2XY5A

Crystal structure of an artificial salen-copper basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
581
structure length
581
Chain Sequence
b'AAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy5A01
4FZXC 4RPXA 5J0TA 3LP0A 2ITGA 4I2EA 2PFPA 3FYHA 4EZ9A 5FROA 4OLAA 5KRTA 3U6FA 1HYZA 4YN4A 3TQ1A 1QSLA 1ZQXA 5KT4A 3SYZA 4IBNA 3OS2A 3RR7A 4F2RA 1Z00B 2ZUDA 3ISNC 4OKEA 4FJ9A 3AVIA 3TI0A 4KLOA 4CE9A 3LZJA 3TFRA 4AHUA 4W5RA 1T8EA 2W9BB 3IG1A 3IRXA 3VN5A 1SL0A 4P4MA 5KFDA 1EXNA 1UT5A 3KK2A 3M9MB 1UA1A 4J2EA 2JZBA 4KLEA 3ISBA 4F4XA 1U45A 3NH0A 4ZHRA 3BJYA 1K1QA 5J0YA 3JPPA 4CJ4A 2R8GA 3WNGA 4KLSA 1VSDA 8ICGA 3RB4A 3VA3A 1KTQA 3AVNA 4QAGA 4FJNA 2V9WA 4FW1A 2AJQA 3WNFA 4I7FA 3ZDEA 4I28A 4TUSA 1XSPA 4B9TA 1ZQYA 4DTSA 4UAWA 2DFFA 4HTUA 4KLIA 1QHTA 4ED2A 1WNSA 2W9CB 3KKRA 4FK2A 1ZQVA 3PO4A 3DRSA 4M2YA 3LAMA 4DF8A 2PI4A 4EBEA 3T5JA 5D46A 2UVRA 4PWDA 4RQ5A 5KFZA 4YFKA 4DQQA 2BCRA 3LPTA 3HL8A 1S9FA 3GIMA 4EYIB 3AV9A 4F3TA 2ASDA 4B08A 2XCAA 2BCSA 4RW9A 3AVHA 1TK5A 3OHAA 8ICJA 2B6AA 3G0ZA 4X5VA 1IM4A 3NDKA 1B43A 8ICBA 2WONA 5IILA 1D5AA 1LW2A 1WSFA 1DTTA 1T03A 1UA0A 3NGIA 4DFPA 3AU2A 5DLFA 4BDPA 1TV6A 2ZTCA 1T7PA 1HYSA 3RJEA 1N5YA 1XSLA 3LDAA 1VSMA 3G6YA 1JLAA 4RQ8A 1RBUA 3SUNA 1F21A 3ZT0A 9ICRA 2IOCA 3QEWA 3RBEA 1U4BA 1J9AA 4YD2A 1KVCA 3KHRA 4DS4A 4RU9A 1VSHA 1G15A 2BE2A 2WOMA 5DB6A 1S10A 4OGCA 4O3QA 2J6SA 2HHQA 4RNOA 2AGPA 3H08A 2O4GA 3QNOA 3Q8MA 2YV0X 3MR5A 3V1OA 1A76A 1RYSA 2NRXA 5J2PA 1HPZA 1RBVA 4H4MA 3B0XA 5EWEA 5KG1A 2B21A 3B6OA 2VG5A 5DBAA 1S1VA 1SV5A 4CFCA 2A1JB 4DTOA 3V6HA 5CP2A 5HRPA 4DQSA 2Z1GA 1YTUA 3C6TA 4AHCA 4Y1CA 3K2PA 1AROP 3DLKA 1JLQA 3KIOA 3IHQB 1EX4A 2XO7A 3AU6A 1BI4A 2Z1JA 1NKBA 3C6UA 3PY8A 1BQMA 4YNQA 3S3OA 5CZ1A 4E7JA 4F5QA 1RT1A 4RW6A 3H8WA 4CHQA 3V9ZA 4ID1A 1WSGA 1UAXA 2C2EA 1IKVA 1YVUA 2BPFA 3OYCA 1SKWA 1J53A 3ZSOA 5J2BA 4M3ZA 3ITHA 4CJVA 4B9MA 4ECZA 1A77A 4RT3A 1TKXA 9ICAA 4YMMA 3M9OB 4W5NA 4LZDA 4DU4A 3VQBA 4FLUA 4YXJA 1NOYA 5TZVA 2NUBA 4O5KA 3FDSA 4UBCA 5DG9A 3QERA 4Q0BA 3NFAA 3V1QA 3DI6A 1T05A 2BPGA 3KTQA 3VQEA 4JLHA 3KHGA 2HNYA 7ICTA 4FZYA 4RQ2A 5KFPA 3Q8QB 2C22A 1KFSA 4MF8A 4I27A 9ICFA 3MR3A 3P5JA 4Z6EA 5HHIA 1NK9A 3UIQA 4XIUA 2KW4A 1KFDA 1LB2B 4N5SA 4HCCA 1GOAA 5KFKA 1K1SA 4CFAA 2H5XA 1SUQA 1KLNA 2YNIA 3CM5A 2F8SA 2ISOA 3AVJA 3HO1A 2BCUA 3OYKA 9ICOA 3RR8A 3ZSQA 3PW4A 4I2JA 4LY7A 3AA2A 4RUAA 3O4NA 3ZD9A 1KRPA 4Q43A 3K5LA 2IBKA 3VQQA 2FLPA 4E1MA 7ICSA 5DGAA 3RB0A 4FJIA 2M9NA 4CJPA 2ZTEA 4PHDA 4PGXA 2JZBB 3T5KA 4M0AA 2VA3A 4CEEA 1D8LA 3DLHA 2HMIA 8ICOA 2E6LA 3ZDCA 4YXMA 3GFKB 3CQ8A 2PFQA 4PA1A 3AVCA 4BWMA 3NGDA 2BPCA 1WN7A 5KG7A 2VA8A 1NOZA 4F91B 4JWNA 3HVRA 3OYLA 3MDAA 4J2AA 4Z4CA 2OPRA 5DQHA 1BPDA 4CJLA 4BXOA 3F9KA 4M45A 1TAUA 4CK1A 5D3GA 4FBTA 3ZDDA 4MFBA 3AA3A 3OVNA 4XQ8A 5FDLA 3SV3A 2UVWA 1WAJA 4E1NA 5K14A 4ZTJA 1ZQKA 3BQ2A 2DPJA 1S5JA 1QS4A 9ICWA 4QWAA 7ICUA 4HVJA 2XHBA 3AVGA 4DSLA 4K8ZA 8ICMA 4RG8A 5DG8A 3SPYA 3Q8RB 3EYZA 3L2UA 4KI6A 3GQCA 4EBCA 4J9QA 4QZAA 4DL4A 4OGEA 3NBPA 4C8NA 5D4BA 5CB1A 5KG2A 5HNKA 4KTZA 3PW5A 4BACA 2YNHA 3HSTB 8ICUA 1RT3A 3KK1A 4DSKA 3KD5E 1R0AA 4JV2A 2P51A 3DRRA 1WSHA 9ICJA 3C2KA 2RN2A 3QNNA 4N56A 4OLBA 5F9NA 5HP1A 3OJSA 1EETA 3L8BA 1VSFA 2I9GA 2IA6A 4KLUA 4ELUA 1BCOA 5BOMA 1RTIA 4YR3A 1CLQA 1B9FA 4FM2A 4PH5A 4DL3A 4B8AB 2HNZA 4ED7A 1U48A 3BDPA 3NTUA 2VG6A 3O3HA 5KFJA 5KI6A 1L3TA 5KFIA 3SZ2A 2VG7A 4HUFA 1ZQRA 5DBBA 5DBCA 2OPPA 4WE1A 4CEQA 1N6QA 4B9LA 4UB4A 2ZJAA 5DGBA 3EY1A 4GLXA 3ZT2A 1TVAA 3JSMA 3V6JA 2C2RA 2BCVA 2RDIA 3L3VA 2XY7A 5C5JA 2F8TA 3E2EA 3GIJA 1KLMA 2X74A 2BQUA 3AVMA 4M9NA 4FCYA 1BI4B 2P6RA 3GV5B 4AHVA 2I5JA 2HHSA 4JWMA 4FM0A 5DQIA 4TURA 3RH6A 1CEZA 2Z1HA 4ED3A 1NOMA 3PX4A 8ICXA 3C1YA 4ED6A 1A5XA 2EHGA 1PZNA 3ZSYA 1ITGA 2ZUCA 1FKPA 2YHAA 2EX3A 4NXZA 5D49A 5HRNA 3G10A 2VANA 1SKSA 1HQUA 3DLGA 3U3YA 5KFYA 1J54A 4RQ4A 4CK2A 5KRSA 3QEVA 3LK9A 2PFOA 5J2GA 1RYRA 1GOCA 2GUIA 1JMSA 1NKCA 3V72A 4JV0A 1U49A 5J2QA 4LD0A 4QZGA 1RXVA 3ALYA 4QZ9A 3ZSXA 2OZMA 4QZ8A 5E41A 3KKSA 4PUOA 7ICFA 1KCFA 1S97A 4CCHA 5HLFA 3ULDA 5KFCA 1IXRA 8ICWA 4JRPA 2PYJA 4B9UA 8ICFA 2HNDA 3PUFA 5KFQA 3LANA 3HX0A 2LYHA 3PX0A 4AHSA 4KLMA 8ICCA 2VWKA 5KG5A 1ZQNA 5SZTA 1ZBUA 3UXPA 3SUOA 4P4OA 4RNMA 3V9WA 3P83D 1WAFA 4CF8A 3S3NA 5DB8A 3MGHA 2ALZA 1JN3A 3M8QA 4QWDA 3CFOA 2BKEA 1S0NA 3RJGA 1BPZA 3MBYA 2J6UA 1ZQEA 5KGWA 2JEIA 4CHZA 1A5VA 5KGXA 5CA7A 5KFMA 3MABA 8ICHA 8ICKA 3I0SA 5IIJA 3N4MB 7ICHA 4CHYA 4R8UA 4UB3A 3H4DA 1BVSA 4F5NA 1XU4A 4DQRA 7ICQA 5J0UA 3JPOA 4KLGA 3GV7B 3V6KA 5CWRA 2ETJA 8ICLA 4DL6A 1WSIA 4FLTA 4DOAA 4CJRA 3RBDA 2IGIA 4CJEA 3CG7A 4O0IA 4CGIA 4RUCA 3NGZA 4CECA 4P2HA 3ZD8A 2G8IA 4Z4GA 3VQ5A 3S9HA 3OYJA 3L2VA 3QZ8A 2MUTA 4Z6DA 5IIKA 3SQ1A 3DLEA 5J29A 4RW4A 3KLIA 3VQ6A 4DU1A 8ICAA 2GV9A 1B9DA 3SQ4A 5DK5A 1ZQUA 1FKOA 4CF0A 3MXMA 2G8UA 1I3AA 4FJ7A 4F2SA 4IFVA 4RQ3A 7ICLA 4FLWA 4QWEA 3TAMA 3VQDA 2HVIA 4Y1DA 1BHLA 4FW2A 1IO2A 1ZBFA 9ICIA 2HHXA 5HRRA 4M9HA 1FK9A 4QW9A 2BQRA 2IC3A 4M6WA 2ATLA 4FLVA 4ECWA 4KPYA 3VA0A 1X1PA 3OYNA 1ZQGA 1JLBA 1LWFA 2Z1IA 3OYAA 4BDZA 3QO9A 5DG7A 4IRDA 1Z26A 4IDKA 4CF1A 2YKNA 1BQNA 4KLFA 4J9SA 2KN7A 2BGWA 4E89A 3HW8A 3KLHA 3DOKA 2XRIA 3H8SA 3JPQA 3M8RA 2XGPA 3OS0A 5L9XA 2D0BA 3C5FA 2D0AA 4CK3A 5J2FA 1JXBA 4RQ1A 1C7YA 4CGHA 4I2BA 3QEIA 3Q8LA 1XO1A 1SKRA 2B4JA 2JEGA 1ZQLA 1TKDA 7ICVA 4AH9A 2FC0A 3CM6A 3TWHA 3SI8A 3D0PA 4DSEA 4UB2A 5KFEA 7ICPA 4Z4EA 1QQCA 4CGFA 2J6TA 5J2HA 1ZQWA 3QEBZ 3L2RA 5KG4A 3HYFA 4DTMA 4K8XA 5KT3A 4J9KA 3SV4A 3OHBA 4KTQA 5KFSA 3DM2A 4XUSA 1RDAA 3QESA 4F4KA 4I9LA 4KV8A 5KFGA 7ICNA 2GBZA 2JEFA 4CGGA 4KITB 3HPOA 3M8PA 3ZT1A 5EU7A 4I2IA 4M41A 4UB1A 3ISCA 9ICQA 4QW8A 8ICRA 3LZIA 3LWMA 2FBTA 4KHUA 3H7IA 3PW0A 1ZQOA 4ELTA 1W0HA 5KFUA 5KFTA 9ICBA 4M3RA 1C0TA 2IHMA 3C21A 1HNVA 3PR4A 2V4QA 1TVRA 5J2AA 9ICLA 4MEYA 5KFBA 1ASVA 4ID5A 4NM1A 4DLGA 4KB1A 4UQGA 4FK0A 4F93B 4YQWA 2Y1IA 3TAGA 3QEPA 4UAYA 4JRQA 1MSWD 3JPSA 4O5EA 3TFSA 1Q9XA 3RMCA 4I2QA 5KT2A 3KD1E 5J2NA 1L5UA 3AUOA 2F96A 5DB7A 1L3SA 2JEJA 1CZBA 5KG3A 4M9JA 4KLDA 5KFNA 2HW3A 1S0MA 5KFFA 4R64A 3NH1A 2YKMA 1WCNA 4KRFA 3HXMA 3UQ0A 1NK0A 4CIGA 2W42A 4NLNA 2ZTDA 3QETA 5JS2A 2R7YA 4O44A 4NLKA 5F9LA 5KFLA 1A5WA 4I2GA 2VWJA 4EP5A 4RZRA 1W9HA 4N41A 3Q8KA 3ETLA 1TK0A 1WSJA 2QXFA 9ICXA 2G8KA 4ZTFA 4OKKA 2WTFA 3IM1A 1U9LA 1JL1A 4AHTA 4L8RB 3C95A 4MQ3A 2BQ3A 4FJGA 1NJXA 2D5RA 5L1KA 3H8JA 1T3NA 3IAYA 3SNNA 1REVA 3DLBA 1LW0A 5JUMA 4QZEA 4CJFA 5KFXA 3OYHA 3PMNA 3OYIA 1S76D 4DU3A 4RPZA 3JPTA 1LAVA 8ICSA 4NCAA 1ZQQA 8ICTA 3HWTA 1S6PA 4TUPA 4GC6A 3T19A 4IR9A 2XY8A 4DS5A 5KG0A 1XHZA 1DTQA 5CJ7A 4RT2A 1S1XA 3WNEA 1JXLA 3ZDAA 2F1JA 3HP6A 3PX6A 4FXDA 1TGOA 4FVMA 5JS1A 1HMVA 4ECUA 2ZUBA 1VSKA 4YCXA 2MUTB 4Q8FA 3RJIA 3K59A 4KHQA 2IAJA 2PFNA 1LAWA 5J0QA 3TAPA 1FXXA 7ICKA 4YP3A 4HYKA 4O3PA 4BWJA 1RNHA 3T1AA 4CGJA 4LH4A 1ZQPA 1Z00A 3OYFA 2ATQA 3MFIA 5HBMA 1LWEA 3GV8B 4ICLA 4XRHA 4IG3A 4DSIA 3LP3A 4MFCA 2A1SA 2XC9A 2W9BA 2IDOA 1C1AA 7ICEA 1QLNA 1IKWA 4GXKA 4CFDA 5KFOA 4M6WB 4KREA 3V7JA 4ECSA 2ZQBA 4M3YA 4Z4FA 3ASMA 1RDBA 1JLCA 3O4QA 5L1IA 1U47A 4NY8A 4F4YA 3ZSRA 4CJWA 4BGDA 3H40A 4EBDA 4DTNA 3AO4A 3VQ4A 4P4PA 3NE6A 3HVTA 1VSLA 8ICQA 1RDDA 9ICPA 3MEGA 4DSJA 1JLEA 1VRTA 5J1EA 1QSYA 5EOZA 1RXWA 2NRTA 5CR0A 3AVAA 4ECQA 2V4RA 3JPNA 1S9GA 2RDJA 4Z6CA 4Q44A 4CEFA 3T5HA 2DTUA 2W9CA 4LZGA 2XY5A 3QIPA 2A1RA 1D8YA 2AGQA 3AO2A 4DWIA 1T4GA 2AQ0A 4CJ3A 3KLGA 3PO5A 2BCQA 4O55A 3ORYA 5IIMA 4JS5A 5KT7A 2DY4A 4GXIA 2HB5A 2FPKA 4I9QA 4I2DA 1JX4A 1RDCA 4W5TA 2ZJ8A 4NCGA 1CUKA 2X78A 1RTJA 3SQ0A 3MR6A 4O3RA 1BGXT 3ZT3A 4RNNA 5CYQA 5J0PA 5CZ2A 9ICHA 1ZETA 3P1GA 2BR0A 1I39A 3RTVA 2X6NA 3LDSA 3KJVA 3K57A 4MEXA 1BPXA 1QSSA 4NLGA 3BGRA 4FJ5A 1WCLA 4QZHA 1HYVA 4FLXA 4FJLA 3GILA 3ZSWA 4KFBA 4TUQA 3TR8A 4TQSA 1QTMA 1IH7A 4J9NA 2RKIA 3AVLA 3RWUA 4IKFA 4QZDA 1HNIA 4CJQA 1KVBA 3WNHA 5HRSA 1ZBIA 5J2DA 4MFAA 4DTXA 4UBBA 4UAZA 4DF4A 2KTQA 4E7IA 1KDHA 4O9MA 4E7LA 2P5OA 1NKEA 1RT6A 4EP4A 1COOA 4PHEA 5J2JA 2PI5A 4DTJA 4B8CA 1EXQA 4W5OA 1ZQSA 2XGQA 4DSFA 4YFUA 4DEZA 3KHHA 1RPLA 4M9LA 1KVAA 4BE0A 4ZH4A 3RH4A 1RTHA 3SJJA 2A1JA 3B0YA 3VQ7A 3EZ5A 1VSJA 3TAFA 9ICEA 1WSEA 3C5GA 4Z0UA 3MEDA 2OPQA 4CF9A 3QE9Y 4NCBA 4F92B 2AQ4A 3MXJA 3K4GA 1VK0A 1JLGA 4DTRA 1S0OA 4KHNA 3M8SA 1B22A 3PW7A 4NM2A 1MQ3A 1WLJA 1XI1A 2IHNA 2FPMA 4KLQA 4LSLA 3PW2A 3BQTA 5I42A 2W9AA 4J9RA 9ICMA 1BISA 2OYQA 5J2IA 2QKBA 5BOLA 2DFEA 4M3UA 1U04A 5HMMA 1BPYA 1N48A 3C2MA 9ICNA 3GIKA 3RB6A 3QEAZ 3VQAA 3K75D 3ZSVA 4QZCA 3AVBA 4E7HA 1H38A 4J9MA 4UB5A 1CXUA 1ZJNA 3A2FA 3ZT4A 3DOLA 4FS2A 3E01A 2BHNA 2DPIA 5CY4A 4FJKA 4M9GA 4GVMA 3K5OA 1TK8A 4CERA 3HM9A 4C8KA 2YNFA 1D9FA 3SI6A 4F5PA 1RBTA 2ISPA 2DFHA 1RCHA 3LPUA 4F8RA 4M47A 4FLZA 1ZBHA 5DLGA 3M9NB 4F5RA 4O5BA 3SPZA 2NRWA 8ICNA 4DOCA 3ZDBA 1GOBA 2ZD1A 4PHPA 3RAQA 9ICSA 1S1TA 5DB9A 1XC9A 4YD1A 4CJ5A 3AO3A 2FBYA 3V7KA 2W8KA 3N97B 3T3FA 9ICCA 5L1JA 4IRKA 2OZSA 9ICKA 3OYMA 3MECA 4HCBA 4E3SA 3OYDA 1VSEA 1D9DA 4DQPA 4RPYA 1XS9D 4PQUA 4BXOB 4KHWA 5EWGA 2QKKA 3C94A 4PHAA 8ICVA 4KAZA 2PYLA 2OPSA 4R65A 7ICGA 1UWBA 5J2EA 3BQ1A 3AO1A 4PY5A 1BIUA 4R5PA 4B3OA 5KT5A 4FJHA 3RMDA 3CFRA 3ZCMA 2ASJA 4QZFA 1S1UA 4IRCA 4IG0A 1SL2A 5HP4A 4RQ6A 3K58A 4CEDA 3LP2A 4O3NA 4ED0A 4N47A 3T5LA 3TAEA 4YMNA 3QEXA 1XWLA 1HRHA 4KKOA 4LH5A 4CIEA 4E0DA 4RQ7A 1IKYA 2HHWA 4O5CA 1QE1A 5KFWA 3LAKA 3TANA 4FK4A 3U3GA 1J5OA 4O3OA 4J2DA 2KFNA 4ED8A 2RF2A 3KHLA 5IIIA 3HT3A 2FBXA 4K4GA 4IQWA 1ZQFA 3I0RA 4FZZA 4J2BA 1C1CA 2E4LA 4M42A 3NCIA 4DOBA 3UXOA 1ASWA 4JK1A 4DLEA 3L3UA 2ASLA 3PV8A 3ISDA 4F3OA 3G6XA 3THVA 2IMWP 2R8JA 3V1RA 4KI4A 2PXIA 1TAQA 4FLYA 4FS1A 7ICRA 5C42A 3S3MA 3KK3A 4CIFA 3QINA 1Q9YA 2NRZA 3RH5A 1X2IA 5C25A 2R8KA 3IS9A 3NF9A 2KQ2A 4Z4HA 3PMLA 2R8HA 2ZE2A 2LSNA 3I8DA 4QZBA 1Z25A 1UT8A 4OPJA 1RBRA 4MFFA 4DTPA 8ICYA 4I2FA 2UVUA 1Y97A 3NF8A 1C0UA 4YG2A 1LV5A 5KTQA 4I2HA 4JV1A 4IR1A 4AHRA 2HVHA 4LSNA 4B9NA 4KO0A 4FYDA 4NYFA 1JL2A 1NK4A 1X9MA 3TAQA 1JLFA 2P66A 2BANA 3K5MA 2KZ3A 4YMOA 4KTWA 5IIOA 3MEEA 3MR2A 4O3SA 1K6YA 3HP9A 2QK9A 3AO5A 3NF6A 2YNGA 1BPBA 4Z6FA 4DFJA 5KT6A 3NGYA 3LWLA 5BPCA 4QWCA 3VQPA 1ASUA 3JPRA 3UXNA 1NJWA 1SZPA 2RPIA 4CJKA 4YVZA 3Q8SB 2Y1JA 4F4WA 2KFZA 5J0RA 9ICTA 2FMSA 3LP1A 3MFHA 4B9VA 3DMJA 4NYNA 4ECYA 3NF7A 3KLEA 4EEYA 4J9LA 3AVKA 2XY6A 4M3XA 4O4GA 3SUPA 1BCMA 1CZ9A 2JGUA 3PNCA 1LWCA 1S0VA 2DFLA 4KN7A 4FJJA 3OSPA 1V9PA 5KFHA 5J2MA 1NK5A 4DL2A 1TL1A 2AU0A 3HK2A 2HHTA 3L2QA 1NJYA 3MAQA 4DMNA 4M3TA 3TABA 3OJUA 4NLZA 3ZSZA 3NH2A 1TFRA 3OSNA 3C1ZA 4JS4A 5DKWA 4G3IA 2P6UA 1BIZA 4CHNA 3OS1A 1MQ2A 1HJRA 4QCLA 1KFTA 4R8UB 5HHHA 4I29A 1RT2A 4CF2A 3OYEA 1RT5A 1ZQHA 3RJKA 5DDYA 4GC7A 8ICPA 2YHBA 2FLLA 4EZ6A 3OY9A 3EW9A 4HHTA 2MAXA 2VA2A 1ZQZA 3DLRA 1ZQBA 4JUZA 4OVLA 1RTDA 5J0SA 9ICUA 4CJSA 1RILA 1JXEA 4ECVA 4KMUA 3V9XA 1ZQIA 5FRNA 4CGDA 4CHPA 3HJFA 3V81A 4ECRA 1XSNA 1TL3A 4OJRA 4RW8A 3QLHA 5I3UA 1NK6A 2W9MA 5KFAA 3PVXA 9ICGA 4FJMA 3C2LA 3O3FA 3EWAA 5IINA 4Q45A 5KFRA 4CEZA 1NK7A 4GXJA 2G8HA 2G8WA 1C1BA 7ICJA 1DGSA 4DG1A 1MC8A 1Z3EB 2W8LA 4B9SA 2KZZA 3AVFA 4CEBA 5FRMA 1HUZA 4K4IA 5L1LA 4F5OA 1JKHA 3NAEA 7ICMA 1MU2A 4Q5VA 4PGYA 4I2AA 3RMBA 4CEOA 5J2CA 4BE1A 1BPEA 1S9EA 3AA4A 1S77D 4DL5A 4H4OA 3AA5X 1RZTA 3CFPA 3BQ0A 3MGIA 3DYAA 3B6PA 4M3WA 4KLTA 4CFBA 4KHYA 4CJTA 4CEAA 1SL1A 9ICVA 4BE2A 1IG9A 4R63A 1ZQMA 1EP4A 4IQVA 2PY5A 4QWBA 2OWOA 4Q8EA 4M04A 3OGUA 1Q8IA 1BL3A 1RT4A 1X9WA 3GDXA 2KZMA 3MXIA 1VSIA 4HUGA 2I1QA 5KFVA 2F1HA 4N76A 5T7BA 3VQ8A 1ZJMA 3NHGA 4J9OA 2FMPA 4GW6A 1DOQA 2X6SA 1TKTA 2ZJ5A 3V9SA 1UOCA 3MDCA 2OA8A 1C0MA 4HUEA 1KSPA 4W5QA 3TARA 3OYBA 1B92A 4E7KA 3SUQA 4FJXA 1DLOA 1RT7A 2FMQA 2R8IA 8ICZA 4O0JA 1IKXA 4DQIA 4FJ8A 3OYGA 3UPQA 1NJZA 4DFKA 2FBVA 3C23A 1HJPA 4DTUA 4R66A 2C28A 5EWFA 5C24A 5DDMA 1ZQJA 3VQ9A 3VQCA 4QZIA 3RRHA 2HHVA 3V9UA 3RRGA 4KLJA 7ICIA 5KG6A 5SWMA 3RJJA 3HPGA 1NK8A 3QZ7A 5CYMA 2Q3SA 4PPXA 2AGOA 2UVVA 3RMAA 4OKJA 5HMLA 5DMRA 4C8MA 1L3UA 4DL7A 4RW7A 4CJUA 3RJHA 1XHXA 1ZQTA 3LALA 8ICIA 3KLFA 4LVSA 2G8FA 3RJFA 4YR0A 1ZYQA 1ZBLA 5DQGA 4K4HA 2JLEA 1TV9A 4J9PA 3D45A 4G1QA 4KLHA 3QIOA 4CHOA 5HROA 4IQTA 8ICEA 4GMJB 1YT3A 7ICOA 4KHSA 4DFMA 3EPIA 4KLLA 1VRUA 3HPHA 3FFIA 5J0OA 4TSXA 4I2CA 1HUOA 4H8KA 3GIIA 3F73A 1ZQCA 3SQ2A 3Q8PB 4BDYA 2C2DA 2FLNA 2FPLA 4ECXA 2E6MA 1KEJA 3SCXA 2G8VA 3K5NA 1S6QA 4PGQA 4FBUA 1HQEA 4C8OA 2D0CA 1L3VA 4F4ZA 4OPKA 4I2PA 2NRVA 4C8LA 2PZSA 3H4BA 3CYMA 2B5JA 4YR2A 3UQ2A 1CXQA 3JYTA 5J2KA 2F1IA 4EYHB 2IS3A 4FM1A 4IFYA 1JIHA 2Q0ZX 4E19A 3O3GA 2HHUA 1O1WA 2BGGA 5J0WA 1EKEA 1Y88A 4MF2A 1S1WA 2GWSA 3V4IA 4FO6A 1YTAA 3DRPA 2O4IA 3V6DA 3PR5B 2P5GA 1N56A 4RQ0A 2BDPA 4XA5A 3V7LA 3L2WA 5CHGA 5J0XA 4CESA 4ELVA 1X9SA 4AILC 4KB0A 4TQRA 4DO9A 1RBSA 2P1JA 4KN4A 1ZQAA 4QOZB 4IQUA 3RB3A 3EPGA 1C6VA 3G6VA 2XCPA 4ED1A 1ZQDA 4ECTA 1TKZA 4Z4IA 4F50A 3RAXA
chains in the Genus database with same CATH superfamily
3OR1B 4FZXC 1RHRB 5J0TA 1RQ0A 4MKAA 1X6IA 2W25A 4I2EA 4JI1K 1NGJA 1HD0A 2FVRA 2FLOA 3F2DA 4NOHA 4EZ9A 3BH6B 2ADCA 1KAZA 4C48A 4ZPAA 5KRTA 1HYZA 2ZJQQ 3SYZA 2Y0SC 1FFVA 1L7MA 4F2RA 1Z00B 4G9BA 5FLXU 2LVWA 2OLWA 3GFXA 3AVIA 4YN3B 2GC8A 4RWTA 3CCSS 2RLTA 2A40A 1IBMF 2F2AB 2M0NA 4AP9A 3GE9A 1SAZA 5AQTA 4P4MA 5KFDA 1EXNA 3M2UB 5M1QA 1UA1A 4J2EA 1CULB 1RA6A 4NPOA 3BJYA 1OKJA 2LCWA 4PAAA 1K1QA 3JPPA 2M9KA 1SV0C 2J0SD 8ICGA 2DXEA 3LVWA 2ZC4A 2F77X 2RB7A 4QAGA 1UFKA 3WKAA 3OTQA 4ZVSB 3POTB 5CQGA 3OVAA 2V9WA 1QVFR 3R6MA 1LK5A 4ETZA 3EEQA 4TUSA 4B9TA 5ETOA 2L3MA 3HI9A 3AEVA 1FE0A 5LY3A 2J9DE 2X3GA 4HTUA 4GKJK 1X9JA 4ED2A 2YVSA 2N7CA 4YY3K 4G6VB 1WNSA 2W9CB 3KKRA 5BJRA 1ZQVA 4FK2A 4OHXA 3OFGA 2DUYA 3BR8A 3NGTA 2DBBA 4KGVB 2HWTA 1R59O 1CRXA 1FNMA 1X5SA 2CJBA 1S9FA 4CLFA 2Y0SD 5ELZA 1IKXB 5B0BA 4BRDA 2VBXA 2C3UA 4K42A 4F3TA 2ASDA 4B08A 2Y9UA 4DX6A 4RW9A 2ZIUB 1FRIA 4X5VA 3ETMA 4OYWA 2DITA 2C3OA 1ZZFA 3EKSA 3KJVB 5ETRA 1HBOB 4OI1A 4X4NA 3BGRB 2R18A 5A8WA 4A8WA 3HZGA 4CM2A 3CCQN 3AU2A 5DLFA 2N3LA 2WVBA 1APSA 2ZTCA 1XSLA 3CPWM 2O8CA 4F36A 1RBUA 4OJ5A 3HSJA 4U7CA 2GEMA 4NXMF 4A8KA 2FSKA 2IOCA 4Z37A 3RBEA 1U4BA 3J8AA 4DS4A 2KHQA 1VSHA 1G15A 1I51B 2WOMA 2N3OA 4OGCA 2LDYA 2J6SA 4K4ZA 3CULA 3H08A 3S8SA 3UNGC 2QWPA 1RCXB 2OEMA 2VQEJ 3FJ2A 2CA9A 1A76A 1BD6A 3IKMA 2Y1LB 2XEXA 2DNGA 4H0YB 1KVJA 5EWEA 3C16A 5KG1A 1S1VA 1VRUB 2DXFA 4CFCA 3N6MA 2A1JB 4DTOA 2MB0B 5JRTA 1GTEA 4JB8B 4AHCA 3KBBA 3MMBB 2E1ZA 3R1XA 1I5OB 2P9GA 3CIZA 1EX4A 3O9UA 1NNDA 1DFDA 4GV3A 2NCKL 3C6UA 4YNQA 2DKOB 2PO4A 4RW6A 4CF4A 3O9RA 4LRCA 2QYGA 2BPFA 5ALXA 1GMUA 5F41A 5J2BA 4BROA 4M3ZA 5TKYA 4DR7K 4ECZA 1A77A 3NMRA 1DAXA 1ZRMA 3CC2N 4RT3A 9ICAA 4YMMA 3C15A 4W5NA 2ITMA 2LMIA 1O03A 4FLUA 3R8EA 4YXJA 2B7CB 4C3MA 3OW2R 3LYSA 4UBCA 5DG9A 2GJ2A 3QERA 3MWPA 1T05A 5C0YA 3DOLB 1WOOA 3ETOA 1SJRA 2L9NA 3M32A 4JLHA 2D4WA 1WOSA 2EH9A 3CERA 2FJAB 3JB9k 2VKZG 4JI3K 2YNFB 2C22A 1KFSA 4NYPA 3VOVA 4CF5A 1U8WA 3D2FB 1Q8BA 3HM8A 3B6BA 2CN1A 2L48A 3EM1A 4FP9A 3P5JA 3M6ZA 4Z6EA 5HHIA 3CMQA 2XLJA 5GINA 5GAHP 2VFVA 2WZ1A 1F9FA 1ZM9A 3C14A 4JI7J 4NZ0A 4N5SA 1ZAWA 1SKUB 1VQ9S 2ZD1B 2W4DA 5ALKA 1M5PC 3MM6A 2OD4A 2H5XA 1FFWB 4UAUA 1XR7A 3CMES 5D6GA 2A3JA 2YNIA 3WQUA 3D2SA 1KQSM 3CM5A 2HLTA 1HPMA 3F5EA 9ICOA 3RR8A 4I2JA 2OH2A 2JNJA 1XMQJ 4PQUB 5CE3A 3D6TB 3QAEA 4Q43A 5EVZA 3PJWA 3QWPA 5EGYA 2OTLN 4DCPB 7ICSA 1SI9A 1Q5VA 5DGAA 5BYSA 3RB0A 3MPWA 2DY1A 4PHDA 5B08A 4JI6J 4ZHRB 3TA1A 3HSCA 3NCPA 4B02A 4P2XA 4B3RF 2AD9A 4A8FA 3CJ9A 3GJRB 1B7YB 3AVCA 2HK3A 5KG7A 3N7PD 1M90T 2HI0A 1RQLA 1IR2A 4Z4CA 4R0EA 3ZC4A 5DQHA 1B4FA 4QS9A 5AQHA 4OJ6A 2QTWA 4BXOA 2MY7A 3DDNA 1TAUA 2FJWA 5D3GA 3PHTA 5L8RC 3ZDDA 4MFBA 8RUCA 1NG9A 1PK1A 2UVWA 4FZMA 4X4SA 1RBAA 5EHHA 4E1NA 5K14A 5DZ7A 3NL0A 2DPJA 9ICWA 4QWAA 3K9JA 1RLDA 3CCES 2IJNA 4JI0F 1ZD5A 1OY6A 3SPYA 2OFGX 2IM1A 4DV4J 4AXJA 4UOFA 4WK1A 4DL4A 3KK3B 4OGEA 5ETQA 5D4BA 2QIFA 3HHLC 4JYAF 3IS9B 2GWKA 2YPZA 4KTZA 4BACA 1W25A 2FVPA 2CNNB 2HOEA 8ICUA 1T03B 3JAMO 1R0AA 2VFTA 1EKSA 2WF9A 3DRRA 4JI5K 4EWTA 9ICJA 4FYWB 2BKOA 2ZOMA 4DQ8A 5AKXA 2Y9TA 4USAA 2EZYA 3SIPB 3PSIA 1IBKF 1VSFA 3CDAA 2IA6A 4KLUA 1BCOA 1K9MO 1KHWA 5DJBA 4YR3A 1CLQA 5A76A 1RLCL 4WTOB 3WKEA 1U48A 2BANB 3NTUA 2F8EX 1VIXA 3MEEB 3FBCA 1ZQRA 4WE1A 2F4VF 3IC1A 5IC4B 2QLBB 1D8BA 2LECA 1X4HA 1BLUA 1NAQA 2RS8A 3EY1A 1P9YA 3M8WA 2NXUA 3V6JA 2LQ9A 2RDIA 3QWUA 5KPZA 1SZHA 4Y2JA 1KLMA 4DV1K 3MPYA 2EC2A 2BQUA 2QWRA 4OL8A 4FF2A 3W3SA 1JLQB 2AYGA 4URGA 4PWUA 3IGNA 3BO2A 1XR6A 1EARA 2BJ9A 3EVOA 4CT8A 2Z1HA 4M63A 2KKPA 3PX4A 4ILHA 2EANA 3C1YA 2CQDA 3NEKA 1LVHA 1VJWA 3KLEB 2QL5B 1FKPA 4XPCA 4AYBC 4NXZA 4DV5F 4DUYF 5J8YC 3HHLB 1O08A 1SKSA 2LU1A 1O5JA 1BWEA 5KFYA 4YHHK 3U02A 1E3MA 2HZVA 3F5AA 1V5IB 4KR0B 3QGPA 1KN5A 2OFHX 4D3GA 3D28A 4ZCLA 1TELA 2L08A 4KX5A 4Q0BB 3DI6B 2V9KA 1YXQA 2P9PB 2V8DA 3ZSXA 2OZMA 4J7CA 4QZ8A 1FWLA 3HVWA 2MZSA 3HVAA 5HLFA 4NLCA 3ULDA 1IXRA 3KHYA 1DZ5A 5M1KA 4JRPA 2HNDA 3PUFA 1RABB 5SUHA 1MW7A 1YJ7A 3HX0A 4L72B 1X31C 1TQLA 1ZBUA 3GFHA 4DUZK 3SUOA 3VQTA 2ADBA 2LXFA 4CF8A 2CPHA 1A7GE 5DB8A 3BGLA 4H4KC 1N88A 3NNCA 3J7AN 2DGUA 3DN9A 2OHFA 1LXJA 3MBYA 3CIMA 4AYBD 3KOOA 5I3QA 3FCHA 2JH3A 2JEIA 4CHZA 4DV7F 5CA7A 2HAIA 2CPRA 3UR3C 5T7LB 1DXSA 4F5NA 3KUEA 3THXA 4MK7A 3JPOA 4URQU 1JWWA 2ETJA 5CWRA 8ICLA 3VGUA 5M2UA 1XTZA 2DGTA 1B4SA 1RWOB 3LOUA 1CC7A 5LMNJ 2DCUB 1MU2B 4DCOB 4RO0A 4CJEA 1VQLS 3CG7A 1ZD4A 2Z2MA 4CGIA 1BOTO 4YS2A 4CECA 3ZD8A 1V4TA 4Z4GA 4NB4A 1S9EB 3VQ5A 4AFFA 3L2VA 3QZ8A 2DWQA 3KUHA 5F3TA 3SCIE 3HHNB 1CI4A 5C2CA 4DU1A 1C4AA 4X66K 3AQFA 4ITSA 5KOXA 3O9TA 3DXMB 1ZQUA 4ZN3A 2AJ1A 2P5VA 4CF0A 4MO5A 2KJ9A 2Q1LA 1I3AA 4FJ7A 1B64A 3T1YK 4F2SA 4FLWA 3VEZA 4P2FA 4QWEA 1LQ9A 3TAMA 3VQDA 4C2MA 2KYXA 2VBWA 3PRVA 1FRXA 3BN4A 3ID8A 4U7UD 1N0VC 2IDEA 1XNRJ 4F0KA 1R27B 3VCBA 3ZZTA 2ZHAA 3KNAA 1ZBFA 3RU0A 5HRRA 3N6NA 1X9XA 4JI8F 1EJ7L 4M6WA 3MN5A 2ZIWB 4FLVA 4ZIWA 4ECWA 4KPYA 4IQMA 2V8VA 2YNHB 2QWLA 2ZHOA 5DG7A 1Z26A 2VDIA 1VQ9N 1OVYA 2XI2A 3NP5A 1F3FA 3DOKA 3CMEN 4OX9J 3ZTRA 2K1RB 5C24B 3E9LA 4DR3K 5L9XA 4F72A 3NVKA 4NXMJ 3QX7A 1C7YA 4CGHA 4I2BA 3ADAC 3QEIA 2CQIA 3Q8UA 3CNQP 5AKZA 3Q8LA 3FVYA 1XO1A 3K8WA 1A9NB 1TKDA 4M5DA 2FC0A 3UKUB 5CA5A 1UVIA 2UU9J 1GLCG 5KFEA 4JV5F 3QPIA 2KLAA 3MN9A 4CGFA 2D74B 2GGPB 5AK6A 3O8WA 4F26A 4BRFA 1LK7A 3W64A 1OQ3A 4JI2F 3KLFB 3JSMB 5B7WA 3HYFA 4DTMA 2C1EB 3SV4A 3OHBA 3N9UC 5ETVA 4CLWA 1VDVA 1KC8T 4NA1A 1WF0A 3FCVA 7ICNA 4P6QA 3OTBA 1NB2A 2GMHA 1D1UA 1BU6O 3M6GA 2IFXA 3FFIB 2Q0UA 4ZVEA 4WZMA 3LM2A 9ICQA 3LWMA 1HWLA 1RI7A 4KHUA 1W0HA 3PW0A 1ZQOA 5KFUA 3UB5A 1XR5A 1YVFA 9ICBA 4CBXA 2PAVA 1C0TA 3A12A 2EFPA 3T1HF 2GZOA 2V4QA 2R2UA 1TVRA 5J2AA 4KPCA 4ZK7M 2J0QD 1FD8A 4MEYA 4WFNQ 4FVUA 4USJC 3OLBA 5EY4A 4F93B 4YQWA 2Y1IA 3FK4A 2OAUA 4B1VA 4UAYA 1MSWD 4O5EA 3TFSA 3RMCA 3PZPA 4I2QA 1CJUA 2EQYA 1GTHA 3N4QA 2BW2A 1S1WB 3V4IB 3ZXWA 5J2NA 2HRUA 2B51A 2JEJA 4BJQA 2OM6A 2WB1F 2M8HA 4KLDA 3SCJE 3MM8B 1IG6A 2J9CA 2YY3A 3O1WA 3F2KA 2YKMA 4KRFA 1V5VA 3HXMA 3TJ8A 4OZLA 3UQ0A 4CIGA 3EDQB 3IM8A 3R7NB 3HJVA 4FXVA 2ZBIA 5M1FA 5EN1A 4A62A 1U6BA 3KZBA 4JD2A 1KL9A 2K4EA 1KONA 4ES1A 4NRTA 3MCMA 1W9HA 1FI4A 2A41A 3ETLA 9ICXA 4PJ0U 3OVBA 4OKKA 1WYGA 3PNIA 3AQPA 3NGUA 3R6LB 3MDQA 4XTTA 4AHTA 4L8RB 3C95A 2BQ3A 3KKFA 2D5RA 5L1KA 3H8JA 1LW0A 3DV9A 2KD1A 1PIEA 2KMDA 2YMPA 4QZEA 2OEHA 2P9CA 1X5TA 2XSFA 4KMOB 3D0IE 3OYIA 4DU3A 1LAVA 1NZPA 5ALEA 4B3SK 5CXTA 8ICSA 4FOEA 5AQXA 8ICTA 1KQFB 4YY3F 1FERA 2WFBA 2HHHK 4DS5A 2H4YB 5CJ7A 1IWGA 1V85A 1X5PA 5GAEI 3ZDAA 1TGOA 4FVMA 4EIAA 4ERDA 1HMVA 1GT8A 3G6ES 3X1LB 4HTLA 2MUTB 3DLEB 3PYFA 5HJYA 4NL9A 4ZS6A 1OSDA 3WT0A 3D6RA 4CNZA 4B3TK 1RNHA 2K3KA 3IWNC 4WZQA 4MT1A 5HBMA 1LWEA 1K0VA 3CDUA 3WBZA 1C1AA 7ICEA 1IV0A 4Y2RA 5CEHA 1ZXIA 2WHOA 1IKWA 3VCDA 2HBYB 4M5KA 1PCAA 2W3RA 1Z4OA 2E2QA 3H5XA 4HT5A 5L1IA 2KVQE 2COLA 1RCOB 1NUEA 3FZKA 5AM4A 1RDRA 2YKNB 5L9NA 1T3QA 2DH7A 3AO4A 1Y5NB 1KN6A 4Y28C 1RWUA 4KHPK 4DSJA 4KC5A 4V1Ak 5EOZA 5AXMA 1RXWA 1RHQB 1VQKS 1VYAA 3JPNA 1S9GA 5A8WB 3KKAC 3OTOJ 2DTUA 1VFJA 5CR4A 3H2VE 2GAHC 3I8BA 2YH1A 2JLGA 2O8CB 2ZNZA 2AGQA 3AO2A 1T4GA 1M0SA 3OFEA 2M88A 4ZPWR 4X2BA 2H3IA 4X65K 1GH8A 3MAHA 3THPA 1Q3UA 4GXIA 4J91A 2I6WA 1XQSC 2WOMB 2KVCA 3M2RB 4X4UA 3DJCA 3SQ0A 4O3MA 3ZT3A 5ADXH 2BJ1A 3IBFB 5J0PA 1IUJA 5CZ2A 9ICHA 4AL5A 2BR0A 2MLYA 5KQDA 1R6YA 1S6OA 4A4JA 2JH1A 4ILJA 4NLGA 2K4HA 1X4GA 5K8MA 2UUAK 2DH8A 4QR0A 3MM9A 1HNXK 1S1VB 4DX5A 3L3CA 3PYEA 2WHEA 4WFBQ 3AT1B 4TQSA 3WQTA 5HAOA 3PM9A 2HDOA 4ATNA 3RWUA 2ZDOA 3FBEA 2KV2A 1HNIA 4BLGA 2MQMA 4LRBA 3MM5A 3PSFA 3C6UB 1NLKL 2DGWA 3ZTOA 3G4SS 2CVIA 3AD8C 4E7IA 1QQMA 4O9MA 4LVNP 4RW6B 1NKEA 4NXNK 2E2PA 2DK2A 4BVOA 4IO1A 2XGQA 2W41A 1RK8A 4XPEA 4M9LA 2CZVC 4GKKK 4LF4J 2K8BB 3FQKA 4ZH4A 3RH4A 5ALHA 3C15B 1VSJA 5HQMA 3SR6A 3JQKA 5AZIA 2G13A 5DDRC 1WSEA 5MLCV 4P74A 4NA3A 3QE9Y 3CCJN 3OR2A 2RJZA 1GMVA 2RS2A 1M90O 2DO0A 1WC6A 1SB3C 2QXLA 3PW7A 4GIBA 1MQ3A 3M05A 3RBXA 1WLJA 2FPMA 3MZIA 4ZJLA 2AYMA 1VGYA 4LSLA 3PW2A 3JXOA 3R5BA 1CLFA 2OYQA 2CJYB 5BOLA 1BNOA 4M3UA 1U04A 3PEJA 2ZH4A 3C14B 4IL6U 4EAHD 3MPDA 3RB6A 3MM6B 3HI0A 1Y3KA 4IO9Q 4CNQA 4DV7J 2WCXA 3ZSVA 3AVBA 3L6QA 2F76X 1YITS 2V8PA 2YNIB 2KE7A 4G1PA 1CXUA 1NGAA 3UQSA 1ZJNA 4ZJOA 2MZJA 3A2FA 3CMAN 4HH0A 3ZT4A 3DDHA 3E01A 2DPIA 5JLFA 2RRBA 2CJKA 4N7TA 2K8GA 5ALJA 1S6PB 4Y2PA 4DV3J 4GVMA 2E8NA 2XMKA 1VC0A 2GHVC 3HHDA 3TZXA 3G9CA 4LFBJ 3P96A 2YWHA 4ILGB 2FHMA 2KP7A 2HBRB 1OXJA 2ROGA 1T9YA 4OMFG 4F5PA 2J0WA 2AF6A 5E3PA 2H5EA 2GW8A 1ZBHA 3FGUA 3QU2A 1O51A 3CWJA 2MSSA 2AZ3A 2GVDA 2G2OA 1OO0B 4DOCA 3ZDBA 4MN4C 4A48A 5DB9A 4OHWA 4CD1A 2EW9A 3MDFA 3ZEUA 1BA0A 3TADA 1T9WA 3M6UA 2H54B 3N97B 5H1SV 4TKTA 3J7AP 9ICCA 4C9DA 1E6YB 3SEIA 1FJ7A 3MECA 4X62K 3OYMA 4HCBA 4E3SA 3OFHA 1UVKA 3QMQA 3K0SA 4RPYA 1XS9D 1KHVA 4LQ3A 4IG3B 4BXOB 4KHWA 4JI5F 3C94A 2JFDA 2PYLA 5JU5A 1PK1B 2OPSA 4LVOP 4HLBA 4A2BA 1HFEL 2MQLA 4BR2A 4PY5A 5K14B 2RHQB 4OX6A 3NVVA 5ITHA 4R5PA 1BIUA 4B3OA 4KH4A 1Z4UA 2B56A 1QHAA 2ASJA 3VF2A 1Y00A 3QJJA 4IG0A 2HF4A 4PL1A 2ZGYA 4LF6J 1WEZA 4RQ6A 3K58A 3MN6A 4M63C 4CEDA 3LA0A 3D2NA 5ALRA 2MQNA 1NDCA 1FO1A 2PMWA 4YMNA 3D6JA 4F25A 2I2YA 2EFOA 1VQOS 2E3TA 1P1LA 5ALGA 3T41A 4F0MA 3LAKA 1PC4A 3ILJA 2KFNA 2FVQA 2XZWA 1DJ0A 3KHLA 5IWAF 1DGKN 3EKUA 1ZQFA 3DRRB 4WJBA 3BF3A 1TUUA 4FZZA 1C1CA 1WEYA 4DV1F 3NCIA 2KOBA 3QATA 4JK1A 2VCPA 3FGVA 5BR8K 2LDIA 3PLAA 4EX7A 2E7VA 5IOLA 4PG8A 3TACB 1RTJB 2GUPA 3I6PA 2D0OA 2PXIA 2KH9A 1FEEA 1EWRA 4QR1A 4FS1A 7ICRA 3OBYA 4CIFA 5BRHA 2WAQF 3JQJA 5C25A 3BUZB 2R8KA 3NF9A 3M8ZA 1SB6A 4WE1B 2EFQA 3I8DA 3CO9A 2QARA 4QZBA 4Y2AA 4OPJA 2RQCA 2IYGA 4I2FA 3Q8VA 4AM7A 3TUPA 1Y97A 3O5TB 4NLRA 4O23A 4FXWA 4YG2A 1C0UA 2KKVA 1KLMB 5KTQA 1YJWN 2RKIB 4JV1A 1VAZA 4NV0A 2HVHA 4V19S 4LSNA 1J2NA 4B9NA 1YRUA 5E3AA 1WC4A 1YVNA 2QGFB 5AQMA 2DGZA 1J2MA 4WPAA 4QIFA 2QSWA 4X4PA 1JLFA 4LFCJ 2KZ3A 2VGMA 4PPDA 3OXGA 1RT6B 5IIOA 2PMZC 3N7SC 1YJ9S 4Z7YA 1FKPB 1XJWB 5I4MA 4W4MA 2YNGA 3HOTA 2DT9A 4BRIA 2JZ5A 3NGYA 1HW9A 4DR4K 5BPCA 1MROA 5AQOA 1PYSB 1ASUA 1WTFA 5BXIA 3A5NC 2ES6A 3UXNA 4A5AA 1SZPA 4JI1J 2RPIA 4YVZA 5BRFA 1NGGA 1YRXA 3MEDB 2F9DA 2KFZA 4XDCA 1VBXA 2CJAA 4OJPA 1Y3JA 9ICTA 2GIRA 4M94A 1VQKN 1PG5B 3EGNA 4PWWA 5HLFB 4Y2IA 3DLLL 4B9VA 1X7VA 2JOQA 2IOFK 4EEYA 2HNDB 3VGTA 1EB0A 5TKWA 2UXCK 2DHAA 1CZ9A 2GS8A 2PD1A 4CLZA 5AQYA 2KDOA 2JDJA 2HOIA 4FNIA 1HLWA 2K7JA 3N4PA 2XYGB 3D4JA 3TJ9A 3ED5A 2KG5A 2AEMA 5KFHA 1HNZJ 2E8AA 1P1TA 2HHTA 3FUYA 2CAJA 1SCJB 3MAQA 3NRZA 4NLOA 5K9FA 2PGCA 2FJ6A 1MMLA 2PMZD 3BSCA 4NLZA 4ZA1A 3MMAB 3C1ZA 4JS4A 4G3IA 3EZWA 1BIZA 4WXWA 2IRYA 1KFTA 4GKJJ 3U26A 3A0IX 4JKEA 3TQEA 5HHHA 1XC3A 1RKJA 3OYEA 3JS6A 3GJTB 3THXB 4GC7A 2FLLA 4EZ6A 1KXPA 4UOCA 4UB6U 2MAXA 2O8EB 4C7QA 5F8NA 1ZQBA 4JUZA 1VBZA 2QMWA 4CJSA 2H51B 2FC8A 3CD6S 2IIHA 4DN0A 3V81A 2LQBA 1XSNA 1HBUB 3HKWA 2HFVA 4ANCA 3FZFA 4RW8A 3QLHA 4CLSA 5I3UA 3THWA 4DZDA 1DRGA 1EHWA 4ILLA 4BCAA 1NK7A 1DKGD 2B4UA 1I1GA 5L1MA 2G8WA 4BGAA 7ICJA 1DGSA 5FRMA 1N61A 3QGIA 1S1UB 3RUBL 4UATA 1KC8O 4H03B 3LPEA 2ZH3A 4ZVQB 2H5JB 2UZAA 3EUNA 4DZ6A 2DNRA 3A8EA 3KG0A 3O44A 3AA4A 4KAIA 4I64A 3SFGA 2BMBA 4IOAL 4MH8A 1IKYB 3H90A 3EE9A 3H7HB 4AL6A 3QUQA 4CFBA 3QSIA 2V94A 3HHKA 5HATA 2BZ2A 3TEHB 1YITN 4ZOHC 3P4UB 2OWOA 5GAGI 4M04A 3DHXA 1JXVA 3QAUA 2WSFC 1S7HA 1Q8IA 1BL3A 3CCVN 1X9WA 3W1YC 5M1NA 1VSIA 4HUGA 5HQ8A 4C1NK 4MYUA 2W7OA 2FZCB 3NHGA 2FMPA 4GW6A 1DOQA 4ZVFA 2X3DA 4EEKA 1EQ0A 3V9SA 4PXEA 2VJUA 2N82B 4W5QA 1ZAXA 1DLOA 1M1HA 3AAWB 2FMQA 2ZE2B 8ICZA 4YOVA 4K4YA 2ZC3A 4DR1F 4DR7J 3PIPL 4DQIA 2GQCA 4FJ8A 3LW5C 2MSNA 4DFKA 3HD2A 2K60A 3K5PA 1DHMA 5DDMA 1ZQJA 5AQLA 1VQMS 3WIVA 4KLJA 2AIRB 3P38A 5KG6A 1ICEB 2K3IA 3BGOP 2E5LJ 3NGRA 4WFAL 3H20A 3QZ7A 5CYMA 2RP5A 2JRSA 1OH7A 2M2BA 1PAUB 4IH5A 4JI3J 2KT2A 2CPYA 1C0TB 1T9XA 5HMLA 2CIMA 3GYXB 4USVA 4BRPA 4RW7A 4CJUA 4P75A 3ENVA 1VQ4N 1TVRB 3R9LA 5AE3A 4YR0A 5KAFU 3PTWA 5IM0A 2FD2A 3TO8A 2JLEA 2F9TA 1GK8A 3T6JA 5AJ3K 4A57A 4LF1A 5HROA 1FVQA 1VQON 3VAIA 1N33J 3D1HA 1CJUB 3MMCA 4NL9C 1NO8A 1RAAB 5MAOA 3G2XA 5J2NB 3AD7C 3Q23A 5C12A 4G65A 1ACMB 4K50A 3GIIA 1COKA 3F73A 4BDYA 4C0HA 4O4GB 2YKMB 5M1PA 1VLYA 3SCXA 1P27B 3ATVA 1NWKA 4C8OA 4OPKA 2VFSA 4A8QA 3MX5A 2W03A 1CJVA 2PZSA 4PYDA 3H4BA 1WHWA 2W24A 2B5JA 1CS4A 3UQ2A 4EYHB 4DR5J 3CCMN 2Q6CA 4E19A 3KDNA 2M52A 2GNKA 2MXYA 1B0XA 1DQ9A 3I4PA 4FO6A 3MD1A 1MNEA 1HR0F 2WVCA 3DRPA 3V6DA 3TTFA 1LW0B 1N56A 3V7LA 1BC6A 4OFZA 3CQXA 1NPRA 3N5FA 4CH1A 5CHGA 1VQPS 4DJBA 1VQ6N 1Q0NA 4CESA 4JKFA 2C3YA 2XS7A 2OANA 1X9SA 4KB0A 4TQRA 3CF5L 5T14A 1X4FA 2VQEK 2WVFA 3E66A 2A3VA 4IQUA 3TVKA 2VPYB 1C6VA 1YJ9N 2XCPA 4Z4IA 2EBEA 1HMVB 2VH7A 3WK7A 4RPXA 3AQEA 4K0KJ 1NDKA 2ITGA 1S12A 2CKWA 3I56N 3FSXA 3EZUA 2P9UB 1YGYA 4IH6A 2OKQA 4OLAA 2W55A 1TUGB 2EK6A 3EUB2 1DQ8A 3CCLS 4KHPF 3RFAA 1K8AT 5KT4A 4PQAA 2IDLA 4IBNA 2ZUDA 5HBMB 2MLZA 3TNVA 2GQ2A 4KLOA 3AN1A 2DHGA 4AHUA 1T8EA 3A4TA 3IG1A 5DZ6A 4FZVA 2BE7D 3GP9A 1IKWB 2YWGA 2E44A 2PT0A 4J37A 3L4IA 2OGUA 4OYXA 2JZBA 1FF2A 4Y34A 3TVYA 4ZPBA 2R8GA 4FVCA 4M8LA 1A0PA 4DPYA 2BZFA 4RPFA 3BPDA 4PL7A 3VA3A 3N0VA 4TYAA 5ADXA 4FJNA 1U7LA 4BRAA 2CGLA 2IHR1 2VU5A 3L4BC 3WNFA 2XMJA 1P9QC 3I82A 2JX2A 1CG2A 2KO1A 1ZQYA 3GPAA 4GVLA 5JVHL 2UUAF 2DFFA 5HL7L 1S9GB 1HNXF 1RT4B 4WQ4A 4BRGA 3DRSA 3J80U 5EUHA 5AKLA 2DL0A 2PI4A 1TKTB 4QIWC 5ETSA 3MURP 5KPRA 2R3VA 4PWDA 3UR0A 3D5MA 2BCRA 3LPTA 3S6JA 3HL8A 1QZ6A 2D3DA 4EYIB 3SFUA 5AZJA 2CQ0A 4YHHJ 4UF4A 2AKWB 3DNCA 4NLBA 4JK7A 3G0ZA 3UDCA 2AX1A 4EHTA 2IVOA 2AJFE 1B43A 1DY3A 8ICBA 3MX2A 2R4FA 1XMQK 5IILA 1LW2A 4LRAA 2ZH1A 1WSFA 3NGIA 1U2VA 1FJGK 4DFPA 1TV6A 4BDPA 3A5OC 1HYSA 3RJEA 1JMTA 1N5YA 3LDAA 4CP5A 1K73T 1VSMA 1MA7A 1WD6A 4K5SA 1F21A 2DKZA 3QEWA 4YD2A 1KVCA 1OSCA 1HNIB 2MJUA 3MM5B 5DB6A 2LEBA 2NREA 1MMDA 1JCFA 1BWVA 1SIWB 1TP7A 4DUZJ 4O3QA 2HHQA 5AR0A 1X0PA 4P2SA 1KR4A 3OD2A 1N32K 2PFFB 4RU2A 2O4GA 5KQ8A 4NLTA 3O4WA 3Q8MA 2YV0X 4TLQA 1KQGB 3VZIA 5J2PA 4QIWD 1HPZA 4H4MA 1RBVA 1EWQA 3B0XA 2B21A 3B6OA 4TY8A 2XS5A 1SV5A 1PBUA 1URJA 3S1TA 3TADC 2GVZA 5AZIB 5HRPA 1S6UA 4PCQA 2Z1GA 5GAGP 1AROP 3BF4A 2JV3A 3KIOA 4BHQA 3AGRA 2XO7A 1BI4A 2E2NA 2ZXHA 3OR2B 1Q16B 5LJ3Y 2VQFF 1BQMA 4JK9A 3S3OA 3HHEA 5CZ1A 3PG9A 1RT1A 3R6GB 3HFVA 3SAGA 1HKGA 4I2PB 4CHQA 3V9ZA 4ID1A 1WSGA 2ZVSA 1IKVA 4DR2F 4LSLB 1J53A 3IG8A 2YPYA 2A1AA 2W4PA 1UCNA 1IJEB 3PEHA 3EICA 3W66A 5TZVA 4X66J 3FDSA 3O08A 2NYVA 2H1YA 3KMSA 4XK8C 3NFAA 1XNSA 3R5GA 4QPTA 3KTQA 1NLVA 3CDEA 4FYVB 3T1YJ 1PGZA 2VGNA 2WBMA 4X4RA 4DV6J 3VQEA 4FKXA 3FEYB 1SS6A 5A2QU 4PYAA 4FZYA 5EX0A 2D8CA 4I27A 4MF8A 5KAIU 2DHXA 2AWZA 2LXIA 2XWXA 3R5AA 2YB4A 3U9ZA 4F71A 1WWVA 3ULEB 5BN8A 2OJ3A 2GVDB 4JKGA 1CQMA 1ZRNA 2HQFA 4CFAA 2F65A 9RUBA 3OHRA 2J9DA 2GJIA 3ZEUB 1KLNA 4DR6K 2ISOA 4LR8A 4BQZA 3SQOP 2BCUA 3OYKA 3MECB 4KBIA 2QEXS 1O8BA 1NZ8A 1X60A 2XNRA 3AA2A 2GIFA 4DR3J 2BW7A 4J9UE 3I96A 2QW9A 3K5LA 4Y0WA 1W2BR 2H9ZA 3CDBA 5AKKA 1R89A 2OPSB 4NYOA 2B7BB 1N5QA 3QMLA 2ZTEA 2ZJRL 3VVUA 1Q81T 3T5KA 4M0AA 1D8LA 3KXDA 2ZDPA 4IG0B 2YQ0A 2HMIA 5D4LA 3ZDCA 1I3OB 3CQ8A 2PFQA 5ETMA 5HMZA 2BPCA 3BYRA 1WN7A 3LH2S 1NOZA 4U9RA 2FJVA 3HVRA 3MDAA 4I7FB 3O5BA 4F67A 2Z2YB 3RW6A 2OPRA 4YOEA 1BPDA 1QUPA 3M6WA 4CLKA 3F9KA 2UUBK 4FBTA 2IMOA 4PG4A 5FDLA 3QRPA 3SV3A 1RE1B 1C1CB 4ZTJA 1ZQKA 2J7KA 1QS4A 1VQPN 2A19A 2E8MA 4NMXA 1RQNA 2IVMA 1CJKA 5DG8A 4UARA 3Q8RB 1WG5A 3L2UA 4EBCA 3G96A 4FKYA 4QZAA 1FNXH 4FWMA 3NBPA 5CB1A 5C25B 2PEHA 5HNKA 5F8LA 1G2EA 3HSTB 2Y8YA 1X40A 1M5SA 1DTTB 3PHEA 4DSKA 3KD5E 2E66A 4JV2A 3N5BA 4FZLA 1NMNA 2RN2A 1C0UB 2W2PP 4N56A 5FJ4A 3SBTA 3DOMA 4CO0A 3L8BA 4LSNB 1P8ZA 2Y0SF 4ELUA 1SJ3P 3GG4A 2CGJA 2KKHA 3H0MB 5A2QY 5AK5A 4ED7A 1GMWA 1XIQA 1F5CA 2N7YA 2VDHA 2MKHA 3WUHA 1F2HA 2WVEA 3W5YA 5KPTA 5KFJA 1L3TA 4HUFA 5DBBA 2O5DA 4CEQA 4P7TA 3QNWB 1D8ZA 2DGQA 4Y2QA 1MROB 1RGIA 4UZBA 5DETA 2A5XA 3KDOA 3D7SB 1S48A 1RHKB 3UMCA 5EX3A 2P6RA 2R7WA 1J5EK 4FM0A 4K8RA 3W5ZA 4B3SJ 2XZDB 4ED3A 2EC0A 2ASOA 5AM1A 2EHGA 4MK9A 3DU6A 1ITGA 2HHHJ 1NNEA 5D49A 2ZM6F 1H2TZ 2W43A 4M5HA 1NZBA 4C0OC 3RZAA 5KL1B 2GJFA 1NM2A 2VODA 3QBWA 1H7WA 2BYCA 2DR6A 5J2GA 1RYRA 2NO4A 1JUDA 4Y0FA 1N5SA 4P73A 4RQMA 1JMSA 1NKCA 1T0TV 3H5SA 2CQ3A 4JV0A 4WYLA 4JKHA 4B3TJ 4QZGA 3VTIA 2D3O1 3ONQA 4QZ9A 3ZX3A 3SDEB 1N5TA 5E41A 2GOLA 5KFCA 1A6SA 3J7YI 1TUVA 4OJLA 3CQYA 3VPZA 2G9OA 3IFRA 3LANA 3OXFA 3OTCA 3CCUS 2R2RA 2K89A 3ZZOA 4J03A 5KG5A 2QE5A 3UXPA 3QT5A 4RNMA 5ALSA 3V9WA 3F5TA 1HI1A 1WAFA 4Q7AA 3WK8A 5D4OA 2NUHA 1ZOTA 2BOPA 4CI6A 2ALZA 3BGUA 1KAXA 3WXIA 1U8SA 3M8QA 4ANDA 3ILLA 4QWDA 2KT5A 2GMJA 2BKEA 2PE8A 2HRTA 3MR7A 3RJGA 3JS9A 1UEVA 3V81B 3QLHB 5I3UB 1QCKA 3N4MB 7ICHA 4R8UA 4UB3A 2XMTA 1U24A 3T79A 4DQRA 1FDNA 1XU4A 2HS3A 4S0MA 3FFKB 3TA2A 4US9A 5J0UA 3GV7B 2AEJA 4U8YA 4X65J 2KHVA 5B0CA 4RX6A 4JI4F 4IQXA 1AFIA 1G7CB 1YLXA 4DOAA 4FDFA 2EAOA 1S7IA 1ZTTA 4G1IA 5AQKA 4CZHA 3CRXA 2IGIA 3WKBA 3PKMA 3LL3A 2YX7A 4P2HA 2G8IA 4BR0A 3MMVA 3OYJA 4RBUA 2ZWHA 3MHYA 2PA8D 4NLSA 4Z6DA 5IIKA 1RWKB 2YCHA 2UUCK 4ZN1A 4RW4A 3KLIA 3MUVP 1HHTP 1DARA 2GV9A 3NGKA 2KVSA 1FKOA 3MXMA 1RWPB 4BC3A 2FGCA 2E5HA 4NLQA 4B6JA 2IPOB 3DXKA 3LTOA 2IOHA 1IO2A 4ZLJA 4P9SA 1FK9A 4YMEA 4NXNJ 2ATLA 2DRBA 2B9YA 1X1PA 2MLXA 3VEVA 3F0NA 1ZQGA 4LUBA 3UN3A 1DLOB 1RT3B 2Z1IA 3KK1B 1XERA 1BQNA 4GKKJ 1QH9A 1HW8A 1FKAF 3T69A 4J9SA 3GB0A 2KN7A 5ALOA 1WI6A 1WG1A 3GWCA 1DBDA 4HVZA 4WK3A 3H8SA 4ER8A 3DWLA 5HMWA 2XGPA 4CRJA 2FDNA 2YH0A 2XLIA 1FO4A 4FNHA 4ZKAA 3C5FA 2D0AA 4CK3A 2QEXN 4CVNE 1RTIB 2PEBA 2RH3A 3SK3A 2EXUA 4CO1A 2XO6A 1SKRA 2B4JA 2JEGA 1EZZB 5CYMB 3QJPA 7ICVA 1YBUA 2VG7B 2XNQA 4RQNA 3SI8A 3M1YA 1PVRA 1LEOA 2CPXA 1BDGA 1IIPA 2RDDA 2J6TA 2ZZMA 2G5IB 3OL7A 1RWXB 3M8YA 1X4AA 2BV3A 4RW7B 3CPWR 1BO5O 4RKUC 3QEBZ 2MZ1A 3FBBA 1MWYA 1YK9A 4K8XA 2D7SA 3O0FA 2ILYA 2J76E 3H0RB 5HROB 5KFSA 2E1MC 4KV8A 3AY0A 3C2PA 2GBZA 1EQMA 4UW9A 3MMCB 3HPOA 4I2IA 1XMBA 4UB1A 3VTHA 3QJLA 4L6V3 1OVQA 4C4SA 1ATSA 2RSQA 4B9QA 4Y2KA 4ELTA 1RSCA 4M3RA 4KH5A 2BM1A 3DLGB 3MCNA 3DRYA 2X51A 5AM3A 4LF8J 2HURA 9ICLA 4PKDB 3ENOA 3P4IA 2VQEF 4KB1A 1CJVB 4OI6A 2B5JB 4JHDB 3TAGA 2DXDA 1S4EA 3RG6A 1CBKA 2R7TA 2AJ2A 4X62J 3JPSA 3OTOK 1Q9XA 1NJIO 4ICAA 3AUOA 2CQHA 5DB7A 2MKIA 5KG3A 3DRPB 3EL2A 2RNEA 2HW3A 1AT1B 3AB2B 3SCKE 3H0PA 1HA1A 3NH1A 2E88A 3IWLA 4C8ZA 3GFZA 3CXCM 3C6HA 1MA9B 2FY1A 1ULRA 2W42A 4CLLA 4PKIA 3QBXA 1L3KA 2ZTDA 2FZKB 3M6XA 5JS2A 2R7YA 1YHQN 3I76A 1WUUA 2QA1A 2Q6BA 4WQ4C 1A5WA 4I2GA 1K9MT 4CZMA 1N4LA 3A13A 1O13A 3VERA 1VDHA 1TK0A 2G8KA 4ZTFA 4FPBA 3THTA 1GLAG 2WTFA 4LREA 3IM1A 1Y4ZB 4H5VA 2AJ0A 2V2VA 3UO0A 2QLXA 3JAMU 4WIIA 3PXGa 4FJGA 1EO1A 3SAFA 1NJXA 3I0SB 3SNNA 4EO6A 1RAFB 5JUMA 1S57A 3M1VB 3E9OA 4ZVGA 1Q53A 3G8TA 2BUPA 3WC2A 4ILMA 1CQNA 1SQEA 1RACB 1VR6A 3B9JA 3MPUB 4RCHA 2XYPB 5BR8J 4QNLA 1NMDA 4IR9A 3AA8A 1KQSR 5KG0A 1DTQA 2DY9A 3H5YA 4RT2A 1B3TA 2K8CB 2F1JA 3HP6A 2HVDA 3V2UC 4AYBF 4HEA9 4JI7F 4BRMA 2AYBA 1QVGM 3MM7A 4ECUA 4U96A 3IBPA 4YCXA 3M6KA 3KWMA 3K59A 1HL6A 4K4UA 2F3JA 4YOWA 1YWXA 2PFNA 3O9QA 3GU0A 2QMUB 1K8KA 3ILIA 4BWJA 1YKWA 4CGJA 4BR5A 1XMQF 2YKPA 1TYQA 5GMDA 1IVZA 5AQFA 3QUCA 2XMAA 5B0EA 2ZKTA 1DK2A 2A6OA 4ICLA 4XRHA 3J7YP 3LP3A 2A1SA 2VIHA 2W9BA 2IDOA 4BG8A 1UJ4A 3OTDA 4JI6F 4GXKA 1Z19A 1U1OA 4CFDA 4FF4A 3V7JA 4ECSA 2ZQBA 4XO0A 2CYYA 4PWDB 4TU7A 4M3YA 3RGIA 4DCCA 3W62A 4ZJQA 1JLCA 3EX7B 2HFNA 2GLEA 4UOHA 3IAS9 1TL5A 3ZSRA 5AZJB 4CJWA 4AT1B 1I94K 4BGDA 1MWQA 4EBDA 1RHMB 1OWXA 3ALRA 4DR4J 1NI3A 3HVTA 8ICQA 3ZZZA 3MEGA 3UCUP 2PDAA 1VRTA 5LJWA 2UUWA 2X7IA 4HHUA 2NRTA 4C23A 5CR0A 3FZHA 4LF5J 4ECQA 3TU5A 2V4RA 2RDJA 4Z6CA 5LM7E 1TV6B 3T5HA 1H74A 3QIPA 3MOZA 1N5YB 5A2QO 5A0YA 4DWIA 3UVJA 3WKDA 4DV2K 3FC9A 2ZWOA 1GQEA 1YAGA 1UFLA 1EKRA 2UXCJ 5KT7A 2FPKA 4BREA 4DV4F 3IP4B 2F8LA 2CUYA 1UW4A 1RM6C 2ZJ8A 3ZO7A 4NCGA 1CUKA 2X78A 3MR6A 4MLEA 5G5GA 5A8RA 4WU3A 4GV6A 3ZNJ1 1I39A 1HI0P 1VBYA 5AKJA 3LDSA 1JNZB 3DM2B 1OIAA 2PC6A 3K57A 3H46O 1BPXA 3G82A 1WCLA 1WC1A 4H4MB 1N0UA 3A0BU 1T11A 3VHQA 4TY8B 1SV5B 5LMUJ 2YJFA 4YOYA 2BBEA 3R8YA 1EQYA 3DGPA 3UNYA 1BA1A 3B82A 3ILOA 4LF6K 4CJQA 1ZBIA 5J2DA 3NAIA 5ALDA 4WIQA 5K8PA 4EENA 1RT1B 3Q2TC 4E7LA 5GAHU 4DOZA 4P10A 5JXSA 2PI5A 4USWA 1HBMA 3GZ7A 4Y2CA 1ZQSA 2CNKB 5AKIA 3N7RC 4DEZA 1Y9OA 1RPLA 4OI4A 2HFSA 4CH0S 3VQ7A 2CH5A 3RJMB 1ZD3A 2J4RA 1Q8LA 3OPXA 1ZPWX 1R3NA 2LFVA 4JOUA 4Z0UA 4CF9A 4CZEA 1SC4B 1Y64A 4NCBA 1W97L 3VZHA 3DLLQ 3Q0AA 4JBCA 2FYXA 5ALPA 1S0OA 2OHDA 6FDRA 2DNHA 3QSYB 2ZVIA 3M8SA 4NM2A 1VQSA 5I3PA 4MYTA 2HSTA 3CCRS 4RLEA 3CJKA 3WQPA 1BISA 2VPWB 2RVJA 2NLWA 1XNQK 3M2VA 1OW5A 3AARA 3QEAZ 3CW2C 2R7SA 4E7HA 3UD3P 1RDWX 4UB5A 4C80A 3LF0A 2G2YA 4JKBA 3SJHA 2BHNA 1KNZA 5CY4A 4CO5A 3SMVA 4FJKA 4IDHA 3AOCA 4F3QA 4TN2A 2YXLA 1NGEA 3HM9A 4C8KA 1ZM4A 4OYPA 1ZAVA 1D9FA 5HSPA 5IS2A 2Q66A 5G4DA 3K0JA 3AJ2A 4OYZA 1LFWA 4M47A 3ENQA 4QU7A 1YBTA 2IVYA 3M9NB 5AT1B 4O5BA 3NAHA 3RAQA 9ICSA 1S1TA 3I9ZA 3IBCB 1NNLA 3W3DA 4CJ5A 1RAHB 5MLCQ 2YHYA 3D2EB 4DPUA 5L1JA 4Z94A 2OZSA 4USMA 2LLZA 1D9DA 2FTRA 3ZX2A 4ZP6A 2W1BA 2OPRB 2E20A 4EELA 4NLDA 4M5MA 4JB3A 1NGDA 3GYGA 4DV0K 4PABA 5FPEA 5AICA 4WYWA 4K4WA 3A8YA 5FDLB 2KIWA 4R65A 2FJEB 1UWBA 3AO1A 2O8BA 2GMLA 3KVGA 5BYQA 2UV8A 5KT5A 4FJHA 4U8VA 2QB0A 3ZCMA 1WUAA 3BKUA 1SZ2A 2QN6B 1WDTA 5LMNF 2AYEA 3GTYX 3NNAA 6AT1B 1U0HB 1HNZK 1RKIA 3S41A 5BRDA 4O3NA 4ED0A 2QC3A 4NLPA 5LSLA 1GFWB 4GV9A 4NLUA 4IOAQ 3T5LA 4M5JA 1Q18A 4GVEA 1TE2A 1OH5A 3NBPB 3MUTP 1XWLA 4Q2MA 5J1EB 4KKOA 5CCMA 5AJ3J 4CIEA 3AA9A 2HHWA 4C7ZA 4O5CA 5KFWA 4B17A 3AMZA 1J5OA 4J2DA 2DPNA 1D4XA 2DQNB 4ED8A 2RF2A 5AFUA 3AH6A 2QV6A 4FE3A 2E9RX 1ZOLA 3I0RA 2VHGA 3RSEB 1HARA 2MZRA 2I6XA 2W11A 1ASWA 4NE9C 3DOMB 4DLEA 2ASLA 2D3ZA 4C4TA 2E1FA 1XNRF 3K1ZA 3G6XA 3THVA 2ZBCA 5H1SQ 5I9EB 2BACA 3QFUA 1NMEB 4LR7A 4OZ5A 1WNEA 5C42A 2OI2A 2NRZA 2JVRA 3TX0A 3NXZA 5AXNA 2HLUA 2KQ2A 2Z57B 2Z7JA 2QLFB 4Z4HA 5AIBA 3MEKA 2CGKA 4KBOA 3KWIA 4OX9F 2DB1A 2UVUA 1YJRA 1FRLA 2NRRA 3O1BA 2D3UA 2DEJA 3AAQA 4I2HA 2FXUA 1X4BA 3UN2A 2OCEA 3MAAA 1YBAA 4WFAQ 1U1LA 1JL2A 2P9IA 3CC4S 2P35A 2P66A 4YMOA 2UU9F 4KTWA 3MR2A 4O3SA 1U1PA 1IBLK 2QK9A 3VV2B 1XMOK 3NF6A 4QYRA 2W2OP 2HVEA 2CJ9A 2MA1A 2IRUA 3QU4A 4Z6FA 5KT6A 4Y2MA 2LI6A 1B0PA 4KSEB 4QWCA 1X66A 2UXBK 3HRGA 1V3ZA 2KXHA 1NJWA 2DNNA 2P6TA 3K2YA 2F4FA 4HI1A 5BREA 1W7WA 3FSYA 1U1QA 2V68A 1UVMA 4USHA 4N8OA 3IR6B 4V19X 3BO4A 2FMSA 4DMZA 3TR5A 7FD1A 3NVWA 1FRMA 4DB3A 1NPKA 1HD1A 4ECYA 2O67A 3AVKA 2XY6A 4M3XA 5ADZA 4XH1A 1RHUB 2DNPA 3ZLJA 1N34J 3PNCA 2P6SA 1LWCA 2P9KA 3UM9A 2DFLA 3LGNA 4FPRA 2G2ZA 4LF2A 2C3PA 1V9PA 2IA0A 1NK5A 4DL2A 1TL1A 4BRKA 2YKAA 1QQ7A 1J27A 1FX2A 1Q7LB 4DMNA 1F9EB 3TABA 4M3TA 1Y7PA 4LF9J 2W54A 2ZH9A 2DNLA 3J7A1 2NXNA 3ZSZA 2E5LK 3OSNA 5AI4A 2IYIA 3MUMP 1B70B 4J8FA 5IT9Y 3OS1A 2I9SA 4QCLA 4A59A 4R8UB 4Y2UA 2HBMA 1RT2A 2BOAA 4OJ3A 2N4DA 4P71A 3CF5Q 5DDYA 3WK4A 2KFYA 3W2VA 4Z7CA 3QUBA 2CWXA 3MCAB 4CRXA 4MIWA 3I9V9 1HNWK 3NG8A 2VA2A 4CLTA 5IC6B 2I0XA 3HCXA 4UUXA 3HBTA 2MPUA 4OVLA 3UCZP 2HQGA 3UD4P 3HFZB 9ICUA 3GJQB 2RRAA 2FSJA 1JXEA 4YOXA 2DKXA 1N33K 3D9BA 3V9XA 1UAWA 1TL3A 4OJRA 4RW4B 3KLIB 1NK6A 4C0BA 2W9MA 4PL8A 5HVFA 9ICGA 4FJMA 1FJGJ 3GG0A 2A0FB 2B9XA 1TL7B 3IFEA 4NX9A 2EAMA 1QY7A 5KFRA 4LT6A 1FKOB 4GXJA 3SENA 2RMLA 3B8AX 2G8HA 5B0FA 3Q8YA 1MC8A 1Z3EB 3AVFA 3UPFA 3BO3A 4A5BA 4F5OA 3DXKB 2CQPA 1RTZA 2V7YA 2IM3A 3LP2B 5AQSA 1MN9A 4ES2A 2OP5A 3IAM9 4C98A 5J2CA 1P7DA 1FK9B 1FXDA 3W9IA 2QWQA 3M2UA 1N32J 4DCJB 4DR5K 1FVSA 2JVOA 1S77D 1CULA 1BNPA 3CCRN 1SC6A 1WWUA 3MGIA 4P72A 4B3MJ 2QFJA 4CJTA 4CEAA 2G5HB 1T6CA 3HSZA 4BE2A 4R63A 2FUG9 4CZCA 5JVHQ 4IQVA 3VETA 2PY5A 3NS1A 2J7UA 5HL7Q 5HN0A 5CABA 3QT6A 3C28A 5AI6A 4NL5A 4FF1A 1RISA 1Y5LB 2HMXA 4H0PA 2PMHA 2KZMA 4J90A 2I1QA 5KFVA 1IBMK 2F1HA 1D9AA 5T7BA 5AI8A 3VQ8A 4J9OA 2ZJ5A 4B1XB 2G1HA 3NS6A 4HUEA 1KSPA 4K0KK 3TARA 4FJXA 4E7KA 2R8IA 2Z4PA 1VCTA 1IKXA 2WSCC 2E5JA 4U95A 4OYOA 4ZPVR 3OYGA 3UW1A 3UPQA 2Q36A 3CCZA 1HJPA 2ZIUA 2HSZA 1PVPA 4R66A 2C28A 2CQ4A 3VGSA 1X4CA 2HWIA 4NA2A 4QZIA 3V9UA 3FEXB 2JSXA 2M70A 4A47A 3OTOF 3TUJC 7ICIA 3C29A 4UT4A 4BGBA 3RF9A 4CI0B 2RU3A 3N6LA 2EPIA 4ALZA 4QIGA 2GO7A 2B8PA 3CCSN 3IGVA 4PPXA 2UVVA 3OUYA 3RMAA 4PXCA 2LQJA 1VK8A 4OKJA 2J8AA 5GMKa 2ZGZA 3R5JB 4OI2A 1L3UA 1TUYA 4WF9L 2AP1A 1SV0A 1XHXA 2AEFA 1ZQTA 2J0XA 8ICIA 4LVSA 1IQZA 1W26A 4CT9A 3RJFA 3U9DA 3FRZA 5DQGA 2D1CA 4BY9C 3A8IA 4CHOA 3QIOA 4GMJB 3AAPA 5HI7A 4DR6J 4WFNL 3N28A 3UI3A 1YT3A 7ICOA 4KHSA 3AOBA 5E26A 3ZZPA 1VLBA 1RAOA 1VRUA 2HWHA 5HR7A 3DMJB 4KGZB 3K9KA 4Y00A 4H8KA 3Q8PB 3MMBA 2FLNA 1U26A 1FRKA 1UW9A 2Q0RA 1KQKA 4FBUA 2FJDB 3NWGA 2BA9A 3WIUA 3NMUA 1L3VA 1DEJA 4ZP7A 4EGLA 3O3LA 2VFUA 3MTJA 4MDBA 2NRVA 3H8YA 5LJVA 3D66A 4PL2A 4IOXA 5ALYA 4YR2A 3KZXA 3HT0A 3UKRB 4CBUA 2CDRB 2V7ZA 4LF4F 3JYTA 2ZITA 2F1IA 1LOTB 2Q0ZX 5J0WA 4DU7A 2UXDJ 3DDKA 3BREA 2DTJA 2O4IA 3IA0A 1M1KT 2UUBJ 3CO0P 3B4DA 2CNOB 3OT9A 4MHVA 1KKXA 2C2KB 2F63A 3MCPA 1AZSA 4IXCA 5AXLA 3NCRA 2NSCA 1FJEB 4XEIA 4DO9A 2ROPA 1M5VC 3I5AA 1DTQB 3VWSA 4KN4A 1ZQAA 1RTDB 2PMZF 3G6VA 1ZQDA 2B4OA 2KN4A 2YQ3A 2Z56B 4ECTA 4BC9A 5RUBA 3G71S 3MM7B 1FESA 3LP0A 2ASPA 1WKJA 2NZ4A 2XI9A 1SH2A 1V6HA 2G07A 2PFPA 5AQUA 2NRHA 4H0XB 3CJ4A 1K8KB 3U6FA 3MCOA 5F8GA 4YN4A 1QSLA 1TYQB 2VPXB 4DG1B 4DV3F 2KXNB 4OKEA 4LFBF 2XMUA 3KG1A 2LA6A 4ICLB 3CD7A 3TI0A 1JKHB 5C2DA 3TFRA 2W9BB 3IRXA 2J5AA 3VN5A 3WXLA 5L39A 3P39A 3JSYA 1UT5A 3J81Y 3KK2A 2RQMA 3M9MB 4KLEA 2LQ8A 3P3DA 2W6LA 1U45A 3GIRA 3KUGA 3NH0A 4ZHRA 1JLCB 3MWTA 4CJ4A 3WNGA 5E5NA 2PN6A 2EZXA 4ZVRB 1T3OA 5B0GA 2QTDA 3R3LA 3RB4A 3QFHA 4HACA 3UFCX 1PO6A 1KTQA 4KB7A 1JRPA 3CJ8A 2AJQA 3MEGB 1N8RT 1VRTB 2DD8S 1Y0HA 3ZDEA 4I28A 1XBWA 5CYJA 1XSPA 4DV6K 2AHOB 2G1DA 4DTSA 4UAWA 4KLIA 3GU3A 1J5EJ 2KICA 1VHXA 3QIPB 5A0YB 4M2YA 4I69A 3W63A 3MTKA 5BPNA 3DEEA 3T5JA 5D46A 4RQ5A 2HBZB 5KFZA 4LF6F 2V63A 2YX1A 1RT7B 3GIMA 2YWKA 4NCGB 4EI2A 4B3RK 1UHUA 4DCHA 5AKHA 1VMBA 3AVHA 1JJ2M 1TK5A 3OHAA 4YEAA 8ICJA 2B6AA 2XZTB 1IM4A 1SIZA 4LC9B 3NDKA 4H0VB 4OPHA 2E8PA 2WONA 3BZKA 2V0NA 3R9PA 2DISA 3HDSA 2QLTA 1UA0A 2FPHX 1T03A 4AXIA 5F1XA 1WORA 2ZJPL 2YMMA 1VQ8S 3CEDA 5K8NA 5JVGQ 3G6YA 3M1FA 1SXLA 4RQ8A 1GXTA 2Y8WA 3SUNA 3FR0A 4FFDA 2M3DA 1HEKA 2XB2D 4QJFB 9ICRA 2EFNA 1Y10A 1VJ5A 4RL1A 3DLJA 2XYHB 3CJSA 4OV6A 2CXYA 1S10A 2DGSA 2ERRA 1OPIA 4M95A 4JI0K 2A10A 4L76A 4YORA 5EXWA 4RNOA 2IM2A 2MKJA 2AGPA 1T6DA 1HBMB 3V1OA 5KAKA 4JYAK 1RYSA 4OLOA 1MWZA 4QYZK 3O2IA 1FA0A 3CJTA 5DBAA 1TFWA 4DQSA 2FDRA 2WVDA 1QJHA 3C6TA 4DN9A 4Y1CA 2QG9B 3H42A 3QUTA 3DLKA 1JLQA 3CJAA 3O6QA 2HF3A 3PJXA 1HQEB 1IBKK 4LFCF 3G87A 1I6JA 3I5CA 1WHVA 3CCEN 4E7JA 1X6JA 3OL6A 3R1LA 4F5QA 2J7WA 1GX6A 4CWBA 2E7WA 3H8WA 3BSAA 1UAXA 1YVUA 2E2OA 1FRJA 3HHLA 1SKWA 2RHSB 3ZSOA 3JSBA 3CJKB 4IFYB 1F5AA 2CQCA 2AXTU 2KM8C 2IJFA 4QIEA 1TKXA 4JI1F 3M2VB 2H3QA 2UUCJ 3U4LA 3KD3A 5LOQA 5IT9O 1S5ZA 3CJ7A 2NUBA 1RG6A 2DIVA 4DXLA 4Q0BA 4IO9L 3V1QA 3DI6A 4BUGA 1TMJA 2P9PA 2HOQA 3PRDA 1A6LA 1QAJA 3KHGA 2HNYA 7ICTA 5KFPA 3K8VA 3Q8QB 3TZWA 9ICFA 2GQQA 4LIWA 5GADI 4DV5K 4X84A 3MR3A 3F56A 1ESVA 1NK9A 2KW4A 1KFDA 4HCCA 4R25A 4NLWA 2U2FA 1HNZF 3VGVA 4CJ7A 1K1SA 5AKEA 1Y5IB 4O8KA 1NSKL 2B4VA 2KK0A 2F8SA 1AXQA 3AVJA 1SPBP 3HF5A 4NZ7A 3CI5A 3D3CJ 3CCQS 1N36J 3O4NA 4GKJF 2EG2A 3WX8A 5E3CA 3E0FA 3BGFA 2LXUA 3VQQA 5EOYA 4O0NA 1AW0A 2ZIXA 3TZZA 2CQBA 4FJIA 2M9NA 1UWBB 4MIAA 2BEFA 3MC1A 3LO3A 4PGXA 3MOJB 2A42A 5AM5A 2B8QA 2O8BB 5J1NA 4WFYA 1ELOA 4N77A 2KM8B 8ICOA 2ZBRA 2C2OB 5ETTA 2ATCB 1UZHA 3NGDA 1RAEB 4WQ5A 2KYZA 4GRSA 2VA8A 1PBAA 4IUFA 1KQQA 4IOCL 5F8HA 1AQ6A 1BHNA 3BZQA 2QZ8A 1J5OB 4CJLA 4KGMA 2CQ1A 1R0CB 1HWJA 2RF2B 3UE5A 3TSUA 1NGIA 5FP0A 3OVNA 3I0RB 1PK3A 5IV3A 5DDPC 1WAJA 1IV8A 1IG8A 4XH5A 2VIXA 3BQ2A 4C1NI 4OX8A 1S5JA 2RUSA 5AXKA 2XHBA 3DDIA 4LR9A 8ICMA 3G86A 5AQJA