2G5IB

Structure of trna-dependent amidotransferase gatcab complexed with adp-alf4
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
410
structure length
410
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 120
structure length 410
sequence length 410
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5iB02
2F2AB 3AL0B 2G5IB 3IP4B 4WJ3B 1ZQ1C 3H0LB 2G5HB 3H0RB 3KFUF 2DF4B 2D6FC 2DQNB 3H0MB
chains in the Genus database with same CATH superfamily
4KLSA 5CR0A 4TUPA 1NK0A 1XSPA 2W9CA 4F2SA 1BPEA 3KZXA 1RQNA 3N7PD 3MR5A 5ALNA 3MDAA 4CCHA 5ALDA 4J9OA 1L3SA 1ZD5A 2KE7A 4F2RA 3J81j 4EBDA 4QZAA 2WF8A 4R8UA 4PPXA 1TKDA 2K4PA 3I1YA 5L1MA 3T5KA 2EAMA 5KFCA 3FDSA 2FLLA 3Q8QB 2ASJA 5KFHA 5J0UA 3PW5A 4QWEA 1B0XA 2E3TA 4B9SA 4Y2VA 1B22A 5DDYA 2VANA 5L1KA 5DB6A 4UBBA 3PW0A 2P35A 7ICGA 4UB8U 1X2IA 3QU9A 4JUZA 1T3QA 2NV3A 1JXLA 3Q8PB 8ICZA 4IL6U 3IM1A 1ZQIA 4J9RA 2KVCA 4MF8A 4DOCA 5AI6A 4C4SA 4JV0A 2ZXIA 4QZCA 3IV6A 3RRGA 3WKEA 2KFZA 4EEYA 5CRXA 3HKZF 3C5FA 5GTIU 3DV9A 1X9XA 4RPXA 1ZQSA 2MU2A 4M6WB 1S0MA 1ZQ1C 1L7NA 3RB0A 5FP0A 3CW2C 3QX7A 8ICLA 3HRDD 4PZNA 3RRHA 4PGYA 2F8LA 2BQ3A 9ICCA 1KSPA 4FE3A 4M04A 3T3FA 2BPFA 3F2CA 2PMZC 2V4QA 4BUGA 4GC7A 3TANA 3CNHA 1PK3A 3ORYA 5ALFA 1MA7A 4BDPA 4KX5A 2I6XA 4F5RA 3D2SA 2IA6A 5ALZA 5E79U 4MFCA 3KHLA 1AROP 5KAFU 5AKGA 3TQ1A 9ICNA 2ZJAA 4I2JA 4A8EA 4KN4A 3ZI4A 4KLTA 3NASA 3M6KA 4CRXA 4O5EA 5AM1A 2IBKA 1SV0C 2W04A 1RXVA 2F8KA 1XS9D 9ICEA 1DK3A 1WG8A 1X66A 2A1JA 1K5OA 2ZTEA 2FPLA 2C2DA 5J2BA 5AKJA 1Q46A 3PSTA 3ICXA 1J2NA 1Y88A 1ED1A 5KFUA 3OHBA 4P0PA 4DL4A 3SAGA 3BS7A 2Z7JA 4J9QA 1SWWA 3QEBZ 4F4KA 2KICA 5AKHA 1EXNA 4ED7A 4O3MA 1SIJA 2ZIWA 1U49A 1MN8A 4DL5A 3BQ0A 2KJ9A 4DL3A 5KNIA 5AHXA 5KFMA 3NGDA 3KKAC 2NRXA 2BKEA 2KZMA 2HMXA 2HBKA 4F5NA 2FLPA 4Y2UA 4O5KA 2G5HB 2K8CB 3SYZA 2DGZA 5DQGA 3C2KA 3KHGA 5ALGA 4KMUA 5DQHA 2QB0A 4O5CA 3EW9A 3U26A 3SQIA 4UB3A 3RBEA 3K1ZA 3C29A 3BQTA 5KFJA 3PR4A 3EPGA 3PX6A 2MUTA 1TAMA 2A19A 4EX6A 2M0NA 4YXJA 2QLTA 2W3SA 1B4FA 2V9WA 4F4ZA 3FC4A 8ICMA 8ICCA 4R65A 4ECWA 1N5XA 2ESEA 3AQFA 2R8KA 1ZQMA 5AI5A 2JR5A 4E0DA 1DRGA 4DCCA 2JXJA 3MR3A 2JGAA 2KMDA 3QU2A 4FFDA 3SMVA 4YVZA 1X6IA 4NLKA 2ZJ5A 2FDRA 1S77D 2H3IA 3IHQB 4UASA 4TQSA 2LHTA 4EELA 3MFHA 5HR7A 4ECVA 4I29A 3JPQA 3MGHA 1NK8A 4KN7A 3UMGA 4PH5A 2KEYA 2LM1A 1ZQAA 3TFRA 3OTQA 1WCLA 1BGXT 2OHFA 1NI3A 1RM6C 5T14A 1L3VA 1U9LA 4K4GA 5KFVA 2G07A 1UQVA 3F53A 4JMUA 1UT8A 5IIOA 3HW8A 1LVHA 4LVSA 5J29A 4GFJA 4Y2YA 5EWEA 3JPNA 4I2GA 3Q8SB 4DS5A 3AN1A 4DL2A 5J0OA 2YMMA 3LWMA 2VIXA 4DSJA 1ZQYA 1Z1VA 4OJPA 4I2BA 1L8LA 2BDUA 2C2RA 1DGJA 2W7PA 4KLMA 3RTVA 4B9VA 3ZDDA 2O6KA 2LMRA 5J0QA 2F1IA 5C5JA 3VCBA 8ICTA 1D8YA 4YMOA 4MEYA 2ZJ8A 4HYKA 2OCEA 4XA5A 4QZDA 3T5LA 2GLEA 7ICNA 3PX0A 4O9MA 2KHVA 7ICEA 5AI8A 2DFLA 4QZFA 2XVTA 4ED8A 3SI8A 2F44A 1ZQTA 4QZ9A 4Y2SA 3M8RA 1KTQA 5IIKA 1SKWA 4NLCA 2DQNB 4NM1A 4G9BA 3TADA 4ECTA 4YR2A 2JEJA 1SGGA 2MSNA 5KFFA 3NTUA 4Z6CA 3PSPA 3OGUA 3BS5B 4OJ6A 8ICOA 4DQSA 2QARA 4IQUA 4C8MA 4Y2XA 2RP5A 3NVVA 2JEIA 1IM4A 4J9PA 1UHUA 1NJYA 5J8YC 1HUOA 4F5OA 5DB8A 3O0FA 1CI4A 4QIWF 3JPTA 1ZETA 2ATLA 2NYVA 4ECSA 1PVPA 4KLEA 2FMPA 2DBYA 3RH6A 4O3OA 2UVUA 4NXZA 2PFQA 5IINA 1QQ6A 3RAXA 2BR0A 1A76A 2RRDA 3AU6A 5KL1B 4I2IA 4AYBF 3L5KA 1SWVA 4QZHA 5G5HA 3G6VA 3A0BU 1QH9A 1X9SA 5AKEA 4O3RA 4B9NA 3C2LA 5JRTA 1NKCA 2XGPA 3N7SC 4O3NA 4DQRA 2C22A 5KFRA 1JUDA 1WYGA 3QU4A 5EWFA 2AJQA 4DFJA 4BWMA 4YCXA 2HOFA 1Q3VA 4ZOHC 2R8HA 4NLGA 4YD2A 4FZMA 3GIMA 1SZPA 3EUB2 2LPEA 4NWIA 3GZFA 2H3QA 2J6UA 5J2CA 1ZQDA 1ZRNA 5DQIA 3V7JA 4NM2A 2HHXA 2KFNA 1ZQUA 1L7MA 4DWIA 3TAQA 2MA1A 3TI0A 4FBTA 2B6GA 4KLIA 1L3UA 2JRZA 2F77X 4NLBA 1N5WA 3D2NA 5F9LA 5DB9A 1XO1A 2LYBA 1ZQWA 4Q8EA 4PL2A 2W8KA 1RYRA 1D9DA 4UAYA 4MF2A 9ICLA 3ISCA 5AI0A 4USAA 3VC8A 4PZOA 3JPOA 4UQGA 1JI7A 5J2FA 2EH9A 5D49A 2EAOA 2H3FA 5ALRA 4DF8A 2XY5A 4OCZA 4MEXA 1F44A 3RB3A 4AYBC 2DWQA 2E5SA 2HHQA 2A1JB 1KKXA 3TARA 4J9SA 3QE9Y 3F5EA 2W9CB 3KTQA 4TUSA 8ICXA 4RZRA 2W9AA 3V6JA 1NJWA 5DBBA 4RU9A 1X42A 3GDXA 4KLUA 4PJ0U 2OM6A 2JZBB 8ICKA 5GTHU 1N62A 2ZIXA 5KG3A 1LKYB 1JROA 5DLGA 1IG6A 1ECWA 1TVAA 1Q3UA 3H4DA 2ZTDA 2C2EA 5HMMA 2JH7A 2EAPA 1C7YA 1V9PA 4ACOA 1ZQOA 3D2QA 3M9NB 2NO4A 2W11A 3PSFA 2PFPA 1FFVA 5J2GA 3AMZA 4U6PA 3RJKA 5KFQA 2IHNA 3PMNA 3AU2A 3F5AA 3QZ7A 2L5YA 4DQQA 3UQ2A 5J2DA 2ZIUB 4DSFA 1N63A 4C0ZA 7ICFA 3OPXA 4OO1J 4ED1A 3GU3A 5J0PA 2KZZA 3D6JA 9ICUA 4M6WA 4DSIA 4US9A 5DG9A 1NK7A 2K60A 3PZPA 3BS5A 4J9MA 2FMSA 1Z4NA 1M6YA 3MABA 4DS4A 1J2MA 2WB1C 3WK4A 9ICAA 8ICVA 2A1AA 4KLDA 2JV3A 9ICSA 2KN7A 3HILA 2WAQF 2I5HA 2ZUBA 3UM9A 4O3PA 5ALXA 8ICGA 2LYAA 3UMBA 1T3NA 2ODGA 4YQWA 4IQWA 3C21A 2D6FC 3KZIU 5AKIA 5ALTA 2EZXA 3WU2U 5JUMA 1LB2B 3AEVA 4M47A 3QU7A 2YQEA 4PL1A 2BQRA 3HJEA 3ZDBA 2HI0A 3FAHA 2RDJA 8ICHA 3TADC 3A0HU 4F4WA 3H8SA 4PHEA 1HEKA 7ICJA 4TURA 2Y9UA 2LYHA 4UB6U 5K4LA 1KL9A 2ZUDA 3T79A 2XCAA 1SL1A 4MFAA 2HOIA 4ECRA 9ICJA 4I2FA 4C4RA 3ZDAA 3RJEA 2ZIVB 1WUDA 3EZ5A 1XSLA 2BCQA 2DL0A 4J9LA 4B9TA 7ICSA 4FBUA 3RJJA 5KT6A 2NRWA 4BXOB 4JV2A 2BCVA 1KBUA 4I27A 5ALQA 4PHAA 1XWLA 4YP3A 1FEZA 9ICRA 2BDPA 3I28A 5IIIA 1Z19A 5B66U 1ZQPA 4P4MA 3C1ZA 3H8JA 2E8NA 1JXEA 3RJHA 4TUQA 3Q8KA 3H0LB 7ICHA 5ALMA 3SV3A 2FE9A 4MHVA 8ICUA 2R8JA 4RQ5A 3GIIA 2W7OA 5JU5A 4Q8FA 3E2EA 1URJA 1N60A 4RQMA 2J6TA 1UA0A 4ECXA 5AM0A 2R8GA 1PVQA 4I2CA 3L4PA 2G06A 1ZQXA 7ICUA 1BNPA 5DGBA 5KFGA 1TAUA 4F4YA 5TISU 5J2IA 2NRTA 2QB1A 4Y2TA 4YG2A 4IRCA 1KEJA 4P4OA 2UVWA 3ISDA 5J2HA 5KFWA 3V6HA 3CYMA 1O03A 2KP7A 4B9UA 5KFIA 1ZQBA 3UXNA 4O3SA 3I76A 3AM9A 5ALLA 2H5XA 1NK6A 5AM4A 2LBOA 4I2EA 2K4IA 2VA2A 2GOLA 1L6NA 1J97A 4AP9A 2E8OA 1B43A 4FS1A 3GFKB 2AGOA 3QUCA 1ZQFA 2PI5A 2JZBA 3WK7A 1WCNA 4QZIA 4P2HA 5ALIA 1RDFA 3NRWA 2JMGA 4BWJA 3UMCA 4ELVA 4NLNA 3ETRA 2PXIA 4WJ3B 3MR2A 4XRHA 4QNLA 4DSKA 3E0FA 3PNCA 5HP4A 4B9LA 9ICPA 1OW5A 5J2KA 4M9NA 2Y0SF 3RR7A 2EQYA 1T94A 5KFTA 5KFSA 1NJZA 3HKZC 3C5GA 2LKYA 5EWGA 2D3DA 2XICA 5KG1A 3ISBA 3V7LA 2BCRA 7ICOA 2CN1A 3GIKA 1XNSA 2HVHA 1MQ2A 3TKAA 4RPZA 3WK5A 1ZQCA 1BPXA 1D8LA 5J0YA 5AM5A 3KHHA 4QZ8A 2JH1A 7ICVA 3B9JA 3PW2A 1X6JA 4ZH4A 2GO7A 4DLEA 2BZFA 1KFTA 1Z00A 2ISPA 3QYPA 3FYHA 5F3XB 1V38A 2AHOB 2R18A 5G5GA 3ALRA 4IRDA 5AK4A 3Q8MA 3OSPA 2EZZA 1PVRA 3RH5A 2ZXHA 1HIWA 4YR3A 3QXGA 2F3NA 1PK1B 2NRZA 2Y1IA 4GIBA 9ICKA 8ICJA 3L3FX 4RQ8A 2Y0SC 4UB2A 1DK2A 4IQVA 3N97B 5KFPA 5L9XA 4CGZA 1ZD3A 4RT2A 3GILA 1N56A 1BVSA 4KLLA 4BXOA 1RQLA 4CNQA 5J0RA 4ED6A 1PZNA 3BDPA 2LI6A 1XSNA 4FS2A 5HHHA 1ZOLA 4J9KA 4F93B 5TZVA 2BGWA 4QWAA 1JX4A 3RBDA 3GV5B 4JB3A 1PUZA 2Q0ZX 4X5VA 3ZDEA 3HP6A 4ED3A 3PX4A 5AM3A 2ZIWB 4CF5A 3TAPA 2HHSA 1IV8A 3OHAA 4UB1A 1ZJMA 1L7PA 2QARB 2ISOA 5DDMA 4F50A 1TFRA 5EOZA 4F91B 1VDVA 2VA8A 4ECQA 1CUKA 3RAQA 5DBCA 4IR9A 3SAFA 4RQ0A 1XC9A 2K8AA 1FO4A 5AI9A 1ZJNA 2KZ3A 4JK1A 2WF6A 3V6KA 2KJ8A 4OJLA 2KKPA 7ICRA 4BJQA 1YT3A 2RLTA 4QJFB 2RQ5A 4I28A 1NKEA 2W9BB 1SXEA 5CP2A 5EE0A 5L1LA 3QU5A 2YB4A 1COKA 9ICVA 2F1JA 4QIWC 1QTMA 1U48A 1S5LU 3PW4A 4Q43A 3G6YA 2XY7A 4UAWA 1V85A 4R66A 1ZQNA 4EX7A 2CRXA 4M2YA 9ICGA 5KT5A 3TFSA 4RQ1A 2P66A 2XCPA 1ZQJA 2EDUA 5H2FU 1ZQGA 1RYUA 1JRPA 3HX0A 4DFDA 1YZ7A 4RQ4A 1C20A 4QZEA 3H7IA 1S97A 2HBMA 4QW8A 4I2HA 1QLNA 2KG5A 3BZCA 1KFDA 8ICBA 4KLGA 1KQQA 4KTQA 2VKQA 3N4MB 3BJYA 4M9JA 2WF5A 1ZYQA 3PR5B 4NV0A 3M1YA 4C80A 1ZQRA 2HSZA 5KT3A 2HVIA 5F9NA 1N48A 1ZXIA 9ICFA 4DFKA 2KSOB 2HDOA 1L8OA 4CE6A 4CF4A 5KFXA 1LKYA 2G5IB 3UPQA 3SV4A 4NJ8A 4KLFA 4PGXA 1N2XA 4ECUA 5BOMA 2E8MA 2G08A 2BPCA 2PFOA 1Z1BA 4F8RA 4M9HA 3OSNA 4J9NA 8ICSA 3KFUF 1K1SA 2W8LA 3MBYA 4P4PA 2K4HA 4QWCA 4EBEA 2KJ5A 2JEGA 4DSLA 4BGDA 3KHRA 5EE1A 2F2AB 1S0OA 8ICAA 2VJ4A 2K4EA 3WKAA 4RQ7A 4EZ6A 5DGAA 1T4GA 3IG5A 1OXJA 3PW7A 3JPRA 4I2AA 8ICQA 1D8BA 9ICBA 1X9MA 3C23A 2XO7A 2B0CA 9ICOA 5AKZA 3LWLA 5L1JA 3AL0B 4IC9A 1BPZA 1ZQEA 2KD1A 5B5EU 1O08A 3V7KA 3H0RB 1RPLA 4YFKA 4C8KA 3B0XA 4YD1A 4IR1A 2MAXA 2DUYA 3PMLA 3MGIA 2DKZA 2QKQA 4RQ2A 3NVYA 4M0AA 4PHPA 4YN4A 3RR8A 1KLNA 1Q8KA 1S0NA 2RDIA 2MRLA 2MUTB 3UXPA 4QWBA 4Y2QA 3S6JA 1TK5A 4ELTA 4YMNA 4UATA 4UARA 3M6ZA 4P0QA 2N1RA 4QZGA 2YX8A 5ALKA 5AKXA 5ALEA 3HT3A 5A0LA 5KFLA 5KFDA 4DOAA 4NL9C 2VA3A 3DDHA 7ICQA 2WHEA 1ZD4A 3QNMA 1SKSA 3TACB 1JMSA 4PHDA 1SB3C 3RB4A 1JALA 3HWTA 3NRZA 2NRVA 4OJ5A 2LM4A 3MC1A 2HOQA 1A0PA 1RXWA 4C7YA 2IOFK 3H4BA 2ZTCA 8ICIA 2P6UA 5AKYA 3KD3A 3F2DA 1BPYA 4I2DA 4KLJA 5J0SA 9ICXA 1ZQQA 2E8PA 2Y9TA 2XIDA 2WAQC 4GXJA 4RNMA 4B6JA 4Z6FA 2KNJA 2AU0A 1UPHA 4DOBA 3K4GA 3EYZA 2OXOA 2YMPA 2W43A 3UXOA 2CXYA 4P0PB 2YN4A 5KFEA 2KHQA 8ICWA 1DOQA 2ZIXB 3BQ2A 3MGVA 3RH4A 5AK6A 5KG7A 4Y2RA 4Z6EA 3WK8A 2M9NA 5KFKA 2FPMA 4KX3A 4YXMA 4J03A 3WKBA 4QWDA 1ZRMA 2F1HA 2ALZA 4ICAA 3NUQA 1A6SA 2W55A 1TE2A 1IXRA 5ALOA 4EBCA 4F5QA 3RF9A 4GXIA 2J6SA 2P6RA 3MFIA 1FFUA 1L3TA 4Y2PA 3F2BA 1IIPA 1T8EA 5AIAA 5J0TA 5ALYA 2AQ4A 2HW3A 3SD7A 4O0IA 3OJSA 3SEIA 8ICEA 2PMZF 3H8WA 3KKAA 1DXSA 2H3ZA 3MDCA 4MFFA 1NKBA 1HUZA 4DFPA 4DSEA 3LK9A 2V4RA 5AKLA 4IS7A 3N7RC 1NZBA 3IG8A 1SKRA 5DG8A 1JIHA 3BZKA 2DKXA 2HHVA 3SR6A 2PKEA 2AXTU 2KIVA 4OD0A 5KG5A 4QZBA 2AGPA 7ICKA 4NLZA 2H3VA 5DG7A 1S76D 5HMLA 1MSWD 3T5JA 4P0QB 3QUBA 1RZTA 5EE9A 2EANA 2FLNA 1U47A 1NZPA 4DO9A 2ZUCA 5BPCA 3RJFA 1ZD2P 2GH1A 4R64A 4NL9A 1OUQA 4KMOB 2B21A 5HHIA 3E58A 8ICFA 1P7DA 2XI9A 2WFAA 3WK6A 4UAZA 2HBJA 3K75D 5KFOA 3WKDA 4Y2JA 4JV1A 2KKVA 4IQTA 4CF3A 3V72A 2ZIVA 2GWSA 2W9BA 4F4XA 2CPRA 5KT7A 3M9MB 3PO4A 1NK5A 1GO3F 5KG6A 1ZQHA 5J2EA 5AIBA 1KDHA 3ED5A 3Q8RB 5AK3A 2DPJA 4F3OA 2XGQA 3AQEA 3PV8A 3PY8A 4C4TA 4IRKA 2KIWA 2XY6A 7ICTA 2KSOA 4RQ3A 4UB5A 3ZD9A 2E1EA 4ECYA 3JPPA 1S9FA 5J0WA 1QSLA 2IOFA 4DF4A 1SL2A 4Q44A 1SZHA 4C7ZA 5ALWA 3M7DA 5EE3A 2F76X 1K1QA 3C2MA 1T7PA 5AKKA 4US8A 4XUSA 1TV9A 1YZ6A 1H38A 2K89A 4U7CA 3KOOA 3GIJA 2C28A 4LZGA 4R63A 1TAQA 4F92B 2AH5A 5HR6A 5J8YA 2QB0B 4RT3A 1TK8A 2W3RA 5JTIA 4TQRA 1NK4A 2R8IA 4KLQA 2Q4TA 4M9LA 4Q45A 2HCFA 1ZQLA 1HJPA 4DLGA 2K8BB 3GV8B 1VJ5A 2WF9A 4HAIA 1KFSA 4FZNA 4UAVA 3FM9A 3LDAA 4LZDA 4RQNA 2EZYA 1S10A 4C8OA 3PO5A 4C8LA 2AGQA 2PI4A 1L5UA 3SAHA 2IHMA 2KV2A 2ASDA 2ASLA 4B9MA 2BQUA 4CDGA 3QEAZ 4K4HA 3GV7B 4JWNA 1DGSA 4RNOA 3THVA 2HHTA 9ICTA 5KG0A 4YR0A 5CA7A 4PGQA 1U45A 1SL0A 1CRXA 8ICYA 5CB1A 5IILA 5IIMA 2I9GA 3HPOA 9ICMA 3R9KA 4UB4A 2Y1JA 3NS1A 2W03A 1QSYA 2ZIUA 3B0YA 2KOBA 4RQ6A 4K4IA 3IN5A 3H40A 3PVXA 3IP4B 3QUQA 2JHDA 5KG2A 3KBBA 4DFMA 4XQ8A 1S0VA 2VJ5A 3SZ2A 4RUCA 9ICIA 9ICHA 4GXKA 1KRPA 4EYHB 2OWOA 2YB1A 1UT5A 5KL8B 4ELUA 4EENA 3PSIA 4UBCA 5ALUA 2YY6A 1CEZA 2G09A 7ICIA 5AK5A 2W54A 5C0YA 2HHWA 3LYSA 3SENA 2FMQA 1TK0A 3EWAA 3WKCA 5DB7A 5J0XA 1COOA 3C28A 9ICWA 5AM2A 4GC6A 5DKWA 1NOMA 2I1QA 3M9OB 1D9FA 2OEHA 1NK9A 5ALPA 1PK1A 3NVWA 2YMQA 2YTUA 2BHNA 4O3QA 2BPGA 3G6XA 4UAUA 1JN3A 1SV0A 5D4BA 2ES6A 3BQ1A 1QSSA 3OJUA 2KVSA 1QQ5A 2PFNA 8ICNA 5KG4A 3CRXA 1S8OA 4QW9A 4LJXA 4RPYA 2DPIA 2RHFA 4RUAA 4BX9C 5ALJA 4KLOA 1VLBA 4NY8A 5DBAA 4F5PA 1NJXA 1BPBA 1X9WA 4F71A 2HHUA 1ZQVA 1F5SA 1AQ6A 3T5HA 3JPSA 5KT2A 2FJ6A 2WB1F 1Z3EB 5KFAA 1BNOA 4FO6A 1UCVA 5KFZA 1A77A 1ZQZA 4DQPA 5ALSA 1KN5A 2W9MA 5CEHA 2A3VA 1L7OA 3ETLA 3RFAA 5J2AA 1LV5A 8ICPA 2G0AA 1U4BA 4G3IA 4KLHA 3NVZA 1MQ3A 4R8UB 4JWMA 2D8CA 2AQ0A 5ALVA 2XC9A 3ZDCA 3WK9A 1XO0A 1QQ7A 4RNNA 1WWVA 2E1FA 5AI4A 2FPKA 1ZQKA 3RJIA 1BPDA 5D46A 3C1YA 5CWRA 4KITB 1FIQA 5IIJA 7ICPA 4Z6DA 4F72A 3UQ0A 5KAIU 1SV4A 4DEZA 5KFNA 3MR6A 2HBLA 4DL7A 1X40A 3BQ7A 3AUOA 1F0MA 2WTFA 3CP8A 3N28A 5KT4A 3EPIA 1RG6A 1NNLA 3RB6A 3IDWA 3QUTA 3IRUA 4EEKA 4ED0A 4DQIA 2OH2A 5CJ7A 1XU4A 3ONNA 5AICA 3H0MB 2YMLA 3RJGA 5KFBA 2KK0A 5CHGA 1Z4OA 3K1RB 2FI1A 2UVVA 3LVVA 2JEFA 7ICLA 2UVRA 4FZLA 2ZG6A 1Z00B 4GLXA 1WWUA 2OYYA 4DL6A 4EYIB 3Q8LA 1QCKA 3ZD8A 8ICRA 2KTQA 1KW4A 2NO5A 5ALHA 7ICMA 9ICQA 1UA1A 4EZ9A 3GQCA 3QZ8A 4ED2A 3M8SA 5J2JA 1MC8A 5L1IA 1RYSA 2IMWP 5KFYA 3H8MA 5DLFA 5HNKA 2DF4B 4OJOA 3DEEA 4UW9A 3LVWA 2BCUA 1V97A 5KTQA 4ECZA 2IOHA 4C8NA 2WF7A 4M9GA 2BCSA 1N61A 1SXDA 5BOLA 4YMMA
chains in the Genus database with same CATH topology
2KNJA 2E1FA 5C0YA 1UPHA 3LYSA 2H3VA 2BDUA 2OM6A 5HR6A 3F2CA 2PMZC 1D8BA 4BUGA 2W7PA 5KL1B 2YB4A 2ZIXA 4P0QB 2OXOA 1HEKA 3SQIA 3N7SC 3KZXA 2LBOA 3N7PD 3C28A 2K4IA 3K1ZA 1MA7A 4P0PB 3L3FX 4QIWC 3C29A 1ECWA 2GOLA 2Q4TA 4IC9A 2KHQA 2Y0SC 4KX5A 3VCBA 3AL0B 1Q3UA 3D2SA 1L6NA 2KD1A 2JH7A 2K8BB 1TAMA 4ACOA 2ZIXB 3T79A 2HBLA 2GH1A 2HOFA 3MGVA 4CGZA 1Q3VA 3H0RB 2M0NA 2CRXA 3D2QA 1OUQA 4KMOB 4FZNA 4FZMA 3PSFA 2HOIA 1P7DA 3CP8A 2KHVA 4U6PA 2XI9A 4A8EA 4NWIA 2ZIVB 1WUDA 3F5AA 3GZFA 2H3QA 3NRWA 2XVTA 3AQFA 2JMGA 3M6KA 4CRXA 4KX3A 2HBJA 2ZIUB 2OH2A 1DRGA 2HBMA 4WJ3B 2W04A 2KKVA 4C0ZA 2JGAA 3SAHA 3ONNA 3OPXA 4QNLA 3CRXA 2KV2A 4ICAA 4OO1J 3NUQA 2ZIVA 3SMVA 3GU3A 1KBUA 3E0FA 2VKQA 3H0MB 1A6SA 2MA1A 2CPRA 2RHFA 4CDGA 2MRLA 4BX9C 1GO3F 4NLCA 2Y0SF 3PZPA 2DQNB 4NV0A 1T94A 3RF9A 1Z19A 2H3IA 2NV3A 2F77X 3LVVA 2WB1C 2ZIWB 4NLBA 4FZLA 3D2NA 1CRXA 3M6ZA 3HKZC 4P0QA 2LKYA 2ZG6A 3AQEA 3PSTA 3ICXA 2LYBA 2N1RA 3H0LB 4AYBF 2KVCA 2LHTA 3PSPA 3F2BA 1IIPA 2YX8A 1ED1A 4P0PA 2OYYA 4OJ6A 4PL2A 2XICA 2W03A 3SAGA 2WAQF 2G5IB 5HR7A 5A0LA 2CN1A 2ZIUA 2Z7JA 2RP5A 1XNSA 2KIWA 2KOBA 3VC8A 2W7OA 2ZXIA 3IN5A 1URJA 2WB1F 2KICA 2PMZF 3IP4B 2E1EA 4O3MA 2G08A 5CRXA 3HKZF 2LYAA 2H3ZA 2KEYA 2ZIWA 3O0FA 3SAFA 1PVQA 2K8AA 1Z1BA 2JH1A 2H3FA 2A3VA 2G06A 4OJ5A 4QIWF 2JHDA 2KJ9A 2HOQA 5T14A 3KFUF 1A0PA 1F44A 2D6FC 3RFAA 1PVPA 2VJ5A 2K4HA 2G07A 3N7RC 2KJ5A 3F53A 4JMUA 1ZQ1C 4AYBC 2G0AA 1NZBA 2HMXA 1SZHA 2E5SA 2DF4B 3M7DA 4OJOA 3DEEA 3IG8A 2F76X 2HBKA 3LVWA 2YB1A 2F2AB 5KL8B 4GFJA 3F2DA 2G5HB 2VJ4A 2K4EA 2KJ8A 2K8CB 2KKPA 3PSIA 4OJLA 2F8LA 4PL1A 4BJQA 2DGZA 1YT3A 2R18A 3F5EA 3ALRA 4QJFB 2XIDA 2K89A 3CYMA 2VIXA 1XO0A 3IG5A 4FE3A 2WAQC 2RRDA 2G09A 1PVRA 4OJPA 4U7CA 2ZXHA 1HIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  3AL0 B;  2G5I B;  3IP4 B;  4WJ3 B;  1ZQ1 C;  3H0L B;  2G5H B;  3H0R B;  3KFU F;  2DF4 B;  2D6F C;  2DQN B;  3H0M B; 
#chains in the Genus database with same CATH topology
 4KLS A;  5CR0 A;  4TUP A;  1NK0 A;  1XSP A;  2W9C A;  4F2S A;  1BPE A;  3KZX A;  1RQN A;  3N7P D;  3MR5 A;  5ALN A;  3MDA A;  4CCH A;  5ALD A;  4J9O A;  1L3S A;  1ZD5 A;  2KE7 A;  4F2R A;  3J81 j;  4EBD A;  4QZA A;  2WF8 A;  4R8U A;  4PPX A;  1TKD A;  2K4P A;  3I1Y A;  5L1M A;  3T5K A;  2EAM A;  5KFC A;  3FDS A;  2FLL A;  3Q8Q B;  2ASJ A;  5KFH A;  5J0U A;  3PW5 A;  4QWE A;  1B0X A;  2E3T A;  4B9S A;  4Y2V A;  1B22 A;  5DDY A;  2VAN A;  5L1K A;  5DB6 A;  4UBB A;  3PW0 A;  2P35 A;  7ICG A;  4UB8 U;  1X2I A;  3QU9 A;  4JUZ A;  1T3Q A;  2NV3 A;  1JXL A;  3Q8P B;  8ICZ A;  4IL6 U;  3IM1 A;  1ZQI A;  4J9R A;  2KVC A;  4MF8 A;  4DOC A;  5AI6 A;  4C4S A;  4JV0 A;  2ZXI A;  4QZC A;  3IV6 A;  3RRG A;  3WKE A;  2KFZ A;  4EEY A;  5CRX A;  3HKZ F;  3C5F A;  5GTI U;  3DV9 A;  1X9X A;  4RPX A;  1ZQS A;  2MU2 A;  4M6W B;  1S0M A;  1ZQ1 C;  1L7N A;  3RB0 A;  5FP0 A;  3CW2 C;  3QX7 A;  8ICL A;  3HRD D;  4PZN A;  3RRH A;  4PGY A;  2F8L A;  2BQ3 A;  9ICC A;  1KSP A;  4FE3 A;  4M04 A;  3T3F A;  2BPF A;  3F2C A;  2PMZ C;  2V4Q A;  4BUG A;  4GC7 A;  3TAN A;  3CNH A;  1PK3 A;  3ORY A;  5ALF A;  1MA7 A;  4BDP A;  4KX5 A;  2I6X A;  4F5R A;  3D2S A;  2IA6 A;  5ALZ A;  5E79 U;  4MFC A;  3KHL A;  1ARO P;  5KAF U;  5AKG A;  3TQ1 A;  9ICN A;  2ZJA A;  4I2J A;  4A8E A;  4KN4 A;  3ZI4 A;  4KLT A;  3NAS A;  3M6K A;  4CRX A;  4O5E A;  5AM1 A;  2IBK A;  1SV0 C;  2W04 A;  1RXV A;  2F8K A;  1XS9 D;  9ICE A;  1DK3 A;  1WG8 A;  1X66 A;  2A1J A;  1K5O A;  2ZTE A;  2FPL A;  2C2D A;  5J2B A;  5AKJ A;  1Q46 A;  3PST A;  3ICX A;  1J2N A;  1Y88 A;  1ED1 A;  5KFU A;  3OHB A;  4P0P A;  4DL4 A;  3SAG A;  3BS7 A;  2Z7J A;  4J9Q A;  1SWW A;  3QEB Z;  4F4K A;  2KIC A;  5AKH A;  1EXN A;  4ED7 A;  4O3M A;  1SIJ A;  2ZIW A;  1U49 A;  1MN8 A;  4DL5 A;  3BQ0 A;  2KJ9 A;  4DL3 A;  5KNI A;  5AHX A;  5KFM A;  3NGD A;  3KKA C;  2NRX A;  2BKE A;  2KZM A;  2HMX A;  2HBK A;  4F5N A;  2FLP A;  4Y2U A;  4O5K A;  2G5H B;  2K8C B;  3SYZ A;  2DGZ A;  5DQG A;  3C2K A;  3KHG A;  5ALG A;  4KMU A;  5DQH A;  2QB0 A;  4O5C A;  3EW9 A;  3U26 A;  3SQI A;  4UB3 A;  3RBE A;  3K1Z A;  3C29 A;  3BQT A;  5KFJ A;  3PR4 A;  3EPG A;  3PX6 A;  2MUT A;  1TAM A;  2A19 A;  4EX6 A;  2M0N A;  4YXJ A;  2QLT A;  2W3S A;  1B4F A;  2V9W A;  4F4Z A;  3FC4 A;  8ICM A;  8ICC A;  4R65 A;  4ECW A;  1N5X A;  2ESE A;  3AQF A;  2R8K A;  1ZQM A;  5AI5 A;  2JR5 A;  4E0D A;  1DRG A;  4DCC A;  2JXJ A;  3MR3 A;  2JGA A;  2KMD A;  3QU2 A;  4FFD A;  3SMV A;  4YVZ A;  1X6I A;  4NLK A;  2ZJ5 A;  2FDR A;  1S77 D;  2H3I A;  3IHQ B;  4UAS A;  4TQS A;  2LHT A;  4EEL A;  3MFH A;  5HR7 A;  4ECV A;  4I29 A;  3JPQ A;  3MGH A;  1NK8 A;  4KN7 A;  3UMG A;  4PH5 A;  2KEY A;  2LM1 A;  1ZQA A;  3TFR A;  3OTQ A;  1WCL A;  1BGX T;  2OHF A;  1NI3 A;  1RM6 C;  5T14 A;  1L3V A;  1U9L A;  4K4G A;  5KFV A;  2G07 A;  1UQV A;  3F53 A;  4JMU A;  1UT8 A;  5IIO A;  3HW8 A;  1LVH A;  4LVS A;  5J29 A;  4GFJ A;  4Y2Y A;  5EWE A;  3JPN A;  4I2G A;  3Q8S B;  4DS5 A;  3AN1 A;  4DL2 A;  5J0O A;  2YMM A;  3LWM A;  2VIX A;  4DSJ A;  1ZQY A;  1Z1V A;  4OJP A;  4I2B A;  1L8L A;  2BDU A;  2C2R A;  1DGJ A;  2W7P A;  4KLM A;  3RTV A;  4B9V A;  3ZDD A;  2O6K A;  2LMR A;  5J0Q A;  2F1I A;  5C5J A;  3VCB A;  8ICT A;  1D8Y A;  4YMO A;  4MEY A;  2ZJ8 A;  4HYK A;  2OCE A;  4XA5 A;  4QZD A;  3T5L A;  2GLE A;  7ICN A;  3PX0 A;  4O9M A;  2KHV A;  7ICE A;  5AI8 A;  2DFL A;  4QZF A;  2XVT A;  4ED8 A;  3SI8 A;  2F44 A;  1ZQT A;  4QZ9 A;  4Y2S A;  3M8R A;  1KTQ A;  5IIK A;  1SKW A;  4NLC A;  2DQN B;  4NM1 A;  4G9B A;  3TAD A;  4ECT A;  4YR2 A;  2JEJ A;  1SGG A;  2MSN A;  5KFF A;  3NTU A;  4Z6C A;  3PSP A;  3OGU A;  3BS5 B;  4OJ6 A;  8ICO A;  4DQS A;  2QAR A;  4IQU A;  4C8M A;  4Y2X A;  2RP5 A;  3NVV A;  2JEI A;  1IM4 A;  4J9P A;  1UHU A;  1NJY A;  5J8Y C;  1HUO A;  4F5O A;  5DB8 A;  3O0F A;  1CI4 A;  4QIW F;  3JPT A;  1ZET A;  2ATL A;  2NYV A;  4ECS A;  1PVP A;  4KLE A;  2FMP A;  2DBY A;  3RH6 A;  4O3O A;  2UVU A;  4NXZ A;  2PFQ A;  5IIN A;  1QQ6 A;  3RAX A;  2BR0 A;  1A76 A;  2RRD A;  3AU6 A;  5KL1 B;  4I2I A;  4AYB F;  3L5K A;  1SWV A;  4QZH A;  5G5H A;  3G6V A;  3A0B U;  1QH9 A;  1X9S A;  5AKE A;  4O3R A;  4B9N A;  3C2L A;  5JRT A;  1NKC A;  2XGP A;  3N7S C;  4O3N A;  4DQR A;  2C22 A;  5KFR A;  1JUD A;  1WYG A;  3QU4 A;  5EWF A;  2AJQ A;  4DFJ A;  4BWM A;  4YCX A;  2HOF A;  1Q3V A;  4ZOH C;  2R8H A;  4NLG A;  4YD2 A;  4FZM A;  3GIM A;  1SZP A;  3EUB 2;  2LPE A;  4NWI A;  3GZF A;  2H3Q A;  2J6U A;  5J2C A;  1ZQD A;  1ZRN A;  5DQI A;  3V7J A;  4NM2 A;  2HHX A;  2KFN A;  1ZQU A;  1L7M A;  4DWI A;  3TAQ A;  2MA1 A;  3TI0 A;  4FBT A;  2B6G A;  4KLI A;  1L3U A;  2JRZ A;  2F77 X;  4NLB A;  1N5W A;  3D2N A;  5F9L A;  5DB9 A;  1XO1 A;  2LYB A;  1ZQW A;  4Q8E A;  4PL2 A;  2W8K A;  1RYR A;  1D9D A;  4UAY A;  4MF2 A;  9ICL A;  3ISC A;  5AI0 A;  4USA A;  3VC8 A;  4PZO A;  3JPO A;  4UQG A;  1JI7 A;  5J2F A;  2EH9 A;  5D49 A;  2EAO A;  2H3F A;  5ALR A;  4DF8 A;  2XY5 A;  4OCZ A;  4MEX A;  1F44 A;  3RB3 A;  4AYB C;  2DWQ A;  2E5S A;  2HHQ A;  2A1J B;  1KKX A;  3TAR A;  4J9S A;  3QE9 Y;  3F5E A;  2W9C B;  3KTQ A;  4TUS A;  8ICX A;  4RZR A;  2W9A A;  3V6J A;  1NJW A;  5DBB A;  4RU9 A;  1X42 A;  3GDX A;  4KLU A;  4PJ0 U;  2OM6 A;  2JZB B;  8ICK A;  5GTH U;  1N62 A;  2ZIX A;  5KG3 A;  1LKY B;  1JRO A;  5DLG A;  1IG6 A;  1ECW A;  1TVA A;  1Q3U A;  3H4D A;  2ZTD A;  2C2E A;  5HMM A;  2JH7 A;  2EAP A;  1C7Y A;  1V9P A;  4ACO A;  1ZQO A;  3D2Q A;  3M9N B;  2NO4 A;  2W11 A;  3PSF A;  2PFP A;  1FFV A;  5J2G A;  3AMZ A;  4U6P A;  3RJK A;  5KFQ A;  2IHN A;  3PMN A;  3AU2 A;  3F5A A;  3QZ7 A;  2L5Y A;  4DQQ A;  3UQ2 A;  5J2D A;  2ZIU B;  4DSF A;  1N63 A;  4C0Z A;  7ICF A;  3OPX A;  4OO1 J;  4ED1 A;  3GU3 A;  5J0P A;  2KZZ A;  3D6J A;  9ICU A;  4M6W A;  4DSI A;  4US9 A;  5DG9 A;  1NK7 A;  2K60 A;  3PZP A;  3BS5 A;  4J9M A;  2FMS A;  1Z4N A;  1M6Y A;  3MAB A;  4DS4 A;  1J2M A;  2WB1 C;  3WK4 A;  9ICA A;  8ICV A;  2A1A A;  4KLD A;  2JV3 A;  9ICS A;  2KN7 A;  3HIL A;  2WAQ F;  2I5H A;  2ZUB A;  3UM9 A;  4O3P A;  5ALX A;  8ICG A;  2LYA A;  3UMB A;  1T3N A;  2ODG A;  4YQW A;  4IQW A;  3C21 A;  2D6F C;  3KZI U;  5AKI A;  5ALT A;  2EZX A;  3WU2 U;  5JUM A;  1LB2 B;  3AEV A;  4M47 A;  3QU7 A;  2YQE A;  4PL1 A;  2BQR A;  3HJE A;  3ZDB A;  2HI0 A;  3FAH A;  2RDJ A;  8ICH A;  3TAD C;  3A0H U;  4F4W A;  3H8S A;  4PHE A;  1HEK A;  7ICJ A;  4TUR A;  2Y9U A;  2LYH A;  4UB6 U;  5K4L A;  1KL9 A;  2ZUD A;  3T79 A;  2XCA A;  1SL1 A;  4MFA A;  2HOI A;  4ECR A;  9ICJ A;  4I2F A;  4C4R A;  3ZDA A;  3RJE A;  2ZIV B;  1WUD A;  3EZ5 A;  1XSL A;  2BCQ A;  2DL0 A;  4J9L A;  4B9T A;  7ICS A;  4FBU A;  3RJJ A;  5KT6 A;  2NRW A;  4BXO B;  4JV2 A;  2BCV A;  1KBU A;  4I27 A;  5ALQ A;  4PHA A;  1XWL A;  4YP3 A;  1FEZ A;  9ICR A;  2BDP A;  3I28 A;  5III A;  1Z19 A;  5B66 U;  1ZQP A;  4P4M A;  3C1Z A;  3H8J A;  2E8N A;  1JXE A;  3RJH A;  4TUQ A;  3Q8K A;  3H0L B;  7ICH A;  5ALM A;  3SV3 A;  2FE9 A;  4MHV A;  8ICU A;  2R8J A;  4RQ5 A;  3GII A;  2W7O A;  5JU5 A;  4Q8F A;  3E2E A;  1URJ A;  1N60 A;  4RQM A;  2J6T A;  1UA0 A;  4ECX A;  5AM0 A;  2R8G A;  1PVQ A;  4I2C A;  3L4P A;  2G06 A;  1ZQX A;  7ICU A;  1BNP A;  5DGB A;  5KFG A;  1TAU A;  4F4Y A;  5TIS U;  5J2I A;  2NRT A;  2QB1 A;  4Y2T A;  4YG2 A;  4IRC A;  1KEJ A;  4P4O A;  2UVW A;  3ISD A;  5J2H A;  5KFW A;  3V6H A;  3CYM A;  1O03 A;  2KP7 A;  4B9U A;  5KFI A;  1ZQB A;  3UXN A;  4O3S A;  3I76 A;  3AM9 A;  5ALL A;  2H5X A;  1NK6 A;  5AM4 A;  2LBO A;  4I2E A;  2K4I A;  2VA2 A;  2GOL A;  1L6N A;  1J97 A;  4AP9 A;  2E8O A;  1B43 A;  4FS1 A;  3GFK B;  2AGO A;  3QUC A;  1ZQF A;  2PI5 A;  2JZB A;  3WK7 A;  1WCN A;  4QZI A;  4P2H A;  5ALI A;  1RDF A;  3NRW A;  2JMG A;  4BWJ A;  3UMC A;  4ELV A;  4NLN A;  3ETR A;  2PXI A;  4WJ3 B;  3MR2 A;  4XRH A;  4QNL A;  4DSK A;  3E0F A;  3PNC A;  5HP4 A;  4B9L A;  9ICP A;  1OW5 A;  5J2K A;  4M9N A;  2Y0S F;  3RR7 A;  2EQY A;  1T94 A;  5KFT A;  5KFS A;  1NJZ A;  3HKZ C;  3C5G A;  2LKY A;  5EWG A;  2D3D A;  2XIC A;  5KG1 A;  3ISB A;  3V7L A;  2BCR A;  7ICO A;  2CN1 A;  3GIK A;  1XNS A;  2HVH A;  1MQ2 A;  3TKA A;  4RPZ A;  3WK5 A;  1ZQC A;  1BPX A;  1D8L A;  5J0Y A;  5AM5 A;  3KHH A;  4QZ8 A;  2JH1 A;  7ICV A;  3B9J A;  3PW2 A;  1X6J A;  4ZH4 A;  2GO7 A;  4DLE A;  2BZF A;  1KFT A;  1Z00 A;  2ISP A;  3QYP A;  3FYH A;  5F3X B;  1V38 A;  2AHO B;  2R18 A;  5G5G A;  3ALR A;  4IRD A;  5AK4 A;  3Q8M A;  3OSP A;  2EZZ A;  1PVR A;  3RH5 A;  2ZXH A;  1HIW A;  4YR3 A;  3QXG A;  2F3N A;  1PK1 B;  2NRZ A;  2Y1I A;  4GIB A;  9ICK A;  8ICJ A;  3L3F X;  4RQ8 A;  2Y0S C;  4UB2 A;  1DK2 A;  4IQV A;  3N97 B;  5KFP A;  5L9X A;  4CGZ A;  1ZD3 A;  4RT2 A;  3GIL A;  1N56 A;  1BVS A;  4KLL A;  4BXO A;  1RQL A;  4CNQ A;  5J0R A;  4ED6 A;  1PZN A;  3BDP A;  2LI6 A;  1XSN A;  4FS2 A;  5HHH A;  1ZOL A;  4J9K A;  4F93 B;  5TZV A;  2BGW A;  4QWA A;  1JX4 A;  3RBD A;  3GV5 B;  4JB3 A;  1PUZ A;  2Q0Z X;  4X5V A;  3ZDE A;  3HP6 A;  4ED3 A;  3PX4 A;  5AM3 A;  2ZIW B;  4CF5 A;  3TAP A;  2HHS A;  1IV8 A;  3OHA A;  4UB1 A;  1ZJM A;  1L7P A;  2QAR B;  2ISO A;  5DDM A;  4F50 A;  1TFR A;  5EOZ A;  4F91 B;  1VDV A;  2VA8 A;  4ECQ A;  1CUK A;  3RAQ A;  5DBC A;  4IR9 A;  3SAF A;  4RQ0 A;  1XC9 A;  2K8A A;  1FO4 A;  5AI9 A;  1ZJN A;  2KZ3 A;  4JK1 A;  2WF6 A;  3V6K A;  2KJ8 A;  4OJL A;  2KKP A;  7ICR A;  4BJQ A;  1YT3 A;  2RLT A;  4QJF B;  2RQ5 A;  4I28 A;  1NKE A;  2W9B B;  1SXE A;  5CP2 A;  5EE0 A;  5L1L A;  3QU5 A;  2YB4 A;  1COK A;  9ICV A;  2F1J A;  4QIW C;  1QTM A;  1U48 A;  1S5L U;  3PW4 A;  4Q43 A;  3G6Y A;  2XY7 A;  4UAW A;  1V85 A;  4R66 A;  1ZQN A;  4EX7 A;  2CRX A;  4M2Y A;  9ICG A;  5KT5 A;  3TFS A;  4RQ1 A;  2P66 A;  2XCP A;  1ZQJ A;  2EDU A;  5H2F U;  1ZQG A;  1RYU A;  1JRP A;  3HX0 A;  4DFD A;  1YZ7 A;  4RQ4 A;  1C20 A;  4QZE A;  3H7I A;  1S97 A;  2HBM A;  4QW8 A;  4I2H A;  1QLN A;  2KG5 A;  3BZC A;  1KFD A;  8ICB A;  4KLG A;  1KQQ A;  4KTQ A;  2VKQ A;  3N4M B;  3BJY A;  4M9J A;  2WF5 A;  1ZYQ A;  3PR5 B;  4NV0 A;  3M1Y A;  4C80 A;  1ZQR A;  2HSZ A;  5KT3 A;  2HVI A;  5F9N A;  1N48 A;  1ZXI A;  9ICF A;  4DFK A;  2KSO B;  2HDO A;  1L8O A;  4CE6 A;  4CF4 A;  5KFX A;  1LKY A;  2G5I B;  3UPQ A;  3SV4 A;  4NJ8 A;  4KLF A;  4PGX A;  1N2X A;  4ECU A;  5BOM A;  2E8M A;  2G08 A;  2BPC A;  2PFO A;  1Z1B A;  4F8R A;  4M9H A;  3OSN A;  4J9N A;  8ICS A;  3KFU F;  1K1S A;  2W8L A;  3MBY A;  4P4P A;  2K4H A;  4QWC A;  4EBE A;  2KJ5 A;  2JEG A;  4DSL A;  4BGD A;  3KHR A;  5EE1 A;  2F2A B;  1S0O A;  8ICA A;  2VJ4 A;  2K4E A;  3WKA A;  4RQ7 A;  4EZ6 A;  5DGA A;  1T4G A;  3IG5 A;  1OXJ A;  3PW7 A;  3JPR A;  4I2A A;  8ICQ A;  1D8B A;  9ICB A;  1X9M A;  3C23 A;  2XO7 A;  2B0C A;  9ICO A;  5AKZ A;  3LWL A;  5L1J A;  3AL0 B;  4IC9 A;  1BPZ A;  1ZQE A;  2KD1 A;  5B5E U;  1O08 A;  3V7K A;  3H0R B;  1RPL A;  4YFK A;  4C8K A;  3B0X A;  4YD1 A;  4IR1 A;  2MAX A;  2DUY A;  3PML A;  3MGI A;  2DKZ A;  2QKQ A;  4RQ2 A;  3NVY A;  4M0A A;  4PHP A;  4YN4 A;  3RR8 A;  1KLN A;  1Q8K A;  1S0N A;  2RDI A;  2MRL A;  2MUT B;  3UXP A;  4QWB A;  4Y2Q A;  3S6J A;  1TK5 A;  4ELT A;  4YMN A;  4UAT A;  4UAR A;  3M6Z A;  4P0Q A;  2N1R A;  4QZG A;  2YX8 A;  5ALK A;  5AKX A;  5ALE A;  3HT3 A;  5A0L A;  5KFL A;  5KFD A;  4DOA A;  4NL9 C;  2VA3 A;  3DDH A;  7ICQ A;  2WHE A;  1ZD4 A;  3QNM A;  1SKS A;  3TAC B;  1JMS A;  4PHD A;  1SB3 C;  3RB4 A;  1JAL A;  3HWT A;  3NRZ A;  2NRV A;  4OJ5 A;  2LM4 A;  3MC1 A;  2HOQ A;  1A0P A;  1RXW A;  4C7Y A;  2IOF K;  3H4B A;  2ZTC A;  8ICI A;  2P6U A;  5AKY A;  3KD3 A;  3F2D A;  1BPY A;  4I2D A;  4KLJ A;  5J0S A;  9ICX A;  1ZQQ A;  2E8P A;  2Y9T A;  2XID A;  2WAQ C;  4GXJ A;  4RNM A;  4B6J A;  4Z6F A;  2KNJ A;  2AU0 A;  1UPH A;  4DOB A;  3K4G A;  3EYZ A;  2OXO A;  2YMP A;  2W43 A;  3UXO A;  2CXY A;  4P0P B;  2YN4 A;  5KFE A;  2KHQ A;  8ICW A;  1DOQ A;  2ZIX B;  3BQ2 A;  3MGV A;  3RH4 A;  5AK6 A;  5KG7 A;  4Y2R A;  4Z6E A;  3WK8 A;  2M9N A;  5KFK A;  2FPM A;  4KX3 A;  4YXM A;  4J03 A;  3WKB A;  4QWD A;  1ZRM A;  2F1H A;  2ALZ A;  4ICA A;  3NUQ A;  1A6S A;  2W55 A;  1TE2 A;  1IXR A;  5ALO A;  4EBC A;  4F5Q A;  3RF9 A;  4GXI A;  2J6S A;  2P6R A;  3MFI A;  1FFU A;  1L3T A;  4Y2P A;  3F2B A;  1IIP A;  1T8E A;  5AIA A;  5J0T A;  5ALY A;  2AQ4 A;  2HW3 A;  3SD7 A;  4O0I A;  3OJS A;  3SEI A;  8ICE A;  2PMZ F;  3H8W A;  3KKA A;  1DXS A;  2H3Z A;  3MDC A;  4MFF A;  1NKB A;  1HUZ A;  4DFP A;  4DSE A;  3LK9 A;  2V4R A;  5AKL A;  4IS7 A;  3N7R C;  1NZB A;  3IG8 A;  1SKR A;  5DG8 A;  1JIH A;  3BZK A;  2DKX A;  2HHV A;  3SR6 A;  2PKE A;  2AXT U;  2KIV A;  4OD0 A;  5KG5 A;  4QZB A;  2AGP A;  7ICK A;  4NLZ A;  2H3V A;  5DG7 A;  1S76 D;  5HML A;  1MSW D;  3T5J A;  4P0Q B;  3QUB A;  1RZT A;  5EE9 A;  2EAN A;  2FLN A;  1U47 A;  1NZP A;  4DO9 A;  2ZUC A;  5BPC A;  3RJF A;  1ZD2 P;  2GH1 A;  4R64 A;  4NL9 A;  1OUQ A;  4KMO B;  2B21 A;  5HHI A;  3E58 A;  8ICF A;  1P7D A;  2XI9 A;  2WFA A;  3WK6 A;  4UAZ A;  2HBJ A;  3K75 D;  5KFO A;  3WKD A;  4Y2J A;  4JV1 A;  2KKV A;  4IQT A;  4CF3 A;  3V72 A;  2ZIV A;  2GWS A;  2W9B A;  4F4X A;  2CPR A;  5KT7 A;  3M9M B;  3PO4 A;  1NK5 A;  1GO3 F;  5KG6 A;  1ZQH A;  5J2E A;  5AIB A;  1KDH A;  3ED5 A;  3Q8R B;  5AK3 A;  2DPJ A;  4F3O A;  2XGQ A;  3AQE A;  3PV8 A;  3PY8 A;  4C4T A;  4IRK A;  2KIW A;  2XY6 A;  7ICT A;  2KSO A;  4RQ3 A;  4UB5 A;  3ZD9 A;  2E1E A;  4ECY A;  3JPP A;  1S9F A;  5J0W A;  1QSL A;  2IOF A;  4DF4 A;  1SL2 A;  4Q44 A;  1SZH A;  4C7Z A;  5ALW A;  3M7D A;  5EE3 A;  2F76 X;  1K1Q A;  3C2M A;  1T7P A;  5AKK A;  4US8 A;  4XUS A;  1TV9 A;  1YZ6 A;  1H38 A;  2K89 A;  4U7C A;  3KOO A;  3GIJ A;  2C28 A;  4LZG A;  4R63 A;  1TAQ A;  4F92 B;  2AH5 A;  5HR6 A;  5J8Y A;  2QB0 B;  4RT3 A;  1TK8 A;  2W3R A;  5JTI A;  4TQR A;  1NK4 A;  2R8I A;  4KLQ A;  2Q4T A;  4M9L A;  4Q45 A;  2HCF A;  1ZQL A;  1HJP A;  4DLG A;  2K8B B;  3GV8 B;  1VJ5 A;  2WF9 A;  4HAI A;  1KFS A;  4FZN A;  4UAV A;  3FM9 A;  3LDA A;  4LZD A;  4RQN A;  2EZY A;  1S10 A;  4C8O A;  3PO5 A;  4C8L A;  2AGQ A;  2PI4 A;  1L5U A;  3SAH A;  2IHM A;  2KV2 A;  2ASD A;  2ASL A;  4B9M A;  2BQU A;  4CDG A;  3QEA Z;  4K4H A;  3GV7 B;  4JWN A;  1DGS A;  4RNO A;  3THV A;  2HHT A;  9ICT A;  5KG0 A;  4YR0 A;  5CA7 A;  4PGQ A;  1U45 A;  1SL0 A;  1CRX A;  8ICY A;  5CB1 A;  5IIL A;  5IIM A;  2I9G A;  3HPO A;  9ICM A;  3R9K A;  4UB4 A;  2Y1J A;  3NS1 A;  2W03 A;  1QSY A;  2ZIU A;  3B0Y A;  2KOB A;  4RQ6 A;  4K4I A;  3IN5 A;  3H40 A;  3PVX A;  3IP4 B;  3QUQ A;  2JHD A;  5KG2 A;  3KBB A;  4DFM A;  4XQ8 A;  1S0V A;  2VJ5 A;  3SZ2 A;  4RUC A;  9ICI A;  9ICH A;  4GXK A;  1KRP A;  4EYH B;  2OWO A;  2YB1 A;  1UT5 A;  5KL8 B;  4ELU A;  4EEN A;  3PSI A;  4UBC A;  5ALU A;  2YY6 A;  1CEZ A;  2G09 A;  7ICI A;  5AK5 A;  2W54 A;  5C0Y A;  2HHW A;  3LYS A;  3SEN A;  2FMQ A;  1TK0 A;  3EWA A;  3WKC A;  5DB7 A;  5J0X A;  1COO A;  3C28 A;  9ICW A;  5AM2 A;  4GC6 A;  5DKW A;  1NOM A;  2I1Q A;  3M9O B;  1D9F A;  2OEH A;  1NK9 A;  5ALP A;  1PK1 A;  3NVW A;  2YMQ A;  2YTU A;  2BHN A;  4O3Q A;  2BPG A;  3G6X A;  4UAU A;  1JN3 A;  1SV0 A;  5D4B A;  2ES6 A;  3BQ1 A;  1QSS A;  3OJU A;  2KVS A;  1QQ5 A;  2PFN A;  8ICN A;  5KG4 A;  3CRX A;  1S8O A;  4QW9 A;  4LJX A;  4RPY A;  2DPI A;  2RHF A;  4RUA A;  4BX9 C;  5ALJ A;  4KLO A;  1VLB A;  4NY8 A;  5DBA A;  4F5P A;  1NJX A;  1BPB A;  1X9W A;  4F71 A;  2HHU A;  1ZQV A;  1F5S A;  1AQ6 A;  3T5H A;  3JPS A;  5KT2 A;  2FJ6 A;  2WB1 F;  1Z3E B;  5KFA A;  1BNO A;  4FO6 A;  1UCV A;  5KFZ A;  1A77 A;  1ZQZ A;  4DQP A;  5ALS A;  1KN5 A;  2W9M A;  5CEH A;  2A3V A;  1L7O A;  3ETL A;  3RFA A;  5J2A A;  1LV5 A;  8ICP A;  2G0A A;  1U4B A;  4G3I A;  4KLH A;  3NVZ A;  1MQ3 A;  4R8U B;  4JWM A;  2D8C A;  2AQ0 A;  5ALV A;  2XC9 A;  3ZDC A;  3WK9 A;  1XO0 A;  1QQ7 A;  4RNN A;  1WWV A;  2E1F A;  5AI4 A;  2FPK A;  1ZQK A;  3RJI A;  1BPD A;  5D46 A;  3C1Y A;  5CWR A;  4KIT B;  1FIQ A;  5IIJ A;  7ICP A;  4Z6D A;  4F72 A;  3UQ0 A;  5KAI U;  1SV4 A;  4DEZ A;  5KFN A;  3MR6 A;  2HBL A;  4DL7 A;  1X40 A;  3BQ7 A;  3AUO A;  1F0M A;  2WTF A;  3CP8 A;  3N28 A;  5KT4 A;  3EPI A;  1RG6 A;  1NNL A;  3RB6 A;  3IDW A;  3QUT A;  3IRU A;  4EEK A;  4ED0 A;  4DQI A;  2OH2 A;  5CJ7 A;  1XU4 A;  3ONN A;  5AIC A;  3H0M B;  2YML A;  3RJG A;  5KFB A;  2KK0 A;  5CHG A;  1Z4O A;  3K1R B;  2FI1 A;  2UVV A;  3LVV A;  2JEF A;  7ICL A;  2UVR A;  4FZL A;  2ZG6 A;  1Z00 B;  4GLX A;  1WWU A;  2OYY A;  4DL6 A;  4EYI B;  3Q8L A;  1QCK A;  3ZD8 A;  8ICR A;  2KTQ A;  1KW4 A;  2NO5 A;  5ALH A;  7ICM A;  9ICQ A;  1UA1 A;  4EZ9 A;  3GQC A;  3QZ8 A;  4ED2 A;  3M8S A;  5J2J A;  1MC8 A;  5L1I A;  1RYS A;  2IMW P;  5KFY A;  3H8M A;  5DLF A;  5HNK A;  2DF4 B;  4OJO A;  3DEE A;  4UW9 A;  3LVW A;  2BCU A;  1V97 A;  5KTQ A;  4ECZ A;  2IOH A;  4C8N A;  2WF7 A;  4M9G A;  2BCS A;  1N61 A;  1SXD A;  5BOL A;  4YMM A; 
#chains in the Genus database with same CATH homology
 2KNJ A;  2E1F A;  5C0Y A;  1UPH A;  3LYS A;  2H3V A;  2BDU A;  2OM6 A;  5HR6 A;  3F2C A;  2PMZ C;  1D8B A;  4BUG A;  2W7P A;  5KL1 B;  2YB4 A;  2ZIX A;  4P0Q B;  2OXO A;  1HEK A;  3SQI A;  3N7S C;  3KZX A;  2LBO A;  3N7P D;  3C28 A;  2K4I A;  3K1Z A;  1MA7 A;  4P0P B;  3L3F X;  4QIW C;  3C29 A;  1ECW A;  2GOL A;  2Q4T A;  4IC9 A;  2KHQ A;  2Y0S C;  4KX5 A;  3VCB A;  3AL0 B;  1Q3U A;  3D2S A;  1L6N A;  2KD1 A;  2JH7 A;  2K8B B;  1TAM A;  4ACO A;  2ZIX B;  3T79 A;  2HBL A;  2GH1 A;  2HOF A;  3MGV A;  4CGZ A;  1Q3V A;  3H0R B;  2M0N A;  2CRX A;  3D2Q A;  1OUQ A;  4KMO B;  4FZN A;  4FZM A;  3PSF A;  2HOI A;  1P7D A;  3CP8 A;  2KHV A;  4U6P A;  2XI9 A;  4A8E A;  4NWI A;  2ZIV B;  1WUD A;  3F5A A;  3GZF A;  2H3Q A;  3NRW A;  2XVT A;  3AQF A;  2JMG A;  3M6K A;  4CRX A;  4KX3 A;  2HBJ A;  2ZIU B;  2OH2 A;  1DRG A;  2HBM A;  4WJ3 B;  2W04 A;  2KKV A;  4C0Z A;  2JGA A;  3SAH A;  3ONN A;  3OPX A;  4QNL A;  3CRX A;  2KV2 A;  4ICA A;  4OO1 J;  3NUQ A;  2ZIV A;  3SMV A;  3GU3 A;  1KBU A;  3E0F A;  2VKQ A;  3H0M B;  1A6S A;  2MA1 A;  2CPR A;  2RHF A;  4CDG A;  2MRL A;  4BX9 C;  1GO3 F;  4NLC A;  2Y0S F;  3PZP A;  2DQN B;  4NV0 A;  1T94 A;  3RF9 A;  1Z19 A;  2H3I A;  2NV3 A;  2F77 X;  3LVV A;  2WB1 C;  2ZIW B;  4NLB A;  4FZL A;  3D2N A;  1CRX A;  3M6Z A;  3HKZ C;  4P0Q A;  2LKY A;  2ZG6 A;  3AQE A;  3PST A;  3ICX A;  2LYB A;  2N1R A;  3H0L B;  4AYB F;  2KVC A;  2LHT A;  3PSP A;  3F2B A;  1IIP A;  2YX8 A;  1ED1 A;  4P0P A;  2OYY A;  4OJ6 A;  4PL2 A;  2XIC A;  2W03 A;  3SAG A;  2WAQ F;  2G5I B;  5HR7 A;  5A0L A;  2CN1 A;  2ZIU A;  2Z7J A;  2RP5 A;  1XNS A;  2KIW A;  2KOB A;  3VC8 A;  2W7O A;  2ZXI A;  3IN5 A;  1URJ A;  2WB1 F;  2KIC A;  2PMZ F;  3IP4 B;  2E1E A;  4O3M A;  2G08 A;  5CRX A;  3HKZ F;  2LYA A;  2H3Z A;  2KEY A;  2ZIW A;  3O0F A;  3SAF A;  1PVQ A;  2K8A A;  1Z1B A;  2JH1 A;  2H3F A;  2A3V A;  2G06 A;  4OJ5 A;  4QIW F;  2JHD A;  2KJ9 A;  2HOQ A;  5T14 A;  3KFU F;  1A0P A;  1F44 A;  2D6F C;  3RFA A;  1PVP A;  2VJ5 A;  2K4H A;  2G07 A;  3N7R C;  2KJ5 A;  3F53 A;  4JMU A;  1ZQ1 C;  4AYB C;  2G0A A;  1NZB A;  2HMX A;  1SZH A;  2E5S A;  2DF4 B;  3M7D A;  4OJO A;  3DEE A;  3IG8 A;  2F76 X;  2HBK A;  3LVW A;  2YB1 A;  2F2A B;  5KL8 B;  4GFJ A;  3F2D A;  2G5H B;  2VJ4 A;  2K4E A;  2KJ8 A;  2K8C B;  2KKP A;  3PSI A;  4OJL A;  2F8L A;  4PL1 A;  4BJQ A;  2DGZ A;  1YT3 A;  2R18 A;  3F5E A;  3ALR A;  4QJF B;  2XID A;  2K89 A;  3CYM A;  2VIX A;  1XO0 A;  3IG5 A;  4FE3 A;  2WAQ C;  2RRD A;  2G09 A;  1PVR A;  4OJP A;  4U7C A;  2ZXH A;  1HIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...