2E8MA

Solution structure of the c-terminal sam-domain of epidermal growth receptor pathway substrate 8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Epidermal growth factor receptor kinase substrate 8
publication title Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8
rcsb
source organism Homo sapiens
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18016 SAM_3 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8mA01
2K60A 5JTIA 2EAOA 5JU5A 4RQMA 2FE9A 2DL0A 1KW4A 1X40A 1OW5A 2JV3A 2KSOB 2EAPA 2B6GA 3BS5B 4NL9A 5F3XB 2QARB 3BQ7A 1B0XA 1SV0A 1WWVA 2LMRA 1V85A 3TACB 2KSOA 2EANA 1WWUA 2KE7A 3BS5A 2Y9UA 2YTUA 2F44A 2ESEA 1PK1A 2QARA 2Y9TA 5KNIA 4IS7A 2F8KA 2E8MA 1UQVA 1X9XA 1PK1B 1PK3A 3KKAC 5J8YC 2D3DA 1SV4A 2KIVA 3TADC 5J8YA 1DXSA 2KG5A 1COKA 2E8OA 3SEIA 3BS7A 3HILA 1JI7A 3K1RB 1UCVA 2ES6A 5L1MA 2GLEA 1SXDA 2EAMA 1LKYA 1SGGA 2QB0B 2E8PA 2KMDA 2L5YA 5JRTA 4RQNA 1OXJA 4MHVA 1V38A 2K4PA 1LKYB 1B4FA 1X66A 3KKAA 3IDWA 2DKXA 2LPEA 1Z1VA 2QB1A 3SENA 2E8NA 4NJ8A 2F3NA 2QB0A 1RG6A 3TADA 4NL9C 2DKZA 1SV0C 1SXEA 4PZOA 2QKQA 4PZNA 3H8MA 2D8CA 1F0MA
chains in the Genus database with same CATH superfamily
3NUQA 3N7SC 5ALKA 2E3TA 3NVZA 2ZIWA 4M9JA 5KL1B 2WF5A 5KG5A 4Y2TA 3QUQA 4IRCA 4KLUA 5CR0A 5ALFA 4U7CA 4PGQA 2J6SA 3SAGA 4PHPA 3JPTA 2AQ0A 5DQGA 1T8EA 4BXOB 4CRXA 5J0TA 4QIWF 4NWIA 1KFSA 3M9NB 2HBJA 3ONNA 1XSLA 2P66A 2R8JA 1NK4A 2Y1JA 5KFYA 2FLPA 4CGZA 4ED0A 1BPBA 4J9SA 2H3FA 5J0WA 4F91B 3GV8B 4C0ZA 3Q8LA 3UMGA 1KSPA 2H3QA 3N4MB 5ALSA 1N5WA 2KJ8A 4B6JA 3CW2C 3HJEA 4FZLA 1T3QA 3UM9A 5EE9A 5GTIU 1ZD4A 5AKHA 2RLTA 8ICCA 5J2DA 3B0XA 2P6UA 1U45A 4MF8A 4F4ZA 2JHDA 4JB3A 4O5CA 2YB4A 1S0VA 4F2SA 2EZZA 3EPIA 9ICMA 2M9NA 4NXZA 3AU6A 2HOFA 3OGUA 3SV3A 1ZD2P 4I2IA 4ECYA 2ZUDA 2G08A 4YR2A 2NRWA 1M6YA 4YD1A 1TV9A 3MC1A 8ICIA 2IOFA 4M04A 8ICHA 4DF8A 3T5JA 3KZXA 2PFOA 9ICQA 3GIKA 4J9QA 8ICGA 2ZIUA 1ECWA 4EZ6A 4M6WB 4TUQA 2DKXA 2QB1A 2F3NA 2VJ5A 1NKBA 4I2AA 4YMMA 2G07A 3NGDA 1D8BA 5T14A 4PL2A 4YG2A 4RUAA 3THVA 1S10A 4P0PB 4CNQA 5KT3A 2ZIXA 2AH5A 4F4WA 1L3TA 5CB1A 3TFSA 1MSWD 1ZQEA 2F8LA 4C8MA 1CRXA 4RQ1A 2XCAA 2B6GA 4Y2YA 4KLSA 5DQHA 2W8KA 3RAXA 3QZ8A 1P7DA 8ICZA 3NS1A 5KT2A 2PMZC 2H5XA 3AM9A 2BDPA 1Z4OA 3MFHA 5AK6A 5K4LA 2KK0A 4RNMA 7ICLA 1L6NA 3DV9A 3QUBA 1XWLA 1B22A 3JPPA 3HWTA 3SR6A 1HUOA 2OXOA 3RH4A 4MF2A 5ALPA 2W9CB 1Q3VA 2FMSA 1A77A 3CNHA 3LYSA 4GFJA 4DS5A 3KKAC 2RHFA 4I2EA 4IQUA 3WK5A 2EZYA 4UAUA 7ICUA 5J8YA 8ICBA 4QZFA 4BWMA 2KG5A 4CF5A 2BDUA 2R18A 5KFCA 1QTMA 5C0YA 1X2IA 3BS7A 3K1RB 2GWSA 2K4IA 1NK7A 1UT5A 1YT3A 5AKYA 4UB1A 4UB6U 5ALZA 4FBUA 2D6FC 1V9PA 3C1YA 4IRDA 3WK8A 1K1SA 1DRGA 4QWAA 2ZJAA 5KFDA 2B21A 5AKZA 4ED2A 3I76A 3WK4A 2CXYA 1PZNA 2I9GA 4KLTA 4USAA 4UATA 3PW4A 5DG8A 1ZQBA 1RXWA 4YD2A 7ICTA 4B9NA 4JK1A 3SI8A 2LKYA 4YQWA 2WAQF 3QU5A 3PV8A 4ICAA 1SZPA 5ALVA 4RQ7A 2AGQA 2PXIA 3MR6A 2JV3A 5KG2A 4DL5A 4J9PA 3N7PD 3M9OB 4DSJA 1S0MA 5AKJA 9ICLA 5J2JA 1L3VA 3ZDEA 4C4RA 1SB3C 3KHLA 3HPOA 3HX0A 2YMPA 2FJ6A 4EEYA 2HHTA 3RTVA 3H8WA 2KE7A 1Z00A 5F9LA 2OCEA 1NK5A 2YMMA 1QLNA 2HVIA 3K1ZA 2KVSA 3BQ1A 2KHQA 1MQ2A 3CYMA 1X9XA 4JV0A 1ZRNA 1PVRA 3SMVA 4UAWA 5AK5A 4QZ8A 1ZQIA 2PI5A 4UBCA 4FFDA 4PHDA 1SL1A 1JI7A 5KFIA 5J2CA 4DOCA 5AK4A 4O5KA 1IIPA 1SGGA 3RJIA 3C5GA 5CWRA 4NLNA 4E0DA 4WJ3B 1NJZA 4QWCA 2V4RA 3EZ5A 5AM3A 2XY5A 2W43A 4PHEA 2LPEA 1N62A 7ICSA 4AYBF 3E0FA 2ISOA 4F92B 3SAFA 4YMNA 5J2GA 4CF4A 7ICNA 4PZOA 4P4OA 3H40A 4UQGA 8ICEA 2A19A 5EOZA 4KLJA 9ICKA 2HHQA 1ZD3A 1KW4A 8ICMA 3BQ2A 2BCUA 2WF9A 2ZIXB 2KOBA 4F2RA 1U47A 1RYRA 4HYKA 1S9FA 2I6XA 3MGHA 1LV5A 4J03A 2MSNA 2JXJA 4NLGA 3GZFA 2KP7A 1T94A 3K4GA 1COOA 4B9TA 2OH2A 1NKEA 5J2IA 1A0PA 5HHHA 3B0YA 4QZDA 4G9BA 8ICRA 4DL7A 8ICJA 4C4TA 2C28A 2F8KA 3T5KA 5AKLA 2WB1C 3ISDA 3EW9A 1KRPA 4Y2VA 1DK3A 4JUZA 2DFLA 3L5KA 1UT8A 4R65A 4O3OA 3A0BU 5KFAA 4C8NA 4TURA 4PGXA 3JPNA 4RQ3A 5ALIA 1VDVA 1WCNA 2ES6A 5KFTA 3WKCA 1SXDA 4NLKA 5HR6A 1CI4A 2N1RA 4DL4A 2HBKA 5EWFA 1LKYA 1ZQHA 1TE2A 2FPKA 3TANA 3FM9A 2KMDA 4C8KA 5KFEA 4GXKA 2GOLA 1ZRMA 4UASA 4KITB 4UAVA 2IBKA 2EQYA 4NJ8A 4C80A 3ETLA 1ZQRA 3ZD9A 1D9DA 1RYUA 3IN5A 3QEBZ 4R63A 4QIWC 5DGAA 1KFTA 2PI4A 2WHEA 4Y2UA 2ASJA 4M6WA 3T79A 1JROA 5CA7A 3C5FA 2RDJA 2JZBB 1ZXIA 5L1IA 4F5PA 3TQ1A 4DSLA 4KLIA 2O6KA 3ICXA 1HUZA 1L8LA 5KT6A 2AHOB 3BQ0A 1QSYA 1O08A 4I2JA 1IXRA 3IP4B 4QZEA 3D2SA 7ICVA 4O3NA 3MDCA 4EX7A 3AQFA 1WWUA 3GIJA 5AKGA 1LB2B 3ZDCA 1YZ6A 2BCSA 5KNIA 1Z00B 5KFSA 1S8OA 4TQSA 2HBLA 1NK8A 5GTHU 4QWDA 9ICTA 2E8MA 1UQVA 2ZUBA 2UVVA 1ZQKA 2HDOA 2NO5A 3AU2A 3BZCA 2ZJ5A 3UQ0A 4YFKA 5AM5A 4KX5A 4F71A 5AI5A 1MN8A 2KIWA 4BX9C 3SAHA 4DLGA 4C8LA 1RDFA 3OHAA 4YXJA 4IQTA 3I28A 1N61A 5KG0A 4DO9A 1K5OA 1TAQA 5EWGA 4YN4A 2HHUA 3HRDD 4TUPA 2FLLA 2W04A 3ISCA 2MUTA 3LWMA 1B4FA 4IR9A 4NV0A 4CF3A 4JMUA 4LZDA 3SV4A 4O9MA 4BGDA 1NZPA 2HI0A 5AKKA 2BPFA 2KZMA 4GC7A 4F4XA 3HKZF 5DB9A 1JUDA 2QKQA 3C2LA 1BGXT 3RJFA 5DBAA 5KG1A 5E79U 2W9BB 5J0RA 5F9NA 4RNOA 9ICFA 4OJ5A 1ZD5A 1PUZA 1XSPA 5J0XA 2W11A 3EUB2 2QARB 5ALWA 5KT5A 3UMBA 1WWVA 5KFPA 4B9LA 8ICOA 4FS1A 4IR1A 5TZVA 4ED7A 3BDPA 1S77D 1ZQFA 2JEGA 3LK9A 2R8GA 3TAPA 1KBUA 7ICIA 4ECQA 3G6XA 5D49A 5DBCA 3FDSA 4KLGA 1ZQTA 3C1ZA 9ICBA 1ZQNA 5KFJA 4IC9A 1DXSA 5KT4A 2W55A 1U49A 4K4GA 2W8LA 4PGYA 2E8OA 4OJPA 3SEIA 5ALEA 4I2DA 2R8KA 3AEVA 5CJ7A 3H0LB 5DBBA 2WAQC 4ELTA 4M9HA 3WK6A 4R8UB 2KJ9A 4QZIA 2VA8A 5JRTA 3KTQA 4P0QB 1RQNA 2AU0A 2FPMA 5TISU 3Q8SB 1LKYB 2CPRA 4DL6A 4MEXA 1ZQZA 3IDWA 5KFMA 5IIIA 4A8EA 4FZMA 2AQ4A 4XRHA 1BPXA 1SKWA 3KHGA 2XIDA 3GU3A 3MGVA 1AROP 3KD3A 4OCZA 3QU2A 2ZG6A 4PHAA 2W03A 4IRKA 2B0CA 1JX4A 4MFFA 3MFIA 1NK6A 1F0MA 4OJ6A 1T7PA 3PW5A 3Q8QB 2IOHA 5AK3A 3B9JA 3T5HA 3L3FX 1ZQJA 3CRXA 3GIMA 4ED6A 9ICCA 4F5QA 2JGAA 5ALRA 3RRGA 2NRZA 3BQTA 3QU9A 1SV0A 1DGJA 4Y2PA 5DDMA 1X9SA 3OHBA 3RRHA 2FMPA 2OEHA 2P35A 5DGBA 9ICEA 4C4SA 4NM2A 8ICFA 3KZIU 5B5EU 3PR5B 4NM1A 5HMLA 3KFUF 5ALTA 1YZ7A 2D3DA 3SD7A 3NRWA 4AYBC 1ZJMA 4Q45A 3PMLA 4EX6A 5CRXA 4UB8U 2ASDA 7ICMA 2ZXHA 2Q0ZX 1VJ5A 2XCPA 1RXVA 1KDHA 3WU2U 2H3IA 5AHXA 1TVAA 2QB0B 4Q8FA 4DOBA 5ALQA 1Z19A 2WF7A 1XC9A 4Z6EA 2XGQA 5KTQA 3IHQB 5AM1A 4J9NA 4DOAA 2F77X 4DFJA 1Z1VA 3TFRA 3PZPA 4DWIA 2MUTB 3HP6A 3HW8A 2P6RA 3TADA 2NRTA 4EBCA 9ICXA 1A6SA 1MC8A 4X5VA 3RB4A 2J6TA 2AJQA 3WKEA 1B43A 5AKEA 3WK7A 2LHTA 3VC8A 7ICPA 4F4YA 3H0MB 1JALA 2GO7A 5AKIA 2W7PA 5L9XA 5IIJA 1F5SA 2RQ5A 2EZXA 3NASA 2EAPA 4ECTA 2ZTEA 5J0PA 5CP2A 2VA3A 1L3UA 1DOQA 1D8YA 2ISPA 1XO1A 4UB4A 3TACB 3QU7A 2DF4B 2JZBA 4ZH4A 3WKBA 3M8RA 2K4HA 2Y9UA 3T5LA 2DUYA 4C7ZA 8ICTA 4FO6A 4DQIA 4YVZA 3H4BA 2JEFA 5KFVA 5C5JA 8ICYA 1N48A 3IV6A 1RZTA 1S97A 2KFZA 9ICVA 4I28A 1X6JA 2G09A 2YN4A 4IL6U 1ZQLA 1COKA 2F1IA 5KFNA 4UBBA 1ZQPA 1J97A 1RM6C 1ZQWA 5EE3A 5AKXA 3KHRA 4Y2SA 1ZYQA 2IOFK 3PX0A 2L5YA 3QU4A 1VLBA 1BNPA 1V38A 3D6JA 3PX6A 1X9WA 3FAHA 5KG4A 5J0YA 2ODGA 4UAZA 2ZIVA 8ICSA 1UHUA 1N5XA 3LDAA 4F3OA 7ICOA 4UW9A 5KL8B 2KVCA 2J6UA 2W9MA 9ICHA 4Y2QA 1KLNA 4DSIA 3JPOA 2MAXA 3A0HU 1SV0C 3U26A 4DF4A 1BNOA 2YX8A 4Z6DA 3RJKA 2IHNA 3QUTA 2NV3A 3RJEA 2KZ3A 5D46A 2FE9A 4KN7A 1BPDA 3PW7A 3I1YA 2OYYA 3ZDAA 1X40A 5KFXA 4MFCA 2EDUA 4I2FA 3H7IA 4LZGA 2ZJ8A 3UPQA 2I1QA 1TK8A 3RJHA 3RBEA 1RPLA 3V7JA 5HP4A 1K1QA 1FO4A 3PX4A 1A76A 2YB1A 2WF8A 2W9BA 4YXMA 3MR2A 1UPHA 2EANA 4RQ0A 4O0IA 1ZQSA 1QSLA 1N60A 5CHGA 2W54A 5KFZA 4J9RA 1QH9A 4RPZA 1NJXA 3AL0B 9ICPA 4G3IA 4UARA 1ZQVA 3WKDA 2QARA 1TAMA 3WK9A 1JRPA 1IG6A 1PK3A 5J8YC 5DLFA 5EE0A 1XU4A 4UB2A 2KNJA 3UXOA 3TADC 3OJUA 3SZ2A 3RAQA 7ICFA 3JPSA 1KL9A 4FS2A 4EYIB 4F72A 3HKZC 4Q44A 2F76X 3NRZA 2Y1IA 2XVTA 4ECUA 1Q8KA 2RRDA 4DEZA 1UA1A 2PFNA 1S0OA 2K4EA 4JV2A 5IIKA 4AP9A 1X42A 2ZXIA 3NTUA 7ICJA 4R8UA 3FC4A 3PY8A 4P0QA 7ICHA 1L8OA 2ASLA 3QUCA 4RPYA 2ATLA 1XSNA 2EAOA 2DPIA 3F5EA 4ELVA 4F5RA 3PMNA 3OSNA 1Q3UA 3M6KA 4RQ6A 3UXPA 2AXTU 4F5OA 2XI9A 4TQRA 5KFGA 1URJA 2HHSA 4K4IA 5F3XB 2HW3A 2NRXA 5ALYA 1V85A 1V97A 2HBMA 9ICNA 1ZQDA 4QW9A 3EWAA 1OUQA 5ALGA 1DGSA 4DQRA 8ICPA 5AM0A 4CE6A 1BPEA 4M2YA 2BCRA 9ICOA 1C20A 3GIIA 3MABA 3PSPA 4QZHA 2Y0SF 1XO0A 5EWEA 1QQ7A 2A1JB 4HAIA 3TKAA 5G5GA 4US8A 3OSPA 5KG3A 5L1LA 9ICRA 2GLEA 3L4PA 4O3QA 2W9AA 2KN7A 5KFLA 4PJ0U 2XY6A 2E8PA 3ZI4A 4O5EA 3Q8RB 1TK0A 3C23A 4I2BA 2K4PA 2M0NA 4Y2JA 1X66A 4YMOA 4F8RA 2V9WA 3F5AA 5HHIA 7ICEA 2XC9A 4RT2A 1QQ6A 2AGOA 5JUMA 5ALOA 2QB0A 1RG6A 4EYHB 2K8AA 2ZIVB 4Q43A 3N97B 3BJYA 4DQSA 1Z1BA 4M9NA 3EYZA 2W3RA 2XICA 1O03A 5J2FA 2WFAA 4NY8A 4CDGA 2DWQA 5JU5A 2ZTCA 4Y2XA 3RB0A 5DG7A 4I2CA 2KSOB 5AI6A 1U48A 4UB5A 5HR7A 1D9FA 1L7NA 5KFBA 4R66A 2JH1A 1J2NA 4Z6FA 5KFFA 5DDYA 1ZQXA 1IM4A 3FYHA 4ED8A 3TARA 3AQEA 4F50A 3QNMA 3RBDA 9ICIA 5J29A 4EBDA 1S5LU 5DQIA 4PH5A 2QLTA 2BZFA 5DB8A 1FFVA 4JV1A 3PR4A 2KTQA 9ICGA 3G6YA 4DFMA 4OJOA 2XO7A 4QNLA 2C2EA 2JEIA 1N56A 4JWNA 2ALZA 1ZQOA 1QCKA 2UVWA 3PO4A 3E2EA 2BGWA 1BPYA 3RR7A 3M9MB 5ALJA 4OO1J 3GILA 1PVQA 5L1MA 3UMCA 3CP8A 3V6JA 9ICUA 3KOOA 4KMUA 1TFRA 5EE1A 4RQ4A 1OXJA 4MHVA 1LVHA 5ALXA 5ALDA 1ZJNA 4B9UA 1ZQUA 4QZAA 4RNNA 1FEZA 1BVSA 1Y88A 3NVYA 4YR0A 3C21A 1KKXA 3S6JA 7ICQA 5CEHA 3RF9A 2WF6A 2HSZA 4ECVA 3KHHA 2F1HA 4M9GA 2RDIA 4QZGA 4OD0A 1KQQA 5J2AA 3V7KA 4KLLA 4ECRA 2IHMA 4TUSA 3BS5B 4QZ9A 1SL2A 2BKEA 3RB6A 2HHVA 1L7OA 4CCHA 5HMMA 3GFKB 1ZETA 2KKPA 2F2AB 1UA0A 2CRXA 3SQIA 2LYAA 1QQ5A 3DEEA 4GXJA 5DB7A 2BR0A 2DGZA 4B9VA 3ETRA 2ZUCA 1WG8A 5IINA 2BQUA 1ZQCA 3ORYA 2YMQA 3IG5A 4GIBA 2KHVA 9ICJA 2E5SA 2MA1A 3M8SA 1IV8A 4YCXA 2R8HA 3C29A 3QZ7A 1KEJA 4O3PA 4RZRA 3F2DA 3H8JA 5KFQA 2HHWA 5J0SA 3HILA 4DL2A 4J9KA 3GV5B 4Q8EA 3ZD8A 4DLEA 2G5HB 2K8BB 2VIXA 4RQ2A 8ICAA 4M0AA 1TKDA 2NO4A 2XY7A 2E1EA 2LM4A 2KFNA 3R9KA 5KAIU 4LJXA 4KLFA 3C2KA 4I2GA 3SENA 1NK0A 5J2HA 1Q46A 2HOQA 1SWVA 2KICA 2G06A 3TAQA 1BPZA 1X6IA 4NLBA 3G6VA 3QX7A 4DL3A 2K60A 2E1FA 3IM1A 1U9LA 4ELUA 4RQMA 1XS9D 4ED3A 4DFKA 3OTQA 4DQQA 3GQCA 3OPXA 1RQLA 1ED1A 4UAYA 3RFAA 3QEAZ 1H38A 5J0QA 5J2EA 3NVVA 1L5UA 2EH9A 3F2BA 2IMWP 2HCFA 5AI0A 5IIOA 4DSEA 2NRVA 1B0XA 2LMRA 5G5HA 2XGPA 1ZQQA 2HOIA 4KLMA 5ALUA 9ICAA 4XUSA 2UVRA 2C22A 3HT3A 4BWJA 2F44A 1SL0A 1XNSA 4BUGA 1QSSA 1T3NA 4GXIA 3J81j 4EENA 2BCQA 4IS7A 4RUCA 2VA2A 3E58A 4F5NA 4KX3A 4KLHA 8ICWA 3KBBA 3MBYA 5L1KA 4O3RA 5KFOA 2BCVA 1Z3EB 2YMLA 2Z7JA 5BOMA 3IRUA 3Q8KA 2KZZA 9ICWA 3LWLA 1MA7A 5A0LA 4O3SA 2JRZA 4KN4A 4XQ8A 1UCVA 2PKEA 1GO3F 4P2HA 3LVWA 3ALRA 3RH5A 2R8IA 4KLOA 2A1JA 4I27A 2W7OA 5J2KA 4ACOA 2FDRA 3D2QA 1L7MA 2VKQA 4EBEA 3V6KA 4MEYA 2UVUA 2KKVA 1JIHA 2ZIWB 3T3FA 3PNCA 5AIAA 4EELA 2DKZA 2CN1A 2BPGA 4R64A 2H3VA 3PSIA 3VCBA 5KG6A 4I29A 2BPCA 1WUDA 1OW5A 2LM1A 1NK9A 2MRLA 3F53A 3H0RB 2YY6A 8ICXA 5D4BA 3LVVA 4RQ8A 2Y0SC 1NI3A 2W3SA 3PO5A 4DSFA 8ICQA 2C2RA 4RT3A 1X9MA 2V4QA 2KSOA 4QWEA 1MQ3A 2C2DA 2YTUA 4P4PA 3NVWA 4ECXA 1SWWA 1SKRA 1PK1A 2NYVA 2Y9TA 3EPGA 2PMZF 3UXNA 5AM4A 5ALMA 1C7YA 4DFDA 2BQRA 2HHXA 2YQEA 5AI4A 3AN1A 4OJLA 5ALLA 7ICKA 3M1YA 3PSTA 2ZIUB 2KJ5A 4I2HA 3D2NA 1ZQGA 3V72A 2EAMA 2JMGA 4ED1A 2FMQA 1NJYA 4RPXA 3RH6A 3C28A 4C8OA 2MU2A 4QZCA 5HNKA 1DK2A 3Q8PB 1HEKA 5KFUA 7ICRA 4FZNA 4J9MA 3N7RC 3ED5A 1NNLA 1S0NA 4Y2RA 5ALHA 1KTQA 4PZNA 1WYGA 1CEZA 5H2FU 1N63A 5AM2A 5JTIA 8ICLA 1ZOLA 4PL1A 2DL0A 1JXLA 1TAUA 4BXOA 2G0AA 2KD1A 1JXEA 3QE9Y 4FE3A 3AMZA 4F4KA 3MR5A 3ZDDA 5KT7A 4XA5A 3RR8A 1ZQYA 3IG8A 4BJQA 1FIQA 1Z4NA 2LBOA 4F93B 3RB3A 4NL9A 4ECWA 4MFAA 4GLXA 2DBYA 2JR5A 2JEJA 1NZBA 3MGIA 1ZQMA 3BS5A 2H3ZA 2ESEA 4RQ5A 1U4BA 1HIWA 1KN5A 3QXGA 5B66U 2ZTDA 3N28A 2VANA 4B9SA 3H8SA 5AIBA 5BPCA 3OJSA 5KFHA 4EEKA 4M9LA 3MR3A 1CUKA 4DSKA 5KAFU 5J0UA 1SV4A 3AUOA 1ZQ1C 1NOMA 3PSFA 5DLGA 1SKSA 4K4HA 4DQPA 2IA6A 3RJJA 1ZQAA 4FBTA 2KV2A 3BZKA 4KLDA 4IQVA 3M6ZA 2K8CB 4RQNA 4GC6A 3PW2A 5ALNA 4QWBA 3GV7B 4DFPA 3K75D 2PFPA 2DPJA 2OWOA 5BOLA 1SZHA 1RYSA 5IILA 4BDPA 1JMSA 3PVXA 3JPRA 2LI6A 5L1JA 4P0PA 1NKCA 3V7LA 3WKAA 1JN3A 1J2MA 3H8MA 4KTQA 5AI9A 2D8CA 1NJWA 3SYZA 2FLNA 5FP0A 4Z6CA 3O0FA 4NLCA 2A3VA 1EXNA 2F1JA 2AGPA 5KFKA 4DCCA 2HVHA 3RJGA 3ISBA 4EZ9A 2K89A 2LYBA 4IQWA 2JH7A 2KEYA 2PFQA 3PW0A 3BQ7A 2WTFA 1S76D 3JPQA 1TK5A 8ICNA 4KLEA 8ICVA 4ZOHC 5KFRA 4C7YA 2BQ3A 4RU9A 2OM6A 4U6PA 1L3SA 2FI1A 4KMOB 1F44A 3ZDBA 2W9CA 2VJ4A 3MDAA 2LYHA 1PVPA 1D8LA 4J9LA 4QZBA 4P4MA 1SIJA 3H4DA 5KG7A 5IIMA 3V6HA 2BHNA 4UB3A 1PK1B 3Q8MA 2FPLA 2KIVA 1HJPA 4YR3A 8ICUA 9ICSA 4M47A 2G5IB 2HMXA 3C2MA 4B9MA 5AI8A 2GH1A 8ICKA 4DS4A 4KLQA 1N2XA 3F2CA 3UQ2A 3TI0A 4QW8A 1FFUA 2WB1F 3GDXA 4ECZA 1WCLA 7ICGA 2RP5A 4US9A 3M7DA 3QYPA 5J0OA 2DQNB 3KKAA 5KFWA 5DG9A 4QJFB 1AQ6A 5DB6A 2E8NA 2Q4TA 1L7PA 4NL9C 4YP3A 4PPXA 1KFDA 4ECSA 1SXEA 5DKWA 2I5HA 4JWMA 2A1AA 1T4GA 2OHFA 5AICA 4NLZA 5J2BA 4J9OA 4O3MA 3DDHA 4LVSA
chains in the Genus database with same CATH topology
2K60A 5JTIA 2EAOA 5JU5A 4RQMA 2FE9A 2DL0A 1KW4A 1X40A 1OW5A 2JV3A 2KSOB 2EAPA 2B6GA 3BS5B 4NL9A 5F3XB 2QARB 3BQ7A 1B0XA 1SV0A 1WWVA 2LMRA 1V85A 3TACB 2KSOA 2EANA 1WWUA 2KE7A 3BS5A 2Y9UA 2YTUA 2F44A 2ESEA 1PK1A 2QARA 2Y9TA 5KNIA 4IS7A 2F8KA 2E8MA 1UQVA 1X9XA 1PK1B 1PK3A 3KKAC 5J8YC 2D3DA 1SV4A 2KIVA 3TADC 5J8YA 1DXSA 2KG5A 1COKA 2E8OA 3SEIA 3BS7A 3HILA 1JI7A 3K1RB 1UCVA 2ES6A 5L1MA 2GLEA 1SXDA 2EAMA 1LKYA 1SGGA 2QB0B 2E8PA 2KMDA 2L5YA 5JRTA 4RQNA 1OXJA 4MHVA 1V38A 2K4PA 1LKYB 1B4FA 1X66A 3KKAA 3IDWA 2DKXA 2LPEA 1Z1VA 2QB1A 3SENA 2E8NA 4NJ8A 2F3NA 2QB0A 1RG6A 3TADA 4NL9C 2DKZA 1SV0C 1SXEA 4PZOA 2QKQA 4PZNA 3H8MA 2D8CA 1F0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K60 A;  5JTI A;  2EAO A;  5JU5 A;  4RQM A;  2FE9 A;  2DL0 A;  1KW4 A;  1X40 A;  1OW5 A;  2JV3 A;  2KSO B;  2EAP A;  2B6G A;  3BS5 B;  4NL9 A;  5F3X B;  2QAR B;  3BQ7 A;  1B0X A;  1SV0 A;  1WWV A;  2LMR A;  1V85 A;  3TAC B;  2KSO A;  2EAN A;  1WWU A;  2KE7 A;  3BS5 A;  2Y9U A;  2YTU A;  2F44 A;  2ESE A;  1PK1 A;  2QAR A;  2Y9T A;  5KNI A;  4IS7 A;  2F8K A;  2E8M A;  1UQV A;  1X9X A;  1PK1 B;  1PK3 A;  3KKA C;  5J8Y C;  2D3D A;  1SV4 A;  2KIV A;  3TAD C;  5J8Y A;  1DXS A;  2KG5 A;  1COK A;  2E8O A;  3SEI A;  3BS7 A;  3HIL A;  1JI7 A;  3K1R B;  1UCV A;  2ES6 A;  5L1M A;  2GLE A;  1SXD A;  2EAM A;  1LKY A;  1SGG A;  2QB0 B;  2E8P A;  2KMD A;  2L5Y A;  5JRT A;  4RQN A;  1OXJ A;  4MHV A;  1V38 A;  2K4P A;  1LKY B;  1B4F A;  1X66 A;  3KKA A;  3IDW A;  2DKX A;  2LPE A;  1Z1V A;  2QB1 A;  3SEN A;  2E8N A;  4NJ8 A;  2F3N A;  2QB0 A;  1RG6 A;  3TAD A;  4NL9 C;  2DKZ A;  1SV0 C;  1SXE A;  4PZO A;  2QKQ A;  4PZN A;  3H8M A;  2D8C A;  1F0M A; 
#chains in the Genus database with same CATH topology
 3NUQ A;  3N7S C;  5ALK A;  2E3T A;  3NVZ A;  2ZIW A;  4M9J A;  5KL1 B;  2WF5 A;  5KG5 A;  4Y2T A;  3QUQ A;  4IRC A;  4KLU A;  5CR0 A;  5ALF A;  4U7C A;  4PGQ A;  2J6S A;  3SAG A;  4PHP A;  3JPT A;  2AQ0 A;  5DQG A;  1T8E A;  4BXO B;  4CRX A;  5J0T A;  4QIW F;  4NWI A;  1KFS A;  3M9N B;  2HBJ A;  3ONN A;  1XSL A;  2P66 A;  2R8J A;  1NK4 A;  2Y1J A;  5KFY A;  2FLP A;  4CGZ A;  4ED0 A;  1BPB A;  4J9S A;  2H3F A;  5J0W A;  4F91 B;  3GV8 B;  4C0Z A;  3Q8L A;  3UMG A;  1KSP A;  2H3Q A;  3N4M B;  5ALS A;  1N5W A;  2KJ8 A;  4B6J A;  3CW2 C;  3HJE A;  4FZL A;  1T3Q A;  3UM9 A;  5EE9 A;  5GTI U;  1ZD4 A;  5AKH A;  2RLT A;  8ICC A;  5J2D A;  3B0X A;  2P6U A;  1U45 A;  4MF8 A;  4F4Z A;  2JHD A;  4JB3 A;  4O5C A;  2YB4 A;  1S0V A;  4F2S A;  2EZZ A;  3EPI A;  9ICM A;  2M9N A;  4NXZ A;  3AU6 A;  2HOF A;  3OGU A;  3SV3 A;  1ZD2 P;  4I2I A;  4ECY A;  2ZUD A;  2G08 A;  4YR2 A;  2NRW A;  1M6Y A;  4YD1 A;  1TV9 A;  3MC1 A;  8ICI A;  2IOF A;  4M04 A;  8ICH A;  4DF8 A;  3T5J A;  3KZX A;  2PFO A;  9ICQ A;  3GIK A;  4J9Q A;  8ICG A;  2ZIU A;  1ECW A;  4EZ6 A;  4M6W B;  4TUQ A;  2DKX A;  2QB1 A;  2F3N A;  2VJ5 A;  1NKB A;  4I2A A;  4YMM A;  2G07 A;  3NGD A;  1D8B A;  5T14 A;  4PL2 A;  4YG2 A;  4RUA A;  3THV A;  1S10 A;  4P0P B;  4CNQ A;  5KT3 A;  2ZIX A;  2AH5 A;  4F4W A;  1L3T A;  5CB1 A;  3TFS A;  1MSW D;  1ZQE A;  2F8L A;  4C8M A;  1CRX A;  4RQ1 A;  2XCA A;  2B6G A;  4Y2Y A;  4KLS A;  5DQH A;  2W8K A;  3RAX A;  3QZ8 A;  1P7D A;  8ICZ A;  3NS1 A;  5KT2 A;  2PMZ C;  2H5X A;  3AM9 A;  2BDP A;  1Z4O A;  3MFH A;  5AK6 A;  5K4L A;  2KK0 A;  4RNM A;  7ICL A;  1L6N A;  3DV9 A;  3QUB A;  1XWL A;  1B22 A;  3JPP A;  3HWT A;  3SR6 A;  1HUO A;  2OXO A;  3RH4 A;  4MF2 A;  5ALP A;  2W9C B;  1Q3V A;  2FMS A;  1A77 A;  3CNH A;  3LYS A;  4GFJ A;  4DS5 A;  3KKA C;  2RHF A;  4I2E A;  4IQU A;  3WK5 A;  2EZY A;  4UAU A;  7ICU A;  5J8Y A;  8ICB A;  4QZF A;  4BWM A;  2KG5 A;  4CF5 A;  2BDU A;  2R18 A;  5KFC A;  1QTM A;  5C0Y A;  1X2I A;  3BS7 A;  3K1R B;  2GWS A;  2K4I A;  1NK7 A;  1UT5 A;  1YT3 A;  5AKY A;  4UB1 A;  4UB6 U;  5ALZ A;  4FBU A;  2D6F C;  1V9P A;  3C1Y A;  4IRD A;  3WK8 A;  1K1S A;  1DRG A;  4QWA A;  2ZJA A;  5KFD A;  2B21 A;  5AKZ A;  4ED2 A;  3I76 A;  3WK4 A;  2CXY A;  1PZN A;  2I9G A;  4KLT A;  4USA A;  4UAT A;  3PW4 A;  5DG8 A;  1ZQB A;  1RXW A;  4YD2 A;  7ICT A;  4B9N A;  4JK1 A;  3SI8 A;  2LKY A;  4YQW A;  2WAQ F;  3QU5 A;  3PV8 A;  4ICA A;  1SZP A;  5ALV A;  4RQ7 A;  2AGQ A;  2PXI A;  3MR6 A;  2JV3 A;  5KG2 A;  4DL5 A;  4J9P A;  3N7P D;  3M9O B;  4DSJ A;  1S0M A;  5AKJ A;  9ICL A;  5J2J A;  1L3V A;  3ZDE A;  4C4R A;  1SB3 C;  3KHL A;  3HPO A;  3HX0 A;  2YMP A;  2FJ6 A;  4EEY A;  2HHT A;  3RTV A;  3H8W A;  2KE7 A;  1Z00 A;  5F9L A;  2OCE A;  1NK5 A;  2YMM A;  1QLN A;  2HVI A;  3K1Z A;  2KVS A;  3BQ1 A;  2KHQ A;  1MQ2 A;  3CYM A;  1X9X A;  4JV0 A;  1ZRN A;  1PVR A;  3SMV A;  4UAW A;  5AK5 A;  4QZ8 A;  1ZQI A;  2PI5 A;  4UBC A;  4FFD A;  4PHD A;  1SL1 A;  1JI7 A;  5KFI A;  5J2C A;  4DOC A;  5AK4 A;  4O5K A;  1IIP A;  1SGG A;  3RJI A;  3C5G A;  5CWR A;  4NLN A;  4E0D A;  4WJ3 B;  1NJZ A;  4QWC A;  2V4R A;  3EZ5 A;  5AM3 A;  2XY5 A;  2W43 A;  4PHE A;  2LPE A;  1N62 A;  7ICS A;  4AYB F;  3E0F A;  2ISO A;  4F92 B;  3SAF A;  4YMN A;  5J2G A;  4CF4 A;  7ICN A;  4PZO A;  4P4O A;  3H40 A;  4UQG A;  8ICE A;  2A19 A;  5EOZ A;  4KLJ A;  9ICK A;  2HHQ A;  1ZD3 A;  1KW4 A;  8ICM A;  3BQ2 A;  2BCU A;  2WF9 A;  2ZIX B;  2KOB A;  4F2R A;  1U47 A;  1RYR A;  4HYK A;  1S9F A;  2I6X A;  3MGH A;  1LV5 A;  4J03 A;  2MSN A;  2JXJ A;  4NLG A;  3GZF A;  2KP7 A;  1T94 A;  3K4G A;  1COO A;  4B9T A;  2OH2 A;  1NKE A;  5J2I A;  1A0P A;  5HHH A;  3B0Y A;  4QZD A;  4G9B A;  8ICR A;  4DL7 A;  8ICJ A;  4C4T A;  2C28 A;  2F8K A;  3T5K A;  5AKL A;  2WB1 C;  3ISD A;  3EW9 A;  1KRP A;  4Y2V A;  1DK3 A;  4JUZ A;  2DFL A;  3L5K A;  1UT8 A;  4R65 A;  4O3O A;  3A0B U;  5KFA A;  4C8N A;  4TUR A;  4PGX A;  3JPN A;  4RQ3 A;  5ALI A;  1VDV A;  1WCN A;  2ES6 A;  5KFT A;  3WKC A;  1SXD A;  4NLK A;  5HR6 A;  1CI4 A;  2N1R A;  4DL4 A;  2HBK A;  5EWF A;  1LKY A;  1ZQH A;  1TE2 A;  2FPK A;  3TAN A;  3FM9 A;  2KMD A;  4C8K A;  5KFE A;  4GXK A;  2GOL A;  1ZRM A;  4UAS A;  4KIT B;  4UAV A;  2IBK A;  2EQY A;  4NJ8 A;  4C80 A;  3ETL A;  1ZQR A;  3ZD9 A;  1D9D A;  1RYU A;  3IN5 A;  3QEB Z;  4R63 A;  4QIW C;  5DGA A;  1KFT A;  2PI4 A;  2WHE A;  4Y2U A;  2ASJ A;  4M6W A;  3T79 A;  1JRO A;  5CA7 A;  3C5F A;  2RDJ A;  2JZB B;  1ZXI A;  5L1I A;  4F5P A;  3TQ1 A;  4DSL A;  4KLI A;  2O6K A;  3ICX A;  1HUZ A;  1L8L A;  5KT6 A;  2AHO B;  3BQ0 A;  1QSY A;  1O08 A;  4I2J A;  1IXR A;  3IP4 B;  4QZE A;  3D2S A;  7ICV A;  4O3N A;  3MDC A;  4EX7 A;  3AQF A;  1WWU A;  3GIJ A;  5AKG A;  1LB2 B;  3ZDC A;  1YZ6 A;  2BCS A;  5KNI A;  1Z00 B;  5KFS A;  1S8O A;  4TQS A;  2HBL A;  1NK8 A;  5GTH U;  4QWD A;  9ICT A;  2E8M A;  1UQV A;  2ZUB A;  2UVV A;  1ZQK A;  2HDO A;  2NO5 A;  3AU2 A;  3BZC A;  2ZJ5 A;  3UQ0 A;  4YFK A;  5AM5 A;  4KX5 A;  4F71 A;  5AI5 A;  1MN8 A;  2KIW A;  4BX9 C;  3SAH A;  4DLG A;  4C8L A;  1RDF A;  3OHA A;  4YXJ A;  4IQT A;  3I28 A;  1N61 A;  5KG0 A;  4DO9 A;  1K5O A;  1TAQ A;  5EWG A;  4YN4 A;  2HHU A;  3HRD D;  4TUP A;  2FLL A;  2W04 A;  3ISC A;  2MUT A;  3LWM A;  1B4F A;  4IR9 A;  4NV0 A;  4CF3 A;  4JMU A;  4LZD A;  3SV4 A;  4O9M A;  4BGD A;  1NZP A;  2HI0 A;  5AKK A;  2BPF A;  2KZM A;  4GC7 A;  4F4X A;  3HKZ F;  5DB9 A;  1JUD A;  2QKQ A;  3C2L A;  1BGX T;  3RJF A;  5DBA A;  5KG1 A;  5E79 U;  2W9B B;  5J0R A;  5F9N A;  4RNO A;  9ICF A;  4OJ5 A;  1ZD5 A;  1PUZ A;  1XSP A;  5J0X A;  2W11 A;  3EUB 2;  2QAR B;  5ALW A;  5KT5 A;  3UMB A;  1WWV A;  5KFP A;  4B9L A;  8ICO A;  4FS1 A;  4IR1 A;  5TZV A;  4ED7 A;  3BDP A;  1S77 D;  1ZQF A;  2JEG A;  3LK9 A;  2R8G A;  3TAP A;  1KBU A;  7ICI A;  4ECQ A;  3G6X A;  5D49 A;  5DBC A;  3FDS A;  4KLG A;  1ZQT A;  3C1Z A;  9ICB A;  1ZQN A;  5KFJ A;  4IC9 A;  1DXS A;  5KT4 A;  2W55 A;  1U49 A;  4K4G A;  2W8L A;  4PGY A;  2E8O A;  4OJP A;  3SEI A;  5ALE A;  4I2D A;  2R8K A;  3AEV A;  5CJ7 A;  3H0L B;  5DBB A;  2WAQ C;  4ELT A;  4M9H A;  3WK6 A;  4R8U B;  2KJ9 A;  4QZI A;  2VA8 A;  5JRT A;  3KTQ A;  4P0Q B;  1RQN A;  2AU0 A;  2FPM A;  5TIS U;  3Q8S B;  1LKY B;  2CPR A;  4DL6 A;  4MEX A;  1ZQZ A;  3IDW A;  5KFM A;  5III A;  4A8E A;  4FZM A;  2AQ4 A;  4XRH A;  1BPX A;  1SKW A;  3KHG A;  2XID A;  3GU3 A;  3MGV A;  1ARO P;  3KD3 A;  4OCZ A;  3QU2 A;  2ZG6 A;  4PHA A;  2W03 A;  4IRK A;  2B0C A;  1JX4 A;  4MFF A;  3MFI A;  1NK6 A;  1F0M A;  4OJ6 A;  1T7P A;  3PW5 A;  3Q8Q B;  2IOH A;  5AK3 A;  3B9J A;  3T5H A;  3L3F X;  1ZQJ A;  3CRX A;  3GIM A;  4ED6 A;  9ICC A;  4F5Q A;  2JGA A;  5ALR A;  3RRG A;  2NRZ A;  3BQT A;  3QU9 A;  1SV0 A;  1DGJ A;  4Y2P A;  5DDM A;  1X9S A;  3OHB A;  3RRH A;  2FMP A;  2OEH A;  2P35 A;  5DGB A;  9ICE A;  4C4S A;  4NM2 A;  8ICF A;  3KZI U;  5B5E U;  3PR5 B;  4NM1 A;  5HML A;  3KFU F;  5ALT A;  1YZ7 A;  2D3D A;  3SD7 A;  3NRW A;  4AYB C;  1ZJM A;  4Q45 A;  3PML A;  4EX6 A;  5CRX A;  4UB8 U;  2ASD A;  7ICM A;  2ZXH A;  2Q0Z X;  1VJ5 A;  2XCP A;  1RXV A;  1KDH A;  3WU2 U;  2H3I A;  5AHX A;  1TVA A;  2QB0 B;  4Q8F A;  4DOB A;  5ALQ A;  1Z19 A;  2WF7 A;  1XC9 A;  4Z6E A;  2XGQ A;  5KTQ A;  3IHQ B;  5AM1 A;  4J9N A;  4DOA A;  2F77 X;  4DFJ A;  1Z1V A;  3TFR A;  3PZP A;  4DWI A;  2MUT B;  3HP6 A;  3HW8 A;  2P6R A;  3TAD A;  2NRT A;  4EBC A;  9ICX A;  1A6S A;  1MC8 A;  4X5V A;  3RB4 A;  2J6T A;  2AJQ A;  3WKE A;  1B43 A;  5AKE A;  3WK7 A;  2LHT A;  3VC8 A;  7ICP A;  4F4Y A;  3H0M B;  1JAL A;  2GO7 A;  5AKI A;  2W7P A;  5L9X A;  5IIJ A;  1F5S A;  2RQ5 A;  2EZX A;  3NAS A;  2EAP A;  4ECT A;  2ZTE A;  5J0P A;  5CP2 A;  2VA3 A;  1L3U A;  1DOQ A;  1D8Y A;  2ISP A;  1XO1 A;  4UB4 A;  3TAC B;  3QU7 A;  2DF4 B;  2JZB A;  4ZH4 A;  3WKB A;  3M8R A;  2K4H A;  2Y9U A;  3T5L A;  2DUY A;  4C7Z A;  8ICT A;  4FO6 A;  4DQI A;  4YVZ A;  3H4B A;  2JEF A;  5KFV A;  5C5J A;  8ICY A;  1N48 A;  3IV6 A;  1RZT A;  1S97 A;  2KFZ A;  9ICV A;  4I28 A;  1X6J A;  2G09 A;  2YN4 A;  4IL6 U;  1ZQL A;  1COK A;  2F1I A;  5KFN A;  4UBB A;  1ZQP A;  1J97 A;  1RM6 C;  1ZQW A;  5EE3 A;  5AKX A;  3KHR A;  4Y2S A;  1ZYQ A;  2IOF K;  3PX0 A;  2L5Y A;  3QU4 A;  1VLB A;  1BNP A;  1V38 A;  3D6J A;  3PX6 A;  1X9W A;  3FAH A;  5KG4 A;  5J0Y A;  2ODG A;  4UAZ A;  2ZIV A;  8ICS A;  1UHU A;  1N5X A;  3LDA A;  4F3O A;  7ICO A;  4UW9 A;  5KL8 B;  2KVC A;  2J6U A;  2W9M A;  9ICH A;  4Y2Q A;  1KLN A;  4DSI A;  3JPO A;  2MAX A;  3A0H U;  1SV0 C;  3U26 A;  4DF4 A;  1BNO A;  2YX8 A;  4Z6D A;  3RJK A;  2IHN A;  3QUT A;  2NV3 A;  3RJE A;  2KZ3 A;  5D46 A;  2FE9 A;  4KN7 A;  1BPD A;  3PW7 A;  3I1Y A;  2OYY A;  3ZDA A;  1X40 A;  5KFX A;  4MFC A;  2EDU A;  4I2F A;  3H7I A;  4LZG A;  2ZJ8 A;  3UPQ A;  2I1Q A;  1TK8 A;  3RJH A;  3RBE A;  1RPL A;  3V7J A;  5HP4 A;  1K1Q A;  1FO4 A;  3PX4 A;  1A76 A;  2YB1 A;  2WF8 A;  2W9B A;  4YXM A;  3MR2 A;  1UPH A;  2EAN A;  4RQ0 A;  4O0I A;  1ZQS A;  1QSL A;  1N60 A;  5CHG A;  2W54 A;  5KFZ A;  4J9R A;  1QH9 A;  4RPZ A;  1NJX A;  3AL0 B;  9ICP A;  4G3I A;  4UAR A;  1ZQV A;  3WKD A;  2QAR A;  1TAM A;  3WK9 A;  1JRP A;  1IG6 A;  1PK3 A;  5J8Y C;  5DLF A;  5EE0 A;  1XU4 A;  4UB2 A;  2KNJ A;  3UXO A;  3TAD C;  3OJU A;  3SZ2 A;  3RAQ A;  7ICF A;  3JPS A;  1KL9 A;  4FS2 A;  4EYI B;  4F72 A;  3HKZ C;  4Q44 A;  2F76 X;  3NRZ A;  2Y1I A;  2XVT A;  4ECU A;  1Q8K A;  2RRD A;  4DEZ A;  1UA1 A;  2PFN A;  1S0O A;  2K4E A;  4JV2 A;  5IIK A;  4AP9 A;  1X42 A;  2ZXI A;  3NTU A;  7ICJ A;  4R8U A;  3FC4 A;  3PY8 A;  4P0Q A;  7ICH A;  1L8O A;  2ASL A;  3QUC A;  4RPY A;  2ATL A;  1XSN A;  2EAO A;  2DPI A;  3F5E A;  4ELV A;  4F5R A;  3PMN A;  3OSN A;  1Q3U A;  3M6K A;  4RQ6 A;  3UXP A;  2AXT U;  4F5O A;  2XI9 A;  4TQR A;  5KFG A;  1URJ A;  2HHS A;  4K4I A;  5F3X B;  2HW3 A;  2NRX A;  5ALY A;  1V85 A;  1V97 A;  2HBM A;  9ICN A;  1ZQD A;  4QW9 A;  3EWA A;  1OUQ A;  5ALG A;  1DGS A;  4DQR A;  8ICP A;  5AM0 A;  4CE6 A;  1BPE A;  4M2Y A;  2BCR A;  9ICO A;  1C20 A;  3GII A;  3MAB A;  3PSP A;  4QZH A;  2Y0S F;  1XO0 A;  5EWE A;  1QQ7 A;  2A1J B;  4HAI A;  3TKA A;  5G5G A;  4US8 A;  3OSP A;  5KG3 A;  5L1L A;  9ICR A;  2GLE A;  3L4P A;  4O3Q A;  2W9A A;  2KN7 A;  5KFL A;  4PJ0 U;  2XY6 A;  2E8P A;  3ZI4 A;  4O5E A;  3Q8R B;  1TK0 A;  3C23 A;  4I2B A;  2K4P A;  2M0N A;  4Y2J A;  1X66 A;  4YMO A;  4F8R A;  2V9W A;  3F5A A;  5HHI A;  7ICE A;  2XC9 A;  4RT2 A;  1QQ6 A;  2AGO A;  5JUM A;  5ALO A;  2QB0 A;  1RG6 A;  4EYH B;  2K8A A;  2ZIV B;  4Q43 A;  3N97 B;  3BJY A;  4DQS A;  1Z1B A;  4M9N A;  3EYZ A;  2W3R A;  2XIC A;  1O03 A;  5J2F A;  2WFA A;  4NY8 A;  4CDG A;  2DWQ A;  5JU5 A;  2ZTC A;  4Y2X A;  3RB0 A;  5DG7 A;  4I2C A;  2KSO B;  5AI6 A;  1U48 A;  4UB5 A;  5HR7 A;  1D9F A;  1L7N A;  5KFB A;  4R66 A;  2JH1 A;  1J2N A;  4Z6F A;  5KFF A;  5DDY A;  1ZQX A;  1IM4 A;  3FYH A;  4ED8 A;  3TAR A;  3AQE A;  4F50 A;  3QNM A;  3RBD A;  9ICI A;  5J29 A;  4EBD A;  1S5L U;  5DQI A;  4PH5 A;  2QLT A;  2BZF A;  5DB8 A;  1FFV A;  4JV1 A;  3PR4 A;  2KTQ A;  9ICG A;  3G6Y A;  4DFM A;  4OJO A;  2XO7 A;  4QNL A;  2C2E A;  2JEI A;  1N56 A;  4JWN A;  2ALZ A;  1ZQO A;  1QCK A;  2UVW A;  3PO4 A;  3E2E A;  2BGW A;  1BPY A;  3RR7 A;  3M9M B;  5ALJ A;  4OO1 J;  3GIL A;  1PVQ A;  5L1M A;  3UMC A;  3CP8 A;  3V6J A;  9ICU A;  3KOO A;  4KMU A;  1TFR A;  5EE1 A;  4RQ4 A;  1OXJ A;  4MHV A;  1LVH A;  5ALX A;  5ALD A;  1ZJN A;  4B9U A;  1ZQU A;  4QZA A;  4RNN A;  1FEZ A;  1BVS A;  1Y88 A;  3NVY A;  4YR0 A;  3C21 A;  1KKX A;  3S6J A;  7ICQ A;  5CEH A;  3RF9 A;  2WF6 A;  2HSZ A;  4ECV A;  3KHH A;  2F1H A;  4M9G A;  2RDI A;  4QZG A;  4OD0 A;  1KQQ A;  5J2A A;  3V7K A;  4KLL A;  4ECR A;  2IHM A;  4TUS A;  3BS5 B;  4QZ9 A;  1SL2 A;  2BKE A;  3RB6 A;  2HHV A;  1L7O A;  4CCH A;  5HMM A;  3GFK B;  1ZET A;  2KKP A;  2F2A B;  1UA0 A;  2CRX A;  3SQI A;  2LYA A;  1QQ5 A;  3DEE A;  4GXJ A;  5DB7 A;  2BR0 A;  2DGZ A;  4B9V A;  3ETR A;  2ZUC A;  1WG8 A;  5IIN A;  2BQU A;  1ZQC A;  3ORY A;  2YMQ A;  3IG5 A;  4GIB A;  2KHV A;  9ICJ A;  2E5S A;  2MA1 A;  3M8S A;  1IV8 A;  4YCX A;  2R8H A;  3C29 A;  3QZ7 A;  1KEJ A;  4O3P A;  4RZR A;  3F2D A;  3H8J A;  5KFQ A;  2HHW A;  5J0S A;  3HIL A;  4DL2 A;  4J9K A;  3GV5 B;  4Q8E A;  3ZD8 A;  4DLE A;  2G5H B;  2K8B B;  2VIX A;  4RQ2 A;  8ICA A;  4M0A A;  1TKD A;  2NO4 A;  2XY7 A;  2E1E A;  2LM4 A;  2KFN A;  3R9K A;  5KAI U;  4LJX A;  4KLF A;  3C2K A;  4I2G A;  3SEN A;  1NK0 A;  5J2H A;  1Q46 A;  2HOQ A;  1SWV A;  2KIC A;  2G06 A;  3TAQ A;  1BPZ A;  1X6I A;  4NLB A;  3G6V A;  3QX7 A;  4DL3 A;  2K60 A;  2E1F A;  3IM1 A;  1U9L A;  4ELU A;  4RQM A;  1XS9 D;  4ED3 A;  4DFK A;  3OTQ A;  4DQQ A;  3GQC A;  3OPX A;  1RQL A;  1ED1 A;  4UAY A;  3RFA A;  3QEA Z;  1H38 A;  5J0Q A;  5J2E A;  3NVV A;  1L5U A;  2EH9 A;  3F2B A;  2IMW P;  2HCF A;  5AI0 A;  5IIO A;  4DSE A;  2NRV A;  1B0X A;  2LMR A;  5G5H A;  2XGP A;  1ZQQ A;  2HOI A;  4KLM A;  5ALU A;  9ICA A;  4XUS A;  2UVR A;  2C22 A;  3HT3 A;  4BWJ A;  2F44 A;  1SL0 A;  1XNS A;  4BUG A;  1QSS A;  1T3N A;  4GXI A;  3J81 j;  4EEN A;  2BCQ A;  4IS7 A;  4RUC A;  2VA2 A;  3E58 A;  4F5N A;  4KX3 A;  4KLH A;  8ICW A;  3KBB A;  3MBY A;  5L1K A;  4O3R A;  5KFO A;  2BCV A;  1Z3E B;  2YML A;  2Z7J A;  5BOM A;  3IRU A;  3Q8K A;  2KZZ A;  9ICW A;  3LWL A;  1MA7 A;  5A0L A;  4O3S A;  2JRZ A;  4KN4 A;  4XQ8 A;  1UCV A;  2PKE A;  1GO3 F;  4P2H A;  3LVW A;  3ALR A;  3RH5 A;  2R8I A;  4KLO A;  2A1J A;  4I27 A;  2W7O A;  5J2K A;  4ACO A;  2FDR A;  3D2Q A;  1L7M A;  2VKQ A;  4EBE A;  3V6K A;  4MEY A;  2UVU A;  2KKV A;  1JIH A;  2ZIW B;  3T3F A;  3PNC A;  5AIA A;  4EEL A;  2DKZ A;  2CN1 A;  2BPG A;  4R64 A;  2H3V A;  3PSI A;  3VCB A;  5KG6 A;  4I29 A;  2BPC A;  1WUD A;  1OW5 A;  2LM1 A;  1NK9 A;  2MRL A;  3F53 A;  3H0R B;  2YY6 A;  8ICX A;  5D4B A;  3LVV A;  4RQ8 A;  2Y0S C;  1NI3 A;  2W3S A;  3PO5 A;  4DSF A;  8ICQ A;  2C2R A;  4RT3 A;  1X9M A;  2V4Q A;  2KSO A;  4QWE A;  1MQ3 A;  2C2D A;  2YTU A;  4P4P A;  3NVW A;  4ECX A;  1SWW A;  1SKR A;  1PK1 A;  2NYV A;  2Y9T A;  3EPG A;  2PMZ F;  3UXN A;  5AM4 A;  5ALM A;  1C7Y A;  4DFD A;  2BQR A;  2HHX A;  2YQE A;  5AI4 A;  3AN1 A;  4OJL A;  5ALL A;  7ICK A;  3M1Y A;  3PST A;  2ZIU B;  2KJ5 A;  4I2H A;  3D2N A;  1ZQG A;  3V72 A;  2EAM A;  2JMG A;  4ED1 A;  2FMQ A;  1NJY A;  4RPX A;  3RH6 A;  3C28 A;  4C8O A;  2MU2 A;  4QZC A;  5HNK A;  1DK2 A;  3Q8P B;  1HEK A;  5KFU A;  7ICR A;  4FZN A;  4J9M A;  3N7R C;  3ED5 A;  1NNL A;  1S0N A;  4Y2R A;  5ALH A;  1KTQ A;  4PZN A;  1WYG A;  1CEZ A;  5H2F U;  1N63 A;  5AM2 A;  5JTI A;  8ICL A;  1ZOL A;  4PL1 A;  2DL0 A;  1JXL A;  1TAU A;  4BXO A;  2G0A A;  2KD1 A;  1JXE A;  3QE9 Y;  4FE3 A;  3AMZ A;  4F4K A;  3MR5 A;  3ZDD A;  5KT7 A;  4XA5 A;  3RR8 A;  1ZQY A;  3IG8 A;  4BJQ A;  1FIQ A;  1Z4N A;  2LBO A;  4F93 B;  3RB3 A;  4NL9 A;  4ECW A;  4MFA A;  4GLX A;  2DBY A;  2JR5 A;  2JEJ A;  1NZB A;  3MGI A;  1ZQM A;  3BS5 A;  2H3Z A;  2ESE A;  4RQ5 A;  1U4B A;  1HIW A;  1KN5 A;  3QXG A;  5B66 U;  2ZTD A;  3N28 A;  2VAN A;  4B9S A;  3H8S A;  5AIB A;  5BPC A;  3OJS A;  5KFH A;  4EEK A;  4M9L A;  3MR3 A;  1CUK A;  4DSK A;  5KAF U;  5J0U A;  1SV4 A;  3AUO A;  1ZQ1 C;  1NOM A;  3PSF A;  5DLG A;  1SKS A;  4K4H A;  4DQP A;  2IA6 A;  3RJJ A;  1ZQA A;  4FBT A;  2KV2 A;  3BZK A;  4KLD A;  4IQV A;  3M6Z A;  2K8C B;  4RQN A;  4GC6 A;  3PW2 A;  5ALN A;  4QWB A;  3GV7 B;  4DFP A;  3K75 D;  2PFP A;  2DPJ A;  2OWO A;  5BOL A;  1SZH A;  1RYS A;  5IIL A;  4BDP A;  1JMS A;  3PVX A;  3JPR A;  2LI6 A;  5L1J A;  4P0P A;  1NKC A;  3V7L A;  3WKA A;  1JN3 A;  1J2M A;  3H8M A;  4KTQ A;  5AI9 A;  2D8C A;  1NJW A;  3SYZ A;  2FLN A;  5FP0 A;  4Z6C A;  3O0F A;  4NLC A;  2A3V A;  1EXN A;  2F1J A;  2AGP A;  5KFK A;  4DCC A;  2HVH A;  3RJG A;  3ISB A;  4EZ9 A;  2K89 A;  2LYB A;  4IQW A;  2JH7 A;  2KEY A;  2PFQ A;  3PW0 A;  3BQ7 A;  2WTF A;  1S76 D;  3JPQ A;  1TK5 A;  8ICN A;  4KLE A;  8ICV A;  4ZOH C;  5KFR A;  4C7Y A;  2BQ3 A;  4RU9 A;  2OM6 A;  4U6P A;  1L3S A;  2FI1 A;  4KMO B;  1F44 A;  3ZDB A;  2W9C A;  2VJ4 A;  3MDA A;  2LYH A;  1PVP A;  1D8L A;  4J9L A;  4QZB A;  4P4M A;  1SIJ A;  3H4D A;  5KG7 A;  5IIM A;  3V6H A;  2BHN A;  4UB3 A;  1PK1 B;  3Q8M A;  2FPL A;  2KIV A;  1HJP A;  4YR3 A;  8ICU A;  9ICS A;  4M47 A;  2G5I B;  2HMX A;  3C2M A;  4B9M A;  5AI8 A;  2GH1 A;  8ICK A;  4DS4 A;  4KLQ A;  1N2X A;  3F2C A;  3UQ2 A;  3TI0 A;  4QW8 A;  1FFU A;  2WB1 F;  3GDX A;  4ECZ A;  1WCL A;  7ICG A;  2RP5 A;  4US9 A;  3M7D A;  3QYP A;  5J0O A;  2DQN B;  3KKA A;  5KFW A;  5DG9 A;  4QJF B;  1AQ6 A;  5DB6 A;  2E8N A;  2Q4T A;  1L7P A;  4NL9 C;  4YP3 A;  4PPX A;  1KFD A;  4ECS A;  1SXE A;  5DKW A;  2I5H A;  4JWM A;  2A1A A;  1T4G A;  2OHF A;  5AIC A;  4NLZ A;  5J2B A;  4J9O A;  4O3M A;  3DDH A;  4LVS A; 
#chains in the Genus database with same CATH homology
 2K60 A;  5JTI A;  2EAO A;  5JU5 A;  4RQM A;  2FE9 A;  2DL0 A;  1KW4 A;  1X40 A;  1OW5 A;  2JV3 A;  2KSO B;  2EAP A;  2B6G A;  3BS5 B;  4NL9 A;  5F3X B;  2QAR B;  3BQ7 A;  1B0X A;  1SV0 A;  1WWV A;  2LMR A;  1V85 A;  3TAC B;  2KSO A;  2EAN A;  1WWU A;  2KE7 A;  3BS5 A;  2Y9U A;  2YTU A;  2F44 A;  2ESE A;  1PK1 A;  2QAR A;  2Y9T A;  5KNI A;  4IS7 A;  2F8K A;  2E8M A;  1UQV A;  1X9X A;  1PK1 B;  1PK3 A;  3KKA C;  5J8Y C;  2D3D A;  1SV4 A;  2KIV A;  3TAD C;  5J8Y A;  1DXS A;  2KG5 A;  1COK A;  2E8O A;  3SEI A;  3BS7 A;  3HIL A;  1JI7 A;  3K1R B;  1UCV A;  2ES6 A;  5L1M A;  2GLE A;  1SXD A;  2EAM A;  1LKY A;  1SGG A;  2QB0 B;  2E8P A;  2KMD A;  2L5Y A;  5JRT A;  4RQN A;  1OXJ A;  4MHV A;  1V38 A;  2K4P A;  1LKY B;  1B4F A;  1X66 A;  3KKA A;  3IDW A;  2DKX A;  2LPE A;  1Z1V A;  2QB1 A;  3SEN A;  2E8N A;  4NJ8 A;  2F3N A;  2QB0 A;  1RG6 A;  3TAD A;  4NL9 C;  2DKZ A;  1SV0 C;  1SXE A;  4PZO A;  2QKQ A;  4PZN A;  3H8M A;  2D8C A;  1F0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...