2K8AA

Solution structure of a novel ubiquitin-binding domain from human plaa (pfuc, gly76-pro77 trans isomer)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phospholipase A-2-activating protein
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8aA00
3PSTA 2K8AA 3PSPA 2K89A 2K8BB 2K8CB 3L3FX
chains in the Genus database with same CATH superfamily
2C2DA 2E8MA 1O03A 2HMXA 8ICHA 7ICLA 2IOHA 4QWDA 4C4RA 3V6KA 2C2EA 5KFCA 5ALZA 2OCEA 5TISU 2BDPA 4C8LA 4M9LA 5ALLA 4ECXA 2QARA 5F9LA 1S9FA 3HILA 3PY8A 4QNLA 3PMLA 1NOMA 2F1IA 2W9BA 3EYZA 1FEZA 3D2NA 3UMGA 3C1YA 4KLJA 4F8RA 2MA1A 2XCAA 3RTVA 1IM4A 1KEJA 4RQ2A 1CEZA 3MR5A 3KFUF 3M9NB 4UB5A 4FS1A 4QIWF 2KZZA 2KKVA 2BR0A 1U4BA 4J9OA 2CN1A 4C8NA 4O3NA 4E0DA 2KTQA 4OJPA 3WK5A 5KFSA 4LJXA 4IRCA 9ICUA 2KK0A 2A1JB 1T4GA 3Q8RB 2B6GA 2BPFA 3C5FA 2K8CB 2AJQA 4F4ZA 2ES6A 3GV8B 3V7KA 3V7JA 1ECWA 5IIOA 1BVSA 2Z7JA 2DKXA 2XY5A 2FDRA 1NK7A 4CF5A 4QWAA 2HSZA 5AKIA 3PW4A 2W7PA 1T8EA 3GZFA 3CRXA 1T7PA 8ICJA 4KLSA 2MU2A 5ALTA 2F1JA 4J9MA 2J6SA 4I2CA 4ED1A 1WCNA 4QZBA 2ZJAA 4KN7A 4UB6U 3ED5A 3LDAA 4DQSA 2JEJA 4CF4A 4P2HA 4IC9A 5DLGA 4Y2VA 4P4PA 2K4EA 4ECTA 3H8SA 5J8YA 4DSLA 9ICSA 4DLGA 5J2CA 4FFDA 8ICWA 3Q8QB 3H7IA 5J2BA 1X2IA 2R8GA 2ZUBA 3IDWA 4J9KA 1HUOA 3NUQA 1RXVA 2I5HA 3IG8A 5KFGA 3PVXA 1NK8A 3JPTA 2F44A 4ECSA 2EAPA 3BZCA 3L5KA 2AQ4A 5HHIA 7ICTA 2ZTEA 2HHTA 1ZQZA 1V9PA 2V4RA 5H2FU 1U45A 4DOCA 2DWQA 4ZH4A 3SYZA 1ZQQA 2B0CA 3DV9A 2XO7A 3T5JA 5ALKA 3QEAZ 1BPBA 2PMZC 4MFCA 5KFLA 2KG5A 4ZOHC 3QZ8A 5L9XA 2RHFA 3FM9A 4YMOA 5KFHA 1URJA 4CF3A 3NASA 4I27A 1PK3A 4NLZA 5C5JA 4UB2A 3F2CA 7ICIA 5ALVA 9ICLA 2WHEA 1ZD3A 1UPHA 1ZQYA 4EZ9A 5DDMA 3MDAA 4KN4A 4OO1J 5J0TA 3JPQA 5EWEA 2JZBB 2JZBA 5AI0A 4DCCA 5AI8A 5J0RA 2R8HA 3QU7A 2GWSA 3ISCA 3H0LB 1ZQKA 2YTUA 5KG1A 1S8OA 3TARA 3SR6A 3M7DA 1OW5A 4F91B 2G07A 5DLFA 5KFAA 4RQ8A 1DRGA 1XWLA 4I2DA 4O3MA 4YG2A 2H3QA 4PGYA 1T3NA 3J81j 3K1RB 3U26A 3N28A 1UCVA 3MDCA 1QTMA 4X5VA 1NK5A 4Z6EA 3MGIA 3AM9A 2ZJ8A 1C20A 1L7PA 4PH5A 1ZD5A 4F4YA 1J2NA 5L1MA 5D46A 4ELTA 4NJ8A 4UATA 4O5CA 1T94A 2AQ0A 2N1RA 5CHGA 1KRPA 1SZHA 2DPJA 3BQ2A 7ICPA 4DQQA 3RJFA 4O5EA 3PW7A 4C8OA 3UXNA 3NVZA 4QZGA 1BNPA 2NRVA 2UVVA 1UT8A 4QIWC 5KT6A 2LI6A 3BDPA 4UASA 1ZQUA 1DOQA 5AKXA 2LHTA 3PX6A 1OUQA 3IN5A 4DQIA 2ZIWA 1ZD2P 2K60A 4RQ5A 3MR3A 2GH1A 1NJXA 1CI4A 4DOBA 3BS5A 5AK3A 1WG8A 4R8UA 1ZQSA 1SV0C 3GV7B 1F44A 3NS1A 2BQRA 4UBCA 1PK1B 5D4BA 4U6PA 4DO9A 5F9NA 3K75D 4UB1A 3IM1A 4FZMA 2H3VA 3Q8LA 2JH1A 4FS2A 4JWNA 3TADC 3GFKB 4F93B 1RDFA 2HVHA 1ZQVA 2ZIVA 4RPYA 2BCQA 5ALYA 5BOLA 2P6RA 1NJYA 4GXJA 4DQPA 3AN1A 3KBBA 3PZPA 2I6XA 1SV4A 5TZVA 5JTIA 2XGPA 1QQ5A 2VA8A 1ZQMA 2HCFA 4R65A 2HW3A 2A1JA 5ALPA 4F4KA 3RB6A 2K4IA 4DFJA 8ICUA 3TADA 5D49A 5IILA 5AM5A 1TKDA 4J9SA 5CWRA 4J03A 4FZLA 5KG5A 1S5LU 5L1IA 5KFBA 4DL6A 2C28A 3M6ZA 5J2KA 2HHWA 8ICAA 5HR6A 3V7LA 4YD2A 4B9TA 4KTQA 4Z6FA 2QARB 4HAIA 2Y9TA 2KJ9A 1D9DA 1SIJA 3SV3A 2W9CA 2FMSA 4TQRA 5KFEA 5J2FA 4F72A 2ISPA 4GFJA 5JRTA 2MUTA 5KFFA 4DL3A 3T3FA 3UMBA 3WK7A 5DKWA 9ICIA 2EZZA 3HP6A 2JR5A 5KT4A 5DG8A 3F5EA 3N7SC 3M8SA 4CCHA 3N4MB 3ETRA 1NNLA 1S0OA 1YT3A 1Q3UA 1RYRA 4QWCA 4R66A 4F4WA 1SXDA 3TAQA 9ICQA 5KT2A 1KBUA 2AH5A 5AM4A 4KX3A 2KHQA 9ICOA 3UXOA 4F2SA 2IMWP 2ZIXA 3QU4A 5J0SA 1SL2A 4J9LA 2UVUA 3QZ7A 2ASLA 2Y0SC 3C1ZA 4FBUA 5ALOA 1VDVA 3PR5B 3UM9A 2HHXA 2AGPA 1N56A 2XY7A 4F5OA 3SI8A 5J0UA 3AUOA 2ZIWB 3G6VA 2FLPA 2JEFA 7ICGA 3M9OB 5ALMA 4F5PA 2RRDA 4BUGA 1QSYA 4DWIA 5AICA 3PX4A 4RNOA 5AM1A 3LYSA 2BKEA 4IQTA 2KP7A 5DQHA 4BDPA 3L3FX 4Q44A 4B9VA 4B9LA 1IXRA 4GXKA 3WKEA 4ECZA 4O9MA 1Q46A 4Y2RA 3QUTA 5EWGA 3RBEA 3SQIA 5L1JA 3ORYA 1WWUA 2ISOA 1Y88A 1VLBA 4RQNA 1ZJMA 4RNMA 4KLFA 3OTQA 3GQCA 1SL1A 1S77D 3ZDDA 3QE9Y 2EZXA 4PJ0U 1XNSA 3SEIA 3AMZA 4UARA 4IRDA 2E1EA 2VANA 1ZD4A 1X9WA 1ZJNA 4DSKA 2LKYA 3IG5A 7ICVA 2H3ZA 5KFMA 2E8NA 1TFRA 9ICWA 5AKZA 1WWVA 5AKYA 7ICMA 1L3VA 4Y2PA 4B9SA 2R18A 2PI4A 2ZUCA 3SAFA 3ISDA 1L3TA 1K1QA 4TURA 2QB0A 5KFZA 1HUZA 3OGUA 4DL5A 2FMPA 1KQQA 5ALGA 3T5KA 4QZCA 5J2AA 1RYUA 3MFIA 1HJPA 3BJYA 2E5SA 3NVYA 4RQ1A 2JV3A 1L3UA 4KLHA 3H4BA 3NTUA 2J6UA 1JN3A 2M9NA 4LZDA 2LBOA 3RAXA 4Q8FA 3CNHA 2GLEA 5ALFA 1N60A 2LYBA 3S6JA 7ICEA 8ICSA 3PSFA 4J9RA 2K4PA 1JROA 4GIBA 5G5HA 3HT3A 4BXOA 4QZ8A 4BJQA 3ETLA 3RH5A 1S0VA 5KFNA 4PL1A 2KKPA 2KZ3A 5ALDA 4P4MA 2CPRA 1FFVA 5B5EU 5KAIU 5KFRA 1A76A 2XVTA 3EW9A 4UB4A 1ZQAA 2F76X 4OJOA 2IA6A 2HDOA 4B9NA 4F71A 5CRXA 1JRPA 2A1AA 2ASJA 5ALUA 4NLNA 4ELVA 3QEBZ 1KFSA 3KKAA 3I76A 5JUMA 1ZQNA 2HOQA 3MABA 4IR1A 5AK4A 2DF4B 2XY6A 2XGQA 4FZNA 5L1LA 9ICEA 4F4XA 2MUTB 4CGZA 1N61A 2I1QA 2HBKA 1L8LA 3M6KA 1ZQPA 3GDXA 4ED6A 4P0QB 4M04A 2C2RA 4DF4A 4R63A 1WUDA 1QSLA 2R8KA 8ICQA 9ICCA 2BGWA 2GOLA 3H40A 2IOFK 1X6IA 2ZTDA 9ICGA 4YVZA 2OH2A 1UT5A 2W8LA 2W9CB 4ED0A 5ALXA 3QU5A 2OEHA 3JPOA 3HX0A 1N48A 2W9MA 3ZD8A 4AP9A 2YN4A 4DEZA 5AI4A 1NKCA 1LB2B 1DGSA 4OJ6A 4UBBA 4P4OA 5ALNA 3NGDA 3RR7A 2WB1F 4B6JA 3H4DA 4RQMA 3MR2A 1BGXT 2KHVA 2G0AA 4DSFA 4I29A 2WF7A 2FMQA 1ZETA 5B66U 1GO3F 4ECVA 3OSPA 3WKCA 4RT2A 4EX7A 3N97B 1ZQRA 2MSNA 3NRZA 1SKSA 2ZIUA 3KKAC 3LVVA 1N62A 4O3RA 4O3SA 5AKHA 4QZFA 3CYMA 4UAWA 4M6WA 1KKXA 5E79U 1AROP 4QZIA 2P6UA 1A0PA 3QU9A 3DDHA 3ZDCA 3A0BU 4YQWA 2K8AA 1Q3VA 2K8BB 2AXTU 1VJ5A 4PGXA 2DBYA 3RRGA 1NI3A 4DL2A 1KFDA 4OJLA 1SKWA 3UPQA 1PVPA 2H3FA 4HYKA 5KFJA 4JB3A 1H38A 1BPZA 4XRHA 2HHVA 4YD1A 4OCZA 2KFNA 9ICHA 4YR3A 1QCKA 3V72A 5KG0A 2FI1A 1SWVA 4JV2A 2LMRA 5C0YA 1JXLA 1U47A 5IINA 2KJ8A 4Y2QA 4DOAA 4RQ6A 1T3QA 5DGAA 4NL9A 4NLBA 3E2EA 4CRXA 2DL0A 1TAQA 2YQEA 2MRLA 2FLLA 2YMQA 1JIHA 2O6KA 7ICHA 5J2DA 2OYYA 3ZDAA 1TVAA 4KLQA 4KLOA 4B9MA 1V38A 3PMNA 2NRXA 1L8OA 4M9NA 4MFAA 3M1YA 1XS9D 2NRZA 3F2DA 4PZNA 2W04A 5KT3A 1XSPA 7ICUA 8ICLA 4I2EA 1L7OA 8ICRA 7ICJA 3PO5A 3D6JA 5KFDA 2EAOA 5ALIA 5DB9A 3OJUA 2E8OA 1TAUA 2ZUDA 4XQ8A 3WK8A 1ZQ1C 4QW8A 5KFYA 4TUSA 5KFWA 3C21A 3BQ0A 2AHOB 2MAXA 4MEXA 1DK3A 4M47A 4EEYA 1X9MA 2JHDA 4IQVA 1JMSA 1MQ3A 1HIWA 4NV0A 4ECWA 3PSTA 1Z1BA 1TV9A 1RPLA 4I2BA 4NL9C 5KT7A 5J0WA 4K4HA 1UQVA 2KD1A 1KSPA 1KN5A 7ICSA 4ECQA 1IG6A 8ICFA 3WK6A 4RT3A 3HJEA 2EH9A 3HW8A 2IHMA 4GXIA 3C23A 3UQ0A 4M0AA 5EE9A 3TANA 3B0YA 9ICFA 2EZYA 1N63A 8ICIA 1Z00A 2EDUA 4QJFB 3UMCA 2YY6A 5AIBA 8ICPA 2WFAA 2BCSA 2AGOA 1ZOLA 2OHFA 3ZDBA 4KLIA 5AI5A 4NLCA 3LK9A 4Y2TA 3ZD9A 4Q43A 3ZDEA 3M9MB 4MF2A 2KSOB 4TUPA 4F5NA 1D8BA 5J0OA 1BPYA 1ZQFA 2PFQA 3WKBA 2RQ5A 4KLGA 4R64A 1BPXA 5AM3A 2JRZA 1TK8A 4C8KA 2NYVA 5AKGA 4PPXA 2HHQA 3Q8MA 1TK0A 4C8MA 4EYHB 1SZPA 4KLMA 1SGGA 3F5AA 3MR6A 2R8JA 9ICBA 4ECUA 1DGJA 5KG2A 3RAQA 2YX8A 4EELA 3HWTA 3E0FA 1KFTA 2RP5A 2E8PA 4GC7A 4K4IA 2Y9UA 4IQWA 4I2HA 4ICAA 1NZBA 9ICKA 4RQ3A 3PSIA 2QB0B 2WF5A 5F3XB 3KZXA 1X9SA 3GIMA 1MC8A 5J0PA 8ICMA 4NM1A 3CW2C 5KG6A 1ZQCA 5J0XA 4DSJA 4NXZA 3RJGA 3FDSA 3OSNA 4PHPA 2PFPA 1NJZA 3KHHA 3AL0B 4RQ0A 4NY8A 2BHNA 2ZG6A 1WCLA 4ED7A 1J97A 4YFKA 3GIKA 2DFLA 1L6NA 5GTIU 3FAHA 2FJ6A 3SD7A 5BOMA 3SZ2A 5J29A 3H8MA 4LZGA 5EOZA 3EPIA 3RR8A 4DS5A 4DF8A 2F2AB 3WU2U 8ICBA 1NKBA 2UVWA 2M0NA 1ZRMA 4RNNA 3BQTA 2G08A 2OXOA 4DFDA 3RJEA 2KMDA 4F5QA 3N7RC 4BXOB 5KFOA 2IBKA 4JV0A 4DFKA 1L5UA 2IHNA 4KLTA 2HHUA 3RJKA 3QU2A 3KTQA 4QZ9A 2P35A 1S0MA 2ZJ5A 5CR0A 2D8CA 5ALQA 1NZPA 1NKEA 8ICEA 3EUB2 1RYSA 1SXEA 3AU2A 2WB1C 4CNQA 9ICTA 4BGDA 5KFTA 4IL6U 4QZEA 5DB6A 3DEEA 2W8KA 4EBDA 3TAPA 1NJWA 3ZI4A 1ZQTA 2DPIA 5ALEA 4KMUA 4C7YA 5KL1B 3L4PA 1EXNA 2LPEA 5DB8A 2G09A 5DBAA 1ZQWA 2EANA 4RPZA 2P66A 2KSOA 1FFUA 2ATLA 1FIQA 1QQ6A 1ZQGA 3MGHA 3Q8PB 4J9PA 2WF8A 4UW9A 1D9FA 2ALZA 5J2HA 2PKEA 3KHLA 4DS4A 3GV5B 1X40A 1IV8A 4M9HA 5HMLA 2LYHA 3RF9A 4JV1A 3A0HU 3C29A 1MA7A 1LV5A 1B4FA 4EZ6A 3NVWA 4GLXA 2W7OA 4NLGA 4FO6A 7ICFA 3TI0A 9ICAA 4QW9A 3V6HA 4DFPA 2RLTA 5AK5A 2KNJA 4P0QA 1QSSA 3T79A 1D8YA 1OXJA 2H5XA 4RQ7A 1UA0A 2YB4A 3GU3A 5ALSA 4AYBC 9ICRA 3H8JA 2R8IA 5J2JA 2BZFA 4LVSA 2BQUA 9ICJA 1WYGA 8ICOA 3D2SA 3BQ7A 4QWBA 1JI7A 1N2XA 1K1SA 1XSLA 1LKYA 5AM2A 5DQIA 3NRWA 1KW4A 4C4SA 4USAA 4FBTA 4JWMA 1ZQBA 5KT5A 2KZMA 2E1FA 3BQ1A 2E3TA 5IIKA 1ZYQA 2KFZA 4KITB 5AKEA 4ED3A 2ASDA 1Z1VA 1A77A 5KFKA 5AM0A 4B9UA 1D8LA 5AI6A 5DG7A 2JEIA 3VC8A 2G5HB 5KAFU 2KIWA 2B21A 5DBCA 4RUAA 4O0IA 3N7PD 1IIPA 2NO4A 3SAHA 5KFXA 1X66A 1U49A 2W43A 5G5GA 2LM4A 3PR4A 2WF6A 1UHUA 5J2GA 3C5GA 4UQGA 5AKLA 1B22A 2DUYA 2F1HA 2JH7A 2NRWA 4I2IA 1PZNA 1V97A 1O08A 2HI0A 1SL0A 4YP3A 4XUSA 4BWMA 2F3NA 2WAQC 4US8A 4F5RA 3UXPA 4EEKA 1L7NA 1X42A 2W3SA 2V4QA 4KMOB 8ICZA 1Z4NA 5KFIA 3THVA 1S10A 4EX6A 4J9NA 4M9JA 1F0MA 2CXYA 2GO7A 5CEHA 5IIJA 8ICGA 4FE3A 3SMVA 1ZQEA 2I9GA 3WKDA 5AHXA 2G5IB 2W54A 3RBDA 3AQEA 4F2RA 3R9KA 2VIXA 3OHBA 1ZQIA 1K5OA 2VA3A 1CRXA 1X9XA 5FP0A 2YMPA 3TACB 3QUBA 2OWOA 4P0PB 2UVRA 2ZXHA 8ICCA 2KV2A 2JGAA 2BPGA 4Y2XA 4JMUA 4KLUA 3MC1A 1NK9A 3D2QA 4ED8A 4O3PA 1V85A 1TK5A 3WK9A 2F8KA 3PV8A 3EPGA 3F53A 3GILA 4GC6A 3TFSA 1C7YA 3AQFA 5K4LA 3PW0A 2QKQA 3WKAA 5J2IA 3BZKA 2YB1A 3PSPA 4PHDA 4AYBF 2BPCA 2HHSA 2Y1IA 5KFQA 4F92B 4EBCA 1FO4A 1RG6A 3AEVA 4C4TA 4ED2A 4MFFA 2NV3A 2OM6A 4O5KA 3ISBA 5KFVA 1XO1A 1AQ6A 4MF8A 2Y0SF 2HVIA 1PVQA 2XICA 3IRUA 5EE3A 3CP8A 1PUZA 3FC4A 5AK6A 3K1ZA 3RH6A 5HP4A 5ALRA 3KHRA 3PO4A 7ICQA 3QYPA 3TQ1A 3TFRA 1RQNA 2J6TA 4M6WB 3ONNA 4PZOA 2JMGA 4YCXA 4RQ4A 2PMZF 3T5HA 5HNKA 2HBMA 4YR2A 4WJ3B 3EZ5A 3HRDD 5DB7A 1Z4OA 4ACOA 3KZIU 5DG9A 4P0PA 3SV4A 1ZQOA 2RDJA 1SKRA 3Q8KA 3OPXA 2BDUA 1LVHA 2NO5A 5T14A 5ALHA 1L3SA 8ICXA 2KEYA 1U48A 3MBYA 1QQ7A 1BNOA 4U7CA 3G6XA 4Y2JA 3G6YA 1JUDA 2KJ5A 5AKKA 2WTFA 1NK0A 4K4GA 1F5SA 1XSNA 1RXWA 4C80A 2A3VA 4DL7A 1COOA 2A19A 1KTQA 5J2EA 3QNMA 4UB8U 2W03A 3Q8SB 4Q8EA 2QLTA 3I1YA 2PXIA 3JPNA 1TE2A 4YN4A 1NK4A 2ZIVB 5AI9A 3V6JA 4RU9A 4I2JA 1RQLA 5J0YA 2ZTCA 4RUCA 1BPDA 1KDHA 1CUKA 3LWMA 2VKQA 5GTHU 3MFHA 4DQRA 2KIVA 5HHHA 2QB1A 2C22A 1S0NA 4MEYA 4Y2YA 1N5WA 3SENA 4OJ5A 2HBLA 3OHAA 8ICTA 3C2LA 3F2BA 4Z6DA 3KOOA 2XI9A 3KD3A 4MHVA 4CDGA 4C0ZA 3HKZC 4IRKA 2W9AA 9ICXA 3RJIA 4G3IA 4M2YA 3M8RA 4JUZA 1JALA 3NVVA 4UAZA 3BS5B 1A6SA 2Y1JA 5AIAA 5KNIA 2ODGA 1U9LA 1MN8A 4YMNA 2YMLA 3GIIA 3LVWA 1RZTA 4KLEA 2HOIA 2RDIA 2XCPA 1ZQXA 1Q8KA 2L5YA 3B0XA 2D6FC 7ICNA 1NK6A 1J2MA 1COKA 1KL9A 3H0RB 5BPCA 3AU6A 4J9QA 4Y2UA 3QUQA 4M9GA 3RB0A 3GIJA 2XC9A 3C2MA 2VA2A 4UAVA 3T5LA 2F77X 4TUQA 3ALRA 9ICPA 1TAMA 1YZ6A 5DQGA 2NRTA 1BPEA 2DQNB 5CA7A 2K89A 3PX0A 1XO0A 3OJSA 4R8UB 4I2AA 3TKAA 4ECYA 3BS7A 4DLEA 3JPPA 4IS7A 2KICA 3K4GA 1Z3EB 2CRXA 1ED1A 2W3RA 4QWEA 5DDYA 4G9BA 1PK1A 2HBJA 2W9BB 2K4HA 2Q0ZX 4UAYA 2F8LA 4OD0A 5JU5A 4TQSA 3PW5A 4YMMA 2G06A 1HEKA 3H0MB 3C28A 4O3OA 1N5XA 4BWJA 3JPRA 4PGQA 3O0FA 7ICOA 8ICVA 1UA1A 5A0LA 1ZQDA 2PFNA 3QUCA 5KFPA 4Z6CA 5EE1A 5J8YC 4EYIB 4NLKA 9ICVA 2ZIUB 2IOFA 4PHAA 4UAUA 3B9JA 3PW2A 2KOBA 4DFMA 5EE0A 2JEGA 3HKZF 2WF9A 4YXMA 1LKYB 2VJ4A 4CE6A 1ZXIA 2FE9A 2BCVA 3E58A 3RFAA 5HR7A 4NM2A 4KLDA 4I28A 5EWFA 4IQUA 5KL8B 2EAMA 1ZQHA 5KFUA 2KVCA 3KHGA 3VCBA 5KG7A 2HOFA 1QH9A 9ICMA 4KX5A 5ALJA 5KG3A 3LWLA 4ECRA 5DGBA 4PHEA 3JPSA 3ICXA 2BCRA 3FYHA 2DKZA 1ZQJA 1S76D 3UQ2A 4NWIA 3RJHA 5L1KA 4JK1A 2DGZA 5ALWA 1RM6C 4O3QA 4Y2SA 8ICYA 7ICRA 4DL4A 1B43A 4KLLA 4US9A 1PVRA 3H8WA 9ICNA 4QZDA 2ZIXB 4BX9C 1L7MA 3HPOA 4RPXA 3EWAA 2FPKA 2PI5A 2BQ3A 3QX7A 4I2GA 5J0QA 2KN7A 4QZHA 4YXJA 4QZAA 1S97A 1MQ2A 8ICNA 1Z19A 3RH4A 4EENA 5KG4A 1SB3C 3IHQB 4IR9A 3PNCA 2JXJA 2LYAA 2V9WA 7ICKA 5IIIA 4Q45A 2BCUA 2AU0A 1M6YA 4F3OA 4A8EA 1YZ7A 5CB1A 2ZXIA 1SV0A 1ZRNA 2KVSA 1ZQLA 4UB3A 2PFOA 8ICKA 2FPLA 3RB3A 5CJ7A 2FPMA 5KTQA 3C2KA 3I28A 2H3IA 1JXEA 1QLNA 2FLNA 2LM1A 5HMMA 4XA5A 1SWWA 4YR0A 1P7DA 4DSEA 2XIDA 1DXSA 2WAQF 1MSWD 2W55A 4RZRA 4F50A 5DBBA 4I2FA 3WK4A 3QXGA 2AGQA 3MGVA 4C7ZA 3SAGA 2EQYA 4PL2A 5CP2A 1KLNA 3RRHA 2KE7A 5IIMA 2Q4TA 1B0XA 4ELUA 3RJJA 1XC9A 3IV6A 1X6JA 1JX4A 2YMMA 4EBEA 2W11A 2ESEA 2D3DA 1Z00B 1XU4A 5AKJA 3IP4B 3RB4A 1DK2A 4DSIA 2VJ5A
chains in the Genus database with same CATH topology
4CDGA 4NLBA 4C0ZA 5A0LA 4CRXA 2E5SA 2HMXA 2MRLA 3HKZC 2ZIWB 3ONNA 2KNJA 4P0QA 3T79A 2JMGA 2K4IA 4OJ6A 3NUQA 2F2AB 3IG8A 2YB4A 4NLCA 2LBOA 2PMZF 2ZIUB 3GU3A 4AYBC 1A6SA 2HBMA 4FE3A 2OYYA 3SMVA 1D8BA 2M0NA 2LYBA 4WJ3B 2RRDA 2G5IB 4FZLA 1T94A 4BUGA 2N1RA 2WB1F 3AQEA 4ACOA 3PSFA 2KOBA 1Z19A 5C0YA 2G08A 2OXOA 2VIXA 2KHVA 3LYSA 2G0AA 1SZHA 3AL0B 3LVWA 4P0PA 3D2SA 3N7RC 1CRXA 3HKZF 3M6ZA 2HOIA 4BJQA 4P0PB 3OPXA 3F2DA 2BDUA 2ZXHA 2KV2A 2JGAA 2LYAA 4PL1A 1GO3F 5HR6A 3L3FX 5T14A 4QNLA 2W04A 2KKPA 2VJ4A 3NRWA 2D6FC 4JMUA 3D2NA 2KEYA 2PMZC 4A8EA 2CPRA 2MA1A 2KJ9A 3D2QA 3RFAA 2ZIUA 5HR7A 4U7CA 2E1FA 2WB1C 3F5AA 2XVTA 2RHFA 2ZXIA 3H0RB 3KFUF 2KJ5A 4QIWF 1URJA 2F76X 3LVVA 4OJOA 4QIWC 2YX8A 3DEEA 3F53A 5KL8B 2KKVA 3SQIA 3E0FA 2CN1A 1ZQ1C 5CRXA 4GFJA 4OJPA 2H3IA 2LHTA 2KVCA 1OUQA 5KL1B 3IN5A 3AQFA 2RP5A 2ZIWA 3CYMA 3VCBA 3F2CA 2A3VA 2F77X 2G09A 3ALRA 2HOFA 4ICAA 3VC8A 1A0PA 1TAMA 2G5HB 2HOQA 1NZBA 1UPHA 2KIWA 2GH1A 4KX5A 2K8CB 3PSIA 2W03A 3N7PD 3F5EA 3N7SC 1XNSA 4OO1J 2YB1A 2K8AA 3ICXA 1IIPA 2DF4B 1P7DA 2DQNB 3PSPA 3SAHA 1Q3VA 2K89A 2JHDA 2K8BB 2XIDA 1ECWA 3KZXA 4AYBF 1HIWA 4NV0A 2WAQF 4FZNA 1XO0A 4NWIA 2E1EA 3PSTA 1Z1BA 2Z7JA 2ZIVB 4CGZA 3MGVA 2LKYA 3IG5A 2KD1A 2HBKA 4OJLA 1F44A 1YT3A 1Q3UA 2H3ZA 2KICA 3SAGA 3M6KA 4PL2A 1PVPA 2H3FA 2CRXA 2DGZA 1ED1A 4U6PA 2W7PA 4P0QB 2VKQA 3H0LB 2Q4TA 3GZFA 3RF9A 1KBUA 3CRXA 2HBJA 4FZMA 2KHQA 2H3VA 4KX3A 2JH1A 2NV3A 2OM6A 2K4HA 2JH7A 3C29A 1MA7A 1WUDA 2R18A 2ZIXA 2F8LA 1PVRA 2GOLA 3M7DA 3SAFA 2G07A 2G06A 2Y0SF 2ZIVA 2ZIXB 2W7OA 1DRGA 2Y0SC 4BX9C 1HEKA 2ZG6A 1PVQA 2XICA 2OH2A 2WAQC 4OJ5A 3CP8A 2HBLA 3H0MB 4QJFB 3C28A 4O3MA 1L6NA 3PZPA 2H3QA 3K1ZA 3IP4B 4IC9A 3F2BA 3O0FA 2KJ8A 4KMOB 2K4EA 2VJ5A 2XI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PST A;  2K8A A;  3PSP A;  2K89 A;  2K8B B;  2K8C B;  3L3F X; 
#chains in the Genus database with same CATH topology
 2C2D A;  2E8M A;  1O03 A;  2HMX A;  8ICH A;  7ICL A;  2IOH A;  4QWD A;  4C4R A;  3V6K A;  2C2E A;  5KFC A;  5ALZ A;  2OCE A;  5TIS U;  2BDP A;  4C8L A;  4M9L A;  5ALL A;  4ECX A;  2QAR A;  5F9L A;  1S9F A;  3HIL A;  3PY8 A;  4QNL A;  3PML A;  1NOM A;  2F1I A;  2W9B A;  3EYZ A;  1FEZ A;  3D2N A;  3UMG A;  3C1Y A;  4KLJ A;  4F8R A;  2MA1 A;  2XCA A;  3RTV A;  1IM4 A;  1KEJ A;  4RQ2 A;  1CEZ A;  3MR5 A;  3KFU F;  3M9N B;  4UB5 A;  4FS1 A;  4QIW F;  2KZZ A;  2KKV A;  2BR0 A;  1U4B A;  4J9O A;  2CN1 A;  4C8N A;  4O3N A;  4E0D A;  2KTQ A;  4OJP A;  3WK5 A;  5KFS A;  4LJX A;  4IRC A;  9ICU A;  2KK0 A;  2A1J B;  1T4G A;  3Q8R B;  2B6G A;  2BPF A;  3C5F A;  2K8C B;  2AJQ A;  4F4Z A;  2ES6 A;  3GV8 B;  3V7K A;  3V7J A;  1ECW A;  5IIO A;  1BVS A;  2Z7J A;  2DKX A;  2XY5 A;  2FDR A;  1NK7 A;  4CF5 A;  4QWA A;  2HSZ A;  5AKI A;  3PW4 A;  2W7P A;  1T8E A;  3GZF A;  3CRX A;  1T7P A;  8ICJ A;  4KLS A;  2MU2 A;  5ALT A;  2F1J A;  4J9M A;  2J6S A;  4I2C A;  4ED1 A;  1WCN A;  4QZB A;  2ZJA A;  4KN7 A;  4UB6 U;  3ED5 A;  3LDA A;  4DQS A;  2JEJ A;  4CF4 A;  4P2H A;  4IC9 A;  5DLG A;  4Y2V A;  4P4P A;  2K4E A;  4ECT A;  3H8S A;  5J8Y A;  4DSL A;  9ICS A;  4DLG A;  5J2C A;  4FFD A;  8ICW A;  3Q8Q B;  3H7I A;  5J2B A;  1X2I A;  2R8G A;  2ZUB A;  3IDW A;  4J9K A;  1HUO A;  3NUQ A;  1RXV A;  2I5H A;  3IG8 A;  5KFG A;  3PVX A;  1NK8 A;  3JPT A;  2F44 A;  4ECS A;  2EAP A;  3BZC A;  3L5K A;  2AQ4 A;  5HHI A;  7ICT A;  2ZTE A;  2HHT A;  1ZQZ A;  1V9P A;  2V4R A;  5H2F U;  1U45 A;  4DOC A;  2DWQ A;  4ZH4 A;  3SYZ A;  1ZQQ A;  2B0C A;  3DV9 A;  2XO7 A;  3T5J A;  5ALK A;  3QEA Z;  1BPB A;  2PMZ C;  4MFC A;  5KFL A;  2KG5 A;  4ZOH C;  3QZ8 A;  5L9X A;  2RHF A;  3FM9 A;  4YMO A;  5KFH A;  1URJ A;  4CF3 A;  3NAS A;  4I27 A;  1PK3 A;  4NLZ A;  5C5J A;  4UB2 A;  3F2C A;  7ICI A;  5ALV A;  9ICL A;  2WHE A;  1ZD3 A;  1UPH A;  1ZQY A;  4EZ9 A;  5DDM A;  3MDA A;  4KN4 A;  4OO1 J;  5J0T A;  3JPQ A;  5EWE A;  2JZB B;  2JZB A;  5AI0 A;  4DCC A;  5AI8 A;  5J0R A;  2R8H A;  3QU7 A;  2GWS A;  3ISC A;  3H0L B;  1ZQK A;  2YTU A;  5KG1 A;  1S8O A;  3TAR A;  3SR6 A;  3M7D A;  1OW5 A;  4F91 B;  2G07 A;  5DLF A;  5KFA A;  4RQ8 A;  1DRG A;  1XWL A;  4I2D A;  4O3M A;  4YG2 A;  2H3Q A;  4PGY A;  1T3N A;  3J81 j;  3K1R B;  3U26 A;  3N28 A;  1UCV A;  3MDC A;  1QTM A;  4X5V A;  1NK5 A;  4Z6E A;  3MGI A;  3AM9 A;  2ZJ8 A;  1C20 A;  1L7P A;  4PH5 A;  1ZD5 A;  4F4Y A;  1J2N A;  5L1M A;  5D46 A;  4ELT A;  4NJ8 A;  4UAT A;  4O5C A;  1T94 A;  2AQ0 A;  2N1R A;  5CHG A;  1KRP A;  1SZH A;  2DPJ A;  3BQ2 A;  7ICP A;  4DQQ A;  3RJF A;  4O5E A;  3PW7 A;  4C8O A;  3UXN A;  3NVZ A;  4QZG A;  1BNP A;  2NRV A;  2UVV A;  1UT8 A;  4QIW C;  5KT6 A;  2LI6 A;  3BDP A;  4UAS A;  1ZQU A;  1DOQ A;  5AKX A;  2LHT A;  3PX6 A;  1OUQ A;  3IN5 A;  4DQI A;  2ZIW A;  1ZD2 P;  2K60 A;  4RQ5 A;  3MR3 A;  2GH1 A;  1NJX A;  1CI4 A;  4DOB A;  3BS5 A;  5AK3 A;  1WG8 A;  4R8U A;  1ZQS A;  1SV0 C;  3GV7 B;  1F44 A;  3NS1 A;  2BQR A;  4UBC A;  1PK1 B;  5D4B A;  4U6P A;  4DO9 A;  5F9N A;  3K75 D;  4UB1 A;  3IM1 A;  4FZM A;  2H3V A;  3Q8L A;  2JH1 A;  4FS2 A;  4JWN A;  3TAD C;  3GFK B;  4F93 B;  1RDF A;  2HVH A;  1ZQV A;  2ZIV A;  4RPY A;  2BCQ A;  5ALY A;  5BOL A;  2P6R A;  1NJY A;  4GXJ A;  4DQP A;  3AN1 A;  3KBB A;  3PZP A;  2I6X A;  1SV4 A;  5TZV A;  5JTI A;  2XGP A;  1QQ5 A;  2VA8 A;  1ZQM A;  2HCF A;  4R65 A;  2HW3 A;  2A1J A;  5ALP A;  4F4K A;  3RB6 A;  2K4I A;  4DFJ A;  8ICU A;  3TAD A;  5D49 A;  5IIL A;  5AM5 A;  1TKD A;  4J9S A;  5CWR A;  4J03 A;  4FZL A;  5KG5 A;  1S5L U;  5L1I A;  5KFB A;  4DL6 A;  2C28 A;  3M6Z A;  5J2K A;  2HHW A;  8ICA A;  5HR6 A;  3V7L A;  4YD2 A;  4B9T A;  4KTQ A;  4Z6F A;  2QAR B;  4HAI A;  2Y9T A;  2KJ9 A;  1D9D A;  1SIJ A;  3SV3 A;  2W9C A;  2FMS A;  4TQR A;  5KFE A;  5J2F A;  4F72 A;  2ISP A;  4GFJ A;  5JRT A;  2MUT A;  5KFF A;  4DL3 A;  3T3F A;  3UMB A;  3WK7 A;  5DKW A;  9ICI A;  2EZZ A;  3HP6 A;  2JR5 A;  5KT4 A;  5DG8 A;  3F5E A;  3N7S C;  3M8S A;  4CCH A;  3N4M B;  3ETR A;  1NNL A;  1S0O A;  1YT3 A;  1Q3U A;  1RYR A;  4QWC A;  4R66 A;  4F4W A;  1SXD A;  3TAQ A;  9ICQ A;  5KT2 A;  1KBU A;  2AH5 A;  5AM4 A;  4KX3 A;  2KHQ A;  9ICO A;  3UXO A;  4F2S A;  2IMW P;  2ZIX A;  3QU4 A;  5J0S A;  1SL2 A;  4J9L A;  2UVU A;  3QZ7 A;  2ASL A;  2Y0S C;  3C1Z A;  4FBU A;  5ALO A;  1VDV A;  3PR5 B;  3UM9 A;  2HHX A;  2AGP A;  1N56 A;  2XY7 A;  4F5O A;  3SI8 A;  5J0U A;  3AUO A;  2ZIW B;  3G6V A;  2FLP A;  2JEF A;  7ICG A;  3M9O B;  5ALM A;  4F5P A;  2RRD A;  4BUG A;  1QSY A;  4DWI A;  5AIC A;  3PX4 A;  4RNO A;  5AM1 A;  3LYS A;  2BKE A;  4IQT A;  2KP7 A;  5DQH A;  4BDP A;  3L3F X;  4Q44 A;  4B9V A;  4B9L A;  1IXR A;  4GXK A;  3WKE A;  4ECZ A;  4O9M A;  1Q46 A;  4Y2R A;  3QUT A;  5EWG A;  3RBE A;  3SQI A;  5L1J A;  3ORY A;  1WWU A;  2ISO A;  1Y88 A;  1VLB A;  4RQN A;  1ZJM A;  4RNM A;  4KLF A;  3OTQ A;  3GQC A;  1SL1 A;  1S77 D;  3ZDD A;  3QE9 Y;  2EZX A;  4PJ0 U;  1XNS A;  3SEI A;  3AMZ A;  4UAR A;  4IRD A;  2E1E A;  2VAN A;  1ZD4 A;  1X9W A;  1ZJN A;  4DSK A;  2LKY A;  3IG5 A;  7ICV A;  2H3Z A;  5KFM A;  2E8N A;  1TFR A;  9ICW A;  5AKZ A;  1WWV A;  5AKY A;  7ICM A;  1L3V A;  4Y2P A;  4B9S A;  2R18 A;  2PI4 A;  2ZUC A;  3SAF A;  3ISD A;  1L3T A;  1K1Q A;  4TUR A;  2QB0 A;  5KFZ A;  1HUZ A;  3OGU A;  4DL5 A;  2FMP A;  1KQQ A;  5ALG A;  3T5K A;  4QZC A;  5J2A A;  1RYU A;  3MFI A;  1HJP A;  3BJY A;  2E5S A;  3NVY A;  4RQ1 A;  2JV3 A;  1L3U A;  4KLH A;  3H4B A;  3NTU A;  2J6U A;  1JN3 A;  2M9N A;  4LZD A;  2LBO A;  3RAX A;  4Q8F A;  3CNH A;  2GLE A;  5ALF A;  1N60 A;  2LYB A;  3S6J A;  7ICE A;  8ICS A;  3PSF A;  4J9R A;  2K4P A;  1JRO A;  4GIB A;  5G5H A;  3HT3 A;  4BXO A;  4QZ8 A;  4BJQ A;  3ETL A;  3RH5 A;  1S0V A;  5KFN A;  4PL1 A;  2KKP A;  2KZ3 A;  5ALD A;  4P4M A;  2CPR A;  1FFV A;  5B5E U;  5KAI U;  5KFR A;  1A76 A;  2XVT A;  3EW9 A;  4UB4 A;  1ZQA A;  2F76 X;  4OJO A;  2IA6 A;  2HDO A;  4B9N A;  4F71 A;  5CRX A;  1JRP A;  2A1A A;  2ASJ A;  5ALU A;  4NLN A;  4ELV A;  3QEB Z;  1KFS A;  3KKA A;  3I76 A;  5JUM A;  1ZQN A;  2HOQ A;  3MAB A;  4IR1 A;  5AK4 A;  2DF4 B;  2XY6 A;  2XGQ A;  4FZN A;  5L1L A;  9ICE A;  4F4X A;  2MUT B;  4CGZ A;  1N61 A;  2I1Q A;  2HBK A;  1L8L A;  3M6K A;  1ZQP A;  3GDX A;  4ED6 A;  4P0Q B;  4M04 A;  2C2R A;  4DF4 A;  4R63 A;  1WUD A;  1QSL A;  2R8K A;  8ICQ A;  9ICC A;  2BGW A;  2GOL A;  3H40 A;  2IOF K;  1X6I A;  2ZTD A;  9ICG A;  4YVZ A;  2OH2 A;  1UT5 A;  2W8L A;  2W9C B;  4ED0 A;  5ALX A;  3QU5 A;  2OEH A;  3JPO A;  3HX0 A;  1N48 A;  2W9M A;  3ZD8 A;  4AP9 A;  2YN4 A;  4DEZ A;  5AI4 A;  1NKC A;  1LB2 B;  1DGS A;  4OJ6 A;  4UBB A;  4P4O A;  5ALN A;  3NGD A;  3RR7 A;  2WB1 F;  4B6J A;  3H4D A;  4RQM A;  3MR2 A;  1BGX T;  2KHV A;  2G0A A;  4DSF A;  4I29 A;  2WF7 A;  2FMQ A;  1ZET A;  5B66 U;  1GO3 F;  4ECV A;  3OSP A;  3WKC A;  4RT2 A;  4EX7 A;  3N97 B;  1ZQR A;  2MSN A;  3NRZ A;  1SKS A;  2ZIU A;  3KKA C;  3LVV A;  1N62 A;  4O3R A;  4O3S A;  5AKH A;  4QZF A;  3CYM A;  4UAW A;  4M6W A;  1KKX A;  5E79 U;  1ARO P;  4QZI A;  2P6U A;  1A0P A;  3QU9 A;  3DDH A;  3ZDC A;  3A0B U;  4YQW A;  2K8A A;  1Q3V A;  2K8B B;  2AXT U;  1VJ5 A;  4PGX A;  2DBY A;  3RRG A;  1NI3 A;  4DL2 A;  1KFD A;  4OJL A;  1SKW A;  3UPQ A;  1PVP A;  2H3F A;  4HYK A;  5KFJ A;  4JB3 A;  1H38 A;  1BPZ A;  4XRH A;  2HHV A;  4YD1 A;  4OCZ A;  2KFN A;  9ICH A;  4YR3 A;  1QCK A;  3V72 A;  5KG0 A;  2FI1 A;  1SWV A;  4JV2 A;  2LMR A;  5C0Y A;  1JXL A;  1U47 A;  5IIN A;  2KJ8 A;  4Y2Q A;  4DOA A;  4RQ6 A;  1T3Q A;  5DGA A;  4NL9 A;  4NLB A;  3E2E A;  4CRX A;  2DL0 A;  1TAQ A;  2YQE A;  2MRL A;  2FLL A;  2YMQ A;  1JIH A;  2O6K A;  7ICH A;  5J2D A;  2OYY A;  3ZDA A;  1TVA A;  4KLQ A;  4KLO A;  4B9M A;  1V38 A;  3PMN A;  2NRX A;  1L8O A;  4M9N A;  4MFA A;  3M1Y A;  1XS9 D;  2NRZ A;  3F2D A;  4PZN A;  2W04 A;  5KT3 A;  1XSP A;  7ICU A;  8ICL A;  4I2E A;  1L7O A;  8ICR A;  7ICJ A;  3PO5 A;  3D6J A;  5KFD A;  2EAO A;  5ALI A;  5DB9 A;  3OJU A;  2E8O A;  1TAU A;  2ZUD A;  4XQ8 A;  3WK8 A;  1ZQ1 C;  4QW8 A;  5KFY A;  4TUS A;  5KFW A;  3C21 A;  3BQ0 A;  2AHO B;  2MAX A;  4MEX A;  1DK3 A;  4M47 A;  4EEY A;  1X9M A;  2JHD A;  4IQV A;  1JMS A;  1MQ3 A;  1HIW A;  4NV0 A;  4ECW A;  3PST A;  1Z1B A;  1TV9 A;  1RPL A;  4I2B A;  4NL9 C;  5KT7 A;  5J0W A;  4K4H A;  1UQV A;  2KD1 A;  1KSP A;  1KN5 A;  7ICS A;  4ECQ A;  1IG6 A;  8ICF A;  3WK6 A;  4RT3 A;  3HJE A;  2EH9 A;  3HW8 A;  2IHM A;  4GXI A;  3C23 A;  3UQ0 A;  4M0A A;  5EE9 A;  3TAN A;  3B0Y A;  9ICF A;  2EZY A;  1N63 A;  8ICI A;  1Z00 A;  2EDU A;  4QJF B;  3UMC A;  2YY6 A;  5AIB A;  8ICP A;  2WFA A;  2BCS A;  2AGO A;  1ZOL A;  2OHF A;  3ZDB A;  4KLI A;  5AI5 A;  4NLC A;  3LK9 A;  4Y2T A;  3ZD9 A;  4Q43 A;  3ZDE A;  3M9M B;  4MF2 A;  2KSO B;  4TUP A;  4F5N A;  1D8B A;  5J0O A;  1BPY A;  1ZQF A;  2PFQ A;  3WKB A;  2RQ5 A;  4KLG A;  4R64 A;  1BPX A;  5AM3 A;  2JRZ A;  1TK8 A;  4C8K A;  2NYV A;  5AKG A;  4PPX A;  2HHQ A;  3Q8M A;  1TK0 A;  4C8M A;  4EYH B;  1SZP A;  4KLM A;  1SGG A;  3F5A A;  3MR6 A;  2R8J A;  9ICB A;  4ECU A;  1DGJ A;  5KG2 A;  3RAQ A;  2YX8 A;  4EEL A;  3HWT A;  3E0F A;  1KFT A;  2RP5 A;  2E8P A;  4GC7 A;  4K4I A;  2Y9U A;  4IQW A;  4I2H A;  4ICA A;  1NZB A;  9ICK A;  4RQ3 A;  3PSI A;  2QB0 B;  2WF5 A;  5F3X B;  3KZX A;  1X9S A;  3GIM A;  1MC8 A;  5J0P A;  8ICM A;  4NM1 A;  3CW2 C;  5KG6 A;  1ZQC A;  5J0X A;  4DSJ A;  4NXZ A;  3RJG A;  3FDS A;  3OSN A;  4PHP A;  2PFP A;  1NJZ A;  3KHH A;  3AL0 B;  4RQ0 A;  4NY8 A;  2BHN A;  2ZG6 A;  1WCL A;  4ED7 A;  1J97 A;  4YFK A;  3GIK A;  2DFL A;  1L6N A;  5GTI U;  3FAH A;  2FJ6 A;  3SD7 A;  5BOM A;  3SZ2 A;  5J29 A;  3H8M A;  4LZG A;  5EOZ A;  3EPI A;  3RR8 A;  4DS5 A;  4DF8 A;  2F2A B;  3WU2 U;  8ICB A;  1NKB A;  2UVW A;  2M0N A;  1ZRM A;  4RNN A;  3BQT A;  2G08 A;  2OXO A;  4DFD A;  3RJE A;  2KMD A;  4F5Q A;  3N7R C;  4BXO B;  5KFO A;  2IBK A;  4JV0 A;  4DFK A;  1L5U A;  2IHN A;  4KLT A;  2HHU A;  3RJK A;  3QU2 A;  3KTQ A;  4QZ9 A;  2P35 A;  1S0M A;  2ZJ5 A;  5CR0 A;  2D8C A;  5ALQ A;  1NZP A;  1NKE A;  8ICE A;  3EUB 2;  1RYS A;  1SXE A;  3AU2 A;  2WB1 C;  4CNQ A;  9ICT A;  4BGD A;  5KFT A;  4IL6 U;  4QZE A;  5DB6 A;  3DEE A;  2W8K A;  4EBD A;  3TAP A;  1NJW A;  3ZI4 A;  1ZQT A;  2DPI A;  5ALE A;  4KMU A;  4C7Y A;  5KL1 B;  3L4P A;  1EXN A;  2LPE A;  5DB8 A;  2G09 A;  5DBA A;  1ZQW A;  2EAN A;  4RPZ A;  2P66 A;  2KSO A;  1FFU A;  2ATL A;  1FIQ A;  1QQ6 A;  1ZQG A;  3MGH A;  3Q8P B;  4J9P A;  2WF8 A;  4UW9 A;  1D9F A;  2ALZ A;  5J2H A;  2PKE A;  3KHL A;  4DS4 A;  3GV5 B;  1X40 A;  1IV8 A;  4M9H A;  5HML A;  2LYH A;  3RF9 A;  4JV1 A;  3A0H U;  3C29 A;  1MA7 A;  1LV5 A;  1B4F A;  4EZ6 A;  3NVW A;  4GLX A;  2W7O A;  4NLG A;  4FO6 A;  7ICF A;  3TI0 A;  9ICA A;  4QW9 A;  3V6H A;  4DFP A;  2RLT A;  5AK5 A;  2KNJ A;  4P0Q A;  1QSS A;  3T79 A;  1D8Y A;  1OXJ A;  2H5X A;  4RQ7 A;  1UA0 A;  2YB4 A;  3GU3 A;  5ALS A;  4AYB C;  9ICR A;  3H8J A;  2R8I A;  5J2J A;  2BZF A;  4LVS A;  2BQU A;  9ICJ A;  1WYG A;  8ICO A;  3D2S A;  3BQ7 A;  4QWB A;  1JI7 A;  1N2X A;  1K1S A;  1XSL A;  1LKY A;  5AM2 A;  5DQI A;  3NRW A;  1KW4 A;  4C4S A;  4USA A;  4FBT A;  4JWM A;  1ZQB A;  5KT5 A;  2KZM A;  2E1F A;  3BQ1 A;  2E3T A;  5IIK A;  1ZYQ A;  2KFZ A;  4KIT B;  5AKE A;  4ED3 A;  2ASD A;  1Z1V A;  1A77 A;  5KFK A;  5AM0 A;  4B9U A;  1D8L A;  5AI6 A;  5DG7 A;  2JEI A;  3VC8 A;  2G5H B;  5KAF U;  2KIW A;  2B21 A;  5DBC A;  4RUA A;  4O0I A;  3N7P D;  1IIP A;  2NO4 A;  3SAH A;  5KFX A;  1X66 A;  1U49 A;  2W43 A;  5G5G A;  2LM4 A;  3PR4 A;  2WF6 A;  1UHU A;  5J2G A;  3C5G A;  4UQG A;  5AKL A;  1B22 A;  2DUY A;  2F1H A;  2JH7 A;  2NRW A;  4I2I A;  1PZN A;  1V97 A;  1O08 A;  2HI0 A;  1SL0 A;  4YP3 A;  4XUS A;  4BWM A;  2F3N A;  2WAQ C;  4US8 A;  4F5R A;  3UXP A;  4EEK A;  1L7N A;  1X42 A;  2W3S A;  2V4Q A;  4KMO B;  8ICZ A;  1Z4N A;  5KFI A;  3THV A;  1S10 A;  4EX6 A;  4J9N A;  4M9J A;  1F0M A;  2CXY A;  2GO7 A;  5CEH A;  5IIJ A;  8ICG A;  4FE3 A;  3SMV A;  1ZQE A;  2I9G A;  3WKD A;  5AHX A;  2G5I B;  2W54 A;  3RBD A;  3AQE A;  4F2R A;  3R9K A;  2VIX A;  3OHB A;  1ZQI A;  1K5O A;  2VA3 A;  1CRX A;  1X9X A;  5FP0 A;  2YMP A;  3TAC B;  3QUB A;  2OWO A;  4P0P B;  2UVR A;  2ZXH A;  8ICC A;  2KV2 A;  2JGA A;  2BPG A;  4Y2X A;  4JMU A;  4KLU A;  3MC1 A;  1NK9 A;  3D2Q A;  4ED8 A;  4O3P A;  1V85 A;  1TK5 A;  3WK9 A;  2F8K A;  3PV8 A;  3EPG A;  3F53 A;  3GIL A;  4GC6 A;  3TFS A;  1C7Y A;  3AQF A;  5K4L A;  3PW0 A;  2QKQ A;  3WKA A;  5J2I A;  3BZK A;  2YB1 A;  3PSP A;  4PHD A;  4AYB F;  2BPC A;  2HHS A;  2Y1I A;  5KFQ A;  4F92 B;  4EBC A;  1FO4 A;  1RG6 A;  3AEV A;  4C4T A;  4ED2 A;  4MFF A;  2NV3 A;  2OM6 A;  4O5K A;  3ISB A;  5KFV A;  1XO1 A;  1AQ6 A;  4MF8 A;  2Y0S F;  2HVI A;  1PVQ A;  2XIC A;  3IRU A;  5EE3 A;  3CP8 A;  1PUZ A;  3FC4 A;  5AK6 A;  3K1Z A;  3RH6 A;  5HP4 A;  5ALR A;  3KHR A;  3PO4 A;  7ICQ A;  3QYP A;  3TQ1 A;  3TFR A;  1RQN A;  2J6T A;  4M6W B;  3ONN A;  4PZO A;  2JMG A;  4YCX A;  4RQ4 A;  2PMZ F;  3T5H A;  5HNK A;  2HBM A;  4YR2 A;  4WJ3 B;  3EZ5 A;  3HRD D;  5DB7 A;  1Z4O A;  4ACO A;  3KZI U;  5DG9 A;  4P0P A;  3SV4 A;  1ZQO A;  2RDJ A;  1SKR A;  3Q8K A;  3OPX A;  2BDU A;  1LVH A;  2NO5 A;  5T14 A;  5ALH A;  1L3S A;  8ICX A;  2KEY A;  1U48 A;  3MBY A;  1QQ7 A;  1BNO A;  4U7C A;  3G6X A;  4Y2J A;  3G6Y A;  1JUD A;  2KJ5 A;  5AKK A;  2WTF A;  1NK0 A;  4K4G A;  1F5S A;  1XSN A;  1RXW A;  4C80 A;  2A3V A;  4DL7 A;  1COO A;  2A19 A;  1KTQ A;  5J2E A;  3QNM A;  4UB8 U;  2W03 A;  3Q8S B;  4Q8E A;  2QLT A;  3I1Y A;  2PXI A;  3JPN A;  1TE2 A;  4YN4 A;  1NK4 A;  2ZIV B;  5AI9 A;  3V6J A;  4RU9 A;  4I2J A;  1RQL A;  5J0Y A;  2ZTC A;  4RUC A;  1BPD A;  1KDH A;  1CUK A;  3LWM A;  2VKQ A;  5GTH U;  3MFH A;  4DQR A;  2KIV A;  5HHH A;  2QB1 A;  2C22 A;  1S0N A;  4MEY A;  4Y2Y A;  1N5W A;  3SEN A;  4OJ5 A;  2HBL A;  3OHA A;  8ICT A;  3C2L A;  3F2B A;  4Z6D A;  3KOO A;  2XI9 A;  3KD3 A;  4MHV A;  4CDG A;  4C0Z A;  3HKZ C;  4IRK A;  2W9A A;  9ICX A;  3RJI A;  4G3I A;  4M2Y A;  3M8R A;  4JUZ A;  1JAL A;  3NVV A;  4UAZ A;  3BS5 B;  1A6S A;  2Y1J A;  5AIA A;  5KNI A;  2ODG A;  1U9L A;  1MN8 A;  4YMN A;  2YML A;  3GII A;  3LVW A;  1RZT A;  4KLE A;  2HOI A;  2RDI A;  2XCP A;  1ZQX A;  1Q8K A;  2L5Y A;  3B0X A;  2D6F C;  7ICN A;  1NK6 A;  1J2M A;  1COK A;  1KL9 A;  3H0R B;  5BPC A;  3AU6 A;  4J9Q A;  4Y2U A;  3QUQ A;  4M9G A;  3RB0 A;  3GIJ A;  2XC9 A;  3C2M A;  2VA2 A;  4UAV A;  3T5L A;  2F77 X;  4TUQ A;  3ALR A;  9ICP A;  1TAM A;  1YZ6 A;  5DQG A;  2NRT A;  1BPE A;  2DQN B;  5CA7 A;  2K89 A;  3PX0 A;  1XO0 A;  3OJS A;  4R8U B;  4I2A A;  3TKA A;  4ECY A;  3BS7 A;  4DLE A;  3JPP A;  4IS7 A;  2KIC A;  3K4G A;  1Z3E B;  2CRX A;  1ED1 A;  2W3R A;  4QWE A;  5DDY A;  4G9B A;  1PK1 A;  2HBJ A;  2W9B B;  2K4H A;  2Q0Z X;  4UAY A;  2F8L A;  4OD0 A;  5JU5 A;  4TQS A;  3PW5 A;  4YMM A;  2G06 A;  1HEK A;  3H0M B;  3C28 A;  4O3O A;  1N5X A;  4BWJ A;  3JPR A;  4PGQ A;  3O0F A;  7ICO A;  8ICV A;  1UA1 A;  5A0L A;  1ZQD A;  2PFN A;  3QUC A;  5KFP A;  4Z6C A;  5EE1 A;  5J8Y C;  4EYI B;  4NLK A;  9ICV A;  2ZIU B;  2IOF A;  4PHA A;  4UAU A;  3B9J A;  3PW2 A;  2KOB A;  4DFM A;  5EE0 A;  2JEG A;  3HKZ F;  2WF9 A;  4YXM A;  1LKY B;  2VJ4 A;  4CE6 A;  1ZXI A;  2FE9 A;  2BCV A;  3E58 A;  3RFA A;  5HR7 A;  4NM2 A;  4KLD A;  4I28 A;  5EWF A;  4IQU A;  5KL8 B;  2EAM A;  1ZQH A;  5KFU A;  2KVC A;  3KHG A;  3VCB A;  5KG7 A;  2HOF A;  1QH9 A;  9ICM A;  4KX5 A;  5ALJ A;  5KG3 A;  3LWL A;  4ECR A;  5DGB A;  4PHE A;  3JPS A;  3ICX A;  2BCR A;  3FYH A;  2DKZ A;  1ZQJ A;  1S76 D;  3UQ2 A;  4NWI A;  3RJH A;  5L1K A;  4JK1 A;  2DGZ A;  5ALW A;  1RM6 C;  4O3Q A;  4Y2S A;  8ICY A;  7ICR A;  4DL4 A;  1B43 A;  4KLL A;  4US9 A;  1PVR A;  3H8W A;  9ICN A;  4QZD A;  2ZIX B;  4BX9 C;  1L7M A;  3HPO A;  4RPX A;  3EWA A;  2FPK A;  2PI5 A;  2BQ3 A;  3QX7 A;  4I2G A;  5J0Q A;  2KN7 A;  4QZH A;  4YXJ A;  4QZA A;  1S97 A;  1MQ2 A;  8ICN A;  1Z19 A;  3RH4 A;  4EEN A;  5KG4 A;  1SB3 C;  3IHQ B;  4IR9 A;  3PNC A;  2JXJ A;  2LYA A;  2V9W A;  7ICK A;  5III A;  4Q45 A;  2BCU A;  2AU0 A;  1M6Y A;  4F3O A;  4A8E A;  1YZ7 A;  5CB1 A;  2ZXI A;  1SV0 A;  1ZRN A;  2KVS A;  1ZQL A;  4UB3 A;  2PFO A;  8ICK A;  2FPL A;  3RB3 A;  5CJ7 A;  2FPM A;  5KTQ A;  3C2K A;  3I28 A;  2H3I A;  1JXE A;  1QLN A;  2FLN A;  2LM1 A;  5HMM A;  4XA5 A;  1SWW A;  4YR0 A;  1P7D A;  4DSE A;  2XID A;  1DXS A;  2WAQ F;  1MSW D;  2W55 A;  4RZR A;  4F50 A;  5DBB A;  4I2F A;  3WK4 A;  3QXG A;  2AGQ A;  3MGV A;  4C7Z A;  3SAG A;  2EQY A;  4PL2 A;  5CP2 A;  1KLN A;  3RRH A;  2KE7 A;  5IIM A;  2Q4T A;  1B0X A;  4ELU A;  3RJJ A;  1XC9 A;  3IV6 A;  1X6J A;  1JX4 A;  2YMM A;  4EBE A;  2W11 A;  2ESE A;  2D3D A;  1Z00 B;  1XU4 A;  5AKJ A;  3IP4 B;  3RB4 A;  1DK2 A;  4DSI A;  2VJ5 A; 
#chains in the Genus database with same CATH homology
 4CDG A;  4NLB A;  4C0Z A;  5A0L A;  4CRX A;  2E5S A;  2HMX A;  2MRL A;  3HKZ C;  2ZIW B;  3ONN A;  2KNJ A;  4P0Q A;  3T79 A;  2JMG A;  2K4I A;  4OJ6 A;  3NUQ A;  2F2A B;  3IG8 A;  2YB4 A;  4NLC A;  2LBO A;  2PMZ F;  2ZIU B;  3GU3 A;  4AYB C;  1A6S A;  2HBM A;  4FE3 A;  2OYY A;  3SMV A;  1D8B A;  2M0N A;  2LYB A;  4WJ3 B;  2RRD A;  2G5I B;  4FZL A;  1T94 A;  4BUG A;  2N1R A;  2WB1 F;  3AQE A;  4ACO A;  3PSF A;  2KOB A;  1Z19 A;  5C0Y A;  2G08 A;  2OXO A;  2VIX A;  2KHV A;  3LYS A;  2G0A A;  1SZH A;  3AL0 B;  3LVW A;  4P0P A;  3D2S A;  3N7R C;  1CRX A;  3HKZ F;  3M6Z A;  2HOI A;  4BJQ A;  4P0P B;  3OPX A;  3F2D A;  2BDU A;  2ZXH A;  2KV2 A;  2JGA A;  2LYA A;  4PL1 A;  1GO3 F;  5HR6 A;  3L3F X;  5T14 A;  4QNL A;  2W04 A;  2KKP A;  2VJ4 A;  3NRW A;  2D6F C;  4JMU A;  3D2N A;  2KEY A;  2PMZ C;  4A8E A;  2CPR A;  2MA1 A;  2KJ9 A;  3D2Q A;  3RFA A;  2ZIU A;  5HR7 A;  4U7C A;  2E1F A;  2WB1 C;  3F5A A;  2XVT A;  2RHF A;  2ZXI A;  3H0R B;  3KFU F;  2KJ5 A;  4QIW F;  1URJ A;  2F76 X;  3LVV A;  4OJO A;  4QIW C;  2YX8 A;  3DEE A;  3F53 A;  5KL8 B;  2KKV A;  3SQI A;  3E0F A;  2CN1 A;  1ZQ1 C;  5CRX A;  4GFJ A;  4OJP A;  2H3I A;  2LHT A;  2KVC A;  1OUQ A;  5KL1 B;  3IN5 A;  3AQF A;  2RP5 A;  2ZIW A;  3CYM A;  3VCB A;  3F2C A;  2A3V A;  2F77 X;  2G09 A;  3ALR A;  2HOF A;  4ICA A;  3VC8 A;  1A0P A;  1TAM A;  2G5H B;  2HOQ A;  1NZB A;  1UPH A;  2KIW A;  2GH1 A;  4KX5 A;  2K8C B;  3PSI A;  2W03 A;  3N7P D;  3F5E A;  3N7S C;  1XNS A;  4OO1 J;  2YB1 A;  2K8A A;  3ICX A;  1IIP A;  2DF4 B;  1P7D A;  2DQN B;  3PSP A;  3SAH A;  1Q3V A;  2K89 A;  2JHD A;  2K8B B;  2XID A;  1ECW A;  3KZX A;  4AYB F;  1HIW A;  4NV0 A;  2WAQ F;  4FZN A;  1XO0 A;  4NWI A;  2E1E A;  3PST A;  1Z1B A;  2Z7J A;  2ZIV B;  4CGZ A;  3MGV A;  2LKY A;  3IG5 A;  2KD1 A;  2HBK A;  4OJL A;  1F44 A;  1YT3 A;  1Q3U A;  2H3Z A;  2KIC A;  3SAG A;  3M6K A;  4PL2 A;  1PVP A;  2H3F A;  2CRX A;  2DGZ A;  1ED1 A;  4U6P A;  2W7P A;  4P0Q B;  2VKQ A;  3H0L B;  2Q4T A;  3GZF A;  3RF9 A;  1KBU A;  3CRX A;  2HBJ A;  4FZM A;  2KHQ A;  2H3V A;  4KX3 A;  2JH1 A;  2NV3 A;  2OM6 A;  2K4H A;  2JH7 A;  3C29 A;  1MA7 A;  1WUD A;  2R18 A;  2ZIX A;  2F8L A;  1PVR A;  2GOL A;  3M7D A;  3SAF A;  2G07 A;  2G06 A;  2Y0S F;  2ZIV A;  2ZIX B;  2W7O A;  1DRG A;  2Y0S C;  4BX9 C;  1HEK A;  2ZG6 A;  1PVQ A;  2XIC A;  2OH2 A;  2WAQ C;  4OJ5 A;  3CP8 A;  2HBL A;  3H0M B;  4QJF B;  3C28 A;  4O3M A;  1L6N A;  3PZP A;  2H3Q A;  3K1Z A;  3IP4 B;  4IC9 A;  3F2B A;  3O0F A;  2KJ8 A;  4KMO B;  2K4E A;  2VJ5 A;  2XI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...