2WHEA

Structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic Details of Near-Transition State Conformers for Enzyme Phosphoryl Transfer Revealed by Mgf-3 Rather Than by Phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wheA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wheA01
3WKCA 3R9KA 3WK7A 4E88A 5AI9A 3NALA 4G63A 1YMQA 2RBKA 5ALFA 2OA0A 2PQ0A 2IOFK 3UM9A 3ET5A 4OHFA 3A3YA 2MU1A 5AVVA 2YMLA 5ALGA 5AICA 4I9GA 1U2TA 1MH9A 5ALKA 1Z5GA 3ET4A 3D6JA 5AW6A 2FPWA 1ZD3A 5AKJA 5AW5A 2NYVA 5AK4A 4BEWA 1J8DA 1FEZA 1T5TA 1ZS9A 2ODAA 2BDEA 3L0CA 5AW3A 3K1ZA 3CZ4A 2R8YA 1WVIA 2PR7A 2EAUA 5ALHA 2G07A 4XPZA 3OCVA 1Z4MA 5T41A 3E81A 4KYTA 3U7EB 4L57A 1T9ZA 4IG4A 2HEGA 3L7YA 3PCTA 1ZD4A 5AVZA 4YCNA 1YJ5A 1NRWA 3QU7A 2I7DA 5IT0A 5FP0A 1SWVA 1RKUA 1RLTA 4ZEWA 2G08A 2O9JA 3OCYA 1RC8A 3A1EA 2YMPA 3L1VA 4BX2A 1XVIA 1RMYA 3J7TA 4DWOA 2C8LA 1ZD2P 5AW2A 5AK3A 1Z88A 4HGRA 1Z4PX 3KDPA 4NWIA 2EATA 3EPRA 4UM7A 2BDUA 3L5KA 3FGOA 5ALOA 1IWOA 3L8HA 5AI6A 2W4MA 5AM3A 1L7NA 2CFSA 5AK6A 2GHQA 4KNWA 1JUDA 1O08A 2CFTA 2YFYA 3FZQA 4UU0A 5AKYA 4DCCA 2EARA 2YJ4A 3SMVA 4C4RA 3ED5A 3QU4A 1XPJA 2B1RA 1Z4KA 3MC1A 3FPBA 4XQ0A 3HLTA 2B1QA 3MN1A 2WFAA 5AIBA 4Y2QA 4CNQA 4IFTA 4F71A 2CFRA 4PNHA 3N07A 1RKQA 1LVHA 3OCWA 4MWOA 1XP5A 2YJ5A 4YCMA 2B30A 3QU2A 3QUBA 4UASA 2JAWA 1Q92A 4YH1A 2HF2A 5AVRA 3WGUA 5AVXA 1TJ4A 2R8XA 4C4SA 1K1EA 4J2TA 4QJBA 5AVYA 3AR8A 3E58A 3PGLA 2FDRA 4RESA 3GYGA 3I6BA 4BNDB 5AI8A 1U7OA 3ZTWA 3AR4A 2G09A 5ALXA 3SKYA 2P69A 1CR6A 3AR2A 4CF5A 3FM9A 3PDWA 3ZWKA 3QUTA 1L8OA 2C4NA 2ZBDA 3AR6A 2X4DA 1KYTA 2JAUA 3WKEA 2B82A 4UAUA 2I6XA 2JARA 5AM0A 1VFPA 3UMGA 1ZD5A 2P11A 1Q91A 5AKHA 1L7OA 3NASA 3NAMA 4YIHA 5AVQA 3FVVA 4YIKA 3U13A 1Z4QA 4MUMA 5AVTA 3SD7A 3IJ5A 3M9LA 5AK5A 4BEVA 3ZTYA 4QQFA 3U7GA 2G06A 4Y2YA 4I9FA 3WKBA 2CN1A 2WM8A 3E84A 3NANA 3A1CA 4EEKA 4H1WA 2VKQA 4EZEA 1L7PA 2ZBGA 5IT4A 4Y2JA 2WF7A 5AM1A 2OYCA 2HSZA 1YS9A 2W11A 3MMZA 3ESRA 3ZVNA 1AQ6A 3L8FA 1J97A 5AIAA 3UMCA 2P27A 4HAIA 3L8EA 5AKGA 2FI1A 3SKXA 3OPXA 3KD3A 1VJRA 1SU4A 1ZOLA 4HYTA 4O8CA 3AR7A 5A3QA 3BA6A 5ALLA 3SLRA 2HHLA 3DDHA 2HO4A 2DQSA 3BWVA 4Y2RA 3L1UA 4UMDA 4AP9A 3OCXA 2G0AA 2O2XA 4HGNA 4KX3A 5AESA 3ESQA 4ZEVA 5AKXA 4OCZA 4KN8A 3WK6A 3WGVA 4UU1A 4XOUA 4CF3A 3W5BA 2BY4A 4OFZA 3QUQA 2OBBA 3HYCA 3QNMA 3KBBA 1N9KA 2YBDA 3ZI4A 3QLEA 3AR3A 1EK2A 1Z4JA 1QQ7A 2MSNA 3CNHA 2AMYA 3QGMA 4UW9A 1EK1A 2Q4TA 2ZXEA 1QH9A 1S8OA 3L8GA 2G1AA 5AM5A 1Z5UA 2ZBEA 3SF0A 5E0OA 1QQ6A 4AS3A 3NRJA 3AR5A 1N8NA 2RAVA 1Z4NA 4CE6A 2RB5A 3ZUPA 2WF9A 4GIBA 3OCZA 3W5AA 1VJ5A 4Y2UA 4EX7A 1NF2A 1RLMA 4BBJA 4EENA 4GXTA 3U19A 3WK5A 3OTQA 4BYGA 1NNLA 1YNSA 2WF5A 5AKKA 4KNVA 4DFDA 3B8EA 5ALMA 5ALZA 1L6RA 5AW0A 1PW5A 2HX1A 1WPGA 3N1UA 3N28A 5IS2A 2YMMA 2HDOA 5AVWA 4AS2A 3R4CA 4NFLA 2AUTA 3KOOA 1RPZA 5AKEA 3WK9A 2FPRA 2FEAA 2FPSA 4FYPA 4Y3UA 3QYPA 1RRCA 5AI4A 1ZRMA 3NIWA 1RMTA 5AW8A 3NUQA 3SHQA 2ZBFA 2JGAA 4Y2XA 3FPSA 5ALWA 2R8EA 4BX3A 1O03A 3I76A 2I54A 2IYEA 2C9MA 2R8ZA 5ALRA 2GO7A 5AM2A 4FFDA 1RQLA 4Y2TA 5ALDA 2B0CA 4HGQA 4JDPA 5AKIA 3QU5A 5AW9A 4Y2VA 4C4TA 3PGVA 2HOQA 2I55A 4DW8A 3N8GA 2FPUA 1YV9A 5AW1A 2QYHA 3KZXA 1U02A 3WK8A 4UMVA 5AKLA 2P9JA 3WKAA 3DNPA 3E8MA 5ALEA 2WHEA 2I33A 1U2SA 2I34A 2AGVA 3L0YA 5ALUA 2FUCA 4NAVA 2IOFA 5AW4A 2QLTA 3B9RA 2Q5EA 2IA5A 3N5KA 3F9RA 4B6JA 3OCUA 4BNDA 3B9BA 1Z4IA 3ZU6A 3ZWDA 3R09A 1S2OA 3TLMA 4UAVA 3WKDA 3M1YA 5AI5A 2AH5A 1YDFA 3ONNA 4J03A 4NV0A 3L0BA 1ZJJA 3U7HB 1Y8AA 3DV9A 2G80A 4UARA 4YCLA 2ZG6A 4EELA 4Y2SA 4UM5A 5AVUA 2YN4A 4UMEA 4CF4A 5ALYA 3ZVMA 3ZVLA 1RLOA 4HGOA 3QU9A 4F72A 2WF8A 4G9BA 2YY6A 1TJ3A 2GMWA 3KC2A 3P96A 3RFUA 2YJ6A 5ALJA 3WK4A 1L7MA 1RQNA 3W5CA 2B8JA 5A3RA 2IOHA 3S6JA 4JB3A 3U7FB 4BX0A 1Z4OA 4YGYA 2HCFA 4BKMA 1RDFA 1RMQA 1X42A 1WZCA 4ZEXA 5ALPA 3VAYA 4L6CA 1TJ5A 3IRUA 1L8LA 1ZRNA 3U26A 2C8KA 1SWWA 3RF6A 3DAOA 2WF6A 4XE5A 2RARA 3EF0A 4FE3A 1QQ5A 2PKEA 2MU2A 1T5SA 1TA0A 4KX5A 4UATA 5ALQA 2NO4A 3W5DA 3UMBA 3EWIA 3ZX5A 3I1YA 5ALIA 2HI0A 5ALVA 4Y2PA 2B8EA 3QXGA 3MPOA 1LTQA 2FUEA 2YJ3A 1F5SA 3AR9A 4RETA 1WR8A 1TE2A 5AI0A 5AKZA 1Z4LA 1RKVA 2FPXA 5AHXA 5AW7A 2W43A 1CQZA 2JAOA 3I28A 4UMFA 4HGPA 2NO5A 2D2VA 3QX7A 3IB6A 5AVSA 3ZW7A 1QYIA 2HF7A 4NABA 3QUCA 2YMQA 2C88A 3ZX4A 1U7PA 3A1DA 3EF1A 5A3SA 2GFHA 4OD0A 2OM6A 2ZOSA 5JJBA 2Q4RA 5ALNA 5ALSA 5AM4A 4EX6A 2GHTA 4L6AA 5ALTA
chains in the Genus database with same CATH superfamily
2EDAA 3AEZA 5LU8A 3NWJA 2C42A 4X45A 4GRAA 1CSEE 5ICGA 2V3CC 2O8DB 1X7YA 4CTNA 5KFFA 3FOCA 1T4DA 1V2HE 3RYIA 4CR8A 3T3IA 5C5DA 3IR5A 2E1RA 1XTBA 1GILA 3L0PA 3P0JA 1S2GA 1OOEA 2V6JA 4B34A 1W94A 8ICYA 3RUFA 4JI7B 2JGNA 1R00A 4HC4A 3IHTA 2ECFA 2FAXA 4F5YA 4DSNA 2M9MA 4DCNA 2EZXA 3I73A 3TAPA 1A0PA 2JS7A 3UENA 1B0ZA 4JITA 4ZO7A 1IU9A 5F1YA 4BXOB 2AQHA 4M36A 4BGIA 3CLSD 4F3RA 2VDRB 5C0OE 4WTOA 3QENA 4IZHA 1RWWA 4LOKA 4UU0A 4XGNA 3TZ6A 2AEMA 3RWBA 2GZ3A 4JGIA 2XHEA 3WYDA 3ECAA 1Y1QA 3PO4A 4YRTA 4AJHA 1S9DA 1B1AA 4RIHA 2NTYC 2JGIA 4OHOA 3TDMA 4MQEA 3AIMA 1FFGA 3E22A 4XFDA 1YA4A 3CF0A 4XSVA 2A9PA 1TXGA 3Q4GA 3U16A 2XNKA 3EZ2A 3BS5B 3UVEA 3D54D 2VA2A 1H2AS 1BCRB 4Z8YA 4BFLA 4OHRA 4PZDA 2VF7A 2AK2A 1E3WB 1KY5A 3P0FA 2C31A 1YQTA 3DE7X 1EP3B 1U2EA 4PJ0U 4YMMA 1CYDA 3BXXA 3MJ4A 1PK7A 6ABPA 3QA9A 7MDHA 2E4WA 1RWKA 1LPPA 5C5IA 2PJDA 3WO1A 3V8EA 4BLRA 1HWYA 4YRGA 3JPPA 3OFND 2WWVD 3K30A 5FYDA 3AR3A 4R0NA 1IM2A 1PZFA 3MTAA 1FP6A 4PZPA 2XA1A 4FOOA 2IBMA 2OXFA 4OHBA 4B33A 2PFOA 4PC3A 3JPSA 3TOZA 4PBTA 3AM4A 4BBJA 5FLYA 4WCDA 1EJ2A 2F8LA 2R7MA 4MV1A 4MPDA 3KO8A 1SC6A 3WFZA 1C3XA 3VYRB 3NIBA 1U1EA 4Z9XA 2JCBA 5ICCA 3G49A 3KOOA 1C9DB 2BHSA 2ENUA 3HTXA 1NDUA 2V0GA 2I7CA 2JJ1D 1VTKA 2PT5A 3GV7B 5BMVF 4KE9A 4I7EA 1NZBA 3WE7A 3ZJUA 3IQWA 3PC8C 2GESA 2C61A 2A5DA 1LLCA 1DWOA 2ZS9A 2VUHB 3RJTA 2I4NA 1NC1A 2FFJA 4ZU6X 3BRSA 4BGDA 3HX0A 2WJHA 5FBQB 2EIHA 1ZEJA 1HQKA 3SEZA 2QRZA 2D4AA 4CIYA 1WUDA 1GL6A 2WINI 2QVYX 1UANA 3UIEA 4B1FA 4E5KA 4UM9B 2ZRKA 2CJWA 1PJZA 2NZWA 4FYMA 3EYZA 2G36A 4TYWA 4KN4A 1Q5PA 1RQNA 1SG0A 2GTIA 4GEGA 1WS6A 3A8TA 4GZMA 3OA0A 5B53A 2H4HA 1SBYA 5AO9A 1KSFX 3U4MA 2QXYA 2D4HA 1LC0A 3ZCSA 1EVKA 1OREA 4PIVA 4ZYVA 3RG8A 1JPUA 2JJ2D 2YCBA 1I2CA 2PBZA 1PJSA 5EINA 1R88A 5CJ7A 2BUAA 4LW8A 3MIIA 4ZHQB 1ZGJA 3MAJA 1Q0QA 2I65A 1S10A 5D46A 4I14A 3A31A 4UCQA 4DCMA 4NABA 2EKBA 1C41A 4MS1A 5FA5A 4WKCA 3HVKA 3LPNA 4RNCA 4B9VA 1NW5A 5ALTA 4C2TA 1OXBB 1MQ3A 2VA8A 1D7OA 1N2GA 1KFTA 4DLAA 3HA2A 4FP9A 3GX1A 1U4OA 3AG5A 2YYYA 5IKOA 3A14A 4RQ0A 4NEQA 1BX1A 3HJBA 5LYYA 4OA8A 2DRIA 1PFUA 4DNQA 1DS6A 1Z22A 2O6LA 4EIWA 3D0QA 1BEUB 1RBQA 3AQFA 1JAXA 1EDOA 2NV0A 4ARCA 3F98A 3OIVA 3L77A 3ADBA 2C04A 4KQKA 5KBYA 4LZZA 2HHHB 1IEWA 3OQPA 5I9MA 3AERA 2GNPA 4MZDA 2J5RA 1CEZA 2FW6A 3L5KA 2X9VA 1GQYA 2Q1SA 2WTAA 4MYSA 2VHYA 1ZHFA 2YOGA 1ZQRA 3TS1A 3IE1A 3ED5A 2ZR8A 2YHBA 1T6ZA 3N0WA 2J09A 3GZJA 2QIPA 4HX2A 3ZXSA 4A8TA 1XTZA 2C0PA 4LYEA 3P7MA 1QFXA 3TE7A 3T34A 1RM5A 4QM7A 4RV5A 1NN5A 5CVDA 2ZZNA 4XKJA 2XYGA 3HJHA 4CDRA 1L5NA 3PXEA 4ARZB 5EWFA 3HCOA 5JCJA 2ATVA 4MKHA 4ZRMA 4UNSA 1XPRA 2KKPA 4L4SA 4L8GA 3KTAA 1ZQZA 4Y2JA 1AGRA 4BKUA 4W7IA 3KR1A 5FQOA 2PFKA 3AC0A 5C32A 2AG0A 3PPIA 3KD3A 4DDTA 3FGPA 3UJ9A 4KMOB 5K45A 4M8NE 4BFYA 5FI1B 3ZXYA 2GDJA 1E6WA 2BP7A 4RM3A 1P0QA 1F5NA 1FFXB 2F8MA 3KZ1E 2BI7A 1RRFA 4CGZA 3CNQS 5J2UB 3DMPA 4FKBA 2QM3A 2HVHA 4KLCA 2BMAA 3GJZA 3NIDB 4ZI2A 1VPEA 2IP1A 2EVWX 1QS0B 4FYYA 3FTQA 4UHKA 4C89A 1VLLA 3U4IA 4NNOA 4ZT7A 5K9ZA 4N7MA 4KNVA 4W7SA 1EIZA 3HI4A 1GL7A 3U37A 2D74A 2WTUA 2OCIA 1UEJA 3PC6A 3CZMA 3N28A 4CMAA 3QKTA 2EQAA 2LCQA 3DHWC 2X6RA 3CUWA 3HBFA 3EGXB 3IAS1 4IMPA 1P74A 2E89A 2ZUTA 3R0XA 2J0SA 5DI3A 3WGKA 4UU8A 3RYFA 4X8LA 2H51A 2M6RA 4ZALA 1PF7E 4AJ9A 1WP9A 4V0ME 2IYEA 3PF9A 1G5PA 2FJPA 5BR8B 1TK2A 3UMYA 5J23A 4HFNA 4O4LA 5BXQC 4U7TB 4KLUA 1DC3A 5AJVB 3LWLA 5DYNA 1X7XB 5CNJA 1LK5A 2OP1A 2XYHA 3NT5A 1TM7E 3HU1A 3ZQKA 4MUHA 1LRJA 4U3JA 4ZQIA 4QBTA 2WNSA 1KI9A 3TLMA 3TUZC 4HATA 1PJ2A 4OJLA 4RPKA 4WGFA 2WJ3A 1IUOA 5DN6D 2AF4C 4HGOA 5E3IA 5ALJA 5B5SA 2XQIA 1N2EA 5DM60 2ZRMA 4PGGA 4FEGA 4ZO4A 1WZCA 2O1XA 5JD6A 4A8HA 2WKRA 2FZEA 2OXTA 4UHFA 4HQKA 4F5EA 2WYIA 5DBHX 4Q48A 4MVJP 3H9UA 2OFFA 1JXLA 3CLTD 4LY0A 3UV7A 1ONPA 5KAFU 3SVLA 4WCFA 1JU3A 3GGGA 1AXEA 4AY5A 4D3XA 1YE8A 1P44A 2XCOA 4R16A 2J7KA 4PLCA 1FK8A 3DC2A 1DVRA 3NBYC 1F3LA 5FO0A 1CB0A 3IAXA 3MS4A 4MHVA 1OBFO 3SBEA 1ORIA 3IQZA 4JL6A 2VHZA 5B7QA 1R12A 2PMKA 5B1EA 4RTRA 4X91A 1UK6A 3IHLA 5CB8A 2YJGA 2NYVA 3GBPA 1SUEA 3L0CA 1YUNA 1G9XA 2QB0A 3NHAA 4PYKA 3WNDA 4CTMA 4AZVA 3TRFA 4OXNA 4NPCA 4FGJA 1QWSA 1OZHA 2KPOA 1T8PA 2H08A 3VHRA 3GUYA 4A5SA 1PBTA 5F52A 4XW2A 3FR7A 3HCPA 2FQQA 5D4BA 2CD7A 4P86A 3LGSA 3BZCA 2M6SA 2JJQA 4EYQA 1PVPA 3AVYA 1BXGA 2GJSA 1ULAA 1M8JA 2VK2A 2Q3FA 1M2VB 3K0AB 5THXA 3B1XA 4Z4FA 5IM4F 1O9BA 3ZH9B 2CFRA 3PHLA 1Y7TA 5FWNA 1DXHA 2VVTA 4Z99A 1WPRA 4NCAA 1RM6C 3UOGA 4B32A 2N46A 3SV3A 1MVNA 1Y1TA 3RNOA 2GLUA 3G02A 5KNLA 2W6NA 4EGCB 2G09A 4CKEB 1EWVA 3NM5A 3D7LA 2GILA 3VU8A 1UFVA 2EWVA 4E15A 4KKVA 5E38A 4DYHA 3BWMA 4Q8EA 3MB5A 1J21A 4MKGA 3PO5A 4I36A 3A04A 1W85B 5J40A 2P6MA 2JI4A 3LQ2A 3PX0A 3K8YA 1Q2XA 3ORSA 3IJ5A 5J1TB 1MH1A 2QQ0A 1WDTA 4MI3A 2QWXA 3TM5A 3LC7O 3OLCX 1AU9A 2D5IA 3EH1A 1GNQA 3CRVA 1BFKA 1UINA 2YQ5A 2I1LA 2NX2A 5JSFA 3RLIA 3TW4A 1S0UA 2GYYA 3P5BA 4EFKA 3CPJB 4XD7A 1U9JA 2IYFA 2OBYA 5EKTA 3AB7A 4WK4B 2PO5A 2XUZA 3VNRA 8ICPA 3HYCA 4PH5A 2AZMA 3M1IA 2R87A 3QYFA 5C0YA 3WTBA 1C0IA 4LRTB 1YQXA 4ZDJA 5IJ0B 2XWPA 3Q5GA 3RS2A 4MHTA 4EBEA 4TRRA 1ADCA 3M6MD 4ECRA 1K63A 3NI2A 5KHLB 4N49A 1FSZA 4FUTA 3CO5A 3A3OA 3ILSA 4Q9NA 4CQLB 2MT9A 4TTVA 3WJ7A 8ICWA 2AXTU 1NVXQ 3GARA 4OKSA 1RYFA 2E4UA 3EVNA 1E3TA 2GPNA 2PJRA 2H6EA 4K3VA 5KYUA 2D3DA 3FKJA 3I2FA 4MA0A 2YFQA 3PXCX 3P94A 3F4LA 4DO9A 4Z9YA 2D1YA 4HXGA 5FV7A 3C45A 1VE3A 5IC5A 1XMQB 2BEUA 1IK4A 3QTLA 2XYRA 1L4YA 4ECAA 1K7EB 1E18A 1PUXA 3BWEA 4ZEOA 5F7ZA 4YT5A 1BNCA 1WSBA 3LGXA 3RUPA 3DL7A 2CBGA 3L8DA 4C5AA 1HKUA 2Q6OA 3OY2A 1KS9A 2EQYA 2NRXA 1JEDA 2CDRA 3GJ7A 5HM8A 3OPNA 4NICA 1P2SA 2FCRA 4FIDA 2R00A 2IXGA 4YCLA 3TTXA 1GPUA 4UCWA 4CF4A 3CX8A 2CJPA 4WZZA 4KQ6A 3C7CB 3B7WA 2XB4A 2O8DA 2WSYB 5TV2A 3HT3A 3WGTA 4UULA 1GYRA 4MUIA 3BSYA 3HXPA 5KVVA 3VNVA 4MV6A 1QRRA 3TX6A 4OI0A 3UGKA 4V0SA 2NT3A 3EOAI 1H2BA 3AL0C 2EX0A 1QU2A 3BGVA 4D02A 3N97B 3JQEA 2YVQA 3OE5A 4RA9B 3PUWA 1YXMA 4OQPA 3QXGA 4F1KA 3GJ4A 1ZQYA 2ZSIA 2DT5A 1QK4A 4U2KA 3BC1A 1LX6A 4NS4A 3ASUA 3N58A 3M6UA 1NRJB 1K97A 3SR0A 5CLFA 4R1OA 1LK0A 4F21A 2P3OA 1BMTA 3WVNA 1RWQA 3MERA 5JSYA 4HNUA 1GNRA 1WF3A 3ZE7A 1L5RA 2ONZA 3V3TA 3ET5A 3I01A 3ONFA 2MR5A 1Y3IA 3S28A 1F2DA 1LV5A 1W30A 1AMNA 1MB3A 2FNAA 2O3JA 1FYDA 3V80A 1JVSA 2PZLA 3BGWA 2A78A 4BBPA 2OHIA 1J2UA 1H0SA 4AKGA 1N0IA 5A5EA 3S5JA 3UK2A 3OTWA 4FEAA 2K8BB 1H2ZA 1Z4PX 5LZ8A 4YJFA 4R7GA 4FFLA 1WMBA 2RGWA 1RYYA 2XLCA 4WGGA 4G1BA 2X8JA 2YJ4A 3PGXA 3SQMA 1QIJA 5L4NA 1F8YA 2V58A 4NZPA 3VZCA 4WNYA 2UKDA 4A6PA 4XUCA 4XXHA 3OPVA 1ZQEA 4ZVPA 4B9MA 4KIGA 5IYZB 1KDYA 4M1WA 2XOKA 2R8XA 1N92A 9ICQA 5FA6A 3M8KA 3PGLA 4ML3A 4B75A 1FSSA 3T3DA 4DXHA 3O2NA 1EFRA 3FM9A 3L0DA 4OU5A 4IZOA 1RLUA 1BWQA 3U56A 4RZ2A 2QLMA 1P5JA 1HL3A 1QCKA 1V97A 3BQ0A 3NHMA 3ENNA 3I9FA 3AJAA 1BG6A 2L82A 4BX8A 4JK3A 5FOVA 2CMGA 2VYND 4XWKA 4X5VA 5K4HA 3AY3A 4TTIA 3KQWA 1LTKA 1YVRA 1FNCA 2FR1A 4ZMBA 1QNFA 3EVCA 4NU8X 4Y0VA 1C3OB 3BQ7A 2XKKA 1QYVA 1FFUA 2XJ9A 1MC8A 4QLOA 5DLEA 3S2ZA 2JH8A 4EUHA 2J1LA 1DRJA 1V39A 2IPLA 3F2VA 5J29A 3K92A 2XNCA 1G8MA 3RVPA 2Z6AA 3RGGA 4IRXA 3UGJA 1S96A 1XCOA 4OHVA 4QA9A 2ZXEA 4BNHA 1EXNA 4Y6QA 3CO0S 1OC4A 4B40A 3AR5A 5DM70 4PINA 4EHIA 4RD0A 2WRZA 4MV7A 3ZBPA 4EUSA 1Q17A 5DLQC 1Y98A 2IOYA 4QEKA 3T6KA 1KYZA 3LX4A 4BO0A 4QL3A 2ZYIA 2Q3EA 2BQUA 3T5DA 3JQCA 4MB6A 1CBUA 2ZS8A 3H1BA 3SYLA 4YTEA 5EIEA 2F4VB 2WIGA 2HPVA 5JEDA 4IIJA 3RANA 4F46A 1AK1A 4J9UE 2I7VA 3DVQX 1F0KA 4EJ0A 3IGFA 5I7EA 1KI4A 1TTTA 1KDRA 1Z5VA 3VPAA 3B6ZA 3ZIAA 5E6SB 4PV7A 3M0EA 4U1RA 5DGIA 3KEGA 1GP2A 3W6OA 4CU5A 3A9RA 3LDGA 1P2UA 1UMBA 5E9AA 3WIBA 2YHUA 1G7CA 3TCXB 3QKSB 2Y0DA 1S2OA 4GI3A 4B8ZA 3CLVA 2XEXA 3T9DA 3AM5A 2ASEA 1J90A 3ONWA 2LYHA 1AD2A 5IBPA 2I6FA 1DO8A 2J87A 1IQUA 4WNCA 4XM0A 4YO7A 3PJDA 1ZIPA 5AVJA 1U94A 1C9KA 4LOJA 3HKEB 4EGAA 7ICVA 3DLPX 9ICGA 5DNUA 4N6OA 2GRUA 1EP9A 1UBUS 1HORA 4X7BA 1A2KC 2O2JA 3BJRA 1B8VA 4NCHA 1Z3IX 3RVKA 2G1UA 3U3KA 5CFQA 4K3UA 1ZGZA 3G85A 4WX2B 2ETVA 3GFKB 3HFGA 4CMGA 2AHRA 5AW7A 5JS8A 3BXFA 3X2FA 3G0GA 4QJ3A 3L41A 3DT8A 4RJJA 1H4TA 4MUNA 3JVDA 3SSAA 3FPHA 2H63A 3D2LA 4PYLA 1GLNA 2J7PA 2G9QA 1XDDA 5LZ9A 2YZMA 4QBHA 4AQYB 2JEJA 8ICQA 2IHTA 4M9UA 2ES4A 2C2EA 3H9JA 4JBNA 1YDWA 1SUIA 2R1TB 4JYAB 2O0JA 4DRYA 1Z5NA 4BEWA 4RAOA 4ZXPA 3RB3A 5GONF 5A9SA 4TQ9A 1TI7A 2GA9A 4YRRA 4RGVA 2OFXA 2D7CA 3FHTA 2FOXA 2HMTA 2QS9A 3PQFA 4TKLA 4NPAA 1Z29A 1L6NA 5CD9A 3L1VA 4CT4B 4D0GA 3SCZA 3DQPA 1ECFA 4M7RA 5CFMA 5IAEA 2EU8A 1B4FA 4ARZA 1L5KA 1B3BA 3U4QB 2KK0A 4DNPA 5I51A 1YK1A 4HAOA 1MA0A 4Y9RA 3BICA 1TM1E 2PWAA 2RH5A 4LWZA 3SICE 4MB2A 4FI3F 4NLZA 4QWEA 3IOEA 3KKKA 3EVBA 2NU9B 1KFCB 1CZOA 2QTRA 5AVYA 1P75A 5KU1A 5AP9A 3C3EA 3ZJTA 2DC1A 4JC5A 3OZBA 2KBEA 1XZHA 3NCHA 4GX0A 1PK8A 2CV0A 1S76D 2R6JA 3L6EA 1ZJ6A 3WDMA 2C4WA 2H1SA 4L6IA 1RQRA 3ESYA 4DBZA 4XGKA 3M9LA 4RQ5A 1CIJA 2QTTA 4OA5A 5A62A 2BFDA 4CYMA 3H87A 4HT3B 3ZVNA 1SKYE 4R0VA 1GLVA 3G6KA 5JJCA 4RK5A 4PTZA 3UXYA 3DTYA 3HWSA 3H0MB 1KZ6A 3OCXA 2I5HA 1T43A 3IA7A 1GT6A 4O4IF 3KOWA 2HKIA 1CR2A 3AJ9A 1P72A 1YBMA 2MSNA 1IEQA 1IXZA 2GERA 5K0BA 2NP6A 1Z28A 1EWYA 2MDTA 2BFFA 2FE1A 2XXAA 1EXVA 4OX9B 4QUGA 2FSGA 1N2ZA 4XRRA 1AO3A 4B47A 1GM5A 4C6RA 4YMTA 5ARBA 3L6RA 4OUDA 3KL2A 2CZGA 5L45A 3NUZA 4P4SB 3SX2A 5B58C 1G38A 4NU5A 1RWOA 1ID1A 4JYMA 3E23A 4FYPA 1KYQA 3GCWA 3PC8A 2NVOA 2GKOA 2JLCA 4FT4A 4XPIA 3E0FA 4ZYLA 4RIGA 2PSJA 1YBAA 4OYYA 4AX8A 3DAYA 4EBBA 4BC0A 4AWXA 2J5QA 2DGDA 1G20A 1J25A 4RQAA 3DNPA 1SXJE 3CSUA 4GLJA 3MWFA 3PW5A 2ARKA 3EE6A 3G7UA 1Q6YA 3ZOZA 1NPDA 1AKQA 3OJXA 2AS0A 2CK3D 3ONNA 3VX4A 1KYXA 2GM5A 4B6EA 4L0CA 5KTRA 4DIMA 1OB5A 3KJZA 4MUYA 2IRWA 3N2GA 1OSNA 2OAP1 3WNBA 3GDOA 4F6CA 1UJNA 5CW1A 1KZ1A 3HXKA 3KZVA 3PW0A 4DJFC 2I76A 4J4TA 4EHBA 3IRUA 1HRKA 4JWMA 4CT5A 4MS4A 2ZRGA 2BHLA 1L4NA 4INZA 1GGKA 1Z2PX 4R65A 1HDXA 2C9OA 2HQOA 2ADFA 5ENVA 1SR8A 1MO3A 1YMVA 1XTJA 3MR2A 5CG1A 1NW3A 2EGHA 2AUNA 3JWGA 2B8EA 1A9RA 3Q7TA 1UOEA 2HDWA 3IHWA 2FPXA 1FLNA 2W43A 4NMMA 5G3ZA 1SXHA 2FPIA 4PLPA 3ETLA 4DQKA 2HA3A 2WP8J 4YMSA 2ZXIA 4EVRA 3DDUA 1UXOA 2JFWA 2IT1A 4TZKA 1J33A 2UXBB 4QU8A 2Z4TA 2GVDC 1HNXB 4MV4A 2BMEA 4YXWD 4OJMX 3ISDA 7MHTA 3QKWA 5F7XA 5GM1A 2BGUA 3GL9A 1S3IA 3LCRA 1T8SA 3TDNA 3IVAA 3QLJA 4B87A 3LY8A 1Q3UA 2FVXA 3BGOS 1UDRA 2R751 3OCYA 1ADGA 4BGUA 4ZK6A 2PU5A 2IV2X 3JQGA 4AMGA 2W2VA 4ZAXA 5A2QA 2OZPA 2B7CA 2FFBA 2GPJA 2YB4A 4DIOA 4MYDA 4ALJA 3DVSX 3DFIA 3PKIA 3JATA 1X0VA 4DUGA 2VHWA 1CZHA 2QYTA 1H85A 3CX7A 1L3UA 1OROA 3GLHB 2EW1A 2HF2A 4DSOA 1RRGA 2JI7A 5FLEX 4J9RA 3ZV3A 3R7AA 1V7CA 5C1OA 3KETA 4KTQA 2XPCA 4DTIA 1YF3A 7YASA 3DGFC 4YRDA 3IFSA 4CIBA 1HL7A 4CKWB 2QRLA 4EO4A 1IULA 4H31A 4Z53A 4AP5A 3Q5DA 1E5VA 4K87A 4R3WA 2I22A 4MGEA 5IJ0A 1NIJA 2N9UA 1GKLA 4HDRB 3HCDA 3SK0A 4JJKA 1TT7A 1HY3A 3QXXA 3HV2A 4KDCA 5G1OA 3QMMA 3WLOA 1SK8A 3O1LA 4MWZA 2QB1A 3QFSA 2XDQB 2VS1A 4IFEA 3K6SB 4YLGA 1V0JA 1ZK0A 3AR7A 2BFOA 4ZTBA 2YQEA 3IIJA 4X7PA 4LE2A 3GAZA 3QF7A 3P71T 4NEGA 3RYHA 4U6PA 4X24A 4TYNA 1IXKA 1J0EA 5JASA 3G1WA 2VBIA 3ZE2B 3AY6A 4URYR 2XTJA 1QH9A 1NBME 1JXQA 1LS1A 4R83A 2QLNA 2XMGA 4Q3DA 5JBIA 1Q0LA 5CVEA 3TG2A 1CDDA 1NMYA 2PX6A 2EFDB 5G1NA 2OBFA 3SJZA 3CEAA 4FR0A 3F3YA 3P4YA 4YJ2B 1NVKA 4TSFA 1L6RA 4BO2A 4FSHA 3QE0A 4F3CA 5BN1A 2J4CA 4GFJA 1KIMA 4IQWA 1JG1A 1KJQA 1QFMA 3EIEA 2O6KA 3THYB 3O31A 3D4IA 2AFHE 2MSWA 1T8YA 2LHTA 4HH4A 3F1KA 1WX1A 5J58A 2W6PA 3D2SA 3MS2A 1V9LA 4X5OA 2PLRA 3O3MB 1M1NA 1REQA 5DNEA 1HT1E 4FDTA 2BR4A 4RH0A 4B82A 1P33A 2JFGA 1BPXA 3T5LA 1MF7A 2DFNA 2GPYA 2GJKA 3C7DB 1OI7A 5HGJA 3EXG1 3FOAA 1KKMA 1WXWA 3UG6A 2KZMA 2EFCB 2ONJA 4YDQA 5C4GB 5A6SA 4JLSA 3LK7A 3OLXA 3CUYA 1N61A 4NNPA 5CM9C 1Q44A 4WQMA 3H5TA 3P2JA 3RJMA 3ZK7A 2DPLA 4OJ5A 2Z2JA 1N36B 2X42A 4B3SB 1WCV1 2JASA 3K8ZA 4B44A 4Z7JA 4PC1A 2F55A 4X00A 1TJNA 2V9ZA 3HVHA 4RSHA 4JHXA 2NO4A 1TU0A 4I4TA 4Q9AA 3DUFA 2YNMA 5SY9A 2RGBA 3QTBA 2OD9A 2OG2A 1KRHA 1SIJA 3EXEB 4XGRA 4MWEA 3P19A 3C6XA 4QOJA 4ND2A 3V9AA 2AW5A 4A3SA 4L5IA 4HXEB 4MITA 2JVKA 4KO1S 2J85A 3K9WA 4PFQA 1QYIA 2J3HA 2C88A 3HB1A 4ZZIA 3INTA 5LQSA 4FNAA 4PYOA 4YAIA 4RNNA 2C78A 3BHIA 2PR2A 4F5NA 3DW3X 5BSGA 4QW8A 3X2EA 1YK0A 1GWNA 4F1JA 3TSOA 2HFKA 2CNKA 4KQHA 2MU1A 1PX2A 4KL8S 3P45A 1EDDA 1HUOA 3OJFA 3O4HA 1C4XA 1VDMA 4NS1A 2F9LA 3FUXA 2F1JA 2W00A 2O8FB 1UUFA 2ZTSA 5KJEA 4RWEA 3RK1A 3G0BA 4JMLA 3EAQA 2B3TA 3DE5X 4URVR 1DMSA 1KFJB 4XQGA 3WB2A 4HDOB 5TPWB 1K9VF 2W3RA 4US9A 4OHPA 2Y1KA 5ITWA 3LZ6A 5A4IS 1NI3A 3HZZA 3CFYA 1S9FA 2WSMA 4O02B 1TK9A 3H17A 4TTAA 1V7ZA 4DIKA 5E7IA 1A4RA 4EO7A 1BGXT 4AUNA 1JW9B 2XVTA 3CVWA 2JEGA 2HT1A 1TLFA 1ZW6A 2VYFA 5CVUA 3GZTB 4IFTA 5CYFA 4DL6A 2GR9A 2H2IA 4FZLA 1GPAA 2NUPA 3OF2A 3WO0A 4BZXA 1TUGA 4AY6A 1R4ZA 4D57A 2XRMA 3EGWA 3MCUA 2FMFA 4U6NA 3G6XA 3AF5A 4L1KA 4LTNA 3AR2A 4RDXA 2P0AA 1GG9A 1D07A 4TTJA 3AJ8A 1ZKMA 5BXYA 2XLBA 3FPKA 4E6PA 2QTGA 4PY2A 3GC6A 1P1RA 4YRSA 2GBPA 4GXIA 2QARA 4LVUA 4WEOA 1KEZA 1LH0A 1LJUA 3HPOA 4QYSA 4MW4A 3QW4B 4YREA 3H2GA 3BJMA 4RPLA 2D6FA 1A88A 4ZAGA 3ZXXA 4FZ5A 3DAPA 4Q03A 5F5XA 1W73A 2QP9X 4O8CA 2FLNA 4XUSA 5JJKA 3BM5A 5KFEA 3OKCA 3HY4A 1ZQXA 3B1WA 3ZNOA 3ZZTA 5IXSA 2PL1A 3E7DA 4TKZA 3NNNA 4OFZA 3MLAA 3OJSA 2B8TA 5A04A 2YBDA 2QNIA 1ZO8A 1P31A 3RH6A 2HHWA 3SAHA 3NCTA 2W8KA 3PJGA 1JN0A 3PX3A 1F17A 2GEBA 5C34B 4FXOA 2ECOA 3TFOA 3WGZA 1ODLA 3NEPX 1RLMA 4TLAA 3TFRA 5F33A 3Q8QB 4TV8B 4FE7A 2G77B 1TZ2A 2MSCB 3LL4A 4Y6GB 3LOQA 5DVZA 2ZBQA 1WXEA 1ECLA 4FQ7A 5LLDA 2GNOA 4MWGA 2Y6VA 3DB1A 2R8EA 4BX3A 2OR3A 4B79A 4KXLA 2RCYA 3PB3A 1IL0A 2IZ7A 4AT1A 4H6PA 4PZZA 4WACA 1SUWA 4UEJA 3SC4A 4UHCA 1UKCA 4O3RA 3ZZUA 2WE7A 3KXIA 2EYUA 4RCVA 3IURA 5ANRB 1VXRA 4DLXA 1U2SA 4CMKA 4PNEA 3SSNA 2XAUA 2R48A 1B76A 3CC8A 1WD5A 1JKMA 1TPYA 4P3KA 2AH5A 4DABA 4EMUA 4U7PB 2H1LA 3DL0A 3B6MA 3KWFA 4A0QA 2LBPA 4UMEA 3JWPA 2CVQA 3ZY2A 1LZLA 1UDWA 1JQBA 2BFCB 4BNYA 1Q7GA 4GKBA 2WFLA 4I1UA 3TSCA 5JXHA 3VUEA 3BB4A 1LY1A 2GKSA 1F6DA 1F2UB 2E18A 1JU4A 3EDCA 1U1DA 1RBYA 2R1TA 4MXDA 4ZEXA 3FDFA 2UUAB 1YZYA 4BEJA 1OPRA 5I01A 1Z75A 1A7AA 3KHUA 5AXCA 4XE5A 4RQ7A 5TMDA 1Y3CE 2PUGA 4ZKEA 3LSTA 4XVQA 1EAMA 2XYPA 4FFBA 4OP2A 2H7CA 4MWCA 1JIJA 4INPA 1T1IA 2TRSB 5KYYB 1PWXA 1UBSB 4BTVA 4MKRA 3ROEA 1TM5E 2ZP1A 4ZYWA 3UFXA 2GZRA 1IQRA 2PZFA 2J3QA 4H0FA 4C0HA 3N3BC 3U4QA 2A1JA 3OOWA 2TMYA 1ZI6A 3HGQA 1P18A 3STWA 3BIFA 2AN4A 1KPHA 2P68A 1L5SA 4FJ2A 2FTKE 1NW6A 1C7EA 2EF1A 1OMOA 4GOJA 2XC9A 5AT1A 5BSHA 4LGVA 5AW3A 1ZAKA 2HWUA 4WUTA 5J63A 2PVCA 1RPNA 4WEQA 4QQNA 3M8SA 4N7BA 4M1YA 2V7UA 1HX7A 3ABZA 3GLUA 2FG5A 3FBWA 3KSBC 2VUIB 1J0AA 4Z4GA 3BE8A 3PENA 1N7JA 3KDPA 2W2KA 3TLJA 5IIIA 4YJ3B 1WSAA 2Z58A 3M6KA 1GTL1 3OEHD 3FOWA 5CT6A 4BEBA 4ARAA 2HNKA 1D9ZA 5CURA 3TLCA 1IBRA 5JSHA 1RZRD 2D0OB 2KLBA 1ZQVA 2PH3A 2V7TA 3ETJA 5KU7A 3W8EA 4C4SA 1Q7EA 1X7DA 2JRLA 1MO6A 2Q0HA 5KYTA 3W4JA 2PWZA 3JALB 2KNJA 2X8AA 1IH8A 3TTYA 2ZRBA 1NYQA 3IOYA 3QFFA 1M2EA 2FFRA 4M04A 3W3ZB 3AWIA 4EZ9A 3PFKA 1YA8A 4L8YA 1PEDA 1S7CA 2MSEB 3KK0A 3MFYA 3ZGVA 2QMQA 1PAUA 1NX6A 3WLAA 1P1IA 7ICLA 4Y8VA 1SZDA 3TQSA 5I5EA 3GJQA 5C53B 3AVQA 4P4SA 4B17A 5KOJB 5K3BA 1NFFA 2V7VA 3U40A 3PTLA 1NSFA 4E31A 1ZU4A 3P0IA 1KXZA 4M86A 5BVGA 3ED1A 3R3SA 4C76A 4KLSA 5BSFA 1A9QA 3D5EA 3SQXA 4ZVTA 2P6PA 2C4UA 3ICWA 4LNUA 4LUCA 3GCGA 4MV5A 3JCZA 2GASA 4M1TA 2D00A 3N70A 2EJBA 2YHIB 3PT5A 1A27A 2GF9A 1VJ5A 4NHEA 2FSSA 4IQGA 3M4YA 4FMCF 4CKZA 4WJ3B 1J22A 3CW2A 3X1WA 3PW4A 1KJJA 1BH2A 2FFQA 1T3NA 4JBHA 2NUBA 4OJ6A 1P39A 4Q4AA 4B2IA 4MOWA 1NUAA 2FG7C 1E3MA 4RZSA 3QYPA 1DKMA 1RXCA 1FYVA 1GU0A 1MW8X 4DANA 5DG7A 3T7TA 1HDCA 3MWKA 1XN4A 3QYAA 4B3GA 2GZMA 2JV3A 2BQRA 3ROZA 3OETA 2GNAA 5CNKA 3ST7A 1UDBA 4M37A 4FHDA 5IKXA 3GCXA 4PQGA 10MHA 1KS2A 1XAIA 3E9NA 1Y6JA 2E6KA 2ORIA 3Q8KA 1Y9ZA 2FMHA 4JNKA 3EFBA 4OB6A 5KYVA 5D51S 4R0MA 2GCNA 2WZDA 5BUSA 4CTOA 4MUXA 3RTBA 2O5VA 4K6CA 3U6KA 2KE5A 1UFKA 2AJ8A 3VR5A 3CLRD 1NPTO 5FT9A 5EFZA 4ETIA 3C6YA 3N6VA 5ICFA 4EATA 2K5UA 1W0KD 1HM5A 5REQA 2C29D 3I04M 1NY6A 3LQQA 1W4CA 3O92A 1SAYA 1ACJA 2WAYA 2J6TA 1Y6ZA 1QAMA 4I27A 3B3AA 2HRBA 2RC5A 1TQDA 4F0JA 4KHZA 1H3NA 2ZYVX 2IUSA 3RS3A 4EG5A 5FBZA 4V1CB 1E69A 4JSTA 4CN8A 4G2NA 2UZAA 3AI2A 4XZ3A 4GI7A 1FJHA 3KAKA 2VSFA 1T8UA 3EPKA 1A04A 1MTOA 3O91A 1N1MA 2ZBUA 1PJCA 2XF2A 2DULA 3VDMA 4ZT4A 3OWXA 2VR1A 4WMLA 3PGA1 4HPWA 2VJAA 1RC1A 3MJEA 4KLNA 5LZ2A 2XY5A 4F84A 3GLFE 3MR3A 4MQFB 3AUXA 4DV2B 1Z56C 2ASLA 1FEZA 4AG6A 3I2IA 2OHHA 2AVDA 3V4RA 4YG2A 2WICA 1MMFB 3PXGA 5KT5A 1ZK2A 3DV0B 1H0KA 1Z4MA 8ICMA 4P7FA 5SICE 3AVTA 2K89A 4NZMA 2W58A 4B3CA 4FE4A 5K4GA 2RGYA 3DFZA 3OZWA 4Q7KA 3OBBA 2EOAA 5TZVA 3HNOA 2C9CA 1GPYA 4YRLA 3GD7A 3DPSA 1FY2A 2PRYA 3C6QA 5ALOA 1H05A 1Q19A 1NG9A 4DN6A 1W2GA 5LMCA 1L7NA 5L1KA 3PWKA 3IKMB 1UP6A 4LXIA 3ODPA 5DLPA 1IPHA 1G5TA 2JVIA 2G28A 3KWLA 2O8VA 3D8TA 4O3MA 1W5BA 2BD0A 1F3OA 4C9BA 3QXHA 3IAM6 1EA5A 4X95A 3EFOB 1TJ4A 3OGUA 1TYEB 3QHPA 4BNDB 3G82C 4M8KA 3VO1A 3GNSA 4JP2A 1G3RA 3T7DA 1KTVA 5CFRA 4ZT2A 3F5EA 2J9XB 4V3CA 3H0LB 4Q4JB 1GDDA 4LKOA 2C07A 3URMA 3VPXA 3FVVA 2QG9A 4YALA 3L82B 1PGNA 1TEXA 4NYMR 4IDFA 2C00A 5BO5A 4WBXC 1L3VA 3BKWA 4NBUA 5DTRA 3PBKA 4GQIA 2Z9BA 3RSSA 1SL0A 3CJQA 4AMVA 2KZZA 2B9EA 3CT4A 2PSEA 4E21A 3TAXA 1U0RA 5H16A 4KDEA 1J7KA 2NSHA 5IEBA 5JNRA 3K70B 3OPQA 5IFKA 4P2BA 2FDCA 1NBOA 1Z5ZA 4HYTA 2MUTB 4YRNA 1CUKA 3PHBE 5EN4A 4GH5A 3EGEA 4L15A 1G9TA 1M6VB 1Q7RA 4B8WA 4X41A 2HREA 4IAOA 4G1UC 4XGIA 2JZCA 3OEWA 1G4HA 4KYUA 4B3RB 4UTXA 1E4EB 5KTQA 4PRZA 1YVEI 2P0EA 1SZHA 2EJWA 1LC3A 1ZD1A 2XKAA 4HB2A 4FUQA 1Z6TA 4KAXA 3H5VA 1VOTA 5JJLA 3ZU2A 3QZ7A 2RI0A 3LPDA 1N7HA 1LPMA 4YV2A 3VU9B 3S8EA 4AF7A 2FN8A 4GL2A 1TKRA 3N53A 4YAOA 1S77D 1RAFA 2PI5A 3DWIA 2VYCA 4DIDA 4PG6A 1HIWA 1TQ8A 2YNMC 2QENA 2IX9A 2JHDA 4BLTA 3RH4A 3PQEA 1GV0A 3EGDA 2P2CA 2EH9A 2P2GA 4GR4A 4IL6U 4O0LA 4HDQB 4ZYUA 4K26A 3HC7A 3WLKX 1M34B 3HUTA 1UMCA 5BWLA 2M1ZA 4REQB 4HDMB 4N3AA 2P77A 4M1QA 1I4TD 4P7JA 5KI6A 5IDYA 4O4JB 2ZB3A 2IIQA 2Q6LA 4J03A 3L0BA 3MWYW 2YVUA 1B15A 3RAFC 1FC0A 4HQ0A 1PR9A 2F4NA 5AJHA 2OBNA 4G9BA 3RFUA 3CUVA 4J0JA 2VT2A 2BDPA 2W2PA 5DZSA 1Q1BA 3LBYA 5EVCA 2PS3A 5ED0A 4LXHA 4YP7A 3F6SA 3WHKA 2P9BA 2OY0A 3GXBA 5EJ8A 4HVTA 3LNCA 1RS0A 1DPGA 4QO8A 1D2AA 2DQ4A 5TPWA 1IB6A 4D3ZA 4JKYA 4YQYA 5FX2A 4J4HA 3ILYA 3JD4A 1RE0A 2C1EA 1OWNA 1PG5A 3N5CA 3AONB 2RONA 4JUCA 1JFSA 1A4XA 2WMYA 3TBFA 3VMMA 3VA7A 1T3GA 5HCUA 1FLVA 2RBKA 3KLBA 3S68A 4R2HA 2IOFK 4UE2A 4EGQA 1J0DA 3VYTB 4KCGA 4WN9B 4G2TA 3U7QB 2G04A 1GJRA 1DJPA 3QOWA 1FU4A 2C7BA 2F1OA 2NUAA 3B48A 4ATNA 5JAHA 1XQ9A 3USES 2NPFA 3O4VA 4QPDA 5BMOA 1XD8A 1GZ5A 3IAUA 3SIRA 3FPGA 5FTLA 5KQSA 2Z2YA 4KWIA 1UEXC 1AVTA 3WDLA 4DWOA 1Z2DA 4D3FA 5TC4A 1YDMA 4HNVA 2YCLA 2AQ0A 4IH1A 2D6FC 1ES9A 2JBWA 1WXDA 2OQIA 1U4BA 4G1FA 1KI1A 3UJ7A 3W3AD 3UYLA 5ES4B 2I9GA 4RABA 4L78A 5JV5A 5KO2A 4AJNA 1N2BA 2AG8A 1G8KA 1PP4A 3ESCA 1U7OA 3GLQA 2VDJA 4RPJA 2ODTX 3UATA 3D7KA 1EUDB 4R9RA 5DGAA 3N7TA 2Q7OE 2WFZA 1BZYA 4MRMA 1EVIA 5JQGF 1UF9A 4QWBA 1RZVA 3BCRA 5EZYB 1YTLA 1UKBA 2DFTA 3OOSA 3EB9A 1RI4A 4CCYB 3AFGA 1E20A 4F3YA 1I94B 4RLHA 2C0QA 1KH2A 2QUAA 3MFQA 4ACAA 4I46A 1XG5A 2C5GA 3T5AA 1CJVC 4GVPA 4C4ZA 4AP9A 1X0XA 4NXNB 4P7KA 4KN8A 3FLAA 4RT2A 3VISA 4IQUA 1RQPA 1PJ8A 2VJBA 3HHEA 2LXNA 3NETA 2JIMA 3NXSA 3ZHTA 1QONA 3DWGA 3FCSB 3CNHA 4HEA1 4Y6OA 2B3DA 3UCEA 1HQDA 2G1AA 1FFVA 4MW5A 5LFAA 4BZPA 3M6ZA 4IVQA 4IOKA 3FHLA 3HL4A 4ZMRA 3V7KA 2DETA 4HZIA 1PEYA 4U8GA 2AI2A 5T64A 4YNBA 4RTPA 4YAGA 4RNDB 3LVQE 3N8KA 2MAXA 3EOBI 2RH9B 1VECA 3QEAZ 1HEKA 1E94E 2WVJA 5L7WA 1PZGA 3IBTA 4OSOA 5FOWA 9ICRA 2OYYA 3GFRA 5SZJA 2ADMA 2XNDA 2BCGY 5HXAA 1GSHA 2BFCA 1FDTA 4AZSA 1FUIA 3BXOA 1ZJZA 3V7UA 2WIFA 2P3LA 4HSGA 4E2WA 1YQUA 4BXOA 1NVVR 4NG4A 1NJ1A 1RI2A 3V4SA 3PQ2A 4Q18A 4YDSA 4Z86A 4TMWA 3K6KA 4Q8FA 3AHHA 4BPBA 3ZD8A 3OZVA 3WU2U 1ZGGA 1V8ZA 5FNVB 4Q9IA 2QQGA 2M6KA 2PD6A 4AC9A 3CE9A 4FT2A 3IKTA 4IEEA 1QHNA 3LVVA 2EG5A 2SBTA 1BN7A 3PXXA 1P9RA 2IXTA 3PYLA 5J2JA 4URUR 1GIAA 1PUZA 3SFZA 5A7GA 4ROSA 3BS5A 4JGGA 3ZWVA 5TQVA 1GUAA 4HN9A 2GWRA 1A9YA 3LUJA 1S01A 1IG3A 4P0PB 1X42A 2W70A 2AMJA 1BCRA 4E14A 4CM9D 4E13A 4IOMA 3ZGZA 4DRZA 1AH2A 1NATA 3HFSA 3RSCA 4UEKA 1E3WA 3IUYA 4Z9FA 1PT5A 3TZBA 3OCCA 4N4AA 5ALIA 3LY9A 2UZ0A 3WZLA 3WWZA 3O75A 5H02A 1Q50A 1VJTA 3TL3A 2LI6A 3KE8A 3Q8WA 1DUIA 2IE8A 4FSXA 4ENQA 2NO5A 5EP4A 4HFMA 1DDIA 3L4KA 3W6UA 3IO3A 2IUUA 3ZIUA 3ZX4A 1Y7HA 1EESA 3UWMA 3NTRA 2R4TA 4MQUA 2IHBA 3C3KA 4IR9A 4MO2A 4YY3B 2YFHA 5H82A 3LBFA 3DM9B 2VYVD 5AW5A 2CUTA 2EGUA 3DLHA 2MIIA 4OM7A 3ZGXA 1GPJA 2G5HB 1OBHA 2PKXA 5D7BA 2GD0A 4BRZA 1FQOA 2P4EA 2UXCB 2Y27A 3JXEA 1HMYA 5AVZA 4MPRA 5I4IA 1UQTA 1OH6A 1QNLA 3NT2A 4HUQB 4G9GA 1Z0KA 3ICPA 1XKLA 3RVSA 1YGYA 2X2EA 1I4OA 2VPZA 2ASJA 2UYOA 3KQNA 4MVJA 4NYIR 2PIDA 4QZIA 2WV9A 1HURA 4KNWA 3S2GA 2Q4DA 3Q7IA 5JS2A 1NXXA 4MFAA 1D8LA 2FZWA 3K9GA 1J42A 5DIZA 1ORDA 3VZRA 2HBZA 4DL3A 5KOJA 3PC7A 1U1IA 4OKIA 1JE1A 4M2YA 3N7UA 4FW9A 4YECA 4MKZA 2XTMA 4IJ5A 3SIWA 4TURA 3LT5A 3VOAA 4AJJA 1C8LA 2P11A 2QT1A 4M87A 3Q9NA 4A2PA 4H18A 3CW2C 1MJHA 3FW1A 2OV6A 5HK9A 3M6WA 2X8BA 3DYBA 1Y0BA 5LC1A 4BEVA 4BX9C 2AD1A 2AN1A 1Z25A 2PM8A 5K3CA 1DRWA 2YWRA 4G4SP 2ACEA 2DP4E 3BYZA 1JB1A 4KLEA 4OXKA 1SXDA 3UA3A 4R6XA 1TUIA 5B4UA 5HSGA 1QDUA 4F38A 4ZHQA 1ACMA 1P5ZB 4AM8A 4TMTA 3FDIA 1KWGA 5DBGA 4RQMA 2FSIA 1E4YA 5F1PA 421PA 2AZ4A 2P2ZA 1E3IA 4OCZA 1K86A 4N6GA 2R8RA 4BLSA 1QQBA 3F7NA 4YAJA 1ZQ1A 4FFPA 2CFOA 1G5FA 3SOZA 3T4UA 4HWTA 2WNHA 1NXQA 4CQJA 3QEKA 5AM5A 4DLGA 3G8YA 5FUWA 3HJUA 4HEHA 2FEPA 1NK0A 4CE6A 3EPHA 2JI9A 2X1LA 1MGOA 5BMVB 3N2EA 3U3OA 5I4KA 3FVRA 3IIKA 4EENA 3U19A 5IRCD 1TYBE 3U61B 3PSIA 2PZAA 3VAAA 3VO8A 3HDJA 5HBGA 3BH6A 2P78A 3F8TA 4M21A 3D2QA 2YN2A 3OO1A 3I53A 3RFTA 1WPGA 5JIBA 2EFEB 2O3TA 1JEJA 1N57A 4BE4A 3OQVA 3BZUA 2AUTA 2DBRA 4GI2A 3NHLA 1Q7BA 3OFJA 2VJCA 4M89A 2FMSA 1NVAA 5I9BA 3DLIA 1C0PA 1TIKA 5I3ZA 2CJYA 4M8IA 3K2IA 1EP1B 4LX8A 3AESB 3LHSA 2ZWAA 2GO7A 5AM2A 4HBGA 2D1SA 4E94A 3L7BA 4HWOA 2A0KA 4PAQA 3JRXA 3IVCA 1GL3A 1VB3A 3SLKA 4ER6A 1U1FA 5DTMA 3X1ZA 3V4OA 2WC1A 2FCAA 1XDGA 2XJ4A 5EJMA 3ZWMA 3IAEA 1OXXK 4FBTA 2C5HA 3GPLA 3ZW9A 1U5BB 4EA8A 2Z8XA 1PEAA 4UUQA 3TB4A 4N1AA 2KM1A 4EELA 4EI8A 1K88A 5B2ZA 5TEVA 2O19A 1Z6XA 2YY6A 2FN3A 2JH9A 1CULC 2YJ6A 4WOPA 3G2KA 2G0TA 1A8IA 4QIWC 3GGSA 3OZAA 1DBPA 4PLZA 1R0LA 4YP9A 2FJUA 5EJ2A 1E0JA 4WJLA 3ABRB 2Q3LA 3NOVA 5J0TA 2AQKA 5K6AC 3DXZA 1ZVVA 1R6UA 3DV0A 3EWIA 4ESEA 1E3DA 2JCSA 2XQKA 2BOVA 2HI0A 3JD3A 3ZDZB 1IJBA 4UB8U 3BQ2A 1PSWA 4KMOA 4BMYA 1OD6A 1G7TA 3ZDCA 3OJUA 1KAQA 1BDBA 3IPXA 3AW8A 3P9YA 4NMXB 3DOJA 3C2MA 1FO4A 3DDNA 1FFXA 2R5WA 3SIXA 4M83A 2EV9A 1RHKA 2V7QD 3B53X 1MDFA 1GPNA 2BGLA 4PVDA 4PHCA 2ZYWX 3PPXA 5J2UA 2K2WA 5I7SA 1E64A 3LYHA 2X0EA 4B43A 3CNEA 5DTQA 3T0GA 1QS0A 3TEJA 3L7DA 3AOEA 3QX8A 2R6FA 4RQTA 2HU8A 4EZBA 3CZ4A 1NYTA 4ARVA 1Z5OA 1Z83A 3P9XA 4F9TA 5A03A 5ADHA 3AM9A 3DZHA 1Q3KA 4C6HA 4D8XA 1O94D 3I4LA 3HCRA 3W8FA 4ITRC 3SEQA 3OUZA 4Q4JA 2GLXA 4X92A 2GEKA 3A9UA 1IIRA 1P2GA 2A0UA 3EGXA 2VAWA 2Q6VA 1SRRA 1EFDN 4Y1RB 1NNSA 4MWDA 4A10A 4R63A 4QRDA 4KWHA 4WOBA 3H8WA 5A71A 3QU4A 3E27A 2EKQA 1NUPA 4F4UA 2ZBPA 1QFJA 2VZ8A 1X7XA 4G8JA 3C48A 4YN3A 4YCMA 2UYYA 4Z6EA 4ZXFA 4H4DA 3H2SA 2JB9A 2QJTA 3I6BA 2P69A 2L69A 1Z0DA 2IWRA 1MRZA 5KSZA 1GRNA 1I1OA 1L5QA 1RC0A 1LVUA 2IP4A 6YASA 2NQTA 1NXTA 4MEJA 1N5LA 2YWCA 4L9AA 3PFHA 5T14A 3T5MA 1HFKA 1BPYA 2CXPA 4R98A 1ZIXA 4FOLA 1P1KA 1M2GA 5CEFA 4Y2GA 1Y33E 5JT1A 2NAFA 4EY4A 4FZVA 3AVOA 4ODIA 1JLMA 1KZ9A 2PD4A 4QZ8A 3DQZA 2RDIA 1V1RB 4EMSA 4HSEA 4IR7A 3BAZA 5JC1A 5JAIA 3U2QA 4CV3A 4CPDA 1JA0A 3LL7A 4WK2B 2F9FA 4ABYA 4QUJA 2VJQA 1F1BA 4Q4LA 4XWGA 3K20A 1VIMA 2EP7A 4GPBA 1X2BA 4LVCA 3LDHA 1NLUA 2AIRA 5ADUS 1KTIA 3ZPXA 2HV8A 1DV2A 4E5YA 1SL2A 3NDBB 5FFMA 3RB0A 4ZQGA 4EX7A 4HDMA 4FHEA 3LK9A 3GLGB 3BH7A 3FDJA 1F38A 1ZCBA 1VA5A 1XSLA 5CLQA 9ICXA 2PYZA 3G3EA 1GUBA 4LRXA 2NUTB 2H2FA 4J75A 5TMEA 1JBKA 3OUUA 1D9XA 2A1TS 3QBEA 5T6MA 5KWIA 4RVUA 5ARDA 3MLBA 1Y5MA 5K3OA 3NUQA 3BWXA 4WZAE 1M6WA 5I6DA 2GSDA 2IBTA 5CIYA 3EMBA 1M2VA 4B2LA 3K0AA 4W4TA 4Q82A 4RZUA 3T1VA 4YX9A 3EEQA 1M33A 1JZQA 2PLAA 3N8GA 1Y4UA 4I6JA 3KVRA 4GM1A 3G2QA 1QSGA 4D81A 3WK8A 2GN9A 2JAPA 1TZCA 3O0FA 3HO1A 7ICNA 4H1HA 2ESEA 4CKEA 2RC6A 3C5EA 4PHTA 4CG0A 1TA9A 4U7JA 4D42A 1CJBA 3SFVA 5JNWA 3W5HA 1W85A 2PNJA 3FR8A 1OQAA 2KJ9A 1DC8A 1HXHA 2NXJA 4HQOA 2R8PA 4X0EA 5ALPA 1QGZA 4B5LA 3CEHA 2K7FA 2EFHB 3MJSA 2ON6A 2EQ5A 3RNLA 1O9HA 3LRXA 3I3OA 4QBGB 3ZK9A 3P2MA 1KMCA 5KSWB 3ZHBA 1ISIA 3D2BA 3D43A 3WNZA 3RJKA 1U3VA 4QZDA 4Y2PA 9ICHA 3O03A 3MPOA 3B12A 2P79A 4DLWA 2XWSA 4BLWA 3SMQA 4I3HA 4MW2A 3WGMA 4YR9A 3UN1A 3DBIA 3SC2B 4NL4H 3MBYA 4BV9A 1KETA 4YWHA 4XRHA 4DBLE 3T9CA 2G9RA 3ER9A 2HSDA 2DEUA 3TIXB 5FR2A 1C0EA 4NM1A 3F9CA 3IVGA 3PEWA 2OO5C 4MQ4A 1EDZA 1Z16A 4IS2A 5KG6A 4W1SA 5C1BA 2QD3A 4CQLA 2AE1A 1C14A 1Z1BA 5L3QB 4POOA 2HIMA 4QAJA 3QFTA 3STUA 2WUDA 3H5LA 5IT0A 2GQ0A 4XYMA 4KE6A 3S1SA 3DP7A 4DKXA 4LE1A 5JRZA 2PX8A 4IPTA 5K4LA 1ESCA 1Z88A 1OWMA 1H6DA 1K6IA 3NW9A 4ND7A 2ZPUA 3PY8A 3MMNA 9ICFA 4LDAA 3K2QA 2CNOA 5FH9A 2UXDB 4M0LA 1HUZA 1TUBB 2B2CA 3NWPA 2G4CA 4N3BA 2W2TA 2VIIA 4GL4A 1KFDA 2ZCJA 1G64A 3ZBUA 4GZ6A 3D8BA 1PJRA 4BRSA 2V4UA 1QFYA 5DRTA 1E4VA 1JKIA 1QHIA 1IG6A 2J9FB 2YZ7A 3ROGA 5IM5A 3CWQA 3AR6A 2VQ3A 2RB4A 3H11B 4BO6A 1USUA 1K06A 1T3LA 2H18A 3MJHA 1HT3A 4AKTA 1L2TA 3L0ZA 2ZR9A 4G5YA 4IXDA 1R10A 2JZOA 4MDHA 1V38A 3SG0A 2P3SA 2IU0A 3RAQA 2H3FA 4WINA 2PNFA 1F8UA 1LDGA 4M1SA 2P66A 2ZSHA 2PX5A 1QYCA 1H4VB 1E2HA 4YC7A 4LFCB 2W0SA 2ZRFA 4RA9A 1N2JA 1HV8A 3Q6NA 2XB8A 3PQ8A 1SUAA 2UDPA 2OZEA 2WWRA 2FG6C 3NAGA 3QVTA 4IDPA 2Y9UA 1ULUA 2V55B 4QNNA 4YRMA 5JJIA 2ERXA 1J9ZA 2KN7A 3L1UA 1WUKS 3GVIA 1NE2A 2Y77A 4CG1A 4AZ0B 3OHPA 5TVGA 3DEJA 1XZQA 3W5BA 2O23A 3R0ZA 1UZNA 1DG3A 1EK2A 2IH4A 3OE7D 3R1IA 1PVVA 1I4DD 3U9SA 3NPAA 5I7UA 5KFLA 1UXIA 1ZN8A 1DJLA 3KQUA 2LYBA 4LK2A 2WF5A 3D6MA 2C2YA 3RJJA 1Q2UA 3CF6R 1RM3A 2X7HA 1ZQMA 1XMSA 2Z08A 3F7OA 3IKVA 1KU0A 1AY0A 1KZHA 4Y1EA 4CQMB 1IAVA 2BTQB 4W8OA 1SVIA 3NV9A 3I6IA 3QE2A 4FDLA 1ZQJA 4PPXA 4JT8A 4W5RA 1SIBE 3AF6A 1FLAA 2X6QA 3L49A 2XZLA 3I32A 2BGTA 4RKYA 5IIJA 1DG1G 2AR0A 2HCJB 2XVXA 3WQQA 3OMWA 1FZQA 1YV9A 4I6EA 3E4DA 5IYZA 3BB3A 2JLBA 4IC9A 5MGBA 3T38A 1A6SA 5ENZA 4EB6B 4IICA 4C6TB 2QX9A 3BDAA 1T13A 1WRBA 5DQHA 4IDHA 3WWEA 3GO4A 1RHJA 5CTJA 2ALZA 3CW9A 1Z06A 3A4VA 1SG9A 4JIGA 3VJLA 1VL0A 2JCGA 1ZOPA 3NG1A 2QZSA 4G25A 3G8BA 5DHFA 4E1VA 5A3RA 4JB3A 4D44A 1DGJA 2VAVA 5JMTA 2WTFA 4IS7A 4LJ5A 1WUTA 4UBLA 3SDSA 4MEXA 1YR1A 4PLGA 3PTAA 3GPDG 4GDMA 1C3OA 4TUSA 1E5LA 2FRDA 1EM8B 4GXRA 1L5YA 3A0RB 4DIUA 1M1XB 2VXBA 3AR9A 5K3FB 2FLPA 2BH9A 1KO8A 3WXMA 1GR0A 2PFQA 4E5DA 2WB4A 4EYOA 2OPBA 3ZQ6A 3OSUA 1XTKA 1XEWX 5ALNA 5JWHA 4JA2A 1HE1C 2WJYA 3WX0A 2EF0A 4OQQA 2DHDA 1ZA1A 4RFLA 3A1FA 4B9LA 4GEKA 1U2TA 3H19A 3ET4A 3IS3A 1ZQIA 4ZOCA 2X9LA 1SKYB 1GRCA 3WDSA 1RLJA 3TPZA 4MYCA 4DLEA 3SBDA 1FMCA 2QX8A 3TPFA 1ECWA 3MRSA 4G8DA 2ZRCA 2H5JA 1I24A 2WI8A 4KYTA 3W5IA 3SVTA 1A9ZA 2C2BA 5E4TA 2A67A 5FKJA 2UV8A 3CCCA 2J46A 5IDXA 4ZVQA 5CB4B 3DW1X 4UHDA 1ULBA 3EJWA 4WY5A 4UM7A 3LVBA 4I4LA 5BNIA 2ZJ6A 4XARA 2MYPA 2VHQA 5E6SA 4BN4A 1SKMA 1TFRA 1P4RA 3DHEA 1BX3A 4C4RA 4MLDA 5AXBA 3WGIA 1S8FA 4TT3D 3SC3A 3Q9LA 4FGLA 1HUQA 1ZQ1C 5LB4A 2AWNA 2V5VA 4NCNA 4R64A 1GSIA 3QKSA 4QJIA 3JYLA 1XXHB 1G17A 9ICSA 1NN0A 2WKWA 1SN7A 3GQCA 4QQ8A 4KPUB 4F8EA 2AOWA 1V5EA 1PI3A 3G13A 5HDBB 2YZGA 1SGGA 1ED1A 4LMAA 5CNIA 4PWYA 1YL6A 1Q1QA 2YS6A 2VHJA 5FFFA 3HKEA 2RCNA 1TW2A 1DV1A 5CDYA 2BSXA 3MINB 3Q87B 2AJBA 2IQ5A 3GCZA 2VKQA 2FSVC 3R7WB 1J5EB 4JQYA 5LLSA 2I8CA 2IC5A 2WHYA 1T8WA 1JH8A 1MB4A 3AKDA 3HABA 2PMCA 4PLFA 3NNDA 1E89A 2QP4A 1D9FA 2XMQA 5TJ9A 2XMSA 2H07A 2H06A 3ZY6A 1HDIA 2OHGA 3FB4A 2A5YB 2BY4A 5FLXA 1KK3A 1W0CA 4KRFA 2A14A 2IGTA 1K7FB 1Z3CA 4G84A 4KMUA 3VSCA 1MQ2A 4KN9S 4MRPA 2JD2A 3L8GA 2Y0CA 2ZZMA 3N7AA 1KWKA 2UZIR 1ZWLA 5HOQA 4EWLA 3V5NA 2ZYGA 3E3NA 4MVJI 2QTFA 4BNKA 1CF9A 3V34A 4MQBA 1CUDA 5F7JA 3SX0A 2NO6A 2VL7A 4BO3A 1Y5LA 4ZWNA 5IABA 3KAPA 2LNDA 4LI0A 4ECUA 3EVFA 5TS2A 2IKSA 3NIWA 4G0YA 3D7SA 5FPPA 2I3DA 4GS5A 5ALWA 5ERYA 1D8AA 2AWOA 3U80A 4NCBA 3LIIA 1QLHA 2QSYA 1VCHA 1HFEL 2GXUA 4GAEA 2Y9TA 5J4KA 4MVYA 3GDFA 3ASYA 3FIJA 1K08A 2OILA 2VSYA 5C35A 2NU9A 1PJ3A 2WILA 3AF2A 2I2AA 2BR5A 1OZGA 1RAAA 1P1CA 4CKBB 2I6GA 3L6OO 1VA4A 2ZG6A 3SZOA 2W6MA 4WOCA 3AOEC 3C87A 3F4KA 5JVDB 5TGTA 2A3VA 3WV5A 1G19A 3COYA 4D1YA 1JHVA 4OF4A 3SPXA 4YAUA 1JAHA 4ILKA 5FUBA 4JJ6A 1S4QA 5C52B 2HXGA 2C2GA 1OH8A 1PZMA 4BAZA 1DTWB 3RHSA 4YXJA 2FX2A 1N77A 5BWOA 1Z74A 1JEAA 2VP3A 4MPTA 3H1PA 3VTKA 3DAFA 1PGQA 4I5DA 2X0JA 2HW8A 1N8KA 1BHO1 1FQJA 3G0IA 1IONA 1CY0A 3Q0IA 2JANA 4GD3Q 1LLFA 3OJWA 2P9GA 3IESA 2ZDGA 3U0BA 1QBKC 4WE3A 4TYYA 4OD0A 1GZDA 3K70C 1X8LA 3I5UA 1N6OA 2Q4OA 1Z38A 3FFBA 3KXDA 1XQ6A 3PWSA 3PE4A 4WOJA 3QVOA 2FZCA 2QP3A 4OI2A 2C9ZA 1FNMA 4OHFA 4ED3A 1MH9A 1TAHA 3DA8A 1ZU5A 4OP3A 3ZE1B 2R86A 3VMFA 3G9TA 1MOSA 4R2IA 3PR2B 2EWWA 1WUHS 2XCIA 1Y82A 4AZTA 1G6HA 4WXRA 3ZI7A 1FLDA 2FLWA 4M4SA 2PUEA 1BMDA 3KALA 2OT3B 1GAWA 1RYUA 2ZRDA 4N7JA 5HE9A 3BFXA 3DPUA 4QGHA 5SY6A 2OGWA 4LC0A 3PSTA 5I7OA 3Q2IA 1FRQA 4NWIA 3B0XA 3SX4A 1VZ3A 2C8VA 4AUEA 2ILTA 4QTYA 7ADHA 1XDZA 3O3NB 4AO7A 3O1JC 4UVHA 2BJWA 5K0NA 4RQ8A 1RXIA 3KEFA 1GG5A 2B1RA 1PW7A 4TV9F 2F1KA 4NOKA 3KT6A 4URZR 4CCWA 3R6WA 3N0RA 1QX4A 1E2IA 3N07A 3EY4A 3ROQA 1JLKA 1E7MA 3K0BA 3DKRA 1NYLA 4D79A 4J9MA 4IJUA 2TYSB 5A0LA 1DBWA 1LPNA 2HMVA 3ANYB 1MV8A 1XDSA 1PQPA 1L5LA 4BX9A 1MAWA 3QE9Y 1WL8A 1JIUA 4IQFA 1YZ7A 1EFLA 1I2BA 2FSPA 1QGED 4EGJA 3K0HA 4F04A 1WU7A 5F76A 4A82A 3TFWA 1QAQA 4XH9B 2NUTA 4JUAA 4BV8A 3IQFA 4QFMA 4QTZA 4IQ0A 1XDUA 3DT6A 3WRVA 2IUFA 4P5EA 1VJRA 2QTVB 2PE5A 2PSDA 3WIDA 2PUHA 3B1FA 4K03A 3UPDA 2NZYA 2I2DA 3R4VA 2YWHA 4EUNA 4L07A 2PEZA 1WDLA 3QRWA 1M8PA 3A06A 2W55A 1UIRA 3GJTA 1EDBA 3LNTA 1ETHA 4ACOA 3PA6A 4JVOA 3KOXA 4JQOA 3A6GA 721PA 1B93A 5JFOA 1NYRA 2R79A 1Z19A 3ASZA 4NYJR 4D4KA 2OXOA 1C7YA 4P2HA 5THQA 1N75A 2EGGA 4LE0A 2H1HA 5AVKA 5AKKA 4O9MA 1RACA 1FJ2A 5FJIA 1FRNA 5A06A 4ZCLA 1YA6A 3Q11A 2HDOA 4IGKA 3M6VA 3NYWA 2SECE 1O3YA 1X15A 4UBJA 4NU0A 3CVVA 3C3MA 4GQBA 2QZJA 1QKIA 3KVYA 4YRPA 2JGAA 4KTVE 4I1PA 1NZJA 2LIVA 2XV1A 2GN2A 4ROTA 4RC9A 5FWAA 2C7PA 2ODGA 2FZLA 2KD1A 5CLJA 4LGYA 3GLHA 1PU2A 1XFAA 4NLKA 3M7IA 4EJSB 3UANA 1BKSB 1ZHHA 1RKBA 3SC2A 5K2MA 4QTXA 4P84A 4JJIA 3L7CA 4CM5A 3IAFA 1YDFA 1U9CA 5IN5A 1RVV1 4CKWA 5HHTA 4QUIA 2OK8A 1PJBA 3ZVMA 5K6AA 3CLKA 1LTHR 4UPEA 1M6NA 3I9NA 3QJ5A 1UPCA 4PQRA 2VHEA 121PA 4B7XA 5DT2A 4HDRA 5AMXA 2OL4A 3QOFA 1IHDA 1S3GA 5G4KB 1NQWA 4N12A 5T7BA 3OZSA 4K8OA 3F5FA 4CVNA 1G98A 2XE6A 3OC0A 1JR3E 5L3QA 3EXAA 3REOA 2ORYA 2XDQA 2O07A 5TMBA 4DSEA 4B7ZA 4K8RB 4WFQA 2FUG6 1DHTA 3NTXA 5G0SA 3FA2A 1AHNA 2DUWA 4UDNA 3TECE 1UPFA 3K6SA 2AFIE 2VEOA 2VJNA 3TTUA 3THWB 3BTUA 1JG2A 3PXAA 2I6QA 1DL5A 1DJMA 2QMUA 3UY4A 1AKNA 1CK4A 4H0NA 3U60B 2N1BA 1GGFA 3GJRA 1YZKA 1RD4A 5G5GA 2AGQA 2I7XA 2IYPA 4CN9A 1ZH4A 3TW8B 3DZBA 4GP9A 1SV4A 1Q83A 4JBLA 5FL7A 2OHXA 2GCPA 1V7QA 2BQ3A 4NZOA 2KICA 1JSLA 4IEIA 1G8YA 2KEYA 1Y3DE 3AVPA 1KP9A 2D06A 3ZDBA 1BNPA 4K0RA 4YJ2A 3MCAA 2Q1TA 3KHLA 3B7PA 5KWVA 3U9TA 2QEQA 3NP9A 4IY1A 4KPFC 2P2DA 8ICSA 3J7TA 2Y67A 2P2LA 1DT3A 4N9WA 1N62A 2Z9CA 2BBSA 3CKLA 3THYA 4FYKA 4FZJA 2YXPX 2ACVA 3D7RA 4BU1A 4MJ7A 1ZCZA 4GBMA 4YCJA 5ISMA 3R3UA 3PV8A 7ICHA 2DPIA 2FRXA 2ZI6A 2OZVA 1EFTA 3NC4A 4RF2A 3MN1A 4HLDA 4R2KA 4N47A 3P9KA 1X66A 3D0KA 2R4UA 5H3CA 4P31A 3UEOA 4RQ1A 3S0JA 4BLPA 1NHGA 3AXSA 5AVRA 1P9OA 3ECCA 4EYIB 2FWRA 2DUYA 5U4XA 2ZSAA 3D1VA 4F5OA 1QHFA 4RESA 4NAUA 1U2PA 4V0OA 3JQAB 1O1YA 5IHXA 1XTUA 3ID6C 4R2JA 4BQEA 4KV9A 3JPWA 1K2WA 3E03A 1NLYA 4MUMA 3DNFA 1P2BA 1J2TA 4LYAA 5B1HA 1TPZA 4P08A 3G2IA 2HBYA 1XMOB 3LYSA 1UAYA 1KE2A 3LP6A 1WXIA 2NPOA 4OGWA 4MV8A 1L3IA 3DTVB 3WLLA 1BS1A 1NA5A 2BFBB 3OQMA 4DHWA 1R15A 3MMZA 5EPEA 3MQFA 3RYCB 3EXEA 1GPBA 5KB3A 2VFAA 3CB4A 2I99A 3L7MA 4C1BA 4COKA 2XUJA 5ALLA 3ESZA 4LF9B 2HO4A 4WA8A 1EVZA 3INGA 2F43B 1OU0A 4YRZA 1XRPA 5E8RA 4IHAA 3MZ0A 1KSJA 2YRXA 1NVBA 1RYSA 5F78A 4X1KB 1BEEA 3BRCA 5ESWA 1QZZA 3ZCTA 2AMYA 5GOZA 1WEKA 3O9MA 2VTEA 2WHRA 4Q7MB 1Z7GA 4GECA 1SB8A 1GG2A 2JJMA 3NRJA 4W8GA 3O94A 1N6RA 4M7PA 2F59A 1KL7A 5CJ2A 2O8FA 3T5TA 2POCA 3SJAA 5J2AA 4UBBA 4J43A 2Q27A 4Y6LA 3V7YA 4IIFA 5C7YA 3V3KA 1DKRA 4F3NA 2M32A 4IJWA 1VGRA 1PR2A 2WTXA 4JLPA 4D74A 2CF5A 4XQ9A 3HKZF 2H5EA 2CEAA 2BSQA 3B70A 2ZSFA 2FRDC 5L7TA 3U4GA 4MPJA 1RYEA 3LSYA 4O8ZA 2I66A 4OAOA 2EZYA 4R8RA 4AO8A 5FLKA 1EM8A 2BL4A 1LBEA 4WLFA 4HH3C 4D3YA 4GPEA 5D87A 5K3FA 1QZUA 4K28A 1J49A 2Q5EA 1I0LA 3Q8RB 2J5BA 2BR3A 5E1BA 5E3HA 5BOVA 5JALA 1G60A 1UBKS 3SU8A 4C04A 3BE4A 3I45A 2QRVB 3IIIA 4D3SA 3ZVLA 2C94A 1VLMA 4UOEA 3NWBA 1PJTA 4KXUA 1PK9A 3HZOA 4XD7D 1SXEA 3CVJA 3TAUA 3O1IC 1XCPA 4EQZA 3HY3A 2G9UA 2EWMA 3VKGA 3K1AB 1BYUA 1N7GA 4IXNA 1T94A 1N63A 2D2FA 3TD2A 1WCYA 2RHWA 2QRMA 1ZQHA 2HTFA 3HVRA 4UFPA 2QD4A 2W8LA 4LHZA 4XYGA 4KSYA 1PVOA 5CB4A 3OFKA 2O48X 3GFGA 4WWHA 1C4KA 3ZC3A 2ZWIA 2OO5A 4LJRA 2O2ZA 5DGCA 4YT4A 821PA 1U8UA 1ILEA 1UC8A 5LQDA 4PSDA 3A1DA 1Z2CA 4BKQA 3EIXA 1TLLA 3ADCA 3WKCA 2NVBA 2Q29A 5DXFA 2YHSA 3JQRA 4O5EA 4C0AC 2QVZX 1JX6A 1EWQA 1ZD3A 5JY6A 3KQKA 4EAAA 4HEJA 1L5VA 4TV8A 3DJYA 3LUBA 2G3YA 3PC2A 2QMEA 4BO4A 3A10A 5P8WA 4MJLA 4KPUA 4EB3A 4ZAWA 3NQ41 4UAJA 2WAQF 4FR2A 3MTIA 4PLWA 4CMIB 2CLCX 3NTOA 3OKFA 2QQEA 4I5GA 5CIQA 2BDUA 4I1IA 5DBEX 2OD2A 5KFRA 1ORVA 4BQRA 4IIBA 1Z2EA 1GEGA 4IKOA 4IDOA 1PHRA 4ASUD 3BB1A 3TGWA 1T8EA 2DBYA 4RFSB 2OB2A 4CLRB 3L93A 3VTAA 2QZ4A 5FF9A 2GM4A 4QHYA 4C21A 3WR5A 1KIFA 5B12A 2LDBA 4HHEA 5D85A 2W2MA 5FI3A 4IDDA 5JPIA 4OXQA 4UNIA 1U65A 2NIPA 1E1YA 3V00A 3RVRA 2V4MA 3QI2A 4IO1A 1T0PA 3C70A 5BW8A 1DKQA 2E4AA 4JLAA 3C85A 1U2RA 1F2UA 4LJ6A 1Q46A 4DEYA 2H4JA 3IG8A 1VI6A 5KAMA 4UZSA 1OZ0A 4WLUA 2P6RA 1UT8A 3HEMA 3PNYA 4MRAA 3A0UA 4JCCA 2XOEA 3DE2X 4DPKA 5FWYB 4TS1A 1SHJA 5KYYA 4BCBA 2Q9CA 2WHPB 2ONKA 4W7HA 2B21A 4PX5A 3AQEA 5COAA 1R0KA 4WK0B 3BWVA 3MPUA 1OLXB 5LBIA 5LUBA 4UEQA 1GPMA 3RC9A 2G7ZA 2WQ6A 3ZKWB 2FW9A 5GM2A 1T5OA 2YJTD 4K6OA 1VL8A 1JQJC 2RH4A 1EWRA 3H1GA 1BNOA 3D2AA 3OZUA 5FOTA 3NVVA 3EVZA 3PEUA 4NEHB 1XZDA 3MR6A 3FX2A 4ZTZB 2CNNA 1B23P 1N8NA 4E4YA 3H8MA 3V7LA 5EL0A 4DSJA 1PGOA 2F1IA 4U2GA 2I6SA 3EWNA 1BDIA 2E8NA 2WUEA 3INNA 4YFVA 2ZT6A 2RGAA 5DIFA 4RQ2A 2RGGA 1O6CA 5CDUA 2ZRQA 4BP1A 2XOKD 4BBZA 1RRCA 1CQWA 4YJ3A 4RK0A 1E2GA 5T4FA 2WBLC 2DOKA 1UOOA 2AGOA 3NC1C 3TRHA 3PGKA 1CUBA 1EFRD 1UP7A 1Y5IA 3GFPA 2I54A 1X9HA 3VZBA 1DTWA 3PG5A 3JYOA 1WTAA 2QX7A 3GVCA 5KYXB 5KOIA 3RJ5A 1XO0A 4Z4CA 5EYPB 3LY5A 2I34A 1EGVB 1C3EA 4CCSA 5EOVA 4BVFA 2DF8A 2FQ1A 2ZDQA 2HWYA 1ZITA 1L9KA 4ECSA 2IF2A 3AX6A 2ZITA 1H1TA 1YBHA 3JALA 5KSPA 3KB6A 1SB9A 1FP4B 1HZJA 4C87A 3KHTA 3LKBA 1HF3A 3DG9A 5FYQA 2DL0A 5HQ3B 4BFXA 3IDAA 5BQXA 3PVXA 4YASA 4PO1A 2VRNA 2QJRA 1L8LA 5C8XA 5DX1A 2XVZA 3TBHA 2C2RA 2W6QA 4IKPA 3N87A 4GLXA 1I80A 4U7DA 3LBHA 4DMCA 3NORA 2FGKA 4Q9HA 4MW7A 4YO8A 4RXTA 4JC8A 2JIZA 5EXTA 2P3QA 1TE2A 3SQIA 3I2HA 3USCS 3ZN2A 2QROA 4JU9A 2LDXA 4B48A 4Y98A 4GPZA 4AYWA 3VPCA 4MO9A 1YZNA 4QODA 7ICPA 5AUPB 3MGIA 1HT0A 4IL5A 1MLDA 3KJNA 1OYYA 1WB9A 3IBGA 4MRNA 5AVVA 4R1QA 3TZHA 9ATCA 4BOYA 1EUCB 2YHIA 3RS9A 1Y8RB 2R11A 3KSZO 3DMGA 3ZTTA 1JT2A 1AKMA 5JNVA 1BE8A 2X14A 1GCOA 3PD1A 1NW8A 1FUYB 1JDPA 3R7DA 2FEOA 5DE3A 3ZIAD 1ZQDA 3VJKA 4L7QA 3O8RA 2B69A 2JEZA 5KQRA 4RULA 1FQKA 3E9MA 1OXTA 4B71A 3DTNA 4EW2A 3M9MB 2YC2C 4RL4A 4LNAA 4JD5A 1E1KA 3FGOA 3SI7A 3G17A 1Q7TA 3ENWA 1X1RA 3VGJA 3T3GA 4WXYB 1FU8A 2YUTA 4X93A 1VXOA 2VP9A 1NXWA 1A7JA 5DTEA 2VBFA 2C9BA 4PLVA 3PUVA 3KHGA 3R5TA 4MWOA 1E79A 3IDQA 1JG4A 3MW8A 2GA8A 5I8WA 4QUKA 4JOCA 1EK6A 1YR9A 4II7A 1ZC3A 1I5EA 1NE7A 3M1LA 3AR8A 1OWOA 3RCBA 4NH4A 5ALXA 3OIYA 5GZ3A 1R6TA 3MK31 1A50B 4BTLA 2P90A 1FB5A 2DLDA 3ZWBA 4ALNA 1CRPA 4F2HA 2FSVA 3VZSA 2J41A 2O2SA 1JHXA 2XBUA 2XZTA 4PAGA 5EKUA 1JDTA 2AZXA 1DQSA 5FOXA 1AHPA 2F3PA 1N1DA 1DINA 5LM3A 1CXZA 2J7PD 4BATA 4FFMA 2JRZA 5GQSA 2JLRA 3FMGA 3RIGA 2G6BA 3WP1B 2QW1A 3MELA 4GOMD 4OQMA 1XCJA 3TJRA 4FMCB 4OHCA 4PPGA 1E8MA 4W82A 4YJGB 1X38A 4V1CA 1XWWA 2ZTVA 3MAGA 4ZEVA 3KEMA 1FRFS 4KG7A 2OORC 1NULA 1RSZA 4DM4A 3IMFA 4OVKA 1QP8A 3IIMA 5C7IO 3UKJA 3PVCA 1L5GB 4MQFA 4ZKDA 1YT5A 5HBRA 2H2GA 1SQ0A 3BMCB 1Z33A 2D5CA 5C1DA 1U5CA 4XX0B 3T1TA 1ZX1A 4HAYA 3W5SA 3D02A 1Y89A 1IZ9A 5EXEA 1NL3A 4ZOQI 2NSYA