2G5IB

Structure of trna-dependent amidotransferase gatcab complexed with adp-alf4
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
410
structure length
410
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 120
structure length 410
sequence length 410
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5iB02
1ZQ1C 2F2AB 4WJ3B 2DF4B 3IP4B 2D6FC 3AL0B 2G5IB 3KFUF 3H0MB 3H0RB 2DQNB 2G5HB 3H0LB
chains in the Genus database with same CATH superfamily
5EE0A 3RR7A 3AQEA 5HHHA 3QUCA 4RNOA 1HIWA 1N61A 2XICA 4Q8EA 1TK0A 2DL0A 4RQMA 4UARA 3BS5B 4I2GA 7ICGA 3GV7B 4F4YA 3LVVA 1SV4A 3RF9A 2KP7A 4C7ZA 4R8UA 2EAOA 5DLGA 5J2HA 3TARA 2RDJA 5KAFU 4DL3A 1U48A 4P0QB 2BCUA 1COKA 1TAMA 3K1RB 2DPJA 1SV0A 4OJ6A 1U47A 3BDPA 3A0HU 4GFJA 4DF8A 3KFUF 4K4GA 1SKWA 9ICTA 4R64A 4CRXA 3WK9A 3B0XA 4RQ3A 5DQGA 2VANA 3T5KA 4UBBA 4XQ8A 4YR3A 1ZQYA 1COOA 9ICGA 8ICIA 1Z00B 2ALZA 4YR0A 3HKZC 4PHDA 3AN1A 1QQ6A 1HEKA 5KT3A 3DDHA 4US9A 2NRWA 4BDPA 1N5WA 2WF8A 4B9TA 2Y9UA 1YZ7A 1L8OA 1HUOA 4JWMA 4BXOB 2FMPA 3QUBA 4YMOA 3BQ7A 5AKEA 3EPIA 1L7MA 5F9LA 2XY5A 4DWIA 3DV9A 1NK4A 5KG1A 2AGOA 4B9VA 3ZD8A 5IIOA 4NY8A 4YMMA 3QEBZ 4DQSA 3CP8A 4NLZA 4I2BA 1KFTA 4DL5A 4KLOA 1UQVA 1SL0A 2A1JB 2AGQA 2XGQA 2V4QA 2KJ9A 4Y2VA 5ALNA 1X40A 2R8IA 3PO5A 4DSJA 5KG7A 5CR0A 5ALJA 4RT3A 4J9RA 2DWQA 2BCQA 1D8LA 4USAA 4PGYA 4GXKA 4CCHA 4QWAA 2GLEA 7ICFA 3NRZA 4F72A 9ICSA 4XA5A 2JEGA 4CF5A 4QWBA 2FPMA 2C2DA 2DFLA 5J0UA 1PUZA 2HHVA 4PGQA 2WAQF 3IHQB 2HMXA 1C20A 1X6IA 3E58A 4M9JA 5AI4A 4F2SA 2EANA 5AI9A 3RJEA 1UA1A 5K4LA 4DL7A 4DOCA 4DSKA 5KG3A 2ZUBA 2RQ5A 4Z6DA 2F1JA 2ZXHA 5DDMA 3KBBA 2K60A 2J6UA 4EENA 5KAIU 5ALGA 2KKPA 5DQIA 2HW3A 2KOBA 3T79A 1TKDA 5CA7A 4KMOB 2HHXA 2VKQA 1RYRA 3N7SC 1T4GA 4RUCA 3I1YA 4ECZA 5KFTA 4ECXA 2IOFA 1PVPA 5AM0A 4RUAA 5ALRA 3MR5A 2ZTEA 1ZQLA 3EPGA 3BS7A 1NK0A 5AK4A 2HDOA 2JXJA 5KFSA 2W3RA 4C4RA 3JPTA 5JTIA 2KVCA 1NK7A 2KE7A 2YMQA 5KT7A 4ACOA 5JRTA 3S6JA 3MDCA 3VC8A 3V6KA 2BPFA 4F4KA 3MGHA 1ZQBA 4JMUA 4IRCA 2ZUDA 4UAZA 1XU4A 2HHWA 1V38A 4ED7A 3OSPA 3MFHA 4ECSA 3SV4A 8ICUA 1S0MA 3V72A 4DL2A 3B0YA 9ICMA 2AQ4A 2KD1A 4FZMA 2A1JA 3CW2C 2OHFA 3QU5A 2UVWA 7ICPA 4QIWC 1SKRA 1IIPA 1X42A 2BCRA 1BNOA 2BGWA 3O0FA 2KNJA 4OJOA 2D3DA 4Q45A 1BPYA 2ZIUB 3LK9A 1DRGA 5KL1B 5ALYA 3GIIA 3M9MB 4Z6CA 3G6XA 3KHGA 5L1IA 2A3VA 1SZHA 2ZTCA 4UAWA 4Q43A 1S5LU 4O3RA 2EAMA 3N4MB 2YY6A 5J0XA 2ZJ5A 3ETLA 2R8HA 7ICVA 1XO1A 1RXVA 3FAHA 5ALWA 4K4HA 1KFDA 3QNMA 5G5HA 4AYBF 1UPHA 4RQ0A 1QSLA 3SZ2A 5J2IA 2ZTDA 2ISOA 2WF9A 2AXTU 5KFEA 1A77A 3TAPA 2ZJ8A 4ED8A 1NJZA 1C7YA 2ZXIA 2H3ZA 5B5EU 9ICCA 3Q8SB 4I2IA 3KZXA 1L8LA 5KFYA 1FIQA 2BHNA 1MA7A 3SEIA 4O3OA 4JWNA 3PSPA 2KK0A 5J2GA 4RU9A 5HMLA 1Q3VA 5AM2A 1ZQTA 1JALA 4M9HA 1S0VA 2JZBB 1RDFA 3KD3A 2ISPA 2F76X 5FP0A 2R8JA 9ICXA 4K4IA 1KN5A 3BJYA 3Q8LA 4Y2YA 4QNLA 2HHQA 1UCVA 4DQQA 2VIXA 5L9XA 4ED1A 2K4PA 2KV2A 5KFHA 4OO1J 4KN7A 1DK2A 5J0QA 4DFMA 3AEVA 4PHEA 4IR1A 4UB2A 1NK8A 9ICOA 4Y2XA 3WKCA 2G06A 2NV3A 5AM3A 3SI8A 2EZYA 5KT4A 4GC6A 2KMDA 2ZIVA 4R65A 5KFJA 4DSEA 3RH4A 4UW9A 2RLTA 2DKZA 3RR8A 5J2DA 1JMSA 2BQUA 4RQ2A 3H8MA 3QU9A 4O3QA 2FDRA 2ZIUA 4U6PA 2KICA 4F4XA 1B43A 1L3TA 2YMMA 1SXDA 4NWIA 1ZD2P 2WTFA 4G9BA 3C1ZA 1J2NA 3AMZA 3RJJA 5BOLA 1SGGA 1M6YA 4I27A 3H8JA 1ZQZA 4Y2JA 3SAHA 1QQ7A 1KRPA 3NTUA 3UQ0A 3HW8A 5DGAA 1WWUA 3FM9A 4CDGA 5ALPA 4ECWA 1L7NA 2PKEA 5BOMA 2F8LA 4DFDA 5DB8A 4RPYA 2GH1A 3IM1A 2W8LA 4BXOA 4PGXA 5KFXA 5DKWA 2A19A 4P4PA 2RDIA 1SWWA 1PVRA 3PMNA 3IDWA 5AKIA 5J0RA 3I28A 1PK1B 3OJUA 2YB4A 5J2BA 5L1JA 1IG6A 2P6UA 2RHFA 2ZJAA 5G5GA 4P4MA 4CGZA 1JXLA 4R63A 3BQ2A 5AIBA 1GO3F 4Y2SA 4LZGA 2P66A 3WU2U 4KTQA 2FI1A 2BQRA 1D8BA 4KN4A 3IN5A 4NJ8A 3K4GA 4X5VA 1QSSA 2HBMA 3OHBA 2HBJA 3C2MA 4RNMA 3OPXA 2KTQA 3PY8A 5IILA 4IRKA 8ICBA 4AP9A 4RQ5A 5KFNA 8ICNA 5AKHA 2HBLA 5AI5A 4I2HA 1N56A 2PFQA 1K1QA 4OCZA 4TQSA 2DKXA 1N2XA 5DQHA 3F2CA 3PNCA 4JUZA 3HKZF 2E1FA 3SAFA 2PFOA 4GIBA 3H8WA 2K8CB 1X2IA 1TV9A 1MSWD 2OWOA 3HX0A 2RP5A 3L3FX 3RJKA 4B9UA 7ICTA 3GV8B 3C29A 1JIHA 3GV5B 2R8KA 4R66A 4NLCA 1JI7A 2F3NA 4I2AA 1CUKA 3OJSA 3MGVA 4FBTA 4KX3A 4UB5A 4C4TA 4CF3A 2E8MA 8ICAA 4EELA 3WK7A 1F0MA 5CRXA 4MFFA 4KLUA 2QB0A 1NJYA 3QZ8A 4M6WA 4UAVA 4DO9A 4DFPA 1EXNA 2CPRA 4FZNA 1ECWA 2XCAA 5EWEA 1ZQSA 3V6JA 3BS5A 3T5JA 1CI4A 2W7OA 3CYMA 4M47A 4GC7A 3VCBA 1KQQA 3GFKB 3SQIA 4YXJA 3RB0A 5D46A 5BPCA 2P6RA 2J6TA 2O6KA 5AM5A 4QZGA 1QSYA 1L6NA 2KFZA 4F5RA 1ZQXA 3C1YA 4M04A 1L3VA 2QB1A 5AKKA 1ED1A 3AU6A 3K75D 4F8RA 1BPDA 2XO7A 2W9CA 4UB3A 3QYPA 3HPOA 3QU7A 3Q8MA 5J2AA 5HNKA 4FO6A 3C28A 4RQ8A 2F1IA 3H0LB 3WKAA 8ICEA 3RBEA 2KIWA 2G5HB 4JV0A 3KHRA 4UATA 3EYZA 2KIVA 4RQNA 1A76A 3T3FA 3NVWA 2XGPA 3ZD9A 2W04A 3KZIU 1D8YA 4Z6FA 4YMNA 1KEJA 4RZRA 2F2AB 5ALMA 4QZDA 2FE9A 3N7PD 3QEAZ 1Z4OA 4KLTA 8ICWA 3TANA 2UVUA 4EZ9A 3IG5A 3NASA 1U9LA 3RAXA 5KFLA 8ICYA 2J6SA 1ZQFA 5J29A 2KZMA 2G08A 4QWEA 8ICZA 2AGPA 3KKAC 2F8KA 1DK3A 4JV2A 1BNPA 2QARA 2W54A 5H2FU 5J0YA 1P7DA 5A0LA 4O3SA 5KFGA 4YP3A 4YN4A 2H3FA 4DQPA 1IXRA 2G07A 5KFZA 5DGBA 1SZPA 2W55A 3UXNA 3IRUA 3JPQA 4UB6U 3C23A 1PZNA 3K1ZA 3F53A 4XRHA 4TURA 2F1HA 3Q8KA 2LYBA 4F71A 3QE9Y 5KFOA 1DGJA 1Z1BA 1SXEA 2HHSA 3NS1A 4TUSA 3PX6A 1FFVA 5IIIA 3PZPA 3IP4B 4I2FA 7ICSA 1WCLA 2QB0B 4TUPA 1D9DA 4IR9A 3QZ7A 3RJIA 2KJ8A 1LKYA 4F93B 4O5CA 1RYUA 1NZBA 3M6ZA 8ICFA 2YTUA 3UXOA 2OYYA 1LKYB 5T14A 2UVRA 3TADC 1T7PA 1JXEA 4RQ7A 4UB4A 4Y2UA 5EE3A 3RB4A 1V9PA 2JMGA 1Z19A 4KLJA 1NJWA 2DBYA 3HJEA 3G6YA 4RNNA 4QIWF 2HSZA 2G09A 3WKDA 3FC4A 1LV5A 2KEYA 5ALTA 4B9SA 3M1YA 3EW9A 2PMZC 2NYVA 2WF7A 1X66A 5J0WA 4F4ZA 3I76A 5DDYA 4BWMA 1LVHA 3QXGA 1NK6A 5ALSA 3PVXA 4TUQA 4QW8A 3UPQA 2LBOA 1Z00A 5ALQA 1ZQCA 4YQWA 4NM2A 1KW4A 4IQVA 1RZTA 4LZDA 4FZLA 7ICHA 4RT2A 1MC8A 2H3QA 4DQRA 1KFSA 3PR4A 2JHDA 3SMVA 3M9OB 1RQNA 3MGIA 4IL6U 4JV1A 2D8CA 1U4BA 8ICOA 3MFIA 1IM4A 3MBYA 5TZVA 1CEZA 1L7OA 1LB2B 1ZJNA 1X9XA 5J0TA 1HJPA 2JRZA 2W3SA 5KG6A 1SL2A 1BPXA 1FEZA 4FS2A 4C4SA 2W43A 2W11A 3HP6A 4KX5A 1BPEA 4IC9A 4I2DA 1JROA 2ODGA 3OHAA 4M9GA 2KKVA 3TADA 1NKBA 3AQFA 3GIKA 1NKEA 4YD2A 2IHNA 2EZXA 1ZJMA 3FDSA 2CN1A 4QZ9A 1JN3A 3LDAA 3KTQA 4DOAA 1ZRNA 3SAGA 1SKSA 1F5SA 4KLDA 3MDAA 2FLNA 5DBCA 2HVHA 2K4IA 1TVAA 4OD0A 1L7PA 1DOQA 3PSTA 2P35A 5L1MA 1XWLA 9ICQA 2EH9A 4EEKA 4NLNA 3H40A 2BCSA 4KLEA 1K1SA 2JZBA 5GTIU 2EAPA 4O3NA 5KFBA 4KLSA 5CJ7A 3PW4A 1H38A 4ECUA 4RQ6A 4UB8U 1ZQRA 1MQ2A 2HBKA 2C28A 2I6XA 4PH5A 3C2KA 3PSIA 5IIMA 2DGZA 2HHTA 1ZRMA 2E8OA 5J0OA 3RFAA 3GQCA 3JPSA 2BZFA 2FPKA 5AI6A 3ZI4A 3RH6A 2EZZA 1VLBA 1ZD4A 1NI3A 1AROP 4QWDA 3BZCA 1TFRA 7ICKA 2LI6A 3UMBA 4FE3A 1PK1A 1QLNA 2WFAA 1BVSA 5JUMA 3ISBA 3Q8QB 3GIMA 3H7IA 4F5OA 2K4EA 7ICIA 3PSFA 5KG0A 3AL0B 4PL1A 4C7YA 2MUTA 5KFRA 4C8MA 1B4FA 2HCFA 5KG2A 4O3PA 5EE1A 1ZETA 4YG2A 9ICEA 4BX9C 5IIKA 5ALXA 4BUGA 3IG8A 3L4PA 1FFUA 1RXWA 3RJHA 3PW2A 4EBCA 1PVQA 2KVSA 3BQTA 4ICAA 2M0NA 4PHPA 4O9MA 2ES6A 5AIAA 1ZQGA 1ZQUA 2E3TA 3GDXA 3M8RA 3EZ5A 2WAQC 1TAUA 5ALVA 1NKCA 5D49A 3QU2A 5IINA 2PFNA 3QU4A 3D2NA 5CB1A 2LHTA 1MQ3A 5HMMA 4ED6A 3PW7A 2W03A 5KFWA 4AYBC 4QW9A 3MR2A 5J0SA 5AM1A 4OJ5A 3LWLA 7ICEA 2PXIA 2KHQA 4GLXA 4KMUA 9ICWA 1KLNA 2ESEA 4F5NA 2BDUA 5TISU 4DLGA 5D4BA 8ICTA 1XSLA 4XUSA 2G5IB 2IOFK 2PFPA 1N63A 2W9CB 2I1QA 1VJ5A 2OEHA 2WF6A 2AH5A 3TI0A 1SIJA 2LYHA 1ZQHA 3B9JA 4DOBA 1XSPA 5ALLA 4M2YA 2XC9A 2KZZA 3WK5A 1A0PA 3GIJA 4F3OA 1ZQMA 4B9MA 1QCKA 4F4WA 5HR6A 3ISCA 5C0YA 8ICQA 2VJ4A 4PHAA 2EQYA 1Q8KA 5DB9A 4LVSA 4WJ3B 5KFUA 1L3SA 7ICOA 3TFSA 1NZPA 1X9WA 2Y0SC 4EX7A 2R8GA 3E0FA 2W9BA 3Q8PB 1TK5A 1SL1A 3N28A 1AQ6A 5J2EA 2OCEA 1KSPA 3ZDAA 1N5XA 5KFPA 3PR5B 2W9BB 1CRXA 5HR7A 3OGUA 2BR0A 7ICNA 2LMRA 5AHXA 4O5EA 9ICFA 1OUQA 1S0NA 5KL8B 4ELTA 2ZUCA 2HOFA 3F5AA 5KT5A 2F77X 1TAQA 2ASDA 3GILA 4NL9A 3H8SA 1UHUA 2KHVA 3M7DA 3HWTA 2MAXA 4P0PA 5AKXA 1S8OA 2KJ5A 4DL6A 4QJFB 4RPZA 2Y1JA 2XVTA 5KT2A 3F2BA 1D9FA 3ETRA 4ECYA 3PW5A 5HP4A 3M8SA 4IRDA 3PV8A 1S9FA 1S76D 3GZFA 2W9MA 4PZNA 2YMPA 2XY7A 4EYHB 3AM9A 4EEYA 1Z1VA 2ZIXA 5KNIA 1TE2A 1JX4A 4EYIB 7ICLA 4P0PB 4QZCA 1QTMA 5AKZA 3ALRA 3KOOA 4Z6EA 4G3IA 4OJPA 1KKXA 1K5OA 1RG6A 5JU5A 5L1KA 4PL2A 1T3NA 5KFCA 4US8A 2R18A 3SV3A 1XSNA 7ICUA 1ZQ1C 3NUQA 4DCCA 1TK8A 3WKBA 4Q8FA 4M0AA 4Q44A 5C5JA 5KFAA 2LYAA 5EE9A 1SV0C 4YD1A 1ZQWA 3UMCA 4J9MA 1NOMA 4O3MA 9ICLA 4QZEA 3QUTA 4PPXA 1FO4A 3WK6A 3MR6A 4A8EA 2ZIXB 1KBUA 5J8YC 4MF2A 5AICA 2NRVA 4GXIA 1J97A 2D6FC 1L3UA 1ZOLA 4CF4A 5AK5A 2YMLA 3C5GA 4J9PA 4OJLA 3LVWA 8ICMA 4C8NA 5KG4A 3N97B 3CNHA 5DG9A 4KLIA 1S97A 3V7LA 3SYZA 2XY6A 2HVIA 4C8KA 2Y9TA 4O5KA 1NK5A 9ICIA 5DB7A 3D6JA 4P4OA 2ATLA 5DG7A 2N1RA 2OH2A 2FMQA 4DSIA 3WKEA 4F2RA 3PW0A 2VA3A 2JH7A 1OXJA 3R9KA 2E8PA 3FYHA 3MABA 1ZQPA 4B6JA 1S0OA 1URJA 5EOZA 2K89A 2NO5A 3RB6A 4C0ZA 4ELUA 3M9NB 2MRLA 1BGXT 4NLGA 4MEXA 3C5FA 3NRWA 1Z3EB 3ISDA 4P2HA 4KITB 3TQ1A 1UT5A 4IS7A 4JB3A 3MR3A 3H4BA 5KTQA 5DG8A 3G6VA 2H5XA 2C2RA 4U7CA 2JEIA 1ZQKA 3RB3A 4B9LA 3ED5A 3LWMA 4UAUA 2L5YA 3BZKA 1T3QA 1ZD3A 7ICRA 3L5KA 3E2EA 4YCXA 2XI9A 5AKLA 1XS9D 2CRXA 4IQWA 1O03A 1N48A 2XCPA 1HUZA 4DS4A 3ICXA 4DLEA 5B66U 2NRXA 3V6HA 1WWVA 4QZHA 4QWCA 3KKAA 3SENA 4DFKA 4BGDA 1Q3UA 8ICPA 2NO4A 4MFCA 5AKYA 3RRGA 4KLMA 2UVVA 1WUDA 2H3IA 2MU2A 3CRXA 1B22A 2LPEA 3RH5A 4EZ6A 2E8NA 4QZIA 3HILA 1IV8A 5AI8A 4C8LA 4ECQA 2FMSA 4M9LA 2HOIA 2DF4B 5J2CA 3ZDDA 3TKAA 3H0RB 1SB3C 5ALFA 3PX4A 2Y1IA 5J2JA 2FJ6A 1XC9A 4F5QA 1X6JA 2QKQA 3RJFA 3THVA 2JR5A 8ICHA 3UM9A 1PK3A 2YN4A 3F5EA 4MEYA 8ICVA 4QZ8A 4DF4A 2IHMA 4C8OA 1ZQNA 2W8KA 3OTQA 5AK3A 4UB1A 5ALOA 1XNSA 2B0CA 2MUTB 3GU3A 4UQGA 4RPXA 2H3VA 1RM6C 5DBAA 3KHHA 1OW5A 2PI4A 2C22A 2K8BB 2IA6A 3BQ1A 3Q8RB 1SWVA 1Q46A 4PZOA 1NJXA 2DPIA 2JH1A 3N7RC 2IBKA 1Y88A 2ZIWB 5IIJA 1ZQDA 2AQ0A 2HHUA 3MC1A 1XO0A 2QARB 4I2JA 1S77D 4TQRA 2B6GA 8ICKA 2F44A 4FS1A 2XIDA 7ICJA 4IQTA 2BKEA 2JGAA 2ZIVB 2ASJA 3T5LA 2RRDA 4Y2RA 2GOLA 5J0PA 1ZQOA 1T8EA 2BPGA 3EUB2 3UXPA 4P0QA 1YT3A 5KFDA 5ALKA 3H4DA 1ZYQA 4PJ0U 2IMWP 2MSNA 3C21A 1S10A 4ELVA 4FBUA 4UAYA 1ZQIA 4DL4A 2GWSA 4RQ4A 1WYGA 1O08A 9ICBA 2KSOB 3TACB 2KZ3A 4F50A 8ICLA 5AM4A 4F92B 1F44A 3ZDBA 1KDHA 3WK4A 3NGDA 3AU2A 1UT8A 2OM6A 4QZFA 4I2CA 3HRDD 3PMLA 1VDVA 4QZBA 8ICSA 2YB1A 3JPRA 4IQUA 1QH9A 4RQ1A 3NVVA 1QQ5A 1X9MA 4KLLA 2BDPA 5KFIA 2E1EA 3J81j 3U26A 5DB6A 1L5UA 2W7PA 2K8AA 2M9NA 4F91B 9ICPA 4KLGA 2AJQA 3V7KA 4CE6A 5F9NA 1DGSA 1JRPA 1WCNA 3RBDA 5E79U 3ORYA 3JPOA 7ICMA 3PX0A 2AHOB 2FLLA 5KFFA 3TAQA 4EBEA 5GTHU 5ALIA 3RAQA 4ECRA 4ECVA 2OXOA 2JEJA 3UQ2A 8ICRA 1ZQVA 5DLFA 5CEHA 3PO4A 1V97A 4ED2A 3SD7A 5J2FA 5KG5A 4DQIA 4J9SA 1UA0A 4KLQA 2A1AA 9ICAA 2KN7A 2I9GA 5HHIA 2KG5A 2VA8A 9ICHA 3BQ0A 7ICQA 8ICXA 4UBCA 4I29A 4J9KA 5AK6A 2BQ3A 4C80A 2BPCA 3T5HA 5CWRA 5EWGA 4J9LA 2ZIWA 4DFJA 4YFKA 2PI5A 1RPLA 2V9WA 1ZQQA 4Y2PA 3QUQA 2JV3A 4EX6A 4KLFA 1A6SA 5KFKA 3KHLA 2EDUA 4DS5A 2ASLA 2ZG6A 5KFMA 2AU0A 4Y2TA 3D2QA 5DBBA 2LM4A 1N62A 5AI0A 5L1LA 4ED0A 2WB1C 5F3XB 5KFVA 1NNLA 3ZDEA 9ICKA 5ALEA 4J9OA 9ICJA 9ICNA 3ONNA 2VJ5A 1B0XA 2HOQA 4M6WB 4ED3A 3DEEA 5CP2A 4NLBA 2E5SA 4I28A 4YXMA 2BCVA 2WHEA 9ICUA 3AUOA 2CXYA 4O0IA 3TFRA 2WF5A 2DQNB 2FLPA 4FFDA 2DUYA 3QX7A 4CNQA 2LM1A 4BJQA 3JPNA 1V85A 2YX8A 3WK8A 3RTVA 1J2MA 2PMZF 4J9QA 3H0MB 2W9AA 2QLTA 2Q0ZX 1ZQEA 3ZDCA 4ECTA 2JEFA 5J8YA 1YZ6A 8ICJA 4J03A 1NK9A 5ALUA 4DSFA 4Y2QA 4BWJA 4M9NA 3LYSA 3F2DA 4UASA 4HAIA 2NRTA 9ICRA 1RYSA 4NLKA 1BPBA 1KTQA 4ZOHC 3V7JA 8ICGA 1U45A 2GO7A 2VA2A 5CHGA 3A0BU 3RJGA 2V4RA 5ALDA 4MFAA 1ZD5A 5EWFA 1N60A 3JPPA 4J9NA 2Y0SF 4ZH4A 3OSNA 3M6KA 4YR2A 1T94A 1X9SA 4NV0A 2FPLA 1KL9A 2NRZA 1BPZA 2Z7JA 2KSOA 4I2EA 2MA1A 3UMGA 4LJXA 1ZQAA 1ZXIA 2G0AA 5AKGA 1ZQJA 3IV6A 4F5PA 4MF8A 3HT3A 1RQLA 2HI0A 2Q4TA 5KFQA 2B21A 4B9NA 2IOHA 9ICVA 4E0DA 1JUDA 1DXSA 4MHVA 4EBDA 4NM1A 4NL9C 4JK1A 5ALZA 1MN8A 4NXZA 4R8UB 4GXJA 3RRHA 1Z4NA 3NVYA 2KFNA 3EWAA 5KT6A 4HYKA 2C2EA 4DSLA 5ALHA 1WG8A 3C2LA 2YQEA 3NVZA 3D2SA 2LKYA 4DEZA 4KLHA 1U49A 2I5HA 5AKJA 8ICCA 2WB1F 4QZAA 5J2KA 3SR6A 4YVZA 2K4HA
chains in the Genus database with same CATH topology
2F2AB 3KZXA 2KEYA 4NLCA 2F8LA 1MA7A 4JMUA 2XIDA 2GH1A 1CRXA 2PMZC 3N7PD 2JGAA 3PSPA 5HR7A 2ZIVB 3LYSA 4OJLA 3LVWA 1Q3UA 3F2DA 3AQEA 1Q3VA 2RRDA 3MGVA 4KX3A 2WAQC 1PVRA 2GOLA 1HIWA 3IG5A 2XICA 5KL8B 1OUQA 1WUDA 2HOFA 2H3IA 3F5AA 2F77X 3CRXA 2F76X 3D2NA 5CRXA 2LHTA 2G08A 2KHVA 2YB4A 4P0QA 3LVVA 2LBOA 1YT3A 3RF9A 2WAQF 3M7DA 4QNLA 2HMXA 4P0PA 2W03A 2RHFA 2KJ5A 2N1RA 4QJFB 5A0LA 1P7DA 2OH2A 2VIXA 2CPRA 4AYBC 4FZNA 4CGZA 1ECWA 2XVTA 2KV2A 2Y0SF 2HBKA 2H3FA 2HOIA 2KD1A 4FZMA 3F2BA 2ZIWA 4OJ5A 3PSIA 4P0QB 1GO3F 1TAMA 2DF4B 2G07A 2DGZA 3M6KA 4OJ6A 4OO1J 2JH7A 3H0RB 1T94A 4FZLA 2H3QA 4NV0A 3RFAA 4QIWC 2JHDA 2KHQA 1IIPA 2W7OA 4GFJA 3CYMA 2Z7JA 3SMVA 1F44A 3KFUF 3GZFA 1D8BA 1URJA 2MA1A 3VCBA 3IN5A 2OM6A 2K89A 3O0FA 2BDUA 2HBMA 2KNJA 4OJOA 2ZIXA 4C0ZA 1A6SA 2HBJA 4CRXA 2MRLA 2G0AA 2ZIUB 2ZG6A 2ZXHA 3K1ZA 3OPXA 1DRGA 3F53A 3SQIA 2YB1A 3D2QA 5KL1B 2G06A 2NV3A 2LYBA 4P0PB 2ZIVA 2G5IB 3NRWA 3ALRA 1Z1BA 2Q4TA 4FE3A 1L6NA 2KKPA 3F5EA 2E1EA 2A3VA 3PZPA 2KOBA 2WB1C 3IP4B 3T79A 4OJPA 1SZHA 2HBLA 4KMOB 3HKZC 1ED1A 1HEKA 1XNSA 2VKQA 3GU3A 4PL2A 4U6PA 3N7SC 2K8AA 2ZIUA 2W7PA 2H3VA 2R18A 2KJ8A 2KICA 1A0PA 1ZQ1C 4KX5A 2K4EA 3ONNA 2VJ5A 3NUQA 3PSFA 4IC9A 3C28A 3AL0B 2HOQA 4PL1A 4NWIA 3DEEA 3F2CA 4NLBA 2KKVA 5HR6A 2E5SA 1PVPA 3H0LB 3HKZF 4U7CA 3AQFA 5C0YA 1NZBA 2K8BB 2VJ4A 2E1FA 3M6ZA 2KIWA 3SAFA 2LYAA 2DQNB 2G5HB 4AYBF 1UPHA 4BX9C 2OYYA 2JH1A 5T14A 2CN1A 3N7RC 4O3MA 4BUGA 3CP8A 4WJ3B 3IG8A 2K8CB 3D2SA 4BJQA 2LKYA 3SAHA 3SAGA 2KVCA 2YX8A 2PMZF 2XI9A 2ZIWB 2W04A 2CRXA 2Y0SC 3H0MB 2KJ9A 2RP5A 2JMGA 4A8EA 3E0FA 2OXOA 2ZIXB 2ZXIA 3L3FX 1Z19A 1KBUA 3ICXA 2K4IA 4ACOA 1XO0A 2WB1F 1PVQA 2H3ZA 4CDGA 2K4HA 3VC8A 3C29A 4ICAA 3PSTA 4QIWF 2D6FC 2M0NA 2G09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ1 C;  2F2A B;  4WJ3 B;  2DF4 B;  3IP4 B;  2D6F C;  3AL0 B;  2G5I B;  3KFU F;  3H0M B;  3H0R B;  2DQN B;  2G5H B;  3H0L B; 
#chains in the Genus database with same CATH topology
 5EE0 A;  3RR7 A;  3AQE A;  5HHH A;  3QUC A;  4RNO A;  1HIW A;  1N61 A;  2XIC A;  4Q8E A;  1TK0 A;  2DL0 A;  4RQM A;  4UAR A;  3BS5 B;  4I2G A;  7ICG A;  3GV7 B;  4F4Y A;  3LVV A;  1SV4 A;  3RF9 A;  2KP7 A;  4C7Z A;  4R8U A;  2EAO A;  5DLG A;  5J2H A;  3TAR A;  2RDJ A;  5KAF U;  4DL3 A;  1U48 A;  4P0Q B;  2BCU A;  1COK A;  1TAM A;  3K1R B;  2DPJ A;  1SV0 A;  4OJ6 A;  1U47 A;  3BDP A;  3A0H U;  4GFJ A;  4DF8 A;  3KFU F;  4K4G A;  1SKW A;  9ICT A;  4R64 A;  4CRX A;  3WK9 A;  3B0X A;  4RQ3 A;  5DQG A;  2VAN A;  3T5K A;  4UBB A;  4XQ8 A;  4YR3 A;  1ZQY A;  1COO A;  9ICG A;  8ICI A;  1Z00 B;  2ALZ A;  4YR0 A;  3HKZ C;  4PHD A;  3AN1 A;  1QQ6 A;  1HEK A;  5KT3 A;  3DDH A;  4US9 A;  2NRW A;  4BDP A;  1N5W A;  2WF8 A;  4B9T A;  2Y9U A;  1YZ7 A;  1L8O A;  1HUO A;  4JWM A;  4BXO B;  2FMP A;  3QUB A;  4YMO A;  3BQ7 A;  5AKE A;  3EPI A;  1L7M A;  5F9L A;  2XY5 A;  4DWI A;  3DV9 A;  1NK4 A;  5KG1 A;  2AGO A;  4B9V A;  3ZD8 A;  5IIO A;  4NY8 A;  4YMM A;  3QEB Z;  4DQS A;  3CP8 A;  4NLZ A;  4I2B A;  1KFT A;  4DL5 A;  4KLO A;  1UQV A;  1SL0 A;  2A1J B;  2AGQ A;  2XGQ A;  2V4Q A;  2KJ9 A;  4Y2V A;  5ALN A;  1X40 A;  2R8I A;  3PO5 A;  4DSJ A;  5KG7 A;  5CR0 A;  5ALJ A;  4RT3 A;  4J9R A;  2DWQ A;  2BCQ A;  1D8L A;  4USA A;  4PGY A;  4GXK A;  4CCH A;  4QWA A;  2GLE A;  7ICF A;  3NRZ A;  4F72 A;  9ICS A;  4XA5 A;  2JEG A;  4CF5 A;  4QWB A;  2FPM A;  2C2D A;  2DFL A;  5J0U A;  1PUZ A;  2HHV A;  4PGQ A;  2WAQ F;  3IHQ B;  2HMX A;  1C20 A;  1X6I A;  3E58 A;  4M9J A;  5AI4 A;  4F2S A;  2EAN A;  5AI9 A;  3RJE A;  1UA1 A;  5K4L A;  4DL7 A;  4DOC A;  4DSK A;  5KG3 A;  2ZUB A;  2RQ5 A;  4Z6D A;  2F1J A;  2ZXH A;  5DDM A;  3KBB A;  2K60 A;  2J6U A;  4EEN A;  5KAI U;  5ALG A;  2KKP A;  5DQI A;  2HW3 A;  2KOB A;  3T79 A;  1TKD A;  5CA7 A;  4KMO B;  2HHX A;  2VKQ A;  1RYR A;  3N7S C;  1T4G A;  4RUC A;  3I1Y A;  4ECZ A;  5KFT A;  4ECX A;  2IOF A;  1PVP A;  5AM0 A;  4RUA A;  5ALR A;  3MR5 A;  2ZTE A;  1ZQL A;  3EPG A;  3BS7 A;  1NK0 A;  5AK4 A;  2HDO A;  2JXJ A;  5KFS A;  2W3R A;  4C4R A;  3JPT A;  5JTI A;  2KVC A;  1NK7 A;  2KE7 A;  2YMQ A;  5KT7 A;  4ACO A;  5JRT A;  3S6J A;  3MDC A;  3VC8 A;  3V6K A;  2BPF A;  4F4K A;  3MGH A;  1ZQB A;  4JMU A;  4IRC A;  2ZUD A;  4UAZ A;  1XU4 A;  2HHW A;  1V38 A;  4ED7 A;  3OSP A;  3MFH A;  4ECS A;  3SV4 A;  8ICU A;  1S0M A;  3V72 A;  4DL2 A;  3B0Y A;  9ICM A;  2AQ4 A;  2KD1 A;  4FZM A;  2A1J A;  3CW2 C;  2OHF A;  3QU5 A;  2UVW A;  7ICP A;  4QIW C;  1SKR A;  1IIP A;  1X42 A;  2BCR A;  1BNO A;  2BGW A;  3O0F A;  2KNJ A;  4OJO A;  2D3D A;  4Q45 A;  1BPY A;  2ZIU B;  3LK9 A;  1DRG A;  5KL1 B;  5ALY A;  3GII A;  3M9M B;  4Z6C A;  3G6X A;  3KHG A;  5L1I A;  2A3V A;  1SZH A;  2ZTC A;  4UAW A;  4Q43 A;  1S5L U;  4O3R A;  2EAM A;  3N4M B;  2YY6 A;  5J0X A;  2ZJ5 A;  3ETL A;  2R8H A;  7ICV A;  1XO1 A;  1RXV A;  3FAH A;  5ALW A;  4K4H A;  1KFD A;  3QNM A;  5G5H A;  4AYB F;  1UPH A;  4RQ0 A;  1QSL A;  3SZ2 A;  5J2I A;  2ZTD A;  2ISO A;  2WF9 A;  2AXT U;  5KFE A;  1A77 A;  3TAP A;  2ZJ8 A;  4ED8 A;  1NJZ A;  1C7Y A;  2ZXI A;  2H3Z A;  5B5E U;  9ICC A;  3Q8S B;  4I2I A;  3KZX A;  1L8L A;  5KFY A;  1FIQ A;  2BHN A;  1MA7 A;  3SEI A;  4O3O A;  4JWN A;  3PSP A;  2KK0 A;  5J2G A;  4RU9 A;  5HML A;  1Q3V A;  5AM2 A;  1ZQT A;  1JAL A;  4M9H A;  1S0V A;  2JZB B;  1RDF A;  3KD3 A;  2ISP A;  2F76 X;  5FP0 A;  2R8J A;  9ICX A;  4K4I A;  1KN5 A;  3BJY A;  3Q8L A;  4Y2Y A;  4QNL A;  2HHQ A;  1UCV A;  4DQQ A;  2VIX A;  5L9X A;  4ED1 A;  2K4P A;  2KV2 A;  5KFH A;  4OO1 J;  4KN7 A;  1DK2 A;  5J0Q A;  4DFM A;  3AEV A;  4PHE A;  4IR1 A;  4UB2 A;  1NK8 A;  9ICO A;  4Y2X A;  3WKC A;  2G06 A;  2NV3 A;  5AM3 A;  3SI8 A;  2EZY A;  5KT4 A;  4GC6 A;  2KMD A;  2ZIV A;  4R65 A;  5KFJ A;  4DSE A;  3RH4 A;  4UW9 A;  2RLT A;  2DKZ A;  3RR8 A;  5J2D A;  1JMS A;  2BQU A;  4RQ2 A;  3H8M A;  3QU9 A;  4O3Q A;  2FDR A;  2ZIU A;  4U6P A;  2KIC A;  4F4X A;  1B43 A;  1L3T A;  2YMM A;  1SXD A;  4NWI A;  1ZD2 P;  2WTF A;  4G9B A;  3C1Z A;  1J2N A;  3AMZ A;  3RJJ A;  5BOL A;  1SGG A;  1M6Y A;  4I27 A;  3H8J A;  1ZQZ A;  4Y2J A;  3SAH A;  1QQ7 A;  1KRP A;  3NTU A;  3UQ0 A;  3HW8 A;  5DGA A;  1WWU A;  3FM9 A;  4CDG A;  5ALP A;  4ECW A;  1L7N A;  2PKE A;  5BOM A;  2F8L A;  4DFD A;  5DB8 A;  4RPY A;  2GH1 A;  3IM1 A;  2W8L A;  4BXO A;  4PGX A;  5KFX A;  5DKW A;  2A19 A;  4P4P A;  2RDI A;  1SWW A;  1PVR A;  3PMN A;  3IDW A;  5AKI A;  5J0R A;  3I28 A;  1PK1 B;  3OJU A;  2YB4 A;  5J2B A;  5L1J A;  1IG6 A;  2P6U A;  2RHF A;  2ZJA A;  5G5G A;  4P4M A;  4CGZ A;  1JXL A;  4R63 A;  3BQ2 A;  5AIB A;  1GO3 F;  4Y2S A;  4LZG A;  2P66 A;  3WU2 U;  4KTQ A;  2FI1 A;  2BQR A;  1D8B A;  4KN4 A;  3IN5 A;  4NJ8 A;  3K4G A;  4X5V A;  1QSS A;  2HBM A;  3OHB A;  2HBJ A;  3C2M A;  4RNM A;  3OPX A;  2KTQ A;  3PY8 A;  5IIL A;  4IRK A;  8ICB A;  4AP9 A;  4RQ5 A;  5KFN A;  8ICN A;  5AKH A;  2HBL A;  5AI5 A;  4I2H A;  1N56 A;  2PFQ A;  1K1Q A;  4OCZ A;  4TQS A;  2DKX A;  1N2X A;  5DQH A;  3F2C A;  3PNC A;  4JUZ A;  3HKZ F;  2E1F A;  3SAF A;  2PFO A;  4GIB A;  3H8W A;  2K8C B;  1X2I A;  1TV9 A;  1MSW D;  2OWO A;  3HX0 A;  2RP5 A;  3L3F X;  3RJK A;  4B9U A;  7ICT A;  3GV8 B;  3C29 A;  1JIH A;  3GV5 B;  2R8K A;  4R66 A;  4NLC A;  1JI7 A;  2F3N A;  4I2A A;  1CUK A;  3OJS A;  3MGV A;  4FBT A;  4KX3 A;  4UB5 A;  4C4T A;  4CF3 A;  2E8M A;  8ICA A;  4EEL A;  3WK7 A;  1F0M A;  5CRX A;  4MFF A;  4KLU A;  2QB0 A;  1NJY A;  3QZ8 A;  4M6W A;  4UAV A;  4DO9 A;  4DFP A;  1EXN A;  2CPR A;  4FZN A;  1ECW A;  2XCA A;  5EWE A;  1ZQS A;  3V6J A;  3BS5 A;  3T5J A;  1CI4 A;  2W7O A;  3CYM A;  4M47 A;  4GC7 A;  3VCB A;  1KQQ A;  3GFK B;  3SQI A;  4YXJ A;  3RB0 A;  5D46 A;  5BPC A;  2P6R A;  2J6T A;  2O6K A;  5AM5 A;  4QZG A;  1QSY A;  1L6N A;  2KFZ A;  4F5R A;  1ZQX A;  3C1Y A;  4M04 A;  1L3V A;  2QB1 A;  5AKK A;  1ED1 A;  3AU6 A;  3K75 D;  4F8R A;  1BPD A;  2XO7 A;  2W9C A;  4UB3 A;  3QYP A;  3HPO A;  3QU7 A;  3Q8M A;  5J2A A;  5HNK A;  4FO6 A;  3C28 A;  4RQ8 A;  2F1I A;  3H0L B;  3WKA A;  8ICE A;  3RBE A;  2KIW A;  2G5H B;  4JV0 A;  3KHR A;  4UAT A;  3EYZ A;  2KIV A;  4RQN A;  1A76 A;  3T3F A;  3NVW A;  2XGP A;  3ZD9 A;  2W04 A;  3KZI U;  1D8Y A;  4Z6F A;  4YMN A;  1KEJ A;  4RZR A;  2F2A B;  5ALM A;  4QZD A;  2FE9 A;  3N7P D;  3QEA Z;  1Z4O A;  4KLT A;  8ICW A;  3TAN A;  2UVU A;  4EZ9 A;  3IG5 A;  3NAS A;  1U9L A;  3RAX A;  5KFL A;  8ICY A;  2J6S A;  1ZQF A;  5J29 A;  2KZM A;  2G08 A;  4QWE A;  8ICZ A;  2AGP A;  3KKA C;  2F8K A;  1DK3 A;  4JV2 A;  1BNP A;  2QAR A;  2W54 A;  5H2F U;  5J0Y A;  1P7D A;  5A0L A;  4O3S A;  5KFG A;  4YP3 A;  4YN4 A;  2H3F A;  4DQP A;  1IXR A;  2G07 A;  5KFZ A;  5DGB A;  1SZP A;  2W55 A;  3UXN A;  3IRU A;  3JPQ A;  4UB6 U;  3C23 A;  1PZN A;  3K1Z A;  3F53 A;  4XRH A;  4TUR A;  2F1H A;  3Q8K A;  2LYB A;  4F71 A;  3QE9 Y;  5KFO A;  1DGJ A;  1Z1B A;  1SXE A;  2HHS A;  3NS1 A;  4TUS A;  3PX6 A;  1FFV A;  5III A;  3PZP A;  3IP4 B;  4I2F A;  7ICS A;  1WCL A;  2QB0 B;  4TUP A;  1D9D A;  4IR9 A;  3QZ7 A;  3RJI A;  2KJ8 A;  1LKY A;  4F93 B;  4O5C A;  1RYU A;  1NZB A;  3M6Z A;  8ICF A;  2YTU A;  3UXO A;  2OYY A;  1LKY B;  5T14 A;  2UVR A;  3TAD C;  1T7P A;  1JXE A;  4RQ7 A;  4UB4 A;  4Y2U A;  5EE3 A;  3RB4 A;  1V9P A;  2JMG A;  1Z19 A;  4KLJ A;  1NJW A;  2DBY A;  3HJE A;  3G6Y A;  4RNN A;  4QIW F;  2HSZ A;  2G09 A;  3WKD A;  3FC4 A;  1LV5 A;  2KEY A;  5ALT A;  4B9S A;  3M1Y A;  3EW9 A;  2PMZ C;  2NYV A;  2WF7 A;  1X66 A;  5J0W A;  4F4Z A;  3I76 A;  5DDY A;  4BWM A;  1LVH A;  3QXG A;  1NK6 A;  5ALS A;  3PVX A;  4TUQ A;  4QW8 A;  3UPQ A;  2LBO A;  1Z00 A;  5ALQ A;  1ZQC A;  4YQW A;  4NM2 A;  1KW4 A;  4IQV A;  1RZT A;  4LZD A;  4FZL A;  7ICH A;  4RT2 A;  1MC8 A;  2H3Q A;  4DQR A;  1KFS A;  3PR4 A;  2JHD A;  3SMV A;  3M9O B;  1RQN A;  3MGI A;  4IL6 U;  4JV1 A;  2D8C A;  1U4B A;  8ICO A;  3MFI A;  1IM4 A;  3MBY A;  5TZV A;  1CEZ A;  1L7O A;  1LB2 B;  1ZJN A;  1X9X A;  5J0T A;  1HJP A;  2JRZ A;  2W3S A;  5KG6 A;  1SL2 A;  1BPX A;  1FEZ A;  4FS2 A;  4C4S A;  2W43 A;  2W11 A;  3HP6 A;  4KX5 A;  1BPE A;  4IC9 A;  4I2D A;  1JRO A;  2ODG A;  3OHA A;  4M9G A;  2KKV A;  3TAD A;  1NKB A;  3AQF A;  3GIK A;  1NKE A;  4YD2 A;  2IHN A;  2EZX A;  1ZJM A;  3FDS A;  2CN1 A;  4QZ9 A;  1JN3 A;  3LDA A;  3KTQ A;  4DOA A;  1ZRN A;  3SAG A;  1SKS A;  1F5S A;  4KLD A;  3MDA A;  2FLN A;  5DBC A;  2HVH A;  2K4I A;  1TVA A;  4OD0 A;  1L7P A;  1DOQ A;  3PST A;  2P35 A;  5L1M A;  1XWL A;  9ICQ A;  2EH9 A;  4EEK A;  4NLN A;  3H40 A;  2BCS A;  4KLE A;  1K1S A;  2JZB A;  5GTI U;  2EAP A;  4O3N A;  5KFB A;  4KLS A;  5CJ7 A;  3PW4 A;  1H38 A;  4ECU A;  4RQ6 A;  4UB8 U;  1ZQR A;  1MQ2 A;  2HBK A;  2C28 A;  2I6X A;  4PH5 A;  3C2K A;  3PSI A;  5IIM A;  2DGZ A;  2HHT A;  1ZRM A;  2E8O A;  5J0O A;  3RFA A;  3GQC A;  3JPS A;  2BZF A;  2FPK A;  5AI6 A;  3ZI4 A;  3RH6 A;  2EZZ A;  1VLB A;  1ZD4 A;  1NI3 A;  1ARO P;  4QWD A;  3BZC A;  1TFR A;  7ICK A;  2LI6 A;  3UMB A;  4FE3 A;  1PK1 A;  1QLN A;  2WFA A;  1BVS A;  5JUM A;  3ISB A;  3Q8Q B;  3GIM A;  3H7I A;  4F5O A;  2K4E A;  7ICI A;  3PSF A;  5KG0 A;  3AL0 B;  4PL1 A;  4C7Y A;  2MUT A;  5KFR A;  4C8M A;  1B4F A;  2HCF A;  5KG2 A;  4O3P A;  5EE1 A;  1ZET A;  4YG2 A;  9ICE A;  4BX9 C;  5IIK A;  5ALX A;  4BUG A;  3IG8 A;  3L4P A;  1FFU A;  1RXW A;  3RJH A;  3PW2 A;  4EBC A;  1PVQ A;  2KVS A;  3BQT A;  4ICA A;  2M0N A;  4PHP A;  4O9M A;  2ES6 A;  5AIA A;  1ZQG A;  1ZQU A;  2E3T A;  3GDX A;  3M8R A;  3EZ5 A;  2WAQ C;  1TAU A;  5ALV A;  1NKC A;  5D49 A;  3QU2 A;  5IIN A;  2PFN A;  3QU4 A;  3D2N A;  5CB1 A;  2LHT A;  1MQ3 A;  5HMM A;  4ED6 A;  3PW7 A;  2W03 A;  5KFW A;  4AYB C;  4QW9 A;  3MR2 A;  5J0S A;  5AM1 A;  4OJ5 A;  3LWL A;  7ICE A;  2PXI A;  2KHQ A;  4GLX A;  4KMU A;  9ICW A;  1KLN A;  2ESE A;  4F5N A;  2BDU A;  5TIS U;  4DLG A;  5D4B A;  8ICT A;  1XSL A;  4XUS A;  2G5I B;  2IOF K;  2PFP A;  1N63 A;  2W9C B;  2I1Q A;  1VJ5 A;  2OEH A;  2WF6 A;  2AH5 A;  3TI0 A;  1SIJ A;  2LYH A;  1ZQH A;  3B9J A;  4DOB A;  1XSP A;  5ALL A;  4M2Y A;  2XC9 A;  2KZZ A;  3WK5 A;  1A0P A;  3GIJ A;  4F3O A;  1ZQM A;  4B9M A;  1QCK A;  4F4W A;  5HR6 A;  3ISC A;  5C0Y A;  8ICQ A;  2VJ4 A;  4PHA A;  2EQY A;  1Q8K A;  5DB9 A;  4LVS A;  4WJ3 B;  5KFU A;  1L3S A;  7ICO A;  3TFS A;  1NZP A;  1X9W A;  2Y0S C;  4EX7 A;  2R8G A;  3E0F A;  2W9B A;  3Q8P B;  1TK5 A;  1SL1 A;  3N28 A;  1AQ6 A;  5J2E A;  2OCE A;  1KSP A;  3ZDA A;  1N5X A;  5KFP A;  3PR5 B;  2W9B B;  1CRX A;  5HR7 A;  3OGU A;  2BR0 A;  7ICN A;  2LMR A;  5AHX A;  4O5E A;  9ICF A;  1OUQ A;  1S0N A;  5KL8 B;  4ELT A;  2ZUC A;  2HOF A;  3F5A A;  5KT5 A;  2F77 X;  1TAQ A;  2ASD A;  3GIL A;  4NL9 A;  3H8S A;  1UHU A;  2KHV A;  3M7D A;  3HWT A;  2MAX A;  4P0P A;  5AKX A;  1S8O A;  2KJ5 A;  4DL6 A;  4QJF B;  4RPZ A;  2Y1J A;  2XVT A;  5KT2 A;  3F2B A;  1D9F A;  3ETR A;  4ECY A;  3PW5 A;  5HP4 A;  3M8S A;  4IRD A;  3PV8 A;  1S9F A;  1S76 D;  3GZF A;  2W9M A;  4PZN A;  2YMP A;  2XY7 A;  4EYH B;  3AM9 A;  4EEY A;  1Z1V A;  2ZIX A;  5KNI A;  1TE2 A;  1JX4 A;  4EYI B;  7ICL A;  4P0P B;  4QZC A;  1QTM A;  5AKZ A;  3ALR A;  3KOO A;  4Z6E A;  4G3I A;  4OJP A;  1KKX A;  1K5O A;  1RG6 A;  5JU5 A;  5L1K A;  4PL2 A;  1T3N A;  5KFC A;  4US8 A;  2R18 A;  3SV3 A;  1XSN A;  7ICU A;  1ZQ1 C;  3NUQ A;  4DCC A;  1TK8 A;  3WKB A;  4Q8F A;  4M0A A;  4Q44 A;  5C5J A;  5KFA A;  2LYA A;  5EE9 A;  1SV0 C;  4YD1 A;  1ZQW A;  3UMC A;  4J9M A;  1NOM A;  4O3M A;  9ICL A;  4QZE A;  3QUT A;  4PPX A;  1FO4 A;  3WK6 A;  3MR6 A;  4A8E A;  2ZIX B;  1KBU A;  5J8Y C;  4MF2 A;  5AIC A;  2NRV A;  4GXI A;  1J97 A;  2D6F C;  1L3U A;  1ZOL A;  4CF4 A;  5AK5 A;  2YML A;  3C5G A;  4J9P A;  4OJL A;  3LVW A;  8ICM A;  4C8N A;  5KG4 A;  3N97 B;  3CNH A;  5DG9 A;  4KLI A;  1S97 A;  3V7L A;  3SYZ A;  2XY6 A;  2HVI A;  4C8K A;  2Y9T A;  4O5K A;  1NK5 A;  9ICI A;  5DB7 A;  3D6J A;  4P4O A;  2ATL A;  5DG7 A;  2N1R A;  2OH2 A;  2FMQ A;  4DSI A;  3WKE A;  4F2R A;  3PW0 A;  2VA3 A;  2JH7 A;  1OXJ A;  3R9K A;  2E8P A;  3FYH A;  3MAB A;  1ZQP A;  4B6J A;  1S0O A;  1URJ A;  5EOZ A;  2K89 A;  2NO5 A;  3RB6 A;  4C0Z A;  4ELU A;  3M9N B;  2MRL A;  1BGX T;  4NLG A;  4MEX A;  3C5F A;  3NRW A;  1Z3E B;  3ISD A;  4P2H A;  4KIT B;  3TQ1 A;  1UT5 A;  4IS7 A;  4JB3 A;  3MR3 A;  3H4B A;  5KTQ A;  5DG8 A;  3G6V A;  2H5X A;  2C2R A;  4U7C A;  2JEI A;  1ZQK A;  3RB3 A;  4B9L A;  3ED5 A;  3LWM A;  4UAU A;  2L5Y A;  3BZK A;  1T3Q A;  1ZD3 A;  7ICR A;  3L5K A;  3E2E A;  4YCX A;  2XI9 A;  5AKL A;  1XS9 D;  2CRX A;  4IQW A;  1O03 A;  1N48 A;  2XCP A;  1HUZ A;  4DS4 A;  3ICX A;  4DLE A;  5B66 U;  2NRX A;  3V6H A;  1WWV A;  4QZH A;  4QWC A;  3KKA A;  3SEN A;  4DFK A;  4BGD A;  1Q3U A;  8ICP A;  2NO4 A;  4MFC A;  5AKY A;  3RRG A;  4KLM A;  2UVV A;  1WUD A;  2H3I A;  2MU2 A;  3CRX A;  1B22 A;  2LPE A;  3RH5 A;  4EZ6 A;  2E8N A;  4QZI A;  3HIL A;  1IV8 A;  5AI8 A;  4C8L A;  4ECQ A;  2FMS A;  4M9L A;  2HOI A;  2DF4 B;  5J2C A;  3ZDD A;  3TKA A;  3H0R B;  1SB3 C;  5ALF A;  3PX4 A;  2Y1I A;  5J2J A;  2FJ6 A;  1XC9 A;  4F5Q A;  1X6J A;  2QKQ A;  3RJF A;  3THV A;  2JR5 A;  8ICH A;  3UM9 A;  1PK3 A;  2YN4 A;  3F5E A;  4MEY A;  8ICV A;  4QZ8 A;  4DF4 A;  2IHM A;  4C8O A;  1ZQN A;  2W8K A;  3OTQ A;  5AK3 A;  4UB1 A;  5ALO A;  1XNS A;  2B0C A;  2MUT B;  3GU3 A;  4UQG A;  4RPX A;  2H3V A;  1RM6 C;  5DBA A;  3KHH A;  1OW5 A;  2PI4 A;  2C22 A;  2K8B B;  2IA6 A;  3BQ1 A;  3Q8R B;  1SWV A;  1Q46 A;  4PZO A;  1NJX A;  2DPI A;  2JH1 A;  3N7R C;  2IBK A;  1Y88 A;  2ZIW B;  5IIJ A;  1ZQD A;  2AQ0 A;  2HHU A;  3MC1 A;  1XO0 A;  2QAR B;  4I2J A;  1S77 D;  4TQR A;  2B6G A;  8ICK A;  2F44 A;  4FS1 A;  2XID A;  7ICJ A;  4IQT A;  2BKE A;  2JGA A;  2ZIV B;  2ASJ A;  3T5L A;  2RRD A;  4Y2R A;  2GOL A;  5J0P A;  1ZQO A;  1T8E A;  2BPG A;  3EUB 2;  3UXP A;  4P0Q A;  1YT3 A;  5KFD A;  5ALK A;  3H4D A;  1ZYQ A;  4PJ0 U;  2IMW P;  2MSN A;  3C21 A;  1S10 A;  4ELV A;  4FBU A;  4UAY A;  1ZQI A;  4DL4 A;  2GWS A;  4RQ4 A;  1WYG A;  1O08 A;  9ICB A;  2KSO B;  3TAC B;  2KZ3 A;  4F50 A;  8ICL A;  5AM4 A;  4F92 B;  1F44 A;  3ZDB A;  1KDH A;  3WK4 A;  3NGD A;  3AU2 A;  1UT8 A;  2OM6 A;  4QZF A;  4I2C A;  3HRD D;  3PML A;  1VDV A;  4QZB A;  8ICS A;  2YB1 A;  3JPR A;  4IQU A;  1QH9 A;  4RQ1 A;  3NVV A;  1QQ5 A;  1X9M A;  4KLL A;  2BDP A;  5KFI A;  2E1E A;  3J81 j;  3U26 A;  5DB6 A;  1L5U A;  2W7P A;  2K8A A;  2M9N A;  4F91 B;  9ICP A;  4KLG A;  2AJQ A;  3V7K A;  4CE6 A;  5F9N A;  1DGS A;  1JRP A;  1WCN A;  3RBD A;  5E79 U;  3ORY A;  3JPO A;  7ICM A;  3PX0 A;  2AHO B;  2FLL A;  5KFF A;  3TAQ A;  4EBE A;  5GTH U;  5ALI A;  3RAQ A;  4ECR A;  4ECV A;  2OXO A;  2JEJ A;  3UQ2 A;  8ICR A;  1ZQV A;  5DLF A;  5CEH A;  3PO4 A;  1V97 A;  4ED2 A;  3SD7 A;  5J2F A;  5KG5 A;  4DQI A;  4J9S A;  1UA0 A;  4KLQ A;  2A1A A;  9ICA A;  2KN7 A;  2I9G A;  5HHI A;  2KG5 A;  2VA8 A;  9ICH A;  3BQ0 A;  7ICQ A;  8ICX A;  4UBC A;  4I29 A;  4J9K A;  5AK6 A;  2BQ3 A;  4C80 A;  2BPC A;  3T5H A;  5CWR A;  5EWG A;  4J9L A;  2ZIW A;  4DFJ A;  4YFK A;  2PI5 A;  1RPL A;  2V9W A;  1ZQQ A;  4Y2P A;  3QUQ A;  2JV3 A;  4EX6 A;  4KLF A;  1A6S A;  5KFK A;  3KHL A;  2EDU A;  4DS5 A;  2ASL A;  2ZG6 A;  5KFM A;  2AU0 A;  4Y2T A;  3D2Q A;  5DBB A;  2LM4 A;  1N62 A;  5AI0 A;  5L1L A;  4ED0 A;  2WB1 C;  5F3X B;  5KFV A;  1NNL A;  3ZDE A;  9ICK A;  5ALE A;  4J9O A;  9ICJ A;  9ICN A;  3ONN A;  2VJ5 A;  1B0X A;  2HOQ A;  4M6W B;  4ED3 A;  3DEE A;  5CP2 A;  4NLB A;  2E5S A;  4I28 A;  4YXM A;  2BCV A;  2WHE A;  9ICU A;  3AUO A;  2CXY A;  4O0I A;  3TFR A;  2WF5 A;  2DQN B;  2FLP A;  4FFD A;  2DUY A;  3QX7 A;  4CNQ A;  2LM1 A;  4BJQ A;  3JPN A;  1V85 A;  2YX8 A;  3WK8 A;  3RTV A;  1J2M A;  2PMZ F;  4J9Q A;  3H0M B;  2W9A A;  2QLT A;  2Q0Z X;  1ZQE A;  3ZDC A;  4ECT A;  2JEF A;  5J8Y A;  1YZ6 A;  8ICJ A;  4J03 A;  1NK9 A;  5ALU A;  4DSF A;  4Y2Q A;  4BWJ A;  4M9N A;  3LYS A;  3F2D A;  4UAS A;  4HAI A;  2NRT A;  9ICR A;  1RYS A;  4NLK A;  1BPB A;  1KTQ A;  4ZOH C;  3V7J A;  8ICG A;  1U45 A;  2GO7 A;  2VA2 A;  5CHG A;  3A0B U;  3RJG A;  2V4R A;  5ALD A;  4MFA A;  1ZD5 A;  5EWF A;  1N60 A;  3JPP A;  4J9N A;  2Y0S F;  4ZH4 A;  3OSN A;  3M6K A;  4YR2 A;  1T94 A;  1X9S A;  4NV0 A;  2FPL A;  1KL9 A;  2NRZ A;  1BPZ A;  2Z7J A;  2KSO A;  4I2E A;  2MA1 A;  3UMG A;  4LJX A;  1ZQA A;  1ZXI A;  2G0A A;  5AKG A;  1ZQJ A;  3IV6 A;  4F5P A;  4MF8 A;  3HT3 A;  1RQL A;  2HI0 A;  2Q4T A;  5KFQ A;  2B21 A;  4B9N A;  2IOH A;  9ICV A;  4E0D A;  1JUD A;  1DXS A;  4MHV A;  4EBD A;  4NM1 A;  4NL9 C;  4JK1 A;  5ALZ A;  1MN8 A;  4NXZ A;  4R8U B;  4GXJ A;  3RRH A;  1Z4N A;  3NVY A;  2KFN A;  3EWA A;  5KT6 A;  4HYK A;  2C2E A;  4DSL A;  5ALH A;  1WG8 A;  3C2L A;  2YQE A;  3NVZ A;  3D2S A;  2LKY A;  4DEZ A;  4KLH A;  1U49 A;  2I5H A;  5AKJ A;  8ICC A;  2WB1 F;  4QZA A;  5J2K A;  3SR6 A;  4YVZ A;  2K4H A; 
#chains in the Genus database with same CATH homology
 2F2A B;  3KZX A;  2KEY A;  4NLC A;  2F8L A;  1MA7 A;  4JMU A;  2XID A;  2GH1 A;  1CRX A;  2PMZ C;  3N7P D;  2JGA A;  3PSP A;  5HR7 A;  2ZIV B;  3LYS A;  4OJL A;  3LVW A;  1Q3U A;  3F2D A;  3AQE A;  1Q3V A;  2RRD A;  3MGV A;  4KX3 A;  2WAQ C;  1PVR A;  2GOL A;  1HIW A;  3IG5 A;  2XIC A;  5KL8 B;  1OUQ A;  1WUD A;  2HOF A;  2H3I A;  3F5A A;  2F77 X;  3CRX A;  2F76 X;  3D2N A;  5CRX A;  2LHT A;  2G08 A;  2KHV A;  2YB4 A;  4P0Q A;  3LVV A;  2LBO A;  1YT3 A;  3RF9 A;  2WAQ F;  3M7D A;  4QNL A;  2HMX A;  4P0P A;  2W03 A;  2RHF A;  2KJ5 A;  2N1R A;  4QJF B;  5A0L A;  1P7D A;  2OH2 A;  2VIX A;  2CPR A;  4AYB C;  4FZN A;  4CGZ A;  1ECW A;  2XVT A;  2KV2 A;  2Y0S F;  2HBK A;  2H3F A;  2HOI A;  2KD1 A;  4FZM A;  3F2B A;  2ZIW A;  4OJ5 A;  3PSI A;  4P0Q B;  1GO3 F;  1TAM A;  2DF4 B;  2G07 A;  2DGZ A;  3M6K A;  4OJ6 A;  4OO1 J;  2JH7 A;  3H0R B;  1T94 A;  4FZL A;  2H3Q A;  4NV0 A;  3RFA A;  4QIW C;  2JHD A;  2KHQ A;  1IIP A;  2W7O A;  4GFJ A;  3CYM A;  2Z7J A;  3SMV A;  1F44 A;  3KFU F;  3GZF A;  1D8B A;  1URJ A;  2MA1 A;  3VCB A;  3IN5 A;  2OM6 A;  2K89 A;  3O0F A;  2BDU A;  2HBM A;  2KNJ A;  4OJO A;  2ZIX A;  4C0Z A;  1A6S A;  2HBJ A;  4CRX A;  2MRL A;  2G0A A;  2ZIU B;  2ZG6 A;  2ZXH A;  3K1Z A;  3OPX A;  1DRG A;  3F53 A;  3SQI A;  2YB1 A;  3D2Q A;  5KL1 B;  2G06 A;  2NV3 A;  2LYB A;  4P0P B;  2ZIV A;  2G5I B;  3NRW A;  3ALR A;  1Z1B A;  2Q4T A;  4FE3 A;  1L6N A;  2KKP A;  3F5E A;  2E1E A;  2A3V A;  3PZP A;  2KOB A;  2WB1 C;  3IP4 B;  3T79 A;  4OJP A;  1SZH A;  2HBL A;  4KMO B;  3HKZ C;  1ED1 A;  1HEK A;  1XNS A;  2VKQ A;  3GU3 A;  4PL2 A;  4U6P A;  3N7S C;  2K8A A;  2ZIU A;  2W7P A;  2H3V A;  2R18 A;  2KJ8 A;  2KIC A;  1A0P A;  1ZQ1 C;  4KX5 A;  2K4E A;  3ONN A;  2VJ5 A;  3NUQ A;  3PSF A;  4IC9 A;  3C28 A;  3AL0 B;  2HOQ A;  4PL1 A;  4NWI A;  3DEE A;  3F2C A;  4NLB A;  2KKV A;  5HR6 A;  2E5S A;  1PVP A;  3H0L B;  3HKZ F;  4U7C A;  3AQF A;  5C0Y A;  1NZB A;  2K8B B;  2VJ4 A;  2E1F A;  3M6Z A;  2KIW A;  3SAF A;  2LYA A;  2DQN B;  2G5H B;  4AYB F;  1UPH A;  4BX9 C;  2OYY A;  2JH1 A;  5T14 A;  2CN1 A;  3N7R C;  4O3M A;  4BUG A;  3CP8 A;  4WJ3 B;  3IG8 A;  2K8C B;  3D2S A;  4BJQ A;  2LKY A;  3SAH A;  3SAG A;  2KVC A;  2YX8 A;  2PMZ F;  2XI9 A;  2ZIW B;  2W04 A;  2CRX A;  2Y0S C;  3H0M B;  2KJ9 A;  2RP5 A;  2JMG A;  4A8E A;  3E0F A;  2OXO A;  2ZIX B;  2ZXI A;  3L3F X;  1Z19 A;  1KBU A;  3ICX A;  2K4I A;  4ACO A;  1XO0 A;  2WB1 F;  1PVQ A;  2H3Z A;  4CDG A;  2K4H A;  3VC8 A;  3C29 A;  4ICA A;  3PST A;  4QIW F;  2D6F C;  2M0N A;  2G09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...