2G5IB

Structure of trna-dependent amidotransferase gatcab complexed with adp-alf4
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
410
structure length
410
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 120
structure length 410
sequence length 410
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5iB02
3AL0B 2D6FC 2G5HB 3IP4B 2DQNB 2G5IB 2F2AB 3KFUF 4WJ3B 1ZQ1C 3H0RB 2DF4B 3H0MB 3H0LB
chains in the Genus database with same CATH superfamily
4DFJA 3HP6A 4B9TA 5KT4A 5ALZA 3F5AA 5AKXA 3MFIA 3IRUA 2DUYA 4M9NA 2H3IA 3SAFA 4RQ6A 7ICKA 4QNLA 2HCFA 1S77D 3BQ0A 3U26A 1UA1A 1OUQA 1YT3A 3GIMA 3AU2A 2KIWA 3KZXA 3KHHA 4QWCA 2FJ6A 5KG2A 1NKEA 2LPEA 1JXLA 2HHUA 1B0XA 3ISBA 3M6KA 2FI1A 5J2GA 2BGWA 2JGAA 2HHWA 4KMUA 1SL1A 1JRPA 5BPCA 9ICWA 5J2CA 3ED5A 2C22A 2UVVA 2KD1A 2W8LA 2L5YA 2K8BB 3V7LA 5ALKA 1SV4A 5DB8A 5L1MA 3MGVA 1ZETA 1PK1B 2P6UA 3T3FA 1Y88A 2J6TA 4RQ0A 4DOBA 1ZQ1C 3MDCA 2JEFA 4LZGA 2W55A 2JH1A 1S0MA 4R63A 2HOIA 1SKWA 1ZD2P 3G6YA 3RB6A 2BQ3A 1EXNA 1ZQHA 3QZ8A 1CUKA 2PFOA 2BKEA 4ZOHC 3C5FA 3PVXA 4DFDA 1KBUA 2B21A 5EE9A 2VJ5A 4R66A 1LB2B 1NK0A 4FBTA 1U9LA 1DGSA 2BCVA 1N2XA 2NO5A 4DLGA 8ICWA 3AMZA 5AI5A 1B43A 3QU4A 4RNOA 2RRDA 4NLCA 2GO7A 3WKAA 1NK8A 5CJ7A 4P4OA 4YN4A 2KZMA 1ZQOA 4ECUA 2GOLA 1ZQTA 3F2DA 2FLLA 1QSSA 1O03A 1F44A 5D46A 2W9MA 3FDSA 1ZJMA 1SV0A 5EWFA 4EEKA 3PW7A 1D9FA 3AQEA 2V4QA 4J9SA 4B6JA 5AI6A 5J0PA 5J2HA 4RPXA 2XY7A 3ZD8A 4NY8A 4C4SA 5KFOA 5J2KA 5J2FA 4R8UA 1FFUA 2JMGA 4EENA 3M6ZA 2UVUA 5L1IA 4OJPA 3PW2A 5CB1A 4NLZA 4I29A 4EEYA 2RHFA 2G06A 3QU7A 3H0MB 1ZQJA 4Q8EA 5JRTA 4C4TA 8ICAA 2HOFA 1RG6A 1QCKA 1UA0A 3ALRA 5AKGA 5AM1A 4TQRA 2BR0A 9ICLA 5IINA 3ZD9A 2LM4A 1D8LA 3QUBA 1NJXA 3GQCA 9ICVA 3A0BU 3FAHA 1A76A 2KFZA 9ICTA 5G5HA 1B22A 5DKWA 1TAQA 4C8MA 2XGPA 3UM9A 1ZQXA 4R8UB 5DGBA 2HDOA 1T8EA 3H0RB 4J9NA 3IG5A 3Q8KA 1HEKA 1MQ3A 3K1ZA 2NRZA 5AM3A 1BPYA 2GWSA 1V9PA 3UXOA 1BPXA 5AIAA 1DGJA 4Y2UA 1N5XA 2I6XA 5TZVA 1SL0A 2EDUA 4FFDA 2R8IA 1IG6A 3RB3A 2KK0A 2DQNB 3V72A 1M6YA 3QU9A 8ICBA 4GXJA 5KFXA 5KFDA 3JPQA 2EAPA 3KTQA 2WB1C 1JMSA 3V6HA 4DQSA 3AM9A 1L3SA 2ZTDA 5KT2A 3WKBA 3BZKA 3RBEA 5ALQA 2E3TA 7ICMA 1WWVA 3C2LA 2PI4A 4FBUA 1U45A 2R18A 1ZOLA 3FYHA 9ICBA 2AQ0A 7ICJA 4P4PA 2Y0SF 4F5OA 3IHQB 2I9GA 4YXMA 1QTMA 3HILA 3PW5A 3KZIU 5J2BA 3E2EA 2LM1A 2FE9A 4QZFA 3QUQA 9ICSA 1ZQBA 1U47A 1LVHA 2OEHA 3UXPA 4YQWA 3SV4A 4KLTA 4DSJA 5AIBA 2OXOA 1ZQKA 3OJSA 1XSNA 1XU4A 5AK6A 2W9CA 4LZDA 2QKQA 2IOFK 2F76X 2XI9A 4O3MA 3M9NB 5B5EU 1O08A 1Z00A 5KFYA 3WK9A 3B0XA 1ZD3A 2BHNA 5EOZA 2KOBA 1AQ6A 1QSYA 4Y2XA 4A8EA 3RTVA 2EZYA 2MA1A 1YZ7A 1SZPA 3LVWA 2PI5A 4HAIA 2ZIWB 1LV5A 7ICEA 7ICGA 5DB6A 1IIPA 2YN4A 4AYBF 4RZRA 3ZDCA 9ICQA 4IL6U 4C80A 3F2BA 8ICIA 4LVSA 3OHBA 3G6XA 1RYUA 7ICSA 4F4ZA 3NASA 3D2SA 2HW3A 1ZQQA 8ICFA 5AKZA 5KFFA 1TK8A 3Q8QB 4ECZA 2OH2A 8ICXA 2NO4A 1PVQA 5HMMA 1X42A 1U4BA 2C2EA 5G5GA 1SB3C 2G0AA 4JUZA 2P35A 4DO9A 4FZMA 3ISDA 1KEJA 5KNIA 5ALLA 5HR7A 4C8LA 4UB6U 5KFCA 2E5SA 4RPYA 2A1JB 4Z6FA 3RH6A 5KFPA 2J6UA 2YB1A 4U6PA 4JV1A 5HHHA 2WTFA 5KFJA 5JU5A 1Z19A 5K4LA 3RF9A 3D2QA 4P0PA 1N56A 5HP4A 1XS9D 5D49A 3Q8MA 4XA5A 3C21A 1XC9A 3RJHA 4BUGA 3PZPA 1NOMA 1JXEA 5JUMA 1WWUA 1RYSA 4Z6EA 4ICAA 4I2AA 3KHRA 2WF6A 8ICZA 4I2FA 4NXZA 4RQ7A 1N5WA 4QZDA 3JPRA 1ZJNA 1X9MA 1J2NA 2IA6A 4PL1A 1RDFA 2KZ3A 3CW2C 1TVAA 3ZDDA 2DKXA 2W43A 5AK4A 5TISU 2ZJ8A 4USAA 4YVZA 4RQ4A 3QE9Y 4PGXA 2LI6A 4QW9A 4KLSA 4BX9C 2AHOB 5AKEA 9ICIA 2ASJA 1OXJA 3F53A 3MR2A 2VA8A 4ED6A 1K1SA 2KIVA 3WK5A 9ICPA 2G08A 5C5JA 4BDPA 4UB8U 1PK1A 1VDVA 4O3PA 3GDXA 4IQTA 2H3VA 3B9JA 4C7YA 3T5KA 4OCZA 2FPKA 4IQVA 2K4HA 5DQHA 3TADA 2BPFA 8ICHA 1ZQLA 4YMMA 1ZYQA 3UMCA 2RDIA 4GC6A 5DB7A 3HWTA 3RJIA 5L1LA 2V4RA 3K4GA 2YB4A 4GC7A 2KKVA 4KLLA 2LYAA 2N1RA 2NRXA 2NV3A 1NI3A 5J0XA 1JALA 3KHGA 3O0FA 4DQRA 5HR6A 8ICKA 1S0NA 3RAQA 2IBKA 2DBYA 2RLTA 3GIIA 2PMZC 3L5KA 5J0YA 1UQVA 4UB2A 3RR8A 5KG0A 4DQPA 5J2IA 3V7JA 4F5RA 4F4KA 2BQUA 4ECYA 1L3UA 4M47A 2QB0B 3GV5B 3LVVA 1X9WA 1PVPA 4UASA 3GZFA 2ZJAA 4PGQA 2KVCA 4DSLA 2H5XA 1N48A 2BCRA 4DQQA 1ZQPA 4MFCA 5DBCA 5J2DA 1KW4A 1ZQNA 2E8PA 4UB1A 7ICUA 4Z6DA 1J97A 1FO4A 4DOCA 2OM6A 5J8YA 4FE3A 8ICMA 3RBDA 4I2CA 4MFAA 7ICRA 2JZBA 2E1FA 3TAPA 3A0HU 3EYZA 2PXIA 4GXKA 4NLBA 1N62A 3MBYA 5D4BA 4KLGA 5KFMA 4DSEA 9ICUA 8ICNA 5KG5A 5DBBA 1DK2A 2D8CA 2BZFA 1K5OA 2WF8A 5ALDA 2WF5A 1SXEA 3BQ1A 3NGDA 1HUOA 2I1QA 5B66U 5AKJA 4F93B 1ZQFA 5J8YC 8ICJA 2OWOA 2ZXHA 2YX8A 4KLMA 4RNNA 5IIOA 3PMNA 5CRXA 5F9NA 4DL4A 5IIMA 2DKZA 3JPSA 4TUSA 2EAMA 1TV9A 9ICCA 4ECSA 9ICJA 2W54A 1X2IA 2YY6A 1RXWA 2NRWA 1NNLA 4AP9A 4F3OA 1MSWD 2MRLA 3IG8A 4PZNA 2ZXIA 5ALWA 4UAYA 5KG6A 4QW8A 4C4RA 2BQRA 2KKPA 3BZCA 3BDPA 3IV6A 1RZTA 3T5LA 5J0RA 4K4GA 4Q45A 2WF9A 2MSNA 5ALXA 2KHQA 3VC8A 7ICNA 3T79A 4F2SA 3RB4A 4J9LA 4MHVA 4ED3A 1ZQDA 2KJ5A 3QEBZ 4YMNA 7ICFA 4MEYA 2G5HB 1FEZA 2AH5A 1D9DA 3GU3A 2GLEA 1FFVA 3RH4A 4QIWC 1ZQSA 2VANA 1ZXIA 2D3DA 2W03A 2KFNA 1WUDA 2MU2A 2B0CA 4O9MA 2D6FC 9ICAA 4OJ5A 4IQUA 5EE3A 4ED0A 5L1KA 4OO1J 4GFJA 2JZBB 3IDWA 3DEEA 4M9JA 3PMLA 4B9LA 3EPIA 4M0AA 2H3FA 2KE7A 2G5IB 1JROA 1VJ5A 2KN7A 1FIQA 5KT6A 4FO6A 1F5SA 3D6JA 1L7NA 4Y2YA 5ALYA 4DSIA 5GTIU 1V97A 7ICTA 3SD7A 5J2AA 3UQ2A 3HKZC 3NVVA 4RUAA 1L3TA 3D2NA 4DEZA 4FZLA 2DL0A 4J9MA 2A1JA 5IIJA 2JEGA 4JMUA 4JWNA 4Y2RA 2JR5A 2ESEA 5CHGA 4DLEA 5GTHU 5FP0A 4KITB 3RJJA 4NJ8A 4RQ1A 3C28A 5DGAA 1NK7A 2BCSA 1IM4A 3QEAZ 4ED7A 3EZ5A 2CRXA 5EWEA 1S5LU 5AM5A 3ONNA 2E8NA 2IOFA 4OJ6A 1RXVA 2G07A 2ZUDA 4YR3A 2ZIXA 2E8MA 1YZ6A 1ZD4A 4KLJA 1U48A 4CF3A 1RM6C 1XO1A 1COKA 4KLFA 1T94A 4GIBA 3C1YA 5KFLA 4EX6A 5L9XA 2H3QA 5F3XB 5CEHA 4UW9A 1KLNA 2HHSA 3MGIA 3NS1A 5J0TA 2K4PA 1J2MA 1B4FA 4YFKA 2LBOA 2W9BA 2W9BB 1SKRA 1KN5A 9ICHA 4JV0A 4GLXA 1X9XA 2YMMA 1IV8A 3BJYA 4QZCA 3AL0B 2H3ZA 5BOMA 2KJ9A 1TKDA 4DFKA 4FZNA 2HHXA 2ISOA 3ICXA 2WAQF 5DQGA 4LJXA 5DG8A 2ZIUB 2LMRA 4F71A 9ICMA 4P0QB 4DL3A 4KLOA 1HIWA 5KFGA 4J9PA 2HBJA 1NK4A 3QUCA 4Y2QA 5DBAA 3LWMA 4IC9A 1QQ6A 1ZRMA 4I2JA 8ICRA 2FLNA 3VCBA 3JPPA 3PY8A 1PK3A 3TADC 2K8CB 5ALPA 3RJEA 4XQ8A 5KFIA 4BJQA 1RPLA 2VIXA 4UATA 2WF7A 5AKYA 4CF5A 1BNPA 3GIKA 2HSZA 4M04A 3M9MB 5J2JA 4MF8A 4ED2A 3WKEA 1Q8KA 3NVYA 3UMGA 2KP7A 3I1YA 4F5PA 3KOOA 2B6GA 2BCQA 4I2DA 1SZHA 2Q0ZX 3OTQA 4J9RA 2AQ4A 4M2YA 5AI9A 5AKLA 4RQ8A 5CP2A 3OHAA 4EYHB 4GXIA 3TFSA 4ELUA 2MUTA 1Z4OA 2XIDA 2HMXA 5ALOA 3SENA 5KL1B 4MF2A 5ALIA 2UVRA 1KTQA 5AM4A 1Z3EB 2AGOA 2HBLA 1QQ7A 4J9QA 4R64A 8ICYA 2BDUA 4BXOA 2QARA 3QNMA 5IIKA 2KV2A 4CE6A 3TI0A 1KL9A 1MA7A 1DOQA 1MC8A 1X9SA 4O0IA 1SGGA 1ZQUA 2ZTCA 3ZDAA 5ALNA 1BPDA 5KFKA 2ZIWA 4UB5A 3PX0A 1T4GA 4HYKA 9ICGA 5CWRA 2BPGA 5CA7A 3J81j 2W11A 4B9VA 4CCHA 4MFFA 1A0PA 3QU5A 2AGPA 3SV3A 4KLHA 2E1EA 1NK9A 5AI4A 2F1HA 3PV8A 2PFPA 2ODGA 4IRDA 1TE2A 4PHDA 4QWAA 2LKYA 3GIJA 8ICUA 2KSOB 2Q4TA 2ASDA 1K1QA 1L8OA 1X6IA 3WK7A 5JTIA 2R8JA 3LYSA 3H4DA 2KJ8A 4ECXA 4G3IA 7ICOA 4NM2A 4QZIA 2KZZA 3GILA 1XO0A 3H8MA 1ED1A 3TFRA 3IP4B 4UB4A 2W9AA 3ZDEA 3NTUA 9ICOA 2A19A 4YR0A 2R8KA 1L7MA 4US9A 5KFNA 4RUCA 5ALEA 4F72A 5DG7A 3H8SA 5DDYA 1ZQVA 1SV0C 2CXYA 4QWDA 7ICVA 4I2IA 4M6WB 3ZI4A 3MGHA 4KLQA 4J9KA 4IRKA 3H40A 3H7IA 5IIIA 3SEIA 3DV9A 5KFSA 5KFBA 1CRXA 2F1IA 4DF4A 2W7OA 3BS5B 3CNHA 2WFAA 1NK6A 4C0ZA 2KNJA 2I5HA 5IILA 1RQNA 1L3VA 2AXTU 3HW8A 1XWLA 3IN5A 3K1RB 2EAOA 3DDHA 3M8SA 4Q44A 4BGDA 3I28A 2HHQA 2ZJ5A 1ECWA 1WG8A 2W9CB 4IS7A 3OJUA 3BQTA 2QLTA 2HBKA 4XUSA 5KFEA 4DF8A 4TURA 2W3SA 4UAWA 1IXRA 3BQ7A 3ETRA 2Y0SC 4O3OA 4QZ9A 2A3VA 4UAVA 3PX4A 4CGZA 2KICA 2O6KA 4I2EA 1QH9A 3AQFA 3RRGA 2EZXA 4JK1A 3LK9A 4NWIA 5AK5A 2R8HA 2NRVA 4OJOA 2XICA 4DSKA 4P4MA 1XNSA 5DDMA 9ICKA 3TAQA 3PSIA 2K89A 3TACB 2ZIUA 1UHUA 5KTQA 8ICVA 4RT3A 1ZQRA 1DRGA 1A6SA 1MQ2A 2VA3A 5DG9A 4JV2A 1NZPA 3L4PA 7ICIA 1L5UA 1ZQGA 4F4YA 1UPHA 2IHMA 3N7RC 3NRWA 4DL7A 7ICHA 3T5JA 3HKZF 5F9LA 3RFAA 5AKIA 4JB3A 1NJZA 1ZQZA 1TFRA 1ZQMA 4NLKA 3TANA 1LKYA 3WK8A 5J0SA 1BGXT 3MDAA 5AKKA 3C2KA 3M9OB 5EE0A 4AYBC 3B0YA 4WJ3B 4YD2A 1S9FA 2YMQA 1S97A 5DB9A 1XSLA 2EANA 2FMQA 4U7CA 1HJPA 5ALHA 3KD3A 2AGQA 2YTUA 3PO5A 1JX4A 4QWEA 3PSTA 3GV8B 4YR2A 3SQIA 5ALFA 2ZIXB 1BPEA 3C1ZA 4B9NA 4PHPA 2F3NA 4KMOB 2DPIA 2ZG6A 4PGYA 4K4IA 9ICFA 1GO3F 1JUDA 4M9GA 1L7OA 1ZQIA 4B9MA 2DGZA 1JI7A 1UT8A 3V6JA 1V38A 3GV7B 2BCUA 2XC9A 1KFTA 5T14A 1ZD5A 2EH9A 2Y1JA 2F1JA 2IOHA 3RAXA 2KG5A 3F5EA 3Q8RB 3SAHA 2PMZF 2VJ4A 3BQ2A 1CEZA 3N7SC 3OPXA 5AM2A 4IR9A 4F2RA 1A77A 8ICEA 4RQ3A 3PR4A 2W3RA 4F91B 3MFHA 2FMPA 4EYIB 3PSFA 4R65A 2DFLA 3OGUA 4NM1A 2R8GA 3WK6A 4UAUA 1S76D 4EBDA 4YP3A 2G09A 5J0OA 4DS4A 3KBBA 3ETLA 2CPRA 3JPOA 3N28A 4ELTA 8ICLA 3NVWA 3KKAC 5KFTA 2JRZA 4ED8A 3K75D 5KFQA 2AU0A 4Y2SA 8ICPA 4ECRA 4UQGA 4O5EA 1ZQYA 4J03A 5KT7A 4M9LA 2K4IA 1NKBA 4Y2PA 1S10A 3LDAA 5AI8A 4EELA 3NRZA 3ORYA 2M0NA 4O5KA 4DFMA 2Y9TA 3RB0A 1SXDA 1ZQEA 4Q43A 2LHTA 4DS5A 2Y9UA 4ELVA 2OYYA 1D8YA 4ACOA 2DPJA 5CR0A 1VLBA 4I28A 2F8LA 4J9OA 4DL6A 1PUZA 3L3FX 3E0FA 5AM0A 3QYPA 7ICLA 4EZ6A 2VA2A 2E8OA 4YD1A 5J29A 4P2HA 1KKXA 1Z00B 8ICTA 3N4MB 1QSLA 3WKCA 1UCVA 3MR6A 1ZRNA 3WU2U 3Q8PB 2KEYA 3PNCA 4O5CA 2HVHA 3F2CA 4Y2TA 3Q8SB 3MABA 1TAUA 5HHIA 4IRCA 3PW4A 3KKAA 4UAZA 2C28A 1NJYA 1SWWA 2K60A 2KHVA 3RRHA 1P7DA 3T5HA 4UARA 3SYZA 4C7ZA 2ISPA 4QWBA 2FLPA 2P6RA 5AHXA 1SKSA 2V9WA 1Q3UA 2XO7A 4KLIA 2PFQA 3EPGA 1QQ5A 2YQEA 4E0DA 1N60A 1Q46A 4G9BA 5KT5A 4US8A 2AJQA 3SI8A 1V85A 3FM9A 5AK3A 2Y1IA 1QLNA 4RQ2A 1TK5A 5DLGA 2XY6A 5AI0A 3C5GA 4KLDA 1PVRA 1T7PA 1MN8A 3UXNA 2W8KA 4QZGA 2JHDA 3SAGA 3C23A 1KQQA 2GH1A 4ECQA 7ICQA 2PFNA 5KG4A 2OCEA 4PJ0U 5KFVA 4QZ8A 2HHTA 9ICRA 3BS5A 5ALVA 3KHLA 4BXOB 4F4XA 4Q8FA 4KLEA 8ICSA 5ALUA 1SL2A 1WYGA 2RP5A 4RU9A 1KSPA 3JPTA 2JXJA 4F8RA 2ALZA 2BDPA 2XVTA 1T3NA 2EQYA 4NV0A 2ZIVA 4PHAA 1L6NA 4KN7A 4M9HA 3Q8LA 1OW5A 4FS1A 1S0OA 3AEVA 4KN4A 4ECWA 1UT5A 4ZH4A 4JWMA 3I76A 2KTQA 4IR1A 5KFRA 2QB1A 3WKDA 4DCCA 1F0MA 2HI0A 2BPCA 2ZTEA 3SR6A 1LKYB 3TARA 2ES6A 3C2MA 2J6SA 2W7PA 2EZZA 5DQIA 9ICXA 4FS2A 2FMSA 2KSOA 3SMVA 2ZUCA 3H8WA 1NZBA 1DXSA 2Z7JA 4KX5A 1L8LA 1KFDA 2WHEA 4CF4A 3C29A 4F92B 3OSPA 4P0QA 5ALTA 4XRHA 4DWIA 1SIJA 1NKCA 4M6WA 8ICOA 4I2GA 2KVSA 4X5VA 1X40A 4RQNA 5KFUA 2HOQA 4B9SA 1JN3A 2YMLA 3AUOA 1S0VA 5ALRA 3UPQA 1HUZA 3E58A 3JPNA 4Y2JA 5HNKA 2CN1A 1S8OA 4CDGA 3RJKA 2IMWP 1XSPA 4OD0A 1U49A 1D8BA 3TQ1A 1ZQWA 2HHVA 3CYMA 4QZBA 3RJGA 7ICPA 5ALJA 5BOLA 1NK5A 1SWVA 2HBMA 2WAQC 4QZHA 4NLGA 3CRXA 3NUQA 2RDJA 5KG7A 3ZDBA 4DL2A 3R9KA 5H2FU 3M1YA 3KFUF 1CI4A 2MAXA 2C2RA 3QU2A 4QIWF 3SZ2A 2P66A 5KFZA 1C7YA 3V7KA 5KFAA 5KFHA 5KT3A 3MR3A 5HMLA 1BNOA 4QZAA 2ZIVB 4KTQA 2JV3A 3AU6A 1X6JA 2ASLA 3QUTA 1KDHA 4C8OA 2NRTA 1X66A 1L7PA 4ECTA 4F5QA 4DFPA 5ALGA 1RYRA 3RJFA 5KG3A 3UQ0A 2F44A 4CNQA 5KG1A 2C2DA 2QB0A 5J0UA 4YXJA 1N61A 2DF4B 4DL5A 4O3QA 4EBEA 2F77X 5KL8B 5KAFU 2XY5A 1BVSA 5A0LA 4KX3A 3M8RA 1Z1VA 4OJLA 5J2EA 4RQMA 1N63A 3HX0A 1JIHA 5AKHA 3GFKB 2WB1F 2K4EA 4YMOA 4NLNA 2VKQA 3UMBA 2F2AB 2UVWA 4DQIA 4C8NA 4PZOA 3QZ7A 3LWLA 4BWJA 5J0WA 2JEJA 3PO4A 1RQLA 3MC1A 4O3RA 3MR5A 4QJFB 2FPLA 3M7DA 2XCPA 3RR7A 5C0YA 4IQWA 3BS7A 1NJWA 4RT2A 3PW0A 5EWGA 4K4HA 1TK0A 2DWQA 4PH5A 8ICGA 5EE1A 4O3NA 1Z1BA 4TUPA 9ICEA 4F5NA 4QZEA 4KLUA 3QX7A 5J0QA 3NVZA 4RPZA 1BPZA 4I2BA 3HPOA 3V6KA 4NL9C 3PSPA 4NL9A 4PHEA 4MEXA 4Y2VA 4B9UA 2HVIA 2IHNA 1C20A 2OHFA 2M9NA 5KFWA 1KRPA 3PX6A 3THVA 2A1AA 1KFSA 3G6VA 5KAIU 4PL2A 4UBBA 2YMPA 1AROP 1WCLA 5ALMA 2K8AA 2ATLA 3QXGA 2LYBA 3PR5B 1TAMA 2W04A 3CP8A 4EX7A 4ED1A 3EUB2 3OSNA 4I27A 4O3SA 2NYVA 3EW9A 3EWAA 2F8KA 5DLFA 3ISCA 3RH5A 1ZQAA 1WCNA 2MUTB 2LYHA 4EBCA 2QARB 4P0PB 1URJA 4F4WA 5AICA 4RQ5A 1PZNA 4PPXA 3HT3A 5E79U 2ZUBA 8ICQA 4RNMA 1BPBA 2XCAA 3H0LB 3H4BA 4TQSA 4TUQA 4CRXA 3H8JA 1Q3VA 3HJEA 4I2HA 3AN1A 1ZQCA 4C8KA 4YCXA 4UBCA 1Z4NA 8ICCA 3HRDD 2RQ5A 2KMDA 4Z6CA 9ICNA 3S6JA 1DK3A 2JEIA 2XGQA 4YG2A 3N7PD 2PKEA 1T3QA 2JH7A 5ALSA 4DOAA 2FPMA 5L1JA 4F50A 2FDRA 4DSFA 4UB3A 4BWMA 3N97B 4EZ9A 4ECVA 3IM1A 3WK4A 1COOA 1H38A 3FC4A 3TKAA
chains in the Genus database with same CATH topology
2WAQC 2HBMA 2XVTA 3PSPA 1ED1A 3F2CA 2G08A 2G5HB 3IP4B 3CRXA 3NUQA 2WB1C 4NV0A 1SZHA 3D2SA 1T94A 2ZIVA 3F5AA 3GU3A 1UPHA 2H3VA 3PSFA 2H3IA 2GOLA 1L6NA 2E1FA 3N7RC 3NRWA 3SAFA 3KFUF 2H3QA 3F2DA 4QIWC 2KHVA 4QIWF 1F44A 4QNLA 2OH2A 2K4HA 1P7DA 1OUQA 2W03A 1PVQA 4PL2A 3HKZF 4NLBA 1YT3A 3RFAA 1WUDA 2R18A 2XIDA 2HMXA 2K8AA 2G09A 3AQEA 2D6FC 4OJ5A 5KL1B 2LYBA 2KIWA 3KZXA 2CPRA 2G0AA 1TAMA 4FZMA 2W04A 4OO1J 2HBLA 2Y0SF 3CP8A 4GFJA 2ZIVB 5HR7A 3DEEA 2BDUA 2YB4A 2LBOA 1CRXA 2KKVA 1Q3UA 4AYBC 2KV2A 2LYAA 2N1RA 2JMGA 2W7PA 2NV3A 3M6KA 3M6ZA 2W7OA 2E5SA 4WJ3B 1MA7A 3SMVA 4OJPA 2JGAA 1NZBA 2H3FA 2Z7JA 2KNJA 4C0ZA 3O0FA 2RHFA 4KX5A 2YB1A 2G5IB 4U6PA 2G06A 5HR6A 2KD1A 3C29A 3H0MB 3IN5A 4U7CA 2ZXHA 2K8BB 2K4IA 2YX8A 4P0QA 1Z19A 2ZIWA 3RF9A 2HOFA 2DF4B 3D2QA 4P0PB 1URJA 4P0PA 5CRXA 1ECWA 2F77X 5KL8B 2PMZC 3ALRA 2M0NA 3HKZC 3MGVA 2HBKA 3PSTA 3AL0B 2H3ZA 2KJ9A 2OXOA 4KX3A 4BUGA 5A0LA 3PZPA 4OJLA 4FZNA 1A0PA 3ICXA 1ZQ1C 3D2NA 3SQIA 4FZLA 2LHTA 2WAQF 3H0LB 2ZIXB 1PVRA 2HOQA 4CRXA 2OYYA 4JMUA 2Y0SC 4ACOA 2JH1A 4ICAA 1Q3VA 2WB1F 2MRLA 2K4EA 3IG8A 2E1EA 2ZIUB 2F8LA 2ZXIA 4KMOB 2A3VA 2VKQA 2JHDA 4P0QB 3SAGA 2HOIA 4CGZA 2F2AB 2F76X 2XI9A 2ZG6A 1HIWA 4O3MA 3H0RB 2GH1A 3IG5A 2KICA 3LVVA 1GO3F 2KKPA 2HBJA 1PVPA 3L3FX 3E0FA 2DGZA 3GZFA 1HEKA 3AQFA 3K1ZA 2KOBA 4NWIA 2LKYA 4IC9A 4PL1A 3C28A 2CN1A 4A8EA 4QJFB 3M7DA 2KVCA 5C0YA 4OJOA 4CDGA 3N7PD 3VCBA 5T14A 2XICA 1KBUA 2MA1A 2Q4TA 2KHQA 3VC8A 2JH7A 3LVWA 2K8CB 3T79A 1D8BA 2VJ5A 2ZIWB 3F5EA 1XNSA 3SAHA 2CRXA 4BJQA 3LYSA 1Z1BA 2KJ8A 2PMZF 2VIXA 2VJ4A 3ONNA 3PSIA 2K89A 2ZIUA 2RP5A 4BX9C 1IIPA 3CYMA 3N7SC 4AYBF 4OJ6A 3OPXA 2KJ5A 2G07A 3F53A 2OM6A 2DQNB 4FE3A 1DRGA 3F2BA 2RRDA 1A6SA 2KEYA 4NLCA 2ZIXA 1XO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL0 B;  2D6F C;  2G5H B;  3IP4 B;  2DQN B;  2G5I B;  2F2A B;  3KFU F;  4WJ3 B;  1ZQ1 C;  3H0R B;  2DF4 B;  3H0M B;  3H0L B; 
#chains in the Genus database with same CATH topology
 4DFJ A;  3HP6 A;  4B9T A;  5KT4 A;  5ALZ A;  3F5A A;  5AKX A;  3MFI A;  3IRU A;  2DUY A;  4M9N A;  2H3I A;  3SAF A;  4RQ6 A;  7ICK A;  4QNL A;  2HCF A;  1S77 D;  3BQ0 A;  3U26 A;  1UA1 A;  1OUQ A;  1YT3 A;  3GIM A;  3AU2 A;  2KIW A;  3KZX A;  3KHH A;  4QWC A;  2FJ6 A;  5KG2 A;  1NKE A;  2LPE A;  1JXL A;  2HHU A;  1B0X A;  3ISB A;  3M6K A;  2FI1 A;  5J2G A;  2BGW A;  2JGA A;  2HHW A;  4KMU A;  1SL1 A;  1JRP A;  5BPC A;  9ICW A;  5J2C A;  3ED5 A;  2C22 A;  2UVV A;  2KD1 A;  2W8L A;  2L5Y A;  2K8B B;  3V7L A;  5ALK A;  1SV4 A;  5DB8 A;  5L1M A;  3MGV A;  1ZET A;  1PK1 B;  2P6U A;  3T3F A;  1Y88 A;  2J6T A;  4RQ0 A;  4DOB A;  1ZQ1 C;  3MDC A;  2JEF A;  4LZG A;  2W55 A;  2JH1 A;  1S0M A;  4R63 A;  2HOI A;  1SKW A;  1ZD2 P;  3G6Y A;  3RB6 A;  2BQ3 A;  1EXN A;  1ZQH A;  3QZ8 A;  1CUK A;  2PFO A;  2BKE A;  4ZOH C;  3C5F A;  3PVX A;  4DFD A;  1KBU A;  2B21 A;  5EE9 A;  2VJ5 A;  4R66 A;  1LB2 B;  1NK0 A;  4FBT A;  1U9L A;  1DGS A;  2BCV A;  1N2X A;  2NO5 A;  4DLG A;  8ICW A;  3AMZ A;  5AI5 A;  1B43 A;  3QU4 A;  4RNO A;  2RRD A;  4NLC A;  2GO7 A;  3WKA A;  1NK8 A;  5CJ7 A;  4P4O A;  4YN4 A;  2KZM A;  1ZQO A;  4ECU A;  2GOL A;  1ZQT A;  3F2D A;  2FLL A;  1QSS A;  1O03 A;  1F44 A;  5D46 A;  2W9M A;  3FDS A;  1ZJM A;  1SV0 A;  5EWF A;  4EEK A;  3PW7 A;  1D9F A;  3AQE A;  2V4Q A;  4J9S A;  4B6J A;  5AI6 A;  5J0P A;  5J2H A;  4RPX A;  2XY7 A;  3ZD8 A;  4NY8 A;  4C4S A;  5KFO A;  5J2K A;  5J2F A;  4R8U A;  1FFU A;  2JMG A;  4EEN A;  3M6Z A;  2UVU A;  5L1I A;  4OJP A;  3PW2 A;  5CB1 A;  4NLZ A;  4I29 A;  4EEY A;  2RHF A;  2G06 A;  3QU7 A;  3H0M B;  1ZQJ A;  4Q8E A;  5JRT A;  4C4T A;  8ICA A;  2HOF A;  1RG6 A;  1QCK A;  1UA0 A;  3ALR A;  5AKG A;  5AM1 A;  4TQR A;  2BR0 A;  9ICL A;  5IIN A;  3ZD9 A;  2LM4 A;  1D8L A;  3QUB A;  1NJX A;  3GQC A;  9ICV A;  3A0B U;  3FAH A;  1A76 A;  2KFZ A;  9ICT A;  5G5H A;  1B22 A;  5DKW A;  1TAQ A;  4C8M A;  2XGP A;  3UM9 A;  1ZQX A;  4R8U B;  5DGB A;  2HDO A;  1T8E A;  3H0R B;  4J9N A;  3IG5 A;  3Q8K A;  1HEK A;  1MQ3 A;  3K1Z A;  2NRZ A;  5AM3 A;  1BPY A;  2GWS A;  1V9P A;  3UXO A;  1BPX A;  5AIA A;  1DGJ A;  4Y2U A;  1N5X A;  2I6X A;  5TZV A;  1SL0 A;  2EDU A;  4FFD A;  2R8I A;  1IG6 A;  3RB3 A;  2KK0 A;  2DQN B;  3V72 A;  1M6Y A;  3QU9 A;  8ICB A;  4GXJ A;  5KFX A;  5KFD A;  3JPQ A;  2EAP A;  3KTQ A;  2WB1 C;  1JMS A;  3V6H A;  4DQS A;  3AM9 A;  1L3S A;  2ZTD A;  5KT2 A;  3WKB A;  3BZK A;  3RBE A;  5ALQ A;  2E3T A;  7ICM A;  1WWV A;  3C2L A;  2PI4 A;  4FBU A;  1U45 A;  2R18 A;  1ZOL A;  3FYH A;  9ICB A;  2AQ0 A;  7ICJ A;  4P4P A;  2Y0S F;  4F5O A;  3IHQ B;  2I9G A;  4YXM A;  1QTM A;  3HIL A;  3PW5 A;  3KZI U;  5J2B A;  3E2E A;  2LM1 A;  2FE9 A;  4QZF A;  3QUQ A;  9ICS A;  1ZQB A;  1U47 A;  1LVH A;  2OEH A;  3UXP A;  4YQW A;  3SV4 A;  4KLT A;  4DSJ A;  5AIB A;  2OXO A;  1ZQK A;  3OJS A;  1XSN A;  1XU4 A;  5AK6 A;  2W9C A;  4LZD A;  2QKQ A;  2IOF K;  2F76 X;  2XI9 A;  4O3M A;  3M9N B;  5B5E U;  1O08 A;  1Z00 A;  5KFY A;  3WK9 A;  3B0X A;  1ZD3 A;  2BHN A;  5EOZ A;  2KOB A;  1AQ6 A;  1QSY A;  4Y2X A;  4A8E A;  3RTV A;  2EZY A;  2MA1 A;  1YZ7 A;  1SZP A;  3LVW A;  2PI5 A;  4HAI A;  2ZIW B;  1LV5 A;  7ICE A;  7ICG A;  5DB6 A;  1IIP A;  2YN4 A;  4AYB F;  4RZR A;  3ZDC A;  9ICQ A;  4IL6 U;  4C80 A;  3F2B A;  8ICI A;  4LVS A;  3OHB A;  3G6X A;  1RYU A;  7ICS A;  4F4Z A;  3NAS A;  3D2S A;  2HW3 A;  1ZQQ A;  8ICF A;  5AKZ A;  5KFF A;  1TK8 A;  3Q8Q B;  4ECZ A;  2OH2 A;  8ICX A;  2NO4 A;  1PVQ A;  5HMM A;  1X42 A;  1U4B A;  2C2E A;  5G5G A;  1SB3 C;  2G0A A;  4JUZ A;  2P35 A;  4DO9 A;  4FZM A;  3ISD A;  1KEJ A;  5KNI A;  5ALL A;  5HR7 A;  4C8L A;  4UB6 U;  5KFC A;  2E5S A;  4RPY A;  2A1J B;  4Z6F A;  3RH6 A;  5KFP A;  2J6U A;  2YB1 A;  4U6P A;  4JV1 A;  5HHH A;  2WTF A;  5KFJ A;  5JU5 A;  1Z19 A;  5K4L A;  3RF9 A;  3D2Q A;  4P0P A;  1N56 A;  5HP4 A;  1XS9 D;  5D49 A;  3Q8M A;  4XA5 A;  3C21 A;  1XC9 A;  3RJH A;  4BUG A;  3PZP A;  1NOM A;  1JXE A;  5JUM A;  1WWU A;  1RYS A;  4Z6E A;  4ICA A;  4I2A A;  3KHR A;  2WF6 A;  8ICZ A;  4I2F A;  4NXZ A;  4RQ7 A;  1N5W A;  4QZD A;  3JPR A;  1ZJN A;  1X9M A;  1J2N A;  2IA6 A;  4PL1 A;  1RDF A;  2KZ3 A;  3CW2 C;  1TVA A;  3ZDD A;  2DKX A;  2W43 A;  5AK4 A;  5TIS U;  2ZJ8 A;  4USA A;  4YVZ A;  4RQ4 A;  3QE9 Y;  4PGX A;  2LI6 A;  4QW9 A;  4KLS A;  4BX9 C;  2AHO B;  5AKE A;  9ICI A;  2ASJ A;  1OXJ A;  3F53 A;  3MR2 A;  2VA8 A;  4ED6 A;  1K1S A;  2KIV A;  3WK5 A;  9ICP A;  2G08 A;  5C5J A;  4BDP A;  4UB8 U;  1PK1 A;  1VDV A;  4O3P A;  3GDX A;  4IQT A;  2H3V A;  3B9J A;  4C7Y A;  3T5K A;  4OCZ A;  2FPK A;  4IQV A;  2K4H A;  5DQH A;  3TAD A;  2BPF A;  8ICH A;  1ZQL A;  4YMM A;  1ZYQ A;  3UMC A;  2RDI A;  4GC6 A;  5DB7 A;  3HWT A;  3RJI A;  5L1L A;  2V4R A;  3K4G A;  2YB4 A;  4GC7 A;  2KKV A;  4KLL A;  2LYA A;  2N1R A;  2NRX A;  2NV3 A;  1NI3 A;  5J0X A;  1JAL A;  3KHG A;  3O0F A;  4DQR A;  5HR6 A;  8ICK A;  1S0N A;  3RAQ A;  2IBK A;  2DBY A;  2RLT A;  3GII A;  2PMZ C;  3L5K A;  5J0Y A;  1UQV A;  4UB2 A;  3RR8 A;  5KG0 A;  4DQP A;  5J2I A;  3V7J A;  4F5R A;  4F4K A;  2BQU A;  4ECY A;  1L3U A;  4M47 A;  2QB0 B;  3GV5 B;  3LVV A;  1X9W A;  1PVP A;  4UAS A;  3GZF A;  2ZJA A;  4PGQ A;  2KVC A;  4DSL A;  2H5X A;  1N48 A;  2BCR A;  4DQQ A;  1ZQP A;  4MFC A;  5DBC A;  5J2D A;  1KW4 A;  1ZQN A;  2E8P A;  4UB1 A;  7ICU A;  4Z6D A;  1J97 A;  1FO4 A;  4DOC A;  2OM6 A;  5J8Y A;  4FE3 A;  8ICM A;  3RBD A;  4I2C A;  4MFA A;  7ICR A;  2JZB A;  2E1F A;  3TAP A;  3A0H U;  3EYZ A;  2PXI A;  4GXK A;  4NLB A;  1N62 A;  3MBY A;  5D4B A;  4KLG A;  5KFM A;  4DSE A;  9ICU A;  8ICN A;  5KG5 A;  5DBB A;  1DK2 A;  2D8C A;  2BZF A;  1K5O A;  2WF8 A;  5ALD A;  2WF5 A;  1SXE A;  3BQ1 A;  3NGD A;  1HUO A;  2I1Q A;  5B66 U;  5AKJ A;  4F93 B;  1ZQF A;  5J8Y C;  8ICJ A;  2OWO A;  2ZXH A;  2YX8 A;  4KLM A;  4RNN A;  5IIO A;  3PMN A;  5CRX A;  5F9N A;  4DL4 A;  5IIM A;  2DKZ A;  3JPS A;  4TUS A;  2EAM A;  1TV9 A;  9ICC A;  4ECS A;  9ICJ A;  2W54 A;  1X2I A;  2YY6 A;  1RXW A;  2NRW A;  1NNL A;  4AP9 A;  4F3O A;  1MSW D;  2MRL A;  3IG8 A;  4PZN A;  2ZXI A;  5ALW A;  4UAY A;  5KG6 A;  4QW8 A;  4C4R A;  2BQR A;  2KKP A;  3BZC A;  3BDP A;  3IV6 A;  1RZT A;  3T5L A;  5J0R A;  4K4G A;  4Q45 A;  2WF9 A;  2MSN A;  5ALX A;  2KHQ A;  3VC8 A;  7ICN A;  3T79 A;  4F2S A;  3RB4 A;  4J9L A;  4MHV A;  4ED3 A;  1ZQD A;  2KJ5 A;  3QEB Z;  4YMN A;  7ICF A;  4MEY A;  2G5H B;  1FEZ A;  2AH5 A;  1D9D A;  3GU3 A;  2GLE A;  1FFV A;  3RH4 A;  4QIW C;  1ZQS A;  2VAN A;  1ZXI A;  2D3D A;  2W03 A;  2KFN A;  1WUD A;  2MU2 A;  2B0C A;  4O9M A;  2D6F C;  9ICA A;  4OJ5 A;  4IQU A;  5EE3 A;  4ED0 A;  5L1K A;  4OO1 J;  4GFJ A;  2JZB B;  3IDW A;  3DEE A;  4M9J A;  3PML A;  4B9L A;  3EPI A;  4M0A A;  2H3F A;  2KE7 A;  2G5I B;  1JRO A;  1VJ5 A;  2KN7 A;  1FIQ A;  5KT6 A;  4FO6 A;  1F5S A;  3D6J A;  1L7N A;  4Y2Y A;  5ALY A;  4DSI A;  5GTI U;  1V97 A;  7ICT A;  3SD7 A;  5J2A A;  3UQ2 A;  3HKZ C;  3NVV A;  4RUA A;  1L3T A;  3D2N A;  4DEZ A;  4FZL A;  2DL0 A;  4J9M A;  2A1J A;  5IIJ A;  2JEG A;  4JMU A;  4JWN A;  4Y2R A;  2JR5 A;  2ESE A;  5CHG A;  4DLE A;  5GTH U;  5FP0 A;  4KIT B;  3RJJ A;  4NJ8 A;  4RQ1 A;  3C28 A;  5DGA A;  1NK7 A;  2BCS A;  1IM4 A;  3QEA Z;  4ED7 A;  3EZ5 A;  2CRX A;  5EWE A;  1S5L U;  5AM5 A;  3ONN A;  2E8N A;  2IOF A;  4OJ6 A;  1RXV A;  2G07 A;  2ZUD A;  4YR3 A;  2ZIX A;  2E8M A;  1YZ6 A;  1ZD4 A;  4KLJ A;  1U48 A;  4CF3 A;  1RM6 C;  1XO1 A;  1COK A;  4KLF A;  1T94 A;  4GIB A;  3C1Y A;  5KFL A;  4EX6 A;  5L9X A;  2H3Q A;  5F3X B;  5CEH A;  4UW9 A;  1KLN A;  2HHS A;  3MGI A;  3NS1 A;  5J0T A;  2K4P A;  1J2M A;  1B4F A;  4YFK A;  2LBO A;  2W9B A;  2W9B B;  1SKR A;  1KN5 A;  9ICH A;  4JV0 A;  4GLX A;  1X9X A;  2YMM A;  1IV8 A;  3BJY A;  4QZC A;  3AL0 B;  2H3Z A;  5BOM A;  2KJ9 A;  1TKD A;  4DFK A;  4FZN A;  2HHX A;  2ISO A;  3ICX A;  2WAQ F;  5DQG A;  4LJX A;  5DG8 A;  2ZIU B;  2LMR A;  4F71 A;  9ICM A;  4P0Q B;  4DL3 A;  4KLO A;  1HIW A;  5KFG A;  4J9P A;  2HBJ A;  1NK4 A;  3QUC A;  4Y2Q A;  5DBA A;  3LWM A;  4IC9 A;  1QQ6 A;  1ZRM A;  4I2J A;  8ICR A;  2FLN A;  3VCB A;  3JPP A;  3PY8 A;  1PK3 A;  3TAD C;  2K8C B;  5ALP A;  3RJE A;  4XQ8 A;  5KFI A;  4BJQ A;  1RPL A;  2VIX A;  4UAT A;  2WF7 A;  5AKY A;  4CF5 A;  1BNP A;  3GIK A;  2HSZ A;  4M04 A;  3M9M B;  5J2J A;  4MF8 A;  4ED2 A;  3WKE A;  1Q8K A;  3NVY A;  3UMG A;  2KP7 A;  3I1Y A;  4F5P A;  3KOO A;  2B6G A;  2BCQ A;  4I2D A;  1SZH A;  2Q0Z X;  3OTQ A;  4J9R A;  2AQ4 A;  4M2Y A;  5AI9 A;  5AKL A;  4RQ8 A;  5CP2 A;  3OHA A;  4EYH B;  4GXI A;  3TFS A;  4ELU A;  2MUT A;  1Z4O A;  2XID A;  2HMX A;  5ALO A;  3SEN A;  5KL1 B;  4MF2 A;  5ALI A;  2UVR A;  1KTQ A;  5AM4 A;  1Z3E B;  2AGO A;  2HBL A;  1QQ7 A;  4J9Q A;  4R64 A;  8ICY A;  2BDU A;  4BXO A;  2QAR A;  3QNM A;  5IIK A;  2KV2 A;  4CE6 A;  3TI0 A;  1KL9 A;  1MA7 A;  1DOQ A;  1MC8 A;  1X9S A;  4O0I A;  1SGG A;  1ZQU A;  2ZTC A;  3ZDA A;  5ALN A;  1BPD A;  5KFK A;  2ZIW A;  4UB5 A;  3PX0 A;  1T4G A;  4HYK A;  9ICG A;  5CWR A;  2BPG A;  5CA7 A;  3J81 j;  2W11 A;  4B9V A;  4CCH A;  4MFF A;  1A0P A;  3QU5 A;  2AGP A;  3SV3 A;  4KLH A;  2E1E A;  1NK9 A;  5AI4 A;  2F1H A;  3PV8 A;  2PFP A;  2ODG A;  4IRD A;  1TE2 A;  4PHD A;  4QWA A;  2LKY A;  3GIJ A;  8ICU A;  2KSO B;  2Q4T A;  2ASD A;  1K1Q A;  1L8O A;  1X6I A;  3WK7 A;  5JTI A;  2R8J A;  3LYS A;  3H4D A;  2KJ8 A;  4ECX A;  4G3I A;  7ICO A;  4NM2 A;  4QZI A;  2KZZ A;  3GIL A;  1XO0 A;  3H8M A;  1ED1 A;  3TFR A;  3IP4 B;  4UB4 A;  2W9A A;  3ZDE A;  3NTU A;  9ICO A;  2A19 A;  4YR0 A;  2R8K A;  1L7M A;  4US9 A;  5KFN A;  4RUC A;  5ALE A;  4F72 A;  5DG7 A;  3H8S A;  5DDY A;  1ZQV A;  1SV0 C;  2CXY A;  4QWD A;  7ICV A;  4I2I A;  4M6W B;  3ZI4 A;  3MGH A;  4KLQ A;  4J9K A;  4IRK A;  3H40 A;  3H7I A;  5III A;  3SEI A;  3DV9 A;  5KFS A;  5KFB A;  1CRX A;  2F1I A;  4DF4 A;  2W7O A;  3BS5 B;  3CNH A;  2WFA A;  1NK6 A;  4C0Z A;  2KNJ A;  2I5H A;  5IIL A;  1RQN A;  1L3V A;  2AXT U;  3HW8 A;  1XWL A;  3IN5 A;  3K1R B;  2EAO A;  3DDH A;  3M8S A;  4Q44 A;  4BGD A;  3I28 A;  2HHQ A;  2ZJ5 A;  1ECW A;  1WG8 A;  2W9C B;  4IS7 A;  3OJU A;  3BQT A;  2QLT A;  2HBK A;  4XUS A;  5KFE A;  4DF8 A;  4TUR A;  2W3S A;  4UAW A;  1IXR A;  3BQ7 A;  3ETR A;  2Y0S C;  4O3O A;  4QZ9 A;  2A3V A;  4UAV A;  3PX4 A;  4CGZ A;  2KIC A;  2O6K A;  4I2E A;  1QH9 A;  3AQF A;  3RRG A;  2EZX A;  4JK1 A;  3LK9 A;  4NWI A;  5AK5 A;  2R8H A;  2NRV A;  4OJO A;  2XIC A;  4DSK A;  4P4M A;  1XNS A;  5DDM A;  9ICK A;  3TAQ A;  3PSI A;  2K89 A;  3TAC B;  2ZIU A;  1UHU A;  5KTQ A;  8ICV A;  4RT3 A;  1ZQR A;  1DRG A;  1A6S A;  1MQ2 A;  2VA3 A;  5DG9 A;  4JV2 A;  1NZP A;  3L4P A;  7ICI A;  1L5U A;  1ZQG A;  4F4Y A;  1UPH A;  2IHM A;  3N7R C;  3NRW A;  4DL7 A;  7ICH A;  3T5J A;  3HKZ F;  5F9L A;  3RFA A;  5AKI A;  4JB3 A;  1NJZ A;  1ZQZ A;  1TFR A;  1ZQM A;  4NLK A;  3TAN A;  1LKY A;  3WK8 A;  5J0S A;  1BGX T;  3MDA A;  5AKK A;  3C2K A;  3M9O B;  5EE0 A;  4AYB C;  3B0Y A;  4WJ3 B;  4YD2 A;  1S9F A;  2YMQ A;  1S97 A;  5DB9 A;  1XSL A;  2EAN A;  2FMQ A;  4U7C A;  1HJP A;  5ALH A;  3KD3 A;  2AGQ A;  2YTU A;  3PO5 A;  1JX4 A;  4QWE A;  3PST A;  3GV8 B;  4YR2 A;  3SQI A;  5ALF A;  2ZIX B;  1BPE A;  3C1Z A;  4B9N A;  4PHP A;  2F3N A;  4KMO B;  2DPI A;  2ZG6 A;  4PGY A;  4K4I A;  9ICF A;  1GO3 F;  1JUD A;  4M9G A;  1L7O A;  1ZQI A;  4B9M A;  2DGZ A;  1JI7 A;  1UT8 A;  3V6J A;  1V38 A;  3GV7 B;  2BCU A;  2XC9 A;  1KFT A;  5T14 A;  1ZD5 A;  2EH9 A;  2Y1J A;  2F1J A;  2IOH A;  3RAX A;  2KG5 A;  3F5E A;  3Q8R B;  3SAH A;  2PMZ F;  2VJ4 A;  3BQ2 A;  1CEZ A;  3N7S C;  3OPX A;  5AM2 A;  4IR9 A;  4F2R A;  1A77 A;  8ICE A;  4RQ3 A;  3PR4 A;  2W3R A;  4F91 B;  3MFH A;  2FMP A;  4EYI B;  3PSF A;  4R65 A;  2DFL A;  3OGU A;  4NM1 A;  2R8G A;  3WK6 A;  4UAU A;  1S76 D;  4EBD A;  4YP3 A;  2G09 A;  5J0O A;  4DS4 A;  3KBB A;  3ETL A;  2CPR A;  3JPO A;  3N28 A;  4ELT A;  8ICL A;  3NVW A;  3KKA C;  5KFT A;  2JRZ A;  4ED8 A;  3K75 D;  5KFQ A;  2AU0 A;  4Y2S A;  8ICP A;  4ECR A;  4UQG A;  4O5E A;  1ZQY A;  4J03 A;  5KT7 A;  4M9L A;  2K4I A;  1NKB A;  4Y2P A;  1S10 A;  3LDA A;  5AI8 A;  4EEL A;  3NRZ A;  3ORY A;  2M0N A;  4O5K A;  4DFM A;  2Y9T A;  3RB0 A;  1SXD A;  1ZQE A;  4Q43 A;  2LHT A;  4DS5 A;  2Y9U A;  4ELV A;  2OYY A;  1D8Y A;  4ACO A;  2DPJ A;  5CR0 A;  1VLB A;  4I28 A;  2F8L A;  4J9O A;  4DL6 A;  1PUZ A;  3L3F X;  3E0F A;  5AM0 A;  3QYP A;  7ICL A;  4EZ6 A;  2VA2 A;  2E8O A;  4YD1 A;  5J29 A;  4P2H A;  1KKX A;  1Z00 B;  8ICT A;  3N4M B;  1QSL A;  3WKC A;  1UCV A;  3MR6 A;  1ZRN A;  3WU2 U;  3Q8P B;  2KEY A;  3PNC A;  4O5C A;  2HVH A;  3F2C A;  4Y2T A;  3Q8S B;  3MAB A;  1TAU A;  5HHI A;  4IRC A;  3PW4 A;  3KKA A;  4UAZ A;  2C28 A;  1NJY A;  1SWW A;  2K60 A;  2KHV A;  3RRH A;  1P7D A;  3T5H A;  4UAR A;  3SYZ A;  4C7Z A;  2ISP A;  4QWB A;  2FLP A;  2P6R A;  5AHX A;  1SKS A;  2V9W A;  1Q3U A;  2XO7 A;  4KLI A;  2PFQ A;  3EPG A;  1QQ5 A;  2YQE A;  4E0D A;  1N60 A;  1Q46 A;  4G9B A;  5KT5 A;  4US8 A;  2AJQ A;  3SI8 A;  1V85 A;  3FM9 A;  5AK3 A;  2Y1I A;  1QLN A;  4RQ2 A;  1TK5 A;  5DLG A;  2XY6 A;  5AI0 A;  3C5G A;  4KLD A;  1PVR A;  1T7P A;  1MN8 A;  3UXN A;  2W8K A;  4QZG A;  2JHD A;  3SAG A;  3C23 A;  1KQQ A;  2GH1 A;  4ECQ A;  7ICQ A;  2PFN A;  5KG4 A;  2OCE A;  4PJ0 U;  5KFV A;  4QZ8 A;  2HHT A;  9ICR A;  3BS5 A;  5ALV A;  3KHL A;  4BXO B;  4F4X A;  4Q8F A;  4KLE A;  8ICS A;  5ALU A;  1SL2 A;  1WYG A;  2RP5 A;  4RU9 A;  1KSP A;  3JPT A;  2JXJ A;  4F8R A;  2ALZ A;  2BDP A;  2XVT A;  1T3N A;  2EQY A;  4NV0 A;  2ZIV A;  4PHA A;  1L6N A;  4KN7 A;  4M9H A;  3Q8L A;  1OW5 A;  4FS1 A;  1S0O A;  3AEV A;  4KN4 A;  4ECW A;  1UT5 A;  4ZH4 A;  4JWM A;  3I76 A;  2KTQ A;  4IR1 A;  5KFR A;  2QB1 A;  3WKD A;  4DCC A;  1F0M A;  2HI0 A;  2BPC A;  2ZTE A;  3SR6 A;  1LKY B;  3TAR A;  2ES6 A;  3C2M A;  2J6S A;  2W7P A;  2EZZ A;  5DQI A;  9ICX A;  4FS2 A;  2FMS A;  2KSO A;  3SMV A;  2ZUC A;  3H8W A;  1NZB A;  1DXS A;  2Z7J A;  4KX5 A;  1L8L A;  1KFD A;  2WHE A;  4CF4 A;  3C29 A;  4F92 B;  3OSP A;  4P0Q A;  5ALT A;  4XRH A;  4DWI A;  1SIJ A;  1NKC A;  4M6W A;  8ICO A;  4I2G A;  2KVS A;  4X5V A;  1X40 A;  4RQN A;  5KFU A;  2HOQ A;  4B9S A;  1JN3 A;  2YML A;  3AUO A;  1S0V A;  5ALR A;  3UPQ A;  1HUZ A;  3E58 A;  3JPN A;  4Y2J A;  5HNK A;  2CN1 A;  1S8O A;  4CDG A;  3RJK A;  2IMW P;  1XSP A;  4OD0 A;  1U49 A;  1D8B A;  3TQ1 A;  1ZQW A;  2HHV A;  3CYM A;  4QZB A;  3RJG A;  7ICP A;  5ALJ A;  5BOL A;  1NK5 A;  1SWV A;  2HBM A;  2WAQ C;  4QZH A;  4NLG A;  3CRX A;  3NUQ A;  2RDJ A;  5KG7 A;  3ZDB A;  4DL2 A;  3R9K A;  5H2F U;  3M1Y A;  3KFU F;  1CI4 A;  2MAX A;  2C2R A;  3QU2 A;  4QIW F;  3SZ2 A;  2P66 A;  5KFZ A;  1C7Y A;  3V7K A;  5KFA A;  5KFH A;  5KT3 A;  3MR3 A;  5HML A;  1BNO A;  4QZA A;  2ZIV B;  4KTQ A;  2JV3 A;  3AU6 A;  1X6J A;  2ASL A;  3QUT A;  1KDH A;  4C8O A;  2NRT A;  1X66 A;  1L7P A;  4ECT A;  4F5Q A;  4DFP A;  5ALG A;  1RYR A;  3RJF A;  5KG3 A;  3UQ0 A;  2F44 A;  4CNQ A;  5KG1 A;  2C2D A;  2QB0 A;  5J0U A;  4YXJ A;  1N61 A;  2DF4 B;  4DL5 A;  4O3Q A;  4EBE A;  2F77 X;  5KL8 B;  5KAF U;  2XY5 A;  1BVS A;  5A0L A;  4KX3 A;  3M8R A;  1Z1V A;  4OJL A;  5J2E A;  4RQM A;  1N63 A;  3HX0 A;  1JIH A;  5AKH A;  3GFK B;  2WB1 F;  2K4E A;  4YMO A;  4NLN A;  2VKQ A;  3UMB A;  2F2A B;  2UVW A;  4DQI A;  4C8N A;  4PZO A;  3QZ7 A;  3LWL A;  4BWJ A;  5J0W A;  2JEJ A;  3PO4 A;  1RQL A;  3MC1 A;  4O3R A;  3MR5 A;  4QJF B;  2FPL A;  3M7D A;  2XCP A;  3RR7 A;  5C0Y A;  4IQW A;  3BS7 A;  1NJW A;  4RT2 A;  3PW0 A;  5EWG A;  4K4H A;  1TK0 A;  2DWQ A;  4PH5 A;  8ICG A;  5EE1 A;  4O3N A;  1Z1B A;  4TUP A;  9ICE A;  4F5N A;  4QZE A;  4KLU A;  3QX7 A;  5J0Q A;  3NVZ A;  4RPZ A;  1BPZ A;  4I2B A;  3HPO A;  3V6K A;  4NL9 C;  3PSP A;  4NL9 A;  4PHE A;  4MEX A;  4Y2V A;  4B9U A;  2HVI A;  2IHN A;  1C20 A;  2OHF A;  2M9N A;  5KFW A;  1KRP A;  3PX6 A;  3THV A;  2A1A A;  1KFS A;  3G6V A;  5KAI U;  4PL2 A;  4UBB A;  2YMP A;  1ARO P;  1WCL A;  5ALM A;  2K8A A;  2ATL A;  3QXG A;  2LYB A;  3PR5 B;  1TAM A;  2W04 A;  3CP8 A;  4EX7 A;  4ED1 A;  3EUB 2;  3OSN A;  4I27 A;  4O3S A;  2NYV A;  3EW9 A;  3EWA A;  2F8K A;  5DLF A;  3ISC A;  3RH5 A;  1ZQA A;  1WCN A;  2MUT B;  2LYH A;  4EBC A;  2QAR B;  4P0P B;  1URJ A;  4F4W A;  5AIC A;  4RQ5 A;  1PZN A;  4PPX A;  3HT3 A;  5E79 U;  2ZUB A;  8ICQ A;  4RNM A;  1BPB A;  2XCA A;  3H0L B;  3H4B A;  4TQS A;  4TUQ A;  4CRX A;  3H8J A;  1Q3V A;  3HJE A;  4I2H A;  3AN1 A;  1ZQC A;  4C8K A;  4YCX A;  4UBC A;  1Z4N A;  8ICC A;  3HRD D;  2RQ5 A;  2KMD A;  4Z6C A;  9ICN A;  3S6J A;  1DK3 A;  2JEI A;  2XGQ A;  4YG2 A;  3N7P D;  2PKE A;  1T3Q A;  2JH7 A;  5ALS A;  4DOA A;  2FPM A;  5L1J A;  4F50 A;  2FDR A;  4DSF A;  4UB3 A;  4BWM A;  3N97 B;  4EZ9 A;  4ECV A;  3IM1 A;  3WK4 A;  1COO A;  1H38 A;  3FC4 A;  3TKA A; 
#chains in the Genus database with same CATH homology
 2WAQ C;  2HBM A;  2XVT A;  3PSP A;  1ED1 A;  3F2C A;  2G08 A;  2G5H B;  3IP4 B;  3CRX A;  3NUQ A;  2WB1 C;  4NV0 A;  1SZH A;  3D2S A;  1T94 A;  2ZIV A;  3F5A A;  3GU3 A;  1UPH A;  2H3V A;  3PSF A;  2H3I A;  2GOL A;  1L6N A;  2E1F A;  3N7R C;  3NRW A;  3SAF A;  3KFU F;  2H3Q A;  3F2D A;  4QIW C;  2KHV A;  4QIW F;  1F44 A;  4QNL A;  2OH2 A;  2K4H A;  1P7D A;  1OUQ A;  2W03 A;  1PVQ A;  4PL2 A;  3HKZ F;  4NLB A;  1YT3 A;  3RFA A;  1WUD A;  2R18 A;  2XID A;  2HMX A;  2K8A A;  2G09 A;  3AQE A;  2D6F C;  4OJ5 A;  5KL1 B;  2LYB A;  2KIW A;  3KZX A;  2CPR A;  2G0A A;  1TAM A;  4FZM A;  2W04 A;  4OO1 J;  2HBL A;  2Y0S F;  3CP8 A;  4GFJ A;  2ZIV B;  5HR7 A;  3DEE A;  2BDU A;  2YB4 A;  2LBO A;  1CRX A;  2KKV A;  1Q3U A;  4AYB C;  2KV2 A;  2LYA A;  2N1R A;  2JMG A;  2W7P A;  2NV3 A;  3M6K A;  3M6Z A;  2W7O A;  2E5S A;  4WJ3 B;  1MA7 A;  3SMV A;  4OJP A;  2JGA A;  1NZB A;  2H3F A;  2Z7J A;  2KNJ A;  4C0Z A;  3O0F A;  2RHF A;  4KX5 A;  2YB1 A;  2G5I B;  4U6P A;  2G06 A;  5HR6 A;  2KD1 A;  3C29 A;  3H0M B;  3IN5 A;  4U7C A;  2ZXH A;  2K8B B;  2K4I A;  2YX8 A;  4P0Q A;  1Z19 A;  2ZIW A;  3RF9 A;  2HOF A;  2DF4 B;  3D2Q A;  4P0P B;  1URJ A;  4P0P A;  5CRX A;  1ECW A;  2F77 X;  5KL8 B;  2PMZ C;  3ALR A;  2M0N A;  3HKZ C;  3MGV A;  2HBK A;  3PST A;  3AL0 B;  2H3Z A;  2KJ9 A;  2OXO A;  4KX3 A;  4BUG A;  5A0L A;  3PZP A;  4OJL A;  4FZN A;  1A0P A;  3ICX A;  1ZQ1 C;  3D2N A;  3SQI A;  4FZL A;  2LHT A;  2WAQ F;  3H0L B;  2ZIX B;  1PVR A;  2HOQ A;  4CRX A;  2OYY A;  4JMU A;  2Y0S C;  4ACO A;  2JH1 A;  4ICA A;  1Q3V A;  2WB1 F;  2MRL A;  2K4E A;  3IG8 A;  2E1E A;  2ZIU B;  2F8L A;  2ZXI A;  4KMO B;  2A3V A;  2VKQ A;  2JHD A;  4P0Q B;  3SAG A;  2HOI A;  4CGZ A;  2F2A B;  2F76 X;  2XI9 A;  2ZG6 A;  1HIW A;  4O3M A;  3H0R B;  2GH1 A;  3IG5 A;  2KIC A;  3LVV A;  1GO3 F;  2KKP A;  2HBJ A;  1PVP A;  3L3F X;  3E0F A;  2DGZ A;  3GZF A;  1HEK A;  3AQF A;  3K1Z A;  2KOB A;  4NWI A;  2LKY A;  4IC9 A;  4PL1 A;  3C28 A;  2CN1 A;  4A8E A;  4QJF B;  3M7D A;  2KVC A;  5C0Y A;  4OJO A;  4CDG A;  3N7P D;  3VCB A;  5T14 A;  2XIC A;  1KBU A;  2MA1 A;  2Q4T A;  2KHQ A;  3VC8 A;  2JH7 A;  3LVW A;  2K8C B;  3T79 A;  1D8B A;  2VJ5 A;  2ZIW B;  3F5E A;  1XNS A;  3SAH A;  2CRX A;  4BJQ A;  3LYS A;  1Z1B A;  2KJ8 A;  2PMZ F;  2VIX A;  2VJ4 A;  3ONN A;  3PSI A;  2K89 A;  2ZIU A;  2RP5 A;  4BX9 C;  1IIP A;  3CYM A;  3N7S C;  4AYB F;  4OJ6 A;  3OPX A;  2KJ5 A;  2G07 A;  3F53 A;  2OM6 A;  2DQN B;  4FE3 A;  1DRG A;  3F2B A;  2RRD A;  1A6S A;  2KEY A;  4NLC A;  2ZIX A;  1XO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...