2E8MA

Solution structure of the c-terminal sam-domain of epidermal growth receptor pathway substrate 8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor kinase substrate 8
publication title Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18016 SAM_3 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8mA01
2QB0A 1SXDA 5KNIA 2LMRA 3TADA 3BQ7A 2Y9UA 1JI7A 2ESEA 2JV3A 5J8YA 4NL9C 1Z1VA 2EAOA 3K1RB 3SEIA 2QB1A 2YTUA 2B6GA 2EANA 1SV4A 2QB0B 2FE9A 1SV0A 1LKYA 4PZNA 3HILA 1X40A 3TADC 1V38A 1WWUA 5J8YC 2ES6A 1F0MA 1SXEA 1B0XA 4PZOA 4IS7A 2K4PA 2F3NA 3SENA 1LKYB 3H8MA 1UCVA 3BS7A 2Y9TA 1COKA 5JRTA 2F8KA 1PK3A 5JTIA 3BS5A 2EAMA 2DL0A 2QKQA 1B4FA 5L1MA 2LPEA 2KIVA 2E8MA 2KE7A 1V85A 2KSOA 2F44A 2E8OA 1X66A 1WWVA 4NL9A 4MHVA 3BS5B 2L5YA 1PK1A 2QARA 2KMDA 2DKZA 5F3XB 1OW5A 2KSOB 4NJ8A 1KW4A 1SV0C 2DKXA 3KKAA 1RG6A 1PK1B 2QARB 2D3DA 2E8PA 2D8CA 2E8NA 2GLEA 1SGGA 3IDWA 5JU5A 2KG5A 2EAPA 3TACB 1X9XA 1UQVA 1DXSA 2K60A 4RQNA 3KKAC 1OXJA 4RQMA
chains in the Genus database with same CATH superfamily
2W04A 5KNIA 3QZ8A 4PL1A 1AROP 4PHDA 1J2NA 5L1KA 5KL1B 1RM6C 2K4HA 2XY5A 2FLLA 9ICBA 5AI4A 4XQ8A 1N48A 1U47A 3NVYA 4Y2TA 4DSEA 3UXPA 1L3UA 2RDJA 2FI1A 4UASA 2MUTA 2ZIWA 1COOA 2GOLA 4M9GA 4ED6A 4EX6A 5AI8A 1S97A 1S77D 5HR6A 4I2HA 4Y2VA 2EZYA 4OCZA 3M7DA 1KSPA 3HP6A 4QZEA 5KFIA 1T4GA 4DFJA 4EENA 5EWEA 8ICUA 4DF4A 2C2DA 3OSPA 4B9NA 2XGQA 2Q4TA 3TFSA 4DOBA 2HHTA 2VIXA 3NRZA 7ICJA 1KDHA 5KFGA 2WHEA 4NV0A 1NI3A 2W3RA 2ATLA 4FZNA 1YZ6A 2DPIA 2P6UA 3V7JA 5H2FU 1N56A 1MQ2A 3TKAA 3AMZA 1X2IA 1WG8A 3SR6A 2QLTA 4FO6A 1KKXA 2UVUA 4O3NA 4UB3A 3E58A 2E8NA 4FBUA 2HVIA 3C29A 1Q8KA 4OJ5A 1B22A 3V6KA 5DDYA 2JEFA 5IIMA 4BDPA 4B9LA 3F5EA 3ZDBA 2EZXA 2WAQF 3IV6A 2LYHA 3RRHA 2CN1A 1ECWA 5KT5A 3KHRA 2LYAA 3BQ7A 3IRUA 4I2GA 8ICCA 2NRTA 4R65A 1S0NA 1RDFA 2M0NA 2XY6A 4I2BA 3SAHA 1L3SA 2ZXHA 4KMOB 1Z19A 4YMNA 5AM2A 1V9PA 4DQQA 1U49A 3PSTA 2K89A 8ICZA 4F93B 5AM4A 2VJ4A 1J2MA 1SV0A 1ZQTA 3ONNA 3JPRA 5CJ7A 2PI4A 5T14A 2ASDA 8ICEA 5ALHA 3T5JA 1IXRA 3G6XA 1L3VA 1ZOLA 2ZXIA 4P0PA 1B0XA 2JEJA 5KG2A 2PFNA 1KFDA 5CRXA 7ICIA 4IR1A 2I6XA 1K1SA 3BS5A 1QQ5A 4Z6EA 5ALZA 5JUMA 4F5PA 4K4IA 1V85A 5D46A 4IC9A 3QXGA 5KG1A 5IINA 2KD1A 4M9NA 4YG2A 4DL6A 2XI9A 5AKYA 2W8LA 1OW5A 2MU2A 3F53A 3NVZA 3TANA 2AGPA 3C28A 7ICRA 4M04A 3RJFA 1IIPA 4LVSA 3Q8PB 4DCCA 1RG6A 2V4QA 3GIKA 2JH1A 1MSWD 3SAGA 9ICWA 4Z6FA 3Q8QB 1DK2A 2GLEA 3SV4A 3B0YA 2WTFA 3F5AA 4J9OA 2P66A 1A77A 1U45A 3MFHA 2B21A 3QNMA 4O3PA 4EYIB 1ZQVA 2HHQA 1HEKA 4US8A 3WKAA 4CF4A 4YFKA 4RQMA 4Y2JA 3QEAZ 2RQ5A 2BPFA 3PSFA 2KNJA 3C21A 4CE6A 5ALJA 3CYMA 5BPCA 4HYKA 3H0RB 2KHVA 4A8EA 4MFFA 4DFDA 1D8YA 1SV4A 4F8RA 3L4PA 5J2AA 5GTHU 4JV2A 1JUDA 4ECUA 2BQUA 4RNOA 3KBBA 4UW9A 3HWTA 4F5RA 3TADC 3WK4A 3Q8RB 1TAUA 3NRWA 1F0MA 3GIMA 4RQ1A 2F3NA 3HPOA 8ICVA 2NRXA 7ICLA 4AP9A 3BS7A 5KFTA 1COKA 5HMMA 2B0CA 4ELVA 4QWBA 5KG0A 3R9KA 4GLXA 1JX4A 3BQ2A 3M9NB 5DG7A 3AU2A 1ZQMA 2ASJA 4KX3A 5AKJA 2WB1C 3AM9A 2K8AA 4EBEA 4NL9A 5ALEA 8ICGA 1NJZA 3NVVA 4NLKA 1ZQIA 4EELA 4YXJA 2R8KA 4EX7A 2KP7A 4DL7A 4JB3A 4CF5A 2K8BB 3MGVA 1FIQA 3ORYA 2D3DA 2AGOA 1XSLA 2Q0ZX 3TI0A 4CF3A 1XWLA 4J03A 5DBAA 2Y0SF 4I2JA 3BQ1A 4ECVA 4HAIA 2KG5A 2KZ3A 3TACB 3H8WA 2MA1A 4P0QA 2KJ8A 3Q8MA 1T7PA 5A0LA 3ISCA 4ECWA 1QQ7A 4ED1A 3JPSA 4EZ9A 1A76A 1LKYA 5KFOA 1UHUA 4DS4A 4RQ2A 3ZDEA 2ZG6A 2DUYA 2EH9A 2KVSA 3KTQA 3D2NA 3PMLA 3JPQA 5AI5A 2M9NA 5J0RA 3ZDDA 4UARA 4ZH4A 1ZD3A 1B4FA 5AM3A 4DSJA 4LZGA 3PO4A 4Q43A 2BPGA 4P4PA 2NRVA 4RQ0A 9ICFA 3GV8B 2LI6A 1HUZA 1IG6A 3LDAA 1MQ3A 3GZFA 5CHGA 2OH2A 2LM4A 1LVHA 2KSOB 2CRXA 3AU6A 3JPTA 5AKHA 2HOIA 4IL6U 4DQPA 2QARB 1ZETA 5KAFU 5KFCA 1ZQJA 2FDRA 4YD1A 5J2DA 3RJGA 4O5EA 1VDVA 1X42A 4UAZA 3U26A 2P6RA 4C7YA 4YP3A 4RQNA 4RNMA 3PVXA 3OJSA 5KFUA 4C8MA 9ICLA 3RJHA 5ALSA 4RPZA 1T3QA 4YR3A 5KFYA 2ESEA 1ZQDA 4P4MA 3N4MB 3O0FA 2DGZA 4GXKA 2F8LA 3TFRA 5BOMA 4DLGA 4M9HA 3LWLA 2YTUA 2B6GA 2BCQA 5KT3A 3OHBA 4ED2A 1AQ6A 2FE9A 3RRGA 2ZIVA 4RZRA 2VA2A 2W9AA 5DB7A 1ZD2P 4P2HA 4FZLA 4DEZA 1M6YA 5ALUA 4BGDA 9ICPA 1Q3VA 1WWUA 2G08A 4B9MA 1S0MA 2Y0SC 1TAMA 2IA6A 5KFWA 4FFDA 5BOLA 4Y2XA 2FMPA 4TUQA 3QU4A 3MABA 2XIDA 2W8KA 3CNHA 2E5SA 1UA0A 3LYSA 2BCRA 2KHQA 4DFKA 5CEHA 3Q8SB 2H3VA 4UBBA 1RXWA 2ZJ8A 5KFXA 4O9MA 2J6SA 4MHVA 3HRDD 1SIJA 2LYBA 4I2FA 3RH5A 2KMDA 5ALGA 3H4DA 4F5NA 4DS5A 5F3XB 4G3IA 3HT3A 1KFTA 2WF7A 3T5HA 1S10A 1XU4A 1TVAA 2DKXA 3ISDA 1KFSA 2KICA 3NTUA 4C8OA 5L1JA 1N61A 1XC9A 2FLPA 4NM1A 5ALRA 2BHNA 2LHTA 5HHIA 1WYGA 5KFQA 2JR5A 1QH9A 3PW5A 1BPZA 2K60A 5DDMA 1A6SA 4CRXA 2AH5A 2BCSA 3QE9Y 5AIAA 1ZQRA 3ALRA 3SAFA 5J8YA 1ZRNA 2YMLA 4TQSA 4JMUA 4X5VA 5AI0A 3WK8A 4DFMA 4UB5A 2W43A 4EYHB 2DQNB 3ETLA 4M6WB 3PV8A 3FM9A 4YMOA 3WK9A 2NO5A 3UM9A 2ES6A 1SXEA 2I5HA 2YMQA 1XNSA 1XO1A 3SENA 3RAQA 4JUZA 3RBEA 1L8LA 2F8KA 3AQEA 3Q8KA 1BPYA 4YXMA 4ECSA 1D8LA 2E1FA 4R64A 2FMQA 3C5FA 4BUGA 4M2YA 2I1QA 2FPKA 5DB6A 2HI0A 4QZBA 2CPRA 2GH1A 4C8KA 3IHQB 5AKZA 1QTMA 9ICXA 4CNQA 3M9MB 3JPNA 2CXYA 1IM4A 3WKEA 3RH6A 1VLBA 2KTQA 3BZKA 2JXJA 4UQGA 5DG9A 2W55A 3HKZC 8ICSA 2JEIA 2PXIA 3ICXA 5DQGA 1D9FA 4O5CA 4KN4A 1Q46A 1H38A 1ZQZA 3NASA 2FLNA 2HHSA 2KN7A 2HBKA 4YCXA 4RQ3A 3L5KA 5ALQA 3OHAA 2A19A 2G0AA 4QW9A 2KIWA 4UB8U 4C8NA 4O3SA 1QLNA 3KD3A 4YQWA 2AU0A 4NM2A 4K4GA 4TUSA 2LMRA 4F91B 1X9MA 7ICVA 4BWMA 1Z4OA 2F77X 3K1RB 3C2KA 2QB1A 4J9PA 1X6JA 4NLZA 4O3MA 3OPXA 3QU2A 1N2XA 1RYUA 3PSPA 4QW8A 4Y2PA 4QIWF 1L8OA 5GTIU 2RLTA 2ZIXB 3PR5B 4BXOB 5DG8A 1RQNA 4AYBF 5ALIA 4JWNA 1S76D 4EBCA 5KFLA 4IS7A 2K4PA 4UAUA 3KOOA 2YB4A 4C0ZA 1BPBA 2YX8A 1NKCA 2PFQA 5B66U 4RQ5A 3SZ2A 2EAMA 5J0YA 1TFRA 4DF8A 4QZDA 5D4BA 3TQ1A 1X6IA 1TE2A 2KIVA 2E8MA 9ICIA 1K5OA 3V7LA 4OJLA 4NLCA 1VJ5A 1NNLA 3MDAA 2W7PA 4IR9A 2G09A 2L5YA 1NK5A 1WUDA 3OGUA 1ZXIA 5KFSA 5AKGA 5KFJA 3PW7A 3EW9A 5DGAA 4NJ8A 2ZTCA 4FS2A 4BX9C 3N28A 5F9NA 3MGIA 4U6PA 3HX0A 4OJOA 2OEHA 1PK1B 2IHMA 1UPHA 5ALDA 5J0TA 4BJQA 3QZ7A 3MDCA 5AM1A 4EBDA 4QZHA 5KG5A 4RQ6A 2FPMA 2OM6A 5IILA 2KKVA 5KFDA 5HP4A 1JIHA 8ICNA 1X9XA 3EWAA 1URJA 1ZQSA 3GV7B 2DWQA 2H5XA 1JN3A 3B0XA 3GIJA 3FAHA 2C2RA 2VANA 3PY8A 3RJEA 5K4LA 4J9QA 3N7PD 4RQ4A 5EE9A 7ICGA 1JMSA 4J9NA 3VCBA 1S0OA 1GO3F 4JV1A 2OWOA 3PW4A 5DLFA 5EE1A 3FDSA 1L7OA 2K4EA 1K1QA 3NVWA 9ICSA 5AKKA 5KFBA 1D8BA 3L3FX 1TAQA 2BQRA 4NLNA 3QU5A 2A3VA 3H8SA 5J0SA 2Y9TA 1KQQA 4G9BA 1PK3A 4USAA 3S6JA 4F4ZA 4YR0A 4R66A 4NXZA 1RYSA 4I29A 2KE7A 2KSOA 3ZI4A 1NZBA 3PX4A 1SWVA 5EE0A 4QIWC 2QARA 2XY7A 2WAQC 4QNLA 3GV5B 4UAYA 4J9RA 2EDUA 2AQ4A 4IRCA 4KLQA 3N7SC 1NJWA 4Y2UA 1ZQUA 5AM0A 5HHHA 1T3NA 4Q8EA 1SKWA 5J0WA 2YN4A 3M6KA 2XCPA 3IG8A 1C20A 4UB6U 1X9WA 1NKEA 2PMZF 5ALMA 2R8GA 4ECZA 5F9LA 1SKRA 5DB9A 3ZD9A 1N63A 5ALTA 3EYZA 4PPXA 2DF4B 4RT3A 3UQ2A 3EUB2 1BPXA 8ICIA 3JPOA 3BQTA 3V72A 2A1AA 3I76A 3RBDA 3SEIA 1ZQOA 2YY6A 3T5LA 2HHXA 1N5XA 2GO7A 4B6JA 3BQ0A 2EANA 2QB0B 2JZBB 4C4SA 2MAXA 1Z1BA 1RYRA 1BNPA 4ECYA 4ED0A 3DEEA 5TZVA 4UBCA 1KN5A 1XSPA 1L7MA 3AN1A 1JXEA 4NY8A 2ZIUB 1FO4A 1L5UA 4RPXA 3MFIA 5J0PA 3RJIA 4J9LA 1BPEA 5JTIA 4K4HA 5AK5A 7ICNA 7ICHA 1NKBA 2YMMA 1Z00A 2ALZA 1HIWA 2K4IA 5KT4A 1TK0A 3NGDA 1JRPA 4ECXA 9ICTA 1S9FA 2BDUA 1L7NA 2JGAA 2ZTEA 3QUBA 4B9VA 4Z6CA 3H4BA 8ICYA 4J9MA 2R8JA 3M9OB 5KG7A 1NZPA 4R8UB 3KKAA 3M1YA 1SB3C 1MA7A 2YB1A 2KKPA 2LBOA 2HCFA 5IIIA 2D8CA 4F5QA 5AK4A 1U4BA 3WK6A 4KLMA 2OHFA 4IQWA 2OYYA 3KHGA 4PJ0U 4DL3A 3Q8LA 1PVPA 9ICHA 1WCNA 2UVVA 2EQYA 1HUOA 4M6WA 1RZTA 3VC8A 2KJ9A 2YMPA 4JWMA 3V7KA 5AM5A 7ICEA 8ICTA 4Y2SA 5B5EU 4DL5A 2HMXA 2IOFK 1ZQEA 4F92B 2G07A 4DQSA 4J9SA 3T79A 3OJUA 4PZNA 1RQLA 1SL0A 4ECRA 2N1RA 5J0XA 8ICOA 2XC9A 5J8YC 3F2DA 2MRLA 4CDGA 4ZOHC 4QWAA 3HW8A 2F1IA 8ICMA 1ZQPA 1NK4A 2AQ0A 4M9JA 4KLTA 1B43A 4KLOA 3C23A 4MF2A 2KFZA 3SI8A 1O08A 4ECTA 2R8HA 4MEYA 1ZD4A 5AIBA 5KG3A 7ICTA 1NK7A 2G06A 3I28A 5DBBA 2C2EA 4KLDA 3QX7A 5KT7A 4DL4A 5EWGA 1NJXA 1KW4A 4F3OA 5EOZA 4ELTA 1NK0A 2ASLA 1ZRMA 3E2EA 5CA7A 1A0PA 2ZTDA 3GU3A 4U7CA 4F5OA 5IIJA 4PGYA 2W7OA 3GFKB 4I28A 1NOMA 4LJXA 5E79U 4C4TA 4F50A 2K8CB 2XVTA 3UPQA 5HNKA 4KITB 2BCVA 2EAPA 3C2LA 9ICOA 1QCKA 1DXSA 5AICA 2AXTU 4DSLA 4RQ8A 4RT2A 3F2BA 1ZQWA 2NRWA 5KFFA 9ICKA 2Y9UA 7ICPA 1LV5A 3CRXA 4KLLA 2F1JA 4US9A 3WK5A 9ICAA 2ZIXA 3KHLA 4BXOA 3SMVA 3RF9A 3UMCA 4QZGA 4IQVA 3H8JA 2W3SA 5ALYA 2BGWA 9ICUA 3TARA 2Y1JA 4F2SA 3H40A 1J97A 1BNOA 5AKLA 4F4KA 1KTQA 2F1HA 4UAWA 3RJJA 2VJ5A 3D2QA 4MF8A 5KFMA 5J2JA 3GIIA 4YVZA 4F4YA 2C22A 8ICFA 3TAQA 4JV0A 1PVQA 3KFUF 4I2IA 2A1JB 5DBCA 3QU7A 2LPEA 1BPDA 4O5KA 3FC4A 2F44A 2AJQA 4O3OA 1L6NA 2KV2A 1PK1A 3AEVA 2DKZA 7ICQA 5HR7A 3M8RA 8ICBA 4C80A 1SV0C 3PX0A 3D2SA 1BGXT 1F5SA 2AGQA 3RFAA 2E8PA 4QWEA 3MR6A 2ZUBA 4KTQA 2JRZA 2H3ZA 4KX5A 3TAPA 1JROA 1KL9A 3SV3A 1NK9A 5ALWA 4QZ9A 1JALA 5D49A 9ICNA 1C7YA 4ECQA 8ICHA 4TURA 5ALOA 4B9TA 8ICXA 3PW0A 3PX6A 1SXDA 3BZCA 2ZUCA 2G5HB 2MSNA 2JV3A 2ZIVB 3PMNA 3QYPA 2XCAA 2V4RA 1U48A 9ICJA 5AK3A 2W54A 3QUQA 4PHEA 3IN5A 4PGXA 5IIKA 4R63A 3HILA 5DQIA 7ICUA 2W9BB 5J2EA 1ZQHA 2I9GA 3RR8A 2E3TA 5DGBA 1S5LU 4IQTA 3AL0B 1ZQQA 9ICRA 5L9XA 4KLHA 1UA1A 4M9LA 4C4RA 1OUQA 5J2HA 2ZJAA 1FFUA 3M6ZA 5J0UA 4KMUA 5AI9A 5C5JA 1ZJMA 2W9CB 2WF6A 2BKEA 3QUTA 2KZMA 4QJFB 2ZJ5A 5KFAA 7ICOA 4DL2A 1T8EA 5KFHA 3OTQA 1L3TA 2R8IA 4DSKA 3CW2C 1Z3EB 3ED5A 3C1YA 5AKEA 2ZUDA 3K75D 1RXVA 1QSYA 3DV9A 2DFLA 2PI5A 8ICJA 1DRGA 3GILA 4F4WA 4IRDA 3H0MB 4UATA 4GC6A 2WFAA 3SYZA 3QEBZ 1CI4A 7ICKA 2WB1F 2LM1A 4PHPA 4XRHA 3CP8A 4NWIA 1SZHA 1N5WA 5KFKA 3PR4A 3PNCA 1V97A 3EPIA 2QB0A 2JZBA 4E0DA 4QWDA 2Z7JA 2IMWP 4CGZA 9ICEA 4UB2A 3F2CA 5KG4A 4NL9C 1ZQ1C 4RQ7A 3BJYA 1Y88A 2HBMA 2IOFA 5FP0A 2ZIUA 2JEGA 1BVSA 2WF9A 5KFRA 2IBKA 9ICGA 2XGPA 1X40A 2HW3A 4F2RA 1YT3A 1CUKA 4KN7A 2KJ5A 5CR0A 4RUAA 2IOHA 1RPLA 4I2DA 3H8MA 1DGJA 2MUTB 2ZIWB 5JRTA 4DQIA 8ICAA 1U9LA 1XO0A 4EEKA 1ZQYA 2YQEA 4OJPA 3BDPA 1N62A 2F76X 3PW2A 4KLEA 4DQRA 5J2BA 4YMMA 3SQIA 2LKYA 4JK1A 4PL2A 1O03A 1PZNA 5TISU 1WWVA 1ZQNA 4R8UA 3A0HU 2XO7A 1ZYQA 5J29A 4DOAA 4PH5A 3RH4A 3GQCA 3GDXA 5KT6A 5J2CA 3M8SA 3ETRA 5G5GA 9ICCA 1TK8A 4LZDA 5KFPA 4DFPA 3UXOA 1F44A 5AKXA 4ICAA 2ODGA 2DPJA 4QWCA 5DKWA 2PFOA 1T94A 4GXJA 4F71A 1ED1A 5CP2A 1MN8A 1ZQCA 2HBLA 5J2IA 3I1YA 3ISBA 3FYHA 1ZQGA 2KZZA 3K1ZA 5KFEA 1UQVA 1UT8A 4AYBC 1SWWA 5AKIA 3KKAC 4PGQA 1ZQLA 1OXJA 4EEYA 3LWMA 3RB3A 5L1LA 4QZAA 5HMLA 2C28A 4RPYA 5AHXA 1L7PA 1QSSA 2V9WA 2HVHA 2BPCA 4EZ6A 3IG5A 5CWRA 3RJKA 2RP5A 2FMSA 2UVWA 4FZMA 9ICMA 4GFJA 2OXOA 4O3QA 4C8LA 1FFVA 4GC7A 1ZQFA 2RHFA 2NO4A 3H7IA 3ZDCA 5DLGA 2P35A 4Q45A 4YN4A 4KLFA 5AK6A 3RB0A 5DB8A 2W9MA 1TV9A 2D6FC 1TK5A 5KFZA 1NK6A 3K4GA 8ICRA 5ALLA 4P0PB 3UXNA 5ALFA 3EPGA 5ALPA 3NUQA 2HBJA 4Y2QA 8ICQA 3PO5A 1N60A 1X66A 4FE3A 1ZQBA 1WCLA 4M0AA 3BS5B 3EZ5A 2E1EA 1CEZA 4KLSA 1SL1A 2BDPA 1D9DA 3MR3A 3LK9A 3JPPA 1NK8A 3H0LB 1ZQXA 4J9KA 3ZDAA 4C7ZA 2PKEA 3UMGA 3WU2U 1Q3UA 1KRPA 4YD2A 4YR2A 5J0QA 3WKDA 2Y1IA 3IM1A 3OSNA 4OJ6A 3KHHA 7ICMA 1DGSA 2RDIA 4QZFA 1XS9D 2NYVA 4DSFA 5ALXA 4FS1A 1PUZA 1SGGA 4KLGA 4RUCA 4I2AA 1Z4NA 1IV8A 4QZ8A 7ICFA 3UMBA 4BWJA 4MEXA 5KG6A 4RNNA 4F4XA 1LB2B 2W11A 3TADA 5KAIU 3PZPA 4CCHA 2KK0A 2DBYA 3A0BU 3LVWA 4O3RA 1Z1VA 5J2GA 3DDHA 3RAXA 4UB4A 2W03A 4FBTA 3ZD8A 7ICSA 2RRDA 4OD0A 3B9JA 4B9SA 2VA3A 1S8OA 9ICQA 5G5HA 4DWIA 4F72A 4Q44A 4O0IA 4TQRA 1ZJNA 3QUCA 4DOCA 2HDOA 4TUPA 2ISOA 1EXNA 4DLEA 4I2EA 2A1JA 2WF5A 2KFNA 2FPLA 2J6UA 3MR2A 5KT2A 1ZD5A 3V6JA 3T3FA 2R18A 5C0YA 2H3IA 1HJPA 3J81j 3WKCA 1UCVA 2UVRA 3HJEA 5ALVA 2WF8A 4KLJA 3G6VA 4DSIA 2JH7A 5KL8B 2NRZA 5J2FA 5L1MA 2BZFA 3MR5A 3V6HA 4ELUA 3NS1A 4I2CA 1XSNA 4IQUA 2HHWA 2PMZC 2HSZA 5ALKA 4PHAA 3RR7A 5EWFA 8ICWA 4I27A 4QZCA 5KTQA 3N7RC 2OCEA 3AUOA 3QU9A 4KLUA 2H3FA 4P4OA 3UQ0A 3KZXA 3D6JA 4MFAA 3AQFA 2JHDA 1QQ6A 3WK7A 4IRKA 5JU5A 2ISPA 4MFCA 2HHVA 1YZ7A 3MBYA 2EZZA 1X9SA 1TKDA 1FEZA 9ICVA 3RB6A 3KZIU 4Z6DA 2GWSA 1CRXA 2O6KA 4GIBA 1JI7A 4Q8FA 4NLGA 1KEJA 4UAVA 3HKZF 4M47A 2W9BA 2EAOA 3IP4B 2F2AB 2BCUA 4DO9A 3RB4A 4B9UA 4OO1J 3C2MA 3C1ZA 2PFPA 4P0QB 5IIOA 5J2KA 4ED7A 5CB1A 2XICA 1P7DA 4ED3A 4XA5A 1UT5A 1V38A 8ICKA 2W9CA 2JMGA 3G6YA 1KBUA 4NLBA 4QZIA 4KLIA 3WKBA 4PZOA 1QSLA 4UB1A 1LKYB 8ICPA 3LVVA 4ACOA 3SD7A 1Z00B 2HOFA 1S0VA 2KOBA 1NJYA 1KLNA 2QKQA 2DL0A 2HOQA 3THVA 1SKSA 2VA8A 3MC1A 3E0FA 3MGHA 2AHOB 2BR0A 2E8OA 5EE3A 3N97B 3PSIA 5AI6A 4WJ3B 2H3QA 2IHNA 4ED8A 2NV3A 5KFVA 5DQHA 3RTVA 4GXIA 1JXLA 5L1IA 1SL2A 5J0OA 2FJ6A 4Y2RA 4XUSA 8ICLA 1SZPA 1DOQA 2BQ3A 2J6TA 2KVCA 1ZQKA 2G5IB 2HHUA 1PVRA 4RU9A 4Y2YA 3T5KA 3C5GA 2VKQA 3IDWA 1ZQAA 5ALNA 5KFNA 2KEYA 1DK3A 1MC8A
chains in the Genus database with same CATH topology
2QB0A 1SXDA 5KNIA 2LMRA 3TADA 3BQ7A 2Y9UA 1JI7A 2ESEA 2JV3A 5J8YA 4NL9C 1Z1VA 2EAOA 3K1RB 3SEIA 2QB1A 2YTUA 2B6GA 2EANA 1SV4A 2QB0B 2FE9A 1SV0A 1LKYA 4PZNA 3HILA 1X40A 3TADC 1V38A 1WWUA 5J8YC 2ES6A 1F0MA 1SXEA 1B0XA 4PZOA 4IS7A 2K4PA 2F3NA 3SENA 1LKYB 3H8MA 1UCVA 3BS7A 2Y9TA 1COKA 5JRTA 2F8KA 1PK3A 5JTIA 3BS5A 2EAMA 2DL0A 2QKQA 1B4FA 5L1MA 2LPEA 2KIVA 2E8MA 2KE7A 1V85A 2KSOA 2F44A 2E8OA 1X66A 1WWVA 4NL9A 4MHVA 3BS5B 2L5YA 1PK1A 2QARA 2KMDA 2DKZA 5F3XB 1OW5A 2KSOB 4NJ8A 1KW4A 1SV0C 2DKXA 3KKAA 1RG6A 1PK1B 2QARB 2D3DA 2E8PA 2D8CA 2E8NA 2GLEA 1SGGA 3IDWA 5JU5A 2KG5A 2EAPA 3TACB 1X9XA 1UQVA 1DXSA 2K60A 4RQNA 3KKAC 1OXJA 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 A;  1SXD A;  5KNI A;  2LMR A;  3TAD A;  3BQ7 A;  2Y9U A;  1JI7 A;  2ESE A;  2JV3 A;  5J8Y A;  4NL9 C;  1Z1V A;  2EAO A;  3K1R B;  3SEI A;  2QB1 A;  2YTU A;  2B6G A;  2EAN A;  1SV4 A;  2QB0 B;  2FE9 A;  1SV0 A;  1LKY A;  4PZN A;  3HIL A;  1X40 A;  3TAD C;  1V38 A;  1WWU A;  5J8Y C;  2ES6 A;  1F0M A;  1SXE A;  1B0X A;  4PZO A;  4IS7 A;  2K4P A;  2F3N A;  3SEN A;  1LKY B;  3H8M A;  1UCV A;  3BS7 A;  2Y9T A;  1COK A;  5JRT A;  2F8K A;  1PK3 A;  5JTI A;  3BS5 A;  2EAM A;  2DL0 A;  2QKQ A;  1B4F A;  5L1M A;  2LPE A;  2KIV A;  2E8M A;  2KE7 A;  1V85 A;  2KSO A;  2F44 A;  2E8O A;  1X66 A;  1WWV A;  4NL9 A;  4MHV A;  3BS5 B;  2L5Y A;  1PK1 A;  2QAR A;  2KMD A;  2DKZ A;  5F3X B;  1OW5 A;  2KSO B;  4NJ8 A;  1KW4 A;  1SV0 C;  2DKX A;  3KKA A;  1RG6 A;  1PK1 B;  2QAR B;  2D3D A;  2E8P A;  2D8C A;  2E8N A;  2GLE A;  1SGG A;  3IDW A;  5JU5 A;  2KG5 A;  2EAP A;  3TAC B;  1X9X A;  1UQV A;  1DXS A;  2K60 A;  4RQN A;  3KKA C;  1OXJ A;  4RQM A; 
#chains in the Genus database with same CATH topology
 2W04 A;  5KNI A;  3QZ8 A;  4PL1 A;  1ARO P;  4PHD A;  1J2N A;  5L1K A;  5KL1 B;  1RM6 C;  2K4H A;  2XY5 A;  2FLL A;  9ICB A;  5AI4 A;  4XQ8 A;  1N48 A;  1U47 A;  3NVY A;  4Y2T A;  4DSE A;  3UXP A;  1L3U A;  2RDJ A;  2FI1 A;  4UAS A;  2MUT A;  2ZIW A;  1COO A;  2GOL A;  4M9G A;  4ED6 A;  4EX6 A;  5AI8 A;  1S97 A;  1S77 D;  5HR6 A;  4I2H A;  4Y2V A;  2EZY A;  4OCZ A;  3M7D A;  1KSP A;  3HP6 A;  4QZE A;  5KFI A;  1T4G A;  4DFJ A;  4EEN A;  5EWE A;  8ICU A;  4DF4 A;  2C2D A;  3OSP A;  4B9N A;  2XGQ A;  2Q4T A;  3TFS A;  4DOB A;  2HHT A;  2VIX A;  3NRZ A;  7ICJ A;  1KDH A;  5KFG A;  2WHE A;  4NV0 A;  1NI3 A;  2W3R A;  2ATL A;  4FZN A;  1YZ6 A;  2DPI A;  2P6U A;  3V7J A;  5H2F U;  1N56 A;  1MQ2 A;  3TKA A;  3AMZ A;  1X2I A;  1WG8 A;  3SR6 A;  2QLT A;  4FO6 A;  1KKX A;  2UVU A;  4O3N A;  4UB3 A;  3E58 A;  2E8N A;  4FBU A;  2HVI A;  3C29 A;  1Q8K A;  4OJ5 A;  1B22 A;  3V6K A;  5DDY A;  2JEF A;  5IIM A;  4BDP A;  4B9L A;  3F5E A;  3ZDB A;  2EZX A;  2WAQ F;  3IV6 A;  2LYH A;  3RRH A;  2CN1 A;  1ECW A;  5KT5 A;  3KHR A;  2LYA A;  3BQ7 A;  3IRU A;  4I2G A;  8ICC A;  2NRT A;  4R65 A;  1S0N A;  1RDF A;  2M0N A;  2XY6 A;  4I2B A;  3SAH A;  1L3S A;  2ZXH A;  4KMO B;  1Z19 A;  4YMN A;  5AM2 A;  1V9P A;  4DQQ A;  1U49 A;  3PST A;  2K89 A;  8ICZ A;  4F93 B;  5AM4 A;  2VJ4 A;  1J2M A;  1SV0 A;  1ZQT A;  3ONN A;  3JPR A;  5CJ7 A;  2PI4 A;  5T14 A;  2ASD A;  8ICE A;  5ALH A;  3T5J A;  1IXR A;  3G6X A;  1L3V A;  1ZOL A;  2ZXI A;  4P0P A;  1B0X A;  2JEJ A;  5KG2 A;  2PFN A;  1KFD A;  5CRX A;  7ICI A;  4IR1 A;  2I6X A;  1K1S A;  3BS5 A;  1QQ5 A;  4Z6E A;  5ALZ A;  5JUM A;  4F5P A;  4K4I A;  1V85 A;  5D46 A;  4IC9 A;  3QXG A;  5KG1 A;  5IIN A;  2KD1 A;  4M9N A;  4YG2 A;  4DL6 A;  2XI9 A;  5AKY A;  2W8L A;  1OW5 A;  2MU2 A;  3F53 A;  3NVZ A;  3TAN A;  2AGP A;  3C28 A;  7ICR A;  4M04 A;  3RJF A;  1IIP A;  4LVS A;  3Q8P B;  4DCC A;  1RG6 A;  2V4Q A;  3GIK A;  2JH1 A;  1MSW D;  3SAG A;  9ICW A;  4Z6F A;  3Q8Q B;  1DK2 A;  2GLE A;  3SV4 A;  3B0Y A;  2WTF A;  3F5A A;  4J9O A;  2P66 A;  1A77 A;  1U45 A;  3MFH A;  2B21 A;  3QNM A;  4O3P A;  4EYI B;  1ZQV A;  2HHQ A;  1HEK A;  4US8 A;  3WKA A;  4CF4 A;  4YFK A;  4RQM A;  4Y2J A;  3QEA Z;  2RQ5 A;  2BPF A;  3PSF A;  2KNJ A;  3C21 A;  4CE6 A;  5ALJ A;  3CYM A;  5BPC A;  4HYK A;  3H0R B;  2KHV A;  4A8E A;  4MFF A;  4DFD A;  1D8Y A;  1SV4 A;  4F8R A;  3L4P A;  5J2A A;  5GTH U;  4JV2 A;  1JUD A;  4ECU A;  2BQU A;  4RNO A;  3KBB A;  4UW9 A;  3HWT A;  4F5R A;  3TAD C;  3WK4 A;  3Q8R B;  1TAU A;  3NRW A;  1F0M A;  3GIM A;  4RQ1 A;  2F3N A;  3HPO A;  8ICV A;  2NRX A;  7ICL A;  4AP9 A;  3BS7 A;  5KFT A;  1COK A;  5HMM A;  2B0C A;  4ELV A;  4QWB A;  5KG0 A;  3R9K A;  4GLX A;  1JX4 A;  3BQ2 A;  3M9N B;  5DG7 A;  3AU2 A;  1ZQM A;  2ASJ A;  4KX3 A;  5AKJ A;  2WB1 C;  3AM9 A;  2K8A A;  4EBE A;  4NL9 A;  5ALE A;  8ICG A;  1NJZ A;  3NVV A;  4NLK A;  1ZQI A;  4EEL A;  4YXJ A;  2R8K A;  4EX7 A;  2KP7 A;  4DL7 A;  4JB3 A;  4CF5 A;  2K8B B;  3MGV A;  1FIQ A;  3ORY A;  2D3D A;  2AGO A;  1XSL A;  2Q0Z X;  3TI0 A;  4CF3 A;  1XWL A;  4J03 A;  5DBA A;  2Y0S F;  4I2J A;  3BQ1 A;  4ECV A;  4HAI A;  2KG5 A;  2KZ3 A;  3TAC B;  3H8W A;  2MA1 A;  4P0Q A;  2KJ8 A;  3Q8M A;  1T7P A;  5A0L A;  3ISC A;  4ECW A;  1QQ7 A;  4ED1 A;  3JPS A;  4EZ9 A;  1A76 A;  1LKY A;  5KFO A;  1UHU A;  4DS4 A;  4RQ2 A;  3ZDE A;  2ZG6 A;  2DUY A;  2EH9 A;  2KVS A;  3KTQ A;  3D2N A;  3PML A;  3JPQ A;  5AI5 A;  2M9N A;  5J0R A;  3ZDD A;  4UAR A;  4ZH4 A;  1ZD3 A;  1B4F A;  5AM3 A;  4DSJ A;  4LZG A;  3PO4 A;  4Q43 A;  2BPG A;  4P4P A;  2NRV A;  4RQ0 A;  9ICF A;  3GV8 B;  2LI6 A;  1HUZ A;  1IG6 A;  3LDA A;  1MQ3 A;  3GZF A;  5CHG A;  2OH2 A;  2LM4 A;  1LVH A;  2KSO B;  2CRX A;  3AU6 A;  3JPT A;  5AKH A;  2HOI A;  4IL6 U;  4DQP A;  2QAR B;  1ZET A;  5KAF U;  5KFC A;  1ZQJ A;  2FDR A;  4YD1 A;  5J2D A;  3RJG A;  4O5E A;  1VDV A;  1X42 A;  4UAZ A;  3U26 A;  2P6R A;  4C7Y A;  4YP3 A;  4RQN A;  4RNM A;  3PVX A;  3OJS A;  5KFU A;  4C8M A;  9ICL A;  3RJH A;  5ALS A;  4RPZ A;  1T3Q A;  4YR3 A;  5KFY A;  2ESE A;  1ZQD A;  4P4M A;  3N4M B;  3O0F A;  2DGZ A;  4GXK A;  2F8L A;  3TFR A;  5BOM A;  4DLG A;  4M9H A;  3LWL A;  2YTU A;  2B6G A;  2BCQ A;  5KT3 A;  3OHB A;  4ED2 A;  1AQ6 A;  2FE9 A;  3RRG A;  2ZIV A;  4RZR A;  2VA2 A;  2W9A A;  5DB7 A;  1ZD2 P;  4P2H A;  4FZL A;  4DEZ A;  1M6Y A;  5ALU A;  4BGD A;  9ICP A;  1Q3V A;  1WWU A;  2G08 A;  4B9M A;  1S0M A;  2Y0S C;  1TAM A;  2IA6 A;  5KFW A;  4FFD A;  5BOL A;  4Y2X A;  2FMP A;  4TUQ A;  3QU4 A;  3MAB A;  2XID A;  2W8K A;  3CNH A;  2E5S A;  1UA0 A;  3LYS A;  2BCR A;  2KHQ A;  4DFK A;  5CEH A;  3Q8S B;  2H3V A;  4UBB A;  1RXW A;  2ZJ8 A;  5KFX A;  4O9M A;  2J6S A;  4MHV A;  3HRD D;  1SIJ A;  2LYB A;  4I2F A;  3RH5 A;  2KMD A;  5ALG A;  3H4D A;  4F5N A;  4DS5 A;  5F3X B;  4G3I A;  3HT3 A;  1KFT A;  2WF7 A;  3T5H A;  1S10 A;  1XU4 A;  1TVA A;  2DKX A;  3ISD A;  1KFS A;  2KIC A;  3NTU A;  4C8O A;  5L1J A;  1N61 A;  1XC9 A;  2FLP A;  4NM1 A;  5ALR A;  2BHN A;  2LHT A;  5HHI A;  1WYG A;  5KFQ A;  2JR5 A;  1QH9 A;  3PW5 A;  1BPZ A;  2K60 A;  5DDM A;  1A6S A;  4CRX A;  2AH5 A;  2BCS A;  3QE9 Y;  5AIA A;  1ZQR A;  3ALR A;  3SAF A;  5J8Y A;  1ZRN A;  2YML A;  4TQS A;  4JMU A;  4X5V A;  5AI0 A;  3WK8 A;  4DFM A;  4UB5 A;  2W43 A;  4EYH B;  2DQN B;  3ETL A;  4M6W B;  3PV8 A;  3FM9 A;  4YMO A;  3WK9 A;  2NO5 A;  3UM9 A;  2ES6 A;  1SXE A;  2I5H A;  2YMQ A;  1XNS A;  1XO1 A;  3SEN A;  3RAQ A;  4JUZ A;  3RBE A;  1L8L A;  2F8K A;  3AQE A;  3Q8K A;  1BPY A;  4YXM A;  4ECS A;  1D8L A;  2E1F A;  4R64 A;  2FMQ A;  3C5F A;  4BUG A;  4M2Y A;  2I1Q A;  2FPK A;  5DB6 A;  2HI0 A;  4QZB A;  2CPR A;  2GH1 A;  4C8K A;  3IHQ B;  5AKZ A;  1QTM A;  9ICX A;  4CNQ A;  3M9M B;  3JPN A;  2CXY A;  1IM4 A;  3WKE A;  3RH6 A;  1VLB A;  2KTQ A;  3BZK A;  2JXJ A;  4UQG A;  5DG9 A;  2W55 A;  3HKZ C;  8ICS A;  2JEI A;  2PXI A;  3ICX A;  5DQG A;  1D9F A;  4O5C A;  4KN4 A;  1Q46 A;  1H38 A;  1ZQZ A;  3NAS A;  2FLN A;  2HHS A;  2KN7 A;  2HBK A;  4YCX A;  4RQ3 A;  3L5K A;  5ALQ A;  3OHA A;  2A19 A;  2G0A A;  4QW9 A;  2KIW A;  4UB8 U;  4C8N A;  4O3S A;  1QLN A;  3KD3 A;  4YQW A;  2AU0 A;  4NM2 A;  4K4G A;  4TUS A;  2LMR A;  4F91 B;  1X9M A;  7ICV A;  4BWM A;  1Z4O A;  2F77 X;  3K1R B;  3C2K A;  2QB1 A;  4J9P A;  1X6J A;  4NLZ A;  4O3M A;  3OPX A;  3QU2 A;  1N2X A;  1RYU A;  3PSP A;  4QW8 A;  4Y2P A;  4QIW F;  1L8O A;  5GTI U;  2RLT A;  2ZIX B;  3PR5 B;  4BXO B;  5DG8 A;  1RQN A;  4AYB F;  5ALI A;  4JWN A;  1S76 D;  4EBC A;  5KFL A;  4IS7 A;  2K4P A;  4UAU A;  3KOO A;  2YB4 A;  4C0Z A;  1BPB A;  2YX8 A;  1NKC A;  2PFQ A;  5B66 U;  4RQ5 A;  3SZ2 A;  2EAM A;  5J0Y A;  1TFR A;  4DF8 A;  4QZD A;  5D4B A;  3TQ1 A;  1X6I A;  1TE2 A;  2KIV A;  2E8M A;  9ICI A;  1K5O A;  3V7L A;  4OJL A;  4NLC A;  1VJ5 A;  1NNL A;  3MDA A;  2W7P A;  4IR9 A;  2G09 A;  2L5Y A;  1NK5 A;  1WUD A;  3OGU A;  1ZXI A;  5KFS A;  5AKG A;  5KFJ A;  3PW7 A;  3EW9 A;  5DGA A;  4NJ8 A;  2ZTC A;  4FS2 A;  4BX9 C;  3N28 A;  5F9N A;  3MGI A;  4U6P A;  3HX0 A;  4OJO A;  2OEH A;  1PK1 B;  2IHM A;  1UPH A;  5ALD A;  5J0T A;  4BJQ A;  3QZ7 A;  3MDC A;  5AM1 A;  4EBD A;  4QZH A;  5KG5 A;  4RQ6 A;  2FPM A;  2OM6 A;  5IIL A;  2KKV A;  5KFD A;  5HP4 A;  1JIH A;  8ICN A;  1X9X A;  3EWA A;  1URJ A;  1ZQS A;  3GV7 B;  2DWQ A;  2H5X A;  1JN3 A;  3B0X A;  3GIJ A;  3FAH A;  2C2R A;  2VAN A;  3PY8 A;  3RJE A;  5K4L A;  4J9Q A;  3N7P D;  4RQ4 A;  5EE9 A;  7ICG A;  1JMS A;  4J9N A;  3VCB A;  1S0O A;  1GO3 F;  4JV1 A;  2OWO A;  3PW4 A;  5DLF A;  5EE1 A;  3FDS A;  1L7O A;  2K4E A;  1K1Q A;  3NVW A;  9ICS A;  5AKK A;  5KFB A;  1D8B A;  3L3F X;  1TAQ A;  2BQR A;  4NLN A;  3QU5 A;  2A3V A;  3H8S A;  5J0S A;  2Y9T A;  1KQQ A;  4G9B A;  1PK3 A;  4USA A;  3S6J A;  4F4Z A;  4YR0 A;  4R66 A;  4NXZ A;  1RYS A;  4I29 A;  2KE7 A;  2KSO A;  3ZI4 A;  1NZB A;  3PX4 A;  1SWV A;  5EE0 A;  4QIW C;  2QAR A;  2XY7 A;  2WAQ C;  4QNL A;  3GV5 B;  4UAY A;  4J9R A;  2EDU A;  2AQ4 A;  4IRC A;  4KLQ A;  3N7S C;  1NJW A;  4Y2U A;  1ZQU A;  5AM0 A;  5HHH A;  1T3N A;  4Q8E A;  1SKW A;  5J0W A;  2YN4 A;  3M6K A;  2XCP A;  3IG8 A;  1C20 A;  4UB6 U;  1X9W A;  1NKE A;  2PMZ F;  5ALM A;  2R8G A;  4ECZ A;  5F9L A;  1SKR A;  5DB9 A;  3ZD9 A;  1N63 A;  5ALT A;  3EYZ A;  4PPX A;  2DF4 B;  4RT3 A;  3UQ2 A;  3EUB 2;  1BPX A;  8ICI A;  3JPO A;  3BQT A;  3V72 A;  2A1A A;  3I76 A;  3RBD A;  3SEI A;  1ZQO A;  2YY6 A;  3T5L A;  2HHX A;  1N5X A;  2GO7 A;  4B6J A;  3BQ0 A;  2EAN A;  2QB0 B;  2JZB B;  4C4S A;  2MAX A;  1Z1B A;  1RYR A;  1BNP A;  4ECY A;  4ED0 A;  3DEE A;  5TZV A;  4UBC A;  1KN5 A;  1XSP A;  1L7M A;  3AN1 A;  1JXE A;  4NY8 A;  2ZIU B;  1FO4 A;  1L5U A;  4RPX A;  3MFI A;  5J0P A;  3RJI A;  4J9L A;  1BPE A;  5JTI A;  4K4H A;  5AK5 A;  7ICN A;  7ICH A;  1NKB A;  2YMM A;  1Z00 A;  2ALZ A;  1HIW A;  2K4I A;  5KT4 A;  1TK0 A;  3NGD A;  1JRP A;  4ECX A;  9ICT A;  1S9F A;  2BDU A;  1L7N A;  2JGA A;  2ZTE A;  3QUB A;  4B9V A;  4Z6C A;  3H4B A;  8ICY A;  4J9M A;  2R8J A;  3M9O B;  5KG7 A;  1NZP A;  4R8U B;  3KKA A;  3M1Y A;  1SB3 C;  1MA7 A;  2YB1 A;  2KKP A;  2LBO A;  2HCF A;  5III A;  2D8C A;  4F5Q A;  5AK4 A;  1U4B A;  3WK6 A;  4KLM A;  2OHF A;  4IQW A;  2OYY A;  3KHG A;  4PJ0 U;  4DL3 A;  3Q8L A;  1PVP A;  9ICH A;  1WCN A;  2UVV A;  2EQY A;  1HUO A;  4M6W A;  1RZT A;  3VC8 A;  2KJ9 A;  2YMP A;  4JWM A;  3V7K A;  5AM5 A;  7ICE A;  8ICT A;  4Y2S A;  5B5E U;  4DL5 A;  2HMX A;  2IOF K;  1ZQE A;  4F92 B;  2G07 A;  4DQS A;  4J9S A;  3T79 A;  3OJU A;  4PZN A;  1RQL A;  1SL0 A;  4ECR A;  2N1R A;  5J0X A;  8ICO A;  2XC9 A;  5J8Y C;  3F2D A;  2MRL A;  4CDG A;  4ZOH C;  4QWA A;  3HW8 A;  2F1I A;  8ICM A;  1ZQP A;  1NK4 A;  2AQ0 A;  4M9J A;  4KLT A;  1B43 A;  4KLO A;  3C23 A;  4MF2 A;  2KFZ A;  3SI8 A;  1O08 A;  4ECT A;  2R8H A;  4MEY A;  1ZD4 A;  5AIB A;  5KG3 A;  7ICT A;  1NK7 A;  2G06 A;  3I28 A;  5DBB A;  2C2E A;  4KLD A;  3QX7 A;  5KT7 A;  4DL4 A;  5EWG A;  1NJX A;  1KW4 A;  4F3O A;  5EOZ A;  4ELT A;  1NK0 A;  2ASL A;  1ZRM A;  3E2E A;  5CA7 A;  1A0P A;  2ZTD A;  3GU3 A;  4U7C A;  4F5O A;  5IIJ A;  4PGY A;  2W7O A;  3GFK B;  4I28 A;  1NOM A;  4LJX A;  5E79 U;  4C4T A;  4F50 A;  2K8C B;  2XVT A;  3UPQ A;  5HNK A;  4KIT B;  2BCV A;  2EAP A;  3C2L A;  9ICO A;  1QCK A;  1DXS A;  5AIC A;  2AXT U;  4DSL A;  4RQ8 A;  4RT2 A;  3F2B A;  1ZQW A;  2NRW A;  5KFF A;  9ICK A;  2Y9U A;  7ICP A;  1LV5 A;  3CRX A;  4KLL A;  2F1J A;  4US9 A;  3WK5 A;  9ICA A;  2ZIX A;  3KHL A;  4BXO A;  3SMV A;  3RF9 A;  3UMC A;  4QZG A;  4IQV A;  3H8J A;  2W3S A;  5ALY A;  2BGW A;  9ICU A;  3TAR A;  2Y1J A;  4F2S A;  3H40 A;  1J97 A;  1BNO A;  5AKL A;  4F4K A;  1KTQ A;  2F1H A;  4UAW A;  3RJJ A;  2VJ5 A;  3D2Q A;  4MF8 A;  5KFM A;  5J2J A;  3GII A;  4YVZ A;  4F4Y A;  2C22 A;  8ICF A;  3TAQ A;  4JV0 A;  1PVQ A;  3KFU F;  4I2I A;  2A1J B;  5DBC A;  3QU7 A;  2LPE A;  1BPD A;  4O5K A;  3FC4 A;  2F44 A;  2AJQ A;  4O3O A;  1L6N A;  2KV2 A;  1PK1 A;  3AEV A;  2DKZ A;  7ICQ A;  5HR7 A;  3M8R A;  8ICB A;  4C80 A;  1SV0 C;  3PX0 A;  3D2S A;  1BGX T;  1F5S A;  2AGQ A;  3RFA A;  2E8P A;  4QWE A;  3MR6 A;  2ZUB A;  4KTQ A;  2JRZ A;  2H3Z A;  4KX5 A;  3TAP A;  1JRO A;  1KL9 A;  3SV3 A;  1NK9 A;  5ALW A;  4QZ9 A;  1JAL A;  5D49 A;  9ICN A;  1C7Y A;  4ECQ A;  8ICH A;  4TUR A;  5ALO A;  4B9T A;  8ICX A;  3PW0 A;  3PX6 A;  1SXD A;  3BZC A;  2ZUC A;  2G5H B;  2MSN A;  2JV3 A;  2ZIV B;  3PMN A;  3QYP A;  2XCA A;  2V4R A;  1U48 A;  9ICJ A;  5AK3 A;  2W54 A;  3QUQ A;  4PHE A;  3IN5 A;  4PGX A;  5IIK A;  4R63 A;  3HIL A;  5DQI A;  7ICU A;  2W9B B;  5J2E A;  1ZQH A;  2I9G A;  3RR8 A;  2E3T A;  5DGB A;  1S5L U;  4IQT A;  3AL0 B;  1ZQQ A;  9ICR A;  5L9X A;  4KLH A;  1UA1 A;  4M9L A;  4C4R A;  1OUQ A;  5J2H A;  2ZJA A;  1FFU A;  3M6Z A;  5J0U A;  4KMU A;  5AI9 A;  5C5J A;  1ZJM A;  2W9C B;  2WF6 A;  2BKE A;  3QUT A;  2KZM A;  4QJF B;  2ZJ5 A;  5KFA A;  7ICO A;  4DL2 A;  1T8E A;  5KFH A;  3OTQ A;  1L3T A;  2R8I A;  4DSK A;  3CW2 C;  1Z3E B;  3ED5 A;  3C1Y A;  5AKE A;  2ZUD A;  3K75 D;  1RXV A;  1QSY A;  3DV9 A;  2DFL A;  2PI5 A;  8ICJ A;  1DRG A;  3GIL A;  4F4W A;  4IRD A;  3H0M B;  4UAT A;  4GC6 A;  2WFA A;  3SYZ A;  3QEB Z;  1CI4 A;  7ICK A;  2WB1 F;  2LM1 A;  4PHP A;  4XRH A;  3CP8 A;  4NWI A;  1SZH A;  1N5W A;  5KFK A;  3PR4 A;  3PNC A;  1V97 A;  3EPI A;  2QB0 A;  2JZB A;  4E0D A;  4QWD A;  2Z7J A;  2IMW P;  4CGZ A;  9ICE A;  4UB2 A;  3F2C A;  5KG4 A;  4NL9 C;  1ZQ1 C;  4RQ7 A;  3BJY A;  1Y88 A;  2HBM A;  2IOF A;  5FP0 A;  2ZIU A;  2JEG A;  1BVS A;  2WF9 A;  5KFR A;  2IBK A;  9ICG A;  2XGP A;  1X40 A;  2HW3 A;  4F2R A;  1YT3 A;  1CUK A;  4KN7 A;  2KJ5 A;  5CR0 A;  4RUA A;  2IOH A;  1RPL A;  4I2D A;  3H8M A;  1DGJ A;  2MUT B;  2ZIW B;  5JRT A;  4DQI A;  8ICA A;  1U9L A;  1XO0 A;  4EEK A;  1ZQY A;  2YQE A;  4OJP A;  3BDP A;  1N62 A;  2F76 X;  3PW2 A;  4KLE A;  4DQR A;  5J2B A;  4YMM A;  3SQI A;  2LKY A;  4JK1 A;  4PL2 A;  1O03 A;  1PZN A;  5TIS U;  1WWV A;  1ZQN A;  4R8U A;  3A0H U;  2XO7 A;  1ZYQ A;  5J29 A;  4DOA A;  4PH5 A;  3RH4 A;  3GQC A;  3GDX A;  5KT6 A;  5J2C A;  3M8S A;  3ETR A;  5G5G A;  9ICC A;  1TK8 A;  4LZD A;  5KFP A;  4DFP A;  3UXO A;  1F44 A;  5AKX A;  4ICA A;  2ODG A;  2DPJ A;  4QWC A;  5DKW A;  2PFO A;  1T94 A;  4GXJ A;  4F71 A;  1ED1 A;  5CP2 A;  1MN8 A;  1ZQC A;  2HBL A;  5J2I A;  3I1Y A;  3ISB A;  3FYH A;  1ZQG A;  2KZZ A;  3K1Z A;  5KFE A;  1UQV A;  1UT8 A;  4AYB C;  1SWW A;  5AKI A;  3KKA C;  4PGQ A;  1ZQL A;  1OXJ A;  4EEY A;  3LWM A;  3RB3 A;  5L1L A;  4QZA A;  5HML A;  2C28 A;  4RPY A;  5AHX A;  1L7P A;  1QSS A;  2V9W A;  2HVH A;  2BPC A;  4EZ6 A;  3IG5 A;  5CWR A;  3RJK A;  2RP5 A;  2FMS A;  2UVW A;  4FZM A;  9ICM A;  4GFJ A;  2OXO A;  4O3Q A;  4C8L A;  1FFV A;  4GC7 A;  1ZQF A;  2RHF A;  2NO4 A;  3H7I A;  3ZDC A;  5DLG A;  2P35 A;  4Q45 A;  4YN4 A;  4KLF A;  5AK6 A;  3RB0 A;  5DB8 A;  2W9M A;  1TV9 A;  2D6F C;  1TK5 A;  5KFZ A;  1NK6 A;  3K4G A;  8ICR A;  5ALL A;  4P0P B;  3UXN A;  5ALF A;  3EPG A;  5ALP A;  3NUQ A;  2HBJ A;  4Y2Q A;  8ICQ A;  3PO5 A;  1N60 A;  1X66 A;  4FE3 A;  1ZQB A;  1WCL A;  4M0A A;  3BS5 B;  3EZ5 A;  2E1E A;  1CEZ A;  4KLS A;  1SL1 A;  2BDP A;  1D9D A;  3MR3 A;  3LK9 A;  3JPP A;  1NK8 A;  3H0L B;  1ZQX A;  4J9K A;  3ZDA A;  4C7Z A;  2PKE A;  3UMG A;  3WU2 U;  1Q3U A;  1KRP A;  4YD2 A;  4YR2 A;  5J0Q A;  3WKD A;  2Y1I A;  3IM1 A;  3OSN A;  4OJ6 A;  3KHH A;  7ICM A;  1DGS A;  2RDI A;  4QZF A;  1XS9 D;  2NYV A;  4DSF A;  5ALX A;  4FS1 A;  1PUZ A;  1SGG A;  4KLG A;  4RUC A;  4I2A A;  1Z4N A;  1IV8 A;  4QZ8 A;  7ICF A;  3UMB A;  4BWJ A;  4MEX A;  5KG6 A;  4RNN A;  4F4X A;  1LB2 B;  2W11 A;  3TAD A;  5KAI U;  3PZP A;  4CCH A;  2KK0 A;  2DBY A;  3A0B U;  3LVW A;  4O3R A;  1Z1V A;  5J2G A;  3DDH A;  3RAX A;  4UB4 A;  2W03 A;  4FBT A;  3ZD8 A;  7ICS A;  2RRD A;  4OD0 A;  3B9J A;  4B9S A;  2VA3 A;  1S8O A;  9ICQ A;  5G5H A;  4DWI A;  4F72 A;  4Q44 A;  4O0I A;  4TQR A;  1ZJN A;  3QUC A;  4DOC A;  2HDO A;  4TUP A;  2ISO A;  1EXN A;  4DLE A;  4I2E A;  2A1J A;  2WF5 A;  2KFN A;  2FPL A;  2J6U A;  3MR2 A;  5KT2 A;  1ZD5 A;  3V6J A;  3T3F A;  2R18 A;  5C0Y A;  2H3I A;  1HJP A;  3J81 j;  3WKC A;  1UCV A;  2UVR A;  3HJE A;  5ALV A;  2WF8 A;  4KLJ A;  3G6V A;  4DSI A;  2JH7 A;  5KL8 B;  2NRZ A;  5J2F A;  5L1M A;  2BZF A;  3MR5 A;  3V6H A;  4ELU A;  3NS1 A;  4I2C A;  1XSN A;  4IQU A;  2HHW A;  2PMZ C;  2HSZ A;  5ALK A;  4PHA A;  3RR7 A;  5EWF A;  8ICW A;  4I27 A;  4QZC A;  5KTQ A;  3N7R C;  2OCE A;  3AUO A;  3QU9 A;  4KLU A;  2H3F A;  4P4O A;  3UQ0 A;  3KZX A;  3D6J A;  4MFA A;  3AQF A;  2JHD A;  1QQ6 A;  3WK7 A;  4IRK A;  5JU5 A;  2ISP A;  4MFC A;  2HHV A;  1YZ7 A;  3MBY A;  2EZZ A;  1X9S A;  1TKD A;  1FEZ A;  9ICV A;  3RB6 A;  3KZI U;  4Z6D A;  2GWS A;  1CRX A;  2O6K A;  4GIB A;  1JI7 A;  4Q8F A;  4NLG A;  1KEJ A;  4UAV A;  3HKZ F;  4M47 A;  2W9B A;  2EAO A;  3IP4 B;  2F2A B;  2BCU A;  4DO9 A;  3RB4 A;  4B9U A;  4OO1 J;  3C2M A;  3C1Z A;  2PFP A;  4P0Q B;  5IIO A;  5J2K A;  4ED7 A;  5CB1 A;  2XIC A;  1P7D A;  4ED3 A;  4XA5 A;  1UT5 A;  1V38 A;  8ICK A;  2W9C A;  2JMG A;  3G6Y A;  1KBU A;  4NLB A;  4QZI A;  4KLI A;  3WKB A;  4PZO A;  1QSL A;  4UB1 A;  1LKY B;  8ICP A;  3LVV A;  4ACO A;  3SD7 A;  1Z00 B;  2HOF A;  1S0V A;  2KOB A;  1NJY A;  1KLN A;  2QKQ A;  2DL0 A;  2HOQ A;  3THV A;  1SKS A;  2VA8 A;  3MC1 A;  3E0F A;  3MGH A;  2AHO B;  2BR0 A;  2E8O A;  5EE3 A;  3N97 B;  3PSI A;  5AI6 A;  4WJ3 B;  2H3Q A;  2IHN A;  4ED8 A;  2NV3 A;  5KFV A;  5DQH A;  3RTV A;  4GXI A;  1JXL A;  5L1I A;  1SL2 A;  5J0O A;  2FJ6 A;  4Y2R A;  4XUS A;  8ICL A;  1SZP A;  1DOQ A;  2BQ3 A;  2J6T A;  2KVC A;  1ZQK A;  2G5I B;  2HHU A;  1PVR A;  4RU9 A;  4Y2Y A;  3T5K A;  3C5G A;  2VKQ A;  3IDW A;  1ZQA A;  5ALN A;  5KFN A;  2KEY A;  1DK3 A;  1MC8 A; 
#chains in the Genus database with same CATH homology
 2QB0 A;  1SXD A;  5KNI A;  2LMR A;  3TAD A;  3BQ7 A;  2Y9U A;  1JI7 A;  2ESE A;  2JV3 A;  5J8Y A;  4NL9 C;  1Z1V A;  2EAO A;  3K1R B;  3SEI A;  2QB1 A;  2YTU A;  2B6G A;  2EAN A;  1SV4 A;  2QB0 B;  2FE9 A;  1SV0 A;  1LKY A;  4PZN A;  3HIL A;  1X40 A;  3TAD C;  1V38 A;  1WWU A;  5J8Y C;  2ES6 A;  1F0M A;  1SXE A;  1B0X A;  4PZO A;  4IS7 A;  2K4P A;  2F3N A;  3SEN A;  1LKY B;  3H8M A;  1UCV A;  3BS7 A;  2Y9T A;  1COK A;  5JRT A;  2F8K A;  1PK3 A;  5JTI A;  3BS5 A;  2EAM A;  2DL0 A;  2QKQ A;  1B4F A;  5L1M A;  2LPE A;  2KIV A;  2E8M A;  2KE7 A;  1V85 A;  2KSO A;  2F44 A;  2E8O A;  1X66 A;  1WWV A;  4NL9 A;  4MHV A;  3BS5 B;  2L5Y A;  1PK1 A;  2QAR A;  2KMD A;  2DKZ A;  5F3X B;  1OW5 A;  2KSO B;  4NJ8 A;  1KW4 A;  1SV0 C;  2DKX A;  3KKA A;  1RG6 A;  1PK1 B;  2QAR B;  2D3D A;  2E8P A;  2D8C A;  2E8N A;  2GLE A;  1SGG A;  3IDW A;  5JU5 A;  2KG5 A;  2EAP A;  3TAC B;  1X9X A;  1UQV A;  1DXS A;  2K60 A;  4RQN A;  3KKA C;  1OXJ A;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...