2K8AA

Solution structure of a novel ubiquitin-binding domain from human plaa (pfuc, gly76-pro77 trans isomer)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Phospholipase A-2-activating protein
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8aA00
3PSPA 2K8AA 2K8CB 3PSTA 2K8BB 2K89A 3L3FX
chains in the Genus database with same CATH superfamily
3PR5B 2R8HA 3N28A 1SL2A 1YZ7A 5KFHA 4NM1A 2HHUA 1SWWA 5KG1A 2AHOB 1NKEA 2EZYA 2KICA 3MC1A 9ICTA 1J97A 4YVZA 2XIDA 4Y2VA 2ZUBA 3QUTA 9ICUA 5KL1B 4KLGA 2AH5A 2HW3A 3C2KA 2K8CB 5ALPA 3D6JA 4QZFA 3CW2C 3SAGA 3M1YA 1NZPA 2C22A 4I27A 3GQCA 5L1LA 2UVVA 2I1QA 2ATLA 2O6KA 2W04A 4UAZA 3MGVA 4KLQA 2F1JA 2C2RA 4NXZA 1SV0C 2NYVA 4KX5A 1SXEA 1TAMA 5CJ7A 2A3VA 3WK7A 2W9CB 9ICRA 2Y9TA 1IG6A 3FDSA 5AKEA 5AI9A 5JU5A 3BDPA 4CF3A 4EYHB 3GU3A 4TURA 2DGZA 1QTMA 5J0QA 1JIHA 2XY5A 3NTUA 2ZIUA 2DUYA 5AKGA 4Y2JA 2AGOA 4C80A 4ECUA 5AI6A 4YD2A 3M7DA 3E58A 4B9MA 8ICQA 3RR8A 9ICFA 2JV3A 2Y9UA 4PHEA 4PPXA 3OPXA 4F4KA 5J8YA 3C5GA 4I2GA 3B0YA 4O3RA 4NLGA 2ZIWB 2IA6A 1Z19A 3TACB 1BPZA 2NRWA 1S76D 1X6JA 2VJ5A 2ZXHA 4CRXA 4QZGA 2W9MA 3QU4A 4DEZA 2AGPA 3C2MA 3KOOA 4O3PA 4RQ4A 5AKJA 1ZQFA 2ISOA 1UQVA 1V85A 4J9MA 3PSPA 1N48A 4CF4A 2F44A 4IR1A 1S8OA 5G5HA 8ICSA 8ICBA 5ALYA 4PHAA 3TKAA 8ICWA 2MUTB 4F71A 1ECWA 1Q3VA 5J0OA 4TUQA 7ICKA 2HDOA 4RQ3A 1Z3EB 3RH6A 5ALSA 3KHLA 4RPZA 2KN7A 4IQVA 2J6SA 2KIVA 2RRDA 2KZMA 2RDIA 1F5SA 1VJ5A 3PW7A 5ALUA 2W03A 2WB1F 1JALA 5KFXA 1M6YA 2VA3A 2ZUCA 2RLTA 3QXGA 1X9XA 4DF4A 2YN4A 4GC6A 4F72A 1UT5A 4ECQA 2ZUDA 5KFSA 1WYGA 5EOZA 3L4PA 2LYAA 3N7PD 1LKYB 1LVHA 1NJYA 3BS5B 4DO9A 1ZQJA 5J0XA 5ALIA 2KTQA 4NLCA 3NUQA 5DBAA 5KFUA 1U9LA 4R65A 3SV3A 1MSWD 4F2SA 2ALZA 1ZJMA 4F8RA 2XICA 2DBYA 1AQ6A 3EWAA 5AIBA 1K1QA 1PUZA 2ZTEA 4RUAA 4CDGA 4PHPA 3PW0A 2PFPA 2VA8A 2OM6A 4C8MA 4X5VA 3AN1A 4KLLA 9ICSA 2KIWA 2DKZA 4F5OA 5KFBA 5J0PA 8ICJA 5KG4A 1MQ3A 3SQIA 3M8RA 2BKEA 1JN3A 5HR6A 1K1SA 9ICVA 2EDUA 4DWIA 4RNNA 4NLKA 5AM1A 3ETLA 4JUZA 2AJQA 3DDHA 4Q44A 4BXOB 3EYZA 4F4WA 2M0NA 3BQTA 9ICIA 4BDPA 1U49A 2LHTA 3RF9A 5CR0A 1L7NA 4UB2A 3PX4A 3PO4A 4J9PA 4B6JA 3LWMA 3IM1A 2BQUA 2IOFA 2ASLA 3RTVA 7ICVA 2WF9A 2GH1A 4UAYA 2B0CA 4KLUA 4I2AA 4A8EA 9ICOA 4KLJA 2LM1A 4I28A 3TQ1A 2K8AA 1IIPA 3EPGA 1NKCA 4KLIA 3UMGA 5J2CA 1NOMA 2ZTCA 4ZH4A 2QARA 4Z6DA 5AK4A 4MF2A 4FBTA 4QIWC 2HOIA 2W9BA 3Q8RB 2DPIA 2FDRA 8ICAA 7ICSA 3G6XA 4F4ZA 1LB2B 3PSIA 4GFJA 1ZJNA 4Z6CA 2LI6A 2KJ8A 1X9MA 4DSJA 5KG5A 1FIQA 3H0RB 2W7PA 5IIIA 5BOLA 3H4DA 3SI8A 1VDVA 4CNQA 4PL1A 3F2BA 1XSNA 1D8LA 3MGHA 4GIBA 3J81j 5DDYA 1SV4A 4ECSA 4EELA 5CA7A 2E8NA 4UB6U 1X9SA 2OWOA 2IOHA 4KN4A 4Y2QA 4B9UA 4P0PB 1FO4A 3WK5A 4NLZA 2BQ3A 4DS5A 3T79A 4OJ6A 5KT3A 2D3DA 1ZQHA 5DLGA 4RQ0A 3H0LB 1PVQA 2K4PA 1X6IA 2ISPA 8ICMA 1NJXA 1KW4A 1NK4A 4KLHA 4EZ6A 8ICPA 5CRXA 5ALRA 4YCXA 1RXVA 1QSSA 1PVRA 4F5QA 5EWGA 4ECWA 3ZDAA 3V6HA 2RDJA 2UVUA 2FPMA 1L7MA 4B9SA 5HHIA 4Q8FA 3K4GA 2LMRA 3KD3A 1RZTA 4ECVA 1A0PA 4ED2A 5J2BA 4B9NA 2FMSA 3C29A 4RZRA 4G3IA 2MA1A 3GFKB 2PMZC 5EWEA 1ZQXA 2IHNA 5ALOA 2JRZA 8ICUA 4RT2A 3KHHA 3C23A 2ZJ5A 1ZD2P 2P6RA 4DLEA 3ONNA 4ICAA 2ZIVB 3RFAA 4J9OA 4CE6A 5J2DA 5KG0A 5F9NA 4K4HA 1D9DA 2CRXA 4DOCA 2JMGA 2XVTA 4O3QA 5DGAA 3H7IA 3ISBA 5KT6A 4M6WB 4R8UB 1ZYQA 5JTIA 3DEEA 1U48A 2F2AB 4UARA 4ECTA 1ZQVA 2YY6A 2KNJA 4OCZA 3ETRA 3GV8B 2HBKA 2J6UA 2PKEA 7ICHA 5AM3A 1WWVA 4O3MA 3E2EA 3OSPA 3QE9Y 2E3TA 3PV8A 1CRXA 2HHWA 3V7KA 5EWFA 9ICJA 2WF6A 3IDWA 3M9OB 2WAQC 3WKEA 1ZQTA 4IQTA 7ICMA 2G08A 5J2EA 4HYKA 2W54A 1KLNA 3PNCA 7ICJA 3AM9A 5ALVA 4ELTA 4RNMA 1YZ6A 4UB1A 1DGSA 3C28A 1Q8KA 4JV2A 2I6XA 3PSFA 1Z1VA 4Y2RA 3TADA 2MSNA 5KFFA 3C5FA 2LKYA 2F8KA 3QX7A 4GLXA 5G5GA 5CEHA 1ZQRA 5AK5A 2KVSA 4P0QB 1DK2A 4F3OA 2W8LA 3G6VA 3B9JA 4G9BA 2H3ZA 3IP4B 1L3VA 4R66A 5KTQA 5D46A 3QZ7A 1S0MA 1FFUA 1KQQA 3LVWA 3T5KA 4JV1A 2NRXA 5DQHA 1ZD5A 2HBMA 2C2DA 1SB3C 5C5JA 1N2XA 2PXIA 3GIJA 3Q8MA 3BQ7A 2UVWA 4QZIA 4I29A 3KZIU 1X42A 4GC7A 1NNLA 2BZFA 1XSPA 2QB1A 3SMVA 2F1IA 5ALJA 3GV7B 2AQ0A 5KFPA 2EAOA 4NL9C 4OJLA 1JRPA 2BCVA 1ZQKA 3G6YA 4KLEA 3NGDA 4C8LA 4KLFA 3PR4A 4C8OA 4F50A 3TAPA 2PFOA 3FC4A 4I2BA 1OW5A 2OHFA 4M2YA 5EE3A 5KG3A 3HWTA 1ZQSA 2G09A 1SL0A 3Q8QB 3K75D 1CI4A 1T94A 9ICKA 4PZNA 3RJHA 4RQNA 2I9GA 5KFCA 1N5WA 4DSEA 2E1FA 5HMMA 9ICWA 1SZHA 3PVXA 4YFKA 3M9NB 3UQ2A 1DRGA 2EZZA 5KFLA 3N7RC 3WK6A 1DOQA 2M9NA 3RB6A 4J9QA 1BNPA 3OHBA 3HILA 3GV5B 1KFDA 3V72A 1S97A 5TZVA 2HHVA 5J0YA 4QWBA 5DB9A 5KFAA 3TAQA 4IRKA 4QZHA 3U26A 1TKDA 1MQ2A 2ZG6A 5KFVA 4C8KA 4CGZA 2MUTA 3HW8A 7ICUA 3E0FA 5AKXA 5KFQA 2DL0A 4DQSA 2GO7A 2HHQA 3GIKA 3KBBA 3SAHA 1DGJA 1RDFA 5E79U 2ZIXA 5KFMA 4F92B 4J9NA 4YXMA 4FZNA 3PO5A 1A77A 1IXRA 2AXTU 4UAWA 4LZDA 2OCEA 4ACOA 5KFKA 4KITB 5TISU 1V9PA 3UM9A 1U45A 5DGBA 1X40A 1B4FA 2NO4A 4U7CA 4CCHA 5AM0A 4M0AA 2HHSA 5KFIA 4UAVA 1BPXA 5A0LA 3WKBA 7ICFA 3RJIA 4RPXA 4FS1A 1PK1B 5AKYA 2XGPA 4LZGA 8ICVA 4PL2A 3WU2U 1S5LU 5B66U 5J2AA 3KHGA 2FI1A 5J2JA 2KSOB 3KZXA 4FBUA 2G5IB 1URJA 1SXDA 9ICXA 2KEYA 4IRCA 5AHXA 4RUCA 3TFRA 2JGAA 4EENA 1TK8A 1ZQPA 1L3TA 3JPRA 4IS7A 1RG6A 2BPFA 2KJ5A 2I5HA 4DQRA 3QUBA 3FYHA 9ICPA 4FS2A 3MGIA 9ICGA 2AU0A 3PSTA 4DFPA 3SENA 4EEKA 5D49A 1SKWA 2J6TA 4Q43A 2IOFK 4MF8A 5J0TA 2KKVA 1KTQA 2CXYA 3ZD8A 2YMPA 4M9HA 4FE3A 1ZOLA 4ELVA 1XO0A 2JH1A 1BPBA 1SKSA 2ASJA 1MA7A 1NK8A 2ZJ8A 3M6KA 4U6PA 5KAFU 1DK3A 4MEYA 2JZBA 3KKAC 2R8GA 1X9WA 7ICOA 1L8OA 2KP7A 3V6JA 2QB0A 1KSPA 8ICNA 2PFQA 2NV3A 3D2QA 4BGDA 2DPJA 2KOBA 4DSIA 3PX0A 4Q8EA 5IIJA 3H8SA 4YXJA 1XS9D 1TV9A 4DL5A 4FZLA 1T3NA 2WF7A 2WFAA 2IBKA 4Y2SA 4ED7A 4QIWF 3R9KA 8ICTA 1WUDA 1F0MA 3VC8A 4BX9C 4IC9A 2VA2A 4KMOB 2HOFA 2IHMA 2YX8A 5GTHU 1QQ6A 3QNMA 2XCPA 2Y1IA 5KT2A 4DFMA 4WJ3B 1AROP 3EUB2 4QZEA 5HP4A 3H8MA 1KKXA 5AI4A 2A1JA 4O5EA 2JXJA 5AIAA 2PI4A 3UXNA 2G5HB 5L9XA 5ALGA 7ICTA 1Y88A 3AEVA 2BCSA 2RHFA 3UMCA 3ISCA 4M9NA 4KX3A 5KT4A 1V38A 3MR2A 1COOA 3ZDEA 4EX6A 2V4RA 2W11A 4YN4A 1BVSA 4FZMA 3RH5A 4M47A 4GXIA 3IHQB 4RQMA 2RQ5A 1KFTA 1O08A 2F1HA 8ICHA 9ICNA 2VKQA 4Z6EA 2JHDA 4K4GA 5EE1A 2K4HA 3HRDD 3H8JA 2PMZF 3PW4A 1NK5A 5IIOA 3BQ2A 3UXPA 2P6UA 5AM5A 4P4MA 3GZFA 4YD1A 3NRWA 5J0SA 2F76X 3MABA 5DBCA 3L3FX 4DOBA 5AKZA 2MAXA 1BPEA 4EBCA 1XWLA 3OJSA 8ICLA 5J8YC 4JMUA 3HJEA 4PGXA 5ALHA 2HHXA 2KMDA 2Q4TA 1TE2A 1P7DA 1RYRA 2DKXA 4PHDA 4C7YA 5EE9A 1A76A 3RR7A 4Y2UA 3A0HU 1L6NA 3ISDA 4DS4A 2KE7A 2WAQF 2YMQA 3IG5A 3S6JA 5HHHA 3SZ2A 5AKLA 5J2HA 3AUOA 9ICCA 1L3SA 5J29A 4ECZA 5DDMA 4ED6A 4DL7A 1L5UA 4MFAA 1GO3F 2KG5A 2FLNA 1RQNA 5KG7A 1ZQAA 4IR9A 4DFJA 1WCLA 4QZAA 3Q8KA 1ZQYA 5ALTA 1S77D 3UPQA 3SAFA 3CYMA 2W3SA 2G07A 3KTQA 4C4RA 5DKWA 4BWMA 3AQFA 5KFJA 3H40A 5IILA 3ZDBA 1A6SA 2A1AA 4O3OA 3MR3A 2HBJA 4YMOA 1ZQ1C 5F9LA 5AK6A 4AYBF 4MEXA 4MFFA 2W9AA 2YTUA 3MDAA 5AKKA 4XQ8A 3D2NA 3ZDDA 3LVVA 4ZOHC 4USAA 4DFDA 1BPYA 3RH4A 3F5EA 3T5JA 1ZRNA 3Q8SB 5ALZA 5KFEA 1SV0A 1QCKA 4J9RA 4C0ZA 4YMMA 4ECYA 4I2IA 2FLPA 1QLNA 1UA1A 1NK6A 2QARB 4YP3A 4RPYA 2KJ9A 4DQQA 5IIMA 4NV0A 5KFWA 4DL6A 4KLMA 3LYSA 4QJFB 2ZTDA 8ICKA 3JPNA 5KL8B 1VLBA 1UA0A 2KHVA 5KFDA 4EYIB 3WKCA 4ED3A 1Q46A 5J0UA 3IN5A 3SV4A 3C1YA 2BCQA 4F5NA 4TUSA 1QQ7A 1ZQOA 5CP2A 2QKQA 1JXEA 4Y2PA 2Q0ZX 4RQ5A 2HVHA 2V9WA 3K1ZA 3CNHA 4QWDA 5KNIA 3MFIA 1X66A 2VJ4A 4F91B 2OH2A 9ICHA 2FMPA 4O5CA 3BZCA 1SL1A 1X2IA 3T5HA 1KFSA 4TQSA 2EAPA 3OHAA 4AYBC 2LPEA 4UB5A 4HAIA 5L1JA 2YB1A 4CF5A 1J2NA 4YR3A 5ALEA 2XO7A 2C2EA 3MDCA 4J9LA 2BGWA 2JEFA 1C20A 1SKRA 4UBCA 1RQLA 4RQ8A 2E8PA 1ED1A 8ICYA 7ICRA 4F2RA 2W9CA 4F5RA 4I2CA 5J2FA 5KFNA 4TUPA 4O3SA 4ECXA 1ZQWA 3PZPA 1K5OA 1EXNA 4MFCA 3HKZF 2H3QA 4ED8A 4QWAA 1UHUA 3SR6A 1ZQNA 2NRTA 8ICFA 1RYUA 2XI9A 4M9LA 4F93B 2E8MA 5J2KA 4QWEA 2C28A 1NJZA 5AI5A 1ZQCA 5J2IA 1PK1A 3Q8PB 4GXKA 5CB1A 4KN7A 4Y2YA 4OJPA 4M9JA 2JEIA 3H4BA 2XY6A 5KFGA 3WKAA 2R18A 1LV5A 1RPLA 4LVSA 3WK8A 5KFRA 5JUMA 2ZXIA 3NASA 1N56A 2ZIWA 2K89A 3H0MB 2KZZA 2DF4B 2HOQA 2BHNA 1ZQMA 2AQ4A 1N5XA 3SD7A 3LK9A 2EQYA 2XGQA 3V7LA 2F3NA 2R8KA 1ZQLA 5KG2A 1XU4A 2MRLA 1JI7A 3IV6A 3FAHA 1NI3A 3QU2A 3AQEA 4YR0A 3GILA 1UT8A 1WCNA 2YMLA 3T3FA 1MC8A 4XUSA 2BPCA 5DQIA 5ALDA 2KKPA 3QU9A 5KFOA 2BPGA 2KVCA 1TAUA 1Z00B 1T7PA 5JRTA 2XY7A 7ICIA 5DG8A 9ICQA 3NVWA 2FPKA 3RB3A 2Y0SC 4DL2A 1B22A 1QSLA 1JROA 2BDPA 4IRDA 4DL4A 2H3FA 1KEJA 2HSZA 5HNKA 4R64A 1NK0A 2CN1A 2E1EA 3HKZC 4Z6FA 4ED0A 3ALRA 4DSKA 3WK4A 3CP8A 2K8BB 1KN5A 1OUQA 4P4OA 4DFKA 4UB3A 2KD1A 1LKYA 3ORYA 3BS5A 4NJ8A 3Q8LA 4OJOA 1T4GA 4EZ9A 1S0OA 4UB8U 3AMZA 1JXLA 4NLBA 3UQ0A 1BGXT 1HJPA 5ALMA 2HBLA 4JK1A 2G0AA 2NO5A 3H8WA 3FM9A 2KHQA 4LJXA 1XC9A 3OSNA 3RB4A 3EPIA 4UATA 2ASDA 2BR0A 5GTIU 4RQ6A 4I2DA 5ALNA 3TADC 2FE9A 5H2FU 3QEBZ 5L1KA 2WHEA 2B6GA 1XNSA 4M04A 3CRXA 8ICEA 3B0XA 3JPPA 3JPQA 5ALLA 3THVA 1ZETA 3KFUF 1SGGA 2E5SA 5IIKA 1SIJA 4TQRA 3RRHA 1QQ5A 3SYZA 3OGUA 1TK0A 2ES6A 4UASA 5FP0A 3PW5A 2EZXA 3OJUA 4RT3A 1TAQA 5KFYA 5KT5A 4RNOA 4JWNA 4C4TA 1SZPA 2HMXA 5EE0A 2E8OA 4DOAA 5DBBA 3C21A 1JX4A 3JPOA 4F4XA 4RQ1A 4US9A 4F5PA 1H38A 4PJ0U 4BXOA 2BCUA 3DV9A 4QZ9A 1NKBA 2ODGA 4BWJA 4ELUA 3PW2A 3QU7A 1WG8A 1FEZA 5ALXA 3MR5A 5DB6A 2ZIXB 3BQ1A 2KV2A 5L1MA 2F77X 4Y2TA 3C2LA 2H3VA 7ICPA 1ZD4A 5J2GA 3BJYA 5BPCA 4O0IA 3NVVA 2FLLA 2KZ3A 5D4BA 3V7JA 2PI5A 3T5LA 1PVPA 2BCRA 8ICZA 4QZ8A 4B9VA 3OTQA 1N63A 2ZIUB 4PZOA 3WKDA 4P4PA 1XO1A 4O5KA 3RBDA 4QZBA 8ICXA 1D8YA 2UVRA 1TFRA 1HUOA 2YMMA 3GIMA 3UMBA 4QZDA 5HMLA 4BJQA 7ICLA 4KLDA 5HR7A 1IV8A 3VCBA 2Y1JA 5C0YA 2KK0A 4RU9A 4NWIA 5KAIU 5KFTA 4IQUA 5KFZA 4P0PA 4Y2XA 4KTQA 1MN8A 2PFNA 1RM6C 5AM4A 2KFZA 9ICLA 3I76A 4P2HA 1B43A 5ALWA 3F2DA 1PK3A 4NLNA 1O03A 4DQIA 2B21A 2RP5A 2K4IA 2GWSA 5CWRA 2W7OA 3M8SA 2IMWP 3BS7A 4I2FA 4OD0A 3K1RB 4C7ZA 4PGYA 1KBUA 4DF8A 1Q3UA 5DLFA 2NRVA 3GDXA 3EZ5A 3QYPA 4J9KA 5K4LA 3HT3A 5T14A 3RJJA 2BQRA 3I1YA 2WTFA 4I2JA 3M9MB 4XA5A 4R63A 1TVAA 3BZKA 1ZQIA 2JH7A 4DL3A 2V4QA 1WWUA 3NVZA 1NK7A 1NZBA 2A19A 2WB1C 2OYYA 1ZXIA 1CEZA 4EBDA 2W43A 1DXSA 5BOMA 2FJ6A 4QWCA 2ZIVA 3ZD9A 4UB4A 2DFLA 3RJEA 1IM4A 1U47A 2W8KA 2JZBB 4FFDA 2QB0B 4QNLA 3AU6A 5AICA 4B9LA 2CPRA 4K4IA 1S9FA 3NRZA 8ICCA 4M6WA 4R8UA 2GLEA 2XC9A 4Q45A 3N4MB 1F44A 4KLSA 1N62A 3QZ8A 4PH5A 9ICMA 2EANA 5KG6A 4IL6U 1ZQUA 9ICAA 4NL9A 7ICGA 2HHTA 4RQ7A 2NRZA 4J03A 3HP6A 1ZQZA 4OJ5A 5DQGA 4E0DA 1NK9A 3ZDCA 2WF8A 1UPHA 1ZQGA 5AI0A 4JB3A 4JV0A 3RRGA 4GXJA 2HVIA 5J0WA 7ICQA 1S0NA 3PMNA 4QW9A 1JMSA 4C4SA 3TANA 1S0VA 2A1JB 1BNOA 3N7SC 3QEAZ 3RJGA 4YQWA 1V97A 2H5XA 3AU2A 2KFNA 3TFSA 2P66A 4P0QA 4US8A 1ZRMA 3TI0A 3RAXA 2Z7JA 3MFHA 2LYHA 3JPSA 3MR6A 4UQGA 1B0XA 2K4EA 3RAQA 4I2HA 4EBEA 4JWMA 1NJWA 4F4YA 3NVYA 3SEIA 4OO1J 5AM2A 1J2MA 1JUDA 1C7YA 2G06A 3BQ0A 2P35A 4NM2A 3AL0B 2HI0A 5AKIA 8ICGA 1RYSA 2FMQA 2D8CA 3V6KA 2ESEA 4NY8A 5DB8A 3IRUA 3QUCA 2YQEA 1T3QA 1YT3A 4RQ2A 3PX6A 1RXWA 5F3XB 2QLTA 2BDUA 4PGQA 3L5KA 2R8JA 4B9TA 2ZJAA 4QW8A 5J0RA 2D6FC 5AKHA 4I2EA 3PY8A 1CUKA 3QU5A 2XCAA 5ALFA 3HX0A 1SWVA 2W9BB 2AGQA 3ZI4A 3RBEA 2L5YA 3QUQA 3RJKA 1N60A 4AP9A 5ALKA 2FPLA 1QSYA 2OEHA 3C1ZA 1KDHA 2YB4A 4ED1A 3F5AA 1ZQEA 2JR5A 3LDAA 2HCFA 4UW9A 2GOLA 4XRHA 1KL9A 2DWQA 3IG8A 3LWLA 1OXJA 4J9SA 3NS1A 4DLGA 3JPTA 3MBYA 4C8NA 1U4BA 1ZQQA 5L1IA 3I28A 4DSLA 3WK9A 3F53A 1PZNA 2EAMA 4KLOA 2WF5A 2K60A 1L7OA 4ECRA 3M6ZA 1Z1BA 4YG2A 1Z00A 1D8BA 3GIIA 5DB7A 4O3NA 4DQPA 4YMNA 1ZQBA 4IQWA 3KHRA 2W55A 2Y0SF 4EX7A 1ZD3A 2W3RA 2F8LA 2R8IA 3TARA 3RB0A 4KLTA 3ED5A 1BPDA 5B5EU 2OXOA 2JEGA 5AI8A 1KRPA 2MU2A 1TK5A 7ICEA 1QH9A 2EH9A 4DSFA 3O0FA 3N97B 3KKAA 1L7PA 2N1RA 4YR2A 4BUGA 2VANA 3D2SA 9ICEA 2H3IA 8ICRA 1N61A 1XSLA 4QZCA 5KT7A 9ICBA 2KSOA 8ICOA 3HPOA 1S10A 1UCVA 8ICIA 5DG7A 4MHVA 5CHGA 2JEJA 4FO6A 2DQNB 4UAUA 1COKA 5IINA 1HUZA 5ALQA 2LYBA 7ICNA 2LBOA 1T8EA 3A0BU 1Z4OA 3F2CA 2VIXA 1HIWA 3EW9A 1ZQDA 2LM4A 3ICXA 4KMUA 1L3UA 3UXOA 4UBBA 4M9GA 3RJFA 1FFVA 1HEKA 1L8LA 3PMLA 4O9MA 1Z4NA 4DCCA 4EEYA 5AK3A 1D9FA 5DG9A
chains in the Genus database with same CATH topology
2ZXHA 2F76X 1CRXA 2Z7JA 4CRXA 1ED1A 4FZLA 4PL2A 5T14A 2H3FA 3L3FX 2OM6A 2K4EA 2G09A 2CN1A 2WAQC 3F5EA 3KZXA 2G5IB 1URJA 2E1EA 2G08A 3HKZC 1T94A 2KICA 4P0PB 2KIWA 4QIWF 2KEYA 3ALRA 3PZPA 2ZIXB 3PSPA 2JH7A 3HKZF 4JMUA 4OO1J 2H3QA 2XIDA 3CP8A 2KV2A 2E1FA 2K8BB 1OUQA 2F77X 2Q4TA 3SQIA 4C0ZA 3T79A 1SZHA 1WUDA 3C28A 1NZBA 2WB1C 2XI9A 2JGAA 5KL1B 1P7DA 3M6ZA 4OJ6A 1Z1BA 2G06A 3PSFA 2OYYA 3VC8A 2K8CB 4BX9C 4IC9A 2H3VA 1DRGA 3AL0B 4KMOB 2HOFA 1D8BA 2YX8A 2KD1A 3H0LB 1PVQA 3N7RC 2ZIVA 1ECWA 2KJ9A 2LKYA 5HR6A 3SAGA 4NV0A 1Q3VA 1L6NA 2Y0SF 3LYSA 4OJOA 4QJFB 2F8LA 5KL8B 2KJ5A 1PVPA 4QNLA 4WJ3B 4NLBA 4OJPA 2KHVA 2CPRA 2W04A 2M0NA 2WAQF 1YT3A 2ZIUB 3IG5A 5CRXA 2R18A 3MGVA 2LHTA 3RF9A 2HBLA 1F44A 4P0QB 2G0AA 2RRDA 2OXOA 2BDUA 4KX5A 1PVRA 2ZXIA 2G5HB 3IN5A 2KHQA 2D6FC 1TAMA 2ZIWA 3PSTA 2K89A 2ZG6A 2A3VA 2H3ZA 1A0PA 3H0MB 2W03A 2WB1F 2RHFA 3IP4B 2DF4B 4BJQA 4CGZA 4KX3A 2GH1A 2HOQA 3O0FA 3C29A 1GO3F 5HR7A 3VCBA 2N1RA 3E0FA 3LVWA 5C0YA 2MA1A 2PMZC 2KKVA 4OJ5A 4BUGA 3D2SA 2H3IA 2HBMA 3GU3A 4A8EA 4NWIA 1UPHA 1XNSA 3K1ZA 2YB4A 2DGZA 2K8AA 3F5AA 1IIPA 3SAHA 3CRXA 3KFUF 4FE3A 4FZMA 2DQNB 2E5SA 4P0PA 2VJ4A 2OH2A 3ONNA 2ZIUA 2LYAA 2ZIXA 3N7PD 4ICAA 2LYBA 1XO0A 2GOLA 2MRLA 2LBOA 2ZIVB 2JH1A 3RFAA 3SAFA 3F2CA 3CYMA 2VIXA 2G07A 3SMVA 1HIWA 4FZNA 2VKQA 1MA7A 3IG8A 3F2DA 2JHDA 2CRXA 3AQFA 2RP5A 3AQEA 2JMGA 3ICXA 2K4IA 2XVTA 3M7DA 1A6SA 3M6KA 2K4HA 4ACOA 4U6PA 2W7OA 2HMXA 4AYBC 4QIWC 2HOIA 2HBJA 1ZQ1C 1HEKA 3OPXA 4OJLA 2YB1A 4AYBF 3DEEA 3N7SC 4NLCA 2F2AB 2KKPA 3NUQA 1KBUA 2PMZF 3PSIA 4U7CA 4GFJA 2KVCA 2NV3A 3D2QA 2KJ8A 2KNJA 2ZIWB 3H0RB 2W7PA 2HBKA 1Q3UA 2XICA 2KOBA 5A0LA 3D2NA 4O3MA 1Z19A 4P0QA 3LVVA 3GZFA 3F53A 2VJ5A 3NRWA 4PL1A 2Y0SC 3F2BA 4CDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSP A;  2K8A A;  2K8C B;  3PST A;  2K8B B;  2K89 A;  3L3F X; 
#chains in the Genus database with same CATH topology
 3PR5 B;  2R8H A;  3N28 A;  1SL2 A;  1YZ7 A;  5KFH A;  4NM1 A;  2HHU A;  1SWW A;  5KG1 A;  2AHO B;  1NKE A;  2EZY A;  2KIC A;  3MC1 A;  9ICT A;  1J97 A;  4YVZ A;  2XID A;  4Y2V A;  2ZUB A;  3QUT A;  9ICU A;  5KL1 B;  4KLG A;  2AH5 A;  2HW3 A;  3C2K A;  2K8C B;  5ALP A;  3D6J A;  4QZF A;  3CW2 C;  3SAG A;  3M1Y A;  1NZP A;  2C22 A;  4I27 A;  3GQC A;  5L1L A;  2UVV A;  2I1Q A;  2ATL A;  2O6K A;  2W04 A;  4UAZ A;  3MGV A;  4KLQ A;  2F1J A;  2C2R A;  4NXZ A;  1SV0 C;  2NYV A;  4KX5 A;  1SXE A;  1TAM A;  5CJ7 A;  2A3V A;  3WK7 A;  2W9C B;  9ICR A;  2Y9T A;  1IG6 A;  3FDS A;  5AKE A;  5AI9 A;  5JU5 A;  3BDP A;  4CF3 A;  4EYH B;  3GU3 A;  4TUR A;  2DGZ A;  1QTM A;  5J0Q A;  1JIH A;  2XY5 A;  3NTU A;  2ZIU A;  2DUY A;  5AKG A;  4Y2J A;  2AGO A;  4C80 A;  4ECU A;  5AI6 A;  4YD2 A;  3M7D A;  3E58 A;  4B9M A;  8ICQ A;  3RR8 A;  9ICF A;  2JV3 A;  2Y9U A;  4PHE A;  4PPX A;  3OPX A;  4F4K A;  5J8Y A;  3C5G A;  4I2G A;  3B0Y A;  4O3R A;  4NLG A;  2ZIW B;  2IA6 A;  1Z19 A;  3TAC B;  1BPZ A;  2NRW A;  1S76 D;  1X6J A;  2VJ5 A;  2ZXH A;  4CRX A;  4QZG A;  2W9M A;  3QU4 A;  4DEZ A;  2AGP A;  3C2M A;  3KOO A;  4O3P A;  4RQ4 A;  5AKJ A;  1ZQF A;  2ISO A;  1UQV A;  1V85 A;  4J9M A;  3PSP A;  1N48 A;  4CF4 A;  2F44 A;  4IR1 A;  1S8O A;  5G5H A;  8ICS A;  8ICB A;  5ALY A;  4PHA A;  3TKA A;  8ICW A;  2MUT B;  4F71 A;  1ECW A;  1Q3V A;  5J0O A;  4TUQ A;  7ICK A;  2HDO A;  4RQ3 A;  1Z3E B;  3RH6 A;  5ALS A;  3KHL A;  4RPZ A;  2KN7 A;  4IQV A;  2J6S A;  2KIV A;  2RRD A;  2KZM A;  2RDI A;  1F5S A;  1VJ5 A;  3PW7 A;  5ALU A;  2W03 A;  2WB1 F;  1JAL A;  5KFX A;  1M6Y A;  2VA3 A;  2ZUC A;  2RLT A;  3QXG A;  1X9X A;  4DF4 A;  2YN4 A;  4GC6 A;  4F72 A;  1UT5 A;  4ECQ A;  2ZUD A;  5KFS A;  1WYG A;  5EOZ A;  3L4P A;  2LYA A;  3N7P D;  1LKY B;  1LVH A;  1NJY A;  3BS5 B;  4DO9 A;  1ZQJ A;  5J0X A;  5ALI A;  2KTQ A;  4NLC A;  3NUQ A;  5DBA A;  5KFU A;  1U9L A;  4R65 A;  3SV3 A;  1MSW D;  4F2S A;  2ALZ A;  1ZJM A;  4F8R A;  2XIC A;  2DBY A;  1AQ6 A;  3EWA A;  5AIB A;  1K1Q A;  1PUZ A;  2ZTE A;  4RUA A;  4CDG A;  4PHP A;  3PW0 A;  2PFP A;  2VA8 A;  2OM6 A;  4C8M A;  4X5V A;  3AN1 A;  4KLL A;  9ICS A;  2KIW A;  2DKZ A;  4F5O A;  5KFB A;  5J0P A;  8ICJ A;  5KG4 A;  1MQ3 A;  3SQI A;  3M8R A;  2BKE A;  1JN3 A;  5HR6 A;  1K1S A;  9ICV A;  2EDU A;  4DWI A;  4RNN A;  4NLK A;  5AM1 A;  3ETL A;  4JUZ A;  2AJQ A;  3DDH A;  4Q44 A;  4BXO B;  3EYZ A;  4F4W A;  2M0N A;  3BQT A;  9ICI A;  4BDP A;  1U49 A;  2LHT A;  3RF9 A;  5CR0 A;  1L7N A;  4UB2 A;  3PX4 A;  3PO4 A;  4J9P A;  4B6J A;  3LWM A;  3IM1 A;  2BQU A;  2IOF A;  2ASL A;  3RTV A;  7ICV A;  2WF9 A;  2GH1 A;  4UAY A;  2B0C A;  4KLU A;  4I2A A;  4A8E A;  9ICO A;  4KLJ A;  2LM1 A;  4I28 A;  3TQ1 A;  2K8A A;  1IIP A;  3EPG A;  1NKC A;  4KLI A;  3UMG A;  5J2C A;  1NOM A;  2ZTC A;  4ZH4 A;  2QAR A;  4Z6D A;  5AK4 A;  4MF2 A;  4FBT A;  4QIW C;  2HOI A;  2W9B A;  3Q8R B;  2DPI A;  2FDR A;  8ICA A;  7ICS A;  3G6X A;  4F4Z A;  1LB2 B;  3PSI A;  4GFJ A;  1ZJN A;  4Z6C A;  2LI6 A;  2KJ8 A;  1X9M A;  4DSJ A;  5KG5 A;  1FIQ A;  3H0R B;  2W7P A;  5III A;  5BOL A;  3H4D A;  3SI8 A;  1VDV A;  4CNQ A;  4PL1 A;  3F2B A;  1XSN A;  1D8L A;  3MGH A;  4GIB A;  3J81 j;  5DDY A;  1SV4 A;  4ECS A;  4EEL A;  5CA7 A;  2E8N A;  4UB6 U;  1X9S A;  2OWO A;  2IOH A;  4KN4 A;  4Y2Q A;  4B9U A;  4P0P B;  1FO4 A;  3WK5 A;  4NLZ A;  2BQ3 A;  4DS5 A;  3T79 A;  4OJ6 A;  5KT3 A;  2D3D A;  1ZQH A;  5DLG A;  4RQ0 A;  3H0L B;  1PVQ A;  2K4P A;  1X6I A;  2ISP A;  8ICM A;  1NJX A;  1KW4 A;  1NK4 A;  4KLH A;  4EZ6 A;  8ICP A;  5CRX A;  5ALR A;  4YCX A;  1RXV A;  1QSS A;  1PVR A;  4F5Q A;  5EWG A;  4ECW A;  3ZDA A;  3V6H A;  2RDJ A;  2UVU A;  2FPM A;  1L7M A;  4B9S A;  5HHI A;  4Q8F A;  3K4G A;  2LMR A;  3KD3 A;  1RZT A;  4ECV A;  1A0P A;  4ED2 A;  5J2B A;  4B9N A;  2FMS A;  3C29 A;  4RZR A;  4G3I A;  2MA1 A;  3GFK B;  2PMZ C;  5EWE A;  1ZQX A;  2IHN A;  5ALO A;  2JRZ A;  8ICU A;  4RT2 A;  3KHH A;  3C23 A;  2ZJ5 A;  1ZD2 P;  2P6R A;  4DLE A;  3ONN A;  4ICA A;  2ZIV B;  3RFA A;  4J9O A;  4CE6 A;  5J2D A;  5KG0 A;  5F9N A;  4K4H A;  1D9D A;  2CRX A;  4DOC A;  2JMG A;  2XVT A;  4O3Q A;  5DGA A;  3H7I A;  3ISB A;  5KT6 A;  4M6W B;  4R8U B;  1ZYQ A;  5JTI A;  3DEE A;  1U48 A;  2F2A B;  4UAR A;  4ECT A;  1ZQV A;  2YY6 A;  2KNJ A;  4OCZ A;  3ETR A;  3GV8 B;  2HBK A;  2J6U A;  2PKE A;  7ICH A;  5AM3 A;  1WWV A;  4O3M A;  3E2E A;  3OSP A;  3QE9 Y;  2E3T A;  3PV8 A;  1CRX A;  2HHW A;  3V7K A;  5EWF A;  9ICJ A;  2WF6 A;  3IDW A;  3M9O B;  2WAQ C;  3WKE A;  1ZQT A;  4IQT A;  7ICM A;  2G08 A;  5J2E A;  4HYK A;  2W54 A;  1KLN A;  3PNC A;  7ICJ A;  3AM9 A;  5ALV A;  4ELT A;  4RNM A;  1YZ6 A;  4UB1 A;  1DGS A;  3C28 A;  1Q8K A;  4JV2 A;  2I6X A;  3PSF A;  1Z1V A;  4Y2R A;  3TAD A;  2MSN A;  5KFF A;  3C5F A;  2LKY A;  2F8K A;  3QX7 A;  4GLX A;  5G5G A;  5CEH A;  1ZQR A;  5AK5 A;  2KVS A;  4P0Q B;  1DK2 A;  4F3O A;  2W8L A;  3G6V A;  3B9J A;  4G9B A;  2H3Z A;  3IP4 B;  1L3V A;  4R66 A;  5KTQ A;  5D46 A;  3QZ7 A;  1S0M A;  1FFU A;  1KQQ A;  3LVW A;  3T5K A;  4JV1 A;  2NRX A;  5DQH A;  1ZD5 A;  2HBM A;  2C2D A;  1SB3 C;  5C5J A;  1N2X A;  2PXI A;  3GIJ A;  3Q8M A;  3BQ7 A;  2UVW A;  4QZI A;  4I29 A;  3KZI U;  1X42 A;  4GC7 A;  1NNL A;  2BZF A;  1XSP A;  2QB1 A;  3SMV A;  2F1I A;  5ALJ A;  3GV7 B;  2AQ0 A;  5KFP A;  2EAO A;  4NL9 C;  4OJL A;  1JRP A;  2BCV A;  1ZQK A;  3G6Y A;  4KLE A;  3NGD A;  4C8L A;  4KLF A;  3PR4 A;  4C8O A;  4F50 A;  3TAP A;  2PFO A;  3FC4 A;  4I2B A;  1OW5 A;  2OHF A;  4M2Y A;  5EE3 A;  5KG3 A;  3HWT A;  1ZQS A;  2G09 A;  1SL0 A;  3Q8Q B;  3K75 D;  1CI4 A;  1T94 A;  9ICK A;  4PZN A;  3RJH A;  4RQN A;  2I9G A;  5KFC A;  1N5W A;  4DSE A;  2E1F A;  5HMM A;  9ICW A;  1SZH A;  3PVX A;  4YFK A;  3M9N B;  3UQ2 A;  1DRG A;  2EZZ A;  5KFL A;  3N7R C;  3WK6 A;  1DOQ A;  2M9N A;  3RB6 A;  4J9Q A;  1BNP A;  3OHB A;  3HIL A;  3GV5 B;  1KFD A;  3V72 A;  1S97 A;  5TZV A;  2HHV A;  5J0Y A;  4QWB A;  5DB9 A;  5KFA A;  3TAQ A;  4IRK A;  4QZH A;  3U26 A;  1TKD A;  1MQ2 A;  2ZG6 A;  5KFV A;  4C8K A;  4CGZ A;  2MUT A;  3HW8 A;  7ICU A;  3E0F A;  5AKX A;  5KFQ A;  2DL0 A;  4DQS A;  2GO7 A;  2HHQ A;  3GIK A;  3KBB A;  3SAH A;  1DGJ A;  1RDF A;  5E79 U;  2ZIX A;  5KFM A;  4F92 B;  4J9N A;  4YXM A;  4FZN A;  3PO5 A;  1A77 A;  1IXR A;  2AXT U;  4UAW A;  4LZD A;  2OCE A;  4ACO A;  5KFK A;  4KIT B;  5TIS U;  1V9P A;  3UM9 A;  1U45 A;  5DGB A;  1X40 A;  1B4F A;  2NO4 A;  4U7C A;  4CCH A;  5AM0 A;  4M0A A;  2HHS A;  5KFI A;  4UAV A;  1BPX A;  5A0L A;  3WKB A;  7ICF A;  3RJI A;  4RPX A;  4FS1 A;  1PK1 B;  5AKY A;  2XGP A;  4LZG A;  8ICV A;  4PL2 A;  3WU2 U;  1S5L U;  5B66 U;  5J2A A;  3KHG A;  2FI1 A;  5J2J A;  2KSO B;  3KZX A;  4FBU A;  2G5I B;  1URJ A;  1SXD A;  9ICX A;  2KEY A;  4IRC A;  5AHX A;  4RUC A;  3TFR A;  2JGA A;  4EEN A;  1TK8 A;  1ZQP A;  1L3T A;  3JPR A;  4IS7 A;  1RG6 A;  2BPF A;  2KJ5 A;  2I5H A;  4DQR A;  3QUB A;  3FYH A;  9ICP A;  4FS2 A;  3MGI A;  9ICG A;  2AU0 A;  3PST A;  4DFP A;  3SEN A;  4EEK A;  5D49 A;  1SKW A;  2J6T A;  4Q43 A;  2IOF K;  4MF8 A;  5J0T A;  2KKV A;  1KTQ A;  2CXY A;  3ZD8 A;  2YMP A;  4M9H A;  4FE3 A;  1ZOL A;  4ELV A;  1XO0 A;  2JH1 A;  1BPB A;  1SKS A;  2ASJ A;  1MA7 A;  1NK8 A;  2ZJ8 A;  3M6K A;  4U6P A;  5KAF U;  1DK3 A;  4MEY A;  2JZB A;  3KKA C;  2R8G A;  1X9W A;  7ICO A;  1L8O A;  2KP7 A;  3V6J A;  2QB0 A;  1KSP A;  8ICN A;  2PFQ A;  2NV3 A;  3D2Q A;  4BGD A;  2DPJ A;  2KOB A;  4DSI A;  3PX0 A;  4Q8E A;  5IIJ A;  3H8S A;  4YXJ A;  1XS9 D;  1TV9 A;  4DL5 A;  4FZL A;  1T3N A;  2WF7 A;  2WFA A;  2IBK A;  4Y2S A;  4ED7 A;  4QIW F;  3R9K A;  8ICT A;  1WUD A;  1F0M A;  3VC8 A;  4BX9 C;  4IC9 A;  2VA2 A;  4KMO B;  2HOF A;  2IHM A;  2YX8 A;  5GTH U;  1QQ6 A;  3QNM A;  2XCP A;  2Y1I A;  5KT2 A;  4DFM A;  4WJ3 B;  1ARO P;  3EUB 2;  4QZE A;  5HP4 A;  3H8M A;  1KKX A;  5AI4 A;  2A1J A;  4O5E A;  2JXJ A;  5AIA A;  2PI4 A;  3UXN A;  2G5H B;  5L9X A;  5ALG A;  7ICT A;  1Y88 A;  3AEV A;  2BCS A;  2RHF A;  3UMC A;  3ISC A;  4M9N A;  4KX3 A;  5KT4 A;  1V38 A;  3MR2 A;  1COO A;  3ZDE A;  4EX6 A;  2V4R A;  2W11 A;  4YN4 A;  1BVS A;  4FZM A;  3RH5 A;  4M47 A;  4GXI A;  3IHQ B;  4RQM A;  2RQ5 A;  1KFT A;  1O08 A;  2F1H A;  8ICH A;  9ICN A;  2VKQ A;  4Z6E A;  2JHD A;  4K4G A;  5EE1 A;  2K4H A;  3HRD D;  3H8J A;  2PMZ F;  3PW4 A;  1NK5 A;  5IIO A;  3BQ2 A;  3UXP A;  2P6U A;  5AM5 A;  4P4M A;  3GZF A;  4YD1 A;  3NRW A;  5J0S A;  2F76 X;  3MAB A;  5DBC A;  3L3F X;  4DOB A;  5AKZ A;  2MAX A;  1BPE A;  4EBC A;  1XWL A;  3OJS A;  8ICL A;  5J8Y C;  4JMU A;  3HJE A;  4PGX A;  5ALH A;  2HHX A;  2KMD A;  2Q4T A;  1TE2 A;  1P7D A;  1RYR A;  2DKX A;  4PHD A;  4C7Y A;  5EE9 A;  1A76 A;  3RR7 A;  4Y2U A;  3A0H U;  1L6N A;  3ISD A;  4DS4 A;  2KE7 A;  2WAQ F;  2YMQ A;  3IG5 A;  3S6J A;  5HHH A;  3SZ2 A;  5AKL A;  5J2H A;  3AUO A;  9ICC A;  1L3S A;  5J29 A;  4ECZ A;  5DDM A;  4ED6 A;  4DL7 A;  1L5U A;  4MFA A;  1GO3 F;  2KG5 A;  2FLN A;  1RQN A;  5KG7 A;  1ZQA A;  4IR9 A;  4DFJ A;  1WCL A;  4QZA A;  3Q8K A;  1ZQY A;  5ALT A;  1S77 D;  3UPQ A;  3SAF A;  3CYM A;  2W3S A;  2G07 A;  3KTQ A;  4C4R A;  5DKW A;  4BWM A;  3AQF A;  5KFJ A;  3H40 A;  5IIL A;  3ZDB A;  1A6S A;  2A1A A;  4O3O A;  3MR3 A;  2HBJ A;  4YMO A;  1ZQ1 C;  5F9L A;  5AK6 A;  4AYB F;  4MEX A;  4MFF A;  2W9A A;  2YTU A;  3MDA A;  5AKK A;  4XQ8 A;  3D2N A;  3ZDD A;  3LVV A;  4ZOH C;  4USA A;  4DFD A;  1BPY A;  3RH4 A;  3F5E A;  3T5J A;  1ZRN A;  3Q8S B;  5ALZ A;  5KFE A;  1SV0 A;  1QCK A;  4J9R A;  4C0Z A;  4YMM A;  4ECY A;  4I2I A;  2FLP A;  1QLN A;  1UA1 A;  1NK6 A;  2QAR B;  4YP3 A;  4RPY A;  2KJ9 A;  4DQQ A;  5IIM A;  4NV0 A;  5KFW A;  4DL6 A;  4KLM A;  3LYS A;  4QJF B;  2ZTD A;  8ICK A;  3JPN A;  5KL8 B;  1VLB A;  1UA0 A;  2KHV A;  5KFD A;  4EYI B;  3WKC A;  4ED3 A;  1Q46 A;  5J0U A;  3IN5 A;  3SV4 A;  3C1Y A;  2BCQ A;  4F5N A;  4TUS A;  1QQ7 A;  1ZQO A;  5CP2 A;  2QKQ A;  1JXE A;  4Y2P A;  2Q0Z X;  4RQ5 A;  2HVH A;  2V9W A;  3K1Z A;  3CNH A;  4QWD A;  5KNI A;  3MFI A;  1X66 A;  2VJ4 A;  4F91 B;  2OH2 A;  9ICH A;  2FMP A;  4O5C A;  3BZC A;  1SL1 A;  1X2I A;  3T5H A;  1KFS A;  4TQS A;  2EAP A;  3OHA A;  4AYB C;  2LPE A;  4UB5 A;  4HAI A;  5L1J A;  2YB1 A;  4CF5 A;  1J2N A;  4YR3 A;  5ALE A;  2XO7 A;  2C2E A;  3MDC A;  4J9L A;  2BGW A;  2JEF A;  1C20 A;  1SKR A;  4UBC A;  1RQL A;  4RQ8 A;  2E8P A;  1ED1 A;  8ICY A;  7ICR A;  4F2R A;  2W9C A;  4F5R A;  4I2C A;  5J2F A;  5KFN A;  4TUP A;  4O3S A;  4ECX A;  1ZQW A;  3PZP A;  1K5O A;  1EXN A;  4MFC A;  3HKZ F;  2H3Q A;  4ED8 A;  4QWA A;  1UHU A;  3SR6 A;  1ZQN A;  2NRT A;  8ICF A;  1RYU A;  2XI9 A;  4M9L A;  4F93 B;  2E8M A;  5J2K A;  4QWE A;  2C28 A;  1NJZ A;  5AI5 A;  1ZQC A;  5J2I A;  1PK1 A;  3Q8P B;  4GXK A;  5CB1 A;  4KN7 A;  4Y2Y A;  4OJP A;  4M9J A;  2JEI A;  3H4B A;  2XY6 A;  5KFG A;  3WKA A;  2R18 A;  1LV5 A;  1RPL A;  4LVS A;  3WK8 A;  5KFR A;  5JUM A;  2ZXI A;  3NAS A;  1N56 A;  2ZIW A;  2K89 A;  3H0M B;  2KZZ A;  2DF4 B;  2HOQ A;  2BHN A;  1ZQM A;  2AQ4 A;  1N5X A;  3SD7 A;  3LK9 A;  2EQY A;  2XGQ A;  3V7L A;  2F3N A;  2R8K A;  1ZQL A;  5KG2 A;  1XU4 A;  2MRL A;  1JI7 A;  3IV6 A;  3FAH A;  1NI3 A;  3QU2 A;  3AQE A;  4YR0 A;  3GIL A;  1UT8 A;  1WCN A;  2YML A;  3T3F A;  1MC8 A;  4XUS A;  2BPC A;  5DQI A;  5ALD A;  2KKP A;  3QU9 A;  5KFO A;  2BPG A;  2KVC A;  1TAU A;  1Z00 B;  1T7P A;  5JRT A;  2XY7 A;  7ICI A;  5DG8 A;  9ICQ A;  3NVW A;  2FPK A;  3RB3 A;  2Y0S C;  4DL2 A;  1B22 A;  1QSL A;  1JRO A;  2BDP A;  4IRD A;  4DL4 A;  2H3F A;  1KEJ A;  2HSZ A;  5HNK A;  4R64 A;  1NK0 A;  2CN1 A;  2E1E A;  3HKZ C;  4Z6F A;  4ED0 A;  3ALR A;  4DSK A;  3WK4 A;  3CP8 A;  2K8B B;  1KN5 A;  1OUQ A;  4P4O A;  4DFK A;  4UB3 A;  2KD1 A;  1LKY A;  3ORY A;  3BS5 A;  4NJ8 A;  3Q8L A;  4OJO A;  1T4G A;  4EZ9 A;  1S0O A;  4UB8 U;  3AMZ A;  1JXL A;  4NLB A;  3UQ0 A;  1BGX T;  1HJP A;  5ALM A;  2HBL A;  4JK1 A;  2G0A A;  2NO5 A;  3H8W A;  3FM9 A;  2KHQ A;  4LJX A;  1XC9 A;  3OSN A;  3RB4 A;  3EPI A;  4UAT A;  2ASD A;  2BR0 A;  5GTI U;  4RQ6 A;  4I2D A;  5ALN A;  3TAD C;  2FE9 A;  5H2F U;  3QEB Z;  5L1K A;  2WHE A;  2B6G A;  1XNS A;  4M04 A;  3CRX A;  8ICE A;  3B0X A;  3JPP A;  3JPQ A;  5ALL A;  3THV A;  1ZET A;  3KFU F;  1SGG A;  2E5S A;  5IIK A;  1SIJ A;  4TQR A;  3RRH A;  1QQ5 A;  3SYZ A;  3OGU A;  1TK0 A;  2ES6 A;  4UAS A;  5FP0 A;  3PW5 A;  2EZX A;  3OJU A;  4RT3 A;  1TAQ A;  5KFY A;  5KT5 A;  4RNO A;  4JWN A;  4C4T A;  1SZP A;  2HMX A;  5EE0 A;  2E8O A;  4DOA A;  5DBB A;  3C21 A;  1JX4 A;  3JPO A;  4F4X A;  4RQ1 A;  4US9 A;  4F5P A;  1H38 A;  4PJ0 U;  4BXO A;  2BCU A;  3DV9 A;  4QZ9 A;  1NKB A;  2ODG A;  4BWJ A;  4ELU A;  3PW2 A;  3QU7 A;  1WG8 A;  1FEZ A;  5ALX A;  3MR5 A;  5DB6 A;  2ZIX B;  3BQ1 A;  2KV2 A;  5L1M A;  2F77 X;  4Y2T A;  3C2L A;  2H3V A;  7ICP A;  1ZD4 A;  5J2G A;  3BJY A;  5BPC A;  4O0I A;  3NVV A;  2FLL A;  2KZ3 A;  5D4B A;  3V7J A;  2PI5 A;  3T5L A;  1PVP A;  2BCR A;  8ICZ A;  4QZ8 A;  4B9V A;  3OTQ A;  1N63 A;  2ZIU B;  4PZO A;  3WKD A;  4P4P A;  1XO1 A;  4O5K A;  3RBD A;  4QZB A;  8ICX A;  1D8Y A;  2UVR A;  1TFR A;  1HUO A;  2YMM A;  3GIM A;  3UMB A;  4QZD A;  5HML A;  4BJQ A;  7ICL A;  4KLD A;  5HR7 A;  1IV8 A;  3VCB A;  2Y1J A;  5C0Y A;  2KK0 A;  4RU9 A;  4NWI A;  5KAI U;  5KFT A;  4IQU A;  5KFZ A;  4P0P A;  4Y2X A;  4KTQ A;  1MN8 A;  2PFN A;  1RM6 C;  5AM4 A;  2KFZ A;  9ICL A;  3I76 A;  4P2H A;  1B43 A;  5ALW A;  3F2D A;  1PK3 A;  4NLN A;  1O03 A;  4DQI A;  2B21 A;  2RP5 A;  2K4I A;  2GWS A;  5CWR A;  2W7O A;  3M8S A;  2IMW P;  3BS7 A;  4I2F A;  4OD0 A;  3K1R B;  4C7Z A;  4PGY A;  1KBU A;  4DF8 A;  1Q3U A;  5DLF A;  2NRV A;  3GDX A;  3EZ5 A;  3QYP A;  4J9K A;  5K4L A;  3HT3 A;  5T14 A;  3RJJ A;  2BQR A;  3I1Y A;  2WTF A;  4I2J A;  3M9M B;  4XA5 A;  4R63 A;  1TVA A;  3BZK A;  1ZQI A;  2JH7 A;  4DL3 A;  2V4Q A;  1WWU A;  3NVZ A;  1NK7 A;  1NZB A;  2A19 A;  2WB1 C;  2OYY A;  1ZXI A;  1CEZ A;  4EBD A;  2W43 A;  1DXS A;  5BOM A;  2FJ6 A;  4QWC A;  2ZIV A;  3ZD9 A;  4UB4 A;  2DFL A;  3RJE A;  1IM4 A;  1U47 A;  2W8K A;  2JZB B;  4FFD A;  2QB0 B;  4QNL A;  3AU6 A;  5AIC A;  4B9L A;  2CPR A;  4K4I A;  1S9F A;  3NRZ A;  8ICC A;  4M6W A;  4R8U A;  2GLE A;  2XC9 A;  4Q45 A;  3N4M B;  1F44 A;  4KLS A;  1N62 A;  3QZ8 A;  4PH5 A;  9ICM A;  2EAN A;  5KG6 A;  4IL6 U;  1ZQU A;  9ICA A;  4NL9 A;  7ICG A;  2HHT A;  4RQ7 A;  2NRZ A;  4J03 A;  3HP6 A;  1ZQZ A;  4OJ5 A;  5DQG A;  4E0D A;  1NK9 A;  3ZDC A;  2WF8 A;  1UPH A;  1ZQG A;  5AI0 A;  4JB3 A;  4JV0 A;  3RRG A;  4GXJ A;  2HVI A;  5J0W A;  7ICQ A;  1S0N A;  3PMN A;  4QW9 A;  1JMS A;  4C4S A;  3TAN A;  1S0V A;  2A1J B;  1BNO A;  3N7S C;  3QEA Z;  3RJG A;  4YQW A;  1V97 A;  2H5X A;  3AU2 A;  2KFN A;  3TFS A;  2P66 A;  4P0Q A;  4US8 A;  1ZRM A;  3TI0 A;  3RAX A;  2Z7J A;  3MFH A;  2LYH A;  3JPS A;  3MR6 A;  4UQG A;  1B0X A;  2K4E A;  3RAQ A;  4I2H A;  4EBE A;  4JWM A;  1NJW A;  4F4Y A;  3NVY A;  3SEI A;  4OO1 J;  5AM2 A;  1J2M A;  1JUD A;  1C7Y A;  2G06 A;  3BQ0 A;  2P35 A;  4NM2 A;  3AL0 B;  2HI0 A;  5AKI A;  8ICG A;  1RYS A;  2FMQ A;  2D8C A;  3V6K A;  2ESE A;  4NY8 A;  5DB8 A;  3IRU A;  3QUC A;  2YQE A;  1T3Q A;  1YT3 A;  4RQ2 A;  3PX6 A;  1RXW A;  5F3X B;  2QLT A;  2BDU A;  4PGQ A;  3L5K A;  2R8J A;  4B9T A;  2ZJA A;  4QW8 A;  5J0R A;  2D6F C;  5AKH A;  4I2E A;  3PY8 A;  1CUK A;  3QU5 A;  2XCA A;  5ALF A;  3HX0 A;  1SWV A;  2W9B B;  2AGQ A;  3ZI4 A;  3RBE A;  2L5Y A;  3QUQ A;  3RJK A;  1N60 A;  4AP9 A;  5ALK A;  2FPL A;  1QSY A;  2OEH A;  3C1Z A;  1KDH A;  2YB4 A;  4ED1 A;  3F5A A;  1ZQE A;  2JR5 A;  3LDA A;  2HCF A;  4UW9 A;  2GOL A;  4XRH A;  1KL9 A;  2DWQ A;  3IG8 A;  3LWL A;  1OXJ A;  4J9S A;  3NS1 A;  4DLG A;  3JPT A;  3MBY A;  4C8N A;  1U4B A;  1ZQQ A;  5L1I A;  3I28 A;  4DSL A;  3WK9 A;  3F53 A;  1PZN A;  2EAM A;  4KLO A;  2WF5 A;  2K60 A;  1L7O A;  4ECR A;  3M6Z A;  1Z1B A;  4YG2 A;  1Z00 A;  1D8B A;  3GII A;  5DB7 A;  4O3N A;  4DQP A;  4YMN A;  1ZQB A;  4IQW A;  3KHR A;  2W55 A;  2Y0S F;  4EX7 A;  1ZD3 A;  2W3R A;  2F8L A;  2R8I A;  3TAR A;  3RB0 A;  4KLT A;  3ED5 A;  1BPD A;  5B5E U;  2OXO A;  2JEG A;  5AI8 A;  1KRP A;  2MU2 A;  1TK5 A;  7ICE A;  1QH9 A;  2EH9 A;  4DSF A;  3O0F A;  3N97 B;  3KKA A;  1L7P A;  2N1R A;  4YR2 A;  4BUG A;  2VAN A;  3D2S A;  9ICE A;  2H3I A;  8ICR A;  1N61 A;  1XSL A;  4QZC A;  5KT7 A;  9ICB A;  2KSO A;  8ICO A;  3HPO A;  1S10 A;  1UCV A;  8ICI A;  5DG7 A;  4MHV A;  5CHG A;  2JEJ A;  4FO6 A;  2DQN B;  4UAU A;  1COK A;  5IIN A;  1HUZ A;  5ALQ A;  2LYB A;  7ICN A;  2LBO A;  1T8E A;  3A0B U;  1Z4O A;  3F2C A;  2VIX A;  1HIW A;  3EW9 A;  1ZQD A;  2LM4 A;  3ICX A;  4KMU A;  1L3U A;  3UXO A;  4UBB A;  4M9G A;  3RJF A;  1FFV A;  1HEK A;  1L8L A;  3PML A;  4O9M A;  1Z4N A;  4DCC A;  4EEY A;  5AK3 A;  1D9F A;  5DG9 A; 
#chains in the Genus database with same CATH homology
 2ZXH A;  2F76 X;  1CRX A;  2Z7J A;  4CRX A;  1ED1 A;  4FZL A;  4PL2 A;  5T14 A;  2H3F A;  3L3F X;  2OM6 A;  2K4E A;  2G09 A;  2CN1 A;  2WAQ C;  3F5E A;  3KZX A;  2G5I B;  1URJ A;  2E1E A;  2G08 A;  3HKZ C;  1T94 A;  2KIC A;  4P0P B;  2KIW A;  4QIW F;  2KEY A;  3ALR A;  3PZP A;  2ZIX B;  3PSP A;  2JH7 A;  3HKZ F;  4JMU A;  4OO1 J;  2H3Q A;  2XID A;  3CP8 A;  2KV2 A;  2E1F A;  2K8B B;  1OUQ A;  2F77 X;  2Q4T A;  3SQI A;  4C0Z A;  3T79 A;  1SZH A;  1WUD A;  3C28 A;  1NZB A;  2WB1 C;  2XI9 A;  2JGA A;  5KL1 B;  1P7D A;  3M6Z A;  4OJ6 A;  1Z1B A;  2G06 A;  3PSF A;  2OYY A;  3VC8 A;  2K8C B;  4BX9 C;  4IC9 A;  2H3V A;  1DRG A;  3AL0 B;  4KMO B;  2HOF A;  1D8B A;  2YX8 A;  2KD1 A;  3H0L B;  1PVQ A;  3N7R C;  2ZIV A;  1ECW A;  2KJ9 A;  2LKY A;  5HR6 A;  3SAG A;  4NV0 A;  1Q3V A;  1L6N A;  2Y0S F;  3LYS A;  4OJO A;  4QJF B;  2F8L A;  5KL8 B;  2KJ5 A;  1PVP A;  4QNL A;  4WJ3 B;  4NLB A;  4OJP A;  2KHV A;  2CPR A;  2W04 A;  2M0N A;  2WAQ F;  1YT3 A;  2ZIU B;  3IG5 A;  5CRX A;  2R18 A;  3MGV A;  2LHT A;  3RF9 A;  2HBL A;  1F44 A;  4P0Q B;  2G0A A;  2RRD A;  2OXO A;  2BDU A;  4KX5 A;  1PVR A;  2ZXI A;  2G5H B;  3IN5 A;  2KHQ A;  2D6F C;  1TAM A;  2ZIW A;  3PST A;  2K89 A;  2ZG6 A;  2A3V A;  2H3Z A;  1A0P A;  3H0M B;  2W03 A;  2WB1 F;  2RHF A;  3IP4 B;  2DF4 B;  4BJQ A;  4CGZ A;  4KX3 A;  2GH1 A;  2HOQ A;  3O0F A;  3C29 A;  1GO3 F;  5HR7 A;  3VCB A;  2N1R A;  3E0F A;  3LVW A;  5C0Y A;  2MA1 A;  2PMZ C;  2KKV A;  4OJ5 A;  4BUG A;  3D2S A;  2H3I A;  2HBM A;  3GU3 A;  4A8E A;  4NWI A;  1UPH A;  1XNS A;  3K1Z A;  2YB4 A;  2DGZ A;  2K8A A;  3F5A A;  1IIP A;  3SAH A;  3CRX A;  3KFU F;  4FE3 A;  4FZM A;  2DQN B;  2E5S A;  4P0P A;  2VJ4 A;  2OH2 A;  3ONN A;  2ZIU A;  2LYA A;  2ZIX A;  3N7P D;  4ICA A;  2LYB A;  1XO0 A;  2GOL A;  2MRL A;  2LBO A;  2ZIV B;  2JH1 A;  3RFA A;  3SAF A;  3F2C A;  3CYM A;  2VIX A;  2G07 A;  3SMV A;  1HIW A;  4FZN A;  2VKQ A;  1MA7 A;  3IG8 A;  3F2D A;  2JHD A;  2CRX A;  3AQF A;  2RP5 A;  3AQE A;  2JMG A;  3ICX A;  2K4I A;  2XVT A;  3M7D A;  1A6S A;  3M6K A;  2K4H A;  4ACO A;  4U6P A;  2W7O A;  2HMX A;  4AYB C;  4QIW C;  2HOI A;  2HBJ A;  1ZQ1 C;  1HEK A;  3OPX A;  4OJL A;  2YB1 A;  4AYB F;  3DEE A;  3N7S C;  4NLC A;  2F2A B;  2KKP A;  3NUQ A;  1KBU A;  2PMZ F;  3PSI A;  4U7C A;  4GFJ A;  2KVC A;  2NV3 A;  3D2Q A;  2KJ8 A;  2KNJ A;  2ZIW B;  3H0R B;  2W7P A;  2HBK A;  1Q3U A;  2XIC A;  2KOB A;  5A0L A;  3D2N A;  4O3M A;  1Z19 A;  4P0Q A;  3LVV A;  3GZF A;  3F53 A;  2VJ5 A;  3NRW A;  4PL1 A;  2Y0S C;  3F2B A;  4CDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...