2G5IB

Structure of trna-dependent amidotransferase gatcab complexed with adp-alf4
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
410
structure length
410
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 120
structure length 410
sequence length 410
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5iB02
2F2AB 4WJ3B 2D6FC 2G5IB 2G5HB 2DF4B 1ZQ1C 2DQNB 3IP4B 3H0LB 3AL0B 3KFUF 3H0RB 3H0MB
chains in the Genus database with same CATH superfamily
7ICQA 3KTQA 3TAPA 2WF6A 3PMLA 3NRWA 1D9FA 4UASA 4Y2RA 1TK8A 4I2AA 2UVVA 5CHGA 1BPDA 2JV3A 4GXKA 4GXJA 1LVHA 3CNHA 2DKXA 1K1SA 2VIXA 1MQ3A 1J2MA 1SL2A 5KFQA 1FIQA 1KN5A 2B0CA 2DFLA 1TAMA 9ICJA 3H8SA 1L5UA 4ECUA 2G09A 4RU9A 2QLTA 2G06A 4R66A 3MC1A 1D8YA 3A0HU 3LVVA 3RB3A 3ETRA 8ICIA 2ASJA 3MBYA 3QUQA 7ICKA 3JPRA 4M04A 3FDSA 5J0PA 8ICNA 2AGQA 4KLJA 1B22A 4CF3A 4YFKA 5CJ7A 3SR6A 4QZDA 1TFRA 2Y0SF 2YMPA 4ACOA 2H3QA 2KJ9A 4Q44A 1ZQYA 4M47A 3PVXA 4DLEA 3S6JA 4G9BA 5J2DA 4BDPA 4F4WA 4YR0A 4KMUA 1TVAA 3C2MA 4F5OA 1UPHA 4RPZA 5DKWA 5KFGA 3THVA 4IQTA 1WYGA 2HHXA 1BPYA 5KG6A 8ICLA 1DXSA 1X9SA 2AXTU 1NKCA 3SENA 5ALOA 1XSPA 1X9MA 2YB4A 1NI3A 1U47A 1RG6A 2JZBB 4DSKA 5KFRA 4QZAA 2ISOA 1B43A 3D2QA 5KFTA 1N56A 4NXZA 4JWNA 2W7PA 7ICPA 2EAOA 4HAIA 3RF9A 2RLTA 1U49A 3N7RC 1SKSA 4F5QA 7ICTA 3GU3A 4LVSA 3SMVA 2BHNA 8ICMA 2BQRA 3GZFA 4KLOA 4UB6U 2ZIVA 5KNIA 2NRXA 1XSNA 4UB1A 3L4PA 3M9OB 1BPZA 4ZOHC 8ICJA 2PMZF 5J2EA 2ZJ8A 2NO5A 2YN4A 3C21A 5KFVA 2E8MA 3HWTA 5ALPA 2E1FA 3ZDEA 2KFZA 3DDHA 5CRXA 3ZD9A 1COKA 1S0OA 3HW8A 1V85A 1U4BA 2AGOA 4JV2A 8ICGA 4F5PA 5J2BA 1IIPA 1NKBA 4NLZA 5AKXA 5J0OA 2W9BA 8ICKA 3VCBA 2R8JA 9ICOA 4C8KA 1ZQTA 1B0XA 3ONNA 3QU4A 5KL8B 3RJEA 5AK5A 2W3SA 3RB0A 5AICA 3LDAA 4PHDA 2V4QA 2WF7A 1C20A 5AM3A 2CN1A 2BQUA 4B9SA 1X42A 5ALJA 3KZIU 1P7DA 2QARB 1IV8A 4CF5A 1KRPA 1TAUA 3GQCA 2YMMA 3PX6A 4XA5A 4PZOA 1JROA 2I5HA 4B6JA 5T14A 2ZIWB 3QU9A 3BZCA 4DQRA 5IIKA 1ZRNA 3H0RB 4F92B 2D3DA 2YB1A 3PO4A 2NRTA 1HJPA 2CPRA 4RNMA 4U7CA 4Z6EA 2E5SA 4O3MA 3ETLA 5E79U 4JK1A 1PZNA 5AKEA 1DGSA 2ZJAA 2RDJA 1LKYA 4P0PA 5AK3A 4ED6A 1A6SA 3ED5A 2DGZA 3N28A 5BPCA 3QUTA 4KMOB 3TADA 3UMGA 1T3NA 4YG2A 4ECTA 7ICFA 1NJXA 4M9LA 1DK3A 1ZQLA 2ZTDA 2EZZA 1SL0A 1UHUA 3F2DA 4DSFA 1NKEA 2GOLA 3BZKA 4UB8U 1ZD3A 4DCCA 4I2DA 1NK7A 4NJ8A 3C1YA 4J9SA 3MGHA 2QKQA 4ECRA 2JMGA 4CE6A 3PNCA 5KG2A 4BXOB 5F9NA 4C8LA 5DDYA 5F3XB 5ALIA 1F5SA 4P0QB 9ICHA 5ALWA 3V72A 5CWRA 1F44A 4B9UA 8ICVA 2LM4A 2EAPA 2HHSA 4F72A 3H4BA 4Y2YA 8ICQA 3UPQA 2Q0ZX 4IL6U 2W04A 4DF8A 4KLUA 3F2BA 3AEVA 1N5XA 5GTHU 4YVZA 1LV5A 5KFXA 9ICAA 2AQ0A 3AL0B 3C2LA 4F5RA 1Z00B 1BPBA 1KW4A 3D2SA 1SB3C 2RDIA 4CRXA 4YD2A 5A0LA 2OH2A 1N48A 2J6SA 3ZDBA 2ISPA 4YR3A 5KG3A 3SI8A 2N1RA 3SAHA 2QB0A 2IOFA 3IRUA 3UXNA 4F5NA 5DGBA 4OCZA 7ICSA 4PPXA 3L5KA 1S8OA 4RPXA 1ZQDA 3WK6A 4OJLA 1PK1A 3OJSA 5L1KA 3WK9A 1L7PA 3T3FA 2E8PA 3FYHA 1A77A 3DV9A 3V6HA 5ALDA 5JRTA 2MU2A 5KFMA 3NUQA 3LYSA 3GV7B 2ZXIA 3BQ1A 4Q43A 4I27A 3QZ7A 7ICHA 4C80A 4QIWC 4Y2PA 9ICCA 2ZXHA 4QZ9A 2BCRA 2G08A 3WK7A 2VA3A 1L3UA 4QZEA 1ZQGA 2K4IA 1X40A 5AI8A 2F44A 2CXYA 2WFAA 4EYIB 4RNOA 2IOHA 3HP6A 4PHAA 3NS1A 3RR7A 1ZQVA 5J0XA 4I2CA 5KFAA 3BS7A 2OM6A 4GC6A 4QWEA 3RH4A 4OJ5A 2MA1A 3ISCA 2YQEA 1V9PA 3HJEA 3GDXA 4G3IA 5DBAA 1RXWA 4DL4A 7ICEA 4Y2JA 3PW5A 2GH1A 4YXMA 2HDOA 4YR2A 2BR0A 5ALXA 3EYZA 2HVHA 2KVCA 1Q8KA 2JRZA 9ICFA 2LYHA 3F2CA 1JXLA 2K89A 2PI4A 4C8OA 3WU2U 2HMXA 4UATA 1BNOA 4P4PA 3MR6A 4I2BA 3GIKA 2BCVA 3UQ0A 1TE2A 3SAGA 4ED8A 5AI0A 1O08A 3RJIA 4EX7A 4XQ8A 4QZCA 3QUBA 1XS9D 5KFFA 7ICJA 2D8CA 2RRDA 2KICA 3VC8A 3QX7A 5KT3A 3T5JA 3KHRA 1BVSA 1IM4A 2AH5A 5AIAA 3WK5A 5J2KA 3AU6A 3QZ8A 2HOFA 4IQWA 5KT6A 3RR8A 8ICBA 3RH6A 3TFRA 5KT5A 4J9KA 1ZQXA 1DK2A 1OW5A 3TQ1A 4QWCA 9ICXA 4NM2A 4UAWA 4IR9A 3UXOA 5KT2A 2YY6A 5JU5A 3GIIA 4EX6A 1SWWA 4UAYA 5DGAA 2PXIA 3AM9A 3ZDCA 4CF4A 4QZFA 1GO3F 3IM1A 5HR7A 2RP5A 2MUTB 2M9NA 2ZIXA 3QEAZ 1O03A 1A0PA 2H5XA 4GLXA 5EWGA 4M6WA 5KFUA 2UVRA 1SWVA 1NK0A 4YCXA 3BS5A 1L3TA 2XIDA 2OXOA 3ISBA 4J9OA 1ZQCA 3PSIA 1URJA 4KTQA 2FMPA 5L1JA 5KG4A 5H2FU 2KHQA 4Q8EA 3OTQA 4B9LA 2XI9A 2ASLA 5HMMA 1FFVA 1ZQOA 4ED1A 7ICRA 8ICRA 5KFYA 1X9WA 4YMMA 4EZ9A 2LKYA 2LYBA 2PFQA 2HHVA 1XNSA 1LKYB 4P0PB 1IG6A 1Z4NA 2IOFK 2K8CB 4C0ZA 1D9DA 4KITB 4OJPA 2KEYA 3LWLA 1KLNA 5AK4A 3C28A 4DF4A 2F77X 4JV0A 5CA7A 4O3RA 5KTQA 1ZXIA 2FPKA 4JB3A 3AQEA 4KN7A 5HNKA 4FO6A 4DSJA 1RYUA 4RQ4A 4F50A 5KFLA 2IBKA 4RQ3A 1AQ6A 5HHIA 1DRGA 2R8KA 8ICEA 1NK5A 9ICWA 1S77D 1NNLA 4FZLA 4ZH4A 2KFNA 3MDCA 1NK6A 4JUZA 4KLTA 3G6YA 2K8BB 8ICUA 2PFNA 4TUPA 2ZUBA 1MA7A 4PGXA 2DUYA 1RXVA 1K1QA 3UXPA 4KLIA 5KFEA 3M8SA 3B0XA 3MGVA 4NLNA 2YMQA 4QZHA 2EZXA 5AKJA 4C8MA 1XO1A 4IR1A 2HOQA 2ZIUA 2Y0SC 4OD0A 5GTIU 4O5CA 4QJFB 2ZJ5A 1ZQQA 2KIWA 2J6UA 3IHQB 3AQFA 3CP8A 1WUDA 7ICIA 2C2DA 5ALZA 4KLSA 5DQIA 1PUZA 4UBBA 4Z6FA 2HCFA 8ICXA 4WJ3B 1A76A 5AKHA 3QU7A 9ICBA 5ALYA 3R9KA 3U26A 3RAXA 5DG8A 2G0AA 4KLLA 4O3QA 2QB0B 2BKEA 3RJHA 3H40A 4PHPA 5KT7A 4M9JA 1X6IA 1YZ7A 4NLBA 2HHWA 2R18A 2UVUA 8ICYA 1SIJA 5DB9A 1PK1B 4DLGA 5CR0A 2KSOA 1FFUA 4F2SA 2LYAA 2LMRA 3MR5A 1H38A 1S9FA 5AKGA 3V7KA 4USAA 3H7IA 3TADC 5EWEA 2I6XA 1RPLA 4TQRA 3EPGA 2AQ4A 4LZDA 3SEIA 2K4PA 5DQGA 1PK3A 1ZJMA 4QW8A 5J8YC 4M2YA 1ZD2P 1ZQKA 3C5FA 4UARA 1XU4A 3KFUF 4MFAA 3N97B 2NV3A 3KKAC 1KFTA 4C4TA 1PVPA 1QH9A 1RYSA 4QWAA 5DDMA 1MN8A 2DL0A 2F8LA 2KP7A 1ZQJA 2PMZC 3T5KA 3T79A 5B66U 5KFPA 4KX3A 2M0NA 2E3TA 4BWJA 1NK8A 3RRHA 3PR5B 3TKAA 4JV1A 4YXJA 2W55A 3C23A 5ALLA 3PW0A 2BGWA 3K1ZA 4NWIA 5IIJA 3OSNA 4UBCA 4DS5A 4CGZA 4X5VA 3Q8RB 2F2AB 1QSLA 5FP0A 1B4FA 2WB1F 2R8GA 2VA8A 4QZIA 4IQVA 3EPIA 1ZQHA 3OJUA 2XY7A 3H0MB 5J0TA 2JXJA 2D6FC 4I2FA 4NLCA 3NVVA 3H8WA 3Q8LA 2JHDA 3AUOA 2XO7A 1JIHA 1UQVA 3RFAA 1N5WA 1OXJA 2KVSA 2A19A 3IG5A 2VANA 2P35A 4I28A 2BDUA 2KN7A 5KFKA 2W8KA 3Q8QB 3N7SC 1N2XA 2JEJA 3PW2A 3KHHA 3O0FA 3J81j 3M9MB 2NYVA 4FBTA 2A1AA 3G6VA 3C2KA 1KEJA 4Z6CA 3EUB2 3ZDDA 5J8YA 5JTIA 2KTQA 1BNPA 3QE9Y 1RQLA 1Q46A 1DOQA 4EZ6A 3CYMA 7ICVA 3KKAA 4Q45A 8ICPA 2MRLA 5J2AA 5ALSA 4J9NA 5J0WA 3DEEA 1S0NA 1L3SA 4RQ0A 2EQYA 4LJXA 1ECWA 4KLEA 1ZOLA 3SV4A 2HHUA 5IIIA 4DWIA 4IS7A 1Y88A 5AHXA 3H4DA 2W54A 2VKQA 3IN5A 2BCSA 2W7OA 4NM1A 5ALNA 4M9GA 9ICGA 2MAXA 3QU5A 2W9CB 1ZQNA 3MR2A 3UMCA 1S0VA 4RQ5A 1SKWA 4J9QA 2XY5A 2FPLA 3EZ5A 1ZD4A 4CNQA 4DOAA 2C2RA 1IXRA 1YZ6A 1ZQ1C 1NJYA 4LZGA 1NK9A 1HUZA 1T7PA 1Z19A 5ALHA 4FZMA 5ALTA 3HKZF 3QYPA 3BQ7A 4M6WB 3OHBA 3PX0A 2W9AA 2W03A 2G5IB 3D2NA 3SV3A 2A1JB 8ICZA 3RBDA 4GIBA 5C0YA 4DFJA 4PGQA 2JZBA 2F1HA 4FS2A 1FO4A 3TAQA 3G6XA 9ICMA 3L3FX 5DLGA 4ECZA 1ZQFA 1WWUA 4DL7A 2KKPA 2F76X 3PSTA 3RAQA 3RJGA 4Y2QA 5AM0A 3F53A 3SQIA 2Y9TA 5EE9A 2P6UA 5KFBA 3GIMA 2G07A 2BCUA 2FLNA 5CB1A 3E2EA 4MFCA 2DPJA 4O0IA 2HBKA 2F8KA 2GO7A 3GFKB 1D8BA 2HVIA 4JWMA 5KAFU 4YN4A 1ZQWA 4TURA 3WKEA 7ICLA 2AJQA 1ZQIA 2FE9A 2NRZA 2HBLA 5AM1A 1ZQAA 3ORYA 1S0MA 4I2HA 3F5EA 1JALA 2JR5A 3WKBA 1NZPA 2BCQA 1RQNA 3RJKA 4IRKA 3I1YA 5KAIU 9ICQA 4F4YA 3SD7A 3ISDA 3SZ2A 4Y2VA 2CRXA 4HYKA 4PL1A 1RDFA 4RUAA 4KX5A 2MSNA 3QU2A 5KL1B 1KQQA 3BQTA 4GFJA 2F1IA 4FZNA 5DG9A 1BPXA 4C7ZA 4DL6A 3KOOA 3HX0A 4C7YA 4ED3A 3QUCA 1L7MA 3M6KA 2WF8A 3PSFA 2ZIUB 3JPOA 5ALEA 2V4RA 2ES6A 3PV8A 4MFFA 3QXGA 2H3ZA 1UA0A 3NTUA 4EELA 3C29A 2Y1IA 5AK6A 4GXIA 4KLGA 2ZIWA 5IIOA 3TANA 3ALRA 1ZETA 4O9MA 2WTFA 4UB4A 5ALFA 4PH5A 3WKDA 2FPMA 4DL5A 3RJJA 2OHFA 1ZQEA 5AI6A 5KFCA 3C5GA 2ZUCA 5AM5A 2ZG6A 1JRPA 1WG8A 2ZIVB 4R8UA 4RZRA 1KBUA 2W9MA 1AROP 4F4ZA 1NK4A 4M9HA 4F3OA 4KLMA 5L1LA 4JMUA 2WF9A 2DWQA 4IRCA 2KSOB 1LB2B 2EAMA 2LPEA 5J0QA 5AKZA 3Q8KA 3LVWA 4XRHA 2KD1A 4DOCA 9ICVA 1OUQA 5EWFA 4ELVA 2H3IA 1SKRA 4Y2XA 4B9VA 1DGJA 3D6JA 2W43A 3PW4A 3KBBA 4AYBF 1TK5A 1JMSA 4UAUA 9ICKA 3C1ZA 2KKVA 4DQQA 1C7YA 2KK0A 2A3VA 2BZFA 3K4GA 5AI5A 2W9BB 2H3FA 4BXOA 2WAQF 5KFDA 4AP9A 1TKDA 2HOIA 4P0QA 4R64A 2C22A 2DKZA 1MQ2A 5KG5A 4BWMA 4O5KA 1KKXA 1XWLA 3FM9A 1JI7A 1RZTA 4J9PA 2UVWA 2C2EA 2Y1JA 2AU0A 4YD1A 5DBCA 2KV2A 8ICCA 2Z7JA 4CCHA 2PI5A 5IILA 3NGDA 1Q3VA 1Z00A 4MF2A 4OO1J 1QQ5A 1TAQA 2BPFA 3UMBA 3SYZA 5DG7A 4QZGA 3M6ZA 2R8HA 3PX4A 2H3VA 4QW9A 1HEKA 2OYYA 4P4OA 4EEKA 1U48A 3HILA 3FAHA 5B5EU 1CUKA 2ZUDA 2XCAA 4ELTA 2EANA 2J6TA 4DS4A 4J9RA 2WF5A 3F5AA 4O5EA 2K4HA 3CRXA 4IQUA 5AI4A 1XC9A 5KFSA 3FC4A 2HW3A 1X6JA 4ECVA 2BPGA 1RYRA 3RRGA 4ELUA 3V6KA 3GILA 5AKLA 5EE3A 4UB5A 3TFSA 4F8RA 4O3SA 3AN1A 3HPOA 5KFWA 4UQGA 2PFOA 2EZYA 4RUCA 4O3OA 1TK0A 1KFSA 8ICOA 1Z1VA 2FDRA 4J9MA 4DOBA 3H0LB 4ED0A 1V97A 3MDAA 3IV6A 1ZQBA 7ICOA 2FMSA 3JPQA 1L6NA 2DF4B 1L8OA 2ZTCA 4DSIA 2VJ4A 3MGIA 1CI4A 2E8NA 3RBEA 3HRDD 1SXDA 3KHLA 4DSLA 2JEIA 4QWDA 2IHMA 5J2JA 2ZTEA 2R8IA 3GV8B 4BGDA 5J2HA 3RB4A 3V6JA 2VJ5A 4BUGA 3IG8A 4RQNA 1NJWA 5J0SA 1U9LA 2Q4TA 4B9MA 4KLQA 2KZMA 1S76D 5KG1A 3NVWA 4NLKA 2IHNA 2JEFA 4M0AA 3UM9A 4DQSA 4UW9A 4MEXA 3ZI4A 2NO4A 1ZJNA 1N60A 5AM4A 1Z3EB 1ZQMA 1ZQZA 9ICUA 5L1IA 9ICPA 3PMNA 5D49A 2RQ5A 2PFPA 3WK8A 1T8EA 4NLGA 3HT3A 3T5HA 2JGAA 1KL9A 1KFDA 3E0FA 4F2RA 1QQ7A 3KZXA 2DPIA 9ICLA 4MHVA 2IMWP 4Z6DA 4F4KA 1S10A 2E8OA 3I76A 5KFOA 3K75D 1HIWA 4YP3A 1N62A 7ICNA 2KJ5A 2XVTA 4KN4A 1MSWD 2HHQA 3TARA 3M8RA 4F71A 3NVZA 4UB2A 5DBBA 2XICA 1Z4OA 4O3NA 2O6KA 2RHFA 3Q8SB 4QWBA 3K1RB 3EW9A 4BX9C 2LHTA 2KOBA 3JPNA 4IRDA 5C5JA 3TI0A 2FLLA 2XCPA 5AKIA 4DSEA 1PVRA 3NRZA 1S97A 2F3NA 4E0DA 2BQ3A 1QLNA 3NVYA 2K4EA 1T4GA 4A8EA 2P6RA 3OGUA 4XUSA 4PL2A 5ALQA 9ICTA 3BDPA 2FI1A 2GWSA 1J2NA 2MUTA 2B21A 4DL3A 5BOMA 2G5HB 1J97A 4K4GA 4EYHB 4FS1A 4MF8A 1L3VA 2XGPA 3PO5A 1L7NA 4QNLA 4DL2A 2BDPA 1T94A 5F9LA 2WB1C 1UT8A 8ICSA 3PW7A 5J0UA 5IINA 3H8MA 3MFHA 1COOA 2AGPA 5AI9A 4UAVA 2IA6A 4RQ1A 4ICAA 5TZVA 5KFJA 4DQIA 5D4BA 3IDWA 1RM6C 1M6YA 5DB7A 3RH5A 2HI0A 8ICAA 4RT2A 2HHTA 4FBUA 8ICTA 5J2GA 3OPXA 5ALMA 5K4LA 4GC7A 5L9XA 4NV0A 1T3QA 4R8UB 5J2FA 4R63A 5AM2A 4EBEA 2ASDA 1Z1BA 3KD3A 4KLHA 3GV5B 4YQWA 1ZD5A 1NZBA 2V9WA 2W11A 3M1YA 4BJQA 2KG5A 4ED2A 3N4MB 1QCKA 1JUDA 9ICNA 8ICHA 8ICFA 3GIJA 1BPEA 2KZ3A 3Q8MA 5J29A 2I9GA 4ED7A 3ICXA 3OHAA 1PVQA 3WKAA 2KIVA 5ALGA 4U6PA 3V7LA 1XO0A 4EBCA 1JN3A 1WCLA 3M9NB 9ICEA 4KLFA 1FEZA 4ECQA 3TACB 5KFZA 2ZIXB 1QSYA 1WCNA 5ALRA 4DEZA 3NASA 4C4SA 5KFIA 1ED1A 1X9XA 3N7PD 4RQMA 3CW2C 2NRWA 2XGQA 2ESEA 4R65A 3BS5B 3I28A 1JX4A 3EWAA 5AIBA 4TUSA 2QB1A 2NRVA 3MR3A 4RQ8A 2K60A 5HR6A 3LWMA 1KTQA 2E1EA 2HBJA 4TUQA 1U45A 2LM1A 9ICRA 1QQ6A 5J0YA 4RQ2A 5TISU 1ZQRA 3RJFA 3B0YA 3IP4B 2GLEA 4B9NA 1KSPA 2XY6A 1N61A 5EE0A 1BGXT 3BQ0A 2ODGA 3AU2A 3HKZC 2L5YA 5HP4A 2FLPA 4NY8A 3JPPA 1SXEA 1UA1A 5AKYA 1NJZA 5DQHA 5KFHA 4QIWF 1NOMA 1L8LA 4O3PA 4F93B 4KLDA 3AMZA 4FFDA 2DBYA 2EDUA 4B9TA 4RT3A 4P4MA 4RQ6A 4RNNA 2YX8A 4MEYA 3Q8PB 2ATLA 1JXEA 5KFNA 1VJ5A 4UB3A 2I1QA 1X66A 3V7JA 1EXNA 2VA2A 4NL9C 1Q3UA 5CP2A 1UCVA 2DQNB 4IC9A 1ZQPA 4TQSA 2HSZA 1MC8A 3LK9A 4PHEA 5AKKA 3RTVA 3MFIA 4K4IA 5ALUA 5G5GA 5DLFA 1ZQUA 1D8LA 3BJYA 2P66A 1ZRMA 2KJ8A 2YMLA 2JEGA 1SGGA 2FMQA 4I2IA 4I2GA 3PZPA 4DO9A 3RB6A 2K8AA 1WWVA 1F0MA 4PJ0U 5ALVA 4Y2UA 3UQ2A 3WK4A 4PZNA 2JH1A 3QNMA 4I29A 3E58A 1SL1A 2QARA 4ECWA 7ICUA 1N63A 4YMOA 4DFMA 1K5OA 1QSSA 5KG0A 2WHEA 4QZ8A 3ZDAA 4DFKA 4J03A 5JUMA 4CDGA 4YMNA 2KE7A 5G5HA 2BPCA 4C8NA 2Y9UA 3M7DA 4P2HA 3ZD8A 4RPYA 5J2IA 4F4XA 4OJ6A 2LBOA 1SV0C 4DFPA 2KNJA 7ICMA 3JPSA 5EE1A 3OSPA 1SZHA 4EENA 2KHVA 2B6GA 4US8A 3BQ2A 1XSLA 1UT5A 2EH9A 7ICGA 3MABA 1KDHA 1HUOA 5DB8A 5BOLA 4OJOA 3QEBZ 3SAFA 1SZPA 2KMDA 3H8JA 4C4RA 4I2JA 4ECXA 5EOZA 4J9LA 2KZZA 2OWOA 4UAZA 2JH7A 1VDVA 5L1MA 1VLBA 4FE3A 5KG7A 5HMLA 1SV4A 4NL9A 1S5LU 5DB6A 2XC9A 3A0BU 9ICSA 4RQ7A 4F91B 3KHGA 1L7OA 5CEHA 1CRXA 2F1JA 2W3RA 4US9A 4PGYA 4Y2TA 4Q8FA 2YTUA 3B9JA 4EBDA 5ALKA 2HBMA 8ICWA 3PY8A 1V38A 4K4HA 3JPTA 4Y2SA 4QZBA 4AYBC 5D46A 2PKEA 1TV9A 2W9CA 9ICIA 4I2EA 5J0RA 2AHOB 1X2IA 4EEYA 1CEZA 2C28A 1ZQSA 3WKCA 2FJ6A 5KT4A 5J2CA 1YT3A 2ALZA 4DQPA 3PSPA 2WAQC 4ECYA 1QTMA 2W8LA 2OEHA 4DFDA 1SV0A 1ZYQA 2LI6A 5IIMA 5HHHA 4ECSA 4M9NA 3T5LA 2A1JA 2OCEA 3PR4A
chains in the Genus database with same CATH topology
1ECWA 1SZHA 3OPXA 1HIWA 2KHVA 2W04A 1OUQA 1MA7A 2F8LA 1GO3F 2KJ5A 2OM6A 2PMZC 4NV0A 3F2BA 3T79A 2H3IA 2HBLA 4KX3A 2M0NA 2XVTA 4OJ5A 2MA1A 2ZIWB 5T14A 1Z1BA 5HR7A 2RP5A 3F5EA 4QIWF 2ZIXA 3D2QA 3AL0B 3MGVA 3H0RB 4OJOA 2VKQA 4AYBF 3SAFA 3IN5A 1NZBA 3NRWA 2W7OA 4BJQA 2YB1A 3F2CA 1A0PA 3K1ZA 2W7PA 2GH1A 2KKVA 2CPRA 4NWIA 3D2SA 4U7CA 2XICA 3RF9A 4CGZA 2HOQA 2ZIUA 2E5SA 2F2AB 2A3VA 4CRXA 2WB1F 2Y0SC 4O3MA 3N7RC 4QJFB 5A0LA 2CRXA 2RHFA 3H0LB 3GU3A 4PL1A 2XIDA 2OXOA 2JH7A 2VIXA 2OH2A 3SMVA 2KVCA 2H3FA 4KX5A 2YX8A 4FE3A 4P0PA 5KL1B 3PSIA 3GZFA 3H0MB 1URJA 1TAMA 2KIWA 2WAQF 2LHTA 2K89A 4GFJA 2KOBA 4FZNA 2N1RA 2ZIVA 4BX9C 3SAHA 2D6FC 2HMXA 2HOIA 1L6NA 2DF4B 3ICXA 1ZQ1C 2KHQA 1WUDA 3AQFA 3CP8A 4NLCA 4P0QA 1A6SA 2DGZA 4KMOB 2VJ4A 1Z19A 1PVQA 1Q3UA 2G09A 2XI9A 3M6KA 2JHDA 4FZMA 4OJLA 3HKZF 3PSFA 2DQNB 2ZIUB 4IC9A 3RFAA 1PVRA 2G06A 3SAGA 4U6PA 4WJ3B 2W03A 2G5IB 3D2NA 1CRXA 2PMZF 2LKYA 2H3ZA 3LVVA 2LYBA 1XNSA 2K4EA 4A8EA 4P0PB 5C0YA 3C29A 3IG5A 1XO0A 2K8CB 4C0ZA 4OJPA 2G0AA 2VJ5A 4PL2A 2KJ8A 2KEYA 2KV2A 3NUQA 3IG8A 4BUGA 3F2DA 2Z7JA 2E1FA 2BDUA 3LYSA 2ZIWA 3C28A 3ALRA 2ZIXB 2ZXIA 4NLBA 2R18A 2F77X 3L3FX 3PZPA 5CRXA 2GOLA 2Q4TA 2Y0SF 3N7SC 2HBMA 2RRDA 4ACOA 2G5HB 1ED1A 2H3QA 2K8AA 2KJ9A 3N7PD 2KICA 3AQEA 3O0FA 1Q3VA 4OO1J 4QIWC 2KKPA 3VC8A 2F76X 2LYAA 3PSTA 4AYBC 2ZXHA 2JH1A 3M6ZA 2H3VA 1IIPA 2G08A 3F53A 3SQIA 1HEKA 2JMGA 2OYYA 4QNLA 1T94A 3VCBA 5HR6A 2WB1C 2ZG6A 2HOFA 2G07A 1UPHA 2ZIVB 3ONNA 2E1EA 5KL8B 1KBUA 1DRGA 2HBJA 4P0QB 2K4IA 1YT3A 4ICAA 4JMUA 3PSPA 2CN1A 3CYMA 4CDGA 2HBKA 2WAQC 1F44A 3IP4B 4FZLA 1D8BA 2JGAA 3KFUF 3F5AA 3M7DA 2MRLA 3E0FA 3KZXA 2NV3A 1P7DA 4OJ6A 2LBOA 2K4HA 3DEEA 1PVPA 3CRXA 3LVWA 3HKZC 2KNJA 2KD1A 2K8BB 2YB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  4WJ3 B;  2D6F C;  2G5I B;  2G5H B;  2DF4 B;  1ZQ1 C;  2DQN B;  3IP4 B;  3H0L B;  3AL0 B;  3KFU F;  3H0R B;  3H0M B; 
#chains in the Genus database with same CATH topology
 7ICQ A;  3KTQ A;  3TAP A;  2WF6 A;  3PML A;  3NRW A;  1D9F A;  4UAS A;  4Y2R A;  1TK8 A;  4I2A A;  2UVV A;  5CHG A;  1BPD A;  2JV3 A;  4GXK A;  4GXJ A;  1LVH A;  3CNH A;  2DKX A;  1K1S A;  2VIX A;  1MQ3 A;  1J2M A;  1SL2 A;  5KFQ A;  1FIQ A;  1KN5 A;  2B0C A;  2DFL A;  1TAM A;  9ICJ A;  3H8S A;  1L5U A;  4ECU A;  2G09 A;  4RU9 A;  2QLT A;  2G06 A;  4R66 A;  3MC1 A;  1D8Y A;  3A0H U;  3LVV A;  3RB3 A;  3ETR A;  8ICI A;  2ASJ A;  3MBY A;  3QUQ A;  7ICK A;  3JPR A;  4M04 A;  3FDS A;  5J0P A;  8ICN A;  2AGQ A;  4KLJ A;  1B22 A;  4CF3 A;  4YFK A;  5CJ7 A;  3SR6 A;  4QZD A;  1TFR A;  2Y0S F;  2YMP A;  4ACO A;  2H3Q A;  2KJ9 A;  4Q44 A;  1ZQY A;  4M47 A;  3PVX A;  4DLE A;  3S6J A;  4G9B A;  5J2D A;  4BDP A;  4F4W A;  4YR0 A;  4KMU A;  1TVA A;  3C2M A;  4F5O A;  1UPH A;  4RPZ A;  5DKW A;  5KFG A;  3THV A;  4IQT A;  1WYG A;  2HHX A;  1BPY A;  5KG6 A;  8ICL A;  1DXS A;  1X9S A;  2AXT U;  1NKC A;  3SEN A;  5ALO A;  1XSP A;  1X9M A;  2YB4 A;  1NI3 A;  1U47 A;  1RG6 A;  2JZB B;  4DSK A;  5KFR A;  4QZA A;  2ISO A;  1B43 A;  3D2Q A;  5KFT A;  1N56 A;  4NXZ A;  4JWN A;  2W7P A;  7ICP A;  2EAO A;  4HAI A;  3RF9 A;  2RLT A;  1U49 A;  3N7R C;  1SKS A;  4F5Q A;  7ICT A;  3GU3 A;  4LVS A;  3SMV A;  2BHN A;  8ICM A;  2BQR A;  3GZF A;  4KLO A;  4UB6 U;  2ZIV A;  5KNI A;  2NRX A;  1XSN A;  4UB1 A;  3L4P A;  3M9O B;  1BPZ A;  4ZOH C;  8ICJ A;  2PMZ F;  5J2E A;  2ZJ8 A;  2NO5 A;  2YN4 A;  3C21 A;  5KFV A;  2E8M A;  3HWT A;  5ALP A;  2E1F A;  3ZDE A;  2KFZ A;  3DDH A;  5CRX A;  3ZD9 A;  1COK A;  1S0O A;  3HW8 A;  1V85 A;  1U4B A;  2AGO A;  4JV2 A;  8ICG A;  4F5P A;  5J2B A;  1IIP A;  1NKB A;  4NLZ A;  5AKX A;  5J0O A;  2W9B A;  8ICK A;  3VCB A;  2R8J A;  9ICO A;  4C8K A;  1ZQT A;  1B0X A;  3ONN A;  3QU4 A;  5KL8 B;  3RJE A;  5AK5 A;  2W3S A;  3RB0 A;  5AIC A;  3LDA A;  4PHD A;  2V4Q A;  2WF7 A;  1C20 A;  5AM3 A;  2CN1 A;  2BQU A;  4B9S A;  1X42 A;  5ALJ A;  3KZI U;  1P7D A;  2QAR B;  1IV8 A;  4CF5 A;  1KRP A;  1TAU A;  3GQC A;  2YMM A;  3PX6 A;  4XA5 A;  4PZO A;  1JRO A;  2I5H A;  4B6J A;  5T14 A;  2ZIW B;  3QU9 A;  3BZC A;  4DQR A;  5IIK A;  1ZRN A;  3H0R B;  4F92 B;  2D3D A;  2YB1 A;  3PO4 A;  2NRT A;  1HJP A;  2CPR A;  4RNM A;  4U7C A;  4Z6E A;  2E5S A;  4O3M A;  3ETL A;  5E79 U;  4JK1 A;  1PZN A;  5AKE A;  1DGS A;  2ZJA A;  2RDJ A;  1LKY A;  4P0P A;  5AK3 A;  4ED6 A;  1A6S A;  3ED5 A;  2DGZ A;  3N28 A;  5BPC A;  3QUT A;  4KMO B;  3TAD A;  3UMG A;  1T3N A;  4YG2 A;  4ECT A;  7ICF A;  1NJX A;  4M9L A;  1DK3 A;  1ZQL A;  2ZTD A;  2EZZ A;  1SL0 A;  1UHU A;  3F2D A;  4DSF A;  1NKE A;  2GOL A;  3BZK A;  4UB8 U;  1ZD3 A;  4DCC A;  4I2D A;  1NK7 A;  4NJ8 A;  3C1Y A;  4J9S A;  3MGH A;  2QKQ A;  4ECR A;  2JMG A;  4CE6 A;  3PNC A;  5KG2 A;  4BXO B;  5F9N A;  4C8L A;  5DDY A;  5F3X B;  5ALI A;  1F5S A;  4P0Q B;  9ICH A;  5ALW A;  3V72 A;  5CWR A;  1F44 A;  4B9U A;  8ICV A;  2LM4 A;  2EAP A;  2HHS A;  4F72 A;  3H4B A;  4Y2Y A;  8ICQ A;  3UPQ A;  2Q0Z X;  4IL6 U;  2W04 A;  4DF8 A;  4KLU A;  3F2B A;  3AEV A;  1N5X A;  5GTH U;  4YVZ A;  1LV5 A;  5KFX A;  9ICA A;  2AQ0 A;  3AL0 B;  3C2L A;  4F5R A;  1Z00 B;  1BPB A;  1KW4 A;  3D2S A;  1SB3 C;  2RDI A;  4CRX A;  4YD2 A;  5A0L A;  2OH2 A;  1N48 A;  2J6S A;  3ZDB A;  2ISP A;  4YR3 A;  5KG3 A;  3SI8 A;  2N1R A;  3SAH A;  2QB0 A;  2IOF A;  3IRU A;  3UXN A;  4F5N A;  5DGB A;  4OCZ A;  7ICS A;  4PPX A;  3L5K A;  1S8O A;  4RPX A;  1ZQD A;  3WK6 A;  4OJL A;  1PK1 A;  3OJS A;  5L1K A;  3WK9 A;  1L7P A;  3T3F A;  2E8P A;  3FYH A;  1A77 A;  3DV9 A;  3V6H A;  5ALD A;  5JRT A;  2MU2 A;  5KFM A;  3NUQ A;  3LYS A;  3GV7 B;  2ZXI A;  3BQ1 A;  4Q43 A;  4I27 A;  3QZ7 A;  7ICH A;  4C80 A;  4QIW C;  4Y2P A;  9ICC A;  2ZXH A;  4QZ9 A;  2BCR A;  2G08 A;  3WK7 A;  2VA3 A;  1L3U A;  4QZE A;  1ZQG A;  2K4I A;  1X40 A;  5AI8 A;  2F44 A;  2CXY A;  2WFA A;  4EYI B;  4RNO A;  2IOH A;  3HP6 A;  4PHA A;  3NS1 A;  3RR7 A;  1ZQV A;  5J0X A;  4I2C A;  5KFA A;  3BS7 A;  2OM6 A;  4GC6 A;  4QWE A;  3RH4 A;  4OJ5 A;  2MA1 A;  3ISC A;  2YQE A;  1V9P A;  3HJE A;  3GDX A;  4G3I A;  5DBA A;  1RXW A;  4DL4 A;  7ICE A;  4Y2J A;  3PW5 A;  2GH1 A;  4YXM A;  2HDO A;  4YR2 A;  2BR0 A;  5ALX A;  3EYZ A;  2HVH A;  2KVC A;  1Q8K A;  2JRZ A;  9ICF A;  2LYH A;  3F2C A;  1JXL A;  2K89 A;  2PI4 A;  4C8O A;  3WU2 U;  2HMX A;  4UAT A;  1BNO A;  4P4P A;  3MR6 A;  4I2B A;  3GIK A;  2BCV A;  3UQ0 A;  1TE2 A;  3SAG A;  4ED8 A;  5AI0 A;  1O08 A;  3RJI A;  4EX7 A;  4XQ8 A;  4QZC A;  3QUB A;  1XS9 D;  5KFF A;  7ICJ A;  2D8C A;  2RRD A;  2KIC A;  3VC8 A;  3QX7 A;  5KT3 A;  3T5J A;  3KHR A;  1BVS A;  1IM4 A;  2AH5 A;  5AIA A;  3WK5 A;  5J2K A;  3AU6 A;  3QZ8 A;  2HOF A;  4IQW A;  5KT6 A;  3RR8 A;  8ICB A;  3RH6 A;  3TFR A;  5KT5 A;  4J9K A;  1ZQX A;  1DK2 A;  1OW5 A;  3TQ1 A;  4QWC A;  9ICX A;  4NM2 A;  4UAW A;  4IR9 A;  3UXO A;  5KT2 A;  2YY6 A;  5JU5 A;  3GII A;  4EX6 A;  1SWW A;  4UAY A;  5DGA A;  2PXI A;  3AM9 A;  3ZDC A;  4CF4 A;  4QZF A;  1GO3 F;  3IM1 A;  5HR7 A;  2RP5 A;  2MUT B;  2M9N A;  2ZIX A;  3QEA Z;  1O03 A;  1A0P A;  2H5X A;  4GLX A;  5EWG A;  4M6W A;  5KFU A;  2UVR A;  1SWV A;  1NK0 A;  4YCX A;  3BS5 A;  1L3T A;  2XID A;  2OXO A;  3ISB A;  4J9O A;  1ZQC A;  3PSI A;  1URJ A;  4KTQ A;  2FMP A;  5L1J A;  5KG4 A;  5H2F U;  2KHQ A;  4Q8E A;  3OTQ A;  4B9L A;  2XI9 A;  2ASL A;  5HMM A;  1FFV A;  1ZQO A;  4ED1 A;  7ICR A;  8ICR A;  5KFY A;  1X9W A;  4YMM A;  4EZ9 A;  2LKY A;  2LYB A;  2PFQ A;  2HHV A;  1XNS A;  1LKY B;  4P0P B;  1IG6 A;  1Z4N A;  2IOF K;  2K8C B;  4C0Z A;  1D9D A;  4KIT B;  4OJP A;  2KEY A;  3LWL A;  1KLN A;  5AK4 A;  3C28 A;  4DF4 A;  2F77 X;  4JV0 A;  5CA7 A;  4O3R A;  5KTQ A;  1ZXI A;  2FPK A;  4JB3 A;  3AQE A;  4KN7 A;  5HNK A;  4FO6 A;  4DSJ A;  1RYU A;  4RQ4 A;  4F50 A;  5KFL A;  2IBK A;  4RQ3 A;  1AQ6 A;  5HHI A;  1DRG A;  2R8K A;  8ICE A;  1NK5 A;  9ICW A;  1S77 D;  1NNL A;  4FZL A;  4ZH4 A;  2KFN A;  3MDC A;  1NK6 A;  4JUZ A;  4KLT A;  3G6Y A;  2K8B B;  8ICU A;  2PFN A;  4TUP A;  2ZUB A;  1MA7 A;  4PGX A;  2DUY A;  1RXV A;  1K1Q A;  3UXP A;  4KLI A;  5KFE A;  3M8S A;  3B0X A;  3MGV A;  4NLN A;  2YMQ A;  4QZH A;  2EZX A;  5AKJ A;  4C8M A;  1XO1 A;  4IR1 A;  2HOQ A;  2ZIU A;  2Y0S C;  4OD0 A;  5GTI U;  4O5C A;  4QJF B;  2ZJ5 A;  1ZQQ A;  2KIW A;  2J6U A;  3IHQ B;  3AQF A;  3CP8 A;  1WUD A;  7ICI A;  2C2D A;  5ALZ A;  4KLS A;  5DQI A;  1PUZ A;  4UBB A;  4Z6F A;  2HCF A;  8ICX A;  4WJ3 B;  1A76 A;  5AKH A;  3QU7 A;  9ICB A;  5ALY A;  3R9K A;  3U26 A;  3RAX A;  5DG8 A;  2G0A A;  4KLL A;  4O3Q A;  2QB0 B;  2BKE A;  3RJH A;  3H40 A;  4PHP A;  5KT7 A;  4M9J A;  1X6I A;  1YZ7 A;  4NLB A;  2HHW A;  2R18 A;  2UVU A;  8ICY A;  1SIJ A;  5DB9 A;  1PK1 B;  4DLG A;  5CR0 A;  2KSO A;  1FFU A;  4F2S A;  2LYA A;  2LMR A;  3MR5 A;  1H38 A;  1S9F A;  5AKG A;  3V7K A;  4USA A;  3H7I A;  3TAD C;  5EWE A;  2I6X A;  1RPL A;  4TQR A;  3EPG A;  2AQ4 A;  4LZD A;  3SEI A;  2K4P A;  5DQG A;  1PK3 A;  1ZJM A;  4QW8 A;  5J8Y C;  4M2Y A;  1ZD2 P;  1ZQK A;  3C5F A;  4UAR A;  1XU4 A;  3KFU F;  4MFA A;  3N97 B;  2NV3 A;  3KKA C;  1KFT A;  4C4T A;  1PVP A;  1QH9 A;  1RYS A;  4QWA A;  5DDM A;  1MN8 A;  2DL0 A;  2F8L A;  2KP7 A;  1ZQJ A;  2PMZ C;  3T5K A;  3T79 A;  5B66 U;  5KFP A;  4KX3 A;  2M0N A;  2E3T A;  4BWJ A;  1NK8 A;  3RRH A;  3PR5 B;  3TKA A;  4JV1 A;  4YXJ A;  2W55 A;  3C23 A;  5ALL A;  3PW0 A;  2BGW A;  3K1Z A;  4NWI A;  5IIJ A;  3OSN A;  4UBC A;  4DS5 A;  4CGZ A;  4X5V A;  3Q8R B;  2F2A B;  1QSL A;  5FP0 A;  1B4F A;  2WB1 F;  2R8G A;  2VA8 A;  4QZI A;  4IQV A;  3EPI A;  1ZQH A;  3OJU A;  2XY7 A;  3H0M B;  5J0T A;  2JXJ A;  2D6F C;  4I2F A;  4NLC A;  3NVV A;  3H8W A;  3Q8L A;  2JHD A;  3AUO A;  2XO7 A;  1JIH A;  1UQV A;  3RFA A;  1N5W A;  1OXJ A;  2KVS A;  2A19 A;  3IG5 A;  2VAN A;  2P35 A;  4I28 A;  2BDU A;  2KN7 A;  5KFK A;  2W8K A;  3Q8Q B;  3N7S C;  1N2X A;  2JEJ A;  3PW2 A;  3KHH A;  3O0F A;  3J81 j;  3M9M B;  2NYV A;  4FBT A;  2A1A A;  3G6V A;  3C2K A;  1KEJ A;  4Z6C A;  3EUB 2;  3ZDD A;  5J8Y A;  5JTI A;  2KTQ A;  1BNP A;  3QE9 Y;  1RQL A;  1Q46 A;  1DOQ A;  4EZ6 A;  3CYM A;  7ICV A;  3KKA A;  4Q45 A;  8ICP A;  2MRL A;  5J2A A;  5ALS A;  4J9N A;  5J0W A;  3DEE A;  1S0N A;  1L3S A;  4RQ0 A;  2EQY A;  4LJX A;  1ECW A;  4KLE A;  1ZOL A;  3SV4 A;  2HHU A;  5III A;  4DWI A;  4IS7 A;  1Y88 A;  5AHX A;  3H4D A;  2W54 A;  2VKQ A;  3IN5 A;  2BCS A;  2W7O A;  4NM1 A;  5ALN A;  4M9G A;  9ICG A;  2MAX A;  3QU5 A;  2W9C B;  1ZQN A;  3MR2 A;  3UMC A;  1S0V A;  4RQ5 A;  1SKW A;  4J9Q A;  2XY5 A;  2FPL A;  3EZ5 A;  1ZD4 A;  4CNQ A;  4DOA A;  2C2R A;  1IXR A;  1YZ6 A;  1ZQ1 C;  1NJY A;  4LZG A;  1NK9 A;  1HUZ A;  1T7P A;  1Z19 A;  5ALH A;  4FZM A;  5ALT A;  3HKZ F;  3QYP A;  3BQ7 A;  4M6W B;  3OHB A;  3PX0 A;  2W9A A;  2W03 A;  2G5I B;  3D2N A;  3SV3 A;  2A1J B;  8ICZ A;  3RBD A;  4GIB A;  5C0Y A;  4DFJ A;  4PGQ A;  2JZB A;  2F1H A;  4FS2 A;  1FO4 A;  3TAQ A;  3G6X A;  9ICM A;  3L3F X;  5DLG A;  4ECZ A;  1ZQF A;  1WWU A;  4DL7 A;  2KKP A;  2F76 X;  3PST A;  3RAQ A;  3RJG A;  4Y2Q A;  5AM0 A;  3F53 A;  3SQI A;  2Y9T A;  5EE9 A;  2P6U A;  5KFB A;  3GIM A;  2G07 A;  2BCU A;  2FLN A;  5CB1 A;  3E2E A;  4MFC A;  2DPJ A;  4O0I A;  2HBK A;  2F8K A;  2GO7 A;  3GFK B;  1D8B A;  2HVI A;  4JWM A;  5KAF U;  4YN4 A;  1ZQW A;  4TUR A;  3WKE A;  7ICL A;  2AJQ A;  1ZQI A;  2FE9 A;  2NRZ A;  2HBL A;  5AM1 A;  1ZQA A;  3ORY A;  1S0M A;  4I2H A;  3F5E A;  1JAL A;  2JR5 A;  3WKB A;  1NZP A;  2BCQ A;  1RQN A;  3RJK A;  4IRK A;  3I1Y A;  5KAI U;  9ICQ A;  4F4Y A;  3SD7 A;  3ISD A;  3SZ2 A;  4Y2V A;  2CRX A;  4HYK A;  4PL1 A;  1RDF A;  4RUA A;  4KX5 A;  2MSN A;  3QU2 A;  5KL1 B;  1KQQ A;  3BQT A;  4GFJ A;  2F1I A;  4FZN A;  5DG9 A;  1BPX A;  4C7Z A;  4DL6 A;  3KOO A;  3HX0 A;  4C7Y A;  4ED3 A;  3QUC A;  1L7M A;  3M6K A;  2WF8 A;  3PSF A;  2ZIU B;  3JPO A;  5ALE A;  2V4R A;  2ES6 A;  3PV8 A;  4MFF A;  3QXG A;  2H3Z A;  1UA0 A;  3NTU A;  4EEL A;  3C29 A;  2Y1I A;  5AK6 A;  4GXI A;  4KLG A;  2ZIW A;  5IIO A;  3TAN A;  3ALR A;  1ZET A;  4O9M A;  2WTF A;  4UB4 A;  5ALF A;  4PH5 A;  3WKD A;  2FPM A;  4DL5 A;  3RJJ A;  2OHF A;  1ZQE A;  5AI6 A;  5KFC A;  3C5G A;  2ZUC A;  5AM5 A;  2ZG6 A;  1JRP A;  1WG8 A;  2ZIV B;  4R8U A;  4RZR A;  1KBU A;  2W9M A;  1ARO P;  4F4Z A;  1NK4 A;  4M9H A;  4F3O A;  4KLM A;  5L1L A;  4JMU A;  2WF9 A;  2DWQ A;  4IRC A;  2KSO B;  1LB2 B;  2EAM A;  2LPE A;  5J0Q A;  5AKZ A;  3Q8K A;  3LVW A;  4XRH A;  2KD1 A;  4DOC A;  9ICV A;  1OUQ A;  5EWF A;  4ELV A;  2H3I A;  1SKR A;  4Y2X A;  4B9V A;  1DGJ A;  3D6J A;  2W43 A;  3PW4 A;  3KBB A;  4AYB F;  1TK5 A;  1JMS A;  4UAU A;  9ICK A;  3C1Z A;  2KKV A;  4DQQ A;  1C7Y A;  2KK0 A;  2A3V A;  2BZF A;  3K4G A;  5AI5 A;  2W9B B;  2H3F A;  4BXO A;  2WAQ F;  5KFD A;  4AP9 A;  1TKD A;  2HOI A;  4P0Q A;  4R64 A;  2C22 A;  2DKZ A;  1MQ2 A;  5KG5 A;  4BWM A;  4O5K A;  1KKX A;  1XWL A;  3FM9 A;  1JI7 A;  1RZT A;  4J9P A;  2UVW A;  2C2E A;  2Y1J A;  2AU0 A;  4YD1 A;  5DBC A;  2KV2 A;  8ICC A;  2Z7J A;  4CCH A;  2PI5 A;  5IIL A;  3NGD A;  1Q3V A;  1Z00 A;  4MF2 A;  4OO1 J;  1QQ5 A;  1TAQ A;  2BPF A;  3UMB A;  3SYZ A;  5DG7 A;  4QZG A;  3M6Z A;  2R8H A;  3PX4 A;  2H3V A;  4QW9 A;  1HEK A;  2OYY A;  4P4O A;  4EEK A;  1U48 A;  3HIL A;  3FAH A;  5B5E U;  1CUK A;  2ZUD A;  2XCA A;  4ELT A;  2EAN A;  2J6T A;  4DS4 A;  4J9R A;  2WF5 A;  3F5A A;  4O5E A;  2K4H A;  3CRX A;  4IQU A;  5AI4 A;  1XC9 A;  5KFS A;  3FC4 A;  2HW3 A;  1X6J A;  4ECV A;  2BPG A;  1RYR A;  3RRG A;  4ELU A;  3V6K A;  3GIL A;  5AKL A;  5EE3 A;  4UB5 A;  3TFS A;  4F8R A;  4O3S A;  3AN1 A;  3HPO A;  5KFW A;  4UQG A;  2PFO A;  2EZY A;  4RUC A;  4O3O A;  1TK0 A;  1KFS A;  8ICO A;  1Z1V A;  2FDR A;  4J9M A;  4DOB A;  3H0L B;  4ED0 A;  1V97 A;  3MDA A;  3IV6 A;  1ZQB A;  7ICO A;  2FMS A;  3JPQ A;  1L6N A;  2DF4 B;  1L8O A;  2ZTC A;  4DSI A;  2VJ4 A;  3MGI A;  1CI4 A;  2E8N A;  3RBE A;  3HRD D;  1SXD A;  3KHL A;  4DSL A;  2JEI A;  4QWD A;  2IHM A;  5J2J A;  2ZTE A;  2R8I A;  3GV8 B;  4BGD A;  5J2H A;  3RB4 A;  3V6J A;  2VJ5 A;  4BUG A;  3IG8 A;  4RQN A;  1NJW A;  5J0S A;  1U9L A;  2Q4T A;  4B9M A;  4KLQ A;  2KZM A;  1S76 D;  5KG1 A;  3NVW A;  4NLK A;  2IHN A;  2JEF A;  4M0A A;  3UM9 A;  4DQS A;  4UW9 A;  4MEX A;  3ZI4 A;  2NO4 A;  1ZJN A;  1N60 A;  5AM4 A;  1Z3E B;  1ZQM A;  1ZQZ A;  9ICU A;  5L1I A;  9ICP A;  3PMN A;  5D49 A;  2RQ5 A;  2PFP A;  3WK8 A;  1T8E A;  4NLG A;  3HT3 A;  3T5H A;  2JGA A;  1KL9 A;  1KFD A;  3E0F A;  4F2R A;  1QQ7 A;  3KZX A;  2DPI A;  9ICL A;  4MHV A;  2IMW P;  4Z6D A;  4F4K A;  1S10 A;  2E8O A;  3I76 A;  5KFO A;  3K75 D;  1HIW A;  4YP3 A;  1N62 A;  7ICN A;  2KJ5 A;  2XVT A;  4KN4 A;  1MSW D;  2HHQ A;  3TAR A;  3M8R A;  4F71 A;  3NVZ A;  4UB2 A;  5DBB A;  2XIC A;  1Z4O A;  4O3N A;  2O6K A;  2RHF A;  3Q8S B;  4QWB A;  3K1R B;  3EW9 A;  4BX9 C;  2LHT A;  2KOB A;  3JPN A;  4IRD A;  5C5J A;  3TI0 A;  2FLL A;  2XCP A;  5AKI A;  4DSE A;  1PVR A;  3NRZ A;  1S97 A;  2F3N A;  4E0D A;  2BQ3 A;  1QLN A;  3NVY A;  2K4E A;  1T4G A;  4A8E A;  2P6R A;  3OGU A;  4XUS A;  4PL2 A;  5ALQ A;  9ICT A;  3BDP A;  2FI1 A;  2GWS A;  1J2N A;  2MUT A;  2B21 A;  4DL3 A;  5BOM A;  2G5H B;  1J97 A;  4K4G A;  4EYH B;  4FS1 A;  4MF8 A;  1L3V A;  2XGP A;  3PO5 A;  1L7N A;  4QNL A;  4DL2 A;  2BDP A;  1T94 A;  5F9L A;  2WB1 C;  1UT8 A;  8ICS A;  3PW7 A;  5J0U A;  5IIN A;  3H8M A;  3MFH A;  1COO A;  2AGP A;  5AI9 A;  4UAV A;  2IA6 A;  4RQ1 A;  4ICA A;  5TZV A;  5KFJ A;  4DQI A;  5D4B A;  3IDW A;  1RM6 C;  1M6Y A;  5DB7 A;  3RH5 A;  2HI0 A;  8ICA A;  4RT2 A;  2HHT A;  4FBU A;  8ICT A;  5J2G A;  3OPX A;  5ALM A;  5K4L A;  4GC7 A;  5L9X A;  4NV0 A;  1T3Q A;  4R8U B;  5J2F A;  4R63 A;  5AM2 A;  4EBE A;  2ASD A;  1Z1B A;  3KD3 A;  4KLH A;  3GV5 B;  4YQW A;  1ZD5 A;  1NZB A;  2V9W A;  2W11 A;  3M1Y A;  4BJQ A;  2KG5 A;  4ED2 A;  3N4M B;  1QCK A;  1JUD A;  9ICN A;  8ICH A;  8ICF A;  3GIJ A;  1BPE A;  2KZ3 A;  3Q8M A;  5J29 A;  2I9G A;  4ED7 A;  3ICX A;  3OHA A;  1PVQ A;  3WKA A;  2KIV A;  5ALG A;  4U6P A;  3V7L A;  1XO0 A;  4EBC A;  1JN3 A;  1WCL A;  3M9N B;  9ICE A;  4KLF A;  1FEZ A;  4ECQ A;  3TAC B;  5KFZ A;  2ZIX B;  1QSY A;  1WCN A;  5ALR A;  4DEZ A;  3NAS A;  4C4S A;  5KFI A;  1ED1 A;  1X9X A;  3N7P D;  4RQM A;  3CW2 C;  2NRW A;  2XGQ A;  2ESE A;  4R65 A;  3BS5 B;  3I28 A;  1JX4 A;  3EWA A;  5AIB A;  4TUS A;  2QB1 A;  2NRV A;  3MR3 A;  4RQ8 A;  2K60 A;  5HR6 A;  3LWM A;  1KTQ A;  2E1E A;  2HBJ A;  4TUQ A;  1U45 A;  2LM1 A;  9ICR A;  1QQ6 A;  5J0Y A;  4RQ2 A;  5TIS U;  1ZQR A;  3RJF A;  3B0Y A;  3IP4 B;  2GLE A;  4B9N A;  1KSP A;  2XY6 A;  1N61 A;  5EE0 A;  1BGX T;  3BQ0 A;  2ODG A;  3AU2 A;  3HKZ C;  2L5Y A;  5HP4 A;  2FLP A;  4NY8 A;  3JPP A;  1SXE A;  1UA1 A;  5AKY A;  1NJZ A;  5DQH A;  5KFH A;  4QIW F;  1NOM A;  1L8L A;  4O3P A;  4F93 B;  4KLD A;  3AMZ A;  4FFD A;  2DBY A;  2EDU A;  4B9T A;  4RT3 A;  4P4M A;  4RQ6 A;  4RNN A;  2YX8 A;  4MEY A;  3Q8P B;  2ATL A;  1JXE A;  5KFN A;  1VJ5 A;  4UB3 A;  2I1Q A;  1X66 A;  3V7J A;  1EXN A;  2VA2 A;  4NL9 C;  1Q3U A;  5CP2 A;  1UCV A;  2DQN B;  4IC9 A;  1ZQP A;  4TQS A;  2HSZ A;  1MC8 A;  3LK9 A;  4PHE A;  5AKK A;  3RTV A;  3MFI A;  4K4I A;  5ALU A;  5G5G A;  5DLF A;  1ZQU A;  1D8L A;  3BJY A;  2P66 A;  1ZRM A;  2KJ8 A;  2YML A;  2JEG A;  1SGG A;  2FMQ A;  4I2I A;  4I2G A;  3PZP A;  4DO9 A;  3RB6 A;  2K8A A;  1WWV A;  1F0M A;  4PJ0 U;  5ALV A;  4Y2U A;  3UQ2 A;  3WK4 A;  4PZN A;  2JH1 A;  3QNM A;  4I29 A;  3E58 A;  1SL1 A;  2QAR A;  4ECW A;  7ICU A;  1N63 A;  4YMO A;  4DFM A;  1K5O A;  1QSS A;  5KG0 A;  2WHE A;  4QZ8 A;  3ZDA A;  4DFK A;  4J03 A;  5JUM A;  4CDG A;  4YMN A;  2KE7 A;  5G5H A;  2BPC A;  4C8N A;  2Y9U A;  3M7D A;  4P2H A;  3ZD8 A;  4RPY A;  5J2I A;  4F4X A;  4OJ6 A;  2LBO A;  1SV0 C;  4DFP A;  2KNJ A;  7ICM A;  3JPS A;  5EE1 A;  3OSP A;  1SZH A;  4EEN A;  2KHV A;  2B6G A;  4US8 A;  3BQ2 A;  1XSL A;  1UT5 A;  2EH9 A;  7ICG A;  3MAB A;  1KDH A;  1HUO A;  5DB8 A;  5BOL A;  4OJO A;  3QEB Z;  3SAF A;  1SZP A;  2KMD A;  3H8J A;  4C4R A;  4I2J A;  4ECX A;  5EOZ A;  4J9L A;  2KZZ A;  2OWO A;  4UAZ A;  2JH7 A;  1VDV A;  5L1M A;  1VLB A;  4FE3 A;  5KG7 A;  5HML A;  1SV4 A;  4NL9 A;  1S5L U;  5DB6 A;  2XC9 A;  3A0B U;  9ICS A;  4RQ7 A;  4F91 B;  3KHG A;  1L7O A;  5CEH A;  1CRX A;  2F1J A;  2W3R A;  4US9 A;  4PGY A;  4Y2T A;  4Q8F A;  2YTU A;  3B9J A;  4EBD A;  5ALK A;  2HBM A;  8ICW A;  3PY8 A;  1V38 A;  4K4H A;  3JPT A;  4Y2S A;  4QZB A;  4AYB C;  5D46 A;  2PKE A;  1TV9 A;  2W9C A;  9ICI A;  4I2E A;  5J0R A;  2AHO B;  1X2I A;  4EEY A;  1CEZ A;  2C28 A;  1ZQS A;  3WKC A;  2FJ6 A;  5KT4 A;  5J2C A;  1YT3 A;  2ALZ A;  4DQP A;  3PSP A;  2WAQ C;  4ECY A;  1QTM A;  2W8L A;  2OEH A;  4DFD A;  1SV0 A;  1ZYQ A;  2LI6 A;  5IIM A;  5HHH A;  4ECS A;  4M9N A;  3T5L A;  2A1J A;  2OCE A;  3PR4 A; 
#chains in the Genus database with same CATH homology
 1ECW A;  1SZH A;  3OPX A;  1HIW A;  2KHV A;  2W04 A;  1OUQ A;  1MA7 A;  2F8L A;  1GO3 F;  2KJ5 A;  2OM6 A;  2PMZ C;  4NV0 A;  3F2B A;  3T79 A;  2H3I A;  2HBL A;  4KX3 A;  2M0N A;  2XVT A;  4OJ5 A;  2MA1 A;  2ZIW B;  5T14 A;  1Z1B A;  5HR7 A;  2RP5 A;  3F5E A;  4QIW F;  2ZIX A;  3D2Q A;  3AL0 B;  3MGV A;  3H0R B;  4OJO A;  2VKQ A;  4AYB F;  3SAF A;  3IN5 A;  1NZB A;  3NRW A;  2W7O A;  4BJQ A;  2YB1 A;  3F2C A;  1A0P A;  3K1Z A;  2W7P A;  2GH1 A;  2KKV A;  2CPR A;  4NWI A;  3D2S A;  4U7C A;  2XIC A;  3RF9 A;  4CGZ A;  2HOQ A;  2ZIU A;  2E5S A;  2F2A B;  2A3V A;  4CRX A;  2WB1 F;  2Y0S C;  4O3M A;  3N7R C;  4QJF B;  5A0L A;  2CRX A;  2RHF A;  3H0L B;  3GU3 A;  4PL1 A;  2XID A;  2OXO A;  2JH7 A;  2VIX A;  2OH2 A;  3SMV A;  2KVC A;  2H3F A;  4KX5 A;  2YX8 A;  4FE3 A;  4P0P A;  5KL1 B;  3PSI A;  3GZF A;  3H0M B;  1URJ A;  1TAM A;  2KIW A;  2WAQ F;  2LHT A;  2K89 A;  4GFJ A;  2KOB A;  4FZN A;  2N1R A;  2ZIV A;  4BX9 C;  3SAH A;  2D6F C;  2HMX A;  2HOI A;  1L6N A;  2DF4 B;  3ICX A;  1ZQ1 C;  2KHQ A;  1WUD A;  3AQF A;  3CP8 A;  4NLC A;  4P0Q A;  1A6S A;  2DGZ A;  4KMO B;  2VJ4 A;  1Z19 A;  1PVQ A;  1Q3U A;  2G09 A;  2XI9 A;  3M6K A;  2JHD A;  4FZM A;  4OJL A;  3HKZ F;  3PSF A;  2DQN B;  2ZIU B;  4IC9 A;  3RFA A;  1PVR A;  2G06 A;  3SAG A;  4U6P A;  4WJ3 B;  2W03 A;  2G5I B;  3D2N A;  1CRX A;  2PMZ F;  2LKY A;  2H3Z A;  3LVV A;  2LYB A;  1XNS A;  2K4E A;  4A8E A;  4P0P B;  5C0Y A;  3C29 A;  3IG5 A;  1XO0 A;  2K8C B;  4C0Z A;  4OJP A;  2G0A A;  2VJ5 A;  4PL2 A;  2KJ8 A;  2KEY A;  2KV2 A;  3NUQ A;  3IG8 A;  4BUG A;  3F2D A;  2Z7J A;  2E1F A;  2BDU A;  3LYS A;  2ZIW A;  3C28 A;  3ALR A;  2ZIX B;  2ZXI A;  4NLB A;  2R18 A;  2F77 X;  3L3F X;  3PZP A;  5CRX A;  2GOL A;  2Q4T A;  2Y0S F;  3N7S C;  2HBM A;  2RRD A;  4ACO A;  2G5H B;  1ED1 A;  2H3Q A;  2K8A A;  2KJ9 A;  3N7P D;  2KIC A;  3AQE A;  3O0F A;  1Q3V A;  4OO1 J;  4QIW C;  2KKP A;  3VC8 A;  2F76 X;  2LYA A;  3PST A;  4AYB C;  2ZXH A;  2JH1 A;  3M6Z A;  2H3V A;  1IIP A;  2G08 A;  3F53 A;  3SQI A;  1HEK A;  2JMG A;  2OYY A;  4QNL A;  1T94 A;  3VCB A;  5HR6 A;  2WB1 C;  2ZG6 A;  2HOF A;  2G07 A;  1UPH A;  2ZIV B;  3ONN A;  2E1E A;  5KL8 B;  1KBU A;  1DRG A;  2HBJ A;  4P0Q B;  2K4I A;  1YT3 A;  4ICA A;  4JMU A;  3PSP A;  2CN1 A;  3CYM A;  4CDG A;  2HBK A;  2WAQ C;  1F44 A;  3IP4 B;  4FZL A;  1D8B A;  2JGA A;  3KFU F;  3F5A A;  3M7D A;  2MRL A;  3E0F A;  3KZX A;  2NV3 A;  1P7D A;  4OJ6 A;  2LBO A;  2K4H A;  3DEE A;  1PVP A;  3CRX A;  3LVW A;  3HKZ C;  2KNJ A;  2KD1 A;  2K8B B;  2YB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...