2XY5A

Crystal structure of an artificial salen-copper basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
581
structure length
581
Chain Sequence
AAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 211
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy5A01
7ICKA 3TFRA 2X74A 2EHGA 1JLCA 2BPGA 4ED8A 9ICBA 3VQDA 2W42A 4GXKA 2F1HA 1IO2A 2G8WA 3SNNA 2XRIA 1BISA 3DYAA 7ICMA 1JLGA 3QNOA 1C1AA 4O44A 3OSPA 1RYRA 2ZD1A 3EPIA 3CQ8A 9ICUA 5DG8A 3SUPA 3ZDEA 4F5RA 2VWJA 2GWSA 5CZ1A 3LDAA 4UBBA 4DSJA 3PUFA 3TAEA 1DOQA 4H4MA 4RU9A 4NYFA 2DFEA 5CJ7A 4QZHA 1EXNA 5KG2A 1KEJA 3RAXA 4O0IA 1T05A 3HPHA 3QEVA 2FMSA 5J2CA 2VWKA 3L2UA 4B9TA 1LAWA 3TWHA 1XI1A 4F4ZA 4CHQA 3O4QA 5KT2A 4AHSA 1RDBA 3SQ0A 1TAQA 3RMBA 2C2DA 4K8ZA 1EX4A 4CGGA 4BGDA 2MUTB 2XCAA 3A2FA 4O3RA 4J2AA 2W9CA 5DB6A 3LP1A 2OZMA 5HP4A 3FFIA 1IKXA 4CEZA 3ISNC 4XIUA 3U3YA 1T03A 5E41A 3LZIA 4RW8A 1VK0A 2AJQA 4EZ6A 4KLJA 4QZDA 4DTMA 5SZTA 2HNZA 8ICPA 2J6TA 5DQIA 4FK2A 4BDYA 5DB8A 3EZ5A 4EEYA 1DLOA 9ICNA 4E3SA 1L3VA 4M6WB 3JPSA 1DGSA 4B8AB 3ZT1A 3EYZA 3GIKA 3NTUA 5KFQA 4E7HA 4DLGA 2MUTA 4Z4FA 2W9CB 4CK1A 5TZVA 4G3IA 3L3VA 4DQRA 4AHVA 1TVAA 3C94A 5J2IA 1UT8A 4RPXA 3H08A 3AVHA 3C2LA 2X78A 4QZEA 4KFBA 4Z6CA 1W0HA 4RZRA 4AILC 8ICXA 3KLGA 1RTJA 2IA6A 1KDHA 2BDPA 1VSFA 3HVTA 1UT5A 1S0MA 3DMJA 3PR5B 4BXOA 3M9NB 4DSIA 5HBMA 2UVRA 5HRSA 4HCBA 3AU2A 1B9DA 8ICBA 3S3OA 4JLHA 1JLAA 1U49A 4R8UA 2BPFA 2YHAA 4O5CA 2WOMA 1JXEA 1S1XA 2HHSA 4F91B 4HVJA 3ZSVA 4ECUA 4FLWA 5D3GA 4DSLA 5C24A 3AO3A 1D5AA 2V4RA 4KLHA 5L1KA 1RT1A 5KFBA 4E7IA 4AHRA 3AA2A 4LSNA 3OSNA 5J2QA 1SL1A 1U9LA 7ICEA 3QE9Y 1A5XA 1KFSA 1ZQWA 4FXDA 1RT4A 2YNIA 3C6UA 3V1OA 3ITHA 4E1MA 1RPLA 4QZGA 4HHTA 9ICKA 5KG1A 4E7KA 3KJVA 5KG6A 1KRPA 1XSPA 3JPRA 2Y1JA 3NGYA 4M9GA 3RJJA 4ID1A 3AVKA 5I42A 2D5RA 3G6XA 3SCXA 4FZZA 4LH4A 4J9PA 2OWOA 1HMVA 3RMDA 4YP3A 3KK3A 3KLHA 4YMOA 1B92A 1IH7A 3B6OA 1RBUA 4M9LA 9ICLA 4R63A 4KTWA 3SV3A 4KMUA 4EBEA 2HHWA 4FJ7A 4JK1A 4KLSA 3Q8SB 4Q44A 4B9MA 1TVRA 4IG3A 3VQ4A 3PW5A 4CJRA 1S1VA 2EX3A 1TL3A 3T19A 1KVCA 5J0QA 1S9GA 2JZBB 8ICCA 1ASUA 3AO2A 3AU6A 3PW4A 2JEIA 3TAPA 3LP3A 2HNYA 4GMJB 1UA0A 4ECTA 2KZMA 1JL2A 5J2DA 1N6QA 8ICHA 2ZJ8A 4CJLA 4I2DA 3NF6A 4J2BA 2HVHA 4MFCA 4PY5A 3BJYA 3ETLA 3ZD9A 3GDXA 1TKDA 1SKWA 3SJJA 4NLZA 4CHYA 4UB5A 2BCUA 4I9QA 4DEZA 5KFHA 5CHGA 3H4BA 4HUEA 4FJMA 3C5FA 4RUCA 3O3GA 4ICLA 1TKZA 1XSLA 8ICMA 4CJUA 1Y88A 1U04A 2YHBA 5L1IA 5HLFA 8ICSA 4TQRA 3RB6A 4J2EA 3CM5A 1ZQHA 5C42A 3G6YA 4EP5A 2W9BB 4P4OA 2F96A 3CYMA 3H8SA 5DLGA 1VSJA 1WSFA 3TAMA 2JEJA 2Z1IA 1KFDA 5BOMA 4CFCA 4RQ7A 9ICIA 3MEEA 3ULDA 1VSHA 1NJZA 3SYZA 2A1SA 3TAFA 8ICYA 4DTUA 4CIGA 1FKPA 3SUQA 4CCHA 1ZQFA 1TGOA 4F8RA 4KI4A 3VQ8A 5KFYA 2Q0ZX 5EWEA 3F73A 4B9SA 3V9WA 3UXPA 3EPGA 1ZQOA 4DMNA 3H8JA 5CP2A 4RPYA 4MF8A 4KLOA 4UAWA 1BPDA 4DFMA 3PW7A 1XWLA 4F5NA 1ZQYA 1K1SA 4M3WA 3KTQA 3Q8KA 4QZFA 4DTJA 4FJ8A 3MR3A 4DSFA 5L1JA 2AQ0A 1B43A 3O3HA 3LP2A 4KLFA 4KLGA 4CGHA 1Q9XA 1IG9A 4UAYA 4IQTA 4ECYA 2BANA 4XUSA 4QWEA 4YN4A 1SKRA 5T7BA 2XY5A 5CYQA 2F8SA 1S6PA 4CHNA 1CZ9A 3HVRA 1L3TA 1HRHA 5HP1A 2ALZA 3TI0A 2G8VA 1XSNA 2W8LA 1HQUA 4YD2A 4CEQA 5I3UA 2B5JA 2IOCA 3PVXA 4N5SA 1WN7A 3RB4A 4O0JA 5KFPA 4FLUA 3V72A 4K4HA 3PY8A 2FBYA 1WSJA 8ICOA 3KHLA 5KT4A 3T1AA 4RQ4A 3PW2A 1JL1A 4OPKA 1RDAA 1X9WA 4FLVA 1NK8A 2RPIA 4OGEA 5HRRA 3ZSOA 3C2KA 4FJNA 2RDJA 5HMLA 1ZQAA 3KIOA 4QZ9A 4M9HA 3LANA 1WAFA 2BGWA 9ICXA 1N56A 2ISPA 3V6KA 4QZBA 2XY6A 5C25A 3QESA 1JX4A 4DU3A 1JKHA 4N76A 3V4IA 1ZQZA 4PQUA 1HNVA 4Z4CA 4IQWA 3MR2A 3RH4A 2DPJA 1J54A 4RW6A 4ED6A 5FRNA 2QK9A 3H40A 2F1JA 1ZQDA 3MEDA 4MEYA 1IKYA 5KFAA 2IMWP 7ICGA 2ASJA 3IG1A 1DTQA 4PHDA 3AVCA 4M0AA 3MECA 5IINA 1S9EA 3NCIA 9ICHA 2O4GA 5J0UA 4B9VA 2YKMA 7ICFA 3RB3A 3PO5A 5FROA 7ICJA 1B22A 2YNGA 4O3PA 4FJHA 2XCPA 2R8IA 3GIMA 5CZ2A 8ICJA 4ED7A 5DQHA 1RTHA 3MDCA 4UBCA 3HSTB 2XC9A 5F9NA 3PR4A 9ICCA 4CJQA 3HM9A 3V81A 3QEAZ 1RT2A 4I2JA 9ICJA 3ZSXA 4PWDA 1SV5A 3P83D 1S1UA 5KT7A 1WSHA 3EY1A 4IFVA 4H4OA 3AVIA 3K58A 2ZTEA 1WAJA 2BCQA 1C1BA 3RJFA 3V6JA 1C0MA 1T4GA 1RBVA 4R8UB 4KTZA 1KVBA 3M9OB 3DLGA 5BOLA 3NDKA 5J0YA 2FLLA 1JLEA 3DI6A 3T5LA 5J0OA 2UVVA 3GILA 4I2FA 5IIIA 2FBTA 2HHVA 4BWMA 4BE0A 3K5NA 3H4DA 4CEFA 3K59A 4M3UA 4QWDA 3TANA 3QETA 4FK0A 2G8FA 3NGDA 3RH6A 1RXVA 3D45A 3PO4A 2ZUBA 2HHXA 3ALYA 3UXNA 2BR0A 3QLHA 1SL2A 3VQCA 1Z25A 5DG7A 1JLFA 3DRPA 3DRRA 1YVUA 1D9FA 5EWFA 4DS4A 4FLXA 5KFJA 5FRMA 3RJHA 2P51A 1BCMA 4I2HA 4DS5A 1XHZA 5CYMA 3QEPA 7ICQA 4BACA 1VSKA 4OVLA 2HHUA 2PFNA 3V7KA 1S9FA 2A1JA 3TAQA 1ZQPA 3D0PA 4CESA 1SZPA 5KG0A 4CIEA 4FYDA 8ICUA 3TR8A 3V1RA 4R66A 3S9HA 4LD0A 7ICPA 2H5XA 3ASMA 3SQ4A 2OA8A 4DWIA 4HUGA 1HUZA 4E19A 2ASDA 2BHNA 4M47A 1WLJA 4YCXA 2IHMA 3TFSA 1H38A 4KHWA 3LWLA 7ICUA 5IIKA 3AA4A 1RT6A 3CFOA 1ZQUA 4ZHRA 5KFTA 1I39A 1MQ2A 5IIOA 3OHAA 4CEDA 4B8CA 3NH2A 1ZBUA 3T5HA 4WE1A 2Z1GA 1NJYA 2BPCA 3RRHA 1BQMA 2IBKA 3BQ0A 4DU1A 5BPCA 1MQ3A 4DQIA 4O5EA 2I5JA 1TV9A 1K6YA 2P6UA 4CGJA 1HNIA 4RUAA 4DFPA 2QXFA 3MXJA 4AHCA 5J0TA 4F5PA 4ZTFA 1NK0A 2OPRA 1LW0A 3UQ0A 3IRXA 3K5LA 4DSKA 2R8JA 3KHHA 3NFAA 1MSWD 2NUBA 1Q8IA 2A1RA 3HP9A 1NKEA 2BGGA 4Z6FA 1HUOA 4PHEA 4CJPA 2YNFA 4FJLA 2NRVA 1QE1A 4AH9A 9ICTA 3LAKA 2FPLA 4ECVA 3C1YA 3LDSA 4OKEA 1ZQXA 2HNDA 5J0WA 4KLEA 1A77A 4MFAA 2G8IA 9ICSA 1VSIA 3BQ1A 1ZQCA 4NXZA 5KFWA 4CF2A 1K1QA 4NM1A 4YXMA 4P4PA 2KQ2A 4FJ5A 1BI4B 4ECWA 4I2PA 4TURA 3JPQA 4CGFA 3NF9A 5J1EA 1MC8A 1XHXA 3QIPA 1S97A 2GV9A 3L2VA 2IDOA 4J9KA 3V7JA 3V9SA 2GBZA 4DOBA 4UAZA 4GXJA 5KFXA 3LALA 4M2YA 4JV1A 3OGUA 2F8TA 1EETA 3L8BA 7ICIA 4PA1A 5KRSA 3ZT3A 1VSMA 3V7LA 5DK5A 4E7LA 5KFDA 5J0XA 2MAXA 4R65A 3ZSZA 4P4MA 1RZTA 3OYBA 2DPIA 4ZTJA 5HHHA 2XY7A 1TKTA 3T5KA 4JRQA 4DL4A 4RQ8A 5JS2A 3OYCA 4NY8A 4O55A 3MGHA 3C2MA 3QIOA 1NK7A 4GLXA 5HRPA 4YVZA 5DDMA 1QQCA 4RT3A 4DTXA 3SPYA 2PY5A 1U45A 1X9SA 1S0NA 1BVSA 3AUOA 4O3QA 4H8KA 3PX6A 4MEXA 2JEGA 4PGQA 3JPPA 3KKRA 1ZJNA 5SWMA 2BQ3A 1WNSA 1N5YA 4M3RA 5DBCA 5DMRA 3NGIA 1EKEA 4KLDA 4N56A 3H7IA 4LSLA 4FLTA 1YTUA 2ZJ5A 5KFNA 5DGAA 1QTMA 2PXIA 3DOLA 3ISCA 4HYKA 4DSEA 2IAJA 4NLKA 3Q8LA 3T3FA 3BDPA 3C95A 5EU7A 1LW2A 3ZDDA 4QW8A 4RG8A 2PI5A 3PX4A 4K4IA 4QZIA 2BCVA 5EWGA 4F92B 2JLEA 3MXIA 1J9AA 4CHOA 2PFQA 3RRGA 2ATLA 3PMNA 3PNCA 1DTTA 5EOZA 4NCAA 4CGDA 1HYZA 1JMSA 5DGBA 4J9QA 5DDYA 4DL2A 2XHBA 2I1QA 8ICRA 2X6SA 1S10A 4I27A 2AGOA 3QEXA 4CFDA 4KLMA 4KI6A 2IC3A 2J6SA 2PI4A 3KK1A 1ZQKA 5J0SA 4CJ5A 2VG7A 4RQ2A 3S3MA 3V6DA 1CXQA 3Q8MA 2GUIA 3CFRA 4GXIA 3PMLA 5HMMA 4NCGA 5KG3A 4JV0A 4M3YA 4DQQA 4F5QA 4FLZA 1VSLA 9ICPA 4Y1CA 1LAVA 2IGIA 3QZ8A 4RQ6A 1WSEA 3RH5A 2V9WA 1ZQQA 4CF1A 2P66A 4BE1A 4IR9A 5KFKA 1ZBIA 4ELTA 5FDLA 4KV8A 2M9NA 4RPZA 3AO5A 7ICLA 3VQPA 4DLEA 1C0UA 1ASVA 4FJIA 3Q8RB 1CXUA 5KFSA 1BPBA 4IRDA 1C7YA 3MBYA 1JXLA 5IILA 9ICEA 4GC6A 4GVMA 3MDAA 1F21A 2WONA 4PHPA 1C0TA 4EYIB 5KRTA 1FK9A 1CUKA 3E2EA 4HUFA 3NH1A 1BHLA 2C28A 1NK4A 3RJEA 3AA5X 3G0ZA 2V4QA 3OYKA 3IM1A 4RNNA 3GV7B 3VA0A 4E7JA 4IKFA 3VN5A 1QSSA 3ZSWA 1QHTA 4FW1A 8ICVA 3N97B 4KKOA 3OS0A 4CJEA 2WTFA 3NBPA 3ZDCA 3DLRA 1XU4A 5KGXA 2DTUA 3AVNA 4GC7A 1X2IA 1BPZA 3UXOA 1XO1A 4FJXA 4DQPA 4M9NA 4KHSA 1IM4A 1NJXA 3IAYA 3QEBZ 2A1JB 3BQ2A 4DTNA 1Q9YA 2ASLA 3SI6A 3MABA 4PGYA 2FBVA 1WCNA 3AA3A 4B3OA 5KFZA 4CFAA 7ICHA 1KLMA 1ZQVA 4I29A 2IS3A 1ZBHA 3CFPA 1ZQGA 4FLYA 3RBEA 4P2HA 4Z4EA 1EP4A 1NOMA 2JGUA 4KITB 4HCCA 1JLBA 3VQ9A 1S6QA 4FJGA 1SUQA 3QERA 3JPTA 3L3UA 2B4JA 4EYHB 1XS9D 5J2MA 2KFNA 4BWJA 4QZCA 2KZZA 4BXOB 4ZH4A 1QSYA 5KT6A 5CA7A 4F3OA 3G10A 1WSGA 4ECRA 4FZYA 2YV0X 4CF8A 4HTUA 2D0BA 9ICQA 1RDDA 3C6TA 4CHZA 4IDKA 1R0AA 1T7PA 2F1IA 4RQ1A 4Q8FA 4W5TA 4CK2A 3HXMA 3AVFA 3E01A 2RF2A 1UOCA 4Z4IA 4CECA 3JSMA 3V6HA 3O3FA 2ITGA 4RNOA 1B9FA 2FLPA 1CEZA 1YTAA 4ECQA 5J2EA 1D8YA 4EBDA 3M8SA 2HHTA 4XQ8A 3TARA 3RJIA 1XC9A 3L2QA 3MGIA 2OPQA 5HNKA 4GW6A 3I8DA 4KHYA 9ICGA 3HPOA 1ZQJA 8ICEA 4C8NA 4O5KA 4B08A 2FLNA 4X5VA 3HP6A 2VG6A 1T8EA 4YR3A 1HPZA 1J5OA 4M42A 3JYTA 3KHGA 3ISBA 4FK4A 4Z4HA 3KD5E 4E0DA 4N47A 3RB0A 4MQ3A 4F2RA 2VA2A 4LH5A 4O3SA 2ATQA 1S1TA 3LAMA 4M3ZA 3ZCMA 5JUMA 1HYVA 3K2PA 1LV5A 3BQTA 1C6VA 1A76A 2ZTCA 2KTQA 2HB5A 4KB0A 4FS1A 4QAGA 1LB2B 2C2RA 5HROA 1L3SA 3OYGA 1RT7A 3OS1A 3S3NA 1UWBA 3HPGA 2OZSA 3PW0A 1NKCA 5HRNA 5DQGA 2YNHA 4DTPA 4AHTA 3KD1E 3VQ6A 5JS1A 5KFRA 1BPEA 2O4IA 4OJRA 4DTRA 8ICNA 4KRFA 4RQ3A 2W9AA 1KFTA 3RBDA 4FZXC 2E4LA 2E6LA 5KI6A 4BE2A 2P5GA 4PHAA 4DG1A 3JPOA 2E6MA 3GIIA 2I9GA 3FYHA 8ICZA 4YG2A 4ECXA 4KREA 5IIMA 2KZ3A 4I28A 4M3XA 4E89A 4KLQA 1U48A 1T3NA 4YFKA 2PFPA 4M3TA 3LK9A 3QO9A 1ZQBA 1ZQNA 5K14A 3G6VA 4G1QA 3AO1A 4C8OA 5DBBA 4W5QA 4KTQA 4OLAA 4BDPA 4UQGA 2PFOA 5J2PA 5J2BA 2XY8A 3VA3A 3FDSA 4C8KA 4QZ8A 3M8QA 4QCLA 3RR8A 4J9NA 3MXMA 8ICWA 1WCLA 2R8HA 2VANA 3RAQA 1RTIA 3HWTA 5L1LA 2D0CA 4IQUA 3OYEA 5CB1A 2XGPA 3BGRA 1HYSA 5J29A 4YR0A 3OYMA 4JUZA 1S76D 4J9LA 4DOCA 1RCHA 3I0RA 1JLQA 2PYLA 3OS2A 1EXQA 3QEWA 5IIJA 3EW9A 3KLIA 3K5MA 5J2JA 2UVUA 5CR0A 3KKSA 4EBCA 1LWFA 2C2EA 2NRWA 4I2AA 3GFKB 3ZSRA 4ED3A 4FW2A 9ICVA 5DB7A 1KTQA 7ICTA 4KAZA 2VA3A 4QWCA 2KN7A 3UPQA 3VQ5A 1VRUA 3CG7A 4J9SA 3HW8A 4QW9A 1Z26A 4M04A 2VA8A 1Z00B 5KFGA 4C8MA 4JWMA 7ICVA 9ICOA 3M9MB 4DL3A 4PUOA 3LPTA 4YFUA 5D49A 1TKXA 1BGXT 2LSNA 2J6UA 3IS9A 5C5JA 2G8UA 1ZQSA 1S1WA 5CWRA 1GOCA 3OYHA 4F4WA 2NRZA 2BQRA 3U3GA 4JS5A 3Q8QB 3VQBA 3ISDA 4W5OA 4KB1A 2FMPA 3P5JA 4XA5A 1BIUA 4LZGA 4J9MA 4I9LA 2Z1HA 1ASWA 1N48A 2UVWA 3M8PA 4JS4A 1U47A 1GOBA 1Z00A 4TQSA 2AU0A 3ZSYA 1AROP 1Y97A 3WNGA 4KN7A 4NM2A 1TAUA 4J2DA 4CF0A 2R7YA 2FC0A 4KN4A 5KFMA 4DL6A 4K4GA 2W8KA 9ICWA 4DTOA 4NLGA 5J2GA 3ZT2A 4ELUA 7ICOA 1ZQMA 3ZSQA 3QINA 8ICGA 3AVGA 3K4GA 4W5RA 3WNFA 4ED1A 4KHQA 2VG5A 4M6WA 4MFBA 1JXBA 3MFIA 2QKKA 9ICMA 5D46A 4ID5A 1BPXA 4FJJA 1QSLA 3OYFA 1BI4A 3ZT4A 2Y1IA 2NRXA 1NOYA 3OYDA 3OHBA 4MFFA 3CM6A 5J2KA 3DM2A 3PX0A 4PPXA 4RW4A 3DLHA 4B9LA 3KLFA 3OJSA 4CJVA 1G15A 1RBRA 3UIQA 4KHNA 1JN3A 1TV6A 1ZBFA 3LWMA 2HW3A 4Y1DA 1FXXA 4JRPA 3HJFA 1NKBA 4L8RB 5KFVA 2YKNA 4YR2A 4CFBA 4FBTA 1VSEA 1X1PA 3NAEA 1RT3A 5DB9A 4I2EA 1RBTA 4LZDA 2OPSA 3KLEA 1IXRA 3SV4A 2HHQA 9ICRA 2RN2A 4FVMA 2BQUA 3NF8A 4FM1A 3VQEA 2KW4A 7ICNA 4C8LA 2OPPA 7ICSA 4I2CA 3WNEA 1LWCA 7ICRA 4K8XA 4OLBA 1NJWA 4O3NA 3DRSA 3JPNA 4CEEA 3WNHA 4MF2A 1S0OA 3C23A 4OPJA 4F4XA 3AVAA 1ZQTA 3NE6A 2DFFA 4M41A 3SUNA 4JV2A 4YMNA 3HK2A 1QS4A 4UB3A 3LP0A 2ISOA 1J53A 3L2RA 4Z6EA 9ICAA 4CJSA 1ZJMA 3O4NA 3VQ7A 1S5JA 2FMQA 3OYAA 4M9JA 1NK5A 3HL8A 3HO1A 3K5OA 2RDIA 1RDCA 1RTDA 4F2SA 5L9XA 4ED0A 4YMMA 4FM0A 4I7FA 1KSPA 5KGWA 1RNHA 3C5GA 3HYFA 4UB2A 1GOAA 3RR7A 2P6RA 3SUOA 2ETJA 3ZDBA 1KLNA 4CGIA 1S0VA 4DQSA 1TK0A 2BCRA 4TSXA 4I2IA 3GIJA 4DL5A 1O1WA 1L3UA 2P5OA 1NK9A 1BCOA 1PZNA 2ZJAA 4F4KA 4Q43A 3AVLA 1ZQLA 4EZ9A 4KPYA 8ICLA 2P1JA 1CZBA 4B9UA 3RTVA 4I2BA 3TABA 5J0PA 3ORYA 5F9LA 2X6NA 1IKWA 4KO0A 3VQQA 4NCBA 2FBXA 2W9MA 1FKOA 3Q8PB 2JZBA 4CF9A 3OYIA 4O9MA 5KG4A 3MR5A 1W9HA 2PYJA 3ZDAA 4DL7A 3AVJA 4E1NA 3RMCA 3SI8A 4R64A 2NRTA 5CY4A 3OYLA 3KK2A 4RT2A 3NF7A 2G8HA 4I2GA 5KG5A 2ZE2A 1ZYQA 3B0YA 3MFHA 4R5PA 3AVMA 4Q45A 5J0RA 8ICAA 3SQ1A 3NHGA 4QWAA 4IBNA 4XRHA 3OYNA 4RW7A 4B9NA 3HX0A 4UB1A 4PGXA 2ZUCA 4FM2A 2R8GA 4F50A 1IKVA 4RQ5A 3GV5B 4KLUA 2Z1JA 3T5JA 3IHQB 2DY4A 3PV8A 1HQEA 5KT5A 4ECZA 3AVBA 4IRCA 3QNNA 4CEAA 5DLFA 4RNMA 4F5OA 3THVA 3MR6A 3OY9A 2BE2A 4OKKA 1ZBLA 4OGCA 4KLTA 1BQNA 3LZJA 4QOZB 4CE9A 3SZ2A 5J2HA 4FBUA 3GV8B 3NGZA 8ICKA 4LY7A 1REVA 4YXJA 4IQVA 3GQCA 1MU2A 1UA1A 1L5UA 4F3TA 8ICFA 5J2FA 3OYJA 4KLLA 5KFEA 2DFHA 8ICQA 3F9KA 1ZQEA 4Z4GA 1D8LA 4Q8EA 9ICFA 1SKSA 4Z0UA 3ZT0A 2BKEA 3KHRA 2B6AA 1ZQRA 2ZTDA 1Z3EB 4FS2A 2Q3SA 4CHPA 8ICTA 3RMAA 3C1ZA 4W5NA 2AGPA 1RYSA 3MAQA 3V9XA 3OVNA 4IG0A 4QZAA 4LVSA 3AO4A 2HVIA 4FCYA 1A5VA 1S77D 1ITGA 3ZD8A 1TK5A 3UQ2A 3P1GA 4FO6A 4CJWA 4OKJA 4ED2A 3LPUA 2OYQA 3V9UA 3DLBA 1HJRA 1NK6A 2XGQA 4O5BA 2QKBA 1KVAA 8ICIA 2LYHA 1RILA 1TL1A 5D4BA 3K75D 1A5WA 3NH0A 1QLNA 5KG7A 4CK3A 1BL3A 4F93B 4NYNA 4CEBA 2IHNA 4FJ9A 5DKWA 4BDZA 4ELVA 1V9PA 4DOAA 1ZQIA 2D0AA 1SL0A 3L2WA 2KFZA 4Z6DA 2FPKA 3OJUA 3DLEA 3AV9A 3TQ1A 1RBSA 4I2QA 1JIHA 1BPYA 3V1QA 4FJKA 4CJFA 4DO9A 5J2AA 4DFKA 1NOZA 3QEIA 5KFLA 2B21A 1I3AA 3VQAA 5HHIA 1KCFA 3HT3A 2PZSA 4EP4A 1WSIA 1C1CA 2C22A 4DTSA 1TK8A 4IFYA 4CIFA 3SQ2A 3V9ZA 4TUQA 4J9RA 2AQ4A 4O4GA 3DLKA 1U4BA 3RWUA 1HJPA 5KFCA 2G8KA 3EWAA 1BIZA 1X9MA 4YQWA 1COOA 4TUPA 4ECSA 4UB4A 5KFFA 2ZQBA 3DOKA 3U6FA 2R8KA 2HMIA 4QWBA 4YNQA 5KFIA 1RT5A 2ZUDA 1TFRA 1CLQA 4NLNA 3RJGA 4PH5A 4CJTA 4DF4A 3MEGA 4CJ3A 1LWEA 1YT3A 4O3OA 2RKIA 1VRTA 4CERA 4IR1A 3C21A 4RQ0A 1VSDA 5J2NA 4N41A 2FPMA 1UAXA 3H8WA 4TUSA 3RJKA 4YD1A 4JWNA 4DF8A 4KHUA 5KT3A 4DU4A 5KTQA 1D9DA 1ZETA 4CJ4A 2AGQA 2DFLA 2BCSA 4CEOA 4AHUA 4M45A 2W9BA 3K57A 4Q5VA 3QZ7A 4CJKA 3M8RA 1RXWA 3B6PA 4DFJA 4Q0BA 5KFOA 4RW9A 3TAGA 3SPZA 4J9OA 4IRKA 4KLIA 3B0XA 5DG9A 5KFUA 4F4YA 2JEFA 5DBAA 3I0SA 3N4MB 2XO7A
chains in the Genus database with same CATH superfamily
3A5OC 4NLPA 2JLFA 4PG4A 1R31A 1TUUA 2DHAA 3D6HB 5IFMA 3D2WA 3HRDD 1IO2A 1HBMA 4QIEA 3ET6A 3PRVA 2K89A 7ICMA 1GK8A 3H2LA 4N7TA 2CIMA 5IOLA 3EPIA 3CQ8A 4HTIA 2V51B 3J80O 3ZDEA 4PWWA 4KO0B 5K8MA 1GNKA 3G86A 2HOEA 3IG5A 5CZ1A 2VQFK 1B0PA 2RIJA 2JV3A 3CGIA 2HHPA 1GEHA 2HBKA 5JTIA 3H46O 2KJ5A 1SQKA 4QZHA 3IGNA 2YX1A 2E2NA 3RAXA 4O0IA 2FMSA 3KDNA 5J2CA 2G0AA 4URGA 3L2UA 2COLA 1NMDA 4CHQA 1QHAA 5AQHA 2M88A 5C2CA 3OTOJ 2AJ1A 1HJOA 3EE3A 2C2DA 1CJVB 4BGDA 2MUTB 4J2AA 2OP5A 4O3RA 2CJKA 1GX6A 2W54A 3FFIA 4MDBA 3TJ9A 5LM7E 2F9WA 1YJWN 2R7TA 4JI7F 1ZZNA 5E41A 3N4PA 5I3QA 1FA0A 3OL8A 5A6WA 2K3KA 1FKAF 4KLJA 3KZIU 4G1PA 2UP1A 1TUGB 5DQIA 4FK2A 1A9NB 5DB8A 3EZ5A 3D2NA 3LVVA 4EEYA 1YWXA 4IJNA 5M1FA 1KKHA 5KPTA 4E3SA 2G0IA 2J0SD 4LBHA 2E8OA 3EYZA 1HBNB 5BN9A 3NTUA 5B66U 2EDUA 3TW0A 2ZOMA 4CK1A 3K7RA 4IG0B 1UT8A 4OZJA 3H08A 3AVHA 1IBLF 4ILGB 1DTTB 2UXBK 3KLGA 2F9JA 2NYIA 1RTJA 2IA6A 1TL5A 4FZNA 1WUAA 2R4FA 3L4QA 3DMJA 1A6SA 1OH8A 4C4TA 2DIVA 2DXDA 2NSBA 4BXOA 2NV3A 3CJ4A 3UR3C 3M9NB 2VD3A 1YK9A 4TU9A 5CRXA 2ZOFA 5HBMA 4QNLA 2K3IA 2CA9A 5T7LA 8ICBA 1ZBSA 3BH7B 5IT9Y 2HHHJ 3DXMB 2MGZB 4QOTA 1ZOTA 1IIPA 3QJJA 2ZH3A 1S1XA 2HHSA 4B9QA 3BYRA 4HVJA 4WK3A 3ATUA 9ATCB 4FLWA 2AEJA 2DKOB 4Y2UA 2OMOA 2ABYA 4M63A 2V4RA 3PJ9A 1C0UB 3MCMA 4B3TJ 1YJ9N 3J7AN 2R7WA 5AE3A 5J2QA 4YOEA 4DR4K 3AXMA 2VC0A 1NU4A 1YHQS 3QRRA 3QQCD 3VAGA 3QU7A 1RT4A 1QVFR 3C6UA 2RB7A 4Y34A 3NVYA 3ITHA 2HFSA 3T79A 3CIPA 2DGVA 3ZX0A 5KG1A 4E7KA 2FVRA 3TADA 4A8QA 2O5DA 4DR1F 3QICA 3P38A 1HQUB 3DOMA 1RKJA 3DFEA 2L9WA 5JVHQ 2DR6A 1T0TV 1YVFA 4URSA 1QM9A 3KLHA 3THPA 4YMOA 3NS1A 4R63A 3LDPA 4PZVA 5T14A 2ASMA 4KTWA 3ILLA 3SDEA 4FJ7A 3KLFB 2M8HA 3NLCA 2KSOB 3LP1B 4OIXA 4CJRA 1JROA 1TL3A 3CJKA 3T19A 1T3OA 5EUHA 5J0QA 4DR7K 1PC4A 3F44A 4UUXA 8ICCA 2YXLA 4RW8B 1GFWB 4ZVOB 3O9SA 2JEIA 1VOMA 3LP3A 1BNOA 1UA0A 4ECTA 5SUHA 3U4LA 4H0PA 5J2DA 2EG1A 8ICHA 4ETZA 4IS7A 4I2DA 2EBEA 2ZIVB 4MFCA 4RW9B 2DNZA 1SZHA 5DRKA 5GTHU 2JR5A 3BJYA 3GDXA 1NGDA 3SJJA 2ZJQQ 2Z58B 4UB5A 1F44A 2BCUA 1KTVA 4DEZA 5F2RA 2KXHA 1PYSB 3QMLA 2P9IB 2QIFA 1Y88A 4P0QB 1U04A 8ICSA 3RB6A 2SXLA 4J2EA 1SC3B 3VQTA 2W9BB 4P4OA 2G0CA 2HF4A 3CVKA 3G96A 3TUIC 2JEJA 1SC1B 4CJ7A 4WE1B 3EGNA 3JSYA 1RABB 2QARB 3CB4A 9ICIA 3MEEA 3W61A 3HHKA 3WXKA 1NJZA 4CLPA 3SYZA 1CJTB 3O6WA 4ICLB 3EVOA 2DGSA 3GOIA 4GNIA 1FKPA 1YQHA 2KO1A 5GAGU 1OQ3A 2BRLA 3CCWA 3VQ8A 4IYQA 4DR1J 3F73A 3V9WA 2CPXA 4MKYA 4B1VA 3EPGA 4CZCA 3VPZA 4KGKA 3H8JA 5J1EB 3HLUA 4QS8A 4MF8A 4ZVFA 4I4BA 2GS8A 1VBXA 1K1SA 3FC4A 3Q8KA 2W7AA 4FJ8A 4DTJA 3MR3A 4DSFA 3Q2SC 1H1VA 3O3HA 3LP2A 4KLFA 3DDNA 2MJNA 2VC1A 4UOGA 3RF9A 1VQNS 1SKRA 4L3NA 4LF2A 3ULEB 3VAFA 2WF7A 5CYQA 1RJJA 3G6ES 3LPEA 4FPAA 2BJ3A 3AN1A 1S5LU 3TA1A 4RQNA 1HRHA 4K4UA 2ALZA 3MMBB 4URQU 1XSNA 3M6VA 1N0UA 3PVXA 4WIIA 1EQMA 1YJRA 4LIRA 3V72A 3GZFA 3TOQA 2ZDOA 4MIAA 4K4HA 4ZP6A 3H6EA 4XH1A 2FBYA 2HBQB 4JI8K 2QMXA 4PEOA 3UMBA 2VFUA 5DDOC 4RQ4A 3D1OA 3O1LA 1JL1A 1VS3A 1RDAA 2QSWA 2J4RA 4A46A 1X9WA 5AKHA 3I33A 3HFZB 4AXJA 2RVJA 1V6HA 2B4OA 1LWCB 2A1BA 2BW2A 3OUYB 4YB1P 3JXUA 3C2KA 4MLEA 4DUYF 4O8UA 4E8UA 1N62A 4F71A 2R7QA 2BGWA 3V6KA 4QZBA 1I5OB 3QESA 1JX4A 4EMDA 4U8VA 2MZQA 2FF6A 2ZM6K 4DU3A 3OVAA 3CJ9A 3TA0A 3M1VA 4N76A 3V4IA 3UPFA 2F9DA 3RW7A 4XPEA 4X64J 1U1QA 4JI5F 3ZTQA 4LR9A 2DGWA 3HM8A 2F4FA 4EIAA 2QL5B 5KFAA 1VQ9S 4JK8A 1UJ5A 1XQSC 1MN8A 2WBNA 4A8EA 3AVCA 5IINA 2O4GA 3ZETB 4DR3K 2GC8A 3RB3A 5IC4B 3HHLC 3JYTB 3QRPA 1S4EA 3I0RB 4FJHA 4K4YA 3J7AP 1OY9A 2X7IA 3CO0P 3BS7A 4USVA 3GWCA 2AYBA 3U9DA 3WKAA 1PBAA 1ZXOA 2P9LB 2LVWA 2YHXA 3HSTB 3I4HX 4LVOP 2M0GB 3OR1B 4AL7A 3PR4A 3HVTB 1RT2A 3QFHA 3SSRA 3PHTA 3P83D 1U6BA 3I76A 4BQLA 2GJFA 2KVIA 2BCQA 3UO0A 4OLPA 3VGMA 3RJFA 4KTZA 4R8UB 3KZXA 4DR6J 3NDKA 5J0YA 1JLEA 2KV2A 4X4SA 5J0OA 3KJNB 2X1BA 3N5FA 4I2FA 1RLCL 3DYAB 5IIIA 2LQ8A 4DX8H 3J81Y 2FBTA 2HHVA 1WHWA 5IQ6A 4BE0A 2XZWA 3CJAA 4CEFA 3CDUA 3EDRB 4USHA 4PHTX 1L8LA 2UUCJ 1RXVA 5AR0A 4IG3B 3D45A 3ZXWA 4C7YA 1S1VB 3BN7A 4X2BA 2CQGA 3C14B 4DB3A 2OMLA 2D69A 3BUZB 3DRPA 1XNQJ 2QA1A 1D9FA 4QJFB 2L08A 1O0PA 4DV2K 4DS5A 1QY7A 2FLOA 2GFFA 2HHUA 2AHOB 3UMCA 1QAYA 3MM9B 3KKAC 1VQ7S 1F3VA 2NUUG 5AKZA 1ZQPA 1C0GA 2MKJA 2WBRA 1FJEB 4LF4K 1SZPA 1O51A 4ID8A 2GEMA 4FYDA 8ICUA 3TR8A 1J5EJ 1PVRA 2YQ1A 3B8AX 1HWUA 4L6V3 4OZ3A 2HG4A 2YQ0A 2OA8A 1RADB 2HF3A 1QZ6A 3NG8A 3M5RA 1WSRA 1HUZA 2ASDA 2KB2A 4M47A 1EIYB 2UXCF 4YCXA 4XTTA 2B0GA 1C4CA 4FXWA 4KHWA 4I64A 1E6VA 2MZRA 2D9OA 1RT3B 3AA4A 3KZBA 3D7SB 5LJWA 3DOLB 5KFTA 1I39A 3QU2A 2KFYA 2Z1GA 2OEJA 1NJYA 3AAPA 3UI3A 5F8LA 2CAJA 2R42A 1HA1A 1P1LA 3O9TA 5BPCA 3VOVA 4Y2QA 1TV9A 1HNIA 4RUAA 4DFPA 1URNA 2GX9A 2QXFA 3MXJA 5CCLA 3J7YP 5KPRA 1YIJS 3UQ0A 3OFFA 3ZC4A 2BEFA 3S01A 3UMGA 3JAMO 5AQYA 4FVCA 1Z6RA 1Q8IA 1FW6A 3HP9A 4Z2XA 1OQ6A 5GMKa 2F76X 1WHYA 4EO6A 5AQGA 1O03A 2HWIA 4NO7A 4PHEA 3WEEB 2YNFA 2NRVA 1QE1A 3GJRB 5BR8K 4ECVA 1VJ5A 3W7BA 3LDSA 4OKEA 2UXBJ 3D4JA 1KVJA 3EEQA 4DV1K 3EGWB 1OVYA 3R6LB 5DZ6A 2I6WA 1A77A 3JTPA 9ICSA 3BQ1A 4WBFA 1JI7A 1QVFM 3D6MB 4OYOA 1P90A 2KT3A 4Q7AA 4NL9A 3BS5B 4YXMA 3VGUA 2ZM6F 4MT1A 4ID5B 4P4PA 2KQ2A 5L1MA 1HIYA 3Q24A 3DAWA 2A6AA 4CGFA 4DV6F 3MAHA 1K9MO 2K8BB 3W2WA 3V7JA 1RT7B 5KFXA 3BDEA 4USIA 3NGSA 1UWBB 4ZJQA 4X66K 3C14A 2QA4S 4M2YA 4WQ5A 3OGUA 1PGZA 1EETA 3L8BA 3R9LA 3R1XA 2MRLA 3V7LA 5DK5A 3LGHA 1YJTA 4YOYA 1T11A 3M30A 5J0XA 2KVQE 3J81O 4JHDB 5CR4A 3JSBA 2Y9HA 2B5JB 2ZFHA 1SQGA 2JLGA 3QIPB 3DU5A 2HRYA 4DL4A 4JRQA 3BGOP 1VQOS 2HFOA 3FSXA 2UYTA 4NY8A 1BUXA 3D28A 3QIOA 2HMIB 4GLXA 4P2SA 2G5HB 1WKLA 3THYB 5DDMA 1QQCA 4DV5J 4DTXA 1LW2B 4CLTA 4NA2A 1U45A 3OLBA 3MM6A 1BVSA 3AUOA 3O0FA 3T1YF 1KHVA 2A18A 1RZMA 3CEDA 2ZXIA 3IMXA 3PX6A 1Y11A 3F9MA 2GX8A 5D15A 3HSGA 4PYDA 4LF1A 5SWMA 1M1KT 4M3RA 3FJ2A 4KGVB 1ZBTA 5J2MB 4GKKK 3H7IA 1YTUA 2PXIA 3ISCA 3MX2A 4NLKA 3LH2S 4ZK7M 3QDKA 4RW6B 2CJBA 2IOHA 1RU1A 1G4CA 3R6MA 1IJJA 4QZIA 4F92B 2V6AA 1J9AA 1UP1A 4RBTA 2ATLA 1B0XA 3LM9A 4M95A 3SK3A 1XMQK 4OJ6A 2FDRA 3TEHB 3CCRS 3TTCA 1JMSA 4J9QA 4DV4F 5DDYA 1RTZA 5D0RA 3QWPA 3CMES 3C15A 3DOKB 5HSPA 3QEXA 1JJ4A 1DGJA 3P45B 3EDQB 5J2PB 2CJQA 2GMJA 3U8XA 2J6SA 1WG5A 1OIAA 2RS8A 1ZQKA 4CJ5A 1SI9A 2VG7A 1XMQJ 4RQ2A 3BYPA 2W11A 2ZD1B 4Y2IA 1CXQA 2GUIA 2AJ2A 1V3ZA 4NCGA 5AQTA 2GHVC 4DQQA 4FLZA 4CLSA 2IGIA 3QZ8A 2V9WA 4CF1A 2P66A 3K0JA 2FUG9 2RDDA 9RUBA 2O8FB 2J0QD 3THXA 2ROGA 1HNXJ 3VQPA 4IDHA 1KQGB 2I0XA 4JB3A 5AE1A 2W1BA 1NZBA 1RLDA 1ASVA 1M1GA 1CXUA 5KFSA 2CQBA 2O8EB 1F5AA 4Y0FA 2B9XA 3MMCB 2MKKA 1C7YA 2GH1A 2DYAA 1N5XA 4YB5A 4MMOA 2ZH6A 2QB1A 1XN9A 2E9ZA 3ZEUB 4BQZA 1T9YA 5HP1B 4DKWA 3CNHA 3CCLS 2OFHX 4HUFA 1XMQF 2DEIA 4DN0A 4MFBB 4B1XB 1Q46A 4F0KA 4YOUA 5ALFA 2QFIA 4C1NK 3VA0A 4IKFA 3NGTA 5D0HA 1IQTA 5AI5A 5F8NA 5AXLA 1KAZA 4FW1A 3N97B 4CJEA 2DR8A 1GXUA 2RHSB 4KH6A 1F6TA 1NDCA 3DN9A 4IO1A 3VEWA 5E7OB 2KMDA 4M9NA 4V19X 1IM4A 1NJXA 3IAYA 2A1JB 4U6PA 3BQ2A 3EMTA 1Q9YA 1LK7A 2ASLA 3SI6A 5KFZA 5F0UA 3H0RB 7ICHA 3FVYA 1HNZF 2PSZA 2KKZA 3RBEA 5AXNA 2XB2D 2Q66A 1E6YA 4C6AA 4IZ9A 4KITB 3PFEA 4LF5J 3VQ9A 4JKHA 1SUQA 4F72A 4DHYA 3IGVA 5AQPA 3JPTA 3L3UA 1WTBA 2B4JA 1I94J 1XS9D 1B70B 5J2MA 2KFNA 1BG3A 4JV5F 4ZPCA 2KZZA 4P71A 1F0XA 4P0PB 5KQDA 3GE1A 5KT6A 4M5KA 3G87A 2LXUA 2WTUA 4GKJF 3G10A 4XH5A 1O6XA 4CF8A 4FN5A 2D0BA 3CPWR 9ICQA 4KSEB 4TXSA 3O4WA 4CHZA 1I94K 4IDKA 3UVJB 2VKQA 1T7PA 3AJ2A 3A3OB 2Q2RA 4CK2A 3QU4A 1S6QB 2GAHC 2ZIXB 2MY7A 1UOCA 2Y0SC 4Z4IA 3JSMA 4RNOA 5CHCB 2DJWA 1YTAA 3Q2TC 3PCOB 2ASPA 4WFNQ 5J2EA 1EKSA 1D8YA 4EBDA 3I9ZA 2DEJA 1U02A 5ADXA 3TRGA 1Q95G 1HBOB 2DNQA 3WIVA 1KOOA 3UD3P 3I8DA 3BZCA 5GAEU 3R7BB 2G09A 2KK0A 3H3NO 4C8NA 2BUNA 3IP0A 2FLNA 4DPYA 3MCSA 5BXIA 2ZEJA 3NP5A 5AJ3J 2XI3A 4GVLA 1J5OA 2K1RB 2FC8A 2IDEA 3KHGA 4QR2A 1TL7A 3K89A 3PLAA 4WFXA 3ZX2A 4N47A 3RB0A 4MQ3A 2CXYA 4F2RA 4F7VA 2YH1A 3D3CJ 5JUMA 2HS0A 3K2PA 3I4PA 4U7CA 1OSCA 3QGIA 3CTRA 1GAOA 2GJIA 3OV7A 5ETLA 1A76A 2ZTCA 2LCWA 3AQPA 3A5MC 2HIQA 3F56A 3KYLA 4ZVHA 5K9FA 4H4OB 1VR6A 3OS1A 2W6LA 2JHDA 1NKCA 4HT5A 1FD8A 4DTPA 1PUZA 3IRUA 1LKYA 5JMNA 1MMDA 3SSSA 1BPEA 2O4IA 4OJRA 2W9AA 3PIPL 5FLXO 5H9FJ 2CG8A 3L3FX 2L9NA 2QFJA 3FYHA 8ICZA 1FT8A 4YG2A 3GFHA 3IBPA 4FF1A 2H3EB 4KREA 1IM6A 2KZ3A 4I28A 1FE0A 2Y9TA 1T3NA 5CXTA 2EAPA 1HWKA 2OI2A 3IR7B 1CJUB 4M3TA 3QO9A 1ZQBA 1NJIO 3D2EB 1KLMB 4LF7K 4LC9B 2VBWA 1ZM4A 5AT1B 4KTQA 4UOHA 2YKPA 5ALSA 4LBIA 1F9HA 3VA3A 2OTJN 3M8QA 4QCLA 4DG1B 4UW2A 3MXMA 1VBKA 8ICWA 4ERDA 1WCLA 2XMKA 3PFOA 2OUGA 3QT7A 1AT1B 2ZXHA 1RTIA 3HWTA 4BJQA 5CB1A 2XGPA 5ALJA 1HYSA 3IRXB 3T1HK 5AI6A 3OYMA 2LYVA 1S76D 2QARA 1T6DA 1RCHA 3N01A 5IV3A 2W4PA 2WVFA 5DM7Q 3EW9A 3ATVA 3PKMA 4CZGA 1CS4A 5U47A 3KKSA 2C2EA 4UY8T 3CC4S 1YGYA 2I7PA 2PMHA 9ICVA 4FPBA 2EFQA 4MK7A 1WELA 4X65K 4KAZA 1XMOJ 4QIWC 3NRBA 4FWOA 2V34A 3VEVA 1PC5A 4J9SA 1HW9A 3T6JA 4QW9A 2HZVA 4UAVA 4YHHK 4FOEA 2UXCK 2XM3A 4PKHA 1UW4A 5FJ4A 5AKGA 2BANB 3EGVA 4DV5F 4LF6J 7ICVA 2NR0A 4DL3A 2HQ3A 3LPTA 5E0OA 2NYHA 4M63C 1UCVA 2H3ZA 3IS9A 5C5JA 4KE5A 2NZTA 3ID6A 4N77A 3O8MA 2G8UA 1VQ7N 3OYHA 3R2CJ 5BREA 2K4PA 1MA7A 1REVB 1FD2A 5G0RB 4JS5A 3SCJE 4J03A 4FYYB 3ISDA 2YQEA 5L39A 2WW4A 3VERA 1FEEA 1V85A 4B3MF 2Q0RA 2ZG6A 2IVMA 3UE2A 4A8SA 1Q8LA 2HBJA 1VI7A 1N48A 4TQSA 2XIDA 3ZSYA 1FTRA 4IO9Q 4DR5F 3FEYB 4J2DA 4CF0A 4K59A 2HKEA 2R7YA 2HBZB 2ZHBA 4P7TA 5KFMA 4DL6A 2W8KA 5J2GA 4BCAA 2WSCC 1ZQMA 3QINA 5ALOA 1RA6A 5AQJA 1FVQA 5LMNF 5HR7A 4C4SA 2MLZA 2IOFK 5D46A 3CXCR 3CC2N 4LFCF 1QSLA 5M1NA 5AQQA 4LFAF 1WF1A 3OHBA 2V0NA 2ZH2A 4DR7J 4K0KF 3KG4A 5D0GA 4IFYB 4PPXA 4X84A 3MEDB 2ZH4A 1CC8A 5JRTA 3DLHA 4B3SJ 3KLFA 3A5LC 3D6TB 1JN3A 4NMXA 1HKCA 4C0ZA 4BRGA 3HJFA 4Y1DA 5H1SV 1FXXA 1PJ6A 1H73A 4DV7J 4CFBA 2LA6A 4L3QA 1EETB 2DIUA 1RBTA 1Q53A 3KLEA 2Q97A 3AARA 2A0FB 7ICNA 1RKIA 2QGFB 2BMBA 3UKUA 3HT0A 3AEVA 4DR1K 3NAHA 1LWCA 7ICRA 3OUYA 2GA7A 1NJWA 3AFGA 4DU8A 1G2EA 4OYPA 4F4XA 1M0SA 1ZQTA 4V1Ak 1FRMA 4JV2A 3H2VE 4YMNA 1NHVA 2GWJA 1QS4A 2Z2YB 2H3GX 3F53A 3T6BA 3ENBA 3KK1B 2GQCA 1S3XA 4LF8J 1JQGA 2H4YB 5EOYA 4LF7F 3OYAA 4M9JA 1NK5A 2QLJB 3HL8A 3K5OA 3NNHA 4WFBQ 1RTDA 1RDCA 1K8KB 3WXIA 4XDDA 2IVOA 3QYPA 5KGWA 1BO5O 4DR5J 4UB2A 2P9GA 2P6RA 5TKYA 2DHGA 4BR9A 3SUOA 1UZDA 3ZDBA 3QGPA 4P7VA 3DXMA 1BWVA 5C12A 3MTJA 1PSDA 3NWGA 2ZC4A 4WP9A 4CZIA 5DM6L 2OIHA 1RUSA 1O1WA 3IS9B 1WOPA 3MM7A 2QWLA 3QMQA 3H1QA 4F4KA 2FI1A 1ZQLA 2ZJPQ 3RYLA 5D77A 2WB1D 3Q7BA 3DU6A 5AQSA 3AQFA 4I2BA 4CBWA 5ADZA 3A0IX 3ORYA 5F9LA 4LSZB 1WDTA 5AKIA 5BYSA 4KO0A 3VQQA 1Q79A 2DNYA 4DX6A 2CPEA 2D3DA 1HNXK 2FBXA 4GO7X 2LBOA 3M6ZA 4US9A 2J5AA 3Q8PB 5GADI 2E5SA 2V7ZA 4QYZJ 2PDAA 3SMPA 1XNRK 5KG4A 1W9HA 3KWGA 4ZVSB 2CYYA 2PYJA 3ZDAA 1VGYA 5CY4A 3KK2A 5E3PA 1BA1A 2EXUA 5DS7A 1KQFB 4FF4A 4J5OA 1CJVA 2OSQA 3RSEB 3MFHA 2G1DA 3AGKA 2DNLA 2KJ9A 3LGNA 4R5PA 1CVJA 3CCLN 2RNEA 1N61A 4DI6A 2NNWA 3QLHB 4YB7A 4JK7A 1E3MA 3OYNA 4UB1A 2ZUCA 3R27A 2OYYA 3MD1A 3FSYA 4M5GA 5D78A 4RQ5A 3A5NC 4DPUA 2EFNA 3U1NA 4CI0B 1TYQA 3AVBA 4FL9A 3W0LA 1V9OA 3NBPB 1BA0A 2K06A 3ICXA 1WC6A 4MKVA 5KAKA 4DZDA 5DLFA 1URRA 4OJ5A 3THVA 3MR6A 2BRKA 1NNLA 2AYMA 2JWLA 4KLTA 4OKKA 4GFJA 3HBTA 2D3OR 1TU0B 3PYEA 2DGZA 3GJTB 2G13A 2EW9A 4RUHA 3NGZA 3UDCA 3PSTA 1JRPA 1UKUA 3WKEA 1UA1A 1E6YB 4F3TA 2ZGYA 3GYNA 2VYPA 4KLLA 4F4AA 4CO5A 1U0HB 5KFEA 4CQ1A 1S57A 2MY8A 3SAHA 2P9LA 1ZZFA 3CF5Q 1WEZA 8ICQA 1CPZA 4OX9K 9ICFA 1RT2B 4Z0UA 4JMUA 1NCLA 4DQ8A 3L95X 1ZQRA 1IBCB 1RHJB 4CHPA 2LMRA 5D4LA 4CF5A 3E8OA 2OCEA 1FF2A 2V50A 4W5NA 2AGPA 2V94A 2GVZA 2HQCA 3MAQA 1D4XA 4JI5K 3MD3A 4BHQA 3AO4A 2HVIA 6FDRA 3ZD8A 1DURA 1NO8A 1TK5A 2Z2ZA 4OHXA 4GO5X 2V63A 4ZP9A 2W55A 4FO6A 5LT5A 2CRLA 4OKJA 1MMLA 2KJWA 2OYQA 3DLBA 1HJRA 2QKBA 4DR4F 1IV0A 4QU7A 2VWBA 3K75D 1A5WA 2HHHF 3O5BA 1N4LA 4A62A 3FZBA 5KG7A 1BL3A 5HVGA 3MWBA 4NYNA 3VGKA 4FJ9A 5DKWA 3IM9A 4KGZB 4BVOA 1IQZA 2C2ZB 4Y2MA 2DBYA 2DHHA 1FRXA 1ZQIA 1GMWA 5A2QY 2D0AA 1SL0A 2KFZA 1KVKA 2K1RA 5M1KA 5A0LA 1Q5VA 4UASA 3SR6A 3DLEA 2D41A 2KVSA 2J9DA 5E3RA 2R2RA 3TQ1A 2AV5A 1JIHA 4FJKA 4OD0A 3SBGA 1SJFA 5J2AA 4FWSA 2XI9A 3KUHA 5KFLA 1I3AA 1WNEA 2D8CA 3W9JA 3HT3A 2E1AA 2PZSA 2WRMA 5HQ8A 4EP4A 4DJBA 3LTOA 5CYJA 1XK8A 3TYTA 3MX5A 1TK8A 3AHPA 3SQ2A 4FWRA 4TUQA 5BR8J 2CQ3A 4UB8U 5KFCA 3EWAA 4I67A 1EQ0A 1X9MA 1COOA 4ECSA 1P8GA 4B6JA 5KFFA 4UOCA 2OD4A 3MUVP 2YWHA 2Y1RI 4ZPAA 3W66A 4LMZA 2MHNA 2R8KA 1S72S 2HMIA 5KFIA 1DRGA 1RT5A 2YY3A 3QFWA 2ZIWB 1KN6A 4NLNA 3GCWP 1FCAA 4CJTA 2NO4A 2KRBA 3BR9A 1YIJN 2VCPA 5IS2A 2QLFB 1VRTA 2DGQA 2WF5A 1VSDA 3C21A 4CERA 4HAIA 3TTDA 4A57A 2MLXA 3KLGB 2F40A 2N3LA 4L76A 3CCUS 2RHQB 1D9DA 1ZETA 4CJ4A 2DFLA 2XMJA 5AM2A 4M45A 1HW8A 2W9BA 2CUYA 2XYHB 2M3DA 2CDRB 2ZWHA 5F3TA 2B9EA 3R3LA 4CJKA 1K5OA 4FE3A 2WHEA 3B6PA 5B0GA 3MM8A 2HCFA 2RQMA 4U96A 1XQIA 3H20A 1Y10A 3QGHA 4C11A 3R7SB 5AQNA 5KFUA 2JEFA 1RGVA 5KAFU 1RISA 1FXLA 5DBAA 1UPHA 1PVPA 1N33K 1ZH5A 1RHKB 4CLKA 4CZHA 1PCAA 2P9EA 2PFFB 5B8HA 5CYMB 1ZQ1C 3MAAA 2CQ0A 1HD0A 2JWNA 2GJ2A 3W5XA 3VQDA 4BVPA 5A8KB 1KXPA 2F1HA 2G8WA 3HKWA 5HLFB 2EZZA 1BISA 3DYAA 4R79A 2UUAJ 4O44A 1Y00A 1FRKA 2IPOB 2ZD1A 4LFCJ 5DG8A 3CI5A 3TAMB 3D0GE 5AFUH 3NNAA 2VFTA 5J1PA 2N82B 4DUZK 2GWSA 2FHOB 1RHRB 3FEXB 3DXBA 2YPYA 3FCVA 4DSJA 3EXCX 3SAGA 4OZ0A 2DISA 1VIXA 3MMAA 1FDBA 1SC4B 3NUQA 2B7CB 3H42A 1EXNA 2F7TA 2UZAA 1T05A 3VVTA 4UT4A 1N52B 1X4HA 2MQLA 1XI1A 3CF5L 4F4ZA 3GE9A 1M1KO 1SQEA 2F77X 4QR0A 5KT2A 3O4QA 2HLTA 1VYAA 4YDUA 3HHLD 2XCAA 2W9CA 5DB6A 3LP1A 1SJRA 3N7RC 1U1MA 3CJKB 5CD4H 1KAXA 4CEZA 1XIQA 1SV0A 3ISNC 4AE5A 1Q3VA 1SH2A 4RW8A 1VK0A 1Q18A 3EN9A 3DLKB 4QZDA 3JSRA 2WB1F 3D1QA 2HNZA 8ICPA 1KAYA 1UWAA 2C2NA 4NZ0A 3VAKA 2YY6A 2DITA 1L3VA 2KJ8A 4GKJJ 2P9UA 4B8AB 3VVUA 4ZVEA 2P8IA 1WACA 1VMBA 1XMOF 2UU9K 2VFSA 5TZVA 3L3VA 4DQRA 2WF9A 5EVZA 4AHVA 3AJ1A 1X5PA 1R8PA 2V67A 1TVAA 1ZS6A 3C94A 4XDCA 3HF5A 4PZOA 4RPXA 1RQ0A 2MGZA 3C2LA 1ILYA 4B1YB 1WHXA 1RB0A 5IT4A 2KHDA 4RZRA 3J80U 2KNJA 2JRZA 3HTVA 4TLQA 4TKTA 2A3ZA 1RDRA 5ALHA 1RAFB 1DLOB 3JQKA 2BDPA 4TU8A 3HVTA 1TL4A 3UN5A 4P0PA 2Y9UA 1DJ0A 1FJGF 4DSIA 2UVRA 5HRSA 4LUBA 4PABA 1WG8A 4GV6A 3VEYA 2QWPA 5IWAJ 1HR0K 3S3OA 5LL6Z 4B3TK 5LMNJ 4LF8K 4O5CA 3CCZA 3OTOF 1OUQA 5ELZA 1JXEA 3KJVB 4JN4A 3TP2A 2HQGA 3ZSVA 1QUVA 4A8MP 1GTEA 4ZPWR 3AO3A 3MAAB 4KLHA 3PJWA 2MQNA 1L8OA 2B43A 3AAWB 3CCSN 3OSNA 4CO0A 1YKWA 4NL5A 1IKWB 1A5XA 1KFSA 5FLXU 2WCXA 3TR5A 4H0YB 1X8DA 4FXDA 3WIUA 3QT5A 2RP5A 3V1OA 2CGJA 1RPLA 2VQFF 4HHTA 5CZXA 3ALRA 2MKCA 2RE2A 2AJ0A 9ICKA 1U6FA 1SB6A 3DV9A 3QO9B 1KRPA 4RPFA 4C9DA 3D2EA 5D3GB 3SEOA 4BR7A 4YDXA 1OH6A 3AVKA 4KYZA 4UOFA 1X0FA 2P9SA 3G6XA 3SCXA 4Y2KA 2D9PA 4LH4A 4C7ZA 2OWOA 4LSNB 3RMDA 4YP3A 1UVNA 3MM7B 1B92A 4NLXA 1RBUA 4M9LA 2WMMA 1RHMB 3KLVA 1N36F 1QQNA 2YKQA 2QZ8A 2J7KA 5KL1B 1YLXA 3THYA 4CLYA 4ISFA 3TZYA 1W26A 3VGLA 2CPIA 1KVCA 3KNAA 1D0EA 1RDWX 2B4VA 1ASUA 3DRXA 3PW4A 3C19A 3DRRB 3G8TA 4CD1A 4CLLA 4GMJB 1L6NA 3CIMA 1GLAG 2KZMA 4DPTA 2V2VA 3FBEA 1SUQB 4YS2A 3OXFA 2ZJ8A 3G4SS 4DCPB 4H5NA 5EX0A 5AJ3K 3ETLA 2GZOA 1TKDA 1SKWA 5F0WA 4NLZA 4LR7A 4PXEA 2QSFA 3PZPA 4HUEA 4FJMA 4CIOA 4RUCA 4YOXA 2GCFA 2W24A 2DNGA 3N28A 8ICMA 4H0VB 1SAZA 3NEKA 3LYSA 3P3DA 2YQ3A 5D4OA 1O13A 2G08A 2MA1A 1M5VC 2MZTA 1Z05A 4DPWA 2D3ZA 2QA2A 2Q1NA 1VQ5S 1X9XA 3G6YA 4EP5A 3DLLL 3PSIA 2F96A 3H8SA 1EKRA 4GIBA 2CNKB 3CJ7A 2X1GA 2Z1IA 3C0BA 2HBMA 1QVGM 5BOMA 4CFCA 4FKXA 3ULDA 5LMUF 1VSHA 3FRZA 3HKZF 1C1BB 2RHKA 1K8AT 2A1SA 4BR2A 2P9PA 4DTUA 1GH8A 3A0HU 1ELOA 3MPVA 4CCHA 1F9FA 4I68A 5AQXA 5AE2A 5KL8B 2Q0ZX 1V3SA 2ZC3A 3I87A 4RPYA 4UAWA 1KQQA 1BPDA 3L7PA 4C97A 1FIQA 3PW7A 3D68A 4HT7A 5TISU 2H9ZA 2GIFA 3DGVA 1SJ1A 1X4FA 3CJSA 4M3WA 5L1JA 1GT8A 1B43A 4KLGA 1SGGA 2J0WA 4H03B 4CGHA 3BBCA 1RM6C 3TVYA 2BANA 4QWEA 2LU1A 4OX7A 4USKA 2XY5A 4J90A 1S6PA 3J8AA 4Y2YA 5HP1A 2G8VA 4ISGA 3Q83A 1ZPWX 2WHOA 4H4KC 2WVBA 5G0RA 2IOCA 3C6HA 4N5SA 1WN7A 4O0JA 3M6WA 5L9NA 3V4IB 2HOQA 4DX7A 2W2OP 1YRXA 1WSJA 8ICOA 1OJ4A 1VQ9N 5KT4A 5HMZA 2QXLA 2BE9B 1H72C 2Y0SD 4OPKA 1N8RO 4FLVA 4OI4A 2ZZNA 2OPPB 1NK8A 2RPIA 2IY5B 4OGEA 2ZKTA 2D6FC 4FWLA 3TSPA 1YI2N 1U8WA 5HMLA 3KIOA 4A2BA 4QZ9A 2DBBA 3LANA 1N63A 2ISPA 1BMQB 2V68A 1IBLK 5C25A 1DRZA 4YMEA 3CCMS 1FRLA 4X64F 3T41A 4NXMK 3UNGC 2VF3A 4Z4CA 1N32K 3RH4A 3OPXA 3LDOA 2KH9A 5AI0A 3A8IA 4JI7K 2QK9A 3H40A 1WSVA 2E8AA 1M90O 2QWNA 2YX6A 3MEDA 4MEYA 2ILZA 7ICGA 4UTGA 4NASA 5D8HB 3U1MA 1ED1A 1U2FA 1XEZA 4H5VA 1S9EA 3M2VA 4V19J 4B9VA 2YKMA 5FROA 4K4XA 3M1FA 2YNGA 4WF9L 5AQOA 3CCEN 4LF5F 2BJ9A 1KQKA 1PJ7A 3C15B 3JS9A 3AQOA 1RBAA 1DT9A 1SC6A 1DHMA 8ICJA 4PRFA 4IWVA 4ED7A 5DQHA 1RTHA 2KEYA 3NVKA 5G4DA 2FQQB 2JH1A 4NPOA 4ZJLA 3RBXA 2EK1A 2LXIA 2B6AB 3TO8A 3WC2A 4JI2K 1S1UA 1EX8A 1WSHA 5AXMA 2DR5A 1DFDA 4KIAA 4IFVA 5GAEI 3N6NA 2B7BB 3D3BJ 2KHCA 3AVIA 1GMWD 4FWMA 1WAJA 3HSCA 2CNLB 3SBTA 1C1BA 2KHVA 5ALWA 3IDHA 2EQYA 2F4VK 4P73A 1JLCB 5HQMA 1C0MA 1T4GA 1RBVA 4CW7B 4DMZA 4GV3A 2CQ1A 1RWPB 1X5TA 5A0YB 2FLLA 2DR9A 3DI6A 3T5LA 1IXKA 1U8SA 1M5PC 3CIZA 2FJVA 4BWMA 2F3JA 3H4DA 3MCOA 1QQMA 2V8HA 5AK6A 4M3UA 5KNIA 1KL9A 1MDUB 1F1BB 3WX4A 4FK0A 5FPNA 4MDAA 3ADAC 3R5JB 4JI0K 4LF9J 2J76E 1WWHA 1YITS 1OY6A 2HHXA 5CD4A 2I7NA 5AQVA 3UXNA 3QLHA 3HHNB 2DNRA 3B6BA 3LDLA 4FWKA 4PXDA 3DLGB 1ZD3A 5G5GA 5EDWA 4DX5A 4DS4A 1AQ6A 1NPRA 3DNCA 2LFVA 3RJHA 3DDHA 4FO0A 1XHZA 2HQDA 3M6XA 2M8DB 1VDHA 4S0MA 2ZJPL 4OVLA 3CJBA 1R89A 1SIWB 4HHJA 2PFNA 4LFAK 1S9FA 1FWPA 3OT9A 2A1JA 3TAQA 4CESA 1OKJA 2C3UA 2EKYA 1IKXB 2IJFA 2QYGA 2MZJA 5DDRC 4R66A 3V1RA 2GELA 2NYVA 3KMQA 1Q82O 3ASMA 3Q86A 4HUGA 2XQCA 2HI0A 5DDPC 4K2XA 4E19A 3H90A 2BHNA 3UM9A 1WLJA 2E20A 2IHMA 1H38A 4HHHA 4RR5A 5LSLA 3MMAB 1U26A 1XR6A 4LIWA 3J80Y 1RT6A 3Q8UA 3MOZA 1ZOLA 3OFHA 3OHAA 4CEDA 3NH2A 1T05B 4JKGB 1ZBUA 3AM9A 1QE1B 2H4WB 1U0SA 2BPCA 4R25A 3VENA 3RRHA 3BKUA 3CCRN 1TP7A 3LO3A 3BQ0A 5A6PA 3DDKA 2W7OA 1MQ3A 2FPHX 3J7ZO 2G5IB 1NK0A 4PL7A 4BR0A 3FBBA 1HUXA 3NCPA 3BZQA 1ATNA 3BO2A 4DSKA 3NFAA 2NUBA 2A1RA 5HQLA 3WQUA 3VGVA 1HUOA 2DKZA 2W2PP 4GKKF 4CJPA 2QB0A 4EELA 1G1XA 1KVIA 4ZKAA 4BRNA 2WVCA 4LT6A 2EH9A 5GADU 1ZQXA 2HNDA 2R2UA 4CZKA 2CVEA 4MLHA 2CGKA 2Y8YA 3IR6B 2IA0A 2MTLA 2FGCA 3F2KA 3EZOA 1VSIA 1ZQCA 4NXZA 3PG9A 4B3TF 2BJ7A 1MLAA 3KNGA 4NM1A 4DDFA 1N88A 1VLBA 3C6AA 2E5IA 4OX9F 2NPFA 1BI4B 1JUDA 4P6QA 3NF9A 1JNRB 1WI6A 3MCPA 1F2HA 4B3RF 2CH5A 2GV9A 3L2VA 2XULA 4F36A 3CUNA 2V2QA 2VB6A 3V9SA 2GBZA 4DOBA 4DV6J 1D8BA 3AT1B 3CWJA 2GHPA 1IJFB 4WP3A 2ZJRL 3R5AA 3N0VA 3EM1A 1VSMA 4H5TA 5AI4A 4DUZJ 1QCKA 2AEFA 3GSIA 3HOSA 5HATA 1N34J 4R65A 3C66A 4B1ZA 1RZTA 3OYBA 3H5YA 2DPIA 3JQJA 4ZTJA 2LU2A 4BGAA 5HHHA 2KT5A 5RUBA 2D3O1 3QATA 5JS2A 3OYCA 3QFUA 3C2MA 1N33F 1NK7A 4KHPK 4RT3A 3SPYA 4ZLJA 4OYZA 2VPXB 1OSDA 4OJOA 2A6MA 2J0XA 2PY5A 1PK1B 4GVBB 1S9GB 3RAMA 5F8IA 2HAIA 4ZCLA 1UEKA 1F5SA 1B64A 5BRDA 4H8KA 4OHYA 3HSJA 4MEXA 1BNPA 2Q1LA 4B1WB 1N5YA 5E5NA 4LRDA 5K20B 1U2RA 1E4GT 3CJCA 3WKBA 1Y5IB 1HI0P 4FLTA 2DK2A 2RMLA 2RQ4A 5DGAA 1QTMA 4HYKA 2XMAA 3Q8LA 3T3FA 1YRUA 1AUDA 5EU7A 4U67L 3BGRB 1NWKA 3H8YA 3G6EN 2PI5A 3PX4A 2MU2A 3MMJA 5JJBA 2WVEA 2KT2A 4BY9C 2H5IB 4WKRA 3PIPQ 3SCLE 3T1HF 4FWPA 3C65A 2YMPA 4FOIA 1HYZA 3HSDA 1IWAA 4Y2XA 5K14B 1Q16B 3TX0A 4DL2A 2I1QA 1HBUB 3QU9A 1S10A 3L6QA 2FYXA 4WU3A 1YI2S 3AJDA 2IC3A 5IC6B 2PI4A 2IAJB 4NYZA 3KK1A 4F3QA 4N8OA 2CNNB 1S48A 1UCNA 4K5SA 1VBZA 4JD2B 4PWDB 2KKVA 3PMLA 4HDGA 5HMMA 4JV0A 2V8DA 4KHPF 2EFGA 2FY8A 2P5VA 3EWGA 4DU7A 3EX7B 2EAOA 2B8QA 4Y1CA 1LAVA 3CQYA 3MCNA 1J5OB 2GVZB 2HRUA 4J9VA 5E3QA 4ELTA 5FDLA 3FCWA 2ZBIA 1YTYA 3PYGA 2M9NA 3I8BA 4DLEA 4M5NA 5AZJA 3I82A 4FJIA 4BC9A 4KKOB 2NXNA 4LQ3A 5ALDA 3CPWM 3MPWA 1CBKA 1NU0A 1JXLA 5IILA 3JQMA 2AXTU 4GVMA 3SCKE 3HJVA 5GINA 4ZCIA 4HKQA 5AKEA 2GQQA 1QQOA 3NVZA 2CJAA 2BDUA 2HVEA 3Q22A 1C0TA 1FK9A 3PIOQ 2NXEA 2OGUA 3E2EA 2B4UA 3O80A 4UW9A 5AKLA 4ED4A 3AA5X 3G0ZA 2V4QA 3IM1A 3CE8A 2K60A 1TFWA 1PO6A 3R5CA 2HNZB 4CNZA 4AFFA 5FPDA 5CH7B 3MMVA 2W6KA 3TX8A 2XICA 2FXUA 3M8YA 3AXKA 1N5WA 4USWA 2LKYA 4HVZA 4KHSA 3B4MA 4LF7J 1FEZA 3KOOA 4DTNA 3DGPB 3OL7A 2R7OA 3MABA 4Y00A 3M8WA 3AA3A 4CFAA 5F41A 1KLMA 3CFPA 2RSQA 2ZNZA 3R9KA 3CC7N 4NLRA 4P2HA 1EP4A 1HNVB 4HCCA 1BWFO 2QLBB 1MROB 1MA9B 4IOAQ 1IG8A 2QM1A 4EYHB 4FVUA 1L7MA 1OYEA 1WEXA 1VQ4N 5GAHU 1Z2ZA 4BWJA 4QZCA 4ZH4A 4NE9C 1AZSA 4F3OA 3ENOA 4DV4K 2YV0X 2VJ4A 1RWNB 3S6JA 5AQRA 4FNIA 2XS5A 4OJHA 1COKA 1ITPA 2C3MA 1TKZB 2UUAK 5HVFA 1R0AA 1YBTA 4RQ1A 4Q8FA 4C8ZA 3UW1A 3HXMA 5LY3A 3E01A 2RF2A 4JI7J 4ZA1A 4JKDA 4DV5K 4FYVB 2V9KA 1Q81T 1N34F 2H65B 2JMGA 1A0PA 2WC9A 5EE3A 3SEIA 1UPPA 2E5HA 3W2WB 2N4CA 4KY3A 3I96A 3JAMY 2IVNA 3TARA 3RJIA 1XC9A 2RAQA 1RWWB 3MGIA 3UE5A 3LQVA 4C0HA 2QE5A 5B0CA 1KC8O 3CCJS 3HPOA 1WC3A 3VCDA 4A8FA 1ZPVA 4A47A 3NL0A 3DRSB 3NMRA 3HP6A 5M1QA 1FDDA 4B3RJ 5AQKA 3PACA 2XNQA 5H9EK 3JYTA 1RWXB 1RHUB 3ISBA 5FLXY 2XLKA 4WCEL 1URJA 2HFNA 4A8KA 3ZCMA 4FZLA 4UQTA 2NREA 4HH1A 1HEKA 3H59A 4NOHA 1LV5A 5L8RC 4CYUA 3CJ8A 3WQTA 2KTQA 1FJGJ 2R7VA 2HB5A 2CQIA 4FS1A 4BRFA 3GMGA 4YHHF 2WONB 4X4NA 1LB2B 5ALTA 4K42A 2I6XA 2AZ1A 3VF2A 3HPGA 2OZSA 2UXDF 2YB4A 3VEXA 4DV0K 2JL9A 2HSTA 4ZJOA 1RE1B 5ALXA 2J7UA 4JI0J 2RRBA 4IEIA 5DJBA 1KFTA 4ISEA 1Q0NA 2E4LA 2E6LA 4B3SK 3R5GA 2E6MA 3OFEA 3GIIA 2JC0A 3IWLA 2I9GA 3UN2A 4W90B 4YB6A 2V5HG 2WF6A 1VQMN 5IXUA 2GGPB 4HTLA 1X40A 5F3XB 3KMSA 3N79A 4NLUA 2OXOA 5J8YA 1ZM3A 2CH6A 4ZVGA 2NXJA 2FSKA 3G6VA 2MYFA 2B4PA 2BACA 3AO1A 4MO4A 4O5FA 5HR6A 4R0JA 2IM1A 4P72A 3KLEB 2W03A 5J2BA 2XMTA 4KC5A 2HVDA 2P6SA 3L4BC 2QI2A 3QJPA 4MYTA 3PSFA 2K4HA 1IKYB 1VIOA 4Z7CA 4RX6A 2R8HA 3KWMA 1UHUA 5L1LA 2Q0UA 3OYEA 5AFUA 1GLJO 2HFUA 2E1FA 3C7NB 4YR0A 4J9LA 2IMOA 3BGLA 5A2QO 4IQXA 4J8FA 2JVRA 5LXRA 1EXQA 2DO0A 5IIJA 4Y28C 6FD1A 3K5MA 2W3RA 4P52A 1R6YA 3BZKA 3CCVN 4I2AA 2G2OA 1DQAA 3BN4A 4DV0F 1RAJA 1C4AA 4FW2A 2YTUA 3CPEA 5DB7A 5CQGA 1X3MA 1SV5B 1X60A 3P96A 2I8EA 3P49B 1YJ7A 4PWUA 1PVQA 1VRUA 1W2BM 3GLJA 4IOBA 1Z26A 4J91A 3E3XA 5CAAA 1O08A 4JWMA 4XAKA 9ICOA 4ZDNA 1FHTA 2OTLS 1F2GA 3CETA 4F3MA 4RKUC 5D49A 2MSNA 3HMJG 1X4EA 3OHRA 1R0CB 1RHQB 1BGXT 2LSNA 1NRKA 2VDHA 3G82A 4WK1A 2J6UA 2R3VA 1FRJA 2IIHA 5F3ZA 2VGNA 1S1WA 1V38A 1NGBA 2HGMA 3U3GA 5I3UB 5CABA 2Y3YA 4NI2B 4US8A 4KR0B 2FMPA 1FRIA 4XA5A 4ALZA 1NEEA 2QN6B 2XVTA 2UVWA 1YX2A 3M8PA 1U47A 2AU0A 3THWA 3MOJB 4NLOA 3WNGA 5H2FU 1HWIA 2V52B 2XHCA 4KN7A 4NM2A 2HQIA 3HRGA 2K4IA 2HAFA 1RCOB 3GR0A 3J7A1 4K4GA 2ADBA 4PG6A 3GFYA 4ELUA 7ICOA 3ZSQA 3AGRA 8ICGA 1GLFO 2XEXA 1RDFA 1H2UX 3CMAN 4J9UE 4M6WA 1OS5A 5CHIA 2Z4PA 1Q1KA 9ICMA 2VONA 4ID5A 2DY1A 4DR2J 3MTKA 3OYFA 3J7YI 2Y1IA 2IYIA 2XG8A 2NRXA 1KBRA 4GY2B 1J97A 1C1CB 3LDQA 4MFFA 5J2KA 3DM2A 4BREA 2MZSA 1NPKA 3CD6N 3SDEB 2ZH1A 4B9LA 1H2TZ 1IVZA 3OJSA 3HX9A 5LJVA 3ZI4A 4CJVA 3UN3A 5CCMA 2FD2A 1RBRA 2ZIXA 3FFIB 1FRHA 3LWMA 1YJUA 3D6FB 3JSMB 4OHWA 4RO0A 5KFVA 4YR2A 2CQ4A 3VMFB 4YOVA 4FBTA 2POKA 8RUCA 2ZBPA 5DB9A 1W2BR 2Y8WA 4H5RA 3AOAA 4KHPJ 2OPSA 1VHFA 1U2VB 2HHQA 2VPYB 4FVMA 5A8RB 3NF8A 1GLEG 1NM1A 2DNMA 2OPPA 4NMLA 1NNEA 3WNEA 3V81B 5F0XA 4QS9A 2ODGA 4K8XA 2LDIA 2LYBA 4M5DB 4DR6K 4KMOB 4MF2A 2O8CB 4OPJA 3C23A 2A3VA 2IFXA 3PEJA 5LSOA 3SUNA 2HK3A 4RBVA 1J2NA 2XZTB 4DV1F 1R43A 2OAUA 1VQ6S 2ISOA 4QYZK 1BUPA 1J53A 2JXJA 1VQ8S 5IV4A 4Z6EA 3L2RA 2DNPA 9ICAA 1N5YB 1VQNN 3AODA 4CJSA 1ZJMA 4NWBA 2K8GA 3FMWA 4HHUA 4C0BA 4NB4A 2MKSA 2RDIA 1X9JA 4F2SA 5L9XA 4YMMA 2IM3A 1L7OA 3NGUA 1XNQK 1RNHA 3DEEA 2OPQB 1T9WA 3O1WA 1F5CA 1N5TA 2E5LJ 1U1RA 5LL6d 1JLFB 4I2IA 5ETNA 1FKPB 4DZ6A 3GIJA 2KM8C 2X3DA 3HHDA 1NK9A 2CKWA 2EFVA 3VTIA 1HBMB 4Q43A 2YBVA 4EZ9A 1EHWA 5BRHA 2HS3A 4H54A 4IOCL 4CZMA 1SJQA 4FPRA 4QYRA 3TABA 1S1TB 5J0PA 1ZM2A 3H25A 3CC7S 4PZNA 2VG7B 1IKWA 3J81U 3I56S 3K9JA 2DB1A 3GJQB 3C6UB 2JZBA 4OYAA 1T94A 2DGUA 5CYQB 3R97A 1EWRA 3OVBA 1SVDA 2O66A 1IR1A 3AVJA 4E1NA 1N2XA 3DLEB 2FJBB 1T44A 2V4JB 4Z94A 2E9RX 2G8HA 4W98A 4WYLA 2AX0A 3S1TA 2VQEJ 2RJZA 1FNOA 4NXNF 4JI4F 4EWTA 4U8YA 1UL3A 4OX9J 4KH0B 1ZRMA 3OBWA 4OZLA 2J8AA 4RW7A 4PGXA 1N32J 1YAGA 3ZEUA 4CBXA 1HLUA 4FM2A 2MKYA 3PJXA 2R8GA 3JTNA 2VDIA 3UWTA 1SPBP 2XS7A 4ANDA 3R1LA 3U02A 4F0MA 3CJQA 2L41A 1MNEA 4ECZA 4IH6A 1XR5A 4IRCA 1IJEB 3K8WA 3M32A 1H74A 5ALMA 4RNMA 1KWMA 3OY9A 2CWKA 5LJ3Y 5AK3A 2HMPA 1NLKL 4X4OA 3LZJA 2AP1A 2RU3A 1RI7A 5FPMA 4OPAA 4F02A 4FBUA 3W2VB 1XUPO 2OO4A 4YXJA 4IQVA 1KC8T 3GQCA 1WUDA 4YUDA 1TUWA 1EP4B 4C4WA 2NPIA 4M1KA 4ANCA 4WTYA 1W7WA 2DCLA 4MH8A 3R7NB 3BSOA 3M8ZA 2DFHA 3OBYA 4NLCA 1SXDA 2VUGA 4Q8EA 4DR2F 4X66J 3ZT0A 4BUGA 3KHRA 4C2MA 2ZTDA 4ZVRB 3X1LB 4I6AA 3ZZPA 4NXMF 4IH5A 1Q86O 2GW8A 3OVNA 4QZAA 4LVSA 1CJTA 2VOOA 3PHEA 3VF4A 4PUOB 4FCYA 1Z1VA 2KM8B 4UF4A 3UQ2A 1N5SA 1RTJB 4MJKA 3KHYA 1HKAA 3ZNJ1 4CJWA 1S6OA 4ED2A 1J6ZA 5B7WA 2JDJA 4RW4B 2CPHA 1NK6A 4UAUA 2VICA 3EZWA 2JHEA 2KIVA 2Q6CA 2AX1A 3THTA 2QLWA 1RILA 2NUHA 2YN4A 4I6MA 4JI1J 1QLNA 5IWAF 4AYBD 4FF2A 1D9AA 2GVDB 5JVGL 3ENAA 4ACOA 4BDZA 2E44A 4F26A 5B0BA 3RFAA 2YWWA 1V9PA 1NSAA 2XNRA 4DOAA 1CQNA 5EE9A 1FTCA 4Z6DA 1WG4A 2FPKA 4IQMA 1VJQA 1KEKA 5C24B 3AV9A 2E29A 4WKYA 1RBSA 2ZIUB 5CEHA 4C3LA 3HKZC 4DFKA 3QEIA 2FHMA 2B21A 1N5VA 4JYAJ 4ER8A 3VEOA 3OL9A 4DV0J 5JU5A 4WIQA 2EC2A 4FZVA 2C22A 4DTSA 3EKUA 4CIFA 1TZ0A 1QAXA 4H4KA 3V9ZA 3DXKA 4J9RA 2AQ4A 3DLKA 3BSNA 3T69A 4GKJK 1HJPA 3WK8A 5B0FA 2G8KA 5AM1A 1BIZA 2VPWB 1YJVA 1WB9A 2FF3B 3RBZA 1NBEB 1NBWA 4K0KK 2ZQBA 1YXQA 2KP7A 4EO8A 1ZM9A 2OELA 5ETVA 1TTHB 4QBUA 3RJGA 3E51A 5MLCV 2RKIA 3OPKA 3W5YA 2DNNA 1KKXA 2FPMA 1LWXA 3RJKA 1LNQA 3D9BA 4YD1A 1BLUA 4KHUA 2HVZA 2IOFA 1XO0A 1S72N 4DCOB 2A19A 3ILOA 3QFPA 1LK5A 1YZ7A 1S7HA 4AHUA 1ATRA 2BV3A 4Q5VA 2P9NA 3P4UB 3L4PA 3B82A 1S8OA 4YY3K 1GLCG 4H0XB 3RVCA 3M8RA 3ET6B 5KFOA 4RW9A 4HEA9 3NCRA 5DG9A 1MWMA 3UB5A 2ACYA 1UEUA 3GL1A 1P1TA 1DZ5A 1C0TB 3BREA 2KYZA 7ICKA 3TFRA 2X74A 2FJWA 1KP6A 4DCHA 1JLCA 3KK2B 2DGXA 9ICBA 1YRTA 1IBMK 4YHHJ 1CS4B 4WWSA 4GXKA 3SNNA 2XRIA 2W7PA 4HI2A 4M7XA 2H3QA 1JLGA 1YJNS 3QNOA 1FFUA 3OSPA 5M1OA 1RYRA 9ICUA 1S22A 2FDNA 3D7EO 4A8YA 2KKHA 4NLBA 2QA4G 2QEXS 1SCJB 2NSCA 3LDAA 2CPRA 1UVJA 3PUFA 3IR5B 3G8QA 1DOQA 5FDLB 4QIGA 2WZ1A 4H4MA 3GB0A 4NYFA 3PTWA 4X4VA 5CJ7A 2F8KA 1XBWA 1TYQB 4OYMA 1ECWA 3QUBA 2DUYA 2HRTA 2V69A 4CZJA 4B9TA 1LAWA 2CPYA 3TWHA 3MN7A 5CE3A 4RUBA 3OR2A 2VKRA 1KS2A 4AHSA 1RDBA 2ZE2B 1TAQA 3RZAA 3RMBA 4CGGA 1Q3UA 3A2FA 3NVWA 2OZMA 1VK8A 5HP4A 3CJ1A 3O5TB 1PK1A 3C46A 3ICLA 4LJMA 3SBMA 3QAEA 4XIUA 1T03A 3U3YA 3LZIA 2AJQA 1ZTTA 1FE4A 4EZ6A 4DTMA 5SZTA 2E2PA 3KJFB 2J6TA 4WJ3B 2RQ5A 4BDYA 4IXCA 9ICNA 1SBRA 1N36K 1P8ZA 3BO3A 4IC9A 1DGSA 5E84A 3GIKA 2HBRB 2VBYA 5BR8F 1PBUA 4Z4FA 4JKGA 2ZH8A 4DV7K 2OHDA 3ZETA 3E0FA 1W7AA 2RH3A 2C1EB 1NZAA 1UTAA 3Q8VA 1NDKA 2X78A 4QZEA 2W25A 4KFBA 4Z6CA 4OZ1A 1W0HA 1VAZA 4OI2A 3OTCA 4BRCA 8ICXA 4FWQA 1ZRNA 4KX3A 3DLJA 3ZFVA 3W62A 1YJ9S 2PAVA 3UKRA 7FDRA 2ZDPA 1KDHA 2XYGB 4Y2TA 4CLZA 5BRFA 1UT5A 3PR5B 4PQUB 2F8HA 2AYEA 4HCBA 1HNZJ 1X4CA 3N4QA 3AU2A 3TWZA 1B9DA 3ZZUA 5IT0A 3EL2A 3X3UA 4NLWA 4NX9A 1U49A 3IV6A 4R8UA 2BPFA 3HVAA 2VJUA 4FPIA 5HROB 2WOMA 4B3MK 3MN5A 4F91B 4ECUA 1P7DA 1Y9OA 1VQON 5D3GA 4DSLA 1Z1ZA 2LDYA 5KFBA 3AA2A 4LSNA 1U9LA 7ICEA 1L7PA 1MN7A 3QE9Y 1UMJA 3CCUN 1ZQWA 2EAMA 3VAJA 1VISA 1C2PA 1B99A 4JBCA 2FZCB 2DRBA 1X5SA 2YNIA 2P2CB 2X1AA 2YMMA 3CJ2A 4JI0F 1FWKA 2VV5A 3CQXA 2ZZTA 4DL0C 1Q5YA 1DAXA 1TL1B 4BGBA 3FE1A 3SFUA 4RNHA 2Z2LA 1TL3B 3JPRA 2Y1JA 3EJMA 1F9EB 3GFXA 5GAEP 3RJJA 4HL9A 2ZOGA 1DK2A 1JMTA 4OJ1A 2PA8D 4J9PA 2QTWA 5ALQA 4YDUC 3KK3A 1OXJA 3UDLA 1SXLA 1IH7A 4NLQA 4P2XA 1BDGA 3OR2B 4KMUA 3ONQA 5AXKA 4EBEA 2HHWA 2Q6BA 4JK1A 1KD1T 4KLSA 3Q8SB 2DHSA 4WZQA 3FZKA 4Q44A 3JS6A 4B9MA 2D1KA 5C25B 3LOUA 3PW5A 3T9NA 3VQ4A 1S1VA 2EX3A 4C8YA 4EHTA 4JYAF 1S9GA 2AJFE 3W1YC 2YCHA 3F2CA 2CWXA 3AO2A 2YX4A 1WKKA 3SCIE 2P9IA 4DBQA 3TAPA 4X65J 1N6QA 3LVWA 2Z0GA 4CJLA 2E9TA 2K7JA 2VOPA 4PY5A 3ZD9A 3HSZA 3EGZA 2VJVA 3ONNA 3K8VA