2WHEA

Structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Details of Near-Transition State Conformers for Enzyme Phosphoryl Transfer Revealed by Mgf-3 Rather Than by Phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wheA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wheA01
5IT4A 2YMLA 5E0OA 3N28A 5AVXA 2I7DA 4Y2JA 2HOQA 1U02A 1J8DA 3W5BA 3RF6A 2AMYA 4BBJA 4AS3A 2HI0A 3SLRA 4BEWA 2W11A 1TJ3A 2Q4RA 2HO4A 1VJRA 3ZVMA 3QGMA 1JUDA 3BA6A 3L5KA 3WGUA 2IYEA 3L8EA 1RMYA 1EK1A 3U7GA 3OCWA 4BEVA 3DDHA 4XE5A 1N8NA 2HSZA 2Q4TA 3EF0A 5AI4A 4KX5A 5AI9A 3OCVA 1RQLA 2GFHA 2RB5A 2AH5A 4BX2A 1ZD4A 3I28A 5AVSA 4NWIA 5ALFA 5AW0A 5ALOA 4OCZA 5FP0A 1RKVA 3KBBA 2ZBGA 5ALNA 2PQ0A 2PKEA 3QYPA 2C4NA 2I34A 5AI8A 2YBDA 3KDPA 1Z4IA 5ALHA 1L7OA 2I54A 1XP5A 4HGOA 3OCXA 3W5AA 2RAVA 3WK7A 5AM5A 2G09A 2W43A 3U13A 1QQ5A 4Y2YA 3L1UA 3ZWKA 1NNLA 5AKXA 4UM7A 3WK6A 5ALUA 3EF1A 3ESRA 1Z4KA 5AK5A 5AKGA 2B1QA 4YCNA 1SWVA 5AIAA 3EWIA 2GHTA 1L7MA 3A1DA 4Y2TA 1TA0A 5AKZA 4OHFA 5AM0A 1U2TA 2FUCA 3AR5A 1Z4MA 4KYTA 1U7OA 2W4MA 1RQNA 3D6JA 1L8OA 5AKJA 4UARA 4CF4A 5ALGA 1J97A 2ZG6A 1Z4OA 4GIBA 4Y2VA 3IJ5A 5AK4A 2B0CA 3ZWDA 1AQ6A 1YV9A 2G80A 1L7PA 3OCZA 1S8OA 2HHLA 2G0AA 2WM8A 4KN8A 3FGOA 1VJ5A 3N1UA 1ZD2P 1ZRNA 2NO5A 4Y2SA 3ZVNA 1SWWA 2CFSA 4UW9A 2JGAA 1RKUA 3F9RA 3UM9A 5AW3A 1U7PA 3DAOA 2YJ4A 4MWOA 4YCLA 2FUEA 5AW1A 2ZOSA 2WF6A 3A1EA 3UMGA 2CN1A 5AK6A 1YNSA 5AVQA 4YIHA 3CNHA 1T9ZA 3SD7A 3N8GA 4DW8A 3AR6A 4FYPA 1ZD3A 4AS2A 1RC8A 4JB3A 4BX3A 3AR2A 1Z4JA 5ALQA 1VFPA 3N5KA 5IT0A 3E81A 5AICA 2O2XA 4BNDA 2I55A 4DFDA 4RETA 4UMVA 4O8CA 4HGPA 2FDRA 3NALA 1T5SA 4BX0A 1RRCA 3ESQA 2C8KA 1Z5UA 4I9GA 2QLTA 5AVYA 2YJ3A 1Z4NA 1ZS9A 3ZTWA 1RLOA 4UATA 3ED5A 3W5DA 3DNPA 1PW5A 3WK5A 3ZU6A 3VAYA 4HGRA 2ZXEA 3QU2A 3QU4A 5AI0A 4QQFA 3SKXA 5A3RA 3WK8A 3I6BA 3WKEA 1RMQA 5AVVA 2B82A 2G1AA 5AKYA 4I9FA 3SF0A 2YMQA 3QNMA 3R9KA 4HGQA 5AVWA 3ET5A 4ZEWA 2BDUA 4AP9A 2CFTA 4CNQA 3L7YA 5ALEA 2IA5A 4E88A 4KX3A 1S2OA 4Y2RA 5IS2A 4YIKA 4UM5A 1K1EA 2AUTA 3IB6A 4EENA 4Y2UA 2YMMA 4BYGA 4EX7A 4G63A 4EELA 1WVIA 1EK2A 1T5TA 1ZJJA 3WKCA 4F71A 2BY4A 3KC2A 3AR7A 3ONNA 2HEGA 3AR4A 2R8EA 5AIBA 3SMVA 2WF8A 1L8LA 2YJ5A 5AVZA 2YJ6A 5A3QA 4ZEXA 5AKHA 5ALRA 3HLTA 5ALSA 3NRJA 3R4CA 4BNDB 4Y3UA 1L7NA 4IFTA 2NYVA 3PGVA 1ZOLA 5AW7A 5AESA 5ALLA 1L6RA 2I6XA 2WF7A 4L6AA 2IOFA 3U19A 3ZI4A 1WPGA 3PCTA 3L8HA 4CF5A 1X42A 3QUCA 2OA0A 2IOHA 3KD3A 3OTQA 2ODAA 3UMBA 2FPRA 5JJBA 1ZRMA 4C4RA 1RMTA 4EZEA 3B9BA 3U7FB 2NO4A 2CFRA 1RLTA 2JAUA 4H1WA 2VKQA 2YMPA 1YS9A 1KYTA 3ZTYA 3S6JA 2JARA 3SKYA 3AR8A 2FEAA 3QX7A 3QLEA 3E8MA 4XQ0A 2YFYA 2FPUA 5ALIA 4L57A 2R8YA 1YJ5A 1Z4LA 2FI1A 4EEKA 3I76A 2EAUA 2RARA 4NV0A 4G9BA 5AKLA 2OBBA 5AW2A 4YH1A 2ZBEA 5AK3A 4OFZA 1LVHA 1Q91A 4EX6A 3NUQA 5AW5A 3IRUA 1XPJA 3FPBA 1QQ6A 1WZCA 4CF3A 3WK9A 1TJ4A 3A3YA 3BWVA 5AM1A 5AW6A 4HAIA 1LTQA 2HF2A 3UMCA 3MPOA 4ZEVA 5AI6A 1RLMA 3NAMA 2GO7A 2JAWA 5AVUA 5ALXA 3FM9A 4XOUA 1Q92A 3I1YA 2GHQA 4C4TA 2C8LA 2I33A 3QUTA 5ALZA 3L0BA 4IG4A 5ALWA 2IOFK 3ZX5A 2P69A 4DWOA 2EATA 3KZXA 2B8JA 3NANA 2MU1A 2P9JA 4QJBA 3GYGA 5AW4A 1TE2A 1O03A 3ET4A 3K1ZA 1Z5GA 2RBKA 4Y2QA 4GXTA 4NABA 3TLMA 3J7TA 2BDEA 1CQZA 5AW9A 5ALVA 1QH9A 1RDFA 5AHXA 3HYCA 3KOOA 3ZW7A 5AW8A 4NFLA 4KNVA 5AM2A 3DV9A 2AGVA 1TJ5A 3OCYA 3EPRA 3WKBA 1RPZA 3MN1A 2WF9A 5AKIA 4UMDA 1O08A 1Z88A 1ZD5A 3A1CA 5ALPA 1MH9A 3U26A 5AI5A 3QXGA 2MSNA 3MMZA 2JAOA 4Y2PA 3W5CA 4PNHA 3PGLA 5ALYA 4C4SA 1U2SA 3NASA 5AM4A 2R8ZA 4JDPA 4MUMA 4OD0A 2B1RA 4UASA 1SU4A 2Q5EA 2YN4A 3B9RA 3QU5A 2EARA 3ZUPA 3CZ4A 3FVVA 2FPWA 3M1YA 2P11A 1N9KA 3M9LA 5AVTA 4HYTA 4KNWA 3WKAA 4FE3A 3R09A 3U7EB 3OCUA 1F5SA 2DQSA 3OPXA 2R8XA 1Y8AA 3L0CA 3PDWA 3U7HB 1RKQA 2P27A 4HGNA 2QYHA 2GMWA 2C9MA 3L8GA 3WK4A 5ALJA 4J03A 3QU7A 1YMQA 2G06A 3P96A 5ALKA 2FPXA 4J2TA 1NF2A 4L6CA 2WHEA 3NIWA 4UMFA 2HF7A 4UAUA 3ZVLA 4F72A 5ALMA 4UAVA 3WKDA 3E58A 3QUQA 5AKKA 2HDOA 3FZQA 3FPSA 4RESA 2PR7A 1NRWA 2OYCA 1QQ7A 2HX1A 4XPZA 4CE6A 1FEZA 4DCCA 3RFUA 3QUBA 3AR3A 5AKEA 3N07A 3E84A 2HCFA 5T41A 2YY6A 2B30A 2FPSA 2ZBDA 3B8EA 4UMEA 2OM6A 3L1VA 4BKMA 1XVIA 1YDFA 2WF5A 1Z4QA 2B8EA 5A3SA 2D2VA 3ZX4A 1WR8A 2WFAA 3AR9A 5AVRA 2MU2A 4FFDA 1CR6A 2O9JA 1QYIA 1IWOA 2ZBFA 4NAVA 3QU9A 4UU1A 2X4DA 3L0YA 2G08A 5ALTA 4YCMA 2G07A 3MC1A 3WGVA 5ALDA 4UU0A 1Z4PX 4YGYA 4B6JA 3L8FA 3SHQA 2C88A 4Y2XA 5AM3A
chains in the Genus database with same CATH superfamily
4RPKA 5J0TA 4YAWA 4YTEA 1IM5A 1H5QA 2V4ZA 5HJ5A 1F1BA 2A33A 2AHRA 5IBRA 1QB7A 1G20E 4YYEA 2GEFA 2QRVB 4CHGA 3OQMA 1NXTA 1E59A 2ILVA 4I4TF 4UB8U 3N70A 4MPRA 3R7NA 4CMEC 2ZUDA 2G1JA 2BUBA 2C9ZA 3DE6X 4XGNA 3A32A 4DCOA 1T5HX 2P2GA 4F2RA 3W9YA 1SC4A 5DT9A 3AFNA 1DAMA 1SIUA 3RIMA 4J75A 2A5YB 2PT6A 1B6TA 1X39A 3O2JA 4GEKA 1HLGA 2B8NA 2QVGA 2YXLA 2XE8A 3EOZA 4K9DA 1QRAA 1C9EA 2Q6TA 4MR8B 4RVFA 4BQQA 2V0GA 2WINI 5JCJD 1KNQA 2R8IA 5DH9A 1ORIA 3N6RA 3OLYA 2VEDA 3RBZA 3MINA 3ZYCA 1P0PA 1HNWB 1VZ2A 3NKLA 3N5CA 2H51A 2W00A 4IICA 1IIPA 1RAHA 4BN4A 2QE7A 1HIWA 1W6RA 2G71A 2CEKA 2Z8XA 1E2JA 2C5GA 3G9QA 3R7DA 5J2DA 4D6XA 4L0MA 2FMKA 3GCGA 3Q12A 1B76A 2FRDA 5K7SA 3OSZA 1P2FA 1XTRA 5HUQA 5JASA 2WUDA 3O95A 2LKCA 4LHYA 5IZCA 3RAFC 2DUYA 1FS6A 2FK7A 3PT9A 3UK2A 1Z17A 5I9LA 1PZNA 1MQ8B 2OZPA 2ZBGA 3AHJA 4B79A 3REFA 1BNPA 3R24A 3DPUA 5AI8A 4X62B 2XWPA 2CSXA 1NNSA 4UTXA 3FPGA 3FUUA 3KDAA 4EMBA 1VGQA 2O8NA 1YZKA 2A2ZA 2AF3C 2P3SA 3S40A 4CTOA 2I22A 4F0JA 4NMMA 4L6IA 4EYIB 1LUAA 2BPFA 5J2TA 3RYHA 4D8YA 1M73E 2GFIA 1I4TD 1U9YA 3LAWA 3V3KA 2IS6A 1EZ1A 1OZGA 1EXMA 5CEHA 3DLCA 3BILA 3EG9B 3NFYA 4JWKA 4M37A 4TTPA 5FL7D 5H9VA 1U7TA 1KDVA 5LKRA 3R20A 1T3GA 5KYUA 1ODFA 3VC7A 3I83A 1IZYA 2PQMA 3FFWA 4UAGA 4ZAXA 5ALUA 2AJDA 3H1PA 5SZHB 1PE0A 2YBEA 5HKBA 3T3MB 3Q8PB 2PMCA 2FH5B 5EHQA 4Q3LA 4AJIA 2W2NA 4UPVA 5CVEA 3D8RA 4D6YA 4E4RA 3GV8B 1T8EA 5CLJA 3AJRA 4QA9A 1VMKA 3UV3A 2VDPB 4CTNA 3HCEA 4YRTA 2FRVA 4XYEA 4Z54A 1HORA 4D4LA 1ZCZA 2XKKA 2RGCA 3D4OA 3KEOA 3BQ1A 1T4BA 4AYBC 1VKRA 2J6TA 1HSOA 3AR5A 3DOFA 3OEED 4IEFB 4AUKA 5EP2A 5D51S 5KG2A 2ODWA 5DE3A 2Q3JA 1EDOA 1JG1A 1J2NA 1G9SA 2YQEA 1J4AA 4IDDA 3GLSA 2NPOA 4M99A 4BVBA 4R9RA 1XHEA 1C9MA 4HSGA 4WE3A 4UARA 1L8XA 1Y1KE 1O77A 1D3AA 3EZNA 4KUGA 4NDNE 4MTLA 3THXA 2C82A 1TZKA 2GF0A 5FADA 4L85A 2ZG6A 1FQOA 2ZB3A 1L5YA 4FEGA 3MPUA 4B9LA 1NZDA 2FWNA 2JC3A 3L0ZA 1XL1A 2OL4A 3M6AA 2VATA 4KQWA 3TZ6A 3WL6A 3SHFA 1K6MA 5E4YA 1K6IA 3OC0A 1FYFA 4QDOA 1ZCBA 3M5PA 4PC6A 3LQFA 1E5LA 4J90A 3UK1A 1VJ5A 4JOQA 2VJAA 5C5EA 3MFYA 1NQVA 3VTFA 1ZCJA 1LPNA 4CTKA 2FDXA 3ZU4A 1CQPA 1P9NA 1T43A 1TPZA 1OKKD 1U7ZA 1Z5WA 3LBNA 3A1SA 1DBRA 2BM0A 3R7LA 3RPEA 2VUSA 3ONFA 3V46A 4LF4B 4X5OA 5KIAA 3RUPA 4YRNA 3F5QA 1E79A 2XMRA 5DBAA 3MUNA 4GM0A 1W44A 1QIIA 5AK6A 3N3AC 2IKQA 2Q6IA 3OAAD 1OBCA 2IV2X 4NX2A 3OJXA 5IEBA 5IF9A 2DE0X 4L5IA 1M0WA 2ZIZA 5K0LA 2YVAA 4GD3Q 3IDZA 4H0CA 1CETA 4PX2A 4ARVA 1NNUA 1K97A 3BH0A 3BH7A 5C1OA 3ADCA 4RD1A 1EVJA 3SAGA 4X8MA 4D8UA 1NR5A 4PBRA 5ALQA 3R0ZA 4BQOA 4P36A 2FF7A 7ICTA 4MPJA 1ZXIA 3WXMA 2RJ3A 4AECA 2Y9PB 5IWCA 1EP1B 2PK3A 3D0RA 2J3LA 4IS3A 2R5NA 3P7MA 2LKYA 1O95C 4US0R 3NBQA 1NBIA 1SKWA 3BX1A 1KI9A 3VCBA 4GI1A 5KNLA 1T3TA 2WAQC 1T26A 5ENVA 3LW8A 5JSQA 5JD5A 1SV0A 1NVMB 2CLOB 4HLNA 4JKOA 4F12A 2C8KA 4O5CA 1SK8A 4YPFA 3ZTWA 2Y77A 1N2XA 8ICGA 1KEWA 2VSQA 4II7A 1Z8HA 3VR4H 1TIPA 3JWHA 1VMAA 2X0IA 3FYDA 4V0OA 3DE3X 3TO5A 1FUIA 3TS1A 4ENWA 5MGNA 1DGQA 4TUSA 4WOJA 1H5NA 3TQCA 3KALA 5JWRA 1QKJA 1XZKA 1RI2A 4R41A 1XLTC 2KOBA 3FCOA 4BO2A 4YJFB 2QT1A 1T9HA 4MKIA 2AJCA 1H5UA 1BDJA 1EX1A 1HF3A 3F49S 1L4BA 2ORYA 1N5MA 3MT8A 4AG6A 4R2LA 2J45A 2ORWA 4QBGB 1UMDB 2VBFA 3OIFA 5LLSA 3VR3A 7ICOA 2X2FA 3TLZA 4BGEA 3NAZA 1Y48E 5KX5A 1EFAA 2MSEB 2ZRDA 5FTMA 3DOJA 1T8RA 3OA2A 3UJ8A 1UMBB 3PQ3A 3K6RA 4HDKB 5HZKA 5GZ1A 2I7VA 4HQFA 4L0CA 1DFHA 1T0JB 2DUMA 3GJ8A 4JD5A 2C8JA 1HQKA 3E3NA 3NHBA 3CFYA 1MAWA 2PZLA 4MRNA 1QWSA 1UMBA 3QTBA 2LCFA 4F84A 1J21A 2IBKA 1T9GS 1EESA 1B4FA 2MYPA 2WJVA 4LJLA 2HJRA 3EEIA 1XFDA 3H7AA 4OAOA 4D56A 5LYYA 4EENA 1DWUA 2N0SA 2YMMA 3RF7A 4EX7A 3U3JA 3UAWA 1GA6A 1TM2A 3UUEA 4P4NA 2FW7A 2N46A 3FB1A 1V8FA 4AN0A 5KYWA 1FLVA 1U81A 1I0ZA 3GP5A 4DF4A 4A3SA 3E23A 2ZJ8A 1PT8A 2PKRA 4F71A 5GINE 4GX1A 3N74A 3W6PA 3ZIDA 1JQKA 1Q1GA 1SG6A 1AM4D 4TM8A 3N7UA 3RJ5A 5KT3A 4E21A 4TTJA 3BDPA 1Q7TA 2OHIA 1NI4A 3FYCA 5TE9A 1T35A 5EI5A 3S2YA 2H3EA 3TPFA 2DUNA 3LVVA 1A97A 1POXA 1O54A 2C57A 4X54A 2WQ7A 1XNQB 5T67A 4O25A 4ZO9A 4DJ5X 4EJSA 3AF6A 1LTHR 1P77A 4OGLA 4S1OA 3TH5A 4PEVA 3CURA 1WXQA 4F85A 1ZM3A 1EBFA 4LCJA 2R8PA 4QAQA 2XGMA 4UCFA 1MNQA 3VO1A 1YJCA 3GYBA 3TYXA 2VZLA 3MCWA 4AMYA 3S3TA 3CPSA 3AI1A 3HR8A 1ZINA 1MU0A 1HE5A 2DM6A 4FWIB 5C4GB 2YCBA 4EBDA 1UXOA 3DAYA 4Q12A 1EM6A 4BN0A 5B1EA 2PL1A 4OBEA 3H13A 2Z9BA 3DVLA 2HHQA 3QG1A 1G3IA 1R16A 1WPGA 2O2YA 2OV3A 1OGJA 4ED1A 4IH4A 4NJEA 3L8HA 4LZGA 3RKUA 3GLGB 1A7KA 3BJMA 5A5DA 1KWGA 4FQ5A 2PKQP 1WMFA 4AURA 1N33B 1ETUA 2BKEA 4WQMA 3BGWA 4EARA 2AG6A 4RF5A 2EJWA 4OJQA 4A0HA 4CJXA 2ODAA 2FFHA 3MDAA 1P0QA 3NS7A 2E8NA 4K7JA 5EIEA 1ZRMA 2PDAA 4RHUA 1SFRA 3L3BA 1V9PA 3B9BA 2DGDA 4TQAA 3P0IA 2BCSA 3W4JA 3ADBA 1GLNA 2CHVA 4XIGS 4P0PB 2WSYB 3JU3A 3T4EA 1QCYA 3KKKA 2QW8A 1H1LB 5AYVA 1OWNA 2RH9B 4YAIA 2PS3A 1X38A 3TVTA 5KJFA 4I2VA 4GR5A 3KP1A 3OBBA 4G4GA 3WP0A 3GB9A 1FFSA 3PQ2A 1QRRA 4WWHA 2MR6A 2DFKB 1IK6A 1T5IA 3OEWA 4TM7A 2M1ZA 1I5RA 3I5UA 4TMXA 5ARDA 3U7QB 1IE3A 4MA0A 4OAPA 4B3MB 3RJIA 3WLOA 3MFIA 2RGAA 2OV2A 1EWKA 1Z4LA 1W34A 4MQ4A 3PZBA 4X41A 2H2IA 3B6JA 4A15A 1HDXA 1HI9A 3FNFA 2W04A 1DT3A 4E12A 4H4CA 1XO1A 1LVHA 3Q0TA 4N6NA 3ASYA 4R51A 3OC6A 4TGLA 2I9PA 5AW5A 3QEMB 4A8JC 4D97A 2IDJA 5EGNA 1HNXB 2W70A 1W4BA 3HCNA 1SXJD 4RZ2A 1AXEA 1DC8A 1N2JA 1W0JA 4JLAA 5F21A 1T36A 4URVR 5KTYA 3NI2A 4NJMA 2C2XA 3GV5B 4PPXA 4E5DA 4OUKX 4EG1A 4ZI7A 5KFAA 2OZLB 5L4LA 1RYYA 2G9UA 1TT5A 3MHPA 4F3KA 1MJGA 2JCBA 1Y1RA 3ESCA 2X77A 2P6NA 2FMSA 1HZZA 2XD4A 4R54A 5FBQB 4ZZIA 3I62A 1YOVA 2QL7A 4S0ZA 5KQGA 1DGJA 3A58B 4J4HA 2EZTA 4RV4A 1L5VA 1V3TA 3OZSA 4FSDA 3WWOA 3IE2A 3H04A 4WCDA 2A4KA 2R1VB 1Z63A 3Q7PA 1K8QA 2HRRA 3WWZA 3TRKA 3BXGA 3GRPA 5BN5A 4OKIA 3TSZA 4Q39A 3H5OA 1QB8A 4KXXA 1D07A 4RZSA 3E6AA 4G4SO 2AYXA 4TT8A 1W52X 3DLHA 1UPAA 1Q20A 3AUSA 1RBYA 2VNAA 4M4SA 3QEKA 3LSTA 4M1SA 2ZTDA 3IJRA 4EW2A 3L8DA 4GXTA 5KOJB 5LQSA 5A3JA 4DEXA 5KT7A 2AWOA 3GGGA 3RU9A 2W9CA 3GRRA 4FHGA 3MWFA 2EQ5A 3IVGA 4BKOA 1P2TA 1U0GA 1ZESA 4ZGGA 2EZZA 1J2RA 4X5VA 4BGIA 1Y6ZA 2RE8A 2VDNB 2ORVA 1RPNA 1U04A 4LNHA 4BWGA 3IN5A 1QK5A 4JWMA 1HWYA 1NLMA 2FXVA 4KNVA 3SSAA 3G2MA 4LXTA 3ZCXA 1HG0A 1TAHA 1WXDA 3WGIA 2EFDB 2Z30A 3LY9A 2CLLB 1QUFA 2GEKA 3K9QO 1GRRA 4MPPA 5LA6B 4B0OA 1LPAB 5KWVA 5KYGA 2EJBA 4GUDA 3FZNA 3X1XA 3ZGVA 2WT4A 1I8TA 1VA5A 3QXGA 3MMZA 4G8DA 2JAOA 4HH0A 4R40A 2A0UA 3DZGA 4P98A 4ZZ2A 1SBYA 3UY4A 3TB4A 5LDDC 3NZEA 2QKYA 3DM5A 4C4AA 5IKPA 1VI2A 1RHKA 2EP7A 2QPAA 4Y1RA 4MVYA 4JP1A 3DQQA 5AUNB 3RBVA 3D2SA 1LBSA 3COVA 3H6KA 3P4YA 2KJ5A 3LM8A 4NU5A 1WQ4A 3OIWA 4IOKA 5DXFA 3ELYA 3V4RA 5KQLA 3LHKA 4WVFA 2LRHA 3H3JA 3I2IA 4K26A 3I30X 5EWEA 3RS9A 2HBMA 1GO3F 3PV8A 1XZJA 3D4BA 3H05A 2R47A 4FN4A 4HKTA 1NVUQ 2DR0A 3NDJA 2JGDB 2WAAA 3FUVA 4C4OA 3T1YB 2ZJ7A 3L0CA 1ESNA 2P27A 4NOKA 4KAJA 3TG8A 5IC5A 3K31A 5LQDA 1QCDA 3FPJA 3BIFA 5DHAA 2CNNA 1A5AB 3HPRA 5BOSA 3KO8A 3ZD6A 5THKA 1MW9X 2P3LA 2JI9A 4MWTA 4TQ9A 3A11A 4LHEA 4OL0A 2FZWA 3D6FA 3TANA 1B6RA 3RUHA 1S4QA 3BMQA 3U1TA 1QVRA 3B53X 3R9WA 4U7TB 3UAOA 2A9QA 3AEUB 4F56A 1THZA 1A8IA 3ROPA 1SZDA 4M36A 2PLWA 4F9GA 4J7CA 5BWNA 5BXQC 3ZVLA 5KAPA 2WB4A 5J3JA 2Z6QA 1RYUA 4ED8A 1NBHA 4BVEA 2YX8A 2ZXFA 5TZVA 4OI4A 1P3JA 4Y6SA 4DY6A 1EGMB 3D6HA 2IT1A 3INNA 1UBLS 1RJWA 4WZBA 3X43A 1W9MA 2ON6A 3GJ4A 4MVJH 5HDQA 2X8BA 1X7XA 3RVOA 3DOUA 2PD4A 4WXHA 2FR8C 1HM5A 4BMYA 2BJHA 4R9SA 4M7OA 2COEA 1GL7A 2H07A 2J07A 3TNFA 4XVHA 4OM7A 4RULA 3ZJ4A 5KYUB 3OKCA 2Q4DA 5FI3A 1FS4A 1U0LA 2BONA 2XB9A 3AFGA 4YT4A 4PPFA 5L3QB 2CC2A 5BP7A 5E4FA 1UP7A 2VC2B 4WECA 3GGJA 1Z2PX 4OM8A 4ZPXA 4ZYYA 1IYZA 9ICUA 1TECE 1DAOA 4GSLA 4D9EA 1U2PA 2UXDB 1KL9A 1LNSA 4U7CA 4HH4A 3GZFA 1A04A 1L4KA 4AO6A 2ZW9A 5KPJA 1U65A 3R5SA 2D59A 4X20B 3I6IA 2RQ5A 4C0QC 4CM3A 3TR5A 4DG5A 1JJAA 2KFNA 1Z29A 1ZH2A 3ESDA 3HI6A 3OPYA 4JLBA 1EM8A 3KHSA 2ZBFA 4I0WB 2A94A 2OGUA 2QA5A 3K96A 3L6DA 1KA9H 3BTVA 3QY9A 4ZHSA 3CF6R 4TKUA 3OURA 4BEJA 3KV1A 4R84A 3PFHA 1HETA 5E4JA 1T4GA 4DSKA 1Z13A 2QT9A 4NZ9A 1E1RA 5EIXA 1WVGA 3N2LA 4QL3A 1RXWA 3D54D 4WCFC 1NVBA 2BR5A 3BQNB 4UU0A 1WUYA 2PGOA 2KSOB 1K8ZB 1E9SA 4CUZA 1DXSA 1NK9A 5DU2A 1VZ3A 4I1VA 4AYTA 3WFIA 1ZIOA 2ZYIA 5SZIA 1E9EA 1T36B 1T1IA 2FQQA 3MLAA 4C8KA 1JU4A 3R3XA 1PEDA 2Z5VA 3FFBA 1JROA 3H1BA 4FS8A 4ITVA 5ERYA 4D3DA 4QQ8A 3A26A 2HK7A 4L4SA 1M9NA 2Y8EA 3UXHA 4D0NA 5MN4A 2BHSA 2JD0A 1KEEA 4Z2AA 3P97A 1CQXA 5FOQA 2WWXA 1QS0B 3EIHA 3AEYA 1BD4A 3SHTA 1Q16A 8LDHA 2DKXA 2PGAA 3AV3A 1BEZA 1ZQHA 1XVVA 3EVFA 3W8EA 4DM4A 1DJPA 3ZE9A 3M6IA 2Y0PA 4BLRA 4WDRA 3DR5A 4UJ3A 5FORA 4FT4A 3DAHA 2IPNA 3LWNA 2A0XA 4Z4HA 2GN4A 2OFOA 1JMYA 2V97A 5LP6B 2Q2NA 4HV4A 4RTMA 3Q3HA 3M6XA 3DDHA 4MVWA 1QOZA 3FVTA 1QIHA 1XA0A 3I6QA 3JQGA 3O9ZA 2WM2A 4ILKA 4M8KA 4QTUB 2CBGA 2EP5A 2WV9A 1KS2A 1SBHA 4V0ME 1LS6A 3M8RA 2QENA 3DNFA 3LV8A 3LX8A 1SULA 1OX4A 5SZKB 1RXSA 3E7DA 4D99A 4G0XA 1GEEA 1NJSA 4JOCA 3QV1A 2FMPA 1SUAA 3MM4A 4JBWA 4DDTA 1WUHS 3VYUB 5GZ3A 5J2UF 2QI9F 4LVCA 1JI7A 3KDPA 2QYOA 3Q3VA 4DABA 3K35A 4HMOA 1DTSA 3KTFA 4LTDA 3H5VA 3RAJA 1JHDA 2WI8A 1TI7A 3AY3A 3NHPA 4R2HA 2NVWA 2K8CB 4H9GA 4Y9UA 2PIDA 2IY9A 3PYLA 2REOA 4R1QA 4D3XA 1M6VB 4MFCA 2E82A 5K09A 1CUHA 4D7AA 4UHFA 4WNCA 3W7AA 4S0XA 5EZYF 3F6YA 2R5FA 3OQ6A 4H77A 2Y1KA 2Y68A 4AIRA 4E5YA 3EF1A 4NXZA 1JDVA 1DARA 3K0CC 3OT1B 3EJ6A 3RSZA 4Z1MD 1PCXA 3UG6A 5IJXA 3Q7RA 1CUSA 3H0EA 4IGIA 7ICSA 1Z0AA 4PFJA 4MV0A 1ZC4A 1WUDA 2ZBUA 4OBXA 4MV5A 5EERA 3TINA 3WL5A 3SQMA 2EAOA 2H5JA 2FEXA 2VHUA 3AERA 3MA0A 4YAJA 5BUQA 2GCOA 1YXMA 2H4WA 4JUFA 1GG2A 2V7GA 3C6BA 4MOWA 5E1OA 3K4HA 5EINA 5IAGA 4CG3A 3ZDDA 4KYTA 3BUSA 1KVUA 2PKQO 1DJQA 1NXQA 4Q48A 3WA6A 4COOA 5B6JA 2ZJBA 4A1OA 4Z0PA 5CIYA 5EIWA 2Q5QA 1ILWA 2BYTA 5FL3A 4PHAA 3I4FA 3A9SA 4YWHA 4UNQA 4P5DA 4CM6A 3LUCA 1ND6A 1W7AA 3IAS1 3H0LB 3WRYA 4O4LB 1XZGA 3U31A 3IEVA 1UZNA 3LXMA 2XQJA 2WC1A 4OHVA 3V97A 3ZJUA 2VYFA 4L9WA 3LYSA 1U2QA 2H8GA 4P93A 3IIIA 1DTWB 1Z4OA 1ZQ1C 1F2VA 3IVMA 4GWGA 4MUAA 4M9SA 5J4LA 1I01A 3ZWDA 2G4LA 4EWLA 1HFWA 4X6XA 1II8A 2G80A 1W93A 3OCZA 3P45A 4TLLB 1R88A 4N5MA 4JBHA 1BX3A 4OYRA 5L1JA 3LKVA 2R8JA 4UHHA 1WXIA 4WK0B 5B57C 1F7VA 2QVXX 1FJXA 1GA4A 4RHXA 2P79A 2KYRA 1U0JA 4WBNB 1H0HA 3I6MA 2WR8A 3NYWA 4X97A 2JCVA 3SC2A 4YROA 5KFFA 3ZZMA 5KOHA 1NUHA 5K20A 4LEIA 4RM3A 1Q1EA 4YXMA 3HBJA 2CN1A 3CEHA 3WBFA 3F6RA 1P5RA 1GZSA 4OJ6A 4G8CA 2ZSHA 2BZGA 3CNHA 4KPUA 4MYDA 4RD4A 4RZQA 2CKDA 4HVLA 3PLAE 4R2JA 3VH1A 1HY3A 4KLEA 3OTWA 5KNCA 3T34A 3AR6A 4HNAA 1RLIA 4KQGA 5ER9A 3IUBA 4CM8B 1G17A 1I0IA 3A1FA 3BRCA 1TK2A 1X7YB 4MUIA 1VQ1A 5GM2A 3QKSB 2CJXA 4UCXA 2WWIA 2QKQA 4GBJA 3DCIA 2PL9A 3TNLA 2MSWA 1CTQA 1F12A 4UEWA 3EZLA 4YMTA 1I7LA 1OY1A 2AN3A 2J5BA 3VQTA 3IR5A 5HQTA 1IEWA 3OTIA 4YMWA 3E2PA 2ZCUA 4TYQA 3VM6A 4Q93A 2DB3A 4ZA2A 3OSUA 2ZUVA 3FUWA 2BZ1A 4ECAA 3SEZA 3ELDA 4RW0A 2PEZA 2VJ4A 5B7NA 5J4YA 1GQYA 3H0RB 1XX6A 2Z9CA 1NDUA 2ATXA 1IXZA 1D0SA 1MZVA 2AXPA 2F9MA 3PW0A 3DBIA 3IHKA 5A7HA 3HKCA 4TWRA 3TVYA 3G59A 5BQXA 1F8XA 5BSWA 4CQMD 2WSSA 2CCJA 4OX9Y 1Q7CA 3PJGA 1G19A 1ODJA 4N7JA 3V1LA 4JJ6A 1ZM9A 2XZTA 4PHTA 4KDCA 2HA4A 3ZU6A 1HX7A 3OPQA 1HEKA 2CPRA 3SJ7A 1LI4A 1OT3A 3PX0A 3ZV4A 4BTVA 2P75A 4CV2A 1DG1G 3CT4A 3HCWA 4D42A 4ENRA 4EECA 2G7MC 1KAOA 2WU8A 5TPWA 3PHHA 2PRIA 4QWWA 5CLIA 2KG5A 3EA4A 5CCBA 1ZHFA 3D4NA 2CFIA 1S9DA 2G1AA 3PSIA 2JGFA 4RMIA 2DVMA 4N0QA 1F3LA 2EC5A 3E9ZA 4RYDA 3RC2A 5LVAA 1FW8A 3B6KA 2REQA 4OFBA 4MW7A 3COYA 4Z9AA 2D0DA 1ONNA 3HRDD 2NO7A 4MH0R 1G66A 2VDWB 4YFVA 4ZEWA 1GO2A 4V2UA 3VR3D 3ZI7A 1OTHA 4YX9A 3WSWA 4RXMA 4XDHA 4ZOEA 4CU2A 2NSJA 4UEKA 1DJMA 2DBRA 4BMCA 1EAMA 1T8PA 1AXGA 1V97A 3P0FA 3R4VA 5D85A 5GGYA 2ERCA 3H3FA 3IUNA 1V6AA 4TRNA 1EXWA 1NU6A 4OHOA 2H6EA 2FKAA 4M0AA 1WMDA 4MVXA 1X6IA 3TIVA 3TCXB 4EZBA 5CEFA 5LFAA 1CUUA 1IJKA 2PTGA 1BOFA 1F2UB 4O0LA 1WCLA 3NH6A 3SEAA 4HI0E 2PS0A 1ECJA 1FUKA 2VQDA 4G63A 2ZKLA 3WNDA 3WVNA 1SOAA 4D9KA 4ZDJA 1MQ2A 4WACA 5IZ4A 1YULA 4DSIA 2XVYA 3WKCA 2QTFA 4C0LA 5DNCA 1M67A 4HPJB 1MTZA 3CLUC 1ZVQA 5ERXA 1FLDA 5FOSA 1U47A 1OD6A 4MWBA 3UANA 2M6RA 1TV9A 2P4EA 3H5NA 3UW3A 1NNEA 3HUDA 2R7NA 1JEEA 4KPGA 3K8YA 1TJNA 3KQQA 3ZV7A 2AUNA 1CIPA 4YRMA 4TMYA 4EABA 1YZFA 2GKSA 5EIHA 3ZGOA 4B17A 4R0VA 2E7ZA 1DKQA 3RS4A 2Y93A 4YR2A 3IV9A 1PJZA 1WDWB 2AUMA 1JPNA 1QAOA 3KT3A 4L0DA 4ZU1X 5ENDA 5LSAA 3HO1A 3D8BA 1ZX1A 1PFYA 1TAGA 5KU7A 4K6KA 3BZBA 4ATNA 1NQUA 1MOPA 1P6UA 1QSLA 4PBTA 4WD3A 5D3KA 1I6LA 3KJEA 2PUTA 5KVQA 3IV7A 5BRNA 4CL0A 5ITSA 1CV2A 2JZBB 2HBRA 2JNWA 4ZCRA 1TVMA 1X1SA 2J41A 1MF7A 2NX2A 2V6IA 1GYQA 4LZNA 4EUFA 5I8WA 1H2ZA 1A4IA 1P91A 3C7AA 5CVUA 1RU3A 1W4AA 2QN9A 2AI3A 3IEMA 2KZMA 3D3WB 1W0KA 3TLXA 1RZRA 4QTZA 1DUVG 5KAFU 1BKDR 1X9HA 3HV0A 3ZK8A 2YV5A 5LD2B 5CXSA 2IOHA 2KIWA 9ICIA 3H2IA 3OT4A 4B33A 3AQIA 3JX9A 5C53B 4DS3A 4RQBA 3SYMA 1M34A 1E0SA 1E9CA 1SBCA 2W7PA 4G0PA 3TZKA 1O94D 3ZHSA 3EDRA 1YTLA 4PSVA 2X3UA 1I4EB 4INAA 3Q8QB 2BBTA 1GFIA 2OR3A 3D3QA 3HG7A 3OF2A 3OIDA 4IEEA 4WCFB 1HFKA 2BCEA 3FFTA 3KQTA 5K0GA 1E9FA 1VRVA 4LOHA 3LY7A 4HR7A 2GAJA 4HAZA 2I5HA 4OQFA 3W6ZA 4ZV9A 5K8UA 1MA7A 3DEEA 3TTTA 1SVKA 3AR8A 5B36A 1FVOA 3EZ7A 5C8YF 5JHHB 4JLSA 4WKBA 1Q57A 5WRFA 3TMKA 2WE8A 1XJWA 1KBUA 2WD7B 3HR4A 3PJEA 4U2CA 4QG3A 2IHUA 3CF4A 5DHTA 4EFNA 2FMFA 1P2UA 4H3HB 3RTBA 1T2VA 4NQRA 4ZAVA 1AN9A 1NDQA 4LMBA 1ONSA 3T5MA 1X8JA 2C4KA 2D3DA 2XXJA 2Q46A 3R6TA 1AUPA 4EX6A 1X8XA 3V2UA 3QWIA 4LDRA 4PG8A 1TK0A 5JZOA 1YL6A 2GN0A 3FPBA 4ALIA 1WZCA 2IK8A 4CF3A 1ZM4A 3R6DA 1LV8A 1TNDA 3BSYA 3GDXA 1SV0C 1FRNA 4Q1CA 1G5TA 4I1SA 5IH3A 1I24A 1Q22A 4L4UA 2ZUUA 2CZGA 4J07A 1SN7A 2ZRBA 1PJAA 2R1UA 3M8KA 1K98A 4PZNA 5KCZA 2PVCA 3DPIA 3SHWA 4YCXA 3ZDFA 1LKZA 5I01A 2JAWA 1KSFX 5FAXA 3KSRA 1UT6A 2DPXA 2GR9A 3C3KA 3NVAA 4REOA 4YHBA 4YV1A 1U0BB 3SJBA 5ABPA 3KPWA 1EJBA 2FE4A 2OK8A 5I9IA 3I23A 3PX2A 3L4JA 1GIAA 1ONOA 2PJZA 4GECA 4D4MA 4DT1B 1DSSG 1VHTA 2NRZA 3INGA 3PGMA 4L8YA 4R83A 4DWOA 1U0NA 2O4CA 4Z51A 1W46A 3H7IA 4LYGA 5IC4A 4X90A 1JW9B 4N3NA 2I3GA 3FDJA 3KR1A 5HQJA 1PQYA 1RLUA 3D0KA 1MA0A 1Q2UA 5C7OO 1ZPDA 2WJ6A 4N3AA 3VVCA 4EKGA 5EN4A 1MABA 5GVSA 1RC0A 1LSSA 2QB5A 2OOSA 4Y2QA 4P6VF 4WH0A 5JYBA 2WV7A 1ULAA 5B6PA 1HE2A 4CW7A 3S27A 1PK1B 2C2OA 1MAHA 2RCNA 1TMOA 4NENB 1J56A 9ICLA 4OJNA 5KWSA 2RHGB 3E3AA 1E61A 3QLVC 4NG4A 2ICAA 4I29A 3A6LA 4UZFA 1UWKA 4P4SB 1O4WA 4AUNA 9ABPA 4F4IA 3C3YA 5J23A 4PZZA 1X1EA 1KVTA 3LBHA 3R3ZA 4J0FA 3TLEA 1EM8B 3ZQ6A 2JRLA 5FTWA 3ZY5A 4CG1A 1KFEB 4PLPA 1X94A 4D4JA 4EKYA 1RPZA 4M6WA 4BRSA 3LPLA 2X1VA 2QUZA 3RQIA 3VSBA 2HK6A 1X9GA 3GVCA 4G5FA 4C43A 5GTDA 1UC9A 2JFGA 4JK1A 1N4AA 1I4LD 4I2IA 5J0YA 4KLCA 5DM0A 1IY1A 2IGBA 1ECLA 4JLDA 2VI5A 2M9NA 1QTMA 1YD7A 3AQEA 1XQXA 1YB5A 3BF7A 4N9WA 4WESA 1EUQA 1XEXA 5BR7A 4UB2A 4D4HA 1MO6A 1N0IA 2C95A 1YACA 2ZP1A 4C87A 5JBIA 3G02A 3SEFA 4IRKA 1IHUA 2WOJA 4PIPA 1HE1C 3D59A 4NFSA 1KZHA 5BVGB 4RMJA 1H3EA 4IXNA 4AI6A 3IKVA 4JC0A 1PJ4A 4FFOA 1JDBB 4AW9A 3B60A 3L84A 1U9IC 4Q1BA 3CVVA 4MRRA 3TE6A 1H22A 1E69A 1OSNA 4WZBB 1G8FA 1L8QA 3K94A 2QM3A 1ECWA 3C85A 4M89A 5CT8A 3IALA 1K86A 5ESXA 3EDCA 3JRNA 1EGAA 1HSZA 5KI6A 1UDRA 5KQPA 3T15A 5F3RA 3OLCX 4AF6A 3FYSA 4HZUA 3MUOA 1P75A 2XUIA 4LYEA 2PLRA 4M88A 3V6HA 1YRWA 2XOKA 5DLPA 1EFRA 5FBKA 3SZGA 1UZUA 1A82A 5HRCA 2XBUA 3GLTA 1JPUA 3NLLA 4EO4A 3BYZA 3NHJA 5T5QA 3UN1A 1O94C 4OQYA 3GAFA 5AR1A 1LQ2A 3N76A 4H16A 4OLFA 2O2JA 3LKDA 1NVKA 4WZAB 1XPRA 4IZ6A 4NJOA 1SB9A 4PC1A 2OFFA 1BVHA 2WU1A 1E3EA 4K0KB 4FB4A 3RU7A 5PNTA 4FDAA 4JYMA 1MW8X 1Z36A 2HA0A 9LDBA 3EMBA 5AQEA 4ZTZB 2CHFA 3FZQA 2I80A 1BX1A 2PKWA 1N5IA 2XMPA 1ULHA 3PW5A 3KQPA 3ZK7A 4D0SA 4LXUA 2H3VA 4NNOA 5BSHA 4B76A 5AKEA 1BJRE 4KYUA 3VTKA 3EXFA 2Z6VA 1RRFA 3K8ZA 3DT9A 1MABB 4ECXA 1ARZA 1TRHA 3FJOA 4RO0A 2H08A 2IV7A 3RE1A 5K6AA 3Q6NA 1T5LA 1CY1A 2FLNA 1ODTC 1U1GA 1Q83A 2FPSA 2OD9A 3AU9A 1J8FA 1JHXA 1ZK2A 1NLFA 5H0IA 3RC9A 5KTTA 2CMKA 1JJVA 3KSMA 2E1FA 1IPHA 4COKA 2OUKA 1ZIYA 5EP1A 1FZTA 2PE5A 3HJCA 4R1PA 1M8GA 2F59A 5IIMA 4G1MB 2BI7A 3BRWD 2G4VA 4F7DA 5FEMA 5J0PA 2UUAB 5KFWA 1P1RA 1B0PA 1G6HA 3FHLA 4BVGA 3TB6A 1KQPA 2AN5A 4URWR 4DMGA 1HK7A 7ICQA 4RLHA 1ZMBA 1JZSA 3Q9NA 1M34E 4EJSC 1FDOA 2PWYA 3OIYA 4WRRA 2R68A 2Z57A 3J81k 1AJEA 3X0DA 2HCJB 1WHTB 5EJ6A 1JVNA 5ALDA 3K70C 1LF5A 1Z6XA 3AVVA 3WRYC 4D41A 4FZNA 4ZCTA 1AQNA 3TX2A 3SX2A 5KOYA 1O9HA 2RDMA 4N12A 4WSOA 1G8YA 1GADO 2OHVA 3BWYA 1GCAA 4RABA 1M2EA 1QR2A 3ILXA 1QRUA 1WB4A 3DC2A 1P17A 3PC3A 4NMWA 4H0NA 1TPYA 3PWZA 3QVUA 3N28A 2Y0EA 3EXEA 3C4QA 4P5PA 5AK0A 5EL0A 2CVZA 4PF1A 1XEXB 4MR9A 1WE2A 1F38A 3CJRA 1C1XB 2VH1A 5FR2A 4BO3A 3RJHA 2FPGA 5IVDA 3RIXA 1CPYA 1DOAA 3DMTC 2QTMA 4FNAA 1F0NA 3ND6A 5I4CA 4BBJA 1AQYA 4GDMA 4AS3A 4FE4A 4Q1FA 3WOVA 2ZIVA 4XWTA 3NKVA 3QWFA 1PX0A 6PFKA 4XYLA 2HF9A 2FPGB 3RR2A 4CPDA 4DHEA 2J3EA 1NWHA 4J2OA 2F9FA 4BDPA 2OEPA 4V0LA 3HM9A 3E70C 1R10A 1VYVA 4HDRB 4ESEA 2X5KO 1K08A 1RCUA 8ICOA 2DQKA 4C4ZA 5JMWA 4KPEC 3PFWO 2FG6C 3Q41A 4P7FA 2HSZA 1E5XA 1SCDA 1XD2A 3B2EA 3GEBA 4NBWA 1B3RA 4Q21A 4B8YA 4KLFA 8ICQA 1YRYE 2BTOA 4MUBA 3RVMA 4I7EA 2WVAA 5EFOA 5GP1A 4ZIRB 1UHUA 3PS9A 3DC7A 4XD7A 4BX2A 4Z1OA 3PFBA 4MVJF 4BU1A 1E6CA 2PUBA 3LUBA 2B34A 1JMSA 3CR7A 3LT2A 4R0MA 4YV2A 1XTZA 2IGTA 4RTLA 4GH5A 1I1QB 1TK9A 4J9NA 1U5BB 4BMVA 2QARA 5IBCA 1ECPA 3BD7A 3LUKA 4P84A 4BNLA 2P4SA 2F17A 2PQ6A 3OZFA 2VDQB 5GGXA 1I5OA 2VWPA 3WJ7A 4DLZA 4ZI7F 3U7QA 2MOKA 1N6LA 1RLJA 2ZBPA 4I1UA 1XZBA 1SNYA 1JFSA 3HSSA 2Z4SA 2X1MA 2XBLA 5IT9A 2I7XA 3QVJA 3A70A 3ZLBA 4QQRA 3BXOA 3SZLA 1A77A 1RBMA 2ZS7A 3BORA 3E22A 3FN4A 2ZXUA 4H1UA 4TS9A 2WG0A 2VZ8A 1X80B 2J0VA 1SKYE 3P9SA 3ZLTA 5B2FA 2XTZA 1L7QA 1PHPA 2YFHA 3DTVA 4JT2A 3IAM6 1KQ3A 3DJYA 4TLDA 4ER5A 1NJ1A 3L18A 3F3MA 1J7KA 8ICHA 2E5SA 3KB2A 5DK6A 4HS9A 5EJ5A 1PEYA 1T0BA 4PZCA 1QKKA 2AEEA 2GD6A 3N0WA 1KOFA 4L15A 2IPXA 4X24A 3EFEA 3ZWNA 3BG5A 2IS2A 1DXHA 2YR0A 3TLKA 3A6PC 1C3OA 1YWGO 3T94A 3IUMA 4ERNA 5KZMB 1DIOB 2YNMA 4PZPA 1M3SA 2VIIA 2Q5LA 3F5AA 1GL6A 1MB9A 4QGBA 4QXPA 3NRBA 3TD9A 3U7RA 1ZQCA 2C5LA 4JGGA 3VR5H 4RD6A 2JR5A 1C1DA 4Z4EA 4O2AB 4OLHA 4M1MA 3G8DA 4I2DA 5KFYA 1L1EA 1LVGA 4RTKA 1A9RA 3LF1A 4W99A 5F77A 2ZR7A 2QR2A 4X00A 2GQ0A 5LUBA 1QH1A 2J6CA 3NIDB 3OZWA 4G97A 4F4FA 4K1LA 3IE1A 3QPBA 4ZARA 2KD1A 2XWBF 1CRQA 4EVIA 1L5FA 2VEOA 1U4BA 2GI4A 2VJBA 3ZWWA 4HN2A 3PUWA 3HDTA 4QPNA 5LM3A 6AT1A 3K9CA 2QQEA 4IQFA 5KINB 4JJKA 2APJA 5IU6A 5EJ9A 1VIAA 2V7VA 3DMDA 1FFXB 3FGOA 4X45A 1LB1B 3U4IA 2NO5A 2VLBA 2K8BB 2WYUA 1QMPA 2SBTA 3DE5X 4LMRA 2XYPA 1PK9A 1DO2A 3R6WA 1ICEA 2X7JA 4F8RA 2IUSA 2Y1EA 1PBNA 3DZJA 3TADA 2J5KA 3E1GA 1PK3A 4LGVA 4WT7A 1ZH8A 1YI1A 3IOEA 1FL9A 4RJTA 1FYWA 4TV9A 2JGJA 1NJXA 3DBOB 3B3AA 3EAGA 3HKCB 1NXXA 1Z28A 4FCVA 3RU2A 5KJ1A 3E22B 5H16A 3Q3GE 2IBMA 3CJQA 4PPNA 1EZ4A 4ZO4A 2V8OA 3G0GA 3VR6A 1RPAA 1SD1A 2OFWA 4GZMA 3KZMA 4ZV7A 1D6NA 3WBBA 5CXUA 3F7OA 2JAQA 4LJXA 3F90A 3HZRA 4ANFA 1X77A 5LNK6 3EY4A 3IBTA 1T2CA 1TQ2A 5AICA 2B9EA 5M5BA 1SQ6A 3IO3A 3C6ZA 3QVOA 2QD2A 3OF3A 2PJDA 2PX6A 1DQZA 4ECTA 3CIFA 2VRCD 1JEQA 5TEWA 3RVNA 2O19A 4GYJA 3MGBA 4YAGA 2NQ2C 2I91A 1E96A 4JL5A 5HP4A 1HO3A 3UCXA 3UF0A 1OFUA 4H4DA 4MUKA 4E5PA 2A9PA 4EFDA 1DEKA 1PLKA 2FW6A 2OXIA 2Q0HA 4BX0A 4RFLA 4OREX 5T4HA 2RHMA 2I3AA 3NCHA 1ML3A 1A96A 4P4UA 4BP8A 2PL3A 1X0VA 4GOND 5C5DA 1BMTA 3RT1A 1Z34A 1P3DA 2VWGA 3KPUA 1Y7IA 1GP2A 1IV8A 2O2HA 2NVOA 1E7WA 4DSOA 5JCOC 5A5VA 1XO0A 1QBGA 3HVJA 5A3VA 3FVQA 4TMKA 2OTCA 3HFRA 2BMVA 2H0QA 4QWDA 3L05A 4H35A 5KPDA 3OHSX 4D25A 2XKBA 4C01A 1HTTA 4XA5A 1W96A 3GPIA 5EIFA 4FHDA 4G41A 5GJWC 5T57A 3MLBA 1L4LA 3ZU5A 4EKNB 1QHHB 1T13A 2FLVA 2K5UA 1M8PA 1KJ8A 5CDTA 1DMRA 1C7RA 1USUA 2VQSA 3NEJA 4MA4A 3WKEA 4YRRA 2WSMA 3STTA 4QZBA 1PUIA 3PKIA 3M4NA 2Z3ZA 2GPBA 3WGJA 4HEQA 5DYNA 4AO7A 4MR9B 3K6SA 1LJLA 2VAXA 3EZYA 5JNLA 3B3QA 1SZCA 3HJEA 3HXKA 4DLEA 1FSFA 1GUFA 3CC8A 2XUKA 2WJWA 3PU6A 1Q3KA 2XCSB 1BDHA 1G60A 5I9BA 2QGZA 1W73A 8ICBA 2HPHA 3CQ9A 5ARBA 2ZRPA 1CS0B 3AL2A 3KLPX 3DV0A 2I2CA 3Q3IA 4CLRB 4XQGA 4QPZA 4JI3B 2IA5A 2JFOA 1MO5A 5DB7A 1VG0B 2P1ZA 1PG0A 3FBWA 4ISBA 4PWYA 2R4TA 3CS3A 1CDEA 4NDZA 5K3SA 4AJ1A 4UTOA 4E30A 5EE3A 1XJQA 5EE1A 4PH5A 1PT6A 2PFOA 2VYVD 1PWXA 3CZQA 2BMWA 1L3UA 3EXG2 3GT7A 3I01A 4FCWA 2H2GA 4ZOLF 5F4BA 4DWWA 5ILOA 1VPWA 1OLUA 2I6UA 3CW8X 1JHQA 4C3ZA 4TMWA 2J30A 2CV0A 3CT6A 2JG3A 4ICAA 4JJ8A 4DY4A 1RIIA 4EY4A 3HFSA 1UWLA 4TVKA 1XNRB 1W85A 3CWZA 4WIAA 2QF7A 1TCVA 2DT8A 1GLGA 2AMVA 2VTVA 4J4BA 1JIVA 2HEGA 2P1RA 4GLBA 1RJ9B 1DAFA 3T54A 2X8LA 8ICLA 4BMSA 2HBQA 5J2UB 2H1OA 4XWWA 1MMFB 5DXJA 3ZV6A 5B3JC 4B44A 2XRZA 2FR1A 5PGMA 3PW4A 2FN4A 1GRCA 1KOLA 4QT4A 2OORA 4B9MA 4FILA 1FUEA 5JSKA 3AF0A 1STOA 3O3OB 4M8IA 4KO3S 3V6KA 1RJEA 1CIJA 3AT1A 2ST1A 1GR0A 3TTSA 1GQ2A 3B85A 2KN7A 5CVDA 3SZ2A 3QSGA 4U5XA 4YDHB 1R8JA 4QZFA 2UZ3A 2DX7A 2Q0XA 3OPNA 4B43A 3HTXA 2AX3A 3TKLA 1J9ZA 5KFJA 4KMOB 3JQDA 3DDNA 4HYEA 1EE9A 4R6WA 5CR9A 1SVWA 3WMEA 1K92A 3ZIUA 4Z4FA 2WYHA 3BXZA 1TZ2A 3HA2A 3IP6A 4QUHA 4WLVA 2I2BA 3Q2IA 1TEXA 4EG4A 1QXSA 4E3WA 4EL5A 1II8B 1Y3IA 2R7AA 2V65A 3AWIA 3BWBA 3T5BA 1V4BA 4DXHA 1NIPA 3NEPX 3PGXA 2ZU6A 3D0OA 8ADHA 2EWWA 1YO6A 3DAFA 4JLMA 1B0XA 3H1EA 3NX4A 4YP9A 4G8JA 3ZVKA 4DCJA 4Q9DA 1Q3VA 4DV4B 4DADA 1U4OA 1ECFA 4IRXA 3REGA 3PUYA 3SC6A 3RRBA 3A3KA 4YD2A 2ZAOA 1JFFB 2Y3IA 5DGBA 4U7DA 1BMQA 3NUZA 3J81A 2YWEA 4Y0AA 3Q8SB 3L7BA 2CFRA 1XRMA 3MT9A 4LF5B 3NBAA 1CUGA 4PLVA 3WHIA 2D74A 4DSJA 4O4IB 4ZOCA 4E13A 3G7SA 5K3BA 3M70A 1BFDA 1BN7A 3OM1A 3DAGA 4AP5A 1WF6A 2B0JA 4TWAA 4RDHA 3DWFA 4OHPA 4LSZA 4TSFD 3UK6A 2RP5A 2W54A 2ZDQA 1W94A 2JVJA 4XYBA 1UDAA 2ENUA 4IZOA 5H59A 2W6NA 3FGNA 3MRSA 1TB4A 1XTJA 4KIFA 4HNTA 2GEDA 3AUAA 1AS2A 1I36A 4KVGA 2V1XA 2FP3A 2RARA 4CT0A 3DHNA 3GFOA 5HJ7A 4JV1A 1BW9A 4YH1A 1XZPA 4AQDA 1PR0A 1Q91A 1KQQA 1JG6A 1U7HA 2F43A 2IPLA 3DM9B 4YAEA 3DBHB 4K4GA 4EB3A 3IAUA 4WJZA 2EFYA 1KYZA 1K3TA 2H31A 2LE0A 5EPOA 1YR6A 3GRKA 5J1SB 4ND8A 2ZFUA 5SY4A 2WZBA 5L3ZA 1I7PA 1J2JA 4YV0A 4NH0A 3VPHA 3JQAD 1DBWA 1VIVA 1DX6A 4RU1A 1KDZA 3PX4A 1UM9A 4DQXA 3STVA 3MQ4A 1KFSA 2HC9A 5AI6A 1RADA 1QZZA 1U3GA 4W8HA 1CE8A 5JAOA 3GQBB 3FM9A 1QSYA 2XKJE 4W4TA 4B73A 3DUWA 3MFHA 3E05A 1MIHA 4CMCA 4EF4A 1ZYUA 4KREA 4HMPA 1XC9A 3FPHA 3SS8A 5HIJA 5LN1A 3SXJA 2AV6A 3FYHA 2H5XA 4Y1FA 3RK1A 1ZJNA 9ICNA 1O9BA 1ISSA 1FTNA 2HPAA 3TSAA 3HVIA 3PO5A 4YI3A 2W9AA 2BR3A 2ZWMA 4TWBA 1W25A 1XVUA 2ODEA 1VBNA 2JEOA 2PS9A 2ZT5A 2XYHA 3PVSA 5K3CA 1FFYA 3L7AA 3MVEA 2BQUA 3K8OE 1E60A 2VHXA 4W1RA 4L5CA 3BM5A 4UVGA 3QX8A 4OHXA 4LBZA 4LQ4A 4N5HX 4ZVRA 3S4YA 3WB9A 2YUIA 1FK8A 1GZVA 3RREA 4EUKA 3UJDA 5KWEA 5IVHA 3HJFA 2O59A 2HIGA 2JGNA 4GNRA 4II3A 2G8NA 2QP4A 3TRJA 3GFFA 1LWOA 1ZOOA 3GG9A 5TT1A 2W7OA 3OO0A 3LI2A 1GTVA 1SUSA 4RZHA 3D8HA 1R4AA 2PD6A 2ZVQX 3EGDA 3WAJA 4YXWD 4RA6B 3AU2A 2JI6A 3QF4B 5DM60 1R6TA 1LU9A 5GJCA 3PL1A 1Z2NX 1UOPA 3JD2A 1CI4A 4F93B 1ZEMA 3GNSA 1TYCA 3LDHA 5M7EA 4GYYA 1NE2A 3A9WA 1NMEA 1QIJA 4WMLA 5CT9A 4ZKEA 3DEZA 4NOJA 3CX6A 1JI3A 4QELA 1WZ2A 3U26A 1MT0A 1OROA 1TK5A 1XN4A 5DQIA 5AI5A 2AFRA 2MSNA 1HXHA 2CE7A 3C3MA 3H9GA 3MCUA 3QYAA 1FMJA 1JSZA 4KNYA 5KFHA 1M6HA 4MRPA 2FU5C 5EUBA 4GPAA 2BD0A 2I1LA 2QMZA 4LZJA 4MUMA 4PG6A 3QFSA 5IHXA 4KAXA 1THGA 1XPOA 1V6SA 2VJOA 4GYWA 1JIXA 3DHWC 5JNUA 1SOUA 4CKWA 4TVBA 1TM7E 3GVIA 4ECRA 5C4MA 4U9HS 3BEDA 1MDBA 5EAIA 1O97D 2PRZA 3CLVA 1LVUA 1JR2A 1FOEB 2B4AA 2W8BB 3EWNA 1GN8A 3OHPA 3PHCA 5TMDA 1HFEL 1NFFA 2R8RA 4RLSA 3WB0A 2DFLA 1FU4A 5LQKA 2G1UA 3CW9A 3F2CA 1J0XO 1NZFA 2DSTA 2O8VA 2VO1A 2WUVA 3LO5A 4HGNA 2ZE8A 1WABA 3LY8A 1AMOA 4FZRA 1OPXA 1E1LA 4OXIA 2WG1A 1Z2CA 3GMTA 1CUVA 4G84A 5LD2C 4MWZA 4IMPA 2XJ9A 3VR5A 1U0OC 3WHLA 1Y37A 3UC9A 2X0KA 1Z38A 5K8JB 5EPEA 4NESA 1J49A 1MN8A 2G06A 4NYIQ 1H2YA 2COKA 1F9AA 2RJNA 1Q44A 3QPAA 4NARA 4ZGBA 1KOJA 3QEAZ 1VE9A 2OG2A 1TF2A 1DAPA 3ELBA 3TW4A 1RFGE 2HJSA 3C1YA 4RTQA 2Y2VA 2HF7A 9ICWA 2HRBA 3R23A 4RPZA 2F3SA 5FPYA 4CDMA 4CL8A 3WKDA 2G0TA 4C07A 3O38A 4HHEA 3RW9A 1OOEA 4YMNA 3EZ5A 1FSGA 1P4RA 2EG5A 3RSGA 3W5IA 4EYOA 4RTNA 2ILTA 2FUG1 2XTNA 3QEBZ 1B6GA 2OGTA 3A6JA 4D9BA 5FX2A 2OD2A 4JR2A 2OZLA 3U3XA 2FSFA 2QL6A 1QFXA 1U28A 4CI0B 1NVDA 1FXWA 1A9OA 1BE1A 4GU5A 1O94A 1SKQA 1OLSB 2I3DA 2P7IA 3CCCA 3I9JA 1MQAA 1QG6A 4K88A 4L73A 4CCSA 3B3FA 4JVSB 1NI4B 1WCXA 1C20A 4FBUA 4KFRA 3LZ6A 3KJZA 4Q19A 2XQVA 2V7TA 3FFAA 1JA0A 4RVHA 4XWOA 3BGSA 5HHTA 1DQNA 1SEVA 2ZRGA 4Z1MA 2NTEA 4BO1A 4GEGA 1K7CA 3IRVA 3VHLB 1TLLA 3OX3A 4CODB 1E92A 4ZI3A 1K5GA 3S8YA 4PAWA 2AK3A 2ZIXB 4QOSA 3RVKA 1LZKA 1KMNA 3PPWA 3CRQA 4U2GA 4XGKA 5CD9A 3AR9A 5BNWA 4IH9A 4OHWA 5HZMA 1LNZA 2HGZA 1FW6A 3GZNB 1JQ5A 1Q0ZA 3OJ0A 3DNMA 2OZEA 4EUSA 3OIUA 1TCBA 1UR5A 2P5UA 3VUFA 4ARZB 5ISMA 3KOMA 1PVOA 4BB0A 4RA9B 5JCXA 4K03A 3GLUA 5I4KA 3GEMA 3QIVA 3A0BU 2H85A 2QXYA 3QOFA 2OPHA 1EP2B 2HD4A 4KL8S 2FGJA 2D6FA 4EJMA 3COWA 5KQMA 1NW6A 3DT6A 1BEEA 1Z4PX 1OZHA 1GILA 3AEXA 2H4HA 3I2JA 4U2EA 4YGYA 2ID4A 5EUQB 1ZISA 3WJ2A 5BNTA 4G5QA 4UM9B 1ISPA 2ZATA 2XMCA 4Y2XA 2HHVA 2C2RA 2MR5A 1G1AA 3HDHA 1JSRA 3OFND 3W78A 1Z0JA 4EMSA 1RAAA 3AF5A 1W0CA 1ZETA 1JNXX 3IHLA 3UT6A 2CNKA 3EVNA 4B47A 2QGNA 1W4LA 3Q72A 4URFA 1BDBA 5IPFA 3H40A 2HI0A 2AGOA 1LCIA 4RUCA 1N6HA 2PSSA 3FH0A 3D4PA 5GPBA 2W2QA 1N6IA 3QV2A 8ICXA 4TTQA 3V72A 4BEWA 3HKEA 1VKHA 3OQHA 3PE4A 5FUBA 4AY6A 3PFNA 1VYHA 1UQRA 3BWMA 2GFQA 1VSVA 2VTKA 3KB6A 1TYEB 2JLXA 3H2GA 2JLAA 1I2CA 2QSZA 1GWNA 1NKVA 3MUEA 4FOSA 3O74A 2ISCA 2QYTA 5K1ZA 1AKUA 2EZYA 1IN5A 4EY6A 3IEPA 2X2EA 3IIKA 3FB4A 3OCVA 1VDMA 2ODBA 1XCGB 3KCQA 4PN3A 1SC1A 3NAGA 5TQJA 2DKFA 1DCMA 3AJDA 3BHMA 3QELB 5I7FA 3ITNA 4N49A 4KLSA 4RQ4A 4RKRA 4AZ3A 5AVSA 1OC4A 5AW4A 1LKYB 4OCZA 2ZJ0A 1XZAA 5JDIC 3A4VA 1EJ6A 3KBBA 4B3BA 1C7YA 2CBZA 3AP1A 3BBPA 2XCIA 4AX4A 3SYZA 3OQJA 5LMUB 2XI4A 3RC8A 4F4WA 2QRZA 3RYFB 1V71A 3W3AH 4INPA 2GXQA 2WIAA 1L7OA 3ZU2A 5KYWB 2GK6A 3OTOB 2LHTA 1TVAA 1B22A 1EYZA 3GFRA 3PENA 4G0YA 5KFMA 1KAHA 1W2WB 2QK4A 3L7NA 5H81A 5BOVA 5K01A 4Y2YA 2IHTA 4HWRA 2DKNA 1LLDA 2JCYA 3QOYA 1KL7A 4S05A 3U5ZB 4L4YA 4UM7A 2QX9A 4PLFA 4JC4A 1CUFA 3J81j 1Z4KA 4JGBA 3TVDA 3UAGA 3NONA 2DCMA 1UP6A 4MV3A 1P81A 1E4OA 2IPMA 2AVDA 2PSHA 1JR6A 4PM4A 1YH3A 1WB6A 3ZZ0A 1XN1A 2ZROA 1DWOA 3L0PA 2CGEA 4TV8B 1IJBA 4PSAA 4W6ZA 2VP2A 1MPXA 5G0UA 3U0VA 4YRLA 2V58A 4LYDA 3A2MA 4QXMA 4ZVPA 1C14A 3IBSA 4IHJA 2R25B 4CLEA 4A8EA 1D0VA 1AQUA 2GHIA 2G9RA 4BAZA 2ZJFA 4M0FA 4GMDA 1XAHA 1I7QB 4B6OA 3PR4A 4ZVVA 1Y89A 2MSLA 2PTHA 5U1PA 4FU0A 2GEUA 2H16A 2FWIA 10MHA 3KZVA 4LG1A 4RHCA 4N8DA 2OYRA 3T7SA 4K6CA 5JEEA 3H5LA 4J1QA 5KWIA 1TF5A 2B0CA 4AZ3B 4BQIA 2Q8QA 4O2BB 5J2GA 2V55B 4XUEA 1J0DA 2V0CA 1LY1A 4DLVA 2D1RA 1K4KA 2XMBA 3CEJA 1VECA 3Q9SA 1RYBA 4K8OA 3WXBA 4A8PA 4F11A 1ZQWA 1SU6A 4J4TA 3ZWQA 4IFBA 1ZC3A 1YS6A 3QM1A 4ZXPA 3PLNA 3MWJA 5LMCA 2GM4A 4LRSB 3N8DA 3R5TA 4WK6A 1PYOA 4FNGA 4XCVA 1FDSA 3CF0A 4MWOA 1F0KA 3NWOA 2ZOSA 3OT1A 2O4UX 4YCLA 3FBGA 4V0SA 3GEDA 3R0VA 3EGWA 4LWQA 2ZI4A 4PSKA 5IABA 3WL3A 3L4BA 1PL8A 1NT2A 2P5YA 1V9LA 1QH8A 2BMDA 2ONYA 2PWAA 1VLMA 2BN4A 3K1AA 3PNMA 1SA0B 3AMZA 1KRPA 2RGXA 4MROA 2D2EA 4LV8B 2KB0A 4ND5A 3U09A 2PXXA 4DDKA 1GPLA 3AUFA 4GOJA 1JTVA 3BH6A 3M6VA 2GJSA 2VP3A 2HW3A 2HGSA 3U9SA 4B2IA 1RC8A 4LXXA 3ENQA 1UBMS 4DSZA 2NGRA 1W8DA 3TOZA 2OXCA 3DTVD 4NC9A 1PZEA 1QP4A 3WRWA 2O3SA 5HF5A 1B8VA 4ZJZA 5HGXA 4FUQA 4OMUA 4X63A 5LLTA 1DQRA 3E5MA 4PYJA 1PJSA 3IG8A 4B8WA 2ARKA 4UB3A 2XTAA 2CB0A 4M7WA 1W36D 1KLNA 4W5QA 2W6ZA 3HVRA 4H3VA 1QOQB 1MX1A 3ESQA 4C6TB 2K4MA 1FA9A 1KQFA 3FKJA 1A5ZA 3LOQA 5HHHA 1MOQA 1OFIA 1Z5UA 3O1HB 4JK3A 3VFDA 4DR1B 4FX2A 5EWJA 1Z0FA 3CRRA 4PAMA 5DMHA 1IWPB 4LGYA 3TQHA 5ELXA 3TQ1A 1FFVA 3ABOB 3D7KA 4WHMA 1ZL0A 2NTNA 2YINC 3OZIA 1ZI6A 5F3XB 1E0JA 3P1JA 2FMTA 3IC5A 2DH6A 1H3NA 3IURA 4U5QA 2PPVA 5KNCD 5JO9A 5BOLA 2BFCA 4FGLA 5FUYA 4CKEB 4URXR 2GWHA 4J9LA 3TCKA 4FCTA 2R2AA 1QX4A 1I7DA 4OX9B 2WD9A 4NSNA 1I3NA 3MABA 1OHHD 1VHJA 4Q43A 3WK8A 1JAXA 2HLNA 5ELLA 3MRVA 5G3ZA 1L5HA 4AX8A 4UBKA 1P2SA 1UFQA 2OILA 1KN5A 1R00A 5DGAA 2A6PA 4RNNA 2GPWA 3EXG1 3PUIA 3MWDA 4LC9A 1UBRS 1W76A 2CLMB 5SICE 4D81A 3QNMA 1GKUB 2ZETA 3RVRA 1XCMA 1FNNA 1J2MA 4F92B 1GV0A 3QPWA 4GOMD 3GU3A 1DV1A 2QP9X 5JRDS 1DPGA 2PD3A 1JA1A 1UJMA 1CSEE 2R6CA 1ZQSA 2RGEA 4AP9A 2R1ZA 1DAIA 2D13A 2Z4TA 2J3DA 3N2KA 4R0NA 1D5CA 4Y0NA 1LC0A 4FNOA 2TMDA 1J25A 4O2LA 4RHYA 5CFPA 1LZLA 4ESVA 1X70A 3MLEA 1ECBA 2I6QA 3DBLB 5F76A 2RGBA 1U8TA 3JQ8B 2VNHA 1PR6A 5KHLB 4M1QA 3NRCA 3M34A 4C3VA 1Y1TA 2ADMA 2BFBA 3MMXA 4H1TA 1K6JA 3AI2A 4B87A 1HA3A 3C5FA 2J9FA 2FSSA 1QPBA 1JS1X 1H6DA 1TKBA 4AT1A 2CV1A 4M1EA 4XUCA 2JJ8A 4OI1A 1GL9B 1U0TA 7ICRA 3AEZA 3G2OA 5EWJB 5JH7B 3GJ6A 1ORVA 1PZHA 1VRCA 1HYEA 2GT1A 1P39A 4M8NE 4ZVUA 3DYVA 4DL4A 4DIBA 4RY9A 3MGIA 1J6UA 1J1ZA 1XRLA 4AZSA 2C4HA 1L8LA 3I53A 3LVFO 1W9HA 4CKXA 2E85A 4YRPA 5C34B 3AK4A 1CQIA 1UBCA 3IUQA 3LHIA 4KODA 3U80A 4AJOA 2OHXA 2QZPA 3K1AB 1KO1A 5GM1A 3NNNA 5LP6C 2HRDA 3L7KA 2B20A 3HUEA 5BY2A 5CA1B 1L1RA 3ZU3A 9ICOA 2OSVA 2XIDA 3FTQA 4ZV4A 2JFPA 4ZICA 4EKEA 2E18A 3A0HU 5L1IA 1L6RA 4Y7CA 1Q8KA 1BHSA 4Q16A 4BC0A 3GNTA 2BPOA 1K2VN 2OGSA 1J39A 3ILSA 1NI3A 3JQGB 3L93A 3JQBA 2JDIA 3K5WA 3NOVA 2MYNA 5JQGF 3RJMA 3GBSA 3L5OA 4QWMA 1CHDA 5JFOA 1I0LA 1WWUA 1MX3A 3T9BA 3B20A 4HXFB 2QMHA 3RUDA 1A5SB 4L51A 1CP2A 5F1PA 4TUPA 1EG7A 3QFRA 3RSCA 4CIDA 2J67A 1XXHE 3AIMA 5JSUA 2NOAA 4ZP1A 3AJ9A 5E0OA 4CM4A 1OWPA 3KSUA 1O0CA 5JJBA 2XPCA 4H7PA 4ZK6A 2WLSA 3FMGA 2V4RA 3NHUA 4ZAZA 5K2OA 4BFUA 4U7GA 2FSVC 1C9KA 4IQGA 5LQNA 3AVXA 2A5GA 3Q4GA 4H1WA 4DV0B 1M8FA 1DKOA 2YCLA 3H8VA 2YMPA 3JPWA 4NYMR 4MFFA 5AJUA 3S99A 4NQZA 1HURA 4QLOA 1ACLA 4GMXA 3K53A 1P1IA 2AZMA 3UQ2A 2IIVA 3H4DA 4DEYA 5H7XA 3VVBA 1OFHA 4CMJA 3GPCA 1MGPA 5CBPB 3K20A 4YPOA 1NLYA 2Z6AA 1Q1AA 1BA2A 4UPEA 4YHHB 2O06A 3ENWA 3HJUA 2ZI5A 3PK0A 4J0KA 1V5WA 4Q1AA 4TT3A 4CTJA 3C1TA 1SHLA 1DBQA 3W6NA 3S2FA 2P9ZA 3T3DA 4CM9A 3NUQA 2QTZA 2J6UA 2X9QA 4M9QA 2FZEA 5FULA 3U17A 4Z86A 2A7XA 2B35A 4HZIA 3R7BA 5KT4A 2J9RA 3V4VB 5E4TA 4P80A 2L0XA 2ZPAA 2FW0A 1TM1E 3GDOA 2MINA 1O96B 3ZDQA 2LPEA 3IOBA 4JOBA 4NBTA 5CGZA 4R66A 1U3TA 4P3XA 2WM3A 1WSBA 4F4UA 4FS1A 2QTAA 2V7QA 5FT9A 1WZIA 2LZ0A 5CK4A 3IBFA 5EKUA 1XTKA 4FI3C 2LMRA 3SF8B 4GDFA 1G5FA 4BNFA 3L9XA 2PUHA 3ROEA 4GZ6A 3BD8A 4X60A 3D7LA 4KLDA 3V1NA 5LJIA 3X3HA 1UQUA 5LJLA 3IUPA 1XQYA 4YQWA 1VI6A 3LC7O 3P0JA 3ZX5A 5BQPA 2P69A 1MVNA 3RB3A 2TMYA 4DMMA 3AVWA 4BBZA 3GJ7A 421PA 3KKPA 1OGIA 4WXRA 1FB5A 3VAZA 1TAQA 4JI4B 2IHKA 4MRMA 5GJVC 3LZCA 1MAAA 1IM4A 4RQNA 1CUJA 1G8KA 3K4GA 2H29A 4WKGA 5JWHA 1IZ7A 3VKVA 5FOUA 4CCYB 5LR6A 1S6YA 4C04A 2AHOA 4FZ3A 2R6R1 2EZXA 2E9SA 2EEZA 2I65A 2NZYA 4J16A 2B6NA 3ZKWB 2ZM5A 2UYYA 4X8LA 4BZZA 4D5EA 4AZTA 3L3FX 4KQ2A 4WFJA 2PV7A 3HS3A 5CX1A 2AZDA 5AW9A 4WESB 1H42A 1PQUA 3AJEA 2KV2A 3C39A 2X9GA 5DGTA 2O8CB 4L3OA 1GKIA 2NV2B 4XX0B 2OXFA 5CVTA 2X1HA 1DHRA 2QMQA 1KQGA 4FDUA 2UZAA 3N2ZB 4C7JA 4BWVA 4P7JA 5E9AA 3VNUA 1GGEA 2QY9A 3KXPA 4KWCA 2OE2A 2AL7A 3A04A 1YZQA 3BTOA 4ZREA 1V11A 4FFPA 3KZ1E 2X9NA 5JFGA 2ZT7A 1B0ZA 1KO7A 1NATA 1WCYA 3PNOA 4MUGA 4PNHA 4YALA 5LWQA 1NURA 3N87A 4GLJA 1IAVA 2AQIA 4GXQA 4MQFA 4UQPA 5KKCA 1XDZA 2OCAA 4DR2B 1J0BA 2LP4Y 4N47A 4YCCA 3T1HB 1L9KA 2Q5EA 4FZJA 2YN4A 3IE0A 7ICGA 4Q02A 3WGQA 2K89A 4ZJUA 2F7SA 3JPTA 2Z2ZA 4U00A 4C8NA 2C2GA 3H1TA 2BR4A 3BXHA 2JHDA 1YZUA 3GBVA 1PYGA 2WUFA 2XB6A 1K63A 1S2MA 3BS5A 1Z68A 2YV4A 4FMCB 3R3HA 2V03A 3E15A 1DKPA 3AJAA 4KNWA 5AVTA 5M04A 2PGIA 5HCNA 3EULA 2JH1A 2QSJA 2UVUA 5DNAA 5IM4A 5JARA 3EFHA 3AM4A 2Q1SA 1VL8A 5BR4A 3ECSA 1F5SA 1DOQA 1M5TA 1IIBA 1L7XA 1R8XA 3QYJA 3IMGA 1Y8AA 4XIFA 3VR5D 1SD5A 4A6DA 4B4WA 4CFZA 4XAQA 5KYVA 5IKMA 5KC9A 4IIYA 2RRDA 1SOVA 3QBEA 9ICRA 1Z7BA 2IU4A 2GMWA 4N54A 2XXAA 2O8DB 3L8GA 4LHVA 3ER6A 2BCRA 1UJ4A 4E0DA 3RVPA 3PQFA 4MEYA 4PQGA 3W6OA 1OXUA 4Z3KA 4B6PA 4MO2A 2W2OA 4YY3B 2FPXA 3MERA 3OECA 4YV7A 1A9ZA 4CQLB 1SXJE 2XDWA 1ZM2A 3KFXA 4QJFB 1EU1A 2F77X 4BTLA 2CJWB 4UMFA 3TQRA 5F2OA 1U49A 4IDCA 1Q46A 2JV3A 1DAGA 1Y5MA 4RQUA 4JNKA 1WNTA 2OVFA 4ONEA 3EVAA 3C3EA 2RHHA 1N5LA 2PR7A 1AURA 5IVIA 2XIJA 2BEWB 2QV7A 3CY6A 5FNZA 1N6KA 1IC6A 3GJZA 4WAUA 4DCCA 1WMBA 4QKQA 1KORA 2K87A 4NCHA 1KW4A 2PLNA 3KEQA 2PM8A 5KTRA 1ZDMA 5F1OA 2YY6A 1COWD 2IW1A 2V6JA 3I9MA 3HWRA 2X19A 3ICPA 2BGIA 5EC8A 4O59O 4C80A 2P3OA 9ICSA 1FS5A 1GDHA 1YR2A 2IXTA 3BWCA 4HX5A 1DTEA 4I2GA 2GLTA 2AI2A 2MSCB 1GPUA 3OM8A 4IMRA 4MS4A 4W1QA 4LVUA 3TMAA 2LYBA 2DAPA 3B13B 1QV6A 1G6OA 5TV2A 1DC7A 1L4MA 4A9AA 1OGYA 2FZCA 1CW2B 3MFQA 4HG2A 1KC1A 2H7XA 4D82A 1A5TA 2W8BA 3UIEA 4ISCA 5AP9A 2WIDA 3CH4B 3K4QA 4CETA 2OO3A 2B6GA 1UKAA 3AUJB 2LYAA 1QYIA 1S77D 4L8WB 3O4VA 2MA1A 1JILA 4NE2A 3RVSA 1ZYQA 4ITUA 4QPJC 3NWBA 4CKWB 3WLFA 4XQCA 4XASA 3MBYA 1V3VA 1Q3UA 1V8OA 2O23A 5ARCA 4YUXA 2HYDA 4BIMA 5DLFA 1RHRA 5I5GA 4M7RA 3L6EA 4DSFA 1KY4A 2EERA 5F1YA 4BUJA 3HFJA 5JIBA 1Z8NA 4IRCA 3GLKA 2P6UA 4UPDA 1WULS 3K2BA 3HHEA 1QX3A 2HWKA 1X7WA 5EKXA 4JJIA 1NVXQ 1SAYA 4KVFA 4Y2JA 4P0PA 4YJGB 4GOKA 1A1SA 1RKXA 2VH5R 4FW9A 1UAGA 4NYJR 1M10A 3OJFA 4PNZA 4N0MA 3ZDXB 1F0MA 2C5FA 5B64A 3HKDA 2GSWA 2XZLA 2W48A 3OZDA 1ZG3A 4RADA 3ONDA 4AO8A 1JHMA 1P3Y1 2Q27A 3E2IA 5ICMA 4LV6A 3KETA 2AFIB 2HO4A 2OECA 3K0AB 2CW5A 2HY7A 1MDFA 2V5UA 2WD7A 2XVAA 4TXLA 2ACKA 5J2EA 2E4VA 2VWQA 3CZ5A 1P1JA 3F2IA 3I2GA 3KIPA 3O3NB 4QUJA 4HB3A 5LQCA 3KPJA 3UMMA 3ND8A 4P83A 2DFVA 4IQVA 3AHGA 3L4SO 4PCLA 4QULA 3RRJA 4G07A 4ZWNA 3L8YA 5IP5A 1WTAA 2IUYA 1E2HA 4IIEA 2E8PA 2Q4TA 3EF0A 1KF0A 3GJ5A 4W9NC 4KX5A 4TN5A 4ZCLA 3UKJA 4BCCA 4DIEA 3LQRA 1B42A 1OPRA 3LX5A 4DQ0A 3BRWA 4LOKA 3PLRA 4JLNA 2CXUA 3PC6A 2VQ6A 4EGFA 2XVMA 3HP7A 4WDQA 5JROA 5LYJB 2GXAA 3PA6A 1SUFA 4IQ0A 3B1YA 3M9OB 3BMCA 5EJFA 2R8HA 2BKUA 3G5LA 5E6RA 3H4IA 2Q1UA 1LLUA 5JANA 1Y7LA 3CG4A 4OHBA 3VC2A 2V5AA 3PMLA 3RAEC 3IPYA 3EHDA 2ZANA 2A35A 3QYPA 2BPGA 1EX6A 2C4NA 2YBDA 2WB1C 3DE0X 4YJ2F 3HPOA 4TURA 1GAWA 2J6IA 1ZK4A 1FDTA 1A6SA 5E7MA 2J3MA 4TSKA 4CDRA 5FLXA 3OCXA 4ECUA 3N58A 4OMCA 3AFIA 3INTA 5BYJA 4JYCA 2C04A 4NPCA 4U2BA 5D01A 3U13A 1BE8A 4PG5A 5IJWA 3OUZA 1KJNA 2YWFA 1XSNA 3EGCA 3FCEA 1KBZA 4OQQA 4EB6B 5IRCD 2PIAA 1ML4A 1HL7A 3OOWA 3UO8B 1VRWA 3AGQA 3LBFA 1T5OA 4LC1A 4MYRA 5AK5A 5CNMA 1QGUA 3BIOA 4CEIA 2ZR0A 3SQWA 4B2YA 5CJ7A 1XZCA 5L1MA 2OCPA 4N6OA 5TF0A 1VMIA 2V6GA 1IBSA 2ZJ4A 4I2NA 4L8LA 4Q9HA 3TQOA 3STHA 4KPYA 1A9YA 2QZ4A 4ALLA 3UBMA 1XEWY 4TRRA 3WDLA 2HBKA 5IM4F 4RQ0A 4TRJA 4ZOLA 3W8DA 4ZODA 2DPIA 4DRZA 2VF8A 3U4MA 3SFTA 1G20B 3PWKA 3FETA 2XUZA 4FO6A 1YC2A 1VPLA 3BZCA 4IW3B 3VO9A 4YP1A 4DG9A 1O58A 5ALGA 4MI3A 1MOSA 5LZ5A 1TXGA 3EQ7A 4G0UA 3C14C 3OLXA 3PNCA 2UYGA 3GGCA 3LYAA 4J43A 4RELA 3ID6C 3OJCA 4MR7B 4UBLA 3ZCVA 1SV4A 4AKTA 4AROA 4E51A 3BMCB 2G0NA 4F5OA 1K5DA 3O26A 5E7IA 5CNKA 5COQA 2C98A 2WUGA 3OCJA 3V2IA 3KAJA 4TRMA 4DKJA 4KIWA 2G0AA 1I3OA 2FW8A 1J20A 2GAFA 5B5SA 3RH5A 2R1TB 2JFYA 3DD5A 5DB4A 1G5HA 2QD4A 4J94A 5KT5A 4KQIA 3SC3A 5JJLA 4NLNA 1CY0A 1DDIA 1JSCA 4P4LA 4CXMA 4K0RA 5DPMA 4PYQA 2A1JA 3G1TA 2CHGA 3RRNA 2FLKA 3BFKA 5HFAA 1TO1E 4ALNA 1P7ZA 3A1EA 3UCFA 3NRZA 4UB5A 3FSGA 5H2FU 2KLBA 2WILA 3GJYA 3OJWA 4L16A 3RHZA 1JG2A 5MN5A 1UKCA 5JQWA 4YT8A 3LIPA 4CF7A 4R8RA 4R1LA 1OH7A 1E58A 1XMOB 3UXYA 4B5LA 2PZEA 3L4KA 5DDMA 1RHJA 4EPVA 2IFTA 1K8YB 3P9PA 5TGDA 4TS3A 2ECQA 4M0LA 4WKPA 3WP1B 5TJ9A 1OAOA 2BFCB 3H5WA 4O2BF 2ZRLA 3MRTA 1T4CB 1XG5A 2AQ4A 2RKBA 2IYZA 2VYVA 3B2NA 2QZJA 4EZ6A 5JJ5A 4DFDA 5H82A 5JNSA 3EASA 4H08A 3QIAA 4KFTA 1XCLA 3IUSA 2JEZA 4M8SA 4P7BA 4C21A 3KZNA 5JNWA 3JQFA 5DCUA 1XV5A 4FR5A 5BQ3A 2PFQA 2Q3DA 4IV8A 3OQBA 4HRAA 2IIQA 2P68A 2GZ1A 3NTOA 4HQLA 2GEJA 4PLHA 5D7BA 2GOYA 5IVPA 2BP7B 2P9TA 2QLTA 3WI7A 4AF8A 4ND3A 5AVYA 2Q1TA 1RXYA 3F3KA 2YJ3A 1ZS9A 2BJWA 2OH2A 4N3GA 4TUYB 1PFVA 4G09A 1J0EA 2W22A 2O57A 2XY5A 2IPOA 3P9YA 4EY7A 3VGJA 1LLFA 2UZIR 4Z0NA 4ESHA 4KWTA 3ZD8A 4HGRA 4UOZA 3P2MA 3JWPA 2ISPA 1JE1A 3O4HA 3GNQA 2OBLA 3SZMA 3F6SA 3C41J 3L49A 2QU8A 1TEZA 3K5PA 4X95A 1CJCA 2IS1A 4EEYA 3I6BA 2YDXA 3T12A 1GGNA 1QYWA 1NPTO 4EL0A 5AKYA 1EUZA 5J2IA 1MPTA 1S01A 2FAXA 2TSYB 3GI1A 4LOAA 2I2DA 2VRCA 3HBFA 4RVUA 4B31A 4KTTE 4QYSA 4JODA 1N0UA 1PAUA 3CWCA 1PNTA 4Y6OA 2OV1A 2ONJA 3AUOA 1NK8A 4K4IA 4IGFA 5H83A 5HRAA 4PAOA 1P60A 2HOFA 3I1IA 4MEAA 4IDNA 5SV2A 1TT5B 3QBTA 3RASA 3SYNA 5EJ4A 5TY0A 2AIRA 2WHRA 3I1JA 2AG1A 4OJOA 1F8UA 1US8B 1ILEA 3LTNC 4A8JA 4OB8A 1HTBA 2AF4C 4NI5A 5BYKA 4AMVA 5LDHA 2WVJA 3NHFA 4ZALA 3R9XB 5JH7F 2QUIA 2DCUA 2QR5A 4JXJA 3OJSA 2G7ZA 2XECA 1GSHA 4EMTA 4JN6B 5JPIA 1QR6A 4M98A 3SBOA 1T5TA 3KC2A 1JDJA 2POCA 1QORA 2O52A 3ZBQA