2JRZA

Solution structure of the bright/arid domain from the human jarid1c protein.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
SMNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVCNTRPFDNEEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1C
publication title Backbone and sidechain 1H, 13C and 15N resonance assignments of the Bright/ARID domain from the human JARID1C (SMCX) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 117
sequence length 117
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jrzA00
2EH9A 4LJXA 1IG6A 1KQQA 2OEHA 1RYUA 2KK0A 2RQ5A 2EQYA 2LM1A 1C20A 2CXYA 1KKXA 5K4LA 2JRZA 2JXJA 2YQEA 2LI6A 5CEHA 1KN5A
chains in the Genus database with same CATH superfamily
1SV0A 1ZQRA 5ALGA 3ZI4A 4RQ6A 2AQ0A 1BPYA 2KK0A 4I29A 2K8AA 4UQGA 3H0MB 1BVSA 4M6WB 5KFKA 2HHVA 2KNJA 5BOMA 5EWFA 4BX9C 1ECWA 3Q8MA 1SL2A 3OPXA 1VDVA 1T3QA 2F76X 1T4GA 5J0YA 2JZBA 4I2AA 1KEJA 4KLSA 3SYZA 4I2FA 3FC4A 4GLXA 1TAQA 2JH1A 2QB1A 5HR7A 2G5IB 3QUCA 2ZXHA 4Y2VA 1NI3A 3ETRA 5AI4A 4EX6A 7ICOA 1MN8A 2KICA 4ED7A 2I6XA 4F92B 4UW9A 3A0HU 4DSLA 3H40A 5DDMA 2ISPA 4QW8A 4DFPA 4IR1A 2Y9TA 5TZVA 2BCVA 1NK4A 3G6VA 1DK3A 4NLCA 2WB1F 1X9SA 1V85A 4FBUA 5ALIA 1KL9A 5KFAA 1QQ5A 3G6YA 2FMSA 4UB6U 3UXNA 1FFUA 3UXPA 1D9DA 1COOA 2JEJA 4F5RA 4B9TA 3V6HA 4KLTA 4KLQA 2HHSA 5AIAA 1BGXT 4F4XA 1ZETA 1PZNA 3NUQA 3ETLA 3AMZA 4RNNA 3JPQA 7ICPA 4J9OA 2YB1A 1NK0A 3R9KA 1QTMA 3OJSA 2C2DA 1U49A 4OJ5A 3C1ZA 3C28A 5AKKA 1ZQJA 5J0RA 1MQ2A 3JPRA 2H3IA 2RDJA 8ICHA 4F5NA 2LMRA 9ICNA 3WKDA 2HHXA 2W11A 5KFLA 2CRXA 2CXYA 3RH5A 4LVSA 1OXJA 2AQ4A 7ICUA 5J2DA 5JRTA 3IDWA 3KBBA 3OSNA 2Y0SF 1RYUA 3TADC 3QYPA 1HUZA 2W03A 3EPIA 5KFHA 2DPJA 3F2DA 1SKRA 4QZAA 3FDSA 4YD1A 4RU9A 1SGGA 3U26A 4M0AA 2NYVA 4BXOA 2YTUA 4ED8A 4F93B 4FBTA 1J97A 5DGAA 4XQ8A 3SEIA 2I9GA 4NLZA 2PMZC 2KZZA 2ZIVA 1NZBA 2K4HA 4J9KA 4OJOA 2KZ3A 1X66A 2W9CA 5AKEA 3MC1A 4DQSA 3HJEA 2LBOA 4J03A 4R8UA 3MDAA 5KL8B 4XUSA 1CI4A 2NRWA 4M9NA 4P0PA 4EENA 9ICXA 1D8YA 2JEGA 4IC9A 5KFYA 4DF4A 5DBCA 3NVZA 8ICFA 2V4QA 2IA6A 7ICMA 5KG1A 1O08A 2PFNA 2WAQC 4UAZA 1HEKA 2HDOA 5HHIA 2KG5A 3PV8A 2KJ5A 3JPTA 2JR5A 3EW9A 5H2FU 3EYZA 8ICJA 5J0OA 4IRCA 3HW8A 1RQLA 1T3NA 3C2MA 1A76A 4PPXA 1TVAA 2HVIA 4JV0A 8ICVA 3RBDA 1ZQQA 2LPEA 5AM2A 2MU2A 2W04A 5F9LA 1WWVA 2FI1A 4DSFA 9ICAA 3C1YA 3LDAA 1N2XA 4P2HA 4CGZA 3MFHA 4B9UA 4ELUA 3LK9A 5DBBA 4U6PA 5AI0A 1RXVA 4KN7A 2FMPA 1Z4OA 1YZ6A 1HIWA 2LYHA 2EAPA 2BDPA 9ICOA 3CNHA 2JV3A 5ALPA 1SXEA 2YMPA 5AKLA 4F4WA 4DL4A 2W9BB 3AQEA 4J9LA 1ZYQA 1LKYB 3N97B 2EDUA 3GV5B 1ZD4A 3OSPA 4NV0A 2Y1JA 5HP4A 9ICWA 3RH4A 3KZXA 9ICEA 2BCSA 2KFNA 3WK9A 5ALFA 5KTQA 2NRTA 2OM6A 2PMZF 4UARA 5ALVA 2PFOA 3EUB2 2OYYA 8ICOA 3C5GA 4Y2PA 3K1ZA 2LKYA 4TUPA 4GXKA 4RQ3A 2HHUA 4MEYA 1L3UA 4JUZA 4QZFA 2OCEA 1K1QA 5KFFA 5EE0A 1XO1A 3RTVA 1VJ5A 2KVSA 4GC6A 2PKEA 3LWLA 4DL5A 1U45A 1HJPA 4YMNA 1RXWA 2JHDA 2WAQF 3SENA 4O9MA 3PX0A 5CHGA 1Z19A 2BZFA 4UAYA 5CB1A 1ZQGA 5DB7A 3AN1A 2VA3A 3RR8A 5DG8A 4BUGA 1M6YA 3A0BU 1QQ6A 4M04A 2E8MA 2GOLA 2XGQA 3HX0A 3ISDA 3BS5A 2W9AA 2KZMA 2H3QA 5KFIA 2LYBA 3PNCA 2K4PA 1Q46A 4Q45A 2PFQA 2FLPA 3F5AA 1RYSA 1RDFA 4IQVA 2PFPA 2KKPA 3MR6A 4BWJA 4DOAA 1J2MA 4DSEA 4C0ZA 2WF9A 1WG8A 3FAHA 2ZUDA 4EBCA 1B43A 1ZRMA 4C8NA 1XNSA 1WCLA 4NLBA 1WYGA 4DL7A 4EZ6A 7ICIA 5KFJA 2ATLA 1L8LA 4QIWC 4ECYA 4M9GA 7ICHA 9ICRA 4PGYA 4FS2A 4MF8A 8ICUA 1N62A 3QU2A 3UPQA 2L5YA 4ECQA 1Q8KA 3PR5B 2KVCA 3QX7A 3H8MA 5ALLA 4BGDA 1CEZA 1SIJA 3GV7B 3BQ2A 2H3VA 4RQ7A 5KFRA 1QSSA 7ICQA 1NJYA 2NO5A 4ELVA 4J9MA 4UB2A 5L1KA 1UT5A 2E3TA 4ECXA 2P6RA 2OXOA 4HYKA 4PGQA 1ZQ1C 5J8YC 1COKA 2CN1A 5J0SA 4RUAA 4EBDA 2W8LA 4TQSA 1WUDA 1K5OA 3ED5A 3PW5A 4O5EA 5C5JA 4RQ1A 3I76A 8ICMA 2K89A 4X5VA 5EE9A 3QZ8A 9ICMA 3MGVA 2ZIWB 4PHEA 2ZIUB 4E0DA 2KJ8A 1A77A 1T8EA 5KFVA 3CW2C 2DKXA 4M2YA 9ICCA 3WK5A 4K4HA 4KMUA 3IRUA 4B9NA 2R8IA 5IIIA 2RRDA 2KKVA 1RZTA 2W9BA 5J2HA 2KV2A 4IL6U 5AKHA 3C2KA 5ALTA 2LM4A 4QIWF 3RJEA 1S0MA 4QNLA 1Q3UA 2KTQA 3QUQA 5KFUA 4A8EA 5DQGA 3GFKB 3M6ZA 4I2JA 3GIMA 1KDHA 7ICGA 1H38A 3PW7A 2BPFA 4HAIA 4I2GA 2LI6A 4ZOHC 4GXIA 2BPGA 1J2NA 3QNMA 3T3FA 1WWUA 1FEZA 5GTHU 7ICKA 2DF4B 5J0QA 2HHTA 1L8OA 1X6IA 4OCZA 2AJQA 1JX4A 1SWVA 4R66A 3OHBA 1AROP 4QZCA 3T5HA 2W54A 5AK5A 2VJ5A 4C8LA 3TADA 3H8JA 1S9FA 5IIJA 4OD0A 4C4RA 5ALQA 2WFAA 1U47A 2VANA 2R8GA 3KFUF 3G6XA 4UBCA 4RQ2A 1IV8A 1FO4A 4ECSA 1FFVA 2WB1C 2ALZA 4O3RA 4CNQA 3QUBA 5ALUA 4YVZA 3B9JA 1QCKA 1ZQOA 3OHAA 3PX6A 1PK1B 3N28A 2BQ3A 3AM9A 1B0XA 2UVUA 2FMQA 4I2BA 4O3OA 3BS7A 1ZQEA 1KLNA 5AM4A 2BGWA 4Y2XA 2DPIA 3M7DA 4YMOA 2PXIA 4YP3A 4DLEA 5AKXA 3Q8LA 3NRZA 3PMNA 2ZJ8A 2HI0A 1ED1A 5J0PA 2W8KA 1RM6C 5AI8A 2ASDA 5HHHA 2HBKA 4RQ4A 4RPYA 1NKBA 5A0LA 9ICKA 4EBEA 1SZPA 2Y0SC 5J2JA 9ICLA 2AH5A 3PO5A 4GC7A 2E1EA 4EX7A 2IHMA 3RR7A 3HRDD 2A1AA 3ALRA 2KIWA 3HT3A 4O3SA 3BQ1A 2ZIUA 2C22A 3WK8A 1UA0A 2RDIA 1X6JA 5KG6A 3T79A 1KFSA 3F2CA 4UB8U 1U9LA 2B6GA 4EZ9A 5D49A 1JXLA 2AXTU 1Z1BA 1TV9A 2J6SA 8ICRA 4QWBA 2DUYA 4M47A 3BQ0A 3ZDCA 3RF9A 5ALMA 2MUTA 3BQTA 4RZRA 7ICRA 2KEYA 4FZNA 1KRPA 5J0XA 4QZEA 4YR3A 5ALZA 2PI5A 1X42A 4AP9A 2V9WA 9ICPA 5DB9A 3C23A 2XIDA 4ACOA 4DFDA 4DFKA 5KFGA 3KZIU 1CUKA 5KL1B 4YD2A 4Z6FA 2XY5A 4AYBC 2KD1A 3K1RB 4ECZA 1UA1A 4F4KA 4O3PA 3D2QA 2KSOA 2BKEA 7ICSA 7ICLA 1PVPA 2JRZA 4MF2A 4O3QA 4TUSA 2HBLA 3TARA 3RB4A 4RPZA 3MDCA 8ICPA 4QZGA 3C29A 4DQPA 2G07A 1DOQA 1L7OA 3PO4A 4G9BA 4Q8FA 8ICTA 2QKQA 1MA7A 2G0AA 1NK7A 4GFJA 1N56A 4QZ9A 4Z6EA 2RLTA 5KFEA 2QARA 4P0QA 3NVVA 4QJFB 1NK5A 5KT6A 1QSLA 5HR6A 2R18A 1OUQA 2C2RA 5G5HA 4UAUA 3SAFA 2F1IA 1PK1A 1JXEA 3L5KA 2IOFK 1Y88A 1BPDA 2GLEA 4B9SA 5J2EA 1N5XA 4OJPA 4FS1A 5HMLA 2YMQA 3RRGA 3WU2U 4O5KA 2VKQA 3T5KA 3WK7A 2WF8A 2EAOA 1WCNA 4YXMA 5KG5A 3RJKA 2FE9A 4CRXA 2KIVA 4F3OA 4QWEA 1X40A 1YZ7A 1JN3A 3PZPA 4M6WA 2K60A 3GIKA 2LHTA 4QWCA 4AYBF 4UB3A 5J8YA 4YXJA 4YG2A 4CDGA 5JTIA 4IR9A 1SV0C 4Y2SA 3PW0A 5L9XA 4NJ8A 1NJWA 5IIMA 1QH9A 5EE3A 4F4YA 1L7NA 2WF5A 4PHDA 2XCAA 3LVWA 1OW5A 4LZDA 5ALNA 2UVVA 4B6JA 2A1JB 3GIIA 2DQNB 3T5JA 2DKZA 8ICKA 4KN4A 4YMMA 1ZXIA 3MBYA 3EPGA 3MR2A 5G5GA 4QZBA 1JROA 4CF5A 8ICAA 4RQ8A 2CPRA 4DSIA 5AK6A 5KNIA 4PGXA 1PVQA 8ICSA 2ISOA 2A3VA 2ZUCA 5AM1A 3QEBZ 2PI4A 3NASA 5D4BA 4PZOA 4KLUA 1ZQZA 3M6KA 1ZQDA 2G5HB 4US9A 5DBAA 5J2KA 3C21A 3PVXA 5DKWA 3F5EA 2VIXA 3ZDDA 4I2CA 4JWMA 4DOCA 3M9MB 3F2BA 3V6KA 5ALYA 4B9MA 2G09A 4QWDA 1S76D 3UMBA 3QE9Y 1XSLA 5F3XB 4R63A 4KLEA 4NL9C 5J0UA 5JU5A 1UCVA 1X9XA 3BDPA 7ICNA 1O03A 4NXZA 4QWAA 3GV8B 1NZPA 2HCFA 3RJGA 3I28A 3AUOA 4PH5A 1BNOA 2P35A 2HHWA 3C5FA 3C2LA 5L1JA 2E8PA 5CRXA 1KBUA 2FPMA 3WKEA 5K4LA 4ECRA 3CYMA 2ASLA 1A6SA 1RYRA 3PR4A 2HW3A 1ZOLA 3JPSA 3Q8RB 4RQMA 2F8LA 2AGPA 4C4TA 1KFDA 4C8MA 4BWMA 1MC8A 2P66A 5DB6A 4DSJA 1NNLA 3AQFA 5CA7A 1B4FA 5ALSA 3QZ7A 2HVHA 5C0YA 3PSPA 5DQIA 9ICTA 4DLGA 5L1LA 1PUZA 4DL3A 2WF6A 1SZHA 1UHUA 2XCPA 2JEFA 1Z3EB 3L3FX 4UATA 5KFTA 3KHHA 2BCRA 3PSFA 3SR6A 2OHFA 4CF4A 2KN7A 4EYHB 3KOOA 1Z00B 8ICQA 3FYHA 3H4DA 4KLFA 2JEIA 1LVHA 1S5LU 2VA8A 2YX8A 1ZQKA 2D3DA 4KLOA 9ICIA 2F1JA 2RQ5A 4JV1A 2ZTDA 5J0TA 5AK4A 5ALEA 4PZNA 3TI0A 5ALRA 2IOFA 3GU3A 2RP5A 4IQWA 3MFIA 3KHRA 4U7CA 3OJUA 1XSPA 2YY6A 4ED6A 9ICJA 4FFDA 2C2EA 2F44A 2JZBB 3V7JA 4ECTA 3RAXA 4MFAA 5L1MA 2EH9A 1DXSA 4QZ8A 4PL2A 5BPCA 1ZJNA 1NKEA 2KP7A 4ED1A 8ICNA 3ZDEA 2HOQA 1JIHA 5J2IA 5AICA 5ALHA 2Y1IA 3WKBA 1LKYA 4OO1J 4M9HA 1S97A 1D8LA 3ISCA 5T14A 4J9PA 1RQNA 4IS7A 4P4OA 2V4RA 2QB0B 1D9FA 3KKAC 4PL1A 5KG2A 2F3NA 2UVWA 3N7SC 1ZQCA 3WK4A 1FIQA 2MSNA 4JK1A 1ZQMA 1SWWA 3QEAZ 4DL6A 1BNPA 2AGOA 2P6UA 4F72A 4RNOA 2ZUBA 3IP4B 3QU7A 5AKGA 2BCUA 4ICAA 3AEVA 1N63A 2QLTA 3QU9A 3AU6A 1JMSA 2DL0A 2EZZA 2G08A 2R8HA 3M8SA 1SL1A 4IRDA 3D2SA 2XY6A 5KT7A 3H0RB 2VA2A 2XVTA 4QW9A 1N5WA 2ZIXB 2W43A 5ALOA 4TURA 5E79U 1ZQSA 2DWQA 4LZGA 4OJ6A 4FZLA 2MAXA 3QU5A 1N60A 4C8OA 8ICIA 3BZKA 3M9OB 3SV4A 4NM1A 3QXGA 3MABA 4YQWA 1S77D 5AKZA 2B0CA 2BDUA 2W9MA 4RQ0A 3BJYA 5KFQA 5J2CA 3V7LA 1U48A 2MRLA 3ZD9A 1SV4A 5DG9A 1KQQA 5AI6A 4KLGA 4F5PA 2FJ6A 3RB6A 3N4MB 2W7PA 2KFZA 2EZXA 2KHQA 4NLNA 4UASA 1L3TA 5HNKA 3GQCA 2XICA 1JUDA 8ICBA 1V38A 2BR0A 3RJFA 1L6NA 5GTIU 3SD7A 4ED2A 5AM0A 3MGHA 5ALXA 3ORYA 1BPBA 4DFMA 2ODGA 2HMXA 3LWMA 4RNMA 4QZHA 2W9CB 4OJLA 3SV3A 4CCHA 2AU0A 1Z00A 3UQ0A 3V6JA 4F8RA 1SKSA 2AHOB 1XC9A 1PK3A 2EANA 5KG7A 8ICEA 2IMWP 8ICCA 1ZQUA 3Q8PB 3HILA 3NTUA 2FLLA 1UPHA 2J6UA 4Y2YA 1YT3A 1KSPA 1Z4NA 3CRXA 4YR2A 1DRGA 2JGAA 4Q43A 4UB4A 3PSIA 1V9PA 4CE6A 2KHVA 5KFMA 4EYIB 3B0YA 3LYSA 4DO9A 1ZQXA 5AI5A 2ZIWA 5HMMA 1MSWD 5KG0A 1L3VA 4F50A 5AKYA 5AI9A 5DG7A 1T94A 4DSKA 1S0VA 2KJ9A 4O3NA 5KFNA 5AIBA 3SQIA 5KFDA 4RPXA 5DLFA 2WTFA 2RHFA 1TE2A 2GH1A 2GO7A 2XGPA 4J9QA 3IG5A 3UXOA 5B66U 1QQ7A 5J29A 1ZQHA 2FLNA 1NK8A 4O0IA 1ZQAA 3QU4A 5DLGA 5J2AA 8ICXA 2QB0A 2DBYA 4UB1A 4NM2A 2R8JA 4RQNA 2LM1A 3HKZC 3SMVA 3J81j 4I2EA 3PX4A 2Y9UA 4Q44A 4MFCA 5D46A 5KAFU 3BQ7A 2ZG6A 1ZD3A 2F77X 1A0PA 3UMGA 4DQQA 5FP0A 3HPOA 5IILA 4IRKA 2IHNA 2OEHA 4GIBA 9ICVA 4ECWA 2KOBA 3K75D 3GZFA 1C20A 4NL9A 1ZQFA 4UAWA 4KMOB 4J9RA 5J0WA 2ZIXA 3N7RC 2K8CB 5ALWA 3M8RA 4ED3A 1ZD5A 3RJIA 2DFLA 2GWSA 2XY7A 4NLGA 1URJA 1S0OA 1NJXA 4DS5A 3ONNA 1ZQTA 4YFKA 5AM3A 2FDRA 1ZQNA 2M9NA 1HUOA 2W55A 1S10A 3L4PA 4JWNA 1X2IA 5EE1A 2WF7A 2EZYA 3BS5B 2J6TA 4TUQA 2YB4A 1BPEA 4US8A 3D2NA 3RH6A 4FO6A 4DL2A 2HSZA 4ELTA 8ICWA 1IM4A 1VLBA 5EWGA 5TISU 2JMGA 5KT2A 9ICBA 1QSYA 4G3IA 4KLHA 1ZQVA 5KAIU 3RB0A 3ISBA 4KLDA 2K8BB 4Z6CA 4NY8A 1TK5A 3I1YA 5KFSA 1NOMA 4KX5A 3HKZF 3IG8A 4F91B 2XO7A 4FZMA 5DGBA 1QLNA 4DWIA 9ICSA 4B9VA 1ZQPA 3PMLA 2LYAA 4XRHA 4UAVA 2K4EA 4DCCA 2BQRA 3GIJA 7ICJA 3NRWA 4GXJA 3Q8KA 1XS9D 4IQTA 4DOBA 4RT2A 4PHPA 2BHNA 4EEYA 3TANA 2Q0ZX 3T5LA 5J2GA 2KMDA 3MR5A 1KN5A 2H3FA 2A19A 4C80A 5CJ7A 4IQUA 5DQHA 3RFAA 4F71A 3KTQA 4J9SA 3OTQA 3KD3A 5B5EU 1TAMA 5KT3A 2F2AB 9ICQA 4DFJA 4JMUA 5KFZA 2YMMA 9ICFA 3SAHA 4Z6DA 4ECUA 3TQ1A 3IHQB 1DK2A 1XSNA 2HOFA 5KFBA 4NLKA 1JI7A 2HBJA 4QZDA 2ZTCA 2IOHA 2E5SA 4DQRA 2JH7A 4FE3A 3UMCA 3RJJA 3RAQA 4K4IA 4DS4A 1CRXA 2ZTEA 4KTQA 2BCQA 2W3SA 5L1IA 3RJHA 2NV3A 4MHVA 3THVA 3HWTA 3KKAA 3H8WA 3PW4A 1S0NA 5CWRA 1LV5A 1KFTA 1UT8A 1N61A 4PHAA 1DGJA 1XO0A 2H3ZA 5AKIA 1L3SA 3DDHA 3LVVA 2B21A 1EXNA 3ZD8A 2ZJ5A 2HHQA 1AQ6A 1RPLA 4CF3A 2YN4A 3N7PD 3TFRA 3NGDA 4RUCA 4EELA 4M9LA 3IM1A 4NWIA 7ICVA 4MFFA 1ZQLA 2M0NA 1TAUA 3F53A 4F4ZA 4WJ3B 2NRVA 5JUMA 5ALJA 2W7OA 4K4GA 5KT4A 5CR0A 2NO4A 4P4MA 3UQ2A 5CEHA 3HP6A 3WK6A 1IXRA 1L7PA 4M9JA 3Q8QB 1L7MA 3SAGA 2E8NA 4F2SA 3H0LB 3H7IA 2Q4TA 2D6FC 7ICEA 3B0XA 4RQ5A 5KFXA 2KE7A 2UVRA 4B9LA 1Q3VA 2YQEA 3JPPA 5F9NA 5AKJA 5KG4A 2G06A 3ZDBA 2EAMA 1BPZA 3OGUA 1TKDA 1D8BA 4R64A 3E58A 2E1FA 5BOLA 9ICUA 5KT5A 3RBEA 3K4GA 3PW2A 4BDPA 3M9NB 2JXJA 5AHXA 2D8CA 1SB3C 3NS1A 5AM5A 4KLIA 1GO3F 4BJQA 2ASJA 4ZH4A 5EOZA 1F5SA 3BZCA 2K4IA 4YCXA 2ZXIA 2O6KA 1TK8A 5ALKA 1F44A 3H8SA 4MEXA 1MQ3A 4USAA 3H4BA 2OWOA 3RRHA 3ZDAA 2C28A 4UBBA 2H5XA 4KLMA 1KTQA 1RG6A 2WHEA 3DEEA 1ZJMA 5KFWA 3JPOA 4I28A 1P7DA 3IV6A 2R8KA 1KW4A 3EZ5A 9ICHA 2HOIA 3TKAA 2F1HA 3UM9A 3M1YA 2FPLA 4Y2TA 4R65A 1T7PA 4C7YA 1XWLA 2A1JA 4Y2QA 3Q8SB 1SL0A 1PVRA 5J2FA 4F2RA 4C7ZA 4YR0A 2E8OA 8ICGA 4DQIA 1F0MA 3GILA 2N1RA 1ZQIA 1V97A 4Y2RA 3V7KA 4ECVA 5CP2A 2XC9A 4KLJA 2ZJAA 3EWAA 1ZQWA 5EWEA 3S6JA 1DGSA 1SXDA 1XU4A 4KITB 4TQRA 2EQYA 2I1QA 1UQVA 5DDYA 3AL0B 2DGZA 1Z1VA 1U4BA 4I2IA 3SZ2A 1TK0A 3TACB 1L5UA 1X9WA 4KX3A 3V72A 4ED0A 4KLLA 2MUTB 3WKCA 8ICYA 1X9MA 4JB3A 4O3MA 3KHLA 4JV2A 1NJZA 5IINA 4P4PA 4Y2UA 3PY8A 2ESEA 4PJ0U 3NVYA 1IIPA 8ICLA 2ES6A 5IIKA 5AK3A 4Q8EA 3VC8A 4RT3A 1KKXA 1N48A 1BPXA 1NK6A 4I2HA 1B22A 4I2DA 2YMLA 3TAPA 2F8KA 4EEKA 5J2BA 3ICXA 1ZRNA 4YN4A 5DB8A 4O5CA 2MA1A 3KHGA 2FPKA 4J9NA 4C8KA 4XA5A 2NRXA 5IIOA 2NRZA 2KSOB 4Y2JA 4C4SA 3WKAA 3VCBA 1ZQBA 3QUTA 3D6JA 3E0FA 2HBMA 2VJ4A 3JPNA 1JALA 1ZD2P 4LJXA 1IG6A 5ALDA 1TFRA 1ZQYA 3TFSA 1LB2B 3MR3A 3GDXA 4UB5A 1NK9A 1K1SA 3NVWA 3PSTA 3TAQA 1C7YA 4F5QA 4DF8A 1JRPA 9ICGA 5KFCA 3RB3A 3AU2A 7ICFA 2QARB 3SI8A 5KFPA 2OH2A 4P0QB 2BQUA 4BXOB 2AGQA 4F5OA 3IN5A 3E2EA 7ICTA 2Z7JA 3CP8A 2XI9A 2BPCA 2ZIVB 3DV9A 8ICZA 2I5HA 4QZIA 1NKCA 2W3RA 5KFOA 4R8UB 4I27A 2IBKA 4P0PB 1SKWA 3O0FA 3FM9A 4DEZA 3MGIA 5KG3A 1S8OA
chains in the Genus database with same CATH topology
2EH9A 4LJXA 1IG6A 1KQQA 2OEHA 1RYUA 2KK0A 2RQ5A 2EQYA 2LM1A 1C20A 2CXYA 1KKXA 5K4LA 2JRZA 2JXJA 2YQEA 2LI6A 5CEHA 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EH9 A;  4LJX A;  1IG6 A;  1KQQ A;  2OEH A;  1RYU A;  2KK0 A;  2RQ5 A;  2EQY A;  2LM1 A;  1C20 A;  2CXY A;  1KKX A;  5K4L A;  2JRZ A;  2JXJ A;  2YQE A;  2LI6 A;  5CEH A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 1SV0 A;  1ZQR A;  5ALG A;  3ZI4 A;  4RQ6 A;  2AQ0 A;  1BPY A;  2KK0 A;  4I29 A;  2K8A A;  4UQG A;  3H0M B;  1BVS A;  4M6W B;  5KFK A;  2HHV A;  2KNJ A;  5BOM A;  5EWF A;  4BX9 C;  1ECW A;  3Q8M A;  1SL2 A;  3OPX A;  1VDV A;  1T3Q A;  2F76 X;  1T4G A;  5J0Y A;  2JZB A;  4I2A A;  1KEJ A;  4KLS A;  3SYZ A;  4I2F A;  3FC4 A;  4GLX A;  1TAQ A;  2JH1 A;  2QB1 A;  5HR7 A;  2G5I B;  3QUC A;  2ZXH A;  4Y2V A;  1NI3 A;  3ETR A;  5AI4 A;  4EX6 A;  7ICO A;  1MN8 A;  2KIC A;  4ED7 A;  2I6X A;  4F92 B;  4UW9 A;  3A0H U;  4DSL A;  3H40 A;  5DDM A;  2ISP A;  4QW8 A;  4DFP A;  4IR1 A;  2Y9T A;  5TZV A;  2BCV A;  1NK4 A;  3G6V A;  1DK3 A;  4NLC A;  2WB1 F;  1X9S A;  1V85 A;  4FBU A;  5ALI A;  1KL9 A;  5KFA A;  1QQ5 A;  3G6Y A;  2FMS A;  4UB6 U;  3UXN A;  1FFU A;  3UXP A;  1D9D A;  1COO A;  2JEJ A;  4F5R A;  4B9T A;  3V6H A;  4KLT A;  4KLQ A;  2HHS A;  5AIA A;  1BGX T;  4F4X A;  1ZET A;  1PZN A;  3NUQ A;  3ETL A;  3AMZ A;  4RNN A;  3JPQ A;  7ICP A;  4J9O A;  2YB1 A;  1NK0 A;  3R9K A;  1QTM A;  3OJS A;  2C2D A;  1U49 A;  4OJ5 A;  3C1Z A;  3C28 A;  5AKK A;  1ZQJ A;  5J0R A;  1MQ2 A;  3JPR A;  2H3I A;  2RDJ A;  8ICH A;  4F5N A;  2LMR A;  9ICN A;  3WKD A;  2HHX A;  2W11 A;  5KFL A;  2CRX A;  2CXY A;  3RH5 A;  4LVS A;  1OXJ A;  2AQ4 A;  7ICU A;  5J2D A;  5JRT A;  3IDW A;  3KBB A;  3OSN A;  2Y0S F;  1RYU A;  3TAD C;  3QYP A;  1HUZ A;  2W03 A;  3EPI A;  5KFH A;  2DPJ A;  3F2D A;  1SKR A;  4QZA A;  3FDS A;  4YD1 A;  4RU9 A;  1SGG A;  3U26 A;  4M0A A;  2NYV A;  4BXO A;  2YTU A;  4ED8 A;  4F93 B;  4FBT A;  1J97 A;  5DGA A;  4XQ8 A;  3SEI A;  2I9G A;  4NLZ A;  2PMZ C;  2KZZ A;  2ZIV A;  1NZB A;  2K4H A;  4J9K A;  4OJO A;  2KZ3 A;  1X66 A;  2W9C A;  5AKE A;  3MC1 A;  4DQS A;  3HJE A;  2LBO A;  4J03 A;  4R8U A;  3MDA A;  5KL8 B;  4XUS A;  1CI4 A;  2NRW A;  4M9N A;  4P0P A;  4EEN A;  9ICX A;  1D8Y A;  2JEG A;  4IC9 A;  5KFY A;  4DF4 A;  5DBC A;  3NVZ A;  8ICF A;  2V4Q A;  2IA6 A;  7ICM A;  5KG1 A;  1O08 A;  2PFN A;  2WAQ C;  4UAZ A;  1HEK A;  2HDO A;  5HHI A;  2KG5 A;  3PV8 A;  2KJ5 A;  3JPT A;  2JR5 A;  3EW9 A;  5H2F U;  3EYZ A;  8ICJ A;  5J0O A;  4IRC A;  3HW8 A;  1RQL A;  1T3N A;  3C2M A;  1A76 A;  4PPX A;  1TVA A;  2HVI A;  4JV0 A;  8ICV A;  3RBD A;  1ZQQ A;  2LPE A;  5AM2 A;  2MU2 A;  2W04 A;  5F9L A;  1WWV A;  2FI1 A;  4DSF A;  9ICA A;  3C1Y A;  3LDA A;  1N2X A;  4P2H A;  4CGZ A;  3MFH A;  4B9U A;  4ELU A;  3LK9 A;  5DBB A;  4U6P A;  5AI0 A;  1RXV A;  4KN7 A;  2FMP A;  1Z4O A;  1YZ6 A;  1HIW A;  2LYH A;  2EAP A;  2BDP A;  9ICO A;  3CNH A;  2JV3 A;  5ALP A;  1SXE A;  2YMP A;  5AKL A;  4F4W A;  4DL4 A;  2W9B B;  3AQE A;  4J9L A;  1ZYQ A;  1LKY B;  3N97 B;  2EDU A;  3GV5 B;  1ZD4 A;  3OSP A;  4NV0 A;  2Y1J A;  5HP4 A;  9ICW A;  3RH4 A;  3KZX A;  9ICE A;  2BCS A;  2KFN A;  3WK9 A;  5ALF A;  5KTQ A;  2NRT A;  2OM6 A;  2PMZ F;  4UAR A;  5ALV A;  2PFO A;  3EUB 2;  2OYY A;  8ICO A;  3C5G A;  4Y2P A;  3K1Z A;  2LKY A;  4TUP A;  4GXK A;  4RQ3 A;  2HHU A;  4MEY A;  1L3U A;  4JUZ A;  4QZF A;  2OCE A;  1K1Q A;  5KFF A;  5EE0 A;  1XO1 A;  3RTV A;  1VJ5 A;  2KVS A;  4GC6 A;  2PKE A;  3LWL A;  4DL5 A;  1U45 A;  1HJP A;  4YMN A;  1RXW A;  2JHD A;  2WAQ F;  3SEN A;  4O9M A;  3PX0 A;  5CHG A;  1Z19 A;  2BZF A;  4UAY A;  5CB1 A;  1ZQG A;  5DB7 A;  3AN1 A;  2VA3 A;  3RR8 A;  5DG8 A;  4BUG A;  1M6Y A;  3A0B U;  1QQ6 A;  4M04 A;  2E8M A;  2GOL A;  2XGQ A;  3HX0 A;  3ISD A;  3BS5 A;  2W9A A;  2KZM A;  2H3Q A;  5KFI A;  2LYB A;  3PNC A;  2K4P A;  1Q46 A;  4Q45 A;  2PFQ A;  2FLP A;  3F5A A;  1RYS A;  1RDF A;  4IQV A;  2PFP A;  2KKP A;  3MR6 A;  4BWJ A;  4DOA A;  1J2M A;  4DSE A;  4C0Z A;  2WF9 A;  1WG8 A;  3FAH A;  2ZUD A;  4EBC A;  1B43 A;  1ZRM A;  4C8N A;  1XNS A;  1WCL A;  4NLB A;  1WYG A;  4DL7 A;  4EZ6 A;  7ICI A;  5KFJ A;  2ATL A;  1L8L A;  4QIW C;  4ECY A;  4M9G A;  7ICH A;  9ICR A;  4PGY A;  4FS2 A;  4MF8 A;  8ICU A;  1N62 A;  3QU2 A;  3UPQ A;  2L5Y A;  4ECQ A;  1Q8K A;  3PR5 B;  2KVC A;  3QX7 A;  3H8M A;  5ALL A;  4BGD A;  1CEZ A;  1SIJ A;  3GV7 B;  3BQ2 A;  2H3V A;  4RQ7 A;  5KFR A;  1QSS A;  7ICQ A;  1NJY A;  2NO5 A;  4ELV A;  4J9M A;  4UB2 A;  5L1K A;  1UT5 A;  2E3T A;  4ECX A;  2P6R A;  2OXO A;  4HYK A;  4PGQ A;  1ZQ1 C;  5J8Y C;  1COK A;  2CN1 A;  5J0S A;  4RUA A;  4EBD A;  2W8L A;  4TQS A;  1WUD A;  1K5O A;  3ED5 A;  3PW5 A;  4O5E A;  5C5J A;  4RQ1 A;  3I76 A;  8ICM A;  2K89 A;  4X5V A;  5EE9 A;  3QZ8 A;  9ICM A;  3MGV A;  2ZIW B;  4PHE A;  2ZIU B;  4E0D A;  2KJ8 A;  1A77 A;  1T8E A;  5KFV A;  3CW2 C;  2DKX A;  4M2Y A;  9ICC A;  3WK5 A;  4K4H A;  4KMU A;  3IRU A;  4B9N A;  2R8I A;  5III A;  2RRD A;  2KKV A;  1RZT A;  2W9B A;  5J2H A;  2KV2 A;  4IL6 U;  5AKH A;  3C2K A;  5ALT A;  2LM4 A;  4QIW F;  3RJE A;  1S0M A;  4QNL A;  1Q3U A;  2KTQ A;  3QUQ A;  5KFU A;  4A8E A;  5DQG A;  3GFK B;  3M6Z A;  4I2J A;  3GIM A;  1KDH A;  7ICG A;  1H38 A;  3PW7 A;  2BPF A;  4HAI A;  4I2G A;  2LI6 A;  4ZOH C;  4GXI A;  2BPG A;  1J2N A;  3QNM A;  3T3F A;  1WWU A;  1FEZ A;  5GTH U;  7ICK A;  2DF4 B;  5J0Q A;  2HHT A;  1L8O A;  1X6I A;  4OCZ A;  2AJQ A;  1JX4 A;  1SWV A;  4R66 A;  3OHB A;  1ARO P;  4QZC A;  3T5H A;  2W54 A;  5AK5 A;  2VJ5 A;  4C8L A;  3TAD A;  3H8J A;  1S9F A;  5IIJ A;  4OD0 A;  4C4R A;  5ALQ A;  2WFA A;  1U47 A;  2VAN A;  2R8G A;  3KFU F;  3G6X A;  4UBC A;  4RQ2 A;  1IV8 A;  1FO4 A;  4ECS A;  1FFV A;  2WB1 C;  2ALZ A;  4O3R A;  4CNQ A;  3QUB A;  5ALU A;  4YVZ A;  3B9J A;  1QCK A;  1ZQO A;  3OHA A;  3PX6 A;  1PK1 B;  3N28 A;  2BQ3 A;  3AM9 A;  1B0X A;  2UVU A;  2FMQ A;  4I2B A;  4O3O A;  3BS7 A;  1ZQE A;  1KLN A;  5AM4 A;  2BGW A;  4Y2X A;  2DPI A;  3M7D A;  4YMO A;  2PXI A;  4YP3 A;  4DLE A;  5AKX A;  3Q8L A;  3NRZ A;  3PMN A;  2ZJ8 A;  2HI0 A;  1ED1 A;  5J0P A;  2W8K A;  1RM6 C;  5AI8 A;  2ASD A;  5HHH A;  2HBK A;  4RQ4 A;  4RPY A;  1NKB A;  5A0L A;  9ICK A;  4EBE A;  1SZP A;  2Y0S C;  5J2J A;  9ICL A;  2AH5 A;  3PO5 A;  4GC7 A;  2E1E A;  4EX7 A;  2IHM A;  3RR7 A;  3HRD D;  2A1A A;  3ALR A;  2KIW A;  3HT3 A;  4O3S A;  3BQ1 A;  2ZIU A;  2C22 A;  3WK8 A;  1UA0 A;  2RDI A;  1X6J A;  5KG6 A;  3T79 A;  1KFS A;  3F2C A;  4UB8 U;  1U9L A;  2B6G A;  4EZ9 A;  5D49 A;  1JXL A;  2AXT U;  1Z1B A;  1TV9 A;  2J6S A;  8ICR A;  4QWB A;  2DUY A;  4M47 A;  3BQ0 A;  3ZDC A;  3RF9 A;  5ALM A;  2MUT A;  3BQT A;  4RZR A;  7ICR A;  2KEY A;  4FZN A;  1KRP A;  5J0X A;  4QZE A;  4YR3 A;  5ALZ A;  2PI5 A;  1X42 A;  4AP9 A;  2V9W A;  9ICP A;  5DB9 A;  3C23 A;  2XID A;  4ACO A;  4DFD A;  4DFK A;  5KFG A;  3KZI U;  1CUK A;  5KL1 B;  4YD2 A;  4Z6F A;  2XY5 A;  4AYB C;  2KD1 A;  3K1R B;  4ECZ A;  1UA1 A;  4F4K A;  4O3P A;  3D2Q A;  2KSO A;  2BKE A;  7ICS A;  7ICL A;  1PVP A;  2JRZ A;  4MF2 A;  4O3Q A;  4TUS A;  2HBL A;  3TAR A;  3RB4 A;  4RPZ A;  3MDC A;  8ICP A;  4QZG A;  3C29 A;  4DQP A;  2G07 A;  1DOQ A;  1L7O A;  3PO4 A;  4G9B A;  4Q8F A;  8ICT A;  2QKQ A;  1MA7 A;  2G0A A;  1NK7 A;  4GFJ A;  1N56 A;  4QZ9 A;  4Z6E A;  2RLT A;  5KFE A;  2QAR A;  4P0Q A;  3NVV A;  4QJF B;  1NK5 A;  5KT6 A;  1QSL A;  5HR6 A;  2R18 A;  1OUQ A;  2C2R A;  5G5H A;  4UAU A;  3SAF A;  2F1I A;  1PK1 A;  1JXE A;  3L5K A;  2IOF K;  1Y88 A;  1BPD A;  2GLE A;  4B9S A;  5J2E A;  1N5X A;  4OJP A;  4FS1 A;  5HML A;  2YMQ A;  3RRG A;  3WU2 U;  4O5K A;  2VKQ A;  3T5K A;  3WK7 A;  2WF8 A;  2EAO A;  1WCN A;  4YXM A;  5KG5 A;  3RJK A;  2FE9 A;  4CRX A;  2KIV A;  4F3O A;  4QWE A;  1X40 A;  1YZ7 A;  1JN3 A;  3PZP A;  4M6W A;  2K60 A;  3GIK A;  2LHT A;  4QWC A;  4AYB F;  4UB3 A;  5J8Y A;  4YXJ A;  4YG2 A;  4CDG A;  5JTI A;  4IR9 A;  1SV0 C;  4Y2S A;  3PW0 A;  5L9X A;  4NJ8 A;  1NJW A;  5IIM A;  1QH9 A;  5EE3 A;  4F4Y A;  1L7N A;  2WF5 A;  4PHD A;  2XCA A;  3LVW A;  1OW5 A;  4LZD A;  5ALN A;  2UVV A;  4B6J A;  2A1J B;  3GII A;  2DQN B;  3T5J A;  2DKZ A;  8ICK A;  4KN4 A;  4YMM A;  1ZXI A;  3MBY A;  3EPG A;  3MR2 A;  5G5G A;  4QZB A;  1JRO A;  4CF5 A;  8ICA A;  4RQ8 A;  2CPR A;  4DSI A;  5AK6 A;  5KNI A;  4PGX A;  1PVQ A;  8ICS A;  2ISO A;  2A3V A;  2ZUC A;  5AM1 A;  3QEB Z;  2PI4 A;  3NAS A;  5D4B A;  4PZO A;  4KLU A;  1ZQZ A;  3M6K A;  1ZQD A;  2G5H B;  4US9 A;  5DBA A;  5J2K A;  3C21 A;  3PVX A;  5DKW A;  3F5E A;  2VIX A;  3ZDD A;  4I2C A;  4JWM A;  4DOC A;  3M9M B;  3F2B A;  3V6K A;  5ALY A;  4B9M A;  2G09 A;  4QWD A;  1S76 D;  3UMB A;  3QE9 Y;  1XSL A;  5F3X B;  4R63 A;  4KLE A;  4NL9 C;  5J0U A;  5JU5 A;  1UCV A;  1X9X A;  3BDP A;  7ICN A;  1O03 A;  4NXZ A;  4QWA A;  3GV8 B;  1NZP A;  2HCF A;  3RJG A;  3I28 A;  3AUO A;  4PH5 A;  1BNO A;  2P35 A;  2HHW A;  3C5F A;  3C2L A;  5L1J A;  2E8P A;  5CRX A;  1KBU A;  2FPM A;  3WKE A;  5K4L A;  4ECR A;  3CYM A;  2ASL A;  1A6S A;  1RYR A;  3PR4 A;  2HW3 A;  1ZOL A;  3JPS A;  3Q8R B;  4RQM A;  2F8L A;  2AGP A;  4C4T A;  1KFD A;  4C8M A;  4BWM A;  1MC8 A;  2P66 A;  5DB6 A;  4DSJ A;  1NNL A;  3AQF A;  5CA7 A;  1B4F A;  5ALS A;  3QZ7 A;  2HVH A;  5C0Y A;  3PSP A;  5DQI A;  9ICT A;  4DLG A;  5L1L A;  1PUZ A;  4DL3 A;  2WF6 A;  1SZH A;  1UHU A;  2XCP A;  2JEF A;  1Z3E B;  3L3F X;  4UAT A;  5KFT A;  3KHH A;  2BCR A;  3PSF A;  3SR6 A;  2OHF A;  4CF4 A;  2KN7 A;  4EYH B;  3KOO A;  1Z00 B;  8ICQ A;  3FYH A;  3H4D A;  4KLF A;  2JEI A;  1LVH A;  1S5L U;  2VA8 A;  2YX8 A;  1ZQK A;  2D3D A;  4KLO A;  9ICI A;  2F1J A;  2RQ5 A;  4JV1 A;  2ZTD A;  5J0T A;  5AK4 A;  5ALE A;  4PZN A;  3TI0 A;  5ALR A;  2IOF A;  3GU3 A;  2RP5 A;  4IQW A;  3MFI A;  3KHR A;  4U7C A;  3OJU A;  1XSP A;  2YY6 A;  4ED6 A;  9ICJ A;  4FFD A;  2C2E A;  2F44 A;  2JZB B;  3V7J A;  4ECT A;  3RAX A;  4MFA A;  5L1M A;  2EH9 A;  1DXS A;  4QZ8 A;  4PL2 A;  5BPC A;  1ZJN A;  1NKE A;  2KP7 A;  4ED1 A;  8ICN A;  3ZDE A;  2HOQ A;  1JIH A;  5J2I A;  5AIC A;  5ALH A;  2Y1I A;  3WKB A;  1LKY A;  4OO1 J;  4M9H A;  1S97 A;  1D8L A;  3ISC A;  5T14 A;  4J9P A;  1RQN A;  4IS7 A;  4P4O A;  2V4R A;  2QB0 B;  1D9F A;  3KKA C;  4PL1 A;  5KG2 A;  2F3N A;  2UVW A;  3N7S C;  1ZQC A;  3WK4 A;  1FIQ A;  2MSN A;  4JK1 A;  1ZQM A;  1SWW A;  3QEA Z;  4DL6 A;  1BNP A;  2AGO A;  2P6U A;  4F72 A;  4RNO A;  2ZUB A;  3IP4 B;  3QU7 A;  5AKG A;  2BCU A;  4ICA A;  3AEV A;  1N63 A;  2QLT A;  3QU9 A;  3AU6 A;  1JMS A;  2DL0 A;  2EZZ A;  2G08 A;  2R8H A;  3M8S A;  1SL1 A;  4IRD A;  3D2S A;  2XY6 A;  5KT7 A;  3H0R B;  2VA2 A;  2XVT A;  4QW9 A;  1N5W A;  2ZIX B;  2W43 A;  5ALO A;  4TUR A;  5E79 U;  1ZQS A;  2DWQ A;  4LZG A;  4OJ6 A;  4FZL A;  2MAX A;  3QU5 A;  1N60 A;  4C8O A;  8ICI A;  3BZK A;  3M9O B;  3SV4 A;  4NM1 A;  3QXG A;  3MAB A;  4YQW A;  1S77 D;  5AKZ A;  2B0C A;  2BDU A;  2W9M A;  4RQ0 A;  3BJY A;  5KFQ A;  5J2C A;  3V7L A;  1U48 A;  2MRL A;  3ZD9 A;  1SV4 A;  5DG9 A;  1KQQ A;  5AI6 A;  4KLG A;  4F5P A;  2FJ6 A;  3RB6 A;  3N4M B;  2W7P A;  2KFZ A;  2EZX A;  2KHQ A;  4NLN A;  4UAS A;  1L3T A;  5HNK A;  3GQC A;  2XIC A;  1JUD A;  8ICB A;  1V38 A;  2BR0 A;  3RJF A;  1L6N A;  5GTI U;  3SD7 A;  4ED2 A;  5AM0 A;  3MGH A;  5ALX A;  3ORY A;  1BPB A;  4DFM A;  2ODG A;  2HMX A;  3LWM A;  4RNM A;  4QZH A;  2W9C B;  4OJL A;  3SV3 A;  4CCH A;  2AU0 A;  1Z00 A;  3UQ0 A;  3V6J A;  4F8R A;  1SKS A;  2AHO B;  1XC9 A;  1PK3 A;  2EAN A;  5KG7 A;  8ICE A;  2IMW P;  8ICC A;  1ZQU A;  3Q8P B;  3HIL A;  3NTU A;  2FLL A;  1UPH A;  2J6U A;  4Y2Y A;  1YT3 A;  1KSP A;  1Z4N A;  3CRX A;  4YR2 A;  1DRG A;  2JGA A;  4Q43 A;  4UB4 A;  3PSI A;  1V9P A;  4CE6 A;  2KHV A;  5KFM A;  4EYI B;  3B0Y A;  3LYS A;  4DO9 A;  1ZQX A;  5AI5 A;  2ZIW A;  5HMM A;  1MSW D;  5KG0 A;  1L3V A;  4F50 A;  5AKY A;  5AI9 A;  5DG7 A;  1T94 A;  4DSK A;  1S0V A;  2KJ9 A;  4O3N A;  5KFN A;  5AIB A;  3SQI A;  5KFD A;  4RPX A;  5DLF A;  2WTF A;  2RHF A;  1TE2 A;  2GH1 A;  2GO7 A;  2XGP A;  4J9Q A;  3IG5 A;  3UXO A;  5B66 U;  1QQ7 A;  5J29 A;  1ZQH A;  2FLN A;  1NK8 A;  4O0I A;  1ZQA A;  3QU4 A;  5DLG A;  5J2A A;  8ICX A;  2QB0 A;  2DBY A;  4UB1 A;  4NM2 A;  2R8J A;  4RQN A;  2LM1 A;  3HKZ C;  3SMV A;  3J81 j;  4I2E A;  3PX4 A;  2Y9U A;  4Q44 A;  4MFC A;  5D46 A;  5KAF U;  3BQ7 A;  2ZG6 A;  1ZD3 A;  2F77 X;  1A0P A;  3UMG A;  4DQQ A;  5FP0 A;  3HPO A;  5IIL A;  4IRK A;  2IHN A;  2OEH A;  4GIB A;  9ICV A;  4ECW A;  2KOB A;  3K75 D;  3GZF A;  1C20 A;  4NL9 A;  1ZQF A;  4UAW A;  4KMO B;  4J9R A;  5J0W A;  2ZIX A;  3N7R C;  2K8C B;  5ALW A;  3M8R A;  4ED3 A;  1ZD5 A;  3RJI A;  2DFL A;  2GWS A;  2XY7 A;  4NLG A;  1URJ A;  1S0O A;  1NJX A;  4DS5 A;  3ONN A;  1ZQT A;  4YFK A;  5AM3 A;  2FDR A;  1ZQN A;  2M9N A;  1HUO A;  2W55 A;  1S10 A;  3L4P A;  4JWN A;  1X2I A;  5EE1 A;  2WF7 A;  2EZY A;  3BS5 B;  2J6T A;  4TUQ A;  2YB4 A;  1BPE A;  4US8 A;  3D2N A;  3RH6 A;  4FO6 A;  4DL2 A;  2HSZ A;  4ELT A;  8ICW A;  1IM4 A;  1VLB A;  5EWG A;  5TIS U;  2JMG A;  5KT2 A;  9ICB A;  1QSY A;  4G3I A;  4KLH A;  1ZQV A;  5KAI U;  3RB0 A;  3ISB A;  4KLD A;  2K8B B;  4Z6C A;  4NY8 A;  1TK5 A;  3I1Y A;  5KFS A;  1NOM A;  4KX5 A;  3HKZ F;  3IG8 A;  4F91 B;  2XO7 A;  4FZM A;  5DGB A;  1QLN A;  4DWI A;  9ICS A;  4B9V A;  1ZQP A;  3PML A;  2LYA A;  4XRH A;  4UAV A;  2K4E A;  4DCC A;  2BQR A;  3GIJ A;  7ICJ A;  3NRW A;  4GXJ A;  3Q8K A;  1XS9 D;  4IQT A;  4DOB A;  4RT2 A;  4PHP A;  2BHN A;  4EEY A;  3TAN A;  2Q0Z X;  3T5L A;  5J2G A;  2KMD A;  3MR5 A;  1KN5 A;  2H3F A;  2A19 A;  4C80 A;  5CJ7 A;  4IQU A;  5DQH A;  3RFA A;  4F71 A;  3KTQ A;  4J9S A;  3OTQ A;  3KD3 A;  5B5E U;  1TAM A;  5KT3 A;  2F2A B;  9ICQ A;  4DFJ A;  4JMU A;  5KFZ A;  2YMM A;  9ICF A;  3SAH A;  4Z6D A;  4ECU A;  3TQ1 A;  3IHQ B;  1DK2 A;  1XSN A;  2HOF A;  5KFB A;  4NLK A;  1JI7 A;  2HBJ A;  4QZD A;  2ZTC A;  2IOH A;  2E5S A;  4DQR A;  2JH7 A;  4FE3 A;  3UMC A;  3RJJ A;  3RAQ A;  4K4I A;  4DS4 A;  1CRX A;  2ZTE A;  4KTQ A;  2BCQ A;  2W3S A;  5L1I A;  3RJH A;  2NV3 A;  4MHV A;  3THV A;  3HWT A;  3KKA A;  3H8W A;  3PW4 A;  1S0N A;  5CWR A;  1LV5 A;  1KFT A;  1UT8 A;  1N61 A;  4PHA A;  1DGJ A;  1XO0 A;  2H3Z A;  5AKI A;  1L3S A;  3DDH A;  3LVV A;  2B21 A;  1EXN A;  3ZD8 A;  2ZJ5 A;  2HHQ A;  1AQ6 A;  1RPL A;  4CF3 A;  2YN4 A;  3N7P D;  3TFR A;  3NGD A;  4RUC A;  4EEL A;  4M9L A;  3IM1 A;  4NWI A;  7ICV A;  4MFF A;  1ZQL A;  2M0N A;  1TAU A;  3F53 A;  4F4Z A;  4WJ3 B;  2NRV A;  5JUM A;  5ALJ A;  2W7O A;  4K4G A;  5KT4 A;  5CR0 A;  2NO4 A;  4P4M A;  3UQ2 A;  5CEH A;  3HP6 A;  3WK6 A;  1IXR A;  1L7P A;  4M9J A;  3Q8Q B;  1L7M A;  3SAG A;  2E8N A;  4F2S A;  3H0L B;  3H7I A;  2Q4T A;  2D6F C;  7ICE A;  3B0X A;  4RQ5 A;  5KFX A;  2KE7 A;  2UVR A;  4B9L A;  1Q3V A;  2YQE A;  3JPP A;  5F9N A;  5AKJ A;  5KG4 A;  2G06 A;  3ZDB A;  2EAM A;  1BPZ A;  3OGU A;  1TKD A;  1D8B A;  4R64 A;  3E58 A;  2E1F A;  5BOL A;  9ICU A;  5KT5 A;  3RBE A;  3K4G A;  3PW2 A;  4BDP A;  3M9N B;  2JXJ A;  5AHX A;  2D8C A;  1SB3 C;  3NS1 A;  5AM5 A;  4KLI A;  1GO3 F;  4BJQ A;  2ASJ A;  4ZH4 A;  5EOZ A;  1F5S A;  3BZC A;  2K4I A;  4YCX A;  2ZXI A;  2O6K A;  1TK8 A;  5ALK A;  1F44 A;  3H8S A;  4MEX A;  1MQ3 A;  4USA A;  3H4B A;  2OWO A;  3RRH A;  3ZDA A;  2C28 A;  4UBB A;  2H5X A;  4KLM A;  1KTQ A;  1RG6 A;  2WHE A;  3DEE A;  1ZJM A;  5KFW A;  3JPO A;  4I28 A;  1P7D A;  3IV6 A;  2R8K A;  1KW4 A;  3EZ5 A;  9ICH A;  2HOI A;  3TKA A;  2F1H A;  3UM9 A;  3M1Y A;  2FPL A;  4Y2T A;  4R65 A;  1T7P A;  4C7Y A;  1XWL A;  2A1J A;  4Y2Q A;  3Q8S B;  1SL0 A;  1PVR A;  5J2F A;  4F2R A;  4C7Z A;  4YR0 A;  2E8O A;  8ICG A;  4DQI A;  1F0M A;  3GIL A;  2N1R A;  1ZQI A;  1V97 A;  4Y2R A;  3V7K A;  4ECV A;  5CP2 A;  2XC9 A;  4KLJ A;  2ZJA A;  3EWA A;  1ZQW A;  5EWE A;  3S6J A;  1DGS A;  1SXD A;  1XU4 A;  4KIT B;  4TQR A;  2EQY A;  2I1Q A;  1UQV A;  5DDY A;  3AL0 B;  2DGZ A;  1Z1V A;  1U4B A;  4I2I A;  3SZ2 A;  1TK0 A;  3TAC B;  1L5U A;  1X9W A;  4KX3 A;  3V72 A;  4ED0 A;  4KLL A;  2MUT B;  3WKC A;  8ICY A;  1X9M A;  4JB3 A;  4O3M A;  3KHL A;  4JV2 A;  1NJZ A;  5IIN A;  4P4P A;  4Y2U A;  3PY8 A;  2ESE A;  4PJ0 U;  3NVY A;  1IIP A;  8ICL A;  2ES6 A;  5IIK A;  5AK3 A;  4Q8E A;  3VC8 A;  4RT3 A;  1KKX A;  1N48 A;  1BPX A;  1NK6 A;  4I2H A;  1B22 A;  4I2D A;  2YML A;  3TAP A;  2F8K A;  4EEK A;  5J2B A;  3ICX A;  1ZRN A;  4YN4 A;  5DB8 A;  4O5C A;  2MA1 A;  3KHG A;  2FPK A;  4J9N A;  4C8K A;  4XA5 A;  2NRX A;  5IIO A;  2NRZ A;  2KSO B;  4Y2J A;  4C4S A;  3WKA A;  3VCB A;  1ZQB A;  3QUT A;  3D6J A;  3E0F A;  2HBM A;  2VJ4 A;  3JPN A;  1JAL A;  1ZD2 P;  4LJX A;  1IG6 A;  5ALD A;  1TFR A;  1ZQY A;  3TFS A;  1LB2 B;  3MR3 A;  3GDX A;  4UB5 A;  1NK9 A;  1K1S A;  3NVW A;  3PST A;  3TAQ A;  1C7Y A;  4F5Q A;  4DF8 A;  1JRP A;  9ICG A;  5KFC A;  3RB3 A;  3AU2 A;  7ICF A;  2QAR B;  3SI8 A;  5KFP A;  2OH2 A;  4P0Q B;  2BQU A;  4BXO B;  2AGQ A;  4F5O A;  3IN5 A;  3E2E A;  7ICT A;  2Z7J A;  3CP8 A;  2XI9 A;  2BPC A;  2ZIV B;  3DV9 A;  8ICZ A;  2I5H A;  4QZI A;  1NKC A;  2W3R A;  5KFO A;  4R8U B;  4I27 A;  2IBK A;  4P0P B;  1SKW A;  3O0F A;  3FM9 A;  4DEZ A;  3MGI A;  5KG3 A;  1S8O A; 
#chains in the Genus database with same CATH homology
 2EH9 A;  4LJX A;  1IG6 A;  1KQQ A;  2OEH A;  1RYU A;  2KK0 A;  2RQ5 A;  2EQY A;  2LM1 A;  1C20 A;  2CXY A;  1KKX A;  5K4L A;  2JRZ A;  2JXJ A;  2YQE A;  2LI6 A;  5CEH A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...