2G5IB

Structure of trna-dependent amidotransferase gatcab complexed with adp-alf4
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
410
structure length
410
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 120
structure length 410
sequence length 410
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5iB02
3H0LB 3AL0B 4WJ3B 3KFUF 3H0MB 2DQNB 2G5HB 1ZQ1C 2D6FC 2F2AB 3H0RB 2DF4B 2G5IB 3IP4B
chains in the Genus database with same CATH superfamily
2C28A 1IG6A 1MQ2A 2W8LA 9ICCA 1UA0A 3UM9A 3N7PD 1J2NA 1LVHA 3H8WA 4Y2XA 5FP0A 4Q44A 3KKAA 1L3VA 5J2FA 5KFMA 2JRZA 2C2DA 1X42A 4BGDA 5ALQA 2I9GA 3ZDEA 1XU4A 5J0QA 1J2MA 2EZXA 3PMNA 3E58A 1TK8A 5AIBA 5D46A 4PHEA 2AGOA 5ALNA 1ZD3A 5DGAA 3K4GA 1QSLA 1HEKA 2AQ0A 1QTMA 2JEJA 2FMQA 3ISBA 3TADC 4Q8EA 1VJ5A 3KZIU 1Y88A 4J9QA 1TK0A 1SGGA 2ZTDA 4YCXA 2JR5A 2W9BB 7ICLA 2W11A 3PVXA 4QZDA 5EE9A 1WYGA 5ALGA 2HOIA 1CUKA 3GIMA 2I1QA 2FJ6A 4K4GA 4DF4A 2W8KA 2D3DA 4C0ZA 1D9FA 2KE7A 2KICA 4MEYA 1XNSA 1URJA 2QARB 4JB3A 3H0MB 1DRGA 2B0CA 2CN1A 5CJ7A 1FFUA 1Z1BA 1ZQFA 2FI1A 2W9AA 5KAIU 5CWRA 2ZG6A 3BS5B 3M6ZA 4J9SA 3EYZA 2KV2A 3DV9A 2E8NA 3RJIA 2K4HA 4Y2UA 5C0YA 2UVVA 4RPYA 4DS5A 2L5YA 3M7DA 3B0XA 4B9VA 5ALPA 2XICA 2ASJA 4JV2A 3AN1A 2FPLA 1P7DA 2KK0A 2W03A 1ZJNA 3IP4B 1NK7A 2MAXA 3L3FX 3RJHA 5J2JA 4EBCA 5KG6A 1BPYA 3WKCA 3IG5A 2XCPA 1PK3A 9ICWA 8ICOA 1OW5A 1IXRA 3R9KA 2ZIXB 3RH6A 5KFZA 4YFKA 1NZPA 5DDYA 2NRZA 2EAOA 3B9JA 4F92B 1BNPA 2IBKA 1ZQDA 2DL0A 3QZ7A 3QUBA 4DO9A 2JMGA 2F44A 5KFIA 2ASLA 4EEKA 5TISU 4I2EA 3SV4A 2F1HA 5J2BA 5IILA 2YY6A 1B0XA 2H5XA 5DBAA 8ICIA 3SAHA 8ICBA 3QUCA 2NV3A 2JHDA 3MR3A 4LZDA 5ALXA 3OSNA 4RQ6A 4QIWF 1QLNA 2F77X 1SZPA 8ICPA 2ASDA 1QQ6A 2A1JB 9ICNA 1A0PA 2KVCA 5KFAA 3PSTA 1RDFA 3QUQA 4MF8A 1ZQIA 3UQ0A 2R8JA 1JXEA 1X9MA 2LM4A 1TK5A 3BQ7A 3Q8SB 2HBLA 5AKYA 3THVA 4PJ0U 3Q8LA 5L1IA 2BCUA 3RBDA 5JRTA 1PVQA 4OJ5A 2XY6A 3KD3A 2W43A 4R63A 1XC9A 3K75D 4CCHA 4RNNA 4YR2A 5AI5A 1SL2A 1BPXA 1N61A 4KLTA 3RR7A 4O3PA 2FE9A 2Z7JA 9ICSA 1X6JA 3MR2A 3TI0A 4B9NA 2A3VA 2KHQA 4TQRA 2AXTU 1DK3A 4QJFB 2ZIWA 4KLOA 4QWEA 4DL5A 4C8NA 1ZD2P 4IS7A 3PW0A 3MABA 2RLTA 5AK4A 4UAVA 5B66U 5J0YA 2R8KA 2K4PA 2VIXA 4QZ9A 4NLZA 4J9OA 3C23A 4YVZA 1CI4A 3NVZA 4RQ0A 8ICUA 1N5WA 4DSKA 5ALOA 4OO1J 2DPIA 4YP3A 1MSWD 4I29A 1CRXA 1SWVA 2AHOB 4I27A 2KIVA 2W7OA 1N60A 3AMZA 1SL0A 2QB0B 2GLEA 8ICTA 2ZIVB 3I28A 3RB4A 5DLFA 3CNHA 2W55A 3GQCA 4DQSA 3KFUF 2WTFA 5CHGA 8ICAA 2XO7A 1ZQKA 1MN8A 4DFPA 3PO5A 1SV0C 1U48A 4QZGA 1YZ6A 4IL6U 5IINA 4PL2A 5AHXA 3FC4A 4FBUA 2DGZA 4ED0A 3AU6A 4EENA 1KTQA 3D2SA 4KN7A 2JEFA 2BHNA 4R8UA 3GIKA 1ZOLA 4DL7A 2ZIUA 2ISOA 1ZQQA 3PNCA 2KVSA 3PO4A 5ALDA 3M8SA 3N4MB 1SB3C 5KAFU 2BKEA 1ZQCA 4KLQA 4ECSA 1WCLA 3KHHA 2BPFA 5EWFA 3WK9A 4C4RA 5J2HA 5DGBA 3SMVA 4IQUA 1ZQAA 4RQ8A 4BUGA 4B9MA 1DGJA 2XGQA 2G0AA 1KLNA 2WF6A 2GH1A 2NO4A 5IIKA 2E8MA 1NJYA 4Y2YA 5EE3A 3ORYA 1ZQOA 5DG7A 2CXYA 3C2MA 1SIJA 2BQUA 3LVWA 4B9UA 4CNQA 4NV0A 4ELTA 4DLEA 4CGZA 7ICOA 5DQHA 2NRVA 2H3FA 1KL9A 2YMQA 3BQ0A 5EE0A 4YMOA 1RZTA 1KSPA 5L1LA 1L3UA 2BPGA 3WK4A 1L3SA 4I28A 4XUSA 3FAHA 3HPOA 5AKIA 4GLXA 1L8OA 4ECQA 1RG6A 1UT8A 4BWMA 9ICGA 4M9GA 4QZFA 3MC1A 1ZQBA 5KFQA 4KX5A 2UVWA 4DSLA 5BOLA 2K8BB 4YMMA 5D4BA 8ICRA 3LK9A 3SV3A 4IQWA 4ZOHC 4UASA 4BX9C 9ICUA 4P0QB 3GV8B 3PSPA 1BPZA 1AROP 4B9LA 2DPJA 5KG2A 4QZEA 3T5HA 2XCAA 3M9NB 3B0YA 4YXJA 2ES6A 2JH7A 5HHHA 2W9CA 1HUOA 3D2QA 5JU5A 4C4SA 4UB8U 1B22A 1QQ5A 4RQ3A 3TARA 2KSOB 1ZXIA 3HP6A 1RXWA 1RYUA 2HI0A 4I2JA 7ICEA 5J0PA 4Z6FA 9ICAA 1L8LA 4M2YA 5DBCA 1S10A 1ZQZA 2HMXA 4RT2A 4DEZA 4YQWA 4PGQA 3RTVA 2G09A 1O03A 4PHAA 4EZ6A 4CE6A 2GWSA 3ZDAA 3MGHA 3GFKB 1LKYA 2ZJAA 4OJLA 4RQ1A 4HAIA 3PW4A 5KFFA 2LBOA 1UHUA 1U49A 4GXKA 2BCRA 3UMBA 1TAUA 5KT5A 1U47A 1S0VA 1CEZA 2XY7A 1L7PA 2P6UA 4YD2A 5ALYA 1ZQLA 4KLSA 5KFXA 2F8LA 4GC7A 1GO3F 1SL1A 5EWGA 1ZQYA 2FMPA 3M6KA 4Z6EA 2R8HA 5KG3A 2E1FA 4F4YA 3QU9A 5KFPA 5TZVA 2KKVA 3EW9A 2WHEA 5A0LA 2XIDA 1BGXT 1T3NA 2B6GA 1NNLA 3UQ2A 4FZNA 2G08A 4C7YA 1RXVA 9ICMA 5L9XA 3QU2A 4NJ8A 2K4IA 4EYHB 2KG5A 1L6NA 1NK6A 2VKQA 1NJZA 4IRDA 3QEAZ 3PX6A 3WKEA 1JI7A 8ICGA 3OPXA 2E3TA 5G5HA 2ISPA 3G6XA 3H0LB 3F53A 8ICMA 1FIQA 4EBDA 4ED6A 4O3NA 1WUDA 4ECVA 3QYPA 1NK8A 1K1SA 2Y0SF 2DKZA 1COOA 2BQRA 4J03A 2EZZA 4QWCA 9ICKA 4M47A 1KW4A 4OD0A 1EXNA 4Y2TA 1DOQA 1XSLA 3ISCA 1HJPA 4KX3A 5KFGA 3U26A 3H0RB 1T3QA 1Z00B 3M8RA 2JZBA 3AQFA 5KFWA 4J9PA 7ICMA 2E8OA 3IV6A 5DB6A 2WFAA 4DSEA 4RQ2A 4ED3A 5J2IA 2PFQA 1AQ6A 3EPIA 4F50A 4QNLA 3RF9A 4UB3A 3T79A 2KHVA 4K4IA 3FYHA 5F9NA 4F5NA 5J8YC 1F44A 4US8A 2WF8A 1JN3A 4B9TA 4EEYA 4KLMA 1ZQEA 1QQ7A 3PW5A 5AM1A 1SKRA 4Q45A 1YT3A 2W3RA 4EELA 2FDRA 2G07A 4RUCA 4JMUA 5J0OA 3OHBA 4UB2A 4O5CA 2D8CA 2HCFA 5AM3A 3WK8A 1XSPA 3KTQA 2W9BA 2HHTA 4PHDA 5ALFA 3I76A 3DEEA 3NUQA 5KG1A 2KOBA 3TKAA 4UAZA 2YMMA 2VJ5A 2VA2A 2NO5A 1T8EA 3CP8A 1L7OA 4R66A 2ZTEA 2BGWA 3ZDDA 2B21A 5J0UA 3IN5A 3K1ZA 5T14A 3UMGA 2QARA 5AKGA 3T5JA 3LDAA 5IIMA 4QIWC 1U4BA 1T7PA 1S0NA 4F72A 3MDAA 3A0HU 3BS5A 2ESEA 1A76A 2F2AB 4UB6U 2MUTB 3CW2C 1X66A 5DBBA 4FBTA 3KKAC 3C1YA 4KLJA 4EX6A 4BXOB 3RJFA 3KBBA 2NRXA 5DQIA 3QU4A 4DOBA 3KHRA 3GV5B 9ICBA 3MGIA 2DWQA 4C8KA 3G6YA 4UB1A 2HHQA 7ICRA 2KD1A 5DLGA 5HP4A 1HIWA 3TANA 4XQ8A 5KFSA 1KKXA 3JPSA 3BDPA 1NKCA 4EBEA 8ICLA 3OJSA 3M1YA 3MFIA 4DQIA 2FPMA 2ZIXA 4P0PB 4DCCA 4ECZA 2A1AA 4ED7A 2AGQA 1NK0A 1D9DA 1Z4NA 3HX0A 4DFMA 4I2FA 3PZPA 1V38A 3IRUA 3GV7B 5CA7A 4QZCA 3WKBA 4PZNA 2KJ8A 1OUQA 4NLNA 2ZXIA 1N2XA 1SXDA 2K8AA 2Y1IA 4ECRA 3QXGA 2W04A 2GO7A 4WJ3B 2A1JA 5H2FU 3WK5A 1ZQGA 4G3IA 5EE1A 2PKEA 3RR8A 4HYKA 2G5HB 1SZHA 3TAPA 2KZZA 5KFJA 2KEYA 5AKLA 3TFSA 1Q8KA 4F4KA 5KT6A 3GDXA 2H3QA 3NASA 2ZUBA 1DXSA 2WF7A 9ICEA 4FZMA 3T3FA 3SAGA 1NI3A 3PSFA 4J9MA 4NM1A 1PK1B 5KFDA 4ELUA 3ZDCA 2BCQA 3RB3A 5AKJA 4RNMA 1ZQSA 3MFHA 4US9A 2W3SA 4GC6A 1ZQVA 2ALZA 3CYMA 1C20A 2F8KA 4QWBA 3EUB2 3IG8A 5ALEA 3GIJA 1Z1VA 3MR6A 2H3ZA 4ED1A 4F8RA 1VDVA 5AKHA 3QX7A 5KFLA 1BPDA 2IOHA 4MFFA 2FPKA 5J0RA 4QWAA 4RNOA 9ICIA 4JUZA 4KLLA 1BPEA 1S76D 3I1YA 2EANA 5ALVA 1XO1A 3Q8MA 2BQ3A 3ETRA 1X9SA 4O5EA 3E0FA 5CR0A 2I5HA 5KFTA 5J2EA 3GILA 3SZ2A 5KG5A 4M04A 3N7SC 3OTQA 2W7PA 3D2NA 1ECWA 4UQGA 4MFCA 1ZYQA 2XI9A 2O6KA 3S6JA 5KT2A 3UXPA 2MU2A 1ZQUA 3Q8QB 2ZIVA 1ZJMA 2BCSA 1JMSA 3NTUA 7ICGA 5AICA 5JUMA 3Q8RB 2HHUA 2HOFA 4KN4A 3TAQA 3BZKA 1ZQXA 2BDUA 3C2KA 4NL9A 2YMLA 4U6PA 3FDSA 4TQSA 5ALUA 2OCEA 3RBEA 3KZXA 3PMLA 9ICJA 1MA7A 4FE3A 2KJ9A 3V7JA 5DB7A 1Z19A 1S0MA 4Y2PA 5HHIA 4JK1A 2AU0A 3RAXA 2PI5A 2FLLA 3HILA 3IHQB 2PFNA 2AJQA 3AEVA 8ICQA 2CPRA 2EDUA 2YB1A 4NLGA 1ED1A 1XO0A 3BQTA 2ZTCA 3KHGA 4TUSA 4LVSA 4I2HA 1ZD5A 4P4MA 4PGXA 1TKDA 3EWAA 4JV0A 1WWVA 3SI8A 3BQ1A 4NLBA 4RUAA 2R18A 2K8CB 5AKZA 3PX0A 3RJGA 8ICWA 1IM4A 5KFUA 4ECXA 2LI6A 5IIIA 4CF4A 5KFHA 3NRWA 4UB5A 1L7MA 5KFVA 4DL4A 1SWWA 4PL1A 3LWLA 3RJKA 3PR4A 3HJEA 3PV8A 2PMZC 3HWTA 3ETLA 4USAA 1UPHA 2M9NA 4QW8A 5J2DA 4JWMA 2WAQF 4EYIB 4CRXA 2HHVA 4Y2SA 4UAYA 1A6SA 1QSSA 1D8YA 4M0AA 4PPXA 2ZJ8A 5AKXA 5HR6A 8ICXA 1B43A 4DSFA 5J2CA 5K4LA 4KLFA 5GTHU 5DB8A 1S77D 5KTQA 4UW9A 2AH5A 4C4TA 4DSJA 2IA6A 1ZQNA 3PX4A 4GXJA 2OM6A 5ALIA 1NK5A 4NXZA 7ICFA 4RT3A 4UB4A 2VJ4A 2DKXA 1S5LU 4J9KA 3UPQA 2HSZA 4PH5A 4P0QA 2EAPA 3HRDD 2BDPA 2PI4A 4ECYA 5AI8A 3IDWA 2XC9A 9ICHA 9ICXA 1NK4A 1OXJA 1COKA 3RB6A 1UA1A 1WWUA 2V9WA 2Q4TA 4C8MA 1F5SA 2P66A 4O3MA 5KL1B 5DKWA 1VLBA 2UVRA 4I2IA 2PMZF 4DWIA 3V7LA 2KSOA 2YQEA 5IIOA 4NLCA 4Q43A 4JV1A 2JEIA 4QZBA 4IRCA 4OJ6A 5CP2A 2DFLA 2HBKA 7ICHA 2XVTA 3V7KA 2PFPA 2LPEA 5HMMA 3TFRA 5J0TA 9ICTA 9ICRA 2N1RA 4O3SA 3H8SA 4QZAA 4X5VA 4Z6DA 3UXNA 3OJUA 1TV9A 2QB1A 5G5GA 4F3OA 1N62A 3H8MA 5L1JA 3RJJA 1DK2A 2Y0SC 1O08A 2G5IB 1KDHA 5AM5A 5ALSA 4M6WB 2Y1JA 4O0IA 5J2GA 4ECTA 3SR6A 3C5GA 4JWNA 4K4HA 2P35A 4PHPA 2LHTA 1S9FA 1U9LA 4UAWA 5AI9A 2JEGA 4F5QA 1KQQA 4RQNA 3V6KA 1X2IA 3EZ5A 5ALZA 3ALRA 4O3OA 5CB1A 3AU2A 3F2CA 1ZQMA 3G6VA 7ICKA 2E8PA 3F5AA 5KFCA 1ZD4A 4M9HA 5HNKA 8ICHA 2PXIA 2NRWA 4YD1A 1C7YA 1BNOA 3M9MB 3CRXA 4DQRA 4F5PA 3NGDA 1X40A 1X6IA 4QZHA 4UATA 3NVYA 3NVWA 2KKPA 5ALLA 5EOZA 4RPXA 4DSIA 9ICVA 1J97A 4Q8FA 2OEHA 1A77A 3MBYA 2RDIA 4YMNA 4F5RA 2KIWA 3AL0B 7ICSA 4UBCA 8ICCA 1Q46A 4P2HA 3HKZC 5ALMA 4P4OA 5GTIU 4BWJA 2HBJA 3N97B 4F93B 2BPCA 3IM1A 1PZNA 4KLDA 3JPTA 1Z00A 7ICVA 2WF9A 5KG4A 2J6SA 5J0SA 3RRGA 2BR0A 4BDPA 1ZQRA 4G9BA 4RPZA 1ZQWA 9ICOA 4M9LA 4GIBA 3QUTA 4KMUA 4DFDA 4ZH4A 1B4FA 3EPGA 1V97A 1UCVA 2HBMA 3N28A 2M0NA 3H4BA 2KMDA 1S8OA 3PW7A 4O3RA 2YB4A 9ICQA 4ELVA 3HW8A 7ICUA 2FLNA 1KRPA 3M9OB 5KFBA 8ICYA 1SKWA 2FLPA 5KFRA 4F4ZA 1SXEA 2H3IA 5DG8A 5DB9A 4C80A 1RPLA 2YX8A 1PVRA 5L1MA 4DLGA 4CF5A 5AK6A 3C2LA 5AIAA 4Y2QA 3SYZA 1N48A 3RH4A 3HKZF 4DFJA 5AK3A 2RDJA 1PUZA 1NOMA 2JH1A 3F5EA 2V4QA 1UT5A 1KFSA 3MGVA 5KT4A 5AM2A 1H38A 4NLKA 4C8OA 2KJ5A 2V4RA 4F4XA 4NWIA 2RRDA 2H3VA 4RQMA 5AKKA 3PR5B 4ED8A 3C21A 4MF2A 3LWMA 2LYBA 3SENA 2MUTA 4GXIA 5BPCA 1JXLA 5DDMA 4BXOA 4EZ9A 1V9PA 2IHNA 2RHFA 4IR1A 1M6YA 1NKEA 2EAMA 1RYSA 1KN5A 4J9RA 3H7IA 3ZDBA 3OSPA 4OCZA 4I2DA 3LVVA 5KNIA 5BOMA 3WKAA 1ZETA 3JPNA 3D6JA 4DFKA 3BZCA 2JV3A 2HHXA 3Q8KA 3AUOA 4KLHA 2XGPA 1SKSA 2AGPA 4P0PA 3RAQA 4R65A 3N7RC 5L1KA 5KG7A 1RM6C 1TE2A 4DOAA 3L4PA 1V85A 4F5OA 2NYVA 2D6FC 2ODGA 1NJXA 3Q8PB 2QLTA 3ICXA 4IQTA 2R8IA 3C5FA 1LV5A 4O9MA 4LJXA 2ZUDA 5KFEA 1JRPA 1WG8A 1JROA 4F91B 8ICVA 4KLGA 1NK9A 2EQYA 4OJPA 4YR3A 2MA1A 5D49A 3GZFA 4OJOA 4P4PA 3KHLA 5AKEA 1KFDA 1FO4A 8ICFA 3NS1A 7ICIA 4GFJA 3NVVA 1Q3UA 7ICNA 3RRHA 2KFNA 4KTQA 2K89A 1ZQPA 3SEIA 4TUQA 3SAFA 4ICAA 2HDOA 4B9SA 1SV0A 4FFDA 1PK1A 4PGYA 5J29A 2HHWA 2MSNA 2G06A 5AM4A 1K1QA 5J0WA 4KMOB 4RZRA 2XY5A 5AI4A 1JALA 4CDGA 3LYSA 4QW9A 1UQVA 3H8JA 4YN4A 1LB2B 4YXMA 4LZGA 3UMCA 4DOCA 5KFYA 8ICSA 2KNJA 2LMRA 1WCNA 3PY8A 2FMSA 5AM0A 2ATLA 1T94A 5ALHA 2ZIWB 4J9LA 1K5OA 2DQNB 1D8LA 5C5JA 4Y2JA 3OGUA 1KFTA 4DS4A 2KP7A 2ZXHA 1RQNA 1QCKA 2QB0A 2CRXA 4J9NA 3FM9A 5KFNA 5E79U 4KLUA 5J2KA 4FO6A 2BZFA 5AI0A 3OHAA 3JPRA 5F9LA 2WB1C 5J0XA 4TURA 5JTIA 3RFAA 1S0OA 1QH9A 2K60A 1KEJA 4ECWA 4YG2A 2DUYA 2WAQC 4YR0A 1N63A 2OXOA 3BS7A 4IC9A 1N5XA 4Z6CA 1NKBA 2F1JA 3T5KA 1PVPA 7ICTA 4DL2A 3BQ2A 1DGSA 1ZQJA 3H4DA 5AI6A 1TAQA 4QZ8A 3PSIA 1IV8A 3RB0A 1KBUA 3E2EA 3A0BU 5DG9A 8ICNA 4R8UB 4QWDA 3ONNA 2OH2A 2HW3A 4F2SA 2ZIUB 2A19A 2IHMA 4FZLA 1JUDA 2PFOA 1X9XA 3VC8A 1ZRMA 2F3NA 3O0FA 3SD7A 3C28A 4FS2A 4EX7A 2JGAA 4PZOA 4I2AA 4C7ZA 2KZMA 1NZBA 2EZYA 4I2GA 4DL3A 3AM9A 2VANA 4A8EA 5AK5A 3DDHA 4M9JA 3QEBZ 2K4EA 1JIHA 2NRTA 2P6RA 2WB1F 3TACB 4IR9A 3SQIA 4MEXA 5J2AA 2VA3A 2C2RA 8ICKA 2C22A 5DQGA 2OYYA 5KFKA 3L5KA 3GIIA 2E5SA 9ICPA 2LYAA 4NL9C 4XRHA 9ICFA 4U7CA 1D8BA 1YZ7A 4R64A 3J81j 1ZQHA 3K1RB 3TQ1A 2QKQA 3T5LA 2WF5A 2GOLA 3UXOA 4UBBA 5CRXA 3H40A 4MFAA 1L7NA 4M9NA 1FFVA 7ICPA 4UAUA 1F0MA 1RQLA 2HVIA 2E1EA 4KLIA 2DF4B 4DQPA 4CF3A 2J6TA 2OWOA 3VCBA 8ICJA 5B5EU 4I2CA 2IOFA 4E0DA 5HMLA 5ALKA 4IRKA 4AP9A 2F1IA 2RP5A 2C2EA 1L3TA 2LKYA 4DQQA 9ICLA 3KOOA 2J6UA 1XS9D 4RQ7A 2W54A 2ZJ5A 5ALRA 5IIJA 1MQ3A 1N56A 2W9CB 1QSYA 2LM1A 5KT7A 2MRLA 8ICEA 2VA8A 5ALJA 4BJQA 4IQVA 2Q0ZX 3BJYA 3V72A 3NRZA 2I6XA 2IMWP 3WK7A 7ICQA 7ICJA 5F3XB 4FS1A 3V6JA 2OHFA 3ZD9A 3WK6A 4DF8A 2RQ5A 2BCVA 3WU2U 1BPBA 4O3QA 4XA5A 2DBYA 3ZI4A 3MDCA 1XWLA 4RQ4A 4M6WA 5KL8B 4RQ5A 1Z3EB 2JXJA 4ED2A 3GU3A 4AYBC 2Y9TA 8ICZA 1TAMA 3ZD8A 4ACOA 1LKYB 1TFRA 3QNMA 4F71A 3QZ8A 3PW2A 5ALWA 3HT3A 2R8GA 1L5UA 2KN7A 1JX4A 1Q3VA 3MR5A 4F4WA 2YTUA 4RU9A 1X9WA 1RYRA 2KTQA 4C8LA 1BVSA 4NY8A 2HHSA 2YN4A 2ZUCA 4B6JA 4Y2VA 3QE9Y 5HR7A 5EWEA 5KFOA 2EH9A 3ISDA 2KZ3A 5J8YA 3AQEA 3QU5A 1Z4OA 4KITB 4Y2RA 4NM2A 2HVHA 1ZRNA 3C29A 2YMPA 2W9MA 3WKDA 4QZIA 3TADA 4TUPA 1XSNA 3JPPA 2F76X 2KFZA 4AYBF 4MHVA 3C1ZA 1FEZA 1U45A 3QU7A 3ED5A 4DL6A 4KLEA 5KT3A 2HOQA 3V6HA 4ECUA 1NJWA 4I2BA 3F2BA 1IIPA 2LYHA 4UARA 1HUZA 1MC8A 2Y9UA 1T4GA 1S97A 2IOFK 2UVUA 4F2RA 5CEHA 3F2DA 5ALTA 5KG0A 3JPOA 3RH5A 1ZQTA 4O5KA 1SV4A 1TVAA 2JZBB 3JPQA 2AQ4A 1ZQ1C 3RJEA
chains in the Genus database with same CATH topology
3KZXA 1MA7A 1WUDA 4FE3A 2KJ9A 2H3IA 2Z7JA 4U7CA 1P7DA 2KEYA 2W03A 1TAMA 3ICXA 1Z19A 1D8BA 2Y0SF 3IP4B 4ACOA 2VJ4A 2A3VA 2H3QA 2YX8A 2KHQA 3L3FX 4QIWC 3N7PD 4P0QA 4QJFB 1PVRA 2WB1C 2ZIWA 4FZMA 5T14A 3IG5A 3SAGA 3SMVA 3RFAA 4OJPA 2F2AB 2GOLA 2CPRA 3HKZF 3CRXA 5CRXA 2MA1A 4BUGA 1Q3VA 2YB1A 1ED1A 1XO0A 2G0AA 2VIXA 4KX3A 2ZIXB 3GZFA 4OJOA 3PSFA 2GH1A 2Q4TA 2KKPA 3H0RB 2WAQC 2HMXA 4O3MA 2JH1A 3F5EA 3AQFA 5KL1B 3LVWA 2OXOA 2E1EA 3MGVA 2G09A 4IC9A 2DF4B 4GFJA 2JMGA 4OO1J 4NLBA 2PMZF 3CYMA 4NV0A 1PVPA 2R18A 2K8CB 1Q3UA 2KD1A 2KJ5A 3IG8A 1CRXA 3VCBA 4NLCA 2K89A 2KIWA 2W7OA 2CRXA 1HIWA 4OJLA 2H3ZA 4CGZA 3AL0B 3PSIA 4OJ6A 2H3FA 1HEKA 2HBKA 4NWIA 1KBUA 2XVTA 2LBOA 2RRDA 3SAFA 3NRWA 2H3VA 5HR7A 4ICAA 3SAHA 2RP5A 3HKZC 3AQEA 2ZIVB 3ONNA 2OH2A 2LKYA 4QNLA 2LYBA 2NV3A 3RF9A 4PL1A 2JHDA 2KHVA 2N1RA 3T79A 2HBJA 2ZIUB 2ZIXA 3KFUF 4QIWF 2F77X 2HOIA 4FZLA 2G06A 1F44A 4P0PB 2F8LA 3VC8A 4KMOB 3C29A 1GO3F 2RHFA 2Y0SC 3IN5A 2PMZC 3O0FA 1A0PA 2KVCA 4CDGA 3PSTA 3C28A 2G5IB 3LYSA 3E0FA 3M6KA 4PL2A 2JGAA 4C0ZA 2DGZA 2E1FA 1UPHA 2F76X 4KX5A 3PZPA 3N7SC 2K8BB 2MRLA 2W7PA 2KKVA 1NZBA 2KICA 1YT3A 3D2NA 1ECWA 5A0LA 2WAQF 2XIDA 4AYBF 1XNSA 4CRXA 3D2SA 1URJA 2KNJA 4BJQA 3H0MB 2XI9A 2G07A 1A6SA 4FZNA 4JMUA 4A8EA 3LVVA 4BX9C 1DRGA 2CN1A 2G08A 2HOQA 2LHTA 2ZIVA 1Z1BA 2K4EA 2HBLA 2D6FC 2HBMA 2KJ8A 1T94A 3F5AA 2M0NA 2ZIWB 3PSPA 1OUQA 4P0QB 5HR6A 3F2BA 2ZIUA 1IIPA 2WB1F 2ZG6A 2ZXIA 2YB4A 2K8AA 4OJ5A 1PVQA 2K4IA 3SQIA 1L6NA 2DQNB 2HOFA 4P0PA 3M6ZA 2VKQA 2W04A 3DEEA 3N7RC 3NUQA 2KOBA 2KV2A 2BDUA 4WJ3B 3OPXA 3F2DA 2K4HA 5C0YA 2VJ5A 2JH7A 2OYYA 2OM6A 3ALRA 3D2QA 4U6PA 5KL8B 3H0LB 3F53A 3M7DA 3CP8A 3F2CA 2E5SA 2ZXHA 2G5HB 3GU3A 1ZQ1C 4AYBC 1SZHA 3K1ZA 2LYAA 2XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0L B;  3AL0 B;  4WJ3 B;  3KFU F;  3H0M B;  2DQN B;  2G5H B;  1ZQ1 C;  2D6F C;  2F2A B;  3H0R B;  2DF4 B;  2G5I B;  3IP4 B; 
#chains in the Genus database with same CATH topology
 2C28 A;  1IG6 A;  1MQ2 A;  2W8L A;  9ICC A;  1UA0 A;  3UM9 A;  3N7P D;  1J2N A;  1LVH A;  3H8W A;  4Y2X A;  5FP0 A;  4Q44 A;  3KKA A;  1L3V A;  5J2F A;  5KFM A;  2JRZ A;  2C2D A;  1X42 A;  4BGD A;  5ALQ A;  2I9G A;  3ZDE A;  1XU4 A;  5J0Q A;  1J2M A;  2EZX A;  3PMN A;  3E58 A;  1TK8 A;  5AIB A;  5D46 A;  4PHE A;  2AGO A;  5ALN A;  1ZD3 A;  5DGA A;  3K4G A;  1QSL A;  1HEK A;  2AQ0 A;  1QTM A;  2JEJ A;  2FMQ A;  3ISB A;  3TAD C;  4Q8E A;  1VJ5 A;  3KZI U;  1Y88 A;  4J9Q A;  1TK0 A;  1SGG A;  2ZTD A;  4YCX A;  2JR5 A;  2W9B B;  7ICL A;  2W11 A;  3PVX A;  4QZD A;  5EE9 A;  1WYG A;  5ALG A;  2HOI A;  1CUK A;  3GIM A;  2I1Q A;  2FJ6 A;  4K4G A;  4DF4 A;  2W8K A;  2D3D A;  4C0Z A;  1D9F A;  2KE7 A;  2KIC A;  4MEY A;  1XNS A;  1URJ A;  2QAR B;  4JB3 A;  3H0M B;  1DRG A;  2B0C A;  2CN1 A;  5CJ7 A;  1FFU A;  1Z1B A;  1ZQF A;  2FI1 A;  2W9A A;  5KAI U;  5CWR A;  2ZG6 A;  3BS5 B;  3M6Z A;  4J9S A;  3EYZ A;  2KV2 A;  3DV9 A;  2E8N A;  3RJI A;  2K4H A;  4Y2U A;  5C0Y A;  2UVV A;  4RPY A;  4DS5 A;  2L5Y A;  3M7D A;  3B0X A;  4B9V A;  5ALP A;  2XIC A;  2ASJ A;  4JV2 A;  3AN1 A;  2FPL A;  1P7D A;  2KK0 A;  2W03 A;  1ZJN A;  3IP4 B;  1NK7 A;  2MAX A;  3L3F X;  3RJH A;  5J2J A;  4EBC A;  5KG6 A;  1BPY A;  3WKC A;  3IG5 A;  2XCP A;  1PK3 A;  9ICW A;  8ICO A;  1OW5 A;  1IXR A;  3R9K A;  2ZIX B;  3RH6 A;  5KFZ A;  4YFK A;  1NZP A;  5DDY A;  2NRZ A;  2EAO A;  3B9J A;  4F92 B;  1BNP A;  2IBK A;  1ZQD A;  2DL0 A;  3QZ7 A;  3QUB A;  4DO9 A;  2JMG A;  2F44 A;  5KFI A;  2ASL A;  4EEK A;  5TIS U;  4I2E A;  3SV4 A;  2F1H A;  5J2B A;  5IIL A;  2YY6 A;  1B0X A;  2H5X A;  5DBA A;  8ICI A;  3SAH A;  8ICB A;  3QUC A;  2NV3 A;  2JHD A;  3MR3 A;  4LZD A;  5ALX A;  3OSN A;  4RQ6 A;  4QIW F;  1QLN A;  2F77 X;  1SZP A;  8ICP A;  2ASD A;  1QQ6 A;  2A1J B;  9ICN A;  1A0P A;  2KVC A;  5KFA A;  3PST A;  1RDF A;  3QUQ A;  4MF8 A;  1ZQI A;  3UQ0 A;  2R8J A;  1JXE A;  1X9M A;  2LM4 A;  1TK5 A;  3BQ7 A;  3Q8S B;  2HBL A;  5AKY A;  3THV A;  4PJ0 U;  3Q8L A;  5L1I A;  2BCU A;  3RBD A;  5JRT A;  1PVQ A;  4OJ5 A;  2XY6 A;  3KD3 A;  2W43 A;  4R63 A;  1XC9 A;  3K75 D;  4CCH A;  4RNN A;  4YR2 A;  5AI5 A;  1SL2 A;  1BPX A;  1N61 A;  4KLT A;  3RR7 A;  4O3P A;  2FE9 A;  2Z7J A;  9ICS A;  1X6J A;  3MR2 A;  3TI0 A;  4B9N A;  2A3V A;  2KHQ A;  4TQR A;  2AXT U;  1DK3 A;  4QJF B;  2ZIW A;  4KLO A;  4QWE A;  4DL5 A;  4C8N A;  1ZD2 P;  4IS7 A;  3PW0 A;  3MAB A;  2RLT A;  5AK4 A;  4UAV A;  5B66 U;  5J0Y A;  2R8K A;  2K4P A;  2VIX A;  4QZ9 A;  4NLZ A;  4J9O A;  3C23 A;  4YVZ A;  1CI4 A;  3NVZ A;  4RQ0 A;  8ICU A;  1N5W A;  4DSK A;  5ALO A;  4OO1 J;  2DPI A;  4YP3 A;  1MSW D;  4I29 A;  1CRX A;  1SWV A;  2AHO B;  4I27 A;  2KIV A;  2W7O A;  1N60 A;  3AMZ A;  1SL0 A;  2QB0 B;  2GLE A;  8ICT A;  2ZIV B;  3I28 A;  3RB4 A;  5DLF A;  3CNH A;  2W55 A;  3GQC A;  4DQS A;  3KFU F;  2WTF A;  5CHG A;  8ICA A;  2XO7 A;  1ZQK A;  1MN8 A;  4DFP A;  3PO5 A;  1SV0 C;  1U48 A;  4QZG A;  1YZ6 A;  4IL6 U;  5IIN A;  4PL2 A;  5AHX A;  3FC4 A;  4FBU A;  2DGZ A;  4ED0 A;  3AU6 A;  4EEN A;  1KTQ A;  3D2S A;  4KN7 A;  2JEF A;  2BHN A;  4R8U A;  3GIK A;  1ZOL A;  4DL7 A;  2ZIU A;  2ISO A;  1ZQQ A;  3PNC A;  2KVS A;  3PO4 A;  5ALD A;  3M8S A;  3N4M B;  1SB3 C;  5KAF U;  2BKE A;  1ZQC A;  4KLQ A;  4ECS A;  1WCL A;  3KHH A;  2BPF A;  5EWF A;  3WK9 A;  4C4R A;  5J2H A;  5DGB A;  3SMV A;  4IQU A;  1ZQA A;  4RQ8 A;  4BUG A;  4B9M A;  1DGJ A;  2XGQ A;  2G0A A;  1KLN A;  2WF6 A;  2GH1 A;  2NO4 A;  5IIK A;  2E8M A;  1NJY A;  4Y2Y A;  5EE3 A;  3ORY A;  1ZQO A;  5DG7 A;  2CXY A;  3C2M A;  1SIJ A;  2BQU A;  3LVW A;  4B9U A;  4CNQ A;  4NV0 A;  4ELT A;  4DLE A;  4CGZ A;  7ICO A;  5DQH A;  2NRV A;  2H3F A;  1KL9 A;  2YMQ A;  3BQ0 A;  5EE0 A;  4YMO A;  1RZT A;  1KSP A;  5L1L A;  1L3U A;  2BPG A;  3WK4 A;  1L3S A;  4I28 A;  4XUS A;  3FAH A;  3HPO A;  5AKI A;  4GLX A;  1L8O A;  4ECQ A;  1RG6 A;  1UT8 A;  4BWM A;  9ICG A;  4M9G A;  4QZF A;  3MC1 A;  1ZQB A;  5KFQ A;  4KX5 A;  2UVW A;  4DSL A;  5BOL A;  2K8B B;  4YMM A;  5D4B A;  8ICR A;  3LK9 A;  3SV3 A;  4IQW A;  4ZOH C;  4UAS A;  4BX9 C;  9ICU A;  4P0Q B;  3GV8 B;  3PSP A;  1BPZ A;  1ARO P;  4B9L A;  2DPJ A;  5KG2 A;  4QZE A;  3T5H A;  2XCA A;  3M9N B;  3B0Y A;  4YXJ A;  2ES6 A;  2JH7 A;  5HHH A;  2W9C A;  1HUO A;  3D2Q A;  5JU5 A;  4C4S A;  4UB8 U;  1B22 A;  1QQ5 A;  4RQ3 A;  3TAR A;  2KSO B;  1ZXI A;  3HP6 A;  1RXW A;  1RYU A;  2HI0 A;  4I2J A;  7ICE A;  5J0P A;  4Z6F A;  9ICA A;  1L8L A;  4M2Y A;  5DBC A;  1S10 A;  1ZQZ A;  2HMX A;  4RT2 A;  4DEZ A;  4YQW A;  4PGQ A;  3RTV A;  2G09 A;  1O03 A;  4PHA A;  4EZ6 A;  4CE6 A;  2GWS A;  3ZDA A;  3MGH A;  3GFK B;  1LKY A;  2ZJA A;  4OJL A;  4RQ1 A;  4HAI A;  3PW4 A;  5KFF A;  2LBO A;  1UHU A;  1U49 A;  4GXK A;  2BCR A;  3UMB A;  1TAU A;  5KT5 A;  1U47 A;  1S0V A;  1CEZ A;  2XY7 A;  1L7P A;  2P6U A;  4YD2 A;  5ALY A;  1ZQL A;  4KLS A;  5KFX A;  2F8L A;  4GC7 A;  1GO3 F;  1SL1 A;  5EWG A;  1ZQY A;  2FMP A;  3M6K A;  4Z6E A;  2R8H A;  5KG3 A;  2E1F A;  4F4Y A;  3QU9 A;  5KFP A;  5TZV A;  2KKV A;  3EW9 A;  2WHE A;  5A0L A;  2XID A;  1BGX T;  1T3N A;  2B6G A;  1NNL A;  3UQ2 A;  4FZN A;  2G08 A;  4C7Y A;  1RXV A;  9ICM A;  5L9X A;  3QU2 A;  4NJ8 A;  2K4I A;  4EYH B;  2KG5 A;  1L6N A;  1NK6 A;  2VKQ A;  1NJZ A;  4IRD A;  3QEA Z;  3PX6 A;  3WKE A;  1JI7 A;  8ICG A;  3OPX A;  2E3T A;  5G5H A;  2ISP A;  3G6X A;  3H0L B;  3F53 A;  8ICM A;  1FIQ A;  4EBD A;  4ED6 A;  4O3N A;  1WUD A;  4ECV A;  3QYP A;  1NK8 A;  1K1S A;  2Y0S F;  2DKZ A;  1COO A;  2BQR A;  4J03 A;  2EZZ A;  4QWC A;  9ICK A;  4M47 A;  1KW4 A;  4OD0 A;  1EXN A;  4Y2T A;  1DOQ A;  1XSL A;  3ISC A;  1HJP A;  4KX3 A;  5KFG A;  3U26 A;  3H0R B;  1T3Q A;  1Z00 B;  3M8R A;  2JZB A;  3AQF A;  5KFW A;  4J9P A;  7ICM A;  2E8O A;  3IV6 A;  5DB6 A;  2WFA A;  4DSE A;  4RQ2 A;  4ED3 A;  5J2I A;  2PFQ A;  1AQ6 A;  3EPI A;  4F50 A;  4QNL A;  3RF9 A;  4UB3 A;  3T79 A;  2KHV A;  4K4I A;  3FYH A;  5F9N A;  4F5N A;  5J8Y C;  1F44 A;  4US8 A;  2WF8 A;  1JN3 A;  4B9T A;  4EEY A;  4KLM A;  1ZQE A;  1QQ7 A;  3PW5 A;  5AM1 A;  1SKR A;  4Q45 A;  1YT3 A;  2W3R A;  4EEL A;  2FDR A;  2G07 A;  4RUC A;  4JMU A;  5J0O A;  3OHB A;  4UB2 A;  4O5C A;  2D8C A;  2HCF A;  5AM3 A;  3WK8 A;  1XSP A;  3KTQ A;  2W9B A;  2HHT A;  4PHD A;  5ALF A;  3I76 A;  3DEE A;  3NUQ A;  5KG1 A;  2KOB A;  3TKA A;  4UAZ A;  2YMM A;  2VJ5 A;  2VA2 A;  2NO5 A;  1T8E A;  3CP8 A;  1L7O A;  4R66 A;  2ZTE A;  2BGW A;  3ZDD A;  2B21 A;  5J0U A;  3IN5 A;  3K1Z A;  5T14 A;  3UMG A;  2QAR A;  5AKG A;  3T5J A;  3LDA A;  5IIM A;  4QIW C;  1U4B A;  1T7P A;  1S0N A;  4F72 A;  3MDA A;  3A0H U;  3BS5 A;  2ESE A;  1A76 A;  2F2A B;  4UB6 U;  2MUT B;  3CW2 C;  1X66 A;  5DBB A;  4FBT A;  3KKA C;  3C1Y A;  4KLJ A;  4EX6 A;  4BXO B;  3RJF A;  3KBB A;  2NRX A;  5DQI A;  3QU4 A;  4DOB A;  3KHR A;  3GV5 B;  9ICB A;  3MGI A;  2DWQ A;  4C8K A;  3G6Y A;  4UB1 A;  2HHQ A;  7ICR A;  2KD1 A;  5DLG A;  5HP4 A;  1HIW A;  3TAN A;  4XQ8 A;  5KFS A;  1KKX A;  3JPS A;  3BDP A;  1NKC A;  4EBE A;  8ICL A;  3OJS A;  3M1Y A;  3MFI A;  4DQI A;  2FPM A;  2ZIX A;  4P0P B;  4DCC A;  4ECZ A;  2A1A A;  4ED7 A;  2AGQ A;  1NK0 A;  1D9D A;  1Z4N A;  3HX0 A;  4DFM A;  4I2F A;  3PZP A;  1V38 A;  3IRU A;  3GV7 B;  5CA7 A;  4QZC A;  3WKB A;  4PZN A;  2KJ8 A;  1OUQ A;  4NLN A;  2ZXI A;  1N2X A;  1SXD A;  2K8A A;  2Y1I A;  4ECR A;  3QXG A;  2W04 A;  2GO7 A;  4WJ3 B;  2A1J A;  5H2F U;  3WK5 A;  1ZQG A;  4G3I A;  5EE1 A;  2PKE A;  3RR8 A;  4HYK A;  2G5H B;  1SZH A;  3TAP A;  2KZZ A;  5KFJ A;  2KEY A;  5AKL A;  3TFS A;  1Q8K A;  4F4K A;  5KT6 A;  3GDX A;  2H3Q A;  3NAS A;  2ZUB A;  1DXS A;  2WF7 A;  9ICE A;  4FZM A;  3T3F A;  3SAG A;  1NI3 A;  3PSF A;  4J9M A;  4NM1 A;  1PK1 B;  5KFD A;  4ELU A;  3ZDC A;  2BCQ A;  3RB3 A;  5AKJ A;  4RNM A;  1ZQS A;  3MFH A;  4US9 A;  2W3S A;  4GC6 A;  1ZQV A;  2ALZ A;  3CYM A;  1C20 A;  2F8K A;  4QWB A;  3EUB 2;  3IG8 A;  5ALE A;  3GIJ A;  1Z1V A;  3MR6 A;  2H3Z A;  4ED1 A;  4F8R A;  1VDV A;  5AKH A;  3QX7 A;  5KFL A;  1BPD A;  2IOH A;  4MFF A;  2FPK A;  5J0R A;  4QWA A;  4RNO A;  9ICI A;  4JUZ A;  4KLL A;  1BPE A;  1S76 D;  3I1Y A;  2EAN A;  5ALV A;  1XO1 A;  3Q8M A;  2BQ3 A;  3ETR A;  1X9S A;  4O5E A;  3E0F A;  5CR0 A;  2I5H A;  5KFT A;  5J2E A;  3GIL A;  3SZ2 A;  5KG5 A;  4M04 A;  3N7S C;  3OTQ A;  2W7P A;  3D2N A;  1ECW A;  4UQG A;  4MFC A;  1ZYQ A;  2XI9 A;  2O6K A;  3S6J A;  5KT2 A;  3UXP A;  2MU2 A;  1ZQU A;  3Q8Q B;  2ZIV A;  1ZJM A;  2BCS A;  1JMS A;  3NTU A;  7ICG A;  5AIC A;  5JUM A;  3Q8R B;  2HHU A;  2HOF A;  4KN4 A;  3TAQ A;  3BZK A;  1ZQX A;  2BDU A;  3C2K A;  4NL9 A;  2YML A;  4U6P A;  3FDS A;  4TQS A;  5ALU A;  2OCE A;  3RBE A;  3KZX A;  3PML A;  9ICJ A;  1MA7 A;  4FE3 A;  2KJ9 A;  3V7J A;  5DB7 A;  1Z19 A;  1S0M A;  4Y2P A;  5HHI A;  4JK1 A;  2AU0 A;  3RAX A;  2PI5 A;  2FLL A;  3HIL A;  3IHQ B;  2PFN A;  2AJQ A;  3AEV A;  8ICQ A;  2CPR A;  2EDU A;  2YB1 A;  4NLG A;  1ED1 A;  1XO0 A;  3BQT A;  2ZTC A;  3KHG A;  4TUS A;  4LVS A;  4I2H A;  1ZD5 A;  4P4M A;  4PGX A;  1TKD A;  3EWA A;  4JV0 A;  1WWV A;  3SI8 A;  3BQ1 A;  4NLB A;  4RUA A;  2R18 A;  2K8C B;  5AKZ A;  3PX0 A;  3RJG A;  8ICW A;  1IM4 A;  5KFU A;  4ECX A;  2LI6 A;  5III A;  4CF4 A;  5KFH A;  3NRW A;  4UB5 A;  1L7M A;  5KFV A;  4DL4 A;  1SWW A;  4PL1 A;  3LWL A;  3RJK A;  3PR4 A;  3HJE A;  3PV8 A;  2PMZ C;  3HWT A;  3ETL A;  4USA A;  1UPH A;  2M9N A;  4QW8 A;  5J2D A;  4JWM A;  2WAQ F;  4EYI B;  4CRX A;  2HHV A;  4Y2S A;  4UAY A;  1A6S A;  1QSS A;  1D8Y A;  4M0A A;  4PPX A;  2ZJ8 A;  5AKX A;  5HR6 A;  8ICX A;  1B43 A;  4DSF A;  5J2C A;  5K4L A;  4KLF A;  5GTH U;  5DB8 A;  1S77 D;  5KTQ A;  4UW9 A;  2AH5 A;  4C4T A;  4DSJ A;  2IA6 A;  1ZQN A;  3PX4 A;  4GXJ A;  2OM6 A;  5ALI A;  1NK5 A;  4NXZ A;  7ICF A;  4RT3 A;  4UB4 A;  2VJ4 A;  2DKX A;  1S5L U;  4J9K A;  3UPQ A;  2HSZ A;  4PH5 A;  4P0Q A;  2EAP A;  3HRD D;  2BDP A;  2PI4 A;  4ECY A;  5AI8 A;  3IDW A;  2XC9 A;  9ICH A;  9ICX A;  1NK4 A;  1OXJ A;  1COK A;  3RB6 A;  1UA1 A;  1WWU A;  2V9W A;  2Q4T A;  4C8M A;  1F5S A;  2P66 A;  4O3M A;  5KL1 B;  5DKW A;  1VLB A;  2UVR A;  4I2I A;  2PMZ F;  4DWI A;  3V7L A;  2KSO A;  2YQE A;  5IIO A;  4NLC A;  4Q43 A;  4JV1 A;  2JEI A;  4QZB A;  4IRC A;  4OJ6 A;  5CP2 A;  2DFL A;  2HBK A;  7ICH A;  2XVT A;  3V7K A;  2PFP A;  2LPE A;  5HMM A;  3TFR A;  5J0T A;  9ICT A;  9ICR A;  2N1R A;  4O3S A;  3H8S A;  4QZA A;  4X5V A;  4Z6D A;  3UXN A;  3OJU A;  1TV9 A;  2QB1 A;  5G5G A;  4F3O A;  1N62 A;  3H8M A;  5L1J A;  3RJJ A;  1DK2 A;  2Y0S C;  1O08 A;  2G5I B;  1KDH A;  5AM5 A;  5ALS A;  4M6W B;  2Y1J A;  4O0I A;  5J2G A;  4ECT A;  3SR6 A;  3C5G A;  4JWN A;  4K4H A;  2P35 A;  4PHP A;  2LHT A;  1S9F A;  1U9L A;  4UAW A;  5AI9 A;  2JEG A;  4F5Q A;  1KQQ A;  4RQN A;  3V6K A;  1X2I A;  3EZ5 A;  5ALZ A;  3ALR A;  4O3O A;  5CB1 A;  3AU2 A;  3F2C A;  1ZQM A;  3G6V A;  7ICK A;  2E8P A;  3F5A A;  5KFC A;  1ZD4 A;  4M9H A;  5HNK A;  8ICH A;  2PXI A;  2NRW A;  4YD1 A;  1C7Y A;  1BNO A;  3M9M B;  3CRX A;  4DQR A;  4F5P A;  3NGD A;  1X40 A;  1X6I A;  4QZH A;  4UAT A;  3NVY A;  3NVW A;  2KKP A;  5ALL A;  5EOZ A;  4RPX A;  4DSI A;  9ICV A;  1J97 A;  4Q8F A;  2OEH A;  1A77 A;  3MBY A;  2RDI A;  4YMN A;  4F5R A;  2KIW A;  3AL0 B;  7ICS A;  4UBC A;  8ICC A;  1Q46 A;  4P2H A;  3HKZ C;  5ALM A;  4P4O A;  5GTI U;  4BWJ A;  2HBJ A;  3N97 B;  4F93 B;  2BPC A;  3IM1 A;  1PZN A;  4KLD A;  3JPT A;  1Z00 A;  7ICV A;  2WF9 A;  5KG4 A;  2J6S A;  5J0S A;  3RRG A;  2BR0 A;  4BDP A;  1ZQR A;  4G9B A;  4RPZ A;  1ZQW A;  9ICO A;  4M9L A;  4GIB A;  3QUT A;  4KMU A;  4DFD A;  4ZH4 A;  1B4F A;  3EPG A;  1V97 A;  1UCV A;  2HBM A;  3N28 A;  2M0N A;  3H4B A;  2KMD A;  1S8O A;  3PW7 A;  4O3R A;  2YB4 A;  9ICQ A;  4ELV A;  3HW8 A;  7ICU A;  2FLN A;  1KRP A;  3M9O B;  5KFB A;  8ICY A;  1SKW A;  2FLP A;  5KFR A;  4F4Z A;  1SXE A;  2H3I A;  5DG8 A;  5DB9 A;  4C80 A;  1RPL A;  2YX8 A;  1PVR A;  5L1M A;  4DLG A;  4CF5 A;  5AK6 A;  3C2L A;  5AIA A;  4Y2Q A;  3SYZ A;  1N48 A;  3RH4 A;  3HKZ F;  4DFJ A;  5AK3 A;  2RDJ A;  1PUZ A;  1NOM A;  2JH1 A;  3F5E A;  2V4Q A;  1UT5 A;  1KFS A;  3MGV A;  5KT4 A;  5AM2 A;  1H38 A;  4NLK A;  4C8O A;  2KJ5 A;  2V4R A;  4F4X A;  4NWI A;  2RRD A;  2H3V A;  4RQM A;  5AKK A;  3PR5 B;  4ED8 A;  3C21 A;  4MF2 A;  3LWM A;  2LYB A;  3SEN A;  2MUT A;  4GXI A;  5BPC A;  1JXL A;  5DDM A;  4BXO A;  4EZ9 A;  1V9P A;  2IHN A;  2RHF A;  4IR1 A;  1M6Y A;  1NKE A;  2EAM A;  1RYS A;  1KN5 A;  4J9R A;  3H7I A;  3ZDB A;  3OSP A;  4OCZ A;  4I2D A;  3LVV A;  5KNI A;  5BOM A;  3WKA A;  1ZET A;  3JPN A;  3D6J A;  4DFK A;  3BZC A;  2JV3 A;  2HHX A;  3Q8K A;  3AUO A;  4KLH A;  2XGP A;  1SKS A;  2AGP A;  4P0P A;  3RAQ A;  4R65 A;  3N7R C;  5L1K A;  5KG7 A;  1RM6 C;  1TE2 A;  4DOA A;  3L4P A;  1V85 A;  4F5O A;  2NYV A;  2D6F C;  2ODG A;  1NJX A;  3Q8P B;  2QLT A;  3ICX A;  4IQT A;  2R8I A;  3C5F A;  1LV5 A;  4O9M A;  4LJX A;  2ZUD A;  5KFE A;  1JRP A;  1WG8 A;  1JRO A;  4F91 B;  8ICV A;  4KLG A;  1NK9 A;  2EQY A;  4OJP A;  4YR3 A;  2MA1 A;  5D49 A;  3GZF A;  4OJO A;  4P4P A;  3KHL A;  5AKE A;  1KFD A;  1FO4 A;  8ICF A;  3NS1 A;  7ICI A;  4GFJ A;  3NVV A;  1Q3U A;  7ICN A;  3RRH A;  2KFN A;  4KTQ A;  2K89 A;  1ZQP A;  3SEI A;  4TUQ A;  3SAF A;  4ICA A;  2HDO A;  4B9S A;  1SV0 A;  4FFD A;  1PK1 A;  4PGY A;  5J29 A;  2HHW A;  2MSN A;  2G06 A;  5AM4 A;  1K1Q A;  5J0W A;  4KMO B;  4RZR A;  2XY5 A;  5AI4 A;  1JAL A;  4CDG A;  3LYS A;  4QW9 A;  1UQV A;  3H8J A;  4YN4 A;  1LB2 B;  4YXM A;  4LZG A;  3UMC A;  4DOC A;  5KFY A;  8ICS A;  2KNJ A;  2LMR A;  1WCN A;  3PY8 A;  2FMS A;  5AM0 A;  2ATL A;  1T94 A;  5ALH A;  2ZIW B;  4J9L A;  1K5O A;  2DQN B;  1D8L A;  5C5J A;  4Y2J A;  3OGU A;  1KFT A;  4DS4 A;  2KP7 A;  2ZXH A;  1RQN A;  1QCK A;  2QB0 A;  2CRX A;  4J9N A;  3FM9 A;  5KFN A;  5E79 U;  4KLU A;  5J2K A;  4FO6 A;  2BZF A;  5AI0 A;  3OHA A;  3JPR A;  5F9L A;  2WB1 C;  5J0X A;  4TUR A;  5JTI A;  3RFA A;  1S0O A;  1QH9 A;  2K60 A;  1KEJ A;  4ECW A;  4YG2 A;  2DUY A;  2WAQ C;  4YR0 A;  1N63 A;  2OXO A;  3BS7 A;  4IC9 A;  1N5X A;  4Z6C A;  1NKB A;  2F1J A;  3T5K A;  1PVP A;  7ICT A;  4DL2 A;  3BQ2 A;  1DGS A;  1ZQJ A;  3H4D A;  5AI6 A;  1TAQ A;  4QZ8 A;  3PSI A;  1IV8 A;  3RB0 A;  1KBU A;  3E2E A;  3A0B U;  5DG9 A;  8ICN A;  4R8U B;  4QWD A;  3ONN A;  2OH2 A;  2HW3 A;  4F2S A;  2ZIU B;  2A19 A;  2IHM A;  4FZL A;  1JUD A;  2PFO A;  1X9X A;  3VC8 A;  1ZRM A;  2F3N A;  3O0F A;  3SD7 A;  3C28 A;  4FS2 A;  4EX7 A;  2JGA A;  4PZO A;  4I2A A;  4C7Z A;  2KZM A;  1NZB A;  2EZY A;  4I2G A;  4DL3 A;  3AM9 A;  2VAN A;  4A8E A;  5AK5 A;  3DDH A;  4M9J A;  3QEB Z;  2K4E A;  1JIH A;  2NRT A;  2P6R A;  2WB1 F;  3TAC B;  4IR9 A;  3SQI A;  4MEX A;  5J2A A;  2VA3 A;  2C2R A;  8ICK A;  2C22 A;  5DQG A;  2OYY A;  5KFK A;  3L5K A;  3GII A;  2E5S A;  9ICP A;  2LYA A;  4NL9 C;  4XRH A;  9ICF A;  4U7C A;  1D8B A;  1YZ7 A;  4R64 A;  3J81 j;  1ZQH A;  3K1R B;  3TQ1 A;  2QKQ A;  3T5L A;  2WF5 A;  2GOL A;  3UXO A;  4UBB A;  5CRX A;  3H40 A;  4MFA A;  1L7N A;  4M9N A;  1FFV A;  7ICP A;  4UAU A;  1F0M A;  1RQL A;  2HVI A;  2E1E A;  4KLI A;  2DF4 B;  4DQP A;  4CF3 A;  2J6T A;  2OWO A;  3VCB A;  8ICJ A;  5B5E U;  4I2C A;  2IOF A;  4E0D A;  5HML A;  5ALK A;  4IRK A;  4AP9 A;  2F1I A;  2RP5 A;  2C2E A;  1L3T A;  2LKY A;  4DQQ A;  9ICL A;  3KOO A;  2J6U A;  1XS9 D;  4RQ7 A;  2W54 A;  2ZJ5 A;  5ALR A;  5IIJ A;  1MQ3 A;  1N56 A;  2W9C B;  1QSY A;  2LM1 A;  5KT7 A;  2MRL A;  8ICE A;  2VA8 A;  5ALJ A;  4BJQ A;  4IQV A;  2Q0Z X;  3BJY A;  3V72 A;  3NRZ A;  2I6X A;  2IMW P;  3WK7 A;  7ICQ A;  7ICJ A;  5F3X B;  4FS1 A;  3V6J A;  2OHF A;  3ZD9 A;  3WK6 A;  4DF8 A;  2RQ5 A;  2BCV A;  3WU2 U;  1BPB A;  4O3Q A;  4XA5 A;  2DBY A;  3ZI4 A;  3MDC A;  1XWL A;  4RQ4 A;  4M6W A;  5KL8 B;  4RQ5 A;  1Z3E B;  2JXJ A;  4ED2 A;  3GU3 A;  4AYB C;  2Y9T A;  8ICZ A;  1TAM A;  3ZD8 A;  4ACO A;  1LKY B;  1TFR A;  3QNM A;  4F71 A;  3QZ8 A;  3PW2 A;  5ALW A;  3HT3 A;  2R8G A;  1L5U A;  2KN7 A;  1JX4 A;  1Q3V A;  3MR5 A;  4F4W A;  2YTU A;  4RU9 A;  1X9W A;  1RYR A;  2KTQ A;  4C8L A;  1BVS A;  4NY8 A;  2HHS A;  2YN4 A;  2ZUC A;  4B6J A;  4Y2V A;  3QE9 Y;  5HR7 A;  5EWE A;  5KFO A;  2EH9 A;  3ISD A;  2KZ3 A;  5J8Y A;  3AQE A;  3QU5 A;  1Z4O A;  4KIT B;  4Y2R A;  4NM2 A;  2HVH A;  1ZRN A;  3C29 A;  2YMP A;  2W9M A;  3WKD A;  4QZI A;  3TAD A;  4TUP A;  1XSN A;  3JPP A;  2F76 X;  2KFZ A;  4AYB F;  4MHV A;  3C1Z A;  1FEZ A;  1U45 A;  3QU7 A;  3ED5 A;  4DL6 A;  4KLE A;  5KT3 A;  2HOQ A;  3V6H A;  4ECU A;  1NJW A;  4I2B A;  3F2B A;  1IIP A;  2LYH A;  4UAR A;  1HUZ A;  1MC8 A;  2Y9U A;  1T4G A;  1S97 A;  2IOF K;  2UVU A;  4F2R A;  5CEH A;  3F2D A;  5ALT A;  5KG0 A;  3JPO A;  3RH5 A;  1ZQT A;  4O5K A;  1SV4 A;  1TVA A;  2JZB B;  3JPQ A;  2AQ4 A;  1ZQ1 C;  3RJE A; 
#chains in the Genus database with same CATH homology
 3KZX A;  1MA7 A;  1WUD A;  4FE3 A;  2KJ9 A;  2H3I A;  2Z7J A;  4U7C A;  1P7D A;  2KEY A;  2W03 A;  1TAM A;  3ICX A;  1Z19 A;  1D8B A;  2Y0S F;  3IP4 B;  4ACO A;  2VJ4 A;  2A3V A;  2H3Q A;  2YX8 A;  2KHQ A;  3L3F X;  4QIW C;  3N7P D;  4P0Q A;  4QJF B;  1PVR A;  2WB1 C;  2ZIW A;  4FZM A;  5T14 A;  3IG5 A;  3SAG A;  3SMV A;  3RFA A;  4OJP A;  2F2A B;  2GOL A;  2CPR A;  3HKZ F;  3CRX A;  5CRX A;  2MA1 A;  4BUG A;  1Q3V A;  2YB1 A;  1ED1 A;  1XO0 A;  2G0A A;  2VIX A;  4KX3 A;  2ZIX B;  3GZF A;  4OJO A;  3PSF A;  2GH1 A;  2Q4T A;  2KKP A;  3H0R B;  2WAQ C;  2HMX A;  4O3M A;  2JH1 A;  3F5E A;  3AQF A;  5KL1 B;  3LVW A;  2OXO A;  2E1E A;  3MGV A;  2G09 A;  4IC9 A;  2DF4 B;  4GFJ A;  2JMG A;  4OO1 J;  4NLB A;  2PMZ F;  3CYM A;  4NV0 A;  1PVP A;  2R18 A;  2K8C B;  1Q3U A;  2KD1 A;  2KJ5 A;  3IG8 A;  1CRX A;  3VCB A;  4NLC A;  2K89 A;  2KIW A;  2W7O A;  2CRX A;  1HIW A;  4OJL A;  2H3Z A;  4CGZ A;  3AL0 B;  3PSI A;  4OJ6 A;  2H3F A;  1HEK A;  2HBK A;  4NWI A;  1KBU A;  2XVT A;  2LBO A;  2RRD A;  3SAF A;  3NRW A;  2H3V A;  5HR7 A;  4ICA A;  3SAH A;  2RP5 A;  3HKZ C;  3AQE A;  2ZIV B;  3ONN A;  2OH2 A;  2LKY A;  4QNL A;  2LYB A;  2NV3 A;  3RF9 A;  4PL1 A;  2JHD A;  2KHV A;  2N1R A;  3T79 A;  2HBJ A;  2ZIU B;  2ZIX A;  3KFU F;  4QIW F;  2F77 X;  2HOI A;  4FZL A;  2G06 A;  1F44 A;  4P0P B;  2F8L A;  3VC8 A;  4KMO B;  3C29 A;  1GO3 F;  2RHF A;  2Y0S C;  3IN5 A;  2PMZ C;  3O0F A;  1A0P A;  2KVC A;  4CDG A;  3PST A;  3C28 A;  2G5I B;  3LYS A;  3E0F A;  3M6K A;  4PL2 A;  2JGA A;  4C0Z A;  2DGZ A;  2E1F A;  1UPH A;  2F76 X;  4KX5 A;  3PZP A;  3N7S C;  2K8B B;  2MRL A;  2W7P A;  2KKV A;  1NZB A;  2KIC A;  1YT3 A;  3D2N A;  1ECW A;  5A0L A;  2WAQ F;  2XID A;  4AYB F;  1XNS A;  4CRX A;  3D2S A;  1URJ A;  2KNJ A;  4BJQ A;  3H0M B;  2XI9 A;  2G07 A;  1A6S A;  4FZN A;  4JMU A;  4A8E A;  3LVV A;  4BX9 C;  1DRG A;  2CN1 A;  2G08 A;  2HOQ A;  2LHT A;  2ZIV A;  1Z1B A;  2K4E A;  2HBL A;  2D6F C;  2HBM A;  2KJ8 A;  1T94 A;  3F5A A;  2M0N A;  2ZIW B;  3PSP A;  1OUQ A;  4P0Q B;  5HR6 A;  3F2B A;  2ZIU A;  1IIP A;  2WB1 F;  2ZG6 A;  2ZXI A;  2YB4 A;  2K8A A;  4OJ5 A;  1PVQ A;  2K4I A;  3SQI A;  1L6N A;  2DQN B;  2HOF A;  4P0P A;  3M6Z A;  2VKQ A;  2W04 A;  3DEE A;  3N7R C;  3NUQ A;  2KOB A;  2KV2 A;  2BDU A;  4WJ3 B;  3OPX A;  3F2D A;  2K4H A;  5C0Y A;  2VJ5 A;  2JH7 A;  2OYY A;  2OM6 A;  3ALR A;  3D2Q A;  4U6P A;  5KL8 B;  3H0L B;  3F53 A;  3M7D A;  3CP8 A;  3F2C A;  2E5S A;  2ZXH A;  2G5H B;  3GU3 A;  1ZQ1 C;  4AYB C;  1SZH A;  3K1Z A;  2LYA A;  2XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...