2JRZA

Solution structure of the bright/arid domain from the human jarid1c protein.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
SMNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVCNTRPFDNEEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone and sidechain 1H, 13C and 15N resonance assignments of the Bright/ARID domain from the human JARID1C (SMCX) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Histone demethylase JARID1C
total genus 35
structure length 117
sequence length 117
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jrzA00
2CXYA 5CEHA 1KKXA 2OEHA 2JXJA 2KK0A 2LI6A 2JRZA 2YQEA 2LM1A 5K4LA 1KN5A 4LJXA 2EH9A 1IG6A 1RYUA 2RQ5A 2EQYA 1KQQA 1C20A
chains in the Genus database with same CATH superfamily
1DK3A 3TFRA 2OEHA 1UHUA 4UASA 5B5EU 3RJJA 2V9WA 1V97A 4I28A 3FYHA 2FMPA 1IG6A 1PZNA 2KZ3A 4NL9C 2A1AA 2KIVA 2JH1A 1L8OA 3I1YA 3FM9A 4RZRA 1ZYQA 1UCVA 3NVYA 5ALSA 3RB3A 2JEJA 1QLNA 1ZQIA 4F3OA 3TKAA 3EWAA 5DG9A 3Q8RB 4OJOA 2G09A 4PJ0U 1D9FA 1N2XA 5EWFA 3VC8A 3PY8A 8ICLA 4KITB 5DQGA 3BS7A 1Q8KA 1ZQLA 1JROA 1BNOA 5CR0A 3SMVA 3U26A 9ICJA 2FMSA 2C22A 1Z00B 4YMNA 3C5GA 1XU4A 1TAUA 9ICUA 3HILA 2BQRA 4ECQA 9ICKA 5DBAA 4ED0A 4PPXA 4NXZA 4LZDA 3HX0A 3QU4A 2EZXA 9ICSA 2FJ6A 3M9NB 4F93B 3T5JA 2WB1C 4HYKA 4P4MA 2ZJ8A 4O0IA 4Z6EA 4FS1A 1KL9A 4UAWA 1MSWD 1MC8A 9ICAA 1NK8A 1WCLA 5AK6A 2BCVA 2UVRA 3N7PD 4F72A 4DOAA 4OO1J 4F8RA 3PNCA 3F5EA 3N7RC 8ICEA 5L9XA 5EOZA 1D9DA 4EBDA 2KICA 2ESEA 1RXVA 2HW3A 1N5WA 5AI6A 3HKZC 1LV5A 1ZQXA 8ICVA 5IIJA 2KIWA 4EENA 4DQSA 1TK8A 2LYBA 1ZQKA 4DFMA 2VJ4A 4C4TA 2CN1A 1AROP 1A0PA 3HJEA 2XGPA 3PW4A 1U47A 4US8A 2W9AA 4ECTA 3CNHA 1SZHA 2W55A 2I1QA 4C8NA 4Q45A 1U4BA 1OUQA 3C29A 3QE9Y 2IMWP 5E79U 1A77A 3PX4A 1EXNA 4DL2A 8ICXA 5J0OA 4RPXA 4B9VA 3C1ZA 4ELVA 5DB7A 2KNJA 4RQ6A 2HHQA 1NZPA 2W9MA 5GTHU 2ZUCA 2IOFA 4DOCA 2WF6A 5KG6A 4QWEA 9ICIA 4DQQA 3H0RB 3WK8A 1U9LA 4O3PA 1JX4A 3G6YA 3ONNA 4PZNA 1L3TA 2Y9UA 5KFPA 2AQ0A 1KFSA 4ED2A 1V85A 1SL1A 1L7MA 1S0MA 2IBKA 1UA0A 5ALVA 3PO4A 3ZI4A 4ECXA 1KQQA 2KHVA 1L7NA 1Z1BA 1ED1A 3N28A 3C5FA 3MR5A 5AKYA 3B0YA 2C28A 4IRCA 1T94A 1T3QA 2BCSA 2W9BB 3GV5B 4Z6CA 5EWEA 2DFLA 4ICAA 3KZIU 2C2RA 2BCUA 4I2GA 4USAA 3HKZF 2PXIA 3KFUF 1JUDA 4P0PA 3TAQA 2EZZA 2BCRA 4KLLA 4BWJA 2W9CB 1PVQA 2HHWA 4M47A 3HP6A 3WKCA 2B6GA 4UATA 4I2JA 4ACOA 1XSPA 3EPIA 4QZIA 5J2JA 4QZGA 1QQ5A 1K5OA 4JUZA 1D8YA 2Y1JA 1T4GA 4DL6A 4KLDA 2P35A 5AICA 4UB1A 4I27A 1BNPA 9ICRA 2F8LA 4DSLA 5KTQA 2HOFA 5AIAA 2W54A 3RR7A 2EDUA 4AP9A 1F0MA 2W7PA 2F1IA 1O08A 4F5QA 2NRXA 1T3NA 3FC4A 4OJLA 2OH2A 5KFNA 3LYSA 3F2CA 1RXWA 9ICQA 5F3XB 2IHNA 3QUTA 4BXOA 2WFAA 3WKEA 1ZQPA 4KLIA 4QWBA 4F4ZA 4ECSA 2RHFA 2G08A 2JXJA 3ZDDA 3M8RA 4NLGA 4EX7A 2EANA 2KMDA 8ICHA 4TQRA 1BPZA 5J0PA 2FPKA 3IHQB 5EE0A 4KX3A 4ED6A 1MQ3A 4QWAA 2AXTU 4RQ0A 3D2SA 4QZHA 4Q43A 1S0OA 7ICKA 3GZFA 1SL2A 4DEZA 1N60A 2XCPA 4EZ9A 4DF4A 4NV0A 2W8LA 1K1SA 3C2LA 4KN7A 3SYZA 1X9XA 5ALPA 5AHXA 5KFMA 1B4FA 4UB6U 1SV0A 1KEJA 4OCZA 5IIIA 3RB6A 1HUZA 4PH5A 2QB0B 1ZQZA 1SZPA 4Y2PA 5KL1B 1KKXA 4UB4A 3PW7A 2VIXA 3RJEA 1N48A 3D2QA 1X40A 4I2FA 4M0AA 1TAMA 1L5UA 3Q8LA 1ZD2P 2YY6A 5AKKA 3EZ5A 4FZLA 4FZMA 2E8PA 5CA7A 4MHVA 3LWLA 7ICTA 3N7SC 1PVRA 3T5HA 2Q0ZX 2P6RA 5KAFU 3JPTA 2AH5A 1WG8A 4IQVA 4MF8A 4M6WA 4MFAA 2HHSA 5IIMA 3BZCA 4CNQA 4YR2A 1L7OA 3GV7B 2LM1A 7ICPA 3OJSA 5KFXA 5ALJA 5KFEA 3PW5A 5AM4A 4C8LA 2BPFA 1ZQVA 1MA7A 4C8OA 4MEXA 1L3UA 1NNLA 1Q46A 1HEKA 4ECYA 1NKCA 3EUB2 3GIIA 2VJ5A 3KHLA 3PR5B 2V4QA 5KFKA 2ZUDA 2UVWA 1CEZA 5ALWA 3MBYA 4QJFB 5JRTA 1L3VA 4GFJA 4B6JA 1QQ7A 2A1JA 3E2EA 5J29A 2J6SA 2DUYA 4O3MA 3IN5A 1YZ7A 3D2NA 2AU0A 2YMPA 3I28A 5TZVA 3WK9A 3QXGA 3KHGA 5ALTA 1S5LU 4G3IA 3KOOA 2O6KA 4EZ6A 1LKYB 2HCFA 4NLZA 4F71A 2I5HA 3NUQA 1WCNA 2MU2A 2W8KA 9ICBA 2ATLA 1ZQSA 1AQ6A 2JV3A 8ICNA 5KFTA 4DSFA 2XVTA 3GIJA 4M9HA 4UB5A 4Y2QA 4NM2A 2DPJA 1QTMA 8ICTA 1X9WA 1X9SA 3BZKA 3RR8A 2A19A 4ED1A 2ALZA 2HOQA 3WK5A 2HHTA 2GH1A 2RQ5A 3ISDA 3QZ8A 3T79A 3QUCA 3TADC 2A3VA 3RBEA 1H38A 4B9MA 4TQSA 3PZPA 2K4HA 1UA1A 4F4KA 4IR1A 3LDAA 4YG2A 4P4PA 1U49A 9ICOA 1WYGA 8ICYA 4IRDA 4WJ3B 3V6JA 1TAQA 1L3SA 4I2BA 2E8MA 1RYRA 1NOMA 5AKLA 4FE3A 2MAXA 5BOMA 3QNMA 4CGZA 4NM1A 2G5IB 2BCQA 1NK7A 3V7KA 5KFQA 1ZQYA 2BPCA 3D6JA 1WUDA 2K8BB 2KJ9A 3V7JA 3K1ZA 3M9MB 3UXPA 4IS7A 5K4LA 2E1FA 5KT2A 3SAHA 1SXDA 2AQ4A 3TFSA 4P2HA 1Z1VA 4P0QB 1K1QA 2ASDA 5ALRA 2KP7A 5HNKA 3FDSA 1QSLA 2PI4A 1KN5A 4PHDA 3PW0A 1PK1A 4NWIA 2WF9A 4XRHA 5DG7A 3EYZA 2YTUA 2JR5A 1QSYA 1RQNA 1X6IA 2DGZA 4CF3A 7ICOA 3ETRA 4F4YA 8ICSA 2ZIWA 3ZDAA 4US9A 4ECWA 2DBYA 5HR6A 8ICJA 1OW5A 4AYBC 2MUTB 4DFDA 4XQ8A 4RUAA 3PX6A 2NRWA 9ICFA 5DB9A 5AI4A 1C7YA 1N62A 1NZBA 5KFWA 3HWTA 4R64A 2WF8A 5J8YA 3NTUA 5AKXA 1PK1B 2PMZF 3RRHA 5J0UA 5L1LA 4YR0A 4MF2A 3LWMA 3UQ0A 4UAYA 1ZQGA 5AI5A 1S10A 4YQWA 4F4WA 4DLEA 3ED5A 3RJIA 3OSPA 3KHRA 4I2HA 1MQ2A 2HHUA 4EEKA 4I2CA 4DSJA 3GFKB 1UQVA 3LVWA 4LJXA 1JMSA 4J9SA 4UAUA 4O5EA 2F2AB 5DBBA 3NVVA 1KBUA 2FLNA 1ECWA 8ICBA 3BS5A 9ICPA 2LHTA 5C0YA 1SKSA 2Z7JA 5AK5A 2JZBB 7ICVA 3QUBA 2XY6A 4C8KA 4RQ2A 2FLPA 4UB3A 2H3ZA 1FIQA 3BQ2A 2HBKA 4J9MA 2CPRA 4GLXA 1MN8A 4C8MA 4ED8A 4EELA 4PGXA 3ORYA 1COOA 2R8GA 3MABA 4MFCA 2KJ8A 3HRDD 4KMUA 2FI1A 3F5AA 1BPDA 2EH9A 2E1EA 1Z4NA 4J9QA 3K4GA 2QB1A 2W7OA 1NI3A 4YN4A 1BPEA 5KFFA 4DWIA 1UT8A 3KKAA 2OM6A 2W43A 2KV2A 2ZTDA 5AKZA 3VCBA 3QUQA 4AYBF 4B9LA 3H0MB 3H8MA 1SKRA 3RAXA 4IQTA 4M9LA 5J0WA 2NO4A 4UQGA 1SKWA 5KG7A 5AKJA 5AM1A 1QH9A 3GIKA 8ICZA 2J6TA 4K4GA 5L1IA 2KVCA 3ZD8A 3C2MA 4JB3A 5B66U 5J2KA 2JRZA 2BKEA 4R63A 2JHDA 3OHBA 4EBCA 3ISBA 4JWNA 5L1KA 2YMQA 5AM3A 4RQ7A 2YQEA 4RNNA 5DQIA 4XUSA 2NV3A 4Y2RA 3RFAA 2ZIUA 1YZ6A 1JRPA 8ICMA 1SXEA 4TUPA 1TK0A 1CRXA 1FFUA 4YMMA 2EZYA 2XCAA 2NRZA 4PZOA 2AGOA 2F8KA 3EPGA 5KT5A 3RH5A 4UBBA 2OYYA 4CRXA 1BVSA 2HI0A 2K4IA 1ZQFA 5AKIA 2GO7A 2LPEA 4YD2A 5KT6A 4BX9C 1QSSA 3RJHA 5ALQA 3RH6A 3TANA 1SGGA 1NJWA 4J03A 5A0LA 4BXOB 4R65A 2VA8A 1Z4OA 4PL2A 4NY8A 1LVHA 2AGPA 2PFOA 5CHGA 1ZQTA 1ZQMA 2D6FC 1ZD5A 2ZUBA 2DPIA 2W04A 5DGAA 5IIKA 3KBBA 5IILA 2BPGA 2YX8A 3AU6A 5HMLA 3T5KA 4P4OA 2K4EA 2FE9A 1NK5A 4F5NA 1A6SA 2JEIA 4TUSA 5ALXA 3BQTA 2FPLA 3E58A 3SV4A 7ICJA 2R8JA 1ZD4A 3M6ZA 1KDHA 3SQIA 4PHPA 4F92B 1T7PA 5AM0A 2YN4A 5J0YA 1IIPA 1P7DA 1KW4A 2RP5A 3PW2A 4F5RA 1XSLA 4JV0A 9ICMA 2KTQA 1ZQUA 2R8KA 2W9CA 4KMOB 2P6UA 2DKXA 1ZQHA 4ELUA 2K4PA 1B22A 4EBEA 4MFFA 3F2DA 2NO5A 1KLNA 8ICRA 2ES6A 1ZD3A 4GXKA 2HVIA 3BQ0A 3GDXA 1SV4A 1DK2A 1F5SA 2MA1A 7ICUA 4FS2A 1JXEA 2BQ3A 3KTQA 2G07A 1S77D 5ALYA 1VDVA 1ZQDA 3ZDEA 4BWMA 4EEYA 9ICVA 2KFZA 5DLGA 2EAOA 4KLFA 3MGIA 1NK0A 1NJYA 2LBOA 2NRVA 2HBLA 1UPHA 4PHAA 3B9JA 2KG5A 3IV6A 3NS1A 2FPMA 5FP0A 2EQYA 3FAHA 1F44A 3PSIA 2ZIWB 2W3SA 3OGUA 2UVVA 3QX7A 3PV8A 2CXYA 4E0DA 1PK3A 4EYIB 2HDOA 4DFKA 8ICWA 3LVVA 3QU5A 5F9LA 2H3QA 3N4MB 1BGXT 5KFVA 3Q8PB 2RDJA 8ICIA 4KLSA 1XC9A 3MFHA 5J0SA 2KZZA 3CRXA 4BDPA 4R8UA 3OJUA 2D3DA 2KD1A 1QQ6A 1KTQA 2HSZA 5KT3A 1ZJNA 4F2RA 4DL7A 3RBDA 2JZBA 4ZH4A 4J9PA 5KFCA 4DOBA 4FBUA 1Q3VA 2FDRA 5DB6A 4BGDA 2OXOA 4QZCA 3SAFA 2PKEA 3SEIA 1S0NA 2Y0SC 4M9NA 4FFDA 1OXJA 4CF4A 3H8JA 4PGQA 3H7IA 3RB4A 4CF5A 3JPNA 1U45A 4O3RA 4DF8A 4UB8U 2ZXIA 3C23A 3RB0A 4DS4A 1D8LA 3MGVA 3TAPA 3MDAA 2K89A 5T14A 2E3TA 4IC9A 2KEYA 4PL1A 4RQ1A 2LM4A 4P0PB 4DLGA 1NJXA 4PHEA 5ALEA 4ECZA 3AM9A 4OJ6A 4RQ3A 4DQRA 5DBCA 3H8WA 1FO4A 1NJZA 1S8OA 4RNMA 1ZQAA 2AGQA 3RAQA 2G06A 5DQHA 3MFIA 1XO0A 2FMQA 4KLGA 7ICFA 5AM5A 4GXJA 3I76A 9ICHA 2JGAA 2BZFA 5EE1A 3C28A 2ZJAA 1L8LA 2W11A 2C2DA 1FEZA 3SI8A 5AK4A 1Q3UA 3RJKA 3IG8A 1Z00A 1S0VA 4IR9A 1ZQBA 3SAGA 1WWUA 5AKGA 5KFYA 5KFGA 1Z19A 2XIDA 4LZGA 5J0QA 4RUCA 2PFNA 5AKEA 2WB1F 4O3SA 4J9LA 3T3FA 2OWOA 3TQ1A 5KAIU 8ICFA 2K8CB 3IDWA 2DWQA 5IINA 4CDGA 4GIBA 1ZOLA 2XI9A 3QZ7A 5L1MA 4LVSA 4IRKA 1IXRA 1J2MA 3AL0B 2Y0SF 1RPLA 1GO3F 4F5OA 1NK9A 1XWLA 5KFIA 2KHQA 2I6XA 2FLLA 3PSFA 3Q8SB 5C5JA 1DGSA 1V9PA 4UW9A 2LMRA 4TUQA 7ICRA 1NKBA 4FZNA 3MR6A 1BPYA 4KLUA 3UMBA 4QIWC 2KSOA 5KFDA 3HW8A 2VANA 5J0XA 1DOQA 2K8AA 5AI9A 3K75D 3KHHA 2BHNA 5J2HA 1M6YA 5KT7A 4J9RA 7ICEA 4KLHA 5KFZA 3WKBA 4QZBA 5L1JA 2YB1A 5D4BA 1XO1A 2EAMA 3H40A 4B9SA 5BOLA 1Y88A 3DV9A 5H2FU 4M04A 3B0XA 5D46A 2ZIVB 4DSIA 1DXSA 2G0AA 5J2EA 2KFNA 5ALKA 8ICKA 3MC1A 4FO6A 7ICIA 2XICA 3BQ7A 3V6HA 5J0RA 3LK9A 1URJA 2V4RA 4DCCA 4YR3A 3NVWA 3H4DA 9ICLA 5KFSA 2WHEA 3M6KA 1CI4A 8ICAA 2ZXHA 4ED7A 4NLNA 1RDFA 1SB3C 3AEVA 2BQUA 3ICXA 3AQFA 4GC7A 2OHFA 2F76X 3F53A 3SV3A 2JH7A 2XC9A 4OJ5A 2HHXA 1X9MA 7ICNA 2QLTA 2H3VA 4NJ8A 4R8UB 2K60A 2ODGA 4Y2UA 2QB0A 3MDCA 1D8BA 2EAPA 4KLOA 5TISU 2HMXA 2UVUA 4YXMA 3TI0A 4Y2YA 1NK4A 2ASJA 4DL5A 5ALHA 4OD0A 5J8YC 1XSNA 5AM2A 5AI0A 2YB4A 3PSPA 3WKAA 1SIJA 4C7ZA 3RJGA 1UT5A 5AI8A 5J2AA 5KG1A 3GQCA 7ICHA 3QEBZ 4ECRA 4RQ5A 4QIWF 5DGBA 2ZTCA 1ZQRA 2PI5A 4U7CA 1U48A 2DL0A 2R18A 2ZIUB 3JPOA 5ALMA 3ALRA 5AIBA 1NK6A 3Q8KA 4EYHB 3GILA 5G5HA 1BPXA 2HHVA 4HAIA 9ICEA 4J9OA 4QZ8A 5DKWA 3GV8B 7ICSA 3PMLA 3CYMA 1RM6C 1JN3A 5KFOA 4YVZA 3OTQA 1N5XA 3UPQA 3TACB 5KT4A 1A76A 1HIWA 3CW2C 3RH4A 4DSEA 4DS5A 1IV8A 2KVSA 3MR3A 3A0BU 3H8SA 5KG0A 4C7YA 2F1HA 3EW9A 4I2IA 4O3QA 1ZQEA 4Q8FA 1VJ5A 2B21A 2XY7A 1RQLA 2IHMA 4QZDA 2KN7A 1X6JA 2W9BA 4K4HA 2H3FA 3UXNA 1ZQQA 1B43A 3WK6A 2ZIXA 2DKZA 3H4BA 3PO5A 2IA6A 3PX0A 3WU2U 1VLBA 3WKDA 3M1YA 4YMOA 5BPCA 2WF7A 2PFQA 4G9BA 1JIHA 5KG4A 3T5LA 2P66A 4IQUA 3S6JA 3AUOA 4NL9A 8ICCA 5ALFA 3L3FX 4M9JA 4JMUA 1SV0C 3C21A 3V72A 2KZMA 4DFJA 4QZ9A 2BGWA 2F44A 4KLQA 2ISOA 3A0HU 5AKHA 2HVHA 3PVXA 4I2EA 2G5HB 5ALUA 4QWCA 1X42A 8ICUA 4O5KA 4Z6FA 4F50A 1ZXIA 1XNSA 3RF9A 1TE2A 3K1RB 1NKEA 2KK0A 3QU9A 4C4SA 1L7PA 2HBJA 2KOBA 5DDYA 2E8OA 4KTQA 2LI6A 3HT3A 5ALIA 4RQ4A 4RT3A 1RYSA 4QNLA 2IOFK 4FBTA 1O03A 3IP4B 4QZFA 3Q8MA 1SWVA 4IQWA 5KFJA 4F2SA 5CRXA 3C2KA 1S9FA 2PFPA 3L4PA 4DL3A 4A8EA 3MR2A 2GLEA 2N1RA 7ICGA 4F91B 5J0TA 3GIMA 2QARA 3JPQA 4YD1A 2R8HA 4TURA 2H3IA 2Y9TA 2WTFA 2E8NA 2PMZC 4O9MA 4ECVA 2DF4B 4RQNA 4UBCA 5EE9A 1J97A 5KFAA 4C0ZA 3MGHA 3BS5B 4J9KA 2ZTEA 4NLKA 4P0QA 2MUTA 3N97B 1PUZA 2NYVA 2YMLA 1TKDA 1J2NA 4BUGA 3KD3A 3NRZA 4OJPA 5J2DA 3RJFA 5HR7A 4Y2TA 4ZOHC 5ALLA 1ZETA 2KE7A 1TV9A 5CWRA 5KFHA 5J2GA 5KFBA 2JEGA 5KFLA 2ZJ5A 5ALGA 1ZRMA 3IG5A 4QW9A 2ZIVA 1COKA 4KN4A 1ZQOA 3OHAA 2C2EA 2MRLA 2WAQC 1V38A 3AMZA 3ETLA 3M7DA 4JWMA 4Y2XA 2M9NA 3E0FA 4IL6U 1RG6A 3F2BA 2QARB 3RTVA 1X66A 3SENA 4RQMA 2LKYA 1ZQCA 3SD7A 2KSOB 2BDPA 5KG5A 9ICTA 1CUKA 4RQ8A 1WWVA 3O0FA 5CJ7A 1X2IA 3OSNA 4NLCA 1JALA 4K4IA 4NLBA 2LYAA 2QKQA 4M2YA 3KKAC 9ICCA 3UM9A 4J9NA 1ZQNA 4XA5A 4QZEA 2HOIA 3QYPA 2ZG6A 1KSPA 1KFDA 9ICNA 2VA2A 3BJYA 2RLTA 1TK5A 4C80A 3R9KA 4GC6A 2R8IA 1L6NA 4QZAA 2F1JA 3Q8QB 9ICWA 5HMMA 3V7LA 4O5CA 1TVAA 4M9GA 1KRPA 3ZDBA 5HP4A 3L5KA 2HBMA 1LKYA 3GU3A 2OCEA 4Y2SA 3QEAZ 5ALZA 4RPYA 3QU7A 1SWWA 1BPBA 2IOHA 5JTIA 5G5GA 8ICGA 5JUMA 1PVPA 1ZJMA 5DDMA 1DGJA 4X5VA 4YFKA 2BR0A 4DFPA 2F3NA 2XY5A 1DRGA 4YP3A 3ZD9A 4Q44A 4MEYA 4KLMA 2ASLA 2B0CA 3UMCA 2WAQF 2W3RA 5KG3A 4R66A 4KX5A 3THVA 1YT3A 3AN1A 1T8EA 4B9UA 4B9TA 3TARA 3NASA 5F9NA 2AHOB 1N61A 2L5YA 2DQNB 5CB1A 4I29A 1N56A 3BQ1A 1JI7A 3AQEA 4PGYA 5KL8B 3QU2A 4JV2A 2GWSA 4DSKA 2W03A 4Q8EA 8ICOA 4RNOA 3PMNA 3PSTA 3WK4A 2MSNA 4EX6A 4QWDA 5JU5A 5ALDA 3AU2A 5KFRA 3NRWA 1TFRA 5CEHA 2RDIA 4GXIA 2H5XA 4RT2A 2XO7A 5D49A 7ICLA 2M0NA 4YXJA 5CP2A 3NGDA 4DO9A 2JEFA 1IM4A 3UXOA 3RRGA 4O3NA 8ICPA 5KFUA 2AJQA 2A1JB 5EE3A 4KLJA 4Y2VA 3JPPA 4C4RA 1S97A 1HUOA 1S76D 4JV1A 4JK1A 2J6UA 5DLFA 2VKQA 3M8SA 2VA3A 5HHIA 2NRTA 3CP8A 1Z3EB 4B9NA 3PR4A 4BJQA 4UAZA 4UAVA 4YCXA 2CRXA 5J2CA 3KZXA 4KLEA 5J2BA 1B0XA 2KJ5A 5ALNA 4ELTA 5DG8A 8ICQA 3WK7A 1LB2B 2JMGA 3JPRA 1RYUA 1RZTA 5HHHA 3IRUA 3DDHA 3BDPA 1KFTA 3OPXA 4F5PA 3SZ2A 1FFVA 2F77X 4RPZA 5J2FA 4O3OA 4DQPA 5AK3A 3DEEA 2ZIXB 4DL4A 5IIOA 5KG2A 1C20A 3G6XA 3UQ2A 1SL0A 1ZRNA 4F4XA 2E5SA 2KKPA 3JPSA 2RRDA 3NVZA 5EWGA 3SR6A 1N63A 4I2DA 4U6PA 2XGQA 4I2AA 2WF5A 4Y2JA 3H0LB 1ZQJA 3M9OB 4RU9A 2LYHA 3TADA 4ECUA 2D8CA 3ZDCA 1XS9D 5ALOA 3IM1A 2BDUA 3J81j 4DQIA 4KLTA 2Y1IA 1ZQ1C 4CE6A 2GOLA 4UARA 2I9GA 9ICGA 4CCHA 5J2IA 4ED3A 3HPOA 5DB8A 1JXLA 7ICMA 5KNIA 9ICXA 1HJPA 1ZQWA 4Z6DA 3UMGA 5GTIU 2KKVA 2Q4TA 3V6KA 3C1YA 3G6VA 4QW8A 1QCKA 4UB2A 3ISCA 2ISPA 4M6WB 2YMMA 7ICQA
chains in the Genus database with same CATH topology
2CXYA 5CEHA 1KKXA 2OEHA 2JXJA 2KK0A 2LI6A 2JRZA 2YQEA 2LM1A 5K4LA 1KN5A 4LJXA 2EH9A 1IG6A 1RYUA 2RQ5A 2EQYA 1KQQA 1C20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXY A;  5CEH A;  1KKX A;  2OEH A;  2JXJ A;  2KK0 A;  2LI6 A;  2JRZ A;  2YQE A;  2LM1 A;  5K4L A;  1KN5 A;  4LJX A;  2EH9 A;  1IG6 A;  1RYU A;  2RQ5 A;  2EQY A;  1KQQ A;  1C20 A; 
#chains in the Genus database with same CATH topology
 1DK3 A;  3TFR A;  2OEH A;  1UHU A;  4UAS A;  5B5E U;  3RJJ A;  2V9W A;  1V97 A;  4I28 A;  3FYH A;  2FMP A;  1IG6 A;  1PZN A;  2KZ3 A;  4NL9 C;  2A1A A;  2KIV A;  2JH1 A;  1L8O A;  3I1Y A;  3FM9 A;  4RZR A;  1ZYQ A;  1UCV A;  3NVY A;  5ALS A;  3RB3 A;  2JEJ A;  1QLN A;  1ZQI A;  4F3O A;  3TKA A;  3EWA A;  5DG9 A;  3Q8R B;  4OJO A;  2G09 A;  4PJ0 U;  1D9F A;  1N2X A;  5EWF A;  3VC8 A;  3PY8 A;  8ICL A;  4KIT B;  5DQG A;  3BS7 A;  1Q8K A;  1ZQL A;  1JRO A;  1BNO A;  5CR0 A;  3SMV A;  3U26 A;  9ICJ A;  2FMS A;  2C22 A;  1Z00 B;  4YMN A;  3C5G A;  1XU4 A;  1TAU A;  9ICU A;  3HIL A;  2BQR A;  4ECQ A;  9ICK A;  5DBA A;  4ED0 A;  4PPX A;  4NXZ A;  4LZD A;  3HX0 A;  3QU4 A;  2EZX A;  9ICS A;  2FJ6 A;  3M9N B;  4F93 B;  3T5J A;  2WB1 C;  4HYK A;  4P4M A;  2ZJ8 A;  4O0I A;  4Z6E A;  4FS1 A;  1KL9 A;  4UAW A;  1MSW D;  1MC8 A;  9ICA A;  1NK8 A;  1WCL A;  5AK6 A;  2BCV A;  2UVR A;  3N7P D;  4F72 A;  4DOA A;  4OO1 J;  4F8R A;  3PNC A;  3F5E A;  3N7R C;  8ICE A;  5L9X A;  5EOZ A;  1D9D A;  4EBD A;  2KIC A;  2ESE A;  1RXV A;  2HW3 A;  1N5W A;  5AI6 A;  3HKZ C;  1LV5 A;  1ZQX A;  8ICV A;  5IIJ A;  2KIW A;  4EEN A;  4DQS A;  1TK8 A;  2LYB A;  1ZQK A;  4DFM A;  2VJ4 A;  4C4T A;  2CN1 A;  1ARO P;  1A0P A;  3HJE A;  2XGP A;  3PW4 A;  1U47 A;  4US8 A;  2W9A A;  4ECT A;  3CNH A;  1SZH A;  2W55 A;  2I1Q A;  4C8N A;  4Q45 A;  1U4B A;  1OUQ A;  3C29 A;  3QE9 Y;  2IMW P;  5E79 U;  1A77 A;  3PX4 A;  1EXN A;  4DL2 A;  8ICX A;  5J0O A;  4RPX A;  4B9V A;  3C1Z A;  4ELV A;  5DB7 A;  2KNJ A;  4RQ6 A;  2HHQ A;  1NZP A;  2W9M A;  5GTH U;  2ZUC A;  2IOF A;  4DOC A;  2WF6 A;  5KG6 A;  4QWE A;  9ICI A;  4DQQ A;  3H0R B;  3WK8 A;  1U9L A;  4O3P A;  1JX4 A;  3G6Y A;  3ONN A;  4PZN A;  1L3T A;  2Y9U A;  5KFP A;  2AQ0 A;  1KFS A;  4ED2 A;  1V85 A;  1SL1 A;  1L7M A;  1S0M A;  2IBK A;  1UA0 A;  5ALV A;  3PO4 A;  3ZI4 A;  4ECX A;  1KQQ A;  2KHV A;  1L7N A;  1Z1B A;  1ED1 A;  3N28 A;  3C5F A;  3MR5 A;  5AKY A;  3B0Y A;  2C28 A;  4IRC A;  1T94 A;  1T3Q A;  2BCS A;  2W9B B;  3GV5 B;  4Z6C A;  5EWE A;  2DFL A;  4ICA A;  3KZI U;  2C2R A;  2BCU A;  4I2G A;  4USA A;  3HKZ F;  2PXI A;  3KFU F;  1JUD A;  4P0P A;  3TAQ A;  2EZZ A;  2BCR A;  4KLL A;  4BWJ A;  2W9C B;  1PVQ A;  2HHW A;  4M47 A;  3HP6 A;  3WKC A;  2B6G A;  4UAT A;  4I2J A;  4ACO A;  1XSP A;  3EPI A;  4QZI A;  5J2J A;  4QZG A;  1QQ5 A;  1K5O A;  4JUZ A;  1D8Y A;  2Y1J A;  1T4G A;  4DL6 A;  4KLD A;  2P35 A;  5AIC A;  4UB1 A;  4I27 A;  1BNP A;  9ICR A;  2F8L A;  4DSL A;  5KTQ A;  2HOF A;  5AIA A;  2W54 A;  3RR7 A;  2EDU A;  4AP9 A;  1F0M A;  2W7P A;  2F1I A;  1O08 A;  4F5Q A;  2NRX A;  1T3N A;  3FC4 A;  4OJL A;  2OH2 A;  5KFN A;  3LYS A;  3F2C A;  1RXW A;  9ICQ A;  5F3X B;  2IHN A;  3QUT A;  4BXO A;  2WFA A;  3WKE A;  1ZQP A;  4KLI A;  4QWB A;  4F4Z A;  4ECS A;  2RHF A;  2G08 A;  2JXJ A;  3ZDD A;  3M8R A;  4NLG A;  4EX7 A;  2EAN A;  2KMD A;  8ICH A;  4TQR A;  1BPZ A;  5J0P A;  2FPK A;  3IHQ B;  5EE0 A;  4KX3 A;  4ED6 A;  1MQ3 A;  4QWA A;  2AXT U;  4RQ0 A;  3D2S A;  4QZH A;  4Q43 A;  1S0O A;  7ICK A;  3GZF A;  1SL2 A;  4DEZ A;  1N60 A;  2XCP A;  4EZ9 A;  4DF4 A;  4NV0 A;  2W8L A;  1K1S A;  3C2L A;  4KN7 A;  3SYZ A;  1X9X A;  5ALP A;  5AHX A;  5KFM A;  1B4F A;  4UB6 U;  1SV0 A;  1KEJ A;  4OCZ A;  5III A;  3RB6 A;  1HUZ A;  4PH5 A;  2QB0 B;  1ZQZ A;  1SZP A;  4Y2P A;  5KL1 B;  1KKX A;  4UB4 A;  3PW7 A;  2VIX A;  3RJE A;  1N48 A;  3D2Q A;  1X40 A;  4I2F A;  4M0A A;  1TAM A;  1L5U A;  3Q8L A;  1ZD2 P;  2YY6 A;  5AKK A;  3EZ5 A;  4FZL A;  4FZM A;  2E8P A;  5CA7 A;  4MHV A;  3LWL A;  7ICT A;  3N7S C;  1PVR A;  3T5H A;  2Q0Z X;  2P6R A;  5KAF U;  3JPT A;  2AH5 A;  1WG8 A;  4IQV A;  4MF8 A;  4M6W A;  4MFA A;  2HHS A;  5IIM A;  3BZC A;  4CNQ A;  4YR2 A;  1L7O A;  3GV7 B;  2LM1 A;  7ICP A;  3OJS A;  5KFX A;  5ALJ A;  5KFE A;  3PW5 A;  5AM4 A;  4C8L A;  2BPF A;  1ZQV A;  1MA7 A;  4C8O A;  4MEX A;  1L3U A;  1NNL A;  1Q46 A;  1HEK A;  4ECY A;  1NKC A;  3EUB 2;  3GII A;  2VJ5 A;  3KHL A;  3PR5 B;  2V4Q A;  5KFK A;  2ZUD A;  2UVW A;  1CEZ A;  5ALW A;  3MBY A;  4QJF B;  5JRT A;  1L3V A;  4GFJ A;  4B6J A;  1QQ7 A;  2A1J A;  3E2E A;  5J29 A;  2J6S A;  2DUY A;  4O3M A;  3IN5 A;  1YZ7 A;  3D2N A;  2AU0 A;  2YMP A;  3I28 A;  5TZV A;  3WK9 A;  3QXG A;  3KHG A;  5ALT A;  1S5L U;  4G3I A;  3KOO A;  2O6K A;  4EZ6 A;  1LKY B;  2HCF A;  4NLZ A;  4F71 A;  2I5H A;  3NUQ A;  1WCN A;  2MU2 A;  2W8K A;  9ICB A;  2ATL A;  1ZQS A;  1AQ6 A;  2JV3 A;  8ICN A;  5KFT A;  4DSF A;  2XVT A;  3GIJ A;  4M9H A;  4UB5 A;  4Y2Q A;  4NM2 A;  2DPJ A;  1QTM A;  8ICT A;  1X9W A;  1X9S A;  3BZK A;  3RR8 A;  2A19 A;  4ED1 A;  2ALZ A;  2HOQ A;  3WK5 A;  2HHT A;  2GH1 A;  2RQ5 A;  3ISD A;  3QZ8 A;  3T79 A;  3QUC A;  3TAD C;  2A3V A;  3RBE A;  1H38 A;  4B9M A;  4TQS A;  3PZP A;  2K4H A;  1UA1 A;  4F4K A;  4IR1 A;  3LDA A;  4YG2 A;  4P4P A;  1U49 A;  9ICO A;  1WYG A;  8ICY A;  4IRD A;  4WJ3 B;  3V6J A;  1TAQ A;  1L3S A;  4I2B A;  2E8M A;  1RYR A;  1NOM A;  5AKL A;  4FE3 A;  2MAX A;  5BOM A;  3QNM A;  4CGZ A;  4NM1 A;  2G5I B;  2BCQ A;  1NK7 A;  3V7K A;  5KFQ A;  1ZQY A;  2BPC A;  3D6J A;  1WUD A;  2K8B B;  2KJ9 A;  3V7J A;  3K1Z A;  3M9M B;  3UXP A;  4IS7 A;  5K4L A;  2E1F A;  5KT2 A;  3SAH A;  1SXD A;  2AQ4 A;  3TFS A;  4P2H A;  1Z1V A;  4P0Q B;  1K1Q A;  2ASD A;  5ALR A;  2KP7 A;  5HNK A;  3FDS A;  1QSL A;  2PI4 A;  1KN5 A;  4PHD A;  3PW0 A;  1PK1 A;  4NWI A;  2WF9 A;  4XRH A;  5DG7 A;  3EYZ A;  2YTU A;  2JR5 A;  1QSY A;  1RQN A;  1X6I A;  2DGZ A;  4CF3 A;  7ICO A;  3ETR A;  4F4Y A;  8ICS A;  2ZIW A;  3ZDA A;  4US9 A;  4ECW A;  2DBY A;  5HR6 A;  8ICJ A;  1OW5 A;  4AYB C;  2MUT B;  4DFD A;  4XQ8 A;  4RUA A;  3PX6 A;  2NRW A;  9ICF A;  5DB9 A;  5AI4 A;  1C7Y A;  1N62 A;  1NZB A;  5KFW A;  3HWT A;  4R64 A;  2WF8 A;  5J8Y A;  3NTU A;  5AKX A;  1PK1 B;  2PMZ F;  3RRH A;  5J0U A;  5L1L A;  4YR0 A;  4MF2 A;  3LWM A;  3UQ0 A;  4UAY A;  1ZQG A;  5AI5 A;  1S10 A;  4YQW A;  4F4W A;  4DLE A;  3ED5 A;  3RJI A;  3OSP A;  3KHR A;  4I2H A;  1MQ2 A;  2HHU A;  4EEK A;  4I2C A;  4DSJ A;  3GFK B;  1UQV A;  3LVW A;  4LJX A;  1JMS A;  4J9S A;  4UAU A;  4O5E A;  2F2A B;  5DBB A;  3NVV A;  1KBU A;  2FLN A;  1ECW A;  8ICB A;  3BS5 A;  9ICP A;  2LHT A;  5C0Y A;  1SKS A;  2Z7J A;  5AK5 A;  2JZB B;  7ICV A;  3QUB A;  2XY6 A;  4C8K A;  4RQ2 A;  2FLP A;  4UB3 A;  2H3Z A;  1FIQ A;  3BQ2 A;  2HBK A;  4J9M A;  2CPR A;  4GLX A;  1MN8 A;  4C8M A;  4ED8 A;  4EEL A;  4PGX A;  3ORY A;  1COO A;  2R8G A;  3MAB A;  4MFC A;  2KJ8 A;  3HRD D;  4KMU A;  2FI1 A;  3F5A A;  1BPD A;  2EH9 A;  2E1E A;  1Z4N A;  4J9Q A;  3K4G A;  2QB1 A;  2W7O A;  1NI3 A;  4YN4 A;  1BPE A;  5KFF A;  4DWI A;  1UT8 A;  3KKA A;  2OM6 A;  2W43 A;  2KV2 A;  2ZTD A;  5AKZ A;  3VCB A;  3QUQ A;  4AYB F;  4B9L A;  3H0M B;  3H8M A;  1SKR A;  3RAX A;  4IQT A;  4M9L A;  5J0W A;  2NO4 A;  4UQG A;  1SKW A;  5KG7 A;  5AKJ A;  5AM1 A;  1QH9 A;  3GIK A;  8ICZ A;  2J6T A;  4K4G A;  5L1I A;  2KVC A;  3ZD8 A;  3C2M A;  4JB3 A;  5B66 U;  5J2K A;  2JRZ A;  2BKE A;  4R63 A;  2JHD A;  3OHB A;  4EBC A;  3ISB A;  4JWN A;  5L1K A;  2YMQ A;  5AM3 A;  4RQ7 A;  2YQE A;  4RNN A;  5DQI A;  4XUS A;  2NV3 A;  4Y2R A;  3RFA A;  2ZIU A;  1YZ6 A;  1JRP A;  8ICM A;  1SXE A;  4TUP A;  1TK0 A;  1CRX A;  1FFU A;  4YMM A;  2EZY A;  2XCA A;  2NRZ A;  4PZO A;  2AGO A;  2F8K A;  3EPG A;  5KT5 A;  3RH5 A;  4UBB A;  2OYY A;  4CRX A;  1BVS A;  2HI0 A;  2K4I A;  1ZQF A;  5AKI A;  2GO7 A;  2LPE A;  4YD2 A;  5KT6 A;  4BX9 C;  1QSS A;  3RJH A;  5ALQ A;  3RH6 A;  3TAN A;  1SGG A;  1NJW A;  4J03 A;  5A0L A;  4BXO B;  4R65 A;  2VA8 A;  1Z4O A;  4PL2 A;  4NY8 A;  1LVH A;  2AGP A;  2PFO A;  5CHG A;  1ZQT A;  1ZQM A;  2D6F C;  1ZD5 A;  2ZUB A;  2DPI A;  2W04 A;  5DGA A;  5IIK A;  3KBB A;  5IIL A;  2BPG A;  2YX8 A;  3AU6 A;  5HML A;  3T5K A;  4P4O A;  2K4E A;  2FE9 A;  1NK5 A;  4F5N A;  1A6S A;  2JEI A;  4TUS A;  5ALX A;  3BQT A;  2FPL A;  3E58 A;  3SV4 A;  7ICJ A;  2R8J A;  1ZD4 A;  3M6Z A;  1KDH A;  3SQI A;  4PHP A;  4F92 B;  1T7P A;  5AM0 A;  2YN4 A;  5J0Y A;  1IIP A;  1P7D A;  1KW4 A;  2RP5 A;  3PW2 A;  4F5R A;  1XSL A;  4JV0 A;  9ICM A;  2KTQ A;  1ZQU A;  2R8K A;  2W9C A;  4KMO B;  2P6U A;  2DKX A;  1ZQH A;  4ELU A;  2K4P A;  1B22 A;  4EBE A;  4MFF A;  3F2D A;  2NO5 A;  1KLN A;  8ICR A;  2ES6 A;  1ZD3 A;  4GXK A;  2HVI A;  3BQ0 A;  3GDX A;  1SV4 A;  1DK2 A;  1F5S A;  2MA1 A;  7ICU A;  4FS2 A;  1JXE A;  2BQ3 A;  3KTQ A;  2G07 A;  1S77 D;  5ALY A;  1VDV A;  1ZQD A;  3ZDE A;  4BWM A;  4EEY A;  9ICV A;  2KFZ A;  5DLG A;  2EAO A;  4KLF A;  3MGI A;  1NK0 A;  1NJY A;  2LBO A;  2NRV A;  2HBL A;  1UPH A;  4PHA A;  3B9J A;  2KG5 A;  3IV6 A;  3NS1 A;  2FPM A;  5FP0 A;  2EQY A;  3FAH A;  1F44 A;  3PSI A;  2ZIW B;  2W3S A;  3OGU A;  2UVV A;  3QX7 A;  3PV8 A;  2CXY A;  4E0D A;  1PK3 A;  4EYI B;  2HDO A;  4DFK A;  8ICW A;  3LVV A;  3QU5 A;  5F9L A;  2H3Q A;  3N4M B;  1BGX T;  5KFV A;  3Q8P B;  2RDJ A;  8ICI A;  4KLS A;  1XC9 A;  3MFH A;  5J0S A;  2KZZ A;  3CRX A;  4BDP A;  4R8U A;  3OJU A;  2D3D A;  2KD1 A;  1QQ6 A;  1KTQ A;  2HSZ A;  5KT3 A;  1ZJN A;  4F2R A;  4DL7 A;  3RBD A;  2JZB A;  4ZH4 A;  4J9P A;  5KFC A;  4DOB A;  4FBU A;  1Q3V A;  2FDR A;  5DB6 A;  4BGD A;  2OXO A;  4QZC A;  3SAF A;  2PKE A;  3SEI A;  1S0N A;  2Y0S C;  4M9N A;  4FFD A;  1OXJ A;  4CF4 A;  3H8J A;  4PGQ A;  3H7I A;  3RB4 A;  4CF5 A;  3JPN A;  1U45 A;  4O3R A;  4DF8 A;  4UB8 U;  2ZXI A;  3C23 A;  3RB0 A;  4DS4 A;  1D8L A;  3MGV A;  3TAP A;  3MDA A;  2K89 A;  5T14 A;  2E3T A;  4IC9 A;  2KEY A;  4PL1 A;  4RQ1 A;  2LM4 A;  4P0P B;  4DLG A;  1NJX A;  4PHE A;  5ALE A;  4ECZ A;  3AM9 A;  4OJ6 A;  4RQ3 A;  4DQR A;  5DBC A;  3H8W A;  1FO4 A;  1NJZ A;  1S8O A;  4RNM A;  1ZQA A;  2AGQ A;  3RAQ A;  2G06 A;  5DQH A;  3MFI A;  1XO0 A;  2FMQ A;  4KLG A;  7ICF A;  5AM5 A;  4GXJ A;  3I76 A;  9ICH A;  2JGA A;  2BZF A;  5EE1 A;  3C28 A;  2ZJA A;  1L8L A;  2W11 A;  2C2D A;  1FEZ A;  3SI8 A;  5AK4 A;  1Q3U A;  3RJK A;  3IG8 A;  1Z00 A;  1S0V A;  4IR9 A;  1ZQB A;  3SAG A;  1WWU A;  5AKG A;  5KFY A;  5KFG A;  1Z19 A;  2XID A;  4LZG A;  5J0Q A;  4RUC A;  2PFN A;  5AKE A;  2WB1 F;  4O3S A;  4J9L A;  3T3F A;  2OWO A;  3TQ1 A;  5KAI U;  8ICF A;  2K8C B;  3IDW A;  2DWQ A;  5IIN A;  4CDG A;  4GIB A;  1ZOL A;  2XI9 A;  3QZ7 A;  5L1M A;  4LVS A;  4IRK A;  1IXR A;  1J2M A;  3AL0 B;  2Y0S F;  1RPL A;  1GO3 F;  4F5O A;  1NK9 A;  1XWL A;  5KFI A;  2KHQ A;  2I6X A;  2FLL A;  3PSF A;  3Q8S B;  5C5J A;  1DGS A;  1V9P A;  4UW9 A;  2LMR A;  4TUQ A;  7ICR A;  1NKB A;  4FZN A;  3MR6 A;  1BPY A;  4KLU A;  3UMB A;  4QIW C;  2KSO A;  5KFD A;  3HW8 A;  2VAN A;  5J0X A;  1DOQ A;  2K8A A;  5AI9 A;  3K75 D;  3KHH A;  2BHN A;  5J2H A;  1M6Y A;  5KT7 A;  4J9R A;  7ICE A;  4KLH A;  5KFZ A;  3WKB A;  4QZB A;  5L1J A;  2YB1 A;  5D4B A;  1XO1 A;  2EAM A;  3H40 A;  4B9S A;  5BOL A;  1Y88 A;  3DV9 A;  5H2F U;  4M04 A;  3B0X A;  5D46 A;  2ZIV B;  4DSI A;  1DXS A;  2G0A A;  5J2E A;  2KFN A;  5ALK A;  8ICK A;  3MC1 A;  4FO6 A;  7ICI A;  2XIC A;  3BQ7 A;  3V6H A;  5J0R A;  3LK9 A;  1URJ A;  2V4R A;  4DCC A;  4YR3 A;  3NVW A;  3H4D A;  9ICL A;  5KFS A;  2WHE A;  3M6K A;  1CI4 A;  8ICA A;  2ZXH A;  4ED7 A;  4NLN A;  1RDF A;  1SB3 C;  3AEV A;  2BQU A;  3ICX A;  3AQF A;  4GC7 A;  2OHF A;  2F76 X;  3F53 A;  3SV3 A;  2JH7 A;  2XC9 A;  4OJ5 A;  2HHX A;  1X9M A;  7ICN A;  2QLT A;  2H3V A;  4NJ8 A;  4R8U B;  2K60 A;  2ODG A;  4Y2U A;  2QB0 A;  3MDC A;  1D8B A;  2EAP A;  4KLO A;  5TIS U;  2HMX A;  2UVU A;  4YXM A;  3TI0 A;  4Y2Y A;  1NK4 A;  2ASJ A;  4DL5 A;  5ALH A;  4OD0 A;  5J8Y C;  1XSN A;  5AM2 A;  5AI0 A;  2YB4 A;  3PSP A;  3WKA A;  1SIJ A;  4C7Z A;  3RJG A;  1UT5 A;  5AI8 A;  5J2A A;  5KG1 A;  3GQC A;  7ICH A;  3QEB Z;  4ECR A;  4RQ5 A;  4QIW F;  5DGB A;  2ZTC A;  1ZQR A;  2PI5 A;  4U7C A;  1U48 A;  2DL0 A;  2R18 A;  2ZIU B;  3JPO A;  5ALM A;  3ALR A;  5AIB A;  1NK6 A;  3Q8K A;  4EYH B;  3GIL A;  5G5H A;  1BPX A;  2HHV A;  4HAI A;  9ICE A;  4J9O A;  4QZ8 A;  5DKW A;  3GV8 B;  7ICS A;  3PML A;  3CYM A;  1RM6 C;  1JN3 A;  5KFO A;  4YVZ A;  3OTQ A;  1N5X A;  3UPQ A;  3TAC B;  5KT4 A;  1A76 A;  1HIW A;  3CW2 C;  3RH4 A;  4DSE A;  4DS5 A;  1IV8 A;  2KVS A;  3MR3 A;  3A0B U;  3H8S A;  5KG0 A;  4C7Y A;  2F1H A;  3EW9 A;  4I2I A;  4O3Q A;  1ZQE A;  4Q8F A;  1VJ5 A;  2B21 A;  2XY7 A;  1RQL A;  2IHM A;  4QZD A;  2KN7 A;  1X6J A;  2W9B A;  4K4H A;  2H3F A;  3UXN A;  1ZQQ A;  1B43 A;  3WK6 A;  2ZIX A;  2DKZ A;  3H4B A;  3PO5 A;  2IA6 A;  3PX0 A;  3WU2 U;  1VLB A;  3WKD A;  3M1Y A;  4YMO A;  5BPC A;  2WF7 A;  2PFQ A;  4G9B A;  1JIH A;  5KG4 A;  3T5L A;  2P66 A;  4IQU A;  3S6J A;  3AUO A;  4NL9 A;  8ICC A;  5ALF A;  3L3F X;  4M9J A;  4JMU A;  1SV0 C;  3C21 A;  3V72 A;  2KZM A;  4DFJ A;  4QZ9 A;  2BGW A;  2F44 A;  4KLQ A;  2ISO A;  3A0H U;  5AKH A;  2HVH A;  3PVX A;  4I2E A;  2G5H B;  5ALU A;  4QWC A;  1X42 A;  8ICU A;  4O5K A;  4Z6F A;  4F50 A;  1ZXI A;  1XNS A;  3RF9 A;  1TE2 A;  3K1R B;  1NKE A;  2KK0 A;  3QU9 A;  4C4S A;  1L7P A;  2HBJ A;  2KOB A;  5DDY A;  2E8O A;  4KTQ A;  2LI6 A;  3HT3 A;  5ALI A;  4RQ4 A;  4RT3 A;  1RYS A;  4QNL A;  2IOF K;  4FBT A;  1O03 A;  3IP4 B;  4QZF A;  3Q8M A;  1SWV A;  4IQW A;  5KFJ A;  4F2S A;  5CRX A;  3C2K A;  1S9F A;  2PFP A;  3L4P A;  4DL3 A;  4A8E A;  3MR2 A;  2GLE A;  2N1R A;  7ICG A;  4F91 B;  5J0T A;  3GIM A;  2QAR A;  3JPQ A;  4YD1 A;  2R8H A;  4TUR A;  2H3I A;  2Y9T A;  2WTF A;  2E8N A;  2PMZ C;  4O9M A;  4ECV A;  2DF4 B;  4RQN A;  4UBC A;  5EE9 A;  1J97 A;  5KFA A;  4C0Z A;  3MGH A;  3BS5 B;  4J9K A;  2ZTE A;  4NLK A;  4P0Q A;  2MUT A;  3N97 B;  1PUZ A;  2NYV A;  2YML A;  1TKD A;  1J2N A;  4BUG A;  3KD3 A;  3NRZ A;  4OJP A;  5J2D A;  3RJF A;  5HR7 A;  4Y2T A;  4ZOH C;  5ALL A;  1ZET A;  2KE7 A;  1TV9 A;  5CWR A;  5KFH A;  5J2G A;  5KFB A;  2JEG A;  5KFL A;  2ZJ5 A;  5ALG A;  1ZRM A;  3IG5 A;  4QW9 A;  2ZIV A;  1COK A;  4KN4 A;  1ZQO A;  3OHA A;  2C2E A;  2MRL A;  2WAQ C;  1V38 A;  3AMZ A;  3ETL A;  3M7D A;  4JWM A;  4Y2X A;  2M9N A;  3E0F A;  4IL6 U;  1RG6 A;  3F2B A;  2QAR B;  3RTV A;  1X66 A;  3SEN A;  4RQM A;  2LKY A;  1ZQC A;  3SD7 A;  2KSO B;  2BDP A;  5KG5 A;  9ICT A;  1CUK A;  4RQ8 A;  1WWV A;  3O0F A;  5CJ7 A;  1X2I A;  3OSN A;  4NLC A;  1JAL A;  4K4I A;  4NLB A;  2LYA A;  2QKQ A;  4M2Y A;  3KKA C;  9ICC A;  3UM9 A;  4J9N A;  1ZQN A;  4XA5 A;  4QZE A;  2HOI A;  3QYP A;  2ZG6 A;  1KSP A;  1KFD A;  9ICN A;  2VA2 A;  3BJY A;  2RLT A;  1TK5 A;  4C80 A;  3R9K A;  4GC6 A;  2R8I A;  1L6N A;  4QZA A;  2F1J A;  3Q8Q B;  9ICW A;  5HMM A;  3V7L A;  4O5C A;  1TVA A;  4M9G A;  1KRP A;  3ZDB A;  5HP4 A;  3L5K A;  2HBM A;  1LKY A;  3GU3 A;  2OCE A;  4Y2S A;  3QEA Z;  5ALZ A;  4RPY A;  3QU7 A;  1SWW A;  1BPB A;  2IOH A;  5JTI A;  5G5G A;  8ICG A;  5JUM A;  1PVP A;  1ZJM A;  5DDM A;  1DGJ A;  4X5V A;  4YFK A;  2BR0 A;  4DFP A;  2F3N A;  2XY5 A;  1DRG A;  4YP3 A;  3ZD9 A;  4Q44 A;  4MEY A;  4KLM A;  2ASL A;  2B0C A;  3UMC A;  2WAQ F;  2W3R A;  5KG3 A;  4R66 A;  4KX5 A;  3THV A;  1YT3 A;  3AN1 A;  1T8E A;  4B9U A;  4B9T A;  3TAR A;  3NAS A;  5F9N A;  2AHO B;  1N61 A;  2L5Y A;  2DQN B;  5CB1 A;  4I29 A;  1N56 A;  3BQ1 A;  1JI7 A;  3AQE A;  4PGY A;  5KL8 B;  3QU2 A;  4JV2 A;  2GWS A;  4DSK A;  2W03 A;  4Q8E A;  8ICO A;  4RNO A;  3PMN A;  3PST A;  3WK4 A;  2MSN A;  4EX6 A;  4QWD A;  5JU5 A;  5ALD A;  3AU2 A;  5KFR A;  3NRW A;  1TFR A;  5CEH A;  2RDI A;  4GXI A;  2H5X A;  4RT2 A;  2XO7 A;  5D49 A;  7ICL A;  2M0N A;  4YXJ A;  5CP2 A;  3NGD A;  4DO9 A;  2JEF A;  1IM4 A;  3UXO A;  3RRG A;  4O3N A;  8ICP A;  5KFU A;  2AJQ A;  2A1J B;  5EE3 A;  4KLJ A;  4Y2V A;  3JPP A;  4C4R A;  1S97 A;  1HUO A;  1S76 D;  4JV1 A;  4JK1 A;  2J6U A;  5DLF A;  2VKQ A;  3M8S A;  2VA3 A;  5HHI A;  2NRT A;  3CP8 A;  1Z3E B;  4B9N A;  3PR4 A;  4BJQ A;  4UAZ A;  4UAV A;  4YCX A;  2CRX A;  5J2C A;  3KZX A;  4KLE A;  5J2B A;  1B0X A;  2KJ5 A;  5ALN A;  4ELT A;  5DG8 A;  8ICQ A;  3WK7 A;  1LB2 B;  2JMG A;  3JPR A;  1RYU A;  1RZT A;  5HHH A;  3IRU A;  3DDH A;  3BDP A;  1KFT A;  3OPX A;  4F5P A;  3SZ2 A;  1FFV A;  2F77 X;  4RPZ A;  5J2F A;  4O3O A;  4DQP A;  5AK3 A;  3DEE A;  2ZIX B;  4DL4 A;  5IIO A;  5KG2 A;  1C20 A;  3G6X A;  3UQ2 A;  1SL0 A;  1ZRN A;  4F4X A;  2E5S A;  2KKP A;  3JPS A;  2RRD A;  3NVZ A;  5EWG A;  3SR6 A;  1N63 A;  4I2D A;  4U6P A;  2XGQ A;  4I2A A;  2WF5 A;  4Y2J A;  3H0L B;  1ZQJ A;  3M9O B;  4RU9 A;  2LYH A;  3TAD A;  4ECU A;  2D8C A;  3ZDC A;  1XS9 D;  5ALO A;  3IM1 A;  2BDU A;  3J81 j;  4DQI A;  4KLT A;  2Y1I A;  1ZQ1 C;  4CE6 A;  2GOL A;  4UAR A;  2I9G A;  9ICG A;  4CCH A;  5J2I A;  4ED3 A;  3HPO A;  5DB8 A;  1JXL A;  7ICM A;  5KNI A;  9ICX A;  1HJP A;  1ZQW A;  4Z6D A;  3UMG A;  5GTI U;  2KKV A;  2Q4T A;  3V6K A;  3C1Y A;  3G6V A;  4QW8 A;  1QCK A;  4UB2 A;  3ISC A;  2ISP A;  4M6W B;  2YMM A;  7ICQ A; 
#chains in the Genus database with same CATH homology
 2CXY A;  5CEH A;  1KKX A;  2OEH A;  2JXJ A;  2KK0 A;  2LI6 A;  2JRZ A;  2YQE A;  2LM1 A;  5K4L A;  1KN5 A;  4LJX A;  2EH9 A;  1IG6 A;  1RYU A;  2RQ5 A;  2EQY A;  1KQQ A;  1C20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...