2E8MA

Solution structure of the c-terminal sam-domain of epidermal growth receptor pathway substrate 8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Epidermal growth factor receptor kinase substrate 8
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18016 SAM_3 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8mA01
2K60A 2L5YA 3KKAA 4PZOA 1KW4A 5J8YA 2E8NA 1COKA 2F3NA 1OXJA 2KIVA 1WWUA 1LKYB 1B0XA 2KSOB 1SV0A 4RQMA 2F8KA 3SEIA 2D3DA 3H8MA 2KG5A 4NL9A 3TACB 2QB0A 1Z1VA 2LPEA 1X66A 5JU5A 2E8PA 5F3XB 2ES6A 1X9XA 4NJ8A 3IDWA 1SXEA 3BS5A 1UCVA 1PK3A 2Y9TA 5J8YC 5JRTA 3BS5B 2KMDA 3K1RB 3KKAC 2KSOA 3TADA 2QARA 1UQVA 1V38A 5KNIA 2YTUA 1JI7A 2FE9A 2LMRA 1SXDA 1SGGA 2QARB 2EAOA 4NL9C 1DXSA 4RQNA 1LKYA 2K4PA 4IS7A 2D8CA 4PZNA 2E8MA 2QB1A 1PK1B 2E8OA 1OW5A 2GLEA 3HILA 2QB0B 2EAPA 3BS7A 2F44A 2DKZA 3TADC 1SV4A 1V85A 2DKXA 3BQ7A 5L1MA 1SV0C 2KE7A 3SENA 2Y9UA 1F0MA 4MHVA 2DL0A 1B4FA 2EAMA 2JV3A 5JTIA 1PK1A 2B6GA 2EANA 2ESEA 2QKQA 1RG6A 1WWVA 1X40A
chains in the Genus database with same CATH superfamily
2KD1A 2RDJA 5KFPA 3EPIA 4QZBA 5CJ7A 3HKZC 4CDGA 2ASDA 1N2XA 1COKA 4ED0A 2ZIUB 1RYUA 2MRLA 3ETRA 2PFNA 3QZ8A 5DB9A 1NJXA 4RQMA 8ICWA 2I9GA 5AK5A 3PVXA 3I76A 5DDMA 3QU4A 3MBYA 5JU5A 4I2BA 3PX4A 3RFAA 3GIIA 2V9WA 3UXPA 3RAQA 4C7ZA 4IQWA 3NASA 4ED1A 4K4HA 2OYYA 1ZQPA 1TK0A 4EX6A 1N56A 4DSJA 3GIKA 4KLHA 1QQ7A 1V38A 5AM4A 5ALVA 2W9AA 4NM1A 1S5LU 1KTQA 3WKEA 3RRHA 2OEHA 2YN4A 4DL7A 4IS7A 4XUSA 4R63A 5ALNA 5KFVA 1MA7A 3BZCA 4TUPA 1NK5A 1ZQEA 2BHNA 2IOFK 4PPXA 3BQTA 4I2IA 2MAXA 4TURA 5AIBA 4R66A 2QB0B 2C2DA 2EAPA 7ICJA 2NV3A 4F8RA 2F44A 1NNLA 2KEYA 5A0LA 2BCQA 3QEAZ 4QZ9A 1FO4A 4BXOB 5J2IA 1MSWD 3H7IA 5ALLA 2XO7A 4J9MA 4QZDA 3HWTA 1SIJA 2HDOA 4AYBF 5AI0A 5KFGA 4UAUA 5KFLA 9ICCA 3NVVA 4KN7A 4Z6DA 1IXRA 2WB1F 4DQRA 3PW2A 2A1JB 1JXLA 1ZQZA 4DQQA 3F2CA 3RJKA 9ICMA 5AM2A 2YB1A 5J29A 3V6KA 3QE9Y 3PW7A 4I2CA 2OCEA 4ELUA 8ICYA 4R8UA 2WAQF 1ZQDA 2NO5A 1RYRA 2ZTCA 3QU5A 1VDVA 4B9VA 2D3DA 3K75D 4M9NA 3SMVA 2AXTU 4J9NA 5DB8A 4UBBA 2LBOA 2W9BB 2E8PA 2YY6A 3EYZA 1DK3A 2WF7A 3KHRA 3F2BA 1RXWA 5D46A 2ZXHA 4M0AA 5ALXA 7ICLA 2JH7A 5J2CA 4JV0A 2JEJA 5L1LA 2BPFA 4GXJA 3ZDAA 1U4BA 4UAZA 3GIJA 4B9MA 1VJ5A 4PH5A 3HRDD 2KV2A 4F5RA 2ZUDA 4DSIA 2WF6A 2ODGA 1Q46A 2HOQA 2E8OA 2W8LA 4KLGA 2ZUBA 3AMZA 5J0UA 4KLIA 5KG6A 4KMUA 4B9LA 9ICIA 5ALGA 4IL6U 4HAIA 2ZIWB 1KFSA 2A3VA 5H2FU 3C23A 4O5CA 5ALWA 5KAFU 2WF5A 5TISU 5DGAA 2KKVA 1UPHA 5ALSA 2DPIA 5KG0A 4B9TA 8ICVA 1N63A 2A1JA 2P66A 3PMLA 1HIWA 4BGDA 2ZIVB 1ZQQA 2VANA 2Y0SF 4QIWF 3KFUF 4QZGA 8ICCA 3PNCA 3N28A 3WK7A 2KIVA 4PGYA 1FFUA 3WKCA 1X9WA 1A77A 3A0BU 5J0TA 8ICAA 2HHUA 1L7PA 3SEIA 4DO9A 1V9PA 3DDHA 2JZBA 3UXOA 1PZNA 4Q43A 4Y2XA 3CP8A 1BPBA 5KFMA 4JB3A 5ALHA 4B9UA 4DSKA 5EE9A 3MFHA 3SV3A 4US8A 4PHPA 3NGDA 2E5SA 4EX7A 4CF4A 3CRXA 5EE1A 4ED6A 5AICA 3H4BA 2HMXA 3J81j 3TADA 4MF2A 4Q44A 3QNMA 5EWFA 4Q45A 2YMLA 1K5OA 4QZ8A 9ICOA 9ICKA 3MR5A 1K1QA 4M9GA 4NL9C 3Q8SB 1LKYA 4EEKA 2ZG6A 2Q0ZX 2KHVA 1L7MA 5AKZA 8ICUA 2J6TA 8ICXA 3IN5A 1K1SA 3BS7A 4DL3A 3T5LA 4FS1A 2KVCA 4DL4A 3ETLA 4QW9A 5KFKA 3UQ0A 4C80A 5BOLA 3GILA 3UQ2A 3I28A 2EDUA 1Q8KA 4QWAA 1TK5A 8ICNA 5CB1A 2DL0A 7ICKA 2W8KA 1L7NA 2BZFA 2BPGA 2EZZA 5KFNA 1Z19A 5EOZA 4J9KA 3TI0A 3GIMA 9ICUA 3GQCA 1D8YA 4AP9A 4DS4A 1ZQBA 3AEVA 2W04A 1JX4A 5ALOA 3GV7B 5DG8A 2BPCA 1ZOLA 2IA6A 1U49A 4RQ5A 5KFCA 4NWIA 4NM2A 5CP2A 8ICZA 4C0ZA 4ECWA 2LYBA 3N7PD 3JPRA 4UB3A 3RJIA 1BPEA 4U7CA 1Z1VA 1NI3A 1XO0A 4Z6FA 2EZYA 4RNMA 2E1FA 4ZH4A 4P2HA 2AGPA 2A1AA 3RJHA 2DQNB 3BS5B 5FP0A 1NJWA 7ICVA 2QARA 5AKLA 3F53A 5F9NA 3B9JA 2AJQA 4DL2A 2FE9A 2RQ5A 2MUTB 3PSTA 2IHMA 2C2RA 1Z00B 4C8KA 5EE3A 2HHVA 4DOBA 4F93B 3B0YA 2ASJA 1DGJA 1RXVA 1SKRA 4ECYA 5GTIU 4OJ5A 4DFMA 2B21A 4QZAA 4OJLA 4RPZA 8ICLA 1ZQRA 4QZHA 3RJFA 1V85A 4RQ2A 3MDAA 4B6JA 3MFIA 4ECVA 4XQ8A 5CHGA 3PSFA 5KFYA 4Z6CA 3V7LA 4YN4A 2KZZA 4EZ6A 3WU2U 2JR5A 5KFSA 2HOIA 8ICOA 3OJUA 2NYVA 4IR1A 2HVIA 2UVRA 2H3FA 5K4LA 2MU2A 5KTQA 2PI5A 4FBTA 2K8AA 1ZQOA 4C8MA 4RUCA 3ONNA 1WWUA 2JXJA 5J0YA 3RR8A 3RJJA 2PFOA 4QNLA 4O3PA 5AKGA 5HHIA 3MR2A 7ICIA 1X9XA 4P0PA 1RYSA 1ZQSA 4IRCA 3WK5A 5AI8A 8ICPA 1L8OA 1NZBA 2LYAA 3NVZA 1QSLA 1Z1BA 5KNIA 5ALZA 2NRXA 1XSNA 4DF4A 2LMRA 2HHXA 4M04A 1TV9A 1MQ3A 3BZKA 5IIIA 2G09A 4FS2A 3C28A 4K4IA 2WAQC 1S76D 1SWWA 4J03A 1L6NA 4JK1A 3ED5A 3Q8KA 4EELA 3C2KA 4CGZA 5KT4A 4YXJA 5C5JA 3WKBA 3RH4A 2FI1A 2G06A 2LKYA 3OTQA 5KFZA 1C20A 2FMQA 5DQGA 9ICTA 1QSSA 1SV0C 2KHQA 1N60A 2XGQA 1Q3VA 3UMBA 1PK1A 3PSIA 1U47A 3FYHA 2EANA 5DDYA 2K4EA 1ZD3A 5DG9A 2PKEA 2W54A 2F1JA 2KFZA 4DSFA 1T3NA 5J8YA 2HHSA 1NK4A 2ZUCA 4O3QA 4ED3A 3D6JA 4KTQA 1BPDA 4F4WA 5L1JA 4ZOHC 2W7PA 2MUTA 4TQRA 2KG5A 3RB3A 4GC6A 7ICSA 4GXKA 5F3XB 2LM1A 4DF8A 2W55A 5KT6A 2WF9A 2HBLA 1KSPA 5HR6A 3ALRA 2XGPA 5EWEA 3Q8MA 2W11A 3IG5A 2GH1A 4NV0A 5KFAA 3L3FX 5CA7A 3DV9A 4KN4A 1L3SA 3MDCA 3WKDA 4BUGA 3QU2A 1PUZA 3O0FA 5BOMA 5T14A 4I28A 4QZFA 3AL0B 2WTFA 4CNQA 5AKEA 3T5JA 2D6FC 2HVHA 4YMOA 4UARA 4C4RA 2FLNA 4O3RA 3PO5A 5E79U 2GLEA 9ICJA 1L3TA 1ZQWA 5KFWA 1KFTA 3UPQA 1WCNA 3N4MB 4BXOA 1RPLA 2R8JA 3SAFA 3NVYA 3SENA 4F5QA 2DWQA 3BQ0A 2FPMA 2F77X 4YQWA 4FFDA 4YR2A 3Q8PB 2BDPA 2K60A 1O08A 3KBBA 5ALTA 5KG4A 2VIXA 2KIWA 3JPPA 3C2LA 1HUOA 2P6RA 4KLEA 3H0LB 3QUBA 7ICNA 1TKDA 3FAHA 4YG2A 1ZQXA 4M47A 3D2SA 3D2QA 4J9OA 4MFCA 4LVSA 5HNKA 5IIJA 2XICA 3RB4A 4NJ8A 9ICPA 5DBCA 4DL6A 4I2HA 3E58A 2VJ5A 3G6VA 3PW5A 1SB3C 3LK9A 4EBCA 4DQSA 4CE6A 2E3TA 4O9MA 2J6UA 2YTUA 5J0PA 1QTMA 3OGUA 4OJ6A 4F2SA 3Q8QB 2K4PA 4B9SA 4TUQA 1BGXT 4E0DA 4BJQA 1D8BA 1D8LA 4RQ4A 1JMSA 1YZ6A 5IIOA 3SAHA 3KZIU 4CF5A 3RB6A 4JV2A 1KLNA 4JUZA 2YB4A 4RT2A 5J2GA 2XY6A 1WYGA 2I1QA 4YFKA 3SQIA 1ZQFA 1UHUA 4DWIA 3KHLA 4Y2QA 4DFPA 2I6XA 2BR0A 4J9RA 1VLBA 2HBJA 1BNOA 4P4MA 3SI8A 1NKEA 3KD3A 3H8JA 5KG5A 4TUSA 8ICTA 2ATLA 2L5YA 3KKAA 2IMWP 5L9XA 2ISOA 4KLDA 2P35A 2G5IB 5HMMA 2F1HA 2BQUA 2I5HA 4UB4A 1X6JA 2NRTA 5AK3A 3IV6A 4DLEA 1RZTA 1T4GA 4NY8A 3M7DA 2EQYA 4MEXA 2F8KA 2UVVA 2KNJA 2OHFA 4UAVA 8ICRA 1X66A 2HBMA 2ES6A 4DFDA 4YP3A 2CRXA 3TANA 2V4QA 3BJYA 2JEGA 2VA3A 2VA8A 1ZRMA 1XS9D 4DOCA 4BDPA 4ECRA 4DQIA 2HHQA 3C1YA 3KKAC 1ZQHA 3LWLA 7ICGA 1MC8A 4M9HA 4DCCA 1F44A 2YMMA 3MR6A 2ZIXA 3HP6A 1ECWA 1QQ5A 2H3QA 7ICQA 2R8GA 4UB6U 3V6HA 4I2DA 5DLGA 1S10A 3C5FA 3RBEA 5KFIA 4DLGA 3V7KA 3AQFA 4RUAA 2JEFA 4CCHA 4F5PA 2N1RA 3D2NA 5KT7A 1ZQKA 8ICHA 3FDSA 1RQLA 4F91B 7ICOA 3PW4A 2DPJA 2DKZA 1ZYQA 5AKKA 2PMZC 2XY5A 3TADC 4M2YA 4J9SA 1ZD2P 1ED1A 2K4HA 5IILA 4QZEA 1MN8A 2R8HA 4YXMA 3NUQA 3EZ5A 2KJ8A 4EYIB 1P7DA 2FPKA 4MHVA 3PX6A 4NXZA 1B4FA 1CI4A 3QU9A 5IINA 4A8EA 4YR3A 1B22A 2FMSA 5ALEA 4PZOA 4I2JA 1N62A 1QH9A 2YMQA 3QU7A 5KL8B 5DB6A 1DGSA 2B0CA 4O3NA 3C29A 1OXJA 1BPZA 1FFVA 2KSOB 3RRGA 4DOAA 1U48A 3OSPA 3ZDBA 1SKSA 4ACOA 4K4GA 3RAXA 4GLXA 2QB0A 1BPXA 3MABA 8ICMA 2HSZA 3HJEA 2Y1JA 4P0QA 7ICTA 7ICHA 2DF4B 1HJPA 5JRTA 4F4XA 1WG8A 5KG7A 2G07A 4P4PA 5KFDA 5L1KA 1J97A 2HCFA 3V6JA 4UASA 4O5KA 3WKAA 5D49A 2KVSA 3LDAA 1SGGA 1ZQJA 8ICKA 5KFOA 3RH5A 2ZTEA 3M6ZA 5AI4A 5DGBA 3MR3A 3M9OB 5BPCA 5J0XA 4NLBA 3N7SC 4CF3A 2ZIUA 3QUQA 3C21A 4DSLA 3UMGA 3CW2C 4EYHB 5ALMA 1X9SA 4O0IA 4JWMA 1HUZA 5HMLA 4Y2UA 2KK0A 4PHEA 4RNNA 4O3OA 1X42A 5J2KA 3BQ7A 1QCKA 4GXIA 2Y1IA 2PI4A 4KX3A 2FMPA 1CUKA 1CRXA 1KN5A 3M1YA 4FZMA 1J2MA 4YVZA 4ELVA 1ZQYA 2ASLA 4ECTA 4M6WB 1RM6C 2QKQA 4PGQA 5DQIA 2XCPA 5DLFA 3WK4A 1WCLA 5EE0A 1D9FA 4I2EA 1SL1A 4DFJA 2PFPA 4P4OA 4EBEA 3GZFA 4GIBA 5GTHU 2K8CB 5KFXA 5DBAA 1ZQNA 7ICEA 1TE2A 3JPOA 5ALUA 1LKYB 1KL9A 1JRPA 5ALDA 4R65A 2AQ4A 2VKQA 3RJEA 3JPQA 4Y2YA 3U26A 3GV5B 5AI5A 4NLNA 2CN1A 2R8KA 4UAYA 3BQ2A 3UXNA 3OHBA 4C8OA 4KLLA 4RQ3A 4G3IA 4B9NA 3IDWA 1IV8A 5AM3A 4ECUA 3IRUA 5HR7A 1LVHA 3VCBA 4AYBC 4OJOA 2H5XA 1UA1A 1NKBA 2EZXA 4IQVA 5J2JA 3M8RA 3M9NB 5KT2A 5AKYA 2EAOA 4JWNA 5CR0A 1ZJMA 2ALZA 3SYZA 4KLTA 1S0VA 1ZQVA 5AM1A 1ZD4A 1ZQUA 3GU3A 1T7PA 4O5EA 4USAA 3CYMA 1UT5A 3NVWA 9ICNA 1L7OA 3SZ2A 3RB0A 5ALRA 2RDIA 3AUOA 2MA1A 2AGOA 4KLOA 3TFRA 1BVSA 1KDHA 2RHFA 4KLSA 1JROA 3T5KA 5F9LA 2ZJAA 2HBKA 2Y9UA 1QSYA 1ZQCA 1YZ7A 4NLGA 1LB2B 2R8IA 4UATA 1S0OA 4QWBA 4DQPA 1RG6A 4RQ1A 1N5XA 3QUTA 4US9A 2W3SA 2G0AA 9ICBA 2FPLA 2W7OA 9ICWA 9ICQA 2FLLA 2AQ0A 4IQUA 2CPRA 3HX0A 2WB1C 2ZIXB 3G6XA 2GO7A 3ZI4A 1L8LA 1KKXA 2BKEA 3F5EA 5AI9A 5HHHA 1ZETA 4KLJA 5KFHA 8ICSA 2WF8A 2LPEA 4C8NA 2KZMA 2Y0SC 2KN7A 9ICXA 2NRZA 4RPYA 2GWSA 4IQTA 4J9QA 3IHQB 2WFAA 2F76X 2JZBB 5KG2A 4PGXA 5J8YC 1B43A 3UMCA 3QZ7A 1DK2A 3RR7A 3LVVA 2DBYA 3JPNA 3K4GA 1L5UA 4QZIA 4QIWC 2JH1A 4RT3A 2JRZA 3PY8A 1XO1A 3TKAA 7ICUA 4I2AA 1S0NA 2OM6A 5D4BA 1BPYA 3T5HA 9ICLA 3ORYA 2FDRA 4OJPA 1DXSA 4RQNA 4QW8A 4KMOB 4F71A 9ICFA 4EBDA 2CXYA 4ICAA 4ED8A 1ZQGA 4Y2PA 2PFQA 4Q8FA 4M6WA 4RU9A 2E8MA 4PHAA 4YCXA 7ICMA 3H0MB 4IRKA 5AHXA 1UT8A 4RQ8A 4IR9A 1N5WA 2PXIA 4MF8A 4M9LA 4BWJA 1SV4A 2F1IA 2J6SA 2RLTA 1AROP 5KFJA 9ICGA 5L1MA 2XVTA 2KE7A 3LYSA 1F0MA 5IIKA 3BDPA 3E2EA 1J2NA 2HI0A 1FEZA 3EW9A 3L4PA 3B0XA 3EWAA 2K8BB 3M6KA 2W9CA 3PO4A 1ZXIA 4PHDA 3NRWA 2OH2A 3QYPA 4JMUA 1A6SA 1GO3F 4FO6A 2KTQA 3QUCA 5ALQA 4QWDA 2NRVA 4R8UB 2UVWA 4YD1A 5KT5A 5AK6A 2IOFA 2WHEA 2R18A 4RPXA 5KFQA 3TACB 3TAQA 1NJYA 7ICFA 3PX0A 2A19A 9ICRA 2HOFA 1DOQA 1SXEA 1Y88A 2M9NA 3GFKB 1UCVA 1IG6A 8ICEA 3ZD8A 5L1IA 1XWLA 5KFEA 2ZXIA 4F4YA 1UQVA 1V97A 3ISCA 2ISPA 2XIDA 4NLCA 4MFFA 2W9CB 3WK6A 1QQ6A 2E1EA 2PMZF 1KQQA 1SWVA 4NLZA 2XC9A 4FBUA 4GFJA 4YR0A 4Q8EA 1N48A 3OPXA 1KEJA 4KX5A 2V4RA 4ECQA 1WUDA 2JMGA 4Y2VA 4BWMA 3SV4A 1L3VA 4UB2A 5J2FA 2YX8A 4PL2A 4KLQA 3C2MA 5J0WA 1XSPA 3FC4A 4OO1J 9ICSA 2NO4A 5J0RA 1YT3A 4NLKA 5DQHA 4F72A 4ECZA 2B6GA 1A76A 1ZQAA 5AKIA 2DFLA 1X40A 3OJSA 2G5HB 4UB8U 2H3VA 1DRGA 2IBKA 9ICEA 3QEBZ 1S9FA 5AM0A 1JXEA 4UW9A 2F8LA 4HYKA 4TQSA 1TK8A 4YD2A 8ICGA 2AHOB 3H8MA 5J2BA 3ZDEA 3G6YA 4C4SA 3PSPA 3M8SA 3HW8A 1KBUA 3LVWA 1CEZA 1PK3A 2Y9TA 2XCAA 5J0OA 2BQ3A 5KG1A 1HEKA 2UVUA 3K1RB 3RTVA 3EUB2 1TAUA 3N97B 5CEHA 1IIPA 4IC9A 1L3UA 9ICHA 1ZQMA 1XU4A 1S97A 2QARB 2RRDA 4Y2JA 1OUQA 2G08A 2KZ3A 5C0YA 2DUYA 1N61A 5G5HA 3KOOA 5ALFA 4Y2RA 2D8CA 1NK9A 4YMMA 4QJFB 7ICPA 4ED2A 2QB1A 4FZLA 5CRXA 1NOMA 1OW5A 3L5KA 4OCZA 5ALJA 3AN1A 5AM5A 5AK4A 8ICFA 1X6IA 4J9LA 4KLUA 2DKXA 2BCVA 2ZJ5A 2IHNA 4ECSA 2W9MA 2ZJ8A 1PVPA 1X2IA 4XRHA 4I29A 4UAWA 9ICAA 1T8EA 2C22A 2JV3A 5JUMA 5TZVA 5JTIA 3TFSA 1SZPA 1IM4A 4J9PA 2H3ZA 2ESEA 1MQ2A 3WK8A 3E0FA 3F2DA 2KP7A 9ICVA 5KFRA 3BQ1A 1XSLA 2FLPA 1S8OA 2LYHA 4Y2TA 2H3IA 4UB1A 4YMNA 1S0MA 4LJXA 4O3SA 1B0XA 3MC1A 1NK8A 3TAPA 1SV0A 5ALYA 4I2GA 4F4KA 5KT3A 3HPOA 2KICA 4NL9A 3QX7A 3V72A 2LM4A 3H0RB 2BCUA 4U6PA 3NTUA 2BGWA 5KAIU 3V7JA 4R64A 3Q8RB 1PVQA 3KTQA 2BCRA 4XA5A 4ELTA 1U45A 2W43A 1UA0A 1F5SA 2KFNA 2RP5A 1NK0A 1SXDA 2JHDA 3SAGA 4MEYA 5KFTA 1NJZA 5IIMA 2KKPA 3S6JA 3PMNA 3T3FA 3ISDA 3H4DA 3MGHA 4JV1A 4ECXA 2BCSA 7ICRA 2OXOA 4F5NA 3RF9A 1NZPA 3QXGA 3PW0A 1Q3UA 3DEEA 2KJ5A 2JGAA 3R9KA 1SL2A 4FZNA 4F50A 3TQ1A 3UM9A 3GDXA 2W03A 2C28A 5ALPA 3Q8LA 8ICIA 3T79A 8ICBA 3H40A 2MSNA 4PJ0U 4Y2SA 3HT3A 3CNHA 1ZQLA 3MGIA 1D9DA 2IOHA 1JIHA 3WK9A 3PZPA 1URJA 2EAMA 2DGZA 2M0NA 1U9LA 2HHTA 2ZIVA 4LZDA 3JPSA 3ISBA 1NK7A 3OHAA 4FE3A 1TAQA 4BX9C 2LHTA 3FM9A 2QLTA 1O03A 2W9BA 1H38A 4G9BA 2Z7JA 5KFBA 4EZ9A 4KLFA 3RH6A 2E8NA 2F3NA 3PR5B 3NS1A 4RQ6A 4QWCA 3EPGA 4MFAA 2Q4TA 1ZD5A 1COOA 1TAMA 3ICXA 3C5GA 4P0QB 1JN3A 3IG8A 3BS5A 2BQRA 2XI9A 4CRXA 1SKWA 4IRDA 1QLNA 3LWMA 3NRZA 3TARA 3GV8B 4C8LA 5ALIA 1KFDA 2KSOA 4F92B 3M9MB 4UQGA 2C2EA 4UBCA 4O3MA 4QWEA 2EH9A 4C4TA 4RQ7A 2NRWA 3N7RC 4DL5A 5AKJA 1TFRA 4I27A 4PZNA 5AKXA 4KLMA 1NKCA 3ZDCA 4M9JA 1ZQ1C 5J2AA 2YMPA 4P0PB 3AU2A 4RNOA 2HW3A 4DS5A 1PK1B 1ZRNA 2F2AB 2GOLA 3HILA 1Z4NA 2AH5A 2VJ4A 3PV8A 4X5VA 2FJ6A 5J0QA 5J2EA 4RQ0A 2YQEA 3KZXA 3RJGA 1Z00A 2KJ9A 2VA2A 5B5EU 5AKHA 1AQ6A 1JUDA 3HKZF 3AU6A 2BDUA 1BNPA 1Z3EB 5ALKA 3IP4B 3SR6A 1WWVA 1TVAA 3PR4A 4RZRA 4DSEA 1T94A 2K89A 1KW4A 4I2FA 3I1YA 2K4IA 2LI6A 1C7YA 1S77D 4Z6EA 5HP4A 3JPTA 2HHWA 4KITB 3KHGA 2AU0A 8ICQA 3IM1A 1XC9A 5KG3A 5B66U 4DFKA 3C1ZA 1ZJNA 3RBDA 5EWGA 1Z4OA 4F4ZA 3SD7A 3F5AA 2KMDA 1XNSA 2JEIA 4ED7A 2ZTDA 1PVRA 5DB7A 5J0SA 3OSNA 4WJ3B 4DEZA 4OD0A 3MGVA 1JI7A 4LZGA 4F5OA 5CWRA 3AM9A 5KL1B 1X9MA 4PL1A 1EXNA 4F2RA 4EEYA 1NK6A 1SL0A 5KFUA 8ICJA 1M6YA 5J2DA 2O6KA 5G5GA 5KFFA 3ZDDA 1A0PA 3AQEA 2W3RA 3K1ZA 3A0HU 4GC7A 4C7YA 3KHHA 1RDFA 3VC8A 3H8SA 2KOBA 1ZQIA 2AGQA 1JALA 2P6UA 5AI6A 1T3QA 5AIAA 5J2HA 2XY7A 5DBBA 2OWOA 4F3OA 2ZIWA 4EENA 1KRPA 1RQNA 1FIQA 1SZHA 4UB5A 3H8WA 4QZCA 5DKWA 1ZQTA 5DG7A 3THVA 3ZD9A 1LV5A
chains in the Genus database with same CATH topology
2K60A 2L5YA 3KKAA 4PZOA 1KW4A 5J8YA 2E8NA 1COKA 2F3NA 1OXJA 2KIVA 1WWUA 1LKYB 1B0XA 2KSOB 1SV0A 4RQMA 2F8KA 3SEIA 2D3DA 3H8MA 2KG5A 4NL9A 3TACB 2QB0A 1Z1VA 2LPEA 1X66A 5JU5A 2E8PA 5F3XB 2ES6A 1X9XA 4NJ8A 3IDWA 1SXEA 3BS5A 1UCVA 1PK3A 2Y9TA 5J8YC 5JRTA 3BS5B 2KMDA 3K1RB 3KKAC 2KSOA 3TADA 2QARA 1UQVA 1V38A 5KNIA 2YTUA 1JI7A 2FE9A 2LMRA 1SXDA 1SGGA 2QARB 2EAOA 4NL9C 1DXSA 4RQNA 1LKYA 2K4PA 4IS7A 2D8CA 4PZNA 2E8MA 2QB1A 1PK1B 2E8OA 1OW5A 2GLEA 3HILA 2QB0B 2EAPA 3BS7A 2F44A 2DKZA 3TADC 1SV4A 1V85A 2DKXA 3BQ7A 5L1MA 1SV0C 2KE7A 3SENA 2Y9UA 1F0MA 4MHVA 2DL0A 1B4FA 2EAMA 2JV3A 5JTIA 1PK1A 2B6GA 2EANA 2ESEA 2QKQA 1RG6A 1WWVA 1X40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K60 A;  2L5Y A;  3KKA A;  4PZO A;  1KW4 A;  5J8Y A;  2E8N A;  1COK A;  2F3N A;  1OXJ A;  2KIV A;  1WWU A;  1LKY B;  1B0X A;  2KSO B;  1SV0 A;  4RQM A;  2F8K A;  3SEI A;  2D3D A;  3H8M A;  2KG5 A;  4NL9 A;  3TAC B;  2QB0 A;  1Z1V A;  2LPE A;  1X66 A;  5JU5 A;  2E8P A;  5F3X B;  2ES6 A;  1X9X A;  4NJ8 A;  3IDW A;  1SXE A;  3BS5 A;  1UCV A;  1PK3 A;  2Y9T A;  5J8Y C;  5JRT A;  3BS5 B;  2KMD A;  3K1R B;  3KKA C;  2KSO A;  3TAD A;  2QAR A;  1UQV A;  1V38 A;  5KNI A;  2YTU A;  1JI7 A;  2FE9 A;  2LMR A;  1SXD A;  1SGG A;  2QAR B;  2EAO A;  4NL9 C;  1DXS A;  4RQN A;  1LKY A;  2K4P A;  4IS7 A;  2D8C A;  4PZN A;  2E8M A;  2QB1 A;  1PK1 B;  2E8O A;  1OW5 A;  2GLE A;  3HIL A;  2QB0 B;  2EAP A;  3BS7 A;  2F44 A;  2DKZ A;  3TAD C;  1SV4 A;  1V85 A;  2DKX A;  3BQ7 A;  5L1M A;  1SV0 C;  2KE7 A;  3SEN A;  2Y9U A;  1F0M A;  4MHV A;  2DL0 A;  1B4F A;  2EAM A;  2JV3 A;  5JTI A;  1PK1 A;  2B6G A;  2EAN A;  2ESE A;  2QKQ A;  1RG6 A;  1WWV A;  1X40 A; 
#chains in the Genus database with same CATH topology
 2KD1 A;  2RDJ A;  5KFP A;  3EPI A;  4QZB A;  5CJ7 A;  3HKZ C;  4CDG A;  2ASD A;  1N2X A;  1COK A;  4ED0 A;  2ZIU B;  1RYU A;  2MRL A;  3ETR A;  2PFN A;  3QZ8 A;  5DB9 A;  1NJX A;  4RQM A;  8ICW A;  2I9G A;  5AK5 A;  3PVX A;  3I76 A;  5DDM A;  3QU4 A;  3MBY A;  5JU5 A;  4I2B A;  3PX4 A;  3RFA A;  3GII A;  2V9W A;  3UXP A;  3RAQ A;  4C7Z A;  4IQW A;  3NAS A;  4ED1 A;  4K4H A;  2OYY A;  1ZQP A;  1TK0 A;  4EX6 A;  1N56 A;  4DSJ A;  3GIK A;  4KLH A;  1QQ7 A;  1V38 A;  5AM4 A;  5ALV A;  2W9A A;  4NM1 A;  1S5L U;  1KTQ A;  3WKE A;  3RRH A;  2OEH A;  2YN4 A;  4DL7 A;  4IS7 A;  4XUS A;  4R63 A;  5ALN A;  5KFV A;  1MA7 A;  3BZC A;  4TUP A;  1NK5 A;  1ZQE A;  2BHN A;  2IOF K;  4PPX A;  3BQT A;  4I2I A;  2MAX A;  4TUR A;  5AIB A;  4R66 A;  2QB0 B;  2C2D A;  2EAP A;  7ICJ A;  2NV3 A;  4F8R A;  2F44 A;  1NNL A;  2KEY A;  5A0L A;  2BCQ A;  3QEA Z;  4QZ9 A;  1FO4 A;  4BXO B;  5J2I A;  1MSW D;  3H7I A;  5ALL A;  2XO7 A;  4J9M A;  4QZD A;  3HWT A;  1SIJ A;  2HDO A;  4AYB F;  5AI0 A;  5KFG A;  4UAU A;  5KFL A;  9ICC A;  3NVV A;  4KN7 A;  4Z6D A;  1IXR A;  2WB1 F;  4DQR A;  3PW2 A;  2A1J B;  1JXL A;  1ZQZ A;  4DQQ A;  3F2C A;  3RJK A;  9ICM A;  5AM2 A;  2YB1 A;  5J29 A;  3V6K A;  3QE9 Y;  3PW7 A;  4I2C A;  2OCE A;  4ELU A;  8ICY A;  4R8U A;  2WAQ F;  1ZQD A;  2NO5 A;  1RYR A;  2ZTC A;  3QU5 A;  1VDV A;  4B9V A;  2D3D A;  3K75 D;  4M9N A;  3SMV A;  2AXT U;  4J9N A;  5DB8 A;  4UBB A;  2LBO A;  2W9B B;  2E8P A;  2YY6 A;  3EYZ A;  1DK3 A;  2WF7 A;  3KHR A;  3F2B A;  1RXW A;  5D46 A;  2ZXH A;  4M0A A;  5ALX A;  7ICL A;  2JH7 A;  5J2C A;  4JV0 A;  2JEJ A;  5L1L A;  2BPF A;  4GXJ A;  3ZDA A;  1U4B A;  4UAZ A;  3GIJ A;  4B9M A;  1VJ5 A;  4PH5 A;  3HRD D;  2KV2 A;  4F5R A;  2ZUD A;  4DSI A;  2WF6 A;  2ODG A;  1Q46 A;  2HOQ A;  2E8O A;  2W8L A;  4KLG A;  2ZUB A;  3AMZ A;  5J0U A;  4KLI A;  5KG6 A;  4KMU A;  4B9L A;  9ICI A;  5ALG A;  4IL6 U;  4HAI A;  2ZIW B;  1KFS A;  2A3V A;  5H2F U;  3C23 A;  4O5C A;  5ALW A;  5KAF U;  2WF5 A;  5TIS U;  5DGA A;  2KKV A;  1UPH A;  5ALS A;  2DPI A;  5KG0 A;  4B9T A;  8ICV A;  1N63 A;  2A1J A;  2P66 A;  3PML A;  1HIW A;  4BGD A;  2ZIV B;  1ZQQ A;  2VAN A;  2Y0S F;  4QIW F;  3KFU F;  4QZG A;  8ICC A;  3PNC A;  3N28 A;  3WK7 A;  2KIV A;  4PGY A;  1FFU A;  3WKC A;  1X9W A;  1A77 A;  3A0B U;  5J0T A;  8ICA A;  2HHU A;  1L7P A;  3SEI A;  4DO9 A;  1V9P A;  3DDH A;  2JZB A;  3UXO A;  1PZN A;  4Q43 A;  4Y2X A;  3CP8 A;  1BPB A;  5KFM A;  4JB3 A;  5ALH A;  4B9U A;  4DSK A;  5EE9 A;  3MFH A;  3SV3 A;  4US8 A;  4PHP A;  3NGD A;  2E5S A;  4EX7 A;  4CF4 A;  3CRX A;  5EE1 A;  4ED6 A;  5AIC A;  3H4B A;  2HMX A;  3J81 j;  3TAD A;  4MF2 A;  4Q44 A;  3QNM A;  5EWF A;  4Q45 A;  2YML A;  1K5O A;  4QZ8 A;  9ICO A;  9ICK A;  3MR5 A;  1K1Q A;  4M9G A;  4NL9 C;  3Q8S B;  1LKY A;  4EEK A;  2ZG6 A;  2Q0Z X;  2KHV A;  1L7M A;  5AKZ A;  8ICU A;  2J6T A;  8ICX A;  3IN5 A;  1K1S A;  3BS7 A;  4DL3 A;  3T5L A;  4FS1 A;  2KVC A;  4DL4 A;  3ETL A;  4QW9 A;  5KFK A;  3UQ0 A;  4C80 A;  5BOL A;  3GIL A;  3UQ2 A;  3I28 A;  2EDU A;  1Q8K A;  4QWA A;  1TK5 A;  8ICN A;  5CB1 A;  2DL0 A;  7ICK A;  2W8K A;  1L7N A;  2BZF A;  2BPG A;  2EZZ A;  5KFN A;  1Z19 A;  5EOZ A;  4J9K A;  3TI0 A;  3GIM A;  9ICU A;  3GQC A;  1D8Y A;  4AP9 A;  4DS4 A;  1ZQB A;  3AEV A;  2W04 A;  1JX4 A;  5ALO A;  3GV7 B;  5DG8 A;  2BPC A;  1ZOL A;  2IA6 A;  1U49 A;  4RQ5 A;  5KFC A;  4NWI A;  4NM2 A;  5CP2 A;  8ICZ A;  4C0Z A;  4ECW A;  2LYB A;  3N7P D;  3JPR A;  4UB3 A;  3RJI A;  1BPE A;  4U7C A;  1Z1V A;  1NI3 A;  1XO0 A;  4Z6F A;  2EZY A;  4RNM A;  2E1F A;  4ZH4 A;  4P2H A;  2AGP A;  2A1A A;  3RJH A;  2DQN B;  3BS5 B;  5FP0 A;  1NJW A;  7ICV A;  2QAR A;  5AKL A;  3F53 A;  5F9N A;  3B9J A;  2AJQ A;  4DL2 A;  2FE9 A;  2RQ5 A;  2MUT B;  3PST A;  2IHM A;  2C2R A;  1Z00 B;  4C8K A;  5EE3 A;  2HHV A;  4DOB A;  4F93 B;  3B0Y A;  2ASJ A;  1DGJ A;  1RXV A;  1SKR A;  4ECY A;  5GTI U;  4OJ5 A;  4DFM A;  2B21 A;  4QZA A;  4OJL A;  4RPZ A;  8ICL A;  1ZQR A;  4QZH A;  3RJF A;  1V85 A;  4RQ2 A;  3MDA A;  4B6J A;  3MFI A;  4ECV A;  4XQ8 A;  5CHG A;  3PSF A;  5KFY A;  4Z6C A;  3V7L A;  4YN4 A;  2KZZ A;  4EZ6 A;  3WU2 U;  2JR5 A;  5KFS A;  2HOI A;  8ICO A;  3OJU A;  2NYV A;  4IR1 A;  2HVI A;  2UVR A;  2H3F A;  5K4L A;  2MU2 A;  5KTQ A;  2PI5 A;  4FBT A;  2K8A A;  1ZQO A;  4C8M A;  4RUC A;  3ONN A;  1WWU A;  2JXJ A;  5J0Y A;  3RR8 A;  3RJJ A;  2PFO A;  4QNL A;  4O3P A;  5AKG A;  5HHI A;  3MR2 A;  7ICI A;  1X9X A;  4P0P A;  1RYS A;  1ZQS A;  4IRC A;  3WK5 A;  5AI8 A;  8ICP A;  1L8O A;  1NZB A;  2LYA A;  3NVZ A;  1QSL A;  1Z1B A;  5KNI A;  5ALZ A;  2NRX A;  1XSN A;  4DF4 A;  2LMR A;  2HHX A;  4M04 A;  1TV9 A;  1MQ3 A;  3BZK A;  5III A;  2G09 A;  4FS2 A;  3C28 A;  4K4I A;  2WAQ C;  1S76 D;  1SWW A;  4J03 A;  1L6N A;  4JK1 A;  3ED5 A;  3Q8K A;  4EEL A;  3C2K A;  4CGZ A;  5KT4 A;  4YXJ A;  5C5J A;  3WKB A;  3RH4 A;  2FI1 A;  2G06 A;  2LKY A;  3OTQ A;  5KFZ A;  1C20 A;  2FMQ A;  5DQG A;  9ICT A;  1QSS A;  1SV0 C;  2KHQ A;  1N60 A;  2XGQ A;  1Q3V A;  3UMB A;  1PK1 A;  3PSI A;  1U47 A;  3FYH A;  2EAN A;  5DDY A;  2K4E A;  1ZD3 A;  5DG9 A;  2PKE A;  2W54 A;  2F1J A;  2KFZ A;  4DSF A;  1T3N A;  5J8Y A;  2HHS A;  1NK4 A;  2ZUC A;  4O3Q A;  4ED3 A;  3D6J A;  4KTQ A;  1BPD A;  4F4W A;  5L1J A;  4ZOH C;  2W7P A;  2MUT A;  4TQR A;  2KG5 A;  3RB3 A;  4GC6 A;  7ICS A;  4GXK A;  5F3X B;  2LM1 A;  4DF8 A;  2W55 A;  5KT6 A;  2WF9 A;  2HBL A;  1KSP A;  5HR6 A;  3ALR A;  2XGP A;  5EWE A;  3Q8M A;  2W11 A;  3IG5 A;  2GH1 A;  4NV0 A;  5KFA A;  3L3F X;  5CA7 A;  3DV9 A;  4KN4 A;  1L3S A;  3MDC A;  3WKD A;  4BUG A;  3QU2 A;  1PUZ A;  3O0F A;  5BOM A;  5T14 A;  4I28 A;  4QZF A;  3AL0 B;  2WTF A;  4CNQ A;  5AKE A;  3T5J A;  2D6F C;  2HVH A;  4YMO A;  4UAR A;  4C4R A;  2FLN A;  4O3R A;  3PO5 A;  5E79 U;  2GLE A;  9ICJ A;  1L3T A;  1ZQW A;  5KFW A;  1KFT A;  3UPQ A;  1WCN A;  3N4M B;  4BXO A;  1RPL A;  2R8J A;  3SAF A;  3NVY A;  3SEN A;  4F5Q A;  2DWQ A;  3BQ0 A;  2FPM A;  2F77 X;  4YQW A;  4FFD A;  4YR2 A;  3Q8P B;  2BDP A;  2K60 A;  1O08 A;  3KBB A;  5ALT A;  5KG4 A;  2VIX A;  2KIW A;  3JPP A;  3C2L A;  1HUO A;  2P6R A;  4KLE A;  3H0L B;  3QUB A;  7ICN A;  1TKD A;  3FAH A;  4YG2 A;  1ZQX A;  4M47 A;  3D2S A;  3D2Q A;  4J9O A;  4MFC A;  4LVS A;  5HNK A;  5IIJ A;  2XIC A;  3RB4 A;  4NJ8 A;  9ICP A;  5DBC A;  4DL6 A;  4I2H A;  3E58 A;  2VJ5 A;  3G6V A;  3PW5 A;  1SB3 C;  3LK9 A;  4EBC A;  4DQS A;  4CE6 A;  2E3T A;  4O9M A;  2J6U A;  2YTU A;  5J0P A;  1QTM A;  3OGU A;  4OJ6 A;  4F2S A;  3Q8Q B;  2K4P A;  4B9S A;  4TUQ A;  1BGX T;  4E0D A;  4BJQ A;  1D8B A;  1D8L A;  4RQ4 A;  1JMS A;  1YZ6 A;  5IIO A;  3SAH A;  3KZI U;  4CF5 A;  3RB6 A;  4JV2 A;  1KLN A;  4JUZ A;  2YB4 A;  4RT2 A;  5J2G A;  2XY6 A;  1WYG A;  2I1Q A;  4YFK A;  3SQI A;  1ZQF A;  1UHU A;  4DWI A;  3KHL A;  4Y2Q A;  4DFP A;  2I6X A;  2BR0 A;  4J9R A;  1VLB A;  2HBJ A;  1BNO A;  4P4M A;  3SI8 A;  1NKE A;  3KD3 A;  3H8J A;  5KG5 A;  4TUS A;  8ICT A;  2ATL A;  2L5Y A;  3KKA A;  2IMW P;  5L9X A;  2ISO A;  4KLD A;  2P35 A;  2G5I B;  5HMM A;  2F1H A;  2BQU A;  2I5H A;  4UB4 A;  1X6J A;  2NRT A;  5AK3 A;  3IV6 A;  4DLE A;  1RZT A;  1T4G A;  4NY8 A;  3M7D A;  2EQY A;  4MEX A;  2F8K A;  2UVV A;  2KNJ A;  2OHF A;  4UAV A;  8ICR A;  1X66 A;  2HBM A;  2ES6 A;  4DFD A;  4YP3 A;  2CRX A;  3TAN A;  2V4Q A;  3BJY A;  2JEG A;  2VA3 A;  2VA8 A;  1ZRM A;  1XS9 D;  4DOC A;  4BDP A;  4ECR A;  4DQI A;  2HHQ A;  3C1Y A;  3KKA C;  1ZQH A;  3LWL A;  7ICG A;  1MC8 A;  4M9H A;  4DCC A;  1F44 A;  2YMM A;  3MR6 A;  2ZIX A;  3HP6 A;  1ECW A;  1QQ5 A;  2H3Q A;  7ICQ A;  2R8G A;  4UB6 U;  3V6H A;  4I2D A;  5DLG A;  1S10 A;  3C5F A;  3RBE A;  5KFI A;  4DLG A;  3V7K A;  3AQF A;  4RUA A;  2JEF A;  4CCH A;  4F5P A;  2N1R A;  3D2N A;  5KT7 A;  1ZQK A;  8ICH A;  3FDS A;  1RQL A;  4F91 B;  7ICO A;  3PW4 A;  2DPJ A;  2DKZ A;  1ZYQ A;  5AKK A;  2PMZ C;  2XY5 A;  3TAD C;  4M2Y A;  4J9S A;  1ZD2 P;  1ED1 A;  2K4H A;  5IIL A;  4QZE A;  1MN8 A;  2R8H A;  4YXM A;  3NUQ A;  3EZ5 A;  2KJ8 A;  4EYI B;  1P7D A;  2FPK A;  4MHV A;  3PX6 A;  4NXZ A;  1B4F A;  1CI4 A;  3QU9 A;  5IIN A;  4A8E A;  4YR3 A;  1B22 A;  2FMS A;  5ALE A;  4PZO A;  4I2J A;  1N62 A;  1QH9 A;  2YMQ A;  3QU7 A;  5KL8 B;  5DB6 A;  1DGS A;  2B0C A;  4O3N A;  3C29 A;  1OXJ A;  1BPZ A;  1FFV A;  2KSO B;  3RRG A;  4DOA A;  1U48 A;  3OSP A;  3ZDB A;  1SKS A;  4ACO A;  4K4G A;  3RAX A;  4GLX A;  2QB0 A;  1BPX A;  3MAB A;  8ICM A;  2HSZ A;  3HJE A;  2Y1J A;  4P0Q A;  7ICT A;  7ICH A;  2DF4 B;  1HJP A;  5JRT A;  4F4X A;  1WG8 A;  5KG7 A;  2G07 A;  4P4P A;  5KFD A;  5L1K A;  1J97 A;  2HCF A;  3V6J A;  4UAS A;  4O5K A;  3WKA A;  5D49 A;  2KVS A;  3LDA A;  1SGG A;  1ZQJ A;  8ICK A;  5KFO A;  3RH5 A;  2ZTE A;  3M6Z A;  5AI4 A;  5DGB A;  3MR3 A;  3M9O B;  5BPC A;  5J0X A;  4NLB A;  3N7S C;  4CF3 A;  2ZIU A;  3QUQ A;  3C21 A;  4DSL A;  3UMG A;  3CW2 C;  4EYH B;  5ALM A;  1X9S A;  4O0I A;  4JWM A;  1HUZ A;  5HML A;  4Y2U A;  2KK0 A;  4PHE A;  4RNN A;  4O3O A;  1X42 A;  5J2K A;  3BQ7 A;  1QCK A;  4GXI A;  2Y1I A;  2PI4 A;  4KX3 A;  2FMP A;  1CUK A;  1CRX A;  1KN5 A;  3M1Y A;  4FZM A;  1J2M A;  4YVZ A;  4ELV A;  1ZQY A;  2ASL A;  4ECT A;  4M6W B;  1RM6 C;  2QKQ A;  4PGQ A;  5DQI A;  2XCP A;  5DLF A;  3WK4 A;  1WCL A;  5EE0 A;  1D9F A;  4I2E A;  1SL1 A;  4DFJ A;  2PFP A;  4P4O A;  4EBE A;  3GZF A;  4GIB A;  5GTH U;  2K8C B;  5KFX A;  5DBA A;  1ZQN A;  7ICE A;  1TE2 A;  3JPO A;  5ALU A;  1LKY B;  1KL9 A;  1JRP A;  5ALD A;  4R65 A;  2AQ4 A;  2VKQ A;  3RJE A;  3JPQ A;  4Y2Y A;  3U26 A;  3GV5 B;  5AI5 A;  4NLN A;  2CN1 A;  2R8K A;  4UAY A;  3BQ2 A;  3UXN A;  3OHB A;  4C8O A;  4KLL A;  4RQ3 A;  4G3I A;  4B9N A;  3IDW A;  1IV8 A;  5AM3 A;  4ECU A;  3IRU A;  5HR7 A;  1LVH A;  3VCB A;  4AYB C;  4OJO A;  2H5X A;  1UA1 A;  1NKB A;  2EZX A;  4IQV A;  5J2J A;  3M8R A;  3M9N B;  5KT2 A;  5AKY A;  2EAO A;  4JWN A;  5CR0 A;  1ZJM A;  2ALZ A;  3SYZ A;  4KLT A;  1S0V A;  1ZQV A;  5AM1 A;  1ZD4 A;  1ZQU A;  3GU3 A;  1T7P A;  4O5E A;  4USA A;  3CYM A;  1UT5 A;  3NVW A;  9ICN A;  1L7O A;  3SZ2 A;  3RB0 A;  5ALR A;  2RDI A;  3AUO A;  2MA1 A;  2AGO A;  4KLO A;  3TFR A;  1BVS A;  1KDH A;  2RHF A;  4KLS A;  1JRO A;  3T5K A;  5F9L A;  2ZJA A;  2HBK A;  2Y9U A;  1QSY A;  1ZQC A;  1YZ7 A;  4NLG A;  1LB2 B;  2R8I A;  4UAT A;  1S0O A;  4QWB A;  4DQP A;  1RG6 A;  4RQ1 A;  1N5X A;  3QUT A;  4US9 A;  2W3S A;  2G0A A;  9ICB A;  2FPL A;  2W7O A;  9ICW A;  9ICQ A;  2FLL A;  2AQ0 A;  4IQU A;  2CPR A;  3HX0 A;  2WB1 C;  2ZIX B;  3G6X A;  2GO7 A;  3ZI4 A;  1L8L A;  1KKX A;  2BKE A;  3F5E A;  5AI9 A;  5HHH A;  1ZET A;  4KLJ A;  5KFH A;  8ICS A;  2WF8 A;  2LPE A;  4C8N A;  2KZM A;  2Y0S C;  2KN7 A;  9ICX A;  2NRZ A;  4RPY A;  2GWS A;  4IQT A;  4J9Q A;  3IHQ B;  2WFA A;  2F76 X;  2JZB B;  5KG2 A;  4PGX A;  5J8Y C;  1B43 A;  3UMC A;  3QZ7 A;  1DK2 A;  3RR7 A;  3LVV A;  2DBY A;  3JPN A;  3K4G A;  1L5U A;  4QZI A;  4QIW C;  2JH1 A;  4RT3 A;  2JRZ A;  3PY8 A;  1XO1 A;  3TKA A;  7ICU A;  4I2A A;  1S0N A;  2OM6 A;  5D4B A;  1BPY A;  3T5H A;  9ICL A;  3ORY A;  2FDR A;  4OJP A;  1DXS A;  4RQN A;  4QW8 A;  4KMO B;  4F71 A;  9ICF A;  4EBD A;  2CXY A;  4ICA A;  4ED8 A;  1ZQG A;  4Y2P A;  2PFQ A;  4Q8F A;  4M6W A;  4RU9 A;  2E8M A;  4PHA A;  4YCX A;  7ICM A;  3H0M B;  4IRK A;  5AHX A;  1UT8 A;  4RQ8 A;  4IR9 A;  1N5W A;  2PXI A;  4MF8 A;  4M9L A;  4BWJ A;  1SV4 A;  2F1I A;  2J6S A;  2RLT A;  1ARO P;  5KFJ A;  9ICG A;  5L1M A;  2XVT A;  2KE7 A;  3LYS A;  1F0M A;  5IIK A;  3BDP A;  3E2E A;  1J2N A;  2HI0 A;  1FEZ A;  3EW9 A;  3L4P A;  3B0X A;  3EWA A;  2K8B B;  3M6K A;  2W9C A;  3PO4 A;  1ZXI A;  4PHD A;  3NRW A;  2OH2 A;  3QYP A;  4JMU A;  1A6S A;  1GO3 F;  4FO6 A;  2KTQ A;  3QUC A;  5ALQ A;  4QWD A;  2NRV A;  4R8U B;  2UVW A;  4YD1 A;  5KT5 A;  5AK6 A;  2IOF A;  2WHE A;  2R18 A;  4RPX A;  5KFQ A;  3TAC B;  3TAQ A;  1NJY A;  7ICF A;  3PX0 A;  2A19 A;  9ICR A;  2HOF A;  1DOQ A;  1SXE A;  1Y88 A;  2M9N A;  3GFK B;  1UCV A;  1IG6 A;  8ICE A;  3ZD8 A;  5L1I A;  1XWL A;  5KFE A;  2ZXI A;  4F4Y A;  1UQV A;  1V97 A;  3ISC A;  2ISP A;  2XID A;  4NLC A;  4MFF A;  2W9C B;  3WK6 A;  1QQ6 A;  2E1E A;  2PMZ F;  1KQQ A;  1SWV A;  4NLZ A;  2XC9 A;  4FBU A;  4GFJ A;  4YR0 A;  4Q8E A;  1N48 A;  3OPX A;  1KEJ A;  4KX5 A;  2V4R A;  4ECQ A;  1WUD A;  2JMG A;  4Y2V A;  4BWM A;  3SV4 A;  1L3V A;  4UB2 A;  5J2F A;  2YX8 A;  4PL2 A;  4KLQ A;  3C2M A;  5J0W A;  1XSP A;  3FC4 A;  4OO1 J;  9ICS A;  2NO4 A;  5J0R A;  1YT3 A;  4NLK A;  5DQH A;  4F72 A;  4ECZ A;  2B6G A;  1A76 A;  1ZQA A;  5AKI A;  2DFL A;  1X40 A;  3OJS A;  2G5H B;  4UB8 U;  2H3V A;  1DRG A;  2IBK A;  9ICE A;  3QEB Z;  1S9F A;  5AM0 A;  1JXE A;  4UW9 A;  2F8L A;  4HYK A;  4TQS A;  1TK8 A;  4YD2 A;  8ICG A;  2AHO B;  3H8M A;  5J2B A;  3ZDE A;  3G6Y A;  4C4S A;  3PSP A;  3M8S A;  3HW8 A;  1KBU A;  3LVW A;  1CEZ A;  1PK3 A;  2Y9T A;  2XCA A;  5J0O A;  2BQ3 A;  5KG1 A;  1HEK A;  2UVU A;  3K1R B;  3RTV A;  3EUB 2;  1TAU A;  3N97 B;  5CEH A;  1IIP A;  4IC9 A;  1L3U A;  9ICH A;  1ZQM A;  1XU4 A;  1S97 A;  2QAR B;  2RRD A;  4Y2J A;  1OUQ A;  2G08 A;  2KZ3 A;  5C0Y A;  2DUY A;  1N61 A;  5G5H A;  3KOO A;  5ALF A;  4Y2R A;  2D8C A;  1NK9 A;  4YMM A;  4QJF B;  7ICP A;  4ED2 A;  2QB1 A;  4FZL A;  5CRX A;  1NOM A;  1OW5 A;  3L5K A;  4OCZ A;  5ALJ A;  3AN1 A;  5AM5 A;  5AK4 A;  8ICF A;  1X6I A;  4J9L A;  4KLU A;  2DKX A;  2BCV A;  2ZJ5 A;  2IHN A;  4ECS A;  2W9M A;  2ZJ8 A;  1PVP A;  1X2I A;  4XRH A;  4I29 A;  4UAW A;  9ICA A;  1T8E A;  2C22 A;  2JV3 A;  5JUM A;  5TZV A;  5JTI A;  3TFS A;  1SZP A;  1IM4 A;  4J9P A;  2H3Z A;  2ESE A;  1MQ2 A;  3WK8 A;  3E0F A;  3F2D A;  2KP7 A;  9ICV A;  5KFR A;  3BQ1 A;  1XSL A;  2FLP A;  1S8O A;  2LYH A;  4Y2T A;  2H3I A;  4UB1 A;  4YMN A;  1S0M A;  4LJX A;  4O3S A;  1B0X A;  3MC1 A;  1NK8 A;  3TAP A;  1SV0 A;  5ALY A;  4I2G A;  4F4K A;  5KT3 A;  3HPO A;  2KIC A;  4NL9 A;  3QX7 A;  3V72 A;  2LM4 A;  3H0R B;  2BCU A;  4U6P A;  3NTU A;  2BGW A;  5KAI U;  3V7J A;  4R64 A;  3Q8R B;  1PVQ A;  3KTQ A;  2BCR A;  4XA5 A;  4ELT A;  1U45 A;  2W43 A;  1UA0 A;  1F5S A;  2KFN A;  2RP5 A;  1NK0 A;  1SXD A;  2JHD A;  3SAG A;  4MEY A;  5KFT A;  1NJZ A;  5IIM A;  2KKP A;  3S6J A;  3PMN A;  3T3F A;  3ISD A;  3H4D A;  3MGH A;  4JV1 A;  4ECX A;  2BCS A;  7ICR A;  2OXO A;  4F5N A;  3RF9 A;  1NZP A;  3QXG A;  3PW0 A;  1Q3U A;  3DEE A;  2KJ5 A;  2JGA A;  3R9K A;  1SL2 A;  4FZN A;  4F50 A;  3TQ1 A;  3UM9 A;  3GDX A;  2W03 A;  2C28 A;  5ALP A;  3Q8L A;  8ICI A;  3T79 A;  8ICB A;  3H40 A;  2MSN A;  4PJ0 U;  4Y2S A;  3HT3 A;  3CNH A;  1ZQL A;  3MGI A;  1D9D A;  2IOH A;  1JIH A;  3WK9 A;  3PZP A;  1URJ A;  2EAM A;  2DGZ A;  2M0N A;  1U9L A;  2HHT A;  2ZIV A;  4LZD A;  3JPS A;  3ISB A;  1NK7 A;  3OHA A;  4FE3 A;  1TAQ A;  4BX9 C;  2LHT A;  3FM9 A;  2QLT A;  1O03 A;  2W9B A;  1H38 A;  4G9B A;  2Z7J A;  5KFB A;  4EZ9 A;  4KLF A;  3RH6 A;  2E8N A;  2F3N A;  3PR5 B;  3NS1 A;  4RQ6 A;  4QWC A;  3EPG A;  4MFA A;  2Q4T A;  1ZD5 A;  1COO A;  1TAM A;  3ICX A;  3C5G A;  4P0Q B;  1JN3 A;  3IG8 A;  3BS5 A;  2BQR A;  2XI9 A;  4CRX A;  1SKW A;  4IRD A;  1QLN A;  3LWM A;  3NRZ A;  3TAR A;  3GV8 B;  4C8L A;  5ALI A;  1KFD A;  2KSO A;  4F92 B;  3M9M B;  4UQG A;  2C2E A;  4UBC A;  4O3M A;  4QWE A;  2EH9 A;  4C4T A;  4RQ7 A;  2NRW A;  3N7R C;  4DL5 A;  5AKJ A;  1TFR A;  4I27 A;  4PZN A;  5AKX A;  4KLM A;  1NKC A;  3ZDC A;  4M9J A;  1ZQ1 C;  5J2A A;  2YMP A;  4P0P B;  3AU2 A;  4RNO A;  2HW3 A;  4DS5 A;  1PK1 B;  1ZRN A;  2F2A B;  2GOL A;  3HIL A;  1Z4N A;  2AH5 A;  2VJ4 A;  3PV8 A;  4X5V A;  2FJ6 A;  5J0Q A;  5J2E A;  4RQ0 A;  2YQE A;  3KZX A;  3RJG A;  1Z00 A;  2KJ9 A;  2VA2 A;  5B5E U;  5AKH A;  1AQ6 A;  1JUD A;  3HKZ F;  3AU6 A;  2BDU A;  1BNP A;  1Z3E B;  5ALK A;  3IP4 B;  3SR6 A;  1WWV A;  1TVA A;  3PR4 A;  4RZR A;  4DSE A;  1T94 A;  2K89 A;  1KW4 A;  4I2F A;  3I1Y A;  2K4I A;  2LI6 A;  1C7Y A;  1S77 D;  4Z6E A;  5HP4 A;  3JPT A;  2HHW A;  4KIT B;  3KHG A;  2AU0 A;  8ICQ A;  3IM1 A;  1XC9 A;  5KG3 A;  5B66 U;  4DFK A;  3C1Z A;  1ZJN A;  3RBD A;  5EWG A;  1Z4O A;  4F4Z A;  3SD7 A;  3F5A A;  2KMD A;  1XNS A;  2JEI A;  4ED7 A;  2ZTD A;  1PVR A;  5DB7 A;  5J0S A;  3OSN A;  4WJ3 B;  4DEZ A;  4OD0 A;  3MGV A;  1JI7 A;  4LZG A;  4F5O A;  5CWR A;  3AM9 A;  5KL1 B;  1X9M A;  4PL1 A;  1EXN A;  4F2R A;  4EEY A;  1NK6 A;  1SL0 A;  5KFU A;  8ICJ A;  1M6Y A;  5J2D A;  2O6K A;  5G5G A;  5KFF A;  3ZDD A;  1A0P A;  3AQE A;  2W3R A;  3K1Z A;  3A0H U;  4GC7 A;  4C7Y A;  3KHH A;  1RDF A;  3VC8 A;  3H8S A;  2KOB A;  1ZQI A;  2AGQ A;  1JAL A;  2P6U A;  5AI6 A;  1T3Q A;  5AIA A;  5J2H A;  2XY7 A;  5DBB A;  2OWO A;  4F3O A;  2ZIW A;  4EEN A;  1KRP A;  1RQN A;  1FIQ A;  1SZH A;  4UB5 A;  3H8W A;  4QZC A;  5DKW A;  1ZQT A;  5DG7 A;  3THV A;  3ZD9 A;  1LV5 A; 
#chains in the Genus database with same CATH homology
 2K60 A;  2L5Y A;  3KKA A;  4PZO A;  1KW4 A;  5J8Y A;  2E8N A;  1COK A;  2F3N A;  1OXJ A;  2KIV A;  1WWU A;  1LKY B;  1B0X A;  2KSO B;  1SV0 A;  4RQM A;  2F8K A;  3SEI A;  2D3D A;  3H8M A;  2KG5 A;  4NL9 A;  3TAC B;  2QB0 A;  1Z1V A;  2LPE A;  1X66 A;  5JU5 A;  2E8P A;  5F3X B;  2ES6 A;  1X9X A;  4NJ8 A;  3IDW A;  1SXE A;  3BS5 A;  1UCV A;  1PK3 A;  2Y9T A;  5J8Y C;  5JRT A;  3BS5 B;  2KMD A;  3K1R B;  3KKA C;  2KSO A;  3TAD A;  2QAR A;  1UQV A;  1V38 A;  5KNI A;  2YTU A;  1JI7 A;  2FE9 A;  2LMR A;  1SXD A;  1SGG A;  2QAR B;  2EAO A;  4NL9 C;  1DXS A;  4RQN A;  1LKY A;  2K4P A;  4IS7 A;  2D8C A;  4PZN A;  2E8M A;  2QB1 A;  1PK1 B;  2E8O A;  1OW5 A;  2GLE A;  3HIL A;  2QB0 B;  2EAP A;  3BS7 A;  2F44 A;  2DKZ A;  3TAD C;  1SV4 A;  1V85 A;  2DKX A;  3BQ7 A;  5L1M A;  1SV0 C;  2KE7 A;  3SEN A;  2Y9U A;  1F0M A;  4MHV A;  2DL0 A;  1B4F A;  2EAM A;  2JV3 A;  5JTI A;  1PK1 A;  2B6G A;  2EAN A;  2ESE A;  2QKQ A;  1RG6 A;  1WWV A;  1X40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...