3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords Predicted phosphatase, HAD family
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
1XPJA 1YJ5A 3N1UA 3WK6A 1JUDA 5AI9A 2IYEA 4MWOA 3KDPA 4YH1A 4NFLA 3DAOA 5ALYA 5AHXA 4ZEXA 3ZU6A 3I6BA 1U7PA 5AVSA 5ALLA 4HGOA 1YDFA 2MSNA 5JJBA 5AVXA 3AR5A 4Y2SA 3PDWA 3WKBA 2I33A 5AVZA 1TA0A 2C8LA 5AKKA 2I54A 2Q4TA 1Z4KA 4BEWA 2HI0A 3E58A 2JGAA 4CE6A 5AK4A 2CN1A 4AP9A 2NYVA 1RRCA 1QH9A 4QJBA 2W43A 4Y2PA 3ZI4A 4RESA 3ED5A 1SWWA 4EZEA 3UMGA 4YIHA 4J2TA 2GHQA 5ALUA 1L8LA 1SU4A 5AKGA 4YIKA 1RQNA 5AVWA 3QXGA 4UASA 3OCXA 2WF9A 4KNVA 1Z5GA 4Y2UA 3L0CA 1Z5UA 5ALRA 3EPRA 1ZRMA 1L8OA 5ALVA 4Y2XA 3WGVA 1RPZA 3WKCA 1MH9A 2WF8A 1ZD3A 5AM2A 3F9RA 4BX0A 1QQ7A 4Y2YA 2FPUA 2P69A 3U26A 3WK8A 4UU1A 2WF7A 4UAUA 2JAUA 1N9KA 5IT4A 3ZX5A 2GHTA 2YMQA 2CFRA 5AKYA 3WK4A 3CZ4A 2WF5A 3U7EB 3NRJA 1Z4QA 3U7GA 4OD0A 3FGOA 3DDHA 4ZEWA 2C9MA 2YFYA 5AIBA 1TE2A 1ZD5A 2P27A 3L8HA 2C88A 4UMDA 5AW4A 2I6XA 3W5DA 3KZXA 5AW1A 3AR2A 5ALZA 1RLOA 5A3SA 3W5CA 1Z4IA 2GO7A 5AW0A 2YMPA 1ZD2P 3ZTWA 1ZRNA 5AESA 3ZTYA 4C4SA 3QU7A 3WKAA 5AVTA 2B1QA 2WM8A 2ZBDA 4UMVA 5ALHA 5FP0A 1ZS9A 4KYTA 2OYCA 2RARA 4J03A 3AR6A 3KC2A 3QU2A 2MU2A 4I9GA 1IWOA 1RKVA 5AI5A 4HAIA 2BDUA 3E81A 1NF2A 3NALA 4DW8A 4C4TA 3OCZA 3RF6A 3ESQA 2B1RA 3MN1A 1WVIA 2YJ4A 1RMTA 3ZVMA 5ALNA 3SF0A 2B82A 3ONNA 3EF0A 1RDFA 4KX3A 1ZOLA 2CFTA 5A3QA 4L6AA 1X42A 4BX2A 3OTQA 5AW3A 1U2TA 4B6JA 2NO5A 1K1EA 4UARA 5ALJA 2Q4RA 2B8JA 2NO4A 3OCYA 2YJ5A 4CNQA 5ALXA 2CFSA 2IOFA 3OCUA 4FE3A 4HGRA 3KBBA 5AICA 2GFHA 4KN8A 2G0AA 1J97A 4NWIA 4BBJA 5AM5A 1F5SA 1Q92A 1Z4MA 2HOQA 4O8CA 2FUEA 3ZWDA 3ZWKA 3GYGA 4F72A 1L7MA 3ZVLA 2O2XA 4NABA 3L8FA 5AVVA 2ZBEA 1Q91A 4KNWA 4CF4A 4OFZA 3K1ZA 3N8GA 1O03A 4XQ0A 4UMFA 4RETA 3BA6A 2VKQA 3FZQA 3QNMA 5ALGA 2YJ6A 3NIWA 5AM1A 3M1YA 3IRUA 4UATA 2AH5A 3WK9A 1LTQA 4L57A 1L7PA 3MC1A 2YN4A 4I9FA 1VJRA 2ODAA 3OCWA 1ZJJA 3N28A 3E8MA 1N8NA 2OM6A 2YY6A 2RAVA 2WHEA 5AKIA 3ZVNA 3KD3A 4E88A 5ALWA 5A3RA 1NRWA 2W4MA 3A1CA 3FVVA 3QUCA 2O9JA 3A1DA 4CF5A 3MMZA 5AW7A 2G08A 1Z4LA 3FM9A 1O08A 3U7HB 2P9JA 3N5KA 3QGMA 1TJ5A 3L0BA 1S8OA 1RLMA 3MPOA 2EARA 5AVRA 5AKLA 1U7OA 1TJ4A 2HF2A 1AQ6A 2JAOA 3RFUA 3E84A 3UMCA 3J7TA 1Y8AA 3WK5A 3L1VA 5AVQA 3U7FB 3SKXA 4JB3A 2AGVA 4DCCA 2FPRA 5ALKA 1QQ5A 3QYPA 5AVUA 1RKQA 4G63A 3QUBA 3UM9A 2GMWA 5T41A 4Y2TA 2YMLA 3I28A 5ALTA 4JDPA 1RC8A 4Y2QA 2IA5A 5ALFA 2AMYA 3PGLA 1QYIA 2EAUA 1J8DA 1RMQA 1LVHA 3NUQA 4HGPA 2WFAA 1ZD4A 5AW5A 2W11A 3AR8A 3WKEA 2YMMA 3ESRA 3SMVA 4UM7A 5ALEA 5ALQA 2G1AA 5AKXA 5AW9A 1T5TA 2ZXEA 4QQFA 4XE5A 1RMYA 3FPSA 2HCFA 3R9KA 5AVYA 3L1UA 2Q5EA 1RQLA 5IT0A 3WK7A 4EENA 4Y2RA 2PR7A 1YV9A 3ZW7A 5AKJA 4EX6A 3AR4A 3ET5A 4IG4A 4OHFA 4UMEA 3EF1A 3U13A 5AM0A 4IFTA 2HEGA 2G07A 4Y3UA 2QLTA 3L0YA 2X4DA 5AK5A 4C4RA 1WPGA 4DWOA 4UAVA 4YCMA 2HX1A 5E0OA 2IOFK 3QU4A 3WKDA 1L7OA 4NAVA 3U19A 3L8GA 4AS3A 2ZBFA 1EK2A 1KYTA 3B9BA 2OBBA 3B8EA 2HSZA 1YMQA 3ET4A 3PGVA 3M9LA 4ZEVA 2B30A 4Y2JA 3IB6A 1NNLA 5ALIA 3NASA 1U02A 5AKHA 2YBDA 5AIAA 2D2VA 3W5AA 4L6CA 4PNHA 2ZBGA 3HYCA 4KX5A 1YS9A 3SHQA 4AS2A 2PKEA 3DNPA 3FPBA 4MUMA 2B0CA 1T9ZA 1CQZA 1L6RA 4HGNA 3SLRA 5ALOA 5AW2A 1Z4OA 3N07A 1Z4JA 3AR9A 2BY4A 2ZOSA 3P96A 2R8XA 2WF6A 2G80A 2PQ0A 3HLTA 3CNHA 1WR8A 2B8EA 2FPSA 2QYHA 2HF7A 3R09A 3SKYA 2R8EA 3IJ5A 3TLMA 3I76A 2JARA 2FPXA 2OA0A 5ALSA 5AM3A 3AR3A 2YJ3A 5ALMA 3A1EA 1PW5A 1Z88A 2MU1A 3NANA 2C8KA 3EWIA 3OPXA 3QLEA 4UU0A 4UW9A 4XOUA 3KOOA 3AR7A 3VAYA 1L7NA 3B9RA 5AK3A 3L7YA 4YCLA 1Z4NA 3DV9A 2ZG6A 2C4NA 5AW8A 4EELA 1SWVA 5ALDA 2HO4A 4G9BA 4YGYA 3W5BA 2I34A 2JAWA 4DFDA 4FYPA 1U2SA 4EEKA 3QU9A 4UM5A 3I1YA 2P11A 4XPZA 1XP5A 1T5SA 3A3YA 1RLTA 4GIBA 4YCNA 5AKEA 5AI8A 1FEZA 1RKUA 2FDRA 5AM4A 1YNSA 1Z4PX 4HYTA 5IS2A 3R4CA 2R8YA 3ZX4A 5ALPA 2FUCA 2G09A 4GXTA 3QU5A 4BEVA 4H1WA 4F71A 5AI0A 4Y2VA 2R8ZA 1VFPA 3UMBA 2I55A 3D6JA 1CR6A 5AKZA 5AI4A 4BX3A 3NAMA 2HHLA 1QQ6A 4BKMA 1S2OA 4BNDA 4BYGA 2G06A 2I7DA 3BWVA 3QUQA 1VJ5A 2EATA 5AK6A 2DQSA 3ZUPA 3SD7A 1TJ3A 2BDEA 4OCZA 2RBKA 3L8EA 4NV0A 5AW6A 1EK1A 4CF3A 2HDOA 3QX7A 3WGUA 2FI1A 3L5KA 2RB5A 4EX7A 4BNDB 3QUTA 3S6JA 2FEAA 2FPWA 1WZCA 3OCVA 2IOHA 4FFDA 5AI6A 4HGQA 3PCTA 2AUTA 1XVIA
chains in the Genus database with same CATH superfamily
1OY1A 4ENPA 5JH7F 1IN8A 3ZWNA 1JUDA 1L3BA 3EVCA 2WWWA 2AQ4A 3QNUA 4G07A 5PNTA 5LKRA 1NNEA 1U0GA 3BHMA 1X15A 2XMQA 4G0QA 3ZHCA 5JH7A 1NN5A 1OLXB 4MUIA 4PSUA 4JFAA 1L5HB 4DNPA 3NOOA 2OCLA 4E3WA 1PWEA 3TH5A 4LMAA 4YP1A 4Z51A 3I6BA 1QOQB 2HOFA 3G6KA 4ZC1A 2ZQZA 3FYDA 3SJ7A 5K3BA 1VE3A 3OHMA 1E8NA 3A2NA 2PZMA 3QW4B 3JPNA 2WDPA 2Q45A 5CT8A 4DIKA 4LF9B 3IR6A 5AYVA 3AR5A 2FK7A 4DQLA 4GOJA 3MILA 2JZBB 2BZFA 3K9GA 3PX7A 2OCEA 3T94A 5BMVA 4TKZA 2OL4A 3OMLA 3A36A 3B1KA 1BVSA 1F8FA 1TA0A 2QSYA 1S2LA 4P58A 4U9UA 4F4XA 4WINA 3NLLA 4RKYA 5JDIA 4QIWF 1S5PA 1RXUA 5IM5A 4H6WA 4YP5A 1ZW6A 1SCAA 4MIOA 1QHHB 2WWIA 1WM1A 2ASVA 1Q7EA 5AK4A 3IE1A 3H16A 1TK2A 1QH9A 1KMHB 3ZUGA 1MHTA 4ROSA 3U9LA 4YQYA 4KW7A 1OXBB 4FNMA 4XSHA 3SNKA 3ZC3A 4CL2A 4DPMA 2ZJYA 1N25A 3VJRA 4J6FA 1FSGA 1WUDA 1MOPA 1UP6A 4XIFA 1MAUA 3UMGA 2JGEA 1V3TA 1FYEA 1LBQA 2Q2NA 3IA7A 3WS7A 3RR2A 1T5OA 4AECA 1JA9A 2OBNA 5BWBA 1SXQA 1JIXA 4K28A 3EXFB 4OB6A 3ZWYA 4JS0A 2IF0A 5LBTA 1AZSC 3N86A 4DCNA 3QXGA 2WF9A 1NM5A 4KPUA 3T95A 4Y2UA 1R3DA 1H6BA 4FKMA 1D2EA 4HEQA 5AOCA 5G5GA 3RS4A 1WP4A 3UGKA 4RD2A 4B3CA 2FR8A 3H9UA 4EG3A 5DM1A 1Q1QA 3KSAC 3AEXA 4JI4B 1EJ2A 1PL0A 2NSJA 3DZKA 4HFJA 1MCZA 2R6FA 3KCNA 1Z6QA 5GZ1A 4D26A 2C7OA 1OV6A 4I5IA 2GZHA 5LMNB 1KK0A 3DR5A 4CM3A 2PLFA 3BGDA 1RI4A 2HUPA 1FF9A 1ODIA 1N8KA 4LYJA 4QBIA 4UNNA 1QDLB 3M4XA 5F9MA 5IT5A 3FW1A 2BHRA 1L5ZA 2ANBA 2L42A 2H3IA 5FORA 4XB2A 4ZYTA 1N2GA 3S0JA 2Q27A 3NDBB 3MINB 2TMDA 4Z9XA 2KKVA 1AHNA 3L46A 4UU8A 1U2DC 3CEAA 3LDHA 2XMBA 1CB7A 1VPTA 2DQYA 3F6PA 4BLOA 4AMGA 7MDHA 2J87A 4M1KA 5TVGA 4R0MA 1OWLA 1NR1A 2V3WA 5GMOA 5DX0A 3PRKE 5DB7A 5IDVA 2Q3JA 3AWDA 3DTYA 1S5LU 3PSHA 4FYWA 4C6TB 3QLUC 1SHKA 4CIVA 2NYUA 4Q7KA 2H1WA 4YQWA 4MS1A 1GG9A 2ZTCA 3BS4A 1BPBA 4G1VA 1X8XA 1X70A 4IH4A 2PM8A 2ZB7A 1QJ4A 4B7UA 5H4HA 4CNBA 4L6IA 4NS4A 1C7QA 1XU9A 1XYGA 3D4IA 4CZ2A 2P9BA 2O20A 3CUWA 4NFSA 3LLUA 4YA6A 2QF7A 4ASUD 1GGFA 4V2IA 4UBKA 1KJZA 5F77A 5C4GB 1QDUA 1TKRA 3KKOA 3B1XA 3EDMA 1J0XO 1V7PC 1MENA 2NZJA 4TRNA 3FPEA 4IGIA 4U7TB 2Q6TA 3WGHA 3BRWD 1GCGA 3CR7A 4FWBA 2HK6A 4RT2A 2O8CB 1G4HA 2L82A 4D9MA 5EP1A 2CYBA 2UYHA 4PZCA 5ERGB 3UG7A 1BJTA 1HE2A 4KQFA 4YS6A 1F8XA 4OI2A 1U3CA 5EQDA 1SXPA 1KPIA 2XGPA 4IIEA 2ISQA 3ZHVA 4AULA 3UZUA 3A0UA 1L9XA 2ODPA 3PUXA 9GPBA 2NN3C 3L8YA 2KOBA 4F3YA 1Z6PA 4GF5A 4P3KA 3GV5B 1KI7A 1W1IA 2UXDB 2GNAA 3OCZA 4OHWA 3RF6A 2AFIB 4ED8A 2PSHA 1N3LA 3D1LA 3E5NA 3MN1A 1C9MA 4URYR 1NE7A 3R0VA 2XCIA 4MV0A 4O2RA 1LKYB 4W7IA 5B6PA 2PTGA 1GAJA 4P4OA 4JOSA 2GWRA 4BO3A 4H9GA 2G04A 2PV7A 2DBZA 5ENDA 2JFHA 2WP0A 5CFMA 1XKLA 5IIKA 2QIPA 4EB6B 1PR6A 1MEEA 2FRXA 2R6AA 3EBPA 3L8ZA 1L8AA 4L4ZA 1AK2A 1KO8A 2HU7A 5A62A 2ZSIA 3IKMB 3NTXA 1KK1A 3FD8A 2C7GA 2IZ0A 5AT1A 4OHUA 3K0AB 1T34A 5JQGF 1JHXA 4Q1DA 2O1SA 2WAAA 3JYNA 5J9FA 5C8VA 2NO6A 2C82A 1BO6A 3FWYA 3Q7RA 4MJXA 2OE2A 1W2GA 3BH7A 3I42A 2BP7A 3TLCA 4P0PB 1S97A 4PZLA 5JXHA 1V8BA 1MJGA 4TS1A 3MR3A 4TMWA 2CXQA 4R0VA 4EBEA 1JA1A 3THVA 3I2HA 1FE8A 2GCOB 5AICA 2JEOA 4IHQA 4OP3A 2JEIA 1XKXA 2Q0SA 4ENVA 1N5OX 1GKIA 5TNXA 4DSAA 1M66A 3O3OB 3ETNA 1GPNA 2ZIEA 2IS1A 1K7SN 4HNTA 1B41A 1SG6A 4PFKA 4I5GA 5HFNA 3GYGA 3U4MA 2AYYA 4H7EA 3DEAA 4YRCA 1H2BA 5CA1B 3GLFB 3IOCA 4KV9A 3T1VA 1BMFD 2IX9A 5D5QA 1CZKA 4PV7A 1UFQA 1O6ZA 5LP6F 2RRDA 1QHGA 2WU0A 1RHJA 3CNLA 1JSXA 3VKWA 1IM5A 3Q72A 1U99A 1QYXA 3I0NA 4USAA 4Y18A 2PGIA 3UV7A 3VPBA 4CCWA 4ETIA 3B85A 1XGKA 3LPMA 4R8SA 1GUFA 1GCOA 2QZ9A 3BA6A 2YX1A 1R0LA 2UZ1A 1WY7A 3DFFA 1FMCA 1VYUA 4B34A 2VK1A 1PK8A 1Q22A 2UKDA 3JQ9A 3ORHA 4MLPA 4Q93A 5K6AC 4MR9B 2I9PA 2XTJA 1QCYA 5E9QA 1R2QA 4EBCA 3BHIA 3UF0A 1KVUA 1MV8A 1XLTC 3A3KA 3ADPA 1N0WA 3PQ5A 1Y33E 4OQQA 1WAMA 2G5HB 4XQ9A 3U9TA 5LQJA 1XCMA 1Y6JA 1HFEL 1B6GA 3ER6A 5EJMA 2A0XA 4RZQA 3FDZB 2HVHA 1YBVA 1C30A 2QRPA 3M83A 3MJCA 3IYLW 4FDTA 1N8NA 2PGJA 4M54A 2OWOA 3WTBA 1ZDMA 3RADC 4HRYA 3V4PB 3ISVA 2YNMA 4B5LA 1AHHA 4XWWA 1L3UA 4YN4A 3NWEA 4IXDA 4LX8A 4OREX 4ER7A 4DA7A 3VPXA 4PAMA 4ZJZA 3NXSA 4QL3A 4CLXA 5FPKA 3SBEA 4WOJA 4I3HA 1L8XA 1QAQA 1QZ3A 3C7DB 1AURA 3NYQA 3O9MA 4GGPA 3DVAA 3CNBA 4IY1A 1KY2A 3CTMA 2WPNA 4C7MA 4DEZA 4WVFA 4I3FA 4IDHA 4EJSA 1DC8A 3X1MA 1PYOA 1BYUA 3GGCA 1LSJA 4CQNA 4A15A 3RS3A 8ICAA 1CUWA 3MWJA 4UHCA 1KO7A 1ZYUA 3MJVA 1KTVA 2KQUA 3C3DA 2HB6A 2J9ZB 1HG1A 3IP9A 5DYIA 1I7LA 3D2BA 1JEEA 4KWIA 3T0GA 5FHQA 1W0CA 1TJ4A 2DPHA 2OCKA 1VA4A 2JAOA 4RELA 4BZQA 4F8RA 1RD4A 1UJ5A 1RM3A 4JP2A 2ES6A 2WDZA 5JE8A 1BDIA 1RYHA 3B38A 3BSFA 3ILSA 3GQCA 1NLYA 3D3WA 3RPEA 4QUHA 3SSNA 4W9NC 3OPYA 4I50B 2DXIA 4IDDA 4BQSA 3CG0A 1BE1A 1G18A 1K0FA 1W5BA 1WCWA 1AGXA 4ZRDA 2FPRA 3HUDA 5EMLA 3WAJA 1F06A 4B87A 3QYPA 4NZOA 1QYWA 2PS1A 1A76A 3GI1A 4R1QA 1U3TA 1NFRA 3JQBA 1Y80A 4X0EA 4Z7NB 2B37A 4KQXA 4WXEA 1F8GA 4RV9A 4X6LA 2ESRA 3FVTA 3TO5A 3AHFA 1JG1A 1Q0HA 4KFSA 4KMOA 4U6PA 4IAOA 1G6HA 3VPFA 1ABFA 1WZ2A 2PGXA 3RT7A 3AHCA 4ZI5A 3LXRA 4H6PA 2WAQF 3PQ6A 3GD7A 1GZSA 3GA0A 3OIWA 4PHPA 4CKXA 5B2EA 4B2LA 3SF8B 1N6PA 1IY1A 8ICEA 4MKFA 4OKSA 1Q0SA 3A26A 4JZKA 4NECA 1T13A 1A97A 1X7YB 2LR0A 1FIUA 3NUQA 1E9DA 1C7IA 1O97C 5BSWA 2VPQA 3I2FA 1B8UA 1FNNA 5LBIA 4K9MA 5JVDF 4QLOA 2Q99A 3LQ2A 4R1MA 4Q00A 4LKRA 2J0SA 2G1AA 3G5MA 3TKAA 2O57A 4OQYA 4AQ7A 1BG6A 4RGYA 1SC1A 4UNRA 3BD6A 3P26A 4F96A 2DQNB 1RYMA 2B34A 3CP8A 2BEVA 3OWHA 5LXTF 4HADA 3WGIA 3BICA 4M9SA 1TC1A 1WCXA 4JQOA 4D9JA 1V9LA 3UAVA 1BQ3A 2JCGA 3JD3A 4KQJA 3J81A 1M7GA 4EG7A 2QROA 3FRHA 1YSCA 2NGRA 3KYBA 3PFFA 1Q0ZA 2W4IA 4C4PA 1ZJ4A 2WTNA 1I9CA 4HQKA 4EA6A 4IFTA 3MBYA 3C5GA 3RC9A 4NYMR 3ZI0A 2BBWA 4Y3UA 1JSLA 2BUBA 2F90A 1N1DA 4G25A 4ZVQA 2PL9A 2QP9X 4QOGA 4XB6B 3E5HA 4BVBA 1X7XB 5C5IA 4LF4B 1XZEA 3CRNA 1QTQA 2ZS9A 3URMA 3OKAA 1RYYA 1U0BB 3ODPA 1N36B 2P2YA 3QU4A 3CIOA 2OG1A 1QBGA 4RNNA 3GBPA 4NE7A 5EKUA 3IR5A 1NPTO 4ND7A 3VR5A 1ZOOA 5CGQB 4E5NA 1A98A 1XA3A 4H16A 4DCMA 2AG5A 2X2OA 4REOA 2BRUA 4AYTA 3ZJTA 2Q1SA 1NR5A 4YJ2B 2Q0HA 4EYIB 5L40A 2IYRA 5BN5B 3REQA 2BWJA 3STYA 3NASA 4HS4A 5M29A 4ISBA 1IOVA 2FXVA 2OZPA 2PJUA 5TLSA 5TPWB 4YT4A 3ZLUA 1U65A 2RLTA 5D4BA 2ANCA 1N5MA 5IARA 2FQXA 1ZA1A 2VPXA 3MGHA 3LUHA 4M9GA 4ZDWA 2F1JA 3DZGA 3IQHX 4MCJA 3HCEA 2G40A 2L19A 1XELA 4GC7A 9ICBA 1O87A 2QMYA 2XC9A 4GXQA 1L5OA 4L0MA 5KFFA 1CUGA 2OFOA 4B8ZA 2ZIZA 2GZAA 4LVNA 2ZUTA 1G8MA 3F2IA 4E09A 1SXJA 2MINA 3D2QA 2GN0A 3GNTA 3HLTA 1E2FA 2NX2A 7ICRA 2QRKA 3KR2A 1NG9A 4AYXA 2ECFA 4M0UA 4UVGA 3NBQA 2FCRA 4M8IA 2LYBA 1OASA 1Z29A 2JGKA 4W5WA 2JARA 3B0YA 3BS5B 1UOQA 3AUTA 5FUVA 5GJWC 5K0LA 3W4KA 4BO7A 4KOEC 1YONA 2R96A 4LJYA 2H0RA 1UUFA 2QORA 3A1EA 4NFHA 4MVXA 1CNEA 1IRIA 3WDKA 5KREA 2BKXA 2PAAA 3LX4A 1AT1A 3O94A 4UB3A 3EWIA 5CNKA 2H8KA 3JQGA 4OYHA 4IRKA 2VH2A 1EZZA 1DE0A 1WUYA 3CVVA 2XXAA 2R18A 1UKEA 1EFUA 1IXZA 1JH8A 3GRCA 4EW3A 1O96A 3HMKA 5TT0A 2EX4A 3WWYA 4YR0A 4CTKA 4FXOA 1L5KA 2NSYA 3EC7A 4JXKA 4ESOA 1OXSC 4QUEA 3HBMA 5EAIA 4DV7B 3RAFC 5CIWA 3L7YA 1YASA 3ITDA 3KTQA 4EF5A 3A9TA 4I1VA 5KWVA 3L0OA 1E0AA 3C5CA 4L28A 5CURA 3IAHA 5KS2A 2WI8A 1Q0QA 5FI3A 1GO3F 3SF8A 4A6XA 1KO1A 1ZIDA 3NKFA 5HGJA 2WZBA 4JAVC 4CCSA 5K8LA 4LFCB 1H8HA 2HQ1A 3TTTA 4DIUA 1F9AA 3ZHQA 4O02B 4BJ1A 2NP7A 1KAMA 4GXRA 5KOIA 5C31A 2W9CA 2GD0A 2OY0A 3HJRA 2ZYSA 4HLUA 5H8WA 4GC9A 1GGVA 1QIMA 2ZLBA 3EGIA 3F97A 1JALA 3MW8A 4UTNA 4I8XA 2HT1A 3EYZA 1W93A 2P6RA 2D5IA 3H9EO 3KUDA 2H9YA 3BD8A 3CX7A 4RK4A 3VH4A 4JK3A 1ZGGA 1AN9A 2X1MA 3NC0C 4OJQA 4A0QA 5ALPA 2K7ZA 1UK8A 1X7HA 5IAJA 3VNQA 5T3YA 1WB9A 4X1YA 4P8RA 3NDRA 1AGYA 3E05A 3NS7A 4JYPA 5DCLA 3SQLA 2XVMA 5CG1A 1EG2A 3OUUA 5G4KB 1DEOA 5J3JA 1CD5A 2I55A 2V0CA 1ONBA 3FYUC 2NT3A 3NONA 3Q7TA 4QXRA 3GLHB 4J0GA 3AG6A 1C1XA 1Z2AA 2EERA 2P6NA 3ENQA 4HNHA 1I5EA 3PQ2A 1KDVA 4BX3A 4HYYA 1OH5A 1YKSA 4K1XA 3L7NA 4BVGA 4UD2A 2VP0A 5LDGA 5LYYA 2YUTA 2QLFA 1AOXA 3S2SA 3L6OO 1AKRA 2FN8A 3H8WA 5A3JA 1OXUA 1KIAA 2EDUA 2R6ZA 3E7FA 1VJ5A 3AQ4A 1N4AA 4AC9A 1HT3A 2PXHA 3PZRA 3RB8A 4MPDA 1G3UA 2NV0A 3NHWA 4RZ2A 4TLLB 5KJEA 1AH2A 1TVAA 4QPJC 1GP2A 3JALA 3I62A 1JDBC 1GZDA 2PSSA 4JP5A 3RS7A 3NT4A 4CIWA 1A9ZA 2B98A 1CETA 2DTDA 3BK2A 5THXA 1HURA 1T0UA 4CUZA 3OQMA 1PRYA 2AKYA 3OHAA 2RB5A 1A4IA 4EX7A 3BXGA 5CHYA 2MSDB 3B20A 2IK8A 4GT1A 1J5PA 1HOXA 4IIJA 4RIFA 3U1BA 1HT2E 1L7DA 3NGDA 1BWRA 3NTLA 2DHEA 4HAYA 3WDLA 5IJ0B 1HEUA 1N7HA 2X4GA 1DRGA 3BH6A 2IOHA 1JIKA 3PFGA 4NS1A 4D8UA 4EJMA 4JXZA 1PN3A 3H2GA 2K4EA 1ZM2A 2FX2A 1T4CA 1FFAA 3ZYZA 2KLHA 1U28C 3NBKA 1TB4A 4FFNA 1KEEA 3O8OA 4MKGA 5DB4A 3B78A 2VBCA 4IJUA 4CM6A 2HRBA 2BD0A 3EGEA 4UNSA 4X1YB 5CAEA 1KRXA 2BFEB 2IE8A 1L4GA 1ORHA 2G4CA 1KMIY 3H13A 5K8IA 4KAXA 1D7AA 4ZEXA 2QRHA 2EFYA 1QUFA 5J2DA 3PNPA 1RYNA 1MORA 3ZU6A 2C94A 5CGZA 4RULA 5JCJD 3HVJA 5LQDA 5E3JA 1SVKA 3PQ8A 4HGOA 1YDFA 5KYYA 1WUJS 3JD2A 3RBXA 1EDEA 2J3JA 3OJWA 3KAJA 5FWNA 4MQ5A 4ZOHC 4RABA 5C9ZA 2TMYA 3BDPA 2VHTA 4LGMA 4DVJA 5LOVF 1M2NA 1U28A 2VDUE 1PJCA 2XTZA 5AVZA 5EPOA 4DBVO 4TYNA 3JQ7B 5AKKA 3QOXA 4RVFA 2C5SA 1UBLS 2DWCA 5BW5A 2WM2A 1OV4A 4Q8EA 2F3UA 2ZYAA 3ELYA 1EDZA 3F6CA 2AEJA 1SV0A 3OFVA 4XH9B 5EJ9A 4F06A 1HNXB 2CHQA 2H3VA 3WNBA 5K4HA 1H3EA 4J4BA 1P0FA 3W2FA 2I0FA 4OB8A 2H11A 1IWBB 4FMCF 3LJKA 2A67A 1WU7A 1IZYA 2IC5A 3B1WA 4UUNA 1KOLA 4QJBA 4DZZA 1C0EA 3HVRA 4LQLA 1WXEA 1QV7A 3K0HA 2HHQA 3OQIB 4YJ3A 1QH8B 2VPTA 1JT9A 1H1LB 1PG2A 4JXXA 1P7VA 1E8MA 4XWYA 3TZKA 3U1TA 3LW7A 1KMCA 4O08A 5C5EA 2HC9A 1W4ZA 2UYCA 5J0OA 1C81A 4Q9NA 3JPYA 2NXCA 1L4YA 1E62A 2JGDB 1Z5GA 1JG6A 4RAQA 1D04A 1DWQA 3JPRA 2FMXA 3C1AA 2FSFA 3QQPA 3L07A 4Q37A 1J2NA 2EKBA 3KJHA 1QMPA 1C3LA 1QPGA 5LN1A 5EMJA 2VYNA 4KRYA 1BXGA 4F45A 4HDNB 4RU9A 2DP4E 5KTPA 3T7AA 1BDHA 1PJAA 2PZKA 1FSSA 3KUKA 3N97B 2R8RA 1P33A 1RKBA 4NEHB 3HYRA 1UFKA 2C2DA 3C3BA 2BF4A 2W8LA 1J0DA 3LDGA 3QWBA 1KJQA 4X5VA 4B48A 4B2YA 1E96A 3H42B 2VA8A 1SBZA 3KU1A 3O92A 1FP1D 1X1BA 4HJXA 5JSUA 3OX1A 5DM2A 5KAPA 2P0AA 1TJNA 3I34X 3MA0A 4RMHA 3TD9A 3VZRA 1FTQA 4F46A 3LWBA 4RA6A 4I1YA 4PONA 1IQRA 1NBHA 4TMKA 1WSWA 4G5QA 1YNOA 2O2IA 4M86A 5EIXA 1YKGA 5D46A 5AKYA 5A4JA 1NTOA 2FEOA 3RLIA 3GLUA 1W8DA 1CUIA 2BCQA 1IXRC 1NKVA 1KU6A 2OXRA 1ZGJA 4YJKA 1JHZA 5DHAA 3VR3A 1Y3IA 4KLOA 1Z08A 5GAJA 1V9CA 2ZJOA 3HR7A 2Q1UA 2BCGY 3TOZA 2WD7A 4DV3B 3DF9A 1VYTA 3LAWA 3UV3A 2C28A 1YB2A 3GGSA 3QFFA 4D0SA 1P1FA 1PDOA 3F9RA 5D01A 1I36A 3O8QB 4IDOA 4MI1A 4QDUA 4XSGA 1WVGA 1YR6A 1U7TA 3ETDA 5THQA 2AXTU 1R0KA 1E9AA 3TBKA 1AHPA 1CULC 4X1IA 1FP6A 4NMXB 2E5FA 3D7MA 3JZIA 4YCJA 2IU0A 3PIRA 4HFNA 3TE7A 1YHYA 5I9SA 4FZ3A 3WKAA 4YMLA 3GJ7A 2H2AA 3FUUA 3Q0EA 1RE0A 5F64A 4ANFA 2JCSA 2ZCUA 4DWVA 4AY6A 5DG9A 1F5NA 1C7ZA 1N2JA 2PNJA 5CFLA 1YOVB 2O0MA 3THYA 4BFWA 2XY7A 1M1YE 1D2HA 1IATA 4G23A 4Y8VA 5BUCA 4ZCRA 1P1CA 2Q5FA 2WFLA 5CX4A 1VCIA 3QLUA 1P4GA 4NOKA 1ZM7A 5ITWA 4OIFA 3VX4A 2I8LA 2M9NA 4INOA 3C3YA 2GYYA 3EZNA 3GV8B 1L3SA 1A9TA 2EWVA 2IJGX 4HMQA 4RMGA 3W5SA 1RAIA 2WC1A 2YYYA 5IH7A 3VR6H 1LX6A 5ALNA 4HYKA 1GQFA 1VGQA 1YA8A 1QOPB 1PZXA 3PUZA 1XXHE 3ISDA 1ZQEA 3GR6A 3P9QA 1SVNA 4R2LA 2RSLA 2P0YA 4JLKA 5JAIA 1SK8A 3ANMA 4MZDA 2BCEA 1XKTA 3AL0B 4F3NA 4MUYA 5JSZA 4JGIA 3EVAA 2FSHA 1KO5A 2QV0A 4Z6FA 1NFQA 2BIFA 1PL6A 1GVNB 2AXNA 621PA 1NC1A 4MR8B 4O2AA 1PT7A 1SUAA 2Z30A 3AEYA 1XSPA 4ZAXA 1UDXA 5TR9A 1DVRA 3QE2A 4HLUC 2FMTA 4WN9B 3IVCA 2AKAB 3RO7A 4CNQA 2GR9A 3MVEA 4DV2B 1ULUA 3ETEA 1DWPA 3FFTA 4M83A 5KQRA 1JR4A 1OUQA 2CT8A 4QJ3A 5CDFE 2JIMA 4IIXA 1DO8A 4MEAA 4Q1AA 3K16A 3UA3A 5DQGA 4NU5A 4RD1A 1RXIA 3BIJA 3ZGZA 2GFHA 2ZJ5A 2WHPB 5JS2A 3VU9A 1N2XA 2VT3A 1TUBA 5EE0A 3FIUA 4I55F 1XZFA 2LCIA 3I58A 4OY3A 3TLBA 1Q7CA 2YXBA 3U5ZB 4U2BA 3TCKA 2E21A 1WLSA 3D59A 5JZBA 3L18A 5CYOA 2FUEA 5IZCC 1Y4UA 1ZJ5A 4GYKA 1R8JA 1ZH2A 2O3TA 3K31A 4PCLA 5IIMA 1YH3A 1Z2DA 2XB8A 5B53A 2VP5A 1JSCA 2NZ8A 1PNRA 1EAMA 3HPOA 1LF0A 1THZA 1TLFA 2ZUSA 4WKOA 2OTCA 3BA1A 2P66A 3K0KA 1JDBB 2WUVA 3ENNA 4Y6LA 1P77A 2VT7A 4OQFA 2JLVA 3ADDA 2P9EA 2QPOA 2PAFA 2Z43A 3PL5A 2ZEJA 3DD1A 3LUJA 3IFSA 3LO5A 4XQ0A 3RKSA 3WRYC 4F04A 3IPYA 2YYSA 1FFHA 3EW7A 2EFHB 3OY7A 2BR0A 5CXSA 4F8YA 2EIHA 5DKWA 4TLDA 1GRQA 4RLFA 1UPUA 2VWGA 2W55A 1A9YA 1CUXA 2D4AA 1YS2X 2D0OB 2VP3A 3C3MA 4JJ8A 4UFNA 1UBFA 3WR5A 4QLAA 4AX8A 2FYTA 4BNTA 5DXFA 4KIWA 3RIMA 1QX4A 2J5BA 5AP9A 4Z99A 5BMVB 5KYUA 4UTVA 4S05A 1EUDA 3UMJA 1W5EA 2EQAA 2JHPA 3FN4A 1E2IA 2I6QA 5EN4A 3LHKA 3OC0A 2X58A 4YFKA 3LP5A 2M98A 1U1IA 5JCOC 4YRFA 1B7GO 3AJ9A 1Y88A 2Y4NA 3NOVA 1NZBA 1S4MA 3EDRA 2AQ0A 1E3IA 1W19A 3P9NA 3R6LA 1CS4C 4RCVA 5FPSA 4KXFB 3PYLA 4I1SA 4WUTA 3A1DA 4MUAA 4JJ6A 3AVTA 2Z6AA 1NF3A 5LMUB 4QWBA 1QORA 3IDOA 4O3PA 1DSSG 3DZBA 1PWYE 2W2MA 1ULTA 1SKWA 5HJ5A 2QG4A 3GJYA 1GWNA 2FGJA 1W5SA 3W2HA 1FVFA 4CPDA 2NMVA 3QGMA 4MHOA 5U4XA 5AXDA 4V0KA 2LBOA 2P2LA 2PFQA 1E5QA 1YXMA 3L82B 4L9RA 3EVBA 2HHVA 4YPFA 3FYTA 1R16A 1U7OA 4NVRA 521PA 2D5AA 3ANSA 4XGIA 8ICNA 4QXAA 1CZUA 4YMGA 1WF3A 1WB4A 3RR7A 1V3QE 1WW3A 4PL2A 2PJZA 3BJIC 1R88A 4LDAA 4MVCA 4I5EA 1XXHB 3BQ1A 3R75A 4XRHA 4GI5A 5CYFA 5KG0A 4ISCA 1M2HA 2R87A 4CKEB 3MWEB 3N6VA 4MICA 2BGMA 1QAOA 2LNDA 3AU6A 5KFEA 2ASLA 1Z19A 2A7XA 2PZLA 3KEFA 5F5NA 3U0BA 4DCPA 4EIWA 2Z2KA 2XQIA 4HEHA 2VF4X 4BLSA 5DQHA 1JZQA 1QS0A 1SHLA 3DV0B 2MSCB 4I46A 1JR2A 4XLTA 1ODFA 3W3AD 3KCQA 4AW9A 5DPMA 1JFRA 2Q7XA 2N47A 3IAUA 3PRHA 4ENSA 2PUHA 1XRPA 2QRJA 3HW8A 4OAOA 5FJJA 1CFZA 4YK7A 4YRSA 3EZ2A 3K0AA 3QVUA 4EEYA 1FLAA 1UP4A 2AF4C 4DLUA 4AMYA 1OPXA 5K2OA 2DUWA 2E5SA 2X8JB 3CLRD 3QE3A 2F3SA 1RBMA 2QUJA 3TX6A 4CT0A 3T5KA 2AJ8A 1UAYA 1RYUA 4O3NA 4L8GA 5E7JA 2FPLA 2REQA 2I76A 1JJIA 3MABA 5DNDA 4U00A 1K9SA 3PHHA 1R9NA 3N6XA 3CBQA 3WLSA 1DKUA 4DFJA 1DTEA 4ECAA 3DC7A 4ESHA 2WFAA 4N65A 3PDHA 3I83A 3L7LA 4UFOA 3QPDA 4ZOEA 1XAJA 2R84A 2YWDA 3ESRA 3HEAA 5HHHA 4TL7A 1I14A 1TT5A 3GFGA 4OV6B 3D5QA 5ALQA 2AN1A 4ME6A 3A1WA 3C98A 4KMMA 3E4CA 2Q0XA 2ZXEA 2BH9A 1T4CB 3K9NA 4W7HA 5B7GA 3ECAA 1BNCA 1QPZA 3FPSA 3ZZNA 3R9KA 4TTTS 2V9CA 1G8FA 3NVAA 4DSTA 5LP6B 1RBYA 1GQQA 2PZBA 4X91A 5DX8A 2C2EA 3G2OA 4C7VA 5IT0A 3PI6A 5ECDA 3M5PA 3SZUA 3HJGA 4EENA 2W2XA 2P30A 3WMFA 4BLPA 2ESEA 2F8LA 9ICSA 1USVA 4QDKA 5H02A 4YRKA 2IEZA 2AVDA 2MDTA 3OD1A 3RYHA 2BFPA 4CDMA 5CT9A 4AYBF 1Y7IA 5ERYA 1J6UA 1T8WA 3DP9A 5HE8A 4F6LA 5I7RA 1GCAA 3Q3HA 1ZGHA 4BAGA 4NHEA 2RBEA 2E48A 4TUSA 1UAGA 1MX1A 1UMBB 3BWXA 2B35A 3GEIA 1YHNA 3L7DA 3OURA 3R3HA 2QVZX 1Z7YA 4FR5A 4N5NA 1PTJC 1CJSA 3RWMB 1JG2A 3V1YA 4BNXA 4DWOA 4P4SA 1WX1A 4BO8A 5LSAA 4C78A 3PE3A 2PGNA 4LJLA 3IBCA 2BRUC 2VPIA 1BW9A 1P29A 1VSQA 2FMKA 2ZBFA 3OZVA 2O14A 1O6GA 2Z5VA 2HNKA 3DZCA 2EKDA 3A10A 3NCTA 3ILHA 4C05A 4EYSA 4JDUA 4ZHQA 2X7HA 1M75A 1B0UA 3M9LA 1V9PA 2IHNA 1TJYA 3WDMA 3FLAA 4ZVTA 1L5QA 1N2CE 5IASA 1SXIA 3QXHA 1ZOPA 3KHGA 4MVJD 4WFQA 2O0LA 2PEZA 4Q39A 1ZQ9A 5AKHA 3RTBA 3T3FA 3TZEA 1NGSA 2RH9B 4NU6A 1IM4A 1T9DA 9LDTA 1M1YB 1VJDA 1QM5A 3INGA 4OQMA 1CUUA 2R2AA 1S89A 3PUVA 3SCZA 3WX0A 4EWLA 4HGNA 5KCZA 2BFNA 2Q3BA 3FAZA 3C6XA 4HMPA 2IUUA 1A7UA 4CFSA 1MAWA 4R1UA 3NTQA 1SEPA 3PC8C 4C7ZA 3GDWA 2VYND 3UXOA 2BY4A 2LYAA 4BMYA 1VCMA 2EW8A 3BJYA 3NVMB 4OUKX 3GGPA 1U8FO 3TZQA 3WGKA 3JTMA 3R09A 4GX2A 2D5CA 1F2TA 4RPXA 1YZKA 4LIPD 2FSIA 3ZR4B 2JIQA 4DUPA 4B7AA 3QMVA 2GOLA 4JGBA 4EUSA 1W85A 4EHDA 4CDNA 1AG9A 1U4OA 1WQ1R 4KXWA 2IHYA 1M8KA 4BN5A 1Z88A 2M0NA 3DUFA 4UAGA 2IX3A 3MCVA 2VC2B 3HKBA 4FC7A 1RYEA 1CJUC 3QITA 2WY2D 3ZQJA 1C4WA 1CZNA 3M5CA 1T8EA 4OFBA 4CU2A 5FTJA 2YCLA 2G70A 1RAEA 4I4LA 4PPQA 3SGLA 4HB2A 3ZQKA 2JRLA 3C97A 4UUMA 3ZYCA 1IEXA 4LDRA 4NZMA 3GJ0A 3R3JA 1A6SA 2PRYA 4HSGA 3I3OA 5HEKA 2JVIA 1YZUA 3K2EA 1XNQB 2X22A 1OYWA 5IJZA 1KAQA 3R7WA 3EVEA 3MDAA 4H0CA 1I4EB 2DBYA 3QI7A 3PPVA 4FD3A 5H59A 3WLPA 2VYVD 1DC3A 2XYHA 4Z0TA 4EHIA 3GLHA 2AOVA 1SCIA 3PENA 4POAA 2Q5LA 3LLMA 2ZIUA 3RAPR 4AURA 3PE6A 5B7PA 5IDQA 1I6KA 4KVFA 3OUTA 1FRZA 2YQZA 1G21E 4K40A 5EY5B 1F4LA 4IWNA 1VYHA 2FFJA 4JR0A 5KX5B 3EXEA 4K26A 2ZWAA 4DMGA 2J9FB 4NE9A 3KKEA 4BFCA 3RRXA 2CRXA 2VYFA 2ZSBA 2GEDA 3FOAA 1CB0A 2PWAA 2PX8A 3H11B 1PS8A 3L06A 4ECXA 1T1SA 4G5RA 5BOVA 1PSWA 1TU4A 3H1TA 4IS2A 4RJIA 3UXEA 1LNZA 1DDGA 1ZQXA 2A8YA 1VPVA 4HDCA 3U3MA 1MAVA 3T7IA 2JEFA 2ZU0C 1K6XA 3USZA 4HX9A 2J0EA 5D6OA 1D1PA 1HLFA 3LQFA 4C76A 5CEEA 4QYIA 2C2BA 5BW8A 3AQEA 2HLDD 5KJ1A 2A30A 1NYTA 5EWMA 4BEVA 1J5EB 4MB0A 4R40A 4F71A 3SR0A 4Q9AA 4EPWA 1VFPA 4GPIB 3I8XA 5KFRA 2REBA 2VSYA 2ODGA 4RYDA 4NLGA 1TEXA 5ARBA 2Y27A 3F3MA 3LT2A 3P45A 1CHDA 3I5AA 1P0IA 5I9LA 4UB2A 1PEKE 1Q20A 2XD4A 3MIIA 3PEVA 1Y8RA 1U9ZA 1EGAA 2VQ3A 3E9CA 4IO1A 3BE5A 5KKNB 3CJRA 4G24A 3NAGA 3KWFA 4BYGA 3O1JC 3OQ1A 4JMPA 3H4DA 2Z1MA 3RU2A 2XA1A 4N5LA 3BMQA 4ACOA 4F2RA 1O6FA 4KNYA 1B3RA 3BFXA 2BDEA 2NU6B 2DSNA 1OZHA 1RRFA 1UL1X 2IU4A 1BEEA 2ZSFA 1RZTA 3DZHA 3IELA 3OVMA 4G1CA 4JA2A 4K8RB 4MLZA 5JLAA 4C7BA 4Z53A 3OJSA 3SFZA 1TCVA 2KKPA 4U0KA 3N8DA 4EMBA 5BUQA 1DNPA 1PSZA 2Y1CA 3I9JA 4KN9S 4Y1EA 5J0RA 4RHCA 3I37X 2W0SA 4LWOA 1TZMA 2XA9A 5DTJA 1OD6A 4QBHA 4YAOA 4BDPA 1S3IA 5J4YA 1F0KA 1YGYA 4N7RA 4ALJA 1V16B 3OCVA 5E4FA 4C30A 4CQMA 1EWTA 1CYEA 3K8ZA 3LCUA 3QSYA 4MKHA 3HMQA 3Q9SA 1TVKB 3SYRA 1EBBA 4Y0VA 5HDQA 4RJTA 1MH1A 4MWOA 2QJRA 3OSUA 4QFDA 2WR8A 4AXXA 5JS7A 2ZIAA 4FD2A 3F53A 4JVSB 4ASUA 2O6HA 3TIXB 2C7PA 4RIGA 2HR1A 2CYAA 3SI8A 3AJAA 1B6TA 1ZICA 3G5UA 3D6FA 4CMAA 4GKAA 4PS0A 2ZS8A 3CH5A 1EWRA 1I2MA 4EHHA 4EG5A 2XBMA 2YIMA 2NV3A 1K9VF 1U9IC 3KU4A 2KX7A 3CJQA 2OV8A 3EQ8A 4O29A 2D06A 2R00A 1GZVA 3VBEA 5JS6A 5KDLA 5JJBA 2RHFA 1N3YA 1G8YA 2HSDA 5I51A 1YFKA 3ZU4A 1VLVA 4DANA 3RUAA 2A9FA 2OO5A 3KSDO 4LMRA 1NQAO 1I4DD 1ZVQA 2W6JA 2G6TA 1EUCA 3LKDA 4BLWA 5J0UA 2A92A 2JFUA 3IG5A 4F4HA 4QQRA 3FCEA 2VTVA 3GWGA 5B2FA 3F71A 2HHWA 3MD9A 5CLJA 1SKMA 1RLUA 3TW8A 2DBQA 2B4QA 2ZRPA 3QBTA 1WABA 3V8EA 3ZG6A 4IL6U 3IVMA 2VA2A 4G86A 5KL1B 3NP9A 4YAEA 4AO7A 4FS8A 1KK2A 4GR9A 4IQ4A 7ICSA 1CR2A 2FDXA 1R6AA 4RESA 5KVCA 3PK0A 3RVBA 3IAM6 1SWWA 2WTBA 5BYJA 3X0DA 1M5UA 2PFSA 3AF2A 3WGNA 5IVPA 1ONOA 1E66A 1A8IA 3GLGA 3AW8A 1QVZA 2JLQA 5EJAA 4Z0HO 4Z4IA 3R5KA 5G41A 5G1PA 2ZANA 5K8UA 3KR9A 2H3EA 5E1OA 3QPWA 5T4EA 3RK0A 3V7WA 1I0LA 3H0RB 1H6DA 4UASA 4PHHA 3FTDA 3WBFA 2QTMA 3ZJVA 2XIJA 3IHQB 1UBGA 3F6YA 2A5YB 2F7SA 3GEDA 3FWZA 1VTKA 3OKFA 2AFIE 3V1TC 4Q82A 4YCXA 3KUUA 5KFQA 4HXGA 1YOBA 4L16A 4Y2GA 3DR3A 1VL8A 5JALA 2XCPA 3FSGA 1ADCA 5CCBA 3BJEA 4RVHA 3R7NA 2QIOA 3GXBA 3VI3B 2IS2A 4F4YA 2F17A 2O2GA 3C2LA 3NC1C 1CNFA 3I2YX 2H5XA 4OF4A 2AWOA 3SIPA 4BAZA 2IHMA 3CZCA 3OOSA 4MA0A 1DK2A 1GGKA 4E5YA 4J16A 1NMEA 5IWCA 1ZUNB 3TLGB 5DKFA 4IMIB 1V26A 1VHLA 4V03A 5FOQA 2O3QA 1AF7A 4ZDJA 3C4VA 2ES4A 2FPUA 3PC7A 3QY0A 4IFIA 2DFKB 5ADWA 1NXWA 2ZRJA 3T9EA 3V55A 1DCFA 1BA2A 1X1AA 2GARA 1TQ2A 1G19A 2P2ZA 3BMCB 4BO1A 2ZRKA 3KV1A 4Q1CA 3EPKA 1C3VA 5LR6A 5KFVA 3NDPA 5KFIA 1L8QA 2JZCA 3Q6IA 3ESDA 4TQUS 4WZAB 4WOBA 4LHYA 1JEYA 2ZI5A 1BWQA 3TL2A 1PX0A 4IICA 1BTOA 3V7UA 3RC8A 4AIRA 1I3CA 1T25A 2A33A 2C61A 1WWVA 2R4TA 1LRKA 2GTHA 3HXPA 4PQGA 2X9LA 7ABPA 4QZEA 4HH3C 4Y6RA 4RY8A 5J2GA 5AW1A 1SJ9A 2EFJA 3DHWC 4XX0A 1CQXA 4I4IA 4DR5B 1D3AA 4ZRMA 2GK6A 4IDNA 2DLDA 1D9DA 1IY9A 1LNSA 4EZ9A 1IUOA 1ZNZA 2O2YA 2X23A 2Z4RA 1L5GB 4HZUA 4C5CA 1S0NA 3H2IA 2B1QA 3CRQA 2EKQA 1BXRB 3LXMA 4BTVA 4Q3BA 2C5HA 3V6HA 1DLJA 5BWMA 1SKSA 1JXEA 1ONNA 3KQHA 3I5YA 4B9NA 4XIYA 5BVHB 3WV4A 4P08A 1SULA 2E37A 3MB8A 3CSSA 3FR7A 3QIAA 4IJKA 3RFVA 1EK6A 1QCKA 4ZT7A 4WKBA 3I73A 1Z38A 1XRQA 2R8KA 1E4YA 3P9SA 5FFFA 3U4DA 4B81A 5AI5A 1GITA 2P9QA 4EFKA 1EM8A 3B36A 4TMYA 2WUFA 3S2UA 4OXNA 2AL7A 2REOA 2QDKA 4TL8A 2AOXA 1KRWA 3RW9A 2WZCA 4JX8A 4RQ1A 2A57A 5JYCA 1G16A 1AS3A 1ZQWA 2WSBA 5DH9A 2TMGA 3MRSA 4HY3A 4WZBA 3G0DA 1L2TA 4W1PA 1TA4A 2PX2A 1COWD 2TECE 2ZAGA 3BF7A 3RASA 1MW8X 2ADMA 3EA5A 4KGVA 1FRNA 1NYRA 4NARA 4XVCA 2JIZA 2PD4A 2ZB8A 3A04A 4HMOA 2NTYC 2V5VA 2ZBRA 3PR1A 5DULA 4F56A 5IZ4A 5AMXA 2RQ5A 3KBOA 3TZBA 1ZHHA 1LBHA 3C74A 4XVRA 2W6QA 2Z5FA 1K1EA 3B3QA 1FBNA 4YECA 1WHTB 1UC5B 4CYMA 4PGGA 4MWEA 1K5OA 1HUQA 2J7PA 3BB4A 3RHFA 4YJ3B 4A3SA 4EA9A 4LF8B 3EK2A 2ZJ6A 1N6RA 4WNAB 3EXHC 5F2OA 2O8FB 1DCKA 2QM8A 4OSEA 5DOZA 3VU1A 1U0LA 2N46A 1A1VA 1XWWA 5H83A 1K08A 1O8CA 1OB2A 4M6WB 1TTQB 4IIJB 4INPA 4LYHA 3VZBA 3SDSA 4DSNA 1N5XA 1KQOA 4FBGA 1J97A 1EUDB 1RM5A 3A2MA 3NHSA 2QGZA 1N9ZA 2P5SA 2QVBA 4WI1A 4MH0R 4XEUA 1J0BA 1WSBA 1YRLA 4DLNA 1H9BA 5B64A 4XA8A 1FFSA 2R6R1 3TL6A 1W94A 2VJBA 5HKKA 2JAHA 1DQZA 1NBMD 3H2HA 4DDHA 3ZVLA 1UXJA 4UCQA 5TF0A 1T3NA 1KVQA 2P2SA 4FWIB 5KAMA 2QT1A 4D96A 1ZR4A 1N2OA 3W6ZA 4I2BA 4EFMA 4CEIB 2QM0A 4L3OA 4TKVA 1Z2OX 4L2IB 3ETLA 3WB9A 2BGIA 1NUPA 2J09A 5FI5A 4B2IA 1AKUA 2RHGB 3TFSA 3W3ZB 3Q5GA 3PMLA 1OBVA 5AVOA 1SCBA 1XPUA 1O03A 4IIGA 2GYWA 3EZFA 1AKEA 2R6JA 2YOFA 2FZKA 1VLBA 4J7CA 1XFDA 2W2KA 4Q4JB 4Y9SA 2OOSA 3DPIA 3MT0A 4LOKA 3EQ6A 5G0TA 3SP1A 1HUOA 1YIAA 4PCAA 3VUFA 3JYQA 1O3YA 3UQYS 3FZQA 1HMPA 3O83A 2JNWA 3M9XA 2CMKA 4PFSA 3HJNA 5A4KA 1O77A 3GP8A 1YULA 3ST7A 1C1YA 2RGWA 1G0OA 1FS5A 3BE8A 5GIPE 1E32A 1E6KA 3ACBA 2AI3A 4ECQA 3VOTA 4FT4A 3W05A 2KV2A 3AX6A 1T9AA 1F3LA 1Q1NA 1UK7A 4PO1A 3QEAZ 1JPNA 1WL8A 4RKWA 4AKSA 2HA2A 3ZXIA 4DLLA 1ZN2A 4JB8A 1XN4A 3S7ZA 2QN2A 1UBSB 3OIVA 4MGYR 4ZVLA 2QSUA 3ITNA 3T9AA 3DONA 3ZY6A 5AKIA 5BT8A 3V6KA 2GGSA 2J48A 5ALWA 1DIHA 5DT9A 2FVYA 4P36A 4QNMA 5GWXA 3ADBA 2DETA 1RXYA 2QVLA 2YYAA 1V2HE 1W1UA 4EI7A 2VXYA 4S04A 2VJNA 1KZ1A 3ZD6A 3HCBA 3I2IA 5K5EA 3FHTA 1R00A 3RIHA 4FOPA 2SKCA 3CEPB 3TFOA 3JQAB 4RVNA 2YVAA 3FUTA 4B9UA 3C1UA 4B9TA 2B7BA 1XO0A 3CLSC 1ZQQA 1UK6A 1KMHA 3UK6A 1ZA2A 2JFYA 3W5UA 4MX8A 3O3NB 1XTJA 3MS4A 5LVAA 4GE3A 5FT9A 3S55A 2WKQA 2YWGA 4R4JA 3IMFA 3ZWAA 2HLDA 3O6VA 1E6UA 4MUEA 4RA9B 2AK2A 2Z6QA 5IUJC 2XUOA 4K1LA 2PO7A 1M0WA 3RIXA 3DZJA 1EFVB 1M2VB 4KXXA 3DJFA 3OJ0A 4B7CA 4FYHA 5DNUA 3U7FB 3SKXA 4KPUB 2JH8A 3VX3A 1XTVA 3OMXA 1JN0A 1MKYA 4JWKA 1NSTA 4KPGA 1DXHA 2OQVA 5ALKA 2F43A 5JFGA 3BWCA 3UGQA 1X14A 4LJAA 1PUIA 2CYCA 4QUAA 4B4VA 1BS2A 1ZH4A 2LKCA 1JFSA 3WLJA 1U2EA 1JYFA 1YRAA 3A1VA 4RQ4A 2BM8A 4M1OA 1K75A 4TKLA 5BSKA 2BGWA 2B2NA 4K7JA 4X7BA 5EJGA 5BNFA 1PJZA 4EKEA 3GT4A 4RADA 1H2ZA 2E1PA 2BGUA 2QS9A 4N40A 3RM3A 4PGYA 2IHJA 3GIIA 2EC5A 2IYSA 2OK7A 5A4AA 4TT3A 2AMYA 4U5XA 4QZDA 2QV7A 2BKUA 3ZCSA 4NAUA 2IOQA 4BO6A 4YDQA 1UPTA 2HHCA 9ICVA 2HTFA 5EHGA 2AKEA 5BWNA 3PQ3A 1TD9A 1BGVA 2ZWMA 1X77A 3LCVB 4EMUA 1T1EA 5DOVA 3CGGA 1C9NA 4UB8U 2H3HA 2IEYA 4QQFA 4QPZA 2MYPA 3T5GA 4DV1B 4UVEA 4ZYXA 3ID6C 4PN7A 2ZFUA 2JZOA 3L1UA 1IEQA 1OXKB 3N2EA 8OHMA 2G4VA 2VHYA 2XZTA 1PW7A 4H0FA 2J85A 4MW6A 4CM5A 4F2HA 1NW3A 3UKOA 3HUFA 2ZPAA 4BEJA 4KWCA 1U7UA 3BTVA 1Z63A 1M2GA 4YMMA 4YR3A 2HWYA 3AH8A 3OZUA 4EY6A 5CFNA 1DCTA 2P4EA 4JH0A 1M8PA 2VANA 4MPJA 3SC2B 4M2YA 1P60A 3EVZA 3TB6A 3OLVA 3ZHOA 3N7TA 3EXFA 4Y6OA 5CNIA 3GVCA 2AOUB 3DWGA 5AK5A 1DADA 3LIIA 4XCXA 3ZN2A 1NW4A 2XY4A 1G2OA 3FFWA 4FZMA 4IQVA 3JARB 4LWQA 1OWNA 3K9WA 2HX1A 2XMZA 1BCSA 2AYZA 3HRIA 3OFKA 4ARIA 3GLIA 1I4WA 3N2ZB 1PV2A 3CQ9A 4HR7A 2P62A 5IAGA 1E2PA 5LUBA 1GRNA 1ZHOA 1EK2A 1ZKDA 1KYTA 3N39C 5CH8A 1IJEA 2YC4C 4KXUA 4UU7A 5KTTA 2GAIA 1I10A 2O1WA 2QTVA 4GWKA 4GL2A 3GPCA 2QHXA 3MM4A 3WGQA 1BXGB 2QYTA 1FQKA 1G20A 3AVYA 1CTQA 4IOKA 2DPIA 4BVAA 3EEYA 2PKXA 1NRJB 5L4SA 1WBJB 1JX4A 4L6CA 2FG5A 3QPAA 4N49A 1GL6A 4MF8A 3IPAA 1XHFA 1YS9A 2P2NA 3MSCA 2M6KA 4B6OA 1ECLA 8ATCA 5KX5A 2QB0A 1RNLA 1UF9A 3E9YA 1JEJA 3O82A 3BH0A 3FHJA 1MQ2A 3DNFA 5A1JA 5IJ9B 1KJWA 3FSEA 1ORTA 3HZRA 4O0LA 3BZWA 2JFQA 2Z57A 4JV2A 1JIIA 4HPXB 2GI4A 3THRA 4BQRA 2H2HA 5CNMA 3NTOA 4MMXB 4FN4A 1AB5A 2JCYA 4UBCA 1GU1A 1SKYE 4O5CA 2QK4A 2XWSA 3GLQA 4JLVA 4W1QA 4ZVKA 3WB1A 5C7YA 3KHHA 3NHZA 5K0EA 4A36A 2QL9A 2OHGA 4KLGA 3V1MA 2POCA 1W48A 3PTAA 4UAZA 2VRNA 1MIOB 1WW8A 5J0WA 4B3TB 4QVIA 1GA6A 2UYQA 3BF8A 4IKOA 4XW2A 4DAEA 3C7TA 3OSZA 2XY5A 1OLSA 3I01A 3RB6A 3DBHA 3UYLA 1QB8A 1FJHA 4BFUA 1DO0A 3HWWA 4FHFA 3RUFA 1R6VA 3HWX1 1QSLA 1OAOA 3QKRB 1DINA 1HL3A 1KC1A 2FF7A 2ZE6A 5SYNA 2HADA 1YQDA 2C8KA 3I72A 2XVXA 3S3TA 5I7FA 2JZBA 2A9RA 2JB9A 3F5AA 3B7GA 3HO8A 4P4GA 2QUKA 5I9NA 1C0IA 5JPCA 5J2CA 4EEXA 5HS4A 1DKOA 2ODWA 3P2IA 4TQAA 5HE9A 2ZXUA 1U1DA 1G41A 1IZ9A 1QF7A 4I4TA 4RZRA 3EUB2 1JAXA 2OVBA 2IYNA 2NO0A 1FOEB 1G4AE 3O0TA 5ADHA 1U3GA 2PBLA 1WMEA 1XIVA 1YT5A 3E35A 5I9BA 4A6EA 1TCAA 2QW8A 2XCQA 3VTKA 3NB0A 1XYVA 1UJ2A 3ZIAA 4Q0MA 2IV2X 1R0CA 5GQSA 3SLRA 3QY9A 4BC1A 4PG8A 1PV4A 1EJ6A 3BWYA 4C07A 1ZOSA 3LS2A 5BUSA 2Q3MA 3OE1A 3T5TA 4Z86A 3D81A 4BDSA 4NXNB 1AO0A 5JS1A 3HWRA 1KFCB 1LLUA 2DH6A 3N8NA 1U45A 1VJCA 3KEQA 4QYMA 4Q9HA 3H0EA 2QLJA 5E4YA 4E30A 3L04A 1YQGA 5MGNA 3CEHA 2PA3A 4DLGA 4J6EA 4C7OA 3KWMA 2J4FA 5DHPA 3TAUA 1UBKS 1DV1A 1JI7A 4XUSA 1XP5A 3CYMA 2C2ZA 2CHUA 2J33A 3EBLA 4NMWA 4NV3A 2C1ZA 4BX9C 4KR9A 4PR3A 4ARAA 4HUQA 2HYIC 4Z7QB 1RLTA 3QMPA 1B43A 3CMMA 3G8YA 3FNFA 4G36A 9ICHA 4PYMA 5JCJA 4DT1A 5C8ZA 2MYTA 4OBXA 4DMCA 3L77A 3CVOA 2F48A 5I7HA 2WB1F 1RM4A 2B61A 5DM70 2O7VA 3I12A 3RDPA 3FFXA 3KYCB 4PXAA 4OYRA 1G3MA 3TPCA 5JMTA 4KV7A 3R0JA 2QAGC 3UN1A 2ACWA 3H9BA 5JD5A 4KVGA 2CD9A 1THGA 3LWNA 1W44A 2QXYA 3ZKWA 4GP9A 2D3TA 3OWXA 4JL8A 2LIPA 5EJEA 1G2IA 2ILTA 4FEYA 3AF1A 4JR1A 5AJWA 4YFVA 1J0CA 3JQ8A 4MEXA 1GY8A 2ECKA 3KXPA 1E9CA 1KFJB 4OJ5A 2YW2A 5H0IA 5J59A 3K1RB 1FMLA 2GEVA 3P0RA 4JQZA 2OGSA 5K0NA 2I7TA 3KFUF 1VCNA 3DV0A 3O8LA 2QUBA 2DQSA 2RGXA 2BCUA 1VSVA 3EG5A 4IDGA 1FDSA 2HXSA 1FUUA 5CG2A 3F5FA 4HH1A 4E94A 5LP1A 3FKSD 3O4JA 4I55A 4ALMA 4KFUA 5J2TA 3CNEA 3ZWKA 1MR3F 5A03A 1CU1A 4QXQA 3IIKA 4EUFA 3G2QA 4DYHA 5KG5A 1JHUA 1MDBA 4KE6A 3BAFA 5EFZA 5FOWA 3ZNOA 1JTEA 3U7QB 3GJSA 1FC0A 2JLAA 2JI7A 2JDIA 5IZCA 2EAMA 5GINE 4FE7A 1Q3VA 1LD3A 2RJNA 2DF4B 2IDMA 1V35A 3SR4A 4C5AA 2Y71A 3OTWA 1G8SA 2NXNA 2ZRAA 4HWKA 4I7EA 2VPWA 3F4BA 4M8SA 3B48A 3F49S 5EIHA 3HCNA 2WTXA 2UVPB 3QFRA 2R85A 3EARA 1G66A 4LAFA 3SS7X 3LLVA 4JK1A 1XVIA 2HIMA 2QU8A 3GLHE 4KJXA 1YJ5A 1NVKA 3E2PA 1L4MA 2RI6A 4NBVA 2LI6A 5AI9A 4RD6A 2GCEA 3RTAA 1IU9A 1VE9A 4I8IA 4E7OA 3D64A 5ER9A 4CIBA 3L43A 2JFGA 1WCIA 3HGQA 2GBIA 3ZCVA 1YB6A 3CRRA 2J3EA 1PVRA 1BOOA 1CUKA 2C5LA 2GA8A 2P2CA 4IUYA 4FZJA 5KSPA 1V0JA 3HS3A 5LCXA 4B45A 1U7PA 4PLWA 1E1KA 1BD3A 1E3EA 3CZAA 3LWDA 4GI2A 4ECRA 4LI0A 3HJFA 2P7HA 1P74A 4H60A 1NUUA 4DCJA 1XU4A 3ZIUA 2VRBA 3DPUA 3VR4H 1E9BA 3WAGA 3PCRB 2ZIFA 2PQ6A 3HI4A 3K53A 3LBYA 2ZJ8A 3ML1A 2Q49A 5IULC 1R8SA 2LMRA 4JX9A 1ATZA 3WI7A 3RR8A 1LNQA 1XZKA 2C8LA 1MO4A 2PPLA 4IF6A 3GIJA 2YZGA 4MTCA 5HG0A 5ICFA 4ZN6A 2R1TB 5BN3A 4PLCA 4B6QA 1WG8A 2I1QA 8ICKA 1ZSVA 1GQYA 1EGHA 1G21B 2H2WA 3G6XA 3HY4A 2IS4A 3UH0A 2V7EA 4TXJA 5B3AA 3HFRA 2EZTA 4TRRA 1LTHR 5IKMA 1SKAA 5GM1A 1YMVA 4MI3A 1UMCA 4TWAA 4L3VA 5K0CA 1DAMA 5JNTA 5KX5F 1KNXA 3REQB 3CF4G 2LKDA 1A77A 1TLLA 4HPJB 4LV5B 5BORA 3FJ1A 3TVYA 4CF7A 1DAEA 3HKZF 1VG8A 1PVOA 3Q2OA 3QG1A 1CW2B 1Z13A 1T0PA 1Y89A 4Y6GB 4AP6A 3GFKB 1HR0B 3P2MA 5LYJF 1H1TA 3NNDA 4NQZA 2PJDA 3JQ9C 2KNJA 1DXQA 1GUAA 3MWEA 3OM0A 3PXCX 1DZ3A 4BGDA 2DHCA 3LUBA 3RC1A 4AT1A 5BSFA 3PO4A 5H3HA 1WW2A 3UJ6A 4OK3A 1S1CA 3LUPA 1BPEA 4KLQA 1GNPA 1PT8A 4JHLA 2O0KA 3AINA 3QX8A 2R5FA 2RKBA 4TTIA 3RUCA 1FS6A 2NZWA 3PW4A 1NF8A 2R751 4R31A 3KB6A 4OVKA 2V55B 5JUMA 2WHYA 4RD3A 3PVSA 4F4CA 1NBME 4A7PA 1DKMA 5M5BA 1I5OA 3LGAA 4YRLA 3MUFA 4N82A 2IHUA 1YQWA 4F91B 2Q2VA 2V8OA 4U02A 4JV1A 1OBOA 3ZH2A 4BO4A 5FB3A 2PSJA 2CNOA 2Z58A 3AUAA 4HYEA 4NONA 5LQSA 1XCOA 4UU1A 3VTAA 4XX1A 2ASJA 4E07A 1NJSA 2V97A 5HVNA 1Z0IA 1KDZA 1YBFA 4NU8X 8MHTA 1OFTA 2BI8A 3LTNC 3GROA 4N9WA 3QXCA 2HIAA 2L5YA 2WIDA 3HDGA 3X1ZA 5KMGA 1V1JA 2Z8XA 2R79A 4A82A 1QE5A 4LZAA 3DLHA 3GILA 2H1HA 1IPEA 4UTZA 5AJHA 3U7EB 5DNCA 1ZJ6A 2JIOA 2B2XA 2VXOA 2OBYA 2PMZC 3EXIB 1DU4A 1Y42X 2HAEA 2EW1A 3A3NA 3TLZA 3UHFA 1ODSA 3VR4D 3C8ZA 3CXRA 1TEHA 1MOSA 1YJBA 2SICE 4DFPA 3P2YA 4IFEA 4QUGA 2O8EB 3MHPA 3FNIA 4NFYA 1E63A 1M2WA 4P22A 4EY4A 3W3AH 1XCJA 5KT6A 1K1QA 1ENZA 1TMOA 3BXPA 3FYUA 4IJVA 4KZPA 5JISA 4L5IA 3B9JA 2VDNB 4TMFA 3PD1A 5FBWB 1TCUA 1XTSA 4IP0A 5J2UB 2CXOA 2PBFA 4RTKA 1S02A 3PEWA 2C3MA 1YKFA 3U31A 5IAOA 1ZCFA 2ZBDA 4XLZA 1IIBA 1B8NA 4IRCA 2QLLA 2MR6A 3KQYA 4DEYA 5AUPB 7ICMA 5BWOA 6GPBA 3VR6D 1W34A 3THWB 3AFOA 3GPBA 3PFHA 4UE3S 1LVGA 1OKKA 5KYXB 2B1GA 3QJ5A 4R9SA 2XUZA 2W6OA 2J0UB 4OM7A 1IPHA 4TKUB 3AVVA 1G9XA 1QTNA 2PMFA 1YU9A 2V4QA 1COZA 1H2FA 4CHTA 1T3SA 1X74A 3OY2A 1R0WA 2EP7A 3PVCA 4Q1VA 2ZZMA 5TV2A 4KIGA 1TMKA 1H2HA 1WHSB 4TSFD 4ZV9A 4NP6A 2Q1YA 4L5JA 3UPUA 2GLUA 1WXDA 5KNCH 1T4DA 1W4LA 2WMOB 3ONNA 3C3AA 1ZQSA 3GW8A 4YAJA 4QA9A 2D2IA 2QRVB 1YJAA 4NJOA 2CFTA 5A3VA 1X42A 1ES9A 2O2JA 1OJLA 2X9NA 3PJDA 4TKVB 1YZQA 1SIOA 3RROA 3F5EA 2H7XA 4BKQA 1KBQA 3OIFA 4E2FA 4UBIA 2VQFB 4M04A 4AN1A 1E3SA 2RHHA 1RZUA 3BCUA 4TVSA 2O2EA 4I9HA 3TAQA 1ESNA 1X1TA 3NT5A 1OXTA 1U8XX 3CWQA 4LE0A 2PSDA 2NO4A 3BSWA 3GZJA 3SZOA 4B9LA 7ICJA 1GPJA 2A1UA 2P4UA 1ZUIA 2KSQA 4EO7A 3L0ZA 3TR6A 1R6DA 3BMNA 3EWSA 1BE0A 1E6MA 2JCBA 4RMNA 5E9WA 5F33A 1J8QA 2R68A 1KOJA 1XU7A 4OYLA 3AXTA 2C5FA 3DMTC 3IJPA 3IO5A 4OQPA 2CBXA 4KN8A 5TARA 2BGJA 4TTPA 3K94A 4CL3A 1P0CA 6LDHA 4NWIA 2Q29A 3LFTA 3UWOA 1XJ5A 2NU7B 2EH9A 4H35A 2ZUFA 4BQQA 1GVHA 2MA1A 3HUTA 4P98A 3Q4GA 3T15A 3RVLA 3WL4A 2D8MA 5T64A 2VXCA 3ZWDA 5DMHA 3SOPA 1NVVQ 4EKYA 3BX1A 5K8JB 5KFCA 3FDZA 4L7VA 2GRUA 4A26A 3O3MB 5L3QA 7ICIA 4C80A 2J67A 1GZ4A 3FPGA 3WBBA 3H05A 1PR4A 3OM1A 4M0KA 2XXBA 4OFZA 1WCYA 1FFGA 3GLSA 4UE6A 5GTIU 1VSBA 4P32A 4WESB 3ICWA 5LMCA 3M4NA 3WLAA 1KVSA 3NEYA 1MO3A 2DPLA 4LSMA 4HDQB 2QPTA 2R62A 2AC2A 4RF3A 1EFPA 4GW3A 3VYWA 1M2OB 4FDVA 3RJ5A 4EUKA 2QVXX 2J3MA 3U0VA 4H15A 5E38A 4WDRA 3NIWA 2X0FA 2WJ4A 1QP4A 3IRUA 1WB5A 4ZJUA 2XGGA 4HH0A 1BH2A 1JEQB 1P7PA 5CCDA 2AZXA 4Z2AA 4IMJB 3TTYA 1VJTA 1QFSA 5JBQA 2W6ID 1JKIA 1ZBDA 3BMOB 3MTIA 1PZGA 2A86A 2GPJA 3O31A 3OOEA 3PFWO 1UXIA 4R84A 3N76A 1PK1A 1JXOA 1V48A 1N6NA 1L5RA 1R6UA 5EWJA 1T3QA 4FYIA 5A4FS 1J25A 1XMVA 2W4MA 4AUEA 2EZ9A 4IILA 3OKPA 5FA5A 2PMBA 4LHWA 1T6ZA 3AUFA 5AW7A 4OMUA 4XYLA 3IS3A 5C8YF 5HSGA 4JT9A 2VPYA 3E0FA 4L73A 1MO2A 4D6YA 1EEXB 3ZV3A 1XMOB 1R27A 5JTTA 1MVLA 4KI0A 3U81A 5CDUA 4RTRA 1DIAA 4YT8A 4QUKA 1JAYA 3GPIA 1N2BA 3TVDA 3ZE9A 3L7MA 4QM6A 1XUOA 1G5IA 3EEQA 5IIOA 3CT6A 2IBSA 4NOLA 4BO5A 1RE1A 3TADA 5ILQA 4CUJA 2X4LA 2V7VA 1HETA 1ULSA 1QRAA 2ZB2A 3IR7A 4Q05A 5G0VA 1ZQVA 4AD8A 2I2DA 2P67A 5L9XA 3PKIA 4PFJA 1PR5A 3WK5A 2Z5GA 3PT9A 2K8BB 2XUAA 4S1OA 5ADUS 5ICSA 4F5DA 2FA9A 1DQYA 4UPDA 3KQTA 4X7MA 2OXTA 3NAZA 2P6MA 3FHOA 4FDLA 4RQ2A 1L4EA 3WO0A 4CHGA 4KO1S 5I9TA 1NV8A 2I2CA 2WUDA 3OPMA 4A2CA 4CMEA 1QQ5A 1ZUNA 3R20A 3R24A 1GJRA 3TLGA 2EBUA 3KSUA 4F3OA 5F1YA 3TINA 3ZCRA 4EJFA 4G63A 1LB2B 3WWEA 4CDRA 5KNCD 2INGX 4CLDA 2BQ3A 3BBPA 3CV3A 1O5OA 3JX9A 3LV8A 4Y2TA 1V8PA 5ARCA 4CMCA 2NUBA 3H2JA 1C50A 5KYTA 2PD6A 4RGVA 4RPLA 4IXNA 4YRRA 3JASA 1A2BA 4B9MA 3D02A 1PGQA 2MSEB 1L5WA 4I2CA 2ZKLA 3ANTA 3BK1A 2C3PA 2IRWA 4NK5A 2VUUA 4NAHA 1J23A 4X8HA 1TA9A 3E9QA 1RMQA 2HA0A 2DKZA 4PGAA 4V39A 1SHZA 3RYFA 1Z7GA 2R86A 2XGOA 1DAGA 2J08A 4EYHB 3RKRA 5KG1A 1NHWA 3RTEA 4P92A 3KKQA 2E6KA 2P5TB 4HBZA 3F7TA 1CEQA 3N7PD 1Z06A 3GRPA 4M1YA 5KU7A 1IHYA 1OTXA 1QVAA 4JEMA 5FWXA 3FMOB 1J8FA 4IOMA 4PQEA 2J5XA 4LV6A 4CWAA 2FU5C 3KOZA 1MV5A 1L3VA 2BR5A 1NRXA 1VPLA 5CVUA 5P21A 3ZKAA 1YJXA 2H85A 3P97A 1MB0A 2PS3A 4MI6A 5HFJA 3RAEC 1PLKA 2OO3A 4LCEA 2VBGA 4HRXA 5AKJA 3VFDA 3ET5A 1EVKA 3ZW7A 2GBCA 1VMIA 3LXUX 1G6Q1 1F12A 4R2IA 4X61A 5AM0A 3QEOA 1VL2A 3GCXA 4KZKA 4RQAA 2HEGA 1X9SA 1IVYA 3A1TA 1RZVA 1ZI6A 3BJMA 2A5LA 1H8EA 2QLTA 1E4EB 3DEZA 4INZA 4JUDX 4L4RA 1S0OA 2OFPA 2BM9A 2X4DA 3VC7A 4KITB 3W8NA 2MSKA 4TSRA 4BRUA 2DTEA 5TS2A 3B6KA 1IAVA 3B6EA 4F3CA 3GEHA 4ZOBA 1JHOA 2VJMA 5CEFA 1QFZA 3SE7A 5F52A 3NVZA 3OCJA 2VDWB 3DLCA 4ITUA 3RIEA 3WBKA 4DLPA 5IUNC 3U19A 4AS3A 2EGGA 1T2VA 4XQ8A 4YI3A 3C3KA 3NUZA 1X87A 2OBBA 4RL6A 1NG1A 4BQOA 3PSFA 1ZIYA 1LDBA 4ZEVA 3S4YA 1B0XA 3K5IA 3GL9A 1NBIA 5EMHA 3NOQA 1QTRA 1WXHA 1DQSA 2O50A 1YACA 4IW3B 4XRGA 1FRQA 3K0CC 2GN2A 3VU3A 1A27A 3FNEA 1SUCA 1U47A 4FFBB 2VCEA 1UBCA 3HYCA 4WE3A 4XVHA 3TUJC 4E0BA 4V1CA 3IV7A 5J2EA 3HJUA 2RIPA 4YAWA 4PXYA 4XDZA 1T9ZA 1W76A 3GLIB 1EVLA 3G85A 4IX9A 1CBUA 4ND8B 9ICTA 1HE5A 4TUPA 8ICZA 1GIAA 2AA3A 2VSXA 3UK7A 4E5DA 1NJYA 1LDEA 1SXJD 4R2KA 4RZHA 2WQ7A 1A5BB 4P7FA 5KVSA 2W8BB 3RYCB 4GFJA 3KJIA 4C08A 3TGPA 4GC5A 4RU1A 2CE7A 5EWLA 3NH6A 3KQVA 4KMUA 1L7RA 2Z3VA 4FT2A 4GZ6A 2CUKA 3AR3A 2YJ3A 1ZCAA 9ICOA 2D2FA 4Q3NA 1WMSA 5JATA 1OLUA 2CXHA 2IUEA 4M1TA 2KBFA 1J8MF 2EF0A 2FW0A 4H7KA 1LJUA 4L8YA 5IMBA 1R0RE 1VI2A 3PXAA 4FGWA 1O5IA 3HL4A 4J9VA 4CR7A 4Z4HA 3CONA 2V6FA 4UULA 3IP5A 1ZM9A 3C45A 4MP6A 2Y9MB 3DZ8A 5IC5A 2PGLA 3T5PA 4MVWA 1DELA 2ATIA 2CFCA 4J9MA 3PNMA 5THKA 3VAYA 5JHHB 5LQRA 2FHSA 3BL8A 1E64A 3GP3A 4OHVA 4BEBA 1XVVA 1JB9A 4QZHA 1XSNA 2G63A 3K4QA 3LVBA 2ODQA 2V98A 4YMOA 1O95D 3AB3A 2XDAA 4HNRA 4E6PA 2ZI9A 1GZHB 2BMWA 2JJ2A 1ZQTA 3PVXA 1T4BA 3H65A 1NI3A 2QL6A 4XIGS 1P9OA 5DHTA 1YZ3A 4C3UA 2GYVA 5CA1F 2YWXA 3VPAA 1KI4A 1YCHA 4RQTA 4FYPA 1NJXA 3TTWA 3ZNQA 4EEKA 4UM5A 1Z25A 3E23A 3MERA 4I0WB 2ECQA 4LVOA 2ATLA 1JA0A 2BHSA 4XB1A 4ZQIA 1X6VA 3DAYA 4UHKA 3OZAA 4DA0A 3QV2A 1Q44A 3HG7A 3SC2A 2QE7D 4M1WA 5CHEA 1J90A 2UVRA 4C7JA 1WIWA 3A3YA 1FVXA 2ZPTX 3SEAA 3SX2A 5KHOC 1ZN8A 5IS2A 1GPUA 2QTGA 3QHQA 1R6XA 2DX7A 3LUAA 2XYGA 2IW3A 1OKKD 4H31A 3ZX4A 4AKGA 1O1YA 3FLBA 3IALA 3IOBA 4KGXA 4OJPA 2J07A 3Q87B 4GXTA 1YR8A 4X97A 3TIFA 3LPCA 3QU5A 2A14A 3D3WB 1JI3A 2F64A 4K9RA 4YPOA 1XTPA 4YGXB 4HH4A 3IJEB 4QT0A 2VJOA 1LTKA 2QA5A 5K51A 2G9NA 1HL7A 4XWKA 4RHYA 3AXSA 4L75A 1K86A 1ZINA 3LPAA 2G17A 1B16A 1I0ZA 2WYIA 1F6WA 1X9IA 1A2QA 1RHKA 4G2TA 2YQ4A 1YMUA 2O8VA 2RC5A 1KIMA 5DEOA 3T0IA 3SI7A 2ZIVB 2R5NA 4QO7A 4BKMA 3ICOA 1BPYA 1OT3A 5DHUA 4CJXA 2V6MA 2O7QA 2MSWA 2IEIA 3GIWA 4GRAA 2QNIA 3TNLA 3AKZA 2R44A 2EATA 2YJZA 3AILA 4DQPA 1KJJA 2CE2X 3P27A 2GRJA 2YZMA 3K0FA 3IUYA 2H6EA 4UDNA 3SV3A 3VMFA 1DPFA 3LSYA 2V3CC 4DARA 3T5BA 5JDCA 4NV0A 2WIJA 2Y1GA 1G5RA 3FBGA 3H5OA 3PXXA 3TRHA 3HJEA 2ODEA 1T36B 1JLRA 2O6KA 2D74A 3AYXB 2DLNA 1XMXA 3DE6X 1KE2A 5TPZD 4Y6QA 3V33A 1YC5A 2I4RA 4UEOA 1KI8A 1TC2A 1EGVB 1KK3A 2CXTA 4YRQA 5LIRA 1KZGB 2GZ2A 1NJ5A 4RH3A 3RSGA 1NATA 1XDGA 1JR3D 2VP6A 1RAAA 4HLQB 1SXGA 1PGOA 2WWGA 2PJRA 3A06A 3ETGA 3N2IA 3CU5A 1S0UA 2H31A 1S77D 4QGBA 5KFNA 2NVOA 4EM6A 1Z82A 2FPGA 3N2NA 4Q6BA 4A91A 5T4FA 1A4XA 1WNFA 3I92A 1Y1TA 2E4XA 1N6HA 2QT9A 4ZOLF 1LY1A 3NIDB 2JLUA 3CE9A 3R74A 3AP3A 4KG7A 2ZBPA 1CY1A 2A1JB 3CRXA 5DP1A 4K2HA 1NWCA 4MGZR 4DWJA 1FRVA 3LFHA 4KO2S 3GELA 4BMOB 2C1XA 1H85A 4JENA 3ROMA 4CT5A 1UANA 3HXQA 3VNVA 5JU5A 3NU1A 3ICQB 2JD2A 2GAOA 1EFLA 4UM8B 1XEWX 4R83A 5LXTA 4K5QA 4EJSB 5BVGA 4LOAA 2W58A 1TF7A 4PRYA 3TZCA 2ZULA 1Z9BA 1UMBA 4WOCA 1SXJE 3OPYB 4I50A 2KSOB 2K89A 4PXSA 3ZCQA 3VNBA 3LZCA 5EQJB 5FBHA 1R8YA 2H1IA 2I54A 5CEHA 4DM3A 1QHSA 1WMAA 2DFVA 2IFTA 2FSGA 3KT0A 1HSOA 1XAGA 2E8MA 1USUA 5DHRA 1BDBA 2Y4OA 2HRCA 1RRPA 4CIDA 4EBDA 1UT6A 4YRBA 2W6IA 2RKOA 1XFAA 3H2SA 4FKBA 4UB5A 2CNWD 4TX1A 1I2BA 3AK4A 2VJ4A 1H1DA 2J3IA 1G5FA 1GPDG 1M7BA 2HCJB 3C70A 3R9XB 1WSAA 3CRZA 4F97A 5FDFA 4EZEA 3KTAA 2CWDA 4MS3A 2QMZA 3AI1A 4P54A 3Q3GE 1IRXA 2KVSA 1NZFA 5J0SA 1IY0A 1SY7A 2WYOA 1D6SA 2XMSA 2Y0PA 4LI3X 2FB9A 4RD4A 5TC4A 3TLJA 1P9LA 1KQ3A 4DLYA 1C2YA 1SPXA 4MV7A 3RUEA 10MHA 1V8ZA 4ZV7A 3VI4B 5LDHA 1J33A 1IC6A 2DZDA 1RP7A 1TM4E 1II8B 1RHRA 1MB2A 1RHQA 2PH5A 1YL5A 2WWTA 2KB0A 1RZRA 5ITVA 2FLLA 4RV5A 4YP9A 3ZV5A 1Y5MA 4BNLA 4RFSA 3OHPA 4CKBA 1VYVA 5ALVA 4LJ6A 5D7NA 3TL3A 1AKVA 4UM9B 4ZKDA 5CDHA 2JC3A 4EYKA 3DMRA 1RPZA 1LBTA 3KLNA 4RUAA 5KFYA 1INLA 1IAQA 1VB5A 1ZK4A 2REQB 2NU9B 2WF8A 1I3OA 4OUDA 3LUDA 1CJMA 5DBEX 1I5RA 2YINC 3GRVA 4JVMA 4JVLA 5LQNA 1SIJA 4OXYA 3KXKA 4A2QA 4WK2B 1QZTA 4CQLA 3VYVA 4F92B 4JC0A 4IBOA 3IM1A 4G65A 4KRXA 2DC1A 2JL1A 1LSUA 2F1OA 4A23A 2ADFA 2ZSKA 3C1ZA 4YAGA 4QREA 4JJFA 2PUAA 4FNOA 1DXYA 3O7WA 2WP8J 1SBQA 1UJ4A 2H5IA 4K9NA 2CB9A 4Q03A 1AKNA 1LQUA 3I8OA 1Z73A 2QLMA 4PGFA 2CPRA 1PWXA 1SIBE 4QTXA 5JZ9A 2B6GA 2H5EA 4DIMA 3ACDA 1DTWB 4MUBA 4BNVA 3VR5H 1LK5A 2YTUA 2Y1JA 1NXQA 2NAPA 3NHJA 5DE3A 3DVSX 3KRTA 1IHDA 5I48A 3HJHA 4AMVA 2AK3A 1C8BA 4BIMA 1I4TD 3I5UA 3EE6A 2Q21A 1EINA 4DL4A 4BQNA 3KFLA 3OE7A 3PS9A 1PWZA 2WU1A 5AW0A 2IHVA 1AKMA 1N63A 2YNMC 3DL4A 1MJHA 1ZRNA 3OQJA 4HTFA 4JC5A 5FWYB 5TE9A 4Z4QA 2UUBB 3ZNPA 4F9GA 3TQ1A 1TXGA 3HKDA 4FBLA 4OL0A 4PLFA 4QOIA 4QXOA 5COAA 4WNIA 5FO0A 2ZRFA 5HM6A 5DXAA 3HCOA 1QS0B 1JF8A 3M9MB 3F8WA 3EVFA 3L8DA 2GN4A 3QVGB 3QZUA 3EZ7A 1KWKA 4Q3AA 2RE8A 3CRMA 3NBMA 5L3QB 3HV0A 3HA7A 4NLNA 4CQJA 4JV5B 3BMNB 4OK5A 7ADHA 1LVUA 3QQ5A 5FUWA 2QB1A 2G36A 2HCBA 4DDMA