2XY5A

Crystal structure of an artificial salen-copper basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
581
structure length
581
Chain Sequence
AAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 211
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy5A01
3RH5A 2VWKA 1CEZA 3AO1A 4KAZA 1T3NA 1VSDA 3DI6A 2HVHA 4M04A 3KLGA 3UXPA 4O5EA 1KTQA 3ZCMA 1HQUA 1NK5A 2OA8A 4XA5A 1ASUA 5KFMA 4DTXA 2JGUA 3DM2A 1C1CA 2PYLA 4KI4A 4FZZA 4YFUA 5KFSA 5J2NA 4ZHRA 4O3PA 3PO5A 5KFNA 4ED1A 3JYTA 4BXOA 2QKKA 4CF0A 5L1LA 3F73A 4I2QA 4H4MA 4FJJA 2BQRA 4CGHA 4J2EA 4I2DA 3KHLA 5J2DA 3O4NA 3SUPA 4J9NA 2IHMA 4QAGA 4M45A 4E7HA 2BE2A 9ICIA 2FBYA 1WNSA 4OGEA 5KFZA 2YV0X 4K8ZA 5HNKA 3RMDA 1L5UA 3RJFA 3B0YA 4NLKA 3ZDEA 2HHQA 1JIHA 5KFXA 4J9MA 3OYLA 1WSFA 3O3FA 4NM2A 4CEAA 4M3ZA 5KFFA 4R8UB 3CG7A 4E1NA 2JZBB 2VANA 4TUSA 1S76D 1J5OA 4ELUA 4NCGA 4RQ2A 4XQ8A 4OPKA 4CHZA 4GLXA 5K14A 4OLAA 4R66A 4GXJA 3AU6A 3OYNA 4HUEA 2Y1JA 1REVA 5I3UA 2YNGA 4PPXA 4JS5A 4C8OA 1KEJA 4I27A 7ICPA 3MGIA 4J2DA 2Z1GA 4M3YA 3VQCA 4Z4EA 1XHZA 3IS9A 1XS9D 4DFKA 3NE6A 9ICOA 1BCMA 7ICEA 4RQ3A 1ZQCA 4FK2A 1ZQXA 4DTPA 4FXDA 3EYZA 3NF8A 2HHVA 4EBDA 3NTUA 1NOZA 4LY7A 4KHSA 1UOCA 3NF6A 8ICBA 4IQWA 3CQ8A 5JS2A 4Z4CA 4I9LA 3BQ1A 3DLGA 2W9BA 4NLZA 8ICIA 3KD1E 4DSEA 4R5PA 2KZ3A 3OS0A 4DOAA 4FBTA 1K1SA 4P2HA 2H5XA 7ICHA 2ZTEA 1HUOA 5CYMA 4Z6EA 3HP9A 4EYHB 1WAFA 4CEFA 1ASVA 1NK0A 4Q45A 4P4PA 4BE1A 5J0PA 4M2YA 1JXLA 3EPIA 3L2UA 4IDKA 1S1XA 3ZSXA 4F5QA 2FBVA 4PY5A 2IA6A 5CZ1A 8ICXA 4ED7A 5CHGA 4FJGA 4EYIB 1X2IA 1BI4B 2C2RA 1TKZA 3LP3A 5IIOA 5J0RA 5KFBA 1HPZA 3SQ1A 4KLHA 5DB8A 2BPGA 5DKWA 4MF2A 1ZQBA 4YD1A 4GXKA 3RB3A 2W9CA 1UA0A 4ECWA 9ICRA 4CJWA 3AO3A 4NXZA 3PMLA 3O4QA 4CIFA 4J9QA 1UT8A 3RB4A 3ETLA 1ASWA 3RR7A 4DO9A 1B92A 5KFYA 2V4RA 4DS5A 3HVRA 3TWHA 3TR8A 4KLDA 4YVZA 4RNNA 2B5JA 8ICMA 3QEIA 1IM4A 5CY4A 4EBEA 1QLNA 4R64A 1TKXA 2FMQA 3TFSA 1JLAA 2HVIA 1EXNA 1T4GA 1IH7A 4JLHA 4RT2A 3ZT1A 4QZBA 1ZBUA 2JEJA 5HRNA 3JPPA 4FM2A 1A5XA 4B3OA 4DF4A 1IO2A 3SQ4A 3BDPA 2P1JA 4XIUA 2HNYA 3QIPA 3NF7A 3ZSQA 2WONA 4KTWA 4CF9A 4DWIA 1SZPA 3T3FA 1JN3A 3THVA 4CFBA 4I2IA 2ZUCA 3JPNA 3ISNC 5D3GA 1VSKA 1JXBA 4PH5A 3Q8LA 3OHBA 2I5JA 2UVWA 2XC9A 4E19A 4LVSA 4RG8A 3NH1A 2WTFA 1TV6A 3DLHA 2E4LA 1LW0A 3QEPA 4ECSA 4JRPA 4AILC 4KLGA 3TAQA 3AA4A 2F8TA 4C8LA 1C0MA 2G8WA 2BR0A 4QZ9A 2OZMA 3Q8MA 7ICNA 1VSHA 4KHQA 3ITHA 1LWFA 4UB3A 3RWUA 3AO4A 1I3AA 3GIMA 5KFJA 9ICGA 1WCLA 4I29A 3NBPA 4CEOA 4DL7A 1WCNA 4FJ5A 2R8IA 1BISA 4LZDA 4O0JA 3DRSA 3T1AA 4GW6A 4Z4HA 3GFKB 4MFFA 4DTNA 2BCSA 1ZQNA 5KFVA 4ECVA 2DPJA 2Z1HA 1T8EA 2PZSA 1XSLA 4KO0A 3PW4A 3SJJA 1ZQKA 1BPYA 1QTMA 2J6SA 4KRFA 4CFDA 3V81A 4ECYA 4FBUA 3UQ0A 1GOAA 3UXOA 1A5VA 3E2EA 4CGJA 1HYSA 1B9FA 5HMLA 1RT4A 3JPQA 4KLSA 2G8FA 3PV8A 1NKEA 9ICJA 3I8DA 2ATLA 1UWBA 2W42A 5DBBA 4HUGA 4RQ7A 2I9GA 8ICRA 4W5QA 4ZTJA 2OPQA 4LH4A 2OYQA 1TKDA 1T05A 1RNHA 1JKHA 4KLJA 4W5TA 1GOBA 3RJEA 3C5FA 3TFRA 3QEWA 2BANA 3JSMA 2NRWA 4RW8A 2PXIA 1EP4A 4UBBA 4DQSA 4Q44A 4QZGA 4M9JA 1ZQYA 5BOMA 4FJNA 2M9NA 1S77D 3AA3A 1CZBA 8ICPA 4CHQA 2FMSA 4RW9A 9ICQA 1U04A 4B9SA 5J2AA 1ZQIA 2ZJAA 2C22A 3SUNA 1BQMA 3V72A 1LWEA 4UB2A 1ZQRA 3OYAA 3DLRA 2ATQA 4QZEA 1XSNA 4F5OA 3GIKA 5KG2A 2BPCA 4ELVA 4DFMA 4F5RA 4FJ8A 3RJGA 4BE2A 1ZQLA 3ZSZA 3RH4A 4ECQA 3KK2A 4J2BA 5J0UA 4BDPA 1XSPA 2XY6A 1ZBLA 1QE1A 4ECTA 1S10A 3ZSRA 4CJPA 3LZJA 1ZBIA 4IRCA 3VQ4A 2QXFA 3QLHA 4UB1A 3V4IA 4DQPA 4CIEA 2UVVA 1N5YA 9ICKA 4HCCA 1QHTA 3PX6A 4KLFA 3CYMA 1D8YA 3GQCA 3OVNA 1MU2A 2IC3A 1KVCA 3NGDA 4B08A 4G3IA 5DBCA 1VSLA 2VG5A 1RZTA 2RDJA 1FXXA 4UAYA 1H38A 5JS1A 1CZ9A 2R7YA 1F21A 4FVMA 4JV2A 4KLOA 3KJVA 2KTQA 2P66A 1KSPA 1SKRA 3IAYA 3NH0A 4FW1A 3V7JA 2JEGA 4YN4A 5CA7A 4IR9A 2BPFA 1JLQA 3L2VA 1FKOA 3QNOA 4MEYA 2MUTA 4IRDA 3Q8SB 3GV7B 1RYRA 1C0TA 4MFBA 4N41A 3DYAA 3OYGA 1HJRA 3MR5A 2UVRA 4DSJA 1J53A 2P5GA 4M3RA 4K8XA 3HWTA 1L3TA 4AHUA 4AHSA 4YG2A 4IFYA 2NRTA 5C5JA 1RBUA 1JMSA 1ZQMA 1TK8A 2F1JA 4DG1A 2W9BB 4Q5VA 4RQ1A 4P4MA 4BE0A 4AHCA 3HPOA 3RMBA 2QK9A 5C25A 1ZQAA 3IG1A 4L8RB 1DGSA 4I2CA 3RBEA 1TL1A 5HROA 1O1WA 1RT1A 9ICEA 4Z6FA 1C0UA 4I2BA 3N97B 9ICXA 7ICVA 3L2QA 1KDHA 4KV8A 1RXWA 3PW2A 5HLFA 9ICPA 3BQ2A 1S1UA 4M9LA 3EWAA 3HXMA 2RF2A 1X9MA 5KFUA 3G0ZA 4DQQA 4FW2A 1HYVA 4KLLA 3RJJA 5HP4A 1RBTA 2XY7A 5KFWA 7ICRA 3UPQA 1HRHA 3VQEA 4EEYA 4CJ4A 4PHEA 5J2GA 2HNDA 3G6XA 3AVBA 3K4GA 1LAWA 2W9CB 4LSLA 3ZT2A 1N48A 3KHRA 4JWMA 2FLLA 1J54A 5KGWA 4CJQA 1A5WA 3NCIA 3AA5X 2J6UA 5FRNA 1S0VA 3OYHA 2F8SA 1W0HA 3RR8A 3VQBA 2GWSA 1MQ3A 4B8AB 3V1QA 5DLGA 4DF8A 2BCRA 7ICOA 3MXMA 4O3NA 4CGIA 3RTVA 4YCXA 4IQTA 4M42A 1RT5A 2OPRA 1FKPA 1YTAA 1V9PA 4C8MA 3C95A 4GC6A 3PX0A 3V9UA 4YR3A 5E41A 2XCAA 4DOBA 4E7JA 2G8KA 1HQEA 1XHXA 4OKJA 3VQ6A 5JUMA 4B9VA 4CEZA 4OKEA 4IR1A 2XY8A 3V1OA 4BWJA 9ICLA 2F1HA 3NGYA 3CFRA 2XCPA 1ZYQA 4QWCA 3QNNA 4MQ3A 4DEZA 2F1IA 2ZJ5A 4Z6CA 4QWBA 2AGPA 4DTRA 3TARA 3ZSYA 4E0DA 4RQ0A 4PGXA 5FDLA 5IIKA 1HNVA 4FZYA 2G8VA 4FJLA 3TAGA 3O3HA 5CB1A 4P4OA 5J2JA 3OGUA 4KTZA 1RBVA 4F3TA 3N4MB 1QSLA 1KLNA 4IG3A 2XGPA 3MABA 2XO7A 1EX4A 1S6PA 1ZQWA 4YMMA 3ZDDA 3VQ9A 3KKRA 3T5KA 3QZ8A 2ETJA 3BQ0A 3H4DA 3SUQA 2IAJA 3MR6A 1KLMA 2VA3A 2W9AA 1HUZA 2C2EA 1WSIA 1J9AA 3SI8A 5F9LA 4DSIA 5KFIA 1DTQA 5D4BA 4QWEA 5HHHA 4I2PA 4B9LA 7ICIA 1Y97A 3NF9A 2AGOA 3K59A 3CFPA 2E6LA 2W8LA 9ICUA 5L1KA 2IOCA 3LP0A 3JPRA 4N76A 1BPEA 1UAXA 2PFNA 2EHGA 4KN4A 5KFGA 3RH6A 1RILA 2IS3A 3H8JA 1EETA 1SKWA 1WSGA 3NGIA 3QETA 1RXVA 3MGHA 4BDZA 3LPUA 2IHNA 4CE9A 1QSSA 8ICTA 4AHRA 4CGDA 3LK9A 1ZBFA 4DLGA 4F4XA 4BGDA 4I2GA 8ICQA 3OYEA 5J2HA 3TANA 3AVNA 5J2CA 4BWMA 3QEBZ 3AVAA 3AVIA 3BJYA 1RDDA 1KVAA 2GUIA 4HVJA 3OYDA 2DFEA 4RUAA 3TAFA 4B9UA 4KHUA 3HPGA 4JWNA 4FLZA 4K4GA 1TFRA 3VA0A 8ICKA 3HPHA 3HSTB 4CEDA 3T5HA 5KG7A 4FLVA 4GVMA 4M3WA 4FK0A 4NYNA 2IBKA 3C1ZA 2I1QA 4MFAA 2QKBA 4CCHA 4LSNA 5DG7A 3ZT0A 7ICKA 1SL1A 3G10A 3KTQA 3K5OA 3L2RA 3ALYA 7ICMA 5KT6A 1VRTA 4O3OA 4KHNA 4CECA 4IRKA 1B9DA 3AVKA 4AHVA 2YNHA 1ZQZA 3PW7A 1TGOA 3MFHA 3KD5E 3SNNA 2IDOA 3T5JA 1NK8A 1NJZA 5J2BA 3RMCA 1JL2A 5KFTA 5KGXA 4FJXA 4JK1A 3SPZA 4F92B 2ZTDA 3HX0A 1B22A 9ICWA 1UA1A 5D49A 1EKEA 1X9SA 2O4GA 1VRUA 9ICBA 2A1SA 5EWEA 4RZRA 1RTIA 5HRPA 4UQGA 4YMNA 5KFKA 7ICJA 5DK5A 4RU9A 1NK6A 2PFQA 2X6SA 3LALA 2MAXA 1WSJA 5J2MA 3KHGA 3NDKA 4IFVA 4QW8A 5IIJA 4ED0A 1Q9XA 4F8RA 2FBTA 3ZD9A 5KFRA 4KHYA 2Q3SA 2MUTB 2NRZA 4O0IA 1QS4A 1PZNA 8ICUA 2O4IA 4QZHA 2PY5A 3PR4A 1BVSA 1NJWA 4I2JA 4JV0A 4R8UA 1U48A 1BGXT 3SCXA 2JZBA 9ICHA 4R63A 1MSWD 1A76A 4I2FA 1T03A 5CZ2A 3LP1A 5DLFA 3RBDA 1HMVA 1I39A 3H7IA 4DTUA 2ISPA 2BDPA 1JLEA 3DLEA 3PW0A 1SL2A 1NKCA 4TQSA 3DLKA 1ZQTA 4MFCA 3Q8QB 5J2QA 4O44A 3OYIA 3AV9A 1ZQVA 3OYMA 1KCFA 2EX3A 3ULDA 1SL0A 4Z4IA 4F4ZA 5KFCA 1ZQFA 4TURA 4E1MA 4YR2A 4FLTA 2R8GA 2ZJ8A 3D0PA 4CJ3A 1CXQA 4MEXA 1VSFA 3V6KA 1R0AA 2B4JA 3MBYA 1RT2A 1DOQA 4O3QA 4ED6A 4RPZA 4M0AA 2RN2A 3OHAA 3HP6A 4J9KA 3S9HA 2ALZA 2RPIA 4CEEA 2NRVA 4FJ9A 4ECUA 4YR0A 5DBAA 4RW4A 3V1RA 9ICTA 3EZ5A 3RB0A 3OYBA 1RTDA 2P6UA 4CESA 4PWDA 4DL3A 2DFLA 2B6AA 3I0SA 3OS1A 3LAMA 4CHYA 1WLJA 3C94A 4NY8A 3MAQA 3KK3A 2FPKA 4ELTA 3GDXA 5KFQA 2D0BA 3V7KA 1ZQEA 4CK3A 1ZQHA 5KFEA 3LWLA 4RQ5A 4TQRA 1IG9A 3HK2A 3MR2A 5SWMA 4CJ5A 4DL2A 9ICAA 3NH2A 3JPOA 4B9NA 4Q8EA 3C6UA 3P5JA 5KRTA 1RDCA 3MXIA 4CGGA 3GV5B 4EZ6A 2HHSA 5CWRA 2BQUA 4JV1A 4PHAA 8ICWA 2HHTA 4JRQA 1KVBA 3NAEA 2P5OA 1YTUA 1RBSA 3ISBA 1U45A 3K2PA 3JPSA 4Y1CA 4M41A 3MXJA 1NK4A 1U47A 4BXOB 2A1JA 3H8WA 3AVJA 3Q8KA 3B6OA 3K5MA 7ICSA 3M9MB 1RTJA 4CJSA 5CR0A 3U3YA 1D8LA 1Z25A 2BKEA 4IKFA 3HW8A 2OPSA 5DQIA 3G6YA 3VQ7A 8ICFA 4CJUA 3S3OA 3PVXA 5J0OA 1ZQSA 2DFFA 3P1GA 4UAZA 1L3UA 2IGIA 4FCYA 4Z4GA 4RPXA 4YNQA 3AVFA 4KLUA 1C6VA 4O55A 4FJ7A 1ZQOA 1UT5A 5J0QA 4E7IA 5KT7A 4Q43A 1Z00A 4UBCA 3LWMA 1Z3EB 4O9MA 1MC8A 4N5SA 3L3VA 4CK2A 2DPIA 1NOYA 4NYFA 3BGRA 1IKWA 3SQ2A 4F2SA 3ISDA 3AUOA 3K5NA 2OWOA 4YXJA 1ZJNA 1LV5A 4W5NA 2G8UA 3M9OB 1U49A 4QZAA 3AU2A 3K75D 1T7PA 3VQ8A 3AO2A 4KTQA 4LH5A 3VQAA 3K5LA 3H4BA 1ZETA 5DQHA 2AQ4A 2AU0A 9ICSA 3AVCA 4EP5A 3SPYA 4RNMA 3VA3A 1RBRA 4QWAA 2HHUA 4AHTA 5FROA 5IILA 5DB7A 3SUOA 4W5OA 4I9QA 2AGQA 3ZT4A 1TK5A 1VSEA 3KIOA 4QZFA 3U6FA 5IIMA 4YD2A 1U9LA 3RJHA 1RCHA 1VSMA 2VG6A 3M8PA 9ICNA 1C1BA 5J0WA 1JLFA 4YXMA 4DFPA 2J6TA 4RPYA 1S1WA 2KW4A 1U4BA 2WOMA 4PQUA 5DB6A 5HRSA 4J9LA 1ZBHA 2FBXA 5KFAA 1S6QA 5KG5A 1X1PA 4YFKA 3QERA 1HJPA 2BCVA 3LDAA 5J2PA 3Q8PB 4KMUA 1W9HA 5KTQA 4M3TA 2KFZA 3C23A 4N47A 1BCOA 3AVMA 4K4HA 3EY1A 8ICCA 4FZXC 2G8IA 4EP4A 3HL8A 2ZQBA 4FM1A 3OYKA 2YKMA 4E7KA 2Z1JA 5KT4A 2NUBA 4F93B 2KN7A 3K57A 3WNFA 1S0OA 5BPCA 3QEVA 3IHQB 2PI5A 3VN5A 4H4OA 4ECRA 2HW3A 5J2IA 4B9TA 1BIZA 2D0AA 2KFNA 1NKBA 3CM5A 1LB2B 5KT3A 5F9NA 3RAQA 4F5PA 4I7FA 4TSXA 1HNIA 2HHXA 2JLEA 4PHDA 3MDAA 4J9PA 1XWLA 7ICFA 2KZMA 3FDSA 9ICFA 4G1QA 3OYCA 1GOCA 4ID1A 8ICNA 3PR5B 4OVLA 4HTUA 4DTJA 4YP3A 3DRPA 5J0YA 2UVUA 4RUCA 4KREA 5KG6A 4O5CA 5KG4A 1ZQDA 4FLYA 2HB5A 4KLQA 3RRGA 2BHNA 4BDYA 1VSIA 3LAKA 4J9OA 4R65A 1BHLA 3S3MA 4KITB 4KLTA 4GC7A 4M3UA 1L3VA 2DY4A 1BPDA 4OGCA 4KI6A 4F5NA 7ICLA 5EU7A 3DOKA 9ICMA 3C1YA 3JPTA 3OJUA 3QINA 3MR3A 3C2MA 3VQQA 2ASDA 1KRPA 5J0XA 4I2AA 5DDYA 1S9EA 2BQ3A 4M6WA 5CP2A 3C21A 3A2FA 3SZ2A 2PFPA 4EBCA 2V4QA 4FJMA 1TAUA 1YT3A 4B9MA 5CJ7A 3V9WA 2BGGA 4BACA 3HYFA 1TL3A 3ZDAA 9ICVA 3P83D 2ZD1A 2LYHA 5KG3A 4UB5A 2FC0A 2ISOA 5J29A 4M9GA 2ZTCA 4DQIA 3SI6A 1IKXA 2BGWA 2XRIA 5TZVA 8ICLA 1FK9A 4FJIA 5J0SA 3ISCA 1S0NA 2C2DA 2E6MA 4DSKA 4ECZA 4O5KA 2ITGA 7ICTA 1S5JA 4FO6A 3L3UA 5KFPA 1X9WA 2PYJA 2GBZA 1ZQPA 4O3SA 1QQCA 1TK0A 3CM6A 4HHTA 3M8SA 5CYQA 4IG0A 3FFIA 3M8RA 4ED3A 5T7BA 3C2KA 3ZSVA 5J1EA 3C2LA 2KZZA 4KLEA 1NJXA 4DOCA 4ZH4A 4LD0A 2X78A 2HMIA 4NCBA 2OZSA 3Q8RB 5J2FA 1KFDA 4M47A 3V9XA 5DG8A 3UXNA 4QZCA 4Y1DA 8ICJA 1RTHA 4F4WA 4KN7A 1IXRA 1Z26A 3ZDCA 4FJHA 8ICSA 5SZTA 4DL4A 2PI4A 3T19A 1S97A 3HM9A 5HP1A 4KHWA 7ICGA 1WAJA 3MEEA 1TVRA 4DMNA 2R8KA 1JLBA 3M8QA 4FJKA 4H8KA 4CFCA 3SV3A 4Z0UA 3UQ2A 3D45A 4FLWA 2VWJA 4MF8A 3RMAA 4ZTFA 3H8SA 1RYSA 3MEDA 3MDCA 4CEQA 4WE1A 4CJVA 2A1RA 2P6RA 4CERA 4M9HA 3SQ0A 1G15A 1SKSA 2YHAA 1LAVA 3GV8B 1RPLA 4GMJB 2YHBA 4FLUA 4N56A 1TKTA 4DU1A 3EPGA 4XUSA 4CF1A 4CHNA 3B0XA 2A1JB 4FYDA 3PUFA 3RJKA 2VA2A 1CLQA 4W5RA 3LDSA 4M3XA 2BCQA 4F3OA 3LANA 4DTMA 2V9WA 2XGQA 4DQRA 1JL1A 2JEIA 2DTUA 1KFTA 4CJLA 1BPBA 4OJRA 1BIUA 3S3NA 4OPJA 3RB6A 3ZDBA 3OS2A 3L8BA 3M9NB 3O3GA 3T5LA 8ICHA 2VG7A 4ICLA 2FPMA 4QZDA 4DSFA 4DU4A 4KB1A 4ECXA 1JXEA 2X74A 4DS4A 1Z00B 4HCBA 4JS4A 4C8NA 2DFHA 5BOLA 3VQDA 4OKKA 3AO5A 1C1AA 4RQ4A 5DMRA 4Q0BA 4Q8FA 2X6NA 4CEBA 4J2AA 7ICQA 3K58A 3DMJA 2Y1IA 2HHWA 3QEAZ 3PX4A 1RT6A 3I0RA 3QEXA 1NOMA 5KFHA 1RT3A 1WSHA 3AVHA 3OSNA 2YNIA 1ZQJA 1DTTA 4UAWA 3MFIA 3GIIA 3AVLA 3PW5A 5KFOA 5J2EA 4QZ8A 4PA1A 4CFAA 4PGQA 3RJIA 1CXUA 5KI6A 4CJEA 4E89A 2ZUBA 8ICOA 1K6YA 3KLHA 4IBNA 2Z1IA 2JEFA 1WN7A 3SYZA 2PFOA 2NRXA 4HYKA 3WNHA 2FLPA 2YKNA 4HUFA 4DTOA 8ICZA 4F4KA 2R8JA 4F91B 3C5GA 2FMPA 1BPXA 4RQ6A 1Y88A 1XI1A 2P51A 3ZT3A 3QESA 3H40A 1D5AA 4TUPA 3ZD8A 2C28A 4IQUA 4O3RA 1XU4A 4NLGA 1WSEA 2RDIA 4QW9A 2KQ2A 4FS1A 5C42A 4ED8A 2D5RA 3RRHA 1N56A 8ICEA 1JLGA 3LP2A 4NCAA 1C7YA 3TQ1A 3PY8A 3F9KA 1RDAA 3HT3A 3V9SA 4FS2A 3C6TA 3VQ5A 3KK1A 4J9SA 1RDBA 8ICGA 5DG9A 1TVAA 4RQ8A 4IQVA 3AA2A 1ZQQA 4J9RA 3QIOA 4X5VA 2ZUDA 1S9GA 3V6DA 2ZE2A 4NLNA 8ICAA 3DOLA 3WNGA 4ID5A 5HBMA 5J0TA 3GIJA 1Q9YA 4JUZA 4Z4FA 1S9FA 3V7LA 5DB9A 4DU3A 3TAPA 1ITGA 1JX4A 4QZIA 1BI4A 1BPZA 3KLEA 3GILA 4F2RA 3OYJA 1Q8IA 1A77A 2YNFA 5EWFA 3SV4A 4DFJA 8ICVA 5D46A 4RW7A 4QWDA 4CJRA 4CJKA 3TAEA 4E7LA 5KG1A 3ASMA 1AROP 4GXIA 3ZSWA 3PMNA 1RT7A 4I28A 3RAXA 5KT2A 7ICUA 3MEGA 4PGYA 4AH9A 3BQTA 1D9FA 5HMMA 3QE9Y 4O4GA 4EZ9A 3B6PA 3KLFA 4DL5A 1JLCA 2BCUA 1ZQUA 2W8KA 4CK1A 9ICCA 1LW2A 4KPYA 4M9NA 3QO9A 3OJSA 4CF8A 3MECA 4QOZB 2OPPA 3NFAA 4DSLA 5KFDA 4FK4A 5L1JA 5C24A 1BL3A 2FLNA 1ZQGA 3TAMA 5J2KA 1SUQA 3EW9A 3DRRA 3HJFA 4DL6A 3KLIA 4M6WB 1N6QA 1S1VA 1B43A 3ORYA 5DDMA 4NM1A 4O5BA 3VQPA 3TABA 5KT5A 4CJTA 3H08A 4RNOA 3HO1A 1KFSA 2XHBA 2R8HA 1NK9A 3WNEA 4Z6DA 2XY5A 3IM1A 4B8CA 3V9ZA 1EXQA 4KKOA 3ZSOA 3PO4A 1BQNA 4OLBA 2GV9A 2IMWP 8ICYA 4DTSA 4KB0A 4F50A 1VK0A 5HHIA 5DQGA 4F4YA 2AQ0A 5I42A 1IKVA 3OYFA 1SV5A 5KG0A 4LZGA 3OSPA 4RT3A 4KLMA 5KRSA 1COOA 4KLIA 4CIGA 3AVGA 4XRHA 1HYZA 2ASLA 1L3SA 1VSJA 2LSNA 3NGZA 3G6VA 2AJQA 1TV9A 2RKIA 2B21A 4CGFA 3L2WA 1NK7A 4CJFA 4QCLA 1TAQA 1XO1A 1S0MA 4YQWA 1K1QA 3KKSA 1QSYA 4PHPA 3LPTA 2VA8A 2W9MA 2G8HA 4E3SA 4CHPA 4FLXA 5DGBA 1CUKA 4CHOA 1D9DA 1ZJMA 1MQ2A 1LWCA 5EOZA 3QZ7A 1XC9A 3V6HA 1IKYA 4I2HA 3HVTA 3KHHA 3V6JA 5EWGA 4K4IA 3IRXA 5FRMA 5HRRA 4ED2A 3FYHA 2D0CA 1YVUA 3PNCA 4C8KA 4FM0A 2HNZA 3DLBA 4DLEA 3E01A 2FPLA 5KFLA 1NJYA 4KFBA 4YMOA 4RW6A 3LZIA 4TUQA 4CF2A 4UB4A 5IINA 4I2EA 3TI0A 1S1TA 5IIIA 4PUOA 5DGAA 3NHGA 3U3GA 3OY9A 5L1IA 3UIQA 3CFOA 2ASJA 1DLOA 2F96A 5L9XA 2Q0ZX
chains in the Genus database with same CATH superfamily
2WAQF 5CD4A 3QNWB 1TKTB 3AO1A 1QH9A 1K47A 1EKRA 2W40A 4X62K 2GOLA 3TUZC 2HVHA 4M04A 3UXPA 4O5EA 1CJUB 3G4SS 3KOOA 2VFUA 2JGUA 3BH7B 5GINA 2DEIA 1EWRA 3VAKA 1LCUA 3ILOA 2GVZA 2CG4A 5M1PA 4NI2B 4IWVA 3DXMA 5KFNA 3QU5A 3PXGa 2LVWA 1VRQC 3P3DA 4DI6A 3JYTA 5BN9A 1VDVA 4GVEA 3KUHA 1SI9A 2R7SA 1X4AA 2YQEA 2E5SA 1X66A 3G82B 2UZAA 2ZM6K 2I2YA 2BQRA 3KYLA 1CJKA 4BC2A 5LMNF 3SUPA 2IHMA 1GXUA 3FAHA 3C8YA 2HRUA 1NNEA 3KKFA 2FBYA 4OGEA 3I0RB 2B8PA 3CCRS 4K8ZA 1T3OA 3RMDA 5ALYA 1RT3B 2VC1A 2N82B 4DV0J 3ZDEA 1R8BA 3O3FA 3BDEA 2I7PA 4M3ZA 2Y8YA 3H0MB 4R8UB 4JKAA 4ZVOB 4E1NA 1HWUA 3VC8A 5AKXA 1FKAF 1KD1T 5ALUA 3PIOQ 3TADA 3VGSA 4DR7J 4CHZA 1R8HA 1W2IA 5K14A 4GXJA 2YKNB 3OYNA 4HUEA 2GHWA 2KIWA 2Y1JA 2G09A 3SMZA 5I3UA 1B7YB 4OZ2A 4Y2JA 5ETRA 4FP9A 1FE4A 1S6OA 3EKUA 3BSCA 3VGLA 2MQ8A 5DJBA 4US9A 4IH7A 4DFKA 1FRXA 3NE6A 3O44A 3MM9A 4RQ3A 5BRFA 1TFYA 4DUZJ 1K0TA 4GY2B 1ZQXA 4DTPA 1KN5A 6AT1B 4OCZA 3NTUA 4LY7A 1UOCA 1JLGB 4CE6A 4IQWA 5JS2A 3NGSA 4L74A 5F8LA 3DLGA 4NLZA 1MN7A 3KD1E 3OS0A 4FBTA 1K1SA 5AQVA 4JKGB 3QGHA 2ZTEA 1R6YA 3SCIE 1HL6A 1TL7A 4Z6EA 1NRKA 1V85A 2DL0A 3HP9A 4PZNA 3SJHA 3RRKA 3H20A 2ZE2B 4BE1A 1NDPA 5J0PA 2QG9B 3HI0A 5HBMB 4BRGA 3KUEA 1S1XA 3C7NA 3ZSXA 1FO4A 2IA6A 3I31A 3R2DJ 1T6CA 2V50A 4X62F 1TKZA 4JKFA 2YB1A 1L7MA 2IOFA 2FHJA 1MLAA 3CGIA 4MKAA 1FEHA 1LOUA 2LCWA 2CKWA 4YD1A 1P8GA 4NXZA 1H7WA 4PL1A 3K17A 2KRRA 3MGJA 1SWVA 3MEGB 3RG6A 1S4EA 1TUGB 8AT1B 4DS5A 3SD7A 4PXCA 3IXQA 4CQ1A 4DV6K 3HVAA 8ICMA 2ZM6F 4JI8J 3MK6A 3DXSX 3BH6B 1VBYA 2QL5B 2FMQA 1PJ5A 3MECB 2BEFA 3U1MA 4CIOA 2W4CA 1O8BA 5D0EA 4QIWF 3K7RA 4E2FB 3NNCA 1VFJA 3ZT1A 4HACA 3TAMB 2KB2A 3EUB2 3OFHA 2JEJA 2COLA 1A5XA 2LQBA 1DY3A 4B3OA 4DF4A 2A3VA 1S1VB 3W7BA 1JRPA 2RD5C 2P1JA 2HS0A 1DGJA 1GLCG 2W7OA 5CA5A 4PG8A 4DWIA 3T3FA 3THVA 3LW5C 1F9HA 4I2IA 3B4DA 2RH3A 4NXMK 3PSTA 4PH5A 4KKOB 4LF9J 5LM7E 3PSIA 4ACOA 1GO3F 1ZM3A 4LVSA 3CCEN 4O4RA 2WTFA 2J9DA 2VQFJ 2WCXA 4C9DA 1RWPB 2P5VA 3S6JA 4KSEB 4X65K 1IKVB 3J7AN 2DO4A 5AM3A 1SV5B 3O0FA 2BTFA 3AA4A 4YHHK 1HKAA 4RKUC 3D68A 2WBRA 2QTDA 2XMUA 2VH7A 4QZ9A 3Q8MA 2CH6A 2YTCA 7ICNA 1PO6A 3ITHA 5D0GA 3RWUA 3AO4A 1WCLA 1SV0A 2POKA 1WCNA 4HKQA 1CS4B 2RKIB 1J6ZA 4IOCQ 3RJMB 1W7WA 4LZDA 4O0JA 2NO5A 4GW6A 4Z4HA 4YDUC 2VQEK 5KFVA 3BM7A 2PZSA 3SJJA 2BRLA 4FL9A 2XSFA 2A19A 4JI1F 4KRFA 4FYVB 1X5TA 4DPYA 4HT7A 2FGCA 4PG5A 1GOAA 3CCJN 3E2EA 2AJ2A 1AW0A 1IKYB 5HMLA 1RT4A 2EXUA 5AKGA 4DPWA 5LSRA 5T7LB 3IRWP 3I8DA 2BUNA 3VESA 5ALXA 1K8KA 5CABA 4HUGA 3WK4A 2I9GA 2QJ3A 4W5QA 2OPQA 4U8YA 3NNAA 4LH4A 2HNZB 2GMHA 1RNHA 4KLJA 4NYPA 3LVVA 4KFBB 4ENOA 1GOBA 4RW6B 4GVBB 3QEWA 3VEWA 2OSQA 2K4EA 2PXIA 4GV6A 5HQMA 5HMZA 2YWWA 5AM4A 4DQSA 4M9JA 4QZGA 3D1OA 3PIOL 1IG6A 2N3LA 1NB2A 3CPWR 3N28A 2GHVC 2J4RA 4CHQA 2HBJA 4HT5A 3JB9k 4DV6F 9ICQA 2VPZB 3O8WA 1SQGA 5AR0A 4B9SA 2OMLA 2PIIA 1MNEA 3FCWA 3T9NA 1VIXA 2Z7JA 1LWEA 3Q22A 3MF5A 1RU2A 2GVZB 1XSNA 2BPCA 2ZF5O 2ZZNA 2E1CA 4JKEA 4TLRA 1FTCA 3DXMB 4Y2QA 3OD2A 1NG9A 1Q86O 1ZQLA 5CCLA 4ECQA 3GU3A 2YKAA 2YPYA 3JYTB 4DV3K 2KHVA 3AMZA 1ZBLA 1QE1A 1S10A 4CJPA 3FMBA 3KG1A 3P8BB 4OZJA 1IBMK 1WG4A 3QLHA 3K1ZA 3D67A 4LC9B 2YXLA 1CJKB 2AJFE 4NXMF 2W1BA 1ITPA 2IIHA 2GH1A 2BYCA 1NHUA 3CYMA 1LKZA 1B0XA 1W7AA 1XNQJ 3QATA 1KVCA 3QBWA 2UUBJ 3QUTA 3O9TA 3NGDA 4X65F 4H0XB 2EPIA 4ZPAA 1L8OA 2MA1A 2VG5A 4YHHF 3KBBA 1H38A 3M6XA 2HLTA 1CZ9A 2C2NA 4FVMA 1N54B 3UE2A 3IAYA 3ZZYA 5B0AA 4C1NK 1RWXB 2A0FB 2FLOA 4YN4A 5K14B 1UFKA 2R4FA 3L2VA 5AKZA 4C3LA 2ZH8A 2G5IB 4IO1A 5GADP 5I3UB 4C4TA 3GFHA 3Q8SB 3K89A 4RNFA 5EX0A 4KQZA 3I56N 5EX3A 2VQEF 3CC2N 3FFIB 3DYAA 3PRVA 1A9NB 3SBMA 5AQMA 3POTA 3MM9B 4C97A 2QTWA 3AOCA 5CHIA 1VS3A 4IFYA 2NRTA 2JSXA 4GO7X 1JMSA 1ZQMA 3DLGB 2F1JA 4DG1A 4Q5VA 3UVJA 2NZTA 4BE0A 4DX8H 4YOXA 1S72S 2LMIA 1FDAA 3TA1A 2K8CB 1KONA 4I2CA 4WKYA 2O8CA 5F2RA 5HROA 2JZ5A 2NSCA 5IXUA 5ALPA 4X64K 3HOSA 4Z6FA 1TL7B 3R6MA 2AZ3A 1OPIA 1SZ2A 7ICVA 3L2QA 3PYEA 3PRBA 4ALZA 2PFDA 5AQHA 4BC3A 3V2UC 2JDJA 4HR2A 3QU9A 4Y2UA 4WIQA 2XHWA 3HXMA 1S1XB 3CTRA 1CLFA 4DV1J 3BF3A 3C7NB 2ZIXA 1VQ8N 3AA9A 1FWLA 3KWIA 1TKZB 3D66A 3QSIA 3UPQA 1Q86T 1VQYA 4WQ4C 3AQEA 2VKQA 3G6XA 1EHWA 2KYZA 1OY9A 3GLJA 4DXLA 1LAWA 5JLFA 2Z57B 4AE5A 5CXTA 2UXCF 3D5MA 1J54A 2QKQA 2ZBCA 3EEQA 3NCIA 4OX6A 3PRDA 3AA5X 4DV3F 1VQ7N 1WHWA 2CZ4A 4HI2A 4JKHA 1W0HA 4CD3A 1VQ6S 3VQBA 2GWSA 1UP1A 1IBMF 3FFKB 3V1QA 4IOCL 3T9ZA 1CULA 1X4BA 5GMDA 2GJ2A 4RUBA 3MXMA 1YJ9N 5A8WA 1RDRA 4OX9J 3HHLA 3MAAA 4NA3A 4KH1B 1EIYB 1YTAA 4HACB 3ILLA 2IRUA 3PX0A 2FF3B 3QNMA 5E41A 2G1HA 2XCAA 3WBZA 4CO0A 1U1MA 4DOBA 2OH2A 2G8KA 3R27A 3GB0A 1XHXA 4C8YA 3BO4A 3W61A 3JQKA 4ES3A 5G5HA 4K41A 1B0PA 4A8YA 1ZYQA 4NLYA 4O23A 2V8HA 2F1IA 2KG1A 1MDUB 3TARA 3ZSYA 2DY9A 2V52B 4WK1A 2W41A 4NLVA 2LBOA 5FDLA 2FJVA 2AX1A 4LBHA 3TWZA 3TAGA 1KNZA 1UEVA 3R5BA 4BR2A 5J2JA 1LXNA 3MGVA 1K73O 4KTZA 4WZQA 1QVFR 4WXOA 1EX8A 1YRUA 1AQ6A 2DRBA 3ITHB 3IBPA 3GCXP 5B0FA 4D3GA 4Y2YA 4YMMA 2HFVA 5EVZA 2KYXA 2DHAA 1TUVA 3SUQA 2E29A 2X3DA 2IAJA 3GR1A 2YY3A 4P72A 2W9AA 4UY8O 5BYRA 1F9EB 3N01A 3E3XA 3SI8A 3I5CA 4USWA 5F9LA 3KJFB 1WUAA 3CPWM 2B4VA 1DTQA 1HD0A 4X64F 4WCEL 2E5HA 2R42A 5AHXA 2W25A 3NF9A 2XICA 3FGVA 2AGOA 1YF5L 2ASOA 2PMHA 2W8LA 2PGCA 1NZAA 4WYWA 2DBBA 5BR9A 4KHPK 4QJFB 1RT4B 2E1MC 1ZZNA 1FDDA 2AKWB 1N5XA 3ETMA 4Y2AA 4USMA 1UVNA 2WW4A 4A5BA 3RH6A 1X9JA 1K8KB 2WB4A 3H8JA 3VOVA 3LGNA 4GKJJ 4B3MJ 2OPQB 1SKWA 1HBMA 4J03A 2XULA 3DOLB 3ULHA 3JQJA 2H5IB 5I3QA 3LPUA 2IHNA 1QSSA 4AHRA 4CGDA 2IM3A 1DEJA 4DLGA 4I2GA 4LMZA 1YDLA 3T1YK 4TU8A 2KM8B 4U7UK 3AVIA 3BJYA 1RDDA 4U96A 1VQ5S 3K9KA 4KHUA 4Y6IA 2GNKA 4CNZA 2OTJS 2QWPA 8ICKA 4LRAA 1LWEB 2DKXA 4N7TA 2JMGA 2ZKUA 1F5CA 1JALA 2IBKA 3LPYA 3T41A 2I1QA 2VIHA 4MFAA 1KXPA 2QKBA 3KXDA 1NSPA 1P7DA 7ICKA 2D4WA 5AZJA 5D4PA 1SL1A 2E5JA 4UW2A 3KTQA 1QE1B 3CXCR 1QQ5A 2I0XA 7ICMA 1VRTA 4O3OA 4CECA 4IRKA 3QLHB 4AHVA 1ZQZA 1RWOB 1TZ0A 3QT8A 1KKXA 3IR6B 1K73T 2E44A 2N1RA 3WK6A 1X5PA 4FWNA 1WOQA 1JL2A 2SXLA 2I6XA 5AFUA 2KV2A 2O01C 3QFWA 1KQQA 2VG5B 3K5PA 4UY8T 2VODA 5EWEA 1RTIA 5HRPA 5KFKA 1ZAVA 1NK6A 2PFQA 2MAXA 4ED4A 3KHGA 2YKPA 5IIJA 3OPKA 4F8RA 2FBTA 3Q7CA 3ZD9A 4KHYA 3KG4A 2Q3SA 4O0IA 4U67Q 4CZGA 2E1AA 2IVPA 2M2BA 4HH1A 2O4IA 2PY5A 2FJDB 3JTPA 3PR4A 1V5IB 1BMQB 1BVSA 4NYOA 2DNMA 3DYAB 2MKKA 1NU0A 4ZP8A 1BGXT 1U48A 3H3OB 2OJ3A 1M5HA 1OYEA 2DNPA 2QSFA 4Y2XA 3NS1A 1MSWD 4I2FA 2FIUA 3POTB 3N79A 5D4NA 3R3TA 3QMQA 4IFYB 4GVLA 1I39A 4XK8C 4KHPF 5GAGI 4DTUA 3OUYA 4EELA 5EUHA 4DG1B 3AAQA 3UVJB 4CO5A 1HLUA 2GS8A 1NKCA 4XPEA 3PG9A 3DLKA 1ZQTA 3HKZC 5J2QA 3AQOA 4L3NA 4YOTA 4WFAL 2O8CB 3ULDA 5HROB 4F4ZA 4HEA9 2LDIA 3QGIA 1ZQFA 2Z2YB 1RDWX 4DHVA 1VQLN 2W03A 4BGAA 2ZJ8A 5HO4A 1CXQA 2CRXA 4RJVA 2K1RB 1DOQA 2RRDA 4M0AA 2GELA 1PSDA 1IR1A 3HP6A 2VWBA 1SV4A 2RPIA 2ZIXB 2P9IA 5E79U 1P1TA 3T1YF 4FJ9A 4ECUA 1EKSA 1BXNA 3KNGA 5DBAA 3CT9A 4RW4A 9ICTA 5AKIA 5EE1A 3UDEA 5B7WA 5M1KA 4IL6U 4CESA 3IWXA 2X51A 1T44A 2YY6A 4BGBA 4L3QA 2NXNA 2WF9A 3AXKA 4CHYA 3C94A 5IWAK 3MAQA 1VLOA 3IR5B 5H1SV 1ZQEA 4CK3A 3MM5A 4C11B 3MR2A 4CJ5A 4DL2A 3NH2A 1RDCA 4YY3J 3MTKA 2B4UA 4EZ6A 2HHSA 3K0SA 8ICWA 4KPCA 2W3RA 3C46A 2JLGA 1QVFM 2HF3A 2P5OA 1SB6A 5A8WB 2B4OA 3K2PA 3HHLB 3MAAB 1C20A 2YKOA 2QL7B 2QXLA 1GFWB 1U47A 4BXOB 4WKRA 2A1JA 2G0CA 2WAQC 3G4SN 4IJNA 3K5MA 2K89A 3DRXA 2CVIA 3N5FA 4CJSA 3U3YA 2P9GA 3VEXA 3ED5A 4WFNL 3MM7B 2NUHA 4IKFA 1IBKK 3AOAA 2VASA 3PEJA 3VGVA 2N3OA 2YN4A 5J0OA 3T79A 1VMBA 3KNAA 3DN9A 2C3MA 4OHWA 2IGIA 2DGUA 4KLUA 1UT5A 1Z00A 5GAEP 3LWMA 3FZKA 4EK2A 3OR2A 5FDLB 3O5BA 3ENWA 4YN3B 3NOGA 4JI7K 2XZWA 4CK2A 3P4IA 5M1NA 3P45B 3CCRN 3SQ2A 3K5NA 5IM0B 1LV5A 4Y0FA 1U1RA 5KPZA 3CJ1A 3K75D 1T7PA 1SGGA 3F5TA 2L9DA 2PMZF 3KMQA 1DAXA 2Y9HA 1FT8A 3U26A 1ZPWX 4UUWA 4LH5A 3K5LA 3VQAA 1QY7A 3FUYA 2CPDA 2AQ4A 2GC8A 5KQDA 1BUXA 2AU0A 1NO8A 2P9EA 3SPYA 4DN0A 3AB4B 2MDAA 1APSA 3ZETA 3VA3A 4QWAA 4AHTA 1N52B 3SUOA 1U8SA 2CQ0A 1KHWA 2DUYA 2AGQA 2B43A 3ZT4A 3HCXA 3U6FA 1Y64A 4YD2A 1N5QA 3H98A 3I6PA 3M8PA 1C1BA 2VUGA 5B66U 5HMXA 2DHHA 1JLFA 4U8VA 4YXMA 3W5XA 1ZBSA 4OX7A 2DH9A 5FIIA 1WUDA 4Y2SA 3MN9A 5AQRA 4CO3A 2D3ZA 1ZBHA 5IC6B 1S6QA 3FC4A 3LDAA 5J2PA 3Q8PB 1HBMB 5CHCB 2K4IA 4KYZA 4K4ZA 4DX6A 2ZXHA 5GAGP 1ILYA 4IDKB 1COKA 4P2SA 4F4AA 2F8KA 4G9BA 4Y00A 4N47A 2VFTA 2XMVA 2ABYA 4LRBA 2LA4A 4OYXA 5LSOA 1PG5B 4MJKA 2QGFB 4GKKJ 2YMLA 3M05A 3OVAA 2XMTA 2YKMA 4J9UE 2MKSA 1GQEA 2LECA 3EDRB 4JI5J 2ZITA 4IO9Q 2R3VA 3WNFA 3FJ2A 2KH9A 1M6YA 2ROEA 4XH4A 3QEVA 4FPAA 3Q8YA 5J2IA 4B9TA 1BIZA 2D0AA 2KFNA 5A0LA 3BGFA 1NKBA 3H59A 5B5EU 4CT8A 3KZXA 2GLEA 2NXUA 3RAQA 5ALSA 4Y2IA 5DM6Q 1HKGA 4I7FA 2CJ9A 2ADCA 1SIZA 3FZ2A 4OHYA 3MDAA 2DHXA 1XWLA 7ICFA 1RISA 3CO9A 4G1QA 3OYCA 4ISEA 1GOCA 1CI4A 8ICNA 3IMQJ 1VQSA 1Y9OA 1FVQA 1WDTA 1IBKF 4CLPA 2O66A 3N4PA 3JXOA 5KG6A 4WPAA 5HL7Q 2PO4A 1ZQDA 1JJ2R 2DBYA 1MWYA 1YRTA 4KLQA 3RRGA 3GU0A 5D4OA 2BHNA 4QYZK 3LAKA 4R65A 1BHLA 4LRDA 3CJ5A 4S0MA 3TO8A 1UAWA 1BPDA 1WG5A 4OGCA 4KI6A 5GTIU 4FN5A 3QBCA 4JI7F 4NZ6A 1YGYA 9ICMA 3C1YA 5T41A 3JPTA 1FIQA 3AGRA 4B1YB 5C10A 3C2MA 2ASDA 1KRPA 2G0IA 4I2AA 5DDYA 3GSDA 5AQQA 3ZZOA 5KOWA 4QQBA 3B4MA 4ED5A 2PFPA 4EBCA 2V4QA 4N77A 4FJMA 2QC3A 1SQFA 2EWSA 4A61A 4B9MA 2BGGA 4IC9A 2DYAA 3ZDAA 3TX8A 3U4LA 1MA7A 1TUUA 2QWLA 3P83D 4UB5A 2KKVA 2FC0A 3FZBA 3I28A 3FCHA 1ZA1B 3DAWA 1MA9B 2IYGA 2E8AA 3CUNA 4V19S 3O5TB 4Y2RA 1IKXA 1Z4UA 1NPRA 2XRIA 5K20B 1PCAA 4OIXA 1FK9A 3SCJE 1SS6A 2E6MA 4K4YA 2K7JA 4LSZB 3OFFA 3J7A1 4ECZA 4O5KA 3OUYB 7ICTA 4FO6A 3GDQA 3OLBA 1X9WA 1KWMA 1WD6A 1DQ9A 3B6BA 3CDWA 2V5HG 3M8SA 4HHTA 3BBFA 3CCUS 2JHDA 3GJSB 1SIJA 2YB4A 3C2LA 5J1EA 1B4FA 3D54A 2M4MA 4DR6J 4WFBQ 5AKYA 4DOCA 4DV0K 2ZDOA 3D2SA 1HBOA 4C4RA 2APOA 4KGXB 4OHXA 4FWMA 2OZSA 2OI2A 3GE9A 3T69A 2DD8S 4M47A 3NKYA 3D2NA 2GJFA 3DOMA 2P9IB 2DTJA 5DM7L 3M3ZA 4DR7K 4KAIA 4KJIA 4JI2J 4RW4B 4OZNA 3CNHA 4FJHA 8ICSA 1NB7A 5SUHA 1RFQA 1S97A 3SQOP 2LEBA 4KHWA 2V9KA 5IT9Y 3LGHA 1WAJA 1HNWK 4OO1J 1RHRB 4OI6A 5G4DA 3H5SA 4DPUA 3VGUA 4NYZA 3UQ2A 2DITA 2WUSA 4DCJB 1FO1A 2R7QA 4ZPTR 4DUZK 3MEKA 4ZTFA 3MM5B 2XB2D 2L48A 1LKYA 5H2FU 2NYHA 3RZAA 4OJ3A 4CEQA 4CJVA 2ZH3A 2P6RA 2JX2A 2CJBA 4LF7J 2YHAA 2Y9TA 3GV8B 3M7DA 1H1VA 1M5OC 4B3SK 4QOTA 4FLUA 5A6PA 2OD4A 2Y9UA 4N56A 4DU1A 1L7OA 2DISA 4CD1A 2YQ3A 4OJGA 4XUSA 3G8TA 3B0XA 2A1JB 5J8YA 3NEKA 2QFJA 4FZNA 1FRLA 2VA2A 1HHTP 1QQMA 1C0FA 3ZTPA 3LANA 4Z2XA 2VOOA 3H6EA 2EBEA 2XGQA 1KDNA 3WKEA 4DQRA 2DTUA 2JEIA 3MPVA 4EO8A 1BIUA 4CTAB 1YJWS 3VAFA 2PKEA 3W60A 3TSQA 2YX6A 1MU2B 4AL6A 4BR7A 1N36K 5GMKa 2QLBB 2B0CA 2IVYA 5BRDA 2YCHA 2FPMA 3IP0A 4CDIA 3TOQA 2EZXA 1Z00B 5LJ5Y 2OFHX 3OL6A 1XR5A 5BOLA 3OR2B 3VQDA 4Q0BA 5DMRA 4Q8FA 3HLUA 4C7YA 5LJVA 4KX3A 3K58A 1I1GA 2DNNA 3KLVA 3DMJA 2CPJA 5B8HA 3CDAA 3ENAA 3CNQP 2X3GA 4NEYA 4IO9L 6FDRA 1OIAA 3AVHA 5T14A 2YNIA 2YWEA 5L9NA 4JI8K 4LR8A 3GIIA 2E5LJ 3PW5A 1LFPA 4H4KA 5I9EB 4CFAA 5LL6d 4MYTA 2LMRA 1K6YA 3KLHA 4OI3A 3HULA 3ZETB 2XM3A 1SJ3P 2Z1IA 2JEFA 1WN7A 4DV0F 1MN9A 4ZVQB 2ZOMA 3WXIA 4DTOA 4OZ0A 4F4KA 2ZZTA 1PK3A 3M8PB 1C1BB 3RBXA 4PR6A 2KT5A 2ZDPA 3DFEA 2YQ1A 1D1UA 1JLFB 4BG8A 1LK5A 4Y34A 3RYLA 2EH9A 3H40A 4DR7F 1D5AA 2KM8C 4LF9K 4NLGA 1WSEA 2RDIA 1VQ4S 2WF8A 4KV8B 1S6QB 4AYBD 2LQ5A 5C42A 3LP2A 2AT1B 1U2FA 5J2PB 2VQFK 1T95A 1S1UB 3O9QA 5BPMA 1HNWF 4YDXA 2MKHA 1VCTA 4BC5A 3PY8A 1ZZFA 3ETRA 3BS5A 5A2QY 4FS2A 3VQ5A 3MCOA 2HFZA 3QGPA 8ICGA 3I96A 4I0WA 5DG9A 4DUZF 3QX7A 2EAOA 5AM0A 4IQVA 2GGPA 1K8AO 3AA2A 4XO0A 2FVCA 1ZBTA 2HNDB 3QIOA 2ZUDA 3GG1A 2QFIA 3CW2C 4UQTA 1U25A 1QQNA 4USTA 4ID5A 3ZZZA 3HD1A 4CLFA 4B3SF 1RADB 2A3JA 4DUYK 3V7LA 3PACA 2YWHA 5DB9A 4PG7A 5CAAA 1GLDG 4QZIA 1BI4A 1QAJA 5AXKA 2HMPA 3DDIA 3GILA 4F2RA 4WIIA 3WUHA 1J2MA 2CFXA 2N4CA 4I7FB 3OYJA 1A77A 1G99A 3ENOA 3EE9A 4G1QB 1Q18A 3OTEA 2LKYA 4B17A 1OY8A 4QWDA 2LXUA 3ZEUA 1HLWA 4CNYA 4E7LA 2XS7A 1AROP 4AP9A 4BROA 4GXIA 2E7XA 1RT7A 2DKZA 3NAHA 1N36F 3VAGA 2MEWA 2M3DA 3BQTA 1VQ6N 4BRPA 4DL5A 5LMNJ 1ZQUA 4WFBL 2W8KA 4LR7A 3BO3A 5I4MA 1KAYA 1WOSA 1U24A 4X4PA 4CF8A 1BNPA 2OPPA 1QDUB 5M1OA 3M7VA 2VZ9A 2XMKA 4WU3A 1U26A 1SUQA 3EW9A 4CH7A 1F5BA 3NASA 4WP9A 4YOYA 4JI8F 3O08A 3TABA 4ZVRB 2ZVIA 1ATRA 2YJFA 3H08A 3UR3C 2JL9A 4CF3A 2WVDA 3CCWA 2XHBA 3N5BA 2R8HA 2G9OA 1U1KA 4TY9A 1X4EA 4CWBA 3V9ZA 3ZSOA 5F8IA 3TKAA 2GV9A 8ICYA 4M63A 2C3PA 3IM9A 1IKXB 4DTSA 1NDCA 1X5SA 1UW9A 3CD7A 1HI8A 1FK9B 3ZO7A 1VJWA 5DQGA 4A59A 4F4YA 5I42A 1ZD2P 2CPFA 4ICAA 1RJJA 2KJVA 4ANCA 4MN4C 5HN0A 2FVRA 4RT3A 5L8RC 3KD3A 4LF9F 4KLIA 2CWKA 2CQ4A 1I5OB 5B0EA 3ZI4A 3G86A 2GHPA 2ASLA 1K8AT 1SIWB 1VSJA 5J1EB 2VQFF 1XNQK 2ZHOA 3VWSA 3WEEA 3NGZA 4XDCA 2AJQA 1VK8A 3THWA 4CLTA 4DV5J 1HBOB 3CDUA 2MQNA 2VB6A 2B21A 4CGFA 1IM6A 3OW2R 2DCLA 1G7CB 4LFAK 2F3NA 3IP4B 4X4QA 5JMVA 2Z4PA 2EK6A 2M7SA 2BJEA 4BC9A 2PMWA 5ELZA 4NLPA 4YQWA 3J81Y 1P8ZA 2D3O1 4EAHD 3OTOF 2G8HA 4E3SA 3BQ7A 4IH6A 3NCQA 4NLBA 5C15A 4CHOA 1D9DA 2MKJA 3K0JA 3HZGA 1AUSL 4WP8A 2HFOA 4FDFA 5HR7A 4C1NI 4WBFA 4DUYF 3KHHA 2VONA 3ZLJA 1B0TA 1JXVA 3D6TB 5EWGA 4CLZA 2J9CA 1S12A 5K8OA 4EU0A 1YVUA 3EDQB 3VALA 1QTNB 4M94A 3P5TL 3DLBA 1W2BR 2LDYA 3AN1A 4JV5J 4DLEA 1LKYB 5KFLA 1F5SA 4YMOA 4TUQA 2H9ZA 2QWNA 4I2EA 2NXJA 3TI0A 2IVOA 5AM5A 4LVNP 1WACA 4HHUA 5L1IA 3UIQA 3WQUA 3CFOA 3ZZTA 2ASJA 4C3MA 2ZM6J 1JI7A 3RH5A 1WC3A 1VQ5N 1CEZA 1ZA2B 4KAZA 2XZDB 3TVYA 2J9DE 2OTJN 3DI6A 3H5UA 4OYWA 1GMVA 4U6PA 1HQUA 2A3ZA 2UUTA 4CZHA 4DTXA 3UDCA 1C1CA 2EC2A 4FZZA 2WB1D 4JYAJ 5KFSA 3WC2A 3MR7A 1XQSC 4H0YB 1IBLJ 1RGIA 1RWMB 2ZH9A 1NGCA 4P52A 1WOPA 1QQ7A 5K9FA 3BGOP 4JHDA 4J5OA 1OS5A 1D3WA 1RKIA 3VQTA 4FJJA 1HBNA 4J2EA 3UD5A 4Q0BB 3B54A 1NGDA 5ALOA 3JAMO 1I3OB 4QAGA 2IVFB 2BE2A 4X66K 1L8LA 3DMJB 1WNSA 2E1FA 4BR9A 2YV0X 1RHMB 4B3TJ 3RJFA 2V8GA 3ENHA 4M5GA 4NLKA 2AEFA 2W2NP 3MN5A 3HVWA 1L6NA 3RUBL 4JEPA 2YNIB 1JIHA 5AKKA 4NO7A 3OYLA 5HAOA 5AQSA 4NM2A 2GQQA 2DHGA 3S7RA 3CG7A 2F7TA 2JZBB 1Z19A 4OX9K 2Q3PA 5AQLA 4NCGA 2QW9A 4USUA 3KLHB 4OPKA 5F3TA 3L09A 4GLXA 1XNQF 3EGVA 5JICA 4R66A 3GMGA 2MQQA 2V68A 3P5BP 3CCZA 4CM2A 1RDFA 4CZIA 1REVA 5C2DA 4PPXA 2KVSA 4ATNA 4LFAF 4DPXA 1KEJA 2ZH6A 2OSRA 4G6VB 4JI1J 4K2XA 3IO1A 1KBRA 2DNKA 3ULEA 2UUCJ 2Z1GA 1C4CA 5AXNA 5CEHA 4Z4EA 1XHZA 3CHWA 1T9WA 3JAMU 4QYRA 1BCMA 3BB5A 4U9RA 2ZUGA 4OYPA 3EYZA 5C42B 4EBDA 2ZXIA 2E8MA 3CJRA 4KHSA 1RT2B 3LP2B 2VF3A 3DXKA 2GCFA 3KFWX 4Z4CA 3BQ1A 5EXWA 4DB3A 2NRHA 4DCCA 1RDUA 4KH6A 4M7YA 5C2GA 3BS5B 5ALWA 4BVPA 2F76X 4P2HA 2XS2A 1RQ0A 1HUOA 1S7HA 2JC0A 2R7UA 2A41A 4Y2MA 5IQQA 1FW6A 1ATSA 2GGPB 1U7LA 4EYHB 2XMMA 1Z4NA 4LF8K 1WAFA 4F3MA 4HH0A 4UY85 3HOTA 1PILA 3S8SA 1RAHB 2L41A 1FCAA 4ID5B 4DV6J 4OZLA 2DGXA 2CPRA 2FBVA 3QFUA 4KIAA 4EYIB 2P9NA 1BI4B 3BSNA 4DV4K 3F56A 1HPZA 3SQ1A 1T9TA 4MF2A 1ZQBA 4GXKA 1UA0A 3ZFVA 2PN6A 4ECWA 3ZEUB 3AO3A 4CIFA 3HJVA 4LF5J 3W3DA 1UT8A 3NP5A 3RB4A 2CA9A 5FPNA 3R1HA 2XYHB 3RR7A 4F0MA 1KOOA 3TTDA 4ZVGA 3WHIA 1MROA 5KFYA 4NXMJ 2AP1A 4GKJK 2V4RA 4Z94A 1BQXA 4B3MK 3TWHA 3TR8A 2KHCA 3M2UA 2K4HA 4K5SA 4RNNA 1O13A 2B5JA 3GE1A 3QEIA 1IM4A 4RWXA 1QLNA 2H65B 1TKXA 2OPPB 3M5RA 2ASYA 4RT2A 5A8KA 4X66F 3C6HA 3NMAA 1Y5IB 3A8KA 1ZBUA 1SUQB 4TLQA 4FM2A 2F9DA 3R9PA 2RVJA 2IOHA 3D0HE 2HNYA 3QIPA 1ACMB 3CCMS 1RWKB 4FPRA 4CF9A 3CCSS 4BRKA 1FNOA 2ZUCA 2F63A 2JHEA 3ISNC 4OX9F 3GCWP 5ETLA 1CRXA 1JXBA 4I67A 1TYQB 1UVMA 4MH8A 2WC9A 1KAXA 3M1VB 1QJHA 2XC9A 5AI5A 3NH1A 1D0EA 1TV6A 4FYXB 5K4LA 4CF5A 3D1HA 3HHKA 4L75A 4AILC 2HRYA 2PFUA 3MOJB 5I42B 4KLGA 4M5DA 5JXSA 3TAQA 3TYTA 3FM9A 2F8TA 1T6DA 1GT8A 3I9V9 1JNRB 4M5JA 4GFJA 2VICA 2ZC3A 5D0HA 3D3BJ 1LWFA 5GTHU 4P74A 1I3AA 3LF0A 2JH7A 3NBPA 3THWB 4B6JA 3AAPA 1CC7A 4HHHA 4K4XA 5EE0A 2R8IA 2RB7A 4HTIA 4F0KA 2ZGZA 1VQMS 3H1QA 1ZOTA 1QZ5A 2DPJA 1T8EA 1XSLA 4KO0A 1ZQKA 4QU6A 4LF8F 2CPXA 1RAOA 5AJ3F 3FSYA 3V81A 2F2AB 1R8CA 2R2UA 1HJOA 4I6WA 1I94J 3UN5A 4CGJA 2P9UA 4MT1A 2F8EX 4CZCA 3B8AX 2BKPA 2J5AA 3UMBA 1NM2A 4QIEA 1NKEA 5E3QA 4IS7A 2KJWA 2ATLA 4BQZA 1IXKA 1XEZA 2V7YA 4Q7AA 4DV4F 5L46A 3C28A 2OYQA 2UXCJ 3EWGA 1JKHA 2WRMA 2V69A 1KVIA 2Q4TA 3TFRA 4OHZA 3JSMA 2NRWA 4RW8A 1VQKS 3LTOA 3EO3A 2YJEA 1EP4A 1E6VA 3UNYA 3NOCA 4FJNA 5HSPA 4GKJF 2M9NA 3AA3A 4B3MF 1CZBA 1ICEB 2RUSA 2ZWHA 4YDUA 2RU3A 3RU0A 3DI6B 2AH5A 1SBRA 1HQUB 1ZQIA 1UFLA 2ZJAA 3SUNA 3V72A 3C14A 2VJVA 1DFDA 3U8XA 5FP0A 3R7NB 3Q89A 3EXCX 1ZQRA 3KG0A 3SSQA 3NY0A 2HAIA 4BRNA 4DR3J 3UE5A 4DFMA 1G1XA 3HRGA 3ZSZA 3KK2A 4J2BA 5J0UA 1KEKA 2QRRA 2XY6A 4JHDB 1ZRMA 3ZSRA 1ZBIA 2CH5A 1RSCA 3LZJA 4IRCA 2ZBRA 2QXFA 1QM9A 3V4IA 4DQPA 3TX0A 2UVVA 3L4IA 1JJCB 5KAIU 1EARA 3NVMA 9ICKA 1N61A 1WSRA 4R0JA 3W65A 2BE2B 1KAZA 1D8YA 3MMCB 2NUUG 4H54A 4LBPA 4OYIA 4YY3K 4RQNA 1VSLA 4R0EA 3EVMA 1FXXA 1F21A 3R5DA 4JV2A 3KJVA 1FHTA 5F0WA 2P66A 2QARB 4NCGB 2XWXA 4CLWA 2CDRB 4CW7B 1URJA 1JLQA 4PPDA 4MLEA 1RLDA 1REVB 3LDPA 5EY4A 2EVZA 5AZIB 2PA3A 2ZH1A 2KKHA 3ULEB 1F2GA 1S49A 4OPAA 3MR5A 1IV0A 4A46A 2UVRA 1HWLA 2CN1A 1J53A 2P5GA 4K8XA 3HWTA 1KS2A 4AHUA 2XO6A 3G71N 1Z2ZA 4IZ9A 4ZLLA 3DXKB 2W11A 1RBUA 3M6WA 2Q1NA 4OJOA 4QU7A 1A6SA 2DO0A 3CCUN 2HLUA 1F60B 1N0UA 3A12A 2AYBA 1H3DA 2K3KA 4F3QA 2UU9J 1GTHA 4WFZA 1P9YA 1RT1A 4RUHA 2F9JA 1C0UA 3N97B 3PKYA 3E51A 2U2FA 5BN8A 2ZNZA 2OHFA 1KDHA 5HLFA 2ZBQA 2XI9A 3BQ2A 4M9LA 2XZTB 3DU5A 3ENVA 1X9MA 2GFFA 2EZZA 4PKHA 3PFEA 1NEEA 4FW2A 1HYVA 3IG8A 3H5XA 2V2VA 1OH8A 2P9NB 1RBTA 1EO1A 2V8VA 2OTLS 3VQEA 4KR0B 2ATCB 3UN2A 3OBIA 4K50A 3QUCA 3FZMA 3DHXA 3OBYA 3SQIA 2KHQA 1N48A 4H5RA 2FLLA 3JSBA 4FSVA 3U9DA 2BE9B 1A5WA 2HFSA 3HT0A 3QFHA 3LDLA 3OYHA 4BRCA 3M2UB 3BN4A 2B5JB 3W64A 3GONA 4MO5A 4B8AB 3QJLA 4Y2CA 4ZP6A 5E84A 2O5DA 4HHJA 1KHVA 4MK8A 4O3NA 3J7YP 3RTVA 5A8KB 4GKKK 2XMJA 3C2PA 4IQTA 2OPRA 3ALRA 2DNHA 3VQSA 3BF4A 3V9UA 3MDQA 4YR3A 4JI5K 4YY3F 2HNYB 3QIPB 4E7JA 3W9HA 2QX0A 2Q6CA 1YJWN 1HQEA 4F9OA 3VQ6A 5JUMA 4B9VA 4CYUA 4WQ4A 3WKDA 3TUJC 1GK8A 1HHQA 5J1PA 3HSGA 4BRMA 2HOQA 1SQEA 4L73A 2HBLA 1J2NA 2AGPA 1YVFA 3L3CA 1TV6B 4E0DA 2OELA 4RQ0A 1FRJA 1KVJA 2DJWA 3MPUB 5IOLA 2NNWA 4ZP9A 4FPBA 1HNVA 3QPIA 4M5DB 3O3HA 2BACA 1IV8A 3KJQB 3B82A 1QSLA 3I76A 4OZ1A 3TRGA 2XGPA 3MABA 1RP5A 2JH3A 2WSEC 4AF1A 4ILLA 1GMWA 1LWFB 4XH5A 1ZQWA 1KTVA 2LXFA 3ZDDA 3VQ9A 1DARA 2EFNA 3D2QA 5KNIA 3MXHP 1IQZA 3MR6A 4BR5A 1HUZA 1WSIA 1J9AA 1IR0A 1NGGA 4DSIA 2LHTA 5KFIA 4KO0B 2BE7D 3EVWA 4H5VA 7ICIA 1RQLA 1LEOA 1IBCB 3K59A 4J91A 3V81B 2QYGA 4LF4K 2DPNA 4CZLA 1S7IA 2E6LA 2VCPA 3DXBA 1BD6A 2P9UB 4UB6U 1S4FA 4P2FA 4BQLA 1WEXA 3QB0A 4NL5A 3VPZA 2H3VA 2RE2A 1VQ4N 4C7ZA 2EHGA 4KN4A 4WTYA 4DR5F 3VF2A 2FTRA 2HOFA 2GMLA 3CC4S 1VI7A 2O8EA 3PHTA 2IS3A 4EHTA 4PKIA 2GV1A 3FCVA 2RQ5A 4AFFA 2HSTA 3QWUA 3ZNUA 2XIDA 3NGIA 3QETA 3PM9A 1LK7A 3KDNA 1FJCA 1JKHB 2BUPA 1CC8A 1LNQA 3MGHA 1FD2A 4CE9A 2CJYB 4PWUA 3JSMB 3N4QA 4RW8B 3LK9A 1J27A 5CE3A 3UQSA 2V0NA 5HQ8A 3IDHA 3PDNA 3SAHA 1EP4B 1ZBFA 3KLEB 1CJTA 2OAUA 3KOAA 1T9VA 1E6VB 3OYEA 5J2CA 3UFCX 1SKUB 4C0HA 4HVJA 4DR6K 3EGZA 3TAFA 3C66A 2E9ZA 3HPGA 1DJ0A 1OWXA 4FLZA 2KHOA 1F0XA 1TFRA 3HSTB 4CZEA 2C3YA 3C14B 2GEMA 1XBWA 3JS6A 3D6MB 4EFHA 4BJQA 4GKKF 3QRQA 2VGMA 4FLVA 4HDGA 1RWNB 2V94A 3CPEA 2VDIA 3ISZA 3AQFA 1M5PC 4JI5F 4DUTA 3QO9B 3OFGA 3FQKA 1WC5A 2Y0SD 5ALDA 2MYFA 4KHNA 1CJUA 1B9DA 5AI0A 3PW7A 3V4IB 2QB1A 3KD5E 2H3ZA 2CXEA 3KLIB 3TQEA 3NWRA 2KK0A 2N7CA 3RMCA 3VEZA 4JK1A 2H4WB 1WNEA 5BYQA 1OW5A 1EWQA 1FFSB 3O3LA 5D49A 1X9SA 4CO4A 2O4GA 1Q3VA 5AKHA 3N6MA 5ETVA 2CIMA 1FNMA 1S8OA 9ICBA 2ZH5A 2A1SA 4G1PA 4RZRA 3PJ9A 2XWYA 3W62A 3KJVB 3H25A 4DBQA 2X6SA 2R7OA 3CJ8A 3NDKA 2B56A 1JLQB 2NZCA 1OVQA 5M2PA 2NRZA 3VAJA 2CPHA 1REGX 3UR0A 3OR1A 8ICUA 4QZHA 2HBMA 2FD2A 3PSPA 1HX1A 4BY9C 4JV0A 4R8UA 3MMAA 3SCXA 4LFCJ 1KOHA 5JVHL 4R63A 3DLLQ 4B1ZA 4ZJLA 5EHHA 4LF4F 1R6VA 5DLFA 4CVNE 1U2CA 3I5BA 1BUPA 3RBDA 1HMVA 1Q78A 2JH1A 2EI5A 1SL2A 4TQSA 2C3OA 3GSIA 2M8HA 3L0QA 1ZQVA 2VBWA 2R7WA 3OYMA 1KCFA 5AICA 3DV9A 1RT1B 4H0TB 1Q53A 2XG8A 1C0UB 4JB8B 2J0WA 4MEXA 1VSFA 4KGZB 2E5LK 5LT5A 1WBBA 5HLFB 4O3QA 4V1Ak 4RPZA 4BC4A 4J9KA 2I6WA 3VZIA 2N7YA 2H3FA 2P2CB 3A0BU 2OD6A 2VFVA 4U7CA 3V1RA 4DR6F 2DH8A 3EZ5A 3E8OA 3AY9A 2H3EB 1TQLA 3FMWA 2I38A 4FNHA 3BPSP 1MMLA 3ID8A 4R79A 4I6AA 3GYXB 2CQ1A 4JI3F 4ZLNA 4ELTA 3GDXA 5AM1A 1ZQHA 5KFEA 4RQ5A 1T3QA 3ILIA 4MO4A 1RBAA 4KX5A 3JPOA 1HNZJ 4Q8EA 2VJ5A 5KPTA 3P5JA 3PFOA 3MXIA 3GV5B 2NLWA 3DLJA 2HMXA 3THPA 2DY1A 4HTJA 3IWNC 4PHAA 2HHTA 4JRQA 1KVBA 3NAEA 1YTUA 3NGKA 4M41A 5TISU 1HKCA 5B08A 2OPRB 2YHYA 3MXJA 4M63C 2YI1A 3KUGA 4B3RK 4WTOB 2PSZA 4G9ZA 2HQDA 2ZJPQ 3D1QA 2EDUA 3M9MB 1RTJA 2XI3A 3UMGA 2I5HA 2ITMA 1NGFA 3HW8A 4CYUB 1R0BG 1F1BB 2A10A 3VQ7A 4CJUA 4IOAL 3MWBA 3PVXA 1ZQSA 4DR2J 2EC0A 2WVBA 2P35A 1L3UA 2JOQA 3D7EO 1XUPO 4QS9A 3R5JB 3MD3A 1ZQOA 2YWFA 5J0QA 4HTLA 4RCHA 1JB0C 4E7IA 4Q43A 1KBUA 4OQJA 3TA0A 4USAA 2YX4A 4O9MA 4K7QA 4Y2KA 1MC8A 3OLAA 1FEZA 1HNVB 3FC9A 2DR8A 2MU2A 3OTDA 4DX5A 1UJ5A 2ZNYA 3MM8B 3VEOA 2DPIA 4F2SA 2LYVA 4YXJA 3CF5Q 4W5NA 4YB6A 4PHTX 4F72A 2X7IA 5AQYA 2RLTA 4LFBJ 2BW7A 4YOUA 4CI6A 4P73A 1R43A 3NUQA 3HJEA 4BCAA 3EN9A 3AM9A 2XMAA 4OLPA 2LU2A 3CMQA 4RNMA 1RBRA 1XN9A 3BEXA 5DB7A 4DOZA 1U6FA 1TUWA 4P9SA 4I9QA 2AHOB 2E5LF 1TK5A 1VSEA 3JXUA 1PKUA 4QZFA 5IIMA 4ZPWR 1VSMA 3HSZA 3CMEN 3NVZA 4PKDB 3NLCA 2LQJA 2GZOA 4DFPA 2J6TA 4DQ8A 1RI7A 4OJ6A 3T1HJ 4OZ5A 4J9LA 5ALMA 4OJ5A 5HI7A 4NA2A 2O8EB 3MWPA 1PUZA 5KPRA 2KG0A 4NLWA 5KTQA 5TKWA 1Q82T 2O3DA 2KFZA 3AY0A 2LM4A 3AVMA 8ICCA 2G8IA 2P8IA 1CJTB 4FFDA 4CBWA 5T7LA 2ZQBA 2PC6A 3RGIA 4C48A 2Z1JA 5KT4A 2D69A 2E1RA 2IRXA 1NMDA 3GWCA 4FF3A 3K57A 2E7WA 3O1WA 5BPCA 4DV5K 4KE5A 2D0PA 1R3NA 1HFEL 4H4OA 3UI3A 3IV6A 2HW3A 4NV0A 3PYDA 1Z2LA 2WB1F 1LB2B 5D0RA 2DCUB 2BRKA 2R2TA 1YIJS 4B3RF 4OHVA 5F9NA 3CD5A 3NRZA 2HHXA 2WHOA 4J9PA 1YKWA 2RMLA 1M90O 1X42A 3F2CA 1PC5A 4DHYA 2CPIA 2J7KA 1UTAA 3ADAC 4HDHA 2CNNB 1NSQA 4MTPA 3DRPA 5J0YA 4OYBA 4RUCA 4KREA 1Q95G 5H9FJ 4O5CA 3R6GB 4FLYA 2A6AA 3LQVA 4USHA 3U27A 3KK7A 2LU1A 4JV5K 2EAPA 3S3MA 4GC7A 4ETXA 4Y3CA 3BBBA 4C0BA 1CVJA 2RUGA 3NXZA 2BKNA 4ZLPA 1EJ7L 4F5NA 1PGZA 3Q83A 5AM2A 2H1YA 5F41A 1D4XA 1K9MO 1HKBA 5J0XA 4QNLA 1KW4A 1S9EA 4IQXA 2BQ3A 4M6WA 3SZ2A 3CCMN 5LXYA 4F0HA 1TAUA 1BDGA 2J7WA 3CCSN 2FZKB 2CXYA 5CJ7A 1J5EJ 4BACA 5LL6Z 4NOHA 2LEPA 3OR1B 4JYAK 2EW9A 2EKYA 1ZTTA 5H9EJ 2ISOA 1BY9A 3NCRA 1IBLK 1A7GE 4CLSA 3MMAB 2PEHA 2MQOA 3HTVA 2HGMA 2M52A 3SI6A 5HANA 4C8ZA 1DRZA 3D7SB 3LDOA 5TZVA 2QL9B 3WXMB 4YB1P 1UPPA 3QJPA 5HVGA 2GX9A 4NMLA 1HMVB 2ZOFA 3BPDA 2B7BB 3GZ7A 3FR0A 4B1WB 2GBZA 1ZQPA 4O3SA 2YKQA 1QQCA 3CM6A 2LYBA 1HNWJ 5HQLA 1RHUB 3MCAB 3FFIA 4ZS6A 1OSDA 5T7BA 2KZZA 4B3TK 1NJXA 4PYAA 3RFAA 2K7KA 2X78A 5M2RA 1GLLO 3GJQB 1VQMN 1BNOA 5IFMA 1QVGR 5AKEA 5J2FA 3OHRA 1SXEA 3R7SB 1UWBB 5D6GA 2CZVC 3V9XA 5DG8A 4WF9Q 1Y5NB 3H0PA 1SC6A 3IAS9 1Q5YA 3M8YA 4X4OA 4B3SJ 2BOAA 1RTHA 2J8AA 3GOIA 1WBDA 5SZTA 3QYPA 3T19A 4DV5F 1M90T 2R7VA 4EHUA 5KQ8A 5F3XB 1N32J 4MMOA 4JI1K 4BS2A 2UUCK 2QMXA 2LYAA 4FJKA 4H8KA 2Z30B 1M0SA 3CQXA 4CFCA 3TZWA 3CF5L 4DV7K 4FLWA 4ILMA 5HK4A 4X4TA 2JC1A 3QT7A 2FZCB 1N36J 3MDCA 1HR0J 1HW9A 3T6JA 1VQKN 1WEZA 1NGHA 1RWWB 2RS8A 5HR6A 1AFJA 2E2QA 4ZOHC 1K9MT 2R9LA 1B7FA 2A1AA 3EPGA 3JTNA 2A18A 3ETOA 4JV5F 4CHNA 3UWTA 2B9WA 4TNOA 4FYDA 3AJ1A 1RAJA 1FRMA 3UKRB 4K4UA 1RTJB 1QZ6A 2V9WA 3SSSA 5G5GA 1UL3A 1KFTA 2EQYA 4JNEA 4CJLA 2EKNA 5CH7B 3S3NA 3T7ZA 5BRHA 2DR5A 2IRYA 5HOOA 4GV9A 1NMEB 4JKCA 1U1NA 3HHNB 2IMOA 3T5LA 2AW0A 1Z4OA 3NVYA 8ICHA 1Y3KA 3L3FX 1NH7A 4NWIA 5G0RA 1X7VA 4KB1A 4ECXA 1JXEA 2ZBPA 4JK7A 3IWLA 4URQU 4HCBA 2FJAB 4GMKA 4JS4A 4FVCA 1KP6A 4QIWD 4ANEA 1S5ZA 4ZJQA 2DFHA 4DCHA 4JYAF 2QA4S 4OKKA 1IBLF 4RQ4A 5L38A 4LF5K 1SZHA 2X6NA 5MLCQ 3E1YA 7ICQA 3MAHA 2HHWA 4FF2A 2YQ0A 3S41A 5E2QA 2E3TA 3QEXA 5KFHA 3GIRA 2DEJA 1WSHA 1SH0A 4UOHA 3AD7C 1ZQJA 1XMBA 2ZGYA 3MFIA 2IA0A 3AVLA 2GJIA 5KFOA 2M0NA 5J2EA 3BGUA 4QZ8A 3LDQA 4PGQA 3CCVS 2VIXA 1BO5O 5KI6A 2YH0A 4PCQA 4DX7A 4E89A 2CJAA 3IFRA 1RTZA 4URGA 4B3TF 3SYZA 2LP4A 3WNHA 4ZKAA 1T0TV 1NJIO 2KVCA 2OMOA 1A0OB 2BBEA 1BPXA 3OTOJ 1HPMA 4B1UB 2QWQA 3OL8A 2WVEA 3CDBA 2FHJD 1S5LU 5HMYA 4NLQA 2P51A 4V19J 2MKCA 4J90A 4XPCA 3R2CJ 3M30A 4A8SA 5ALQA 4O3RA 5DDQC 1XU4A 4DUYJ 4QW9A 2AEJA 4B1XB 4FS1A 4OLOA 2BJ3A 2MKIA 4KHMA 1HD1A 4ILHA 5RUBA 1N56A 8ICEA 2KEYA 4CP5A 5F8MA 3J7ZO 5AE2A 2UUCF 3HT3A 3FEXB 2CGLA 2MLZA 3C6TA 3O9UA 3UD4P 4DV7F 3KK1A 3F9MA 4J9SA 1RDBA 1K0VA 4RQ8A 5C2CA 1UQVA 2EFVA 2QI2A 4A8FA 4P75A 1ZQQA 1YQHA 3BR9A 3V6DA 4NLTA 8ICAA 4M5MA 3P49B 3DOLA 1JWWA 4H4OB 1PYOB 5ALIA 4Z4FA 1BA0A 1S9FA 2CNLB 2I8EA 3MMVA 2DGQA 1FJGJ 3O8MA 3E0FA 3QICA 2OTLN 2KXNB 1Q8IA 3CJ7A 2YNFA 5HJYA 1X4DA 2Q2RA 3AB2B 1I94K 8ICVA 2VJUA 5FJ4A 4CJRA 2DGSA 1SQKA 5LY3A 3B78A 5EE9A 1FKPB 3DRPB 2AD9A 5EE3A 1Q81O 1ZM4A 2VBYA 1SH3A 5KT2A 4PGYA 1I6JA 4AH9A 1PBUA 4O4GA 5HMMA 3M2VA 4K0KJ 2Y3YA 4AQYJ 4JK8A 3KLFA 3B6PA 1JLCA 2BCUA 2UXCK 4CK1A 1LW2A 2JV3A 2Y8WA 4KPYA 3CJ2A 1URRA 1ZM2A 2EG2A 1Q46A 2W55A 4LF5F 4DSLA 2IDEA 1ZC6A 3R97A 4W98A 5KFDA 3HKWA 3N4WA 1L3KA 4EIAA 3EZUA 4WF9L 4CRXA 3QFPA 4I69A 5ADXH 1PAUB 1S9EB 5KAFU 2FJBB 4M6WB 2DNLA 4DN9A 5ALEA 1B43A 3ORYA 1NJIT 3A8IA 2HZCA 5KT5A 2E66A 2LQ9A 2KLAA 2ZOGA 1NNDA 1WHXA 3GZFA 2R7RA 3CERA 4KH4A 3MPYA 5ETMA 3HO1A 2QSWA 1NK9A 2Q0RA 3WNEA 4Z6DA 4DR3K 4B8CA 4LFAJ 1EXQA 2E8OA 3PO4A 1HUXA 4OLBA 5IT9O 1ATNA 2MZRA 3DC2A 2HURA 3AHPA 3THYA 5HHIA 3J7ZT 1H7XA 2AQ0A 1WC4A 2V8DA 4PG4A 3BKFA 1U8WA 4LJMA 1NPPA 5AQGA 4LZGA 4AUKA 2NPFA 3WX4A 2HRTA 2MRLA 2WF5A 2D6FC 1HYZA 3DGPA 4FOEA 1J97A 2ZJQQ 2D1KA 2DNZA 2LSNA 4IFEA 1PYTA 3O2IA 3G6VA 1WTBA 2B4PA 5E3AA 2XLKA 4USVA 3O1LA 3L5KA 3CCTA 1PVQA 3R1LA 1XO1A 2UUAJ 4HLBA 3KKSA 4J7CA 3LPTA 1RTHB 2JWLA 4CHPA 4FLXA 1FDBA 5IT9U 2J9EA 1ZXOA 1MQ2A 2ZZMA 4WFXA 5EOZA 3QZ7A 3V6HA 3W66A 4DR4J 1XR6A 1RLCL 2K1RA 3PSFA 5HRRA 3CC4N 4B9QA 1YUWA 1Q81T 1JROA 5U47A 4RBUA 3VAHA 4ZVEA 5BYSA 3WK9A 4TXSA 3QRRA 5IT4A 1I94F 5ALKA 2FPLA 1O5JA 4GRSA 3SMSA 3OTCA 2O8FA 5IINA 3J80Y 2Z8QA 1W26A 5DGAA 3U3GA 2YHXA 2HGLA 2MLYA 2UU9K 2F96A 5L9XA 2FVPA 2VWKA 3MC1A 1H98A 1VSDA 2O8BA 3W8PA 4X66J 1N2XA 3KLGA 4C11A 2D74B 2OHDA 4ID8A 1KTQA 4C3KA 4XA5A 1ASUA 1KQSR 2PYLA 3DM2A 1FRIA 3TJ8A 4KI4A 4O8UA 4KGVB 5J2NA 2J8SA 2QLFB 1N34J 1T11A 3A8EA 4ZHRA 4FWOA 2FI1A 1U2RA 2IY5B 3VETA 5G0RB 4BXOA 2QKKA 3Q8UA 1VRUB 1ELOA 1YTYA 1FRHA 4CGHA 5D78A 4I2DA 3KHLA 3AA8A 4DR3F 3MM7A 3O4NA 4J9NA 5ALVA 4X2BA 3GPAA 4M45A 3EGNA 4WYBA 2BJDA 5KFZA 1JCEA 4JD2A 4AXJA 2MMYA 2FJWA 5HNKA 1L5UA 5A2QO 2KG5A 1GTEA 3A5MC 3E9PA 1XMOJ 4J9MA 5KFXA 1WSFA 4CEAA 5IZHA 1Z1BA 2BM0A 1J5OA 4TUSA 4ELUA 1RHKB 4XQ8A 4EX7A 2MQPA 3ZTSA 3MCSA 3AU6A 3R9KA 5IM0A 5AQIA 2DVIA 3AXMA 4X4SA 3KJNB 4UB8U 2YNGA 3Q2TC 2KT2A 4IQMA 4O8KA 4LF8J 1D8BA 1L7PA 5AJ3J 4BG9A 7ICPA 3N6NA 2V8PA 2HI0A 1HNXF 2CJKA 3M30B 2E1EA 4RBTA 1YXQA 4N8NA 4H0PA 2E8NA 5JTIA 9ICOA 3NMRA 4FK2A 2ZBIA 2CADA 3NF8A 1KL9A 3NRBA 1NOZA 3CIPA 1QAXA 8ICBA 2RAQA 4DV4J 3CQ8A 4AYBC 5F8HA 4I9LA 3F53A 2W9BA 8ICIA 1RU1A 1M5VC 2OM6A 1TU0B 4DOAA 3C6TB 1FJ7A 2P9PA 1X31C 4UW9A 3KK1B 4B02A 2KU7A 2KMDA 3I8BA 3VZHA 1J2VA 3HHLD 1LXJA 3I0SB 2E1YA 4Q45A 2QLTA 4I6YA 3V6DB 2NXCA 4M2YA 3W0LA 3WKAA 5DDOC 4JAXA 5GIPA 1DT9A 4XAKA 3L2UA 4IDKA 3BGLA 2UU9F 1NPKA 4CF4A 1SJFA 8ICXA 4ZCMA 4KMOB 4ED7A 3CJTA 2RS2A 1X2IA 4K25A 2RIJA 1E4GT 5J0RA 2HCFA 5AK4A 2AA4A 2YNFB 3GL1A 4JI6J 5DB8A 5FPMA 2BPGA 3BBCA 1DGKN 2P6SA 5DKWA 3WKCA 4TU9A 3RB3A 3X1LB 2L5YA 4RX6A 1EZZB 4J9QA 2MQMA 1MW7A 2RT3A 2OUGA 2PA8D 4MAKA 4BC7A 4DO9A 2RU9A 5AK3A 4O4GB 3M2VB 3KLFB 2H54B 1JLCB 2G0JA 4KLDA 2AP6A 4YVZA 4A57A 4PEOA 1LW2B 2Z58B 3C16B 5CY4A 5ETNA 4M5LA 1RBOB 3TFSA 1JLAA 1T4GA 4JLHA 2V2ZA 4BRHA 1VQON 5EN1A 4QZBA 1RABB 3O9SA 4CGZA 4BRFA 2FYXA 1IO2A 3SQ4A 1NNLA 2CGJA 3JS9A 3BDPA 4WK3A 4IEEA 1FERA 2F65A 3NF7A 2WONA 1OJ4A 3RW7A 1NSAA 1SZPA 3J81O 1JN3A 1OVYA 3JPNA 1B99A 2RJZA 2GWJA 5D3GA 2UYTA 4OYAA 3OHBA 2UVWA 5E3PA 2RSQA 4E19A 3I55S 2OLW