2WHEA

Structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic Details of Near-Transition State Conformers for Enzyme Phosphoryl Transfer Revealed by Mgf-3 Rather Than by Phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wheA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wheA01
2MSNA 3AR5A 3SF0A 5AI8A 1ZD4A 3QU5A 4RESA 5AW2A 4BNDA 1T5TA 3WGUA 3WGVA 5ALNA 2P27A 3K1ZA 4NV0A 3I28A 1SU4A 3W5CA 4E88A 3ET5A 3U26A 3RFUA 3ESQA 5AKYA 5AKLA 2ZXEA 1YS9A 2W11A 2WF8A 4DCCA 3A3YA 2IA5A 3W5AA 4JB3A 5A3SA 3IB6A 3M9LA 2MU2A 2X4DA 1EK1A 3UMGA 3QU7A 4MUMA 4UM5A 5T41A 2I33A 4B6JA 3ZVMA 3MC1A 5AHXA 3E84A 3OCZA 5AW6A 4L6AA 5E0OA 3N28A 3OCUA 3ZU6A 3SHQA 3AR2A 3I1YA 3FPBA 2GFHA 2EARA 3QU2A 3KD3A 3ZTYA 1YDFA 2IOFA 2YFYA 3AR7A 3AR6A 3ZX4A 4YH1A 4UMEA 3L5KA 3AR9A 1J8DA 5AKZA 4G63A 3FGOA 4BBJA 4EELA 1NF2A 1TA0A 3W5DA 2R8ZA 4OHFA 5ALFA 3UMCA 2G80A 1L6RA 3A1CA 4XQ0A 4EENA 2G08A 3SKXA 3QU9A 5A3RA 1TJ4A 5AW7A 5ALLA 2Q4TA 1SWWA 2B82A 3WK4A 3U7FB 3SKYA 2D2VA 2EAUA 2YJ3A 3PGLA 1ZD2P 4H1WA 4UATA 5A3QA 1SWVA 5AVYA 4NWIA 4UMDA 1Z4PX 4I9FA 1LTQA 5AI5A 1YV9A 2HEGA 2JAUA 4GIBA 4IFTA 1RDFA 3BWVA 3OCVA 4Y2RA 5AK4A 3B9BA 4Y2TA 2R8XA 4QQFA 3OTQA 3CNHA 3QGMA 4BNDB 3KC2A 3E81A 2GHQA 3R9KA 3NASA 4Y2UA 4Y2JA 1QQ7A 4KX3A 4HGQA 4UM7A 5AKGA 3PDWA 2RAVA 1RMQA 4FYPA 3KBBA 3NRJA 1L8LA 2WFAA 2JAOA 1F5SA 4UU1A 2RB5A 3OCXA 1RRCA 4XOUA 2FI1A 5AKXA 3EWIA 1TE2A 2P11A 4BKMA 2YY6A 3NAMA 2C8KA 1U7PA 3EF1A 5ALUA 4C4SA 2R8EA 2AH5A 4Y2SA 4KN8A 1Z88A 1QQ6A 1VFPA 2ZBGA 2DQSA 4Y2YA 3ONNA 3WKCA 1NRWA 1RLTA 2ZOSA 2AGVA 3R4CA 1WR8A 1Z4NA 2HCFA 2HDOA 2FUEA 2GHTA 3NALA 5ALIA 4AP9A 5AVVA 3NUQA 4YCNA 5AK5A 5ALKA 1X42A 5IT0A 3PGVA 2IOFK 4Y2PA 3OPXA 4CE6A 3QXGA 3N8GA 5ALHA 1L7PA 2EATA 1YMQA 5AM4A 4QJBA 3QLEA 5ALJA 2FPXA 3WKAA 1L7NA 2YMQA 4J2TA 4NFLA 2OM6A 4IG4A 2HF7A 2HI0A 5IS2A 3U7EB 2FPUA 2GO7A 5AK6A 4NAVA 2ODAA 1Z4OA 3SD7A 4EEKA 2AUTA 2HOQA 2RBKA 4YCMA 2YN4A 1YJ5A 1WPGA 2YJ6A 2FDRA 2B30A 3L8HA 3E8MA 2OA0A 1RMYA 2C9MA 4HGOA 2WM8A 3PCTA 4ZEXA 3ZVLA 2FPRA 2FPSA 5AKEA 2O9JA 1RQNA 1ZOLA 4KX5A 4MWOA 4HAIA 5AW3A 2I34A 1Z5GA 2B1RA 4UASA 5ALTA 2I55A 2AMYA 1XP5A 4KNWA 3D6JA 4UARA 2OBBA 5AVTA 2HO4A 3J7TA 5AW5A 2G09A 4YGYA 4AS3A 1RMTA 5AI6A 2NO5A 3S6JA 2I7DA 3N5KA 4BX2A 1O03A 2JAWA 2C8LA 3MMZA 3W5BA 2WF7A 2PR7A 4YIHA 1L7MA 3MN1A 3ED5A 5AI0A 1U2SA 2P9JA 4EX6A 3UMBA 4Y2QA 1ZD3A 5ALRA 5ALXA 2G06A 4HGPA 3TLMA 4L57A 3KDPA 3DAOA 3ZVNA 1J97A 3U19A 4GXTA 3AR8A 4HYTA 4YCLA 1S2OA 4O8CA 5AW4A 1U02A 2Q4RA 5AI4A 3BA6A 5AKIA 5IT4A 5AW9A 3FZQA 1ZS9A 3ZW7A 4L6CA 3AR3A 5AIBA 1Z4JA 1S8OA 5AM0A 3L1VA 3U7HB 3MPOA 1O08A 4Y2VA 5AM1A 3U13A 4DWOA 2NYVA 3B8EA 3EPRA 3NIWA 1Z4IA 4EX7A 4Y2XA 5AKHA 3FM9A 3L7YA 3FVVA 3M1YA 1Z4MA 3WK8A 4J03A 3L8GA 2YMPA 4CF5A 3R09A 1RLOA 3HLTA 4AS2A 3WK7A 3IRUA 5AM3A 5AVXA 2BDEA 4UU0A 3QYPA 3VAYA 1RLMA 5AVWA 5ALGA 1Z4KA 2YBDA 2R8YA 3ZX5A 5ALYA 2CFRA 2JARA 3WKBA 3A1DA 2YJ4A 2VKQA 4BYGA 2FEAA 4YIKA 4XE5A 1U7OA 5AVZA 4Y3UA 1IWOA 5AM2A 3GYGA 2WHEA 4FFDA 1Z4QA 2I6XA 5AKJA 5FP0A 3ZWKA 5AVUA 5AW8A 2NO4A 3ZUPA 1RKUA 5AICA 3P96A 3QUBA 1AQ6A 3ZI4A 5AI9A 3U7GA 3SLRA 2ZBEA 5ALDA 2C88A 1CQZA 2QYHA 1KYTA 3QUQA 3ESRA 1JUDA 3I6BA 3B9RA 4CNQA 2CN1A 4FE3A 2FUCA 2Q5EA 4C4TA 2CFTA 4UMFA 4KNVA 2HSZA 3L0YA 5ALQA 3L0CA 1FEZA 4JDPA 4G9BA 1Y8AA 5AVSA 1RC8A 2BY4A 1N9KA 4HGRA 2IOHA 2YJ5A 4F71A 3UM9A 4UAVA 3DV9A 1K1EA 2O2XA 3A1EA 5ALSA 2FPWA 2MU1A 5ALOA 2ZBDA 1ZJJA 2G1AA 2RARA 3L1UA 5ALWA 4DW8A 5ALEA 3SMVA 3WK6A 1QQ5A 4BX0A 5AVRA 1QH9A 1XVIA 4CF3A 3RF6A 1L7OA 2YMLA 2B0CA 3QU4A 3KOOA 1TJ5A 2B8EA 4BEWA 1ZRMA 3QUTA 5ALMA 4PNHA 5AW1A 3OCYA 4ZEWA 5ALVA 2WF9A 3WKDA 3WK9A 4ZEVA 4BEVA 2GMWA 1EK2A 3CZ4A 1ZD5A 4F72A 2W43A 3F9RA 2YMMA 4UW9A 2B8JA 4BX3A 1ZRNA 2JGAA 1Q91A 4UMVA 1RQLA 3QNMA 1WZCA 1XPJA 5JJBA 1WVIA 1NNLA 2BDUA 2G07A 4HGNA 1Z4LA 1QYIA 2HF2A 1Q92A 3NANA 3E58A 2WF5A 1RKVA 5AIAA 4OD0A 4C4RA 1RPZA 5AM5A 2PKEA 3ZTWA 5AK3A 3I76A 3DNPA 3L0BA 2G0AA 3AR4A 3KZXA 1MH9A 3QUCA 2WF6A 1RKQA 2B1QA 4RETA 5ALPA 4OCZA 2ZBFA 3HYCA 3N07A 1PW5A 1L8OA 4DFDA 2C4NA 3ZWDA 1N8NA 3N1UA 1YNSA 5AESA 1T5SA 2HX1A 4KYTA 3DDHA 2CFSA 3OCWA 2I54A 4CF4A 1Z5UA 3WKEA 2QLTA 3EF0A 3IJ5A 1T9ZA 5AKKA 1U2TA 3L8EA 4EZEA 2ZG6A 5ALZA 3ET4A 5AW0A 4I9GA 2IYEA 1VJ5A 4NABA 2OYCA 1VJRA 4XPZA 3WK5A 2P69A 1TJ3A 3L8FA 2HHLA 2W4MA 1CR6A 4OFZA 3FPSA 5AVQA 4UAUA 2PQ0A 1LVHA 3QX7A
chains in the Genus database with same CATH superfamily
2F9MA 2O0LA 3BRQA 1ZOIA 1TF5A 4FNAA 4HLUC 2G63A 1UBJS 2J7PD 4FBUA 1IQ0A 4FFVA 3K1RB 3FIUA 5D3QA 5G3YA 5J47A 1N2CA 3UMGA 1RM3A 1E4VA 5E3IA 5JS8A 5KOJA 3I61A 4P5EA 5A9SA 5KQGA 4MHSA 3OLWA 5JOQA 5CJ7A 4R98A 2YWCA 4R8RA 4BRWA 1H2RS 1V3UA 2NTYC 3FRJA 4TYQA 1G38A 1AK1A 2C04A 3FSGD 5EE9A 3ZC3A 3A1CA 4GBMA 3INNA 4FTWA 5T4BA 1ZD9A 3GIWA 4Q45A 3WL6A 4I8IA 4HFMA 3U7FB 4GVLA 3V4SA 2DR0A 3GLIA 1C3VA 2FQQA 2DX7A 3FCUB 3JAWB 3RVLA 4DGQA 2QRUA 4U7TB 2E4UA 1EVJA 4R4JA 1YQWA 1SOMA 4B6EA 1F1JA 3MNFA 1II8B 3U4AA 4I9HA 3IP6A 3CEAA 4IJVA 3ID6C 1FFHA 16PKA 1GL3A 4MVJE 2Y0BA 4UM7A 4HYEA 3UWKA 5E3JA 3BWDD 4EMBA 2FLPA 4WJLA 1UZUA 3RK0A 1VOTA 5F2KA 2D1RA 2E1EA 3LVQE 2JJ2D 4F2SA 3VPCA 3TEFA 1XZDA 3PIIA 1YKGA 5FA6A 4ZHQF 4LDQA 2DPMA 4YCNA 4TTIA 2Y9UA 4O4HF 4YI3A 3MSXA 1ZQWA 3V7KA 1GSIA 5BNWA 1WXXA 2NU6A 2ZAMA 2ZK7A 3DTNA 3OOSA 1AZSC 2X0EA 3TG2A 3SIPA 4Z0NA 2HHWA 1K6XA 3LIIA 4LSZA 1UMCA 3UPDA 3E1KA 4E2XA 4LAFA 2WHQA 1BHO1 3FOAA 1O8CA 4D3ZA 2JRCA 4NMWA 4Q34A 5IZCA 3EUAA 4Z51A 2UUOA 1N3IA 5BMVA 2VJNA 1Q11A 4QNLA 2H0RA 4F11A 4TLBA 2FMUA 4KLUA 2E3JA 3D6JA 5NULA 1PJQA 3E27A 1RMTA 2PMBA 3FGZA 3VSCA 1Z37A 1ODJA 1G8FA 3RVOA 4OQEA 4XUDA 5DYWA 3WR5A 1V35A 3S8YA 5HUHA 4GLBA 3DV2A 3NCHA 2ADFA 2ZB4A 3N87A 1MIOA 2P2DA 2OZLA 1UXOA 2XZPA 2GJKA 1SL2A 1NYLA 4D8VA 2PRYA 2RDIA 2VJKA 4CEJA 3WZLA 2MSCB 3MGCA 2YMPA 1FC0A 1B14A 4YUXA 2H2AA 3LOUA 3QWBA 1MNQA 3WMXA 2P78A 4UBMA 3PWTA 1QIDA 4IDCA 2VTDA 5C37A 1QUFA 2WVAA 1OW5A 1E6UA 1VDVA 3B1FA 1Z25A 2KPOA 3WO0A 2BL4A 2YH2A 1KZ4A 1NC3A 2Q0SA 4MDEA 4B6QA 1DEKA 1WZUA 2WFMA 5ILGA 4NTZA 3NG1A 3SBXA 2GKOA 5JJCA 3A1EA 3KXDA 1RI1A 1KC1A 5REQA 2H5EA 4YJKA 4YRJA 2CB9A 3A6ZA 4I4TA 4EKYA 3OF3A 3LCJA 3AVVA 2G76A 1IMJA 1Z00B 2VRBA 4BV9A 3C98A 3MFQA 2GMWA 5K0CA 4LZNA 1IONA 4GICA 4E5PA 4OHVA 4IZHA 3MJVA 2WU4A 5JANA 4Q19A 1RPZA 3RREA 2V98A 1VTKA 5GTIU 1W96A 3OJSA 4ELVA 2CXQA 3DNPA 4X64B 5DGBA 2OAP1 2KLHA 2DCMA 3REQB 1W4RA 4HVLA 2B1QA 3HRDD 2IXTA 3ADBA 5CVTA 4F2RA 3TZQA 4P4PA 1L3IA 1T5SA 1GPDG 5T64A 3TD6A 1F9EA 4IDHA 4IF6A 2K89A 3EVZA 2PKCA 5JRZA 1LK0A 4R41A 1I0LA 1MVLA 3S81A 4TQ9A 1XI2A 1QFMA 2QD2A 4EPRA 5H3HA 1I2CA 1O94A 4KQEA 1OGYA 2D00A 3RK4A 3VKHA 4XH9B 4NV0A 1TM2A 2R4UA 2ZXEA 2AB0A 5C5JA 3QVVA 4HS9A 3VKGA 4QXOA 1RYNA 1ZINA 1UZNA 4RGVA 4FR5A 5IEJA 3EC2A 1RJGA 4MRSA 2PSHA 2WU3A 1UJBA 4BWFB 3AQ4A 4UOZA 3VH4A 2I3ZA 3H5WA 4DBLC 4FS8A 3UHPA 4NFSA 5KSWB 4ZQIA 3NFRA 3AOEC 5JCOC 3ZTYA 1NE7A 5D2CA 3EQ8A 4UUAA 1ILWA 1TUIA 1JVNA 3IBSA 1QIMA 1YA6A 1XN4A 1YONA 1SL0A 4PO9A 1KZYC 3C7CB 2X8JA 1U81A 4CFYA 1NVKA 3QNWA 1TK8A 3KQHA 3LX8A 3AIIA 5H02A 3HSYA 3HY3A 1B73A 2I4LA 4F3KA 1FFWA 3AFIA 2X23A 3EQZA 2VI5A 4NPHA 4YJHB 1K92A 2WJAA 4HZIA 2CL0X 4IHAA 4WT7A 4Z4HA 3PFKA 3QHQA 2EGGA 4KL8S 3B3QA 4HR7A 3DQPA 4Q1BA 1B2RA 1XAIA 4WINA 2IE0A 1BNOA 3PGKA 1WCLA 1K0FA 3FUWA 1E3IA 3BZCA 3G9XA 1W88B 4KQKA 4X60A 3HT3A 1SGGA 2LKCA 3LA6A 1K5GA 1T9CA 1E89A 3MTQA 2W2MA 1ZQJA 2C2EA 2R8JA 4ZYXA 3GZTB 5HX7A 5ITZB 3O1IC 1DIOB 3CKYA 2ZU6A 4QZ8A 2VF5X 2YWEA 4RLQA 1EXDA 4JY7A 2B30A 3F7MA 3S1SA 1ZQKA 4BQFA 3H3XA 2ILTA 1Y37A 3OZAA 1OHHD 3PQ2A 1B0XA 3W2GA 3TMAA 2ZAGA 1RPNA 4UFNA 4QZIA 4NXMB 3MFIA 2LM4A 1QH8B 4ED9A 2H16A 4BX2A 1GA1A 4E03A 1VJGA 2C8LA 2WF7A 1ODKA 2JCVA 2AG0A 2F62A 3D3NA 4CKEA 3PEUA 4CM9A 5HR7A 2ZZKA 2RCNA 5TT0A 1ZUNA 3Q41A 2QARB 1J2RA 1L5LA 3C3WA 5C5EA 3PJEA 2FFHA 4U9UA 1GCGA 3ZD9A 1Z4JA 3H8JA 1EX1A 2XVMA 4J1QA 3MDAA 3ESYA 3DA8A 3FM9A 5KTPA 4LRTB 2VQ3A 1JL3A 1E8MA 4IUDS 4IDPA 3FHJA 1QQTA 5EFOA 1RLOA 3Q2IA 2I3AA 1O4VA 3DO8A 3F6YA 4Z5XA 4B4DA 3BTUA 2XODA 5CB6A 3SQXA 4LOIA 5L4NA 2HWYA 1TK9A 5DI9A 4LRQA 5JD4A 1GA4A 4ML3A 3A6JA 5A06A 3K70B 4EHLA 1T1RA 2E89A 4UBNA 5LZ4A 1LDBA 1TL7C 3R0IA 4JP1A 4LWOA 1RM0A 1YE5A 4HEA1 5DKFA 4R63A 1RXEA 2QT0A 3EXFB 5FH9A 4A8HA 2C0CA 2VJAA 7ICPA 1A4UA 4JI7B 3JD2A 4KXNA 4KP7A 3ZHUA 5KTYA 4UEJA 1SVOA 4CG2A 2IHNA 1HZJA 4YJ3F 3B2NA 3IAAA 3HPOA 3A4MA 2FDXA 4IXNA 1ITZA 2HJVA 1JIVA 4QJIA 4TKUA 4V0QA 4IRUB 1V9SA 2GBFA 3GGGA 5J2KA 3ZOKA 4QDOA 1O7JA 1L8XA 3VU9B 3QH4A 4UTPA 1NNLA 5BSFA 4B3DA 1QRTA 1IVNA 2X3FA 2C2GA 3MYRA 4R3WA 4YRZA 1S89A 3TX6A 1XMIA 3FPAA 1ZU4A 3AI3A 1ZQ1C 3HMQA 2AJCA 1G3QA 4TKMA 1I1OA 1WWVA 2ZT8A 4MIEA 4C6RA 4AU1A 2H2GA 4IDEA 5DBOA 4YRMA 1PK8A 1JXAA 2HSJA 2UUAB 4DM4A 1PWEA 1J0BA 5E9QA 2J4CA 1CR6A 4HF7A 3FTEA 3GRYA 5BQFA 2O05A 3KEOA 3QG1A 1OBFO 3VI3B 2E21A 2WP0A 4Q3CA 4XOIA 5I7AA 4XDYA 1TECE 3OIGA 1ZK2A 1FSFA 4Y9RA 3O95A 4INZA 4YQWA 3BQ2A 2IXFA 2QR3A 2BEVA 4KEAA 4UM5A 5TMBA 3VYUB 1P17A 1DNPA 1BOFA 4YRKA 1CE8B 5I4KA 4AT1A 5J1TB 3PGA1 2JIMA 5A5VA 1LTKA 4IRKA 2JLRA 3VAAA 3O82A 4MVWA 1TT7A 1V8PA 4E2ZA 1MIHA 3C3AA 1L8QA 3NHMA 1HT3A 2R9VA 3EBOA 5HMLA 2OY0A 3IYLW 1COKA 1IY9A 3T3IA 4ARCA 3UOAB 4N54A 4DN6A 2JJ1D 4RULA 4IVQA 3HA2A 4MTLA 2GAFA 3C3MA 3BXOA 3WY9A 4GMHA 4PHHA 4GE0A 4FZNA 1H69A 4BO5A 4B46A 2HUPA 5TF4A 1T9KA 4HS4A 3FVRA 3CPJB 3GLGE 4ZT2A 2ZTCA 2W03A 2YIJA 7ICOA 4UEWA 2Y71A 3RF7A 1DDIA 4I66A 1AKRA 2NIPA 4KLZA 2UXDB 2ZB7A 4JJEA 4Z7NB 2ZBPA 5JFGA 2BFBB 3O94A 2XGSA 4J0EA 5EGSA 4FFWA 3BGOS 4JYMA 1XKQA 5HJ5A 2AE1A 3BCUA 3T3NA 1LNZA 4DFMA 3HMKA 4G85A 3FWKA 3I2HA 2GD6A 4G1UC 2BZSA 3TAHA 2PVCA 1CUXA 1C8LA 1OY1A 5EP1A 3QELB 2GLUA 2ZS8A 1BPDA 4NDNE 4GX2A 3DG9A 1PZGA 1G5PA 1SUCA 1F51E 4QZFA 2BD0A 4BP3A 3WGMA 3F2CA 1NQWA 2WZCA 2FCRA 2H1HA 4TV9A 4YACA 3BZUA 2GPBA 4RTOA 4J1NA 4RNDB 3BQ0A 3CW8X 2G09A 3ND9A 3S6JA 5ESRA 5DNEA 2COKA 1T5HX 2GBPA 3R7SA 1L4MA 4BGUA 5B57C 2VYND 1XU9A 4X8HA 1T13A 4C7YA 2KW5A 3AW8A 3V1MA 5BQPA 5AHKA 2RHCA 3HXKA 1TYZA 3RRZA 4C01A 1S0MA 3B9QA 2HADA 5TGDA 2R4TA 1RM6C 4CF5A 3LQ2A 3OMWA 2E4ZA 1MC8A 3A36A 5F52A 1VYUA 2YS7A 3RRHA 4YMSA 3UV3A 2XQJA 1Y34E 1E5LA 5BN1A 1CY8A 4FPXA 4ED6A 4FSHA 4HVAA 3PHLA 2OG1A 4C3ZA 1DX9A 3GLQA 1SVWA 4EECA 1Z2EA 3RC3A 2YXEA 4FI3F 4HD8A 2V55B 1OREA 3ANYB 1HA3A 3C5VA 5DT9A 1HG0A 1SN7A 2SCUA 5JPCA 1X6JA 4JEIA 4IW3B 5KG7A 4DSUA 2Q3EA 4GOND 3NP9A 2RD2A 5CJJA 1KHHA 4CT5A 1UJNA 3A32A 4J0JA 3DGFC 4BX8A 2PVSA 3WA6A 1U7UA 1T9GR 1OLUB 3DLHA 3MBIA 1S2NA 2HQBA 3E1SA 3UKJA 3WLHA 3ZZ1A 5EPEA 2N1MA 5GMOA 4AG3A 3AU9A 3UWPA 3BWBA 1JFRA 3K6JA 1FRVA 5KKAA 4NEHB 4EEXA 4KCGA 4MZXA 5HBRA 2OYRA 2AOUA 9ICHA 4K46A 4PFSA 4ASUA 3F53A 3R3HA 3NV7A 5BSKA 1UQVA 2O7NA 1NTOA 1NWHA 1HR0B 1DFGA 1R8YA 2E3TA 3MRVA 2BPFA 4BTEA 3D4IA 1DELA 4OP3A 3HWWA 1AUXA 4UQPA 3VC3A 4YALA 1DIGA 4RLFA 2H29A 2BTQA 3CRNA 3ZNOA 4ZKDA 5MGBA 3SHWA 1DBSA 4CIDA 4Q4AA 1XXHA 1Z8NA 3C7KA 3I28A 2NUAB 2CVHA 4DZRA 2Y1DA 1ZKMA 2JGRA 4F3OA 2CLOB 4F8JA 2C7QA 3EF3A 2CMFA 3GJ4A 4TSKA 5BR8B 2W8LA 4AYTA 4UD2A 4RC9A 4BWYA 4GMFA 3V7YA 2I2WA 4H18A 4OATA 4LDRA 5DMHA 1GG8A 2PMWB 3F2VA 1W85A 2JB9A 4L5AA 3T7RA 1T3HA 3OU6A 1ZMBA 5ILQA 2ODGA 3QU9A 2RBGA 1DJMA 5AK0A 4DIUA 9GPBA 1O95D 3CB2A 4PEVA 4FE4A 2WRZA 4MEAA 2BM8A 5CH5A 4A2QA 1HFEL 1IBSA 2F2AB 1GADO 3ZWMA 4FE7A 1L5VA 3WYDA 1WIWA 2C7RA 2WNIA 3WIDA 3GAZA 3ZPXA 4Y2UA 4TL8A 3CH4B 2I4IA 3DJFA 1IY8A 2VQEB 1LW7A 4EO7A 3SR3A 4KPEC 3L7MA 1EUZA 3AY6A 3EWIA 4F38A 4YP5A 1E7RA 5ADHA 3C7TA 1U45A 3EEYA 1U1CA 2ZYVX 4OQQA 3HB0A 3P0EA 2UVRA 1FTSA 1SCUB 4PLVA 2AQKA 2JGDA 3LVRE 2ES4A 3ZKWA 5IJWA 1K1SA 1M0EA 1QJCA 4HB0A 3I0MA 4GFJA 3S5JA 4JKYA 5K3CA 3KZCA 1PL7A 1Z4OA 4OJLA 3KWJA 1UC4B 3O9ZA 2Y0SF 3R9WA 4YCMA 5HUQA 1QOQB 1EE2A 2CHGA 3E4DA 1KO7A 1WABA 4Y1FA 2JZCA 4BNTA 3ZU2A 3HUDA 5AKEA 1Q95A 1OQAA 2MDTA 1K8QA 2P4UA 4QOIA 4A4DA 3SC6A 3CVUA 1D1QA 2X0KA 4TRRA 1YU9A 1XC9A 4OSEA 3U2QA 3HKBA 1IWPB 1W1WA 4FLFA 4FCVA 1J97A 1FJ2A 3SQOA 2E7ZA 2BOVA 1FMJA 4ENRA 5IT5A 4OI4A 3LBHA 3QRWA 1X15A 1Z6TA 1C9YA 5AM0A 1OAOC 4F8RA 4EYQA 5FUQA 1ZA2A 1R8SA 5DGDA 3BS4A 1C0LA 3WZMA 2HK9A 4QZDA 4CL8A 3D7LA 5BSTA 2NU8A 1PN3A 4WOKA 5GONF 1PUJA 4HN9A 1JQDA 4D4LA 3TNFA 1WB4A 3OIYA 3I9V1 4WCVA 4ARBA 3GN2A 3RBDA 1QFXA 1ZJZA 2HRDA 3LYSA 4PZYA 4FM9A 1E0AA 2GZRA 1EVZA 4UVGA 2J0UA 1AC5A 5F4BA 1ZQTA 5CXSA 5CA1B 4PG5A 3JSXA 2C29D 4DOCA 4FKMA 3SEAA 1PK3A 3AEXA 4QDTA 2OXIA 4WSOA 3FTFA 2EX1A 3C5FA 4MS1B 5ESXA 4BKUA 3V00A 4OAOA 1DG3A 3Q7QA 2QXTA 3R7FA 4KN5A 1ZXLA 4XCVA 1JEAA 4B9SA 2R1ZA 3WSWA 3PC8A 2BHRA 2PSFA 3RYCB 4DMLA 3P9QA 1VL8A 2RGRA 1MH1A 1P7CA 5CFLA 3UXOA 1R7RA 2IYNA 4I7EA 3EY9A 1XD8A 1RYDA 4MVJF 1XSPA 2C20A 1F44A 2QUAA 3NAGA 5JCXA 2OBFA 3LPLA 4OQLA 1E61A 2VNAA 4Z49A 4IZ6A 3GX1A 5CT6A 3B52X 2JAHA 5BRNA 5HQJA 4GL2A 2VQSA 2X5KO 2L2QA 5DSTA 3EPPA 1ZK3A 3O38A 1LI4A 2J5RA 3E9NA 1HZZC 1E8NA 4LJXA 4PYKA 1RQRA 4TWRA 1G17A 3BQNB 4MF8A 3HWTA 3JR7A 1EXVA 1E79A 1WUJS 4ADSG 2ZXUA 4B73A 4BJQA 4M9UA 1XJWA 4ZCPA 4RD3A 4RMGA 1SKSA 3QWIA 4V1CB 3C85A 3TQ1A 4NBTA 4LXXA 3AF2A 5DTMA 5I7EA 1PV4A 1NIJA 3KKOA 3SKYA 2P1RA 1HT2E 2H2FA 1YR3A 3VVMA 2NV2B 2G40A 1SXGA 2G9UA 3I2GA 3TTSA 5COQA 3AVOA 4PFJA 4LYAA 2V4UA 5KAFU 4BQPA 4XVRA 1TYAE 7ICVA 2R1VA 1LRJA 2E5LB 1E1LA 1ENYA 2W2KA 3FF4A 4C4SA 1R4AA 1E77A 2JC3A 5K99A 4NC9A 4OMDA 4A16A 4QGFA 2KKPA 3HLYA 2G5TA 2WC1A 2X9NA 5J23A 1K7YA 4P2BA 4R83A 4CKZA 1DQZA 1U2GA 1KK2A 3P20A 4NLZA 3M7IA 1H8HA 3HFGA 3TADA 2Y4OA 1HT0A 2GNAA 1E7SA 1I7QB 1Z1VA 1Z34A 4MIKA 1B8PA 4M8NE 3FLMA 4HH0A 3WL4A 2I3BA 1JB9A 2ATVA 4DR2B 2Y1LA 3B5JA 3AIKA 2RB4A 2FQXA 1ATIA 5JE8A 5D7NA 1ZC4A 3LYHA 1XG5A 4B3XA 4I50F 3GDFA 2YJZA 4GYYA 7ICIA 3GG9A 2OILA 4F4IA 1KMHB 1R9MA 4COOA 5L7TA 5DP1A 2P6MA 4RJJA 1ODCA 4RHEA 5C52B 4R40A 3U19A 4GXTA 5HILA 5FOTA 2CD9A 1MD9A 4L5CA 3H4TA 2EKZA 1JE1A 3K9CA 1JALA 1QJ4A 4C5AA 4PTZA 3H19A 4R9UC 4I14A 2AFRA 3SYLA 4YNBA 2Y27A 1F60A 4YV7A 4L9AA 2PTGA 5EUBA 3AHHA 1EGQA 4EFNA 2V54A 5BT8A 1LBQA 5AUPB 1VIYA 2OB1A 2O8VA 2QVCA 2BI8A 2VWGA 4M53A 1FMCA 4HQLA 3DV0B 4OSPA 4R5MA 2V8BA 3DTVB 1YBVA 1FFAA 5DM4A 2J6SA 2EJWA 5A1JA 2BF4A 1TQ2A 2ENWA 1LC3A 2QMOA 1PVQA 5DYGA 5DNUA 2RP5A 4ZHSA 4M46A 4AJ4A 4FC7A 5B58C 3AUAA 4YCCA 3UWMA 2WI8A 2QRJA 2OQ2A 3T4XA 2XUFA 2TMKA 2IEYA 5AT1A 5HMMA 3UM9A 1JHVA 2Q8QA 2B34A 3TD2A 2WDPA 1L7EA 4C4AA 1GU0A 5T57A 2BCUA 1E60A 4LYHA 1LKZA 2PT6A 3U81A 4NQRA 2GSWA 3G68A 1CU1A 4M1SA 3ZVRA 4NLKA 1OC2A 2XTZA 4M9SA 4MVYA 1ECCA 1P0MA 5K0EA 5BY2A 5KOYA 2VN8A 3FWYA 4RENA 1QBGA 8ICWA 2XUPA 1QE3A 3PZPA 2HJGA 5JG7A 1MO5A 2PGDA 3TTYA 3P0RA 4AECA 1E3WB 5HGXA 4MYCA 3H0CA 5ES3A 3EF0A 3HO6A 4DDHA 3L77A 1B1CA 3NHRA 1N5KA 4EPVA 1F8GA 2RK6A 3JQAB 1XRQA 4B4WA 2YFQA 1UK9A 2H3QA 2AG8A 1R18A 2F43A 1X6IA 5FNVA 3K1ZA 4YQYA 4E88A 4DC0A 5HS6A 2XDQA 4JB3A 4WNYA 4M54A 3OPYI 2ETVA 4EVSA 5D51S 3QVLA 3FGNA 1BSVA 3I1YA 5LXTB 4MPRA 3U5TA 3H2YA 3GGJA 1KZGB 2RJOA 8ICAA 5A4JA 4QTZA 2M32A 5CVVA 4BBJA 4DMKA 5KYYA 3KO8A 3T3MB 4DQVA 1A0PA 4XQCA 1T8RA 1ZETA 5C51B 3MBOA 4FDTA 1FFUA 1FTWA 2PV7A 3WGQA 2OCGA 3T1OA 3CO0S 2FPPA 3HYLA 4LZJA 3WBFA 1ZBDA 2QP9X 3KQYA 3NDRA 2IY9A 4Y2TA 2KX7A 1DTWA 1E5TA 2OXFA 1YZQA 4QDXA 1WXDA 2EU8A 4IDGA 2J5KA 2NU7A 4DLAA 3JWIA 3NHLA 3BK2A 1W76A 5GOTA 8ABPA 1JG6A 1XELA 5ESWA 1FTNA 2NZVG 2CLKB 1IK6A 5DBCA 2PY6A 4OYHA 2POCA 4TWIA 4H6XA 5LQDA 1ZJ4A 3R4CA 2YVKA 3LC7O 1ONSA 2VF4X 2IVFA 1RABA 4ZOBA 3ZZNA 5FO0A 1VMKA 2YQEA 3CVOA 3QKTA 5FTMA 4BNHA 4N0MA 3SZOA 2WICA 2YN4A 2FFRA 3FJYA 3OY7A 4X1KB 2VDKB 3EZYA 5I7OA 1OW3B 2H08A 2X2FA 3D2LA 4F9FA 3EC7A 3GZNA 1J7JA 1Y3IA 3H7AA 1N77A 2IKQA 3EFOB 3G2QA 4P7KA 2XX3A 1RBQA 2J6CA 1XALA 3FYSA 5KBYA 2EKPA 1EYZA 1DSSG 3MTAA 3EW7A 2O5RA 2WSSD 3T1VA 3VTZA 1LWOA 4PL1A 2Z09A 3BFKA 4X54A 4MCAA 1ULZA 2NTJA 3TB4A 5A04A 3THSA 1IBCA 3IFSA 1N5WA 1E62A 1O6FA 2DETA 3G85A 2BEUB 1X3LA 3S68A 4YYZA 1DC6A 3TIXB 3ZBQA 2B36A 3IV9A 2J6UA 2LDXA 3K5HA 2H7XA 2FFBA 2CYAA 1EFRA 2WJ4A 1XCBA 3IUEA 4YCXA 2VCHA 4RD1A 2GEBA 3HU2A 1Z4QA 1UANA 1Q1AA 3UKOA 5J0YA 1LQ2A 1DKOA 3RJIA 1OASA 1N6NA 2NXEA 2VDOB 4BO9A 2V7UA 1KFSA 3IEXA 3X3HA 5GQSA 3K8ZA 4BV8A 2BCJQ 3TTWA 3JD0A 2X7XA 1LV7A 3Q6IA 2XCAA 3X2EA 1AURA 4Q3EA 3JYHA 2QGZA 1K4YA 3W6NA 4BEWA 3TLXA 1P3DA 3DMYA 1WU8A 2J3JA 1ZMXA 1LPMA 4UNIA 3R2JA 4D81A 3DZBA 1TW2A 4MV5A 2KZMA 4HAZA 3OECA 1KDTA 4XLZA 3ECAA 4I1SA 2VDQB 4MTCA 4S05A 1R66A 4L0CA 4MKXA 4LCBA 3PJDA 1KY2A 3VHRA 2OV4A 3OURA 3WZ2A 2N1RA 5DLQC 4PAQA 5H5JA 3WRYC 2II6A 3OFKA 1WHSA 3KZVA 1ISSA 3THYB 2VDPB 4EHBA 4HOYA 2HHSA 2KN7A 3PJGA 4P0PB 3SS7X 2FPOA 1M5UA 2B7BA 3RKRA 3G6WA 5FBLB 4TROA 4DQ0A 2I0FA 1IPFA 1P8AA 1YS9A 3W5AA 4JB0A 3ISJA 5IVHA 3AEUA 4IKOA 2GRUA 1BHJA 1B74A 4B6JA 1SVUA 5KKCA 2GX6A 1U1DA 1D5CA 1T3TA 2HLNA 2W54A 1ONNA 3PA6A 1ZH4A 5LWQA 2ZIWA 3V6MA 4BLTA 4P4SB 4QHYA 4LJ9A 2RAUA 5FPTA 5EEGA 3CBQA 1MAHA 4DMUB 1FL9A 2WUEA 4PSVA 1BH6A 4BNIA 5HQTA 3DAYA 4CMGA 1Z1BA 3KTAA 4HEHA 3OJWA 1SZJG 5J0QA 1PQWA 2D4HA 4KE8A 2I7TA 2UZIR 4IXWA 3PE3A 2W6ID 1N0VC 2ZT6A 3GIDA 4I9FA 1QVZA 1LTQA 3OA0A 3WNBA 4R1UA 3OCVA 3H1PA 1E1MA 2R6HA 4G97A 4YDHB 3CX6A 2QLMA 5BWCA 3L84A 3I73A 4IAOA 3BE4A 5LQNA 3ORRA 2Y1IA 4ALKA 4H7HA 1R6DA 3VR5A 1GNSA 3O47A 3Q11A 4NCAA 3PXCX 3L7JA 5D6OA 2ZI7A 1TO2E 4Y6PA 4KLIA 1P1FA 4U6QA 5DASA 2PMFA 1TEVA 5BRAA 1PJ8A 2XUAA 5H83A 4GOKA 1L5ZA 3IOMA 4RPLA 4ZOEA 2EWMA 3G2KA 4MW6A 2XMGA 4P3KA 3NNDA 1TGVA 3N2KA 4IOJA 1I4DD 2VPPA 4DSLA 1JH8A 5ED0A 1BJRE 3K8OE 3V42A 5EMKA 3AU8A 4YHHB 1RVDA 5L4LA 1IOZA 2ZSKA 4RF2A 4F91B 2UU9B 2ACVA 4CL3A 4F12A 5JJLA 3NM4A 3WISA 4UJ3A 3IMEA 2AGOA 4HH4A 1TDJA 3QIAA 3JQ9A 1MX9A 1EDDA 1QCZA 4I5EA 3QOXA 2AEFA 2E5WA 2NTEA 2ACWA 3CZAA 3C0KA 4WXPA 3KV3O 2R7KA 3GJ0A 3WLJA 4RCZA 3I39X 3I01M 2XIDA 1K86A 4DLWA 3AUUA 4DS3A 3TECE 4YDRA 4DQUA 1C30A 1OTYA 1LJ8A 2XUZA 1D7OA 3PPWA 2LE0A 4WBXC 2IWRA 3B20A 4I3HA 1LWNA 2FHPA 2XE6A 4KGXA 4F2GA 3RTBA 1G8KA 4JBXA 4JL8A 1CUCA 2O8CA 5K3EA 1Q1ZA 1I32A 4KN6A 3FBGA 1Z13A 3K8YA 1QVWA 2A19A 3HADA 2OOKA 1PX0A 3HR8A 3OHBA 2ONZA 1AO3A 2ZIXA 1JI3A 1VBFA 3B9RA 4F8EA 2FUCA 3QX3A 1K98A 1F38A 2JH8A 4RPCA 3P9IA 3NTRA 1URJA 4Q8EA 3DONA 2KTQA 3RYFB 2Z5GA 3TIVA 2XICA 5GJWC 3TWOA 1JDJA 1NJYA 1OOEA 5KYXA 1LQTA 4CZ2A 2B0CA 1CZLA 5CB4F 1EG7A 1D09A 1ZD1A 5FPSA 4B6FA 2OWEA 3DAPA 3BIOA 4PYNA 5C7LO 4XGKA 2O2SA 4DCVA 2XNSA 1OR8A 3HBAA 3FR7A 3FTDA 3RM3A 3BT7A 4E5MA 2H3EA 3IQFA 3BE8A 2OHFA 4ILEA 4RPKA 2DBVO 3LC2O 4ZT3A 4NS1A 3D7SA 3UGJA 4P31A 3E7FA 3BSWA 4UFOA 3IDFA 4IUYA 4BUCA 2FSIA 4DAOA 1AB6A 4HKTA 1IN6A 3UJ3X 5L9AA 4U7HA 4YN3A 1X1BA 2HMSA 3AQIA 1U94A 1HV8A 2QBYA 4KC0A 1E69A 1SQFA 1IOWA 4CM4B 2WG2A 3O03A 2ODBA 1SCAA 4MUMA 4MW4A 4JT8A 3DBIA 3A1TA 4CTJA 2QQ5A 3M5WA 5T7BA 4A0RA 5A5EA 1C81A 4NZ9A 2IDKA 4DLKA 3L8ZA 5BYJA 2VP9A 2R8ZA 2NAFA 5G0UA 3AWDA 4E12A 2Q3CA 4UM9D 3K75D 2EWVA 2HIHA 5ALLA 3U61B 1N60A 4PSUA 1SWWA 4ZJYA 3PT9A 2DUJA 1YMVA 2C2ZA 1FIUA 1ZH6A 1JBQA 2P8SA 3HKZF 5DNCA 3ELBA 1N57A 4UKDA 1ZU5A 1LQUA 1OXXK 2C95A 3FZYA 4RT3A 1ENPA 2IOYA 3ZHCA 2W9MA 4YR0A 2D1SA 1H1LA 1J07A 1TVKA 2PLNA 4U9IS 1KH2A 4YD1A 4KBFA 4MI3A 2E0IA 1E3LA 1E9EA 1UDBA 3TMYA 4D74A 3HO8A 3PF9A 3DOOA 3CGGA 4DEYA 1OAKA 3EWSA 3IAXA 4HNAB 5F1PA 3S7ZA 2E4VA 5CVCA 4XQ9A 3M83A 5AVVA 3NBXX 1HE4A 1R4MB 5KZMB 2WJYA 1WVGA 4WKGA 4B85A 2OFXA 4WNIA 1QVVA 2R84A 1EUDA 3I2IA 2AI1A 2PRSA 3WFIA 3JPSA 1J70A 4KLJA 1NKTA 5LLTA 4IXMA 1E2FA 5E3HA 3PHBE 1Y8RA 2IYOA 4O4IB 3RQIA 4AMVA 1EM6A 3CB4A 5KC9A 2GSDA 4YUYA 3IS3A 1Q5PA 4ZFNA 3ON5A 1YHZA 3U9SA 3MB5A 2Q9UA 2F90A 1CDDA 1B15A 3WB1A 1KARA 4AUNA 3Q85A 4F6LA 2Q2NA 1NF9A 3EVCA 3ZVNA 4UUNA 3T6KA 5DB6A 4P1ZA 3TVYA 1KI6A 2GERA 1DC3A 1VL1A 5HOQA 1GPJA 3DZFA 4AKTA 3UJ7A 3HQ4O 4MWTA 1N2CB 2XNKA 4J0GA 1C3OB 1WYGA 4MGEA 5KOJB 5CT4A 1BPBA 1U2RA 4KUHA 2W71A 3JATA 3EXHA 4A2PA 4WY5A 3GFRA 2LTAA 1Q3KA 5JYCA 1ZUD1 3QM1A 3PRJA 2IK8A 2YUTA 3REFA 3UAXA 4FFDA 3VSBA 3QE9Y 3H40A 4B33A 2PNFA 1POXA 3EOBI 1PQUA 3VTFA 2BM1A 1AQ6A 4GEGA 4YRAA 3OUZA 3QFTA 1SBCA 3OHAA 1KKMA 3U48A 3GLIB 1GPH1 2AR7A 3AT1A 3QKRB 1N92A 4XGRA 3RS5A 1E66A 2CXTA 1N25A 5EZYA 2WDZA 5HKAA 5B37A 1YBFA 2KJ9A 2DSNA 4PCAA 5D1NA 4DNPA 1HEIA 5LKRA 4E7PA 4TRJA 3GFFA 4MVJD 4ECUA 1MOSA 4QZAA 4ZXFA 4GKBA 4QRIA 2ST1A 3B0YA 2W9CA 1A96A 2ISSD 5FTLA 4C0HA 2AZMA 8OHMA 1X77A 2VSXA 3A4LA 3MR5A 5FBZA 3HYNA 3G6KA 5I5EA 2QLFA 1U7ZA 4ND8A 2GTHA 4NZPA 4RSHA 3L0BA 3GDOA 1DJNA 4KWCA 2VHYA 3MVEA 3W9YA 4WADA 2CFSA 3CSSA 1F3OA 1A9TA 2FK8A 3TZKA 1UMCB 4GKAA 4F5WA 1EDOA 3ETGA 2P69A 3L8FA 1YHNA 4QBHA 4AJLA 3VHXA 2BHLA 3DBRA 3P9PA 1I7NA 4DQSA 5BMVB 4E51A 3EPHA 2NV3A 2VA8A 3DB1A 1X1CA 2MHCA 1XGKA 1SU4A 3CWZA 5BWNA 3V34A 5AKYA 1JU9A 3F74A 1FLNA 3LK7A 1ICEA 2LYAA 4KU4A 2FPGA 1XZQA 3EVAA 1GG2A 2QM0A 5C3UA 1KDYA 3M49A 3OJEA 1NJ2A 1E9RA 4QQKA 2BFWA 3B51X 1CJCA 1Q14A 1D3AA 5GTHU 1SHTX 1MIOB 2G71A 3ITDA 3UK0A 3RWOA 1KQNA 3Q9SA 1DPGA 2AVNA 4P22A 2D0PB 4X1YA 2WWVD 1C1HA 3OIWA 2ZIUA 2IZ6A 1ZQRA 1H2FA 2DQYA 3PEYA 6PFKA 4D9HA 1ZD2P 4D4MA 2FLVA 3DM5A 4HLUA 4GOJA 3T5MA 1DO8A 1UBTS 2N1BA 4YXFA 1E1QA 3WQQA 1XTBA 3WOHA 2ZDHA 1RQGA 2M0NA 1XMQB 1CJSA 1NW5A 2WTAA 2GHQA 4R2MA 1V71A 2IJGX 3H1AA 3Q88A 2RAVA 2W22A 1M54A 4TYYA 4JITA 3PQ3A 4NFHA 1VHLA 4O5CA 3W1WA 3HA3A 3PXXA 3ISVA 2ZBRA 4N47A 5BQXA 3R0JA 1SXJA 5REQB 4ZN6A 3IP7A 2ZFUA 3FUXA 2NVWA 5B7QA 4I4TB 5EGNA 4RQ3A 4I46A 3BIFA 1L7PA 5IUJC 1GLNA 5B1DA 2NMVA 4KLNA 2OEHA 1DUVG 3EISA 4BEBA 5J0PA 3MIIA 1V95A 2H5XA 1J25A 5IS2A 2VTBA 2B4YA 2IGTA 2KVCA 1K3UB 2G5GX 4J43A 2G04A 1WPGA 5J5CA 2YZ2A 4G5XA 1IY1A 4LGCA 3PW7A 3ZDDA 3PUVA 3E18A 4EUFA 4W9MC 4MJLA 3HM9A 3UZUA 1RWNA 4YONB 1GCIA 3J7TA 1O9GA 1VQ1A 4PHGA 2BKVA 1PGPA 4BDPA 4PHTA 2DLDA 3UJCA 3B7PA 2C98A 4INOA 3PL5A 4B9AA 4Q7EA 4FYMA 3O4IA 1QR6A 2CLIB 2Z1NA 3ZDZB 1PJAA 5LDHA 1KH3A 1JDSA 1QHSA 5KDLA 3VPAA 3P9SA 4PZCA 3T5LA 3B38A 2IS6A 3A6GA 4JT9A 3ADCA 1Y6RA 3FTQA 3KYJB 3JZMA 1LBIA 2XO7A 3AYZB 1NAHA 4OMUA 1VLMA 1CNEA 3UT5A 2L5YA 3MR6A 1WUIS 5JATA 3IEVA 2HW8A 2AD1A 4HDCA 3AG6A 1VYTA 1XTJA 5LQUA 1L8AA 2R8PA 3N4MB 3TLZA 3SKVA 4YFVA 3R7NA 3KPYA 3WMEA 4BZZA 2QD5A 3AXSA 4N6OA 2QKYA 2QZPA 1I9GA 4UAYA 3CUUA 1Z22A 3V9PA 5IF9A 4CM8A 2X8JB 4R69A 2H1LA 4L3OA 3RODA 5KFVA 1AIPA 2PUJA 3LE8A 4UNRA 2Q5QA 1FO4A 2QU7A 3BF8A 1QP8A 4KI7A 1F4LA 1UM8A 3PUIA 2OT3B 3BH0A 3L1HA 3BQ1A 3NTQA 1ED1A 2YNMA 3R6TA 1TTPB 5BSGA 3H5OA 1VLJA 2BONA 2DHRA 5JAZA 3H1EA 5EXXA 3CW2C 4EL0A 3HZOA 2DH5A 1EPUA 2WF5A 3DDWA 5AVKA 2KWIA 5FA5A 3ZTWA 1PL0A 3PFHA 5T4EA 3GEMA 2E85A 4HLNA 1SQ5A 2ZIZA 2JH3A 3K9WA 5DE3A 2IDJA 3O3MB 3OCWA 3FBTA 3FAZA 1FYEA 4GOXA 1DBWA 1IXYA 2ABWA 5BMOA 5F76A 1ZQ9A 2VA2A 4R1MA 4YUAA 1QUEA 1NRXA 4HRAA 4DSJA 1P33A 1AB5A 2RHGB 5EKXA 1A8SA 2WIJA 5KG2A 2PA3A 5K0JA 3EXAA 1X74A 2RDMA 3GUVA 5AVJA 4B35A 1USWA 3PR2B 5JYDA 9ICOA 1E5XA 3CNBA 4DDKA 5ABPA 4KWTA 1O9HA 2MMGA 3JD4A 5TGTA 5CP8A 4Q7JB 2O8BA 1I8TA 3EGEA 4C1BA 5BOLA 3S3TA 4FQ7A 3FRHA 3AR2A 4CKEB 1FDIA 1MLDA 1X8KA 1IJBA 3ZQKA 3KKZA 2BLLA 3AR9A 1J8DA 1QM5A 3V1UA 4FFRA 1NF2A 1I0IA 4OHFA 4B3TB 4P08A 3DD5A 2EKLA 3O6VA 1J2NA 1YJCA 2H1VA 4JBLA 9ICPA 5KTMA 3RKUA 4DA4A 3O8LA 2B4AA 3ANMA 4UATA 4IHKA 4RKQA 5JFOA 5L1MA 4PQFA 3H5IA 4Z4IA 3ZK7A 4DUPA 3LWLA 1UEJA 5KNBD 1T0PA 1JZQA 1Z75A 2ZJ6A 3OZFA 4QU9A 2AWOA 2J3MA 2B9VA 1TQHA 3AOEA 4BKMA 1X94A 2MUTA 3GNTA 1U2DC 4XUSA 3X2FA 2AH5A 1N0HA 2OV3A 3WWPA 3HY4A 3BULA 4RVCA 5B3LA 4CLOB 1KMNA 1WPRA 3VMMA 2IZ7A 4OHMA 2JVKA 1C41A 1CETA 2Q2QA 1QGUA 2QI9F 1FX1A 1U8YA 4PINA 5TX7A 1JFLA 2MA1A 1B76A 1BNPA 3U7EB 1BN6A 1MJFA 5LVAA 1SZCA 3C1ZA 3IO5A 2FX3A 4QUEA 1KIFA 2KLBA 4F1JA 1J0DA 5IKXA 1YRHA 1HWYA 3I83A 1TAUA 2P7IA 3FYDA 2EYUA 2FMPA 3TZLA 1X1TA 4R6WA 4V1CI 5CDFA 1O03A 1C9MA 4KR7A 4QULA 5KFUA 3RT7A 2XKKA 1P5FA 3PXEA 4CM3A 1S9FA 3U7RA 3W6OA 5I6DA 3IBFA 2B4RO 1UM9B 1KJQA 4BFYA 2I71A 2FVYA 4NHOA 3PBKA 2JFNA 3OUTA 4G0XA 4WA7A 4EUNA 4R01A 3DEIA 4Q21A 1E2IA 2J07A 5K2OA 2AEMA 2O3RA 1DI0A 3JQDA 1APBA 1M8FA 5IK2A 3PFGA 1RLMA 1KJWA 2YBDA 2XRYA 2RHTA 3D7MA 5AVZA 2Q4BA 1S3SA 1VZ3A 2GTIA 3AF6A 1SOWA 4GMXA 1VPDA 5LUAA 4UHDA 4EF6A 4LQDA 1A0OA 2XF8A 2E6UX 4WCFC 3LW7A 4DT1A 4DCPA 4B3CA 4M49A 5LQMA 3KUXA 4JVOA 3L7BA 4PW0A 2JI7A 1JKJA 5CDTA 3RIGA 5CNIA 4HDQB 2QTCA 6ABPA 4K4HA 4JIGA 2QORA 1TK0A 2Z3ZA 3M9NB 3I34X 3T3EA 2BJVA 3QEKA 5KHAA 3JTEA 4PL2A 5DYIA 3RIHA 2XTNA 3SDSA 2WFZA 4KXQA 2H2IA 4L8LA 2WF9A 5FWDA 4GBJA 1XCGB 2IHZA 4R0VA 1HK7A 1K2VN 4F72A 3RG8A 4QXMA 1RQLA 5CB0A 4Q1AA 2C3MA 2YCLA 2QRZA 2QU8A 4IOKA 4OD0A 4QOSA 4KQFA 1V7PC 4XRRA 1J06A 4GPEA 5ALPA 3DMHA 4LJ8A 3R7DA 4F6RA 3EBPA 2D7CA 2FXIA 1FSGA 3LT1A 1RAFA 1TCUA 2G77B 1L7VC 4A8PA 1CB0A 3X1MA 1CS4C 1QLJA 2FSPA 3QXSA 4C29A 1F0MA 1IUNA 4UAGA 2UXBB 1EWKA 4U02A 3JALA 2A0UA 5TB5A 2XKAA 2H0QA 1UBMS 2OYCA 4XPZA 3K3PA 3T5CA 2Y1WA 2V7QD 2ZJ5A 5JADA 1Y8ZA 4Y6SA 2J46A 5DEOA 1DIRA 4TV9B 2YV2A 5LWHA 3B12A 1KWGA 3A2MA 3H0EA 1XCMA 3G1UA 3AP1A 3U26A 3AFNA 2ONCA 4BO4A 2JIBA 2P9BA 4M7WA 1OT3A 1T3NA 1RWVA 4BV3A 1Z3CA 3SYTA 5AW6A 2AHRA 4L07A 4UEKA 5KNLA 1XZNA 4CKWA 3KXLA 5KJEA 1AV7A 1LTHR 1XNHA 4Q3BA 5TY0A 9ICGA 4IOMA 1JP7A 1Q44A 3LC0A 2BN4A 3GEHA 3P45A 3TRJA 4QPDA 3TLJA 3UA4A 3SKXA 2WPDA 2PNJA 4YB8A 2ZRAA 3TANA 3ROMA 1W93A 2Q4TA 2VRWA 1Z12A 3A31A 2GWHA 4PO3X 3ASVA 1D4AA 3HJAA 3I04A 3LUBA 1TFUA 1QIEA 1U0LA 2P9CA 3LYLA 2P91A 1ISRA 1ZQOA 1DGJA 1IHPA 1UMDA 3LUDA 2VH5R 1OVMA 2AYXA 5LZ9A 3SQDA 4TM7A 3HSSA 4PANA 4RWZA 1SPBS 1GYRA 3MXTA 3NRWA 1U0EA 3LNCA 4DSOA 1CWUA 8ICHA 1Y1RA 4AICA 2BGTA 4ZH4A 4GWGA 3V55A 2SCUB 4DG8A 4HEA6 1QHXA 3M5PA 1HUZA 1Y48E 4EFKA 4F97A 2XYHA 1PJ2A 5EHNA 1AQYA 4ZWNA 4GI3A 4QD3A 2J1LA 3F8TA 2JBWA 4K40A 2B99A 2EIXA 4MR9B 4E5UA 4TS3A 5ALJA 3COZA 4BJ5A 1CLEA 3GRAA 5EUQB 3JQ7A 3OQBA 5JQGF 4AVYA 3R7WA 3DYBA 1A82A 1DAIA 5K3BA 4RQ5A 3MJHA 3D3EA 4AZTA 1ZCZA 2FP3A 3VYTB 4Y6LA 4M55A 3RC7A 1J2JA 3DE4X 3HC7A 2UXCB 3G2NA 3LWBA 4G37A 2VNIA 5IX8A 1Y42X 3F6RA 4N0DA 2BSQA 4G8BA 3K6KA 3Q6NA 3IT1A 4NAUA 1R0WA 2J45A 1QR2A 1YB7A 2H52A 1OH7A 3D31A 3OLQA 5THXA 1UA0A 4EZIA 5LQJA 2OV2A 4FGKA 4Q4AB 1XXHB 3ZN2A 1FW6A 3QV2A 2Q4RA 1L5UA 3KNZA 1EEHA 3FOFC 3A9UA 3ZBTA 1WB5A 2BZFA 2ZB3A 4AQYB 3L8GA 1EDEA 3QP9A 1CDEA 5LU8A 3TACB 5E7MA 1M3SA 2FWIA 1A4IA 1ZI6A 2Q1TA 2RHFA 1FVOA 1W85B 3P2OA 3RLFA 1T5DX 5JSHA 3A0BU 4G4IA 4OREX 1PG0A 1L1RA 4U7WA 5AW8A 3N6VA 1X92A 2TYSB 5EI5A 4AJJA 4QUDA 1PJRA 4RUKA 4JLJA 2XY6A 2OORC 3LO8A 2ZLBA 4YFYA 1BMDA 1G9XA 2D5AA 3B70A 2ASDA 1FF9A 1ZMTA 4YR2A 3ZYCA 3IIJA 2YWJA 3RAFC 2QD3A 2Q6OA 2I6GA 1P4GA 5FHRA 4RHCA 1CY7A 2Q45A 4YAGA 3L18A 4QDUA 3IJEB 2HBQA 3G23A 1EK2A 2P5YA 4U39A 4MA5A 5FADA 4KMOB 3IDSA 4DIDA 1MJGM 1Y3BE 2XRMA 2PA0A 3P26A 2HQ1A 5K09A 2OPBA 4EG1A 3GBSA 2E1RA 3TEJA 3P52A 2JGDB 2RI0A 4JT2A 3AR4A 3P97A 1YOVB 4OCZA 2PZGA 2RHHA 2PDAA 1D9ZA 2YZGA 1MC1A 4ZAGA 3QTTA 2IF2A 3YASA 3AMVA 3OE7A 4L08A 4OAQA 5I47A 1NURA 2QYSA 2SKDA 3CRW1 4L2IA 1ZXIA 5KJ1A 1AGNA 4UAUA 1UEIA 3A4IA 4BVGA 5EIBD 3R76A 4UB2A 2QPTA 5AI8A 1Q3UA 1GUAA 5JD6A 2ZWMA 3GEPA 4F4DA 4ECVA 4S0XA 5E7QA 1U0JA 1TTHA 4PXSA 1JLSA 3ZHBA 2H18A 1NR7A 3K7EA 2ZAIA 4KLEA 2RI6A 2X77A 2IYSA 4I55A 3ZJYA 2O2JA 3K0EA 4G5HA 2YY7A 3WDSA 2C0PA 5KT3A 4OI1A 2ACEA 4UMEA 4MINA 4WGFA 3WNQA 1GAQA 5MFPA 4G5FA 3F8SA 5SYMA 4QOGA 2G08A 2KZZA 2GYUA 1X9WA 5JWOA 3KALA 2JASA 3LECA 3WK4A 4WACA 3MWYW 3ZJUA 2NU8B 2WSYB 1Z5OA 5IP5A 2FZGA 4LXUA 3FNBA 2ZPUA 3FYUC 2BMWA 4ZARA 3CNHA 2JLAA 1UBGA 3OE5A 2LGJA 3TL2A 1PR3A 2ZRMA 2I1VB 4G4GA 3IIKA 4GXJA 3KOYA 4ER7A 3U7QA 1WUHS 1DWQA 3S70A 1WCIA 3H16A 3SBOA 2J0UB 4YCSA 3OFJA 3E03A 4BC0A 3N05A 3E4CA 5I51A 2JVJA 2AMVA 3OHSX 1QZUA 2XB9A 2QROA 1U9IC 4HSEA 5TNXA 1R74A 5IXJA 5FEUA 1SBQA 3PTZA 4LXGA 4ZOLA 4OJPA 3D2NA 3DHWC 4EGAA 3L0OA 4TURA 5EHQA 4IVRA 4GOOD 121PA 5KJ6A 3E0XA 4FMDB 4X7BA 5G02A 5JHGB 5MFZA 3PDHA 3CLUD 4CV0A 1R5NA 5LFAA 4TZKA 2DL0A 3KJHA 4BQQA 3KZOA 3FPEA 3IMCA 2YASA 4QYSA 1NN3A 2ZYWX 3VV2A 2P2SA 1DL5A 3PXUA 2QVZX 2WJ3A 3WO1A 3CKMA 1XPRA 2M9MA 1ETUA 2XA2A 3SJZA 2XAUA 3BD9A 2H2WA 4LFBB 3AUOA 1O8BA 4E4RA 4ZANA 5GAJA 4KITB 3HXTA 4JVSB 4MUIA 4I28A 3BA6A 4CKBA 1YT5A 2J30A 3O9VA 3M6MD 3VPXA 4ZREA 3KHSA 4U6SA 1OFUX 1U3DA 4RNNA 1NX6A 2HJHA 5B7NA 1UIMA 2OZKA 1N5LA 5IASA 1D6SA 3GRRA 3EVNA 4GXQA 5KNIA 4BQRA 3Q4GA 5ETJA 2GGSA 3LWMA 2K4EA 2QSUA 3CXRA 4MS4A 2MCFA 1HRDA 4ZAYA 5EE0A 2DWUA 1Q46A 2HLHA 7ICGA 5KTQA 2VS1A 1RFGE 3CKLA 4O9MA 3AM3A 2BPCA 4KFSA 1K2WA 3WBBA 2R8OA 4HT3B 1JIXA 3BRWD 4Y6QA 4NZMA 5KYKA 4UMFA 4KNVA 4LZOA 1G64A 1JMVA 3PW4A 2ET6A 4RK7A 2YYSA 1TCVA 3HS3A 1Q3TA 1XZMA 5ENDA 1OAOA 2ZPTX 2Y93A 1L7BA 2EW1A 2RARA 1EWRA 4U2FA 3IEPA 5JNUA 1M2EA 3QE2A 3UENA 4XWGA 5AVRA 3A25A 4KXUA 5C5CA 3OCYA 4BVFA 3CEPB 3ZZMA 3ICPA 2HT1A 5TLSA 2KVSA 1DADA 2W2KB 3H83A 4UW9A 1QO9A 4CU2A 3BJMA 2NSLA 2HJ9A 3GFPA 2VTKA 4RQ1A 2W6PA 1M66A 3DXFA 2W55A 3ONVA 1PHPA 2Z30A 2HDWA 3VR6A 3UV7A 1HGXA 2PT7A 1JIJA 1YKFA 3OP4A 4O3FA 1GPMA 4QXAA 1QG6A 5CR0A 1VLBA 2HNBA 4LJRA 3EPKA 4YAWA 3MM4A 4C0KA 4IRCA 4R1LA 4P86A 1R6XA 3IILA 3HN6A 4PRYA 1U04A 1YR9A 1SD2A 5HRUA 4QXQA 2XWJI 2VJYA 1ESZA 4R68A 5J2JA 4LA4A 1TKCA 3K94A 3R7AA 3SZUA 4XM2A 5IAKA 4EL5A 5C1IA 2EW2A 3M1LA 5FI3A 3L4BC 1JR3A 2YHAA 2MSDB 2OGUA 3A8TA 3COJA 1T4CA 2RGYA 2ZW9A 1CR0A 1X13A 4MWEA 3G5UA 1Z28A 4Y1EA 3LXXA 3L5KA 3MIZA 4XWKA 2HRCA 3F98A 3R9XA 4IHJB 2IF0A 4XQ0A 3VDNB 4YR3A 2F8TA 2F1RA 3D1JA 3ZY3A 5DCLA 2BPOA 2FRDA 1OLXB 2FN8A 4UHBA 1MV5A 5KFEA 1U0BB 1GL9B 4L8GA 1C8BA 5TT1A 2GI4A 1XJ5A 4R9NA 5B2FA 5EZ6B 4PC2A 2W58A 2EFHB 4TMXA 4D0RA 4PLWA 2WA1A 3O8QA 3GUYA 4B9MA 4WXMA 1NVFA 2CLFB 3TLGA 1HURA 2EEZA 4ZQHA 1RMQA 5DHUA 3ZCQA 1ZGBA 2HIGA 3I9V6 1KDRA 3BHMA 2BFNA 3GV8B 1PV2A 2E1PA 4ENUA 1L9XA 2Q5LA 2ZBGA 4P53A 1NNUA 1AK9A 1GKIA 4YMLA 4RKRA 3QLTA 3GFBA 3FLAA 4D41A 7ICTA 3A1FA 1IRXA 4BMYA 4ES6A 3PIRA 3WKAA 4ENVA 3AY7A 1JH9A 3NX4A 5HG0A 4Q6BA 3KYIB 1VI6A 2O2EA 4HPJB 3RAGA 4YX9A 3WI7A 2FJ0A 2ISPA 2AUMA 2O1WA 1W5SA 4RSRA 4DV2B 4RS4A 4EOGA 3O4VA 4JWTA 4L9SA 1K8YB 5AFSA 4D9MA 4R2KA 4BGIA 2BJWA 1B2LA 2D0OB 2ATCA 1BE1A 2ZIVA 4J7UA 1SPXA 5C5DA 5WRFA 2NPIA 5JLAA 3CQ9A 2ZE7A 5IANA 3A9VA 3CJTA 1YMUA 3MMZA 3G5AA 5BOVA 3CO5A 3L4SO 4RV4A 2CPRA 3DAOA 1JTEA 2J41A 4QFBA 4KAJA 4HX9A 5FNVB 4DOMA 1X8LA 2BUBA 4AMBA 4DKJA 3OFND 4R84A 4QM7A 5K45A 5LB2A 5HIIA 4NBWA 4YP9A 3D8HA 4U2EA 3QHPA 3BUSA 5HJ2A 2O06A 1C7ZA 3TSYA 2OGZA 1L2TA 1XZBA 4ZYVA 5F7OA 3CN7A 4RJIA 1PR2A 5IIOA 4BJHB 3ICOA 3IJPA 1ZHOA 1WBJB 4QIHA 3RU2A 3PUWA 1NF8A 2JZOA 2H7CA 3TM4A 3ORQA 2DMRA 3AB8A 4CCYA 2FZCA 2P66A 3DTYA 1CPYA 1PQ4A 4FK8A 2AGQA 1ZA1A 4B7CA 2KS6A 3IC5A 4EWLA 1QH1A 4K6HA 2NRXA 2DR3A 4F9EA 2EFGA 2VF8A 1V2GA 2FPPB 3PNVA 2VHQA 4HMPA 2CSUA 5ICGA 3BQTA 2RGBA 4KJZA 2ZBDA 5ALWA 5ALEA 4BFZA 2NU7B 3BHIA 4ER6A 4FO6A 1JAXA 2ZIGA 3T5BA 1ST3A 4NK5A 5T8KC 5B36A 2X58A 5EG5A 2J3KA 2XTMA 2Z6VA 1BMTA 2VZ0A 4GKVA 5I7WA 4IDFA 3WMWA 2XQVA 3ZV6A 1O89A 1XRNA 3C6BA 4WKPA 3RADC 2UYGA 4Q02A 2FFQA 5HIJA 1D6MA 5DBBA 2W3RA 4TQAA 3KEFA 4JB8A 2WHYA 1XVAA 3UAVA 1OJ7A 4AB1A 3MMSA 3FR8A 2GDZA 4H60A 2DXIA 3QTLA 4XWTA 5JRJA 4HY3A 1B93A 3II6X 2GJSA 1LDMA 3NIGB 4YWHA 1EK5A 3PV0A 3GJ3A 3MS4A 4DSAA 2ISCA 2WWFA 1ZZEA 2AWNA 3GPLA 3FKSA 4INPA 2QG9A 4XAQA 4K9SA 1JFFB 1F0YA 1YRWA 3ITNA 3SJ7A 2OD9A 3VKFA 2VOEA 4RFVA 1D1TA 1OYOA 3L8DA 1ZQDA 3T0GA 1KO8A 4A0GA 1DBPA 4GDFA 1QTMA 4J9SA 3WDKA 3GRVA 1A9OA 2PZJA 2L42A 4X71A 4EH1A 2Z7JA 3NOOA 5HTOA 4QZHA 2GOYA 1JU4A 1QRUA 2BSAA 5ICEA 2JFUA 1XVLA 1KVRA 4B6PA 3UMRA 3FFBA 1P5HA 1E6LA 4HEQA 1BS9A 3KHRA 3DKRA 2HBJA 4KACA 2PG3A 4TPKA 3R5SA 4AJKA 4MUXA 9ICCA 4E07A 1J90A 4C03A 3QA3E 2AN1A 5JNWA 4NY1A 3S1AA 5IJ9A 2DKFA 4D4KA 5DLDA 3OZBA 3OVMA 2EFJA 4AL4A 2NACA 3C3KA 1WUKS 3RANA 4IP0A 2R85A 2MT9A 5F9FA 2YY6A 2IPNA 4LF5B 2YYZA 3JYOA 2ARKA 3G1WA 2C5BA 2QF7A 3KZMA 3SR4A 3BBPA 3GEDA 4MITA 1UXGA 3UB4A 3R75A 2B5VA 1GZUA 3WLSA 3RYIA 2R62A 3Q7RA 5SY6A 1LH0A 4FNGA 2CFOA 3O4GA 4O5OA 4D45A 4O2BF 4ZQEA 2OCPA 1LPOA 1LZLA 3CEMA 5JIBA 1O5OA 3HBMA 3M9WA 1M1NA 1I9CA 4EJSC 3E8MA 3BVPA 3W8EA 5JPDA 1AGXA 3Q8PB 4LVUA 3I42A 2Q0ZX 3AVUA 2P0YA 3DP9A 4ID9A 1C4KA 3GAMA 1UMKA 3D5TA 1WHSB 2VAWA 3OBIA 2Y1JA 1R00A 3UNXA 4BB0A 1RI3A 2CJXA 3TRFA 3M9OB 1UPCA 3KD2A 3DMGA 5THKA 4A6DA 3RUIA 4EY3A 4OB7A 3GH3A 2JANA 1P8JA 3ZW7A 3R1IA 1L5HB 1DRKA 2VTEA 2OXTA 1CVRA 5AHOA 3N2EA 3ZWBA 3QE4A 4LJYA 1Y5NA 4M3NA 4C87A 2XYQA 2J9ZB 1MJ5A 3EPLA 1GNPA 3GK3A 4ZAFA 4O2AA 4W5RA 5HCUA 3SZ2A 1ODLA 5AOVA 4FJ2A 4QDZA 5ICSA 1I24A 1QSGA 1QHNA 1ODSA 1MXHA 2CFIA 1ECBA 4ZVTA 2BEWA 1HNWB 2BUAA 1WVMA 1L0BA 4U5XA 4KLHA 3KTAB 3CYFA 1KTQA 3BZWA 4YRSA 1WM1A 1TM3E 4QFDA 4FE3A 4C4TA 4X41A 3WWEA 1XEWY 4IZOA 4OFXA 5K3AA 4LMRA 4NCJA 2IUEA 4ZI3A 5EPOA 4P3YA 1PJBA 4LYEA 1GKYA 1NVVQ 2ZYAA 4MR8B 4QUIA 2L19A 5DT2A 1S5PA 5G1NA 4MIOA 4E5SA 4LV5B 4QAQA 3DBVO 1W34A 3IT3A 3DLBA 2XJ4A 1PFGA 3GJXC 4IDOA 1INLA 1G98A 2A58A 4X90A 4E0DA 1JHRA 4N7MA 1A8PA 4IXTA 2VPWA 1ZCFA 3VQTA 3TQRA 4CLDA 4Z0HO 5CCEA 4XUCA 1W73A 5K0FA 2XYVA 2PRJA 3EAQA 3WL7A 3G0DA 3JX9A 1ZJMA 5EZQA 1YGYA 1IJFA 2GESA 4X62B 1KFEB 4E31A 4MO2A 2P6NA 4BNVA 1HRKA 2IIPA 1JX4A 5FWXA 1VIDA 1TADA 1KO4A 5EPUA 3N2KB 1E64A 1A7UA 1SXDA 3IVRA 4G84A 1YDWA 3L9WA 1JPVA 1YDEA 3H2IA 2Q7DA 1QSYA 4TRMA 9ICIA 2V3WA 1PNRA 5K01A 2KI5A 1KJIA 4OGFA 3CLRD 2EX4A 3V6HA 3G9UA 3GL9A 2DWCA 4PX5A 2G67A 5P21A 5CIWA 3DNFA 2RGAA 2QZZA 5C1DA 3AMZA 4U63A 1RC1A 3AHGA 1VI2A 2VEOA 3FTCA 4ECXA 3FSJX 4PXAA 1UDXA 3SCZA 4HDNA 2LCQA 4LZPA 1V11A 4M04A 4ALLA 2BWJA 1CG6A 1NN0A 1XD2B 1T1JA 2BUCA 4HQRA 3WRYA 5H82A 1W87A 3T9FA 3PX0A 1TO1E 1OA0A 4G63A 5AUNB 3W5JA 1M6HA 1ZEMA 2V7XA 3UT6A 1AH2A 2NRTA 1LXCA 4O59O 3PHHA 1G55A 1C30B 1WU7A 2HN9A 2Y05A 4NDAA 2JA1A 4N0QA 4HP8A 1G63A 5E8RA 3RC8A 3DL0A 3Q98A 4G1EB 2HEGA 4LOJA 5D00A 4P4GA 5A6SB 1RRMA 3V80A 4ZDIA 2KM1A 4ZU6X 2LBPA 2VF2A 4DO9A 2QX4A 4D9IA 4K4IA 1A8QA 1VE1A 1Y1PA 4ALJA 1PU2A 4M9ZA 4ND4A 1QAMA 2BV3A 2WFAA 3F3YA 5LUBA 1RE1A 3V46A 3RH0A 5AKXA 2PWAA 2CHUA 2VSQA 4RHXA 3UKDA 4J9QA 1CCWA 3NT5A 2P3LA 3MGVA 3DOCA 2FG7C 5A9SB 1FZQA 1E0KA 4BMNA 2KZ3A 2Z8YA 4HXGA 1L4BA 3K9LA 3L4KA 4Q05A 2RFLA 4DL6A 4HUTA 5KYXB 1MQSA 3EEQA 4IX1A 4OH1A 4C21A 5LB4A 2QL6A 5DBFA 2CXOA 3VSAA 3A4NA 1XTTA 1RCFA 1W581 5I7RA 4M83A 1BKSB 2HLPA 4AM8A 3ZH9B 2O0HA 4ZU3A 3SU8A 3DAFA 3D7KA 4RX1A 3PC7A 1YZ7A 3W3AD 3HDGA 5K4HA 3NEYA 2W3SA 3BS5A 3GPCA 1QLNA 3NRCA 2PWYA 4NMLA 1HI9A 2ZSHA 3OMXA 2A5JA 1ZFNA 3OLXA 3OIVA 1NHGA 4CMHA 1J9EA 1ZZGA 2Q6VA 2QM3A 1QORA 5CURA 3I2JA 3V2UA 3ALRA 4ED1A 5J0RA 4WK0B 3KUKA 1KP3A 2FZEA 3ICVA 2Q5JA 4CM6A 2JF0A 1YI8A 3M0EA 1U02A 1QANA 3OAAD 2PKWA 3V3TA 3G7NA 2VHEA 4GLOA 3N7TA 1N56A 2C3PA 3FPCA 3U13A 3ECSA 4FIDA 4KHPB 4CR8A 1EP9A 3H6KA 3W9BA 3EUEA 2K5UA 4J0IA 2OXEA 2J5QA 1V1RA 4RAQA 2I8LA 2QKQA 4KLFA 2NU6B 3HV0A 3FNEA 2HTEA 3T7DA 5KYUA 2NT3A 1AF4A 4K1LA 2AU0A 2ORVA 1ZQVA 1L3VA 1JG1A 1LGYA 2VDJA 3LV8A 3DDUA 3Q7PA 4GAEA 3FXAA 1NVDA 3GJZA 2K4HA 2Q28A 5TJHA 4II2A 1D9DA 5A03A 3M4YA 3IIEA 1QXSA 2RGCA 3J80A 4ND1A 1DHTA 3SS9X 3DMTA 3JQ6A 2E1FA 2PH3A 4LXHA 4B76A 1W0KD 1ZN7A 1UFOA 1VSQA 2QZ9A 1H1LB 3PPYA 1TVKB 1JNXX 2WHXA 2OZLB 3BDAA 2QMYA 3MTDA 4C7OA 4CEJB 4J9MA 3QVGA 3AI7A 4EUSA 3GRKA 2H4XA 3AVQA 3EBLA 1QTRA 3A4TA 3KB6A 1WNFA 4Y0VA 3HJGA 1FNNA 1F06A 1OH8A 1KO1A 2G0AA 4G3IA 4EARA 1CRXA 5B1HA 2LCIA 3FCAA 2NYUA 2GDJA 3SXUA 1BG6A 1EUDB 4IJUA 4PPXA 3UN1A 3RRYA 2QTFA 3INYA 4QWMA 4BO1A 4RNMA 4IGFA 1X6VA 4TSFD 3MWDA 1Y8RB 4BYMA 2HPAA 3ZHTA 2MSNA 2WAQF 3PRYA 4YJDA 2JGFA 3GZ4A 5ALNA 3DJYA 1CJMA 1BNCA 2HWXA 4DXAA 1XVUA 4OJOA 4EHDA 1JHYA 3IB6A 1L5NA 2OO7A 4MFCA 1V39A 1TUBA 4L6AA 1CY1A 5COAA 5GPBA 3RS0A 4FGWA 1LI7A 3R4VA 1XZKA 4MUHA 1SK8A 4TOIA 1RACA 3PKZA 1X39A 4Y98A 1JMKC 5K8JB 3GMSA 3I2YX 1KI6B 5MN6A 4J91A 4LOKA 1A5AB 3H2ZA 4L51A 4MZDA 2Q99A 4A03A 4I2HA 1E0SA 4C0LA 3DD1A 4GXIA 1WP9A 1A9YA 2WP8J 2MYUA 2JIZD 1W36B 1J42A 4DV7B 3EXHB 5BYAA 3RSZA 4L78A 3V33A 1NMXA 2C28A 2PUBA 3PUJA 2RI1A 3B9BA 1BFUA 3SYNA 4LF9B 4KUGA 2GB4A 8ICLA 2M2IA 4ZOHC 4Y9DA 4DEZA 4CF7A 2ZBQA 2A5LA 2BCEA 3RLIA 2Y1KA 2DR2A 4ZVMA 2OCEA 5EZYB 1WD5A 1IQUA 4NYMQ 4HAXA 1M6NA 4OKNA 4LFAB 1WSDA 1CZRA 2GUWA 1SG6A 5J2UA 2G6BA 3RIEA 1ECGA 1W4ZA 3L4EA 3E9ZA 4IR9A 1QZTA 5H9VA 2W9CB 3W1EA 3N7RC 3WNCA 1GUDA 3ONDA 4XFDA 2GPSA 3SJBA 5CCDA 5EUMA 1ZQHA 5CP2A 1NDQA 5AMXA 4GLFA 1KAGA 3PFBA 4HAIA 5CYPA 1CQPA 1XDWA 1M1UA 4B3MB 3C6ZA 3P19A 2YWFA 1BX1A 2VLIA 1G8AA 1IXRC 4GRAA 3UXEA 4I2GA 4G3XA 5KOIA 1J22A 2JJMA 4V0OA 4E1VA 1JQKA 4C06A 4YT2A 3GGCA 3VHXB 3F2BA 3DBRB 4NBLA 2CLMB 1XKXA 3QE0A 5I9NA 5BSUA 1CZOA 3KJQA 2Z2IA 4RACA 2NVUA 1LJUA 5DNWA 1XCPA 2DKXA 1HE1C 4J4TA 5IFLA 2B78A 4JYCA 1GUFA 4M9HA 4PLHA 4Q9KA 2FPGB 3NIWA 4QEZA 3AUSA 4UDXX 4MR7A 3QXXA 4G0OA 3RRJA 1QIGA 5EESA 3UK2A 4XKJA 3RTEA 4ZDKA 4F4FA 1VB3A 2G9NA 3OOHA 4F60A 1DCTA 2G28A 3EDMA 4EG7A 4OM7A 3DUFA 1QTIA 1Y5MA 2GRJA 4LGVA 2X6RA 3C8HA 4X1YB 1UP7A 1KY4A 3D2QA 5IVIA 4BASA 2WUGA 2EBHX 4KBYA 1BVSA 5J2TA 3M89A 2Z4TA 1A9XA 1XNQB 3JRXA 3OE1A 4G5YA 2ZBUA 1V7ZA 3Q87B 3R3ZA 2RH9B 3OLVA 3IUPA 4JV5B 1QVAA 4J4HA 3MELA 1ZUNB 5BWMA 4OJ5A 1A8HA 1QH9A 1GDHA 2NV6A 1FB5A 3RS4A 1ZRHA 1UJMA 1HTBA 3SVZA 1M34A 4UOEA 3WKDA 1RHKA 4PO8A 3R6DA 1P6UA 4N49A 2YINC 5DM70 1JHAA 4MPDA 4QPPA 1F8FA 3ZD7A 3PQEA 1SXJB 1P5JA 2JEGA 1J8QA 5DEIA 2FVXA 4QICA 1FK8A 4Z6CA 3QX9A 1IQPA 2EP7A 1S0VA 2GZ2A 5DNYB 1ZQSA 1F17A 3IP1A 3OO1A 2VL7A 4OM8A 4Z3OA 4P2HA 4GYWA 3ZNQA 3IHTA 4H15A 2VTBB 2K8CB 4JJIA 1AS2A 2X14A 3WWCA 4NP6A 5JCOA 4BMSA 1TIPA 3AJDA 2Z43A 3D4PA 4YCDA 1UT8A 5K8LA 4Z3KA 1RXCA 3HJFA 3OQVA 3ZWXA 4DPLA 4MQMA 3OT1A 3Q72A 4OL0A 5CYFA 4R7GA 5JD3A 4TKUB 1RAIA 3ZGYA 3ZHYA 5EN4A 5AHXA 1GOTA 4UXHA 5KVAA 3PMLA 3UHFA 3OCUA 4JV1A 3SI8A 4HNRA 3LVBA 4UBIA 4MARA 1JMYA 1F0NA 4ECWA 2K2QB 3PNMA 2GJ4A 4AY2A 2GZSA 1JDBB 1EG2A 5BURA 4FBTA 3K9QO 2PMZC 3CF6R 1UDAA 2O59A 2ZUUA 4U4AA 4CQMA 4LZWA 1JGTA 3UT5B 1VSBA 1WZNA 1PKXA 3JW8A 1LX6A 4FDAA 2QUZA 4YECA 5L9XA 2ZE8A 2JEYA 1SA0A 1PL8A 2Y2VA 1DJQA 1PK9A 3WHIA 2BQUA 2Q6KA 3GGDA 4M0KA 5EJAA 3TINA 4WZZA 4ZO4A 5A62A 3D3WA 1ZITA 3H9JA 5DTIA 2CKDA 3FFXA 4CM8B 3H9BA 3DP7A 3V7JA 1RADA 4O08A 1J1ZA 2DBQA 2BEVB 3JVUA 4ARVA 1Y98A 4Y2SA 1H0KA 3GIJA 5CRXA 5ERGB 1DKUA 1DDGA 5FAXA 4RQ4A 2JZBA 4QELA 1RXYA 4XCQA 1Y5LA 3D0RA 1LY1A 4ZJUA 2HA4A 4I2AA 1N5XA 4J1TC 2W8KA 3D4LA 3W06A 4ZJZA 4IMIB 2ZQZA 3C3EA 1NKSA 3G0BA 3LZDA 4G1BA 4NAVA 3TH5A 5C35A 1I13A 3FFAA 2ZTEA 2P9TA 1YK1A 3ZHSA 5JNSA 4QWAA 2PN1A 3D5QA 4G41A 1TAQA 1C8KA 4WVLA 4MWOA 4P54A 1Y3AA 4B4OA 1E9BA 1BQEA 4DG5A 4D9NA 2VJ4A 5H9WA 4S1PA 5CA1F 2GZHA 5B1SA 4BQSA 3H2SA 3HV2A 3U4DA 5DDIP 3STWA 1NLFA 3VU8A 4RKYA 1D6JA 2JFWA 3OX4A 3I9JA 4YCLA 1R1DA 5KFBA 1UWCA 1R3DA 1H8ED 1WQ4A 1GU7A 5JMPA 2RKOA 9ICQA 2ZDGA 2FCAA 4KMSA 1HDCA 2O8BB 3LBFA 3GP5A 3S55A 4QZEA 2GEUA 4M76B 4QNMA 1N2CE 4X6YA 1MJHA 4JOCA 1UOOA 3D7RA 5IF3A 2QMQA 3ZDBA 4TT8A 1BCSA 3HU5A 1WB9A 1L5FA 1CQZA 2H54A 4QBTA 2WTBA 3K0BA 1H4VB 4J9NA 3KQUA 1FEZA 1C4WA 3GVCA 3UAOA 2XNDA 1ZQ1A 1K1EA 2O2XA 3C74A 3R3WA 3UYLA 3ICCA 2WIBA 3SLGA 1XZFA 3GLIE 4RWEA 3CRZA 4RV5A 3M6UA 5KWSA 4BDSA 1NZFA 5ALVA 1SHZA 2MUTB 4KXLA 1S97A 4D92A 1HLGA 1FRQA 1WNTA 4DHEA 2Z6AA 1YJQA 3OOWA 3HBNA 2IEDA 3DZHA 1SEVA 4URYR 2A9JA 4WOBA 2PL9A 4LHSA 1N48A 1KAOA 2APJA 4UPVA 2OHHA 1V4NA 4E94A 1LPNA 3ABOB 4PF1A 4BJ6A 4PPFA 3SM9A 2I65A 4U0KA 5HHHA 3PUHA 2I54A 5IXYA 5IVKA 3ZDQA 1X7HA 3MS2A 2IXGA 3SHVA 1KGDA 1J5EB 3WNDA 5H70A 4MB2A 5FJIA 1DIBA 1OTXA 2V97A 1XZCA 2GQ0A 2PQ0A 2QJTA 3D4OA 4F3RA 1B1AA 4OQFA 1ND5A 3RJ5A 1VFNA 4D3YA 3AP3A 3W5CA 3ET5A 3CW2A 4EY5A 3IVXA 2DEUA 2FEWB 4YI5A 3A3YA 1VGQA 2O0KA 2J87A 3M9LA 1NW7A 4MWBA 3DNMA 1KOJA 5J2EA 5IH7A 4OHBA 3NHJA 4LJ4A 5DG9A 5IHXA 2GK6A 2R5NA 1W59A 3ZU6A 5EJ9A 3OPNA 1N5IA 1UQTA 3GZJA 4INJA 4G9GA 4PZDA 2ORED 5DSZA 4QE3A 5T6BA 1JKFA 3RUDA 4Z4QA 2YFYA 3D6MA 3U56A 2AOUB 1JXOA 3ELWA 5BW6B 4JJZA 3IIMA 5DYYA 2FKAA 4MWZA 3L07A 3SP1A 2JGNA 3QZ8A 3QXJA 4KIJA 1V5IA 3Q3CA 4YCBA 2EYQA 3EDRA 1AA9A 1DAOA 4HNHA 4F9TA 1RPLA 4ECEA 2RHLA 1LBEA 2BTQB 2JFBA 3AG5A 2PMEA 1LK7A 2RIRA 4XWAA 1PKEA 2V1UA 2REBA 3IDQA 2MRLA 5AKGA 3GFQA 3ME5A 1GT91 4XOUA 4KWEA 1ADBA 1VBNA 1IJKA 3OIUA 3UB3A 5ECGC 1SOUA 3HEAA 2HJWA 3HUTA 1JKJB 4KH0A 3CLSD 2QL5A 5KFTA 2XITA 4X44A 4O0LA 1V9CA 3OD5A 3KTOA 2WINI 2VAXA 4D82A 3L6UA 3HDTA 3BAFA 3IUQA 1COWA 4I1VA 2EAPA 4HWGA 2DOKA 5IAGA 3F7TA 3R6LA 2YWHA 3HE3A 4BFVA 3HB1A 4CG0A 3E3AA 4I29A 4FDVA 1U2QA 2B98A 1N3YA 2C5HA 4MRRA 1UC8A 4K0RA 4UNSA 5FOQA 1THMA 4DCSA 4O3NA 4DS5A 2IELA 1WDKA 1P2SA 3NR2A 4HDOB 3G1TA 2Z58A 3ZGOA 4LI3X 1M2JA 4F6CA 3AL0C 4NARA 4FHDA 4OFBA 2AV6A 1IEXA 2X76A 4UPEA 3O90A 2WAXA 4G5SA 5KU7A 1H2XA 4ZPJA 5FCDA 4ZCLA 2IHKA 3TGPA 1OH6A 1KLNA 1UBNA 3H84A 2R0QC 4I5FA 4NEGA 2KQUA 3FCXA 3ZKWB 1JSCA 3PQDA 3I1IA 3GNSA 3Q3JB 1GFSA 3G2HA 4KQ9A 4PX3A 5LYYA 3QY9A 1U31A 4GZMA 1MFPA 3PSIA 1HXHA 5B3AA 2OHIA 4TL7A 2P30A 3N7AA 3BZKA 3P9ZA 4DXDA 4FEEA 1QO7A 3UCFA 5BPFA 3G2OA 2IQIA 2YQ4A 2NUPA 4S24A 1XSNA 3T7SA 5I45A 4CMCA 5K6TA 1HM5A 1EGMB 3B5IA 4IINA 2O2YA 2SHKA 4RA6A 3QFFA 2V6GA 5ECYA 4Y6RA 2VPZA 3N9IA 1Y33E 3VX4A 3L0CA 3A9SA 3HKBB 1RC8A 3A3PA 4PAGA 2IOHA 9ICLA 5KFWA 3L1UA 1YIAA 4TXNA 2YB4A 1Z0KA 2BPGA 1JFVA 2H00A 1Q1NA 1G6KA 2C7VA 4OTZA