3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
b'SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted phosphatase, HAD family
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
3KBBA 5AI5A 1XVIA 4DWOA 5AW9A 5ALFA 1Z4PX 4XPZA 2MU2A 1ZD3A 1Q91A 2GHTA 4Y2UA 3W5CA 1L7OA 4NAVA 3PCTA 1L7PA 5ALMA 2CN1A 4UMFA 2W11A 1Z88A 2IA5A 5AVXA 4BNDB 1Y8AA 4I9GA 4KYTA 3D6JA 5ALEA 3KOOA 4ZEXA 3OCZA 1RLOA 4UMEA 4Y2VA 1SU4A 4QJBA 3ZX4A 3MC1A 2BY4A 3ET5A 3WKDA 3L0CA 3QX7A 3ZTWA 3FPSA 3NANA 5AI4A 4BBJA 4CE6A 4C4RA 1ZD4A 2G0AA 1T5TA 5AVQA 5AKIA 5ALNA 3ZI4A 2WFAA 5AW1A 3NAMA 1TJ3A 3WGVA 3ET4A 4BX2A 2B1QA 4HGNA 2AGVA 3A3YA 2G09A 2FI1A 4F72A 3L7YA 2OBBA 5AW3A 1ZOLA 3WK6A 1SWWA 2BDUA 3I76A 4FYPA 5ALVA 5AW5A 4FE3A 4Y2JA 2HX1A 4BEWA 1MH9A 5ALPA 2G06A 5ALXA 2FPWA 2R8ZA 1L8OA 4UAVA 3W5DA 3AR4A 2C8LA 2FUCA 2HF2A 1ZRNA 2EARA 5ALOA 2FPUA 2QYHA 4UMVA 3ZVNA 1RLMA 2ZBFA 5AVWA 2GO7A 3QU5A 5ALGA 4L6CA 2I34A 2JAOA 4CF5A 4EZEA 4C4SA 4EENA 2Q4TA 3CZ4A 1IWOA 4UMDA 2GHQA 3N8GA 4IG4A 2CFSA 1RQNA 2ZOSA 3RFUA 5AKGA 3ZWKA 1RC8A 3IRUA 3QU9A 2O9JA 2RB5A 2FPRA 1U02A 2EATA 2JGAA 4HGRA 4L57A 3SKXA 5AIAA 1TE2A 3TLMA 1U7OA 3GYGA 3OCUA 2IOHA 3E81A 3R09A 3L5KA 5AVZA 2GFHA 3L0BA 3QUTA 3A1EA 2YJ4A 5ALJA 3L8FA 2HEGA 3ZUPA 3OCYA 2RAVA 3EF1A 3N1UA 1L7MA 3L0YA 5A3QA 1KYTA 5AVUA 1SWVA 5ALKA 3A1CA 1AQ6A 5T41A 4PNHA 2HO4A 1O08A 4J03A 5AKEA 4ZEVA 4J2TA 3K1ZA 2G1AA 1RDFA 2HOQA 5AM5A 4H1WA 1ZJJA 5AVSA 3UM9A 5AK4A 1Z4NA 4RESA 2C4NA 4YIKA 5AW6A 4DW8A 3J7TA 4I9FA 3FGOA 2HSZA 2I6XA 2YY6A 1ZD5A 4KX5A 3AR9A 2WF9A 1Z4JA 3OTQA 5ALYA 2ODAA 1F5SA 2G80A 1Z4LA 3KC2A 1X42A 4AP9A 4UU1A 5IT4A 2Q4RA 3WKEA 3L1VA 4OFZA 4OD0A 3NALA 2NYVA 1U2SA 4AS2A 4DFDA 2P11A 1Z4MA 2R8EA 2YBDA 3L1UA 3IJ5A 3I28A 4Y2QA 4YH1A 5ALUA 2IOFA 3E8MA 4HGPA 3E58A 1WPGA 1RRCA 3QU2A 5A3SA 3A1DA 5FP0A 3WKBA 5AM2A 3U7GA 1TA0A 5AM4A 3U7EB 4CNQA 1ZS9A 3QU4A 2ZXEA 3ZVMA 4FFDA 1YMQA 4NV0A 4XOUA 2HCFA 3QGMA 4UATA 4B6JA 3PGVA 3KZXA 4G9BA 5ALLA 3WK9A 1Z4KA 4UU0A 3OPXA 5AM0A 5A3RA 3EPRA 3QXGA 1EK1A 5AIBA 3OCXA 3E84A 4CF4A 4HAIA 4BEVA 2I54A 2G07A 5IT0A 3ZU6A 1WVIA 4AS3A 3NRJA 2RARA 2C88A 2YMMA 2ZBEA 4XQ0A 2YMQA 1QYIA 4Y2SA 3ED5A 5AI6A 3SD7A 1RKQA 2B30A 3PDWA 1YV9A 1RPZA 3MPOA 3MN1A 4DCCA 1QQ6A 1EK2A 2B0CA 1NF2A 1TJ5A 1NRWA 4GIBA 3DNPA 3QUBA 5IS2A 2YJ5A 3B8EA 5AI0A 1Z4QA 4YGYA 2FDRA 3F9RA 2W4MA 1QQ7A 4Y2XA 3NIWA 4F71A 5AKJA 3N5KA 2NO5A 4HGQA 3HLTA 2WF5A 1RMQA 2FPXA 4EEKA 1QQ5A 5AHXA 1RLTA 3DDHA 3UMGA 2NO4A 2YMPA 5AM1A 2IYEA 5ALHA 4UARA 2YJ3A 5ALTA 4HGOA 2JAUA 4YCLA 2WF7A 2PKEA 4O8CA 5AKKA 3ZWDA 1J97A 4OCZA 1ZD2P 3IB6A 1S8OA 3AR8A 2AH5A 2W43A 1CR6A 4NWIA 4Y2YA 3ESRA 2WF8A 3QU7A 2P27A 2FPSA 5AI9A 3KD3A 4UM5A 1LVHA 4C4TA 1VFPA 3U13A 2FUEA 3SLRA 1U2TA 2QLTA 1YNSA 3R9KA 2YJ6A 3OCVA 3VAYA 4QQFA 5ALZA 2MU1A 5JJBA 3FPBA 3U19A 5ALIA 5AKLA 3WK8A 3NUQA 3N28A 3N07A 2X4DA 3I6BA 3EWIA 3ZW7A 1L7NA 4KN8A 4UASA 5AW2A 2MSNA 4KX3A 4IFTA 2FEAA 1TJ4A 5AK6A 3EF0A 2Q5EA 2EAUA 4G63A 4NFLA 2B82A 2OA0A 4RETA 5AI8A 2I7DA 2ZBGA 1RKVA 3QUQA 2C9MA 2P69A 3QNMA 2BDEA 2WM8A 4MUMA 4YIHA 3WKCA 5ALWA 2YN4A 1O03A 1FEZA 1VJ5A 3B9BA 3I1YA 2I33A 3AR5A 4E88A 1YJ5A 2PR7A 3BA6A 3QUCA 4JB3A 3W5BA 4Y2PA 2B1RA 3P96A 4NABA 1Z5GA 5ALDA 2HF7A 3U7FB 3AR2A 3HYCA 1N9KA 4L6AA 1WZCA 2B8JA 2HI0A 2CFRA 5E0OA 2R8YA 2ZBDA 4EX6A 2IOFK 2ZG6A 2AUTA 1JUDA 5AVTA 3NASA 3PGLA 4JDPA 2DQSA 1XPJA 3DV9A 1L6RA 3S6JA 4ZEWA 4GXTA 5AW7A 3QLEA 3RF6A 4Y2TA 5AKHA 2WHEA 1S2OA 1Z4OA 3M1YA 3B9RA 3WK7A 3KDPA 4KNVA 4BKMA 3WKAA 3MMZA 3UMCA 1YDFA 1ZRMA 5AK5A 1PW5A 3FZQA 3M9LA 2OYCA 2HHLA 2YMLA 1J8DA 1RQLA 2P9JA 3L8HA 5AKYA 3ZVLA 5AM3A 3L8EA 1N8NA 4BX0A 2VKQA 2GMWA 3SF0A 3SKYA 5AVYA 3W5AA 5AW0A 5ALSA 1YS9A 3OCWA 5AICA 3ONNA 4EX7A 2B8EA 1WR8A 1XP5A 5AW4A 3U26A 3ZX5A 2RBKA 2I55A 1T9ZA 1L8LA 3AR3A 3WGUA 3UMBA 1K1EA 1LTQA 4UM7A 1Z4IA 3QYPA 1CQZA 2D2VA 4CF3A 5ALRA 3AR6A 2YFYA 3FVVA 4UAUA 4BYGA 1RMTA 3SMVA 3DAOA 3CNHA 2OM6A 5ALQA 2JARA 3AR7A 1T5SA 4MWOA 4Y2RA 4YCNA 3BWVA 2AMYA 4OHFA 3ZTYA 2C8KA 3ESQA 5AVRA 4YCMA 2R8XA 5AVVA 5AKXA 3SHQA 1VJRA 1NNLA 3U7HB 3WK4A 2WF6A 1U7PA 4Y3UA 2JAWA 5AESA 4BNDA 3FM9A 2G08A 5AK3A 5AKZA 3R4CA 4UW9A 2CFTA 4KNWA 4XE5A 4EELA 1RMYA 1RKUA 1Z5UA 3WK5A 5AW8A 3L8GA 4HYTA 2PQ0A 4BX3A 2HDOA 1QH9A 2O2XA 1Q92A
chains in the Genus database with same CATH superfamily
3AB8A 1H6BA 2A1TR 4LHXA 4CDGA 5P21A 3NM6B 1GA6A 2C0QA 3OGUA 1VIVA 3HJHA 5JJLA 4K9LA 2R6GA 3QP9A 1H38A 4MQEB 2UXBB 3QYJA 4M2YA 4FT4A 2H65A 2YWEA 2B1IA 3I9NA 4NXNB 3A31A 2UYHA 3RB6A 3P71T 3IHKA 8ICMA 4X1KB 1VHQA 3ENWA 2EC5A 3MMPA 2B98A 4QICA 3E3MA 4XUCA 5G0WA 3QFCA 5AVWA 2J6HA 4GQBA 5DNCA 3V00A 2D5IA 3EZNA 2HIHA 1D2AA 3L82B 1ZOPA 1BXKA 1ATZA 3C5GA 1IWOA 2K4HA 1E61A 1TVEA 2ZOSA 4RFLA 4QBGB 2K89A 4BMDA 4LJ4A 4PVCA 3R09A 1IAVA 3JQFC 3B1XA 1FZQA 5DDMA 4X3PA 2X3FA 1YRAA 2JZBA 2AUNA 4IJ5A 3FCAA 3TOCA 2OK8A 2O50A 4L3VA 5DFAA 2V97A 3FVQA 2RDJA 1KVSA 2R1TB 1Z4JA 2Q2QA 3Q10A 1Z0KA 1LW7A 2GD2A 2J3DA 1QTMA 4UBMA 1OXSC 3AETA 4BN4A 5T5QA 1X3SA 2PJZA 3LUHA 2YZMA 2OHVA 1NX6A 5C1BA 3QVKA 1H6DA 1ZQZA 2ALJA 4EBDA 4C30A 2OCEA 2P9CA 1NVVQ 2HXSA 5CLJA 2GN4A 4UB8U 5HSGA 3HHEA 4CQLB 1W5BA 3CG4A 2R8BA 1KI6A 3HB4X 5JNSA 3I1IA 3MFIA 2REXB 4L73A 4XYGA 2HBZA 3PBKA 4AL4A 3S8EA 4J0QA 1RPTA 1BX3A 3NBAA 3PDWA 1R66A 2GBFA 4R64A 4P35A 1OUQA 4BRUA 1IOLA 5B4VA 5JARA 3CTMA 1VYUA 1N8KA 4PAWA 2HV8A 3VTZA 2JFPA 3B7PA 3L7MA 3HLTA 4AI6A 4X7PA 3DKPA 1XMOB 4E1BA 2IKQA 3R7SA 3KR0A 4XYEA 1W76A 5G2OA 1WDMA 2JLCA 3I61A 3NBFA 3DMYA 3GHYA 1E79A 4P92A 5JBQA 3FOFC 1O96B 4CGZA 4N5LA 3WLTA 2O8EB 2Z5GA 2V3WA 4JLKA 3FWNA 3DC7A 4M1KA 1X1TA 1INLA 4I4CA 3B3GA 2V5AA 5JAQA 2VA9A 3G79A 1QIEA 1IH8A 1CE8B 3U7RA 3BCRA 3VR2A 4IRDA 3NPAA 4HX9A 3TIVA 4DQXA 5DM60 3S1AB 4RKQA 3AU8A 2OV4A 3LQKA 4AMGA 1A8IA 1NOJA 3MRXA 3O1HB 2G1UA 4E51A 3GLFB 1PJQA 1UPUA 3RS5A 1X38A 1Q7CA 3EHDA 4KLQA 5FO1A 1F4PA 2AI1A 3TNLA 5LOVF 3ZGVA 2V9CA 5IYZF 3ETRA 3ZJ5A 4ED7A 2YFKA 1E99A 1C30A 1FDWA 1EESA 4FZVA 1AO3A 4J0CA 2ZJ3A 2WHEA 2QB0B 3FKSD 4O4IF 3D0QA 3IP4B 5DG8A 5ARDA 1Q7EA 4I2FA 3DEZA 3FLBA 4RQ1A 1L3BA 1U2DA 3A06A 2XCSB 2JFOA 4YCJA 5LZ9A 2D2VA 1TRHA 3V8MA 5C3UA 1XSPA 2PDAA 4W99A 3KEGA 3RC7A 4OSPA 2AF4C 2D8AA 4B1FA 4UQLA 1DGJA 3GP5A 3Q8QB 5LBTA 4ZAYA 3MB5A 1T6XA 3SHVA 3LY5A 3VNSA 4EQZA 1SV0C 3T3DA 2HBLA 2H2DA 1P44A 4S1PA 2P30A 2O2XA 2BFEB 4NL9A 3KU4A 1W88B 3W7AA 1ONNA 3ETEA 4LMAA 3SJ7A 2GEKA 1FK8A 4FKMA 1U0RA 3HB0A 4NXZA 5CT5A 1VJCA 1P2DA 2P2DA 4PHAA 4ZCPA 1KQPA 1QO0A 2I1QA 4BNNA 3P9RA 4BBAA 1PZGA 2WUDA 3QYAA 5H68A 3ET4A 4LNHA 4RQNA 1T1EA 4I9UA 4Y2JA 4JUBA 3LV8A 2BDTA 2P3LA 3T1YB 3KU1A 1VECA 1XVLA 2WHXA 2DPIA 3O83A 1Y89A 5IFLA 1FO4A 1T8YA 3JZAA 5FBVB 3PE6A 1IZ7A 1SXJE 2QTCA 4NBRA 3T3OA 3A6JA 2AQ8A 2PFOA 3JATB 3HKCB 2CVHA 4K9MA 4BVEA 4PGAA 5JECA 3PKJA 1MTOA 3BDAA 1ZJJA 3R6WA 1G41A 3THYB 1I1NA 4HYYA 4L72A 2O2CA 1P2BA 4QOFA 2A5DA 2F7SA 2MCFA 1Y8RA 3Q5DA 1X1CA 4RIFA 1HF3A 3FOAA 4RQUA 3B2NA 2YWRA 3RRMA 3SC6A 4AIIA 2EIHA 1IHPA 1XMSA 4Z53A 3G2JA 4U2KA 2JD2A 3Q0TA 4Y1FA 2RIRA 4EY3A 1JJ7A 4H77A 1VCHA 2G70A 4JOCA 1NI5A 5GM2A 2HSJA 2BH9A 4POOA 1SKMA 4EHDA 2RFLA 2E0IA 4MKRA 1A5AB 4EMUA 5GJVC 1NDHA 3LG2A 1B1CA 1SCNE 3PT9A 1TZBA 1XRQA 4R4JA 4EARA 3PYLA 5A0VA 3DTVA 2I5HA 4IDBA 3C8UA 1EP2B 4D02A 2J9YB 2R7MA 4UAJA 1T3HA 3IQEA 1KA9H 5DBEX 3FMVA 1EDBA 3QW2A 2Q3CA 2KK0A 4XTCS 4ZTZB 4ND1A 2J0QA 2WBLC 2FP4A 3UMGA 3LVQE 5CA0A 3WGNA 4H7DA 3G68A 1SQGA 4Y2GA 4D9CA 4BGIA 1QCDA 3ZCSA 2WIDA 4R2MA 4Z7JA 3SJCA 4Z3DA 1MVOA 4A6XA 1JPJA 1V1MA 5KG6A 1A9RA 1FZTA 3TZEA 1U2DC 1GD1O 4HAWA 1COOA 4V0OA 3U44B 1WIWA 1HFEL 1BA2A 3DOHA 4KO8A 4AYBC 1N9ZA 2ZCJA 4RV5A 3KE8A 3UQYS 5JJIA 1CJBA 3K15A 4RZIA 4ESEA 1YUMA 2G5GX 4KO1S 3NATA 5EIBC 5AWFC 2P5UA 5DNVA 3RJHA 1JALA 3P96A 3UN1A 3ALRA 1ZQLA 3FJOA 1OY1A 2ZTLA 4UOZA 4X1IB 3GBSA 2IIBA 3ZN2A 2R8YA 4NL9C 1C20A 4L27A 1UWKA 3CMCO 5L3VA 1JFFB 3DMTC 4HRYA 1YDGA 2XRYA 5IABA 3DV9A 1SRQA 1HKUA 3LECA 2WIJA 2Y0SF 2ZRKA 1NUPA 4BHTA 1ZK2A 2HMAA 2C4KA 3EGOA 2IYQA 2WJJA 4MK4A 3MGGA 8GPBA 5SZHB 3DM5A 1F6WA 4KSCA 4D6YA 4LXUA 1XPOA 4RK7A 2J4FA 2NTJA 4J0GA 2JGDA 4R84A 4U8HA 1SVUA 1UFQA 3F5MA 1DAGA 4OV6B 3S28A 3F98A 4RK4A 5DI9A 3K35A 5K4HA 5A7FA 1DC6A 2NVOA 1RHKA 5AVRA 4G8JA 3BH7A 3SAJA 2ECPA 2EP5A 4DADA 3E7FA 2E55A 3O8LA 3CFYA 5E38A 4X65B 4DQ0A 1FW6A 5HF8A 2IX9A 4D81A 1OUMA 1BVYF 4D9KA 5EE9A 5BV2P 4HPXB 2XTNA 3X2SA 1KIMA 1L5LA 4F06A 5FBLB 3IOCA 1Z2EA 1G5IA 2XOKA 3AEYA 4YAIA 4D8XA 2WFZA 5K5EA 5CCEA 3GD7A 4LF9B 1E66A 3GI1A 5JTIA 4OGGA 5ULLA 3G2NA 1UJ5A 3F46A 3DXYA 1Z35A 3BICA 4HPWA 4B17A 1CP3A 3DC2A 2HU5A 4B31A 4F4KA 1AQUA 5L7YA 2GM4A 4UUQA 4D7AA 1ISMA 1FP1D 2RG1A 2EARA 4DS4A 3PRKE 3CW8X 3SAHA 1ZZEA 2CXNA 2V6GA 1PVDA 1E2QA 4BN5A 1H0RA 4CLOA 4W7IA 4D46A 1VOTA 1J2YA 4IVRA 1ZVJA 3ZXIA 1ZU5A 3DDWA 4FYMA 4A4DA 1XX6A 1QWSA 4MDYA 1RXEA 1FX0B 2WDPA 3L0YA 3GXBA 2PUBA 1LKYA 3UT5B 4H59A 3Q3EA 3BXOA 1CUIA 3CH4B 4EEXA 3R7FA 4QPCA 3PHCA 2C83A 1R6TA 3OPNA 4OJNA 1VPWA 4L8VA 4KR9A 2KIVA 2IIVA 1FJGB 3NC4A 5BSMA 3A9CA 1LX7A 4BVFA 2BELA 2HRRA 2SKEA 3SQXA 3GFRA 4XYMA 3ZWVA 5L3SB 1HDXA 2JJ8A 1H3EA 5FI1B 1YU6A 2R1VA 5UKDA 4DA8A 4OQQA 4NH0A 4DNQA 2G9ZA 5FIUA 4TUPA 1DE0A 4CIAA 4KTQA 3F2IA 3RFXA 2DSTA 1FMJA 4ARUA 3IH5A 1WCIB 4EUEA 3AEVA 1E6LA 3DZJA 3IQZA 1W94A 821PA 2XGMA 1GR1A 3Q3VA 5LD2C 1U28C 5LDGA 1GUDA 3GRAA 4H7KA 4O1MA 2AG6A 2KLBA 2CXTA 2XLBA 1JWAB 4JEHA 1Z6GA 4O3PA 3F2BA 3V55A 2HVHA 3QJ5A 4U6PA 3I0NA 3O73A 1FS5A 2HT6A 2XVZA 4OFWA 2RAFA 1S3FA 2YHIA 4IKPA 1UK9A 3GLGA 3PUXA 5CR0A 2I9KA 1XLWA 3PFFA 1IU9A 3NVKI 3A9TA 3RK1A 2NO5A 2BJVA 2W2VA 1HURA 1T1IA 5IULC 1JE1A 3HFGA 2PZLA 3MGKA 3LO5A 1RW4A 2V0NA 2D00A 2P1ZA 4R2JA 4CR8A 2XVYA 1D4ZA 4P0PB 4C4PA 1RAHA 4U7FA 2CVOA 3OJEA 1NP3A 3H8VA 4RQAA 2X0IA 2GFQA 3ZBPA 3LNCA 3OVMA 4JN6B 3GLKA 3L6BA 4F2SA 3UGKA 1OI3A 2Q2OA 3EGWA 4Q7KA 3LH5A 1HY3A 3RODA 2W6QA 3KVNA 3SDZA 4NKRA 5IIMA 2LE0A 2Z8ZA 4YXWD 1OH8A 4RH3A 3CURA 5A6SA 3OTWA 2C2ZA 3AQ4A 1RI5A 5JD5A 2CLFB 1J0AA 5J5VA 2ZRHA 3VR6D 1SPBS 1U0NA 2OEPA 3CE9A 4YJHB 4ZXFA 2EZ9A 1WCNA 5DM1A 2V1UA 5KFVA 1GUAA 5EMNA 2HI0A 5ENVA 3ILXA 4AO6A 4IIVA 2IOFK 1LFAA 1XD8A 1ZAYA 1P1FA 1XE3A 2ZRGA 3T9EA 1RM0A 5FUVA 2L2QA 1FMTA 4KBGA 4OHWA 3GLSA 1QFJA 1ZJYA 4GI2A 4GFDA 8ABPA 2RH8A 2R4QA 3FUCA 3ESBA 5FUQA 4J0JA 2DKXA 2ABWA 1H2YA 5JNWA 1Q2UA 5DN9A 1M2JA 3BS7A 1OI4A 4KO3S 1HG0A 3QWHA 4EYSA 3G7NA 3A7DA 3S2EA 1UT8A 3EISA 3PZRA 2WP8J 4DMRA 1X8XA 1SXEA 4DOCA 1QE3A 1BZYA 4FBLA 1R12A 4B6PA 4EYOA 2AT1A 2OM6A 2O7NA 3U6BA 4I8XA 5G1OA 5FA6A 2PKXA 3FAKA 2AUMA 1X6VA 2FH5B 4WNYA 5FUXA 2DF4B 3B1JA 4IP0A 4DNOA 1UQVA 1YE3A 4UQPA 2TMYA 1P0CA 1GSHA 3QVMA 1GTL1 3FNIA 1DHRA 4K9NA 4MYHA 1JEYA 3DTTA 3INNA 5K8VA 3SEQA 1EA5A 1EIWA 3D5EA 4LNUA 1T24A 2IEYA 3PEEA 1AGPA 1E6CA 1HDEA 1XXHB 4BKRA 5BUCA 2FPOA 2Q3MA 5BSTA 3HR7A 3VU9A 4UNIA 1TTPB 4LA4A 2PS3A 4DR2B 1U7ZA 1XYYA 3FYUA 1LC0A 1Y8QA 3NWPA 4XUSA 1CRZA 4KI7A 4ZCLA 3C3KA 1JTEA 2RGEA 2R8HA 3C41J 1P4AA 3EEBA 3EB9A 1TK0A 1UCVA 1H94A 1XK6A 5AJHA 1JLHA 4FLEA 4B35A 3AGPA 2WILA 2E49A 4MR9A 1PJCA 3VR6H 1C1HA 3IRUA 1AKUA 2EJTA 4O4HF 4P31A 3OUTA 1LPPA 2XTJA 1G21E 4LV8B 5JCXA 1MAWA 2FAXA 2Z4SA 3ZY2A 3URMA 2IPLA 5E7JA 2LKYA 1OPRA 5H9WA 2POQX 3ADPA 1RWQA 5E3JA 4RGVA 3ZK8A 1JHVA 3PXEA 2ZI4A 1D1SA 4TMFA 3M3DA 4MFFA 1DIAA 2VBIA 3HKBA 2XYQA 1Q2XA 2HWYA 4YJ2B 3CRW1 4D3DA 3TN7A 1E0DA 2GZDA 1KRXA 2J1LA 4RIEA 1TLFA 1WD5A 2XDWA 1XA4A 1F12A 2UUAB 3BRWD 1ZC3A 3TVTA 4AWXA 2EF0A 3WG9A 1DI0A 1SH7A 5JROA 2I4OA 3QFFA 1ESDA 1HSOA 4Z4IA 3VO8A 3F8SA 1PNTA 2DE0X 1UOQA 3VR0A 4OLAA 2IDZA 1M3SA 2VYFA 5FPTA 1KC1A 5IZ4A 1U8UA 2NADA 1MJFA 4MJXA 2SECE 2AGOA 3D02A 1J0CA 1WDTA 3OEWA 5G4LA 5KX5A 5HE9A 2WF5A 2RCYA 1U7WA 2W22A 1J8YF 2KSOA 3DLPX 1YZYA 1EWRA 1G21B 1BS9A 3VVLA 4QPZA 5JHGB 1G8PA 3O4GA 4P3NA 1LNSA 4KXLA 1XMQB 2WF7A 1NXOA 1RWWA 2ANBA 3OMLA 4OQ4A 2GCNA 2JAQA 3EVNA 2XDQB 3H2KA 2WINI 2OBNA 5K3SA 5J2IA 2A1UB 1ESZA 3KEQA 3T3FA 3V6JA 1WAMA 5D3KA 2A1IA 2C04A 3T7AA 2VYQA 3UV3A 4LVNA 3AJAA 5IBRA 1COKA 3EY9A 5ALIA 5IC5A 3PSTA 5LKRA 4L75A 4QGAA 2A0WA 3TWOA 3FSJX 1XAGA 4RU9A 4WXYB 4X90A 5LQUA 4D3FA 4ZRNA 5F7ZA 1OXKB 4EGCB 3M8SA 4CQJA 1TPYA 2LWIA 3E8XA 3R3HA 4FK8A 4Y2PA 2Q62A 5ECGC 1MV8A 1X7ZA 2BFNA 1UA1A 2CDNA 3BHNA 4LDNA 1ECGA 3I1FA 3KPUA 1FFUA 3ZNNA 3EUB2 2FZKA 2CT8A 2QW8A 2ZG6A 5E6UB 1ZN2A 4EG3A 2I9GA 2R00A 6Q21A 5DLDA 1B7GO 3GBVA 5TMBA 4C8NA 1Z7BA 3LYUA 4NJMB 2IV7A 2F77X 2VPPA 2CV0A 4PC7A 3MR5A 1WHTA 5FV7A 3COYA 2DUNA 1QVVA 4MEBA 2YY5A 2RHHA 5FEUA 3DMGA 2R97A 3R6DA 1SB8A 3DM9B 1M1XB 2RI6A 3FYUC 2Q0QA 1QRAA 4HUQA 4P4MA 4IEEA 1Z4IA 3C1AA 1LTKA 2O0HA 1AA9A 3VA7A 1PQWA 2WEKA 3I0ZA 1WXHA 1H8HA 5E6SA 4Z9AA 2RGDA 4DSOA 1P4GA 2A14A 2I2AA 3A6HA 7ICFA 4LC9A 4EY4A 4ERNA 1GXSB 3KELA 3VU3A 4PZCA 4K6MA 5JO0A 3IB3A 8ICWA 3SYRA 1FVFA 1HV8A 5BOSB 1TOAA 4BX3A 1Z63A 2BCSA 2QU8A 2B3DA 3GCWA 5KJ6A 4NDZA 2I62A 2CBXA 4R1OA 3CJRA 1KI4A 4MPRA 4H3KB 1GIAA 1ZGGA 2A4MA 3NAGA 1X14A 1EX1A 2Z58A 4QBFA 4DT1B 3M4XA 1VL5A 3L0IB 3NAMA 4EW2A 2VWPA 4QUGA 4KPYA 2Q46A 1Q0UA 5BR4A 1GQYA 2I9PA 3ZQ4A 3C2KA 2HX1A 2O8CB 2CYCA 3G3EA 4HB0A 4XTRA 2XT0A 1UC8A 5ALOA 1VL0A 4D99A 4OI2A 2WFLA 1D2HA 2QTZA 1FU4A 3OLWA 2XUFA 2OAGA 3BIOA 3TAXA 2JHGA 2XWQA 3SOPA 1ULSA 2IL1A 1Q0LA 4C21A 5DGIA 1JG7A 1QFYA 4ZJZA 3ILYA 3VTAA 3HBAA 1KMQA 2OCPA 4IRKA 4B33A 2CNNA 2WU8A 4A2CA 1L5VA 5BVGA 4MR7B 1VPDA 3K5HA 2OLJA 3IAS6 3M7DA 1T8SA 2MINA 2CE2X 4J03A 2WOOA 3MCTA 4DCNA 3KYDB 2QVLA 1QIFA 1IXKA 4PIPA 4PS1A 4YRIA 3HE3A 5INTA 4BGUA 1NNUA 2J0VA 4M83A 1VHTA 2OKGA 4BZXA 3PTAA 2KB0A 1KU0A 1QYVA 2PS9A 3FMPB 2WIBA 4Q3BA 4NEQA 3LM8A 4A6PA 4ZRMA 3SXUB 4BO1A 4GW3A 4D9FA 1FVHA 4KN7A 3FI9A 4MKZA 3MZ0A 1CUAA 4MYRA 5CEJA 2A1TS 4QM6A 1OBOA 1GZHB 1YC2A 2I99A 4R1MA 5CFMA 2IUUA 5T14A 7ADHA 3UOGA 1TZKA 3ANLA 4HAIA 1AJEA 1VC2A 1FBNA 4R5MA 4AJOA 1KXZA 2IW3A 3L4PA 2YL2A 3QQPA 2Y8EA 1QVZA 3MIIA 4RV4A 5E1DA 4BJ3A 2QQFA 3NRZA 4G6ZA 3N8HA 5JCPA 1NUAA 2GKOA 2CL0X 1OBHA 3M3HA 1ESNA 2FMQA 3GT4A 3FN4A 3OLCX 2QT0A 5CUQA 2GM9A 4FNGA 3OZUA 5A5EA 2WJWA 1QKKA 3VVMA 4K87A 2HADA 4ZZ1A 4N39A 1IWBB 4H1HA 8ICCA 3KZOA 3NUZA 2HYIC 3WGKA 2NQ2C 1ZUWA 1AROP 4AUKA 2Y92A 4P9NA 5K0LA 4GNKA 4K2AA 3PC8C 2X4DA 4P4SA 2AJQA 1PR9A 4GZ3A 3TLKA 1Z82A 1U1FA 3I6YA 4Z2YA 4QULA 2UVPB 1CJUC 4YRQA 1F4LA 2QQ0A 1N2IA 5SY6A 4KLCA 2FMPA 2Q4BA 3SV4A 2C00A 1YIOA 2Y1CA 3F4BA 3VNBA 2X7XA 2FPLA 3BQMB 2PH5A 2GVZC 3V2IA 1SU6A 1E4EA 3QX9A 4P53A 2QBYB 5BYJA 3QXSA 2IK8A 4Z1MA 1ZMTA 3AXSA 4QZCA 4G86A 4Y2TA 4IHAA 3LT1A 4DKJA 1EJ6A 1N1DA 2WMOB 5BMOA 2FPPA 3DLTA 4PN3A 1L3CA 4P8RA 2V8OA 3B60A 1SIOA 2A19A 3ONWA 4FLFA 3B1WA 4HVLA 1E2JA 5IUKC 3BJEA 1RMTA 4K03A 1CDOA 2BFPA 3OLYA 3S7TA 1C81A 2C8KA 8ICAA 4ISBA 2H1CA 4LJ8A 5AYVA 3ZK7A 1VLJA 4Y98A 3F3MA 3TRJA 3N2GA 1PQUA 2WYOA 2G28A 3MFYA 5DTJA 3P26A 3RRHA 1NLZA 5T57A 5DBGA 1JKXA 5EHIA 1K7EB 1VDMA 2CLSA 3WXMA 3HXKA 2P62A 4DLGA 2QSUA 7ICSA 3PNMA 2CMFA 2QRPA 2JH7A 1OW3B 1NULA 3PQ5A 2BY4A 4BYMA 2IQ5A 4TXHA 4U7CA 4IGEA 5AJZA 1I0LA 2FI1A 2O14A 1Y9JA 2IFTA 2VH5R 2RGNA 1W36C 1YRBA 4BVBA 1QJCA 4B3CA 4TRRA 3OOHA 3PQ3A 1L7XA 2ZQYA 1KMIY 1V4NA 1Y1RA 3WICA 4ZT2A 5BWOA 4OJKA 4TUYF 4Q43A 3MTGA 1NV8A 4JLAA 2OMEA 4DY6A 1ND6A 4OP1A 4DZZA 4RSMA 1UL1X 1T6ZA 3ZU2A 5A4KA 3KHGA 4EPRA 1B8OA 1JDZA 4BE9A 1NYQA 5DEOA 5AVZA 4D4JA 1FUIA 2HEGA 4D3ZA 3DWIA 2C82A 2H2GA 1XCGB 1ZJWA 5B3AA 2YOFA 3MGVA 1E3IA 1O08A 3V7NA 1R4MB 1U8EA 1D1PA 3GIJA 1LV5A 1QZTA 1SZJG 1XZGA 4CF6A 5AVSA 2LBOA 5BVHA 4ZA2A 2Z56A 5JWOA 3J7TA 2XB4A 3BWCA 2QPAA 1J9ZA 4ZV4A 4LQ4A 4P5PA 3B6ZA 1MN8A 1Z0FA 2XT6A 1SEVA 2P11A 2VHZA 4OAOA 3THWA 3T5TA 2VXOA 1CV2A 2DBYA 4MX8A 4NPAA 3NJRA 2I0FA 5FP0A 1M0SA 1MJGM 4HV4A 1TVAA 2DAPA 4P54A 2X6QA 2JLRA 4MINA 1QP7A 3B53X 3EZ7A 4AZ0A 4NLBA 3U48A 3EX7C 2CF5A 5TGZA 1HO3A 1RZ3A 2CMKA 1UINA 3DQPA 4ZCQA 1JHAA 3JVDA 3OUZA 5C5JA 5DT9A 5EP1A 3C5CA 5SZKB 2I65A 2QRUA 4DF4A 4DBZA 1Q15A 2F00A 3T7EA 3KUKA 2GS9A 3DMNA 1Z1VA 1YL6A 1Y6JA 3EXFA 4AD8A 4LDAA 4KVAA 4BE4A 1N7HA 2E3JA 4JENA 3CX7A 2BBSA 4R1PA 3SSNA 1SULA 1RYEA 5JQWA 3LK9A 3QZUA 1OYYA 2FUKA 3GL9A 3TSAA 4PG4A 2E5LB 4OMFG 1DPGA 2XIJA 4OGKA 5EOVA 1YB2A 3DJYA 1H8ED 5DYYA 2P5TB 4GBMA 1KI1A 3UK7A 2PTGA 2I8CA 4FFBB 2NTYC 3RM3A 1M1YA 4NZNA 1YACA 2B36A 3OHAA 3QEAZ 1XT6A 2EGUA 1XKQA 3WMWA 5BXYA 4ZQIA 3WDMA 4CKYA 5LMNB 1YQXA 2P6RA 4NABA 3DXZA 2W54A 2YRXA 2WVJA 4BX9A 4EG1A 3UJPA 2IYRA 3AX6A 1R0BA 3RGGA 4E08A 2VJKA 1ENZA 3LCCA 2X0FA 4GXTA 4H0FA 1PWHA 4F0JA 4JA2A 2YW2A 3KRTA 4RKYA 2ADFA 2NTVA 3PV0A 2QN9A 1LPNA 4N12A 1CEEA 3HB7A 3PYMA 3ELWA 4I8DA 4L9WA 1SBZA 3X1ZA 2VDPB 3EZ6A 2F1KA 4HDKA 3VZCA 3N3AC 1J25A 3N2ZB 2WV9A 2H7VA 3BWVA 3BZCA 3A4LA 3V1TC 1II0A 5F1YA 3KFXA 2CRXA 1IY1A 4J94A 1V6AA 3DSRA 1OGJA 2P5SA 4I2IA 1S7GA 2W04A 3UY4A 4KW7A 2RJNA 3W8EA 3HYSA 5K0ZA 2DECA 3T9CA 1T1RA 4O4IA 5K2MA 3K09C 1BDMA 4J9KA 5HZHA 1EXNA 3LWMA 3RFAA 2ZYTX 4ZMBA 2DTXA 1ZKDA 3LT5A 4OQLA 2C4TA 1RJ9B 4X94A 4GWKA 5DCUA 4IV8A 1JH8A 4F9EA 1YOVA 2QRMA 1WWUA 2O8FB 5FCDA 4BBJA 1F3OA 1FFDA 1E1LA 1JV2B 2N75A 2J08A 2JHPA 5BOVA 1RM4A 4DCJA 1QAQA 3OZGA 1NUTA 5AW5A 4RDIA 3IT0A 3M8RA 4DDVA 3VKFA 4LYAA 4BRSA 4RW0A 3WZ2A 4NLLA 4UAVA 3KXLA 1QH1A 3FETA 2XF8A 4O4LF 4JLMA 4BP3A 2VANA 1HZJA 4KREA 2ZIUB 3LZCA 4FEGA 5CT4A 1X70A 1VGVA 3UHOA 3DFIA 4EFDA 5L1JA 4JVOA 3G6WA 5EHNA 2YWJA 3U7QB 3H9GA 4KIWA 3TTSA 2BFCB 2EEZA 1VI5A 2H2HA 2RK4A 4XIJA 3ZWKA 3E22A 5CBPA 3NONA 4OI4A 4LY9A 3QBTA 5LNK6 4LCEA 3FBTA 2P67A 3BFVA 4PSDA 1DZIA 2IYNA 3AONB 4GBED 4O0MA 3TLJA 3TXYA 1MXFA 4EHLA 4QVGA 3EMKA 1II8A 1WX1A 2ODWA 3UFBA 1YFJA 9ICOA 1ADYA 2WWGA 4FBUA 4R7TA 1WZNA 4K5QA 1P81A 1OFTA 5K0EA 4GR5A 4JQOA 3BTUA 4I1SA 1N56A 3ACCA 2W9MA 5J2CA 3LHDA 4DR1B 5K3AA 4OFZA 2BR4A 4L8GA 4AS2A 4H4EA 5ETJA 3LPLA 4RZRA 1Z73A 1L5HA 3WLPA 5JYCA 4I50F 2QY6A 1Y9AA 4UOEA 1YB6A 3OLVA 4XM1A 5BSWA 1JKJA 1Y3IA 1NK5A 3IMFA 3M9NB 2FR0A 4F97A 3GFKB 2GCOB 3O8OB 3ND9A 3K72B 4UATA 4F11A 1TTTA 3RU7A 5BW4A 2JKYA 2H3IA 1ADFA 3HUTA 1E9VA 3JW8A 1Z1BA 8ICFA 1M6HA 3C8MA 2I3AA 3SYKA 3LPAA 1WOMA 4RKRA 4HN9A 4N7RA 2B30A 3KQVA 2O48X 4FNOA 1NF2A 2YVLA 5K0NA 1K4KA 1BVHA 2WQ7A 2J5QA 4BX9C 2B99A 2I2CA 2ZUEA 5DXJA 2XQKA 3BB3A 2YDYA 3IYLW 1X9IA 1KQNA 1QX4A 2OCGA 1RLTA 2KBFA 2I6QA 2GJ9A 2YJ3A 2HSGA 3EEOA 3RRYA 5B37A 2Q5JA 4WXPA 3PJDA 2JIBA 1P1IA 3CV3A 3PR2B 4MI9A 4PZZA 4OFBA 1L3SA 3IT3A 3ESRA 4OUKX 5LUBA 3NBMA 1Q3VA 3FOZA 2AMJA 1JIXA 5ITVA 1G2OA 1RI3A 1U8ZA 3UK6A 5ESXA 1FUYB 2QPTA 2IP1A 1C7QA 1ONBA 5F98A 3S99A 3R5XA 1BMDA 2W4IA 2I4IA 1VBKA 4CUKA 4ZMSA 3OZFA 3VYSB 3BL6A 2FZ5A 4R01A 4YO8A 2IYXA 3EVBA 4XQ8A 3RHTA 2PA3A 2H7XA 4EF4A 3GD5A 2PQ2A 4FUQA 3W34A 5AUPB 3NW9A 1NK9A 3FMFA 3R9WA 1SHKA 2G88A 4X5OA 2H57A 1JDBC 4R0MA 4MI1A 3PENA 3HG7A 3CW2A 4I81A 2CFIA 4NP6A 1F3LA 1B2RA 4J76A 3IAUA 1U0EA 3G6XA 3N0WA 1OD6A 5FYQA 3B1FA 3WK7A 2GK4A 2YZ2A 1OBFO 3ZU3A 4F3YA 1VBNA 4NAHA 4GMHA 2KFZA 1Z6TA 1GTSA 1Q12A 3ZVLA 1MT3A 1SBYA 5FUMA 1CUJA 4L4XA 1TIKA 2TMDA 1GL7A 3TEMA 1HTWA 5CTAA 4DYDA 3VPGA 4BV9A 2OP0A 1VI2A 3LP6A 1UPTA 1U7PA 4AULA 3ZBTA 2Q6KA 2HMXA 2HIGA 1R18A 5D01A 5GGYA 5SYMA 1W2GA 2F4NA 1GL3A 4O3NA 1SVLA 1KR5A 1COZA 3M6IA 5EMKA 3G8CA 3ICQB 1J2RA 2G3YA 5A1JA 2WYWA 5TS2A 4KXMA 3BZWA 4M3NA 1T8PA 2C1XA 3S40A 3ZE7A 2Q3LA 3ET5A 5EE5B 3RC8A 1E2NA 4HDMA 3I04A 1ILWA 3WSWA 3OJ0A 2DUYA 3RFVA 5AQ1A 5I48A 1PT8A 5DGBA 1AHPA 5JDIA 3KR2A 5AW3A 5CW1A 4BJ5A 2LIPA 2NVWA 2CEKA 3I4LA 1XZHA 3SIXA 3VSBA 1L3VA 1CUSA 2O6HA 4MW9A 4NE7A 3TK1A 3ZGOA 3V32A 4RK0A 2V03A 2YDXA 4DRZA 8ICUA 1S76D 5DYTA 1YJQA 1O57A 1QP0A 3HCOA 4ZN6A 1FSGA 1SQSA 4DQSA 3PMLA 5C81A 4ND3A 1QVAA 5HR6A 1IYZA 3GYGA 5EP2A 3SICE 4LYHA 4A0SA 3LIIA 2JGIA 1ULTA 2CF6A 2ZI5A 3C5WP 2O2HA 1RAIA 4HYKA 4D6PA 1PT5A 4IG9A 5GMOA 2JI7A 1U80A 1ZLXA 1XTJA 3LPNA 4Q9KA 4N7MA 1M8FA 3W8DA 4R05A 4HATA 1GZ6A 1L5RA 1QF6A 3N86A 4D0RA 3ETNA 1V41E 1X1AA 2ZVDA 3JWPA 5L95A 5DV9A 3RD5A 4GDFA 3U9TA 2QAGA 1USUA 5DOZA 4AMYA 2XI9A 5ES3A 2IZ0A 1SK9A 5FNVA 2QZSA 4DR6B 1EJ2A 3FF4A 4BBPA 3CC8A 1YRWA 1I7SB 1SHUX 3BQ0A 2NUAB 3BMOB 4FFDA 5KFLA 2BHRA 5L3QB 4YRLA 3H17A 5H5JA 4UB5A 2AS0A 4JBNA 5ALLA 2QNRA 4CCYB 3RS3A 3DZIA 2Z2KA 5JZSA 2BCRA 4DVGA 3LUFA 1CQIB 1ADJA 2NTEA 3HRIA 5J2JA 5AI6A 3K0CA 3M6ZA 1FIUA 1LCIA 5BN5A 2B0JA 4O3OA 2B2XA 4G41A 4TRJA 3CW2C 4FO6A 2ZAGA 2WSIA 1IBMB 1GLNA 1Y3AA 2XPCA 3O8RA 1N3IA 3CG0A 1ZQIA 4CV2A 1PUJA 1J90A 5KMGA 5G3YA 5LIRA 2Q5FA 5HCIA 3JVUA 4EB6A 3NM5A 3KQKA 1QZUA 4OK3A 3BQ7A 3DFZA 4RQ2A 1RKBA 2GEDA 2OFPA 2VUHB 1YNSA 2FG7C 2B4RO 4L4YA 3IKVA 5K8JB 5EIXA 2R48A 5AUOB 1DBSA 4EJSB 4O6VA 5FPKA 5IW8A 4ITVA 1H5NA 8ICOA 1AUOA 1EJBA 4NIMA 3AG6A 2KLHA 1T5HX 3MJVA 2D54A 2ZUVA 2B1RA 3K1YA 2IT1A 1KEUA 3G02A 4KE6A 2DG2A 3RAFC 1MPTA 4IFEA 5EYPA 1YRYE 5D87A 2P9BA 4EX6A 1ZQ1A 1HE5A 2N1BA 4LF7B 3MJCA 2E5WA 1A5TA 4B4OA 4K2HA 1I2AA 2BHSA 1Q46A 1PGPA 2C57A 4YA6A 2PXHA 1U2ZA 1QP4A 1J70A 3C2MA 1RQXA 1KFCB 3GAMA 2HOIA 5BNWA 3MYRA 1NSFA 2OSVA 5CYGA 4HNAB 3MUEA 4CWAA 3W5HA 2H0AA 1N0WA 2ZSBA 1R6UA 3K53A 1GCUA 4KHZA 3QJYA 3VNVA 2IYFA 2JI9A 4OJLA 1S8AA 2QN7A 3G7UA 3AJ9A 2JAWA 5I5EA 3CNNA 3LHFA 4Q7QA 1A2QA 4KN4A 2HOFA 4HRXA 2GPYA 2C3OA 5BRJA 2QD2A 5JLAA 1R3DA 3ZIAD 4Q03A 4E46A 4LYYA 4U9IS 1MB9A 2Z2YA 2VTBB 5AH0A 3LOQA 2IVZA 3QVSA 4MYUA 1ZQMA 4ZO7A 2QAGC 3D3WA 1JMSA 1N5JA 3OIYA 5E7MA 4URXR 3ORQA 1TJPB 3I2GA 4PZ9A 1JN3A 3HNOA 2I3GA 2QMZA 3SHFA 2QL6A 3QENA 2C8LA 4R7GA 1N33B 4WFIA 3SR6A 1OJLA 3ZWCA 3U3JA 4QO7A 2PWZA 3VC8A 2JAOA 2XNHA 1BMFA 4KH0A 4CLHA 1EVEA 3CKYA 4EENA 3RO7A 2BPGA 2HD4A 3NNNA 2C58A 4IDQA 4U0JA 5A4AA 4Q9JA 3QMVA 3ZWQA 3ESCA 2D4HA 2YVKA 4E5DA 2O2JA 3ZLVA 2COKA 1CVIA 4WACA 5ICEA 1L8QA 1SXJB 4ED8A 4I5EA 4GLFA 4RMHA 4JI5B 4Z9BA 1Y6QA 5EE1A 4IVQA 2CLCX 1NBEA 1ZEJA 5JBNA 5AVUA 2HVIA 2ZM6B 2X6TA 2QRGA 5T64A 4BQOA 2EFCB 5KTOA 4EDFA 5A5FA 4PL1A 1PG5A 2NRVA 1M34E 2ID7A 2VZ9A 3GU3A 2F59A 4L9AA 3G0HA 1G3QA 4NHEA 4E21A 5ADUS 2W55A 3F4KA 3CH6A 4IY1A 1TA0A 3P5BA 3CJTA 4U2BA 2XZOA 3AFMA 4O4HA 4I08A 1EP3B 3TTWA 2Z8YM 3NUGA 5M2QA 5EOZA 3RYCA 1UK7A 3OM8A 1AO0A 5EWLA 1JBQA 3W9BA 3H99A 1L4EA 2OENG 2QAJA 3QELB 4EHFA 3EIEA 2OORA 3SD7A 3ZXSA 4MV5A 3GWGA 1CY7A 4RPYA 4N0DA 2AKEA 4DBLC 5ELXA 4DV7B 1JL3A 5M3BA 3BDPA 3KT0A 2W2LD 2NP6A 2KKPA 4EEKA 3HWTA 4JXZA 4YT4A 4UARA 1TCUA 1SQ5A 1YL5A 1EK5A 3M2TA 4G0NA 4FJ2A 2F3QA 5HE8A 1UPBA 5CH3A 3PB3A 3HDTA 1P73A 5CITA 3QE0A 5FV4A 1M34B 4AF8A 4QFDA 3FPJA 4GPZA 3DCNA 2A94A 4JGGA 3HCFA 1Z5VA 2BZFA 2C2MA 2PT6A 1OU4A 3FCCA 3QRWA 4GECA 4ER3A 4KR2A 1XJWA 5JS1A 4HQ0A 4Q4AA 2AHRA 2YX1A 4DUZB 3S2IA 5K1ZA 3EG9A 1OXTA 2ZBDA 4OHMA 5FBWB 4CMIB 1QDLB 2BMFA 3BEOA 4PLFA 1CZLA 5DYGA 3EFOB 1LTHR 3R0IA 5GP1A 1BYUA 3KZKA 3VZDA 1QH8A 2EQYA 1FTQA 1FC0A 3RB8A 4N48A 5HGXA 2W98A 1D4OA 2YIJA 2C94A 3MMZA 3GUYA 3EY4A 2FWBA 4EYHB 1IPFA 2PD4A 3EWSA 2YVQA 3LFUA 2NP7A 1V8PA 1XU9A 3VPSA 3OFSA 3O9MA 3NOQA 3LU1A 4M86A 2X9QA 3ZQJA 2FRVA 1U94A 2ES6A 1ML4A 2C28A 4B6RA 2G36A 4WOBA 1SXGA 2HCBA 4YCMA 2R8XA 1X7GA 3B3FA 4EF6A 2GN1A 1LUAA 4LZOA 3LQQA 3MQ2A 2V7WA 3HZZA 5BSVA 4MWSA 1V3UA 2Y1OA 2XY7A 4L5CA 4F4XA 4P38A 3REFA 1POWA 3IV7A 1WTAA 4F5YA 5CXUA 2PV7A 4F2HA 1DT5A 1KJ8A 1T5IA 5DB6A 4NNJA 3AHIA 3QWIA 1ZQNA 1V37A 1Z2DA 2YQ5A 1N2JA 9ICUA 5CX1A 3QQ5A 2ZU6A 2VJMB 2EG5A 2NVUB 4MSUA 4F92B 5GPBA 5ENDA 1SVWA 4PPXA 4YDRA 4MVJH 4HT3B 3KEOA 1VSUA 1TCAA 4D44A 2QN3A 5DNYB 1FLNA 3PDJA 4M46A 2J33A 2P2SA 1PT9A 5GIOE 1G18A 4DVJA 1ARZA 3ZCTA 3N8KA 4LECA 1NQ5A 1CRQA 4C6TA 1QE0A 4I2AA 3BAZA 3FKJA 2HA3A 4A0GA 2HJ9A 4XB1A 3CISA 3ZTTA 3LKZA 1Z13A 1RACA 1N2SA 2C20A 4OM8A 4B4VA 2B2CA 3Q1KA 1BHSA 3CF2A 1Y5LA 2VA2A 3N3BC 1E7YA 1U2GA 1OLSA 3HMKA 4QGSA 1XVUA 1YQUA 3EC1A 1Q95A 3RC3A 4DSEA 1E2PA 4LXGA 5JC1A 1IIBA 2F4VB 5FOXA 3RTAA 1ZIPA 3CCFA 1YZVA 4FBTA 4OQFA 3HFRA 1CR4A 4C7ZA 1Z4MA 1ETUA 3AEQB 4FGWA 4MPJA 2ZFUA 4P2GA 4R8SA 4G07A 3EPPA 2UYCA 1H05A 2C4WA 3QOYA 1LLDA 4KYVA 2KV2A 4TWZA 4IR1A 1RYYA 5IMBA 4QZFA 3SNHA 4KLLA 3W9UA 4GXQA 4G0VA 4WDRA 1KDVA 4NM1A 4FW9A 2F76X 5FRDA 5L51A 4M76B 2XDAA 1JEAA 5H9VA 2DGDA 3BD7A 3ED5A 4RQ5A 3MN1A 4DCCA 1C3XA 2UKDA 3ZCVA 4PRYA 5F3XB 2CFOA 5EJ8A 1G7TA 2EKPA 2R25B 5KNIA 2W9CA 4OUDA 3Q7IA 5KSOA 3F7OA 5KVAA 2RONA 1DFGA 2XC9A 2M2IA 2NO4A 5FLYA 5F35A 3TXAA 1LZLA 4IIJB 1JKMA 4FOPA 4OREX 2Z57A 2PCLA 4QNNA 4K7JA 3IDFA 4HH4A 2JD1A 3GGDA 4ZOHC 1VCMA 3UK1A 3GEGA 5C5DA 2KJ5A 3BMNA 4XRGA 1U47A 4X85A 1WXEA 5JHHB 3AP1A 4MJ3A 4M0LA 3U19A 4V0LA 3SZ3A 1AM4D 3WO0A 3UWPA 2PFGA 4DB4A 3SBOA 1P33A 4L9RA 2E37A 1Y80A 4AXBA 1JECA 2QR5A 4GVPA 4ML3A 2WJ3A 1ZQXA 2P4UA 4ZZ0A 4YAUA 5F52A 1VMIA 3PPIA 3A9WA 2PZFA 1PZHA 5DRYA 1HI9A 5LQMA 1JT2A 2PLAA 1DFIA 1OTHA 3VCBA 1Y1PA 1MVNA 1ZJ5A 1F2TB 3NFRA 5KFJA 5TGTA 1QMGA 5CM8B 1EDEA 3M6WA 4S2EA 3W4IA 1U0BB 2XMCA 1CR0A 3OIVA 1N2GA 5KL8B 2EKBA 1YS1X 4ETNA 1VP3A 4QXQA 3LHIA 3QXXA 1AN0A 3PR1A 4LIPD 4TQ9A 5KFFA 1GUYA 1G9TA 1XJQA 5DSXA 4ENVA 2N42A 1HEIA 4PHEA 3WLFA 3KKOA 4XX0B 2IDMA 4CR7A 4F4IA 3IUPA 4KLTA 2VKTA 1L4HA 4FYXA 1HT2E 5DYIA 2J6IA 3EXIB 3DWEX 1LDYA 1AGYA 4MVJE 4X6YA 1IN1A 1DP4A 1RXYA 3W2IA 5EC8A 3EGXA 3MGIA 1CZNA 1GNLA 3O4IA 4F56A 4R69A 3NHKA 1ZIDA 1S9HA 4P7FA 1O0BA 4OQYA 1XVIA 4R8MA 1U2GC 4UBKA 4IH4A 4JSYA 3GPIA 4DR3B 1KJNA 3GLHE 4KYTA 4FQ8A 5EKSA 1V8FA 3GH3A 2B9VA 4LJYA 3ZX4A 2HRZA 1U7UA 4O33A 2C5EA 4ZICA 4NMLA 3TNDA 1NU6A 1Z2PX 1H1LB 3DZGA 4H4DA 4G5QA 4YR3A 1SRRA 4GOLD 2XA9A 5F3RA 1T34A 1Y33E 3NS7A 3WNVA 3SC4A 2BLLA 4CN8A 3PRYA 4MQ6A 4EYGA 1H2FA 3BFJA 1G5QA 3OE4A 4EZEA 3ABSB 5BN3B 5KS2A 1ZQEA 4MA5A 1PFWA 3WQSB 3PLNA 1IBSA 9ATCA 1TAGA 4GPEA 4RCZA 2O9JA 3IEPA 3RSQA 3TLMA 3L7KA 4LQCA 4YFKA 4P4UA 1LI5A 2GFHA 4TKVB 4DM7A 3CLVA 4GX1A 4MDFA 1JS1X 2WG0A 4O3SA 2OOSA 5JXHA 2NSDA 5ARBA 2FQWA 2ZYUX 1U2QA 1E7RA 3BORA 3E70C 3IBYA 3Q8SB 3GIMA 3H5NA 2YY6A 2R4UA 1XNJA 3KKKA 1APBA 5JJ5A 1NUHA 1VP9A 4ITRC 1JBEA 1SQFA 3SLGA 2JGLA 3NTVA 1PV2A 3ND7A 2AR0A 3A2MA 3M70A 4B7CA 3IAHA 2Y0CA 2WHRA 4JJGA 4CMJA 2VBCA 4LC1A 3AU2A 3KZXA 1V3VA 4JU9A 5LWQA 3K7EA 3H8JA 3CF6R 1ZSVA 2NGRA 3IBFA 2ZRLA 5CK4A 3E03A 3THXB 1UFRA 4Q9AA 3IDAA 3NHAA 2QSJA 1GA4A 4XAQA 1E8NA 1PTKA 1GL9B 4L28A 3SQNA 3OT1A 4EHBA 4P3YA 4J3JA 2KEYA 1KZ6A 1MB4A 4WBNA 1GAQA 5AKJA 1P5FA 1ECFA 4MZXA 5FYDA 2HHTA 4P80A 5CVCA 2JASA 3HWWA 3VR5A 3SZLA 1QFSA 2YWCA 1HLGA 1U81A 2HFJA 2UZIR 1KEWA 3P9IA 1G9SA 1DO2A 2OR3A 3PFCA 5IT9A 2EOAA 1GG8A 3H87A 2EP7A 5K0SA 2NRTA 1LSSA 4TYPA 3W0LB 4KUEA 1DELA 2ZPUA 2W48A 2ZGVA 3L6EA 3HACA 3TQHA 3VHLB 4AMVA 2JZNA 2EBWA 4O2AA 1KLNA 2C5FA 3RR8A 1QZZA 4WZBA 2V3CC 1Z19A 4U3JB 5REQB 2JJ2D 5KKNB 3L8ZA 5EGSA 4FYKA 4WI1A 3W5BA 2QTNA 3HR4A 1NQUA 4KFTA 1M8PA 1UOEA 2H4ZA 2PVSA 1PBNA 4Q6WA 5DLYA 3KEMA 3FJ1A 1YE5A 4JI6B 2A92A 5K0BA 1RRMA 2KOBA 1NBAA 2VHVA 5HIJA 3U62A 1WVGA 5KOHA 1M1NB 1C0EA 2WU4A 3LUAA 5K51A 3VAAA 3AVOA 1QGOA 1OVGA 4NOMA 1GPWB 4EPXA 3I64A 4I6JA 1VB5A 1CEXA 3L1IA 1Y4ZA 2GMWA 1N34B 2I2XB 5HEKA 1K5GA 3EEFA 3JZMA 3KKEA 1RAFA 2VP9A 4IX1A 2R3SA 1IZZA 4IXNA 1UKBA 3QBEA 4WLNA 3VNRA 3RH4A 4WBSA 4FHDA 2GCEA 8ICPA 4MLCA 4M21A 1SCQA 4C2BA 1O6FA 1N92A 4TVOA 5D4BA 4AUNA 1WXIA 4PSVA 4BV3A 2Y4OA 2DC1A 4P6VF 1EG7A 4QRIA 2RKBA 2HBMA 2ICAA 1T4CA 1P0MA 1XC7A 1U0LA 5IT4A 3MGCA 5A71A 5D46A 3LDAA 2FE1A 1P2TA 4MS3A 1EG2A 3LVVA 4FINA 3IVXA 2BLNA 4DLBA 3I34X 3BREA 5DSTA 1C1DA 4HBZA 1UBGA 2PSDA 4CL0A 3K2EA 1TYAE 4RACA 1TA4A 4Z9XA 3AQFA 4U7WA 3I2FA 1K1SA 3R7WB 2NZ8A 3LBAA 4X1OA 3I76A 4WAUA 4ND2A 2GEVA 3E61A 4XDZA 3GMIA 4IHJA 4IXMA 1Z36A 2GN2A 1PGOA 1XWLA 4JJ4A 1PD0A 3UMMA 1TJNA 1YDEA 2E7ZA 4RSRA 5A4FS 4DGQA 3R3WA 4TZTA 5CIYA 1Y6RA 4B79A 3CYFA 4XM0A 4JUDX 3T5PA 4KGXA 3RTCA 1K8QA 1CY1A 2R00C 4GC9A 5C1DA 1JFTA 5LPNA 1TCBA 2BQRA 2QPLA 3T54A 1YZQA 3N75A 3PFKA 3VJLA 2O3RA 3CLTC 1K9VF 2IMWP 3ZWBA 2Y1IA 1X9WA 5C8VA 3WGOA 2JS7A 3TSWA 5F5NA 1L9KA 2KPOA 3MCAA 2Y76A 2WPNA 2LM4A 4DLVA 4O4LA 1P91A 1M67A 4MMYB 3L4KA 4X44A 3B0YA 2D13A 4I66A 3M9OB 3U39A 3PNSA 3HJEA 2PUHA 2QL9A 2IUSA 4JLDA 1V35A 2ORYA 1Q8KA 4YCSA 4JI0B 1Z08A 4B6JA 1G5HA 1VIYA 1TMYA 3OQOA 2E4WA 4GQIA 5HXAA 1X9SA 2HLDA 4ZU6X 4TS4A 2GZRA 4ED3A 2E9SA 2NQTA 1RKQA 1YV9A 1LSJA 5LYJA 1GGMA 2CXHA 4W82A 4M99A 3FPKA 1Z74A 1LGYA 4JXKA 3M1LA 5LCXA 3NIWA 3SSMA 1KQOA 3EH1A 2WMDA 1UBKS 5BWNA 4JIMA 4W5OA 3LC2O 3I5AA 2VDWA 2P6NA 3KZCA 3R7LA 3FHLA 5THKA 2GK3A 2QDKA 2MU1A 2I1LA 4AF6A 4UHFA 3L1JA 1BIFA 2AZ4A 5HHIA 4C2TA 2B4AA 2JKVA 1TC2A 1QNFA 2BEWB 2DP4E 2F8MA 1SVKA 4RH0A 5E3IA 4KV9A 1Y4UA 3EEQA 4IOKA 3UANA 1DG9A 3L06A 2IXEA 1IN4A 4Q66C 1A72A 4Q93A 5DHTA 4L0CA 2P75A 3WGHA 1TM3E 1BH2A 4C8KA 3S1SA 3RR2A 4Q19A 3Q7SA 1LK0A 1ZM9A 1VHJA 5IHPA 1BHO1 1L6RA 5JMWA 4JT2A 3BD8A 4PQRA 3TDKA 4YAGA 3JD2A 4F85A 1UBTS 4P4PA 1QG2A 3KQNA 1AY0A 2YZGA 3ZHVA 4RFSB 2PHZA 4LXHA 1GFSA 4GI7A 4YRZA 4DCPA 4WN9A 3FDFA 2W0SA 4KRXA 3LYLA 1GP2A 5L3ZA 5AM3A 3L8EA 1KH1A 1W34A 3PNYA 4M1MA 3FRJA 4E33A 2FA9A 5THQA 2YOHA 2XXAB 2NRXA 2IZ7A 3JRWA 2BGGA 2ZYGA 2QTGA 3GFFA 3EXAA 3DE6X 3DAOA 1WZEA 5E2AA 2HQRA 3F71A 3RLFA 3CCCA 4A10A 5KINB 3T1NA 1IN6A 4KRYA 1NR5A 1TZCA 1SCUA 4WESB 4OM7A 1P0IA 1TAHA 3EUWA 5JS2A 3C85A 3QLVA 4DXHA 4FEYA 5KCZA 4ARZA 2XVXA 2PX8A 3MJEA 4IQWA 1YZUA 4F4HA 3SZRA 1JFSA 2DVMA 5ESDA 2DL0A 2VTVA 2JKZA 4OQZA 2FSPA 1EK6A 1RIIA 3ZTWA 3QV2A 4IIUA 2VAWA 1ML3A 2OXFA 2H29A 4DPKA 4QQKA 1ZGAA 4JBXA 2AC4A 1SC9A 2BZGA 4YLEA 3GDFA 4J9MA 2PH7A 2GX6A 4AZVA 1EGVB 3DL0A 2CD7A 4RHEA 3KV1A 3NIFB 1UEXC 4WFQA 4OBBA 1JVBA 2H07A 4DOMA 3QX8A 3D8NA 3QTBA 1R0YA 3QSYA 5D7NA 2AB0A 1UQUA 2PMZF 1VLLA 5JWRA 1UBJS 1CS0A 4GYWA 3PUYA 2GR9A 4CIWA 5EMLA 1K9SA 2O0LA 4OAPA 5TQ0A 2V54A 3ZNQA 1Z62A 5EPUA 2C7PA 3PGXA 2YTUA 3W1VA 3VKWA 4B3IA 4G2NA 3GT7A 3N7TA 3NJ8A 4PZDA 4DF3A 5AKEA 2P6PA 2UZ4A 1LS6A 4X62B 4QBIA 5KBYA 4ND8B 2AN1A 4Z6DA 4F3CA 2LUOA 1L5GB 4US9A 5JTTA 1OZGA 4FZMA 1JB9A 1WOYA 4QXOA 1W5TA 4QNLA 1XSNA 5EWEA 1KSPA 2ZJ7A 2ATVA 2P2ZA 4I6GA 1NTRA 4WCVA 3KWFA 4XWAA 1OV6A 5J9FA 3K0AB 3S29A 2YYZA 4YJ2F 3H2SA 3W2TA 2FLPA 3Q98A 4F45A 1P9RA 5EZ5A 2IH2A 4H9GA 1N62A 4Q8EA 4BFSA 4CHTA 2A9OA 4B43A 2LD4A 2ACKA 4XUDA 1TIBA 1YK0A 2W9BA 1YA8A 3DHVA 1JW9B 4RH1A 3K6JA 4HJXA 3Q8KA 1A4XA 1EHCA 1T5DX 5DTEA 4DJAA 1J4AA 4BC0A 2AKAB 3KOYA 1TEHA 2XOXA 1DJPA 4EFLA 4D8UA 1S8FA 4TL7A 3JQGA 2E4ZA 4EUKA 2PGDA 2RGNC 3Q7RA 3WLAA 1HDRA 1Y1SA 2JLVA 1IM8A 3N7UA 1KAGA 3VPXA 3EODA 1SAYA 4IDOA 4U02A 3AJ8A 4CM8B 5BN4A 1M2OA 3ANXA 4O0IA 2CV1A 1S2GA 2CNBA 4YMHA 4Y2YA 1YR2A 2EWVA 2CE7A 2C8JA 2P27A 4YMWA 3KD3A 1XK7A 1XVTA 5LOVA 4MWGA 5IYZA 3DV0B 1PFQA 1KBOA 4DHWA 2I8LA 9ICMA 5IJ0B 1BRTA 5LYYA 5CLIA 4BE7B 1P72A 5E4YA 4YN4A 3GPBA 3REQB 3D59A 3WAKA 2IEZA 2B1GA 1N5OX 3H8SA 1JA0A 1N6LA 4YECA 3IIJA 3QLVC 3UPDA 2BJWA 2Y2VA 2LZ0A 3FOCA 4IM7A 3OQPA 4PSCA 4H7JA 1X8JA 2C31A 3UT0A 3C97A 4U6QA 4CQMA 1GGFA 4RK5A 1LQ2A 2C7QA 3G6YA 2O2ZA 1ZCBA 3I6QA 5BUQA 3JQ7A 1KAEA 2BEJA 1ULUA 4HDAA 1P75A 3R0ZA 2F3RA 3R5HA 2HXGA 1ODSA 1TK5A 2VKQA 2F8TA 1UBRS 3UQ2A 1AS0A 2CHEA 5E2IA 1ZQUA 4HWGA 4AJIA 3T4EA 5I7FA 4H7EA 1BXGB 1OU0A 5IPFA 2IITA 5KFXA 2HA4A 1J49A 1DKNA 1NN5A 5DLGA 1DAEA 2UYGA 2I76A 1G7SA 2LDBA 2JZOA 4DILA 3OTIA 4FU0A 1E2UA 1PKXA 3PE4A 4C78A 4F5PA 1A0PA 1VPLA 4M9NA 1WXGA 2WUWE 5T8KA 2AFHA 6LDHA 4FEAA 2H92A 2LPMA 1XWWA 1GLVA 2A3RA 4LWPA 4ES6A 2JXJA 3PC3A 5TQ2B 2FZWA 4UDOA 2DTEA 3ZH2A 7ICKA 1W1UA 3P4YA 1IIPA 3OF2A 3A9SA 3AUFA 5CNIA 4DA4A 4YP5A 4GZMA 1RYRA 3Q8XB 2G0AA 2QVZX 3V4OA 1GUZA 3KVYA 1U7HA 1BD4A 3SOZA 4KLNA 4UUPA 4BAUA 1NOKA 4P0QA 5EFZA 5BNFA 1WUKS 1R0ZA 1A4UA 5KAFU 3OFND 4OQMA 3MJSA 4O5OA 4OXKA 3GGJA 4UHDA 1Q11A 4BP9A 1A88A 2JLQA 3JYHA 1FMFA 1PUZA 1T1JA 2B5OA 4I2NA 4JP2A 3QKRA 4Z6FA 2RHLA 3DL2A 3D4PA 5JLJA 5ALJA 2VRNA 4BQPA 2IU4A 4EKYA 2HSWA 1Q7RA 4HEA1 4F5WA 5G0VA 3C6ZA 3MCVA 3UJ8A 2KWIA 3RYTC 1EVYA 3GA0A 1KS9A 2PGNA 4U7JA 2ZJOA 4KVZA 1O6ZA 3V8QA 1KN5A 4YYZA 1FQOA 1T1SA 4LYJA 3RVBA 4TOIA 3A1SA 4ZV7A 3BGVA 2V6MA 3S2UA 5F4BA 4TTJA 3RRJA 1Q6ZA 1P3JA 3GROA 1GWNA 3K4PA 2KHZA 4JV0A 3L04A 4M55A 4D82A 4NICA 1PFKA 1QZXA 1YMQA 2VUIB 2PWYA 2O7SA 5C8XA 2DFTA 4YJGB 5J2EA 2X8BA 4QSMA 1FYVA 2C0PA 1E0SA 4EUSA 2G07A 3HUUA 4WXRA 4P58A 5FBKA 5COQA 5JAOA 4W7HA 1TU0A 1Y6ZA 5I9LA 3IR7A 4IJMA 4WSOA 4CBVA 1RBQA 4UNNA 4CLDA 2ZRIA 3TFRA 2VP4A 4TM8A 2P66A 2Q4OA 3SEIA 3Q8PB 4NBSA 1K4MA 5C7IO 3RWBA 4I55B 1WB4A 1Y7LA 2QMYA 4QYIA 4RT2A 2ZRDA 3OPYI 2OK7A 3WLRA 2J3JA 1CDZA 4DJ5X 2WF8A 3IUQA 4M8NE 3ROKA 3JQPA 1XPRA 3VYWA 1NMQA 2R47A 1FXSA 4Z49A 2W8BA 1PV1A 4BN0A 4DL5A 1JHRA 2KSQA 3RS0A 4UCQA 2PUTA 5BT8A 3JPSA 5BURA 5JAUA 3N6RA 5CIQA 1I8TA 2NU7A 2I33A 1U9YA 1XD2A 2Z6UA 5CHEA 3W1EA 3ZZMA 4IR7A 3G8YA 2FJ0A 1H9BA 1HL3A 5T8KC 2LYHA 4MRAA 4EA8A 2GLXA 3IRVA 1ADBA 3D2QA 1MEJA 2AHOB 2GOYA 3RT1A 1P45A 3ONDA 3OX2A 4G37A 5DGHA 3USES 5HZKA 4DA0A 2XB8A 5EP3A 3JQ9A 5FA5A 2VF2A 4Z3KA 4YFYA 1KDTA 2AYYA 2PU7A 1F0YA 3MBOA 4BGEA 1NBIA 5TB5A 5KNDD 3U26A 2FQYA 2I55A 1G4HA 3V4FA 1PG0A 1AA6A 5BN1A 3MRTA 4N0EA 4EBEA 1V48A 2A86A 5A06A 3OE5A 2XBMA 4EG6A 1GO2A 4A5SA 2P9FA 1P2GA 2GNOA 4C7KA 5JIBA 3BPSA 2KICA 1KQ3A 3B0XA 3BIJA 4PV7A 4ENPA 4JYCA 3SZOA 4BO6A 3VUFA 4V1CI 1CJCA 4M8KA 1N7IA 4ED2A 2JLXA 3UWMA 4LRTB 5DOVA 3TLGA 1BFUA 1IN7A 3JPTA 3MD0A 2IF2A 1M1ZA 2R2AA 2JI4A 4J4BA 3QVGA 5DULA 4IILA 1JU9A 3LGAA 2VSOA 1ZD4A 1KJ9A 1VKRA 1NXWA 2ZZNA 4J1QA 4DMHA 5KT6A 5ERGB 1E9SA 3GCGA 3WL7A 4JYAB 3ANYB 1UANA 6REQA 4G5RA 3R24A 1T4MA 4DSNA 4ECVA 3QU5A 1N0VC 4BMCA 4R1SA 1QLJA 2Q4TA 1YQ9A 1FMLA 2GZ3A 3HUFA 4UEOA 1GZSA 2HA0A 2UYOA 4BKOA 3M9XA 4OHVA 5BY2A 3JD1A 1U7OA 3OZWA 1NOMA 4AZ3A 2GF2A 5JUMA 4NATA 2OCLA 4AZSA 4Z6CA 1CT9A 2X8LA 4PLGA 2O7QA 1HK7A 1RDFA 3SQDA 5IVPA 2QW1A 1XCMA 2ZATA 4BASA 1G291 1PFYA 5EJMA 1EBBA 4JK3A 4TV9B 4MQEA 2CDBA 5KFMA 4V0ME 1A6SA 3X1WA 1DARA 3ENQA 3C2LA 4JODA 4YRTA 1O8CA 1P9OA 7ICLA 2XB2A 4G81A 5HVNA 2QVYX 4X1KA 4AJPA 3KJGA 1PKEA 4EG7A 3NTLA 5KNDH 2Y27A 3TTTA 4DLPA 2YFHA 1Y3DE 1YU9A 2X76A 1I7QB 1N2EA 3HO1A 3MT8A 3NIBA 3FDXA 4X60A 5EA2A 2BGLA 4WFJA 1T94A 2ZBQA 4XPIA 5AOVA 4BVHA 2Y0SC 3EMVA 4N5NA 3ENKA 4NZ9A 2PWBA 3ISCA 4BCDA 3SGLA 2VIXA 1QYIA 1BPZA 4R40A 2QG6A 5I3CA 3C4VA 3W04A 5CJ2A 2ZJ1A 3VBEA 1ZGZA 1U3VA 2KFNA 2PUCA 4XSVA 2ZR7A 3S70A 1NASA 2R1TA 1HIWA 3UH0A 4Y6RA 3I92A 4X6XA 3MWJA 3LK7A 5JDIC 1E2MA 1KP9A 1TVKA 2C5GA 3DQQA 4OP3A 2C4UA 3D8TA 1UAYA 5TMPA 1Q1GA 1NVDA 2F3NA 3ESYA 4PU0A 2ZULA 3B9PA 3CVOA 4YCLA 1DKOA 4DDKA 1V1RA 2ZRQA 4EQ6A 3A0HU 5DG9A 5I47A 1CD5A 1ZG3A 4FYIA 4CEIB 5DPMA 2WWXA 2EFEB 3SLRA 1T8TA 1EH5A 3A4MA 5IN5A 1N2OA 2OGZA 1HUQA 4PIMA 2XYHA 4WXHA 1W96A 4O1IA 3PYXA 3HN7A 3P9KA 5EJ6A 4YMOA 3T35A 1G20A 1PYGA 1BE0A 1CUFA 1VYVA 2PH3A 2QTFA 3RASA 3S8MA 3W3ZB 1T25A 3ML1A 4G0OA 1PS9A 5EL0A 3EJ6A 2P4EA 2Q8QA 3IHTA 3V4ZA 1H23A 1SCDA 5ED4A 3TW8A 3GG9A 1IB6A 3RJ5A 1T43A 4Q21A 2WRZA 3VJRA 2D1SA 4QYSA 5IARA 2QLMA 4Q05A 9ICAA 1DUSA 4CRXA 1O96A 4E13A 4H1TA 2PLWA 4C0KA 2O8EA 4PGGA 4Z1OA 1YQDA 2J5XA 5AW4A 2Q9CA 1JXOA 3BWYA 4QXPA 3X44A 5EERA 2C4VA 1ISRA 1CERA 4A9AA 4Y6LA 1CE8A 1KERA 5F9NA 1RYNA 3AILA 1C7YA 3K0CC 3S1AA 4NJEB 4XJXA 3T7CA 3ZTYA 3K6SA 3B82A 3V3KA 1Y4DE 3R8XA 4URYR 4RPZA 5J0WA 3GLFA 3ENNA 3ZR4B 1YQQA 4C0AC 4E5KA 3DP7A 3O94A 1UZLA 4YJ3B 1OKKA 3JAWA 4FTWA 4WEOA 3PX2A 3SS8A 1U1IA 3C87A 3W5CA 4OLBA 5A4MS 4KDCA 1EEHA 5KU7A 1FYFA 4OFXA 2JLSA 5K8UA 4PC6A 3ISBA 3SY8A 4REQB 4A91A 3O1JC 3HFJA 1KEJA 5EQFA 2BCQA 4R51A 5BWLA 3E8SA 4MNTA 2DCMA 1V7CA 4D57A 4UZEA 2UYQA 2DR3A 4YRBA 3E2EA 3WNDA 4HX5A 2ERYA 1FL9A 5JQGB 5J2FA 4CI0B 3SYZA 3DL7A 2H1OA 5H4GA 2WKQA 1ONPA 1K5OA 3AEKA 4YP7A 4QGFA 4BWYA 4YMSA 3BTOA 1XG5A 3CUUA 3EN0A 3U7JA 4C5BA 2HSDA 4BNXA 2ZJYA 1ZQ1C 4ANFA 4PWYA 2J3KA 1OLUA 2QP9X 1GM5A 3WDKA 1GGKA 5LFAA 3PZPA 1DDGA 3CQ9A 4CLRB 1W44A 2ZTDA 3ENVA 5KKCA 4C4OA 1ZIYA 2QWXA 4E4RA 4BVAA 4LQDA 3BBPA 2OWDA 4R5HA 1EFPB 3N59A 2XAUA 1IG3A 5DQIA 3U6KA 4EFMA 4HVCA 2I71A 2R84A 4IJKA 1SVNA 3WWEA 1AT1A 2ZYIA 7ICIA 1UDWA 3IVRA 4PHHA 5IF3A 4MVJD 1XQ6A 2CZQA 2R60A 5KQSA 3OZXA 1CJMA 4LBYA 1L7QA 1ZA2A 2I7TA 4HGPA 4JYPA 4AG5A 2A9QA 4EGJA 1A8PA 4M8IA 1DINA 2A58A 2C7RA 1NJSA 3V8PA 2RRDA 4M8SA 4P2BA 2ZR8A 3C16C 1CP2A 4HWPA 4AB1A 5KFBA 3WWYA 2X2OA 4XUEA 2ZIFA 4GMFA 4I5GA 5A5VA 1DKPA 3BK1A 1GYRA 5KT2A 4OVKA 1RZTA 2G04A 3VU8A 3UTCA 2W03A 5AVKA 2FDCA 3JATA 2YZKA 3HKCA 2W6CX 3OHPA 2WHPA 5FHRA 3FNQA 3OEED 5HQ3B 1U8XX 4AUEA 4X1YB 1X1EA 1Z8HA 4WZAE 1LA2A 4MP8A 2QSZA 2OGTA 3THYA 2B69A 2D59A 1E3LA 4LE0A 4FDMA 1YR3A 4PFQA 1VYTA 4KK4A 1QQ5A 2K2WA 3ORSA 4PTZA 2I3DA 3ESXA 2OE2A 4GM0A 3UPQA 2J3HA 1QR6A 1UPXA 5J2UB 3WJ1A 3GA5A 4NI5A 4TTTS 1U9ZA 3RB4A 5IHXA 5GOZA 1NSYA 3AVWA 2C9ZA 4MIOA 3KSMA 3DBOB 3R9KA 3K9FC 3U5ZB 1KS2A 1A76A 4LOKA 4M7WA 3ZGNA 3HTXA 4IQ4A 1XALA 1ZQTA 3QA3E 4DQQA 1NC3A 1XTKA 2A6PA 5DMHA 5KHAA 4L07A 9MHTA 5HA5A 3PV8A 3E27A 3AR5A 3UHAA 1MG5A 2BGWA 3LLMA 2YR0A 2C9YA 3CEJA 3PLRA 2ZXIA 3B6KA 1E9DA 4JGBA 1RTKA 2HTEA 4UDXX 2WYUA 1M2WA 1SVSA 3OKPA 1PFVA 3HJGA 2Y68A 1BCRB 3FNGA 4RPXA 1K7SN 3GG2A 4GT1A 3TTXA 2ZRNA 3SJBA 2CNLA 1NN1A 1P1RA 1GSIA 1YCFA 2Y1LA 1N2HA 3HYRA 2HHLA 3PO4A 4P3PA 3JPRA 4IBOA 3X1YA 3LGXA 3R3SA 4EKIA 3BFKA 2QR2A 3TZKA 1XCJA 3USZA 1IG6A 2R2GA 1STOA 1H5QA 8ICKA 1QGED 2OORC 3D43A 4PHPA 3BX1A 1Y37A 3HYNA 4I19A 1UJNA 1I01A 1KR2A 2GASA 4OHFA 4XJTA 3PJEA 2JFZA 1J6UA 4HB2A 2Q6TA 2MMCA 3QPCA 3TZHA 2R86A 3ZJTA 4R9NA 4X1IA 1D09A 3QE3A 3EULA 3OTGA 1JFFA 4ESVA 3BGDA 4RJLA 1FUKA 3DTNA 2CLLB 2QTWB 4I9GA 1AOXA 1Y8ZA 1VE6A 4M60A 1U04A 2I4LA 4IOJA 4TLBA 2OEHA 4QE3A 2MIIA 1J2UA 2BONA 1N6RA 2WTMA 1CY0A 2FZCA 4UTVA 1Y63A 3Q87B 3DE4X 5MGBA 5FFFA 4FYPA 4BY9E 2XMGA 2WJGA 2D2FA 5K3OA 1MC4A 2QYOA 1K6JA 5J40A 1EDZA 3FCSB 3I6IA 1HA3A 1NW9B 3TYXA 4X91A 4W9RA 4I6EA 2H5EA 4YRFA 2BPFA 4PJ0U 2B6HA 3GO4A 1PV4A 3GRFA 1J7KA 4K4HA 2A0KA 2JCXA 4RVDA 1BNOA 3SI7A 1T3SA 4ZOLB 1HE4A 1V97A 3GCZA 1HBJA 2RKWA 1IJFA 1JEOA 4EYKA 1AXGA 6GPBA 5GV8A 4M9SA 1RE1A 3SR4A 4ZANA 1VL8A 5CB6A 5AW6A 3PHLA 4N0MA 3U1TA 1PQYA 4KX5A 3ZZ0A 1TD9A 2E4YA 3H3XA 1MNAA 2R6HA 4DV1B 9ICTA 4DA6A 2GM5A 1I5EA 1RE0A 3QLJA 1A69A 3A1WA 1RLJA 4ECXA 1Y42X 1A2KC 4DOAA 1BWRA 2G82A 3D8HA 4QECA 4F3OA 2B3TA 1S2IA 4GZ5A 2JGMA 2O3JA 4YMUA 2WZDA 1D4AA 1KSHA 4J9VA 4ZI3A 5DQGA 4C87A 4KQEA 4CI9A 4MFCA 5IIJA 3UMYA 4O9MA 4R6XA 1G8KA 3PUWA 2GSWA 3OCJA 1FX0A 4BB9A 3UT5A 3JYOA 3QI7A 5K4GA 2GZHA 1OLXA 5ITSA 4HC4A 2X2EA 3VO9A 3N7AA 2ZSKA 3E0XA 4EYIB 3D6UA 3E7XA 2FQXA 3GGCA 4WXMA 2GAAA 3DUWA 4K88A 4EJ6A 5L3SA 3INYA 4OA8A 4CMBA 5LQKA 5AJWA 1MVLA 2GERA 5KJEA 1D03A 1WCIA 1VFPA 2O6KA 2Q8PA 1GGEA 4I1PA 3GLUA 4TTQA 1DKUA 3D6AA 2KHVA 3AY0A 4TV9F 4B71A 3FKSA 4KTVE 4OLHA 4MVJM 4J7UA 4KSBA 2WM3A 1V96A 3PL5A 3U4CA 5JI2E 5KFHA 2A35A 5G1NA 3IUYA 5CR9A 4BCCA 3AERB 1LRKA 4Z4QA 5FPSA 4Q3OA 2IZ1A 2BV3A 4YRRA 3NP9A 4OGWA 4CG2A 1DC8A 5I4KA 3A28A 4PNPA 5HNKA 4OHZA 5I51A 5HRCA 9GPBA 1QUFA 3KP1A 3QF7A 6PFKA 3ID6C 1LDGA 1KO4A 3G5MA 1V3QE 4P0PA 4J43A 5FNZA 3W8RA 1Q19A 1Z6ZA 4RYDA 3NHUA 1MT0A 1UBHS 4R0NA 1T2NA 4PHFA 1QGUA 1NWCA 3RROA 3HM2A 5LZ7A 2C2HA 4R3UC 1Z0AA 1VBMA 3K75D 4EY5A 2ODGA 1EBFA 2PQMA 3AR7A 2QN2A 2XCRB 1Z5ZA 3HCBA 2IRWA 4IS2A 4BO2A 3CBQA 5IKOA 3EGIA 5CXXA 3DF9A 2QX4A 1Y7IA 3FM9A 5G41A 1AF7A 3FUUA 4MAAA 3F6YA 1QPBA 3JWGA 4HEHA 2J6SA 2J0SA 4AMZA 1NKTA 2F2TA 4RHTA 5KAIU 5ALFA 2GJAA 4RV9A 3HY3A 4I14A 2I6GA 1SOAA 3OI7A 1TO2E 2NUBA 3W5UA 4MKGA 1BGXT 2ISPA 1ED1A 1BDJA 4FW8A 4TUYA 1KSFX 1ZNWA 2FU5C 5EXEA 2HMUA 3GLHB 1TA9A 3RK4A 3QTTA 4FONA 4B48A 3MC1A 2KTQA 1PR0A 4BNJA 4D0LB 3VR4A 2BYTA 1EAYA 4CG3A 4RQ8A 1CUUA 3OE1A 3TSZA 1L5UA 3D4BA 1T9AA 3LTEA 3KKPA 5KFIA 2TMKA 2BFAA 2QVXX 3N0TA 3QITA 1O97C 1ZH4A 1ZCJA 3EIOA 3H0MB 2NU6B 4DS5A 4OBXA 2JA1A 2VDQB 3GFGA 2BM8A 3DHEA 5FKJA 3PFIA 1XZAA 2GF9A 3I2JA 1TUIA 7MHTA 2Y0PA 3FDZB 1LLCA 3I4CA 1EE1A 5IM4F 3RBEA 1L7MA 1WQ3A 4JL6A 4KMMA 3R7DA 5FORA 1NMYA 1R6AA 3UXEA 1W75A 3DEJA 5JZOA 1TIPA 3IMGA 1AQYA 3BHIA 1WUYA 4FFPA 1Q0ZA 1XXHA 3SWWA 4JP1A 1O0SA 1KRHA 1XO0A 5IAKA 4TMZA 4AP9A 1YK1A 1G8SA 1PHRA 4YMGA 3PUZA 5EIWA 2IODA 4YH1A 5IEBA 1TL7C 2C2DA 2DUMA 1UJ6A 4L4UA 1HDZA 3C5FA 1NT2A 3ZGZA 1UMDB 3VU1A 9ICJA 3WMEA 1N5WA 3UAGA 2ZS8A 1V85A 5GZ3A 4YP1A 1XZJA 1TRKA 3EIFA 3UV6A 3TI7A 1DAFA 3KSZO 5FI0B 4GXIA 1P4HA 3NRJA 1EQAA 2ZIWB 3DLIA 1MMFB 4H3VA 2I4NA 1U9JA 4X95A 4IC9A 2QB5A 2OLEA 1ZI8A 3WA6A 1XF1A 5CB4B 1ZQRA 4RK6A 4OJOA 2V0CA 1XMXA 1I3OA 4K9KA 3KCNA 4G26A 1XNRB 4ZJYA 2JJMA 1V2HE 1OA0A 2H9IA 3P9CA 6NULA 2VLBA 4C7MA 5F9HA 5AM1A 4RTKA 1TM4E 1OHHD 4EEYA 1LBIA 1NI3A 1ZRHA 5C0OE 3RUCA 4ZQHA 1OQAA 2UZ1A 4ZDWA 1JRPA 1W52X 2GEFA 1GG5A 3QV1A 5HHHA 1EFVB 5C4MA 1E6KA 4BLSA 4AXXA 5B1EA 5B7GA 3O3MB 3NCTA 2DHQA 3SC2B 3GIDA 2BI7A 4RNMA 3E35A 4L0DA 2FFJA 4IQUA 2X5OA 4I5FA 3D3KA 3DW3X 3KLNA 4HVTA 4PAMA 1W8IA 2A9RA 3WBKA 2EBFX 4LFBB 2D62A 2WTEA 3P19A 3NHFA 2J6CA 4DLKA 1BPDA 3GV8B 4G5OA 1X6IA 4HH1A 4JBWA 5B64A 1YZ7A 5I8PA 3B51X 3CT6A 1QF9A 2UUOA 4KQ1A 1HFWA 3IM1A 1Q44A 1KK2A 5J0YA 4DJEC 3GZNB 2BMVA 2VO1A 2HHXA 2PA0A 2J7PD 4LCJA 3RVQA 1RCFA 4KQMA 2H9YA 5EXSA 4IWYA 2OZKA 2CCJA 5HWSA 1F6BA 1PVRA 4FXOA 1JXEA 2X1LA 1JLKA 1VG9B 4ECRA 2FW1A 2HHAA 3CKMA 3GW8A 3Q2IA 4TMYA 1QYWA 1WBBA 3TD2A 2HPHA 2H1RA 2UVWA 3T15A 1DS6A 1NBME 3TADA