2KMDA

Ras signaling requires dynamic properties of ets1 for phosphorylation-enhanced binding to co-activator cbp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
109
Chain Sequence
HMECADVPLLPSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein C-ets-1
publication title Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to coactivator CBP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, protein binding
total genus 29
structure length 109
sequence length 111
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kmdA01
2DKXA 2JV3A 2EANA 2E8MA 4MHVA 3IDWA 1V85A 3HILA 2E8NA 4NL9A 5KNIA 2L5YA 1OXJA 1B0XA 1PK1A 1F0MA 3BS5A 2E8OA 2E8PA 1V38A 2KIVA 3K1RB 1PK3A 3H8MA 2GLEA 2KSOB 2Y9UA 1X40A 2QB0B 1DXSA 1SXEA 2Y9TA 5JRTA 2KG5A 3TACB 1X9XA 1X66A 1KW4A 1COKA 4RQMA 5L1MA 2ESEA 3TADC 2LMRA 1WWVA 4IS7A 1PK1B 1UQVA 3BS5B 2QARA 2YTUA 1LKYA 4PZOA 2K4PA 2QARB 1SGGA 1LKYB 1B4FA 1SV0C 2DKZA 3BQ7A 3SEIA 5JTIA 1SV0A 2DL0A 2B6GA 2FE9A 1SXDA 2D8CA 1SV4A 3KKAC 2LPEA 2K60A 2F44A 5J8YC 2EAPA 2QKQA 4RQNA 3TADA 2KMDA 2KE7A 3BS7A 1RG6A 2D3DA 3SENA 1Z1VA 2QB1A 5F3XB 1WWUA 2F3NA 1UCVA 1JI7A 2EAMA 4NJ8A 2ES6A 2EAOA 1OW5A 3KKAA 2KSOA 4PZNA 5JU5A 2QB0A 5J8YA 2F8KA 4NL9C
chains in the Genus database with same CATH superfamily
3C1ZA 4AYBF 4HYKA 5IIJA 3QYPA 3HILA 3MGHA 4IL6U 4Y2UA 3Q8RB 3H8JA 5AHXA 1AQ6A 4I29A 4Q8FA 3OSNA 3TFSA 2E3TA 3NGDA 3RF9A 5ALNA 2NRVA 1F44A 2ZJ8A 3KHRA 1IIPA 9ICNA 1A76A 1U4BA 2CN1A 1D8BA 4CF5A 2G5IB 1XO0A 3E2EA 4ECUA 4QZGA 1X40A 1SXEA 2F8LA 3HT3A 4B9SA 1ZQJA 1PVQA 3UMBA 3IHQB 9ICQA 5G5HA 4B9NA 5KFCA 2W9BB 4I2EA 1IG6A 1M6YA 3WU2U 3OSPA 3TADC 4UAYA 2WAQF 3RBDA 1TK5A 3H0LB 1CI4A 5AKJA 1WCLA 3A0BU 3KFUF 4QJFB 4PZOA 3D6JA 4C8NA 1KDHA 4EZ9A 3RJHA 3I28A 5DQHA 1T3NA 2K4IA 2LI6A 1C20A 1SV4A 5ALRA 2LPEA 2JH7A 1JN3A 5AKLA 2OWOA 3FDSA 3WK7A 3SZ2A 4E0DA 3SI8A 7ICJA 7ICFA 5KG0A 2E5SA 4DLEA 3F5AA 4YFKA 4J9KA 4C8KA 4BJQA 4EENA 4KLQA 5HNKA 8ICGA 2JEFA 3QUTA 4QZFA 5KFIA 3EYZA 1NJXA 3C2MA 1D9DA 2WF5A 4BWMA 1IXRA 4YQWA 2V9WA 3N7SC 5J2FA 1ZQPA 4Y2XA 1KSPA 1XWLA 2K8AA 5A0LA 3ZDCA 2Y1IA 1DOQA 4KN4A 8ICRA 5J8YA 2FPLA 4KLFA 1NJZA 3ZDAA 2EANA 3B0XA 3IDWA 4JV0A 1L8OA 2YMQA 1NKCA 1QTMA 2W9AA 1L7OA 1B22A 1NK0A 5AM4A 2ZXIA 4UB2A 4DFKA 1NOMA 4UQGA 4R66A 5C0YA 2FLNA 1QQ7A 3OJUA 2ISPA 2IOFK 4QZAA 1KFDA 3F5EA 3M9NB 4YXJA 4OJPA 1X9XA 2HHQA 5KFQA 1ZQYA 4UB6U 2JH1A 4KMUA 4RNNA 2JXJA 4RQ3A 2DPJA 4BXOB 1QH9A 4DWIA 3GZFA 3DV9A 1ZQGA 4ED3A 4F2RA 2PMZC 1ZQLA 2ODGA 5DBBA 4I27A 1ECWA 3GV8B 1JMSA 3PSTA 7ICSA 4UBBA 1SL1A 3KKAC 5AKIA 3QXGA 2LBOA 3N7PD 3M8RA 3JPPA 3CRXA 3TADA 4P4MA 3Q8KA 1RG6A 1O08A 1FFVA 1X2IA 4UAVA 1XC9A 4ECSA 4QZIA 1NI3A 4ECTA 8ICFA 1ZQRA 5KFWA 4HAIA 5AM5A 9ICGA 3H40A 4EEYA 4KTQA 5FP0A 4IR9A 3V7LA 3HKZF 4O5EA 5J0WA 3MDAA 1JXLA 3E0FA 2IOFA 4UB3A 4DOBA 2UVWA 5AKZA 4B9UA 2H3VA 9ICIA 4F72A 1V85A 4BGDA 4ELVA 5KT7A 1WG8A 1L6NA 1UPHA 2HBJA 3TI0A 1S0MA 2P35A 2WFAA 2V4QA 4ED6A 3PO4A 2IHNA 4M47A 4J9SA 4DL3A 4C8MA 1NK7A 3AM9A 3RAXA 2CXYA 4UW9A 2VA8A 3H7IA 1SB3C 2JR5A 5CJ7A 1EXNA 5DB7A 3MBYA 3RH5A 3QU2A 2Y0SC 4QZEA 3RB6A 4J9PA 4EEKA 1OUQA 1TAQA 1NK6A 1BPYA 4RNMA 1NKEA 3PO5A 4PJ0U 5L1JA 4DF4A 4BXOA 4Q44A 1T3QA 1PK1B 3V6JA 1S77D 1XO1A 8ICBA 4EZ6A 1KRPA 5DKWA 2JHDA 3Q8LA 2R8IA 3BQ7A 1LVHA 1D8YA 1S9FA 4J9LA 5KT4A 4PHAA 3EPGA 4DLGA 4C7YA 2R8HA 1NJYA 1HIWA 5KFVA 1DK2A 4DL4A 4PL2A 2HHWA 5KFDA 2M9NA 4RQNA 4KLTA 2AGQA 2KMDA 7ICPA 5KAIU 4AP9A 2M0NA 2OHFA 4DQQA 3BDPA 4F4XA 2ATLA 5BPCA 1FO4A 4ED1A 2H3ZA 9ICLA 4YVZA 4YN4A 4J9NA 4DQSA 4GXKA 2F3NA 3MR5A 3H8WA 2EAMA 4NJ8A 2HHSA 3D2SA 2Z7JA 4I2IA 2BCQA 2BPGA 4DL5A 1XNSA 2VIXA 8ICZA 3KKAA 3TFRA 2QB0A 5CA7A 2ZUBA 1WUDA 2G5HB 1CEZA 5D49A 5ALZA 5ALDA 4ACOA 4Q45A 1SKRA 1B0XA 3ZDBA 2B21A 4XRHA 1JUDA 3WKAA 4M0AA 4F4ZA 4I2CA 1YZ6A 2HCFA 3K1RB 1QCKA 4I2DA 2XGQA 2KNJA 5ALGA 4F5QA 3BZCA 9ICHA 1ZOLA 5KG1A 2EZZA 2ASDA 3V6HA 5DG7A 5CHGA 4QWEA 2Y9TA 1MN8A 2KG5A 1DGJA 1N56A 1ZQAA 2BCSA 4M9JA 4USAA 7ICTA 1HJPA 4ZH4A 3EWAA 5G5GA 4IS7A 2HBMA 1CRXA 3K1ZA 3RRHA 4DQRA 5AM1A 1N61A 3F2CA 3AUOA 5KFPA 1NZBA 4DSJA 1KQQA 2FPMA 2KZ3A 1ZRMA 4ZOHC 2YB1A 4ED7A 5ALHA 4EYHB 4O5CA 4M9HA 2YY6A 2BHNA 1SL2A 4M9GA 4F3OA 4RQ2A 5AICA 1ZQQA 5IIMA 5HP4A 4KLDA 4UAZA 1Z1VA 3D2QA 9ICUA 2V4RA 2C2DA 8ICCA 5H2FU 2QLTA 2ZIWB 4TQRA 2KV2A 1ZQZA 1SZPA 1Z4NA 4MF2A 2EAOA 5AI6A 8ICLA 3UQ2A 3L5KA 3RB4A 3QNMA 3GDXA 2KZZA 1QQ6A 1SWWA 2EZXA 1OXJA 3PW2A 4DEZA 5DG9A 2W9CB 3PR5B 3HWTA 5J29A 2EQYA 4JMUA 1WYGA 2ZG6A 2BQUA 2KKPA 1L3VA 5AM3A 5T14A 4RPYA 1ZQ1C 2Y9UA 2DF4B 8ICIA 5CWRA 4ELUA 5HHIA 1X66A 3HRDD 3C29A 7ICNA 4FS2A 4RQMA 3L4PA 4RZRA 5KFRA 3VCBA 3UM9A 2LKYA 4PL1A 2N1RA 3HP6A 2VKQA 3SAHA 2JZBA 3PY8A 1B4FA 2VA3A 2ZTDA 3QUBA 1HUOA 1ZQEA 2LM1A 3L3FX 4A8EA 4IQTA 7ICLA 4DOAA 5AI5A 1SXDA 3ED5A 2I1QA 3SYZA 5KFJA 2KFZA 4F4WA 1PVRA 2R8KA 2F44A 4DQIA 5AK3A 3MDCA 1AROP 4GLXA 4K4HA 2FDRA 5AKGA 4Q8EA 4DO9A 1A0PA 1DGSA 1Z1BA 3B0YA 3B9JA 1U47A 5HHHA 3NTUA 3JPTA 8ICPA 5KFLA 2ZIWA 4UB4A 1UCVA 1ZQOA 4RUCA 5EWGA 5DBAA 2FJ6A 5AI0A 2AQ0A 2F1HA 4KX5A 5KFKA 2MU2A 5L1IA 2F1JA 4OJLA 3PSPA 5JU5A 2JEIA 4YXMA 5KFTA 3N4MB 4Y2JA 4C0ZA 4PHPA 1L3UA 2C22A 1N5WA 2R8GA 2BKEA 5KFHA 2W8KA 2FLLA 2HHVA 4I2BA 4KLMA 2W9CA 3NASA 4MEXA 1MC8A 2AH5A 1VLBA 5J2JA 2E8PA 2PI5A 4QWDA 4FZNA 2H3IA 4O3QA 9ICEA 5JUMA 5CP2A 2FLPA 3BQ0A 2BR0A 3UMGA 3NVYA 2HW3A 5J0RA 5L1KA 4JK1A 3EZ5A 2RQ5A 1KW4A 1COKA 3NS1A 2NRZA 4DSIA 5DBCA 2J6UA 2NRXA 4QZDA 1PZNA 2Y0SF 2LYAA 2P6UA 1TV9A 3M7DA 4M9NA 2HDOA 1JALA 2IMWP 4C8LA 9ICFA 3AU2A 3PW5A 3MGVA 8ICEA 5KAFU 3MR2A 2ZXHA 2HOFA 4KLJA 2OM6A 5EE1A 2MA1A 2FE9A 2D8CA 4F2SA 4YD2A 2OEHA 3AQFA 4TUPA 1Z00B 4KX3A 1QQ5A 5BOMA 2A3VA 4NLGA 3PX0A 1URJA 3E58A 7ICIA 2O6KA 4QZ9A 3UXPA 2ASJA 5ALUA 1L7MA 2RP5A 3ISDA 2PFNA 1N60A 5B66U 5D46A 1HUZA 5CR0A 5F9NA 2GH1A 4I2JA 1RYUA 5ALWA 1J2MA 4TUSA 2D6FC 5KFFA 4Q43A 2CPRA 1UT8A 1ZQBA 9ICAA 4PZNA 8ICHA 3M6ZA 2VJ5A 2AGOA 1V97A 4P4PA 4QIWC 8ICXA 3AMZA 5AI9A 5J2BA 1ZQWA 1Q3UA 1XSNA 4IQUA 5AKHA 5KFXA 3PW7A 3N97B 1TE2A 3KZIU 4PHEA 2GO7A 2XICA 4BDPA 4YR2A 2JEJA 1RXVA 2KFNA 1DXSA 7ICVA 3DDHA 4DSLA 3GV5B 3GIIA 3EPIA 2YMLA 4ECVA 3ZI4A 5CEHA 8ICJA 3KTQA 1B43A 5GTHU 5AK4A 5J0SA 3T79A 4Y2SA 3ALRA 4YG2A 2FI1A 5DLFA 2GOLA 2WB1C 3TARA 2IHMA 5ALMA 1UHUA 2Q0ZX 4CF4A 2JRZA 2G06A 5AIBA 1Z00A 5ALFA 2XVTA 5HMLA 3T5JA 4G9BA 2ALZA 3OTQA 4RT2A 5L1LA 5DB6A 5J2HA 1RDFA 2EAPA 3F2DA 3HPOA 4DOCA 2F76X 1TAUA 3TANA 4GC6A 2KD1A 4F4YA 5TISU 5CRXA 4P4OA 1UA1A 1C7YA 1S97A 1X42A 2G07A 1JI7A 3KD3A 1L3TA 8ICTA 4B9LA 1ZD2P 1SWVA 1BPBA 2NRWA 2KSOA 1ED1A 2MUTB 5HR6A 4KLIA 4IRDA 3C23A 3F53A 2HI0A 4KLLA 4TUQA 5DB8A 5ALEA 2KVSA 4FE3A 2W43A 3TKAA 1KBUA 1V38A 4OO1J 5J0QA 2KIVA 2PFQA 3UMCA 5AIAA 1LV5A 5J0UA 8ICQA 1TFRA 2QB0B 2GWSA 4UB5A 2WF6A 5HR7A 2JGAA 1T7PA 9ICXA 4PGYA 4GFJA 4NV0A 2XCAA 3UQ0A 5L1MA 1T8EA 2LMRA 4RU9A 1WWVA 7ICOA 1COOA 5J2EA 1JRPA 5J2AA 3DEEA 4KN7A 3SMVA 4I2GA 4IQWA 2YTUA 4EX7A 2XIDA 5KL1B 5AKYA 4FZMA 2A1AA 1SV0A 1Q3VA 1N5XA 9ICRA 3PMNA 1YT3A 1ZD3A 4AYBC 1BPZA 4F93B 1KEJA 3GIJA 3BS7A 3WK8A 4J9MA 4NXZA 5EOZA 2NV3A 1RYSA 3D2NA 4MF8A 3M9MB 3HW8A 3C1YA 7ICUA 4JWNA 4F91B 3IN5A 2DWQA 4LZGA 3RJGA 5EWFA 2IA6A 2OCEA 4RPXA 3NRZA 1J97A 1N63A 1WCNA 1OW5A 2MUTA 4Y2VA 3AEVA 4CGZA 3FAHA 2P66A 2KJ5A 1NJWA 2WAQC 2NO5A 5HMMA 2JEGA 2RRDA 3MR6A 1XU4A 3WKDA 4F5PA 3BS5A 2ZTEA 4BWJA 4C7ZA 3PMLA 4B9VA 2R18A 3T5LA 4FBTA 4IQVA 3QX7A 3PSFA 4R8UA 4C4TA 2KTQA 4DFMA 5C5JA 3V7KA 1MA7A 2KJ8A 5EWEA 5KFGA 4P0QB 3C5FA 4O3MA 2H3QA 3PX6A 2HHTA 1UQVA 4JV2A 2W3RA 3K75D 5B5EU 3LDAA 5J0YA 3MR3A 4B9MA 4K4IA 1ZQIA 2F1IA 3RRGA 3SEIA 1ZQDA 3ZDDA 7ICRA 2DL0A 4DFJA 5DQIA 8ICAA 1RM6C 4DFDA 2FPKA 3ISBA 9ICVA 2XCPA 2DQNB 4ICAA 3TQ1A 2I9GA 3QEBZ 3RJIA 4OJOA 1A6SA 1Z3EB 2HVIA 2ZIXB 2JZBB 2H3FA 4IRKA 4P0PB 3C5GA 2YMMA 2LYHA 3QZ7A 5KFUA 4DS5A 2W9MA 4Y2PA 2KN7A 1XSLA 4R64A 7ICMA 2KKVA 4QW8A 3RJJA 4PGQA 1TKDA 3IRUA 3OHBA 1ZXIA 1JX4A 3EUB2 2ZIVB 4RQ4A 5D4BA 5KFNA 1Z19A 2DKXA 2BQRA 4MHVA 4KITB 1PVPA 5ALSA 4R63A 4DCCA 4O0IA 2RHFA 3QU9A 3MGIA 5KG7A 2HMXA 3IP4B 4OJ6A 5KG3A 2P6RA 2HHXA 3PW0A 2Y1JA 1KLNA 3QU5A 2E8OA 2FMSA 3H8SA 3HX0A 1PK3A 3QE9Y 1ZRNA 2VJ4A 1P7DA 2DPIA 3TAPA 1ZQSA 4UB8U 4FS1A 4Z6CA 5IILA 4LJXA 1ZD4A 5KT3A 3TACB 2NYVA 2WTFA 4YCXA 4P0QA 1BVSA 2E1EA 3EW9A 1S0NA 4EBCA 3Q8MA 2UVVA 2UVUA 8ICYA 1BPEA 1D8LA 1UA0A 1LKYB 3HKZC 4F92B 4JWMA 2ZJ5A 2BGWA 5KFEA 9ICKA 2BPCA 4KLUA 1U49A 3PR4A 2ZTCA 4YR3A 4UASA 1Q8KA 1MQ2A 4YMNA 2ZUCA 4JB3A 2QKQA 4QWAA 1RQLA 4C8OA 2KJ9A 5AK6A 2ZIXA 1Q46A 2MSNA 1NKBA 4P0PA 4RQ5A 5DDMA 3QZ8A 1ZJNA 3LVWA 3FC4A 4QNLA 5IIOA 5KT5A 2PFOA 4LVSA 4O3PA 2PMZF 3IV6A 1ZJMA 2J6TA 2ZIVA 2XI9A 2CRXA 2A1JB 2K8CB 3H0MB 4F5NA 1MQ3A 4RUAA 2HOIA 2WF9A 3O0FA 4LZDA 1ZQCA 2F2AB 1MSWD 1NK5A 3KOOA 4IC9A 5ALYA 3M8SA 4RQ0A 3N28A 3ZD9A 3T5KA 3AQEA 3WK4A 4PGXA 1U45A 3ICXA 3SQIA 3J81j 5ALVA 1NZPA 1JIHA 4ECRA 4YMMA 5EE9A 5K4LA 2DBYA 3M9OB 1QSSA 2RDIA 4U6PA 1S10A 4DSKA 2BZFA 1LKYA 1T4GA 5J2CA 3PV8A 5KFBA 1ZQVA 1SL0A 1U9LA 2AHOB 3MFHA 3PVXA 4BX9C 2W8LA 5DDYA 1ZETA 2BDUA 1ZYQA 4DSFA 2MRLA 1H38A 4FFDA 4OCZA 2C2EA 4OJ5A 5EE0A 4F5OA 5ALXA 2I5HA 1YZ7A 1IM4A 1DRGA 2AU0A 2D3DA 2OYYA 2KOBA 4DL7A 5DG8A 4O3SA 5F9LA 4P2HA 3ETRA 4NWIA 1ZQKA 2BCRA 4GC7A 2EH9A 3MFIA 4US8A 2IOHA 3RJEA 3RB0A 5DLGA 4Z6DA 8ICMA 5J2IA 4Y2RA 2F8KA 5DGAA 2A1JA 3V7JA 2YX8A 5IINA 4CCHA 3RJKA 2KHVA 1U48A 2E8NA 1K1QA 3VC8A 4M04A 1GO3F 3LK9A 2HVHA 4O5KA 4OD0A 1F0MA 3H0RB 3OPXA 9ICPA 4UBCA 4XA5A 3ZDEA 5AI4A 4BUGA 5AM2A 8ICWA 2EZYA 3KZXA 2GLEA 2KSOB 2W54A 4US9A 3MABA 2XY7A 2W3SA 3OJSA 3PZPA 5KFSA 9ICJA 1VJ5A 4EELA 5EE3A 4NY8A 2ZJAA 9ICCA 4DF8A 3OHAA 5DGBA 3V6KA 4QZHA 3GU3A 3T3FA 4IRCA 2RDJA 3RH6A 2FMPA 4ED2A 2QARB 4FZLA 2JMGA 1SV0C 1RQNA 3GIKA 2XY5A 2DUYA 4CE6A 2AXTU 2W04A 4NLZA 2IBKA 2B0CA 2YB4A 2B6GA 4PHDA 3I76A 4ECYA 1DK3A 3R9KA 1TVAA 4QW9A 3ONNA 4ECQA 9ICBA 5AI8A 3JPOA 3PW4A 2A19A 2I6XA 2KHQA 5KG4A 4X5VA 3RFAA 1BNPA 3CW2C 3GILA 4NM2A 4GXIA 5KT6A 4XUSA 8ICKA 1KN5A 3BQTA 4CDGA 2F77X 5J0TA 4RPZA 1ZD5A 5F3XB 1LB2B 4JUZA 2AQ4A 4NM1A 5L9XA 2K8BB 2XY6A 4QWCA 3LVVA 2KZMA 1S0VA 1NK9A 5KFOA 4DFPA 2EDUA 1L3SA 5DB9A 2JV3A 1L7PA 1K1SA 5J0OA 4NL9A 2BCUA 5J0PA 2HBLA 1Z4OA 5CB1A 2W9BA 5ALTA 3PSIA 2L5YA 2ISOA 5ALLA 2PXIA 4F8RA 3Q8SB 5KFZA 4G3IA 3PX4A 5GTIU 2UVRA 8ICNA 1ZQHA 3M6KA 1ZQUA 4JV1A 3M1YA 5JRTA 1X9MA 3A0HU 7ICHA 2ESEA 4NLCA 2PKEA 2PI4A 4U7CA 4MFAA 1PUZA 5BOLA 3BS5B 1TAMA 2QARA 5AM0A 2MAXA 1FFUA 4EBEA 4KLSA 4R8UB 4J03A 1A77A 1S5LU 3LYSA 2XO7A 1S76D 3WKEA 4DL6A 2K4HA 3IG5A 1O03A 3GV7B 3KHHA 2RLTA 5AKXA 2G08A 2KE7A 2W55A 3JPNA 2OXOA 8ICVA 3SENA 4O3NA 2W7OA 4RT3A 4EX6A 1S8OA 3GFKB 3C21A 1ZQMA 4TURA 3MC1A 7ICQA 3G6VA 4M6WB 1WWUA 3SV3A 1SKSA 2KICA 4ECZA 3WK5A 3FM9A 3QUCA 3BJYA 1ZQNA 2W7PA 1F5SA 3RR7A 1J2NA 4M2YA 4KLEA 2E8MA 3NVWA 4J9QA 4QZ8A 5J0XA 3LWMA 2E1FA 3CYMA 5KT2A 1Y88A 5KNIA 2WF7A 4F5RA 1UT5A 4QZBA 3G6YA 4K4GA 9ICWA 2LYBA 4YP3A 8ICSA 4O3OA 4I2AA 2YN4A 3H8MA 4F71A 4NLBA 3RBEA 4PH5A 8ICOA 4I2HA 1L7NA 3Q8PB 4Z6EA 3AN1A 2HSZA 2ZUDA 4QWBA 3IG8A 5ALIA 3BQ2A 4RQ8A 4C4SA 9ICTA 3SAGA 4WJ3B 7ICKA 3PNCA 2J6SA 4UAUA 2FMQA 1QLNA 3UXOA 4RQ7A 2KP7A 3BQ1A 3UPQA 3TAQA 1XSPA 2DFLA 1SGGA 3CNHA 2BCVA 2K4EA 3F2BA 5JTIA 2LHTA 3BZKA 4PPXA 2AGPA 5J2GA 1SZHA 3ISCA 1V9PA 4C4RA 2HOQA 3QUQA 3C28A 3ETLA 4DQPA 4YR0A 1N48A 4ECWA 2PFPA 1QSLA 1L8LA 2C2RA 1HEKA 4YMOA 1ZQTA 4M6WA 4UARA 3HJEA 5E79U 4J9OA 4ELTA 4DSEA 1RXWA 1VDVA 7ICEA 5J2KA 3AL0B 4DS4A 5KTQA 3C2KA 4O9MA 3K4GA 5TZVA 2KEYA 2KVCA 1ZQXA 3S6JA 4MFCA 3THVA 5AK5A 5AKKA 4C80A 1N2XA 4B9TA 4KLGA 1KFSA 4B6JA 1TK0A 1X6JA 5AKEA 3WK6A 4FO6A 3C2LA 1PK1A 3GQCA 4GIBA 1BPXA 3NUQA 5ALOA 3JPSA 4MEYA 1BPDA 3QU4A 4UB1A 4NLKA 1KTQA 2H5XA 2XGPA 4Y2TA 2W11A 2BPFA 4Y2YA 3RH4A 1FEZA 4IR1A 5ALJA 4R65A 1RYRA 5IIIA 3KHLA 3RJFA 4QIWF 4FBUA 3SAFA 2AJQA 3QU7A 3IM1A 5KG6A 4RQ6A 2LM4A 3ORYA 8ICUA 1ZQFA 2DKZA 2C28A 2BQ3A 2OH2A 4Z6FA 2KIWA 2DGZA 3KHGA 5KFYA 1X9SA 3RAQA 2VANA 4GXJA 1NK4A 2Q4TA 5KL8B 2K60A 1X6IA 1XS9D 3N7RC 1S0OA 4KLOA 1SIJA 2BDPA 9ICSA 3SD7A 4I28A 2NRTA 2ASLA 2ZIUB 3T5HA 2WB1F 5KFAA 3QEAZ 1NK8A 4XQ8A 7ICGA 1RZTA 1CUKA 4M9LA 5DQGA 9ICOA 3RB3A 4TQSA 4J9RA 4F4KA 3RR8A 5IIKA 4YD1A 1BGXT 4QZCA 4CF3A 3H4BA 4ED0A 1QSYA 1SKWA 3I1YA 3WK9A 4CNQA 3NVVA 5ALKA 4O3RA 1X9WA 1IV8A 1TK8A 4I2FA 4KMOB 1NNLA 3JPQA 3U26A 3GIMA 2YMPA 3RTVA 1N62A 2VA2A 2K89A 2WF8A 1K5OA 2G0AA 1T94A 3FYHA 5KG5A 3NRWA 3SV4A 4MFFA 4EYIB 5J2DA 5KG2A 3UXNA 3WKCA 4ECXA 2K4PA 4UAWA 4NLNA 3CP8A 2KK0A 4ED8A 5ALQA 3SR6A 1D9FA 1FIQA 4RNOA 4KLHA 3WKBA 2R8JA 2G09A 4Y2QA 4RQ1A 1L5UA 9ICMA 5J8YC 4UATA 3OGUA 1KFTA 3JPRA 3KBBA 1KL9A 3LWLA 4CRXA 2XC9A 1BNOA 4EBDA 3H4DA 3G6XA 3V72A 2QB1A 2WHEA 2W03A 1JXEA 2ZIUA 3Q8QB 4DL2A 1JROA 1RPLA 2ES6A 3AU6A 3NVZA 1KKXA 2YQEA 5ALPA 3ZD8A 2HHUA 2HBKA 2NO4A 4F50A 5KFMA 4NL9C
chains in the Genus database with same CATH topology
2DKXA 2JV3A 2EANA 2E8MA 4MHVA 3IDWA 1V85A 3HILA 2E8NA 4NL9A 5KNIA 2L5YA 1OXJA 1B0XA 1PK1A 1F0MA 3BS5A 2E8OA 2E8PA 1V38A 2KIVA 3K1RB 1PK3A 3H8MA 2GLEA 2KSOB 2Y9UA 1X40A 2QB0B 1DXSA 1SXEA 2Y9TA 5JRTA 2KG5A 3TACB 1X9XA 1X66A 1KW4A 1COKA 4RQMA 5L1MA 2ESEA 3TADC 2LMRA 1WWVA 4IS7A 1PK1B 1UQVA 3BS5B 2QARA 2YTUA 1LKYA 4PZOA 2K4PA 2QARB 1SGGA 1LKYB 1B4FA 1SV0C 2DKZA 3BQ7A 3SEIA 5JTIA 1SV0A 2DL0A 2B6GA 2FE9A 1SXDA 2D8CA 1SV4A 3KKAC 2LPEA 2K60A 2F44A 5J8YC 2EAPA 2QKQA 4RQNA 3TADA 2KMDA 2KE7A 3BS7A 1RG6A 2D3DA 3SENA 1Z1VA 2QB1A 5F3XB 1WWUA 2F3NA 1UCVA 1JI7A 2EAMA 4NJ8A 2ES6A 2EAOA 1OW5A 3KKAA 2KSOA 4PZNA 5JU5A 2QB0A 5J8YA 2F8KA 4NL9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKX A;  2JV3 A;  2EAN A;  2E8M A;  4MHV A;  3IDW A;  1V85 A;  3HIL A;  2E8N A;  4NL9 A;  5KNI A;  2L5Y A;  1OXJ A;  1B0X A;  1PK1 A;  1F0M A;  3BS5 A;  2E8O A;  2E8P A;  1V38 A;  2KIV A;  3K1R B;  1PK3 A;  3H8M A;  2GLE A;  2KSO B;  2Y9U A;  1X40 A;  2QB0 B;  1DXS A;  1SXE A;  2Y9T A;  5JRT A;  2KG5 A;  3TAC B;  1X9X A;  1X66 A;  1KW4 A;  1COK A;  4RQM A;  5L1M A;  2ESE A;  3TAD C;  2LMR A;  1WWV A;  4IS7 A;  1PK1 B;  1UQV A;  3BS5 B;  2QAR A;  2YTU A;  1LKY A;  4PZO A;  2K4P A;  2QAR B;  1SGG A;  1LKY B;  1B4F A;  1SV0 C;  2DKZ A;  3BQ7 A;  3SEI A;  5JTI A;  1SV0 A;  2DL0 A;  2B6G A;  2FE9 A;  1SXD A;  2D8C A;  1SV4 A;  3KKA C;  2LPE A;  2K60 A;  2F44 A;  5J8Y C;  2EAP A;  2QKQ A;  4RQN A;  3TAD A;  2KMD A;  2KE7 A;  3BS7 A;  1RG6 A;  2D3D A;  3SEN A;  1Z1V A;  2QB1 A;  5F3X B;  1WWU A;  2F3N A;  1UCV A;  1JI7 A;  2EAM A;  4NJ8 A;  2ES6 A;  2EAO A;  1OW5 A;  3KKA A;  2KSO A;  4PZN A;  5JU5 A;  2QB0 A;  5J8Y A;  2F8K A;  4NL9 C; 
#chains in the Genus database with same CATH topology
 3C1Z A;  4AYB F;  4HYK A;  5IIJ A;  3QYP A;  3HIL A;  3MGH A;  4IL6 U;  4Y2U A;  3Q8R B;  3H8J A;  5AHX A;  1AQ6 A;  4I29 A;  4Q8F A;  3OSN A;  3TFS A;  2E3T A;  3NGD A;  3RF9 A;  5ALN A;  2NRV A;  1F44 A;  2ZJ8 A;  3KHR A;  1IIP A;  9ICN A;  1A76 A;  1U4B A;  2CN1 A;  1D8B A;  4CF5 A;  2G5I B;  1XO0 A;  3E2E A;  4ECU A;  4QZG A;  1X40 A;  1SXE A;  2F8L A;  3HT3 A;  4B9S A;  1ZQJ A;  1PVQ A;  3UMB A;  3IHQ B;  9ICQ A;  5G5H A;  4B9N A;  5KFC A;  2W9B B;  4I2E A;  1IG6 A;  1M6Y A;  3WU2 U;  3OSP A;  3TAD C;  4UAY A;  2WAQ F;  3RBD A;  1TK5 A;  3H0L B;  1CI4 A;  5AKJ A;  1WCL A;  3A0B U;  3KFU F;  4QJF B;  4PZO A;  3D6J A;  4C8N A;  1KDH A;  4EZ9 A;  3RJH A;  3I28 A;  5DQH A;  1T3N A;  2K4I A;  2LI6 A;  1C20 A;  1SV4 A;  5ALR A;  2LPE A;  2JH7 A;  1JN3 A;  5AKL A;  2OWO A;  3FDS A;  3WK7 A;  3SZ2 A;  4E0D A;  3SI8 A;  7ICJ A;  7ICF A;  5KG0 A;  2E5S A;  4DLE A;  3F5A A;  4YFK A;  4J9K A;  4C8K A;  4BJQ A;  4EEN A;  4KLQ A;  5HNK A;  8ICG A;  2JEF A;  3QUT A;  4QZF A;  5KFI A;  3EYZ A;  1NJX A;  3C2M A;  1D9D A;  2WF5 A;  4BWM A;  1IXR A;  4YQW A;  2V9W A;  3N7S C;  5J2F A;  1ZQP A;  4Y2X A;  1KSP A;  1XWL A;  2K8A A;  5A0L A;  3ZDC A;  2Y1I A;  1DOQ A;  4KN4 A;  8ICR A;  5J8Y A;  2FPL A;  4KLF A;  1NJZ A;  3ZDA A;  2EAN A;  3B0X A;  3IDW A;  4JV0 A;  1L8O A;  2YMQ A;  1NKC A;  1QTM A;  2W9A A;  1L7O A;  1B22 A;  1NK0 A;  5AM4 A;  2ZXI A;  4UB2 A;  4DFK A;  1NOM A;  4UQG A;  4R66 A;  5C0Y A;  2FLN A;  1QQ7 A;  3OJU A;  2ISP A;  2IOF K;  4QZA A;  1KFD A;  3F5E A;  3M9N B;  4YXJ A;  4OJP A;  1X9X A;  2HHQ A;  5KFQ A;  1ZQY A;  4UB6 U;  2JH1 A;  4KMU A;  4RNN A;  2JXJ A;  4RQ3 A;  2DPJ A;  4BXO B;  1QH9 A;  4DWI A;  3GZF A;  3DV9 A;  1ZQG A;  4ED3 A;  4F2R A;  2PMZ C;  1ZQL A;  2ODG A;  5DBB A;  4I27 A;  1ECW A;  3GV8 B;  1JMS A;  3PST A;  7ICS A;  4UBB A;  1SL1 A;  3KKA C;  5AKI A;  3QXG A;  2LBO A;  3N7P D;  3M8R A;  3JPP A;  3CRX A;  3TAD A;  4P4M A;  3Q8K A;  1RG6 A;  1O08 A;  1FFV A;  1X2I A;  4UAV A;  1XC9 A;  4ECS A;  4QZI A;  1NI3 A;  4ECT A;  8ICF A;  1ZQR A;  5KFW A;  4HAI A;  5AM5 A;  9ICG A;  3H40 A;  4EEY A;  4KTQ A;  5FP0 A;  4IR9 A;  3V7L A;  3HKZ F;  4O5E A;  5J0W A;  3MDA A;  1JXL A;  3E0F A;  2IOF A;  4UB3 A;  4DOB A;  2UVW A;  5AKZ A;  4B9U A;  2H3V A;  9ICI A;  4F72 A;  1V85 A;  4BGD A;  4ELV A;  5KT7 A;  1WG8 A;  1L6N A;  1UPH A;  2HBJ A;  3TI0 A;  1S0M A;  2P35 A;  2WFA A;  2V4Q A;  4ED6 A;  3PO4 A;  2IHN A;  4M47 A;  4J9S A;  4DL3 A;  4C8M A;  1NK7 A;  3AM9 A;  3RAX A;  2CXY A;  4UW9 A;  2VA8 A;  3H7I A;  1SB3 C;  2JR5 A;  5CJ7 A;  1EXN A;  5DB7 A;  3MBY A;  3RH5 A;  3QU2 A;  2Y0S C;  4QZE A;  3RB6 A;  4J9P A;  4EEK A;  1OUQ A;  1TAQ A;  1NK6 A;  1BPY A;  4RNM A;  1NKE A;  3PO5 A;  4PJ0 U;  5L1J A;  4DF4 A;  4BXO A;  4Q44 A;  1T3Q A;  1PK1 B;  3V6J A;  1S77 D;  1XO1 A;  8ICB A;  4EZ6 A;  1KRP A;  5DKW A;  2JHD A;  3Q8L A;  2R8I A;  3BQ7 A;  1LVH A;  1D8Y A;  1S9F A;  4J9L A;  5KT4 A;  4PHA A;  3EPG A;  4DLG A;  4C7Y A;  2R8H A;  1NJY A;  1HIW A;  5KFV A;  1DK2 A;  4DL4 A;  4PL2 A;  2HHW A;  5KFD A;  2M9N A;  4RQN A;  4KLT A;  2AGQ A;  2KMD A;  7ICP A;  5KAI U;  4AP9 A;  2M0N A;  2OHF A;  4DQQ A;  3BDP A;  4F4X A;  2ATL A;  5BPC A;  1FO4 A;  4ED1 A;  2H3Z A;  9ICL A;  4YVZ A;  4YN4 A;  4J9N A;  4DQS A;  4GXK A;  2F3N A;  3MR5 A;  3H8W A;  2EAM A;  4NJ8 A;  2HHS A;  3D2S A;  2Z7J A;  4I2I A;  2BCQ A;  2BPG A;  4DL5 A;  1XNS A;  2VIX A;  8ICZ A;  3KKA A;  3TFR A;  2QB0 A;  5CA7 A;  2ZUB A;  1WUD A;  2G5H B;  1CEZ A;  5D49 A;  5ALZ A;  5ALD A;  4ACO A;  4Q45 A;  1SKR A;  1B0X A;  3ZDB A;  2B21 A;  4XRH A;  1JUD A;  3WKA A;  4M0A A;  4F4Z A;  4I2C A;  1YZ6 A;  2HCF A;  3K1R B;  1QCK A;  4I2D A;  2XGQ A;  2KNJ A;  5ALG A;  4F5Q A;  3BZC A;  9ICH A;  1ZOL A;  5KG1 A;  2EZZ A;  2ASD A;  3V6H A;  5DG7 A;  5CHG A;  4QWE A;  2Y9T A;  1MN8 A;  2KG5 A;  1DGJ A;  1N56 A;  1ZQA A;  2BCS A;  4M9J A;  4USA A;  7ICT A;  1HJP A;  4ZH4 A;  3EWA A;  5G5G A;  4IS7 A;  2HBM A;  1CRX A;  3K1Z A;  3RRH A;  4DQR A;  5AM1 A;  1N61 A;  3F2C A;  3AUO A;  5KFP A;  1NZB A;  4DSJ A;  1KQQ A;  2FPM A;  2KZ3 A;  1ZRM A;  4ZOH C;  2YB1 A;  4ED7 A;  5ALH A;  4EYH B;  4O5C A;  4M9H A;  2YY6 A;  2BHN A;  1SL2 A;  4M9G A;  4F3O A;  4RQ2 A;  5AIC A;  1ZQQ A;  5IIM A;  5HP4 A;  4KLD A;  4UAZ A;  1Z1V A;  3D2Q A;  9ICU A;  2V4R A;  2C2D A;  8ICC A;  5H2F U;  2QLT A;  2ZIW B;  4TQR A;  2KV2 A;  1ZQZ A;  1SZP A;  1Z4N A;  4MF2 A;  2EAO A;  5AI6 A;  8ICL A;  3UQ2 A;  3L5K A;  3RB4 A;  3QNM A;  3GDX A;  2KZZ A;  1QQ6 A;  1SWW A;  2EZX A;  1OXJ A;  3PW2 A;  4DEZ A;  5DG9 A;  2W9C B;  3PR5 B;  3HWT A;  5J29 A;  2EQY A;  4JMU A;  1WYG A;  2ZG6 A;  2BQU A;  2KKP A;  1L3V A;  5AM3 A;  5T14 A;  4RPY A;  1ZQ1 C;  2Y9U A;  2DF4 B;  8ICI A;  5CWR A;  4ELU A;  5HHI A;  1X66 A;  3HRD D;  3C29 A;  7ICN A;  4FS2 A;  4RQM A;  3L4P A;  4RZR A;  5KFR A;  3VCB A;  3UM9 A;  2LKY A;  4PL1 A;  2N1R A;  3HP6 A;  2VKQ A;  3SAH A;  2JZB A;  3PY8 A;  1B4F A;  2VA3 A;  2ZTD A;  3QUB A;  1HUO A;  1ZQE A;  2LM1 A;  3L3F X;  4A8E A;  4IQT A;  7ICL A;  4DOA A;  5AI5 A;  1SXD A;  3ED5 A;  2I1Q A;  3SYZ A;  5KFJ A;  2KFZ A;  4F4W A;  1PVR A;  2R8K A;  2F44 A;  4DQI A;  5AK3 A;  3MDC A;  1ARO P;  4GLX A;  4K4H A;  2FDR A;  5AKG A;  4Q8E A;  4DO9 A;  1A0P A;  1DGS A;  1Z1B A;  3B0Y A;  3B9J A;  1U47 A;  5HHH A;  3NTU A;  3JPT A;  8ICP A;  5KFL A;  2ZIW A;  4UB4 A;  1UCV A;  1ZQO A;  4RUC A;  5EWG A;  5DBA A;  2FJ6 A;  5AI0 A;  2AQ0 A;  2F1H A;  4KX5 A;  5KFK A;  2MU2 A;  5L1I A;  2F1J A;  4OJL A;  3PSP A;  5JU5 A;  2JEI A;  4YXM A;  5KFT A;  3N4M B;  4Y2J A;  4C0Z A;  4PHP A;  1L3U A;  2C22 A;  1N5W A;  2R8G A;  2BKE A;  5KFH A;  2W8K A;  2FLL A;  2HHV A;  4I2B A;  4KLM A;  2W9C A;  3NAS A;  4MEX A;  1MC8 A;  2AH5 A;  1VLB A;  5J2J A;  2E8P A;  2PI5 A;  4QWD A;  4FZN A;  2H3I A;  4O3Q A;  9ICE A;  5JUM A;  5CP2 A;  2FLP A;  3BQ0 A;  2BR0 A;  3UMG A;  3NVY A;  2HW3 A;  5J0R A;  5L1K A;  4JK1 A;  3EZ5 A;  2RQ5 A;  1KW4 A;  1COK A;  3NS1 A;  2NRZ A;  4DSI A;  5DBC A;  2J6U A;  2NRX A;  4QZD A;  1PZN A;  2Y0S F;  2LYA A;  2P6U A;  1TV9 A;  3M7D A;  4M9N A;  2HDO A;  1JAL A;  2IMW P;  4C8L A;  9ICF A;  3AU2 A;  3PW5 A;  3MGV A;  8ICE A;  5KAF U;  3MR2 A;  2ZXH A;  2HOF A;  4KLJ A;  2OM6 A;  5EE1 A;  2MA1 A;  2FE9 A;  2D8C A;  4F2S A;  4YD2 A;  2OEH A;  3AQF A;  4TUP A;  1Z00 B;  4KX3 A;  1QQ5 A;  5BOM A;  2A3V A;  4NLG A;  3PX0 A;  1URJ A;  3E58 A;  7ICI A;  2O6K A;  4QZ9 A;  3UXP A;  2ASJ A;  5ALU A;  1L7M A;  2RP5 A;  3ISD A;  2PFN A;  1N60 A;  5B66 U;  5D46 A;  1HUZ A;  5CR0 A;  5F9N A;  2GH1 A;  4I2J A;  1RYU A;  5ALW A;  1J2M A;  4TUS A;  2D6F C;  5KFF A;  4Q43 A;  2CPR A;  1UT8 A;  1ZQB A;  9ICA A;  4PZN A;  8ICH A;  3M6Z A;  2VJ5 A;  2AGO A;  1V97 A;  4P4P A;  4QIW C;  8ICX A;  3AMZ A;  5AI9 A;  5J2B A;  1ZQW A;  1Q3U A;  1XSN A;  4IQU A;  5AKH A;  5KFX A;  3PW7 A;  3N97 B;  1TE2 A;  3KZI U;  4PHE A;  2GO7 A;  2XIC A;  4BDP A;  4YR2 A;  2JEJ A;  1RXV A;  2KFN A;  1DXS A;  7ICV A;  3DDH A;  4DSL A;  3GV5 B;  3GII A;  3EPI A;  2YML A;  4ECV A;  3ZI4 A;  5CEH A;  8ICJ A;  3KTQ A;  1B43 A;  5GTH U;  5AK4 A;  5J0S A;  3T79 A;  4Y2S A;  3ALR A;  4YG2 A;  2FI1 A;  5DLF A;  2GOL A;  2WB1 C;  3TAR A;  2IHM A;  5ALM A;  1UHU A;  2Q0Z X;  4CF4 A;  2JRZ A;  2G06 A;  5AIB A;  1Z00 A;  5ALF A;  2XVT A;  5HML A;  3T5J A;  4G9B A;  2ALZ A;  3OTQ A;  4RT2 A;  5L1L A;  5DB6 A;  5J2H A;  1RDF A;  2EAP A;  3F2D A;  3HPO A;  4DOC A;  2F76 X;  1TAU A;  3TAN A;  4GC6 A;  2KD1 A;  4F4Y A;  5TIS U;  5CRX A;  4P4O A;  1UA1 A;  1C7Y A;  1S97 A;  1X42 A;  2G07 A;  1JI7 A;  3KD3 A;  1L3T A;  8ICT A;  4B9L A;  1ZD2 P;  1SWV A;  1BPB A;  2NRW A;  2KSO A;  1ED1 A;  2MUT B;  5HR6 A;  4KLI A;  4IRD A;  3C23 A;  3F53 A;  2HI0 A;  4KLL A;  4TUQ A;  5DB8 A;  5ALE A;  2KVS A;  4FE3 A;  2W43 A;  3TKA A;  1KBU A;  1V38 A;  4OO1 J;  5J0Q A;  2KIV A;  2PFQ A;  3UMC A;  5AIA A;  1LV5 A;  5J0U A;  8ICQ A;  1TFR A;  2QB0 B;  2GWS A;  4UB5 A;  2WF6 A;  5HR7 A;  2JGA A;  1T7P A;  9ICX A;  4PGY A;  4GFJ A;  4NV0 A;  2XCA A;  3UQ0 A;  5L1M A;  1T8E A;  2LMR A;  4RU9 A;  1WWV A;  7ICO A;  1COO A;  5J2E A;  1JRP A;  5J2A A;  3DEE A;  4KN7 A;  3SMV A;  4I2G A;  4IQW A;  2YTU A;  4EX7 A;  2XID A;  5KL1 B;  5AKY A;  4FZM A;  2A1A A;  1SV0 A;  1Q3V A;  1N5X A;  9ICR A;  3PMN A;  1YT3 A;  1ZD3 A;  4AYB C;  1BPZ A;  4F93 B;  1KEJ A;  3GIJ A;  3BS7 A;  3WK8 A;  4J9M A;  4NXZ A;  5EOZ A;  2NV3 A;  1RYS A;  3D2N A;  4MF8 A;  3M9M B;  3HW8 A;  3C1Y A;  7ICU A;  4JWN A;  4F91 B;  3IN5 A;  2DWQ A;  4LZG A;  3RJG A;  5EWF A;  2IA6 A;  2OCE A;  4RPX A;  3NRZ A;  1J97 A;  1N63 A;  1WCN A;  1OW5 A;  2MUT A;  4Y2V A;  3AEV A;  4CGZ A;  3FAH A;  2P66 A;  2KJ5 A;  1NJW A;  2WAQ C;  2NO5 A;  5HMM A;  2JEG A;  2RRD A;  3MR6 A;  1XU4 A;  3WKD A;  4F5P A;  3BS5 A;  2ZTE A;  4BWJ A;  4C7Z A;  3PML A;  4B9V A;  2R18 A;  3T5L A;  4FBT A;  4IQV A;  3QX7 A;  3PSF A;  4R8U A;  4C4T A;  2KTQ A;  4DFM A;  5C5J A;  3V7K A;  1MA7 A;  2KJ8 A;  5EWE A;  5KFG A;  4P0Q B;  3C5F A;  4O3M A;  2H3Q A;  3PX6 A;  2HHT A;  1UQV A;  4JV2 A;  2W3R A;  3K75 D;  5B5E U;  3LDA A;  5J0Y A;  3MR3 A;  4B9M A;  4K4I A;  1ZQI A;  2F1I A;  3RRG A;  3SEI A;  1ZQD A;  3ZDD A;  7ICR A;  2DL0 A;  4DFJ A;  5DQI A;  8ICA A;  1RM6 C;  4DFD A;  2FPK A;  3ISB A;  9ICV A;  2XCP A;  2DQN B;  4ICA A;  3TQ1 A;  2I9G A;  3QEB Z;  3RJI A;  4OJO A;  1A6S A;  1Z3E B;  2HVI A;  2ZIX B;  2JZB B;  2H3F A;  4IRK A;  4P0P B;  3C5G A;  2YMM A;  2LYH A;  3QZ7 A;  5KFU A;  4DS5 A;  2W9M A;  4Y2P A;  2KN7 A;  1XSL A;  4R64 A;  7ICM A;  2KKV A;  4QW8 A;  3RJJ A;  4PGQ A;  1TKD A;  3IRU A;  3OHB A;  1ZXI A;  1JX4 A;  3EUB 2;  2ZIV B;  4RQ4 A;  5D4B A;  5KFN A;  1Z19 A;  2DKX A;  2BQR A;  4MHV A;  4KIT B;  1PVP A;  5ALS A;  4R63 A;  4DCC A;  4O0I A;  2RHF A;  3QU9 A;  3MGI A;  5KG7 A;  2HMX A;  3IP4 B;  4OJ6 A;  5KG3 A;  2P6R A;  2HHX A;  3PW0 A;  2Y1J A;  1KLN A;  3QU5 A;  2E8O A;  2FMS A;  3H8S A;  3HX0 A;  1PK3 A;  3QE9 Y;  1ZRN A;  2VJ4 A;  1P7D A;  2DPI A;  3TAP A;  1ZQS A;  4UB8 U;  4FS1 A;  4Z6C A;  5IIL A;  4LJX A;  1ZD4 A;  5KT3 A;  3TAC B;  2NYV A;  2WTF A;  4YCX A;  4P0Q A;  1BVS A;  2E1E A;  3EW9 A;  1S0N A;  4EBC A;  3Q8M A;  2UVV A;  2UVU A;  8ICY A;  1BPE A;  1D8L A;  1UA0 A;  1LKY B;  3HKZ C;  4F92 B;  4JWM A;  2ZJ5 A;  2BGW A;  5KFE A;  9ICK A;  2BPC A;  4KLU A;  1U49 A;  3PR4 A;  2ZTC A;  4YR3 A;  4UAS A;  1Q8K A;  1MQ2 A;  4YMN A;  2ZUC A;  4JB3 A;  2QKQ A;  4QWA A;  1RQL A;  4C8O A;  2KJ9 A;  5AK6 A;  2ZIX A;  1Q46 A;  2MSN A;  1NKB A;  4P0P A;  4RQ5 A;  5DDM A;  3QZ8 A;  1ZJN A;  3LVW A;  3FC4 A;  4QNL A;  5IIO A;  5KT5 A;  2PFO A;  4LVS A;  4O3P A;  2PMZ F;  3IV6 A;  1ZJM A;  2J6T A;  2ZIV A;  2XI9 A;  2CRX A;  2A1J B;  2K8C B;  3H0M B;  4F5N A;  1MQ3 A;  4RUA A;  2HOI A;  2WF9 A;  3O0F A;  4LZD A;  1ZQC A;  2F2A B;  1MSW D;  1NK5 A;  3KOO A;  4IC9 A;  5ALY A;  3M8S A;  4RQ0 A;  3N28 A;  3ZD9 A;  3T5K A;  3AQE A;  3WK4 A;  4PGX A;  1U45 A;  3ICX A;  3SQI A;  3J81 j;  5ALV A;  1NZP A;  1JIH A;  4ECR A;  4YMM A;  5EE9 A;  5K4L A;  2DBY A;  3M9O B;  1QSS A;  2RDI A;  4U6P A;  1S10 A;  4DSK A;  2BZF A;  1LKY A;  1T4G A;  5J2C A;  3PV8 A;  5KFB A;  1ZQV A;  1SL0 A;  1U9L A;  2AHO B;  3MFH A;  3PVX A;  4BX9 C;  2W8L A;  5DDY A;  1ZET A;  2BDU A;  1ZYQ A;  4DSF A;  2MRL A;  1H38 A;  4FFD A;  4OCZ A;  2C2E A;  4OJ5 A;  5EE0 A;  4F5O A;  5ALX A;  2I5H A;  1YZ7 A;  1IM4 A;  1DRG A;  2AU0 A;  2D3D A;  2OYY A;  2KOB A;  4DL7 A;  5DG8 A;  4O3S A;  5F9L A;  4P2H A;  3ETR A;  4NWI A;  1ZQK A;  2BCR A;  4GC7 A;  2EH9 A;  3MFI A;  4US8 A;  2IOH A;  3RJE A;  3RB0 A;  5DLG A;  4Z6D A;  8ICM A;  5J2I A;  4Y2R A;  2F8K A;  5DGA A;  2A1J A;  3V7J A;  2YX8 A;  5IIN A;  4CCH A;  3RJK A;  2KHV A;  1U48 A;  2E8N A;  1K1Q A;  3VC8 A;  4M04 A;  1GO3 F;  3LK9 A;  2HVH A;  4O5K A;  4OD0 A;  1F0M A;  3H0R B;  3OPX A;  9ICP A;  4UBC A;  4XA5 A;  3ZDE A;  5AI4 A;  4BUG A;  5AM2 A;  8ICW A;  2EZY A;  3KZX A;  2GLE A;  2KSO B;  2W54 A;  4US9 A;  3MAB A;  2XY7 A;  2W3S A;  3OJS A;  3PZP A;  5KFS A;  9ICJ A;  1VJ5 A;  4EEL A;  5EE3 A;  4NY8 A;  2ZJA A;  9ICC A;  4DF8 A;  3OHA A;  5DGB A;  3V6K A;  4QZH A;  3GU3 A;  3T3F A;  4IRC A;  2RDJ A;  3RH6 A;  2FMP A;  4ED2 A;  2QAR B;  4FZL A;  2JMG A;  1SV0 C;  1RQN A;  3GIK A;  2XY5 A;  2DUY A;  4CE6 A;  2AXT U;  2W04 A;  4NLZ A;  2IBK A;  2B0C A;  2YB4 A;  2B6G A;  4PHD A;  3I76 A;  4ECY A;  1DK3 A;  3R9K A;  1TVA A;  4QW9 A;  3ONN A;  4ECQ A;  9ICB A;  5AI8 A;  3JPO A;  3PW4 A;  2A19 A;  2I6X A;  2KHQ A;  5KG4 A;  4X5V A;  3RFA A;  1BNP A;  3CW2 C;  3GIL A;  4NM2 A;  4GXI A;  5KT6 A;  4XUS A;  8ICK A;  1KN5 A;  3BQT A;  4CDG A;  2F77 X;  5J0T A;  4RPZ A;  1ZD5 A;  5F3X B;  1LB2 B;  4JUZ A;  2AQ4 A;  4NM1 A;  5L9X A;  2K8B B;  2XY6 A;  4QWC A;  3LVV A;  2KZM A;  1S0V A;  1NK9 A;  5KFO A;  4DFP A;  2EDU A;  1L3S A;  5DB9 A;  2JV3 A;  1L7P A;  1K1S A;  5J0O A;  4NL9 A;  2BCU A;  5J0P A;  2HBL A;  1Z4O A;  5CB1 A;  2W9B A;  5ALT A;  3PSI A;  2L5Y A;  2ISO A;  5ALL A;  2PXI A;  4F8R A;  3Q8S B;  5KFZ A;  4G3I A;  3PX4 A;  5GTI U;  2UVR A;  8ICN A;  1ZQH A;  3M6K A;  1ZQU A;  4JV1 A;  3M1Y A;  5JRT A;  1X9M A;  3A0H U;  7ICH A;  2ESE A;  4NLC A;  2PKE A;  2PI4 A;  4U7C A;  4MFA A;  1PUZ A;  5BOL A;  3BS5 B;  1TAM A;  2QAR A;  5AM0 A;  2MAX A;  1FFU A;  4EBE A;  4KLS A;  4R8U B;  4J03 A;  1A77 A;  1S5L U;  3LYS A;  2XO7 A;  1S76 D;  3WKE A;  4DL6 A;  2K4H A;  3IG5 A;  1O03 A;  3GV7 B;  3KHH A;  2RLT A;  5AKX A;  2G08 A;  2KE7 A;  2W55 A;  3JPN A;  2OXO A;  8ICV A;  3SEN A;  4O3N A;  2W7O A;  4RT3 A;  4EX6 A;  1S8O A;  3GFK B;  3C21 A;  1ZQM A;  4TUR A;  3MC1 A;  7ICQ A;  3G6V A;  4M6W B;  1WWU A;  3SV3 A;  1SKS A;  2KIC A;  4ECZ A;  3WK5 A;  3FM9 A;  3QUC A;  3BJY A;  1ZQN A;  2W7P A;  1F5S A;  3RR7 A;  1J2N A;  4M2Y A;  4KLE A;  2E8M A;  3NVW A;  4J9Q A;  4QZ8 A;  5J0X A;  3LWM A;  2E1F A;  3CYM A;  5KT2 A;  1Y88 A;  5KNI A;  2WF7 A;  4F5R A;  1UT5 A;  4QZB A;  3G6Y A;  4K4G A;  9ICW A;  2LYB A;  4YP3 A;  8ICS A;  4O3O A;  4I2A A;  2YN4 A;  3H8M A;  4F71 A;  4NLB A;  3RBE A;  4PH5 A;  8ICO A;  4I2H A;  1L7N A;  3Q8P B;  4Z6E A;  3AN1 A;  2HSZ A;  2ZUD A;  4QWB A;  3IG8 A;  5ALI A;  3BQ2 A;  4RQ8 A;  4C4S A;  9ICT A;  3SAG A;  4WJ3 B;  7ICK A;  3PNC A;  2J6S A;  4UAU A;  2FMQ A;  1QLN A;  3UXO A;  4RQ7 A;  2KP7 A;  3BQ1 A;  3UPQ A;  3TAQ A;  1XSP A;  2DFL A;  1SGG A;  3CNH A;  2BCV A;  2K4E A;  3F2B A;  5JTI A;  2LHT A;  3BZK A;  4PPX A;  2AGP A;  5J2G A;  1SZH A;  3ISC A;  1V9P A;  4C4R A;  2HOQ A;  3QUQ A;  3C28 A;  3ETL A;  4DQP A;  4YR0 A;  1N48 A;  4ECW A;  2PFP A;  1QSL A;  1L8L A;  2C2R A;  1HEK A;  4YMO A;  1ZQT A;  4M6W A;  4UAR A;  3HJE A;  5E79 U;  4J9O A;  4ELT A;  4DSE A;  1RXW A;  1VDV A;  7ICE A;  5J2K A;  3AL0 B;  4DS4 A;  5KTQ A;  3C2K A;  4O9M A;  3K4G A;  5TZV A;  2KEY A;  2KVC A;  1ZQX A;  3S6J A;  4MFC A;  3THV A;  5AK5 A;  5AKK A;  4C80 A;  1N2X A;  4B9T A;  4KLG A;  1KFS A;  4B6J A;  1TK0 A;  1X6J A;  5AKE A;  3WK6 A;  4FO6 A;  3C2L A;  1PK1 A;  3GQC A;  4GIB A;  1BPX A;  3NUQ A;  5ALO A;  3JPS A;  4MEY A;  1BPD A;  3QU4 A;  4UB1 A;  4NLK A;  1KTQ A;  2H5X A;  2XGP A;  4Y2T A;  2W11 A;  2BPF A;  4Y2Y A;  3RH4 A;  1FEZ A;  4IR1 A;  5ALJ A;  4R65 A;  1RYR A;  5III A;  3KHL A;  3RJF A;  4QIW F;  4FBU A;  3SAF A;  2AJQ A;  3QU7 A;  3IM1 A;  5KG6 A;  4RQ6 A;  2LM4 A;  3ORY A;  8ICU A;  1ZQF A;  2DKZ A;  2C28 A;  2BQ3 A;  2OH2 A;  4Z6F A;  2KIW A;  2DGZ A;  3KHG A;  5KFY A;  1X9S A;  3RAQ A;  2VAN A;  4GXJ A;  1NK4 A;  2Q4T A;  5KL8 B;  2K60 A;  1X6I A;  1XS9 D;  3N7R C;  1S0O A;  4KLO A;  1SIJ A;  2BDP A;  9ICS A;  3SD7 A;  4I28 A;  2NRT A;  2ASL A;  2ZIU B;  3T5H A;  2WB1 F;  5KFA A;  3QEA Z;  1NK8 A;  4XQ8 A;  7ICG A;  1RZT A;  1CUK A;  4M9L A;  5DQG A;  9ICO A;  3RB3 A;  4TQS A;  4J9R A;  4F4K A;  3RR8 A;  5IIK A;  4YD1 A;  1BGX T;  4QZC A;  4CF3 A;  3H4B A;  4ED0 A;  1QSY A;  1SKW A;  3I1Y A;  3WK9 A;  4CNQ A;  3NVV A;  5ALK A;  4O3R A;  1X9W A;  1IV8 A;  1TK8 A;  4I2F A;  4KMO B;  1NNL A;  3JPQ A;  3U26 A;  3GIM A;  2YMP A;  3RTV A;  1N62 A;  2VA2 A;  2K89 A;  2WF8 A;  1K5O A;  2G0A A;  1T94 A;  3FYH A;  5KG5 A;  3NRW A;  3SV4 A;  4MFF A;  4EYI B;  5J2D A;  5KG2 A;  3UXN A;  3WKC A;  4ECX A;  2K4P A;  4UAW A;  4NLN A;  3CP8 A;  2KK0 A;  4ED8 A;  5ALQ A;  3SR6 A;  1D9F A;  1FIQ A;  4RNO A;  4KLH A;  3WKB A;  2R8J A;  2G09 A;  4Y2Q A;  4RQ1 A;  1L5U A;  9ICM A;  5J8Y C;  4UAT A;  3OGU A;  1KFT A;  3JPR A;  3KBB A;  1KL9 A;  3LWL A;  4CRX A;  2XC9 A;  1BNO A;  4EBD A;  3H4D A;  3G6X A;  3V72 A;  2QB1 A;  2WHE A;  2W03 A;  1JXE A;  2ZIU A;  3Q8Q B;  4DL2 A;  1JRO A;  1RPL A;  2ES6 A;  3AU6 A;  3NVZ A;  1KKX A;  2YQE A;  5ALP A;  3ZD8 A;  2HHU A;  2HBK A;  2NO4 A;  4F50 A;  5KFM A;  4NL9 C; 
#chains in the Genus database with same CATH homology
 2DKX A;  2JV3 A;  2EAN A;  2E8M A;  4MHV A;  3IDW A;  1V85 A;  3HIL A;  2E8N A;  4NL9 A;  5KNI A;  2L5Y A;  1OXJ A;  1B0X A;  1PK1 A;  1F0M A;  3BS5 A;  2E8O A;  2E8P A;  1V38 A;  2KIV A;  3K1R B;  1PK3 A;  3H8M A;  2GLE A;  2KSO B;  2Y9U A;  1X40 A;  2QB0 B;  1DXS A;  1SXE A;  2Y9T A;  5JRT A;  2KG5 A;  3TAC B;  1X9X A;  1X66 A;  1KW4 A;  1COK A;  4RQM A;  5L1M A;  2ESE A;  3TAD C;  2LMR A;  1WWV A;  4IS7 A;  1PK1 B;  1UQV A;  3BS5 B;  2QAR A;  2YTU A;  1LKY A;  4PZO A;  2K4P A;  2QAR B;  1SGG A;  1LKY B;  1B4F A;  1SV0 C;  2DKZ A;  3BQ7 A;  3SEI A;  5JTI A;  1SV0 A;  2DL0 A;  2B6G A;  2FE9 A;  1SXD A;  2D8C A;  1SV4 A;  3KKA C;  2LPE A;  2K60 A;  2F44 A;  5J8Y C;  2EAP A;  2QKQ A;  4RQN A;  3TAD A;  2KMD A;  2KE7 A;  3BS7 A;  1RG6 A;  2D3D A;  3SEN A;  1Z1V A;  2QB1 A;  5F3X B;  1WWU A;  2F3N A;  1UCV A;  1JI7 A;  2EAM A;  4NJ8 A;  2ES6 A;  2EAO A;  1OW5 A;  3KKA A;  2KSO A;  4PZN A;  5JU5 A;  2QB0 A;  5J8Y A;  2F8K A;  4NL9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...