2E8MA

Solution structure of the c-terminal sam-domain of epidermal growth receptor pathway substrate 8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Epidermal growth factor receptor kinase substrate 8
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18016 SAM_3 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8mA01
2JV3A 1COKA 3BQ7A 3SENA 4RQMA 2E8NA 2QB1A 1SGGA 5JRTA 2EAPA 5L1MA 1PK1B 2EAOA 1RG6A 2FE9A 5JU5A 2E8PA 5J8YC 4PZOA 2F8KA 2F3NA 4RQNA 2KG5A 1SV0A 2LPEA 2YTUA 2DKXA 2D8CA 1KW4A 3TADC 2KIVA 2K60A 3BS5B 3SEIA 1UQVA 2QB0B 4NJ8A 1SV0C 2ES6A 2K4PA 1OXJA 1F0MA 4PZNA 2EANA 1OW5A 1LKYA 1X9XA 1WWUA 2DL0A 1WWVA 1JI7A 4MHVA 3TADA 1SXDA 1PK3A 3K1RB 3KKAC 2QARA 2KSOA 3BS5A 2QB0A 5JTIA 3BS7A 1V85A 1X66A 3TACB 4IS7A 1DXSA 1Z1VA 2L5YA 4NL9A 1B4FA 2F44A 1SV4A 2DKZA 2E8OA 1LKYB 1X40A 2D3DA 5F3XB 2EAMA 2GLEA 2QKQA 5J8YA 3HILA 2LMRA 2KE7A 1SXEA 2Y9TA 1PK1A 2QARB 4NL9C 2KMDA 2KSOB 2B6GA 2E8MA 1B0XA 3H8MA 1V38A 3IDWA 3KKAA 2Y9UA 2ESEA 1UCVA 5KNIA
chains in the Genus database with same CATH superfamily
2YY6A 9ICKA 1HEKA 2G0AA 1ZETA 2XCAA 5BOLA 3RJIA 4ED2A 3QNMA 3DDHA 5J2CA 2D6FC 9ICGA 3ZDCA 2WHEA 2ZUCA 2YQEA 1N2XA 4NLNA 2YMQA 3V7LA 2E1EA 3KTQA 4F5RA 4C80A 2UVRA 1NK0A 4Q8FA 2KTQA 1KEJA 3SD7A 2HCFA 4RQ6A 4ECYA 3RBEA 1NJWA 1ZQSA 5D49A 1NI3A 3PR4A 2NRZA 2XC9A 4RQ1A 7ICGA 4UAVA 2PMZF 3I76A 5KG2A 1F44A 2W43A 3QUTA 4M9LA 4MF8A 3N4MB 1L7OA 2KVSA 3MR2A 1VDVA 3T5HA 5HR6A 5KFQA 2PFNA 2XGQA 3M9OB 1ZQQA 1SXDA 5AKXA 1XS9D 1RXWA 4GFJA 3GDXA 3V7KA 2CPRA 5J0SA 3WK6A 3MR3A 5GTIU 2L5YA 4GIBA 1L7PA 1PVPA 1SV4A 1ZQBA 3C1YA 1UPHA 1RM6C 4P4OA 9ICIA 3PSFA 2XICA 3JPPA 2V9WA 8ICXA 5ALVA 2ZIXB 4PGYA 5EE9A 5KFBA 2JXJA 3ICXA 4O3NA 5KG0A 5DDYA 4PHPA 2J6UA 5J0WA 5KG4A 1IIPA 1ZQXA 4U7CA 4QZAA 1NJYA 2BQRA 1NK4A 1ZQ1C 4FFDA 1N62A 2JV3A 2WF8A 4PH5A 3SZ2A 1KDHA 1CUKA 2WF5A 2PFQA 2XY5A 5JRTA 5JU5A 4QNLA 1NOMA 2JZBB 2F8KA 3EYZA 5J0QA 3M8SA 2YTUA 2PFOA 5ALFA 4I2AA 3RB4A 4ELVA 1UQVA 1KBUA 2VA2A 5KFNA 2HW3A 1ZQTA 4EEKA 4BXOA 2KV2A 2K4PA 1F0MA 3RJKA 3WK7A 1X9SA 4RZRA 1TVAA 1VJ5A 3WU2U 9ICFA 4DFJA 3NTUA 3UM9A 3FAHA 4KMOB 2MUTA 2KICA 4F50A 5ALXA 3SAHA 4PHAA 2PFPA 4K4IA 3NRZA 4C8OA 3K75D 1WCNA 1Q8KA 2A1AA 1X9MA 1QQ6A 1Z1VA 2VKQA 1TK8A 2JH1A 4RT3A 3MDCA 4FBUA 5AIAA 3CNHA 4AYBC 4JMUA 2D3DA 4JB3A 2VJ4A 3WK9A 1ZQNA 3WKCA 2OXOA 5ALOA 4RQ7A 8ICGA 5KT5A 4I29A 3EUB2 2PKEA 5GTHU 4LZGA 4QW9A 5ALRA 2Y9UA 4B9MA 1BPEA 2VA3A 5HNKA 5HMMA 4QZIA 4I2IA 4Q44A 3PW5A 1ZQEA 3UPQA 2IHNA 1SWWA 3TFSA 1RG6A 5CHGA 3RBDA 2F3NA 4RQNA 4NWIA 4M6WB 3MGVA 1MQ2A 1SZPA 2W9MA 2HMXA 1SV0A 5KFTA 4UB4A 4DSJA 3IN5A 1KFDA 4ED0A 2D8CA 1L8OA 5CRXA 4EEYA 4DQPA 1N5XA 8ICNA 4YG2A 4DSEA 7ICFA 2PMZC 3T79A 1SL1A 3N7PD 4GC6A 5AM0A 3E58A 4DS4A 1NK6A 5DB8A 1OXJA 4NLZA 3BDPA 4KX5A 4F93B 4GLXA 3M6ZA 1WWUA 4F92B 2HBMA 4F3OA 4Z6EA 3AQFA 4RUCA 1ZD4A 3V72A 5J2DA 4QZCA 3T5KA 2QARA 4PPXA 4OJ6A 3G6YA 1KN5A 2W04A 5KFHA 4UW9A 3HRDD 5AKEA 1BPDA 4BXOB 1X66A 3B9JA 3IM1A 5KFXA 1ZQIA 5J2JA 1Z00B 4E0DA 1XSPA 4PL1A 3QU4A 1ZQRA 1NKEA 3IRUA 2GLEA 2H3IA 3OGUA 3HKZC 4PGQA 4DL3A 2KN7A 4IR9A 5ALJA 2DPIA 3GIMA 4JWMA 3U26A 9ICAA 1X42A 1COOA 1QTMA 4I2DA 3LK9A 4YMNA 4M9NA 4DEZA 1JX4A 1JUDA 2FJ6A 7ICNA 4ED6A 2FLPA 4IR1A 1NK9A 7ICHA 2DQNB 3QU9A 1RPLA 3BQ7A 5AM2A 1UA0A 3C5GA 2QB1A 3QUQA 4Q45A 3IG8A 3AM9A 3H4BA 3RH5A 4O3SA 4FS1A 1D8BA 2NRTA 4B9UA 4JUZA 1MN8A 5IIMA 2IA6A 3Q8SB 4KMUA 3FC4A 3HPOA 4M9JA 3H8SA 5AI5A 1F5SA 5DBCA 5AIBA 4IRCA 1DK3A 3PSPA 4PZNA 4LJXA 1SIJA 4OJOA 3C29A 3LDAA 4KX3A 4JV0A 5ALMA 1U48A 1JRPA 5A0LA 2E1FA 3OSNA 2EZZA 4JV1A 3BQ2A 2HOFA 3DV9A 5JUMA 3H8JA 2BDPA 4C4TA 3E2EA 4IS7A 3ETLA 4C8KA 5CEHA 3ZDEA 3SQIA 3BJYA 4F5QA 4Q43A 1ZD5A 3JPRA 1BVSA 2BPFA 3MBYA 2HHXA 4QWCA 5AK6A 1MC8A 4XRHA 4ECVA 2IHMA 4UQGA 5DBAA 3OPXA 3NRWA 2I6XA 2HBJA 5J29A 2JEGA 1NZBA 1NZPA 2FLLA 5KAFU 4K4HA 1ZQZA 7ICVA 4P4MA 5DGAA 2XI9A 2WF9A 2DUYA 2AXTU 2V4QA 3M9NB 1BNPA 4QZ8A 5C5JA 4YMMA 2BCVA 4NM1A 2ZIUB 4KLOA 4UB6U 2C2EA 4XA5A 3QXGA 4IC9A 3VCBA 5B66U 4RQ5A 3TFRA 1NKCA 2LKYA 4O0IA 5KFFA 5BPCA 3SI8A 3RJHA 2PI5A 3KD3A 1FFUA 3TAPA 2OM6A 2BPGA 2ISOA 2CRXA 4KN4A 5CB1A 4BGDA 1TV9A 4YR0A 5DG8A 4J9LA 4X5VA 4Z6CA 4YVZA 2AU0A 3MR6A 1X9XA 2HSZA 4RPYA 1WWVA 4C8NA 2RHFA 2RLTA 2IOHA 1Z3EB 3EZ5A 5DGBA 2HDOA 1RYUA 4DS5A 8ICAA 1DGSA 2W9CB 1LVHA 5KFKA 2F8LA 1ZQMA 4OD0A 4TQRA 4ACOA 4ECXA 3F53A 4QZFA 4I2FA 4DO9A 1ZD3A 1IM4A 1TFRA 2WTFA 1QQ5A 8ICIA 3RAQA 4KLEA 4EYHB 4DL5A 4CF4A 2LYHA 2AGPA 5F9LA 5J0YA 4YFKA 5KNIA 1IXRA 5KT4A 4P0QA 3PW2A 2KFZA 4MF2A 3SMVA 2EQYA 4U6PA 1RZTA 3BQTA 3OTQA 3PW7A 3Q8KA 1DOQA 1UA1A 5ALZA 1SB3C 2H3FA 2LHTA 2KG5A 4IRKA 3NVZA 4NLCA 3PR5B 4YR2A 1X2IA 4F72A 7ICOA 3RF9A 3QE9Y 3RH6A 3TARA 4Y2SA 3CYMA 4DQIA 2P6RA 2LYAA 4US9A 5IIJA 2HHQA 3ZDDA 2ES6A 3H4DA 5ALWA 1AQ6A 1EXNA 4IL6U 9ICXA 3M1YA 4M6WA 2YMLA 2XGPA 4BWMA 2JEFA 1T94A 4LZDA 8ICLA 4CF5A 2WF6A 4I28A 2QB0A 4ZH4A 5JTIA 4F71A 3PX6A 4O3QA 1JROA 2AH5A 5KFUA 3M9MB 2ALZA 7ICRA 2BKEA 1JXEA 1UT5A 3UXPA 8ICTA 3GFKB 3UMBA 2ZTDA 4OCZA 4MEXA 4C4RA 3Q8QB 5KFYA 5KG1A 2Y9TA 2HHWA 4NLGA 4DQQA 5KFMA 5AKHA 7ICUA 1ZD2P 5EE0A 1U9LA 2EDUA 4P2HA 8ICMA 1NNLA 3MGIA 4KN7A 1ZJMA 4ECWA 8ICFA 2UVVA 2KP7A 2W3RA 4YXJA 8ICZA 5HHHA 4IQVA 3KHHA 4PJ0U 3SENA 2E8NA 2IMWP 9ICEA 4YR3A 4QWAA 3C28A 4RT2A 1U4BA 5ALHA 5ALUA 5K4LA 4DQSA 4F91B 4I2HA 1PVQA 4J9MA 3TADC 2KZMA 2K60A 3WKAA 1QSYA 7ICEA 3BS5B 5B5EU 4KITB 5ALTA 4UAUA 5L1LA 3NVWA 5J0UA 3PY8A 4I27A 2JH7A 4NLBA 5J0PA 1Y88A 2A3VA 4M04A 2XVTA 4EZ6A 3OJSA 2FMQA 5HP4A 3RB6A 4EBDA 2PXIA 2BQUA 3K4GA 3WK4A 3K1RB 1ZYQA 2BHNA 5KFAA 4O9MA 3IP4B 2Z7JA 4K4GA 3QU5A 2JHDA 4I2CA 1TK5A 2BCRA 4F2SA 5ALDA 4C7ZA 4O5EA 1DXSA 2G09A 3L3FX 4QZBA 2ISPA 2K89A 4DFKA 2KJ5A 4NXZA 3SV3A 1URJA 2E8OA 2YMMA 5J2EA 2FMSA 4B9TA 4FE3A 3PMNA 3N28A 1SXEA 4QWDA 3PZPA 3WK5A 1ED1A 3Q8LA 4PL2A 3KHRA 3UQ0A 4GXIA 3KKAA 4JK1A 3BQ0A 3ORYA 4F5NA 3OJUA 3WK8A 5J0TA 4O5KA 4YCXA 4EX6A 2F77X 2GH1A 4DFMA 3GZFA 3N7SC 1P7DA 1ZQAA 2DF4B 4TUSA 1XO1A 1HUZA 2DPJA 4UB3A 2EAPA 2YX8A 1SKRA 4UB2A 1ZQUA 8ICEA 1O03A 5J2FA 4KLFA 1Z4OA 2KZZA 5AHXA 1C7YA 3UQ2A 2XO7A 5KTQA 3QU7A 2OHFA 1KW4A 1L7NA 4R65A 1BPZA 5AKIA 5EWEA 1L8LA 5IINA 3PW4A 2HVHA 2DGZA 1TK0A 2K4EA 4NJ8A 3UXOA 9ICRA 3Q8RB 1SV0C 1OUQA 1SL0A 1XO0A 1Z1BA 4M47A 1L3SA 4EENA 3KZXA 2W3SA 4O3MA 3AN1A 1QLNA 1J97A 5FP0A 4Z6FA 5KFGA 4QJFB 2ASDA 4MHVA 2K8AA 1S10A 4EBEA 2ZIWA 2BQ3A 4Y2YA 3C2LA 3G6VA 1ZQGA 3GIIA 4M9HA 4Y2QA 4OJPA 1XSLA 3ETRA 2HOQA 1BNOA 4QZDA 1JMSA 2EZYA 3TAQA 2H5XA 4DLGA 4Y2XA 2VA8A 3B0YA 3EWAA 1WCLA 1KTQA 2B0CA 4Q8EA 4O3PA 5D46A 1X6JA 1BGXT 1CI4A 3A0HU 2EAMA 4RPZA 2QKQA 5DG9A 2ZXIA 4J03A 3OSPA 2KHVA 3GV5B 1GO3F 4DF8A 2LM4A 3OHBA 2W11A 2K4IA 2R8JA 4J9RA 7ICLA 1FO4A 2IBKA 1V97A 5DQGA 2HVIA 1S97A 5EE1A 4KLQA 2Y1IA 4KLJA 5J2BA 3MFIA 8ICYA 4CDGA 4NLKA 3NUQA 2F1IA 1M6YA 8ICUA 2UVWA 4RPXA 2XY6A 5J8YC 4US8A 4DL2A 5KFVA 2I1QA 4MFAA 9ICQA 4QZ9A 1L6NA 2HI0A 1NJZA 2KZ3A 2YB1A 8ICOA 4R63A 3HT3A 3KOOA 3BZCA 4J9OA 4ECZA 3GQCA 3F5EA 2KK0A 3CP8A 3AU2A 4YQWA 2IOFA 5KL8B 3MDAA 4EELA 3H8WA 3RJJA 4UAWA 5L1KA 2AJQA 4HAIA 1MSWD 2MA1A 1L3TA 3HW8A 1K5OA 7ICJA 3IV6A 2YN4A 3KKAC 5KFSA 1ZRMA 4F4ZA 1JALA 3TANA 2V4RA 5J0OA 2G07A 3LWMA 4ZOHC 2F1JA 4UB8U 8ICVA 2I5HA 3TQ1A 4B9SA 4GC7A 2Y0SF 4ECRA 5F9NA 2Y1JA 2KFNA 1IG6A 4J9QA 1TAUA 3KBBA 2DKZA 2KIWA 2QLTA 1ZXIA 4YMOA 1DK2A 1ZQKA 3HILA 4Z6DA 2HBLA 2FMPA 1DGJA 4BUGA 3KFUF 2XIDA 4I2GA 2IOFK 4P0PA 1XSNA 3IDWA 3JPSA 2P66A 4RU9A 5KAIU 8ICKA 1T3QA 3AEVA 5E79U 4HYKA 4DQRA 5J2AA 4QIWF 1COKA 4KLHA 9ICCA 4A8EA 3QEBZ 1SGGA 2W55A 3GV8B 3K1ZA 2BCQA 4M0AA 2C2RA 4DL4A 2G06A 1T3NA 5HHIA 1ZQHA 1L7MA 3C1ZA 2F76X 2KNJA 1JXLA 2C28A 1JN3A 1CEZA 2I9GA 4ED8A 5DBBA 2XY7A 5AK3A 5AKKA 5J2GA 1UT8A 4RQ3A 4NM2A 1TAQA 2G5HB 4F4YA 5KFOA 4EYIB 1N56A 1ZRNA 2H3QA 3RAXA 4BJQA 3QZ8A 4ELTA 1OW5A 3ISCA 3T5JA 2NYVA 4FBTA 4DSIA 8ICQA 2W7PA 4USAA 3TADA 2C22A 1XWLA 4BX9C 4KLMA 2KSOA 3TKAA 3C2MA 4UAZA 3SV4A 2EH9A 4CGZA 4C7YA 3TACB 3H0LB 2J6SA 1RQNA 4OJLA 7ICTA 4UATA 1D9DA 5EWGA 1T4GA 1SKWA 2G08A 5DB6A 3NVYA 1QSLA 1ZJNA 3V6HA 3WKEA 2KE7A 4EX7A 2YMPA 3RTVA 2ASLA 2KKPA 2W54A 4NL9C 2B6GA 3C23A 3AMZA 4IQWA 1B0XA 2HBKA 2WAQC 2BR0A 3V7JA 3GV7B 2KJ9A 4KLGA 4XQ8A 4DSLA 1ECWA 5AI4A 5CP2A 4RQ2A 2HHTA 1UCVA 4QZEA 5KG3A 2A1JA 5TISU 2OCEA 1TKDA 1QQ7A 2F2AB 2WFAA 4B9LA 3UXNA 1S0VA 4RQMA 2WB1C 2VJ5A 4TUQA 1KRPA 2LI6A 1N48A 4RUAA 2VANA 5KL1B 2FPMA 2H3ZA 5AKJA 4O3RA 3V6JA 5EWFA 4FO6A 3L5KA 8ICSA 5DQIA 3THVA 2LM1A 3H7IA 5ALPA 2W8KA 4NV0A 5EOZA 1L5UA 3QEAZ 4R66A 1FEZA 5DDMA 2HHSA 2ZUDA 4QZHA 1UHUA 4M9GA 9ICTA 1WUDA 3ISDA 3PO4A 8ICCA 3ZDBA 3B0XA 4KLLA 4MEYA 4TQSA 4ED3A 4B9NA 3SYZA 2OEHA 3CW2C 2P35A 5DKWA 5AICA 1K1SA 5J0RA 2GWSA 5AKLA 4NL9A 5KFWA 1S0OA 9ICLA 3QX7A 2NRVA 2ZJ5A 3SAFA 2JEJA 4F2RA 2LMRA 3LVWA 2Q4TA 2ZJAA 4TUPA 1PK1A 2ASJA 4RQ0A 2KEYA 2NO5A 3ISBA 1NK7A 3IG5A 5L1IA 2E8MA 4WJ3B 9ICSA 7ICPA 4DLEA 2ESEA 4OJ5A 3LVVA 4P4PA 2HOIA 3I28A 4TURA 2N1RA 3MGHA 7ICIA 3JPNA 4GXJA 4QW8A 4DF4A 2W03A 5DB7A 9ICMA 1KFSA 2EAOA 4CF3A 1V9PA 3GIJA 4NY8A 1RDFA 4PZOA 2LBOA 2ATLA 2MRLA 4DSFA 2E3TA 3T5LA 2BZFA 1S76D 4RNMA 2DKXA 2ZUBA 2OWOA 4UB1A 1ZQFA 4I2BA 2KIVA 3ZDAA 2AGQA 1TE2A 2A1JB 3NS1A 3BQ1A 2NV3A 3I1YA 4IQTA 3OHAA 5KT6A 3RFAA 5IIOA 4F5PA 4J9NA 2ZIUA 2DFLA 2EANA 2JGAA 3GILA 4B6JA 1LB2B 9ICNA 1BPBA 3UMCA 1JI7A 4PGXA 4DL6A 3WKDA 4KLTA 4RQ4A 4PHDA 2BCSA 1D8LA 2FPLA 2JR5A 4P0PB 1S77D 4DCCA 3H40A 3BS7A 3DEEA 3FDSA 9ICWA 8ICHA 3FYHA 3QZ7A 4G9BA 3QU2A 1J2MA 5KFDA 2RQ5A 5ALQA 3Q8MA 2MU2A 2NO4A 1LKYB 5F3XB 3ZD8A 1Q46A 3M6KA 5DLFA 9ICOA 2WAQF 3D2NA 3EPGA 3HWTA 3RR8A 2QARB 3C21A 1PUZA 4ECUA 3ZI4A 4I2EA 4MFFA 2W9CA 3PX0A 4UAYA 2NRXA 5KFJA 2WF7A 3N7RC 4ELUA 4GXKA 4FZMA 5AK4A 2RP5A 4YD2A 5AM3A 4DFDA 9ICVA 3A0BU 3E0FA 1T8EA 1A0PA 1N5WA 5KFLA 2M9NA 1BPYA 1KFTA 1SZHA 3PMLA 1NK8A 1X6IA 3PO5A 7ICSA 2ZIXA 1SKSA 2LPEA 3J81j 5KG6A 3S6JA 3H0RB 3SEIA 9ICJA 4RQ8A 3RB0A 4P0QB 3PX4A 4J9KA 1L3VA 2M0NA 4JWNA 4AYBF 1YT3A 3C2KA 5KFZA 1QSSA 3D6JA 1LKYA 3F5AA 2B21A 5DLGA 1KL9A 4F4KA 1PK3A 2YB4A 4FZNA 4LVSA 3G6XA 2R8HA 1NKBA 1PZNA 2R18A 4ECTA 2E5SA 1H38A 1ZQWA 4CNQA 5L1JA 2K8CB 5CWRA 5J0XA 7ICKA 3D2QA 3O0FA 5G5HA 3HKZF 2F1HA 1HUOA 5AI6A 2PI4A 5J8YA 4ICAA 3Q8PB 4OO1J 3TI0A 3H0MB 1IV8A 4J9PA 4BDPA 2KMDA 2KSOB 1KSPA 2FI1A 4M2YA 2G5IB 3H8MA 1C20A 5ALEA 1VLBA 4KLDA 5J2KA 2MAXA 1ZQVA 1MA7A 4EBCA 1K1QA 5DQHA 3AL0B 5KT2A 1S8OA 1ZQDA 2R8IA 1KKXA 5ALKA 3JPQA 3MFHA 4CCHA 5HR7A 5ALGA 4J9SA 3F2CA 3SAGA 1S5LU 5CJ7A 2BGWA 7ICQA 1QH9A 2JMGA 2RRDA 2KKVA 1D8YA 3BZKA 4IQUA 1L3UA 2R8KA 3PV8A 3HX0A 4ECSA 4UB5A 4Y2RA 1RYSA 1Z4NA 3NVVA 9ICBA 1YZ7A 4F4WA 2VIXA 3MC1A 5IIKA 3KHLA 5J2IA 3ALRA 2AQ0A 3IHQB 2AGOA 4ECQA 4DL7A 4YD1A 3D2SA 4JV2A 4UASA 3GIKA 5AKYA 3UMGA 4C8LA 5CA7A 3BS5A 1HJPA 2W9BA 1ZQLA 2ZIVB 1DRGA 1NK5A 2AHOB 1S9FA 4G3IA 4QZGA 4YXMA 4XUSA 3MR5A 1B4FA 3VC8A 3N97B 2RDIA 2MSNA 9ICPA 1SWVA 2J6TA 3WKBA 2DWQA 4UARA 2FDRA 3PSTA 4DOAA 3AUOA 1ZQYA 4RNNA 4Y2UA 4R8UA 2GO7A 3PW0A 1ZQOA 2H3VA 4C4SA 5KFPA 1PVRA 1RXVA 5CR0A 5AM5A 4O3OA 4BWJA 3FM9A 2UVUA 4F8RA 2W7OA 2Y0SC 3PVXA 3F2DA 8ICBA 5KFIA 1N60A 1FIQA 4KLIA 4Y2PA 5KFCA 1Q3VA 5L1MA 1PK1B 1ZQJA 2E8PA 3RJFA 1ZQCA 3RJGA 2HHUA 1Z19A 2ZIWB 5H2FU 4DOCA 2HHVA 2MUTB 4ED7A 1N63A 1ZOLA 3R9KA 5T14A 1NJXA 1KQQA 2QB0B 1S0MA 2OYYA 5ALLA 1Q3UA 5AI9A 1RQLA 3ZD9A 5IILA 2KJ8A 3LWLA 5AI0A 4ED1A 2O6KA 2C2DA 4F4XA 5BOMA 4F5OA 4DWIA 4EZ9A 1QCKA 3ED5A 3JPTA 4AP9A 1D9FA 2KD1A 5KFEA 5KFRA 1MQ3A 4C0ZA 2P6UA 2DL0A 4UBCA 2DBYA 2JZBA 2FLNA 5AKZA 4R8UB 1WG8A 2XCPA 5J2HA 2ZTCA 3JPOA 4CRXA 1U47A 5AK5A 1FFVA 2ZTEA 2ZXHA 5AM1A 1A77A 1TAMA 1XNSA 1V85A 3QUCA 4KLSA 2A19A 2FPKA 3PSIA 5AI8A 4KTQA 3MABA 5TZVA 1SL2A 5DB9A 1B22A 2RDJA 2K8BB 2GOLA 1BPXA 1X40A 2EZXA 4UBBA 4DFPA 4I2JA 5AM4A 3M7DA 9ICUA 2ODGA 3NGDA 2W9AA 4PHEA 5EE3A 2Q0ZX 1V38A 2W9BB 3RJEA 2ZIVA 4IRDA 2ZJ8A 4DSKA 3RH4A 4MFCA 2OH2A 4Y2VA 1CRXA 2JRZA 1AROP 1A76A 3M8RA 3V6KA 4FS2A 5IIIA 4R64A 2CXYA 4QIWC 2R8GA 2JEIA 2FE9A 4RNOA 4YP3A 1B43A 3NASA 1O08A 4C8MA 4CE6A 1KLNA 1ZQPA 1LV5A 5DG7A 2LYBA 5C0YA 4DOBA 4O5CA 2BCUA 5HMLA 1T7PA 3AQEA 3T3FA 5ALIA 3CRXA 5L9XA 8ICJA 3SR6A 3LYSA 4Y2TA 3RR7A 3AU6A 4FZLA 3F2BA 2WB1F 4Y2JA 1XU4A 1HIWA 3KZIU 1JIHA 3HJEA 5AKGA 2ZG6A 5ALSA 3QYPA 5G5GA 5KT7A 3C5FA 3HP6A 3RRGA 2KHQA 2K4HA 1XC9A 3EW9A 2CN1A 5KG7A 1S0NA 3L4PA 4QWBA 3GU3A 1X9WA 2F44A 8ICPA 8ICWA 1A6SA 5D4BA 1U49A 3RB3A 1U45A 2BDUA 2KOBA 2AQ4A 1YZ6A 3ONNA 1J2NA 5KT3A 7ICMA 5ALYA 3PNCA 4KLUA 4B9VA 4YN4A 9ICHA 1RYRA 3QUBA 3EPIA 5ALNA 1WYGA 2W8LA 8ICRA 4QWEA 2BPCA 2KVCA 1Z00A 3KHGA 1N61A 5KG5A 3RRHA 2NRWA
chains in the Genus database with same CATH topology
2JV3A 1COKA 3BQ7A 3SENA 4RQMA 2E8NA 2QB1A 1SGGA 5JRTA 2EAPA 5L1MA 1PK1B 2EAOA 1RG6A 2FE9A 5JU5A 2E8PA 5J8YC 4PZOA 2F8KA 2F3NA 4RQNA 2KG5A 1SV0A 2LPEA 2YTUA 2DKXA 2D8CA 1KW4A 3TADC 2KIVA 2K60A 3BS5B 3SEIA 1UQVA 2QB0B 4NJ8A 1SV0C 2ES6A 2K4PA 1OXJA 1F0MA 4PZNA 2EANA 1OW5A 1LKYA 1X9XA 1WWUA 2DL0A 1WWVA 1JI7A 4MHVA 3TADA 1SXDA 1PK3A 3K1RB 3KKAC 2QARA 2KSOA 3BS5A 2QB0A 5JTIA 3BS7A 1V85A 1X66A 3TACB 4IS7A 1DXSA 1Z1VA 2L5YA 4NL9A 1B4FA 2F44A 1SV4A 2DKZA 2E8OA 1LKYB 1X40A 2D3DA 5F3XB 2EAMA 2GLEA 2QKQA 5J8YA 3HILA 2LMRA 2KE7A 1SXEA 2Y9TA 1PK1A 2QARB 4NL9C 2KMDA 2KSOB 2B6GA 2E8MA 1B0XA 3H8MA 1V38A 3IDWA 3KKAA 2Y9UA 2ESEA 1UCVA 5KNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV3 A;  1COK A;  3BQ7 A;  3SEN A;  4RQM A;  2E8N A;  2QB1 A;  1SGG A;  5JRT A;  2EAP A;  5L1M A;  1PK1 B;  2EAO A;  1RG6 A;  2FE9 A;  5JU5 A;  2E8P A;  5J8Y C;  4PZO A;  2F8K A;  2F3N A;  4RQN A;  2KG5 A;  1SV0 A;  2LPE A;  2YTU A;  2DKX A;  2D8C A;  1KW4 A;  3TAD C;  2KIV A;  2K60 A;  3BS5 B;  3SEI A;  1UQV A;  2QB0 B;  4NJ8 A;  1SV0 C;  2ES6 A;  2K4P A;  1OXJ A;  1F0M A;  4PZN A;  2EAN A;  1OW5 A;  1LKY A;  1X9X A;  1WWU A;  2DL0 A;  1WWV A;  1JI7 A;  4MHV A;  3TAD A;  1SXD A;  1PK3 A;  3K1R B;  3KKA C;  2QAR A;  2KSO A;  3BS5 A;  2QB0 A;  5JTI A;  3BS7 A;  1V85 A;  1X66 A;  3TAC B;  4IS7 A;  1DXS A;  1Z1V A;  2L5Y A;  4NL9 A;  1B4F A;  2F44 A;  1SV4 A;  2DKZ A;  2E8O A;  1LKY B;  1X40 A;  2D3D A;  5F3X B;  2EAM A;  2GLE A;  2QKQ A;  5J8Y A;  3HIL A;  2LMR A;  2KE7 A;  1SXE A;  2Y9T A;  1PK1 A;  2QAR B;  4NL9 C;  2KMD A;  2KSO B;  2B6G A;  2E8M A;  1B0X A;  3H8M A;  1V38 A;  3IDW A;  3KKA A;  2Y9U A;  2ESE A;  1UCV A;  5KNI A; 
#chains in the Genus database with same CATH topology
 2YY6 A;  9ICK A;  1HEK A;  2G0A A;  1ZET A;  2XCA A;  5BOL A;  3RJI A;  4ED2 A;  3QNM A;  3DDH A;  5J2C A;  2D6F C;  9ICG A;  3ZDC A;  2WHE A;  2ZUC A;  2YQE A;  1N2X A;  4NLN A;  2YMQ A;  3V7L A;  2E1E A;  3KTQ A;  4F5R A;  4C80 A;  2UVR A;  1NK0 A;  4Q8F A;  2KTQ A;  1KEJ A;  3SD7 A;  2HCF A;  4RQ6 A;  4ECY A;  3RBE A;  1NJW A;  1ZQS A;  5D49 A;  1NI3 A;  3PR4 A;  2NRZ A;  2XC9 A;  4RQ1 A;  7ICG A;  4UAV A;  2PMZ F;  3I76 A;  5KG2 A;  1F44 A;  2W43 A;  3QUT A;  4M9L A;  4MF8 A;  3N4M B;  1L7O A;  2KVS A;  3MR2 A;  1VDV A;  3T5H A;  5HR6 A;  5KFQ A;  2PFN A;  2XGQ A;  3M9O B;  1ZQQ A;  1SXD A;  5AKX A;  1XS9 D;  1RXW A;  4GFJ A;  3GDX A;  3V7K A;  2CPR A;  5J0S A;  3WK6 A;  3MR3 A;  5GTI U;  2L5Y A;  4GIB A;  1L7P A;  1PVP A;  1SV4 A;  1ZQB A;  3C1Y A;  1UPH A;  1RM6 C;  4P4O A;  9ICI A;  3PSF A;  2XIC A;  3JPP A;  2V9W A;  8ICX A;  5ALV A;  2ZIX B;  4PGY A;  5EE9 A;  5KFB A;  2JXJ A;  3ICX A;  4O3N A;  5KG0 A;  5DDY A;  4PHP A;  2J6U A;  5J0W A;  5KG4 A;  1IIP A;  1ZQX A;  4U7C A;  4QZA A;  1NJY A;  2BQR A;  1NK4 A;  1ZQ1 C;  4FFD A;  1N62 A;  2JV3 A;  2WF8 A;  4PH5 A;  3SZ2 A;  1KDH A;  1CUK A;  2WF5 A;  2PFQ A;  2XY5 A;  5JRT A;  5JU5 A;  4QNL A;  1NOM A;  2JZB B;  2F8K A;  3EYZ A;  5J0Q A;  3M8S A;  2YTU A;  2PFO A;  5ALF A;  4I2A A;  3RB4 A;  4ELV A;  1UQV A;  1KBU A;  2VA2 A;  5KFN A;  2HW3 A;  1ZQT A;  4EEK A;  4BXO A;  2KV2 A;  2K4P A;  1F0M A;  3RJK A;  3WK7 A;  1X9S A;  4RZR A;  1TVA A;  1VJ5 A;  3WU2 U;  9ICF A;  4DFJ A;  3NTU A;  3UM9 A;  3FAH A;  4KMO B;  2MUT A;  2KIC A;  4F50 A;  5ALX A;  3SAH A;  4PHA A;  2PFP A;  4K4I A;  3NRZ A;  4C8O A;  3K75 D;  1WCN A;  1Q8K A;  2A1A A;  1X9M A;  1QQ6 A;  1Z1V A;  2VKQ A;  1TK8 A;  2JH1 A;  4RT3 A;  3MDC A;  4FBU A;  5AIA A;  3CNH A;  4AYB C;  4JMU A;  2D3D A;  4JB3 A;  2VJ4 A;  3WK9 A;  1ZQN A;  3WKC A;  2OXO A;  5ALO A;  4RQ7 A;  8ICG A;  5KT5 A;  4I29 A;  3EUB 2;  2PKE A;  5GTH U;  4LZG A;  4QW9 A;  5ALR A;  2Y9U A;  4B9M A;  1BPE A;  2VA3 A;  5HNK A;  5HMM A;  4QZI A;  4I2I A;  4Q44 A;  3PW5 A;  1ZQE A;  3UPQ A;  2IHN A;  1SWW A;  3TFS A;  1RG6 A;  5CHG A;  3RBD A;  2F3N A;  4RQN A;  4NWI A;  4M6W B;  3MGV A;  1MQ2 A;  1SZP A;  2W9M A;  2HMX A;  1SV0 A;  5KFT A;  4UB4 A;  4DSJ A;  3IN5 A;  1KFD A;  4ED0 A;  2D8C A;  1L8O A;  5CRX A;  4EEY A;  4DQP A;  1N5X A;  8ICN A;  4YG2 A;  4DSE A;  7ICF A;  2PMZ C;  3T79 A;  1SL1 A;  3N7P D;  4GC6 A;  5AM0 A;  3E58 A;  4DS4 A;  1NK6 A;  5DB8 A;  1OXJ A;  4NLZ A;  3BDP A;  4KX5 A;  4F93 B;  4GLX A;  3M6Z A;  1WWU A;  4F92 B;  2HBM A;  4F3O A;  4Z6E A;  3AQF A;  4RUC A;  1ZD4 A;  3V72 A;  5J2D A;  4QZC A;  3T5K A;  2QAR A;  4PPX A;  4OJ6 A;  3G6Y A;  1KN5 A;  2W04 A;  5KFH A;  4UW9 A;  3HRD D;  5AKE A;  1BPD A;  4BXO B;  1X66 A;  3B9J A;  3IM1 A;  5KFX A;  1ZQI A;  5J2J A;  1Z00 B;  4E0D A;  1XSP A;  4PL1 A;  3QU4 A;  1ZQR A;  1NKE A;  3IRU A;  2GLE A;  2H3I A;  3OGU A;  3HKZ C;  4PGQ A;  4DL3 A;  2KN7 A;  4IR9 A;  5ALJ A;  2DPI A;  3GIM A;  4JWM A;  3U26 A;  9ICA A;  1X42 A;  1COO A;  1QTM A;  4I2D A;  3LK9 A;  4YMN A;  4M9N A;  4DEZ A;  1JX4 A;  1JUD A;  2FJ6 A;  7ICN A;  4ED6 A;  2FLP A;  4IR1 A;  1NK9 A;  7ICH A;  2DQN B;  3QU9 A;  1RPL A;  3BQ7 A;  5AM2 A;  1UA0 A;  3C5G A;  2QB1 A;  3QUQ A;  4Q45 A;  3IG8 A;  3AM9 A;  3H4B A;  3RH5 A;  4O3S A;  4FS1 A;  1D8B A;  2NRT A;  4B9U A;  4JUZ A;  1MN8 A;  5IIM A;  2IA6 A;  3Q8S B;  4KMU A;  3FC4 A;  3HPO A;  4M9J A;  3H8S A;  5AI5 A;  1F5S A;  5DBC A;  5AIB A;  4IRC A;  1DK3 A;  3PSP A;  4PZN A;  4LJX A;  1SIJ A;  4OJO A;  3C29 A;  3LDA A;  4KX3 A;  4JV0 A;  5ALM A;  1U48 A;  1JRP A;  5A0L A;  2E1F A;  3OSN A;  2EZZ A;  4JV1 A;  3BQ2 A;  2HOF A;  3DV9 A;  5JUM A;  3H8J A;  2BDP A;  4C4T A;  3E2E A;  4IS7 A;  3ETL A;  4C8K A;  5CEH A;  3ZDE A;  3SQI A;  3BJY A;  4F5Q A;  4Q43 A;  1ZD5 A;  3JPR A;  1BVS A;  2BPF A;  3MBY A;  2HHX A;  4QWC A;  5AK6 A;  1MC8 A;  4XRH A;  4ECV A;  2IHM A;  4UQG A;  5DBA A;  3OPX A;  3NRW A;  2I6X A;  2HBJ A;  5J29 A;  2JEG A;  1NZB A;  1NZP A;  2FLL A;  5KAF U;  4K4H A;  1ZQZ A;  7ICV A;  4P4M A;  5DGA A;  2XI9 A;  2WF9 A;  2DUY A;  2AXT U;  2V4Q A;  3M9N B;  1BNP A;  4QZ8 A;  5C5J A;  4YMM A;  2BCV A;  4NM1 A;  2ZIU B;  4KLO A;  4UB6 U;  2C2E A;  4XA5 A;  3QXG A;  4IC9 A;  3VCB A;  5B66 U;  4RQ5 A;  3TFR A;  1NKC A;  2LKY A;  4O0I A;  5KFF A;  5BPC A;  3SI8 A;  3RJH A;  2PI5 A;  3KD3 A;  1FFU A;  3TAP A;  2OM6 A;  2BPG A;  2ISO A;  2CRX A;  4KN4 A;  5CB1 A;  4BGD A;  1TV9 A;  4YR0 A;  5DG8 A;  4J9L A;  4X5V A;  4Z6C A;  4YVZ A;  2AU0 A;  3MR6 A;  1X9X A;  2HSZ A;  4RPY A;  1WWV A;  4C8N A;  2RHF A;  2RLT A;  2IOH A;  1Z3E B;  3EZ5 A;  5DGB A;  2HDO A;  1RYU A;  4DS5 A;  8ICA A;  1DGS A;  2W9C B;  1LVH A;  5KFK A;  2F8L A;  1ZQM A;  4OD0 A;  4TQR A;  4ACO A;  4ECX A;  3F53 A;  4QZF A;  4I2F A;  4DO9 A;  1ZD3 A;  1IM4 A;  1TFR A;  2WTF A;  1QQ5 A;  8ICI A;  3RAQ A;  4KLE A;  4EYH B;  4DL5 A;  4CF4 A;  2LYH A;  2AGP A;  5F9L A;  5J0Y A;  4YFK A;  5KNI A;  1IXR A;  5KT4 A;  4P0Q A;  3PW2 A;  2KFZ A;  4MF2 A;  3SMV A;  2EQY A;  4U6P A;  1RZT A;  3BQT A;  3OTQ A;  3PW7 A;  3Q8K A;  1DOQ A;  1UA1 A;  5ALZ A;  1SB3 C;  2H3F A;  2LHT A;  2KG5 A;  4IRK A;  3NVZ A;  4NLC A;  3PR5 B;  4YR2 A;  1X2I A;  4F72 A;  7ICO A;  3RF9 A;  3QE9 Y;  3RH6 A;  3TAR A;  4Y2S A;  3CYM A;  4DQI A;  2P6R A;  2LYA A;  4US9 A;  5IIJ A;  2HHQ A;  3ZDD A;  2ES6 A;  3H4D A;  5ALW A;  1AQ6 A;  1EXN A;  4IL6 U;  9ICX A;  3M1Y A;  4M6W A;  2YML A;  2XGP A;  4BWM A;  2JEF A;  1T94 A;  4LZD A;  8ICL A;  4CF5 A;  2WF6 A;  4I28 A;  2QB0 A;  4ZH4 A;  5JTI A;  4F71 A;  3PX6 A;  4O3Q A;  1JRO A;  2AH5 A;  5KFU A;  3M9M B;  2ALZ A;  7ICR A;  2BKE A;  1JXE A;  1UT5 A;  3UXP A;  8ICT A;  3GFK B;  3UMB A;  2ZTD A;  4OCZ A;  4MEX A;  4C4R A;  3Q8Q B;  5KFY A;  5KG1 A;  2Y9T A;  2HHW A;  4NLG A;  4DQQ A;  5KFM A;  5AKH A;  7ICU A;  1ZD2 P;  5EE0 A;  1U9L A;  2EDU A;  4P2H A;  8ICM A;  1NNL A;  3MGI A;  4KN7 A;  1ZJM A;  4ECW A;  8ICF A;  2UVV A;  2KP7 A;  2W3R A;  4YXJ A;  8ICZ A;  5HHH A;  4IQV A;  3KHH A;  4PJ0 U;  3SEN A;  2E8N A;  2IMW P;  9ICE A;  4YR3 A;  4QWA A;  3C28 A;  4RT2 A;  1U4B A;  5ALH A;  5ALU A;  5K4L A;  4DQS A;  4F91 B;  4I2H A;  1PVQ A;  4J9M A;  3TAD C;  2KZM A;  2K60 A;  3WKA A;  1QSY A;  7ICE A;  3BS5 B;  5B5E U;  4KIT B;  5ALT A;  4UAU A;  5L1L A;  3NVW A;  5J0U A;  3PY8 A;  4I27 A;  2JH7 A;  4NLB A;  5J0P A;  1Y88 A;  2A3V A;  4M04 A;  2XVT A;  4EZ6 A;  3OJS A;  2FMQ A;  5HP4 A;  3RB6 A;  4EBD A;  2PXI A;  2BQU A;  3K4G A;  3WK4 A;  3K1R B;  1ZYQ A;  2BHN A;  5KFA A;  4O9M A;  3IP4 B;  2Z7J A;  4K4G A;  3QU5 A;  2JHD A;  4I2C A;  1TK5 A;  2BCR A;  4F2S A;  5ALD A;  4C7Z A;  4O5E A;  1DXS A;  2G09 A;  3L3F X;  4QZB A;  2ISP A;  2K89 A;  4DFK A;  2KJ5 A;  4NXZ A;  3SV3 A;  1URJ A;  2E8O A;  2YMM A;  5J2E A;  2FMS A;  4B9T A;  4FE3 A;  3PMN A;  3N28 A;  1SXE A;  4QWD A;  3PZP A;  3WK5 A;  1ED1 A;  3Q8L A;  4PL2 A;  3KHR A;  3UQ0 A;  4GXI A;  3KKA A;  4JK1 A;  3BQ0 A;  3ORY A;  4F5N A;  3OJU A;  3WK8 A;  5J0T A;  4O5K A;  4YCX A;  4EX6 A;  2F77 X;  2GH1 A;  4DFM A;  3GZF A;  3N7S C;  1P7D A;  1ZQA A;  2DF4 B;  4TUS A;  1XO1 A;  1HUZ A;  2DPJ A;  4UB3 A;  2EAP A;  2YX8 A;  1SKR A;  4UB2 A;  1ZQU A;  8ICE A;  1O03 A;  5J2F A;  4KLF A;  1Z4O A;  2KZZ A;  5AHX A;  1C7Y A;  3UQ2 A;  2XO7 A;  5KTQ A;  3QU7 A;  2OHF A;  1KW4 A;  1L7N A;  4R65 A;  1BPZ A;  5AKI A;  5EWE A;  1L8L A;  5IIN A;  3PW4 A;  2HVH A;  2DGZ A;  1TK0 A;  2K4E A;  4NJ8 A;  3UXO A;  9ICR A;  3Q8R B;  1SV0 C;  1OUQ A;  1SL0 A;  1XO0 A;  1Z1B A;  4M47 A;  1L3S A;  4EEN A;  3KZX A;  2W3S A;  4O3M A;  3AN1 A;  1QLN A;  1J97 A;  5FP0 A;  4Z6F A;  5KFG A;  4QJF B;  2ASD A;  4MHV A;  2K8A A;  1S10 A;  4EBE A;  2ZIW A;  2BQ3 A;  4Y2Y A;  3C2L A;  3G6V A;  1ZQG A;  3GII A;  4M9H A;  4Y2Q A;  4OJP A;  1XSL A;  3ETR A;  2HOQ A;  1BNO A;  4QZD A;  1JMS A;  2EZY A;  3TAQ A;  2H5X A;  4DLG A;  4Y2X A;  2VA8 A;  3B0Y A;  3EWA A;  1WCL A;  1KTQ A;  2B0C A;  4Q8E A;  4O3P A;  5D46 A;  1X6J A;  1BGX T;  1CI4 A;  3A0H U;  2EAM A;  4RPZ A;  2QKQ A;  5DG9 A;  2ZXI A;  4J03 A;  3OSP A;  2KHV A;  3GV5 B;  1GO3 F;  4DF8 A;  2LM4 A;  3OHB A;  2W11 A;  2K4I A;  2R8J A;  4J9R A;  7ICL A;  1FO4 A;  2IBK A;  1V97 A;  5DQG A;  2HVI A;  1S97 A;  5EE1 A;  4KLQ A;  2Y1I A;  4KLJ A;  5J2B A;  3MFI A;  8ICY A;  4CDG A;  4NLK A;  3NUQ A;  2F1I A;  1M6Y A;  8ICU A;  2UVW A;  4RPX A;  2XY6 A;  5J8Y C;  4US8 A;  4DL2 A;  5KFV A;  2I1Q A;  4MFA A;  9ICQ A;  4QZ9 A;  1L6N A;  2HI0 A;  1NJZ A;  2KZ3 A;  2YB1 A;  8ICO A;  4R63 A;  3HT3 A;  3KOO A;  3BZC A;  4J9O A;  4ECZ A;  3GQC A;  3F5E A;  2KK0 A;  3CP8 A;  3AU2 A;  4YQW A;  2IOF A;  5KL8 B;  3MDA A;  4EEL A;  3H8W A;  3RJJ A;  4UAW A;  5L1K A;  2AJQ A;  4HAI A;  1MSW D;  2MA1 A;  1L3T A;  3HW8 A;  1K5O A;  7ICJ A;  3IV6 A;  2YN4 A;  3KKA C;  5KFS A;  1ZRM A;  4F4Z A;  1JAL A;  3TAN A;  2V4R A;  5J0O A;  2G07 A;  3LWM A;  4ZOH C;  2F1J A;  4UB8 U;  8ICV A;  2I5H A;  3TQ1 A;  4B9S A;  4GC7 A;  2Y0S F;  4ECR A;  5F9N A;  2Y1J A;  2KFN A;  1IG6 A;  4J9Q A;  1TAU A;  3KBB A;  2DKZ A;  2KIW A;  2QLT A;  1ZXI A;  4YMO A;  1DK2 A;  1ZQK A;  3HIL A;  4Z6D A;  2HBL A;  2FMP A;  1DGJ A;  4BUG A;  3KFU F;  2XID A;  4I2G A;  2IOF K;  4P0P A;  1XSN A;  3IDW A;  3JPS A;  2P66 A;  4RU9 A;  5KAI U;  8ICK A;  1T3Q A;  3AEV A;  5E79 U;  4HYK A;  4DQR A;  5J2A A;  4QIW F;  1COK A;  4KLH A;  9ICC A;  4A8E A;  3QEB Z;  1SGG A;  2W55 A;  3GV8 B;  3K1Z A;  2BCQ A;  4M0A A;  2C2R A;  4DL4 A;  2G06 A;  1T3N A;  5HHI A;  1ZQH A;  1L7M A;  3C1Z A;  2F76 X;  2KNJ A;  1JXL A;  2C28 A;  1JN3 A;  1CEZ A;  2I9G A;  4ED8 A;  5DBB A;  2XY7 A;  5AK3 A;  5AKK A;  5J2G A;  1UT8 A;  4RQ3 A;  4NM2 A;  1TAQ A;  2G5H B;  4F4Y A;  5KFO A;  4EYI B;  1N56 A;  1ZRN A;  2H3Q A;  3RAX A;  4BJQ A;  3QZ8 A;  4ELT A;  1OW5 A;  3ISC A;  3T5J A;  2NYV A;  4FBT A;  4DSI A;  8ICQ A;  2W7P A;  4USA A;  3TAD A;  2C22 A;  1XWL A;  4BX9 C;  4KLM A;  2KSO A;  3TKA A;  3C2M A;  4UAZ A;  3SV4 A;  2EH9 A;  4CGZ A;  4C7Y A;  3TAC B;  3H0L B;  2J6S A;  1RQN A;  4OJL A;  7ICT A;  4UAT A;  1D9D A;  5EWG A;  1T4G A;  1SKW A;  2G08 A;  5DB6 A;  3NVY A;  1QSL A;  1ZJN A;  3V6H A;  3WKE A;  2KE7 A;  4EX7 A;  2YMP A;  3RTV A;  2ASL A;  2KKP A;  2W54 A;  4NL9 C;  2B6G A;  3C23 A;  3AMZ A;  4IQW A;  1B0X A;  2HBK A;  2WAQ C;  2BR0 A;  3V7J A;  3GV7 B;  2KJ9 A;  4KLG A;  4XQ8 A;  4DSL A;  1ECW A;  5AI4 A;  5CP2 A;  4RQ2 A;  2HHT A;  1UCV A;  4QZE A;  5KG3 A;  2A1J A;  5TIS U;  2OCE A;  1TKD A;  1QQ7 A;  2F2A B;  2WFA A;  4B9L A;  3UXN A;  1S0V A;  4RQM A;  2WB1 C;  2VJ5 A;  4TUQ A;  1KRP A;  2LI6 A;  1N48 A;  4RUA A;  2VAN A;  5KL1 B;  2FPM A;  2H3Z A;  5AKJ A;  4O3R A;  3V6J A;  5EWF A;  4FO6 A;  3L5K A;  8ICS A;  5DQI A;  3THV A;  2LM1 A;  3H7I A;  5ALP A;  2W8K A;  4NV0 A;  5EOZ A;  1L5U A;  3QEA Z;  4R66 A;  1FEZ A;  5DDM A;  2HHS A;  2ZUD A;  4QZH A;  1UHU A;  4M9G A;  9ICT A;  1WUD A;  3ISD A;  3PO4 A;  8ICC A;  3ZDB A;  3B0X A;  4KLL A;  4MEY A;  4TQS A;  4ED3 A;  4B9N A;  3SYZ A;  2OEH A;  3CW2 C;  2P35 A;  5DKW A;  5AIC A;  1K1S A;  5J0R A;  2GWS A;  5AKL A;  4NL9 A;  5KFW A;  1S0O A;  9ICL A;  3QX7 A;  2NRV A;  2ZJ5 A;  3SAF A;  2JEJ A;  4F2R A;  2LMR A;  3LVW A;  2Q4T A;  2ZJA A;  4TUP A;  1PK1 A;  2ASJ A;  4RQ0 A;  2KEY A;  2NO5 A;  3ISB A;  1NK7 A;  3IG5 A;  5L1I A;  2E8M A;  4WJ3 B;  9ICS A;  7ICP A;  4DLE A;  2ESE A;  4OJ5 A;  3LVV A;  4P4P A;  2HOI A;  3I28 A;  4TUR A;  2N1R A;  3MGH A;  7ICI A;  3JPN A;  4GXJ A;  4QW8 A;  4DF4 A;  2W03 A;  5DB7 A;  9ICM A;  1KFS A;  2EAO A;  4CF3 A;  1V9P A;  3GIJ A;  4NY8 A;  1RDF A;  4PZO A;  2LBO A;  2ATL A;  2MRL A;  4DSF A;  2E3T A;  3T5L A;  2BZF A;  1S76 D;  4RNM A;  2DKX A;  2ZUB A;  2OWO A;  4UB1 A;  1ZQF A;  4I2B A;  2KIV A;  3ZDA A;  2AGQ A;  1TE2 A;  2A1J B;  3NS1 A;  3BQ1 A;  2NV3 A;  3I1Y A;  4IQT A;  3OHA A;  5KT6 A;  3RFA A;  5IIO A;  4F5P A;  4J9N A;  2ZIU A;  2DFL A;  2EAN A;  2JGA A;  3GIL A;  4B6J A;  1LB2 B;  9ICN A;  1BPB A;  3UMC A;  1JI7 A;  4PGX A;  4DL6 A;  3WKD A;  4KLT A;  4RQ4 A;  4PHD A;  2BCS A;  1D8L A;  2FPL A;  2JR5 A;  4P0P B;  1S77 D;  4DCC A;  3H40 A;  3BS7 A;  3DEE A;  3FDS A;  9ICW A;  8ICH A;  3FYH A;  3QZ7 A;  4G9B A;  3QU2 A;  1J2M A;  5KFD A;  2RQ5 A;  5ALQ A;  3Q8M A;  2MU2 A;  2NO4 A;  1LKY B;  5F3X B;  3ZD8 A;  1Q46 A;  3M6K A;  5DLF A;  9ICO A;  2WAQ F;  3D2N A;  3EPG A;  3HWT A;  3RR8 A;  2QAR B;  3C21 A;  1PUZ A;  4ECU A;  3ZI4 A;  4I2E A;  4MFF A;  2W9C A;  3PX0 A;  4UAY A;  2NRX A;  5KFJ A;  2WF7 A;  3N7R C;  4ELU A;  4GXK A;  4FZM A;  5AK4 A;  2RP5 A;  4YD2 A;  5AM3 A;  4DFD A;  9ICV A;  3A0B U;  3E0F A;  1T8E A;  1A0P A;  1N5W A;  5KFL A;  2M9N A;  1BPY A;  1KFT A;  1SZH A;  3PML A;  1NK8 A;  1X6I A;  3PO5 A;  7ICS A;  2ZIX A;  1SKS A;  2LPE A;  3J81 j;  5KG6 A;  3S6J A;  3H0R B;  3SEI A;  9ICJ A;  4RQ8 A;  3RB0 A;  4P0Q B;  3PX4 A;  4J9K A;  1L3V A;  2M0N A;  4JWN A;  4AYB F;  1YT3 A;  3C2K A;  5KFZ A;  1QSS A;  3D6J A;  1LKY A;  3F5A A;  2B21 A;  5DLG A;  1KL9 A;  4F4K A;  1PK3 A;  2YB4 A;  4FZN A;  4LVS A;  3G6X A;  2R8H A;  1NKB A;  1PZN A;  2R18 A;  4ECT A;  2E5S A;  1H38 A;  1ZQW A;  4CNQ A;  5L1J A;  2K8C B;  5CWR A;  5J0X A;  7ICK A;  3D2Q A;  3O0F A;  5G5H A;  3HKZ F;  2F1H A;  1HUO A;  5AI6 A;  2PI4 A;  5J8Y A;  4ICA A;  3Q8P B;  4OO1 J;  3TI0 A;  3H0M B;  1IV8 A;  4J9P A;  4BDP A;  2KMD A;  2KSO B;  1KSP A;  2FI1 A;  4M2Y A;  2G5I B;  3H8M A;  1C20 A;  5ALE A;  1VLB A;  4KLD A;  5J2K A;  2MAX A;  1ZQV A;  1MA7 A;  4EBC A;  1K1Q A;  5DQH A;  3AL0 B;  5KT2 A;  1S8O A;  1ZQD A;  2R8I A;  1KKX A;  5ALK A;  3JPQ A;  3MFH A;  4CCH A;  5HR7 A;  5ALG A;  4J9S A;  3F2C A;  3SAG A;  1S5L U;  5CJ7 A;  2BGW A;  7ICQ A;  1QH9 A;  2JMG A;  2RRD A;  2KKV A;  1D8Y A;  3BZK A;  4IQU A;  1L3U A;  2R8K A;  3PV8 A;  3HX0 A;  4ECS A;  4UB5 A;  4Y2R A;  1RYS A;  1Z4N A;  3NVV A;  9ICB A;  1YZ7 A;  4F4W A;  2VIX A;  3MC1 A;  5IIK A;  3KHL A;  5J2I A;  3ALR A;  2AQ0 A;  3IHQ B;  2AGO A;  4ECQ A;  4DL7 A;  4YD1 A;  3D2S A;  4JV2 A;  4UAS A;  3GIK A;  5AKY A;  3UMG A;  4C8L A;  5CA7 A;  3BS5 A;  1HJP A;  2W9B A;  1ZQL A;  2ZIV B;  1DRG A;  1NK5 A;  2AHO B;  1S9F A;  4G3I A;  4QZG A;  4YXM A;  4XUS A;  3MR5 A;  1B4F A;  3VC8 A;  3N97 B;  2RDI A;  2MSN A;  9ICP A;  1SWV A;  2J6T A;  3WKB A;  2DWQ A;  4UAR A;  2FDR A;  3PST A;  4DOA A;  3AUO A;  1ZQY A;  4RNN A;  4Y2U A;  4R8U A;  2GO7 A;  3PW0 A;  1ZQO A;  2H3V A;  4C4S A;  5KFP A;  1PVR A;  1RXV A;  5CR0 A;  5AM5 A;  4O3O A;  4BWJ A;  3FM9 A;  2UVU A;  4F8R A;  2W7O A;  2Y0S C;  3PVX A;  3F2D A;  8ICB A;  5KFI A;  1N60 A;  1FIQ A;  4KLI A;  4Y2P A;  5KFC A;  1Q3V A;  5L1M A;  1PK1 B;  1ZQJ A;  2E8P A;  3RJF A;  1ZQC A;  3RJG A;  2HHU A;  1Z19 A;  2ZIW B;  5H2F U;  4DOC A;  2HHV A;  2MUT B;  4ED7 A;  1N63 A;  1ZOL A;  3R9K A;  5T14 A;  1NJX A;  1KQQ A;  2QB0 B;  1S0M A;  2OYY A;  5ALL A;  1Q3U A;  5AI9 A;  1RQL A;  3ZD9 A;  5IIL A;  2KJ8 A;  3LWL A;  5AI0 A;  4ED1 A;  2O6K A;  2C2D A;  4F4X A;  5BOM A;  4F5O A;  4DWI A;  4EZ9 A;  1QCK A;  3ED5 A;  3JPT A;  4AP9 A;  1D9F A;  2KD1 A;  5KFE A;  5KFR A;  1MQ3 A;  4C0Z A;  2P6U A;  2DL0 A;  4UBC A;  2DBY A;  2JZB A;  2FLN A;  5AKZ A;  4R8U B;  1WG8 A;  2XCP A;  5J2H A;  2ZTC A;  3JPO A;  4CRX A;  1U47 A;  5AK5 A;  1FFV A;  2ZTE A;  2ZXH A;  5AM1 A;  1A77 A;  1TAM A;  1XNS A;  1V85 A;  3QUC A;  4KLS A;  2A19 A;  2FPK A;  3PSI A;  5AI8 A;  4KTQ A;  3MAB A;  5TZV A;  1SL2 A;  5DB9 A;  1B22 A;  2RDJ A;  2K8B B;  2GOL A;  1BPX A;  1X40 A;  2EZX A;  4UBB A;  4DFP A;  4I2J A;  5AM4 A;  3M7D A;  9ICU A;  2ODG A;  3NGD A;  2W9A A;  4PHE A;  5EE3 A;  2Q0Z X;  1V38 A;  2W9B B;  3RJE A;  2ZIV A;  4IRD A;  2ZJ8 A;  4DSK A;  3RH4 A;  4MFC A;  2OH2 A;  4Y2V A;  1CRX A;  2JRZ A;  1ARO P;  1A76 A;  3M8R A;  3V6K A;  4FS2 A;  5III A;  4R64 A;  2CXY A;  4QIW C;  2R8G A;  2JEI A;  2FE9 A;  4RNO A;  4YP3 A;  1B43 A;  3NAS A;  1O08 A;  4C8M A;  4CE6 A;  1KLN A;  1ZQP A;  1LV5 A;  5DG7 A;  2LYB A;  5C0Y A;  4DOB A;  4O5C A;  2BCU A;  5HML A;  1T7P A;  3AQE A;  3T3F A;  5ALI A;  3CRX A;  5L9X A;  8ICJ A;  3SR6 A;  3LYS A;  4Y2T A;  3RR7 A;  3AU6 A;  4FZL A;  3F2B A;  2WB1 F;  4Y2J A;  1XU4 A;  1HIW A;  3KZI U;  1JIH A;  3HJE A;  5AKG A;  2ZG6 A;  5ALS A;  3QYP A;  5G5G A;  5KT7 A;  3C5F A;  3HP6 A;  3RRG A;  2KHQ A;  2K4H A;  1XC9 A;  3EW9 A;  2CN1 A;  5KG7 A;  1S0N A;  3L4P A;  4QWB A;  3GU3 A;  1X9W A;  2F44 A;  8ICP A;  8ICW A;  1A6S A;  5D4B A;  1U49 A;  3RB3 A;  1U45 A;  2BDU A;  2KOB A;  2AQ4 A;  1YZ6 A;  3ONN A;  1J2N A;  5KT3 A;  7ICM A;  5ALY A;  3PNC A;  4KLU A;  4B9V A;  4YN4 A;  9ICH A;  1RYR A;  3QUB A;  3EPI A;  5ALN A;  1WYG A;  2W8L A;  8ICR A;  4QWE A;  2BPC A;  2KVC A;  1Z00 A;  3KHG A;  1N61 A;  5KG5 A;  3RRH A;  2NRW A; 
#chains in the Genus database with same CATH homology
 2JV3 A;  1COK A;  3BQ7 A;  3SEN A;  4RQM A;  2E8N A;  2QB1 A;  1SGG A;  5JRT A;  2EAP A;  5L1M A;  1PK1 B;  2EAO A;  1RG6 A;  2FE9 A;  5JU5 A;  2E8P A;  5J8Y C;  4PZO A;  2F8K A;  2F3N A;  4RQN A;  2KG5 A;  1SV0 A;  2LPE A;  2YTU A;  2DKX A;  2D8C A;  1KW4 A;  3TAD C;  2KIV A;  2K60 A;  3BS5 B;  3SEI A;  1UQV A;  2QB0 B;  4NJ8 A;  1SV0 C;  2ES6 A;  2K4P A;  1OXJ A;  1F0M A;  4PZN A;  2EAN A;  1OW5 A;  1LKY A;  1X9X A;  1WWU A;  2DL0 A;  1WWV A;  1JI7 A;  4MHV A;  3TAD A;  1SXD A;  1PK3 A;  3K1R B;  3KKA C;  2QAR A;  2KSO A;  3BS5 A;  2QB0 A;  5JTI A;  3BS7 A;  1V85 A;  1X66 A;  3TAC B;  4IS7 A;  1DXS A;  1Z1V A;  2L5Y A;  4NL9 A;  1B4F A;  2F44 A;  1SV4 A;  2DKZ A;  2E8O A;  1LKY B;  1X40 A;  2D3D A;  5F3X B;  2EAM A;  2GLE A;  2QKQ A;  5J8Y A;  3HIL A;  2LMR A;  2KE7 A;  1SXE A;  2Y9T A;  1PK1 A;  2QAR B;  4NL9 C;  2KMD A;  2KSO B;  2B6G A;  2E8M A;  1B0X A;  3H8M A;  1V38 A;  3IDW A;  3KKA A;  2Y9U A;  2ESE A;  1UCV A;  5KNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...