2KMDA

Ras signaling requires dynamic properties of ets1 for phosphorylation-enhanced binding to co-activator cbp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
109
Chain Sequence
HMECADVPLLPSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to coactivator CBP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, protein binding
molecule keywords Protein C-ets-1
total genus 29
structure length 109
sequence length 111
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kmdA01
2DKZA 1SV0A 3TACB 2QARA 2K4PA 2E8MA 2GLEA 1X66A 2KSOA 2D8CA 3SEIA 2QARB 1KW4A 2EAMA 5KNIA 5JRTA 3HILA 2KIVA 1X9XA 1UQVA 4NL9C 5JTIA 1LKYA 1UCVA 2B6GA 4PZOA 1PK3A 4IS7A 3KKAC 1JI7A 1WWUA 2D3DA 1B4FA 2EANA 2KMDA 1PK1B 4NL9A 5JU5A 3BQ7A 1RG6A 1SV4A 1SV0C 3TADC 2EAOA 5L1MA 1F0MA 2F44A 1DXSA 4NJ8A 2F3NA 2JV3A 2F8KA 1OXJA 1PK1A 2DKXA 2ES6A 4RQNA 2QB0B 5F3XB 2K60A 1SXDA 2DL0A 3BS5B 2KSOB 4MHVA 3SENA 3TADA 5J8YA 1SGGA 2E8PA 4PZNA 2ESEA 3BS7A 1LKYB 1B0XA 1V85A 2FE9A 1COKA 3KKAA 2E8OA 2Y9TA 2LPEA 2Y9UA 3K1RB 2QB1A 2QKQA 2L5YA 2E8NA 3H8MA 3IDWA 2QB0A 1WWVA 5J8YC 1SXEA 2KE7A 3BS5A 2KG5A 1OW5A 4RQMA 1X40A 1Z1VA 2EAPA 2LMRA 2YTUA 1V38A
chains in the Genus database with same CATH superfamily
5AKXA 4C8LA 3V72A 4UAVA 3O0FA 3C21A 4FBTA 4IQVA 9ICSA 4KLOA 3KD3A 4FE3A 3GILA 4IQWA 5AICA 2BR0A 3A0HU 1QSLA 1ZQHA 1X42A 5JRTA 4M04A 2HBLA 5CJ7A 3NVWA 7ICEA 1X9XA 4B9NA 1ZQNA 2W8KA 1DOQA 1LKYA 2Q4TA 5KFUA 1D8LA 4C4TA 2AXTU 3ISBA 4GLXA 1A77A 2KP7A 4F4ZA 1U49A 1NK8A 1Z3EB 4CE6A 2WF5A 5AM0A 2LBOA 3TARA 1S0MA 3EW9A 3ZDDA 5KFWA 3C5GA 5KFNA 2F3NA 2ASLA 1ZQVA 3JPSA 4AYBC 2H3VA 2A3VA 2BKEA 7ICNA 2ZIUA 4KX5A 5KFFA 4M9HA 1JUDA 4MF8A 3D6JA 5KFQA 4M9NA 1RXWA 4Y2XA 2W7PA 1L8OA 2DQNB 4OJPA 3OSNA 3QNMA 5DB8A 1BPBA 4F4KA 3OHAA 9ICAA 2KVSA 2ZJ5A 5KT3A 5FP0A 9ICMA 2IOFK 1XC9A 1ZXIA 3JPQA 2I6XA 2PI5A 5DBBA 3FM9A 2EAPA 3G6YA 1V38A 2DKZA 3KHHA 4DQIA 1V97A 5KFTA 3FC4A 3M7DA 3NASA 5ALZA 2E8MA 7ICUA 1ZQFA 9ICBA 4ELTA 4UB1A 2Y0SF 4USAA 4ECUA 1IM4A 3RB6A 1KFTA 4DF4A 2BGWA 1QSYA 1KFDA 1P7DA 1UPHA 3LVWA 3QU2A 2D6FC 5IILA 2HHXA 2ISPA 1NI3A 4FZLA 1WWUA 2R8KA 4KLDA 2DGZA 5KT6A 2AJQA 2NO4A 3CW2C 5EE3A 4R8UA 2ZUBA 4NM2A 1JMSA 1SV0C 5J0UA 4QZHA 3QU5A 4F2RA 3GV5B 4NLGA 2FMPA 4KX3A 4EBCA 2PFOA 3V6JA 5J2KA 4QZDA 3RFAA 4DL5A 1NKEA 2DL0A 1ECWA 1L3UA 2KKVA 3SR6A 1N5XA 3K75D 3H8SA 3L4PA 4MEYA 3KBBA 3EPIA 4M6WB 4KLLA 3V7LA 3GIMA 1D9FA 4UAUA 4I2JA 3MGVA 1L7PA 2A19A 3JPNA 2W9MA 1Z00B 4P2HA 3GU3A 4UQGA 4IRDA 4QZEA 2HOFA 2HBMA 3PSPA 3HW8A 3UQ0A 3OSPA 4GC6A 2JMGA 5DKWA 8ICKA 4RQMA 1X40A 7ICLA 3B0XA 2QARA 1N60A 1T7PA 4YR3A 1PZNA 5L1JA 1TAMA 3SMVA 4Q43A 4B9UA 8ICOA 5DDMA 4P4OA 1KN5A 4CF5A 2KKPA 4M9GA 5CEHA 3KOOA 4OD0A 2K8BB 1UCVA 2KOBA 3ONNA 2HBKA 4YMNA 2MRLA 4MEXA 4DL2A 2F1JA 4UB2A 4DSFA 2KICA 7ICTA 1ZD4A 4QWDA 1TK5A 3SZ2A 1T94A 2FDRA 5KFPA 1SL1A 2ZTCA 5DQIA 4F92B 3C28A 3C2MA 5J2FA 3T5LA 5KFSA 2BCSA 2XC9A 2R8HA 2JZBB 1J97A 2RQ5A 1DK3A 2ES6A 3UXNA 4O3NA 3MDAA 5J8YA 2JEIA 1JN3A 4PZNA 2ESEA 1UT5A 4F5PA 4F5QA 3ZDCA 3WK4A 3C2KA 3NVZA 3EWAA 5J2CA 5DBAA 4ZOHC 2BCUA 4P4MA 3JPRA 3UMGA 4Y2UA 1S10A 1PVPA 2ZUDA 2NO5A 1MSWD 5AM5A 4ED0A 4F4XA 4UASA 2W7OA 5KG5A 1URJA 1WYGA 1L8LA 4PL2A 5J8YC 1J2NA 5J0OA 3QUQA 3BS5A 4O3PA 3I76A 4I29A 2NRTA 1KDHA 1QQ7A 1Z1VA 4I28A 1ZQTA 1S76D 1KL9A 1RYSA 2G06A 2K4PA 4J9RA 4I2BA 4E0DA 2CRXA 3AEVA 3F2DA 1H38A 1X6JA 4CRXA 1BGXT 5KAIU 5ALLA 1LVHA 4ECVA 2C2RA 3PX6A 4DSIA 3MABA 1CI4A 2KHVA 2MSNA 9ICKA 1U47A 5ALNA 2BHNA 5CRXA 5ALHA 1S97A 1B4FA 4QZ9A 4NXZA 3MC1A 4J9QA 4NY8A 2XCAA 4C80A 3FYHA 1CEZA 2BPFA 5KFGA 3HRDD 4WJ3B 4BWJA 4BX9C 2GO7A 2YQEA 4A8EA 3PX0A 1A6SA 2K8AA 2W54A 4Q45A 2ZIVA 4DQPA 2ZJAA 1PK1A 2DKXA 1ZQDA 1B43A 5KG1A 8ICLA 2JR5A 2A1AA 4DL6A 4EZ6A 5ALQA 3BS7A 5DGBA 2RHFA 3F5EA 1ZQZA 2VJ5A 5BOLA 5DG9A 4TUSA 1TE2A 3GV8B 3ED5A 1FO4A 3QZ7A 3T3FA 5KFKA 2K8CB 4ECZA 1N48A 2KNJA 2W43A 2JRZA 5KFHA 2PFQA 4B9SA 5ALEA 2DWQA 5KL1B 5KG7A 1L6NA 2QLTA 2HHSA 5J0QA 3G6XA 4PJ0U 3NGDA 5BOMA 1ZQGA 3IN5A 2EQYA 3EZ5A 3F2BA 2UVUA 4QZ8A 5C0YA 3C1ZA 3GDXA 8ICQA 3MBYA 2J6UA 2WB1F 3QU9A 8ICTA 4TUPA 4RU9A 5AIAA 1SB3C 2C22A 3WKBA 5IIMA 3HKZF 1FFUA 4I2AA 3MGIA 3THVA 1KQQA 3K1ZA 3BQTA 2LYBA 4KLMA 1BPDA 5AKZA 3AU6A 3SV4A 5J0SA 4UB6U 1S9FA 2FMSA 3TAQA 4YG2A 3RB3A 3RH6A 1KLNA 1IIPA 1NZPA 3KTQA 2PMZC 4UAZA 3HILA 3S6JA 3HWTA 3QUTA 2OM6A 4DL4A 3R9KA 2B6GA 3ISCA 2JHDA 3DEEA 1RG6A 3RJFA 5EWFA 2B0CA 4YD2A 4R63A 1JRPA 5HMLA 3H40A 3AQEA 3RJGA 3VCBA 1JXEA 4DSKA 3E58A 2NRZA 2JH7A 1SXDA 1ZQIA 2BQUA 3HJEA 3OPXA 4QWBA 2W9AA 3RR7A 3IRUA 3LDAA 3ORYA 4RT3A 3SV3A 4UB4A 1Q8KA 2Y9TA 4TQSA 3CNHA 3H4DA 2P6UA 3J81j 1TFRA 3SD7A 4K4GA 3BQ0A 5B5EU 1XO0A 4NLKA 9ICRA 4AYBF 2OCEA 3C29A 3IP4B 3C1YA 2XO7A 4PHPA 4O3OA 8ICJA 1SL2A 3PZPA 2P6RA 4I2EA 3IHQB 4BUGA 1D8YA 5ALMA 4KLGA 1IG6A 3PVXA 2BDUA 1ZYQA 1MQ2A 3OJUA 5J2BA 2BPCA 2A1JA 5L1KA 2W9CB 2LM1A 1NK9A 4C7ZA 3GV7B 4EENA 4BXOA 5KL8B 3MR6A 4UATA 3UMCA 3ZDBA 1PVRA 1J2MA 2GOLA 5DBCA 1N56A 4QWCA 1TAQA 3RR8A 4UAYA 4YR2A 4IRCA 1PK3A 1ZQQA 1JI7A 4YMMA 2YMQA 1EXNA 4RPYA 1RZTA 4M0AA 1ZD2P 4RPZA 5EE9A 5IIJA 1XSPA 2DPJA 2PI4A 1Z1BA 5HR7A 2KVCA 1TK8A 4FO6A 4O3SA 4DOCA 1DXSA 2IHNA 2R8GA 2VJ4A 1VLBA 2F8KA 2E1EA 1OXJA 2O6KA 3Q8SB 4PL1A 1ZETA 2ZIXB 1COOA 1U48A 3PY8A 3N97B 3SENA 5J2HA 1S0OA 5KFIA 3RBDA 1WUDA 2G5IB 5A0LA 5AK4A 4ACOA 1V85A 2PKEA 1ZD5A 4Y2QA 3KKAA 2ZXHA 5ALVA 2NYVA 4DWIA 4YD1A 2HOIA 1RYUA 3PSIA 2G0AA 1N63A 3PMLA 2G09A 5DB6A 3F2CA 2JEJA 1TKDA 4F50A 4C8NA 2R8JA 3RJIA 4RNMA 1U4BA 4EYIB 7ICKA 2YMMA 4C4SA 4YVZA 2XGPA 1ZQOA 3B0YA 4DQRA 4QZAA 3AUOA 4RUAA 4DL3A 1KTQA 3UM9A 4J9LA 2KIWA 2VA8A 2KSOA 2Y1IA 1NOMA 4LZGA 2HVHA 1XU4A 4FFDA 4O3RA 4B9LA 2HHUA 2E5SA 1L3TA 2K4IA 1NK0A 3ZI4A 3OHBA 1NJXA 4RQ2A 3M1YA 5ALSA 5AK6A 3KZXA 4P4PA 5HP4A 5KG6A 3BZKA 2EANA 3JPOA 3GIIA 1PK1B 7ICGA 8ICRA 4PPXA 4Z6CA 5JU5A 2E1FA 1ZQYA 2YMLA 4IL6U 3N7PD 4F8RA 4NJ8A 4U6PA 4ECRA 2XI9A 2QB0B 4JV0A 4GXKA 1ZQRA 5AKHA 4PHAA 2M9NA 3B9JA 4F5NA 4RUCA 4ED2A 4RQ5A 3IV6A 4X5VA 4IR1A 3K4GA 9ICVA 2EZYA 3TFRA 4XUSA 4K4IA 2QKQA 4Y2VA 2E8NA 2Y1JA 1QSSA 2WF7A 1QQ5A 2FPMA 5AKYA 3RBEA 3QUBA 5HHHA 2YY6A 1Z00A 3PV8A 3U26A 2VA2A 1Z4NA 4ECTA 1BNOA 1QLNA 2MA1A 2WFAA 4UARA 2KFNA 1TAUA 5J0XA 4QZFA 5J2DA 4I27A 2ATLA 1ZQSA 3WK8A 1L3SA 4OJ6A 2W9BB 5KFDA 1WG8A 4QZBA 9ICTA 2GH1A 3TACB 5AKEA 3PO4A 2FPKA 2GLEA 2KJ5A 3A0BU 3CP8A 5L1LA 3FAHA 1BPYA 3AQFA 2KHQA 2W03A 2FLLA 3F53A 3QU7A 3MFHA 5KNIA 4FS2A 8ICEA 5AI5A 3KHGA 1DGSA 4ED7A 4C4RA 2BZFA 4TUQA 5KFBA 4Z6DA 5CA7A 4I2GA 4QW9A 1AQ6A 2ZXIA 2UVWA 5AKLA 4HYKA 4UB3A 4Q8EA 2Y0SC 3FDSA 5DGAA 3M8RA 4U7CA 2AH5A 1L3VA 3MFIA 4OJ5A 4NLBA 3QEAZ 1BPZA 5EWEA 1HUOA 3M6ZA 3QUCA 1K5OA 1N62A 3WKDA 2F8LA 4F3OA 3CYMA 4RNOA 4DFMA 4EYHB 4XA5A 3RF9A 8ICCA 4YFKA 5L1IA 4YXMA 5KT2A 4QZGA 1ZQBA 1S8OA 3N7RC 3Q8LA 5ALPA 2L5YA 3H0RB 8ICFA 2IA6A 1NNLA 3BQ1A 4C8KA 4KTQA 5J0PA 4DSLA 4O9MA 4OO1J 1LB2B 5IIKA 2KE7A 5DB7A 3NTUA 4UB8U 1KRPA 3ISDA 2VANA 5AI9A 5KFCA 4KMUA 2FMQA 4F72A 3DDHA 9ICPA 1NK4A 2AU0A 3C23A 4EBEA 1O03A 2KV2A 2QARB 1KW4A 3RB0A 5ALJA 1ZJNA 3M9OB 5IIOA 2ZIWA 4DCCA 3UXPA 3M6KA 3GIJA 1AROP 1T3QA 3TAPA 4FS1A 4O5KA 3E2EA 2HW3A 2F76X 4G3IA 8ICAA 4RPXA 5GTIU 1NK6A 5ALWA 3BJYA 4DO9A 8ICMA 4ECWA 4XQ8A 4Y2TA 5KTQA 4ED8A 5EE0A 4EZ9A 4CGZA 2ZIUB 5AKGA 4PH5A 4RNNA 2KN7A 2XIDA 2EAOA 1F0MA 4NV0A 3LYSA 3T5KA 5J2IA 2EDUA 2DFLA 3ETLA 1SKWA 3QEBZ 2FLPA 3PW4A 1XO1A 2JZBA 2K89A 1WCNA 1LKYB 4DFKA 2FPLA 5ALOA 5ALFA 2W55A 2IMWP 3BDPA 2XY5A 4IQTA 2Z7JA 4F2SA 3ZDAA 5AI4A 1JROA 1K1SA 2V9WA 2W9CA 1S0VA 4QZIA 2HHQA 2OWOA 4EX6A 5AK3A 1ZQWA 4RQ3A 4UAWA 3PR4A 4LVSA 1CUKA 9ICQA 4I2DA 4B6JA 7ICQA 1A0PA 3DV9A 4DLGA 2J6SA 5HR6A 1FFVA 5KFOA 3ALRA 2IHMA 5KFAA 4J9SA 1JX4A 2LMRA 9ICCA 2ISOA 2AQ4A 2WAQC 5EWGA 1S77D 5KFLA 5GTHU 3PMNA 3L3FX 1NKCA 4M47A 1SIJA 4R64A 4Q44A 1HUZA 2IBKA 4EELA 4YXJA 2ALZA 1X9SA 3PW5A 2HHTA 5HMMA 1DK2A 2K4EA 2KIVA 4RZRA 3GZFA 3V6KA 5F9LA 1U9LA 1K1QA 5DLGA 2JH1A 3ICXA 2PFNA 5ALTA 2MUTA 5KFVA 4P0QB 2KMDA 3HKZC 5J2EA 4CNQA 1Y88A 4ECXA 4I2CA 1IV8A 3H8JA 4F5RA 2RDJA 2LM4A 2NV3A 2BQ3A 2PFPA 4TQRA 1JALA 2VIXA 4B9TA 3OGUA 4GXIA 1RPLA 4KN7A 4Z6EA 3WKAA 4RQNA 1HEKA 1RYRA 1JXLA 1T3NA 3TADA 2E8PA 2J6TA 1ZD3A 3TKAA 8ICUA 4QJFB 4DS5A 1WCLA 1TVAA 4ED1A 3NRZA 2G07A 2ZJ8A 4OCZA 4KLHA 4RQ4A 1YT3A 2F2AB 3SYZA 7ICJA 7ICMA 2EZXA 2NRVA 1WWVA 3UMBA 5HNKA 3T79A 3I1YA 5KFEA 2K4HA 1M6YA 2LI6A 2XICA 4DFJA 2KJ9A 3RJHA 4YMOA 2W04A 3V7KA 3I28A 1QTMA 2AHOB 5ALGA 4M9JA 1NKBA 2UVRA 8ICIA 4AP9A 4MFCA 5KT5A 5AM4A 1PUZA 2KZZA 3PW7A 1NK5A 4RQ0A 3SEIA 1MN8A 3AMZA 2W3RA 2I1QA 2I9GA 2Q0ZX 3T5JA 4IC9A 5KFXA 4M6WA 3RJEA 3KFUF 1ZRMA 5KG0A 3SAGA 4IS7A 4Y2YA 2RDIA 3KKAC 2H3FA 1T8EA 2VA3A 5DLFA 4P0QA 5EE1A 3RJKA 2AGQA 2W11A 1BVSA 3V7JA 1C7YA 3SI8A 1S0NA 2P35A 1UA0A 4IQUA 1HIWA 4QWAA 4DFDA 2HI0A 1PVQA 5DG8A 5AHXA 2BCVA 2JV3A 2ZTEA 4F71A 5AM2A 8ICWA 1KKXA 7ICRA 3WKEA 3BS5B 4KLUA 1SZHA 5AM3A 4JB3A 7ICPA 4Y2PA 4M9LA 4FZNA 2WTFA 2OEHA 1N5WA 4DEZA 8ICZA 4C7YA 1XSLA 1L5UA 1Z19A 4GXJA 2LKYA 2KTQA 5C5JA 4IRKA 3QYPA 2IOHA 5H2FU 5EOZA 3KHLA 2YN4A 2JXJA 1UA1A 5KFZA 4JV1A 1IXRA 1OW5A 4EX7A 4CCHA 5CWRA 2RP5A 3SQIA 2ZUCA 2OHFA 1C20A 5J2GA 2ZIVB 5T14A 2KJ8A 2HVIA 1MA7A 4QNLA 4K4HA 4DLEA 7ICFA 5AKKA 4J9MA 4F5OA 2XY7A 4DQQA 4BXOB 1UQVA 4LZDA 4O5CA 3NS1A 2H5XA 1L7OA 2D3DA 3L5KA 5DQHA 3N28A 4HAIA 2UVVA 4KMOB 4PHDA 5KAFU 4ED3A 2ZIXA 1YZ6A 1ZJMA 5AK5A 7ICSA 4FZMA 2V4QA 5IINA 4PGYA 3T5HA 8ICNA 5D46A 3H7IA 1FEZA 2KK0A 4RT2A 1XNSA 4KITB 4Y2RA 2NRWA 1ZRNA 1B0XA 3Q8PB 4JMUA 3IM1A 1VDVA 2Y9UA 3PX4A 4C8MA 3RB4A 7ICIA 3JPPA 3NUQA 3M9MB 4MF2A 4QIWF 5KFMA 2LHTA 1ED1A 5D4BA 2QB0A 2DF4B 2XCPA 2NRXA 8ICHA 2CPRA 1ZQ1C 3HP6A 1SXEA 7ICOA 3QU4A 9ICNA 3CRXA 5AKJA 4MFFA 1ZQMA 4NM1A 4EEYA 5DDYA 2FJ6A 3H0MB 4DSEA 9ICWA 2HSZA 4J03A 4F4WA 3OJSA 1TV9A 4FBUA 3Q8KA 4JK1A 3TANA 3PSFA 1RDFA 2HHWA 1VJ5A 4Y2SA 3TFSA 4RQ1A 1SKSA 2F1IA 2RLTA 4US9A 4P0PA 4UW9A 1FIQA 2MUTB 3N7SC 5ALYA 3F5AA 3D2NA 4JV2A 4UBCA 1O08A 4PGQA 2OYYA 5ALXA 4O0IA 3E0FA 4DS4A 5KG4A 5J0TA 4CF4A 9ICLA 2HOQA 1X9MA 4I2HA 3M8SA 4DQSA 1XS9D 4KLQA 3AL0B 1NK7A 4KLIA 4QW8A 1KBUA 2VKQA 8ICGA 5AIBA 4Q8FA 4ECSA 2EH9A 2N1RA 3MDCA 3RRHA 3RTVA 4DOAA 5KG2A 5CR0A 3H8WA 2G5HB 1QQ6A 4M2YA 1ZQLA 2FLNA 1RQLA 2OXOA 4F91B 3M9NB 2ASJA 1CRXA 1COKA 2E8OA 2F1HA 2W8LA 3TI0A 5AM1A 4CDGA 8ICVA 4EEKA 1N61A 2YMPA 1QH9A 4F93B 4UBBA 4PHEA 1UHUA 4ELUA 2B21A 3MR2A 4DFPA 1L7MA 3IDWA 4JWMA 2RRDA 4OJOA 1SKRA 4TURA 4KLSA 2PXIA 1QCKA 4J9PA 4NLNA 5J2AA 1ZQAA 1SWWA 3RAQA 1GO3F 2GWSA 1SV0A 1MQ3A 1RQNA 5ALIA 1N2XA 4Z6FA 1OUQA 4G9BA 3BZCA 4RQ7A 2BCRA 1KSPA 4GIBA 4R66A 2FI1A 4YQWA 1B22A 2MU2A 4IR9A 4OJLA 3G6VA 4NL9C 3N4MB 2KFZA 2KD1A 3H0LB 4C0ZA 2A1JB 4KLJA 4MFAA 5ALKA 9ICHA 4YCXA 1V9PA 9ICIA 5F9NA 4RQ6A 3QZ8A 3EYZA 5E79U 3WK6A 5ALDA 3UPQA 3WK5A 5J2JA 2KZ3A 5BPCA 5L1MA 5AI8A 4EBDA 4P0PB 1BNPA 2IOFA 3ZD9A 1TK0A 1LV5A 2BDPA 2KZMA 1NZBA 2HBJA 5ALRA 5KFRA 3AN1A 3PO5A 5G5GA 3HPOA 5F3XB 2K60A 5AI6A 3UXOA 5DB9A 2KSOB 4MHVA 1D9DA 5B66U 1Q3UA 1ZQXA 3SAHA 3EUB2 5AI0A 2XY6A 2H3QA 4BJQA 4J9NA 5CB1A 7ICVA 2XVTA 4RQ8A 2XGQA 3WK7A 2R18A 5ALUA 5JUMA 3C2LA 2BPGA 1F44A 4GC7A 3RH5A 4ZH4A 1ZQEA 4KLFA 5CHGA 8ICPA 2JEGA 4R8UB 2AGOA 3GQCA 2ZG6A 2WAQF 2M0NA 2AQ0A 4QWEA 1Q46A 1RM6C 1S5LU 2ODGA 4GFJA 9ICFA 2KG5A 2PMZF 9ICXA 3IG5A 3KHRA 4NWIA 2JGAA 2YTUA 4ED6A 4B9MA 1ZQKA 5KG3A 2MAXA 3LWLA 4YN4A 2V4RA 4C8OA 1Z4OA 1ZQUA 4I2IA 8ICYA 4US8A 3NVVA 3QX7A 3MGHA 1L7NA 2F77X 4BDPA 2C2DA 2HCFA 2CXYA 5HHIA 3TQ1A 2WHEA 2HHVA 3LVVA 2YB1A 5KT7A 4PZOA 1SWVA 4ECQA 1KEJA 1DRGA 4F4YA 3LWMA 5J0WA 2AGPA 4JWNA 4JUZA 9ICOA 4NL9A 3HX0A 3Q8QB 2P66A 3VC8A 1SV4A 2H3ZA 3TADC 1XWLA 2JEFA 2CN1A 4KLEA 4O5EA 4NLZA 3LK9A 4DL7A 2WB1C 8ICBA 3BQ2A 9ICUA 3RJJA 3PSTA 2WF8A 2EZZA 2R8IA 3QE9Y 1SGGA 9ICEA 2E3TA 1XSNA 3ETRA 5KFJA 2DBYA 4BWMA 1SZPA 3ZD8A 3RRGA 3WU2U 2FE9A 5K4LA 3MR5A 4O3QA 3KZIU 2I5HA 2YB4A 3SAFA 4NLCA 3Q8RB 5DG7A 4UB5A 3PNCA 3PW2A 2LYHA 5DQGA 5TISU 1HJPA 4ECYA 7ICHA 3GFKB 2WF6A 8ICSA 2H3IA 1JIHA 1A76A 1NJYA 8ICXA 4J9OA 4Y2JA 1X9WA 5G5HA 1X2IA 5IIIA 3EPGA 4ELVA 4ICAA 5J0RA 2C2EA 2BCQA 4DSJA 5L9XA 5J0YA 4R65A 3Q8MA 5J29A 3V6HA 1X66A 4CF3A 1UT8A 2D8CA 4YP3A 2EAMA 1YZ7A 2DUYA 4J9KA 4DOBA 1D8BA 5JTIA 1ZQCA 9ICJA 3C5FA 4KLTA 2W9BA 2WF9A 1ZQPA 1X6IA 5CP2A 3QXGA 1RXVA 2ASDA 1NJZA 2HMXA 3BQ7A 2HDOA 5KT4A 3AU2A 3AM9A 3WKCA 3UQ2A 4B9VA 3PW0A 1Q3VA 9ICGA 3JPTA 2F44A 2YX8A 3HT3A 4XRHA 2BQRA 1F5SA 3PR5B 3H4BA 5KFYA 1DGJA 4PGXA 3RAXA 5AKIA 3GIKA 4KN4A 1BPEA 3RH4A 4O3MA 4YR0A 3D2SA 3ZDEA 3IG8A 1ZOLA 3WK9A 2LPEA 1KFSA 4I2FA 3K1RB 3D2QA 2QB1A 2G08A 1U45A 2C28A 3H8MA 2ZTDA 2LYAA 3NVYA 2W3SA 4QZCA 4LJXA 1ZQJA 5D49A 1BPXA 2KEYA 1MC8A 3NRWA 4DF8A 1NJWA 2OH2A 2ZIWB 1SL0A 4BGDA 3MR3A 1T4GA 2DPIA 3OTQA 5TZVA 4QIWC
chains in the Genus database with same CATH topology
2DKZA 1SV0A 3TACB 2QARA 2K4PA 2E8MA 2GLEA 1X66A 2KSOA 2D8CA 3SEIA 2QARB 1KW4A 2EAMA 5KNIA 5JRTA 3HILA 2KIVA 1X9XA 1UQVA 4NL9C 5JTIA 1LKYA 1UCVA 2B6GA 4PZOA 1PK3A 4IS7A 3KKAC 1JI7A 1WWUA 2D3DA 1B4FA 2EANA 2KMDA 1PK1B 4NL9A 5JU5A 3BQ7A 1RG6A 1SV4A 1SV0C 3TADC 2EAOA 5L1MA 1F0MA 2F44A 1DXSA 4NJ8A 2F3NA 2JV3A 2F8KA 1OXJA 1PK1A 2DKXA 2ES6A 4RQNA 2QB0B 5F3XB 2K60A 1SXDA 2DL0A 3BS5B 2KSOB 4MHVA 3SENA 3TADA 5J8YA 1SGGA 2E8PA 4PZNA 2ESEA 3BS7A 1LKYB 1B0XA 1V85A 2FE9A 1COKA 3KKAA 2E8OA 2Y9TA 2LPEA 2Y9UA 3K1RB 2QB1A 2QKQA 2L5YA 2E8NA 3H8MA 3IDWA 2QB0A 1WWVA 5J8YC 1SXEA 2KE7A 3BS5A 2KG5A 1OW5A 4RQMA 1X40A 1Z1VA 2EAPA 2LMRA 2YTUA 1V38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKZ A;  1SV0 A;  3TAC B;  2QAR A;  2K4P A;  2E8M A;  2GLE A;  1X66 A;  2KSO A;  2D8C A;  3SEI A;  2QAR B;  1KW4 A;  2EAM A;  5KNI A;  5JRT A;  3HIL A;  2KIV A;  1X9X A;  1UQV A;  4NL9 C;  5JTI A;  1LKY A;  1UCV A;  2B6G A;  4PZO A;  1PK3 A;  4IS7 A;  3KKA C;  1JI7 A;  1WWU A;  2D3D A;  1B4F A;  2EAN A;  2KMD A;  1PK1 B;  4NL9 A;  5JU5 A;  3BQ7 A;  1RG6 A;  1SV4 A;  1SV0 C;  3TAD C;  2EAO A;  5L1M A;  1F0M A;  2F44 A;  1DXS A;  4NJ8 A;  2F3N A;  2JV3 A;  2F8K A;  1OXJ A;  1PK1 A;  2DKX A;  2ES6 A;  4RQN A;  2QB0 B;  5F3X B;  2K60 A;  1SXD A;  2DL0 A;  3BS5 B;  2KSO B;  4MHV A;  3SEN A;  3TAD A;  5J8Y A;  1SGG A;  2E8P A;  4PZN A;  2ESE A;  3BS7 A;  1LKY B;  1B0X A;  1V85 A;  2FE9 A;  1COK A;  3KKA A;  2E8O A;  2Y9T A;  2LPE A;  2Y9U A;  3K1R B;  2QB1 A;  2QKQ A;  2L5Y A;  2E8N A;  3H8M A;  3IDW A;  2QB0 A;  1WWV A;  5J8Y C;  1SXE A;  2KE7 A;  3BS5 A;  2KG5 A;  1OW5 A;  4RQM A;  1X40 A;  1Z1V A;  2EAP A;  2LMR A;  2YTU A;  1V38 A; 
#chains in the Genus database with same CATH topology
 5AKX A;  4C8L A;  3V72 A;  4UAV A;  3O0F A;  3C21 A;  4FBT A;  4IQV A;  9ICS A;  4KLO A;  3KD3 A;  4FE3 A;  3GIL A;  4IQW A;  5AIC A;  2BR0 A;  3A0H U;  1QSL A;  1ZQH A;  1X42 A;  5JRT A;  4M04 A;  2HBL A;  5CJ7 A;  3NVW A;  7ICE A;  1X9X A;  4B9N A;  1ZQN A;  2W8K A;  1DOQ A;  1LKY A;  2Q4T A;  5KFU A;  1D8L A;  4C4T A;  2AXT U;  3ISB A;  4GLX A;  1A77 A;  2KP7 A;  4F4Z A;  1U49 A;  1NK8 A;  1Z3E B;  4CE6 A;  2WF5 A;  5AM0 A;  2LBO A;  3TAR A;  1S0M A;  3EW9 A;  3ZDD A;  5KFW A;  3C5G A;  5KFN A;  2F3N A;  2ASL A;  1ZQV A;  3JPS A;  4AYB C;  2H3V A;  2A3V A;  2BKE A;  7ICN A;  2ZIU A;  4KX5 A;  5KFF A;  4M9H A;  1JUD A;  4MF8 A;  3D6J A;  5KFQ A;  4M9N A;  1RXW A;  4Y2X A;  2W7P A;  1L8O A;  2DQN B;  4OJP A;  3OSN A;  3QNM A;  5DB8 A;  1BPB A;  4F4K A;  3OHA A;  9ICA A;  2KVS A;  2ZJ5 A;  5KT3 A;  5FP0 A;  9ICM A;  2IOF K;  1XC9 A;  1ZXI A;  3JPQ A;  2I6X A;  2PI5 A;  5DBB A;  3FM9 A;  2EAP A;  3G6Y A;  1V38 A;  2DKZ A;  3KHH A;  4DQI A;  1V97 A;  5KFT A;  3FC4 A;  3M7D A;  3NAS A;  5ALZ A;  2E8M A;  7ICU A;  1ZQF A;  9ICB A;  4ELT A;  4UB1 A;  2Y0S F;  4USA A;  4ECU A;  1IM4 A;  3RB6 A;  1KFT A;  4DF4 A;  2BGW A;  1QSY A;  1KFD A;  1P7D A;  1UPH A;  3LVW A;  3QU2 A;  2D6F C;  5IIL A;  2HHX A;  2ISP A;  1NI3 A;  4FZL A;  1WWU A;  2R8K A;  4KLD A;  2DGZ A;  5KT6 A;  2AJQ A;  2NO4 A;  3CW2 C;  5EE3 A;  4R8U A;  2ZUB A;  4NM2 A;  1JMS A;  1SV0 C;  5J0U A;  4QZH A;  3QU5 A;  4F2R A;  3GV5 B;  4NLG A;  2FMP A;  4KX3 A;  4EBC A;  2PFO A;  3V6J A;  5J2K A;  4QZD A;  3RFA A;  4DL5 A;  1NKE A;  2DL0 A;  1ECW A;  1L3U A;  2KKV A;  3SR6 A;  1N5X A;  3K75 D;  3H8S A;  3L4P A;  4MEY A;  3KBB A;  3EPI A;  4M6W B;  4KLL A;  3V7L A;  3GIM A;  1D9F A;  4UAU A;  4I2J A;  3MGV A;  1L7P A;  2A19 A;  3JPN A;  2W9M A;  1Z00 B;  4P2H A;  3GU3 A;  4UQG A;  4IRD A;  4QZE A;  2HOF A;  2HBM A;  3PSP A;  3HW8 A;  3UQ0 A;  3OSP A;  4GC6 A;  2JMG A;  5DKW A;  8ICK A;  4RQM A;  1X40 A;  7ICL A;  3B0X A;  2QAR A;  1N60 A;  1T7P A;  4YR3 A;  1PZN A;  5L1J A;  1TAM A;  3SMV A;  4Q43 A;  4B9U A;  8ICO A;  5DDM A;  4P4O A;  1KN5 A;  4CF5 A;  2KKP A;  4M9G A;  5CEH A;  3KOO A;  4OD0 A;  2K8B B;  1UCV A;  2KOB A;  3ONN A;  2HBK A;  4YMN A;  2MRL A;  4MEX A;  4DL2 A;  2F1J A;  4UB2 A;  4DSF A;  2KIC A;  7ICT A;  1ZD4 A;  4QWD A;  1TK5 A;  3SZ2 A;  1T94 A;  2FDR A;  5KFP A;  1SL1 A;  2ZTC A;  5DQI A;  4F92 B;  3C28 A;  3C2M A;  5J2F A;  3T5L A;  5KFS A;  2BCS A;  2XC9 A;  2R8H A;  2JZB B;  1J97 A;  2RQ5 A;  1DK3 A;  2ES6 A;  3UXN A;  4O3N A;  3MDA A;  5J8Y A;  2JEI A;  1JN3 A;  4PZN A;  2ESE A;  1UT5 A;  4F5P A;  4F5Q A;  3ZDC A;  3WK4 A;  3C2K A;  3NVZ A;  3EWA A;  5J2C A;  5DBA A;  4ZOH C;  2BCU A;  4P4M A;  3JPR A;  3UMG A;  4Y2U A;  1S10 A;  1PVP A;  2ZUD A;  2NO5 A;  1MSW D;  5AM5 A;  4ED0 A;  4F4X A;  4UAS A;  2W7O A;  5KG5 A;  1URJ A;  1WYG A;  1L8L A;  4PL2 A;  5J8Y C;  1J2N A;  5J0O A;  3QUQ A;  3BS5 A;  4O3P A;  3I76 A;  4I29 A;  2NRT A;  1KDH A;  1QQ7 A;  1Z1V A;  4I28 A;  1ZQT A;  1S76 D;  1KL9 A;  1RYS A;  2G06 A;  2K4P A;  4J9R A;  4I2B A;  4E0D A;  2CRX A;  3AEV A;  3F2D A;  1H38 A;  1X6J A;  4CRX A;  1BGX T;  5KAI U;  5ALL A;  1LVH A;  4ECV A;  2C2R A;  3PX6 A;  4DSI A;  3MAB A;  1CI4 A;  2KHV A;  2MSN A;  9ICK A;  1U47 A;  5ALN A;  2BHN A;  5CRX A;  5ALH A;  1S97 A;  1B4F A;  4QZ9 A;  4NXZ A;  3MC1 A;  4J9Q A;  4NY8 A;  2XCA A;  4C80 A;  3FYH A;  1CEZ A;  2BPF A;  5KFG A;  3HRD D;  4WJ3 B;  4BWJ A;  4BX9 C;  2GO7 A;  2YQE A;  4A8E A;  3PX0 A;  1A6S A;  2K8A A;  2W54 A;  4Q45 A;  2ZIV A;  4DQP A;  2ZJA A;  1PK1 A;  2DKX A;  1ZQD A;  1B43 A;  5KG1 A;  8ICL A;  2JR5 A;  2A1A A;  4DL6 A;  4EZ6 A;  5ALQ A;  3BS7 A;  5DGB A;  2RHF A;  3F5E A;  1ZQZ A;  2VJ5 A;  5BOL A;  5DG9 A;  4TUS A;  1TE2 A;  3GV8 B;  3ED5 A;  1FO4 A;  3QZ7 A;  3T3F A;  5KFK A;  2K8C B;  4ECZ A;  1N48 A;  2KNJ A;  2W43 A;  2JRZ A;  5KFH A;  2PFQ A;  4B9S A;  5ALE A;  2DWQ A;  5KL1 B;  5KG7 A;  1L6N A;  2QLT A;  2HHS A;  5J0Q A;  3G6X A;  4PJ0 U;  3NGD A;  5BOM A;  1ZQG A;  3IN5 A;  2EQY A;  3EZ5 A;  3F2B A;  2UVU A;  4QZ8 A;  5C0Y A;  3C1Z A;  3GDX A;  8ICQ A;  3MBY A;  2J6U A;  2WB1 F;  3QU9 A;  8ICT A;  4TUP A;  4RU9 A;  5AIA A;  1SB3 C;  2C22 A;  3WKB A;  5IIM A;  3HKZ F;  1FFU A;  4I2A A;  3MGI A;  3THV A;  1KQQ A;  3K1Z A;  3BQT A;  2LYB A;  4KLM A;  1BPD A;  5AKZ A;  3AU6 A;  3SV4 A;  5J0S A;  4UB6 U;  1S9F A;  2FMS A;  3TAQ A;  4YG2 A;  3RB3 A;  3RH6 A;  1KLN A;  1IIP A;  1NZP A;  3KTQ A;  2PMZ C;  4UAZ A;  3HIL A;  3S6J A;  3HWT A;  3QUT A;  2OM6 A;  4DL4 A;  3R9K A;  2B6G A;  3ISC A;  2JHD A;  3DEE A;  1RG6 A;  3RJF A;  5EWF A;  2B0C A;  4YD2 A;  4R63 A;  1JRP A;  5HML A;  3H40 A;  3AQE A;  3RJG A;  3VCB A;  1JXE A;  4DSK A;  3E58 A;  2NRZ A;  2JH7 A;  1SXD A;  1ZQI A;  2BQU A;  3HJE A;  3OPX A;  4QWB A;  2W9A A;  3RR7 A;  3IRU A;  3LDA A;  3ORY A;  4RT3 A;  3SV3 A;  4UB4 A;  1Q8K A;  2Y9T A;  4TQS A;  3CNH A;  3H4D A;  2P6U A;  3J81 j;  1TFR A;  3SD7 A;  4K4G A;  3BQ0 A;  5B5E U;  1XO0 A;  4NLK A;  9ICR A;  4AYB F;  2OCE A;  3C29 A;  3IP4 B;  3C1Y A;  2XO7 A;  4PHP A;  4O3O A;  8ICJ A;  1SL2 A;  3PZP A;  2P6R A;  4I2E A;  3IHQ B;  4BUG A;  1D8Y A;  5ALM A;  4KLG A;  1IG6 A;  3PVX A;  2BDU A;  1ZYQ A;  1MQ2 A;  3OJU A;  5J2B A;  2BPC A;  2A1J A;  5L1K A;  2W9C B;  2LM1 A;  1NK9 A;  4C7Z A;  3GV7 B;  4EEN A;  4BXO A;  5KL8 B;  3MR6 A;  4UAT A;  3UMC A;  3ZDB A;  1PVR A;  1J2M A;  2GOL A;  5DBC A;  1N56 A;  4QWC A;  1TAQ A;  3RR8 A;  4UAY A;  4YR2 A;  4IRC A;  1PK3 A;  1ZQQ A;  1JI7 A;  4YMM A;  2YMQ A;  1EXN A;  4RPY A;  1RZT A;  4M0A A;  1ZD2 P;  4RPZ A;  5EE9 A;  5IIJ A;  1XSP A;  2DPJ A;  2PI4 A;  1Z1B A;  5HR7 A;  2KVC A;  1TK8 A;  4FO6 A;  4O3S A;  4DOC A;  1DXS A;  2IHN A;  2R8G A;  2VJ4 A;  1VLB A;  2F8K A;  2E1E A;  1OXJ A;  2O6K A;  3Q8S B;  4PL1 A;  1ZET A;  2ZIX B;  1COO A;  1U48 A;  3PY8 A;  3N97 B;  3SEN A;  5J2H A;  1S0O A;  5KFI A;  3RBD A;  1WUD A;  2G5I B;  5A0L A;  5AK4 A;  4ACO A;  1V85 A;  2PKE A;  1ZD5 A;  4Y2Q A;  3KKA A;  2ZXH A;  5ALV A;  2NYV A;  4DWI A;  4YD1 A;  2HOI A;  1RYU A;  3PSI A;  2G0A A;  1N63 A;  3PML A;  2G09 A;  5DB6 A;  3F2C A;  2JEJ A;  1TKD A;  4F50 A;  4C8N A;  2R8J A;  3RJI A;  4RNM A;  1U4B A;  4EYI B;  7ICK A;  2YMM A;  4C4S A;  4YVZ A;  2XGP A;  1ZQO A;  3B0Y A;  4DQR A;  4QZA A;  3AUO A;  4RUA A;  4DL3 A;  1KTQ A;  3UM9 A;  4J9L A;  2KIW A;  2VA8 A;  2KSO A;  2Y1I A;  1NOM A;  4LZG A;  2HVH A;  1XU4 A;  4FFD A;  4O3R A;  4B9L A;  2HHU A;  2E5S A;  1L3T A;  2K4I A;  1NK0 A;  3ZI4 A;  3OHB A;  1NJX A;  4RQ2 A;  3M1Y A;  5ALS A;  5AK6 A;  3KZX A;  4P4P A;  5HP4 A;  5KG6 A;  3BZK A;  2EAN A;  3JPO A;  3GII A;  1PK1 B;  7ICG A;  8ICR A;  4PPX A;  4Z6C A;  5JU5 A;  2E1F A;  1ZQY A;  2YML A;  4IL6 U;  3N7P D;  4F8R A;  4NJ8 A;  4U6P A;  4ECR A;  2XI9 A;  2QB0 B;  4JV0 A;  4GXK A;  1ZQR A;  5AKH A;  4PHA A;  2M9N A;  3B9J A;  4F5N A;  4RUC A;  4ED2 A;  4RQ5 A;  3IV6 A;  4X5V A;  4IR1 A;  3K4G A;  9ICV A;  2EZY A;  3TFR A;  4XUS A;  4K4I A;  2QKQ A;  4Y2V A;  2E8N A;  2Y1J A;  1QSS A;  2WF7 A;  1QQ5 A;  2FPM A;  5AKY A;  3RBE A;  3QUB A;  5HHH A;  2YY6 A;  1Z00 A;  3PV8 A;  3U26 A;  2VA2 A;  1Z4N A;  4ECT A;  1BNO A;  1QLN A;  2MA1 A;  2WFA A;  4UAR A;  2KFN A;  1TAU A;  5J0X A;  4QZF A;  5J2D A;  4I27 A;  2ATL A;  1ZQS A;  3WK8 A;  1L3S A;  4OJ6 A;  2W9B B;  5KFD A;  1WG8 A;  4QZB A;  9ICT A;  2GH1 A;  3TAC B;  5AKE A;  3PO4 A;  2FPK A;  2GLE A;  2KJ5 A;  3A0B U;  3CP8 A;  5L1L A;  3FAH A;  1BPY A;  3AQF A;  2KHQ A;  2W03 A;  2FLL A;  3F53 A;  3QU7 A;  3MFH A;  5KNI A;  4FS2 A;  8ICE A;  5AI5 A;  3KHG A;  1DGS A;  4ED7 A;  4C4R A;  2BZF A;  4TUQ A;  5KFB A;  4Z6D A;  5CA7 A;  4I2G A;  4QW9 A;  1AQ6 A;  2ZXI A;  2UVW A;  5AKL A;  4HYK A;  4UB3 A;  4Q8E A;  2Y0S C;  3FDS A;  5DGA A;  3M8R A;  4U7C A;  2AH5 A;  1L3V A;  3MFI A;  4OJ5 A;  4NLB A;  3QEA Z;  1BPZ A;  5EWE A;  1HUO A;  3M6Z A;  3QUC A;  1K5O A;  1N62 A;  3WKD A;  2F8L A;  4F3O A;  3CYM A;  4RNO A;  4DFM A;  4EYH B;  4XA5 A;  3RF9 A;  8ICC A;  4YFK A;  5L1I A;  4YXM A;  5KT2 A;  4QZG A;  1ZQB A;  1S8O A;  3N7R C;  3Q8L A;  5ALP A;  2L5Y A;  3H0R B;  8ICF A;  2IA6 A;  1NNL A;  3BQ1 A;  4C8K A;  4KTQ A;  5J0P A;  4DSL A;  4O9M A;  4OO1 J;  1LB2 B;  5IIK A;  2KE7 A;  5DB7 A;  3NTU A;  4UB8 U;  1KRP A;  3ISD A;  2VAN A;  5AI9 A;  5KFC A;  4KMU A;  2FMQ A;  4F72 A;  3DDH A;  9ICP A;  1NK4 A;  2AU0 A;  3C23 A;  4EBE A;  1O03 A;  2KV2 A;  2QAR B;  1KW4 A;  3RB0 A;  5ALJ A;  1ZJN A;  3M9O B;  5IIO A;  2ZIW A;  4DCC A;  3UXP A;  3M6K A;  3GIJ A;  1ARO P;  1T3Q A;  3TAP A;  4FS1 A;  4O5K A;  3E2E A;  2HW3 A;  2F76 X;  4G3I A;  8ICA A;  4RPX A;  5GTI U;  1NK6 A;  5ALW A;  3BJY A;  4DO9 A;  8ICM A;  4ECW A;  4XQ8 A;  4Y2T A;  5KTQ A;  4ED8 A;  5EE0 A;  4EZ9 A;  4CGZ A;  2ZIU B;  5AKG A;  4PH5 A;  4RNN A;  2KN7 A;  2XID A;  2EAO A;  1F0M A;  4NV0 A;  3LYS A;  3T5K A;  5J2I A;  2EDU A;  2DFL A;  3ETL A;  1SKW A;  3QEB Z;  2FLP A;  3PW4 A;  1XO1 A;  2JZB A;  2K89 A;  1WCN A;  1LKY B;  4DFK A;  2FPL A;  5ALO A;  5ALF A;  2W55 A;  2IMW P;  3BDP A;  2XY5 A;  4IQT A;  2Z7J A;  4F2S A;  3ZDA A;  5AI4 A;  1JRO A;  1K1S A;  2V9W A;  2W9C A;  1S0V A;  4QZI A;  2HHQ A;  2OWO A;  4EX6 A;  5AK3 A;  1ZQW A;  4RQ3 A;  4UAW A;  3PR4 A;  4LVS A;  1CUK A;  9ICQ A;  4I2D A;  4B6J A;  7ICQ A;  1A0P A;  3DV9 A;  4DLG A;  2J6S A;  5HR6 A;  1FFV A;  5KFO A;  3ALR A;  2IHM A;  5KFA A;  4J9S A;  1JX4 A;  2LMR A;  9ICC A;  2ISO A;  2AQ4 A;  2WAQ C;  5EWG A;  1S77 D;  5KFL A;  5GTH U;  3PMN A;  3L3F X;  1NKC A;  4M47 A;  1SIJ A;  4R64 A;  4Q44 A;  1HUZ A;  2IBK A;  4EEL A;  4YXJ A;  2ALZ A;  1X9S A;  3PW5 A;  2HHT A;  5HMM A;  1DK2 A;  2K4E A;  2KIV A;  4RZR A;  3GZF A;  3V6K A;  5F9L A;  1U9L A;  1K1Q A;  5DLG A;  2JH1 A;  3ICX A;  2PFN A;  5ALT A;  2MUT A;  5KFV A;  4P0Q B;  2KMD A;  3HKZ C;  5J2E A;  4CNQ A;  1Y88 A;  4ECX A;  4I2C A;  1IV8 A;  3H8J A;  4F5R A;  2RDJ A;  2LM4 A;  2NV3 A;  2BQ3 A;  2PFP A;  4TQR A;  1JAL A;  2VIX A;  4B9T A;  3OGU A;  4GXI A;  1RPL A;  4KN7 A;  4Z6E A;  3WKA A;  4RQN A;  1HEK A;  1RYR A;  1JXL A;  1T3N A;  3TAD A;  2E8P A;  2J6T A;  1ZD3 A;  3TKA A;  8ICU A;  4QJF B;  4DS5 A;  1WCL A;  1TVA A;  4ED1 A;  3NRZ A;  2G07 A;  2ZJ8 A;  4OCZ A;  4KLH A;  4RQ4 A;  1YT3 A;  2F2A B;  3SYZ A;  7ICJ A;  7ICM A;  2EZX A;  2NRV A;  1WWV A;  3UMB A;  5HNK A;  3T79 A;  3I1Y A;  5KFE A;  2K4H A;  1M6Y A;  2LI6 A;  2XIC A;  4DFJ A;  2KJ9 A;  3RJH A;  4YMO A;  2W04 A;  3V7K A;  3I28 A;  1QTM A;  2AHO B;  5ALG A;  4M9J A;  1NKB A;  2UVR A;  8ICI A;  4AP9 A;  4MFC A;  5KT5 A;  5AM4 A;  1PUZ A;  2KZZ A;  3PW7 A;  1NK5 A;  4RQ0 A;  3SEI A;  1MN8 A;  3AMZ A;  2W3R A;  2I1Q A;  2I9G A;  2Q0Z X;  3T5J A;  4IC9 A;  5KFX A;  4M6W A;  3RJE A;  3KFU F;  1ZRM A;  5KG0 A;  3SAG A;  4IS7 A;  4Y2Y A;  2RDI A;  3KKA C;  2H3F A;  1T8E A;  2VA3 A;  5DLF A;  4P0Q A;  5EE1 A;  3RJK A;  2AGQ A;  2W11 A;  1BVS A;  3V7J A;  1C7Y A;  3SI8 A;  1S0N A;  2P35 A;  1UA0 A;  4IQU A;  1HIW A;  4QWA A;  4DFD A;  2HI0 A;  1PVQ A;  5DG8 A;  5AHX A;  2BCV A;  2JV3 A;  2ZTE A;  4F71 A;  5AM2 A;  8ICW A;  1KKX A;  7ICR A;  3WKE A;  3BS5 B;  4KLU A;  1SZH A;  5AM3 A;  4JB3 A;  7ICP A;  4Y2P A;  4M9L A;  4FZN A;  2WTF A;  2OEH A;  1N5W A;  4DEZ A;  8ICZ A;  4C7Y A;  1XSL A;  1L5U A;  1Z19 A;  4GXJ A;  2LKY A;  2KTQ A;  5C5J A;  4IRK A;  3QYP A;  2IOH A;  5H2F U;  5EOZ A;  3KHL A;  2YN4 A;  2JXJ A;  1UA1 A;  5KFZ A;  4JV1 A;  1IXR A;  1OW5 A;  4EX7 A;  4CCH A;  5CWR A;  2RP5 A;  3SQI A;  2ZUC A;  2OHF A;  1C20 A;  5J2G A;  2ZIV B;  5T14 A;  2KJ8 A;  2HVI A;  1MA7 A;  4QNL A;  4K4H A;  4DLE A;  7ICF A;  5AKK A;  4J9M A;  4F5O A;  2XY7 A;  4DQQ A;  4BXO B;  1UQV A;  4LZD A;  4O5C A;  3NS1 A;  2H5X A;  1L7O A;  2D3D A;  3L5K A;  5DQH A;  3N28 A;  4HAI A;  2UVV A;  4KMO B;  4PHD A;  5KAF U;  4ED3 A;  2ZIX A;  1YZ6 A;  1ZJM A;  5AK5 A;  7ICS A;  4FZM A;  2V4Q A;  5IIN A;  4PGY A;  3T5H A;  8ICN A;  5D46 A;  3H7I A;  1FEZ A;  2KK0 A;  4RT2 A;  1XNS A;  4KIT B;  4Y2R A;  2NRW A;  1ZRN A;  1B0X A;  3Q8P B;  4JMU A;  3IM1 A;  1VDV A;  2Y9U A;  3PX4 A;  4C8M A;  3RB4 A;  7ICI A;  3JPP A;  3NUQ A;  3M9M B;  4MF2 A;  4QIW F;  5KFM A;  2LHT A;  1ED1 A;  5D4B A;  2QB0 A;  2DF4 B;  2XCP A;  2NRX A;  8ICH A;  2CPR A;  1ZQ1 C;  3HP6 A;  1SXE A;  7ICO A;  3QU4 A;  9ICN A;  3CRX A;  5AKJ A;  4MFF A;  1ZQM A;  4NM1 A;  4EEY A;  5DDY A;  2FJ6 A;  3H0M B;  4DSE A;  9ICW A;  2HSZ A;  4J03 A;  4F4W A;  3OJS A;  1TV9 A;  4FBU A;  3Q8K A;  4JK1 A;  3TAN A;  3PSF A;  1RDF A;  2HHW A;  1VJ5 A;  4Y2S A;  3TFS A;  4RQ1 A;  1SKS A;  2F1I A;  2RLT A;  4US9 A;  4P0P A;  4UW9 A;  1FIQ A;  2MUT B;  3N7S C;  5ALY A;  3F5A A;  3D2N A;  4JV2 A;  4UBC A;  1O08 A;  4PGQ A;  2OYY A;  5ALX A;  4O0I A;  3E0F A;  4DS4 A;  5KG4 A;  5J0T A;  4CF4 A;  9ICL A;  2HOQ A;  1X9M A;  4I2H A;  3M8S A;  4DQS A;  1XS9 D;  4KLQ A;  3AL0 B;  1NK7 A;  4KLI A;  4QW8 A;  1KBU A;  2VKQ A;  8ICG A;  5AIB A;  4Q8F A;  4ECS A;  2EH9 A;  2N1R A;  3MDC A;  3RRH A;  3RTV A;  4DOA A;  5KG2 A;  5CR0 A;  3H8W A;  2G5H B;  1QQ6 A;  4M2Y A;  1ZQL A;  2FLN A;  1RQL A;  2OXO A;  4F91 B;  3M9N B;  2ASJ A;  1CRX A;  1COK A;  2E8O A;  2F1H A;  2W8L A;  3TI0 A;  5AM1 A;  4CDG A;  8ICV A;  4EEK A;  1N61 A;  2YMP A;  1QH9 A;  4F93 B;  4UBB A;  4PHE A;  1UHU A;  4ELU A;  2B21 A;  3MR2 A;  4DFP A;  1L7M A;  3IDW A;  4JWM A;  2RRD A;  4OJO A;  1SKR A;  4TUR A;  4KLS A;  2PXI A;  1QCK A;  4J9P A;  4NLN A;  5J2A A;  1ZQA A;  1SWW A;  3RAQ A;  1GO3 F;  2GWS A;  1SV0 A;  1MQ3 A;  1RQN A;  5ALI A;  1N2X A;  4Z6F A;  1OUQ A;  4G9B A;  3BZC A;  4RQ7 A;  2BCR A;  1KSP A;  4GIB A;  4R66 A;  2FI1 A;  4YQW A;  1B22 A;  2MU2 A;  4IR9 A;  4OJL A;  3G6V A;  4NL9 C;  3N4M B;  2KFZ A;  2KD1 A;  3H0L B;  4C0Z A;  2A1J B;  4KLJ A;  4MFA A;  5ALK A;  9ICH A;  4YCX A;  1V9P A;  9ICI A;  5F9N A;  4RQ6 A;  3QZ8 A;  3EYZ A;  5E79 U;  3WK6 A;  5ALD A;  3UPQ A;  3WK5 A;  5J2J A;  2KZ3 A;  5BPC A;  5L1M A;  5AI8 A;  4EBD A;  4P0P B;  1BNP A;  2IOF A;  3ZD9 A;  1TK0 A;  1LV5 A;  2BDP A;  2KZM A;  1NZB A;  2HBJ A;  5ALR A;  5KFR A;  3AN1 A;  3PO5 A;  5G5G A;  3HPO A;  5F3X B;  2K60 A;  5AI6 A;  3UXO A;  5DB9 A;  2KSO B;  4MHV A;  1D9D A;  5B66 U;  1Q3U A;  1ZQX A;  3SAH A;  3EUB 2;  5AI0 A;  2XY6 A;  2H3Q A;  4BJQ A;  4J9N A;  5CB1 A;  7ICV A;  2XVT A;  4RQ8 A;  2XGQ A;  3WK7 A;  2R18 A;  5ALU A;  5JUM A;  3C2L A;  2BPG A;  1F44 A;  4GC7 A;  3RH5 A;  4ZH4 A;  1ZQE A;  4KLF A;  5CHG A;  8ICP A;  2JEG A;  4R8U B;  2AGO A;  3GQC A;  2ZG6 A;  2WAQ F;  2M0N A;  2AQ0 A;  4QWE A;  1Q46 A;  1RM6 C;  1S5L U;  2ODG A;  4GFJ A;  9ICF A;  2KG5 A;  2PMZ F;  9ICX A;  3IG5 A;  3KHR A;  4NWI A;  2JGA A;  2YTU A;  4ED6 A;  4B9M A;  1ZQK A;  5KG3 A;  2MAX A;  3LWL A;  4YN4 A;  2V4R A;  4C8O A;  1Z4O A;  1ZQU A;  4I2I A;  8ICY A;  4US8 A;  3NVV A;  3QX7 A;  3MGH A;  1L7N A;  2F77 X;  4BDP A;  2C2D A;  2HCF A;  2CXY A;  5HHI A;  3TQ1 A;  2WHE A;  2HHV A;  3LVV A;  2YB1 A;  5KT7 A;  4PZO A;  1SWV A;  4ECQ A;  1KEJ A;  1DRG A;  4F4Y A;  3LWM A;  5J0W A;  2AGP A;  4JWN A;  4JUZ A;  9ICO A;  4NL9 A;  3HX0 A;  3Q8Q B;  2P66 A;  3VC8 A;  1SV4 A;  2H3Z A;  3TAD C;  1XWL A;  2JEF A;  2CN1 A;  4KLE A;  4O5E A;  4NLZ A;  3LK9 A;  4DL7 A;  2WB1 C;  8ICB A;  3BQ2 A;  9ICU A;  3RJJ A;  3PST A;  2WF8 A;  2EZZ A;  2R8I A;  3QE9 Y;  1SGG A;  9ICE A;  2E3T A;  1XSN A;  3ETR A;  5KFJ A;  2DBY A;  4BWM A;  1SZP A;  3ZD8 A;  3RRG A;  3WU2 U;  2FE9 A;  5K4L A;  3MR5 A;  4O3Q A;  3KZI U;  2I5H A;  2YB4 A;  3SAF A;  4NLC A;  3Q8R B;  5DG7 A;  4UB5 A;  3PNC A;  3PW2 A;  2LYH A;  5DQG A;  5TIS U;  1HJP A;  4ECY A;  7ICH A;  3GFK B;  2WF6 A;  8ICS A;  2H3I A;  1JIH A;  1A76 A;  1NJY A;  8ICX A;  4J9O A;  4Y2J A;  1X9W A;  5G5H A;  1X2I A;  5III A;  3EPG A;  4ELV A;  4ICA A;  5J0R A;  2C2E A;  2BCQ A;  4DSJ A;  5L9X A;  5J0Y A;  4R65 A;  3Q8M A;  5J29 A;  3V6H A;  1X66 A;  4CF3 A;  1UT8 A;  2D8C A;  4YP3 A;  2EAM A;  1YZ7 A;  2DUY A;  4J9K A;  4DOB A;  1D8B A;  5JTI A;  1ZQC A;  9ICJ A;  3C5F A;  4KLT A;  2W9B A;  2WF9 A;  1ZQP A;  1X6I A;  5CP2 A;  3QXG A;  1RXV A;  2ASD A;  1NJZ A;  2HMX A;  3BQ7 A;  2HDO A;  5KT4 A;  3AU2 A;  3AM9 A;  3WKC A;  3UQ2 A;  4B9V A;  3PW0 A;  1Q3V A;  9ICG A;  3JPT A;  2F44 A;  2YX8 A;  3HT3 A;  4XRH A;  2BQR A;  1F5S A;  3PR5 B;  3H4B A;  5KFY A;  1DGJ A;  4PGX A;  3RAX A;  5AKI A;  3GIK A;  4KN4 A;  1BPE A;  3RH4 A;  4O3M A;  4YR0 A;  3D2S A;  3ZDE A;  3IG8 A;  1ZOL A;  3WK9 A;  2LPE A;  1KFS A;  4I2F A;  3K1R B;  3D2Q A;  2QB1 A;  2G08 A;  1U45 A;  2C28 A;  3H8M A;  2ZTD A;  2LYA A;  3NVY A;  2W3S A;  4QZC A;  4LJX A;  1ZQJ A;  5D49 A;  1BPX A;  2KEY A;  1MC8 A;  3NRW A;  4DF8 A;  1NJW A;  2OH2 A;  2ZIW B;  1SL0 A;  4BGD A;  3MR3 A;  1T4G A;  2DPI A;  3OTQ A;  5TZV A;  4QIW C; 
#chains in the Genus database with same CATH homology
 2DKZ A;  1SV0 A;  3TAC B;  2QAR A;  2K4P A;  2E8M A;  2GLE A;  1X66 A;  2KSO A;  2D8C A;  3SEI A;  2QAR B;  1KW4 A;  2EAM A;  5KNI A;  5JRT A;  3HIL A;  2KIV A;  1X9X A;  1UQV A;  4NL9 C;  5JTI A;  1LKY A;  1UCV A;  2B6G A;  4PZO A;  1PK3 A;  4IS7 A;  3KKA C;  1JI7 A;  1WWU A;  2D3D A;  1B4F A;  2EAN A;  2KMD A;  1PK1 B;  4NL9 A;  5JU5 A;  3BQ7 A;  1RG6 A;  1SV4 A;  1SV0 C;  3TAD C;  2EAO A;  5L1M A;  1F0M A;  2F44 A;  1DXS A;  4NJ8 A;  2F3N A;  2JV3 A;  2F8K A;  1OXJ A;  1PK1 A;  2DKX A;  2ES6 A;  4RQN A;  2QB0 B;  5F3X B;  2K60 A;  1SXD A;  2DL0 A;  3BS5 B;  2KSO B;  4MHV A;  3SEN A;  3TAD A;  5J8Y A;  1SGG A;  2E8P A;  4PZN A;  2ESE A;  3BS7 A;  1LKY B;  1B0X A;  1V85 A;  2FE9 A;  1COK A;  3KKA A;  2E8O A;  2Y9T A;  2LPE A;  2Y9U A;  3K1R B;  2QB1 A;  2QKQ A;  2L5Y A;  2E8N A;  3H8M A;  3IDW A;  2QB0 A;  1WWV A;  5J8Y C;  1SXE A;  2KE7 A;  3BS5 A;  2KG5 A;  1OW5 A;  4RQM A;  1X40 A;  1Z1V A;  2EAP A;  2LMR A;  2YTU A;  1V38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...