1TE2A

Putative phosphatase ynic from escherichia coli k12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
RQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxyglucose-6-P phosphatase
publication title Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.3.22: Mannitol-1-phosphatase.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1te2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1te2A01
4UAVA 3L0YA 4HAIA 1RQNA 4FYPA 1RKVA 2G06A 4Y3UA 3L5KA 2RBKA 4EX7A 1JUDA 5T41A 2G1AA 3B8EA 5ALDA 5AKGA 4UASA 2HX1A 3DAOA 5AVXA 3IRUA 2MU2A 1ZD4A 4EENA 2CFSA 3OPXA 2P9JA 3I28A 3FPBA 5A3RA 3AR4A 4L6CA 1YS9A 3MN1A 3FVVA 2OBBA 2R8XA 3W5CA 3QU9A 1O03A 3L8GA 2B1RA 2R8YA 2HSZA 5AHXA 4HGRA 3UM9A 3AR5A 2PQ0A 2W43A 1NF2A 1IWOA 1L7PA 2EARA 5ALLA 3ZW7A 2IOFK 5ALVA 2HOQA 3ONNA 2NO4A 1L6RA 4HGQA 3OCXA 3NASA 5AK4A 3PGVA 3WK5A 4RESA 2YY6A 4BNDA 1F5SA 3CZ4A 4AS2A 2WF7A 5FP0A 2YJ3A 3E58A 3W5AA 4B6JA 3WKAA 1WPGA 3AR6A 3I6BA 1RC8A 2HCFA 3ZU6A 5AW1A 4OHFA 5AKKA 4I9GA 1RRCA 5AKEA 4C4SA 4Y2SA 5AW3A 5AI9A 3S6JA 4L6AA 1Z88A 2HEGA 3QUBA 1O08A 2ODAA 1AQ6A 3ZVMA 3E84A 4Y2UA 1PW5A 3PDWA 1T5TA 3WKEA 2B82A 2VKQA 3IB6A 4NV0A 3ZVLA 3B9BA 1WZCA 4ZEVA 5AW6A 3KDPA 4OFZA 4UAUA 1SU4A 4JDPA 5AVSA 3KC2A 5ALXA 3KD3A 5ALYA 3NIWA 3R9KA 2HHLA 3BA6A 3I1YA 1Z4OA 2FDRA 1RMQA 2ZBEA 4XOUA 3MC1A 1U2SA 2AUTA 2G80A 1U7PA 2B8JA 2G07A 5AKHA 4CF4A 2Q4TA 5AVUA 4ZEWA 1QQ6A 4J2TA 2Q4RA 4BYGA 3WK7A 1Z5UA 2P11A 4Y2XA 2IA5A 2JGAA 1Z5GA 3RF6A 3W5DA 1QH9A 2I54A 1RLMA 4I9FA 1TJ5A 2BY4A 3R09A 5ALNA 2FPSA 4G63A 5ALGA 1L7OA 2R8EA 2BDEA 2WM8A 3QUTA 4UMVA 3NAMA 3N07A 3ZWDA 1TA0A 3ESRA 2HF7A 3U7GA 1T9ZA 1S8OA 3NRJA 3FGOA 4BX3A 1Z4LA 3EPRA 3MMZA 5ALTA 4NABA 4YIHA 4H1WA 2YFYA 2AH5A 2GFHA 4GIBA 5ALOA 5AM1A 2FPXA 2I55A 5ALIA 5AKIA 3QU2A 4HGNA 3PCTA 4KX3A 3DV9A 5AVQA 2ZBDA 3I76A 2MU1A 5A3SA 2WF5A 2EAUA 3NUQA 3L0CA 4BX0A 5AVRA 2IYEA 4CNQA 5AW7A 5AVTA 1ZD5A 1EK2A 1NNLA 3QUCA 4FFDA 2FPWA 2HO4A 4XQ0A 1YNSA 2DQSA 1XVIA 1WVIA 3ZX4A 2OM6A 5AW2A 2W4MA 4RETA 5AK6A 2AGVA 1TE2A 3A1CA 4UU1A 5ALWA 1QQ7A 2ZBFA 2Q5EA 3ZVNA 1CR6A 1QQ5A 5AW9A 3SHQA 3E8MA 5ALQA 5JJBA 2YMQA 5AW5A 5A3QA 3ET4A 4YCLA 1XP5A 1RKQA 3QLEA 4UARA 1K1EA 5AIBA 4KN8A 1Y8AA 4BKMA 3J7TA 4UMFA 3OTQA 1RDFA 1U7OA 5AI8A 1X42A 1YJ5A 4YH1A 4NAVA 1Z4PX 4KX5A 1Z4JA 2PKEA 3EF0A 4NWIA 5AI6A 2C88A 1ZS9A 4KNVA 2ZBGA 5ALUA 5ALFA 3WK8A 1SWWA 4BX2A 1L8LA 3AR8A 3SF0A 2B0CA 4AS3A 2YMPA 3EF1A 4YGYA 3WKBA 4UW9A 2YJ4A 2NO5A 5AVWA 3RFUA 2B30A 3N28A 2GMWA 4Y2TA 2YJ6A 3U7FB 2FEAA 1VJRA 3PGLA 5AESA 4OD0A 3SKYA 2WF6A 4IFTA 1RKUA 4NFLA 1XPJA 5AW0A 1Q91A 3NANA 3SLRA 2IOFA 3WK9A 4EELA 4UMEA 3L1UA 4HYTA 3QUQA 1VFPA 2FPRA 2JAUA 1RMTA 2NYVA 5AK5A 1MH9A 1ZOLA 2FI1A 5AM4A 5AI4A 5AKXA 4G9BA 5AKLA 3WGUA 2RAVA 4OCZA 5ALPA 3AR9A 2BDUA 4L57A 2PR7A 3UMCA 2ZOSA 3WK4A 1TJ4A 4Y2PA 2YBDA 4DFDA 1NRWA 5AVVA 3M9LA 5AK3A 4XPZA 3QU7A 3WGVA 3ESQA 2OYCA 3VAYA 3ZTWA 1RMYA 3KZXA 2X4DA 5IT0A 3U7HB 3SMVA 3L8FA 1YMQA 2YMLA 4UATA 3QX7A 2IOHA 3ZI4A 4QQFA 5AI0A 3N8GA 3M1YA 2B1QA 2CFRA 3AR2A 3QU4A 3AR7A 3DDHA 3BWVA 2RB5A 2HDOA 5AKZA 2C8KA 2O2XA 3FM9A 3WK6A 4BNDB 4Y2VA 1WR8A 2EATA 3U7EB 3E81A 3ZX5A 4DCCA 3N5KA 1KYTA 1Q92A 1Z4KA 3L8EA 3NALA 4YCMA 2QYHA 5ALSA 4BEWA 3ED5A 3ZWKA 4FE3A 5AM3A 4KNWA 5AKYA 3KBBA 5AKJA 2YMMA 4CF5A 4F72A 4ZEXA 4YCNA 1ZD3A 1ZRNA 2YN4A 4BBJA 3W5BA 2I34A 1YDFA 4AP9A 1FEZA 4HGPA 2FPUA 2HF2A 3EWIA 3A3YA 4GXTA 3L1VA 1J8DA 3ZUPA 3SKXA 3MPOA 2D2VA 4YIKA 4KYTA 1VJ5A 3QNMA 1SWVA 2WFAA 5ALRA 4CF3A 1T5SA 1ZRMA 4HGOA 4E88A 1L7NA 2CN1A 3F9RA 2P69A 2WF9A 5AICA 5AW4A 1L8OA 3UMBA 4DW8A 4J03A 2W11A 3A1DA 5ALJA 3D6JA 2I6XA 1EK1A 2FUEA 4MUMA 5ALKA 2R8ZA 4XE5A 2I7DA 1S2OA 5AM0A 1Z4MA 2WF8A 1N9KA 2GHQA 4EEKA 5ALMA 3U13A 2JARA 1RPZA 1RLOA 2HI0A 1RQLA 3N1UA 3U19A 3OCUA 5AVYA 1LTQA 2C8LA 3OCWA 2ZXEA 1TJ3A 3HYCA 3TLMA 4Y2QA 1N8NA 4UM5A 3ET5A 4Y2JA 3SD7A 2P27A 5ALZA 3L0BA 3QXGA 3U26A 4Y2RA 1Z4IA 2CFTA 3DNPA 4Y2YA 2JAOA 5ALHA 5IT4A 2QLTA 3K1ZA 2ZG6A 2G0AA 4BEVA 2MSNA 4MWOA 2I33A 3WKCA 3B9RA 3KOOA 4EZEA 5AVZA 3WKDA 2OA0A 1Z4NA 1J97A 5IS2A 4JB3A 3HLTA 1Z4QA 2G09A 3OCYA 3OCZA 3QU5A 3OCVA 3CNHA 3GYGA 5E0OA 2FUCA 3QYPA 1ZD2P 3L7YA 1QYIA 2G08A 4UU0A 5AIAA 2C4NA 3A1EA 1U02A 2JAWA 5ALEA 4IG4A 3UMGA 3AR3A 1U2TA 2RARA 2B8EA 4QJBA 4EX6A 5AM2A 4C4RA 2C9MA 2YJ5A 5AI5A 1LVHA 3FZQA 2WHEA 2O9JA 5AW8A 2GO7A 4UMDA 4C4TA 1RLTA 3QGMA 4F71A 3R4CA 2GHTA 3P96A 4O8CA 4DWOA 4UM7A 4CE6A 3IJ5A 3L8HA 2AMYA 1ZJJA 1L7MA 5AM5A 4PNHA 1YV9A 3ZTYA 1CQZA 3FPSA
chains in the Genus database with same CATH superfamily
3FWYA 1ZVMA 3QXHA 3D8RA 2PS3A 1YFKA 1VXRA 5EG5A 2RHMA 1B8UA 4KDCA 3EDOA 3BK7A 2BI4A 3T7TA 3K0EA 3V4FA 2ZPUA 1V9PA 1CVLA 3PQ4A 1CZRA 2GAJA 5JZOA 1F8UA 2ZK7A 1XNGA 3WDKA 4Z4HA 3DYBA 4FGUA 5T6BA 1PU2A 4DPLA 4F4XA 3L1KA 4HUJA 3RWBA 1TKRA 5BWMA 2M0NA 3Q2KA 3O91A 2HLDA 3QFSA 1E2UA 2JFQA 3TECE 2PWAA 4IH1A 1KSFX 3IOEA 4L5YA 5B6PA 5LP6A 3LQKA 4AJEA 4JWTA 3E84A 4YXWD 4NJOA 4R2WA 1IWBB 1OI7A 4Q1EA 2XB9A 2ZQ5A 3FUUA 2XBMA 4UAUA 3H5VA 2H2HA 3NIWA 4P34A 3TJRA 3RAPR 3QPUA 3OJSA 2R8PA 3T41A 1YE8A 2H54A 2H1LA 1T91A 2P78A 2QRUA 2ORED 2JI8A 1QHIA 3B1FA 4TXNA 1QAQA 1PWXA 1Y6FA 2EXXA 1TIBA 2C3PA 4JBXA 1A9QA 2C20A 5ALGA 3LPDA 3JVVA 5F5XA 4FFMA 1QFMA 3HYSA 2NU7A 3OTGA 1PFGA 3P19A 3T3OA 2CNKA 1OZHA 3TSAA 3SR6A 4PG7A 4LZJA 3OPYI 3VC2A 1YZTA 3M34A 3NWJA 3R8CA 2VN8A 3V33A 4JP5A 1SVNA 2W7TA 1JNYA 1BS1A 9ATCA 1PZFA 5I9TA 3VO2A 2ZUCA 3CEHA 1GA1A 4FR0A 4WASA 4BIIA 4DZRA 1RC1A 3HH8A 1MFPA 1SFRA 1UXHA 1ZHHA 2FW8A 3PFCA 3SVTA 3QTBA 1GFIA 3UEOA 1JFTA 4Z6EA 1DSSG 3O4JA 4N3CA 3WG9A 4GPTA 1SD2A 4TX1A 3PGJA 4EB8A 3ZZUA 4DQLA 2B7BA 1DG3A 1KVSA 5JRDS 1PR9A 1K89A 1NP3A 3OICA 1LD3A 4WI1A 2O48X 4I7EA 3HUEA 1XBTA 2PT6A 1KSJA 4QHYA 4Q9IA 2NTEA 5J0QA 2H51A 4R2IA 5EXXA 1RYUA 2R751 1GPYA 1Q1ZA 3DONA 4JLUA 1YVEI 3L1UA 2Z5VA 1JDZA 1S9FA 5A02A 1SXIA 1BEZA 1SRRA 4EVRA 3O5AA 2WG1A 2BEJA 1VGRA 1PS8A 1P7ZA 2JJ2D 5HUQA 3L8DA 3CLRD 5AK3A 2FDXA 3DLTA 5KJFA 4J0FA 5IT0A 2QRZA 3TLAA 4G25A 2B3DA 4FB4A 2WJHA 4AZ3A 1QYVA 3LK7A 5F9MA 3FIUA 2RP5A 1TK5A 3W5HA 2J45A 3TO5A 2Q5HA 2TMYA 4HVCA 2GYVA 1SB8A 1G8MA 2YB1A 4O3QA 4XIGS 3QPDA 4D99A 1W2HA 4IL5A 1D6MA 2QVGA 4JB2A 1DGSA 3V4OA 1M67A 2YR0A 1I6MA 1BQ4A 2XTAA 1ZQJA 4QSHA 1IHYA 1M2GA 3OPNA 3TOZA 2X2EA 1KBOA 2UKDA 2UVWA 5EESA 4EQ6B 2IPLA 3WGMA 3I64A 2W2LD 5F9LA 5SY9A 3WJ1A 5IKOA 3P0IA 1V39A 3G1TA 2VDRB 1XLUA 5C1PA 2BR0A 3U26A 2MYNA 4FOSA 2JASA 4XH9B 5BURA 2GPJA 5FIUA 3E9NA 4YJ2F 1U9CA 3UHAA 4WJ3B 2I3DA 4YJ2B 4KLSA 3HMQA 1OASA 4YDRA 2GDJA 5AJUA 1W4BA 1M66A 4JI0B 1DXSA 3GQCA 4B6GA 4UU0A 4EPYA 4N41A 3KFUF 5F7OA 1XA4A 2GRUA 3KSZO 1CHDA 3WNZA 3TKAA 5C9ZA 4NHOA 3UAVA 3CYMA 1K86A 2A5YB 4MVJF 421PA 1TMGE 3VQTA 2B36A 3TDMA 1GAEO 4WGGA 3G2MA 3H17A 3X2EA 3INNA 3GFFA 1GU1A 2YV4A 4IGFA 1G3UA 4JJKA 5BMOA 2OD7A 5IIMA 3EXIB 3A0UA 5IMBA 1D0IA 4NYIR 2PQMA 2JIQA 3WTBA 3ASYA 3B6MA 2AFHE 2Y1WA 2MSWA 3TOSA 3OE7D 2XODA 4BO3A 4PG4A 1GG2A 1PT6A 4F21A 2J8ZA 1IXSB 1YCFA 4WVFA 4U6SA 4PS1A 3KHKA 1Z68A 3SLKA 1GG5A 4EHKA 5HGJA 3Q9NA 2AEEA 2P6OA 3DYVA 4N0PA 1XD2B 5K0BA 3BRCA 2Y1JA 3ND5A 4U2DA 2ACWA 3WMEA 1D1TA 1ZK0A 4PLYA 1ZCFA 3LUPA 1YJXA 2CMFA 3GQBB 4X8OA 2FPMA 1XRLA 2ZIVA 3T5PA 3P5SA 4QYMA 4M9JA 4TT3D 1PV1A 4FS3A 1E4EA 2YQ4A 4Q48A 4Q9HA 3FPHA 4PPYA 1PCXA 5EUMA 2E82A 5GTHU 1XG5A 5ALNA 1XTKA 2WTUA 3GLGE 4S1PA 1QZZA 3BXGA 3PHIA 3LT1A 2IK8A 4N7RA 3CKKA 4J3NA 3KB6A 1W1IA 5B58T 3T1QA 3NUQA 2CLDX 4RT3A 2J6BA 1G8YA 2ERCA 3GFOA 3EB9A 3H0MB 2VWGA 1R8SA 4YFVA 2BCUA 4MR8B 2I22A 2FG7C 3RRMA 4RLQA 2RI0A 2E8NA 3MTDA 3K70B 3FWPA 3EUFA 2CLMB 4DFJA 4TVOA 1E3WB 3ADCA 3BCUA 3AB8A 4C0BA 2JIDA 3A4LA 1UPAA 221PA 2NSYA 2OQVA 3R0QA 3U40A 4WXEA 2WSBA 1ONBA 3LPMA 2OFWA 5GZ1A 3QEMA 3GT0A 2GRAA 3CVUA 3AO0B 3TGLA 4KHZA 2B30A 3JD1A 3DVAA 1QR2A 2WINI 1VHQA 1Z82A 4ZEMA 2XICA 4EMBA 1WCXA 4E46A 4G84A 4QATA 2BUCA 3FPJA 3WL5A 5IK2A 5FPPA 3WGTA 2PGLA 3OP1A 1LSSA 5LD2B 1M6VA 4U9IS 3OJFA 3RD5A 2ASLA 2W2KB 1FFDA 2DR3A 1FF9A 1QP0A 2IZ0A 2WTNA 3WY9A 1KFEB 1YRYE 4B2PA 2CMHA 1Y80A 4KUEA 3BQMB 3O38A 1VYTA 2QVBA 1S4QA 4YXFA 3UAGA 4LYAA 2HDOA 2BFPA 3UK1A 3KPWA 5J2UA 4WKGA 1BG6A 1U3TA 1RXIA 3AI3A 1Z4KA 4B9TA 2F1KA 1CW2B 1NJ6A 2LYBA 1Y3AA 4N8EA 5FPQA 3GGOA 4Y2HA 2EEZA 4BBPA 1OI2A 4GNKA 4IIGA 3N7AA 2IYRA 2CYBA 1LV7A 5DYYA 4GYWA 9ICPA 1K9SA 5AHKA 1VI6A 1IU9A 1TX4B 1WM1A 1DAPA 1UP7A 1VLZA 2QE7A 4RVSA 5EXDA 4G5XA 1AB6A 3PFWO 3AU9A 3SF8A 5EWLA 1N9KA 4C22A 4CN8A 1QTRA 3NM6B 3BMNB 3TZ6A 5HKOA 1BE0A 2HI0A 1OH8A 5KFVA 4WADA 1G21E 3U62A 1WCLA 3TZCA 3FUVA 1JPNA 2QP3A 3OKFA 3LKZA 4A27A 2CFIA 2P65A 2OUKA 1YMUA 3CZRA 3HVKA 4FW8A 1ZH0A 4Z1MA 4K6GA 2B34A 2WVGA 3F3SA 1J07A 5DDYA 1Z8NA 3SQDA 2CVHA 1Q6ZA 5AIAA 3THSA 5H82A 3R3WA 3T1HB 4M4SA 1QGOA 4L5JA 1GTJ1 3HKEB 3TJMA 5DHPA 4KR7A 1DXOA 3BMCB 4ESEA 1P1CA 2YICA 4KMRA 4BGDA 1DXQA 4ZIRA 5C1DA 1RPNA 1V6CA 5B2ZA 4A8JA 3QF7A 2VJKA 3C1UA 4WJLA 3QE9Y 2NU8B 4UTOA 4LDPA 2WZCA 4QNLA 4HQ0A 3ER6A 1SXQA 4CPDA 3LLCA 5DK6A 4ZCSA 4LVNA 4KN6A 9ABPA 2ECFA 1H3NA 3W5CA 1TUGA 1XYYA 1WF6A 2E21A 3GFPA 3EAFA 4F7DA 1QHSA 2R6JA 4J4BA 5KQSA 3TS1A 2SKDA 5IHPA 2YINC 4FUQA 1TPZA 4XB2A 3RUAA 4XYGA 2P79A 1ZQOA 2X0IA 2OCIA 2O7SA 4IL6U 4IQVA 2WJJA 1MEEA 3O4GA 2B82A 5LSAA 4DQSA 5KT2A 7ICGA 5JG7A 4YQFA 1M7GA 2CEKA 3N7RC 4NM1A 2IYZA 2PUDA 4F3OA 4BVGA 4U0KA 4JEUA 1SC9A 1YC2A 2N3ZA 3WNBA 2NRWA 1RBZA 2RGUA 3IP6A 2OL4A 5KTTA 1DWPA 4PEVA 1TJ5A 3N8DA 4IDDA 2ZRAA 4IVQA 3HDQA 1N2CE 3F2BA 4RW0A 2NXJA 1JA9A 3GUHA 3PSAA 3VSBA 1YQ9A 4QWCA 2O4CA 3N2IA 5DCWA 1BXGB 5EJ7A 2GAFA 3KWMA 4ELTA 3RTVA 1L1FA 2N42A 2HK9A 1ZM9A 4DMCA 4LFAB 1E79A 3VPXA 1CXZA 4AO8A 1J4AA 3DMGA 1JR3D 3VU3A 2XCAA 4RQBA 3NUZA 1WLYA 2Q8PA 1QQ7A 2RQ5A 1QQ5A 4Z3KA 2C3UA 1A4XA 3L92A 3I2IA 1X38A 4F38A 1U2QA 4M76B 1ULSA 5GVSA 3E22A 4CIVA 5FKJA 5LUBA 2DUWA 4EAAA 2MHCA 4G9EA 5DH9A 1XMVA 4XVUA 1KK3A 1KTQA 5I4IA 1UCVA 3OG9A 1UMCA 2FZ4A 2H4FA 1DS6A 2COKA 2J08A 3BJZA 4RIGA 4BX8A 2R5NA 4X8LA 1HUZA 5E1OA 3P4XA 3EXEB 3E4CA 2VBFA 1VXOA 1G38A 2IPMA 2KS6A 1ZOLA 3CVYA 2V74B 1Q7GA 4FCCA 3FFTA 2RG1A 1GKYA 1V25A 4C0AC 4WEOA 2XE4A 4M1QA 2OYCA 2HFJA 3GLVA 1NNEA 4JBIA 5LM3A 1MG0A 4BB0A 5EINA 1J2RA 3J80A 4Y2VA 3ECAA 1PSWA 3TIGA 1O95D 1C0IA 1V3QE 1VA5A 3OEWA 4JODA 3PW4A 5FL7D 3ED5A 3O92A 1E63A 9ICFA 4KP7A 3SBEA 1VMIA 1SAYA 1E4OA 4TTVA 5ADUS 2PS1A 3E61A 1SIUA 3CMCO 4WBNA 2G6TA 2WYHA 5D6NA 4X9XA 3I12A 4I3HA 1H8EA 2IHJA 1SUDA 3ZJUA 1KK2A 3C3XA 1T4MA 3W2HA 2FEMA 2I8LA 4FEGA 1DAFA 1G59A 1RZVA 2WP0A 2NSDA 2GNAA 3GD5A 1WETA 4P4MA 1TU4A 1R6DA 5JNRA 2F90A 1ZN7A 2K8BB 3JU3A 5EPUA 2GEKA 3GAZA 1K3TA 1P1RA 3E9CA 4R05A 1Y4UA 5JI3E 4RMHA 4N6GA 3LD9A 1V1MB 1TO1E 8ICIA 3H11B 4QPJC 2BZSA 3SVLA 2BHRA 3GH3A 1JLHA 4MHVA 1F8XA 3RRYA 4R84A 3C2MA 1TIKA 4RH1A 3TW0A 1ZIOA 3DWIA 4RSGA 1SIOA 5JCZA 3AYXB 1YDGA 3HKCB 1WDKA 4YDQA 1MR3F 5B1HA 1JMSA 3GNLA 5LZ5A 4B6PA 2PVCA 3AMVA 1NF9A 1EJ2A 2DHDA 2X1HA 4BC0A 3SGLA 2WIKA 2XLBA 1RQNA 4RIIA 2CL6X 2ECPA 2A0KA 5KT6A 1CRQA 3ETRA 3AETB 4YRQA 3TMYA 3ORYA 1MLDA 2GA9A 4IH9A 3WO1A 3C7TA 1C2YA 4OI2A 2AXPA 4ZYWA 1N3BA 2QKYA 5FP0A 4MW9A 2Q45A 5IDVA 5C0OE 1POXA 3V4SA 1HKUA 2B2CA 5L3ZA 3OIDA 2QQGA 3WRYC 1K4YA 2HA0A 4IR1A 5TQ0B 4NLLA 1V0JA 3R76A 1MF7A 4CV1A 1RLJA 4ERXA 4URZR 4PIPA 4OMUA 3EY4A 4DHWA 2C9DA 1OUQA 2XKAA 3SMQA 4UOQA 1EHCA 2HCBA 3MGCA 4GW3A 1P7WA 3RRHA 3TSWA 1GNTA 3LXRA 4BS9A 4CR8A 2R87A 3ZWNA 3HJRA 4H3KB 3CWZA 3AFNA 5EYPB 2ZU0C 2XZTA 3F1LA 3D8SA 4XM2A 4RA6B 4MKGA 1SL0A 4JEMA 1W0JD 3G17A 1O94C 3C14C 2F3QA 3NRJA 2CFCA 4A92A 4I2GA 1G6Q1 4CIAA 3HC7A 1KEUA 2JZBA 3D6TB 4B9UA 3UHFA 4A6PA 4ZT6A 1J99A 4BECA 3SK0A 2UZ3A 3H5NA 1SUPA 3QVXA 1QOZA 4HAXA 3IP4B 1KY4A 6NULA 3WL3A 3D3JA 4J16A 4IPTA 1JR3E 2ODGA 4K6CA 1YL5A 1E6MA 2ZRPA 4BKMA 1RPJA 3BDVA 3D8NA 1ZSVA 3L0SA 1NR5A 2PE5A 4GXRA 3LSTA 3KOWA 4B71A 5C8YA 1C1YA 2TMKA 2FEWB 1B3RA 2D1FA 4QEKA 1XQ9A 3SF0A 1FVXA 3IULA 2B0CA 2V8BA 1JSCA 2YIJA 2ZUEA 2B5VA 4EIWA 5DTRA 1TFRA 1Z2DA 2IY8A 4U7TB 2W7PA 3FSRA 3PJGA 2JAHA 3IAM6 4OM8A 4J9QA 2DP4E 4G4SP 1BCRA 3UPTA 2OHOA 3EVCA 3ABIA 2B8TA 4MV1A 3E9ZA 2J3LA 4MULA 1VLMA 3RSSA 2AWNA 3P32A 1YR7A 3CM0A 4FOTA 3AONB 2CDAA 4GLXA 1EFRD 2R8JA 1KHTA 5ENVA 1Z45A 2YZ2A 5DMHA 4QXOA 4CG0A 2MAXA 3MBOA 4GL2A 4IJUA 3LHIA 2GM5A 2IYQA 2QRHA 4KFCA 4R8RA 3I0ZA 2TMDA 4RNDB 4NFSA 5L51A 4RXUA 1WULS 4BNDB 3UPDA 3R24A 2XR1A 4V0RA 4GOJA 3GNTA 1KAHA 3V6KA 2OZKA 2M9MA 4IYRA 2O8CB 3AJAA 3T34A 5KTKA 1RYZA 3DH0A 3I92A 4M0UA 1NVMB 2FZ5A 4TWZA 5GPBA 4C1NA 3BCRA 1XKLA 4XE5A 3A4NA 5IXSA 1EM6A 2IZ7A 2C5HA 4KIJA 3G89A 3CX3A 1CEZA 3HK2A 1RYDA 1W4ZA 2IEBA 5BVGA 4RV9A 4ITVA 3L5OA 5ELMA 5A2QA 4XQCA 4KWIA 3BZUA 2LPMA 1UHUA 3WE7A 4KLZA 2VYNA 1AC5A 1EINA 2IPXA 1KMQA 4FEYA 3WO0A 2FQYA 4XRHA 1S2NA 1GL9B 1KFJB 5F77A 3WXBA 4R40A 4UUQA 5JCJD 4G0WA 1VSUA 4Y1RA 4RVNA 4G5SA 4J07A 4PC3A 3NJ8A 1H42A 3C15C 1W85A 3H5RA 2BFMA 3P9CA 4EHIA 2VO1A 4QYIB 4ZANA 4OP2A 2DWCA 3MK31 5AM5A 2GWSA 3ZGOA 2IVZA 2E3TA 3CH5A 4F12A 2O52A 1G20E 2W6QA 3V8BA 1G3IA 4UASA 4V3BA 4MA5A 4PQRA 4QHTA 2NSLA 3T95A 1CBUA 2NZUG 3DBHA 4R2KA 5CA1A 4OL9A 1K4KA 1DX9A 1TDJA 4JY7A 4ZCIA 3B1VA 3WMFA 5JYDA 1DRKA 4NZPA 4XFKA 2OESA 2E8OA 2VUIB 4CGZA 3KPUA 4AJKA 4F5QA 5EE5B 1B0PA 3JWEA 4IO0A 3UMVA 1OLXB 3TW8A 5DV9A 4NENA 1LK5A 5I7FA 4MIYA 4D6XA 4HDKA 4MQFB 3HJCA 4LJRA 3O9ZA 4UDXX 4HYKA 3ORSA 1QS0A 4M9CA 4ZU3A 5M34A 2NTVA 2G36A 1U7PA 1WTAA 5DRTA 1H4QA 4EJSB 1PSDA 3FNFA 5DASA 1BHQ1 1K7EB 3L49A 8ICJA 4AXBA 1K06A 4BGIA 1NE2A 3USES 1MPTA 2GYWA 3LVVA 4HWTA 5LQAA 3BJYA 1GSOA 3HSSA 1GEGA 2HQBA 2YBEA 4UDNA 4B34A 3TINA 5CT9A 3E9DA 1A8HA 5LMZA 1RAEA 4F5WA 2BQ3A 4WA7A 2XCPA 1OD6A 3OKCA 1EQ2A 3KHTA 4R6XA 1RJFA 3V4LA 1ZH4A 2ZIXB 2XGOA 3VJLA 4C2BA 2RMKA 3W8NA 3HXQA 1XVIA 1C81A 1XXLA 2BMEA 2Q5EA 2ORYA 3PT5A 5AW9A 7REQB 3E9EA 4ZZ2A 1NI5A 1D2GA 2A1UA 4KN8A 3DEKA 4IUYA 3GY0A 3P9SA 3RUPA 5EZQA 2IQ5A 3DE0X 5DVZA 2H8KA 2PR2A 3N2KA 5FBQB 2I2BA 4B35A 5DYGA 4QM7A 4ZYTA 3GWZA 3RFUA 1NOKA 5J2HA 1DAHA 1IN7A 5D5HA 3PTLA 4AJ1A 1NBMA 2CGEA 1TM3E 4Q1FA 2Z5GA 2TS1A 1KO8A 4OQLA 2YHIA 4M9NA 2V58A 2AOTA 2ZB7A 3KPVA 2C2GA 1WW2A 2P7IA 1JA1A 4ID3A 3M4XA 5LYJB 1XV5A 3SYRA 1YOVB 4XPZA 3ESQA 4FGZA 1R10A 2O2YA 3ASVA 2PK3A 2YMLA 4Q9NA 3P0RA 1FQWA 5AJHA 4BU0A 4LVSA 2IE0A 3N5CA 3IIEA 2IV7A 2C7QA 2E18A 3PYMA 4YCMA 4BEWA 2NIPA 2KLHA 2H7XA 2Y1LA 3DUFB 4OUKX 1JLMA 4ZVOA 2WY2D 4JGGA 2DH5A 3WLMA 1CUXA 4CR7A 3SNHA 3H2ZA 1D2MA 2R8ZA 1GRNA 3IJEB 5B3JC 5I7RA 3H8JA 3OM8A 5G2OA 2QTVB 1Z7GA 1U7WA 3D6NB 3L8ZA 1B3BA 2I2XB 2OFXA 1JAXA 2H9YA 1S9HA 1F8FA 4JUCA 5LMCA 3D4IA 4XQEA 4WNAB 4MRMA 3D7SA 4Y2YA 4RPZA 4GSYA 4OJOA 1SC4A 4OYLA 3TZBA 4Z8YA 4B09A 5F2NA 1PJRA 2GGSA 4ZOLF 3LPNA 1HT3A 2C97A 2BDPA 2OCYC 3MCZA 5GADl 3QXXA 3GRFA 8GPBA 1ZD2P 1AZWA 1CUEA 2FR0A 1V3UA 1QCYA 1IG0A 2IP2A 4KE6A 3JQ9C 4P84A 1LSJA 3OZUA 3TXXA 4K1LA 5TV2A 2GEDA 3R6GA 3L6RA 5I7SA 2WFLB 1U0NA 1KRXA 1B7GO 3GLQA 2BFCB 1GN9A 4S1WA 4ILEA 1A0PA 4LJ7A 1H1LA 1T5DX 3THXA 1YQWA 4P7GA 3DO6A 2NQ8A 4UEJA 3FFWA 3SZMA 4F1KA 1YR2A 1NZBA 5JPCA 2C4KA 2ZZNA 1QH8A 2OR3A 3FSEA 4URVR 4QXMA 2C2HA 1NF2A 2VS1A 4MIOA 5BV7A 1ZAYA 3LXXA 3ORRA 1FNMA 2XCRB 1H4SA 1LJUA 2NACA 2O3JA 1M2JA 3E58A 2J6CA 4ETWA 3GLSA 4XUEA 3CO5A 3KJNA 2OP1A 2QN9A 4WUTA 4UEQA 3BAFA 4FKZA 5IIKA 2A30A 4N5MA 2C5LA 2C7RA 5KFWA 4Y2SA 2QROA 4GI1A 1GVNB 4KXWA 3B78A 3EQ2A 1BFUA 2ROQA 4U7DA 3LY8A 5SZHB 4D4LA 4G5FA 3TLKA 3IAHA 2B61A 2J5QA 3LBIA 4MKFA 2AK2A 2RHHA 1XRNA 2P41A 3KC2A 3HCCA 2Q1SA 4Y0VA 3C6XA 1SVWA 1HZZC 3HQ4O 4OFWA 3ZBTA 4YLYA 2HBMA 3TLGA 4Z0PA 2ZBUA 2EANA 2TSYB 1CIJA 2W6CX 4PC1A 2VRBA 3DMFA 8AT1A 2PWZA 3KB2A 3IG5A 1D2CA 1JPUA 3A8TA 3FTQA 1JV2B 4AF6A 2ZE6A 1FDSA 4RULA 1FX0B 5E0KB 1OCEA 4DR1B 2LZ0A 4O3MA 4YT4A 3PL1A 3GFKB 2NUTB 1Z13A 5HFJA 1E1QD 4GXNA 1AHHA 1PUZA 1KRWA 3ZCPA 4TKUA 4QZ8A 4GBMA 2AOXA 4YMVA 4DBVO 5D86A 2AW5A 4JR0A 3H5AA 2VYQA 2QEQA 4EYSA 1RQ7A 2IXGA 4L2IB 5JJBA 1XZGA 2O19A 4Q05A 1HOTA 1NT4A 1RZ3A 2J7PA 2V4MA 3IESA 1U0RA 4BQQA 2P35A 2GWHA 5BSUA 1P4JA 3ME5A 2ZTUA 5D2CA 4CYMA 1PJBA 1IUNA 3HY3A 1COKA 2JEYA 1YVUA 3ZWBA 2NV2B 2QMOA 2UYYA 3IT1A 5MN6A 2NNLD 3OD1A 5DT9A 3U9LA 1NBEA 2FFRA 2P9TA 4MPTA 3KXDA 4AIRA 1A5TA 4MUHA 4IVPA 3O8OA 3D7KA 1TT7A 1H3EA 2BHNA 1G1MA 3C16C 2EZUA 4CIDA 4QFBA 2Y0EA 5GVRA 1QYCA 3HL0A 4X71A 4AICA 5JMWA 4P35A 1AN9A 3VZPA 5AKZA 2PS0A 2J0UA 2QTWB 4MQLA 3U5ZB 1WSWA 2BEWB 1E1KA 3CLRC 2Z08A 1YDHA 3ZWKA 4YV7A 2YZNA 1YD7A 5L45A 2ZJAA 1HDRA 2I34A 3L43A 2HBQA 4YNBA 5F5LA 1E9AA 4UXJA 1NYTA 2VUUA 3ZV7A 4QDJA 2G9RA 1Z17A 3AZOA 5CB6A 5I5EA 3DWFA 4QZHA 1QTNA 3UTDA 1OHHA 1FSZA 4EYQA 4HEJA 2PUGA 3CQ9A 2HU2A 4ZCTA 3DHWC 4DT1A 1GITA 2B35A 5DBHX 4HH0A 2MUTB 1P0IA 3O8CA 3OPYB 3SV3A 3BQTA 2ZJ7A 1O97D 3TRFA 3GHHA 1UK8A 5EIXA 1CLEA 4H08A 2PX8A 1E18A 3MCWA 1BE8A 1CY7A 3FUTA 2VH1A 1I5RA 4KLIA 4M55A 3QKUA 2YJ5A 3HBAA 1LVHA 2NTJA 4HH4A 2YHSA 3HWRA 2C04A 2R6CA 3K6RA 3E0XA 4WMLA 1OX6A 5EP3A 4HXGA 3PEFA 4HHEA 4G81A 5F9NA 4PAGA 3VDNB 3OY7A 2Y0PA 1NZJA 1QGUB 1B43A 3H0EA 4RFLA 3VNVA 4KBYA 4IDHA 7ICPA 1K97A 2PKYX 4PHCA 2XDQA 5IFLA 3W6UA 3MHPA 2FJ6A 3NBXX 4JOBA 3EASA 2BJHA 3QQPA 2QLNA 4G2TA 4J1TA 1JAIA 3D3NA 3DGFC 3MJRA 1NL3A 1YUBA 4NCIA 1KO1A 2YZMA 4U1RA 5L7WA 3MYYA 3RHZA 5FF9A 3EIEA 3ZDXB 3TQQA 1NATA 4Y98A 2GLXA 4LZOA 4M1KA 4RGQA 1LPPA 1XRQA 1Y98A 1NXPA 3K1AA 5FFMA 3RB4A 5ALYA 3CXUA 2LI6A 1K92A 2H11A 2BR5A 4X93A 2IGBA 1VB5A 4OLJA 1U9ZA 1ZMXA 2HBKA 2YUIA 2CVQA 1EDEA 3LWDA 4IIJF 4DV0B 3SFZA 5ILOA 1O96B 4LN1A 4U3JB 4Q9JA 1IIBA 1JYSA 2FR8A 3ESRA 3EDQA 4TWIA 2Z4TA 4AJ9A 2JH8A 2BBOA 2GFHA 4EVIA 2DPJA 2UU9B 1TC1A 1U4OA 1DJOA 2ODPA 2Z9DA 2BCGY 1CRLA 2B2NA 3NDJA 3HG7A 1GA4A 3ZCSA 2GEBA 2QRGA 3TK1A 1DX4A 4QXRA 2WE8A 4OK5A 4PG5A 3ZWOA 5C1IA 4I3GA 3BAZA 4ADSG 5FEMA 4RY9A 1ABEA 1E2HA 1R4MA 4NULA 2BQRA 2VJNA 3S8YA 4KQGA 2JMGA 1UPFA 1R4NA 2K4EA 4ZT7A 1MB0A 4OIMA 3JPTA 3SAJA 3BJRA 3FHCB 3Q3EA 1U8XX 4YMTA 5CPBA 5LDGA 5KT7A 2WKQA 5KJCA 2L18A 2HRRA 3H40A 3VKWA 1QONA 3V6HA 4HDNB 2JGDA 4HS4A 4NPHA 5BW6B 3DFZA 4YALA 1AU9A 4FT2A 4Z7OB 3LQFA 4N5IX 3LK6A 2NU9B 1TVEA 3CF4G 5JJ5A 2WRZA 1HE1C 3A26A 4O4LA 2C54A 1T8PA 2JKYA 2VK8A 2ZDHA 2DKNA 2VTEA 1G6KA 2PFNA 2ZR9A 3LXUX 4LJ9A 3R7FA 3FW1A 2WB4A 3TWOA 3G2OA 2CXQA 4JT4A 4QO8A 1CJMA 2C5EA 3GP8A 4ZGBA 3U2QA 2HVHA 4B3HA 2XBUA 3R7BA 4I6EA 4KLDA 3JASB 4JP3A 1FLVA 3QF4A 4RZ3A 2OSBA 5IN5A 5J2EA 4DARA 5K01A 1ADGA 1ZETA 4CMIB 3U39A 2HDHA 1JEDA 2OQIA 4KRYA 1U28C 4NG5A 5A5VA 4K86A 1M34E 2QYHA 3SYKA 2PU5A 5D6OA 4YAFA 4IWYA 3PDCA 3I9NA 2JGFA 2PMEA 2KICA 5DTJA 4AP9A 1TZ2A 3S2FA 4Q34A 2OC4A 5G0SA 2JIOA 5T6MA 3M4JA 2CBZA 2GBFA 3IQXA 4CF3A 2BGLA 5EZSA 4D9NA 1XZPA 1EKXA 2ZAIA 1KQGA 1A1VA 3C3WA 2QA5A 1K5DA 1PQPA 3H84A 2V0GA 3C39A 2X0KA 1JTVA 2DPLA 4G37A 3MGIA 4ME6A 2QAIA 3HEAA 4RZRA 1YJAA 5BUQA 1LDMA 3I2JA 5BNIA 2IGTA 4DLNA 4RQ8A 4JC0A 1LU9A 2ZIEA 3OKAA 3HKDB 2PI5A 5E9JA 1KU0A 3KKZA 1BCSA 4P2BA 2QZZA 2ZUVA 4UBNA 5JCXA 2BFEB 4EMUA 3VVLA 4CRXA 1X14A 2NXWA 4IR9A 4IXWA 5JMTA 1MTZA 1YF3A 2BM1A 5D1HA 2HWYA 1ZCBA 3B9JA 5BN3B 2VT6A 3TCNA 4G2NA 4DA4A 1U2EA 4ARVA 4AJJA 2YJNA 3QV1A 3TR5A 3I37X 4CMCA 1V9CA 2JATA 1ZJJA 4AJNA 1ZO8A 2HLHA 5TPZA 3ZBUA 1GXSA 4TTIA 4ZT3A 4UBJA 2JLVA 3KQHA 2ZBVA 4EENA 2BSQA 4N3AA 1PD1A 3IQDB 3PENA 4PC2A 4ND6A 3N8NA 3ZJ5A 5JSYA 2W8KA 2GB4A 4E1VA 5CDTA 2OUIA 2JFUA 1IWOA 2O5RA 4RQ3A 1FNBA 1ONNA 3QKIA 5DI3B 1B76A 1X1CA 4LHYA 4DWIA 2HRBA 1EM8B 5I4KA 2Z04A 1KJYA 1ULUA 2ALJA 1I80A 4I9GA 3AEUA 5AW3A 1TGVA 3D2NA 3F6SA 2O8FA 3OKPA 3UV6A 4OI0A 1CSEE 3COWA 3KDAA 4MR9B 4FKMA 5K4AA 1UINA 3HRKA 4YRAA 2CXTA 1W76A 4AY3A 1XO1A 3NKLA 1JLLB 2EW2A 5A0TA 4YRZA 3WA6A 4YP6A 2LD4A 1NZFA 3N0WA 3TCXB 3RVDA 4RH0A 4AZTA 4WLFA 1TVAA 3K5WA 2BY4A 4C06A 4CCAA 3KQVA 4B33A 4LMPA 4KZKA 4QBHA 3DLCA 2BYTA 3LZDA 4J49A 3DDWA 4ACAA 5THXA 1JIIA 2B8NA 2B4KA 4FKBA 5CB4F 1V8BA 2VWQA 3TD2A 4OAOA 4A82A 4EGFA 4MB2A 5ER6A 5CB4B 3OCJA 4PHEA 4O3RA 4I50F 1E2FA 4R69A 4I50B 2MA1A 1EB9A 3RUFA 5BR8B 4DJFC 4P3PA 4U9UA 2AEMA 4RLSA 2ZSJA 3JQEA 1QSGA 5KG3A 2DETA 3X1ZA 4EHJA 3TVYA 4BLVA 1YL6A 2TMGA 1EVIA 3AF3A 3H3FA 4B4UA 3W2TA 1MRZA 4MUNA 4EBBA 2WHXA 4KIGA 3L77A 3F5SA 2IZZA 2GPTA 8ICYA 1WZIA 1X8KA 2V03A 1DK2A 2G72A 2O2EA 2CZQA 2Z2KA 2MMCA 3ONVA 2Q6KA 2WF6A 1SBZA 5EJAA 4HYYA 4BZWA 4QFMA 4IHJF 1NLUA 1YQXA 5CCEA 4WZAE 2F7SA 4ZRMA 4K6KA 4IHJB 4XQGA 4JI1B 4Z9BA 2XMGA 2KVCA 3IODA 5UKDA 1CF4A 4EFDA 3B1XA 5CEEA 2GILA 3VPAA 4ONEA 5KVCA 3SXPA 2FPOA 1WO8A 1T4GA 1D4FA 3D81A 1WMDA 1W75A 2VL7A 2ACVA 3LDAA 2VCHA 5E6RB 2C31A 4DMLA 5EFOA 2QS9A 3GRAA 4KMOA 5CR0A 2C3MA 1NC3A 1ULHA 2R65A 1N8KA 2E6UX 4JQYA 3SX4A 5AKJA 1QFSA 2ZI3A 4O63O 4XVRA 4YUVA 4AF7A 3NVKI 3L0DA 1O95C 3IV6A 4XLLA 2AI3A 1D4ZA 6CHYA 2FMSA 3E2MA 2FK8A 1JJAA 3U9SA 3JYLA 4DLAA 3M81A 1Z47A 1QG2A 1CZOA 4RD6A 5TE9A 1KW4A 5JNVA 4KSBA 4AMYA 1FDTA 1RTKA 1TQ4A 1ENPA 3U19A 4FYYA 3PRHA 1J25A 3FX2A 1LEHA 4ESHA 1JMYA 1BXZA 1S2IA 1T8UA 3DZFA 4INZA 1J5PA 2CHFA 3T7CA 1MXHA 3K6SA 9ICIA 4FQ8A 2VP5A 1Z6GA 3HLTA 3ZGNA 3EPLA 1LFAA 2FUNB 4QPNA 1TQDA 3V1TC 5J0RA 4ND1A 3KJHA 4M6WB 4R9NA 5KNLA 1Q7EA 1KBUA 3GUVA 3PZPA 1C3OA 4CLDA 4O9MA 2GH1A 1SL2A 2B8EA 3OHAA 1DQNA 4UM8B 5AI5A 1IDOA 5JAZA 4DSOA 2QI9F 4I19A 3B5EA 5LIRA 1GEEA 3GCGA 3EZ5A 5KT3A 1KJQA 4V1CI 1EUYA 2XQFA 3B82A 2YZGA 1XMJA 3FLBA 4WIAA 2RI6A 1CUBA 2JFOA 1GPJA 2XQGA 4QZCA 1QIFA 1TT5A 4R8UB 1FP2A 5B58C 4OXQA 2P3QA 1U0LA 1GZHB 2WEKA 3KAJA 3GEEA 3A11A 1KDZA 4B43A 1MJFA 3HO8A 3MFYA 5AUQA 3X0DA 1M1YE 2Q28A 5CA0B 1GZSA 1X7HA 4ZTBA 3H6GA 1DKQA 5JLAA 3WOVA 4FTWA 1ZCZA 5C51B 3B6ZA 3VGJA 3IT3A 3HDJA 5FI0B 3HB9A 2O2DA 5FWXB 3S5UA 5TX7A 2R68A 2G07A 3T99A 4OI4A 2F4VB 4CI0B 3NTOA 3RF6A 2VQSA 4FI3F 4C6TB 4RTQA 5AK0A 4K9MA 3B38A 2BDEA 1C9KA 2JKZA 3WGGA 1AGPA 4DL9A 1T6BY 2ZTDA 3LP8A 4ZDJA 3MT7A 4PIVA 2ONYA 5EL0A 1P3Y1 1CETA 2OCDA 4F1WA 1T8YA 1YA8A 3PF9A 5J59A 3HZRA 2MU1A 1Q1EA 1FDRA 3DCJA 5AW7A 2FP3A 1T0JB 2QRVB 3H87A 3MWEA 3SC3A 1ZOIA 2BSXA 721PA 3EISA 3KVOA 3JWIA 2IV3A 4C14A 2QLBA 2C84A 4G5YA 2FE4A 2ZT7A 4MWCA 3BF7A 4LQLA 4L08A 2YMQA 3DEHA 1NVEA 3O4FA 4KAXA 1GV0A 4CQMB 5F23A 2V7PA 4AZVA 3OTQA 3G9TA 2DFTA 2A3RA 5AP9A 3RTBA 5KFGA 3E8XA 5J8YA 2JCGA 2DUMA 1W93A 3FYCA 1X87A 3ABRB 2YB4A 4DQIA 4EI7A 4XR4A 2DFKB 4LDZA 5IT9A 2FEXA 1BWPA 5I8PA 1FNCA 4MVJH 4KI0A 1QKKA 3CUVA 4DMUB 3PEWA 3OU2A 4X45A 1X15A 1ZM3A 4CT0A 4YPOA 3A70A 1D1SA 5EE9A 4AYXA 2Q2VA 2EZXA 2L19A 2ADOA 5EQFA 4PGAA 2QR3A 2O2JA 3F5DA 2VHZA 1D2HA 3M33A 3KKPA 3PHCA 2QRJA 1W88B 1II0A 2CFRA 2C2EA 5CDHA 1NI4B 4F2WA 4Y6GB 3CUSA 5ETJA 1MRNA 2V54A 2P4EA 1UMKA 2W42A 3ZUGA 5KG5A 5JT1A 4M9XA 1EIZA 4OXXA 4DEVA 4DBLC 4B75A 5DP1A 2A9RA 3MT8A 1PDVA 2DWUA 2FPUA 4HLUA 5I7UA 3WP1B 2FKNA 4F9TA 4BMOB 4XX0A 3DBLA 1KDHA 1J23A 4ECWA 5KI6A 4FN4A 1Z18A 2VK2A 4Q3NA 1RJ9A 4PWYA 1ZN9A 4ETIA 1E1CB 5EEHA 1KXJA 3VTFA 2Q27A 3MAGA 1JHAA 1T35A 5GZ6A 3HKBB 1I1QB 4C7KA 2RDMA 4GKAA 2PBFA 2PXCA 3FSGD 5P21A 1WA5A 3LXMA 1EFHA 4IFBA 1E2MA 2XMSA 4HZUB 1XVLA 3NHFA 2E1RA 1ZLXA 4ZQCB 2WKRA 3DPSA 5DNUA 5BW4A 3ZN2A 2IELA 3EDCA 3ISDA 4QBTA 4RJKA 1V7ZA 3ZWVA 2QD5A 2OWOA 3GJYA 4LKRA 7ICJA 1P4HA 1R00A 4GYYA 4XQ9A 5KT5A 1GILA 2JI6A 2GBLA 5FQOA 5HJ5A 4V0MA 2ABWA 3WV5A 4P32A 3RBZA 3ZE0B 2Z0MA 3Q9SA 3ZLJA 1ZMOA 4DA0A 1NBAA 4B9VA 3N7SC 5JZ9A 2RK6A 3G8YA 1Q3HA 2JJQA 3OZIA 1E32A 1IEXA 5FHRA 5JXWA 1M6YA 2FEKA 4N12A 3KWFA 4XVQA 4GKBA 1V85A 3ZDCA 5IW8A 4M1EA 5DNAA 4LE2A 1W4LA 2B92A 3S1AA 5ECDA 1ILWA 2Q4OA 1OLSB 3TARA 4G0VA 1GYPA 2ZIUA 2WAAA 2ZZMA 4CKEB 1Z39A 2VA8A 3G68A 1QZXA 3AHDA 1RWQA 4BE7B 5B4VA 4EPXA 1TJPB 2NQTA 4EY4A 4NARA 3F73A 3EIWA 2NGRA 4Q3EA 2P68A 2BEUA 4FYKA 5KYNA 2YVUA 4J0HA 5HNKA 1E89A 4JQCA 3QLVA 1G8PA 1JKJB 5ESXA 7ICEA 3LUAA 4IRDA 2FFAA 4YUZA 8ICGA 3CVWA 3WNQA 4DFKA 1SQFA 3H5TA 1YVPA 2AA3A 4PX3A 2CKMA 1QQAA 2ST1A 1PUXA 1V71A 1FMJA 5ITVA 2V4RA 5ARDA 2VJQA 3WLTA 1V8PA 4GI7A 1T2DA 3T3PB 2BTQB 2WILA 4HN2A 4F2HA 1ECGA 4KVZA 2IYUA 3KJEA 3MMNA 1ZQEA 3D8TA 3HSYA 2C0QA 1JMVA 2PPLA 1XCLA 3GLGA 3Q8LA 4GGPA 4IIYA 4G1BA 4OMFG 4BNFA 3RV4A 1GG8A 3ZBPA 4XUSA 3HXPA 5E6UB 1A4RA 4G5OA 4BO4A 4MROA 1VKOA 3Q3IA 1T1JA 3AJDA 5I3CA 3GF4A 4KTVE 4Y1GA 1RVV1 4HGZA 4OAPA 4GLJA 1R0RE 5E3IA 2RK4A 4Z51A 2YRWA 4PO3X 3PJEA 4YJFA 4MV6A 3K8OE 2NAPA 1HE4A 2QV0A 3OQOA 2I87A 4NBSA 5AHWA 4HDRB 4ZYYA 1AUVA 1ZH8A 3GL9A 2B9VA 2DQKA 3O21A 5FAXA 1YHZA 3T0IA 1SU8A 4RSHA 4YFYA 5L3QB 1SRQA 1Q6YA 4ISBA 2JHGA 2D3DA 5JECA 4JFAA 3HN2A 4OQPA 4WOPA 3H6KA 4BKOA 3L06A 3ZIAD 2FPGA 3UC9A 1Z2NX 4RX1A 3PGA1 2IOHA 3V7KA 3Q10A 1GUYA 3JALA 1ODFA 4JC4A 4UB3A 3VU0A 2WM9B 3RRZA 2ZBQA 3FOWA 5T8KA 2X0EA 1Y3HA 2NUBA 4W7HA 1YVDA 1QP4A 4X7BA 4JUFA 1PVPA 1ZXLA 3RBDA 2P9ZA 3D3QA 3COJA 3VOSA 4QOIA 1FSPA 2HMYB 3LGXA 2CLKB 4F56A 4LMAA 1C4WA 1K1QA 3EFOA 5KFJA 5EERA 1ZRMA 3Q98A 3L46A 1BRMA 3B3FA 3S29A 2I6XA 3BK1A 4XKJA 1ESZA 4GOKA 3GFRA 3ZDBA 1L3SA 3MGGA 4BMVA 3EQ6A 1JIXA 2ONCA 3SX0A 4WKBA 2RDIA 2EKPA 3DQQA 1B6RA 4B4DA 1A04A 2Y99A 3AL0B 5HRUA 4QDUA 2QDKA 3LBAA 2IPNA 4G97A 1Y8RA 3P2EA 3JWGA 2PVSA 2YWGA 1TF5A 1W94A 4AW9A 3NCHA 4Z6FA 4X24A 3DL2A 2C59A 3ZV3A 2YKGA 1G21A 1GPUA 4S1OA 3RK4A 4HNQA 4ZPXA 3F2DA 3UB2A 2D8AA 4ZOCA 2A5LA 1Y82A 1Y7IA 4BVAA 1T1SA 4KMSA 3OLZA 5FPHA 2Y9PB 1XD8A 1WOMA 2JF0A 2XC9A 3CU5A 2PUHA 3AKYA 2JCSA 5FBWB 3S7TA 4O8CA 3QZUA 1SOWA 4JXJA 5M04A 5KOIA 2I2AA 3FZGA 2WG2A 5KDOA 2WIDA 1T29A 1PWYE 4WFIA 3ACBA 1GAWA 1JUDA 3FE2A 5CP8A 5AVXA 1JX4A 2QRQA 4L8VA 1M0EA 3HU3A 3N4MB 2A86A 4HJXA 2QOEA 4UVHA 3EJ6A 4PLVA 5JISA 2OV6A 3GIWA 2XTJA 3TGWA 2K2WA 4OX9B 3A58B 2DKXA 2NO4A 1O5IA 3NRCA 4W5WA 2D1QA 4FYXA 3UCFA 2EP7A 2JFFA 3DHVA 3EEQA 4N0QA 4QZVA 5BSHA 3HXTA 3HM9A 3C2KA 3UT6A 1SBCA 2XWSA 3QVOA 2UZ1A 3DO5A 3TXAA 3GPIA 3PXDA 4N65A 1DQZA 5KKNB 3ZOZA 1ED1A 1FS6A 2EW8A 2XRMA 5DWVA 2WWGA 1J9ZA 1ZZGA 1N2SA 3VPSA 3G1UA 2OBMA 1CVIA 4N4AA 1T2CA 2C61A 4PLFA 2HB6A 4YROA 5T3UA 1Q1BA 3V1KA 4JI2B 2GBIA 4OK6A 3TR0A 3VR1A 1XMIA 4MR7B 2J1LA 3NKFA 2QY9A 3TKLA 4B79A 2Q0XA 2IIVA 2OGSA 5LXTF 5JJLA 4YRTA 8ICZA 5DULA 3NM4A 5LXTB 3RYFB 1IXZA 4XDYA 3BIOA 5EP4A 4U2EA 3LPAA 4OM7A 2ZBFA 2OAP1 4TYMA 2FHSA 1D0VA 3SHQA 3TX2A 2W2VA 3SBOA 1FVHA 1QZTA 2I4IA 3S40A 2SECE 1BD4A 3BERA 5KT4A 4B3JA 3IXMA 4RMNA 3CWCA 5CTJA 3FJ1A 2F62A 1C9NA 1GU7A 4NWIA 4WINA 4FNOA 2RKWA 4ZCRA 1UJNA 4F5EA 1P4GA 2N1MA 3OQHA 1TVKA 2NO5A 2C0PA 2H1SA 3OZDA 521PA 1UT5A 1UOQA 2IKSA 1KARA 3ANTA 3UWPA 3DB1A 1G5HA 4BVEA 3HV2A 1VGQA 2NUPB 4UMEA 4O1IA 3LVWA 2BH2A 2ORWA 4YR3A 4QM6A 2ZPTX 3BH0A 5U9CA 2OAEA 4R5MA 3OZ7A 3B1ZA 1UBFA 3Q2OA 3I9FA 3K8QA 1EWQA 3ORQA 1VG1A 1I9CA 1IUKA 4AM8A 5HDBB 1XU4A 4JNCA 4RIFA 3E7WA 3FHLA 3H1TA 2O23A 3N59A 4KW7A 2HREA 1O5TA 1SV0C 1AKMA 2B3TA 5FOUA 1OMOA 1BOOA 2WTEA 3SYZA 2DSNA 1L4FA 3KT0A 1G4AE 2V3CC 1LBIA 3HJAA 4DYVA 1VE7A 4A7PA 3QA3E 1FBTA 3TPCA 1RWOA 2Y1OA 3VKGA 1C3XA 4DCNA 1WRBA 3NHKA 1O58A 1Y9ZA 2IHZA 1L8OA 3B53X 3G0CA 4IP0A 1RKXA 3TQCA 3DEEA 3HT3A 5KJ1A 1Q0HA 2CLOB 1SXJB 3OU6A 2C98A 1T0BA 2BVNA 4Q12A 1CRWG 4DUYB 3I83A 4AT1A 2FMPA 2JIZA 3JZIA 3ZCXA 3JS5A 4ZOBA 5K3OA 1UBUS 1INLA 4WKPA 1YB5A 4JU9A 4X1IB 1QYXA 1N8NA 3CRVA 2CB0A 2F44A 1ZMTA 4URYR 3AJRA 4PANA 4DF4A 3NYIA 4X60A 3K30A 3HB0A 1UT8A 7ICNA 4GRDA 4LWZA 1GNQA 1P7PA 1UKVY 3PC6A 2OHFA 5EMHA 3LC0A 2DC1A 2HHTA 4NNJA 2CNNA 3QITA 3GGCA 1O97C 3FPCA 4F9FA 1G9SA 1CQIB 1FY2A 4BVBA 1EG2A 1N63A 4DYHA 1UJMA 1KMMA 2O0MA 3ROGA 3QVSA 4EY8A 1QPBA 5J5VA 2GAIA 1YRAA 3MBKA 4QULA 5FUQA 2Y1XA 2Z83A 3LY7A 1XQ1A 5G4LA 4YRFA 1KE2A 2NU6B 3GU3A 2D62A 3OJUA 2VT2A 4AY4A 1MG5A 4F0JA 2HSZA 4PZAA 1A7KA 1UH5A 3IE0A 4WE3A 4BMCA 2D1YA 1HY3A 5AK4A 3H0KA 4G0XA 1XNQB 2QX9A 1OBOA 3PE3A 1HQYE 2JBAB 3U09A 3RBEA 3NBFA 2JGNA 1GTG1 1VCOA 5K8TA 2O3SA 4JJ8A 4KK4A 3QUBA 5KSZA 4W9NA 4BPRA 1RP1A 4XWWA 1DELA 4BV3A 4K87A 3RE1A 1CRPA 1KBZA 5I7WA 2HTEA 3VBCA 3ZJVA 4UCQA 4EW2A 2PRJA 1E1DA 1JTEA 3DZDA 2YQ5A 1OJ7A 5DW3A 3JPOA 1E3JA 4K9DA 1WS6A 3CY6A 4YCAA 3MTAA 4M7WA 1M2OB 4DJJA 1KC3A 3DFMA 4TTQA 3H2HA 5LYJF 4HS9A 3I8SA 1O2DA 2QMHA 2YCBA 2TECE 1FRQA 5L6LB 1Y6RA 4A1OA 4W5TA 2M32A 3UK7A 1LTKA 3FDSA 5KQRA 1L3UA 2ZRQA 1RM0A 4LNUB 2BKXA 4DBLE 3BEOA 1VG9B 4UC0A 4S0ZA 3T7SA 1H65A 3ZK7A 4AKEA 4TURA 2J3QA 1UK6A 2DSTA 1AF7A 2OGTA 2QUIA 2VFAA 3BSYA 3GVHA 5B2FA 1TF2A 1W87A 4PGGA 4UHHA 2RHLA 1ODJA 4MTLA 1EFPB 2F64A 4P54A 2WUFA 1BS2A 2ZSUA 4XGQA 1W0KA 2D7CA 1EFLA 1WV0A 3MINA 3K70C 3VMMA 4CKWA 2C95A 5F1KA 4EGJA 1GT91 4UFOA 1L8LA 3DL7A 3BGIA 2O2HA 1ZC3A 3W05A 3ZHXA 4CZ2A 3EZLA 3UKDA 1UOEA 5HOQA 3L4JA 3QQ5A 3NR2A 3MRTA 3NHUA 4ZREA 1YS1X 2X1LA 1XEWX 2ARKA 3SZRA 2PV7A 1DQSA 3A0HU 1VSVA 1YE5A 2B9EA 3DDZX 2JK1A 3ERCA 4R1TA 4R9SA 2PUEA 4A36A 1TK3A 1YKSA 3VXKA 3T5MA 3GLHB 4UPDA 1L4BA 5LD2C 4HXEB 4KCGA 2EGUA 4M98A 1NMQA 2EBUA 3IHKA 1AQNA 3CBQA 1M8KA 4KQCA 3H83A 3PJRA 3FDXA 3MTBA 4YRNA 3THWB 3AEKA 3WBFA 4NEQA 2A1IA 3PUWA 3JPPA 3CUWA 1E0DA 4BLRA 1ADJA 4RNMA 4P0QA 4R9VA 2PJRA 4XJSA 2YTUA 1F0KA 2GZ2A 3PEVA 4R01A 4DV5B 4DSUA 4OATA 4PIMA 3GDXA 3QX8A 1A7JA 1T5SA 3W90A 4LXXA 3K5HA 3RIGA 3T5LA 4FN5A 4FE4A 1RPTA 2P9QA 1KDYA 2WHPB 2C9CA 3QP9A 3FOZA 2EKQA 3R7DA 1J2EA 1UODA 3WGKA 4QEZA 4XASA 4DMFA 3SIXA 5CIYA 5J1TB 2CNWD 4CNBA 1E2QA 5CDSA 3V3KA 1X8JA 3IA7A 4DV3B 4OHBA 3MTIA 3Q5GA 5A9SA 2CBGA 2OA0A 4KOAA 1J97A 1ZQBA 2YQEA 3FPGA 2D7DA 2AE1A 2OHGA 4J9LA 4PZEA 2CJWA 4MYTA 4GC6A 3CB2A 2GFQA 5CH8A 2P2SA 3CF6R 1ZI6A 2FLKA 3L4BC 2ONJA 4AKSA 1MHPA 4PYIA 1Z3EB 1C0PA 3FBGA 3FCSB 1FIUA 5KDDA 1M1ZA 4N47A 5AM2A 2GF9A 3WBJA 1TK0A 5K09A 4PC6A 2O50A 3EAQA 2JPDA 2VJDA 4NR0A 3AIKA 3QLUA 4RJTA 1OXVA 3CXRA 5CX4A 4MVJG 3DQPA 2J3MA 3KT3A 3HSKA 1YB7A 4ZI7B 4AZSA 3BDPA 4JJFA 1GO2A 3V1MA 2D13A 3A3KA 4E07A 3ITDA 3L8GA 4F2PA 2O14A 3EH2A 2X2PA 3HLKA 1E1LA 2FMKA 4OB8A 3PW0A 1YAHA 2EVWX 2X40A 4UB6U 1G64A 1JWAB 4ED7A 1D8YA 3UOWA 5CJ7A 2XO7A 2JJMA 3T9FA 1Z6PA 1MJNA 3M6UA 1ZJNA 3QPBA 8ICFA 4P3KA 3G8DA 4KRXA 2ETVA 3TGPA 4X3OA 2ODAA 1G5IA 3DZHA 2E8MA 4OKNA 4EYKA 4DQKA 3R5HA 3KTAB 3N86A 4COKA 2C2KA 4DUPA 1U04A 1EHYA 1ZL0A 2D4AA 2J09A 5KYXA 3T3EA 4ECYA 5CG2A 5JXHA 3MWLA 2VTKA 1IBSA 1JMKC 2LCQA 4WESB 1O6BA 1ID8A 1YHNA 5H7XA 1KI6B 2FSIA 3NOVA 3H9UA 1CY0A 1Q21A 3AKEA 4MO9A 1XEXA 1QF9A 1HEKA 4ZAXA 5IUNC 1T9ZA 1E61A 4JENA 4XQ8A 2VATA 1T25A 2VHYA 3FPKA 4FHGA 3V6MA 3VDRA 2FZLA 4L8WB 4IIDA 5T57A 2B4QA 1SZPA 3SR3A 2ILVA 4QFDA 2P6NA 1XPUA 1D3AA 1PFWA 4YAWA 4CT4B 4N1AA 4WK6A 2PZ8A 3NH9A 1YR3A 1R18A 5JXGA 3KYBA 3AUXA 1YK1A 2BPCA 1V4BA 1N6NA 1JKXA 2QP4A 4NBRA 5EPEA 1CQJA 4XSHA 4B9EA 4B4OA 4KKXB 4ZCMA 5G53C 5K0LA 3ESCA 2KD1A 3II6X 3AR8A 3FTDA 4AS3A 4DC1A 3CF2A 4ZJYA 4H18A 2P5TB 3IEPA 3BPSA 3RJGA 5JQWA 5BT8A 1N2EA 5AW0A 2Q6IA 2Y8EA 5F76A 4WY2A 3FWKA 4L22A 4B9NA 1U3UA 3OJ0A 4KWTA 4RQNA 4POAA 4IJKA 2WB1F 1LBHA 3SEZA 1NQWA 4WA8A 2GN0A 3HY6A 3U7HB 1JBEA 3V7UA 3C3MA 1Y8ZA 3BIXA 4JLWA 1KKXA 4WCFB 4MVJD 1DLIA 2XGMA 3FNHA 4LHEA 2AVDA 1Y5RA 5EEGA 1U2GA 4A9AA 4CT5A 2ZAMA 1KGDA 5KWVA 1EDDA 3VOTA 1VIDA 1RYFA 2PKWA 3MOSA 2D2VA 1ZESA 4MW6A 3C5GA 1NK8A 3LCMA 4A0QA 1Z08A 3JQGB 4XVHA 4HNAB 3TLXA 3O2NA 3CCBA 1VSQA 1ZD8A 1FJGB 4ZZ0A 2IYNA 1WX1A 2AOWA 5DXJA 3DDCA 4QU9A 3TQSA 3DZBA 2CL5A 3VR4A 2PSSA 2RI1A 1H2WA 4QSMA 1DRGA 4PXAA 2W6JD 4G8CA 3WYEA 1EBUA 4HXYA 3M5WA 2ZSKA 3M6XA 3KT8A 2I33A 3PNKA 4W5HA 1EJ0A 4ZWNA 3AVTA 4P4SA 3R3XA 4D5GA 2QU7A 3O26A 2Q41A 3BEDA 5HS6A 1LDBA 4BNZA 3NPMA 2GPBA 2VHJA 4EKYA 3R20A 3T8YA 5LUAA 3PO5A 3AWDA 4F6RB 4EGCB 3LOQA 4OREX 1S9DA 4F50A 4V03A 4LRYA 2I4OA 4ZCPA 1BNPA 1DAOA 2R2GA 1PR5A 2H4HA 4GSKA 4DSZA 3R4CA 1N1MA 4LISA 2BGWA 5FRDA 4ZXPA 3K09C 1AOXA 4GI5A 2DBVO 2ISCA 3MTEA 1Z5NA 1MOSA 3Q7RA 1MA7A 3IMCA 1YO6A 2DFNA 5T41A 2EYQA 1KU6A 1AS0A 2J3KA 2W83A 3OPXA 2O8NA 5IULC 4NBNA 3HA7A 1GNSA 1SUWA 3BG5A 4DVGA 1SKBA 1O03A 4GMFA 2Q2WA 3IQEA 3MILA 3K70D 1N2HA 1T4CA 3HACA 4YCJA 1YB1A 4H7FA 3GBVA 5JNWA 2YJ3A 2CXPA 4B6JA 2IDZA 5EWMA 1NN3A 1DEOA 4X7RA 2R8RA 3FA2A 3RU7A 2XUZA 3SC2A 1Q22A 1CD5A 3F8TA 3MJHA 4HCJA 4OVKA 4NAHA 2DL0A 2PFGA 5ITZA 3VHQA 1Y34E 4JFRA 3TDKA 1E58A 1NG1A 3EEYA 2YH2A 2HSGA 1Z75A 4RZSA 3LTEA 2AB0A 4Q7MB 3AYZB 3EVDA 4G09A 4Q21A 2ZU6A 1U7ZA 1ZA2A 4R8KA 1NVGA 2AUTA 3GV8B 2IMWP 3JQFA 4IXMA 3DTVB 3YASA 1TTTA 1HL3A 3RBXA 5CBKA 2JW5A 1JG7A 4XGNA 4X6YA 3HUDA 3AF6A 2HF7A 7AT1A 3UQ0A 2VUTA 2E8PA 2YFYA 1SVOA 1Z0KA 4KIWA 4BLSA 3MXOA 4QQKA 1Y1TA 2ICAA 2YDYA 2WF5A 2GETA 2BBSA 1IHOA 4O2BB 4DCJA 1DPGA 1WXWA 4NZYA 4RL6A 1WVIA 3LOUA 3UT5A 1PFKA 3PX2A 3R3UA 1SMKA 3TFWA 1T2UA 1C50A 4O29A 1J2TA 2QT9A 4GPD1 2BONA 1GZVA 2QLFA 3OO1A 2W9BB 2HF8A 3EG5A 2HHAA 3R7WB 4PQYA 3HYLA 2ZB4A 3JYQA 3B1YA 1L9KA 1FDVA 1PN3A 3Q85A 2P4HX 4XXHA 1T2NA 1EA7A 2DFDA 2CCGA 2XDAA 1Q0RA 1UDCA 2ZR7A 4OKSA 2PFKA 2F9FA 1PL0A 1GCIA 2PFQA 4URWR 2INGX 1JJVA 1IPEA 2CXSA 4ML3A 2H3VA 4JITA 3O03A 3C97A 2QAJA 4EELA 4WXRA 2PRYA 2DKFA 4NY1A 2PD4A 2P2YA 4TVBA 4TL8A 1JKMA 1QHXA 3LT2A 2PCLA 4E2WA 2H2AA 1UAAA 4D3FA 2ACKA 4G36A 1N92A 3KUKA 3L8FA 3LHDA 3B5IA 4EG3A 5DN6A 1XJQA 4D4GA 1V48A 2D0OB 1EI9A 4J2HA 3OI7A 2YWFA 5TRTA 4MEBA 1PI3A 1AXEA 3UFXA 2XXJA 1QP7A 4MS4B 4RUCA 4MVJE 2PGAA 2XVYA 3ILYA 4WACA 4AC9A 4C0JA 4MIKA 3JQ8A 1YB4A 1VI5A 4FJ0A 3JATB 5A1JA 3A3YA 3VOBA 1KN5A 3GYBA 3TF5A 3CX6A 3EGVA 1WUTA 4JV2A 2R1UA 3FTFA 5KJ6A 2YYSA 3SXUB 4F3YA 2VF5X 1IMOA 1ZISA 3G8CA 2Z5FA 2ZITA 1R6UA 3DBIA 4R8MA 3LX6A 3R9IA 4Z6CA 1TLLA 1L4NA 1HBJA 2C3OA 3GRPA 4IINA 3SAFA 4ZQGA 4LSGA 3QG5A 1JJFA 1NN0A 4KG7A 4LSZA 3H18A 5H4GA 2W7OA 2PXAA 2CHEA 2ZB3A 3A7EA 1IH8A 1GSIA 2REXB 4LV5B 3MR3A 2HGSA 3ELDA 4YLEA 4WXYB 3I45A 3WKDA 3GP5A 3PYXA 4AG6A 3K8ZA 4RVCA 4PSDA 1M3SA 4FMDB 5B7NA 3TOVA 1FMLA 1E1RD 1ZINA 1C3LA 3OCCA 2NPFA 4D56A 5DO9A 1P77A 4A8TA 3UGJA 3BKWA 3ZDRA 2HU8A 4IDEA 4FT4A 2CUTA 4J29A 4BX9C 4IDOA 3H42B 1JFRA 4EYHB 4DLRA 3CUYA 1AGRA 4J1QA 5GOTA 4DWOA 3SQIA 4BP8A 2Q3FA 4AVYA 2VXYA 1O94A 2GCEA 1T5HX 1US8B 5LOVF 4Q3AA 4MCIA 2VDWA 2ZTLA 5LOVB 1FQOA 2C2YA 2BM9A 2P9CA 2QYTA 3OM1A 2WJVA 1NJ8A 3GAMA 3R6TA 5BVHB 1ST3A 1E7SA 2AE2A 5D8DA 3CEPB 1YOBA 1XZ8A 1CF2O 4B6SA 3I52A 3NJRA 2HY7A 3JWPA 2QJRA 1XYGA 3QNUA 5EUBA 3GEHA 4HGQA 5IJ9B 2K4MA 3CW2C 4NICA 3KUDA 3PLAE 1EE1A 3D1JA 5K1ZA 3TR6A 5DNVA 1E5QA 2DWOA 3HFJA 3AUOA 1EQAA 1E77A 1CUCA 1D9ZA 2J4CA 3FGNA 1RRCA 4F92B 4K6MA 4ASUA 1WXGA 3H05A 1C9EA 2JFZA 2ZBPA 2OHVA 1QO0D 1RI5A 5MGBA 4DTIA 4B6EA 3DE6X 4ZYZA 2A9VA 2Q1YA 2F3TA 2UVQA 4ER0A 3DOCA 3M5PA 1L5MA 2IXFA 4M1MA 3B3JA 2ZIZA 4PYKA 5FO1A 4G3XA 3UXNA 3GEDA 3JZMA 2BC9A 3HGQA 2R6HA 2ZBRA 5CK5A 1MHTA 2C2XA 4OH1A 5CPFA 1U5AA 2J3EA 4LQCA 4HRAA 1JKFA 1JKIA 5FORA 3OEHD 5D87A 1JI7A 3KOZA 4EBCA 1PFUA 3HYRA 2O59A 3I5XA 1OWNA 1CUYA 2ZRDA 3RK0A 4TLCA 1ENYA 3PVSA 5AW2A 3CEMA 1E0KA 1XX6A 3C3EA 3PY8A 3U4IA 3VUEA 1U4NA 4FXOA 2HA6A 2AIRA 1MIOA 2BFBA 2R1VB 1VMAA 3IE1A 3WLQA 2R8BA 5EMMA 4YH1A 5E4FA 4NAVA 4YMIA 1F0PA 2XGSA 3C5CA 3M1IA 5MFPA 4RK4A 5EMLA 2W8BB 4BL5A 1OU0A 3N2GB 3HCWA 3Q7QA 4G1CA 2AXTU 4CF6A 2QBYB 1PT7A 4O0MA 1FJ2A 3PV0A 3WQSB 1OPRA 4ZKDA 1ODKA 2VHTA 5K0SA 2BJVA 5JJIA 1VI2A 1KO4A 1JEJA 3P0FA 5EHIA 4UBKA 4H77A 2FPKA 4RD3A 1XRJA 3PFNA 1WEKA 4EBFA 3BGOS 3I61A 5IX8A 4IXTA 2PX2A 1YXMA 3K92A 1Z2PX 3I23A 3DAFA 2R62A 1ZQIA 4Y6SA 3E3OA 5F64A 2M6KA 3X44A 1A69A 1Q84A 1JN3A 1J1ZA 5KSWB 4QUKA 4E2ZA 7ICHA 5LIPA 5KNCH 4JC8A 3OWOA 3SEIA 2XJ4A 1OB2A 3FMFA 2WPNA 3QKSA 1NSFA 1TJNA 1N6PA 2D5IA 1XTVA 3VR2D 4RSRA 1FFWA 1BMFA 2OM2A 5ALRA 1GADO 1WXFA 4JKIA 3VZRA 3IAS6 4TN5A 3A1DA 3OT4A 2DT5A 5AM0A 1GZ7A 4E94A 3O31A 1ZIPA 2Z1NA 4RPGA 9ICSA 3BREA 2UYGA 5CA0F 3RKUA 4DLVA 2I6FA 1GHTA 3EGCA 4YK7A 3SZOA 3KHLA 4X90A 1RXVA 1GVHA 1IBKB 4OUDB 8ICKA 1SHJA 3TZKA 1KVUA 1QH1B 1P31A 4PWZA 5BWLA 1K75A 2I3ZA 4XPIA 2FE1A 1VKHA 5J2IA 3LCRA 4N6NA 4WZBB 1JIQA 1WMAA 1PV2A 4N48A 2XQIA 3ZNNA 5KOHB 3O1IC 3QGMA 2JI9A 3I04M 4CE6A 2RGCA 3LDHA 3DUWA 4M21A 5ELLA 4KLJA 2PA3A 1QBKC 4YRIA 4GR4A 1F44A 3HR8A 5BN5B 1W9MA 3DAOA 3K16A 3L7LA 2DUJA 2XE8A 1MAUA 4EAQA 1LBEA 1G63A 5CXSA 1RABA 1XNRB 3H4DA 2FPPB 1EUCA 1C80A 1TW2A 3G82C 5JTTA 2ZB8A 4DZTA 1Z5PA 5J4HA 1F9EA 1PX0A 1NJGA 4PO9A 3OPMA 2ZSFA 1KOJA 1MXFA 3LFUA 1IM4A 1SQGA 5CW2A 1ACJA 3MUNA 3E9YA 4LXQA 3SPXA 3DSRA 4KMMA 5I9MA 2XNDD 4ZOEA 5LWQA 1FYVA 1LVGA 5FULA 2RC6A 3U3DA 4MS3B 5EGSA 3IMEA 1IOVA 3MRVA 3PC2A 4MYRA 2JGKA 4R71A 2H3EA 1EVJA 4O6VA 4DDHA 3WK7A 1SBQA 4CV3A 3MTQA 5HIIA 4J9SA 1E8MA 3R09A 1TC2A 4Q03A 5KPDA 3RRNA 4DDTA 5GIOE 2YV1A 2FZCA 3L7OA 4Z9AA 4BE4A 5CNIA 3GLRA 1UK7A 3O95A 1HQDA 5KU7A 5FX2A 3PRYA 4B5KA 3RFVA 2YXDA 3VKHA 5BQ3A 1C8VB 1EVZA 1BE1A 3QTLA 3GXBA 1L2TA 4K4HA 3PR4A 1KMNA 3WRVA 1LI5A 4UHBA 2CT8A 2H59A 5E9AA 3AUSA 1U80A 3GJTA 3TTUA 5ALQA 3NGLA 1XAHA 1CDEA 1B2RA 3PDJA 1EQUA 2XF2A 1P0MA 2A1AA 5TGZA 1S2GA 1UIMA 5KSOA 3KQSA 3ER9A 2UUCB 3GGJA 4JOSA 2BE7A 4X8MA 1PBTA 1XHEA 3Q9UA 2PIAA 1GQFA 2C82A 4Q82A 1TZCA 4P0TA 3OJWA 1NW6A 5B3JA 3G59A 1SKYB 4Y2TA 4X0EA 1A8UA 3SX2A 1TYDE 1SUCA 2ERXA 1GKLA 1R0SA 1J2NA 1H2RS 3G2PA 5JD3A 3OZCA 1EFUA 4RK0A 2WAOA 1JI0A 2AU0A 2ZSEA 1V11B 1DMRA 3RYCA 5EKTA 1CUWA 3DULA 1QB8A 4YRDA 4N49A 5CDUA 4US0R 4WZAA 3H1BA 1J70A 1IIPA 2I29A 2EBFX 4NCHA 1C9YA 4UU8A 3JQ9A 2W4IA 2F8MA 1ODCA 1VDMA 1PS9A 1MU0A 4OMDA 4C2UA 2QUZA 3JW8A 1VPDA 3D43A 2H06A 3RTDA 4JWKA 4M36A 4CEJB 1CUUA 1IPHA 3BS5B 4MFAA 1N78A 4TKVA 3N0TA 3NOOA 1D6SA 4LDNA 1ZH6A 2JLAA 1Z0DA 3TH5A 1B0UA 1V7QA 5AMXA 4QJFB 3E05A 2MRLA 3T3MB 4US2R 1U49A 4IX9A 2VF8A 3G3EA 4U8GA 3ESDA 1E3MA 2WV9A 1BGXT 1YH3A 3A6KA 2VUSA 4IRXA 5EOVA 2P6RA 3NEJA 4AJ2A 4ARUA 5F4BA 1ZL2A 4DAEA 3MFQA 2AFHA 3OOYA 4W5QA 4IGKA 3KKLA 1J2UA 2DHRA 1ESCA 2V45A 1S2LA 1H0KA 4NTZA 2OORC 4W4TA 1O8CA 4CRWB 4M0MA 2NUAA 3PNBA 3KL4A 4GZ3A 2KJ9A 1QYIA 3RREA 5C34B 4C05A 3R7AA 4RC9A 3U7JA 1X7DA 4YXWA 4PLHA 1VJTA 3AWIA 4AJPA 4P7FA 3RFTA 2HJVA 1N2GA 1OBVA 2CMGA 4DL3A 3FXAA 3F6RA 3KKAC 2OFFA 1L4GA 1V37A 2XCQA 3SIWA 1HQKA 3MWDB 3KR1A 1RKVA 1T94A 3NHYA 1MT0A 3UPUA 5EHQA 3P9KA 3EK2A 4IQFA 3MDAA 1VIVA 3KZCA 3FNQA 4MWDA 2BKUA 3FYUA 2I7CA 3FAZA 3IBTA 3OQVA 3PW5A 2K8AA 2JGIA 2FZKA 3RIXA 3GRKA 1UQTA 4ZH4A 2ATLA 3SHTA 3L7CA 3AY7A 2X5KO 1RRKA 1UA1A 1K68A 5L6MB 4RESA 2WYVA 3ID6C 2IYLD 2FDCA 3AMZA 4BNLA 5JAOA 2QTHA 3EMBA 4TV9B 5K0JA 4RNCA 1TYBE 3EOAI 4YJKA 5G5GA 1J7KA 3PVXA 3JARB 4RJLA 4UBIA 1NG9A 3UAYA 1ZD1A 4C5AA 1O08A 5EIWA 2RE8A 2CJYA 2R7NA 2PAAA 2N46A 4QECA 1LBSA 4X44A 2Y4OA 4UTPA 4OJNA 4KVAA 5JSZA 2FP4A 1QM5A 4XOUA 8ATCA 1PL8A 5IVHA 3G6YA 1L4UA 4RPXA 3ZXUB 3RH6A 2CXOA 3M3PA 5FTNA 5IAEA 3KCQA 2K7ZA 1WBJB 3OQIA 2CSXA 1CRXA 4DLEA 4UHCA 3GMTA 3MXTA 3FG9A 2Q2NA 3Q8RB 3QKRB 5JFOA 4Q9KA 4KPGA 1IB0A 2PMBA 3AC0A 4MKXA 1CI4A 3X1JA 5GAJA 3HZZA 5LN1A 1NQVA 1NNLA 3ONEA 1PZEA 1T1GA 1UM8A 3OA2A 2AOUA 2YC2C 3ISJA 3BB1A 2JJ2A 4KLQA 3WAJA 3NBQA 2H3ZA 3U3JA 5AJTA 5KHOC 4M46A 1PFYA 5BPCA 1UZUA 1B26A 1D8LA 3P45A 3T35A 2VAXA 3ROQA 2PLNA 1UFRA 2P8JA 3ZWYA 2IXDA 2CYAA 4TLEA 2WMOB 3MGBA 3A36A 4CMKA 2XMPA 4O4IA 1ORVA 5F3XB 2XSZD 5COQA 3UMFA 2CJXA 1PLLA 2A57A 2B6GA 1AUPA 1S77D 3KHGA 2RKOA 1X7ZB 4TL7A 4IHAA 1PT5A 3STXA 1Q50A 3SS7X 4N3BA 4I1VA 4OP1A 2XZDA 4E6EA 2IU0A 4A73A 1XALA 1G7SA 5D3MB 2NYVA 2W2LA 2EBWA 4HKTA 1PKEA 3V8VA 3F8WA 1KOGA 2RAVA 1GWNA 4L4ZA 5FBKA 1M2KA 3ZC3A 3PP8A 3I2GA 1I7DA 1OIVA 3VPCA 2H4JA 1KZGB 4QYWA 1ISMA 3LQYA 4IMJB 2NX2A 4YWHA 1GLNA 3FDFA 3GARA 2JLYA 2ZVPX 2OYSA 1KI4A 5FH9A 2W70A 7ICTA 2RONA 1MW8X 4IJMA 4RK7A 5FNVA 1Z1VA 1B41A 1B16A 1KTIA 1F38A 4OQYA 2PNFA 5E7IA 2YN4A 1HGXA 1JXMA 4OBWA 5JQGA 1BGVA 3ZGLA 2I03A 4OLBA 5F9HA 3RGGA 2X1VA 1KFSA 4TVKA 2J59A 3ABSB 4F06A 1J1UA 2BHTA 4YJDA 3A27A 2FWMX 5HILA 4KPFC 3C3YA 2X9LA 3O3MB 1OFUA 2IHVA 2RD2A 4F4HA 3CP8A 3K9BA 3W8DA 1XXHB 3KKKA 3EZNA 4JAVC 4EZEA 3ZW8A 4ED6A 3B13B 3OE7A 2CEAA 2YJZA 2BP7B 2HK7A 4PZYA 2HC9A 3BM5A 3STTA 3U60B 3VGPA 4ZGWA 1NDHA 3ORFA 2G08A 2B4AA 1J0BA 3LDGA 4UU7A 1TMKA 1HDXA 3F9IA 4J0EA 4HVLA 4C1BA 3D4OA 1I9GA 2QTBA 5EZ6B 2ZTMA 1G9XA 4NVRA 3RANA 4ARCA 3N2ZB 1Y1RA 5BSFA 1C3JA 4INAA 3PUXA 4LRUA 3I2KA 1S0OA 2H1CA 2QQ5A 2VCEA 2F3RA 3QY0A 4TT3A 2C83A 1PZXA 1X77A 1Q0TA 1YBAA 3AY0A 2V8OA 4Q4AB 4Z9FA 3OHSX 3QEAZ 2WSIA 3OSPA 5EZYB 4D8UA 2GJKA 2QG4A 4LZDA 1ZWLA 1JA0A 3R75A 1N2CA 1Y9JA 5KMGA 1Y7LA 4IIHA 3SJUA 4UCWA 3KYIB 3K0CA 1ESMA 2VLBA 1R1DA 2PL9A 5CT4A 3W2GA 5KQPA 2EQAA 3ADPA 2QENA 4G0QA 3OZTA 1BW9B 3WFJA 3PW2A 3ANSA 1GPWB 3DC7A 4OGKA 1RADA 2W37A 1ECPA 1GKIA 2HUNA 1N3LA 2G8NA 4PZ9A 1EGHA 2GI4A 3OSZA 4P4GA 3NBUA 4HB3A 2ZTCA 2BR3A 3IOCA 2PTGA 2IS1A 2WPDD 4JLNA 4AULA 1S2DA 4LPKA 5C7YA 3MERA 2E37A 4N7JA 4EWLA 1RXUA 1X74A 4MV4A 3PVCA 1RFLA 3F90A 1FS5A 2FDRA 4GLOA 3ZEAA 2Q21A 4Y0NA 1N1DA 2Q4DA 1N25A 5D3QA 3HJNA 4ND7A 4L5IA 4IV0A 4DQVA 2WWXA 1ECLA 1RIFA 2KIWA 3GIMA 3NS7A 3S8EA 4HAUA 2Q07A 3N07A 3JAWA 2I6TA 1KETA 2PLWA 1FXSA 1RFGE 2VH2A 4C20A 4BKRA 1TEZA 3HA3A 2ASJA 3GJ6A 4PX5A 3EDRA 4E21A 4N9QA 4FYVA 1EVKA 2N75A 3OJXA 1O87A 8ICEA 4L78A 3RHSA 2UVDA 3VUFA 1U28A 4KUHA 4DQ0A 3KV3O 1EFVB 1DCKA 4HSEA 3COVA 4WV3A 1GZ3A 4V0LA 2GAAA 4URUR 1AK1A 1LW7A 1NOJA 4BVHA 2PUAA 5FLKA 3TW4A 4TKMA 1QOPB 5H68A 2D5LA 3HWWA 1MH1A 3UH1A 5C5IA 3EZFA 3HCBA 1YBFA 4MRVA 3EF1A 3U1TA 1HT1E 3DMYA 3QEJA 5HR6A 3GIDA 1E2PA 1E8NA 3X1XA 3D0KA 1NGSA 1Z74A 1QRUA 1M6HA 1MH9A 3UQZA 4S04A 4U00A 4PNEA 2QPLA 1NJSA 4ER3A 2YX8A 4MHOA 3NHRA 2IYXA 7ICQA 3H65A 4CBVA 5C7LO 1N8SA 2ES6A 2JEZA 5BR7A 5LU9A 2HJRA 4EB6A 4DLKA 2QW0X 4LGVA 4WAUA 4GDFA 2VJCA 5REQB 2KE5A