1TE2A

Putative phosphatase ynic from escherichia coli k12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
b'RQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxyglucose-6-P phosphatase
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
rcsb
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.3.22: Mannitol-1-phosphatase.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1te2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1te2A01
4XPZA 4UU1A 2EATA 4XOUA 2YJ3A 3ZI4A 4Y2XA 3SHQA 4FFDA 5ALFA 5AI5A 5AIAA 1EK2A 5AK6A 3MPOA 2OYCA 5AM0A 5AW7A 1RLMA 5IS2A 1ZD2P 1Z4JA 5AKXA 3WK8A 5AVYA 1L8OA 3ZVNA 5AVTA 2D2VA 1N8NA 5AICA 2YY6A 4IG4A 1KYTA 2X4DA 4UMVA 3B8EA 2GHTA 3QGMA 1VJRA 3AR2A 4DCCA 3ET4A 3ZVMA 3CNHA 1Z88A 1T5TA 2W43A 3A1EA 2YMLA 4YIHA 1XP5A 2QLTA 5AM2A 2PKEA 5AM5A 2G06A 2IOFA 1WR8A 4YCMA 3L7YA 3EF1A 4Y2TA 3ESQA 3WK4A 1VFPA 2YMMA 1U7PA 1RLTA 4NWIA 3PGVA 2PQ0A 2NO4A 3WKBA 2FPUA 2R8XA 3UM9A 4EEKA 4YCLA 2WF9A 4Y2YA 1T5SA 2VKQA 3ZWKA 1J97A 2RBKA 2B1QA 3A3YA 1Z4PX 1JUDA 3A1CA 2I33A 4UM7A 4QQFA 1RQNA 5ALYA 2O9JA 2FDRA 3EPRA 4BX3A 4L6AA 5AHXA 4BEWA 1L8LA 4O8CA 1L7MA 2ZBEA 3W5DA 4ZEWA 1RKVA 1K1EA 2Q4RA 3I1YA 3MC1A 5AW6A 1RC8A 2C88A 5A3RA 2ZBFA 2NYVA 2B82A 2CN1A 3BWVA 2B8JA 2MU1A 3L8HA 4AS3A 4CF4A 2IOFK 1ZD4A 2ZBDA 2HSZA 3KOOA 5AW3A 5AVVA 3QLEA 3ZTYA 3WKDA 1F5SA 3IB6A 3FZQA 3L0BA 4RESA 3WKEA 5ALVA 4G63A 3ZX4A 2ZXEA 4UASA 3L1UA 2I34A 3QUBA 4BNDA 5AW1A 1ZRMA 1Z4MA 2RARA 3E58A 4CF3A 3AR3A 3U7GA 5AK5A 2HOQA 3QXGA 3OPXA 5AW8A 2G0AA 3TLMA 4DWOA 1CQZA 4C4RA 3MN1A 5AW5A 2GMWA 3E81A 2FI1A 4XQ0A 2BY4A 3ET5A 1RPZA 2OM6A 1RKUA 4HGQA 1XPJA 5AKEA 1QQ5A 5AKIA 5AW2A 3UMGA 3QU4A 4HGNA 4CNQA 3NRJA 4EELA 3I76A 4MWOA 4UMEA 3IRUA 1LTQA 3AR5A 1RMQA 2DQSA 1Q91A 3FVVA 4MUMA 3L5KA 3S6JA 3EWIA 2EARA 2I6XA 3DAOA 2AH5A 1Z4KA 2O2XA 3NASA 4L57A 3AR9A 1SU4A 4CE6A 5A3QA 3DNPA 3AR7A 4AS2A 4DFDA 4BYGA 5AVUA 4KX5A 3MMZA 1PW5A 2JGAA 3N28A 1Z4NA 2I7DA 3NIWA 3L0CA 3QUTA 5AI6A 4NV0A 3QUQA 5ALOA 3R4CA 5ALQA 4HAIA 2YBDA 5ALRA 5AKLA 2I55A 3ZWDA 4PNHA 1Z5GA 2GHQA 5T41A 3BA6A 2FPXA 5AW9A 3QU7A 3WGVA 1SWVA 4JB3A 2B0CA 4XE5A 5IT4A 2RB5A 1VJ5A 2GO7A 2P9JA 3ZU6A 2FPWA 3D6JA 5IT0A 2HHLA 5ALTA 2CFRA 5AW0A 2WF8A 1T9ZA 5E0OA 4UAUA 1L7PA 1QQ6A 5AI8A 4BX0A 4QJBA 2OBBA 1YMQA 3DV9A 5AKGA 3ZVLA 3K1ZA 2B30A 2FUEA 1NRWA 5ALUA 3NALA 1QH9A 5FP0A 4F71A 1YDFA 1Z4IA 4UAVA 2W11A 4E88A 4Y2QA 3OCVA 1YJ5A 3U19A 1Z4OA 3U7HB 5ALKA 1J8DA 2JARA 3CZ4A 2R8ZA 4KN8A 1Z4QA 3RF6A 2AMYA 4B6JA 3W5AA 4UARA 4OHFA 3N07A 3ZW7A 1Q92A 2HX1A 2JAUA 3VAYA 1RDFA 5AIBA 1TJ5A 3RFUA 2MU2A 4BBJA 1Z5UA 2R8YA 3ED5A 4C4TA 4GIBA 4KX3A 3QU9A 3HYCA 4HGOA 4F72A 3U13A 1IWOA 2WFAA 3A1DA 2BDEA 4I9FA 4AP9A 2HO4A 3ESRA 3DDHA 3OCYA 5AI4A 3FM9A 2JAWA 3M9LA 3WK7A 2G1AA 3QU2A 3SKYA 2PR7A 5ALDA 3L0YA 5A3SA 3I6BA 5ALLA 3FPSA 3EF0A 4Y2PA 1U2TA 4UW9A 5ALXA 3ONNA 3WKAA 5AKZA 5AKJA 3WK9A 5AM4A 1LVHA 4Y2RA 3OTQA 2IYEA 1ZRNA 3R09A 2CFSA 3P96A 5AVSA 1S2OA 3KDPA 3L8FA 3L1VA 2FPRA 2Q4TA 5ALPA 3FGOA 1XVIA 2WM8A 5AKKA 4UMDA 2YFYA 5AKHA 4BX2A 1CR6A 2JAOA 1O03A 5ALJA 5AVRA 2G09A 3AR4A 4J2TA 4H1WA 2HDOA 1EK1A 3FPBA 3SLRA 3N8GA 1ZD3A 3UMCA 5AKYA 5ALGA 2ZG6A 4GXTA 4HGRA 1WZCA 2HF2A 1ZD5A 3U26A 3KBBA 2BDUA 4I9GA 2YMQA 4DW8A 3SF0A 1AQ6A 3KD3A 1YS9A 5ALEA 2YN4A 4EZEA 4BEVA 3SKXA 5AVXA 2WF7A 2W4MA 2I54A 2NO5A 3OCWA 4UU0A 4YIKA 2RAVA 2MSNA 4JDPA 5AK3A 4UMFA 4UATA 3QU5A 5ALWA 3L8EA 2AGVA 3OCZA 3B9BA 4CF5A 4Y3UA 5AM1A 2G80A 1TJ4A 2IOHA 2P11A 3U7FB 2P27A 4RETA 2WHEA 2YJ5A 2HCFA 5ALNA 2C8KA 2WF5A 1S8OA 4C4SA 2AUTA 4EX7A 3KC2A 3SD7A 4YH1A 3ZTWA 1YNSA 3IJ5A 5AVQA 3QYPA 4EENA 1N9KA 3WKCA 2IA5A 3M1YA 3NAMA 1U02A 5ALIA 5AI9A 4Y2VA 4BKMA 3N1UA 1RMYA 1TJ3A 3WGUA 5AW4A 5AM3A 2G07A 3AR8A 4KNVA 4YCNA 1RLOA 2CFTA 3F9RA 4EX6A 3E8MA 3B9RA 1O08A 1SWWA 3KZXA 1RKQA 2B1RA 4KNWA 4HYTA 4Y2UA 4BNDB 1QYIA 4ZEVA 4IFTA 1FEZA 4Y2JA 1NNLA 3QX7A 1WPGA 3OCUA 3NUQA 3GYGA 4KYTA 2Q5EA 4YGYA 2OA0A 5JJBA 1X42A 1RQLA 1U2SA 1NF2A 1WVIA 1RRCA 2HEGA 1QQ7A 3OCXA 5ALHA 2B8EA 3WK6A 3UMBA 3NANA 3U7EB 3ZX5A 3SMVA 1L6RA 2ZOSA 2C8LA 2EAUA 2QYHA 1ZJJA 2ODAA 4OCZA 4FYPA 5AESA 4ZEXA 2HF7A 1L7OA 5AK4A 1ZS9A 3W5CA 2FUCA 3WK5A 1YV9A 2GFHA 4G9BA 4OD0A 1MH9A 2YJ6A 2WF6A 5AVWA 3I28A 3J7TA 3R9KA 4L6CA 4NABA 2ZBGA 1TE2A 3AR6A 1TA0A 3QUCA 4UM5A 2FEAA 3E84A 1ZOLA 4NFLA 5ALMA 2R8EA 3L8GA 5AVZA 2HI0A 3ZUPA 4FE3A 2P69A 3N5KA 5ALZA 2C4NA 3PGLA 5AI0A 2G08A 1L7NA 1U7OA 3PDWA 5ALSA 1Z4LA 4HGPA 3HLTA 4NAVA 3W5BA 2FPSA 2YMPA 1Y8AA 4Y2SA 1RMTA 2C9MA 2YJ4A 4J03A 4OFZA 3QNMA 3PCTA
chains in the Genus database with same CATH superfamily
2I87A 4Q12A 1QVAA 4EAQA 3JQGB 1ABEA 5FNVB 2J6HA 4ND6A 4MWZA 3Q8XB 4GKBA 4C7BA 2KJQA 1HT3A 4GMKA 4L78A 3V7LA 5B2EA 1SK8A 2XCUA 3L6RA 5JG7A 1ZM7A 3ZIDA 2I91A 1PD0A 3MJTA 3MPOA 1L3VA 1VCMA 2JEFA 4URWR 5HF8A 3T06B 1NKTA 2HUPA 1I5OA 4XB2A 3VAZA 4O2AF 1KKMA 4U2BA 4P7FA 4PRKA 5BXYA 1E2IA 2BZSA 2Y66A 2AF4C 2OO5A 3MUOA 3QHAA 5FO0A 4I50F 3S4YA 3TE7A 2IPLA 3CSUA 5CUQA 1Y7IA 2B69A 4DDTA 1T0UA 1GAQA 2G17A 4P98A 4WESB 2XADA 4QLAA 4GXKA 1OWPA 2IU4A 5AVTA 4CKXA 2ZRIA 3BKXA 4UDYX 3O91A 5KYYB 1A6SA 2RLTA 1MRNA 2EAMA 3W7VA 1E99A 2I22A 5GINE 2EAOA 1BVHA 5E6RA 3COSA 4NOKA 2KHVA 5J47A 1DGQA 3H84A 1ZOIA 1NNEA 2E37A 3FW1A 3BTOA 3IM1A 4B4VA 2CKMA 2XGSA 2P3LA 3H1GA 4IFEA 1IY0A 3WDKA 4YI5A 5JECA 5D85A 1R0WA 5KYWA 3R6TA 2IEDA 1XXHE 4GMDA 4PLYA 4DDMA 1UBMS 4QPDA 5BSWA 1S01A 1GU0A 2EZ8A 3KVNA 4AZ3B 4ECRA 5BOMA 3KQMA 1Y4UA 5DKFA 1JEYB 3H6GA 2WIKA 3RCBA 1RYNA 2FQ1A 2FZLA 2QRZA 1YI0A 2YBEA 3AJEA 4D9EA 1W46A 2Q8QA 4OQNA 3H9GA 3TRHA 5L4SA 2IPMA 3ZY6A 1OXBB 4N3NA 3HCAA 2FUG6 2P65A 4NMXB 3DVAA 4PG4A 1QTNA 2FPUA 3LFTA 2GN8A 3SLKA 3VPCA 1NK5A 5CM8B 4GSYA 4MI9A 4YRZA 1FFXA 4QEDA 3G6XA 1LNZA 1P45A 3GV8B 4FWTA 4F4CA 1IZYA 4GVXA 2ZDHA 1U9JA 3LUHA 4MPRA 5EI5A 4A91A 3Q7TA 1GZ3A 1KP2A 1N3LA 4TTJA 3Q7PA 4YJDA 4EG0A 2AN1A 1XLUA 3PUKA 3OLZA 4G3XA 3EDRA 4TTQA 2GA9A 2QWXA 4MP6A 1IHOA 2XEXA 3C87A 1JG3A 3D8NA 4XARA 1DLIA 4O3MA 4QYTA 2AWOA 3L0SA 5FEMA 5KYUB 8ICMA 4KQWA 3Q8SB 2QN3A 1JZSA 4JFRA 4LF7B 1Y9ZA 3DKKA 3PNKA 5EKDA 5TNXA 1RJ9B 1JG2A 3AHIA 3C41J 4GR9A 3ZN2A 1NY6A 1M7HA 4QXPA 3Q8PB 2HHTA 1XTUA 3BRCA 3GJ3A 4M0LA 1U6KA 2C9DA 1D2AA 1EJ6A 5JAZA 4WESA 4LKRA 3CLVA 4MB0A 1U0GA 1NJYA 3MJFA 4I4TA 4JJIA 4B87A 2ZSIA 5CIWA 4QNNA 3DQPA 2FP4B 3I3OA 1ZD4A 4BNNA 1FMJA 2NTYC 3AYXB 3PC6A 3PI6A 2OPBA 4X20B 4P0PA 2Q4EA 5CYGA 1EVKA 3QLEA 4XLTA 3EEYA 5GONA 1FXWF 2LYHA 4PM4A 2R2AA 1GPNA 1G0NA 1SBYA 3IB6A 1Q83A 4CODB 3MWYW 3PVCA 4MW4A 4CM9A 1VMIA 3B52X 1XG5A 2HVIA 1C2TA 3SF8A 5IXYA 5LU9A 3TN7A 3ABRB 3O73A 1LRKA 3L7AA 4CJXA 2VS1A 4KU4A 1A4XA 1V11B 4RT3A 2FG7C 3KFUF 4MP3A 1HZZA 3H2JA 2DY1A 3C23A 3OH8A 4L02A 3Q4GA 4LMPA 3SDSA 5ABPA 3W6ZA 4MW7A 3U3XA 4UNQA 3V4LA 1TZBA 2ZBUA 4IXWA 1GL9B 3PCRB 4HNGA 2RARA 4WN9A 1N2GA 3FBGA 4J9NA 4J2HA 5E9QA 3OPYA 1HLFA 4KQEA 2QY9A 5D6OA 5EJ2A 5GQSA 5DRYA 5FI0B 2G0AA 1LBEA 5H82A 2H7VA 4RFVA 4OUKX 5IEBA 3TLMA 2FSFA 4J0DA 2ZUFA 4QPCA 1E9FA 3CF6R 3DDZX 4LK2A 2YB1A 4MO9A 2VT3A 1JEDA 1KO4A 1YRLA 1E3WB 2D5AA 5GTHU 2I7CA 3ILVA 1X9WA 5HS4A 5JDCA 1AA9A 1E9DA 1B93A 2GN0A 4RNNA 5F12A 1P7WA 2FPPB 1FOEB 3CRXA 2OKGA 3EFOA 5P21A 4DVJA 3FOAA 1G8HA 1IXKA 3EC7A 3GUCA 4ZYWA 1TJYA 1XPJA 1XTVA 4M9QA 4AP5A 5LNK6 1WMAA 3FFAA 1RBQA 2E3JA 4UCQA 3TYXA 4DILA 2TMYA 1G9XA 3U0VA 1U9YA 1GAJA 4CNQA 1LPMA 4EELA 3T1VA 3VI4B 3W9SA 4EG5A 4HOYA 1X6IA 1XGKA 4O33A 3O7WA 3AR5A 4U7GA 4QZGA 5J2EA 1NL3A 1T5HX 5JSHA 4X65B 2EP7A 1CLUA 1T24A 2QTBA 3GU3A 4WI1A 3S6JA 4ZDWA 4PG7A 1R00A 1T43A 2W98A 3DEKA 3CPJB 3HO6A 4O2BF 5DSTA 4C0KA 4B6FA 2RSLA 1EFHA 1I0IA 3W3ZB 2VT7A 2HC9A 1H4QA 5BN4B 3DNPA 5EINA 1BS1A 2QAGB 2ILTA 3A7EA 2GAOA 3HV0A 2RGRA 1IFXA 2P2ZA 5LBUA 4CV1A 2OHJA 4QZVA 4HD8A 2CB9A 2IGBA 1I3NA 2R25B 5L1KA 1N6RA 3GT0A 5B3JA 1KWGA 3NIWA 1D1TA 3IQIX 2IHMA 4DMRA 1OTHA 3L82B 4S1VA 3PX2A 5EWEA 1U98A 1CJUC 4WXPA 5K3CA 4C0JA 2XQVA 1FF9A 5CK4A 5BVHA 2UZ1A 2Q9CA 4B9NA 3X2EA 4FOLA 4R16A 1N6KA 3ONVA 1R18A 4WAUA 3PC7A 1ZQRA 2KLBA 1G6KA 1HDRA 4ECAA 1VPEA 5KOJA 5F2EA 3F6RA 3FJYA 4WEQA 1SCAA 4WY5A 5EJAA 5EWLB 3HYSA 3KSZO 4DIBA 4DIUA 1OCEA 2XWJI 1ZJZA 1QGYA 2PLRA 3IYLW 2FR8C 4M1YA 1XLWA 3KCQA 1I94B 1T26A 5J0QA 4Q4LA 3EXIB 4MR9A 2R5FA 4RDXA 4FWBA 5KNIA 4CUJA 5AXAA 1KSHA 4C6TB 5BNTA 4Y18A 3BZWA 3DPIA 4A6PA 4Q1AA 5ICEA 5KTRA 3DMGA 4Z7NB 2XE6A 4KITB 3U44A 5TEWA 4QYIB 4CKBB 5C35A 1OLSA 1E9RA 2Y2UA 2W9AA 4INPA 1HFEL 4FK8A 1G18A 1T36B 3GRKA 4DL4A 2EH9A 4O2LA 3LWDA 4EOGA 1WA5A 2IZ0A 3OCVA 3USES 1MSWD 3NVAA 3OVMA 5AUNB 3A32A 3E9YA 4V1CI 3K1YA 2PZMA 2QVYX 5BWNA 5FWNA 2B4QA 2F4NA 1JWBB 4QEKA 1E6MA 1NK7A 5F2OA 1H8HA 3AINA 1M7GA 3RF6A 2R6JA 4N41A 2QMOA 1JU4A 8OHMA 2A30A 5K03A 3KLMX 1Y98A 5F3XB 1MNQA 4UARA 5AYVA 5J5AA 3TSCA 5G0UA 3KX2A 1UBJS 1USUA 5DBOA 2P9BA 4X7RA 2DMRA 2IEAA 2ACWA 4RLFA 4KMOB 3NORA 1IHPA 1CWUA 3PWTA 4NPCA 2KIWA 1Z6XA 2NRXA 1BVUA 1TT5B 2Y1OA 2Z4RA 2G83A 4AO6A 1LD3A 1THMA 1VKJA 2EX1A 2J6BA 2W8LA 2Q2VA 3I8OA 4LEIA 5EP4A 4V1CA 1XD2A 1N36B 3EA0A 2JMGA 4LZDA 1U9ZA 2EZUA 4NK5A 5KZMB 3W7BA 3R8FA 1WOMA 2CLIB 3NRBA 1MENA 1Z2AA 4RM2A 4QM7A 4YP7A 3R9WA 1CZHA 4Q45A 1F7VA 1ZRSA 1DEAA 4QHTA 3LP6A 5BVHB 4O5EA 4EIWA 1D5CA 4HUTA 1E1DA 4D9NA 1WF3A 3UAVA 4QM6A 4RNOA 2Z5LA 3IR6A 1HKHA 2WC1A 3PGJA 5SV2A 4CLDA 5LP6F 8ADHA 2C4HA 2XUZA 1I33A 5DI3B 3V8RA 2KEYA 2FSIA 3DBHA 3SQLA 5E79U 5KYTA 3I9JA 2GRAA 3AZPA 4GRIA 1WYGA 1C81A 1GKYA 3H5WA 2P2YA 2HH9A 5BN5B 3SFVA 4BLSA 4UB6U 3GIMA 2WD8A 3QKRB 4QFBA 3WLKX 4CCYA 3H0KA 1T9GR 3LIPA 3UA4A 4NS1A 1CUKA 2V96A 1F0NA 5CNIA 1NBWB 1CRLA 4ND2A 2V97A 4FFMA 4W9MC 2OG2A 4EY5A 3U9SA 3AHEA 4EY7A 3N39C 3K0AB 4WLNA 5EXTA 1V1RB 2K89A 1GA6A 3ELYA 4L4RA 1KEEB 1T35A 4MJLA 4V0SA 1VPDA 4LZJA 2PU7A 4BU0A 2O1SA 4GKJB 5CEHA 2O8FB 3I32A 4BCBA 2DP4E 3KKQA 5B12A 3ALRA 1UP7A 2YRXA 1U45A 1VPVA 2GZHA 1A4IA 5KB3A 3RJ9A 1DAFA 4G4IA 3IG8A 2LKDA 1PL6A 2BV3A 4BUCA 1Z6QA 4FI3C 3AP3A 2UVVA 1ULHA 4ACAA 1IHXA 5L9XA 4RAOA 1S8AA 2VA9A 3NBXX 1HDZA 2C5EA 3Q7QA 5HWSA 4N8DA 5C0YA 2HHWA 4K9MA 4L50A 3ZWXA 2GN2A 2QZ9A 3E7XA 3PYMA 4U5XA 3HVKA 4TYYA 2Q49A 3MGKA 4JS0A 3UT5B 4J2TA 4A8TA 3D0RA 1L7AA 2QOEA 4Z51A 1U5BA 1ATZA 3O03A 1SXJB 3JW8A 4Q5IA 3SF8B 2P4EA 3B6IA 3GZTB 3ANNA 3PNQA 3QFSA 4HGRA 4L3WA 5J0SA 7ICNA 1QAMA 4WNCA 3UH0A 3COJA 2VWQA 3ILSA 2X3FA 1NLYA 1DBWA 1PL8A 1ZXXA 1P19A 4PX3A 4G1BA 1CVLA 1BWPA 2PKWA 4F5YA 1DKNA 3MUEA 4BEVA 4RORA 4B9VA 3SKXA 4KLAA 4OK5A 3D2SA 4QOEA 4OLAA 5K2MA 4YMMA 2ZVPX 4H4DA 2VSFA 3AUXA 3G13A 3EXAA 2PWAA 1ZJ4A 1SRQA 2A1JA 2A5LA 5LQAA 5JAOA 1P81A 4P3XA 1UJCA 2JFFA 3H5VA 5FCDA 3BWMA 2ODQA 3RVNA 3FPGA 2FP4A 1DRKA 1OVMA 2ABWA 4EBDA 2QGFA 2X4GA 2X77A 3C16C 3L8EA 1DO2A 4JZYA 4UHHA 2Q3BA 1P9RA 2NU6B 2WJIA 3JAWB 2QN8A 2V3VA 3AEUB 2HZ7A 4YGXB 5KFYA 2GRJA 4NU6A 5B55A 4JWNA 4LS3A 5IVHA 1HEIA 4RNCA 4DQUA 2FWRA 3MAGA 5KTNA 4MYTA 2HHCA 3W06A 4R1PA 3VI3B 4B7CA 1CULC 4UBCA 5EMHA 4FYMA 4G5OA 1EGAA 4ZODA 2O2HA 2VUHB 3VNRA 4BECA 4B3FX 5C52B 5BSTA 3SBDA 1LDEA 1T3TA 2GKOA 3TZKA 3D3QA 3VHXB 3MW8A 1YDEA 1ZL2A 2A1IA 3IDZA 3LLCA 1GNVA 5KFPA 2IY8A 3GJ8A 2GJKA 1M76A 3HDTA 5AVQA 5BY2A 2V7EA 2VL7A 5JMWA 3TLJA 1GT6A 4D74A 1E9CA 3VR2D 5DO9A 2ZTUA 3ZE9A 3RIEA 1X7ZB 2LPEA 2HW8A 1ZCFA 2CD7A 1MC4A 3RJFA 3I6YA 4OTZA 1GEGA 4B9MA 4G65A 3PSFA 4KNVA 3R7WB 4EVQA 4JKYA 1E6UA 4GPBA 4CM8A 1IB0A 1NMZA 4WKNA 2Z8ZA 1AN0A 3TW6A 5ARCA 1ISFA 4KLNA 1G5HA 1G8PA 5DNDA 5KHAA 5CFRA 4KWIA 5CB6A 1QHXA 4I2DA 2H5JA 3AUYA 1NNLA 2ZIVB 3MSCA 4X62B 3BCRA 2IQ5A 5AXCA 3P94A 2ZYDA 1QAQA 2DPYA 4P4OA 4TSFA 1JTFA 2BHRA 5EGSA 2O54A 2OORC 2Z1NA 4FNAA 5IJ9A 4OP3A 2Q5EA 5DG8A 1RS0A 2R47A 3E5MA 3KP1A 2VK4A 2QGNA 4Q48A 5CH3A 2YZKA 3GNQA 2FK7A 4GUDA 5EJFA 5DP2A 1DBVO 1LY1A 3HBJA 3VVCA 3NPMA 4KQCA 4O59O 1UXGA 3U7EB 3PSTA 2QA5A 2QTAA 1HH4A 4QZDA 5IYZB 4M88A 4DHWA 3A2MA 2YNMD 4R54A 1OV6A 1R5NA 3T7SA 1ISMA 5K4HA 2RFLA 2QYHA 3IUQA 4PAGA 4EZIA 1W0KD 1H6CA 2OSVA 4CG0A 3EIUA 2ODAA 3L01A 1JW9B 2DF4B 3WLRA 5CVVA 1GKKA 5J2GA 1HI9A 1SG9A 5DNYB 4IX1A 3RJJA 2HIHA 1RI5A 2ANBA 1QHHB 3H1AA 1MVLA 3MMXA 2K8AA 1VL6A 2NP6A 3FFBA 2IBTA 1RCFA 2YWCA 2PG3A 1YE3A 5J0XA 2BP7A 2I8AA 1N1GA 5I6DA 2K2WA 4P32A 5JXJA 2C2ZA 1ACJA 4XYGA 1BFUA 2WWFA 4HPWA 4JJZA 2X8JA 1O4VA 1RP1A 4CI9A 1XWLA 2QRJA 3MUFA 5AVWA 4ZQGA 1BJRE 7ICJA 1AF7A 4NABA 3NX4A 3HJBA 4AICA 1QQBA 2CPRA 3N2KB 4HVAA 1SU8A 5FWAA 5T4BA 4BBAA 5KYXB 3AR6A 4DV4B 4BLUA 2XT6A 5F98A 4TWZA 4MWBA 3VHXA 2YIMA 1SULA 3O0FA 3ZE8A 4MV5A 3KXPA 3RRXA 4RVHA 3WR5A 2VNAA 1WXGA 3IG5A 4BO4A 5J63A 5BPFA 1O0BA 3H0EA 3HZHA 2X19A 3OTIA 4UBLA 4J9KA 1OA0A 1Q17A 2P4HX 1E1NA 3AVWA 4JNCA 2PANA 1UJMA 4XM0A 4FBTA 4RY2A 4NAVA 3L7NA 4BC1A 4QW9A 5ALSA 4OMUA 3JQBA 1FUEA 3AONB 2KFZA 2PN1A 1VHDA 3EEFA 3T7DA 4Y2SA 1H22A 2PNFA 4WINA 5HFNA 3ZV5A 3WBJA 3PCTA 4K6OA 1T6NA 1FRNA 4X9XA 4JN6B 4PPGA 1GPLA 4QIHA 4KR0A 4Q44A 2QYOA 3K05A 2V3CC 2HA5A 2XAUA 4LCEA 2J1LA 4TYWA 2A7QA 5TPZD 2CFOA 4KLZA 4UXIA 1OILA 3R9XA 3ROQA 3EUAA 3G89A 3O1JC 1AT1A 1V9CA 2BBWA 2OYCA 4DEVA 1NNUA 5KFFA 2O50A 4A6XA 4MUEA 2F67A 2Y1JA 1VZ3A 2FSVA 2PFGA 3CCBA 3ISVA 4DL3A 2FFJA 4RSGA 1I10A 1SXJE 3BJRA 1J9EA 3FWZA 4MR7A 2HA7A 5U4QA 4C43A 3PJRA 1JKIA 4OO1J 4MDEA 5CAEB 1VTKA 5ELLA 5B64A 3CURA 4JLSA 1JAXA 2ECOA 5FOVA 3V6JA 1KNQA 3DL7A 1FYXA 2FUKA 2DPXA 2H1CA 1NM5A 2AJ8A 3X3HA 4F2PA 3LHFA 1KYTA 2P9YA 4RD2A 4TS3A 3WMWA 5DIFA 3Q8QB 9ICHA 2WUWE 4M0FA 3U3ZA 4Z4EA 2PKQO 1CUDA 3IKJA 4F97A 3F5MA 3W3AA 4AUNA 1UODA 3OPYB 3PC8C 1FUKA 2NT4A 4X95A 2EG5A 4D9JA 1XJWA 2XCTB 2IDJA 4NBTA 2PY6A 1R0SA 2IMWP 1HE5A 4JBGA 1X1AA 4NH4A 2IQIA 1ES9A 3L7JA 3T8YA 4IJWA 3UJAA 4YCMA 1RG6A 3I72A 4F8RA 5LP6B 3RKSA 2Q41A 3E2IA 4Y6SA 4BNFA 3BGDA 3PVXA 1UBOS 1TCBA 3L7DA 4G86A 4EJSB 1Z3IX 2HPZA 1PGPA 5KTSA 2AR0A 4PZCA 2YMMA 1EAYA 1M6VB 4D4JA 4LBYA 1TM1E 2D59A 3RH6A 3L4BA 4CM4B 4AYBF 1BJTA 1YBFA 1R6BX 3KOYA 4IRXA 5A6SB 1TK0A 1IATA 4DSEA 1RXCA 4GKVA 2C04A 4HX9A 3T12A 4DV6B 3KKOA 4GU5A 2MSLA 4YV7A 4W8HA 3MK31 3KPYA 4DLUA 2E8PA 1LSJA 4XB6B 1JXQA 4OI1A 2RJOA 4X00A 2AK2A 4PGYA 1V5GA 3RK1A 5GTIU 3JPQA 1XNGA 2BFEB 3N8DA 2YCLA 2OCEA 4IYJA 4LTNA 3PQ8A 4AY2A 1SBZA 1NFQA 1HSZA 3HM2A 3L6DA 3EPRA 3HEBA 3PQ4A 5JLAA 4GS5A 4CIVA 4JUZA 2DF8A 4R05A 3TOVA 5JAUA 1Q1GA 3B6ZA 2NO9A 3KU1A 1PUXA 3BXZA 1WHTA 3W5DA 2XGJA 2PJZA 3PC3A 1LTKA 1TEZA 2YV5A 3KZKA 3OZUA 2FW8A 3KLBA 3ZWAA 1WV1A 1N25A 2ZTHA 4TQRA 1MQAA 3GEDA 4B4WA 1EXVA 3PTAA 1X8LA 1QRUA 3C43A 3A05A 2XF8A 4DTCA 4GH5A 4MYRA 4JGBA 5SYNA 1C9JA 3RUDA 4BNLA 1QPZA 3D3JA 3E9EA 4HGZA 1SBCA 2Y92A 4GL2A 3LWLA 1ZSYA 5EKUA 1HYEA 1UBHS 2JFGA 2JJ2A 4ITUA 4JLKA 3LHDA 1W8DA 3D8UA 3Q6MA 4ETWA 1S3SA 3GUHA 2VRBA 3JS5A 1H4VB 3H3FA 4N0PA 5KNDA 4KDFA 4R51A 1UOQA 1Y3CE 4LTDA 3L0BA 4AWBA 3W34A 1JXLA 1G6Q1 5C5DA 5M34A 3WS7A 1UBGA 3BKWA 4MR8B 3UGJA 3WY9A 1CZLA 1EM8B 3NKVA 3SEFA 4LMAA 4CT5A 1D1QA 3G5UA 4S1PA 3S2EA 4EB0A 4ARSA 1Y8QB 3B6KA 2DY0A 3GUYA 4WE3A 3MVEA 2X2OA 3TKLA 3NYRA 2RD2A 2ZPTX 2R6FA 4ARZB 3EW9A 3BK2A 3HKEB 3CLKA 4X90A 4X97A 2X7XA 3OQ1A 1VLHA 3UAOA 1JMKC 2BQUA 1G2PA 2HWWA 1O77A 2XY6A 1NF9A 1CJKC 1HK7A 1UEXC 1QDEA 1CP2A 3PU6A 2IDMA 1H69A 4G9EA 3R7FA 2AOTB 2XE7A 2MINA 5FYQA 1B2RA 5CCXA 4RKYA 2PRSA 2WSYB 1GQQA 1D8LA 2VQ6A 1H4TA 4YFVA 1JAIA 1PJCA 2W4QA 2Q4DA 1W59A 2B2CA 3FYUB 4I3GA 5B7NA 3NIFB 1NQ5A 1F8YA 3P0RA 4A73A 8ABPA 1COWA 3DUFA 2KE7A 3CO5A 1SVWA 4WBNB 4ZVOA 2HRZA 1RD4A 1SIJA 3L4PA 3I5XA 2H8GA 4P0QB 1DC7A 4IHKA 5EKXA 3GQBA 2A5YB 3M5WA 1E2PA 5BXQC 1GAEO 5D51S 3DDWA 4BXOA 4MWOA 5D3MA 4DV1B 3AVXA 1QZUA 4ABTA 1XYYA 4P84A 2R87A 4BC0A 2W8BB 4F5PA 3QJ5A 4AC9A 2WUVA 1U48A 4X91A 2PGJA 1TDJA 1QF6A 2KW5A 1UKEA 3GLIA 4HBZA 3C3KA 3QOXA 2XW6A 5BN1A 3C6YA 1GPBA 4NOJA 1OLUB 1XHFA 3HKZC 2QB5A 3BB4A 2AYZA 3DJYA 3JWGA 4OGFA 4F45A 1LF0A 2IYUA 3PC2A 1X1EA 3WJ7A 5AQ1A 2DBRA 1ZONA 3GH3A 2QP9X 3DQQA 3ZS9A 4KPYA 5AT1A 1FZQA 2XBMA 1S89A 4S2EA 2ADMA 4NV0A 3GFBA 4JQZA 1FBNA 1RZ3A 2VEDA 3RODA 1IXZA 3KQLA 4KBGA 1ZO8A 1ZBDA 3NKLA 3ETDA 1DAGA 3V6LA 1MX5A 1OX4B 2REQB 3DEZA 4NECA 3A6GA 1HEKA 5J40A 5KNBD 4DCMA 3ON5A 3P45A 5I7HA 3IEVA 4UM9B 3VC7A 2J85A 2XE4A 1ZLXA 3CRW1 5AW9A 1XAIA 3HA2A 4LW8A 2Y4OA 4MMZB 4A1FA 1Z56C 4DNPA 5JW6A 1N34B 4XE5A 4B3CA 1ZR2A 4FZJA 1OROA 4MUNA 3X1DA 5BWLA 1SIOA 1VJ5A 3RJHA 2ZE6A 4TKVA 1C5KA 3RC9A 5JOQA 1JVBA 1NZJA 2QTCA 3N2LA 2PGXA 2WF8A 3FYHA 1FNCA 3PQ7A 4AJHA 1N7HA 1KKXA 1UBFA 4DDUA 1J2NA 4JC5A 1SOVA 4YRFA 1SKMA 3LP5A 1E3DA 1QV7A 3MCTA 1XN4A 4Q3DA 4B83A 5AVOA 5K8CA 2H59A 5ELXA 3U1BA 2WKQA 3SQIA 1W36C 1D9FA 1O6ZA 3L1KA 3TNJA 5A4KA 3NALA 2OY0A 3UPTA 3P9XA 2OZLA 3T15A 2WB2A 2NU9A 5JADA 1JMYA 1NIPA 3PQDA 4FHCA 3QMVA 2KICA 1MIOA 1O96B 2H5IA 3RRJA 3VISA 3F3MA 4K03A 2MCFA 3W5JA 4W7SA 3D6MA 4HJRA 3STHA 1IRIA 4LHZA 3RUIA 1MEEA 1GV1A 1YBAA 3VU0A 4Q82A 3EXEA 3KQTA 4YRDA 1YRWA 3WJ2A 5K6AA 1EIWA 1B23P 1JX6A 4MEAA 1C8LA 5BMVA 4B4KA 1L3UA 1NI4B 4OHFA 2NUAB 1ORTA 3ZBQA 3R24A 7ICOA 2JLAA 2FYTA 3H9BA 4RUKA 2FJUA 4ZVPA 2QU8A 1EINA 1GSOA 4ENQA 2RHMA 1T3NA 1E0AA 1YDMA 2FEPA 3ZV6A 4DB2A 2FXIA 5H3CA 5FUBA 1CHNA 3UOWA 4QJ3A 2PH1A 2FN4A 2LWIA 4IGEA 1RYYA 4UC0A 1I2DA 5JASA 5BSVA 1EWQA 2IF2A 4YA6A 1DAIA 1GNLA 2C0PA 1KZYC 3HXTA 4EPVA 7ICFA 1APBA 4HGOA 5B6JA 3L0DA 4I4LA 3MAAC 2ZUWA 2H08A 1ZEMA 4W1QA 1LBHA 2RC5A 2I1QA 4AYXA 3WNDA 1A1SA 1J0DA 5EJ8A 2VZ8A 3HPRA 4J43A 1T5OA 1XDSA 2JFPA 2ONJA 3ZQJA 2BHLA 4YCDA 3AETA 3AFOA 1PEAA 1UJ5A 3MFQA 3MRVA 3O94A 4HDQB 4LZZA 5A3SA 5JS7A 5KFBA 4YJFB 3ZD9A 2R3SA 4PSAA 2BH9A 3DVQX 3PDHA 3PCXA 1I4OA 5CDGA 5HYVA 2KZMA 4KO4S 1NJ1A 1KFKB 4ZCRA 1SHZA 1ZVKA 4XWYA 4OQQA 4KXNA 1DRUA 2WWVD 2QD2A 4UCXA 1CUGA 3DP7A 1YA8A 2KHQA 3WSVA 1ZRNA 1IY8A 3FE2A 3PHJA 4L5JA 1ZQUA 1PVQA 3E82A 2DLCX 3BJEA 1NULA 3VU9B 1KSJA 4OKIA 2PFSA 3UCXA 5KFSA 3NIGB 4QVKA 2AFHE 1JAZA 1D07A 2F48A 3CONA 4QJ4A 2AHRA 3L1VA 1NZBA 4NMWA 2VKTA 2O2EA 4LKOA 3S2SA 5I5GA 1ST3A 4Y7DA 2F59A 4RACA 4JLOA 4RLQA 1BH2A 4X1KA 1WDWB 3OSUA 3OWHA 3UYLA 5ADUS 1MA7A 3B9JA 3HGMA 5CB1A 2F3UA 3LLSA 4S2UA 2H5XA 1M1NB 3EFBA 3EQZA 3DKVA 3NHSA 3EVZA 3MT7A 4KLHA 2QPLA 1T5IA 4MW6A 6PFKA 2JG3A 1JKMA 1IBSA 1BHO1 3GGJA 4FX5A 4N6NA 4RTSA 1ZJWA 3SLRA 1D9DA 5KJ6A 4A2WA 1KEVA 5EWFA 2XUJA 4EB8A 1UC5B 5IKPA 4IR1A 3CLRD 5FPSA 2BKEA 5KL1B 3GOQA 4IMJB 3RW9A 3ETCA 1GZ7A 4RHCA 1WCIA 4ZI5A 2ZUBA 3GVPA 3VTFA 2E9SA 1H2YA 4BNKA 1MPTA 3CEPB 1I30A 4XQ9A 1JIHA 2P5SA 4YQFA 4LPKA 4XIYA 5ERGB 2J0EA 4AY3A 2ZIWB 2VATA 1NGSA 1QDUA 1YS9A 2VN8A 1U7ZA 3DDUA 3PYLA 3SDBA 1QU2A 3CLHA 4TXJA 4UD6A 4C5CA 3W6UA 2YN4A 1OQAA 4K46A 4Q1EA 2DUNA 2VHCA 5FLEX 3DHWC 3WIVA 1TUIA 3K0HA 1JYFA 5GZ6A 4U7HA 4HVCA 1CERA 2BMAA 5CYFA 4TZKA 4JEHA 3RI3A 3S7ZA 1AK9A 4IXNA 4YIKA 3LQ2A 5CA0A 1KIAA 2EJBA 2Z9BA 1LSSA 3QE4A 4TWBA 2GT1A 4UVEA 5TEVA 3ZJVA 4U6PA 3RVDA 1P4JA 2AT1A 3EVTA 3JD0A 4KUHA 1W1UA 4GX5A 4CETA 5J43A 1T9GS 1JIXA 1OUMA 3LT2A 3EYWA 1T1EA 3B9BA 3OFVA 1ECPA 1LK0A 4LRTB 4P33A 3KVVA 3TM5A 3TSYA 1MABA 3BVPA 4FYJA 1NI4A 1M74A 2JS7A 2NUAA 2P11A 1BD4A 1WXQA 3GPLA 5B1HA 4Q3NA 1D2RA 4TLCA 3VBCA 2YVQA 3H2GA 2A9JA 4ZQHA 5B6PA 1XEFA 2R48A 3FUTA 3G9XA 1GFZA 3A37A 3WG9A 1MDBA 1MFPA 4V0LA 2PKYX 2XSZD 1DTWB 2VYND 1X7WB 4WOCA 3A27A 5BSFA 1NVBA 5GV7A 4OP2A 2YKGA 1GU7A 1T25A 4HATA 5AP9A 4TS9A 4D9MA 4MK4A 2O4UX 1AUOA 2ZS8A 3HUEA 1F3LA 3K9NA 5BSEA 2GNPA 1N3IA 2IEGA 2O7VA 3WKCA 4ZCMA 3OURA 1P6XA 2MMGA 2WWHA 3HO1A 1NJ5A 2XZOA 1PK3A 3QITA 3K2BA 3TQTA 4OUDB 5E1MA 3WDMA 1XO1A 3O4RA 3SAFA 1ZQAA 2GTIA 1UA1A 3WAJA 5LSAA 2VA3A 3L02A 1I6MA 2HJSA 2JATA 1ISRA 1Q1NA 2BFCB 2E4YA 4V03A 4UTXA 1Y4SA 3WGGA 3ZS8A 1NW8A 4FBGA 3MCZA 4DSJA 3W6NA 4K6HA 1GNRA 1V5FA 3A2NA 1OJ7A 2ZJYA 4DLLA 2ZTCA 4CUZA 3LWBA 4FB5A 3KZXA 1BH6A 3J7AC 1POWA 1PV4A 3KKEA 3GRAA 4KR9A 2FA9A 2O3SA 3IIEA 2DWOA 4NOLA 1D4OA 2VCYA 3AJDA 3IR7A 5A5FA 2OR3A 4BN0A 3KQKA 3VC2A 2X4IA 3E9CA 1J24A 3TL2A 4R9UC 5DTQA 2GJAA 1ZH2A 2QM8A 2JLBA 2C82A 1DQRA 3RH5A 4QLOA 1Y7HA 4ROSA 2H54A 4Y67A 4G0UA 4QBIA 2JHAA 4X1IB 3I6IA 2G70A 5DHQA 2PMFA 4BTLA 1RRCA 1QUFA 3IEXA 1QQ7A 1U2DC 1WWUA 1NBEA 3B78A 3EDMA 4BX8A 3UBMA 3NHWA 2D62A 1M1YB 4KLIA 3TX6A 3FHJA 2UUPA 1DOAA 8ICFA 1UMCB 1XZPA 3KXLA 4YRTA 1BNCA 2JDID 4CU2A 2G1PA 1JVSA 3QXXA 1XVUA 2H1WA 3VPXA 2GI4A 5TV2A 4ZT4A 2BHSA 2YHIB 4KVZA 2ZCUA 2EIXA 3PSPA 4Z86A 3B13B 4GP9A 5B58T 2C2EA 3ZGVA 1QRTA 2VZ9A 3PXCX 3HY6A 2X6RA 4JWKA 1PX2A 2IE8A 1G17A 1N1DA 2RG1A 4HDRB 3UV7A 1Z37A 1KQOA 3P9IA 4BVHA 4CLHA 3TF5A 5CEJA 3EXHC 3DMHA 4JAVC 4KFUA 4PIMA 4Y1RA 3TX2A 2Y27A 3VKVA 4XQEA 1EE9A 2F1JA 4GF5A 4HYKA 1YO6A 1WZEA 4KPUB 4QGFA 5HSGA 2YXEA 3M3PA 4Z54A 3BMXA 4DA4A 4X8LA 3ZDFA 4BWFB 5IHXA 4AJ1A 5CXSA 1KYVA 1RZTA 4C30A 4LYHA 2XXAB 5TY0A 5CA7A 1P8JA 1UZUA 2W2QA 1S2IA 5CT8A 4O3PA 2ERCA 3X2FA 2K8CB 3L9WA 2DBVO 1N4AA 4UM5A 5JAMA 1X9HA 4QYSA 3PO4A 1YJBA 2GLUA 1NVVR 2IF0A 2VHEA 2XHZA 4LJXA 1DXYA 2XOKA 1LKYB 3NQ41 4HAUA 1N5OX 1S8FA 4A36A 3QLTA 1W94A 1K3UB 3BT7A 1TZMA 3DLTA 1GUAA 3Q10A 4Y6GB 5F52A 1SUSA 3F6BX 2E4VA 3KS9A 2YHUA 5JJIA 4B9SA 2C4NA 3RJMA 2V6FA 5IAAA 3VTZA 2ZIVA 2W6QA 5CFMA 2C3UA 3WLFA 1YUMA 4TMFA 5KT4A 2C9MA 3JQFC 4JXKA 4YYEA 4BRUA 4PHCA 4EJ6A 2VDPB 1G59A 4JD5A 3V1LA 3ETNA 5DMHA 3DO8A 3GT4A 3OJOA 2NZYA 3ZY5A 1QG6A 3KNZA 5C4MA 1GKIA 3TJMA 4KQ1A 2JFBA 4Q3BA 1A5AB 2CMDA 3KQSA 1XKXA 3WGLA 1IXSB 3D7NA 5GJVC 5AIAA 3R8XA 4G0WA 4ZOQI 5AW7A 3E1SA 2BFWA 2IX9A 3L4SO 1X7ZA 3NJRA 4WTOA 4JI6B 4TTIA 5LQCA 3KZNA 1TQHA 1NVFA 3G85A 2CEKA 2EIHA 1EG2A 1Z4JA 1QYRA 4XRRA 1L1QA 1KP3A 5HCIA 3JWHA 2BPCA 3RAXA 2JGNA 2HO5A 3OQIA 5CDFA 4P53A 3DEEA 1OZHA 1SVMA 2YICA 4GVPA 5EHXA 2UUCB 4O1HA 4KRFA 1JG6A 4DCTA 4X1YB 3V2HA 2X4DA 3ZU5A 5AJUA 3K0CC 4LFBB 3QGMA 2XF2A 3KJQA 3OZSA 4S12A 5HF5A 4YRNA 4YK7A 2Q5LA 2HLPA 4TVBA 2GEDA 5L3RA 3AK4A 2APJA 2ESEA 2B92A 3QPWA 3L7CA 3KZVA 3EGDB 4PFQA 5DK6A 4MA5A 1KHTA 4PRYA 1GZ5A 3IUJA 3SIWA 1TMGE 4OEHA 2FEOA 2G06A 1TM7E 1F17A 1S1MA 3LLMA 1M0WA 3MINB 2KP7A 1EWTA 4GZ5A 4NBSA 4YJGB 1AG9A 4R71A 2QU7A 5KG6A 2PZJA 1GKUB 1FYDA 1NBIA 5I7WA 1SO8A 3HWRA 2HBZA 3TLEA 4DY6A 1RFGE 2AJQA 1TMKA 1E6WA 4RPJA 3WK4A 1XS9D 2QJFA 3IQDB 1GO2A 3CUYA 4J0CA 4HL6A 2FN3A 5E7IA 2A1JB 2G7MC 3MTGA 4GOMD 1PFUA 2CJWA 4X3OA 3FKSA 1JIQA 1DZIA 2R8XA 1G98A 3BXOA 5DCYA 5EMLA 5CA1F 4RQ2A 4HH4A 4MARA 3QZ7A 5C34B 1P75A 5K0TA 3KD2A 4M0EA 3IVMA 1K68A 4GNRA 2WIDA 3LKZA 4KO8A 1N6NA 2H4YA 1NUUA 3LLVA 3NB0A 3ADBA 2ISSD 5FDFA 3WB2A 3DMTC 4AVYA 3EEQA 4EEZA 3UK0A 5JAPA 3GG9A 3G68A 2IYPA 4NFHA 3U1TA 3B51X 3EXEB 1GTZA 4A23A 4M9LA 1NI5A 4WECA 4GLOA 4BFWA 1RM5A 1L7MA 3BJYA 4QZAA 1WUJS 5I9MA 1WG8A 2VZ0A 7ABPA 3CMMA 1Z0DA 1P5ZB 1Y89A 4JYCA 2BI7A 4LZOA 4NOMA 4OLHA 1YA4A 3UF0A 1G5TA 3NDBB 1W6RA 4GKKB 1Z5WA 1L7BA 2CN1A 1TC2A 1WQ4A 4Q24A 3EASA 4P3KA 3RQIA 2BCGY 4HFNA 4MR7B 4LGCA 2Y1EA 3CNBA 1UK7A 2I2BA 2IYSA 3E4CA 1NVUQ 3TTYA 1ZK0A 2H3ZA 3OJ0A 4JHXA 5IWCA 2GB4A 4J1NA 3RWBA 1Z6GA 4R8MA 1U0OC 1N2CB 2ICAA 3PJGA 2RHOA 3FVRA 3ZV3A 2PU5A 4RESA 3X1JA 3B1VA 1U3CA 4YXWA 2WDPA 4Z4IA 4F2RA 4JUDX 5DM70 1YA6A 3ZXSA 5BSUA 3BHIA 4UASA 4W5HA 3ZDYB 3FLAA 1E3MA 5KQMA 1U94A 1RXEA 3AV0B 4TXHA 5BQXA 2GJSA 4Q7QA 2O3UA 3CVVA 3G6YA 3LBAA 3UMMA 2C2KA 3TPCA 1UOEA 2GD0A 4BO1A 1GXSB 2AOWA 1W5SA 3A1VA 1P2GA 2X9QA 4HQNA 3VHQA 4F4JA 2B8WA 2A9VA 4LG1A 1AH2A 3ZYZA 3OLCX 3QXGA 3OPXA 1QIEA 3HKCA 1H8EA 1CFJA 2QP4A 3CIOA 4L9AA 1J39A 1FFGA 1RWBA 5DLYA 5EP3A 5FUWA 4II2A 3Q5GA 4ALKA 1ZYQA 3RVKA 2JFWA 3C0KA 1CQZA 4LSZA 4OX9Y 4L5YA 4C4RA 2LCFA 4FBLA 1ACLA 3BUSA 2WHXA 3ISDA 1MJFA 4TV8B 1SKUA 4D3YA 5G5HA 3E2MA 3K94A 4G36A 4XX1A 3VM6A 1QYVA 1KBOA 4WOBA 2I1WA 4DG5A 4QDZA 4AZTA 5E7MA 1GCOA 3EVFA 3QEJA 1PR0A 4OQMA 4LA4A 5FTWA 1ONPA 1LC0A 2TYSB 3ZE2B 5BSKA 3IE1A 1EK6A 3SR4A 1DDOA 4Q4JA 3KXKA 5E6UB 3DFFA 2P5YA 1XD2B 5BUZA 3D8SA 2ZRKA 2AI3A 3L6CA 6ADHA 4F4WA 1TL7C 2MUTA 1TAUA 1E8NA 3I34X 1A95A 4IP0A 1R6XA 1S4QA 3FGZA 3IP7A 3NHAA 3SBOA 5BYAA 4KDCA 5JSUA 1LTQA 1QFXA 1ZIXA 2Q5QA 2Z6UA 4PH5A 1J0AA 4P3PA 3FVVA 3KR9A 3UAYA 2P90A 1ZXBA 3OBIA 1MC1A 5JD6A 1Q74A 1BE1A 4JV1A 4M86A 2QDKA 3VPFA 4MS4A 1TFUA 1WKBA 3IHLA 3JVDA 3RFTA 3UIEA 3FOEC 3DKIA 1WB5A 4N39A 1ZETA 3T79A 1XNHA 4XPIA 4AJKA 4QUBA 2H3VA 4I46A 3FIUA 1M34A 1J2TA 5EXPA 3DLCA 2GPTA 3Q98A 1EE2A 5HMMA 4HQRA 1Z4NA 2WZCA 5KFTA 2XRZA 3DUWA 5IU6A 2CUNA 1E7RA 4IF6A 4OBBA 3LYHA 2Q27A 1PT8A 5CA1B 5JDIA 6ABPA 2GEVA 1MHPA 1FDSA 2PL9A 3N2GA 3NM6B 8ICBA 5L51A 1GGMA 5JNSA 1OLSB 2QRMA 2EF0A 2B6GA 1SIUA 3QFHA 3K1TA 4X7BA 1NQTA 1QC5B 4Y6LA 5AKLA 2NQTA 3THYA 2ODBA 4K28A 2AN5A 3BA6A 2BCRA 3L5OA 4QTYA 3IEUA 4CQLA 2ZJAA 1WU8A 3U3DA 1D7OA 4YMUA 2D1TA 3IIKA 3ISCA 2ATIA 1K7CA 3SG0A 4R2HA 5A04A 1EQAA 4MV0A 5G4KB 2X9NA 1S7CA 4I5FA 2RB5A 4GSKA 3Q9NA 4YREA 3GFKB 4JU8A 4L5BA 4N49A 4XW2A 2GK7A 1M2EA 4C4ZA 4E4TA 4ZIRB 3BMNA 4E7OA 2CT8A 3TECE 2JCYA 4C0SA 3DONA 3OT1B 1ML3A 4GP6A 4MLCA 3U7JA 3EEOA 3QLVA 2C1XA 4U2KA 3JYHA 3LGAA 3DNMA 3QSGA 1Y0BA 1S3GA 3DV9A 3AFHA 4HJXA 3TKAA 1MP0A 3NEPX 3ABOB 1JP7A 4OYHA 3ZVLA 3DO6A 4A7PA 1A27A 3AF1A 1XUOA 1CD5A 1G63A 1FMLA 1XQ9A 2FFAA 3LO5A 2F6RA 3D7RA 4P3NA 2C2YA 5LXTF 3BMOB 3RVBA 4R01A 5IJAA 2WM2A 2XJ4A 1G7TA 2GBGA 3TFSA 2JIOA 2WJJA 3OZAA 5ENDA 2A1AA 4DJFC 2D0IA 5KG7A 4HEA1 1VL5A 3X43A 5COQA 5B7QA 5L3QA 2DTEA 2WU8A 1PR5A 3CZ4A 3IUEA 1TYEB 2OCXA 4GLJA 4IJVA 4O4IA 1ZQ9A 4LOLA 4PYIA 3ZTTA 5IJ0B 5EUBA 1LQUA 2Z1DA 3I4LA 2RDIA 4WFIA 2F1RA 3BXEA 4DSTA 6YASA 1JEQA 5LLTA 2QN2A 2BFNA 2ZSKA 1KTQA 1M5RA 2NU7A 1ZVVA 1F4LA 3I5MA 3T3IA 4ER5A 3F6YA 3FIJA 3K9LA 4GGMX 2KKVA 1E9SA 1E6CA 1LXCA 3OHSX 3R3ZA 4CV2A 4ZFNA 4QC2A 3EOBI 1RRKA 2Z2KA 3I5YA 3QG5A 2DUUA 2HHQA 1PBTA 4YD1A 1ZD8A 2FWBA 2V74B 3W77A 5JLJA 1J5EB 9ICWA 5A6SA 4XWGA 3ED5A 1DHRA 2UVRA 2PD3A 2VJBA 4KFRA 2Z5GA 4XVCA 1N61A 1FNBA 4JJ6A 4M8NE 2GZDA 2OUKA 1VP9A 4LF8B 1U1IA 1TUEA 3OO0A 3N76A 4QHYA 4M1OA 1VRVA 1E1RA 2G9VA 2MYPA 3OLYA 5ILOA 3OCYA 4HSGA 5JJ5A 3N8NA 3ZGNA 4G1FA 4CEJB 2H3FA 1P44A 1KRWA 2GQ0A 1F3OA 1R1DA 4XXHA 4BGUA 2G1AA 3QU2A 2V5VA 1WULS 1ETHA 1ZN7A 1WD7A 3NP9A 4MUAA 4TLAA 2CNLA 4TUSA 2ZTDA 5HRAA 1JDSA 3K6SA 3RTEA 3FPSA 3ABQB 4AYTA 4E70A 1KJ9A 3O7MA 3ONNA 4OXQA 2PO5A 4ZJZA 4KXYA 4DZRA 1F14A 1JHOA 1O6FA 1DV2A 3DOEA 1XC9A 1QOPB 1P5JA 3CH6A 1GDTA 3TG8A 1JVNA 3OTQA 1TYDE 4XGNA 5T3UA 2WBLC 3U7IA 4YMSA 4D9HA 1R4NB 4PGHA 3BWDD 3NOQA 1W0JA 4UQOA 1YFJA 2JR5A 1VLZA 4BFLA 4GOLD 1YWGO 2GZ2A 2QRKA 2YZGA 2M9NA 2C2MA 5GONB 3PV8A 1HE1C 4QQRA 2H31A 3IQHX 1PLJA 4K2AA 4R1SA 4XR4A 4KYVA 1ZI6A 1B0XA 1ACMA 1P73A 5J4LA 2P3QA 1F44A 4OHUA 5EOZA 3A04A 2OGWA 1UPUA 4DQQA 3O82A 3SQMA 5FHQA 1R5OA 3FB1A 4IJUA 2X13A 2FKAA 3EGOA 4RQ8A 5J3JA 4NCBA 3U49A 1KQGA 2FWNA 1ECFA 2AXQA 2YJNA 4RV5A 1CY8A 2C4WA 2GZMA 2Q0HA 1O6BA 3GXOA 3HACA 4L76A 2E82A 3ILXA 3H16A 1PK7A 3OKPA 5P8WA 4IQFA 4N0MA 3ZD7A 4PN3A 4Y8VA 4DS4A 1GCAA 2QX7A 1U9CA 3WIEA 3ICEA 4GBED 4MS1A 4RZQA 3LVBA 1ZM4A 2V6MA 1QCCA 4TV9F 4WLOA 2YXDA 4X41A 2OXTA 3EVGA 5K01A 4M1KA 1JR2A 3I9KA 4RPHA 1V1MA 3Q9SA 3IMFA 2H4HA 4L0DA 3ZD6A 2AMFA 1TKDA 4CTMA 1A2QA 1KE2A 2BJWA 2J3HA 4YPVA 1I36A 3T5BA 3WGQA 5I45A 3A36A 5HG0A 3KQUA 4B9EA 4LSMA 5HA5A 2D00A 2EEPA 1RLUA 1X9GA 1XAJA 1YI1A 2FDXA 4EBCA 4WBSA 2Z95A 4CTKA 4EYOA 2HWKA 3D02A 3F5QA 4W63A 2VDWA 3WDSA 1FXSA 4J6EA 4RQTA 5KAFU 1PJ2A 2DE0X 3PD7A 4IAOA 2HB6A 2KX7A 4ME6A 3ZWNA 3OIYA 2DEUA 4Z1MA 4CYMA 3CKMA 2A0XA 4ZXPA 4DPKA 4Z1OA 5I5EA 2WRZA 3A1FA 1N7GA 2NPFA 1ORVA 1NXWA 5EE5B 2PD6A 2J41A 3GC6A 4GMGA 5IN5A 2CLFB 1QYWA 2R7KA 1VI2A 1XQVA 5BWMA 4ZT6A 2WD9A 4ND1A 4R69A 3HQ4O 2K4PA 3RB3A 3L07A 3FC4A 3OQOA 4HRXA 3MWFA 1RAHA 1Y3AA 2W83A 4I8DA 4DLTA 2IS1A 3PNPA 2PFOA 1OT5A 1XZ8A 1YR2A 3I5UA 3T9DA 3CINA 3S7TA 4WVLA 4RD0A 2W9CB 4E6EA 2HJGA 5FOXA 2ZJ5A 2IYXA 2LM1A 3BD7A 5I9LA 2CKDA 4M0DA 3E3MA 1GQYA 4QZCA 3EXG2 4QAJA 5BUSA 3HKDB 5EL0A 2GZ3A 4R9SA 1K27A 2CHFA 3ABIA 2WUFA 3LVRE 3O95A 3QFFA 4M21A 1YQQA 1CRZA 3D9QX 4LHXA 3AR8A 3IMKA 2SCUA 3FAZA 3MEQA 3P8ZA 4TTAA 5IDYA 1I32A 3RO7A 4C4PA 2VQEB 1C3VA 3IELA 4LNUB 3WRXA 3F9RA 3RRFA 3LC0A 1L5FA 2I9PA 2JKZA 1SCBA 2C5HA 5HMLA 4GL4A 4U6NA 4UDXX 5D1HA 3D2BA 3N53A 5EXSA 4G0XA 1TVKB 2WTXA 3TR0A 1V9SA 1YZVA 2CSUA 2EKBA 2MSEB 2NXCA 3DM9B 4S05A 3DD1A 2K87A 1NZPA 5K0FA 1J70A 4FDUA 3H4DA 1NVGA 5H70A 4UB5A 3FMFA 3FR8A 2D8AA 3Q72A 1SXQA 1M1UA 3M3HA 4DYDA 4ZYTA 2C5SA 3PC4A 1V37A 5KFLA 2Q6VA 1WWKA 4TLLB 5TQ2B 1XPRA 3GGGA 3BHMA 3I9LA 1Z5PA 3KAQA 4NENB 3WB1A 3ZCTA 5I7VA 4C29A 3BGVA 1CJTC 2OKCA 3KQPA 3UMBA 1B4DA 3NANA 3DTVD 3P9NA 4TUQA 1Y9DA 1M2KA 5C0OE 3ZX5A 2AIRA 1MA3A 3BERA 2PQ6A 2DVMA 5IFLA 3T5HA 3KJZA 3A25A 3BE5A 2ACEA 1LK5A 3LBHA 2DETA 1KVSA 5AESA 4C0ZA 1R6VA 1EWVA 2KQUA 4RU9A 1ECJA 1GQOA 1DJOA 2OD7A 4KC0A 4RMIA 3RRBA 4J9RA 1M7BA 2O6LA 4AFNA 1UFVA 4ECTA 2FQQA 3UHPA 3C74A 4BFYA 4LY9A 5IZCA 1NNSA 4DIMA 5KMGB 4LDPA 4JI0B 1UP4A 2YXBA 4W5JA 5HBRA 3F5EA 1ZHFA 3WTCA 2J3LA 5IMSA 2VBFA 2EW8A 3TEFA 2GYUA 5BPCA 1CXZA 3DKPA 1L4EA 1NVXQ 2B8TA 3MGBA 3EC1A 3HFJA 4JBLA 4JP2A 1EXNA 4OQDA 4DV5B 1Z63A 2A33A 4GZLA 4NU8X 2XKKA 2AD1A 2ZRFA 3HZZA 4DLKA 1XRNA 1E66A 4F6LA 4ZHQF 1ZQOA 4N76A 9MHTA 5SYAA 3QUCA 1DXHA 2QT9A 4HRAA 4FS2A 2ZKLA 2B4TO 3WJAA 2CLDX 5IPFA 3TIIA 4Y0VA 2HHSA 4L3OA 4ZZ0A 3DV0A 2VJMA 3H3XA 4QUGA 1PEYA 4BZQA 3I12A 4QU0A 2ES4A 4RFLA 2Q5OA 1XD8A 2E6UX 2HRQA 4FSDA 1L5GB 3TGLA 2ZYVX 1POXA 1U3TA 3KJNA 5DZSA 2HA3A 1J25A 3ONEA 1AROP 4PZ9A 5KTKA 2R8GA 1IN6A 3CNNA 4ZA2A 2IZ5A 1Y8AA 5IIOA 2PJDA 3CNHA 2XD4A 4II7A 4MVYA 2ZSFA 4MLDA 2EXXA 2LMRA 3PXXA 4MW2A 4C01A 2BTEA 1DDGA 1L0BA 3K1AA 4ZT5A 1VJGA 4BLQA 3SJAA 2PFQA 3Q5DA 3EG9A 1DAPA 5K8LA 4EGCB 3PHHA 4DWIA 4RLHA 4MI1A 3JRWA 3PFKA 1A4RA 2LRHA 3UO8B 3M4NA 3C8UA 3UATA 1WZNA 1I51A 5DLFA 1RVV1 2IHVA 1DUSA 3AHJA 4URVR 4OJ5A 1WUYA 2AJLI 3HKDA 5BSHA 1G5FA 3QXSA 4L5CA 1DJPA 3FCYA 2C9YA 1H2RS 1F2UA 1NAHA 4IEEA 4S3MA 4H16A 5FLKA 1N5KA 1JRLA 4MFFA 1PAUA 3JD3A 5BMVF 2CCKA 3GMIA 1LNQA 4ZO6A 2BCVA 1KS2A 3BSYA 3JZDA 4L2IA 4EDHA 3SZ2A 2AGOA 5C8DA 4DC0A 2GESA 1MVOA 2K2QB 3CHYA 3MOSA 3O8BA 1R4ZA 1CZOA 3DOJA 4N3AA 1TUBA 4Y98A 1CEXA 3UWPA 2HLNA 5LCXA 4KGVA 5CA0F 2BMVA 3WYNA 1L5KA 3JPPA 5FV7A 4NM1A 3VZCA 5KOYA 1W4ZA 3FPKA 5JANA 2HCJB 1ZD1A 2QXTA 1W36D 1AKTA 4IRMA 5BV0A 1KYZA 4KLJA 3G7SA 3RT1A 3RASA 4B3GA 2VDWB 3ZC3A 3MWKA 3TLZA 3H18A 4Z6FA 1I2BA 1RRFA 4M76B 4ZAZA 1HDEA 3RT9A 5IAOA 3SMQA 3H0RB 5G0WA 2LR0A 3VR4H 7ICIA 2WYUA 1HNWB 1N1MA 2QAJA 1U8ZA 2R6HA 4M1WA 4DG9A 2CHGA 3DBRB 3VR4A 3WLMA 2FPGB 2V4UA 4S1NA 4LXUA 1D03A 3G02A 4ADSG 4FLEA 1D3AA 5MFZA 3FMVA 3R2JA 5FOQA 2Q1UA 3UCFA 2GLEA 1II0A 4PW0A 5CB4B 2BFMA 4HDNB 3VU1A 2BTQA 1AV7A 2KE5A 2Z4SA 2GYWA 5JY6A 3RADC 2G5PA 2UYCA 1YHZA 3QYFA 2QKQA 1UK6A 1Y1LA 7ICUA 2XOEA 2YOFA 3TAHA 3W5UA 4C03A 1L8LA 1FDOA 1KI9A 2ZS9A 4CLXA 3QJGA 6Q21A 4PZLA 1V1JA 5KI6A 5KHLB 2XNJA 4X1OA 5E0KB 4MVJP 1J0CA 5A0VA 4XZ3A 4Q1CA 2PFKA 3AYZB 5ESDA 1EEHA 2Q4BA 3QA9A 3VO1A 5CPBA 4WERA 3RSCA 3LRPA 3V6MA 4URXR 2F62A 2W71A 3FI9A 2PMZF 5C7LO 1NX6A 3OIVA 3S1LA 2IU6A 4KN5A 4UHCA 3AUAA 4GVLA 4EB6A 4H1TA 3PIRA 4IL5A 4MGYR 3STVA 2IZ1A 1K6EA 3ITEA 1ODTC 2IZOA 3NFYA 1SHKA 2RHCA 2RHWA 4NTZA 2PK3A 3UXEA 1UPXA 2P6UA 4TXLA 1C4KA 3F6EX 1NW3A 5A62A 3DE2X 1R4NA 2FX5A 2XAAA 3VRHA 2ZUDA 2QVZX 4EFKA 5BYKA 1N77A 2JLYA 4EAAA 1BOOA 1OXTA 2D5IA 4GZ3A 3TQHA 4EQ6B 2BEUB 1TO1E 2BFBB 4IILA 3LBFA 4OXYA 2ZCJA 2XKBA 3LWNA 5F2NA 5KWSA 1IPFA 1FP4B 2IYVA 3FB4A 3N2ZB 1B1AA 4XX0B 4S0ZA 2C94A 3UUGA 5H4GA 5KOIA 3E58A 3MILA 1RPNA 1NLFA 1OC4A 5AK5A 1TYZA 3AR3A 4KPEC 4IMPA 2V0CA 3SSOA 1BPXA 1Z6PA 3KXIA 4C22A 3S27A 5KTQA 2NADA 5JI2E 5I9TA 1ADCA 3GN1A 3ZYCA 4QPPA 2OP0A 1PCXA 1NBHA 3W1VA 4PPFA 2SNIE 4DWOA 4D96A 4DVGA 2J59A 4NMLA 3BJMA 5DPMA 9ATCA 2HHHB 3LC2O 3U4MA 4XM2A 3GIJA 1J07A 3FHOA 3K9WA 4M8LA 4OFBA 2GMWA 1PR3A 1UMCA 1YRBA 2YCBA 1DXSA 2B0JA 3HV2A 3IE0A 3RH0A 2XYHA 4B81A 5CAEA 3EODA 2GCEA 3WOVA 4NG5A 3C1UA 1QHSA 3OLVA 1J5PA 1P61B 2DM6A 3IJEB 4FCWA 4R0NA 3RIYA 2C4TA 3QK7A 4OAPA 3QKSA 1KH3A 1T1GA 3NOXA 1LDBA 3GLSA 5JYEA 2YOGA 5DM4A 3UK7A 1ZA1A 1SIBE 1VPLA 2EBWA 3O26A 5LLSA 3O31A 4NBWA 1GTJ1 2J08A 3NBMA 3QKSB 4RD3A 2KBEA 3C2MA 3I30X 2O8BB 2R9VA 1X6JA 1DIRA 1CUAA 1GPUA 2FF5A 1O4WA 2ZTVA 3GGDA 4J7XA 4JL8A 4LJ7A 1U3FA 4TTVA 4UPDA 5GJCA 5L7YA 2I6XA 3ZHXA 3KTFA 4C07A 2P6NA 2OQ2A 1Y81A 8ICTA 2LZ0A 3T3PB 5JFTA 1P7ZA 1R0XA 3GMDA 4S1OA 2W6PA 4N6OA 3H5LA 1Y3HA 3GLFA 4N6GA 4FCTA 2QQGA 4RJ2A 1KI4A 3ZKAA 2CFIA 4EDFA 4ENPA 4QLBA 4OK6A 4HQFA 2M6LA 5J4YA 3L0CA 4TLMB 2XE8A 1TEHA 4U7WA 3OJUA 1MGPA 2OYSA 4IINA 1UBNA 4YBRA 4YQEA 3K8QA 4LV6A 1L1FA 3N2KA 3NVVA 3W2IA 1FS6A 1OXVA 2LW7A 2QI9C 5I47A 4YRSA 3CBQA 1JRPA 1DAKA 3RJIA 1NVEA 2EV9A 2GHQA 3C5VA 3R5SA 4MEJA 4X6LA 4DA8A 2BEVA 2I2WA 3QU7A 1NQAO 1DOQA 4LVUA 3MABA 1Y1PA 2VDRB 1SU7A 1WVMA 2JZCA 1NC1A 3C3JA 3S2ZA 2ZRLA 4DDVA 2XTNA 2PSHA 3IHKA 4HO1X 2P1RA 1ZMBA 1KL7A 1KN5A 1E7MA 1G8AA 4I9HA 4RA9A 3RYIB 4DANA 4B44A 2VNSA 4X45A 4UAUA 4PG8A 1XALA 4P58A 3FCSB 4D42A 2GASA 3CPHA 4NLBA 1AK2A 4KQ6A 5LB2A 2BCJQ 1Y8RB 1G7RA 1URJA 4R66A 2Y1IA 3RBEA 2J6UA 2FUEA 2GN6A 2IYLD 2J0VA 2P2DA 2RB4A 3KZOA 3LH5A 3OPQA 2HA2A 4RTKA 4NM2A 2JEGA 1YDFA 1IG3A 3ESDA 1UWLA 3ZZNA 2VYCA 4B3TB 4TMTA 2H17A 3F3SA 4G5XA 5CA0B 1ISIA 3H5NA 4DR7B 3KO8A 3AEKA 4NFSA 2G1KA 3OWXA 3UA3A 4ZCIA 2ZU6A 5B1IA 4YUWA 1GTRA 1VMDA 2ZBVA 5DGHA 3JQ8A 5ICCA 1EDDA 2JLSA 1K1SA 4WZ6A 1ZNYA 4B6JA 3JD4A 4HN9A 5ICGA 4LY3A 2FWAA 2VWHA 4P4PA 2IOQA 4ZGWA 4WKPA 1KEWA 2UVPA 3WIDA 3ZW7A 4TL6A 3QRWA 3HA7A 4YONB 2WT8A 2UKDA 1S97A 1Z13A 1JKFA 3PGKA 1PJSA 2VK2A 1B00A 2WABA 3E7DA 4MKHA 4QYMA 4OQZA 4IW3B 4TQSA 3RIHA 5KFMA 9ICCA 4X6XA 4HYEA 3ZI7A 4DMUB 2A0FA 2BD0A 2DFLA 5CVJA 2IUYA 2R8YA 3TQRA 1P6UA 4CT0A 3PEFA 5FPKA 1QLWA 3P9QA 1OI2A 1SC1A 5CFLA 3I42A 2G8NA 4LQ4A 2NSJA 2OGUA 2IH4A 4BWVA 5KVAA 4FMCB 4GX1A 1DWOA 3AOGA 4Q9LA 1NKEA 3BTSA 4J76A 4GC9A 3OC6A 4RV4A 4EO4A 2VT6A 3OSPA 2Y0EA 3G2NA 4K9SA 5JSZB 4DEXA 1XTTA 1G0OA 4NYMQ 5CB8A 1TCVA 1MV5A 3MA0A 4BQFA 1PEDA 1RZRA 1IEQA 4XIFA 4MQFB 1SXPA 5FQNA 1VJ1A 3GK3A 4OYLA 4Z7OB 5JNTA 2ALZA 4MW0A 5BT9A 3AETB 2C9ZA 1V8DA 2IRWA 3GYBA 2TMKA 1EFPB 4JSRA 4C0LA 4PSDA 4UDOA 1UAYA 3RTGA 4YWHA 5JZSA 1QU3A 3V1UA 3EMBA 3PUZA 2HDWA 4DKJA 4G84A 2FW9A 1DAHA 3V7NA 1ECCA 2EX0A 4ETMA 5JYCA 1U8CB 2A88A 1J23A 4ALIA 4CBVA 2QTTA 2YXLA 1UANA 4NBNA 1NE2A 2QSYA 3RRHA 4QSHA 1S2OA 5I51A 5K8IA 4LYJA 4PX5A 1RQ7A 2IIQA 5K51A 5C53B 3BM5A 1UJ6A 8MHTA 4C0BA 5LNK1 2XXBA 3FGNA 1XR3A 2HMSA 2VZLA 2ZWIA 3PXGA 3PVZA 3OQJA 4WK2B 1WCXA 5MN5A 1FRZA 4S1WA 2O0HA 4QDXA 2VWPA 4DCGA 2YFYA 3EG9B 3G5MA 5AKHA 2W6OA 4GM4A 4A6EA 2Y4NA 3HYLA 1FO4A 4E12A 1F38A 1UIRA 4JP5A 1SBNE 3I9OA 3K15A 3E7PA 1BPDA 4F7WA 3QPAA 1PZMA 1UC8A 2HRRA 5C1IA 4E5UA 1KMIY 4QBHA 4JOBA 3UEOA 2YXNA 4S0XA 2WB4A 1CEYA 1MF7A 1NJ6A 3B2QA 4Q02A 4M9RA 2D13A 4A03A 1BFKA 1NVKA 3RT7A 2F8KA 2WSSD 3FYUC 4LF6B 2E7ZA 3O4JA 3IDWA 2V55B 3BQNB 1OD6A 3V4SA 2BH2A 2B6HA 4KR7A 1AUPA 1PKXA 1NXSA 1ZJYA 3PX4A 1PNVA 1KJZA 3DVLA 5F5NA 3U3KA 1KFSA 4JVNA 2J5BA 2O5RA 4R68A 3G6KA 1J7JA 1NVTA 3HXPA 3AERB 4NC9A 3R0IA 1NXOA 5AR1A 5LMCA 1E0SA 3N7SC 2FRVA 3EF3A 3GWGA 5EUQB 1R7RA 1MIOB 3R5TA 4LXTA 3NONA 5GVRA 1RJGA 2FN7A 3TCXB 1MAAA 4Z6CA 1E59A 4E3WA 3OY2A 3W78A 5EJEA 2UAGA 2RGEA 4PTLA 1JYSA 1QTRA 2QZ4A 1EDOA 4HFJA 4BNVA 1W4AA 5KMGA 4Y2GA 2D5BA 1ZMRA 3ICWA 1BC5A 2JA2A 4LPSA 1SUPA 2VO1A 1EFAA 1M9NA 3PNBA 3WL6A 1E2LA 3ZCPA 5L40A 1EUQA 1ODFA 3CN9A 3Q9UA 5DI9A 4YVZA 4MJ3A 1Z0SA 2NZWA 2DQYA 2VHVA 4ML3A 5EQFA 5HOEA 1ZWLA 1I7SB 1SCNE 1OW5A 1CRXA 1LS1A 1MJHA 2ALJA 3T7EA 3WHLA 1L5HB 2WHEA 1ISSA 5HUHA 3TH5A 3D3KA 1Q0PA 1Y7LA 1C9DB 1Q2XA 4JV5B 2Y9TA 1TK2A 1Q7GA 1F20A 2FQYA 2JIMA 3A70A 2YWFA 1L5SA 2F1HA 5EQJB 4WZAE 4ZU6X 5F78A 3BS7A 3ZEAA 3FZGA 3AM9A 2HSEA 1I6WA 1GA1A 3AIOA 3RJKA 5DXAA 5EIFA 2XXJA 3EWNA 2X7JA 8ICIA 3H65A 1PLKA 1WPXA 2C5AA 2D2XA 2DFKB 3EZ7A 5CTAA 5K0NA 3OZGA 4L07A 3TKYA 1E1QA 5EZYF 5FOWA 3VYTB 4KEAA 2GPYA 5I3ZA 5IBCA 4B2PA 4NLKA 3ETEA 5CHEA 4PQRA 1OJLA 1P6QA 5JO9A 4DJJA 5JHGB 1RIIA 3EZ5A 9ICPA 1BWRA 2WJVA 1OFHA 3PQFA 4O4JB 3VHRA 1TVMA 3HR7A 4OXKA 3NW9A 3W9UA 1RMYA 4FIZA 1OE0A 2RI0A 3OFNA 3QXCA 1AGXA 1A5BB 3HJTA 2D5LA 3IOMA 5AW4A 1ISHA 3UFBA 2JFHA 3BYZA 5B4TA 2SCUB 4O29A 4MF8A 5E8JA 4A5SA 2O0KA 1D2CA 2HJVA 4UREA 1RHQA 1AC5A 2WFMA 1EVEA 4HNVA 2XY7A 1HDIA 4CCAA 2FNAA 4AY5A 5EWGA 3FYUA 3H9CA 1HDXA 4FKBA 1KO5A 4IS2A 3QX7A 1OZGA 2OCYC 5DB4A 3T3EA 1Q0HA 3BQMB 3TLXA 4GAEA 2BR0A 5LBTA 1Q16A 2JCGA 2ZB4A 1B6GA 2BZGA 2GILA 3A11A 5F4BA 3S0JA 3W5HA 1BWSA 4HX2A 3V4RA 2JEOA 2Z3ZA 3NAZA 2P77A 4HDKB 4ZPXA 1KETA 1XJ0A 1S0NA 1EVIA 1WVIA 2NPOA 5DTMA 4ZAFA 3T7TA 1XDDA 3OCXA 4W6ZA 5U4XA 3WLQA 4G37A 4QWCA 4XA8A 3LUFA 5IM4A 1ODIA 4D1YA 2JGIA 4AKGA 1RWOA 1CS0A 2G6TA 2XWPA 2FMIA 2Z4TA 3JQQA 1J22A 5DW3A 5E38A 3I9V6 1SVNA 2PI5A 3QBDA 4XFJA 4OI4A 4YI3A 4HAZA 2P75A 3EGIA 3KLPX 4BFSA 5LLDA 4GE0A 3OQNA 1H9BA 3SENA 1Q44A 4LX8A 3H5RA 1NHWA 4Q47A 1W36B 2MINB 3GBPA 4U6SA 3BDPA 1SHUX 2JHCA 4I1VA 4ZJPA 1EVQA 4XGRA 5AJYA 1NYRA 1GTL1 1Y5RA 1KDZA 1S5LU 1O95D 4J0IA 5EMKA 1M2OB 1YZQA 2GCIA 4QWEA 1WQ3A 3LUAA 5AOAA 1RM6C 2XTZA 1WLSA 3ODPA 3A1SA 4KREA 1MQ9A 2GAJA 2PZAA 4WXEA 4X71A 3G0DA 5CX1A 5ETJA 5DGTA 4YROA 4HV4A 3RAEC 1VPWA 3DGEC 4JHLA 1K8XB 4J16A 4C7KA 3QBTA 3JPSA 3CZRA 5JNRA 1PS0A 4L6CA 3GFPA 3JYNA 3NHLA 5KFNA 4FQ5A 4IJ6A 3CCCA 3T1TA 3E03A 3L93A 2XHEA 3DOFA 4R3WA 1JGTA 2FZCA 1P33A 2QW0X 1QOQB 3VC8A 3AB3A 2A0KA 1KEZA 4RQ3A 2AD5A 3JQAB 4RJKA 3SEZA 2RC6A 5LL6P 3KSBC 3HHPA 1ZOLA 3GJZA 4KN6A 2QTGA 4Q4HB 5M7EA 1JDTA 3M6WA 4D97A 2VA8A 2LCIA 2PV7A 3ZDDA 2VP9A 4KGXA 5FV4A 4ARBA 3DZHA 4XUSA 1FUIA 3TCKA 4ZYUA 4Q7EA 4NY1A 6LDHA 1U7OA 2IODA 3HCDA 3PX6A 1STOA 3TI9A 3WICA 2X76A 3WX0A 4XSVA 3KHLA 2RDJA 2IK8A 1B8OA 4I6EA 4XIGS 5H9WA 5I7OA 1KKLA 4QASA 4HWOA 4FR5A 4MGZR 1DC5A 4NEQA 1RJWA 1UJBA 4MDHA 4RMGA 1QO0A 3H1BA 4KKVA 2Q29A 3SHQA 1NBAA 3EGEA 1TKBA 2P6PA 5J0UA 2GXAA 5ALFA 1D4ZA 4WZZA 4AJ2A 1IN5A 3F67A 1W76A 3T9FA 4YRQA 1CF9A 5ECWA 1H3FA 4FDVA 4CMEA 1EK2A 2G04A 3W1EA 3P1JA 4NZYA 2JNWA 5F7OA 5AM0A 3ANSA 3H4TA 1RLMA 2AZ4A 3ROZA 3V7UA 2VXCA 3PDIB 1JQKA 1LTHR 2DKXA 2ZT5A 1K8QA 1XU9A 2PH3A 3O3CA 2QSJA 1LB2B 3DF9A 4I28A 1NBMD 2CBGA 1N5JA 2H48A 3TVYA 2NQ2C 1ENYA 3A9VA 3TANA 3BCHA 1ZFNA 1N6OA 1VIMA 2J7PA 2QD4A 1QH8B 1IONA 3JARA 5IUKC 5AICA 1JNXX 1HRKA 4ZO7A 2PZFA 2RGWA 2WYOA 3DEFA 4OSEA 4RA9B 3EZFA 1JI7A 4HLDA 3ADDA 2FWPA 2GBIA 1Z2PX 1M6VA 4DSAA 2JBAA 3MERA 3EN0A 4WPGA 2Q0SA 5MHTA 4XUEA 4MAFA 1T5TA 4ZVNA 2W43A 3EXG1 4J94A 5FA5A 3T5TA 2JBAB 3EEBA 3TOZA 4WN9B 3NETA 2QLTA 3E22A 3RS0A 4JUBA 3E5NA 3F3YA 3N6XA 3HSSA 3LYAA 1LLCA 3E22B 2JHGA 1FSPA 3BORA 4RKFA 2XA9A 3SXJA 1TADA 3C3EA 4C3UA 4CDGA 1S1CA 3FPLA 2JL1A 3SHTA 1SEVA 4XYMA 5IDQA 3QPCA 4BLWA 3HCPA 3KB2A 1L6IA 3FJ1A 4YB8A 5HE8A 3BB1A 4AZSA 3FKSD 3VYSB 3S81A 2VT2A 2XLCA 4AAYA 1G5PA 3SJBA 5EFZA 2V8OA 1E7WA 4HAYA 5FFMA 3EDQA 2Z8YA 2VJ5A 3N3BC 3EUFA 3GLIE 2RMKA 4AD8A 5TMEA 3VNSA 1EFVB 4MUKA 1F8FA 2WNSA 3IPLA 1QKIA 3HVRA 3HY4A 3P2MA 2ZB3A 4LJ5A 1E3QA 2MOKA 2FR1A 3QBVA 2XUOA 1PHPA 1YRHA 3HWSA 1UDRA 3PQCA 1AV6A 2O5EA 5ALYA 1DWUA 1BEUB 4KH1A 3PUHA 1T29A 1YMUA 4MWDA 2WJWA 2CV1A 1GGFA 1OFUA 1OX5A 5HR6A 3KBOA 3ORQA 5DF1A 3RVRA 4DF4A 5M29A 1RJ9A 121PA 1Y8CA 1DIOB 3D7KA 2K4MA 2E4ZA 4M04A 3GMTA 5EHZA 3PFHA 5HFJA 3HSYA 4J1SA 4YCAA 3R3YA 2HREA 4ED3A 4FQ7A 4OAOA 5B1SA 4BWGA 4UOEA 4ZOLA 1YRAA 4TL8A 3RS9A 2CB0A 1NQOA 3AU9A 4UHBA 4Q66C 4IDGA 4M9HA 2ORED 2GF2A 1U5AA 3N87A 2MU1A 4JUFA 4YRLA 1E89A 5K09A 2O59A 4LHWA 3C28A 1OU4A 2GF9A 5CP8A 1KO1A 1A9OA 1NN1A 2CLCX 5DBEX 5ED0A 2WFLB 2O8DB 3A9SA 1Z18A 1CQJB 5L1MA 3ZTYA 3GZ4A 2H4XA 4Q4HA 2KV2A 2BP7B 3S8MA 2GPBA 5DDIP 3AVYA 3RJEA 1EP9A 4DA6A 2B6NA 3K5PA 1AMUA 1YTUA 2V7QD 2W6JD 3IT0A 2OC9A 4J9VA 2CXQA 1WABA 4LXQA 2I34A 4ERNA 2YUIA 2N75A 2X0NA 1DGJA 1FK8A 2BFBA 2PJUA 3N8KA 1CSEE 2J7KA 1MB0A 1NT4A 1NXQA 1RW4A 3BMNB 3BXXA 4B75A 2FLLA 2EFYA 3F7TA 4A9AA 2BONA 4ESEA 2YC4C 1PVPA 2Y76A 2XUKA 4LDZA 3UJNA 4AX8A 4B6SA 1SKBA 2K7FA 3V7WA 3L8CA 2Z5FA 3CU5A 3OJWA 2ZFUA 4F3KA 2BGIA 3UTDA 1KDVA 4ZQFA 3TXXA 1F7UA 3P20A 4ES6A 3TBHA 2IP1A 3LPMA 4W5NA 3FVWA 2VPZA 4W5RA 4IRCA 3BGOS 4XQ0A 4FE4A 4I3HA 1ZQKA 3ZZ0A 4N47A 4KN7A 2H9AA 1T5DX 4JXJA 2BY4A 1H65A 1ZK2A 2J8ZA 3VVBA 1TX4B 3KZ1E 4I9UA 5AUQA 4FU0A 3DXYA 1QV9A 4E2FA 3QVGB 5DM1A 3V33A 2XWQA 1SXJC 5F9NA 5EZ5A 2WHYA 3WRXC 4OJPA 4OSOA 1PUIA 1G4AE 2VDOB 1XRLA 2V7TA 3FLEA 4B7AA 4MVJD 1ZH0A 1W29A 1BA3A 4NHEA 2F9LA 4IIFA 5EZSA 5EYPB 3ERCA 2W03A 2C98A 4ZAXA 1HYQA 1I5RA 2QLBA 2WAMA 5A4MS 2NXWA 5ERYA 2VSNA 1FW8A 2O2SA 3VKWA 2P2LA 2EFGA 4A6DA 2JLCA 4TT3A 2ZCVA 3DAOA 4YECA 1OA1A 3KAPA 4MCHA 4O5AA 4Y6RA 4ZJUA 4GMXA 2IHKA 4KLGA 4EHHA 3NASA 3DJFA 2HMTA 4ID9A 1YZUA 2WYHA 2HM7A 2H4JA 4RY8A 1NQVA 3ZY2A 4M89A 3V7FA 4DRXB 8ICQA 1XZKA 3K4HA 4YP6A 3DBRA 5F9MA 5KYVA 4AECA 1PYGA 2QIPA 1EKXA 2JGAA 2Z09A 5IAEA 1GL7A 1ZQSA 4Q3EA 2WSMA 4QTUB 2B83A 1FFUA 4DYVA 5JT1A 1GEEA 3Q8LA 3LUPA 3VH1A 5LFAA 3K0FB 2C42A 4GOJA 1VL1A 2V3WA 1L5UA 3FJOA 2BCEA 2RGYA 5B3JC 1SXDA 2BGUA 3UK1A 1FUUA 5HQ3B 3TM4A 3N0RA 1XELA 2CSXA 3AB8A 4HXFB 1Z5GA 1VJTA 2BOVA 4NG4A 2BISA 3G5LA 4ONEA 4K8OA 4AMGA 2XCRB 3BHJA 3BILA 4IIVA 1KIMA 3AF2A 3EZ2A 4OY3A 3TR5A 3FDIA 4BE4A 3OO1A 4UNNA 2XB9A 2YFQA 4F46A 2A1TR 4FJ1A 4HWRA 4PSVA 2CK3D 1QRAA 1FFVA 2ES6A 3VZPA 4QW8A 3NWJA 2X6TA 2X0FA 2MR6A 4BN4A 1GXSA 2PMKA 4L4UA 3X1YA 5I7RA 2M6SA 5GOZA 3AM1A 1K89A 3OTWA 3PPXA 3TVTA 4E11A 3CX6A 4D9BA 2XUGA 3T5LA 8ICEA 1OX4A 2REQA