1TE2A

Putative phosphatase ynic from escherichia coli k12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
RQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-deoxyglucose-6-P phosphatase
publication title Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
rcsb
source organism Escherichia coli
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.3.22: Mannitol-1-phosphatase.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1te2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1te2A01
4RESA 1J8DA 1XVIA 3ZUPA 1XPJA 3L8EA 4KX5A 3E84A 5AK3A 1Z4IA 3QXGA 2IOHA 2O2XA 3OCVA 5AI0A 2OM6A 3WKDA 3QU4A 4NFLA 2WF5A 4CE6A 5ALDA 1RLTA 4Y2XA 5AM4A 4Y2TA 1U7PA 3KDPA 2MSNA 4Y2UA 1VJ5A 1WZCA 3UMBA 3WK8A 2C9MA 3AR5A 2RARA 4HGPA 5AM0A 2QYHA 1WVIA 4EELA 3MC1A 4UMVA 3EPRA 3ZX5A 5ALPA 2IA5A 2ODAA 3ZWDA 4OCZA 2OA0A 3W5DA 1QQ5A 2NO5A 4H1WA 3QU2A 1Q92A 1ZS9A 4HGOA 5AW4A 1ZOLA 2ZXEA 4Y3UA 1RMTA 5AVRA 3ESQA 4C4RA 1VJRA 2W11A 3ZVLA 2G07A 1RKQA 5AIBA 3E81A 2I55A 3IB6A 5AVXA 3DDHA 3ZTYA 4UAUA 2PQ0A 5AK4A 5AW7A 1L8LA 5ALKA 2P9JA 1JUDA 5AKJA 4CNQA 4HYTA 5A3RA 4YH1A 5AICA 2O9JA 2C8LA 1L7NA 3QUTA 3QU9A 3ED5A 1SWWA 5AI9A 1S8OA 4BNDA 1Y8AA 5JJBA 5ALMA 3SMVA 2JARA 1ZD2P 2NO4A 1T5TA 3WK4A 5ALZA 4OFZA 2Q4TA 5AKLA 3U7EB 5T41A 3MPOA 3QUBA 2FPRA 4BX2A 4YCNA 4NWIA 1ZD5A 2YMLA 4EX7A 4KNWA 3ESRA 2P11A 4UMEA 2GFHA 5AVUA 2Q5EA 5AVWA 1ZD3A 4BNDB 3L5KA 3I6BA 5AK6A 1RMQA 2CN1A 2IYEA 3A1EA 3FVVA 3KD3A 5FP0A 3L1UA 3A1DA 4KX3A 4O8CA 1YMQA 4AP9A 3F9RA 2ZBEA 5AKYA 5ALYA 4DW8A 4Y2VA 3I1YA 5AKZA 5ALQA 3NAMA 2CFRA 5ALUA 2I54A 2PKEA 4XOUA 3WK5A 5AW2A 2ZBGA 3WGVA 3DV9A 3IRUA 3TLMA 4QQFA 5E0OA 2ZBDA 3M1YA 2IOFA 2RAVA 1RQLA 3ZU6A 3SF0A 1MH9A 3WK7A 2RBKA 3QYPA 4QJBA 3L1VA 2ZOSA 5AVTA 4BBJA 4NV0A 4UATA 4BKMA 1ZRMA 1QYIA 3NASA 4L57A 2BDEA 2B8JA 1K1EA 1F5SA 3OTQA 1SU4A 3OCUA 2HX1A 1ZJJA 3DNPA 4OHFA 3AR4A 5ALHA 3L8GA 2Q4RA 2R8EA 2YMMA 3RF6A 4AS2A 5AW3A 2I6XA 3AR2A 3AR8A 3ZX4A 5AM3A 1L7MA 1L8OA 1RRCA 2B8EA 3ET4A 4YGYA 2AMYA 4KNVA 5ALRA 2YBDA 3PDWA 3UMCA 2WFAA 2P69A 2PR7A 3OCWA 4RETA 4B6JA 2X4DA 3QNMA 3I28A 4HGRA 1CQZA 2FI1A 3CNHA 4DFDA 2G09A 1PW5A 2YMQA 3RFUA 1N9KA 4Y2PA 5AW6A 4KN8A 3U19A 3NIWA 5AW0A 2WHEA 4GIBA 1Z5UA 3KZXA 1Z4NA 2B0CA 1Z4KA 4ZEVA 2HCFA 1O03A 2I7DA 2CFSA 3OCXA 1YS9A 4GXTA 5AVVA 3J7TA 2YMPA 3SHQA 4UM7A 4DWOA 2ZG6A 1TA0A 2B1QA 5AKXA 3ONNA 4YCLA 3B9BA 3UM9A 4ZEXA 3M9LA 2HDOA 2R8YA 2GHTA 3K1ZA 1U2SA 3FZQA 5A3SA 4BEVA 1NF2A 4UARA 5AI4A 4UU1A 5AW8A 1ZRNA 3KOOA 2P27A 5ALWA 3L0BA 5AKKA 2WF9A 2HO4A 4E88A 4J03A 3CZ4A 3R09A 4BEWA 2HF7A 5AVQA 1KYTA 4BX3A 5ALFA 5AKGA 3L0YA 3FGOA 2RB5A 1LTQA 2C88A 5IT0A 2HSZA 2HI0A 4FFDA 3MN1A 3ET5A 3AR3A 3L7YA 1YJ5A 1RKUA 4UW9A 3IJ5A 3EF0A 3ZW7A 2YY6A 1T9ZA 1Z4LA 3PGVA 3SKXA 3SLRA 3U7GA 3N07A 4UASA 1O08A 1Z4MA 3B8EA 5ALSA 1Z4PX 2FPSA 3AR7A 4EEKA 4L6AA 2B1RA 4NAVA 1RC8A 5AI8A 2WF6A 1EK2A 2D2VA 2YJ4A 3D6JA 1U2TA 1VFPA 4BYGA 4AS3A 1RPZA 5AI6A 2FUEA 1S2OA 3ZWKA 3U13A 2GMWA 3MMZA 4UU0A 4HGQA 3WK9A 3KBBA 4ZEWA 4YIHA 4UM5A 1T5SA 4EENA 2VKQA 3NANA 5AW9A 3OCZA 1EK1A 3I76A 5IT4A 2ZBFA 1FEZA 5AHXA 5AVSA 4IFTA 4G9BA 3N8GA 3OCYA 2JAOA 4FYPA 4Y2RA 2OYCA 4EZEA 3WKEA 3E8MA 4FE3A 2WF7A 5IS2A 2QLTA 5ALIA 2GO7A 3U26A 4MUMA 3VAYA 3BA6A 5ALGA 1NNLA 3QUQA 2MU2A 1AQ6A 4BX0A 1RKVA 1IWOA 4EX6A 2C8KA 1J97A 1L7OA 1TJ3A 2AGVA 2G08A 2MU1A 4Y2SA 1Z4OA 1ZD4A 1QQ7A 1L6RA 4J2TA 2FDRA 2R8ZA 3A3YA 1YV9A 3QLEA 1L7PA 3W5AA 3WK6A 3QU5A 3N28A 3WKBA 3W5CA 4JB3A 1RLMA 2AUTA 5AKHA 1CR6A 2FUCA 3PCTA 1SWVA 3W5BA 3NRJA 2HHLA 2EARA 3GYGA 4YIKA 5AI5A 3WKCA 5AKEA 3L0CA 3QU7A 2JGAA 3ZTWA 5AVZA 2FPUA 3N1UA 2NYVA 4L6CA 2YN4A 3SD7A 3DAOA 1N8NA 1TJ5A 1YDFA 1XP5A 4XE5A 4UMDA 2C4NA 3QUCA 2G06A 2JAUA 5ALXA 1WR8A 2EAUA 4F71A 2G0AA 4UMFA 4IG4A 5ALLA 5AESA 4I9GA 5AM5A 1YNSA 1Z4JA 1Z5GA 3NALA 2GHQA 3R4CA 3E58A 2JAWA 4Y2YA 3ZI4A 1Z88A 2FPWA 3ZVNA 3L8FA 3R9KA 3UMGA 5AM1A 3U7HB 3WKAA 4C4SA 3FPSA 1Z4QA 1RDFA 5ALJA 4NABA 2B82A 4C4TA 1TE2A 4Y2JA 4F72A 3QGMA 2YJ5A 3N5KA 2FEAA 3BWVA 3HLTA 3U7FB 2EATA 5ALTA 1Q91A 2W4MA 3L8HA 4HAIA 2CFTA 4KYTA 1RLOA 2AH5A 4CF4A 2OBBA 3FPBA 3B9RA 4Y2QA 5AK5A 2W43A 2G80A 4XQ0A 5AIAA 2IOFK 1QH9A 1X42A 2YFYA 3OPXA 2WM8A 5ALEA 1LVHA 2I34A 1WPGA 3FM9A 2BY4A 2DQSA 3AR9A 3AR6A 4I9FA 4YCMA 1QQ6A 2FPXA 4MWOA 4CF5A 1TJ4A 5AM2A 2YJ6A 3S6JA 5AKIA 2I33A 5ALVA 1U02A 4PNHA 5ALOA 3ZVMA 3QX7A 3EWIA 4UAVA 3A1CA 2YJ3A 3HYCA 2R8XA 5ALNA 2WF8A 3SKYA 5AW5A 1RQNA 3WGUA 4CF3A 4DCCA 5AVYA 3KC2A 1U7OA 2G1AA 4XPZA 4HGNA 5AW1A 1RMYA 3EF1A 2HF2A 2BDUA 3NUQA 4G63A 2B30A 4JDPA 5A3QA 3P96A 1NRWA 2HEGA 3PGLA 4OD0A 2HOQA
chains in the Genus database with same CATH superfamily
1OXSC 4RESA 5J0XA 2P3LA 3V2GA 3A11A 3QYFA 1VE1A 3LZCA 2DBQA 3ND9A 3BMQB 1WWKA 2WDZA 1H4TA 5ES3A 3PEYA 2B20A 1VMIA 2PD4A 5J2HA 2GXQA 2R6FA 3W5DA 5HTKA 3PUXA 4N5HX 2QJOA 4XRRA 1WVGA 2QQFA 5D3MB 4R9RA 1HDZA 3HRIA 5CNIA 5HR7A 3FZEA 3QVTA 1Z63A 3BFJA 3CYFA 4X5VA 5AIBA 1MOSA 4G86A 2YFKA 1E3IA 3WRWA 5F77A 1DRWA 2L42A 3IHKA 4D45A 3STHA 2CRXA 3KJGA 4NMXB 4AF6A 5K3AA 3T4XA 4RZXA 2EH9A 3UWOA 3F1KA 2HJSA 4OHMA 4C6TB 2W6JA 3NVZA 4DAOA 1V5IA 8ABPA 1ISIA 4MVJI 3VJRA 3KG2A 1KO8A 1T3GA 2ZRGA 1TEHA 3U3JA 5JVDB 5AK6A 2P4SA 1BW9A 2P6RA 4IRKA 2MUTA 3SEQA 5FOQA 1OH7A 1L1RA 2EZ8A 5HIJA 2YZ7A 2E1EA 4JWTA 3I1YA 1G66A 3OMWA 4IVPA 3FGNA 2D1RA 3G1UA 1GNRA 3RV3A 2OV1A 1EFVA 3DR5A 4O4IA 6Q21A 3WB0A 3WU2U 1SD2A 1TYEB 2VXCA 5G4KA 2DBRA 3RHSA 1KEPA 8ICFA 1ZQGA 1G55A 5FTMA 1ZN2A 3O4VA 2NW6A 1CQIB 1IM8A 4D3ZA 3VSEA 4MHSA 3PKJA 3FCYA 4KI7A 2HQ1A 3WGOA 3S8EA 2HCFA 3HDQA 3DZHA 1ZAYA 3PCRB 1M2GA 1KSJA 4AO6A 2NTNA 3RM3A 3SS7X 4KO1S 4LFCB 4HAWA 3BSYA 1NF2A 2OAP1 5BQ3A 2OHOA 3KPJA 3TZ6A 1YI0A 4NM1A 5M04A 1UBOS 1L4EA 3H8SA 2GN8A 4JQOA 4M9HA 5DGDA 3D4LA 4G84A 4EZ9A 3NZEA 3STVA 3G2MA 3GLFA 5KNDH 1UBTS 5IXSA 2WINI 1FPQA 3OU2A 1ZX1A 2XH8A 1KC1A 3IAM6 3U3MA 3MJEA 3PGVA 4CF6A 3DG9A 3KQSA 4GECA 2IH5A 1C7IA 5CFQA 1VSBA 4DQKA 1ZQ1C 4MYRA 1TMKA 2PDAA 2A5FA 1MMFB 1Z38A 2JAHA 2Q8NA 4RHTA 2GF9A 1K75A 5AW9A 5COBA 3THYA 3O83A 4NLZA 4KWIA 5CIYA 1XPUA 4Y2RA 4DWJA 1UXGA 2ZIFA 2KVCA 1E7WA 5G02A 2FMSA 3DD1A 1PNTA 1GAXA 3ZI7A 1FS4A 4BYMA 1QC5B 1DCMA 4WKNA 1XD2B 3T7CA 3NP9A 2C4WA 1PS9A 5DHRA 3UPDA 1BYUA 1A7UA 3VTZA 4GFJA 4Q3KA 1ZIOA 3K92A 4MUBA 3DPUA 2R86A 4QXRA 4NARA 1N8NA 3GROA 1OFIA 2PMEA 4F3CA 1KOGA 2O2DA 1UADA 5LB4A 4RXTA 1A98A 5F73A 4JKOA 4PAQA 5JSQA 3QYJA 4MKXA 4K4GA 1FDRA 4MHTA 4N7BA 1VKJA 3P9CA 2BZGA 3GGSA 1ZEJA 1KP2A 2OL4A 1EZZA 5LYJB 4P35A 2Q29A 3AQIA 4Y2QA 3GDOA 2BJWA 5DYTA 5T6MA 1A72A 3WLNA 1DRJA 4JCCA 4TKLA 2OQVA 3O3MB 1IIRA 6AT1A 4EF6A 4CLEA 2YR0A 4LMAA 1YE5A 4GKBA 2E4VA 3HXQA 2HC9A 1C7FA 2XOXA 4YJHA 2JFNA 2Y1GA 1JYSA 3JD2A 3CN9A 3KC2A 4WOPA 2SCUB 1TJNA 4M2YA 5IH3A 5IUKC 1BMDA 4GMXA 2B4KA 1WUDA 2RH8A 2D5BA 1IQRA 2WZCA 1FSGA 4QXMA 4GKKB 5F4ZA 4TPKA 2PSDA 3WFZA 2WFMA 5KFIA 5AT1A 4N0PA 2WIBA 5A5DA 5KOIA 1J7JA 1Z2AA 1SC6A 4DIOA 1H23A 4HPJB 5KFFA 4D4LA 4DBLC 3PUKA 5HHTA 1KL9A 2I55A 3ONEA 4GDMA 5GOZA 4HS9A 3TQRA 4WGFA 5HKBA 1JBKA 4PG5A 4PG7A 2IEDA 3P9KA 2OXOA 1XN4A 4G0QA 3TZKA 5AQ1A 5IUNC 3V5NA 1T5DX 2R6CA 4A10A 3L9XA 4UD2A 2IGBA 4AUMA 4IM7A 4J7XA 2ERYA 3LPAA 4GM4A 1P0IA 2OILA 2RH4A 2P30A 3IBFA 4N8SA 2B9EA 1D8BA 3AERA 2CUKA 3G0DA 3NEAA 4BO6A 3ZCQA 2O8NA 2PGIA 1EB9A 3T5TA 4UTVA 3IL2A 3PV0A 4BP1A 5M34A 4XFJA 3AOEA 4IS3A 3M1YA 1XVAA 2H1LA 5A5EA 5T64A 2RI0A 3S70A 5EIAA 2B3TA 1G17A 4IQ0A 3AKZA 3UT5B 4TRJA 4OU4A 1JRLA 2UZ1A 4UCWA 4F9EA 1WU7A 4FDVA 3CJTA 1DHTA 1IVSA 2WWHA 4Z3OA 2FWPA 2GAOA 2AD5A 4MWGA 3U4AA 3KOXA 2RHTA 5BNIA 3TRFA 2Q2NA 1EB8A 1D2MA 3UN1A 4WJKB 3FJOA 2VNSA 4KLFA 1RIFA 3X1YA 5E2IA 1ZIXA 4ZI5A 1Y9DA 3OE1A 2OLKA 4HOYA 1YR3A 5KFQA 1PU2A 1UXJA 1PLLA 4FYKA 4BO4A 4YUXA 5GONF 2PPVA 5HHHA 3TLJA 5CUQA 4C29A 3H16A 4HVLA 4FMDB 4BDPA 3FCCA 5T4EA 3TB6A 2X8JA 2QL9A 3PHCA 4MW7A 3KEMA 2PFKA 2QD1A 1YHNA 1ZO8A 2AW3A 3VX4A 1EKXA 4R1PA 3P2OA 4G8CA 3JRXA 3BMOB 3GPBA 1IXKA 1EINA 1W5FA 2G4LA 3NWEA 3ZCXA 3DLAA 3EIEA 1R6TA 1TK2A 3EEOA 4DLRA 3SLKA 3QEMB 2JFUA 1EH5A 3AEUA 1RRMA 2QPAA 3V42A 4PXSA 5K8LA 3SGLA 5KG0A 4IJ5A 2JFPA 2A14A 3JS5A 2FJ0A 4DQSA 3TQTA 2E85A 3CZRA 2KICA 2WU1A 4MDEA 1MDFA 2UVDA 4EG0A 2XA1A 2R0QC 4WN9A 4LOAA 4M9NA 2JLWA 4DA6A 3CLKA 2XE4A 5KVSA 1FLVA 5HDBB 3FFWA 3T5PA 2BBOA 3B1YA 8ICXA 1B7GO 1Z4JA 3UT0A 5MN4A 2H2WA 4FNGA 3DBRB 3GLGE 2F8KA 4D8VA 2HMAA 5I9LA 3WRVA 3OM8A 4NY8A 3SN6A 3L04A 1MRZA 2BI7A 3UXMA 3BEDA 3B1FA 3IDFA 4BV8A 1Q91A 3K5HA 5A7GA 2OBBA 1BEEA 4FOPA 3PNKA 2P2GA 1BGXT 4JJ8A 4KC0A 3S40A 3MQ4A 1RJWA 1H8EA 3X43A 1VRCA 1CE8B 5ICSA 2R8RA 2P9YA 3OJEA 4G5YA 3LT0A 3JALB 2JLSA 4HQOA 1RI4A 3OY2A 4OXKA 3LX6A 4E6PA 3C1UA 2FFAA 3H8MA 2BI4A 2FOXA 4I2EA 1J8YF 3ROGA 2EYUA 5I7SA 3T5BA 2IZ0A 3NOQA 2FSIA 5DG7A 3GJ7A 3NVMB 4CE6A 3D5QA 4PLFA 1EVQA 1U7PA 4ENWA 1KVUA 3ZU5A 3COWA 1CUYA 1MX1A 4E31A 4Q3NA 4A1FA 2DKOA 4B80A 2YL2A 1A27A 3ZW8A 4ZZ0A 4XLLA 3OQ1A 2R5FA 3TANA 2P35A 4E03A 2JBAB 3L93A 4WLFA 4RANA 1SQGA 4BZPA 1R4NA 2HHXA 1GPWB 3OKCA 1UFVA 5FYDA 4USAA 2BH2A 2R85A 2W2NA 2GKGA 3SYRA 4IDBA 4UHCA 2JHAA 2YFHA 3A3OA 3UKOA 3HT3A 3BRCA 5H3CA 3O7WA 5HF8A 1CP3A 2HIGA 3E3LA 1WF3A 2ZI3A 4DW8A 3E2PA 4DIKA 4PBSA 1PJAA 3NAMA 2AN5A 2QG6A 3P52A 4XLZA 3P94A 4K26A 1ZQOA 2QP4A 2YJTD 4NZMA 3D8BA 4BCBA 4NHOA 3L92A 2FMQA 2OQIA 4FBLA 3UJ8A 4P7FA 5HZGA 1U48A 1HFKA 2ZXUA 5I01A 3SJUA 3EK2A 4AN4A 1N2GA 2B8EA 3GV5B 4AUKA 4MV5A 4MIOA 3RS2A 4LHYA 4Q24A 4WBSA 1LS1A 2Q6VA 2F76X 1QCYA 1GPBA 4JCOA 1N9KA 4JUAA 5KYUA 4NH0A 4O4HA 1XNRB 2CFSA 4H08A 4O3FA 4CMGA 5IYZA 1JWAB 2R8YA 1F44A 1EX7A 3TD2A 3FZQA 1X7YB 3HKEB 3AG6A 3NS1A 3FWPA 3CZ4A 2ZUBA 3EWAA 4D9NA 1K97A 3B7WA 5CAEB 1T9AA 4ZRMA 3T12A 1D03A 3EIOA 5L3VA 3WADA 4EO4A 3ENWA 3R24A 1U9IC 4F4UA 2WQ6A 2ZAMA 5KTSA 4IZ6A 1R15A 1T9CA 1J9EA 2V6BA 3R7WA 2VEDA 3V3KA 3ZY5A 2EJVA 3PUZA 3DW1X 1LDNA 3GT4A 1WDMA 1D04A 1SKYB 4DBLE 5KT7A 3KCQA 3NYWA 2GERA 3C8UA 2C84A 4JI3B 1GN9A 5B3KA 3PXEA 3H2YA 1C7QA 1FZTA 4F06A 1F8XA 3OOYA 4LVUA 4RPJA 2YC4C 1GZSA 4DSTA 1OBVA 4QWEA 2X6QA 5AXDA 1VM6A 2OXFA 4XXHA 2ZYAA 1NLYA 5AI5A 4OGKA 3CM0A 3USES 3BIFA 3FTCA 1KVTA 3UGQA 1DBQA 1ILEA 1L0BA 2PPLA 4JLSA 4K1LA 5ERXA 2VP4A 4YT4A 1O0SA 3NCHA 4M9QA 3PQ3A 4AQYB 4CDMA 3CGGA 4QWMA 3HL4A 3SC4A 4D80A 3OZGA 4HNAA 4BKQA 2GBIA 1JR3A 5HUQA 4P5EA 3H2IA 4DKJA 4HQ0A 2Q45A 3WL5A 2C2RA 2PXHA 6LDHA 4RQTA 4YMSA 4KDEA 2VJAA 4YR7A 2VA3A 3FZYA 4EW2A 4YP7A 2LR0A 4LNAA 2HRRA 1DAPA 4HFJA 4ZCMA 3HFGA 1UIMA 1EWTA 1LI7A 1PFGA 2VANA 4BE4A 1Q44A 1Q7RA 4NYIQ 1OXXK 4P08A 1AQUA 5FI5A 2IEGA 2QU8A 3MERA 2P0AA 3IKTA 4NMHA 5K45A 4I4TB 1A8UA 4H1UA 3TLYA 2PX0A 2W6QA 4QOEA 3FF4A 4HZIA 3GFPA 4UM9D 4K1XA 4FC6A 5H82A 4FGKA 4HGPA 3QK7A 2V7XA 4LJXA 1FFWA 1ZXIA 1AUPA 4I4LA 1GUAA 4Q7LA 4ZTBA 1DP4A 1LTKA 4DRXB 2AZ4A 1PV2A 3IEVA 3RIGA 4YRLA 1WP4A 1T36B 1U63A 2DBZA 1SC9A 3H65A 1GA6A 3CT6A 3NVDA 5EVJA 3QLUC 1ABBA 5KVVA 2FP4A 2R68A 3AM5A 1XCGB 3DQQA 1EDDA 4ROTA 1QZZA 2XCIA 3DA8A 2OPHA 2IP4A 1Z7EA 4DQXA 4M6WA 4W8HA 5KYXB 2I2BA 4PFKA 2ZBDA 1IK6A 2ODBA 4KHZA 3U7JA 3PXCX 4WLUA 1WXWA 2MR6A 5I7EA 5JRDS 3H1TA 2UXBB 1P3JA 1RW4A 3GLGB 1LBIA 2J7KA 4JP1A 4JI8B 5HOEA 2YH2A 2X1MA 4HDNA 4N0DA 3E3MA 5L1JA 3WYNA 1P73A 3ISBA 4LJ9A 1YC2A 4O0IA 3QVLA 2WILA 2HPAA 1F0PA 4ZYVA 2RLTA 4XW2A 2XGQA 3RD5A 4P4PA 4F9TA 4QM6A 3HCFA 2XXAA 1YA8A 3TW0A 3TRIA 3KZKA 3WLKX 4MW1A 3H9QA 3PK0A 1PGPA 1GT6A 3F4KA 3IP5A 1ARZA 5K9ZA 2XUFA 5CCXA 3C2LA 3N2KA 3C7KA 4MRMB 4MYTA 1DV2A 3SI7A 1GKKA 2CEKA 1CK4A 3V7KA 4P5DA 4P7BA 2XTJA 4WJLA 2CEAA 4FX2A 2VHQA 3UIEA 1CLEA 2XAAA 5C8YA 5CLFA 4EEKA 3CA8A 1C7RA 1WB9A 3ZJVA 4PBTA 3D6JA 1N63A 4RQ1A 3MTEA 1TCUA 4R8SA 1AVTA 3R41A 4D8XA 2GI4A 3BL8A 5D3ZA 2OSVA 4HDQB 3KEGA 1JEYA 4URVR 2VJOA 2ZXIA 2FVYA 4KPUB 1U11A 3T3OA 1Z6GA 2ODEA 2XCSB 5K01A 2FXVA 1B2LA 2JFFA 3KHRA 1BXKA 2QLBA 1SUFA 4TKZA 1DQPA 5CHGA 2EW8A 5T4FA 4FEGA 3X2EA 2RB4A 4YJ3A 1UDWA 3RBVA 4UBBA 4NECA 4FEAA 4TTVA 3VNUA 1JU4A 1JE1A 5ALLA 3IDWA 3L0OA 3EY4A 3C6MA 4O2BA 3SSAA 2PO7A 3UMRA 1RWXA 3I5XA 4R81A 5CLIA 3VH3A 2IU6A 2WJ4A 3UJHA 2CMDA 5LBIA 4Q4HA 3H42B 3ABQB 1YWGO 4QC2A 1ECCA 2QORA 2QTHA 4AO8A 3CVYA 1D07A 5BNFA 3AF4A 4JEIA 4KYTA 3DF7A 3HJHA 4NENA 3UFXA 1TMGE 3IDZA 2V0CA 5DFAA 1XKQA 3I30X 4C6SA 2AJTA 3JZIA 3RLFA 1NOKA 3F9IA 3QLVA 4CLRB 3OTWA 4PX9A 3JWJA 2AJDA 3R7AA 2B61A 4L73A 2PMCA 4OQ4A 2WK1A 3MCUA 3ZGZA 3EARA 1JWLA 1TF5A 2IUSA 2CXOA 2G5CA 3PSAA 2B83A 4E09A 1VJ1A 4JHLA 4ARCA 2GN9A 4UTXA 1WHTB 3PHHA 5TMEA 2XI9A 1U7WA 5J2DA 1J49A 5AJXA 4C7XA 1RYRA 1C1HA 5AK3A 1T1JA 3PB3A 1T0IA 3SHVA 2GYYA 3IEUA 3KEQA 3LX4A 3RRBA 3VJMA 1PJBA 2A3VA 4OLJA 3QTBA 2XCRB 5E7JA 2BFEB 1RYBA 1XZCA 3AW8A 3FMIA 4IIDA 1RBQA 1OW5A 3DEEA 2J8ZA 1L8LA 2DPJA 2QVLA 1U8ZA 2PLRA 2Q1XA 2JGLA 2CDCA 3N6VA 1U0GA 3OLVA 2DWUA 4QNNA 1T4GA 1HV8A 4A2QA 4HSEA 1WETA 1U3GA 2RI1A 5DNDA 3MJRA 4B3SB 3W5HA 3T54A 2IS2A 3TPCA 1DOZA 1IZ8A 3OPQA 3P1JA 2PKQP 4I4TF 1KDRA 2W22A 5CVUA 1DBRA 4CQMA 3OQMA 3M5PA 1J2MA 4KGVA 5C7OO 2ZETA 4IMRA 4S35A 2CFRA 3OUUA 1JEAA 3M0EA 4LF7B 3KR0A 3F2DA 3F73A 5FWDA 4D6XA 5EMKA 5JI2E 4ZKEA 2JIDA 1ZOOA 3VDNB 4JT8A 4D4JA 1ZRMA 3K05A 4NFSA 8ICQA 3AETA 2Q6LA 2W2XA 2WYVA 2GM3A 2DTEA 3RR8A 3AJEA 4ZAWA 2YMMA 1IE3A 3GWZA 5H1YA 2JKZA 1MRNA 1Y33E 4AO7A 5JLAA 1UM9A 1PW5A 4MDHA 3GWGA 5KQGA 1N2SA 4G5XA 5IC4A 5CDGA 4Y67A 3MB5A 4L3OA 1NL3A 4ER7A 4QWWA 1J9ZA 1NAIA 2HK7A 2GBLC 4KLNA 7ICVA 1N8TA 1Z28A 4B9TA 1ECLA 5JHHB 5DBAA 4AZTA 1DPGA 3D6HA 1YZGA 3FZGA 2P0EA 4PHEA 4XR4A 2VZLA 1HH4A 3ET5A 4OO1J 1DC6A 3L7YA 3P4YA 1X0VA 3HCAA 2O7NA 2AEMA 2FTKE 2ZIXB 3K2EA 2XCUA 4WMLA 3COJA 2B6NA 1NWHA 2A9PA 5EJAA 4OGGA 1NI4A 3W9BA 1GU1A 1IXRC 4RK7A 2XGGA 3NGMA 1GSOA 1OTHA 2XY7A 3MGAA 1JA9A 2AKAB 2O50A 5J2TB 1QR6A 3FWZA 3V9AA 2DFLA 2ERCA 4KQJA 1BJTA 3NWBA 4BTVA 3RJIA 4R9SA 1P45A 4HR7A 2ECKA 2GFQA 1G3QA 2Q0QA 3BMNB 1HLFA 2PS9A 2GBPA 2IVFA 1YU6A 3N8KA 2YHUA 3LX5A 3I45A 2E2WA 1KH1A 4F5OA 4US8A 1AKWA 1XJWA 1PEAA 4PAWA 1Y5LA 1EUZA 1QIKA 2DPXA 1LW6E 2A5GA 3QKSA 2QX8A 3OD1A 2F17A 3HU1A 4TWJA 4LYFA 3VI4B 121PA 3FYUB 4I9GA 1TAMA 2REQA 1PE0A 1BD3A 3MGGA 4X1YA 2C9CA 1SU8A 3I52A 2QSUA 2I2WA 3OLCX 2Z2KA 3ANSA 5J29A 1BVHA 3BT7A 4KQ1A 1KKXA 2BI8A 1N5WA 4OHPA 2IT1A 4P4TA 5T3YA 4D4IA 1GTG1 3AEKA 4YUWA 2PUFA 4EKYA 2WD8A 4A0SA 1H6AA 3OMXA 1LSJA 5DLYA 2I8CA 2G80A 1N2CA 1IBCA 2GPJA 3GFSA 5CDHA 1I94B 1SCUA 2V1XA 3YASA 1C1XA 3SJZA 5BRJA 3B82A 3T06B 1DO0A 3TEMA 3ZWNA 1FDUA 1EVKA 1GOTA 1G8MA 1SHZA 1W75A 5AVYA 4GYKA 2O2IA 4A0FA 2ZEJA 7ICHA 4PO3X 5BOSA 4EZBA 4MEAA 2R7KA 2XTNA 2QAGA 2CNWA 1TAGA 4F6RA 1RC0A 2ASDA 1E6KA 4W82A 3H2KA 2OWEA 2GDZA 2DHEA 2RHLA 1ZU4A 2ZPUA 4NZOA 4BX9A 1A2BA 2WJWA 3K5IA 2QM0A 4LI0A 4MFFA 1DC5A 1T3HA 1G9TA 1BYIA 2HUNA 1Z34A 1XYVA 4G0NA 2C7OA 3ENZA 4ENSA 4K9KA 3GT0A 3CKMA 1GPH1 1G60A 2HLHA 5EWJB 2ZI5A 1GPYA 2ID9A 2OZPA 3BHIA 1E3WB 3GU3A 4NCJA 1F1JA 3GCDA 1XQWA 4O1IA 4TVSA 1WUKS 2O2EA 5K09A 2XDQA 4BB6A 2CVOA 2FZKA 5E4JA 1MIOA 1XQ9A 2D3WA 3ESRA 4KLMA 4UVGA 3O90A 2V54A 2YXNA 4P38A 4HWSA 5FV4A 3RW9A 3SIPA 1Z82A 5C3MA 3OFSA 3QPAA 1NMXA 2ZBEA 1EP9A 4DQVA 3CLSC 2QX4A 3N75A 3IEPA 3GEHA 1RADA 2P1ZA 3G0HA 1Y42X 3LUHA 1LH0A 1GL7A 2B2CA 1WCIB 5FWAA 4NIMA 2YCBA 5FUQA 4F21A 3R0VA 5TVGA 2XUKA 4XEHA 3L1VA 1CS4C 1LX6A 1ZM7A 4KG7A 2I71A 4HMOA 2D5LA 4OP2A 2OO3A 1GPMA 3ZX4A 4C7YA 2J3JA 1E9EA 3ICWA 2ES6A 3ZWXA 1V47A 4K28A 3LZDA 5AOVA 3C3YA 3KZXA 3Q3HA 4MKIA 1SQFA 1EWQA 3TNLA 3V4FA 2H7XA 3SS9X 3WQQA 1J90A 3RKUA 4FJ0A 4DIDA 1HLGA 2IUEA 1IEXA 2RGYA 3EQZA 3O9MA 5CURA 2QDXA 4ZQFA 2CLFB 4C8OA 5BMOA 1P31A 1XTVA 2D6FC 2AQ0A 3OVMA 4L9AA 1HYHA 2IHKA 1RKUA 4H4EA 5E6SB 4G3IA 1NULA 2V59A 1YJCA 1MX9A 2V3VA 5HIIA 2BZFA 1BDBA 2RHWA 3GF4A 4YLGA 7ICPA 2ZTUA 3CTMA 2Z9BA 3DHNA 4Q4DA 2BQUA 3L18A 4R5MA 4XUCA 3N7RC 4EENA 1KQPA 721PA 1WOYA 1YJ8A 4B40A 1HGXA 2E4YA 4MLPA 2YWGA 4JLUA 3UA3A 3D1JA 3WJ2A 5KAFU 2X22A 4I2VA 1ZD8A 5HK8A 4ILEA 4RAQA 3DEAA 2QRGA 4ZAGA 4NJ8A 3AL2A 1KBUA 5FO0A 4MRAA 2JEJA 3X1JA 1QQ7A 3FVTA 4K4IA 2XC9A 4M54A 5IVHA 1P81A 5BSRA 1ZUNA 2GEBA 3EVTA 1ECFA 4HATA 1J06A 2FWBA 3BSFA 3GPCA 3CZMA 2XZLA 2G0AA 1G3IA 2ZE7A 2YICA 1S1CA 2H7CA 4GW3A 3EVBA 4QJIA 4I2AA 4Z1MD 4REQB 4G5FA 3KL2A 4G4IA 4ZIRA 5IP5A 3GHHA 4JASB 3DDCA 4EY7A 3WIEA 4V2UA 3WTCA 4C03A 4G1MB 5CNKA 4B2PA 2JFOA 1VL0A 3H1PA 1G8KA 3PPIA 4I2CA 1KPHA 1S0VA 1VSVA 4KHPB 1AK9A 3A27A 3EGIA 4Y30A 3GYBA 1Q19A 4MHVA 1DIRA 1E3DA 1FC0A 2LYBA 3CBQA 2UVPB 2EG5A 3KQVA 4U2CA 4W8OA 1QK4A 4JNCA 2DLDA 4FZ5A 4IV0A 2LXNA 2GESA 5A3QA 1JFTA 4NBUA 3I58A 2Y67A 3RS8A 1NRWA 4W99A 3JVVA 5JNLA 3W6UA 3DCYA 3CRZA 1ZQNA 5IH7A 3E0XA 2H59A 4XUSA 1NR7A 3LH5A 3ZK9A 1P8AA 5IEBA 1KRWA 3Q11A 1Z26A 3HWX1 3WWYA 3QX9A 5DG8A 1FQWA 1VJ5A 7MDHA 1E4YA 3M89A 1TOAA 2QE6A 3E05A 4KITB 4CM9A 2NO5A 2AOWA 4HMPA 2XZPA 5L3RA 3DEFA 2AVNA 4GXIA 4F3OA 5FOSA 5KFPA 5C51B 4I8IA 5EKUA 1T3ZA 1CPYA 2RMKA 1ZQEA 4E0BA 4GR5A 4M98A 5DIZA 1O95A 1UA0A 2I3ZA 1Z0UA 2FFBA 4EJSA 4R1TA 1GXSA 1JN0A 1NJ2A 3JXEA 1XYYA 3O94A 4CQLA 4H59A 5EJ7A 4MQFB 4QIWF 2E8OA 2OYYA 1FRFS 1GKIA 3HX0A 3LHKA 2LE0A 2VK1A 4O0MA 3D0RA 2AKYA 4PU0A 1B4DA 1ZCBA 7ADHA 2NRWA 1EFRD 4IIVA 2C4KA 3K2QA 1TM3E 3TGLA 4FDUA 8ICUA 1VIVA 2GNPA 1V6AA 3BHNA 4WDQA 4RQ3A 1QJ4A 1E1DA 3UK2A 2FE1A 1MB3A 1ICEA 3KR1A 2UYYA 4WCFA 1R7RA 2KJ5A 2XVMA 1I1OA 3TR0A 2BJVA 1ZK3A 3LG2A 1RPTA 3NC0C 3P9ZA 4IIJF 3HN2A 1Y88A 2A6PA 3OEYA 4ND4A 4OFXA 4BU1A 4L02A 2RG7A 1N7IA 1S3FA 3TSYA 2VH2A 3H8WA 3VZDA 4NXMB 2IYXA 2FFJA 1W59A 4ZEXA 1G4HA 3VA7A 1D9DA 3GV7B 5K0BA 1F8FA 1Z5WA 4QZAA 3GDXA 4UU1A 3PTLA 4RD2A 4S0XA 2A3NA 4XFDA 5FO1A 2AW5A 2Q5FA 3KZCA 4Z4CA 5ALFA 3NWPA 2Z8ZA 1FW6A 5I45A 2Y71A 4TL7A 3CRMA 4YMMA 2E89A 5IT0A 3MN1A 2XD4A 4HVCA 3G2OA 1PL6A 2PUDA 3UT6A 2X41A 2E8NA 1LB2B 3AHCA 3B78A 3IIMA 5CYOA 4ZYYA 3OQJA 1JDNA 1HE1C 4X1IB 2H4WA 4IXMA 3KKZA 3S81A 2B99A 3LP5A 2PYDA 2E6UX 1PT9A 4FOTA 1Z5NA 3TDKA 4LXHA 1Y8ZA 3DOCA 1GU0A 3PE4A 1JHYA 4KQHA 3EXEA 2E7ZA 3KETA 3EVFA 2H29A 4UNQA 3BTOA 5DOVA 3STUA 1RR6A 5EP1A 5EUCA 3DZCA 4RTQA 2N47A 1Q17A 3KQWA 3VYVA 3MGBA 3ZWOA 1BX0A 4TVOA 4ZK2A 5J23A 3JQ9A 3JWEA 1RM0A 1RS0A 3DGEC 4RAOA 4H6VA 1RABA 1YV9A 2CPRA 5GWXA 3HJCA 3KSDO 4MAMA 2WHQA 4V03A 4EFKA 5K6AC 3MNFA 1J2YA 3T6KA 3STYA 1WTAA 4FKBA 4FTWA 1QUFA 4OYRA 2FW1A 4NXNB 4KLRA 2RKBA 2NO0A 5CVCA 2CK3D 4B87A 4M55A 4Y1RB 4RLSA 1ZBDA 4EJMA 4ERNA 1CIVA 1GITA 4DEYA 5IJWA 1Y80A 4YCDA 3LLVA 3A3NA 5P21A 5BN4A 5KTTA 1US8A 1ZETA 4R2LA 2IQ5A 1WB4A 2AZXA 2J31A 2N75A 2O3RA 2NXNA 4R1OA 4G24A 2C1EA 5AK5A 2AZTA 4GI2A 4JVMA 2B4RO 1N36B 8LDHA 1RCUA 2YJ3A 3HCDA 3QWAA 2QL5A 4W7SA 1Z6YA 5KNIA 2WSYB 3AC0A 2YOHA 4DNOA 5SYNA 5D1HA 1CRQA 2PFQA 3RG2A 4TV9A 5GONB 1E62A 3AF0A 2TSYB 2XUQA 2P5YA 4M88A 3WLHA 1BGWA 2G5GX 5DCYA 3E61A 3RVKA 2P6OA 2W9CB 5JAOA 1HUZA 4HNTA 3L6OO 1YGPA 4WQMA 2PWBA 2OEPA 4F2HA 3WK8A 3EXHC 4XUEA 3DV0A 4X65B 4DUYB 2UYQA 4D81A 3ZV4A 3BICA 3HCWA 4P34A 4XTRA 1XSNA 4RWZA 4FHDA 4G1VA 1QVAA 4HGOA 5KX5A 5HQJA 1MF7A 1CF4A 4FCTA 4KSBA 4GVLA 4M7OA 5ALKA 3THVA 5HXAA 3BBPA 4NOLA 2IRWA 4WBXC 5JSZB 4BNDA 4GZ6A 3KQOA 2IF2A 4UTPA 3IHTA 2X9QA 1F2UB 4M7RA 2VWQA 1KFDA 3OO1A 1YK1A 3E2MA 2VTEA 3CFYA 2EERA 3LDUA 4G0PA 4C4XA 3FX2A 4YMVA 1SXPA 2Q7OE 1JLLB 2XMQA 3KD3A 4GH5A 1BRTA 3R0QA 2IS1A 2WM3A 3WXMA 1K8RA 2CXHA 4GRAA 4D92A 2KJQA 2Q5HA 1NXWA 5AJWA 2I54A 1AURA 1Z6TA 3CKKA 1O57A 4QW8A 1AKEA 5JD4A 3HUTA 5BVHB 3U1TA 3ZTTA 3C7AA 5IFLA 5K8CA 2ZZKA 5CM8B 3PGKA 2X2PA 1VSUA 5ENDA 3AR8A 4J2HA 2VQEB 2DJIA 3HJUA 5DGBA 1E63A 3QVSA 1U0TA 5FORA 3NNSA 4ESEA 1GA1A 3HY4A 1ZJYA 3MBKA 4JBHA 4OXNA 3A2MA 2YB4A 4HQRA 1FFAA 3EPGA 2ZIVB 1B74A 2I1QA 3IKVA 5CYPA 4EB6B 4XX0B 3IP8A 4I5IA 2VDWA 3HCBA 1XTJA 5D01A 3CP8A 2AOTA 2OESA 1HMYA 2CXPA 3G8DA 1HT0A 4BIIA 5KFNA 3CLRD 1YAHA 4JLVA 5AKKA 3E18A 5LU9A 3C6BA 1QMGA 2Q3LA 2WJAA 3W8FA 3TLGB 4PQEA 4FQ7A 2FJPA 3BRSA 5FPHA 2VF7A 1DTSA 2QUHA 2IMWP 1VL5A 2JF0A 1LF0A 1FW8A 4BB9A 4O3SA 1L4HA 1DBSA 3DZFA 1Z2PX 1QB7A 3KCNA 2B1RA 1N0IA 3MBOA 4PLHA 4EO9A 3JQCA 2V96A 4DM4A 1QO0A 4C21A 3OSUA 3N0TA 3AY6A 2ZJBA 4M8SA 1QE3A 1IEVA 2H00A 2H5IA 5E3HA 2ZBFA 3AOGA 2XNSA 2W9MA 2P9BA 5KL1B 5CT4A 2JR5A 4BNUA 3HABA 4RS4A 3LC1O 4F85A 3ACCA 3KQTA 4XH9B 2FNAA 4L07A 1UAGA 3BF7A 5AXCA 4HNSA 3V1KA 4KXLA 4GNRA 5J59A 3DULA 2YS7A 5ERYA 1I0IA 4E4TA 2J9FA 5DM70 4JNKA 1QP8A 2O2JA 5KYWA 3W5BA 5DBBA 1EJ0A 3KZVA 2VO1A 8ATCA 2VFAA 6NULA 4O4LA 4XE5A 2SECE 4IUDS 3TTWA 2BGJA 1AK2A 3IO5A 3PX6A 3ORYA 1NUTA 5DHAA 3VO2A 4IG4A 2FX5A 4LSWA 1FFHA 1YNSA 4PZYA 4BNFA 3M4YA 3BJZA 1K7XB 3BZKA 4Q6WA 3ICXA 2GNAA 1OT3A 4EATA 1SGGA 3KFXA 5DM4A 1Y3AA 1XSLA 3O8OB 3T52A 5JO0A 3LGXA 1QB8A 4H1VA 2F48A 1DJLA 2PBFA 2JZCA 4UDNA 2EU8A 3TM4A 3RVMA 1ODKA 1S6YA 3VOSA 1U49A 5FLXA 5F33A 2P66A 4DBZA 3GAFA 3ASZA 2E5WA 3O9ZA 3FDSA 3LYAA 1V8BA 4GE3A 1NBMA 3TUZC 3QX3A 3DBLA 3WGUA 5EZYF 2NUPB 3VHXB 2GTPA 2IXFA 4O2AA 2AC4A 3TKAA 5KWVA 1NUUA 4J6FA 2GS9A 3BRQA 3IPAA 4U0KA 2RQ5A 1OXMA 4GC5A 4ZV7A 1LK0A 1ECGA 5CDFA 1BPDA 2PX6A 4ZVOA 2PA0A 1M72A 4XQGA 3QJYA 4KQ9A 4BFTA 4PL1A 5CA1F 2CLCX 1A1VA 3NNNA 1OHHA 3RWBA 5KWEA 4JLOA 4YBRA 1LF5A 2NZYA 4C4RA 4KBGA 4ARAA 4K0RA 4YS6A 3EGEA 3KIPA 2NRTA 4D5EA 4HLDA 1WRBA 2A8YA 3ZNQA 4DXHA 1E64A 2X2OA 5F3XB 5LNK6 5BWBA 2XEXA 1YOVB 4TKVB 1F9EA 4JQYA 4RELA 3U37A 1ORHA 3OHSX 1PJSA 3FSJX 9ICKA 4HQLA 3OPVA 3H3XA 1ZD3A 2BSQA 4HEJA 1U0OC 4OJMX 2H65A 2R1VA 4AP9A 4G07A 1JFRA 2V98A 5G3ZA 4O0LA 2JFYA 1PR9A 1T6YA 2NZ8A 1PJ4A 5DTIA 2ZUSA 4C2TA 3NKVA 4B7AA 2QD2A 2KHZA 5CJPA 5DB9A 1I4OA 2A0KA 3V7NA 1YKFA 3ISVA 4GOJA 1Z39A 4LDAA 3RANA 4YVFA 1W88B 2XF2A 4O3PA 5KDDA 3OKAA 2MT9A 4PIVA 1PS8A 3RVQA 2QJWA 2YMQA 2QN9A 5JI3E 4QO8A 3NIWA 4EUSA 5GZ1A 1OF1A 4N5MA 5KPDA 4JUDX 4CF7A 3F5QA 5F9HA 5FDFA 1MA0A 3IP9A 5HNKA 3RIHA 3GCGA 2LM1A 3C41J 5A1TA 1WDLA 1VHQA 5U1PA 1KZ6A 1AMOA 3FYUC 4K9LA 5A3SA 1JROA 3JQBC 2R4UA 1UT8A 1FJ2A 1SZDA 3UGKA 2HO4A 1BOFA 1K8XB 3HYSA 2VZ9A 3SXJA 4LJ4A 4LZAA 3RTDA 1DADA 3H5VA 1XT6A 3NFRA 3HLYA 3JWHA 3IPLA 3RYFA 3HU2A 2Y66A 1BCSB 1FUYB 2AMFA 4X90A 1SBZA 5IG2A 2I22A 2CWWA 5DH9A 3Q72A 3V8VA 3W9SA 5D8DA 2EANA 1ILWA 5A2GA 3ZZ0A 4R8MA 2P9QA 1WIWA 5KVCA 3ER6A 3RR2A 2CLKB 5KTKA 1PEYA 1EK1A 3ZV7A 4CMEA 2CWDA 4ME6A 2D62A 5KJEA 1BCRA 3TVDA 3E3AA 4QIWC 4DKXA 3DEKA 2IH4A 3IPYA 4HGYA 1E7SA 4IW3B 4MEYA 4C14A 5TLSA 2VSXA 1D9XA 5ICMA 2XLBA 1TVKA 5AWFC 2KS6A 3LY5A 2AUTA 1P1KA 2HHCA 2Z4TA 2HQRA 3ZD9A 4CLHA 4Z6KA 3OOSA 3IELA 4BB5A 1JIHA 1YDFA 1TUBB 4MH0R 4RA6B 1XU4A 3V4LA 1NVMB 1A2KC 4RQMA 3Q0IA 3FDIA 1FFEA 2VT2A 2B7CA 2HA5A 3UMGA 3R8XA 4NV3A 3IDQA 1ATIA 5EP2A 1EWVA 2ZIZA 3AIMA 2V5VA 5FD8A 4YAFA 3BQ0A 1ZGCA 3U7FB 2VDKB 1SN7A 3E7PA 1RLOA 1KJ8A 3NOOA 4RU1A 2AG1A 3ZWBA 2VF5X 2YV1A 2WYIA 5DX8A 1FXSA 4G36A 2K8AA 4FYMA 1AUOA 1TF2A 4TMXA 2WM8A 1ZN7A 4ECWA 3EVCA 4IZOA 3G59A 4POAA 1SKWA 1TQ4A 1G2QA 3H1AA 2KK0A 1TU3A 2GZ1A 4E32A 3B3GA 4YR9A 3TGWA 5J0YA 1Y3CE 1EX1A 4JDPA 4BEBA 4KEAA 4JC4A 4YTEA 4TMVA 5GIPE 1NDHA 4HB2A 1UKYA 1T4MA 4WNAB 1CC1S 2VHCA 1VPTA 1UWCA 4J3JA 3EVDA 4Y6SA 1ZL2A 1JMKC 3UHOA 1M8PA 4IG9A 2OM2A 3URMA 2OXEA 4X9XA 1CUFA 1WVIA 4TSFD 4LVCA 4OU5A 5C35A 4EGQA 5BSFA 3JU3A 5G0TA 1E0KA 3OLQA 4I29A 3BXZA 9ICCA 5BWCA 1QP0A 2O9JA 5GGYA 1FFVA 1BG6A 4QZCA 1U2DC 1YR2A 3QU9A 1GA4A 2BLNA 1O7JA 3V7UA 3WWPA 4DNXA 3CUKA 4OBBA 2MHCA 3SQDA 4KVGA 4YCNA 4NWIA 1SUIA 4Q8FA 1WB5A 4QARA 4F92B 1WW2A 4KX3A 3M6IA 3SPXA 1Q74A 4WXPA 2AG6A 4UCQA 1ZR4A 4M0DA 5EMNA 2NTJA 2YX1A 4EI2A 2BT4A 4OYYA 4EJ2A 5ETJA 2E5FA 3Q2OA 1WBBA 4N76A 5J1SB 1ADFA 3IT2A 2ORIA 1ZNXA 1HBJA 2X0EA 1G1AA 3W7AA 3ZGYA 5ADVA 2OZEA 3WMWA 2PJRA 1EFLA 1RWNA 4HWRA 4MYHA 4WZ6A 1B22A 2Y0CA 4RU9A 4F5RA 5HFJA 2FFRA 1E1NA 2FPKA 3QE3A 5FEMA 3AUOA 4L6IA 5KFYA 4UB4A 2VQSA 2ENUA 1HPLA 4TXMA 2ZCUA 3PR3A 2RDJA 3FFTA 2AU0A 2F77X 1Q1GA 3PX2A 1E2IA 4BFYA 4HS4A 4LA4A 1DKQA 1U1IA 3S1AB 3SDBA 5IDYA 4Z7NB 4GAEA 5E4FA 4O5OA 3JPRA 5JAPA 2Q5LA 2IZ7A 1YRLA 3VCBA 1OH5A 3CQ9A 1DRVA 5DI3B 4Z6EA 3TL3A 2QSJA 1CLUA 3BTUA 2J41A 3U44A 3IBCA 1Z4LA 1H3EA 2NVWA 2Q1YA 3H86A 4L2IA 1EUCA 1OLOA 1UBKS 1N5RA 3JARB 3RJHA 5DDYA 2ZJ6A 2H63A 3RK1A 1EX6A 3WIVA 3KHLA 1AUXA 3V4PB 3R77A 3E8SA 5ECWA 4LYYA 2HSWA 4RQ4A 4PC2A 4P3KA 1CZRA 2XOKA 4IICA 3FN4A 5EJFA 3KBOA 3GA0A 1E7QA 1UJMA 3UJAA 1RKVA 2VDRB 4RF2A 4TZTA 4RQ0A 3N86A 3G23A 4K88A 3QMMA 3A6DA 4RD3A 1P6XA 2GJ8A 2BRUC 3E8XA 1TD1A 4PZEA 1VFNA 3CLHA 5J1TB 2H2IA 1QRRA 3S2YA 4MR7A 2EHJA 1SNYA 2VHTA 2HF9A 4U8GA 5ALXA 2WJHA 2QI9F 1Z1VA 3TLAA 2FZCA 3PX0A 1ZI8A 4TUSA 4N3NA 3LBAA 5L4SA 3V1LA 3ZEIA 1JIKA 3QPUA 1L5NA 1HNZB 2HB6A 3OZ7A 2OFOA 2ZS7A 4MQLA 5FPYA 1XNSA 2V4UA 4BQOA 4EY5A 5BPHA 2F3SA 1LTHR 3JQFA 2ZR0A 3H13A 1SRQA 3GB9A 4ALKA 3CVOA 4ER0A 5DLPA 5DVZA 3OLYA 5EHXA 3BORA 1QHNA 4G0MA 3DMNA 1U1GA 3E5NA 5DMHA 2A58A 4ND3A 4LZGA 5DEIA 5G5HA 1XD9A 1N60A 7ICIA 5E6RB 1C5KA 2F8SA 2QKQA 3CTPA 5DIFA 4C0HA 4NBWA 5BOVA 5KQLA 1VYUA 3GUCA 1CQJA 1IU9A 4BTEA 4L4UA 5KTMA 1LQUA 2W37A 3WGLA 2JJ1D 5B30A 3UQ0A 4P3XA 4CEHB 4JLBA 1D2AA 1R8SA 4IIUA 5AHRA 1U8EA 1A7AA 2I6TA 5DM0A 3USCS 4Y1FA 5FIUA 3P5SA 3GGCA 1ZQHA 3BH6A 2O07A 2XUHA 2E9SA 4YASA 3ANNA 1U7UA 1CVIA 2W2PA 1H0KA 1CQPA 3TJZA 4KLDA 5CH8A 4J9QA 5JJIA 3ERCA 3OG9A 3SM9A 4DIUA 3EXHB 1ZS9A 2XTAA 3MUFA 2OC4A 1ORVA 4Y7DA 2IITA 3IOEA 4LGMA 4PTLA 3WWCA 1QFYA 1TM5E 4WK6A 4DDKA 2XE7A 3IT1A 5KL8B 2WVJA 4NYMQ 1CR0A 3ALRA 1TJPB 1T0HB 3SSMA 2VRCA 4RHFA 1K5GA 5BWOA 5FOUA 4BP3A 4OBEA 3K75D 4F5EA 4L4RA 1BN7A 4EG3A 1DOQA 2C98A 1PHRA 5HBGA 3IEKA 3JPOA 1UPFA 1ABFA 1M2EA 2JI4A 1YS6A 1L4FA 1XRMA 2V4ZA 3QVOA 2XVTA 3E1SA 2HMTA 4IRMA 3WGZA 2GPAA 1GV1A 3KZMA 2ZSIA 2I0FA 2M6RA 4CCYB 1XCBA 3KSRA 3U4CA 1C2YA 5AVTA 4BXOB 3CZ9A 5ICEA 1L3VA 4F1JA 1R0YA 3DR3A 1NVFA 3MK31 5EJ5A 3GI1A 4BVBA 4PEVA 2ASEA 1HYGA 4BLQA 3F98A 4RYLA 3A6JA 5HG0A 4KNVA 2UUPA 3HXTA 1CDDA 3ZWVA 1ZH4A 4L0CA 1ML4A 3T3DA 2GZ3A 3T3NA 3MR5A 2WHEA 3GUUA 3VDRA 1XF1A 1H2EA 5EIOA 3ABOB 2QW8A 3IQFA 1TA0A 5C1PA 1NXSA 4A4DA 4FS3A 2P5UA 4DB2A 2JIQA 5DCWA 1NXTA 5AVQA 3RHZA 1OU4A 5KFBA 1YVPA 4KTTE 1XWIA 4XYMA 1I5EA 4B3MB 1Y34E 1U0FA 3IJ5A 1KYYA 4TVKA 4BX8A 1I4TD 4ZVUA 3ROFA 1EQ2A 5G53C 3TEJA 4D9EA 3U3XA 1NPTO 3HN7A 2WQ7A 3DHVA 4OAQA 4F84A 5CK5A 2PGOA 4OFBA 1H4QA 1XSPA 1SVUA 3A31A 1FX0B 2VK2A 1TA9A 3DWEX 1I32A 4BNMA 1ISSA 2N9UA 1TTTA 1NNLA 3OM0A 1B0PA 1Q1AA 1Q7BA 1B0XA 1C3OA 2GTHA 2H2FA 5BURA 4NLNA 2R8ZA 1OYWA 1CJCA 4Q39A 1KAMA 3L8YA 1ZC4A 3FOAA 5TDHA 2QMYA 2G36A 5A3JA 9ICUA 3ZHTA 1WBDA 1A97A 2FWMX 4KXVA 1KY4A 1A9OA 3KYIB 5TQ2B 4YD1A 3KLBA 3MMNA 4YMWA 1TK9A 3LT5A 1UC8A 2Q21A 4HK4A 2AEFA 4BLOA 1V45E 5L3QB 3A1UA 2NT3A 2WHRA 2ZKLA 2JK0A 1WMEA 1UCVA 1N3BA 5H2FU 2JI8A 2JH8A 2XA2A 3LTNC 4A23A 1EIWA 2WOOA 2PZBA 2P4UA 5K05A 2UZAA 3R3YA 1L7RA 3IMEA 4AAYA 2FLLA 4QWDA 1KQFA 4RF4A 4NCXA 3BQTA 1SCNE 1MC1A 5JASA 3TO5A 1TUIA 5BNWA 2ZIUA 4U2EA 2XDAA 3PVZA 3FBWA 1CRPA 2DQSA 2SHKA 3O4FA 5EWEA 5A6VA 4RQBA 1P18A 4G5SA 5JU5A 1JG6A 5EIBC 3PRKE 1P0CA 5SZHB 4C87A 3OIWA 1QH8A 1XCJA 1GGVA 3Q5EA 2XRMA 4NL9C 3ENKA 4M1KA 1DKUA 3G5AA 4XPZA 4XB2A 3VKHA 1OU0A 3ASUA 1OBHA 3QMPA 4WVLA 4YWHA 3OEED 1QIJA 2R6DA 5DBOA 4F4CA 3IAM1 4ASUA 1L4BA 5KT5A 1VIYA 4H6WA 4Q9KA 1NLUA 4ZOHC 1C3JA 1QVZA 5DB4A 1Y8QB 3H9CA 2VAVA 4QLOA 3P27A 2BMAA 3HV0A 3GPLA 2H1CA 5TARA 2SKEA 4DQPA 3OJSA 1D2NA 1J39A 3D1VA 4BRSA 4RDIA 4C6HA 3LWMA 1QNFA 4E6EA 4PH5A 5DHPA 3EZNA 1JTFA 3TSCA 4MCIA 1KP9A 3BSWA 1UC4B 3HUEA 2JI9A 1QIHA 3Q2IA 3HCOA 4PYMA 5EJ6A 3S1SA 5KYVA 3BYZA 2XWJI 4GPD1 2X40A 3PW5A 3V2HA 1LUAA 2DKNA 4NX2A 4K6HA 2Y2VA 4TMYA 4JJZA 1NBHA 4D97A 4KDRA 2W6CX 3OF2A 3HR8A 2QB5A 5EWMA 1ZQYA 1ANKA 4J0GA 2QS9A 2Q5EA 5G1PA 3BZWA 4RKQA 3WNCA 4G56A 4XA5A 2Z5GA 4UB5A 3KALA 1A9SA 1NRXA 3P9IA 1QKJA 4DPKA 3DT8A 2G9ZA 2ZSKA 2O8FA 1HE5A 5DM2A 5CDSA 3VX3A 1Y8RA 5G0SA 1K3FA 4YECA 1KDVA 2HX1A 4FB5A 4JJ7A 4AZ0A 5CWRA 4MA4A 4XUDA 3SEIA 5C7IO 2I80A 5F5XA 5HIAA 4EA9A 3MFQA 1YZLA 1OREA 1E61A 3VOAA 4HGRA 2PE5A 3KLPX 4KTVE 3AM1A 3TIGA 5AVVA 4OV6B 1SXHA 3ORRA 2Z58A 2AK2A 1E96A 2Y68A 1JG2A 4C5CA 1FMCA 2G8NA 3RRMA 3LC0A 4GSLA 4BDTA 5D00A 2RAFA 1C9MA 3U0VA 3H9UA 4RPHA 1KMQA 2XYVA 4R1SA 2BKLA 2OEHA 4GHWA 4CM8B 3SMQA 3QA3E 4JOCA 5GV8A 1NY6A 2V7BA 2H7VA 4UW9A 1L3TA 3T7JA 1AS2A 5IK2D 1HZZC 4ZOBA 2IYUA 2Z3VA 3KXKA 1TTPB 2AFRA 4O3MA 2ONZA 3AF1A 4V24A 1GRVA 1I2MA 2C9YA 5CW2A 4EY4A 5KYYA 2QL7A 2VQ3A 5TQVA 1XLTA 1GZVA 1Q3KA 5K4AA 2Q1SA 4QOGA 5LQDA 2NZWA 3W1EA 2LDXA 1NW3A 3E7WA 3K1AB 1S0OA 3PDCA 1ECPA 3GMTA 3ADPA 4ED1A 1GCOA 4MKHA 2OT3B 3E53A 5E1BA 1UCFA 1O58A 3WSWA 4BKPA 3PCTA 2ZU6A 1VGQA 3TIVA 2O3TA 3DZKA 1ACMA 3T41A 1RT9A 4LJRA 5GINE 3W6NA 1BKYA 2VUIB 1H6BA 3T1TA 4Z99A 2I7VA 4QFDA 5LBUA 4B7ZA 2H8GA 3LMKA 1DEOA 3JYOA 3AIKA 4ED0A 4MQEA 3ZH9B 2UAGA 4HX2A 3E23A 2Y9TA 3RC7A 4ITRC 4IIJB 4JUFA 3TW8A 1XWFA 4HXFB 1NVTA 3QEAZ 1XZLA 1UBSB 5EA2A 1ITZA 2Q3FA 1I8TA 1E2FA 1T3LA 3GBVA 3ZJ4A 3GARA 5DW0A 1O97C 4IMPA 1F2DA 5IN4A 1W9HA 2VDPB 5A9RA 4EBDA 1TYBE 4D5GA 3BIXA 4N7JA 3LE8A 4RKWA 1V7QA 3H1GA 3SKYA 1DL5A 2NUAA 3DBHA 1XZDA 4IDOA 5MDHA 4ZC8A 1P6QA 1G59A 5JISA 1V5GA 4OYHA 1BPEA 3NRBA 1UEXC 5A03A 1XZHA 4DMKA 3HUFA 1MC5A 2UVVA 1M2OA 1P1BA 1Y4ZA 1XBTA 2XKJE 1KXZA 5G4LA 3E9YA 4UQGA 2GFIA 4Y2UA 3EAGA 1V7PC 3VR2A 3M4NA 5KFCA 4MGEA 4N0QA 3VZQA 3AX6A 3T95A 4IQUA 5JDCC 1Y98A 2PEZA 1JZSA 4UHDA 3Q7RA 3WYGA 2J85A 4QAJA 2CXUA 4X1OA 3SEZA 1V97A 4TRNA 2GTIA 2NYAA 2OLJA 1B3BA 1F4PA 3K5WA 1U4OA 3G8AA 2C28A 5A4FS 4ETIA 2P5TB 3RYIB 4MVJH 4IF6A 4B3BA 4B79A 1DQNA 2V6GA 4EHBA 2FEMA 5D6NA 2J45A 2QI9C 3B2QA 4YQYA 2Y0BA 1PGQA 3M5DA 2PN1A 5FJJA 5G0UA 1AGXA 3EEYA 4P32A 1S02A 3LYUA 1P0FA 1VB3A 4W6ZA 5IBPA 4EUNA 4XKJA 4BATA 4AMYA 1TT5A 1TCCA 1VIAA 4TXNA 2HRCA 2GN6A 3M34A 3RIEA 3F71A 1MQ9A 4GG1A 4QYSA 5HDQA 4KMOB 4LTMA 4UATA 5JC1A 1C9JA 2HHSA 1Q0QA 4QD3A 1FRVA 1MO2A 1QOZA 1SVMA 1MAAA 1OBCA 2HADA 3F6EX 5BNTA 1W0CA 2B6GA 1THTA 2VZEA 4ZCTA 3P4UA 3WHIA 3IR5A 3V7FA 5DWDA 4B6QA 4B4DA 3G7NA 3QM1A 5FFNA 2YXDA 3LRXA 4OGWA 1MIHA 4W5QA 3SENA 2P3QA 1T9KA 1COOA 3K4QA 1EGMB 2NN3C 3BD8A 4ER6A 2H92A 2ANBA 2GB4A 4Z4GA 4UVIA 3HDGA 1EFDN 1V1MB 3BN3A 2UXCB 3FGOA 4RULA 1J09A 5F51A 3CONA 2CL5A 3KEOA 5LA6A 3ANMA 1SOAA 4D8WA 4LSMA 2ASJA 4ZOAA 4LOHA 1T9ZA 2W8BB 3ETHA 4QKQA 2KW5A 1NJ6A 4BO1A 4BEJA 2C2WA 1EVEA 3ST7A 4F0JA 1KVQA 5KB3A 1A76A 4WNYA 4BJ6A 4AZVA 1E59A 2BW0A 2XQKA 4DSUA 3G2JA 3SYMA 3HBLA 2QRMA 1DGSA 1X19A 3MJHA 4JX9A 1LBTA 1PNQA 1QIFA 4DLWA 2ZPTX 4FFSA 2FQXA 5L7YA 3NJ4A 1OLXA 3IOCA 3ZDBA 1KQ3A 4J90A 2WSMA 1QF9A 1MPTA 3KTOA 1WMDA 5BN1A 1ZD1A 3W5AA 3T15A 5KFEA 2ACKA 2XD9A 4GVXA 1WMFA 1PK3A 2IXBA 2ZE8A 4POOA 3LYSA 1VKNA 1JA0A 4R1NA 5AKEA 5JDIA 1WMSA 3N1UA 4ZU1X 4Q3BA 4FLEA 4ND1A 4YP1A 3LUPA 4BJ5A 2FUG6 4LHWA 2HIHA 5AESA 3TFOA 3DOOA 4JY7A 2F3NA 4QZIA 3OETA 1RYDA 1BHO1 1ORDA 5FX2A 3ZVNA 3N4MB 4U3JA 3U9LA 4MS1A 4FFWA 4DL3A 2H4FA 2JRLA 1LSSA 4XIGS 3OF5A 1U6JA 5CBKA 3HYRA 1JHXA 4IJVA 1TK0A 3LCJA 2PXCA 2XKAA 3N2YA 1KIAA 3DC7A 2Q3CA 4PZZA 4JGIA 1L5WA 3TAHA 4DRYA 2ERXA 2C2YA 4RW0A 4CKYA 5JE8A 3T0IA 1E8NA 3N74A 5BSEA 1JTEA 5JH7F 3BGIA 2FPGA 5EHQA 1CBUA 3ITDA 1GSIA 4CIVA 5B2FA 2R5WA 4YJFB 1QGUA 5JZMA 1ZQXA 1YJBA 1FS5A 1EDZA 3GMDA 4IZIA 3D3NA 5LCXA 4EIWA 2ODNA 3E2IA 1SOVA 3V1YA 5JCZA 5AOAA 3SG0A 3Q8QB 3KB2A 4P4NA 4H0CA 5CB6A 2H7YA 1Y1LA 1R3DA 2RFLA 1BVUA 3VH2A 1XA3A 4Q93A 5B7QA 3QPVA 3JAWB 1AX9A 3I3OA 2BGMA 1G2IA 3UPQA 3IJPA 2J5XA 4W5OA 1MTZA 4A27A 2JEOA 1UBJS 2QVZX 2F67A 3MRTA 4I50F 1ZI9A 3QU2A 2J08A 4V0ME 4BMVA 2LMRA 1RKQA 4R8UA 3KQMA 1RP1A 4DTCA 2ZI4A 3EIQA 1JUDA 3P2YA 2CLEB 1MN8A 3IVRA 5DEOA 5ALMA 4IL5A 1ZK2A 4D7AA 1UT5A 4NMLA 4CIXA 4NLKA 4FOLA 4ERXA 2CBZA 4IJKA 3O8QA 2HRBA 1CIPA 3S5JA 1JAXA 1LLQA 1CZLA 4YP6A 2W2KA 1S2DA 2HQBA 2ATXA 4TMKA 4M76B 3RVOA 1PGOA 2C2ZA 4PGQA 4A8JC 2P68A 4JLPA 4LBYA 3BS4A 1NVEA 2MJLA 4DZTA 2B2NA 3ZHSA 4PNPA 4Q66C 1USGA 1F0YA 2PBLA 1UQVA 1CS0B 3W1WA 1LJ8A 4MGHA 3IG5A 4KE9A 2ZJ0A 3L82B 4EG1A 1RHUA 3JSAA 3H05A 2ZAYA 1TUGA 4OJTA 4WV3A 2DBVO 3ZGNA 2OH2A 1YZHA 2QNIA 1RI5A 2WE7A 1CDOA 4F8RA 4AL4A 2B1GA 1OYYA 2IYSA 4BS9A 5EZYB 3TW4A 2HSEA 4L7QA 3P9RA 5EHGA 5CJ7A 4Y18A 4WLNA 4S2UA 2WD7A 2ALJA 4C4AA 5G2OA 1KETA 3U61B 2O5CA 5F9NA 1UJ5A 1OYVA 1Q0SA 4J9SA 3CZ5A 3BG5A 1X9GA 2R6GA 1K7EB 3TFRA 4HEA6 4PX3A 1TK8A 3QH4A 2BZ1A 5KPJA 2QY6A 3EIUA 1OUQA 5CA1B 4GO1A 1M8GA 3LFTA 3B3JA 2IZ6A 3EFEA 4HLUC 1I4LD 4BGVA 3TIIA 4L8GA 4ZTUB 1RC8A 1X3SA 4M46A 4ZI7F 2FN9A 3U13A 4C2AA 4F5WA 1GV0A 5EIXA 4ECYA 4GM0A 1GKUB 1BD4A 3KXLA 3CWCA 3Q12A 1RHJA 4NE7A 3GNTA 4B2YA 4CYMA 3OP4A 2J0EA 4TV8A 2XCQA 4KN4A 4AJOA 3H8VA 5ITWA 4M1MA 4B17A 3ILHA 4ES6A 2K4MA 3B6JA 2E5SA 1DEKA 1G20E 5A3VA 2ZRPA 3ZEAA 3H2GA 4KQ6A 5THXA 4GSYA 3WGGA 4ND5A 5HJEA 1EM8A 3IBGA 2JLUA 4MUHA 2JA2A 4OOFA 3NVYA 2W48A 4PZ0A 5K3FB 5CDUA 4GR9A 5J4LA 2FE9A 4B83A 4ELTA 1FSSA 4BFZA 1Z1BA 4P31A 2GILA 4DT1B 2NO1A 4C43A 4PINA 1YDWA 3CS3A 3QE4A 2C4MA 1X77A 5DE3A 1GM5A 4FU0A 4Q7JB 5HX7A 4PSAA 1PJLA 2BP7B 4NABA 4K6OA 4KO2S 3LJKA 2VJNA 1AB5A 3DOHA 4QXPA 1IN6A 3HDVA 2I3BA 1NK4A 4AVYA 4D79A 4ZCIA 5CCEA 3TEFA 3QSYA 1YFZA 4F9GA 3QNUA 5F5LA 4FBUA 3WRXC 4C5BA 3N0XA 2NAPA 4AKIA 2ZYIA 5TMDA 3VHQA 2YFYA 9ICIA 4QRHA 2E1FA 5I9MA 3UAOA 2FRDA 5IKMA 3EZLA 1P8JA 2IEIA 3ANXA 3CY6A 4MV1A 4XFKA 4JYZA 3WGQA 3AGPA 1JBQA 4L72A 1XEWX 1T3NA 4K9DA 4AF8A 4IXTA 2VJCA 2IJGX 3NFYA 5H4GA 2VLIA 3K9WA 3R8CA 2DQYA 1O5TA 1W19A 4QDXA 1U81A 2FAXA 4BECA 4H16A 1PEKE 5F2NA 1Y3BE 4NZ9A 3HHPA 1ISPA 1FFBA 4KXNA 4F2WA 1EPUA 2FMPA 3L8EA 2IXDA 1V8FA 3GD5A 4DLUA 2EHDA 3QBJA 2JW5A 4HMQA 5C5EA 3D6VA 4LWZA 4YK7A 5B12A 2OV8A 3IE1A 4EHJA 3PYMA 4RPYA 1YQXA 5LOVB 2F8LA 1N56A 3STTA 2AG8A 4P0QA 3LCMA 1VCNA 2QM8A 4OP3A 2NRVA 1C1DA 4JP2A 2RSLA 5F3DA 4W4TA 1UBCA 1Z00B 2WWXA 1MP0A 2OBLA 1WDWB 4IWXA 5L7WA 4OH7A 1QYWA 4UULA 4Y2GA 2C2DA 1J0EA 5CVDA 2PQ6A 3FD8A 4RTJA 4AY4A 4YC7A 2QV7A 1ONOA 3KUXA 1RMQA 3LKZA 3HB7A 3QV2A 2AQ4A 4NLBA 3IQEA 2KLHA 4U2GA 3TOCA 2QM7A 3NUGA 4BO8A 1J1IA 1JFLA 5BUCA 1Y0BA 1MRSA 3BH0A 2UVWA 3DXYA 4GWLA 2ISPA 1ZZEA 3F46A 4QJBA 5KYTA 3V2IA 3V7YA 5JATA 4RE6A 1J1ZA 4MV4A 4UE6A 3LTEA 2BFOA 1NW8A 3OQBA 3PNLA 1H8HD 5JAZA 1QRSA 1IYZA 5K8IA 1E6LA 2V55B 4OTZA 4E3ZA 2I5HA 3IYLW 4B82A 1VI2A 3CB2A 4UHEA 1ZQJA 3HVRA 5CM9C 3UMFA 3PL5A 1QG2A 1ZNQO 1U28A 2Z8YM 5FNVF 1FUKA 4FLMA 2H3FA 2PUCA 1NK7A 4TRRA 2ZRFA 1UJBA 3TACB 3FI9A 3STWA 1OJ7A 1T1SA 3NGXA 2YOGA 4DA7A 3VGJA 1SH7A 2WTNA 2EZ4A 2QX7A 3BXHA 4ALJA 3HXMA 2YZGA 4A2PA 2QROA 1G42A 4Y6QA 3WYEA 3U7GA 4J7AA 4FO6A 4DF4A 3OAAD 4LXYA 1J2EA 1H05A 3Q40A 2FK8A 3IP4B 1TZBA 2NYRA 3IBSA 1DGQA 4ZCQA 2PFGA 1SG6A 2FHPA 4HDMA 3WK9A 1OI3A 1U4BA 4OQMA 2C2HA 3L4JA 2A1UA 2EW1A 5CNJA 3OE4A 4HDKA 4A26A 2Z08A 2YBEA 4FE3A 4MOWA 3U3DA 2QLTA 2A0WA 4MUMA 1J6UA 4P6VF 2HHHB 4Q82A 3RGWS 3ZDXB 2H4XA 3DEYX 4ZQGA 3LFHA 4ZALA 2LBOA 1WU8A 2ZU0C 3DQPA 3VYWA 1A7JA 2QTFA 2G77B 3LF2A 1J1UA 2OV4A 4JBNA 4IDHA 1WAMA 2VI5A 1N2XA 1M2WA 3H9EO 2TMDA 4P3PA 3GJRA 4CM6A 2KJ9A 1QFXA 4M1TA 1ZJ6A 4OQDA 2IDKA 3PJDA 5KNBA 3SXUB 8ICAA 2ZS8A 4Z9YA 1QPBA 1KRXA 1WWVA 3HV2A 3KOMA 1KERA 4A0GA 3KQQA 1EP3B 4HX9A 4BNXA 2H06A 2WSIA 3ETGA 1FUIA 3I0MA 4L8FA 1TPYA 5EERA 5I8WA 4KQ2A 4FFPA 1RKXA 5E4YA 2BN4A 3F78A 5EFOA 1H6DA 5DNYB 5DLDA 1I2DA 5L4NA 1N6NA 5IIMA 5ALNA 1VPVA 3QWBA 2VT6A 9ICBA 3C5WP 1BPXA 2OCXA 1I7DA 3S0JA 2I4RA 2HHWA 1I3KA 3C5EA 2JEIA 4JENA 3GV0A 3U5TA 2JJYA 4RIHA 2QOEA 4GUDA 8ICRA 1G0NA 2BF4A 4DFPA 3K20A 4AKTA 5JXWA 4JMLA 4GLJA 2H0AA 1B8PA 4Y6GB 2UVRA 3UAYA 1E94E 1OX4A 2JV3A 1ZQCA 4WRRA 3ZDYB 2CLLB 4Q00A 2KZ3A 3G89A 2C3PA 4EKEA 1WDTA 4RQNA 3F2VA 1GUFA 2HUPA 4WT7A 2IA6A 2BCGY 5GJWC 3NDJA 5IKOA 2QUAA 3C1OA 3UK7A 3AXSA 2BQRA 3KTDA 3VR4D 3V6HA 1JQLB 2IPLA 3AY3A 1UHUA 2OHGA 1IOZA 4OJPA 5ISMA 3PCXA 3R5TA 4N9QA 4FW9A 1UDXA 1G20B 4K9PA 5HKLA 5EPOA 1NZPA 4ND8B 5JCJD 3ONFA 4CN8A 4ZDJA 3RLIA 4WE3A 4BE7B 4TTIA 5LN1A 3DOEA 5AD1A 4GD3Q 4D02A 10MHA 3HP1A 1G2PA 3IE0A 2BEVB 3E5MA 2VQFB 5M3BA 3MELA 1OAKA 2RAVA 3EISA 1Q7GA 4IO1A 5KG3A 1NVKA 3O1LA 3R8FA 5LOVF 1HWYA 1UBUS 1ONPA 1E9FA 1N0VC 3VPCA 4LJYA 2R8EA 3C1TA 1GDHA 2DL0A 1WXHA 2ADOA 3DO8A 1OQAA 1PF7E 1XDWA 1VBFA 5HUHA 3VV3A 1AN0A 1G8YA 2ZTSA 4EPTA 2VK8A 4IH1A 3PX4A 3J7TA 4JJAA 2YMPA 2YWBA 2YY7A 1XMPA 3ISCA 3QV1A 2P27A 3GLHA 1L3UA 4JBWA 1K98A 2YUIA 1I2BA 4OMFG 4I99A 3R09A 4WESA 2PL5A 4G37A 2R7LA 1DEHA 2HXGA 1JEOA 1HL3A 2Q6OA 5EVCA 5DNWA 4D0NA 2XUJA 1O8BA 1L7AA 4MUGA 3SLRA 2BJHA 3C5CA 3S2UA 3U81A 2QN3A 1JILA 1Y81A 3TI9A 1BFUA 2GMWA 1I33A 2OD7A 2MOKA 5KFZA 3NLLA 2G28A 1GWNA 1D7OA 2E0IA 1L8QA 4E5NA 3OZXA 2HK8A 1KXJA 3CH7A 1L5SA 2DSTA 1OI4A 2C5GA 3AI2A 2WIKA 4RK6A 1L5ZA 3QJ5A 1B16A 1UA1A 3T34A 1KQQA 3KR2A 3GFFA 1S4MA 1Z35A 4DV2B 5M5BA 2N1MA 3NDPA 4A3SA 4UQLA 1CR6A 3K72B 1JQEA 1JHQA 3CWQA 4C7OB 4KXUA 2FN3A 1U2GC 2WZQA 2F3RA 3ZE7A 1YVUA 1ZQPA 4I2HA 5KFSA 2C1XA 2WTMA 3RBEA 3RVDA 4FIDA 4NH4A 3EW9A 4YMGA 2Q50A 2ZRAA 1DTWA 5D46A 2QAJA 4JDUA 2YW9A 1XVUA 1FVXA 2DSNA 1N7GA 4MFAA 1E4VA 2L82A 5F9FA 2HCBA 4Y2JA 4U6SA 4D9BA 4B3HA 5J4YA 1HKHA 5CMLA 1E1MA 1EQAA 1M6VB 1DAKA 3R1IA 2C5AA 3AF6A 1YDHA 2J07A 1SBTA 1LVGA 2R8OA 2HPZA 1PCXA 1FJHA 2R6ZA 3T7RA 3IJEB 1E1QA 2DT5A 8ICSA 2Y4NA 3BUSA 1XQ1A 2P2YA 5KT6A 4AZ3A 5IIJA 1KSPA 2JC3A 4K40A 5J2KA 3ENQA 3DAPA 3P0FA 3FKSD 3EYZA 1LI5A 3A8TA 4H3HB 2RGRA 2XYRA 3CCFA 3UHPA 5KJFA 1E6EA 2YV4A 4UHBA 3SF8A 1JQAA 3D8UA 4OHRA 3ER9A 3L7KA 4OHYA 2I8AA 4KQCA 4R64A 4GM1A 3T4PA 2ZRKA 3EVEA 1ONSA 2Y1IA 3MSCA 1QRDA 4H77A 5AM4A 1QP4A 1KRPA 2O52A 3E9ZA 5K0TA 3NTQA 3L3FX 4M7WA 3JQ7B 3HEBA 4PTYA 2H52A 1V43A 5IVPA 1NBIA 4M1WA 1QDLB 1I7NA 4IIXA 4YEDA 1G291 5EWFA 2QXYA 3V4RA 2VJMA 2VJDA 1SWWA 4ETMA 5AI9A 5JLJA 3CUWA 3PQ7A 4M04A 1V7ZA 5L1LA 2G04A 2OO5C 3PGXA 3VSAA 2C7RA 3A3KA 3GDHA 1XJQA 5LMUB 2P8SA 3VMMA 3L0DA 3S29A 4LV8B 1QX4A 1IB6A 4B7UA 3G82C 3PX3A 3JATA 2HRDA 4P4LA 1Q11A 1RLIA 4PQRA 4MR9A 2PI4A 1GIAA 3ZS8A 5C4MA 3K9QO 2OP1A 3IULA 4LC1A 4DS3A 4RGQA 4EL0A 5A7FA 1R27A 3VFDA 5K5EA 2EZTA 2K8BB 4GOLD 4FILA 4B7CA 2HN9A 3W5UA 2IDZA 4A8JB 1DBPA 1JAHA 4OXYA 4LC0A 3REQA 3JASA 2CJPA 4LVOA 2FG7C 1UDRA 5JQGA 2AMYA 3NM6B 4YLEA 5LSAA 3W7BA 3C5VA 4XB6B 3HUUA 2MYUA 2MSKA 2TMYA 4J49A 5E7MA 4ICAA 5DW3A 4BPRA 4N48A 3EZFA 3DFIA 1QE5A 1VQ1A 2J7PD 4B4KA 3M8SA 4I2GA 1G21E 1V9LA 3T7AA 1D8LA 1DGJA 4HC4A 3BL5A 3CB4A 3IOYA 1QZ3A 3AEYA 4L5JA 2FCRA 1AKQA 4F46A 1C7JA 4PLTA 2KI5A 4KQMA 2H1HA 3Q0EA 3CR8A 5H0IA 2EG9A 5BO5A 2ZRNA 2D7DA 1P5HA 4FCCA 4DL9A 2R00A 1CD5A 1U3VA 3ZHUA 5GVSA 4ZJPA 2V7VA 2VXBA 3PICA 3HWWA 2Y3IA 1L5LA 3SKXA 1ZNZA 2VJYA 4FFNA 5EZ5A 2NVUB 2JJ2D 1ZQBA 4EVQA 3KHUA 2GJKA 4ZEWA 4J16A 4UM5A 4NCNA 2AQ8A 4EB3A 3ZE1B 1PWXA 4PGMA 1OX5A 5EI5A 4JU8A 4WZAA 4YRAA 4HFMA 2YNMA 4M9UA 1E99A 4YRTA 2WP0A 3NAGA 1E8MA 2JIMA 3W6ZA 1P77A 4NJEA 3ZUGA 2PRSA 4P3NA 2C8KA 1H66A 1UAAA 2ZSEA 1GG9A 2I87A 2WM9B 1SBQA 5IDQA 2OFWA 2MAXA 4UZFA 1JYEA 1JHRA 3LPDA 2KE5A 2BFMA 1I80A 1G0OA 2RD2A 4JQSA 1T13A 3EBLA 3NG1A 2RP5A 5JOQA 5CFLA 4YMNA 3RWOA 1C14A 4OQNA 1PG0A 4C76A 3VZPA 2G06A 1WR8A 3LK7A 3U80A 5C81A 1TT7A 4Z9XA 3KE8A 4CBVA 3PMNA 4EG7A 5J0TA 3TBHA 3C24A 2F90A 2DETA 4LRXA 1THZA 1SXJA 3W5JA 1XYGA 5K3SA 1CDEA 4DJTA 2FEAA 4OQPA 1WUHS 1T9BA 5HQTA 2CNNA 5FUYA 4GPTA 3TGPA 3PEUA 1R8YA 4OP1A 1T2FA 3RT1A 3UXEA 2KMLA 4BQEA 1LWOA 2W5UA 5JCOA 4CKWB 3THWA 1NE2A 1NE7A 1E6WA 4C01A 1AXRA 3PRYA 1XXHA 2F44A 5EUBA 2SKCA 2NSLA 1ZRHA 2H0QA 2VWHA 3W8DA 3VR4H 1GCUA 1HIWA 3TS1A 3COYA 4UPVA 1VKZA 1N0WA 4K8OA 3QI2A 5SV2A 2XODA 4E30A 2I62A 4H2DA 1DAMA 3VNSA 4R3UC 1YKSA 1J0DA 4IRCA 5IDWA 1W93A 3CX6A 2YVUA 5T67A 2DERA 1IZYA 3JQEA 4H27A 1DNPA 2QIPA 4MJLA 1H5UA 4MVJD 4N49A 1SXGA 4BBAA 1HE2A 3OPYB 1SOWA 4Z51A 1PWEA 4MKFA 3PFFA 1P7WA 5A3RA 3EQ8A 5AICA 2AMLA 5L51A 4RVSA 2HJVA 3IMGA 3OLZA 3RJTA 1P39A 5ELXA 1OXJA 1QHHA 2YVKA 5JJBA 3PUHA 3RH6A 4RHEA 5CB4A 2R66A 1JH8A 4E70A 3WK4A 3SS8A 3EJWA 2VOEA 2X42A 3L0SA 3PDIA 2GVDC 3VUFA 1KI4A 1Z15A 2AX3A 2FP3A 2PJUA 1POWA 3OZFA 4GI1A 2INGX 3TNFA 3A1DA 3RK4A 5CPBA 5F9MA 3PNYA 3BE5A 1ZI6A 1W9MA 3FYTA 3QVXA 2E4ZA 3IEIA 4RORA 4M3NA 2I3AA 2IX9A 2B0JA 3UJ7A 3P9QA 1T10A 3RSSA 1T91A 1TTQB 4UDYX 2WFZA 1U8XX 5E7QA 1SBYA 3ADBA 1DS6A 2ABWA 5JPCA 2W00A 3AKDA 3L8GA 2PKXA 4PZCA 2O05A 3UHFA 2WAAA 4QDJA 1GQ2A 2RHMA 3RDPA 2ZTVA 1Z8HA 3TF5A 2QE7D 4Q4JA 2ZE6A 2FI1A 4UHHA 1UZAA 1PV4A 2YDYA 2WT9A 2XY5A 1ZQRA 2Z1NA 3GMSA 1U3TA 5IAJA 1GCIA 3U56A 3EZYA 3OJ0A 3I8OA 1VLQA 4TS4A 3DPIA 3R3UA 1BVSA 4YRJA 4M0LA 1ZRNA 3ZE2B 3WZMA 1FP6A 3GP5A 2C95A 4BEWA 1M66A 1ZITA 4JVOA 2IHBA 2LPEA 4QYIB 2W6MA 3WI7A 1WKBA 3F6YA 3KFLA 5IJ0B 3PSIA 1U5CA 4ID3A 5J5AA 1XZQA 2OUKA 3LPNA 3WO1A 1JMSA 1KI1A 1Z0ZA 2A67A 4G89A 1OFUX 4YCBA 5T8KC 2WPDD 1DU4A 4V0LA 3D4NA 1D6JA 5J2UA 3I34X 4O5AA 1L4MA 1M6HA 3O91A 3WWZA 4FVTA 1UOQA 6ADHA 2FVXA 3ZWKA 4Q03A 1E3EA 4F93B 2VKQA 3RAFC 4ENRA 5J2FA 2NXEA 4IOKA 3F5FA 1QGOA 1JPUA 2A33A 4DMRA 3HA7A 1UKZA 2N0SA 4QBTA 1G8PA 3UPTA 3SJAA 3SZOA 1GRRA 4B7XA 2OV2A 1T4CB 2EWWA 1JIIA 3CPEA 1DJNA 3JWPA 2Q9AA 1ESMA 1PK7A 3Q9NA 3LNCA 1X66A 3TTTA 2KTQA 4QPJC 4R8LA 3A3PA 4L6CA 2ACEA 4XCXA 3HKDB 1N48A 5TQ0A 5I7VA 2AHRA 4R7ZA 5JJ5A 4DJFC 3C4VA 1RXYA 3R0JA 2REXB 4RKFA 3KKOA 3QVJA 3RAQA 3B0YA 2N46A 4PHHA 5C2JB 2JZBB 2HV9A 4ZDIA 1TYDE 1QHEA 3VGPA 4WOJA 1LQ2A 1XDBA 2QGZA 4HN2A 1IVYA 4HAIA 1A77A 4D8UA 3AONB 3S8YA 2QK4A 5LUBA 2B94A 4QJ3A 1AN9A 3UICA 3EAFA 3HCRA 3CC8A 5GPBA 2Y0PA 3F8TA 1FJXA 4I9FA 1KYXA 2A2ZA 5ALVA 3IAXA 2BEKA 4MVXA 4LDPA 4NG4A 4EABA 5HFNA 4LHEA 1RKBA 1S89A 3AY7A 4OK6A 5KYNA