1TE2A

Putative phosphatase ynic from escherichia coli k12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
RQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 2-deoxyglucose-6-P phosphatase
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.3.22: Mannitol-1-phosphatase.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1te2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1te2A01
4UM7A 3ZWKA 2NYVA 2CFRA 1YS9A 5AKEA 1Z4KA 3N8GA 5A3QA 3U7HB 4BX0A 3QUTA 3WK6A 2RB5A 1QQ6A 2X4DA 1KYTA 3SF0A 2C8KA 2B1QA 4UM5A 3FZQA 1RMYA 2D2VA 5AW9A 1CQZA 4YCNA 4L57A 2JAWA 5JJBA 3FVVA 3SD7A 2CN1A 4OCZA 1MH9A 4IFTA 3MPOA 3VAYA 4UATA 3N1UA 2MSNA 3QU4A 5AI6A 4EX6A 3L5KA 5ALYA 3ED5A 3HLTA 4UAUA 3QX7A 4I9FA 2HF2A 3L8GA 2B8JA 5A3RA 1Z4IA 3QLEA 2FI1A 2NO5A 3FM9A 4IG4A 3IRUA 4KX5A 1S2OA 1RKUA 5AK6A 3EWIA 5AI9A 4JB3A 2FUCA 5AM4A 3I76A 1ZJJA 1VJ5A 5AVVA 2P69A 1ZD3A 2WF9A 3R09A 5AM3A 1NRWA 4OHFA 2OBBA 2HOQA 3L0BA 2PKEA 1TA0A 2HSZA 3QU5A 4NV0A 3EF0A 2WF8A 2Q4RA 4KNVA 3OPXA 1RLOA 4EX7A 3L0YA 4UMDA 2C8LA 3W5DA 2I34A 4XQ0A 4QQFA 2FDRA 3ZWDA 4UMVA 5ALXA 1Y8AA 4BEVA 2Q4TA 3WK8A 3A1DA 2G1AA 4GXTA 2FEAA 1YMQA 5AKXA 4ZEVA 1Q91A 2JGAA 3J7TA 4YCLA 4BYGA 1YNSA 2C88A 3MN1A 5AKZA 4CF4A 4DCCA 2B82A 3A1CA 3N28A 5ALIA 1EK2A 1O03A 4BX3A 3KOOA 2G0AA 3PGVA 2ZBFA 4GIBA 5A3SA 2FPWA 5ALFA 1CR6A 4NAVA 4F71A 5AM2A 3B8EA 4UMFA 2QLTA 2PQ0A 3KZXA 4C4TA 4QJBA 4Y2RA 5AI4A 3QUQA 2G07A 4H1WA 3K1ZA 4MUMA 5AW3A 1K1EA 1Z4LA 3DNPA 4HGRA 1EK1A 4C4SA 2JAUA 3SHQA 2FPRA 4UW9A 3QU7A 1Z4JA 2FPUA 3KC2A 3OCUA 2YMMA 2C9MA 3U7FB 2GO7A 4FYPA 2IOFA 2I7DA 3EPRA 1TJ4A 1U02A 2WM8A 4YH1A 5AICA 5ALNA 2GHQA 4L6AA 5AIBA 3SLRA 3NASA 3AR4A 1RQLA 3I28A 1J8DA 3NALA 5AVQA 3GYGA 4UU1A 4Y2UA 3R4CA 3PCTA 2YJ5A 4BEWA 2WFAA 3ZVMA 3W5AA 4YIKA 5AKJA 1NNLA 3BA6A 4HGQA 5IT4A 2G09A 1WR8A 3ZVLA 1AQ6A 3QXGA 3AR3A 5AW2A 2HI0A 1XVIA 2AGVA 4EENA 4FFDA 4XE5A 1F5SA 2YMLA 4HGNA 3S6JA 2C4NA 1N9KA 3ZTYA 4BBJA 3D6JA 3WK7A 3NUQA 3UMCA 2G06A 2ZBEA 3FPSA 5AKKA 5ALPA 4HGOA 2FPXA 5ALRA 5AW8A 1T5TA 2B8EA 2VKQA 4RETA 2YN4A 5AM5A 2PR7A 5AM0A 1RMQA 1ZRNA 4O8CA 2YJ6A 3N5KA 1ZD4A 3DDHA 4E88A 1RLMA 2HCFA 2IA5A 1ZOLA 3L8FA 3U19A 2IOHA 1L7OA 3QGMA 3WKDA 1QQ7A 2AMYA 3ZU6A 4HAIA 4JDPA 1U2SA 2W4MA 2YFYA 4OD0A 3ZI4A 1JUDA 5ALSA 3AR9A 4HYTA 2DQSA 4AS3A 1TJ5A 2I55A 2R8XA 1QQ5A 3FPBA 1RDFA 4EEKA 4I9GA 1WPGA 1U7PA 3CNHA 5ALHA 3WKBA 3NAMA 2G08A 4PNHA 2YJ3A 3A3YA 2YJ4A 3E84A 4BX2A 2AH5A 3PGLA 4F72A 5E0OA 3ET4A 1T5SA 1L6RA 3F9RA 4RESA 2B30A 3IB6A 3U13A 3I1YA 5ALVA 3QYPA 3BWVA 2EARA 3U7GA 4MWOA 5AW1A 2HO4A 4ZEWA 2FUEA 5AVSA 1FEZA 3OTQA 3WK9A 4G63A 2R8YA 2GFHA 5ALDA 2ZG6A 2MU2A 1L7MA 4CNQA 1IWOA 1Z4NA 1U7OA 5ALQA 2AUTA 2W43A 3RFUA 2BY4A 5AVUA 4UU0A 1U2TA 4Y2SA 1N8NA 1RRCA 2ZBDA 4G9BA 2RAVA 4YIHA 1YJ5A 3NIWA 1Z4PX 5AW6A 1QYIA 3ZVNA 1ZRMA 5AW7A 3RF6A 1XPJA 2R8EA 2P9JA 3UM9A 1QH9A 2EATA 1X42A 2HHLA 5ALWA 5AESA 1RMTA 2MU1A 1T9ZA 2HDOA 4Y2TA 3M1YA 5AKYA 2EAUA 5AW0A 3ESRA 3ET5A 1Z4MA 3N07A 5IT0A 2IOFK 3MC1A 3ZUPA 3DV9A 4XPZA 3TLMA 1Z5UA 2RARA 4YGYA 1PW5A 3KDPA 5AIAA 5AKGA 1TE2A 5T41A 1Z88A 1L8OA 3L1VA 5AK3A 3FGOA 1SWWA 2WHEA 3E8MA 3PDWA 2ZBGA 4Y2VA 1ZS9A 1SU4A 2QYHA 2CFTA 5AVZA 1YDFA 2GMWA 3OCVA 5ALUA 4EELA 3QU2A 4UARA 4DW8A 1SWVA 4Y2XA 5AVWA 4KX3A 2OYCA 4UASA 5ALOA 2NO4A 5AK5A 3KD3A 3WK5A 3L0CA 1RQNA 3E81A 4Y2QA 3ZX4A 4AS2A 4KN8A 4NABA 3SMVA 5AVXA 3R9KA 2B1RA 2YY6A 1Z4QA 3AR5A 2HX1A 4L6CA 5AK4A 2ZXEA 5AI0A 3HYCA 5ALTA 5AVYA 4C4RA 1O08A 3WK4A 1S8OA 4EZEA 3L8EA 3ZTWA 5ALGA 2I54A 2W11A 1XP5A 4BKMA 3W5CA 3WKAA 3AR6A 5ALJA 5AKLA 4HGPA 2FPSA 3NANA 4XOUA 1L8LA 3B9RA 4DFDA 3QU9A 5ALKA 3QUCA 2HF7A 2O2XA 2I33A 3QUBA 4J03A 2RBKA 4AP9A 4UAVA 1Z4OA 5AW4A 2IYEA 5AW5A 3UMBA 1LTQA 1L7NA 2ZOSA 3P96A 4Y2PA 3QNMA 3W5BA 2I6XA 5AVRA 1WVIA 3EF1A 3DAOA 3ESQA 4CF5A 3ZW7A 3ONNA 1Q92A 2YMPA 5AI5A 4B6JA 5FP0A 3L1UA 4ZEXA 1VFPA 3B9BA 2Q5EA 3L8HA 4Y2YA 4KNWA 5AVTA 5AI8A 3U7EB 1NF2A 2GHTA 2BDUA 3UMGA 1RKQA 2B0CA 2BDEA 1ZD2P 3OCYA 3NRJA 2ODAA 5AM1A 5ALEA 1YV9A 2YBDA 4UMEA 2JARA 3OCXA 2WF7A 3OCZA 3SKYA 4DWOA 4NFLA 3AR2A 3AR8A 5AHXA 3WGUA 4CE6A 3WKEA 2OM6A 3E58A 4YCMA 1VJRA 4FE3A 4BNDB 4J2TA 3L7YA 1TJ3A 2CFSA 3M9LA 1Z5GA 1ZD5A 2P11A 3WGVA 2P27A 5ALLA 2R8ZA 5AKHA 3ZX5A 3SKXA 3I6BA 1RLTA 2G80A 3MMZA 4Y3UA 3A1EA 1RC8A 1LVHA 3WKCA 3KBBA 4CF3A 1WZCA 4NWIA 3U26A 5ALMA 3CZ4A 5IS2A 4BNDA 2HEGA 1J97A 4OFZA 2O9JA 2OA0A 5ALZA 3IJ5A 4KYTA 2WF5A 2WF6A 2YMQA 4Y2JA 1L7PA 2JAOA 1RPZA 5AKIA 1RKVA 3AR7A 3OCWA
chains in the Genus database with same CATH superfamily
4IGEA 4PC3A 5CVCA 4YUWA 1P2TA 3C5CA 1ZETA 1TFRA 4NLCA 2XUGA 4G84A 5DI3B 4CV3A 1QDEA 5EGNA 2W70A 4G9EA 4MQ5A 4JP3A 3KRTA 4BX0A 5KC9A 3NRZA 2BT4A 2RB5A 3QVWA 2OXEA 3OQBA 4TS1A 2A9QA 3K05A 2V4QA 3WGKA 1VMDA 2IHJA 2ES4A 3HP7A 3ZY3A 5LJLA 1RVDA 2WJJA 4XAQA 2V3CC 3FHLA 3RUCA 4OY3A 1RTKA 4K9MA 4U7JA 4EDHA 4DNQA 4E30A 2HTEA 4KUHA 2A4MA 2NRWA 4K3VA 4J3NA 5JJBA 1O8CA 2KFNA 1WZEA 3BQ9A 2DUNA 3I6MA 4FCWA 4OQEA 3E22A 4BATA 2OBNA 4OLHA 2J5KA 3DOCA 4IIGA 5CB0A 1J90A 3EQ6A 4P31A 1RXVA 1CPYA 3ZJ4A 2WJ4A 4DQUA 3ZJVA 2F77X 4LA4A 4K0RA 1PVDA 3HDJA 4U6QA 5AJZA 1KDYA 4EB6B 1KOGA 4RVOA 3AY7A 1N1DA 3OE7D 4FCTA 1UDBA 1ZIPA 4LZDA 2C57A 2MINA 2VK1A 3OQPA 5FBHA 4JB0A 1PQ4A 2XUHA 5KBYA 3REFA 3SDSA 4LDPA 3TPCA 5KCZA 2GA8A 2P35A 2OORA 5FL3A 4XH9B 1ZPDA 3NB0A 1N6HA 4QBHA 4ZVUA 5KHLB 3SP1A 2IHBA 5L3SA 1M2HA 2UU9B 5DMHA 3W8RA 3D3QA 1YA8A 1UCFA 4K9QA 3SZUA 1L8XA 2RHDA 3A6DA 3CLHA 1IBSA 4NJOA 4I6GA 4RZRA 3CLVA 3JAKA 4CG3A 3PIRA 4MEAA 1H23A 2P5SA 3COSA 4J1QA 3RVOA 3QK7A 4HDNA 3QI2A 1ETHA 1PFVA 2R6JA 1TCAA 3K20A 5GVRA 4B4VA 4UEKA 3SG0A 3MUNA 1U80A 2OZPA 5EJ8A 5DHAA 4DSUA 3TLEA 3VKUA 5AM3A 1Z6PA 1NRWA 1ZJ5A 3AKEA 4IGFA 5E4JA 2PKQP 3ZQ4A 1ECFA 3C5WP 2EDCA 2XJ4A 5KNBH 5KFUA 1YL6A 3G89A 3VTAA 2BSXA 1DJOA 4NBNA 4F9EA 4NYJQ 3RRMA 3EJWA 1ABEA 4X6YA 1KERA 3KYCA 4OK6A 5JVDF 4ETWA 2WSLA 1MO2A 2IYLD 2JIOA 4QQFA 4YCSA 5CB4B 1VRCA 4PHFA 3GBSA 1LD3A 1M7BA 9ICPA 4U9UA 3RV3A 5F1YA 2K87A 1SL0A 2YKGA 4KMOA 3HH8A 1IY8A 1C3VA 4YONB 4RPYA 1AV7A 4N18A 4BWGA 4RD0A 4BYGA 1HH4A 2PD6A 2Q9CA 4XLZA 2XYPA 4RDIA 1D2MA 3IPRA 3UJCA 1XKXA 5K8JB 2QZ4A 2YRFA 3D6AA 1E9SA 3PUJA 3MJRA 3K9LA 1EX6A 1RHMA 2GBLA 3RV4A 4LOLA 4P33A 3ICWA 3L2OB 2WV9A 3G0GA 3NHFA 5B12A 4YFVA 2FLVA 1UMKA 3OFNA 4CLOB 3FETA 5EZQA 4Q8FA 4IVQA 1TQHA 2IXDA 2D7JA 3DCYA 4LJLA 4RSMA 2XOXA 1Q1BA 3X1DA 1N5MA 1XTUA 3PGJA 4IEFB 3J81k 4IIEA 1Q0TA 1CR6A 4IXNA 1XNHA 4UM9D 5GOZA 1GTVA 2GEFA 3LTEA 3JWGA 4JC8A 4KP7A 4XJXA 2WTNA 3NETA 5GQSA 1ZJ4A 2CDNA 5C1PA 5C8YB 5IYZB 3KZXA 1XRJA 1F1BA 1W4CA 1Z7WA 3SBOA 4CKBB 2EKQA 3F97A 1CLEA 2JFPA 2C83A 4RU1A 4QQ8A 3WB9A 5IIKA 4RZ3A 4X6LA 4FYWA 2NAFA 2HIMA 1BRTA 1DZIA 1RKBA 4HUJA 4HGRA 4E31A 1EK5A 4W7IA 4EF4A 1NBAA 5IJ9B 4EHBA 2JLCA 1O6GA 1P39A 2LM1A 4KVGA 1YKFA 3LFHA 4F1JA 3G88A 4HVLA 5G2OA 3KVOA 4AMBA 3AJ9A 4PNPA 3VGJA 3VVBA 4F3RA 2QUBA 2IUEA 4GE0A 2B34A 4LWOA 1I4DD 2I8AA 2JLRA 2IYSA 1X9IA 5FTMA 5ITWA 2XNDA 5KT5A 1BDBA 4IUCS 1FTWA 1ZGHA 2NTJA 2Q3MA 1NJ1A 3V7WA 2A5YB 2DHQA 5HVNA 1KWKA 1N63A 2B69A 4MVJE 3CLRD 3PXBA 1DCMA 1F2VA 1OGJA 4QXOA 2HMWA 4BFLA 1U0GA 4IIDA 4ND7A 2CLOB 3MT7A 4C8LA 4MB2A 2G70A 2C2KA 1JHXA 3CW2C 2BM9A 2D1YA 2ID8A 5KAIU 2HSJA 1Y6QA 3AKYA 3DHWC 4PSAA 3FJOA 3LUPA 1EP9A 4GOKA 5HIIA 4OREX 2KQUA 2ISOA 2EW8A 3ELUA 1PR1A 2FYTA 3B8HA 3NASA 3OF5A 3FR8A 4WK0B 2B7LA 4LJ8A 4A0RA 1O0CA 1HF3A 1RQLA 3ISBA 2BGMA 2Q6OA 1YBMA 3ZXIA 1JYSA 4R6WA 1JRLA 2ETXA 3E53A 4HLUC 3L77A 1EG7A 2VP5A 4Z4QA 5A4DA 3N2GB 1NM5C 5K2OA 4GZ6A 7MDHA 2LDBA 4INOA 5JQGA 5CHGA 3NTVA 1BO6A 2OHVA 3R4CA 3AEQA 4F1WA 1QGOA 3EOAI 4GL2A 4ICAA 2BPCA 4O2AB 4DR3B 3RQSA 1O95C 3OI7A 3AUTA 4MLDA 4LVCA 1C3JA 3SU8A 4M98A 4TVKA 4DR4B 4ED1A 1XXHE 1R0YA 5EXTA 3VNRA 1E4EB 4NCIA 3BA6A 4KQXA 4IC9A 1IK4A 2R9VA 4A10A 3H1BA 8ICFA 3RRFA 1I4TD 3RTAA 3AR3A 4ZQEA 2AMLA 2R48A 3KQQA 4RSHA 5EIEA 2O19A 3LGXA 2EFHB 5CJ2A 2P0YA 3J80A 3FOCA 4A8HA 4ABYA 2GCPA 2A0XA 3ASZA 5J5AA 4YMTA 2KIVA 5KT3A 2B61A 4K8OA 3W8FA 1LPMA 2GH1A 3K2QA 5IZCC 3HZZA 3SYTA 2ZRNA 2A3NA 2G06A 1RPJA 4LISA 2PBLA 3DHVA 3EODA 1T8PA 5K8VA 1H9BA 6PFKA 3AWIA 2GN2A 1T5TA 3L7IA 7ICTA 4F4XA 1NVUQ 4ZU1X 1S5LU 1RYRA 1PZEA 3NP7A 2AV6A 1Z0UA 4DV7B 3IKVA 4IGKA 1X87A 3W5IA 2LZ0A 1RZUA 1XVAA 4HH0A 3ZE1B 3BRWA 3RYFA 1VJTA 2Y6UA 1N1EA 3T7EA 1VG0B 4UFOA 3RJ9A 2IKSA 3LHKA 4RIEA 4AJ4A 1EE1A 1TUIA 1Z12A 1QV9A 4NIMA 2I76A 2HOIA 2AG8A 3OQNA 2VO1A 3TR0A 5LCXA 2CV2A 4HWKA 1D1PA 4G0XA 1ZD1A 2FHSA 5F98A 4ASUD 4QULA 1RW4A 6ABPA 3W5UA 1UXJA 4NBSA 3H0MB 4MTLA 1PHPA 3WFIA 1LPBB 4RL6A 2QLFA 4AZWA 1RM4A 1B0XA 2XGQA 4HUQA 2JHDA 2BF4A 3A05A 2WDPA 1CUBA 4AS3A 1ZMTA 3UUFA 4BFXA 4BV9A 1Y9JA 5LQRA 1KWGA 5AOVA 4TLAA 5EZYF 1OPXA 5DWDA 3JARB 1GCAA 8ICYA 1RWOA 2OCLA 1BFKA 2RGDA 2ZIGA 4I50A 3DE0X 1JFVA 2AUMA 2C2XA 2NT4A 5E8JA 1EK0A 3WFJA 3II6X 2P30A 3NAMA 4B3SB 2W04A 1CK4A 3NTOA 4LBZA 1S0UA 1KETA 2VJ5A 4S05A 2H11A 1PSDA 1U4SA 2BGTA 3NH9A 3OX4A 2LWIA 1T3ZA 1E7QA 2ATCA 1ORVA 2P75A 4Q4DA 5KFFA 1T5SA 2VWGA 1OZAA 4HMPA 3QZ7A 4S2UA 4MPRA 1GQSA 4NHEA 4RESA 4XJTA 4YB8A 4Z9XA 5IIOA 2V7TA 3O8QB 3LE8A 3PQCA 4P3PA 4GLFA 5TLSA 2J3IA 2HSEA 4MKGA 2IYZA 3BJMA 4NY1A 4Q3OA 4IMJB 4JBGA 1U7XA 1YB4A 4NKRA 3QYPA 2R5FA 5C1DA 5B7NA 5IUNC 3TO5A 1DK2A 2A1TS 3NX4A 4BLQA 4E3WA 5B4UA 5GIPE 4B81A 4EARA 5JRJA 3N8DA 5F2KA 5CFQA 2JEIA 2X1HA 3N58A 1H0KA 3F5DA 1JQ5A 4L95C 3W2FA 1X9GA 1OWLA 2BGGA 1DO0A 1DVRA 1G7TA 1VCMA 3LHFA 4O6VA 4G63A 3HJTA 3F9IA 4Y18A 4JQZA 4D4IA 1CLUA 2IXGA 3RSLA 3RIHA 8OHMA 5KG5A 2AXQA 2ZJAA 4R8UA 1ZAKA 1OX4A 2O1EA 5I9BA 1ECJA 4KLUA 2YS6A 2FWRA 3GEIA 3QVSA 4HXEB 4Y6OA 2W43A 4JWNA 3RGGA 3L7LA 1XFDA 5AVUA 1GPDG 2F2TA 3HJUA 3CEPB 3I9V6 1D9ZA 3V33A 1JIXA 3VBEA 3M89A 4HT3B 4NULA 3D4NA 4JFAA 3N8HA 2XWQA 5I5EA 4MVJI 1PFGA 5EIBD 4PZDA 1COOA 1UC4B 1VSQA 1DINA 1HMYA 1Y7PA 3V7NA 2PG3A 2VNJA 1AO0A 3N2IA 5JXJA 5G40A 1N6NA 4BFCA 4DLAA 1DGJA 1TK9A 3KTOA 1HDZA 3VI4B 2VYNA 3MT0A 3UM9A 2OBMA 3RADC 2O8BA 4QZEA 4F8RA 1BTOA 2GM5A 2XB9A 5T64A 5CEFA 4YCBA 4ECQA 1R0WA 2YN2A 4QGAA 3M1YA 4BV2A 5AW0A 3TAPA 3IIEA 4AXXA 4GMXA 3KS9A 4A2CA 2ZTUA 4X6UA 5IRCD 2ZRJA 3QPWA 4L5YA 4FR5A 4B73A 4HQ6A 4B7ZA 4JL8A 4MV3A 4QZVA 3HSSA 3TLMA 1CKEA 5DBCA 2RHLA 4HTFB 4MRMA 5JRZA 4YGYA 5MFZA 3BKXA 2BZSA 5FX2A 4HAOA 1NOMA 1Q11A 1IXZA 1G3IA 1ZW6A 2A58A 1JKJB 3EPKA 4WEQA 1KI7A 2H3ZA 4LVNA 4YJFA 1N7IA 5SZJA 4B7XA 4COKA 1B74A 2HRCA 5IJZA 1IUNA 3DAHA 4F3CA 5ADHA 1GL7A 1QGYA 5IG2A 2ZBGA 3QXXA 3VPDA 4YX9A 1T3QA 5JBNA 3UN1A 1UM8A 3V48A 4Q4LA 5EMKA 3CZAA 3KX2A 2JVIA 1O54A 1JAIA 1NPTO 3HVJA 4M0PA 3OT1B 3QEOA 1SCDA 5AUQA 4K1XA 3NVWA 3EBPA 2FLKA 2I3AA 2WG2A 2X1LA 4OUKX 5KT7A 2YHIA 3HNPA 1KYZA 4DW8A 2ZJZA 2N75A 3JW8A 1XPOA 1US8B 8ICAA 3SJ7A 4C7BA 2GFQA 2ZUWA 2FR1A 2W7TA 3PX0A 3MQ2A 2Y68A 3WWPA 1XRMA 3NTUA 2XQVA 3FYUB 3GPIA 3H5NA 4YMLA 4K6GA 4L1KA 4ZT6A 1EJBA 1U7DA 4C7VA 3RSZA 1M34A 2FEMA 1T43A 2IPXA 3BS4A 1M10A 2QOEA 4NMWA 2HFJA 5WRFA 3WLEA 1ZUIA 4KXNA 3GRPA 4QQRA 4AO8A 1EX1A 4WLEA 3X1KA 5AI0A 1NQWA 1W88B 4QT0A 2O8NA 3ZCRA 3AB8A 3L8DA 3QVLA 2HHUA 2WD8A 2NO6A 2ZTLA 4RPXA 5IDWA 3EQZA 5CD1A 1JZSA 2GPAA 1KKUA 2EGHA 2I54A 3C29A 1HUOA 2BUAA 3K30A 4RHXA 1EGHA 2JFQA 1O5OA 3NYQA 1DRGA 4QBFA 1SQSA 4P8RA 2XKBA 4HEA6 3NIDB 2Y05A 2V3VA 1LI5A 1QOPB 2GETA 4LE2A 4XOUA 3W3AD 5KVQA 2C9YA 2EGUA 9ICBA 4B3BA 3AH8A 1MV8A 2CVZA 1YUMA 2UYYA 3Q3CA 1GZ3A 1SVKA 2CLHB 1WOMA 4L22A 2C1XA 1TK0A 4NYJR 4PS0A 4D9MA 1FNDA 4FU0A 1L1EA 2AHOB 1JA1A 1QFYA 3HFRA 3SLGA 3OM1A 1JHVA 2PUFA 4UAVA 1AXEA 4W8HA 5AHKA 5BRJA 1TPZA 3M81A 4F5RA 3UMBA 3BUSA 3BZKA 5LR6A 5BSTA 4CXMA 1PG2A 3L6EA 1Z7GA 4WOKA 4YAEA 3IELA 1L5HB 2H4FA 3HKCB 5DYTA 4WLOA 1PJZA 3CF6R 4RZIA 3G9TA 3UQZA 3CWCA 3VH3A 1N5JA 4F2DA 3TMYA 5F4BA 5F64A 5HRCA 7ICLA 1R00A 4QYIA 2EQYA 5IDVA 2YMPA 1F38A 4M9UA 4I2CA 1K88A 1EZ4A 4PFJA 4RK4A 2EV9A 2Q1UA 1VLMA 3F5SA 3NQ41 4G6ZA 4Y2YA 4TT3D 4OGGA 2DQ4A 2Q2VA 5K3CA 4JXXA 3N76A 1PK8A 3TQHA 4OJMX 1JX6A 1QHGA 4JJZA 3SK0A 1HZZC 3T9DA 4D92A 4HADA 2W93A 5HF5A 1O4VA 3LUHA 3ZU5A 1U1EA 2H65A 5L1MA 4TT3A 4P34A 5JDCA 3S81A 3RU3A 3OCYA 2W9CB 4LV6A 4ED8A 1EBBA 5B64A 3TG8A 2VQEB 4P35A 2QLMA 3KOZA 4NH0A 3WDMA 4Q00A 5CH5A 1AUPA 4P5PA 3REOA 2PTHA 1P1HA 2PT6A 1P5ZB 4YMNA 3QIVA 3IEXA 4NCJA 2QVXX 3UCFA 5C5JA 3CKMA 5M04A 1X1BA 5TT0A 1VL0A 3IRVA 4EGCB 2QSUA 5A4KA 3SSAA 5CXUA 5BXYA 2VZ0A 5H3LA 3JQPA 2ZJ5A 1DWOA 4R98A 3T0IA 1YAJA 4F4ZA 4KN4A 2DE0X 3SQLA 4BNDB 1Y5MA 2AOUB 2BFFA 1QBGA 4DCTA 1C9EA 2GYYA 2YWCA 5J2EA 3KV1A 2C5AA 5FD8A 1BAPA 1DO8A 1PJTA 4IAOA 5JMWA 4I2FA 1UHUA 3DD5A 4R2HA 5B53A 4DNFA 4PHCA 1QP8A 1FFUA 1RAGA 1RLTA 1S8FA 3CH6A 1JEEA 3MMZA 1T34A 4R7TA 4BDTA 3E4DA 2AD1A 1TRKA 1ZN9A 2QU7A 3ISVA 2O2ZA 3OQJA 4ZAWA 1KFSA 2FR8A 2J4FA 4CF3A 1OFVA 1WZCA 2B36A 3P4YA 2HNAA 3PSIA 5FRDA 3G13A 2H3HA 4RQ4A 1SXJB 5ALMA 1QRRA 2OFWA 4QUAA 4UQOA 1BEEA 2L17A 1D07A 2NZXA 3RS0A 3IJ5A 2WF5A 1GPAA 3QJYA 1XTQA 2AN9A 2IXEA 1Y3DE 1TCUA 4FFBA 4DVGA 5IHXA 1GPWB 3AR7A 1QCZA 1LDNA 1U48A 3VVLA 4DSTA 4EG5A 4UM7A 3ZWKA 5FYQA 1XYGA 4DOBA 2ZLBA 3OP1A 3QXHA 4HQRA 3Q9SA 3FDIA 1QYXA 5KT6A 5IK2A 1YA4A 3KFUF 4M55A 5LKAA 1N6LA 3QUTA 1S8AA 1XRPA 2XHEA 2Z30A 3HNRA 3QWIA 4YQYA 4X97A 2C95A 1KYTA 1IZ9A 4R31A 5IC6A 4HO1X 2FFBA 1CEXA 3NEAA 2HV8A 1MPXA 3ECSA 3H16A 5DTJA 1FUYB 1TT5B 2AF4C 5J4VA 3IG5A 1U7UA 1Z29A 2VXYA 1NUQA 1B26A 4TX1A 1KE1A 2H2GA 2G9NA 4E07A 4E5DA 3KHGA 4IRDA 4BO6A 1CNFA 2LUOA 4OOEA 5DGAA 5CA7A 2RHMA 4XQ9A 4AKEA 3KSBC 1J8FA 3P97A 1KKXA 1HL7A 2GF9A 3QPCA 3GPDG 4PLVA 5LLDA 2WZDA 3H0KA 4LKRA 5ECWA 3NOVA 1G8PA 3OZAA 3ITEA 3D8NA 2YXLA 1QGDA 2PO7A 2D3WA 3ADKA 4G5SA 1UAYA 4WBNA 4TYNA 1F20A 2Q8NA 1VIDA 4FJ1A 4WK2B 3ETRA 5DOVA 1CW2B 4O4HA 4IIVA 5E79U 1DOZA 4FT4A 3MR3A 3FLBA 1NI4B 4BKUA 4F5YA 2Y1EA 4KTTE 4AS2A 1DUIA 2EJWA 1RBYA 1X13A 1RP1A 4PCLA 4D0RA 3VOTA 1NP3A 2X2PA 1C7ZA 4PC6A 5A4IS 3D4LA 3KJNA 5IW8A 3CCCA 3CEHA 3ZLTA 2MTBA 5CYGA 4FS1A 1D5WA 3ZE6A 1CG6A 4LTMA 4W5WA 3G2OA 4BQEA 4EPXA 2RAFA 3UWMA 2GZDA 4EIWA 3I2HA 1Y3CE 4J0DA 1NXQA 3MWFA 3R5HA 2QRMA 1QP0A 1PWHA 1U3GA 3T9BA 1GUBA 1CIVA 3RYIB 6LDHA 1SN7A 2W6JD 4HEA1 4HAVA 3U7QB 2QENA 3LQFA 1FDWA 4KLGA 4ZKDA 2YZKA 1KI4A 1NG9A 2WWWA 2FN8A 3J7AC 4IH4A 1V9CA 3H3JA 4OHXA 1E2QA 1VKZA 2NPIA 3H6GA 3K0FA 3PFFA 4GQBA 4YP5A 1BMFA 4F21A 4FB5A 5LDDC 5HYVA 1E9BA 2H92A 5I7RA 4ZI3A 4QOIA 2LD4A 5BR8B 1Y1SA 3U4QA 4YP0A 5ILOA 3OPXA 1G21E 4QTXA 1OHHD 3AYXB 3UWPA 2XQGA 5AR1A 5SZHB 4BTEA 1NUPA 1VZ3A 2C5HA 5ALXA 1T8TA 4PX2A 4ZT7A 4LV8B 1XTJA 3PW5A 1T3TA 5M7EA 3IJRA 3CYFA 1K08A 1K4KA 3IKLA 1RRGA 1W9HA 1XMIA 1H38A 2FPLA 3GL9A 3H6HA 1XLTA 3O82A 3TLAA 2PD3A 1YD7A 2VDNB 2WNSA 4C87A 2G82A 2V1XA 3AW9A 3MQFA 1KDPA 4L4ZA 1IULA 1WG8A 4M1EA 1XCGB 2HLHA 2OK8A 2X58A 2EG5A 3L4EA 3FUXA 2UVQA 1ZQBA 1N75A 3GDWA 3P9QA 3N8KA 1RPTA 2YZGA 2EYQA 3BRQA 4CQNA 2QNIA 4Z7QB 2ZAIA 3NOXA 4M0FA 2W7PA 1KW4A 1G20B 3RS9A 4WPGA 1JJFA 4EB8A 1EUDB 3IBFA 1R0LA 1T3LA 1WEKA 3HYNA 3IESA 4UBOA 4X7PA 1AGYA 1EGMB 4EBCA 3Q8MA 2EZUA 3Q3JB 4MV1A 3T06B 4ZI2A 5F77A 5BN3B 1XNQB 5GM2A 4DLUA 5CHEA 4IQWA 5EWMB 5T57A 3WLJA 4F3TA 3OJSA 4GBGA 3T5TA 1VQ1A 2PQ0A 4Q44A 3DP9A 2C00A 5LWHA 4Q9HA 2VP6A 5THXA 4II7A 3K71B 5EJ6A 2C2BA 2YXEA 1QIKA 1L3TA 4FE4A 4M88A 3RH5A 1Z16A 1H2AS 1J70A 4YWHA 3BH6A 4LYFA 2I22A 3HB1A 3RH4A 2R0QC 2OD2A 4XX0B 4GI7A 4NLLA 3IQIX 1Y8RA 3Q6NA 3V80A 5FAKA 5K0JA 2R6FA 1X1DA 2GLXA 1SPXA 3F7OA 3OCUA 1XTTA 3KL4A 4KLNA 2H1IA 4FBUA 3ZHQA 4PN7A 5K4GA 1QP7A 3UOAB 3TIGA 1AQNA 1W88A 3QVVA 4B87A 3W5VA 1H2EA 5BYKA 1NMEA 2I87A 3D2AA 5HM6A 3HWRA 1GTG1 2I7DA 2LGJA 5F76A 4C8OA 3TIXB 3NAQA 1FLAA 3FPKA 4KYIB 4B74A 1CQJB 1BNOA 1L2TA 1TNDA 1EWRA 3TADA 2B6HA 2JRZA 2IP1A 2J3QA 2KNJA 1P80A 2MSCB 4IOLA 1OAOA 3QHPA 4QYMA 1QVAA 5BQXA 3TQQA 4JV0A 1V8PA 1J8MF 4KLSA 1LLUA 3IPYA 4GM1A 3DEFA 4MIEA 4DDUA 3CP8A 4F3OA 3NAGA 1NJZA 4F4IA 4QRHA 5C8XA 2N1MA 3EZ2A 4PGXA 3O3OB 4HV4A 3P5SA 3C7CB 1J99A 1KBOA 4OEHA 5GJCA 1P9NA 3KWLA 3PNSA 2OK7A 2FQQA 2IX3A 3OLXA 1AKUA 3QVUA 2VSOA 5KNDA 1K98A 4UU1A 4UNSA 4A27A 3I1IA 5G0SA 3PCTA 4JH0A 1FRZA 4F97A 4EG3A 1NUTA 3O83A 3JY6A 3AY3A 3GZNA 3RYCA 1Y6GA 4EJFA 5FHQA 1XLVA 3IAS6 4L5IA 4XB1A 2VBGA 3B53X 2GILA 4P32A 2H3VA 1VKRA 1Z45A 3CNEA 1VI2A 3P27A 4N1AA 4YDQA 1UFVA 3U48A 3I5UA 4TTAA 1OC2A 4XE5A 2XR1A 3WL4A 3U5TA 1AHHA 2BH9A 5JQGF 1F8FA 3H13A 4UDNA 4X8HA 4B80A 1AH2A 4IF6A 1ZQCA 1R7RA 3R3YA 5KYYB 4RTPA 5BOLA 2CDAA 4JLNA 5C5DA 2R7NA 2CUKA 4UUMA 3EVBA 5AW8A 5IJ0B 2OKCA 4HX2A 1GUZA 1UBUS 2I7CA 2AJLI 2J5RA 4OGFA 4Q7JB 4M22A 4J1TA 2F3UA 2XX3A 4MRNA 3TZQA 5HJ2A 1A9TA 1OLUA 2PWZA 3G5TA 1UJ6A 2NUBA 3LRTA 4PGAA 5A9TA 3PQDA 4V24A 5KWEA 1WZ2A 5AM0A 3VQTA 4P81A 2EDUA 1X39A 3QV1A 1ZRNA 3MRSA 3A7EA 5JYCA 1JHMA 4PNEA 2JLYA 4B3MB 4NNOA 4Z51A 3WBBA 4MW1A 1TM3E 1MJ5A 4JVMA 5BV7A 1TW2A 1GA1A 1CC1S 2BOVA 4RVGA 1IIPA 3MWYW 4FZ3A 3T1VA 2Q4EA 4KR2A 1GO2A 4C0AC 4MDEA 9ICJA 1MJGM 3EW7A 4KLFA 3JZFA 1MN6A 4IPTA 2IYRA 2O7VA 1JBEA 3GXOA 4CGYA 3EZFA 4LK3A 2HK9A 2A35A 1ZH8A 3UA3A 4ETNA 2F1HA 2M2IA 1ED1A 1UPFA 2UYOA 1JPUA 3I5AA 3HKEB 4HNAA 2JFWA 4ZAZA 5G0WA 2N47A 1XC9A 3UOWA 1DFHA 3I72A 2R25B 3KQWA 2ANBA 3TBHA 2HUNA 5ALHA 5HKLA 5KFEA 3A9RA 1LCIA 5AD1A 4WN9B 3E05A 1T91A 4O2BA 2CBXA 2XE4A 4MVJD 2WWYA 4PBTA 2IF0A 3BZWA 2LYBA 4REMA 3T3HA 3RJKA 3VU0A 4ZK6A 4FX2A 3UXHA 1Q3KA 4WXYB 4RDHA 2RGUA 3ICXA 1NBWB 2C0PA 4PLFA 4DO9A 5FBVB 2NLOA 2HRRA 4RA6A 2IQ5A 3NBXX 2QL7A 1XQWA 1OA1A 4P4TA 2PN1A 5A04A 2WQ7A 4DB2A 4BP1A 5FNZA 2W6PA 1IAVA 3VKFA 5P21A 4FDMA 2LBOA 2CDCA 4Y7DA 1T5IA 1VKJA 2R11A 3RYHB 3TRKA 5REQB 4ALKA 4K9RA 4YECA 4EYSA 5JVDA 4O5EA 4X5VA 1QQTA 3RVMA 2AGQA 1PL8A 1ID1A 2EARA 4UE3S 4EMTA 2IVZA 2KJ9A 3QOWA 3CR7A 3WZLA 3ZDDA 1M0WA 2EJTA 2FUEA 5J4YA 3ZJUA 4NCHA 1QF6A 3OTQA 2RGBA 1A9XB 4MR7A 3LLVA 1WYGA 1HMPA 1HSZA 2IHMA 4Q21A 3RFFA 3RWOA 1OV4A 1DIGA 1WPRA 1ATIA 3AVOA 1XLUA 2BFDA 5AH0A 5ICGA 1YRYE 4MV9A 4ENWA 3T79A 4OHMA 3GNSA 5LP1A 4BO3A 2LP4Y 1E3WB 2NX2A 2MR5A 721PA 2AR0A 2BY4A 2Q5CA 8ICTA 1RLUA 3U1TA 1L4LA 2PS3A 2QUKA 3IQXA 4YDRA 3VHXB 1G4UR 2F59A 3WMRA 1SD1A 2IEDA 3WO0A 4Y2SA 2GPJA 5F3DA 1R64A 1RLJA 5SZIA 2P2YA 1FYFA 1OI4A 3HXLA 4I55F 4NPAA 4EW6A 1RRCA 5JFOA 3W7AA 1FLVA 2JH1A 2I0FA 1HDGO 5CVDA 3WJAA 3S8MA 1EZZA 9GPBA 3OIGA 2O5VA 2OBXA 1NM5A 2HNKA 3B1WA 2VNKA 1UWKA 2HLNA 1P0QA 3BXPA 3RUFA 3SBDA 4EOGA 4G0MA 4D7AA 2XA1A 1DRUA 4EECA 2C84A 1NMZA 1BN7A 1IQPA 4RMHA 1XZMA 3A58B 3P2KA 2QLJA 5FLEX 1UZAA 2H16A 3TANA 1KPGA 2ATXA 4YXJA 2GWRA 2OGSA 3KUXA 1ZQIA 1AHNA 2PL1A 3TDMA 3CH5A 4ZQFA 5KOHB 1GN8A 4FFNA 3S3TA 4EKDA 4JMLA 1ZCJA 3CKKA 3CW2A 2GM9A 4GDMA 3WGIA 5HF6A 6Q21A 1J24A 1HLGA 1I3MA 2FQYA 3H2KA 3HFGA 3KDPA 1QGUB 1KDVA 4U39A 4LC1A 1TC2A 1UKCA 4B48A 4CG0A 2ZZMA 3FFAA 2ZYTX 1CUVA 3NOOA 4K8RB 5A0LA 2P7IA 4YRTA 4ZZ1A 4YMHA 4QPZA 3R5JA 4XX0A 3SF8B 2OE2A 4Y9SA 2OBFA 3AUYA 4ZVSA 1FUKA 1C81A 2BLNA 2H1RA 3UHOA 1F2UA 3FNGA 1QHHA 1ZD9A 2FGKA 5CYFA 5E1OA 2GMWA 5BQOA 1DTEA 3GLKA 4FXPA 1ESZA 2BHLA 1BCSA 1NFQA 4JQOA 3N2EA 2BKVA 2JKYA 2X13A 4MWTA 3HO1A 2ORWA 4CFYA 4NOKA 1RQNA 3GIIA 1E1CB 4XCVA 1UPAA 2UUAB 4UAWA 4QREA 2WK1A 3TQTA 1IM8A 5ICEA 4C7XA 4KQWA 3B5EA 2Z09A 2NSHA 1K4MA 2WVJA 3R9KA 2DKZA 1IB0A 1CQIB 1UBNA 1W30A 3NGLA 1COWD 2XNHA 1C7EA 1TVKB 2PKXA 1SO8A 1IXRC 2B1RA 1UPXA 1MLDA 3H84A 1W96A 3QKRB 4FVTA 4YR9A 2GJ8A 5LA6F 2GXAA 3GLHA 3LP8A 4XDHA 4HWSA 1DV1A 5CJ7A 3H5TA 2RHGB 4I5IA 4O2BF 5I5GA 3OIWA 3KDAA 5TPZD 4EFKA 5L1IA 4N3AA 1T25A 5MFPA 3L8EA 3B9QA 4NLNA 3KKOA 3T5CA 1LBIA 2OLKA 1G38A 4L9WA 4ED0A 1TK5A 4HDSA 4R51A 1L5SA 2V9WA 3L0SA 5K8IA 5J2TB 1LTKA 3LTNC 3PXGA 2ECPA 4J1TC 4HAWA 4FIDA 5ALJA 3KFXA 4BLWA 4MPJA 3ORSA 2WHPB 1R0CA 4W5JA 5TS3A 1ENOA 3DOIA 3GA0A 1CUZA 2O48X 9ICNA 1ZDMA 1PLLA 2VJQA 3CCFA 2POQX 4FI3F 5E9JA 5HFNA 5BRNA 5LD2B 5KTPA 3IIIA 2XNSA 3SS9X 2MSLA 3Q8KA 2QRJA 5IYZA 1P3Y1 3I04M 1SZJG 1JQAA 1U2RA 2XYVA 4FONA 1U49A 4NARA 4DIBA 4NDZA 4I9UA 4M60A 3LI2A 4IIFA 4S12A 2W71A 2Z2YA 4KRYA 1TX4B 2XUDA 3H0LB 3CZPA 2RDMA 3RG2A 4UB4A 4X1KB 3DAOA 2RGWA 2EF0A 2WEKA 4RJ2A 5EHXA 3BE6A 3O94A 4WDQA 4OOFA 3ABRB 1K92A 4JYMA 2IUSA 4ZT5A 3DNFA 3TJRA 4AN0A 5TB5A 2QU8A 1L4YA 3HVIA 4W1PA 4G4JA 4EMSA 1QDLB 4ZEXA 4OJPA 5CLLA 2AW3A 4KLLA 1MO4A 1I1HA 3L8HA 4QZIA 3DGFC 1PJRA 3WRYC 2BMWA 2NSDA 5FBKA 2X9VA 2BJHA 3VC7A 3NWOA 4KFUA 7ICSA 1PWYE 3ACDA 3AOEA 3BYZA 4IICA 3O3CA 3HE3A 1X9XA 4LOAA 2XAAA 4NENA 4Q66C 2XZLA 1I4OA 2W2LD 1P8JA 3DVSX 3THSA 3CA8A 5TJ9A 4QW9A 5TDHA 3G02A 4KV7A 1BWQA 4D9EA 4TV8A 3VH2A 3BWEA 1DWUA 2QY9A 5TMPA 4RPCA 3SV3A 1NDQA 5DN6A 2BQRA 2OESA 2V6JA 2AJBA 1TUEA 5KC8A 2K4PA 2EP5A 2ZSHA 4I1RA 3S2UA 5HQTA 3UJDA 3P2OA 2OOKA 1L8QA 3AR8A 5DQIA 1NZPA 3I9KA 5ITVA 4LE0A 3TKLA 5KOIA 3A37A 2OAP1 3NJ4A 2EKLA 5FPHA 2QX6A 5EUMA 4IV8A 3F1LA 1R9MA 1QZUA 3TL6A 3ZDFA 2Y0SC 2WAYA 1SAYA 1TVAA 2DBRA 4JJ4A 4RQ7A 2OHGA 4NFYA 5A9RA 3E7WA 2DBVO 1GQRA 2GK4A 4MCJA 4QPDA 3I6BA 1OZGA 1QIMA 3L7OA 3DMFA 3VPBA 3PXEA 4AKIA 4TYYA 1V1JA 2FMIA 3VYUB 1W76A 2OAEA 2V4ZA 2VXBA 4WNAB 2IEZA 2XUPA 1IMJA 2XMRA 4NWIA 4IKPA 4A26A 3BEDA 1WO8A 3TQRA 4FDAA 1VRVA 2GB4A 3BJZA 3CZ4A 2BGWA 4PWZA 4YNBA 5EA2A 5JSKA 1DQRA 4YP1A 3U0VA 4N48A 5ALZA 2B6GA 1V41E 1YQXA 4I81A 4QUBA 3FPEA 1DTWA 1PR3A 2W42A 2JD2A 1L7AA 4ML3A 2VJBA 4HXYA 4EVRA 2Q5HA 3COVA 3VAZA 3E3OA 1T4CB 1OQAA 1D2AA 3TS1A 3A6JA 2ZIAA 2AEMA 5ILQA 3HDVA 2G9QA 3LBHA 2NYVA 3Q7TA 1HKHA 4WERA 3GUUA 3N8GA 1A8PA 3K9QO 5LP6A 4BGEA 4Z1OA 2FKAA 3Q11A 4MFCA 4GMFA 3REGA 3RFXA 2Q0ZX 2YJGA 4BIIA 5G4KA 4IWXA 1AQUA 3MILA 5JNTA 3R0JA 4OPMA 4ZK2A 3DCNA 2KP7A 2PEZA 5TY0A 2D4HA 3OLVA 4F6RA 3ZYCA 2WICA 4LHYA 2ZUCA 3Q8LA 2CJWB 3NGDA 1P4AA 3F3KA 1GTRA 2QLNA 3PHGA 2E5LB 3FVVA 5D4BA 2WW8A 5GZ1A 4GSKA 1CDOA 1FJHA 3UH1A 4YRKA 3UXYA 1Z68A 3HR4A 2Y99A 4LZJA 1N0UA 2SCUB 5G0UA 3A6FA 3QE4A 3LRPA 5THQA 3QU4A 1MBZA 8ICEA 5A4FS 3PTLA 4HWRA 1TKCA 3E8SA 2DWQA 5ALYA 1LI4A 2XQKA 2RGYA 4RXTA 1SZCA 4ARUA 4BN4A 5LIRA 1CVIA 4CUZA 1L5OA 2XUAA 3QX7A 2ZT7A 1UDRA 1Y6ZA 4JY7A 4DA9A 1VA4A 3DTNA 3RJZA 1JIVA 2C1ZA 3L8GA 4AJIA 3BD8A 2XWSA 3BWDD 4XYGA 2QXTA 4CDMA 1FFGA 1XV5A 1G21A 2AE2A 3N86A 3IRUA 4JR0A 4EK9A 4I3FA 5HOQA 1TYZA 3TB6A 1AGXA 4CTNA 4AZVA 4G0PA 3I9JA 4NNPA 1ZJJA 3LKZA 3IVAA 1CZNA 4AJ9A 4AMVA 1GXSB 4NY8A 1GQ2A 5JCXA 4MA4A 1QK3A 2FF7A 4AUMA 2O0LA 4XD2A 2P2GA 4M89A 1USKA 2XSZA 3PPVA 5FBWB 1DBIA 1O97D 2I71A 5KJ6A 2HOQA 1ULHA 1R18A 5ESXA 2E6UX 2R4UA 4ICIA 3T54A 4ZU6X 1WF3A 1SXJC 4D0SA 1N6RA 2XA9A 1SHLA 3SFZA 3WL7A 4DCNA 3L0YA 2R8GA 5IABA 2XCPA 3H9EO 2C8LA 4NJEA 2W2MA 4KQHA 1ZQOA 1BHJA 2I34A 3IJPA 3L0ZA 2RHWA 1KSJA 2PZFA 3OZSA 3N2KB 3OEWA 2FEAA 4B6OA 3IA7A 1S0MA 5DG7A 4PANA 1KFJB 1P81A 3FMOB 4JI2B 3O5AA 1PG0A 3GZFA 4YCLA 2JBAA 1SOMA 4ZYYA 1T5DX 5LZ4A 1D9DA 3NM5A 5G4KB 1RWWA 3PKIA 1JB1A 5I8ZA 3JD2A 1KPHA 9ICCA 1XL0A 2OY0A 3KFLA 3ESBA 1LK5A 2XECA 5B1SA 4AJJA 3GJXC 3GLFB 1YKGA 2Q5FA 2HWWA 2DU8A 2TMKA 1NULA 4M9LA 1NT4A 3C3JA 3KEOA 1P29A 1A9SA 4XWKA 3UO8B 4R8VA 3EG5A 4Z1MD 2FPIA 2VAVA 3H1TA 4JSYA 3WQSB 5BSKA 5KSZA 5DLFA 1UINA 4PO8A 4MMXB 4B17A 4ED3A 2OSBA 3G8AA 1RXUA 1NF3A 4NAVA 4RV4A 1IRXA 1JJIA 1YCFA 3PITA 3I45A 5DVZA 2P2SA 4MWDA 4UULA 1KZ4A 2ZJ2A 4CQJA 4AKSA 3QG1A 1CUSA 1J8QA 5FI1B 3RH0A 3RSFA 3G5UA 2RKOA 1J5PA 1RJ9A 1I6MA 1EXDA 1QE3A 3AI7A 4HWGA 4IL6U 2QKYA 4F3YA 4PZZA 1A8IA 5JY1A 1ADFA 3GG9A 2GN9A 3FCEA 1F12A 1WMDA 1KP2A 2HHAA 4S1VA 4DDTA 2X42A 3C21A 1YL7A 3C74A 4IVRA 3DULA 2GYWA 2W6JA 2WSIA 2O2IA 1GR1A 2BGJA 3FNBA 5KSPA 1NJWA 1KZHA 4C3VA 1V11B 1KI6B 3M9WA 2GO7A 2FKNA 3HR7A 4N3GA 5M29A 1MB2A 4EUEA 1A7UA 3ICPA 3MJTA 2IOFA 1LV8A 1J0BA 2UDPA 4PQEA 5C3UA 1Z0IA 2Q28A 1EDZA 1U02A 1EFTA 4JLKA 4Y6PA 3I8SA 4RUAA 2G0TA 1X15A 2PLWA 3PVSA 3S1AB 2C2OA 5EXEA 1BPXA 2JHFA 5MHTA 4NCKA 4EI2A 1NTRA 4B9LA 1STOA 3PXUA 3ZOKA 3Q0EA 4DYHA 5K03A 5DLYA 1Q2XA 1Z17A 4EHLA 3QF7A 1N2JA 1RIIA 3WRWA 1JMSA 1PVVA 5T4BA 1TCBA 1UOEA 5CFPA 2J7KA 4MYHA 1K9SA 3UAYA 5B1IA 1JIUA 4MUKA 3PL5A 5L53A 1XZEA 1J0XO 1ONBA 4PFQA 5J5VA 1ACJA 2EQ5A 5DHFA 2BR5A 3E1GA 1PD1A 1LX7A 5JNVA 1E2BA 2ARKA 3WNZA 1JI3A 3PGXA 2LKCA 2H00A 1GVNB 3EXHA 4EW2A 5BMOA 1C3EA 1WBJB 5DE3A 3UPTA 3K9FC 2YZMA 2Z3ZA 3AHEA 3TTVA 1W36C 2XC9A 1P0PA 4PZEA 5FAXA 3MLAA 2QYOA 4EG8A 4YR3A 5BOSA 2EKDA 1ZMOA 2R87A 4OFBA 4Z3OA 1R1DA 4GKAA 5EUBA 3U9LA 1QCYA 2C59A 3E9RA 1EDEA 3HW8A 3MXTA 4GKBA 3T4PA 3ZVLA 4RM2A 5F2OA 4RYDA 4QECA 5FWXA 1QV6A 4INJA 3N59A 4I4CA 3KSDO 3M83A 4KGVA 4FQ5A 2IDMA 2YHIB 4BNJA 1M5UA 4UPEA 1MZPA 4YFKA 1GYQA 4TURA 2OR3A 1Q46A 1XP8A 3JALB 4B0PA 4NXNB 3S6JA 2Q29A 2QTVB 2ZJFA 3D6JA 3C16C 2BBOA 4GSYA 1XWWA 3G6KA 1EJ6A 3RBDA 3KT6A 4KITB 1U0FA 4N9QA 3T7JA 3QQPA 3TZKA 2JG3A 2O8CA 3ESXA 3H1AA 4A9AA 2O7QA 4FFWA 4IHAA 1R6UA 3O91A 4LZPA 4WX2B 1V3TA 1L4UA 2P3SA 2XLBA 1ODTC 5CCXA 1EWYA 4G89A 4DT1A 1ZU4A 4RETA 1AGPA 3PSAA 3VAAA 3NXSA 1NW8A 4DF8A 1OSNA 1KBZA 1OT3A 4WBNF 1AUVA 2C9DA 3AV3A 3MBKA 4BKPA 3EIQA 1PGOA 3CWZA 3E70C 1VI5A 2JI4A 3FB4A 1ZESA 2GEJA 3KAKA 4TMWA 3HRDD 1SBNE 3ZGVA 1G59A 2B8TA 5CW2A 1EG2A 5FUXA 3LC7O 3NV7A 1JDJA 3ACBA 5KYVA 2J3MA 4U7PB 2A1IA 4DQIA 2RJ3A 5G53C 2EWWA 1UBTS 4UB5A 3KKLA 4LGVA 1JAYA 1N6PA 2W4MA 2MWMA 4IOJA 4M99A 3N97B 4O4HF 4RVSA 3VA7A 4I4TB 2KB0A 1VHQA 3PR3A 5KFSA 4IVNA 3OFJA 5BO5A 3RG8A 4W99A 1M54A 1NMXA 4KIJA 1CDDA 5BQ5A 1BXGB 3SZ3A 3R3XA 3MMSA 2KW5A 5H9VA 3THOA 3W2GA 3W9SA 4A8JB 4G5OA 4ECVA 1R9NA 1LC3A 1ZCZA 3A9CA 3NHWA 5DK4A 2CKMA 2R6DA 2X4IA 4MCAA 4L9AA 1HQYE 3P0JA 3MYRA 4JUFA 3LPLA 1TJNA 4U0KA 2HBZA 1U4NA 2ISCA 5LYYA 4C04A 4C76A 5F3XB 5KVSA 2X0EA 4FWTA 3MWDA 5L1KA 1M8JA 4NJMA 4OL0A 1ZMBA 5E3IA 1XN1A 2D6FA 1GKYA 4US9A 1SBTA 4NG5A 4QWCA 1K75A 4N9WA 4XTCS 1VXRA 3M8RA 2WM3A 4FFLA 1HLPA 5KFRA 3AHCA 3TZLA 3PW0A 4D3SA 3UYKA 2FG7C 3ND9A 4G2TA 1D0SA 3IB6A 3QA9A 2PZAA 4KLAA 5DCWA 4RTJA 4ALIA 4W5HA 4RPJA 3FSRA 3SBXA 4P86A 2ASLA 2P0EA 2VEOA 2WMDA 1CZKA 5CT9A 1PJLA 4L5JA 1OBCA 4MXDA 5D5HA 4UBJA 3WXBA 4E13A 3T99A 1M2VA 2FPGA 3DOHA 4R63A 4GGOA 4L78A 2HKIA 4ZCSA 2YDXA 3RT9A 3SR0A 4E51A 1QE0A 4M21A 2J0UA 1PLJA 3MF4A 4D8WA 3G2IA 4ZIRA 3HN2A 4H15A 5JZMA 3BD6A 1JEJA 4MW4A 2IBKA 3RFVA 3DEEA 2KHVA 1O96A 2O23A 1P4JA 3N0WA 5G02A 2WHXA 3FNIA 4C20A 5L6LB 5BNFA 2J45A 3SSMA 2ZB2A 5KTSA 1TZJA 5LIPA 1TZ2A 2W9AA 2RIPA 3QBVA 4P36A 5CG2A 1RYYA 1TU0A 2G5CA 4OP1A 3UB4A 5FLXA 1WHSB 2V5UA 1XDWA 3AL0C 3R5TA 2ONKA 5CXQA 1N2XA 3ICVA 4CU2A 1QK4A 3GZTB 4F5OA 3C0KA 3LZ6A 4TL6A 4AQ7A 2OXCA 2HDNB 5J47A 2O2DA 4TQGA 3V7FA 2B1IA 4BFTA 1F6WA 1IVYA 3NJ8A 3RVJA 5JYEA 2W0MA 1XPJA 4C08A 4B8WA 1QH9A 2ID9A 3OPYA 2KM1A 5FLKA 2FWAA 1X42A 3ZLUA 3H4BA 4KLZA 2NUAB 3LUCA 3IOYA 1VBKA 2WUWE 1DBSA 4M9QA 1YZKA 2MMCA 1GDTA 4N5HX 1JL3A 1P4SA 1S9FA 1CERA 1QIDA 1VJGA 2QMZA 2VP3A 3ET5A 4L07A 4OAPA 4OJ6A 3LNCA 5K6AA 3W04A 1BE8A 1JFFA 3IAM6 1L4BA 4DSEA 2ODEA 3D7SA 4P38A 4PQYA 3MM4A 3ZDYB 5A9SA 1UPCA 2LI6A 2CMGA 1S10A 3MB5A 4ZO9A 1JVNA 1SU6A 2DAPA 2C22A 2G5HB 1U7WA 2V7UA 3DDZX 3LY7A 3OD1A 4G0YA 4LXQA 3HFJA 2BQ3A 4R1PA 2Y0PA 5IJ0A 1UKBA 1JSRA 1PUIA 4K4IA 1LF5A 4YMMA 1DRJA 1Q5PA 3FBGA 3NNSA 3OZEA 3TPFA 2XOKD 2YASA 1EGQA 2FY8A 3JPPA 4G85A 1GSOA 4XLLA 4JV1A 3BGDA 1F3OA 3CG4A 1WUKS 3AEXA 4RH0A 1KZ7B 5AOAA 1DIRA 1NFRA 4JOSA 4YT2A 3T3NA 2CNLA 1DEXA 2QTAA 4LWZA 5LOVF 5L40A 5U9CA 3WYNA 2D8AA 4TV8B 4RTKA 4LDNA 4EYHB 3GLHE 3AU9A 4I50F 3NHYA 1WSAA 5D87A 2AFRA 1SBZA 3ISJA 4UM9B 4Z7JA 5AVZA 2F1JA 4G1MB 3BT7A 2ORIA 2IEYA 4KH0A 3OJLA 2W22A 2ZB8A 1CQJA 2EZTA 3LGAA 4PTLA 3QE3A 8ICCA 3IJEB 4BMZA 1D03A 2FX3A 4XA5A 4OP3A 3VPHA 2KMLA 2HPHA 3PXXA 3GGOA 1QKIA 1SHTX 2YS7A 2OHOA 3IAEA 4UCXA 3PU6A 2HBYA 1T3NA 3V7UA 4ZA2A 1O94A 1R9JA 1C0KA 1WPQA 5ERYA 4E32A 2H3EA 1EVIA 2XLCA 3Q5DA 5CYPA 3AHFA 3GLSA 1UIMA 2FVXA 2O2YA 5IANA 1Z4QA 1ZK3A 1SHJA 2BCGY 2QZJA 1A1SA 1NY5A 2B37A 1D8BA 3E5HA 1QRUA 1QHSA 3OA0A 3IQZA 1RWPA 3U3XA 4ENQA 2DMRA 5L7YA 3GVPA 3WGHA 5ARBA 3DPSA 3KCQA 1XWLA 3R24A 2ZYVX 4OUDB 1MAAA 3TTSA 1YS1X 1H4VB 3PWTA 1H2BA 4O02B 2HXSA 4MTCA 3ZTWA 3AQFA 2VSNA 1QFJA 4W8OA 5BSHA 2VDUE 3UPDA 4YPVA 1M76A 1QWSA 2IUTA 1PL0A 3BG5A 2Z8XA 3M0EA 2DQNB 3WKAA 1LB1B 4REQA 3UWDA 1JDSA 2QN3A 4HDQB 2FPSA 2N3ZA 2DP4E 3VR0A 2CXXA 1L8LA 2J7PA 5JDCC 3ZNQA 1QX4A 1Q7BA 3GQBA 2NU9B 5HUHA 1S2LA 1UP7A 1TJYA 2FW7A 4Z6KA 5EUCA 2WAQF 2O2XA 5K3FB 1ZR2A 4TZ6A 4MUYA 1VE7A 1P9WA 1UPHA 1K8YB 1NSTA 2OXIA 3LNTA 5ARCA 2R6CA 2J0VA 2YWGA 4NL4H 3VR4A 5A1JA 1B42A 2GJAA 3AW8A 1YJAA 4O4IB 4OMCA 3BKWA 3ZIDA 2W00A 2OC9A 4QWAA 3MTAA 1AXRA 3IXQA 5ESRA 4RJKA 2D1RA 3Q2KA 1LA2A 2XVZA 1YCHA 4OKSA 1VHJA 2VK2A 5EJ2A 4F5WA 2XMZA 1NV9A 3EPGA 2NU6A 4D9JA 2JLVA 2X6QA 1E0AA 3OLWA 4RFLA 3R44A 3ESQA 2OO5A 3Q10A 2HO5A 4YJDA 1U0TA 2O6HA 2WAQC 3R20A 5JBQA 2W03A 3CY6A 4ND5A 2JK0A 4RGQA 2QX9A 1B22A 2R85A 3IIJA 3UQ2A 1WZIA 2CHFA 4DEZA 2XW6A 1FYVA 2VN8A 2ZSIA 2SNIE 3PEWA 3LGSA 3ZD7A 1QBKC 1VPLA 1E1QA 3LH5A 3NBMA 3QP9A 3E9QA 5E4FA 5TRTA 4RTNA 3YASA 4Q43A 5FR2A 3LO5A 3P0FA 1OV6A 3BGWA 2G1KA 4BWFB 2CZQA 3CE6A 1G2QA 1GG2A 2VEDA 2VYCA 2Y1WA 3D6VA 2GLTA 2Q5LA 1K3UB 4X20A 5EQDA 3PW4A 3VDQA 4BIMA 4C4OA 4QATA 3WLKX 3CE9A 1JDBC 5CVTA 2ODAA 4HVAA 1L7VC 1VLHA 4NE9A 4LSMA 2JEGA 2YBDA 3H99A 4UMEA 3QMWA 4EB0A 1VPDA 2YDYA 2ZJ6A 2ZRLA 4MEJA 2JARA 3EBLA 4OBBA 4MI6A 4DJFC 4H18A 5KQSA 1K4YA 3E7XA 2PWBA 2GXUA 2O3SA 1NNI1 3IOCA 3O4IA 4DIMA 5ISMA 5KFQA 3SKVA 1Z1VA 1UP4A 1UWCA 2GHIA 3AVPA 3AR2A 4NFLA 4QG3A 1DXQA 3AERA 4CEHB 5EWEA 1MDBA 3EGXB 5DGHA 4V3BA 4A0HA 1UXHA 1E8DA 1F4VA 2Q2WA 1JFFB 3B1VA 3OO0A 5LMCA 4NOMA 1FYEA 4HFRA 4YCJA 3ZZUA 1H4QA 3PD1A 1Y8RB 1KAHA 1DXYA 1P6QA 1PS8A 4DLYA 5D3MB 3GHYA 1WW3A 4OFXA 4EJSA 5CURA 2XYHA 3C5EA 2IH4A 5LOVA 2R8ZA 1W6UA 1JG4A 4YTEA 1KQOA 2PIDA 1GUDA 4R0NA 2RGRA 1OYOA 2XTAA 2FRVA 1HYHA 1DZ3A 3CEAA 2O8EB 3WKCA 3NYWA 2VA2A 1S6YA 3E9DA 4WKBA 4Z8XA 4TKMA 2X8JB 4N40A 3EZ6A 3TK1A 5JWHA 1X94A 3SQXA 1BFDA 3H4DA 2DUMA 2QN2A 1XT6A 2P6OA 5DHSA 4GE3A 4W82A 5C1IA 4XPIB 5TF4A 5C2JB 1V85A 1KMHB 3IBSA 4KO4S 5EPEA 1DCTA 1PWXA 4EA6A 2YMQA 2PX3A 1C4KA 1L7PA 2GXSA 3LDUA 4QUEA 3L6UA 1L5KA 2AZTA 1VB3A 2E85A 1K8QA 1UBSB 1ZM4A 3KKPA 3MFIA 1ZH4A 1BEUB 3F1KA 3F47A 4DG9A 2N42A 4Q4JB 3RANA 3TOXA 4EL0A 4TVSA 4UB1A 1WCWA 4CIYA 2P4QA 4WOPA 1OA0A 4AULA 4JUAA 1YS9A 2CXTA 3QPUA 4U2EA 1X1EA 5HIMA 3UK0A 2VBFA 3AQ4A 1FIUA 2VJYA 2R8RA 1XQ1A 1KN5A 4G1FA 3I2IA 1UOQA 1SD2A 2VA8A 1V38A 4F9TA 2M9NA 5J0SA 2PH5A 5HZGA 3X3HA 1ZONA 1J06A 4ELVA 3PZPA 5HKKD 2P66A 1PSWA 5ERXA 2OBLA 2IT1A 1RMYA 1BE1A 4ABTA 1Z13A 2XBLA 3EQ8A 1QQBA 2DFKB 4FFBB 5CR9A 4RLQA 3OESA 5HBGA 2CNBA 1C3OA 1VRWA 2ESRA 3OX2A 3GP8A 1CQPA 1OBOA 1KNQA 3EVCA 2KVSA 2W2PA 2E2WA 2Q21A 3ROPA 5EP3A 3B6IA 3VAYA 1V25A 3E4CA 4XASA 3DVAB 2P5YA 2ZPTX 1VG8A 2CXHA 3ST7A 5AI6A 2QG6A 5DCLA 3WGJA 1ISJA 1O7JA 2I9PA 3BX1A 3HWX1 4WXHA 3UMFA 4C01A 4YCCA 2W8LA 2BCQA 1E9AA 3C4QA 1YFJA 4EITA 3L7NA 1W87A 3SQIA 4EGQA 2EANA 4RY0A 1ITZA 1POWA 2JGLA 1GPYA 4WECA 1XNRB 2Q3DA 4CLDA 2IEBA 4D9IA 1N8SA 4B9EA 5J2UF 1ZEMA 4FHDA 4NENB 4U7FA 1UWVA 4CLRA 4GI1A 5J63A 2NO5A 3RHZA 3A1FA 2D2XA 1E59A 1NBMD 5HK8A 1LSOA 2NNLD 1T4MA 3WMEA 1N8TA 2EERA 2YBEA 4TUPA 5EE1A 4B9MA 1M67A 3K0BA 1TK3A 3GJ5A 1FLDA 3UXMA 3UT5A 1AA9A 1FFXA 3TIIA 4F6CA 1PK1A 3KJEA 3BS5B 3AIKA 1EWVA 2BI8A 4IZOA 2LKYA 2AG0A 2IHYA 4M6WB 3UHFA 2CJWA 4IS7A 2DFTA 2AWNA 4G0ZA 4DBLC 3L0BA 4RKFA 5JFGA 3WHKA 5JY6A 1XXLA 1XTZA 2E5WA 3NRWA 4WGGA 3HQ4O 4YBRA 5CEHA 1KEWA 1E18A 1B93A 1N2CB 2O2SA 3AU2A 2PH7A 1F9AA 3I83A 4UMDA 5DDYA 3V8EA 5KX5B 1C1HA 1NZJA 2CLIB 1U9LA 1PJBA 2FDRA 1A98A 3AIMA 1E7MA 2O2CA 3B6EA 3NNDA 2VQ6A 1DIAA 2D13A 4FZMA 3A1DA 4JA2A 2PVCA 4NZMA 4Q19A 5E6SA 4DQXA 2PCLA 3TRFA 4MINA 3LWBA 3CSSA 3F6PA 1WVGA 5JD4A 2PK3A 2OWEA 4XWWA 3G3EA 1VMEA 5KIAA 1M1XB 2JGDA 4R16A 1TT7A 4TN5A 4IH1A 4QZ9A 2NAPA 4PPYA 4CF4A 1V5GA 4IIJB 3BWXA 4U7GA 2O07A 4ACAA 1BGVA 3A1CA 2NN3C 4F2SA 4JYPA 4OHKA 4W9NA 5CNKA 2AK2A 2FZWA 5EL0A 3UJ8A 1F0KA 1J2MA 1THZA 3KOOA 4EBEA 2V5VA 4BVFA 5C53B 1NW9B 1BWPA 1UK6A 2KPOA 2ZBFA 3TEJA 4DLBA 2UV8A 4HYYA 1NVMB 3A6ZA 2P3OA 4FBTA 3L1KA 5DPMA 5CEJA 4DFMA 1DBWA 4M4SA 4IRMA 2AG5A 2QGNA 4TLDA 1R37A 4GLBA 1QVVA 1T9GR 2R1TA 4INPA 2JZBA 4BZWA 1Q14A 3KVNA 1MD9A 2ISQA 5JAQA 2FE1A 2ZPAA 4NFSA 4Q1DA 1BJRE 2IZZA 1L3VA 5LMUB 2IH2A 1IN1A 4C1NA 1G6Q1 3D4BA 1QAOA 3MGIA 4IH9A 1GZVA 1YE5A 4DE5A 3IIKA 4XOIA 3L3FX 2X5NA 4L3VA 2V98A 5KJCA 2L19A 5LP6B 3JVUA 3LA6A 2H0AA 3HS3A 2X15A 1XEWY 4FSHA 1HIWA 1J0EA 2GCOB 4KLRA 4QUJA 3TLJA 1CNMA 1CE8B 2X7JA 2EIXA 3X1WA 1M2NA 1PJ2A 3V7LA 2PU7A 3IAXA 3O2SB 2J8ZA 3HCOA 2ERXA 4RUKA 1ZLYA 2OILA 1PT6A 1RXIA 1T3SA 5EHQA 4R1MA 3QRWA 3NT5A 3WNBA 5TQ0A 5KDOA 1R2QA 1V9LA 4UKDA 4IRUB 1HG1A 2GHQA 1CY4A 3VYVA 1Q15A 2VDWB 1DWQA 3ACCA 3AZOA 3RABA 3O8DA 3R76A 2YUIA 1NKSA 2DFDA 3K0AA 3OEHA 3Q0TA 4ZVKA 3SLRA 4UEQA 3VM6A 1X7XB 4E5SA 4EUFA 5M2QA 1V16A 2GSWA 2IMWP 1KAOA 4U7TB 3WBKA 3MGKA 3I28A 4JEIA 3OF3A 5AO9A 5LQJA 4ELUA 3FPLA 3QX9A 3S2ZA 1U3TA 1XVTA 5CLIA 1W4LA 2G3YA 2NO7A 2O1WA 1F60A 1FX1A 1NA5A 3HSKA 5L3VA 4I1PA 4PYNA 1GN9A 1S1CA 4JVOA 4KXLA 4EVIA 2VS1A 1KEPA 4Y2UA 4LI0A 1PDOA 3GT7A 3O4RA 3AVWA 1EFPB 4H7EA 4N5DA 4RABA 4O2RA 1G8MA 1ZH6A 4CMEC 4L0QA 3V42A 1SKMA 2ZIWB 1CWUA 4JP1A 3H3FA 3HEBA 3KPWA 2XQIA 4IFIA 1JDBB 3V2UA 3FWPA 3MBOA 5I7FA 1WR8A 4IQTA 4F2HA 2IZ7A 4WUVA 4MHVA 3SEFA 2HNBA 5T67A 3H87A 2JFNA 4EENA 1DBRA 1RWKA 2PH3A 3OFSA 2X6TA 4URXR 2AHOA 4ND4A 3ASUA 4O4JF 5DHRA 2GOLA 2C4NA 4QWBA 1E2FA 1WUDA 2NSLA 5JCPA 8ICJA 3ZV3A 2X2FA 1MO5A 5K0LA 2AXPA 1DJLA 1K5DA 4A0GA 3E9MA 4DGSA 3BIWA 2OCPA 4LHWA 3I62A 3F7NA 4JK1A 1H5QA 1W46A 4V0LA 5IBPA 3UGKA 1FFDA 2WOJA 2JFGA 3BF7A 4EAQA 1G16A 1YNOA 2F1OA 4G5YA 3LYLA 1KVQA 3GJ3A 4UBMA 3MINB 3UFBA 3RK4A 2PWAA 2WSYB 1WV0A 1A76A 3D31A 3FWZA 3K4HA 3MMPA 4YRJA 3RU9A 3VI3B 1YJQA 1FQKA 2EZ4A 2ZBRA 3C4JA 4R2KA 5EJ4A 3ISCA 3U31A 1I2DA 4M1WA 1DC7A 1Q20A 2A0YA 5FUWA 1FXUA 4IIYA 4J9VA 4DL9A 1ZD4A 2IW3A 3DDHA 1A50B 2D0OB 1RLMA 1HM5A 1WLSA 1VPEA 3SHFA 1PNRA 3LSYA 1BA3A 3L8FA 3PC6A 4O1MA 4DARA 3PBKA 5KTKA 3NVZA 3EGIA 1QQ7A 4RT2A 4LHXA 2GHRA 2ODQA 1AE1A 3FHJA 1OF1A 4EA9A 1SY7A 3AI3A 4MGEA 2R4TA 3FRIA 2H59A 2BGNA 3A27A 3FNRA 4V0KA 5L3ZA 4X62B 3B60A 1IBMB 1YUBA 2H48A 1HEUA 4S1TA 4HYTA 3G8YA 1QLHA 1N7HA 1MX5A 1T2DA 1FUEA 4IXWA 2Y1CA 2O52A 3O21A 1RJDA 1FP2A 4PM4A 2GVNA 2OYYA 2XTNA 1J1ZA 3EGEA 1PEAA 5HE8A 5JMPA 3W6NA 2G71A 1N2CA 2IIBA 2KJQA 5C80A 3N7UA 1N2HA 2HBRA 4TV9F 4BJHB 4TWRA 4M1ZA 4DOAA 4UHKA 1Z7YA 4IOMA 2OEPA 4L8LA 2BUCA 2IFTA 3O0TA 3UJHA 1BZYA 5HQ3A 3A3YA 3CUYA 2IGTA 3VOAA 3VC3A 1MH1A 3PGLA 2BZ0A 5TEWA 5E0OA 5FUQA 2WD7B 3F3SA 3JQ7B 2RFLA 4ZOEA 5BR1A 3KZIU 2UYCA 4F96A 4GNKA 2ZP1A 2WNIA 1KRHA 1LSJA 3TI9A 4IMIB 4ZCMA 1UJ4A 1YZQA 3OT4A 4X45A 4EHKA 3BMQA 3MFQA 3V3TA 5TX7A 1X9SA 1FSZA 4DRYA 1JU4A 1CEEA 2H4ZA 4J29A 3LUFA 3GV7B 3HBFA 3EFOB 4NESA 1V6CA 2WPDD 8ICGA 1A69A 4U02A 1OZ0A 3ZHBA 5KPJA 2FWBA 2IIPA 1DKRA 1FLNA 4IFEA 5AVJA 2HLDA 1FVOA 1IG0A 4ECYA 1UJ5A 3DKIA 4X00A 3WMXA 4CM4A 4NBLA 2GFHA 4EO9A 2JIZA 1MQSA 4I2HA 1X2BA 1NK0A 3OLQA 2Q4BA 4KHZA 2ZG6A 5COAA 5DMXA 4EGFA 1L7MA 2QY6A 3T52A 5TPZA 3GIDA 4ZOLB 1C5KA 1NKCA 1T36B 3DMYA 5ENDA 1X74A 1QZ3A 3TEFA 3GCGA 4OJNA 4WA8A 1IH8A 3D0KA 1JIKA 4V0OA 5TE9A 4UU0A 4TYWA 1ULTA 4JI0B 2D54A 2HK6A 1I10A 3G0HA 3E27A 1NVBA 5IASA 1ENPA 2ZBDA 1EU1A 1TAQA 1Q21A 2OYRA 3D6HA 5DWVA 5L3RA 4R0MA 3A9TA 3IAUA 4URVR 4M9RA 3MCTA 4BP9A 1X66A 3GGGA 3P9KA 5I7AA 1FP1D 4YRRA 4ADSG 5IEBA 1LC0A 4AG5A 1WUIS 2AQIA 4G5RA 4O4JA 2WYWA 4TMVA 1A6SA 1XE3A 1CU1A 1NVFA 2B4RO 4Z4EA 2HA0A 5JRDS 1DJPA 3A4LA 1LVGA 1A4RA 1JHQA 2XMDA 1MABA 2BMEA 3TLXA 4BMXA 2O6LA 3OM9A 4AURA 3RO7A 2D59A 3ADPA 1H3EA 2E4AA 2BISA 3KHTA 5A62A 4BASA 3GPLA 3COJA 5EN4A 4YXWD 4X7BA 2E8NA 1L6NA 3E5MA 3MUOA 4JT2A 4PHAA 4MHSA 3A3OA 4RHYA 4QL3A 2AZDA 2AOUA 2BFFB 3LZDA 4Y6LA 2PGJA 5CM8B 3DJFA 3RI3A 5JAUA 1Z88A 3TW6A 2N1RA 1OMOA 2JJ1A 4YWJA 2M9MA 1FJGB 3PKJA 2MRLA 1BCRA 4Q4HA 3H5AA 4E94A 4MR7B 4RJIA 4X1YA 4J2OA 4A1FA 4E3ZA 1R4NB 4K9PA 1ZS9A 5BN5B 4AJPA 3WYFA 2E37A 1W5BA 2SKDA 5KAMA 3DUFB 2COKA 4FSXA 2F64A 10MHA 4ALJA 4DNOA 2SBTA 7AT1A 1D04A 1NLFA 2BWJA 4LGYA 1KA9H 2WWHA 3R9XB 4ZO7A 3O8RA 5KWVA 4DTCA 4GM4A 5HKAA 1GGJA 3VJKA 1P9RA 2JIMA 3KD3A 2VBIA 1UANA 3EGXA 5EIWA 4B44A 3T7CA 1WDLA 4HMOA 3GRRA 3LLMA 3VR5H 1GP2A 4M0MA 3DONA 2IVFA 3PUVA 5ES3A 4FCCA 1E6MA 3OLYA 3QIAA 4JYZA 3R3ZA 4YRSA 3D4IA 4O2AF 2HX1A 4TV9A 4DY6A 2RG7A 2NU7A 1NW5A 3JQ6A 3WIUA 3UFXA 3R3WA 2W2TA 4H6WA 1XG5A 4REQB 3ZWQA 1Z8FA 4GD3Q 2CHEA 4HNVA 4MA5A 4A2WA 4LOHA 4DQLA 5BVHB 4OI1A 3SIRA 4NTZA 3QV2A 2GZRA 3BERA 5CDHA 1GQOA 5ALGA 2QZZA 3AKZA 5LPNA 1Y4DE 3AUKA 1N3BA 2OCYC 1K9VF 5JARA 2GZAA 3IURA 3HA7A 3OPNA 5BSEA 5AKLA 1AKTA 1VLJA 2JL1A 4MQEA 2FOXA 4Q37A 4DLTA 5K9ZA 1PG5A 4YAJA 1Q3UA 5BUQA 2HPAA 5K8LA 4NOLA 1YU6A 1OVMA 4E4RA 2EF1A 5A0FA 1SG9A 2OCIA 1MW8X 1JXOA 5ALKA 2J6SA 1VP9A 1MG5A 3WGOA 3DYVA 1ZQVA 2BZGA 1ULUA 1C4OA 2J5XA 4DMKA 1U47A 2ZTMA 5A5GA 2JA2A 1GZ6A 4PIPA 5K4LA 3DLTA 1RHRA 2PAFA 2QN6A 5I48A 4Y2PA 3CH7A 4YXMA 3GCWA 3KHSA 3GIJA 2AMFA 1SB8A 4WESA 4EHIA 3QELB 1W1UA 1ZQXA 2NZ8A 4JJ8A 4ZZIA 1E5TA 3NLLA 4QYXA 3ETGA 1USUA 5AJUA 4TWZA 1ECCA 5DYNA 5ILGA 4CF5A 1VGVA 3CISA 5CU7A 4CR6A 3ZWVA 1ZQSA 3TSCA 5DYYA 2V96A 2XZPA 1T4GA 1ZNWA 2OB2A 1KQPA 4ZVRA 3H7IA 1TLTA 3PR1A 1WHSA 3HN7A 4X7RA 3DC2A 5GJWC 2VWPA 3EG9B 2JKVA 1UDCA 2ZRHA 2BHTA 2JFOA 3HDTA 5E2BA 7GPBA 2JB9A 3HU1A 4ER5A 2FDCA 1BXKA 2F4NA 2VK4A 3H9BA 3M1LA 4OU5A 3JPNA 1R8YA 4V03A 2EFGA 4ZVTA 1F2TB 3VC2A 2GF2A 1YRBA 3BBPA 5ENZA 2GLUA 1EVJA 1XMOB 1GNLA 3L1HA 4RK1A 4N0MA 2Q1TA 3PJRA 4BXOA 1IN4A 2PD4A 2W8BA 3AGPA 3QE2A 4YN3A 3R6DA 2BKUA 1YC2A 4XSHA 1XI2A 1NXXA 5IIIA 3WISA 1JX4A 1H5UA 1NWCA 1XO0A 1BRMA 4HWTA 5EPOA 2NPOA 2NU8A 1NUSA 3C6ZA 2J5BA 1RRPA 4TMTA 1JAXA 2QN8A 3D2CA 3L7MA 5D1NA 5LB4A 2IV3A 4Z49A 4DWOA 1A8HA 3Q98A 3GF4A 4L8FA 4NE2A 1SOUA 3Q9NA 3T3MB 4F86A 3AG5A 4OYRA 5K99A 3GUHA 5AHOA 3F6EX 3L7YA 2XDQB 3QENA 1CR2A 2VF8A 3BGIA 1GTMA 3LM8A 2BEJA 3H0EA 1XRSB 5FPKA 4XVHA 4DUGA 4HDCA 3L8MA 3FG9A 3OLZA 3NPAA 4D98A 1M6YA 3IT3A 4H7IA 1IK6A 2O1SA 4M9NA 4TOIA 5YASA 1UJBA 3HZHA 4H08A 3SOPA 3BCUA 2R5NA 2BC9A 4Z4CA 4Y2GA 1VE9A 2VJKA 3MHPA 4RIGA 2PI4A 2GI4A 2YHUA 3EMKA 4F7DA 3RIYA 1BDIA 3JRWA 3VPGA 2EP7A 3W3ZB 5EQJB 5FR1A 4UQPA 1WDKA 3ODPA 4RLSA 4KQIA 3IX7A 2CLCX 1M7HA 4MVJH 1GFSA 4FD2A 4Q0MA 4GR4A 4AQYB 2V7GA 5D6NA 1IXRA 2AEEA 5EP1A 5BV0A 5K51A 2C7BA 3D1VA 4GOND 1USGA 3IDZA 1BVYF 3M2TA 4DQQA 3DLBA 3ABOB 1FW8A 2Y0DA 4JKYA 4JS0A 4WNCA 5IAOA 4C6SA 3VNQA 1BWSA 1E1QD 2O20A 2OECA 2JZNA 5CCEA 1RABA 1F7VA 2ODTX 4OAQA 4UBKA 5LQCA 1MVLA 2XNKA 2DY1A 2JAWA 2NQTA 2Z58A 2XRZA 2JGJA 8ICOA 2JDID 5TMDA 1N4AA 4OCZA 3ENQA 3QEBZ 1SXGA 3BXOA 4IFTA 1NSYA 4J91A 4GO1A 3R7LA 3OOEA 4OSPA 5KS2A 3AF1A 4MWBA 1PIWA 1V1MB 3C7KA 3F3MA 4FLEA 4BKQA 1KDZA 4MGHA 5DB6A 1U28A 3PE4A 1NXWA 3L5KA 1VJCA 4KQJA 1FVXA 4ENTA 1KR2A 3BH7A 4TTSA 3F6RA 2A94A 1PK3A 1XDGA 2Q0HA 4RQ2A 2AI1A 3F5QA 5D1HA 1MRSA 1M2GA 1YVDA 1QF9A 4CM9D 5I7UA 4CODB 2J9RA 2H1HA 3OSUA 3UPQA 3IDSA 4ISCA 4ZCQA 3T7DA 2RHJA 4EJSC 3VBCA 1BD3A 1SIWA 2HF2A 4PZUA 5BWOA 4D25A 2C4TA 4F56A 3PPYA 1Z4IA 5EJEA 4KJZA 2YQEA 3U1VA 3ZE9A 5LQNA 5JBIA 3GDOA 3UUWA 3WNVA 4UUQA 1MW9X 4EEZA 4CEJB 1RKUA 4Z4IA 1JFSA 1S3GA 3MSXA 2IU4A 1NU8A 1W93A 2FUCA 4F45A 2FFHA 3L6CA 1WWUA 4LPKA 4QU5A 5IJXA 1KYVA 4GMDA 1VMKA 3KZNA 5KJFA 3SDBA 4N7MA 4DSNA 3PC8A 4Z6FA 1LY1A 2P3QA 1FRQA 2ZI3A 4HGZA 4MJLA 4R69A 4ZDWA 2Q8PA 2VANA 2VPIA 3S2IA 4I2IA 3SC3A 1Y8QB 5J2UA 4WVFA 9ICEA 2EWVA 5C46F 3QU5A 4ALLA 3UV3A 5M5BA 2QTVA 2K5UA 1VOTA 2AKEA 3TBFA 4BYMA 3BZUA 4GOLD 1CEQA 4LW8A 1CUWA 2XEXA 4HH1A 5JI2E 1UBMS 1LNQA 2PXCA 3DE4X 3M6XA 1DKNA 1ZM7A 4H7PA 2XGPA 5EVJA 5EUQB 3VR3A 2HQ1A 2ZR9A 2HW3A 4ILEA 4J7XA 1JN3A 1G2PA 1FFHA 1SKQA 3LT4A 1Z28A 3RVNA 4MS4B 1D0VA 2AR9A 4I4IA 2WU1A 1NKTA 4B76A 2O5EA 3IPCA 4D97A 2I7XA 1PT7A 1MB0A 1RJFA 3ZDCA 2JJMA 1H8HD 1X7YB 3CLSD 4IO1A 2XY4A 4K86A 2AVDA 3IILA 3PS9A 3N7SC 2BEUA 1F48A 2GCGA 1Y1PA 4GLJA 3SYRA 5A4JA 3ANYB 1GARA 3S7TA 3SI7A 3UGQA 3WY9A 1OX5A 4MB6A 4MPDA 3O4JA 1DC5A 4WBSA 3WGQA 1JWBB 1CUUA 3EMVA 3FCOA 4ETMA 5MN6A 2HT1A 1TMOA 1ECPA 2W3SA 2PSHA 4L7QA 2CNWA 2XMBA 5DX1A 3RNLA 3H4VA 4DS3A 1WP4A 2VH2A 4CM5A 5BN5A 4L6IA 4YROA 4JBLA 4YQEA 4PLWA 1HYEA 1Z0FA 3RBVA 1RNLA 3OMXA 4DL7A 4RTSA 2I29A 2MYNA 1ATZA 1EWQA 3DH0A 1HFEL 5E1DA 3T1YB 1DC6A 1G5RA 2WJ6A 2W83A 3DMRA 1VPTA 1JPNA 2NW6A 2WIJA 2IYPA 2QMQA 1G8SA 1KFTA 1EHIA 4BMDA 5KTRA 4IRCA 4B6QA 2X3FA 4BNMA 1R0ZA 3IOEA 4HTAA 4JWKA 4AMGA 5PGMA 2DWOA 4IINA 4C3OB 1IJKA 1X8LA 4Q47A 3UJ9A 5AW3A 5IUJC 5F1PA 1E3JA 3AF0A 3V1TC 2FPIB 3S5JA 3WADA 2W6ID 1ML3A 1PDWA 1UZUA 4B5LA 1NWHA 1L4GA 4W5NA 5AUPB 2QUJA 1BDHA 5BNWA 1P62B 4K2HA 4GLXA 4EPTA 3KTQA 3ILVA 4LX0A 4Q1AA 2C58A 2WRZA 1JTEA 4KH1A 2ZXUA 3W2TA 3QOYA 3QLTA 3GJRA 4D6PA 5MN5A 2V1UA 1Z63A 4RADA 3NBFA 4FFMA 5TGTA 1A9PA 2J09A 1LU9A 4KBGA 5H82A 4FIZA 4Z2YA 3ZHRA 4TYMA 4RW0A 3T8YA 3UXEA 5KPDA 3HL0A 3I4FA 4DLVA 5A2GA 1U3UA 4KFTA 1UMBA 2HIAA 3HI4A 2Y2VA 4Z54A 3FNHA 3LBAA 1HG0A 4RIIA 2Y1JA 4HN4B 5KSOA 3VNSA 3MOGA 1XTBA 1PR0A 1KFDA 1E92A 3D02A 4PXAA 3ZVRA 3I9LA 1BQEA 1NTOA 5E9AA 4J0KA 2KBEA 2W58A 2YHAA 1S3FA 3D8BA 4LHEA 3CKLA 5DHUA 1YZYA 1W85B 2CNDA 2DSNA 1JIHA 3GYGA 1BE0A 1M7GA 3T9AA 4C0XA 2Y76A 1OTHA 1ZQEA 1KGDA 1NURA 1T9HA 2AFHB 3JQFC 5C37A 5EKDA 3MIZA 3ZCXA 4TTQA 4FYJA 2GZM