2KMDA

Ras signaling requires dynamic properties of ets1 for phosphorylation-enhanced binding to co-activator cbp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
109
Chain Sequence
HMECADVPLLPSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, protein binding
molecule keywords Protein C-ets-1
publication title Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to coactivator CBP.
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 109
sequence length 111
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kmdA01
2F8KA 1SXEA 2GLEA 3BQ7A 5J8YC 2K60A 4NL9A 2QB1A 2KG5A 2DKXA 2K4PA 3H8MA 3SEIA 2DL0A 1V85A 3BS7A 2KE7A 3IDWA 1SGGA 4MHVA 1UCVA 2Y9TA 5L1MA 1X66A 1UQVA 1PK1B 3K1RB 2KIVA 2ES6A 1F0MA 1PK3A 2F44A 2QB0A 3BS5A 1B4FA 1V38A 2KMDA 2KSOB 2QARB 1SXDA 4NJ8A 1COKA 5KNIA 2B6GA 2EAOA 3KKAC 5JU5A 1KW4A 1LKYB 3HILA 1X40A 4RQNA 1B0XA 1OXJA 2Y9UA 4PZNA 2JV3A 1DXSA 2YTUA 2ESEA 3KKAA 1JI7A 1OW5A 2FE9A 2E8MA 2DKZA 2E8NA 1SV4A 3TADC 1WWUA 4IS7A 4PZOA 3TACB 1PK1A 5JTIA 2D8CA 4RQMA 3TADA 2EANA 5F3XB 2EAMA 2KSOA 2QARA 2D3DA 5JRTA 2QKQA 1RG6A 1WWVA 3SENA 1LKYA 2LMRA 1SV0C 2LPEA 5J8YA 2QB0B 2L5YA 3BS5B 2E8OA 4NL9C 1Z1VA 2EAPA 2E8PA 1X9XA 1SV0A 2F3NA
chains in the Genus database with same CATH superfamily
4UASA 5AKEA 4GFJA 3N4MB 5ALZA 2K60A 1SKSA 3PVXA 3OTQA 1ZQYA 3KOOA 8ICTA 4DF8A 3ICXA 5DQHA 2PFQA 5BOLA 4RPXA 5J0YA 2C2RA 1DOQA 2ZIXB 4BXOB 4Z6FA 3F5EA 4JUZA 2OHFA 4I2GA 4O9MA 1MSWD 1KRPA 7ICFA 5EE3A 4ED0A 1X66A 2WF6A 2YQEA 1X9SA 2BHNA 2Z7JA 1ZQEA 4KLIA 5KFZA 3C23A 4QZ8A 2Y1IA 4Y2RA 4F5PA 1RYRA 4UARA 3R9KA 2KMDA 2QARB 2ZIUA 5IIMA 2EZYA 2I6XA 2WFAA 2NRWA 5KFEA 3SMVA 1LKYB 1WG8A 1ZQRA 2BCVA 4Y2TA 1TK5A 2G5IB 3VC8A 1NI3A 5KFSA 4PHDA 2HHUA 5ALEA 2YTUA 3C1YA 2HBLA 2MA1A 1TAQA 4QZEA 4IQUA 5G5GA 1UA0A 2M9NA 1QTMA 1TK8A 4MF2A 1N56A 1ZQXA 4Y2SA 1BPDA 4QZDA 4QZAA 4F2RA 3TADC 2K4EA 2NRXA 3SAGA 3DDHA 1ZQIA 3T3FA 5BPCA 2R8HA 3V7KA 8ICAA 1S10A 4DQPA 1WYGA 5KG4A 2KV2A 5KFTA 1KDHA 1SV0C 4ECXA 2BCSA 4OJPA 4BJQA 4PGQA 2E8PA 5KFYA 4DSIA 2ISOA 2HHVA 3HRDD 3AMZA 3FDSA 2FLNA 1QSLA 3WK4A 3WK5A 5KT7A 1ZQNA 3ZDDA 1V85A 1XU4A 5ALGA 1L8LA 3E58A 2NV3A 1L7MA 1PK1B 2P6UA 1LV5A 2G0AA 2JZBA 2K89A 5KFXA 1U47A 2E1FA 5KFJA 4EZ6A 3IG5A 2ODGA 1SXDA 4I2BA 2OM6A 5KG1A 2RDJA 5D4BA 5CR0A 2B6GA 3KKAC 5DG9A 5G5HA 1L8OA 3N7SC 5KT3A 2KOBA 1L3TA 5DQGA 3Q8KA 3RJKA 5KFQA 5KFGA 4ECSA 5DGBA 4KX3A 3ETRA 2ZUDA 2DGZA 3FC4A 4C4SA 1EXNA 3TARA 1S5LU 3ONNA 5KG2A 4Z6EA 7ICOA 3G6XA 4RNMA 5ALDA 1RDFA 3KHRA 4M9GA 2NRTA 2XGQA 8ICCA 5J0RA 5JRTA 2QKQA 5AIAA 4RQ8A 2BKEA 4DOBA 4YMOA 1TV9A 5KFMA 4QZFA 2L5YA 2E8OA 3OHAA 3MGVA 3C5GA 3BJYA 4NL9C 3EW9A 1Q3UA 2VJ4A 1XSNA 5ALVA 4UAZA 4RU9A 4KLGA 1SXEA 4F5NA 1QCKA 4USAA 5J8YC 4PGXA 4NV0A 2YMLA 1CUKA 3C2LA 5AKYA 3LWMA 4OCZA 2BCUA 3EYZA 1MQ2A 4NWIA 2DKXA 3RB4A 4UB6U 4B9NA 4MFCA 3ALRA 4HYKA 2GOLA 4RUAA 2BPFA 2H3IA 4NLZA 5J2GA 3F2DA 1JMSA 3KBBA 5J2AA 2IBKA 1NJXA 3J81j 1ZQLA 5KFAA 1YZ6A 2BQUA 2IOFA 1O03A 5DDYA 3PW7A 3PO4A 5ALSA 2ZIWA 4F93B 5KFDA 2KHQA 1BNOA 5KFBA 2DPJA 2W9CA 3UQ2A 4C7ZA 3EUB2 1NKCA 3QE9Y 2BQ3A 2LM4A 1GO3F 2BCRA 3QU5A 1UA1A 1RQLA 3RJGA 4QW9A 3HKZF 3HKZC 5EWGA 5AIBA 2RDIA 1WCLA 3RH6A 1WWUA 9ICEA 2HMXA 4M6WA 1XO1A 5DG7A 1MQ3A 1NZBA 3QXGA 3QU9A 3NUQA 4OJOA 4YFKA 1L6NA 3GIIA 8ICSA 4JK1A 4J9LA 5AM2A 1OUQA 2W7OA 1S0OA 2GH1A 5IILA 1KEJA 2XY5A 1XO0A 5EWEA 2OYYA 3Q8RB 2XVTA 2EAPA 2BQRA 2K4IA 4O3PA 5HNKA 4Y2UA 1ZRNA 5KFHA 3MDCA 4DSEA 8ICYA 1ZXIA 2KJ5A 2F8KA 5AKJA 4TQRA 3GIJA 3I76A 5C5JA 2Y0SF 1XWLA 4B9TA 2Y0SC 2OCEA 9ICPA 1NK5A 3B0XA 2JZBB 4IC9A 1J2NA 4GXIA 2KE7A 4F71A 3PSFA 2ZIVB 1ZQVA 1UCVA 1N61A 4RQ3A 3AM9A 3WKBA 3HP6A 3QU4A 2MUTA 4KITB 2W9BA 4I2AA 1K5OA 2RQ5A 1Z19A 3GQCA 5HHHA 1VLBA 3PSIA 2JR5A 2W7PA 5J2IA 2R8KA 4C8OA 5KNIA 3Q8MA 4PL1A 1JROA 9ICQA 8ICPA 8ICRA 2D6FC 5J0XA 3H8WA 1X9WA 5JUMA 3LDAA 1BNPA 1LB2B 4RT2A 3PW5A 4M47A 1L3VA 3WK9A 4FE3A 2HCFA 3GFKB 3RH5A 3RRGA 4UW9A 1KKXA 1ZQFA 1ZQWA 2PI4A 5KTQA 3KTQA 2A1JA 3UXNA 1COOA 5DB6A 4EYIB 3PX0A 2QARA 3MABA 4ACOA 2JRZA 2IMWP 4YD1A 4I2EA 2KTQA 2MSNA 4XRHA 2KKPA 1LKYA 2P6RA 4KLTA 9ICBA 8ICFA 3BS5B 5AI0A 1UPHA 4CF3A 1SL2A 4DSKA 2HBJA 1X9XA 2C2EA 5CP2A 1A77A 4GIBA 3EWAA 2J6TA 2QB1A 5EWFA 4IL6U 1ZQOA 9ICMA 2MRLA 2ISPA 5DQIA 2XO7A 5ALMA 1SIJA 2NO5A 2AH5A 2HOIA 2DBYA 3FYHA 2KIWA 2IHNA 4DCCA 4RQ6A 3IHQB 1NK7A 2ZIWB 2KZMA 5L1LA 4I2CA 4QNLA 5KT5A 2VA8A 1X6IA 1NJZA 5EOZA 2YX8A 5ALFA 4F50A 2WHEA 1ZOLA 4ECZA 2FLLA 4IRDA 3IP4B 4ZOHC 1COKA 4KLQA 3H4BA 3AQFA 5CRXA 4DL7A 3AU6A 1S9FA 4DS5A 3SYZA 8ICGA 2LI6A 1QSYA 4NLCA 1S77D 2WTFA 3LWLA 3GILA 5AI8A 4DSJA 8ICJA 8ICZA 2FE9A 3GIMA 8ICKA 4F92B 2AU0A 1UT8A 3PR4A 4TUSA 5J2HA 1ZQPA 3JPPA 4IS7A 3TACB 1PK1A 1NZPA 4UAYA 4M9LA 1ZQ1C 3TFSA 4GC7A 3NGDA 2YN4A 5DB8A 4AP9A 3WU2U 3MR5A 3EPIA 2F76X 5HR6A 4CNQA 4YR2A 3SV4A 3WKEA 5KT4A 1T3QA 3V7JA 4EBEA 1QQ7A 5HMLA 1DK2A 2F1JA 1SKRA 1KLNA 2KNJA 9ICHA 2K4PA 2MUTB 2YB1A 5DBAA 4EENA 1L3SA 5KL8B 3BS7A 4RPZA 3T79A 4DQIA 3AU2A 3NVVA 5ALWA 4J9SA 4ZH4A 1C7YA 1YZ7A 4UB5A 7ICNA 5T14A 3ZDAA 1B4FA 9ICXA 4QJFB 3HW8A 2R8IA 5EE0A 4NJ8A 1Y88A 2I5HA 3ZD8A 3NVZA 2FMSA 2LKYA 3SD7A 3JPNA 4KLSA 4QZIA 3ZDEA 2PKEA 3BQ2A 2HHWA 2LYAA 3THVA 1L7OA 3TKAA 7ICGA 4BUGA 2A1JB 3UM9A 5DB9A 1IM4A 2XI9A 2NRZA 4KLMA 2KJ8A 5ALKA 2WF8A 3D6JA 5L1KA 4RUCA 5AKLA 4ED8A 2AGOA 1ZD4A 4FFDA 3PX6A 3D2SA 1UT5A 2WF9A 3H40A 4C8MA 3F2BA 3IG8A 1A6SA 1NJWA 1KQQA 3QYPA 2K4HA 5J8YA 9ICWA 1TFRA 4KLFA 2G06A 1ZQAA 2KZZA 4QZHA 7ICPA 5DG8A 2F3NA 5EE1A 4KLUA 4YMNA 4TUQA 4PL2A 4M9JA 3BZCA 1RXVA 1U45A 9ICSA 1PZNA 4I27A 3H4DA 1NK8A 9ICNA 4I2HA 4UB8U 2BGWA 2A19A 3I28A 1V9PA 7ICHA 5CEHA 4P2HA 5AI5A 4DS4A 2NO4A 2F77X 3RB6A 7ICSA 2K8BB 3RR7A 2GWSA 4MHVA 4FO6A 2A1AA 3UXPA 2VKQA 5KT2A 5B66U 2ES6A 1PK3A 5DGAA 4JV1A 2J6UA 9ICCA 5HMMA 1KFTA 1MC8A 2KN7A 2ZTEA 3V7LA 1TK0A 4Q8EA 2XIDA 2BR0A 5KAFU 4DQRA 2MU2A 3H8JA 4NLKA 5JU5A 3GV8B 1HUOA 2HHXA 4PZNA 2W9MA 3FAHA 7ICRA 1DXSA 5ALJA 1ED1A 4YXMA 3GZFA 2F1HA 4EYHB 2JEFA 1JIHA 1L3UA 4QW8A 2UVWA 4B9MA 1SZHA 1NNLA 5B5EU 9ICVA 1SZPA 2AXTU 3ETLA 4OJLA 4CRXA 5AKHA 4BWJA 9ICUA 2ZIVA 4J9RA 3QUQA 3F2CA 2KICA 4EBCA 1IV8A 3ORYA 5GTHU 1CRXA 3RJJA 4BGDA 2EQYA 2DF4B 3G6VA 1D9FA 2RHFA 3PNCA 5ALNA 2BPCA 4QZ9A 4M0AA 1H38A 3IM1A 1ZQZA 1RYUA 1T8EA 2EZZA 2QB0B 4RNNA 5KFWA 4YMMA 2FLPA 2HHSA 4IQTA 4MFAA 5CJ7A 1TAMA 3JPOA 1X6JA 4US9A 2GLEA 2HHQA 3BQ7A 1PUZA 5KFLA 4O5EA 2BDUA 3QX7A 1F5SA 1ZQDA 5CWRA 4R63A 2FPMA 2ZTDA 3C21A 5J0OA 2FDRA 5KG5A 3M7DA 1XNSA 3PW4A 3F53A 1Z00A 4KLOA 1KFDA 4UAWA 1Z3EB 5IINA 8ICMA 4P4MA 1F0MA 5KFVA 4US8A 4ECVA 4ELUA 1B43A 4QWAA 3BS5A 3AN1A 3NVYA 4DO9A 4O3NA 2YMQA 2ZUCA 1BVSA 3WKAA 1NOMA 2R8JA 1D8YA 3OJSA 3KZXA 3QZ8A 4TQSA 5E79U 3QNMA 5D46A 1J2MA 3A0HU 4IQVA 3CNHA 3Q8PB 4JB3A 1JI7A 1KSPA 2VA3A 2OEHA 2B0CA 4MFFA 3PZPA 4PZOA 5D49A 3F5AA 3JPQA 5J29A 2AGPA 1L7NA 4J9QA 4FZNA 4QWDA 2W04A 4UB2A 2H3VA 1U49A 2AHOB 5HR7A 4RQ7A 4OJ5A 4A8EA 4KN7A 2Y1JA 4M9HA 5J2KA 4F4YA 5KG6A 1Z1BA 3T5KA 2DPIA 2FMPA 3RJFA 2KFNA 4FZLA 3FM9A 5F9LA 7ICUA 3UMCA 4R8UB 2XCAA 5ALIA 4QWEA 4J9OA 1NJYA 9ICGA 4YR3A 2XICA 3RJHA 2KVSA 2OH2A 4PHPA 3WK6A 4EEYA 2JGAA 2CN1A 4KX5A 5KL1B 4XQ8A 9ICLA 4J9KA 4KMOB 5KFOA 1RYSA 3A0BU 7ICIA 8ICBA 2K8AA 3DV9A 3C5FA 3ZDCA 2FI1A 2JH1A 2Y9TA 7ICLA 4O3QA 1QQ5A 4C8KA 4M2YA 3K1RB 1K1SA 5ALYA 5KG0A 4DL4A 5DBBA 3BZKA 3V6JA 3ZI4A 3NASA 4DEZA 4KLLA 1HUZA 1F44A 2VIXA 4M04A 3B9JA 3D2NA 1B0XA 1OXJA 4DOAA 4I2FA 4YVZA 3MC1A 4C4RA 1ECWA 5KFIA 1NK9A 4IQWA 3ISBA 4JWMA 3HT3A 4EZ9A 1VDVA 5K4LA 1SV4A 2KK0A 4U7CA 5KAIU 5J0WA 1ZYQA 1A0PA 3EZ5A 2LM1A 2K8CB 4UQGA 2XY7A 4RQ4A 1Q46A 4AYBF 4DOCA 4AYBC 1BPZA 3UQ0A 2W8KA 3PO5A 2G09A 3TAPA 1ZD5A 2ATLA 2PXIA 1JXEA 2ZUBA 3JPRA 3LYSA 1IG6A 5ALUA 3QU2A 5J0QA 8ICQA 3ISDA 2IA6A 2BDPA 4YG2A 2AJQA 2DQNB 1Q3VA 2KP7A 4F91B 1S76D 1Z00B 4RQ1A 3WKCA 4F4ZA 4O5CA 5KFFA 2WF7A 4B9UA 4TURA 1SGGA 1B22A 3L3FX 4GLXA 4YQWA 3C2KA 1FFVA 5J2JA 4QZBA 4J03A 1KFSA 3QEBZ 2IHMA 5AKIA 3PSTA 1S0MA 4M9NA 2ALZA 2KSOB 4CE6A 3BDPA 2ASLA 3RF9A 2AQ4A 2W03A 5KFRA 1N48A 4YR0A 5BOMA 4J9PA 2VJ5A 1QQ6A 3WK7A 5A0LA 1WCNA 3MGIA 4P0QB 4IR9A 1N5WA 2ZJAA 4Y2XA 3AL0B 3L4PA 1SL1A 4FBTA 4ECYA 1SL0A 2E8MA 2HI0A 2HBKA 3PV8A 3I1YA 1BGXT 3KD3A 5AKXA 3PY8A 4JMUA 3SQIA 4UB1A 1O08A 1L7PA 3IRUA 4F4XA 2EH9A 2JEGA 4PGYA 9ICFA 4GC6A 4BDPA 1BPEA 3TADA 2IOHA 4EX7A 4KLDA 2EAMA 3M8RA 3N7RC 4F5OA 2W3RA 1QSSA 4FS1A 2FPKA 3KHGA 7ICTA 2HHTA 7ICVA 4I2JA 3SV3A 5F9NA 1T4GA 5L1JA 1SV0A 4GXKA 3BQ0A 3SAHA 3OJUA 2VANA 2BCQA 3L5KA 2KG5A 4O0IA 3E2EA 5AKGA 2A3VA 3M6ZA 1RM6C 4HAIA 1TVAA 3PR5B 2PFNA 3HPOA 4DL3A 4PHAA 4UAUA 4RQ0A 4JV2A 2DL0A 2G07A 5ALRA 5CHGA 1YT3A 1HJPA 4NLGA 3OGUA 1X9MA 3NS1A 2OWOA 3UXOA 4QZGA 2QB0A 3AUOA 8ICIA 2F8LA 4ED1A 2HOFA 2CRXA 4J9NA 2UVUA 2C2DA 2RRDA 8ICNA 4JV0A 5TISU 4C80A 4C0ZA 9ICOA 4P4PA 4EX6A 4FS2A 1MA7A 3KKAA 4RQ5A 4EELA 3Q8QB 2HSZA 4C7YA 5AK4A 4DWIA 1XSPA 2GO7A 4I29A 5AK3A 3CP8A 2UVRA 1L5UA 2W9AA 4CF5A 3B0YA 4UB3A 1URJA 5ALPA 4LZGA 3M9MB 2NYVA 3LVWA 3OHBA 1ZQGA 1ZQJA 3MR6A 4YD2A 4YCXA 1WWVA 3RB0A 4PH5A 8ICWA 3H0MB 3PW2A 5DKWA 4RQ2A 1KN5A 3HX0A 4K4GA 1N62A 2XY6A 1ZQBA 1RPLA 5GTIU 1LVHA 3TQ1A 4NL9A 4LJXA 2E3TA 9ICAA 3GV7B 4P4OA 4F4KA 3M9NB 3SR6A 3SEIA 5ALHA 4RZRA 1V97A 1QLNA 3SAFA 4ED2A 1NK0A 1VJ5A 8ICUA 4F8RA 4RT3A 1Q8KA 4RNOA 4Y2JA 4R66A 4DFMA 3HJEA 4ICAA 4PHEA 5AM0A 2WAQF 3RB3A 2WAQC 1V38A 3N97B 4R8UA 3GV5B 3M8SA 4QWBA 1D9DA 5L1IA 2IOFK 2KFZA 4Y2VA 9ICIA 3SI8A 3RBDA 2Y9UA 2PFPA 1RZTA 3AEVA 1AQ6A 1ZQUA 4QWCA 5IIIA 3NRZA 3QUCA 3JPTA 9ICTA 1N63A 3RJIA 2CPRA 2E8NA 2FMQA 4DL5A 3NVWA 5KFPA 2LBOA 2MAXA 2R18A 2FJ6A 3H0LB 2V9WA 3QEAZ 4DFDA 4RPYA 2EANA 4UBBA 1CEZA 4ECWA 2I1QA 5L9XA 2JMGA 2W8LA 3Q8LA 2E5SA 5J0UA 3TI0A 2JH7A 9ICRA 4MEYA 4B9LA 4LVSA 4Q43A 3OSPA 2H5XA 5AM1A 2KZ3A 4NLBA 1DGJA 2W55A 3IV6A 3K1ZA 5ALLA 3CW2C 3MFHA 5HP4A 4NLNA 3RBEA 4YP3A 1T94A 4F3OA 3WKDA 5KFCA 3U26A 4C8LA 3MFIA 4QZCA 4IR1A 3H8MA 2VA2A 2NRVA 4Y2QA 1T7PA 4DQSA 2PI5A 4O3MA 2KEYA 1NKBA 1BPXA 2KD1A 2C22A 2F44A 3NTUA 3TANA 2G5HB 3E0FA 1ZQHA 3CYMA 2C28A 2HW3A 1ZJNA 4IRKA 4K4HA 3MR2A 3GDXA 3K4GA 5KG7A 5J0TA 1JX4A 1KTQA 2HVHA 3MGHA 2EAOA 2H3QA 1KW4A 1RQNA 4IRCA 3O0FA 5J2CA 4OD0A 5ALOA 3C1ZA 2DUYA 5J2EA 7ICKA 2JV3A 4P0PA 1T3NA 1P7DA 5C0YA 3C2MA 1UHUA 4DQQA 1XS9D 1OW5A 4DL6A 9ICJA 1FEZA 2D8CA 2J6SA 4RQMA 2KSOA 3S6JA 7ICEA 3PW0A 2W54A 2V4RA 1S0NA 3KFUF 2P35A 2LMRA 3UMGA 3OPXA 3JPSA 2BPGA 1FO4A 5AKZA 3M9OB 4UBCA 4F5RA 3LVVA 4P0QA 1ZQSA 2ZXIA 1NK6A 1PVRA 2ZIUB 1Z1VA 3LK9A 3SZ2A 4Q45A 4EBDA 3RR8A 2W11A 5AM5A 8ICLA 3KZIU 3RAQA 2KVCA 1S8OA 3UPQA 3WK8A 1PVPA 1SKWA 2YMMA 8ICXA 4F2SA 2Q0ZX 4DFPA 2WF5A 2ASJA 4ECTA 3MDAA 2AGQA 1BPBA 4UAVA 2YMPA 1SB3C 1A76A 1HEKA 3IDWA 2B21A 1QH9A 3QU7A 2HVIA 1NK4A 3ZD9A 1KL9A 1BPYA 4MF8A 4ECQA 5DDMA 1C20A 3PMLA 1SWVA 2G08A 2ZJ8A 5KG3A 1XC9A 2CXYA 4KLEA 3EPGA 3PX4A 2EDUA 3HILA 3NRWA 4MEXA 5AK6A 4OJ6A 4RQNA 4UATA 4C4TA 2EZXA 3BQTA 4ECUA 2FPLA 1D8BA 2XGPA 4G3IA 2W43A 4O3SA 1JRPA 4EEKA 3T5LA 3RJEA 3RRHA 1ZQTA 4Y2YA 1S97A 4FZMA 5AM3A 5J2FA 2JHDA 1JXLA 4JWNA 5EE9A 2DKZA 5ALXA 5KFUA 1D8LA 5J2DA 2YB4A 3BQ1A 3V6KA 5DB7A 2YY6A 2JXJA 4G9BA 5JTIA 1X42A 2RP5A 5IIJA 2ASDA 3RAXA 1IIPA 4F5QA 1U48A 4GXJA 4LZDA 4J9MA 2PMZF 2PMZC 4B9VA 4Y2PA 4BWMA 2DWQA 2RLTA 2KJ9A 3ISCA 4NXZA 4DSLA 5CB1A 3C29A 1M6YA 4I28A 3GIKA 4K4IA 5HHIA 4PJ0U 4UB4A 1MN8A 1N5XA 4NM1A 4CGZA 4CDGA 3QZ7A 3GU3A 1CI4A 4ED7A 5KFNA 8ICEA 3V72A 5KT6A 1U4BA 5FP0A 2H3FA 1S0VA 3UMBA 3HWTA 4ECRA 1K1QA 4O3RA 1UQVA 2LYBA 3RFAA 2KIVA 4B6JA 2ZIXA 4BXOA 3KHHA 4QIWF 8ICHA 4QIWC 4P0PB 2UVVA 1ZQMA 4I2IA 4ED6A 1AROP 1TE2A 2HBMA 2ZJ5A 4XUSA 2W3SA 3MR3A 2ZTCA 5AI9A 2E1EA 4DLEA 1WUDA 3N7PD 3N28A 1J97A 4DFKA 3M6KA 4KLJA 5DLGA 3PMNA 1IXRA 1X2IA 3D2QA 8ICVA 1Z4NA 5AI4A 8ICOA 5J0SA 2N1RA 3T5JA 4U6PA 3G6YA 4F72A 2H3ZA 2I9GA 4CF4A 3H7IA 2XCPA 3KHLA 4YN4A 4TUPA 2HOQA 3RH4A 4X5VA 4Z6DA 5F3XB 2JEJA 4I2DA 1ZD2P 3C28A 5CA7A 3RTVA 2D3DA 1NKEA 1ZETA 3CRXA 2Q4TA 7ICMA 1HIWA 5J0PA 2LPEA 1Z4OA 1N60A 3DEEA 5ALTA 5H2FU 1JN3A 2KHVA 4Q8FA 5ALQA 1KBUA 5DLFA 4DSFA 1DK3A 1SWWA 2W9CB 1RXWA 9ICKA 2R8GA 4CCHA 3M1YA 5AICA 2HDOA 3H8SA 3QUBA 1PVQA 2JEIA 5AM4A 1U9LA 5IIKA 4XA5A 1ZJMA 4KLHA 4ED3A 4O5KA 3V6HA 4R65A 4Q44A 1JALA 3H0RB 3TFRA 4NY8A 5L1MA 4M6WB 1ZQQA 2WB1F 3TAQA 4PPXA 2WB1C 2LHTA 3MBYA 1FFUA 2DFLA 2BZFA 3ED5A 1FIQA 1ZRMA 2M0NA 1ZQKA 4DL2A 4ELVA 4OO1J 4NM2A 4E0DA 5AHXA 1N2XA 2KKVA 3IN5A 5J2BA 1DGSA 1X40A 5IIOA 1TAUA 5AI6A 4YXJA 5TZVA 3QUTA 2QLTA 4DF4A 2ESEA 2LYHA 3PSPA 4Z6CA 3AQEA 2OXOA 2XC9A 1ZQCA 4DFJA 4WJ3B 3Q8SB 1ZD3A 3ZDBA 7ICQA 2F1IA 5AKKA 4O3OA 1JUDA 5AK5A 1XSLA 3K75D 3T5HA 4FBUA 3OSNA 3VCBA 1DRGA 4DLGA 5DBCA 4ELTA 7ICJA 1TKDA 4C8NA 2F2AB 2AQ0A 2PFOA 1RG6A 4KN4A 3SENA 2P66A 2W9BB 4F4WA 4BX9C 4KMUA 2ZG6A 2ZXHA 2O6KA 4KTQA 5KFKA 2V4QA 4R64A 4B9SA
chains in the Genus database with same CATH topology
2F8KA 1SXEA 2GLEA 3BQ7A 5J8YC 2K60A 4NL9A 2QB1A 2KG5A 2DKXA 2K4PA 3H8MA 3SEIA 2DL0A 1V85A 3BS7A 2KE7A 3IDWA 1SGGA 4MHVA 1UCVA 2Y9TA 5L1MA 1X66A 1UQVA 1PK1B 3K1RB 2KIVA 2ES6A 1F0MA 1PK3A 2F44A 2QB0A 3BS5A 1B4FA 1V38A 2KMDA 2KSOB 2QARB 1SXDA 4NJ8A 1COKA 5KNIA 2B6GA 2EAOA 3KKAC 5JU5A 1KW4A 1LKYB 3HILA 1X40A 4RQNA 1B0XA 1OXJA 2Y9UA 4PZNA 2JV3A 1DXSA 2YTUA 2ESEA 3KKAA 1JI7A 1OW5A 2FE9A 2E8MA 2DKZA 2E8NA 1SV4A 3TADC 1WWUA 4IS7A 4PZOA 3TACB 1PK1A 5JTIA 2D8CA 4RQMA 3TADA 2EANA 5F3XB 2EAMA 2KSOA 2QARA 2D3DA 5JRTA 2QKQA 1RG6A 1WWVA 3SENA 1LKYA 2LMRA 1SV0C 2LPEA 5J8YA 2QB0B 2L5YA 3BS5B 2E8OA 4NL9C 1Z1VA 2EAPA 2E8PA 1X9XA 1SV0A 2F3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8K A;  1SXE A;  2GLE A;  3BQ7 A;  5J8Y C;  2K60 A;  4NL9 A;  2QB1 A;  2KG5 A;  2DKX A;  2K4P A;  3H8M A;  3SEI A;  2DL0 A;  1V85 A;  3BS7 A;  2KE7 A;  3IDW A;  1SGG A;  4MHV A;  1UCV A;  2Y9T A;  5L1M A;  1X66 A;  1UQV A;  1PK1 B;  3K1R B;  2KIV A;  2ES6 A;  1F0M A;  1PK3 A;  2F44 A;  2QB0 A;  3BS5 A;  1B4F A;  1V38 A;  2KMD A;  2KSO B;  2QAR B;  1SXD A;  4NJ8 A;  1COK A;  5KNI A;  2B6G A;  2EAO A;  3KKA C;  5JU5 A;  1KW4 A;  1LKY B;  3HIL A;  1X40 A;  4RQN A;  1B0X A;  1OXJ A;  2Y9U A;  4PZN A;  2JV3 A;  1DXS A;  2YTU A;  2ESE A;  3KKA A;  1JI7 A;  1OW5 A;  2FE9 A;  2E8M A;  2DKZ A;  2E8N A;  1SV4 A;  3TAD C;  1WWU A;  4IS7 A;  4PZO A;  3TAC B;  1PK1 A;  5JTI A;  2D8C A;  4RQM A;  3TAD A;  2EAN A;  5F3X B;  2EAM A;  2KSO A;  2QAR A;  2D3D A;  5JRT A;  2QKQ A;  1RG6 A;  1WWV A;  3SEN A;  1LKY A;  2LMR A;  1SV0 C;  2LPE A;  5J8Y A;  2QB0 B;  2L5Y A;  3BS5 B;  2E8O A;  4NL9 C;  1Z1V A;  2EAP A;  2E8P A;  1X9X A;  1SV0 A;  2F3N A; 
#chains in the Genus database with same CATH topology
 4UAS A;  5AKE A;  4GFJ A;  3N4M B;  5ALZ A;  2K60 A;  1SKS A;  3PVX A;  3OTQ A;  1ZQY A;  3KOO A;  8ICT A;  4DF8 A;  3ICX A;  5DQH A;  2PFQ A;  5BOL A;  4RPX A;  5J0Y A;  2C2R A;  1DOQ A;  2ZIX B;  4BXO B;  4Z6F A;  3F5E A;  4JUZ A;  2OHF A;  4I2G A;  4O9M A;  1MSW D;  1KRP A;  7ICF A;  5EE3 A;  4ED0 A;  1X66 A;  2WF6 A;  2YQE A;  1X9S A;  2BHN A;  2Z7J A;  1ZQE A;  4KLI A;  5KFZ A;  3C23 A;  4QZ8 A;  2Y1I A;  4Y2R A;  4F5P A;  1RYR A;  4UAR A;  3R9K A;  2KMD A;  2QAR B;  2ZIU A;  5IIM A;  2EZY A;  2I6X A;  2WFA A;  2NRW A;  5KFE A;  3SMV A;  1LKY B;  1WG8 A;  1ZQR A;  2BCV A;  4Y2T A;  1TK5 A;  2G5I B;  3VC8 A;  1NI3 A;  5KFS A;  4PHD A;  2HHU A;  5ALE A;  2YTU A;  3C1Y A;  2HBL A;  2MA1 A;  1TAQ A;  4QZE A;  4IQU A;  5G5G A;  1UA0 A;  2M9N A;  1QTM A;  1TK8 A;  4MF2 A;  1N56 A;  1ZQX A;  4Y2S A;  1BPD A;  4QZD A;  4QZA A;  4F2R A;  3TAD C;  2K4E A;  2NRX A;  3SAG A;  3DDH A;  1ZQI A;  3T3F A;  5BPC A;  2R8H A;  3V7K A;  8ICA A;  1S10 A;  4DQP A;  1WYG A;  5KG4 A;  2KV2 A;  5KFT A;  1KDH A;  1SV0 C;  4ECX A;  2BCS A;  4OJP A;  4BJQ A;  4PGQ A;  2E8P A;  5KFY A;  4DSI A;  2ISO A;  2HHV A;  3HRD D;  3AMZ A;  3FDS A;  2FLN A;  1QSL A;  3WK4 A;  3WK5 A;  5KT7 A;  1ZQN A;  3ZDD A;  1V85 A;  1XU4 A;  5ALG A;  1L8L A;  3E58 A;  2NV3 A;  1L7M A;  1PK1 B;  2P6U A;  1LV5 A;  2G0A A;  2JZB A;  2K89 A;  5KFX A;  1U47 A;  2E1F A;  5KFJ A;  4EZ6 A;  3IG5 A;  2ODG A;  1SXD A;  4I2B A;  2OM6 A;  5KG1 A;  2RDJ A;  5D4B A;  5CR0 A;  2B6G A;  3KKA C;  5DG9 A;  5G5H A;  1L8O A;  3N7S C;  5KT3 A;  2KOB A;  1L3T A;  5DQG A;  3Q8K A;  3RJK A;  5KFQ A;  5KFG A;  4ECS A;  5DGB A;  4KX3 A;  3ETR A;  2ZUD A;  2DGZ A;  3FC4 A;  4C4S A;  1EXN A;  3TAR A;  1S5L U;  3ONN A;  5KG2 A;  4Z6E A;  7ICO A;  3G6X A;  4RNM A;  5ALD A;  1RDF A;  3KHR A;  4M9G A;  2NRT A;  2XGQ A;  8ICC A;  5J0R A;  5JRT A;  2QKQ A;  5AIA A;  4RQ8 A;  2BKE A;  4DOB A;  4YMO A;  1TV9 A;  5KFM A;  4QZF A;  2L5Y A;  2E8O A;  3OHA A;  3MGV A;  3C5G A;  3BJY A;  4NL9 C;  3EW9 A;  1Q3U A;  2VJ4 A;  1XSN A;  5ALV A;  4UAZ A;  4RU9 A;  4KLG A;  1SXE A;  4F5N A;  1QCK A;  4USA A;  5J8Y C;  4PGX A;  4NV0 A;  2YML A;  1CUK A;  3C2L A;  5AKY A;  3LWM A;  4OCZ A;  2BCU A;  3EYZ A;  1MQ2 A;  4NWI A;  2DKX A;  3RB4 A;  4UB6 U;  4B9N A;  4MFC A;  3ALR A;  4HYK A;  2GOL A;  4RUA A;  2BPF A;  2H3I A;  4NLZ A;  5J2G A;  3F2D A;  1JMS A;  3KBB A;  5J2A A;  2IBK A;  1NJX A;  3J81 j;  1ZQL A;  5KFA A;  1YZ6 A;  2BQU A;  2IOF A;  1O03 A;  5DDY A;  3PW7 A;  3PO4 A;  5ALS A;  2ZIW A;  4F93 B;  5KFD A;  2KHQ A;  1BNO A;  5KFB A;  2DPJ A;  2W9C A;  3UQ2 A;  4C7Z A;  3EUB 2;  1NKC A;  3QE9 Y;  2BQ3 A;  2LM4 A;  1GO3 F;  2BCR A;  3QU5 A;  1UA1 A;  1RQL A;  3RJG A;  4QW9 A;  3HKZ F;  3HKZ C;  5EWG A;  5AIB A;  2RDI A;  1WCL A;  3RH6 A;  1WWU A;  9ICE A;  2HMX A;  4M6W A;  1XO1 A;  5DG7 A;  1MQ3 A;  1NZB A;  3QXG A;  3QU9 A;  3NUQ A;  4OJO A;  4YFK A;  1L6N A;  3GII A;  8ICS A;  4JK1 A;  4J9L A;  5AM2 A;  1OUQ A;  2W7O A;  1S0O A;  2GH1 A;  5IIL A;  1KEJ A;  2XY5 A;  1XO0 A;  5EWE A;  2OYY A;  3Q8R B;  2XVT A;  2EAP A;  2BQR A;  2K4I A;  4O3P A;  5HNK A;  4Y2U A;  1ZRN A;  5KFH A;  3MDC A;  4DSE A;  8ICY A;  1ZXI A;  2KJ5 A;  2F8K A;  5AKJ A;  4TQR A;  3GIJ A;  3I76 A;  5C5J A;  2Y0S F;  1XWL A;  4B9T A;  2Y0S C;  2OCE A;  9ICP A;  1NK5 A;  3B0X A;  2JZB B;  4IC9 A;  1J2N A;  4GXI A;  2KE7 A;  4F71 A;  3PSF A;  2ZIV B;  1ZQV A;  1UCV A;  1N61 A;  4RQ3 A;  3AM9 A;  3WKB A;  3HP6 A;  3QU4 A;  2MUT A;  4KIT B;  2W9B A;  4I2A A;  1K5O A;  2RQ5 A;  1Z19 A;  3GQC A;  5HHH A;  1VLB A;  3PSI A;  2JR5 A;  2W7P A;  5J2I A;  2R8K A;  4C8O A;  5KNI A;  3Q8M A;  4PL1 A;  1JRO A;  9ICQ A;  8ICP A;  8ICR A;  2D6F C;  5J0X A;  3H8W A;  1X9W A;  5JUM A;  3LDA A;  1BNP A;  1LB2 B;  4RT2 A;  3PW5 A;  4M47 A;  1L3V A;  3WK9 A;  4FE3 A;  2HCF A;  3GFK B;  3RH5 A;  3RRG A;  4UW9 A;  1KKX A;  1ZQF A;  1ZQW A;  2PI4 A;  5KTQ A;  3KTQ A;  2A1J A;  3UXN A;  1COO A;  5DB6 A;  4EYI B;  3PX0 A;  2QAR A;  3MAB A;  4ACO A;  2JRZ A;  2IMW P;  4YD1 A;  4I2E A;  2KTQ A;  2MSN A;  4XRH A;  2KKP A;  1LKY A;  2P6R A;  4KLT A;  9ICB A;  8ICF A;  3BS5 B;  5AI0 A;  1UPH A;  4CF3 A;  1SL2 A;  4DSK A;  2HBJ A;  1X9X A;  2C2E A;  5CP2 A;  1A77 A;  4GIB A;  3EWA A;  2J6T A;  2QB1 A;  5EWF A;  4IL6 U;  1ZQO A;  9ICM A;  2MRL A;  2ISP A;  5DQI A;  2XO7 A;  5ALM A;  1SIJ A;  2NO5 A;  2AH5 A;  2HOI A;  2DBY A;  3FYH A;  2KIW A;  2IHN A;  4DCC A;  4RQ6 A;  3IHQ B;  1NK7 A;  2ZIW B;  2KZM A;  5L1L A;  4I2C A;  4QNL A;  5KT5 A;  2VA8 A;  1X6I A;  1NJZ A;  5EOZ A;  2YX8 A;  5ALF A;  4F50 A;  2WHE A;  1ZOL A;  4ECZ A;  2FLL A;  4IRD A;  3IP4 B;  4ZOH C;  1COK A;  4KLQ A;  3H4B A;  3AQF A;  5CRX A;  4DL7 A;  3AU6 A;  1S9F A;  4DS5 A;  3SYZ A;  8ICG A;  2LI6 A;  1QSY A;  4NLC A;  1S77 D;  2WTF A;  3LWL A;  3GIL A;  5AI8 A;  4DSJ A;  8ICJ A;  8ICZ A;  2FE9 A;  3GIM A;  8ICK A;  4F92 B;  2AU0 A;  1UT8 A;  3PR4 A;  4TUS A;  5J2H A;  1ZQP A;  3JPP A;  4IS7 A;  3TAC B;  1PK1 A;  1NZP A;  4UAY A;  4M9L A;  1ZQ1 C;  3TFS A;  4GC7 A;  3NGD A;  2YN4 A;  5DB8 A;  4AP9 A;  3WU2 U;  3MR5 A;  3EPI A;  2F76 X;  5HR6 A;  4CNQ A;  4YR2 A;  3SV4 A;  3WKE A;  5KT4 A;  1T3Q A;  3V7J A;  4EBE A;  1QQ7 A;  5HML A;  1DK2 A;  2F1J A;  1SKR A;  1KLN A;  2KNJ A;  9ICH A;  2K4P A;  2MUT B;  2YB1 A;  5DBA A;  4EEN A;  1L3S A;  5KL8 B;  3BS7 A;  4RPZ A;  3T79 A;  4DQI A;  3AU2 A;  3NVV A;  5ALW A;  4J9S A;  4ZH4 A;  1C7Y A;  1YZ7 A;  4UB5 A;  7ICN A;  5T14 A;  3ZDA A;  1B4F A;  9ICX A;  4QJF B;  3HW8 A;  2R8I A;  5EE0 A;  4NJ8 A;  1Y88 A;  2I5H A;  3ZD8 A;  3NVZ A;  2FMS A;  2LKY A;  3SD7 A;  3JPN A;  4KLS A;  4QZI A;  3ZDE A;  2PKE A;  3BQ2 A;  2HHW A;  2LYA A;  3THV A;  1L7O A;  3TKA A;  7ICG A;  4BUG A;  2A1J B;  3UM9 A;  5DB9 A;  1IM4 A;  2XI9 A;  2NRZ A;  4KLM A;  2KJ8 A;  5ALK A;  2WF8 A;  3D6J A;  5L1K A;  4RUC A;  5AKL A;  4ED8 A;  2AGO A;  1ZD4 A;  4FFD A;  3PX6 A;  3D2S A;  1UT5 A;  2WF9 A;  3H40 A;  4C8M A;  3F2B A;  3IG8 A;  1A6S A;  1NJW A;  1KQQ A;  3QYP A;  2K4H A;  5J8Y A;  9ICW A;  1TFR A;  4KLF A;  2G06 A;  1ZQA A;  2KZZ A;  4QZH A;  7ICP A;  5DG8 A;  2F3N A;  5EE1 A;  4KLU A;  4YMN A;  4TUQ A;  4PL2 A;  4M9J A;  3BZC A;  1RXV A;  1U45 A;  9ICS A;  1PZN A;  4I27 A;  3H4D A;  1NK8 A;  9ICN A;  4I2H A;  4UB8 U;  2BGW A;  2A19 A;  3I28 A;  1V9P A;  7ICH A;  5CEH A;  4P2H A;  5AI5 A;  4DS4 A;  2NO4 A;  2F77 X;  3RB6 A;  7ICS A;  2K8B B;  3RR7 A;  2GWS A;  4MHV A;  4FO6 A;  2A1A A;  3UXP A;  2VKQ A;  5KT2 A;  5B66 U;  2ES6 A;  1PK3 A;  5DGA A;  4JV1 A;  2J6U A;  9ICC A;  5HMM A;  1KFT A;  1MC8 A;  2KN7 A;  2ZTE A;  3V7L A;  1TK0 A;  4Q8E A;  2XID A;  2BR0 A;  5KAF U;  4DQR A;  2MU2 A;  3H8J A;  4NLK A;  5JU5 A;  3GV8 B;  1HUO A;  2HHX A;  4PZN A;  2W9M A;  3FAH A;  7ICR A;  1DXS A;  5ALJ A;  1ED1 A;  4YXM A;  3GZF A;  2F1H A;  4EYH B;  2JEF A;  1JIH A;  1L3U A;  4QW8 A;  2UVW A;  4B9M A;  1SZH A;  1NNL A;  5B5E U;  9ICV A;  1SZP A;  2AXT U;  3ETL A;  4OJL A;  4CRX A;  5AKH A;  4BWJ A;  9ICU A;  2ZIV A;  4J9R A;  3QUQ A;  3F2C A;  2KIC A;  4EBC A;  1IV8 A;  3ORY A;  5GTH U;  1CRX A;  3RJJ A;  4BGD A;  2EQY A;  2DF4 B;  3G6V A;  1D9F A;  2RHF A;  3PNC A;  5ALN A;  2BPC A;  4QZ9 A;  4M0A A;  1H38 A;  3IM1 A;  1ZQZ A;  1RYU A;  1T8E A;  2EZZ A;  2QB0 B;  4RNN A;  5KFW A;  4YMM A;  2FLP A;  2HHS A;  4IQT A;  4MFA A;  5CJ7 A;  1TAM A;  3JPO A;  1X6J A;  4US9 A;  2GLE A;  2HHQ A;  3BQ7 A;  1PUZ A;  5KFL A;  4O5E A;  2BDU A;  3QX7 A;  1F5S A;  1ZQD A;  5CWR A;  4R63 A;  2FPM A;  2ZTD A;  3C21 A;  5J0O A;  2FDR A;  5KG5 A;  3M7D A;  1XNS A;  3PW4 A;  3F53 A;  1Z00 A;  4KLO A;  1KFD A;  4UAW A;  1Z3E B;  5IIN A;  8ICM A;  4P4M A;  1F0M A;  5KFV A;  4US8 A;  4ECV A;  4ELU A;  1B43 A;  4QWA A;  3BS5 A;  3AN1 A;  3NVY A;  4DO9 A;  4O3N A;  2YMQ A;  2ZUC A;  1BVS A;  3WKA A;  1NOM A;  2R8J A;  1D8Y A;  3OJS A;  3KZX A;  3QZ8 A;  4TQS A;  5E79 U;  3QNM A;  5D46 A;  1J2M A;  3A0H U;  4IQV A;  3CNH A;  3Q8P B;  4JB3 A;  1JI7 A;  1KSP A;  2VA3 A;  2OEH A;  2B0C A;  4MFF A;  3PZP A;  4PZO A;  5D49 A;  3F5A A;  3JPQ A;  5J29 A;  2AGP A;  1L7N A;  4J9Q A;  4FZN A;  4QWD A;  2W04 A;  4UB2 A;  2H3V A;  1U49 A;  2AHO B;  5HR7 A;  4RQ7 A;  4OJ5 A;  4A8E A;  4KN7 A;  2Y1J A;  4M9H A;  5J2K A;  4F4Y A;  5KG6 A;  1Z1B A;  3T5K A;  2DPI A;  2FMP A;  3RJF A;  2KFN A;  4FZL A;  3FM9 A;  5F9L A;  7ICU A;  3UMC A;  4R8U B;  2XCA A;  5ALI A;  4QWE A;  4J9O A;  1NJY A;  9ICG A;  4YR3 A;  2XIC A;  3RJH A;  2KVS A;  2OH2 A;  4PHP A;  3WK6 A;  4EEY A;  2JGA A;  2CN1 A;  4KX5 A;  5KL1 B;  4XQ8 A;  9ICL A;  4J9K A;  4KMO B;  5KFO A;  1RYS A;  3A0B U;  7ICI A;  8ICB A;  2K8A A;  3DV9 A;  3C5F A;  3ZDC A;  2FI1 A;  2JH1 A;  2Y9T A;  7ICL A;  4O3Q A;  1QQ5 A;  4C8K A;  4M2Y A;  3K1R B;  1K1S A;  5ALY A;  5KG0 A;  4DL4 A;  5DBB A;  3BZK A;  3V6J A;  3ZI4 A;  3NAS A;  4DEZ A;  4KLL A;  1HUZ A;  1F44 A;  2VIX A;  4M04 A;  3B9J A;  3D2N A;  1B0X A;  1OXJ A;  4DOA A;  4I2F A;  4YVZ A;  3MC1 A;  4C4R A;  1ECW A;  5KFI A;  1NK9 A;  4IQW A;  3ISB A;  4JWM A;  3HT3 A;  4EZ9 A;  1VDV A;  5K4L A;  1SV4 A;  2KK0 A;  4U7C A;  5KAI U;  5J0W A;  1ZYQ A;  1A0P A;  3EZ5 A;  2LM1 A;  2K8C B;  4UQG A;  2XY7 A;  4RQ4 A;  1Q46 A;  4AYB F;  4DOC A;  4AYB C;  1BPZ A;  3UQ0 A;  2W8K A;  3PO5 A;  2G09 A;  3TAP A;  1ZD5 A;  2ATL A;  2PXI A;  1JXE A;  2ZUB A;  3JPR A;  3LYS A;  1IG6 A;  5ALU A;  3QU2 A;  5J0Q A;  8ICQ A;  3ISD A;  2IA6 A;  2BDP A;  4YG2 A;  2AJQ A;  2DQN B;  1Q3V A;  2KP7 A;  4F91 B;  1S76 D;  1Z00 B;  4RQ1 A;  3WKC A;  4F4Z A;  4O5C A;  5KFF A;  2WF7 A;  4B9U A;  4TUR A;  1SGG A;  1B22 A;  3L3F X;  4GLX A;  4YQW A;  3C2K A;  1FFV A;  5J2J A;  4QZB A;  4J03 A;  1KFS A;  3QEB Z;  2IHM A;  5AKI A;  3PST A;  1S0M A;  4M9N A;  2ALZ A;  2KSO B;  4CE6 A;  3BDP A;  2ASL A;  3RF9 A;  2AQ4 A;  2W03 A;  5KFR A;  1N48 A;  4YR0 A;  5BOM A;  4J9P A;  2VJ5 A;  1QQ6 A;  3WK7 A;  5A0L A;  1WCN A;  3MGI A;  4P0Q B;  4IR9 A;  1N5W A;  2ZJA A;  4Y2X A;  3AL0 B;  3L4P A;  1SL1 A;  4FBT A;  4ECY A;  1SL0 A;  2E8M A;  2HI0 A;  2HBK A;  3PV8 A;  3I1Y A;  1BGX T;  3KD3 A;  5AKX A;  3PY8 A;  4JMU A;  3SQI A;  4UB1 A;  1O08 A;  1L7P A;  3IRU A;  4F4X A;  2EH9 A;  2JEG A;  4PGY A;  9ICF A;  4GC6 A;  4BDP A;  1BPE A;  3TAD A;  2IOH A;  4EX7 A;  4KLD A;  2EAM A;  3M8R A;  3N7R C;  4F5O A;  2W3R A;  1QSS A;  4FS1 A;  2FPK A;  3KHG A;  7ICT A;  2HHT A;  7ICV A;  4I2J A;  3SV3 A;  5F9N A;  1T4G A;  5L1J A;  1SV0 A;  4GXK A;  3BQ0 A;  3SAH A;  3OJU A;  2VAN A;  2BCQ A;  3L5K A;  2KG5 A;  4O0I A;  3E2E A;  5AKG A;  2A3V A;  3M6Z A;  1RM6 C;  4HAI A;  1TVA A;  3PR5 B;  2PFN A;  3HPO A;  4DL3 A;  4PHA A;  4UAU A;  4RQ0 A;  4JV2 A;  2DL0 A;  2G07 A;  5ALR A;  5CHG A;  1YT3 A;  1HJP A;  4NLG A;  3OGU A;  1X9M A;  3NS1 A;  2OWO A;  3UXO A;  4QZG A;  2QB0 A;  3AUO A;  8ICI A;  2F8L A;  4ED1 A;  2HOF A;  2CRX A;  4J9N A;  2UVU A;  2C2D A;  2RRD A;  8ICN A;  4JV0 A;  5TIS U;  4C80 A;  4C0Z A;  9ICO A;  4P4P A;  4EX6 A;  4FS2 A;  1MA7 A;  3KKA A;  4RQ5 A;  4EEL A;  3Q8Q B;  2HSZ A;  4C7Y A;  5AK4 A;  4DWI A;  1XSP A;  2GO7 A;  4I29 A;  5AK3 A;  3CP8 A;  2UVR A;  1L5U A;  2W9A A;  4CF5 A;  3B0Y A;  4UB3 A;  1URJ A;  5ALP A;  4LZG A;  3M9M B;  2NYV A;  3LVW A;  3OHB A;  1ZQG A;  1ZQJ A;  3MR6 A;  4YD2 A;  4YCX A;  1WWV A;  3RB0 A;  4PH5 A;  8ICW A;  3H0M B;  3PW2 A;  5DKW A;  4RQ2 A;  1KN5 A;  3HX0 A;  4K4G A;  1N62 A;  2XY6 A;  1ZQB A;  1RPL A;  5GTI U;  1LVH A;  3TQ1 A;  4NL9 A;  4LJX A;  2E3T A;  9ICA A;  3GV7 B;  4P4O A;  4F4K A;  3M9N B;  3SR6 A;  3SEI A;  5ALH A;  4RZR A;  1V97 A;  1QLN A;  3SAF A;  4ED2 A;  1NK0 A;  1VJ5 A;  8ICU A;  4F8R A;  4RT3 A;  1Q8K A;  4RNO A;  4Y2J A;  4R66 A;  4DFM A;  3HJE A;  4ICA A;  4PHE A;  5AM0 A;  2WAQ F;  3RB3 A;  2WAQ C;  1V38 A;  3N97 B;  4R8U A;  3GV5 B;  3M8S A;  4QWB A;  1D9D A;  5L1I A;  2IOF K;  2KFZ A;  4Y2V A;  9ICI A;  3SI8 A;  3RBD A;  2Y9U A;  2PFP A;  1RZT A;  3AEV A;  1AQ6 A;  1ZQU A;  4QWC A;  5III A;  3NRZ A;  3QUC A;  3JPT A;  9ICT A;  1N63 A;  3RJI A;  2CPR A;  2E8N A;  2FMQ A;  4DL5 A;  3NVW A;  5KFP A;  2LBO A;  2MAX A;  2R18 A;  2FJ6 A;  3H0L B;  2V9W A;  3QEA Z;  4DFD A;  4RPY A;  2EAN A;  4UBB A;  1CEZ A;  4ECW A;  2I1Q A;  5L9X A;  2JMG A;  2W8L A;  3Q8L A;  2E5S A;  5J0U A;  3TI0 A;  2JH7 A;  9ICR A;  4MEY A;  4B9L A;  4LVS A;  4Q43 A;  3OSP A;  2H5X A;  5AM1 A;  2KZ3 A;  4NLB A;  1DGJ A;  2W55 A;  3IV6 A;  3K1Z A;  5ALL A;  3CW2 C;  3MFH A;  5HP4 A;  4NLN A;  3RBE A;  4YP3 A;  1T94 A;  4F3O A;  3WKD A;  5KFC A;  3U26 A;  4C8L A;  3MFI A;  4QZC A;  4IR1 A;  3H8M A;  2VA2 A;  2NRV A;  4Y2Q A;  1T7P A;  4DQS A;  2PI5 A;  4O3M A;  2KEY A;  1NKB A;  1BPX A;  2KD1 A;  2C22 A;  2F44 A;  3NTU A;  3TAN A;  2G5H B;  3E0F A;  1ZQH A;  3CYM A;  2C28 A;  2HW3 A;  1ZJN A;  4IRK A;  4K4H A;  3MR2 A;  3GDX A;  3K4G A;  5KG7 A;  5J0T A;  1JX4 A;  1KTQ A;  2HVH A;  3MGH A;  2EAO A;  2H3Q A;  1KW4 A;  1RQN A;  4IRC A;  3O0F A;  5J2C A;  4OD0 A;  5ALO A;  3C1Z A;  2DUY A;  5J2E A;  7ICK A;  2JV3 A;  4P0P A;  1T3N A;  1P7D A;  5C0Y A;  3C2M A;  1UHU A;  4DQQ A;  1XS9 D;  1OW5 A;  4DL6 A;  9ICJ A;  1FEZ A;  2D8C A;  2J6S A;  4RQM A;  2KSO A;  3S6J A;  7ICE A;  3PW0 A;  2W54 A;  2V4R A;  1S0N A;  3KFU F;  2P35 A;  2LMR A;  3UMG A;  3OPX A;  3JPS A;  2BPG A;  1FO4 A;  5AKZ A;  3M9O B;  4UBC A;  4F5R A;  3LVV A;  4P0Q A;  1ZQS A;  2ZXI A;  1NK6 A;  1PVR A;  2ZIU B;  1Z1V A;  3LK9 A;  3SZ2 A;  4Q45 A;  4EBD A;  3RR8 A;  2W11 A;  5AM5 A;  8ICL A;  3KZI U;  3RAQ A;  2KVC A;  1S8O A;  3UPQ A;  3WK8 A;  1PVP A;  1SKW A;  2YMM A;  8ICX A;  4F2S A;  2Q0Z X;  4DFP A;  2WF5 A;  2ASJ A;  4ECT A;  3MDA A;  2AGQ A;  1BPB A;  4UAV A;  2YMP A;  1SB3 C;  1A76 A;  1HEK A;  3IDW A;  2B21 A;  1QH9 A;  3QU7 A;  2HVI A;  1NK4 A;  3ZD9 A;  1KL9 A;  1BPY A;  4MF8 A;  4ECQ A;  5DDM A;  1C20 A;  3PML A;  1SWV A;  2G08 A;  2ZJ8 A;  5KG3 A;  1XC9 A;  2CXY A;  4KLE A;  3EPG A;  3PX4 A;  2EDU A;  3HIL A;  3NRW A;  4MEX A;  5AK6 A;  4OJ6 A;  4RQN A;  4UAT A;  4C4T A;  2EZX A;  3BQT A;  4ECU A;  2FPL A;  1D8B A;  2XGP A;  4G3I A;  2W43 A;  4O3S A;  1JRP A;  4EEK A;  3T5L A;  3RJE A;  3RRH A;  1ZQT A;  4Y2Y A;  1S97 A;  4FZM A;  5AM3 A;  5J2F A;  2JHD A;  1JXL A;  4JWN A;  5EE9 A;  2DKZ A;  5ALX A;  5KFU A;  1D8L A;  5J2D A;  2YB4 A;  3BQ1 A;  3V6K A;  5DB7 A;  2YY6 A;  2JXJ A;  4G9B A;  5JTI A;  1X42 A;  2RP5 A;  5IIJ A;  2ASD A;  3RAX A;  1IIP A;  4F5Q A;  1U48 A;  4GXJ A;  4LZD A;  4J9M A;  2PMZ F;  2PMZ C;  4B9V A;  4Y2P A;  4BWM A;  2DWQ A;  2RLT A;  2KJ9 A;  3ISC A;  4NXZ A;  4DSL A;  5CB1 A;  3C29 A;  1M6Y A;  4I28 A;  3GIK A;  4K4I A;  5HHI A;  4PJ0 U;  4UB4 A;  1MN8 A;  1N5X A;  4NM1 A;  4CGZ A;  4CDG A;  3QZ7 A;  3GU3 A;  1CI4 A;  4ED7 A;  5KFN A;  8ICE A;  3V72 A;  5KT6 A;  1U4B A;  5FP0 A;  2H3F A;  1S0V A;  3UMB A;  3HWT A;  4ECR A;  1K1Q A;  4O3R A;  1UQV A;  2LYB A;  3RFA A;  2KIV A;  4B6J A;  2ZIX A;  4BXO A;  3KHH A;  4QIW F;  8ICH A;  4QIW C;  4P0P B;  2UVV A;  1ZQM A;  4I2I A;  4ED6 A;  1ARO P;  1TE2 A;  2HBM A;  2ZJ5 A;  4XUS A;  2W3S A;  3MR3 A;  2ZTC A;  5AI9 A;  2E1E A;  4DLE A;  1WUD A;  3N7P D;  3N28 A;  1J97 A;  4DFK A;  3M6K A;  4KLJ A;  5DLG A;  3PMN A;  1IXR A;  1X2I A;  3D2Q A;  8ICV A;  1Z4N A;  5AI4 A;  8ICO A;  5J0S A;  2N1R A;  3T5J A;  4U6P A;  3G6Y A;  4F72 A;  2H3Z A;  2I9G A;  4CF4 A;  3H7I A;  2XCP A;  3KHL A;  4YN4 A;  4TUP A;  2HOQ A;  3RH4 A;  4X5V A;  4Z6D A;  5F3X B;  2JEJ A;  4I2D A;  1ZD2 P;  3C28 A;  5CA7 A;  3RTV A;  2D3D A;  1NKE A;  1ZET A;  3CRX A;  2Q4T A;  7ICM A;  1HIW A;  5J0P A;  2LPE A;  1Z4O A;  1N60 A;  3DEE A;  5ALT A;  5H2F U;  1JN3 A;  2KHV A;  4Q8F A;  5ALQ A;  1KBU A;  5DLF A;  4DSF A;  1DK3 A;  1SWW A;  2W9C B;  1RXW A;  9ICK A;  2R8G A;  4CCH A;  3M1Y A;  5AIC A;  2HDO A;  3H8S A;  3QUB A;  1PVQ A;  2JEI A;  5AM4 A;  1U9L A;  5IIK A;  4XA5 A;  1ZJM A;  4KLH A;  4ED3 A;  4O5K A;  3V6H A;  4R65 A;  4Q44 A;  1JAL A;  3H0R B;  3TFR A;  4NY8 A;  5L1M A;  4M6W B;  1ZQQ A;  2WB1 F;  3TAQ A;  4PPX A;  2WB1 C;  2LHT A;  3MBY A;  1FFU A;  2DFL A;  2BZF A;  3ED5 A;  1FIQ A;  1ZRM A;  2M0N A;  1ZQK A;  4DL2 A;  4ELV A;  4OO1 J;  4NM2 A;  4E0D A;  5AHX A;  1N2X A;  2KKV A;  3IN5 A;  5J2B A;  1DGS A;  1X40 A;  5IIO A;  1TAU A;  5AI6 A;  4YXJ A;  5TZV A;  3QUT A;  2QLT A;  4DF4 A;  2ESE A;  2LYH A;  3PSP A;  4Z6C A;  3AQE A;  2OXO A;  2XC9 A;  1ZQC A;  4DFJ A;  4WJ3 B;  3Q8S B;  1ZD3 A;  3ZDB A;  7ICQ A;  2F1I A;  5AKK A;  4O3O A;  1JUD A;  5AK5 A;  1XSL A;  3K75 D;  3T5H A;  4FBU A;  3OSN A;  3VCB A;  1DRG A;  4DLG A;  5DBC A;  4ELT A;  7ICJ A;  1TKD A;  4C8N A;  2F2A B;  2AQ0 A;  2PFO A;  1RG6 A;  4KN4 A;  3SEN A;  2P66 A;  2W9B B;  4F4W A;  4BX9 C;  4KMU A;  2ZG6 A;  2ZXH A;  2O6K A;  4KTQ A;  5KFK A;  2V4Q A;  4R64 A;  4B9S A; 
#chains in the Genus database with same CATH homology
 2F8K A;  1SXE A;  2GLE A;  3BQ7 A;  5J8Y C;  2K60 A;  4NL9 A;  2QB1 A;  2KG5 A;  2DKX A;  2K4P A;  3H8M A;  3SEI A;  2DL0 A;  1V85 A;  3BS7 A;  2KE7 A;  3IDW A;  1SGG A;  4MHV A;  1UCV A;  2Y9T A;  5L1M A;  1X66 A;  1UQV A;  1PK1 B;  3K1R B;  2KIV A;  2ES6 A;  1F0M A;  1PK3 A;  2F44 A;  2QB0 A;  3BS5 A;  1B4F A;  1V38 A;  2KMD A;  2KSO B;  2QAR B;  1SXD A;  4NJ8 A;  1COK A;  5KNI A;  2B6G A;  2EAO A;  3KKA C;  5JU5 A;  1KW4 A;  1LKY B;  3HIL A;  1X40 A;  4RQN A;  1B0X A;  1OXJ A;  2Y9U A;  4PZN A;  2JV3 A;  1DXS A;  2YTU A;  2ESE A;  3KKA A;  1JI7 A;  1OW5 A;  2FE9 A;  2E8M A;  2DKZ A;  2E8N A;  1SV4 A;  3TAD C;  1WWU A;  4IS7 A;  4PZO A;  3TAC B;  1PK1 A;  5JTI A;  2D8C A;  4RQM A;  3TAD A;  2EAN A;  5F3X B;  2EAM A;  2KSO A;  2QAR A;  2D3D A;  5JRT A;  2QKQ A;  1RG6 A;  1WWV A;  3SEN A;  1LKY A;  2LMR A;  1SV0 C;  2LPE A;  5J8Y A;  2QB0 B;  2L5Y A;  3BS5 B;  2E8O A;  4NL9 C;  1Z1V A;  2EAP A;  2E8P A;  1X9X A;  1SV0 A;  2F3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...