2WHEA

Structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic Details of Near-Transition State Conformers for Enzyme Phosphoryl Transfer Revealed by Mgf-3 Rather Than by Phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wheA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wheA01
3I1YA 2G1AA 5AVZA 1Y8AA 2JGAA 2WF9A 3L0CA 2MU1A 4QQFA 4YCMA 5ALZA 5ALXA 2AGVA 3L8FA 1TJ3A 4YCNA 2Q4RA 4NV0A 1L8LA 3VAYA 1RLMA 3ED5A 1RRCA 1ZD4A 5AM4A 2MU2A 5AK5A 1ZJJA 5AK4A 5AI0A 2Q4TA 1L8OA 2OYCA 1LVHA 3FM9A 1AQ6A 4E88A 4Y2SA 3L0BA 2JAWA 5AICA 4IFTA 1RQNA 1CQZA 5ALEA 1L7MA 2EARA 4Y2RA 1QQ6A 4BNDB 2YJ5A 1L6RA 1U2SA 3WK4A 1U7PA 2FUCA 2NO4A 3L7YA 1ZD2P 5AVVA 2YBDA 2FPRA 3FGOA 4GXTA 2B8EA 5ALHA 3ZX5A 4CNQA 4UAVA 5AHXA 2CFSA 2YMLA 1Z5GA 5ALFA 5AW5A 2YJ6A 5FP0A 3N07A 4BEWA 2FEAA 2IOHA 1RKQA 4G63A 2JAUA 3M9LA 2ZXEA 5AVYA 1N9KA 1RKVA 1T5TA 3WKBA 4Y2UA 1O08A 2WHEA 3B8EA 3AR7A 3EPRA 3AR9A 3NANA 5AKKA 4RETA 4CF5A 4L6AA 3MMZA 5AKJA 2IOFK 2OA0A 3QUQA 2AMYA 1J8DA 4UMEA 4ZEWA 4BYGA 2EAUA 2ZBFA 3ZVLA 3AR2A 4YH1A 2HX1A 3NIWA 5ALOA 4MUMA 1S2OA 1NF2A 1RKUA 5AKXA 4UMVA 3BA6A 3ZVMA 2FUEA 3AR5A 3AR4A 1L7PA 2FPWA 2I33A 4HGOA 3RF6A 2R8EA 5E0OA 3DAOA 3PGVA 3QU2A 2HCFA 3OCWA 2ZOSA 1SWVA 3UMCA 2PQ0A 3U7GA 2ODAA 2W11A 2IOFA 3WK8A 2WF6A 2OM6A 4C4SA 5AW2A 2P9JA 2BDEA 3UMGA 2HF7A 5AIBA 3N5KA 5ALVA 1QH9A 3E84A 3U7FB 3QU4A 3KZXA 1Z4LA 4UMFA 3ZVNA 4FFDA 5IT4A 1RLOA 2G08A 4Y2TA 2GHQA 2GHTA 3AR8A 3NRJA 3QU5A 2OBBA 4XPZA 4KYTA 4DWOA 3R4CA 5AESA 4O8CA 4BX0A 5AVQA 5A3SA 3QU9A 3ZX4A 1L7NA 3U7HB 5AVTA 1Q91A 3WKDA 1F5SA 3D6JA 2WF7A 2FI1A 4Y2QA 1VFPA 1XPJA 1CR6A 2YMQA 3U13A 5ALNA 1T5SA 1RMTA 4BKMA 2G09A 4OD0A 2C8LA 5AVWA 3R9KA 5AW0A 3A1DA 1WPGA 4Y2JA 2FDRA 3UM9A 4C4TA 2DQSA 1WR8A 3IJ5A 3KD3A 3L5KA 3TLMA 3KDPA 5ALQA 1KYTA 5AI9A 3SKYA 2FPUA 4Y2PA 2ZBEA 4L6CA 1Z4IA 1J97A 2O2XA 3HYCA 1YMQA 3QGMA 5ALYA 5ALSA 4EEKA 3QLEA 4UU1A 5AVUA 2WM8A 1ZD5A 4F71A 4OHFA 4ZEXA 3WKEA 5ALGA 4YIHA 4FYPA 2BY4A 3NALA 4NABA 5ALPA 4XOUA 4UM7A 3ZTYA 3S6JA 3SKXA 3AR6A 5AW1A 3SHQA 1L7OA 3MC1A 2W4MA 1JUDA 5AK3A 2YJ3A 1TE2A 4I9FA 1EK1A 3R09A 2O9JA 2RB5A 2W43A 5A3RA 4ZEVA 5AW9A 1N8NA 4BBJA 3A1CA 3SF0A 1ZRMA 2ZG6A 2RARA 3I6BA 4L57A 5AIAA 4AS3A 2I7DA 3WKCA 1SWWA 4I9GA 5ALKA 5AW4A 2HHLA 4FE3A 4UATA 4Y2XA 1Z4MA 3WK7A 5AKZA 4KX5A 2C8KA 3GYGA 5AVXA 3PCTA 3IB6A 5AI8A 2HI0A 2G0AA 1MH9A 2CN1A 3P96A 2B8JA 3MN1A 2YMMA 4CE6A 5AKHA 4DCCA 3ET4A 2RBKA 3L0YA 3RFUA 3ESRA 2NO5A 1O03A 4NAVA 2CFTA 3ZUPA 2GMWA 4UAUA 2HDOA 3CZ4A 3HLTA 2YMPA 3QNMA 3OPXA 3M1YA 5AVSA 2WF5A 3L8HA 4KNWA 2JARA 4BX2A 5IT0A 4EENA 5ALLA 3U26A 4DW8A 3FPSA 5AW7A 3ESQA 1QQ5A 3E81A 1RC8A 3U7EB 3QX7A 3MPOA 4KNVA 1YV9A 4J2TA 1ZOLA 3ZI4A 5AKEA 3OCXA 4IG4A 2JAOA 4KN8A 4UW9A 2I34A 4EX6A 3QXGA 3FPBA 2YJ4A 3E8MA 2YN4A 2B1RA 4XE5A 2HEGA 5T41A 2B30A 3OCZA 2AH5A 3BWVA 3PGLA 5AW8A 3WK5A 1Z4OA 2PKEA 3KC2A 4UU0A 1T9ZA 3OCYA 2WF8A 1NNLA 5ALWA 1U2TA 2CFRA 1Z4PX 3N28A 4HGQA 1QQ7A 4JB3A 4HYTA 1U02A 3ZWDA 4UMDA 4UASA 1ZD3A 1ZRNA 2YY6A 2BDUA 4QJBA 2FPXA 2VKQA 3DV9A 3A3YA 3WGVA 3L8EA 2I54A 1WVIA 1Z4NA 1U7OA 4HAIA 4AS2A 3I28A 1VJRA 4J03A 2Q5EA 3B9BA 2R8XA 1LTQA 4Y2YA 5ALJA 2B1QA 2C4NA 3DDHA 1QYIA 4YGYA 4NFLA 3NAMA 4EELA 2C9MA 4UM5A 4OCZA 1YS9A 5AM1A 3KOOA 1Z4JA 2G80A 5IS2A 5AKGA 2P11A 4Y3UA 5AVRA 2GFHA 5AM0A 2WFAA 3ZTWA 3WK6A 3W5CA 3L1VA 3FVVA 5ALDA 2D2VA 1Z88A 5AW6A 3DNPA 1IWOA 1X42A 3I76A 2AUTA 4XQ0A 3ET5A 2R8YA 4H1WA 1RDFA 2R8ZA 3L8GA 3QUTA 1SU4A 3L1UA 1NRWA 1EK2A 5AM3A 4EZEA 4PNHA 3W5AA 2B0CA 4DFDA 3ZWKA 2FPSA 1WZCA 3A1EA 1Z4QA 3KBBA 4HGRA 1XP5A 4HGNA 4B6JA 4EX7A 1Q92A 1YDFA 1XVIA 2ZBGA 1RLTA 1RMQA 5JJBA 3U19A 1RQLA 3IRUA 4YIKA 2B82A 3E58A 5AK6A 3AR3A 5AM2A 3EWIA 5ALRA 4NWIA 3W5BA 3PDWA 2G06A 5ALMA 3ONNA 5ALIA 1Z4KA 3J7TA 4BNDA 1YJ5A 5A3QA 3OTQA 2PR7A 4GIBA 2I55A 4RESA 2HSZA 2MSNA 3SLRA 4YCLA 3W5DA 3ZU6A 2RAVA 3EF0A 3QUBA 5AI6A 3OCUA 4MWOA 4AP9A 1ZS9A 3QYPA 4JDPA 4BX3A 3FZQA 2GO7A 5AKLA 3EF1A 4CF4A 5AI4A 2YFYA 4HGPA 1PW5A 3WGUA 3CNHA 2IA5A 4OFZA 3N1UA 3N8GA 5AW3A 3B9RA 3NUQA 4F72A 4UARA 1RMYA 2P27A 2NYVA 2HO4A 2IYEA 1TA0A 2I6XA 1TJ5A 2P69A 4Y2VA 1VJ5A 2HF2A 2X4DA 5ALUA 1TJ4A 1RPZA 3OCVA 3ZW7A 3SD7A 3WK9A 4CF3A 4KX3A 1YNSA 3NASA 3WKAA 1FEZA 3QUCA 2G07A 5AM5A 4C4RA 3K1ZA 2QLTA 5AKIA 2C88A 5AKYA 2HOQA 3QU7A 1S8OA 2ZBDA 1Z5UA 4BEVA 2EATA 2QYHA 3UMBA 5AI5A 3SMVA 5ALTA 1K1EA 3F9RA 4G9BA
chains in the Genus database with same CATH superfamily
2ZK7A 1L4FA 3O1HB 3COWA 1HMPA 3NX4A 2MMCA 5B1YA 1PZFA 2H1IA 3FMVA 1JG6A 4LXHA 1E2JA 3S81A 2PXXA 1V2HE 1GNVA 2AV6A 4LJ7A 4MRNA 2Z6VA 2XC9A 4B71A 3BFPA 5SZJA 3RTDA 1OIXA 1T43A 4QATA 1Z19A 1PZHA 1HFWA 3H13A 4UUPA 5H5JA 3WR5A 1HXHA 4CETA 4Q1AA 4CMIB 3UUGA 2CC2A 3ZGZA 4HDOB 3NCHA 5D85A 5K0CA 1HYBA 1OIVA 5F1KA 3AI7A 2CLIB 1HLGA 3QBVA 4G4JA 3FCOA 5KOJA 1M2OB 4JI0B 3DB1A 4Q3BA 1AA9A 2E5WA 4ICIA 3A37A 2PXCA 1SWVA 3LUKA 3X1DA 2D0DA 4FC7A 4IIVA 5KVSA 3C5HA 4Z2AA 4B9SA 3NVZA 3DQPA 1J1ZA 4ZAGA 4FFPA 1JN3A 3P0RA 1NK5A 4PLCA 3RSQA 1BPXA 1SURA 2XHEA 4JP1A 4WJZA 5HF5A 2G08A 1D1SA 1DAMA 2XUHA 3ONWA 3T61A 1UPFA 1BGXT 1X7XB 3ZHXA 4BNVA 3QHAA 4JV0A 3KTQA 3TOXA 1XDBA 1V16A 3G23A 1YR3A 2V7PA 4YAIA 4O02B 4KOAA 3NETA 2B35A 3K9FC 4DAOA 2AN3A 3S29A 2V3WA 3EQZA 5ECGC 1PS9A 3TAQA 1Z13A 2V7UA 4KTTE 4ARBA 4OGLA 4DY4A 4TYNA 4GOXA 3G7SA 4WCFA 1XFAA 3FJOA 5D3MA 5TJHA 3SCZA 3TB6A 5LDGA 2AMVA 2HSEA 1CZLA 1X9SA 1ONOA 4CMEC 4DNOA 1K5PA 3JQRA 4HEHA 1A2KC 5AKHA 4FMDF 4W5NA 3AG5A 4JEIA 3QI7A 4BGUA 1G5TA 1DEAA 1NDQA 5IT0A 2A58A 4MW6A 4CI0B 2PX3A 1KY5A 1AK2A 1SVNA 1RYFA 2XMBA 3I23A 4ZGGA 1V7ZA 4B5LA 3FXAA 4ZPXA 4GMGA 1U7DA 4HZUB 1JPUA 4R6XA 4R2HA 4Z8XA 5EJAA 2RHFA 1PR1A 2WWVD 5C7YA 5BWOA 2XNKA 5T41A 3N8NA 2NZXA 1VE3A 4Q1EA 1C2TA 3PE6A 4KRYA 1DS6A 1QHXA 1HLFA 1E94E 2NT3A 1YFLA 2QA5A 1KU0A 3JD4A 5FOXA 3WRYA 3IXLA 3OX1A 2QTWB 4Q7QA 4FSHA 1SKRA 1F0PA 3VU3A 1P2DA 1GV1A 4J94A 4J9LA 3KHHA 3L01A 4IG9A 1NJ2A 2PMBA 4AUNA 5DNEA 3GJ5A 4C8NA 1H2YA 3P7MA 2JZOA 3ZLJA 3V9AA 4IWYA 5TQ0A 3WGMA 1B74A 1ZMTA 4LRTB 2RHLA 4KAXA 2FOXA 2I99A 2A86A 2BAGA 4TUYF 2PZAA 1SU4A 2HVHA 1EK2A 3G8BA 4KQWA 2GKGA 3DP9A 2DWQA 3STWA 4LZWA 4QULA 3I42A 3T52A 1JG1A 4B6SA 2CDCA 4ZYTA 3T38A 1H2RS 4PINA 3RB3A 2AFHB 3BWMA 3B9JA 4O9MA 4UOQA 2YXNA 3CUWA 2ZSAA 5JXWA 1RVV1 3KQKA 4ZK2A 3C5GA 5CCEA 4YCLA 8ICVA 4X94A 4QIHA 5G4KA 4MB2A 3OJOA 5IC4A 3ZHSA 1WJGA 5AT1A 1MO4A 5B5SA 1ZNWA 1RMYA 4B3MB 2YVQA 4L95C 5KFXA 1EUQA 2NZJA 2ZITA 4ARUA 4YD1A 4AN4A 4ALMA 2CL6X 2OV8A 3KSAC 5KFMA 3AUOA 1A50B 2BSXA 5J1SB 1TQDA 1Y1LA 3R0JA 4CT5A 3OZGA 2X5OA 3Q8XB 1PR3A 1NC3A 2XX3A 1S3FA 4NBSA 3L5OA 3JASB 1C7IA 2KD1A 4XX1A 2PV0A 2AI2A 2JFFA 1ENPA 1X9GA 3GXOA 2CXHA 3PHLA 4EPVA 4X41A 1FDUA 4W9NA 4TUYA 4XLZA 1ISFA 4ARSA 4QAJA 3I2HA 1BQ4A 1YJCA 5ERYA 4MZDA 4NFHA 4D4MA 2O6LA 3V2IA 4Q19A 1AE1A 1SVIA 3QE9Y 4G3IA 4FDUA 3DULA 4DLBA 3WFJA 1DIGA 1CEEA 1ZH6A 3SR4A 1KI9A 1YVUA 4IJUA 1U9LA 1E8MA 3M4YA 5AVKA 4ALLA 2QM0A 3PD1A 4P0PB 4FZ3A 2WJ6A 4IBOA 4DTCA 2OD9A 3B2NA 5I7EA 3T7JA 2PGXA 3FPEA 3RS9A 2G5CA 1XI2A 2DF4B 1KDPA 3QLJA 1QWOA 5KFIA 1I10A 1WQ4A 4WCVA 4UEQA 4WBXC 3BJIC 4BO6A 3AM1A 1ML4A 1D2HA 5JJ5A 2GF0A 2GHTA 3UC9A 2W42A 3UVEA 4NBRA 4BGVA 1VCNA 2VJDA 2PRYA 4JUFA 1TTPB 4A26A 4OOFA 4MROA 3KJIA 4J0QA 1VMIA 2OVFA 4JR0A 2YMQA 4BLSA 4MV5A 4EFMA 4OQZA 1VYUA 4IKPA 3GA7A 4ZOEA 3E18A 3ZCQA 2O3UA 1HE4A 1O2DA 1URJA 4MQLA 4MUYA 1V8BA 1BGWA 3NO4A 4CDMA 1EQUA 1Z7GA 5G0TA 2AZDA 1URPA 5BOSB 2LGJA 3QVGB 3LIPA 1CFZA 3AR6A 4DZRA 1JUDA 5DGBA 3MABA 4AZSA 1PBNA 1TE2A 2W2LD 3PG5A 3QOYA 4OHMA 4OK3A 2MWMA 1MDBA 3JWPA 2ZWOA 3C6QA 3SC6A 4UB4A 1MEOA 4WVFA 2ZB8A 5EP1A 1VJTA 2C8KA 2OXTA 1TEHA 2BJVA 2DFTA 3PVXA 3H5LA 4ALNA 3C6MA 4CN8A 1SAYA 1L5GB 1YONA 1B2RA 1FTYA 3HABA 2ZYDA 4MKHA 3U7EB 3GJSA 2XNDA 2AE1A 1UFKA 3KCQA 4ZARA 1XOIA 3KV3O 5ARDA 1W47A 4Y9SA 1A9OA 4ED2A 1GZ4A 4A27A 5LXTB 3WY9A 4Q4LA 4CKEB 2HIGA 3WMGA 3VPSA 1U28C 2FSGA 4B4OA 2W55A 2CFRA 4X71A 1N5JA 5H3HA 4MJ3A 5D8DA 3I9OA 3NOOA 4DREA 1N36B 4CMGA 5A03A 1Z00A 1S3IA 3SOPA 4HPWA 1ZUNB 3DXZA 2NU7A 3STXA 1HOXA 1C1YA 4OKSA 2RAPA 5C7OO 3PC3A 4QL3A 3W9UA 3UJBA 1XP5A 2O0LA 3T9FA 5BNTA 2RCNA 3GGGA 1I1NA 1OUMA 5T5QA 1VBNA 3LC2O 1WULS 5HQ3B 2RGEA 4D92A 1OI7A 2ZYRA 1U7ZA 4DMMA 3UKOA 3D6AA 2ZIFA 1H38A 3E5MA 4NJMB 1GL9B 1YE8A 3LRPA 1VSQA 3TX2A 4N0MA 1PW5A 4LZNA 3MB5A 3PSTA 1Z29A 4DVGA 4D8XA 5IVDA 3TL2A 2NVOA 2OQ2A 3I9JA 3EODA 3K20A 4QWWA 1CG6A 3H9UA 1YR7A 3AM3A 2QW8A 3K71B 1DQZA 1FVXA 3X1YA 1OOEA 5EQDA 3FYUC 3L0DA 4FYWA 2HSDA 4X7MA 3F73A 3OM8A 3OX4A 3Q3CA 3SLKA 4AMBA 3OFNA 2JLUA 5GONF 1AHIA 1AMNA 3RJJA 4DUPA 2JEZA 1SMKA 3JPQA 1JKJA 2Q5IA 3KWJA 3RUIA 2BCVA 2WMNB 8ICXA 1RAGA 3BXHA 2JAXA 3TTTA 2XYGA 2A5GA 3FNGA 4NMXB 4CRXA 2Q4TA 3V7NA 4D25A 3ZE7A 5CXQA 4IMIB 5ALEA 4U7WA 5EIHA 4HV4A 3MYRA 1WW3A 3EG9B 4DBLC 1AKRA 1ZQDA 1X1TA 1FU7A 5AVVA 4C14A 3AEUB 3PXDA 1OI3A 1Y7LA 2QP4A 2Y0PA 2ECKA 2EJVA 1JDTA 5D5QA 5JMWA 5JCJA 2ONCA 5A5DA 2FVYA 3T7RA 2GD2A 1DKQA 5F5XA 4AULA 2F1RA 4OB7A 3K16A 1C50A 1FUIA 4D9MA 1YBVA 3P2OA 1N2ZA 3G5MA 1ZQKA 2WTMA 4RKRA 3STUA 4ZO4A 4BFZA 2E18A 3AUTA 4K9QA 3E23A 3IFSA 1LSJA 4ZQEA 5FHRA 3P9SA 4B3FX 5CLJA 2FUG1 3LGSA 3E8XA 5E1MA 1LTHR 4FW8A 3TLJA 5GONA 1ECFA 1NVWQ 2GAJA 1BKSB 3E7WA 4XVQA 1Q12A 4IMPA 4C8MA 2ZUEA 1N56A 3HO6A 2ZU0C 1AUOA 4QWBA 4OHXA 4E6EA 1OHHD 3KS9A 4KH1A 4OK6A 3EDCA 4BIMA 3O0FA 3TQQA 2Y1JA 3CB2A 1MA3A 3P97A 2R751 3ZDAA 9ICOA 1ZNXA 2P90A 4R66A 4UBBA 4IUCS 3TNYA 4QT0A 2ZSDA 3EWAA 3AHCA 4WNAA 3W78A 5TPZA 4R3WA 4CMCA 3M9XA 4S35A 5B58C 3NDBB 4OH1A 1R4ZA 2OCBA 3FMIA 1GYRA 1LCIA 3PUZA 3ICOA 5L53A 1BMTA 2FPLA 5LUAA 2DPLA 2BLNA 3JQ8A 4GSLA 8ICEA 5BMVF 3A06A 2WMYA 2F59A 3UHAA 2DBVO 4FFOA 4JLOA 4IUBS 2VBGA 1KMHA 2D8MA 2XOEA 3CZAA 4IDBA 1I4EB 2E85A 1PZXA 3N2LA 2EF1A 2JLRA 3PT9A 4KWHA 1L4GA 2F43B 2QMQA 2JI8A 4JIMA 3TQHA 4PO1A 1J2RA 1FVFA 1Z5VA 3N0XA 3JXEA 4FDMA 1XQ9A 1O9GA 2WT4A 2WYOA 3IEUA 3KCNA 4M9CA 3THWA 5KDLA 4FR2A 4ZC8A 1J0AA 1BH6A 5L3RA 2E6KA 1RXCA 2F8SA 4DXAA 1GRVA 2BJWA 3H1BA 1O9HA 4IDOA 1QGOA 1I5OA 1MFPA 5C0OE 4K6HA 1LX6A 5CFNA 2PJUA 4JC8A 4I5DA 5AW6A 3DNPA 1RWXA 1MX3A 2NTVA 2Z2YA 4XPIB 5JSKA 3BSWA 2FLWA 1LFAA 4LC0A 1MQ9A 1J2TA 3PTLA 3AYZB 1N2BA 5BMVA 5H9VA 2A5DA 4ENWA 1KNQA 3INNA 1Q6YA 2JA1A 5C1OA 2IEGA 4ZYWA 4FOTA 4ZT6A 2C4TA 5ALIA 3ZHZA 5TT1A 5LOVB 4HVAA 2A0UA 1KK0A 3EY9A 4YVZA 2JIZD 4QZAA 4XKJA 2P65A 3W0LB 1E2MA 3MLAA 3T4XA 3KUUA 1AZSC 7MHTA 4OIFA 1PE0A 3RNLA 3UJPA 2QTVB 1K8QA 2ILTA 3H6KA 5KOYA 3G5LA 4M1SA 2ZB7A 3RG2A 2B78A 4R6WA 3TIGA 3IEKA 5HHTA 4J1QA 5JS6A 3DZIA 3EMVA 4OBEA 1GOTA 3RVDA 2EIHA 5CH3A 4M0DA 3SAFA 4IIJA 3GDWA 3HWWA 1WW2A 3KR1A 4MSUA 3KQPA 3U60B 2QYSA 4YCNA 1DGSA 1U3CA 4GI7A 5FPYA 4FFVA 2PSEA 3PITA 2XUFA 4DNQA 4C4ZA 5TV2A 2YXEA 2FSUA 2P62A 5LZ2A 1X9WA 2YRWA 4RQTA 2WAOA 5JAPA 2E4XA 4QUGA 4C6RA 1ZOOA 5JV5A 3ST7A 2YV2A 3TW6A 4M04A 3VQTA 4MAAA 3KT8A 7ICQA 2AOTB 2IOQA 4CI9A 1FJGB 2Q1WA 1P4SA 2V4ZA 2R5NA 1H6BA 3FYUB 1J99A 2EX1A 1G4UR 1B1CA 2YHUA 3LUCA 5DI3A 3I64A 3R6DA 3PUXA 2JD1A 4B8ZA 3KT0A 4YH1A 3I8XA 2ZRHA 2ODBA 3I9KA 3X43A 4QYXA 3HDGA 1YQXA 4YUZA 4G0MA 1KO8A 2OHJA 1I94B 3IT3A 1TA4A 5CIQA 4EUSA 1L3IA 5EMKA 3ZDYB 3U7GA 2F9MA 2BCUA 4YRAA 2RI1A 2FTKE 3O2QB 2DCMA 1U04A 1H2XA 5KX5F 3BZUA 4MW4A 4EY5A 4I99A 1BFKA 4F5EA 2GQ0A 2D7DA 2YZNA 4PGXA 3T5DA 5I51A 1L7AA 2C29D 2F1KA 4WKCA 1QM5A 3AU2A 4Z6KA 10MHA 4U3JA 1OIWA 1MJHA 5ELXA 3Q8MA 4US2R 3FPCA 4OD0A 2C8LA 4PIVA 3RU3A 3PGA1 2OOSA 2OUIA 4CCWA 1X1BA 5GM2A 3GLHA 2AUNA 4WZ6A 3HY3A 1X92A 4GEGA 1O9BA 3FNQA 1II8A 4A6EA 2RDJA 1PWEA 4HVTA 1Y1SA 2CDRA 4XLLA 3FF4A 1LWNA 5D7BA 2JEGA 3Q87B 2GZHA 1OMOA 2YJ3A 3CZQA 4V0RA 1J5EB 1HA3A 1GPAA 4EGAA 5A3RA 4RHFA 4ZI7F 4UB8U 2NVWA 4ENTA 3RUEA 3WKCA 1U99A 4Y2XA 3OA0A 1WD7A 4DYDA 3AERA 1ZQLA 4QUIA 4PYKA 5AI8A 2Q3FA 1UBSB 1USKA 1VLLA 3A58B 4CQJA 1OTXA 2DEUA 2B9VA 3FPKA 1XTUA 3PMNA 4C43A 2OECA 2F3UA 4M2LA 1ADJA 1IBSA 1RPAA 1WSDA 4QBIA 1OYWA 4Q01A 2HRRA 1GYPA 4RCZA 1A1SA 4M6WA 2WICA 1HE5A 2AGQA 2OEHA 4NBVA 5KWSA 3G9UA 5CIWA 2HQBA 1E2PA 2BFWA 2K89A 2DQNB 1E6MA 3BMOA 1NY5A 3O0TA 4HJXA 1HDIA 2IUFA 3V34A 4AZ3B 1S2MA 3RM3A 3OU6A 3A1UA 3RH4A 1K27A 4LIPD 5GJBA 3E9NA 3PC2A 3WLFA 3HK2A 1NGSA 1Q0RA 1HNWB 2B5WA 2W7PA 1Y8ZA 1EVLA 3GT4A 2CL0X 5F2OA 3A6JA 5JXGA 5ICMA 5JZBA 3KT6A 2D06A 3GLQA 4WECA 3GUUA 2TMKA 2D1YA 4FR5A 4EPTA 5DHRA 9ICWA 2QG6A 1CZHA 2CLKB 3EGXB 2NPIA 1Z4KA 1CU1A 2H1WA 3K1YA 2GPBA 1OLXB 3C3PA 1SIWA 1NUQA 2OQRA 3AHIA 4BO9A 1YH3A 4CMIA 3DMTA 1EFVB 2WPNA 2HK7A 3OQBA 5MN4A 1JR3E 3QE4A 4D8UA 4WJKB 1EVKA 3L8MA 3T5PA 4LCEA 2PGNA 1WB5A 4W5QA 1GZ3A 2C99A 1M2OA 1YBMA 3ER6A 4OM8A 1CZRA 1W0KA 1M34E 3WMWA 2VZEA 5CT6A 3ZJ4A 4PR3A 2IWRA 2DF8A 4B80A 2HM7A 4LRXA 5CGZA 3IQXA 4ND2A 4HDNB 3KWFA 1DT3A 3T5TA 2VJKA 5K8IA 2FDCA 3LUDA 1LVHA 5BV7A 1ECLA 1LK0A 1TTQB 1GPDG 4PAGA 1F51E 4JR1A 1X7XA 4EA7A 3UUEA 1VM6A 1P4GA 1DWQA 4EHDA 3ILXA 1MJGA 2ROQA 1GAEO 1H5NA 1VBMA 2R2AA 2MYNA 5U4QA 1IXZA 4BLWA 4YAFA 4GKBA 5FCDA 1DO0A 4N8EA 3KP1A 3G5TA 3KB6A 5FD8A 1B0XA 2PFOA 4JBYA 3T0GA 2D6FC 2DT8A 5IF3A 2FJPA 4UMVA 1ZK0A 5G1PA 4TGLA 3EQ2A 3D6FA 3BWYA 2IYQA 1Q0SA 2O2CA 1QSYA 4N8DA 1N8KA 2NSLA 5C8ZA 3RKSA 4MGYR 3MR3A 3GLGE 3C8DA 3C43A 3JQAD 4I66A 3RO7A 1S1MA 2OXOA 1QGED 1A0OA 3EAGA 4MDHA 1OZGA 2HWUA 3F6PA 2FX5A 1CF9A 1KLNA 1QFMA 2H0QA 1I0LA 3QP9A 3EUWA 4RKEA 4P2BA 2IODA 4GLOA 1RRKA 2R11A 2N1RA 2R44A 2DTEA 3CZMA 2R86A 1KL7A 5FAXA 4OSEA 5D87A 1D6NA 4RHXA 4HZUA 5T3YA 9LDTA 1LRJA 3BREA 4CLOB 2Y1LA 1DRUA 1ZD5A 4F71A 8ICHA 3BDVA 2JGRA 3U4DA 3MRTA 3ZD9A 4IQ4A 4U00A 5AK3A 4Z4IA 2A19A 3E0FA 3IOYA 2ZB3A 1N3IA 1JEEA 5CXSA 3BRCA 2JK1A 3TM4A 4Q43A 4HZGA 4GVPA 2PAFA 1V0JA 2GBLC 1O6BA 3IPXA 1L4BA 1H22A 2E1FA 4AKGA 2HA5A 3R8CA 4INAA 5B5EU 1CR2A 4PC1A 2C4UA 1P8AA 3AKCA 1W6RA 2C42A 1VPEA 1GG5A 1YIAA 1L4UA 2RGBA 4FYVA 4US8A 2XQJA 2AFHA 1HQDA 1CDOA 3O8DA 1K6IA 1Y81A 1MW8X 2CE2X 4HRAA 4PG7A 4Q05A 4R1UA 2A9FA 3SHVA 5BN5B 2QJRA 3FBGA 3DA8A 4E21A 1IMOA 1CZOA 5K0BA 3MGHA 2Z8YM 3A27A 2GAFA 3RK0A 4IFIA 2NWQA 4OFWA 2UU9B 3MHPA 5COBA 5JTTA 1NKTA 5FPPA 1DRKA 1PR2A 1MX5A 5ED0A 4Y2HA 3SVZA 2XGGA 1XNJA 3BQNB 4IQFA 3EXEB 1W49A 1HOTA 5C8DA 2QVCA 1P75A 2XIQA 3JASA 1W96A 1J9EA 4BUZA 4DLXA 4TXLA 1H6DA 1IY2A 1ACMA 4LDJA 3Q85A 1PQYA 4LOJA 2R1ZA 4ECWA 1CUDA 4R1QA 4LYYA 3F53A 1YJQA 1IOWA 3BL5A 4Z0TA 2VPYA 3H0CA 2D0OB 4F96A 1U8CB 3NRZA 1TCCA 2QIOA 2PLWA 2I6XA 1QZTA 3LUHA 4B6PA 1M7GA 5KG5A 1JE0A 4DR3B 2BHSA 4Z4EA 1N2HA 1U80A 2BF7A 1P6XA 2PT7A 3SQMA 2NU6B 5AM5A 2GTPA 1N7IA 2HCJB 4UNQA 2LWIA 4RD4A 4OH7A 4EW2A 4YBZA 4RMGA 1VMAA 4P0PA 3Q3VA 2ZWIA 5IJAA 4MOWA 1YUBA 3ND7A 3A6PC 1GGHA 1U8YA 3HY4A 1UANA 3H11B 2J31A 3HDYA 4FBTA 1WY7A 2DWPA 3GYBA 4AMZA 2X4IA 2QRNA 2KIWA 4QICA 2VYVD 3RVPA 2ZI9A 4KK3A 2KN7A 3EVZA 4IDFA 4ZQCB 5LXTF 4M0CA 2MTBA 1BW9B 4I1VA 4N0QA 4TQRA 5IP5A 3UZUA 5FL7A 3C7CB 4QGAA 3P4YA 5CK4A 2GZSA 3EVBA 4YT8A 3KHUA 3Q3EA 3QVKA 4MEBA 2HPHA 1ORVA 2FE4A 4OMFG 1YQUA 4JIGA 4HQKA 4A8TA 5KT4A 1XEWX 1EK6A 3GJ7A 3G13A 1B4FA 4IIDA 2COUA 2JFXA 1MA0A 1DDIA 5BOSA 3NIWA 1VB3A 7ICPA 2G5PA 1Y3IA 1I4OA 3QVGA 4DCTA 5JH7F 4EOGA 4S12A 1FYXA 5JC1A 2I2DA 3INRA 4ER7A 3W1WA 2KKPA 1BNPA 4W1QA 5CNIA 2UVPB 1CEYA 4B35A 4RSHA 4AJHA 1L7DA 4GSKA 4Q8FA 4WDRA 1WLSA 4GI2A 5HPYB 4DR7B 1Q83A 3GIDA 2GD0A 2Z56A 1FSFA 5C51B 2ETXA 1GGEA 3BFXA 3W04A 3U3KA 2UVQA 3A9VA 2Q0ZX 1ESMA 1O6FA 1K3UB 2RGGA 2XCAA 3RAXA 2E8OA 5K4HA 3DSRA 1KI2A 5LXTA 3RVRA 4JEMA 1KSHA 4UAYA 4XVHA 4CKEA 3FSGD 3I9V6 3OF2A 3NVKI 4YALA 5C34B 4INPA 2J9RA 2VS1A 3EPPA 4PAQA 2BH9A 4CCYB 2JDID 2QX7A 2WU8A 4BCCA 1MOQA 2F1JA 3D64A 4PF1A 2VHEA 4UM7A 5BVHB 2HWYA 1YMUA 4WX2B 2I3DA 1JLLB 3I6IA 2V96A 1H5UA 4BO2A 4AY4A 4CMEA 1VP3A 2W22A 4YAKA 5DSXA 5DNUA 1OLUB 3LX8A 2ZRMA 3U7IA 4BWFB 3JVUA 4YMHA 3EUEA 5CT5A 2I66A 4F5YA 3A0UA 1ZUNA 1HQYE 3WO0A 3NLLA 1Q1BA 1HFJA 4HJRA 3P96A 1P7VA 2F4VB 2SICE 4GPZA 4NCKA 1WB6A 3M1YA 2V59A 2ODNA 1J0CA 1JVNA 1NULA 3NEAA 2WPDD 4CTOA 3TM5A 3PKIA 3TXAA 4KZKA 4O33A 5HQ3A 2X0IA 2Z83A 4KV7A 5JJKA 1J1IA 4NJMA 3LWDA 5JNWA 1PLLA 1EP2B 3FPJA 1H4TA 2FSVA 2EBFX 5ELMA 3Q98A 1V47A 1ECPA 1BVSA 1F2TB 2EZTA 3PUWA 3BC1A 3CXRA 4YRFA 3G2LA 3WOHA 3SQLA 7ICJA 3FNFA 3PSIA 1S4QA 1JH8A 1L0BA 5DLDA 5CX1B 4GLBA 2OLEA 2JGFA 3RAQA 2JI4A 1UODA 2ZRKA 3N2NA 3A9WA 2VNAA 3I76A 5DNCA 4QDZA 4R9NA 9ICEA 1E6KA 3WGGA 4ECUA 1D2CA 4BO7A 3FTPA 3ZQ4A 3ASYA 1S3SA 4J43A 4BO5A 5EJ6A 1KSFX 1Z38A 4XD7D 3EC2A 3EG9A 5DB8A 1Z2PX 5LA6F 2D2IA 2DH5A 1GPKA 2QHXA 4ECAA 2C4WA 1VPDA 1W9MA 3NEPX 2R00C 3IMGA 8ICBA 4OQFA 3ZUGA 1Q95A 2NIPA 4LNUB 2R85A 3KB8A 1ODCA 1EP3B 2HF2A 1QH0A 1SNYA 4KIGA 2LW7A 1Y3FE 3IVXA 2XWQA 5TE9A 1CUKA 1Z8HA 4OSOA 1NYQA 4ELTA 1RAHA 4Y6OA 1U8UA 3IQZA 2UZ3A 2FJ0A 5DHSA 1X1CA 3RRNA 1SBTA 3JAWB 4R68A 5EZ5A 2IGTA 1U65A 4IR1A 4HX9A 4E13A 5ITZB 4RENA 2X2OA 3G2IA 4LGCA 1LLQA 1CYDA 4A16A 4Y2SA 4KFRA 4ED9A 5KWEA 4G2TA 1NP3A 1QF9A 1FE8A 3TQIA 1SKUA 2X6TA 2W83A 4RSGA 1SOVA 4PYOA 5LZ7A 3D7NA 3Q3GE 4L3WA 1M1YE 4Y0AA 1Q0TA 4PTYA 4QXQA 3D8BA 4QDOA 2FJ6A 2BOVA 1JLRA 3I72A 1Q14A 4IV5A 3AO0B 5H68A 4HNVA 3MFIA 1IVNA 1PGJA 4WZAE 3IO5A 4BDTA 1QFXA 2XCOA 1BXKA 2NO0A 4TZTA 1NATA 1P0CA 4FZNA 4CLHA 3V4VB 4G0QA 4IH4A 5JJIA 4MKFA 2BGKA 3ZE9A 4DUGA 4D2IA 3PYMA 2LVBA 1X1RA 5A7GA 4JP3A 5E1DA 2O0KA 1KC3A 1QE0A 4MVXA 2HZ7A 7ICHA 4HUJA 2CYCA 4DARA 2JIBA 1VBFA 3OKCA 2OL4A 3PXXA 2I3AA 3MINA 3U4IA 5HDBB 1OE0A 2AK3A 3I4LA 4MI1A 4BVBA 2F43A 2RK6A 3NHBA 2BKAA 4CDNA 4KMOB 1VMKA 2FSIA 5B3JC 2AG6A 3OBIA 3D2AA 5EWLB 1EI9A 4YP1A 5SY4A 1DAIA 2IPNA 3DWIA 2F77X 3HXOA 4KR3A 1QGZA 3PCXA 3SEAA 3PC6A 4JN6B 4QUAA 4HATA 5L4NA 1MGOA 3AWIA 4TTJA 2AK2A 1XTIA 4B9NA 1J90A 1EJBA 1WRBA 5CDSA 3RJKA 1ZU5A 2C3OA 2ZI7A 2Z5FA 4BNHA 1GAWA 1C0LA 4J49A 5KX5B 2DUNA 3LZ6A 1JVSA 2YB4A 2H7CA 5AKZA 3NT5A 3NT4A 4BNZA 5JD4A 3GYGA 1JGTA 2IC5A 1RHKA 3H5RA 4XPIA 1FRFS 4J8PA 2Z98A 1C9DB 1YOBA 5CDFE 3QPCA 2DQ4A 3LL4A 1ZQMA 4RHUA 4US9A 1XTSA 3D81A 4HSEA 3USZA 2O2HA 4R8KA 2R8OA 1U28A 2ZAIA 5LOVA 3G2HA 1NLYA 4ON9A 4YMVA 2WWGA 3DHNA 5AUQA 3F0TA 4FYYA 4ZTBA 3SM3A 4PHHA 1EGVB 3UJ9A 1NNLA 3V97A 4IAOA 4UNNA 3ZWDA 3PHIA 3ZDCA 4WXPA 1T6ZA 2WB2A 2QTVA 3TLZA 3FF1A 3VNQA 3M6ZA 5KFVA 2IUSA 4ZI7B 1R8JA 5KQPA 3SQNA 1QR2A 4PLGA 4H7HA 3HILA 4LS3A 4B32A 4PNPA 1ZQXA 4B6RA 4JBXA 4G2NA 4GKJB 3AFOA 1K8XB 3ADDA 5IXSA 5EJ7A 4QG7A 1YZLA 1YIOA 1O4WA 3TLGB 1LLCA 1HSZA 4D3XA 4EZ9A 4OF4A 4XFJA 3U6BA 4M0MA 1KK2A 4IO1A 1E1LA 3NP9A 4D8WA 4NZ9A 3CUKA 4W82A 3AKDA 4JI7B 3BF7A 4O0LA 4X63A 4JNKA 2HRZA 1QZZA 3L1KA 2AOTA 3NVYA 3GJ4A 2ZB4A 4NOLA 5MHTA 1UADA 2GHRA 3FYUA 2AA3A 2QVYX 3CEJA 5KTQA 2JB9A 3HJFA 4DA4A 4F3RA 2D4AA 1FQJA 1N0UA 3WK9A 1OXXK 4WK2B 1W4ZA 2DXIA 1R2QA 2Y0SC 2UUCB 2XQKA 3L8YA 3NOXA 5DQIA 2QN2A 4B4WA 3PA6A 2Y9PB 1M6WA 2N42A 4B84A 3HB0A 1Y8AA 1GKLA 4R40A 4RULA 4NK4A 3PW0A 1C0PA 3EIXA 2N0SA 1XSNA 3IP7A 2AOWA 1NI5A 2BFEB 1Y33E 4M49A 5KL1B 2YJZA 4N9QA 1QUEA 1QUFA 3QY0A 5ED4A 1KAEA 4YPVA 1U2SA 2JFWA 3GV5B 2AOXA 3WYGA 3LBAA 3AB7A 7ICEA 5K3EA 4F8RA 5E4YA 1JI3A 2QDKA 1Q11A 4WJ3B 1XB2A 2R6CA 2EX4A 2DTXA 2QOEA 2VP6A 2RH8A 2ZB2A 4DJFC 5EZQA 2HLPA 2PMCA 1T9AA 2XO7A 3DWGA 4RHTA 2WQ7A 1K2WA 2A6PA 4PX9A 1AKTA 2Z9BA 3I62A 3IR6A 3VO1A 3LECA 3R6GA 2Y68A 4BU1A 2WLTA 3A25A 3ETRA 1QPZA 1QBKC 3X1JA 4HAUA 2VUSA 1SO8A 3BGOS 1HJPA 4NMLA 5KJFA 5IWCA 4J9MA 4PGMA 5WRFA 2Q2QA 2RONA 4DOAA 3R4CA 2ZZNA 5FORA 1R0CA 2YH2A 4KLSA 2RC6A 2LI6A 3KKNA 3A3KA 2IF2A 2HSJA 3KJFA 5LBIA 3H3FA 3GV8B 2FSVC 4DLZA 4WVLA 1WXIA 1W44A 4RD3A 2QW1A 5KNDA 1QYWA 4BTEA 2O2XA 5ALYA 3Q8WA 2F00A 2OD7A 8ICFA 5FLYA 2OG2A 1WV1A 4AZ3A 4UBIA 2JIMA 4JZKA 2P0YA 2E1EA 4QDTA 1IHOA 1PWHA 1XV5A 2O3JA 3DBRB 4YEDA 1MJGM 3IO3A 1HYQA 1NW3A 1KMNA 1ABEA 3L7CA 4EMSA 1LD3A 1M2GA 4HAWA 2LYBA 4GXKA 1EGQA 2GESA 2G77B 2IVFA 4JVNA 3RS0A 2P2ZA 1E62A 3EARA 3QZ7A 5FTNA 3LX4A 3EGXA 4R2IA 2BFDB 3A8TA 3ABSB 5GPBA 3X2EA 2J6CA 3V5NA 2F2TA 3BZWA 4YP0A 3L05A 4RYDA 5DU2A 3HA5A 4E14A 1OLXA 1UEIA 3OLVA 2HPVA 1X74A 1L3SA 3RWOA 2Z9CA 4BV2A 5FOUA 1FUUA 1EFVA 3TSWA 4EHJA 4G1CA 1Q0PA 4AJPA 4OLFA 1EM6A 5ILQA 4FFNA 2WZCA 4PZPA 5BMOA 3WRXC 1DELA 1LJUA 3VC8A 4YRPA 5I45A 4MX8A 3B82A 2PRIA 4JBNA 3TRHA 1UMDB 3DWEX 1ISHA 2D2VA 3OZDA 2N1MA 3IAFA 1UAYA 4W7SA 2FOIA 2VF7A 3W06A 3GL9A 3WJ2A 4A1FA 1OBHA 4HDNA 1VC2A 3AFMA 3HA2A 1N60A 1H0KA 2C5HA 5DN6A 4N9WA 3AUAA 4UHJA 2VXBA 4IQTA 3BS5B 3NTOA 1RQLA 4PHEA 3IP6A 3JQFC 3JAMA 4P7BA 3F47A 4F9FA 3V1KA 2KLHA 1UJNA 2PJZA 3B78A 5LQCA 5ESRA 2AZXA 4MV0A 3HBLA 1J33A 4YFYA 1O5OA 2F7SA 4HGPA 4L0CA 3H17A 3C2KA 3WGUA 3PDJA 2YOHA 2ZIXB 1IN8A 3UJ6A 2OXRA 2A1TR 4YV1A 1UXJA 3WG9A 3PU6A 1DDGA 5J0SA 1DGJA 1ZQEA 2GPJA 2Z8YA 1A9ZA 3SJAA 2WJVA 2KTQA 4PSVA 3GV0A 3TEJA 4HTFB 1PT9A 3DCJA 4M3NA 4W5TA 4TUSA 4XVUA 1D7OA 2IJGX 3HPOA 1UBOS 3QTLA 4RQBA 3A7EA 1DRJA 5J2TB 4FZMA 3A6LA 2FW9A 4CL3A 4TTRA 1YVEI 4YRCA 3GW8A 4CTKA 5B4VA 3EDYA 1M33A 3QHQA 3QEMB 3JQPA 1JIVA 1TM7E 2BEKA 1TX4B 3BSSA 4QNNA 7ICGA 3K7EA 1B0ZA 3CG0A 2FEAA 2NSDA 2PO7A 5COAA 2DU8A 5P8WA 3AR9A 1XTRA 4CLOA 1N7JA 2YZGA 3L6OO 4RY2A 2ZQYA 4WDQA 2G5GX 1K3FA 1RPNA 2JEYA 1HFEL 5F3WB 1SG9A 2EEZA 1HNNA 4V24A 2V58A 1SOAA 2C7BA 2J8ZA 4LI3X 1K5DA 3GUYA 1KKMA 5EJMA 2FLLA 1ZONA 4NYMQ 3HNRA 3PHBE 1OASA 2HCRA 4U7TB 1NUSA 4OKNA 4BNYA 1E3LA 2B83A 1PX0A 4H7EA 2CJWB 1U3GA 5BSVA 2P9TA 4DDVA 3VZCA 2V7QA 1ZQ9A 3D4IA 2JGKA 4QZ8A 1POWA 4IMRA 4N3GA 5LQNA 3WDKA 4GU5A 4BEJA 4D0GA 2XCQA 2Y1DA 1KH2A 1XSLA 2Z3VA 4ISBA 5D5HA 1E3WB 4P7GA 2V0NA 1U5AA 3AI2A 4PYQA 3C1TA 2IEBA 4MKRA 4G3XA 4ZV4A 4Z0HO 5IJWA 3P1JA 4E0DA 3AHDA 4L8WB 4X60A 3ZWYA 5BN5A 3GEEA 2MYTA 5JH7B 1P1BA 1T5LA 3ZCRA 2KS6A 3UAZA 2W9XA 3MC1A 2W4MA 1PD1A 1R64A 4G1EB 4WKOA 3HTXA 1ZCJA 1ETUA 4Z0NA 1HKUA 1J2UA 3T4UA 4ZZ1A 1LWOA 3PDIB 3U4AA 2OO3A 2OKGA 3FY4A 5JISA 3ONVA 3MCUA 2CPRA 4XR4A 3O3NB 3HU2A 4KWCA 3EXEA 4OHPA 3H0EA 3HWTA 3GRCA 5IG2A 5EC8A 4HGZA 3QMPA 5JAQA 3FNBA 1SVKA 1N1MA 3X1XA 7ICOA 2FMQA 1D4OA 2XUGA 4QWCA 4AIIA 2YJNA 1LS6A 2P6OA 1PS0A 1W5AA 3G3EA 1FQKA 2C7GA 1N8SA 1XQXA 4XM1A 2ZJBA 2XMQA 4UUNA 4XQ9A 3TZKA 2W6JD 3IIJA 4MEJA 4JB3A 1NP6A 1Y6RA 4QJBA 3AP1A 4LVSA 1TCAA 3GRPA 3THSA 3JZMA 5LMZA 4MITA 1Z4NA 5J4KA 1JW9B 1SGGA 1Z2CA 1YRAA 4PPQA 2UZAA 4L3VA 5LN1A 2I6QA 2C9MA 4F3TA 2NU6A 4RLSA 4FPXA 1TT5B 1T94A 2FH5B 4JL6A 5L45A 2FGJA 5DYYA 4U2CA 2BR3A 4L3OA 3FPFA 1HT2E 3RVSA 4EJFA 4QBFA 4CLXA 1SN7A 1OA0A 5K8TA 3H11A 3JQAB 3LLCA 3E6AA 3EDRA 4JJFA 3SN6A 4EX7A 1YQTA 4JU8A 4DJEC 2GLEA 4DL7A 2NYAA 5JZSA 2X4GA 4QUKA 4UC0A 3C7AA 2XB4A 2ZIUB 5HSGA 3EVDA 1BW9A 3QM1A 3ZU6A 5BYBA 2GBCA 4N40A 3L43A 3MWKA 1N0WA 4MWOA 3B38A 4YR9A 1AG9A 2I80A 2JCSA 5CTAA 2WM2A 4KN6A 2G4LA 1WETA 4Q9IA 1ZGBA 4FD2A 1E20A 5B58T 3ZS8A 2I6TA 1M5RA 4I8DA 3FAHA 4O59O 2DE0X 4NPAA 3L8DA 2PDAA 5K0ZA 1LH0A 5DF1A 2Z4TA 4UDYX 2W98A 2BRUC 3G5UA 2ZBVA 1NN0A 2GAAA 5JT1A 4OJ5A 2FMHA 4C4RA 2VOJA 1R6TA 3R6TA 4MUIA 4P5EA 1TVEA 4ZWNA 3I1YA 2WG1A 3W2TA 3K31A 2CYBA 1GUBA 2MU1A 5SY6A 1TTHA 4CIXA 3YASA 1EUDB 1QS0B 2C2XA 3OECA 1XR3A 2HHAA 1DC4A 1Z62A 1CHDA 4NCIA 2UVPA 2CXNA 5JS2A 5ILGA 3E61A 3QI2A 3THXB 1NK7A 2C07A 4XEHA 5BN3B 3AV0B 4MGZR 3OX2A 3VSDA 1EXNA 5LA6B 1YTLA 1JEDA 3WK4A 1U7WA 2AWNA 4O2LA 1EHYA 3T3FA 1JHXA 3NBUA 2ABWA 4RTJA 1GFIA 2NG1A 3ANNA 1O0BA 2PX6A 5ALFA 1T2AA 2UZIR 3K0SA 2A88A 5I7OA 5IILA 1T5IA 1ZSNA 4M99A 4W9MC 2D6FA 4DCUA 2GSDA 4X3CA 1DTSA 1TAGA 4NM1A 4M9ZA 5EL0A 4BS9A 4CCYA 2JCGA 4AYXA 4BOYA 3ZK7A 5ADVA 1XCPA 3OPQA 5BVHA 4CMAA 4PGHA 4NL4H 4B44A 2PIAA 4CTMA 1J20A 3PX0A 3GN2A 1H8ED 1JLLA 2PRZA 1NQXA 2ZJ3A 4NATA 1LV5A 3HO8A 1IJEA 5M3BA 4JUAA 4IXMA 1R00A 3C48A 3MXOA 3VU1A 1OLUA 4G0WA 1LI4A 1U9YA 2RC5A 4FJ1A 3UV6A 4CG1A 5F77A 4M36A 3DNFA 3LPCA 3ABIA 4LVNA 3IT1A 4X9XA 2OHHA 2PKWA 2HQ1A 3RRJA 1T5SA 4YP6A 3GMIA 4LBZA 2IZ6A 1ZN9A 1NJ6A 3UPTA 2H31A 1FW6A 1GQFA 1MQSA 4C7OB 4J0EA 5DYGA 3JATB 1MP0A 3E7XA 5THKA 1ILEA 1MN8A 4I1SA 1H4VB 1EP9A 3T79A 2P67A 4NABA 4L74A 3ASUA 1F2TA 4CJXA 3SHQA 4UB3A 2JL1A 3FTNA 3EFHA 2CLLB 2GBLA 1N61A 2C8JA 121PA 1AMUA 4MW2A 3BB1A 5CX1A 1A8HA 2G1KA 4RQ3A 5J0XA 3G2NA 1T8YA 4GC6A 1JG3A 3A9UA 2G76A 2CN1A 4TL9A 1T9KA 4R8RA 4N5IX 1SXJD 1ISGA 2GWHA 1Y9EA 4RVDA 2XBMA 2W04A 2AVDA 3OPXA 3DZKA 1G17A 3GIJA 3L1IA 4WOCA 3KLOA 2FPIB 3PSAA 2ADOA 1IY9A 4NQRA 3KB1A 5CEFA 5AKEA 3WI7A 2PI5A 5ESDA 3GLIE 5TEWA 3CW9A 3H2JA 5A6VA 1CUXA 2VO1A 2FKAA 4A2PA 4TLAA 2R8JA 5AO9A 5AW8A 4YRRA 1AUVA 3WGLA 5IAGA 4TOIA 2IF0A 4LNUA 3TLCA 4DSFA 3RSHA 4HQFA 1H1DA 3K05A 4QHYA 1MNAA 4BB0A 4DCVA 1TCUA 5KUTA 1AIPA 1KH3A 2WNIA 5JECA 4JA2A 2LE0A 4YMLA 2ZUBA 3WMRA 3JAWA 4QYMA 3RS8A 3HFSA 3D59A 4HBGA 3W5AA 2XAAA 1VL2A 3CGWA 3PEEA 4UBNA 5ITZA 1WP9A 4U6QA 2CLFB 1XVIA 1OXMA 4QTTB 3KKEA 5J4VA 3UXMA 2L69A 4FTWA 5G1OA 4ATNA 4NZOA 5LQRA 1QVWA 3O4FA 3ICXA 3T12A 2XUJA 3FZQA 1U90A 1W1WA 1S97A 9ICIA 3Q7QA 4K6OA 3I9LA 4LFBB 2VP3A 4F46A 3R74A 1E7YA 2CJXA 2J09A 3ISTA 5MN5A 4CDRA 3GJYA 4DQKA 4EY8A 3PUYA 4JP2A 1EP1B 4NBTA 1EPUA 3HKBB 2R6ZA 1U3WA 2VDPB 4TVKA 9ICVA 4OM7A 3GRZA 1JFSA 3E7DA 3TCNA 1A27A 3IUPA 3ITDA 5E4FA 1PU2A 1PJLA 2FY8A 4YRGA 1R15A 4DLGA 4PXAA 1WEKA 4AX8A 3RUFA 1B41A 2V7VA 5EY5B 4QDUA 4H4CA 4BDSA 3Q0EA 4J9PA 2JFPA 4OGWA 3NEJA 1MRNA 4KG7A 4BNDB 3PIIA 4QZBA 4H1TA 2I91A 5K51A 1ZP6A 3A6FA 1DHTA 3GMTA 2FB9A 2VAPA 1PKXA 1YUNA 4FJ0A 3ISJA 1L5YA 4RD2A 4AZWA 4KMOA 5EMJA 4GMKA 3PQCA 5KQSA 5FP0A 5DBCA 5EWLA 3CPSA 3MAAC 4TT3A 3SC3A 2OPBA 4RORA 4XUGB 3NKLA 2REQB 5TSDA 1SB8A 3ZPXA 1ZCBA 3VNVA 1S8AA 2DHEA 2HCBA 4MUMA 2QPTA 3X1ZA 2VPZA 2E1RA 4F4HA 3FA2A 2OAP1 2R62A 3O03A 1DUIA 2AF3C 2VSNA 1Q3UA 2C2MA 1HDCA 3ID6C 3GCXA 1GT6A 2QJOA 1ZEJA 1E9FA 2FPPB 2HF9A 5KX5A 5E9QA 4P3NA 4PCAA 5J5CA 3HP7A 1OWOA 3V32A 2PJDA 2XODA 3OG9A 2X4LA 4HSGA 3NDJA 4YRIA 1P33A 1Z63A 2BPOA 1N33B 4YGXB 2ZTVA 5HCNA 4PYLA 3R1IA 1L5LA 4IDNA 2OHIA 4DWOA 4W6ZA 4TQSA 4W1RA 1VPLA 2Y6UA 3NFRA 1HL3A 2K8BB 5IM5A 1CK4A 1D0IA 2YHSA 2ZIZA 3A2LA 2F8MA 5KOIA 1HDOA 4R31A 2WOJA 5CVTA 3QGMA 1M72A 2MCFA 1T4GA 1ZSYA 1ZUD1 4IIXA 4K0RA 3C97A 3GP3A 5F4BA 2V55B 3OQJA 1YBFA 3FOEC 1N5RA 1QTMA 2O06A 3MJRA 1Q7CA 4ZI7A 1O94D 4C0BA 1IEWA 4J1TC 3K9HA 3ZOKA 4W5HA 3O1JC 1N5MA 3RODA 1U0NA 4JSTA 2HHLA 3IDWA 3M1LA 2NSHA 1WVGA 2XMCA 3E2PA 2JJ8A 2IW1A 3PR3A 4LW8A 2PD3A 5JWRA 5NLLA 4B47A 3RAGA 4DCCA 3OPYB 2BONA 1S89A 3HR4A 2YIMA 2VTDA 4QYSA 4QFCA 5HIJA 1KY2A 2I4RA 4Q6WA 1YFZA 3TLGA 3BL8A 5L3QB 3G8AA 5JWHA 4E46A 3GILA 4OYLA 1JFFB 3PEFA 2W4IA 5EVJA 3TQFA 1PWXA 2GTIA 2X2EA 4W1PA 4UHCA 3AM4A 4IR9A 4J9RA 3DC2A 3TVTA 3GG2A 3CVUA 1W35A 1OHHA 7MDHA 1ITZA 7ICUA 2I6SA 1EFUA 1NZPA 2G4CA 5LLTA 1KYXA 1M9NA 1NJZA 4TL8A 3OQPA 1V35A 3V46A 3AF6A 1IIBA 4RPKA 1SQSA 5GZ3A 1U1FA 3L0PA 3KLPX 4RPJA 3AUXA 1WDTA 3V2UA 1T1RA 4BRZA 3ZJ5A 2PRJA 3R3VA 5KFKA 4MWGA 3OTIA 2ZSKA 3VHQA 1NZDA 2AZTA 1G2OA 2EAPA 3D6NB 3BQ2A 4JK3A 2AUTA 4EEYA 1JIUA 1PZGA 5AJZA 1OWNA 1BD3A 1EX1A 3PR1A 1O3YA 3KE9A 4HQLA 1R18A 3AHHA 2ASDA 1Z4QA 5GGXA 1TU3A 2BFEA 3V3KA 3T5GA 4NP6A 5KINB 3EZ7A 4IYRA 1PR6A 3P9ZA 3QE3A 3KKKA 1XXHB 1MDFA 4R8VA 2R00A 5J2BA 2ZRNA 4TSRA 4X92A 2X3YA 5SYAA 1VJ1A 3HJBA 1NVVQ 4XARA 4UKDA 1E7WA 1UMBB 4BX9A 3ZDRA 3DOHA 3JD2A 4PC6A 1RXSA 2CUNA 3R77A 1QQBA 1K7SN 2WKPA 2IX9A 1FS6A 5HK9A 5FA5A 3MTDA 4LTNA 5BR1A 1Q50A 3FJYA 2A3NA 1Z5OA 4IVPA 2JASA 4YBRA 5CVJA 1NBWB 3SQDA 1SGWA 5ALTA 4RVCA 1EUCB 2NRTA 1F8YA 3OSPA 1K9VF 2ZXUA 4AN0A 4EBBA 2K87A 3RQSA 1SH7A 1NN3A 3WA7A 1XDWA 3PC4A 5KT7A 1W5EA 3V1UA 4G24A 4COOA 3GUVA 4OO1J 4D4KA 4E88A 3ZNQA 4RE6A 3COPA 4OJOA 4FEAA 3B3GA 4Y9DA 4UBMA 4PGFA 3ZNNA 1Z1BA 5T7BA 4Z99A 1OPRA 1R66A 2RG7A 2KBFA 2B25A 2K60A 2PGDA 1XTJA 2EW8A 2UVUA 4C2AA 1PK3A 3TQCA 2DUMA 4HR7A 3EPJA 4G25A 3WHKA 1EVZA 4L08A 2O8CB 4Z3KA 3RIMA 3C4JA 3ZY4A 4JI2B 1O5TA 4GI1A 1I2AA 4TUPA 4D97A 4UB6U 2E0IA 4S3MA 1V1JA 2ZI3A 4DCPA 2QORA 4I1YA 4C8KA 5GTDA 2B94A 2PSSA 3HWSA 2NMVA 3EIHA 1D7AA 2C83A 3QMVA 2YDYA 1ICIA 1QIGA 2R87A 3V4PB 3VVCA 2BKXA 3DBRA 1W25A 1G7SA 5J2UB 1L5NA 5HUQA 3R5TA 4R3UC 5IARA 3B5JA 2QSYA 2G7ZA 3AHJA 2QJWA 3DBIA 2B8TA 5B3JA 4DZTA 1UC5B 3TFQA 4PN3A 3OC6A 2QAIA 1MJ5A 4BQIA 3DZGA 3PNCA 3ZE2B 4LOIA 4Q3LA 1BVUA 3W3AD 2BFDA 5CLQA 3TNFA 3IJ5A 1V8FA 3DM9B 3EK2A 1E89A 2IE8A 4CL0A 2OB2A 1MD9A 4F7WA 4UU1A 2OGTA 1KFCB 4ESVA 5LMNB 2XVTA 1XPUA 1K0FA 2AJDA 5JS7A 2WKSA 4ICAA 1ICEA 3DLTA 3HFJA 5CCDA 5BSMA 4LNHA 4KDEA 4BASA 1ZJZA 1OTHA 4DQUA 2O8DB 1UMDA 2RJ3A 1VL1A 5J2TF 4FXPA 4YAEA 3NHUA 1L4KA 1V7PC 4OREX 3CTMA 4QSMA 3LAWA 2GFIA 1QO0D 2HJVA 1QLNA 4PV7A 4Z8YA 4LJYA 3WNCA 1Z07A 4GZ3A 3K15A 1XCGB 4D3ZA 3MWLA 6REQB 2W3RA 3BS5A 1CQJB 3CQ9A 2O2IA 3ZWWA 5KTYA 2Y0SF 3OLXA 4H1UA 1YFJA 4IGKA 3VDXA 2VCYA 2GEBA 5UKDA 4ZYVA 2B8NA 4RQ6A 3EW7A 4CIWA 2ZIXA 4EP1A 1E2IA 1H2AS 1FB5A 1OXJA 5EWFA 1QLJA 1FTQA 3U3DA 5L1KA 3B9BA 4DR2B 5DM70 1NG9A 5FV4A 2VUUA 3UH1A 2YWDA 3I2KA 1DEHA 4WE3A 3IT2A 2ORED 3TO5A 3AG6A 3PO4A 2FJUA 3O3OB 2V4RA 5A62A 4I9NA 1N6HA 1KVSA 3RROA 2ZM6B 3MTIA 3IHKA 3TMYA 3ND9A 4HTFA 3GAFA 5TQ2B 3P2MA 5E3JA 3LMKA 2BGUA 2UVRA 5JNLA 5J2TA 5TB5A 5BRJA 2BD0A 1KJNA 1PUXA 3NBMA 3L82B 4NWIA 2OZLB 1BDBA 3I83A 1FYDA 3CEMA 3DEIA 3WBBA 3CJTA 3H65A 2PUGA 2E82A 3QEMA 4G4SP 1JB1A 3HRKA 5JMOA 5HOQA 3DL2A 4N7BA 4XXHA 1B8VA 5LNK6 2W9MA 2AG5A 4FYHA 4L9WA 4OJKA 2CXOA 5F2EA 4EYSA 2QN3A 3ZKAA 1L5MA 3NVAA 4BP8A 2IHKA 1JHVA 1PL7A 9ICUA 5CW2A 2Q8NA 2C2OA 3R3UA 2FWBA 3GJQA 1YS1X 2BTQB 2QQGA 3VKHA 4DCNA 5DO9A 4TM8A 4NNPA 3R7NA 2X1HA 3KL4A 2IYTA 1VL5A 4FNOA 2FV8A 4N76A 1FIUA 4HNSA 3PXEA 4KIFA 3EPLA 3O8OB 3G2OA 3Q3IA 1ZD4A 3UMVA 1VHLA 3C0KA 3D3NA 3JQBC 1EIWA 1XMJA 3ENNA 4PFKA 4WTOA 5DK6A 3QOWA 2IVZA 4IUDS 1LDNA 2CJWA 5HF6A 1UFVA 2X1VA 3ZJUA 5K05A 1Z2NX 4HNRA 3T3IA 3PSHA 4W99A 2G6BA 1N3BA 1DC8A 1PVQA 1ZI8A 4D44A 5AW5A 1O97D 2D62A 1E3WA 3M9LA 4CYMA 4PLFA 2GK4A 3HB1A 3LVWA 5A1TA 1S0MA 1MC5A 4DQ0A 3QJGA 4E2ZA 2Q3LA 4NLKA 1IZ0A 4JLDA 3ZU4A 5JH7A 5F23A 1L7PA 2FPWA 5TLSA 3FGPA 4GG1A 1KMCA 1ZC4A 2XDWA 3QMWA 2NU9B 2Q29A 5IMSA 3UMGA 3PDIA 3IR7A 1OBFO 3MS7A 5EIBD 1JILA 3VPFA 3OOYA 5CA1B 5C5DA 4R2WA 3GLSA 4MFAA 4P31A 4M37A 1A8QA 1IK4A 4BBZA 3H87A 4QEZA 4KKVA 5K1ZA 4MI9A 3I5XA 2C9BA 4N5HX 4PG4A 3R8XA 4Y2JA 1VXRA 4YRMA 5KTSA 4MKXA 4AN1A 4HY3A 3R0VA 3SIXA 4DIBA 4N7RA 2ONJA 3HRIA 4RA6B 2PBLA 4JLJA 2JJ1D 3TWOA 1R4NB 4NYJR 5E0KB 3GLUA 4A6DA 1HEYA 2O7VA 2VLIA 3RU2A 3K6JA 3BJRA 1APBA 2P6PA 4Y7DA 1NMQA 1W5TA 3HE3A 2D1SA 5M2QA 1KQ3A 3OEWA 2HN9A 2EGUA 4NR0A 4RFSB 1GPWB 1TT5A 2HJWA 2R8HA 4UQGA 4EDFA 2Q7DA 2KZ3A 1NXXA 4MS4B 4BMCA 3AEUA 3HLTA 4K3UA 4WL0A 3DBOB 3JQAA 4P08A 2AZMA 1YRBA 3EEBA 3BFKA 3H1FA 1DJPA 2JHGA 4ZH4A 2BM8A 4GZMA 4JBWA 4L8FA 3KZNA 4XQCA 4XDYA 3BA1A 4BX9C 1Q44A 2PWBA 4DNXA 4EX6A 3T7SA 3MWDB 2GA8A 2ZIUA 4QODA 5K01A 1KYIA 2MOKA 3OZIA 4FOLA 2B1RA 2XT6A 1AGPA 2IHNA 2GYYA 3ENQA 5K3FB 3HJRA 1Z4PX 3MCVA 5HRAA 1WUYA 4B3XA 1SZJG 3RTCA 1VG1A 4JASB 3WRXA 4G65A 1PWZA 4RQAA 3OLCX 5C8YF 4LKOA 5EHXA 1U8ZA 2GDZA 3V55A 2AJTA 5KT2A 2VP4A 1MB3A 3NAMA 1U1DA 3INYA 3PLAE 3CWCA 3WB0A 3T1QA 2K2QB 2HHQA 3DQQA 4FINA 1EMDA 2J3LA 3NHFA 4BVEA 2WFAA 1ZXXA 1P1JA 5FNZA 5FAKA 4N54A 1HE1C 2FZWA 1NC1A 1QS0A 4LJXA 4PNHA 3JQFA 5GOZA 4F4ZA 3GEGA 3EZNA 3QY9A 2YWEA 3THXA 5BN3A 3EDOA 3RLIA 5CDGA 4I46A 2Q1SA 4EL5A 2JFGA 5LA6A 3IP3A 1DCFA 4PSAA 2V7EA 4NV1A 3GU3A 4X7BA 3KQLA 4NZMA 4KXXA 4OX9Y 2DFLA 4LY0A 2YVUA 4B31A 5A4KA 2ZROA 3EE6A 1IB0A 3DAFA 1HURA 4Z7JA 2PZ8A 2C2ZA 4BKPA 2PZFA 1EBFA 2Y1CA 3HCWA 3ZDDA 1O54A 3TKLA 4E07A 4POOA 3O9ZA 3UMBA 1NPTO 5KPDA 4Q9KA 3MNFA 2ZJ8A 2L5YA 1WUKS 3VKUA 2FN3A 4LWZA 2LDBA 1AXGA 3DTVD 5KNCD 2BQRA 3WIUA 1XYVA 3IJPA 4I6EA 2IXDA 1CY0A 3WQBA 2W6NA 1RQNA 3AVYA 1TD1A 3F8SA 3QENA 1L5VA 4QECA 3QBTA 4HVCA 1I4LD 3T3PB 2EKBA 1G8JA 1K98A 2P0AA 3GMDA 3RUDA 4RQ5A 1Z37A 4QZGA 8ICOA 5AHKA 3KKZA 2JZCA 5B4TA 1UMKA 3DD1A 5GVRA 4C7OA 1GYQA 1R5NA 2X8JB 3JATA 1L3VA 3C1AA 1VYVA 3S3TA 4P84A 5A71A 1NXSA 3AR2A 3HZZA 1DMSA 4RZRA 4C04A 1QMGA 4MPPA 4QOFA 1ORHA 3N7AA 4PLTA 4IH1A 2IHBA 2VHZA 3E5NA 3TR0A 2BBOA 2EZYA 3OQIB 1Z56C 1KO4A 2OM6A 2SNIE 3NT2A 1RFGE 3TL6A 2H07A 3D4NA 5GIOE 2VDKB 3RKUA 1K88A 2VXCA 3WSWA 2BPFA 1Z4LA 1FSPA 1H8HA 1QBGA 3K0KA 1N0IA 2GHQA 3BPSA 2PS9A 2QGZA 5HHIA 3X0DA 5LMUB 1K8RA 4NU5A 3WQSB 2FPIA 4BQFA 1UA1A 2VYVA 4H3SA 2I6FA 5AXDA 3GV7B 4M1QA 1GSHA 2ETVA 4E5KA 2QZPA 4LECA 4P7JA 4ZO8A 4CDGA 4Q47A 4FS8A 4FYPA 3NALA 1U0BB 3EZ9A 4TMWA 5I7WA 2HK8A 1MVNA 3IKJA 4OHKA 1Y4DE 3OY2A 5FYDA 2CLOB 3NM6B 2KPOA 2HXSA 4MQFB 1KQGA 2BBTA 3RS4A 5EHZA 1L1EA 2LRHA 4F45A 4Y7CA 3KKQA 1MFZA 4C3UA 4H15A 4R2MA 4EG1A 4GFJA 2R6R1 1WBBA 2WTNA 4MIKA 2B99A 4YRJA 1PKEA 3A2KA 2YMMA 4CG2A 1NP7A 3OKPA 3DZ8A 2JFHA 3UMMA 3RSZA 3AB3A 1IZYA 3L41A 4V38A 1PSZA 3NC1C 4BC1A 1E8NA 3GUZA 1P9LA 1V5IA 3ZWCA 1T4DA 3G6YA 3L0SA 1SZHA 4D99A 2RH9B 3HDHA 3HYTA 2VJPA 2RHHA 4I7EA 3OJEA 5KQGA 1WKCA 4EKEA 3CU5A 4RUAA 4ZCSA 3O82A 4I2JA 1F5NA 5DBGA 1VQ1A 1TM3E 4IWNA 2R8XA 1TC2A 2HW8A 1ZQIA 4Z1MD 3HKBA 2JDIA 5CM9C 3B70A 2FVXA 4O5AA 1ZQRA 2P5TB 2QR3A 4NBUA 1NQOA 1IATA 1J5XA 4BBAA 2VLBA 1A82A 4F84A 3NWBA 3C74A 4HLCA 4OYYA 3W3AH 1FLDA 1G19A 4UNIA 1U49A 1NU6A 3LZDA 4HDMB 3G7UA 3IODA 3LY7A 4BZXA 3DDCA 3PJEA 2C5AA 4YP3A 4UB5A 1YGYA 2X6RA 2IE0A 4BNDA 1KI7A 4A0GA 5BSWA 3OWHA 1ZI9A 4X1OA 2X42A 1RQ7A 4RTSA 2H06A 4WZBB 1AKNA 3W2HA 3R3JA 1QK4A 5J2IA 5DGIA 1AZWA 4IIEA 3WLMA 3TD2A 1AO0A 5KNIA 1KNXA 2BRUA 3FHLA 3QWBA 3M33A 3TPCA 3D4OA 2REQA 4J7AA 4F12A 1UZNA 2C0PA 3G2KA 3Q6MA 4B4KA 1IQUA 4YCBA 1KI8A 4TLMB 2Q2NA 1U5BB 4LF6B 2AC4A 2QJFA 5J0UA 3B6KA 1JU9A 4QVKA 4X6YA 1WU7A 3NYRA 4OXQA 4ZPJA 4FNAA 4KQ2A 5DGDA 4IKOA 2AKEA 1XN4A 3A4NA 4MR9B 4UNPA 3SBEA 2XB2A 2HT6A 4ECVA 2FPPA 5EMMA 4Q7JB 3C24A 2IEIA 3HB9A 3C7TA 1QYRA 2QENA 2FW8A 1V6SA 4MQUA 4PZZA 1NAIA 3O4IA 1SXJB 3K1JA 4DANA 1PG5A 2VHQA 3C3DA 4HEJA 3DDWA 4F5NA 4QOEA 1P1HA 3ADCA 4EB6B 5HRUA 2AFIE 2GO1A 2VHXA 1UBEA 1KDOA 1KEKA 1LPPA 1M6NA 4WK4B 1HUQA 4URWR 1O6CA 3C4VA 1FRQA 2OGSA 1RKUA 5F35A 5KKNB 1TEXA 2EHJA 3UK7A 5TF0A 4RPYA 3NYWA 1CS4C 4JB2A 1LBIA 4Z54A 3TTWA 4NRDA 4JT4A 2QQ5A 4JYCA 4Y6RA 2EKPA 5BSHA 4EUHA 3HUFA 2HNBA 1XZQA 1W4AA 4K9MA 3QTBA 4JXZA 4KIWA 3BKWA 1GTRA 2ZRCA 1HLPA 4XTCS 5IN4A 3L49A 2JKYA 3OPYA 3TDNA 2I1QA 1Y6ZA 3I73A 4X85A 1QAQA 4TKLA 4D57A 3K8YA 5L6MB 5L3QA 2LM1A 2HMUA 1JFFA 5ADUS 1GA1A 3H0LB 3WNZA 4QGBA 2ZTUA 3FH0A 4BKMA 2XEDA 1V38A 2OCPA 4YO7A 4EQZA 2CBXA 1EJ2A 1PJ4A 5DB7A 4JROA 2TMYA 1LXCA 4FB5A 1H3NA 2XNHA 3RAFC 2XYVA 2WKQA 1U2RA 1KSGA 4F2GA 4KMRA 1XVTA 4MUKA 4UREA 3H6GA 2SKEA 3OMXA 1L2TA 3VJRA 3PX3A 1HF3A 5DHQA 1BEEA 2H63A 3PIRA 1VKRA 1F9AA 4I9GA 1HQKA 2CKMA 3I01A 2WWTA 3K72B 1K08A 4EPXA 2OENG 2JBWA 4D6XA 1DG1G 2JKZA 2ZJ1A 3CUYA 3PD0A 3BIOA 4RTQA 5AVSA 4NS1A 4F21A 1IHDA 2O4CA 1J1UA 3WU2U 1GZSA 3TXXA 5EKSA 4IEFB 3H1EA 1ULTA 3T7AA 1XXHA 5I4KA 3G82C 1YL7A 2HEGA 3W1VA 4AXXA 1PNQA 2XCRB 4IP0A 3CPEA 1UMBA 1FOEB 3F9CA 3VU8A 4AJNA 2BDUA 5K99A 1LZLA 3OMWA 4DV4B 3L8EA 3KHLA 4KFSA 4Z6FA 1QYIA 4AMUA 4MUXA 4XIFA 2H9IA 4KGXA 2BSQA 3LT5A 2O2EA 5J2UF 1OXBB 4GD3Q 1KP3A 5EPOA 2BCQA 3AU8A 1EUCA 3T3OA 3ZV5A 3WYCA 2KJ8A 2HK6A 4BMSA 1RLUA 5EE3A 1BTOA 1VIYA 3HYNA 1P4JA 4M89A 4EFNA 4O1HA 4WK6A 3IPRA 2HOFA 2Y0CA 1AN9A 3IYLW 2D5AA 2LKYA 3TAXA 5C2JB 4JVMA 3P2YA 2BR4A 3L8CA 2CDBA 1B1AA 2A9PA 1YS4A 1VLHA 2XGJA 3OO1A 4DMCA 3W5DA 5BT9A 4LG1A 4FGLA 5CRXA 4YP5A 2P27A 3KLBA 2O8CA 5JY1A 3SEQA 5LCXA 1U3FA 3CY6A 3FWKA 3KO8A 3MWFA 3LTNC 2I2AA 1JT2A 4WERA 4A0QA 3RF7A 4KV9A 2YOGA 4AYBF 1GTL1 4KQ6A 1W4CA 3EXHB 3NJRA 4YACA 2PXAA 4F1KA 2DQYA 3IAUA 2AEFA 1GWNA 5FB3A 3VAYA 4PYMA 2VJMB 4TVOA 3ZVRA 2W54A 3O8BA 5J2UA 2PUEA 2DERA 4BFXA 1KVUA 3G8DA 3B6JA 2M32A 1KFBB 4RABA 3IIIA 4Y2RA 5CT4A 4PZLA 1CUVA 2BI4A 2X7JA 4D0LB 1SKQA 3F7OA 1A76A 3AUFA 1CIVA 3W2EA 3SFZA 2QUBA 1ZGAA 4NAHA 2WWFA 1F38A 4WACA 2R47A 4OYRA 7ABPA 4N01A 1TYBE 1OFIA 1GPYA 1NVEA 2MA1A 2IXGA 4OK5A 3TE6A 4M1YA 3COZA 4HN2A 3CH7A 3N70A 3NS7A 1KMIY 2JHAA 4N12A 4C2UA 3UAYA 1EWRA 3E05A 1GNQA 1R6AA 2C95A 4U5QA 5BXQC 4PZCA 1WTAA 1MOSA 4MRAA 4D3YA 5C7IO 3H8WA 1D6MA 3ESCA 4M8KA 3R7AA 2O8DA 3EGEA 1IXSB 3QU4A 3FPHA 4ZOLF 1XTPA 1P45A 2D7CA 4CNBA 5CM8B 1JLHA 1UEJA 1BN7A 3CHYA 2TMGA 2H11A 1XRLA 2NTYC 1RC0A 4EO9A 1O58A 5HR5A 6REQA 1CQJA 1JQJC 1R7RA 1T2CA 1XLTC 2VQ6A 3D2SA 5AVWA 4NCBA 5DX8A 1IOZA 5GVSA 1V39A 3WAKA 3JWEA 1LTKA 1JAHA 3LDGA 4LYFA 4G36A 3DEHA 4A1OA 5C5EA 1YMQA 5TQVA 5A05A 1ENOA 5CPBA 2M6LA 2J0VA 4YNBA 3IEMA 2C98A 4J1TA 1KHTA 5KNCH 4TQUS 4G0UA 3CWQA 4ZAFA 3UMRA 1PNVA 1TYCA 1B6SA 4OBWA 4UBCA 4BN4A 1K68A 4N0DA 1UPCA 2C7OA 4EG5A 4DWVA 3AL0B 3ZZUA 4ZMSA 4CCHA 3BGVA 2I03A 1SBHA 2WA1A 4ERXA 3DMRA 1FSZA 2HDOA 5TQ2A 2PZEA 5HTKA 2ICAA 4GPD1 4G8CA 2AS0A 3ESQA 1SVMA 4X93A 3B3QA 3V4OA 3DE4X 3H1TA 4IZ6A 3L7AA 4B9TA 2OZLA 4QUJA 5JYDA 3ZYCA 4DBZA 3GDGA 3UGJA 4MVJG 5B3AA 4MUGA 3ZOZA 3GJ0A 1JECA 2I8LA 1JFVA 3TPFA 3INGA 4AZ0B 4PAOA 1TQHA 4BQPA 1YK1A 4WLUA 2WM3A 4WNCA 1RWNA 3E9MA 3U7RA 3O90A 5DRTA 4G6ZA 4RF5A 6PFKA 2X0DA 3ZYZA 2VF8A 3LSYA 3DAHA 3W34A 5AD1A 1CS0B 1LEHA 3CXUA 4J9UE 4IHAA 1YCDA 4QTYA 3T7IA 4LY9A 2BTQA 4DG8A 3ZTWA 1XMIA 1RAFA 4BKOA 1VFNA 5A4DA 5BW6B 5CA1F 1GUAA 2B7CA 3UQ2A 4G4IA 3D0RA 1JEOA 1TIKA 3QVOA 3DDNA 2WG2A 3O8OA 5LWHA 2W2XA 3EVCA 5C3UA 3TTSA 2ISPA 4EY4A 4ZMBA 3PZRA 2H5XA 1K86A 4LZLA 2R1UA 2NXCA 2FFQA 3M6KA 4GMHA 3A1TA 2JCBA 2W7TA 4YRKA 1E9EA 3FNEA 3SBXA 2C4VA 1CW2B 1XRQA 1GV0A 4U7HA 3BHMA 1ZQSA 1ZGGA 2JW5A 3RRXA 2G8LA 5C8YB 4CM9D 1UBRS 2C84A 2XUOA 1NW8A 4BFLA 3U1VA 1OAAA 1X2EA 2V5AA 2UV8A 3NRBA 2AG8A 3FPAA 3ONDA 2QMOA 1QHNA 3F3SA 1ZQHA 1Q20A 4DOBA 4EK9A 5DQGA 4G9GA 3E3MA 4QZDA 2APJA 4B7ZA 3EGOA 2H7XA 3DBHB 3K53A 4TLCA 5T6MA 4UBLA 4BTLA 2NU9A 4G67A 4PLHA 1GAXA 1UWVA 5ALZA 5HJEA 3ES9A 1NW7A 5AM4A 3C2MA 1KEZA 1QYVA 2Q99A 3JV7A 4N39A 4W5OA 4LYAA 5A3VA 4PM4A 2OGUA 1PFVA 4P5DA 4TYMA 2X86A 2NW6A 5CA1A 5E7JA 4P3YA 4F4FA 4RL6A 5IEJA 3RS5A 3PKJA 4ZAWA 2JZBB 1OC2A 2XITA 3DEKA 3ZU3A 3RPEA 2QVGA 1LNQA 1SCNE 1N5OX 1ZH8A 1M1NB 4UEKA 4KLOA 5KYYB 3UHFA 4EG7A 4FSDA 4LCBA 3PVSA 4B1FA 4EO7A 2FK7A 3QF7A 2IQIA 1XZ8A 4ZEWA 2AMYA 4EG3A 3MZ0A 4JLMA 4RA6A 1DQYA 2VPPA 3LFHA 2G36A 2LPEA 2YY7A 2MSDB 4GYYA 1R4NA 2ZYAA 4TS4A 1ZOPA 1E2EA 5JANA 4QUBA 5C52B 3NW9A 1IG6A 4MVJE 5CVCA 4O4HB 5EKUA 4BE7B 2C92A 4ZDKA 3KQOA 4JL8A 2JFOA 3C28A 1B76A 1XKTA 3BZBA 4FHZA 3DPIA 2QPAA 4RFSA 1SZPA 3VDNB 4MVWA 3ERCA 1Q1ZA 4P0QB 4WXHA 1KZ6A 4MS4A 2DPGA 1A6SA 3IUYA 3BMCB 2B9EA 4DCJA 3A1SA 3HA7A 2EL9A 5ESWA 1S10A 4L73A 2Q5CA 4ESOA 3ZIDA 3B2QA 4C4OA 2EKQA 5E7IA 3RGGA 4LCJA 3ESYA 4GP6A 3V4LA 3BRWD 1XZJA 1AZLA 1QZ3A 1W2GA 3I2FA 1J2JA 3MWDA 5KMGB 3FWZA 3PHHA 4V0KA 4O3NA 4R64A 4MICA 5IIIA 5JJLA 1UK6A 4M0EA 3PUVA 5K3FA 4CL2A 5L1IA 2O07A 5KFSA 4KQ9A 4NNJA 5AOAA 2OCLA 2W2MA 4RLFA 4JOQA 5L1JA 4EUNA 2W2LA 1FTWA 1BJKA 3TLYA 4S2EA 2P7HA 5AW9A 1M6VB 3SF0A 3EFOB 1WXEA 4PZ9A 2RARA 3C7KA 3M49A 1QE5A 1K92A 2J9GA 3QG5A 3RJTA 1LDMA 1M66A 3IB6A 1H69A 3W5VA 1XIVA 3L79A 4CE6A 4B87A 1AS2A 4CU5A 5KFAA 4UUMA 3UXNA 1HMYA 2WV7A 2RB4A 2IXEA 4RH1A 2PGOA 5K0SA 4FZJA 3L9WA 1PUJA 2RCYA 4R1SA 2FLKA 3W05A 4MYHA 5IF9A 2H2IA 5CYOA 1CUAA 4KI0A 3FPBA 2J3EA 1XCBA 5J5AA 3ETNA 4H7JA 3LX6A 2C5SA 3BXEA 3OCYA 3FSRA 5B2FA 2ZUVA 4B0PA 1SHKA 2YIJA 3WYEA 3VH2A 1FLNA 3CZ9A 2XKBA 1TQ6A 3LYSA 3W5JA 3TF5A 3N0WA 2PEYA 4RK5A 3HR7A 2A35A 2ZVJA 3NTLA 1TQ8A 5I7SA 5A2GA 1JYFA 4ZV9A 1G16A 1N6LA 3SQXA 1QHYA 2XUQA 2Q4BA 1TKRA 5LC1A 1KRHA 5HIAA 1D3AA 2GEJA 2DFVA 3ALRA 4F3OA 4NLGA 4IICA 4P81A 3G2QA 1V4NA 3VNSA 4NXNB 4LJSA 1UPHA 5KDDA 1R5BA 4WFKA 4C3ZA 1C81A 3M6WA 2Q2OA 3HGMA 4X65B 1G7TA 1EFHA 3RC2A 5FWNA 3Q9UA 1C4OA 4ER5A 3ANMA 2GLTA 5JG7A 3OTQA 3O47A 4AZVA 4F60A 3BE6A 2RAVA 3V8PA 3ON5A 1ZD9A 5CXXA 2HU8A 4KYVA 3R7FA 2VATA 2L2QA 4GGOA 3QV2A 1T6XA 3DTNA 5CUQA 2G9NA 2H54A 2X8JA 4E6PA 5CFPA 1YD7A 2ZI5A 4R63A 1A5AB 1Q3KA 4DYVA 1JWBB 2WYWA 3QUCA 4YD2A 5TMBA 3TKYA 3O0DA 4OJQA 3UW1A 1UZMA 1GL6A 3CSUA 2XWJI 2DLCX 4QREA 4QU9A 5L8VA 3OQIA 4AYBC 5ALXA 3Q2KA 3JQBA 5INTA 2MSCB 4E4YA 3AF2A 2NX2A 1NSTA 4ZT3A 5AK4A 2DBRA 4XJVA 5L95A 4I9HA 4MV7A 1TIBA 2CV0A 5FDFA 1P5RA 2BGIA 3CCFA 1X6VA 4HB3A 5E9JA 2EARA 2QL7A 1MNQA 1WXWA 3F6EX 3HZRA 3UWOA 5J4LA 2UYOA 8ATCA 4YJDA 2GVNA 3M5CA 4EKNB 2C3UA 2EWWA 5DIFA 3IUJA 1J7KA 1IC6A 1YMVA 3VYWA 3CNEA 4GX1A 2JGIA 4K9DA 2FQXA 1LDGA 4PYNA 2DFKB 3VXKA 5KFQA 3PWZA 5JQWA 3RYHB 1BDMA 1Q57A 4US0R 4L6AA 1Z3IX 3BOSA 3K9WA 3SK0A 1FS4A 1FP4B 4X62B 3LVVA 2X13A 2VRWA 1WOMA 1HNXB 3TADC 3WO1A 2FYTA 1EXMA 3AR4A 3KR0A 1T3QA 2L19A 5TT0A 1NR1A 2R8PA 4MQFA 3OOHA 3DOIA 3EIOA 4DLUA 4B73A 4OB6A 2GJKA 2Y2VA 1CVLA 4XSHA 3JVDA 4N3CA 4CM5A 3NB0A 1S0UA 5KQRA 3OZBA 1GLGA 2R25B 2C1ZA 2GZ1A 1RNLA 4CM8B 3TZQA 1TM5E 1CQIB 1XBTA 3QPDA 3LHSA 2MSWA 1THMA 1SIOA 2CJFA 4ENSA 4UAWA 4KJXA 4UXJA 3RSGA 4ABYA 3PTZA 1RYNA 8ABPA 8ICRA 1XVLA 1Z7BA 5F73A 2HJGA 3KKAC 3TLMA 9ICMA 4UTVA 4OY3A 3GGPA 1RJWA 5CFQA 2ZIGA 4ETNA 1RADA 4Q66C 2BCEA 1JAZA 3I45A 4NV3A 4RTMA 3MWGA 4NCHA 2Y2UA 3RS7A 2PSDA 2DUJA 1Y1QA 4KDRA 1M5UA 3MHTA 3K94A 1H8EA 5JBQA 4B46A 3A1VA 4O1IA 2I2FA 1YO6A 3B51X 2CNWD 2H2AA 2I2CA 5JMPA 2P9YA 4R3NA 4TMYA 4NVRA 3RBEA 4F4UA 4AMGA 4HDMA 3A10A 2B21A 3PGXA 4KC0A 3NHRA 4O3RA 2VJ5A 4GWKA 1VIVA 1OFHA 2IDJA 1AB5A 4WZBA 1FW8A 1U2TA 4IL5A 2OWOA 4KGVA 4PPNA 2I4OA 1MO6A 3ZCTA