2XY5A

Crystal structure of an artificial salen-copper basepair in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
581
structure length
581
Chain Sequence
AAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 211
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2xy5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2xy5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xy5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy5A01
3KHGA 4RW9A 1BQNA 4KLIA 4YXMA 5HHHA 4GC7A 4LZDA 1ZQQA 4DL4A 1ZQLA 4ZHRA 1BPEA 3K4GA 5J0OA 3VQ4A 1TFRA 4ECVA 2R8IA 4JRQA 8ICEA 1SUQA 2VA8A 3OHAA 1RBVA 4DL6A 2XY5A 8ICGA 2AQ0A 1BPYA 4ED0A 4PY5A 1NK8A 1JL1A 5BOMA 2ZUBA 1RTIA 3NGDA 1RBTA 2C2RA 3AVKA 3T5JA 2D0AA 2VWJA 5CA7A 3L8BA 5J2PA 1HUZA 4B08A 2OA8A 4YVZA 4RPYA 4QZ8A 4ELTA 1GOCA 3NBPA 4AHSA 4AH9A 1TK5A 2H5XA 3OYMA 4DQPA 5KFKA 1CZBA 5CP2A 4PHEA 2FMSA 1QLNA 4ED8A 4ECRA 1JLBA 4Z4HA 2FLLA 3PX0A 3LDSA 4IQWA 1WSIA 4BE2A 4IDKA 1TK0A 4HVJA 3AVBA 3BDPA 3D45A 3V9WA 2HMIA 1KRPA 2VA2A 4I2GA 4RW4A 1TKZA 4I9QA 2HW3A 2BCSA 1XWLA 3LWMA 4O3RA 4IQVA 4L8RB 4NLKA 5HRRA 2BQ3A 2HNYA 4O3QA 3LPUA 3VQ9A 2GWSA 3DLKA 2IMWP 5J2GA 3V1OA 3V72A 3WNGA 3KLHA 5SWMA 3SUQA 4MFCA 9ICWA 3RB3A 4CJ5A 2B21A 3B0XA 3P5JA 1XSNA 4IBNA 1X1PA 4CEZA 3JPNA 4QZHA 3KTQA 1ZQCA 4FO6A 4Z4EA 1EKEA 2DFHA 1XS9D 5KRSA 1HNIA 4M3RA 2R8HA 1RTHA 3MGHA 4TUSA 3HXMA 4XRHA 2Z1HA 4Y1CA 1ZQBA 3SI8A 2WONA 4OVLA 4M9LA 4M9JA 2ASDA 7ICHA 2JEFA 3EW9A 4EP5A 1REVA 7ICNA 4R66A 3QE9Y 3UXPA 4J9NA 4F2RA 3VA0A 2HHUA 4ID1A 3G6YA 3CQ8A 2XGPA 2BCUA 2IAJA 8ICYA 2XGQA 5L9XA 2O4GA 1WAJA 4ECZA 2W42A 2FPLA 1BPBA 5CR0A 4RQ1A 4FJ9A 3LDAA 9ICNA 4F5NA 4R5PA 3QERA 4NLZA 5DB7A 4EP4A 4CIFA 3PW5A 4IG0A 3WNEA 3MFIA 3RJFA 9ICCA 3H4DA 2JEJA 2KW4A 4Q5VA 4XQ8A 1XHZA 5SZTA 9ICTA 4RQ5A 1ZBLA 3OJUA 3TAFA 4M04A 3QEBZ 4CF9A 4IQUA 1ZQHA 2ZUCA 4KLQA 3PVXA 4KTQA 4CFAA 4FLXA 3VQDA 1IXRA 5IILA 3S3OA 3GV8B 2DFFA 2F96A 4RQ3A 3RRHA 3G10A 3GV7B 2NRWA 3HX0A 1B9DA 4UAWA 2DPJA 4W5TA 3PY8A 5KFYA 4KLFA 2R8KA 2DY4A 4ECWA 3AVGA 3DLHA 1Z26A 5KG5A 3H4BA 4EBCA 5L1JA 5J2HA 1IKVA 3PUFA 4FK0A 4KLHA 1ASUA 5J0TA 3LALA 2P6RA 5EU7A 3DRSA 1C6VA 1WN7A 3GV5B 3OVNA 3T1AA 3OYAA 4JK1A 1PZNA 4PGYA 3TQ1A 3TAQA 1MQ2A 3B6OA 1HNVA 5KFFA 3N4MB 3FDSA 1ZQDA 2OPRA 4F50A 4CJVA 4P4PA 3OHBA 2ASJA 1JLGA 4CF1A 3Q8LA 4N47A 1ZQAA 4NCGA 9ICRA 3ZCMA 4W5QA 4IR1A 3Q8SB 4M9HA 4DF4A 4GVMA 4AHVA 4YD1A 4CF0A 3TANA 4QZGA 5JS2A 8ICKA 2BANA 1IKWA 3M8RA 7ICOA 4DF8A 5I3UA 4O5EA 3D0PA 4QZBA 4JS4A 4QZEA 3C6TA 4UB3A 2MUTA 3ISNC 4FS1A 9ICGA 4MEXA 1HYVA 4FJ5A 1S1UA 1QSSA 1ZBUA 2YHBA 3LP2A 4CJSA 1ZBHA 4JWMA 1HJPA 4J9MA 4KHWA 1RCHA 2BPCA 4ECTA 1ZQJA 5KT6A 2X6NA 4E7JA 5L1LA 1TVRA 1UAXA 3ALYA 4OJRA 3SQ2A 2E4LA 2VG6A 4TSXA 1SKSA 2FMQA 8ICQA 2V9WA 4DG1A 4O3NA 5KFRA 1HQUA 4CHOA 4E1NA 2IGIA 5J2AA 3I0SA 1C0MA 5KG0A 1TV6A 2LYHA 1XI1A 4I9LA 1DOQA 5CJ7A 1EXQA 2J6UA 4F5OA 3F73A 4RQ6A 4DL3A 4LSNA 3KD1E 4M3YA 3EWAA 4J9QA 3TFSA 3OYBA 3HK2A 1K1QA 1CEZA 2F8SA 3VQPA 2O4IA 1NJWA 4CE9A 5DKWA 1RZTA 4YMOA 5KG7A 2RPIA 3KHRA 4B3OA 3H7IA 4P4OA 3V81A 5J2KA 4R8UB 2ALZA 2XC9A 2HNZA 4RW7A 4CJFA 4ECUA 1KDHA 3OYJA 3MXJA 3MDAA 2F1IA 3DLEA 4KV8A 3VQCA 8ICWA 2KN7A 4JV1A 4ID5A 4EYHB 7ICLA 4CGGA 1HRHA 4DLEA 3ZDBA 3V6HA 1XSPA 3JPSA 4DSEA 3AVLA 4FLZA 3RH4A 3S9HA 3GIIA 3UQ0A 4DS5A 4RPXA 3JPQA 3TARA 2RF2A 2Q0ZX 4GXIA 5HNKA 1BCOA 1A5VA 2KZ3A 1TKXA 4QZAA 1VK0A 2BHNA 4I2HA 2V4QA 1RT7A 3V9ZA 2HHTA 3K2PA 5DQHA 3OJSA 1VSEA 4FJJA 5J0RA 3MR6A 4NY8A 2KQ2A 5KT2A 1ZQTA 1J5OA 1T8EA 1VSIA 5J2QA 3O3FA 1L3SA 4K4GA 3MEDA 4F5QA 3LP1A 4DSIA 4KFBA 4CFCA 4KLJA 4KLMA 2YNIA 4Z6EA 4IR9A 7ICMA 4I2EA 1XO1A 2IBKA 2ZUDA 2C2DA 3P1GA 4KLEA 2W9MA 4F3TA 4YXJA 1JX4A 3VQBA 3PO4A 4O5BA 1Y97A 3RMAA 4HHTA 3RJIA 4PHAA 2EHGA 2P5OA 2PYLA 4DQQA 5DLGA 2HHQA 3GILA 3TAPA 4IG3A 4LY7A 2X6SA 4DTPA 4K8XA 4RU9A 3TFRA 5D3GA 2E6LA 1MC8A 4P4MA 4BXOB 4F3OA 3RH6A 3DOKA 4RNOA 4KN7A 3AA5X 2HB5A 4FJLA 5EWFA 2GV9A 7ICPA 3TABA 4Z4GA 3T5LA 2PZSA 3ZT2A 3GDXA 3HW8A 1BISA 1JLCA 3HYFA 4O5KA 2FBXA 5J0SA 2OPPA 4FK4A 4FS2A 5KGXA 4I2CA 3NGIA 3EZ5A 3NFAA 3QEVA 1HYSA 4ZTJA 4I2BA 3KK1A 4EZ6A 3PMLA 5DMRA 4R63A 1N56A 3DLRA 4DMNA 1KFSA 4H4OA 4J2EA 3PW4A 1ZBFA 5DQGA 4I2JA 3GIKA 4DLGA 4DFJA 1KTQA 5KFOA 4F93B 4YQWA 3QNOA 4TQRA 4RZRA 5KG4A 3MXIA 4CIGA 9ICPA 4CEAA 1FK9A 2OPSA 1U49A 5J2IA 3T3FA 1ASWA 5EOZA 2PFOA 2ASLA 3K5NA 3RJHA 5KFSA 1TAQA 1G15A 4MEYA 3ZD8A 8ICMA 3Q8QB 1COOA 1JXBA 1A5XA 5DB6A 4IRCA 3Q8MA 4I2PA 1RTDA 3L2QA 2ZQBA 3CFOA 4PH5A 3O4QA 2OYQA 4BE1A 4E7LA 4CJUA 3EPIA 3CYMA 9ICHA 1IM4A 3SV4A 4J9LA 1ZQUA 4ED1A 4KHUA 3SCXA 1BI4A 3PR4A 1RILA 1C7YA 1WCNA 4RNMA 3QEPA 3LWLA 2ZTCA 1L3UA 4B9MA 1B43A 9ICBA 3I0RA 5C24A 4NXZA 4CGDA 1S1XA 2UVWA 3RJJA 3CG7A 1EX4A 1LAVA 4FK2A 2PI5A 4YMMA 3V6KA 1N5YA 2PXIA 4I2AA 3ZDAA 3K75D 3PX6A 4CESA 3TAGA 4CEEA 1QTMA 4BGDA 2XCAA 3ORYA 3UPQA 2VANA 3AVFA 1U04A 3NF7A 3T5HA 2JLEA 3BQ1A 3VN5A 2BPFA 4E89A 1IG9A 4CEOA 1TKDA 8ICNA 3TWHA 3NCIA 4QWDA 4RNNA 4KHNA 2A1RA 3MFHA 3AVMA 7ICFA 2YNHA 1L3TA 1CXUA 4IFYA 1EXNA 5CYMA 4M3XA 5J2NA 5I42A 8ICUA 4LVSA 5KFAA 3N97B 1TVAA 1HQEA 2ZD1A 4M9NA 4BDPA 4FXDA 4KLUA 4FM0A 4RW6A 1B22A 1IH7A 4Z6FA 4RPZA 3FFIA 3SPZA 2BE2A 1CXQA 2IDOA 1YTAA 1KVCA 1N48A 3HP9A 1ZQOA 1DTTA 4CGIA 9ICOA 1S97A 3V7KA 3SQ1A 5J1EA 3SUOA 1IO2A 4ECYA 4M47A 4FJIA 3AO2A 2FLPA 4WE1A 5BPCA 2QKKA 3AO4A 1ZQNA 2C2EA 1H38A 4C8NA 3LZIA 1R0AA 5KFWA 1BQMA 3K5MA 2F1JA 4FJGA 3Q8PB 4G1QA 1YVUA 2FPMA 5D46A 4Y1DA 5KRTA 1KVAA 2RKIA 4CJKA 3O3GA 4FM2A 4B9TA 3G6XA 5IINA 8ICSA 2YV0X 5IIJA 2Z1JA 1ZQXA 1QS4A 3ZT4A 4OLBA 4QZDA 5CB1A 5DBCA 4MFAA 3SV3A 5L1KA 3E2EA 8ICVA 2Z1GA 1JIHA 3LZJA 5HROA 3HVRA 4F4KA 4J2AA 7ICSA 1RT1A 2NUBA 1SZPA 1WSGA 3LK9A 4M6WB 8ICAA 3OSPA 4UAZA 5KFVA 2R8GA 3RJEA 3K5OA 2BQUA 5HP4A 4OKJA 5HMLA 1C0TA 3OSNA 1NK6A 4K8ZA 1IKYA 3L3UA 1T7PA 1J54A 4KTZA 1YTUA 4I27A 1RT5A 2UVRA 3QEIA 2P1JA 1RT6A 4O5CA 1TL3A 4F8RA 4FCYA 1WSFA 4DOAA 7ICRA 4RUAA 4LZGA 1TAUA 3NGYA 4UBBA 4HCBA 3HP6A 9ICIA 1Z3EB 4F4ZA 3NHGA 1Q9YA 3LPTA 4CJPA 3KHLA 4QWBA 4PGQA 3V9UA 1JXEA 3L2RA 3RRGA 4E7IA 1BIZA 5JUMA 2RDJA 4DSFA 4LH5A 5KG3A 9ICFA 4DQRA 4EBEA 3EYZA 1TV9A 8ICBA 1BHLA 1RDBA 2FBYA 2BPGA 2ISPA 3MGIA 4J9OA 1MU2A 3V9XA 1SL2A 3ZD9A 2D0BA 1FKOA 4OGEA 4Z6CA 1NJYA 5C25A 1U48A 1RXWA 5KFGA 2KFNA 5DQIA 4RT3A 5K14A 4OLAA 1CLQA 4YFKA 3HPGA 3ETLA 2UVVA 4F92B 4DU1A 1DGSA 1RDAA 4CEBA 3DYAA 1A77A 2QK9A 8ICPA 2PI4A 2P5GA 3ISBA 4QAGA 4PWDA 5IIKA 4AHCA 1VSHA 4CHZA 5KFCA 3ZSZA 4N5SA 3OYKA 2GBZA 3T19A 4TUQA 4FLUA 3V1RA 5KT4A 4GW6A 4I7FA 3CM5A 4E0DA 2HHWA 3AA4A 1NKCA 1LB2B 3PO5A 8ICTA 4XUSA 4MF8A 1ZQSA 3WNHA 3IM1A 1XU4A 3QNNA 2B4JA 1ZQVA 2G8VA 4W5OA 3AU6A 1N6QA 4CJ3A 3RMCA 3RAQA 4K4HA 4CHPA 4DU3A 1U47A 1RTJA 4Z6DA 3MR2A 4LD0A 8ICHA 1X9WA 3IRXA 3HSTB 4QWAA 1WLJA 2BGGA 2A1JB 4FJMA 1UT5A 2AU0A 4DWIA 5CWRA 3C23A 4JLHA 4AHUA 4KB1A 1LWCA 3KHHA 3AO1A 2KZZA 2HHXA 4ECSA 1S0OA 1SV5A 1T03A 4O3SA 4MQ3A 3ZSXA 2EX3A 2OPQA 4AILC 1S76D 3KIOA 1T05A 1VSMA 1IKXA 1LWFA 2FC0A 1KLMA 3ZSQA 4AHRA 4CHQA 4Z4FA 4PPXA 9ICJA 4RT2A 4I2FA 4OKKA 1B92A 5HMMA 3PX4A 3HPHA 3PMNA 4O0IA 3QETA 1MSWD 4JRPA 1ITGA 4O3PA 4QOZB 1ZETA 4M3UA 4Q8EA 4B9SA 3M8PA 3GQCA 4CECA 3QINA 1RT4A 1JMSA 2ETJA 2W9BB 3VQ6A 3HT3A 4FLTA 3QESA 3OYIA 1RBUA 5KT3A 3RBDA 4JUZA 3HO1A 3JPOA 4R65A 4KLOA 3ZT1A 4HTUA 1RYRA 4I28A 1Y88A 1NOZA 2UVUA 1ZBIA 4O55A 4Q44A 1S0VA 1DLOA 5IIIA 1U9LA 4M0AA 3RAXA 4QWEA 2ISOA 3C6UA 5IIOA 4M3WA 4FBUA 3VQAA 4EZ9A 2ZE2A 5HBMA 1X2IA 1L5UA 3RB4A 2E6MA 5KG6A 4O44A 3IG1A 1RDCA 4FJXA 4F5PA 1ZJNA 3MEGA 8ICFA 1SKRA 3AO3A 4CEFA 1BCMA 2Y1JA 1BPZA 5KFEA 3TI0A 1TGOA 4ED3A 1QHTA 4F91B 1ZJMA 2GUIA 2YHAA 2ZJ5A 4CHYA 3L2WA 3H8WA 5IIMA 5KFJA 3NTUA 2RDIA 2W8LA 1KFTA 3L2VA 8ICCA 3NAEA 3ZT3A 3RJGA 2B6AA 4KI4A 5CYQA 1U4BA 4RQ2A 3HL8A 1TL1A 4UB5A 2FBTA 4FJHA 5TZVA 3NGZA 4BWMA 3MEEA 1QE1A 5CZ1A 8ICLA 5J2FA 4OKEA 3AUOA 4CFBA 5HRNA 3DOLA 3AV9A 2P51A 1LAWA 4JV0A 3AA3A 1D5AA 1ZQKA 3MBYA 1JLAA 2ATLA 3KD5E 4FM1A 1HPZA 3VQ8A 3S3MA 1YT3A 5J0XA 3ZSYA 3ZSRA 3MDCA 3DRRA 4NLNA 5DGBA 4FJ8A 3RTVA 4DTNA 3KLEA 4B8CA 3AVAA 4YR2A 3F9KA 3QZ7A 1VRTA 3CFPA 4CJWA 1S6QA 5HHIA 2XO7A 5KFHA 2X78A 5CZ2A 3KK2A 3AO5A 4F2SA 4YFUA 5KFZA 2XY6A 4QWCA 2XCPA 5T7BA 1D9DA 1CZ9A 3RR8A 1K6YA 3QIPA 2ZJAA 4F4WA 3V6JA 4DL7A 2PFPA 5HRPA 2FPKA 1ZQMA 3HPOA 3ITHA 4KHQA 1EETA 4CK2A 4K4IA 4G3IA 4KPYA 4H4MA 4DTMA 3IS9A 3PW0A 5DBAA 2J6TA 4UQGA 4CGHA 4HUEA 3CM6A 2AJQA 3EPGA 4M2YA 2C28A 4MF2A 1W9HA 2OWOA 4NCBA 4UB2A 4LSLA 2ATQA 2V4RA 2ITGA 4BACA 8ICXA 1QQCA 5KFUA 1I3AA 1NK5A 3RMDA 3JPPA 1ZQRA 4KI6A 2G8IA 4TUPA 1UOCA 2JGUA 4HYKA 2Y1IA 2A1SA 4E19A 3OS2A 3KKSA 1NKBA 3ZDDA 3Q8KA 4KLDA 3QIOA 1T3NA 2OZMA 5KFMA 3EY1A 4N41A 1NK4A 5DDYA 2HHVA 4KLLA 2WTFA 3LP3A 4HUGA 4ECXA 3AA2A 4CF8A 3JPRA 5J0UA 4RQ7A 4DQIA 5FDLA 2BQRA 4M41A 4KLTA 4PQUA 3RWUA 4DTUA 2HVHA 4M3TA 3KK3A 4FJKA 3BQTA 2QKBA 3AU2A 3M9MB 3V7LA 1TKTA 4HUFA 4OPJA 3HVTA 4CFDA 4YP3A 3Q8RB 2G8KA 3M9NB 3GIMA 1KLNA 2HHSA 1GOAA 4Q43A 4BXOA 2NRVA 2VA3A 3SUPA 5J29A 3AVIA 1Q9XA 1A76A 2W9CB 1HYZA 1UT8A 4DTJA 4CJEA 2D5RA 4PUOA 1ZYQA 4CF2A 4KN4A 1D8LA 3OYFA 3NDKA 7ICTA 4CERA 1VSJA 4C8LA 4ED6A 3BJYA 1C1AA 4O9MA 2FLNA 2P66A 9ICLA 4CJ4A 3LANA 5KG2A 4I2DA 5J2CA 4FBTA 2PYJA 4ECQA 5D49A 4B9NA 2KTQA 4RG8A 1UA1A 1S1WA 3PR5B 4O3OA 2AGOA 1WSJA 2AGPA 3V6DA 2VWKA 3C2MA 3THVA 1O1WA 3AVJA 5J0QA 3C1YA 1HJRA 3NE6A 3H08A 4NYFA 4XIUA 4YN4A 2XY7A 3QLHA 3V4IA 2BCVA 5KG1A 3KLGA 4IFVA 4FZZA 1S9GA 5F9NA 3C21A 2VG7A 2NRTA 4R64A 3ULDA 8ICRA 4CK3A 4HCCA 1BVSA 5DLFA 4B8AB 2D0CA 4BWJA 1KEJA 1WCLA 3UXNA 4GXJA 1S1TA 4JV2A 4CCHA 1VSKA 3C5GA 8ICOA 4M6WA 9ICSA 3E01A 3KKRA 4PHDA 4Q0BA 1I39A 4DOBA 3PW2A 2B5JA 4FLWA 1RPLA 2R8JA 1KCFA 2IS3A 4KMUA 4M42A 2OZSA 3RJKA 3B6PA 5DK5A 4W5NA 4AHTA 3L3VA 3OYGA 1D8YA 9ICMA 9ICQA 3ZDCA 1BGXT 3RB0A 3MXMA 1JL2A 4MFFA 3OYEA 2YNFA 4J9KA 1RT3A 4I2IA 3ZDEA 5HLFA 1ZQWA 4IQTA 4IRKA 4FJ7A 4CHNA 3DI6A 3GIJA 4TQSA 3WNFA 4RQ0A 4KHSA 1JXLA 4B9VA 3H8JA 1S9EA 3NH1A 3V9SA 3L2UA 1CUKA 4B9UA 4M45A 4O4GA 5HP1A 1WSHA 4ED7A 2YKMA 8ICJA 3LP0A 2ZJ8A 5KFQA 4GMJB 4IRDA 3K58A 4DO9A 2IHNA 2NRZA 4GLXA 3I8DA 4BDYA 1Q8IA 2QXFA 4OGCA 2MUTB 2IC3A 5KFIA 3P83D 4W5RA 3SPYA 4GC6A 3OY9A 2DPIA 4CEQA 3A2FA 3PV8A 4ZH4A 1FKPA 1WSEA 2XHBA 3NH2A 5KFTA 2MAXA 1J53A 1AROP 5KT5A 3AVNA 1Z00B 1RBSA 4DEZA 3VQ7A 3ZSWA 3H40A 3NF9A 1A5WA 1DTQA 4DFKA 4F4XA 3HJFA 1SKWA 5KT7A 1VRUA 4EYIB 1S6PA 3C2LA 1ZQIA 4DSJA 5KFXA 4PHPA 4J9PA 2R7YA 1SL1A 4YG2A 4C8MA 3QO9A 3BQ2A 1BIUA 4FZXC 2W9BA 1NOMA 2IHMA 7ICUA 2NRXA 4C8KA 4FLVA 4Q8FA 4YCXA 2IA6A 4FLYA 9ICKA 4ELUA 3AVCA 2FBVA 3O4NA 7ICIA 5C42A 4JS5A 3NF8A 4KHYA 4R8UA 1NK9A 1BI4B 4FVMA 3V1QA 4KLGA 1C1CA 2DFEA 4RUCA 4X5VA 4J2BA 3MECA 2BCQA 4ICLA 4H8KA 1NJZA 1J9AA 4EEYA 5HRSA 4FW2A 3OGUA 5KFLA 2AGQA 3RR7A 1V9PA 3OYHA 5J2MA 5KFNA 2DFLA 1U45A 4NLGA 2AQ4A 4ELVA 1T4GA 3M8QA 5KFPA 2A1JA 4N56A 2J6SA 4LH4A 4CIEA 4E7KA 3OYCA 4CK1A 1W0HA 1NK7A 3QZ8A 3SYZA 3VQEA 3S3NA 3AVHA 4DFMA 2LSNA 4NCAA 2I5JA 4TURA 2BR0A 3U3YA 5DG7A 2IOCA 7ICGA 4FYDA 3TAMA 4QZ9A 4QZCA 4KREA 1ZQPA 4QZFA 4DQSA 4UB4A 1QSLA 4XA5A 3RBEA 1JLFA 3ISDA 4I2QA 5KGWA 4DTSA 4J2DA 4DL2A 1ZQEA 3SNNA 4E7HA 4CJLA 1FXXA 1KSPA 4DS4A 2X74A 4ZTFA 2JZBA 3MR5A 1EP4A 3U3GA 2YNGA 5EWGA 3QEAZ 1MQ3A 3FYHA 2PY5A 4J9RA 3TR8A 3TAEA 4YD2A 2BKEA 1Z25A 1WAFA 3OS0A 2M9NA 5DG9A 2WOMA 1JLEA 4RQ4A 4UBCA 4DOCA 4Z4CA 5C5JA 3MR3A 3C1ZA 4QZIA 4YMNA 1JKHA 4ED2A 3DRPA 3VQQA 3QEXA 2Q3SA 4PGXA 3OYDA 4QW8A 3IAYA 1C0UA 2F8TA 5JS1A 3B0YA 7ICKA 1BPDA 5J0YA 1RDDA 9ICXA 2G8FA 1NK0A 5DG8A 3CFRA 3BQ0A 4N76A 5FRMA 3BGRA 2RN2A 2P6UA 4BE0A 4CEDA 4DU4A 3DLGA 4YR0A 5D4BA 4CJTA 3VA3A 2KZMA 1ASVA 5E41A 4KB0A 5EWEA 3C95A 1NKEA 5KI6A 4M3ZA 3OS1A 3ASMA 1BL3A 2HVIA 5DB9A 1X9SA 5DGAA 4CJQA 3JPTA 3MAQA 1QSYA 3SJJA 2KFZA 1UWBA 2ZTEA 3SQ0A 4DSKA 4BDZA 3NH0A 4E3SA 1RNHA 3UXOA 3O3HA 2BGWA 3JYTA 4KTWA 1C1BA 9ICVA 1XC9A 2BDPA 2Z1IA 1X9MA 1XHXA 4DSLA 3UIQA 3SZ2A 3ZT0A 1RT2A 3LAMA 4UB1A 3G6VA 4KKOA 4FJNA 3QEWA 5FRNA 1KFDA 1GOBA 2G8HA 2JEIA 4Z0UA 1S5JA 4JWNA 4CGFA 3SI6A 2G8WA 2W8KA 1S77D 1NJXA 3SUNA 5J2DA 1ZQFA 4P2HA 4C8OA 4CGJA 2G8UA 3HWTA 1S1VA 4E1MA 5J0PA 4Q45A 1B9FA 5DBBA 3C2KA 2DTUA 5DB8A 4OPKA 2JEGA 3IHQB 9ICEA 1LWEA 5CHGA 3ZSOA 3LAKA 1SL0A 4YNQA 3H8SA 3DMJA 3RMBA 1VSDA 1D9FA 4DL5A 4Z4IA 9ICUA 4J9SA 1VSLA 1VSFA 1S0NA 4DTOA 3K5LA 1NOYA 3ZSVA 1S0MA 3KLFA 3VQ5A 1S10A 1JN3A 3C5FA 5J2JA 4I29A 4NYNA 5J2EA 4RW8A 4PA1A 5BOLA 3ISCA 5KFDA 4RQ8A 4IKFA 7ICQA 1ZQYA 1LW2A 2PFNA 4KO0A 3PW7A 1BPXA 2I1QA 3M8SA 2BCRA 3DLBA 5DDMA 2C22A 3DM2A 1ZQZA 3K59A 3GFKB 1F21A 3SQ4A 5KFBA 2HNDA 5L1IA 2XRIA 4FW1A 1RBRA 3KLIA 3V7JA 2I9GA 4F4YA 4M9GA 4UAYA 4KRFA 3C94A 5J2BA 5J0WA 2W9CA 4DTRA 4MFBA 5F9LA 3M9OB 2PFQA 3PNCA 4KLSA 5FROA 5KTQA 3JSMA 3KJVA 3T5KA 4NM2A 1LV5A 2YKNA 7ICJA 1XSLA 7ICVA 1S9FA 9ICAA 7ICEA 1RXVA 8ICZA 4QCLA 4CJRA 1Z00A 3U6FA 1HMVA 3G0ZA 1KVBA 4DFPA 4KAZA 4O0JA 1L3VA 3OYNA 1WNSA 2VG5A 4B9LA 2F1HA 1HUOA 4F5RA 1UA0A 3OYLA 2JZBB 1ZQGA 4YR3A 3NF6A 8ICIA 4KITB 3RB6A 1RYSA 3MABA 1JLQA 3UQ2A 1TK8A 4GXKA 2W9AA 3HM9A 3RH5A 4FZYA 4EBDA 2ZTDA 4DTXA 1K1SA 2FMPA 3K57A 4NM1A 4QW9A 5CY4A 2XY8A 1LW0A
chains in the Genus database with same CATH superfamily
2RNEA 3KHGA 1HFEL 2C1EB 3HCXA 5ETQA 1U7LA 5B0FA 5LSOA 5HHHA 4U6PA 3VOVA 1ZQQA 2HFZA 4DL4A 5E3CA 3DKDA 1BPEA 3JTOA 2BJ1A 2EC0A 3PYFA 3K4GA 3ULHA 5M1OA 1TFRA 1UFKA 5ETNA 4JRQA 3QFUA 2OEKA 4IEEA 2G09A 1NK8A 1O08A 2MHEA 2AIRB 1JL1A 1RTIA 2E5JA 2C2RA 3AVKA 2D0AA 3R1LA 2V4JB 3BGLA 5CA7A 5AM4A 1WC3A 2C3OA 2DBBA 4YVZA 3G8QA 2A1AA 4QZ8A 3N79A 3NBPA 6FD1A 4B3MF 1GOCA 3WKEA 5JLHA 1TK5A 2V8DA 2N3OA 3WXMB 4A8FA 3OTQA 2F8EX 3SMPA 4JYAJ 4CH7A 3HJEA 4PHEA 5JLFA 1QLNA 5AE2A 2EEYA 1LK5A 4Z4HA 2G08A 1S72N 3KBBA 4IQWA 4KYZA 3EWGA 4B3RF 4HTLA 3VAJA 2GVZB 5B0BA 5AJ3F 4AL7A 3D45A 3V9WA 1KRPA 5IXUA 2BACA 2LXFA 3VESA 1T94A 4UTGA 3OL9A 4DI6A 5AT1B 1J5EJ 1VQMS 3B6BA 3W5ZA 4L8RB 4BR4A 5HRRA 1QTNB 3R2CJ 4CBUA 4NLDA 4ID8A 1VMBA 3FAHA 2HRUA 2OPRB 1RHQB 3B8AX 3BKTA 2DNPA 1QZ5A 3X1LB 1FA0A 2GWSA 2IDLA 1H6KX 4FKXA 4LIRA 4IFVB 3N7RC 4DR7F 5SWMA 1SH0A 4MFCA 2EK6A 1IV8A 4Y2SA 5ALRA 4JI1J 1H74A 3PJWA 1FD8A 2B21A 3B0XA 3P5JA 5H1SV 4RNFA 4IBNA 3PFOA 1L7NA 2GJIA 5J2NB 3JPNA 1LWFB 2FXUA 1OW5A 3CI5A 3NMRA 1NHKL 2HK2A 3L7OA 3A8EA 4B1VA 3KTQA 3HHNB 3BS5A 3IGNA 2ZUGA 3WQPA 3D1OA 2BM0A 2HS0A 2VPZB 2E5LF 2FY8A 5HL7L 5GAEI 1XS9D 1HNIA 2R8HA 2MQQA 4JI5K 3MPYA 2P9KA 2Z1HA 3WEEB 4K0KJ 4CT8A 2VKQA 2QARB 2OTJN 4EO6A 1IBKK 3SI8A 2LCWA 2XS5A 5ALYA 3L3FX 3EZWA 7ICHA 1REVA 1YHQS 2IYGA 2PA8D 4R66A 2SXLA 3QE9Y 4F2RA 3VA0A 2DNLA 3A3OB 1EQ0A 4L75A 5TKWA 1ZD5A 3GE1A 2QG9B 2YTCA 1DKGD 8ICYA 4BLGA 3UFCX 4ZP9A 2QTWA 1K8KA 1ZTTA 3P8BB 4X62J 4FJ9A 3QERA 4U7CA 4NLZA 2XZTB 3OR2A 3VVTA 3QQCD 4CIFA 1FRJA 1SH2A 1Z2ZA 2XO6A 4DR5F 1SQKA 3D6TB 9ICCA 2QFIA 1U1PA 1FKAF 4I7FB 2K3KA 2YQ1A 1NJIT 3O0FA 3EVMA 2EFNA 3MMCA 1KS2A 4P75A 4PXDA 3PLAA 3QU2A 4PG5A 4GY2B 2F4VF 1ZBLA 4A8WA 5FPEA 5IQQA 3QEBZ 2JFKA 1XIQA 2V51B 3BN4A 2AXTU 3H8YA 4KLQA 2C2ZB 1QUPA 4KTQA 3BSNA 4EGLA 3PIPL 3VQDA 4ZMMA 1G3OA 2V2KA 5LJ5Y 3S3OA 2F96A 1AUDA 2AKWB 1DK3A 4H0OA 2DQNB 3V5RA 1GLDG 3C7NB 1WC4A 3CMAN 5KFYA 5AM2A 2R8KA 2DY4A 2KKHA 1NMNA 5G5GA 2W3RA 2BH1A 3UVJA 3H4BA 3CJ8A 3S41A 3MAAA 1TP7A 2H4WB 3CPWM 4YOTA 4EHUA 1CJTA 2BKNA 3H1VX 3PUFA 3LALA 1ASUA 4JKFA 5AQGA 3T1AA 2DIUA 1PZNA 4PGYA 1IBMJ 3QBWA 1HNZJ 7AT1B 4JD2B 1HNVA 5E84A 1D8ZA 1H2TZ 1ZQDA 3JB9k 4M94A 1U8SA 4HT7A 3IKMA 1MDUB 5TISU 4P4PA 3AAQA 4NYZA 4WCEQ 1JKHB 3Q8LA 4UB6U 1MLAA 4JV5J 3IBFB 4U67L 2E1RA 4N47A 1RAGB 4NCGA 2X1FA 9ICRA 3NG8A 3BR9A 1K9MT 3ZEUB 4AHVA 3HF5A 2MZRA 1A0PA 4JD2A 2EBEA 4I4BA 3P5TL 3VQSA 2D3UA 2RE2A 2YNGB 2X7IA 4O5EA 4JS4A 1GAOA 3ZYYX 3QRPA 4UB3A 4HACA 4FS1A 2J9DA 4F04B 2M3DA 1HYVA 2DCUB 2M0GB 1S1UA 3ZZOA 2YHYA 3LP2A 1U0HB 2E7XA 3AGRA 5KT6A 3K89A 3IGVA 1KD1T 2XMUA 3ENHA 1I1GA 5AQOA 1ZAWA 2XS2A 2VG6A 1TUGB 1NB7A 4TSXA 4IUFA 2V9WA 3OPKA 2NO5A 1UFLA 5TKYA 5KFRA 1UJ6A 1VR6A 3ZXWA 4DN0A 2APOA 3DDIA 3TA2A 5AQRA 1N4LA 1SI9A 1C0MA 3TSPA 3R5DA 3T9NA 5CJ7A 1TUVA 1X4DA 1SC6A 2J6UA 3DRXA 4F5OA 3MM6A 3BP8A 4P9SA 3EWAA 4D3GA 4M63C 4PWUA 1N33F 2OD6A 1K1QA 5HR6A 6AT1B 5AQLA 3P31A 1GMUA 3MM9A 5KAIU 4P4OA 5AQSA 2ALZA 4JB3A 2VU5A 4ZLNA 3SBMA 2B8PA 2QT7A 1KDHA 1N2XA 5HMZA 3MDAA 2F1IA 3DLEA 4KV8A 8ICWA 7ICLA 3V6HA 2RSQA 3RH4A 1PYTA 5LSRA 3R97A 3SQGA 2R7TA 3UQ0A 3TJ9A 3NUQA 4DS5A 3LDQA 1H73A 3G82B 3R6MA 2YX6A 4DPXA 3MI7X 3NS5A 4URQU 1URRA 2VFRA 1RLDA 2KZ3A 1FX2A 2ILZA 4QZAA 4NCGB 2BHNA 5D77A 2NPFA 1TQLA 2VBXA 2CGLA 4NB4A 3OJSA 4NY8A 1QQNA 2KT5A 4QS8A 2WAQF 1Q46A 1VSIA 4URSA 1Z4NA 4QPXA 3GYXB 4KHRA 4BRNA 4CFCA 2OKQA 4KLJA 2YNIA 4BVOA 1NM1A 3CCMS 1A7GE 7ICMA 4I2EA 4X4SA 4DCJB 3CXCR 1XO1A 1LKYA 2IBKA 1VQ9S 4DPTA 3CCEN 2B6GA 1Y97A 1A9NB 4HHTA 3RJIA 2P5OA 4DQQA 1EX8A 5DLGA 2FTRA 3TAPA 5K8OA 2DH9A 1Q81O 3IG1B 4K8XA 5D3GA 1IUJA 3KYLA 2LEPA 3ENQA 4KN7A 1PKUA 3QT6A 3DXSX 2GV9A 3TABA 1MMDA 1WHWA 1TU0B 3T5LA 4H0XB 4M7YA 2K8CB 2ZXIA 1E6YB 1WF1A 3GJRB 1FDNA 2WBNA 1N61A 3DI6B 2KG1A 4CO4A 4RW7B 2OEHA 1BISA 3HHKA 5J0SA 2OPPA 4FS2A 1UVMA 1NU4A 3CC7N 2E2NA 4V1Ak 3NFAA 1FDAA 2O66A 3KK1A 3D6JA 2P9CA 1N56A 2Q0RA 4J2EA 3TUPA 3PW4A 3BUZB 4K4SA 2VQEK 2E1ZA 5LT5A 4W98A 2CWXA 4WPAA 1JQGA 5KOWA 1JNRB 5FPDA 5GAHP 1FK9A 3FSYA 1M6YA 2OPSA 4JI3K 4KGKA 1ASWA 3M1YA 3K5NA 3H5SA 4CLLA 1SGGA 5KFSA 1G15A 1KVKA 4J8FA 2WONB 2KG5A 4IO1A 1V6HA 1MROA 3WQTA 3Q8MA 4I2PA 3FCVA 1RTDA 2BJDA 3BYRA 1FRXA 1SCJB 1IV0A 1NNLA 4PH5A 3W9IA 3MR7A 3V4IB 1VFJA 3UD3P 2ZWOA 1LKYB 4B1ZA 1IM4A 3T1YK 3TUZC 3ZNUA 4PAAA 5E2QA 3SCXA 1YIJN 1UWAA 3OVAA 1AUSL 3TYTA 1T6DA 3ZZPA 2WSFC 3OR2B 3ZZ0A 3K5PA 4NE9C 5HL7Q 2Z2ZA 4RNMA 5F8GA 3QEPA 1YJWN 3LWLA 1L3UA 2D6FC 4BRIA 4QNLA 1NGEA 3CP8A 3DDKA 1H3DA 4CGDA 2W6LA 1S1XA 2I7NA 1FRKA 3FCWA 4RLEA 1OH8A 3NAIA 1O13A 5B5EU 1W7AA 4YOEA 2ACYA 4ZA1A 3TAGA 4LF8F 4FXVA 4OX8A 1QTMA 4BGDA 2XCAA 1W25A 3UPQA 2VANA 3T5HA 2CQ0A 4C7QA 3VN5A 4IFEA 5LMUF 3TKAA 1TKDA 2P5VA 4WYWA 3Q8UA 1UJ5A 3MN7A 4ZVUB 2A1RA 2NV3A 2O8FA 2ZUAA 3FRZA 3I31A 4IFYA 5DM6L 3MUVP 4LFAJ 2Z8QA 2AEJA 4P6QA 5I42A 2H4YB 1D4XA 1NGGA 8ICUA 2FZCB 1SQGA 3N97B 5AIAA 2G0IA 1ZOTA 2CNNB 4FM0A 4RW6A 4LF6J 3Q24A 1IH7A 5BRDA 5ALLA 4RPZA 5GIOA 3SPZA 2WK4A 4OX9K 1IG8A 1I94K 4A5BA 2DR5A 4I2PB 1TV6B 9ICOA 2NYHA 3UPFA 5DRKA 2JDJA 2V7ZA 3OR1B 3SUOA 4M47A 1GLEG 1RT4B 2UU9F 4DV6F 4L3NA 2QKKA 5M1KA 2AH5A 1K9MO 1J27A 1RU1A 3WT0A 3P4IA 3IBPA 3K5MA 2F1JA 4OCZA 4RBTA 1M90O 1EB0A 1YJVA 3WBZA 2DRAA 1YVUA 1YHQN 3DOMB 5ETKA 4Y1DA 5KRTA 4ZVFA 5C7PA 1DZ5A 3HZ6A 3O3GA 2RS2A 1YKWA 3Q7BA 3G6XA 8ICSA 2VJUA 5AK3A 3CDUA 3OBYA 4OZ5A 5IIJA 3CC2S 1VK8A 3ZT4A 3M6VA 4CO1A 4DUTA 2ZEJA 4ZVSB 4K4YA 8ICVA 1JIHA 3HVRA 7ICSA 1RT1A 3CW2C 3H2LA 3LK9A 4FPBA 1SAZA 2ZJQL 3K5OA 2QA1A 2BQUA 1S1TB 1HPMA 5HMLA 4NXNF 2R42A 2XICA 3OSNA 2PBDA 2DF4B 3MMBA 3L3UA 1JRPA 1IBMK 1EHWA 4KTZA 4UOCA 5D0EA 2ASPA 1YTUA 4CZCA 3EL2A 2BM1A 4O5CA 5K8PA 3HFVA 2KKPA 3CQYA 4FL9A 3FEXB 5CZXA 2MQNA 3NY0A 1KQSR 9ICIA 4CF5A 3CJQA 3NHGA 1RAIB 2FHJA 3CMAS 5DM7Q 1NH8A 3NVYA 3V9UA 2A18A 3BEXA 3CJCA 5MAOA 2H48B 4YOVA 3CJKB 4LH5A 5AQHA 5AK4A 1WTFA 5KG3A 1T3OA 9ICFA 1HNXF 1U1KA 3BS7A 1TV9A 8ICBA 5K20B 4MKYA 2ISPA 1BUPA 2NUHA 5B0AA 2FBYA 2UXBK 4JI7J 4OYXA 1U26A 3G25A 4MLEA 2AA4A 1FKOA 1PC4A 5HBMB 3FC4A 4OGEA 2ZNYA 5C25A 4GRSA 4OZ0A 1RXWA 4XDDA 5HP1B 3KOAA 3ZX0A 5C0YA 4F92B 2GQCA 5GAGU 4CEBA 3KOOA 3ISBA 2DHHA 3G82A 5BPLA 5C2GA 4PWDA 3D0GE 4IZ9A 5IIKA 1B64A 3TZZA 2K7KA 4KH0B 5DJBA 5KFCA 3ZSZA 2QMWA 4QYRA 4X84A 2MLXA 3IMQJ 3MCSA 4GW6A 4I7FA 3VALA 4CLKA 2VUGA 2HHWA 1LB2B 5F8IA 5AQNA 4OX7A 4X62K 2GGPA 4MAKA 3G71S 2ABYA 5KL8B 3A5MC 2IPOB 2VKRA 3QNNA 3NEKA 1ZQVA 2G2ZA 2QWRA 4W5OA 1VQON 3RMCA 3VEZA 3T1HF 3IR6B 1DXSA 1I51B 2G1DA 2V8VA 1KQKA 2XLIA 5AQUA 3MR2A 3HD1A 5T7LB 1REVB 2VOOA 3GFYA 4A2AA 4QWAA 4TVAB 3MM6B 2BGGA 3SMZA 2ZNZA 4JLHA 2P9LA 2M52A 3W8GA 3GFHA 4DHYA 1RA6A 2KZZA 3WEEA 1XMBA 3GL1A 1S0OA 1SV5A 1XR6A 2HFVA 2P9IA 4O3SA 3AA8A 3VPZA 3RFAA 4JI4J 4AILC 2YVSA 1M5KC 4DUYF 1GXTA 1VSMA 4UW2A 1LWFA 1LOTB 5HR7A 1PYOB 3OL7A 4M7XA 4OKKA 1LXJA 2CQIA 4NLQA 4WFAQ 4C48A 1MSWD 4EFHA 2VDIA 2XZWA 3THTA 4QOZB 4X4RA 5MLCV 4M3UA 2PSZA 3M32A 4B9SA 3BGRB 2NXUA 1RT4A 3QESA 4KH1B 2KL8A 5KT3A 1WG5A 2HG4A 3JSMB 1R0BG 3HO1A 4KR0B 3BSAA 2AYBA 2A6OA 2IM2A 1GTHA 2OLWA 4I28A 1ZBIA 4N77A 4O55A 1Q8BA 1B4FA 4GNIA 3J81j 3C6UA 3CRXA 5AKEA 3VQAA 2ZE2A 4USAA 3UQSA 4YUDA 1RDCA 3QRRA 5E33A 1FKOB 4NYOA 2IIHA 3QGHA 3MEGA 5AZJA 4RUBA 4H5RA 4L72B 3TZYA 3AO3A 1BCMA 4CEFA 4IO9L 5D4OA 3BGOP 5IM0B 1NDCA 3L6QA 4DV5F 1TGOA 1KR4A 4PL1A 2H3ZA 4CO2A 4EMDA 1FXDA 3GONA 3ATVA 3CNHA 5GMDA 5IIMA 5AE1A 1RG6A 2RDIA 1BHNA 5LXYA 3RJGA 2B6AA 2QWLA 5CYQA 2OH2A 2CA9A 3SIPB 2GELA 4UB5A 2PN6A 3ET6A 3GCXP 4FJHA 3VETA 5TZVA 4JKHA 3KKAC 2BW2A 2ROGA 3TVKA 4OKEA 1PVRA 2B7BB 4FDFA 3UKUB 1YUWA 4ETXA 1T02A 2WB4A 3AV9A 2DYAA 1B0TA 2AV5A 1D5AA 3R1XA 3H90A 2CPRA 4ZIWA 2DHGA 3KD5E 3ZTOA 4ZJOA 3VQ8A 3S3MA 1KTVA 3ZSYA 1JLGB 3DRRA 5AQFA 3RTVA 2X3DA 4DTNA 3WK9A 1YWXA 2FVPA 3F9KA 1VRTA 4KHPF 3H2VE 3JAMY 1HLUA 4FWPA 4NZ6A 5J8YC 4K25A 4GVLA 5KFZA 1KQSM 3LDOA 1XERA 3B9JA 4GMKA 3SENA 2ZJAA 4K2XA 1RAOA 1SIWB 3A1YG 1REGX 1C4CA 3B4MA 1EETA 3NS7B 2G9OA 4QS7A 2CXYA 2F40A 2A3ZA 4DTMA 2IAJB 3D2EB 5EOYA 2P9NB 3QBCA 3CM6A 4JKGA 3G6EN 2C28A 4MF2A 4J9UE 2OWOA 4NCBA 4OO1J 5AM1A 4LSLA 5AJ3K 1OSCA 3VZHA 3HI0A 2R7RA 4OJ3A 2FVQA 3RMDA 2YPYA 4DV7J 3T1HJ 3QMQA 3A0BU 3QAUA 1HBUB 2A1SA 3THWB 4LF5F 3CD6S 4OPAA 4QIGA 5ALOA 2EXUA 1SZ2A 3EY1A 4NEYA 1X4CA 1NK4A 5DDYA 2ZD1B 4KLLA 2HFSA 5L9NA 4ATNA 4HUGA 2BVZA 4B3MJ 2E5IA 1ZS6A 2QB1A 3BZCA 4CLFA 1LK7A 1KWMA 2GJ2A 3FJ2A 2LMIA 2QE5A 1BNOA 1WHVA 2BQRA 4KSEB 2BKOA 4YOXA 1NPKA 3IRUA 3C14B 3KK3A 4FJKA 2QKBA 3U4LA 2YHWA 4HUFA 2PGCA 4OPJA 2O67A 3QMLA 4KX3A 4UOGA 4B6JA 3KWMA 4IWVA 2EG1A 1Y10A 1TYQB 1Q9XA 2DNQA 3CE8A 1Q86O 1HYZA 2K1RB 4IKAA 4PUOA 3R9KA 1F2GA 2WF9A 3PEHA 4CF2A 2DY9A 2PFFB 3OYFA 3NDKA 2HI0A 1VSJA 1FJ7A 4ED6A 3BJYA 2L9NA 3O1BA 2E2OA 2B4VA 5KG2A 5K8NA 2PDAA 4OX9J 3BS5B 4B9NA 5JMNA 3OBIA 3M1FA 4CE6A 3PACA 3E66A 3KKAA 3AMZA 1UA1A 1X5SA 3PR5B 5ETLA 3MPUB 2AGOA 1YJNS 4CT9A 2W24A 2VWKA 1RU2A 2J0SD 3C2MA 3AVJA 4WQ4C 1MWKA 3NE6A 4XIUA 4PCQA 4YN4A 2XY7A 3QLHA 2CVEA 3DAWA 2GWKA 2QFJA 1WG4A 3KLGA 1R59O 2NZ4A 3RRKA 3NASA 2FHJD 2FJEB 2NRTA 4U7UD 3THWA 5ALNA 2CWKA 5LJVA 3ULDA 2FI1A 4BUGA 3HZGA 5DLFA 2QMXA 1SJRA 4B8AB 3ILIA 3I96A 3MM5A 4BWJA 2OI2A 4MJKA 4KH4A 3VF6A 4USMA 4NXNK 4OJHA 2LQ8A 3CNQP 4OYBA 4CLYA 4JV2A 4CCHA 1BE4A 3ZO7A 4JI2K 3E01A 3HRGA 4PHDA 2F3JA 3Q22A 1I39A 2UUBJ 2B5JA 2HYIB 1ZBTA 4FLWA 1YJ9N 1RPLA 4I6AA 1KCFA 4OD0A 2OZSA 2W7OA 2D0PA 2KXFA 4AHTA 2YMMA 9ICMA 4EUVA 1JL2A 1EJ7L 4NRTA 4MFFA 3QB0A 1YF5L 1XN9A 4UB8U 3F56A 3ZDEA 4BRAA 3QFPA 4TQSA 3WNFA 2BZFA 4RQ0A 4PQAA 4OHXA 1IR1A 1JXLA 2DKZA 1XTZA 4PG7A 1N5WA 4DV3J 3KJFB 4BR2A 4J37A 4WFBQ 5DETA 1CUKA 2GO8A 1YJ7A 3J7YI 1YJ9S 3WHIA 2E1YA 3KWIA 2G0AA 3FKBA 1HI8A 3RW6A 2PKEA 8ICJA 2R2SA 1YAGA 1M0SA 2OJ3A 4FFDA 1Y5IB 4BRCA 3UMBA 4TN2A 3TTCA 2W7PA 4NWIA 4IRDA 2MY7A 2ZC4A 3K58A 1WWVA 1FF2A 3THYB 5CH7B 4CDIA 1Q8IA 3CCRS 8AT1B 4OGCA 3NRWA 2Q79A 2LYBA 2ZBCA 2GLEA 2DEIA 5B08A 2R2UA 3CQXA 2DNZA 3AHPA 3O80A 3IXQA 5D4NA 4N7TA 2KVSA 1S1WB 2XHBA 3C3LA 3NH2A 2MZ1A 4I67A 5KFTA 1XO0A 3HKZF 5KT5A 3AVNA 5FIIA 4DEZA 1PAEX 3VQ7A 3I76A 5BJRA 2CQBA 3LGNA 4DFKA 3T6JA 4DR4K 3WK6A 1VRUA 1SV4A 3M7DA 1S6PA 2RQCA 2XYHB 6FDRA 4BR5A 2E1FA 4QQBA 4PHPA 2ZH6A 1E3MA 2G0CA 4YG2A 5J2MB 1BIUA 3M5RA 1X9XA 4FZXC 2WF8A 2IHMA 7ICUA 4LQ9A 3G9CA 1JCEA 2WFAA 1HR0K 4FLVA 1Y3JA 4X65J 4PHTX 1T9YA 3FE1A 2IA6A 4AQYF 4ID5B 3CJAA 1YI2S 2OSQA 4ELUA 2FBVA 3PIOL 3O4NA 1JWWA 4RR5A 3JTPA 4CWBA 4DR2J 2XYPB 3NF8A 2K7JA 4R8UA 2KIWA 3CCSN 3NNCA 3CJ9A 4NRUA 4IH6A 4X5VA 4JI0J 3CCVS 3FVYA 3WXKA 3LPYA 4ICLA 3ZTQA 3V2UC 4FW2A 5KFLA 2AGQA 1I94J 2KI2A 4IS7A 1V9PA 4ZJLA 3MTJA 1JJCB 2FGOA 3JS9A 2CGKA 2AQ4A 2BRKA 3CCUS 2WTUA 3W62A 3MPVA 4DOZA 1RAJA 2AJ0A 3CMES 3M8QA 5KFPA 1CRXA 5E5NA 2ZH9A 1HKBA 4NA1A 2VC0A 4CO0A 1YLXA 2L41A 3A13A 2J6SA 1Q5YA 4CIEA 1HHQA 1HNIB 4ZLLA 1MG7A 1XBWA 3S3NA 3AVHA 1FXRA 2ZGZA 2MKJA 2J9DE 5KPTA 4FYDA 1RACB 1FFGB 2HBRB 5ADXH 1FVQA 3C6AA 4F02A 4KREA 1FEZA 4DQSA 5GVQA 5IQ6A 4JI0K 3LDNA 2LDYA 1SH3A 5KGWA 4X65K 4J2DA 2R4FA 1HEKA 4DL2A 1ZQEA 1S5ZA 1GT8A 2EBGA 2WAQC 4DS4A 2X74A 1KHVA 5E3RA 1K8KB 4O8UA 2Y0SD 3OFFA 3CDEA 2PY5A 3JQKA 4KAIA 3ZZTA 4J9RA 3O5TB 3LP0B 2K89A 2E5LJ 1WAFA 3ICLA 4C0OC 2GIRA 5DG9A 2HAFA 2J7KA 5C5JA 1TL7B 4QZIA 3JYTB 1BWEA 1PIEA 1QAIA 4B3TK 2RHSB 3EEQA 3VQQA 3FM9A 1JLEB 4WU3A 3VAGA 2LEAA 2QLXA 2FZGB 3WC2A 4CTAB 3CJ1A 2CZ9A 1RDDA 3DXKA 3TEGA 1JB0C 4LC9B 1ZC6A 3WDOA 4Q7AA 3ILJA 4KGZB 2RN2A 4BE0A 2QL5B 2QRRA 3C29A 2F5GA 3TTDA 4ZKAA 3VEYA 1UVNA 5D4BA 3ISZA 1JCFA 2F7VA 2RMLA 3K0SA 4C8YA 3PDNA 1VJQA 4FYYB 2KZMA 1ASVA 4OJPA 2KVCA 1C20A 1NHUA 2P9PB 2MZSA 3KDOA 3MAAB 5EWEA 3RF9A 1N63A 2YQ0A 4QYZK 1CJVB 1J5OB 3JXUA 3K2YA 2IIRA 3CJ2A 5DGAA 2W2MP 3JPTA 5L46A 2Y8WA 3OW2M 1UMJA 2ACMA 3NH0A 2CDRB 5GAHU 1X66A 2JNJA 3O3HA 2BGWA 2OCEA 1UETA 4QU6A 2BDPA 2XQCA 3SR6A 2Z1IA 4DSLA 4OJLA 3ZT0A 1RT2A 3LAMA 4UB1A 2MB0B 2VG7B 3G6VA 4DR6F 3UMGA 5HQMA 1KFDA 2G8HA 1FFVA 2A41A 3U9DA 5CR4A 1XEZA 3LO3A 1S5LU 1YGYA 4JWNA 4CZEA 2O8CB 1Z05A 1S77D 3SUNA 3BZQA 4C8OA 4V19S 3DXBA 4IG0B 2CPJA 4E1MA 3HRDD 1B9FA 4JHDA 3NVWA 5DBBA 5JMVA 2DTUA 3FRYA 1TR0A 1LWEA 4LRCA 1RDUA 4UF4A 1LQ9A 4QIWF 3ETRA 2KLAA 1W26A 4BR7A 1WORA 4KT0C 1Z1ZA 9ICUA 2MGZA 1VSLA 4BQZA 1S0NA 3C65A 4EWTA 5D6GA 4NLBA 3EXYA 3NS6A 1S10A 2Y8YA 1WBBA 3C5FA 2FPHX 2N82B 2J9EA 4RW8A 5CD4H 2JR5A 1O6XA 3MMJA 1P90A 4CRXA 5KFDA 5CABA 3ZLJA 2YNIB 2AWZA 1NGIA 2YMQA 3AQOA 1OUQA 2UU9K 3ENBA 1U8WA 1FKPB 4CIOA 2R7WA 5K9FA 2ZH8A 3DM2A 5GAGP 1AZSA 1RBLA 1H1VA 2YHXA 5AZJB 2JLGA 2C3UA 1HWIA 2XWXA 4USUA 4KX5A 4WQ4A 5EHHA 3E9PA 2IM0A 2LBOA 4A48A 1RBRA 2D4WA 1F5AA 2DHAA 4CD3A 3V7JA 3W5YA 3EUB2 3CJ4A 1XNRJ 5K8MA 2W2PP 4UAYA 4KRFA 4LJMA 1K73T 5J0WA 4DTRA 2VJ5A 2CKWA 4JI8K 5F9LA 2FJWA 2QTDA 3SFUA 5FROA 2JH3A 2MSNA 3JSMA 3PCOB 3K8WA 2RQMA 7ICJA 1XSLA 3PNIA 7ICVA 1NMEB 1S8OA 3D0IE 2HSEB 2GHVC 1QAYA 3O1LA 4CJRA 4CI0B 2IDEA 3G0ZA 3QIDA 3GZ7A 2KJ5A 1L3VA 3G2XA 3FZFA 3DXMA 2HBJA 3GB0A 4F5RA 1W2IA 2AJ2A 2WBRA 2JZBB 1CS4A 2Y0SF 4LFAF 2HPUA 3PYEA 4KITB 3RB6A 3MABA 1WOPA 3UQ2A 2NSBA 3HM9A 3RH5A 1C2PA 3KG0A 4FZYA 3W61A 3VHQA 2LU1A 5D0GA 1GLJO 4DSJA 4RW9A 3HULA 1BY9A 4YXMA 3B54A 3RU0A 1MNEA 1AA1B 4PKHA 1QVGR 1UVIA 1KQFB 3UN3A 3Q0AA 4ILRA 2Z56B 5J0OA 1NO8A 3VQ4A 2ZHBA 3EGNA 3NRBA 3N7PD 2WHOA 1VJWA 3LGHA 2KSOA 1QZ6A 2DR6A 3PEJA 3CJRA 4L74A 1RBVA 2QWNA 1DHMA 1Q82T 2D8CA 4LRFA 5BOMA 2ZUBA 3UE5A 4JI1K 1RBTA 5DDOC 2E20A 4KC5A 2F1FA 4B08A 1UHUA 4F25A 2BMBA 1XC3A 2F4VJ 3D1HA 4DR3J 4RPYA 1NZBA 2RD5C 2ZHOA 1QQMA 4OHYA 5KFKA 5LSLA 1C1CB 1VQ4S 3F2BA 1FTRA 1FJGJ 4JP8A 1CZBA 5ALTA 1HA1A 2GW8A 1JLBA 2FLLA 5THWA 4G1QB 5KPZA 1WTBA 1WWHA 4BE2A 3ZETA 1V5IB 4HHUA 5CZVA 1TK0A 1UPMB 4M5DB 1SZHA 4I2GA 4RW4A 4LF7F 3NMAA 1RYUA 4WJBA 5J1PA 3DC2A 2BCSA 3SJHA 4IOCL 1XWLA 2UUBK 5AKKA 2Q66A 3LWMA 4X4QA 4IQVA 2KJ9A 2F63A 2BQ3A 2HNYA 2HCFA 3TJAA 9ATCB 3BO4A 4DUZF 4DV0K 3E1YA 1O8BA 3DLKA 4Y0WA 1D8BA 3V1OA 3V72A 3WNGA 2IY5B 1VGYA 2Q3PA 2HFNA 4DR6J 4X4PA 1F0MA 4FWNA 9ICWA 4B3SF 5L39A 5F0XA 4XH5A 5AI9A 3GSDA 1IKXB 2R2RA 1X9JA 5FPMA 2DWQA 4F26A 2ZH7A 3SCIE 2ZBPA 2J8SA 2DFHA 2DNRA 5F3XB 2H9ZA 5KRSA 2B9YA 1RKJA 2Z57B 1T9TA 3MGHA 4LFBJ 2D41A 3TTFA 1X4HA 3UD4P 2ZIWB 3HXMA 2I38A 5JXSA 1YJUA 4ZN3A 3KLFB 2UUAJ 1VQOS 1KQQA 3A8YA 4JAXA 4M9LA 2VQFK 2OEMA 2JEFA 3EW9A 4EP5A 5K5MA 7ICNA 2RQ5A 1NSQA 3UXPA 4GV9A 3MWTA 3G6YA 4YORA 1U2FA 2XGQA 4BROA 2O4GA 2AJFE 3LDAA 4F5NA 1N0UA 3UCUP 4MMOA 3O9QA 4WBFA 4WFXA 2M8DB 3WNEA 1XMOK 2XMVA 3H4DA 1G6BA 3D2FA 2JEJA 2KW4A 4Q5VA 4XQ8A 1XHZA 5SZTA 2UUTA 2KVIA 2Z0GA 2KICA 3QT8A 4US9A 3OJUA 3U1NA 4CF9A 1RCOB 4IQUA 1WI8A 3KG4A 1ZZNA 3PVXA 5B09A 4YB6A 5CXTA 3HSCA 5HQLA 3UW1A 3RRHA 3GV7B 5HOOA 2NRWA 1JLAB 2W01A 2N7CA 5EY4A 3GG4A 4DV0F 1FO1A 3PY8A 2JXJA 4ZVPB 4LF8J 1IR2A 4HTJA 2PC6A 3W3SA 1BDGA 5IS2A 4QJVA 2ZOGA 5KG5A 1WG8A 4EBCA 5KOXA 3RW7A 5AKIA 3MGVA 2P8IA 2IJFA 3ELHA 2P6RA 5DDPC 3C6TB 1RWOB 1WN7A 3GV5B 3OVNA 1HW8A 3TQ1A 3TAQA 1MQ2A 3DXMB 2NRHA 3EGZA 1WSVA 2PO4A 3FCHA 1HBMA 2OPRA 3UE2A 4CJVA 4E8UA 1BWFO 2F9TA 5AKJA 5BN9A 5AQWA 1M1GA 2ASJA 1N5YB 5IWAK 2JOQA 4G6VB 1QVGM 2UZAA 4L76A 3DOKB 2HRYA 3ZCMA 2HMIB 4IR1A 2V8GA 3Q8SB 2FY1A 2MPUA 4CF0A 4YD1A 3TANA 5EXWA 2IJNA 2WVDA 4BHQA 1WG1A 2BANA 5ALGA 3M8RA 4DDFA 5H1SQ 7ICOA 4DF8A 1RGVA 3FBFA 5I3UA 2F8HA 2C2NA 4QZBA 2JH7A 4JYAF 2K8GA 2MUTA 3QSYB 3C19A 4JI8F 9ICGA 3NGUA 1LNQA 1MWYA 1T11A 2GWJA 2YHBA 4JI0F 3KZXA 1ZBHA 4JWMA 4KHWA 2BPCA 1ZQJA 2DH8A 2X6NA 1QM9A 5J2QB 2DT9A 2XS7A 4OJRA 1U1MA 3VAFA 2A6AA 2FMQA 8ICQA 2ZXHA 1FFWB 3GJTB 4TU9A 1VC6A 5AQKA 1HQUA 2OPSB 4CHOA 2IGIA 5T41A 5KG0A 2LYHA 1BQXA 1XI1A 1DOQA 2RIJA 2K60A 2PEBA 4C3MA 1IXKA 3NLCA 3KD1E 5AM3A 2F44A 3TFSA 3OYBA 4DG1B 1HIYA 1WUUA 3QGGA 3A3PB 1HQEB 1HYSB 1NJWA 3SFGA 1HIWA 1PJ6A 5DKWA 1KOOA 3DV9A 1LFWA 4YMOA 5AIBA 5KG7A 4OI0A 4B3OA 3V81A 2VBYA 2YY3A 1U09A 3J7AP 4R8UB 3J7Z5 1X4EA 1U2VB 4TLQA 1R8AA 4RW7A 4Y2TA 4IQXA 2XNRA 1HUXA 2KN7A 4JV1A 1VHIA 4EYHB 5F3ZA 1APSA 1RAAB 4DLEA 1XSPA 4UW9A 3H0RB 5BR8K 4DSEA 3S9HA 1CQMA 4C4SA 1Y9OA 2KHQA 5IWAF 4RPXA 3JPQA 1IWAA 2RF2A 2Q0ZX 2BJ3A 1BCOA 3A3NB 2GIQA 2ZJPL 3FMBA 1J2VA 2D9PA 2XG8A 3S6EA 4I2HA 1FFSB 3VGTA 4JI5F 2K3IA 2R7SA 2Q1NA 2HHTA 3K2PA 3GJSB 2RRBA 2DXDA 3RGIA 1D3WA 1VQSA 4OFZA 4USKA 4MKVA 3L4PA 1J5OA 4ED4A 3AAPA 1K0TA 3PFEA 1RFQA 4ALZA 2MKIA 4FF4A 1Y4ZB 4CBWA 2HS4A 5ALQA 4QYZJ 3UB5A 4KLMA 1IQZA 1MMNA 2C3MA 4KLEA 2W9MA 4DV7K 4DV2J 1JX4A 4KRWA 4O5BA 3RMAA 2I7PA 2ZC3A 4PHAA 4NI2A 4KHPK 1SKUB 2YXLA 4UUWA 3ID8A 2KVQE 1GNKA 2V7YA 2W03A 2Q2RA 4LY7A 2EAMA 4DTPA 4JOUA 2E6LA 2M70A 4BXOB 4LBHA 1DFDA 2LYVA 4K4TA 1NZAA 4X4OA 3AA5X 2J4RA 3UM9A 4FJLA 2ZVIA 4H4MB 3RZAA 4JK8A 2O8EB 4Z4GA 4P0PB 3ZETB 2PZSA 2GVZA 2FDRA 2F2AB 3HYFA 2DRDA 4DR3K 4KB7A 4ES3A 4YB7A 3EZ5A 4E1JA 1L3KA 4ZTJA 4G1PA 5EE3A 2V68A 2XIDA 3R5AA 4H4OA 2B9WA 4ANEA 3M05A 4DKWA 3Q83A 1R6VA 1KLMB 1ZBFA 3GIKA 2E8AA 5M2UA 5EX3A 1V3ZA 2NREA 4Q0BB 1OQ6A 2CXEA 4DV6J 4RKUC 2LYAA 4RZRA 4A61A 2QEXN 2DCLA 5C2DA 1EWQA 4JI8J 5IT0A 1RP5A 2K4EA 1U49A 3LA0A 4ZPAA 3CD6N 3T3FA 2ASLA 3GMGA 2W43A 2ADCA 5LL6d 4MEYA 8ICMA 4QIWC 1COOA 2P9LB 1JXBA 2GV1A 4IG3B 4RPFA 2CYYA 2K06A 5AQJA 2ZQBA 3HVAA 4O5FA 4E7LA 2XULA 4CJUA 3EPIA 1R31A 2ASOA 4DFDA 3SV4A 4J9LA 3J7ZO 4KHUA 1YZ6A 1DY3A 2OFGX 1OH6A 4FYVB 4JKEA 3I82A 1RILA 1X5OA 3U26A 1WC6A 2JMGA 1PYSB 4TYBA 2KMDA 3OUYB 2ZTCA 1X40A 4B9MA 2H5JB 5M2PA 5ITHA 1VQ4N 2QC3A 1RWXB 4NXZA 5G0RB 2UVWA 1F5CA 4FK2A 5HVFA 3H0MB 1F44A 3V6KA 5B0DA 2WOMB 3TSUA 3N6NA 4PXCA 3PX6A 4CESA 1OKJA 2LPEA 3C66A 4P7TA 5HJXA 1G4CA 3EXCX 3AVFA 1U04A 4H03B 2OXOA 4CVNE 1SJFA 2H1YA 3SXLA 2WVBA 2IVPA 3CETA 3DLLQ 4QWDA 4KHNA 3MFHA 4DCHA 1ZRNA 4WK1A 2ZZNA 2YNHA 1L3TA 1CXUA 3VGUA 1EXNA 5CYMA 4IOCQ 2V50A 4M5IA 2UXCF 1B7FA 1F2HA 4BRMA 1VYAA 1PSDA 1KVIA 4ZN1A 4LVSA 1LW2B 4LF5J 3WK4A 1HQEA 3C15A 2I5JB 2ZOFA 4FXDA 4KLUA 3HHLC 1QAJA 1MA9B 1EQMA 2BE2A 1OQ3A 1Q7YT 5G4DA 4C9DA 5HJYA 2RHKA 3M2UB 2GHPA 3UR0A 4DR5J 1ZQOA 3HP9A 1DTTA 1JK9B 2MXYA 4CGIA 1ED1A 3ILOA 3EDQB 2HNYB 1V5VA 1IO2A 4IOAL 5M1PA 3BSCA 3QGIA 1KP6A 3R3TA 3MD1A 3UO0A 3AO2A 2KD1A 4DCOB 2UUCJ 1YJNN 3LZIA 1SXEA 3O3LA 3BY5A 4FJGA 1ZRMA 1FJGF 5ALJA 4IC9A 2FPMA 4AT1B 2CJYB 2KN4A 3MN6A 2Y1RI 2RKIA 5M1FA 2MRLA 1YITN 4B9TA 5IINA 2FJDB 2YV0X 1PUZA 2P9SB 2Z1JA 3L5KA 1QS4A 4ETZA 3LW5C 5DBCA 5E3AA 1NJIO 1VQMN 5BXIA 2GMJA 1PBUA 3UCZP 5BPMA 2Z1GA 4F4KA 2ZM6K 2MQPA 1L7OA 3SSRA 1TAMA 2FLOA 1SV0C 3U02A 2QX0A 1QY7A 2CG4A 1FJCA 1UEKA 4KMOB 2DO0A 4OJGA 4OKJA 4F9OA 2HQCA 3N5BA 3UKUA 2KKVA 3M6UA 1T7PA 3O9RA 1CJVA 2GZOA 2A0FB 2YQEA 1RT6A 1TL3A 4ZDNA 1QE1B 3G8TA 7ICRA 3TRGA 4RUAA 3QRQA 1TAUA 1UVKA 2IVFB 5BR8F 2B6AB 2HVDA 3SAFA 3NGYA 2F4VK 4HCBA 5HMYA 3OV7A 4KIAA 1Z3EB 2VIHA 1N36K 2X51A 1D09B 4PGQA 1BIZA 5JUMA 1XMOF 3H5YA 2RDJA 3DLJA 4FYXB 2QL7B 2HWIA 4DQRA 4EBEA 3EYZA 4RL1A 2HGMA 3PXGa 4P7VA 4J9OA 2JRZA 3ZD9A 3TADC 2OTJS 2DR7A 2J7WA 3BM7A 3BB5A 5ADXA 1C0UB 4P0PA 1NJYA 3HVWA 2KK0A 2Q97A 1UKUA 3ETLA 2UVVA 4CZJA 4DU1A 2X1BA 4BC2A 2W3SA 3EVWA 2QK9A 2PI4A 4LSZB 4QAGA 2HQ3A 4CH0S 5IWAJ 2VQFJ 1RBAA 4PXBA 2DGSA 1JALA 1DAXA 2ITMA 3OYKA 2Q43A 5HVHA 4DR4J 4XH1A 5A0YA 5ADZA 3V1RA 3VCDA 3SD7A 8ICTA 4XUSA 2BOPA 4LF9K 1X4AA 5M1QA 5CCMA 4ISEA 4OJ5A 1KKHA 3IV6A 1N6QA 2BUNA 5B0CA 3W8PA 3VEOA 3M2RA 1YRUA 4GO7X 1RTJA 1SUQB 3W9JA 4YHHJ 3IRXA 3QUCA 3IDHA 1WLJA 5AQIA 2K4IA 1NSAA 2DGUA 1UT5A 4ZP6A 3GCWP 4LF8K 4DWIA 5CWRA 2CJBA 3KHHA 1N52B 3AO1A 3KK7A 5I9EB 2KV2A 2RQ4A 4ECSA 2DJWA 3O8WA 5GTHU 3CB4A 3ZSXA 1Q95G 2XI3A 4IEIA 2CQ2A 2V8HA 2R7QA 4G9BA 2OGUA 2K4PA 4DU8A 1SJ3P 2M5YA 1IKXA 4AF1A 3CCTA 4Z4FA 4DV5K 1ZPVA 3BPSP 4PPXA 5CYMB 1NH7A 1T9XA 4RT2A 4I2FA 3I5BA 3SMVA 3PX4A 3PMNA 2AMCB 4PKDB 3QETA 4L3KA 1XMQK 4O3PA 4NLVA 1ZETA 2H5EA 1DJ0A 1E4FT 1X3MA 3M8PA 4CW7B 1GEHA 4FLTA 3OYIA 2CQPA 4FPIA 2JFDA 3JQMA 1IJFB 1NOZA 2DRBA 1B3TA 2V69A 1QQ5A 4ILGB 5IIIA 2IFXA 2BE2B 4M5DA 4QWEA 4M3WA 4DZ6A 4FBUA 5ALWA 4EZ9A 4AUKA 4A8SA 5HBMA 1X2IA 3ATUA 1L5UA 4DV5J 4P2SA 5ALKA 4DR3F 4YEAA 5AXKA 2QLBB 2Y1JA 1IM6A 1BUXA 3SCKE 4LMZA 3T1YJ 4QIWD 5CYQB 3CIPA 3BF1A 3HOTA 2EAOA 2QA2A 4F91B 2GUIA 2YHAA 2ZJ5A 5U47A 4K42A 3H8WA 5KFJA 3NTUA 1KFTA 3NAEA 3ZT3A 2WF6A 4DJBA 1XNSA 1NCLA 3DLKB 4RQ2A 1U4BA 3R8EA 3FGUA 3JAMU 1UPHA 3HJVA 1QE1A 3SQIA 5CZ1A 8ICLA 2LM4A 5J2FA 1RISA 5HRNA 2Y1LB 1N5XA 4JV0A 3AA3A 1HJOA 2ZKTA 1ZQKA 2NLXA 1UW4A 1I94F 1J6ZA 4NOHA 4USIA 1HI0P 1Z19A 3LYSA 2V94A 2VJVA 1HPZA 4KH5A 3CVKA 5J1NA 5J0XA 3ZSRA 4NLNA 3D6MB 5IOLA 4YR2A 3I55S 3QZ7A 3CFPA 3VV2B 1S6QA 2D0OA 5KFHA 2X78A 3KK2A 3GYGA 3AO5A 3IAS9 2VZ9A 4F2SA 2XY6A 3PRBA 3FR0A 4CLZA 4OLOA 4X4VA 5T7BA 3QUQA 1NPRA 1DQ8A 2EKNA 2WVEA 1XMQJ 5AFUH 3OTBA 4F4WA 3CXCM 3V6JA 4Y2MA 1WUAA 2PFPA 2DR8A 5AXLA 1AQ6A 1ZQMA 3U8XA 3A5NC 3HD2A 4KHQA 3L7PA 2R7XA 4K4IA 4G3IA 2B5JB 2C2MB 1R6YA 3N9UC 3KVGA 2MKHA 4WE1B 2C3YA 3CO0P 4H4MA 5BYSA 5D4PA 3IS9A 1B4SA 3PW0A 3GSIA 2J6TA 4UQGA 5CRXA 4CGHA 3NGKA 1W97L 3NWRA 4UB2A 4JI5J 4R0EA 5HANA 2V0NA 3MGJA 2V4RA 4OPHA 2DBYA 8ICXA 3PIOQ 4JI2J 5E79U 3I56N 3HHDA 2CJAA 3J7AN 2W41A 1EQYA 4Z7CA 2VFSA 4KI6A 2JGUA 3F5AA 4Y6IA 2Y1IA 4OI1A 3ILLA 3IO1A 4E19A 2MZJA 1NKBA 1S9GB 4CYUB 1VLBA 3QIOA 2VONA 2OZMA 4N41A 2HHVA 2D1CA 3LP3A 3LF0A 3IBCB 3BF3A 4ILHA 4IO8A 1RI7A 4K5RA 4WQ5A 1SWWA 2QIFA 1NM2A 2OM6A 2JX2A 1UQVA 3HDSA 4NLYA 2IOFK 3ZZRA 2JVRA 1OY6A 3M7VA 3C46A 1GLBG 4A5AA 3AU2A 3M9MB 4CZGA 1TKTA 2MKSA 1HWJA 5A8WB 1Y5LB 3GIMA 3OW2R 1KLNA 2HHSA 1VOMA 4LF7J 3EMTA 4NZ7A 1UT8A 4A8YA 4CJEA 1X7VA 2D5RA 3IP0A 5AXMA 4BC9A 3KLIB 4OYIA 7ICTA 5K14B 2P6SA 1RZMA 2D7SA 4DUZJ 5AZIB 2P66A 4CJ4A 3M2VB 2WSEC 2DNYA 3QU4A 2PYJA 2KTQA 2B8QA 3DM2B 4NLTA 2V9KA 2E1PA 1WKLA 2X1AA 4TU8A 1U1QA 1V85A 3V6DA 4RWTA 4BRQA 1O1WA 1O5JA 4PRFA 3C1YA 1HJRA 2DNGA 4DPUA 3N7SC 2BCVA 4ZCKA 4X64K 2BE9B 1IBKJ 1S4EA 3Q2TC 4FWKA 4MDAA 3CCQS 4FZZA 1TL5A 3C21A 2VG7A 3NGTA 1VQ9N 2DR9A 4NLCA 3UVJB 3Q2SC 4CK3A 2WUSA 1BVSA 2CPYA 1K47A 4BRGA 2KU7A 2LQ9A 1KEJA 2Y9TA 2HZAA 4WFNQ 2CJQA 1S1TA 4DV6K 4OX6A 4R79A 2DUYA 2QLJB 3R7NB 3IWLA 3KKRA 3N6MA 1Q82O 1U1NA 1OWXA 4C4WA 2R8JA 4J9VA 3VTIA 5FLXU 4IDKB 3RJKA 1AW0A 5F8LA 2CNKB 3I1YA 5DK5A 2DGZA 1BA1A 4WF9Q 3L3VA 3ZX2A 2DTJA 1D8YA 3ZDCA 3RB0A 9ICQA 3MXMA 4FWOA 2JSXA 4JI6F 3PYGA 4ICAA 4UUXA 4BC7A 3OYEA 2Z2LA 2YNFA 3MPDA 1DEJA 4I2IA 5L38A 4MIBA 3VAMA 3VGSA 5A8KA 2VOPA 1VHXA 3DI6A 2V2ZA 4BY9C 2BANB 5ALVA 4JB8B 3CGIA 2KE7A 4OL8A 3D5MA 4KHSA 1V9OA 4B9VA 1S9EA 3NH1A 3QO9B 1FI4A 2EPIA 2XMJA 4DCPB 3J80O 3W1YC 3L2UA 4YDUA 4M45A 1HKAA 3RSEB 1B7YB 5D3GB 4ED7A 3IAM9 3I6PA 2L9WA 2AF6A 1NXIA 4H0YB 2C2KB 4U8YA 2RILA 2ROEA 5K4LA 4DO9A 2IHNA 2NRZA 3LH2S 1W2BR 1LFPA 2UXCJ 3OTOF 2J0XA 2PMZD 5ALSA 2IOFA 4USTA 2R9LA 4Y2RA 3HHLB 3KDNA 4M63A 3O9SA 2OHDA 5AM5A 3SPYA 2ZKUA 2DNNA 3MEDB 3Q23A 3JXOA 4LREA 5FDLB 2ZH4A 1CC7A 1FKPA 4ZH4A 2KJ8A 2ERRA 1Z1VA 4ZPDA 1J53A 2UV8G 1JROA 4ZJQA 3QFWA 1NLVA 2EK1A 2N3LA 1A5WA 3QXGA 1WUDA 1DTQA 3FZMA 2O8DA 3HJFA 1FTCA 4XTTA 3CCVN 4DR6K 1DLOB 5KT7A 2PEHA 4MTPA 3S6JA 2HVZA 1ZQIA 4J9PA 1P9YA 1WACA 4QIFA 3QO9A 4B3TJ 2ZBIA 1BNPA 2W9BA 3DGPA 1ZXOA 5AQTA 3HX9A 1S1XB 4C8KA 1BMQB 3KMQA 3OTEA 4EAHD 2KRBA 3GIRA 9ICKA 1VQLS 3N01A 4CNYA 3D2FB 2OIHA 2HBKA 4GKJK 5C42A 3K7RA 5CCLA 1FHTA 4BRDA 4KHYA 5AKXA 1NK9A 3R9PA 2BJEA 5F8MA 1M5VC 4P74A 3BYPA 2DFEA 5F8NA 4J2BA 1KQGB 3CC4N 2AD9A 2OPQB 3VVUA 3LM9A 1J9AA 4EEYA 4AD6A 4ZVEA 4GVBA 4USJC 1RHJB 3ZZUA 1MA7A 4B3SJ 5J2MA 1NGCA 2DFLA 4NLGA 1RT2B 2YWFA 4ELVA 2JH1A 2FD2A 2RU9A 4H5TA 2A1JA 4N56A 4LH4A 3HKWA 3B4DA 3WKCA 2E66A 3B78A 1NK7A 3QZ8A 4WFYA 3AXKA 3GPAA 3MEKA 3ZTPA 2YWKA 4NCAA 3M2RB 2BR0A 4Y2CA 5GINA 2I9SA 4FZVA 3CUNA 1WBDA 1NAQA 2HIYA 3F9MA 4CJ7A 2HOQA 4JBCA 1QHAA 4QZCA 4QZFA 1S59A 4MK9A 3RBEA 3ISDA 5HI7A 2HBMA 4DTSA 4A8EA 2C42A 3O8MA 3FZ2A 1FESA 4B9QA 3MR5A 2O8CA 4CD1A 1CLFA 3U3GA 5EWGA 3L7UA 3QEAZ 4GKJJ 4GIBA 3FYHA 2F8KA 4QR0A 4YD2A 1X31C 1Z25A 2M9NA 3AFGA 3HMJG 1SB6A 2WOMA 2MZTA 3CHWA 4Z4CA 2W25A 4CGZA 1JKHA 3W66A 4QS9A 4C11B 4MHVA 3P6YC 2Q3SA 1Q8LA 1HX1A 3VMFB 1X6JA 2CH6A 3B0YA 1BPDA 1FJEB 3N6LA 2G8FA 4AM7A 1NK0A 5DG8A 3CFRA 2UXDF 3BQ0A 4NXMF 5CEHA 2MQOA 2AT1B 3OA9A 4OI4A 3H3OB 2RB7A 4J03A 3FK4A 2KJWA 1I5OB 4K4XA 5AKHA 3VA3A 1YDLA 2WAQD 4KGXB 4ACOA 2MY8A 3P96A 4KB0A 4P2MA 2Z2MA 2MLZA 1RT5B 4X66F 1TL3B 4Y65A 1BL3A 3ASMA 3KKFA 2KSOB 1FT8A 3LPEA 5HK4A 4DV3K 2ZTEA 1M5HA 4A59A 4BDZA 4NJ8A 3AEVA 1N34J 4E3SA 5B7WA 1RNHA 4BC3A 3UXOA 3UDCA 2Z4PA 4WU2A 1H2VZ 1AFIA 4PXEA 2FQQB 1XC9A 2OANA 4ER8A 2GNKA 1HHSA 1X6IA 3SZ2A 3JSRA 4LF6K 1N32K 4DX7A 3ITHB 1QVFM 3QYYA 3O9UA 4FJNA 1E6VB 3QEWA 4Y2UA 1BLUA 2QWPA 2JEIA 1S5JA 3NWGA 5ETMA 4CGFA 3HT0A 3MMCB 2G8WA 4ZLPA 4LUBA 4F3QA 2QB0B 2W8KA 1R89A 5E0OA 2PFUA 1GQEA 1UCVA 4IOBA 2I6WA 4B1UB 4CGJA 2G8UA 3HWTA 3LL3A 3R7BB 3AGKA 3C2KA 3AB2B 4WKRA 4OPKA 2JEGA 3IHQB 1F0XA 1FERA 3H0PA 2CN1A 1YXQA 3BO2A 4NLRA 2NPIA 2Q6BA 5RUBA 3RG6A 1L8LA 2UXDK 3RMBA 1P8GA 3J8AA 3ISND 4DL5A 2JC0A 2CRLA 2QZ8A 3NS1A 3UDLA 2LQJA 4NL9A 3MCNA 4DTOA 4RW9B 2EVZA 2DVIA 3OT9A 5HO4A 2CAJA 1TMJA 3GFZA 3F2KA 1GLLO 3CJSA 1JN3A 2VFUA 4MLHA 4OYMA 1IQTA 2YKAA 1KN6A 4NYNA 5J2EA 1XR7A 4ICLB 4NMXA 2W04A 4I6MA 3ISCA 3MMVA 3GU3A 3N4PA 1P9QC 1ZM4A 1TELA 1LW2A 1WSRA 1BPXA 2W2QP 4C6AA 4MKBA 1F9EB 5GAEP 3DLBA 2BCRA 4IFYB 4U67Q 2C22A 2MTLA 3ADAC 3W2VB 3C0BA 3GFKB 1ZA1B 2HSTA 4ILJA 1F21A 4IJAA 1R8BA 3G6ES 3F0NA 1Q78A 4BGAA 4OX9F 4DB3A 1MWQA 2MQ8A 4JMUA 3C94A 2WHEA 1HQ2A 4MFBA 2M88A 2ZZTA 3KJVA 2WVFA 4ZOSA 2QMUB 2P9NA 2YKNA 1PJ7A 4ZPWR 2NR0A 2HHHF 1UW9A 3GZFA 4HL9A 9ICAA 3JSYA 2FF3B 3FNNA 1RT1B 1HMVA 3FZBA 2NZCA 4DFPA 2ESEA 2FVCA 5ALXA 2GO7A 1YJTA 4AM6A 4DMZA 5AM0A 1HUOA 5AQYA 3AQEA 3QAEA 1Y7PA 4X2BA 5H9FK 3AB4B 4Z2XA 3HKZD 4P10A 3NF6A 1CC8A 1JLQA 1LOUA 1LCUA 3NMUA 5JICA 4EBDA 2EAPA 2ZTDA 2FMPA 1NBEB 1VS3A 4QW9A 1LW0A 5F0UA 2W4DA 1BQNA 4KLIA 5BYRA 4LZDA 3MMBB 2W4PA 3SCLE 1BOTO 4JI2F 4FWLA 3K1RB 1UL3A 4ECVA 1X0PA 4UOHA 8ICEA 1RTJB 1SUQA 2XB2D 3R6GB 2VA8A 3OHAA 3SLCA 5AXNA 3IP4B 2AQ0A 1BPYA 5ETSA 2ES6A 1QH9A 3NGDA 3T5JA 1OY8A 2VDHA 3MN9A 3E0FA 1F3FA 3L8BA 1SC3B 2OA8A 2CPZA 4L73A 4AXIA 2E2PA 3EE3A 4ELTA 4OMFG 3I55N 3OYMA 2GH1A 1RT3B 2XLJA 3VENA 5C2FA 1HNWK 2RS8A 1AFJA 1VISA 2QEXS 4ED8A 4PG8A 1Y3KA 2IMOA 3C6HA 3S8SA 1QAXA 3VAKA 3PX0A 3LDSA 1Z1BA 2F76X 1YBTA 1WSIA 4R5PB 2F3NA 2ZG6A 3KJNB 4Y2JA 4HVJA 1AT1B 3AVBA 3UN2A 4XO0A 2HMIA 3KFUF 3ONNA 2VA2A 1TKZA 3CJ3A 4I9QA 3NNHA 3H42A 2HW3A 5D4LA 2P9UA 3TADA 3I87A 3GBTA 1L7MA 4URGA 4NLKA 3DOLB 5KAKA 1V3RA 4BRFA 1N60A 5EDWA 1ZTWA 3RAMA 3VQ9A 4F0HA 1YIJS 1HWUA 4WZQA 5J2GA 3KLHA 2WZ1A 3BBFA 3SUQA 4HH0A 4CJ5A 1XSNA 3TVZA 1NGDA 4JI4K 4CEZA 2N4CA 3CD5A 4QZHA 2A6MA 1VAZA 3FEZA 1ZQCA 5CD4A 2W4CA 4FO6A 2A5XA 3T1HK 4Z4EA 1NU0A 4BRHA 5ETOA 2V2QA 1S7IA 4M3RA 4MT1A 3NGRA 1RTHA 2YWEA 3CCLN 1FDBA 5GIPA 4TUSA 4XRHA 3GYNA 4Y1CA 2LQBA 1EAYC 4ZCMA 2OSRA 4O0NA 2IVYA 4UAUA 2WONA 2VYPA 4M9JA 2CVIA 2ASDA 1Y11A 3WC0A 3LUYA 3OHRA 2VL1A 4TY9A 2O6KA 4LBIA 1R0CB 5H9FJ 4ID1A 3CQ8A 2BCUA 2EZXA 2IAJA 4WP9A 1T6CA 2VFTA 2BEFA 5FLXY 3I5CA 3HILA 2QGFB 4B17A 1WAJA 4ECZA 4PL2A 3T1YF 1S12A 4BS2A 5CR0A 9ICNA 4ISFA 4R5PA 2HLTA 4EP4A 2WW8A 2WVCA 4HI2A 1BO5O 1S1VB 2HNZB 2XWYA 4WFNL 2CPFA 2XMMA 4WZMA 1ATSA 4B3OB 3MM7A 4NXMJ 9ICTA 4RQ5A 1QD1A 2QLFB 3TAFA 1ZQHA 2ZUCA 2KT2A 2HOIA 5L1MA 4KHPJ 5GADU 3DDNA 3DYAB 3SDEA 4YHHF 1RDRA 3BH7B 3I0SB 4B3RK 4RQ3A 1C1BB 3G10A 1VHFA 1NWKA 1UEVA 2DPJA 4W5TA 2QWOA 3D0HE 4W4MA 2ZVSA 4KLFA 3NXZA 4ECWA 3AJ2A 3DLHA 1Z26A 1Q0NA 4FXWA 3C16A 3W65A 1WDDA 2ZIVB 5J8YA 4B3RJ 1U0HA 5HATA 4CLSA 1CJUA 1KD1O 1SIZA 2IC3B 3SMSA 2B4OA 1VQ5N 2D3DA 4F36A 4FK0A 4KLHA 4RO0A 2XMWA 5EU7A 1VQ7S 3DRSA 4L3QA 5JRTA 3F41A 3QFHA 3OYAA 3V6DB 4F4AA 2YX7A 3B6OA 2ALYB 1VK3A 3GR0A 5KFFA 3W2WA 3N4MB 2IOHA 1Q81T 4F50A 1S48A 2CH5A 1EWRA 4XK8C 1HMVB 2YWGA 4P73A 3M6WA 1IKYB 3OHBA 5E3QA 4DX8H 1JLGA 4CF1A 3UI3A 1KVJA 1BWVA 4B3TF 3C6UB 3E58A 5B66U 4FN5A 4GV3A 1U6ZA