3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase
molecule keywords Predicted phosphatase, HAD family
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
5AW8A 4HYTA 2WF5A 1X42A 5A3RA 1FEZA 4F71A 5ALHA 1Z4OA 2YY6A 4CF5A 1RMTA 2ZBGA 3KZXA 3ZVMA 3OPXA 4BNDB 1T5SA 4B6JA 5ALFA 4O8CA 3FVVA 5AW5A 4BX0A 4MUMA 3EF1A 4BYGA 2NO4A 5AI4A 2BY4A 3ZUPA 3FPBA 2W11A 4NWIA 5JJBA 5ALPA 2HOQA 5AI6A 3OCYA 2FI1A 4KYTA 3K1ZA 2AMYA 1K1EA 2I34A 5ALIA 2R8EA 1Q92A 2Q4RA 4XE5A 1TJ3A 4Y2YA 2O2XA 1L8OA 1ZS9A 5ALJA 4RETA 1Q91A 5ALZA 4F72A 1J97A 1RC8A 2G0AA 4OHFA 5AW9A 3I28A 4DFDA 4YCNA 3QU9A 1U02A 3U7EB 5AM2A 4PNHA 5ALLA 3ZX5A 5AI0A 5ALQA 3DNPA 1SWWA 4HAIA 3ZWDA 1ZD4A 2GO7A 5AKZA 1PW5A 2Q4TA 4HGPA 3AR3A 5AVTA 3WK8A 1SWVA 3WK6A 3M9LA 3WKCA 1NF2A 3P96A 5AW3A 4EELA 3ONNA 4UAVA 4HGNA 3M1YA 4DW8A 5IT4A 2G09A 1KYTA 2PR7A 2HDOA 4GIBA 2O9JA 2JAOA 4NABA 2YJ4A 1ZD2P 3B9RA 2CFSA 4UW9A 2C9MA 1L7OA 3L8EA 4AS2A 5IT0A 4DCCA 5AK5A 3F9RA 3I76A 3L1UA 4XQ0A 4CF4A 3OCVA 2HCFA 4RESA 1WPGA 2P69A 3UMGA 4AS3A 4I9GA 2WF8A 3L1VA 1ZD5A 5ALOA 4UARA 2EAUA 5AKHA 3W5DA 2ZXEA 2AUTA 4NV0A 2Q5EA 4BEVA 2WFAA 3OCUA 3ZWKA 3WK9A 3EPRA 5AHXA 2WF9A 4UATA 1N9KA 2C8KA 4UU1A 3A1CA 2WF6A 3L8HA 4JDPA 5ALWA 3ZTWA 2B8JA 2JAUA 2W4MA 3L5KA 2OM6A 1Z5UA 5AM4A 2FPUA 3U7FB 3VAYA 3ZU6A 3PCTA 4IFTA 3AR8A 3NIWA 2JAWA 1RKVA 2WF7A 2B8EA 5AI9A 1RPZA 1ZD3A 5AM3A 3W5AA 3EF0A 4OFZA 2YMLA 2AGVA 3IJ5A 3N28A 4Y2UA 3N5KA 1RKUA 1CQZA 4Y2VA 2B1QA 1U7OA 5AK3A 2RAVA 5ALNA 1L7PA 2FEAA 3E84A 4KNVA 4Y2RA 1Z4QA 4Y2XA 3KDPA 4DWOA 1YS9A 2X4DA 1QQ5A 3ZX4A 1WZCA 5ALTA 4ZEVA 4KX3A 3EWIA 5A3QA 4UU0A 1Z5GA 3MPOA 3B9BA 1L8LA 3WKAA 3U13A 3OCWA 1RMYA 2R8ZA 4FE3A 1VJ5A 4BEWA 5AVYA 4UMDA 1RMQA 3E58A 4EX6A 3QUBA 4UMFA 3QX7A 5AKYA 3WKEA 2C8LA 1U7PA 3NANA 4EZEA 1TJ5A 5AICA 1IWOA 2HI0A 2YJ6A 2B82A 1NNLA 1Z4JA 5AKGA 4I9FA 1CR6A 3ESQA 2P9JA 3AR4A 5AIAA 5ALDA 5AM1A 1Z4MA 4ZEXA 2NO5A 3ZI4A 4HGQA 4ZEWA 1N8NA 3ET4A 4Y2JA 3NASA 3AR9A 3OCXA 4JB3A 4KX5A 5AKKA 5AW2A 2OA0A 3OCZA 3QU2A 4E88A 2PQ0A 4MWOA 2G06A 3QU7A 4KNWA 3UMBA 1RLMA 1RLTA 3TLMA 2HF2A 4XPZA 3QU5A 3SF0A 4OCZA 3S6JA 5ALSA 1O03A 1L6RA 2B1RA 5AVWA 3SMVA 4NFLA 3W5CA 2CFRA 1TA0A 1WVIA 2YJ3A 2GHTA 4UASA 2W43A 1T5TA 2I54A 1XPJA 2HX1A 5ALGA 1YDFA 3A1DA 1RQLA 5AW0A 1QYIA 2EARA 3DAOA 5AVQA 3UM9A 4Y2PA 4BBJA 3FGOA 2G80A 1Z88A 2VKQA 1YJ5A 3D6JA 3FM9A 1ZRNA 2PKEA 4QQFA 5ALYA 3WKDA 1VJRA 3L0BA 2OYCA 2OBBA 3QLEA 3SKXA 3NALA 1RRCA 2YBDA 1SU4A 2FPRA 3L0CA 5AW1A 2P27A 3KC2A 2IOHA 3AR6A 2BDEA 2HF7A 2YFYA 3WGVA 3WK4A 4YH1A 1NRWA 3AR2A 4HGOA 5A3SA 4G63A 2GFHA 5AM0A 3PGLA 4YGYA 4IG4A 1RKQA 4UMEA 4L57A 1VFPA 3QNMA 2HSZA 3ZW7A 3MMZA 2MU1A 1TJ4A 5AM5A 4CF3A 3U19A 2FPSA 2YN4A 4L6AA 3U7GA 3I6BA 1YMQA 3N1UA 5AVXA 3QYPA 5ALXA 4C4RA 4CE6A 2IOFA 2HEGA 3RFUA 4C4SA 3CZ4A 1JUDA 1YNSA 3WKBA 1Z4IA 4BX3A 2B30A 5AW4A 3R09A 1YV9A 1RDFA 1Z4NA 3SKYA 3ZVLA 4H1WA 1XP5A 1QQ6A 4OD0A 1ZJJA 2CN1A 1LTQA 5ALMA 2FUEA 3L0YA 3BA6A 3N07A 1Y8AA 2QLTA 1S2OA 1EK2A 3MN1A 4YCMA 1L7MA 4AP9A 3FPSA 1QQ7A 5AVUA 4J03A 4Y2TA 3SLRA 3W5BA 2YJ5A 4G9BA 4UM7A 5AESA 4XOUA 3I1YA 5AI8A 1U2TA 2WM8A 3GYGA 5FP0A 5AKLA 2IYEA 2ZBEA 4C4TA 2RBKA 2G07A 2IOFK 4J2TA 5IS2A 1O08A 1J8DA 2D2VA 4Y3UA 3KBBA 3NAMA 5AVRA 5AKIA 1RLOA 4UAUA 4BKMA 5AVSA 2I7DA 1QH9A 3AR5A 3ESRA 5AVZA 2HO4A 3E8MA 4QJBA 3HYCA 4NAVA 1ZRMA 3IB6A 1Z4PX 3U26A 4UM5A 2FPXA 5AKXA 3QUQA 2I33A 4UMVA 3B8EA 4Y2SA 2JARA 2GHQA 3RF6A 3FZQA 1T9ZA 3DDHA 3ZTYA 1RQNA 5AK6A 2C88A 2P11A 3N8GA 3R4CA 3BWVA 2ODAA 2RARA 3UMCA 2WHEA 3QXGA 5AKEA 3L7YA 5AIBA 1XVIA 5ALRA 1MH9A 3KD3A 4Y2QA 3CNHA 1WR8A 4EEKA 3KOOA 1LVHA 4KN8A 2MSNA 2I6XA 1F5SA 3PGVA 2G1AA 3A3YA 2YMQA 2IA5A 2ZG6A 2QYHA 1Z4KA 2NYVA 1AQ6A 2MU2A 2ZBDA 5AKJA 3WGUA 2HHLA 4BX2A 2EATA 4GXTA 2FUCA 1ZOLA 3PDWA 3QUCA 2G08A 5T41A 1S8OA 1U2SA 1TE2A 2FDRA 2AH5A 2FPWA 2CFTA 2R8XA 3A1EA 5ALEA 3ED5A 2C4NA 3DV9A 3L8GA 2B0CA 4EENA 1EK1A 3NRJA 3SHQA 5ALUA 5AW7A 5ALVA 3ET5A 3NUQA 3R9KA 5AI5A 4EX7A 4L6CA 5AK4A 4FFDA 2R8YA 3MC1A 5AVVA 3IRUA 3ZVNA 4FYPA 5AW6A 2I55A 3J7TA 5E0OA 4YIKA 3SD7A 3QU4A 2RB5A 3QUTA 3E81A 4HGRA 3HLTA 2YMPA 5ALKA 2ZOSA 4YCLA 3QGMA 3WK5A 3OTQA 2JGAA 4BNDA 3U7HB 3AR7A 2GMWA 4CNQA 2YMMA 2BDUA 1L7NA 3WK7A 2DQSA 3L8FA 1Z4LA 4YIHA 2ZBFA
chains in the Genus database with same CATH superfamily
1NLYA 5IPFA 3GLGE 2H5IA 5JH7F 1LNSA 2AN9A 1TXGA 1M9NA 1PV1A 2JC3A 2KTQA 4JKIA 1UPUA 2PS9A 3CBQA 3GJ8A 3HLKA 4CV2A 4KIJA 5BP7A 5IHPA 5ESWA 1MC8A 4H1HA 4HQOA 4JLUA 4IR7A 2UUAB 3NC4A 3HB1A 5B3KA 4DVJA 4DDMA 5F3DA 2EG9A 3OAAA 4O1MA 4ID9A 5REQA 1T1JA 3ZBPA 1SL0A 4TMFA 2O2DA 3NS1A 4K87A 4XIYA 1B8UA 2LPEA 2R1UA 3FPBA 3RRGA 5JJBA 3D02A 3C7TA 8ICJA 4MWEA 5HE9A 5EE0A 5EUBA 1L4FA 2OCGA 3E1SA 2FG5A 3OWHA 4MULA 1X9IA 4DQKA 1LWNA 3ZV7A 1MN8A 4NCKA 4BRZA 4RUCA 2V4RA 2Z6AA 1YRWA 3SC2B 5TMPA 3MRTA 1IIBA 4KBGA 1R4AA 5E9QA 1ESNA 4R71A 3HG7A 2ZKIA 2ZTUA 3RPEA 4ZHQB 5FO0A 3ENWA 4RETA 1ZQRA 4P2BA 4Q9DA 1KMHA 1XTRA 3Q12A 4KJZA 3TDKA 3VNQA 1X66A 3TZQA 1TU3A 5J9FA 4NS4A 3V7FA 3L7MA 1X7HA 3VHXB 3WADA 2FSSA 4EYKA 4N3CA 3LC2O 3ITKA 1SGWA 1TAHA 3F5DA 1DAHA 2VDMB 3GJ3A 1HNZB 2QG6A 5K6RA 1VBKA 3IDZA 1G17A 5ALLA 1YL6A 3QPAA 1AF7A 4D9BA 4GXIA 1PV2A 1G7TA 3ZHTA 7ICJA 3KZ1E 5A9SA 2JEOA 4XDHA 3OEWA 4REOA 1M0SA 4RS3A 4MYDA 4AD8A 1CY8A 2Q8QA 3VOTA 3HS3A 3GEPA 1QR6A 5D3MB 1UJBA 2GJSA 3A37A 3PPXA 1TW3A 1Y6RA 3NHRA 4QE3A 4A10A 3N59A 4AECA 5A0FA 1VECA 4RZRA 5JV5A 3AI1A 3FAHA 1XDDA 2HTFA 2IYZA 2QMEA 4IIJB 2B7LA 3X44A 2JJQA 4S0XA 2FYTA 4DSEA 4TL8A 5DXFA 2ZJZA 1QCDA 2OWDA 2ID8A 1FS4A 1CEEA 3QM1A 1Q1GA 5K3DA 5KFMA 2PQMA 1U1CA 1WS6A 3LK9A 2AGOA 4JY7A 1YZQA 4RJTA 1G291 1AN9A 1MFZA 4M1EA 2GOLA 3V7KA 4TQUS 5CA7A 3JQRA 3I76A 2H3QA 2Z04A 3BQ9A 3D4NA 4GR4A 5B5SA 2GWSA 4OHYA 5E6RB 4HDMA 3Q8MA 2JK0A 3VNRA 2WOOA 4EKEA 3A1TA 5EZQA 2V8BA 3KVOA 1EDDA 2QTRA 1EUDA 2G4LA 4C4XA 4RAOA 4BTEA 1E5LA 2X1MA 5EYPB 5ICSA 2AFHA 2Z5FA 4FZ3A 2JIPA 4CN9A 1OGJA 2JCYA 4S1OA 1FFYA 2UDPA 2EKDA 3GEDA 1P2FA 1S3SA 1XYGA 2HCRA 3DVAB 3IH5A 1FVFA 4MIEA 3T3OA 1QK3A 3QSYA 2A9JA 4FFLA 4LSGA 5LCXA 4YYEA 5BT8A 1U11A 3TLGB 4ED1A 1XTIA 1FMFA 2F44A 4KYVA 4J0HA 1IQRA 3K2QA 4R9UC 3EA4A 4AJ9A 4M8KA 5GINE 5EWJA 3VRHA 3VUEA 4AKEA 3VV2A 1EEXB 3NHFA 3G9ZA 3KWFA 1S7GA 2ZTDA 2ZUUA 5E3IA 1FP2A 1WDLA 2GEVA 2NU7A 4NZYA 5BSEA 1IPFA 1BVYF 1Y82A 3H2BA 1NLZA 2R6JA 3RAFC 4AN0A 4EW2A 1NZFA 1C3JA 2ASEA 4KLZA 4JHXA 1JDJA 4ZT7A 5J43A 1YR7A 4EI9A 3WGZA 3H97A 8ICOA 3V48A 2QDXA 4HP8A 3MTEA 3R0ZA 2JAWA 4YRRA 5J4YA 2IUFA 4PPQA 5AM3A 3H7AA 1C3LA 1IU9A 3DOFA 1X2EA 3EF0A 3N2GA 4JSYA 5FPKA 2XT9A 3O4HA 1MCZA 4MMXB 4PAGA 3I3SR 1JEQB 2G5GX 2AOUB 2E1PA 1W4ZA 1WEHA 3CZAA 3KXDA 3C1OA 4I1UA 3LBAA 1CUAA 1XDZA 1HT2E 2KLHA 2FDCA 4MGZR 1T3NA 3TW4A 2OBLA 4LI0A 1O54A 3ZHRA 1VJGA 4EJSB 2Z2YA 5DLPA 3BX1A 4KNVA 4QBIA 1N48A 1J2RA 3IV7A 4X5VA 1IXSB 1FFCA 2J3MA 4U7FA 5G41A 3ZX4A 4DLLA 3DD1A 3JAKA 4ZEVA 1OJ7A 1H4SA 2WA2A 1N2SA 2QLNA 1JDPA 1YKGA 3TBHA 1QHEA 2V4QA 1FVHA 3PXGA 2IYXA 1XVLA 2VT7A 1VHWA 1J99A 1T9GR 4IQ8A 5CM2Z 4B9AA 3L7DA 1QX3A 5JY1A 5LMNB 1PUXA 1ZU5A 3AETB 3GJZA 1PFWA 4NG5A 5JNRA 1S77D 3BB3A 3GJTA 3OCWA 3OLZA 2DVMA 4MWDA 1EE9A 3PNLA 2VTBA 3QI7A 1US8A 1FPMA 3I4CA 3TSCA 2MUTB 4F4YA 1QJ4A 3LDFA 4BEWA 4ZICA 1AB5A 5FR2A 4KO4S 4LV5B 3L7KA 3ZUGA 3B1ZA 1YB2A 5FCDA 3H11A 9MHTA 1KKMA 3NUZA 3P7MA 3GQCA 1UOOA 2VNIA 4A16A 4CDRA 4OBBA 4L5JA 3RJIA 1DDIA 3B7GA 2OV6A 2XPCA 1CFJA 3G82C 1V3UA 5AOVA 2NRWA 4EJ2A 4C01A 2RHLA 2YYSA 3KELA 3PT9A 5AXBA 2ZYSA 5IAJA 1ITZA 1GAWA 2DUNA 1YZKA 4I4CA 3QZ8A 2NO7A 3NXKA 3SHOA 1JHVA 2C9CA 4XCVA 3X3HA 5ERYA 5U1PA 1QE0A 4QTXA 3N76A 2F64A 4U00A 1Z4JA 2YRFA 4QLAA 4DOAA 2A9KA 3HPQA 4RKFA 4WDQA 1ZQTA 3RV4A 1NK0A 2WWRA 5KAFU 4FIZA 2PMCA 4RY8A 1GL3A 4IW3B 4UPVA 2P9JA 4B1FA 2YWXA 5F3XB 1X7XB 3EVGA 4Z1OA 5IG2A 1DJMA 5FI3A 4Y1GA 1KKUA 2PGXA 3K9HA 3THXB 2NO5A 4L1KA 2NU6B 1RADA 3M4JA 4I3FA 2GTIA 4L0QA 2Q5CA 1ACMA 4GLBA 1C7QA 5T7BA 2DGDA 3QHAA 1AS2A 2D2EA 4QJ4A 1NU6A 4U63A 4C4YA 1P9NA 2OA0A 3GRZA 2XVXA 3BH0A 1I1QB 1VG9B 1SV4A 2BCGY 4US1R 1F7UA 1D7OA 4FZ5A 2DZDA 2RHTA 2CK3D 1RHKA 2JGMA 1RLMA 3DBHB 4FR5A 4Q18A 3TLMA 2Y6VA 1WCWA 4REQA 4DV3B 3B82A 1SXIA 1KC3A 4BMDA 3RUHA 3U9SA 3GJ7A 4KE7A 4DNOA 1FNSA 3RANA 4CDNA 2RGNC 2H7CA 3DLCA 4G1CA 2V6IA 5HJ5A 1OFUA 4J0EA 5EHXA 4RGVA 4D74A 3NNSA 2GHTA 4MKXA 2DULA 1CEQA 4Q9HA 1PJRA 3DTVB 2AOTA 5HK8A 4DMCA 1FL9A 1D0IA 4YR2A 1YDFA 3GZNB 2EKQA 4JOSA 5FUWA 2QU8A 4KLIA 3OIGA 2C03A 1RRMA 1SC3A 1M2OA 1IONA 4PQEA 5LQAA 4DV4B 3FR7A 2CV0A 3LA8A 3I6MA 1KQGA 1BKYA 5GIPE 5JECA 1ZGAA 3S8YA 3UKJA 2ZQ5A 3EYZA 1IY8A 1PFKA 2ESRA 1RXSA 2IYWA 2Q50A 4J8PA 3LS2A 5FT9A 1UJ6A 4NAUA 3SZMA 4BUZA 1A71A 4LIPD 3JVUA 1TT5A 2XLBA 2HU7A 3ZR4B 4ZI7B 1P62B 4X8HA 3AEXA 2JBWA 3LUBA 1DRVA 5CNKA 1J9EA 1YVDA 2YCLA 2GKSA 2FWJA 5E6UA 4DJDC 3IBCA 2C59A 1SU4A 4ZDWA 2FPRA 4O4JA 4OLHA 5HZMA 3EMVA 4FFRA 4BBAA 1D8LA 1VP3A 2ZYUX 5HQ3B 4DA0A 3C1UA 2R6R1 5CDSA 5JDCA 1XRSB 1L3SA 5DBEX 4I1VA 4PSDA 2POQX 5KVQA 5HQJA 3WK4A 4LYJA 1OXVA 5EEHA 1Z2AA 1E9BA 4YK7A 4G0WA 3AL0B 1NXWA 1PN3A 4EFLA 4IR9A 1MJ5A 1UC5B 3SZ2A 4I5EA 4QXPA 3ZWQA 2G1UA 2HBJA 4MQ4A 1Z15A 3U4QB 2JF0A 2ZUFA 4N48A 1TVMA 2P2ZA 2GRJA 2IPAB 4PR3A 2IUUA 3OF3A 3EGCA 2OAQ1 4ZAXA 3SQDA 1Z68A 2QF7A 3SZ3A 4J16A 1R5BA 2CJPA 2HHXA 2OG2A 1YB7A 3HDYA 4KQGA 3KG2A 3AEUB 5KX5A 4KR0A 1QVRA 3W6PA 4UDNA 2ZANA 2P6UA 5AM5A 2DUJA 4YX9A 1U28A 1XWLA 5IK2A 1VSBA 3ROMA 2YN4A 3LPDA 4LS3A 3TL6A 1OE0A 3VI3B 1LLUA 1KY2A 5GWXA 5KBYA 4I4NA 4EPVA 4OK3A 1AHHA 4C4RA 1LI5A 4BHTA 3AEKB 1SCUB 1JXAA 3MJSA 4UXJA 3WDMA 5MN5A 2JMGA 3WL7A 1PJLA 1GQSA 4L5AA 4E3ZA 1O0BA 3GFPA 4OHBA 5GM1A 3AMZA 3NHPA 4KO8A 4KRGA 4QUGA 4BO5A 3FDIA 1Q1AA 3JQ7A 1ONPA 1V3QE 2F76X 1CLUA 2QX8A 2Q8NA 4PQRA 2PTHA 2PMEA 8MHTA 5TR9A 4BNZA 4M54A 1JEAA 4PHCA 2L5YA 3LECA 1HY3A 1JXEA 2CN1A 2D06A 1CIVA 2Y3IA 4GM0A 2VDVE 2W2TA 3SQOA 2ES4A 4W4TA 3WHKA 1XNHA 2BZGA 3EA5A 3PXEA 3FTNA 2BFEA 4C3OB 1XRLA 2VRCA 4NEGA 2AEFA 2H2DA 2DF8A 3DFFA 1H3NA 4UM8B 1JIUA 1TTPB 3L41A 4D56A 4IUDS 1TCBA 4UBIA 1KPIA 1UAGA 2NP6A 1Y8CA 3DXZA 4MSUA 1XRPA 3FE2A 2B21A 4YDSA 4K8OA 3CKYA 5KQMA 2VJPA 1EDOA 4RQ5A 2IGTA 2IYEA 2YRXA 2HO5A 3KZVA 1XQ1A 2O6LA 3E03A 3QEMA 4RYDA 4C7BA 4LQLA 2QG9A 1X9WA 2CHEA 2RBKA 3I9NA 1H4QA 2NZXA 1Y1LA 2QQ0A 1E6KA 3GRCA 3H1GA 2EP5A 4O2LA 4QYMA 3V55A 4BUJA 1YFLA 3DZDA 3KBBA 3IE0A 5LD2B 3GAFA 1VQ1A 1RLOA 1SBIA 3PW4A 1WMEA 3ER6A 4RUKA 4U6QA 1W36D 1E6MA 2R9VA 4EZ6A 2VUUA 5HHIA 5TV2A 3WYBA 2WSLA 1XGKA 3PGJA 4O2BA 4HEA1 4X1IB 2RH8A 5KYXB 4IILA 1OWNA 2IV7A 1NVEA 3CRQA 1DTEA 1ZRMA 1B76A 2WR8A 2WNSA 3HWSA 4DUGA 1OAKA 4KBFA 1QCZA 2FPXA 1KFBB 1M2HA 1E8NA 3O0FA 4OBEA 4R1NA 4D8YA 1BPYA 2UUOA 2WEKA 1GNTA 5KFDA 2PZAA 2B7CA 2Q49A 3CXRA 3DMHA 1ZQWA 2P66A 3LQ4A 2FEOA 1OD6A 4D7AA 1D9FA 1TQ4A 3DMTA 3K1YA 4GQIA 2HSGA 5DLQC 3E6AA 2NTVA 4UUMA 4KWTA 5F23A 1BNPA 2VJCA 1FDWA 3GGSA 2WPNA 3IAS6 1ECPA 4CCYB 4PN7A 4J9VA 4AFNA 5JNSA 3N7RC 1L5SA 4F5RA 1UBCA 5IINA 4O2RA 2V9PA 4RH3A 7GPBA 3E70C 4UB2A 3BS7A 2RARA 3PQ3A 2BV3A 5FLYA 4D9JA 4XPIB 3KHGA 3IKLA 4JEMA 2AHOA 3TX2A 3GLFA 4DEVA 3GILA 2W4IA 1CQXA 1S9DA 5EJFA 1U1DA 4QZIA 4ND1A 2QTCA 1JL3A 2C2HA 2R85A 3BCUA 4KQMA 3ZDXB 4ZYXA 4EEKA 1FSPA 1S8NA 2D5LA 3MF4A 5B6IA 1G20B 1II0A 2GDJA 1RAEA 2ZJOA 3HU5A 5BSFA 2W6OA 1VBNA 1N2CB 3L4PA 3FC4A 1FCJA 1CQJA 2H06A 1N2OA 2M1XA 3GT7A 3WDLA 2Y6UA 5DSXA 3V6HA 3QA9A 4P2GA 4X66B 2WWXA 2DR3A 1DT3A 3B1XA 5EJAA 4KRXA 5AKJA 4RQ3A 3NV7A 4F2HA 1NK8A 1M8JA 2VH5R 1IL0A 1XZLA 4IRMA 3RLIA 1V95A 4BLRA 4DXDA 5LWHA 3JS5A 4P93A 5YASA 3RVSA 1PJ3A 4J9KA 2IV3A 2EFGA 4EVSA 1X6IA 4GGMX 3MTGA 1KOLA 4BOYA 3DFUA 2K7FA 4F4FA 3MWKA 1JWLA 2WHYA 2R8XA 4CMIB 4JVMA 1QF7A 2ZWVA 4XTRA 2YWDA 5L7YA 1OHHA 5A0LA 3C8DA 3K8YA 1EGMB 1N0UA 2WHRA 5HKLA 4DWWA 2QDKA 5C8DA 2BGLA 3LVQE 1KYXA 1O8CA 1RPNA 3PZPA 4KLCA 3SSNA 1G42A 2DPLA 2OUIA 5ALUA 1NKCA 4QZ8A 2HXGA 1MA7A 4GL2A 2RONA 3X1WA 1KJJA 2ADFA 1IN6A 4DABA 2FEWB 5FNVB 2VXOA 5G02A 4M9SA 3RSFA 3PFNA 4AN1A 5KFWA 2WT9A 1ZQ1C 4B6RA 4JVLA 1X15A 4JLVA 1QG0A 4EI8A 3BSWA 2OFPA 3LBFA 4KPFC 3D0RA 1BC5A 1XMQB 3D0OA 1OAAA 1V8OA 1U4SA 4FUTA 3WMWA 3C3PA 4ESVA 2JD2A 4O4HA 4R8UA 4HNAA 4LZZA 2H07A 1L5ZA 3L4SO 3LA6A 3OQBA 9ABPA 5HUJA 2D3DA 5JC1A 3E48A 3J81A 2WTFA 1Y7HA 5D5HA 3R6DA 3U7HB 3ZDYB 3CB4A 5C8VA 1T2EA 5IYZB 4JLAA 3OSPA 2YOGA 3C5GA 4MQFA 4D44A 4KC0A 2OXIA 4LWQA 1TQDA 1HV8A 4UJ3A 1PJ2A 2WE8A 3CX8A 8ICXA 1D09A 3H65A 3JD4A 4U9HS 4D6YA 4B2PA 4ALMA 4HFRA 2WJ4A 5TDHA 5IC4A 2XYRA 4NF2A 2HW8A 4ZZ0A 4OF4A 3KHRA 5H3CA 1HTBA 4OXKA 4BZZA 2OSVA 2DUMA 2Z8XA 2QVZX 1XZHA 4CODB 3KLMX 1CUGA 1FQJA 1LS6A 3T9DA 1J2TA 2N3ZA 1VE7A 2AN5A 1G9TA 3HBNA 1M2GA 1TVCA 2BP7B 2J87A 4U7JA 1PVVA 2AG6A 1KFDA 3AL3A 3LC1O 4D9CA 5KQGA 2O19A 4RK1A 4BZXA 2HQBA 1D6SA 1I80A 4K6HA 1KMCA 3VAZA 1XEXA 5KWSA 2DB3A 1W0JA 1MB2A 5AI6A 2INGX 4LRWA 4DMGA 2AQKA 1NSTA 4O4IB 9GPBA 1R15A 3Q8XB 1AG9A 3CQ9A 3OOYA 3L4JA 4ZCMA 5B66U 4Z4IA 3MG9A 3U7RA 3QBEA 4DLRA 1BO6A 1TRHA 1XZDA 3E7PA 3LM8A 3NW9A 4M7RA 2ZSKA 4GYYA 4NI5A 1UFKA 3PCRB 5I45A 1U98A 3WIDA 9ATCA 3K09C 2C54A 2R7NA 3FW1A 1Q15A 4V02A 2K6GA 3OFNA 3QV2A 4C8KA 1ECCA 3F3MA 3HA2A 3M33A 2ZJ2A 4GVXA 2WJZB 1KPHA 4DY6A 2V9ZA 4QTUB 1SUBA 2KLBA 1R18A 3O2JA 1FTYA 3HJCA 2Y68A 3NTXA 4ZCRA 5JAOA 2C42A 2G0NA 2I3AA 2PFQA 4BWGA 4GSKA 1HFJA 1UBGA 5DHFA 2ZCJA 1KSPA 4JGBA 4YY3B 4R69A 4LVCA 4PSAA 4C21A 5EC8A 3ACDA 3PHIA 5KYXA 2Q4TA 4J9SA 1DC5A 3ZDDA 3KPUA 4NBRA 2JCXA 5F5XA 4FZNA 4N5LA 3W5UA 3WIEA 4C78A 4ZYYA 5B30A 2IHJA 1X2BA 5LA6B 1TF5A 4IVQA 2XYPA 4CM8B 4MEBA 2G5TA 2G9NA 5JADA 5GTIU 5KYKA 2V5AA 3OEED 2A35A 2EX1A 3U49A 5DTRA 4WKPA 2PQ6A 3PGKA 3EAGA 5CEJA 2MSEB 5K0GA 1D6JA 5EWGA 2K4IA 2V7XA 2QRJA 4TWZA 1KJNA 2ODEA 4MW4A 2O9JA 1OLXA 4NABA 1CUUA 2RHCA 4OQFA 3O90A 5EE1A 1T8EA 3SPXA 2HBRA 4GD3Q 2DPYA 3MCUA 4J0JA 3VH4A 1DKPA 1X7GA 1P2BA 3C3KA 3EGXA 2WM3A 4NAHA 3OECA 3LT4A 2ZW9A 5CK4A 1KAOA 4C7OB 3UFXA 1L6NA 2V8OA 3D3NA 4A1OA 4CF4A 1IBCA 1MB3A 1YF3A 2CVPA 3HCDA 2I29A 4B9UA 3NU1A 3FYSA 2H2HA 1R6VA 4QODA 4KCGA 3E9CA 2J41A 4F2PA 5BSTA 3SIRA 4DV1B 1WNTA 1NTOA 3FMIA 4B81A 3O8CA 4HQLA 4DSIA 5EP1A 5LKAA 2C3YA 3M1AA 4BB0A 1QIKA 2W8BB 4X3OA 4Q21A 1MDBA 2HK6A 3T3FA 3BXZA 1QO0D 1LQUA 1TA9A 1UMCB 1XWFA 2Z5VA 1DFHA 1H1DA 4KXMA 5KFVA 3RU7A 3ZKAA 1QCYA 5AHXA 3QKRB 3ZBQA 3JR3A 4JUDX 16PKA 1ZK0A 1JQ5A 3ESDA 2JI6A 1ULZA 5D7NA 4TYWA 4KTTE 3BZUA 2NV2B 2VQSA 1D2MA 4IKEA 5F2OA 5G53C 4JV5B 3L7BA 4N03A 4AP6A 1DK3A 2ZIUA 4O02B 4PM4A 3AF6A 5IDVA 1ZEJA 4OU4A 3K0HA 4BE9A 2AIRA 3VU1A 2Q3BA 5KT6A 5JNLA 1YE8A 2CVHA 2JEIA 1PDVA 1QSSA 1VCHA 1T43A 3ISBA 2I5HA 1BXKA 5FBRB 5FA6A 4DBVO 5COQA 1FDUA 3PFKA 3TLKA 3DONA 4U7DA 5BNWA 4PCAA 1G59A 5KNLA 1UIRA 3P8ZA 4ER0A 1ZOPA 3GVHA 4FW9A 2AGVA 2UKDA 1FRVA 1JYFA 2XRYA 4HDRB 4PC6A 4YCDA 3CR7A 1N5JA 1W5TA 2ECQA 2MSCB 2OGSA 3GBPA 4LMRA 5HGXA 6AT1A 5L1KA 2AI3A 2VTVA 2DQZA 2PT5A 2WSIA 3MTQA 2RHGB 3HHEA 1W49A 3E84A 1W85A 3JQCA 1D9ZA 1UBHS 4QXMA 4JOQA 4X60A 1JMKC 2AOWA 3SXJA 1HURA 4RHXA 5LXTF 2UU9B 1PVOA 2HA3A 1Z6GA 2ETVA 1U0SY 4IDAA 4UU0A 3ESAA 5HIKA 4BVAA 1AX9A 4RQBA 2E4ZA 4UD2A 5BPFA 4KDRA 1KSFX 2E49A 3TRDA 2PT9A 1L8LA 2FLLA 3EVFA 1XLWA 4L3VA 5CR9A 1UT5A 5F5LA 5I7VA 4P83A 3ENNA 1I2BA 3U13A 1LNQA 3SYMA 5IT4A 3M8RA 1GFZA 2B37A 3C98A 2YWJA 5T4HA 4URUR 4YXWD 5AVYA 4DS5A 4Q00A 3IQZA 1QFJA 3BMOA 4WK2B 4KXYA 5B4TA 3L49A 4FE4A 1GGHA 3D6AA 5CXQA 4N65A 1Q11A 4ZT2A 1HLFA 3IQEA 1M75A 1RRKA 3AWDA 3ODGA 1BWPA 2ZPAA 1YOBA 2ADMA 4HUQB 2WAQC 2ZTCA 3K1RB 1BU8A 3GEHA 5AJHA 4YMIA 4E1VA 4EP1A 5K8TA 3BIWA 3A06A 1R8YA 2FZVA 4NZZA 2IEYA 3FYUC 2GBPA 4H7FA 5F7ZA 2Z56A 1SOVA 3MRSA 2OO3A 4QYWA 4EITA 4TGLA 5FBLB 5DNCA 3PQFA 5EVCA 2VHEA 3T5LA 3GBSA 2CXUA 4L4SA 1DRGA 5EIFA 4UTRA 3ESQA 5TX7A 3V4VB 5CDFE 1SHJA 3SIPA 5L40A 3IHQB 1EK6A 2P9YA 2R87A 4RFSA 1G6HA 3NJ4A 1WWUA 2X19A 1MKYA 4M9RA 1P2VA 2JHAA 4Q4AA 3ZGLA 1C0LA 2GPYA 1JFFA 2DHEA 1PJQA 1V45E 1LGYA 2C2DA 1V96A 1TYEB 2F3NA 4JB3A 3B3JA 3KKQA 4EVIA 2PLFA 3I73A 4E2XA 3QU2A 2C2WA 2HN9A 2QRUA 3C4QA 1PEYA 5CTAA 4H0NA 2QB0A 1IG6A 4UHCA 1QWOA 2IYLD 2OVBA 4N49A 3RGGA 3VZQA 3WO0A 4D3DA 3P9KA 3TLJA 2R00A 4F0JA 3K70C 2A3NA 3A7DA 1G21E 3K31A 3S6JA 3Q7QA 4GF5A 4ATNA 4LZDA 2BJVA 3K9WA 1ZJNA 3BWEA 3MLBA 2QJTA 1DO2A 1M2JA 4PN3A 3NAQA 1TZJA 4DLKA 2OCIA 1P5FA 3GD7A 4E33A 1XVVA 5KU7A 1C9NA 1N7JA 3EF3A 3KSRA 1B42A 1LJLA 3O9ZA 3V8EA 4R8KA 4IUCS 3AETA 4M38A 3BIJA 4FS1A 4UASA 1D03A 1KYWA 1XRRA 2BFFB 1Q3TA 1QSYA 1N3BA 2P9BA 3P9YA 3BAFA 4H0FA 4DANA 2YB4A 3LE8A 3WYEA 1P61B 1RZ3A 3LZ6A 4KTVE 3PRKE 7ICEA 2LV8A 3MTAA 3OOJA 4IYRA 2CFIA 1DPGA 2QMOA 1XAGA 1AMUA 2X2OA 3OY2A 2VT3A 4I2VA 1LKZA 1OFIA 3FM9A 3FOBA 1E60A 5CM9C 2FWPA 4RAQA 3I3OA 3NTQA 4JP3A 1LX6A 4RVFA 1VCNA 4LVSA 1C81A 3D6HA 3FPAA 1W96A 4NNPA 2VF5X 3EDRA 2B4AA 3COPA 4MI9A 4RPGA 2HPZA 4KWIA 1DIOB 4BVFA 1F8UA 3MMSA 2WWGA 1GRQA 1MTOA 4BV2A 5BORA 4FZLA 1QIDA 2IPLA 3STUA 2GM9A 4JJKA 3EBOA 5EXDA 5C7IO 1EHYA 1Y4AE 3OEHD 5AYVA 3KC2A 4B3DA 1XLUA 1ZDMA 3NHUA 3DTYA 2DFVA 1GO3F 4IIDA 4DC1A 3UXOA 1T36B 3ZHBA 1X1CA 1XQVA 1Z2OX 1SC4A 2J46A 2OXFA 1I5EA 3D8TA 4WXRA 5C7OO 4DXAA 1XEFA 4YC7A 4N6GA 5JSKA 4IS3A 2O5CA 2PAFA 3FBWA 2VQ6A 3PXXA 3R40A 3U62A 3V2IA 3WYCA 3PYMA 4JLKA 1N6PA 1W52X 4F97A 1W44A 5LLDA 2WYWA 5KG2A 1J1UA 2PWPA 3PGLA 3F2VA 4CCHA 3Q7IA 1JDBC 3HV0A 1VSQA 1TZKA 2JGNA 1ZUWA 2ONKA 4RD4A 3ZGOA 1C7IA 1HMYA 1R27A 1GFWA 2QAGA 4GX1A 1JI0A 3D2BA 5DVZA 2FPKA 4WKBA 1A6SA 5AJTA 4ZVKA 3D0QA 2CLKB 2OTCA 3EUEA 4Z2YA 2PEYA 1Z5VA 5I7OA 1D1SA 3TL3A 2OCKA 4AROA 1Z33A 3IYLW 1F8YA 4CEHB 2PS3A 1OX6A 2RGAA 4CV3A 3QYPA 4D8XA 2I1WA 1RZTA 3CVYA 4O4JF 2BPCA 2FR1A 3RUFA 2RP5A 1RHRA 3KEMA 2JLQA 5JJ5A 1O5OA 4YQEA 5JSZB 4C4SA 3IXLA 3R0XA 4P2HA 4KR2A 4R2XA 1JUDA 1HM5A 1VL6A 1WB6A 4RVUA 3HUUA 4RK5A 1EVIA 1WULS 1NBWB 2AXNA 4PYKA 2HWUA 3SBEA 3MCVA 3R3YA 1RPLA 1HFEL 4RTQA 1DAMA 1ZVKA 1IAQA 3M4YA 5EERA 1ZM3A 3ZJYA 4RQ7A 2IS4A 4G5FA 4PHGA 4MS3B 3TOCA 1QFZA 4LGCA 2ASJA 1ZJJA 4N41A 4TZ6A 1WRBA 3ELWA 5JCJA 2D5IA 2FUEA 4QZCA 1NQVA 3L0YA 1NF8A 1Q19A 1HYHA 1TI7A 2CMHA 5CM8B 5IVPA 1FBNA 2XQKA 2DECA 1EGVB 3HMQA 4WV3A 3DBOB 1MQ3A 1EDBA 3DOCA 4B8YA 1TD1A 4RY2A 2LD4A 3EZFA 3FOAA 2H1IA 2Y9UA 3KQSA 3RT9A 1J0XO 2I2FA 1N2GA 2VSQA 3T38A 3IVMA 4RH1A 5KFNA 4M22A 4C80A 2XVTA 4FYKA 4G9BA 3R3WA 4RKQA 4E3WA 4F5PA 1GPUA 3R5SA 1BVRA 3DNFA 4RK0A 1T2FA 5JS8A 4F4JA 2O0HA 3SJBA 3PSIA 3T7AA 5CXSA 1DGQA 2B8TA 3Q6IA 4LYEA 1U31A 2VWPA 3GYGA 4JELA 4IDDA 4B5KA 3W8DA 2QYSA 2EL7A 4Y67A 2AFVA 2WHXA 1VSTA 2RK3A 5BWBA 2ZM5A 3CVVA 5D49A 1Y48E 3CKLA 1FMCA 1QH0A 1O94C 4U9UA 2W9AA 2M32A 5CVDA 4BNUA 3OURA 2GZDA 5IVHA 1P7YA 2NZVG 4CGZA 1SUWA 1SXJB 2W54A 3PO4A 3PXCX 4U39A 4MFCA 2XWJI 2RHOA 2I7DA 5EWEA 3MB8A 4I1IA 1IHDA 1ND5A 1PR2A 1XRMA 3LQRA 4OHRA 5IBPA 1QH9A 4RQ4A 2IXFA 3WNQA 8ICPA 1XCLA 3RYIA 2BSQA 4YI5A 2OAP1 4HXFB 2XLCA 1KEUA 4QOFA 5JBQA 3BMQB 2WHPA 1K6EA 4TX1A 4EZIA 4F9EA 4ELUA 2H6EA 2NV3A 2IOQA 5B2ZA 3U3JA 4BB6A 3KXLA 3NHAA 1WSBA 4R1QA 2NU9B 1K0UA 3TCKA 4F12A 4AG6A 5AJUA 2FUG6 3SG0A 1D4ZA 2H1FA 1X7DA 2J4CA 1ST3A 3E23A 4I2HA 3AP1A 3HU2A 4OEHA 4P08A 4QGGA 4QU8A 4TTQA 1P4SA 4E5MA 8ICGA 1Q57A 4TPKA 5BNIA 3WRXC 1U2GA 1V1RA 1JX4A 1PZMA 1UJNA 2WU0A 2XMBA 3BZBA 1ZCAA 2KSQA 3IKMB 4NMMA 4TS1A 5H5JA 4TS3A 2O2HA 2BJHA 2IIBA 3RUIA 4EG4A 1BN6A 4FFSA 5JDIA 3S2FA 5DB6A 2XGSA 5KT7A 1AURA 3ZVKA 1ZK2A 3FBTA 1QGUA 4QBHA 2Q0QA 2C7OA 3BFKA 3T7TA 4OBXA 9ICWA 1RG6A 4ZO7A 4MW2A 3FOZA 1Q20A 5T8KA 1XVIA 2ZPUA 3DMGA 2HU8A 4H1UA 4Y2QA 4A0RA 4OU5A 5U4QA 1MOSA 4R84A 4KN8A 5TLSA 2HRBA 2R97A 5EMMA 3WHIA 4OJLA 4D3FA 2BKVA 2CNWA 4OOEA 1E6UA 3HI4A 5FOWA 3VKWA 4DCUA 9ICQA 1XTPA 5EIWA 4Z7OB 3SM9A 4AUMA 4QWEA 3RUCA 4I5GA 1E1QD 3OE1A 4RYLA 2PKRA 1SAYA 1ZWLA 3RIGA 4JYZA 4Q3NA 2OD7A 2IX9A 4NCNA 2GEBA 5IDWA 2DKOA 2FJ6A 5FAXA 5CDFA 1TMKA 3NOOA 4JC0A 3RFTA 1ORRA 1MGPA 2PD3A 1F0KA 4KLNA 2D5CA 5NLLA 3RJMA 1FTWA 2ERYA 4ZKEA 4JSTA 4JHLA 3IA7A 3LCMA 5JYEA 4ECWA 2AQIA 3D4IA 3T9BA 2WTEA 3NHSA 1IATA 3ZH2A 2F4NA 1I0IA 2XODA 1JA1A 8ICRA 1Y5IA 4ZVPA 4UKDA 1CDEA 3F71A 3MD0A 3VR5D 1EK1A 4ZEMA 1YRAA 4J4BA 1PW7A 5CNJA 2PXAA 2JFGA 5DHSA 3REFA 1RKBA 1Y80A 3UUWA 1TIPA 1SCNE 2CE7A 4D5EA 5DISB 3DC2A 4LC9A 1MA3A 2E87A 2Z3VA 2ROQA 5JASA 4TROA 1A88A 2XT0A 3WGLA 3JZFA 2IU4A 3DBHA 1CT9A 2I7VA 3C48A 2VN8A 5C5CA 3MGIA 2NACA 1HLGA 2IFTA 2LDXA 4LJ7A 4ZOHC 1V9LA 4OB6A 1SIJA 2FWIA 4R9SA 3IOMA 2W9CA 4CCAA 3VYRB 1V16A 5L1LA 5DHRA 2X22A 4FILA 3OPYB 5HSGA 2FW7A 2HA7A 2DR2A 2A1TS 2EU8A 4PPYA 2AOVA 1HH4A 2XGOA 4RHFA 2AOTB 4X54A 2C2BA 2PUHA 2WA1A 1HJPA 1YGPA 2FN8A 4LNHA 2H63A 3D9QX 1WDWB 4LHWA 1JHPA 3TADA 1MOQA 4R1OA 3T4UA 1RFLA 4AWBA 2B25A 1BXRA 4MRSA 1SO8A 4US8A 4LVNA 4W8GA 4HF7A 4B17A 4ZKDA 3FMVA 3A9UA 3U2QA 4PXAA 1T9KA 1W88A 5CWRA 1N2CA 2OLEA 3M4XA 2VDLB 4LE2A 4ZVQA 1CQJB 1X7ZB 6GPBA 2IH4A 3VU9B 2XMCA 4HMPA 3STYA 1QVZA 2YINC 4WDRA 2GJAA 1MNQA 4E0BA 5I8WA 5HM8A 4IOJA 1LEHA 2QP4A 2WF5A 2CMDA 2HGZA 2ZYIA 4GBGA 3RC7A 4GI1A 3U9TA 1H9AA 1CK4A 4NP6A 2BR5A 3FCUB 3M5DA 2OVFA 5FI5A 3LD9A 4DJ5X 1TK2A 4XQ8A 1TKAA 1Q0ZA 3GV7B 3LP8A 5IC5A 1TAGA 3GQBB 2FHPA 4MS3A 3OCCA 4M6WB 1TMGE 2CZCA 2WZDA 3DAHA 3OIFA 1EA7A 1KEZA 3CZQA 3WBBA 4UOZA 4K9RA 2QTLA 5A7HA 4QNLA 4W1QA 5I9MA 4JBWA 2Y9MB 3ZY3A 1WTCA 5KT4A 5ALPA 1B2RA 3JQ6A 3SX4A 1QRTA 3A70A 1VKHA 2B4KA 3SXUA 4EATA 3PNQA 4WGFA 1KO5A 5TGDA 5HFAA 5EFOA 1Y9ZA 2EZZA 2HNBA 3E4CA 1AGRA 3KB8A 3WL4A 3I1FA 3CWQA 4R8SA 2LP4Y 2OC9A 4IGFA 1JMSA 2FRVA 1J5PA 4KSYA 5LUAA 4HDKA 1L8OA 4RJLA 1DC4A 4X61A 3TM5A 3M6VA 5ENDA 4NPHA 4CKEB 3INRA 4BS9A 3LL4A 2BMVA 5IT9A 4OBWA 4UVIA 1T9HA 5KFQA 2V97A 5KMGA 2BMWA 4TLMB 2OHGA 1JR4A 3C8HA 4V24A 3OX1A 2DERA 4DR7B 2GXSA 2VYVD 1L7VC 2FWMX 3C7CB 1U9YA 1NXSA 4JV1A 3N87A 3UTDA 3D8SA 4RLHA 2I9PA 5ALQA 2I99A 3O0DA 3LC7O 1YS6A 1H0SA 3PQDA 4FCWA 4EW6A 1T0IA 1FTNA 4EVQA 2AG8A 2R5NA 5DBAA 1NMXA 2OQVA 2WSSA 2JXJA 3R5XA 4AL4A 1E2LA 5IHXA 1WXWA 1V1MB 1C4WA 4LECA 2WV7A 3A11A 2EJTA 1L5UA 1ZD8A 1Q44A 3LLUA 5J0TA 1ZA2A 5B64A 2XMPA 1I0LA 3AT1A 2ONZA 3EUWA 3HKEA 1JI7A 4GM1A 3NKLA 3UMMA 3K0FB 4FT2A 4GT1A 4XD7A 2VYVA 3ZXYA 1S2NA 3WB0A 4BPBA 1WETA 1N3YA 1OVMA 1NRIA 4M1MA 3WRYC 5KG3A 3ZWBA 1NF3A 4I9NA 5L3ZA 2HBZA 4XA5A 3LZCA 3I2HA 4UCFA 4EHNA 1UM9A 4BBPA 1VMAA 1V8DA 2I7TA 3T9AA 2I6TA 3RTGA 2D0IA 3WYNA 5JQGF 4ZIRA 1ZIPA 3PSHA 4IXMA 3JALA 4AS2A 2XCQA 3V6JA 2XICA 2BBTA 2ZE7A 3A4VA 4FBGA 3TB6A 4BFCA 4NXNB 4P7JA 5LP6C 1FVXA 5IVIA 1NQOA 1L8QA 2GQ0A 4QHTA 4PHTA 1ZJ4A 1QRDA 4DR1B 3NMUF 4JNCA 1I2MA 3ZDAA 1K66A 3SS7X 4I4IA 1UBLS 1USVA 1E59A 1C30A 4JENA 4EO7A 4B9TA 2HRZA 1QC5A 3WTCA 3H05A 2PMFA 4YB8A 1H2WA 1LQ2A 3CUUA 4LGMA 5EHNA 2P2SA 5CH3A 3RBZA 4FINA 1XNSA 4BEVA 3DSRA 3CNBA 3MR6A 5DYTA 5DNYB 2P0EA 1V5FA 2GVDC 4TKLA 4YAEA 5I7FA 1UBOS 4ZQEA 5ESDA 3TI0A 1R4MA 4PZCA 4QG7A 3U4AA 4Z4EA 1X6VA 4JBHA 4KFUA 2O57A 2WF9A 4KJXA 4CTKA 3VO8A 1VSUA 2C8KA 1EE2A 1JSCA 4NULA 1EFCA 5F1YA 3SSMA 1N9GB 1M7GA 2XXJA 3JPSA 2VRBA 4QLOA 2ZSUA 5B7GA 1NUSA 4YJFA 5T6MA 1QUFA 3NUGA 3EAFA 1TQHA 2JGIA 2E85A 5TQ0B 3UPTA 1RWVA 4COOA 2RKWA 2IUEA 4FZVA 3C6ZA 2JRZA 3ND7A 4HTFA 2HCBA 4HNUA 1M2VB 4CKXA 4DLXA 4GZLA 2VSYA 5CNMA 4CM8A 4DCJA 3HNRA 2XGMA 3TKAA 5L53A 1UJ4A 2VWGA 4YLGA 4K4HA 1PWHA 3G79A 1HE8B 4QAJA 2FE4A 3HN7A 5TF0A 4I1PA 1NVTA 3I2JA 1QRSA 4Q1DA 2QJFA 3ZE6A 5LQKA 3CGWA 5GQSA 3C41J 2VP4A 4A5OA 3G0GA 4DMFA 4GYKA 1JKFA 2UVPB 3CH7A 3A6LA 3T1QA 1OPRA 3W8EA 4BLWA 2FQ1A 1OLUB 3KR2A 3L5OA 2XCRB 1Z6QA 3P2YA 4K4IA 1E4OA 2IODA 3C5CA 4N4AA 4YJGB 1JFTA 2H5XA 5CITA 1W9MA 1IBRA 2A0KA 4CIVA 1I32A 1PNVA 5I7WA 3KQPA 3QQ5A 5BN1A 2DY0A 1WOYA 2O3TA 1K7EB 4XR4A 1GYRA 4MPDA 5J59A 4HS9A 3C3XA 3EOBI 4GOJA 3TDNA 4QJ3A 3SV3A 2AHRA 2O1WA 3QVUA 2OXTA 4MEAA 1E9AA 3IOYA 5DPMA 13PKA 3RVKA 3TOXA 4EUEA 1DP4A 1MO2A 1OOEA 3HO8A 2D74A 3TH5A 5L3VA 4JZKA 2JIRA 3J81k 3IKTA 1PEKE 2GPTA 4V0OA 2XUGA 4YRFA 3WU2U 1VJ5A 1GGEA 1U7WA 3ASZA 1ZQFA 1BA2A 1O4WA 3PQ7A 3QXJA 4IHJA 4MHOA 5F78A 2X8AA 1QXSA 2E2WA 4UMDA 4XIJA 3UK0A 3WMFA 4DL4A 1OX5A 1Q46A 3EXG2 4RZQA 1AGNA 4ITRC 2R8HA 1RCUA 1W4BA 3GO4A 3LOUA 2XSZD 4I36A 1VGQA 1SZCA 3WKEA 5L9AA 4FKMA 5F7XA 3PX2A 4HAVA 3HCBA 4RA6B 3VZCA 3GC6A 4YP0A 3H40A 3TW8A 3SBOA 3X2SA 2CCJA 3NDJA 2DFLA 4LZWA 2WJ3A 1HQDA 3KXIA 2Q8PA 1HDRA 3L07A 2JI4A 4UM9D 2AX3A 5DHUA 1QP0A 5JJIA 1I8TA 2ZZNA 5DHQA 5DMHA 1WJGA 4ME6A 4RQ6A 2WE7A 5EUCA 5ED4A 2PGLA 2WQ6A 3AZOA 1CUKA 3KLBA 1ZOSA 4JROA 2BGWA 1N5IA 5E8JA 3T3HA 4AUEA 1MMFB 2RJ3A 5KTTA 3ETGA 2JATA 3S1AB 2ZTSA 3NASA 2R7LA 2DHCA 3PNSA 4UUPA 4B3CA 1ZGJA 1QYVA 5EP4A 1HETA 1RQXA 1KH2A 2VSNA 3C2QA 3CG0A 1B0AA 1X9MA 3OCZA 2PQ0A 4J49A 1DCKA 3KFVA 4OG2A 2Z2ZA 4TTAA 3VR4D 3K9GA 2LUOA 3ZWXA 2AXTU 5KSOA 2GN0A 3ZHYA 1XOIA 3E3NA 3I9FA 1OH5A 5EIBD 5J1SB 3DR5A 3JPPA 1UH5A 2F6RA 3FWPA 3TGLA 1CV2A 4EYHB 3TAHA 2WILA 4ZOLB 5JWHA 4B2IA 5AVWA 3V1UA 1LD3A 1P18A 4BKUA 3ABZA 621PA 2YJ3A 3SJZA 4EPWA 4ECTA 1ANKA 4B3GA 2C2GA 3JSXA 3EVZA 2Q5HA 1UDAA 4N8EA 2GEDA 3SQXA 1AKYA 5K8CA 1KDVA 4D9NA 1L3CA 5KOJB 3KTFA 2HWXA 5J2HA 4KLQA 1B1CA 4AMZA 4M0DA 2J85A 2ZPTX 4K6FA 3TZLA 1G5HA 3OFND 1GNPA 2BTQB 2G80A 2LNDA 4QDXA 3V00A 5KU1A 1ZW1A 1S0OA 2HM7A 1IVNA 2CF6A 2QN3A 3IE2A 4K86A 3U44B 1ND6A 1W46A 3WGYA 3ORFA 3OQHA 4QQFA 4YN4A 3DQZA 4UHFA 1QCKA 3WKDA 1SCJA 2QY9A 2YTUA 4K6KA 5HK9A 4H7HA 1W1WA 5EXSA 3LDAA 4ZT3A 2FSHA 2OBBA 4NBWA 4V0LA 4DA9A 4JLJA 4B4DA 4J9MA 4GZ3A 1A4UA 4KR7A 3KUXA 2AG0A 4OO1J 1C2TA 2GZHA 3WWOA 5IN4A 4OP3A 1KFSA 1J21A 1W76A 4I5IA 1ED1A 2XJ9A 3K96A 3H2SA 3HCCA 3L43A 3PHHA 4LI3X 4LV8B 2PI4A 4UFOA 4E15A 1BCSB 2HF7A 4Z86A 1D5WA 3CX3A 3I4FA 2O5EA 3L6RA 4I0WB 1NRWA 1QGAA 1IRXA 4PZZA 4JLMA 5LUBA 2W42A 1Q22A 2VP6A 4O59O 3AVYA 3AO0B 7ICQA 3MWDA 4PX9A 3UVEA 3C2LA 3AVVA 4A8EA 2AR9A 1ORWA 4TLEA 3KLOA 4WNYA 5DTEA 3M70A 4YFKA 2R5WA 1VFPA 3PIDA 4TUSA 9ICEA 1CCWA 2VPZA 5K8UA 2MU1A 2YV4A 1BS1A 1HG1A 3HADA 3LWNA 4AG3A 1G8KA 4CKCB 4PYLA 2ZEJA 1R5OA 3A32A 3FX2A 1ZMXA 3FG9A 2YXNA 3X43A 4PBTA 1NL3A 5EAIA 4KE9A 3EUB2 3TRFA 4ZCLA 1ADCA 3E3MA 3NVZA 1NNSA 3ZDQA 3BWYA 3HY3A 4KQKA 1NXVA 4U6PA 4ND3A 4PZOA 4QZ9A 1JHAA 3JYHA 3SEIA 1R0WA 1XKLA 2WY2D 4MRVA 4L0MA 1AVTA 1HDEA 3TACB 1P77A 1YV9A 1C7RA 2R66A 2X3UA 3Q0IA 2ZSHA 4KIUA 5CAEB 4BQIA 3SKYA 1UKAA 2AUMA 3DE6X 3VOSA 4C1NA 2NMVA 4HRXA 4P81A 3TD9A 2IYNA 3NHZA 3UQ0A 2XE8A 1FXUA 3TMYA 1WF6A 2PWAA 1R0RE 3FXAA 2NVUB 3U09A 1GPMA 3N07A 2IKSA 1Y8AA 1YR3A 1YU6A 2QLTA 1NM5C 2C4WA 2HOIA 2O20A 1J00A 3Q5EA 4FFNA 4BZWA 2XGPA 1K7YA 2C5GA 5J0SA 3JV7A 4UPDA 2KV2A 1ATIA 1RRVA 2BFWA 2BHTA 3LUCA 4Z8XA 1NT4A 2PKCA 3EDMA 4MS4B 4BLOA 1GKUB 5GONF 4H3HB 1HOXA 1TL7C 3ZV3A 3OP4A 1C3VA 2ZB2A 3JQDA 3PENA 4RVGA 4TT8A 5T3UA 4LFCB 3GU3A 4AY5A 1YJ8A 4S24A 2NSYA 1L5MA 2AWNA 2BKUA 3PWSA 4NU8X 3LFTA 4RW0A 1N0HA 1SHZA 1QBKC 2FSPA 4ZALA 3CLUC 1PS8A 3KU1A 3WYGA 5EJ6A 3IFSA 2GK7A 4RDIA 1J8DA 4L9RA 2NUPA 5HWSA 1QZZA 3KOZA 2BEUA 1MOPA 4MOWA 1ESCA 1BH6A 2UVWA 3M3PA 4UAUA 1C9JA 1WTAA 1YA8A 1BA3A 1M1XB 1ZL0A 4M7PA 1KS9A 8ICCA 1EINA 3REQA 5CFLA 5MDHA 4OGKA 1LBIA 1T35A 3IPYA 2DBYA 4IDEA 4KPUB 4YAJA 4LY6A 1M0EA 4IO1A 1L4KA 1ZQSA 3DD5A 1GZHB 3ANYB 3UWPA 1TFUA 5EWFA 2I33A 4Q02A 4DXHA 1DC3A 4K4GA 3VC8A 1GLNA 1A2BA 1N2BA 2JGLA 2QTHA 4LYYA 1UAAA 2ZB4A 1L4HA 3BM5A 1JEYB 1Q0UA 2YZNA 4E22A 3COYA 3VC7A 1MPTA 4FD3A 1FMJA 1S3GA 3L8CA 1FU8A 5A1TA 5K5EA 4LJXA 1T2UA 2ZIZA 2OCXA 2W6PA 2ZDQA 1GAJA 4MRPA 1LZKA 4L9AA 2B8NA 2KKPA 4OMCA 4TL9A 3S1AA 4DNXA 3OZAA 1Y5MA 3CSDA 3DAPA 4ECEA 2ZRKA 4JP1A 1Z3EB 2UXDB 3O8LA 3KIPA 3RASA 4B31A 2PZLA 1ELOA 1MX1A 4NFHA 1SC1A 4H6WA 5AKEA 1KJYA 4N76A 1QO9A 4GI3A 2C98A 3ASYA 1RXYA 2AC2A 3PUJA 4RL6A 2HWKA 5JAIA 4LJ8A 3D0KA 3BMOB 3MMPA 3EZNA 2ZI4A 3PZBA 1EXMA 3EGOA 3OHAA 1N8TA 2JFHA 3GT3A 3KXKA 3N74A 1E3SA 3NLLA 1U9IC 4NYJR 2XVYA 1CWUA 3THWB 1SGGA 4QQRA 2JCBA 2EHDA 1GT6A 1GV0A 3KS9A 4NNJA 4YASA 4JEHA 3Q0EA 4OUDA 1XAHA 1E3WA 4I7EA 1X6JA 4ED8A 2PLRA 2ZJBA 4OQZA 4CYMA 5IK2D 1TIBA 4Q1AA 4F8JA 2ASVA 4USAA 1AZTA 1SG9A 2AFHE 2RGGA 3BSFA 3ZDFA 3BEOA 3OAAD 4JJ8A 2OCAA 2ZT5A 3KOYA 3B12A 4PX5A 1Q84A 4KACA 4MRAA 2XUOA 1BW9B 4RULA 3CSSA 3VDMA 5FWXA 3NIGB 5JAZA 4O5EA 4OREX 1CY7A 2P3LA 2HF8A 4RLQA 3SE0A 1F2TB 2CUNA 1N5LA 2J0UB 2ZTEA 2IY7A 3JZDA 3LSYA 3OT4A 2V7QA 3WBFA 4Z9AA 4ENSA 4G0NA 1BXGA 5CJ2A 4JBYA 1P4RA 3VNSA 3WZMA 4WESA 2WTNA 5F1OA 4RTRA 5KZMB 2K4PA 3R9KA 4EX7A 4BLTA 3JQEA 2D7JA 4RJKA 3FDZA 1GTZA 4FFDA 1S96A 1IEQA 1ZCFA 2XADA 4ISCA 4NTZA 1D6NA 2CLEB 2Y66A 3G17A 3MIIA 4P92A 4PCVA 1QTMA 2EGUA 3TRJA 4BNWA 5SYAA 1YVPA 2JDID 3WGJA 1E1CB 2XWQA 4MQUA 2E82A 3FNHA 1W36B 4CEJA 3DULA 2M1ZA 3QU4A 1Z7YA 4KYIB 1FIQA 3E3LA 4X1KA 3WGQA 1BHSA 4RSGA 1XFAA 5BT9A 3FPKA 2OHIA 3UAZA 4BNKA 2WZCA 1PWXA 1GA1A 4MTLA 1IXKA 1C2YA 4FJ2A 4IO0A 4ABYA 2P4QA 3JQ8A 4L2IA 5E2AA 4JK3A 1C8LA 1I33A 3DHVA 2GMWA 3V8BA 2AYYA 3TTTA 1SKBA 2E4AA 3FDFA 5SYMA 4QEDA 1L7NA 1K68A 3WK7A 1T4MA 3NBKA 5REQB 2FXVA 2GK4A 4BZPA 3MS4A 4LJAA 1J23A 5DTIA 1Y6GA 4NXZA 4KVAA 4TKUB 3DZBA 4DR2B 4IV5A 1QPGA 2MIIA 3I2YX 3OZBA 1SOMA 4JB2A 4YWJA 4TYYA 1IB0A 3MBIA 4H1TA 3ZJUA 2N46A 4RZHA 4YMSA 5BR1A 1Z8NA 1MJGA 1Z4OA 2JFBA 3NVMB 1NMZA 3MJHA 5M5BA 1J90A 2Q5JA 2KJ5A 3BF7A 1JLKA 1U8UA 4G85A 5AW5A 3AVPA 1RS0A 3NHBA 5FQNA 3TR5A 2V3CC 1QO7A 5HF8A 3SQMA 4F5YA 3H9EO 3OKCA 3LXUX 4IRKA 1Z8FA 4ZJZA 3N39C 2E4WA 4ZRNA 2EIXA 3ZW9A 1JXLA 2AR0A 3HJUA 2X0FA 2F1KA 2NWQA 3VPCA 4S05A 5CB0A 4W5OA 1Z82A 4AKIA 2XTJA 1USKA 2Y71A 3PQ6A 4RTKA 3MK31 2V6MA 1EMDA 1HFKA 1PT9A 5EQTA 3SAGA 1LY1A 4D8VA 3WQQA 1ZO8A 2C95A 1JBQA 2OZKA 3H5WA 3QXCA 3ER9A 4S04A 2CLSA 3B1FA 1VLHA 4PC1A 1J1ZA 2ZJ6A 1SXJC 3RIXA 2XZDA 1QYRA 4BMCA 2G5PA 4BFLA 4RM2A 1NV9A 1XB2A 3FWKA 3GAAA 3GVIA 4NJEA 4L8WB 4YCNA 7ICOA 2K8BB 3MBKA 3KUDA 4FEYA 5HDQA 4RC9A 1QG6A 2JB9A 4U2DA 2XHZA 3T12A 3SFZA 4C2AA 4R01A 3LGAA 2HHSA 1DWOA 2VP0A 5HZKA 2VLBA 3WL3A 4HAXA 4F5QA 4MYTA 3GLTA 2WYUA 3LJKA 2WWVD 4DLGA 2XITA 4DKJA 1B23P 3GFVA 2VDPB 2WU8A 2EFDB 4ETIA 3GWGA 4QXOA 1HPLA 5JXWA 2L19A 1QTQA 4DIEA 2Q27A 2QRMA 1QMPA 1NQWA 2ZIEA 2J6SA 3MRXA 5DLEA 4PGXA 2A14A 3M1YA 3MJRA 1W47A 3N2EA 4TKZA 1F0YA 1RWQA 1E63A 3IA2A 3ZCTA 4OQQA 4FC6A 4I50F 3F53A 1KYTA 3IAM1 4C8LA 1GD1O 4URWR 1I5OA 2RI0A 4QAQA 3PD1A 3A4LA 1ZZGA 1GRRA 3OI7A 4JT2A 4PZNA 4KQXA 1NVBA 2X6TA 3G88A 5AH0A 3RG8A 7ICRA 1UXKA 1GKIA 1ZNYA 2UVDA 3KVVA 5ES3A 4WZBE 3TSWA 4C4ZA 2E3TA 2XKKA 4YMMA 2YXDA 2VDJA 4GPTA 5GOZA 2AI2A 4Y0AA 3BWDD 4NJ8A 1EX1A 5E0KB 3AZQA 3L1UA 4Q3OA 5IASA 2X0KA 5E3HA 1WPGA 2IZ0A 3VZSA 3PW0A 4ZVUA 1UBKS 3PLRA 3SXUB 3V46A 2Q2OA 2ZSBA 1I3CA 3CW2A 1RTKA 1JW9B 2VUTA 2VUHB 3IILA 4KHZA 3UXHA 4QOJA 2DHQA 4IH1A 3ZI7A 1G2QA 2TECE 2QUAA 2I87A 4U2CA 4DIBA 3OSUA 4DM3A 2WJ6A 1YFJA 4NV0A 4KGVA 2XY5A 5CRIA 1AMOA 2UYCA 1UT8A 4HWTA 1W7AA 3B13B 1VLZA 3U40A 4DQ0A 2UAGA 3DL7A 5J2AA 1FB5A 1T3HA 4M53A 1UOEA 5DASA 1SG0A 3FYCA 3A1CA 4NRDA 4JDPA 2RK6A 5F76A 1H2YA 2B1IA 3QWAA 3BIXA 3ZTWA 3QLVA 5I7RA 1N7IA 1BVUA 2DUYA 4LXQA 1NJYA 1MB4A 1Z5UA 5IDYA 5C5JA 1J0CA 1E1DA 2XMGA 4CMBA 4KOAA 1LW7A 2Z1MA 1FP1D 4ZQHA 4RL4A 3G6VA 3U56A 5IH7A 1PUIA 3OOEA 2O2CA 3NBQA 3CHYA 1F06A 4AF8A 4PPNA 5H9WA 4M1QA 4N5IX 1ZXXA 3NO4A 5FUMA 2WF7A 2W2VA 3IIEA 1CJTC 3KQWA 1G3UA 1PRYA 4FOLA 4ID3A 4KB5A 5E6UB 4B48A 4L8FA 3G9XA 1J2JA 5BQFA 1FLDA 2FPPB 4NBUA 4W5TA 2ESEA 2WSBA 3DE2X 1F5NA 4QTTB 4U4AA 1WUIS 4HFMA 1NNUA 4ZO6A 1NZBA 3H5LA 5FUBA 2DSNA 5HQ3A 4I08A 3V9AA 1P7DA 1YZ3A 3IKVA 3O4FA 2WD7A 4MYUA 3ICOA 1MBZA 2GEKA 2BGUA 3GFOA 4X6UA 3TQHA 2YDXA 2H48A 5DULA 4QYIB 3R3VA 5LQCA 2AX4A 1US8B 4KK3A 1EQAA 2MUTA 3G0IA 1L7RA 2RKOA 2VTKA 4LOJA 4WE3A 5MGNA 5IM4F 3VX3A 4BY9E 2ZRHA 4M7WA 4DL7A 1CUCA 1XVAA 2XCUA 3OTGA 4XWYA 3E18A 4PQFA 3BL6A 1E2KA 2BPOA 2Z09A 2QV0A 3A3NA 3KFLA 1D1QA 2JFFA 4OK6A 2C8JA 4AX4A 1MP0A 2XKBA 1CZRA 2ZTHA 4ND7A 5AUOB 3CZCA 4MV0A 3O2SB 3UPQA 1D2NA 1VPTA 2WMDA 2JZOA 2CKDA 1GILA 3LOQA 4YHHB 2FFHA 4QTZA 5IJ0A 4FE3A 1ZFNA 1XSLA 1BRMA 2FFRA 4UEQA 2BEVA 4X94A 2W04A 1CR1A 1FS6A 4IIGA 2C2OA 2AZXA 1GVNB 2E1FA 3D3KA 5KFKA 5EPEA 3H2KA 3BN3A 4N8DA 3RTCA 3VYWA 5IU6A 2XDYA 1UT6A 4PHAA 3N3AC 2OG1A 1FW6A 4Z4FA 1QDLB 3CFYA 3HL4A 1S76D 3DTTA 1YDMA 2K7ZA 3PX7A 4JC5A 2AMJA 2R6HA 1IWOA 1NQ5A 2HDNB 2YJ6A 3DEHA 3S28A 2WIKA 4N7JA 2ZIVA 3R24A 2WP0A 3ISJA 4Y7CA 4FFVA 1Z38A 3H4IA 4YRAA 3ZCVA 2A5DA 9ICLA 1ABFA 1P5RA 3LHSA 5AO9A 2AJCA 4BDTA 3LX4A 4F21A 3MSXA 1S4QA 1JHRA 4QVGA 3AR4A 1DRJA 3HL0A 3SX2A 2OLKA 4XLZA 4YLYA 2RHDA 5DN6D 2HU5A 1BFDA 1L3IA 2O48X 2YIVX 5DBFA 5CB4A 2E8NA 2KVCA 4Y2JA 9ICXA 1WZIA 2F48A 4PICA 2ZYAA 1DUSA 4MUHA 5AKKA 3D7SA 3EMBA 4TLCA 3QKUA 3G0HA 4WZBA 2GKOA 2IHYA 3D64A 4IPTA 4RENA 5IWAB 3P0IA 2H3VA 1CLEA 2C5LA 4WMLA 2G8NA 5EQFA 3DGFC 5FWNA 4HO1X 2ZVDA 2VJBA 1L5NA 5EL0A 5FI0B 2WLTA 3MERA 5CDHA 3P2MA 4MHVA 1KJ9A 2DUWA 5FEUA 2EQAA 3D7NA 2FB9A 3QFRA 2XKAA 4ZZ3A 4ZTZB 3CH6A 2VTEA 5BV2P 1GGVA 3FZNA 4TYQA 4MI6A 3UPUA 3MJ4A 2BBWA 4F4HA 1APBA 4BWYA 2WWYA 1Y8QB 3GFQA 1CZLA 1HMPA 4TUYA 3CRRA 1PLLA 1KI3A 1XZFA 5I7SA 5HFNA 4EVRA 5AW0A 2I4IA 2LGJA 4MW7A 3G2IA 3U6KA 1V8PA 3X1YA 2LIVA 2XRZA 5ICFA 3U7QA 1HFWA 1XELA 4XVRA 3GUUA 1N8KA 4W5RA 3VV3A 1KDRA 1I5RA 1SVSA 4JI4B 5TMEA 4N47A 3QIAA 4DLVA 3ICEA 1WB4A 1O57A 2AG5A 3LCJA 3D6JA 2HHVA 2XIQA 3F46A 4FR0A 3PUWA 4P84A 2AC4A 1TUGA 1XUOA 2YJNA 3C3YA 3KYIB 4FDAA 4FEEA 5DI3A 1PQUA 2ZVJA 5K51A 4I28A 3WZLA 1QHFA 5ALYA 3L0BA 7ABPA 3WAJA 3MABA 1MRSA 1I24A 3SKXA 3IUEA 2LCIA 5CVCA 4ZAYA 3TMAA 4MDEA 4L75A 2H2FA 3FVTA 3G2HA 1IM4A 1ULAA 1HDZA 4Q4DA 3UF0A 2KNJA 2FMXA 4GSYA 2C2KA 4C43A 2OZLA 2BUCA 3OX3A 3JY6A 1CZKA 4D6XA 1KKLA 4G9EA 4O4HF 4E08A 5CVTA 3SENA 3TOSA 4EY3A 1FP6A 3LHKA 4YH1A 1ZD1A 1E7QA 3GGOA 4HGOA 1JALA 3E22B 3REOA 2YKGA 4WBNA 4ZI3A 1AA6A 3PJGA 4YVZA 1XZJA 4HWRA 3HH8A 1DUIA 3EIOA 4IOLA 2VAXA 1UHUA 4PANA 1WY7A 1ONNA 5CT5A 5P21A 3QBVA 1TUIA 3K0AB 1K8YB 4LX8A 1KTIA 4U6NA 3KE9A 5KAIU 3QVWA 4K9NA 5DG7A 4JYAB 3CV3A 3DMFA 3SLGA 2MT9A 4OKNA 4TLAA 4JZYA 3U0VA 3PSFA 1JWBB 1U99A 1P9OA 5C81A 1UZUA 1DT5A 4G5QA 4NZ9A 4RF3A 5JXGA 3MW8A 4R4JA 2F3QA 3JPRA 1HDYA 4HT3B 2ISQA 3ENVA 4B34A 4QPPA 2BCEA 1XZ8A 1NTRA 1RR6A 2QGZA 3TLZA 3F49S 4MFAA 4QOEA 1WQ3A 4MHSA 4F1KA 4BCDA 5A02A 1MVLA 1EUDB 2FZCA 3F47A 4TKVA 1GU1A 3SOZA 4NK4A 5IXYA 2FPPA 4TN1A 1N4DA 2R0QC 2C28A 4OX9B 4TT3D 1RDFA 3AK4A 4EYSA 5M2QA 4DQPA 1UFQA 3TNDA 4EHKA 3UKDA 4KLFA 5E7IA 1DTWA 2H3EA 3Q8LA 4ZU3A 2Z2KA 1NXXA 2HMXA 4JCOA 3AWIA 2D8AA 2G0TA 4PV7A 5HM6A 5DXAA 4AKSA 4GMGA 1C7ZA 4BDSA 4ZTUB 3VAAA 4OVKA 1ZC4A 3RNLA 4FOPA 1ZNQO 3D8UA 3PDJA 2RQ5A 4QDKA 4R3WA 4ED6A 1ST2A 4JUBA 1VDZA 1L7MA 1N9ZA 5I5GA 4F93B 2GZ3A 4EB8A 4XWWA 5LN1A 4UBOA 2IZ7A 1TNDA 2H4HA 1JEOA 1FUEA 2WVJA 3THRA 1MD9A 1T4CB 3F4LA 3OJLA 3A0RB 3QI2A 2E6UX 2OD2A 3NX4A 1N0WA 1E1MA 4O4LA 2HSJA 4EJMA 4PLYA 2K89A 1HNWB 3PNCA 1NE7A 2AJQA 2XY6A 1NHWA 4S2EA 5EJ7A 5J2CA 5AQEA 3MFIA 2Y1CA 4FONA 1CUVA 1OU4A 1LFDB 3BMQA 4GZ6A 4NIMA 2JHDA 1B3BA 1TF7A 3NQ41 3L18A 3OSZA 1MXFA 4J2TA 1KERA 1JSZA 2KM1A 2B83A 3HN6A 3L6CA 1TVKA 4PLWA 4YRJA 1KEWA 1OU0A 2DFKB 4PRLA 1OUMA 1YJXA 3TX6A 1JKIA 3AIIA 3LGXA 4IJUA 4JR2A 5DNDA 1HDGO 3EC2A 3LUFA 1BE6A 1H9CA 4E13A 2WKQA 3QRWA 3SM3A 4IWNA 4YO7A 5T4FA 2H1OA 4M0FA 1BVHA 2H00A 1GVHA 4WNCA 3BDPA 3FHCB 4BFTA 3Q11A 2M9NA 1OY1A 5E4JA 2XB2A 4PQYA 2WU3A 2SNIE 2Z8YM 1RQGA 3B8EA 1BWQA 4YD1A 4H4EA 1UZLA 1QYDA 4WN9B 1VKNA 2B5OA 4F60A 5KCZA 4P0QB 4R2LA 3W04A 2KFNA 3RTBA 2RJOA 3NC0C 3PGMA 4N1AA 3ZGXA 4P36A 2B3DA 3KBOA 5JALA 5J0OA 1KNXA 4XARA 4WOJA 4G3XA 3PYLA 1FFWA 4HLUA 3VSDA 4B46A 4CQLB 5JFTA 4NXMB 1TUBB 3AG6A 3BWVA 4QATA 5SY9A 4HQ0A 3UMCA 4UZSA 3U5TA 8ICLA 4EHFA 5A4KA 3RFFA 1Y1QA 3ECSA 2QLBA 4UE2A 2XX3A 2NZ2A 2ZTVA 2ACWA 1E0DA 4JD5A 1L4NA 3LOPA 1WXGA 1P1IA 2REXB 3E05A 4QOSA 5KJ6A 1RM6C 1PCXA 1QANA 2GOYA 2A67A 2Q5OA 3IJRA 1RWXA 3N8DA 3PR1A 1C1HA 1T91A 3TB4A 3IVXA 5IKEA 5FL3A 3C4JA 4I2AA 1NV8A 1RU3A 3OZUA 1YCFA 4Q7QA 3OJXA 4UQOA 3A4IA 4UOQA 1Q3KA 1LBHA 1AKQA 3N8KA 2G08A 1DZIA 1YMUA 2A57A 4X24A 5MFPA 1SU8A 1M73E 1X7XA 2O2YA 2Z1NA 5D85A 1BEZA 5BOVA 3IRVA 3THXA 4RTMA 2EEZA 5B58C 1NI4A 3QG1A 1BKSB 2QENA 3OM9A 1V16B 1ZRHA 3R7WB 4F6RB 2O7NA 3S8EA 3C1TA 4GKAA 3AG5A 4XI9A 1ES9A 2W2PA 4ZV7A 4AQYB 3RIEA 3ZNNA 1RZUA 3NRJA 4PYQA 5LWQA 1MW9X 1P75A 5KTQA 1C1DB 1FNNA 1DS6A 3A14A 3EGXB 4TMWA 4U6SA 3RQIA 1CZOA 3LPLA 1P6XA 2G72A 3GRAA 1DXHA 2PO7A 3H6HA 3AFMA 3ET5A 3IUSA 4NDNE 4GE0A 2WU4A 4L6CA 2PZJA 3HEBA 4CM9A 4DLSA 2R8YA 2F9LA 1NUQA 3R3XA 1LPMA 3ZVNA 2BM9A 4B33A 1GFSA 2H9AA 3H4MA 3QBDA 4FYPA 3OIYA 3FTPA 1K3UB 1H69A 3V1YA 5JMWA 1XRQA 1DOAA 4MP3A 5JEDA 1E3MA 4O3QA 2C20A 2RB5A 4BO8A 1OT3A 1ZUIA 2D8CA 2FMFA 1JYSA 2GEFA 2PFKA 3ID6C 1P4HA 5K4AA 3ZBTA 5EIEA 2JIMA 3HLTA 3KJIA 4M0LA 5GP1A 3BGVA 4DCVA 1BG6A 1BS9A 2AWOA 2DFDA 1U0HC 3H13A 4MKGA 1CXZA 3JD0A 4FHFA 3VKHA 1REQB 2YWFA 4QWAA 4W6QA 1QTIA 2BP7A 3HB9A 2EDUA 4PH5A 1C7JA 4I2FA 2W83A 1JT9A 4JR1A 5B6JA 5KTRA 2BDUA 3A1VA 3ZV5A 1CULC 1G3RA 4YR7A 3HBFA 2ZXUA 1ZBDA 2H11A 1AT1A 4PYMA 1OJLA 2V55B 2Q7OE 2GFIA 2SBTA 1NR1A 5WRFA 4CLRA 5JSUA 3D1VA 2C7RA 3IOEA 4MIYA 1CDZA 1Z56C 4PC3A 4BKOA 4D9HA 4RF2A 5IT5A 4X84A 4GECA 1TM5E 2FLKA 1QFXA 1JE1A 5A3RA 1I94B 3MAGA 3L9WA 1Y5LA 3EQ7A 4N12A 2Y1IA 3KKKA 4CMHA 4QWWA 4E1BA 5F98A 3PW2A 1PZFA 4W5JA 4GPEA 5BUSA 1X92A 6CHYA 2CB9A 4LVUA 4B6JA 1HUZA 1Z0UA 2E48A 2ZSAA 1QQTA 4FQ5A 3ROQA 1SB3C 1N0VC 1RT9A 1UK8A 3G7NA 3Q9SA 4L73A 3SNHA 1QE3A 4PIMA 4F8RA 1D2EA 3FDJA 5AI4A 4BRUA 3A04A 2VJOA 2BUBA 4EPXA 1YZNA 1UXIA 1B93A 3WWDA 3AF4A 3JVEA 4TLLB 1PBNA 4E5UA 5E4YA 2AVNA 2DE0X 1DCMA 3OFJA 2F90A 4TN5A 5H8WA 4CNBA 4NV3A 1SKWA 1R1DA 5I6DA 1JQLB 2IVZA 3E2MA 4TV8F 2Q4RA 5DBGA 4R68A 3TG2A 3H1BA 1QHSA 4AKTA 2A9PA 4C07A 2EQYA 1TM4E 4BGIA 5JZMA 2YXLA 3DHWC 4NEHB 2VCEA 3GYBA 4QSHA 5H7XA 1SKMA 3ZIAD 1NY5A 5CFRA 3QF4B 2R4UA 1SQGA 4EGSA 3PI6A 1RYFA 3M2TA 3JQBA 1E66A 3F98A 2HRQA 3VOBA 1ESEA 3PHCA 2FP4A 3N2ZB 5ETJA 1PVRA 3ZEIA 4QLBA 2HA2A 5DP2A 4ZT6A 4MR8B 3SR3A 4Y7DA 2JA2A 3ZWDA 5I4BA 3COSA 2W7TA 4K9PA 2J45A 3E9RA 3QFFA 2QRPA 1UKZA 4DC0A 4IIFA 1ORTA 1X1AA 3MAJA 4HZGA 3JALB 3ZD9A 3MWEB 4MV6A 1NF2A 2XUHA 3TFQA 3FMGA 4E94A 1O5IA 3VDRA 3PUKA 4NYMQ 3UWOA 4WERA 1F7VA 3LQFA 2DEUA 4HGNA 3G5MA 1BJRE 2VHYA 4OXQA 2JD1A 5KTSA 2P4SA 3V3KA 1U1EA 2VYNA 4OPMA 4TMXA 1BPDA 4FHEA 2RCYA 5FUXA 3UQYS 4D8TA 4DSUA 1SXPA 1LV7A 1NPYA 1A9ZA 1CR0A 2FV8A 4G0ZA 3NNNA 3N2LA 4LHYA 3OX2A 3SJ7A 3KT3A 3ABSB 3E7WA 2RDIA 3HUFA 2XGQA 1Y3HA 3H5RA 4MO9A 3U48A 1VKJA 5BWLA 5LFAA 3HJBA 2H5JA 2AZ4A 1SXGA 4JJ4A 3EQ2A 4AN4A 4C29A 5CT8A 3BXOA 5GPBA 3SR0A 1WUJS 8ATCA 3TXXA 4RY9A 1I9CA 3A4YA 1T26A 3S81A 3E15A 2BQ3A 2BYTA 4PHDA 3VBEA 1NBAA 4INPA 4UB5A 3MR3A 2IZZA 3BQNB 3KJXA 3ZE8A 5IFKA 1TLLA 1M6HA 2JIOA 1ECLA 2ZR8A 5TJ9A 1JAZA 3ONEA 1U4BA 5DGIA 1MU0A 2NUTB 3QOXA 5C31A 4D0RA 4EYQA 3GP3A 3UC5A 5KVCA 2ZITA 4NR0A 1YZUA 2ZI9A 4LRUA 3T52A 3JQFA 4G4IA 5LJIA 1YR8A 2JZCA 2P75A 1NQAO 3JQPA 1YS7A 5GJCA 4HBZA 4YV2A 3NETA 3T1NA 3WLPA 3L6BA 2FOXA 2H4ZA 2VP5A 2Y93A 1QBGA 2C31A 2GZRA 3EPRA 3L79A 2RHMA 4AU1A 3UMYA 1BQEA 1U6IA 1VE3A 3JRXA 1D7AA 2HIHA 3PGXA 2QQGA 4AT1A 2Y9TA 3IOBA 3LVBA 3A1WA 5DRYA 1ZSYA 1ZUD1 3E7XA 4W5NA 9ICMA 1T5DX 5JU6A 1ETUA 1P44A 2CNWD 5DWDA 1SN7A 3HCAA 3KX2A 4DDWA 2LYBA 2WAMA 5EJGA 1PEDA 2E9SA 2Q9BA 2CYBA 3BFJA 1U0EA 3Q5DA 4B35A 3AKYA 3SVTA 3EVDA 3W2IA 3ADOA 2VSXA 4AZ0A 5CFQA 3PCTA 2PUCA 1JLMA 1K97A 1Y1TA 1YRBA 4F9TA 2P30A 1GUBA 3RC1A 3KYDB 4NQZA 1XWWA 1JIJA 1YD7A 1TQ8A 2B4QA 3DOEA 3HCFA 4UTZA 5FBQB 1GITA 5JWRA 4NCBA 2FEMA 2BGTA 2CC2A 4RDHA 3V6MA 3K6SA 4EY6A 1RPZA 1ZAKA 4UE3S 1GZ5A 3ZDEA 5G3YA 4I2CA 5J4VA 3NYQA 2Y0EA 4WLFA 1G20E 4AJ1A 3GUZA 3PXBA 3GLHA 3R0JA 4Y2UA 3JWHA 5BSGA 1C3XA 1BJTA 2WI8A 5KFSA 4RNDB 4GXQA 4E70A 4EKYA 1A9OA 1MJHA 1WUKS 2ZWPA 1T8SA 4RORA 3VYTB 1MAVA 5LZ9A 1VKOA 1U9JA 3WOHA 2I6SA 3R5HA 5F9MA 4IKPA 4IH4A 4QKQA 1B41A 1X8LA 2JDIA 2VF7A 4WWHA 2HYIC 1HEKA 1QYCA 2Y0SF 4AJIA 2ZYGA 1XIVA 3ULKA 5B1EA 4OSEA 521PA 2WKWA 4M8SA 4M36A 3T7IA 1YZTA 3O21A 4Q03A 4TWIA 2BGIA 2YCBA 3BTUA 1E3TA 3AUSA 2FMKA 4EY4A 1B0PA 4M9UA 1T8RA 4UPEA 1K6MA 1DNPA 3NHKA 3C3BA 5C8ZA 4WCVA 4DREA 4OJYA 2PMKA 1IK4A 4X1YB 5HJEA 4RMHA 1D8YA 1XQYA 3GJYA 4WJZA 5BWMA 2IP1A 5KHAA 2GKGA 2I4MA 2CLFB 2FRXA 2Z2XA 3DV0B 2DL0A 2XOKD 1P0MA 2NTYC 1T24A 2LKCA 1HUQA 3MOSA 3Q7PA 4K6OA 3QX7A 4FBUA 2HRRA 5C18A 2F1OA 2DKFA 3TADC 2OM2A 2ZETA 3BORA 5A04A 5ITZA 2VHZA 3ECCA 3NRCA 4Q4AB 2ATEA 3RU2A 3A31A 2HADA 3TRIA 3HXOA 1WNFA 4I50B 2JIBA 1I7QB 3OE4A 3PFGA 3Q7RA 4D42A 4LCEA 1GQ2A 2F8SA 1U1IA 1VL2A 1QPBA 2QROA 4ZEOA 1NNLA 4PVDA 2YC2C 3TOVA 1BPEA 3BWMA 1Z7WA 4I9FA 5B53A 2ZI3A 1N7GA 4LXHA 2GF0A 2TMGA 3B2QA 4EARA 3BJZA 2OGWA 3M5WA 3STTA 5A5DA 4PR0A 3H0LB 2Z8ZA 4IOKA 2FPOA 3GJXC 3KHUA 3P0RA 3ZWNA 3OQMA 4PZDA 4WQMA 4LXYA 4IXTA 1SHKA 1CDOA 1GGNA 2FWAA 2QRLA 4OP1A 4A8PA 3CVOA 4ALNA 2FP4B 2UYQA 4G5YA 1ADGA 3LRPA 3EMDA 5F9NA 2W37A 2WMNB 3HZHA 4Z2AA 1UA1A 4ED0A 1L4EA 3AIMA 3ESCA 1LBTA 3G7SA 4MWBA 3HEAA 4N39A 5TQ2B 3U37A 3VR0A 1R6AA 4LZAA 1C1YA 5BYJA 5CG1A 2PX8A 2D5BA 3D7KA 3GLUA 3RR8A 2BHRA 4IAOA 5BVGB 4CETA 4Q4CA 1V6AA 1KOFA 1YULA 1O6CA 3GRYA 2GCOB 4WJKB 2ZIWB 2O2GA