2K8AA

Solution structure of a novel ubiquitin-binding domain from human plaa (pfuc, gly76-pro77 trans isomer)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phospholipase A-2-activating protein
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8aA00
2K8BB 2K89A 3PSTA 3PSPA 3L3FX 2K8CB 2K8AA
chains in the Genus database with same CATH superfamily
2LM1A 3ICXA 3VCBA 5G5HA 4KLUA 1QLNA 5DB7A 5KT6A 1JIHA 3NVVA 2F3NA 5J0SA 1ZJNA 3GIIA 2WFAA 4PL2A 4PL1A 5KG7A 4K4GA 5AM0A 4O3OA 4TQSA 3NVZA 2HBMA 3SAHA 2FE9A 1RQLA 3QUTA 1UHUA 1T3NA 2C2EA 4J9KA 4KLIA 4UAUA 4OJ5A 3WK8A 4C7ZA 5ALWA 3T5JA 4NLKA 3C1YA 3SZ2A 4O0IA 5KAFU 4RUAA 5IILA 4PGYA 4I2IA 4J9LA 2NO5A 1N2XA 4Q8EA 4LVSA 1PK3A 1UT5A 2BGWA 2ZIXA 4EEKA 2D8CA 5KFYA 4IRKA 3ISDA 2W43A 4ED1A 4J9SA 1NJXA 2JEFA 1KKXA 4NM2A 3ZDDA 3RJGA 2JR5A 1V97A 4Y2XA 5ALTA 1TK5A 4NY8A 2QB1A 2QLTA 3ZD8A 4C4SA 2ZUBA 3AEVA 2W8KA 2D3DA 2LPEA 4IRCA 4RT3A 4P4MA 5ALGA 5IIMA 3DDHA 9ICSA 4M9NA 3WKAA 1AROP 1RQNA 1T94A 4DOCA 8ICSA 4J9MA 4QZIA 1IV8A 8ICXA 1JUDA 2K8CB 4JV0A 2WHEA 1C20A 3Q8LA 5AKYA 2DPJA 3TFRA 3MFIA 5C5JA 1UCVA 4R8UA 4QZ9A 3M9MB 2I1QA 2W9CB 5GTIU 9ICVA 1KFTA 4ACOA 4QIWC 3RJKA 1OXJA 3WKBA 2E8OA 5J2EA 3MFHA 3SYZA 4GIBA 4O3SA 2YY6A 3V72A 3T79A 1S77D 1ZD2P 4FS2A 3EZ5A 1Z00A 4DSFA 5AM1A 5J2FA 5ALHA 3ZDCA 4QZHA 1ZQTA 2ASJA 1J2MA 9ICCA 5J2AA 2H3VA 5DDMA 1T7PA 5L1IA 5AK5A 2C28A 4CNQA 2WB1F 4O5CA 4HYKA 3J81j 3ZDEA 3QEBZ 4KLMA 4DFKA 7ICLA 4FBTA 2EZYA 3IDWA 4ZH4A 5EWEA 2HBLA 4TUSA 2KICA 1ZQEA 2EAMA 5AKKA 3JPRA 1L7OA 4M9JA 1DXSA 4F4YA 3QYPA 2HDOA 1X40A 2C22A 1RDFA 4ECTA 4FZNA 3RH6A 4PGXA 3C29A 3DEEA 4XQ8A 5HP4A 4DQIA 1PUZA 2A1AA 4NJ8A 1N63A 2W54A 4DF8A 4DO9A 5F9LA 2HHQA 2HOIA 3V6HA 5ALNA 1VLBA 4J9QA 4DCCA 2WAQC 1TAQA 8ICRA 3TAPA 7ICSA 1CI4A 2MA1A 1EXNA 3SQIA 4C8KA 3BQ2A 2GH1A 2KJ8A 3QU7A 3JPQA 3LVWA 2H3IA 3CYMA 3OGUA 4DSKA 3ZD9A 1SZPA 1NK9A 1SXEA 2I5HA 4ECRA 3RB0A 4I2JA 4WJ3B 2BPGA 4DQQA 3OSNA 5J0OA 4RZRA 4F71A 3SD7A 3NVYA 3C2MA 2XY6A 2GOLA 3JPSA 4RQNA 4PZNA 5J8YC 4O3PA 2RDJA 3FM9A 1T8EA 4JV1A 5AI9A 1SGGA 1Q3VA 2HHXA 4GLXA 8ICOA 8ICWA 2XCPA 2HSZA 4F4XA 4PHDA 4M9GA 1LVHA 1T3QA 2KEYA 2W03A 5KFWA 3IRUA 1L3SA 4DQPA 1ZQIA 1NK0A 2IBKA 1DGJA 5KG1A 5KFJA 5IIJA 1SKRA 4R66A 5KFLA 4RQ3A 1XS9D 3EW9A 5CP2A 7ICMA 4OJOA 2IA6A 4UB4A 1BNPA 5AK4A 3T5HA 2ALZA 3RJFA 4O5EA 1ZQXA 2QARA 9ICRA 4YXMA 3FC4A 2IOHA 1N5XA 5HNKA 5DLGA 9ICFA 5J2CA 4FFDA 4UASA 1NI3A 4KMUA 3QU5A 4ED7A 1WWUA 2PFOA 1L5UA 1S76D 4RQ8A 1S97A 2EZXA 2LKYA 3C23A 2R8IA 3S6JA 1TV9A 4BUGA 1SV0C 5AI4A 1B0XA 3ALRA 5J2DA 1Y88A 3B0XA 2E8PA 3A0HU 2MU2A 3NTUA 5ALSA 3N4MB 2KG5A 5J0TA 4UB8U 4Y2JA 5AI0A 1A76A 5KL8B 2BHNA 1YT3A 1X9WA 1QSYA 2K4EA 2CPRA 2KK0A 3C28A 2ISOA 5AI8A 1TVAA 3GIKA 3QU2A 5J8YA 4EX7A 2F1JA 1FFVA 3LVVA 4Y2UA 4J03A 1K5OA 1KSPA 2JMGA 2MUTA 2G07A 2HCFA 2DPIA 1ZQCA 9ICQA 1TE2A 1MQ2A 3T3FA 2WF7A 4B6JA 4F93B 2DKZA 2KE7A 4NLNA 5CEHA 3V7LA 1JROA 3M8SA 9ICAA 1ZQNA 2W11A 9ICMA 2A3VA 2E3TA 3PSIA 1Z1BA 3PX4A 3EUB2 4OJ6A 4O9MA 3MR5A 2PXIA 2VIXA 1B22A 2NRXA 1NKEA 3UMGA 4DOAA 4NXZA 3KHGA 2DKXA 5AM4A 4UB5A 3Q8KA 2W8LA 3M6KA 1YZ6A 4DLGA 1XO1A 2Y0SC 2RRDA 1NJWA 2OEHA 2KSOA 3TARA 2AQ0A 3UXPA 5AM2A 3KBBA 4EBDA 7ICGA 2YMPA 4PHPA 4BXOB 4R8UB 4F5QA 4I2HA 8ICNA 5KT4A 3ISCA 1WCNA 5ALIA 4O5KA 3HILA 4F91B 4P2HA 1S9FA 1RXVA 3BDPA 5ALYA 4RT2A 5KG4A 1Z1VA 2IMWP 5IIIA 4XUSA 4QWAA 1N60A 2VJ4A 3T5LA 3NS1A 2VANA 9ICWA 3E2EA 3ISBA 2KP7A 2ZIXB 5DB6A 5DB8A 3EPIA 3K4GA 3L5KA 1COKA 1SKSA 2MUTB 1N56A 9ICLA 2W04A 4CCHA 1O03A 2JRZA 4OJPA 2DQNB 5J2GA 3Q8PB 2ZXHA 8ICAA 4DL4A 3Q8QB 4JB3A 1NOMA 5HHHA 5ALZA 2L5YA 1ZQMA 2KKVA 4RPYA 2KZZA 4CE6A 4BGDA 2HOFA 5ALOA 4J9RA 4F4ZA 3Q8RB 2HVIA 4R65A 4YN4A 2ZIWA 5KFGA 1S0VA 2W9CA 2YN4A 1U49A 3EPGA 2ZIVB 4GC7A 4UW9A 5KT5A 4B9VA 2WAQF 2I6XA 4Y2PA 4I2BA 3LK9A 1ZQAA 3KHRA 4USAA 1BPYA 4KLOA 3H8MA 4ECVA 4C0ZA 5EWFA 5BOLA 2DFLA 4MEYA 1IIPA 3C2KA 5KG3A 1F44A 5HHIA 4PHAA 4QZBA 4JWMA 2YQEA 1ZXIA 9ICKA 3WU2U 1M6YA 4MF8A 1C7YA 3WK6A 5CA7A 1V85A 4MFFA 1GO3F 5EOZA 5F9NA 3LDAA 5CR0A 1X6IA 3RTVA 1RYSA 1NK8A 1NK4A 3G6VA 4PGQA 4O3MA 5AKZA 3HW8A 3TFSA 2RHFA 4Y2YA 3RRHA 4Q8FA 1YZ7A 1IXRA 3N7SC 3M9OB 4QZFA 3THVA 3V6JA 3UXOA 4IL6U 2ZUDA 3SEIA 4RPXA 4NLGA 1ZQUA 5JTIA 3KKAA 8ICQA 1X66A 3PR4A 5AKJA 2K8AA 3N7PD 5DBBA 1NK6A 4BWMA 2XCAA 2IHMA 3MDCA 4M9HA 3WK7A 5DGBA 2WTFA 2KZMA 4XA5A 1AQ6A 5D46A 3OJUA 2V9WA 1ZD3A 3AMZA 3FDSA 3L3FX 3H0RB 3F5EA 4ELUA 3PV8A 1ZQ1C 3HRDD 5J0UA 2LYAA 4ECXA 4G3IA 2XIDA 4I2DA 4MFAA 2AGPA 4Q44A 1Z4NA 5AKIA 5IIKA 3V7JA 2WF9A 3TACB 1HEKA 4QJFB 1UPHA 1KLNA 5ALPA 3AU2A 1ZQRA 7ICOA 1U45A 3E58A 4DF4A 1U48A 1SXDA 2M9NA 2R8KA 2AQ4A 5TZVA 3RJIA 5KL1B 4YR3A 5FP0A 4C8NA 4X5VA 4QWBA 3QUBA 1ZQYA 3PMLA 4DS4A 2KOBA 1SB3C 4MHVA 2YB4A 3MGIA 3RF9A 3ZI4A 4QW8A 5ALQA 2ISPA 2VKQA 3LYSA 3GV5B 1K1SA 2W3RA 2LMRA 1UA1A 4IQVA 1SZHA 3RRGA 2GO7A 5ALLA 2N1RA 4IQTA 4UB6U 2F77X 3TI0A 3PZPA 1ZQZA 4TQRA 3KTQA 2G08A 2YX8A 3HKZF 3K75D 4UQGA 1BPBA 3AM9A 4AP9A 3QX7A 5DLFA 2KIVA 4JUZA 2H3ZA 4KLJA 3V7KA 3KFUF 3EWAA 4Q43A 4YVZA 2QARB 5AIBA 3SMVA 5CRXA 3PW5A 3PX0A 1A6SA 3KKAC 4QZGA 4Z6EA 4KLLA 2KVCA 2BCVA 4AYBF 3IM1A 4GXIA 4EZ6A 1TFRA 3OSPA 1J2NA 3ED5A 2AJQA 2LM4A 8ICYA 1NZBA 5DGAA 5J0QA 1ZD5A 5AI5A 5KFPA 2WB1C 4K4IA 1O08A 1HUOA 4CRXA 2W7OA 4YXJA 2HHSA 2KIWA 9ICUA 2KHQA 7ICJA 5J0YA 1L7MA 4UBBA 2OM6A 4FE3A 3F2BA 4NLZA 3I28A 2NO4A 1F5SA 2KD1A 1ZQDA 3TANA 2E8MA 5CJ7A 3N97B 2YTUA 3PR5B 4RQ5A 8ICKA 4OCZA 4DS5A 2BQUA 3A0BU 1V9PA 4ECZA 2ZXIA 1L8LA 2A1JA 2BKEA 4RQ1A 4M2YA 1PK1A 1NJZA 3GFKB 3ZDBA 5AIAA 1SL1A 3PO5A 1ZD4A 5J2BA 2KKPA 4ECYA 1PVPA 5KFOA 1ZQHA 2PFNA 5DQHA 2WF6A 2H5XA 7ICEA 1JMSA 5J2JA 2ATLA 5B5EU 4J9PA 9ICXA 3M1YA 1X9XA 4CF4A 3HWTA 4DL3A 4DOBA 3HP6A 2E5SA 2Q0ZX 4RQ2A 2G5HB 3QU9A 9ICOA 2FLLA 5KFAA 2F76X 3QUQA 2F2AB 1HJPA 7ICNA 4UB2A 4F5PA 4C8MA 2HW3A 4M04A 4EEYA 2UVRA 4ED0A 3M8RA 2GLEA 2QB0A 1ZQPA 2Q4TA 5ALFA 5L1KA 2FJ6A 5JRTA 4ED8A 2NRWA 3CNHA 3JPTA 2EQYA 2AGOA 3TAQA 4PH5A 3SI8A 5KFRA 4B9TA 2JXJA 9ICBA 4E0DA 8ICEA 1D9DA 2ZIVA 1COOA 4Q45A 3TADA 3NUQA 4UAWA 3D2NA 2B21A 5ALJA 2RQ5A 2CN1A 5KNIA 5AM3A 1XSLA 1N62A 2VA2A 2Y0SF 2HMXA 4ECUA 2E1FA 1U47A 2BQ3A 1WG8A 4M0AA 3NGDA 4GC6A 1NKBA 3HT3A 1KDHA 5KFQA 1ZQQA 5ALUA 4RPZA 4KITB 4UATA 1KW4A 3E0FA 3I76A 4M9LA 1RPLA 4PJ0U 1MSWD 3BQTA 4BDPA 4PZOA 5B66U 3PSTA 3GIMA 1L7PA 3GILA 1WUDA 5KFMA 4F50A 4Z6DA 4KLGA 9ICTA 3C21A 4AYBC 1IM4A 3PSPA 4I28A 4I2FA 5AKLA 1Q46A 7ICUA 8ICIA 2K89A 1B4FA 2CRXA 3MABA 4DQSA 5DG9A 2VA3A 2DL0A 4F4KA 4Z6CA 4BXOA 4YFKA 4DSEA 2CXYA 3MR6A 2BZFA 2G09A 3GDXA 4QWEA 2ZJ8A 4I27A 4K4HA 3SV3A 3WK5A 1HUZA 4YR0A 2Y9TA 4GXKA 3GZFA 2HBJA 3F2CA 3IHQB 1FEZA 5BPCA 2KN7A 3RR8A 2NRZA 4DFPA 5KG0A 3TADC 4OO1J 2PI5A 3R9KA 4LZGA 3RJEA 3GQCA 3SAGA 3IP4B 3HJEA 4M6WB 4QZCA 2PMZF 4KTQA 3H8JA 5KAIU 5HMLA 3K1ZA 1QQ6A 1QQ7A 4DL7A 3F5AA 1UQVA 1Z4OA 2P35A 2C2DA 2R8JA 4MFCA 2XGPA 1S10A 1D8LA 3BQ1A 3WK9A 5CWRA 1Q3UA 3KZXA 1MN8A 4UAYA 3OPXA 4DL2A 1RG6A 1JX4A 1JN3A 1LKYB 1KQQA 4DWIA 1XO0A 2BPFA 5E79U 4ED3A 2KSOB 3BS7A 4UB1A 2BCQA 3D6JA 3LWLA 3HKZC 4EZ9A 2DGZA 3RBEA 1PZNA 1BNOA 2OCEA 4PHEA 1XSNA 2H3FA 3PO4A 9ICJA 3VC8A 3BQ0A 3MR3A 4ZOHC 1DOQA 5HR6A 3CP8A 2K4HA 2NRTA 5KT7A 7ICRA 2GWSA 2HHVA 2B0CA 4DFMA 1FIQA 2BDUA 3RH4A 1K1QA 7ICPA 3BZKA 7ICQA 3IN5A 1Z19A 4DFDA 5H2FU 3RJJA 4JV2A 4YR2A 9ICPA 3C1ZA 1L6NA 3UM9A 2ODGA 4NWIA 2XI9A 3WKDA 5AICA 4NM1A 2QKQA 5DQGA 3KD3A 3HX0A 4F2SA 2P66A 4Y2VA 1FO4A 4YD1A 1X6JA 1ZQFA 2K4PA 4O3QA 2G06A 2F8KA 5G5GA 5ALDA 2RDIA 2FMPA 3M6ZA 1KTQA 4US8A 1ZQSA 1ZQVA 2KV2A 4ED6A 4CGZA 1V38A 4YMNA 1SL0A 4IQUA 1J97A 7ICVA 4FZLA 3CW2C 3B0YA 8ICFA 1DK2A 2K8BB 4J9NA 3Q8MA 5F3XB 4RNNA 1QSSA 1WYGA 1CUKA 4KLEA 3RFAA 1CEZA 3FYHA 2EZZA 2R8HA 2LI6A 3CRXA 1Z3EB 4C8LA 4P0QA 3IG8A 2ZTEA 2AHOB 4DSJA 5J0RA 4F5RA 3OHAA 3UPQA 4ECSA 2RLTA 2KJ9A 3PNCA 4ED2A 4P4PA 3KHHA 4C8OA 2YMMA 3ONNA 5DB9A 5BOMA 2W9BA 4ECWA 4KN7A 4Y2QA 4Z6FA 7ICHA 1SV4A 1XNSA 1X42A 3RB4A 3UMBA 3IG5A 4Y2TA 4DEZA 2UVWA 4P4OA 3C2LA 3KHLA 4CDGA 2DBYA 2KHVA 3QU4A 4IR9A 5ALEA 2ZTDA 2A1JB 4RQ7A 2NV3A 1ZQWA 4NLCA 2V4QA 1A0PA 4BX9C 5KG2A 3PW0A 2W9AA 1N5WA 1IG6A 4IS7A 1L3VA 2YMLA 9ICIA 3MBYA 2F44A 1D8BA 5KFFA 1Q8KA 3NASA 4FO6A 1TAUA 4G9BA 1S0OA 2H3QA 1ZQJA 1NK5A 3H4BA 4P0PB 3AUOA 1ZYQA 4DSLA 2OHFA 5KFKA 1QTMA 4F3OA 2LYBA 5K4LA 2YMQA 2ZIUB 2XVTA 3WKEA 3C5FA 4U6PA 2HVHA 4KN4A 3HPOA 1SWVA 2JH1A 5DG7A 2IHNA 3JPNA 2PI4A 3AL0B 1ZQLA 9ICHA 2XY7A 4QIWF 5KFTA 1X2IA 2BR0A 1A77A 4QZ8A 1XWLA 2ZIWB 2ZTCA 3PY8A 2IOFK 2DF4B 2J6TA 8ICJA 4F92B 4QZEA 4NLBA 4QZDA 1L3TA 4O3RA 2FPMA 5IINA 2P6RA 8ICUA 1JI7A 4YD2A 3H8WA 4OJLA 1BPDA 5JUMA 4KLDA 5DKWA 2HOQA 5J0XA 5KG5A 1PK1B 4DL6A 4F4WA 2EANA 4DQRA 2EAOA 2K60A 2PMZC 3PVXA 1MQ3A 5HR7A 2ZJ5A 3MC1A 4TUPA 3GIJA 4LJXA 4YMOA 3RAQA 1H38A 2EH9A 4RQ0A 5GTHU 4TUQA 4BJQA 1ED1A 4KLFA 2PKEA 8ICHA 2JGAA 2JV3A 2YB1A 4BWJA 4US9A 4I2EA 3NRZA 4Y2RA 5AK6A 5CB1A 3UXNA 5KTQA 5JU5A 1QCKA 4B9NA 4F8RA 2ZUCA 5L1MA 2BPCA 5AM5A 2HI0A 2W9MA 2ES6A 2W3SA 1S8OA 3F2DA 2D6FC 4RNMA 4RQMA 3NVWA 3H7IA 5DQIA 3N28A 3L4PA 3WK4A 2BCUA 4QW9A 4YP3A 5EE3A 1NK7A 1D8YA 4C4RA 3BJYA 2P6UA 3OJSA 1SV0A 3D2QA 1U4BA 1RZTA 3QZ7A 5D4BA 4KX5A 3IV6A 1OUQA 4GXJA 5EE0A 1SL2A 1X9SA 1ECWA 5AKHA 2JZBA 2DWQA 3MDAA 3F53A 4I29A 4KLQA 5DDYA 2ASDA 5AI6A 2NYVA 1SIJA 2PFQA 4KLHA 2BCRA 2OWOA 5KFVA 3B9JA 2ZIUA 4KMOB 4Y2SA 2UVUA 4UARA 4NV0A 5KFEA 4UAZA 1L8OA 3BZCA 2FPLA 3JPPA 4B9MA 1RXWA 2KFZA 4NL9C 1DK3A 2Y1IA 4I2GA 4IR1A 3U26A 7ICKA 3UQ0A 5KFBA 8ICGA 3QXGA 3H40A 4ECQA 4EELA 5AK3A 5ALKA 1NNLA 3SAFA 2A19A 2UVVA 3PW7A 2Y1JA 2E8NA 2F8LA 2AU0A 3TQ1A 3GV7B 2KMDA 4P0QB 2FI1A 2G0AA 2KVSA 2FMSA 3K1RB 3PMNA 4J9OA 2PFPA 1WWVA 5KFZA 4IC9A 2EDUA 4I2AA 4R63A 2JEIA 3H0MB 4A8EA 4DL5A 1MA7A 5KT3A 4RQ4A 2XO7A 5KFSA 3QUCA 4U7CA 1U9LA 2AH5A 1UA0A 2AXTU 2JH7A 3SR6A 5KFHA 1KFDA 5AKEA 2C2RA 1N48A 3PW2A 1ZQBA 2FMQA 5DBCA 3M9NB 1ZETA 2VA8A 4RNOA 3PX6A 3OHBA 3AN1A 3H8SA 1BVSA 1NKCA 2E1EA 1N61A 3PW4A 3PSFA 3H4DA 1KN5A 4UBCA 1NJYA 4KLTA 4UB3A 1QQ5A 1TKDA 5J0WA 2JEGA 3GU3A 1BGXT 3QE9Y 8ICVA 2O6KA 1XC9A 9ICEA 8ICZA 2KZ3A 3LWMA 4FS1A 2XY5A 1XU4A 4RUCA 5EE9A 5J2HA 2KJ5A 1FFUA 4FBUA 4FZMA 2LBOA 4NL9A 1LV5A 2BDPA 3Q8SB 1RM6C 5KFCA 2XGQA 4F5NA 1L3UA 3ZDAA 3DV9A 1S0MA 3H0LB 2LYHA 1ZRMA 4LZDA 3T5KA 1Z00B 1KBUA 4KLSA 1PVQA 2KNJA 4C80A 4JMUA 4MEXA 1KRPA 7ICTA 5AKXA 5KFDA 1URJA 3BS5B 5TISU 5KFUA 1DRGA 4RQ6A 3EYZA 3G6YA 5HMMA 2W7PA 3SENA 4B9UA 2HHTA 1BPEA 3QZ8A 2FLPA 1HIWA 3D2SA 3MGHA 1KFSA 4EX6A 2FDRA 2NRVA 3AQFA 4YCXA 1LKYA 7ICIA 4ELVA 4QNLA 5DG8A 2WF5A 5ALXA 9ICNA 2BCSA 2XC9A 2VJ5A 1LB2B 4CF5A 4TURA 4IRDA 2I9GA 5J2KA 2MRLA 5L1JA 1WCLA 1RYUA 1PVRA 2R18A 1ZQOA 5DBAA 3FAHA 1F0MA 3OTQA 5KFXA 2KFNA 3SV4A 2XICA 1S0NA 1SKWA 2ASLA 4KX3A 1L7NA 2RP5A 2AGQA 8ICCA 3UMCA 2WF8A 2JHDA 3AQEA 2QB0B 1X9MA 5T14A 1ZQGA 1KL9A 4EENA 4EYHB 3ETLA 1VDVA 2FLNA 3G6XA 3QNMA 3WKCA 3BS5A 3O0FA 2M0NA 2B6GA 4F2RA 4YQWA 1ZJMA 1JXLA 1TAMA 1JRPA 2HHUA 2R8GA 2IOFA 1UT8A 5J2IA 1XSPA 1SWWA 2F1HA 4EBEA 2J6UA 2OXOA 4EBCA 3QEAZ 4RU9A 2J6SA 4UAVA 8ICBA 1NZPA 1CRXA 1QH9A 1DGSA 2HBKA 3RB6A 4B9LA 4XRHA 1D9FA 5ALRA 8ICPA 8ICMA 2DUYA 4C4TA 4B9SA 5D49A 4DSIA 4JWNA 5C0YA 5ALVA 4QWDA 4EYIB 3RBDA 4R64A 2JEJA 5AHXA 3RB3A 4MF2A 4JK1A 5KT2A 5J0PA 2V4RA 2ZG6A 4ICAA 2FPKA 2Z7JA 3ORYA 4DFJA 3I1YA 3KOOA 9ICGA 3N7RC 4OD0A 1BPXA 3C5GA 2OYYA 4YG2A 2LHTA 1JXEA 3TKAA 4CF3A 3KZIU 3RAXA 4QWCA 3M7DA 1T4GA 2W9BB 4I2CA 1B43A 4O3NA 4IQWA 5L1LA 1OW5A 2MSNA 4ELTA 5CHGA 2MAXA 4GFJA 1ZRNA 4QZAA 8ICTA 2KTQA 1RYRA 1MC8A 1ZOLA 2F1IA 5KFNA 3NRWA 1TK0A 3GV8B 2HHWA 1JALA 1VJ5A 5IIOA 2Y9UA 5EE1A 3RJHA 3RR7A 1QSLA 2OH2A 4YMMA 1BPZA 3BQ7A 7ICFA 2JZBB 3JPOA 2ZJAA 1P7DA 3ETRA 3MGVA 2K4IA 2ESEA 4M6WA 5AKGA 4PPXA 4DLEA 4HAIA 5A0LA 1KEJA 1S5LU 5KG6A 3MR2A 3UQ2A 5L9XA 2W55A 4F72A 4F5OA 1TK8A 5KFIA 4P0PA 5EWGA 2EAPA 8ICLA 3AU6A 5ALMA 3V6KA 5J29A 4C7YA 2G5IB 1ZQKA 2BQRA 3RH5A 4M47A
chains in the Genus database with same CATH topology
2DF4B 2KJ9A 3AQFA 3ICXA 3VC8A 1OUQA 2G08A 3PSPA 2YX8A 2VJ4A 3VCBA 4ACOA 5HR6A 3HKZF 3CP8A 4QIWC 2E5SA 2K4HA 4QNLA 4NLBA 3ONNA 4O3MA 2RHFA 2K89A 1ECWA 2G5HB 2ZIXB 2H3ZA 5KL8B 2ZG6A 2F76X 4ICAA 2Z7JA 2F2AB 3N7SC 4PL2A 1XNSA 2CRXA 1YT3A 2E1EA 4PL1A 3KFUF 4OJLA 2W04A 2K4EA 2CPRA 2GOLA 2BDUA 2VJ5A 3N7RC 3PSFA 3C28A 3F53A 4OJPA 2OYYA 3T79A 2DQNB 3SMVA 5CRXA 3IG5A 2HOQA 2MRLA 3IN5A 2LHTA 1A6SA 2ZXHA 1Z19A 2HBMA 2K8AA 2Q4TA 3M7DA 3N7PD 2R18A 4CDGA 2G09A 3LVVA 2KHVA 3SAHA 1PVRA 2KVCA 1Q3VA 4AYBF 3GU3A 2PMZC 2JMGA 2NV3A 3GZFA 1L6NA 2G07A 2ZIUA 4KX5A 5HR7A 2H3VA 4KMOB 4NLCA 2HBJA 4NWIA 4OJ5A 3L3FX 3H0RB 2XI9A 4NV0A 3F5EA 2XICA 3F2CA 2KKVA 1ZQ1C 1A0PA 2RP5A 4KX3A 2KEYA 2W03A 1NZBA 2WB1F 4BX9C 2LYAA 2KJ5A 2HOFA 2XIDA 2JHDA 3AQEA 4GFJA 4FZMA 2LBOA 5T14A 2ZIVA 4BJQA 1ED1A 2JGAA 3NUQA 4OO1J 2G06A 2YB1A 2WB1C 3D2NA 2A3VA 1D8BA 2HBLA 3M6ZA 2KICA 3NRWA 3PSIA 1Z1BA 2CN1A 1HEKA 4QJFB 1UPHA 2W7OA 4CRXA 2ZIXA 2KIWA 3SAGA 2KV2A 3IP4B 4OJOA 3SAFA 2KHQA 2ZIWA 4OJ6A 4CGZA 3H0LB 2VIXA 2Y0SF 2PMZF 2HMXA 2OM6A 4FE3A 3F2BA 4FZNA 2F8LA 2KD1A 2E1FA 3O0FA 2H3QA 2M0NA 3C29A 3DEEA 3K1ZA 2ZIVB 4FZLA 2OH2A 2WAQF 3F5AA 1TAMA 4P0QB 1KBUA 5KL1B 4P0PB 2G0AA 2HOIA 1PVQA 2K8BB 3M6KA 1P7DA 2KNJA 2Y0SC 2RRDA 4JMUA 3MGVA 2K4IA 2ZXIA 4IC9A 2WAQC 2LYBA 2OXOA 2ZIUB 3F2DA 2D6FC 2MA1A 3RFAA 1Q3UA 2KOBA 1URJA 3SQIA 3KZXA 4C0ZA 2YB4A 3H0MB 2XVTA 1IIPA 3OPXA 3RF9A 4A8EA 5A0LA 1DRGA 3E0FA 4U6PA 1MA7A 1CRXA 1F44A 2GH1A 2HBKA 2KJ8A 3CRXA 4P0QA 3IG8A 3LVWA 2VKQA 2JH1A 4P0PA 1T94A 2W7PA 2H3IA 2KKPA 3CYMA 3AL0B 2LKYA 3LYSA 1XO0A 1PVPA 4U7CA 2JH7A 3PSTA 4BUGA 2K8CB 3D2QA 1HIWA 3D2SA 1SZHA 4QIWF 3HKZC 1WUDA 2G5IB 4WJ3B 1GO3F 2DGZA 2N1RA 3ALRA 5C0YA 2ZIWB 2H3FA 2F77X 3PZPA 4AYBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8B B;  2K89 A;  3PST A;  3PSP A;  3L3F X;  2K8C B;  2K8A A; 
#chains in the Genus database with same CATH topology
 2LM1 A;  3ICX A;  3VCB A;  5G5H A;  4KLU A;  1QLN A;  5DB7 A;  5KT6 A;  1JIH A;  3NVV A;  2F3N A;  5J0S A;  1ZJN A;  3GII A;  2WFA A;  4PL2 A;  4PL1 A;  5KG7 A;  4K4G A;  5AM0 A;  4O3O A;  4TQS A;  3NVZ A;  2HBM A;  3SAH A;  2FE9 A;  1RQL A;  3QUT A;  1UHU A;  1T3N A;  2C2E A;  4J9K A;  4KLI A;  4UAU A;  4OJ5 A;  3WK8 A;  4C7Z A;  5ALW A;  3T5J A;  4NLK A;  3C1Y A;  3SZ2 A;  4O0I A;  5KAF U;  4RUA A;  5IIL A;  4PGY A;  4I2I A;  4J9L A;  2NO5 A;  1N2X A;  4Q8E A;  4LVS A;  1PK3 A;  1UT5 A;  2BGW A;  2ZIX A;  4EEK A;  2D8C A;  5KFY A;  4IRK A;  3ISD A;  2W43 A;  4ED1 A;  4J9S A;  1NJX A;  2JEF A;  1KKX A;  4NM2 A;  3ZDD A;  3RJG A;  2JR5 A;  1V97 A;  4Y2X A;  5ALT A;  1TK5 A;  4NY8 A;  2QB1 A;  2QLT A;  3ZD8 A;  4C4S A;  2ZUB A;  3AEV A;  2W8K A;  2D3D A;  2LPE A;  4IRC A;  4RT3 A;  4P4M A;  5ALG A;  5IIM A;  3DDH A;  9ICS A;  4M9N A;  3WKA A;  1ARO P;  1RQN A;  1T94 A;  4DOC A;  8ICS A;  4J9M A;  4QZI A;  1IV8 A;  8ICX A;  1JUD A;  2K8C B;  4JV0 A;  2WHE A;  1C20 A;  3Q8L A;  5AKY A;  2DPJ A;  3TFR A;  3MFI A;  5C5J A;  1UCV A;  4R8U A;  4QZ9 A;  3M9M B;  2I1Q A;  2W9C B;  5GTI U;  9ICV A;  1KFT A;  4ACO A;  4QIW C;  3RJK A;  1OXJ A;  3WKB A;  2E8O A;  5J2E A;  3MFH A;  3SYZ A;  4GIB A;  4O3S A;  2YY6 A;  3V72 A;  3T79 A;  1S77 D;  1ZD2 P;  4FS2 A;  3EZ5 A;  1Z00 A;  4DSF A;  5AM1 A;  5J2F A;  5ALH A;  3ZDC A;  4QZH A;  1ZQT A;  2ASJ A;  1J2M A;  9ICC A;  5J2A A;  2H3V A;  5DDM A;  1T7P A;  5L1I A;  5AK5 A;  2C28 A;  4CNQ A;  2WB1 F;  4O5C A;  4HYK A;  3J81 j;  3ZDE A;  3QEB Z;  4KLM A;  4DFK A;  7ICL A;  4FBT A;  2EZY A;  3IDW A;  4ZH4 A;  5EWE A;  2HBL A;  4TUS A;  2KIC A;  1ZQE A;  2EAM A;  5AKK A;  3JPR A;  1L7O A;  4M9J A;  1DXS A;  4F4Y A;  3QYP A;  2HDO A;  1X40 A;  2C22 A;  1RDF A;  4ECT A;  4FZN A;  3RH6 A;  4PGX A;  3C29 A;  3DEE A;  4XQ8 A;  5HP4 A;  4DQI A;  1PUZ A;  2A1A A;  4NJ8 A;  1N63 A;  2W54 A;  4DF8 A;  4DO9 A;  5F9L A;  2HHQ A;  2HOI A;  3V6H A;  5ALN A;  1VLB A;  4J9Q A;  4DCC A;  2WAQ C;  1TAQ A;  8ICR A;  3TAP A;  7ICS A;  1CI4 A;  2MA1 A;  1EXN A;  3SQI A;  4C8K A;  3BQ2 A;  2GH1 A;  2KJ8 A;  3QU7 A;  3JPQ A;  3LVW A;  2H3I A;  3CYM A;  3OGU A;  4DSK A;  3ZD9 A;  1SZP A;  1NK9 A;  1SXE A;  2I5H A;  4ECR A;  3RB0 A;  4I2J A;  4WJ3 B;  2BPG A;  4DQQ A;  3OSN A;  5J0O A;  4RZR A;  4F71 A;  3SD7 A;  3NVY A;  3C2M A;  2XY6 A;  2GOL A;  3JPS A;  4RQN A;  4PZN A;  5J8Y C;  4O3P A;  2RDJ A;  3FM9 A;  1T8E A;  4JV1 A;  5AI9 A;  1SGG A;  1Q3V A;  2HHX A;  4GLX A;  8ICO A;  8ICW A;  2XCP A;  2HSZ A;  4F4X A;  4PHD A;  4M9G A;  1LVH A;  1T3Q A;  2KEY A;  2W03 A;  5KFW A;  3IRU A;  1L3S A;  4DQP A;  1ZQI A;  1NK0 A;  2IBK A;  1DGJ A;  5KG1 A;  5KFJ A;  5IIJ A;  1SKR A;  4R66 A;  5KFL A;  4RQ3 A;  1XS9 D;  3EW9 A;  5CP2 A;  7ICM A;  4OJO A;  2IA6 A;  4UB4 A;  1BNP A;  5AK4 A;  3T5H A;  2ALZ A;  3RJF A;  4O5E A;  1ZQX A;  2QAR A;  9ICR A;  4YXM A;  3FC4 A;  2IOH A;  1N5X A;  5HNK A;  5DLG A;  9ICF A;  5J2C A;  4FFD A;  4UAS A;  1NI3 A;  4KMU A;  3QU5 A;  4ED7 A;  1WWU A;  2PFO A;  1L5U A;  1S76 D;  4RQ8 A;  1S97 A;  2EZX A;  2LKY A;  3C23 A;  2R8I A;  3S6J A;  1TV9 A;  4BUG A;  1SV0 C;  5AI4 A;  1B0X A;  3ALR A;  5J2D A;  1Y88 A;  3B0X A;  2E8P A;  3A0H U;  2MU2 A;  3NTU A;  5ALS A;  3N4M B;  2KG5 A;  5J0T A;  4UB8 U;  4Y2J A;  5AI0 A;  1A76 A;  5KL8 B;  2BHN A;  1YT3 A;  1X9W A;  1QSY A;  2K4E A;  2CPR A;  2KK0 A;  3C28 A;  2ISO A;  5AI8 A;  1TVA A;  3GIK A;  3QU2 A;  5J8Y A;  4EX7 A;  2F1J A;  1FFV A;  3LVV A;  4Y2U A;  4J03 A;  1K5O A;  1KSP A;  2JMG A;  2MUT A;  2G07 A;  2HCF A;  2DPI A;  1ZQC A;  9ICQ A;  1TE2 A;  1MQ2 A;  3T3F A;  2WF7 A;  4B6J A;  4F93 B;  2DKZ A;  2KE7 A;  4NLN A;  5CEH A;  3V7L A;  1JRO A;  3M8S A;  9ICA A;  1ZQN A;  2W11 A;  9ICM A;  2A3V A;  2E3T A;  3PSI A;  1Z1B A;  3PX4 A;  3EUB 2;  4OJ6 A;  4O9M A;  3MR5 A;  2PXI A;  2VIX A;  1B22 A;  2NRX A;  1NKE A;  3UMG A;  4DOA A;  4NXZ A;  3KHG A;  2DKX A;  5AM4 A;  4UB5 A;  3Q8K A;  2W8L A;  3M6K A;  1YZ6 A;  4DLG A;  1XO1 A;  2Y0S C;  2RRD A;  1NJW A;  2OEH A;  2KSO A;  3TAR A;  2AQ0 A;  3UXP A;  5AM2 A;  3KBB A;  4EBD A;  7ICG A;  2YMP A;  4PHP A;  4BXO B;  4R8U B;  4F5Q A;  4I2H A;  8ICN A;  5KT4 A;  3ISC A;  1WCN A;  5ALI A;  4O5K A;  3HIL A;  4F91 B;  4P2H A;  1S9F A;  1RXV A;  3BDP A;  5ALY A;  4RT2 A;  5KG4 A;  1Z1V A;  2IMW P;  5III A;  4XUS A;  4QWA A;  1N60 A;  2VJ4 A;  3T5L A;  3NS1 A;  2VAN A;  9ICW A;  3E2E A;  3ISB A;  2KP7 A;  2ZIX B;  5DB6 A;  5DB8 A;  3EPI A;  3K4G A;  3L5K A;  1COK A;  1SKS A;  2MUT B;  1N56 A;  9ICL A;  2W04 A;  4CCH A;  1O03 A;  2JRZ A;  4OJP A;  2DQN B;  5J2G A;  3Q8P B;  2ZXH A;  8ICA A;  4DL4 A;  3Q8Q B;  4JB3 A;  1NOM A;  5HHH A;  5ALZ A;  2L5Y A;  1ZQM A;  2KKV A;  4RPY A;  2KZZ A;  4CE6 A;  4BGD A;  2HOF A;  5ALO A;  4J9R A;  4F4Z A;  3Q8R B;  2HVI A;  4R65 A;  4YN4 A;  2ZIW A;  5KFG A;  1S0V A;  2W9C A;  2YN4 A;  1U49 A;  3EPG A;  2ZIV B;  4GC7 A;  4UW9 A;  5KT5 A;  4B9V A;  2WAQ F;  2I6X A;  4Y2P A;  4I2B A;  3LK9 A;  1ZQA A;  3KHR A;  4USA A;  1BPY A;  4KLO A;  3H8M A;  4ECV A;  4C0Z A;  5EWF A;  5BOL A;  2DFL A;  4MEY A;  1IIP A;  3C2K A;  5KG3 A;  1F44 A;  5HHI A;  4PHA A;  4QZB A;  4JWM A;  2YQE A;  1ZXI A;  9ICK A;  3WU2 U;  1M6Y A;  4MF8 A;  1C7Y A;  3WK6 A;  5CA7 A;  1V85 A;  4MFF A;  1GO3 F;  5EOZ A;  5F9N A;  3LDA A;  5CR0 A;  1X6I A;  3RTV A;  1RYS A;  1NK8 A;  1NK4 A;  3G6V A;  4PGQ A;  4O3M A;  5AKZ A;  3HW8 A;  3TFS A;  2RHF A;  4Y2Y A;  3RRH A;  4Q8F A;  1YZ7 A;  1IXR A;  3N7S C;  3M9O B;  4QZF A;  3THV A;  3V6J A;  3UXO A;  4IL6 U;  2ZUD A;  3SEI A;  4RPX A;  4NLG A;  1ZQU A;  5JTI A;  3KKA A;  8ICQ A;  1X66 A;  3PR4 A;  5AKJ A;  2K8A A;  3N7P D;  5DBB A;  1NK6 A;  4BWM A;  2XCA A;  2IHM A;  3MDC A;  4M9H A;  3WK7 A;  5DGB A;  2WTF A;  2KZM A;  4XA5 A;  1AQ6 A;  5D46 A;  3OJU A;  2V9W A;  1ZD3 A;  3AMZ A;  3FDS A;  3L3F X;  3H0R B;  3F5E A;  4ELU A;  3PV8 A;  1ZQ1 C;  3HRD D;  5J0U A;  2LYA A;  4ECX A;  4G3I A;  2XID A;  4I2D A;  4MFA A;  2AGP A;  4Q44 A;  1Z4N A;  5AKI A;  5IIK A;  3V7J A;  2WF9 A;  3TAC B;  1HEK A;  4QJF B;  1UPH A;  1KLN A;  5ALP A;  3AU2 A;  1ZQR A;  7ICO A;  1U45 A;  3E58 A;  4DF4 A;  1U48 A;  1SXD A;  2M9N A;  2R8K A;  2AQ4 A;  5TZV A;  3RJI A;  5KL1 B;  4YR3 A;  5FP0 A;  4C8N A;  4X5V A;  4QWB A;  3QUB A;  1ZQY A;  3PML A;  4DS4 A;  2KOB A;  1SB3 C;  4MHV A;  2YB4 A;  3MGI A;  3RF9 A;  3ZI4 A;  4QW8 A;  5ALQ A;  2ISP A;  2VKQ A;  3LYS A;  3GV5 B;  1K1S A;  2W3R A;  2LMR A;  1UA1 A;  4IQV A;  1SZH A;  3RRG A;  2GO7 A;  5ALL A;  2N1R A;  4IQT A;  4UB6 U;  2F77 X;  3TI0 A;  3PZP A;  1ZQZ A;  4TQR A;  3KTQ A;  2G08 A;  2YX8 A;  3HKZ F;  3K75 D;  4UQG A;  1BPB A;  3AM9 A;  4AP9 A;  3QX7 A;  5DLF A;  2KIV A;  4JUZ A;  2H3Z A;  4KLJ A;  3V7K A;  3KFU F;  3EWA A;  4Q43 A;  4YVZ A;  2QAR B;  5AIB A;  3SMV A;  5CRX A;  3PW5 A;  3PX0 A;  1A6S A;  3KKA C;  4QZG A;  4Z6E A;  4KLL A;  2KVC A;  2BCV A;  4AYB F;  3IM1 A;  4GXI A;  4EZ6 A;  1TFR A;  3OSP A;  1J2N A;  3ED5 A;  2AJQ A;  2LM4 A;  8ICY A;  1NZB A;  5DGA A;  5J0Q A;  1ZD5 A;  5AI5 A;  5KFP A;  2WB1 C;  4K4I A;  1O08 A;  1HUO A;  4CRX A;  2W7O A;  4YXJ A;  2HHS A;  2KIW A;  9ICU A;  2KHQ A;  7ICJ A;  5J0Y A;  1L7M A;  4UBB A;  2OM6 A;  4FE3 A;  3F2B A;  4NLZ A;  3I28 A;  2NO4 A;  1F5S A;  2KD1 A;  1ZQD A;  3TAN A;  2E8M A;  5CJ7 A;  3N97 B;  2YTU A;  3PR5 B;  4RQ5 A;  8ICK A;  4OCZ A;  4DS5 A;  2BQU A;  3A0B U;  1V9P A;  4ECZ A;  2ZXI A;  1L8L A;  2A1J A;  2BKE A;  4RQ1 A;  4M2Y A;  1PK1 A;  1NJZ A;  3GFK B;  3ZDB A;  5AIA A;  1SL1 A;  3PO5 A;  1ZD4 A;  5J2B A;  2KKP A;  4ECY A;  1PVP A;  5KFO A;  1ZQH A;  2PFN A;  5DQH A;  2WF6 A;  2H5X A;  7ICE A;  1JMS A;  5J2J A;  2ATL A;  5B5E U;  4J9P A;  9ICX A;  3M1Y A;  1X9X A;  4CF4 A;  3HWT A;  4DL3 A;  4DOB A;  3HP6 A;  2E5S A;  2Q0Z X;  4RQ2 A;  2G5H B;  3QU9 A;  9ICO A;  2FLL A;  5KFA A;  2F76 X;  3QUQ A;  2F2A B;  1HJP A;  7ICN A;  4UB2 A;  4F5P A;  4C8M A;  2HW3 A;  4M04 A;  4EEY A;  2UVR A;  4ED0 A;  3M8R A;  2GLE A;  2QB0 A;  1ZQP A;  2Q4T A;  5ALF A;  5L1K A;  2FJ6 A;  5JRT A;  4ED8 A;  2NRW A;  3CNH A;  3JPT A;  2EQY A;  2AGO A;  3TAQ A;  4PH5 A;  3SI8 A;  5KFR A;  4B9T A;  2JXJ A;  9ICB A;  4E0D A;  8ICE A;  1D9D A;  2ZIV A;  1COO A;  4Q45 A;  3TAD A;  3NUQ A;  4UAW A;  3D2N A;  2B21 A;  5ALJ A;  2RQ5 A;  2CN1 A;  5KNI A;  5AM3 A;  1XSL A;  1N62 A;  2VA2 A;  2Y0S F;  2HMX A;  4ECU A;  2E1F A;  1U47 A;  2BQ3 A;  1WG8 A;  4M0A A;  3NGD A;  4GC6 A;  1NKB A;  3HT3 A;  1KDH A;  5KFQ A;  1ZQQ A;  5ALU A;  4RPZ A;  4KIT B;  4UAT A;  1KW4 A;  3E0F A;  3I76 A;  4M9L A;  1RPL A;  4PJ0 U;  1MSW D;  3BQT A;  4BDP A;  4PZO A;  5B66 U;  3PST A;  3GIM A;  1L7P A;  3GIL A;  1WUD A;  5KFM A;  4F50 A;  4Z6D A;  4KLG A;  9ICT A;  3C21 A;  4AYB C;  1IM4 A;  3PSP A;  4I28 A;  4I2F A;  5AKL A;  1Q46 A;  7ICU A;  8ICI A;  2K89 A;  1B4F A;  2CRX A;  3MAB A;  4DQS A;  5DG9 A;  2VA3 A;  2DL0 A;  4F4K A;  4Z6C A;  4BXO A;  4YFK A;  4DSE A;  2CXY A;  3MR6 A;  2BZF A;  2G09 A;  3GDX A;  4QWE A;  2ZJ8 A;  4I27 A;  4K4H A;  3SV3 A;  3WK5 A;  1HUZ A;  4YR0 A;  2Y9T A;  4GXK A;  3GZF A;  2HBJ A;  3F2C A;  3IHQ B;  1FEZ A;  5BPC A;  2KN7 A;  3RR8 A;  2NRZ A;  4DFP A;  5KG0 A;  3TAD C;  4OO1 J;  2PI5 A;  3R9K A;  4LZG A;  3RJE A;  3GQC A;  3SAG A;  3IP4 B;  3HJE A;  4M6W B;  4QZC A;  2PMZ F;  4KTQ A;  3H8J A;  5KAI U;  5HML A;  3K1Z A;  1QQ6 A;  1QQ7 A;  4DL7 A;  3F5A A;  1UQV A;  1Z4O A;  2P35 A;  2C2D A;  2R8J A;  4MFC A;  2XGP A;  1S10 A;  1D8L A;  3BQ1 A;  3WK9 A;  5CWR A;  1Q3U A;  3KZX A;  1MN8 A;  4UAY A;  3OPX A;  4DL2 A;  1RG6 A;  1JX4 A;  1JN3 A;  1LKY B;  1KQQ A;  4DWI A;  1XO0 A;  2BPF A;  5E79 U;  4ED3 A;  2KSO B;  3BS7 A;  4UB1 A;  2BCQ A;  3D6J A;  3LWL A;  3HKZ C;  4EZ9 A;  2DGZ A;  3RBE A;  1PZN A;  1BNO A;  2OCE A;  4PHE A;  1XSN A;  2H3F A;  3PO4 A;  9ICJ A;  3VC8 A;  3BQ0 A;  3MR3 A;  4ZOH C;  1DOQ A;  5HR6 A;  3CP8 A;  2K4H A;  2NRT A;  5KT7 A;  7ICR A;  2GWS A;  2HHV A;  2B0C A;  4DFM A;  1FIQ A;  2BDU A;  3RH4 A;  1K1Q A;  7ICP A;  3BZK A;  7ICQ A;  3IN5 A;  1Z19 A;  4DFD A;  5H2F U;  3RJJ A;  4JV2 A;  4YR2 A;  9ICP A;  3C1Z A;  1L6N A;  3UM9 A;  2ODG A;  4NWI A;  2XI9 A;  3WKD A;  5AIC A;  4NM1 A;  2QKQ A;  5DQG A;  3KD3 A;  3HX0 A;  4F2S A;  2P66 A;  4Y2V A;  1FO4 A;  4YD1 A;  1X6J A;  1ZQF A;  2K4P A;  4O3Q A;  2G06 A;  2F8K A;  5G5G A;  5ALD A;  2RDI A;  2FMP A;  3M6Z A;  1KTQ A;  4US8 A;  1ZQS A;  1ZQV A;  2KV2 A;  4ED6 A;  4CGZ A;  1V38 A;  4YMN A;  1SL0 A;  4IQU A;  1J97 A;  7ICV A;  4FZL A;  3CW2 C;  3B0Y A;  8ICF A;  1DK2 A;  2K8B B;  4J9N A;  3Q8M A;  5F3X B;  4RNN A;  1QSS A;  1WYG A;  1CUK A;  4KLE A;  3RFA A;  1CEZ A;  3FYH A;  2EZZ A;  2R8H A;  2LI6 A;  3CRX A;  1Z3E B;  4C8L A;  4P0Q A;  3IG8 A;  2ZTE A;  2AHO B;  4DSJ A;  5J0R A;  4F5R A;  3OHA A;  3UPQ A;  4ECS A;  2RLT A;  2KJ9 A;  3PNC A;  4ED2 A;  4P4P A;  3KHH A;  4C8O A;  2YMM A;  3ONN A;  5DB9 A;  5BOM A;  2W9B A;  4ECW A;  4KN7 A;  4Y2Q A;  4Z6F A;  7ICH A;  1SV4 A;  1XNS A;  1X42 A;  3RB4 A;  3UMB A;  3IG5 A;  4Y2T A;  4DEZ A;  2UVW A;  4P4O A;  3C2L A;  3KHL A;  4CDG A;  2DBY A;  2KHV A;  3QU4 A;  4IR9 A;  5ALE A;  2ZTD A;  2A1J B;  4RQ7 A;  2NV3 A;  1ZQW A;  4NLC A;  2V4Q A;  1A0P A;  4BX9 C;  5KG2 A;  3PW0 A;  2W9A A;  1N5W A;  1IG6 A;  4IS7 A;  1L3V A;  2YML A;  9ICI A;  3MBY A;  2F44 A;  1D8B A;  5KFF A;  1Q8K A;  3NAS A;  4FO6 A;  1TAU A;  4G9B A;  1S0O A;  2H3Q A;  1ZQJ A;  1NK5 A;  3H4B A;  4P0P B;  3AUO A;  1ZYQ A;  4DSL A;  2OHF A;  5KFK A;  1QTM A;  4F3O A;  2LYB A;  5K4L A;  2YMQ A;  2ZIU B;  2XVT A;  3WKE A;  3C5F A;  4U6P A;  2HVH A;  4KN4 A;  3HPO A;  1SWV A;  2JH1 A;  5DG7 A;  2IHN A;  3JPN A;  2PI4 A;  3AL0 B;  1ZQL A;  9ICH A;  2XY7 A;  4QIW F;  5KFT A;  1X2I A;  2BR0 A;  1A77 A;  4QZ8 A;  1XWL A;  2ZIW B;  2ZTC A;  3PY8 A;  2IOF K;  2DF4 B;  2J6T A;  8ICJ A;  4F92 B;  4QZE A;  4NLB A;  4QZD A;  1L3T A;  4O3R A;  2FPM A;  5IIN A;  2P6R A;  8ICU A;  1JI7 A;  4YD2 A;  3H8W A;  4OJL A;  1BPD A;  5JUM A;  4KLD A;  5DKW A;  2HOQ A;  5J0X A;  5KG5 A;  1PK1 B;  4DL6 A;  4F4W A;  2EAN A;  4DQR A;  2EAO A;  2K60 A;  2PMZ C;  3PVX A;  1MQ3 A;  5HR7 A;  2ZJ5 A;  3MC1 A;  4TUP A;  3GIJ A;  4LJX A;  4YMO A;  3RAQ A;  1H38 A;  2EH9 A;  4RQ0 A;  5GTH U;  4TUQ A;  4BJQ A;  1ED1 A;  4KLF A;  2PKE A;  8ICH A;  2JGA A;  2JV3 A;  2YB1 A;  4BWJ A;  4US9 A;  4I2E A;  3NRZ A;  4Y2R A;  5AK6 A;  5CB1 A;  3UXN A;  5KTQ A;  5JU5 A;  1QCK A;  4B9N A;  4F8R A;  2ZUC A;  5L1M A;  2BPC A;  5AM5 A;  2HI0 A;  2W9M A;  2ES6 A;  2W3S A;  1S8O A;  3F2D A;  2D6F C;  4RNM A;  4RQM A;  3NVW A;  3H7I A;  5DQI A;  3N28 A;  3L4P A;  3WK4 A;  2BCU A;  4QW9 A;  4YP3 A;  5EE3 A;  1NK7 A;  1D8Y A;  4C4R A;  3BJY A;  2P6U A;  3OJS A;  1SV0 A;  3D2Q A;  1U4B A;  1RZT A;  3QZ7 A;  5D4B A;  4KX5 A;  3IV6 A;  1OUQ A;  4GXJ A;  5EE0 A;  1SL2 A;  1X9S A;  1ECW A;  5AKH A;  2JZB A;  2DWQ A;  3MDA A;  3F53 A;  4I29 A;  4KLQ A;  5DDY A;  2ASD A;  5AI6 A;  2NYV A;  1SIJ A;  2PFQ A;  4KLH A;  2BCR A;  2OWO A;  5KFV A;  3B9J A;  2ZIU A;  4KMO B;  4Y2S A;  2UVU A;  4UAR A;  4NV0 A;  5KFE A;  4UAZ A;  1L8O A;  3BZC A;  2FPL A;  3JPP A;  4B9M A;  1RXW A;  2KFZ A;  4NL9 C;  1DK3 A;  2Y1I A;  4I2G A;  4IR1 A;  3U26 A;  7ICK A;  3UQ0 A;  5KFB A;  8ICG A;  3QXG A;  3H40 A;  4ECQ A;  4EEL A;  5AK3 A;  5ALK A;  1NNL A;  3SAF A;  2A19 A;  2UVV A;  3PW7 A;  2Y1J A;  2E8N A;  2F8L A;  2AU0 A;  3TQ1 A;  3GV7 B;  2KMD A;  4P0Q B;  2FI1 A;  2G0A A;  2KVS A;  2FMS A;  3K1R B;  3PMN A;  4J9O A;  2PFP A;  1WWV A;  5KFZ A;  4IC9 A;  2EDU A;  4I2A A;  4R63 A;  2JEI A;  3H0M B;  4A8E A;  4DL5 A;  1MA7 A;  5KT3 A;  4RQ4 A;  2XO7 A;  5KFS A;  3QUC A;  4U7C A;  1U9L A;  2AH5 A;  1UA0 A;  2AXT U;  2JH7 A;  3SR6 A;  5KFH A;  1KFD A;  5AKE A;  2C2R A;  1N48 A;  3PW2 A;  1ZQB A;  2FMQ A;  5DBC A;  3M9N B;  1ZET A;  2VA8 A;  4RNO A;  3PX6 A;  3OHB A;  3AN1 A;  3H8S A;  1BVS A;  1NKC A;  2E1E A;  1N61 A;  3PW4 A;  3PSF A;  3H4D A;  1KN5 A;  4UBC A;  1NJY A;  4KLT A;  4UB3 A;  1QQ5 A;  1TKD A;  5J0W A;  2JEG A;  3GU3 A;  1BGX T;  3QE9 Y;  8ICV A;  2O6K A;  1XC9 A;  9ICE A;  8ICZ A;  2KZ3 A;  3LWM A;  4FS1 A;  2XY5 A;  1XU4 A;  4RUC A;  5EE9 A;  5J2H A;  2KJ5 A;  1FFU A;  4FBU A;  4FZM A;  2LBO A;  4NL9 A;  1LV5 A;  2BDP A;  3Q8S B;  1RM6 C;  5KFC A;  2XGQ A;  4F5N A;  1L3U A;  3ZDA A;  3DV9 A;  1S0M A;  3H0L B;  2LYH A;  1ZRM A;  4LZD A;  3T5K A;  1Z00 B;  1KBU A;  4KLS A;  1PVQ A;  2KNJ A;  4C80 A;  4JMU A;  4MEX A;  1KRP A;  7ICT A;  5AKX A;  5KFD A;  1URJ A;  3BS5 B;  5TIS U;  5KFU A;  1DRG A;  4RQ6 A;  3EYZ A;  3G6Y A;  5HMM A;  2W7P A;  3SEN A;  4B9U A;  2HHT A;  1BPE A;  3QZ8 A;  2FLP A;  1HIW A;  3D2S A;  3MGH A;  1KFS A;  4EX6 A;  2FDR A;  2NRV A;  3AQF A;  4YCX A;  1LKY A;  7ICI A;  4ELV A;  4QNL A;  5DG8 A;  2WF5 A;  5ALX A;  9ICN A;  2BCS A;  2XC9 A;  2VJ5 A;  1LB2 B;  4CF5 A;  4TUR A;  4IRD A;  2I9G A;  5J2K A;  2MRL A;  5L1J A;  1WCL A;  1RYU A;  1PVR A;  2R18 A;  1ZQO A;  5DBA A;  3FAH A;  1F0M A;  3OTQ A;  5KFX A;  2KFN A;  3SV4 A;  2XIC A;  1S0N A;  1SKW A;  2ASL A;  4KX3 A;  1L7N A;  2RP5 A;  2AGQ A;  8ICC A;  3UMC A;  2WF8 A;  2JHD A;  3AQE A;  2QB0 B;  1X9M A;  5T14 A;  1ZQG A;  1KL9 A;  4EEN A;  4EYH B;  3ETL A;  1VDV A;  2FLN A;  3G6X A;  3QNM A;  3WKC A;  3BS5 A;  3O0F A;  2M0N A;  2B6G A;  4F2R A;  4YQW A;  1ZJM A;  1JXL A;  1TAM A;  1JRP A;  2HHU A;  2R8G A;  2IOF A;  1UT8 A;  5J2I A;  1XSP A;  1SWW A;  2F1H A;  4EBE A;  2J6U A;  2OXO A;  4EBC A;  3QEA Z;  4RU9 A;  2J6S A;  4UAV A;  8ICB A;  1NZP A;  1CRX A;  1QH9 A;  1DGS A;  2HBK A;  3RB6 A;  4B9L A;  4XRH A;  1D9F A;  5ALR A;  8ICP A;  8ICM A;  2DUY A;  4C4T A;  4B9S A;  5D49 A;  4DSI A;  4JWN A;  5C0Y A;  5ALV A;  4QWD A;  4EYI B;  3RBD A;  4R64 A;  2JEJ A;  5AHX A;  3RB3 A;  4MF2 A;  4JK1 A;  5KT2 A;  5J0P A;  2V4R A;  2ZG6 A;  4ICA A;  2FPK A;  2Z7J A;  3ORY A;  4DFJ A;  3I1Y A;  3KOO A;  9ICG A;  3N7R C;  4OD0 A;  1BPX A;  3C5G A;  2OYY A;  4YG2 A;  2LHT A;  1JXE A;  3TKA A;  4CF3 A;  3KZI U;  3RAX A;  4QWC A;  3M7D A;  1T4G A;  2W9B B;  4I2C A;  1B43 A;  4O3N A;  4IQW A;  5L1L A;  1OW5 A;  2MSN A;  4ELT A;  5CHG A;  2MAX A;  4GFJ A;  1ZRN A;  4QZA A;  8ICT A;  2KTQ A;  1RYR A;  1MC8 A;  1ZOL A;  2F1I A;  5KFN A;  3NRW A;  1TK0 A;  3GV8 B;  2HHW A;  1JAL A;  1VJ5 A;  5IIO A;  2Y9U A;  5EE1 A;  3RJH A;  3RR7 A;  1QSL A;  2OH2 A;  4YMM A;  1BPZ A;  3BQ7 A;  7ICF A;  2JZB B;  3JPO A;  2ZJA A;  1P7D A;  3ETR A;  3MGV A;  2K4I A;  2ESE A;  4M6W A;  5AKG A;  4PPX A;  4DLE A;  4HAI A;  5A0L A;  1KEJ A;  1S5L U;  5KG6 A;  3MR2 A;  3UQ2 A;  5L9X A;  2W55 A;  4F72 A;  4F5O A;  1TK8 A;  5KFI A;  4P0P A;  5EWG A;  2EAP A;  8ICL A;  3AU6 A;  5ALM A;  3V6K A;  5J29 A;  4C7Y A;  2G5I B;  1ZQK A;  2BQR A;  3RH5 A;  4M47 A; 
#chains in the Genus database with same CATH homology
 2DF4 B;  2KJ9 A;  3AQF A;  3ICX A;  3VC8 A;  1OUQ A;  2G08 A;  3PSP A;  2YX8 A;  2VJ4 A;  3VCB A;  4ACO A;  5HR6 A;  3HKZ F;  3CP8 A;  4QIW C;  2E5S A;  2K4H A;  4QNL A;  4NLB A;  3ONN A;  4O3M A;  2RHF A;  2K89 A;  1ECW A;  2G5H B;  2ZIX B;  2H3Z A;  5KL8 B;  2ZG6 A;  2F76 X;  4ICA A;  2Z7J A;  2F2A B;  3N7S C;  4PL2 A;  1XNS A;  2CRX A;  1YT3 A;  2E1E A;  4PL1 A;  3KFU F;  4OJL A;  2W04 A;  2K4E A;  2CPR A;  2GOL A;  2BDU A;  2VJ5 A;  3N7R C;  3PSF A;  3C28 A;  3F53 A;  4OJP A;  2OYY A;  3T79 A;  2DQN B;  3SMV A;  5CRX A;  3IG5 A;  2HOQ A;  2MRL A;  3IN5 A;  2LHT A;  1A6S A;  2ZXH A;  1Z19 A;  2HBM A;  2K8A A;  2Q4T A;  3M7D A;  3N7P D;  2R18 A;  4CDG A;  2G09 A;  3LVV A;  2KHV A;  3SAH A;  1PVR A;  2KVC A;  1Q3V A;  4AYB F;  3GU3 A;  2PMZ C;  2JMG A;  2NV3 A;  3GZF A;  1L6N A;  2G07 A;  2ZIU A;  4KX5 A;  5HR7 A;  2H3V A;  4KMO B;  4NLC A;  2HBJ A;  4NWI A;  4OJ5 A;  3L3F X;  3H0R B;  2XI9 A;  4NV0 A;  3F5E A;  2XIC A;  3F2C A;  2KKV A;  1ZQ1 C;  1A0P A;  2RP5 A;  4KX3 A;  2KEY A;  2W03 A;  1NZB A;  2WB1 F;  4BX9 C;  2LYA A;  2KJ5 A;  2HOF A;  2XID A;  2JHD A;  3AQE A;  4GFJ A;  4FZM A;  2LBO A;  5T14 A;  2ZIV A;  4BJQ A;  1ED1 A;  2JGA A;  3NUQ A;  4OO1 J;  2G06 A;  2YB1 A;  2WB1 C;  3D2N A;  2A3V A;  1D8B A;  2HBL A;  3M6Z A;  2KIC A;  3NRW A;  3PSI A;  1Z1B A;  2CN1 A;  1HEK A;  4QJF B;  1UPH A;  2W7O A;  4CRX A;  2ZIX A;  2KIW A;  3SAG A;  2KV2 A;  3IP4 B;  4OJO A;  3SAF A;  2KHQ A;  2ZIW A;  4OJ6 A;  4CGZ A;  3H0L B;  2VIX A;  2Y0S F;  2PMZ F;  2HMX A;  2OM6 A;  4FE3 A;  3F2B A;  4FZN A;  2F8L A;  2KD1 A;  2E1F A;  3O0F A;  2H3Q A;  2M0N A;  3C29 A;  3DEE A;  3K1Z A;  2ZIV B;  4FZL A;  2OH2 A;  2WAQ F;  3F5A A;  1TAM A;  4P0Q B;  1KBU A;  5KL1 B;  4P0P B;  2G0A A;  2HOI A;  1PVQ A;  2K8B B;  3M6K A;  1P7D A;  2KNJ A;  2Y0S C;  2RRD A;  4JMU A;  3MGV A;  2K4I A;  2ZXI A;  4IC9 A;  2WAQ C;  2LYB A;  2OXO A;  2ZIU B;  3F2D A;  2D6F C;  2MA1 A;  3RFA A;  1Q3U A;  2KOB A;  1URJ A;  3SQI A;  3KZX A;  4C0Z A;  2YB4 A;  3H0M B;  2XVT A;  1IIP A;  3OPX A;  3RF9 A;  4A8E A;  5A0L A;  1DRG A;  3E0F A;  4U6P A;  1MA7 A;  1CRX A;  1F44 A;  2GH1 A;  2HBK A;  2KJ8 A;  3CRX A;  4P0Q A;  3IG8 A;  3LVW A;  2VKQ A;  2JH1 A;  4P0P A;  1T94 A;  2W7P A;  2H3I A;  2KKP A;  3CYM A;  3AL0 B;  2LKY A;  3LYS A;  1XO0 A;  1PVP A;  4U7C A;  2JH7 A;  3PST A;  4BUG A;  2K8C B;  3D2Q A;  1HIW A;  3D2S A;  1SZH A;  4QIW F;  3HKZ C;  1WUD A;  2G5I B;  4WJ3 B;  1GO3 F;  2DGZ A;  2N1R A;  3ALR A;  5C0Y A;  2ZIW B;  2H3F A;  2F77 X;  3PZP A;  4AYB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...