3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted phosphatase, HAD family
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
2IYEA 5ALMA 2QYHA 3OCUA 3ZWDA 2C8KA 4MUMA 3L8EA 2RARA 1J8DA 3WKBA 2AH5A 1SWWA 4UATA 4C4SA 4BNDB 3QU4A 1RLMA 1XP5A 2FDRA 2ZBGA 4G9BA 3F9RA 4G63A 5AKHA 3E58A 2IOFK 3U13A 2P69A 5ALJA 1ZOLA 2O9JA 4DFDA 5ALVA 3ET5A 5ALKA 1IWOA 1Z4KA 3L1VA 4HGPA 5AVUA 4UMVA 1WR8A 2Q4TA 3E8MA 2YMMA 4J03A 1L8OA 2GHQA 2YJ4A 2YMPA 3OCYA 2YN4A 2AGVA 1F5SA 5AI9A 3QNMA 1MH9A 4HGRA 4YCNA 4GIBA 5AKKA 2WF5A 2G08A 1Z4MA 2VKQA 3GYGA 2WM8A 1RMYA 3QUBA 1YDFA 2HCFA 4XOUA 2YY6A 5A3SA 4L57A 1XPJA 1FEZA 3R09A 3SD7A 3HYCA 2B0CA 1U02A 1TJ4A 2BDUA 4UW9A 3U7GA 5AW5A 2RB5A 2I7DA 2OA0A 1PW5A 4Y2TA 3MC1A 5ALHA 2MU2A 1QQ6A 1L7OA 5AM5A 3MN1A 1O08A 2B8EA 4AS2A 5AIBA 2RAVA 4Y3UA 1VFPA 2GHTA 3I28A 2BY4A 4KN8A 2ZOSA 3A1EA 4UAVA 3IB6A 2PQ0A 3L0YA 5ALZA 4UAUA 2HOQA 3OCXA 3U7EB 4EX7A 3ZVNA 2CFTA 4Y2SA 1T5SA 5AM0A 3WKCA 4IG4A 2G07A 5AKZA 2MU1A 3NANA 2HI0A 1EK1A 2Q5EA 3U26A 3FPSA 4YCMA 1S8OA 1TE2A 4Y2YA 5ALOA 4BX2A 1RKUA 3L8HA 4BNDA 2JAUA 4UM5A 3QU9A 4BYGA 1ZJJA 3WK9A 1Z4QA 2I54A 4B6JA 1KYTA 3QUCA 2B1QA 5AVYA 5AKLA 5IS2A 5ALNA 3L8FA 3AR2A 3DNPA 5AW6A 3L8GA 2WF6A 3IJ5A 3KOOA 1SU4A 5FP0A 1Z5GA 3N8GA 1L8LA 2ZBDA 3U19A 2FI1A 2IOHA 3QGMA 3ZUPA 4IFTA 2HF2A 5AICA 5AKIA 2W43A 3B8EA 4FYPA 4HGQA 3OPXA 5ALWA 2HSZA 4O8CA 3M9LA 2OYCA 4CF5A 1Y8AA 5AI5A 2D2VA 4J2TA 5ALYA 4OHFA 4CF4A 5T41A 2W11A 1VJRA 3U7HB 5AM4A 1Q91A 4OCZA 4KNWA 5A3RA 1YNSA 4KNVA 1N9KA 3ZTYA 3W5DA 1Z4LA 2DQSA 5AW1A 3AR4A 4EEKA 4BX0A 3A1DA 5AW3A 2P11A 3KBBA 2G06A 3PGVA 3SLRA 1RLTA 1N8NA 3QX7A 1NF2A 3PDWA 3NRJA 1CQZA 2Q4RA 2HDOA 3L0CA 4GXTA 4EZEA 5ALEA 2I33A 3AR5A 3N28A 3FGOA 3NUQA 4AP9A 5AKXA 2YJ3A 1ZRNA 3WK4A 3WK7A 1RMQA 3NASA 1Z88A 2R8XA 3CNHA 5AKYA 1XVIA 3ZVLA 5AK3A 4YGYA 3W5AA 5ALTA 2EARA 3I76A 3R9KA 5AW9A 4I9FA 3WGVA 2GFHA 5ALUA 4HGNA 3UMBA 4EENA 5ALQA 2FPRA 4H1WA 3TLMA 3L5KA 2OBBA 2G09A 3WKEA 2WF8A 2B1RA 3R4CA 1U2SA 4DWOA 3U7FB 3ZI4A 3QU7A 4YCLA 2YFYA 4RETA 1ZD2P 4HAIA 4YH1A 3L1UA 4NAVA 3WK6A 3IRUA 2YJ6A 2B8JA 5AW2A 3ET4A 3CZ4A 1Z4IA 3ZVMA 2CFRA 1YMQA 3ZTWA 1ZD5A 5ALRA 2FPXA 2QLTA 4JDPA 1QQ7A 3FM9A 4OFZA 1RQLA 4F72A 1ZS9A 5ALIA 2NYVA 5AIAA 5AW8A 2FPUA 5AVQA 2EATA 2GMWA 1NNLA 3AR6A 5AVZA 1S2OA 3L7YA 3FPBA 2YJ5A 1QQ5A 2R8ZA 4BX3A 4BEWA 2C9MA 2ODAA 4HGOA 4XE5A 2G1AA 5A3QA 4Y2PA 4NV0A 4UU1A 1WPGA 3AR7A 5ALXA 1Z5UA 3B9BA 3SHQA 4YIKA 1ZRMA 2HHLA 2ZG6A 3SKYA 3ZU6A 5JJBA 2C4NA 4I9GA 4YIHA 5AVXA 3QUTA 2HF7A 4UMEA 4Y2QA 1YV9A 3OCVA 1LVHA 5AM2A 2FEAA 5ALSA 3QXGA 5AK5A 3WK8A 4UM7A 2JAWA 4NFLA 3SF0A 5AVSA 4ZEXA 3AR9A 3W5CA 5AM1A 3KC2A 1RRCA 3EPRA 4L6AA 2ZBFA 1YJ5A 1U2TA 2RBKA 5AESA 4UASA 2FPWA 4CE6A 3SKXA 4Y2RA 1QYIA 3I6BA 3OCZA 3MPOA 5AKGA 3ONNA 5ALLA 3NIWA 2G80A 4Y2UA 3QLEA 3ED5A 4DW8A 3ZWKA 1J97A 1WZCA 3WKAA 1QH9A 5AVTA 1WVIA 3NALA 1RKQA 1U7PA 2WHEA 2YBDA 4XQ0A 3KZXA 2NO4A 4JB3A 1EK2A 1X42A 4C4RA 3ESQA 5AKEA 5AKJA 5AI4A 1L7PA 1SWVA 2B30A 5ALDA 1RLOA 4NABA 3UMGA 4XPZA 3PGLA 2IOFA 2G0AA 4UU0A 5AVRA 3W5BA 3WGUA 3UM9A 4BEVA 1YS9A 3E84A 3HLTA 1TJ5A 2AUTA 2R8YA 3AR3A 2AMYA 2YMLA 3FVVA 5AVVA 2WF9A 3OTQA 5IT4A 4EELA 3BA6A 3WKDA 4Y2VA 1VJ5A 4CNQA 1RDFA 3QU2A 3ZX5A 3DV9A 4Y2JA 3PCTA 1RC8A 5E0OA 2CFSA 2I34A 2PR7A 4UMFA 5AI8A 5AK6A 2ZXEA 3RFUA 1T9ZA 2HEGA 2FUEA 5AI6A 3KDPA 5ALGA 5ALPA 4HYTA 2FPSA 1AQ6A 1Z4JA 3N1UA 4BBJA 4C4TA 2NO5A 2P27A 4ZEVA 4DCCA 2MSNA 5AI0A 5IT0A 3D6JA 4CF3A 1Q92A 2ZBEA 1RMTA 4MWOA 4BKMA 3MMZA 4E88A 3L0BA 3ZW7A 3E81A 2W4MA 4KX3A 3J7TA 3NAMA 3A3YA 5AW4A 2JAOA 2PKEA 4ZEWA 5AW7A 4FFDA 1Z4NA 3OCWA 4KYTA 1O03A 5AM3A 2HX1A 4KX5A 4PNHA 1TJ3A 3QUQA 5AW0A 2I6XA 3QU5A 3DAOA 3KD3A 2EAUA 1ZD4A 1RKVA 3SMVA 3EWIA 1Z4OA 2R8EA 3EF0A 3WK5A 2JARA 1U7OA 3S6JA 2WF7A 2X4DA 4RESA 3N07A 3BWVA 3I1YA 1NRWA 5AK4A 3ZX4A 2P9JA 2GO7A 5AVWA 3ESRA 4UARA 4QQFA 1JUDA 2C8LA 2IA5A 4NWIA 1K1EA 2YMQA 4EX6A 3K1ZA 1T5TA 2CN1A 3A1CA 4Y2XA 2O2XA 3M1YA 2JGAA 2OM6A 5ALFA 1CR6A 1RPZA 3B9RA 1LTQA 1TA0A 3FZQA 1ZD3A 4UMDA 4OD0A 3N5KA 1RQNA 3AR8A 1Z4PX 3RF6A 1L7MA 2BDEA 2C88A 2B82A 1L6RA 2HO4A 3P96A 3QYPA 4QJBA 2FUCA 3VAYA 3DDHA 4L6CA 4F71A 3EF1A 2WFAA 5AHXA 1L7NA 4FE3A 3UMCA 4AS3A 2I55A
chains in the Genus database with same CATH superfamily
3BQ7A 3R5HA 1A2BA 2QYHA 4GPAA 4FQ5A 4FYXA 3V7WA 2E8MA 2ZQ5A 1EHIA 3LX6A 1P4RA 1JIQA 4RPCA 4EABA 3ZR4B 1N77A 2WRZA 3KTFA 5D8DA 1N2CE 3OZCA 3N7TA 2WIGA 3OE4A 3DR3A 4KIUA 3QF7A 3GYGA 1JXOA 1NBMA 4E6PA 2OGTA 4FCVA 1QVRA 4B2YA 3RTCA 6REQB 2WG1A 1ANKA 2BGLA 4N9WA 821PA 1DAGA 4PBSA 3KSMA 3C7KA 2R00A 4YRFA 4X6YA 4BMSA 4DMRA 5DHRA 4W9MC 1II0A 3S2EA 3B38A 4NICA 4RULA 4C8MA 1LDEA 1JKMA 1M73E 3R7LA 1L5HA 3ENNA 3QNUA 2MTBA 4A15A 1FTWA 4AB1A 2IXDA 2QN1A 4CRWB 3NVMB 4BO0A 5ITSA 4LDPA 4H15A 3E27A 4J0CA 1M7BA 5SZKB 3HCEA 1U0FA 4GOXA 2VZ9A 1IZ0A 3L06A 3OIVA 2AU0A 4M6WB 3QEBZ 3INTA 4HAXA 4EMBA 4LUCA 1EVJA 2DPLA 4W8HA 4Z0PA 4J6EA 2CNKA 3PHIA 4FR2A 4JI4B 3PDUA 3UB2A 4JC5A 2CXHA 5J8YC 1FSPA 3FDZB 4CDGA 3GLRA 2BQ3A 1SCDA 4PO1A 4QXQA 1CUEA 1SV0C 5TDHA 1JIHA 3LBAA 2BJHA 3OIUA 4GC7A 1ETHA 5JISA 2O19A 2NXNA 1Z88A 4XWGA 4CI0B 4YGYA 3HZRA 3H8MA 3DVLA 3KWLA 4GOKA 1T91A 1ONNA 2PKYX 5DH9A 1R9GA 2NTVA 4MGEA 4WZAB 1VIVA 3KQKA 4G0XA 5THKA 4FMBB 3VJRA 5LCXA 1CEZA 2H08A 5JSZB 2I99A 5FR1A 2H17A 2VK2A 3WQQA 3AESB 3JPRA 2VDUE 4DG9A 2QD3A 2PG3A 1XVUA 2LUOA 4X1KB 3ZZ0A 1BQEA 4ARSA 2VBFA 1YRLA 2GCNA 3JRXA 4CJXA 3TNLA 4DWJA 2O1WA 3Q3CA 3E5HA 4AK9A 4UHKA 3AHFA 2LM1A 1UBSB 2JB9A 1IN1A 2YZ2A 2EFCB 5MN4A 5KMGB 3ZNPA 2OOSA 1HYHA 4BP1A 1QG2A 5K2MA 5JFGA 1V1RA 4IYJA 3KYBA 2G5CA 4YP6A 3THWB 1NXQA 4M9RA 4BQSA 3D3WA 2KK0A 3EZ9A 2J9ZB 1U7PA 5IDWA 2QX9A 3T3MB 3GAFA 2D6FC 4IFBA 2O4UX 1BC5A 2DPGA 2X42A 2EBUA 4ECXA 4IQWA 2BMDA 1CJVC 3OUZA 1PVOA 2ZRMA 4HAUA 2YMLA 1MQSA 4HLUC 5I9IA 5E2BA 3LQ2A 4ARAA 4WL0A 4DQDA 5DHPA 3RANA 4Q82A 1UPBA 4UMFA 4NDAA 2JBWA 1NZFA 4NJ8A 4O2BF 3L40A 3WBFA 2R7AA 3L8ZA 4BPBA 2CHGA 3LBYA 5CXUA 2JGLA 1P4JA 4ND4A 2Q5QA 3IKTA 5LOVB 3SMVA 4IZHA 4EUHA 2NU6A 1XZPA 1M1XB 5FNVB 1MEJA 1BNCA 4JI0B 4E2FA 3PEWA 3NOVA 4OXQA 4CLOA 3BWYA 4OB6A 1KORA 1F7VA 2MSEB 3JVUA 2YY7A 1T94A 3RFCA 4KREA 3KB2A 2LP4Y 2VOJA 5J2UA 9ICCA 3KLNA 5BSKA 5DGIA 4R31A 5KX5B 4QPJC 3PRJA 2LPEA 4YMNA 5IN4A 1QHEA 1WZ2A 4WDQA 2VCEA 2NIPA 3UV3A 1X66A 5DK6A 3VR6H 1Z07A 4ZAGA 1II9A 1NLZA 2Q8NA 3QU4A 5CMLA 3KQMA 3I32A 4EW3A 4TZ0A 1GAWA 4AJJA 4V2UA 1N6KA 3GQBB 2C07A 3ED1A 1ZK0A 1ZNXA 4RLHA 4JGIA 4J03A 3QELA 4P0TA 4V02A 4DV6B 3M34A 4KK3A 4NEQA 4P3YA 3S55A 5EWLA 1VG8A 1P44A 3BAZA 5K0BA 5I7RA 4RQ1A 1D2CA 1PD1A 3VUFA 4KODA 3WLTA 2A6PA 1K4KA 3F46A 3NBFA 3RAJA 4GM4A 1NV9A 3QWAA 5CFPA 1JLHA 1JKJB 4PQYA 3NANA 4A8TA 1PV2A 4XB1A 1RABA 1TQ6A 3IR5A 1OFUA 4YLEA 1DCFA 3FNFA 1Z0AA 1VKJA 1PR9A 3WLHA 2W6NA 4P81A 2ZBDA 1UL1X 3EDCA 1LK5A 1C3OA 1RWOA 1ODTC 4RLSA 4DGQA 2GVDC 2NT4A 4B71A 3E7FA 1N3IA 4HN4B 1JT9A 3A3KA 4MDEA 1FDUA 1XQXA 2JJMA 1WCYA 2GPYA 3FWHA 1EUQA 5C7OO 1YAJA 1FVHA 1A2QA 4RV4A 4NDZA 3L0OA 4FNGA 1SBQA 4E11A 3OPVA 2Q4RA 1LLQA 1JTFA 1ZCAA 3TW8B 1NYTA 3OIFA 5KG0A 4D0RA 1Y4AE 2C7VA 1SAYA 3KT3A 2PRZA 3HL0A 4RTRA 3K5WA 1C0LA 4WKBA 4D98A 3WAGA 3D3KA 1NM5A 4X1YB 5ICMA 4L5JA 5BOLA 1Z83A 3SC2B 3T5BA 4PCAA 1RYEA 3CR3C 1UJCA 2G76A 4QJ3A 5ALIA 2OD7A 2K4EA 2NOAA 4BO1A 4J9MA 4AG6A 1OX4A 3ZNOA 3SV3A 2RB4A 1LY1A 2GRJA 1Z5UA 1E7MA 2LDBA 1WHTB 1UP7A 4JV2A 2AS0A 3TACB 7ICIA 4DHWA 4TUPA 4E5KA 2HHUA 4B3IA 1M67A 4QODA 3ZJTA 2XWPA 3OJCA 1KFEB 5IH7A 2FPWA 2A7QA 2HPZA 1LBEA 3OZRA 2F3UA 2BI8A 1L2TA 3KT8A 4LRUA 2ZIEA 3OX1A 3N5CA 1NXWA 4MV7A 2HTFA 2CDNA 4ZOLB 3MWGA 4AW9A 2AD5A 2GCEA 2JGEA 1WXEA 1F8FA 3WLMA 4KI7A 3G5MA 4CM8A 3I0MA 1NKBA 1EA5A 1FP4A 3EOZA 2XVTA 5AVRA 2CNNA 2F00A 1WSWA 1MTOA 3ZD9A 2EKLA 4DC9A 3BXXA 3MR3A 4Q9KA 1PYOA 2CFSA 2BFBB 2OB2A 3JQ9C 4ABYA 2FUEA 2H52A 3FOZA 3AFNA 4RQUA 1IY2A 3UTDA 1FTGA 1DIAA 3RBZA 3R44A 2JPDA 2VNKA 3UK2A 2FG7C 5F2KA 3A1UA 1CUAA 2J9RA 3QBVA 1H2RS 2XUOA 1PRYA 5AW4A 3MFQA 3N75A 4RUKA 2FZGA 3ROGA 4ITRC 4IQUA 4LRQA 4PONA 3X2FA 2CMKA 4ZGGA 1K7SN 3Q3EA 4NNPA 3TDKA 3DWEX 5FUVA 4BGDA 2VJPA 2ZVDA 1AKMA 2BBTA 1CVRA 5CVJA 2QXUA 2X9VA 1SUFA 1SXDA 2ZXHA 3K5IA 4EHDA 2ZJ2A 4HAOA 1FU4A 1W25A 3L18A 2DUJA 4N49A 5DEIA 4P4GA 2XGPA 1U04A 7ICKA 2N1RA 1DO8A 4G1EB 4FE3A 1GTJ1 4YQWA 1P2DA 3G2MA 3TIXB 3F97A 3HU2A 5J2AA 5JAIA 1NSYA 1CF4A 1QH1B 2IYXA 1M66A 1MQ8B 1YE5A 1L5SA 3LUFA 3LVFO 4LOLA 1YHYA 1PR3A 4KBGA 4DLPA 2LZ0A 1HJPA 1A4XA 2OCEA 3L9WA 4Y0NA 3A9VA 4FIZA 1E6KA 4P7BA 3SKVA 3KLPX 1JDPA 2HUPA 4UW9A 5D01A 4TMZA 4DIEA 3CZ5A 5GONF 2FCRA 2RH8A 5ADHA 1G2QA 4B6EA 5FO0A 2CHEA 1ZQHA 2NW6A 3LJKA 3T5KA 1ZITA 3VVLA 3W34A 4MGIR 5F3XB 5EKUA 4JB0A 3OPYB 1U5AA 3F71A 5CM9C 1ZJJA 5E6UA 4Z1MD 1ULTA 4L72A 1V6AA 3AR2A 1X1RA 3KP1A 4PYQA 1XZAA 3ZV7A 1EPUA 1Z6TA 4TWIA 1TF2A 4OQZA 4FBLA 4FYYA 3L4KA 3BMQA 2R1VB 3PHJA 2OWDA 2PS9A 4H31A 2GYVA 5H5JA 5FOTA 2W11A 1ZJWA 3DQPA 5D86A 1QGDA 5C81A 4Z4GA 3VO9A 5A3RA 3BSSA 2XT6A 1X87A 2VDWA 2PNFA 4GZ5A 4B17A 1AQUA 4MYUA 4IGIA 5C4MA 1QLNA 1R64A 4RGVA 2I67A 1M5UA 1PGNA 1N36B 3G0OA 2ZPAA 2YIVX 5FFFA 2V58A 1BKYA 2XB4A 3DKVA 4FEYA 5JSHA 4I55F 2FUG1 5I8WA 3EIUA 1E2EA 4C3OB 4R2XA 2QRPA 1NKTA 3ACDA 5CLQA 2WWXA 4UD6A 1DC3A 1XRRA 4EY4A 3G5AA 1KA9H 3L6DA 4DSZA 4DBVO 1UC4B 3UB4A 3DVSX 1O87A 3DH0A 5KT4A 2Y71A 3AL0B 3T1YB 2AZXA 5BSHA 4C88A 1Y4ZA 2KFZA 2RKBA 3MPUA 2XAUA 4HDOB 5IKPA 1WXFA 5KFWA 4NU8X 4YJ3B 2VSNA 2FSIA 3ZJYA 2HF7A 1T8SA 4A1FA 3E03A 2QIPA 1B22A 3BZUA 2PH7A 4XM2A 2WHYA 4BV2A 4J3FA 1SU6A 4PCLA 2V5AA 5CB6A 2H18A 3RIEA 3L0IB 5FUYA 2GK6A 4O5OA 1NJ1A 3MAAC 3BMCA 2C9DA 1ZKDA 1XFAA 1WQ4A 4W9RA 4QA9A 3L6RA 3PUVA 1XQ9A 1DFGA 1WVIA 3QXSA 4R7ZA 2X0DA 4I7EA 1ND6A 4QLOA 1HQCA 2R6JA 3GFRA 2W2TA 1KOJA 5KFYA 2PMCA 4HFJA 3HKZC 1UJ6A 1YVUA 2VBGA 3DLHA 4KLSA 1JQKA 4V3CA 2HA0A 5HBRA 2W2QA 3E4CA 1WPXA 4MS3B 4BATA 1ULAA 3H9CA 1VE7A 2B2CA 3PD0A 4U63A 5ALPA 1AQ6A 3N6XA 1ZUIA 4BBJA 1XLUA 5DK4A 4O4HA 5AI0A 2C7GA 3QY9A 1JJAA 4HH3C 1M0EA 3T41A 1MTZA 2OUKA 4GP9A 3VR3A 2PUTA 3NH6A 3KAQA 1IJFA 3A6HA 3OOYA 2E5SA 5AOBA 2KMDA 5BW6B 4OFBA 5SY9A 3JQBA 5JZ9A 1KY3A 2OEHA 2OK7A 4JLNA 4R81A 3RR8A 4RJJA 3JV7A 4HXEB 3K70B 1I1NA 3TB4A 4Z1MA 1JV2B 2C8LA 1RWBA 3WP1B 3FCXA 4WCFA 2IEGA 5CVCA 4R8LA 1NNUA 2HYDA 2J0UB 2DUYA 2LR0A 4D82A 2JLAA 2IYSA 4KRFA 4YECA 2BCRA 1ZCFA 3C97A 2QAGB 1SVUA 1LA2A 2JD2A 2ZTVA 5J2BA 4L73A 5DYYA 3PPYA 3LSTA 2EFEB 2FKAA 3DDWA 4MI6A 3NIBA 3EVTA 3F6PA 2FEKA 3COPA 1ZQ9A 2ECPA 4C4SA 1I3CA 4CLEA 2NU8B 5J4LA 2P69A 1ZXXA 2H57A 1JHMA 3CKLA 3SHFA 4W9NC 2XVAA 1ID8A 1YQTA 3IILA 1W1UA 4LWZA 5KC8A 2ZIWB 1P7CA 3FNHA 4ELVA 4D4LA 1JHPA 1PJLA 3MRTA 2H51A 5I7SA 1D1QA 4H16A 2BUBA 1G21B 2XSZA 3QE9Y 2P6RA 4NLKA 4Q1AA 3SD7A 2X0RA 1CRLA 2RGUA 1ESDA 4XRHA 1IEVA 1E60A 2FDCA 2EGUA 2HMWA 1O58A 3BE8A 2A14A 1VSUA 2DH5A 5BURA 3TNYA 1TW3A 2ERXA 3O3OB 2F9MA 4DCSA 1LWNA 4YT8A 1J8MF 3DVAB 1L5FA 4R83A 3VDQA 4XFJA 4U3JB 3GLGA 4OHBA 1XQWA 5DYTA 4FZ5A 1TADA 4Q93A 2FG6C 3ECAA 5EE3A 4PHEA 2BMVA 4P5PA 1EM8A 1N0UA 2A88A 2AA3A 2EX4A 3TD2A 1TTTA 3W78A 2GJ4A 4RJIA 4KGVA 3BGVA 1R0RE 2R66A 1BPDA 4EI8A 1B41A 4CU2A 1XDUA 3P9YA 4BO6A 4WRRA 3E18A 2YV2A 4BO2A 3CVXA 4FR0A 1WZNA 4YJ2A 4GX2A 2P2GA 3M6VA 3W5DA 3CVOA 3TAQA 4DIBA 2MINB 2P9YA 1FYWA 1EA7A 4BVGA 2I1VB 4ZYLA 4AJHA 2E55A 3ODGA 1TA9A 1SKUA 3FN4A 2NV0A 1P77A 2HHCA 4NL4H 1NOKA 5ALQA 4MYHA 1UK6A 2VHEA 2IGTA 4F5PA 2YFYA 1M1YA 1KSJA 1BWSA 3SX2A 1DADA 1UOQA 4YO8A 3ZI7A 2WW8A 1KFTA 3G8AA 2D1YA 1HEIA 2X41A 3AZOA 9ATCA 2ZYUX 1KQPA 1WWUA 2AFHE 1PNVA 5CD1A 4OBWA 2QNRA 1I94B 2OHGA 3VC2A 2ZRCA 4A23A 1GZUA 1QWSA 1Q0HA 2W48A 4EQ6B 3PJDA 4HX2A 5CLFA 3P94A 1Z00A 2P2DA 4ZHQF 3NETA 2P4HX 3V6JA 1QANA 3AB3A 3UFXB 1HLPA 3ONDA 2ID4A 4M9ZA 4Q9NA 4URXR 3HB0A 4BKOA 4NBUA 1M6WA 4DRXB 3FTQA 2RGAA 3DM5A 5ICSA 3M9MB 3E0XA 4J2HA 5C37A 3AG5A 2KFNA 2Y9PB 2VBCA 2HRDA 2CNLA 4FZMA 4AF7A 3ZOZA 1W4LA 1QF9A 2VSOA 3PF8A 1KW4A 2GFQA 1M75A 1L5WA 5FWXB 3DOUA 2YYSA 1SGWA 5TJHA 2XXAA 4YXMA 4Q7KA 4GLJA 4BQNA 3HLTA 3KYJB 4KHPB 3GRFA 1KYYA 4CKZA 4EYQA 1JMKC 2WF9A 3CX7A 5CFOA 1IUKA 1MQAA 1NKCA 2ATVA 3KYDA 4MB6A 2PWAA 3FKJA 1JZTA 5FV7A 3T7TA 1ZQ1C 3JZDA 1GTZA 1LLUA 5GJCA 5JR3A 3EPLA 1UMDB 1N92A 3OC0A 5F2NA 5A71A 1E2GA 3ISTA 1AY0A 3TJMA 5DTMA 2PXCA 2NADA 1T6BY 2PGJA 2WPDD 4MVJM 1V1MA 1XMIA 1T3LA 1SKRA 1WSDA 2YXPX 3C1AA 2EYQA 1V6CA 1T3QA 4FNMA 3ONFA 3WR5A 2PWYA 5BQ5A 2Q29A 2QLJA 1VL1A 4JROA 1H9CA 5EXTA 5BQOA 1X9HA 2VHWA 1USIA 3EIXA 4M1YA 4DXDA 5KJFA 3Q88A 3EFBA 2D5LA 3ZXSA 2VJCA 3KXPA 3JR3A 1SWWA 3R3YA 4PPYA 3ROQA 1HURA 1U2DA 2E3JA 4Q6WA 3CH5A 3P5SA 1E2NA 3HXTA 4ENSA 1KGSA 2C7PA 1EFTA 3GGDA 4YG2A 4L57A 3DZCA 2DUUA 4LVSA 3BJMA 3AWIA 2AQ8A 5HILA 1ZJMA 2HBQA 4ZTBA 5DOVA 1QS0B 1FL9A 2OBLA 4R1SA 1KLNA 5EVJA 2GBGA 3QPUA 4IIDA 2PS0A 2W6ZA 3A05A 5FULA 1GT6A 4K4HA 4BP8A 1RKUA 4KQ2A 3AVWA 3Q7TA 5IK2D 1BCSA 3ZGYA 1IULA 4J4BA 2Q45A 2I78A 4FGLA 2QD2A 3W79A 4EO7A 4D97A 1Y3AA 1ZWKA 5IWAB 1NVAA 4F7DA 5U4QA 2R9VA 4I2HA 3K20A 1W44A 3SDSA 5C7LO 1VC2A 3CT6A 3L7BA 4H0CA 4CKXA 3V7NA 4RSRA 4ARVA 1LEHA 1RJFA 3N2KA 4COOA 4NCJA 4ZDKA 2AW3A 2W2MA 1S3SA 4N6GA 2UKDA 3FF4A 4U39A 3TADC 5AWFC 4RWZA 1G8GA 5F4BA 2ETVA 5C4GB 1O4WA 1U8UA 1U8CB 1QV7A 2ODTX 3RROA 3UMBA 1J0BA 2BCGY 3P19A 4Y0VA 5K3EA 2WEKA 3UHFA 5A05A 4RENA 4UU7A 5IJ9B 2VSXA 3DDCA 1OZGA 1EFUA 4ZRNA 4HKTA 3FRJA 3TQRA 4BC0A 1NJ6A 4EL5A 3UAWA 5IKMA 2O8FB 1RQLA 4F5ZA 2WTNA 3AJ9A 3ST7A 5AVQA 9ICIA 4OVKA 3QEJA 1KIFA 4BNLA 1GV0A 3K2QA 2X8BA 3HL4A 3WRYA 3KHUA 1N48A 4KQ6A 4MWBA 2P35A 4KLOA 1K98A 5KVVA 5JS2A 3TUIC 2WPDA 5CA0B 3KUDA 2BH2A 2FP4B 4KSCA 1ZQQA 4C8LA 3KKNA 2PUFA 2KKVA 2RHFA 1UXGA 1SIWA 1RD4A 3HCDA 4INAA 3MSXA 3ZVRA 2HCJB 4IDHA 3CPSA 4RHXA 4KLMA 5C5DA 1JE0A 1N1MA 3U4QA 3MNFA 1ISFA 4GZMA 1GGKA 3ED5A 1BGXT 4OHWA 1ZSVA 3OZBA 4LMAA 4AYXA 3MRVA 3P0RA 5K99A 5KSWB 2XEXA 4Y7CA 3D6MA 4AO6A 3BFKA 4Q19A 4ZJYA 4R1UA 3LUHA 3W5BA 3PKZA 5BSUA 8ICSA 4Y9SA 3G6VA 1N60A 3RFAA 1OTXA 2NUTA 4NNJA 4A3SA 1QQBA 2EJWA 5CBPA 2V7UA 3WLSA 4J76A 4L2IB 4TQAA 2XF2A 3Q7IA 4CEIA 1FRVA 4E30A 2FKNA 3HUEA 5KTKA 1FXSA 3B1KA 1SA0A 3BERA 4NYIR 4QUHA 4OA8A 1YR8A 4TKUB 3RNOA 2MUTB 1X19A 4K6GA 4UUNA 5FI1B 5KOJB 1IATA 4Z5XA 3VJLA 2QRVB 4KQMA 3IHQB 4JBIA 3RT7A 3ZIUA 2IHYA 2Y4OA 3QXHA 2BKLA 1MAVA 5C3MA 5BOSB 3TXYA 3L7KA 1B16A 4FNOA 4YRIA 2CDAA 4GWLA 4RQAA 5IK2A 1C50A 3BXEA 4EAAA 4ZAYA 5DSZA 4EX6A 1E64A 2PJUA 1W75A 3AONB 4QYMA 3ZE0B 5FL3A 2YTUA 5EFOA 3X1KA 2C2EA 3COJA 2VTKA 2CYCA 2BFDA 3KHTA 1E58A 3RO7A 1M1NB 4FN5A 1OCEA 4XASA 1XJWA 1RJGA 5HHIA 4MCAA 2WJVA 3ZWOA 4MLPA 4I9HA 5ALVA 3ZU4A 3T1QA 4UMVA 1UBTS 1M6NA 1JSCA 3U4HA 1QG4A 2VT7A 3IESA 1H23A 2BBOA 4RQBA 5DBHX 2WVJA 1UWCA 4KE7A 4OL0A 1G8AA 2C2KA 2BPCA 4KAFA 5B3LA 2BE7A 5LDDC 1BTOA 3M4ZA 2Y2UA 3BWCA 2Q5LA 1GRRA 4EZ6A 5BNFA 3MTJA 4W1RA 3PEUA 1DKQA 3D1VA 2CFTA 2X9QA 1UOOA 4EITA 4W8GA 5EWGA 4QULA 4KC0A 1ZQDA 3S7TA 1KDYA 3LCVB 1BE8A 3G6XA 1W2WB 2CBGA 3FDJA 4FFPA 5EJ5A 2F4NA 3JWHA 3ZD8A 3RSHA 1F2TB 4ZZ0A 1SEVA 4E15A 1X8XA 4BWMA 5B57C 4JWNA 1DAFA 1CX9B 5IDYA 1GEGA 3H2SA 2GM5A 2GETA 3REGA 1WLYA 1CY4A 3R3SA 1G20A 1HNNA 2OL4A 4FLMA 2CHVA 5T7BA 2CV1A 4WY2A 3RRYA 1XSEA 2XUKA 5DXFA 2VNSA 1GUDA 4RIGA 2QENA 3KB1A 5M04A 5KG7A 5L1LA 4Q3CA 3F5MA 4GPD1 4J29A 3IEXA 4YUAA 3SQDA 3H5WA 3LF2A 3EGIA 1JEYA 2W83A 4EFNA 4DCPA 2K8BB 3BQMB 3SCZA 5B7QA 1RSZA 1FMJA 1RKBA 5ITZA 5LP6B 4LTMA 4R9UC 1RC0A 1OX5A 1UMBA 3ISDA 1U9YA 3A10A 1XO1A 2QM8A 2OV2A 4XGRA 2V6GA 3LX8A 1FBNA 1EJBA 5KQMA 2BWJA 1X8LA 3JQAA 2ZIVA 3IEUA 3DMRA 3BBPA 4FE4A 1XWLA 3OJ0A 2G9RA 1Q7RA 1BJKA 3N2NA 1R37A 1J33A 3R0JA 1AM4D 4NYIQ 3E1GA 3L49A 4OLFA 4N9QA 1ZGZA 4RTNA 3H6GA 3DBIA 5E3IA 1ZLXA 1ORDA 3PUYA 5KYGA 1XFDA 1QYXA 3U3JA 1GM5A 5ILQA 1M34B 1BWRA 3IHWA 2ZI4A 3S2YA 4MPDA 2JFXA 5DULA 4WNYA 3VZPA 2OLKA 2DTEA 3K0EA 3I9V1 1TT5A 3SYTA 2RGCA 1G3RA 5I9TA 5EHQA 4C4RA 1JDBB 2AYYA 4EMTA 3E23A 1R3UA 1WDMA 1ZN2A 1MP0A 2UVPA 2D00A 2JGRA 4DV0B 3N70A 3IGFA 3U44A 5GTDA 4B83A 4QDOA 4RQ6A 1HYBA 1HZZC 3DAGA 3PQEA 5CDTA 3QPAA 2IT1A 1CDDA 4BEBA 2RAPA 3PEVA 1KTIA 2QMOA 4ALJA 4MWDA 4JI7B 5BYBA 4R8UA 2R97A 1IY0A 3GWZA 4AP5A 2ZSJA 3D4BA 2H0AA 5B1IA 2ZVJA 3TFQA 4F50A 1E3EA 2XQGA 1FQOA 3PC8A 4NENB 1JA1A 4YUVA 4DL9A 5K0LA 1GU1A 4HF7A 1JXEA 5JSKA 1ZVMA 3BWVA 3FPCA 1UM9A 1XRPA 5C8YF 4S0XA 1UBFA 3X1WA 4BU0A 1T8UA 3I1IA 1C3VA 2PGLA 4CGYA 2ADOA 4Z53A 2N46A 3HV0A 2CLFB 3K09A 2C1ZA 4ZT4A 4PWYA 3BWEA 4HGYA 4L16A 4C5AA 3RU7A 3RVRA 3F8TA 1SRQA 5JAMA 5FYQA 2D7CA 5DM60 3DGEC 1RPLA 5K0NA 4I81A 3OJUA 1BPYA 1CQWA 1KU0A 1R6UA 1VOTA 4QFDA 4E5UA 5C9ZA 3GFKB 1OY1A 1KYZA 4GRAA 2FZLA 2H1IA 4MWTA 1OH8A 1CZUA 4I28A 3G5UA 4LY3A 2JKYA 3MTEA 3GF4A 1K3TA 4NESA 3OPQA 3H18A 1W5SA 3KKAC 3RC9A 5DGDA 4MRSA 4EYGA 1HDXA 4DEZA 1U48A 1DQNA 4I2VA 3ROEA 4HB4A 3W06A 4Q3NA 2UVRA 1ACJA 5CB8A 2YWHA 3TFRA 3G88A 5TB5A 4IQTA 2C20A 3KR2A 1XU4A 3IPLA 3QVLA 4B4WA 4MUKA 3JS5A 1H3EA 1L8LA 5I9BA 3K0SA 3QJ5A 2RBEA 3UJCA 2A0WA 1U8YA 4KU4A 3CLUD 3BG5A 3RE1A 2O7RA 4TRRA 2CCJA 4O8CA 5C8XA 1NBWB 2CYBA 3C7CB 3IL2A 2GSDA 4BFCA 1X6IA 1JHVA 9ICKA 4DNFA 5C52B 2JIBA 4L9SA 6YASA 4RHUA 3BEOA 4K6HA 5KFZA 2H6EA 4F2GA 4W7IA 3JZAA 1FNSA 9ICPA 1UT8A 1TX4B 5J0XA 4R1NA 5GV7A 2O2CA 1CR4A 2KI5A 3F1KA 1F3LA 1XWFA 4DPKA 2VAMA 2BMAA 2PEZA 3AUFA 1I2MA 3D2NA 2YWGA 1I0IA 1Q50A 1UCFA 2KTQA 2EAOA 1NT2A 3L6EA 3FDSA 1PS8A 3UT6A 5AJUA 3M6IA 1LS6A 1QQ5A 3DPIA 5A9TA 3EXAA 3SJBA 3DUFA 1UQUA 4AZWA 2P2NA 1NR1A 3RJIA 2DWQA 3RASA 4QT0A 3IAEA 4ZREA 4MINA 1EMDA 4JVSB 4F2PA 3C3PA 3GVCA 2IE0A 4O1HA 2NZXA 3BKXA 3TLZA 1YD7A 2FXIA 2VDKB 4QZIA 3L77A 5LQJA 1Q7GA 3MK31 4XJTA 1UT5A 1VL8A 4DJTA 2GRUA 2L5YA 3M8SA 4FS8A 2P9BA 5JRDS 5BWBA 1YZGA 1Z26A 4RHYA 3AQ4A 3OP1A 4JQSA 3O1JC 5AKEA 4RPGA 1Z6XA 4IOLA 2GEVA 2Q1SA 3W9UA 1RLOA 4KFRA 3B12A 5JS1A 2RK3A 3AI2A 2PXIA 4PHHA 1I2BA 1YS9A 5K3FA 1CJBA 4MJ3A 4KRYA 3HJNA 2DECA 3S99A 4G09A 4AZTA 1GCOA 4C22A 1X7XB 3ZGOA 1XL0A 1XC9A 3CRNA 2I5HA 2FOXA 4D6YA 3EPHA 3BDPA 4C01A 1NUSA 1UKZA 4ER0A 5IJAA 3N7UA 3OCWA 3R76A 3KDAA 2HIHA 5DEOA 2EGGA 1E3MA 5FI5A 4GXQA 1VJDA 2VO1A 1QIIA 2DPHA 4D9CA 1TM5E 5B55A 3AHGA 4RDIA 3ZCUA 3ESDA 1RVDA 2GO7A 1ISRA 2NN3C 5GV8A 1NJ5A 4TMTA 4IKPA 3G6YA 1E3SA 1YL5A 3EHEA 2KG5A 4E07A 4GI7A 5KCMA 5C1OA 3W6PA 2JFHA 3I53A 3EDRA 2WB4A 2WJZB 3IELA 2ZREA 3VDXA 3CRW1 4HQRA 1HRKA 3VUEA 4ZJZA 4AY5A 1K8ZB 3K9CA 2TMGA 3RS0A 3EXG2 1D2EA 1ZM9A 4NARA 4DM3A 3PIRA 1XP5A 1AO3A 3BFJA 5KO2A 5LL6P 4EKGA 2JFVA 3U61B 3OC6A 3UH1A 1M5TA 4CRXA 1GU7A 5BWMA 5J2FA 3LIPA 4OAPA 3WGOA 4PG8A 2WU1A 2L82A 1QGUB 3JVIA 5AW5A 2XBUA 3IDZA 3WE7A 1T26A 1Z0DA 1QG0A 4O08A 4QW9A 1KYXA 4PWZA 4YHHB 3COVA 2Y1JA 4KLNA 4UAVA 2X2PA 2O48X 1IN6A 4M9UA 3HJHA 2FVXA 5HQ3A 2W9MA 2Y0SC 4NQRA 2PD3A 5KBYA 2GEKA 4TMKA 1E6UA 4Y1FA 9LDBA 4DS5A 1A04A 4GZLA 2K4PA 5B12A 2HBKA 3TGLA 3H9QA 3WG9A 4DNOA 1BE1A 2B69A 1IN7A 1MFPA 3KOOA 1JDNA 5DI9A 4G5HA 3HA5A 1OXBB 1FYVA 1G4AE 3L7IA 3RK4A 4UC0A 5FBWB 1VXOA 4DSAA 3LBIA 1Z5PA 5DBAA 9ICFA 4JKYA 1HFJA 4M8NE 3K9GA 3D4IA 4J1SA 2FW7A 5D87A 3DVRX 3H1FA 3KCQA 3RI3A 1CS0A 3I01M 2XKBA 1DKLA 3TVDA 1XU9A 4S1TA 2HAEA 4Q0MA 2C5LA 1G66A 2BCVA 4FS2A 1U4NA 2R8XA 1OROA 5JMPA 4URWR 5CG2A 1QTQA 3GDHA 5ALTA 1HQKA 5C51B 4TVOA 5BSTA 1AOXA 4UQPA 1TFUA 1DB3A 4LDAA 1DBVO 2O5RA 2VR1A 1ENZA 7ICSA 1RYUA 1FRZA 1YL6A 2CNDA 1Z62A 3LYLA 1DQZA 3PXEA 1QPGA 4MQ4A 1W2HA 2ZRHA 1Y7LA 3TPFA 3RAFC 1XKLA 5HIJA 3AM9A 4TTQA 2R751 4C0XA 4D45A 1AK9A 2NRZA 2RHCA 2DHCA 4EWLA 2OV4A 5E8RA 2P77A 4MDFA 2C00A 4HEA1 7ICUA 1X7YB 1XQYA 5B66U 4BN5A 3KXKA 3DL2A 1JIIA 5MGBA 4LMBA 3MINB 4IIJA 4EG7A 4GUDA 1L9KA 4JLPA 1IN5A 1YU9A 1NYLA 1MB3A 2HQ1A 2RGBA 3CEMA 1NUUA 4L8YA 3D54D 4QRDA 4B0PA 1MEEA 3ZBPA 3ONNA 5DO9A 3I0NA 1PU2A 4YPVA 2ZUTA 4AMYA 2ZFUA 2Q7OE 1RQGA 2GJ8A 5MHTA 1NQ5A 4E21A 1DTWA 3R3HA 1RT9A 2GZHA 3WMFA 4JENA 2OD2A 3O8RA 4U9UA 3PHCA 1C1DB 4JUDX 1LSJA 2VPPA 1HDCA 3VYWA 3ME5A 3KVRA 3HB9A 1JHXA 4PC7A 3DZBA 2X8WA 1BPBA 2RSLA 2DKNA 3QYJA 2PGNA 2IUEA 1PZXA 1TM1E 1BXRA 1WU7A 3RRFA 3P2KA 2PZAA 3FVTA 4CHTA 3NVWA 1XXLA 4DJEC 4JJ7A 2I4MA 3OEED 1TVCA 3M3DA 2H00A 1H8ED 4BNUA 1UJMA 2J6HA 4LG1A 3ZS9A 2W93A 5ILGA 2ZYGA 3FOBA 2RC5A 4OUDB 3H04A 2IV7A 4QIWF 3N7RC 5LYJB 3R5KA 1F9EA 3PWSA 4F38A 4RAOA 6CHYA 2AJLI 4MHOA 1HSZA 3QH4A 4FMCB 1CZOA 3UW1A 4ZPXA 3Q8WA 4F21A 4QPDA 3D8NA 2JGAA 1M8FA 2VHJA 3F5SA 1B6SA 2E87A 1V25A 1CIPA 3P96A 3MS2A 3LK6A 4UNQA 2D0OB 1NZJA 3T5JA 5E1MA 2WWIA 2J3HA 2ZW9A 4DLAA 3EGCA 4N76A 1XF9A 3OH8A 2I87A 4G9BA 3KE8A 2KP7A 4KLDA 1ONOA 4S2UA 3DL0A 5HIKA 3EFOB 1RM6C 4GYWA 4KYUA 4R5MA 1WR8A 2FFAA 3N0XA 1UMKA 1MH9A 3FLAA 4MRNA 3N9IA 4OJNA 3UOWA 4IHJF 2OV8A 1OU4A 4QZDA 2ZR9A 2J67A 5FBHA 4YMVA 4NBTA 5SZIA 2XRMA 1XRLA 3TNDA 5JC1A 4QZFA 2Q7XA 1Q7TA 1KN5A 3VQTA 2AHOA 1O08A 2A59A 4H3HB 5ALZA 2ZUBA 3QW2A 4OKSA 2WWRA 1S1CA 4R1LA 1JJ7A 4F4DA 4Y98A 2FMUA 2QU8A 2I54A 3C23A 3AY0A 3FB1A 3PS9A 1VCOA 2QTHA 2YXBA 3IAUA 2KKPA 3U4CA 4ZT6A 4H6WA 2BFNA 3VCBA 2ZSUA 1ISGA 4YRSA 3NWEA 2EZUA 3CPHA 4UBJA 4IDQA 1QHYA 1DTSA 1OW5A 2IQ5A 3HY6A 4WH0A 5AW3A 2DHEA 2JA1A 4S2EA 4UUAA 3TPZA 2PX2A 4PC2A 1XEXB 3JWIA 3NFRA 1M8GA 1KEVA 4EKDA 3PXCX 3FHLA 3CVWA 4RQNA 2A5JA 3N0WA 1AURA 4QBFA 1VI5A 3UMFA 2WF8A 4DKXA 2K4MA 5GVSA 1ULZA 3CLSD 4GWKA 2XVYA 4DV3B 2A1UA 2HJRA 1KWKA 2IY9A 1OQAA 4AICA 4PLHA 1PKEA 1OZ0A 5DE3A 5ESWA 1QQ7A 2BTQA 4PGFA 1N63A 2QG6A 3TTTA 3NOOA 2NUPA 4IX9A 2EYUA 3Q8QB 3OEEA 1H8EA 3NBXX 4Y30A 2CFIA 5ENVA 2OQIA 3DXZA 4V1CB 1I7DA 1YMVA 2VEOA 4DDVA 1Q1AA 1N5DA 3ES9A 1CQPA 5JXHA 3CXUA 3RS3A 1QCYA 5FXMA 1L5VA 2JZBA 1J24A 2W6MA 3GGCA 1YQ9A 4RUAA 1W30A 3C7AA 4JC8A 4FE7A 5A5FA 3A6ZA 3CUKA 1PR4A 4I50F 4B09A 1VQ1A 3OJXA 1FY2A 3GUZA 4ZKDA 1RHMA 3G17A 3EBPA 1IPHA 4Y8VA 4IIGA 1Z18A 3P1JA 1L7PA 3BIXA 2XOEA 4G0NA 4NEGA 5DVZA 4UCXA 4XPZA 2BQUA 1BXKA 4WLEA 3VX3A 2M6SA 1KTVA 1XEWY 5IYZF 3L0PA 3LQ4A 2PDAA 5K4GA 3RSFA 1YR2A 1VZ2A 1IL0A 3FWZA 3O8QB 1XF1A 1IHXA 1G4UR 2QVYX 2PR7A 4B4UA 1ZQAA 1XTTA 2HEGA 1V9CA 5HTKA 2QY6A 1QFZA 3PJRA 1LTKA 3FMGA 1IOVA 2XMSA 1KQNA 2A5FA 2W4MA 3VR3D 4PH5A 3ZV6A 3EZXA 2XECA 2PMBA 5KWIA 1YC5A 2ZIXA 2IYLD 4F4XA 1EDBA 3UPUA 4FILA 5E38A 3KQUA 1V97A 3E82A 3NVDA 1QJ4A 1YTLA 4ALIA 4NWIA 5J58A 4BCDA 4HWTA 4DQLA 5TPWB 5ALFA 2IHTA 3MGHA 1J1UA 3FFXA 2HJ9A 1EXWA 1T29A 3SJCA 1ORVA 4Z49A 3EMDA 4YRKA 2QP9X 4JJ4A 2CVPA 3EK2A 3CR8A 1G1MA 2I55A 4YWJA 3PW5A 4L5IA 3SS8A 1N34B 3E3LA 2QYOA 1FFHA 4V0KA 3IEKA 4DIMA 4PN7A 3QKRA 2W6QA 3RQSA 3LE8A 4JA2A 5T64A 1KK1A 4RCVA 3CNBA 2XDYA 3VDMA 2ZRPA 1OBHA 4UEJA 5T5QA 5HFJA 2WF5A 4JUZA 2QV0A 4O63O 3OZAA 1KNQA 1XHFA 1I1HA 2R1TA 2XSZD 4Q4HB 3L3FX 2K8AA 2E5FA 3SK0A 1NUAA 3D7NA 3LC7O 3BE6A 3EGOA 3U3OA 2WB1F 3OFKA 3RYIA 3NYRA 3ZDQA 4RL4A 2ZROA 3TW0A 4OK3A 3B85A 3S1LA 1D7AA 2OR3A 1N2CB 2NZYA 1FQJA 4O3FA 4E5MA 4PLPA 3L8HA 3DEAA 4IKEA 1C1HA 5IFKA 2I9GA 2P0EA 3KX2A 1MIHA 4KR9A 2AZDA 3L8FA 4PZZA 3ESXA 2ZR0A 4NJMB 1LBSA 3ICEA 3IPYA 1IXZA 2HCTA 4BJ5A 2JFUA 3A1NA 1ZUD1 1Y7PA 3LUAA 2FWPA 2BAGA 2VZ0A 4TL9A 4M9SA 2ZUVA 3OE5A 4BQOA 3WYEA 4Q01A 2HR1A 4WDRA 1D2HA 4B3SB 1LDYA 4ELTA 2CK3A 5DDYA 2A1JB 2HU7A 4C05A 3T15A 4RU1A 1Z08A 3OKPA 4URVR 3R7BA 2ZXUA 1WB4A 3AYZB 2VAVA 1ZQNA 1CW2B 2JGDA 2NACA 2FE1A 2PLWA 1QOZA 5JNVA 3R4CA 4N5MA 5FPYA 2I6TA 5HJEA 1BGWA 4B7XA 1C0PA 4GU5A 4P36A 2QKQA 1G6KA 5TMDA 3P0JA 3RTBA 1TU0A 2Y93A 1KZYC 4KAAA 1N25A 1FJXA 4P2BA 1EUDA 4PHTA 4IGEA 4WCDA 2X7XA 5D1HA 2ODAA 1JIUA 2FYTA 3PX7A 4HG2A 3HVKA 5EXEA 4XZ3A 2O5VA 2Q9BA 4XWOA 2IODA 4DBLC 2J4FA 5AXBA 1YV9A 4I5FA 2RGNC 4WINA 1A8SA 4KJZA 1SGGA 4KWEA 4YMIA 1JA0A 3RAPR 1S89A 5A0TA 1UOPA 1SKWA 1X1BA 3FHTA 2R60A 1SL1A 2HLPA 4B4OA 4JYZA 5IUNC 3BK7A 4MUFA 2YN0A 4X63A 1J2RA 4MRVA 3GV7B 2VPWA 2XUDA 1IMJA 4CCHA 3RSSA 4XKJA 3UUGA 2VCHA 4OMUA 4O4JF 1LI5A 5KL8B 3OZFA 4E5YA 1SXIA 3NV7A 4EY6A 3IPCA 2I6GA 3IQIX 1T2FA 5LU9A 4IJ6A 4TTTS 1F2DA 3OTQA 3BS4A 4G5QA 1N3YA 1RCFA 2E2WA 1NAIA 1E96A 5IPFA 3ANYB 3RYFA 5JVDF 1JDUA 1VLLA 1FRNA 3RYHA 2R86A 2QTTA 4Q1DA 5KTSA 2J6BA 2V7VA 2J41A 4PO3X 4UDXX 2LYBA 4CF3A 1XB2A 1IXRC 1P81A 1A50B 3ONVA 1DHRA 5AJTA 3QWIA 3CX6A 2DM6A 1I3OA 2EX0A 4HMPA 4NX2A 3JPWA 2F3TA 2XWBF 3AM4A 1LPMA 4Z86A 2DX7A 2I6XA 1NIJA 1RKVA 2RHMA 5D5HA 1U49A 4GNKA 5DX1A 1DJPA 5F1KA 3FCEA 1W49A 4TMYA 3TIGA 3ZXXA 3TEMA 1FDIA 4UARA 2BLLA 1YK1A 2R6AA 5FADA 2J6TA 2BSAA 4KCGA 3TWOA 1RBYA 1TQHA 2XRYA 1L7VC 4MQ6A 3PKJA 3SQIA 5EN4A 1UWKA 3QHAA 4RQ2A 3HCFA 3ZG6A 4PSUA 4YAIA 4FFSA 3PHHA 2XVXA 2VUTA 4GR9A 4ZI7F 4PRZA 3TTXA 3VAAA 1CLUA 3M2PA 4TV9F 3FUVA 1TEVA 1U9LA 3W8EA 2C2RA 5L4NA 3ET5A 5ALKA 1D6SA 4F3CA 1T25A 2I7VA 1T5OA 3I2IA 2O0LA 1HEUA 3BMXA 1ODCA 4QARA 1X80B 2GF2A 1QZUA 5COQA 2I6UA 2H1SA 3D7KA 5IH3A 5KFJA 3FB4A 3QITA 1KEJA 1CVLA 4F4JA 4RDXA 4UUPA 4X44A 1QV9A 2PV7A 2QGNA 3I3SR 3AT1A 2BGJA 2ZOSA 5JAQA 3BHNA 4XDGA 4HBGA 1MC5A 1D1PA 2VC2B 4HUQB 3QJYA 1N5MA 3D8UA 3U26A 4ERXA 3O95A 4UDNA 4LV5B 2K2WA 3ZHQA 3ILXA 4W5HA 5FTMA 1T10A 3V97A 4FFWA 4ECQA 3LWDA 3FSEA 4MAFA 4N01A 1O5OA 2FPGA 2JH8A 8ICOA 3GEMA 2WWGA 3V1YA 2WQ7A 4HGQA 3H2JA 2ZIGA 1SKSA 4G41A 4DRYA 1K3UB 1NJ2A 2PZJA 4X9XA 4Z4EA 1YR1A 4YV0A 3IIEA 2WDPA 5FNZA 4BNXA 3D1LA 2AIRA 2NSLA 3IQZA 1H42A 3GP3A 3GZFA 3EDYA 5DGAA 3IV7A 1Z2AA 4H08A 3DW1X 3IBTA 2BGUA 2YFKA 2QMHA 1DDGA 3IKMB 3EXHA 9ICUA 3LIIA 4M1EA 8LDHA 4IDCA 3ILHA 1NMEA 1CEQA 3K6KA 4H4DA 2AE2A 5EUCA 4QGFA 5KI6A 5LZ7A 3CSUA 4IV5A 1ZD2P 3CKKA 1XEAA 2WYUA 2E4VA 4YY3B 2H2IA 4U2FA 4F6RA 1ZA2A 2FGKA 3G49A 2GSWA 5A4KA 4HCJA 4EUSA 5LWQA 3PDHA 3D4LA 4WZ6A 2UAGA 4U7TB 4KVZA 4OHKA 3F2BA 2YVLA 3OESA 4TXHA 2JEGA 3I9NA 3L4EA 4D4MA 3HRDD 1MW9X 1Z22A 4PZ0A 2YCLA 2QSUA 2JNWA 2LW7A 5DGBA 5CJPA 1ZHFA 3RK0A 5KOHA 4J9QA 3CN7A 1I4DD 2PCLA 4GL4A 4A8JA 4F5NA 2XOKA 3IXMA 3VU0A 3CJTA 2FEAA 3GUHA 1T4CB 4J9VA 3HUUA 4OGKA 2JRLA 3R3WA 4QYIB 8ICQA 4YRBA 1GG5A 3GLFA 3EVZA 4DEXA 3I9JA 2P9QA 2XNKA 4Z8XA 5ARCA 4RPHA 3HM2A 2W2XA 4RA6B 4X66B 3RH4A 1PJSA 1WF6A 5JZSA 4W5RA 4F3NA 2E48A 3NZEA 4DCOA 3C8ZA 4A0FA 2PRJA 1VHQA 4ER7A 2JL1A 1DINA 1P91A 1XRJA 4NABA 4OHOA 2D0IA 5L3QA 2AGOA 3AC0A 3E9DA 1I2CA 4UQGA 4RV9A 5KTTA 3OKFA 1OPXA 4UTXA 2EKPA 1COZA 1HDZA 2WINI 3RQIA 3SSAA 2Q0XA 3PZPA 1SUEA 2QBYA 2HU5A 3QRWA 1DARA 2D1QA 1I2ZA 4JOBA 1DKMA 4CLHA 1T9ZA 3TG2A 2CJPA 3KK0A 2OAQ1 3K15A 3RJ5A 3KKMA 3FCOA 1OXSC 6Q21A 4Z4HA 1Z2EA 5BN5A 4HJRA 5GOZA 3BQTA 1ML4A 3ZZMA 4FOOA 4UBNA 4O2BB 5LZ2A 3PC3A 2OBXA 4USAA 2Q2OA 3GB9A 1E0JA 1KMQA 1P17A 1FP7A 3VNAA 1EFVB 1YB1A 1C9YA 3WB2A 3CF2A 3PJEA 4G1FA 1FX0A 2Z58A 3QBJA 4V03A 1KDHA 1CZLA 1VPLA 3VKUA 3EARA 4D9GA 4DQKA 3OM9A 1FSFA 3VZCA 3KSZO 4F06A 3HDQA 1QHSA 1PTJA 4FFOA 3ZBQA 4A16A 4P0PA 1NK8A 3K1JA 1BHSA 1CUSA 4PYIA 3NORA 3HG7A 4CLRA 4H1VA 3D6UA 5A6SB 3UXYA 4ZV4A 4E4YA 2UVDA 2X22A 2VEDA 3LUDA 4YMMA 3R5TA 4MVJF 1RZTA 3E7XA 1AZTA 2UU9B 4ID3A 3T3FA 1EI9A 2FTKE 2C2WA 2I9KA 1PJQA 2PL5A 1TEHA 5NULA 4Z7QB 2AOUA 1YC2A 1FEZA 3PMNA 2VF5X 4A6EA 1TJ4A 3PJGA 3LLVA 4QYSA 3NC1C 3DB2A 3I9KA 2FN8A 4LE2A 2TSYB 3L0YA 4J16A 1JZSA 4OJ5A 2QSJA 2R68A 3F5AA 5AKZA 1N4DA 3TX2A 4TN5A 1XC7A 4OM8A 4DA4A 2P65A 4J0QA 2QR2A 1FUKA 3DKPA 2VA2A 2CLLB 4BYGA 4DARA 1JJIA 4MW5A 1O77A 3OUUA 2XE8A 4QVGA 4NLNA 2AN3A 1D5CA 4MFCA 1A7JA 2C5FA 3H1GA 1TNDA 3WGKA 4BRSA 1H2AS 1OAAA 2RKOA 2CXNA 3CNNA 3OJLA 1CXZA 4B85A 4I36A 3EVEA 4R65A 4A0SA 4EJSA 1E0SA 3I2YX 4OCZA 5ADUS 1ZQXA 3PYXA 1COWD 5KTQA 3N74A 4DWWA 3LX4A 3C3DA 3EVGA 2NP7A 2WHQA 4FPXA 1B3BA 3DE2X 2QQ5A 4AN1A 1ZGAA 1LPBB 3S3TA 1JRPA 3HU3A 4N5LA 4TT3A 1W36B 2BM1A 2PKRA 3OTHA 1QSYA 3P52A 3HKZF 4WPGA 4RTLA 5KNDA 1GGFA 3MR5A 1HFEL 3WA7A 1KAEA 1ZUWA 2HY7A 2IPNA 2QTWB 3A1FA 2DUWA 4G4IA 4RZIA 1JDZA 5M2QA 4IO1A 1XXHE 1KVUA 2X2OA 3JQAD 4RCYA 1Y7TA 3WRVA 4NU6A 2Y9UA 2HXGA 1JHUA 4AYWA 3E70C 3LZDA 1VKZA 2RK6A 2DWUA 3FYTA 3ZUGA 2C61A 4Y2QA 1NMQA 2FWRA 2DWPA 3KG2A 5AM2A 2JD1A 2MSCB 3BCUA 1MVOA 2OWOA 1WTAA 3JYNA 4ZVVA 5ICGA 3BJYA 3LGSA 2ZJ3A 3UJ8A 3SKXA 3E0QA 1JFFA 4UZEA 3DBOB 3O8OB 1TVKA 3NIWA 3G9UA 1L7QA 4WEOA 4WWHA 3ZWKA 3G13A 3OM0A 2YWEA 5HR7A 5K45A 2HA7A 4I3GA 3ADOA 1ND5A 3UJ7A 3KYIB 3WX0A 1Z8DA 3SR3A 1JLLB 5AKJA 4LEIA 4HLDA 4INOA 5DDMA 2IOFA 4R8RA 4FZVA 3B2EA 1XD2B 1OA0A 2NRWA 3C8MA 1AQLA 3CWZA 1P62B 1SXJB 3AM1A 3H97A 5BMVA 4R01A 1JWLA 1J7JA 4BV3A 4QOSA 3WIDA 4G1MB 1VG9B 3EPIA 5I8PA 4QU9A 4N0QA 2R11A 4C1BA 1Z4JA 4OK5A 5KSPA 3HDJA 2DBYA 4AWAA 3KQTA 5DFAA 3KKZA 1TCCA 5F4ZA 3UT5A 5DI3A 3SDZA 5T4FA 3T38A 3KOXA 1QDUA 1ECJA 1VLHA 1SVNA 1CB0A 1EZZA 1PR0A 3D81A 3G2QA 2RH5A 4R9VA 1Z74A 2QB1A 2NV2B 1LNSA 2BFWA 4I4TF 2K60A 4Y1RA 4FB5A 2QGFA 5ERXA 4LC9A 3C39A 1Q57A 4G89A 3O3NB 1BDIA 2RHTA 2YZ7A 1NW4A 1RWXA 1ZQJA 2Y1DA 1WB6A 1Z33A 3GT3A 1P2SA 1Z4PX 2DPMA 3GN2A 2Q6IA 2PO7A 4MVJE 1ZSYA 1UC9A 1HV8A 1R4AA 4HB2A 4F8JA 4GMDA 2IIVA 4LMRA 1ONPA 1COWA 4DANA 1DZ3A 1RBMA 4ZDWA 4IW3B 2ZBGA 2JIDA 3GCWA 8ICLA 4EZBA 1E3WA 1B14A 1TTQB 1T3TA 3U16A 3REQB 5AQEA 3BIOA 1P1FA 3VC7A 4PR3A 1WD5A 2FDXA 3SVLA 5AKKA 3V4PB 3C3JA 2AR0A 5HF9A 3O7MA 4BZZA 1IN8A 4QBIA 3CO0S 5LBIA 3K0HA 5FWDA 3FTNA 2XVMA 2I03A 3T5CA 4MRMA 1E1MA 2MSLA 3OG9A 3RB8A 4WNCA 3HKDA 2GHTA 4QZ9A 1BWPA 2ETXA 3R24A 2VTBB 5E1OA 1XZLA 5FEMA 1GXSA 2AEEA 5DM2A 3EEYA 3OETA 2PBRA 1WP4A 1VLZA 5GONB 3DAFA 2FSVC 4M0UA 2H4XA 3ZS8A 2C7OA 5HS6A 2GF0A 1ZQGA 3I52A 4D3DA 3WNBA 4G0VA 4IR9A 2WTAA 1Y1RA 2A1TR 1YR3A 2W43A 3V7JA 3V6MA 3QVGA 3ZWYA 1NJWA 4CTMA 4CF5A 3OFNA 1F17A 1YRYE 2Y0EA 10MHA 5CTJA 3ZY2A 7REQA 4EOGA 1WDTA 1DV2A 4EEKA 2G28A 2HWYA 4C2BA 1SOMA 1MD9A 2W5UA 2VATA 1OWPA 4BFYA 5KTNA 2XNCA 1IBKB 1YB4A 1NSFA 5CJ7A 3QUAA 4BMCA 2R8JA 3NJRA 4ZIRA 1OXXK 3HU1A 1FP2A 1GZVA 3CUWA 2B98A 5H9WA 3MJSA 2XQVA 3PQ4A 3EAQA 3HUDA 3MT7A 2NNWB 1QLHA 5J0UA 3N59A 1KH1A 3IFSA 4XVCA 4UAWA 2CKMA 3HRKA 4UQOA 4RLQA 1VLQA 3TTVA 3IRUA 2QROA 3G23A 3JQ7B 1UJ4A 1YCHA 4I55B 5JJKA 4JJKA 3KSBC 2DKOA 5BV1A 4XGNA 3C3EA 3DPSA 4FSHA 4I2CA 2Y0PA 4LBYA 3WLPA 4XYBA 5JWRA 3R7DA 1FOEB 3C3CA 1JZQA 4NE9A 4XYMA 3IDWA 2F8KA 4PS0A 4YIHA 2VHUA 3IA7A 2QX8A 3DEJA 3A06A 1C3LA 4BL5A 4TMFA 3THSA 5K6AA 2IPAB 1L8AA 3K9HA 3ROMA 4JLJA 2HMTA 1GTVA 3MDCA 2RDMA 4YRTA 4E5DA 2AFHB 2ZAIA 3T7SA 3HT3A 2EH9A 1P0CA 1X7WA 2C2OA 3T3HA 2CLIB 3DLPX 2OQRA 4LW8A 1VGVA 1R0ZA 1TLFA 5G1PA 4BUZA 1LVGA 3TF5A 3OMXA 3EQ7A 3W77A 1OUQA 2FSHA 4BZXA 3RJTA 2F9FA 1VJ5A 2NZWA 3HBAA 4L15A 1HE8B 2REQB 4RTJA 1PJTA 5E9JA 5GPBA 5IIOA 1THGA 4YEDA 2GYWA 3NTUA 4AJIA 4YAUA 3G0IA 3BRSA 2QTZA 4TUYF 4DL2A 2OHXA 2WQZA 1C8KA 2QZZA 1E3TA 4NL9A 1BO6A 2Z7JA 3NPAA 4BNZA 4MRRA 4DZZA 2XCTB 3DMHA 1W8DA 4G8JA 4Q34A 4OB7A 3I2GA 1MIOA 2VN8A 4EG6A 3JPPA 4KLCA 1EGVB 2CNWD 4Z2AA 1XKXA 3BGSA 3FOWA 3QOWA 1ZQZA 3TOXA 3UW3A 4DCNA 1LGYA 4OJYA 3QEOA 1XO0A 3EOBI 3K0FA 3FMOB 3F2IA 5KTMA 1G9XA 1K1EA 4V24A 1KEUA 2IDJA 3JVVA 3BORA 3NDRA 4NHEA 2PJDA 3I1FA 3D8BA 4RH1A 1P7WA 5BXYA 3JQDA 2HO4A 1Y1LA 4IINA 4BQRA 5ELXA 2QYSA 3GRUA 3LCMA 1EUZA 5L1KA 5A5EA 3VNUA 3SYZA 5J0OA 2YX1A 2AXTU 4LF9B 1GP2A 1UMCA 3A7EA 4GEGA 1HDRA 3VI4B 2OBNA 3O8DA 3TQ1A 1KQFA 4QZEA 1UP6A 2CJWA 2FE9A 3B0YA 3R3XA 2VH1A 2PBZA 4BNVA 5E3HA 1AGRA 5TLSA 4HPWA 1NYRA 2H4ZA 1SL2A 1N4AA 5EHNA 1JIJA 1UZNA 3QLVA 4LDRA 3GU3A 5ALHA 4ZCRA 1ZAKA 3JYPA 3E8XA 5G5HA 3WLOA 4C14A 1U7DA 4M8KA 3ASVA 2G9NA 1R3DA 3LQRA 3ZVNA 4MQMA 2HCBA 1N0HA 3CM0A 3HKEB 1K8RA 5E3JA 4F5EA 5ETJA 4C08A 4Q21A 2O23A 4W6ZA 2FMXA 1PL0A 3HN2A 4NOMA 1VB5A 2WWWA 4BMDA 1HA3A 4C3ZA 3DCJA 3BOSA 3JALA 5JYBA 3DE4X 1R6XA 4EYIB 3RJGA 3GLQA 4ZO6A 3UAZA 1S3IA 3H7IA 4J9OA 2PZBA 5J1SB 4BWFB 1ZR2A 1EK5A 4Z3KA 1CR1A 1TAGA 5BUZA 1RP7A 5EMJA 3ZLJA 1TOAA 4OLJA 1ZVKA 1NK0A 1AS3A 3E3MA 2IEDA 3GRKA 2Y99A 4OHMA 3H2BA 5TXGA 3GFPA 1NPDA 3EEBA 4KAXA 3V4SA 2CY0A 3RJHA 3T7IA 1Q20A 4RL6A 1MX1A 4M1TA 3PGXA 2WHPA 2ZULA 4TYQA 5J2IA 3QX9A 1Y1TA 2QRJA 3EGXB 1ZD5A 1TCUA 3Q15C 1Z0SA 4AIRA 4EZIA 2C3PA 3ZE1B 4Z51A 1Q6ZA 2FPOA 1DIRA 5FOVA 4F60A 1J5EB 4X91A 4XX0A 1ZMTA 2RHDA 3PXXA 1GGNA 2ID7A 2WJYA 3EY9A 5EERA 2WM3A 1DMRA 2CNWA 3FFAA 1DQRA 1OXTA 2D4HA 1TUEA 2D1SA 4GR5A 4B82A 1X7HA 1C9JA 1JDTA 4O1MA 4LTNA 2XKJE 1XEWX 1XNRB 3VMFA 4ZK2A 4QYXA 3FYUA 4ZHQB 4TL7A 4FKBA 4IP0A 4O3OA 4YCXA 1B0UA 1EUYA 1RM3A 2OBFA 2Z1MA 1NUPA 5A4FS 3PGA1 1IOLA 1PQPA 9ICOA 2F43B 3PEFA 7ICPA 3UMGA 2YV1A 3L7LA 1TM3E 5JU5A 3GFVA 1XMSA 1LNQA 4P3OA 3ZJ4A 3AEYA 1CUDA 1Y3BE 3SE7A 5JXGA 3WYBA 4YQZA 2CCKA 4M7WA 1KSPA 2VHVA 3QU2A 4OXKA 1GOTA 4DHEA 3GFTA 1QVZA 4XIYA 1T2UA 3RODA 1QZZA 5AI6A 3UHAA 4M1WA 1N5RA 2VHZA 5EKDA 1AKVA 4MEJA 1TIPA 2HCRA 4BGVA 4N5HX 2FW6A 4X7BA 3NAMA 2X0FA 2R5WA 2OORC 5EIBD 1XJ5A 5FBQB 3TH5A 4UE6A 4PNHA 5LB4A 5I45A 5D7NA 3QX8A 1MFZA 3V32A 3LM8A 4NCNA 3EMBA 3SVTA 1KZGB 5LM3A 4DQSA 4K86A 2HSDA 1Y6QA 2YJNA 4S1PA 3GBSA 3GGGA 3PTLA 5H3LA 1JX6A 1JHQA 1KFBB 4KGXA 1R6DA 2ZWPA 1YOVA 4B9VA 1NKSA 4RD2A 2XX3A 3M1YA 1ECFA 2GT1A 4IM7A 1JFSA 2H3QA 2VYVD 4L6IA 3DWFA 1EX6A 3CRXA 1SCUB 1SH7A 1XKQA 3RJZA 3VJMA 3HNPA 2OP0A 1CUJA 4KYVA 1W73A 3K8ZA 1MB9A 1YKFA 4EG8A 7ICMA 5LXTF 4CIBA 1IV8A 5KFAA 3ULKA 3U7JA 4QDUA 4GBJA 1OI2A 5JH7A 5KFNA 5AH0A 2PFPA 3THYB 1CZNA 3ANTA 2UXBB 4HGPA 3F3SA 3OAAD 3F7MA 2YJ4A 3GUCA 2PPVA 3V4LA 2E1FA 5AOVA 2H07A 1OTYA 1ZHHA 2QOEA 4E3ZA 2L17A 2DZDA 1MA7A 3OZDA 5J5CA 1L5RA 1JB9A 1RE1A 1T9GR 1VCHA 3IUNA 2YNMA 3PNVA 3A8TA 5I7UA 2Z6AA 2BKUA 2V4UA 3SSNA 4HNSA 2EIHA 3FZNA 4X3PA 2YJTD 2M32A 2NGRA 4J2OA 1N5IA 4YP3A 2YV3A 1DKUA 2J31A 1F4LA 1MJHA 4FW9A 3NRZA 4XSHA 3GNLA 3I39X 1QYRA 1K97A 3VR6A 4EB3A 2CNBA 4XEHA 5K8UA 4UOEA 1PK8A 3D2BA 4WESB 2BOVA 5JRTA 2NZVG 1EKXA 3GRCA 2BFCA 1V16B 2B34A 2XNHA 3UCXA 1X9XA 3FMPB 3BZKA 4HMOA 4GOOD 4Q24A 3GLIE 3K1AA 2JCSA 4HWPA 4CLDA 1JMVA 2E18A 1R0BA 4KR2A 4A2CA 4S1NA 5KHLB 5TSDA 1R5BA 5BVGA 1R0SA 2GUWA 3VPHA 1OXKB 4C30A 2PK3A 4HUTA 2H63A 2WJ6A 1IJEA 4I9FA 1L6IA 1QPZA 3LP8A 1GQ2A 5IT9A 2FPRA 2GAJA 1MGPA 3WQBA 5EWJA 3CZAA 4YGXB 5KVSA 2NRTA 4LYHA 1RLUA 1JQJC 2NVUA 3VR4D 3OX3A 3D31A 1ELOA 2CL7X 4NTZA 1OE0A 4L3VA 3ZJ5A 1NT4A 5C53B 4LSGA 1O7JA 4L0CA 4KTQA 4QQRA 5BN1A 1RXCA 3KSRA 4WEQA 3W7VA 4ZAZA 2V0GA 3QOXA 4UBMA 4DSEA 4UU1A 4I14A 3MIIA 1LS1A 4PGGA 3NYIA 2LD4A 1VJCA 1JU4A 5BUQA 4N48A 3AJEA 3V8EA 4ROTA 1YUBA 4DCVA 1ORHA 3P9RA 1BPXA 4YRNA 1E3JA 1PUZA 5E4YA 2AOTB 2WJIA 1ES9A 4ZVMA 2VYVA 2X5KO 3B1XA 3BRWD 2OCPA 5F9MA 3HBJA 4PAQA 5DB9A 2XLBA 1T1RA 4CM9D 1UDCA 1YONA 4I46A 4E4RA 1MX5A 4HDCA 2B8NA 5D3ZA 1CUHA 1EQUA 5EINA 1VBKA 3I1JA 1WV1A 3Q41A 5JAUA 4GPEA 2AMYA 4ZVTA 4KWIA 1TEZA 3U3RA 1Z45A 3OAAA 3LDUA 4WOPA 1RDFA 3BWXA 3AEUB 3OA2A 2BEUA 3USCS 1DG1G 1Y3DE 1GFIA 4R2MA 4IJMA 3LT2A 3OZVA 3V34A 1JH8A 1I3NA 4UJ3A 4U5XA 3JQ8A 1IEWA 4OHPA 5A4IS 2B7BA 4MQEB 5EPEA 3LNCA 3IDAA 4OH7A 1N7GA 4F91B 4FNAA 3BKWA 2C31A 2CV0A 5JQGF 1CYDA 1NI4A 5K3AA 4QUKA 2WF7A 4P3NA 2C3YA 2H8GA 4MR9B 2QRKA 3S81A 4M1SA 4E08A 2X0NA 2ZSDA 4NZPA 3B6ZA 1WX1A 2FWNA 1Z47A 2WV9A 4QELA 3AF0A 5EJAA 2VJMA 3M2TA 2V9WA 2PGAA 1NF8A 3HB4X 2WIBA 5HCUA 4M54A 4Y6GB 3MHPA 2K6GA 2KD1A 3F3YA 1GRCA 1I3MA 3LDFA 4DL3A 1Y42X 4WK0B 3E2MA 5CG1A 2BL4A 1U8XX 2JD0A 3IUBA 4GVLA 1LKYA 3DE5X 1QE3A 1CEYA 3FPHA 3DLAA 1G8JA 2Q4TA 1Q7EA 1IHOA 1ZG3A 5GINE 2YMPA 1JPUA 2FRVA 3RW9A 1PSDA 2WMNB 3EASA 2GAOA 5JY6A 4A03A 1N2BA 2YY6A 2ZUEA 4BDSA 3NH9A 1VP9A 3G1TA 3VR4A 3NAQA 2J45A 2JW5A 2PUCA 3T95A 4GLXA 3WNCA 3ORFA 2E4ZA 1NQXA 1WMDA 4WZBA 5KQPA 1M2HA 2X14A 2OXRA 2EJVA 5CA1A 1EK1A 4F9EA 4L4SA 3TLAA 3MT0A 3BN3A 5G0VA 2OE2A 2VDVE 4NAUA 4FVTA 3IQDB 1RYFA 3LY8A 3CYFA 2LE0A 4M8IA 3ZDEA 2ZBPA 2XOXA 7MDHA 3FWKA 1Q1QA 4NC9A 1VLVA 4MVXA 2AQKA 2YTZA 4ZYXA 4UAZA 4NEHB 4DWIA 1NLUA 3WQRA 4FHCA 3VV2A 3VPBA 3BRWA 5IZ4A 2GKGA 3W5JA 4V0NA 2VXCA 4KMOA 2IHKA 4CM9A 2A9QA 2CK3D 3PFIA 4BMOB 3PWKA 3KZ1E 1TPZA 1MEOA 2PT9A 1UBUS 4CM4B 3FGOA 3V5NA 5LWHA 1ZRNA 5TISU 1FSZA 1SCIA 2EARA 1N2EA 2PX6A 1FNNA 1OLXB 1NR5A 1TU4A 2WB2A 3Q2KA 2JRZA 4RA9A 2O4CA 4J1TC 3WYGA 5CBKA 5BR7A 1UWLA 2P9EA 4HAIA 2Z0MA 1IG0A 3O21A 4QUIA 3AVPA 5FV4A 5LPNA 4F2SA 3VU1A 2OZVA 2ZIUA 5FKJA 1TKRA 3V80A 1USUA 4EKNB 1YBAA 1W581 3LOUA 1R8XA 3HWTA 1MT0A 5A5VA 1P18A 4NZYA 2H3ZA 2AD1A 4U7CA 1QVWA 4Q4AA 3SKYA 2DKFA 1UT6A 2PRSA 1AGNA 3TVTA 4DFPA 4HTFA 1H2XA 3N8HA 3RH0A 4RTPA 1AQIA 1F0YA 4KO2S 3AR9A 4GFJA 3EPRA 4FI3C 4BX8A 1LTHR 4UM9B 2ZDQA 3HNRA 4ZDJA 4KFCA 1ESCA 1FIUA 1E4EB 1OYVA 1JAHA 1E2IA 3Q5GA 1C3EA 5CB4A 3ETGA 4PR0A 1B4FA 3FUUA 2I6FA 1E0DA 1LQTA 4LZWA 2MJLA 3DCNA 3T1HB 1S9HA 1S8FA 2YBDA 3VU8A 4JB3A 5FFMA 4F8EA 5KG1A 3ONWA 4BZQA 4Q5IA 2UZ4A 2VF7A 1XA4A 4F11A 3RARA 3AI3A 1Y8CA 2F1HA 2ALZA 4O3MA 5FWYB 2E4YA 4JJ8A 3PCTA 3JQRA 4S24A 2FPPA 3M3HA 4RPZA 1TMGE 3RRBA 2ZXEA 3GJYA 2BHNA 1F2VA 1P74A 4KKXB 2D2FA 2IYNA 4QZGA 1CIJA 3QV2A 3BMOB 4GQAA 4NLLA 3WLQA 1RVV1 5FBKA 1OA1A 1GPDG 4KN5A 2ECKA 5UKDA 3L79A 4BGIA 1J22A 1NZPA 4M0AA 3UAVA 2X6TA 2C78A 3RRZA 3VTKA 4C6TA 2EJCA 2VJYA 1P0IA 2J9FB 4LZLA 5TQ2A 2Z1NA 2Y0SF 3SBOA 4I6GA 1Y9ZA 5EQFA 1DJMA 1YA6A 4K1LA 4TT8A 4ZOBA 3HH8A 1XD9A 3EUFA 1J2NA 2EWVA 1DRKA 2C88A 5C8YB 4F4CA 4O59O 5AVJA 3LS2A 4X1OA 3ANMA 2YOHA 2CSXA 1QC5A 4C0BA 4D42A 4KV7A 4BCCA 1YQWA 5SV2A 2VNJA 2WJGA 1QH8A 3AVOA 4GMGA 2EKQA 4KXMA 4KQ9A 3ASUA 1PGQA 4JOSA 2VKQA 2I3ZA 4ND3A 3IO5A 2JI4A 5DQGA 7ICRA 2I3DA 2Z2KA 3N8DA 3VVCA 2UZIR 3IG5A 3R5FA 4KEAA 2W37A 5J23A 2VG8A 3OOHA 5DLYA 5EZYA 5AIBA 3DOJA 2YV5A 4EYKA 4QTTB 3T6KA 1UJNA 4ZHSA 2PUVA 4FT4A 4LBVA 3FNRA 3NCHA 5B1EA 2BHRA 1QHHA 2OYRA 4E2XA 1RXYA 3NS7A 1SZJG 5FTJA 4FINA 2W2VA 4DIOA 3FG9A 4ED0A 1EK6A 3JU3A 3O4JA 4B4KA 2C4MA 4FT2A 3V9PA 3D7LA 2A9PA 4EDFA 4RABA 2IXFA 4F4YA 1VJ1A 1M8PA 4YMSA 1N57A 1Q1GA 2HV9A 4D3SA 3F7OA 1MVNA 1TU3A 2JLBA 4MPPA 3NHRA 5ECWA 4AULA 1KJZA 4CF4A 2XCAA 2WHXA 3SZ3A 3GVHA 2LPMA 5A9SA 3GMDA 4OJ6A 3PHLA 1PL6A 1W93A 4XQ9A 3JRNA 3DHVA 3L9XA 1QMGA 5HA5A 1MA3A 3NHYA 4II3A 1E59A 3VOBA 3I37X 1A95A 1DELA 2DOKA 2UVUA 4AG3A 3E22A 2CE7A 2CLKB 1JR3A 3K53A 4I2EA 4MMZB 5AXAA 1RRMA 3VKHA 4L27A 1Q44A 4HDSB 2QY9A 1TMKA 2XRFA 4PIVA 1KZ6A 2LYAA 3Q85A 2Y8EA 2AFIA 2O14A 1MV5A 1H6DA 4YP0A 4DADA 3UJ3X 3GIKA 3FZGA 1M2KA 3TFSA 1L4EA 4AMVA 3EEFA 3LKVA 1PUXA 3RHSA 5BRAA 1YFJA 3R7WB 3JAKB 3T9CA 4DMGA 7ICQA 3H0CA 1BVRA 4BVEA 5CX4A 1LQUA 2QNIA 3SQXA 4KVFA 4DDUA 1VBNA 4GEKA 2XOKD 1DHTA 3ZI0A 2PO5A 4X20B 3V7KA 3I23A 5AJXA 1QR2A 1JBQA 3NGXA 3DBRA 4U7GA 3CEJA 5F73A 3HKBA 4P54A 5EUQB 3F8WA 2GNOA 4IPTA 3OWHA 4B9MA 1KC3A 1JR2A 3O3CA 1SUAA 3K2EA 1VP3A 1NVXQ 1UDRA 2X76A 2YINC 3A9RA 4B31A 4HDQB 1WS6A 2WFLB 5H2FU 4XQ0A 2OO3A 3U7QA 2AC2A 4PFSA 1V7CA 3RG8A 1BX0A 1GZ3A 3I73A 4M04A 1O96B 2WUVA 5HFNA 3IXQA 2AJTA 3SE0A 4MUEA 3TBFA 1UBLS 1G5QA 5EYPB 4KR0A 2H7VA 4UJ5A 1S77D 1OB2A 1P7PA 2HBZA 1IOWA 1Y5NA 1J06A 2A5LA 3KDPA 1ST3A 3BBLA 5TQVA 4GWGA 2FWMX 2RGRA 3A2LA 5BNTA 1IWBB 4RZHA 2H31A 1IZ8A 3K0AA 2EV9A 3LFUA 2KIVA 1PR5A 4AN4A 2QI9C 1NF9A 2F7SA 2HV8A 3CB2A 4Z4QA 3O1LA 1CUGA 3QFRA 3Q2OA 2GZ2A 4UVDA 3NPMA 2YWJA 4KO3S 3KHHA 1U5CA 1DBIA 5IU6A 3SBDA 3I61A 3G5TA 3NTXA 5GAJA 2EJTA 5IBPA 4P9NA 1U1FA 2YB4A 2VJAA 1DSSG 4M60A 1WETA 1WDLA 3PT5A 4Q1EA 1W76A 5GJBA 1BYUA 4RK0A 4H7FA 1Y80A 2WSSA 5DB6A 4XIJA 2IF2A 2WDZA 1TXGA 3H5IA 5AUPB 4ED8A 4JHXA 4DR6B 5ICEA 5B4UA 4CR7A 4AMGA 2FX2A 4TYWA 1SULA 3WSTA 1ZOLA 3E5MA 1C0IA 5DM4A 5K8VA 3HQ4O 3SN6A 2VPTA 2RBGA 1EFPA 2YQZA 2GESA 3H5VA 2VH2A 1QCDA 9ABPA 5K01A 1J8FA 3DXXA 4C7VA 3DEHA 3V6KA 4EBFA 1XTZA 1FU8A 1NDHA 1KDTA 2OA0A 4D46A 4GL2A 3MBKA 1L7OA 3BF8A 3GHHA 4E51A 4DLXA 2XGMA 3R5XA 4JHLA 5IMBA 2FSGA 4CG1A 1NI3A 1YFZA 3RIXA 2WIAA 4B44A 1JQDA 3RGGA 1D03A 3R4VA 4UTVA 5SYNA 3MB5A 1NK4A 2X8LA 3EVFA 1GCUA 3L4BC 4C8NA 2LDXA 4X3OA 1JS1X 4OQ4A 1NG1A 5MDHA 1E5QA 2ZRQA 1V43A 2ZYRA 4IV8A 1JL3A 2RMKA 3MZ0A 3PR1A 4Y18A 2L2QA 4B73A 1U47A 2XCIA 4MUGA 2FMQA 4FYIA 6REQA 3OMLA 1WG8A 5JADA 2GO1A 1BDMA 1RRVA 2DQSA 2IYQA 5LZ4A 1CFJA 1QOQB 3R6TA 3PCRB 3PMLA 1UAGA 3MBIA 4RF5A 5K3OA 1J25A 3R9XB 3BCRA 2HIGA 4S05A 1P1RA 4KXYA 4MWSA 3RC8A 3U5TA 3RABA 3HXOA 4TT3D 1RNLA 3TCXB 3F2VA 1Y8RB 2ODNA 5GADl 4IF6A 3DLTA 2CDBA 1DUIA 1E2PA 4Z9FA 2PUWA 3WGJA 2ZUFA 5BY2A 3TMAA 2D06A 5KNDD 2GYUA 1GGMA 4M6WA 3TEFA 3UXPA 1N8TA 5B1DA 4LWQA 4PLTA 3BUSA 4DS4A 2ECFA 2JGFA 1L1EA 3KLMX 3SIRA 1F51E 3ANLA 2Y1CA 1URPA 4I6EA 2EFYA 1R88A 4L5BA 1UA1A 1YZKA 1XTJA 3FDZA 3HADA 1K7EB 2I0FA 4I9GA 2N0SA 5BOVA 3PNKA 2H1CA 2X2FA 1E1DA 1LRKA 2IUUA 1Z73A 3CG4A 1YQXA 1AZSC 3PFHA 1NL3A 2WNHA 2JHDA 1W94A 4B87A 4YA6A 1ZOOA 4UAGA 4XQGA 1U3UA 3LI2A 4PGXA 1B8PA 3FGZA 4JYPA 4UHCA 5COAA 2YHIB 3QE0A 1WZCA 2C9CA 2WQ6A 4Z6KA 5IC4A 4MV3A 3AESA 5KG3A 4UFOA 1CS4C 4B6OA 4X1KA 2EJUA 2JAHA 3WGIA 4MKHA 3KNZA 4QWAA 4TXJA 4QGBA 1QTIA 2O3TA 4PAOA 1TLLA 3TZLA 5TZVA 3V8MA 4HNVA 3QE2A 4HD8A 3OT4A 3UXEA 3VH4A 2I7TA 1D4ZA 2NQ8A 1EAYA 3JTMA 4D99A 4CQJA 1A9PA 1ECGA 5KMGA 4M2YA 4F5QA 2Y9TA 1M2NA 3THWA 2C0PA 2RC6A 3KAPA 3LHKA 4BLSA 1P3JA 1NP3A 2ATCA 4MX8A 2L69A 5LBUA 1ZI9A 1A98A 2X8JB 5BWCA 2BVNA 4ELUA 1E61A 3CVJA 2O0KA 3UXNA 2W4QA 1WV0A 2X13A 2FU5C 4OBXA 4WOJA 1SD2A 1WSAA 4FTWA 3FNGA 3ZBTA 3HABA 1XKTA 4EHFA 221PA 4WOKA 3NR2A 1GNRA 3TW6A 4O2RA 1W85B 2ZTUA 5BXQC 2WWFA 1LPNA 4YMTA 1W0KD 5THQA 1MRNA 1MKYA 2FWBA 2WJWA 2QXYA 5EJ9A 3SYNA