3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted phosphatase, HAD family
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
5AKZA 4XOUA 4UU1A 2G07A 2YMPA 1RMYA 3HLTA 3BWVA 1KYTA 3L1UA 5AKHA 2PR7A 1YNSA 4UAVA 1RRCA 4BNDA 4DFDA 2HX1A 3RF6A 2G08A 3OCZA 2P69A 1Z88A 4YIKA 4EX7A 1XVIA 3QUTA 1Z4PX 2EARA 1FEZA 2G1AA 4CE6A 5IS2A 3HYCA 5AHXA 3SHQA 2P9JA 1L6RA 5AKLA 5AM3A 3IB6A 1QQ5A 1N9KA 4E88A 3WKAA 2I54A 4MWOA 4FFDA 5ALPA 1X42A 2FPRA 5AW6A 5AKEA 3AR4A 2HCFA 5AVVA 1U02A 1J97A 2B1QA 2I6XA 2EATA 3W5BA 2P27A 5E0OA 2C8LA 5ALKA 4G63A 3AR7A 5T41A 5AVXA 4YCNA 2HEGA 2YMMA 1Z4JA 1JUDA 1TA0A 3M1YA 5AICA 5AVTA 3KDPA 1F5SA 2B82A 3ZX4A 2BY4A 3L5KA 3ZI4A 2EAUA 5AW0A 3WK6A 5AVRA 2IA5A 3QU7A 3U26A 3FGOA 3KZXA 1T5TA 3ZX5A 5AI5A 3OCWA 4BKMA 2YBDA 5AM2A 5AW7A 3W5DA 3MC1A 3SKYA 4BNDB 4F71A 3W5CA 3U13A 3D6JA 4IFTA 3WKDA 2GFHA 1RMTA 1ZD2P 3WK7A 2I33A 1EK2A 4L6CA 2WF9A 2BDEA 2HDOA 1QH9A 4UMFA 4RESA 3B9BA 2R8XA 4HGPA 3ONNA 2ZXEA 4YCMA 4Y2XA 5AKIA 2MU1A 3I28A 4MUMA 3QNMA 3ESQA 2CFTA 4Y3UA 3RFUA 1ZS9A 5AK6A 1Z4QA 3N28A 2C4NA 3QXGA 2HSZA 4KX5A 1Q92A 3ZUPA 1Z4OA 5JJBA 3BA6A 2JAWA 3SKXA 1RKUA 5A3RA 2C9MA 4HYTA 1MH9A 1O03A 1Z5GA 2FI1A 2FPWA 3EWIA 5AKYA 4UM5A 3QUCA 3E58A 3WKCA 2I34A 5ALJA 4ZEVA 2YFYA 3WKBA 3QLEA 2C8KA 2Q4TA 3N8GA 3MMZA 4NAVA 1S8OA 2JAUA 4NWIA 3L8FA 2WM8A 3L0CA 4HGOA 1O08A 3QU2A 4Y2UA 3VAYA 5ALZA 2NO4A 5AVUA 3KC2A 2ZBGA 4EX6A 2I7DA 4UATA 1IWOA 4Y2RA 3ZTWA 2PKEA 1WZCA 4KX3A 5AM4A 5ALOA 4UAUA 5AK4A 4ZEWA 2Q4RA 5AIBA 5ALEA 4C4SA 2YY6A 5IT4A 3PGVA 3DDHA 4QQFA 3NRJA 1TE2A 5ALHA 1AQ6A 3I1YA 2AH5A 2RAVA 2AMYA 4OHFA 5AW5A 3M9LA 4QJBA 3ZWKA 5ALTA 2MSNA 2AGVA 2DQSA 1PW5A 4DWOA 5AIAA 3L0YA 4Y2SA 3OCUA 5ALVA 4I9FA 3SF0A 2RBKA 2YJ5A 5AI6A 1YV9A 4YH1A 2OA0A 2CFRA 2HF2A 2NYVA 3SD7A 4Y2TA 3WK9A 2G06A 2RARA 1NRWA 3U7FB 3ZW7A 4EZEA 2GHTA 3NASA 1RLTA 2WHEA 4O8CA 3R9KA 1T5SA 3FPSA 4NFLA 3QUQA 5AI8A 1QQ7A 5A3QA 5ALYA 1L7OA 4Y2PA 3AR8A 2IOHA 4YGYA 2FPSA 3WKEA 5ALGA 2WF8A 5ALWA 1S2OA 3NAMA 5ALXA 1RPZA 3N1UA 2FPUA 1RDFA 3U7HB 2CFSA 5AESA 4UARA 2WF6A 4I9GA 3U7EB 4NABA 4J2TA 2B8JA 4NV0A 2IYEA 2YJ4A 4BEWA 3IRUA 4CNQA 2I55A 3ZVNA 3UMCA 4Y2YA 2P11A 2O2XA 3WGVA 2ODAA 3OTQA 3QX7A 1Z4KA 3FM9A 4B6JA 3U19A 5ALSA 4AS2A 1CR6A 1ZRNA 3PDWA 4OCZA 3OCYA 2ZBFA 3ZVLA 2YMQA 1LTQA 2W4MA 3KD3A 5AKXA 1U2TA 2R8ZA 3R4CA 3KOOA 3P96A 1QYIA 2FUCA 1U7OA 2B30A 5AW4A 3L1VA 3CZ4A 1Z4IA 1NF2A 2VKQA 2FPXA 2RB5A 4BX2A 5A3SA 3OCXA 3QYPA 3DV9A 1L7MA 3L8EA 4KN8A 4XPZA 3QU4A 5AI9A 1YDFA 3AR5A 1Z4NA 1VJ5A 1CQZA 4EENA 4C4RA 1U2SA 1WPGA 1Z5UA 4YIHA 5AW2A 4GIBA 3AR3A 1Q91A 4HGNA 3E84A 2CN1A 2OBBA 1RQLA 3A3YA 5ALRA 2GHQA 3B8EA 2OM6A 4RETA 2IOFK 4L57A 3PCTA 3W5AA 2WF5A 2HI0A 2B8EA 2ZG6A 3L7YA 3NANA 5ALNA 1WVIA 4KNWA 4OD0A 3ZVMA 2PQ0A 3ED5A 4CF3A 5ALIA 3EF1A 5AVSA 4BBJA 3QU9A 3MPOA 3I76A 3I6BA 4Y2VA 1ZOLA 2FEAA 2GMWA 1K1EA 3UMBA 1SWVA 5AM5A 1VFPA 4OFZA 1Z4MA 4YCLA 5ALDA 2O9JA 4DW8A 4BX0A 1TJ3A 2YN4A 2ZBDA 3N5KA 4IG4A 1L7PA 4UMEA 1RKQA 4HAIA 3AR6A 2IOFA 3PGLA 3SMVA 5AKGA 4XE5A 5AM1A 4BYGA 1RLOA 3NIWA 2G09A 2MU2A 4CF5A 2W11A 2W43A 3ET5A 5AW3A 5AW8A 3L0BA 2QYHA 2FUEA 1Y8AA 5AW9A 5ALQA 4L6AA 4EELA 3UMGA 2BDUA 4HGQA 2JARA 3N07A 2YJ3A 1ZRMA 1WR8A 5AI0A 1ZJJA 2GO7A 4J03A 3FPBA 3K1ZA 4EEKA 5AK3A 1XPJA 2HO4A 3ZWDA 3OCVA 4JB3A 5ALMA 5AKKA 3QU5A 3OPXA 4BX3A 5IT0A 5AVQA 1RQNA 1RC8A 4UMDA 1YJ5A 3R09A 2B0CA 3S6JA 4UW9A 3WK8A 3NUQA 1L8LA 4BEVA 3L8GA 5ALFA 3ZTYA 4GXTA 3ESRA 4G9BA 1TJ5A 2Q5EA 2G0AA 3FZQA 5ALLA 1L7NA 3EF0A 1SWWA 3F9RA 1QQ6A 2G80A 2NO5A 3A1DA 1N8NA 4F72A 3B9RA 3AR9A 3E81A 4Y2JA 2WF7A 3UM9A 1SU4A 4DCCA 2JAOA 3WK4A 3QGMA 4CF4A 2R8EA 5FP0A 2D2VA 2ZBEA 5AVYA 4HGRA 5AK5A 4UASA 3ET4A 4UMVA 1YS9A 1ZD5A 4KNVA 2R8YA 2HHLA 3DNPA 4AP9A 1LVHA 3CNHA 4XQ0A 3WGUA 2JGAA 5AW1A 4AS3A 1YMQA 1RKVA 2X4DA 1RLMA 3TLMA 4UU0A 2AUTA 2WFAA 4PNHA 5AVWA 3EPRA 3WK5A 1XP5A 1U7PA 2OYCA 3SLRA 4FE3A 1T9ZA 4UM7A 5AKJA 1RMQA 2C88A 1EK1A 3U7GA 2YMLA 5AI4A 3QUBA 3GYGA 2B1RA 1J8DA 3E8MA 2HOQA 1ZD3A 4JDPA 3MN1A 1VJRA 4H1WA 1NNLA 2YJ6A 5AVZA 5ALUA 3A1CA 1ZD4A 1L8OA 3IJ5A 3ZU6A 4ZEXA 4C4TA 2FDRA 3A1EA 4KYTA 4FYPA 5AM0A 3DAOA 1Z4LA 3FVVA 4Y2QA 2QLTA 3NALA 2HF7A 2ZOSA 3KBBA 3J7TA 3L8HA 1TJ4A 3AR2A
chains in the Genus database with same CATH superfamily
3BIOA 3A32A 2DFPA 4WFIA 3H9QA 2JIBA 4BFTA 5CM2Z 2ODNA 2LBPA 3E0FA 1PX2A 3ZHOA 3JPPA 4I6EA 3HY4A 2FQXA 4NSNA 2I8CA 4LVSA 3V4OA 4S05A 4YRGA 4RY0A 4NG5A 4N9QA 4J9MA 2QRQA 3P9ZA 1SIWA 3TRDA 4P54A 3U6BA 2P4EA 2LVBA 3OIYA 3BE6A 1HV8A 3QXHA 3KVYA 2ZWOA 4IH4A 4BLUA 3KEFA 5E2BA 4LYGA 5CVUA 4DSZA 2ZI9A 1XQVA 1R6VA 4WOPA 3MZ0A 3UAYA 2FFRA 5I9MA 4Q3KA 5DLEA 2EX0A 2JZBA 3RB4A 1COOA 3T7EA 1X39A 5MGNA 1QNLA 2HU5A 3D6TB 1RBMA 2NU7B 1BXRA 4WKCA 1T8RA 2VJMA 3G6YA 3S1LA 1JG6A 4NCJA 5IBPA 2NTNA 1YBAA 4CI0B 4JK3A 3R40A 3SZMA 2QG6A 4LE0A 3ZUGA 7ICQA 1G6HA 4OGLA 4WOBA 1MVNA 5C1PA 3Q6MA 2K7FA 4G86A 3WGIA 1Q50A 4X1OA 3JWJA 4V0RA 3HCEA 1QO0A 1NQAO 2EAPA 4E2ZA 3THWA 5CT9A 5H3LA 5TZVA 4XD2A 2RDMA 4WBXC 2GEKA 4NQZA 2ZTVA 2P8JA 2GYYA 2IX3A 4PS1A 4YT4A 4L78A 4ETWA 1CY7A 3O7MA 2FWBA 4WJZA 7ADHA 4DL5A 1Z7YA 4LJRA 3N3AC 2K4PA 3KDAA 4C76A 3RBZA 5D87A 4O8CA 3TLXA 2BW0A 2J9FB 1FMTA 3H6HA 1QHHB 4RY2A 1XZJA 4BO0A 1LQ2A 4ZMRA 3EASA 3OLXA 3LTNC 1XA0A 2QRMA 1OYVA 2IYSA 4A2WA 1MJFA 1HDGO 1P0IA 2PT9A 2R6FA 1QGOA 2BBWA 1L8QA 1G21A 4QG7A 3G1TA 2E1RA 4IGIA 4ZQEA 1GSAA 2I78A 4FQ5A 3DZCA 3AHJA 4L85A 1HE4A 1U6JA 4EYSA 3N6VA 2PXAA 4EZBA 5EQTA 3FCUB 3G5UA 1YDMA 5BSUA 3CX8A 2OK8A 1BGVA 2PH7A 5B5EU 2QTGA 2XLBA 5JMOA 4O3SA 2IGTA 3B3GA 4PFKA 1W8DA 5JW6A 2FMPA 3SEFA 2REQA 3N76A 4P4UA 3RVLA 4IXMA 2O8DA 1SVUA 1TQ2A 1DWPA 2ANCA 5BUCA 5DOZA 2YV1A 4D44A 3P9PA 2Q5FA 2ZUEA 4RUAA 4U2FA 1QJCA 2PZ8A 2NO1A 2GJ9A 3O7WA 4UB6U 1VBNA 1CQJB 5IXSA 3TG2A 4D2IA 1Z00B 1Z3EB 1SOVA 3K0CC 4BJ6A 1E94E 1GQQA 1XS9D 1I2ZA 5J2TB 2BHRA 2VCHA 4ZGWA 3N53A 1ISFA 2Q6IA 3QVGA 1IOZA 5BRAA 5FPYA 3H1AA 3JWEA 1OXVA 4F21A 4LTNA 3EXFA 1Z6ZA 3VR6H 1EFPA 3VTAA 2XUGA 3QVTA 1RAHA 5CLGA 4KI7A 1AKNA 4JA0A 4OEHA 1Z75A 2Z2KA 2QMYA 5JE8A 3C6QA 3GQBA 1WYGA 1RM5A 2ALJA 4BP8A 2X5OA 3GLTA 2AN5A 2Y6UA 5KWJA 4FKBA 8ICGA 2AWNA 4H1WA 3TZHA 4HG2A 2YVUA 3B1VA 4HQLA 3INRA 5HW0A 1VHTA 1DLJA 2PMBA 3DAOA 2EZ9A 2HF7A 3ZE8A 3TRJA 2H7XA 5EVJA 3JAWA 2L18A 4KAJA 3SHOA 2CVZA 4MV1A 4P7JA 4BNFA 5J2JA 1V3UA 1NGSA 4FC7A 2XX3A 1ZVKA 4R64A 1BC5A 3W79A 1WPRA 4Y9RA 4BNWA 4MS3B 2Q29A 4HUJA 1B93A 2LKYA 4ENRA 3KFVA 1I9CA 5CD1A 2G76A 3IV7A 4WCFB 2B0JA 5G1PA 1PCXA 4DA0A 4X84A 2KJ9A 3OURA 3SQOA 3R24A 4QX6A 4UVIA 2XE8A 4J9OA 3Q8SB 2RHCA 1E69A 3PI7A 1PUIA 4NYMR 1BKYA 3MINA 5JXIA 3ZIDA 2I9KA 4DSIA 1DL5A 3OLZA 5AM2A 3TLGB 2QUHA 4ATNA 2RHDA 3H6GA 3K6SB 1O1YA 5GZ6A 2YV2A 4HNUA 1K7XB 2G67A 2BEUA 3WQRA 4TTTS 4P7KA 3QOYA 1H0HA 3J80A 3PEWA 3QNMA 1U99A 1PJSA 3KKQA 1PDVA 2SICE 2BMEA 1U28A 1Z4OA 5ETJA 2GZRA 2P77A 4ALIA 1EP2B 1I3KA 5BYJA 2X6QA 1QRDA 2VZLA 2FN3A 3NTQA 4QWWA 1ORDA 2ZTDA 1KBUA 2NSJA 1G5TA 3DH0A 3FY4A 3TUIC 5F23A 1AUXA 3NRJA 1MT3A 4G36A 2WRZA 3STVA 4IBOA 2WUGA 3E22A 3WGYA 2F2AB 1WIWA 2OO3A 4CV3A 4RFSB 2F1RA 3BRWD 2DBYA 1QG6A 2XQKA 1JZTA 4JEHA 4ML3A 3TL6A 3DHEA 3CRZA 2EOAA 3LA8A 1WY7A 2NPFA 1Z5PA 2TRSB 3DOIA 4Z4IA 1L9KA 1GGHA 3PHGA 4DG8A 8ICTA 1Z3CA 3F5EA 2JFBA 2ZIXA 2JIPA 3HNPA 1XJQA 4QGSA 1CUAA 1UDWA 3MWEB 5E3JA 2R7LA 1E1RD 3X44A 3BB4A 4HADA 3AUFA 4L5AA 2ZS7A 4PNZA 2BMFA 2YXLA 4RJJA 2Q2VA 9ICHA 1GPWB 3Q2IA 2O7QA 3OSNA 1CTQA 3F3MA 4PC3A 1GPKA 3OQNA 4GGMX 3H9GA 1CC1S 1GZVA 2OGZA 3R8FA 4C0LA 2NZVG 2CF5A 3D31A 3MRVA 5ESDA 1QU3A 4KXQA 1RQPA 3GW8A 4K9KA 1D09A 3BWCA 3TOCA 3A05A 5DTEA 2WF5A 3QV1A 3ANLA 3GVCA 2IMWP 1E7SA 5IJXA 4GU5A 4RF3A 2F7SA 1ZQFA 4IKPA 3H13A 4M9HA 1XZ8A 6REQB 5B55A 2P4QA 3BG5A 4KR9A 4I7EA 2FMIA 4O08A 1EJ6A 1KY5A 3RVJA 2F2TA 1C3XA 1XTTA 3GJYA 4QGHA 4HZIA 3G59A 4RTSA 3K70D 5BNTA 3J81A 1Q17A 1E9AA 3M4NA 1N5DA 4H9GA 4EELA 4BGIA 4ITRC 2RCNA 4R8UA 1F1BA 5FWAA 4E21A 4L8WB 4QLAA 2VPTA 2R66A 2UKDA 3RJ5A 4UZEA 1F0MA 3ZV7A 2FEMA 5JI2E 5KFWA 3II6X 2XMCA 3VDNB 3P32A 2FW8A 5TNXA 5EQFA 1N8NA 1JEEA 2WHPB 4FZMA 3DMNA 2ID4A 4JJ6A 3TLZA 1K86A 3MFQA 2XVTA 3ADPA 3RO7A 1NVXQ 1KO8A 3OAAA 2VJYA 3FAHA 1E2KA 4LV8B 4Q4JA 2AJ8A 1DO2A 3P7MA 2WYOA 1ONNA 5GJCA 1U0SY 2YHUA 2X5XA 3T1NA 3H8MA 4ZT6A 4ID9A 5CDUA 2W9MA 4HYEA 1K7EB 5IDXA 4IF4A 3OZAA 4M1ZA 4CKCA 3VR2D 1P74A 1V2HE 1AG9A 1K4YA 1NMXA 5E4FA 1YZ6A 3L4SO 4H1VA 2NIPA 2ZRQA 3QF7A 3I32A 2LZ0A 5EQJB 4EQ6B 1QRUA 1XU4A 3IUEA 2H5EA 3QTTA 1XTQA 4IQWA 3QQ5A 3D9QX 2C1XA 4TUQA 4F11A 3GDFA 4CE6A 2Y66A 4YQZA 4K0RA 3D7LA 4W5WA 1ZVQA 1EG7A 3NFYA 5EWJA 4MYCA 2D2IA 3L8YA 1XZCA 3ESDA 4K8RB 1V5WA 1DC4A 2JI8A 3L7MA 4ZOQI 5KSPA 2YHSA 2JR5A 1NJGA 4JYBA 1BG6A 4DY6A 2DUMA 4Z4FA 4KR0A 1TIKA 5B3LA 2X0EA 2V7XA 3ZVKA 3RH5A 2AR7A 3IDWA 2PS0A 1I1OA 5H4GA 4QIWF 3OZXA 1KA9H 2FX5A 3E2PA 2Q3CA 1EK2A 4MGKR 4NYJQ 3IEKA 5TEWA 3FJ1A 1AHNA 1KDOA 2OBYA 4CRXA 5DGCA 3CVOA 2AYXA 1TF2A 3FKSD 5GTIU 2P2ZA 4C7JA 2CV2A 1E6UA 2D0DA 3OM9A 1VIVA 1KS2A 2A0FA 1IWBB 4DLEA 1GPDG 3R0ZA 4JYZA 1J2YA 3U4DA 1C41A 1IEVA 2EGGA 3X43A 3GPBA 1QSLA 4BKUA 1VYTA 2IT1A 2QTZA 2KYRA 4KX3A 4H0NA 4RGQA 5ALEA 1YZUA 4BO6A 4LG1A 3ME5A 1DTWB 3A6HA 4AZ0A 4KVAA 4KLUA 4DBZA 1ODJA 5D6OA 4O3MA 1C9JA 2XWJI 4HAZA 2ZU0C 4JBNA 1BGXT 4AZTA 2O19A 4MQBA 2HJRA 2WJYA 1A5AB 1RABA 3CMMA 4BOYA 1HUOA 2A92A 4AKEA 5CGZA 4BV9A 3SEQA 1IJBA 3KQLA 1MP0A 2PN1A 2WHEA 4C7OA 1T2DA 2F1HA 5IVPA 1U5BA 1MVLA 1XNQB 4DYDA 2PUAA 2C94A 4BJ1A 3FFBA 3HDHA 4B40A 4ZHQA 2X86A 5C31A 5LL6P 1MW8X 4GPZA 3HL0A 1VGRA 4YR9A 3OTQA 1A4UA 1POXA 1W0CA 3PMNA 3T1OA 1B8NA 2QTMA 1HFEL 2RHLA 1S7GA 3CZ4A 5DWVA 3O94A 3QZUA 1IZ8A 4EYIB 5KJ6A 3HG7A 3FMIA 3ZCXA 1OLXA 2IF0A 5K8CA 1H2WA 4RPKA 2QM7A 2HHCA 1PTJC 3THRA 5HJ2A 5GJVC 2NU8B 2ZFUA 3P9SA 2B8EA 2I5HA 4UFPA 3OTHA 1EWTA 2NVUA 5CX1A 1RBQA 1ZNYA 3S5UA 2JJ2A 3AMVA 3FF4A 2ZTMA 1XKQA 4DF3A 4DCVA 3LFHA 4YXWD 2QGFA 3Q3IA 3OHAA 4EAAA 4G1MB 3H1EA 3GAMA 3I1FA 1XXHE 3H11B 1EDBA 2VP5A 1G64A 3NCHA 1KORA 5A5FA 1HM5A 1ZI9A 3RBDA 2FDCA 3HUDA 1G3MA 1CQXA 5CK5A 4BO4A 4BQEA 1G60A 3BWYA 1BS1A 2XVAA 2FLPA 1HSZA 3RIHA 5JAMA 2FRDA 3PEYA 4LW8A 4Q9NA 2BJWA 4R0NA 4IYJA 4IILA 3AGQA 2OM2A 3Q87B 3SYRA 2WMNB 4U8GA 3QKIA 4XWKA 1TTPB 2WZCA 4B73A 5JFTA 1U3FA 1A7UA 1A98A 2PV0A 4TV9B 2CD7A 3SYTA 1P73A 2BONA 2AUTA 4P32A 2VNIA 3MS7A 2VYVA 2ZSIA 4TQ9A 4HNQA 4RNDB 4QEKA 4O2AB 5I3CA 2ZXFA 1YB2A 4RF4A 4P98A 4AUMA 2WJPA 4P4LA 1Q7CA 1L3UA 1ZLXA 3TSWA 2VF2A 3CUWA 2OV1A 4OLAA 4BB6A 5DLPA 3L7IA 1BNPA 2WAAA 4BUCA 3DCJA 3JALA 3SAGA 4HN4B 2GOLA 1ST3A 4TVBA 3M6KA 4FT4A 2OLKA 3GRVA 2G72A 2PX2A 2RJOA 5BORA 1RM4A 1ZG3A 2Q0XA 4YMLA 4OHVA 4LF9B 2ECFA 4GXIA 3WGNA 4L3OA 1O0BA 2PSEA 1AMNA 3DTNA 1I2MA 1KI4A 3Q98A 5I5EA 3KOXA 3GUYA 2JFZA 2HNKA 1H2FA 2BGMA 4LZNA 3ERCA 2R7AA 2J3IA 2Y4NA 2IEDA 4V0NA 3SEIA 5IPFA 2G9VA 4UPVA 4J0KA 5TSDA 4U5QA 1ZGGA 4Q02A 3G5TA 1SY7A 4ND8B 1OFIA 4LFBB 5J5AA 4LJ5A 3RNLA 2P6RA 3BFJA 4DSAA 1XV5A 4L6CA 4NZMA 5CNIA 4ZAYA 3HK2A 3GYBA 1WETA 3B9BA 3B3QA 1WRBA 5A62A 2DEUA 3H16A 4RIGA 2I1WA 4YJHB 2YY5A 1J7KA 2IYWA 3ZIAA 2EANA 4RNNA 2J6SA 3SKXA 3FWHA 3AQIA 3UB3A 2C0QA 4LEIA 2O2YA 2WD7B 4I1YA 1FMLA 1EDZA 1O96A 3BJEA 2Q4TA 4RXTA 3S2ZA 3BTVA 1FIUA 2YNMC 4CODB 2FP4B 4NZPA 3SZOA 2CDBA 4X1YB 4DLNA 3BL6A 3QVXA 5BR7A 2BTOA 2OQIA 4ZMBA 1R6XA 4O0IA 4F5PA 1H38A 1R4ZA 2R79A 4JV0A 1X7XB 5GGYA 4DC9A 2JHFA 3PQ6A 4UQLA 1HE1C 4BGUA 1MO3A 2NYVA 4QVKA 2C8JA 2KJQA 4FBTA 3KIPA 3QBJA 1UBUS 1HBJA 2CXRA 3PUXA 4LJ8A 3IAXA 1FUIA 4C07A 2OGWA 4EZ6A 1R37A 3WKEA 3SAHA 1OCEA 4JOCA 4H6WA 3NTUA 1R8JA 3IIKA 3W8EA 4JJZA 5FI0B 5J1SB 1DHRA 2O8NA 2W6IA 4L0QA 3O31A 2HJ9A 2RGNA 5I3ZA 3VNUA 1GCUA 1WAMA 3UJBA 3EC1A 4GP6A 3KOOA 3NTLA 4I81A 3CLHA 3KTAB 1Y1LA 7ICSA 5H80A 3ZWWA 4D92A 3ZE7A 1OXTA 3PSHA 4PGFA 2D06A 1NZPA 4Z9FA 2F3QA 2ONYA 3D54D 2AZMA 1FIQA 2V9WA 1UC9A 1P0FA 3STHA 1LXCA 5IAJA 3ZDFA 1DKNA 4LY9A 1P62B 4M37A 1R0ZA 4A2CA 4I5FA 1N7JA 3C3DA 1RXUA 1U2DC 1M2VB 2IEGA 1M1UA 1DWUA 1Q12A 1R4MA 3MHPA 1GRVA 1WPXA 3THYA 5D3QA 1NXTA 3FDSA 3FI0A 5BV2P 3UUFA 2G09A 5FF9A 4MFCA 1T9DA 4RX1A 2BHTA 5IAEA 4CG2A 1UBLS 4IDEA 4A8HA 5L1LA 1SB9A 3E03A 2X5NA 2Z9CA 1N60A 4J03A 1EPUA 1MR3F 4F4XA 5DV9A 2PWZA 2VYND 1W49A 2C1EA 2KJ8A 4WUVA 4MPRA 1ZJ6A 3P97A 1GVHA 2BLNA 2EFHB 4OQEA 4DDTA 2IH4A 1VPDA 4IDFA 2VTBB 4GRIA 4AC9A 4Q3OA 2HRRA 1J70A 3WK4A 3ISDA 4Z9YA 1TC2A 2FZ4A 3I01A 2YWHA 2VH1A 2JGEA 3VO9A 1JN3A 2KPOA 2AHOB 2CJPA 1AGNA 3UWSA 1P61B 2WJJA 3RIXA 5JNVA 3QWAA 5IX8A 1XQ6A 3T3OA 3OSUA 4LOIA 3FF1A 1MIOB 4RMJA 1ABBA 4BU1A 5HF8A 4JP1A 2VCYA 3K8YA 1UPTA 1D9DA 4K6MA 1U8XX 5DMXA 2ZR9A 1MX5A 1KFDA 4LJLA 4CMEA 4UDOA 4J9RA 4JL6A 3FVVA 4D1YA 5CEJA 2SCUB 3L8HA 4PVDA 4KREA 5MN5A 3CVXA 5J4HA 2C5BA 5AKHA 4KW7A 3F6PA 1M72A 2RGNC 2XXJA 1E1QA 5I8ZA 4N7MA 1UKBA 3C3WA 1YQWA 2P2YA 1KZHA 3BTOA 3AFMA 4NOKA 5CBPA 1GGEA 3LECA 3NFRA 4F04A 1BPDA 4IZHA 2VS1A 3KXPA 8ICBA 2XDAA 4RJTA 3R5XA 1P31A 2IXTA 1FUEA 3PQ7A 1OV4A 5BWMA 1C2YA 4NIMA 3ZV3A 2QMOA 3OQIB 3T7KA 3DV0B 4LZGA 5C1OA 4PANA 4RFLA 2HY7A 3W5IA 1I1NA 4QM7A 3UGTA 4ECVA 1HTWA 3SBDA 2OG2A 2C92A 1AQUA 5D49A 4LKRA 2XRZA 3GMTA 1SKRA 1JALA 2WE8A 1PZXA 5EP1A 3IUYA 2KSOA 2R8XA 3RV3A 1KI6A 2Q5JA 1C7EA 2HJVA 3VV3A 3HZHA 3I28A 3I04M 5J2EA 4EGAA 1LTKA 1L3CA 1ZS9A 4D7AA 1MA3A 1HFKA 4XLTA 3TO5A 1QP0A 5KBYA 1G21E 4HI0E 4PFSA 1TMYA 1DK3A 4AF7A 4GDMA 1H0RA 2K87A 4TTVA 2XT9A 4ZYTA 1C7YA 4DSJA 1OW3B 5AD1A 1P9NA 1T26A 1QFXA 3ETRA 4I8IA 3U4GA 2ETVA 4QJ4A 1AS3A 2PLAA 3UZUA 4C03A 3SIXA 2SBTA 5LNK1 1UBGA 4M9ZA 1KSHA 3FNHA 3EWAA 2BFFA 2BFCB 1ZHOA 1D4AA 2KV2A 3AEVA 3WL6A 4R98A 3GIDA 4NFLA 4URHA 3KSAC 3DEKA 3P52A 2CNWA 5T8KA 1Y1SA 2FPUA 4O8ZA 4M8SA 1G8MA 1SD1A 4XQ8A 2XNCA 3KYDA 1JKIA 1PJ8A 3AFNA 5B37A 5CAEA 4S1PA 4RPJA 3CXRA 3PDUA 3KQSA 3WGVA 2AR9A 5BURA 4MAMA 3M70A 3JATB 3FM9A 4UU7A 1PLJA 2BIFA 3HX0A 1ND6A 4XJTA 1DG3A 4AX4A 3WBBA 4O5KA 4JQOA 5JMPA 4PSUA 4WKBA 4RTJA 4XPZA 2EHJA 3H3FA 9ICCA 1MAUA 2LPEA 3MMNA 1CZUA 2OXIA 1COZA 1Y5IA 1JYFA 1X9GA 1T4CB 3UANA 2OXCA 4REQB 4LY0A 5DFAA 3EVNA 2XY5A 9ICLA 4EGFA 5AVSA 2GRAA 1O94A 4BNVA 1DQNA 1GDDA 2Z9BA 2XY4A 2O2EA 1TLLA 3BJRA 2JEGA 3PSAA 4JB2A 5BVGB 1HKUA 5AUOB 2EBWA 2KJ5A 1MHTA 3FR8A 5H2FU 3B82A 2QTAA 4DCGA 2GJKA 1GAQA 3CX6A 1XFDA 3DO6A 5JQWA 2JI4A 4YP7A 1LJ8A 4RTMA 3T4XA 1V8DA 3OPXA 4E15A 2GN8A 3AERA 4DLWA 3IAEA 5BW8A 4JLUA 5TX7A 4P0TA 1KYQA 4U1RA 4C2TA 1BSVA 4DQKA 2G0AA 4G4SP 2O4CA 2QT0A 1EX9A 2DCMA 3OEEA 4YJFA 3AR9A 2EZYA 1ZQ1C 2ODWA 4GAEA 1VPTA 2VQ6A 3TMAA 1BCSB 3BZKA 1C30A 1SV4A 1X9HA 4NZ9A 1G3IA 4OREX 3BSSA 4W7IA 1XFAA 4HEHA 4LVUA 5BSRA 4L8GA 5HXAA 4ZARA 5AVKA 3B70A 3U4MA 5KDDA 5E7JA 1JMVA 2GLTA 2WPDA 3I4LA 1JQAA 1V8PA 5HR7A 1PVDA 1XEWX 5FJJA 3MABA 4KXUA 1RRKA 3L9WA 3J81j 1PWZA 5C8ZA 2ASEA 3DVLA 4QOEA 4BDTA 1OZGA 1KGSA 2HMTA 2ES4A 2KKVA 4KMSA 2VT3A 3A11A 3RROA 4HZUB 2D1QA 2ZSBA 1VKHA 1SVOA 1UAGA 4H7DA 3UQ0A 3BKXA 1FQOA 1GG2A 3HCCA 4RKQA 4DA6A 1WQ3A 2EARA 4D0LB 3C87A 3DTVD 1NAHA 4KDFA 5ER9A 4CLDA 1KIFA 3C1AA 1T9HA 1X42A 1DMRA 4RPIA 3PA8A 4X92A 4N4AA 5G3YA 9ICGA 2XBLA 2X6RA 3ORFA 3H6KA 5CYPA 1H6BA 5ERYA 2P4UA 4FS3A 3NRBA 3QVMA 2I6UA 2EP8A 4L76A 5JR3A 3TNYA 2AJQA 3A9TA 3PW0A 2G8LA 3VM6A 1L7DA 2I33A 1K88A 1XOIA 3H04A 1OREA 3MIZA 5CEHA 3DF9A 3A1WA 1RJWA 1UPBA 2O48X 4D9HA 4JUBA 3BQ0A 4UE2A 2VR1A 3KEGA 3V4VB 5KVCA 2ZRAA 2LCFA 4JX8A 1X1DA 2HQOA 5HRUA 3O9VA 1PJ4A 2C8KA 1DC7A 5JAPA 4ZCQA 2PD4A 4M9UA 3G02A 3D7SA 4AKGA 5JVDF 5FO1A 3DSRA 4U7HA 3WV5A 4O3RA 5ARCA 3B3AA 1KOGA 5BR4A 4PZNA 3ZS8A 1QE5A 1DKQA 4DAOA 4UBLA 1KHHA 1Q3TA 4AW9A 1ZA1A 4MKZA 4CM3A 1YQ9A 1GQOA 1SVMA 5EE3A 5TDHA 4Y2PA 3T0FA 4R1SA 5DB8A 1XXHB 2X22A 1N77A 2J6TA 4BIIA 2ASVA 4B2PA 1NMEA 2PZBA 1ZOIA 1B22A 1KI2A 2G82A 2I55A 2GCGA 3DYIA 2WV9A 4DB2A 3LL7A 5EAIA 2NMVA 1W4ZA 2MTBA 3CEHA 3A4VA 2FEPA 4C6TB 1E79A 1KOFA 1OAAA 3UJDA 3ZCPA 1CY0A 1V1MB 1BX1A 2VTDA 1SVKA 4QO7A 3T0GA 3TH5A 3WIUA 1FA9A 1D4FA 3P4XA 4UHCA 4D8UA 2BCQA 3A4NA 4YTEA 1A9PA 3TIXB 1OHHD 1EXWA 3VR4D 2XA9A 1KR5A 2VAPA 2VDMB 2X41A 5FR2A 3RABA 4ACBA 4QWAA 3QKSB 2J6CA 2CXXA 3RRFA 4F2WA 2I87A 1K68A 3SLKA 6GPBA 1E3DA 4JWTA 1TTQB 4D3FA 2QM8A 2GDJA 1L4FA 1JJIA 1Q1AA 2ZJ1A 1X1RA 1HYHA 2AMLA 4EL0A 1Z7BA 2NLOA 1RC8A 4UD6A 5DEOA 1WB5A 4Q8EA 2XHZA 2GXAA 3PX2A 1Z12A 1QFJA 2JHAA 2R8RA 1MEEA 2ZT5A 3ESZA 1UJCA 2G80A 2C7BA 4O25A 3RFCA 3VU9A 5LU8A 2A7QA 3HVKA 5ECYA 4P4OA 3ER9A 1XVVA 4IZ6A 1TLFA 6YASA 4KNVA 4I2EA 4G25A 4ZREA 4LYFA 4ANFA 3AZOA 1FYWA 4RKFA 1Z0AA 3ZZ0A 4PYJA 1TGYA 3VC8A 3JASA 5FUBA 5ARDA 3OX4A 1T15A 1AK2A 1EA5A 4RS4A 1YQQA 5EXTA 2NAFA 2W70A 1P9OA 2B1RA 3H99A 2C54A 2JVIA 5EIEA 3ED1A 4HO1X 3D4LA 3ESAA 1YJ8A 1O95D 1YD7A 2GI4A 1THMA 3OICA 3CS3A 3BQ7A 5HKBA 3RSLA 1CWUA 4XOUA 3GXBA 2PTHA 1DJPA 2IEYA 5FQNA 4AJPA 2WWIA 1K7CA 4XPIB 4FYKA 4QEDA 3CB2A 4E1BA 3O8NA 4QDKA 2I6GA 1Q0RA 3A1NA 3IB6A 1GG8A 2IE8A 1G2IA 3B20A 1CIVA 5HFJA 1V7PC 4H7PA 5FAXA 5M5BA 1YZNA 1BJKA 4X3OA 3FHLA 1C3OA 4HDNA 1E5TA 1CUWA 3DT6A 4C5CA 1AO0A 4D81A 4LMRA 3KYCA 2F43B 3RUEA 5IJWA 1FRFS 2DBVO 2PZJA 5E8JA 1T5TA 4DSFA 4NBVA 2YBDA 4BNUA 2AG0A 5EP3A 4GOJA 2QG9A 3U7JA 4RTRA 2AMVA 4NJEB 4DSUA 3WLPA 3FPAA 4D3DA 1NKSA 2YWJA 1QZTA 4M9NA 1F44A 4RQAA 2VPYA 1CRLA 2RC6A 4D26A 1N0UA 4C4PA 4MULA 4Q1EA 1XJ0A 4IO1A 3BSFA 5G40A 2A0YA 4UNSA 4N12A 4HXGA 4NMWA 3FOZA 1S8OA 3K5HA 1CX9B 4WZAE 4ZT2A 1KIMA 3B3JA 4LOKA 2J59A 3Q7RA 1NSFA 1NNSA 4V39A 3SX2A 5BYBA 5KJCA 2Q4RA 4LQCA 4JYAB 4YASA 1R0RE 5BSVA 2Q1YA 1E2EA 3OUTA 1PVPA 2P7HA 1W9HA 3I0NA 3TTSA 1EE9A 5BSHA 1V16A 2CXYA 2PT5A 1U2ZA 2I7TA 2ZWVA 1SN7A 1LLFA 2GWHA 3AEZA 4W4TA 2OUIA 4D9FA 4RV9A 2GEBA 3R5FA 1JR6A 2AEJA 2D6FA 4IQUA 2X2FA 2YMQA 3PW4A 4R1NA 2ZUCA 1EX7A 1UADA 1JU9A 1XKXA 1N1DA 5KG6A 4EHHA 2OCIA 1L3SA 2AOUB 1LVGA 1E1KA 4FGWA 1YF3A 4D99A 1TJYA 1BU5A 4I27A 1CI4A 3VMFA 4O2AF 5K3FB 3FZNA 2IIBA 1PSZA 4BBJA 3SENA 1QP8A 4HX9A 10MHA 3WLKX 3VPCA 1T8YA 4B3HA 5DM60 4DOCA 1VYHA 4C87A 5FI5A 4DWWA 5HUJA 4Q01A 2ASLA 1M0EA 2C5EA 3MWDA 2RKWA 1J2NA 2GZHA 3JWHA 5BWCA 5BW5A 4QG3A 1HDOA 1W47A 1ZYUA 1NG9A 1IL0A 2J31A 1B4FA 1P2UA 4XDZA 4B2IA 2PDAA 4BX3A 4F4DA 3M9OB 2X6TA 4UNRA 4Z2AA 1U6KA 2PEYA 2FF5A 4XM2A 1G7TA 2CHQA 3VSBA 1HEIA 1H65A 1KH2A 1T5OA 3M4XA 3WHIA 1KDYA 1N5JA 2VA2A 4MVJM 2D1TA 3ET4A 3BL8A 1YS9A 2UZAA 1LDGA 2W9XA 5DO9A 4F38A 2QSYA 3L7BA 3W5JA 2MSKA 5IF9A 1WDLA 1A1SA 1P7DA 3GV5B 3CBQA 1N5KA 3NHBA 2ZTEA 5GONA 3FWKA 3R5SA 5JTIA 1DOQA 2QI9C 2YMLA 1EXVA 4IRKA 4TKVA 3M7DA 1F9AA 3E8MA 5HKAA 1U0HC 5FNVF 2G6BA 3V00A 4Z4EA 2GWRA 3CRW1 4U6PA 4DIFA 2JBWA 2WM9B 5B1EA 2C5AA 3K0CA 3UK1A 1C80A 5J40A 1TZ2A 1ZETA 3JX9A 4DQLA 3STUA 1Z56C 4ZVPA 1Y48E 3BAZA 3QLTA 3H4BA 4YQFA 3DTYA 1NVVR 3JD3A 3O03A 1I4DD 3T9EA 2D6FC 3HA5A 2WAYA 3SEZA 1G21B 3RWMB 2JK1A 4OK5A 2OEPA 1URJA 3LVVA 1AQIA 4AJNA 3W5UA 3FDJA 1A8PA 4AG5A 4YPOA 4C1NA 3IHQB 4ILKA 3A2MA 3HWX1 1DQSA 2GF2A 3OPNA 4J49A 1G5PA 4FMBB 1U3UA 2JGMA 5T67A 1JPJA 3AGPA 3E9CA 2Q3HA 4LV5B 5F7XA 2BI4A 4R3NA 4EFMA 5T14A 4L0MA 2G4CA 2P9EA 1XNRB 2E6UX 3C8UA 2J3EA 5ITVA 3BKWA 4LXXA 2BDEA 1VB3A 4YAKA 4MDFA 5IYZA 5ELLA 1LKYA 4HLQB 3RQIA 1HIWA 1QP4A 4Q9AA 1UBMS 4B6EA 4EWLA 4OO1J 1RW4A 3RVMA 3IP9A 5JJBA 1JFTA 4ICIA 4LX0A 3DVAB 3PXCX 2NZUG 3WFZA 4C78A 1XRNA 2PR2A 1I10A 3QVGB 5CJPA 2YN0A 1KEUA 4RE6A 1YHYA 1ZK1A 2Z3VA 4AMZA 3BD6A 3OPVA 2WDPA 4D0RA 4KQGA 5JZ9A 5K09A 3KPYA 3ANYB 5CVVA 1UA1A 1C3JA 1E9FA 3TJZA 3GJQA 3GQBB 4LF4B 1A9OA 4PPGA 3NHSA 3O1IC 5ED0A 3SZLA 4CQLB 2CVPA 3IAFA 1U1GA 2JJ1A 4GPBA 5C8YA 4F8YA 4GDFA 1VYVA 4MYDA 5TARA 3BF8A 2QZJA 4DR3B 2CKMA 1KFBB 3WS7A 4YXJA 1KDVA 1CF9A 4MRNA 1PYDA 1QZ3A 1XZEA 4QNNA 4YD2A 2GBFA 1WOMA 4FS1A 4A0QA 1ZRNA 3FETA 1JRPA 4XTRA 4FOOA 4DHEA 3NVWA 2PL9A 3FOCA 3EVDA 4MHOA 3DV9A 2W90A 1Z5ZA 1UJNA 4JB8A 1US8B 3X1YA 1U4OA 1PZNA 3EAGA 3ENWA 4BIMA 4MQLA 1BE1A 4LQLA 3PVZA 1DQZA 1JBQA 4J43A 2O14A 3KUXA 1I3MA 4PXAA 3UA4A 2ZG6A 2VQDA 1M74A 4MW4A 3MINB 2CXQA 5JXGA 1AA9A 2WJ4A 1XTIA 1WXQA 4WA7A 5KT4A 4XD7D 3QFSA 3W9UA 3GEEA 4BUZA 2EW1A 2ZBRA 2RGCA 1KY4A 2WYIA 3SDBA 3PQ2A 2XBUA 4EFLA 3VNVA 2YH2A 4R2LA 4LWPA 1JILA 1IN1A 4DKJA 2XH8A 1LPOA 2ZB2A 2V3CC 3MELA 5LLTA 5BSEA 4N3AA 3AW9A 3T9BA 1O8CA 3ON5A 3KKEA 1L8LA 2C4UA 4YRBA 1NP6A 2A2ZA 1V6CA 3DYVA 3MFIA 3SGLA 2I1VB 3KPUA 3EF0A 1UBJS 4NNPA 3ZHTA 3K32A 1T7PA 3MLAA 4YVFA 2PI4A 3RKUA 2R8EA 2C82A 4E5SA 2HRZA 1QSGA 1B2RA 1XZHA 2Y6VA 1MJGA 2W6MA 1V4NA 2W7OA 1PU2A 2Q5OA 3PX0A 2F67A 1E63A 3VNAA 4TVOA 1RPLA 1R0BA 3NOVA 5HM6A 1Y4SA 3KCQA 1PKEA 3CJQA 4ZRNA 3ZU5A 4MO2A 3USES 4RU1A 3EZ7A 1R15A 3ZQKA 1FPMA 1WTAA 1KE1A 2G40A 2YJ6A 1KWGA 4CPDA 3IJ5A 3RC1A 3TIIA 3QYAA 5HILA 3U62A 3CLTC 2LW7A 4C06A 1NQUA 4RPHA 4V03A 3R0QA 4RA9B 4NF2A 1VIDA 4MVWA 2A0UA 2QBYA 4GFJA 1WP9A 1R5JA 5EMJA 2AJCA 2CMGA 4BL5A 1FO4A 4TQUS 3IURA 1M0TA 4JI6B 4IDGA 3MWKA 3QPAA 4X6XA 5D5HA 3VC3A 1UIMA 4LPKA 4E88A 2W8KA 3A6PC 3KPJA 3PGA1 1I6WA 3PE6A 1ZIOA 4XASA 3SQDA 4N3NA 4XIIA 3L18A 3KT6A 2DCUA 1CKEA 4EYQA 3DBLA 2I6XA 1EGHA 2G8NA 1G9TA 2FZCA 1HL7A 4L08A 1M3SA 4P4MA 1P0PA 2O2CA 2ZROA 2CNNA 4JLDA 4YN4A 2WJZB 4U7GA 4YR3A 3JYQA 3PGJA 4UTXA 1TJPB 1FP6A 3R6WA 2JFYA 2V5AA 4MRRA 1MQSA 4M1TA 3CH7A 3WWYA 3IP8A 3V8BA 1ZMBA 1H22A 4EBDA 4H0FA 5EQDA 4PE5B 1VIMA 2HJGA 5DEIA 3WB9A 3U4AA 2WSLA 1C9YA 2DY0A 3TI0A 3WA7A 1TQHA 1G8PA 3HEBA 3KNZA 3RAFC 1SOAA 3IOBA 2Z09A 2QZZA 2GT1A 1N8KA 4WLUA 2ZUWA 2BQRA 3VU0A 3VH4A 2J7PA 2K7ZA 4CXMA 5H9VA 3D2CA 1J39A 2GAJA 3O3OB 5B4TA 3PEEA 2YB1A 9ABPA 1T36A 2NG1A 3VR5H 4UBKA 4B6RA 2CZCA 1SCQA 2C8VA 3AHIA 1JDPA 3COSA 5K3OA 4ZOBA 4QT0A 5JVDB 2OQVA 2DUWA 4Q4JB 3GHYA 1EP3B 4YB8A 1FP7A 2FYTA 4JITA 2VAXA 3WIEA 3MQ4A 4J9LA 1FNDA 3B85A 5ALVA 2ZRLA 3SF0A 3GELA 2BZSA 4MQ4A 4LXGA 1I0IA 1ODIA 1QIJA 1E3WB 2I2AA 1QVAA 3LLSA 3DFFA 4YO7A 4I28A 7ICUA 4I2NA 3PI6A 4XX1A 4FD2A 1J2TA 1EDOA 1Q16A 3ASUA 4MF8A 4Y7DA 1EUDB 2EDCA 4X85A 1C9EA 1E18A 2RGWA 3BQNB 1R66A 3ETEA 2JRLA 1L8XA 5CA1A 4IM7A 4C30A 4ALJA 2H1CA 1M8KA 3VVCA 3BQTA 2IC5A 3GFRA 4AXBA 1D0IA 2I6FA 4G4GA 5EWGA 1NULA 2AVNA 1BH2A 4PTLA 4MGHA 1GLNA 5HM8A 5EE9A 1JKJB 5DNAA 5LLSA 1K98A 3VC7A 3WQSB 4GMKA 2DFLA 3ZIUA 2QAIA 3KD2A 5HOEA 1DJQA 3ZGNA 4RMGA 4AP5A 4EBCA 3U3XA 4J9QA 2AFHA 1AKWA 4AWXA 4UEWA 4R1QA 1Q21A 1CJMA 1U1EA 7GPBA 5FOXA 1QOZA 3DP9A 1WW3A 2QX9A 1KYYA 1Z25A 1QIEA 3AEYA 1SU6A 4Q47A 5C46F 2CD9A 2R4QA 2W43A 1SHUX 3ZQUA 3P2KA 4DDWA 3WRVA 2QRNA 4CM8B 2JGIA 4B46A 5L3VA 3K15A 1UOPA 5FA5A 5AOCA 2ZYUX 4E5VA 1PTJA 3V8MA 3DD5A 4HDMB 4XSGA 5K0EA 4G9BA 3FNBA 1TJ5A 4YCJA 3LU1A 2HHJA 1SGGA 4BU0A 2VN8A 3QEMA 2XE6A 1YDWA 2DERA 4I4NA 3IKLA 2XRMA 4GSLA 3F9RA 4U6QA 2Y0EA 4TSFA 4LWQA 4TWIA 3P0JA 4L07A 3EVCA 3RYIB 3Q41A 2IZ7A 4AZ0B 1Q46A 2HHLA 5LXTA 4C04A 1KZ9A 1T6XA 3VPBA 2B7BA 4KKVA 5H02A 3FTQA 2OSVA 2RIRA 3RADC 2FSSA 1PSDA 5AKJA 2R8PA 1OA0A 4LRXA 5K3CA 1QYRA 2D7JA 3PDHA 2HMXA 3QWIA 3IBYA 1KJJA 2VP6A 4KQJA 3MUEA 1BHSA 3IULA 3GFFA 4ZHQB 4ZEXA 5JZOA 4CFZA 3MMSA 3S2IA 1PEDA 4OM8A 3ZCUA 1GA4A 4E22A 3IPXA 3BWVA 1RADA 4EB6B 1Z8HA 3I4CA 2UZ1A 4CM4A 1PVQA 2JKYA 3HJHA 1Y80A 2P69A 5IAAA 1I7QB 4WD3A 2DT5A 4WW0A 1OYWA 3KS9A 3BT7A 4AAYA 3KAQA 4F6CA 3B13B 1XMVA 4WZAB 3D7KA 2X8WA 1CRWG 4ZVTA 1YO6A 5D1HA 4GOKA 2ZAGA 1FYFA 3RK1A 2NVUB 5CX1B 3HLKA 2FETA 1CETA 3NWBA 1F9EA 3LO8A 2YMMA 1L7BA 4LJ6A 4P5EA 1TT5B 2V59A 1MO2A 4H2DA 2UVVA 3K96A 4YMVA 5JLAA 1LJLA 1TZCA 4F91B 1IOWA 1QPBA 4WL0A 1XVLA 3L1JA 2DC1A 3NHFA 3F98A 1T91A 3P9IA 4D45A 4MAFA 3OJSA 3PRKE 5HCNA 5BQOA 3QXSA 4RMIA 3AVTA 1K8YB 1Q92A 2IHJA 4X7MA 1V0JA 4X1KB 3SR0A 2V4UA 3DQPA 2JGRA 2CEAA 2CGEA 2X1MA 3WKBA 1TTTA 3Q12A 3LBHA 4YV1A 4CJXA 1MO6A 1H1DA 3MBYA 3P9NA 5LA6F 3LUFA 2ZRGA 2LWIA 3RFFA 2XIDA 3K6JA 1DWOA 3EXG1 4N6NA 4EVQA 4GC5A 3B7GA 4OHRA 1Q2UA 3T6KA 5K2MA 1QAQA 4L95C 4CKEB 1NY6A 1ODKA 2F55A 3IT2A 1RACA 4JI0B 1KRXA 2ZIFA 3U7EB 1QJ4A 3JALB 3IVAA 5BWLA 2IYEA 3K75D 1NFQA 2OORA 2WSYB 1EFVB 2YNMA 5JH7F 4K7JA 5DTMA 3A1UA 3TCXB 3BDVA 5ITZB 3TZEA 1DK2A 1T6NA 4A0GA 3RQSA 2V9CA 3AU2A 3GLFA 1Z4IA 4KWCA 2FPIA 3SX4A 3REGA 4EYGA 5B4UA 2DKNA 4QZBA 2IHKA 3RH0A 2HWUA 1L3BA 4MUEA 5EL0A 5J0TA 4MIOA 3ZY2A 4OI2A 5FTKA 5JXWA 2QTLA 3LPLA 4JJ4A 4REMA 2FZGA 3RB3A 4URFA 2G5HB 3URMA 4K6HA 3KTDA 3JYLA 1UEXC 2B20A 1VSQA 4US2R 3DEJA 4W63A 1P7WA 3OU7A 4XEUA 3GUHA 4BYGA 5BV7A 2DFNA 3LYHA 1ZNXA 3I3OA 3VVLA 3L0BA 2QYHA 2DKFA 4HGQA 5BVHA 4Y98A 4FFPA 1EDEA 4QELA 4JX9A 4Y30A 3ZDEA 1XN4A 3ZVRA 1QIKA 3AUXA 4HK4A 4RACA 4A8EA 2QTWB 4Z6CA 5HNKA 3EUFA 4OFXA 4FE4A 4UVEA 2VDRB 4RPCA 1U2DA 5FP0A 2VWGA 3VRHA 4WY2A 4PHGA 2QNIA 2WOOA 2C3PA 4EFNA 3O3CA 4J1SA 4US1R 1H2XA 3L3BA 1ECJA 2RE8A 3QE0A 1EGQA 3EMVA 3S2UA 4U5XA 1DWQA 1QS0B 3WK5A 3QPVA 2B3TA 3B38A 3KE8A 5C7OO 1TVMA 3LF1A 3DDNA 2OYSA 1VGQA 2GLEA 1B2LA 2WTEA 3KSMA 2XHEA 5FNVB 4B43A 4WXRA 1IDN1 1KEKA 4YREA 1U0JA 2O54A 1G5QA 4B4DA 1WHTA 2H1FA 2KZ3A 4PAGA 1Z4LA 7ICFA 2JBAA 1XZNA 2WSMA 2P2LA 3ZE0B 2WWYA 2OORC 2GGSA 2VXBA 4LIPD 1PUXA 2IPLA 4COOA 2W6OA 1XDZA 2WM3A 4ZDIA 1T2UA 1QCDA 2DPLA 3C8MA 1Z88A 1G8GA 2FHSA 1DRKA 8ABPA 2PLFA 2JLYA 1VIYA 2X2PA 1CULC 4FFDA 3ETNA 5TMPA 1TQ4A 1EVKA 3FBTA 3KWJA 4RORA 1Y81A 4WXHA 2P78A 2JDIA 2WYVA 4QATA 2HVIA 4KDRA 4ED7A 1PDOA 1GKYA 1G0NA 3VMMA 3QV2A 3MBKA 3FYCA 4UZFA 2E1EA 2Q3JA 3N58A 2V8BA 1JEDA 4ZHSA 4YUXA 3U26A 1E3QA 2HDNB 1TCCA 1GGVA 4HF7A 5LQCA 1JMYA 2OECA 1PJZA 5DM70 3ZWNA 1YQXA 4UB8U 4H7FA 1X2EA 4QGGA 1ODSA 3GV0A 1NYTA 4IWNA 3UOWA 2YJNA 4XQGA 4OAOA 1JE1A 2DBQA 2H4XA 1AK9A 2JVKA 3TJRA 3F53A 4I2JA 1YZ7A 3NDIA 1YS1X 2CHEA 1JQLB 4FYJA 4GKAA 2LNDA 4TT3D 4NCBA 3TPZA 3ORRA 1WB4A 2EQ5A 4P4GA 4RGVA 3PX6A 3K73O 4O4IA 3GU3A 1T25A 3ZXIA 1N2ZA 4M60A 2F64A 2Z98A 5DIZA 3MT9A 8ATCA 4BWYA 1KDZA 2EJUA 2RGBA 3H86A 4TKUA 4UTNA 1TM7E 1YFJA 3AKCA 2FWMX 2IUEA 1XZBA 1YZHA 1UZAA 1KAHA 5HJ5A 4K2HA 3NBFA 3VJRA 2DWOA 3WGMA 3ZW8A 3KG2A 4N40A 2Y71A 2HWYA 4AQ7A 1CVLA 4LGCA 5D1NA 4JEMA 4RQ0A 2W6JA 2GM3A 4MCAA 5TR9A 3K0EA 4QBGB 1GT91 3DPSA 3LQKA 3R1IA 3KE9A 2PHZA 3QKUA 4K6FA 1R50A 3TB4A 1SU8A 2VPWA 3TARA 2FZEA 1KHTA 1NYQA 2VI5A 5AR1A 1K4MA 4FDMA 2OGTA 2LHTA 2AEFA 1F8UA 4PH5A 2JL1A 4ZT4A 3FTPA 1JX6A 1QZZA 5DE3A 2PO5A 3TSAA 1O8BA 2X9LA 4N65A 3OHBA 3P94A 4ESVA 2CLHB 2OBBA 2PZEA 4UPDA 1J5PA 5FWXB 1ZQZA 1TUIA 5E6RA 3AF3A 4CW7A 2QP4A 3A2NA 1I1QB 2IZ5A 1EXDA 4GD3Q 3I76A 4MROA 4YDQA 3L4JA 2BFEB 1S77D 5TMEA 3TW0A 5C81A 5FL7A 5KSZA 1UXKA 3H9BA 4A0RA 3T34A 1JT2A 4HAIA 3A6LA 1Z0KA 4D4IA 1PFUA 3NIWA 4ASUA 1JXQA 1G8HA 1BDMA 1OTYA 4HEJA 4FLEA 1U9LA 1Z5WA 3CURA 4NJ8A 3CH6A 4GBMA 2FLKA 4HP8A 3CE6A 4EB3A 1Q7EA 2LR0A 3RREA 1ZD9A 3TAHA 4IGKA 3CVVA 4LBWA 4Q4AB 3GL9A 4LZPA 2FWIA 2R84A 2FKAA 2QJFA 4OQNA 2QLLA 2NRXA 2FV8A 1CY6A 5DGHA 1QGZA 5F7JA 5F21A 2CNDA 2GPBA 4DS3A 1GNRA 3VU3A 1MHPA 2GEVA 2PUBA 4HPXB 4YXMA 3ZDRA 3UHPA 2BFFB 4DL9A 2BCGY 5EWMA 5E7IA 1SKQA 3RC2A 2A9KA 3OFVA 2XVZA 3UG6A 2XE7A 1U6IA 1H8ED 1KPIA 2WAMA 1XXLA 4ZICA 1C7FA 1PGQA 4Z54A 2UUPA 4M8NE 1E8NA 4YP0A 2EJVA 4CMCA 1RYZA 1X9WA 1N9GA 2AK2A 3RJZA 5EP4A 5FTLA 2GYWA 4O3PA 4HQRA 1OPXA 5P8WA 3UAOA 1KQQA 1IUKA 4EH1A 1ZQ1A 3L5OA 4RHTA 4QZAA 1CUYA 1RRFA 3FBGA 2PE5A 4X94A 1L8AA 1U3CA 1YBVA 1ACJA 1W4LA 1OXMA 2VJAA 3DMGA 4B3DA 3AR4A 1P1CA 4L4XA 4ND1A 1E2MA 2QVBA 2QW0X 2GOYA 1NLYA 1PT7A 1K89A 2Q4BA 1JBKA 4NBTA 4D43A 5JSKA 1P45A 3MOGA 1U4SA 4IGEA 5EXPA 1UM8A 4G0QA 3FWNA 4TN1A 4XDYA 3ENKA 4M54A 2B7LA 4B71A 1U0GA 3STWA 2C4VA 4Q12A 1XQ9A 4DTCA 5J0SA 3Q7EA 2YQZA 4RDHA 5C35A 1H93A 1DI0A 1PZHA 4X1IA 4R8MA 4NS4A 3ESQA 3T94A 3TTYA 2OV4A 3AERB 1ETHA 1SUEA 2VUHB 3I30X 3U60B 2HMWA 3GOHA 4HYTA 2Q3BA 5K51A 4OI4A 3EFHA 2ZM5A 3DZGA 4JI8B 5EZSA 2VPZA 3MJRA 2W9AA 3MMZA 2QK4A 1NA5A 3GH3A 5JXHA 1Q0SA 5GY7A 1SXHA 2JIZD 3BZWA 5G4KA 2CPRA 2XCUA 2XVMA 3BXPA 3RAPR 1W94A 3CPSA 4GLJA 1ZUD1 1YE8A 2XYGA 3D3QA 3OU2A 3IPRA 2XW6A 2Y0CA 2ZDHA 1D04A 4QHSA 5SY9A 3H0RB 1D2EA 4KITB 1BPYA 1XAGA 4YH1A 4ARIA 2BHSA 5SYAA 4Q7EA 5CB1A 4D3ZA 3KCNA 2J45A 3P26A 3BIWA 3W90A 3JPSA 1O9GA 1WXXA 4HYQA 3VISA 4D3XA 4F60A 3D1LA 4OJTA 4TMXA 2XIQA 1CEEA 4P80A 4G0PA 4L8FA 3QLVC 1AQLA 1I7PA 3OUZA 4YEDA 9ICKA 1IAQA 3OM8A 4OUDB 1L4YA 3HP4A 3PZRA 1GPLA 1ZXLA 4H6VA 3ND5A 3L6EA 4FQ8A 5EY5B 4K9SA 1ECCA 1C0EA 1DEHA 4AS2A 3AF0A 3MJ4A 2QHXA 3GR6A 3ZVLA 5IM5A 2YDYA 3HFRA 5AKXA 3O2JA 4DQDA 1P7VA 2O6HA 3QXJA 3U80A 3OIUA 4LJ9A 4F2DA 2CNBA 1QH0A 1A88A 2MMCA 1SIJA 5REQA 2XGGA 1P4SA 4I50A 3H1FA 4D5EA 1TJNA 4HDCA 4FZNA 1ZQMA 4NFHA 1LY1A 2DHQA 2OAEA 7ICKA 4JGIA 2A1AA 3UWMA 1ORRA 3CGGA 2GH1A 1G17A 1NN1A 1XEWY 4PYMA 3A0RB 1QOQB 2DOKA 2FUEA 3ASVA 3PX3A 3O73A 4F46A 1U3GA 3KZIU 1NMQA 2D5LA 2HO4A 4IDAA 3MSXA 5IT0A 1DQPA 3SJUA 2E8MA 3R09A 1TM3E 1X7ZB 2HZ7A 1HDCA 4UBOA 5JS8A 1Q3KA 2B6HA 1GTRA 4NBLA 1JTFA 1W36B 3DFZA 1BKDR 5K8LA 4O3QA 1D8YA 5JNLA 4Z0NA 3UWDA 3MJEA 3CNHA 5KFMA 4W8GA 1B26A 4A9AA 4TS3A 4OKIA 1NQOA 1Y9ZA 1N32B 4LC1A 2EXXA 1U7PA 3H2IA 1Z0ZA 2IYQA 3C7KA 1WDTA 4XUGB 3DBHB 4MVJP 1ZSNA 1KPGA 1KMQA 2VZ8A 3TCNA 4PLPA 3CZQA 1C8VB 4CM5A 3AINA 1R8YA 1Y7PA 5DHFA 4QXAA 4I0WB 3PKJA 2YV4A 2CVQA 5K0FA 1PFGA 2E21A 4GO1A 3OZCA 2B34A 1ZQSA 2UYHA 2EZXA 1SCIA 3IO3A 3IXMA 2AWOA 2CLEB 4X90A 2QEQA 5B64A 5AT1A 3D2AA 3GEHA 4M7RA 4NR0A 1DV1A 4L28A 2YCBA 2IVFA 1ZM3A 5F52A 4TWAA 4KRGA 5AKEA 1Y82A 1I0LA 1WPQA 3P45A 1HE2A 4ETIA 2XVXA 2EX4A 3M9WA 3C4JA 1FXSA 4CL3A 4DV0B 2B2CA 4NLZA 3JQ8A 4M4SA 4Q05A 3L0OA 3ZI4A 1ZCJA 3V33A 5JSZB 4F4HA 4KBYA 1O6BA 5JANA 3UCXA 2GEDA 4B74A 4MI3A 2CSXA 2BCUA 3U3JA 4DZTA 3K9LA 1WTCA 3RFXA 3KDSE 1D9FA 1C14A 1TK5A 3ACBA 1V1JA 3HS3A 2KP7A 2Z7JA 3W78A 1LQUA 1L5KA 3EIWA 2WK1A 3P9QA 4EKYA 3BFVA 3L6DA 2ENUA 3Q7SA 2FPWA 2QZPA 4BRWA 2QZ9A 2NPOA 5CDSA 3G5LA 2PFOA 4MJXA 5BY2A 2VEOA 2ATVA 5LA6B 4MQFB 4GOOD 4IIEA 1L5FA 1H1LA 1MG5A 4AMVA 1XTUA 4INOA 1WV1A 4Y1RB 3PGVA 2AFHE 4M38A 4CETA 2G9QA 4M2YA 4WADA 3ZWYA 1HDRA 4NM2A 1YFLA 3NC1C 3DO5A 4CCHA 2EZ8A 4J2HA 2O5VA 4DLVA 2DTDA 3GIIA 2JAHA 4ESHA 3GFGA 5B30A 1I7DA 2IA6A 3FOBA 2D1RA 2Q3LA 2XNKA 4I5GA 5ALYA 4F84A 2BTEA 1BVSA 4N7JA 2E6KA 3AIOA 3FOFC 4NVRA 4XWWA 3BMQB 1P6QA 2M9MA 3V2GA 4O9MA 3HBFA 2P11A 5JH7B 1AKVA 5CGQB 2E8OA 4QBKA 5HIMA 4TRJA 5EUQB 1FNCA 2ZUVA 4FKMA 5DP2A 5K3DA 4RK1A 2J6IA 4RSRA 2XZDA 2QQEA 4G09A 4ZOCA 1F14A 1Z6QA 4WI1A 3Q1KA 4BVBA 5DKFA 1EM8B 4KH1A 4BUJA 3BCHA 2EEZA 5KG5A 1QAOA 2FPMA 4BFUA 3A0BU 4WZ6A 1FLDA 1AKEA 1WUDA 1DAMA 1WZ2A 3Q5DA 1SK8A 1TADA 5C8VA 5J58A 3UEOA 4ZHQF 1SA0B 4LZDA 1W73A 2A9RA 3QG5A 2VNKA 1CUEA 1VFPA 3UAXA 4HBGA 1BMFD 1RP1A 2XRYA 3PLRA 5CVEA 1HI9A 5DLYA 3IQGX 4DMCA 3PR1A 3PKIA 2O0MA 1SKAA 3DD1A 5JCJD 3FYDA 3LDAA 2P0YA 2MYTA 4PO3X 1Z7WA 4IFIA 1NFRA 4PZYA 2DGZA 4PYRA 2BCSA 4DQIA 5GOTA 4DYHA 4MR8A 1QGUB 1NZBA 2E3JA 4BEVA 2NUTB 5BQXA 4V1CB 4K40A 1VJGA 3PYXA 3ER8A 4FNGA 1USIA 2PM8A 3LWNA 3LV8A 5ERXA 1NJXA 4XFDA 3MSCA 3I6QA 3KL4A 3UM9A 5DI3A 5L8VA 3IUNA 4XM1A 4BFSA 3VI4B 5FPHA 1W9MA 5EXXA 4KOEC 4WUTA 4HDAA 4IDOA 2O8CA 1URPA 2H63A 4LXTA 4GC6A 1YK0A 4UNIA 1OJ7A 2O8EA 2V7TA 4UUBA 3AOGA 3DLHA 2OO5C 3LT1A 3OKPA 5H7XA 2TMGA 5IAKA 3RYHA 1I4TD 2P0EA 4QSHA 3WQHA 1SULA 1Z19A 4D6XA 1MT0A 1JAXA 2Q2WA 3CRXA 2WC1A 3LZDA 2AL7A 2HRCA 1D4ZA 3VR3A 3VZCA 1ZD4A 1GCOA 4C8MA 4MKRA 3JZDA 4ZAVA 2Y2UA 1DFGA 4UM8B 1NC3A 5IILA 3OG9A 5HPYB 1DUIA 4FGJA 3F5AA 2EJTA 2YV5A 3BS5B 2VK2A 3PC4A 5KAFU 3DF7A 4J91A 3PTLA 2OFXA 3QPDA 2ORVA 4YIKA 1Z4PX 3AONB 3DDZX 2QJOA 1GZ5A 1MN8A 3I72A 4LTDA 4UHJA 4KFUA 1N2BA 1Z9BA 1V25A 2X40A 4YP9A 5L9XA 4X7PA 3DL0A 2VSNA 1TLTA 1T8SA 4QD3A 2N1RA 1JB9A 4C0HA 2AR0A 5JARA 3ORQA 7ICLA 4Q19A 2BDPA 3OCWA 2P1ZA 3BVPA 4LI0A 4V2IA 4DPMA 1PIWA 2QLFA 1NXOA 1DVRA 5FV4A 1KNXA 3D1JA 3RRJA 1VL2A 3ANMA 1SUAA 2Y67A 4INPA 1FSSA 1DFHA 3MBOA 2JH7A 1OYYA 3VPGA 5LIRA 1JDNA 4LBZA 1AKUA 3N8HA 1XPUA 4GHWA 4KGZA 1AMUA 3AB3A 4KGVA 4D6PA 1FTYA 3RTCA 2H2IA 8ICLA 1YI1A 2VFAA 1VZ3A 1NN3A 2H17A 3T61A 3S7TA 4N5LA 1FBNA 5FJIA 2A0XA 4EW2A 5LNK6 4LF6B 1RQRA 3TPCA 4DV1B 2C3YA 5D5QA 2JZBB 1D2CA 1AQ6A 2XOEA 5IDWA 2HHVA 3C24A 4Y6SA 3L4PA 3WJ2A 3VTKA 3EPJA 1BXRB 3DMRA 2VJMB 4JELA 4ID3A 2OB1A 2A5GA 5CA7A 5KNCH 1DBPA 3TW4A 5FWYA 1VL8A 1PK7A 2DUNA 2A1IA 2ARKA 4IQTA 4FEGA 1PN3A 4FFOA 3RUIA 1RDFA 4YHBA 3BULA 3LC2O 4EBFA 1K92A 2J3HA 5G41A 2O2XA 3UXNA 2C2ZA 5C1DA 3THWB 1JVSA 4RW0A 7ICTA 2JB9A 4ZXFA 4ZK6A 1NOIA 1CJTC 3IJPA 2WIAA 4B9NA 2Y77A 3ROKA 2ZYGA 1N7GA 3DUFA 2PGOA 2L69A 3PPXA 3HCBA 3FPKA 5DZSA 2I2FA 2VXCA 4LZAA 1SBNE 1LUAA 4QBHA 4UD2A 3ELBA 1RJ9A 3QU9A 5AUPB 4UFOA 3ABIA 1N2HA 4G0OA 1QRAA 3UGQA 3O4JA 2MSWA 1NOKA 5EWEA 3KTQA 4E5DA 1E66A 5EESA 3QZ8A 3UA3A 2FR0A 1LV8A 5JECA 4M1SA 4P5DA 1XYYA 1ZQQA 4F1WA 2E18A 5IULC 2FLVA 2DFTA 1ZJJA 1G66A 1P1HA 2R1TA 4Y2HA 2ZJ6A 1VDZA 4U2CA 3M6WA 4MFFA 2F76X 3E3LA 2FE4A 1ZQLA 5E7QA 3DHWC 5L3ZA 3T3EA 2BSQA 2J9YB 1PJRA 5H81A 4QDJA 5CLIA 4Z7QB 5E3IA 3PC2A 1P3JA 1BOOA 2FFBA 2REQB 2Q1TA 4ZCPA 1BX3A 4QAQA 2O8DB 3SS8A 9ICEA 3A6DA 4AP9A 3K2IA 4DLPA 3R6LA 3QEKA 1H8HA 3O91A 4G0WA 4F4YA 3LVQE 1D0SA 1D8TA 4UCFA 3V6JA 2ATEA 2Y9UA 1ZIXA 2PPLA 1JLLA 1SUSA 5IJ0A 1Y9JA 2UU9B 2IYOA 4P3PA 1LI5A 1R74A 4QU0A 5IWCA 2C98A 1YBFA 2JFXA 4B3SB 2EVWX 3IHKA 2ISQA 1UZUA 4JP2A 3EAQA 5KVAA 1UPCA 3CNOA 5AKZA 1U2RA 4UNNA 2WBLC 4U39A 1CU1A 3EXFB 1EFPB 3I58A 4MINA 1FYDA 3MWJA 2KE7A 2Z30A 5DW3A 3P9RA 1N0IA 4N48A 2C29D 1W25A 3T0IA 2CXPA 5LN1A 4GT1A 4UREA 4XGNA 5CITA 3SG0A 1O3YA 1IONA 1IYZA 5AJTA 4MEBA 2VHCA 3PICA 4GP9A 3TZLA 5ALPA 1SC6A 2LKCA 2IITA 4HAYA 1RLIA 3DP7A 4GL2A 1MB3A 3QQPA 5CXXA 5EIWA 3Q9LA 1IQ0A 2IE0A 2ZUSA 1YMUA 2JJQA 1A5BB 5AVXA 4ABYA 3AETA 1SZJG 4TL7A 1ADJA 4I19A 6LDHA 4D8YA 1G3QA 2CDRA 3WK6A 1VLQA 2Z5GA 3FVQA 3JQAD 4JQSA 1USWA 2XQJA 3JAWB 2RK3A 3PIIA 3HJBA 2J33A 4NHOA 2VH2A 3IAM1 1JHMA 2PL5A 3I2KA 5JBIA 2ZXEA 1YB6A 2R97A 3EIXA 4TURA 4PYIA 4MWBA 1GPBA 2IGBA 3L7KA 4QXPA 4L4RA 1YU6A 1OY1A 3E0XA 2HSZA 3ZI0A 2E55A 1GA1A 8ICVA 2ZTHA 4RZ3A 3UWOA 1EVYA 2RIPA 4FDUA 1GAEO 4ZYVA 5K99A 1E2BA 3PE3A 4F50A 3RFTA 4UUOA 3I2JA 1BTOA 1CUJA 4A0HA 3SM9A 3Q4GA 1WZCA 2DR3A 5ALOA 1RM0A 4KIWA 4NQRA 4NH0A 3DDHA 3C8DA 1XMSA 5ENDA 2B36A 3K0SA 1Z28A 4W99A 2GRUA 2BEUB 1DT3A 2QF7A 1NJYA 3KHSA 5FOQA 3L0YA 3VKFA 2OC4A 1FTQA 3SJ7A 2KKPA 5LUAA 2HYIC 4EZEA 2GHTA 4YV0A 3NAQA 1S0MA 1RAFA 5CDTA 2WABA 2GSWA 3FSGD 4B83A 2VBGA 5EIBD 4ZZ1A 3K09C 4WN3A 1JXLA 3IEUA 4FINA 5EMKA 1CJCA 3ZVNA 4RCYA 4UULA 4DLZA 5KFFA 2IEIA 1LV5A 2LM1A 2QVYX 3HR4A 4FHDA 1L4KA 4BMSA 3L1VA 1RWOA 3WAJA 5JD3A 2OB2A 3E22B 3M5DA 3DR3A 4AUKA 1VCMA 4AUNA 2R1ZA 2C2KA 2PS1A 3DBLB 2CJXA 4TXHA 5L9AA 3DM9B 4K26A 4HJRA 4EJFA 3ETDA 1ZY2A 4MWSA 4IIXA 2H07A 2QM3A 1QIFA 4NNJA 1X87A 4PGMA 1CY1A 2ZIXB 1OXXK 3RTBA 1Y3AA 2D1YA 3EH2A 3IR7A 4MIYA 1NUAA 4KQXA 4BX0A 2BMJA 5LJIA 2ZRJA 2DF4B 1JA0A 2IOFA 4ZVOA 3EGIA 1N8SA 1H6DA 1RLOA 4JLPA 5TF0A 3BEOA 4RPXA 5G1NA 2BTQA 1GRRA 1UA0A 3K9GA 3RK4A 4MB6A 5J4YA 4IH9A 4MEJA 1H05A 3SV4A 1WR8A 4A73A 3S81A 4Q4LA 1E9VA 1Q1ZA 4QTZA 3V7FA 4DCOA 2YTZA 1AZSC 3SJBA 3O38A 3N2KA 5BW6B 5CT4A 5KNBA 1OWNA 1V39A 1SG0A 3FJOA 4Z7OB 2BR4A 3J81k 2OWEA 4PYNA 4KU4A 2QN9A 4LJAA 4Q8FA 3FAKA 3O84A 2VKTA 4KMUA 5F2EA 1UBNA 1JIVA 3AG6A 4YRNA 2WHYA 4F3RA 2GVNA 1PE0A 4CF6A 3CKMA 3EUB2 2H5IA 5JC8A 3UO8B 4XOIA 4XDGA 5JG7A 4CCSA 5GZ1A 3WDMA 4MR7A 3OY7A 3HU3A 4PIMA 3EXAA 3RHZA 3V2IA 1SC1A 4R8UB 3A3KA 4F5OA 3WB1A 1KK1A 2HOQA 4AN4A 1N5IA 1Q7GA 3C0KA 2ZAOA 1A8IA 5KG0A 1IB6A 5ECGC 3CFYA 2ZPUA 1QVRA 1ZHFA 1CRXA 4DRYA 2V1XA 2QVCA 3U44A 2EKQA 5M04A 5U4XA 3AR2A 1VJ0A 1EU1A 3NBAA 3KQTA 4ENWA 1JRLA 2VRCD 2X0KA 1W581 1L5ZA 4QZIA 1V7QA 4ABTA 3PC3A 1L3VA 4K88A 1HOXA 4KLIA 5KKCA 3KQKA 3K0AA 2J6HA 1N9KA 2AD5A 4QKQA 2F90A 1NX6A 4LFCB 1VL5A 5EKSA 1DKUA 2JLVA 3ZCRA 4RPGA 1T2NA 4QU9A 4PLVA 2F8TA 2AFHB 4D79A 4CKCB 4QTYA 5CG2A 1DKOA 2C07A 3LWBA 2IY7A 5LMNB 5HIAA 3AL0C 3HADA 3JTEA 4KZKA 4FI3C 1RXYA 4DAEA 1CR1A 2NTJA 1U90A 1E4VA 2YWRA 1LSJA 1DTEA 3WK7A 4K81B 1J21A 3AY7A 2UV8A 1SQSA 5KVQA 1CZKA 3PF9A 1S3SA 5E79U 4J7CA 3KXIA 2VSYA 2GPWA 5EWJB 1T5DX 2RGGA 3FTFA 3LUAA 4RL4A 1XBTA 4UBJA 5FLKA 3T5BA 4OU4A 1P17A 4RQ1A 4PINA 4CT0A 1Y34E 4XUEA 4CL8A 3WIOA 1ZJZA 2BFMA 4A0FA 5DCYA 4DQXA 1WNTA 3Q5EA 1QK3A 2FMUA 2ICAA 2ZI4A 4HVLA 1NOMA 3WGTA 1LLDA 5TQ2A 3EXG2 3ZU3A 3UVEA 2H3VA 4EAQA 3W5VA 3L0ZA 4RQ6A 3LSTA 1XMOB 1NU6A 1QORA 5KDLA 4R9RA 3AVOA 5JXJA 3E5NA 4OHCA 4QWEA 2EYQA 2HXYA 5LZ4A 5B1IA 1F8GA 4G1VA 2QVLA 1Z0IA 4OUKX 2QY9A 5JJIA 3CTPA 1MX3A 4CNQA 3PL5A 3U7RA 3C3CA 3KALA 5HBGA 1RD4A 5BUZA 1DG9A 1IZYA 3QX7A 4E6EA 3TZCA 1Z82A 2N75A 4N0PA 2JIMA 4BHTA 4L5IA 3VDRA 4JY7A 1M75A 1G5RA 1NXXA 3DUWA 4XIGS 4BX2A 3RKRA 1FQJA 1QRSA 3HHPA 3ESCA 5I5GA 2XYRA 3CLKA 3B8EA 1TD1A 1R6DA 2WU8A 1XWWA 4C7OB 3PDIA 4TLAA 1U5BB 4IRCA 3EEFA 3EIQA 2CYBA 4E46A 4WXYB 3HBLA 5SZKB 1MB9A 1OWMA 4YAJA 2B9VA 3DDWA 1LGYA 1YASA 4YMIA 3IBGA 4L2IA 5CCEA 2OCBA 1GAXA 2JIOA 3SNKA 1HSOA 2BCRA 5BN3A 4PHCA 5DH9A 1CUFA 1QFYA 1NI4A 1N5MA 3B48A 2PKWA 2QLBA 4ZEOA 1OLXB 2PVSA 3AV3A 8LDHA 2BVNA 4U7FA 4RABA 2Z8XA 1OI7A 3N2IA 4QZ9A 2ZRFA 2CLKB 2GZSA 4RADA 1BRMA 1KSGA 1FNBA 1Z2OX 3HCPA 3C15C 3LCCA 3IBTA 1ZNZA 5B2EA 2H0QA 2Z4TA 1QZXA 4Z4CA 4B7UA 4YJGA 4KFSA 4ZGGA 4HT3B 3LM8A 1P4RA 4GI2A 1RVDA 4LHEA 3AP1A 1RQXA 3DNPA 4PZEA 1BDBA 2CWDA 1F4LA 2XTZA 4ZIRA 4YP1A 5J2AA 4FC6A 1TFUA 3HWWA 4OB7A 4PNHA 5AUQA 2PQ6A 4CTJA 2V3VA 2B6GA 5CR0A 3AWDA 3BK2A 4E08A 1FLAA 3B1JA 1HURA 4I2AA 3ZGZA 4MGZR 3CVUA 3JVVA 4N0DA 3EHDA 1JIKA 5DP1A 2MWMA 3CSUA 4WGGA 3X2FA 1L8OA 2G4LA 1KWKA 5DJ5A 2O50A 5DHPA 4MV9A 3MGCA 1OE0A 1MQ2A 4MAAA 4R2KA 4FILA 3KQUA 1KVTA 1T13A 3GA0A 3BREA 5AJUA 6CHYA 1P5HA 4YCBA 2NZXA 3WAGA 1NLZA 3VYSB 4G67A 4L8YA 2BKAA 3B1KA 4C21A 1ZVJA 2VZ9A 2CWWA 1JEOA 1KXZA 4JT9A 1RYMA 5DNEA 5BSMA 2X9GA 4B6SA 2V98A 1S5PA 5T41A 4LV6A 3SQMA 2UYOA 2VDOB 2G28A 5AVTA 5JRTA 3PFFA 3TNJA 1T0UA 2IPOA 3BJZA 2C9CA 5DYYA 1YC2A 4C4ZA 2OT3B 4RC9A 4TYWA 3C5VA 5D6NA 3AVUA 3QHQA 2QENA 3QVSA 2V7QD 5AJZA 2J5BA 2O0JA 2WNHA 4PLTA 4ZAGA 3C5CA 5L4SA 4DNOA 1ZSVA 3OKAA 2VDWA 1FW6A 3L6BA 4DJTA 1ZXIA 2XB4A 3UV7A 1XEXA 1TU3A 4HC4A 1XWIA 3AH8A 1IUPA 4GNKA 3TTWA 1K66A 9ICSA 4G2TA 4E5UA 4QFCA 3D3EA 4WK0B 3L8FA 5EMMA 3L05A 4OJKA 2WB4A 4ECAA 2E1PA 4OXNA 2EKDA 1Y9AA 3EVGA 4CLEA 2J9XB 1VFNA 4OA5A 4A2PA 4QQFA 3WWEA 2XWPA 3RIMA 4U2GA 1GL6A 1T9GS 3NHRA 1U7UA 1UZLA 4CN9A 4QGFA 1C0IA 2VP9A 3HKEA 1YRYE 1UMDA 5AJVB 4A03A 5B3KA 1NZFA 4PQFA 3NASA 3LX8A 5AXCA 3LDUA 3FSEA 5KOIA 1GUZA 1JQ5A 1R27A 4A82A 2F3TA 4Q4DA 1O96B 3D8BA 4RV5A 5AESA 4O4HA 1SBTA 2GJAA 3OSZA 1ZRSA 4NABA 2JFPA 4U8HA 1GZ7A 3FPEA 4CDGA 1SQ5A 3Q40A 2G25A 1IQUA 2G9ZA 4RH3A 4EPWA 4Q7KA 2QPOA 1A2BA 2HA2A 2Q62A 3K1RB 4O1MA 3SZ3A 3IIIA 3DNFA 4KXVA 2XYPA 4JC5A 1ORIA 1RYEA 5E9AA 2Z3WA 4OVKA 5DDIP 1MX1A 4KPEC 5DF1A 2ODQA 4GRAA 4KLOA 1DO0A 2ISPA 4A15A 1M0WA 3KFUF 2AC7A 1F38A 4U2KA 3RBVA 2GHRA 1IAVA 4M1OA 3P9YA 3PQ5A 2XNDA 4E7PA 4XWYA 1P4GA 1WUHS 3F6EX 2XDQA 5DU2A 1G38A 1IBMB 2Z0MA 1THZA 2GAOA 3TQSA 4MDEA 4I2FA 4AJLA 4BLQA 3DC7A 4ARVA 3IAHA 3L04A 4FHCA 4BE7B 4QXOA 4YC7A 1CZRA 3A70A 4AYBC 3RJHA 2O5RA 2WD9A 4B33A 3EODA 1BA3A 2AN9A 1YJ5A 4XLLA 2WKWA 1Y8ZA 4AJ9A 1NMYA 1PJ2A 3LRTA 3LK9A 3NVAA 1S3IA 3GFTA 3D0KA 4OV6B 4ZI5A 1GEGA 1XQWA 1CZOA 1YRQA 1E0AA 3EYAA 4BQRA 4D0NA 2Q49A 1LCIA 1R4MB 4DJJA 2QYOA 5AK5A 3THYB 1LBTA 1YS4A 2Y4OA 4DJFC 4LRQA 5E6UA 4D9NA 2WDZA 1ZP6A 4QZ8A 4XQ0A 4V38A 2YXEA 1R5OA 4RD3A 1HFWA 4RUCA 2D1FA 2PLWA 4WXMA 3S3TA 1RFLA 2QARA 1WSWA 1JQDA 3CJTA 4XVCA 4ED0A 4ECQA 1YHZA 4EKEA 2EIHA 1T9ZA 2V54A 4GM4A 2LMRA 3RUHA 3HI4A 9ICQA 2DMRA 4RKRA 1XE3A 2OCYC 4C4OA 1Q95A 3CUYA 5INTA 3W6OA 4B2YA 2QY6A 4AJHA 5IEJA 3CB4A 5E1MA 3M89A 4PXYA 1T5HX 4E13A 2VEDA 2RGUA 2GQ0A 1KYVA 2PBZA 3L0PA 3N7PD 1M73E 1H5UA 2K8BB 2YXDA 3W1WA 2HX1A 2VYQA 4JLKA 1SZPA 2PXHA 4K9NA 3T7CA 1DAFA 2VJNA 4EI7A 2ZANA 3GD7A 2R6ZA 2V4RA 2JI9A 4NU6A 3IAS1 5GONF 3OECA 1O54A 4BGEA 4IJVA 5LQUA 4H0CA 4OQFA 1IHXA 1W5BA 3E7WA 1Y33E 2R8JA 1M8GA 2OG1A 4H6XA 3ZHSA 3VUEA 3IP6A 3ZGXA 4OHKA 2TS1A 3WLQA 1Y3HA 2PX6A 4LMBA 3EQ9A 1Z34A 1HQDA 4FYXA 5F3RA 1PGNA 4RJIA 2X3FA 5ECDA 4G23A 4IIVA 3PJFA 2AYYA 4XVQA 2BYTA 2QIOA 1FFWA 2VRWA 5BR1A 3QTBA 4GC7A 3WO0A 5KTOA 2VNJA 3DMHA 3VYVA 4JGGA 1NBEA 2QZSA 4A5OA 5J8YC 2XUDA 5CBPB 1GRCA 2JEYA 3AUUA 5DBBA 3EX7C 4P6VF 1IRXA 3PXEA 5FBKA 3QBEA 4GLXA 3VBEA 2BC9A 4WJLA 4CZ2A 9GPBA 1GL7A 2RHMA 3QUSA 2K2WA 3IDQA 5M3BA 4C0XA 1BMDA 3C3YA 1VTKA 3C97A 3ZNPA 4I1OA 4PSDA 1YVEI 3VO2A 1BU8A 4LXHA 1CNFA 3KAJA 4F97A 3V72A 3OFND 4XA8A 2ZI5A 5IT4A 4NONA 4GECA 1XMIA 2PWAA 3SHWA 3OE4A 2VTKA 2KSOB 4H59A 2JJMA 1KI6B 5IYZF 1ENZA 3ZHRA 4MRAA 4ZQIA 3ZD7A 3OX2A 4EYKA 2ZUFA 1GN9A 4QGBA 2X7JA 4ODIA 1JMSA 3RF7A 1FJHA 2VF4X 3R9KA 3QFHA 2J1LA 3OQ6A 4N7RA 4XYLA 1Q8KA 1IATA 1Z35A 3HY6A 4R8RA 3W04A 3CUTA 4UBIA 4F6LA 4X5OA 4GOND 4G85A 4XUCA 3C3KA 3IBSA 2E82A 1OT3A 4DZZA 1O97C 5KFZA 3I83A 1ZH8A 1JI3A 1JT9A 3V97A 5FOVA 1YA6A 3FTCA 3LX6A 1ZUIA 3MGBA 1CDZA 2IXDA 5A3SA 4JJIA 4KL8S 3TXAA 5C9ZA 1BFDA 2IYNA 4FFBA 4JZYA 1XZGA 1O5TA 5C8YF 5H59A 1ZQCA 2R6CA 5B12A 1Y98A 3H97A 4FYVA 5AQ1A 3TEJA 2GBLC 3HKBA 4W1SA 1T1GA 3KYDB 3QLVA 1THTA 4LZLA 3UG7A 5CAEB 4NDAA 1V2GA 4BNTA 4X3CA 1P60A 2WE7A 4TYPA 1HFJA