA 5J0TA 3G0ZA 4KB0A 4P4OA 3K58A 3Q8MA 3QERA 4ED2A 2HHSA 4R8UB 3H8SA 5KFWA 4DOCA 5IILA 3H08A 2J6TA 1ZQLA 2AJQA 3OS0A 2GWSA 3SUPA 1ZJNA 1UOCA 4DF4A 3OYJA 1NK5A 1L3SA 4CJPA 4ID5A 4F4YA 3IS9A 1TGOA 1Z00B 4Q5VA 5KGWA 1TKDA 2QKBA 1HUZA 4DL7A 1NJXA 1HMVA 3RBDA 3QNNA 5L1KA 4NCBA 3NHGA 4ZTJA 3K75D 4J2AA 4FJXA 2W42A 4IQVA 1QE1A 4RW4A 1H38A 4F92B 4I7FA 4NM2A 5J2JA 5J2EA 5J2DA 3THVA 4B8AB 4PGQA 1SKRA 3PR4A 3QEXA 3NGYA 4JUZA 4DL5A 3Q8LA 1QTMA 3EYZA 2EX3A 4GW6A 1HPZA 3PV8A 4O3OA 1BPDA 3PX4A 3Q8SB 3RB6A 2HHWA 4MF8A 2B6AA 2DFFA 4LH4A 2MAXA 3E2EA 3O4QA 5BOLA 1X9SA 4CJEA 3NTUA 3V7KA 1C1BA 1MC8A 4JRPA 3AVGA 4YFUA 4Z6DA 4CFCA 1SKSA 4W5OA 9ICSA 3KHHA 4CF2A 3AU2A 4YMOA 4H8KA 4CJFA 1SL2A 2AGQA 4KLDA 4FLTA 1D8YA 3ZSOA 1TK0A 4KHSA 4HVJA 3ZDBA 1RBVA 2VWJA 5KFMA 2OA8A 1IKYA 2A1JA 2ISPA 3VQBA 2DFHA 4NYFA 4JWNA 4MFBA 1YVUA 4DL6A 1ZQNA 2UVUA 3GIJA 1RT1A 1RT3A 7ICHA 1D9FA 1CLQA 3RB0A 2PI4A 4IKFA 4M3XA 1KFDA 3GIKA 2HW3A 1KVCA 4E3SA 3V6HA 4QOZB 4O3SA 3C6UA 4OKEA 4M3TA 5C24A 4Z4FA 5L1IA 3MFIA 4CEDA 2BCRA 1VSFA 3QLHA 1T03A 2FBTA 4M3RA 3AVCA 1TV9A 1ZQHA 2XCAA 2ISOA 1XSPA 3SYZA 5HRRA 4AH9A 2NUBA 4CEEA 3C23A 3RTVA 3KD1E 1TVRA 3OSPA 4AHVA 5KG7A 3PY8A 9ICLA 3RB3A 3QEBZ 1X9WA 4FJ9A 4BGDA 2OWOA 4O5BA 2JGUA 4YNQA 4OJRA 4ELTA 3HX0A 1YTAA 3HO1A 4XUSA 4UAZA 4TURA 3Q8PB 1ZBIA 4PHPA 4J9OA 4Q43A 3HK2A 3QEIA 3QNOA 3BDPA 8ICAA 1S9GA 5KFEA 2OPSA 4ECSA 4FK0A 1VSKA 4E1MA 2B5JA 2GBZA 4RW9A 1UA0A 1ASWA 9ICFA 3OYGA 4Z4IA 4QWAA 4CFAA 1X2IA 4ECUA 3TR8A 5KFKA 3L2UA 4TQRA 4Q8FA 2Z1IA 2YNFA 4CHPA 4GXKA 4ZHRA 3H4BA 3TAFA 4CJVA 1XHZA 3KHGA 2LYHA 1VSJA 1ZQUA 2VA2A 1UAXA 4M9GA 9ICPA 5F9LA 4LH5A 4OPKA 1UT8A 2D5RA 5DBBA 1R0AA 4XRHA 4FJGA 8ICJA 1MQ3A 4R8UA 4DLGA 2J6SA 4CECA 1CXUA 4J9LA 3AUOA 4RW6A 4B3OA 4CEQA 5EU7A 4IQWA 4CHNA 1RT7A 1TL3A 4BDYA 4F5NA 3O3GA 4CEBA 4JV0A 3MR6A 5JUMA 1TAUA 4TUPA 2HNDA 4N76A 3PMNA 5KFHA 3QZ7A 3MBYA 3WNEA 3OYBA 3I0SA 3RJFA 4IFYA 1CZBA 4JRQA 3UXOA 1ZQOA 3IM1A 4FLVA 2ATQA 1Z3EB 1NOYA 1S1TA 1RCHA 2ZJAA 2XHBA 1MQ2A 4KREA 3V9UA 1QQCA 3H4DA 2KQ2A 3V9ZA 2ATLA 5DQHA 2HHQA 2JLEA 1FKPA 3P5JA 3AO3A 3D0PA 4QCLA 4FJHA 1BCMA 3LPUA 4J9MA 4Y1CA 1BHLA 3PW7A 1KSPA 1ZETA 2Q0ZX 4DWIA 5KFUA 4ED6A 3AVAA 5KFLA 5KG3A 1Z25A 2XY6A 4L8RB 3GV7B 4CJRA 1QS4A 5E41A 4F5QA 4PHDA 4Z4GA 2E4LA 4DTOA 4KTQA 3CG7A 1F21A 3QEWA 3K2PA 1N6QA 3RMBA 3OYLA 1RDCA 5DG9A 4R65A 1A77A 3FDSA 3MEEA 4HUEA 3SQ1A 4FS1A 2NRTA 4KMUA 2ZUCA 3QESA 5DBAA 5KT4A 4E89A 2FPLA 4BE2A 8ICEA 3PX0A 1SL1A 1NKEA 2W8KA 2PYLA 1YTUA 2BE2A 5J2PA 7ICOA 4CJ5A 2BANA 3RJEA 4E7LA 1HYSA 4Z4HA 3RH4A 1KLNA 4HCBA 3EPGA 4EBCA 4J2EA 3GV8B 4NLNA 2C2RA
chains in the Genus database with same CATH superfamily
3TA2A 3M6KA 3WIUA 2VG5B 5E3AA 2HFOA 2MB0B 3OYCA 4JBCA 2LQJA 2YKAA 3HXMA 3J81O 2WFAA 3JPQA 4DU8A 3MXIA 4RCHA 3TFRA 2KXFA 1U0HB 3CULA 4JKHA 4GC7A 1U47A 3ZTRA 2ZOFA 4FCYA 4R0EA 4UARA 4G6VB 4CZHA 1VQLS 2CPEA 1YRUA 3PNCA 2VF3A 4OGEA 4UY8T 1Q5VA 4Z0UA 3DYAB 2VGNA 4DTUA 1U45A 4K8RA 1D8ZA 2Z8QA 2HZAA 4ZPTR 2B7BB 4PR6A 3ITHB 1X6IA 2XLJA 3ZT0A 1FK9B 3HKZF 4TY8A 1NEEA 5KG0A 4LSLB 3PHTA 1MWKA 1IG9A 1BI4A 2ZIXB 3DLGA 1V9PA 3MR2A 2EG2A 2V2ZA 2DRBA 3VQCA 4F0MA 1R89A 3VWSA 2PD1A 3SQ4A 3D6TB 3N79A 3WX4A 4Y2CA 1QE1B 3K89A 5HL7Q 1VIOA 2DTUA 1IM4A 3S3MA 1WF2A 1HMVB 1JLEA 3GIIA 2RF2A 3DCAA 2QA4N 1GNKA 3NS7B 5T7LB 2NZ4A 1JCGA 5AIBA 3KLVA 4AD6A 4DCOB 1AW0A 1T9VA 4KITB 2NZCA 5KFDA 1VK3A 3CB4A 1T95A 1KBUA 3P1GA 1WNEA 4WQ5C 3CYMA 3TW0A 4FZLA 4UQTA 3NLCA 3V1QA 5J1PA 4CGDA 2V8VA 3UD5A 1XTZA 4MJKA 1HNXF 1VQ7S 3HZEA 3Q83A 1VQYA 4E19A 3QWPA 1X3NA 4KN7A 1X66A 2IRXA 5HJYA 5HROA 3TA0A 4H5NA 5KNIA 2DGSA 2ZM6K 2HF3A 1RXWA 5SWMA 2XB2D 2P9IB 9ICIA 4UAWA 3PFOA 3SD7A 3DFEA 5E3CA 2HNZB 1VLOA 4QIGA 4NXNJ 2ZIWB 4A46A 1FXDA 4NL9C 4ECWA 3PYGA 2W9CB 4F4KA 3MUMP 4P2FA 2ZVSA 3CDEA 4ES2A 1ZZFA 2AF6A 2QGFB 4C8LA 1JI7A 4NLGA 2BCVA 5JXSA 5FIIA 1V9OA 3TYTA 4RPYA 4KHPJ 1U1KA 2MQQA 2OJ3A 5FPMA 1FJGF 3K1ZA 4CZMA 1YDLA 3PM9A 1JQGA 2HG4A 5L9NA 2LA4A 3AVLA 4I2IA 2VIXA 2D4WA 4IUFA 3SV3A 3ETOA 3NGSA 3D2EB 1HQUA 4A8WA 5AQJA 3N97B 3QGPA 3KDNA 1W7WA 4CJ7A 3JSRA 1N33F 3RW6A 1SV0A 4H0PA 1N0VC 2Z1GA 3M6XA 4C3LA 1K6YA 1KC8O 4OJOA 3K0JA 2PEBA 4U7UD 1OSDA 2BABA 5DM6Q 4J9KA 4MKBA 4YB1P 1WSHA 1Q81T 3QQCD 1DURA 4URQU 3LZJA 3HT0A 2M9NA 2D0BA 3IS9B 3I56N 4RWWA 1FDDA 2X1GA 4LIWA 2JL9A 1QVFM 4LZGA 3A8IA 4LF5K 2P9GA 1OUQA 5AQGA 4CEAA 1YZ7A 1VRQC 3G71N 3GIRA 4KJIA 4CNYA 4KTZA 4PXCA 4K43A 3WU2U 3MEGB 4OKJA 1HNIB 2A6AA 3CF5L 1F9EB 2RHQB 2X78A 2OANA 2R2RA 1TFWA 1HQEA 5HR6A 2PIIA 3AVKA 3SCIE 1O8BA 2B6AB 1RT4A 1YBTA 1L3UA 4UUXA 2PI5A 3AQOA 4K4WA 3BY5A 2FJXA 2FGOA 3OFGA 2HVDA 5AKHA 4JI1K 2N7YA 3CCTA 3LTOA 1M1KT 3LM9A 4C0ZA 4ECZA 3OYMA 2YNIB 5SUHA 2BH1A 1WCLA 3W2VB 3QUCA 3QEVA 4XH4A 1K0VA 1QQ5A 5DM6L 5JU5A 3RJIA 3VAFA 3N9UC 2DR9A 1Q9XA 2DY9A 1LWCB 2F9TA 2ZE2A 3HKWA 2MUTA 3N4MB 3OPXA 4BY9C 2W7PA 1VQMS 1R8CA 4GO7X 4BRAA 1NGEA 4A8OA 2GJIA 1S77D 3MM6B 2OPRA 4HUGA 2R8HA 3W9IA 4B6JA 1M1GA 5A0LA 1K73O 4RBTA 1SZPA 2J76E 1W2BR 4B3SK 2IA0A 4HH1A 3R7SB 1IJFB 1EKEA 1TYQA 3O3HA 2H4YB 4H5WA 3AOCA 3KKAA 3WK5A 4FK2A 5HVFA 3O6QA 3U7JA 1EWRA 3T1YJ 3DDIA 2UU9K 3SJHA 1LV5A 2UUAJ 3K5LA 4FS2A 3H5SA 1PAUB 5AQOA 4YDDB 3ADAC 3SJJA 1FI4A 3CCES 3M3ZA 4Z6FA 2IOHA 1TELA 1LOTB 3B4DA 1ASVA 3P96A 4ED1A 3HHDA 2GX9A 5AM3A 2Q43A 4JI4J 3PDNA 1N32K 4M5GA 2UVRA 1CS4A 2XMWA 3ENAA 4RQ2A 4P10A 4FLWA 3R8YA 4ILHA 1XNQF 2NRRA 4B3TK 3P8BB 3MR7A 3BPDA 4DU3A 4HT7A 1SWWA 2RKIB 4F4AA 1NU4A 3J81U 3FEXB 2GUPA 3IKMA 3T69A 1NDPA 1J5OB 8RUCA 2XMVA 3BGOP 4KH5A 1X31C 4QZ8A 4FJNA 4JB3A 3TI0A 4RR5A 2CQPA 4BJQA 1ZQAA 5ALXA 5BR8F 3VA0A 2CG8A 3NDKA 4QZAA 3WC2A 2KVSA 1UP1A 4OYOA 2XNRA 2Z57B 3B6PA 2LLZA 1EHWA 3G86A 3AD8C 1PVQA 2V67A 2KICA 4JEPA 3CD0A 3M6UA 2YWEA 3H8YA 2V34A 2ZJ8A 4NO7A 4GMJB 2J9CA 3MI7X 4GKJF 5D8HB 2Q36A 3KNGA 3DWLA 3HKZC 1B0PA 3DI6A 4J9PA 4WTOB 5HK4A 2MTLA 4OYAA 4DR3J 1YWXA 3FJ2A 2RDJA 1S7IA 2RIJA 1YAGA 5F0XA 1N5YA 4LRDA 3H8MA 3BR9A 1FESA 3ZZUA 4Z2XA 3LWLA 4TUQA 1GLDG 4ZITA 1WG4A 4B1XB 2NCKL 1UWBB 4PXEA 1C7YA 4CK1A 4F3TA 3OA9A 5F8JA 4A59A 5F3TA 1BQXA 4C0OC 3I76A 4BRDA 1ZYQA 1RAFB 5L9XA 4U7CA 5KT3A 4WPAA 4RUBA 2JVRA 3T5JA 5C0YA 1Q7YO 1IKWA 3KK3A 4CZKA 3D2EA 1KHWA 4WP3A 3M6GA 3AVBA 3AOAA 3M4XA 4NY8A 3Q8UA 2NUUG 1FEEA 1DKGD 3K2YA 1FO4A 3AO4A 2ZJ5A 4OI4A 4QYZJ 3GDXA 3TJ9A 1P8ZA 2JHDA 1KEJA 3EX7B 2BGGA 3HPGA 1JLGB 1RTZA 2AD9A 4NI2A 2R7TA 2RAQA 4Y2UA 1DTQB 1SAZA 4FJ7A 9ICEA 5J2QA 4C11B 3VAGA 4UT4A 3DM2A 5K8OA 1SJQA 2IC3B 4LF7F 3OR2B 1EQ0A 3E01B 3GJQB 4IO8A 2E7WA 2ZOGA 3LAMA 4GV6A 3EGZA 3OT9A 2I5HA 1DQ8A 4JI8F 1K0TA 3A3OB 8ICWA 2KK0A 1S4EA 4CDIA 4CBWA 1IO2A 1N4LA 5ALGA 2KFZA 4TLQA 3I55N 1JXLA 5HATA 3GTYX 4FL9A 4BQLA 1K44A 1CZ9A 3FCWA 5AKYA 2YKMA 2CJXB 5J0SA 4W5RA 2WSCC 3OR1B 5M2UA 5CZ1A 2UXCJ 4LF6J 4FJ8A 3F2BA 5BXIA 2YWGA 5IWAJ 3VA3A 2G8WA 3NUQA 2EK6A 5C42A 2FB0A 4CZGA 1JB0C 1A5XA 1XMQJ 2A1JB 3KG0A 4P2XA 1E4FT 2DT9A 3BO4A 2CJAA 5KFJA 1S9GB 2ZNYA 3I5CA 2PSZA 4ZVTB 3GP9A 1YXQA 1NJIO 2YB4A 3CCVN 2F96A 3RRHA 3F2KA 4C23A 5HMXA 3E51A 3LP2B 2YHXA 5EWEA 3NEKA 4CF1A 4NCGA 1HRHA 3PO4A 2B4UA 2UU9F 4Z4CA 2P6UA 1PJ7A 5LMNK 4K4HA 2PFPA 3S1TA 3KHYA 2ZD1B 3OY9A 1ZAVA 3LPYA 5AR0A 3ILIA 4LC9B 2W54A 4YG2A 3ZSRA 1H72C 3K4GA 2IVMA 2NPFA 1HNXJ 3F5TA 1KAYA 3DXSX 2JH1A 4ILGB 4FW2A 2LCWA 2GIRA 1JIHA 2DYAA 4NV0A 3CPWM 3IAYA 1ZBFA 3Q8YA 3GE1A 1VQKS 2MKKA 3J80Y 4LFBK 4ETZA 1WOOA 2DNGA 1RP5A 2K4EA 2X51A 4RL1A 8ICIA 4DFPA 2K8CB 2FF6A 4FXWA 4AL5A 4NXNF 4X4PA 4DCHA 2IJNA 4E7KA 1RZTA 4JN4A 5GIOA 3OUYA 4MIWA 2DH7A 5FDLB 3MR3A 3TTFA 2BKPA 2WZ1A 1RAIB 2ROEA 1X9XA 4CTAB 3AA3A 3R9LA 1RBRA 2WUSA 5A6PA 3SDEB 3C5FA 3G96A 3AXKA 4Q2MA 1HKGA 1HI1A 2LQ8A 3I56S 4CF3A 2YKNA 1MW7A 2P9LA 3B8HA 2IGIA 4UAYA 3MF5A 2OM6A 3AJ1A 1U8WA 3D9BA 2HFVA 3DOKB 1XC9A 4OZLA 1SJFA 2XYHB 1D9DA 1IKXA 3ZSWA 2Z4PA 4PQUB 2ZH9A 3OXFA 2ADBA 3L6QA 3VQ5A 4Y3CA 5AXNA 3PW2A 4RW4B 4EEYA 3ZSYA 2IRYA 2ZBQA 1W0HA 2G8VA 1Y9OA 1NXIA 2ZBIA 3A5OC 3CCLN 5CR0A 3M9MB 2K4HA 4JKFA 4AXIA 1VQ4N 1OMSA 4LF8J 3VN5A 3ELHA 2CVEA 4LF9J 3ENWA 3GG0A 4DKWA 3FBFA 4AQYF 1QAYA 1TV6A 4OX9K 2IVFB 2VDHA 3RWUA 3CCRN 1P7DA 2W2QP 3V7JA 1YHQS 2KP7A 3VERA 4EAHD 4H5VA 3AU6A 4FXVA 1T03B 4OMFG 1Q8BA 4NMLA 2VPZB 3I96A 2KN4A 5BYQA 3HPHA 4KAIA 1DGKN 4I4BA 3CT9A 1A7GE 2OFGX 4YB6A 4I68A 1HBUA 2CPXA 2WW8A 4USMA 5L1LA 2ZXIA 2ZTCA 1GQEA 3MDCA 5GMDA 3VAIA 1RISA 2MSNA 4FYDA 5AZJA 4M04A 1UVMA 3LANA 4DX6A 4BC3A 3AHPA 2JEJA 3VEXA 3TADA 4GVLA 5KFBA 2IM2A 3H5YA 2VJ4A 2FC8A 2VHGA 3GYGA 4M3ZA 4NLUA 2L08A 4F0KA 1H2TZ 2Q1LA 3TWZA 5K8MA 2EKNA 1XN9A 3UVJA 1VYAA 3OL7A 1SH2A 5DRKA 3KK1A 1O03A 1VBXA 1AZSA 1BE4A 2A2CA 2C2OB 1BPEA 3JPSA 4ECXA 2IBOA 1APSA 2KYXA 5DK5A 4JS5A 2N3LA 5MLCQ 3QDKA 1NDCA 1S6UA 1SQGA 2QWRA 5HMYA 2P9KB 3JPTA 2VONA 5KT2A 3BGUA 2E5GA 3PW4A 4F67A 1QVFR 3FZFA 1FJ7A 5AI6A 4CT8A 1U04A 2NYHA 2W40A 9ICRA 2PZSA 3BO2A 1H2UX 2E6LA 2JWLA 2JX2A 1ZH5A 4DR2J 3H2VE 1SL0A 2HLTA 4UB8U 4EI2A 2KU7A 5JS1A 1LOUA 3CD7A 4NXNK 5IIIA 5GADP 2W9BA 4WBFA 1HR0F 1JLAB 3SCJE 3T1YF 3KUGA 2KT5A 4QJVA 4RU9A 3UNGC 3N7SC 1NZ8A 1TL3B 5GAGU 4JKEA 4DV2J 3FAHA 4USIA 2RILA 4Y1DA 2MJNA 3ONQA 4MIAA 3H0MB 5KG1A 3BDEA 4DS5A 4OLPA 4WWSA 1O13A 4EO8A 1JLFB 3NCRA 5E7OB 1SV4A 2A1SA 3RYLA 3M8RA 3O1BA 5DG7A 4L74A 4CVNE 2L41A 4DL4A 1FRLA 2E2OA 2KB2A 2HHHK 4JI3F 4QIWF 2NXJA 3N28A 3WXLA 4QZCA 9ICBA 3W61A 5KFQA 3OPKA 2R2UA 1KL9A 3HW8A 4OX9J 3LH2S 2HF4A 1T6DA 4M9JA 1K8AT 4TSXA 1VDVA 5AFUH 1FE4A 2LVWA 5IWAK 3CJTA 3EPIA 4E2FB 3MXJA 4DV0K 4QYRA 3HRDD 4B9QA 5DDMA 4ECQA 4OFZA 2CDRB 2AZ3A 3M2VA 1PJ5A 4KI6A 4FBUA 2IA6A 3ILLA 2QFJA 2BCQA 3BREA 1NSQA 3CETA 2ZTEA 4M9NA 4TNOA 5GADI 4C6AA 3LK9A 2N4DA 1D5AA 1QVGR 3CJ2A 1T0TV 1RWKB 2Z0GA 2ZUDA 3OGUA 1N34K 2W04A 3F56A 3KK7A 3O9QA 2C3MA 2VBYA 4M41A 3VHQA 4X65F 2H3QA 3J81Y 5C7PA 1VMBA 4KGKA 3CC4N 3TVYA 1A0OB 3A8YA 1ACMB 2AMCB 3D54A 4CF9A 4NYZA 3OTDA 4FP9A 3OUYB 3CP8A 2DCLA 3K5OA 3OR2A 5AKKA 4ZVHA 2D0CA 2XICA 8AT1B 4PAAA 2NRWA 3UKUB 1UFWA 5AI8A 4OHZA 1ZA2B 1RAEB 3UN2A 3AA9A 5I4MA 2ZQBA 4DUYF 4U95A 1RGVA 4B9VA 1RDRA 3H98A 2I7PA 4BVOA 5IT9Y 4KSEB 2XHWA 2LBOA 3VAMA 4OYBA 4URSA 4A57A 2DPNA 1BPBA 5EX0A 3MUVP 5CD4A 3ISZA 3CJ8A 5SZTA 4DG1B 1EP4A 2QB1A 3R5AA 4X62F 4YOWA 3ZX2A 5FLXO 4QQBA 3PR5B 1KTQA 1KONA 1TVAA 1S9EA 3QGHA 4AM6A 4IFVB 5HANA 2FF3B 1VQ7N 3AO1A 2E5LJ 3ZTQA 1S1WA 1WF0A 2VFVA 2FHKA 4DG1A 5AQNA 4Y00A 2EDUA 2YJFA 8ICOA 1Z05A 3K5MA 5A8RB 1G99A 4NLKA 2I7NA 3HM9A 2CPDA 4DR6J 1QQMA 1NGJA 1VI7A 2P9PB 1RWMB 5IQ6A 4FLUA 2LYBA 3HHLC 3E9LA 1IJEB 5HQ8A 4PY5A 2KN7A 4JI0J 3FK4A 3C3LA 3RBEA 2V52B 2UXCF 3PYFA 2RUSA 3FBBA 2C2MB 2VWKA 4ZIVA 3U1MA 2B9WA 3DEEA 1JCFA 4C8KA 4EUVA 4C7YA 2GJFA 4DPYA 4FKXA 4I69A 1TP7A 9ICJA 4DR7F 2HFZA 2UXDK 3MCAB 3N4QA 3HVWA 1RWXB 1ZQPA 3VGMA 3M05A 4ILMA 1I6JA 3OLAA 5ALIA 1M90O 5AT1B 2LYAA 1CJUB 4B9MA 3IR7B 3TWHA 2GMJA 2JZ5A 4DOZA 5AM0A 4DR4F 4Z4EA 2XG8A 4OZ3A 5K4LA 4JK8A 1X0PA 1NGBA 2WB4A 4LFAJ 2QARB 2EW9A 4PG5A 3D67A 2YBVA 4E1NA 4HHHA 1Q5YA 4Z37A 2ZWOA 1KLMB 1HBOA 4GVMA 3IDHA 1QAJA 3TP2A 1B7YB 4RBUA 4JI2K 5J0RA 2LPEA 2CH5A 5KTQA 4CRJA 4NLZA 3W64A 3ONNA 4PUOA 1PCAA 3KIOA 4WE1A 1IG8A 4JLHA 4KRWA 2C3UA 3A4TA 1FEHA 4LFAK 1N5VA 3DMJA 2IDOA 4RUHA 3N4WA 3D2FB 3KWGA 4EX7A 1D0EA 1Z2LA 1BIUA 2UUTA 3QGGA 4ZVEA 1ZAXA 4O44B 3TAPA 1DQ9A 2BUPA 5I42A 4ZCIA 2P9SA 2DNQA 4HR2A 2Z2ZA 3JYTA 2VQEJ 1EIYB 2VG7B 4IZ9A 2GAHC 4DL3A 4MIBA 6AT1B 1R0AB 1VS3A 1HA1A 4ZVOB 4X66K 3IRWP 5ETVA 2WOMA 2P2CB 2FDNA 3R2DJ 3MCMA 5CAAA 2FJDB 2HQGA 4FF3A 4CYUB 4EP5A 1FEZA 3QFPA 5LL6Z 4ZVGA 4HTIA 3E9OA 4RW7B 3PX6A 5ALWA 9RUBA 4ZCLA 3TTCA 2JGAA 5BREA 3TQEA 1WAJA 2HBKA 5D77A 3FRYA 4KHUA 5DDQC 1UHUA 2DD8S 2F8KA 1CXQA 3QU7A 4ZPWR 4KHMA 1KQGB 1TKZB 2IVNA 1OXJA 1J27A 1T7PA 5AIAA 3PVXA 1VQ8N 3IRUA 2FPKA 2YX1A 1S3XA 2O4GA 2JSXA 3IBWA 5CA7A 1B0XA 3UMCA 4PXBA 3PJ9A 4FF2A 3NRZA 4OI0A 4NASA 3E66A 4XA5A 2KYZA 1DZ5A 2FLPA 1Z1ZA 2QEXN 3QRPA 3Q89A 1RM6C 2QYGA 1FO1A 3CF5Q 1UW9A 2RS2A 1WOQA 4O5EA 2Q3SA 4KLLA 3VQAA 3EVMA 2AGPA 4QAGA 2OPPB 2XMKA 2E1MC 4QR0A 3L7UA 3DRRA 4YD2A 5J0XA 2W3RA 3VAKA 2CNOB 5CEHA 2ABYA 2VUGA 2UXDJ 3UXPA 1EO1A 1HYZA 3AVIA 5FPEA 5ALVA 3L4PA 4MEYA 3FE1A 4ELUA 3D0HE 3M1VB 2MPUA 1U2RA 1RHRB 1N5XA 1HWJA 3DU5A 1VJWA 4CD1A 4N41A 3M9NB 4CLZA 2BR0A 2ETJA 1UKUA 3WK7A 2YJEA 4DV4K 4JI0K 2MU2A 3GDQA 1HW9A 1TTHB 1S8OA 2HRUA 5EVZA 5L1MA 5A8WA 3VQ6A 2H3IA 4Y0FA 2DITA 3AB2B 3GYNA 3NNHA 1N54B 3FBCA 2HBZB 4OJ6A 1FFSB 4NLDA 4A8QA 4CIEA 3V9WA 1BUXA 3J7AP 2PO4A 4NYNA 2DKXA 1LAVA 4ISFA 2Q6BA 1G15A 5ALHA 5LMUJ 1SBRA 1JNZB 4CK3A 2NRZA 2VJVA 4YN4A 2VV5A 3I28A 3FMBA 5DLFA 4O4GB 4QIFA 3ILOA 5ETPA 4DV3J 3FQKA 4CNZA 4LJXA 4CO1A 2HHPA 5E3RA 3RVCA 4PH5A 2YHWA 5ADXA 3CD5A 4ALZA 1VQOS 2YTUA 5IIMA 2HS4A 2KV2A 3U1LA 3DHXA 3QJLA 3CW2C 2O8CB 3CCUS 4TY8B 4JS4A 2MQLA 4UB3A 1RT5A 4IDKA 2HNYA 3A5LC 5GAGI 3L09A 3OFHA 3ZT4A 4WKRA 2HHXA 3MM8B 4XEIA 4MK9A 1IKVB 3CJRA 2WHEA 2RHKA 2HMIA 2YHYA 4KB0A 3G0ZA 2G08A 3QERA 2DNYA 2ZM6F 4MO5A 2BDUA 2ZGZA 2RB7A 1K8KA 5IILA 5FLXU 3UW1A 2E5IA 3OS0A 2GWSA 2KKZA 3SUPA 1FTRA 3H5UA 4DF4A 2CQBA 3MN6A 1VQ5N 3MM8A 4P72A 3MPYA 4ID5A 3F44A 1RT5B 1U6BA 3U1NA 1MWQA 1NLKL 1TGOA 1AA1B 5F3ZA 2HAFA 2YI1A 3O80A 4C3MA 5KGWA 1TKDA 5A8KA 1J6ZA 3QAEA 1KXPA 3EVOA 2ZWHA 5AQLA 4US9A 3AD9C 5F0UA 2CPZA 3ZFVA 1SIWB 4FJXA 3DLLQ 3T6BA 4QIWD 2WAQD 2R7XA 2AV5A 3VPZA 5J2EA 5J2DA 1S48A 3MCPA 3THVA 1X4FA 3U02A 4B8AB 2V4JB 3GFZA 3QEXA 3DRXA 4K4SA 3NGYA 2YX8A 1QTMA 3CNHA 2YKNB 2ZH5A 4MDBA 4M8LA 4U67Q 4GW6A 3PV8A 5BRHA 3A13A 2YKPA 1N0UA 4Y0WA 1MA9B 4LH4A 2MAXA 1SKUB 1X9SA 1U2VA 2VU5A 3GFXA 4FZNA 4B3MJ 4CF4A 2V4JA 4JRPA 4LF2A 4C0BA 3F2CA 3KHHA 2CWXA 4CF2A 4YMOA 1WC4A 1QAXA 3KVGA 1D8YA 3ZSOA 2Q3PA 4MKYA 1VJQA 3V81B 2D0PA 2OA8A 2ISPA 1M1KO 3M1VA 2ZIVA 1R0BG 2DFHA 2HK2A 4L6V3 4DUTA 4NYFA 4MFBA 2MKCA 1ZQNA 2R2TA 1RT3A 3N6LA 4DV5F 1DARA 4BRKA 1CLQA 3NASA 2DHAA 4IKFA 2J0XA 1KFDA 3FSYA 3GIKA 1KWMA 4PPZA 2HW3A 3G2XA 2PMZC 2CNKB 4QOZB 2MZJA 4M3TA 1TU0B 4CZEA 2YQEA 2HAIA 2ILYA 1S22A 3H1VX 3MFIA 4CO3A 1VQ8S 1VSFA 1T03A 2KKVA 3FCHA 3CJCA 1NH7A 1ZQHA 2QW9A 2R18A 2XCAA 2ISOA 5AQSA 1VDHA 1JK9B 4CBUA 5E3PA 1RBLA 2G07A 2EKYA 1FFWB 3GOIA 2QL7B 3KUEA 3QEBZ 1XIQA 4HHJA 3KYLA 1M5PC 2VC1A 5IFMA 2M5YA 2HRYA 3W2WB 1LWXA 5CE3A 2QA2A 1Q16B 3HO1A 2YN4A 5EDWA 4PHPA 4LF4F 2KT3A 3QNOA 2XEXA 2J0SD 4DUZF 5KFEA 2MJUA 3CXCM 4ECSA 4YORA 2B5JA 4CLTA 2GBZA 1OPZA 4F3QA 4MLHA 4CFAA 4OJLA 4TY9A 4W4MA 3TR8A 1ROFA 1E4GT 3PRBA 4TQRA 4Q8FA 2Z1IA 2NSBA 4CHPA 3HD2A 4JV5K 3BEGB 5IZHA 1LXJA 1IBKJ 4WP8A 2X3DA 2G2YA 1KVIA 2LYHA 2VA2A 2CQCA 4NLRA 4LH5A 4IC9A 1U1QA 1LKYA 4C8YA 3ZZZA 3VEVA 3WK4A 8ICJA 2E5HA 3K9JA 1HNVB 2EC2A 4R8UA 3I4HX 2GIQA 3AUOA 2V2KA 1FJGJ 3GU3A 4B3OA 3EVWA 4BR9A 4DV6J 1FFGB 2EH9A 2HMPA 3R2CJ 1RT7A 1CZAN 3O3GA 2NSCA 1K9MT 3GG4A 4JV0A 3D2FA 4USHA 5DDRC 4IWVA 2HNDA 5KFHA 2FJVA 1HD0A 2DIUA 2A6MA 4IFYA 1X7VA 1CZBA 4BRPA 4H4KC 4AE5A 3K9KA 1J5EK 2VFSA 3IM1A 4DV2K 4FLVA 3H0LB 2ROPA 2EFOA 2ZJAA 3HHKA 1NMEB 1XR5A 1V38A 3L0QA 4ES3A 3PEHA 2KQ2A 3V9ZA 5KL1B 1WACA 5DQHA 4H5RA 1EKRA 2QV6A 3I8BA 3AO3A 3D0PA 2FVQA 3CCQS 4FJHA 4DR5K 4Y1CA 1WELA 5HSPA 2D1KA 1UPMB 5AQXA 3LPEA 4AYBD 3BBCA 2CWKA 1TVRB 5E79U 1NGCA 3QICA 2J7UA 2RHFA 4DZ6A 2XMMA 1HWUA 4PL8A 2RUGA 4JOUA 2ZNZA 2G06A 2MKJA 3C19A 3RMBA 5DG9A 4R65A 2AJ2A 3O2IA 5D4NA 3MEEA 2MKIA 3CUNA 4FPAA 4KMUA 3BUZB 3QESA 8ICEA 5IT9O 1QD1A 2BV3A 2PYLA 2EBGA 5J2PA 4LFCK 3R5BA 1FHTA 4Z4HA 3RAMA 4HCBA 3EPGA 4EBCA 2F1FA 3GV8B 1U7LA 3S6JA 3EMTA 2W43A 4DV6K 3G6VA 5M1OA 2GC8A 2MZQA 3B54A 3A8JA 1NOZA 3J7Z5 1Z00A 3EZ5A 3ZEUA 3VVUA 3NFAA 4DPOA 3QMQA 5FRMA 2RHSB 1H98A 3Q24A 1NH8A 2AYEA 3M30B 3KWIA 3NBPA 3OVNA 1YBAA 4DI6A 1NO8A 1OVQA 3T79A 4NLQA 5B0EA 4KQZA 2PBDA 1CRXA 4ZIWA 4QS7A 2GWKA 4GXIA 2Y8YA 4NPOA 4JKCA 3NVKA 2CQIA 2XY7A 1GOCA 3PW0A 4I6MB 3UCUP 4XDDA 3NGUA 3EUNA 3ID6A 3QNWB 1S9EB 1CJKA 1Y10A 1IJJA 4B1YB 4G9ZA 4ANDA 1RTHB 1XMQF 2OH2A 1FRJA 1S1VB 2RKIA 3H2LA 4GRSA 3NH2A 4HDHA 3IG1A 3E58A 1WEYA 3UQ0A 1I51B 3CD6N 1HNZF 2F8MA 3G6XA 5LOQA 1HBMA 2P5VA 3POTA 4QW9A 1NSKL 1L7PA 4RQ5A 3W2VA 3D6HB 3LQVA 1NUEA 2KI2A 1GXUA 1RBOB 3CI5A 2YWKA 2Z2MA 2GVDB 2BW2A 3TFSA 3TAGA 4BG9A 1NJIT 2XMTA 2HZCA 2GUIA 1CBKA 3ULEB 3S8SA 4QZFA 4I2AA 1BHNA 4JI4F 4L3NA 1BCOA 1VQON 3VCBA 1UPHA 3M7DA 3HHEA 3N5BA 5DQIA 3O1LA 1YJWS 3JAMO 1S10A 1L5UA 3CM5A 1KQSR 3TEHB 3O4WA 1ZBUA 4M5IA 1BOTO 5JS2A 4ZTFA 3JPRA 2A1RA 2OZSA 1XNRK 2FZCB 3IHQB 1H6KX 2DK2A 3T9ZA 4RT3A 2E9RX 4DSFA 5B0CA 1JJHA 1IBMJ 1LWEA 4AILC 4P0QB 3KHRA 2E1CA 3IC1A 1X5OA 3VF0B 1FKOA 2NO4A 2X74A 2B5JB 1VQMN 1NK8A 2YNIA 3CMES 3AY9A 3MMVA 5GAHI 4B1WB 3OYAA 4OJHA 3C94A 2DCUB 3TZZA 5DO2A 3J7AN 4DQRA 4I1TA 5ALJA 5IIJA 3L8BA 5K14B 3KLHA 3JAMU 1X1PA 4ZLPA 3G10A 3IGNA 5ALDA 4NE9C 2C1EB 2HSTA 1U1LA 3TX8A 4OD0A 5D4PA 3ISDA 1KN6A 2H48B 2Q4TA 4CLFA 2GV1A 4CQ1A 1CUKA 2OGUA 4WK3A 4CJUA 2BM1A 4YY3K 2F3NA 3BYPA 3L2QA 2WVBA 4YEAA 5RUBA 4GVBB 3UPFA 3DLRA 2G8UA 4UOHA 5J2NA 3NMRA 2UUBK 3IGVA 4NRTA 4F91B 2VGMA 1YG0A 4I2PA 1PZNA 3T3FA 2L48A 2HNZA 4Y65A 5HAOA 1S97A 5F8HA 3H5XA 1WWVA 4J2BA 4UAUA 1WSRA 2QIFA 1NKBA 4DOBA 2ZKTA 5HHHA 8ICBA 2OTLS 5EY4A 3D28A 1YJRA 1YK9A 2YWHA 1CJVB 4WP9A 5F1XA 2RJZA 4A8FA 2P9UA 3AO2A 3I6PA 2K3KA 4CGFA 1V4TA 4ZH4A 3IWNC 3GR0A 2ZBPA 1NCLA 3HI9A 4G9BA 2X6NA 4PL2A 2HQIA 3TSUA 1B92A 4I2FA 3VGKA 3SI6A 5CYJA 1RDBA 4JKGA 4I28A 1D1UA 5AQKA 1GTHA 1JNRB 3MMAA 2G4BA 4EBDA 3JS6A 4KC5A 2F1JA 4C80A 1PC5A 1S6QB 2CJ9A 3ZETA 5K5MA 2CJBA 1RT6A 3UD4P 1RILA 1ZTWA 3H90A 5LMUK 3VTHA 3LM2A 3T1HK 1URNA 5KFNA 2BTFA 3THYB 4AHCA 3CMAN 5T7BA 2WB1C 1N36K 1BI4B 4ENOA 2V7ZA 2UV8G 3T41A 2EVZA 4RNNA 2P5GA 3MC1A 1JL2A 1HJOA 3K7RA 3DLEA 3MMCB 4BRIA 3AAWB 3JTNA 3WNGA 4CFDA 3LZIA 3HJEA 4RQ0A 5HMMA 4PWDA 3VF6A 3TVKA 3C2LA 4M9LA 1CSJA 2K1RA 7FDRA 1B22A 2BJ3A 2YMMA 3W7BA 2YY3A 4KV8A 1VHXA 2RPIA 3IBFB 3ZYYX 2BYCA 3MEGA 4NYPA 3G82A 4BCAA 2HI0A 4J9VA 5ALSA 1OPIA 2RT3A 5GADU 1HKBA 2UXBK 3D0GE 5DB6A 2KT2A 3FLCO 4DSKA 3R5JB 4DV2F 4BG8A 2X7IA 2EI5A 2G0IA 1U24A 2DEJA 5D4OA 5A6WA 4C7ZA 4KH1B 2P9NB 1I39A 5LJ3Y 4L73A 3ETMA 5D0EA 1NZAA 3UR3C 4RW8B 4PABA 3QYYA 2XWXA 4UB2A 1X40A 1C1BB 1OSCA 1VGYA 4ZOSA 4YDUA 3B4MA 4KH0B 1WSEA 5AJ3K 2YVSA 1F0XA 2EFQA 4M9HA 2E8MA 2R7VA 4NLYA 3L2WA 1Z1BA 5ALYA 4OQJA 4PL7A 3HDSA 4LIRA 3I82A 4PWWA 1Z19A 2KJ8A 1J9AA 3FRZA 1QHTA 3F2DA 1YF5L 4QIVA 3FZBA 2HWTA 1VBYA 4RNFA 3M9OB 4A8EA 2ZUAA 3P4IA 3CCWA 2DQNB 2B9EA 1Q81O 4Y34A 4CGZA 3AOBA 3OBIA 3GZFA 5AQHA 1DK3A 4NEYA 2XY8A 2Y0SC 3F9MA 3AVMA 3KOOA 3EY1A 5B7WA 3BGRB 4IDHA 2B0CA 2BDPA 5CABA 5J2BA 2XSJA 1FXXA 2QTDA 2W9CA 2C22A 2RQMA 1U6ZA 7AT1B 2UVWA 3V9XA 4EP4A 5C12A 1UA1A 1TUUA 3AN1A 1N62A 4X64K 4H4MB 4K4ZA 2EQYA 1REVA 1S5ZA 2ZXHA 1ZPVA 1YJUA 8ICYA 4M63A 5KG4A 2VC0A 4FM0A 3NVYA 4LJMA 3RJJA 3VAJA 4OYIA 3TAMA 3GONA 4EZ6A 3KLGB 4WCEQ 4EMDA 1RTIA 2E1EA 2H5IB 1GLFO 1HPZB 3BBFA 1V3RA 4M47A 3W5XA 1ZBLA 4I29A 4AQYJ 3DOLB 5JRTA 2QTWA 3D7EO 3KLIA 1CPZA 5KPRA 4GFJA 4LR9A 2EZYA 2OP5A 3JAMY 2B51A 3UKRA 5CCMA 4Y2XA 1G6BA 6FD1A 4LSNB 3GB0A 3IR6B 2ZH7A 3JB9k 5J1EB 3NKYA 1M90T 1P90A 2GLEA 1AXQA 3E0FA 3MX5A 3EWGA 3SQ2A 4EX6A 1RT6B 1ZQFA 4M5JA 4XTTA 4F50A 4M3UA 2QEXS 1X5TA 4PQUA 5DMRA 4KHYA 2HIYA 4BUGA 3P4UB 2UUBJ 1RNHA 3ZXWA 3D6MB 4ES1A 1IM6A 2OHDA 1Q9YA 1XSNA 5EOZA 4LFBJ 4GV9A 5HLFA 3LDPA 3UB5A 4C98A 5B66U 2HGNA 4FYYB 3AQEA 1D9AA 4O0JA 1TL7B 2IOFK 1WHYA 3DLKA 2H4WB 1IBLF 1BQNB 8ICQA 2ITMA 1BA0A 4H4MA 2ZGYA 1T3NA 4B9LA 3SPZA 3EGNA 2ITGA 3CJ5A 4DTNA 5TZVA 2PT0A 4IDKB 1M1HA 3TARA 3KG4A 2AEFA 4BGBA 2FJWA 1TK5A 3M32B 4EYHB 4HHUA 1B4SA 4E8UA 3U9ZA 2YXLA 5KT5A 1IV0A 1Y11A 1S0VA 5CYQB 2LEAA 2QA4S 5HP1A 4QIWC 2KHDA 2HQ3A 3DRRB 1M5KC 2RNEA 2OPPA 4ILJA 2LQBA 5AKZA 3OXGA 1W97L 3NNCA 3M8PA 1TE2A 1ZQDA 1L8LA 1I94K 5D15A 4DR2K 3B8AX 5GINA 3MDAA 5DGAA 1DHMA 2VICA 4UY85 2QXLA 2YPYA 5JICA 1HNWF 3M1YA 1YLXA 1VQNN 1S12A 2CJYB 1CC7A 1B9FA 4XPEA 4UW2A 2FDRA 2VJUA 1WBBA 3DNCA 2V68A 1NM1A 5KAIU 1LXNA 2JEGA 5BYSA 2Z30B 3A8EA 2GX8A 3IAS9 3VEZA 3U6FA 2XZDB 2HRTA 1WN7A 1CJVA 1W2BM 1Y97A 5KI6A 2DFEA 2F77X 1HUOA 1UWBA 3VQQA 2E9ZA 3ZSVA 2E8PA 4O3NA 1BQMA 3WEEA 7ICPA 1EETA 3S3OA 1WLJA 8ICSA 1NNEA 2WB1D 8ICFA 1UETA 4IG0A 4JI5F 3KKRA 1Y7PA 1BISA 2ZH1A 4ZP9A 3NVVA 1T05B 3HBTA 1ZQTA 3OR1A 1IBMF 5AQQA 4KLMA 2AJFE 3C46A 3M8WA 2GJ2A 5AQFA 1VQ6N 2Y1IA 2MLZA 3U8XA 9ICMA 1B0VA 2NXCA 4EIAA 3TZWA 1VQ9S 2LA6A 3RGIA 4I6WA 3TX0A 2Z1HA 3LYSA 2MZSA 2O8BA 2W4CA 5ETTA 2FMPA 1HEKA 2QWNA 3W9HA 3E01A 3HP9A 3Q7CA 1MNEA 2O8EA 2YHAA 1L7NA 4PPXA 3RU0A 3AVHA 2EBEA 4OI3A 1FRIA 5D0GA 2OPQA 3BBBA 4QZVB 4I2BA 2G13A 4IG3A 2DR5A 4QZBA 4X84A 3FUYA 4KO0A 5AKJA 3BKTA 2W2OP 2P1JA 2DEIA 4FWKA 2LDIA 1NB2A 4DQ8A 5J2KA 2WVDA 3FMWA 1NBWA 4H4OA 3PRDA 5GMEA 3KZXA 3IG1B 2NPIA 2NRHA 4OLBA 4QJFB 3HWTA 1EARA 2AGOA 5D49A 5KG2A 4U6PA 4ANEA 4K7QA 2EFVA 3KKFA 4AFFA 3IMXA 1N48A 2GVZA 5HO4A 4NEZA 4FJ5A 4DUYJ 1D8LA 3EZUA 2CG4A 3GJSB 1MROB 2QG9B 3KJNB 1E6YB 3VEOA 4KLUA 2X1BA 3QXGA 1NBEB 1SI9A 3CJ7A 1MLAA 2AJ0A 2RP5A 5L1JA 2BQRA 1JX4A 3O8MA 5KFZA 3MMBA 4LY7A 4K5RA 1RDAA 5GAEP 4YMNA 2VPYB 4C48A 3ISBA 2M0GB 3HHLB 2GVZB 4LVOP 3ZZTA 5HLFB 2R8GA 4YXJA 3QSIA 3R7NB 4N5SA 1HX1A 3AY0A 1K1QA 4EHUA 2BACA 2FVSA 1GO3F 2WF7A 3ALYA 3C6AA 4K8ZA 1BQMB 4B9UA 2FYXA 3CC4S 5I3UA 8ICZA 1XJWB 7ICMA 2V63A 2FPMA 3I0RA 3SQIA 1PILA 1NK0A 3GLJA 2HVHA 2XZTB 3QJJA 4HTLA 5AQTA 2C2EA 4FZYA 3VF4A 3QGIA 2QKKA 4GKKF 2PKEA 1N5TA 2DB1A 2R8IA 1RAGB 2HBLA 1YKWA 1HLUA 1J5OA 3SCKE 5EX5A 3CCEN 3FYHA 1KFSA 1HQ2A 4KLJA 4BR4A 3CCSS 3M5RA 1PYTA 4PGXA 4B1ZA 4A8MP 4KHNA 2W2NP 4WQ4A 3QZ8A 2LU1A 2IAJB 4B1UB 5I3UB 3BN4A 3SUNA 4ELVA 4CD3A 4DN0A 4C8MA 4LQ3A 1XMOF 1SKWA 1FX4A 1BC6A 5H9EJ 1WC1A 2NXEA 4JI2F 2KKPA 3RRKA 4K50A 1T05A 3OYIA 2LMIA 4ECRA 1UVIA 1R43A 2V7YA 1JLAA 4CO2A 1HJRA 2QMUB 2HGMA 1AROP 4XAKA 3F73A 1H0HB 2LI6A 3CPWR 2PYJA 3B6BA 3UKUA 2Y9TA 2IMOA 3K5PA 4EO6A 5J2GA 1DAXA 2H54B 1RT7B 4RUAA 4DR4K 4RNHA 4CEOA 1ZJMA 1UFLA 2QXFA 2Q6CA 3VGUA 3L3FX 3HVAA 2V6AA 4GIBA 5HMLA 2AH5A 1JKHB 5LJWA 4YQWA 5B8HA 1UT5A 1S76D 3RMDA 5AJ3F 4O5CA 1WKKA 9ATCB 4JI1J 3A0HU 4A48A 3BGLA 3SQ0A 2GIFA 2KZMA 1E6VA 2OPRB 2HGLA 5BOMA 3G4SN 1N60A 2IS3A 2L3MA 3SSRA 1RWOB 3EO3A 4F4XA 2HBJA 2V9KA 2QSWA 2KVCA 2E5JA 4CI6A 2FTRA 1X5PA 4YHHF 2OSQA 2I6XA 3KTQA 1HI8A 1R6YA 3C14B 4IQTA 4EZ9A 9ICOA 3UCZP 4TQSA 2ZIUB 1L6NA 2CDQA 3I31A 1ZQ1C 1SS6A 3ILJA 4US8A 3ZSQA 3MPVA 3QIDA 1XS9D 1YIJN 1KRPA 2QYCA 5BPLA 1Q79A 3U26A 4HH0A 5AQMA 3AXMA 3NAHA 3M1FA 2HK3A 2M4MA 2AQ0A 5BYRA 2GQQA 2DR6A 2HZVA 1ZBSA 1ITGA 4X4RA 3TRGA 3KK2B 4LRBA 4YMMA 3J81j 4B9SA 4NLXA 2CPRA 3BSOA 4FXDA 2MSTA 2E1ZA 4O3PA 2D3DA 1ZBHA 3MZIA 4QZHA 1RG6A 1TL1B 4ZK7M 1S79A 2KKHA 1S9FA 3BSAA 1IBKK 5AZIB 1FDBA 1WAFA 2CRXA 1A5WA 4C8OA 4YB5A 3VV2B 3NBPB 3HZ6A 3T1HF 4AYBC 5M1PA 1VOMA 3JS9A 4UBCA 5DM7L 1GAOA 5KFIA 2FHOB 4K4XA 4O8KA 3BGFA 1UVJA 2ZZMA 3RAQA 4A2BA 2CKWA 3UM9A 2V2QA 3BQ7A 3HP6A 3BF4A 3SQGA 5F8LA 4Y2TA 1KQQA 3PJWA 3SI8A 3KLEA 1UEKA 4F02A 3WQTA 1MMNA 4KFBA 1FE0A 3OYEA 4YDUC 3W2WA 3M6VA 4YMEA 3JPNA 2JC0A 3O9RA 1B4FA 2XM3A 4DQQA 5EE0A 4Q8EA 2MDAA 4BX9C 2P6RA 1A6LA 3OL6A 1EJ7L 2RRBA 3AVNA 4YCXA 3WNHA 4V19S 2R4FA 1SV5B 2F9DA 3F9KA 2CQ3A 2M7SA 2D0AA 4PEOA 3ISNC 1I3AA 3FSIA 4X5VA 4CTAA 4F5OA 3CPEA 3M8PB 3IFRA 4A8YA 5LM7E 4NRUA 3KUHA 1U26A 4U7BA 3BP8A 3NAIA 5DM7Q 3SEOA 3B0YA 1G4CA 4TU8A 1VQNS 2W7OA 3H20A 2VPWB 1U1RA 4NCAA 4M5KA 4I2PB 1HLWA 4CEFA 2M0NA 1U0SA 4IO9Q 3BH6B 4DV3K 2ASYA 3PLAA 2ZHAA 3HYFA 3CJQA 1OY8A 1YI2S 1SUQB 4G1IA 3G82B 3HSGA 3OBWA 4PPDA 4B3OB 3EN9A 2KZZA 8ICKA 3MR5A 4DLEA 3CO0P 5IOLA 3EWAA 1FRHA 4CLWA 4NLVA 4JI7F 4DBQA 4HHTA 4Y2MA 1NK7A 1VK8A 4XH5A 2VANA 1EXQA 5ALZA 4OHVA 1SJRA 2MEWA 1TL7A 4Y6IA 3CXCR 1H1VA 3LP3A 3CCSN 5EUHA 4NXMJ 3J8AA 2HNYB 5C10A 3KLHB 4N47A 4KE5A 5K14A 3CQXA 1F5AA 2CVIA 2ALZA 4QPTA 4ED7A 1RWWB 2POKA 2V50A 2DXFA 2B9YA 4O3RA 1WCNA 3C16B 2M9KA 4CLSA 2FLLA 3GR1A 2DWQA 1YRXA 2MRLA 2DPIA 4DFMA 3RFAA 4BE1A 3SEIA 5AFUA 5G5HA 3UDCA 3KHLA 4RQ8A 1LWEB 3TU5A 2LEBA 4H0TB 4L3QA 3Q86A 1OH7A 3W1YC 2PAVA 2G5HB 4JKGB 4ECYA 2ZH6A 3THWB 2AXTU 2OYQA 1RTIB 5DJBA 1VSLA 1TK8A 3ZZRA 2GGPA 4ANCA 2K1RB 1KAZA 4AHUA 5G4DA 4MYTA 2GNKA 2E5SA 2OLWA 2CGLA 2JXJA 4FOEA 4DTJA 2D7SA 3DLEB 2HMXA 3MMCA 3SQOP 5TKYA 1QZ5A 2JJ4D 4CRXA 3N7RC 5ALKA 1VRUA 3MM9A 3QATA 4DPTA 2EZXA 2JH7A 4LT6A 4PQAA 3OJUA 4K0KK 1N8RT 1YVNA 2XSJB 3BN7A 4KR0B 3LWMA 1U09A 4GVBA 4DV0J 2ZG6A 9ICNA 4ECTA 5CZ2A 3OTEA 3QT5A 4D3HA 4CW7B 1IKXB 2YNHA 2HHVA 2YKQA 5HRSA 3LGNA 3DOKA 3I8DA 1BVSA 5IM0B 1UJ4A 4FNIA 1UAWA 4KBOA 5HHIA 5F8GA 2GO8A 3GMGA 2A0FB 3PEJA 1FNMA 4WFNL 2CYYA 1VQLN 4LF8F 5B5EU 1LW0B 3TUJC 4WF9L 2VQEK 5HMZA 1GEHA 4UF4A 8ATCB 4P4PA 3NL0A 3E9PA 1L3VA 3KJFB 3OVAA 3QE9Y 1HWLA 4DR5J 2HFSA 1YJ7A 2IM1A 2KJWA 1HNZK 5D46A 3SV4A 1PK3A 3SCXA 2HQFA 4CJKA 2AP1A 1T02A 4K41A 1NK6A 3S41A 1MWZA 1S1TB 3H0RB 3TAQA 3DI6B 2Y1JA 2I1QA 3NCQA 3H40A 1VC6A 4CEZA 1YI2N 4OJPA 3HHLA 3VQEA 4QW8A 4FFDA 2ASPA 2IY5B 5J2PB 4JK9A 4O3QA 3D0IE 3US5A 3DXBA 3P5TL 1WORA 3NGDA 4CZCA 2R7YA 1K8AO 1KR4A 4EFAC 4CGGA 3R1HA 1EQYA 2ZC3A 3VQ8A 3HVTB 3O9UA 3EXYA 1Y88A 2O6KA 3QUTA 3BYRA 5AKEA 1X5SA 2MY7A 4DF8A 2V94A 4TU9A 4IOCL 1UJ6A 2DY4A 5ETSA 7ICFA 3ZDDA 5F3XB 4JYAJ 1XHXA 2DNPA 1WEZA 5AK4A 4WKYA 4FOIA 3G4SS 1NJYA 3J80O 5HMWA 4A2AA 3UPQA 2KSOB 4USVA 1GLJO 2QWOA 2HHTA 1RABB 2FMSA 4KGMA 5GAGP 4I9LA 4BBYA 3TADC 1NDKA 5JLFA 1X3MA 4YD1A 1U1PA 2BQUA 1YJ9N 1ZQCA 1FWPA 1C2PA 2I5JA 3Q7BA 4JKAA 2QA4G 3TABA 5AE2A 2MXYA 2W01A 4PG4A 4BRNA 3N5FA 1GX5A 3W66A 2BE7D 3AVJA 1SJ1A 2AIRB 2FQQB 1MN7A 3R6MA 3IRXB 2BPGA 4CH0S 3V7LA 1CJTA 4OYMA 3BQ2A 4RW7A 9ICAA 3NXZA 2MQPA 4CCHA 1HJPA 4CLLA 1RTHA 2H5EA 4CYUA 4J03A 3NCPA 2ZJRQ 3OW2M 4F3OA 2RSQA 2GO9A 2O8EB 1OKJA 3ZTSA 4P7VA 1FX2A 2WF9A 3MMBB 4M5HA 2V4RA 1BG3A 2FSNA 5M1KA 4CF5A 5HI7A 4RO0A 4ED2A 2HHSA 1TKTB 1DXSA 3QFHA 4EU0A 1Y0HA 3P39A 2KG5A 5KFWA 3CIPA 4DV4J 2J6TA 1U1NA 1E6YA 4O23A 4TYAA 3BS9A 3PSTA 4PL1A 3D4JA 1MROA 4NLCA 3OYJA 1ZTTA 3PSPA 1T9UA 3DXMB 2XS5A 1C4AA 2WCXA 2VKQA 3MPWA 2QKBA 1YITS 2WF5A 3QNNA 4NCBA 1IKYB 2P9PA 4J2AA 1HW8A 3Q0AA 2F9JA 1TMJA 2VG6B 1H38A 2D8CA 1HBOB 2DGZA 3UFCX 2VFTA 2DO4A 2OMOA 1SWVA 1U6FA 3W65A 4PGQA 4R79A 5ETOA 3O6WA 3UMBA 2JDJA 3TJAA 2OPQB 3Q8LA 3EYZA 1IG6A 2IJRA 3A3NB 2O66A 3R3TA 1BPDA 2M8DB 3DC2A 5F8MA 3TUZC 1IVZA 3WHIA 2B6AA 3O4QA 1X8DA 5BOLA 3FZHA 3V7KA 3MCNA 3P45B 1NRKA 3AVGA 4Z6DA 1FD2A 3CJ3A 4CO0A 3GJRB 1GMWD 2YMPA 4H8KA 2AGQA 2V5HG 4FLTA 1FA0A 4UOCA 4KHSA 4HVJA 3ZDBA 2VWJA 5JVHQ 3I32A 2P35A 4G65A 2ACMA 1Q7YT 2RQ5A 2CXYA 4JWNA 1YVUA 1UQVA 4DL6A 2KG1A 1C0FA 3MPDA 7ICHA 1Y5IB 3SSQA 2HNDB 1JJ2R 4M3XA 4IQXA 5E26A 1T11A 2L9DA 4E3SA 2MYFA 2X3GA 2FIUA 1N5WA 2PMZF 4O3SA 3WEEB 3MURP 3QUQA 4Z4FA 2IIHA 2BCRA 4MK7A 2FBTA 5FPNA 4PXDA 1TV9A 2O8DB 1QCKA 2MMYA 2C2NA 3A0IX 4F7VA 1F6TA 4AH9A 4FWQA 1ZOLA 3LP1B 1ED1A 1ITPA 1UL3A 1SQFA 4JNEA 3RTVA 3MM6A 2UXDF 3KD1E 1GLAG 1CI4A 1TVRA 3OSPA 1JJCB 1RB0A 3C65A 2HS3A 5KG7A 9ICLA 2AYMA 4FJ9A 3H25A 3ENOA 5ETMA 2E7VA 4O5BA 2R7RA 5ETNA 4ZVQB 3W8PA 1YTAA 1CJTB 1O51A 2E5LF 4TURA 2CZ4A 1R8AA 3FZKA 2PA8D 1CULA 4LRCA 3QEIA 1RJJA 1NGIA 3BZKA 2OPSA 2YTCA 4DB3A 3EEQA 4DMZA 1VSKA 4MO4A 2E2NA 4E1MA 2FHMA 1NZPA 3TNVA 2BUNA 3H0PA 3IAM9 1UA0A 1CQMA 1X2IA 1IQTA 1WTFA 2XTJP 4ILRA 3M32A 5B0BA 4IG3B 2QARA 3KLIB 2HEKA 3L2UA 1UWAA 3TJ8A 2YNFA 4GXKA 5LT5A 2COLA 3TAFA 3MECB 4OZNA 4WU2A 4DDFA 1FKAF 2E8NA 1WWHA 3KHGA 1VSJA 2ZDPA 1RT4B 3MGVA 4ATNA 1U02A 2CQHA 5IC4B 1S72N 2D5RA 2F7TA 4XRHA 2WVCA 4AT1B 3DU6A 4O4RA 2AKWB 3THTA 3NVWA 2PFFB 1QH9A 2HMIB 1WHWA 4H4KA 5DETA 4CLKA 5EU7A 4A8KA 1XMOK 5LXRA 1NHKL 5FD1A 3MR6A 2QLBB 5JUMA 4N76A 3LP0B 4NXMF 5KL8B 5G5GA 5ELZA 4JRQA 2WF6A 1FTCA 5B0FA 4PHTX 2ATQA 4TXSA 1S1TA 2KOBA 3AGKA 2XHBA 1MQ2A 4KREA 3CDWA 1ZM3A 1QQCA 3H4DA 3KDOA 2JLEA 1AQ6A 3OD2A 1PO6A 1BCMA 3LPUA 3MK6A 1Q82O 1KSPA 1FJCA 2D41A 2ZH2A 1ZETA 5BN9A 3JQKA 1OH6A 5AI5A 3AVAA 2WVEA 4IEEA 2HVEA 5KG3A 1Z25A 3WUHA 2LU2A 2YNGB 1FNOA 4ZP7A 3GV7B 2C42A 4WF9Q 4CJRA 1N34F 2V51B 3AMZA 1QS4A 3FBEA 3QPIA 5E41A 1PYSB 3ATUA 3CG7A 2Z2LA 4X66J 3QEWA 2LFVA 3K2PA 3KD3A 2M2BA 3W5ZA 3OYLA 3NVZA 1MG7A 3HHNB 1XR6A 3SQ1A 2NRTA 5DBAA 5KT4A 4BE2A 3ET6B 1N61A 2W8KA 1S4FA 1Z4UA 4Y28C 1YTUA 4AF1A 3QRQA 3PZPA 4E7LA 1V85A 4OV6A 4ZP6A 3RH4A 5DDPC 1OQ6A 3QUBA 4NLNA 1J2MA 2PMWA 2NS1B 2C2RA 3VC8A 4MKVA 3MWTA 1YRTA 1JN3A 1RSCA 1MU2A 1LVHA 4E7IA 2ZIWA 4CO5A 3DLBA 4ZVPB 2A6OA 1NG9A 3B82A 2ZIVB 1WB9A 3VQPA 1LNQA 1ATNA 1ESVA 4LFCJ 1JCEA 3C6TB 1M5HA 7ICTA 1SC3B 4ZVFA 1RXOB 1KCFA 3MABA 2MGZB 3THXA 2VBXA 3V6KA 2E1AA 5LSRA 2WHOA 4KMOB 3HT3A 3C29A 3VCDA 5KOXA 2CJQA 4M94A 1B0TA 3ORYA 2M70A 1DRZA 2LXIA 3TKAA 1EX4A 2B8PA 4W5TA 3IM8A 3KKAC 3MEKA 3D2WA 3P49B 3LP2A 3EM1A 3THWA 5AI0A 3FZMA 4WFYA 1C0TA 3UDEA 2DH8A 1UZDA 2FI1A 3G9CA 2KG0A 4AL6A 3M8QA 1WSVA 3KFWX 3VESA 3O5BA 2KHOA 1RHJB 4EHTA 3PUFA 4KFBB 2G1HA 4KPCA 1E3MA 4NOHA 4I7FB 2P8IA 2V2VA 1QAIA 3OTBA 1T9XA 1FFVA 4M42A 1G2EA 1KQSM 3NGIA 3IG8A 2BRKA 3R97A 1QUVA 2QL9B 4BHQA 4DSLA 4JI7K 3M8QB 4OHXA 4FK4A 5KG5A 3R3LA 3GCXP 5AK6A 1NOMA 3Q2TC 4USAA 3T7ZA 1OJ4A 5DQGA 4B8CA 3C1YA 1X4BA 3UO0A 1RAOA 3IM9A 2AQ4A 5A76A 2YHBA 4DPXA 3VTIA 1TUYA 4J7CA 3BF3A 2KXNB 3KLFA 4MHVA 3T5HA 1IH7A 2LP4A 3DHWC 3R6LB 4F2SA 4LZDA 3PRVA 3PJXA 2DY1A 1RQLA 2BPCA 3OL8A 2HB5A 2CQ4A 2ZHOA 3CJBA 4ZPDA 2NLWA 3NRBA 3CCUN 3ZDEA 3MM7A 2FVPA 1P8GA 2CFXA 1RTJA 4KHQA 1WC3A 4CT9A 1ZD4A 1B64A 3VOVA 4UATA 2ATCB 4HTJA 3CCRS 1JLEB 5EE9A 2HSEB 1G7CB 4KKOA 3OHAA 5IIOA 2B4VA 4CZJA 3OS2A 1ZRNA 5K8PA 2B4JA 3FR0A 4C1NK 3CRXA 1TL4A 2CGKA 2DR7A 2P6TA 2FSJA 2IMWP 3HCXA 2UXBJ 2ZIUA 1HNWK 4FF1A 1EQMA 1BA1A 3C14A 1SB6A 2YX7A 2QRRA 4O4GA 1N6QB 2UV8A 3FFIB 2NR0A 4PKIA 3ZD8A 4GKJJ 1S1XB 4GC6A 3OSNA 2IVPA 4X4VA 2VQFF 4C0HA 1YIJS 3QFWA 1RDFA 2D1CA 4M7YA 1UVKA 2KJ5A 1ZQQA 3SR6A 1IKWB 4DR3F 1ZQZA 1AZSB 3EW9A 3D3CJ 1VISA 1NGFA 1QY7A 4TYBA 1KN5A 4BQZA 2DHGA 2P51A 2CADA 4AHRA 5BPCA 2W7AA 3ENBA 4DR3K 5D3GA 2HFNA 1X4AA 2ZEJA 3NY0A 2DGOA 4JP8A 2J9DE 2R7QA 2VQFK 4YR0A 1AYEA 1OVYA 5CY4A 3CJSA 3VGVA 1N5YB 1CQNA 4WQ5A 3VQ7A 1RT1B 3GZ7A 4CJSA 1F5SA 1ZQRA 4Z6EA 4PYAA 2VKZG 3IN5A 2BM0A 4AUKA 2RDIA 5E3QA 4OI1A 4RG8A 1RAJA 1X4CA 2DGVA 3IDWA 5AQZA 1K8KB 4GY2B 4OJ5A 3CTRA 3MXHP 2P9SB 1S5JA 4BRHA 3MAHA 3QNMA 1Z4OA 2L9NA 3UE2A 2E1RA 4U67L 3WQPA 2UZAA 4DEZA 2HOFA 2I38A 2R9LA 3NGZA 2IC3A 3CCMS 4O9MA 2H3FA 3D1QA 3KK2A 1OIAA 3G6YA 1RADB 2GHPA 1XEZA 2M8HA 1DGJA 4MMOA 3RG6A 5L38A 2EAPA 3L2VA 4CE9A 4LFCF 5HR7A 3R5GA 2KHQA 2RQCA 4NI2B 3KG1A 1JL1A 1F3FA 2GS8A 2QI2A 2Y9UA 2PFOA 2AJ1A 1GXLA 3F41A 1NLVA 4RQ3A 4IOAQ 3OLBA 1KOOA 2W8LA 5C42B 3OS1A 4FJKA 4M6WB 1N88A 4Q0BB 1IIPA 1WKLA 4USKA 3VQ9A 3C1ZA 2QA1A 3DXKA 2DRD<