2WHEA

Structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Details of Near-Transition State Conformers for Enzyme Phosphoryl Transfer Revealed by Mgf-3 Rather Than by Phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wheA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wheA01
3IRUA 1XPJA 3N1UA 3A1CA 5IS2A 3NRJA 1Z4LA 5AVRA 2I55A 2OYCA 4XOUA 5AI5A 2OA0A 4CF4A 3MMZA 5JJBA 3KOOA 2YJ4A 4KYTA 4NV0A 2G07A 1ZRNA 2EATA 5AVUA 1ZOLA 3OPXA 3KDPA 4UM5A 2C9MA 1ZD4A 5AI6A 3NIWA 2YJ3A 1L7MA 1RMYA 4EENA 1WPGA 1Z4KA 2I54A 1O03A 3L1VA 4DFDA 3OCUA 4DW8A 5ALOA 1Z4MA 3R09A 4IG4A 4G9BA 1T9ZA 4HGNA 3N5KA 1L8OA 3AR2A 3GYGA 3EWIA 4B6JA 4O8CA 1Z4JA 4G63A 5ALDA 4QQFA 2FI1A 5AW9A 3L8EA 3QGMA 3FVVA 2Q4RA 2AMYA 3ZW7A 2I6XA 5ALPA 4Y3UA 4CF3A 5AIAA 4UMDA 5AI4A 3WGUA 2ZBEA 4UATA 3PGVA 3QUTA 4L6CA 5AKLA 4I9FA 4Y2PA 5AW1A 3AR7A 4ZEWA 5AM4A 4NFLA 3R9KA 3PGLA 3CNHA 3KBBA 4YCNA 1TE2A 4UARA 4YGYA 5AK4A 3HYCA 1TA0A 1RLMA 2O2XA 4RESA 1QQ6A 5AM3A 2EAUA 2B1RA 3WK6A 4UMFA 2GHQA 3N28A 4IFTA 3WK5A 2WF8A 1SU4A 5ALGA 2OBBA 3UMCA 3A1EA 5AKGA 5IT4A 3KC2A 1RLTA 1RKUA 3I1YA 4OD0A 4AP9A 5FP0A 1VJ5A 1YDFA 5AM2A 1LTQA 5AW5A 2FPSA 4Y2JA 2D2VA 3IB6A 3ZWKA 4HGPA 2YJ5A 3FGOA 3ED5A 4H1WA 2IA5A 4OFZA 4YCMA 2O9JA 3FPSA 5AW8A 5AKEA 3E81A 1K1EA 2ODAA 3PDWA 1XVIA 2ZBDA 4GIBA 3L0YA 3NUQA 1YMQA 2WHEA 2G09A 5AI8A 1Q91A 5AW0A 5ALFA 2FPWA 3QNMA 1Z5GA 4YH1A 5AW6A 2HF7A 2WM8A 1U02A 4BEWA 1RMQA 1QQ5A 3W5CA 5ALMA 5AKZA 3QU4A 3M1YA 2BY4A 4FFDA 4EELA 3K1ZA 3ONNA 1Z4OA 2FPRA 2G06A 5AW4A 4UAVA 1RKQA 1TJ3A 4PNHA 3SLRA 2W11A 5AK6A 1Y8AA 1N9KA 5AICA 4EX6A 1ZD3A 1JUDA 3BWVA 2MU1A 3AR9A 1Z4PX 4BBJA 3DAOA 1YV9A 2R8EA 5AKHA 5AVVA 1CQZA 2CFSA 5ALLA 1L6RA 2ZBFA 2DQSA 2YMMA 1WR8A 2JAOA 2AUTA 3KD3A 3U26A 3OCVA 3UM9A 2YFYA 2HI0A 3E58A 3MC1A 5ALVA 1NF2A 3EF0A 5ALEA 4YIKA 5ALHA 3EF1A 5AI9A 2QLTA 2NYVA 1YNSA 4F71A 4CE6A 4UM7A 1RQLA 3ZWDA 1U7OA 1LVHA 3SKYA 1CR6A 5AVQA 4DCCA 2FUEA 2RBKA 3CZ4A 1F5SA 3ET4A 4JB3A 3I28A 4C4TA 5AK5A 2P9JA 2FEAA 3MN1A 2PKEA 3UMBA 3IJ5A 2QYHA 3E84A 3NANA 1J8DA 3ZTWA 3L8FA 1TJ4A 3NALA 2G1AA 2YN4A 2CFTA 3QYPA 2JAWA 3ZU6A 3ZVLA 2HX1A 5ALRA 4ZEXA 3QU5A 1U2SA 1T5SA 5ALXA 2CFRA 3A1DA 3UMGA 2PR7A 3OCYA 1MH9A 3RFUA 1ZS9A 3B9BA 2FPUA 1RDFA 3SMVA 2I34A 3PCTA 2OM6A 3N07A 4KN8A 5E0OA 3L0BA 1YS9A 4NWIA 4F72A 1ZRMA 2EARA 3OCZA 4EEKA 4OHFA 1EK2A 3DNPA 5AVZA 5AW2A 5AKJA 3E8MA 2YBDA 3DDHA 5AW7A 3AR5A 1N8NA 3FM9A 5ALJA 4NABA 4XE5A 3S6JA 2HO4A 2B30A 1Z88A 2G0AA 5ALUA 4I9GA 4YIHA 3U7FB 1RC8A 2AGVA 1Z4QA 3BA6A 2B0CA 1KYTA 2P27A 3QU2A 2C8KA 4Y2QA 3W5DA 2P11A 3OTQA 4BYGA 3WKEA 1IWOA 1Z4IA 5ALQA 4UAUA 1FEZA 2WF5A 1YJ5A 3W5AA 5AKXA 3U7GA 3A3YA 1U7PA 4HGOA 2YMQA 1ZD2P 2RARA 2YMPA 5A3RA 2HEGA 1L7OA 2C88A 2IOFK 3ZUPA 3W5BA 1QQ7A 2HCFA 3SF0A 2GO7A 3DV9A 3KZXA 4CF5A 3ZVMA 4AS3A 4UMEA 4Y2SA 3QU7A 3WK7A 1Q92A 2B82A 2W4MA 3J7TA 2W43A 4HGRA 4KX3A 4L6AA 2GMWA 3QUBA 5AKIA 4BX3A 3AR3A 4NAVA 1TJ5A 2IOFA 3B8EA 2HOQA 2FDRA 4MUMA 3WGVA 2WF6A 2ZXEA 4C4RA 2RAVA 1VJRA 2NO4A 2B8JA 5T41A 4Y2TA 2I33A 1RMTA 2HF2A 3ZX5A 4RETA 5AVYA 4BEVA 3QX7A 3ET5A 3L5KA 5AHXA 2R8ZA 5AK3A 2CN1A 5AM5A 3I6BA 3ZX4A 2C8LA 3ZTYA 1QH9A 1ZJJA 2G08A 3U7HB 2I7DA 3AR4A 5AVTA 3RF6A 4Y2YA 2P69A 5AI0A 4BX2A 2YY6A 4EZEA 3ZVNA 1RRCA 4FYPA 5A3QA 2HSZA 2VKQA 3U13A 1RPZA 5ALYA 2G80A 3WK4A 2Q4TA 1ZD5A 4EX7A 4C4SA 3MPOA 2FPXA 4FE3A 3ESRA 3WKAA 1AQ6A 1X42A 3SD7A 4Y2XA 4XPZA 3HLTA 3L0CA 3WKCA 3WKBA 1EK1A 2YMLA 2GFHA 4DWOA 1S8OA 3WKDA 5A3SA 2GHTA 4BNDB 2NO5A 4UW9A 2FUCA 1J97A 2R8XA 4J03A 4HYTA 3U19A 3NAMA 2ZBGA 1RQNA 2Q5EA 4YCLA 4KX5A 4BX0A 3QXGA 1WZCA 5IT0A 1RLOA 2JAUA 1NRWA 5AKKA 2WF7A 4L57A 2IYEA 2ZG6A 3D6JA 3AR6A 1L8LA 3L7YA 4AS2A 1QYIA 4MWOA 4UMVA 5AKYA 4Y2UA 4E88A 2YJ6A 2JGAA 1Z4NA 5AM0A 3WK8A 2B1QA 3L1UA 4XQ0A 4BKMA 3EPRA 2MU2A 1WVIA 3P96A 5ALSA 4Y2RA 2IOHA 2BDUA 3VAYA 4Y2VA 3QUQA 4OCZA 3L8GA 1VFPA 3ZI4A 3R4CA 2B8EA 5AIBA 4BNDA 2WFAA 5ALTA 2PQ0A 3OCWA 3WK9A 4UU0A 3SKXA 5AW3A 5ALNA 3NASA 5ALKA 5AVSA 4KNVA 2ZOSA 5ALWA 5ALZA 3I76A 2HHLA 2RB5A 5ALIA 1NNLA 1T5TA 3OCXA 1L7NA 4UU1A 1RKVA 3QU9A 4QJBA 1O08A 5AESA 1U2TA 3L8HA 4CNQA 4KNWA 3F9RA 2AH5A 1S2OA 2WF9A 1L7PA 2C4NA 3N8GA 3FPBA 3SHQA 5AVXA 1PW5A 4HGQA 4GXTA 2HDOA 2X4DA 3M9LA 3TLMA 1XP5A 3QLEA 2MSNA 1SWVA 2BDEA 4HAIA 4J2TA 3U7EB 2JARA 1SWWA 2R8YA 3AR8A 3FZQA 3QUCA 4JDPA 5AVWA 1Z5UA 3B9RA 4UASA 4ZEVA 5AM1A 3ESQA
chains in the Genus database with same CATH superfamily
2AN4A 3B2QA 1E6CA 1C4XA 3WMWA 4H16A 4QPPA 3ZYZA 3U7RA 2Y6VA 1C80A 1FDWA 2AG0A 2FG6C 1T15A 2QD4A 1TD9A 1RWMA 1T91A 3GCGA 3G8DA 2J6TA 3T3EA 3ZU2A 5JXGA 3AEVA 2HOIA 2I7TA 3H2YA 1U7XA 4L27A 4J9VA 4M55A 2GEUA 1BZYA 3W9BA 1EXVA 5IFKA 1REQA 1ORVA 2YOGA 1SKQA 1V6CA 3AFOA 4NV0A 3L7IA 4WFJA 1TLTA 4B1FA 4UPDA 4TKVB 3DMGA 1V3UA 4YRMA 3UFXA 2MSCB 1MQ3A 3AFHA 3HSKA 2K8CB 1Z6XA 3Q9UA 3F5QA 3U4AA 1JAIA 3CRNA 1BEEA 4Q3LA 3QBJA 2GN2A 5EGSA 5K51A 4DWVA 5CCBA 3L4PA 5ED4A 3PJGA 4URUR 3FGPA 2ZT7A 3QNWA 3GJSA 5AH0A 4F8YA 2J41A 4JL8A 3SQDA 4CV0A 4XRHA 4V2IA 5KFRA 1T5DX 2H1RA 5IAEA 2C04A 2AI2A 3WLRA 4Q1EA 4LIPD 2W0MA 4IG4A 1G3QA 1CQWA 1N9ZA 5DYTA 1K5OA 4DNXA 3U17A 2PT5A 2RHRA 1D03A 2WIDA 2ZR8A 4UZSA 2WV7A 3C4VA 5JAPA 4IOLA 4BTEA 2X0FA 2GILA 2O8CB 1TIPA 4B6JA 1T6ZA 3FWKA 2ES6A 1QGZA 1YRQA 4URYR 4AKEA 2XVMA 4KI7A 3ZW9A 4QM6A 4BPBA 3SXJA 4EYKA 3TTTA 1PX2A 5KQMA 2BFDA 3TQSA 2JFGA 3ENNA 2YFQA 2V9WA 3T0GA 3ZE9A 3P8ZA 4RPIA 5CJ7A 1MT3A 2JGEA 2VXYA 3AOGA 3BRQA 2F3PA 3QW2A 5AMXA 3F3SA 1E62A 1QGED 3B3QA 4RPXA 3DAPA 1T3QA 3LS2A 2C1EA 4JB8A 8ICLA 4FZJA 4IJVA 1KMHA 2AJDA 4PSAA 5CW2A 1S8FA 3S1AB 3T9BA 3M5DA 3F74A 2GOLA 4HH0A 3BH0A 3WYEA 1DXHA 4QPZA 4FC6A 4BV9A 5AW1A 2VJMB 2B1IA 2C0QA 4R8UB 1DDIA 2XQJA 4CBVA 1AK1A 1VZ3A 2ZI4A 3L1HA 3LK9A 1TYAE 1MD9A 2CZQA 4NLBA 3F5FA 3MILA 4JLJA 3ADDA 3UV6A 2B69A 5FUXA 1V16B 4CQMB 3EY4A 2LYHA 3E3MA 3IEIA 5JSFA 1TA0A 4BVAA 1ZH6A 5IDQA 1Z6AA 2NRZA 3QV2A 1CIVA 3N28A 2WJ4A 3EH2A 1KIAA 2AX4A 2IEYA 1R3DA 1WDKA 4IDOA 2H11A 8GPBA 1GDDA 3X1YA 4BLPA 3H6HA 4DUZB 2QUZA 1CY1A 4HNSA 3S7ZA 1IVYA 1HETA 4TS4A 4DVJA 1B8PA 3IPCA 3VDRA 1Q0ZA 1LJUA 2CLKB 2P9FA 2VF7A 3H99A 3P1JA 3V32A 4C22A 5E9JA 1N77A 2YBEA 2DRIA 3FG9A 1KKMA 1THTA 1OBFO 3PMNA 1AZWA 3A05A 4FDVA 5FWAA 2WJGA 2CYAA 2ZIFA 5E6UA 4EY8A 4PSVA 1K0UA 1HRDA 2QL7A 1MC1A 4X92A 1CIPA 3Q8RB 1RBZA 2VPTA 4LGCA 5CJPA 3B1XA 2AX3A 1EWKA 1Y8RA 4H3SA 4GC7A 4KL8S 5CLIA 3UWPA 3UKJA 4NU0A 5BV8A 4M89A 3DFIA 5IAKA 4I6GA 3GWGA 3JASB 4CG2A 2EBWA 3I9KA 4E7PA 2Z2KA 4EHIA 3PC6A 3JWEA 5JEEA 4U2GA 5JSHA 1MO5A 2V7BA 1IWPB 1CUXA 4GI2A 4ECUA 1ULBA 4A4DA 5E6RB 1KKLA 3IAS1 4BTLA 1YVDA 1MO2A 2EP5A 2O14A 2F64A 2A0KA 2ZT5A 5TS3A 1SK9A 2R7NA 5IFLA 1GAJA 4GDMA 5EZ5A 2HJRA 3U3JA 2E3JA 3EOAI 1WZNA 2AIRA 4M1TA 3HRIA 3IA2A 1RYYA 2W6IA 5FBZA 4ZT7A 4D4MA 3TL3A 4MW9A 3FUCA 1K06A 5KDDA 4O2BB 4YRAA 1UM9B 2IYRA 5C8YA 5CXUA 1QAOA 1RMQA 2C4MA 4PAOA 1YI8A 2VXBA 3AF6A 2DR2A 3O9VA 1P1JA 3ZBQA 2ODGA 3MJDA 4S0XA 3REQB 4HJXA 4RHEA 3ONNA 3TFOA 1AQNA 4ZVLA 1I36A 3PSFA 5AW4A 2XIJA 4BO2A 4JR1A 1GSIA 1YQWA 3PX7A 1MORA 1QBKC 4TMTA 4Q7QA 4B9NA 3D5EA 4MAFA 4TL8A 1Y8AA 1C3OA 1OW3B 1S7CA 1VHJA 2WLTA 2EKDA 3AFIA 1N9KA 4MJXA 1F14A 5L9XA 4EX6A 1LJLA 4KIFA 5LIRA 3S8YA 1EFAA 1GO2A 3HBNA 5J2EA 1P2GA 4WOJA 4TQRA 2PTGA 3IPXA 3NT2A 1JYFA 4HRXA 4GHWA 1HE1C 3GGDA 4ZTUB 2XI9A 2LDBA 4IVPA 3FFAA 1CQZA 1ZI8A 5FWYA 3T4XA 3L7NA 5DBFA 1US8B 1NOKA 4DNPA 3TLEA 4EB0A 4RPGA 1V25A 2GS9A 5TARA 4EJSB 3BQMB 4GP9A 2YMMA 1LX6A 5K0TA 3HN6A 4RD6A 4DCTA 3W5UA 2XNKA 1DG1G 3ELWA 3N2GB 4TSKA 1CJBA 2GAIA 2ZIXB 3F8SA 3H42B 1YKSA 3IXQA 3ONDA 1DL5A 4L9AA 2W70A 4IIJA 2F1OA 3GEGA 3L07A 1ZM9A 2RC5A 1LSOA 2VDRB 3VOTA 1ILWA 4JH0A 1GKUB 5AXAA 4QFDA 2XNHA 5ALHA 2CY0A 3K75D 5JBIA 3CU5A 4DSLA 1A95A 3VH3A 1SCUB 1OZFA 2C3PA 4U0JA 5G02A 2WJPA 1BGVA 2MDTA 3KB2A 1JKJB 2H3HA 4ER3A 5CB4B 2G0NA 5BYBA 3SKYA 3TZ6A 1KZYC 1PJ3A 3QG1A 3LIIA 1DB3A 4JI4B 1UKZA 1VPVA 3CZ4A 3RRJA 3M4ZA 4D4IA 1YASA 1UPAA 1LB2B 2ZTDA 3T5JA 2Q0HA 5EOZA 1RM5A 2FNAA 4C4TA 2I66A 2V5AA 4KLAA 1PR0A 4A1FA 4AMBA 1I2MA 3O8OA 1UK8A 3I30X 4O33A 4J49A 7ICLA 4B74A 1T4CB 2G28A 3QKWA 4DXDA 4BJ6A 2AR9A 4DJEC 1R4NA 2J3IA 3L01A 4EVQA 5CB4A 5TLSA 1Z0DA 1J8DA 4KLTA 3L8FA 1AHIA 5J2TF 3CP8A 4PL2A 3Q2IA 3E05A 4HAWA 4IDAA 3QXHA 3STYA 1UMCA 1XRRA 2BMWA 1G7RA 3HA2A 3U4QB 2R6CA 3QYPA 1XTVA 1DHRA 4FJ1A 1KYQA 3A9UA 4WW0A 3BKWA 3PC3A 2Y66A 2B83A 2J0QA 1T5SA 3X1JA 2HHCA 3FF4A 1U3VA 5AVOA 5BXQC 1LSUA 1CI4A 1OZGA 1E66A 1NURA 1T8YA 2IY7A 3KB8A 1TTQB 3LPNA 4RJ2A 3WICA 4HYKA 1KLNA 2NWQA 3HTXA 2TRSB 2JEYA 3M81A 5DMXA 5JFGA 4CDRA 4JUDX 4WNIA 1T6YA 4PG4A 2GOYA 3THSA 1BQ3A 2C8JA 2PFKA 2A30A 3ESCA 2WDZA 3X1XA 2ZI7A 4IC9A 5DGBA 4BFYA 2BTQB 2QSUA 2JLXA 4GUDA 3T3HA 2Q9BA 2GK6A 3GVPA 2DFKB 3PUZA 3IAM6 1V9PA 3TEJA 5A03A 3PF8A 3T5HA 4HN4B 2FPOA 4R05A 1ZINA 1IY0A 1BD3A 2XJ4A 3A2NA 2VAXA 2J6UA 4DQKA 4IL6U 1ONOA 5HF6A 2GH1A 1Z29A 3FUWA 1QO7A 3I32A 2X8JB 4OP2A 1A96A 4RSGA 5GQSA 3EPPA 5I3CA 1T43A 2XHEA 4WX2B 5L3QA 4PYOA 1SBQA 4WZ6A 2Y99A 1CRPA 5C9ZA 4J7CA 4F50A 3AU6A 1J23A 2HJGA 1FFCA 1W4LA 2WK1A 2NTNA 2Z9DA 3BF8A 3PHIA 2GFIA 4KPUB 4MAAA 1NN1A 3W7AA 5BSHA 1O0BA 4OIMA 3JQAB 2J8ZA 5B58C 1ADJA 4UEQA 1ZISA 3D81A 4XX0A 1MQAA 4P2HA 5D3MA 2H9YA 2C57A 2ZRFA 4PANA 4I9GA 4WLEA 3AEUB 4I8DA 5FIUA 4C78A 3G6WA 3NDJA 2XZDA 4C6HA 4J9NA 3ILYA 1QG2A 3R5SA 1IEWA 1M1UA 3EJ6A 4D0GA 5L3QB 1O54A 5LXTA 4XJTA 1GXSA 1BVYF 1K2WA 4QZGA 1K7SN 1OTYA 2RDMA 3PKZA 4LHEA 4B2LA 2BDPA 2BRUA 3W5DA 3NRZA 2BKUA 2P11A 4G25A 1TPYA 4EB3A 3GYBA 2OB2A 1R0RE 1ZU4A 1GSAA 3IHQB 4BASA 1XEWX 1FQJA 3T1HB 3LBHA 3FLEA 5J2DA 4L5BA 4TZ6A 2I8AA 3GFRA 3BFJA 4KK4A 4F4XA 1I0IA 5IJAA 4MR7A 3RSSA 1KAQA 1ZU5A 2GCGA 3L04A 1VCMA 3MYYA 1CZLA 1KNQA 4RZ3A 3SJCA 3PNVA 4HGYA 4BMZA 1RQ7A 4LXIA 4NCXA 3UAWA 3BSSA 1I6LA 2J31A 4KR9A 3PWTA 3IUNA 5ERYA 1AF7A 1A9QA 3CH5A 4Z2YA 4F3TA 2O3UA 5E4YA 3EZ2A 4FS3A 4DZZA 4G0VA 3ND7A 3I37X 1ABEA 1PTKA 4FSDA 3GIKA 2ISPA 2C5EA 2QQFA 2IYAA 4XQEA 1YF3A 2V55B 2GZ2A 3EA0A 4O08A 5HZGA 1NVVQ 1X9SA 2OFFA 1RRMA 1RWBA 4MEJA 2Y9UA 4YK7A 3RJ9A 5YASA 3WNDA 3LT0A 2GJ9A 1ZO8A 3DUFB 2GMWA 3KB1A 4TTIA 3T3NA 3K0AB 5AKIA 2Q27A 4RD2A 3UHJA 4KWIA 2AFIE 1PK3A 4F4ZA 2FR0A 2RJOA 2QTRA 1PEAA 5C34B 1VCOA 5HK9A 5ERXA 2XRMA 4KLMA 2JVIA 2VDOB 2VYVA 2X8AA 1EESA 4E03A 2F9LA 4MMYB 5FXMA 3K9FC 2UUCB 4KSCA 1M83A 1L7BA 4RLHA 4C4RA 1Z7YA 4BPRA 1Y9EA 3JYNA 4IX9A 4Q3OA 2NO4A 2YWRA 3OLWA 5FULA 1RM6C 5KCZA 3JAKA 1COWD 4XQ9A 3K9QO 1WW8A 1YR7A 4JV1A 1CLUA 2NU9A 3U1BA 1YFLA 2GXUA 2XY6A 2ONKA 4Q4JA 1KOLA 1U90A 1JVBA 1TTPB 3I72A 1ZQCA 1DO2A 1W34A 2AQHA 2C2WA 2EAPA 3L5KA 1G5TA 1LNSA 2JEZA 1VE7A 2R8ZA 4ED7A 2W6MA 1A1SA 3EWSA 3NHZA 5J2BA 3OZGA 3QYAA 3AEKA 3R6TA 4N6GA 4QDTA 3SYLA 4A3SA 3QFHA 4LHZA 3I09A 3H1BA 3BD8A 2A9VA 5HILA 4FHGA 5LVAA 3PHGA 4RS4A 2Y1CA 1R9GA 4NBWA 3WLEA 5KYKA 2NUPA 2O3SA 3X1MA 2BEWA 2YY6A 2HSGA 4I4LA 3V9AA 4BQRA 4YHHB 1X7YB 2QIPA 4P4LA 4KFTA 1GRVA 2HSZA 1OXUA 1TGYA 2OPHA 1Z26A 1WP4A 2JGFA 3LW7A 4NFSA 4M9HA 5AK0A 5L1MA 5KT4A 4BLTA 4OBWA 3H87A 1ZQQA 3INYA 3TAPA 5L4LA 2FPXA 5F23A 1IXRC 3DFUA 3EEQA 4FW9A 1CY4A 4QPJC 1FP4A 1Y37A 5HBGA 3T1OA 3MFQA 1PKXA 5CA0A 3IHTA 1FX0A 4XQGA 2CFCA 2UYOA 3KZCA 5JJKA 1BXZA 4MDEA 3T7IA 2H2FA 3TQTA 1AU9A 1R0WA 3L0CA 4CFYA 3IEMA 5KVCA 3I1IA 1YCFA 5F33A 3PR2B 4BMOB 2DPHA 3QPAA 1JSCA 3Q8LA 1V8DA 3D3JA 3RC2A 4ARZA 3TF5A 1WCWA 2R44A 3EXHA 5T4HA 3KJQA 2FSSA 5K3FB 2ZYHA 1HLFA 1GAEO 3LUPA 3OE4A 3ZWXA 2ENWA 4GVLA 2E4VA 2YOFA 4CFZA 2BMVA 2Q5EA 2VXCA 1T29A 1NZJA 2PEZA 2F2AB 2PRSA 3GFQA 4AIIA 3DMHA 5ELXA 2OZLB 1N5IA 2WIFA 1BA2A 4IF6A 5KG4A 2I3AA 2QUIA 1IONA 2FSGA 3CIOA 4L57A 2ASEA 1T0UA 2CJFA 3JQGA 4M1EA 3OA0A 3AR6A 4OQQA 2H52A 4AS2A 4NL9A 3EFHA 2CJWB 1U4OA 2RI1A 3LLSA 2B0JA 1TMGE 3I9OA 3RNOA 1GEGA 2OFOA 4HEHA 3GEMA 3DAYA 3ER9A 5CB4F 4P58A 1SG0A 2VZ8A 2ODPA 3WTBA 2NXCA 3SKVA 2PI5A 1VKNA 3PFIA 2B1QA 2X41A 1GUZA 3L1UA 2QB0A 3FCAA 3RI3A 1E6MA 1BXGA 1CVLA 3GEEA 5EXXA 1CVRA 1EE1A 2JGNA 2PX4A 3KXKA 3F5SA 2GM5A 2IUTA 2EJWA 2ZVDA 1JQEA 3L82B 3A4MA 4Y2VA 3AY7A 2O20A 3EG9B 4GT1A 1B76A 2MMCA 5KYUA 2O8EB 1Y42X 2JKYA 4YJGB 1X6JA 1QUEA 4OHKA 4F84A 4P4SA 2HHUA 3OCWA 3AFMA 2QS9A 1UK6A 4RU9A 3RS5A 3Q7EA 3FKSD 4FJ2A 2QB0B 1B6GA 1YXMA 3H3JA 4C43A 4XB6B 1A0OA 2BGNA 1VMAA 2I2AA 2VYNA 2WD9A 4RE5A 2UXBB 4BDPA 3PPIA 1FL9A 1C1DA 4E46A 1MBZA 1QHIA 3EBOA 5ABPA 3Q3IA 1V7ZA 4LK3A 3D4LA 4P82A 4M21A 2HB6A 4CMHA 4MARA 2OK7A 2CFIA 4MVJP 1DADA 3N59A 1NNLA 4EDFA 1XTIA 3PPYA 4N9QA 1W4BA 1AC5A 2REOA 2WW8A 1L9KA 5KFBA 1PG0A 2PWYA 3PG5A 4HVTA 2A88A 1Y5NA 4YJ3A 1OX4B 4IY1A 4CODB 3BDAA 4YMTA 3AQIA 4BRWA 4JSRA 3F6SA 4A0FA 3ZV7A 2JLBA 3AQEA 2V6IA 3CPJB 1U8CB 3MT7A 5DZSA 3SYRA 5CBPA 3GP3A 4MV5A 4DBLE 1YBMA 3BWBA 3CLRC 3MTQA 4AY6A 2BE7A 2EP8A 3LP6A 4NEGA 1WHSA 3E2EA 1PG2A 2QY9A 3FF1A 5CPFA 2X4DA 3UKOA 3WRYA 2P0YA 2YCBA 3A9TA 4ESOA 3KKAA 1M1NA 1GA1A 1T1GA 4R16A 3AY0A 2REQB 2ZQYA 2WP8J 5E79U 1FFAA 4FVTA 3C98A 4PLHA 1J8QA 2FP4B 2JCBA 3CVYA 2FDCA 5T14A 4KN9S 1CDDA 5EIHA 1OXVA 5AVWA 3BXOA 1NLZA 4F3OA 2FMTA 3G9XA 3OKCA 1CX9B 4WLFA 3SU8A 1ZXIA 3A0UA 5HZMA 3QEOA 4ZQBA 4Z1MA 3N1UA 2XGGA 4JDUA 2WUFA 1CR2A 4OJOA 1NE2A 3SYNA 4ZICA 3RK1A 3AQ4A 3HL0A 4H6XA 1A8PA 3V4VB 2R2GA 3A58B 1XA0A 3AUTA 4XOUA 5KTSA 3Q3CA 1XMSA 2EG9A 3BEOA 3HFRA 1A5TA 4YMNA 1NAIA 3MAGA 3HZRA 4M60A 2B21A 2VNKA 4X24A 3NT4A 4B73A 2V3VA 3DYBA 4YRFA 1FSPA 1TFRA 3O8BA 3S2ZA 3QKRA 4CU2A 4BFVA 3FVTA 1RHQA 4DS4A 2ARKA 3TQIA 3UAGA 1WWKA 5BUSA 4UVHA 5G0WA 3N05A 3DEKA 1M2OA 4YMHA 4MIOA 4REOA 3ZKWA 4YDQA 4L4XA 1F17A 3AM3A 5KPJA 2HW3A 1W52X 2YASA 5JIBA 3RB8A 1KQGA 1FDVA 4MS4A 5ALOA 2C2OA 3D2BA 1XLTA 1BEZA 1SH7A 4IO1A 5REQB 4PAMA 3IAHA 3IB3A 1Z2DA 1PS0A 3A9VA 3UCXA 2QN1A 3RAXA 3ABIA 3THXB 4K5QA 2ISSD 5CT9A 1FU7A 4HNRA 3EGDB 2D0IA 3IP9A 2QX4A 3T4EA 1A7UA 4MQEA 4YROA 4DOBA 4ED3A 2FN7A 3LC2O 3GCDA 3CSUA 5E4JA 1XJ5A 5TQJA 3W06A 2V7QD 3MBIA 4IVNA 4D57A 4GFJA 4E14A 3UH1A 1FYWA 1SKAA 5ARCA 1R1DA 4NMXB 3BHJA 4UATA 4HDSA 1F20A 3OJSA 4JP2A 4B17A 2HMWA 2H2HA 1VG1A 1P45A 2F3TA 3WDLA 3OHMA 4R40A 1WE2A 1YQUA 3CZ9A 3DEHA 4OSEA 4Z8XA 2CDAA 1PVPA 2BFCB 5J0WA 2KTQA 2PQ6A 2YWJA 4FMCF 4NZ9A 4MV0A 2C2RA 4U9UA 1N1EA 4K6CA 4YR9A 4RTNA 1HLGA 4RM2A 2CEAA 2X5JO 3L18A 3U4MA 3SCZA 2OBNA 1IATA 4GH5A 5BSFA 2DBYA 3E7WA 4QD3A 1NYTA 4MV7A 4AN0A 1DELA 3TQQA 1SXJE 1CK4A 1MB4A 3G2JA 2PXCA 4GKBA 4I50B 2O2XA 5AFSA 2R8KA 3QHAA 4QA9A 5LZ5A 5JPDA 4CMIB 1QP7A 2V7QA 1RPJA 4TKUA 1TIKA 5HE8A 5ICFA 2GHQA 3K6KA 1ZMRA 4IQFA 1TQDA 3HLKA 4LFAB 2WICA 2PFQA 2WWRA 3AIIA 3LOQA 4PC1A 4XCQA 2XLCA 7ICNA 1A9TA 5FTWA 2RK4A 1WXXA 5AKGA 4MUYA 1P1KA 4PGFA 3R20A 4K6FA 2HA7A 4IKPA 4LKRA 4RO0A 1ZN8A 4E31A 4FIDA 4IJUA 4WA8A 4ZO7A 4OD0A 3HVUA 3Q72A 4GSYA 4G2NA 1Q17A 3LVRE 2R66A 3PWKA 1TU0A 2ZTEA 3H2BA 3QJYA 4RVOA 5D5QA 2Q4OA 4P6VF 1EYZA 2XE6A 4D9KA 2A0FA 4FWTA 3QLVA 4E5YA 3RFTA 1O94C 2VHYA 1SHJA 4DEVA 3ORQA 3KUCA 4HKTA 3BDPA 3SR4A 4DBZA 2HQRA 3FPSA 5CVUA 1R8JA 3PD1A 2EZTA 5GGXA 3K94A 2AN9A 5I7AA 1U2ZA 4ZFNA 2SKCA 2I6FA 3CZRA 2ZRPA 2Y1OA 5C8VA 3K6RA 1KVQA 4DFPA 2P9CA 4V0MA 4KWEA 3WISA 2C2YA 3PDWA 1NQVA 1V85A 3B3FA 1DIRA 3BBLA 1MA7A 4TTJA 5F21A 4FYMA 1A9ZA 2BGWA 3IUJA 4X71A 1LPBB 3BD9A 2Z56A 3KQMA 4TQAA 1L5HA 2F2TA 1OGIA 3SZRA 3KPVA 3WXBA 3ZDQA 1WF6A 2CNLA 1XYGA 2P2LA 5F2EA 1UKCA 1E6EA 3FOBA 4B0PA 1LGYA 3RAFC 4KR3A 4UJ5A 4GOMD 5JRDS 4BO7A 2P6PA 1XZ8A 4AP5A 4JODA 1R7RA 3AW8A 4CN9A 3CJTA 2OVFA 4K1LA 3D8TA 1RKQA 5AJVB 5P21A 4YUAA 1WPRA 3RBAA 3WGTA 3DOEA 3R5JA 4MHOA 3MWLA 3A1VA 3PK0A 4GR9A 4L0QA 4PHFA 4Q9NA 1JUDA 4N18A 4PICA 2CW5A 4MGKR 3S99A 1U2RA 4AYXA 3TW0A 3IDQA 1RNLA 1VRWA 3THYA 1BNPA 1E1CA 3LWLA 1K75A 4Q47A 4I5FA 1QSLA 1T8WA 3B60A 2H4XA 3ESBA 3O2JA 4XLLA 2JFPA 3G7SA 3MZ0A 1AHHA 3N7PD 1Z35A 3MWFA 2RHHA 5A05A 3W9YA 1QZTA 2QLBA 1C9DB 3L7KA 3JWGA 4UHFA 3PXCX 3WL5A 3WGIA 5BN3B 3AI2A 2AUTA 4PS1A 1H3FA 4TQ9A 1DWUA 3OQ1A 4QECA 1TDJA 5DWVA 4ZYYA 3LBYA 1ZQAA 4J3FA 4TOIA 1YOBA 4L72A 1RWNA 3RUHA 4BQSA 5KQSA 1NA5A 1Z56C 1SL1A 2KHZA 3EXEB 1ISMA 5K8JB 1BPYA 2OD7A 4W5OA 1NKCA 1IM5A 2UVRA 1F8YA 1HQKA 2DPMA 3HL4A 4I4TF 1JG4A 3QOYA 4EPRA 2N46A 4AU1A 4DLXA 4MCIA 4G26A 2FGKA 4R0NA 4O2AB 3A32A 1EEHA 4OLBA 1U9IC 1ZD1A 2C82A 3F8TA 2WUDA 4DPLA 4NCAA 4MVJD 1W5SA 2AMFA 4GS5A 1FRQA 4I1IA 5TZVA 2HMXA 1SOMA 4LJRA 1Z5WA 3FKQA 4L6IA 3PA8A 1UBNA 1UJMA 2FMXA 3N2LA 4DQSA 2K2WA 4JJGA 1C9MA 1I2AA 1UBSB 1N9GA 4RZRA 4I2FA 4P7FA 4JB3A 2FZCA 4Y7DA 5F51A 5WRFA 1JYSA 3ZU3A 4A8JA 1Y98A 4EY6A 1N2CE 1QHHA 2A9JA 2VANA 1P29A 2G9VA 1E92A 1JN0A 2HV9A 3D6TB 3IERA 4AJIA 2QP9X 3LFUA 5FTLA 1YL6A 2W37A 2D8MA 5IINA 2KP7A 1OLSB 1QDUA 1YBFA 2FW7A 2FZWA 4CCHA 1XMVA 4MWSA 4QULA 5C18A 1EVIA 1X9XA 4GI3A 4J16A 1QFYA 4QJFB 2QJTA 4XX1A 4TTTS 1SB3C 1MENA 1QP0A 3HJRA 3MGGA 5HX7A 1RQGA 3I1JA 3R76A 3C3PA 1BCSB 2RGGA 4ZI7F 2Q3CA 1B14A 5ALRA 4GYKA 1QE0A 3RUFA 3DDNA 2A14A 5HKAA 4TKMA 5ALXA 1WULS 3FDSA 3EYAA 4Z7OB 3T5LA 2WPNA 5J5VA 4LNUA 2QRNA 3LJKA 4EDHA 2VSOA 2W2NA 3FMGA 4WBNF 3OFVA 3BWDD 1NJ8A 3LQYA 4OKNA 2PWZA 3TE7A 4D99A 4MVCA 3KEMA 4MMXB 4PQFA 2W6ID 3WHPA 4QASA 4XI9A 3COSA 2Q21A 5MDHA 3ZS8A 2EAOA 2P9EA 3MELA 1WJGA 4YAKA 2BCRA 3W8NA 1PVVA 1WBJB 3F2VA 5A9TA 2J0VA 3F7TA 3GXOA 4RKRA 3CNQS 5DTIA 2XUHA 5B7QA 1NBOA 5LZ7A 5CA0F 1NVTA 2I03A 1CRZA 1P1HA 2FRVA 3EVZA 5C32A 1P17A 1DCTA 1YQ9A 4QZ8A 4OHFA 4OKSA 2I1QA 2IKQA 2XYQA 3HKCB 3U62A 5IJ9B 1C3EA 1N2CB 4DT1B 3IT1A 3CO0S 1KYWA 1USWA 3ETHA 1ZQWA 4RZUA 4CHTA 3DDHA 4BY9E 1S76D 4L0DA 1FSSA 3AR5A 3F0TA 4HRAA 4IR9A 2HC9A 3ESZA 4YBRA 5B3AA 3R7NA 5IAAA 1H3EA 4BXOB 3KKPA 5ED0A 3T15A 1PD1A 4DRZA 2QAIA 2AD5A 2Y1GA 2Y1KA 2C58A 3EIHA 5LYYA 4ZZ0A 4YRKA 1TOAA 1WCLA 1E3IA 4ZD6A 3TLGA 5C1BA 2W42A 2VDJA 1OLUA 1FDOA 4GSKA 1FDSA 4UHHA 1AV7A 2HZBA 2VWQA 4JMLA 3F1KA 4EYHB 1RC0A 3ETJA 5JS2A 4CM1A 5EUQB 3AT1A 4M1YA 3HCDA 1UFRA 2IEIA 3PRHA 4MV1A 3MVEA 5J63A 3T61A 3V1MA 1IEVA 5ALQA 1O8BA 1U0SY 1ACLA 2FV8A 3MR3A 4QEZA 1Y6QA 3SHVA 2GEKA 3VUFA 1T9CA 2ZCVA 1QRRA 2PLFA 3ADPA 4CTJA 2Y8EA 1SG6A 4B3CA 1XTKA 3KHUA 4H08A 2HEGA 5GM1A 2P8JA 3SSMA 3R5XA 1UQUA 2BGTA 1Z25A 5C5JA 1IY2A 4IICA 1AHNA 1T9BA 2FZVA 2QZZA 2YR0A 3H5TA 3PFKA 4GMKA 4F97A 3DM5A 4O59O 4O0MA 4RQAA 4II3A 2QSJA 2W48A 1USKA 3MABA 1XZCA 3AYZB 4IR1A 3BGSA 3DV9A 3NBFA 3CA8A 3S2UA 1JEYB 1USUA 4HNGA 3D2CA 1GGHA 3RYIB 4AMVA 1SXDA 3A9SA 4O3FA 1QDEA 2JGKA 1C20A 4PC6A 5LMZA 3HZOA 4FBGA 5EKSA 3U2QA 1BPBA 3WA7A 4NEQA 1BRTA 6ABPA 4NCKA 5GVSA 2JJ8A 1JN3A 1XTBA 2VVTA 1JQ3A 1NR7A 2ANCA 1ZHOA 2DPLA 4GYJA 4YT4A 2IH4A 2YZ7A 4UNQA 1EWRA 3G2HA 2QJWA 1PNTA 1ZIYA 1U9IA 4XJSA 3TEMA 4XWOA 5DGIA 4CM9A 2NRTA 1CEZA 2XUQA 4LRYA 4JLDA 4U2BA 5J2JA 4HB0A 4MI9A 1NMXA 1FK8A 1JNYA 1NF9A 2V1UA 1JWAB 5CR0A 3HWRA 3RH5A 1W5EA 1Q1EA 1VHTA 4RK0A 3MGVA 4L4RA 2O3JA 3M0EA 4U7WA 1V8FA 1CDOA 1R50A 3UAVA 3BZBA 1Y80A 2GJ8A 4UB1A 3IO5A 1V1MB 5LXTF 4J0QA 1J21A 3SVZA 4CMKA 1GRCA 1NY5A 1U04A 3BQ9A 1ZGCA 3DLCA 1N2HA 3I6BA 3L7CA 1ZA1A 3NVDA 5EY5B 3TCNA 1ZHFA 3QEJA 1EZZA 1T5OA 4UBJA 5DHTA 2AG1A 2A3RA 5HMLA 1UXHA 3N8NA 4MMZB 1W85B 4GBMA 4OYRA 2VRBA 1NTRA 2OZEA 2ZUSA 2AB0A 2H5JA 2IQ5A 2ZJ4A 3TLCA 1N8TA 2IZ6A 3CLVA 3OPMA 3Q7IA 1S7GA 4PC7A 3MMSA 1P2TA 2VZ0A 2D2EA 5E8RA 3S5UA 4JGBA 1SCIA 4CM4A 1B8NA 2QLFA 4WJLA 5BV1A 3ACBA 5CCXA 3R8FA 2WZQA 1XD2B 2CXUA 3DQZA 2C00A 4CUJA 2XB2A 3KOXA 1U4BA 1PZMA 3TM4A 5CDGA 3SX0A 2ATVA 3DLPX 3UPTA 1BFUA 1SVSA 1CY6A 2A1TS 2R1TB 3TRDA 1QAMA 4PO3X 3MS7A 3GLHB 1NU6A 4JUZA 3K1TA 3NETA 1L4BA 1JJIA 1FQKA 4KVGA 2WFLB 5KSPA 2QUHA 1JHOA 2GHTA 3U4IA 1X19A 1CZNA 3Q8KA 2DQZA 2FUCA 2KB0A 8ICVA 4Y1FA 2XX3A 2JBAA 5MFZA 1JTVA 1E3TA 2Q5QA 2VHWA 4COOA 3C7KA 1T8PA 1C7EA 1K4YA 3U19A 4XGRA 4XIJA 1KE2A 4ZK6A 2NTYC 1FMJA 1SBTA 2ATIA 1XELA 1N48A 1L4KA 4B3RB 1M2JA 3GJ0A 1Y9ZA 4LF9B 3NVVA 1MZPA 2PFGA 3G8AA 3ZXXA 1GZ4A 2RJ3A 4GI5A 5DGXA 4NDZA 4RYDA 1ZGZA 2PGLA 3Q41A 3FI9A 2UDPA 1YL5A 3LLMA 4FR5A 4KDEA 5FKJA 4CIXA 4GGOA 3KKEA 1NQAO 1SCJA 1C7IA 2VJAA 3DGFC 2PT6A 3Q3EA 3QVKA 4MW5A 2WWVD 5KG1A 1DPGA 5DG8A 1OBCA 2YB4A 2ID4A 3K4QA 3ZXUB 1DC4A 4AZTA 4PNEA 3MCUA 2VIXA 3IE1A 2QLLA 1C0LA 1R00A 1UC4B 1U8EA 1YC2A 3GVIA 3DE6X 3E6AA 3EGXB 4MPPA 2GEBA 4US1R 4DN6A 2ODBA 3R9XB 2YJGA 3WNQA 1Z68A 4PR3A 2P9ZA 3M3HA 4F4UA 5K9ZA 2P6NA 3CVJA 1M2FA 5JCZA 5GOTA 8ICYA 1XEWY 3DE7X 4JK3A 5EXEA 3SHTA 5F2NA 1X1AA 2YIMA 5HTOA 1DXYA 2IXDA 4JJFA 1CUSA 1NTOA 2WD7A 3OFJA 2D1YA 3V4ZA 3KOMA 4ZC1A 1NKEA 2R1VA 2C92A 2GRJA 3CB4A 3MWJA 3SC2A 5LZ2A 1AMOA 1GQ2A 2XUGA 3WSTA 2ZE7A 1DIBA 1WUYA 2R86A 1M34A 2ECKA 1VMIA 3FMVA 2UYHA 5JS6A 2CLDX 3D0OA 5L40A 1BXKA 5TRTA 5A02A 1WDLA 3AVQA 5D87A 2NVOA 1ZK1A 2K6GA 1HTTA 4ZYLA 1CQIB 2HHAA 1LDYA 2YICA 2LPEA 2ZPUA 3D6HA 4JFAA 3TOVA 5KX5A 2G88A 3QLUC 4MRMB 1BHQ1 3E5MA 3KEFA 3QE0A 3I76A 4HNQA 4HVLA 1TQ4A 1P31A 2HHHB 1KJNA 3H7AA 1U3DA 2WR8A 2XEDA 1ZQIA 4DS5A 2CDBA 3GIDA 2OV2A 3PI7A 3QVGB 4GPBA 3I6YA 1T26A 4KDFA 4Q7MB 2W2QA 4RD1A 1B4DA 4YP6A 4B34A 1L7NA 3UAOA 2YRFA 1D9XA 1XQ9A 3IAFA 3HJHA 5DI9A 2RBGA 4MVJH 4G3XA 4UDXX 1OROA 4X1YA 4OHZA 4AJLA 2KI5A 1Y7LA 1PEYA 2I2BA 4NJMB 3A4VA 3RTDA 3W8EA 4H77A 1VGQA 5K3OA 5K01A 1AQJA 1G9XA 4K46A 1J70A 3GLUA 1WQ3A 1W94A 3HJTA 5U4XA 3WLFA 3VNVA 5CDYA 1EWVA 3QE9Y 3TOSA 3FVRA 1XTRA 2WTEA 1VPLA 2BCSA 4WNAB 2C07A 3GIWA 5AHOA 1RJEA 4KLNA 4OGLA 4AX4A 1LI7A 1ZQ1C 2QQ5A 1XQWA 4Y1RB 1G4HA 2WT4A 3CW2C 2RI6A 3CXUA 4KPUA 2C5AA 4X7RA 4A1OA 5KJCA 2BR5A 7ICIA 4WK2B 1FP7A 2KJ8A 2Y93A 2ZCUA 3BPSA 3H8VA 1MF7A 1XPJA 2NQ8A 5SV2A 3UMFA 5IZ4A 5JNLA 9ICIA 2WC1A 3S3TA 1I7QB 1PVOA 2D3TA 4YI5A 2EL7A 3UJ6A 3RAEC 3GNLA 3CF0A 4PYNA 1MVLA 1Z4LA 1Q44A 4DA6A 4ETNA 4ENSA 5LJLA 1PE0A 4TUYA 2SCUB 5H82A 4Z5XA 2O59A 4KYTA 4YJFB 3FPJA 5BQ5A 3ZZ1A 4QOGA 4ZQGA 3CWCA 2C8VA 3AL2A 3H9GA 5DHFA 2NVUB 2EATA 1BMTA 3B6JA 2IEGA 3HVHA 3DSRA 5IKOA 3WSVA 2E8OA 1VXOA 1XNJA 2P4QA 5ICEA 1RBYA 3DAFA 2P66A 4A8TA 3H40A 2XGPA 3NIWA 1Z0SA 2BR0A 2YWBA 2NZJA 2YVAA 2VI5A 2XQVA 2V0GA 4BVGA 5D4BA 3LBNA 3L1VA 2G82A 1AS0A 4NCJA 3QPDA 2I3ZA 4B09A 3M70A 3EXFA 2GNPA 4JEMA 4IRCA 5AVQA 1Z4MA 121PA 1RQ2A 2QN6A 5ADVA 2IHZA 3OY7A 1E5QA 1Z6YA 4Z4QA 3I1FA 1NFFA 1OFVA 2WU4A 1V11A 3LRPA 4GOJA 4AO8A 4RQ8A 3ISCA 3BQ2A 1IZYA 4KODA 4QQKA 4XDGA 1JT9A 1WPQA 4IQ0A 3B89A 2ZIVB 4TL9A 3JAWA 4R2IA 3L8EA 1JZTA 1P7ZA 3CT4A 3FVVA 3KYCA 4H1HA 4KSYA 4OMCA 3VJMA 1GTL1 4BNUA 1FTSA 1B8OA 4KGVA 4FHCA 2XZTA 2PH3A 1KAGA 2CF6A 2Q1YA 3COWA 5ITZB 4RNDB 1Z12A 4RULA 4NFYA 1YFJA 5IKPA 1NSTA 2NZVG 1GRNA 1QUFA 1A97A 2WAMA 3BL6A 2CZGA 1RADA 3KZ1E 3L41A 3H6GA 1L6NA 3IMKA 3HWTA 1GPUA 4EG1A 1WZIA 5K03A 3L4KA 4RQNA 3SIPA 2DBRA 4DRYA 4YUXA 2YS7A 2XD9A 7MHTA 3AR7A 1CZUA 2PKRA 3CE6A 3ANSA 4KO1S 2F1IA 3K5IA 3GRZA 4LF4B 2DWUA 4OH1A 3MXTA 5HIAA 3M8RA 5A62A 2HNKA 4Y7CA 3CLTD 1GL7A 3NVWA 1JPUA 3L1JA 3X1WA 1J00A 3ICQB 2AQKA 1DLIA 2PS9A 4DMMA 2DLNA 2HEIA 2DQKA 4JJEA 5ECDA 4AT1A 4NYIR 5ECWA 4URXR 3OJCA 5L6MB 4BU1A 2XOKA 3SSAA 2NV0A 4KLRA 1JLLB 1D6SA 3H4VA 2LKYA 1GQOA 3QEMB 3QVJA 3W34A 3C6ZA 1BO6A 5CVJA 5CB6A 2F4NA 1NW8A 1JG3A 2ANBA 1HQCA 1ZCFA 2ERXA 4TLDA 3T12A 3VKUA 4RPCA 1KQNA 4MA4A 3MMPA 4BNWA 1GUYA 2CGEA 3ANMA 1V71A 3IP5A 5JS1A 4RK7A 3ADCA 1AUPA 2AHOB 4HFMA 2IHNA 3K1YA 3CKLA 3GNSA 3U09A 1JT2A 2YHIB 4X20B 1E63A 4BMDA 3W1WA 5JVDA 2EC5A 3EZ7A 4GC6A 3ED5A 1Z63A 2YXDA 3LUJA 4FHEA 4FILA 3EVEA 3FSJX 4U7JA 1Z37A 3AERA 4NP6A 1K27A 1P61B 4H60A 5EWMA 2X5NA 4H0FA 1FXSA 2NU8A 3DDSA 1TT7A 3EY9A 3HKBB 2BCUA 3L0YA 5I4IA 3SC3A 5M3BA 1IZ7A 2GF9A 2ZS8A 1B0PA 1JEQB 1NZDA 1SKYE 5AI8A 1Q91A 2I99A 3DW3X 4FX5A 1RYSA 2CHVA 3NNSA 1Y6JA 4MKIA 4O9MA 4XW2A 3BRSA 1Z5GA 2QJFA 1T9GS 3FTQA 1PAUA 4FCWA 3RQSA 2JG3A 5INTA 2JI9A 2H1WA 1A8IA 1LK0A 1HY3A 4A6XA 4TYPA 4ASUA 4U2KA 2AC2A 1B6TA 2CHQA 2FWRA 1L7VC 2G70A 2CLHB 2W90A 3ACDA 1Z4OA 1MJGA 1QVVA 2X4LA 3AHFA 3H9JA 3NGLA 4IUBS 4BP1A 5KVSA 5J2TB 4EBDA 4Q3EA 5JY1A 4LTNA 3BTSA 1YHZA 3ENQA 2QAGB 4O4HA 2C3OA 5LOVA 4QGSA 4DE5A 2ZITA 4V0SA 3IUMA 4XWYA 1F0PA 3PI6A 2R6JA 1Z47A 5CTAA 3BUSA 5B1EA 1VJ0A 3VU1A 4PN3A 1T5BA 1ZQZA 4BUZA 3LY8A 1XT6A 4P08A 3GMIA 3RG8A 4PIVA 1MN8A 4CKCB 4YJ2A 2FZ4A 3SK0A 1QPZA 1U3FA 3OM8A 1CUIA 4YQWA 4OJKA 5F7JA 1RT9A 2UYQA 2OSVA 3NHJA 3IE0A 3PKJA 4MHSA 4PIMA 5CIQA 3JWHA 4YJGA 3ZV3A 4DTCA 4ZIRB 4G67A 4OAOA 3W1EA 2SHKA 4JJAA 5E2IA 3X3HA 4EY3A 2QV0A 5BO5A 3SC4A 1SPXA 4ZVTA 3QI2A 1RXUA 2DCUA 2KJQA 3IDWA 3DW1X 3DZJA 2WAOA 3PX3A 1HUZA 1UBUS 4GSLA 4O4JF 5EC8A 4PC3A 4ESHA 3K4GA 5KYYA 3MC1A 3NATA 1NK4A 4LUCA 3J81j 5HRUA 3IXMA 1CUGA 1JDPA 5JO9A 2AZXA 2JZBA 1U8YA 2VTVA 4BUCA 2DR0A 4YAGA 3TRKA 2CNWA 1LXCA 2BVNA 3PA6A 1ILEA 4EGCB 2DJ5A 1V1RA 2WD8A 4DLYA 3KHHA 4TUSA 8ICPA 3E03A 4UDYX 4C5AA 5F3RA 4AG5A 2BBOA 2OCKA 1SIUA 1F2DA 1T8EA 3AJ8A 1RXSA 1QSGA 1YR2A 3AI1A 4G4SO 2Z8XA 5FOXA 3R8CA 3V80A 3HK2A 4A9AA 4HH4A 5H8WA 3HV0A 3DEEA 2IA6A 2W2XA 4HEA1 1ZMTA 3KHSA 2WG1A 4M3NA 3RUAA 4ZA2A 4I2DA 3SYTA 4GXNA 4BECA 1J49A 3BOSA 4HFRA 2PCLA 4XQ8A 4X66B 4AKSA 4GVPA 5DIFA 3UC9A 2YWGA 3MYRA 2YIVX 1NFRA 4Z6EA 4EPWA 2PSFA 2PX3A 3N87A 1A7KA 3OUUA 3NCHA 2VBGA 5TEWA 5JI2E 4ND8B 5CDTA 3B5IA 3CZMA 1JXLA 2CHFA 2OGWA 1UAYA 3CO5A 3Q7QA 3H5WA 3P9SA 5FPSA 2W6OA 3E7XA 2O0KA 2JEFA 3O73A 2Y1JA 3L0IB 3PV0A 3HXMA 3NX4A 1Z5NA 1B2RA 3V72A 2Y1EA 3Q1KA 4OGGA 3QIAA 2E89A 3RVPA 4DYVA 1V96A 3LRXA 3LUDA 1IMJA 2PR7A 3T5AA 3SQOA 2BJHA 3UMMA 4KW7A 1XNQB 3IBGA 3TIIA 3RVLA 4DR5B 1F3LA 1DS6A 2EJVA 4OU4A 2J9FB 2WVHA 3GEBA 1VMKA 2I34A 4Q05A 4YAUA 5L1JA 5CGZA 5AUOB 3BXHA 4UQGA 2KSOB 1YS9A 1H8HA 2RJNA 3HABA 4GMGA 3SAHA 4NONA 3CX6A 1GR0A 1MAUA 2LXNA 4EUHA 1HEYA 4W9NC 1ZH4A 3ML1A 1XLVA 4DXAA 2B4AA 2X1HA 2EARA 3I2GA 2JLCA 2DVMA 4XFDA 3ZWMA 1C3VA 3NI2A 2ICAA 1H6AA 3G49A 2PSEA 4EY7A 3OZTA 5BN1A 1SUBA 1YZNA 3L49A 5DHAA 4JYAB 3P9PA 2BCQA 1LDBA 4B2PA 5EZSA 2QROA 2ZYWX 4DA7A 2P9YA 4EY5A 3K6SB 3RARA 2XNJA 3BRWD 5IF3A 3PFCA 1D1TA 2CV2A 1WBDA 3ADOA 1CR0A 1UM9A 5JCOC 5I01A 4NIMA 4W1PA 3IDZA 1XD8A 3G0OA 3TVDA 1NQOA 2IK8A 2AGVA 4I27A 2ZTMA 3CJRA 4IHJA 5IAGA 1Z4QA 3TZCA 2TMYA 1NVBA 2UVPA 4R8MA 1T9AA 2XB8A 3SJ7A 3M7DA 3TPFA 3NKFA 5HQ3A 1G8HA 3G5LA 5CA7A 5IHXA 4PW0A 2QJOA 4K9MA 2W54A 2BEVA 3TYXA 2EF1A 2DHDA 4PHEA 4R1TA 4KHZA 4WXMA 1HLPA 1P5RA 1UDAA 3GD5A 3KYIB 2BUBA 4NS1A 4DDHA 4NTZA 3MAJA 3QP9A 3FJOA 4W9RA 5A3RA 4HS4A 5LA6A 1CE8A 4AROA 4X65B 1OHHA 5LU8A 2QMQA 4N5MA 1T0JB 3IUEA 4RGYA 1TIBA 4BGEA 4UB5A 5EWLB 2HCFA 4EPTA 1KEEB 3PO4A 3PPXA 2QZJA 2Z3WA 3VYVA 1YZGA 3EVDA 1XDSA 1FFGA 4DZRA 5TMPA 3I9NA 4TM7A 1N2SA 1IUNA 1QTIA 1LKYB 1UL1X 2FG5A 3CPHA 2BZFA 1RWQA 2EU8A 3DQQA 3PYLA 2Z3VA 1G9TA 5T5QA 2Q29A 5E7MA 3LZ6A 4UDOA 5CEHA 4IDDA 1HDRA 4IX1A 1FNNA 1LLUA 4KRFA 1KI6A 1P4JA 3W04A 1KSPA 3CGWA 1GARA 2ZWOA 4Q8EA 1MOPA 2ZIUB 3MIZA 4I28A 3HP6A 4ND6A 3ZU4A 2DE0X 4PO8A 1DAOA 4J76A 5DTRA 3W8FA 2JAPA 1A5SB 1EXMA 4BE7B 1RTTA 2PZEA 3KK0A 2DT5A 4GQAA 4WAUA 1W96A 4A2CA 4BVBA 3RJGA 4I2EA 1JZSA 1KU6A 1WZUA 3L06A 4ZO8A 2XE8A 3AMVA 1J0DA 3RU2A 1OHHD 3K9GA 3RSHA 3WGVA 4O4LA 1KJ8A 1MU0A 4RGQA 1G20E 2HRZA 2X2PA 3OBIA 4OXRA 3VR4D 4N7MA 2JHPA 9ICXA 1T8RA 3L4SO 4GP7A 4O4JB 4FYHA 5KTNA 2V4ZA 5ARDA 1OBOA 1XFAA 2HSEA 3HVRA 3HSSA 4Q4AB 1WBBA 5HPYB 3KVYA 3MNFA 2GK3A 1XZNA 5DNEA 3IP3A 2FOIA 3L02A 4QTUB 5KCMA 3TL6A 4DUPA 3DE1X 1JDUA 4F3KA 1TCBA 1QH0A 2GRUA 3GVHA 2BPGA 2G08A 1DC6A 1NXTA 1V37A 2D1SA 2JCYA 4TS1A 5FO0A 1JDVA 1NVMB 2NRWA 2UKDA 4GRIA 3Q2OA 1FS4A 3ZY4A 3G23A 4TWZA 1YJ8A 4J4TA 5ALYA 3PTAA 5K09A 1Y33E 3HT3A 1ZD5A 4PX9A 4P5PA 5FNZA 5TISU 5IJWA 1MX5A 2XF2A 3JQAD 3M9NB 1EDDA 3UT5B 4KP7A 1ZGAA 5K3SA 1GKKA 1NATA 3EMDA 3HHEA 2V7WA 1U7ZA 2X4IA 3HU1A 4PCLA 5KTTA 3FHJA 3AJEA 1K6XA 3SD7A 4OHBA 3CVWA 5EG5A 1XWWA 3CPSA 3THRA 1NHWA 1X2EA 2CD9A 2GFHA 4F4DA 2FXVA 3PGKA 3HBLA 3PQ2A 3ROGA 3ETRA 1ZJZA 2ZS7A 1K4MA 5SYMA 1AROP 5G1NA 1PUJA 2BUAA 4GRAA 3C3BA 5KFKA 5JUMA 3PUJA 1TI7A 2W9CA 1TEVA 1YVUA 3RROA 3JSXA 3GDXA 1F9EA 2H1FA 1K8YB 1LTKA 4BB5A 4ERNA 4J1TA 2WSLA 5HJ7A 4PVDA 4TLEA 1P0QA 1LRKA 5CK5A 4TZ0A 1K88A 4Y2HA 1C4WA 2XVYA 5IHPA 9ICPA 2V8BA 4JIGA 4M0AA 1VCNA 1GADO 4M9RA 1UPCA 1OVGA 1TT5B 3JQAA 4OQ4A 4Q00A 4BQOA 3E0XA 4ZVQA 4CQJA 1Z6GA 3NGMA 4IGEA 3ZQJA 1EE2A 1V5WA 4ZV9A 5CFRA 4QM7A 2GCNA 1M2GA 3DXYA 4R3UC 8ATCA 1NBAA 2OHOA 4MWOA 2W22A 4UC0A 2ZZNA 3MRSA 2V4UA 4L7QA 1EWQA 2J3DA 5TPWA 2F8TA 3N2IA 4NYMQ 2JGAA 3ALRA 3OZCA 5GV7A 2ZAIA 3PRJA 1CS4C 1MIOA 2Q3LA 2QT0A 3E3NA 4J6EA 3T7TA 2IHMA 1PZGA 3ST7A 3H1GA 3JPTA 4NXMB 1QLWA 2C5HA 4DY6A 2A78A 2PMKA 1ONBA 2B8WA 4MUEA 4QTYA 3MWEB 3OE5A 5JH7B 1DSSG 3M6LA 5ALSA 2BDUA 1QRAA 2O2EA 3AH8A 3UCFA 1N3LA 3P27A 4LBYA 4PZUA 4DABA 5L7WA 2IXFA 2KX7A 1WV0A 3CLKA 7ICQA 3D8SA 3PUWA 4IJ5A 1K2VN 5DKFA 1ZH8A 3NUGA 4JQCA 4CM9D 2QGFA 4OOFA 1DXOA 3JQQA 1RZRD 2RHCA 1E1RA 2X6RA 4RF4A 3R7DA 1NXVA 2OYYA 2ETVA 3Q2KA 4RUKA 1TF2A 1AXEA 3IMEA 2I8CA 1JI0A 1QZXA 3IP1A 4PONA 1ECFA 5F3WB 1WB5A 3A31A 1AGPA 5AVSA 5SZHB 2UVVA 2Z95A 4P3XA 2ZOSA 4RU1A 1CUWA 4KDRA 1FBTA 2BLNA 5AYVA 1ESEA 2OQIA 3H0EA 3LP8A 1BA3A 3M8SA 1W4ZA 1NW6A 1WHTA 2V4RA 2H1OA 4X85A 5DNUA 4H3KB 1TZKA 5HEKA 2G8NA 5EIFA 1MC5A 1KDVA 1TF5A 1B0UA 8ICCA 1IY8A 1GYPA 4K26A 4RDCA 1P8AA 1JL3A 2GN9A 2X9NA 3WLOA 5KNCA 5E95A 3ZWAA 4ICIA 1RZRA 3LZDA 3PQ7A 3LZCA 2ZVQX 4FCVA 1CV2A 4HZIA 4MQ6A 1GZHB 3N8GA 3A0BU 1TEXA 3ZWWA 4BLOA 4WCVA 4BLRA 5KPDA 2GD1O 1N1DA 2NYUA 3H5IA 3NIFB 3ENVA 3H17A 4M9UA 4XX0B 3V4PB 1UC9A 3VR4H 3TVTA 1JEOA 1UEJA 4KMMA 3ZZTA 5C5CA 1SQ0A 2VF8A 5BMVB 3QLEA 3I52A 2A5JA 2B6GA 3WG9A 4C7OB 5DX8A 3U7QA 3DP7A 4J0CA 2ZK7A 4JC4A 2JARA 4LOLA 3WC4A 1WEKA 5J1TB 2E1PA 4E5PA 3FZQA 1K5HA 5C1OA 2YVKA 3L6OO 3PYMA 3T3IA 5TQVA 3HVIA 1A2QA 5LQMA 1NIJA 3AB8A 1VYUA 3I6QA 4DMCA 2EKBA 4U2DA 3OC0A 3UMSA 1YOVB 1CUHA 3SS7X 3WFZA 1K66A 3KVRA 3I5UA 3TI9A 7ICJA 5BSRA 4AS1A 3B82A 5CCDA 3HXKA 4YXJA 1OWOA 4GPIB 1Y3CE 4KKVA 4B80A 5IUNC 1ZUIA 3KOOA 1XTPA 1I5EA 4JEUA 1JKFA 3HKEA 4X97A 4QYXA 4GWKA 4BRUA 1XAHA 1CF9A 1GZ6A 4HDQB 1ZEMA 4HZUA 2EFCB 3RF7A 3P9YA 2RDJA 3DVAA 3NBQA 1KDPA 3EXHB 4Q7LA 3UN1A 6AT1A 3U7JA 3AVYA 3O0FA 4IIVA 4XKJA 4B35A 1G2QA 3GRCA 2ZJ0A 2ZU0C 3E1KA 3GJ4A 4I2VA 4JGIA 3UBMA 1MOZA 1JHPA 2W2MA 3ELUA 1ENZA 4HMPA 3WI7A 5JW6A 4FLMA 1Q1BA 4DV3B 4UVDA 4EL0A 4AG3A 1VSVA 3WWDA 3EFEA 4ML3A 4IDGA 1JFRA 2H7XA 1SHUX 3DEZA 1L5NA 3WYNA 4S1PA 2IYWA 2RHTA 1KAHA 2XGMA 2YCLA 2ZYDA 4HZUB 3UTDA 3S8EA 1MRSA 3E61A 2GLTA 1K8RA 1SXEA 3K0SA 2W6NA 2H2GA 4LYYA 4EH1A 3AWIA 5D7BA 4RUAA 2JCGA 1GNSA 2Q2OA 4FIZA 3JRXA 4G86A 4E70A 3ZOKA 5FAKA 2H85A 5AW9A 3IR5A 1Z7EA 3E9CA 5EJIA 5BUZA 1W36B 4IBOA 4G0MA 4Q01A 1GKYA 5F78A 3W7BA 4G5FA 2NUTB 4M7PA 1K5PA 2IXAA 3WQQA 4EFDA 4K6GA 3UPQA 1U11A 4CKXA 2ACEA 4V0OA 2X8LA 4F56A 5LMCA 2FEPA 3RJMA 4ZVRA 3GGSA 4DA8A 2CVFA 5D1HA 4DKXA 4M8KA 4R7GA 4DDTA 3WV4A 3A8TA 4K28A 2VDUE 4DSIA 4NY8A 5DDMA 3EQ7A 3K8QA 4KQXA 4PM4A 4Y2GA 4JUBA 3UG6A 1E79A 3W2EA 4UEKA 3EMBA 2B99A 3CW8X 2DL0A 1Z8NA 3PGLA 4Z54A 5IDVA 1OR8A 4TSRA 4B4WA 1XU4A 4UQOA 4CEIB 1RLMA 3OC6A 2Q5JA 3O8DA 2WQ7A 2EBUA 2AOUB 4BO5A 3WXMA 4HWRA 3G2KA 1PR2A 3ROPA 2YC4C 1WMAA 4R2XA 4GU5A 1Q11A 1EM8A 5J4HA 2CF5A 9ICNA 3GFBA 4DLLA 3UANA 1UBMS 5H59A 5FTJA 5K3FA 3LP5A 4ETIA 5LP1A 3GT3A 1FTNA 1UBEA 4CM3A 3O84A 1VRCA 1ZETA 3A4LA 5CHEA 4KXFB 1KL9A 2PRKA 2R6ZA 4KMSA 3G89A 5LLSA 2I4TA 4DA9A 3FCOA 2VQ3A 1E7WA 2PRYA 3FGOA 3AL0B 1ZQSA 3N5CA 4M1QA 4QUAA 1LA2A 1X87A 3TZHA 1PJBA 4EVIA 5M34A 2A94A 5F4ZA 2O9JA 1ZOPA 3PSTA 3GT7A 4QZIA 2KN7A 3BA1A 2ILTA 1YVRA 4Z6FA 1SKWA 2BCVA 1XDDA 4WFKA 5CHYA 4XFKA 5DVZA 1LH0A 3TM5A 2Q1XA 2QN7A 1OFGA 1DT5A 1UEXC 2VZ9A 2WTAA 2MSDB 1KWGA 1UPXA 2WJ6A 1WETA 2HRDA 2VUTA 3EEYA 2BJWA 1QZUA 3GFGA 4PSCA 1FYFA 3UQZA 3R24A 4LYEA 2OG2A 2ZSUA 1A9RA 3LX5A 3AEXA 4XVCA 3JQFA 4PLZA 3ZIAA 3ZWBA 2AEEA 1WMBA 1FLAA 1VIYA 4ZHQB 4M1OA 1ZQDA 1Z00A 5BP7A 3R0IA 5IM5A 2BF7A 4AKHA 4LQLA 1YZ7A 5LA6F 1JEEA 2WAAA 4HAXA 4KXNA 3HS3A 1S2LA 5KTRA 1SRRA 1HQDA 3B7PA 4LJ9A 5I8ZA 4BO6A 4BFLA 5DHRA 2QUBA 1BOFA 1UCVA 4KMUA 1D2EA 9ICMA 1SXIA 3S1SA 3V4FA 3C5GA 4R1UA 1Z00B 2HBYA 2XZOA 4L9WA 4WK0B 4AC9A 1JLSA 1HYQA 2CL6X 2EP7A 5DT2A 5IAOA 2X7XA 1Z5VA 2RGWA 1M2VA 2QXTA 3RB6A 1FTYA 5AVVA 2BISA 1FMLA 4ALNA 5HKBA 1ZUD1 2PYZA 4JQOA 1VKRA 4QWEA 2D74A 1EU1A 1QF7A 5IARA 3CNOA 4EW3A 3SC2B 1RWVA 4U2FA 2IXGA 1H2BA 9ICWA 4RPHA 5BSMA 2BC9A 2ZBFA 4C9BA 2Q50A 1JFFB 1JFLA 1HKHA 1PR5A 2EZUA 4OJTA 5FTNA 3UK1A 3EZNA 3KD3A 2B5OA 5KI6A 3WGGA 1UWLA 1JBQA 1U9ZA 2C4TA 1UQTA 2D1TA 2VP4A 1QYWA 4GNKA 5HIMA 5CH8A 3HJBA 3L1IA 2Q99A 1DEAA 1LBTA 3L4JA 1PX0A 3I5XA 4XSVA 1J2UA 2WHYA 5LYJA 5JQWA 1R3UA 3GDGA 2HLPA 1WXWA 1I5OA 1L4HA 3ONWA 2GPNA 2PX2A 4BB6A 5FA8A 1BW9A 4N03A 4I5DA 3VVCA 1IN7A 4XB2A 2AXTU 2PUCA 2REQA 3GV5B 3IDAA 4E5SA 1AKEA 2NV3A 2I4OA 2A58A 2V59A 4NQRA 4HDCA 1OGJA 1R66A 5KSWB 2IUEA 1MQ9A 1MR3F 1JH9A 1KJJA 4ZWNA 5J2AA 1D4FA 3T1TA 2H0RA 3DKRA 1XL1A 3R6GA 4EMTA 4R1LA 5F1YA 2DFDA 5F35A 5BOSB 1CHNA 4CNBA 2D00A 4JVNA 2PKEA 2JHAA 1E2QA 2PWAA 4YRDA 3WNZA 2OCIA 5JCXA 2Y9TA 1OXSC 2H65A 1A9SA 4C0XA 4DLRA 3PHLA 3BK1A 2XDYA 4I50A 1O6BA 2FPPB 3R40A 2ZANA 4ZCLA 2ODNA 4I08A 2W2TA 1O89A 2QP4A 1VJCA 2XKAA 3SZ3A 5JSZA 2VDPB 4Z3DA 2APJA 3TFQA 4YMWA 5DB6A 5TGTA 1R6UA 2CVPA 1XROA 4AW9A 3BIOA 3JD4A 5FRDA 3M6AA 3ETNA 5A0LA 1Z2OX 1H42A 5K8TA 4D41A 3C15C 3N2EA 5FLEX 1LPOA 3OE1A 4M53A 2V3WA 2MTBA 1BN6A 3AU9A 3NW9A 1ND5A 4UZEA 2IGTA 4II7A 1MO6A 3GLFA 2X4GA 3VJLA 5HRAA 3HA3A 2JLRA 2JLUA 1TZBA 1BFKA 2B2CA 4PX2A 2H0QA 4IF4A 4M0LA 5H3HA 4P98A 1DO8A 2AYZA 4LCEA 1QR2A 3DE2X 3H4TA 3M6VA 4YJFA 4XCVA 1SHZA 5KL1B 1ZQRA 3QKSA 4ASUD 4ND3A 2O8FB 3MRVA 5M7EA 4TWIA 3A1TA 5F73A 5CNMA 3LGXA 1JMVA 4RIHA 4J9QA 4G0XA 5JLAA 3P52A 2BFEB 1MN6A 4ZXFA 2J3HA 2FHSA 2NZUG 1CPYA 1JHMA 1ATZA 1J0XO 1YBHA 1RYHA 2H4WA 3MBKA 4FDAA 4N0PA 4C3VA 2QD3A 2FMSA 3ORFA 4IH1A 1ZMXA 5D8DA 4RA6A 4B31A 2BFBB 5TVKA 2HNBA 3EVFA 2Q4BA 4CV3A 5D3ZA 3RKRA 4R6XA 1NP6A 4AP6A 4GPTA 3TH5A 4Q1FA 2A9FA 3TNFA 3W2HA 4UOZA 2AYYA 4G5RA 5DHQA 2FJPA 1QSYA 1T2VA 1Z1VA 5EEHA 1E3JA 3VR5D 5F98A 4NHEA 3VJRA 2H5XA 3TZQA 3FAKA 1QIGA 4NMLA 2RAUA 1FX1A 4N0MA 2ERYA 2HYDA 2DUMA 3NWOA 1VRVA 3L8YA 3RHTA 3WZMA 1CY8A 1KU0A 3C6YA 2D2FA 1F2UA 1ZXXA 3OTQA 2ZJ8A 1Z4IA 3HRHA 3INRA 1GPH1 4G6ZA 2J87A 1DC8A 2WF5A 1VI5A 3NJ4A 2HQSA 2QU7A 5BURA 5JRZA 2Q7DA 2IV3A 4M83A 3E48A 2J4FA 2XIQA 2FOXA 3KKLA 1LV7A 2OCDA 3BXXA 4L3WA 5AWFC 3THWA 3ZZUA 1O4VA 2M1XA 5G3YA 3R7WB 1KK3A 4HQ6A 1A5BB 2IHUA 4BO8A 2H2IA 1U2PA 4WKOA 2BELA 4UBKA 4YO8A 2XCUA 1YJQA 4U8GA 3CH4B 3PNLA 4Q12A 1CHDA 4GLOA 3L7LA 1SBHA 2IZOA 4TL6A 2HYIC 2E4ZA 1SXGA 4MYUA 1NUHA 1QG6A 3J7TA 1ZQYA 3V48A 5EE3A 1BS2A 2R48A 4DSKA 4B8YA 4OUDB 1IN8A 2AUNA 3B1KA 4AYWA 4YDRA 3BGVA 3E22A 3CEPB 2Q5IA 2CBGA 1KRPA 1EKXA 2D59A 5K3DA 4OQLA 2VSXA 1IPEA 3FX2A 1IRIA 3HYRA 5IUJC 2IOFA 1I7PA 1ZJ6A 4RFLA 3UAYA 4ALIA 4MEYA 2FJ0A 1HG1A 3TBFA 2XCPA 2ZXEA 4XIFA 4Y98A 3UGJA 2HR1A 1P1RA 4YRTA 1EHYA 1R6BX 4WIAA 4AM8A 1EXWA 5B66U 1KDRA 4D8WA 3X0DA 3F6BX 3E35A 2QORA 1X7ZA 2ZE5A 3UXHA 3KR9A 1PBNA 2CXHA 1RPZA 3GLSA 3H1TA 4UBOA 1Q7RA 1OAOC 1SQGA 2QM8A 1RCFA 1FLDA 2HBLA 2WVAA 3PD0A 4N3NA 1GO3F 4RSHA 4XRRA 2I6QA 1U9CA 1N1GA 4PGGA 4B4DA 4KQ1A 3ISDA 4QXOA 4A0HA 1QH9A 1DWQA 3OG9A 4C03A 1R9NA 1KMHB 2OL4A 1H8HD 2PRZA 4KQWA 4BWFB 4E1BA 5AVTA 3RF6A 1LCIA 3I2JA 3K8ZA 4UBIA 2O8NA 5FBWB 1DFIA 1ES9A 3JS5A 1AZSC 4NE9A 5J29A 3WK4A 2C4HA 1AT1A 2WUGA 3RTBA 2VWPA 5DDIP 5EL0A 1QV9A 1QXSA 4ZI7B 1JDZA 3JPSA 3KJZA 1CRWG 1Y7HA 2G1UA 4ZCQA 5DG7A 2V9CA 1TCCA 2VUSA 3GC6A 3HI6A 1WDWB 3OEED 3OLQA 1Y4UA 3ESRA 4XWTA 3RYFB 1X0XA 4B8WA 1X42A 1KH1A 1X15A 3G5TA 4DSJA 2BQUA 5ELLA 3HY3A 1X40A 3WKBA 2YIDA 3BERA 3I8OA 1WM1A 3ABOB 2I5PO 3AILA 3CKMA 4PBRA 4PRYA 1B1CA 3C43A 3NBUA 3M6KA 2HH9A 1Y4AE 2I3BA 1XU7A 1Q0UA 2XT6A 4MV3A 3ULKA 2JANA 2OSBA 1J97A 4FN5A 2UZ1A 3BT7A 3IRVA 1UMDB 1UPFA 1LS6A 3D3KA 4ZU1X 1OIWA 3S0JA 2FW9A 3RFXA 3W9SA 1ICIA 2E5SA 3C1UA 5CBKA 2G5IB 2FF7A 7ICUA 4N3AA 1QHXA 4RHUA 1FMTA 2CJYA 2L69A 4HQFA 5TXGA 3GROA 3ZV4A 2IHTA 3V1TC 4O2AF 5HIIA 1M6NA 4RIIA 2IPXA 3LKVA 3ONEA 1T2NA 1AB5A 3L7DA 2POQX 3WFIA 3SWWA 4ZYTA 4AQ7A 2J5XA 1T3SA 1WL8A 2IYEA 4XGIA 4FM9A 1QB7A 2UZ4A 3ESYA 1BE8A 4RTLA 2ADMA 3JPOA 1L8LA 2DR3A 2RG1A 4ZEOA 1SPBS 3OSZA 4N7RA 4ARSA 2BH2A 1TMKA 1GYQA 1HC7A 3M9OB 3AK4A 3VDNB 4DWJA 5KC8A 5AKYA 2ZM5A 1UJ4A 4NM1A 2EFDB 2SKDA 4BLSA 3ZZ0A 4I36A 2ZUCA 8ICTA 2V7TA 1UBOS 3E9MA 2JFVA 5J9FA 2EZYA 2QBYB 4AY5A 5AM0A 2X9GA 4CL2A 1N6HA 4D9HA 5ICMA 4NVRA 1GFSA 2NMVA 1N57A 2I22A 4N9WA 3T3MB 3T3DA 4F06A 1KO8A 2WM3A 3RB3A 2IOHA 1EGHA 5FD8A 5BW8A 2Y1LA 3ICCA 1TJNA 4BNLA 1I9CA 1OI2A 2BFDB 1YKGA 3FCEA 3RRYA 2UVQA 1HFJA 2G4LA 2ZRCA 1UBFA 3K9BA 1YJBA 5K8CA 5KFDA 1X1TA 1DAKA 4TSFD 2CBZA 2TMGA 3LY5A 1QKKA 5G2OA 3JALB 2J9ZB 4OLJA 2DXIA 5ALKA 3CH7A 4QNNA 4F2SA 2VXOA 4FMCB 5G4KA 4WV3A 3R6WA 4RJJA 4CR7A 1RYUA 4HAVA 1XX6A 3VMMA 4K9QA 1UODA 1IAQA 3TKLA 2KIWA 2WZDA 1X7WA 4F4YA 3KYDA 4L2IA 4KBFA 3WGYA 3DBHA 1WLYA 2V98A 1VB5A 4L3VA 4UFOA 3LQFA 3FDXA 3NS1A 1Z0UA 7ICSA 4UU1A 5GADl 2I1VB 2VHUA 1H1TA 3HKCA 4F21A 1IQRA 1O96B 2J07A 1UBGA 4HXGA 5I5EA 5A6SA 1W0CA 3Q8QB 3HP1A 1M67A 2R5NA 3M5WA 5J5AA 4MK4A 4NYMR 2DWPA 4JJ6A 1IIBA 8ICEA 1P4RA 2R47A 5FDFA 1EFPA 2JRZA 4MICA 5EUCA 2GHIA 8ICOA 3DAGA 4GE3A 4YDHB 4GXTA 1GRQA 2IHJA 2H59A 1QX4A 3G8CA 1UR5A 4MYTA 2DLCX 3HCOA 2G0TA 4R4JA 4QZAA 4FE4A 3RSQA 3OFSA 2AV6A 4OREX 4ACAA 2RDIA 4BLUA 2PKWA 1SHTX 1WD5A 1XDZA 1XZBA 2BE9A 3C5VA 1ZIXA 2LKCA 1J2RA 4KPEC 3IS3A 1SN7A 3G85A 4ONEA 3RHZA 2Z0MA 2I71A 2P3LA 3MTEA 2GZHA 1M76A 2IY9A 2PSDA 1MZVA 3KCQA 4Z9YA 1IZZA 1PT8A 2Y92A 3AF5A 4RQ1A 1CQJA 4N8EA 5KVQA 5BPHA 4V2UA 3UQ0A 1W8IA 1UMBA 1EFHA 1F6DA 2RCNA 4YD2A 3EVTA 4HZGA 2QQ0A 1XD2A 5IXYA 3U61B 5FL3A 4OL9A 1T4CA 1AUXA 1XCLA 3RBXA 5DU2A 1I1NA 3A6EA 5BMOA 4IPTA 2OY0A 1ZVMA 2VJDA 3MMZA 4I50F 4XJVA 3VC7A 4AXBA 1NXPA 3LL4A 3EMKA 1JHZA 3WJ1A 5JZVA 1PHRA 4L8WB 3N97B 1UJBA 2C9YA 4P33A 4P32A 1EAYA 4V38A 1XSNA 3N2NA 1ODKA 2A33A 4CLXA 1ISHA 3N3BC 1PFQA 3ZLUA 1MGOA 3KSDO 4ARUA 3IKTA 1YVPA 3T3OA 1WG8A 2P8SA 2VP6A 3HCWA 1X8KA 2VDNB 4L8YA 1UJCA 3L8ZA 1ISPA 4AY2A 3REQA 1VBKA 1Z4KA 3T54A 2JFFA 3KAPA 1G1AA 5FORA 5K2MA 5B64A 3NOOA 2QM3A 4N3CA 4JK1A 4HNTA 5I7EA 2JFNA 5K0JA 1AOXA 3RU9A 2JFWA 4A10A 5CWRA 5K0EA 1JR3A 5KAIU 4LN1A 3D31A 4ZHQF 3ZNNA 1UP7A 4MGZR 3TLAA 2H1VA 3PQ5A 2KIVA 2QTAA 1X66A 4LX0A 3ICOA 1QRUA 4DIDA 4OVKA 4RVGA 4RPZA 1JR2A 3OQVA 1Z1BA 1BDJA 1E94E 1M54A 1QOZA 1U9YA 4HFJA 3LYHA 3Q3HA 3VYTB 3U4GA 4LHWA 1DO0A 3TFRA 1UKEA 621PA 2OCLA 2GA9A 1KFKB 5T57A 1DE0A 2XQIA 1JA1A 2IS2A 2WOOA 3ZHSA 1NDQA 2HJVA 2F1JA 2CLSA 2VRCA 2XITA 5HRCA 2CDNA 4OJ5A 2XA9A 4JBYA 3UJ7A 1UKAA 4CR6A 1Y6GA 1QRSA 5ER9A 2Q2QA 2HF9A 4TV8B 3WDSA 4ND2A 3HPOA 4CKYA 3OU7A 3GFVA 1KTQA 1G291 3BCUA 1MRNA 1V3VA 1WNTA 3I83A 3CYFA 2VF4X 3R3SA 2UAGA 5EJMA 4RVCA 4ZDWA 1EFRA 3BIJA 1EJ2A 3LL7A 3SICE 4GZ5A 2EQYA 5A9SB 3UOAB 1E0AA 1CRXA 1FRNA 1RFGE 3PP8A 4IDEA 4PYRA 3BGWA 5KNCD 4TLAA 3MINB 1PJ8A 2IZ5A 4UNNA 4CLEA 3LHIA 2IYUA 4MGIR 2ZLBA 5CA1B 5FWNA 1EE9A 5T67A 5AM3A 2V0NA 3V9PA 2Y0SC 3AXSA 1WD7A 3SQNA 3NHSA 3PMLA 2Y1WA 2YV4A 4MWGA 4Q37A 4QYTA 3L0ZA 2ZJ3A 4AULA 1K9VF 3BXPA 4B43A 3OJUA 5IM4A 3C74A 3OZBA 3PT5A 1IN5A 3ZWVA 3LXXA 1E3SA 2DTDA 2VUIB 2W2OA 2ATXA 1XZDA 1MA0A 1YQEA 1JHUA 3GA5A 4B0OA 5CW1A 3AJRA 1X9MA 1SL0A 3R41A 5CA1A 2MHCA 4BJ1A 2HHWA 1H65A 9ICTA 1XKTA 1ADCA 1U3WA 1DAFA 2D8CA 1I10A 1I94B 2YJ5A 4DL7A 1UC8A 1CVIA 4IJMA 4X90A 4C88A 1J1ZA 3KYJB 4YRZA 4BGUA 2PMFA 1BXRA 1SVKA 1HDIA 4DF4A 1COKA 4ACOA 1K1EA 2M6LA 1NNEA 1RHJA 3N8IA 3OZVA 3EVNA 2FSHA 4HXFB 5CYOA 4EF4A 1TAMA 2FVXA 3OZAA 4ZYZA 4TMKA 4CL8A 2YXPX 1P1CA 3FH0A 2QKYA 3Q8PB 3CPEA 5KKAA 1LK5A 3DO8A 1MT0A 4NBUA 4BFSA 3ZDZB 1QIEA 2ETXA 4O3SA 2W58A 1XZQA 421PA 1RS0A 3ETCA 4JJZA 3R0ZA 4ES6A 3O31A 3NO4A 3PQ3A 3WHIA 2FPWA 1J24A 3N2GA 3TARA 3I3SR 4S1VA 2JFOA 4DL3A 4BUJA 2XGOA 2YYSA 2WAQF 2NT3A 3P0EA 4ZV7A 4Q3KA 2JMGA 1MJHA 2HK7A 3RNLA 4XLZA 4BEWA 2DM6A 4ID3A 2IE0A 3DVQX 3SGLA 5CB8A 3H13A 5CU7A 4JV5B 3IC5A 4ITRC 1P2FA 4KAFA 3ZY6A 2ORED 4A26A 5KB3A 2QUJA 5KFJA 5JNTA 1X7XB 2C9BA 1SRQA 2FR8C 2FZLA 5FL7D 5TV2A 3UENA 3ZHRA 5K0GA 1HTWA 3H9CA 4LMPA 2XSZD 4ZOLA 2W11A 3Q7PA 1ZW1A 1YACA 3ZBUA 3MK31 5LWHA 2OENG 4RF3A 4A92A 1SVWA 2WNIA 2WUVA 3RJFA 3FMOB 5DM60 4BQIA 1OYYA 2L0XA 2H6EA 2HJSA 5KX5B 1YV9A 3RTAA 4BNGA 1T5LA 1KN5A 1FW8A 1GNVA 1VHWA 3K3PA 1NYLA 4L7VA 4TRRA 1XTQA 5U4QA 5BWBA 4KLJA 3O8OB 2Y6UA 2G5CA 3PQDA 5LB4A 1OX5A 2V8OA 4FUQA 1NOMA 2GK7A 2ACVA 2ZSDA 2I3GA 5DNDA 5IJXA 1OJ7A 4JC8A 3JZDA 1W4CA 3E1GA 3TUZC 5LD2C 1E0SA 3ZLTA 4BRSA 2YW9A 2PUTA 1E79D 1U8UA 2OB1A 4UOEA 4QUDA 1C9EA 3CUTA 5K7SA 4V3BA 3VPSA 2YV2A 2ZZMA 2GN6A 3CYMA 1DQYA 3KQSA 1A5AB 3NYQA 3WZ2A 3HKDA 1GTZA 1KETA 4YHBA 3ZHCA 2NU7B 2EHDA 4CFSA 4EM6A 3V7WA 1N5WA 5C4MA 1LPPA 4UB3A 2JZCA 2OD2A 2XYVA 2IF2A 4YS6A 2WT9A 2JJ1A 3SR6A 4EI8A 4EI2A 1QE5A 4L8LA 5J2CA 2HHSA 4N5HX 5U9CA 1O97D 3H5VA 2GX6A 1Y6FA 1TRHA 3B3AA 5CEJA 4D9FA 1IZ9A 1DAIA 4PZZA 2HA5A 5A4AA 1XNSA 1E3WB 1VIDA 4D3FA 3FCCA 3MCTA 4EJFA 3FTPA 4ZODA 1VMEA 1Y7PA 4XYBA 5BV2P 2UXDB 3UUWA 1XZEA 2AFRA 4PZOA 4GX1A 3KPWA 3AQFA 4F92B 2D5LA 4BGVA 4JWTA 3SSOA 3BQTA 4D98A 5K6RA 3BL5A 2R65A 3TLZA 4K4GA 4PNPA 4V1CA 2PH1A 5L3ZA 4EUSA 1LVUA 3CF4A 3EXIA 1AXGA 5FWXB 1A8QA 1V35A 2AL7A