2XY5A

Crystal structure of an artificial salen-copper basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
581
structure length
581
Chain Sequence
AAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 211
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy5A01
3M8PA 4YNQA 4FK0A 4B9NA 1XO1A 4ELUA 4QZAA 3Q8MA 5CA7A 3NF6A 1S97A 1G15A 5T7BA 4FK4A 4QW9A 2YKMA 4Q0BA 4CF2A 2WTFA 3B6PA 5TZVA 3K75D 3AV9A 2C28A 4CE9A 8ICRA 4YR2A 1UA1A 1ZQOA 1RBVA 3E2EA 4UAWA 3WNEA 1A5VA 2W8KA 8ICKA 5DG7A 4O5CA 5J1EA 1ZQRA 2KTQA 2IC3A 7ICLA 2VG5A 3U6FA 2DY4A 4CJFA 3V9SA 3SZ2A 3EW9A 1CEZA 4AHUA 2IBKA 4CHNA 5KFSA 1MC8A 1N48A 4N41A 4NCAA 4O5BA 4E3SA 3MFIA 4DTJA 1ZQXA 3T1AA 1KRPA 3AVKA 2PFNA 2F1JA 5D4BA 4FZXC 4DMNA 4CJTA 3QE9Y 4QAGA 4FBTA 1S1XA 3HYFA 4YN4A 3UQ2A 3OJSA 1YTAA 1LW2A 3D0PA 2FPMA 3RBDA 1D8YA 1SL0A 3V6JA 4OPKA 3LDSA 4DL5A 5EWFA 2X78A 5KFMA 3RJEA 4GMJB 3JPPA 4M3TA 3KLFA 5KG7A 3JYTA 3ZT0A 1RDAA 1ZBFA 4KLEA 3ZT1A 2G8HA 1O1WA 1KVBA 1ZQAA 4JLHA 3HPOA 5CZ2A 1J5OA 3RJKA 1JLGA 4CJWA 2HW3A 4EEYA 4FW2A 3ZSQA 1RYRA 2GWSA 1JLCA 5J2JA 3K2PA 4J2AA 3LZJA 1J54A 1DTQA 1D8LA 1Z00A 2VANA 3KKRA 1K1SA 5KFGA 3M8SA 1C0UA 4MEXA 7ICFA 2KFNA 4YFKA 3HJFA 1TL3A 5CP2A 1UWBA 3LZIA 4OGEA 1TL1A 4H4OA 1WSIA 4FS2A 1HUZA 1RT4A 3SPYA 2ISOA 2E6LA 1VSFA 5KT2A 5J0WA 4XRHA 4O0JA 8ICEA 4KN7A 4E7IA 3V6KA 1QE1A 3H4DA 2RPIA 4I9QA 3VQQA 5KT6A 2ATLA 4TUQA 4O9MA 3S9HA 2F1IA 1YVUA 3RB0A 4HTUA 4RPXA 2YNIA 9ICFA 3RR7A 5KFYA 2KW4A 4CESA 4CEFA 1IKVA 4KFBA 3LWLA 4DG1A 1TKXA 2W9MA 4M47A 1TFRA 2D0BA 3AVIA 2IHMA 1IM4A 2DFEA 3TWHA 5KG2A 2W9AA 1ZQZA 4F4YA 3K4GA 4FYDA 4DOCA 2EX3A 4RQ3A 2G8UA 4BACA 4IRDA 2V4QA 4KLIA 1NOMA 4XA5A 7ICOA 4KTQA 3OYDA 5CZ1A 3MEDA 3SI6A 3RWUA 2BCRA 1K1QA 1JLQA 3KJVA 3G0ZA 3KD5E 3AUOA 1JIHA 3UXNA 1C0MA 4RT2A 3ETLA 3GQCA 4I2QA 5CHGA 1RTHA 4IRCA 3AVFA 5J2KA 1S10A 3QEIA 3LP3A 1JKHA 3V9UA 4CGIA 4CEZA 5L1KA 1N6QA 5HRRA 2YNGA 4CEQA 3ZSOA 3LP0A 5KG6A 7ICIA 2BE2A 5F9LA 4RPYA 4FJGA 1C0TA 3IG1A 3OYKA 1BIUA 3OS0A 4CEDA 4J9NA 3PW4A 4ECVA 1ZBIA 4Z4GA 4Z4HA 7ICKA 4Z6EA 3NGZA 4CJ4A 4PY5A 1JMSA 3OYGA 1ZYQA 4CIEA 1BIZA 1UT8A 3C21A 4FJHA 3JPQA 3T5HA 2UVUA 2IGIA 5IIMA 4P4PA 3LP1A 4DTNA 2ZJ8A 5L1JA 4N47A 3OYLA 2JLEA 4HCBA 2ZTDA 4PHAA 3BQ2A 1NKCA 3HM9A 4I2DA 1KVAA 2BCQA 4CFAA 4B9VA 4B9SA 4FJ5A 3N4MB 8ICXA 4DU4A 4Q8FA 3F9KA 3KKSA 1Q9YA 5CB1A 1XSLA 4NCGA 4DTSA 2BCUA 4DQIA 2YHBA 4DTUA 3TAGA 4RUAA 4GXIA 3ZDBA 4OPJA 5KFNA 1RDCA 3KLIA 4H4MA 3LP2A 4CFCA 1LWFA 4FM0A 4F4KA 3Q8SB 5DB9A 4CCHA 3V4IA 2P6RA 4ID1A 4P2HA 4R5PA 4PHEA 2PFQA 1MSWD 4E1MA 2ZUBA 5KG3A 4C8OA 3UQ0A 3TANA 3VQPA 4DOAA 2O4GA 5DB7A 4I2EA 3V6DA 2BPFA 3ZCMA 4HHTA 2HNYA 1C1AA 4CEEA 4Z6DA 5DLGA 1HJPA 2A1SA 3CQ8A 2IA6A 4PUOA 4J9LA 1Q9XA 1C1CA 1L3SA 4FJ9A 1LB2B 4JWMA 3V6HA 1N56A 2XC9A 3TAFA 5D3GA 5EOZA 2AJQA 4NYNA 3C95A 2YNFA 8ICIA 1FKPA 2F96A 4BWMA 4PPXA 5I3UA 3HXMA 1IH7A 3GV7B 4ECQA 3F73A 2IOCA 4E1NA 2E6MA 1U9LA 4NLKA 1ZQQA 3ZD8A 1D9FA 1BPEA 4AH9A 4M3XA 2PYLA 4J2EA 5KFAA 4KTZA 4Y1DA 4KI6A 4CEBA 4JWNA 4B08A 1RT7A 1KEJA 1T8EA 7ICQA 3C1ZA 2OPPA 3VQ4A 3MGIA 4I9LA 5KFWA 2HMIA 3DLHA 2X6SA 2ZUCA 2QK9A 3LAKA 3M9MB 8ICTA 4YMMA 2JEJA 1ZQTA 1WNSA 1JLAA 1W9HA 2ATQA 5DG9A 3JPRA 3M8QA 1F21A 3WNFA 3ZSWA 4YP3A 3EYZA 1H38A 4CJ3A 3HT3A 8ICSA 4YVZA 7ICRA 5CYQA 4RQ1A 3ZDEA 5SWMA 1WCLA 4FBUA 1L3UA 9ICEA 1A76A 4YG2A 5J2DA 4K4IA 4GW6A 4EZ6A 3ZSYA 4Z4FA 2GUIA 3P1GA 4Z4EA 4CK1A 3NDKA 5HLFA 3FFIA 3T19A 3OHAA 3ZSRA 2IDOA 3M9NB 4Z0UA 5KFIA 4W5QA 4ZHRA 1ZBLA 4CHPA 4FLYA 4C8LA 2HHTA 5HNKA 4C8MA 4I2PA 4MQ3A 5IIOA 4LVSA 4FXDA 4KHQA 4EBDA 3LPUA 5IIJA 3SQ4A 5DQGA 1LAWA 4E89A 3HWTA 3KHRA 3C5FA 2W9BB 3C6UA 3QO9A 3O3GA 3NGIA 3Q8QB 3RB3A 4KHUA 2W42A 1BGXT 2XCAA 3AVCA 4M2YA 4PQUA 3V9WA 4ICLA 1CXUA 4LSLA 2R8GA 4UQGA 3NTUA 3PNCA 4M04A 2ALZA 2NRXA 4O3RA 4DLGA 5J0YA 3Q8RB 1HJRA 4RW4A 1HQEA 4OGCA 2I1QA 1I39A 4R64A 1ZJMA 2XGQA 4ECYA 1T7PA 3LPTA 3UXPA 3NCIA 2ZTCA 1QLNA 3T5LA 2Q3SA 9ICIA 2B6AA 3G10A 2VA2A 4QZIA 2XGPA 1EKEA 4DSEA 5IINA 3MXJA 4R8UA 1ZJNA 3ISNC 2XY7A 4QWBA 4C8KA 1VSHA 4GXJA 9ICGA 5EWEA 4TURA 3L2UA 2PI4A 2NRZA 4RQ6A 1T03A 1UAXA 2FMSA 4MF8A 3RMBA 5HP4A 4Q8EA 2R8KA 1BCOA 1L3TA 2ASLA 4DTOA 3E01A 3T5JA 1ASVA 3VQ7A 4OKJA 4DQQA 4IDKA 1JN3A 3SJJA 3HK2A 3C2MA 4F4WA 9ICQA 2YV0X 4P4OA 1CLQA 4FLXA 5J29A 1QSLA 1ZQVA 3SUQA 4NCBA 3PY8A 5KFTA 3NH2A 4CHZA 2BANA 1LWCA 2BCVA 4IFYA 3OS2A 1JLFA 4NM1A 4BE1A 5J0TA 3MDCA 4KB1A 4DFJA 3D45A 3OYNA 4I2AA 1S1VA 1XC9A 3DI6A 2VG6A 2QXFA 1JXEA 2KZMA 1NK6A 5F9NA 3SV3A 3O3HA 4DL7A 2H5XA 3AVHA 1ZETA 1A5XA 3NF7A 4RQ7A 3KK3A 1XU4A 4JRQA 4NM2A 7ICVA 3ZT3A 3H8WA 2FBTA 4DEZA 1RNHA 4FZZA 2OA8A 4H8KA 3OYBA 4KAZA 2HHXA 5DMRA 3RAXA 4GC7A 4YQWA 1QHTA 4KRFA 1XI1A 3C1YA 3PW5A 5K14A 3MABA 3I0RA 3TAQA 1HNIA 4JV2A 1SV5A 1A77A 1VRTA 5CR0A 2UVRA 4EBCA 4L8RB 4TQRA 4QWCA 1KLNA 4YD2A 1UA0A 3PX6A 3C5GA 1ASUA 3EPIA 1TKTA 5CWRA 1VRUA 1JL2A 4CF1A 9ICAA 4IQTA 4Q5VA 4GVMA 1ZQIA 3HPGA 5D49A 2RN2A 4B8AB 5J2GA 3OVNA 4DU3A 4X5VA 3QEAZ 1YT3A 3CFPA 5L9XA 2HHUA 4HUFA 4FLTA 4RUCA 1PZNA 4I7FA 1YTUA 3GIIA 2BHNA 3K58A 2JZBA 4J9RA 3DLBA 4F2SA 4UAZA 3RAQA 4BDPA 4QZCA 4DTPA 2IS3A 3ZDDA 1HPZA 1X1PA 4J9KA 4CF9A 5DKWA 2NRTA 3ZD9A 5JS2A 3H40A 1RT2A 1NJWA 7ICHA 2B5JA 4F5NA 3ITHA 1IXRA 4KTWA 4M3UA 5HRNA 3K5MA 3DRPA 2Z1GA 4F5PA 4F3OA 4IQWA 1ZQWA 1ZQMA 3DRSA 3ALYA 1L5UA 4B9LA 2Z1IA 3C6TA 3GDXA 3BGRA 3ISCA 1U47A 4AHVA 1J53A 1FKOA 3V1RA 4PHPA 2BQ3A 4G1QA 4DSIA 3EY1A 5KG0A 4XQ8A 1NJXA 2W9CB 3SPZA 3AVMA 1BQNA 9ICNA 1WAFA 3DRRA 2G8VA 1ZQGA 5J2AA 4W5TA 4F4XA 4KLFA 4O3SA 4GXKA 4BXOB 2BQUA 3NE6A 2G8IA 4Q44A 1LV5A 4QZBA 1RT6A 1X9WA 2DPIA 3KHHA 4K4GA 1EP4A 4ED2A 7ICNA 2DFHA 3OHBA 1RILA 3VQ9A 4DL3A 3KTQA 1HYZA 2W9CA 3NF8A 4AHTA 4Z6CA 4MF2A 3Q8PB 1U45A 4Z4IA 2A1JB 4DO9A 3QIPA 8ICYA 4RNMA 5HP1A 2DPJA 1VSDA 3G6YA 3H08A 3P83D 1XHZA 3SYZA 4O5KA 1S6PA 1WSHA 3DMJA 1RPLA 1RTDA 2XY6A 4M3YA 4NYFA 3JSMA 2D0CA 8ICCA 4LY7A 3QEVA 1TV6A 1XHXA 4YXMA 1UOCA 1QSYA 3RJFA 3H8SA 4AHRA 4PGXA 3PMLA 4ED6A 2C2EA 1HQUA 1U48A 3HO1A 3NF9A 4B9MA 1RT1A 1Z26A 3BQTA 4DS4A 2HHSA 8ICHA 1B9FA 5DQHA 1NK8A 1KDHA 5KFKA 2HVHA 1QTMA 4LD0A 1RYSA 1KFDA 1ZQKA 4BXOA 5KRTA 4BDZA 1EETA 8ICAA 3V1OA 4P4MA 1LWEA 4E7HA 3ZSVA 2P66A 4FLWA 3L8BA 3MEGA 1ASWA 5DDMA 2WONA 3DLKA 2FMQA 3AO3A 4I2FA 3V9XA 2V9WA 3CFRA 4UB2A 4B8CA 1RBUA 3MR2A 3BDPA 1C7YA 2FMPA 1J9AA 2ZE2A 4RNNA 2FC0A 3QIOA 1IKWA 1S0NA 4JK1A 4I2BA 4DFKA 1S6QA 3SUOA 3LWMA 3LDAA 3B6OA 5DDYA 1BCMA 1TK5A 4B9TA 1RBRA 4M3ZA 3KLGA 4YD1A 3IRXA 4YCXA 2MUTB 1NK9A 4M0AA 4K4HA 3OYCA 4KLJA 1S9FA 2I9GA 2XO7A 4DFMA 3L3UA 4IR1A 1ZQSA 4NLZA 3U3YA 5C42A 4QZ9A 1ZQHA 2OYQA 1WN7A 4J2BA 1BPBA 3L2QA 2FBVA 4O3OA 1MQ2A 4AHCA 2F8SA 1ZQUA 3L2RA 4JRPA 4CHQA 4O44A 3V81A 2WOMA 1EXNA 1BISA 3P5JA 1T4GA 1RT5A 3RMCA 9ICSA 3VA0A 3HP6A 3OYAA 3QEWA 4ZH4A 5KTQA 4KLUA 1RDDA 3LANA 4ECRA 3TAPA 4RW8A 4Z4CA 3HW8A 5KFJA 3VQ5A 3KD1E 4TQSA 3RH4A 2OPRA 3ZT4A 2NUBA 7ICEA 4RQ8A 1Z3EB 4FM2A 2P6UA 5J0SA 4B3OA 1KSPA 4LZGA 1SKWA 3IS9A 1JXBA 3GIKA 5KFRA 3RB6A 1V9PA 4TSXA 1RDBA 4CIGA 2P5GA 5J0PA 3PO5A 1CZBA 3OYIA 4KLSA 1NK7A 1IKYA 4FK2A 1RZTA 3PW7A 4JV0A 1CZ9A 4RQ4A 5J2BA 3PX4A 2IAJA 2PYJA 4CF0A 3AA5X 4CFBA 8ICFA 9ICJA 3EWAA 4ED3A 1I3AA 4KLHA 4DQPA 3DYAA 2BPCA 4EP5A 3S3OA 3MFHA 1KLMA 3SUPA 3WNGA 2BDPA 2BGGA 8ICLA 3QLHA 4UB4A 4KLDA 1JLEA 3IHQB 4IQUA 4UB5A 4DSFA 5HMMA 3PW2A 1S5JA 3MR5A 4TUPA 5KG4A 3CM6A 1B92A 1XS9D 3GILA 2J6TA 3H7IA 1B9DA 4MEYA 3ZDAA 3TABA 2PY5A 2FPLA 4W5NA 4BGDA 5HRPA 4ECWA 4I2CA 3JPTA 8ICMA 5KFEA 8ICOA 2AGPA 9ICRA 1S0OA 4KLTA 3H8JA 3MXIA 2KN7A 4W5OA 5BOLA 5KFUA 1ZQJA 3HL8A 5KT3A 1S9GA 4CJLA 3TI0A 5J2QA 4N56A 1VSIA 2DFFA 4KPYA 5DBCA 2XY5A 1TKZA 2FLLA 4JS4A 7ICJA 2G8KA 4KHWA 1VSJA 1D5AA 4CERA 5DBAA 5J2EA 1VSEA 2RKIA 4NLNA 5J0RA 2PXIA 2JEIA 2VWKA 2X74A 3MEEA 2YHAA 4AHSA 1NK5A 4M6WB 1GOBA 1AROP 5KRSA 3ORYA 2B21A 3QEXA 3VQ6A 4CJVA 2FPKA 4I2GA 8ICZA 1BHLA 1MU2A 3RRHA 4R63A 3H4BA 4B9UA 4E7JA 2HHQA 2OPSA 3SCXA 3SI8A 2R8JA 3L3VA 1S77D 1GOCA 5KFDA 2D5RA 4FS1A 1SL1A 1VSKA 3OSNA 4KLLA 4CJKA 3PX0A 1W0HA 4HUEA 2YNHA 3HVRA 5IIIA 3MDAA 3DLGA 5IILA 3HP9A 2MAXA 2C2DA 3AVLA 4O3PA 3JPNA 3RRGA 4AILC 3ISBA 4DL4A 5E41A 1RBSA 4KHSA 5KGWA 1TGOA 2B4JA 3I0SA 2XHBA 4BDYA 3SNNA 4I29A 2V4RA 4Q43A 4ZTJA 1BPXA 3QZ7A 4YFUA 5D46A 2J6UA 2VA3A 2HNDA 2I5JA 5KGXA 2ZJAA 3GIMA 4CGDA 4FCYA 5DLFA 2VG7A 2RDIA 4QZ8A 4FJ8A 4ECSA 3DOLA 4RNOA 2DTUA 1A5WA 2ASJA 1T05A 1CUKA 4EYIB 4M6WA 1ZQYA 4MFCA 2J6SA 4DS5A 1S0VA 5KT7A 1TVAA 3OS1A 5J0QA 1ZQCA 3PO4A 3QNOA 3G6XA 3K5OA 4C8NA 3CFOA 3MECA 4YR3A 3TFSA 3PV8A 3BJYA 4QWDA 8ICWA 3MXMA 1RXVA 4UAYA 4OVLA 1TV9A 4JV1A 1C6VA 3FDSA 4LZDA 4J2DA 4QWEA 3VQ8A 2BKEA 5KFVA 4ELVA 9ICKA 2ZD1A 3AO5A 4RG8A 4QWAA 3GV5B 4Y1CA 5SZTA 5J0OA 2Z1JA 4M3RA 7ICTA 1NOYA 1T3NA 4KB0A 4ZTFA 4CJEA 1X2IA 4CECA 3QNNA 1MQ3A 2IHNA 1UT5A 5IIKA 3L2WA 3S3NA 1X9SA 4CFDA 1LW0A 3V7KA 2X6NA 4IBNA 4CGHA 5C5JA 4FW1A 4RQ0A 4ECXA 3HPHA 4DL6A 4M9LA 1WSEA 4LH5A 4CJQA 1KFTA 5DGAA 1HNVA 4BWJA 4F50A 1WCNA 1B43A 2QKKA 3V72A 2HHVA 4ECZA 2BCSA 1CXQA 3A2FA 4QZDA 2Y1IA 4RW7A 4KHNA 1TVRA 9ICWA 1Y88A 5KI6A 3AVAA 3KIOA 3RMDA 1N5YA 4KKOA 4KREA 2FLNA 5EU7A 1S1WA 4KO0A 2D0AA 8ICJA 2LYHA 2JGUA 3RMAA 4QZGA 4PGQA 1KCFA 5J2PA 4NY8A 1ITGA 4UBCA 1IO2A 1K6YA 2AGQA 1RXWA 1DTTA 1HMVA 2BQRA 5KFHA 3AVBA 4J9SA 4M42A 4DQSA 5KFPA 4EP4A 1HYSA 2LSNA 1B22A 4KI4A 8ICNA 5DK5A 8ICBA 2FBXA 4O3QA 1LAVA 2W8LA 4GLXA 3O4QA 4IG0A 4YXJA 3IAYA 2XCPA 4LSNA 3PW0A 4CGJA 5J0XA 4DTMA 9ICMA 4E7KA 1BPDA 4CHYA 3ZDCA 1HRHA 5KFFA 5HBMA 5DGBA 1BPYA 2QKBA 4DF4A 3OYJA 3HSTB 4YR0A 3MAQA 5KT5A 4J9OA 3AA4A 3ZT2A 3S3MA 3IM1A 4O3NA 4F5OA 4E0DA 7ICUA 1S0MA 2PI5A 4CEOA 4F2RA 5DB6A 3GV8B 3N97B 1U4BA 2AQ0A 1JLBA 4BE0A 3NGDA 1ZQNA 2Q0ZX 1JL1A 3OYHA 4M9HA 4DWIA 4I2JA 4ED0A 4F5QA 3T3FA 1ZQEA 4QOZB 4I28A 3TAMA 4IG3A 3NH0A 5KFXA 1RCHA 4KLOA 3KK2A 1BI4A 5JS1A 8ICGA 4FVMA 4DU1A 4MFFA 3KLEA 2ZTEA 3KHGA 4DTXA 9ICPA 5J2FA 3M9OB 4PHDA 4RQ5A 4G3IA 5C24A 1ZQPA 4NLGA 1X9MA 5HHHA 5JUMA 3VQEA 3SQ0A 5KG5A 2JEFA 4DOBA 3KLHA 5DQIA 3Q8KA 4XUSA 1HUOA 3OGUA 1KTQA 3TQ1A 4RT3A 5CY4A 3PUFA 4F4ZA 4OKEA 3DM2A 3RH5A 1XSPA 4PGYA 1TAUA 3TFRA 3CYMA 3HVTA 9ICUA 1SKSA 4CF8A 5CYMA 5CJ7A 3NH1A 3BQ1A 4IR9A 2F8TA 2C2RA 3L2VA 4CK3A 3THVA 3FYHA 5J0UA 4R66A 2VA8A 4RZRA 4UBBA 4DF8A 5EWGA 2ITGA 1VK0A 3JPOA 2O4IA 1NKBA 4PA1A 2VWJA 3PR5B 4CGFA 7ICPA 4HUGA 5FRNA 3AU2A 3K5LA 4Z6FA 3QZ8A 7ICSA 5I42A 3RJIA 2P1JA 4CJPA 1WLJA 1ZQFA 2ASDA 2BPGA 5KFBA 2DFLA 4QCLA 2OPQA 4WE1A 5KG1A 2YKNA 3RBEA 4IFVA 4K8XA 4KLGA 4RW9A 1S1TA 3VN5A 2G8FA 4RQ2A 4KITB 1ZQDA 4M41A 4PWDA 2R8IA 3GFKB 4F3TA 2GBZA 4NXZA 4FLVA 4OJRA 4GC6A 3AO1A 2EHGA 2ZUDA 3VQDA 3QINA 4QZEA 7ICGA 4FZYA 3NHGA 1R0AA 1BI4B 3MR6A 4DSLA 3ZSXA 3SUNA 3AVNA 1RTIA 4ED8A 2NRVA 1BL3A 2FBYA 8ICQA 3RJJA 3AVGA 3RJGA 1DLOA 2XY8A 5DB8A 4J9PA 8ICVA 4DSJA 3B0YA 3KK1A 4KMUA 4KLQA 3ISDA 3EPGA 4JUZA 3GIJA 2PFPA 3VQCA 1C1BA 4UB1A 1JX4A 4CEAA 4EYHB 3V1QA 4MFBA 2AU0A 4J9QA 4N76A 2W9BA 4FLUA 2R8HA 1KVCA 3NBPA 4YMNA 3MGHA 3QEPA 1COOA 2GV9A 2AGOA 1L3VA 1WSGA 2R7YA 1GOAA 3T5KA 3EZ5A 4CIFA 2RF2A 4DLEA 4FM1A 4E19A 4LH4A 1ZQBA 3PVXA 2ISPA 5L1LA 3ASMA 2KQ2A 1REVA 3KHLA 3C94A 3SQ1A 4FJLA 4N5SA 5J2CA 2HNZA 1JXLA 3RTVA 1S9EA 3MBYA 3AA3A 1QQCA 5L1IA 5DG8A 2P5OA 2BGWA 2JZBB 3DLRA 4CJSA 4QW8A 5KFLA 3BQ0A 3AA2A 5FDLA 3QETA 1WSJA 5HMLA 1U49A 9ICLA 3V7JA 1BQMA 4FJ7A 4M45A 4I2IA 3O4NA 1U04A 5HHIA 4ED1A 1XSNA 7ICMA 1NJZA 4IKFA 8ICUA 2KZZA 2OZMA 4FJIA 4CHOA 1SZPA 3LK9A 3RH6A 2G8WA 2ZJ5A 2Z1HA 4FLZA 1RTJA 4F92B 3U3GA 9ICTA 3RR8A 3NGYA 4O55A 2HB5A 4M3WA 4R65A 4M9NA 3LAMA 1TKDA 1RBTA 1FK9A 2KZ3A 4I2HA 1IG9A 5C25A 1Q8IA 4KN4A 1XWLA 1EX4A 1EXQA 4OLAA 3M8RA 1DOQA 4KLMA 4HYKA 1QSSA 1WSFA 4K8ZA 1NJYA 1ZQLA 3OJUA 9ICOA 3OY9A 1IKXA 4ID5A 1VSMA 4JS5A 5KT4A 4TUSA 3HX0A 2XRIA 4EBEA 2A1JA 3RB4A 5J2HA 2E4LA 4DTRA 4F5RA 9ICCA 5HROA 3DLEA 3ULDA 1DGSA 3G6VA 3OYFA 4YMOA 4OLBA 1ZBUA 3Q8LA 1Z25A 1SKRA 5BOMA 3QERA 3TAEA 1Z00B 5KFZA 1TK8A 4F8RA 3NFAA 3OYEA 4O4GA 1Y97A 3ZSZA 4RW6A 3SV4A 3C2KA 4QZFA 1VSLA 1BPZA 9ICXA 4O0IA 9ICVA 3C2LA 2C22A 3TR8A 4HVJA 3UIQA 3VA3A 2HVIA 2M9NA 1HYVA 2UVVA 2BR0A 5HRSA 9ICBA 4CK2A 3OYMA 3VQAA 4ED7A 5FRMA 4F91B 1KFSA 3NAEA 3AVJA 2IMWP 2Y1JA 2AQ4A 2RDJA 4FJJA 5DBBA 4R8UB 2OZSA 1RT3A 3K57A 4F93B 4CGGA 1ZBHA 1TK0A 5KFOA 4ELTA 4ECUA 2HHWA 3CG7A 5FROA 4CJUA 5J2NA 1D9DA 3V9ZA 2KFZA 3RJHA 4FJKA 3V7LA 4FJMA 2PZSA 2F1HA 4M9JA 5BPCA 4IRKA 3AO4A 4DQRA 3TARA 3QEBZ 5J2IA 5KFQA 5KFCA 1S76D 4RU9A 3AO2A 8ICPA 4FO6A 4Q45A 2OWOA 2PFOA 3WNHA 3JPSA 4O5EA 2ZQBA 1BVSA 1SUQA 1SL2A 4HCCA 1FXXA 4KV8A 2NRWA 3UPQA 4FJNA 3SQ2A 4CJRA 2MUTA 2ETJA 1NK4A 2FLPA 9ICHA 4MFAA 1NK0A 3DOKA 2JEGA 4DSKA 3OSPA 2A1RA 1TAQA 3C23A 4I27A 3QESA 3AU6A 1NOZA 4FJXA 3CM5A 3K59A 4QZHA 3O3FA 4E7LA 4UB3A 1NKEA 4DFPA 4KHYA 3K5NA 2P51A 3I8DA 3B0XA 3PR4A 3VQBA 4ECTA 1S1UA 1WAJA 4RPZA 4BE2A 3LALA 4CJ5A 4M9GA 4PH5A 5J2MA 4IQVA 4XIUA 3UXOA 3MR3A 4EZ9A 4W5RA 4DL2A 4OKKA 1QS4A 3PMNA 2UVWA 4J9MA
chains in the Genus database with same CATH superfamily
2D9OA 3H1QA 4P0PB 4OJHA 3TVZA 2V2ZA 2IHR1 3A8JA 4YN3B 4ELUA 1HNXJ 5M1FA 1R7IA 4MDBA 3CO0P 2OH2A 1Y4ZB 5T7BA 3CJKB 2UXBJ 1CJKA 1WOQA 1WWUA 2EI5A 3AV9A 1SC6A 3BS9A 4CE9A 2AP6A 1UA1A 4H4OB 3WNEA 1TL3B 1QDUB 1NJIO 3VWSA 2DISA 2IJRA 2QN6B 1ZQRA 2CWKA 1DQ8A 2MQNA 4ED5A 3RSEB 3NWGA 2KTQA 7ICLA 3U6FA 4J8FA 4Y2UA 3V9SA 4KT0C 1FJGK 2RP5A 3PHEA 2M2BA 1CEZA 3KG1A 4AHUA 2IBKA 3LQVA 1MC8A 2NUUG 4NCAA 4OYPA 3E9PA 2OPPB 3TOQA 5AQIA 4DX8H 4DTJA 1K5OA 2ZM6J 4ES1A 3L9ZA 5EOYA 2PFNA 1MA9B 1I3OB 2QKQA 3CP8A 4CJTA 1IXKA 2Q79A 1HJOA 3D67A 1LW2A 2DD8S 3H5YA 2FPMA 2FGOA 4YDXA 4DL5A 3D66A 4ID8A 1W2BR 1S3XA 5KFMA 3U1LA 1QH9A 3JPPA 4DR2J 2NO4A 2RRDA 2HIQA 3L4IA 4RQMA 4KH6A 1HFEL 1COKA 5AM2A 1ZQAA 1J5OA 1FVSA 3NS7B 1X7VA 3ZSQA 1GLBG 3MM9A 2GWSA 1YVNA 1OH5A 5FJ4A 4J2AA 2GJFA 1OUQA 5F0UA 1RKJA 1J54A 1Z00A 5AQWA 3BY5A 1HBMA 1K1SA 2BZ2A 4MEXA 2KFNA 1F0XA 1MWQA 3H25A 1TL3A 1RA7A 2M0GB 1SGGA 4LFCK 4TLRA 2I6WA 1ELOA 3TR5A 4H4OA 4WQ4C 1WSIA 1HUZA 2NSCA 3CMQA 2IVYA 2M9KA 4O0JA 1UFKA 1SH3A 2ROEA 4KN7A 3V6KA 4TUQA 2WOMB 1WUDA 3M6UA 1KW4A 1Q82T 4HTUA 1N61A 2VJUA 4QIGA 4DXLA 3OLBA 2GX8A 3GZFA 3VGSA 2W9MA 4DFDA 3H42A 1TFRA 2CXYA 5K8MA 3UVJA 1AXQA 1SKUB 2CQ1A 3F9MA 3MECB 1J97A 2IHMA 1IM4A 2W9AA 2QWLA 1NO8A 1NU4A 8ATCB 4FYDA 1VI7A 3TTDA 4RUHA 3HFKA 4Y6IA 3U1NA 4KLIA 4XA5A 2F8MA 3DGVA 5E2QA 4BG9A 4EELA 3HT0A 3SI6A 2M8DB 1HHTP 3RWUA 1K1QA 3QWUA 2XI2A 1DGJA 3B78A 4BRPA 1ZXOA 4H0OA 3H98A 1C0MA 1KWMA 5AKLA 1RTHA 4IRCA 2WHOA 1GH8A 4EMDA 2LFVA 1CRXA 3QEIA 3I5BA 2CQIA 4BC9A 1F6TA 4CEZA 2E1RA 2YNGA 4OHYA 3CD6S 1GXTA 3LP0A 5KG6A 1X9JA 1DLOB 5F9LA 4XH1A 4RPYA 4KGKA 1FRKA 3OS0A 4CEDA 4ISEA 2MHNA 2ZITA 2KH9A 4CJ4A 3OW2R 2EXUA 5IS2A 1ZYQA 1FFGB 3OVSA 2P8IA 2B56A 3CJ4A 2YQEA 1YJNS 2YN4A 4K4VA 5CH7B 3R5JB 3IWNC 3LP1A 3GONA 5HQLA 5LMNJ 3EE9A 2E8MA 4DCHA 4HCBA 3ZTPA 1YJVA 3BQ2A 3DJCA 4ISGA 3HM9A 4LSZB 4I2DA 3VAKA 1BLUA 2ADBA 2XSJB 3ET6B 5HP1B 6FD1A 5BRDA 2IOHA 3IG5A 1RTZA 3A8YA 3KKSA 1N33F 1XSLA 5HQ8A 2YHBA 4DTUA 1N5YB 2FUG9 2C2ZB 3ZDBA 3ENBA 2JV3A 3LGHA 1WKLA 3Q8SB 2D1CA 5B0BA 1WG8A 2P6RA 4NLDA 1GLDG 2VCPA 5A8KB 2HF3A 3L4QA 2HOEA 4R5PA 3M8YA 2IVMA 4A8XA 2JXJA 3BKFA 4URGA 3UD3P 4ZPCA 3U7JA 1MSWD 3KD3A 2ZUBA 4JKAA 2DGWA 2YMLA 4NWIA 5DB7A 2GCFA 4BRFA 5FLXY 2BPFA 2WVBA 1C1AA 2G5IB 4Z6DA 5DLGA 1HJPA 3DHXA 2A1SA 4PUOA 4J9LA 1C1CA 1HKCA 4DX7A 3V6HA 2FVPA 4FYVB 3F5AA 2GVZB 3N01A 1LFPA 2YNFA 4BWMA 1ZAXA 5I3UA 4YS2A 1Q86T 3GR1A 4JI5F 1VR6A 2O1PA 4DV5J 3IFRA 2E5LK 2WB4A 5AQYA 2QLXA 2IOCA 1IJJA 3KVGA 4I0WA 2V7ZA 2GAHC 3IP0A 4F0KA 1BPEA 2BVZA 2HFZA 4NOHA 1U1KA 2PDAA 4LBPA 2WBNA 2DKOB 4CEBA 3Q83A 4B08A 3TAMB 2HSZA 4OLPA 1KEJA 5DM6L 3MMBA 4Q0BB 4YHHK 2WAQF 3C1ZA 2GVDB 4JKFA 3VQ4A 2OTLS 4RR5A 4CZCA 4N7TA 3X3UA 1MN7A 2AEMA 2E20A 4GMKA 4PAAA 3W5XA 2DGQA 2FHKA 1YQHA 1W9HA 3GJQB 2QFIA 2Q4TA 4QIWD 5E0OA 3MXHP 1F21A 1NDKA 1XO0A 2XYPB 4CZKA 1FNOA 1SJ3P 5CYQA 7ICRA 2HFSA 3R7SB 5SWMA 2QM1A 1A76A 4YG2A 2YX1A 4ZVHA 4U67L 5K8PA 3CERA 3UKUA 4JOUA 5J2DA 4K4IA 4EZ6A 3I0RB 3ZSYA 3LO3A 2XVTA 3OFEA 3AOAA 4WWSA 4FYXB 3T19A 3FFIA 1VC5A 2HS3A 3OHAA 2XSFA 4CLFA 3M9NB 2HVZA 1EKSA 5KFIA 3IR6B 2KRRA 1ZBLA 1CULB 3T1YK 4CHPA 3W1YC 4IJNA 1XK8A 4PWWA 4IH7A 1CULA 1R27B 2D3UA 1RUSA 5HNKA 4ENOA 3I33A 2VIHA 4BRCA 1V3RA 5HVGA 4MQ3A 3CC4N 4KHQA 3NAIA 2K4EA 2IBOA 3OTQA 5IIJA 4DR1K 1PBUA 5DQGA 3FSIA 2P9SA 3HWTA 3KHRA 4V1Ak 4G65A 4RWTA 3O3GA 4C7ZA 3Q8QB 3VCDA 4KHUA 1JMTA 2UV8G 2HBYB 1XMOJ 2F9WA 4L74A 2CJXB 4LSLA 1IN0A 4LR9A 1S9GB 2YNHB 3TADC 2QA1A 1F5AA 1OSCA 3PNCA 4B6JA 2NUHA 4O3RA 3Q8RB 4LF2A 1HQEA 1X4AA 3JXOA 1GLAG 2I1QA 4BRDA 6FDRA 3QIDA 4FKXA 1WG1A 5D4OA 5CD4H 2E9ZA 1R8BA 3K0SA 1ZJMA 3CC2S 3DMJB 4JI8F 4ZA1A 2G07A 1C20A 9ICIA 1KXPA 5DM7L 2ZEJA 5IINA 1S57A 2QX0A 5JLHA 1HHSA 4BY9C 2DNOA 2XY7A 2QARA 5EWEA 5AZJA 5RUBA 4OYIA 4RX6A 4LMZA 4JKHA 2NRZA 1T03A 4IXCA 3GB0A 1T44A 3RMBA 5HP4A 5AK3A 3QFWA 4LQ3A 3LUYA 4UATA 3ELHA 3FZBA 2YWWA 4OKJA 4KX5A 2E9TA 2U2FA 3C2MA 2DTJA 4UOGA 1EP4B 4ACOA 4NCGB 2IVFB 3GJRB 1T9WA 1S6UA 5BR8F 1QSLA 3SUQA 1ATSA 2GW8A 5CR4A 4Y00A 2HAFA 1Q53A 4CWBA 1U8SA 3SENA 2DNKA 2ZKUA 4IFYA 3OS2A 1N33K 2XHWA 2E5LF 3EGWB 4IOAQ 3VZHA 3QU2A 4KRWA 3CW2C 3DI6A 2CQ0A 4AXIA 2VG6A 3J81j 2QXFA 1JXEA 1YI2S 4BG8A 3O3HA 3TJ9A 2OI2A 1RT2B 1A5XA 4JV5F 3MCNA 4BC7A 4NM2A 4H5WA 3ZT3A 5AXKA 3H8WA 2FBTA 1VJ5A 4YOYA 4H8KA 1CS4A 1VGYA 2K3IA 5GAGU 4GC7A 3H0PA 4IH6A 1QHTA 5KOWA 1R6YA 4CZLA 3D9BA 1XI1A 3C1YA 4KPCA 3CGIA 4L72B 2JRZA 2XSJA 3ENHA 3CCJN 3HHEA 1VQNS 2AZ3A 5IV3A 2AJ4A 3T7ZA 4FZLA 4A5BA 1FRJA 2ZVIA 2IMOA 4QWCA 1S6QB 2VFRA 1S7HA 4W98A 1IBKF 3E58A 4X62F 2VBXA 1JJ2R 3EPIA 4NPOA 5CWRA 2RQMA 5LY3A 1JL2A 9ICAA 3QQCD 1LKZA 2JDJA 3CULA 4IQTA 4Q5VA 1T9TA 4GVMA 2WBRA 1HI1A 3HPGA 5D49A 2LM4A 5B0CA 4B8AB 4DU3A 4X5VA 3Q89A 1JKHB 5L9XA 3VGLA 5ADZA 3KOOA 4I7FA 1M1GA 3GIIA 2VG7B 4B3MK 3UO0A 2OELA 1HNZJ 1MWMA 4J9RA 3BV8A 3TNVA 2H3FA 1CC7A 3ILIA 4F2SA 2XI9A 2M3DA 4JKEA 5AQHA 4DTPA 2MU2A 5BRHA 1HPZA 1X1PA 4DR4K 2AJFE 3EL2A 1WD6A 5I9EB 2PBDA 1YGYA 5FP0A 3JAMY 2VL1A 4BR0A 2QL7B 1IXRA 4KTWA 5HRNA 5EX3A 4K8RA 5ALLA 4RWXA 4RWWA 1ZQWA 4J7CA 4I64A 3C6TA 4X66F 3GDXA 2J0QD 2BTFA 3EDRB 3ISCA 1U47A 1T0TV 1RWXB 1HNZK 3V1RA 4PHPA 4DSIA 1WC6A 2JH3A 3UD4P 3G82A 5KG0A 1NJXA 2W9CB 1RWPB 3QWPA 4I69A 2BUPA 4DPXA 4IS7A 4MMOA 5CCMA 2NYHA 3OW2M 4F72A 2EFVA 5CRXA 1WB9A 1WAFA 3DRRA 5F8LA 4O4GB 1IBMF 2BQUA 3U26A 5CCLA 5J2PB 4Q44A 4QNLA 3MM6A 3G96A 3QGIA 4QZBA 1UP1A 3GG1A 5DS7A 3LP2B 2HQFA 4DV1K 1PVPA 1NHUA 4OX9J 2DPIA 3L6QA 1R59O 1EP4A 3M3ZA 4ED2A 1VQ7S 1K47A 3EWGA 2K7JA 1Q95G 4D3GA 4MF2A 3LDLA 4DV2K 3DOMB 2A1JB 4DPOA 1K73O 2KXFA 3CJ9A 1VSDA 1HIYA 3H08A 1XHZA 4QOTA 3N28A 5M2UA 1RTDA 1QQ6A 3MDFA 3SCIE 2DNQA 3NVVA 2XTJP 1TV6A 4YXMA 4NV0A 3RJFA 4PGXA 3V4IB 4CNQA 3PMLA 2C2EA 1HQUA 2WSCC 4CBXA 3TP2A 1NK8A 1QVFM 3PDNA 2UXCK 1KDHA 1IG8A 3AT1B 1O51A 2QRRA 1YJWN 2VASA 2CRLA 2VH7A 3RYLA 3VGKA 3ZSVA 2P66A 4FLWA 3E51A 4ETZA 1YZ6A 1KKXA 1S72N 3VAMA 3N79A 4HAIA 4K4ZA 4I2FA 3CFRA 3WKBA 2BJ1A 1PVRA 1DEJA 4B8CA 4O4RA 1JCFA 2R3VA 2GMJA 5M2PA 1Q8KA 1Q46A 1HW8A 3HOTA 4LIRA 3LWMA 1F3FA 1K8KA 4B9TA 3GL1A 4M3ZA 4JK7A 3KLGA 5F1XA 4WPAA 3SBGA 2MUTB 4X2BA 3EKUA 4M0AA 2A6AA 3KJVB 3SCJE 5AKHA 4IR1A 3VEVA 1ZQSA 4NLZA 1Q1KA 3MCPA 4QZ9A 4PKGA 2OYQA 3BPDA 4P71A 4RNFA 3P39A 4FE3A 4UARA 1R31A 3H45C 1LK7A 4O44A 2IOFK 1RT5A 1LXJA 9ICSA 1NGGA 4HDGA 4LF4K 2RVJA 3H5UA 4ZH4A 1VQ7N 4C4SA 4KLUA 2WSFC 3VR1A 3LANA 1W25A 3THXB 1FWKA 3CCSS 3BREA 4ZVTB 2IJNA 4IL6U 2NUBA 2FDNA 5AKYA 4I2QB 4ZPDA 4I68A 1XC3A 1PVQA 2JL9A 1NGFA 2WVFA 2HBLA 1SKWA 4M63C 2N1RA 5B08A 2X1FA 4K0KK 5KFRA 2L48A 4CIGA 3M7VA 1Z4NA 5J0PA 3PO5A 2HLUA 1K0VA 4YY3J 4ILGB 1KQQA 3DLKB 2EK1A 4LVOP 1LOTB 4IO9L 3PW7A 2I1RA 5JMVA 4FO0A 3VENA 5J2BA 3PX4A 1S1TB 2IAJA 3FBEA 2P9UA 1UW9A 3D2QA 1U6FA 4CF0A 3KMSA 3UNGC 3DYAA 1I3AA 4BX9C 5ELZA 3S3OA 4USVA 1KLMA 5KNIA 4LF9F 1NGIA 4U7BA 3T79A 1WC3A 2VHGA 2BDPA 1NXIA 4KLDA 2ZZTA 4DSFA 4IO8A 1OKJA 5C2CA 3WX8A 5HMMA 4K50A 3ALRA 3FVYA 3MR5A 4TUPA 5KG4A 3JB9k 1B92A 8RUCA 3DGPB 3S7RA 3OL7A 2CUYA 4WK3A 1B9DA 1NG9A 2PY5A 1VFJA 3TABA 4W5NA 2DGZA 2M5YA 2P9EA 4ECWA 1D09B 1JJHA 1MMNA 1UVIA 3VEOA 3U1MA 5B0AA 8ICOA 3MM7B 4DBQA 2WF5A 2HZVA 1FFVA 4UAUA 2ZUGA 4JBCA 2VC0A 2FGCA 4LC9B 1YI2N 5J2QB 4ALZA 3OXFA 5KT3A 1FDNA 3SBTA 1FCAA 2JJ4D 1FK9B 4IO1A 4KPYA 2DFFA 3CCSN 4UQTA 4C0HA 2XY5A 3QRRA 3I56N 1I94K 3KZXA 1TKZA 4JS4A 2CNOB 7ICJA 2G8KA 1KONA 4UB6U 4CERA 2Q6BA 2VBZA 5GTHU 3RGIA 1VSEA 5JU5A 4ZJQA 3G71N 4J9UE 2JEIA 2VWKA 2X74A 3G8QA 2VC1A 1NK5A 4V19J 4K42A 1GOBA 1AROP 5KRSA 4DV5K 3QEXA 1SS6A 3GDQA 3VQ6A 4CJVA 4I2GA 4C4RA 3R27A 4R63A 3FAHA 5ALOA 2RUSA 2C3YA 4C48A 3I55N 4DR6J 1J2MA 4K4SA 4IJAA 4M5LA 1HQEB 2CPZA 2ZJRQ 3IG1B 3OSNA 3CIMA 4XH5A 5EX5A 1R0BG 3D2FA 1RTJB 2J7WA 1W0HA 2DGXA 2YNHA 1QQMA 3TX8A 3DLGA 2MKHA 2DNMA 3JS6A 4P75A 3JPNA 3FCHA 1HNIB 4P0QB 3HSCA 4DV3K 4KHSA 1UCNA 1TGOA 1UFLA 1WHYA 1WC5A 1FW6A 1VJWA 3IBPA 1FDBA 1RBOB 4ZTJA 1BPXA 3CC4S 3QZ7A 3VVUA 3MX5A 2N4DA 1U09A 2R7WA 4CGDA 1AW0A 3N7RC 5K14B 3N6LA 2FQQB 2CJQA 4ECSA 5L8RC 5AZIB 5I4MA 2DTUA 1A5WA 3K8WA 3H0LB 4KFBB 2CNNB 4EYIB 2VGNA 2J6SA 4DS5A 1NH8A 1S0VA 1PYTA 1S4FA 2D8CA 2ES6A 4Q2LA 2L41A 4P52A 1PGZA 5IT4A 4CF4A 3AD8C 1ZQCA 3PO4A 1LWCB 3MD3A 2ZIUB 3G6XA 3FKBA 3MECA 1PAEX 5FPEA 3J81O 3D7EO 3BJYA 1VQMS 4JMUA 3GFHA 2E2PA 8ICWA 3MXMA 1RXVA 4UAYA 3T1HF 1TV9A 4JV1A 1TQLA 3FDSA 3PXGa 4QWEA 1QD1A 2LA4A 3HVWA 4XK8C 2JRSA 2GMLA 2FI1A 4LJMA 2Z1JA 4M3RA 1T3NA 4PWUA 2YX6A 4DU8A 4CJEA 4CECA 1PBAA 2MKJA 3HHLD 1LWXA 2DGSA 1UT5A 5D4PA 2J0WA 3CCZA 4A4JA 2ZH3A 3TEHB 1TUVA 2GWJA 5C5JA 2CG4A 5ALZA 1VHIA 1RGIA 4YORA 2H5JB 4ECXA 1LWFB 4DR7F 1IQTA 2H65B 5AQVA 3WKAA 3FRZA 1WSEA 4OX9K 4LH5A 4WF9Q 3MN5A 4CJQA 2CZ4A 1U2RA 4UUWA 4NYPA 3CDUA 4YB6A 2XMWA 3DLLQ 2HSEB 2HHVA 3VEZA 4ECZA 4JI6F 3CMAN 3QU9A 3PKMA 1S8OA 1ZPVA 3GMGA 1Y88A 3Q86A 3AVAA 1LXNA 3OFHA 1NZAA 5GIOA 4EENA 5ITHA 1VOMA 4YOVA 2AP1A 3A0IX 3IS9B 1QAYA 3M32A 2EK6A 4PGQA 1KCFA 5J2PA 2J76E 4K43A 4OI1A 1Z6RA 1FXDA 2HBZB 3QSYB 2NV3A 4QIVA 2K89A 1RT6B 2EFQA 4EP4A 1HYSA 3Q24A 3AHPA 1WHVA 2G2OA 3AAWB 1IR1A 8ICNA 5AT1B 2NPFA 5DK5A 8ICBA 2CQBA 2DRDA 1LAVA 2W8LA 4GLXA 1Q8BA 2C3OA 3R1XA 2GGPB 4IG0A 2QV6A 5AQJA 3IAYA 1OS5A 1DQAA 1FRMA 3UCGA 3PW0A 4CGJA 5J0XA 1X4CA 1EX8A 2XULA 1BG3A 1U26A 4DX5A 1J5EK 5KFFA 4K4WA 2W7PA 2EC2A 4JI4J 1JLQB 4YHHJ 3NVYA 1DRGA 3AXMA 2WW8A 1BPYA 2QKBA 2R4FA 4A8QA 2F9JA 4DV2F 2MZSA 3MPVA 4YR0A 4MFBB 3ZT2A 2YY6A 7ICUA 1S0MA 2OUGA 1E4GT 2PI5A 3KLEB 4CEOA 4F2RA 1SWVA 2CJYB 1V3ZA 5LL6d 2DR6A 4GVEA 3P4UB 4OV1A 2AMCB 1RU1A 2R7TA 1ZQEA 1NGEA 4QOZB 4I28A 3TSUA 1H2TZ 2FHOB 5IT0A 2WF8A 3C16B 5GIPA 1DK2A 4F4AA 2F2AB 2IRUA 2DGUA 3MN7A 3BN4A 1JWWA 1LWEB 2ZTEA 1EETB 2QWRA 5CHIA 2CJBA 1Y9OA 4RQ5A 2V0NA 4UW9A 4NLGA 2CKWA 4LRFA 3VHQA 2R7QA 1ZRNA 3QRPA 3GZ7A 4PKIA 4DOBA 2HEKA 5DQIA 2K7KA 3Q8KA 4OPHA 3HM8A 1QQ5A 3OGUA 1TYQB 3TQ1A 3I96A 2EDUA 2F7TA 1PIEA 3TU5A 1F44A 3UCUP 1TAUA 3CYMA 4B1WB 2V8VA 4JHDB 3CJ0A 3E9OA 3SAFA 3ZZ0A 5CABA 2N82B 2FHMA 5MAOA 4HKQA 2RHFA 2D0PA 2F8TA 4CK3A 4QS7A 3KUEA 1NGBA 4IO9Q 1JQGA 2VA8A 2A2DA 3JPOA 1NKBA 1NSAA 3NNHA 2VWJA 3PR5B 1HKGA 2W24A 4P72A 2G13A 2HMPA 2X1AA 4Z6FA 1SJRA 5IC4B 1SB6A 3W5YA 4HHHA 2DR8A 3CNQP 7ICSA 5ETRA 2KHOA 3WXJA 4GVBA 4C8ZA 3HFZB 2P1JA 3W64A 1HARA 2B8QA 2J7UA 4CJPA 1IWGA 2ASDA 2BPGA 3DEEA 5KFBA 2EEYA 2MZQA 2ZC3A 3RBEA 1T03B 2F4FA 3A0BU 4RW9A 2ZH9A 1O08A 2LYAA 4RQ2A 1ZQDA 3OTDA 2XM3A 3OTCA 2R8IA 2EZZA 3K89A 4DV4K 4DJBA 4F3TA 3N7PD 3W3SA 3CCUN 3E3XA 1RAAB 4PXCA 3VQDA 3QINA 2N4CA 4H5VA 1E6VA 1OVQA 2JMGA 1J5EJ 1Y5IB 3IBFB 3WT0A 3R9KA 1LKYA 2KKHA 1N32F 1VJQA 3TUJC 2ZZMA 5F8MA 3FGVA 4ED8A 5HO4A 1BL3A 1NZBA 1YWXA 1SIZA 1KHWA 8ICQA 2IC3B 3RJJA 3OR1A 2B51A 2QTWA 3AVGA 5M1NA 3RJGA 2XY8A 3ENWA 4HWIA 4Y3CA 4ES3A 1HWJA 3KK1A 1KD1T 2NXEA 3SSSA 3EPGA 3VETA 2Y8YA 3RFAA 1YUWA 4CEAA 2RUGA 3T1YJ 2ZC4A 1NDLA 2B43A 1Q5VA 3J81Y 4K41A 1N4LA 1H7XA 4GKJF 4YMNA 4LRBA 2HFUA 1VRTB 3QEPA 2QMXA 3SEOA 1A0PA 1WSGA 4A8OA 4F9OA 3DFEA 1FO4A 2UUBK 2LCWA 4LFCJ 2ISPA 2QA4G 1REVA 3DLGB 1J6ZA 1JXLA 3WC2A 3RTVA 3MBYA 1QQCA 5L1IA 5AJ3F 3CJ7A 4XH4A 2VQEJ 3DLRA 5I3PA 4OL8A 3QETA 5DRKA 3V7JA 2CN1A 4M45A 2EQYA 4OYWA 2FLOA 2OHFA 2DNLA 1YXQA 3MN6A 5HHIA 8AT1B 2FSNA 2HHPA 4FVUA 4Y2TA 1Z1BA 3W2WA 1FWPA 4EO8A 5GTIU 3NVZA 5BJRA 1RTJA 1C0UB 2VZ9A 3RR8A 3MDQA 2HFVA 3G6EN 4MKBA 1T02A 2HB5A 2K1RA 4B3RF 4J03A 3LAMA 1TKDA 3TW0A 5C25A 3MPYA 3UB5A 2WONB 4NXMF 2V2VA 5G5HA 4RW7B 2GVDA 9ICOA 4ID5A 4FPIA 1RDRA 4JS5A 3HX0A 5J1NA 3B82A 2FHJA 4DR3J 1S5ZA 1IKVB 3DLEA 3ULDA 1DGSA 1HLUA 1ZBUA 1IVZA 2Z2ZA 5ALVA 1QE1B 1ATRA 1OJ4A 2E1MC 4CZJA 3P96A 3A3OB 2WUSA 3SQGA 5AJ3J 4QZFA 1BPZA 4O0IA 2CAJA 3C2LA 3TR8A 1S1WB 4HVJA 1UPHA 2HVIA 5AQRA 1Q78A 3UR3C 1G6BA 2ZM6F 2WZ1A 3GCWP 3ISZA 2BR0A 2RS8A 3NL0A 2QXLA 4C6AA 3KLFB 2Z7JA 4CK2A 2BDUA 6AT1B 5A8WB 3NP5A 1CPZA 4JKGB 3VQAA 3O4WA 4FFDA 1L7NA 1C2PA 4YOEA 4F91B 4NLTA 2AXTU 4GKKF 1RJJA 4WF9L 4NYZA 2RDJA 4FJJA 5DBBA 4IWVA 4CGGA 1TK0A 5F8GA 1CJVB 4FOIA 1KN6A 2R7SA 3PLAA 2HHWA 3CG7A 5FROA 3AXKA 4WTOB 3I76A 4U6PA 5J2NA 1D9DA 4DU7A 3DDKA 3I56S 3KK2B 4MKVA 3W2VA 3N6MA 5CE3A 4ILJA 2W2OP 4M9JA 3AO4A 4DQRA 3DOLB 3QEBZ 4QU7A 3THYB 4ID5B 1SV4A 4RU9A 1RQ0A 2RHSB 3PEJA 4NWBA 3AO2A 2L9DA 4MLHA 4OZ1A 3P8BB 4FZMA 3Q8YA 5A76A 3K9JA 3WNHA 5ALFA 1BVSA 4BS2A 4C7YA 1SUQA 1YG0A 4KV8A 3UPQA 1EQYA 1VRUB 2CFXA 1GX6A 3I55S 4UW2A 4DN9A 2AIRB 2R18A 9ICHA 1FRLA 3CDAA 2JEGA 1JNZB 4JV5J 3C3LA 2QLFB 4FYWB 4X4QA 4QIWF 3A8EA 3C23A 4I27A 4NL9A 1NEEA 1NOZA 2DRBA 1LFWA 3HSZA 3VEYA 4QZHA 4DR3F 2FJ6A 4L3KA 4KHYA 3KXDA 1U0HB 4E1JA 2HMXA 1NDPA 2P51A 1K8KB 1N5QA 4OJGA 2VQFK 1WAJA 4RPZA 4HLBA 4L6V3 5EE9A 4CJ5A 1GEHA 3ZC4A 2KM8B 1ECWA 2E2OA 4IQVA 3A3PB 4XIUA 3MR3A 2D41A 2E5GA 3A8IA 5BREA 2DJWA 4DL2A 3WKCA 3M8PB 3MOZA 3PIPL 4J9MA 1RTHB 1Q7YO 1CLFA 3O08A 4YNQA 2HOFA 1XO1A 2QLBB 2ZFHA 3VAHA 3R6GB 1WC4A 1TL1B 1LQ9A 2GO9A 3NF6A 3TYTA 4C11A 1G15A 3WU2U 5HR7A 1KR4A 2ZIWB 3UMGA 5JMNA 2BM1A 3OR1B 2YKMA 1HW9A 3LDNA 3B4MA 1U1MA 1YJTA 3B6PA 1YRUA 3QFUA 3ZTOA 3K75D 2QA4N 4JI3J 1Y11A 8ICRA 1HLWA 4HI2A 5LJWA 2QLWA 1WBBA 2I0XA 2OANA 3JSMB 3L5KA 2W6LA 3NMAA 8ICKA 4DV0F 5DG7A 4O5CA 4QJVA 1IJFB 4QR2A 2AZ1A 1SI9A 1VHXA 2J0SD 2IC3A 1BE4A 3CJ3A 4YY3K 2DY4A 1RA6A 1W2IA 4KO0B 5DDOC 2FY8A 2DT9A 2YWHA 3SZ2A 2CIMA 1AA1B 1NZ8A 4CHNA 5HN0A 1N48A 3MFIA 5AI6A 2ASYA 2XMMA 1N5WA 2IOFA 3AVKA 5JLFA 3OXLA 2IA0A 4FZXC 4AM7A 5AK6A 3QE9Y 2EFOA 2B0CA 3HYFA 3WZ0A 4NA1A 3D0PA 1Z2ZA 5D0EA 2E1YA 2X78A 3RJEA 4M3TA 5KG7A 2LXUA 5B09A 2QA2A 3UDVA 1ZBFA 3ZT1A 2G8HA 2YB1A 2B6AB 3MWPA 3PYEA 1IKYB 2D74B 2QO3A 4YOXA 4ZP8A 4H54A 4J9VA 2DEIA 2Q66A 4K4UA 3A3NB 5KPTA 2OGUA 4B9QA 1RWVB 4CD3A 4EEYA 4FW2A 1RYRA 1NU0A 2OYYA 2AKWB 1DTQA 3KKRA 1FDAA 3MOJB 1SXDA 4AFFA 3HSGA 2VV5A 2NREA 4IEEA 1TU0B 4OGEA 1TL1A 3GU0A 4KGVB 3HSJA 5FLXU 8ICEA 3A5MC 1UVJA 1ROFA 2RPIA 2QWPA 2BKNA 4O9MA 2CQ4A 1YVUA 1MN8A 5ALQA 4RPXA 1A0OB 3RR7A 4TU7A 2Y1LB 3QAEA 4CEFA 1HNXK 5CYMB 4DG1A 1TKXA 4NYOA 2D0BA 3ETOA 5L38A 1WG4A 5ETTA 3H2VE 2G1DA 3FC9A 2DFEA 5KG2A 1NMEB 3E8OA 1APSA 1ZQZA 3K4GA 3KZIU 4C0OC 4DOCA 3N4WA 4CZIA 4A8MP 2HNZB 3VTHA 3R7NB 2OIHA 3MEDA 4FPBA 1T6CA 2BJ9A 2FD2A 4DOZA 5LSOA 3ZX3A 1PSDA 3RG6A 3G0ZA 2J8SA 3AUOA 5AQNA 4ISFA 1JIHA 3M8QB 4OYZA 1V97A 4G1PA 4PJ0U 1NLKL 4LF6F 3R3TA 2QLTA 3JQJA 5ALKA 4BRIA 1JKHA 1U2VB 5AI0A 5K5MA 4QIWC 2EZYA 3ZSOA 3DXKB 2L5YA 5FLXO 1C0TA 1UL3A 5IXUA 1YX2A 3ADAC 4ECVA 4Z4GA 4Z4HA 2UXBF 4DCPB 1GMWD 1NGAA 1JMSA 3OYGA 1VBXA 4CIEA 1BIZA 1UAWA 1H72C 2ZH1A 2QMWA 3NVWA 1CJUA 1HYSB 3T5HA 2UVUA 4HDHA 5GAHP 4P4PA 2NQPA 2QSFA 1H0HB 1FFUA 5AI4A 3RRKA 3T1HJ 4UOCA 2QL5B 4KBOA 3GR0A 3HHLA 4PHAA 4GO5X 1S6PB 4CTAB 1KVAA 2HBRB 1VDHA 4FJ5A 1KQKA 8ICXA 3UVJB 3F9KA 1Q9YA 5CB1A 4LFCF 4NCGA 2BCUA 4DQIA 2MB0B 3A5LC 3L4PA 1RYUA 2P5VA 4GXIA 1V9OA 4ZPAA 4OPJA 2CQGA 1RDCA 2M52A 3KLIA 4H4MA 3T6BA 4DUYK 3LGMA 4F4KA 3PFOA 5DB9A 4CCHA 3VV2B 3C15A 2RHQB 4YMEA 4P2HA 2UU9K 5MLCV 2MY7A 2UUTA 3FM9A 3MR7A 1TFWA 3ZZUA 1NI3A 3UM9A 1WF2A 3BO3A 1MWYA 3POTA 4E1MA 4C8OA 3VQPA 1PC4A 2V8GA 4DOAA 2A1AA 5F41A 1B64A 1M6YA 3C46A 3V6DA 3H20A 2HNYA 3VGMA 5H9FJ 3BDEA 2IA6A 1U7LA 3N9UC 2JLFA 1Q9XA 2VFTA 1TE2A 1IBLJ 4JWMA 5THWA 1H6KX 5D3GA 3WUHA 3ZNJ1 2AJQA 1YK9A 2K2PA 1FKPA 5B0GA 4KHRA 1MN9A 3HXMA 3GV7B 4ZVGA 4ZIWA 4ECQA 3HD2A 1DURA 3F5TA 3MMAB 4N77A 3Q8UA 1U9LA 1FA0A 4NLKA 1ZQQA 2EBGA 1G1XA 3OTOF 1IBMJ 2PYLA 4X66K 4J2EA 2YWFA 5IZHA 4DV1J 2IJFA 3IAM9 3KBBA 2XZWA 1FFWB 2JC0A 4Y1DA 2VJ5A 3NCRA 2KIWA 7ICQA 4PKDB 2GUPA 3I5CA 4X4UA 4WFAL 1YIJS 3FFKB 3GSIA 4GNIA 2OPPA 2BE2B 3MGIA 4XPCA 4I9LA 3A5NC 4E98A 1YSJA 5EVZA 2HMIA 3DLHA 1M5OC 3ETRA 3JQKA 2QK9A 4MKYA 4C1NK 5E7OB 4LSLB 1FJEB 1ZQTA 5GADP 1X5SA 3C28A 1HBOB 2M7SA 1WNSA 3AARA 1QUPA 5DG9A 4X65J 1WEZA 2HK2A 1Q86O 4ZLJA 1TR0A 2GO8A 3KNGA 2MYFA 1H38A 3IMQJ 2I8EA 4CBWA 4CJ3A 5HI7A 8ICSA 4YVZA 2CJ9A 4DCOB 3ZDEA 3WKEA 4FBUA 5A8RA 4BRKA 2ZIVB 3KKAA 1ZD4A 3P1GA 1HI8A 2FPHX 4CK1A 5ETQA 3THWB 1URJA 4Y2IA 3CJKA 2WB1D 1YAGA 2XNQA 5CEHA 2QT7A 3OR2B 4OHVA 1BC6A 2HMIB 1PC5A 1RHJB 2KK0A 2FF3B 4BRQA 2KVCA 5LMNK 1SV5B 2W7AA 4W5QA 5IC6B 4ZHRA 4KGZB 4A8FA 2H3EB 3SEIA 5A6PA 1P27B 4AL7A 4WZQA 4FXDA 5IIOA 3GPAA 3IMXA 3A4TA 1IV0A 1ZM3A 4WIIA 1E6VB 3DRYA 4E89A 3D2FB 3C5FA 2W9BB 3C6UA 3QO9A 3DOKB 2JSXA 3NGIA 3RB3A 4P2MA 1NDCA 1CJTA 2OEKA 4K7QA 3V9WA 4ICLA 4ZPTR 3WC0A 2R8GA 4CO2A 3FCWA 1Q5YA 4BBYA 3H5SA 5GAGP 3NTUA 4M04A 1L8OA 1RABB 4C4WA 5J0YA 5B0EA 4CLKA 3V5RA 4GVBB 3KJNB 2CPIA 4C4TA 1IBLF 1I39A 4TVAB 2P9IA 2PMZF 2LM1A 5B7WA 4ECYA 4JD2B 5E5NA 2W4PA 3UXPA 2ZTCA 2D3OR 2LBOA 1SXLA 1U6BA 2KG0A 3G10A 1QTNB 2QWOA 4AQYF 2XGPA 3MPUB 4DSEA 4FN5A 3ATVA 2O67A 3MXJA 4WCEL 2V51B 4C8KA 4GXJA 4HTLA 3AJDA 2PI4A 1JLGB 1UAXA 3E0FA 4Q8EA 1TELA 1UETA 5E84A 1RAIB 2CRXA 3AY0A 1L3TA 1BMQB 2P9CA 2ZH4A 3T5JA 4PL7A 3VQ7A 2XMKA 3DWLA 2KSOA 3HZEA 3IGVA 1JN3A 2O8CA 3HK2A 1U02A 3DU6A 4M5DA 4BC4A 2KJ8A 9ICQA 1HNVB 2BM0A 5KPZA 2MLZA 4QPXA 1SWWA 1MROB 4WCEQ 2PKEA 1CLQA 2IAJB 4NLQA 1VQLN 5J29A 4QS9A 4C8YA 1ZQVA 5E3QA 2Q1LA 3DRPB 4NCBA 2UUCF 3H0MB 1VAZA 2IDLA 2BANA 4JNEA 5CXTA 1Y7PA 2MKKA 1Q7YT 1H2VZ 3MM5A 1JLFA 4NM1A 2QWMA 5J0TA 2DNZA 4BE1A 4DFJA 3D45A 4WFYA 3MUTP 3CUNA 2KZMA 2XS2A 2I7PA 3MURP 1I6JA 3C65A 3WIUA 2VQFJ 2H5XA 2E29A 3NF7A 2EFNA 2P6SA 3ET6A 2Z4PA 3KK3A 1XU4A 3MM8A 4DV1F 2NPIA 2NYIA 3J8AA 5KAFU 2DR5A 2H4WB 5ALNA 2OA8A 2C2KB 3PSPA 3BH6B 3RAXA 3B4DA 4PPDA 4KRFA 3KFWX 1OYDA 3MABA 3LPEA 4JV2A 1SV5A 4BHQA 3LP0B 2GZOA 1ESVA 4FYYB 3UN5A 2IYIA 4L8RB 2PN6A 2MSTA 4TXSA 2QFJA 1WJ9A 3ILLA 3DXSX 1W7AA 4C3LA 1UA0A 3C66A 3C5GA 1ASUA 2UYTA 2DVIA 1RACB 2A19A 3ZXWA 5CAAA 3C29A 2F8KA 4AXJA 3LM2A 2RN2A 2RU3A 2DBBA 2KVQE 3QEAZ 4RUCA 3NS1A 4QS8A 3W3DA 4A61A 5DDRC 3QU4A 2JZBA 2EFGA 1M1KO 5D77A 3DLBA 5ALMA 3BEXA 1A7GE 3D0HE 4BDPA 4QZCA 2J9EA 5ADXA 1FTRA 2IS3A 4J9KA 3PIOL 4I1TA 2HWTA 5DKWA 3ZD9A 4ZPWR 4X4SA 1SBRA 3H40A 3PEHA 3NASA 5CQGA 2CDQA 3ITHA 2Z2MA 3LDQA 3R3LA 4WFXA 2CVEA 4F5PA 1IV8A 5DDPC 3MTKA 3DRSA 1ZQMA 1XMQJ 4JEPA 4BGAA 4B9LA 2QC3A 2ZGZA 4YB5A 4AHVA 2Z57B 2LHTA 4EFHA 4WJ3B 1YBUA 5JXSA 3LF0A 4G1QA 3EY1A 2IVOA 1HBOA 1F9EB 4XQ8A 2P9PA 5E26A 2H54B 1M5HA 2O5DA 1FKPB 4Y2PA 3CQYA 5KAIU 1BQNA 5E3PA 3FEZA 2NXJA 1ZQGA 3FMBA 4KLFA 2HZCA 3QUBA 4BXOB 3F2DA 3NE6A 3CCRS 5CZXA 5C2FA 2EKNA 4LF4F 4NA2A 2ZJQL 4B17A 4ZVPB 1N5TA 4NLSA 2MGZA 4JI6K 3VQSA 3KHHA 1S12A 3ZZYA 1RILA 1RBLA 4IKAA 3NF8A 4Z4IA 4DO9A 3QIPA 4DR6F 4RNMA 2DPJA 3NVMA 3KLIB 3DOMA 3RW6A 3G6YA 3P83D 3GFXA 1BA1A 4O5KA 3B9JA 1WSHA 1MDUB 1RPLA 4JI4K 4P73A 2PIIA 4B3TK 4M3YA 3JSMA 2IRYA 3NMUA 1XHXA 4JKDA 3T1YF 1SV0A 4J91A 2Z2LA 1EARA 2QEXN 1WSVA 4CO0A 1UZDA 3NF9A 4WU3A 3O9SA 3BQTA 2HHSA 1URNA 4PABA 4FWSA 1V6HA 2I38A 5IM0B 5KFKA 1E6YB 4LD0A 3PACA 3EXCX 1KFDA 1ZQKA 5KRTA 1EETA 3RSEA 4N8OA 1LWEA 2QIFA 5HJXA 4WQ5A 3L8BA 4FWKA 4GO7X 5DDMA 1UVKA 2HS4A 1SV0C 4CLYA 3AO3A 1J5EF 2ZIXA 3HD1A 1YF5L 4DCJB 2QI2A 4RW4B 3PYFA 3MR2A 2FMPA 2ZE2A 3IRXB 3MUVP 1CJKB 4Y2JA 2HAIA 3BSCA 3O5TB 1S0NA 4JK1A 3HKZF 1RDFA 4PRFA 3NGTA 1UCVA 1UVLA 3B6OA 3T9ZA 2Z56B 3SK3A 1KC8O 1BCMA 2HHHK 1V3SA 3H3OB 2E8PA 3MMJA 1JRPA 5K9FA 4OHZA 4K4HA 4DL0C 2DXEA 2XO7A 4DFMA 1WUAA 4QPTA 3HLUA 5E3RA 5C42A 1ZQHA 2FC8A 4US9A 4W92B 1VQ4N 4J2BA 3HZ6A 4UTGA 4PR6A 3MEGB 1EXNA 5CZVA 2QW9A 5KTQA 2K8CB 4DR4F 1X4HA 1WWVA 2CPEA 4Z4CA 3HW8A 2RD5C 3TEGA 3M6ZA 2E5SA 3VQ5A 3KD1E 4PXBA 2LDYA 4NASA 2OPRA 2RU9A 5D4LA 1OPIA 7ICEA 5AQTA 2CNLB 1S79A 4X4TA 1RM6C 1U24A 5HMWA 5J0SA 2LA6A 1L6NA 4BC2A 1KSPA 3CPWR 4U8VA 3AAPA 2LMIA 1JXBA 3RB6A 4YOUA 4C2MA 1RDBA 4DUTA 2BW2A 2R2RA 3QYPA 1NK7A 1FJGF 4NI2B 4FK2A 1I1GA 3D6FB 4KH4A 2BJDA 4AL6A 4G9BA 4X62J 3W9JA 1FEZA 2EAMA 3GE1A 3VEWA 2R42A 3AA5X 8ICFA 1HX1A 2BPCA 1QAIA 3WNGA 4GV6A 5IV4A 2BGGA 3QLHA 2QYGA 2XYGB 2DY9A 1GO3F 3W9IA 2A42A 3AB4B 3J7A1 1XS9D 2NYVA 4C9DA 2WTUA 2J7KA 3GG0A 3GILA 3BF1A 2J6TA 1KLMB 4MEYA 3ZDAA 2KU7A 3D7SB 1FHTA 2FE9A 4BGDA 5JRTA 2W1BA 1X3NA 5GAEI 4V19S 4I2CA 1Y5LB 5KFEA 1RAFB 3DHWC 2VODA 3J7ZO 3HHLC 1WF0A 1I51B 2OTJS 3H8JA 2YKOA 2DHAA 4W5OA 1UPPA 4CRJA 4CM2A 4NLOA 1ZQJA 2EFPA 4FPRA 4M95A 2XLJA 3JSBA 4N56A 5D0HA 4CZGA 2KHDA 1F3VA 4ZCMA 4JI4F 5DBCA 2VKZG 2XMTA 4I6YA 2H1YA 4K5RA 1F5BA 5BR8K 2OM6A 3QYYA 3MGVA 1N54B 1ZPWX 4Y34A 3UN2A 1MNEA 2PXIA 1NSPA 5AQPA 4M6WB 1FT8A 4Y28C 2JX2A 5MLCQ 4ZOSA 2VJVA 1U2FA 2D3DA 1ZM9A 3CI5A 3D2WA 4E7JA 5HROB 3SCXA 5BR9A 1IM6A 1FJGJ 2BX6A 4CDIA 1GOCA 3CC7N 5KFDA 2L3MA 3ATUA 4MJKA 3G71S 2R7XA 1K8AT 5C24B 3Q22A 2DNYA 1KQSR 3PX0A 2WAQC 1B99A 4O8UA 5ALXA 1R89A 1JLBB 2FVQA 3HP9A 2B9XA 2MAXA 3QMLA 3AVLA 2CJKA 3RRGA 1T05B 4JI7J 4DHYA 4J37A 5E41A 3PSFA 3ETMA 3I0SA 2B4JA 2HHHJ 1UPMB 3SNNA 4RL1A 1EIYB 3NVKA 4ZCIA 4CH7A 1KKHA 4TU8A 3WEEA 1RAGB 1NGJA 2J6UA 2VA3A 3FFIB 2I5JA 3CJAA 5AQFA 5KGXA 3UNYA 5DLFA 3HF5A 3EZUA 4CZHA 2RDIA 2LP4A 2YJFA 2IRXA 3UKUB 3DDIA 5EGYA 5TISU 1T05A 4M6WA 5KT7A 2WAQD 2ABYA 3OS1A 1QAJA 4UY85 1ZXIA 3K5OA 2IIRA 4C8NA 4YR3A 4NXMJ 4IOXA 2KIVA 1SB3C 2HOIA 5DO2A 1FXRA 1RWWB 4LZDA 4ZP7A 3R5DA 1CJVA 4ELVA 4DR3K 4EU0A 3JAMU 1NAQA 3AO5A 4O8KA 3SBMA 4RG8A 4EX7A 5SZTA 4X84A 3O9QA 1SH0A 4LF9J 2UXDK 1NOYA 2HFOA 2LU2A 4KB0A 4ZTFA 5HVHA 3EMTA 3QNNA 1MQ3A 4EHUA 4OD0A 3L2WA 3POTB 3VAGA 4PEOA 4ILMA 2X6NA 1W7WA 5AQQA 3SDEA 1RT3B 1M1HA 2ZM6K 2QB1A 4DL6A 3CIZA 2ZBIA 4C80A 3OL8A 4RBTA 1M5SA 1KFTA 1T9VA 3BN7A 4F50A 4M8LA 3IRUA 4JHDA 3CCJS 5K20B 2QKKA 4USKA 3CT9A 3OBIA 4USTA 3HHDA 3NRWA 3A2FA 3IRWP 4A62A 1RQNA 2C2NA 4NE9C 4CO5A 3WIVA 2Y1IA 1TVRA 2BABA 3SFGA 1FD2A 4LRCA 3KIOA 1N5YA 3BO2A 3EVOA 4KKOA 4KREA 5E79U 4ANDA 2OEMA 5B0DA 1RHUB 2PO4A 3NY0A 4MTPA 3HFVA 8ICJA 3TUPA 3RMAA 4QZGA 2JFDA 4NY8A 2EZXA 2GNKA 2AF6A 1L3KA 3CE8A 4I6MB 1ITGA 4UBCA 1IO2A 4U9RA 1WI8A 2E1PA 2LKZA 2VICA 5AIAA 1UEKA 3S1TA 1OW5A 3KDNA 3OUYB 3LW5C 4U8YA 4UAVA 4P2XA 3DAWA 2LSNA 3TSPA 4KI4A 1VHFA 4TY9A 1RADB 2AEJA 2FBXA 4AYBD 2GC8A 1Y00A 4P6QA 1FRXA 3OBYA 2WFAA 4K0KF 4E2FB 1KBUA 3KHYA 2RRNA 4LF5K 4ER8A 5ALIA 1GFWB 4DTMA 1WNEA 9ICMA 4E7KA 5HJYA 4CHYA 3VC8A 1KDNA 1KS2A 3VEXA 5KQDA 2YX7A 1Y0HA 3J80O 2A5XA 4A8WA 2OO4A 3E9LA 2XI3A 2KFYA 2ODGA 4ZOHC 3NGUA 3ZTRA 3KOAA 2A18A 4B3TJ 4TY8A 2AT1B 5M2RA 2R7UA 1WOOA 4DV2J 5KT5A 1PYOB 5LJ3Y 3I9ZA 3I82A 3IM1A 4O3NA 4E0DA 3TACB 3MAAA 4YUDA 2ZIVA 4JI1K 1U4BA 3A5OC 3HX9A 3QAUA 1JLBA 3NG8A 1ZQNA 1X4GA 3IC1A 4DWIA 3ZETA 5A6WA 1N34K 2E7VA 1CSJA 4OZNA 2EWHA 1B4SA 3CDBA 3ISND 4ZVOB 3ZEUA 3TZZA 2UU9F 3M6XA 5EN1A 3CD6N 3L7OA 1BI4A 3U02A 4FVMA 3NCPA 2V52B 1Q79A 3BBCA 3KMQA 9ICPA 4PHDA 2HBQB 1ZQPA 2MKYA 5JUMA 3AQOA 4CLPA 3MF5A 4XEIA 4L3QA 2UU9J 5KG5A 4TU9A 3S6EA 4XUSA 1E4FT 1HUOA 4CD1A 4GV9A 3DXMA 3ZZRA 3MCMA 3MMAA 4A2AA 3PUFA 2JC1A 4FWPA 3TTFA 4OKEA 2Y9UA 3RH5A 5ALRA 2CADA 4H5NA 4PGYA 2ALYB 2XICA 4B1YB 1RWNB 4ZP9A 1NPRA 2FJDB 3CIPA 3KJQB 3SIPB 3FSYA 2C2RA 3SLCA 3L2VA 5AK5A 2DUYA 5J0UA 2D6FC 5EY4A 4R66A 5H9EK 2YMPA 4RZRA 3MPWA 1VK0A 2J9DE 2O4IA 1MLAA 5B8HA 2GLEA 3AH6A 3R5BA 4CGFA 1NBWA 1SIWB 1V85A 3CCRN 2V34A 3AU2A 2DEJA 3Q2TC 1VQSA 3RJIA 1Z1VA 4RBVA 1WLJA 3DRRB 4Y2XA 2GIFA 4MN4C 4ERDA 3A13A 2HQCA 5TKWA 4IFVA 3EEQA 4KLGA 2MGZB 1JK9B 2WVCA 2JZ5A 3GTYX 2CGJA 2G8FA 4M41A 4PWDA 2FZCB 4CNYA 3HJEA 1KAXA 3GFKB 4HL9A 2YCHA 1FERA 2BBEA 4NXZA 4FLVA 4C97A 3C0BA 1K44A 1FE0A 4JI2F 4OJRA 5ALPA 4S0MA 5CA5A 2JWKA 4QZEA 2BJ3A 1EKRA 1I94J 4Z7YA 1BI4B 5G0RA 3MR6A 4RCHA 1VDVA 2CVIA 3SUNA 4NLCA 3AVNA 1NM2A 1VQYA 2G08A 3TA2A 4KC5A 5JVGL 4H0XB 4MHVA 4BREA 3V81B 2AJ1A 4DSJA 3QMQA 3B0YA 4URQU 4USUA 2E3TA 2ZH8A 5AM1A 2HQDA 1PJ6A 1U1NA 2LDIA 2PFPA 1C1BA 4YDUC 2V2KA 4UB1A 2HQ3A 3TRGA 4I67A 3ILOA 4CO3A 1PG5B 4N76A 3FQKA 5AE2A 1M5PC 3BGUA 3R8EA 3AQPA 4LRDA 1KVCA 5C42B 4GIBA 1Y3KA 2EKYA 3MCAB 3CDWA 5ALGA 3SQOP 3I87A 3CETA 1F5SA 1L3VA 4IDHA 1GOAA 1UWAA 3CCTA 4CIFA 1DK3A 4LH4A 1ZQBA 3AMZA 3QUTA 3A12A 1ZD5A 3DC2A 2HNZA 1WTFA 1S9EA 2CJAA 3H90A 5AQXA 3AA3A 4DV3F 3H59A 2BGWA 3M8ZA 2Z8QA 2DGTA 1NHKL 1JXVA 4OZ0A 2CA9A 4B3RJ 4IOBA 1BQMA 2YTCA 1MWKA 2F44A 3J7Z5 1DY3A 3W2VB 4IG0B 4ED1A 2GGPA 2UUWA 1JJ4A 7ICMA 3HMJG 2OZMA 5F8IA 4RUBA 2G8WA 2DHSA 2ZJ5A 4BCAA 2Z1HA 2P6TA 3K5PA 1DARA 5F8NA 2BJ8A 1TKTB 1P9YA 2PE8A 2NS1B 2HLTA 4O55A 4QR0A 1RBTA 1FK9A 2QE5A 4X66J 4I2HA 3D1OA 2YXLA 1OO0B 3JAMO 1HKBA 1Q8IA 4USMA 1XWLA 3QJLA 1DOQA 1ZD2P 3IV6A 2XS5A 4Q2MA 3Q8VA 2NZCA 2E2NA 4TUSA 1JLAB 2VQEK 4EBEA 5GAEP 4DV0K 2NNWA 4DTRA 3UR0A 5HANA 2QSWA 3VGVA 4OX7A 3OYFA 1UZHA 2NR0A 3QGGA 1U8WA 3MM5B 3WQTA 2B0GA 5H9FK 4GVLA 5G5GA 2HCFA 2ACMA 5AQZA 3SV4A 3C2KA 1UTAA 2RJZA 1GXLA 1EAYC 2L9NA 5CHCB 1N5VA 3UIQA 3VA3A 3ONQA 4MO4A 2M9NA 1YJ9S 2UVVA 2V7YA 3NGRA 4PWDB 3HZGA 3WBZA 1Q18A 2G4BA 3FQLA 5HMZA 3RW7A 4IFVB 2WC9A 3M30B 4D3HA 3KLHB 5FRMA 3R2CJ 4DV4F 1KFSA 3AVJA 2JHEA 2QYCA 5U47A 2CNKB 2AQ4A 3E01B 4TLQA 1RT3A 4RNHA 4YY3F 1G3OA 5KFOA 4X65K 3UFCX 3MD1A 2E8NA 1JCEA 3VF0B 5IOLA 2CZ9A 2V8DA 3OL6A 2LYVA 2J0XA 3UKRA 3TARA 1Z4OA 3VF6A 2YKMB 3DRXA 2QB0A 3AGKA 2GHPA 4KMOB 4OI2A 3FE1A 1P9QC 4FO6A 1N34J 4Q45A 4O5EA 1X5PA 2ZQBA 2UXDJ 1SL2A 1Q8LA 4U7UK 1N8RT 4HCCA 2EBEA 1IBMK 1FXXA 3MUMP 3N4QA 2NRWA 4FJNA 2KHCA 3T6JA 4CJRA 2MUTA 4DUZF 1HR0K 3E1YA 1NK4A 4DN0A 2ZKTA 3DOKA 4OYXA 2BV3A 3M1VA 2ROPA 1HD0A 2GX9A 3FJ2A 4LFBK 2G0AA 4JI8K 2HGMA 3Q7CA 4FJXA 4IQMA 3GG4A 2ZBRA 4ZIVA 3K59A 2ZJPL 1M5VC 1CZAN 3K5NA 3RBZA 4EUVA 4LFBF 3I8DA 4LIWA 1VQKS 3PR4A 2EG2A 1S1UA 2BH1A 2VPYB 4PH5A 3KK1B 1N6QB 2ZNZA 3KG4A 3UXOA 4EZ9A 4I2PB 2XB2D 1QS4A 5AFUH 1GMWA 2O8EA 3M8PA 4FK0A 1RCXB 4PQAA 2Y0SF 1ZTTA 4QZAA 3Q8MA 5CA7A 1NPKA 2RQ5A 1S97A 4P7TA 2YJEA 3NBPB 2VDIA 4B1XB 2DKXA 4M5IA 2E88A 3I8BA 4FK4A 4QW9A 1N0UA 1S7IA 4Q0BA 1IIPA 2GV1A 3O0FA 2WTFA 2RF2B 1HBNA 1ZM2A 5GVQA 5TZVA 4NRTA 3GFZA 2DH8A 1RQLA 4YR2A 3CCWA 1ZQOA 3LDOA 5D3GB 1A5VA 2ILYA 2VYPA 2W8KA 4IDKB 4ZITA 4IOCL 2ZH2A 2FJBB 5J1EA 1TKZB 1NNDA 3T1HK 3G25A 2VG5A 5E3CA 4J90A 4OI3A 2ZVSA 2M88A 4KV8B 3KG0A 2R2UA 4WFNL 1XIQA 2GVZA 3QGHA 2RHKA 5KFSA 4O5BA 4E3SA 1RAJA 2NZ4A 3EUNA 1ZQXA 1X0PA 1WC1A 2K4HA 1KRPA 2H3GX 3PSIA 3PJ9A 4MYUA 2MQQA 1RT7B 2KRBA 2KNJA 3N4PA 1KVIA 2RS2A 1S1XA 4DB3A 3OJSA 1YTAA 4ZVQB 3S8SA 5LMNF 1SL0A 3V6JA 2AWZA 2YKNB 2RE1A 2HRYA 1BWFO 3PSTA 1SZ2A 1O0PA 3J7ZT 1ZTWA 4GMJB 4NJ8A 1NUEA 4LF7F 4WQ5C 1CG2A 1KAYA 4KLEA 2FJAB 1O1WA 1KVBA 1Q3VA 3D68A 1AB8A 2VFUA 4JLHA 1NB7A 5CZ2A 2UUCK 3RJKA 2HW3A 3QFHA 2O8CB 2LQ5A 5AR0A 1R8PA 1JLCA 3TPQA 4EX6A 1WDTA 2VANA 3M8SA 3IFEA 5LSRA 4YFKA 3HJFA 1UWBA 4OX6A 1E3MA 2FZKB 4KHPF 3BGFA 2DPNA 2JWLA 4WP9A 1N88A 3VAIA 3SPYA 2ISOA 2DNNA 1VSFA 5KT2A 1CQNA 1MW7A 2QMUB 5J0WA 4XRHA 3HVTB 2FVRA 1GXUA 3NS6A 3CCLS 4E7IA 1QE1A 3H4DA 5KT6A 4FVCA 2ATLA 3RJMB 3S9HA 4FKYA 1SQFA 2F1IA 3K7RA 2BA9A 3DXKA 5KFYA 4JD2A 2PMHA 1IKVA 3LWLA 1SXEA 2PT0A 3SD7A 2DCUB 3WHIA 2HBMA 3AVIA 3M6KA 4DV6J 5EDWA 5M1PA 4HTJA 2EX3A 1OWXA 1ZOLA 4ITSA 4UF4A 2FC9A 1NMNA 3M1YA 2V4QA 1NOMA 4Z2XA 4OJ6A 3H8MA 7ICOA 4KTQA 3OYDA 5CZ1A 3ZLJA 2HKEA 3OR2A 1X5TA 1NWKA 5H2FU 4LF8F 3VESA 3G8SA 2BCRA 3KJVA 1JLQA 1SJ1A 1TP7A 4I2QA 4CT8A 1S99A 2DRAA 4WIQA 3O9UA 3AVFA 3CXCM 3LP3A 4ZK7M 2FTRA 5AXLA 3P3DA 2VFVA 5HRRA 4U95A 1U2VA 7ICIA 5ALHA 1TMMA 4FJGA 4OPAA 2O8EB 1BIUA 1D8ZA 3H6EA 3PW4A 4DR1F 1VBYA 1WSRA 4BRNA 4Z6EA 4OJPA 3UQSA 4PY5A 5A0YA 4HI1A 3R5CA 4LRAA 1RCOB 1P7DA 3O2IA 2DYAA 4CI6A 1UT8A 1OY9A 3C21A 2V8HA 3C6HA 4B1UB 1VQ6S 3WK5A 3AA8A 4HT7A 3JPQA 5IIMA 3KK7A 4NXMK 2ZJ8A 3OYLA 3QJJA 2MLXA 2CZVC 1O8BA 2YKQA 3FEYB 3SR6A 2ZTDA 1BXNA 4AL5A 4A8KA 2UUBJ 4GY2B 4CFAA 4B9VA 5AQSA 4U7UD 3WQUA 1H98A 3JS9A 3N4MB 4DU4A 4Q8FA 1V5IB 1HBUA 5LMUJ 5LOQA 5IM0A 4DTSA 1RTDB 3TAGA 4RUAA 3GU3A 1NB2A 2E44A 2HPUA 5ALUA 4NZ7A 1JROA 2QLJB 2H5IB 3ZFVA 3CCVN 1LWFA 1OY8A 1VCTA 3H46O 4UT4A 3QBXA 3TQEA 1R3NA 4ID1A 2O8FB 1RT4B 4AQYK 1S6OA 4BRMA 3FUYA 5ETOA 5KG3A 4A8EA 3UQ0A 4CH1A 1VBZA 2GMHA 2PMZC 3ZCMA 4HHTA 3WXKA 3VPZA 2EG1A 3CCQN 3QIPB 1TV6B 3CQ8A 2MSNA 1WF1A 1SJ4P 4NXNK 1FIQA 1L3SA 3QB0A 4FJ9A 4NA3A 2VQFF