2E8MA

Solution structure of the c-terminal sam-domain of epidermal growth receptor pathway substrate 8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor kinase substrate 8
publication title Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18016 SAM_3 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8mA01
3SEIA 2QKQA 2QB0B 1SV0C 1Z1VA 2KSOA 3TACB 2DKXA 1UQVA 1F0MA 3BS5A 4IS7A 5JRTA 3TADA 3BS7A 1SXEA 2D8CA 1KW4A 2F44A 2L5YA 4RQNA 5KNIA 2E8NA 2K4PA 1X9XA 2YTUA 1V85A 3KKAA 2KSOB 2QARA 1X66A 2E8OA 1X40A 2GLEA 2LMRA 4NL9A 5F3XB 1SV4A 2E8MA 1SGGA 3BS5B 5JU5A 2B6GA 2KE7A 1LKYA 2F3NA 5L1MA 3H8MA 1PK1A 2DL0A 2EAPA 2QB0A 3K1RB 1OXJA 1SV0A 2EAMA 1B0XA 2F8KA 1PK3A 2KMDA 2ES6A 3IDWA 1RG6A 2DKZA 4MHVA 5J8YC 4PZOA 3TADC 1WWUA 2K60A 2Y9UA 4RQMA 2QB1A 3HILA 1PK1B 2KIVA 1UCVA 5JTIA 2LPEA 1DXSA 2EANA 1WWVA 1V38A 1OW5A 1COKA 3KKAC 2QARB 5J8YA 1SXDA 4NL9C 1JI7A 2EAOA 3BQ7A 2ESEA 2KG5A 2E8PA 2JV3A 4PZNA 1B4FA 2FE9A 2D3DA 4NJ8A 3SENA 1LKYB 2Y9TA
chains in the Genus database with same CATH superfamily
1ZETA 3FYHA 2A1JB 3N28A 2J6UA 1J2NA 4M9NA 1ECWA 2EDUA 1GO3F 3M6KA 5KFLA 8ICRA 2ZTCA 1MQ2A 2W7PA 1TAQA 1ZD2P 7ICJA 2E1FA 2L5YA 4JB3A 3M8SA 2ISOA 1MQ3A 4PL2A 2G5IB 4WJ3B 2FPMA 1JN3A 2KJ5A 4USAA 2M9NA 4KLTA 2ZTEA 1TAUA 2VA3A 7ICLA 2YY6A 4AYBF 2AJQA 2P6RA 1IM4A 5HMMA 2VIXA 3K4GA 8ICWA 2W9AA 1CI4A 4I2EA 1ZQDA 1SWVA 2EAPA 3ZDDA 1JXEA 9ICXA 5KFUA 1U4BA 1TK5A 2K8CB 8ICQA 4R8UA 1XO1A 4IQUA 1C7YA 4KLOA 4JV0A 4PZOA 3GIIA 2K4EA 1UHUA 4MEYA 1NKBA 2KIVA 1N5XA 3AM9A 2BPFA 4F4YA 1ZXIA 4GXIA 2K4HA 3MBYA 2RQ5A 4DOAA 5BPCA 5IINA 3PZPA 3U26A 9ICOA 1KTQA 5KG6A 1U47A 1X9SA 4C4SA 2JEGA 2QKQA 4QZAA 1NJXA 1ZQLA 3C2MA 2FMQA 4KLDA 5L9XA 3SI8A 3MFHA 4UAWA 2DFLA 5DB7A 5KG3A 2HHTA 3AQEA 1O08A 3ZDCA 2ZUDA 1N2XA 2W04A 3PR4A 4Q8EA 3OJUA 4I28A 2W9CB 4I2JA 5AICA 4PHDA 3CRXA 3ED5A 2F8LA 3WKDA 2XVTA 3PX0A 3RJHA 1VJ5A 1U45A 4B9NA 5AKJA 1X9WA 3M9OB 4PGYA 2LBOA 4P0QB 4U6PA 5CWRA 1HEKA 4I2GA 3B9JA 2ZJ8A 2PXIA 9ICJA 4I29A 3RB0A 5DBAA 5ALGA 3HT3A 5HR7A 2KE7A 3QU9A 3UQ0A 4EENA 3BJYA 2AXTU 2HHUA 1BNOA 1SV0A 4O3RA 3HPOA 3IV6A 1KLNA 2D6FC 3UQ2A 4P0PA 4PHAA 4C8MA 4ACOA 2Y1IA 3RJIA 1F5SA 3Q8LA 2P66A 3IN5A 7ICUA 4M2YA 2RRDA 3PX6A 3SQIA 5CA7A 1FEZA 4F92B 4DCCA 2ZXHA 4YG2A 1RXVA 3VC8A 3WKAA 2BQUA 2JGAA 4YXJA 2R8GA 4O3SA 2EANA 2V9WA 2H3VA 5JUMA 3OSPA 4M9GA 2IOHA 1Q8KA 4NY8A 3NVVA 4GC6A 4PZNA 8ICGA 4BXOB 3IHQB 1O03A 4NLNA 1D8LA 4RPZA 5DDMA 2XI9A 3GV5B 2KSOA 1M6YA 2PI4A 1VDVA 5L1JA 2ATLA 4R8UB 3V7KA 4UW9A 4DSKA 4GIBA 7ICQA 8ICUA 4IQWA 3TFRA 2E8NA 1BPYA 3V6JA 3L4PA 2JEJA 4Z6EA 1X9XA 1HUOA 2YMPA 3IRUA 3DEEA 2YQEA 1RYUA 5DB9A 2KZ3A 4YD2A 3ETLA 4JK1A 3QZ7A 1X40A 4F5NA 4RNOA 4RT2A 5AI9A 4C0ZA 2XIDA 5ALFA 4J9KA 4F5OA 4UB1A 4EEYA 3PSFA 9ICIA 4LJXA 4ECRA 2IHMA 2A3VA 1ZQKA 8ICNA 4IR9A 3I76A 4DSFA 3EWAA 1U49A 1ZQZA 4C80A 4QWAA 2E3TA 3MC1A 4NM1A 4FS1A 4KLQA 1J97A 5DQGA 5KL1B 3GIMA 2VJ4A 2FPLA 4B6JA 5AM2A 1ZQRA 3NGDA 4M9JA 4PGXA 1ZQIA 2R8HA 5EWEA 1S0MA 4RPXA 2GOLA 5J0WA 2NYVA 3BQ7A 5KFEA 3RBEA 1ZRNA 5KFKA 1ZQVA 5EE9A 1ZQJA 4CNQA 4Z6CA 5C5JA 4DF4A 3Q8QB 5KG2A 4KX3A 1Z1VA 4PH5A 3UXPA 1S10A 1Z00A 3D2SA 1BGXT 2JEIA 4DL7A 1TFRA 3H8SA 2MA1A 3QYPA 9ICEA 2IHNA 4M6WB 2BKEA 4M9LA 4TURA 4U7CA 5BOMA 2BQRA 3QU4A 3RFAA 1SL2A 2EZYA 1ZQSA 5ALOA 4O5EA 5ALQA 1SV4A 2RDIA 1WG8A 2VKQA 2KK0A 1AQ6A 4GC7A 5IILA 4YFKA 4JV2A 1KQQA 1K1QA 2ODGA 2QLTA 4QZCA 4DFMA 5F9NA 7ICGA 3UPQA 4UAVA 2ES6A 3E58A 1KFSA 9ICFA 1NOMA 2GWSA 1RG6A 4EZ6A 1L7NA 3V6HA 2WB1C 3SV4A 1NJZA 1Z3EB 5KFPA 2OEHA 4ELTA 2JHDA 1PK1B 2A1JA 4FFDA 1PVQA 3PO4A 1TK8A 1DGSA 5KT2A 5TZVA 2OM6A 5KG1A 3ORYA 1CRXA 5B5EU 5B66U 4JV1A 5ALUA 1NZBA 1Q3UA 4KLEA 1SIJA 4RQ4A 3AMZA 2FLLA 3PW0A 2J6SA 9ICHA 4QZFA 2K89A 1RQLA 5F9LA 8ICJA 3TANA 4KITB 4DFJA 2BGWA 3SR6A 4OD0A 1LVHA 5AM1A 1QQ7A 3WK6A 2NV3A 5HR6A 1LB2B 4ECXA 4J9PA 5KTQA 2XY5A 3SZ2A 7ICHA 1ZQOA 2F44A 3G6XA 3OPXA 4RQNA 4F4KA 2VANA 1QQ6A 2AH5A 1TAMA 3EPIA 4PJ0U 3T3FA 1Z1BA 5DGBA 2AGQA 4P4PA 4UBCA 8ICZA 4NM2A 2P35A 2BCRA 5KFOA 4QWEA 1SGGA 1TK0A 1KSPA 3OTQA 2F3NA 2JXJA 1IXRA 4Q43A 4O3PA 3KOOA 4UB5A 4QJFB 1JXLA 3H0RB 3BDPA 5KFXA 1ZD4A 3NTUA 4DLGA 4ICAA 2F1HA 4ED8A 4XUSA 2HBMA 1ZQ1C 2ZIXA 2ALZA 5AKKA 2ZG6A 3MGVA 4KX5A 3SV3A 4KLIA 3SMVA 4FE3A 1X2IA 3QEBZ 3THVA 3L5KA 1AROP 2HI0A 3WK4A 4F93B 2QB1A 3IG8A 3MR5A 2HW3A 4Y2SA 3D2QA 2G0AA 3QU7A 2FPKA 4XA5A 3UXNA 2IOFA 4RQ3A 5KG7A 1HJPA 8ICIA 1TE2A 4QNLA 4NL9C 4KLGA 1BNPA 4Z6DA 3LWMA 4J9OA 2WAQF 4O3MA 2KP7A 2W9CA 5AKZA 5KFZA 4M47A 3SENA 8ICFA 4CGZA 4RZRA 1L7MA 1ZQQA 4Y2JA 1SKSA 1Z19A 4Y2QA 4RQ6A 4P0QA 2G08A 2VA8A 5DKWA 1S0VA 3C28A 4O0IA 1URJA 3V7JA 4M0AA 1MC8A 4F50A 3PY8A 2W54A 5AI4A 3TFSA 7ICSA 1UA1A 4QZDA 3KHRA 3JPOA 5ALYA 4NLBA 1COOA 2AQ4A 5KNIA 2YTUA 2WTFA 1ZQPA 1MN8A 3K75D 4UB2A 1NK5A 4MF8A 3EW9A 2ASDA 5KFGA 4RQ2A 2BCSA 2GH1A 5F3XB 3AU6A 2LM4A 9ICVA 4C7ZA 2W9BB 1X6JA 2Y0SF 4KTQA 3F5AA 4O9MA 8ICLA 4AYBC 3A0HU 2KICA 5KFIA 4RQ7A 5ALHA 2QB0A 1QSSA 1UA0A 4PHPA 2OCEA 2RP5A 4R65A 2HHVA 3I1YA 3F2DA 3LYSA 5ALVA 4UB3A 4FBTA 4BXOA 1MSWD 3TADC 5G5GA 4B9VA 9ICLA 3TAPA 2HVHA 2XY6A 5KFCA 4P2HA 3C1YA 1DXSA 5DQIA 1WUDA 2NO4A 5KFYA 2YMLA 3IM1A 9ICTA 2KG5A 4F3OA 5AKHA 4R66A 3WKBA 4BJQA 3H0LB 4NLZA 1QQ5A 1PVRA 3HKZF 2W8LA 2DBYA 4QWCA 2I9GA 3GILA 5HNKA 3HX0A 3TACB 1F44A 1SKWA 2ZIXB 3DV9A 2NRZA 1NK9A 3PSPA 2Q4TA 2PFNA 5KFFA 3RTVA 1L5UA 2G07A 4DFPA 1ZQCA 1ZQFA 4Y2VA 3OJSA 3GDXA 2PI5A 2V4QA 2MUTB 1KBUA 5J2AA 1Z4OA 2QARA 1IV8A 9ICAA 4CF5A 3H40A 1X9MA 4JWMA 5KFRA 5EE3A 1DGJA 1X42A 4F2RA 1DOQA 5IIIA 1ZQGA 4M9HA 2G06A 2OXOA 4DQQA 2CXYA 3E2EA 5IIOA 2XO7A 5KFVA 2IA6A 1PK3A 2LYBA 1A6SA 4DSJA 1UPHA 5CR0A 1B43A 3GQCA 2R8IA 1U9LA 1C20A 1JMSA 1XC9A 1LV5A 3MGIA 5CB1A 4B9MA 1KFDA 3O0FA 2AGPA 2YB1A 2KV2A 1FFVA 5KFMA 4UAYA 4M04A 3H4BA 3B0YA 4RQMA 3EYZA 9ICWA 3MDAA 2EZXA 5AIBA 4YP3A 8ICEA 2HHSA 4DSEA 5CEHA 1UT5A 3RB3A 4US8A 9ICBA 2W03A 4KLUA 4DL2A 2WF8A 2ZIUA 4ECVA 3QEAZ 1D8BA 2ESEA 5IIMA 4EYIB 3H4DA 3TKAA 2B0CA 2K8AA 4M6WA 4P4OA 4QWBA 5AIAA 4FBUA 4J9MA 8ICXA 4IRKA 2W43A 2QB0B 4OJOA 4NLKA 1CUKA 3OHBA 1SZPA 2HVIA 2YN4A 3WK7A 2F1IA 4J9QA 1T4GA 3TI0A 4K4HA 3BS7A 4F4XA 4K4GA 4O5KA 1L8OA 1SKRA 2HHQA 2JEFA 1Y88A 3CNHA 2HSZA 4BX9C 1JROA 4YR0A 1ZQYA 2W7OA 3KD3A 4G3IA 4I2FA 4NL9A 5J0PA 2NRTA 2PKEA 4I2BA 4YN4A 4QZBA 4NWIA 4I27A 3BS5B 5KFQA 1JUDA 3BQ1A 4LVSA 2KVCA 3SAHA 1LKYA 3LVWA 1KL9A 2F77X 5L1MA 1PK1A 3FAHA 4Y2UA 3N97B 1B0XA 5AI5A 3RBDA 5KFDA 2FLNA 4JMUA 4G9BA 5J0UA 3RJJA 1XS9D 2EQYA 3C5GA 1Q3VA 2W3RA 4QZEA 2OH2A 1ZQUA 1L8LA 4I2AA 1BPZA 7ICEA 5ALNA 4IQVA 2BZFA 3KHLA 5J2HA 1N63A 1ZQXA 2F76X 4ECUA 3EPGA 2KNJA 2EZZA 4B9UA 1FO4A 3RJEA 4DL3A 1EXNA 2QARB 4J03A 1BPEA 2EAOA 3PR5B 2KHVA 4Y2RA 2FE9A 4UB8U 3UXOA 5J2JA 5DLGA 4ED0A 2AU0A 4FO6A 4EEKA 1PZNA 3ICXA 7ICTA 7ICIA 4ECZA 4O5CA 4HYKA 5TISU 4DOBA 5DG7A 4F71A 3QUQA 2XY7A 1ZJMA 3T5LA 4F5QA 5AK6A 1KEJA 4KMOB 3GU3A 5J2GA 3TADA 5GTIU 1L7OA 1QSLA 2BDUA 2D8CA 3BZKA 4QIWC 3Q8SB 5FP0A 7ICNA 3Q8RB 1L3VA 5AK5A 3LDAA 3PW4A 2NO5A 3RJGA 5EWGA 1ZRMA 1X66A 5HMLA 5E79U 4J9RA 5J2BA 4KMUA 2HHWA 2ZIUB 4GFJA 4DLEA 5H2FU 4BGDA 4F5PA 2C28A 2XCAA 2CRXA 1YT3A 2KD1A 2ZIWB 4QIWF 4NXZA 4BWMA 5L1KA 4DQRA 3FDSA 1XU4A 2EAMA 3QUBA 1YZ7A 4QZ8A 4LZGA 5J29A 1U48A 2G09A 4I2IA 2KMDA 5J2IA 5DLFA 3QU5A 2FMPA 3RRGA 4QZGA 5ALJA 1XSNA 2DKZA 3D2NA 3Q8KA 4J9SA 2B21A 2G5HB 3V7LA 2DPIA 5DB6A 5DQHA 4DL6A 1L3TA 4FZLA 1KKXA 4X5VA 3NRWA 1ZD3A 1SL0A 1ZQTA 5AI6A 5A0LA 4ECYA 2OWOA 8ICYA 2F1JA 1ZQHA 4MFCA 1L3SA 1WWVA 4Y2TA 4DSIA 3PNCA 2HCFA 1A77A 3PO5A 4EX6A 1CEZA 2XCPA 1NK6A 3RR8A 2HOQA 2Q0ZX 2E8PA 1TV9A 5KFBA 4RPYA 1LKYB 1T94A 3IG5A 4UB6U 4OJ5A 3R9KA 4JUZA 3GIKA 3ZDBA 4F8RA 5ALXA 2MSNA 3I28A 1WCNA 1XSPA 2RHFA 1JX4A 3K1ZA 2W9BA 2H3ZA 1T3NA 2FDRA 3GZFA 4IR1A 5KT5A 1SL1A 4UASA 1XSLA 3LVVA 2PMZF 3AEVA 3M7DA 4DL4A 2GLEA 2LMRA 2E8MA 5KT4A 3G6VA 4MEXA 5JU5A 5DDYA 1S8OA 4F4ZA 2ASLA 4NLGA 2AGOA 2P6UA 3JPSA 2R8JA 5J0QA 5AK3A 2XICA 4DQSA 2Y1JA 3AN1A 3C2LA 4OJPA 5ALLA 5AKXA 4ED7A 4JWNA 5CRXA 4F91B 4TUQA 4AP9A 4YMMA 3F5EA 4Q45A 2ISPA 1N62A 3SAGA 3RH4A 4MHVA 3AUOA 1S97A 1BVSA 3HWTA 4KLLA 3WKCA 4PHEA 5KG5A 4DFDA 3NASA 3Q8MA 3HILA 5C0YA 5J2DA 2DWQA 2KJ8A 3RJFA 1QSYA 3SAFA 5DG8A 1NKEA 5T14A 4YR3A 2ZUBA 5KG4A 2ZJAA 2C22A 1JI7A 3EUB2 1JALA 5AHXA 3OGUA 8ICVA 3F2CA 3N7RC 5J2CA 1KRPA 1ZJNA 4NJ8A 2KN7A 2WAQC 4J9NA 2LM1A 4E0DA 4YMOA 9ICMA 3PW7A 4PGQA 4ELVA 4RQ5A 2MUTA 3RF9A 5AI0A 1V97A 3PV8A 2DKXA 2IBKA 5DBBA 4PL1A 4TUPA 2C2RA 2WFAA 2ZUCA 4QW8A 3AL0B 3B0XA 2HBJA 1T3QA 3OHAA 1NI3A 4IQTA 4DSLA 3CW2C 5DG9A 3PW2A 5KAIU 4UBBA 4I2CA 2I1QA 3UMBA 2NRXA 1ZQBA 2H3FA 2KEYA 3JPPA 2Y0SC 2FLPA 2IOFK 4QZ9A 2N1RA 4O3OA 2LKYA 4ZH4A 4RT3A 3C2KA 5IIJA 2W9MA 2KHQA 3V6KA 5AKIA 4ED6A 3MABA 3QUTA 1ED1A 4DOCA 1NK0A 2W8KA 3KZIU 4IRCA 1ZQNA 5AKYA 2JZBB 2I5HA 1WWUA 4US9A 4GLXA 1SZHA 3MDCA 4ELUA 1H38A 4C7YA 5JTIA 3MR6A 3F2BA 3DDHA 1QCKA 3IP4B 3JPRA 5KAFU 4UQGA 4DWIA 5EWFA 4RUAA 5J8YA 1SXDA 5BOLA 2NRWA 3A0BU 3N7PD 4YR2A 9ICCA 4I2DA 1B4FA 1SWWA 1J2MA 4DEZA 3QZ8A 5KFTA 1ZD5A 3ETRA 2JH7A 3HKZC 5L1IA 3SD7A 2KIWA 4CRXA 3RRHA 3LWLA 5ALMA 3BQ0A 4OJ6A 3HW8A 3HP6A 8ICSA 3WU2U 3RH6A 1L6NA 1QH9A 2ZIVB 9ICNA 2MU2A 2UVUA 7ICMA 3BS5A 3FM9A 2KZZA 5JRTA 1KFTA 1VLBA 1HUZA 3M1YA 4DO9A 4XQ8A 4TQRA 2YB4A 9ICUA 5KFJA 2R8KA 3RJKA 5D4BA 2W3SA 1NJWA 3EZ5A 5ALSA 1FIQA 3JPTA 3H7IA 2H3IA 5ALRA 4OCZA 1XNSA 1S0NA 7ICKA 2VJ5A 1WYGA 3QX7A 3C5FA 3C29A 2B6GA 2RLTA 4F5RA 2V4RA 4QZIA 3WKEA 4YCXA 3HJEA 1RYSA 2VA2A 2WF5A 3MFIA 3PSIA 3RB4A 2UVWA 1ZQAA 9ICPA 3M9NB 4F2SA 7ICRA 3MR2A 3T5HA 4IRDA 3T5KA 1ZOLA 1N56A 2HMXA 9ICGA 1X6IA 4FS2A 4UATA 5DBCA 4RQ8A 9ICQA 4DQIA 5AKGA 3QNMA 1N48A 3RAXA 5HHIA 3CP8A 4J9LA 1OW5A 4CF3A 4EELA 3RB6A 1WCLA 3M9MB 4GXKA 4RNMA 4IL6U 1NK7A 5KFSA 1PUZA 5ALEA 2IMWP 4O3NA 3ZDEA 4Y2PA 4EX7A 2DF4B 4TQSA 3RR7A 1UQVA 4DFKA 2DUYA 1SB3C 1RYRA 1IG6A 4KN7A 2I6XA 3UMCA 2EH9A 3PVXA 2ZIWA 2HBKA 4F4WA 3ISCA 5CP2A 3H0MB 4Y2XA 2AHOB 3MR3A 3KFUF 2BR0A 2CPRA 2BQ3A 1D8YA 4RUCA 1RPLA 4QW9A 2MAXA 2OYYA 5KT7A 4O3QA 2WF6A 1N61A 2FMSA 5K4LA 4KLFA 1Z4NA 5GTHU 7ICPA 1OXJA 5AKLA 4ECQA 3GIJA 3S6JA 2NRVA 2ZXIA 3IDWA 5IIKA 8ICOA 3ALRA 1RDFA 3PMLA 3C1ZA 4UARA 4CCHA 1K1SA 3NRZA 1XO0A 1OUQA 4R64A 8ICPA 2K60A 4K4IA 4FZNA 1PVPA 4BUGA 1ZYQA 1A0PA 5EOZA 4CF4A 2HDOA 2KVSA 2ASJA 4FZMA 4YVZA 3ZD8A 1COKA 3KKAC 2OHFA 4B9LA 2O6KA 4QZHA 5ALTA 5KFAA 4ECWA 4EZ9A 2ZTDA 2F2AB 2UVVA 4MF2A 2E1EA 8ICCA 3SEIA 5KT3A 1S76D 3H8WA 4Q44A 4NV0A 2BDPA 1YZ6A 4ED2A 1RQNA 3GV7B 4XRHA 4ZOHC 5KT6A 2C2EA 2YX8A 2E5SA 1NNLA 3JPQA 4B9SA 2MRLA 3NVWA 4KLSA 5J0RA 1F0MA 3KZXA 4IS7A 5AM3A 3QUCA 8ICTA 1SXEA 5CJ7A 2FJ6A 4DQPA 5AM5A 2K4PA 1DK3A 4RQ1A 4UAUA 5AKEA 1NK8A 4F72A 2K4IA 5ALZA 3F53A 5AM4A 3BQ2A 5DGAA 2LI6A 3ONNA 3AU2A 4C8LA 4EBCA 3N7SC 2YMMA 2DL0A 4YD1A 4RU9A 2WHEA 5AK4A 4Z6FA 3OSNA 2KTQA 1N5WA 4DF8A 1L7PA 1A76A 2A1AA 3QU2A 2XGPA 4ED3A 4CDGA 4OO1J 3QXGA 8ICMA 2KJ9A 3FC4A 2ZJ5A 5J8YC 3T5JA 5EE1A 8ICKA 2JMGA 7ICFA 5KG0A 1NKCA 3WK8A 5J0OA 4RNNA 5ALIA 2XGQA 1NZPA 4EBDA 7ICOA 5AM0A 1XWLA 5J0YA 5EE0A 2GO7A 2LPEA 1V9PA 4P0PB 2BCQA 5ALKA 1V38A 1T8EA 3RAQA 5ALDA 1QLNA 8ICAA 1S0OA 8ICBA 1RZTA 4RQ0A 5HHHA 3GFKB 1ZQMA 1D9FA 2HBLA 3ZDAA 1FFUA 3C23A 2W11A 1P7DA 3L3FX 2DPJA 2PFQA 4QWDA 1L3UA 2PFPA 1RXWA 3NS1A 2KKVA 4KLMA 4MFAA 1KDHA 2HHXA 4A8EA 5D46A 3PX4A 3TAQA 4BWJA 2C2DA 5L1LA 3NUQA 4ECTA 1KW4A 2BPCA 1S9FA 3E0FA 1JIHA 2KFNA 3PSTA 2JH1A 2DQNB 5D49A 1V85A 1MA7A 4KLJA 2KSOB 2PMZC 5J2EA 1QTMA 1KN5A 3AQFA 2JZBA 4PPXA 3ZD9A 5KFNA 3M8RA 3H8MA 3KHGA 3NVZA 7ICVA 8ICHA 3K1RB 4OJLA 5AI8A 2DGZA 3G6YA 2F8KA 1RM6C 1D9DA 4C4TA 1BPDA 4YXMA 2WB1F 4P4MA 1TKDA 4Q8FA 4C8NA 5J2KA 9ICSA 3RH5A 1DRGA 2Y9UA 3Q8PB 4ECSA 1ZQEA 5ALWA 3QE9Y 3TQ1A 1UCVA 2JRZA 3D6JA 4GXJA 2A19A 4R63A 1DK2A 2M0NA 2ZIVA 4DS4A 3V72A 1NK4A 1BPXA 2RDJA 1UT8A 3UMGA 2J6TA 3KHHA 3HRDD 5KFWA 3BZCA 1SV0C 2H5XA 4CE6A 5G5HA 4KN4A 4EYHB 3BQTA 3LK9A 1S5LU 3KTQA 4Y2YA 2W55A 1IIPA 3TARA 3WK9A 1Q46A 3C21A 4MFFA 2KFZA 4HAIA 2KZMA 3CYMA 2LYHA 2HOIA 4LZDA 3UM9A 4YQWA 3KKAA 2BPGA 5HP4A 5ALPA 3NVYA 5CHGA 2E8OA 1Z00B 1B22A 4UAZA 4C8OA 1HIWA 5DB8A 4UB4A 3MGHA 2AQ0A 2K8BB 4I2HA 4DS5A 2H3QA 5J2FA 1ZQWA 2XC9A 3PMNA 9ICRA 3JPNA 2LHTA 2CN1A 3H8JA 3GV8B 3ISDA 3ZI4A 3M6ZA 4ED1A 2BCVA 2R18A 2FI1A 1N60A 1S77D 3PW5A 5J0TA 3N4MB 1K5OA 4C4RA 3J81j 2BHNA 2YMQA 4EBEA 4BDPA 2KKPA 2Z7JA 4NLCA 4DL5A 5J0XA 5J0SA 3VCBA 2JR5A 3SYZA 4C8KA 9ICKA 4KLHA 2KOBA 2WF9A 3KBBA 2UVRA 4B9TA 4IC9A 2LYAA 5KL8B 3ISBA 1JRPA 2PFOA 2BCUA 1NJYA 1BPBA 4YMNA 2WF7A 2HOFA 1TVAA 2JV3A 3WK5A 2D3DA 5KFHA 1T7PA 4TUSA 2Y9TA 3T79A
chains in the Genus database with same CATH topology
3SEIA 2QKQA 2QB0B 1SV0C 1Z1VA 2KSOA 3TACB 2DKXA 1UQVA 1F0MA 3BS5A 4IS7A 5JRTA 3TADA 3BS7A 1SXEA 2D8CA 1KW4A 2F44A 2L5YA 4RQNA 5KNIA 2E8NA 2K4PA 1X9XA 2YTUA 1V85A 3KKAA 2KSOB 2QARA 1X66A 2E8OA 1X40A 2GLEA 2LMRA 4NL9A 5F3XB 1SV4A 2E8MA 1SGGA 3BS5B 5JU5A 2B6GA 2KE7A 1LKYA 2F3NA 5L1MA 3H8MA 1PK1A 2DL0A 2EAPA 2QB0A 3K1RB 1OXJA 1SV0A 2EAMA 1B0XA 2F8KA 1PK3A 2KMDA 2ES6A 3IDWA 1RG6A 2DKZA 4MHVA 5J8YC 4PZOA 3TADC 1WWUA 2K60A 2Y9UA 4RQMA 2QB1A 3HILA 1PK1B 2KIVA 1UCVA 5JTIA 2LPEA 1DXSA 2EANA 1WWVA 1V38A 1OW5A 1COKA 3KKAC 2QARB 5J8YA 1SXDA 4NL9C 1JI7A 2EAOA 3BQ7A 2ESEA 2KG5A 2E8PA 2JV3A 4PZNA 1B4FA 2FE9A 2D3DA 4NJ8A 3SENA 1LKYB 2Y9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEI A;  2QKQ A;  2QB0 B;  1SV0 C;  1Z1V A;  2KSO A;  3TAC B;  2DKX A;  1UQV A;  1F0M A;  3BS5 A;  4IS7 A;  5JRT A;  3TAD A;  3BS7 A;  1SXE A;  2D8C A;  1KW4 A;  2F44 A;  2L5Y A;  4RQN A;  5KNI A;  2E8N A;  2K4P A;  1X9X A;  2YTU A;  1V85 A;  3KKA A;  2KSO B;  2QAR A;  1X66 A;  2E8O A;  1X40 A;  2GLE A;  2LMR A;  4NL9 A;  5F3X B;  1SV4 A;  2E8M A;  1SGG A;  3BS5 B;  5JU5 A;  2B6G A;  2KE7 A;  1LKY A;  2F3N A;  5L1M A;  3H8M A;  1PK1 A;  2DL0 A;  2EAP A;  2QB0 A;  3K1R B;  1OXJ A;  1SV0 A;  2EAM A;  1B0X A;  2F8K A;  1PK3 A;  2KMD A;  2ES6 A;  3IDW A;  1RG6 A;  2DKZ A;  4MHV A;  5J8Y C;  4PZO A;  3TAD C;  1WWU A;  2K60 A;  2Y9U A;  4RQM A;  2QB1 A;  3HIL A;  1PK1 B;  2KIV A;  1UCV A;  5JTI A;  2LPE A;  1DXS A;  2EAN A;  1WWV A;  1V38 A;  1OW5 A;  1COK A;  3KKA C;  2QAR B;  5J8Y A;  1SXD A;  4NL9 C;  1JI7 A;  2EAO A;  3BQ7 A;  2ESE A;  2KG5 A;  2E8P A;  2JV3 A;  4PZN A;  1B4F A;  2FE9 A;  2D3D A;  4NJ8 A;  3SEN A;  1LKY B;  2Y9T A; 
#chains in the Genus database with same CATH topology
 1ZET A;  3FYH A;  2A1J B;  3N28 A;  2J6U A;  1J2N A;  4M9N A;  1ECW A;  2EDU A;  1GO3 F;  3M6K A;  5KFL A;  8ICR A;  2ZTC A;  1MQ2 A;  2W7P A;  1TAQ A;  1ZD2 P;  7ICJ A;  2E1F A;  2L5Y A;  4JB3 A;  3M8S A;  2ISO A;  1MQ3 A;  4PL2 A;  2G5I B;  4WJ3 B;  2FPM A;  1JN3 A;  2KJ5 A;  4USA A;  2M9N A;  4KLT A;  2ZTE A;  1TAU A;  2VA3 A;  7ICL A;  2YY6 A;  4AYB F;  2AJQ A;  2P6R A;  1IM4 A;  5HMM A;  2VIX A;  3K4G A;  8ICW A;  2W9A A;  1CI4 A;  4I2E A;  1ZQD A;  1SWV A;  2EAP A;  3ZDD A;  1JXE A;  9ICX A;  5KFU A;  1U4B A;  1TK5 A;  2K8C B;  8ICQ A;  4R8U A;  1XO1 A;  4IQU A;  1C7Y A;  4KLO A;  4JV0 A;  4PZO A;  3GII A;  2K4E A;  1UHU A;  4MEY A;  1NKB A;  2KIV A;  1N5X A;  3AM9 A;  2BPF A;  4F4Y A;  1ZXI A;  4GXI A;  2K4H A;  3MBY A;  2RQ5 A;  4DOA A;  5BPC A;  5IIN A;  3PZP A;  3U26 A;  9ICO A;  1KTQ A;  5KG6 A;  1U47 A;  1X9S A;  4C4S A;  2JEG A;  2QKQ A;  4QZA A;  1NJX A;  1ZQL A;  3C2M A;  2FMQ A;  4KLD A;  5L9X A;  3SI8 A;  3MFH A;  4UAW A;  2DFL A;  5DB7 A;  5KG3 A;  2HHT A;  3AQE A;  1O08 A;  3ZDC A;  2ZUD A;  1N2X A;  2W04 A;  3PR4 A;  4Q8E A;  3OJU A;  4I28 A;  2W9C B;  4I2J A;  5AIC A;  4PHD A;  3CRX A;  3ED5 A;  2F8L A;  3WKD A;  2XVT A;  3PX0 A;  3RJH A;  1VJ5 A;  1U45 A;  4B9N A;  5AKJ A;  1X9W A;  3M9O B;  4PGY A;  2LBO A;  4P0Q B;  4U6P A;  5CWR A;  1HEK A;  4I2G A;  3B9J A;  2ZJ8 A;  2PXI A;  9ICJ A;  4I29 A;  3RB0 A;  5DBA A;  5ALG A;  3HT3 A;  5HR7 A;  2KE7 A;  3QU9 A;  3UQ0 A;  4EEN A;  3BJY A;  2AXT U;  2HHU A;  1BNO A;  1SV0 A;  4O3R A;  3HPO A;  3IV6 A;  1KLN A;  2D6F C;  3UQ2 A;  4P0P A;  4PHA A;  4C8M A;  4ACO A;  2Y1I A;  3RJI A;  1F5S A;  3Q8L A;  2P66 A;  3IN5 A;  7ICU A;  4M2Y A;  2RRD A;  3PX6 A;  3SQI A;  5CA7 A;  1FEZ A;  4F92 B;  4DCC A;  2ZXH A;  4YG2 A;  1RXV A;  3VC8 A;  3WKA A;  2BQU A;  2JGA A;  4YXJ A;  2R8G A;  4O3S A;  2EAN A;  2V9W A;  2H3V A;  5JUM A;  3OSP A;  4M9G A;  2IOH A;  1Q8K A;  4NY8 A;  3NVV A;  4GC6 A;  4PZN A;  8ICG A;  4BXO B;  3IHQ B;  1O03 A;  4NLN A;  1D8L A;  4RPZ A;  5DDM A;  2XI9 A;  3GV5 B;  2KSO A;  1M6Y A;  2PI4 A;  1VDV A;  5L1J A;  2ATL A;  4R8U B;  3V7K A;  4UW9 A;  4DSK A;  4GIB A;  7ICQ A;  8ICU A;  4IQW A;  3TFR A;  2E8N A;  1BPY A;  3V6J A;  3L4P A;  2JEJ A;  4Z6E A;  1X9X A;  1HUO A;  2YMP A;  3IRU A;  3DEE A;  2YQE A;  1RYU A;  5DB9 A;  2KZ3 A;  4YD2 A;  3ETL A;  4JK1 A;  3QZ7 A;  1X40 A;  4F5N A;  4RNO A;  4RT2 A;  5AI9 A;  4C0Z A;  2XID A;  5ALF A;  4J9K A;  4F5O A;  4UB1 A;  4EEY A;  3PSF A;  9ICI A;  4LJX A;  4ECR A;  2IHM A;  2A3V A;  1ZQK A;  8ICN A;  4IR9 A;  3I76 A;  4DSF A;  3EWA A;  1U49 A;  1ZQZ A;  4C80 A;  4QWA A;  2E3T A;  3MC1 A;  4NM1 A;  4FS1 A;  4KLQ A;  1J97 A;  5DQG A;  5KL1 B;  3GIM A;  2VJ4 A;  2FPL A;  4B6J A;  5AM2 A;  1ZQR A;  3NGD A;  4M9J A;  4PGX A;  1ZQI A;  2R8H A;  5EWE A;  1S0M A;  4RPX A;  2GOL A;  5J0W A;  2NYV A;  3BQ7 A;  5KFE A;  3RBE A;  1ZRN A;  5KFK A;  1ZQV A;  5EE9 A;  1ZQJ A;  4CNQ A;  4Z6C A;  5C5J A;  4DF4 A;  3Q8Q B;  5KG2 A;  4KX3 A;  1Z1V A;  4PH5 A;  3UXP A;  1S10 A;  1Z00 A;  3D2S A;  1BGX T;  2JEI A;  4DL7 A;  1TFR A;  3H8S A;  2MA1 A;  3QYP A;  9ICE A;  2IHN A;  4M6W B;  2BKE A;  4M9L A;  4TUR A;  4U7C A;  5BOM A;  2BQR A;  3QU4 A;  3RFA A;  1SL2 A;  2EZY A;  1ZQS A;  5ALO A;  4O5E A;  5ALQ A;  1SV4 A;  2RDI A;  1WG8 A;  2VKQ A;  2KK0 A;  1AQ6 A;  4GC7 A;  5IIL A;  4YFK A;  4JV2 A;  1KQQ A;  1K1Q A;  2ODG A;  2QLT A;  4QZC A;  4DFM A;  5F9N A;  7ICG A;  3UPQ A;  4UAV A;  2ES6 A;  3E58 A;  1KFS A;  9ICF A;  1NOM A;  2GWS A;  1RG6 A;  4EZ6 A;  1L7N A;  3V6H A;  2WB1 C;  3SV4 A;  1NJZ A;  1Z3E B;  5KFP A;  2OEH A;  4ELT A;  2JHD A;  1PK1 B;  2A1J A;  4FFD A;  1PVQ A;  3PO4 A;  1TK8 A;  1DGS A;  5KT2 A;  5TZV A;  2OM6 A;  5KG1 A;  3ORY A;  1CRX A;  5B5E U;  5B66 U;  4JV1 A;  5ALU A;  1NZB A;  1Q3U A;  4KLE A;  1SIJ A;  4RQ4 A;  3AMZ A;  2FLL A;  3PW0 A;  2J6S A;  9ICH A;  4QZF A;  2K89 A;  1RQL A;  5F9L A;  8ICJ A;  3TAN A;  4KIT B;  4DFJ A;  2BGW A;  3SR6 A;  4OD0 A;  1LVH A;  5AM1 A;  1QQ7 A;  3WK6 A;  2NV3 A;  5HR6 A;  1LB2 B;  4ECX A;  4J9P A;  5KTQ A;  2XY5 A;  3SZ2 A;  7ICH A;  1ZQO A;  2F44 A;  3G6X A;  3OPX A;  4RQN A;  4F4K A;  2VAN A;  1QQ6 A;  2AH5 A;  1TAM A;  3EPI A;  4PJ0 U;  3T3F A;  1Z1B A;  5DGB A;  2AGQ A;  4P4P A;  4UBC A;  8ICZ A;  4NM2 A;  2P35 A;  2BCR A;  5KFO A;  4QWE A;  1SGG A;  1TK0 A;  1KSP A;  3OTQ A;  2F3N A;  2JXJ A;  1IXR A;  4Q43 A;  4O3P A;  3KOO A;  4UB5 A;  4QJF B;  1JXL A;  3H0R B;  3BDP A;  5KFX A;  1ZD4 A;  3NTU A;  4DLG A;  4ICA A;  2F1H A;  4ED8 A;  4XUS A;  2HBM A;  1ZQ1 C;  2ZIX A;  2ALZ A;  5AKK A;  2ZG6 A;  3MGV A;  4KX5 A;  3SV3 A;  4KLI A;  3SMV A;  4FE3 A;  1X2I A;  3QEB Z;  3THV A;  3L5K A;  1ARO P;  2HI0 A;  3WK4 A;  4F93 B;  2QB1 A;  3IG8 A;  3MR5 A;  2HW3 A;  4Y2S A;  3D2Q A;  2G0A A;  3QU7 A;  2FPK A;  4XA5 A;  3UXN A;  2IOF A;  4RQ3 A;  5KG7 A;  1HJP A;  8ICI A;  1TE2 A;  4QNL A;  4NL9 C;  4KLG A;  1BNP A;  4Z6D A;  3LWM A;  4J9O A;  2WAQ F;  4O3M A;  2KP7 A;  2W9C A;  5AKZ A;  5KFZ A;  4M47 A;  3SEN A;  8ICF A;  4CGZ A;  4RZR A;  1L7M A;  1ZQQ A;  4Y2J A;  1SKS A;  1Z19 A;  4Y2Q A;  4RQ6 A;  4P0Q A;  2G08 A;  2VA8 A;  5DKW A;  1S0V A;  3C28 A;  4O0I A;  1URJ A;  3V7J A;  4M0A A;  1MC8 A;  4F50 A;  3PY8 A;  2W54 A;  5AI4 A;  3TFS A;  7ICS A;  1UA1 A;  4QZD A;  3KHR A;  3JPO A;  5ALY A;  4NLB A;  1COO A;  2AQ4 A;  5KNI A;  2YTU A;  2WTF A;  1ZQP A;  1MN8 A;  3K75 D;  4UB2 A;  1NK5 A;  4MF8 A;  3EW9 A;  2ASD A;  5KFG A;  4RQ2 A;  2BCS A;  2GH1 A;  5F3X B;  3AU6 A;  2LM4 A;  9ICV A;  4C7Z A;  2W9B B;  1X6J A;  2Y0S F;  4KTQ A;  3F5A A;  4O9M A;  8ICL A;  4AYB C;  3A0H U;  2KIC A;  5KFI A;  4RQ7 A;  5ALH A;  2QB0 A;  1QSS A;  1UA0 A;  4PHP A;  2OCE A;  2RP5 A;  4R65 A;  2HHV A;  3I1Y A;  3F2D A;  3LYS A;  5ALV A;  4UB3 A;  4FBT A;  4BXO A;  1MSW D;  3TAD C;  5G5G A;  4B9V A;  9ICL A;  3TAP A;  2HVH A;  2XY6 A;  5KFC A;  4P2H A;  3C1Y A;  1DXS A;  5DQI A;  1WUD A;  2NO4 A;  5KFY A;  2YML A;  3IM1 A;  9ICT A;  2KG5 A;  4F3O A;  5AKH A;  4R66 A;  3WKB A;  4BJQ A;  3H0L B;  4NLZ A;  1QQ5 A;  1PVR A;  3HKZ F;  2W8L A;  2DBY A;  4QWC A;  2I9G A;  3GIL A;  5HNK A;  3HX0 A;  3TAC B;  1F44 A;  1SKW A;  2ZIX B;  3DV9 A;  2NRZ A;  1NK9 A;  3PSP A;  2Q4T A;  2PFN A;  5KFF A;  3RTV A;  1L5U A;  2G07 A;  4DFP A;  1ZQC A;  1ZQF A;  4Y2V A;  3OJS A;  3GDX A;  2PI5 A;  2V4Q A;  2MUT B;  1KBU A;  5J2A A;  1Z4O A;  2QAR A;  1IV8 A;  9ICA A;  4CF5 A;  3H40 A;  1X9M A;  4JWM A;  5KFR A;  5EE3 A;  1DGJ A;  1X42 A;  4F2R A;  1DOQ A;  5III A;  1ZQG A;  4M9H A;  2G06 A;  2OXO A;  4DQQ A;  2CXY A;  3E2E A;  5IIO A;  2XO7 A;  5KFV A;  2IA6 A;  1PK3 A;  2LYB A;  1A6S A;  4DSJ A;  1UPH A;  5CR0 A;  1B43 A;  3GQC A;  2R8I A;  1U9L A;  1C20 A;  1JMS A;  1XC9 A;  1LV5 A;  3MGI A;  5CB1 A;  4B9M A;  1KFD A;  3O0F A;  2AGP A;  2YB1 A;  2KV2 A;  1FFV A;  5KFM A;  4UAY A;  4M04 A;  3H4B A;  3B0Y A;  4RQM A;  3EYZ A;  9ICW A;  3MDA A;  2EZX A;  5AIB A;  4YP3 A;  8ICE A;  2HHS A;  4DSE A;  5CEH A;  1UT5 A;  3RB3 A;  4US8 A;  9ICB A;  2W03 A;  4KLU A;  4DL2 A;  2WF8 A;  2ZIU A;  4ECV A;  3QEA Z;  1D8B A;  2ESE A;  5IIM A;  4EYI B;  3H4D A;  3TKA A;  2B0C A;  2K8A A;  4M6W A;  4P4O A;  4QWB A;  5AIA A;  4FBU A;  4J9M A;  8ICX A;  4IRK A;  2W43 A;  2QB0 B;  4OJO A;  4NLK A;  1CUK A;  3OHB A;  1SZP A;  2HVI A;  2YN4 A;  3WK7 A;  2F1I A;  4J9Q A;  1T4G A;  3TI0 A;  4K4H A;  3BS7 A;  4F4X A;  4K4G A;  4O5K A;  1L8O A;  1SKR A;  2HHQ A;  2JEF A;  1Y88 A;  3CNH A;  2HSZ A;  4BX9 C;  1JRO A;  4YR0 A;  1ZQY A;  2W7O A;  3KD3 A;  4G3I A;  4I2F A;  4NL9 A;  5J0P A;  2NRT A;  2PKE A;  4I2B A;  4YN4 A;  4QZB A;  4NWI A;  4I27 A;  3BS5 B;  5KFQ A;  1JUD A;  3BQ1 A;  4LVS A;  2KVC A;  3SAH A;  1LKY A;  3LVW A;  1KL9 A;  2F77 X;  5L1M A;  1PK1 A;  3FAH A;  4Y2U A;  3N97 B;  1B0X A;  5AI5 A;  3RBD A;  5KFD A;  2FLN A;  4JMU A;  4G9B A;  5J0U A;  3RJJ A;  1XS9 D;  2EQY A;  3C5G A;  1Q3V A;  2W3R A;  4QZE A;  2OH2 A;  1ZQU A;  1L8L A;  4I2A A;  1BPZ A;  7ICE A;  5ALN A;  4IQV A;  2BZF A;  3KHL A;  5J2H A;  1N63 A;  1ZQX A;  2F76 X;  4ECU A;  3EPG A;  2KNJ A;  2EZZ A;  4B9U A;  1FO4 A;  3RJE A;  4DL3 A;  1EXN A;  2QAR B;  4J03 A;  1BPE A;  2EAO A;  3PR5 B;  2KHV A;  4Y2R A;  2FE9 A;  4UB8 U;  3UXO A;  5J2J A;  5DLG A;  4ED0 A;  2AU0 A;  4FO6 A;  4EEK A;  1PZN A;  3ICX A;  7ICT A;  7ICI A;  4ECZ A;  4O5C A;  4HYK A;  5TIS U;  4DOB A;  5DG7 A;  4F71 A;  3QUQ A;  2XY7 A;  1ZJM A;  3T5L A;  4F5Q A;  5AK6 A;  1KEJ A;  4KMO B;  3GU3 A;  5J2G A;  3TAD A;  5GTI U;  1L7O A;  1QSL A;  2BDU A;  2D8C A;  3BZK A;  4QIW C;  3Q8S B;  5FP0 A;  7ICN A;  3Q8R B;  1L3V A;  5AK5 A;  3LDA A;  3PW4 A;  2NO5 A;  3RJG A;  5EWG A;  1ZRM A;  1X66 A;  5HML A;  5E79 U;  4J9R A;  5J2B A;  4KMU A;  2HHW A;  2ZIU B;  4GFJ A;  4DLE A;  5H2F U;  4BGD A;  4F5P A;  2C28 A;  2XCA A;  2CRX A;  1YT3 A;  2KD1 A;  2ZIW B;  4QIW F;  4NXZ A;  4BWM A;  5L1K A;  4DQR A;  3FDS A;  1XU4 A;  2EAM A;  3QUB A;  1YZ7 A;  4QZ8 A;  4LZG A;  5J29 A;  1U48 A;  2G09 A;  4I2I A;  2KMD A;  5J2I A;  5DLF A;  3QU5 A;  2FMP A;  3RRG A;  4QZG A;  5ALJ A;  1XSN A;  2DKZ A;  3D2N A;  3Q8K A;  4J9S A;  2B21 A;  2G5H B;  3V7L A;  2DPI A;  5DB6 A;  5DQH A;  4DL6 A;  1L3T A;  4FZL A;  1KKX A;  4X5V A;  3NRW A;  1ZD3 A;  1SL0 A;  1ZQT A;  5AI6 A;  5A0L A;  4ECY A;  2OWO A;  8ICY A;  2F1J A;  1ZQH A;  4MFC A;  1L3S A;  1WWV A;  4Y2T A;  4DSI A;  3PNC A;  2HCF A;  1A77 A;  3PO5 A;  4EX6 A;  1CEZ A;  2XCP A;  1NK6 A;  3RR8 A;  2HOQ A;  2Q0Z X;  2E8P A;  1TV9 A;  5KFB A;  4RPY A;  1LKY B;  1T94 A;  3IG5 A;  4UB6 U;  4OJ5 A;  3R9K A;  4JUZ A;  3GIK A;  3ZDB A;  4F8R A;  5ALX A;  2MSN A;  3I28 A;  1WCN A;  1XSP A;  2RHF A;  1JX4 A;  3K1Z A;  2W9B A;  2H3Z A;  1T3N A;  2FDR A;  3GZF A;  4IR1 A;  5KT5 A;  1SL1 A;  4UAS A;  1XSL A;  3LVV A;  2PMZ F;  3AEV A;  3M7D A;  4DL4 A;  2GLE A;  2LMR A;  2E8M A;  5KT4 A;  3G6V A;  4MEX A;  5JU5 A;  5DDY A;  1S8O A;  4F4Z A;  2ASL A;  4NLG A;  2AGO A;  2P6U A;  3JPS A;  2R8J A;  5J0Q A;  5AK3 A;  2XIC A;  4DQS A;  2Y1J A;  3AN1 A;  3C2L A;  4OJP A;  5ALL A;  5AKX A;  4ED7 A;  4JWN A;  5CRX A;  4F91 B;  4TUQ A;  4AP9 A;  4YMM A;  3F5E A;  4Q45 A;  2ISP A;  1N62 A;  3SAG A;  3RH4 A;  4MHV A;  3AUO A;  1S97 A;  1BVS A;  3HWT A;  4KLL A;  3WKC A;  4PHE A;  5KG5 A;  4DFD A;  3NAS A;  3Q8M A;  3HIL A;  5C0Y A;  5J2D A;  2DWQ A;  2KJ8 A;  3RJF A;  1QSY A;  3SAF A;  5DG8 A;  1NKE A;  5T14 A;  4YR3 A;  2ZUB A;  5KG4 A;  2ZJA A;  2C22 A;  1JI7 A;  3EUB 2;  1JAL A;  5AHX A;  3OGU A;  8ICV A;  3F2C A;  3N7R C;  5J2C A;  1KRP A;  1ZJN A;  4NJ8 A;  2KN7 A;  2WAQ C;  4J9N A;  2LM1 A;  4E0D A;  4YMO A;  9ICM A;  3PW7 A;  4PGQ A;  4ELV A;  4RQ5 A;  2MUT A;  3RF9 A;  5AI0 A;  1V97 A;  3PV8 A;  2DKX A;  2IBK A;  5DBB A;  4PL1 A;  4TUP A;  2C2R A;  2WFA A;  2ZUC A;  4QW8 A;  3AL0 B;  3B0X A;  2HBJ A;  1T3Q A;  3OHA A;  1NI3 A;  4IQT A;  4DSL A;  3CW2 C;  5DG9 A;  3PW2 A;  5KAI U;  4UBB A;  4I2C A;  2I1Q A;  3UMB A;  2NRX A;  1ZQB A;  2H3F A;  2KEY A;  3JPP A;  2Y0S C;  2FLP A;  2IOF K;  4QZ9 A;  2N1R A;  4O3O A;  2LKY A;  4ZH4 A;  4RT3 A;  3C2K A;  5IIJ A;  2W9M A;  2KHQ A;  3V6K A;  5AKI A;  4ED6 A;  3MAB A;  3QUT A;  1ED1 A;  4DOC A;  1NK0 A;  2W8K A;  3KZI U;  4IRC A;  1ZQN A;  5AKY A;  2JZB B;  2I5H A;  1WWU A;  4US9 A;  4GLX A;  1SZH A;  3MDC A;  4ELU A;  1H38 A;  4C7Y A;  5JTI A;  3MR6 A;  3F2B A;  3DDH A;  1QCK A;  3IP4 B;  3JPR A;  5KAF U;  4UQG A;  4DWI A;  5EWF A;  4RUA A;  5J8Y A;  1SXD A;  5BOL A;  2NRW A;  3A0B U;  3N7P D;  4YR2 A;  9ICC A;  4I2D A;  1B4F A;  1SWW A;  1J2M A;  4DEZ A;  3QZ8 A;  5KFT A;  1ZD5 A;  3ETR A;  2JH7 A;  3HKZ C;  5L1I A;  3SD7 A;  2KIW A;  4CRX A;  3RRH A;  3LWL A;  5ALM A;  3BQ0 A;  4OJ6 A;  3HW8 A;  3HP6 A;  8ICS A;  3WU2 U;  3RH6 A;  1L6N A;  1QH9 A;  2ZIV B;  9ICN A;  2MU2 A;  2UVU A;  7ICM A;  3BS5 A;  3FM9 A;  2KZZ A;  5JRT A;  1KFT A;  1VLB A;  1HUZ A;  3M1Y A;  4DO9 A;  4XQ8 A;  4TQR A;  2YB4 A;  9ICU A;  5KFJ A;  2R8K A;  3RJK A;  5D4B A;  2W3S A;  1NJW A;  3EZ5 A;  5ALS A;  1FIQ A;  3JPT A;  3H7I A;  2H3I A;  5ALR A;  4OCZ A;  1XNS A;  1S0N A;  7ICK A;  2VJ5 A;  1WYG A;  3QX7 A;  3C5F A;  3C29 A;  2B6G A;  2RLT A;  4F5R A;  2V4R A;  4QZI A;  3WKE A;  4YCX A;  3HJE A;  1RYS A;  2VA2 A;  2WF5 A;  3MFI A;  3PSI A;  3RB4 A;  2UVW A;  1ZQA A;  9ICP A;  3M9N B;  4F2S A;  7ICR A;  3MR2 A;  3T5H A;  4IRD A;  3T5K A;  1ZOL A;  1N56 A;  2HMX A;  9ICG A;  1X6I A;  4FS2 A;  4UAT A;  5DBC A;  4RQ8 A;  9ICQ A;  4DQI A;  5AKG A;  3QNM A;  1N48 A;  3RAX A;  5HHI A;  3CP8 A;  4J9L A;  1OW5 A;  4CF3 A;  4EEL A;  3RB6 A;  1WCL A;  3M9M B;  4GXK A;  4RNM A;  4IL6 U;  1NK7 A;  5KFS A;  1PUZ A;  5ALE A;  2IMW P;  4O3N A;  3ZDE A;  4Y2P A;  4EX7 A;  2DF4 B;  4TQS A;  3RR7 A;  1UQV A;  4DFK A;  2DUY A;  1SB3 C;  1RYR A;  1IG6 A;  4KN7 A;  2I6X A;  3UMC A;  2EH9 A;  3PVX A;  2ZIW A;  2HBK A;  4F4W A;  3ISC A;  5CP2 A;  3H0M B;  4Y2X A;  2AHO B;  3MR3 A;  3KFU F;  2BR0 A;  2CPR A;  2BQ3 A;  1D8Y A;  4RUC A;  1RPL A;  4QW9 A;  2MAX A;  2OYY A;  5KT7 A;  4O3Q A;  2WF6 A;  1N61 A;  2FMS A;  5K4L A;  4KLF A;  1Z4N A;  5GTH U;  7ICP A;  1OXJ A;  5AKL A;  4ECQ A;  3GIJ A;  3S6J A;  2NRV A;  2ZXI A;  3IDW A;  5IIK A;  8ICO A;  3ALR A;  1RDF A;  3PML A;  3C1Z A;  4UAR A;  4CCH A;  1K1S A;  3NRZ A;  1XO0 A;  1OUQ A;  4R64 A;  8ICP A;  2K60 A;  4K4I A;  4FZN A;  1PVP A;  4BUG A;  1ZYQ A;  1A0P A;  5EOZ A;  4CF4 A;  2HDO A;  2KVS A;  2ASJ A;  4FZM A;  4YVZ A;  3ZD8 A;  1COK A;  3KKA C;  2OHF A;  4B9L A;  2O6K A;  4QZH A;  5ALT A;  5KFA A;  4ECW A;  4EZ9 A;  2ZTD A;  2F2A B;  2UVV A;  4MF2 A;  2E1E A;  8ICC A;  3SEI A;  5KT3 A;  1S76 D;  3H8W A;  4Q44 A;  4NV0 A;  2BDP A;  1YZ6 A;  4ED2 A;  1RQN A;  3GV7 B;  4XRH A;  4ZOH C;  5KT6 A;  2C2E A;  2YX8 A;  2E5S A;  1NNL A;  3JPQ A;  4B9S A;  2MRL A;  3NVW A;  4KLS A;  5J0R A;  1F0M A;  3KZX A;  4IS7 A;  5AM3 A;  3QUC A;  8ICT A;  1SXE A;  5CJ7 A;  2FJ6 A;  4DQP A;  5AM5 A;  2K4P A;  1DK3 A;  4RQ1 A;  4UAU A;  5AKE A;  1NK8 A;  4F72 A;  2K4I A;  5ALZ A;  3F53 A;  5AM4 A;  3BQ2 A;  5DGA A;  2LI6 A;  3ONN A;  3AU2 A;  4C8L A;  4EBC A;  3N7S C;  2YMM A;  2DL0 A;  4YD1 A;  4RU9 A;  2WHE A;  5AK4 A;  4Z6F A;  3OSN A;  2KTQ A;  1N5W A;  4DF8 A;  1L7P A;  1A76 A;  2A1A A;  3QU2 A;  2XGP A;  4ED3 A;  4CDG A;  4OO1 J;  3QXG A;  8ICM A;  2KJ9 A;  3FC4 A;  2ZJ5 A;  5J8Y C;  3T5J A;  5EE1 A;  8ICK A;  2JMG A;  7ICF A;  5KG0 A;  1NKC A;  3WK8 A;  5J0O A;  4RNN A;  5ALI A;  2XGQ A;  1NZP A;  4EBD A;  7ICO A;  5AM0 A;  1XWL A;  5J0Y A;  5EE0 A;  2GO7 A;  2LPE A;  1V9P A;  4P0P B;  2BCQ A;  5ALK A;  1V38 A;  1T8E A;  3RAQ A;  5ALD A;  1QLN A;  8ICA A;  1S0O A;  8ICB A;  1RZT A;  4RQ0 A;  5HHH A;  3GFK B;  1ZQM A;  1D9F A;  2HBL A;  3ZDA A;  1FFU A;  3C23 A;  2W11 A;  1P7D A;  3L3F X;  2DPJ A;  2PFQ A;  4QWD A;  1L3U A;  2PFP A;  1RXW A;  3NS1 A;  2KKV A;  4KLM A;  4MFA A;  1KDH A;  2HHX A;  4A8E A;  5D46 A;  3PX4 A;  3TAQ A;  4BWJ A;  2C2D A;  5L1L A;  3NUQ A;  4ECT A;  1KW4 A;  2BPC A;  1S9F A;  3E0F A;  1JIH A;  2KFN A;  3PST A;  2JH1 A;  2DQN B;  5D49 A;  1V85 A;  1MA7 A;  4KLJ A;  2KSO B;  2PMZ C;  5J2E A;  1QTM A;  1KN5 A;  3AQF A;  2JZB A;  4PPX A;  3ZD9 A;  5KFN A;  3M8R A;  3H8M A;  3KHG A;  3NVZ A;  7ICV A;  8ICH A;  3K1R B;  4OJL A;  5AI8 A;  2DGZ A;  3G6Y A;  2F8K A;  1RM6 C;  1D9D A;  4C4T A;  1BPD A;  4YXM A;  2WB1 F;  4P4M A;  1TKD A;  4Q8F A;  4C8N A;  5J2K A;  9ICS A;  3RH5 A;  1DRG A;  2Y9U A;  3Q8P B;  4ECS A;  1ZQE A;  5ALW A;  3QE9 Y;  3TQ1 A;  1UCV A;  2JRZ A;  3D6J A;  4GXJ A;  2A19 A;  4R63 A;  1DK2 A;  2M0N A;  2ZIV A;  4DS4 A;  3V72 A;  1NK4 A;  1BPX A;  2RDJ A;  1UT8 A;  3UMG A;  2J6T A;  3KHH A;  3HRD D;  5KFW A;  3BZC A;  1SV0 C;  2H5X A;  4CE6 A;  5G5H A;  4KN4 A;  4EYH B;  3BQT A;  3LK9 A;  1S5L U;  3KTQ A;  4Y2Y A;  2W55 A;  1IIP A;  3TAR A;  3WK9 A;  1Q46 A;  3C21 A;  4MFF A;  2KFZ A;  4HAI A;  2KZM A;  3CYM A;  2LYH A;  2HOI A;  4LZD A;  3UM9 A;  4YQW A;  3KKA A;  2BPG A;  5HP4 A;  5ALP A;  3NVY A;  5CHG A;  2E8O A;  1Z00 B;  1B22 A;  4UAZ A;  4C8O A;  1HIW A;  5DB8 A;  4UB4 A;  3MGH A;  2AQ0 A;  2K8B B;  4I2H A;  4DS5 A;  2H3Q A;  5J2F A;  1ZQW A;  2XC9 A;  3PMN A;  9ICR A;  3JPN A;  2LHT A;  2CN1 A;  3H8J A;  3GV8 B;  3ISD A;  3ZI4 A;  3M6Z A;  4ED1 A;  2BCV A;  2R18 A;  2FI1 A;  1N60 A;  1S77 D;  3PW5 A;  5J0T A;  3N4M B;  1K5O A;  4C4R A;  3J81 j;  2BHN A;  2YMQ A;  4EBE A;  4BDP A;  2KKP A;  2Z7J A;  4NLC A;  4DL5 A;  5J0X A;  5J0S A;  3VCB A;  2JR5 A;  3SYZ A;  4C8K A;  9ICK A;  4KLH A;  2KOB A;  2WF9 A;  3KBB A;  2UVR A;  4B9T A;  4IC9 A;  2LYA A;  5KL8 B;  3ISB A;  1JRP A;  2PFO A;  2BCU A;  1NJY A;  1BPB A;  4YMN A;  2WF7 A;  2HOF A;  1TVA A;  2JV3 A;  3WK5 A;  2D3D A;  5KFH A;  1T7P A;  4TUS A;  2Y9T A;  3T79 A; 
#chains in the Genus database with same CATH homology
 3SEI A;  2QKQ A;  2QB0 B;  1SV0 C;  1Z1V A;  2KSO A;  3TAC B;  2DKX A;  1UQV A;  1F0M A;  3BS5 A;  4IS7 A;  5JRT A;  3TAD A;  3BS7 A;  1SXE A;  2D8C A;  1KW4 A;  2F44 A;  2L5Y A;  4RQN A;  5KNI A;  2E8N A;  2K4P A;  1X9X A;  2YTU A;  1V85 A;  3KKA A;  2KSO B;  2QAR A;  1X66 A;  2E8O A;  1X40 A;  2GLE A;  2LMR A;  4NL9 A;  5F3X B;  1SV4 A;  2E8M A;  1SGG A;  3BS5 B;  5JU5 A;  2B6G A;  2KE7 A;  1LKY A;  2F3N A;  5L1M A;  3H8M A;  1PK1 A;  2DL0 A;  2EAP A;  2QB0 A;  3K1R B;  1OXJ A;  1SV0 A;  2EAM A;  1B0X A;  2F8K A;  1PK3 A;  2KMD A;  2ES6 A;  3IDW A;  1RG6 A;  2DKZ A;  4MHV A;  5J8Y C;  4PZO A;  3TAD C;  1WWU A;  2K60 A;  2Y9U A;  4RQM A;  2QB1 A;  3HIL A;  1PK1 B;  2KIV A;  1UCV A;  5JTI A;  2LPE A;  1DXS A;  2EAN A;  1WWV A;  1V38 A;  1OW5 A;  1COK A;  3KKA C;  2QAR B;  5J8Y A;  1SXD A;  4NL9 C;  1JI7 A;  2EAO A;  3BQ7 A;  2ESE A;  2KG5 A;  2E8P A;  2JV3 A;  4PZN A;  1B4F A;  2FE9 A;  2D3D A;  4NJ8 A;  3SEN A;  1LKY B;  2Y9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...