2G5IB

Structure of trna-dependent amidotransferase gatcab complexed with adp-alf4
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
410
structure length
410
Chain Sequence
b'HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 120
structure length 410
sequence length 410
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5iB02
3H0RB 2D6FC 2G5HB 2G5IB 1ZQ1C 2DQNB 2DF4B 3H0LB 3AL0B 3KFUF 3IP4B 4WJ3B 2F2AB 3H0MB
chains in the Genus database with same CATH superfamily
3NUQA 3LWMA 3RBEA 4CGZA 3HPOA 2OWOA 2KHQA 2DPJA 1UA0A 4IRDA 2HOIA 3PW2A 2ZXHA 4RQ2A 3C2KA 2PFPA 2JEIA 1SL1A 4K4GA 2RHFA 3CYMA 2GO7A 9ICWA 3H8MA 4CDGA 7ICOA 4J9SA 3RH4A 4BGDA 4B9LA 5ALYA 5J0QA 2ZUCA 2H5XA 2YTUA 3ALRA 4DSEA 7ICKA 3HKZF 4KLDA 1KKXA 3V72A 1UQVA 3RJFA 1FFVA 4Z6EA 3E0FA 3PY8A 5KT6A 1N56A 1SGGA 3HT3A 1NK0A 2WF9A 4ELTA 5AI9A 4LVSA 3PX6A 3N7RC 1KRPA 4TQRA 2K8AA 2DWQA 1RG6A 4US9A 2KIWA 1JALA 2UVWA 3R9KA 4LZDA 3PR5B 4IQTA 3OSPA 4JWNA 2W43A 4NLCA 9ICNA 2QARA 4DL3A 2E5SA 2KOBA 5KT5A 4J9OA 1RYSA 4OO1J 3QZ8A 3IRUA 1HJPA 3RAQA 1YT3A 3MDCA 2NO5A 4K4HA 2LM1A 5DBCA 3M8RA 1VDVA 3NS1A 2HBJA 3G6YA 2R8HA 3K75D 4RU9A 4Q8EA 2ZIVB 3DDHA 3H7IA 4F50A 1TE2A 4DSLA 1ZQYA 1JUDA 3GDXA 5AKKA 2FE9A 4CF5A 1KQQA 1NOMA 5CP2A 3Q8QB 1OW5A 1UHUA 2BPGA 3LVVA 4ED7A 4YMMA 1C20A 4KLSA 5ALTA 4F93B 4O3NA 4EX7A 4QZCA 1B4FA 4KLMA 2KKPA 4GFJA 9ICCA 2LMRA 1LVHA 2ZIUB 2AGOA 1ZQFA 4XA5A 5ALLA 3SR6A 4UAWA 2WF7A 4QWCA 4DF4A 8ICKA 2QB0B 2NRVA 2RRDA 5KFYA 5DQHA 5IILA 1N5WA 7ICQA 2BDUA 1TK0A 4F8RA 2KTQA 3UMGA 2WB1F 2MAXA 4I2HA 2WAQC 4I2CA 9ICBA 3HP6A 2KFNA 2HHXA 4ECUA 1L6NA 5DBAA 4R66A 2NRXA 4E0DA 4KMUA 3MR2A 1LB2B 8ICBA 9ICJA 2CXYA 1HUOA 3TFRA 2YY6A 1SWVA 3O0FA 5DG8A 2BQRA 3GV5B 3ZI4A 3IV6A 3ORYA 2W8LA 5KFVA 5KT2A 2HDOA 4KMOB 1IXRA 2YB1A 5ALWA 4QZ8A 2BKEA 3U26A 2EZZA 4AYBF 5J8YC 1JROA 4NL9C 2WHEA 2QARB 5AM2A 3ETLA 4PGYA 1BPEA 5J2DA 2BHNA 1F0MA 2JV3A 3PW4A 2P6RA 2KSOA 5KFLA 3AEVA 5DDMA 3UMCA 2GH1A 4PGQA 2GLEA 2K8CB 3V6KA 2Q0ZX 3H40A 3QUQA 5L1IA 3K1ZA 4QJFB 1X6JA 4KX5A 3AQFA 4R65A 4ECSA 1NK5A 1ZQCA 8ICGA 3V6HA 1ECWA 2G06A 4JV0A 4I2AA 1ZQOA 5HR6A 3H0LB 3PSTA 2LKYA 3KKAA 1UT5A 4BUGA 3F53A 1DGSA 4JB3A 1QSYA 4FZNA 3SAFA 2N1RA 2WF8A 2YX8A 5J29A 3QX7A 2VA2A 1KEJA 5ALSA 3EZ5A 5J0OA 3LVWA 5F9LA 2R8JA 5AHXA 3D2SA 1NKEA 2NYVA 5AKEA 1Z4OA 2V4RA 5KT3A 2HVHA 5DB8A 4I2EA 5KG2A 5CJ7A 8ICTA 2KG5A 1KW4A 4IS7A 5J2GA 5AK3A 3K1RB 1AQ6A 5KG7A 3WK8A 4US8A 5KG4A 5DB7A 5ALHA 4UB8U 1EXNA 4P0PA 5KFEA 2AQ0A 3E2EA 2F1HA 3Q8KA 3AQEA 1Q8KA 5CHGA 3QE9Y 4UARA 5ALRA 5G5GA 4R8UA 3SZ2A 2EZYA 4UBCA 2E8MA 5KFOA 4ED2A 3HILA 1KFDA 1NZBA 2F77X 1N5XA 5ALMA 1JXLA 1K1QA 2ZJ8A 5ALVA 1NZPA 2L5YA 4RT3A 4Q43A 1N2XA 3ZD8A 1PVRA 1MA7A 3LYSA 1YZ6A 5DG7A 4I2JA 5DLFA 2AJQA 3IG8A 2AH5A 1ZQLA 1WWUA 2A1AA 4NLGA 3A0BU 2KSOB 1IM4A 2LM4A 4RQ4A 2JEJA 2HHUA 2AXTU 4KLIA 2O6KA 2FMSA 1ZD3A 4QZHA 4IRKA 1VJ5A 3QEAZ 3QXGA 1ZJMA 3VC8A 5KL1B 2XY7A 2P66A 2W54A 2YMQA 1U49A 5KT7A 2P35A 4GC7A 3WKDA 4EELA 2JMGA 4C0ZA 2Y9TA 3OJSA 4B9MA 2KNJA 2F8LA 5KFJA 3FYHA 4F5QA 5EE0A 1J2NA 4OJOA 3H4DA 3PX0A 3ZDBA 5KG5A 3GV8B 2HMXA 3IN5A 3ICXA 3KOOA 1KBUA 4ECZA 3T5JA 3QU2A 5L1JA 1NJZA 2KIVA 5JUMA 2UVRA 1DGJA 4MEXA 4MFFA 4UB4A 4UASA 4IRCA 1S76D 7ICNA 3RRHA 4J9QA 4P4PA 5DQGA 3KHGA 3HX0A 2AGQA 3JPPA 1ZETA 3EYZA 5HP4A 2XI9A 3BJYA 4MFAA 4G9BA 8ICXA 2HBKA 2FDRA 5EE9A 4ZH4A 4J9PA 4F2SA 3BZKA 5IIKA 8ICPA 4KLHA 4USAA 3G6VA 4P0PB 2WB1C 2E3TA 1D8LA 5F3XB 1K5OA 1YZ7A 3H0MB 4PHAA 3BQ0A 2CPRA 1NKBA 2NO4A 9ICSA 4R8UB 2XGQA 3PVXA 1DXSA 3QU4A 5KG3A 1KSPA 1A6SA 1X40A 5AKIA 2EQYA 5DG9A 5AKXA 5L9XA 5AKHA 1N61A 3THVA 5HNKA 1XU4A 4DSJA 4NM2A 3L3FX 2A19A 1SKRA 2XCAA 3CNHA 3EW9A 3PSIA 2HVIA 4QW8A 3RRGA 5D4BA 5AI4A 1ZQRA 5DB9A 2HHSA 1LKYA 4I2GA 1JXEA 4JUZA 1RXWA 2RLTA 1FIQA 1BPDA 4AYBC 2W7PA 3RB4A 2H3FA 2K60A 5ALFA 3Q8PB 8ICYA 1N60A 4OJLA 1ZD2P 3QNMA 4UB1A 1ZQGA 3L5KA 5JRTA 2XGPA 2C28A 2G0AA 4BXOA 2E8PA 4PH5A 1MQ2A 5AKLA 1UCVA 2MSNA 3MR3A 2VANA 1L8OA 4UAUA 9ICHA 4HYKA 5C5JA 1PVQA 7ICIA 1BNOA 3TFSA 4KLOA 5EWFA 1S8OA 1A77A 4O0IA 2LYBA 2ZIXB 3C5FA 1DRGA 4DL6A 4DFJA 2J6TA 4EENA 4O3OA 4UB3A 1B22A 2DKZA 4I2IA 1BPBA 5AK6A 3PSFA 3DV9A 5AKYA 5ALQA 9ICTA 1BNPA 2G08A 4UW9A 1PK1B 2C2RA 3QU5A 4DS5A 5KFIA 4F5OA 4QZGA 1TAMA 4KLLA 1D8BA 1SZHA 1HIWA 1C7YA 2Y0SF 1ZXIA 1KDHA 4ICAA 5AM0A 3UPQA 2E1EA 5AI8A 4M9GA 3F5EA 3TQ1A 3RR7A 3TAQA 3BS5A 4I27A 3M1YA 5B66U 1B43A 3BZCA 4Y2SA 2LI6A 4YD2A 4KLJA 3PMNA 4OCZA 3M9NB 4FS2A 4YD1A 5K4LA 2VJ4A 4FO6A 2R8IA 1J2MA 1ED1A 3C29A 4QZBA 2K4HA 5DQIA 5BOMA 4FBTA 3RJGA 4RPYA 4ECYA 4DL5A 2K4PA 1SXDA 1PUZA 3RBDA 3D2NA 4C7ZA 4RZRA 3EPIA 1JMSA 2YQEA 7ICHA 2M0NA 3RH5A 8ICCA 1TK5A 5CB1A 5D46A 3F2BA 1ZQJA 1ZQUA 4GXIA 5HMMA 4F71A 4DFPA 3RH6A 1QTMA 3H4BA 4GIBA 1MSWD 2EZXA 1LKYB 3M9OB 3PZPA 3PX4A 1GO3F 2BDPA 4NLBA 1QQ6A 5KFDA 4P0QB 4EEYA 2MUTA 5KL8B 5EWEA 3OGUA 2W3SA 1PZNA 4EZ9A 2CRXA 4DS4A 4O5EA 1U45A 4BXOB 4M9HA 5HHIA 5DBBA 3AUOA 3SV3A 1S0NA 4OJ6A 4C4TA 5F9NA 3GZFA 5ALJA 2IA6A 1NI3A 4PGXA 4CE6A 4TQSA 4DQRA 5CWRA 5KFRA 2IOHA 5ALPA 1O08A 2I1QA 2PFQA 1RXVA 4ED8A 3AU2A 3KHRA 2ZTEA 2K4EA 4ELVA 5T14A 1IV8A 5KFNA 2H3VA 1S10A 1A76A 2KD1A 4C4SA 2BR0A 2H3QA 4GXJA 1CRXA 4JV1A 2EAMA 2C2DA 2JR5A 2GOLA 3QEBZ 1WG8A 4J03A 1AROP 4GXKA 3C28A 3BS5B 3FC4A 3JPRA 2KN7A 4RNOA 1SV0A 1KFSA 5ALNA 7ICVA 3AM9A 4DSKA 1F44A 1CI4A 2ZUDA 4Y2JA 2KJ8A 4M2YA 3G6XA 4X5VA 2XC9A 4J9LA 5L1LA 5AICA 1WWVA 3L4PA 4DEZA 4B9VA 4PZNA 2HOQA 1TAUA 3B0YA 3ZDCA 4WJ3B 1X9WA 3WK9A 3LK9A 4F4WA 3RB0A 4OD0A 1ZQNA 4QZDA 1NJXA 3UXOA 4FZLA 1ZQIA 3F2CA 2ASJA 3V7LA 4PZOA 2C2EA 4C7YA 2JEFA 5IIJA 3AU6A 2XY6A 2F1IA 4YXMA 2BQUA 1U48A 3RJEA 4RQ1A 9ICVA 2XY5A 2BPCA 4UAYA 1S9FA 2DFLA 3ISCA 3SD7A 1XNSA 2YB4A 4RQ8A 1ZQKA 1X42A 7ICEA 4QZFA 5J0XA 1PVPA 2IHNA 4O5CA 4F4KA 5J2AA 2VKQA 4B9UA 3MFIA 4M9NA 2R8GA 5AK4A 1V97A 1XS9D 2OXOA 1F5SA 5GTIU 1TFRA 1H38A 2KKVA 1U47A 1L3SA 3WK5A 5KFCA 4UB5A 3IG5A 4YG2A 5CEHA 2KICA 5DDYA 9ICOA 4M6WA 2XCPA 1Z00A 3C23A 1XSLA 5J0PA 3Q8SB 1NK7A 1CEZA 3QZ7A 4QZ9A 2BCSA 3FDSA 2ZJAA 3C21A 1L3TA 3SEIA 1D9FA 2F1JA 4O3PA 2B6GA 4Y2YA 5KFPA 4JWMA 3PW0A 3NVVA 4BX9C 1J97A 4YR0A 2OEHA 2DGZA 2FMPA 2R18A 1RZTA 5AM3A 8ICFA 3T3FA 1JRPA 4ED0A 2IMWP 9ICUA 2DQNB 3MGHA 7ICJA 1SL0A 2LHTA 2J6SA 2Y0SC 3Q8MA 4O3MA 2JH1A 4YQWA 1FO4A 3RF9A 2LYHA 9ICFA 2BZFA 5ALOA 4RUCA 4QW9A 3M8SA 1M6YA 1XSPA 4DSIA 4LJXA 4ELUA 2UVUA 4QZIA 3BQ2A 3QYPA 1T7PA 3EWAA 2ZXIA 3UXPA 2E8NA 3MC1A 5IIMA 1FEZA 3OHAA 1HEKA 5AK5A 3GIKA 4TURA 3MGIA 4UAVA 2KP7A 2ZUBA 5CRXA 1X9XA 4I2DA 8ICEA 1JN3A 2RDJA 4IQVA 1ZQ1C 2ISPA 1SKSA 5A0LA 3UXNA 3RJJA 4ZOHC 1BGXT 2WF5A 4NV0A 3SV4A 8ICMA 5AIAA 5AM4A 4F5PA 3HJEA 2HCFA 1Y88A 2HSZA 9ICMA 2JZBA 4IC9A 5J0YA 3T79A 1X9SA 1N63A 4F4YA 1NNLA 2YMMA 4OJPA 2I6XA 4C8OA 5HMLA 3RAXA 4PL1A 1LV5A 3Q8RB 2OHFA 3PNCA 1U4BA 4Z6DA 2FPKA 4M6WB 1Z00B 3UMBA 7ICMA 3CP8A 2DUYA 4KLEA 2LYAA 3ZD9A 2PFNA 1TKDA 4O9MA 2D6FC 2VIXA 4F5RA 2FI1A 3N7PD 2A1JA 3RB3A 2PI5A 5J8YA 1RYUA 3T5LA 4NL9A 3C1YA 5J0WA 4DQPA 4F3OA 1S0VA 4ECVA 1ZRMA 2RDIA 1S77D 5KFGA 3IM1A 1XWLA 5AKZA 4ECXA 4IR1A 1Q46A 5AI0A 4JMUA 1S97A 5KNIA 4B9TA 5KTQA 4BWMA 3GFKB 8ICSA 4UAZA 3GU3A 4TUSA 5L1MA 3NVYA 3GIMA 1SL2A 3C1ZA 2KHVA 3WK6A 1ZQHA 2DF4B 2OCEA 4F92B 3B9JA 4FS1A 2P6UA 2DKXA 5B5EU 3KZXA 2DL0A 3TADA 2FLNA 3SAHA 2KZZA 8ICIA 2F2AB 3A0HU 1RDFA 4YP3A 3HW8A 3WKBA 3C5GA 1V85A 3KHHA 3J81j 2EH9A 4F72A 4NXZA 3RTVA 4KX3A 3OTQA 4QNLA 4KTQA 8ICQA 2G5IB 4Y2XA 3TACB 1RM6C 4GLXA 2BPFA 4XRHA 2IBKA 3M7DA 2BGWA 4DOAA 4Q44A 1NK9A 1TAQA 4KN7A 4RQ7A 1ZQPA 1Q3UA 7ICFA 2MRLA 4ECRA 3SMVA 1NK8A 2FPLA 1Z4NA 3UM9A 1OUQA 2PMZF 3DEEA 5KT4A 5TISU 3NRWA 4KN4A 4HAIA 4YCXA 1NK4A 3SI8A 4RQ6A 3QU7A 2QLTA 2XICA 9ICKA 4OJ5A 4DQQA 3MR6A 1T3NA 4EX6A 2OYYA 3I1YA 8ICVA 5TZVA 5J0UA 2JEGA 5E79U 4P4MA 3S6JA 4EYIB 4EBDA 2ZIVA 2OH2A 2XO7A 2R8KA 3MFHA 2PXIA 2ASDA 1ZQTA 2A1JB 4DQSA 3PW5A 1NK6A 2ALZA 4F2RA 1KN5A 4C8NA 3ZDDA 3H0RB 1X9MA 3SYZA 2PFOA 4Y2RA 4NLKA 1T94A 3PO5A 4ED6A 8ICAA 4KLFA 5CA7A 9ICXA 8ICZA 1MC8A 1KL9A 4DOBA 1SXEA 3SENA 2WF6A 5AI5A 4YR3A 2YMLA 3I28A 2ZIWA 3ED5A 1P7DA 4ECWA 4NM1A 2UVVA 1ZQVA 2IOFA 2V4QA 1Z1BA 2KJ9A 4F4XA 4RQNA 4PPXA 3T5HA 2KMDA 1D8YA 5IIIA 4DQIA 2QB0A 2HHQA 8ICRA 4I2FA 5AM1A 3V7JA 3KFUF 2W9BA 1T4GA 4YN4A 4TUPA 2W9MA 1QLNA 3WK4A 8ICHA 1DOQA 2ISOA 2NRWA 4CNQA 4EYHB 1KLNA 1JIHA 1IIPA 3HWTA 5AI6A 1Z19A 2KZ3A 3KD3A 3WKEA 3UQ0A 2VJ5A 5J2FA 4PHPA 4ECTA 2KZMA 2FLLA 4C8MA 1U9LA 3F2DA 1L7NA 2W04A 2V9WA 1UA1A 7ICLA 3FM9A 1ZQAA 4FZMA 3V6JA 1RYRA 2KVCA 4YVZA 2I9GA 1T3QA 1QSSA 3KKAC 5KFKA 3MBYA 1PK3A 9ICIA 2HW3A 2ZG6A 5KFUA 2JRZA 2ASLA 8ICOA 4Z6CA 4Y2UA 2K4IA 1L3VA 2JGAA 3QUBA 5J2JA 1ZQDA 2EAPA 3BDPA 3D2QA 1OXJA 3IHQB 2B0CA 3GQCA 2AU0A 3NVZA 1ZJNA 1XSNA 5HHHA 3OJUA 4EBEA 3B0XA 2IOFK 5G5HA 2NRZA 2FPMA 5KAFU 4Z6FA 2W03A 1RQLA 2I5HA 3IDWA 4Y2QA 4QIWC 3MDAA 4YFKA 1ZQQA 1L3UA 2AHOB 2HBMA 5KFFA 2C22A 1BPZA 4P4OA 1X6IA 4UBBA 2EANA 3H8SA 4DFKA 2AQ4A 4PHDA 2QKQA 8ICUA 1UT8A 3BQ1A 4ECQA 4EBCA 4A8EA 1ZQSA 2RQ5A 2ZIWB 5KFXA 4YXJA 4DLEA 2JH7A 5KG1A 4UQGA 3CRXA 4P2HA 4K4IA 4DOCA 1FFUA 3HRDD 4Q45A 5KG0A 1BPYA 3E58A 5IIOA 2W9BB 4DFMA 5KFZA 4MF2A 3N97B 4IL6U 2KE7A 4NWIA 1ZQMA 3V7KA 2KV2A 1S5LU 3GIIA 1TK8A 3ZDAA 2ATLA 2A3VA 1COKA 3JPOA 4XQ8A 2BQ3A 4RPXA 2XVTA 1S0MA 4QWDA 4QWEA 2D3DA 4FE3A 4RT2A 1JI7A 4U7CA 4DL4A 5J2IA 1S0OA 4ED1A 1CUKA 4IQWA 2NRTA 4QWBA 4DFDA 3VCBA 1TVAA 5J2KA 3H8JA 1RPLA 4RNNA 4BJQA 1DK3A 3WK7A 4MEYA 1NKCA 1HUZA 3KZIU 1B0XA 3WKCA 2MUTB 5J2CA 4EZ6A 2W55A 5DGAA 3D6JA 1RQNA 2HI0A 2PI4A 2PMZC 2J6UA 2KK0A 5KFMA 5J0RA 3H8WA 9ICQA 1N62A 3BS7A 3KTQA 3PW7A 2FLPA 3NRZA 2KJ5A 4BWJA 1ZQWA 1KTQA 3IP4B 4RQ3A 3ISDA 1ZQEA 3Q8LA 2E8OA 3PR4A 1QQ7A 3NVWA 3WU2U 5KFSA 4ACOA 4F91B 4DWIA 2ES6A 1O03A 1BPXA 5DLGA 4QWAA 3SQIA 2G5HB 2CN1A 3PV8A 5AM5A 2FJ6A 3ETRA 5EE3A 2YN4A 2W11A 1L7PA 4B9SA 3GILA 4Y2TA 4CF4A 1ZQZA 4B9NA 3MABA 3TADC 4MFCA 1Z1VA 4PL2A 1X66A 1L8LA 9ICPA 2EDUA 3TI0A 1T8EA 7ICRA 5KAIU 2IHMA 4RQ0A 1WYGA 4UB2A 8ICJA 4KLQA 2EAOA 3LWLA 3TARA 3RB6A 7ICUA 1ZQXA 1L7OA 1VLBA 4O3QA 4TUQA 2H3IA 2DPIA 1NJYA 2BCVA 3CW2C 2LPEA 4I29A 4ED3A 2NV3A 5GTHU 5KFBA 2F44A 3AN1A 5ALEA 3AMZA 7ICGA 2BCUA 1V38A 2YMPA 3WKAA 3TKAA 8ICLA 5JU5A 2ZTDA 1TV9A 1QCKA 4M9JA 4C8KA 3ISBA 3NASA 4NLZA 1DK2A 3JPSA 3TANA 4I2BA 2HHWA 3N4MB 1V9PA 7ICSA 1QH9A 1MN8A 1SZPA 3GV7B 1L7MA 3HKZC 3ZDEA 2ODGA 2VA8A 4CRXA 4NY8A 4Q8FA 2ESEA 2W9CA 2WTFA 4C4RA 3QUCA 3GIJA 1NJWA 1XO1A 4DO9A 3RJKA 2G09A 5KFTA 2WFAA 4O3SA 1ZQBA 2KEYA 3JPNA 4DCCA 2F76X 2BCRA 5J0SA 2Y9UA 2Z7JA 5KFQA 1D9DA 3JPTA 3N28A 4DSFA 5KFWA 3N7SC 4M0AA 4R64A 3LDAA 5AKJA 4IR9A 4XUSA 1KFTA 1L5UA 4DL7A 3OHBA 4QZAA 4J9KA 2H3ZA 5ALUA 2HHVA 2KVSA 5KG6A 2QB1A 5KFHA 2K89A 9ICEA 1K1SA 1XO0A 3UQ2A 2JHDA 4B6JA 3JPQA 4QIWF 4KLGA 1QSLA 3K4GA 4RNMA 4C80A 4AP9A 2HBLA 4YMOA 5EOZA 1ZD4A 1ZOLA 2VA3A 4M47A 3OPXA 4BDPA 3I76A 5H2FU 5ALZA 7ICPA 2HOFA 9ICLA 2ZIXA 5ALKA 3RJIA 3BQ7A 2RP5A 5FP0A 2LBOA 2AGPA 4CF3A 3ONNA 5AKGA 3RR8A 1PK1A 2W8KA 4JK1A 4YMNA 3QU9A 1QQ5A 1URJA 4I28A 3C2MA 2BCQA 1WCLA 4IQUA 1MQ3A 2ZJ5A 1BVSA 5ALDA 4DL2A 1UPHA 2M9NA 1ZD5A 3NTUA 7ICTA 5HR7A 1COOA 4PJ0U 2ZTCA 8ICNA 1ZRNA 2F3NA 4UB6U 3AL0B 4Y2PA 2WAQF 5J2BA 3BQTA 3MGVA 1A0PA 3KBBA 4J9MA 1X2IA 1Z3EB 3EUB2 3FAHA 2K8BB 3T5KA 2JXJA 4M04A 5BPCA 9ICGA 4J9RA 3M6KA 1WUDA 1SB3C 5CR0A 2OM6A 4RUAA 3MR5A 3PO4A 4EEKA 4KITB 4PHEA 5ALXA 5ALGA 4JV2A 3PMLA 4DLGA 4RPZA 4O3RA 2DBYA 3SAGA 5DGBA 5DB6A 2W9CB 4KLUA 4Y2VA 3RJHA 1SWWA 2KFZA 4J9NA 4F5NA 2FMQA 2GWSA 3PSPA 3M6ZA 5J0TA 4U6PA 1SIJA 3OSNA 4QZEA 2JZBB 5EE1A 4DF8A 4UATA 3EPGA 4FFDA 4MHVA 4NLNA 1WCNA 2PKEA 4NJ8A 3NGDA 1N48A 3F5AA 4R63A 4RQMA 5J2EA 2W7OA 2Y1JA 5EWGA 4GC6A 3C2LA 9ICAA 4YR2A 4P0QA 2W9AA 4F4ZA 4C8LA 4O5KA 2F8KA 2MU2A 2E1FA 1ZYQA 1SKWA 1SV0C 2Y1IA 5KFAA 1JX4A 3KHLA 2Q4TA 4FBUA 2W3RA 1XC9A 2XIDA 3TAPA 4RQ5A 5BOLA 2MA1A 5JTIA 4LZGA 8ICWA 4G3IA 4KLTA 5C0YA 2HHTA 5D49A 2G07A 5AIBA 5ALIA 2D8CA 5DKWA 9ICRA 1SV4A 1Q3VA 2B21A 1IG6A 5L1KA 4M9LA 4CCHA 3QUTA 5J2HA 2ZIUA 3RFAA 3M9MB 4MF8A 5IINA
chains in the Genus database with same CATH topology
2Y0SC 3CP8A 3SQIA 4FZLA 1GO3F 2G5HB 2CN1A 1IIPA 3AQEA 1WUDA 3M6KA 3NUQA 2JH1A 2LYBA 2ZIXB 4NLBA 4AYBF 1DRGA 3CRXA 2OM6A 3N7SC 3NRWA 4CGZA 1Z19A 4P0QB 2LYAA 5KL8B 2D6FC 2VIXA 3RF9A 2XI9A 2KHQA 3N7PD 2HBKA 2CRXA 2HOIA 3LVVA 2XICA 3PSFA 3SAGA 2ZXHA 2VJ5A 2H3ZA 1NZBA 2F77X 4OJ5A 2GH1A 4PL2A 4OJ6A 2RHFA 3F2DA 2K89A 3CYMA 2KKPA 4GFJA 2G08A 2K8CB 2W04A 3GZFA 4CDGA 3PSPA 2ZXIA 2OYYA 1TAMA 1D8BA 4NWIA 1SZHA 3M6ZA 4U6PA 2ZIUB 1XNSA 2WB1C 2JHDA 2YB4A 3K1ZA 4FZMA 2KV2A 4QJFB 1XO0A 4P0PB 1HIWA 2KVCA 4JMUA 2Y0SF 1PVRA 1MA7A 4KX5A 3ALRA 1PVPA 2A3VA 4QIWF 3H0MB 4ICAA 3AQFA 2E1EA 4O3MA 1HEKA 3F5EA 3LYSA 3HKZF 2CPRA 1ECWA 2XVTA 2ZIVA 2H3IA 2HBLA 2G06A 2VKQA 2ZG6A 2OH2A 2RRDA 3F5AA 4FE3A 3GU3A 3OPXA 5HR6A 5CRXA 3IG8A 2K4IA 2K4EA 3H0LB 3PSTA 4U7CA 2LKYA 5T14A 2W7OA 2JGAA 3E0FA 3H0RB 2BDUA 2NV3A 2HOFA 2KHVA 4BUGA 2ZIXA 1A6SA 3F53A 1ZQ1C 2OXOA 2DF4B 4P0QA 4FZNA 3SAFA 2H3VA 2N1RA 3VCBA 2YX8A 3D2QA 1T94A 5A0LA 2KKVA 2KD1A 2RP5A 3N7RC 2H3QA 3KZXA 2K8AA 1CRXA 2WB1F 3SAHA 2F2AB 2VJ4A 4BJQA 2LBOA 2E1FA 2WAQC 3L3FX 3IG5A 1ED1A 3LVWA 2KICA 4NV0A 3PSIA 3VC8A 3C29A 3ONNA 5KL1B 2Q4TA 2KIWA 2GOLA 1L6NA 3D2SA 2K4HA 3C28A 2ZIWA 1URJA 1P7DA 2XIDA 2JMGA 2PMZC 3D2NA 4KX3A 4QNLA 4IC9A 4AYBC 2W7PA 4NLCA 2W03A 1Z1BA 2KJ9A 4C0ZA 2H3FA 3T79A 2MA1A 1UPHA 2KNJA 2F8LA 4OJLA 4QIWC 2E5SA 2KOBA 1F44A 2G5IB 2M0NA 4OO1J 5HR7A 3O0FA 3HKZC 3F2CA 4OJPA 2KJ8A 2G0AA 4CRXA 1YT3A 2HBMA 2KJ5A 4OJOA 3M7DA 5C0YA 2HMXA 3F2BA 3AL0B 3IN5A 3KFUF 4BX9C 2G07A 2WAQF 3ICXA 3IP4B 4PL1A 2HBJA 1KBUA 2DGZA 3MGVA 1A0PA 2R18A 2G09A 2HOQA 4KMOB 1Q3UA 2YB1A 1Q3VA 4WJ3B 2MRLA 2ZIVB 2K8BB 3SMVA 1PVQA 2KEYA 2ZIUA 2F76X 4P0PA 4ACOA 4A8EA 3RFAA 2DQNB 2ZIWB 1OUQA 2PMZF 2JH7A 3DEEA 2LHTA 3PZPA 2Z7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0R B;  2D6F C;  2G5H B;  2G5I B;  1ZQ1 C;  2DQN B;  2DF4 B;  3H0L B;  3AL0 B;  3KFU F;  3IP4 B;  4WJ3 B;  2F2A B;  3H0M B; 
#chains in the Genus database with same CATH topology
 3NUQ A;  3LWM A;  3RBE A;  4CGZ A;  3HPO A;  2OWO A;  2KHQ A;  2DPJ A;  1UA0 A;  4IRD A;  2HOI A;  3PW2 A;  2ZXH A;  4RQ2 A;  3C2K A;  2PFP A;  2JEI A;  1SL1 A;  4K4G A;  2RHF A;  3CYM A;  2GO7 A;  9ICW A;  3H8M A;  4CDG A;  7ICO A;  4J9S A;  3RH4 A;  4BGD A;  4B9L A;  5ALY A;  5J0Q A;  2ZUC A;  2H5X A;  2YTU A;  3ALR A;  4DSE A;  7ICK A;  3HKZ F;  4KLD A;  1KKX A;  3V72 A;  1UQV A;  3RJF A;  1FFV A;  4Z6E A;  3E0F A;  3PY8 A;  5KT6 A;  1N56 A;  1SGG A;  3HT3 A;  1NK0 A;  2WF9 A;  4ELT A;  5AI9 A;  4LVS A;  3PX6 A;  3N7R C;  1KRP A;  4TQR A;  2K8A A;  2DWQ A;  1RG6 A;  4US9 A;  2KIW A;  1JAL A;  2UVW A;  3R9K A;  4LZD A;  3PR5 B;  4IQT A;  3OSP A;  4JWN A;  2W43 A;  4NLC A;  9ICN A;  2QAR A;  4DL3 A;  2E5S A;  2KOB A;  5KT5 A;  4J9O A;  1RYS A;  4OO1 J;  3QZ8 A;  3IRU A;  1HJP A;  3RAQ A;  1YT3 A;  3MDC A;  2NO5 A;  4K4H A;  2LM1 A;  5DBC A;  3M8R A;  1VDV A;  3NS1 A;  2HBJ A;  3G6Y A;  2R8H A;  3K75 D;  4RU9 A;  4Q8E A;  2ZIV B;  3DDH A;  3H7I A;  4F50 A;  1TE2 A;  4DSL A;  1ZQY A;  1JUD A;  3GDX A;  5AKK A;  2FE9 A;  4CF5 A;  1KQQ A;  1NOM A;  5CP2 A;  3Q8Q B;  1OW5 A;  1UHU A;  2BPG A;  3LVV A;  4ED7 A;  4YMM A;  1C20 A;  4KLS A;  5ALT A;  4F93 B;  4O3N A;  4EX7 A;  4QZC A;  1B4F A;  4KLM A;  2KKP A;  4GFJ A;  9ICC A;  2LMR A;  1LVH A;  2ZIU B;  2AGO A;  1ZQF A;  4XA5 A;  5ALL A;  3SR6 A;  4UAW A;  2WF7 A;  4QWC A;  4DF4 A;  8ICK A;  2QB0 B;  2NRV A;  2RRD A;  5KFY A;  5DQH A;  5IIL A;  1N5W A;  7ICQ A;  2BDU A;  1TK0 A;  4F8R A;  2KTQ A;  3UMG A;  2WB1 F;  2MAX A;  4I2H A;  2WAQ C;  4I2C A;  9ICB A;  3HP6 A;  2KFN A;  2HHX A;  4ECU A;  1L6N A;  5DBA A;  4R66 A;  2NRX A;  4E0D A;  4KMU A;  3MR2 A;  1LB2 B;  8ICB A;  9ICJ A;  2CXY A;  1HUO A;  3TFR A;  2YY6 A;  1SWV A;  3O0F A;  5DG8 A;  2BQR A;  3GV5 B;  3ZI4 A;  3IV6 A;  3ORY A;  2W8L A;  5KFV A;  5KT2 A;  2HDO A;  4KMO B;  1IXR A;  2YB1 A;  5ALW A;  4QZ8 A;  2BKE A;  3U26 A;  2EZZ A;  4AYB F;  5J8Y C;  1JRO A;  4NL9 C;  2WHE A;  2QAR B;  5AM2 A;  3ETL A;  4PGY A;  1BPE A;  5J2D A;  2BHN A;  1F0M A;  2JV3 A;  3PW4 A;  2P6R A;  2KSO A;  5KFL A;  3AEV A;  5DDM A;  3UMC A;  2GH1 A;  4PGQ A;  2GLE A;  2K8C B;  3V6K A;  2Q0Z X;  3H40 A;  3QUQ A;  5L1I A;  3K1Z A;  4QJF B;  1X6J A;  4KX5 A;  3AQF A;  4R65 A;  4ECS A;  1NK5 A;  1ZQC A;  8ICG A;  3V6H A;  1ECW A;  2G06 A;  4JV0 A;  4I2A A;  1ZQO A;  5HR6 A;  3H0L B;  3PST A;  2LKY A;  3KKA A;  1UT5 A;  4BUG A;  3F53 A;  1DGS A;  4JB3 A;  1QSY A;  4FZN A;  3SAF A;  2N1R A;  2WF8 A;  2YX8 A;  5J29 A;  3QX7 A;  2VA2 A;  1KEJ A;  5ALS A;  3EZ5 A;  5J0O A;  3LVW A;  5F9L A;  2R8J A;  5AHX A;  3D2S A;  1NKE A;  2NYV A;  5AKE A;  1Z4O A;  2V4R A;  5KT3 A;  2HVH A;  5DB8 A;  4I2E A;  5KG2 A;  5CJ7 A;  8ICT A;  2KG5 A;  1KW4 A;  4IS7 A;  5J2G A;  5AK3 A;  3K1R B;  1AQ6 A;  5KG7 A;  3WK8 A;  4US8 A;  5KG4 A;  5DB7 A;  5ALH A;  4UB8 U;  1EXN A;  4P0P A;  5KFE A;  2AQ0 A;  3E2E A;  2F1H A;  3Q8K A;  3AQE A;  1Q8K A;  5CHG A;  3QE9 Y;  4UAR A;  5ALR A;  5G5G A;  4R8U A;  3SZ2 A;  2EZY A;  4UBC A;  2E8M A;  5KFO A;  4ED2 A;  3HIL A;  1KFD A;  1NZB A;  2F77 X;  1N5X A;  5ALM A;  1JXL A;  1K1Q A;  2ZJ8 A;  5ALV A;  1NZP A;  2L5Y A;  4RT3 A;  4Q43 A;  1N2X A;  3ZD8 A;  1PVR A;  1MA7 A;  3LYS A;  1YZ6 A;  5DG7 A;  4I2J A;  5DLF A;  2AJQ A;  3IG8 A;  2AH5 A;  1ZQL A;  1WWU A;  2A1A A;  4NLG A;  3A0B U;  2KSO B;  1IM4 A;  2LM4 A;  4RQ4 A;  2JEJ A;  2HHU A;  2AXT U;  4KLI A;  2O6K A;  2FMS A;  1ZD3 A;  4QZH A;  4IRK A;  1VJ5 A;  3QEA Z;  3QXG A;  1ZJM A;  3VC8 A;  5KL1 B;  2XY7 A;  2P66 A;  2W54 A;  2YMQ A;  1U49 A;  5KT7 A;  2P35 A;  4GC7 A;  3WKD A;  4EEL A;  2JMG A;  4C0Z A;  2Y9T A;  3OJS A;  4B9M A;  2KNJ A;  2F8L A;  5KFJ A;  3FYH A;  4F5Q A;  5EE0 A;  1J2N A;  4OJO A;  3H4D A;  3PX0 A;  3ZDB A;  5KG5 A;  3GV8 B;  2HMX A;  3IN5 A;  3ICX A;  3KOO A;  1KBU A;  4ECZ A;  3T5J A;  3QU2 A;  5L1J A;  1NJZ A;  2KIV A;  5JUM A;  2UVR A;  1DGJ A;  4MEX A;  4MFF A;  4UB4 A;  4UAS A;  4IRC A;  1S76 D;  7ICN A;  3RRH A;  4J9Q A;  4P4P A;  5DQG A;  3KHG A;  3HX0 A;  2AGQ A;  3JPP A;  1ZET A;  3EYZ A;  5HP4 A;  2XI9 A;  3BJY A;  4MFA A;  4G9B A;  8ICX A;  2HBK A;  2FDR A;  5EE9 A;  4ZH4 A;  4J9P A;  4F2S A;  3BZK A;  5IIK A;  8ICP A;  4KLH A;  4USA A;  3G6V A;  4P0P B;  2WB1 C;  2E3T A;  1D8L A;  5F3X B;  1K5O A;  1YZ7 A;  3H0M B;  4PHA A;  3BQ0 A;  2CPR A;  1NKB A;  2NO4 A;  9ICS A;  4R8U B;  2XGQ A;  3PVX A;  1DXS A;  3QU4 A;  5KG3 A;  1KSP A;  1A6S A;  1X40 A;  5AKI A;  2EQY A;  5DG9 A;  5AKX A;  5L9X A;  5AKH A;  1N61 A;  3THV A;  5HNK A;  1XU4 A;  4DSJ A;  4NM2 A;  3L3F X;  2A19 A;  1SKR A;  2XCA A;  3CNH A;  3EW9 A;  3PSI A;  2HVI A;  4QW8 A;  3RRG A;  5D4B A;  5AI4 A;  1ZQR A;  5DB9 A;  2HHS A;  1LKY A;  4I2G A;  1JXE A;  4JUZ A;  1RXW A;  2RLT A;  1FIQ A;  1BPD A;  4AYB C;  2W7P A;  3RB4 A;  2H3F A;  2K60 A;  5ALF A;  3Q8P B;  8ICY A;  1N60 A;  4OJL A;  1ZD2 P;  3QNM A;  4UB1 A;  1ZQG A;  3L5K A;  5JRT A;  2XGP A;  2C28 A;  2G0A A;  4BXO A;  2E8P A;  4PH5 A;  1MQ2 A;  5AKL A;  1UCV A;  2MSN A;  3MR3 A;  2VAN A;  1L8O A;  4UAU A;  9ICH A;  4HYK A;  5C5J A;  1PVQ A;  7ICI A;  1BNO A;  3TFS A;  4KLO A;  5EWF A;  1S8O A;  1A77 A;  4O0I A;  2LYB A;  2ZIX B;  3C5F A;  1DRG A;  4DL6 A;  4DFJ A;  2J6T A;  4EEN A;  4O3O A;  4UB3 A;  1B22 A;  2DKZ A;  4I2I A;  1BPB A;  5AK6 A;  3PSF A;  3DV9 A;  5AKY A;  5ALQ A;  9ICT A;  1BNP A;  2G08 A;  4UW9 A;  1PK1 B;  2C2R A;  3QU5 A;  4DS5 A;  5KFI A;  4F5O A;  4QZG A;  1TAM A;  4KLL A;  1D8B A;  1SZH A;  1HIW A;  1C7Y A;  2Y0S F;  1ZXI A;  1KDH A;  4ICA A;  5AM0 A;  3UPQ A;  2E1E A;  5AI8 A;  4M9G A;  3F5E A;  3TQ1 A;  3RR7 A;  3TAQ A;  3BS5 A;  4I27 A;  3M1Y A;  5B66 U;  1B43 A;  3BZC A;  4Y2S A;  2LI6 A;  4YD2 A;  4KLJ A;  3PMN A;  4OCZ A;  3M9N B;  4FS2 A;  4YD1 A;  5K4L A;  2VJ4 A;  4FO6 A;  2R8I A;  1J2M A;  1ED1 A;  3C29 A;  4QZB A;  2K4H A;  5DQI A;  5BOM A;  4FBT A;  3RJG A;  4RPY A;  4ECY A;  4DL5 A;  2K4P A;  1SXD A;  1PUZ A;  3RBD A;  3D2N A;  4C7Z A;  4RZR A;  3EPI A;  1JMS A;  2YQE A;  7ICH A;  2M0N A;  3RH5 A;  8ICC A;  1TK5 A;  5CB1 A;  5D46 A;  3F2B A;  1ZQJ A;  1ZQU A;  4GXI A;  5HMM A;  4F71 A;  4DFP A;  3RH6 A;  1QTM A;  3H4B A;  4GIB A;  1MSW D;  2EZX A;  1LKY B;  3M9O B;  3PZP A;  3PX4 A;  1GO3 F;  2BDP A;  4NLB A;  1QQ6 A;  5KFD A;  4P0Q B;  4EEY A;  2MUT A;  5KL8 B;  5EWE A;  3OGU A;  2W3S A;  1PZN A;  4EZ9 A;  2CRX A;  4DS4 A;  4O5E A;  1U45 A;  4BXO B;  4M9H A;  5HHI A;  5DBB A;  3AUO A;  3SV3 A;  1S0N A;  4OJ6 A;  4C4T A;  5F9N A;  3GZF A;  5ALJ A;  2IA6 A;  1NI3 A;  4PGX A;  4CE6 A;  4TQS A;  4DQR A;  5CWR A;  5KFR A;  2IOH A;  5ALP A;  1O08 A;  2I1Q A;  2PFQ A;  1RXV A;  4ED8 A;  3AU2 A;  3KHR A;  2ZTE A;  2K4E A;  4ELV A;  5T14 A;  1IV8 A;  5KFN A;  2H3V A;  1S10 A;  1A76 A;  2KD1 A;  4C4S A;  2BR0 A;  2H3Q A;  4GXJ A;  1CRX A;  4JV1 A;  2EAM A;  2C2D A;  2JR5 A;  2GOL A;  3QEB Z;  1WG8 A;  4J03 A;  1ARO P;  4GXK A;  3C28 A;  3BS5 B;  3FC4 A;  3JPR A;  2KN7 A;  4RNO A;  1SV0 A;  1KFS A;  5ALN A;  7ICV A;  3AM9 A;  4DSK A;  1F44 A;  1CI4 A;  2ZUD A;  4Y2J A;  2KJ8 A;  4M2Y A;  3G6X A;  4X5V A;  2XC9 A;  4J9L A;  5L1L A;  5AIC A;  1WWV A;  3L4P A;  4DEZ A;  4B9V A;  4PZN A;  2HOQ A;  1TAU A;  3B0Y A;  3ZDC A;  4WJ3 B;  1X9W A;  3WK9 A;  3LK9 A;  4F4W A;  3RB0 A;  4OD0 A;  1ZQN A;  4QZD A;  1NJX A;  3UXO A;  4FZL A;  1ZQI A;  3F2C A;  2ASJ A;  3V7L A;  4PZO A;  2C2E A;  4C7Y A;  2JEF A;  5IIJ A;  3AU6 A;  2XY6 A;  2F1I A;  4YXM A;  2BQU A;  1U48 A;  3RJE A;  4RQ1 A;  9ICV A;  2XY5 A;  2BPC A;  4UAY A;  1S9F A;  2DFL A;  3ISC A;  3SD7 A;  1XNS A;  2YB4 A;  4RQ8 A;  1ZQK A;  1X42 A;  7ICE A;  4QZF A;  5J0X A;  1PVP A;  2IHN A;  4O5C A;  4F4K A;  5J2A A;  2VKQ A;  4B9U A;  3MFI A;  4M9N A;  2R8G A;  5AK4 A;  1V97 A;  1XS9 D;  2OXO A;  1F5S A;  5GTI U;  1TFR A;  1H38 A;  2KKV A;  1U47 A;  1L3S A;  3WK5 A;  5KFC A;  4UB5 A;  3IG5 A;  4YG2 A;  5CEH A;  2KIC A;  5DDY A;  9ICO A;  4M6W A;  2XCP A;  1Z00 A;  3C23 A;  1XSL A;  5J0P A;  3Q8S B;  1NK7 A;  1CEZ A;  3QZ7 A;  4QZ9 A;  2BCS A;  3FDS A;  2ZJA A;  3C21 A;  1L3T A;  3SEI A;  1D9F A;  2F1J A;  4O3P A;  2B6G A;  4Y2Y A;  5KFP A;  4JWM A;  3PW0 A;  3NVV A;  4BX9 C;  1J97 A;  4YR0 A;  2OEH A;  2DGZ A;  2FMP A;  2R18 A;  1RZT A;  5AM3 A;  8ICF A;  3T3F A;  1JRP A;  4ED0 A;  2IMW P;  9ICU A;  2DQN B;  3MGH A;  7ICJ A;  1SL0 A;  2LHT A;  2J6S A;  2Y0S C;  3Q8M A;  4O3M A;  2JH1 A;  4YQW A;  1FO4 A;  3RF9 A;  2LYH A;  9ICF A;  2BZF A;  5ALO A;  4RUC A;  4QW9 A;  3M8S A;  1M6Y A;  1XSP A;  4DSI A;  4LJX A;  4ELU A;  2UVU A;  4QZI A;  3BQ2 A;  3QYP A;  1T7P A;  3EWA A;  2ZXI A;  3UXP A;  2E8N A;  3MC1 A;  5IIM A;  1FEZ A;  3OHA A;  1HEK A;  5AK5 A;  3GIK A;  4TUR A;  3MGI A;  4UAV A;  2KP7 A;  2ZUB A;  5CRX A;  1X9X A;  4I2D A;  8ICE A;  1JN3 A;  2RDJ A;  4IQV A;  1ZQ1 C;  2ISP A;  1SKS A;  5A0L A;  3UXN A;  3RJJ A;  4ZOH C;  1BGX T;  2WF5 A;  4NV0 A;  3SV4 A;  8ICM A;  5AIA A;  5AM4 A;  4F5P A;  3HJE A;  2HCF A;  1Y88 A;  2HSZ A;  9ICM A;  2JZB A;  4IC9 A;  5J0Y A;  3T79 A;  1X9S A;  1N63 A;  4F4Y A;  1NNL A;  2YMM A;  4OJP A;  2I6X A;  4C8O A;  5HML A;  3RAX A;  4PL1 A;  1LV5 A;  3Q8R B;  2OHF A;  3PNC A;  1U4B A;  4Z6D A;  2FPK A;  4M6W B;  1Z00 B;  3UMB A;  7ICM A;  3CP8 A;  2DUY A;  4KLE A;  2LYA A;  3ZD9 A;  2PFN A;  1TKD A;  4O9M A;  2D6F C;  2VIX A;  4F5R A;  2FI1 A;  3N7P D;  2A1J A;  3RB3 A;  2PI5 A;  5J8Y A;  1RYU A;  3T5L A;  4NL9 A;  3C1Y A;  5J0W A;  4DQP A;  4F3O A;  1S0V A;  4ECV A;  1ZRM A;  2RDI A;  1S77 D;  5KFG A;  3IM1 A;  1XWL A;  5AKZ A;  4ECX A;  4IR1 A;  1Q46 A;  5AI0 A;  4JMU A;  1S97 A;  5KNI A;  4B9T A;  5KTQ A;  4BWM A;  3GFK B;  8ICS A;  4UAZ A;  3GU3 A;  4TUS A;  5L1M A;  3NVY A;  3GIM A;  1SL2 A;  3C1Z A;  2KHV A;  3WK6 A;  1ZQH A;  2DF4 B;  2OCE A;  4F92 B;  3B9J A;  4FS1 A;  2P6U A;  2DKX A;  5B5E U;  3KZX A;  2DL0 A;  3TAD A;  2FLN A;  3SAH A;  2KZZ A;  8ICI A;  2F2A B;  3A0H U;  1RDF A;  4YP3 A;  3HW8 A;  3WKB A;  3C5G A;  1V85 A;  3KHH A;  3J81 j;  2EH9 A;  4F72 A;  4NXZ A;  3RTV A;  4KX3 A;  3OTQ A;  4QNL A;  4KTQ A;  8ICQ A;  2G5I B;  4Y2X A;  3TAC B;  1RM6 C;  4GLX A;  2BPF A;  4XRH A;  2IBK A;  3M7D A;  2BGW A;  4DOA A;  4Q44 A;  1NK9 A;  1TAQ A;  4KN7 A;  4RQ7 A;  1ZQP A;  1Q3U A;  7ICF A;  2MRL A;  4ECR A;  3SMV A;  1NK8 A;  2FPL A;  1Z4N A;  3UM9 A;  1OUQ A;  2PMZ F;  3DEE A;  5KT4 A;  5TIS U;  3NRW A;  4KN4 A;  4HAI A;  4YCX A;  1NK4 A;  3SI8 A;  4RQ6 A;  3QU7 A;  2QLT A;  2XIC A;  9ICK A;  4OJ5 A;  4DQQ A;  3MR6 A;  1T3N A;  4EX6 A;  2OYY A;  3I1Y A;  8ICV A;  5TZV A;  5J0U A;  2JEG A;  5E79 U;  4P4M A;  3S6J A;  4EYI B;  4EBD A;  2ZIV A;  2OH2 A;  2XO7 A;  2R8K A;  3MFH A;  2PXI A;  2ASD A;  1ZQT A;  2A1J B;  4DQS A;  3PW5 A;  1NK6 A;  2ALZ A;  4F2R A;  1KN5 A;  4C8N A;  3ZDD A;  3H0R B;  1X9M A;  3SYZ A;  2PFO A;  4Y2R A;  4NLK A;  1T94 A;  3PO5 A;  4ED6 A;  8ICA A;  4KLF A;  5CA7 A;  9ICX A;  8ICZ A;  1MC8 A;  1KL9 A;  4DOB A;  1SXE A;  3SEN A;  2WF6 A;  5AI5 A;  4YR3 A;  2YML A;  3I28 A;  2ZIW A;  3ED5 A;  1P7D A;  4ECW A;  4NM1 A;  2UVV A;  1ZQV A;  2IOF A;  2V4Q A;  1Z1B A;  2KJ9 A;  4F4X A;  4RQN A;  4PPX A;  3T5H A;  2KMD A;  1D8Y A;  5III A;  4DQI A;  2QB0 A;  2HHQ A;  8ICR A;  4I2F A;  5AM1 A;  3V7J A;  3KFU F;  2W9B A;  1T4G A;  4YN4 A;  4TUP A;  2W9M A;  1QLN A;  3WK4 A;  8ICH A;  1DOQ A;  2ISO A;  2NRW A;  4CNQ A;  4EYH B;  1KLN A;  1JIH A;  1IIP A;  3HWT A;  5AI6 A;  1Z19 A;  2KZ3 A;  3KD3 A;  3WKE A;  3UQ0 A;  2VJ5 A;  5J2F A;  4PHP A;  4ECT A;  2KZM A;  2FLL A;  4C8M A;  1U9L A;  3F2D A;  1L7N A;  2W04 A;  2V9W A;  1UA1 A;  7ICL A;  3FM9 A;  1ZQA A;  4FZM A;  3V6J A;  1RYR A;  2KVC A;  4YVZ A;  2I9G A;  1T3Q A;  1QSS A;  3KKA C;  5KFK A;  3MBY A;  1PK3 A;  9ICI A;  2HW3 A;  2ZG6 A;  5KFU A;  2JRZ A;  2ASL A;  8ICO A;  4Z6C A;  4Y2U A;  2K4I A;  1L3V A;  2JGA A;  3QUB A;  5J2J A;  1ZQD A;  2EAP A;  3BDP A;  3D2Q A;  1OXJ A;  3IHQ B;  2B0C A;  3GQC A;  2AU0 A;  3NVZ A;  1ZJN A;  1XSN A;  5HHH A;  3OJU A;  4EBE A;  3B0X A;  2IOF K;  5G5H A;  2NRZ A;  2FPM A;  5KAF U;  4Z6F A;  2W03 A;  1RQL A;  2I5H A;  3IDW A;  4Y2Q A;  4QIW C;  3MDA A;  4YFK A;  1ZQQ A;  1L3U A;  2AHO B;  2HBM A;  5KFF A;  2C22 A;  1BPZ A;  4P4O A;  1X6I A;  4UBB A;  2EAN A;  3H8S A;  4DFK A;  2AQ4 A;  4PHD A;  2QKQ A;  8ICU A;  1UT8 A;  3BQ1 A;  4ECQ A;  4EBC A;  4A8E A;  1ZQS A;  2RQ5 A;  2ZIW B;  5KFX A;  4YXJ A;  4DLE A;  2JH7 A;  5KG1 A;  4UQG A;  3CRX A;  4P2H A;  4K4I A;  4DOC A;  1FFU A;  3HRD D;  4Q45 A;  5KG0 A;  1BPY A;  3E58 A;  5IIO A;  2W9B B;  4DFM A;  5KFZ A;  4MF2 A;  3N97 B;  4IL6 U;  2KE7 A;  4NWI A;  1ZQM A;  3V7K A;  2KV2 A;  1S5L U;  3GII A;  1TK8 A;  3ZDA A;  2ATL A;  2A3V A;  1COK A;  3JPO A;  4XQ8 A;  2BQ3 A;  4RPX A;  2XVT A;  1S0M A;  4QWD A;  4QWE A;  2D3D A;  4FE3 A;  4RT2 A;  1JI7 A;  4U7C A;  4DL4 A;  5J2I A;  1S0O A;  4ED1 A;  1CUK A;  4IQW A;  2NRT A;  4QWB A;  4DFD A;  3VCB A;  1TVA A;  5J2K A;  3H8J A;  1RPL A;  4RNN A;  4BJQ A;  1DK3 A;  3WK7 A;  4MEY A;  1NKC A;  1HUZ A;  3KZI U;  1B0X A;  3WKC A;  2MUT B;  5J2C A;  4EZ6 A;  2W55 A;  5DGA A;  3D6J A;  1RQN A;  2HI0 A;  2PI4 A;  2PMZ C;  2J6U A;  2KK0 A;  5KFM A;  5J0R A;  3H8W A;  9ICQ A;  1N62 A;  3BS7 A;  3KTQ A;  3PW7 A;  2FLP A;  3NRZ A;  2KJ5 A;  4BWJ A;  1ZQW A;  1KTQ A;  3IP4 B;  4RQ3 A;  3ISD A;  1ZQE A;  3Q8L A;  2E8O A;  3PR4 A;  1QQ7 A;  3NVW A;  3WU2 U;  5KFS A;  4ACO A;  4F91 B;  4DWI A;  2ES6 A;  1O03 A;  1BPX A;  5DLG A;  4QWA A;  3SQI A;  2G5H B;  2CN1 A;  3PV8 A;  5AM5 A;  2FJ6 A;  3ETR A;  5EE3 A;  2YN4 A;  2W11 A;  1L7P A;  4B9S A;  3GIL A;  4Y2T A;  4CF4 A;  1ZQZ A;  4B9N A;  3MAB A;  3TAD C;  4MFC A;  1Z1V A;  4PL2 A;  1X66 A;  1L8L A;  9ICP A;  2EDU A;  3TI0 A;  1T8E A;  7ICR A;  5KAI U;  2IHM A;  4RQ0 A;  1WYG A;  4UB2 A;  8ICJ A;  4KLQ A;  2EAO A;  3LWL A;  3TAR A;  3RB6 A;  7ICU A;  1ZQX A;  1L7O A;  1VLB A;  4O3Q A;  4TUQ A;  2H3I A;  2DPI A;  1NJY A;  2BCV A;  3CW2 C;  2LPE A;  4I29 A;  4ED3 A;  2NV3 A;  5GTH U;  5KFB A;  2F44 A;  3AN1 A;  5ALE A;  3AMZ A;  7ICG A;  2BCU A;  1V38 A;  2YMP A;  3WKA A;  3TKA A;  8ICL A;  5JU5 A;  2ZTD A;  1TV9 A;  1QCK A;  4M9J A;  4C8K A;  3ISB A;  3NAS A;  4NLZ A;  1DK2 A;  3JPS A;  3TAN A;  4I2B A;  2HHW A;  3N4M B;  1V9P A;  7ICS A;  1QH9 A;  1MN8 A;  1SZP A;  3GV7 B;  1L7M A;  3HKZ C;  3ZDE A;  2ODG A;  2VA8 A;  4CRX A;  4NY8 A;  4Q8F A;  2ESE A;  2W9C A;  2WTF A;  4C4R A;  3QUC A;  3GIJ A;  1NJW A;  1XO1 A;  4DO9 A;  3RJK A;  2G09 A;  5KFT A;  2WFA A;  4O3S A;  1ZQB A;  2KEY A;  3JPN A;  4DCC A;  2F76 X;  2BCR A;  5J0S A;  2Y9U A;  2Z7J A;  5KFQ A;  1D9D A;  3JPT A;  3N28 A;  4DSF A;  5KFW A;  3N7S C;  4M0A A;  4R64 A;  3LDA A;  5AKJ A;  4IR9 A;  4XUS A;  1KFT A;  1L5U A;  4DL7 A;  3OHB A;  4QZA A;  4J9K A;  2H3Z A;  5ALU A;  2HHV A;  2KVS A;  5KG6 A;  2QB1 A;  5KFH A;  2K89 A;  9ICE A;  1K1S A;  1XO0 A;  3UQ2 A;  2JHD A;  4B6J A;  3JPQ A;  4QIW F;  4KLG A;  1QSL A;  3K4G A;  4RNM A;  4C80 A;  4AP9 A;  2HBL A;  4YMO A;  5EOZ A;  1ZD4 A;  1ZOL A;  2VA3 A;  4M47 A;  3OPX A;  4BDP A;  3I76 A;  5H2F U;  5ALZ A;  7ICP A;  2HOF A;  9ICL A;  2ZIX A;  5ALK A;  3RJI A;  3BQ7 A;  2RP5 A;  5FP0 A;  2LBO A;  2AGP A;  4CF3 A;  3ONN A;  5AKG A;  3RR8 A;  1PK1 A;  2W8K A;  4JK1 A;  4YMN A;  3QU9 A;  1QQ5 A;  1URJ A;  4I28 A;  3C2M A;  2BCQ A;  1WCL A;  4IQU A;  1MQ3 A;  2ZJ5 A;  1BVS A;  5ALD A;  4DL2 A;  1UPH A;  2M9N A;  1ZD5 A;  3NTU A;  7ICT A;  5HR7 A;  1COO A;  4PJ0 U;  2ZTC A;  8ICN A;  1ZRN A;  2F3N A;  4UB6 U;  3AL0 B;  4Y2P A;  2WAQ F;  5J2B A;  3BQT A;  3MGV A;  1A0P A;  3KBB A;  4J9M A;  1X2I A;  1Z3E B;  3EUB 2;  3FAH A;  2K8B B;  3T5K A;  2JXJ A;  4M04 A;  5BPC A;  9ICG A;  4J9R A;  3M6K A;  1WUD A;  1SB3 C;  5CR0 A;  2OM6 A;  4RUA A;  3MR5 A;  3PO4 A;  4EEK A;  4KIT B;  4PHE A;  5ALX A;  5ALG A;  4JV2 A;  3PML A;  4DLG A;  4RPZ A;  4O3R A;  2DBY A;  3SAG A;  5DGB A;  5DB6 A;  2W9C B;  4KLU A;  4Y2V A;  3RJH A;  1SWW A;  2KFZ A;  4J9N A;  4F5N A;  2FMQ A;  2GWS A;  3PSP A;  3M6Z A;  5J0T A;  4U6P A;  1SIJ A;  3OSN A;  4QZE A;  2JZB B;  5EE1 A;  4DF8 A;  4UAT A;  3EPG A;  4FFD A;  4MHV A;  4NLN A;  1WCN A;  2PKE A;  4NJ8 A;  3NGD A;  1N48 A;  3F5A A;  4R63 A;  4RQM A;  5J2E A;  2W7O A;  2Y1J A;  5EWG A;  4GC6 A;  3C2L A;  9ICA A;  4YR2 A;  4P0Q A;  2W9A A;  4F4Z A;  4C8L A;  4O5K A;  2F8K A;  2MU2 A;  2E1F A;  1ZYQ A;  1SKW A;  1SV0 C;  2Y1I A;  5KFA A;  1JX4 A;  3KHL A;  2Q4T A;  4FBU A;  2W3R A;  1XC9 A;  2XID A;  3TAP A;  4RQ5 A;  5BOL A;  2MA1 A;  5JTI A;  4LZG A;  8ICW A;  4G3I A;  4KLT A;  5C0Y A;  2HHT A;  5D49 A;  2G07 A;  5AIB A;  5ALI A;  2D8C A;  5DKW A;  9ICR A;  1SV4 A;  1Q3V A;  2B21 A;  1IG6 A;  5L1K A;  4M9L A;  4CCH A;  3QUT A;  5J2H A;  2ZIU A;  3RFA A;  3M9M B;  4MF8 A;  5IIN A; 
#chains in the Genus database with same CATH homology
 2Y0S C;  3CP8 A;  3SQI A;  4FZL A;  1GO3 F;  2G5H B;  2CN1 A;  1IIP A;  3AQE A;  1WUD A;  3M6K A;  3NUQ A;  2JH1 A;  2LYB A;  2ZIX B;  4NLB A;  4AYB F;  1DRG A;  3CRX A;  2OM6 A;  3N7S C;  3NRW A;  4CGZ A;  1Z19 A;  4P0Q B;  2LYA A;  5KL8 B;  2D6F C;  2VIX A;  3RF9 A;  2XI9 A;  2KHQ A;  3N7P D;  2HBK A;  2CRX A;  2HOI A;  3LVV A;  2XIC A;  3PSF A;  3SAG A;  2ZXH A;  2VJ5 A;  2H3Z A;  1NZB A;  2F77 X;  4OJ5 A;  2GH1 A;  4PL2 A;  4OJ6 A;  2RHF A;  3F2D A;  2K89 A;  3CYM A;  2KKP A;  4GFJ A;  2G08 A;  2K8C B;  2W04 A;  3GZF A;  4CDG A;  3PSP A;  2ZXI A;  2OYY A;  1TAM A;  1D8B A;  4NWI A;  1SZH A;  3M6Z A;  4U6P A;  2ZIU B;  1XNS A;  2WB1 C;  2JHD A;  2YB4 A;  3K1Z A;  4FZM A;  2KV2 A;  4QJF B;  1XO0 A;  4P0P B;  1HIW A;  2KVC A;  4JMU A;  2Y0S F;  1PVR A;  1MA7 A;  4KX5 A;  3ALR A;  1PVP A;  2A3V A;  4QIW F;  3H0M B;  4ICA A;  3AQF A;  2E1E A;  4O3M A;  1HEK A;  3F5E A;  3LYS A;  3HKZ F;  2CPR A;  1ECW A;  2XVT A;  2ZIV A;  2H3I A;  2HBL A;  2G06 A;  2VKQ A;  2ZG6 A;  2OH2 A;  2RRD A;  3F5A A;  4FE3 A;  3GU3 A;  3OPX A;  5HR6 A;  5CRX A;  3IG8 A;  2K4I A;  2K4E A;  3H0L B;  3PST A;  4U7C A;  2LKY A;  5T14 A;  2W7O A;  2JGA A;  3E0F A;  3H0R B;  2BDU A;  2NV3 A;  2HOF A;  2KHV A;  4BUG A;  2ZIX A;  1A6S A;  3F53 A;  1ZQ1 C;  2OXO A;  2DF4 B;  4P0Q A;  4FZN A;  3SAF A;  2H3V A;  2N1R A;  3VCB A;  2YX8 A;  3D2Q A;  1T94 A;  5A0L A;  2KKV A;  2KD1 A;  2RP5 A;  3N7R C;  2H3Q A;  3KZX A;  2K8A A;  1CRX A;  2WB1 F;  3SAH A;  2F2A B;  2VJ4 A;  4BJQ A;  2LBO A;  2E1F A;  2WAQ C;  3L3F X;  3IG5 A;  1ED1 A;  3LVW A;  2KIC A;  4NV0 A;  3PSI A;  3VC8 A;  3C29 A;  3ONN A;  5KL1 B;  2Q4T A;  2KIW A;  2GOL A;  1L6N A;  3D2S A;  2K4H A;  3C28 A;  2ZIW A;  1URJ A;  1P7D A;  2XID A;  2JMG A;  2PMZ C;  3D2N A;  4KX3 A;  4QNL A;  4IC9 A;  4AYB C;  2W7P A;  4NLC A;  2W03 A;  1Z1B A;  2KJ9 A;  4C0Z A;  2H3F A;  3T79 A;  2MA1 A;  1UPH A;  2KNJ A;  2F8L A;  4OJL A;  4QIW C;  2E5S A;  2KOB A;  1F44 A;  2G5I B;  2M0N A;  4OO1 J;  5HR7 A;  3O0F A;  3HKZ C;  3F2C A;  4OJP A;  2KJ8 A;  2G0A A;  4CRX A;  1YT3 A;  2HBM A;  2KJ5 A;  4OJO A;  3M7D A;  5C0Y A;  2HMX A;  3F2B A;  3AL0 B;  3IN5 A;  3KFU F;  4BX9 C;  2G07 A;  2WAQ F;  3ICX A;  3IP4 B;  4PL1 A;  2HBJ A;  1KBU A;  2DGZ A;  3MGV A;  1A0P A;  2R18 A;  2G09 A;  2HOQ A;  4KMO B;  1Q3U A;  2YB1 A;  1Q3V A;  4WJ3 B;  2MRL A;  2ZIV B;  2K8B B;  3SMV A;  1PVQ A;  2KEY A;  2ZIU A;  2F76 X;  4P0P A;  4ACO A;  4A8E A;  3RFA A;  2DQN B;  2ZIW B;  1OUQ A;  2PMZ F;  2JH7 A;  3DEE A;  2LHT A;  3PZP A;  2Z7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...