2WHEA

Structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic Details of Near-Transition State Conformers for Enzyme Phosphoryl Transfer Revealed by Mgf-3 Rather Than by Phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wheA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wheA01
2C88A 5ALJA 4J03A 3M9LA 4DWOA 1VJRA 3A3YA 5AW1A 2RARA 1F5SA 5E0OA 3W5DA 4QJBA 3L0CA 1VFPA 3WK9A 4CNQA 4RESA 3L5KA 1RQNA 3NUQA 4NWIA 2YJ5A 4O8CA 3QUCA 5AI9A 1FEZA 3U19A 2W43A 4FFDA 4MWOA 3RF6A 3DAOA 4KX3A 1Z4OA 3NASA 4BYGA 5AI0A 4Y2SA 2EARA 2YJ3A 4KYTA 3ZVNA 3E8MA 4HGNA 3SF0A 5AIBA 4XE5A 3IB6A 1ZS9A 1Z4JA 1T9ZA 1Z4LA 5ALMA 4UARA 1RLOA 5A3RA 2FPUA 3E81A 3ZX4A 2I55A 4CF3A 1VJ5A 1Q91A 1L7MA 4UMEA 5ALUA 2JAWA 5ALNA 1Z4KA 1TJ3A 1SWVA 2FEAA 1Z4NA 3AR5A 4UAUA 3QU7A 5AKZA 4EENA 1JUDA 1QQ6A 5AW7A 2HF7A 3EPRA 4C4RA 3EF0A 2R8ZA 4NV0A 4L6CA 3P96A 4GIBA 2PR7A 3KOOA 2HF2A 2WF6A 1ZRNA 3OCYA 1YV9A 5ALEA 3I76A 3L0YA 4HGRA 5AK5A 1YMQA 5AKJA 2CN1A 3ESQA 1ZD4A 4YCMA 2FUCA 4BEWA 3NALA 2GHQA 4C4TA 4UM5A 3U7FB 3WKDA 2B8JA 3UM9A 4NABA 3TLMA 1J97A 3PGVA 5AKXA 5AVWA 2D2VA 3EWIA 4HAIA 2MU1A 3ZI4A 3WKAA 4JB3A 3QU2A 2C4NA 3CNHA 4CF5A 3KBBA 5AI4A 5AM3A 4XQ0A 1AQ6A 4UU1A 4DFDA 3ZX5A 4IFTA 2NO5A 1L7NA 2BDEA 3IJ5A 2JAUA 2HSZA 4YCLA 3ZWDA 4IG4A 1Z4IA 3A1DA 5AI6A 2Q4TA 1RKVA 1N8NA 5AKEA 2PKEA 1ZOLA 5AM5A 3QUQA 3WK6A 3VAYA 2WF8A 5AVTA 1T5SA 4KN8A 4AS3A 5AIAA 1SU4A 5AVVA 4AP9A 4KNVA 5AVSA 3I28A 2P9JA 2ODAA 1WPGA 4RETA 2JGAA 2EAUA 3AR2A 2NYVA 5ALXA 3SKYA 2EATA 5AM4A 3R09A 1YS9A 2IA5A 2R8EA 2P27A 1CR6A 3W5BA 1ZRMA 3DV9A 1U7PA 1Z4MA 3FVVA 4UATA 1IWOA 1U2SA 3FZQA 3CZ4A 1L6RA 4Y2XA 3DDHA 2B82A 1S8OA 4OD0A 2FPWA 2HO4A 4Y2RA 2WF9A 5ALIA 3U26A 1MH9A 3PGLA 3W5AA 3L1UA 2RB5A 3F9RA 1SWWA 4Y2PA 3QYPA 3QX7A 5AKKA 2ZBGA 3WKCA 2W11A 2Q4RA 2FI1A 2WHEA 3SD7A 1L8LA 2OBBA 2VKQA 2OYCA 3J7TA 3MC1A 3QXGA 4DCCA 3UMGA 2HHLA 3QLEA 1N9KA 2ZBFA 2YMPA 1O08A 2HI0A 4Y2VA 2R8YA 3OPXA 1RPZA 5ALQA 1TA0A 3QU5A 1QQ5A 2WFAA 1QH9A 5AI5A 2R8XA 1RRCA 3ZUPA 4XOUA 3U7EB 4YGYA 1QQ7A 2IYEA 5AK3A 3AR8A 4I9FA 2YBDA 5AK4A 3ZWKA 5AICA 2YJ6A 4FE3A 2P11A 2FPRA 2G08A 1WZCA 2ZG6A 1RLMA 4EX7A 4AS2A 3M1YA 2YMQA 2DQSA 3OCUA 4UMFA 3WKEA 5ALYA 4BNDA 2GHTA 4UAVA 1WR8A 2OM6A 2ZBDA 3FGOA 4J2TA 4CF4A 1K1EA 3KZXA 2G07A 4E88A 1L8OA 2YN4A 4XPZA 5AM0A 1NF2A 3AR9A 5T41A 1XVIA 2ZOSA 4KNWA 3K1ZA 5ALRA 1YDFA 1RMQA 2QYHA 4HGOA 4EX6A 4UM7A 4QQFA 3I1YA 1Q92A 2RAVA 1NRWA 5AKLA 4NAVA 2AUTA 2NO4A 1U02A 3PCTA 4BX3A 4BKMA 2YFYA 4FYPA 4HYTA 4F72A 3R9KA 2B1RA 1TE2A 2B1QA 3WK8A 3AR7A 1XPJA 2G0AA 4PNHA 2HOQA 3KC2A 1KYTA 2B8EA 1J8DA 4BEVA 2CFSA 4G9BA 5AI8A 2FUEA 2I6XA 4UU0A 1L7OA 1TJ5A 3A1CA 3L8GA 1NNLA 2B30A 3IRUA 1L7PA 2W4MA 2WM8A 1RMYA 1RC8A 1Y8AA 5AVYA 3E84A 3KD3A 4OFZA 5IS2A 4ZEXA 3WK7A 1EK1A 4B6JA 1RKUA 2FPXA 4YIKA 4DW8A 2GMWA 5AW5A 2I33A 3MPOA 5ALGA 2FPSA 2AMYA 2ZXEA 5AESA 3B9RA 2I54A 3WGUA 4Y2QA 2IOFA 3D6JA 3RFUA 3NRJA 3UMBA 1CQZA 1Z5UA 2BDUA 3FPBA 3N8GA 1RLTA 1O03A 1RKQA 1Z88A 5ALWA 3R4CA 2C8KA 1U2TA 4Y2YA 5FP0A 3L8FA 2X4DA 5AW8A 2I34A 2BY4A 5AK6A 1Z4QA 5AKHA 1PW5A 3MN1A 1RMTA 4YH1A 3OTQA 2G1AA 4UMDA 5AVZA 3OCZA 2I7DA 5ALOA 4JDPA 3QGMA 3ET5A 3ZTYA 4L6AA 4BX2A 5AW4A 4OCZA 1Z5GA 2PQ0A 5AKIA 1LVHA 5AHXA 4Y2UA 2O2XA 5IT0A 3QUTA 5AKGA 5AVUA 1X42A 1YJ5A 2WF7A 5AKYA 3SHQA 1XP5A 1S2OA 2GO7A 2IOFK 2MSNA 1LTQA 3I6BA 3ZTWA 1ZD3A 5AW2A 4HGPA 5A3SA 2FDRA 5AW9A 1WVIA 2GFHA 4BX0A 1T5TA 5AVXA 1QYIA 1RDFA 2C9MA 2JAOA 4ZEVA 2WF5A 2P69A 5ALKA 2YMMA 4NFLA 4GXTA 3ZU6A 3BA6A 4CE6A 1U7OA 2QLTA 1RQLA 3U7GA 3L7YA 5IT4A 5ALTA 1ZD2P 3HYCA 3SMVA 3PDWA 3SKXA 3QU9A 3QUBA 2HDOA 4L57A 2B0CA 3EF1A 2C8LA 4Y3UA 3NANA 2CFRA 3KDPA 5AW0A 3OCWA 2IOHA 3QNMA 3FPSA 3ONNA 4UMVA 3WGVA 4UW9A 3B9BA 4Y2JA 5AM2A 2ZBEA 5JJBA 3ZW7A 4OHFA 3N5KA 3NAMA 4BBJA 4UASA 4YCNA 5A3QA 3L8HA 3N07A 2YY6A 3QU4A 2Q5EA 4F71A 1TJ4A 5AW3A 3B8EA 1EK2A 2HEGA 3N1UA 4EZEA 5AM1A 2YMLA 1YNSA 2G09A 5ALHA 3FM9A 5ALDA 5ALPA 1ZJJA 2G06A 4H1WA 2JARA 5ALSA 3ET4A 3WK4A 1ZD5A 2CFTA 3L0BA 5AW6A 2G80A 3L1VA 3U7HB 5ALVA 3A1EA 2O9JA 3HLTA 3MMZA 5ALLA 2OA0A 4BNDB 4Y2TA 3SLRA 3E58A 4HGQA 2AH5A 3S6JA 4EELA 3W5CA 3ZVMA 3DNPA 3WK5A 2HX1A 4KX5A 4ZEWA 3L8EA 3AR3A 3GYGA 3BWVA 3ESRA 3ZVLA 3WKBA 3OCXA 3U13A 4MUMA 3ED5A 4YIHA 1Z4PX 5AVRA 4EEKA 3AR4A 3OCVA 3NIWA 4G63A 2HCFA 5ALFA 4I9GA 5ALZA 5AVQA 2YJ4A 4C4SA 3N28A 2AGVA 3UMCA 2RBKA 3AR6A 2MU2A
chains in the Genus database with same CATH superfamily
1Y0BA 2RARA 3K96A 4CUKA 2BFFA 1KTVA 2ZLBA 4NICA 3DZBA 1A82A 5TIIA 5KTOA 3O1IC 2YN2A 2CMDA 3QPCA 3I6ZA 1IU9A 4O4JF 5L9AA 1W47A 2B0JA 1MO6A 2ZP1A 3EB9A 5JADA 1JN0A 3SKVA 5DHPA 2PYIA 5A04A 4XWWA 3ELDA 2HD4A 4Q4HB 4WGGA 4ED6A 3OJFA 3GGSA 4GWLA 3HL4A 2HEIA 1S9DA 9ICEA 1GQRA 2BGTA 3MMNA 2HPAA 1B6RA 1RBZA 4IGIA 1LV5A 3W1VA 4R81A 2JASA 1RIIA 2HKIA 5CNJA 2VKTA 3MTGA 4NHEA 2XD9A 2R7LA 2O6KA 3I09A 3N2ZB 2JGFA 4C9BA 4PH5A 2JIQA 3QZ7A 2ZBVA 3CV3A 4L4RA 2E82A 2OWDA 2R7KA 1L5NA 4TMYA 3ZZMA 4XVQA 4ECXA 3T3MB 4M87A 5CLIA 1N2OA 3AEVA 3K94A 2QRGA 1SFRA 4KQ1A 2JGAA 1NDHA 2W2OA 1V8DA 4R64A 3D0RA 3T41A 3MGBA 2YTUA 2YIVX 4KXMA 1QO0A 2JGKA 1N61A 4K87A 4XARA 4ITRC 3TAUA 4ASUA 4GL2A 1MH9A 3KSUA 2YQ5A 2VXCA 2OBXA 3M6FA 4ZZ0A 2I62A 3SYMA 2G1KA 1QRAA 1AB5A 4AZVA 5KPJA 1FIUA 2P6RA 2V6GA 4HH1A 3GH1A 1H0HA 3DUFB 5I7VA 3Q40A 1W44A 3NHPA 4XFKA 1NVKA 2CVFA 3PA8A 4QGBA 4CDRA 2L0XA 3BL6A 1OFUX 4DV6B 1YNOA 3NHRA 1ZHOA 1VZ3A 5KQPA 4NCXA 3E1GA 1GYQA 1X8XA 1RXSA 3ANLA 1PL6A 3O7MA 1JRLA 4UM7A 7ICLA 2GUWA 5LLDA 5JJLA 3V1LA 3C8DA 2XCOA 3EUEA 1C29B 3VXKA 3KK0A 1RRKA 2D13A 4BDPA 1MW8X 2Y1FA 1WTAA 2MYNA 2JLQA 2FPGA 1O0SA 1R6TA 3L02A 3EARA 4O0LA 2A1TR 1DB3A 3GLHB 4QTTB 4K26A 3WV4A 4I1RA 1TNDA 4J0DA 3EXHA 2ZXEA 3ICEA 3ABRB 2I54A 4BASA 1G3RA 2XGPA 3CE6A 1IBCA 4QATA 3OFJA 1C7JA 1HA3A 1K7CA 4G86A 2AFHE 1XMIA 1XDSA 2KD1A 1U5BB 1ODFA 4H59A 1I2DA 3TGLA 5CA0F 2X2OA 3OT5A 1P73A 2HSDA 2WNHA 3EXAA 4K9RA 4FDAA 3IV9A 3AERB 1T8YA 3E3LA 2HFKA 4UOZA 5DN6D 4PZNA 2GAOA 4TVBA 2B6HA 4N47A 9LDBA 3SDBA 4WINA 4X64B 2Q41A 4ZEOA 4MKFA 2QL6A 3PFHA 3DL7A 3VOBA 3E22B 4BNXA 4J90A 2QPAA 3DVAA 4PPYA 4PSDA 3GEDA 1QVRA 3DBLB 2OGSA 3IAM1 2XIDA 5T67A 5JVDB 3HUEA 3ZW7A 4IVPA 4NLLA 4PNZA 1GZHB 3PX2A 1BA2A 3D8TA 3V72A 2ZT5A 1MOSA 4Z3KA 4DXHA 3U3OA 3FDSA 4LYAA 3T5MA 4NP6A 2LCQA 2H1FA 3NBAA 1JALA 1DJPA 1QCDA 1JE0A 2ZTDA 5M7EA 1KLNA 1Z5WA 1E1CA 4J0HA 2F3UA 2VHTA 1VRWA 3PG5A 1OMOA 2WINI 3A31A 4L51A 2OR3A 5BN4A 3V8MA 4KK4A 1Q16A 1XPRA 3F53A 4OAPA 4BAZA 2X5OA 2XDWA 3PXDA 5I47A 4ARZA 4W9NA 3D3NA 1YQUA 3SU8A 4NARA 4J9LA 4TMWA 4Q00A 4QZGA 3EQ2A 3LW7A 4XOIA 1XU9A 1AN9A 4CKZA 6ADHA 4OUDB 5FLXA 1TM5E 1SCNE 1IY0A 4YJHA 4JJAA 1YJBA 3E81A 3SZ3A 3X1WA 1AD2A 2NQTA 1ZIDA 2POCA 3FAKA 5T4HA 1IE3A 2Z5LA 3SC2A 4LRUA 5JH7A 4FSXA 3KQSA 2ZPAA 3V8PA 3WP1B 4Z6CA 1D6SA 4PL2A 3I2JA 1GKKA 4WZAB 1KEEA 2JW5A 3KJQA 3JU3A 4EL5A 4B73A 4KUEA 4U4AA 2ZJBA 3AONB 5FTWA 3D1LA 1CJVC 3HCNA 1AKWA 1IRIA 4URWR 3A58B 4Q9JA 4M3NA 1YQ9A 3TIVA 2X4IA 3K70B 4EZIA 2CB9A 4R84A 3V97A 2HZ7A 1YCHA 1QDUA 4U7DA 4BRSA 5BUZA 2CKDA 2Q9UA 4TMZA 5DV9A 4KI7A 1QG0A 2AXTU 5HK8A 2JI7A 5C0YA 2AQ8A 4DEVA 3C1TA 3Q5GA 2BHLA 3R3JA 2H5LA 3AYZB 1XTBA 1M6HA 2V1UA 3G0BA 2G4VA 3CLSD 3LKDA 3UMGA 2G5HB 2ZBFA 2GGSA 1JAIA 1UBEA 5KYXA 2XQVA 4O5EA 1JHXA 1GL9B 3IHLA 4IOJA 5D5HA 2JC3A 2GYVA 4FZLA 3H8SA 1P4RA 3PUHA 1U9JA 2CZGA 1SKAA 2DFPA 1I7NA 4G5QA 5K03A 4XPIA 1W85A 2E4WA 2IJGX 2R96A 2D5AA 3PHGA 3H2GA 1ULAA 3PXGA 4LXQA 4F2HA 3ROEA 2O5CA 4BKMA 1Z8NA 3ZZ1A 3KJZA 4R9UC 7REQB 5EY5B 4OLAA 2QZSA 5JALA 2WVAA 1PAUA 3ND8A 4YA6A 4NI5A 5I7FA 4JB0A 4PPNA 4BB0A 5IAOA 3KE9A 5CM9C 2B25A 1DWQA 1PIWA 4EMBA 2HOFA 3CVWA 4DKXA 5ICCA 1D4FA 3UJCA 4ZEXA 2PVCA 1M8FA 4OV6B 5LR6A 4U7JA 3H2ZA 5C7LO 3IG5A 5BNWA 3C8HA 2H4JA 1O6ZA 4J94A 1W2GA 3W2TA 4QEZA 4YRSA 1CUHA 1QR6A 3WIOA 2R60A 4XWTA 1I2ZA 3DR5A 3ZTYA 3KOXA 5IDVA 5KFWA 3S2SA 3ICXA 2W4IA 1RI1A 1SV0C 3O4VA 4BO8A 4MCIA 3FDZB 4BHTA 3RC1A 2ZWAA 1W4RA 3HB4X 4BOYA 1KJNA 3DHYA 3IPRA 1VE7A 2R66A 1RDFA 4MF8A 3A11A 3KT3A 1Z25A 5KG1A 4QW9A 1U7OA 1OLSB 1M6EX 1KZ6A 4YACA 3BAFA 2BCSA 4DADA 4OXKA 4FZ5A 3ZIAD 5LD2C 3S44A 2KICA 3C3AA 1ZUWA 1OWOA 1OXVA 3HKDB 3OX4A 3AU2A 4EUEA 4I2GA 4D8XA 3UGJA 5L45A 3F9CA 4LI3X 5J5AA 1UXHA 4W1QA 1SUBA 4HNSA 1U0TA 5J2AA 1FXWA 1EBUA 1DRWA 5JOQA 1ZONA 4U3JB 1PLLA 3TQRA 3ZVMA 4V1CB 1U11A 2Q1TA 2X22A 1NRIA 1ZRSA 2YVAA 3GFKB 5AP9A 4CDMA 3BWVA 1RRPA 2DTDA 2PQ6A 4X91A 2JJQA 3W5HA 2WEKA 2IE8A 5JJKA 3PSIA 1JIXA 1BS9A 1F5SA 2AVNA 3C2KA 4P4SB 3L4BA 5JECA 1BXRA 2KLBA 4O8CA 3SQLA 2D6FC 2WAOA 2EWWA 3EZXA 4WBNA 2RP5A 4PLTA 1R66A 2WSBA 3TX2A 2V3WA 4CCSA 1EP2B 5TQ0A 1OXBB 1V1RB 1YTLA 3DM9B 3VTZA 2ZB7A 2D1RA 4XWYA 2OLEA 4IUDS 1JUDA 2GK6A 4KDCA 5IXJA 4XDZA 1NP6A 3HDHA 3KTFA 1GNPA 4I1SA 2SBTA 2G9ZA 4F4IA 3UMJA 4MYHA 3K0CC 4DSLA 1AB6A 3IHWA 3ETLA 3H42B 3K09A 3UUFA 1ZD4A 3JAWB 1MBZA 2ATXA 4YCXA 5REQB 2PMDA 2NZXA 4POOA 5BSFA 3EK2A 1TQDA 4A8JC 4IKEA 1HKHA 5HW0A 1QVZA 3DUFA 2CXXA 2O2GA 4IX9A 5JISA 3MB5A 1OLUB 1BMFD 3CXRA 2QMZA 2SKCA 1F8FA 2NXJA 4FLEA 4P86A 3UXYA 3O47A 4ENWA 3LTEA 1NM5A 2C2KA 1L1RA 4GF5A 3GNLA 4I50F 5CB4F 3PEEA 4DQQA 1WEHA 5FL3A 2FKAA 5BR1A 2PGOA 4Z7NB 4DBZA 2DC1A 1TMYA 1Z7WA 1VRVA 4BO0A 3TLXA 3Q7IA 1HPLA 2XUDA 5KG6A 3GMIA 1H8HD 5JBNA 1JB9A 1JQEA 4LCBA 2EYQA 4IRMA 3MXTA 1IXRA 5LMZA 2EWVA 3NVKI 2B5WA 5E3JA 1K7XB 1RLMA 2P9ZA 1XD8A 2YXDA 1JG7A 1WVMA 1M2OB 4Q5IA 2VSXA 3RCBA 1RHJA 3I3SR 3I52A 4NV1A 3FGOA 4U2FA 3CX8A 3K8ZA 2P9QA 4BFYA 1NN1A 3HM2A 4D9CA 1X9SA 1BVYF 2QMQA 5A2QA 2O59A 2GYUA 4EX6A 3AZQA 4WZZA 1II8B 1U5BA 2BGIA 3LFUA 2CZQA 4HYTA 4Y1RA 4BFLA 3A6EA 3TDMA 2ASVA 2PH3A 2QRPA 4I4TB 3WLSA 2RI1A 3C5WP 1N7IA 3AK4A 3V42A 3V8RA 3I9OA 4H0FA 1UIMA 3T3FA 5J1SB 2IU6A 1WPRA 1ZQHA 2BDTA 4PGAA 4QE3A 2ONKA 2J6UA 5CH3A 3MUFA 3E22A 3LCRA 3O83A 1GWNA 1CJCA 2IXFA 3WQRA 1W5SA 3N86A 3BHMA 3DBLA 4DE5A 5KQMA 2Q5CA 4F3NA 4ZHQF 3PD0A 4KOEC 1QMGA 3I6BA 2IPMA 4DDWA 1YVRA 4ETNA 5K4GA 1I2BA 1XN1A 4PZEA 1O97C 4CV2A 1H9BA 2JAQA 1GN9A 1TUEA 5FTMA 3F71A 5EJ4A 3G9XA 2BEVA 1XZBA 3D4BA 4YWHA 4C21A 3T9BA 4TYWA 1VMKA 2W6MA 4AG5A 3TANA 1JAYA 4DYHA 2BR0A 4L4XA 3NCTA 1PL8A 3K5PA 4KOAA 1DIHA 2IPOA 3N4MB 2VZ8A 1A7JA 4BQFA 4RMNA 1UPTA 3AVYA 5HJ5A 4ND4A 1E2PA 5HK9A 1C3EA 4P92A 3GHYA 2WJPA 3B1FA 1ZX1A 2OC4A 4JQOA 3TUJC 2ZXHA 4YLEA 1Z19A 2HLDD 1HDIA 1CYEA 1PYGA 3ZK7A 1VLJA 5KFGA 2WIFA 3NX4A 3RUCA 3NDBB 4US9A 2JEFA 2CCKA 1RPTA 2DQZA 2MIIA 3SSNA 3OBBA 3FDXA 4REMA 5CB1A 1Z29A 4A8PA 2XHZA 1VKHA 1OFTA 3AB7A 1RI3A 3VJMA 3AW8A 2RBKA 1MOZA 5DGXA 2WMDA 4HYKA 3RBAA 4DMGA 4WZAA 4ECWA 4REOA 1SOWA 3I5YA 5AJYA 4ACAA 1ES9A 2M6SA 2CLKB 5EHXA 1YZGA 4FI3C 3L6BA 1KBOA 4TWJA 3WU2U 3Q3VA 2IYSA 3U40A 3J81A 3MJEA 3KU4A 4FQ8A 2JEJA 2DOKA 4D4HA 4WZBE 2XCUA 2C3PA 4ZAXA 4C3OB 1JI3A 2K87A 2CNBA 3MBOA 4HNRA 5BWLA 2HF7A 5JCPA 1LGYA 2PFSA 1WLSA 4N3NA 3N74A 3DMHA 4GIBA 1W0JA 3QNUA 3ZWNA 4B9TA 3NGXA 1NOJA 2ZIFA 4K9OA 4IWYA 5IIOA 3UA3A 1E62A 4E22A 4OQNA 1YDEA 1RYUA 3F47A 1KYWA 4KLJA 2D06A 4W5OA 4YCLA 4KQCA 4LYEA 2K2WA 4LF4B 4OB8A 1TQ2A 4C1BA 4FMCF 3G7SA 4L9WA 2F3QA 3LDHA 1WPGA 2G71A 5HIIA 5KKNB 5GV7A 3VPGA 2FWMX 2HRBA 2NXNA 4NDAA 3RAPR 5DOZA 3QJGA 3MTAA 1NJ8A 3D4OA 3PGLA 3SVZA 3T6KA 3GAFA 1JFFA 1NFQA 1ZI8A 1PK3A 3GV8B 5BOMA 2EH9A 2O8FB 1P4GA 1I3KA 4B4OA 4MZDA 1AK9A 3OIVA 3MQ2A 1TA0A 2HMYB 1JDPA 2GLEA 1L5GB 2O52A 3R5KA 4MW9A 1GOTA 4QUBA 1FVOA 2V9WA 1R18A 1XC7A 3D6VA 3M1YA 2QN6A 4LAFA 3MS2A 4N5LA 1E9SA 3FVQA 4Y6PA 2CKMA 2PPVA 4H15A 1KDVA 5DTRA 3SOPA 5HILA 2XB9A 1KZYC 1SXJC 4ZO6A 4AJPA 1ONOA 4FFBA 3UO8B 4M7OA 3K0FA 3E27A 5JMTA 4YYZA 1RWXA 3B6KA 4NXZA 5BRAA 3TRFA 4IQ8A 1LRLA 1YBHA 4YC7A 4JBHA 3OZBA 3BB4A 3FDZA 1Z5ZA 2XA1A 3GA7A 3QFHA 3KSBC 5BV0A 4DNFA 1WKVA 4EUSA 3FWNA 1BHO1 2FQ1A 4QGSA 4O2BB 3OETA 1OLSA 2BLNA 4ACBA 4NE7A 1CPYA 1O96A 1RLTA 3KAQA 5C8ZA 3AETB 1NA5A 5FPYA 3E4CA 4BFZA 4I4CA 4KB5A 1I7DA 3PD7A 4EW1A 4WK4B 4UOEA 1N2GA 1K98A 3TXYA 3HKDA 3DZIA 4JELA 1M74A 3ZCTA 1O4VA 1LI4A 2EKBA 3BTVA 3TW8B 5HRCA 2W6CX 1H23A 3PQCA 1S77D 1LTQA 2P2NA 3BCUA 2IH5A 5IVHA 3RS7A 4XD2A 2ORED 5CH8A 1GR1A 1J0EA 1SD1A 2FG5A 2CK3A 3Q9NA 1J0AA 4DR1B 3L7YA 3GGOA 4N4AA 4FEGA 3LBAA 4AMGA 1JNXX 4V3CA 4R1MA 4O5KA 1J5XA 4HRYA 4F85A 4N7JA 4JVNA 1B43A 2KZMA 2PMCA 3BK2A 5JMPA 1V38A 1X1AA 2FZEA 3VX4A 4CKWB 2BSQA 1V85A 3EEQA 1YNSA 3EBPA 2WHPA 4HLDA 1J09A 3FUCA 4B8WA 2PEZA 3AF6A 1V4VA 4MEBA 4AKHA 4YDHB 3T1VA 4DGQA 1UZAA 4MV1A 3O82A 3T54A 3OPNA 2QXYA 2H0AA 1VDZA 2EBFX 4QRHA 1A9OA 1RZRD 5EQDA 1SRQA 2ZAOA 1HURA 2OKGA 3ZGOA 3VBCA 2ACVA 4B3JA 1FOEB 3H99A 5JTTA 3IDWA 3H6KA 4EKEA 4CN8A 1E3TA 4NMMA 2GF0A 2XNDA 4E1AA 4PGYA 4WA7A 3X2EA 4MW6A 2BFAA 3VSEA 3JAWA 2VA8A 4MWOA 3QVJA 4DL7A 1ENZA 4KRXA 1V11B 2QYSA 2I7XA 4ZOLA 2HW8A 1M2HA 4KYTA 2IVZA 4AMVA 3FPFA 2WNIA 5KOHA 4LG1A 2OK7A 4Q12A 1IOLA 1DGJA 2DHQA 5HGXA 3TO5A 1BD4A 4AIIA 1Z75A 4GNRA 2DY1A 4F04A 2HCRA 3II6X 1LF5A 4MCHA 1CWUA 2VWPA 2AZTA 1D1PA 2Z9CA 4B81A 3CISA 2W9XA 1RAHA 3GNQA 4YRJA 3LKZA 2HSJA 2ZJ2A 3ESQA 2IXGA 3PX4A 2EIHA 1UKBA 1K89A 4J49A 1LZLA 1JWBB 4P4OA 3ASVA 2F2AB 3MTIA 5ESXA 2PZEA 3U5ZB 1UBLS 4KUGA 1GGHA 3SVLA 1TAHA 4TV9A 5EPUA 4IBOA 3BQ1A 5JQWA 3MCVA 3DFFA 5AKEA 3BS4A 4K1LA 5A9SB 2F64A 5K45A 2IEIA 1JJBA 1JU4A 1TYAE 3OPMA 5ICGA 4M0LA 2HQRA 3QM1A 4PG7A 2XE6A 4CETA 4G8DA 2ZTSA 4G5XA 4RKFA 3LUDA 2ZAIA 4EGAA 4W7IA 4RSRA 2GRAA 1ODKA 1KR2A 2WF9A 1X8JA 2RB5A 4ZC1A 1CE8B 4WNAB 3RIEA 3LX4A 2G9UA 2IYTA 2HBLA 4UHJA 1CY2A 3UQ0A 2AC2A 3WGHA 5K8JB 16PKA 3KALA 4HP8A 5IDYA 4UB1A 1HSOA 3IHKA 3L9XA 2DVMA 1OXSC 5CEFA 2IHNA 2WU8A 3PCXA 1WY5A 2F2TA 2Z95A 1YXMA 2WJ3A 2BZGA 4CMCA 1G18A 4DLGA 3BFXA 2N0SA 3I62A 2DQ4A 3BA1A 4M0UA 4KLHA 4D8VA 2R00C 4YREA 3RK1A 3FYHA 4D9NA 4P5PA 3TIFA 5TEWA 2CDRA 2QI9C 2ERXA 2ODEA 2ZSHA 1D6MA 2P5YA 3BIFA 3PPYA 3L82B 2B30A 4R0MA 3L93A 4QUDA 2X1HA 1T2CA 1CJMA 3E5MA 2E4XA 1IULA 4BE7B 3SQMA 3WJ1A 4TT3D 3ZXYA 2WT9A 3F5FA 2IQ5A 7MHTA 4DHEA 1YVDA 3UMBA 3PP8A 5AXBA 3ZBQA 4TUYA 3V3TA 1PFYA 1T6XA 4OQQA 1VBFA 4DQXA 1JHRA 3ELYA 2PN1A 4OLFA 1U3TA 5FOVA 4M9GA 5H0IA 1DG1G 1M6VA 2SHKA 3TS1A 1O6BA 4LYHA 1GPYA 4EDFA 1U2GA 2IP4A 2O2YA 4MUHA 3K15A 2GZDA 1BGXT 4AZ3B 5EEHA 2P68A 1XTZA 4BX0A 2VK2A 3PC7A 3OQ1A 1PNVA 3IEVA 3OY2A 4BVHA 3UJ3X 2PAAA 2AQ4A 4U02A 3WWPA 3F46A 1GM5A 3AJ9A 4WESA 3AGPA 1QRUA 3ONNA 1GPH1 2ZJAA 4P7KA 2XOKA 5EQJB 4Q93A 5F2OA 3RVRA 1N25A 1VSVA 1S2MA 5EXTA 2QM3A 2X14A 1XZHA 3KPUA 3PC3A 3JWEA 9LDTA 1XCOA 3L1VA 2ZCJA 1QQTA 2FR1A 4IO1A 5ALLA 4BNDB 4Y2TA 4ECYA 2JZBB 1KIMA 3HW8A 3A4NA 3C39A 3K53A 3BD9A 2I3AA 3DEAA 4LYGA 2QRQA 4FWIB 2FW1A 4Q3AA 4GXKA 1JGTA 4DIBA 1PJRA 2XBUA 3EGXA 5G1NA 1EVQA 1XV5A 4U00A 1SIBE 3R6TA 4Q6WA 1RE1A 1A9YA 3UHAA 3DOCA 4MA4A 4LJSA 2B8WA 3D3EA 4IPTA 2WJIA 5IAJA 4DCMA 2GBGA 4B40A 4XVCA 2IZ6A 1VXOA 2L82A 4CTOA 5FHQA 4JITA 1RAIA 1P81A 1FA9A 1FRQA 3RUPA 4KXNA 2PFKA 2R5NA 4F5NA 4CM5A 4UMEA 5DB6A 3HXKA 3GLIB 5CM8B 5EFZA 2PBFA 4HRXA 4BVFA 3MLBA 2BEWB 2HF2A 4A0QA 2WF6A 3T7AA 2XT9A 1S2GA 2ZVJA 3SBOA 2MA1A 2NNLD 5KWVA 4WV3A 5LYJF 3BJYA 4IUBS 1AKEA 2OAGA 4B9LA 3A0UA 3TR6A 4JGIA 2GETA 4PFKA 1TFUA 3D6FA 4R3NA 1P44A 3KHHA 4A23A 4KQEA 3DC2A 3E18A 1GDHA 1T2NA 13PKA 1FUKA 1SD5A 2RGWA 3T1HB 3P0EA 3VPFA 3GBVA 3NO4A 3TLKA 3D8SA 3HYLA 3I8SA 3FVTA 2VQEB 1QVVA 1U81A 4I55F 3TM5A 2QTNA 5CVCA 2IYFA 4BQNA 5FI5A 1XTJA 3D6AA 3N87A 1LW7A 3LS2A 2ZM6B 4KMSA 3EOAI 1FNDA 2O3TA 4L02A 3BSWA 1IIPA 1EH5A 1UK6A 4HDSA 1E94E 2HIAA 3QLEA 3MTJA 1R15A 2WP8J 1I01A 4P98A 1TTQB 4AUMA 4I81A 4PG8A 3MS7A 4J7UA 3AJ8A 1U2DA 4YRGA 3WZ2A 1NIPA 1Z5OA 2WRZA 3B5EA 3Q8SB 4EB6B 1SXDA 1DRJA 1U9IC 1N8SA 1QV6A 4O2BA 3U3JA 4M9LA 3AETA 4UCQA 2QA5A 2B92A 1E79D 4ND7A 1WYGA 2JGRA 3J80A 4EO7A 3KUCA 2J6SA 1QGYA 5JDCA 5KU7A 2JCVA 4HXEB 1H42A 1ECCA 1FBNA 4NXMB 2YCBA 1BHQ1 2JRLA 3ZK9A 2UVRA 3TW8A 1LWOA 3T94A 1KJQA 3C3EA 1GXSB 1MC8A 1QHGA 1MV5A 3G2IA 5A7HA 1U94A 5GWXA 3BWBA 2JLYA 1ICIA 3ON5A 4DMKA 4U63A 5TARA 1DKQA 4NZNA 3V32A 3CONA 1RSZA 2BDUA 2JPDA 5JZSA 3C5HA 4U7GA 4X1KA 3RFXA 1G19A 1ABEA 1OWMA 2JGDB 1FTGA 1G8GA 3ADOA 2J9FA 1Y6QA 4C2BA 4BZQA 5AVUA 4PXAA 3F6EX 1G7CA 1RYEA 2MYTA 2YV3A 1ONBA 1UT6A 2QGNA 4ICIA 3SS9X 2BCEA 5DNAA 4F5OA 1X7WA 4UVHA 2WF5A 5CYPA 5HM6A 4Z9AA 4QTZA 4AICA 4PZYA 3LSYA 1T5BA 1FUUA 4U5XA 1KN5A 1TRKA 3EMVA 4WSOA 4JJZA 3A2LA 4I4NA 3DGFC 4QU9A 1VHJA 1Z34A 4HWKA 3UB3A 5BQPA 4Y6QA 4FLMA 4BFXA 4P4UA 3BZKA 4K6HA 1V11A 3WNCA 3A4MA 4JVMA 2HBMA 2YIMA 5H9WA 5L40A 2GZHA 4NMWA 4G5FA 2R11A 4BXOB 5CXUA 1H2RS 4E1BA 4YFKA 5PNTA 4ED8A 3KHKA 1GA1A 4BTEA 4DA7A 5D46A 4H6XA 2NZYA 1MZPA 1CRPA 4BNUA 1BN7A 2DR3A 3NYRA 4MKZA 3OHMA 4RK0A 4AFNA 1ISHA 1ZBQA 2YWXA 1GV1A 3NHYA 2VRNA 5EGSA 1GHTA 3LX6A 1DWUA 1NPYA 3ZVNA 3EE6A 4OQPA 3PGJA 3VBEA 4C0XA 1AHNA 3DONA 4AWAA 1CW2B 2WT8A 4TQGA 4O5OA 1A77A 3WXBA 2EQYA 2QN7A 1M6WA 4E33A 4TTIA 2X40A 4NLGA 1V97A 2R6JA 2C78A 1XLWA 1HR0B 3SY8A 1QQ6A 5K0EA 4FOSA 4NCKA 4UBLA 4ZJUA 1U47A 1QCZA 3F8WA 3N2KB 3P32A 1EX7A 4BZWA 4I6GA 3ENQA 1T6ZA 4UE2A 1GRCA 1NQWA 3ESBA 1FDTA 3TLMA 4ZMRA 1U3CA 7ICNA 1ECJA 2JA1A 3EPKA 4ZT4A 1CE8A 1Y9DA 4RQAA 4OI4A 4B0OA 5JXJA 3TCNA 2YZNA 3FHCB 1URJA 3K30A 2R1UA 3TN7A 5DP2A 2JLCA 1NVBA 1G5RA 4LX8A 1XNHA 4LF5B 4PHAA 4DL6A 3KUKA 2FLLA 3K1YA 5T6BA 4GDFA 4F91B 2D2FA 2AJTA 2PJDA 2ODAA 4I29A 3L06A 5C5DA 2XRMA 2PFGA 3DEYX 3IMFA 4LW8A 2V1XA 4YI5A 4LN1A 3R3VA 1HI9A 4UULA 4WLEA 1RQPA 1DUSA 1KXJA 1YZQA 5LQDA 1C8LA 3KO8A 2WPDD 1XDZA 2WI8A 4WA8A 1NXXA 3E9DA 2W11A 1V1JA 1R0CA 1PR6A 1TK3A 5B4TA 3HCCA 1PNOA 1J4AA 1BCRB 1Q0LA 1GVNB 3GBSA 5J2EA 4RF2A 3L49A 4GYJA 4CM6A 1W7AA 2QIPA 3AUFA 3IBTA 4BY9E 1MXFA 3AHEA 2IFTA 3QPUA 3WVNA 3F49S 2NT4A 4KMOA 4D56A 4YMUA 1KFKB 3M9MB 1SQ6A 3DYIA 2IP1A 4JLDA 1MP0A 2LCIA 3BSYA 3ZZNA 5ITVA 2XAAA 4KHZA 1XPJA 5FQNA 2X0DA 4A73A 5HCNA 4II2A 3A9WA 1R4MB 2D3TA 1YS1X 1J2NA 3LXRA 2PRYA 4IHKA 1FTSA 3NI2A 3OJOA 1Z5NA 4MTLA 3ICVA 4GVLA 5L4SA 2D0OB 4FFVA 3BIOA 4QTUB 3MPOA 4GUAA 2BDPA 2OZVA 4X7RA 4DV4B 5DBIA 1YZUA 3L8CA 4R7GA 2AJLI 2KJ8A 3FE2A 4Z1MA 3WYGA 5ENZA 5JUWA 4H3VA 5LA6F 1TCVA 2WU0A 4EO9A 3JQEA 3GEIA 4EJ6A 2EFYA 2FZ4A 4RM3A 1ARZA 2JFXA 3PFCA 5F2NA 1T9CA 4MEXA 1WKBA 5LP6A 1QP7A 5TQ2B 2R8GA 2Q6KA 4TYYA 4DL5A 4AN0A 1D2EA 5LZ2A 3QNWA 4JOCA 1F7VA 4FR5A 4F9FA 4E09A 4N5HX 2AFVA 1FRFS 1PDWA 1KYYA 4GMHA 1K8YB 4J2HA 2JVKA 3FPHA 2I4TA 1UBSB 4FHFA 4RKEA 1RQ2A 3DNMA 4BBJA 4I2BA 3MJSA 1LH0A 4JQYA 1Y1QA 3KR9A 2JNWA 1K06A 1FSZA 1PVDA 2QD1A 3JRWA 3A2NA 2Z9BA 2WIAA 3B8EA 2ZYSA 1UKCA 5ALHA 4PGFA 2VYCA 3G5LA 3ZHCA 2YXLA 3A1EA 4MAMA 4OBBA 2P4EA 5KT3A 3OD1A 1QS0B 4NYIR 1TXGA 1OUMA 4ZKDA 4YPOA 3CLVA 3R6DA 6AT1A 1K5PA 5SZJA 1SVSA 3HCBA 4RVGA 2DSNA 1PJ4A 2FRDC 2MR5A 3OD5A 1ZU5A 4RUCA 1P5ZB 4UFPA 1Y3BE 2H3VA 2VNKA 3AR6A 1OYVA 3ABZA 3H05A 5F9MA 2BEWA 3CT6A 3L0CA 3WZLA 1QTIA 3N0XA 3O0FA 2EKZA 3QBDA 1K8RA 3GAAA 1Z4LA 3S1LA 2IYUA 3OPQA 1L7XA 5CK5A 1CIPA 3MWKA 3THXB 3P2YA 5KTTA 1JQBA 1MO2A 4QX6A 1XZCA 2J5BA 2W7PA 1ZQQA 4GYKA 4GI5A 3SXPA 1RC0A 3CFYA 3EPRA 5I9IA 4BP8A 2DBZA 1DTSA 1NKEA 4RVHA 2HLNA 4M99A 3V7NA 2PX0A 2NUPB 2VP2A 3QFCA 2A58A 3UM9A 2C7BA 2MHCA 2R8OA 4PO1A 2W9CB 3U17A 2JFHA 5SY9A 4WN3A 3LXUX 1WHSB 5EXDA 5MFZA 3A2KA 3GFSA 1KPGA 3IAAA 2BP7B 3FUUA 3FXAA 1MU0A 1RLIA 1JR6A 1NW7A 3V48A 1SVWA 1E92A 2SKDA 4I99A 4KQHA 1KEUA 3H18A 3DMYA 1LBTA 3E7WA 4RIEA 4BQPA 1TJPB 2REXB 4ND8B 3QF4B 1BPYA 5HR7A 4DYDA 3MGIA 5B1EA 2J7KA 3ILHA 3LL7A 4C5AA 3UV3A 1B41A 3N7PD 2AHOB 1MPTA 2AS0A 2EAPA 2BJWA 2XY6A 3PW4A 1D1SA 1DBIA 1JG3A 5JSYA 1GXSA 3N0VA 4JBWA 2I91A 4D74A 2R97A 4XJXA 4M54A 3DT6A 2G08A 1QHHB 1ODSA 3KT0A 2N46A 5SZHB 1TL7C 3F1LA 3KKOA 3RUHA 4UAVA 1XD9A 1E18A 3ZHTA 4MO9A 4DVJA 1XVIA 4IJ6A 3NJ4A 4EPRA 3PJEA 4DHWA 2NQ8A 3GILA 2GNOA 2YV1A 4MS1A 1VXRA 4YT4A 3VVBA 1ENYA 2JGJA 3DE3X 2ZZMA 2ID8A 4WKCA 2JLAA 3NV7A 3AZOA 5JQGF 1S9FA 4N8DA 4RQUA 2C7RA 2AT1A 3TRIA 5AJUA 1I7SB 4RC9A 2RKWA 2PKQO 3UCFA 2O06A 1BW9B 3P9XA 1TQ6A 2OCIA 3TQSA 2IYQA 3NRJA 1VLHA 3ONVA 3K75D 1NQVA 4B47A 1HLFA 5C3UA 1YL6A 4KACA 3BE4A 1IQUA 4CQJA 3ZQ4A 4EATA 4DCTA 4ZYTA 2OESA 3S29A 2EFDB 2NWQA 3QFRA 3S2EA 5B1SA 3KWMA 3QP9A 2RGAA 2X19A 4J16A 1XDBA 4HGZA 3HZOA 1ZR2A 2CCJA 5BOSB 2M0NA 4M9UA 1WVIA 1XLTC 4RBNA 5C5IA 1UOPA 5I9LA 1G16A 4URUR 3QIVA 3DOEA 4IH1A 3H13A 1XI2A 1QE3A 4PIVA 2FMKA 3G6XA 2E5FA 3KHTA 4I4IA 1EK0A 4IO0A 3GFGA 1FNMA 3RSQA 3UK6A 3COZA 3I2KA 1PK9A 4QG7A 5CFLA 1N5DA 1GEGA 3FM9A 3PX7A 3R7WB 3C98A 1EJ6A 1PEYA 3QZ8A 2DQKA 4K6MA 4B34A 2ISSD 4YTEA 5AW6A 3ENWA 1MJHA 1ZIXA 5BPCA 3TMYA 1JXOA 2OH2A 3WYNA 3HE3A 1KRXA 1MH1A 1T13A 3V1YA 4PPGA 5JS7A 4B48A 5KAFU 3CUWA 3N2LA 2O1SA 3H9QA 1GRRA 1QIEA 3V34A 3SYKA 2XBMA 4K7JA 3O8BA 2ZIEA 1PW7A 4EI7A 2O0HA 1SBHA 3G8CA 3N2KA 4QEDA 3VAZA 1JFSA 4FKMA 1PL0A 1F38A 3ANSA 3WK9A 3NUQA 4V0OA 1U3DA 1EFPB 1TECE 3U19A 7ICRA 3TJZA 1Z13A 5FUVA 1E1NA 1OZAA 3HRHA 2CMHA 3H65A 5LQJA 1DXYA 5CURA 3DDNA 2X4GA 4M1QA 1F6DA 2VT6A 1KI7A 2PXIA 3I64A 4AUNA 3JYHA 1HSZA 4K8RB 2H5EA 3KRTA 3MQFA 4US2R 5DN6A 2QRVA 3ZXSA 3THVA 3PC8A 2E37A 1ZQBA 4W1SA 4HN2A 5DIFA 4G0ZA 2EYUA 1BEZA 4MGHA 2YOGA 3CTMA 4Q39A 1J2JA 4HTFB 1G21B 3VU8A 1U3GA 4OATA 5B1DA 4KFRA 5CPFA 4HMPA 3CXUA 4C4TA 1FP7A 3K0HA 3WA7A 3QHAA 4DC1A 4PS0A 1JA0A 4OSOA 3EF3A 3G5AA 2PZFA 1HE8B 3QE4A 2CMFA 5A4AA 4F2RA 5HP4A 2QE7D 3EVDA 3F1KA 4WACA 5B7QA 5A5GA 4RQ1A 1YS6A 5IVDA 1G5IA 3C3XA 2PH7A 2JR5A 1R0RE 1XA3A 2FHPA 4UATA 4R3UC 4X00A 3LW8A 3R7DA 3MJVA 3DOIA 1XVTA 4W99A 2C9CA 1U6KA 1GCGA 2O20A 5BN1A 1BMDA 1FP4A 4DCCA 2HHLA 2JJMA 4FEAA 2BAGA 4OP3A 1DCMA 3K4QA 3H3JA 2HI0A 3RKSA 5KSZA 5FA5A 1QQ5A 3ST7A 5B2FA 3OMLA 1DELA 2CYCA 2YVUA 3EZFA 3DE2X 4QVGA 1YOVB 3SVTA 4QFMA 1JPNA 5DNCA 2C96A 2YHIB 3DWIA 3Q41A 3R7NA 3S2YA 5LWHA 5I3ZA 4DZRA 1A97A 1FFBA 4E3ZA 2H4YA 1P3JA 2B1JA 2I67A 4OHBA 4FB5A 4XVHA 1P5HA 4TRNA 4RF3A 4M49A 4HWSA 2W03A 4KBGA 4X6UA 1Z8HA 1PZFA 4IXDA 1QUEA 2OCLA 5DLYA 1BNCA 2CDBA 2G9RA 4PHDA 4P2GA 2I9PA 4PQRA 4X71A 4TTJA 3FGNA 3REQB 3PNYA 1IEVA 2C57A 1E9RA 5ALGA 4GMFA 2BHSA 2YC4C 3PICA 2F62A 4YCDA 4DCPA 1K2WA 1KFJB 5DQGA 4XASA 5JMWA 5LUAA 1SBIA 1YJQA 3GT4A 3O94A 1IIRA 3IAUA 1T4MA 2CJFA 2PXHA 1E7YA 3AP1A 4Q4HA 4Y2YA 3GDOA 3C28A 5KOIA 1JQDA 2PMKA 3RS9A 3GEPA 1N0HA 5T57A 2FPLA 1QFZA 4M38A 2BKVA 4CM8B 1CUUA 3RTEA 4CDGA 1G20B 3BQ7A 4G09A 5FWXB 2I3GA 2ZYAA 2WYIA 1ZGAA 5IAKA 1BPEA 4ER6A 1XS9D 3PFFA 2XVXA 1VHQA 4YDSA 5AVXA 3MUOA 3IOBA 3D5QA 2VLIA 1Y7LA 1SGGA 4KLMA 2B36A 3NTQA 3ZIDA 1KSFX 5GZ3A 2G9QA 3S2GA 4ZYXA 4EKYA 2OQVA 4KE9A 4M0FA 4X93A 3O74A 5CIWA 2H3IA 1J2UA 1XOIA 3BRSA 1UPXA 1AC5A 4EEXA 7GPBA 4YCSA 4UNQA 4FDVA 5CTJA 1CZHA 1O94D 4NZOA 4GX2A 3CVYA 1R0ZA 4QBKA 1SB8A 4GLXA 2EX4A 5TJHA 1G5PA 4E14A 3U44B 1X66A 3ZS9A 4ENSA 1WZNA 2ZRNA 3IYLW 3V9AA 3ZR4B 1BMTA 1EHYA 3G17A 2I3BA 1Z2NX 4W6QA 2OEHA 3AF2A 3FYCA 5ADWA 3ESRA 4OP2A 1F06A 4K2HA 1A95A 2HQBA 2H1CA 1XQYA 2VATA 1WZIA 8ADHA 5AW1A 5ESRA 2RSLA 1X19A 1USWA 1QGUB 1FEZA 2NUPA 3DTVD 2EF1A 4M76B 1XYYA 1YFLA 1KBZA 2OSVA 1ZETA 5IKMA 4MGEA 2W9CA 3PEFA 1T9ZA 1IPHA 4NLKA 1N5KA 1XTSA 2GDJA 3EOBI 1RLOA 4QUHA 1F3OA 1RCUA 3MR3A 5KT6A 2HPZA 5D2CA 3OY7A 1Z7YA 4PONA 5LZ8A 5FOQA 2PIDA 3FWYA 3G1WA 4F4UA 3GLHA 3OZFA 4F3KA 2D1SA 1W2WB 1LQ2A 4JXZA 3OLWA 3I2IA 2XYQA 2JL1A 3OC0A 4Y6LA 4WNCA 1Y5IA 4GBMA 1YFJA 4KR0A 3VYWA 1SQGA 3M89A 3PWZA 4OQ4A 4TRRA 1HNZB 4RKRA 5FBWB 3ZH9B 5DE3A 1DFGA 4ED7A 3ZIAA 1U8AA 4OJQA 8ICBA 3VNRA 2KEYA 2XVZA 4HZGA 2MU1A 1TTPB 1W29A 4AXBA 4DS3A 4JB3A 4NYJR 1MA0A 4FGJA 5H02A 1USVA 5C18A 1DEAA 2PQMA 4XSGA 3DB2A 4ZVTA 2CLMB 2AHOA 3QVXA 4O3MA 3OSZA 2HQOA 3FGPA 1UFRA 3QOFA 1QG4A 1U2ZA 3AERA 2P8JA 1PZGA 4L1KA 1DLJA 4EY8A 1QHHA 1SRRA 4AN1A 2HW3A 3LAWA 5CDFE 1H5UA 1R6DA 3C6BA 4KLOA 3KDAA 1C3OB 5TMDA 5DI3B 1KC3A 4BAGA 5BSVA 1ED1A 1S7CA 1PT6A 3NNDA 3ITEA 4ZRDA 3FCSB 3Q8LA 4E51A 3CZ4A 4WKBA 4F3OA 4R1LA 3V33A 2E8NA 4A03A 5JVDA 1KC1A 4KV7A 2AQHA 1K5HA 4DZTA 2Q0XA 4N5DA 4K4GA 1O08A 4BO3A 1XZGA 4OLHA 1I4LD 4QLBA 1P31A 4DQ0A 3G82C 3G2QA 2EJWA 1XX6A 4DV5B 1PJAA 1OSNA 3EZ6A 5I51A 3OLQA 2XITA 1XMSA 3UQ2A 4LF8B 5JLJA 9ICPA 4NH4A 2DR2A 4S3MA 2BQ3A 2WTEA 4DCOA 3I9KA 5DFAA 2WA2A 3M8RA 4HLUC 3EASA 1SHUX 2M6RA 4ZK6A 1UPUA 1QIIA 4D3XA 1BWPA 4Q3BA 4A1OA 1AK1A 2V45A 3D6MA 1NDQA 2DG2A 4OUDA 1HOTA 3JASB 5B3LA 1GFWA 4EFLA 1BMFA 5JYBA 4RL4A 4BUGA 1Z6AA 1CUWA 1K3FA 4YJ3B 1HF3A 3ER9A 1ZRHA 3HB9A 2WWWA 4YRTA 2ZTCA 3QSGA 2Z6UA 5FA8A 1Z15A 2FQYA 4D9MA 1GKLA 1N4AA 2V6JA 1Y5MA 1W52X 3GFRA 3EXFB 1H4SA 3A05A 3BMCB 1TYCA 1YH3A 5HXAA 3HL0A 3W04A 1EFAA 3UJPA 1UFQA 1IM8A 4QDJA 1H8HA 4LPSA 4NM2A 4WHMA 4WVFA 3HFGA 2OG1A 4UB6U 3VNUA 3VR3D 3BGSA 3T3GA 4KDRA 1YZ7A 1NWHA 3EZYA 3PDWA 3TECE 3M33A 4F3YA 5AM2A 3PNKA 1VE9A 1L4FA 3R8XA 4JUDX 4K5QA 2PX2A 4BJ3A 3CUUA 5F1KA 4EZEA 4FUTA 3NVZA 2X8WA 4BB9A 4G1VA 4DG5A 3ET4A 3K4HA 4FYYA 2PD6A 5KTRA 3SZRA 3A70A 1CFJA 3SIXA 3K0BA 4RQ2A 1ZW6A 3EXEB 1E3EA 2JI6A 2GKOA 3TI7A 4DOAA 4GI2A 2PD4A 1HT3A 4MS4B 4MW5A 3FA2A 3B13B 2QE6A 3RJZA 5AVQA 2WHXA 2PMFA 3F8SA 1PG5A 1PR2A 4HTFA 3NHFA 1L5RA 1MAVA 3IO3A 3WWZA 1WY7A 4ZO4A 5IKXA 3IJEB 4JI5B 2X15A 4FPXA 4TYMA 4OGWA 3WIUA 3TKAA 1VMDA 1A88A 1Z4JA 7REQA 1H69A 2P75A 4DWJA 1YFZA 3H9BA 8ICQA 3GMTA 2J09A 1SL1A 3JZIA 4YMLA 1KI2A 1XRLA 1SC4A 1CD5A 1YQXA 3UICA 3WRYA 4R51A 4GKAA 3NGDA 3FNBA 5TVKA 1I10A 3ZBPA 1T9BA 1RBMA 1YRBA 4F8EA 1XNJA 5KDLA 4NENB 4RULA 4ZDIA 3I3OA 3K5WA 4I14A 4DXAA 1P45A 3VNBA 4KL8S 4US0R 1EVJA 1JFLA 2OPBA 2JIDA 3PL1A 2GVZC 2QUBA 1IOVA 3UPTA 1IG6A 3AW9A 4UNRA 1KVRA 4UHBA 3CNHA 1YR6A 4YBRA 1MQ9A 4D9GA 4XYEA 3DW3X 3BILA 1M3SA 3QKRB 2A1IA 4FILA 5J43A 4W5JA 5IC5A 2DQYA 4DGSA 4Z6FA 3ILSA 1YOVA 3EIUA 4OI2A 4XQCA 4LZLA 3EVBA 5L3QB 1P80A 4RWZA 1O8CA 4S05A 3OJWA 3WFJA 4MQLA 3KYBA 2EU8A 1OOEA 1Q17A 3RREA 2PSJA 4RIGA 1TEVA 1VE5A 2EFCB 4C3UA 4ADSG 5BQXA 1NLYA 3IJRA 3SQNA 1E69A 2C92A 1N34B 5IFLA 1H2XA 3BXEA 5J2GA 1KS9A 5G1PA 4FSDA 1CT9A 3DFZA 1G5HA 3HXPA 4B45A 2AN3A 4U3JA 2IYNA 2HMVA 4V1CA 1ZH2A 1QF6A 1F4LA 4LC9A 1OXTA 3BERA 1RWWA 5GVSA 3ZJVA 1RYRA 4IIDA 3M9NB 4DV3B 4RKQA 3AJEA 3WK8A 2Z5VA 3D31A 4P4SA 3T1YB 2ES6A 4P3YA 3UV6A 4MMXB 3RTVA 4PSKA 1OX5A 1KEJA 2KX7A 4H1VA 3VDMA 1S8NA 2FEPA 4MQEB 3ZJ4A 1QXSA 1KK2A 4XLTA 1YWGO 2A57A 1L5WA 4RXUA 1G59A 1JDVA 1V1RA 3E3NA 1UFKA 5DEIA 5HWSA 3HILA 1ACLA 3P4UA 1QANA 1YASA 4XB1A 2IODA 4A16A 1PQPA 3ZHBA 4UTNA 4MW7A 1FJXA 4A36A 2Q49A 5KYKA 1M54A 4RW0A 2YINC 1EFVB 1Z07A 3MWYW 5REQA 4JJGA 5BVGB 4KO2S 4UB4A 3E9YA 3BGDA 2P9CA 2L18A 1XWIA 3T7JA 1PCXA 5DNUA 1KHTA 5D84A 2EQAA 3LBIA 3RIXA 1OLUA 3DFIA 3KHSA 4URXR 1BA3A 1G3IA 1THMA 3OCWA 1QF7A 4IZHA 1N7JA 1JVNA 4H1UA 2WM3A 4ECEA 4OREX 4MR8B 4QQ8A 3FMPB 2RGDA 1QGUA 1COOA 1PUZA 2OYYA 3BJMA 4H7JA 3UBTA 2AW3A 3BFJA 3LE8A 3WK4A 1L5QA 3AKEA 5CFZA 4ISCA 3V8EA 4MV6A 4DEZA 1XZIA 4ZI2A 5C5JA 1AUOA 4MUBA 3O9VA 3S6JA 3U7QB 3W5CA 4Z9FA 2FX3A 3UXHA 3ROTA 1RYBA 2RLTA 3SAFA 2RBEA 4IIBA 5T3UA 3N5CA 1BZYA 3AY7A 3QH4A 1M2OA 1XRNA 4RY2A 4FQ7A 3L5KA 4J3FA 1B0AA 1PV2A 2O2EA 1X92A 3O3OB 1KZGB 1ZQXA 3L5OA 4U7PB 1II8A 3OJXA 2O7RA 3P5SA 4JL6A 3A7DA 3QOYA 3UGKA 3TBKA 3K6JA 5JS8A 3BFKA 1VE6A 3HN7A 4UARA 2ARKA 5BSEA 3EEYA 4RV9A 3TPCA 4I4TA 4KFTA 4KBYA 5LFAA 2AEMA 1O4WA 4B46A 3KOWA 3QPBA 1W4LA 2V5AA 3HJBA 5H5JA 4WOJA 5HTOA 5HKOA 5KHAA 2PYZA 1BX1A 1C3OA 3K3PA 8ICPA 3LY9A 1H4VB 3RRHA 3K0SA 1CY6A 3EFOB 4AO7A 2OHHA 1SCUB 4IXWA 3DLAA 3AHIA 1Q74A 5KFNA 3SK0A 4Y8VA 2MYUA 4X8MA 1PT9A 4G65A 4EOGA 4K86A 5DLQC 1WP9A 2V7XA 4JQSA 3TDKA 1HORA 3R0IA 3BH0A 1S0VA 4ML3A 2DQNB 1DKPA 4QOEA 2B1IA 4V1CI 2QARB 3V7JA 2WF8A 4K6OA 4IDAA 3A8TA 3FNIA 5CW1A 3JPSA 3TR0A 5AVVA 3FFXA 1HNWB 3WLIA 2YS7A 4XSVA 1RT9A 1WUIS 5E4JA 2GFIA 2LUOA 3L6RA 1XSPA 4MYCA 3FLMA 2VJOA 4ARSA 2W70A 2WTXA 1L4BA 2ZUDA 3DLHA 4ETIA 1V3UA 1C4KA 3SIPA 3VZCA 2WDZA 2R8XA 2LR0A 1XDUA 3BWMA 4KR2A 4I9FA 3CIOA 3HA3A 3F5DA 5CEEA 1FF9A 2VZLA 2RGGA 1GL7A 1LDEA 2HYDA 2ZWIA 3ZWBA 5BXYA 2K6GA 2BI7A 3K2BA 5EE0A 1RHRA 5AM0A 3UWKA 3ZYZA 2GXQA 4FB4A 2HIHA 2GK3A 2DTEA 4ZVNA 3I1YA 4O02B 4MPRA 3MCUA 4OQMA 4F72A 4ZQGA 1SG9A 3N7AA 2I4RA 1QX3A 5G5GA 3KC2A 1EG2A 3RV4A 3ZU4A 4DIDA 3E5RA 2XUAA 3EXFA 4QWWA 1JHZA 4IRDA 3BMCA 3ZHRA 5H3CA 2KV2A 1IBRA 4XTCS 4ME6A 4LHEA 4UXIA 2XT0A 4R5MA 3IM1A 5JXWA 2GX6A 1C9KA 4QZ9A 1PVPA 1G7RA 1E7MA 5K1ZA 1S89A 3NWPA 1QV9A 4PSCA 5IULC 1U2TA 2EL9A 1Z83A 4KQIA 3ZHZA 4LVSA 3MWLA 3AEKB 1YC5A 4QL3A 5SV2A 4AF7A 1TZKA 2I7DA 4JDPA 4LRWA 5K4LA 4CNBA 2F3NA 2JZOA 1ZQEA 4JC4A 2K7ZA 3RJ9A 2B3TA 4MAFA 2H2GA 2Q9AA 1HQDA 1IPEA 1R8JA 4V0LA 4YEDA 3NVAA 1QLHA 1E0DA 4MS4A 2VAXA 1WCIB 4MYSA 1JZSA 4AM8A 4A5OA 3V8QA 3RS5A 4WH0A 5C1IA 1M8JA 4GFJA 1ZU4A 3CEHA 2BPCA 3BPSA 4CM7A 4II3A 3F5EA 5TXGA 4Y0NA 2ZBPA 1G66A 2DF8A 1PJLA 2O8FA 1P1RA 1PFWA 1W73A 1YZLA 3AI3A 4DQSA 1ZAKA 5L1MA 3IPLA 3B0YA 4EELA 4X7PA 5HE8A 5T4BA 2JI4A 3T5KA 3GJSA 3PDJA 4QDZA 3U13A 4C03A 4MQUA 1EUYA 3UN1A 2XNHA 1DKRA 2YOHA 2ECOA 2ASLA 4TT3A 3VOAA 3FAHA 2F77X 4MP3A 1DG9A 3E03A 1ITZA 1AGXA 5C8YB 1T36B 3RC8A 2YWGA 1QH8B 2H2HA 5IABA 3S4YA 2V58A 3NVMB 1QFSA 1EWVA 3RM3A 4R0VA 1YVPA 1BHJA 2UYYA 1RYMA 1RYFA 5HUQA 3KDSE 5FV7A 4BJ5A 3LC2O 2DMRA 4KFUA 3VR2D 3CE9A 2C28A 1NE7A 1XA0A 3VSCA 5DBEX 3T7DA 3ZWMA 3ISCA 4ZRNA 4PE5B 4CUJA 3G79A 2ALZA 4BJ6A 3O7WA 2FSFA 2Y1CA 1QDEA 1NAHA 4U6PA 4RYLA 2F1OA 4WY8A 2CHGA 2GCNA 5F7JA 4XX0B 2GASA 4ES6A 1J97A 1GJRA 2E87A 3PXUA 4OHYA 1AE1A 4XQ9A 3IAHA 3IRVA 1NY5A 1HT0A 4WUVA 1DT5A 1QYXA 5DGBA 4EVRA 1T0HB 4P5EA 4FYIA 2HBZA 3TFQA 1ZMRA 4WK0B 2VZ9A 1SKQA 1GZSA 1TA4A 1EAMA 4KTVE 2PWZA 3SKYA 1P39A 2JGMA 4ZI5A 2B2CA 2R6AA 4A1FA 4D96A 3MOIA 1T9KA 2OLKA 3RVBA 4YMHA 1KO5A 2ENUA 4AP5A 2C77A 3I12A 2FPKA 1ZQUA 4UBCA 2RGRA 4CKWA 4RMGA 3QVUA 4CODB 4R8SA 4OBWA 3IT2A 5BOLA 2W8LA 2R86A 2PKRA 4G85A 2BGGA 3L0IB 2WFZA 3PQDA 1HLDA 2DR0A 4X61A 3WFIA 4NFYA 2Y1XA 3H8MA 4DNPA 3LP8A 2XDAA 1DKMA 1DZ3A 4LI0A 2IYRA 4MKHA 3T5HA 5K8VA 1U3UA 2GRJA 3MUEA 3GFOA 4BC0A 3LOPA 2VHWA 3DF7A 5T4EA 2B2XA 2XMDA 2P78A 2XV1A 3VNVA 3K31A 1OUQA 3OAAD 4M1YA 1EFVA 1Y63A 4PX2A 1F0MA 3KTDA 3MR6A 4OB6A 1E3IA 2J45A 4JSTA 4YJFB 1L7PA 1Y8AA 5AXAA 1T3HA 1KBQA 3H8WA 2ES4A 2CJYA 2AFRA 3LUGA 3ZY4A 1Z56C 1JDJA 3BQ2A 1MX5A 1FNBA 5CVJA 2MMGA 2W2MA 3RVDA 5CVVA 4J43A 1E2HA 1WMSA 4CG3A 1HQKA 3G89A 4P93A 3IP9A 3L0DA 1ZMBA 1Z47A 2XBLA 4HC4A 3MBKA 2CLIB 4FINA 2DUYA 3I0MA 1L4YA 2KP7A 2H2FA 5TY0A 4EYIB 1IG0A 2PL9A 2ADOA 1AG9A 3KJGA 3KPVA 121PA 1DV1A 1EWTA 1NQTA 4RKYA 1TCCA 5B3KA 4B3IA 1EA7A 2WM2A 4HCJA 2AEEA 4JP2A 2XYRA 1V5WA 5JAIA 4YMIA 1TEZA 2IBSA 2FLPA 4NCBA 3RRMA 1QWOA 2I66A 2DFTA 5A9SA 1VBMA 4ZYWA 4ZH4A 2G04A 1LU9A 4H0NA 2B6GA 1QYDA 1AZTA 2FN7A 2EFHB 4J9KA 2C0CA 4LQCA 1PT7A 3L4SO 1JDBB 9ICQA 1GZ6A 1QJ4A 2V74B 4M1ZA 4BMSA 1MQSA 4JLPA 4BLOA 2HEGA 3LRTA 1E79A 3PPXA 1KIFA 3NHJA 1P9OA 1UBRS 1RWNA 3MJHA 4WNAA 2ECKA 5CJ2A 2G6BA 5EWJB 4GSKA 3MMZA 4N54A 3OZEA 4RPJA 1EGHA 3E58A 4ND2A 2FP3A 5E1MA 1VCIA 3RVOA 1CUFA 3AXTA 4LS3A 2DWPA 3U9SA 4CFYA 4BKRA 1VLZA 4JC8A 4HAVA 4KFSA 1CB7A 1JLRA 1CVIA 1OI2A 2GTIA 4PIPA 3D6NB 2VSQA 4N5IX 1TPZA 3H8VA 1FJGB 1P0PA 3KIPA 2O8EB 4Q7MB 2DHEA 1W36C 1LDYA 2J31A 1W0KD 5SYNA 2C07A 2G17A 3NETA 1Q91A 4BBZA 3NIDB 1DIGA 4WKOA 4UZEA 2CDAA 1SC1A 1CZKA 2XC9A 4RDCA 3QMWA 2GBPA 1IN7A 2XH8A 4K6CA 2GLUA 4EHNA 1ODTC 5SYAA 3HN6A 2F8SA 4GX5A 3F4LA 3ZQUA 4M04A 4LZDA 4MVCA 2FOIA 1C1YA 1TF2A 1ZK1A 1PL7A 3HKZC 4QWCA 1C1DB 4NJMB 1XSEA 5C5EA 4GQBA 4ZDWA 4EMSA 4U2GA 2ODTX 1V4NA 2P0EA 2WD9A 5HA5A 3V6LA 1GG9A 2HA2A 4L8VA 1WABA 4DA0A 3FUTA 1C1HA 4UBBA 4AZ3A 3FHTA 3KHUA 2OXCA 2GPTA 5CT6A 4BNGA 2G9VA 1L0BA 2NRWA 1VG0B 5DBHX 1J9EA 4BO5A 2P7IA 1YE3A 3OF2A 1K6XA 1QH1B 4JJIA 4CRWB 3KEOA 3EIFA 3L1UA 3Q12A 3OQOA 4PIMA 3JQ9C 3FYUB 1S2NA 3HLKA 5GONB 5F7OA 1IB6A 3CLRD 3WKCA 3RJ5A 1DC3A 5HX7A 3R8FA 1ZO8A 4TMKA 3TFSA 5KYUB 4DFPA 1VKNA 3ZD6A 3C5GA 3AR8A 4B9EA 1RQRA 3ISBA 3AF4A 3FPGA 1YUMA 2FSVC 3K1AB 1CUCA 2QX8A 2J3HA 4JWKA 4NJOA 4B6OA 1NMQA 4Q3LA 4BNDA 4LJ4A 2JZBA 1EIZA 1YS2X 4D99A 1TLFA 1EVKA 3RLFA 1V37A 4LRQA 2DECA 2FP4B 2BPGA 2GOLA 1HXHA 4HOYA 4DPKA 1G60A 2QROA 4GEGA 2I2DA 4QTXA 4CTNA 1KRPA 2GJ8A 3NR2A 2OCDA 4MV0A 1OFHA 2H1VA 1T6NA 4WXHA 3VKGA 1Z06A 4ND3A 3E1KA 9ICOA 2ZR0A 3DB1A 5BR4A 3I9LA 2WM8A 1QZXA 4RVDA 5E3HA 2XY4A 3KOZA 4TMFA 4RGBA 5A6VA 3MZ0A 1JU3A 3ZBTA 1ESMA 5CR0A 2A88A 1P61B 3SIWA 3OLCX 1FDIA 1RC1A 1ECGA 2HRQA 2FRVA 3GLIA 3LXXA 4P4LA 4DMLA 1XTPA 5IM4F 3UAWA 2CNNA 2KS6A 3T0IA 4K9SA 1NT2A 2BM9A 2QU7A 1O5TA 3CZ5A 3FYTA 3NS1A 5JNUA 2WPDA 3C3YA 5HHIA 1D8AA 1L4MA 1FYXA 3D8UA 4LA4A 3O1HB 1USKA 2BSXA 2HIMA 1O54A 4G1FA 3AVQA 4AB1A 4E5MA 4CHTA 2WIBA 1KMHB 5IEJA 5B1IA 1IM4A 2C9MA 3MILA 3BULA 4YECA 2EVWX 2GPYA 1KJZA 2ZYHA 2VQ3A 4TLLB 2ILTA 4QJIA 3GLFB 1AIPA 3QU9A 4E2WA 3QNMA 5DW0A 5JSHA 2Q3BA 5B7PA 3BCSA 3AHCA 4QARA 2Q2WA 5CNIA 1QOPB 4NECA 1E3QA 3IDZA 3E2PA 2JIMA 2UUOA 3VC3A 2DWOA 4ETWA 2OUKA 3IEMA 3VU3A 1T36A 1J7JA 5EMMA 1BVSA 2BN4A 4DDUA 3KXIA 3OOEA 1QIKA 3ZVKA 4PBRA 1V41E 3RUEA 3UKDA 1Z8DA 2C8VA 1ORDA 1NFFA 3WGOA 4LF6B 2CNWD 2GAIA 5JPIA 3CKYA 5A5VA 2RI0A 4C6HA 1KXZA 2EJVA 4MWEA 2R1ZA 2GXAA 3ECSA 1POXA 4EB6A 1HMPA 5E3IA 3HG7A 2PUFA 4KRYA 4DLWA 1DQZA 1IHYA 1TU4A 2H7XA 2XXAB 4FFDA 4XX0A 4LJ8A 4IQ4A 1JJVA 3RGGA 3SC3A 1EESA 3IUJA 3TXAA 4UD2A 5GJWC 3B3FA 3VM6A 1ZS9A 1KVQA 4P33A 4E46A 4U0JA 1KKUA 5CP8A 5CYOA 2D1YA 4ZO9A 4KLTA 2QG6A 3AKZA 1VIDA 1SVMA 2QR5A 1QV7A 2GCPA 4M1EA 1T6YA 1T8TA 1Z0ZA 5TGZA 4YCCA 4FWBA 4MCAA 1CUIA 1EUCB 3KQMA 3MHPA 1YRWA 5LDHA 1NOMA 2R7MA 4M1MA 2D8AA 2L42A 4QYTA 3IQDB 5FWAA 5CGZA 5I7AA 3TZ6A 1UKVY 2RHWA 3TGPA 2QN2A 3BQMB 3FTQA 2N1RA 2PWBA 1KOLA 1URPA 4PGXA 3PS9A 4NABA 3AN1A 5AKXA 1I8TA 2VNAA 3FZNA 2C0QA 4DMUB 2JGDA 4Q3OA 2NO5A 3SF8B 3HXMA 1W49A 2VT3A 1Y33E 2ZJ4A 3NHUA 5JRJA 1LDNA 5F3XB 5J0PA 2XMCA 1TW2A 2JRZA 3JPWA 4LV6A 2WVGA 3JVEA 1FU7A 4N76A 3WV5A 1VLMA 1DBWA 5AMXA 4JP1A 4LQDA 5L7TA 1GTL1 2QPLA 3VV2A 2NU7B 2ZRMA 1Z4MA 2I4OA 4RJLA 2ZREA 3NV9A 3DG9A 2JD0A 1AHPA 2ZXUA 3D7MA 5IASA 3TGWA 1D03A 1JQ3A 4D4GA 2FWPA 4IDHA 4MR9B 4UHEA 1YQDA 2YMPA 3PT5A 2VIXA 1D9FA 1W9HA 1LKYB 2GK7A 3HCAA 1PHPA 1OFIA 1Q0SA 3V5NA 4R1PA 2P5TB 3SSAA 3HXOA 2A33A 4S2UA 4BNJA 1DKOA 2XR1A 5COBA 3SC4A 4BXOA 4M89A 4GNKA 3UJDA 3WKEA 1P7ZA 4HX9A 1V9LA 4B3FX 1NNEA 5CCBA 2FWRA 2NV3A 1PWXA 1ZINA 2L2QA 4OKIA 1X6IA 2C95A 5B5SA 5DLEA 4GX1A 1T15A 2AUTA 4Q16A 4UFOA 5IJWA 4EQZA 2NLOA 2ZK7A 3DTVB 1ECWA 2HOQA 1TGVA 1V71A 4ZGWA 4ZJYA 3KZVA 5AI8A 2AUNA 2KZZA 4X84A 3IEXA 2REBA 2Z1MA 1N48A 2E8OA 4TWBA 2QENA 3CR3C 2VA3A 8GPBA 3PJDA 3KD3A 4RK7A 3QJ5A 4ZOAA 8ICVA 2FPSA 2D1FA 3HJGA 3H75A 4DOMA 4PLYA 3IGFA 1QSSA 2GAAA 4ALMA 3KJHA 4Q1CA 3SNKA 3FF1A 3EGIA 2GEDA 4UDYX 1XRQA 3L8FA 1EDOA 3ET5A 5AW4A 4BNVA 1X13A 1Z5GA 1L5MA 1QMPA 1LVHA 9ICHA 1O9HA 1VA4A 4MLDA 1DIAA 1PJ8A 2TS1A 1IH8A 4NCAA 4BV9A 4C08A 5EWJA 4LZAA 5KFMA 3HDQA 1IWBB 1MEOA 5DVZA 4CIDA 2JDID 2D54A 3CVUA 2A5GA 8ICTA 1DQPA 1QZTA 5HQJA 3DAGA 1WNFA 4H6WA 1J70A 1IEQA 1K08A 1TM7E 3NHSA 3FNEA 4Z99A 1C7RA 4V0SA 4OK3A 1N3LA 3U4IA 4W8GA 3L7LA 3L9WA 5F12A 1TZMA 3HLYA 1S8FA 4QZCA 4Z51A 4HQFA 5CGQB 2C61A 3EQ6A 2OZPA 2FW7A 3IIEA 1BCRA 3QVWA 2IDMA 1RI2A 4H77A 1O89A 4BO4A 5KBYA 2B4YA 1YZVA 3Q9SA 1Z4PX 2OV2A 2XCPA 2OSBA 2VVTA 2PZMA 1R8SA 4BMYA 3BRQA 5K0BA 3K8OE 1X94A 1GN8A 4NAHA 4MW0A 4OQFA 4FM9A 1CJTC 4P5DA 4IILA 1JNYA 2ZKLA 2OVFA 4OHUA 5AIBA 4CQMD 3NTVA 2ZE5A 4KQ6A 3RV3A 2R8JA 1XCPA 1P74A 5FYQA 2ODQA 1IBLB 1R4MA 3D8RA 2RGYA 3ORSA 3GEEA 3KZKA 4JWNA 3QPWA 2POQX 3SHVA 2YQ4A 3IESA 2VI5A 2PBLA 3P26A 1N6KA 4EJSB 3HP6A 3DBVO 5JD6A 4WT7A 3R6GA 3KOOA 4YG2A 4QNMA 5JJ5A 3A6PC 4RD6A 2EJUA 4CWAA 1JSZA 1C4OA 5DX0A 2ZUBA 3AEUB 4WMLA 4JASB 4POAA 1UC5B 3IMGA 4W7HA 1VE3A 3UYKA 4CMIB 5GONA 2ON6A 3PFIA 3Q7QA 1V5EA 4RCZA 9ICIA 2ZT7A 1NVVQ 4KH0A 2ZYRA 3PNMA 1WD5A 3KQKA 3GJQA 1H3NA 4AY2A 1IZZA 4ALNA 3W2EA 2OQIA 5TQ2A 2IXEA 1SPXA 4COKA 4DR4B 1GRQA 5B30A 3U0BA 2WJVA 2XNKA 3K1AA 4HUQB 5G0VA 1X39A 4KLCA 2VDPB 3MMPA 4GYWA 3QEOA 2ZVPX 3TWOA 5JAHA 1CHNA 5LMNB 1EJ2A 2PA3A 3ZDCA 3PK0A 1X7YB 4B4VA 5FT9A 4EUFA 1YU9A 3W8EA 3RD5A 5D3ZA 9ATCA 1P1FA 3NJRA 5CBKA 4IHJF 4L07A 4FGLA 2OHOA 4UDOA 3QLUC 3E3AA 5COAA 2A3VA 3EMKA 5DMHA 5FBQB 2YMQA 4L16A 4X45A 3LRXA 2FE1A 3MXOA 1QS0A 3B3JA 2YN4A 3S0JA 4Q9AA 1K3TA 3HMKA 1RMQA 5T8KC 4J0JA 4JJEA 1P1CA 2JLSA 4F6CA 2Z1NA 1TE2A 4DC9A 4IFIA 1JPJA 4UEQA 3BD8A 1Q77A 3EDRA 2HZBA 1KYXA 2I6XA 1VM6A 3JXEA 2C5AA 2YJTD 2ADFA 2OD9A 4KDFA 3TI9A 1SHZA 3ORQA 1NK7A 3E8SA 3V4PB 3ZV3A 2JGLA 3THXA 2BGNA 2Y1IA 4HNVA 1ZQ1C 2QE7A 1UMKA 2ZI7A 4OQEA 1O03A 2QZ9A 1K5GA 3FVWA 4X54A 5DCUA 5JJCA 4FMDF 3L43A 3L7NA 5ALOA 3N2NA 1RPAA 4YUZA 4Y98A 2R751 4GOJA 3RAJA 3QXSA 1WXQA 1W4ZA 2BM8A 1NUTA 4MB2A 1YHYA 3C6YA 1WHSA 4F45A 4UD6A 1Q19A 3PR1A 4UB3A 2BP7A 5F4ZA 1DHRA 1QB7A 3B6JA 5KVQA 4EABA 1EX9A 4B7XA 1PBNA 1KI4A 3SZ2A 2B7LA 3FPSA 4FJ0A 5J0WA 2XCLA 1Z82A 4F3TA 1HQYE 2FUG6 4C7OB 4F71A 1GSAA 2AXPA 2H1OA 1S3GA 5GP1A 4YR0A 3NOXA 1T6BY 4ND8A 5FWYB 3QF4A 1Y1PA 3HFSA 1IONA 2PMZF 2KG5A 4M55A 4IEFB 2J9GA 3ZCQA 3L0BA 3A7EA 4GOXA 3EY9A 5C3MA 2BGJA 5AVJA 5JRDS 4UEOA 4FZ3A 5NULA 3D3JA 1KDHA 4PG4A 4FZNA 1MG0A 1JKXA 1JQJC 1QP4A 3EDCA 4Q9HA 3FMVA 1J49A 4F0JA 1EUCA 5FUBA 5EWGA 5AVRA 4KN7A 1J2EA 1AQLA 4BNLA 1KVSA 1YZNA 5A1JA 4BLPA 1GARA 1J06A 1WB6A 2GYWA 1JHYA 5DM1A 4JA0A 5AHWA 4GR9A 3PSTA 2V5VA 2IXBA 3Q98A 4JKYA 3EW7A 4A10A 1YDMA 5AH0A 1GPLA 4MLZA 4OJLA 3BDVA 1XG5A 1C3LA 4PLWA 3KPYA 3SIRA 5IJAA 5CEJA 3SF8A 4B2IA 2W2PA 2XGQA 2E4AA 4ON9A 4XGIA 1DWPA 5EOZA 1NMXA 4GKVA 4HG2A 2G3YA 2GARA 1J0BA 4A0HA 2VF8A 2ZIWB 4MGIR 4BIIA 1BW9A 1IZ8A 5ECYA 2P6PA 1LDMA 2IY9A 4LOHA 5KZMB 2NSYA 1OXUA 4I2JA 2JZCA 4TM7A 1SUIA 3LWZA 3LVVA 2A1TS 3OIYA 5E1BA 5CEHA 3BRWD 3CCBA 1F20A 3RKRA 1SCQA 3P9ZA 3ZX5A 2EHDA 4LBVA 1QOQB 1O94A 2P9FA 1Z18A 2GEVA 1PQWA 1FU8A 1XYVA 1W1UA 4IIXA 4KUHA 4B79A 5BOSA 5TF4A 3HCPA 3EISA 3A28A 1KJ8A 3RB4A 2D62A 3FCOA 4JEIA 4ZOCA 4ROSA 1U7PA 4E5PA 5BYAA 5DWQA 1WG8A 2FEMA 3GDFA 1I0IA 8OHMA 4WERA 3U4AA 3OJUA 1MIHA 1YJCA 1GO2A 1MORA 2H2AA 4QM6A 3KFUF 3L7JA 3TZBA 2OYCA 4LJLA 4F4JA 3H5IA 3DTVA 4QWBA 3MERA 3M8SA 3B8HA 5AUQA 4E30A 3G2KA 4QZAA 1U31A 4GI1A 3R7WA 3EIEA 3QBVA 4M7PA 4OG2A 4BWGA 4F50A 2XRFA 5TV2A 5GQSA 2UAGA 3S2FA 4EHFA 3AEYA 5C4IA 4J0CA 1N2JA 1N2BA 2I6UA 1ZQLA 1JHMA 5JROA 3CIFA 3VPBA 2XTNA 4F9TA 3H2JA 1GZUA 4G4GA 5ADHA 4IVRA 1IV8A 1AXEA 1W5BA 3AVOA 1EFPA 5MGNA 4QRDA 1JI0A 1GUYA 3W8RA 2JIOA 1IN6A 3IHQB 5H59A 3ZU5A 1MUUA 4DQRA 2VWHA 1PJQA 2C2YA 1EK1A 2C5SA 4RVOA 3MS4A 1T9HA 4PYIA 4MVWA 3D6JA 3LT0A 2G5GX 4U2DA 3AJAA 3GJRA 4HXGA 2R25B 1IK4A 1MLDA 1ZA2A 3RRBA 3CH7A 3U60B 4O6VA 4ED3A 1PW5A 1SC9A 3MAGA 3AL0C 4Q3KA 3ZK8A 5DM70 1G21A 3ZKWB 3M4XA 5CDGA 3UHJA 2W6ZA 5FUYA 1P9LA 4JUBA 1TGYA 2RHFA 4ZXFA 4Y2UA 3VR0A 5AKYA 5FFMA 1AQJA 4FBTA 1BX0A 3SZUA 3OHAA 2QD3A 4KEAA 1RM5A 1IC6A 3DE0X 2ECQA 2QY9A 1TYEB 2M9MA 3NRCA 4DM4A 4NDNE 3EUFA 2EX0A 1V8ZA 1QRSA 4PX9A 2P0AA 3UJNA 3COJA 2N3ZA 4COOA 2UZ1B 1CK4A 2QQ0A 3KXPA 3MF4A 4EI9A 3WGVA 5DDIP 2VP9A 4BQQA 5IT9A 4OHFA 2ECFA 4ROTA 1EDEA 3LCMA 1CRLA 2FOLA 4Q48A 1C8KA 1NG9A 2ONJA 1N6LA 2VT2A 1HDRA 3L01A 3PGXA 3JALB 2HMWA 4QXRA 3FF4A 4QASA 3HR7A 4IJVA 3O5AA 4AQYB 4O3PA 2XXJA 3WB2A 5SZKB 5I9NA 3ZWOA 2QORA 2WKSA 4B3BA 4LGYA 2PFQA 3NONA 3EIQA 1WWVA 3Q7RA 4IQFA 2HLDA 1TIKA 3ZEIA 4J0GA 4EJSA 1UKYA 3GL9A 2ZFUA 1AS2A 1UF9A 2EP7A 2YHIA 2YCLA 5HFJA 3GD5A 1UPAA 1YDHA 4GI3A 4UZFA 2H31A 3ZJTA 4MUYA 4IJ5A 3COWA 3CN7A 3DAOA 3N7SC 4GECA 2A9VA 3AEUA 2WWYA 2CXHA 1OBVA 1PZEA 3NZEA 4NJ8A 5H70A 1QYRA 3LRPA 5A3RA 1W75A 2EV9A 3VTKA 1SCDA 3JYQA 3ZPXA 2GBIA 4OK5A 1OZHA 3REQA 3FVRA 1XELA 2GA8A 4UHFA 3LH5A 3ZHVA 4HAOA 2AG0A 5E8RA 1KSJA 3VR3A 4TQRA 5EZYF 3W8NA 2HWYA 5TISU 1EB8A 4I08A 4NYMR 3FDIA 3F3MA 3KB1A 3HEAA 4U0KA 4BB5A 1MHTA 3FOWA 3TG2A 2WU3A 2BHTA 2WB4A 5JCOA 3P5BA 2YNMC 1H4TA 3VUFA 2R3SA 3QU2A 4WZAE 3AM9A 1QG2A 2QRMA 4CM8A 5DQHA 2JAUA 1KFBB 2CV2A 4IH4A 1DXQA 3HDTA 1G20A 4KSBA 4GM4A 1BNOA 5FWXA 2TMDA 4ARIA 4BUJA 4BP3A 3IBFA 3ORFA 1YA6A 5ARCA 1SQ0A 5AHOA 3WRVA 3ZDBA 3ABIA 1N3IA 4AQ7A 4US8A 2J8ZA 5AVKA 4HFJA 4ZDJA 2E7ZA 3Q11A 4DSOA 1KZ9A 1BO6A 1ZRMA 1DE0A 1JSCA 4C06A 3NKVA 4HB4A 1CDEA 5FOSA 4QXMA 1RJFA 4DLEA 1QX4A 5ESDA 4QPDA 3QVKA 3GMDA 5EJEA 2B20A 1GSHA 1V3VA 4D3SA 4H7FA 1K8ZB 4M9NA 4DANA 3TYXA 3DQZA 5D7BA 3QKTA 1V96A 3PX0A 3K6KA 4NBTA 4DUYB 2AXQA 2YJ6A 5CVUA 4ENRA 1POWA 5C5CA 3ZCSA 3U44A 2BQRA 4KPEC 2YJNA 3F7OA 1I0LA 4RFSB 5M34A 1Y1SA 2FETA 5IINA 4J6EA 2P1ZA 2QAGB 4PANA 5J2UF 621PA 1KP3A 3CGGA 4M0KA 3EC2A 4PYMA 1CZOA 3Q6IA 2I80A 2V9PA 1M5RA 4M6WB 4NAVA 2O2DA 3OC6A 2HMXA 3EZNA 3P2EA 1XWWA 2FG6C 1OAAA 5CFOA 3SYTA 4OJTA 1BJKA 2F4NA 3RFFA 1TJ5A 1VL1A 2PK3A 3Q3IA 1ULUA 3FROA 2FZCA 2VJNA 1VIYA 3HCWA 3SAGA 3A3PA 1HV8A 1W6UA 4XDYA 4YIKA 5CD9A 1KBUA 4HQKA 1XB2A 4ZOHC 8ICKA 4BMDA 4MI6A 1JIHA 5BNTA 1NSFA 3G8BA 5EHNA 1Z0DA 4CGYA 1Z9BA 1JLSA 4IKOA 1Z4QA 2VBCA 4BDSA 2NU9B 5BMVB 4OCZA 5BN5B 3RUDA 4FMPA 2WTMA 3SHFA 5FWYA 1P3DA 3F5QA 3EGDB 3ABQB 4AWXA 1ATZA 4HXYA 3TSCA 1UWLA 2H7VA 4U7CA 2GM4A 2RI6A 4R2XA 2QZ4A 5FKJA 1PDVA 2BSAA 3RAEC 3HYSA 2PUCA 3IKJA 3IQFA 4MWDA 4GC9A 2XZOA 4UE6A 5DI3A 3IVMA 1THGA 3QX8A 2I22A 2NX2A 5B37A 5F3RA 4P9NA 2X1LA 1TJ4A 4RNCA 3RJMA 4J3JA 1JSRA 3VI4B 2X8AA 1E6LA 1J90A 4DY6A 3EQ9A