3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords Predicted phosphatase, HAD family
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
2AH5A 3ESRA 5AVWA 2HO4A 1RQNA 3QUQA 1Z4QA 4GXTA 5AKJA 4UMEA 1U7PA 3QNMA 3QU9A 3AR6A 4Y2QA 5FP0A 3L8GA 4E88A 5JJBA 1K1EA 3ZW7A 4KX5A 5AKLA 1U7OA 3S6JA 3WGVA 1TE2A 4B6JA 5AW9A 1TJ5A 5AKGA 4FE3A 3KC2A 2YJ5A 2HSZA 4CE6A 1XP5A 3L0CA 2I55A 1WR8A 3OCXA 2GO7A 3W5AA 4NFLA 1RKVA 3NANA 3ZVMA 5AM4A 2HHLA 2W11A 1O08A 3U7GA 4UU0A 4YGYA 4YCNA 5IT0A 3L7YA 2B1RA 4JB3A 3OCVA 4Y2RA 1Z4OA 5AM5A 1Z4MA 4Y2JA 1T5SA 3A1DA 2HDOA 2C4NA 2JAUA 5A3RA 4HAIA 3F9RA 3I76A 1Q92A 2GFHA 4AP9A 2MSNA 4FYPA 3KOOA 4AS3A 3U19A 1Z4NA 3EF0A 1XVIA 4BEVA 4YCLA 5AVRA 3SLRA 5AM0A 3EF1A 4MWOA 3SHQA 3ZUPA 3ZX4A 4UM7A 2CN1A 3PGLA 3DDHA 3ZWDA 1QH9A 3FGOA 1TJ3A 3WGUA 1RC8A 2C8KA 3E8MA 5AW0A 4UAUA 2G09A 2PR7A 2Q4RA 3N5KA 1T5TA 1N9KA 5AKHA 1N8NA 4UASA 4Y2TA 3WKBA 2PQ0A 2ZG6A 3EWIA 4QJBA 5AW4A 3ZVNA 1ZD5A 4UATA 1SU4A 2YJ3A 3R9KA 3FPBA 1FEZA 3SKYA 2WF8A 3L0BA 1KYTA 2I33A 5AI6A 5AK5A 2YMQA 2CFSA 3QGMA 4I9GA 5AM2A 4L6CA 3N07A 4I9FA 1Z4LA 2WF7A 3ESQA 4OD0A 4BNDB 4ZEVA 2AUTA 5ALZA 1IWOA 2NO4A 3UMCA 3DV9A 3AR3A 4C4TA 4RETA 1RKQA 2C8LA 1Z4JA 2YN4A 2C9MA 3OTQA 5ALXA 3WKAA 2GMWA 2P11A 1L7PA 5AKZA 1NF2A 2FUEA 4UW9A 3MMZA 2IOFA 2FPWA 2G06A 1F5SA 3K1ZA 5ALUA 3L1VA 2JAWA 3WKDA 3KBBA 3U26A 2FUCA 3ZTWA 5AW2A 3N1UA 2GHTA 5ALVA 4BYGA 5ALEA 2I54A 2IYEA 2OYCA 3WK5A 1TJ4A 3B9RA 4KNWA 5AVUA 2FI1A 2R8YA 4NAVA 5AI9A 5AK6A 4BNDA 2D2VA 1ZD4A 2YMPA 4Y2XA 4QQFA 4L6AA 2G07A 4YIHA 3FZQA 5AVQA 5AKEA 1RQLA 4HGOA 2ZBGA 3R09A 3TLMA 4OFZA 5ALWA 2YY6A 3MPOA 1JUDA 4IFTA 2ZBEA 1VFPA 5AKYA 5IS2A 1S2OA 4OHFA 4Y2VA 3E81A 3RFUA 5AI8A 2BDEA 4KX3A 2EATA 4G63A 3QUTA 4G9BA 4UMFA 2AGVA 3AR7A 4GIBA 4XQ0A 3DNPA 1QQ5A 1RKUA 2G80A 4FFDA 1Q91A 1ZJJA 4HGNA 1RMYA 1VJ5A 2EAUA 5AVSA 1YMQA 3B8EA 2WF5A 3OCYA 3NAMA 2W43A 4DCCA 1Z5GA 4PNHA 1SWWA 5ALNA 3A3YA 5AVTA 2OA0A 4BX3A 4H1WA 1RMTA 5AVZA 5T41A 4J2TA 1ZS9A 4UMVA 3W5BA 5AM3A 2YJ6A 4Y2SA 5ALFA 2RARA 1ZOLA 3SD7A 1EK2A 3R4CA 4UMDA 3I1YA 1PW5A 5AIBA 1Z4IA 3U7HB 2YBDA 5AKXA 4O8CA 5AVXA 5AVYA 2ODAA 3B9BA 2B8EA 1U2TA 3N8GA 5ALQA 3P96A 4MUMA 5AK3A 4UARA 4EX6A 3FPSA 3HLTA 4BBJA 3WK9A 2ZOSA 4KNVA 3NRJA 3OCUA 1L7MA 3PCTA 5AW5A 2O9JA 2ZXEA 3ZWKA 3UMBA 3WK6A 3GYGA 3L8EA 5AIAA 3EPRA 3SF0A 3L8HA 4IG4A 3SMVA 5IT4A 3RF6A 1X42A 2HF7A 4KN8A 3OPXA 4NABA 5ALGA 1WPGA 4XOUA 3E58A 2FPXA 4OCZA 2RB5A 3QUCA 2NO5A 2BY4A 2RBKA 4DFDA 2HI0A 2G08A 3U13A 1L6RA 2NYVA 2RAVA 4XPZA 1L7NA 2HOQA 2FEAA 3ET5A 4Y2PA 3NALA 4BX2A 2HEGA 1RRCA 5AW6A 2MU1A 2WF6A 1RLTA 2IOFK 2YJ4A 3E84A 2DQSA 3WK8A 3AR9A 5ALSA 3AR8A 1RMQA 2JGAA 2I7DA 4HGRA 4NWIA 2YFYA 3QUBA 5AI0A 5ALOA 4BX0A 2HX1A 2QYHA 3L0YA 3L5KA 5ALYA 1CR6A 3AR2A 1YDFA 5ALDA 2FDRA 1RDFA 1RPZA 4ZEWA 3ZVLA 2ZBFA 3ZX5A 3QU5A 3QYPA 1Z5UA 2AMYA 2WF9A 3ZTYA 5AW3A 5E0OA 3M1YA 4UU1A 2B1QA 1L8LA 2Q5EA 1WVIA 3BWVA 1LTQA 2WFAA 4YIKA 2B82A 5AI4A 1SWVA 2FPRA 1U2SA 2EARA 1O03A 1Z88A 2W4MA 4CF5A 1YV9A 2P9JA 2VKQA 5AW8A 2R8XA 4CF3A 1VJRA 5ALJA 5ALRA 1MH9A 2IOHA 3CZ4A 1XPJA 3VAYA 3QU2A 3ET4A 2ZBDA 4EELA 4HYTA 2CFTA 1QQ7A 2OM6A 3MC1A 3DAOA 4EZEA 3AR4A 4YCMA 3MN1A 3A1CA 3U7FB 2HCFA 3IJ5A 1Z4PX 2OBBA 4HGQA 3WK4A 4CNQA 3NASA 2JAOA 2YMLA 4EENA 3W5DA 4F71A 2YMMA 5AK4A 2P27A 3PDWA 5AW1A 1LVHA 2Q4TA 5AI5A 4EEKA 1Z4KA 2WHEA 4Y3UA 3KDPA 5AVVA 4AS2A 4BEWA 1QQ6A 1CQZA 5A3SA 5AKKA 2C88A 1AQ6A 4CF4A 3I28A 3KZXA 3HYCA 3SKXA 3M9LA 4L57A 3OCZA 4F72A 2QLTA 4XE5A 4Y2YA 4NV0A 4HGPA 1J8DA 2FPUA 3ONNA 1NRWA 3OCWA 1ZRMA 1L8OA 2IA5A 3QU7A 1L7OA 5A3QA 3UM9A 2G1AA 4EX7A 2MU2A 1RLOA 2B8JA 5ALKA 2BDUA 1TA0A 3AR5A 3WKEA 1RLMA 2PKEA 4UM5A 4ZEXA 2B30A 1ZD2P 4DW8A 1YS9A 2CFRA 3W5CA 3ED5A 3J7TA 2WM8A 3BA6A 4J03A 2O2XA 2JARA 1J97A 4RESA 3FM9A 5ALPA 1S8OA 1U02A 4C4SA 1WZCA 3QXGA 5ALTA 3WK7A 2R8ZA 1NNLA 2I34A 5AM1A 1T9ZA 3I6BA 5AHXA 4JDPA 3QX7A 5ALMA 4UAVA 2B0CA 3L1UA 5AKIA 4YH1A 3CNHA 1Y8AA 3U7EB 2I6XA 5AESA 3NUQA 3ZI4A 2X4DA 1YJ5A 2FPSA 3A1EA 3FVVA 3PGVA 1YNSA 1ZRNA 4Y2UA 3N28A 3IB6A 5ALHA 3NIWA 5ALLA 3ZU6A 1QYIA 3L8FA 3QLEA 3QU4A 3D6JA 4BKMA 5AW7A 4C4RA 3WKCA 2G0AA 2GHQA 2HF2A 2R8EA 3KD3A 2P69A 1EK1A 3IRUA 4KYTA 1ZD3A 5ALIA 5AICA 4DWOA 3UMGA
chains in the Genus database with same CATH superfamily
2QX7A 2QLMA 2I8AA 5EIWA 2VJYA 4JBYA 2VC2B 5LBIA 4LEIA 5FA6A 1WCLA 5HDBB 1JU4A 2OCBA 1KJYA 1ORWA 3HVKA 4FYJA 1RRPA 1Z4QA 4I1VA 4IEEA 4QDJA 5FR2A 4AJEA 4L4YA 4S12A 1Z5PA 3MS4A 3B6IA 1NASA 2IRWA 3OZSA 1UQVA 3RUHA 4F5NA 3PNLA 2A14A 4OGFA 1FDSA 2H52A 5JOQA 4KMOA 2VHQA 2X0NA 2ZBVA 3QVJA 4RDXA 4Z4GA 3SYZA 5EZYB 2H17A 5TQJA 1FFCA 3NBUA 3V55A 1Y8QA 3PWKA 1RLJA 3DL0A 4TTVA 3DL4A 1ZM9A 4IFBA 4O2BB 4XUDA 1U7WA 4MYTA 4ND7A 4OHCA 4UHCA 3DA8A 3QVGA 1H0SA 1L3CA 2WSSD 3PNKA 4BNVA 4LF5B 2GESA 3C29A 4MSUA 5DBAA 2HK7A 1GPAA 1ZUWA 5CB0A 1XEWX 5HCNA 4X20B 3K0SA 3DYBA 3C3CA 1YQWA 4LYDA 4RK6A 2PRYA 3EFHA 2H16A 4CZ2A 4V0QA 4GS5A 1DARA 4PF1A 2KTQA 1M0TA 2CBGA 3L7YA 2B1RA 1UQTA 4ILEA 4B47A 1MX3A 4BQRA 4K9OA 1N5IA 4ME6A 3ZHTA 1F9EA 4G5HA 5ED4A 4REQA 1JWLA 4RFSB 1E5VA 2DP4E 4CCAA 1L3BA 4PO1A 3WS7A 1A9XA 2FAXA 4F5DA 2C84A 4OK3A 3M6UA 5FWYA 2I4LA 8ICKA 2ZIVB 5HRAA 3ASVA 4LZZA 4JS0A 4YAOA 1NVGA 2VDMB 3KR2A 2FSGA 3AJ8A 3UQZA 4BU1A 5C46F 5K0GA 4YT8A 3QZ7A 3DZ8A 3KJXA 4NCNA 2FQWA 4UVDA 3F5QA 3JALB 3GUZA 4MLZA 5KOHA 2P5TB 1X8XA 4RVHA 1B1AA 3I39X 1B16A 4QULA 4XYEA 1ZQMA 5D85A 3TADA 1WPRA 4JSRA 4IVQA 4MWOA 4W9NA 4JFAA 1T1RA 5CRXA 4EZ9A 3ZX4A 4BP3A 1XTPA 2HUPA 1YCGA 2Z8ZA 5DRTA 3WGUA 2BZGA 4KQ6A 2K7FA 2YH2A 3QMWA 2X23A 4C7ZA 4QE3A 3WU2U 5LWHA 3HUUA 1XEFA 4FFLA 3ZBPA 4Q0MA 5KDDA 4QZAA 1OXKB 1RYDA 4X24A 4F86A 3BMOA 4LV6A 4YPFA 5HS4A 1OLSB 3AVVA 1O95D 1P4AA 3HJUA 4MQLA 2QMHA 1CV2A 2NO7A 4RHUA 1RPNA 1GQRA 3EUEA 1SCUB 3RC9A 5IXSA 5JW6A 1DEOA 4JP2A 4AKGA 3JWHA 1X9WA 1E1NA 2O4CA 3GMDA 2FUNB 3TOVA 4PEVA 3SKYA 4D4KA 2OCYC 3RS8A 1FJXA 1AGXA 1VRCA 5DWVA 2DUYA 4AURA 4RORA 4O5AA 7ICVA 1TCVA 2J0UA 3C6BA 3K9NA 3W78A 1KEEB 2ERYA 1JMVA 1T43A 2EBUA 3GK3A 3UY4A 4Z3OA 3OHMA 3AM1A 2CNWD 1HYEA 2PBZA 2PWYA 1N2GA 4O0IA 3E9NA 2WTEA 2ZANA 4U02A 3N07A 1W0KA 1XU4A 3HWWA 1SBZA 5JMPA 4ZGGA 4DQIA 1M72A 1DELA 4OHOA 2J6IA 5HHHA 3FPAA 4U2DA 3DFFA 4Y9DA 3AEZA 4ZQFA 3REGA 3CEPB 5HQ3B 5E1MA 5EHGA 4OXXA 1XWLA 4CN8A 4ZEMA 1AKEA 3PV8A 3RTVA 4Z53A 5DNAA 3UH1A 2J4CA 4C0WA 2NSLA 6REQB 3HMKA 5C4GB 2C8LA 3QWAA 2YN4A 5A1JA 3KIPA 3O4HA 4L9SA 4TVKA 2QD5A 3I52A 1BN6A 2ATEA 4JY7A 4XTRA 4MAFA 1XCGB 4INOA 3HR8A 4CTJA 5L7TA 2EQBA 3GIWA 1KC3A 2RH8A 1IXKA 1KEZA 1PRYA 3Q7PA 4BEJA 3FBTA 3AQIA 1W93A 2H48A 2QQFA 4GP9A 3JZFA 3NXSA 4EY7A 2MDTA 1LSUA 5IILA 3QW2A 3L1VA 2ID8A 3NU1A 4GYYA 5BSGA 1IOVA 1RWPA 2XMCA 1MB3A 4IMPA 1P5JA 3HXKA 3H0LB 4JV2A 1EUDA 1WTAA 2XR1A 3HZRA 1Z0KA 4LOAA 4DQDA 4HUJA 4KAFA 3WC4A 2VP3A 1RS0A 1EBFA 1RIIA 1P2GA 3BYZA 4BPRA 2ECFA 1H4SA 5I7SA 1WCXA 3I2HA 1VXOA 2GVNA 4FR2A 3VAAA 3T0IA 4M9GA 3V4RA 3AY3A 3O0DA 1TT5A 2H3VA 1H69A 3UJHA 1DBIA 1XRJA 2QENA 2UVDA 3C4JA 3BWCA 5EJ5A 5HMMA 1NZBA 1VJ0A 5JWOA 5BPFA 4OJ6A 4YDSA 4BMDA 1CLEA 5HR5A 2FTKE 1WB9A 1GL7A 3UO8B 4YV0A 4MR7A 2QR2A 2H9IA 1QB8A 1QH8B 2A1TR 4W82A 2Z6QA 1F06A 4EA9A 1APBA 1DIHA 1LSSA 3DTTA 2WYVA 1K7EB 4Y2VA 1VKHA 3PA6A 1UMBB 4YYEA 4EJ2A 1PFVA 4N7MA 3DOHA 3C2KA 1JN0A 1Z7WA 2BDEA 4PQYA 2VAPA 2FQYA 5KQRA 1KJZA 3LUAA 9LDBA 2ORVA 4HQNA 2NYRA 4RYDA 4NK5A 5H3HA 1PR2A 2E3TA 2ZIGA 3W5SA 1ZQLA 5JXHA 3VQTA 1G8YA 4C2UA 3M6XA 2VYFA 3DNPA 1T36B 5FUWA 1YDMA 3UKOA 3VH3A 4NDZA 4QEZA 3KOZA 3F71A 4YHBA 1Q3KA 1R8SA 4V0NA 2GBPA 1NZJA 1GCOA 3KR0A 2FLKA 4PIVA 5K2MA 5K05A 2XHZA 5LZ2A 3VPDA 4DT1A 2BHTA 2JJ2D 5KX5F 1N36B 1FNBA 3HXPA 3OE4A 4YACA 4ZVMA 2BFEA 4PNHA 1D1QA 1T34A 5I9MA 3OGUA 2HOIA 4C7MA 1SWWA 4YCSA 1S2LA 1YZHA 3CNQS 2P9BA 2Y76A 4S24A 3F47A 5JBNA 5KJFA 1GDDA 3PKZA 1CUIA 2YJ6A 1KSJA 2VLIA 1XEWY 5HR7A 1OA1A 1RVDA 3HJNA 1CBUA 3IXMA 3OPYB 3UYKA 2Q9UA 3PITA 5F9NA 2GSDA 3EDOA 1ECFA 1PW5A 2OORC 3K9GA 4Q01A 1PN3A 1Z4IA 2OYSA 2RD2A 1J1UA 4YAKA 2JEGA 5L1LA 3SSOA 3BCRA 1SGGA 3QENA 3L4KA 4UDXX 4MI3A 3HACA 4PPYA 3B6JA 1VSBA 1Y6RA 3RYIB 2R48A 1M1YB 4QTUB 1CUEA 2PTGA 1U8XX 2ZFUA 3R6DA 4L27A 4NFSA 8ICOA 1SUBA 5TZVA 3EOBI 1LPNA 1RJ9A 3C24A 4GI2A 1BHO1 4D4HA 3IJRA 3DDZX 3OZDA 3AVTA 2D7JA 4EHLA 3R77A 1BPZA 5CD1A 2R25B 3W2HA 4I4TF 2KEYA 1R6AA 3AG6A 4R6WA 4MX8A 3ON5A 3R74A 5AIAA 4BX9C 3SF0A 1Z6QA 3TLXA 4BE9A 5BWLA 1CVRA 2FWAA 2N1BA 4D8YA 5JSQA 3K70B 2XWBF 5DNVA 4QDOA 4JJ6A 1A2KC 4TV8F 2JZOA 3P9CA 5EZSA 1GRNA 4M9XA 3E58A 2M2IA 1UMCA 2YCBA 4GVLA 3DFIA 3MMPA 4IDGA 4ZU6X 1KQGA 4OHWA 5EJ8A 1FFVA 3LSYA 2NRXA 3O2JA 1EKXA 1O94D 5HFAA 4Z3DA 1EB9A 2Z9DA 4G2TA 3IOCA 4LJLA 4MQUA 3HSKA 3UG7A 5IT9A 1A4RA 5K0CA 3WWCA 4EVIA 1TRKA 2UXCB 4EKGA 2EC5A 1KI6A 5C53B 4HQKA 4BCCA 3GAMA 4IXMA 4YRPA 1Q1BA 4I2DA 4O5EA 3MGGA 5TY0A 3DDOA 2YASA 3H9JA 3LUPA 4BIMA 4NBLA 4P4LA 2C4VA 2UZ4A 2ZUVA 5H2FU 1E2FA 2NLOA 4KYUA 2IOFK 2EKQA 4H4EA 2NU8B 2YJ4A 3HFSA 3UFBA 4MB6A 3GT7A 2CC2A 3LPDA 4Z9FA 4HAYA 2F2AB 1U1DA 2YBEA 3EZ2A 4HXGA 3IERA 4N8DA 5LBTA 2AJTA 3L8DA 2YFYA 3HB0A 1EDEA 1E66A 4PS1A 1V2HE 2XVAA 3I9OA 3UB3A 5CFQA 2EAOA 3AR2A 3UGJA 3D54D 3QVSA 4WE3A 1L3IA 1R6DA 1HEIA 4Q4HA 4EOGA 5BOSA 1I3NA 1T5IA 3W7VA 3CY6A 4H6VA 2ZQYA 2M1XA 2XDYA 2LKYA 4IFIA 5BOSB 1U0LA 5TISU 1NVTA 3WOHA 2IPAB 1UCVA 2IYWA 2VHYA 2BUAA 3AVUA 1UBTS 1BWQA 1W0JD 2H1WA 3C8UA 4KO8A 2IV3A 1FXUA 4HAOA 2QTZA 3PGJA 2NPFA 3VDXA 4XJVA 1CJSA 1U65A 4B6RA 1AB5A 1EXNA 4NG5A 3OURA 3F5AA 4CF5A 1X9HA 1QO0D 5JALA 3AGQA 3CR8A 2DLCX 4Q8FA 4GMKA 4KTTE 2ZT5A 5I4IA 5I8WA 1GVHA 2H3QA 1RYFA 2IGTA 4CF3A 3MWFA 5ALJA 4ZMSA 4NEHB 4B9AA 1YTUA 2EU8A 1FJHA 2VNKA 4I6JA 2BGNA 2BPGA 1EUCA 4PYKA 3T7AA 4AS1A 2EW8A 2NNWB 4MS3B 4CI0B 5K0SA 3G7SA 4LSMA 4OOEA 1YVEI 3O4FA 4QEDA 4DBZA 3CMCO 2VHVA 1EUCB 1QQ7A 3CWQA 4QOJA 4R05A 4W63A 4EO7A 4X85A 4OLHA 2Z8YA 3NC4A 3QEOA 3U3XA 1FFSA 1JVBA 4HBZA 4RZ2A 2ZIWA 3KSBC 1D5CA 4LK3A 4CNQA 1UKYA 2GPYA 1ZJWA 1NLMA 1VBMA 2JAOA 2ZRAA 3MFIA 1LDBA 2XF8A 3NOVA 4WVFA 4DV5B 2J0QA 3X1ZA 5FLXA 1N5DA 5LZ8A 3I4FA 1R3UA 2NPOA 4HADA 1R8YA 4M8KA 1BX1A 2J3LA 2HJRA 5IVHA 2AN9A 4Y7DA 5BYAA 4X6LA 3K0CA 5DTRA 4RJIA 1LVHA 3EF3A 4LF4B 3KM0A 3REQA 2HBMA 4BP1A 1Y1RA 3PXXA 3INRA 4EHDA 1OROA 5EWLB 4RUCA 4KWIA 1EDDA 3IDAA 5A4DA 1Y3FE 2ECPA 2RHHA 3FE2A 2A9FA 3WB1A 5EWLA 1CQZA 4B3XA 2GAAA 2KBEA 5K4GA 1QKJA 2O0JA 1Z5NA 3JQGA 3SVTA 4QOHA 3CNNA 3FWHA 3WSWA 1SIOA 3M9LA 1GT6A 1Q6ZA 2P9QA 2PS0A 2D0IA 3C48A 4OXIA 1GPMA 3NEJA 4JLJA 4ZYVA 5EUQB 2G8LA 1SH7A 1H2XA 1HY3A 2OFWA 3ILVA 1IJEA 4BU0A 9ICUA 5SY9A 1QIFA 1XMXA 1NRWA 3N2KB 3RSFA 3JYLA 1FCJA 3HYRA 1CEXA 3IYLW 2QNIA 1XQWA 2IIQA 1T24A 3KJHA 4U7WA 1EFVB 1KYXA 2C5EA 3IUMA 2OCGA 1IJBA 3OC0A 4G8JA 5K3OA 2RKWA 2H92A 1QC5B 1DBVO 4MTLA 4WNCA 2MU2A 3JARB 2F2TA 2OV4A 5KT2A 5HZHA 3KTQA 1GZSA 1SVMA 2V9WA 1ZDMA 3EJWA 4MV8A 5KMGA 2IH4A 2BCGY 3K2BA 4HNQA 2G6BA 1C9MA 1PGPA 2MSLA 4NHEA 4MS1B 3GCGA 3T5LA 1V35A 2ZWAA 4H15A 4HDQB 2P65A 1N2CE 1QOQB 2GWSA 3ZDBA 2HTEA 4RY9A 3AOGA 5DLPA 4OH7A 2VTBA 2HQBA 1ZCBA 2QLLA 3QX3A 4NOJA 2HJVA 3SCZA 1ZK1A 3GRZA 5H81A 1PK1B 2W9BB 2OB1A 2ODWA 4AI6A 3AF6A 2O2XA 4JUDX 4CKBB 1DTSA 1VKOA 1UDWA 2Q6VA 3NPAA 1WZCA 5MFZA 1COZA 3JQBC 5ICGA 1NNLA 2FRVA 4I4NA 3WIVA 5AJVB 2I1LA 1H93A 2YR0A 4Y9SA 1N2ZA 5SV2A 1RJ9B 1TO6A 2C78A 3RVOA 1OBHA 2ZVJA 3ZHSA 2ZETA 3TZKA 1K8ZB 2F3SA 3PO4A 3GMIA 2FN3A 3D3KA 5FIUA 5FO0A 3K4GA 3DVSX 2A9KA 4YH1A 2LIVA 2Z5GA 3L8CA 3VOSA 4J7UA 5T6BA 4M9HA 1A2BA 3HSSA 5ARCA 1XYVA 5A9SB 2WWYA 2ZTVA 4KQWA 5TPZA 4F4DA 2PLWA 4G24A 1Q8KA 4DMGA 4ED8A 2Y0DA 4Z7NB 1NNI1 4AD8A 1NKTA 3RO7A 5E3HA 5M5BA 1MHTA 1NN3A 1P4SA 4GMGA 1DIRA 2FPSA 5LIPA 4DVJA 3DJFA 1SKWA 3CX7A 1UPHA 2GDJA 3AI7A 2QM7A 3PHBE 3O8LA 1NRIA 4BNXA 3L7KA 5SYAA 2DUMA 4LHVA 4BJQA 4B3DA 4BNNA 1PVRA 1SCAA 4JR2A 4TL8A 5CT4A 2I4MA 5B1SA 1JVSA 3NDPA 4UNNA 4U6NA 1RJWA 5AVJA 1ZQ1A 1GR1A 3WQSB 3T1NA 2HCTA 3L6OO 1E3DA 2HNAA 5GJWC 1DO0A 3RRMA 4RD4A 4ED9A 1G8KA 3AOEC 2ZIEA 4RJJA 4NJ8A 2R8HA 1R15A 5SY4A 1F2UA 1GGMA 1HT0A 3OBIA 4LUCA 4A0GA 2X0RA 2XNKA 3HWRA 2G0AA 1UXKA 1JLMA 4Z4HA 4C22A 4P84A 3STYA 2GOLA 2VDWA 1E79D 2BUBA 2WV7A 2JD2A 2AJLI 4KYTA 4O59O 4QYTA 3E0FA 4BUJA 4QOEA 4DWWA 2C1ZA 4P5DA 4QHSA 4UHHA 4F3CA 3X43A 1TAMA 3LX5A 4QOIA 4BNKA 4JKOA 4CLXA 1S2NA 2J4FA 3NDIA 4ITVA 5C7YA 3DZFA 2BCQA 2K8CB 2H0AA 4NCXA 4P35A 4DLUA 2OB2A 3CLKA 3EXHB 4CRXA 2SKCA 5H83A 1M8PA 1GN9A 4C2TA 3U4AA 3NHWA 3OQJA 2VHZA 1D0IA 1NU6A 2QORA 2Y9MB 2ES6A 3EZXA 1PZGA 4FBTA 3F7NA 3MGBA 3N2ZB 5DTJA 3T3OA 4M60A 1AK9A 3S6JA 4I9HA 4ZA2A 3TSAA 2P1ZA 4XIYA 3VR5A 2P90A 3I05A 4YJ2F 1O96A 2PO5A 1RHQA 2LM4A 2DCUA 3O3NB 1DWPA 5DNEA 2F3RA 1PNOA 2NTJA 2HRCA 1S9FA 4MWTA 1EHYA 4MUJA 4R7TA 3OQOA 5HCIA 4RIGA 5K8JB 1COWA 1ZMTA 4QUEA 1CIPA 1IN6A 2L2QA 3BXEA 1RKVA 4TVBA 3TUJC 4JD5A 4TS4A 5CPBA 2ZT7A 3U7QB 5CB4B 5J9FA 2Y9PB 4HAWA 4U00A 4YCNA 4F93B 3SPXA 1FW8A 1J0CA 2HBRA 1OZFA 4MW1A 1NUPA 4GLBA 2OGSA 1YBAA 3CZCA 4FLMA 4FLFA 3TX2A 3E05A 4F2GA 3JPTA 4WVLA 4XRGA 1QIJA 3PRKE 3JPRA 1E2UA 1FXSA 1OI4A 1JLHA 2E1EA 1R66A 1VSVA 5TF4A 3PGMA 1F8FA 3V4PB 1LSJA 1JDVA 1Y4SA 4KP7A 2JVIA 3WJ2A 1V6SA 1Q2XA 1QRSA 1V37A 2BFNA 4CMEA 2V4ZA 4KVAA 5KSZA 1RXVA 3WGZA 2R00C 1D2CA 5CA7A 4IMRA 4LJ5A 5U1PA 3RSZA 3GXBA 1YB7A 2H57A 1F60A 1WSAA 4MIOA 1Z6ZA 4Y67A 3JD2A 2J6BA 1OFTA 5KTKA 1EYZA 5TEWA 1QIIA 2P9HA 1DRVA 5AJHA 4IKOA 3SYRA 3GJRA 3NBMA 2KLBA 3K8QA 5G2OA 1TYEB 1QH9A 5EWJB 3KELA 4Z2YA 1V6CA 3NHYA 4HDNB 3BCHA 4CLDA 1L5YA 1MEEA 1EE2A 2QJOA 4YJ3A 3JTEA 1QQAA 3NNDA 4KK4A 2Q4RA 3LY5A 3PC3A 4DB4A 3EWIA 2WB2A 1UKVY 1PT5A 4FSHA 1XRNA 1ZQHA 4BPBA 3W34A 3MCVA 4PO9A 5LVAA 1C30A 2OXFA 3HFRA 4UATA 3O0TA 4MV4A 5E3IA 4WNAA 2O8BB 4UXHA 4QYSA 4DIEA 1XZ8A 2ZBPA 4DXAA 1SHKA 1CKEA 4ZHQF 3LQQA 5JI2E 4K9RA 3ETDA 3HUFA 4M7PA 1Z25A 4H2DA 2O8BA 2XMZA 3D5TA 1LC3A 4LISA 1C1DB 3OZBA 4R8MA 2QRGA 4YMWA 1WZEA 2Q0HA 1T3LA 3TQOA 4B7UA 4CQJA 4KR7A 3G0GA 1UZUA 4RAQA 5TQ2A 3AT1A 4LNUA 5I5GA 1RQ7A 2P4UA 2XTZA 1KO1A 3GLGE 1W8IA 5KSYA 5KT5A 3ETRA 4YI3A 1L4KA 2J3DA 4PAGA 3RS7A 3MXOA 2DQKA 2BM1A 1L6IA 3VR2D 2J5BA 2VQDA 4PJ0U 3A28A 3EARA 8ICMA 1E2LA 3L7NA 4F5EA 5ALZA 3OKPA 1F4PA 2C0QA 4DEVA 2YVKA 5B4TA 1DVRA 3ABRB 3QVUA 4RX1A 1SCQA 4ZYUA 1V71A 6Q21A 4RM3A 3A6DA 3F1KA 3F5FA 4RYLA 2WHQA 1NR7A 1PNQA 1ZNYA 4EABA 2GCIA 1XX6A 4RQBA 4N48A 2H4ZA 4RF5A 3ZGZA 2W98A 4P0PB 3CURA 3D6UA 3CS3A 4S2EA 3CO5A 1JQEA 4C5CA 3KZMA 2WTNA 3IR6A 3NG1A 3ZHQA 5C32A 1QONA 3VJLA 1C30B 1FZTA 3UPDA 5EFOA 4GLJA 4CEHB 4HEQA 1MF7A 1GKYA 1J0BA 2IZOA 4KFTA 7ADHA 3OM8A 5J4HA 3LZCA 5LP6C 1S0UA 3TBKA 4DOCA 2Q5JA 4LXGA 2F6RA 3ZK8A 3EA0A 2RG7A 4G4SP 4TV9B 1W5SA 4LVOA 3TPCA 3ZTWA 4FEAA 3R3XA 4NCHA 1XMJA 4XUGB 1TQHA 3ZGNA 4C9BA 1KY5A 5CFNA 4LXHA 3D2NA 2GEJA 3BA1A 4IX1A 4DPLA 4GZLA 1ISJA 1DUIA 4HVCA 2E37A 4QNLA 1B8NA 4GPIB 1XLUA 2D2EA 1WZNA 1Y3AA 2I3GA 2BWJA 1H05A 1NPDA 2AFHE 3INYA 3ISTA 3JX9A 4JLBA 2ATVA 4MF2A 4MEBA 1CR4A 3BE8A 4RANA 3A70A 3IP3A 4A8JC 4D57A 2IXAA 2G4LA 1XO1A 2ZKLA 1G7CA 1FU8A 3E0XA 1JE0A 1OWMA 3BAZA 4XB1A 2BJVA 3RYFA 3FMGA 4DOMA 3H87A 1ABEA 3VTAA 1CD5A 5ES4B 1ZWKA 3LV8A 3NKFA 4YMGA 4ROSA 5L4SA 1U0EA 1NY6A 3GLGA 2XI9A 4I55F 6ADHA 2H5LA 1UC5B 2M9MA 2R7AA 1TPYA 3P5SA 4L16A 2RH9B 3OPQA 1NP6A 2ZRCA 1RWXA 3HS3A 1QX3A 2AQ4A 3LC0A 5BMVB 5I6DA 3Q11A 1TYCA 4XD7A 5DM0A 3PMLA 2ZREA 4XGNA 4B74A 4BJ6A 2XYHA 3TTSA 5IS2A 4NS1A 3TECE 2IW1A 3MOGA 1HL7A 5AI8A 4P4OA 4KLLA 4N4AA 2Z3ZA 2ZVQX 3RAGA 7REQB 4Q39A 2EZ4A 4KDCA 3F53A 2QPLA 1V5IA 3GLSA 3O26A 1AKMA 4FZ3A 2AXQA 1HMYA 3V80A 1A8SA 3ZXXA 3TQHA 1SXPA 4M22A 2AGVA 1XAJA 3CUTA 5KVQA 4GIBA 3M9XA 5DKWA 1UFOA 3SIRA 2C8VA 3TLKA 4C1NA 3PBKA 3SXJA 3B6MA 3ELYA 3GCXA 2O8VA 4E5UA 3KVNA 4RPYA 4BV3A 4YP6A 5JPIA 4DRYA 2W4QA 1OW3B 1KRXA 1OMOA 5DTEA 4DBLE 2B2NA 3LKBA 4WBXC 2NZUG 2HK9A 2PZ8A 1T94A 2R5FA 4MYSA 2CWWA 3G3EA 4QNNA 4QNRA 3CW9A 4TV8A 5COQA 4ENVA 4JHLA 4ECQA 4C7VA 5JDCC 1IZ8A 3BM5A 4ZYXA 3HKZF 5KTRA 5L8VA 2BEVA 4GXJA 1C7ZA 1ADBA 3DE1X 4FFVA 1FTSA 5DE3A 2XQIA 1MXHA 1CDDA 1C3VA 1TAGA 4A92A 1A95A 5LYJA 4DREA 3PW2A 1B00A 4RS3A 3NBXX 3R4CA 1ZISA 1QWOA 3A9VA 2CMGA 2PZAA 5AIBA 4KLFA 4OM7A 4KN6A 3WO0A 3UJAA 4YCCA 2MUTB 2W6ID 3RLIA 4O2AF 5A2QA 4QW9A 1VMDA 1Y9DA 2W2OA 3AI1A 1CS4C 1GRVA 1T4GA 3GIDA 1P9OA 3BE4A 3KB6A 3KKLA 3FXAA 3L9WA 3IXQA 1J22A 1DG9A 2JHPA 4LQDA 1YVRA 2VCYA 5ALQA 1AXGA 3N59A 3P96A 3PE6A 4PHTA 4WXYB 2YFKA 4WT7A 2WY2D 3S44A 1EXMA 3FPSA 4EJSA 3EEIA 5JBQA 1KORA 4ABYA 4J6FA 4U2EA 2C7RA 3HR4A 4MWGA 3E35A 1DIBA 4Q1BA 4U0JA 4URXR 2LTAA 4LYAA 3FBGA 2PWZA 4R9SA 3ZWKA 1TKDA 5CEJA 2QJRA 5BR4A 1I24A 1PR0A 2IYOA 4IDPA 5F23A 2WKWA 2QB1A 1NMQA 3KP1A 1CJCA 4I9NA 4YJ2B 1AB6A 1UOOA 1L4FA 2WE8A 3AWIA 2IZZA 2Q1WA 2VDVE 3IMKA 3K30A 3RF6A 3L1HA 1AUQA 1YXMA 5K8TA 1IIRA 1RNLA 2YYSA 4IDOA 2PUBA 1XNJA 4F6CA 1RPTA 3ORQA 3A31A 3H8VA 2X9NA 2QBYA 1Q1AA 4LE2A 5EMMA 3JQPA 2JLQA 1R0KA 2VYNA 5BQ3A 3TLGA 5J4KA 3GEEA 1E2DA 2GCNA 1XEXB 1CUFA 3BREA 4HGZA 2HVIA 1ISHA 3OY2A 2X0IA 5K9ZA 2I2FA 3R0IA 4ZGBA 1KL9A 3GLFB 1ETHA 1I2AA 2XE8A 4QU5A 3GZJA 5JIBA 3FAKA 2E49A 3IKTA 4A0SA 3CLRD 1W36D 3O75A 3GLHA 3T9AA 3OT4A 4IJVA 1YDHA 2CWDA 3L05A 1C29B 2HEGA 4M7RA 2O8DA 3OZEA 3LC2O 5JDIC 2K4PA 4A6PA 2WB1F 1RE0A 4TYNA 3IE1A 1BHQ1 1J06A 1CUSA 4R1UA 1SU7A 2W3RA 4MUHA 3GVXA 4R8RA 4Y6PA 4D9NA 2CB0A 3LSTA 4I3FA 4URWR 5F7JA 4EW2A 3TZHA 4JT9A 4C29A 3PV0A 1BEUB 2A0YA 3HYNA 2OMEA 4GL4A 3IUYA 4IHJB 4KACA 2Z8YM 2F3PA 1IM8A 1YU6A 3FDZA 3K96A 3OHSX 3SZOA 4AN0A 2BCVA 1JFRA 1TLTA 2WSMA 3AUSA 4LSZA 2CCJA 3Q7SA 2J9FA 2QYHA 8ICBA 3D7MA 3L0YA 3VHXA 3FRJA 1D1SA 2GF0A 2POCA 1J8VA 5KKAA 4ZJPA 5ALDA 2W8LA 2Q1XA 2CXYA 1RDFA 1Z6TA 1S77D 2IEBA 3TIIA 2OV6A 3JALA 5JJIA 3M49A 2HBLA 1KVSA 1IQPA 2BCEA 2D4AA 4MV9A 1Z5UA 4BKUA 1RWNA 1ESEA 2EKPA 2XODA 3GVCA 4G37A 5CT9A 1Z6PA 3HBFA 4FS8A 1L9KA 1T0BA 3K53A 4PVCA 3Q7RA 5FT9A 1H5QA 3BWVA 3WNCA 4I2VA 1QHIA 1Q14A 4OO3A 4TXHA 5K3SA 3SDSA 1ZJMA 3U3OA 3C39A 1KMQA 1ZQIA 1HDRA 1L5UA 4OQQA 4C4YA 1A6SA 2H3IA 3BB1A 1YC5A 2C07A 3TW6A 4ER5A 1J2EA 1T9GS 3KTFA 4ZVRA 2YVAA 5DRYA 1C9EA 5EZQA 5I8ZA 5CCDA 1KRHA 1QSYA 3TOZA 1A3CA 1M1NA 3I1JA 1DXQA 4A26A 5HOEA 4B2IA 3GMTA 2GRAA 3LFUA 4K3UA 5CDHA 5KYGA 4JJAA 4I1SA 2XOKD 4IS7A 1I7LA 2C2ZA 2JAQA 4K40A 4B17A 4AQYB 4RFSA 3OQHA 2BD0A 4KBYA 2KKPA 1R4MA 3ULKA 1PJ8A 3IVRA 3D3WA 4TYQA 2VKTA 4NE2A 3B7WA 4WERA 1U2GC 3NP7A 4P5PA 1YBVA 2W93A 3QEMB 5K4AA 1Z4PX 1GL9B 1T8UA 2Z2XA 3ZU3A 5DB9A 4M1MA 1U0FA 2WWFA 4OGKA 4Q24A 3OQMA 3WYBA 1IU9A 1PGJA 3BL8A 5H4HA 2HA0A 5JWRA 3L8MA 1TB4A 3N9IA 2XY7A 1RPAA 2HNKA 5KYKA 1WV0A 5ISMA 4DDMA 1R88A 1KBOA 3B60A 2YB1A 3PSTA 4C7XA 4WBNF 3I4CA 3NEAA 2RHLA 3UUFA 2VF2A 4HTFB 3F2VA 5IG2A 1OZGA 3DNMA 1KQFA 2Q4TA 2JANA 4FCCA 1L5OA 2JAHA 4ESOA 5KTMA 2Y0SC 2LYAA 1JAZA 3PRYA 1A9QA 1TF7A 4IRXA 1NDHA 1V48A 1KL7A 1UPXA 3CGGA 3H1EA 5JEEA 1WLYA 3RVMA 4ASUD 5CT6A 1BU5A 2WVHA 3FMFA 2OGUA 3TAQA 1RYMA 2EHDA 2UUPA 1KRWA 5T14A 3N6VA 3MBOA 5JC1A 4F3KA 2OCIA 2WABA 3RTBA 4KLMA 2D3WA 2XRFA 5FTKA 3QFCA 5J2KA 1UPTA 3BSYA 5LMZA 1XRLA 1HE8B 1OKKA 4YRMA 5FPSA 1EUDB 1O97C 3SJZA 3ZJYA 1XDSA 2DPXA 4J7CA 4Y6QA 3RTEA 5KC8A 9ICEA 1Y5RA 4YQFA 3HFJA 1CLUA 3U56A 2V7PA 1MH1A 1HMPA 2OV3A 3IKJA 4IV8A 1NI4B 4P36A 4K1LA 1KO4A 4HLQB 5FWXA 2WMYA 4LFBB 1NYLA 2PSDA 5AW5A 3D2SA 3IG5A 4F11A 1L7OA 1VIYA 3FLEA 3KE9A 4D5EA 1YRAA 2G1AA 4KQ2A 1G59A 5C1DA 4CIXA 2ZP1A 1QQTA 4Y6SA 1AUPA 4M7OA 1PNTA 4GECA 5SZHB 4R51A 2WJYA 2H63A 1PT9A 4PX9A 3IAAA 4WFQA 1OU0A 1GKUB 2Y1CA 3RNLA 6LDHA 2IHNA 2CDBA 4OI4A 2ZWOA 2W7TA 4GLOA 4P81A 3B38A 1VYTA 4K28A 3WLTA 3E3LA 4EL0A 2OGZA 2QNBA 3VMFA 1GZUA 1E5QA 3CKYA 1KOLA 2JLXA 3D2CA 3F5DA 1K6IA 2WWRA 1U8TA 3VHQA 4Z5XA 3WBJA 4FQ7A 4ZKEA 3GELA 3GFVA 5JZVA 4GW3A 3U9SA 5EJ6A 4MLPA 3UMYA 1U3CA 3MQFA 2NU6B 3D0QA 5TF0A 1A9YA 4Z99A 1G98A 4FZNA 5K6AA 1S97A 1ZSYA 3M1LA 3UQYS 1Z2AA 2KHZA 3D6NB 4G4SO 4YCAA 2AXPA 5E7QA 3ERCA 1SM4A 4PHEA 1VFNA 2EKDA 1XZLA 1ZCAA 3CBGA 4NYMQ 2FXIA 1GTSA 1YKSA 4OG2A 1ONNA 3P71T 4J0IA 4H7KA 4O3OA 7ICKA 1TVCA 2FE1A 1XLVA 3RJKA 4IDEA 1PJRA 2JGLA 4CLOB 2P9YA 1P74A 1LK5A 4DCGA 1JU3A 1BGXT 4MW2A 5AESA 4JBHA 1JXOA 2YVQA 2M6KA 4ZREA 4C5BA 3H3FA 4HYQA 3DBRA 4C6RA 1B6TA 2PI5A 1DE0A 2P2NA 1CNMA 4F2RA 1DEHA 3L01A 5DJ5A 5ERXA 3ISVA 1JH9A 1SBTA 2C9DA 3D6FA 1CXZA 3ZXUB 2WWHA 1OYYA 2PXAA 4GXQA 2BPOA 3AF4A 4ZJZA 1JGTA 4H35A 1L4NA 4Y2UA 4DQSA 4Q4DA 2EEPA 3IBGA 3LTEA 2C59A 4KIJA 1UA1A 3HY3A 4KQJA 5B1IA 1N25A 5JEDA 1EA5A 2BLLA 2JA2A 1P6QA 3PDJA 5BN3A 2QMEA 1Y82A 4UUMA 4I5EA 2CHFA 2J30A 4C7BA 4JP5A 3RADC 3ZYCA 2FPMA 2P41A 3CKLA 3T38A 3TR6A 5DG7A 5ALIA 3CZQA 5AICA 1J0XO 2QTGA 2ZUUA 2YIJA 3M3HA 1HEKA 3ZH2A 2OPBA 2AH5A 2CXQA 4UBNA 4QYXA 2JZNA 1NQUA 4U7JA 5D5HA 2QRVB 3V3KA 2Z3WA 1QAQA 3EVEA 9ICTA 5FADA 2WPDD 1Y3HA 3FJOA 3MOIA 3AP3A 4PE5B 1JDZA 2FLLA 4C0KA 2OXOA 1S0OA 1USKA 1T0JB 1H2YA 2OV8A 5G0WA 3ROEA 1OILA 4FFBA 3RPEA 1F1JA 3D6AA 1YE8A 4LGVA 4S0XA 1WMBA 3FHOA 3CNLA 4KKVA 4PGMA 2Q5LA 2P8JA 1IN7A 4R2JA 3RAPR 1JIQA 2R5NA 4K88A 2XZLA 2YQEA 5SYNA 4AXXA 2AXTU 4FE3A 1DADA 1E7YA 2C97A 2YV5A 3B3QA 4H77A 4LPSA 5JHHB 5K99A 1ZGCA 1P9RA 2FW1A 2Y6VA 1PFGA 4US0R 1RJEA 4O3QA 3OEHA 1P19A 3EBPA 4M9QA 1JSCA 3VC3A 2VS1A 2AGOA 2OWEA 3AIMA 3VR3A 5CDYA 1NI5A 3ZLUA 5D2CA 3V00A 1RXCA 3AU2A 2Z5LA 3N7RC 5FL7A 1O08A 3G6WA 4ZIRA 5JSZA 1Y9JA 5KEIA 1VDZA 3KT3A 2G36A 5IKEA 4WSOA 3FSEA 1CJTC 1H1LA 1MW8X 3P0JA 2G63A 4MYRA 4A10A 3BFJA 5JVDA 1GTRA 1FMFA 5FPTA 1KEWA 3MJDA 1G3QA 4CL2A 5AM5A 1W1UA 5LB2A 4MVJP 1HNNA 5E9QA 2X41A 2EFYA 1FMTA 2XUZA 2ZT6A 4DF4A 4H59A 5CVVA 3LHKA 3HNPA 4EZ6A 2VZ0A 1F20A 2PX8A 3GRCA 4JLDA 1HNXB 4C01A 3F9RA 1BDHA 5SZKB 4MICA 4FOLA 4BLRA 5CH5A 3GNSA 3I64A 3QSYA 1PUZA 4EF5A 2CLDX 2OC4A 4FOSA 4X00A 4XUCA 4ENTA 3L0SA 1Z7GA 1TYBE 4LYHA 3KHHA 1WXDA 4ZXPA 1HDCA 4NENA 4XRRA 1UJ5A 1FRFS 2CN1A 4X61A 3BB4A 3L41A 2F4NA 2B6NA 2Y05A 3RF9A 4L7VA 1PE0A 1A4UA 1E9BA 1YS7A 3OKAA 3RR8A 4NL4H 1DTWA 2J0VA 1CP2A 4IXWA 2R6JA 2WM3A 5F9MA 1BRMA 1S0MA 1VYHA 3NTVA 2QT0A 5D7BA 1JJIA 2ZWMA 3EVDA 2RB4A 3C1ZA 2EJCA 1PNRA 2ZTCA 1BA2A 2GZ1A 3F67A 2HF8A 3LUHA 3UTDA 2ZRNA 3N8NA 4B6PA 4DLRA 5LZ5A 1B23P 1GQ2A 4R64A 2APJA 2JKVA 2QTLA 1NR5A 3BQ2A 4D9EA 5BPHA 5JJKA 1YI1A 3PUYA 1FEZA 4YRBA 4KLSA 4YAUA 1SKBA 5KFBA 4YUVA 4QFCA 4KPEC 3D4LA 2O1SA 1DCTA 2VXBA 4ENWA 4QBKA 4UHFA 5LBUA 4NCJA 4Q3DA 721PA 1E89A 4ECVA 2XXBA 3QMMA 3ZNQA 4AMYA 3OZIA 3E22A 5IIJA 2OXCA 3OA0A 2W9XA 1EUZA 1A82A 1M1YE 1WXXA 5KDLA 4RIFA 1XR3A 4IGFA 4RMIA 1MB0A 1NBMD 4RCYA 5CX1B 1I33A 4V1CI 3M5DA 4N9WA 3FY4A 2Z2KA 3S2YA 2NZ8A 2BGGA 2PMFA 3CV3A 5FUQA 2WF7A 4QJ3A 2GN8A 3RS2A 5EAIA 4OFWA 3CNOA 4Q1FA 1AOXA 521PA 5FUVA 4TYPA 1NQWA 1FYDA 4AZTA 1SZDA 5KFCA 5C7LO 1NONA 5I5EA 5A5VA 2AMVA 2QRJA 3A06A 1V3TA 4PRYA 1KBZA 1IB0A 2R8IA 4OYRA 3TAHA 2JH1A 1UAYA 3U4MA 2EJUA 5EPEA 5L40A 4M1EA 3D5EA 4UZSA 4GPEA 2A33A 1TT7A 3DWIA 1G3MA 3OT5A 3D8BA 4PYIA 1MXFA 4NZ9A 3DPSA 1L5WA 3HPOA 5EL0A 1WMAA 3G2QA 3T7EA 4CKBA 5KYUB 4MMZB 4GC9A 3DAFA 3THWB 3S2GA 2IOFA 1AXEA 3U3RA 3OFSA 2RGNA 3EY9A 4EFMA 3PIRA 1A77A 4ACBA 2RKOA 4FBLA 3HA3A 4BQPA 4G36A 2VJ5A 1X9GA 3PWSA 4C7OA 4ETMA 2VTVA 5D3KA 1MENA 2ZJ7A 4DEYA 3BQ7A 2F1KA 2VO1A 4Y6OA 2QU7A 3KQOA 4KQIA 3SF8A 4AKSA 1BIFA 5JC8A 1S4QA 4JYBA 1B4DA 1UJNA 2P2SA 1RQGA 1RKXA 2I54A 2F1HA 3Q0IA 1CEQA 3MJCA 3R6WA 3E9RA 4V02A 5BYJA 2CHEA 3A3OA 5AVUA 1E1YA 1FFDA 1ENZA 3MQ2A 5ICSA 3MD0A 3TYXA 4ZVSA 3EXIB 5AK6A 4G8DA 1SBIA 1T4DA 3D0KA 4W7HA 1SVWA 1PKXA 2NV0A 2UZ1B 2NZVG 2XXJA 2W9CA 1TK3A 4LDAA 4JUZA 3DEAA 1I3MA 3VNSA 2X6RA 1BCRB 4Z4FA 3GEDA 3KLMX 1TZMA 4C7YA 3CVUA 3BJEA 3N5CA 5AKYA 1XXHE 4URFA 4NAHA 4AJ2A 4ER0A 5GONB 3S28A 2R7KA 2RGYA 4KLGA 1M2GA 1PR6A 1K2VN 1UC9A 5FLEX 1E1DA 1LLUA 4K4HA 4J9PA 2HK8A 1Q7RA 4GOKA 1G8PA 3WE7A 1E2BA 2GRJA 3GNTA 2Y1IA 2X13A 3BCUA 5LUBA 1MCZA 3GJ8A 5E7IA 1FSGA 5DBOA 2Z4SA 4UQOA 2XUDA 1L4UA 1T6YA 3H3JA 3QWIA 3R6LA 1G4HA 4E3WA 3OWOA 3VHLB 3KJZA 1LDYA 4OJTA 4K05A 4QZVA 4TTIA 2R00A 3OT1B 3EDMA 5DOZA 3OHPA 1TFUA 4YREA 3RRYA 4AFNA 3BAFA 4FSDA 1B2RA 1QRDA 1XKXA 4FUQA 4MI1A 4QQRA 4TS1A 4J2OA 1DU4A 1TMOA 3FCAA 1GSHA 2VDPB 1PJZA 3A6LA 3GC6A 1FNSA 2HWKA 4KN9S 3VZDA 1GZ6A 3V33A 5C8VA 1XOIA 3DOJA 3GJ3A 3PLAE 2I62A 2OA0A 1OGIA 3LVRE 1Z5WA 2IEZA 2K8BB 1XK7A 2VXCA 4NBNA 1U2ZA 4DQLA 4JJZA 3SBDA 5IZ4A 2V6IA 3K1JA 1Z2EA 3BL6A 3HFGA 3LDUA 3VNBA 3GU3A 3X2FA 4H0CA 3FGPA 3ZHCA 1GNVA 3RJJA 1II8A 3ELWA 3PWTA 4UZFA 3TZBA 1ZOLA 3LM8A 3PQ8A 5JNRA 2AT1A 3PFBA 3W4JA 1NBMA 3CW8X 3WGOA 1JALA 4EJSC 5E1DA 3L92A 5E6UB 3BS5A 4TQUS 4D46A 4LOHA 1OZAA 4MRSA 5AKXA 3KL4A 2H4FA 3OFJA 4BDTA 1KI1A 2YIVX 4C03A 3A4YA 2A59A 4E32A 5KNLA 5AUNB 1DDOA 5KTSA 4G4GA 5A5DA 2QEQA 4B3CA 1GWNA 1VJCA 1C9DB 1UOPA 2BV3A 2KPOA 2QV0A 2WHPB 1DGSA 3A25A 1Z73A 1WHSA 3N8GA 4GU5A 4YV2A 4KFUA 4CIWA 3U61B 3HU3A 1H4TA 2VJ4A 1GPH1 2JKYA 1WSWA 3BXPA 1T35A 1VKJA 1E77A 1MO4A 1M6YA 2I2BA 2PKQO 2VP5A 4NKRA 4HXEB 2DECA 5FR1A 3V2UA 1XRPA 4L28A 3W8FA 2P79A 5HUHA 1NXWA 5I3CA 3SDZA 1K8RA 3HUTA 2XDQA 3DKRA 4M1QA 4YWJA 4Q4HB 2UYHA 1YH3A 4C8KA 3AYZB 3NYQA 5HIIA 3PCRB 3HKCA 2GCPA 5EN4A 1BVYF 1GFWA 1Q83A 4KN8A 1U5BA 1TA4A 1ZZGA 4CLEA 1A7KA 5HIAA 3FNGA 1YO6A 1SXEA 1VKZA 1QIMA 5IHPA 3PDIB 3OD1A 2QX9A 3M4NA 5KFZA 3EGXB 3T34A 3V72A 1I51A 2FPXA 2RCYA 3GGOA 1D2AA 3H2GA 4RZXA 4R1MA 4XCQA 4XXHA 2F59A 5FBWB 2FX3A 1TXGA 2ZSDA 1XQYA 1ZQXA 2H9YA 3C87A 5BWNA 3HJGA 4F1KA 2Q3BA 2Y1FA 2FLWA 4ZT6A 4AJHA 2OR3A 1K5OA 2NYVA 3DE5X 4UJ3A 4DDUA 2AKEA 3PR4A 1GGEA 3WRWA 1HTBA 3ETEA 1PTKA 2AJDA 4M86A 1U0NA 2Q0XA 4R1LA 1XNHA 4N8SA 1G8JA 4L3WA 1N9ZA 4OUKX 4QA9A 2OZLA 4Z9YA 4EB6A 1IFXA 2JHCA 3R5JA 3KALA 4X44A 3B3AA 3MJTA 3BWDD 3I1IA 1RIFA 5LQCA 2ENWA 1BS9A 2B9EA 5GP1A 1ZCFA 3UV3A 5KYYB 2BCSA 3LC1O 3RC2A 3UC5A 1VKRA 2VJMA 1ECCA 1PT6A 2C0CA 3T3IA 2QB0B 2HT6A 3R23A 4C06A 4I28A 3CLUC 3GCZA 1W30A 2GEDA 1M2KA 5AOBA 2B21A 1CZLA 5AI0A 1PVVA 3CVOA 4OGLA 4BO6A 1IN8A 5C3MA 4QPZA 4W4TA 3CJRA 2WT9A 1G38A 1YZFA 4A3SA 1CSEE 4F7DA 2QAJA 2O23A 1XZAA 3BH6A 3SYTA 1CUHA 2DOKA 1RZ3A 2C2XA 1U0OC 2F9FA 2REBA 3G0DA 3I9KA 3DLPX 4GBGA 1FPMA 5IW8A 4LZLA 4EK9A 4RDHA 4ZICA 1JHMA 2MINB 5KFEA 4GXKA 1Z19A 2AWOA 3KXPA 1VHJA 1BHJA 1QNLA 2RHJA 4U7FA 4RNMA 3OTWA 2Q5EA 4WZBE 4AN4A 5AR1A 3HVRA 3OIWA 4U9HS 3OHAA 1OWOA 1T91A 4G84A 2WE7A 4MRAA 3SFZA 2OZPA 3QHQA 4D56A 4ZYZA 1AO0A 1A4IA 1XN1A 4Q3BA 1ZP6A 2X9VA 4NMHA 3ZHYA 3SIWA 2X40A 2XB4A 3THSA 2XEDA 3C3YA 2IBKA 2W4MA 1ZH2A 4YJKA 1W49A 3OLYA 3PEEA 4M99A 4CMJA 2GDZA 2WB4A 1JI0A 4QZEA 2C2KA 1P2TA 2QW8A 2VANA 1VJRA 3P0IA 4TRJA 4A8HA 3ZDAA 1SELA 3FSRA 3I6QA 1E0SA 4ZT5A 3QPUA 4IDNA 1PG0A 5CK5A 4ICAA 4HD8A 2IUFA 3PF8A 4P58A 2ZBDA 5IEBA 4NY8A 2VPWA 1YL6A 3LJKA 4HK4A 3RF7A 2XCRB 2C7QA 2QB0A 3DAOA 2VUSA 5PGMA 3NCHA 4PZLA 3QI2A 4D02A 4TT3D 3T5BA 1SXJD 4B3SB 4RH1A 1VHQA 3AVPA 2DPJA 5KFFA 2CL5A 4PSKA 6ABPA 1U7DA 1IYZA 3O3OB 4J3JA 1PL0A 4FD2A 5DOVA 2BPCA 3DZGA 3MR2A 3OIVA 3GP5A 3WAKA 1ZI6A 1P6XA 2E4ZA 1N1EA 2KKVA 1D04A 2VOEA 3ENWA 2GLXA 3R0JA 4FVTA 4ZZ3A 3KWFA 2J3IA 2QQGA 2JBWA 4TKUA 3VKGA 3S27A 1DTEA 3LLSA 1YZNA 4Z0HO 4PFKA 1VLHA 4MVJG 3EXFB 2CJFA 1QKIA 4B34A 1KAQA 2PZEA 4WCFB 5FAXA 2YV3A 1PZMA 3ACDA 1YAHA 3T4XA 3B9QA 3QXXA 5DTIA 4RGBA 3K1TA 1K5DA 5JSUA 2N75A 1JLLB 1UM9B 4BMVA 1N34B 3FKSD 4EVSA 2GK7A 3WJ7A 2FPKA 2P66A 3S2EA 3WWYA 1QF7A 1JB1A 3HCPA 4XX1A 4H1HA 3K0CC 1H2FA 3G9QA 5FI5A 3PFNA 4MQFA 2C00A 1KNXA 1ZRHA 1A9ZA 2NIPA 5THQA 3DB2A 2V7QA 2XQFA 3LXUX 1HDOA 3QPAA 2XDWA 3REOA 5KYWA 5FOTA 3H65A 4B4DA 3H6KA 3BSWA 2Y1JA 3C4QA 4HGPA 1NK5A 1JHVA 4RLHA 3TZLA 3UUGA 4A0FA 1AHHA 4DQVA 1D0SA 2DVMA 3JQFA 3R3SA 1JLKA 2XEXA 3PRHA 3ZEIA 3C2QA 2ZZNA 1E0AA 1NC1A 1KSGA 4O3SA 3TX6A 3OU6A 3O8CA 3MWEA 1D8BA 1DX4A 3K9FC 1XPOA 3TNDA 4J9KA 1VE6A 3ANLA 2JFUA 2QX6A 4B35A 1CR1A 1LH0A 4F4JA 2LWIA 3UMRA 4BO7A 4KFRA 2V54A 5JNUA 2XNJA 3ACCA 2ATLA 1RLOA 2XF2A 2MYUA 4J0FA 4QX6A 5DVZA 2C61A 2BDUA 3F7TA 1V25A 4P5EA 4PYMA 4YRFA 3LPLA 1J07A 1SVOA 4ED2A 1IL0A 3G5MA 2HL6A 4K1XA 3W4IA 2BSQA 1E1RA 3N05A 3OX2A 4HZIA 1UPFA 5MDHA 4BVFA 1ENYA 2O3UA 2XTNA 3B8HA 1SOWA 1CIJA 1MX1A 3F8WA 3QOFA 3KEFA 2XBUA 3ICOA 4J16A 4J0GA 4KMMA 5DO9A 3N97B 4B7AA 4CDRA 2BOVA 2Y99A 3BIFA 3JVDA 4MWBA 3AKZA 4HLNA 2I6GA 4X97A 4RESA 1JYSA 1PG5A 3FM9A 3AETB 3H05A 3DEKA 3MEQA 3QVXA 4M7WA 5B1EA 3A9CA 5DU2A 4NH0A 1PR9A 5JFTA 2YWFA 3G7UA 2G71A 2ZIUA 1IULA 3IIMA 3QX8A 4AT1A 2WQ7A 4IRUB 5J2HA 3DV0A 3I6BA 4L8LA 1DKRA 1OJ7A 1R64A 1ODFA 1X3LA 5AHXA 2B2XA 2D1FA 4L9AA 4OBEA 4OJMX 4UAVA 1BJKA 2B0CA 2XWJI 4NV1A 2MSWA 3CUSA 1EG2A 3K0FA 1LX7A 3KJGA 1ZQTA 4CUKA 5EMLA 4WOBA 2KZMA 2Q3MA 3GRVA 2X1VA 4RGYA 4DYHA 2E4WA 3TNJA 3ZE7A 4BS9A 4DA0A 2WNHA 3ZI4A 4UB4A 2FLPA 4K9LA 821PA 1WCIB 2RJ3A 5LU9A 3V6KA 3O3MB 4OQMA 3ZGXA 8GPBA 4E08A 1SCDA 1EEHA 4ZAXA 4NX2A 2KOBA 4BWJA 3QZ8A 4P1ZA 4B9LA 3FG9A 4GM1A 4JUCA 3A1EA 3LWMA 2V6BA 4JGBA 4JI5B 4C78A 3HA5A 5FTJA 3VKFA 2E8OA 2YW9A 1TFRA 3NV9A 1NK8A 1BSVA 1BVHA 1T3HA 3ZWCA 3GLGB 2R47A 4DIOA 3MR6A 1JSLA 3G7NA 3RAJA 4DRXA 4AJ4A 3RSSA 3RE1A 5MF6A 2WUEA 4YT5A 2IEYA 2LUOA 1F17A 1KOJA 5BNIA 5JCXA 1V1MB 4I1PA 4E03A 1IV8A 2EZ8A 4V2UA 4OKNA 5AW7A 3KB1A 2QRZA 3W9YA 1J5PA 3QLJA 3NTRA 4ITUA 3U5ZB 3I92A 4GEGA 5DB7A 2GJKA 2Y92A 2ZRHA 5BMOA 4NM2A 1OB5A 3I09A 4KR3A 2EYUA 2C99A 2ZPUA 1EVKA 4RJLA 4RK0A 2PV7A 4LECA 4LK2A 3ESRA 3LIIA 4B4KA 2PUCA 4IQ8A 4EPYA 2GEFA 1N62A 3DJYA 2XUFA 5AOAA 2XUOA 4V0LA 1GGFA 3IHKA 5B7GA 3D64A 4WKBA 5BYBA 1N6PA 2ZYHA 4DJJA 4ZO9A 1KA9H 2A9JA 5T3UA 2JLAA 3DBOB 2ZRFA 5ERYA 3M4ZA 1WTCA 1P1JA 4IIGA 2XWQA 4KSCA 4U2BA 1QAMA 4NVRA 3TLGB 3S2FA 2XCTB 1EGHA 1W75A 4ECWA 2QN9A 2YWEA 3IVXA 4O1HA 3WG9A 3G9UA 4FD3A 1ZZEA 2NX2A 3AMVA 4N6OA 2EQ5A 5AVOA 5ULLA 5IDWA 2JHDA 4R9VA 1IAVA 1RYYA 2I55A 3CIOA 4RSHA 2BH9A 1LRKA 5JASA 3IAFA 3MGAA 4BATA 2VP2A 4NFLA 3WHIA 4KQXA 2NO0A 4C7JA 3BMNB 1E3SA 2CV2A 4OL9A 2IBMA 4NOMA 3S1SA 2A7QA 3GPIA 1H0HA 3A1WA 5M3BA 5JQWA 7ABPA 1OTXA 5IT0A 2B5WA 3S2SA 1ZPDA 4J0DA 3WFIA 4HCJA 1ZVKA 3TUIC 2WFMA 1CPYA 4Q1VA 3J80A 1P72A 1C1DA 1SC9A 3JR7A 4PYLA 3FVQA 1PGNA 2VWPA 1Y8ZA 5GJBA 4PLTA 4NJOA 2Y0SF 1T6XA 2L0XA 2JAUA 5H70A 1G3RA 2XSZD 3F2BA 1KI3A 1R18A 3AK4A 3FSGA 4DMUB 4CTMA 5C9ZA 3MINB 2RMKA 4RKQA 5HP4A 4QO7A 4B3TB 1NQOA 1ZQEA 4FT4A 1SK9A 1NOJA 1TO2E 2AX4A 3RBDA 3QLUA 5L3SA 4RVSA 4LQCA 3PHGA 2W03A 7ICLA 1E5XA 2C2YA 2GLUA 3A6GA 3KQQA 4FR0A 2QQ5A 1NP7A 2C7GA 5AQEA 3ZVKA 4QVKA 2P2LA 1HYQA 5TGTA 3FYCA 4KBFA 5T5QA 1J49A 3RUAA 2GILA 4CETA 4EG4A 1ULAA 4RKFA 5CFRA 4NZZA 3IDQA 4GLFA 1JFFB 1CCWA 1JKXA 1SUFA 5KFXA 3PVZA 4RGVA 1E9VA 4QATA 1KK1A 4UHBA 3LLUA 5IAKA 3NVZA 3COVA 3GUYA 3BQ9A 5AW0A 2MYNA 4YGXB 2PLRA 4CKWA 4AM8A 2G1UA 2QM8A 2QTRA 1RYBA 5C34B 4IDDA 1EAMA 1KC1A 4JEHA 1P7YA 1VRVA 3PC2A 2B8WA 3R7SA 1AN0A 4MUXA 1SAYA 1ZJYA 4I1YA 5JBIA 2JGFA 3WRVA 8ICUA 3ZVNA 1NUHA 3B6EA 1K6XA 4Y30A 1X6VA 3DHVA 1Y5IA 2YJ3A 4JMUA 1W5BA 4FW9A 2J3EA 4DAOA 2B34A 4K0RA 3MPUA 2HRDA 3RJEA 3K9LA 1VM6A 4EKDA 1XZFA 4Q47A 1M3SA 1NDUA 2XVMA 1E1QD 3ZV5A 4EFKA 2GEBA 1VP9A 5AK5A 2WU8A 4IQ4A 4HDSB 3FNRA 4U6QA 5HZMA 1IZ0A 1EEXB 2B83A 2J5XA 2J9FB 3AJEA 3GA7A 4I9FA 3TQQA 1YONA 4YVZA 5EI5A 4X62B 1Q0SA 3KUXA 1H2BA 1RZUA 3G5LA 4Q3NA 4Z8XA 1HGXA 3SBEA 4JXZA 1H6AA 2Q3EA 4XIFA 3SEFA 1X8KA 3F2IA 5DASA 4WXPA 1GKKA 1P2VA 3ZD7A 1OX6A 3UMCA 4KDFA 3IPXA 3R0ZA 1EINA 1SCIA 4RETA 3LHDA 3PXCX 4G0NA 1P9LA 2OXRA 1Z4JA 5GY7A 3HU1A 1UBMS 1O57A 1E6EA 1DTWB 2GHRA 3DV2A 4OHBA 3QP9A 3VU0A 2PD4A 1NGSA 4J6EA 4AUKA 3HB1A 4HEHA 4EARA 1Z0UA 3PXGA 3ASZA 3WSVA 1W2HA 3OTOB 4WZZA 4NEGA 4A2WA 1GAXA 1L7PA 5AKZA 3RYCB 1Z06A 4LVCA 3N0TA 3HCEA 1CB7A 3KZIU 1EDZA 1LQ2A 1THZA 1N0UA 1QGED 4HB3A 4NONA 3PQCA 3TANA 4XSHA 2QYSA 1E2KA 3HYLA 2PGIA 4FC6A 3MGKA 4HNAA 4UNQA 3VNQA 1IHYA 4TN5A 5HUQA 4I4TA 1MT0A 2BFFB 2PKXA 3B85A 3Q8XB 1CYDA 4IVPA 4P2BA 4UUOA 4BYMA 1BNCA 4OH1A 4JWKA 4PH5A 3OJWA 3G85A 3ZHVA 5LA6A 5J2DA 2FWRA 2Q4EA 3O1LA 5LUAA 3T1YB 4PYNA 4ZOLA 1KRPA 4E4TA 1XDGA 2GR9A 1FBNA 5ALEA 1NI4A 1WY7A 2X0JA 3L7MA 3WJAA 3IP8A 4ARAA 4DLWA 3TW8A 3H86A 4TXMA 4AN1A 2IYRA 4J94A 2G0TA 3DMTA 3N0VA 3HLYA 5AI9A 2D3DA 3D4IA 3QLVC 3RK0A 2XVTA 2IV2X 5MHTA 4EY3A 2GN1A 4PGHA 2DFNA 3WSTA 2J33A 3NRZA 4N76A 1DAKA 5JRZA 2PMZC 3AUUA 4H3SA 4IGAA 4MLCA 1DAIA 5DX1A 2WJGA 3UWPA 1Z0IA 4DRXB 3UXEA 4QDUA 1TMYA 1PK3A 3TQCA 2DC1A 2H4WA 2ODPA 4RQ4A 3MPOA 3V7UA 3X3HA 4AF6A 3BIXA 5KQSA 1OYOA 1Y4AE 3AP1A 1W59A 3EDRA 4ZVLA 3L6BA 1I7SB 3X2EA 5A62A 4PIPA 2VDJA 2D4HA 2R2AA 5B5EU 1N8TA 2J07A 1RWQA 2ORIA 1KVRA 2MOKA 3GRAA 2YQ4A 5FB3A 3TL3A 5H3CA 1E3QA 1F14A 4QHTA 1TVAA 5DT2A 1QU3A 1Y6QA 3BF8A 4FX2A 3D2BA 4ZDKA 5CD9A 3Q7TA 4YRQA 4A15A 3ILHA 1D09A 2W55A 2B7CA 3EN0A 5EE5B 1IPEA 2X5OA 4DLYA 1XTJA 3B2EA 2ZIFA 3OJFA 1FXWF 1U3UA 4MFAA 3MJFA 3OTGA 1UXGA 4R84A 4TTQA 5HE8A 3DHWC 4QZHA 3RTDA 4AICA 1GN8A 2XVYA 1N7JA 1ZGBA 2OY0A 4GMFA 1L3TA 2VBFA 1IJFA 4E2ZA 4IJQA 2YQ5A 5DIZA 4D9BA 3ETLA 1EWKA 5LD2C 4P3PA 4RNDB 3K4HA 4C0JA 1JDBC 2QW0X 1CRWG 2AW5A 2UKDA 4OHZA 2NV6A 5ARBA 1WAMA 1NX9A 3T5GA 2XXAB 5A4AA 1ENPA 1WM1A 3RS9A 5FUYA 5LMCA 4CQNA 2IYUA 1BWSA 2VDQB 1MZPA 1KZ4A 3TCNA 2RC6A 4BNYA 2D6FC 4HSGA 1SR8A 3UC9A 4CM4A 2VHEA 2CNOA 3V9PA 2NT4A 4X20A 4WOJA 6AT1A 5KBYA 4QQ8A 1E0JA 1UJ2A 4TMKA 2H1OA 1FK8A 4FDLA 5ICCA 4U7CA 3OP1A 4R4JA 3RJMA 3TAUA 5KNDD 2VF7A 4K8OA 1KIFA 2E6KA 4YAFA 4EO9A 1FYWA 5AQ1A 1NUAA 1B8VA 2HMAA 3P4YA 4P22A 4TMXA 4LZOA 4KLTA 2MT9A 5KT7A 3BDPA 2ZI7A 5FO1A 3SIPA 3NJRA 3V7FA 3W2GA 4B8YA 3WIUA 1YFKA 3HXOA 2JIDA 1U0TA 3DMYA 2YHBA 3LUDA 4BBJA 3IQXA 2CVOA 3NRJA 4U0KA 4UJ5A 1L7MA 2O5VA 2OAGA 3KQVA 3VU8A 2Q6IA 2O9JA 4B40A 1QGYA 3OETA 5H4GA 3BXFA 1G5FA 3UIEA 1TM5E 9ICXA 1DV1A 1QU2A 3SYKA 4YR7A 3ITKA 1BAPA 1KDPA 5J2BA 3ANNA 3U48A 3DBRB 5HA5A 1US8B 2LHTA 4BBZA 2Z6AA 2XA2A 2F8TA 3KPUA 1SZPA 2RHTA 1F0NA 3EC7A 4Z9BA 5JXIA 3I5YA 3TMAA 4ERXA 2H7VA 1SURA 4DS5A 3MWKA 4LXQA 2H07A 2Y66A 3IDZA 3DWGA 3OP4A 4EGCB 3K9QO 1WU8A 4FZ5A 3IO5A 4IDQA 1ZMOA 1HSZA 3E27A 3LE8A 4C8NA 7ICUA 2ZE6A 5J2UF 4P38A 3AU9A 1V4BA 3EW9A 2A88A 1C2YA 3VNAA 5C8YF 2OZEA 1BPDA 2ZKIA 2BSAA 3HL4A 4GWKA 2XPCA 3IQIX 1PBTA 2VP6A 1YASA 4EQZA 1U28A 3DMDA 3H2IA 2X1LA 1QZUA 4OHXA 5CJPA 3ZWYA 4ZJYA 5KFYA 1IAQA 3RH6A 1TCCA 3K0KA 1WCNA 2F1JA 5CM8B 3WWEA 3UXOA 1B6SA 1V9SA 3BDVA 1UM8A 1G291 4GI1A 3TTUA 3IKLA 3W7AA 3CUYA 1L4LA 1L5HA 3TLYA 4EJFA 4EG1A 2JFGA 4WKNA 2AR7A 5DSXA 2WMOB 1V95A 2X7JA 1ZGZA 2FDRA 4LWOA 1D4AA 1D6MA 1SMKA 2V5UA 2HDNB 3M9OB 2ZIZA 3AIKA 5T4FA 4Q7QA 1EUYA 2J5RA 1XTVA 4KLQA 4UUAA 4CT0A 1QLWA 3C7TA 5FA5A 5KHOC 1Q0QA 3PDIA 4EHAA 3CSDA 5IJXA 4DL5A 3EQ2A 1WVIA 3W2FA 1Z36A 2ZRLA 1JHZA 2FETA 2IZ6A 1WCV1 1I4LD 4UKDA 5BWCA 5LCXA 1OWPA 1Y1PA 4KXUA 3QTLA 5DK4A 4P0TA 4ZGWA 3M1IA 2C4WA 2FP3A 3QJGA 4FCTA 4MR8B 1J2JA 1T4CA 1YDWA 1VP3A 4GOND 4M0DA 4EYEA 3VTKA 5KNDH 1YS6A 1U9LA 1VG0B 2VKQA 1T4CB 3U3DA 2ZSIA 4IWNA 3HW8A 1D6SA 1F12A 3AM9A 3G0OA 3NPMA 3V34A 1BQEA 3V1TC 5LP1A 4B2YA 3GFKB 2GETA 2Q8NA 4KIGA 3KV3O 5KFTA 7ICFA 1Y5LA 5CA0B 3RANA 1YA8A 2VN8A 5TR9A 4QIWF 1GZ5A 1P75A 3PUJA 1R12A 4M38A 1VSQA 3CSUA 1CP3A 4J91A 3WMXA 5IC4A 3P5BA 4G5OA 2HCFA 1S89A 4DMKA 4DJDC 4ZANA 2CNWA 3W6PA 2XGJA 5DH9A 2BTEA 3JVEA 5CR9A 5AVKA 8ICJA 1KFEB 1S2GA 4QWBA 2JD1A 4YRGA 3PEWA 3GCWA 3S4YA 1P7ZA 4WASA 5A5EA 2F43A 1XU9A 2VUIB 2PKWA 1BXRB 4NEQA 4C4XA 1L4BA 3GLHE 1OXSC 3CJQA 3L4PA 1D4OA 4XB6B 1X7HA 1N75A 2FLVA 1W4AA 5EFZA 1FX0A 3STXA 1UBOS 1NJSA 3F98A 4XVCA 3GLIB 3C5VA 4IJMA 1G6Q1 1XWIA 2DWUA 4LY3A 1EP9A 2IKQA 2AG0A 3AM3A 4JWMA 4BNWA 2NRTA 4UOZA 2WD9A 1T29A 1X80A 1W47A 1EJ6A 3U2QA 1FMJA 1FO4A 2VATA 2PS9A 1W25A 1JT2A 4F8YA 1XD8A 3MMSA 2IEIA 1IY2A 2CZCA 2HAEA 4LA4A 4KXFB 3D4NA 1QHYA 3DYVA 3GOQA 3HN7A 4HXYA 3JQGB 4IV0A 4BO0A 1Y6FA 4ZOEA 1FA9A 5CHEA 2DX7A 5DXFA 1JQAA 4OP2A 4PLHA 2RGDA 1TKAA 1RJDA 1WUTA 4W8HA 4LFAB 1V1JA 3ZE8A 1JQ5A 2WEKA 3EAQA 2ZTEA 4MGHA 3NYWA 5CWRA 4FFSA 3KKQA 3OCWA 2G77B 4KQ9A 3UW1A 4FNGA 3W8RA 1RQ2A 1H3FA 2J85A 4R54A 4YJFA 4AL4A 1TZKA 3WLMA 1Z00A 3UM9A 2H2HA 4RT3A 4C4AA 4EX7A 5E9AA 3LY9A 3CVXA 1DC4A 2VJCA 3K5IA 3I45A 4YP3A 1CZUA 2ZRJA 4R8LA 1IZZA 3K16A 4TMTA 1AZTA 1U7UA 1AGRA 1NJ1A 1ZI8A 2VXOA 3CCFA 3SJUA 5B37A 1R7RA 8ICPA 2CJWB 4YY3B 5KNCH 2WFZA 1TL7C 1D2EA 1XCJA 4LGCA 4AKTA 4MZDA 3GLQA 5DW3A 3KHSA 4BY9E 2DKFA 2NYUA 1T8WA 1UMBA 4ED6A 1G7SA 1P1FA 1Q95A 1WMDA 3B1VA 3C3AA 3EWAA 3J7TA 3K5HA 1KHTA 1CZKA 5KOJA 2I99A 3VVCA 4DV7B 2NVBA 3B0YA 2JIRA 1E59A 3R7BA 1YS1X 4ND8A 2A0UA 2RGWA 4Q7JB 1T9ZA 1RI5A 1W35A 3UXNA 1Z29A 1UDCA 4TX1A 5EG5A 4UE6A 5FQNA 3S40A 5A4JA 1NXQA 2DY1A 4GX0A 1X7DA 2EFJA 3W8EA 4OQDA 4C80A 4QRIA 2ZXFA 2GPNA 2IXGA 3FFWA 1UQUA 2PGNA 2QF7A 2HBYA 2Y93A 3CEJA 3I6ZA 5LQUA 4TWZA 1KJ8A 2DU8A 3O84A 1VLZA 3GEMA 4L75A 3W1VA 3NUQA 3M7DA 2G4CA 1NX6A 3KSUA 2GCOA 4MPPA 3RV4A 1NN1A 3BULA 4BQNA 4YRAA 5A02A 4XA5A 3BJRA 2AN5A 3CJTA 3H0EA 4MW4A 1ITZA 1Z2PX 2UZIR 3ADCA 3T7RA 2FJ0A 4A91A 1S8FA 5JAZA 2A78A 2Y67A 3SZ3A 3KKEA 3QG5A 1MEOA 3A27A 4I1RA 4DCMA 2VJNA 4MQ4A 2OC9A 2E1PA 1ZXXA 4DGQA 1NJXA 4G01B 1PG2A 2I78A 3IB6A 3L07A 4KO1S 4Q8EA 4CR7A 4DB2A 1U99A 5REQA 3BHNA 2KJQA 1E3WB 1ZO8A 3DEZA 1OYVA 2QN7A 4LNAA 2OSBA 2NV3A 2WAQC 2RDJA 3R3ZA 1Q44A 4PZZA 5GQSA 5KT3A 2P9CA 4PZNA 2HN9A 2VAWA 4H3VA 1L5RA 2GHQA 2XIQA 4X0EA 3ZQUA 2NU8A 1T9BA 5KAMA 2OZKA 4MMYB 4CIVA 3IRUA 4ARVA 1ZD3A 1OPXA 4PM4A 1LDMA 4CCWA 4UBMA 4YASA 3QVLA 4J1SA 1PV1A 2JD0A 1RG6A 2VXYA 2P8SA 4GVPA 2YJZA 1D7AA 4L8FA 3TSCA 3DV0B 4K6OA 2GJ8A 4N3CA 5BV0A 5EJ4A 3TLBA 2HO4A 2VPXA 1Y7HA 1NXPA 1X1BA 2BEKA 3L4SO 4AJ1A 1DWOA 4MGIR 3AJ9A 5KSWB 3PSIA 1E5LA 1LPSA 3RHFA 3SJBA 3VYUB 2QV7A 1E96A 3TZCA 3VCBA 2Y0BA 3KSZO 5AFSA 1EFCA 3OPYI 2H65A 3C5CA 1GNRA 1W34A 3PF9A 5TGZA 3WNDA 4UQGA 1U9CA 2OCXA 5HX7A 4RADA 3GV5B 2DZDA 2OBLA 3TNYA 3OBBA 2IS4A 5FLYA 1KFTA 1ZEMA 4RPLA 4F6RA 1QHFA 2WJ4A 1N3BA 4ZC8A 5DLDA 2Y1WA 3FSGD 3LQRA 4RK1A 4OB7A 2W6JD 3HI4A 4CE6A 3NX4A 2QP9X 1ORIA 4RF2A 5K51A 4HPXB 4F3YA 2QGFA 2YWRA 2WJVA 4EGAA 2F3UA 4G56A 3T3GA 4W5HA 2CL7X 2YS7A 3ZCRA 2BFCB 3F6RA 3FCUB 4CEJB 3KZCA 1Z1BA 2GO1A 1PDWA 1TK5A 1NW6A 3QF7A 1GQQA 4K6MA 3W77A 2EWWA 1AV7A 4AECA 3QKUA 4LMRA 2PLNA 4PZ0A 3ISBA 4F5OA 1KNQA 3PPXA 2Z30A 3P9YA 1BC5A 2E8NA 2QUHA 3HQ4O 4V0KA 1YVPA 4F2WA 1Z4OA 4RVGA 1U6JA 4EY6A 2JH9A 2Z4RA 5LPNA 1T5SA 3TM5A 4E2YA 3ALRA 5HF6A 2HDOA 3FR8A 4KSBA 5KTNA 2E5WA 4UC0A 1N6KA 5JJ5A 3RFXA 1G4AE 4QC2A 2JVJA 1LI7A 2FMFA 4F9EA 4JZKA 5KOYA 1LJ8A 3BJYA 1Y7TA 3I6IA 1Q92A 2VPZA 2Z09A 5HK8A 4TUPA 2ZYWX 4M1KA 1TM1E 3N0XA 1RD4A 3EEYA 1JMSA 4MQ6A 4RD1A 3S70A 2HT1A 1T0UA 1OKKD 1OGYA 3NWOA 4PCAA 3W9SA 3SHQA 5IMSA 4ZO7A 4KIWA 4D9KA 3ZNPA 2XIJA 3M34A 5JAQA 3AUFA 4AG3A 4RKYA 1S8NA 4AP6A 4B4UA 2YWHA 2BF7A 4F0JA 2CZQA 1HK7A 4CG3A 1LI4A 1KERA 2JGDB 1PZHA 4EI9A 2Y0EA 2VHCA 3A3KA 3MAAC 2O5CA 4D82A 4RA9A 4OXYA 1M75A 1LDEA 2HU7A 3R3HA 4DDKA 4Y2TA 2QRNA 1SPBS 1TKBA 2NXCA 1ZD5A 1CUVA 2QUIA 4MKRA 5GV7A 1KFKB 1TGVA 4PPGA 5HM8A 3HKDA 1WB5A 1I4DD 1YQ9A 2BTQA 5T4BA 2HF9A 4KITB 3GGCA 3QTTA 1PDOA 4KNYA 1QE0A 2F9LA 2VDOB 2VP0A 3MYYA 3QX9A 4JYCA 3IV7A 4FJ1A 2I65A 4QJ5A 3PNMA 2YMQA 1QCCA 2NSHA 3B1WA 3LFTA 4FFMA 4W5JA 1N2CA 1QLHA 3DONA 2A1AA 3EVBA 1XSPA 5C37A 1T9CA 4LGMA 2RK6A 1J56A 2O1EA 3H7AA 2QXYA 1XJWA 3LVWA 3ESQA 2KJ9A 1HC7A 1ZQNA 3C3MA 3IIKA 3JYHA 2GEUA 2TECE 4PTZA 3WL6A 4BX9A 1MOSA 4MCIA 2QJWA 4GG1A 1B6GA 4IYJA 4UTZA 5FI0B 4O4JB 3QPVA 3SI7A 1R0ZA 3HBLA 3HE3A 2DYKA 5EJIA 5HTKA 4BE7B 1C1XB 5ESWA 1F7UA 3G2NA 2JJ2A 3WDMA 3NGDA 4P7JA 1FYXA 4R1PA 3WYEA 5GADl 1TK2A 2C29D 1I94B 4UUPA 2I7XA 4MGKR 3ZY4A 4D0NA 2HQ1A 2UVPA 5ALXA 4WCFA 4G1EB 3LA6A 4TXNA 1BN7A 4YXWA 1VQ1A 2NT3A 4FFOA 2BLNA 3TPZA 4LF8B 5LYJF 2HBKA 1U2GA 1LZLA 2P11A 3F7MA 1S1MA 4C3VA 1L4HA 4L02A 3VGJA 3W7BA 4NCIA 5FOQA 1TPZA 4QUHA 2QRMA 4R69A 4R6XA 4RT2A 2IPMA 1BE6A 2G06A 4MRMA 5JS7A 3BDAA 3D8HA 1OX4B 4D3YA 1XVVA 1OXXK 1M7HA 3A1TA 1I30A 4Q6WA 3RU7A 3L4BC 1XB2A 3QPWA 2HGSA 4ZVQA 5EMHA 1Q77A 5KX5A 3PNPA 1E9RA 4ODIA 2Q9CA 4PAOA 2VWGA 1O87A 2FX2A 3FYSA 5E1BA 4ZAZA 4B84A 4PC2A 1S3GA 5JLAA 1G8GA 1QORA 4JT8A 4ETNA 1KAHA 1CX9B 4QIWC 4OQYA 2RE8A 4JI8B 4PYQA 3L9XA 5CDGA 3BQ0A 4A27A 3QOXA 3M82A 3V8BA 4MVJH 4EYHB 1PYGA 3BHMA 4YXJA 5D5QA 2XE6A 2Q3JA 5EP2A 5C8XA 1DK2A 3CW2A 2F8KA 2WHYA 4Y1EA 5AXAA 3THYA 3VX3A 1GA6A 1DMRA 1OI2A 2BQ3A 3HO8A 1KPHA 2J9XB 2Q9BA 4QQFA 3ASUA 5FNZA 3VU9A 3MR5A 4HEJA 4LS3A 2Y4OA 1DAGA 2B94A 4OHPA 3NIGB 3ZKAA 4BQFA 5DGAA 4FCWA 1YA6A 2G25A 4EHNA 3OLXA 3K5PA 1G55A 3NVWA 3ZPXA 2X2EA 2XGMA 1Q0ZA 1BFDA 1SCBA 1W4BA 4IFTA 3PEFA 2XB9A 1YT5A 3PDUA 1ZEJA 1JSRA 4YN3A 1XROA 5DHUA 5LQDA 5B4UA 1UM9A 5CXUA 4RQ7A 2HLNA 1U0BB 2O2CA 4FBMA 2EIHA 1OGJA 1I9GA 1ZITA 3TR5A 4C6HA 4RTRA 1J2UA 4BJHB 4E2XA 2FZCA 2H08A 3LLMA 4R8UB 5DLEA 4C6SA 5IYZB 1R74A 5JS2A 2E4YA 3J81k 1JQBA 5JCOC 1VPWA 1GSOA 2PIDA 2QTCA 1RAGA 1RP7A 2DGZA 1X7XB 2FWMX 3N7UA 4ARCA 1P2SA 1XNQB 4B8WA 1VL5A 4URZR 4HGNA 4RSMA 1A8UA 2QAIA 2YOFA 4A6XA 2WTAA 1NK6A 1ZOOA 3ROPA 4RQ8A 1W0CA 2FPOA 3IEUA 1M54A 2WF5A 2QMYA 2REQA 4DCOA 1EJ0A 1Y9EA 1TDJA 2AB0A 5LNK6 1GGHA 1A1SA 3H5VA 3I6YA 5KG4A 2W6PA 1YOVA 3QF4B 3VDRA 5DGBA 1LBEA