2K8AA

Solution structure of a novel ubiquitin-binding domain from human plaa (pfuc, gly76-pro77 trans isomer)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase A-2-activating protein
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8aA00
3PSTA 2K8CB 2K89A 2K8AA 3L3FX 2K8BB 3PSPA
chains in the Genus database with same CATH superfamily
3AU2A 2BPCA 4KX3A 3A0BU 1S8OA 4DO9A 4J9LA 3E2EA 4DOCA 1EXNA 3V7KA 4ELVA 4F4XA 2JH7A 4XUSA 3V7JA 3PO4A 2F44A 4TUPA 1F5SA 4IQVA 2IOHA 2NO4A 4O3NA 3ZI4A 4MEXA 3WKEA 4F92B 3NUQA 1RPLA 4XQ8A 5CB1A 1U9LA 3SAFA 8ICCA 2WAQF 3ISDA 3PW5A 1DK2A 4RQ8A 3SMVA 1ZD3A 1UT8A 2YB1A 3JPOA 4ECVA 3AQEA 8ICHA 1ZQQA 1MSWD 5AI4A 3BS5A 2R8KA 4DL4A 3UMCA 5J29A 1ZD5A 5IINA 2ZIUA 9ICSA 4I2HA 2XC9A 5KG4A 3QEBZ 1B22A 2E8OA 1D8LA 1TAMA 2UVRA 3PSTA 4G9BA 4ECQA 4F72A 7ICVA 4EBEA 1VDVA 5HMMA 4FZNA 2ZJ8A 3C1ZA 9ICRA 1KLNA 1Y88A 2BGWA 1KSPA 4ED8A 4C0ZA 4GC6A 4QIWC 5EE3A 4PZNA 3UMGA 5AIBA 1DXSA 9ICIA 1K1SA 3UPQA 2RQ5A 4I27A 1C7YA 3PY8A 3MR5A 4Z6FA 9ICOA 1RXWA 4PHPA 2XY5A 3CP8A 2FLLA 5IIOA 2ZXIA 3IN5A 3CW2C 2HHWA 4DFDA 5CWRA 1Q3VA 2R8HA 2HDOA 2FPLA 3V6HA 4ECUA 2UVUA 2JEGA 1H38A 3WKAA 2HOIA 4A8EA 2FMSA 5CEHA 2PI4A 7ICPA 1JI7A 4RNNA 3TACB 1BVSA 4NLBA 1UA0A 2KJ5A 1CI4A 5AICA 3T3FA 1RG6A 4DL6A 2ISPA 4EX7A 5J2HA 4IC9A 3SEIA 3RAQA 1KL9A 1N2XA 4M6WA 2D6FC 5DGAA 5CJ7A 4WJ3B 3QNMA 1MQ2A 2H5XA 1ZQTA 4PJ0U 4EEKA 3FC4A 4RQ7A 2K8CB 4ED1A 2W3SA 3MGHA 2DPJA 3OSPA 3NASA 3NS1A 4F5NA 2FMQA 3Q8KA 2XI9A 4O3MA 2GOLA 2VJ4A 8ICBA 5JUMA 2YN4A 3OHBA 2WFAA 7ICSA 4UB4A 4PH5A 1M6YA 4ECXA 4TUSA 4I2IA 5G5GA 2GWSA 3MFHA 4RQ1A 1N5WA 4DLEA 4I2EA 2KVSA 4Y2TA 3N97B 4FBTA 4UB2A 5JU5A 1DK3A 4CE6A 1D8BA 5ALZA 1AROP 2KJ9A 3CRXA 5BOMA 4R8UA 3UQ2A 2EQYA 8ICOA 1T3QA 1YZ6A 4RUCA 5K4LA 5J0SA 1RQNA 2VA3A 4UASA 4NLCA 1QLNA 2ZTDA 5AI9A 3TQ1A 2J6SA 5DB7A 1KBUA 5KFTA 1QQ7A 5ALVA 2A1JA 5ALWA 1SV4A 3IP4B 4B9MA 1FIQA 7ICMA 1RQLA 1X9WA 1YT3A 4JWNA 3AN1A 2A19A 3GIJA 1NKBA 3QU2A 3T5LA 5AK3A 2G5IB 1FO4A 4J9KA 4LZDA 2YMLA 2HBMA 2V4QA 1T8EA 3BQ0A 5DB6A 4JK1A 5J2KA 3PX4A 1J2NA 5KG5A 1FFVA 2PFQA 5ALHA 7ICTA 3MFIA 5JRTA 1Q46A 5KL1B 3HT3A 3EW9A 4PL1A 4QZFA 3AL0B 4O5EA 3EUB2 2DGZA 1HJPA 2WTFA 2K4HA 5KG1A 3M9NB 5HHIA 3BS5B 2KNJA 2PKEA 1DGJA 4ELTA 4MF8A 4FS1A 2BR0A 1JN3A 1NK0A 5ALJA 1X6IA 2I1QA 3QU9A 2ZIUB 2J6TA 2KIWA 4F93B 3HJEA 5CP2A 1TVAA 1KDHA 2EDUA 4NLKA 1UHUA 4Z6CA 5KFDA 2L5YA 5G5HA 1Z4NA 4NY8A 4MFAA 3BS7A 2KP7A 4DQSA 4LZGA 3ICXA 3JPRA 1N60A 2YMPA 1D9FA 3CYMA 5J0TA 4YP3A 4DSEA 3RB0A 9ICNA 5J0RA 2W7PA 8ICWA 3HPOA 4US8A 4B9TA 3PV8A 1LB2B 8ICNA 3C28A 5AKHA 2IBKA 1QH9A 3F2BA 1URJA 1KFTA 3JPNA 4IS7A 2Y1JA 1PVPA 3BQ2A 3SV4A 1T94A 2XIDA 3RRGA 2G5HB 1JIHA 2DKZA 2GLEA 2KICA 3BJYA 3N7PD 5CHGA 2V4RA 4GLXA 5DLFA 4IR1A 4NL9C 5BPCA 3IG8A 5KL8B 4QNLA 1D9DA 1PK1A 3PX0A 2KMDA 9ICVA 3KKAA 8ICRA 4CDGA 4I29A 3EZ5A 4QWAA 3I28A 4QZ9A 4DS5A 4DOAA 4K4HA 4KLTA 2JHDA 4KLOA 2HHVA 3HILA 2ISOA 4M6WB 2K89A 2R18A 5KT6A 2DBYA 3Q8RB 3SQIA 4PGYA 3QZ8A 2WAQC 5EWEA 1NKCA 3C5GA 3RR8A 4NLNA 2ZJ5A 2AU0A 1ZYQA 7ICHA 5HP4A 1JMSA 4RPZA 4RT3A 3RJFA 3OGUA 1ZQXA 2A3VA 1ZQZA 5J8YA 1QCKA 3HX0A 2HVIA 5KFNA 4BX9C 5D4BA 2AH5A 4FBUA 2E8MA 2I9GA 8ICQA 1J97A 2XY6A 1B4FA 3F5EA 3QXGA 2PFNA 5AI8A 5KT4A 5L1MA 3SYZA 4UATA 4YG2A 4YR0A 5HR6A 4Y2QA 3JPQA 3WU2U 5KFUA 2BDPA 4QWCA 4PHAA 1SWVA 2K8AA 3PMLA 4Q44A 2KHVA 5AIAA 1JX4A 1QSLA 3SENA 4RZRA 4YQWA 4DS4A 2IA6A 3L3FX 2KZZA 5AK4A 5KG3A 3IV6A 3D2NA 1Z1BA 1WG8A 4R8UB 3TKAA 1NK8A 3PZPA 2JZBA 3ORYA 4Y2PA 5ALXA 4QWDA 1IV8A 3QX7A 4Q8EA 5JTIA 7ICLA 5L1LA 2OCEA 1U45A 3L4PA 3UMBA 4FZLA 2D8CA 4KLIA 4EZ9A 4P0QB 4YR2A 4GFJA 4F5OA 2JEFA 2YX8A 2A1JB 4F50A 5KFBA 1ZQNA 3H8SA 5KFJA 4OD0A 2OEHA 3MR6A 5KT7A 1TE2A 5AK6A 1SV0C 8ICPA 4DSFA 5KFGA 2CPRA 1IIPA 4F2RA 1QQ6A 4DSKA 4O0IA 3FAHA 4LJXA 3EWAA 5KNIA 3SR6A 4YFKA 4UB5A 2MSNA 3BQ1A 3LYSA 4IRDA 1KN5A 1ZQJA 5KG7A 4I2JA 3MBYA 2G0AA 5DG9A 3OPXA 2GO7A 9ICJA 4B9VA 2W9CA 3N28A 5J2EA 3H0RB 5D49A 1NOMA 3PO5A 5DDYA 3WK8A 7ICNA 1O08A 2EAMA 1WWUA 1TFRA 4PL2A 2BHNA 4GIBA 4PPXA 1ZQGA 5AKZA 4EBCA 4NM2A 4BXOB 2MAXA 4CF4A 5KFZA 1CRXA 1RDFA 4C80A 4BDPA 4IQTA 2NRZA 3H4DA 8ICGA 2JXJA 4J9RA 1OUQA 3PSIA 4NLZA 4Y2XA 5AM2A 4Q8FA 3MGIA 5DQHA 4Q43A 3D2SA 1RZTA 2YY6A 2ASLA 4YMOA 3T79A 2QARB 4HAIA 4RU9A 2ZUDA 1PUZA 3ISBA 1MN8A 3KFUF 2WHEA 4DQPA 4ICAA 4Y2SA 1L3SA 3SV3A 3IDWA 4ECZA 5AKXA 4M9HA 3THVA 4ZH4A 2R8GA 2QKQA 4KLUA 9ICGA 4QZHA 4B6JA 1MC8A 3WK6A 4B9LA 4O5CA 1IG6A 2HMXA 3TADC 2H3QA 2BPGA 1JROA 3E0FA 5KG2A 5TISU 3CNHA 4R64A 3BQ7A 1BPEA 2Y1IA 4C4TA 4CRXA 4DCCA 2AGPA 3UXOA 1JRPA 1L7MA 3MDAA 2BCVA 2BCQA 2KSOB 2W54A 5AKEA 5B66U 4IQWA 4EX6A 2JMGA 5KT2A 5A0LA 2Q4TA 1BPDA 4M47A 4F5PA 3T5HA 2LPEA 1SB3C 3RFAA 4QWEA 4IRCA 3H0LB 2Y9TA 4YD2A 3RB4A 2XY7A 2AXTU 5KT5A 3C29A 4G3IA 2H3ZA 4C7YA 2Z7JA 1SKSA 4UARA 5ALTA 1KKXA 3MC1A 5KTQA 1ZQIA 2P66A 3OJSA 2XICA 3GQCA 4AYBC 8ICYA 5HR7A 4R63A 5ALYA 2KEYA 5AI6A 2HBJA 4C4RA 1S0VA 3GIMA 3ETLA 4EBDA 3NVVA 2E1EA 3N7SC 4O3SA 2HBKA 2KKPA 1ZJMA 2VIXA 4FS2A 3TARA 8ICEA 1F0MA 5DQGA 5J2JA 3G6VA 4M2YA 3QUTA 2MUTA 2DL0A 3G6XA 1ZQLA 3NVZA 1MA7A 2NRTA 4MFFA 1VLBA 4PHEA 2EZZA 5KFEA 3WK9A 5IIMA 2HBLA 3DDHA 4J03A 2QLTA 3UQ0A 4KMOB 4YN4A 1KFDA 2ZIWB 4O3RA 4UAVA 3M7DA 4YMNA 4ECTA 1ZD2P 5ALKA 4KLEA 4FE3A 2H3FA 4MHVA 5EE0A 1FEZA 3PW4A 4ELUA 2JGAA 1UPHA 2OXOA 4B9UA 3RAXA 3AU6A 4OJPA 4O3OA 5KFIA 3T5JA 2LYBA 5AKGA 1VJ5A 3PNCA 3M9MB 1T3NA 5KFRA 3EPGA 3SAHA 4OJOA 5J2FA 1V85A 4O3PA 2KIVA 4Y2UA 3DEEA 4UB8U 2BCSA 1QTMA 4CGZA 3QZ7A 2ES6A 4DFKA 4FFDA 5AM3A 1KFSA 4KLQA 4ECYA 1PVRA 1ZRNA 4KLJA 5AI5A 2MU2A 1RYSA 2OH2A 4DL2A 1Q8KA 2W9CB 2Q0ZX 4B9NA 1QQ5A 4DFMA 2KZMA 1XSLA 2BCRA 1U4BA 1HEKA 1ZQUA 2AQ4A 4K4GA 2ZUCA 1HUZA 1U47A 1LKYB 3RJIA 3TI0A 2KJ8A 3ALRA 1ZQHA 3V6JA 2YMQA 1N56A 3NVYA 1XO1A 4US9A 3AMZA 3LWMA 3N4MB 2EZXA 5ALDA 2A1AA 5IIKA 4DL5A 4M0AA 8ICZA 1TKDA 5KG0A 4QZEA 1B43A 2WB1F 5BOLA 3T5KA 2ZIXA 4C8LA 2XCPA 4CCHA 4O5KA 2ATLA 2E8PA 3IG5A 1X9MA 2AQ0A 4EYHB 2W7OA 2PMZF 5KAFU 3LVWA 2KKVA 1SKWA 4I2AA 4RQNA 2RHFA 4UB1A 2KE7A 2KFNA 3U26A 4AYBF 3K75D 5DBBA 2XVTA 3TFSA 4YXJA 1C20A 4P4PA 3H40A 2K8BB 4NLGA 1O03A 3V72A 2HHSA 1KW4A 4R65A 3M8SA 4DLGA 2KTQA 4F5QA 5HNKA 4OJ6A 1XO0A 4Y2RA 1T7PA 3HRDD 1X66A 3G6YA 4BWMA 2W8LA 2ZTEA 4F2SA 3RJHA 1X6JA 3OSNA 2CN1A 4DF8A 3AEVA 2DUYA 1U49A 5EE9A 1S97A 5CA7A 1L3TA 3M6ZA 4QZDA 1ZQBA 1CUKA 4JMUA 2F2AB 7ICJA 2F1HA 3WK4A 2HOQA 5KFQA 3M8RA 4I2BA 4KITB 2IOFA 3QEAZ 4MFCA 3B0YA 2RDJA 3BQTA 4QZIA 4GC7A 5AK5A 5J0OA 2W9BA 3Q8LA 3IM1A 3GV7B 4QZAA 1NKEA 9ICXA 1ZQOA 3Q8SB 5KFMA 4IR9A 5AM5A 1ZQEA 3QUQA 4YD1A 5J2GA 1ZQ1C 4I2CA 5KFHA 3GIIA 2LKYA 3KBBA 4F4ZA 2MUTB 5AM0A 2FE9A 2RLTA 2P6UA 4C4SA 4NJ8A 4BUGA 1Q3UA 4ECRA 5AKKA 4YVZA 2XGQA 2K4IA 2P35A 3A0HU 4RT2A 2Y0SF 8ICLA 1ZOLA 3WKDA 5J2DA 3WKBA 9ICWA 1WWVA 2R8IA 4Y2VA 1L3VA 1S76D 3IRUA 2F8LA 5KFPA 3EPIA 4P0PA 2LBOA 5B5EU 2FPMA 2ESEA 3PSFA 4QZCA 4ED2A 4X5VA 1NK9A 2K4EA 1OW5A 1NI3A 2VA8A 3I1YA 5DG7A 4RQ2A 4DOBA 3C5FA 3MGVA 1F44A 4UB6U 5AKIA 5AKYA 1WCLA 5CR0A 2DPIA 4I2GA 4GXKA 3PW7A 3VC8A 1Z3EB 5EWGA 2KD1A 3B9JA 5KFFA 2EANA 1RYUA 2E5SA 1BNOA 5ALUA 3K4GA 2C22A 5F3XB 1RXVA 7ICGA 2HHTA 2K4PA 3O0FA 2ASJA 4DEZA 1KQQA 4M04A 2ZUBA 4GXJA 2O6KA 2F77X 4NXZA 1SWWA 2LHTA 2RRDA 5DBAA 3PW0A 2FMPA 2VKQA 2MRLA 4NL9A 2B0CA 4KTQA 4ECSA 8ICKA 1DRGA 3ED5A 4C7ZA 1V97A 5J0XA 4J9QA 2F3NA 3PX6A 2ALZA 1WCNA 5KFSA 3ZD8A 4DF4A 3KHHA 1KTQA 2PFOA 1A0PA 4RPXA 1L7NA 2LM1A 5J0WA 3PSPA 9ICFA 5KFYA 4C8KA 4QZBA 3RJGA 5ALGA 3LDAA 3V6KA 3QE9Y 7ICQA 1TK8A 3RH4A 3UM9A 2ZIXB 1Z19A 2KN7A 2LYAA 5AM1A 1X2IA 2H3VA 2ZG6A 4DQRA 5L1KA 5TZVA 5J2BA 2I6XA 2NRWA 7ICUA 4RQ3A 5ALEA 7ICOA 1XWLA 1AQ6A 9ICAA 2E8NA 4NM1A 1S0MA 2NRVA 1ZRMA 2GH1A 2W9MA 5J2IA 2DWQA 8ICUA 4QW9A 1ZXIA 2AJQA 3SAGA 4QJFB 5KFAA 5CRXA 2M0NA 2B21A 9ICKA 4Z6DA 5DDMA 2YQEA 1V38A 5GTHU 4BGDA 4P4MA 1A77A 2W04A 2KG5A 5E79U 1BPXA 9ICLA 2J6UA 1A76A 1BPYA 3GFKB 4F4KA 5IILA 1S0OA 5D46A 3H8MA 5DGBA 5KFKA 1FFUA 2RP5A 4KMUA 1NK5A 2QB1A 4P4OA 5J2CA 4PGQA 2XO7A 4OO1J 1BPBA 1SL0A 2EAOA 2CRXA 3HP6A 1NK6A 1BGXT 3OJUA 9ICQA 2HHUA 3GDXA 1SV0A 4IL6U 1NJXA 3MR2A 3GILA 2W9BB 4JUZA 2NYVA 3EYZA 2YB4A 2M9NA 1XS9D 4J9OA 2W3RA 2XCAA 2AHOB 1Z00A 2BCUA 3F5AA 2NRXA 4NV0A 2OWOA 8ICAA 4KLGA 1RM6C 3VCBA 3FM9A 4UAWA 4I28A 9ICMA 1L7OA 3C2LA 4F5RA 5F9NA 1Z1VA 3L5KA 4KN7A 1NZPA 3PR5B 3QU5A 3C2KA 1PK1B 1TAQA 4JV2A 3Q8QB 5J0QA 3RJJA 5L1JA 8ICFA 2WB1C 3PVXA 1QSYA 1RYRA 5IIJA 4LVSA 3RH6A 4JV0A 2ZIVA 2OYYA 2EAPA 4JB3A 4KLDA 1KEJA 2WF6A 2PMZC 2G08A 1S9FA 3TFRA 5EWFA 1ZQMA 4F91B 2Y9UA 9ICEA 4I2DA 4PGXA 2W43A 2E3TA 4P0PB 1P7DA 1X42A 3PMNA 3H4BA 3ZDEA 2JV3A 1IXRA 1TK0A 1ZQAA 2PFPA 4Y2YA 3PW2A 3SZ2A 2VA2A 3KD3A 1V9PA 3I76A 5GTIU 4F4YA 3GV8B 1A6SA 5ALRA 2HW3A 2NO5A 2R8JA 3BZCA 3M9OB 5KFOA 3F2DA 3RJEA 1NJYA 4PZOA 2BQ3A 2D3DA 2LYHA 3AQFA 2W8KA 3K1ZA 5KFWA 3QU7A 3AM9A 1TK5A 2UVWA 1COKA 1JUDA 1ZETA 4QZGA 3RF9A 3TADA 4F4WA 1SL2A 4RNOA 4KLFA 1SXDA 1ZQDA 4QWBA 5C0YA 5AKJA 4MF2A 1TAUA 4EZ6A 4KLHA 4ED0A 1TV9A 2HHXA 3ZDDA 2C2EA 2ODGA 5KFLA 5L1IA 2BQUA 4TQSA 3C23A 2JZBB 8ICJA 2CXYA 5DBCA 7ICEA 2QB0A 8ICTA 2HVHA 5DB8A 4UBCA 4UQGA 2DFLA 2HSZA 4F3OA 2FPKA 3M6KA 4DWIA 2KZ3A 3WK7A 1UQVA 2W11A 3ZDAA 1SKRA 5ALLA 2LMRA 7ICIA 3OHAA 3R9KA 4QZ8A 3IHQB 4UW9A 3JPSA 1X9XA 2HCFA 1ZQKA 3TANA 2RDIA 4M9NA 1S0NA 2OM6A 1N63A 2FLNA 1DGSA 3NGDA 4ACOA 4DFPA 1L5UA 1NNLA 2BKEA 4ED3A 1N61A 5HMLA 2KV2A 1SIJA 4RUAA 2ASDA 2MA1A 4DFJA 3ZDCA 4C8NA 3N7RC 2Y0SC 2PI5A 2FDRA 3V7LA 3QUBA 4C8OA 1S10A 3ZDBA 4CF3A 3KZIU 1UT5A 5H2FU 4RNMA 4Z6EA 1UA1A 4M9JA 3JPTA 4OCZA 1U48A 2K60A 4FO6A 2JH1A 3NRWA 3LVVA 4ED6A 3H8WA 1BNPA 1ED1A 4USAA 4UAZA 1ZQFA 2W03A 3Q8PB 3KHRA 1K1QA 2KVCA 3QU4A 3QYPA 3WKCA 1Z4OA 4ZOHC 5ALIA 1HUOA 3KHGA 4Y2JA 4P0QA 3NTUA 2HHQA 4RQMA 2G09A 3HKZC 1DOQA 1PVQA 4EENA 2B6GA 1ECWA 8ICXA 1SGGA 3KOOA 5KFCA 3MDCA 4J9PA 1WYGA 3D6JA 2F76X 3TAPA 4TUQA 4QIWF 3B0XA 2KK0A 3F2CA 1NJZA 1IM4A 4KLMA 4OJLA 2AGOA 2C2RA 4DQIA 7ICKA 5T14A 2G07A 4YXMA 5AM4A 3UXNA 3KZXA 1NJWA 2H3IA 2BPFA 4F71A 8ICMA 2VJ5A 3MR3A 2EH9A 5KFVA 3KKAC 1COOA 1Z00B 4UB3A 4O3QA 1ZQVA 4AP9A 1NZBA 5ALQA 4ECWA 5ALFA 3PR4A 1ZQWA 4EELA 3HWTA 4XRHA 1GO3F 2JR5A 2XGPA 4BXOA 3RB3A 1ZJNA 4ED7A 4J9MA 1XSNA 4DL7A 4KN4A 4DSJA 1N62A 4RQ0A 1ZD4A 8ICIA 1JXEA 2DKXA 3RJKA 3KHLA 2EZYA 3F53A 2OHFA 2ZIVB 2QARA 2IHNA 1WUDA 3MABA 2C2DA 4K4IA 5J8YC 2F1JA 2ZXHA 3GIKA 3FDSA 1PZNA 3ETRA 4KLLA 3LWLA 3Q8MA 4C8MA 3BDPA 4J9SA 9ICCA 3D2QA 5ALNA 1L3UA 3UXPA 4DQQA 8ICSA 1J2MA 2AGQA 5DG8A 2DF4B 2FJ6A 1UCVA 3ISCA 3C2MA 5ALMA 5J0YA 1X40A 5KFXA 2KHQA 3C21A 1ZQRA 3RH5A 1XSPA 1JXLA 1ZQCA 5L9XA 4HYKA 4Q45A 1D8YA 4F8RA 2JRZA 5DQIA 5EOZA 2KSOA 3H8JA 2HOFA 1SXEA 4RPYA 3RB6A 4M9LA 4JV1A 2WF5A 3RRHA 4KLSA 3S6JA 3DV9A 2N1RA 4CNQA 5KG6A 3FYHA 2F8KA 3GZFA 5DB9A 2JEIA 4UAYA 1K5OA 3SD7A 4M9GA 5DKWA 4RQ5A 4DSIA 4DL3A 4UAUA 2KOBA 2YMMA 2VANA 3NVWA 1S5LU 4CF5A 4R66A 4YCXA 2NV3A 4UBBA 1MQ3A 2QB0B 2WF9A 3TAQA 3QUCA 7ICFA 3NRZA 4U7CA 4EEYA 2BDUA 3WK5A 2WF8A 2IOFK 4JWMA 1NK7A 1OXJA 4BJQA 3M1YA 5ALPA 1X9SA 2C28A 2FI1A 1SZHA 3H0MB 5AI0A 4MEYA 4U6PA 3HKZF 3JPPA 3RTVA 1XC9A 2KFZA 5J0PA 4J9NA 1N5XA 5KT3A 9ICPA 1T4GA 5AHXA 3ZD9A 3J81j 7ICRA 1YZ7A 2W55A 4TQRA 1L8LA 1L8OA 4TURA 1XU4A 5F9LA 5J2AA 1JALA 3OTQA 4PHDA 4NWIA 3E58A 9ICTA 4YMMA 5AKLA 3AUOA 1B0XA 1SZPA 2UVVA 2PXIA 4GXIA 3HW8A 2ZIWA 2YTUA 4IQUA 3RBDA 5HHHA 4O9MA 3SI8A 3K1RB 4RQ6A 1NK4A 3BZKA 1PK3A 1LVHA 1SL1A 4E0DA 3ONNA 2ZTCA 9ICHA 2IHMA 4XA5A 2LI6A 4BWJA 2WF7A 4KX5A 2JEJA 1L6NA 1ZQSA 4YR3A 5DLGA 2BQRA 4I2FA 2W9AA 1ZQYA 8ICVA 2V9WA 1N48A 1L7PA 5EE1A 2E1FA 9ICBA 5ALSA 4RQ4A 2G06A 2LM4A 5ALOA 3C1YA 3H7IA 3GU3A 1ZQPA 5FP0A 1XNSA 1QSSA 1S77D 2HI0A 2I5HA 5KAIU 4OJ5A 3LK9A 4FZMA 3GV5B 9ICUA 5IIIA 2P6RA 4B9SA 2ZJAA 2F1IA 4IRKA 1CEZA 5C5JA 1KRPA 5J0UA 4QW8A 4EYIB 1BPZA 1LV5A 4DSLA 1LKYA 2IMWP 2DQNB 2FLPA 3RBEA 4P2HA 3KTQA 3RR7A 1HIWA 2BZFA
chains in the Genus database with same CATH topology
2G09A 3CRXA 2YB4A 3HKZC 4AYBF 3H0RB 2DF4B 1PVQA 4KX3A 2K4IA 4BX9C 1ECWA 3ICXA 2HOIA 3F5AA 2Y0SF 4NV0A 2KHQA 4OJOA 3SAHA 2XVTA 3VCBA 3CYMA 3F5EA 2K8BB 3C29A 2JH7A 2ZIWA 4A8EA 2F8LA 2H3ZA 2Z7JA 4P0PA 4PL2A 2W7PA 2LBOA 2F76X 5HR6A 2ZIXB 1Z19A 2LYAA 3DEEA 4OJ6A 4NLCA 4QIWF 4CGZA 2H3VA 3PSFA 3C28A 1XO0A 2HOFA 2K8AA 2ZG6A 4NLBA 1CRXA 2XICA 2KJ5A 3M6KA 2K4EA 3NUQA 3F2CA 3F2BA 1URJA 1KBUA 3ONNA 1Q3UA 2N1RA 2KHVA 4OJLA 3SAFA 1PVRA 3GZFA 1OUQA 4AYBC 2WAQF 3PSIA 5T14A 5HR7A 2KEYA 2WB1C 4IC9A 2G07A 1PVPA 3IP4B 2OH2A 2D6FC 2HBJA 3KZXA 4KX5A 1L6NA 3D2SA 2CN1A 1YT3A 3SMVA 3MGVA 2H3IA 2ZIVA 1T94A 2OYYA 3L3FX 1F44A 2KOBA 2XIDA 3T79A 2VJ5A 3D2NA 2G5HB 2G5IB 2YB1A 1Z1BA 2E1EA 2GH1A 3N7SC 3AQEA 2HBKA 2KICA 4WJ3B 2KKPA 2VIXA 2HBMA 3M6ZA 3N7PD 2OM6A 2PMZC 1HEKA 3PZPA 2G08A 3VC8A 4ACOA 4JMUA 2F2AB 2NV3A 3SAGA 2KD1A 1NZBA 3KFUF 4QJFB 2ZIUA 5CRXA 2E5SA 4P0PB 1P7DA 1GO3F 2K8CB 2KV2A 2HOQA 2M0NA 3IG8A 4ICAA 5KL8B 2MA1A 2KJ8A 1TAMA 2E1FA 3ALRA 4QNLA 4U7CA 3O0FA 3PSTA 2BDUA 3N7RC 2Y0SC 4FZLA 5KL1B 4CDGA 1MA7A 4P0QB 2XI9A 2W04A 4GFJA 2G06A 4PL1A 2F77X 2GOLA 2VJ4A 4FZNA 4BJQA 4O3MA 2JHDA 2LHTA 2RRDA 2YX8A 3AL0B 1SZHA 1A6SA 2VKQA 2HBLA 3GU3A 2DGZA 3H0MB 2HMXA 2MRLA 2H3QA 3F53A 1XNSA 2K89A 2R18A 2JH1A 4C0ZA 4QIWC 3E0FA 2K4HA 2ZIVB 3F2DA 4KMOB 4OJ5A 4U6PA 2RP5A 4FZMA 1DRGA 3SQIA 3HKZF 2ZIWB 3NRWA 3LVVA 3AQFA 1WUDA 3K1ZA 3M7DA 4CRXA 2WB1F 2KNJA 2ZIXA 2WAQC 1ED1A 2H3FA 4FE3A 2CPRA 1ZQ1C 1IIPA 2ZXHA 4OO1J 3IG5A 2W03A 2JMGA 2LKYA 2CRXA 2ZIUB 2JGAA 5A0LA 2Q4TA 3RF9A 1UPHA 3CP8A 3LYSA 2W7OA 2KVCA 2PMZF 2KIWA 2OXOA 3LVWA 2DQNB 2ZXIA 3IN5A 1A0PA 2KKVA 4OJPA 5C0YA 2G0AA 3OPXA 2RHFA 3RFAA 4P0QA 1Q3VA 1HIWA 1D8BA 2LYBA 3H0LB 2A3VA 3D2QA 4NWIA 4BUGA 2KJ9A 3PSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PST A;  2K8C B;  2K89 A;  2K8A A;  3L3F X;  2K8B B;  3PSP A; 
#chains in the Genus database with same CATH topology
 3AU2 A;  2BPC A;  4KX3 A;  3A0B U;  1S8O A;  4DO9 A;  4J9L A;  3E2E A;  4DOC A;  1EXN A;  3V7K A;  4ELV A;  4F4X A;  2JH7 A;  4XUS A;  3V7J A;  3PO4 A;  2F44 A;  4TUP A;  1F5S A;  4IQV A;  2IOH A;  2NO4 A;  4O3N A;  3ZI4 A;  4MEX A;  3WKE A;  4F92 B;  3NUQ A;  1RPL A;  4XQ8 A;  5CB1 A;  1U9L A;  3SAF A;  8ICC A;  2WAQ F;  3ISD A;  3PW5 A;  1DK2 A;  4RQ8 A;  3SMV A;  1ZD3 A;  1UT8 A;  2YB1 A;  3JPO A;  4ECV A;  3AQE A;  8ICH A;  1ZQQ A;  1MSW D;  5AI4 A;  3BS5 A;  2R8K A;  4DL4 A;  3UMC A;  5J29 A;  1ZD5 A;  5IIN A;  2ZIU A;  9ICS A;  4I2H A;  2XC9 A;  5KG4 A;  3QEB Z;  1B22 A;  2E8O A;  1D8L A;  1TAM A;  2UVR A;  3PST A;  4G9B A;  4ECQ A;  4F72 A;  7ICV A;  4EBE A;  1VDV A;  5HMM A;  4FZN A;  2ZJ8 A;  3C1Z A;  9ICR A;  1KLN A;  1Y88 A;  2BGW A;  1KSP A;  4ED8 A;  4C0Z A;  4GC6 A;  4QIW C;  5EE3 A;  4PZN A;  3UMG A;  5AIB A;  1DXS A;  9ICI A;  1K1S A;  3UPQ A;  2RQ5 A;  4I27 A;  1C7Y A;  3PY8 A;  3MR5 A;  4Z6F A;  9ICO A;  1RXW A;  4PHP A;  2XY5 A;  3CP8 A;  2FLL A;  5IIO A;  2ZXI A;  3IN5 A;  3CW2 C;  2HHW A;  4DFD A;  5CWR A;  1Q3V A;  2R8H A;  2HDO A;  2FPL A;  3V6H A;  4ECU A;  2UVU A;  2JEG A;  1H38 A;  3WKA A;  2HOI A;  4A8E A;  2FMS A;  5CEH A;  2PI4 A;  7ICP A;  1JI7 A;  4RNN A;  3TAC B;  1BVS A;  4NLB A;  1UA0 A;  2KJ5 A;  1CI4 A;  5AIC A;  3T3F A;  1RG6 A;  4DL6 A;  2ISP A;  4EX7 A;  5J2H A;  4IC9 A;  3SEI A;  3RAQ A;  1KL9 A;  1N2X A;  4M6W A;  2D6F C;  5DGA A;  5CJ7 A;  4WJ3 B;  3QNM A;  1MQ2 A;  2H5X A;  1ZQT A;  4PJ0 U;  4EEK A;  3FC4 A;  4RQ7 A;  2K8C B;  4ED1 A;  2W3S A;  3MGH A;  2DPJ A;  3OSP A;  3NAS A;  3NS1 A;  4F5N A;  2FMQ A;  3Q8K A;  2XI9 A;  4O3M A;  2GOL A;  2VJ4 A;  8ICB A;  5JUM A;  2YN4 A;  3OHB A;  2WFA A;  7ICS A;  4UB4 A;  4PH5 A;  1M6Y A;  4ECX A;  4TUS A;  4I2I A;  5G5G A;  2GWS A;  3MFH A;  4RQ1 A;  1N5W A;  4DLE A;  4I2E A;  2KVS A;  4Y2T A;  3N97 B;  4FBT A;  4UB2 A;  5JU5 A;  1DK3 A;  4CE6 A;  1D8B A;  5ALZ A;  1ARO P;  2KJ9 A;  3CRX A;  5BOM A;  4R8U A;  3UQ2 A;  2EQY A;  8ICO A;  1T3Q A;  1YZ6 A;  4RUC A;  5K4L A;  5J0S A;  1RQN A;  2VA3 A;  4UAS A;  4NLC A;  1QLN A;  2ZTD A;  5AI9 A;  3TQ1 A;  2J6S A;  5DB7 A;  1KBU A;  5KFT A;  1QQ7 A;  5ALV A;  2A1J A;  5ALW A;  1SV4 A;  3IP4 B;  4B9M A;  1FIQ A;  7ICM A;  1RQL A;  1X9W A;  1YT3 A;  4JWN A;  3AN1 A;  2A19 A;  3GIJ A;  1NKB A;  3QU2 A;  3T5L A;  5AK3 A;  2G5I B;  1FO4 A;  4J9K A;  4LZD A;  2YML A;  2HBM A;  2V4Q A;  1T8E A;  3BQ0 A;  5DB6 A;  4JK1 A;  5J2K A;  3PX4 A;  1J2N A;  5KG5 A;  1FFV A;  2PFQ A;  5ALH A;  7ICT A;  3MFI A;  5JRT A;  1Q46 A;  5KL1 B;  3HT3 A;  3EW9 A;  4PL1 A;  4QZF A;  3AL0 B;  4O5E A;  3EUB 2;  2DGZ A;  1HJP A;  2WTF A;  2K4H A;  5KG1 A;  3M9N B;  5HHI A;  3BS5 B;  2KNJ A;  2PKE A;  1DGJ A;  4ELT A;  4MF8 A;  4FS1 A;  2BR0 A;  1JN3 A;  1NK0 A;  5ALJ A;  1X6I A;  2I1Q A;  3QU9 A;  2ZIU B;  2J6T A;  2KIW A;  4F93 B;  3HJE A;  5CP2 A;  1TVA A;  1KDH A;  2EDU A;  4NLK A;  1UHU A;  4Z6C A;  5KFD A;  2L5Y A;  5G5H A;  1Z4N A;  4NY8 A;  4MFA A;  3BS7 A;  2KP7 A;  4DQS A;  4LZG A;  3ICX A;  3JPR A;  1N60 A;  2YMP A;  1D9F A;  3CYM A;  5J0T A;  4YP3 A;  4DSE A;  3RB0 A;  9ICN A;  5J0R A;  2W7P A;  8ICW A;  3HPO A;  4US8 A;  4B9T A;  3PV8 A;  1LB2 B;  8ICN A;  3C28 A;  5AKH A;  2IBK A;  1QH9 A;  3F2B A;  1URJ A;  1KFT A;  3JPN A;  4IS7 A;  2Y1J A;  1PVP A;  3BQ2 A;  3SV4 A;  1T94 A;  2XID A;  3RRG A;  2G5H B;  1JIH A;  2DKZ A;  2GLE A;  2KIC A;  3BJY A;  3N7P D;  5CHG A;  2V4R A;  4GLX A;  5DLF A;  4IR1 A;  4NL9 C;  5BPC A;  3IG8 A;  5KL8 B;  4QNL A;  1D9D A;  1PK1 A;  3PX0 A;  2KMD A;  9ICV A;  3KKA A;  8ICR A;  4CDG A;  4I29 A;  3EZ5 A;  4QWA A;  3I28 A;  4QZ9 A;  4DS5 A;  4DOA A;  4K4H A;  4KLT A;  2JHD A;  4KLO A;  2HHV A;  3HIL A;  2ISO A;  4M6W B;  2K89 A;  2R18 A;  5KT6 A;  2DBY A;  3Q8R B;  3SQI A;  4PGY A;  3QZ8 A;  2WAQ C;  5EWE A;  1NKC A;  3C5G A;  3RR8 A;  4NLN A;  2ZJ5 A;  2AU0 A;  1ZYQ A;  7ICH A;  5HP4 A;  1JMS A;  4RPZ A;  4RT3 A;  3RJF A;  3OGU A;  1ZQX A;  2A3V A;  1ZQZ A;  5J8Y A;  1QCK A;  3HX0 A;  2HVI A;  5KFN A;  4BX9 C;  5D4B A;  2AH5 A;  4FBU A;  2E8M A;  2I9G A;  8ICQ A;  1J97 A;  2XY6 A;  1B4F A;  3F5E A;  3QXG A;  2PFN A;  5AI8 A;  5KT4 A;  5L1M A;  3SYZ A;  4UAT A;  4YG2 A;  4YR0 A;  5HR6 A;  4Y2Q A;  3JPQ A;  3WU2 U;  5KFU A;  2BDP A;  4QWC A;  4PHA A;  1SWV A;  2K8A A;  3PML A;  4Q44 A;  2KHV A;  5AIA A;  1JX4 A;  1QSL A;  3SEN A;  4RZR A;  4YQW A;  4DS4 A;  2IA6 A;  3L3F X;  2KZZ A;  5AK4 A;  5KG3 A;  3IV6 A;  3D2N A;  1Z1B A;  1WG8 A;  4R8U B;  3TKA A;  1NK8 A;  3PZP A;  2JZB A;  3ORY A;  4Y2P A;  5ALX A;  4QWD A;  1IV8 A;  3QX7 A;  4Q8E A;  5JTI A;  7ICL A;  5L1L A;  2OCE A;  1U45 A;  3L4P A;  3UMB A;  4FZL A;  2D8C A;  4KLI A;  4EZ9 A;  4P0Q B;  4YR2 A;  4GFJ A;  4F5O A;  2JEF A;  2YX8 A;  2A1J B;  4F50 A;  5KFB A;  1ZQN A;  3H8S A;  5KFJ A;  4OD0 A;  2OEH A;  3MR6 A;  5KT7 A;  1TE2 A;  5AK6 A;  1SV0 C;  8ICP A;  4DSF A;  5KFG A;  2CPR A;  1IIP A;  4F2R A;  1QQ6 A;  4DSK A;  4O0I A;  3FAH A;  4LJX A;  3EWA A;  5KNI A;  3SR6 A;  4YFK A;  4UB5 A;  2MSN A;  3BQ1 A;  3LYS A;  4IRD A;  1KN5 A;  1ZQJ A;  5KG7 A;  4I2J A;  3MBY A;  2G0A A;  5DG9 A;  3OPX A;  2GO7 A;  9ICJ A;  4B9V A;  2W9C A;  3N28 A;  5J2E A;  3H0R B;  5D49 A;  1NOM A;  3PO5 A;  5DDY A;  3WK8 A;  7ICN A;  1O08 A;  2EAM A;  1WWU A;  1TFR A;  4PL2 A;  2BHN A;  4GIB A;  4PPX A;  1ZQG A;  5AKZ A;  4EBC A;  4NM2 A;  4BXO B;  2MAX A;  4CF4 A;  5KFZ A;  1CRX A;  1RDF A;  4C80 A;  4BDP A;  4IQT A;  2NRZ A;  3H4D A;  8ICG A;  2JXJ A;  4J9R A;  1OUQ A;  3PSI A;  4NLZ A;  4Y2X A;  5AM2 A;  4Q8F A;  3MGI A;  5DQH A;  4Q43 A;  3D2S A;  1RZT A;  2YY6 A;  2ASL A;  4YMO A;  3T79 A;  2QAR B;  4HAI A;  4RU9 A;  2ZUD A;  1PUZ A;  3ISB A;  1MN8 A;  3KFU F;  2WHE A;  4DQP A;  4ICA A;  4Y2S A;  1L3S A;  3SV3 A;  3IDW A;  4ECZ A;  5AKX A;  4M9H A;  3THV A;  4ZH4 A;  2R8G A;  2QKQ A;  4KLU A;  9ICG A;  4QZH A;  4B6J A;  1MC8 A;  3WK6 A;  4B9L A;  4O5C A;  1IG6 A;  2HMX A;  3TAD C;  2H3Q A;  2BPG A;  1JRO A;  3E0F A;  5KG2 A;  5TIS U;  3CNH A;  4R64 A;  3BQ7 A;  1BPE A;  2Y1I A;  4C4T A;  4CRX A;  4DCC A;  2AGP A;  3UXO A;  1JRP A;  1L7M A;  3MDA A;  2BCV A;  2BCQ A;  2KSO B;  2W54 A;  5AKE A;  5B66 U;  4IQW A;  4EX6 A;  2JMG A;  5KT2 A;  5A0L A;  2Q4T A;  1BPD A;  4M47 A;  4F5P A;  3T5H A;  2LPE A;  1SB3 C;  3RFA A;  4QWE A;  4IRC A;  3H0L B;  2Y9T A;  4YD2 A;  3RB4 A;  2XY7 A;  2AXT U;  5KT5 A;  3C29 A;  4G3I A;  2H3Z A;  4C7Y A;  2Z7J A;  1SKS A;  4UAR A;  5ALT A;  1KKX A;  3MC1 A;  5KTQ A;  1ZQI A;  2P66 A;  3OJS A;  2XIC A;  3GQC A;  4AYB C;  8ICY A;  5HR7 A;  4R63 A;  5ALY A;  2KEY A;  5AI6 A;  2HBJ A;  4C4R A;  1S0V A;  3GIM A;  3ETL A;  4EBD A;  3NVV A;  2E1E A;  3N7S C;  4O3S A;  2HBK A;  2KKP A;  1ZJM A;  2VIX A;  4FS2 A;  3TAR A;  8ICE A;  1F0M A;  5DQG A;  5J2J A;  3G6V A;  4M2Y A;  3QUT A;  2MUT A;  2DL0 A;  3G6X A;  1ZQL A;  3NVZ A;  1MA7 A;  2NRT A;  4MFF A;  1VLB A;  4PHE A;  2EZZ A;  5KFE A;  3WK9 A;  5IIM A;  2HBL A;  3DDH A;  4J03 A;  2QLT A;  3UQ0 A;  4KMO B;  4YN4 A;  1KFD A;  2ZIW B;  4O3R A;  4UAV A;  3M7D A;  4YMN A;  4ECT A;  1ZD2 P;  5ALK A;  4KLE A;  4FE3 A;  2H3F A;  4MHV A;  5EE0 A;  1FEZ A;  3PW4 A;  4ELU A;  2JGA A;  1UPH A;  2OXO A;  4B9U A;  3RAX A;  3AU6 A;  4OJP A;  4O3O A;  5KFI A;  3T5J A;  2LYB A;  5AKG A;  1VJ5 A;  3PNC A;  3M9M B;  1T3N A;  5KFR A;  3EPG A;  3SAH A;  4OJO A;  5J2F A;  1V85 A;  4O3P A;  2KIV A;  4Y2U A;  3DEE A;  4UB8 U;  2BCS A;  1QTM A;  4CGZ A;  3QZ7 A;  2ES6 A;  4DFK A;  4FFD A;  5AM3 A;  1KFS A;  4KLQ A;  4ECY A;  1PVR A;  1ZRN A;  4KLJ A;  5AI5 A;  2MU2 A;  1RYS A;  2OH2 A;  4DL2 A;  1Q8K A;  2W9C B;  2Q0Z X;  4B9N A;  1QQ5 A;  4DFM A;  2KZM A;  1XSL A;  2BCR A;  1U4B A;  1HEK A;  1ZQU A;  2AQ4 A;  4K4G A;  2ZUC A;  1HUZ A;  1U47 A;  1LKY B;  3RJI A;  3TI0 A;  2KJ8 A;  3ALR A;  1ZQH A;  3V6J A;  2YMQ A;  1N56 A;  3NVY A;  1XO1 A;  4US9 A;  3AMZ A;  3LWM A;  3N4M B;  2EZX A;  5ALD A;  2A1A A;  5IIK A;  4DL5 A;  4M0A A;  8ICZ A;  1TKD A;  5KG0 A;  4QZE A;  1B43 A;  2WB1 F;  5BOL A;  3T5K A;  2ZIX A;  4C8L A;  2XCP A;  4CCH A;  4O5K A;  2ATL A;  2E8P A;  3IG5 A;  1X9M A;  2AQ0 A;  4EYH B;  2W7O A;  2PMZ F;  5KAF U;  3LVW A;  2KKV A;  1SKW A;  4I2A A;  4RQN A;  2RHF A;  4UB1 A;  2KE7 A;  2KFN A;  3U26 A;  4AYB F;  3K75 D;  5DBB A;  2XVT A;  3TFS A;  4YXJ A;  1C20 A;  4P4P A;  3H40 A;  2K8B B;  4NLG A;  1O03 A;  3V72 A;  2HHS A;  1KW4 A;  4R65 A;  3M8S A;  4DLG A;  2KTQ A;  4F5Q A;  5HNK A;  4OJ6 A;  1XO0 A;  4Y2R A;  1T7P A;  3HRD D;  1X66 A;  3G6Y A;  4BWM A;  2W8L A;  2ZTE A;  4F2S A;  3RJH A;  1X6J A;  3OSN A;  2CN1 A;  4DF8 A;  3AEV A;  2DUY A;  1U49 A;  5EE9 A;  1S97 A;  5CA7 A;  1L3T A;  3M6Z A;  4QZD A;  1ZQB A;  1CUK A;  4JMU A;  2F2A B;  7ICJ A;  2F1H A;  3WK4 A;  2HOQ A;  5KFQ A;  3M8R A;  4I2B A;  4KIT B;  2IOF A;  3QEA Z;  4MFC A;  3B0Y A;  2RDJ A;  3BQT A;  4QZI A;  4GC7 A;  5AK5 A;  5J0O A;  2W9B A;  3Q8L A;  3IM1 A;  3GV7 B;  4QZA A;  1NKE A;  9ICX A;  1ZQO A;  3Q8S B;  5KFM A;  4IR9 A;  5AM5 A;  1ZQE A;  3QUQ A;  4YD1 A;  5J2G A;  1ZQ1 C;  4I2C A;  5KFH A;  3GII A;  2LKY A;  3KBB A;  4F4Z A;  2MUT B;  5AM0 A;  2FE9 A;  2RLT A;  2P6U A;  4C4S A;  4NJ8 A;  4BUG A;  1Q3U A;  4ECR A;  5AKK A;  4YVZ A;  2XGQ A;  2K4I A;  2P35 A;  3A0H U;  4RT2 A;  2Y0S F;  8ICL A;  1ZOL A;  3WKD A;  5J2D A;  3WKB A;  9ICW A;  1WWV A;  2R8I A;  4Y2V A;  1L3V A;  1S76 D;  3IRU A;  2F8L A;  5KFP A;  3EPI A;  4P0P A;  2LBO A;  5B5E U;  2FPM A;  2ESE A;  3PSF A;  4QZC A;  4ED2 A;  4X5V A;  1NK9 A;  2K4E A;  1OW5 A;  1NI3 A;  2VA8 A;  3I1Y A;  5DG7 A;  4RQ2 A;  4DOB A;  3C5F A;  3MGV A;  1F44 A;  4UB6 U;  5AKI A;  5AKY A;  1WCL A;  5CR0 A;  2DPI A;  4I2G A;  4GXK A;  3PW7 A;  3VC8 A;  1Z3E B;  5EWG A;  2KD1 A;  3B9J A;  5KFF A;  2EAN A;  1RYU A;  2E5S A;  1BNO A;  5ALU A;  3K4G A;  2C22 A;  5F3X B;  1RXV A;  7ICG A;  2HHT A;  2K4P A;  3O0F A;  2ASJ A;  4DEZ A;  1KQQ A;  4M04 A;  2ZUB A;  4GXJ A;  2O6K A;  2F77 X;  4NXZ A;  1SWW A;  2LHT A;  2RRD A;  5DBA A;  3PW0 A;  2FMP A;  2VKQ A;  2MRL A;  4NL9 A;  2B0C A;  4KTQ A;  4ECS A;  8ICK A;  1DRG A;  3ED5 A;  4C7Z A;  1V97 A;  5J0X A;  4J9Q A;  2F3N A;  3PX6 A;  2ALZ A;  1WCN A;  5KFS A;  3ZD8 A;  4DF4 A;  3KHH A;  1KTQ A;  2PFO A;  1A0P A;  4RPX A;  1L7N A;  2LM1 A;  5J0W A;  3PSP A;  9ICF A;  5KFY A;  4C8K A;  4QZB A;  3RJG A;  5ALG A;  3LDA A;  3V6K A;  3QE9 Y;  7ICQ A;  1TK8 A;  3RH4 A;  3UM9 A;  2ZIX B;  1Z19 A;  2KN7 A;  2LYA A;  5AM1 A;  1X2I A;  2H3V A;  2ZG6 A;  4DQR A;  5L1K A;  5TZV A;  5J2B A;  2I6X A;  2NRW A;  7ICU A;  4RQ3 A;  5ALE A;  7ICO A;  1XWL A;  1AQ6 A;  9ICA A;  2E8N A;  4NM1 A;  1S0M A;  2NRV A;  1ZRM A;  2GH1 A;  2W9M A;  5J2I A;  2DWQ A;  8ICU A;  4QW9 A;  1ZXI A;  2AJQ A;  3SAG A;  4QJF B;  5KFA A;  5CRX A;  2M0N A;  2B21 A;  9ICK A;  4Z6D A;  5DDM A;  2YQE A;  1V38 A;  5GTH U;  4BGD A;  4P4M A;  1A77 A;  2W04 A;  2KG5 A;  5E79 U;  1BPX A;  9ICL A;  2J6U A;  1A76 A;  1BPY A;  3GFK B;  4F4K A;  5IIL A;  1S0O A;  5D46 A;  3H8M A;  5DGB A;  5KFK A;  1FFU A;  2RP5 A;  4KMU A;  1NK5 A;  2QB1 A;  4P4O A;  5J2C A;  4PGQ A;  2XO7 A;  4OO1 J;  1BPB A;  1SL0 A;  2EAO A;  2CRX A;  3HP6 A;  1NK6 A;  1BGX T;  3OJU A;  9ICQ A;  2HHU A;  3GDX A;  1SV0 A;  4IL6 U;  1NJX A;  3MR2 A;  3GIL A;  2W9B B;  4JUZ A;  2NYV A;  3EYZ A;  2YB4 A;  2M9N A;  1XS9 D;  4J9O A;  2W3R A;  2XCA A;  2AHO B;  1Z00 A;  2BCU A;  3F5A A;  2NRX A;  4NV0 A;  2OWO A;  8ICA A;  4KLG A;  1RM6 C;  3VCB A;  3FM9 A;  4UAW A;  4I28 A;  9ICM A;  1L7O A;  3C2L A;  4F5R A;  5F9N A;  1Z1V A;  3L5K A;  4KN7 A;  1NZP A;  3PR5 B;  3QU5 A;  3C2K A;  1PK1 B;  1TAQ A;  4JV2 A;  3Q8Q B;  5J0Q A;  3RJJ A;  5L1J A;  8ICF A;  2WB1 C;  3PVX A;  1QSY A;  1RYR A;  5IIJ A;  4LVS A;  3RH6 A;  4JV0 A;  2ZIV A;  2OYY A;  2EAP A;  4JB3 A;  4KLD A;  1KEJ A;  2WF6 A;  2PMZ C;  2G08 A;  1S9F A;  3TFR A;  5EWF A;  1ZQM A;  4F91 B;  2Y9U A;  9ICE A;  4I2D A;  4PGX A;  2W43 A;  2E3T A;  4P0P B;  1P7D A;  1X42 A;  3PMN A;  3H4B A;  3ZDE A;  2JV3 A;  1IXR A;  1TK0 A;  1ZQA A;  2PFP A;  4Y2Y A;  3PW2 A;  3SZ2 A;  2VA2 A;  3KD3 A;  1V9P A;  3I76 A;  5GTI U;  4F4Y A;  3GV8 B;  1A6S A;  5ALR A;  2HW3 A;  2NO5 A;  2R8J A;  3BZC A;  3M9O B;  5KFO A;  3F2D A;  3RJE A;  1NJY A;  4PZO A;  2BQ3 A;  2D3D A;  2LYH A;  3AQF A;  2W8K A;  3K1Z A;  5KFW A;  3QU7 A;  3AM9 A;  1TK5 A;  2UVW A;  1COK A;  1JUD A;  1ZET A;  4QZG A;  3RF9 A;  3TAD A;  4F4W A;  1SL2 A;  4RNO A;  4KLF A;  1SXD A;  1ZQD A;  4QWB A;  5C0Y A;  5AKJ A;  4MF2 A;  1TAU A;  4EZ6 A;  4KLH A;  4ED0 A;  1TV9 A;  2HHX A;  3ZDD A;  2C2E A;  2ODG A;  5KFL A;  5L1I A;  2BQU A;  4TQS A;  3C23 A;  2JZB B;  8ICJ A;  2CXY A;  5DBC A;  7ICE A;  2QB0 A;  8ICT A;  2HVH A;  5DB8 A;  4UBC A;  4UQG A;  2DFL A;  2HSZ A;  4F3O A;  2FPK A;  3M6K A;  4DWI A;  2KZ3 A;  3WK7 A;  1UQV A;  2W11 A;  3ZDA A;  1SKR A;  5ALL A;  2LMR A;  7ICI A;  3OHA A;  3R9K A;  4QZ8 A;  3IHQ B;  4UW9 A;  3JPS A;  1X9X A;  2HCF A;  1ZQK A;  3TAN A;  2RDI A;  4M9N A;  1S0N A;  2OM6 A;  1N63 A;  2FLN A;  1DGS A;  3NGD A;  4ACO A;  4DFP A;  1L5U A;  1NNL A;  2BKE A;  4ED3 A;  1N61 A;  5HML A;  2KV2 A;  1SIJ A;  4RUA A;  2ASD A;  2MA1 A;  4DFJ A;  3ZDC A;  4C8N A;  3N7R C;  2Y0S C;  2PI5 A;  2FDR A;  3V7L A;  3QUB A;  4C8O A;  1S10 A;  3ZDB A;  4CF3 A;  3KZI U;  1UT5 A;  5H2F U;  4RNM A;  4Z6E A;  1UA1 A;  4M9J A;  3JPT A;  4OCZ A;  1U48 A;  2K60 A;  4FO6 A;  2JH1 A;  3NRW A;  3LVV A;  4ED6 A;  3H8W A;  1BNP A;  1ED1 A;  4USA A;  4UAZ A;  1ZQF A;  2W03 A;  3Q8P B;  3KHR A;  1K1Q A;  2KVC A;  3QU4 A;  3QYP A;  3WKC A;  1Z4O A;  4ZOH C;  5ALI A;  1HUO A;  3KHG A;  4Y2J A;  4P0Q A;  3NTU A;  2HHQ A;  4RQM A;  2G09 A;  3HKZ C;  1DOQ A;  1PVQ A;  4EEN A;  2B6G A;  1ECW A;  8ICX A;  1SGG A;  3KOO A;  5KFC A;  3MDC A;  4J9P A;  1WYG A;  3D6J A;  2F76 X;  3TAP A;  4TUQ A;  4QIW F;  3B0X A;  2KK0 A;  3F2C A;  1NJZ A;  1IM4 A;  4KLM A;  4OJL A;  2AGO A;  2C2R A;  4DQI A;  7ICK A;  5T14 A;  2G07 A;  4YXM A;  5AM4 A;  3UXN A;  3KZX A;  1NJW A;  2H3I A;  2BPF A;  4F71 A;  8ICM A;  2VJ5 A;  3MR3 A;  2EH9 A;  5KFV A;  3KKA C;  1COO A;  1Z00 B;  4UB3 A;  4O3Q A;  1ZQV A;  4AP9 A;  1NZB A;  5ALQ A;  4ECW A;  5ALF A;  3PR4 A;  1ZQW A;  4EEL A;  3HWT A;  4XRH A;  1GO3 F;  2JR5 A;  2XGP A;  4BXO A;  3RB3 A;  1ZJN A;  4ED7 A;  4J9M A;  1XSN A;  4DL7 A;  4KN4 A;  4DSJ A;  1N62 A;  4RQ0 A;  1ZD4 A;  8ICI A;  1JXE A;  2DKX A;  3RJK A;  3KHL A;  2EZY A;  3F53 A;  2OHF A;  2ZIV B;  2QAR A;  2IHN A;  1WUD A;  3MAB A;  2C2D A;  4K4I A;  5J8Y C;  2F1J A;  2ZXH A;  3GIK A;  3FDS A;  1PZN A;  3ETR A;  4KLL A;  3LWL A;  3Q8M A;  4C8M A;  3BDP A;  4J9S A;  9ICC A;  3D2Q A;  5ALN A;  1L3U A;  3UXP A;  4DQQ A;  8ICS A;  1J2M A;  2AGQ A;  5DG8 A;  2DF4 B;  2FJ6 A;  1UCV A;  3ISC A;  3C2M A;  5ALM A;  5J0Y A;  1X40 A;  5KFX A;  2KHQ A;  3C21 A;  1ZQR A;  3RH5 A;  1XSP A;  1JXL A;  1ZQC A;  5L9X A;  4HYK A;  4Q45 A;  1D8Y A;  4F8R A;  2JRZ A;  5DQI A;  5EOZ A;  2KSO A;  3H8J A;  2HOF A;  1SXE A;  4RPY A;  3RB6 A;  4M9L A;  4JV1 A;  2WF5 A;  3RRH A;  4KLS A;  3S6J A;  3DV9 A;  2N1R A;  4CNQ A;  5KG6 A;  3FYH A;  2F8K A;  3GZF A;  5DB9 A;  2JEI A;  4UAY A;  1K5O A;  3SD7 A;  4M9G A;  5DKW A;  4RQ5 A;  4DSI A;  4DL3 A;  4UAU A;  2KOB A;  2YMM A;  2VAN A;  3NVW A;  1S5L U;  4CF5 A;  4R66 A;  4YCX A;  2NV3 A;  4UBB A;  1MQ3 A;  2QB0 B;  2WF9 A;  3TAQ A;  3QUC A;  7ICF A;  3NRZ A;  4U7C A;  4EEY A;  2BDU A;  3WK5 A;  2WF8 A;  2IOF K;  4JWM A;  1NK7 A;  1OXJ A;  4BJQ A;  3M1Y A;  5ALP A;  1X9S A;  2C28 A;  2FI1 A;  1SZH A;  3H0M B;  5AI0 A;  4MEY A;  4U6P A;  3HKZ F;  3JPP A;  3RTV A;  1XC9 A;  2KFZ A;  5J0P A;  4J9N A;  1N5X A;  5KT3 A;  9ICP A;  1T4G A;  5AHX A;  3ZD9 A;  3J81 j;  7ICR A;  1YZ7 A;  2W55 A;  4TQR A;  1L8L A;  1L8O A;  4TUR A;  1XU4 A;  5F9L A;  5J2A A;  1JAL A;  3OTQ A;  4PHD A;  4NWI A;  3E58 A;  9ICT A;  4YMM A;  5AKL A;  3AUO A;  1B0X A;  1SZP A;  2UVV A;  2PXI A;  4GXI A;  3HW8 A;  2ZIW A;  2YTU A;  4IQU A;  3RBD A;  5HHH A;  4O9M A;  3SI8 A;  3K1R B;  4RQ6 A;  1NK4 A;  3BZK A;  1PK3 A;  1LVH A;  1SL1 A;  4E0D A;  3ONN A;  2ZTC A;  9ICH A;  2IHM A;  4XA5 A;  2LI6 A;  4BWJ A;  2WF7 A;  4KX5 A;  2JEJ A;  1L6N A;  1ZQS A;  4YR3 A;  5DLG A;  2BQR A;  4I2F A;  2W9A A;  1ZQY A;  8ICV A;  2V9W A;  1N48 A;  1L7P A;  5EE1 A;  2E1F A;  9ICB A;  5ALS A;  4RQ4 A;  2G06 A;  2LM4 A;  5ALO A;  3C1Y A;  3H7I A;  3GU3 A;  1ZQP A;  5FP0 A;  1XNS A;  1QSS A;  1S77 D;  2HI0 A;  2I5H A;  5KAI U;  4OJ5 A;  3LK9 A;  4FZM A;  3GV5 B;  9ICU A;  5III A;  2P6R A;  4B9S A;  2ZJA A;  2F1I A;  4IRK A;  1CEZ A;  5C5J A;  1KRP A;  5J0U A;  4QW8 A;  4EYI B;  1BPZ A;  1LV5 A;  4DSL A;  1LKY A;  2IMW P;  2DQN B;  2FLP A;  3RBE A;  4P2H A;  3KTQ A;  3RR7 A;  1HIW A;  2BZF A; 
#chains in the Genus database with same CATH homology
 2G09 A;  3CRX A;  2YB4 A;  3HKZ C;  4AYB F;  3H0R B;  2DF4 B;  1PVQ A;  4KX3 A;  2K4I A;  4BX9 C;  1ECW A;  3ICX A;  2HOI A;  3F5A A;  2Y0S F;  4NV0 A;  2KHQ A;  4OJO A;  3SAH A;  2XVT A;  3VCB A;  3CYM A;  3F5E A;  2K8B B;  3C29 A;  2JH7 A;  2ZIW A;  4A8E A;  2F8L A;  2H3Z A;  2Z7J A;  4P0P A;  4PL2 A;  2W7P A;  2LBO A;  2F76 X;  5HR6 A;  2ZIX B;  1Z19 A;  2LYA A;  3DEE A;  4OJ6 A;  4NLC A;  4QIW F;  4CGZ A;  2H3V A;  3PSF A;  3C28 A;  1XO0 A;  2HOF A;  2K8A A;  2ZG6 A;  4NLB A;  1CRX A;  2XIC A;  2KJ5 A;  3M6K A;  2K4E A;  3NUQ A;  3F2C A;  3F2B A;  1URJ A;  1KBU A;  3ONN A;  1Q3U A;  2N1R A;  2KHV A;  4OJL A;  3SAF A;  1PVR A;  3GZF A;  1OUQ A;  4AYB C;  2WAQ F;  3PSI A;  5T14 A;  5HR7 A;  2KEY A;  2WB1 C;  4IC9 A;  2G07 A;  1PVP A;  3IP4 B;  2OH2 A;  2D6F C;  2HBJ A;  3KZX A;  4KX5 A;  1L6N A;  3D2S A;  2CN1 A;  1YT3 A;  3SMV A;  3MGV A;  2H3I A;  2ZIV A;  1T94 A;  2OYY A;  3L3F X;  1F44 A;  2KOB A;  2XID A;  3T79 A;  2VJ5 A;  3D2N A;  2G5H B;  2G5I B;  2YB1 A;  1Z1B A;  2E1E A;  2GH1 A;  3N7S C;  3AQE A;  2HBK A;  2KIC A;  4WJ3 B;  2KKP A;  2VIX A;  2HBM A;  3M6Z A;  3N7P D;  2OM6 A;  2PMZ C;  1HEK A;  3PZP A;  2G08 A;  3VC8 A;  4ACO A;  4JMU A;  2F2A B;  2NV3 A;  3SAG A;  2KD1 A;  1NZB A;  3KFU F;  4QJF B;  2ZIU A;  5CRX A;  2E5S A;  4P0P B;  1P7D A;  1GO3 F;  2K8C B;  2KV2 A;  2HOQ A;  2M0N A;  3IG8 A;  4ICA A;  5KL8 B;  2MA1 A;  2KJ8 A;  1TAM A;  2E1F A;  3ALR A;  4QNL A;  4U7C A;  3O0F A;  3PST A;  2BDU A;  3N7R C;  2Y0S C;  4FZL A;  5KL1 B;  4CDG A;  1MA7 A;  4P0Q B;  2XI9 A;  2W04 A;  4GFJ A;  2G06 A;  4PL1 A;  2F77 X;  2GOL A;  2VJ4 A;  4FZN A;  4BJQ A;  4O3M A;  2JHD A;  2LHT A;  2RRD A;  2YX8 A;  3AL0 B;  1SZH A;  1A6S A;  2VKQ A;  2HBL A;  3GU3 A;  2DGZ A;  3H0M B;  2HMX A;  2MRL A;  2H3Q A;  3F53 A;  1XNS A;  2K89 A;  2R18 A;  2JH1 A;  4C0Z A;  4QIW C;  3E0F A;  2K4H A;  2ZIV B;  3F2D A;  4KMO B;  4OJ5 A;  4U6P A;  2RP5 A;  4FZM A;  1DRG A;  3SQI A;  3HKZ F;  2ZIW B;  3NRW A;  3LVV A;  3AQF A;  1WUD A;  3K1Z A;  3M7D A;  4CRX A;  2WB1 F;  2KNJ A;  2ZIX A;  2WAQ C;  1ED1 A;  2H3F A;  4FE3 A;  2CPR A;  1ZQ1 C;  1IIP A;  2ZXH A;  4OO1 J;  3IG5 A;  2W03 A;  2JMG A;  2LKY A;  2CRX A;  2ZIU B;  2JGA A;  5A0L A;  2Q4T A;  3RF9 A;  1UPH A;  3CP8 A;  3LYS A;  2W7O A;  2KVC A;  2PMZ F;  2KIW A;  2OXO A;  3LVW A;  2DQN B;  2ZXI A;  3IN5 A;  1A0P A;  2KKV A;  4OJP A;  5C0Y A;  2G0A A;  3OPX A;  2RHF A;  3RFA A;  4P0Q A;  1Q3V A;  1HIW A;  1D8B A;  2LYB A;  3H0L B;  2A3V A;  3D2Q A;  4NWI A;  4BUG A;  2KJ9 A;  3PSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...