3MC1A

Crystal structure of a predicted phosphatase from clostridium acetobutylicum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
SLYNYVLFDLDGTLTDSAEGITKSVKYSLNKFDIQVEDLSSLNKFVGPPLKTSFMEYYNFDEETATVAIDYYRDYFKAKGMFENKVYDGIEALLSSLKDYGFHLVVATSKPTVFSKQILEHFKLAFYFDAIVGSSLDGKLSTKEDVIRYAMESLNIKSDDAIMIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANYIVNSVDELHKKILEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Predicted phosphatase, HAD family
publication title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
total genus 76
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3mc1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mc1A01
5AVXA 3W5DA 3N07A 5JJBA 2B8EA 1QQ5A 3N5KA 3L7YA 1RLTA 3OCVA 4KX5A 5ALHA 5ALSA 2IOFK 3E84A 2NO4A 2YBDA 3ED5A 1TJ5A 2G06A 3FPBA 1ZJJA 3QLEA 5AKHA 4EENA 3DAOA 3M1YA 3R4CA 2I33A 5AM2A 5ALMA 1TJ3A 2IOHA 1AQ6A 1QH9A 5AICA 2W11A 3ONNA 1RMTA 1Z4IA 4GIBA 2FPUA 5AVTA 1NRWA 3CNHA 3QYPA 3EWIA 3U19A 2DQSA 3AR3A 2IOFA 1F5SA 4L57A 1WZCA 4J2TA 2WF9A 2ZBEA 3RF6A 3ET4A 5IT0A 5ALWA 2OYCA 1RLMA 4J03A 4AS2A 5ALQA 1ZOLA 5E0OA 2YJ3A 3B9BA 5ALDA 2ZOSA 1ZS9A 1RKQA 1PW5A 3RFUA 5A3RA 2AUTA 2W43A 2OBBA 2BY4A 1RRCA 4XOUA 2RARA 1L7MA 3WKEA 4DWOA 2O9JA 2HI0A 4CE6A 4O8CA 3I1YA 2G09A 1O08A 4UAVA 1KYTA 4Y2QA 1O03A 4KN8A 5AI9A 1Z4KA 3E8MA 4HYTA 4ZEXA 4UM7A 4Y2XA 5T41A 3QU5A 1LVHA 5AHXA 1YDFA 3ZTYA 3WK9A 3KC2A 3FVVA 1XPJA 3AR5A 3VAYA 2B8JA 3QUTA 1RPZA 5AW6A 5AIAA 4BEWA 4Y2VA 5AKKA 3KOOA 1L8OA 1Z4PX 4NAVA 2I55A 1SWVA 3ZVNA 1RMQA 2ZXEA 2JAOA 2JAWA 3DDHA 2NO5A 4YIHA 3ZWDA 3L1UA 2ZBFA 4CF4A 3ZX5A 1U2TA 4Y2JA 1LTQA 3R9KA 4DW8A 4IG4A 4NWIA 4Y2PA 3ZW7A 3U13A 2NYVA 2G1AA 2ZG6A 2JAUA 3ZVMA 3QUQA 3U7FB 2CFSA 3S6JA 1Z5UA 3DV9A 3N28A 4UMVA 3PCTA 2C8KA 3UMGA 4G9BA 4L6CA 5AW9A 5ALVA 4OD0A 1RLOA 1RDFA 5AI0A 4XQ0A 4CF3A 2MSNA 4AP9A 4UW9A 2MU1A 1U7PA 3QUCA 3WKDA 3NIWA 5AKLA 3QNMA 3AR8A 3MN1A 5AKXA 3N8GA 4I9GA 4BX2A 2YMLA 1S8OA 2HHLA 3CZ4A 2B0CA 1QQ7A 3PGLA 1IWOA 3F9RA 3QGMA 5AKJA 4BX3A 4F72A 4RETA 2EARA 5ALRA 2OM6A 4QJBA 2WHEA 5ALKA 1ZD5A 2YN4A 5AI4A 2BDEA 4ZEVA 1RQNA 3WKCA 3EF0A 1YJ5A 4HGQA 3WK6A 4F71A 3ZWKA 4FE3A 3PGVA 4JDPA 5AVYA 3QU2A 4HGNA 4OCZA 4H1WA 3AR4A 3MMZA 3FPSA 5AW1A 3A1CA 3R09A 2P69A 3NASA 1L7OA 2FUEA 4ZEWA 2P11A 3L1VA 2FPXA 2W4MA 2YY6A 3AR6A 5AVSA 4Y3UA 2YMPA 4UMDA 1EK1A 5AM4A 5AW4A 3U26A 1YV9A 3I76A 1RKUA 1L7PA 2PQ0A 2HDOA 2CFRA 2WF7A 2QYHA 3SKYA 3ZUPA 3ZU6A 3W5CA 2HX1A 2O2XA 2RBKA 3WGUA 3L5KA 3HYCA 2OA0A 4BBJA 1J8DA 2IYEA 3L0BA 3A1EA 2GHTA 2HEGA 2C8LA 2GHQA 2WM8A 5AVQA 1XVIA 5AM3A 4KYTA 4Y2TA 4EZEA 5AM5A 3W5BA 2HCFA 1Z4QA 2Q4TA 3WK4A 2B82A 1RQLA 4BEVA 5AK3A 1RMYA 5ALPA 3L0CA 2X4DA 4CF5A 1Z88A 2CN1A 1Y8AA 2PR7A 3AR9A 5AK6A 1T5TA 5AW2A 1U7OA 3WGVA 3KBBA 2HOQA 3ESQA 1WPGA 3U7GA 1JUDA 5ALNA 3AR2A 5ALEA 2FEAA 1K1EA 1ZD4A 2C4NA 3L8EA 4HGRA 4YH1A 2Q5EA 1TJ4A 2YJ5A 4BNDB 5ALYA 1L7NA 3QU9A 5A3QA 3NANA 4Y2UA 2YFYA 4JB3A 3I28A 1EK2A 4PNHA 5AKYA 3ESRA 4CNQA 3FZQA 4EEKA 1ZD3A 3IRUA 3ET5A 5ALGA 4XPZA 4XE5A 5AVWA 3B9RA 1WVIA 5AI6A 2YJ4A 3OCWA 3L0YA 4NFLA 1ZRMA 2GFHA 4G63A 4KNVA 5A3SA 2HF7A 5AW0A 3D6JA 5AVZA 2P9JA 3OPXA 4YIKA 4KX3A 2HSZA 2I7DA 3MC1A 1SWWA 2B30A 2G0AA 3KZXA 2QLTA 3ZTWA 3SMVA 5AVRA 1WR8A 1L6RA 3NUQA 1VFPA 2B1RA 3QU4A 1Z5GA 1Z4LA 2C88A 3QUBA 2FPSA 3U7HB 1Q91A 2HF2A 2BDUA 5ALZA 3NALA 2G07A 4OFZA 1FEZA 5AW8A 2WFAA 1ZRNA 4UAUA 1QYIA 2JGAA 3PDWA 4KNWA 4FYPA 5ALUA 2MU2A 3N1UA 2D2VA 3K1ZA 3FM9A 2WF6A 1TA0A 4UMEA 1CQZA 1YNSA 3KDPA 3GYGA 2WF8A 3OTQA 4QQFA 2GMWA 4UU0A 2FPRA 3ZVLA 2FPWA 1YS9A 5ALOA 4NV0A 1X42A 2FDRA 2RB5A 2I6XA 1U02A 1XP5A 2WF5A 1TE2A 3BA6A 4NABA 4C4TA 4RESA 5AESA 4YCNA 3M9LA 1Z4JA 1YMQA 3SLRA 4HAIA 2R8YA 1J97A 4OHFA 4E88A 3KD3A 2FI1A 4YGYA 1N8NA 4Y2RA 1QQ6A 3J7TA 3WK5A 4BKMA 4UARA 4I9FA 3P96A 4EELA 4BYGA 4BNDA 4DFDA 1VJ5A 5AM0A 3UMCA 4UMFA 4B6JA 3DNPA 3EPRA 2EATA 4MWOA 5AKGA 3WK7A 4EX6A 5AKZA 4UATA 4FFDA 2AGVA 2YMMA 5AM1A 4C4SA 2YJ6A 4L6AA 4MUMA 2P27A 3L8GA 3I6BA 3OCXA 2I34A 3A1DA 2PKEA 2I54A 5AVUA 2ZBDA 5AKIA 1RKVA 3SHQA 2R8XA 5ALLA 3MPOA 5AIBA 3TLMA 1Q92A 3ZI4A 3HLTA 5AI8A 1VJRA 5AW5A 5ALXA 1SU4A 3SKXA 4HGPA 4Y2SA 2FUCA 3WKAA 3WK8A 3U7EB 5IS2A 3E81A 1S2OA 1Z4OA 1T9ZA 5AVVA 2AH5A 4Y2YA 3NRJA 3UMBA 5IT4A 3OCUA 2R8EA 2JARA 3AR7A 2GO7A 2HO4A 3QU7A 4C4RA 1NNLA 1L8LA 1ZD2P 4BX0A 5ALFA 3W5AA 4UM5A 4UASA 3L8FA 4EX7A 2EAUA 4HGOA 3UM9A 5AK5A 2G08A 5AKEA 4GXTA 1Z4MA 2G80A 2C9MA 1T5SA 3QX7A 2ODAA 1MH9A 4IFTA 5AI5A 5FP0A 2R8ZA 2Q4RA 3OCZA 2B1QA 3QXGA 4AS3A 3ZX4A 4UU1A 3L8HA 1RC8A 5ALJA 2IA5A 5AW3A 4YCMA 1Z4NA 4YCLA 2ZBGA 2VKQA 3SD7A 3IB6A 3BWVA 1NF2A 3NAMA 1CR6A 4DCCA 3OCYA 1U2SA 5AK4A 3FGOA 2CFTA 3A3YA 3E58A 2YMQA 5AW7A 2RAVA 3EF1A 5ALTA 3B8EA 3IJ5A 5ALIA 3SF0A 2AMYA 1N9KA 3WKBA
chains in the Genus database with same CATH superfamily
4RS4A 1F1JA 4I6JA 1QYXA 1SEVA 2AR9A 1YRQA 2G9RA 1Y9ZA 1JV2B 4RZRA 4KAJA 4MP8A 3RVNA 4MS4A 1PKXA 3TBHA 4HEQA 3PFIA 1G4UR 9ICLA 1A7JA 1G20A 4R7ZA 2OWDA 1TQ4A 2OORA 2JFOA 5JXHA 1BYIA 4C7ZA 1RG6A 3OX1A 3ZGYA 1BVYF 3IHTA 2QZPA 2B9EA 3SYLA 2PZMA 2PSFA 2HMWA 3EULA 1NZFA 4BP9A 1B73A 1DDGA 2O9JA 3P0EA 1KH1A 3QVVA 2AI2A 4FBGA 1EESA 4C3OB 3AHFA 1U3UA 2R1TA 1PVOA 1WSDA 1DC7A 2AOWA 4R31A 5DN6A 5DTIA 4Q7QA 4IQ4A 2BCSA 3B1ZA 1TK5A 1BPZA 1JPJA 3FB4A 1QM5A 3SJAA 4FGSA 5EJ7A 2E3JA 5DNAA 4F4FA 3LNTA 3FR7A 5TPZA 1DX4A 4XPIA 4CMJA 5IWCA 3DS8A 3F7TA 1IOWA 1S77D 1QGAA 2QV0A 3LBFA 4G5GA 3PJFA 4DJEC 1SQ0A 4Z4QA 4HMPA 5KJCA 5KYKA 4A36A 2WQZA 1VA5A 5FUVA 4QWAA 1FSZA 1E6WA 1AH2A 3RHFA 3KHTA 3B5JA 3EARA 1L5WA 3T6KA 1W36D 4GKKB 3BWEA 5KG3A 4ZQEA 1H4SA 1IBCA 3H0EA 4IWXA 3FAKA 1NDUA 4AJPA 2F4VB 4YNBA 2E37A 3AEUA 4S1TA 1P0MA 5J2FA 2WYUA 1VKZA 5M5BA 2XVYA 3CEPB 2E4XA 4GI1A 5KFIA 5DI3A 3HLKA 4Q4HA 3VZQA 1GKKA 1JJIA 4RIEA 1L1FA 2JD0A 1ZMOA 2FKNA 1GV0A 4QOGA 1VL2A 1PBNA 2HSGA 1D6MA 1U0OC 1YKFA 4R7TA 1FYWA 2VHUA 1REQA 3PA8A 7ICOA 5BVGA 4NMXB 4YPOA 3PZPA 2DQNB 3DZGA 2ZYGA 2VTDA 1O89A 4JLJA 3G9XA 2WLTA 4MTLA 2GTIA 3UK7A 5CD1A 1VHDA 1N4AA 3B1WA 1ZJNA 1YULA 2J7KA 3EF3A 1F8UA 4G1BA 1X7YB 2RH8A 4UOZA 4OXKA 1KJNA 1DAOA 1KKUA 3JATB 4HAZA 5ARDA 1P6QA 4RUKA 2OBLA 1GPAA 1L4UA 3QKRA 3X2EA 4YP1A 3GARA 4TL6A 1U5AA 4DQKA 4M1MA 2WF8A 4O1HA 4JQYA 1Z00A 2EWMA 2V54A 1SVWA 2FDRA 2JCSA 3SVZA 2WFLA 3KT3A 1HGXA 3M7IA 2VCYA 4QE3A 2ZSJA 4EO9A 3RR2A 3OJCA 1DLJA 4OQDA 2HHJA 3UN1A 4J16C 3W9UA 3GMSA 4RD2A 3TL3A 3LLVA 4JEHA 1IOLA 5EUBA 4LIPD 3KG2A 1NMSA 1TF2A 3GZFA 1F17A 4QDXA 2RCYA 3GEPA 1QHNA 1NA5A 5KOJA 3RABA 2OSBA 1MJNA 2EU8A 5C32A 1IOZA 1YVUA 3QQPA 5AVVA 2RGNA 2DWCA 1RXSA 2WHRA 2ZDGA 2NOAA 4L8FA 4S12A 4FZMA 3GYBA 1E64A 3KWMA 1R8XA 2G80A 3LA8A 3ZZUA 4LJRA 3QX7A 2R8ZA 3K4QA 3KLNA 3EEIA 4OHKA 3IR5A 3F2VA 2ROQA 4UU1A 1X6JA 1Z4NA 4F84A 1G1AA 3E4DA 1IQRA 3SV4A 1UWVA 3JQEA 3AM1A 1ZMXA 3CJTA 3ZY5A 1Q1GA 5KFEA 4HBGA 1Y42X 2HJWA 4I5EA 2Z0MA 4KDEA 3PFNA 3A1NA 4RAOA 2D62A 2C84A 1ZVMA 4Y1EA 1G4HA 2WPDA 3LT1A 4IWNA 3IXQA 5KCMA 3MWKA 4ZCPA 1C7QA 1Y3FE 4OK6A 2L2QA 4BWFB 2P78A 1D6SA 1KEUA 4GO1A 1GTJ1 4PFKA 3OZIA 4ZOAA 2X58A 3EHDA 1SCQA 3NJ4A 1W35A 2QI9F 1TZJA 4RMHA 2OYCA 3TQCA 4NKRA 1S96A 5KVQA 1YUBA 3I8OA 2NT3A 3CUWA 1U7HA 3FVTA 2OAP1 2EBWA 1FFGA 4MUXA 3EXG1 3F3SA 1ICEA 5KQPA 3NORA 1HX7A 2A1JA 2R1UA 4WI1A 1OUMA 3VAYA 2WTFA 3CJRA 1IZZA 1T6NA 3OM8A 1RHUA 2WWGA 3BHIA 3CSDA 1ZI9A 2HGSA 1ZNZA 4IQWA 1FO4A 1JI0A 1XRLA 4G1UC 1ZL0A 3ZW7A 2HHTA 4TS4A 3ANLA 2HHHB 5JSKA 4N0QA 3HZZA 4FDVA 3U44B 3PCTA 5G0SA 1VG8A 2QAIA 4FZVA 1M67A 4PZDA 4DCUA 1YZKA 1U7PA 4RMGA 5LKRA 3DCIA 4I1PA 1LI7A 2P5UA 1FFAA 4NQRA 2J0VA 3OZRA 5JNWA 4EI2A 5KNDA 1SL2A 3GEGA 4FW8A 1L7VC 3HYTA 1WBBA 4YK7A 2HA4A 2WD9A 3JV7A 5PNTA 1H4QA 2HY7A 2DPXA 4AURA 4G4SO 1RPTA 1Q11A 3H5WA 3QZ7A 3UJCA 3L46A 1KDTA 2YMPA 4Q9JA 2JZOA 1IJEA 4AM8A 5B7NA 4QPJC 3C5EA 2D8CA 5C1IA 4XJTA 3A1EA 3GDWA 2CDAA 4U6PA 3CUVA 5KAPA 4DRZA 4MUAA 3KZMA 2KS6A 5HJ5A 1JHZA 2JI6A 1Q3TA 5LDDC 1EFKA 2OGUA 2P65A 2D3WA 4RQAA 2O1EA 2NZ8A 4IMIB 4BO9A 3D5TA 3HNRA 4HWPA 4EECA 3UPQA 4I3HA 3SWWA 4PZAA 2G3YA 4BGEA 1LB1B 10MHA 3NBXX 2YIJA 4JLMA 2C3MA 3RTCA 1W75A 1ZSNA 1NF8A 5TMPA 1SWWA 4KLJA 5E7JA 3AU9A 1OI7A 2VH1A 3M82A 1DS6A 2BFDA 5IH7A 2YB1A 1JIQA 1TUBA 3FOEC 5BSHA 1MSWD 3UK0A 4KLRA 3TAQA 5FWXB 3RRBA 1W4CA 1XL0A 1O97D 3KWFA 2LIPA 4MI1A 2W3RA 8ICHA 4YRDA 2BTOA 5J2TF 4YRMA 3C6QA 4HQKA 3T94A 4X3OA 1YRAA 5U1PA 1Z56C 3S7ZA 1H2BA 2Z04A 5H3LA 4Z6DA 3K0FA 1DAPA 2FEOA 1CI4A 1AK1A 2RC6A 3OTHA 5EPEA 3VUEA 1H0SA 1Y7LA 2BFFB 4N7MA 4W8GA 4QUHA 3BREA 1GPKA 1ZGBA 2IXEA 1WZNA 5KYGA 2O7VA 4GWLA 4B4DA 4KAAA 4Z0PA 2GO1A 2XCUA 3HCCA 4H7PA 2A59A 3IURA 5KEIA 3G1TA 3SPXA 4ECTA 5CB0A 5CPBA 1IM4A 2W7PA 3NYRA 3NEYA 4C0QC 4BE4A 4UTXA 4ZALA 3E81A 4IDCA 2AFIE 1V5WA 1S0UA 1IUKA 1T1IA 2AZMA 2AC4A 4YLGA 1XTQA 3M9WA 3LT2A 1WW3A 2PLNA 4URZR 2IV3A 4R66A 3G2IA 4YXWA 1ZU4A 4RTSA 3OPQA 2IHVA 3V2HA 4D9KA 4DLBA 3W78A 3I9NA 3VV3A 1WUYA 3VPFA 3NOXA 3KYDA 4GOLD 1KO7A 2WD7B 4DCCA 5T57A 5BYBA 3IJ5A 3SHTA 3E3LA 2CEAA 3WKBA 4HQFA 3FNQA 3MJEA 1SV0A 1QQ5A 3LNCA 3EIUA 4UB2A 8AT1A 5EQTA 4RM3A 1WMBA 4O2AF 3D31A 2QG6A 4E09A 3ONNA 4UFOA 5ADUS 1KEEA 5FV4A 1SPBS 3ZWPA 2VHEA 2WHPA 4K9KA 3KYIB 2ILVA 4WFKA 1O6CA 2A19A 3BXGA 2JAXA 4WADA 2QAGB 3RKSA 1DHTA 1XQXA 4PPYA 5C1BA 4Y2QA 4UCWA 1BPEA 3LLUA 4FFMA 4HADA 4M1TA 3OE4A 3S1AB 3REFA 5BR1A 4U2GA 1SKYE 1GITA 3QTTA 4RKFA 2AFHE 4NLNA 4S0XA 1SC1A 5B1EA 3A36A 4RJKA 1XI2A 1EA5A 4HB4A 1ZJMA 1XRJA 2ZWIA 1P5RA 4B2PA 2BWJA 3MSCA 3BE6A 5IPFA 2I9PA 1HT0A 1QSLA 3HWSA 2G1JA 2Q1WA 1OBHA 4UXIA 1T7PA 3OZBA 2KI5A 2X7JA 4RQ4A 1HT3A 3CH6A 3FMFA 4CQMB 4HNTA 5EJIA 1GL3A 4ZMBA 1KI8A 3GU3A 3EEQA 1VCHA 3RTVA 1DT3A 2EAOA 1OPRA 1JPNA 4QZEA 4IIEA 2NU7A 1US8A 1XU4A 1UBCA 2Z2ZA 4BATA 4CKBA 2J5RA 5J2TA 1UIRA 5JYBA 4BV9A 5SZHB 3DXZA 3I5MA 3F47A 1V0JA 3JVDA 8ICWA 1A9RA 4K03A 2HVIA 1BX1A 2VPPA 4PZEA 5A62A 3DZ8A 2ZIWB 4BCBA 2VYVD 1VLMA 3EGOA 2VYNA 2GKSA 4YRSA 4JUAA 4K4HA 1O2DA 3K94A 5GVSA 4K9DA 4U6QA 4ABTA 4IOJA 3U37A 4KPYA 1ZQAA 3EGVA 3PHHA 4OUDB 3L4SO 4Y2TA 4EKYA 3AESB 1DUIA 1HUOA 1OWMA 1IY8A 3MWFA 3O38A 1G20E 2X4IA 4R2KA 2Q5EA 4QPPA 3L3BA 2KPOA 3B12A 4B40A 5JZOA 3I2YX 2SECE 2FNAA 5FFNA 3JWJA 1GXSB 5HCNA 3IYLW 5GIOE 1YI1A 4XVHA 2EF0A 4F5YA 3DVRX 2AE2A 4F3RA 2GFHA 2HF7A 1QZUA 2H1IA 3IB3A 2MTBA 2PSHA 3VTKA 1UIMA 2XGMA 2PKQO 4PHPA 3ECAA 1RWQA 1UPXA 5KU7A 4LJ6A 4V3CA 2Z2YA 1GGMA 2F1IA 1ML4A 5C4IA 1VJGA 3AM3A 3DOHA 3C85A 3LRPA 2WTAA 3MEQA 3TM4A 3JZAA 4G0UA 2H1OA 3RIEA 4N65A 4O2AA 3C7TA 4WJLA 3K0BA 3BG5A 2Q5JA 3HO1A 2O0HA 3A6JA 2JRCA 1E2NA 4H7EA 3HCBA 2BGJA 4N3NA 2BUCA 4L5BA 3VC7A 1QHYA 3PD1A 1G55A 4EYEA 3HY4A 4ESOA 4DRXB 3LVQE 1QIGA 3TQIA 1N5MA 1EKXA 1WSWA 2GETA 4YONB 3SQWA 1D1QA 1P1FA 1CUBA 1MABB 2PYIA 1FCJA 2A84A 5G4LA 1E7YA 2NTNA 1Z0IA 2DETA 3LPCA 2VP3A 4XCQA 3PXCX 2H29A 1ZQYA 1VSTA 1FX1A 3RUEA 3N7TA 3QVGA 3SSAA 1HZZC 1KYXA 4WEQA 4OQ4A 4F4HA 1MH9A 2WWTA 1ZJZA 4IR7A 3RD5A 2JJQA 2FH5B 3PSPA 4NBLA 3OLCX 3DP7A 3HXLA 1R6XA 1EH5A 3ROXA 1GR1A 1QCCA 4KSBA 1U8CB 4PBTA 4QOJA 3UKJA 4QXAA 3FMIA 3Q8XB 1RMTA 3TINA 1YOVB 5EPUA 1E92A 3NDJA 1XR3A 3P0RA 1EHYA 2IOFA 2NQ8A 5E6UB 1OVMA 1SVSA 4GP6A 4EA7A 2CNDA 3BUSA 4RAQA 1WF6A 1X70A 3PC4A 3HUFA 2FUNB 1ACMA 1U2ZA 2DJIA 2ZQ5A 2HYIC 4TTIA 2CNOA 1XJQA 1EJ0A 4KDCA 4J9OA 3BKXA 3VPGA 1XEWY 5CBPA 4X84A 3A0UA 3ZCPA 2QW0X 4ECZA 4PV7A 1NW6A 2FR8A 5A02A 3UJPA 3S8EA 5BN4B 4YRBA 5LMZA 2UAGA 1Q2XA 1FYEA 1ESEA 1GTG1 3FTNA 2D2XA 4YXFA 2ICAA 2Q4EA 4B80A 1P3JA 2E49A 1F6BA 3GF4A 1B8PA 4RZSA 2EBFX 3UQ2A 1N1DA 1E2JA 4ICIA 5GM1A 4NQZA 2L42A 2XHZA 3ZWNA 2DHCA 1GL7A 2GLTA 2WP8J 4PYRA 4Q16A 1P0PA 1O94C 1W5FA 1SUBA 4FHFA 1LKYB 3QJ5A 3O8RA 5FA5A 4Q8FA 3DD5A 4JLPA 5JS8A 3B9JA 1XTVA 2NTJA 2V45A 4LNHA 1E9FA 3EDYA 4FNMA 4A6XA 3GJTA 4H35A 4B7ZA 3LFHA 2UYYA 3OIWA 1XNGA 1VL5A 5AW1A 2EW2A 3HVHA 4DQIA 5HWSA 2YJGA 1B93A 3GLTA 5FDFA 1Z5NA 4IM7A 5B66U 5DBFA 1YBHA 5SV2A 1ZYQA 2HX1A 2NYAA 5IINA 3GRYA 1URPA 3LUFA 1QGED 2YNMD 4AJLA 1H2ZA 3WVNA 1CEQA 5I7SA 1IXSB 1DKOA 4PCAA 3A9WA 2WM2A 3O82A 2W4QA 1H0HA 2OM2A 1HBJA 3VNSA 2OWOA 1MMFB 1YFKA 2QUBA 1SRRA 1DJLA 4ZREA 1M6YA 3N3AC 3L6OO 3LK7A 1XLTC 3DYIA 2RJNA 1TB4A 3BCSA 5ICCA 4Q6WA 2G5HB 5J0YA 4UUAA 3PK0A 2C3YA 4PLTA 5LMUB 2DFDA 1BDBA 3CZAA 3CVWA 4MRPA 1H2RS 5LBIA 3NRWA 1XCBA 3DTNA 4D3ZA 2P9JA 2J33A 1X39A 3I9MA 1XL1A 1GPMA 2GN8A 4AYWA 2EJVA 3CGWA 3R8CA 1E63A 3EGCA 3OE7A 4MV4A 4ARZA 1ZWLA 3C87A 5H68A 1H5UA 3ZDQA 2IA6A 2C7GA 4DANA 5JOQA 3PR1A 4K6OA 3EGDB 2XR1A 5KTOA 4C5CA 1SK8A 4X24A 1X80B 1G5RA 4GXNA 2ZSAA 3IJEB 1CFJA 1RYHA 4KEAA 1D2CA 5H3CA 5T8KA 4B9EA 3EXHA 5GQSA 3A9VA 5MN4A 2XRZA 2J6UA 3DLBA 1JGTA 2PANA 2P4HX 4CYMA 4LYFA 1Y8QB 3TSYA 3RR7A 1KTIA 2Q0QA 2BZFA 1ORVA 1DIOB 3ZLBA 5IDVA 2WE7A 5TQVA 2EWWA 4D3XA 5JWOA 4H0NA 1NFRA 1X7DA 4PGXA 1SZDA 4X20A 5I7OA 2G8LA 2FMPA 2TMDA 5GTIU 1ZD2P 4UM5A 3RVRA 3PW0A 2Z4TA 4O3NA 2XVMA 1D2AA 5BN3B 1THTA 4V0OA 3FZGA 5KFQA 4QZAA 2CCKA 2EQBA 2IHTA 2B4AA 4P82A 2R5WA 2ZW9A 3SF8B 2QD2A 4GZ6A 3QZUA 1J33A 4RU1A 2Y68A 3AO0B 2J3LA 1TD9A 3QA3E 3DLCA 3G68A 1VRVA 3LTNC 4H17A 3GJ0A 3WG9A 3FBWA 4YX9A 4DLKA 1ZGCA 4EY8A 3PWTA 3DPUA 3GJRA 4TTQA 5AKHA 1YHZA 4D97A 3AB7A 2XUAA 1N3BA 1XEAA 4BMZA 1I80A 1EPUA 3VO9A 2ZWAA 4LBVA 3M8RA 2FOXA 5KO2A 1KDVA 3F3YA 2J6IA 3E7WA 1HYGA 2FQXA 3RFUA 2D7DA 5JAPA 4O5OA 2ASJA 3HN7A 5EYPA 2HXSA 3VDQA 1JYEA 2BFAA 4RF3A 3RS3A 4BECA 2H59A 1X7YA 1SQSA 4UTVA 2C7OA 1JAZA 5J4VA 4FS2A 4TLLB 3JATA 4XUDA 3WOVA 4PG8A 3SFZA 2V4MA 2YDXA 3C5VA 4NBVA 1G6KA 4DAEA 4W6QA 5LPNA 3SYNA 3CLSC 1H42A 3PQ8A 3ZX5A 3KHHA 2PN1A 2GCGA 4WK2B 5JCZA 1JSXA 5BNZA 3O3OB 4BUGA 4WRRA 4TM7A 3HK2A 4BPRA 1NMEA 3PNCA 1AXGA 4LY6A 2OXTA 3LGXA 1FMFA 4TOIA 3AV0B 3EC7A 2E82A 3E9CA 3M6IA 1V7ZA 4HLQB 1Y3AA 2LD4A 2R44A 4PICA 2VHVA 3BGWA 1YVRA 1UCVA 4MHOA 1E96A 4BP3A 5CFOA 1SXJB 4IKOA 4GI2A 5I9NA 1DAFA 1FU8A 3ILVA 5DWQA 1D07A 8ICRA 3OZFA 3EZ9A 1GGKA 3O5AA 3FX2A 1M2WA 2X8WA 4U02A 1UBOS 1Z3CA 2GZ1A 4BQOA 3EGXA 2QYHA 3H9JA 4IDAA 3SYZA 1MGPA 2ZRJA 4MGHA 2I76A 3ZUPA 2WIJA 3FY4A 2DL0A 2R60A 5KI6A 3WWPA 3QFCA 4TYWA 3H2GA 1V9CA 3TSZA 5K45A 2GHTA 4PLPA 5KAIU 3QRWA 1BEEA 1PNTA 3BWBA 1RWBA 2AEMA 1SU7A 2QD3A 4CF5A 4YJDA 3AR9A 1RM5A 3W2EA 3C24A 1Q12A 3DZFA 4R6WA 2G72A 4EZ9A 3DOIA 3DMYA 1GWNA 3UFXB 2AF4C 3M4NA 2B36A 4UHFA 1ADGA 3B85A 1YHNA 1OV4A 2PHZA 5HYVA 4ACOA 3ILSA 3AUTA 3KKKA 2LM4A 5GTDA 5EXDA 1E2FA 2DULA 3KLMX 4ZWNA 1PZEA 3M9XA 4X7MA 3BX1A 3OFKA 4O1MA 2FPSA 4Z54A 2ECFA 3TQOA 4G84A 2BFEB 2X9NA 3QOWA 4QO8A 3STUA 3RQSA 4YREA 1G18A 1X42A 2G88A 4PCUA 1PE0A 1XP5A 1QIHA 4JA0A 2OC4A 4JQZA 1SKBA 1AHIA 2R8YA 3GI1A 2G4VA 3TTWA 1MX3A 2Q8PA 4KIGA 1RYDA 1SV4A 3A1WA 4B8YA 5KDOA 1FDVA 5AXDA 4TZ0A 2PYZA 2SKEA 5DBIA 1B74A 3V7JA 4FZRA 2IYXA 3O0DA 3U44A 5JRTA 3L0ZA 5IT5A 1SU4A 5DF1A 3T95A 2Z7JA 3GLVA 1OFUA 4YBRA 5TDHA 4N41A 1N5WA 1DEOA 1VL0A 3R7SA 4U7JA 4KO3S 2QAJA 3B8HA 1O9BA 1CY1A 4KUEA 1TEXA 3Q7EA 3L6UA 3JQ9A 2EP8A 4Q4JA 3MRTA 3VMFA 2EH9A 1G3RA 1CVIA 2VNHA 4BS9A 5KFGA 1VHWA 2PAFA 4DDMA 1I01A 1C9EA 1N56A 3M6VA 2B8TA 2DEUA 1OFVA 1KGSA 1ULBA 1R8JA 4V24A 5L9XA 3OLYA 5CB4B 4HAYA 2ORVA 5T67A 4DTCA 1V1JA 1QMPA 1HUZA 4ZCSA 4EG7A 1E61A 3RAFC 7ICSA 4M0UA 4O1IA 2Q5CA 3VOTA 3WWZA 3COPA 1D9DA 4BMPB 3OIFA 3R4CA 1KI3A 1U0TA 1QU2A 1XTRA 4E4RA 2NPFA 2AVNA 4GR5A 2PIDA 3NT2A 1PL6A 2RGBA 4KP7A 4OGKA 4B4WA 4IHQA 3KXLA 4CT0A 3ZJ4A 2CXRA 1YU9A 1I24A 2GZHA 2IPAB 4HLUA 5A4MS 2PX4A 4OHWA 1CNFA 2XJ4A 1PK3A 4FQ7A 3SBDA 3FD8A 4HOYA 2QLFA 3W2TA 5ICEA 5K0ZA 1T24A 1UANA 5CCDA 5T4BA 3H99A 4ZCRA 1Y5RA 2OFXA 3MMPA 4JUBA 1N0IA 2NO9A 4BGVA 4RZ3A 3L7AA 3R24A 4NU0A 3DAYA 2I55A 4C03A 3VU8A 2OV1A 1QV9A 2PWPA 2FUKA 3VSEA 5FWXA 4M49A 5DQGA 2BKXA 4S24A 3NKVA 3TIGA 3ENQA 1HI9A 2VLIA 3N28A 3ONEA 4QZFA 3KUXA 2AOVA 1IDN1 3ZWCA 2KQUA 2L82A 2WKQA 3OUTA 1XLVA 3CF0A 1QOPB 3R0JA 2BFPA 2BFFA 1WUHS 2H3ZA 4EITA 1CZHA 2YVAA 5COBA 1UHUA 3RFFA 3TRFA 1HA3A 2IZ5A 2HADA 2DVMA 2A1AA 3ZWXA 3K70D 3LVBA 3SYKA 3WK6A 2PT7A 3WJ1A 1XTPA 4MX8A 3W1WA 1XZQA 3DOUA 4R41A 2OKGA 5KNCA 4IXDA 4BC0A 3MBKA 1VKOA 4JU8A 1T2EA 2FMIA 1TQ2A 1YR8A 2X13A 5CFMA 4JLOA 1SGGA 1XKTA 4RK5A 2P6NA 1NXTA 1ZQIA 1YJAA 3STTA 2RIPA 4PXSA 5JD6A 1PSZA 2EX4A 4PY2A 1FVHA 4FR2A 5HKOA 5KG6A 3PR5B 5CH3A 2KHVA 2HO5A 4QVIA 1FNSA 4F4IA 3BMCA 4Q0MA 1UBKS 1E9RA 4G5HA 5SY6A 2WD7A 5EL0A 5TJ9A 5L1KA 4JC5A 4C0ZA 2KLHA 4E5SA 1W0KA 4OXRA 1ENPA 4HRVA 2MINB 1DC4A 4ZVSA 5B36A 1K97A 3OCWA 4QZBA 4NPHA 3VSDA 4LC9A 1NVAA 1MQSA 4HXYA 3QUSA 1FE8A 3OU7A 4G1MB 4X54A 1I2BA 3QOYA 1WWKA 1N5IA 1YZ6A 4PGGA 4UNNA 2EF1A 1W2HA 3UMVA 1THMA 3RVPA 1VJCA 1RSZA 2JGDB 5AUQA 1PT7A 2H2GA 3A4IA 5C51B 1NLZA 1Y4SA 5ADVA 2QAGA 2Z30A 3OHPA 1WNTA 2ZK7A 1Z7YA 1WB6A 1R66A 4M9SA 2MJLA 4TWIA 2BPFA 3COVA 1XKQA 2QVCA 4FFSA 3WGNA 2BHSA 5AUNB 1PQWA 3GJQA 5JU6A 3ERCA 3GJ5A 1RPLA 5AOAA 1G3MA 2G1KA 5CK4A 5EE3A 1F2VA 5L4LA 4CF6A 4OJKA 2H7YA 3KM0A 3DVAA 4OL0A 2K4HA 1VSBA 5TIIA 1H3NA 1PQPA 4XCXA 2B5OA 2NU8B 2IMWP 3FR8A 4MUGA 4F93B 1Z34A 3JQBC 4B2LA 3BH6A 3E8XA 2Q1XA 1BMTA 2WAXA 4YMSA 3JRNA 1WSBA 3RCBA 4JD5A 2GWHA 4K0RA 1DBRA 2JEFA 5CGZA 1T1JA 4V1CB 1XXHA 3AH8A 1WLSA 3ETDA 3C45A 2Q3BA 3NTQA 1RRFA 2P2ZA 4DMRA 4B44A 3OQ6A 1J5EB 1PZNA 3ICOA 4OREX 4IEFB 4DE5A 1JLMA 5DG8A 3AESA 4G5SA 3H17A 4CL8A 1Z4IA 3ZHSA 1CUAA 2IUYA 1XTZA 1BXRA 3D2CA 3DKKA 4FMCB 4RHCA 3KVRA 2RSLA 3EDOA 4EFLA 4UUMA 4X0EA 1YZVA 2R8BA 4D92A 2GEFA 5ALWA 2Z9CA 5JHGB 5DIZA 1VXOA 2XGQA 2HIAA 1UKVY 2QRZA 5IXJA 3KQPA 5HHHA 3IEIA 1T8TA 2WYOA 5C81A 4CI0B 3HNPA 1DBQA 1LVGA 3DNFA 1JR2A 2DMRA 2ACVA 3DC2A 1ST3A 1C0KA 1CDEA 4UAYA 5EJFA 3MT9A 3EQ6A 4MCIA 1NURA 2YH2A 1RI3A 3RU2A 5HOEA 5EQJB 4X60A 1G98A 4Y2PA 4YQEA 1IXRC 1MUUA 3O8LA 4AY5A 4PYIA 4IIJB 1PR5A 4Q01A 4KGZA 2X9GA 4BY9E 2GM3A 3TZHA 3UPDA 3GH1A 4ARSA 4MUJA 2PGXA 4DRXA 2A92A 2Z08A 3V7NA 1EB8A 1DO8A 2YV2A 3GJZA 4NMWA 3RFTA 1C3JA 2C3PA 3KE9A 3V6LA 1G5TA 1NASA 5A9RA 1SUPA 4QLOA 3INTA 2P6UA 3PPVA 4OLBA 5BRAA 4RE6A 4UJ5A 5L45A 2KW5A 2BQRA 4PYJA 2FPXA 4G8JA 2X3FA 3FCYA 4YRQA 3O91A 2HA5A 5FB3A 4F56A 3RHSA 2PMBA 3RH0A 3EVDA 3OJUA 2CNNA 1YVDA 1AGNA 1KS2A 1Z0JA 2OA0A 4UEQA 5KFLA 1O96A 3E82A 3TUJC 2F4NA 1H22A 2AFVA 2ZJAA 3GXBA 1U3GA 4X1KB 5D3MB 1GU0A 4WHMA 4WERA 3PNPA 4CNBA 1SQGA 5FWYA 1N2ZA 1NI4B 2H92A 5IZ4A 3Q8MA 2O2JA 5MGNA 4NFYA 3VHQA 1O6BA 5JQGB 3OOYA 3RYTC 4J7AA 1EVQA 4FMPA 5A3QA 4ZJYA 5DBHX 3M3DA 5MHTA 1FY2A 4S1WA 3R9WA 2C4UA 2YWHA 5TQ2A 1MKYA 2DH6A 4ARCA 4LYYA 1Z47A 3ZBPA 2H9IA 4IICA 1G7TA 2ZYHA 4RVDA 1W76A 1YOVA 1RZ3A 4F6CA 4XYMA 2E1EA 4HXEB 1Q0UA 5E6UA 3UC5A 2E4YA 1OUQA 3VU9B 2B8WA 1N7GA 5DK4A 3B48A 1ZCJA 3N0XA 4KIWA 5HF8A 3OH8A 1I3LA 1HDYA 3G2MA 2Y1WA 2GJSA 2PR2A 3K1ZA 1J8QA 4KXYA 4LA4A 1PP4A 2KM1A 3WDSA 1I7QB 2WSMA 1TE2A 3BA6A 3TK1A 2VPQA 5BN4A 4KR0A 1GU7A 3PFBA 3VDXA 2QIOA 1P72A 5K0TA 2DR0A 1GV1A 1LBIA 3D4LA 4PAMA 1OHHD 4YGXB 2UVWA 1V85A 1KS9A 1R0CA 1W7AA 1T6YA 4UPVA 1NN5A 4MPDA 4D81A 1E0SA 3IQGX 4W5TA 4G3XA 1T8SA 3JTMA 5ESRA 3M8KA 3GH3A 1JHXA 5DNCA 3C1AA 3VNRA 4R2XA 1XD2B 5DHPA 4OA8A 5C1PA 5G1NA 3OCUA 4ITRC 4YI3A 1LKYA 3C5HA 4BU0A 4ZT5A 3FCXA 3WHKA 4BJQA 4FTWA 2JFVA 3EOZA 1SZHA 4GQIA 2N1BA 4IDHA 3I9OA 2AQIA 1JFTA 4CCHA 2DUWA 4LZOA 1P31A 2GBPA 4YR3A 4IFIA 3WGLA 1WL8A 4AN0A 3L8ZA 1FDTA 4HB3A 5IIJA 2OKCA 4EDFA 4P4SB 4NDAA 4B5LA 3FKJA 3MR5A 2PQ6A 3IP7A 4QG3A 2KE5A 2ZAGA 3QVJA 1OH6A 1SZCA 3MFHA 3E84A 3EZXA 1B0XA 4ZOHC 2VQSA 5I3ZA 1PF7E 3IKVA 7AT1A 4ZK6A 4M0EA 5F7ZA 5CFPA 4H6XA 2Q5OA 4C7OB 1L3CA 3K2QA 2VT3A 3BZBA 3K0CC 3QNWA 4IDBA 4OQXA 2BFMA 3K75D 1M2VA 4Q3OA 1Q6YA 1XF9A 1R6BX 3TFOA 3BRSA 4YB8A 1HPLA 1DRGA 3PW7A 1DB3A 2FQWA 4MEJA 4V0SA 4GYKA 1QP4A 4RVHA 4NY8A 3OFND 4UDYX 1V7CA 2UZ0A 5HDBB 1LLDA 3WRYA 1ZM4A 4ZGWA 1WVMA 2Q3MA 2Q6LA 2PUJA 3OESA 4DQXA 2R79A 3FF1A 1RJDA 4G01B 4JX8A 1T0PA 1PLKA 4ZVNA 3EGDA 3EUFA 2DGZA 4M1KA 3N7UA 4I2VA 4I5DA 3RRHA 1GHTA 1X80A 4XARA 2IL1A 4GLXA 2WLSA 3ZH9B 1E6LA 2YXPX 1ESDA 3KUDA 3U7FB 2UXCB 3HT3A 4XSVA 5CYFA 5ED0A 2ZLBA 5DLEA 2V5AA 4P53A 3TRIA 3W6PA 4BO0A 2Q4OA 1RM0A 1MQ3A 1E59A 3QPVA 2N42A 4UNQA 1OGJA 3OY2A 3G89A 3HYRA 1HM5A 2DY1A 2NAPA 3U39A 2N46A 5ENVA 3KKMA 3U6BA 2FLKA 4XUEA 5LM3A 1TQ6A 2WHEA 4I2JA 5ALKA 5HGJA 3LVRE 1Y1TA 3A05A 4X92A 3MG9A 3OKPA 3FTDA 3RRFA 1CS4C 4PJ0U 2R48A 1N0VC 2EJUA 3H2IA 1LNZA 1WMDA 5K3BA 1XWIA 2HF9A 5J2DA 1LDYA 1N61A 4RZUA 2YVUA 1BE8A 3FCOA 4EG4A 1RFLA 2RBKA 1WPQA 3T4XA 2FKAA 3HEAA 2WAOA 4E12A 3F2DA 3F5EA 4DG8A 1ZQZA 4QWCA 1UMDB 3UBTA 1I36A 3L0CA 4B9UA 3ZIAD 4A82A 5JXGA 5AJVB 2O2GA 1U0LA 5CP8A 2C4NA 3B3AA 2BHRA 3RSFA 1Q46A 2HQRA 3QMWA 3OE1A 4JB3A 4AN4A 2ZU6A 3K5HA 4MIEA 4IS2A 1E1DA 2XD4A 4F3CA 3PX6A 5L4NA 3D2BA 2BBSA 4ETIA 1ECWA 4UE2A 4HAXA 4DEXA 3PGA1 1KE1A 4G5FA 3KZVA 2HA2A 1KI2A 3B7GA 1U4SA 3HHPA 3SCZA 1B7GO 1I6KA 3ISJA 1J20A 4NJOA 3S28A 1E1QA 4ZAGA 5IJZA 3DP9A 5C8XA 4LZJA 3OZGA 1U02A 5TGZA 1NVBA 1G19A 5CXUA 5FYDA 3K9HA 5JNSA 4LC1A 3KXIA 1QP0A 5TSDA 5IM4F 2DSTA 2WVJA 4Z86A 2P7HA 1K4KA 3CVOA 3NRBA 3RTGA 1L3IA 2BP7A 4GNRA 1NL3A 4KKXB 7ICLA 4Z0HO 4FFDA 1V39A 4MR8A 4EYSA 1QPZA 2K89A 4ZRNA 2Q6VA 1W2WB 3M6UA 3VR2D 1I10A 1Y63A 4Y30A 3P9NA 4EOGA 4XOIA 4HGPA 1YMUA 2PLWA 3D7MA 1OI2A 2IVFA 4NYIR 1IBKB 2BF7A 4TMXA 2DT5A 5A9SA 5DX0A 5DGCA 2GVDC 4CEHB 4MB2A 4UAJA 4KYIB 3G0DA 4B73A 4MAMA 4RH3A 3JQGB 4BBAA 5AI5A 4WGGA 1IM8A 4UREA 4AS3A 1TVEA 1SHZA 2QYSA 5DXJA 1UXOA 3EUB2 1XTIA 1WXEA 4QFBA 4YRKA 2Q2QA 3INGA 4I4TB 2QKQA 4HCJA 1UT8A 3NJRA 4EBBA 2Z3ZA 3Q10A 4BP1A 4QVGA 3QVMA 3L6BA 1OH8A 2FR0A 1Z62A 3Q85A 1DKUA 1B6GA 3E2PA 3TKLA 1GNQA 3JCZA 1USKA 3KVYA 5DCUA 2JKZA 4OLJA 3RADC 4MINA 3L49A 5IIMA 1N2HA 4I2GA 5EQDA 2I6SA 3OQIB 1ZWKA 4ZU6X 4UCXA 3EGWA 1CEXA 2KG5A 2YHUA 5JTTA 3N76A 5BRNA 1ECPA 4E5UA 4ID9A 2Y4NA 4WNCA 1A5SB 2JLRA 5DHUA 3OQNA 3UXYA 5AXAA 4LPSA 2F1OA 1Z4KA 3FC4A 3IE1A 4RA9B 3OJXA 3OICA 3DEEA 4PL1A 1SBQA 1FZTA 3DONA 2WUVA 1K9SA 3C1YA 5EXEA 2BFEA 4PANA 1VRCA 4B8ZA 3TJRA 1WTCA 3AONB 4NONA 121PA 3LWZA 4FGUA 2K2WA 1YJXA 1U1CA 3A4NA 3LDHA 1AJEA 2A78A 4A1OA 3N2KB 2VKTA 3IV6A 3T5MA 2VDKB 1T3GA 1N9GB 1QB8A 1Y4ZA 3L9WA 4DKJA 1Z2OX 3NDRA 2LCQA 3ANTA 4ECWA 2BZ0A 1XXLA 3ZNQA 2H3VA 3AGQA 1GTVA 3I5XA 4DUGA 2IVZA 4YT4A 2EW8A 4NM2A 2BRUC 2LE0A 3WLIA 4UVGA 4XEUA 1S8OA 3GBSA 2RRDA 4FO6A 1LI4A 3HO8A 1KP3A 2BCQA 4C29A 4TTVA 1SBIA 4FJ2A 1NBIA 2G5IB 4QJBA 1RC0A 3UVEA 5TXGA 4EHAA 5IM4A 1B8UA 2XBLA 4RIHA 2DPMA 1XXHE 4YRZA 5EC8A 3L1VA 1QUFA 1Q7EA 1I6LA 4DFMA 4L15A 1D04A 2D1RA 1A7AA 1EBUA 3JQAA 4IDPA 1ZUNB 4X41A 2QSUA 5B4VA 3PNMA 2JJ1A 4ZPXA 1K1SA 4AUNA 2QQEA 2BJVA 4EZEA 4RE5A 3NWJA 4OQEA 1R15A 1ORTA 3A2LA 5EZYB 1AM4D 4AG3A 4G2TA 1U8XX 4GMHA 3VR5H 1KK3A 1UOEA 2OFPA 1TJ4A 4RDXA 2WJVA 1ZD9A 2PWZA 2XDWA 3H9CA 3CLRC 1OE0A 3TQSA 3IUPA 4NCBA 3UT0A 3V4LA 1OBCA 1N2SA 3L8CA 4WWHA 3RS4A 4ACBA 1QP7A 1VPVA 2IBTA 1OXJA 1RXEA 2B30A 1WP4A 4NLGA 3VR3A 4KYVA 4KOAA 4KLCA 4AX4A 1MJFA 2G40A 3U7HB 2AB0A 3NBYC 2G07A 4EA8A 4DS4A 1FEZA 2UUOA 1RI4A 3BIXA 4N3GA 4JITA 3TL2A 1E9VA 5TE9A 1YB4A 1DX9A 1YAJA 3IA2A 1CNEA 4JBXA 4YUAA 1UJ6A 1R16A 3OX3A 1PGNA 5JTUA 1FFSA 4NV0A 4DOBA 2CNWD 5AESA 1YDMA 3Q7QA 2J0SA 3BL8A 2I3BA 4TTSA 3IEMA 4Q39A 4JL5A 1UOQA 3ZEIA 3HKEB 4MB6A 4EABA 2EZUA 4KOEC 3KIPA 2QJFA 2Q3HA 2BELA 1PL0A 2QRNA 3N39C 1JKJA 3MWJA 4URXR 2QJTA 3B20A 1Y6QA 1O0CA 5CH8A 1T3SA 4OEHA 2YRXA 3ND9A 4DFJA 4TKZA 3N8IA 2R8EA 1RM6C 5LL6P 4BNKA 2RAUA 2FPGB 2XOKA 3SQDA 3L6DA 5INTA 4RYLA 2JVKA 2Z95A 3IELA 1X40A 2FFJA 2X0JA 4AMVA 3EVTA 4NEQA 2K4IA 2ABWA 3C6YA 3VISA 5K3AA 1MEOA 4CKZA 3DMFA 4EKEA 4CLEA 1F44A 4QGHA 2X5XA 2QARB 2FX5A 3N07A 1IULA 3PXBA 1AKUA 3O93A 3AJEA 3FMPB 3IEUA 3WXBA 4BHTA 2HRQA 5B1HA 1KGDA 1XVTA 4P33A 2H4WA 2VP4A 4RD0A 5FR1A 1AQ6A 1B22A 1ZK1A 1E4EB 4HDQB 2B5WA 3NHJA 4DLZA 1MAAA 3QYPA 1UAGA 3E7DA 3EVEA 2ZCJA 4C8LA 4M38A 3K5WA 3R0IA 1ZJYA 2C1ZA 2A5DA 4ESEA 4BNJA 4HGYA 2HPZA 2MINA 2VK2A 4BTEA 3TBKA 2VT6A 1U90A 1WY5A 5REQB 1UBNA 1I51A 2RMKA 3KB2A 4EG5A 1JP7A 3REGA 1A5BB 1F5NA 5KYYB 3CUKA 2JIPA 3KBOA 2BEVB 5AHXA 5CVDA 4RQ7A 3UGQA 4M98A 1I4EB 1P45A 2LDXA 3ZVRA 5BPCA 4ZCQA 1U7TA 1FDOA 5HDQA 2NO6A 4ER5A 3W9YA 4G41A 4MV0A 1HKUA 1EIZA 1V5IA 1T1EA 2AC7A 3TSAA 4R71A 1XV5A 1M1NB 1YU6A 3BD7A 3KJGA 2FWAA 2A3RA 3ZJTA 1RKBA 4KODA 4FNAA 1UJ5A 3DW3X 2Z58A 1QWOA 2HHVA 2VF8A 5AKXA 5D00A 3JPWA 4H1UA 4AQDA 4QZ9A 4OG2A 1NKTA 4Y9SA 5BUQA 1J9ZA 4BFVA 4B81A 1U1FA 3BMQA 1WCXA 3H1TA 4HGNA 3UAYA 4WLVA 5EOZA 1X9XA 4U9IS 2I2BA 4RA6A 1YUNA 4HQ6A 2NU8A 3FPLA 5EVCA 4A2WA 5JQGF 4V38A 2N1MA 1RKUA 2A9QA 2W9AA 2OZEA 1IPHA 2C92A 2P2NA 2YXBA 3PQ5A 4EI9A 3HN2A 1WTAA 1JA1A 1HE2A 2DLDA 5EIBD 4PNZA 2A67A 4X7RA 4V1CA 4Z6KA 4M1OA 4MVJI 5E1BA 1LSUA 4TZKA 5FOSA 4IGIA 3CBQA 1N6OA 2CXTA 1QQTA 2B7CA 3MGHA 4BVFA 2QTLA 3D0OA 4MNTA 4BV3A 2FG5A 1HZJA 1JSCA 4IIHA 2ZI9A 4LCJA 2UXDB 4LNAA 4YMWA 3M81A 4YJFB 3DFZA 3ROTA 5ERGB 1AUXA 2WYIA 3IVRA 4YCXA 5TX7A 1YFJA 3I04M 1Z0FA 1E32A 4XIYA 3EUAA 4H7KA 4UQLA 3I9JA 3PC8A 1F8GA 3WGTA 4EK9A 2O05A 1X8JA 3FWZA 4B34A 4D98A 3INNA 4QREA 3VU1A 1G64A 3OT1B 2O3QA 3SNHA 4MYCA 4YP6A 4W4TA 5ALOA 3SYMA 3GRFA 2YUIA 2B83A 1UKEA 4CIYA 2WINI 4L0MA 4YCNA 1ZDMA 3V6MA 3EVAA 4TT3D 5K0EA 3L8DA 2OD9A 4MS1A 4HLDA 2XLBA 721PA 4J9NA 4KBYA 3ESXA 4XYEA 5DHTA 2YJ6A 2P27A 2WMOB 4NATA 1JQDA 4ED1A 2MSWA 2R8XA 4OJ5A 1P19A 4MQEA 5C7IO 2ZTUA 3BFPA 3M1AA 4OH1A 4L8WB 4O6VA 3HW8A 4HDRB 1T9DA 2QWXA 1TD1A 4A4DA 4P0QB 2RHDA 2Z4SA 5E4TA 5AOBA 5HE8A 3OMLA 5T64A 3BDPA 5KFRA 4YR7A 1FU4A 5BN5B 1ZM9A 4E30A 3KVOA 3SHWA 1D0SA 3P0FA 4GBJA 4M8NE 3FPEA 1T2FA 4ZHQB 2W9CB 2Y92A 4FKZA 1F3LA 3W2IA 1XCJA 3JWEA 1Y1QA 4FQ5A 1J0XO 3W8NA 4BE7B 1N9KA 3HRHA 2C2GA 3S4YA 4JJGA 3IAFA 1C9NA 1OROA 2C1XA 4X1KA 2OYSA 3Q8RB 3O4VA 1ZEJA 4ZDKA 3H5RA 4KDRA 1NI4A 3H4MA 2X9VA 2J1LA 1DCKA 4FB5A 5F2KA 5JIBA 4JWMA 1X2IA 1KZHA 5JQGA 3IT1A 4XIIA 1PBTA 3Q41A 221PA 3BH7A 5JNTA 4TMTA 1W6RA 3H7AA 1PVDA 1CDDA 3AUAA 5SY9A 1JDZA 4HQLA 4QEKA 4EYQA 1C9DB 2BY4A 3TRKA 2RARA 3F6EX 1MJGM 3LYAA 3LPLA 3ABZA 4EEXA 2ONJA 7ICKA 4NULA 1O03A 1EUQA 3EH2A 2R8GA 1XE3A 1DEAA 4NG5A 1V9PA 3D54D 4MQBA 2JK0A 3VU9A 4NCJA 1RQRA 1II9A 4XR9A 3UHPA 1CCWA 4C0SA 1VHQA 4G65A 1UM9B 2V65A 3BQNB 3NHFA 4AU1A 4QTTB 3O8QB 4ID3A 1EXVA 4DIUA 2NT4A 4I4NA 3GB9A 1CZLA 2FW1A 4P1ZA 1W9HA 1E3QA 1DSSG 3FKSD 1RHRA 4WUTA 1ZISA 3F9RA 3MM4A 4OH7A 4CUJA 4ER6A 2NZVG 2XAUA 3G7UA 1TTHA 4XASA 1FUUA 1SXJE 2PSSA 4P4OA 4MQ5A 2R6R1 1RYFA 3TXAA 3OKFA 4C88A 1T36B 3IAM6 1JBEA 5M29A 3IOMA 3HB0A 1LV5A 4M3NA 3L3FX 1DEKA 1RHMA 2O59A 5FTLA 3QENA 1DOAA 4XWWA 1CUSA 2HBMA 4MP3A 3GJ3A 2Q6IA 2XVAA 5BQOA 3PPYA 3KT0A 2V8BA 1ZGZA 5JWHA 1L3TA 1KY2A 4YVZA 3QX3A 5AOCA 1AKYA 3PT9A 1CF9A 3QPWA 2XUPA 4RD4A 3K1AB 4D41A 3SI8A 4P4SA 5CLHA 4F4KA 2BFNA 5HOQA 1HR0B 1MB4A 1H2FA 2HLNA 3GFGA 1C41A 4QQNA 1UL1X 1JMVA 3SIXA 4BO4A 2OE2A 5JASA 3LQKA 5FIUA 1ZHHA 2PM8A 2P77A 2F9MA 3EPGA 5A3SA 2EEZA 3GFFA 2R2GA 2QRMA 4F5PA 5BSWA 1EWYA 2QPTA 3RG2A 1P73A 4JIGA 3MUOA 4YCDA 4C1NA 4QXMA 1E77A 4UM9D 4RC9A 1JFLA 2Y1FA 4KPUB 5HGXA 1E5DA 3FF4A 4JMPA 1G2PA 4IINA 3F4KA 2NQ2C 3GGCA 4YMHA 4ZC8A 5E9QA 2HOIA 3ZK7A 1JFFB 1FLNA 1G16A 1WRBA 4I9UA 4PSCA 3GIWA 1Y3HA 7ICPA 1E3IA 1BGWA 3CG0A 1VGRA 1H2XA 4C4SA 3LPDA 1J7JA 5AVUA 4DBVO 3RR8A 3R7NA 1PHRA 3P8ZA 2OGTA 4OHUA 2RHLA 4K6KA 3T5JA 2QNRA 3C3AA 1AMUA 3T7EA 2AH5A 1GJRA 1X6VA 2WP0A 4I4TF 4ER3A 2G17A 1IEXA 1K7EB 2Q28A 2ZBUA 2QVXX 5J5AA 3C14C 5C46F 1OBOA 5IKOA 4WKPA 3IUQA 4U2CA 4KLZA 3QE0A 4ZK2A 2CLHB 1UR5A 4BB5A 2Z5FA 3QEAZ 4Q4CA 4TL8A 3D81A 3Q1LA 4DSEA 4RD6A 7MDHA 5HM8A 3KQTA 5L7YA 3ALRA 3CF6R 4WFJA 3AL3A 1GFIA 1Q1BA 2PGDA 5SZIA 4D9JA 3IDZA 3UAZA 2BFCB 4QUEA 3ZWYA 5CFNA 1I5EA 4J49A 2W42A 1X3LA 3TNFA 4BMXA 5JS7A 1RTTA 2AX4A 2WICA 1N25A 1UMDA 1DCTA 3FHLA 1NRXA 2Q3CA 4GIBA 4K9PA 3GFTA 4JNKA 4DHWA 3HN6A 1EDEA 2DUMA 3H9BA 1S3SA 1OT5A 3HADA 1P4AA 1G5IA 1NXPA 5FFFA 2X0IA 3NVDA 4Q7JB 2DFTA 1PFYA 1XALA 2QGNA 1QTIA 1P9OA 3ADPA 3C1ZA 3L02A 1T1GA 2GZ3A 4LSZA 4L50A 4BB0A 3K05A 3QIVA 4AY2A 1SIJA 1NNSA 1IJFA 2ZU0C 1SU8A 3GEDA 3HFRA 1I9CA 3N0WA 3ZWDA 3RJIA 4LBZA 2HJ9A 4P54A 5L1IA 1W29A 3GIMA 3AEQB 4ZQFA 1CY0A 2KTQA 3OWHA 2VOJA 4XGIA 4KGVA 4MKHA 1DQYA 3KVVA 1CG6A 3IHKA 4AWBA 4PX3A 1B0PA 1QJ4A 2JH1A 3AHDA 1P3DA 1S02A 1C0PA 3E7XA 4D3YA 3VX3A 2DQYA 1PJRA 1OX5A 3ZD9A 1NQVA 2JANA 1BVSA 2B4RO 5AKJA 1LDGA 4A0SA 4ZO4A 3PUHA 4FBLA 3CISA 4X6YA 2F8TA 2FRDC 3NV7A 4KV9A 3S40A 3QVTA 4FEYA 2Y1KA 4KPFC 1SMKA 4RANA 2A0KA 3CX4A 2CXOA 4BVJA 4K86A 5EZYF 2D1TA 4LK2A 1ZONA 1V6CA 5J2CA 1Q1NA 3WWEA 1R9NA 2FPPB 2QF7A 1YZNA 1CRPA 3HHEA 3JD4A 2Z1DA 1IXYA 5FEUA 4CEHA 2CSXA 5HHIA 3WDKA 3V7KA 3JQGA 5EKUA 3BGVA 4KYTA 4JV2A 1PD1A 3OZSA 3FNBA 1EFLA 4IIXA 2BEKA 3UXNA 1RJ9B 2Z3VA 5IN5A 3BGSA 2LPEA 3KB8A 4I4TA 4Y6LA 3AM4A 2GEDA 1J06A 5D49A 3HDVA 2YN0A 2MMGA 4ZHSA 1TZ2A 2ECPA 3K96A 2R1ZA 3UJBA 4B9NA 4J1TC 3EA0A 1CY2A 2AI3A 3QHPA 3KFLA 3T8YA 2YYYA 4R2JA 3D4BA 2VDPB 1WR8A 5SY4A 4R8SA 4MYSA 4MMYB 5IJ0B 3QUBA 4KHPB 5HA5A 3FUXA 5CBKA 5D5PA 4X7BA 1N7IA 3VPDA 4NU5A 4E1BA 3RK0A 1R27A 2V1UA 1E2BA 3DE3X 1SOAA 2E9SA 1U9YA 4HF7A 1K66A 3GJ4A 4RHFA 1DIAA 4MGKR 2R68A 3GFPA 5J2GA 5IFLA 1MN6A 1JF8A 2F67A 4UBNA 1Y5IA 4PFSA 4YO8A 4ZEOA 1D2HA 4RA9A 2HDHA 2R4UA 1WBDA 2PT5A 2ETVA 4EGSA 1M3SA 3NXSA 2WUGA 5KWIA 1XTSA 1MW8X 1H0KA 1ZA1A 5J4LA 4DXAA 3BAFA 4CUZA 4C7VA 1FNBA 1D2MA 2XTAA 4D43A 4GL4A 1RXYA 1N9GA 3KQUA 2UKDA 3IDQA 5JZSA 2VG8A 1I8TA 2ZSFA 4DNQA 3CG4A 3P2OA 3T5BA 1GQQA 4N4AA 3D0QA 3GAFA 2V6FA 2R751 3EEBA 2P5TB 1ML3A 4C4YA 3LUJA 4CHGA 3UOAB 3KO8A 5LU8A 3LUGA 3AOGA 2VZEA 3LYSA 4PLYA 3FYCA 4GXTA 4HVTA 4WOJA 4I2HA 4ONEA 3I6MA 1YT3A 1FNDA 4GR4A 1EM8B 3RSZA 2OO5A 1L5LA 1QKIA 4PN3A 4PO3X 2OBFA 4EUSA 3B1XA 2QUZA 1JQAA 4NJ8A 2ZS8A 3L0OA 3SZOA 3OJOA 2G77B 4WXYB 2J9GA 7ICIA 2ENUA 2QN1A 2SNIE 2HMTA 4E94A 4PYMA 4M9HA 5F4ZA 3P2IA 2VPYA 4OGGA 1ZUNA 3VC3A 2KSOB 1EBFA 3FUWA 1JL3A 3OLVA 4AJNA 4YAEA 3V6KA 5KTTA 4IL6U 4RK4A 2QM8A 2IGBA 4HRXA 3ND8A 5EZYA 1Q16A 1SO8A 3CO5A 3IVXA 3W7VA 3RS8A 2GKGA 5HSGA 5CW1A 1TQDA 5JQWA 2AE1A 1J23A 5JRJA 1RI1A 2IXBA 2QIPA 821PA 3RU7A 2P3SA 1IXZA 1R0SA 1Y3BE 4A8HA 5C0YA 4MV8A 4ZO9A 4KE7A 1J2YA 2QZZA 1R5NA 1DJOA 2PRKA 4ZO6A 1KPHA 8ICBA 3AHEA 2XY6A 3I01A 2JA1A 4F5WA 5HTKA 1VE3A 3M9NB 2I87A 4XA8A 4BWJA 3P2MA 4K9QA 3QG1A 5BT8A 2XUJA 2ZUFA 3UCFA 1DKRA 1D2GA 2PLRA 2P66A 5DNEA 1KP9A 3ASUA 2E1PA 2H11A 4Q1FA 4H6VA 1KEKA 3TE6A 5B3JA 2X86A 1IAVA 3KSZO 4QZGA 4Q3BA 5JEDA 7MHTA 3ROEA 5AVKA 3ZE0B 2UZAA 4R9VA 2QSYA 2NTVA 3E03A 2Q0ZX 2P9FA 5CAEB 9ABPA 4M7WA 3QG5A 1JTFA 3HKEA 4DCTA 4U6SA 4IH4A 4DMKA 3DO6A 2HHLA 1KBOA 2G5GX 4NJEB 5CVUA 3GJ7A 3DT6A 4UNPA 2JB9A 4Q3DA 3LHDA 1LLQA 1HTTA 3KT8A 2LBPA 5E1MA 3ZU4A 4MRAA 3WBBA 4DADA 3S1AA 2XICA 2C4WA 5KOIA 3LQQA 2OCAA 1G63A 3DWFA 3L79A 2VRCA 4ZPJA 1E9CA 3U9TA 2K6GA 1V43A 3E7FA 1D03A 5JW6A 4UPDA 2H8GA 4U2KA 3MFYA 3V1LA 1EZZA 3DOCA 5TQ0B 3M5DA 9ICVA 3ZDXB 3A6EA 4FXPA 1GDTA 3A1VA 3L8EA 5LZ5A 2QARA 3DL4A 4XW2A 3EB9A 4G09A 2WM9B 4CQMA 3BKWA 1RBZA 1WV0A 1T25A 3CBGA 5CB1A 4UZEA 2F64A 2WJIA 1OXKB 1KQPA 4MIOA 4JT4A 4TTPA 4LXIA 4QNNA 4KNVA 1AO0A 4LI0A 4INZA 2PX3A 2C7RA 3PB3A 3AHGA 3DPIA 4Z53A 2HF8A 1AUOA 4URUR 2OXFA 2ZIWA 4N0PA 2D7CA 1SA0B 3EEOA 4NR0A 1WAMA 3PC7A 3FAHA 4I2EA 3U4QB 1WXIA 3FETA 3WQHA 3LO8A 1L3UA 3N1UA 5REQA 3PLRA 3U0BA 1TTTA 5CNKA 1I1OA 3MWYW 5KAMA 4OUDA 3RS7A 1W5SA 3LCCA 2NAFA 1QE3A 4A15A 2RK6A 1A8IA 1ZIOA 1D8TA 1WO8A 3N0RA 2QY6A 5EAIA 2DFNA 3TZCA 4P31A 5DDYA 4OBBA 4QARA 1GXSA 1AK9A 3BWYA 4KITB 1D9FA 3RAEC 1M1NA 4L4YA 4ZHQF 5HRAA 4U39A 3RUIA 4N03A 3GVXA 4RH1A 4FZ5A 3C21A 1XHEA 1GDDA 5IHXA 2EANA 2P35A 1MAUA 2GD0A 4QDUA 1Z2PX 5A7HA 3WQRA 2JIDA 1PV4A 2OB2A 4Z6FA 2HBQA 3GROA 3RVBA 3HY3A 5A6SB 5KX5B 1VCNA 5E4FA 2KJ5A 2AJLI 8ICLA 1ADJA 4QUJA 1ZESA 1GARA 1PK7A 1VRWA 2OWEA 3B0YA 4BRZA 5KG4A 3HX0A 5JFTA 3BJMA 4YAJA 3T9AA 1R0BA 4UVHA 4MHSA 2FMKA 1S10A 5KFDA 2I8CA 3G0OA 4AJ9A 1TC2A 1P6XA 4L0QA 4EHLA 3O8NA 1MJHA 1KLNA 3OCVA 2SICE 4R1OA 1U2EA 3CX7A 3H04A 2WSLA 4MLDA 2BLNA 3QLEA 3NH9A 1MABA 3GN2A 5K3OA 1D8YA 2PBZA 2FPUA 2X9QA 5EE1A 5LQCA 1HYHA 1U6IA 3MWEB 2KZZA 4OI4A 1DFGA 1ULTA 1RQ7A 3CZRA 3FSRA 2RLTA 9ICAA 3V1UA 3ENNA 3WB2A 2GOLA 4EB6B 5C8VA 3EN0A 1A95A 3H5NA 2PUTA 4IPTA 2ZVPX 5DYTA 1E69A 3DO5A 4YAWA 4PF1A 5H82A 1RBMA 2AS0A 4Y2XA 2BH9A 3IVCA 3KR9A 4RO0A 5BORA 4LF5B 1G8GA 4Q1BA 5HBGA 5CFZA 5J2HA 1IHPA 2A2ZA 1YR9A 2GN0A 2PMZC 2XCPA 2X2PA 3Q98A 1EXNA 1ZUIA 5B1IA 3RIMA 1RXCA 1E7SA 1LTQA 5IAAA 4AMYA 4JFAA 2DF8A 4O3RA 1K27A 2Q9UA 4JB0A 4CL0A 2NACA 3AF0A 1EFUA 3CLTD 2VBCA 3J7AC 4Q1DA 3LHSA 4S2EA 4EZIA 5JFOA 4Q1CA 2KMDA 4H18A 3IT2A 4EYKA 5K5EA 4FR5A 4MXDA 4DQSA 4OHVA 5F5NA 5IKEA 1AB6A 2V4RA 3MJDA 4LW8A 4PS0A 1ZGJA 5CDSA 1N2XA 4JLSA 5J2JA 3PGVA 4OCZA 4WK0B 4YO7A 3JAMA 3HZRA 1J90A 1GOTA 3GAMA 4PSUA 2FXVA 4JI7B 1LPNA 5KT4A 4P0QA 4EG3A 2AYXA 2DUYA 4RORA 3DOJA 2V7VA 4M0CA 3K72B 1TNDA 4TLCA 2D5IA 4ZHQA 2W9CA 1C5KA 4N7BA 5KHLB 1PX0A 1DXYA 1IG6A 1RMYA 2DKOA 1RWXA 1KOGA 2JCYA 1ZRHA 2BFBB 4Q3KA 5B6IA 2FCAA 3NV9A 2Q45A 3L7JA 2WD8A 2OBXA 2REBA 3IUMA 3WV4A 3FUTA 1KZ7B 1H65A 3S99A 2AGQA 2R9VA 3AHIA 4YYEA 5JAUA 3UIEA 2DLNA 5FLKA 5TISU 2FV8A 5A3VA 4LJLA 3FTFA 2P30A 5B6JA 2DKNA 1TVKB 1NTRA 3DM5A 1MNQA 1ENYA 5EGSA 3PNOA 3QEOA 1NF3A 1J2RA 3IAHA 5ECYA 1LSJA 4KAXA 3MRSA 1MA7A 2IYYA 1BXKA 4GOXA 2QS9A 1NRIA 3L1HA 1OW5A 2WFAA 1Z9BA 2Q1SA 1XLWA 1KSHA 4U00A 2EAMA 3F3KA 3B38A 1I2ZA 4D4GA 1A2QA 1GGVA 3E5RA 4V0MA 1ZCAA 2WTUA 4M1EA 3GFKB 3SLGA 3V8QA 1M8PA 4KQIA 4RSMA 4WBXC 3IN5A 1Z4JA 4TYMA 4PVDA 1N63A 1CULC 3RRGA 1Q2UA 1Q50A 1VLZA 4KB5A 3ND7A 2HA7A 2JRLA 3ICXA 1UM9A 1W4LA 2XMDA 4DHEA 4P08A 4RGVA 3RK4A 2WR8A 1AD2A 4DYVA 3ZD6A 3LCRA 2XCLA 4N3BA 5EJ8A 5IX8A 3TTTA 2WAAA 1U8YA 4QT0A 4M0KA 4WZZA 2GJAA 2BF4A 4LYHA 1PJCA 1A8HA 5IIOA 2D1SA 3R5TA 4IIGA 1TJNA 2Y1DA 5F3RA 4LJ4A 3KR1A 4AJKA 1ACJA 4GD3Q 3FSGA 1JEDA 4PAWA 3IO3A 5CFQA 3H4DA 1T36A 2QB5A 5F7XA 1YWGO 1W88B 4OGFA 3QLTA 4HEA6 5BY2A 1EP1B 1XMQB 2AJBA 2C2DA 4RDHA 2UVDA 4HZIA 2ZI4A 2JLQA 3JX9A 1KAGA 3SF0A 1GTRA 5JSYA 5JMTA 2NVBA 4K8RB 2RJOA 4WCFB 4KSYA 5E9AA 2WTBA 4G5OA 4Y9TA 1FIUA 3OPYB 1Y8QA 4JKYA 3GC6A 3F5QA 3UANA 3CY6A 1KVTA 4NCAA 4L95C 2Q0HA 3QBVA 3K1AA 3NIFB 1MOSA 3OEEA 4E70A 1TEZA 3AUKA 1YKSA 1F0PA 3FDJA 5D7NA 3IAAA 2J0QA 2BISA 4OKIA 4H4CA 1PNOA 4U5QA 2Q7XA 2GQ0A 2JIMA 2W90A 4GPAA 3E4CA 4XQEA 2Q5HA 4WKGA 4J0HA 1L5HB 5BN3A 2G09A 2X5OA 3ASZA 4N5NA 5UKDA 4CDGA 4CMEA 4GPIB 1H5NA 1U47A 3KCNA 5AR1A 2XMRA 2XTZA 4MQFB 3P5SA 3SF8A 4RSGA 4C0AC 5J63A 3G8DA 4N0MA 1FQJA 3FDFA 1OASA 4WLOA 3RSGA 1CC1S 5BR7A 1XCLA 1FSPA 2WK1A 2BM0A 5FUWA 3L7IA 4DYHA 2ZE5A 3R5XA 3OZWA 1MH1A 1J8MF 4BQEA 3JPQA 5K8LA 4MUFA 4RFVA 5JYEA 4OBWA 3FJOA 5FUQA 2I91A 3SHFA 1J0DA 4PSAA 2QX7A 3F9IA 1L1RA 1NZPA 1FDRA 3OPMA 3BDAA 1Z5WA 4LYGA 4HP8A 5LOVB 3ENKA 5BR8B 3MHPA 3M5WA 4IXTA 4B4UA 3BD6A 4RETA 3QFRA 4Y9DA 2Z2IA 1ODCA 3U4CA 2Y1LA 4B3BA 2ZE7A 3EPPA 4RZIA 3TR0A 1VIAA 4ED6A 3AVQA 1JBQA 1QCYA 1COZA 1X77A 3KB1A 4ZAZA 2J85A 4TS1A 3B9PA 2FZ5A 2D5BA 1UEJA 3NUGA 1T5LA 4C20A 3HEBA 3AXTA 1H8HD 4E6PA 2OAEA 3CURA 5HQ3B 2ZRMA 5AVQA 3HLYA 4TVOA 2HQOA 3ZW8A 3HR7A 4RVFA 3T5TA 2B82A 4CKCB 4EGFA 2P2CA 3VPHA 5LZ7A 3KLBA 3L1IA 2FE1A 1UBLS 9ATCA 2HREA 5DNUA 1JEOA 2C7VA 1GKUB 4RVSA 3ZBTA 1IMOA 1J0BA 5CB4F 3C6BA 1CD5A 1L4KA 1RYYA 3GGJA 3G9UA 3DFFA 4RTMA 1WXFA 4KMRA 3TW6A 1XC9A 1SXJA 3UV7A 3PT5A 3OX2A 2W37A 1CEEA 1LI5A 3TRHA 4GLFA 3SMVA 3KJIA 3KOZA 3IDSA 3UBMA 3ZZMA 2PVPA 4ZU1X 2JJMA 3IAXA 4Y18A 1W94A 2C5LA 4KXWA 1SVKA 2ECQA 4Y1RB 1YZUA 2NV0A 1UWCA 1BH2A 3QEJA 4REOA 4ENVA 2IODA 3EBPA 4XLZA 2D2VA 3FM9A 5BSVA 2O2CA 3L8YA 5D3QA 2NNLD 4F7WA 2R6DA 1VL8A 1C0EA 1QVRA 2AF3C 3QW2A 1USVA 4QFCA 3UJAA 3TOXA 4QBHA 3SR6A 1Y8ZA 1E0DA 4DUPA 2YWRA 4DV6B 5FKJA 2GSDA 4E21A 2VQ3A 3KRTA 2JDID 2CGEA 4HX5A 1KI1A 1XHFA 2GFQA 3UFXA 2C5GA 5KFVA 2NUAB 1TUGA 3JQFC 2RD2A 1SVLA 5I9IA 4BMVA 1GZ6A 4GRIA 4CV0A 2Y0EA 1V5EA 1AKEA 2XOXA 1G17A 3ETHA 5C9ZA 4P5DA 3BS5B 1M7BA 4KIJA 1E9EA 2IYUA 2XMSA 1U45A 1ZH6A 3AW8A 1NJWA 3N74A 4F9EA 1XELA 5KOHB 3IQDB 4TM8A 4U7TB 2PUCA 2W7TA 3NHRA 5B7QA 4OSOA 1HO3A 4O4HB 5EZ6B 3W7AA 2XIQA 5FBHA 2XEXA 2J9RA 1HC7A 3IBSA 3BXOA 1BEZA 4L9RA 4DUYB 3NAMA 1UDBA 3LSYA 4M8LA 2WWHA 4TQAA 3MGAA 3ISCA 4MUYA 1FTWA 2WYWA 1AKMA 3H6HA 3LXRA 1T9KA 2VANA 5KT3A 3L7CA 4PEVA 4HMOA 1F20A 2W2KB 2FQQA 2Z8XA 4C8MA 1ODSA 3I09A 2ZITA 3AEKB 2J4CA 3AF3A 3LOUA 4ZZ3A 2IEIA 4V02A 2H7XA 1ZMRA 3RBDA 3X43A 4AQ7A 4JR0A 2YTUA 4X44A 4DG5A 3ROPA 2IEAA 3B3QA 5DGHA 2BD0A 4AC9A 3WISA 3FN4A 4V0KA 3SR4A 4RXUA 1XN1A 4E0DA 1TKAA 3NM6B 1SN7A 1PVQA 1M2OB 3IT3A 4QBTA 4GZ5A 4MA5A 3P45A 4QUDA 3CZCA 1QO7A 3EBLA 2JH9A 2QRKA 1YZYA 2IHBA 1BW9B 4CMAA 3ZYZA 3D2LA 4BBZA 4WLNA 5CDFA 2AN3A 2AJDA 1JU4A 2V55B 4K2AA 1OWLA 4HATA 3OIUA 5CB4A 4K9RA 1RMQA 1Z74A 4ZC1A 1CY6A 5HFAA 1WCWA 4MPTA 2JIZD 2QMEA 4AN1A 2JR5A 2Z2XA 1JWAB 2BBTA 4ZQCB 1A9PA 4EG6A 1UKZA 1NVMB 4XDZA 1J25A 4WUVA 3GUVA 5AJWA 1OU4A 3VR5A 2CYCA 4YCAA 2W3SA 4FSXA 3ZLUA 2GXAA 3SBEA 2IXDA 2FEMA 3A9CA 3ANNA 1KJQA 3R40A 2C1EA 5BMOA 4UCFA 1Z6PA 5J3JA 1QRDA 3R41A 4TS3A 4DWJA 5JT1A 1TUEA 3RBZA 1K6IA 3PQ7A 2IXGA 1CUGA 4KRFA 3MMSA 5BQ3A 1JG6A 3O31A 1L1EA 1X7XB 3SEFA 3TOCA 5JVDB 1MPTA 2KIVA 4KN4A 3EMVA 3RC2A 3CB4A 2HDOA 1M7GA 2BFWA 4KQHA 4MQ6A 5K3EA 3H1PA 3MINB 4UBJA 4HN9A 3WGUA 1OZFA 1C3OB 2OEHA 1J8DA 1WHTB 3PF8A 1EM8A 3DGFC 2V7QA 5AM3A 4O5EA 2YXDA 3HWTA 1KDYA 1PQUA 4EO4A 5EZSA 1QRTA 1BPYA 4PS1A 5AWFC 5I4IA 2O4CA 2B98A 2IWHA 1N2IA 3GLHB 3KQNA 3WGVA 2YXNA 5ALEA 5E8JA 5FPTA 1N77A 4N76A 1N0UA 3P9PA 2C2WA 3KYCB 4BX9C 2KSOA 3H2JA 1E3TA 3C6XA 4F11A 3DV2A 1GQYA 3ZV4A 3F3MA 4WBNB 1T13A 4FGKA 2ZFUA 3W8DA 1BO6A 3GD7A 3WMEA 4EGCB 1NC3A 4UU8A 4DMFA 2DWQA 2QLMA 2YCBA 3ZTWA 5KCZA 1JEYB 3CHYA 3AYXB 4FMCF 2AOXA 3SM9A 3IV9A 5G0TA 3GT3A 3RM3A 4B79A 3ZY6A 2ZIVB 3FFXA 1M2HA 1G38A 2BGTA 4DZTA 1OB2A 1L5MA 2O2ZA 3EBOA 2C3UA 2C94A 2W48A 2NO7A 3ZNNA 5JDIA 4OJTA 3TKYA 2GCEA 4IDOA 4QJ4A 2IP4A 4JC4A 1GZ7A 5DGDA 3DLPX 1DRVA 3INRA 4KLFA 2JLZA 5KX5F 3T0FA 4F2WA 5IEBA 1HRKA 2GPBA 3N8NA 1H3EA 5DNYB 1FTQA 1KVRA 4R1PA 2PKEA 3R8XA 4TUSA 4IVRA 4B84A 1OKKA 3FLBA 2H1VA 4IIJF 3V5NA 3WKAA 5H80A 2GJ4A 4OXNA 3C4JA 3HU5A 5EG5A 4IX9A 4RF5A 4NJEA 4NC9A 4O0MA 2JGDA 4BNVA 2J07A 4J9MA 4UTNA 3TI0A 3CYMA 3GW8A 1XZBA 2IA5A 3O6VA 3TZQA 1BN6A 2FMUA 3EVZA 5G0UA 2EG9A 4ZV7A 3QV2A 2FMXA 3VA7A 1XNSA 2ODBA 4JOQA 3KKOA 1X8LA 4KXVA 4MUKA 3O92A 3V7YA 3DEYX 2I2FA 4DLTA 3PFWO 5EHGA 2ZKIA 3PW4A 3WL8A 1T8WA 3PX3A 4GMXA 3LX5A 1MDBA 4IUCS 4BNXA 3MTAA 3V8EA 1BHSA 1TM1E 1I1NA 5D7BA 1SHJA 1ZNXA 1N9ZA 1E3WB 5B58C 3FFAA 4RTLA 3MDCA 2J3DA 5IBQA 1BU5A 2FLVA 3C4VA 3M8SA 9ICTA 3I6YA 4I99A 3PSTA 3MD9A 1KYTA 5EWEA 1P1KA 4XFJA 5KYWB 1F4PA 4V0ME 3VNVA 1Z29A 2CD9A 4PRZA 4CDRA 4I2IA 1SA0A 4NBTA 4MK4A 3UKDA 2QW8A 2XD9A 4IZHA 5J0RA 4ZKEA 3ER8A 3GA0A 2V3WA 4R1SA 5DVZA 2GILA 4G9GA 1YS6A 2ZUTA 4IG4A 3HL0A 5FOWA 4HZGA 4OIFA 1NLFA 2BR4A 4ZV9A 5E95A 4EHBA 1OFIA 3FOBA 2FSVC 4XUCA 1K2VN 3O2SB 4IO1A 2IYTA 1WVGA 7ADHA 1CFZA 4KR3A 3BQTA 2D0PB 1OAKA 3SJZA 2WU4A 4CEJB 5EEHA 5T4HA 3A14A 4DOCA 1SBCA 1QGOA 2XBUA 3WMXA 4M9LA 4D9NA 4YVFA 1CHNA 4YUVA 4OHBA 2JCVA 4IIUA 4D8YA 3E9MA 4R6XA 4GZLA 2IWRA 2IIBA 4DIDA 4QYTA 5A6SA 2QJRA 3GWZA 5KX5A 3IA7A 3MGKA 4RLFA 1MO2A 1V16B 4B7CA 3TEMA 2BCGY 3PO5A 2WTEA 2VNSA 4WESB 3LU1A 2YVLA 3FNRA 3BDVA 1JXQA 2DPJA 1LJLA 4C8NA 1YR1A 4BEVA 4IIJA 1DWQA 2FGKA 5FXMA 3MRVA 5BOVA 5KYUB 1JHUA 1FPQA 1BPBA 5DTMA 4RPHA 5ALYA 1TLLA 1QG6A 3RYCB 2GDZA 2YWCA 3MELA 1BOFA 2OG1A 4TVSA 1YRBA 3FZQA 4X3PA 3MTJA 1TK3A 1OLXB 3ZWAA 2ZS7A 1ZJ4A 2J6TA 1OAOA 3LH5A 4RSRA 2XMBA 2XUOA 3RVQA 4KX3A 2ZANA 1VECA 3K5IA 1CVLA 1ZQ1A 4HAOA 2DCUA 2ZBRA 3RE1A 3IERA 3MW8A 1VP3A 2EZTA 3L7MA 1CJCA 4TSKA 2HWXA 4Q47A 3DDSA 3F53A 1DOHA 2CV1A 1C4XA 1UAAA 2VT2A 3IQEA 1HSZA 3GHYA 2EJTA 4D9FA 4ZD6A 2CNKA 5D3MA 2C2ZA 3LF2A 3NNDA 2Z43A 3D6FA 3C98A 1USUA 4R1NA 3QH4A 1LVUA 2C20A 7ICRA 4D44A 3J7TA 3EQ9A 3QXJA 5ITZB 5ELMA 3MT8A 1NK5A 5FTMA 4B6JA 4CKWB 4GW3A 5KWEA 1DX6A 4CM9D 1J1ZA 1B14A 2FEPA 2OFOA 4ZOCA 5CR0A 1U8ZA 4N8EA 2VH5R 1QHEA 4FGZA 3SJBA 2FPOA 3WHLA 2FW0A 2ZE8A 3P4YA 2BGGA 4MW2A 1V25A 5D4BA 4C4RA 2CJPA 2WM3A 4TQ9A 2AV6A 2ZB7A 3U7QB 4IDFA 1PVVA 4XYLA 1ATZA 2DHRA 2IELA 3QA9A 4Z5XA 4BYMA 2HBRA 2XE6A 2VJKA 3T7CA 4JODA 1JH8A 2B1QA 4ALIA 3TFWA 1U8AA 4CLRB 4K6GA 4CFZA 3BZWA 4YJ2B 4AIRA 2Y0BA 1SCDA 4JUZA 2BJHA 1EQAA 2VUHB 3RQIA 1GA4A 3R3JA 3LVWA 2PO5A 1TYAE 3AINA 1WUKS 5LU9A 1YS4A 4KX5A 4HL6A 2FEWB 4GX0A 2IPLA 2Q3DA 3EASA 3DEZA 2F44A 3HCRA 1QH9A 1VA4A 2R6GA 4QRIA 2BFBA 2V0CA 2XZPA 1ZZGA 3RAJA 3D5QA 3AR3A 1XD2A 1ODLA 2P2LA 5BXQC 3A9SA 1T5HX 4IVPA 4FS3A 2Z9BA 4DF4A 1NC1A 2WU1A 4B0OA 3T7RA 1I2MA 1DKQA 4XYBA 1TVKA 5GWXA 2YXEA 4UM7A 4IIDA 4PONA 3N59A 5ELLA 3ECCA 3IIMA 4L5AA 1YACA 4GSKA 3LT5A 4HAVA 1G3QA 1AT1A 3I3OA 3DZDA 1A9TA 4H1HA 2YS7A 1PAUA 3OZEA 1B26A 5LOVF 3W1EA 1K8QA 1SKWA 1P4JA 2VDVE 3B1JA 1W1IA 4YDHB 2CFSA 4KLLA 4KACA 4CQLB 4RPYA 1Z5UA 4ZAFA 5D6NA 3SEAA 3RJMA 1YIOA 4PHCA 1UA1A 2Y1GA 4C7OA 2EFEB 4NXZA 3IAEA 3ZHOA 2OHFA 3IDWA 1S9FA 3THVA 2DOKA 4H3VA 4JP1A 2GLXA 3A9UA 4PPNA 3WYEA 1Q15A 2XPCA 4G07A 1YJ5A 1DV2A 3ODGA 5HM6A 5EQFA 5DKFA 8ATCA 3SOPA 1E2PA 3BZKA 3GRPA 2VWPA 2TRSB 4ZTUB 2P1RA 1GAWA 2Y27A 2XKAA 1FFBA 5EKDA 5ENZA 1GYRA 5P8WA 2P2DA 3TDKA 1KYVA 4IIYA 1PGOA 2HK7A 2J9YB 1GQSA 1O5TA 2PZBA 3CE9A 4BNMA 2J45A 1CRQA 1WU8A 2P9ZA 4A10A 3K4PA 1Z6AA 5KVVA 1Y8AA 3GIDA 3I30X 3TFSA 4CFYA 3JYQA 2W2LA 2C5BA 3EXEB 4WCFA 1SBNE 1RVDA 3IP3A 5CP2A 1W5AA 1TZBA 1D2EA 4DSJA 3OO0A 5LVAA 4TQSA 3FFWA 2PT6A 5TZVA 2L18A 5DDIP 1J99A 4LY3A 4MZXA 1TA4A 1KR5A 5KFPA 5B12A 3IDOA 4QFDA 1Z08A