2JRZA

Solution structure of the bright/arid domain from the human jarid1c protein.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
SMNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVCNTRPFDNEEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone and sidechain 1H, 13C and 15N resonance assignments of the Bright/ARID domain from the human JARID1C (SMCX) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Histone demethylase JARID1C
total genus 35
structure length 117
sequence length 117
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jrzA00
2LM1A 2EQYA 1KKXA 1KN5A 2JXJA 2OEHA 2KK0A 2CXYA 4LJXA 2JRZA 5K4LA 1C20A 5CEHA 1KQQA 1RYUA 2RQ5A 2LI6A 2YQEA 1IG6A 2EH9A
chains in the Genus database with same CATH superfamily
3QXGA 2PFQA 4UAUA 9ICKA 2E1EA 5IIIA 1ZQMA 4ACOA 2GO7A 2QARA 1RYSA 4ED2A 4F5RA 1YZ7A 5KTQA 3Q8LA 2RQ5A 3PMNA 1DK2A 3UPQA 2AH5A 5CEHA 4BUGA 8ICTA 5DG8A 8ICAA 4UB5A 1VLBA 5ALJA 3F2DA 1NKEA 3RJIA 4PHEA 4O5CA 3RAXA 4JWMA 2DWQA 4C8OA 1T3QA 4US8A 1SXEA 2ZIVB 5ALYA 2HDOA 2RLTA 4AYBC 4O5EA 1NK0A 2WF8A 3JPOA 1Z00A 1A0PA 2JZBB 5KFFA 3V7JA 4JWNA 3QX7A 2LYHA 1MC8A 2E3TA 4RPZA 4IR1A 2J6TA 4DFPA 4ELVA 4ECQA 2HSZA 2R8IA 2N1RA 4UAWA 3WKAA 1M6YA 3ISBA 2M0NA 4O3RA 2ZTEA 3G6XA 4QZFA 5HR7A 2QLTA 3M9NB 4RZRA 4B9MA 4DSKA 2YN4A 1Z4OA 3C28A 2HHUA 3OGUA 2OXOA 3CP8A 3C2LA 1KW4A 2W43A 9ICAA 1ZQAA 3LWMA 2W7PA 2LM4A 2ZXHA 7ICFA 8ICEA 2DKXA 5ALLA 3V72A 1V38A 4RNMA 4UBCA 1TE2A 3RJKA 8ICIA 1ZQWA 3SEIA 2YY6A 1L7PA 3IV6A 2DQNB 1L5UA 3WK8A 3UXPA 4CDGA 3PO4A 5ALMA 1TK5A 3SI8A 2ZTCA 1SKRA 2WAQF 5JUMA 1RPLA 1XNSA 2OWOA 4NV0A 2QB0A 5DKWA 5J0TA 4R8UA 2B0CA 5J2BA 4OJPA 3TQ1A 3TARA 1S10A 2K4HA 1S9FA 2VANA 2UVVA 3IHQB 1KQQA 5KFOA 3S6JA 5DG7A 7ICTA 2RHFA 4Q8EA 3C5FA 3LYSA 2HBKA 5KG1A 1N62A 3WK6A 3JPPA 3MR6A 1ZD2P 3FDSA 4J9RA 2W7OA 1U47A 4QZCA 1ZQCA 1FEZA 2LMRA 2KOBA 1ZQZA 9ICJA 3ED5A 2EZYA 7ICLA 3C23A 2Y9TA 3JPTA 4YCXA 3QZ7A 2I1QA 3RR7A 4O3QA 2F1JA 2JEGA 2WB1C 3ZDEA 1RYUA 2FMSA 2F44A 3KZIU 4O3MA 7ICVA 9ICPA 2JZBA 2OYYA 3DDHA 4GC6A 5G5GA 4C8LA 1MSWD 5KFIA 3I76A 4FFDA 1NJZA 1OXJA 1ED1A 4I2EA 2LYAA 2D8CA 3EPIA 5KT6A 1U49A 3F5AA 2WAQC 4FZMA 5AKYA 3N7RC 1QSLA 2JEIA 3PR4A 5J0QA 8ICBA 1LKYA 2G06A 2BGWA 2A1JB 4TQRA 4YXJA 5J2CA 2FJ6A 5J0YA 1PVPA 5DBBA 4QZ9A 2KV2A 4B9TA 4F4KA 5BOLA 5CRXA 5AKJA 4QIWC 3WK9A 5ALEA 3VC8A 2FLNA 2E1FA 1UT5A 2MUTB 4IL6U 1TK8A 3V7KA 1TFRA 5IIKA 2QARB 1IXRA 3PMLA 3RH4A 3ALRA 4QZ8A 4CNQA 2KICA 3E58A 4P4PA 4RNNA 4YFKA 2FPLA 3G6YA 3PW5A 4M2YA 2AGQA 3SQIA 4Z6EA 1B0XA 4M04A 4GLXA 4I29A 1YZ6A 1ZYQA 4US9A 2W9CA 3CNHA 2B6GA 2P6UA 4YG2A 4K4IA 4OD0A 5ALNA 2HHVA 2VA3A 9ICIA 4RNOA 9ICWA 4XQ8A 4F5NA 1QQ5A 1LV5A 5J2KA 3RJJA 3FC4A 4DFJA 3U26A 2E8MA 5KFGA 3OHBA 2L5YA 4DQIA 1PK1B 5KFWA 4EBCA 5ALZA 8ICRA 2KNJA 1RM6C 1JI7A 7ICPA 2KP7A 4JB3A 3MR5A 1J2NA 3H8SA 3RH5A 1DGJA 3L4PA 3HRDD 3JPRA 8ICNA 3ETLA 3V6KA 3BS5A 2BQ3A 2LHTA 4OJOA 4BJQA 8ICVA 2JGAA 9ICHA 4XRHA 2RDIA 2EAMA 5KFHA 3TACB 5KT2A 5D46A 3PSIA 3N28A 3M9OB 5ALRA 1QTMA 1RQNA 9ICLA 3IG5A 3IM1A 1ECWA 4ICAA 2EAPA 5KFEA 2BCVA 8ICUA 4ED0A 1LVHA 2Y0SC 1B4FA 5KG3A 3BQ1A 4DCCA 2CN1A 1S5LU 2KHVA 4XUSA 4IQWA 3A0BU 2ZXIA 5DQGA 4GXKA 1DK3A 5ALXA 3SAFA 4F5PA 1D8LA 2JRZA 4BWJA 3AU6A 2FLLA 1N61A 4RQ6A 4RT2A 2R8HA 3RTVA 1WWVA 9ICVA 2YQEA 4OJLA 3TFRA 2KVSA 3M8RA 2XI9A 1J97A 2H5XA 2W54A 4M6WB 5AKLA 1SL0A 3TANA 3RRHA 2LBOA 2CRXA 2MSNA 5AK5A 2HOFA 3ZD9A 2FMQA 5JU5A 4PL1A 5AIBA 2W9MA 1ZQNA 5AICA 3CYMA 3IG8A 1NZPA 2EDUA 4IR9A 3G6VA 3C2MA 3LVWA 1DGSA 5E79U 4DSIA 3TI0A 1COOA 1CUKA 3IP4B 3QUCA 8ICSA 4RQ0A 4MFAA 5DQIA 1TAUA 4Y2TA 5HMLA 1QSYA 4J9OA 1P7DA 4F91B 4GC7A 8ICPA 4F8RA 1RXVA 3EYZA 2AQ4A 4QZGA 2NRXA 3FYHA 4ELTA 2ESEA 1BPEA 1N60A 4RPXA 2P66A 2W9BA 2C28A 4K4GA 2W9AA 4RQ8A 1UA1A 2FPKA 1L3TA 1PVQA 3N7PD 3NASA 5J2GA 2YMMA 1Q3VA 3WKBA 5J2EA 4A8EA 2HHQA 3TADA 8ICMA 2HVHA 1N63A 5KG5A 4MEXA 3RB4A 5EE3A 4U7CA 1NK5A 1XSLA 4QWAA 4KLDA 1ZQFA 5DB7A 2ZJAA 2HBLA 1ZQBA 4KLHA 3HKZC 2DUYA 1F5SA 3AQEA 1X40A 2DKZA 4DF8A 3NVYA 5AM3A 4BWMA 5D49A 1COKA 2DGZA 2UVWA 2Y1IA 2VA8A 1RG6A 4NLKA 3C29A 4UB3A 2BQUA 4QZEA 1T4GA 2YTUA 4EYIB 1LB2B 5F9NA 2F1HA 3MGIA 3GIMA 2OCEA 2ISPA 9ICCA 2W3RA 3UMGA 2I9GA 4RQ3A 4MFCA 3H4DA 3M7DA 3C5GA 3C2KA 1JXLA 3GFKB 1L3SA 5JTIA 3T5KA 4QZAA 5DDYA 5F3XB 1U45A 1IIPA 4IQTA 4O5KA 1TAMA 3EUB2 4YN4A 2FPMA 4Y2RA 4DQSA 4NWIA 5T14A 4UQGA 2W9CB 2ALZA 3ISDA 3MGVA 4HYKA 3HW8A 5B5EU 4M9HA 1ZJNA 2KE7A 2WF9A 4I2IA 4QWBA 2YB1A 4UB1A 3HP6A 1NJXA 3DEEA 2IHMA 3RH6A 5KFSA 4I2CA 4EX7A 7ICUA 3RJGA 5CWRA 4F92B 4DLGA 8ICOA 7ICNA 2E5SA 1ZQRA 3CRXA 2CXYA 2W04A 1ZQJA 2ZJ8A 1D9FA 1O08A 1T94A 1ZQDA 3GV5B 2BZFA 1T3NA 4NLNA 4Y2UA 1NJYA 4B9UA 2NO5A 5KT7A 4DL5A 5A0LA 5EE9A 5J0OA 3R9KA 2FI1A 3EPGA 3SZ2A 1ZJMA 5J0SA 4KN4A 2MU2A 1Q3UA 4QWCA 5AHXA 3ICXA 4UARA 4R64A 1JN3A 5AI4A 1TVAA 3ZD8A 4F2SA 1NZBA 2OH2A 4KMOB 5BOMA 3LK9A 4PPXA 1A76A 3ORYA 5AIAA 4PHAA 4DFKA 5AM0A 3QU7A 4NM1A 2JV3A 4FBTA 2Y0SF 4DOAA 5ALWA 2AXTU 2KIVA 3RB3A 4M9GA 4EBEA 1U48A 1C7YA 3B0XA 5ALQA 1UHUA 5AI0A 4OO1J 1ZD3A 3O0FA 3QNMA 4KX3A 4NLBA 1X66A 1SIJA 2BPGA 4F2RA 4M0AA 4QWDA 4ED6A 2NYVA 1SB3C 8ICKA 1NK8A 3E2EA 5L9XA 2M9NA 3MDAA 3NRWA 1ZRMA 2YMLA 9ICEA 5J0RA 4IQUA 4NXZA 2AGPA 3QU9A 3QYPA 5DB6A 5HP4A 5IIJA 1X6IA 4P0QB 2MUTA 4M9NA 4C8NA 5KFYA 1PK3A 2WHEA 2JHDA 5FP0A 2ZG6A 3PW2A 2K4EA 5KFPA 3ZDBA 5KT5A 3KTQA 3HILA 4YMOA 3RJFA 5EWFA 3KHRA 3AQFA 2KKVA 4NY8A 1ZRNA 1KL9A 5CJ7A 1XO1A 3HKZF 3QU5A 1OUQA 5J0XA 1SZPA 4DS5A 1ZQTA 1K1QA 1DRGA 5H2FU 2W9BB 1SV0C 5KFTA 3H40A 2R8KA 5BPCA 1U4BA 2FDRA 2VJ5A 8ICJA 1KEJA 2JR5A 1O03A 2K89A 1QSSA 1C20A 3KFUF 2NRZA 4GIBA 4F5OA 3PVXA 4RQMA 1T8EA 4QZHA 9ICRA 2BCQA 5KG7A 2LYBA 3D6JA 2WTFA 2XY6A 4ECXA 3WKCA 3WU2U 2F1IA 1L7NA 1RQLA 5ALFA 1WCLA 1SKSA 9ICFA 3GV8B 4CF4A 2JEFA 3ZI4A 4KLLA 2VKQA 4YP3A 3T5HA 1MQ2A 5KG2A 2YX8A 4DSLA 2EZZA 2KK0A 4IS7A 5J0WA 4C80A 3PW0A 3SAHA 5AKXA 4BX9C 1AQ6A 2A1JA 4RQ1A 4PGQA 4MF8A 1RDFA 1SL1A 3BZCA 4RQ4A 3RBDA 4Z6FA 1SXDA 3NUQA 3BQTA 5ALIA 5KNIA 5EWEA 1ZQVA 5CB1A 4C4SA 4YD1A 4BGDA 3PY8A 1BVSA 3QU4A 4AYBF 4EBDA 3NRZA 4J9SA 4P0PA 3HJEA 7ICHA 4Q43A 2WF5A 1JX4A 2DBYA 1KFDA 3HWTA 3AL0B 2V4RA 5HR6A 3RB6A 5KFAA 5KFJA 4KLOA 3BQ7A 1F0MA 4B9VA 4FZLA 2HVIA 4KTQA 2ZIUA 3RFAA 4ECVA 3QUTA 2W11A 3KHLA 5AI8A 4DFMA 5J8YC 2ISOA 5AM1A 3K1ZA 1ZQPA 5J2HA 4X5VA 5DB8A 3F2CA 2IA6A 2HHWA 4B9LA 1JALA 5AI9A 2JXJA 3H0LB 1NK7A 4UATA 4R8UB 2BKEA 5HHIA 2P6RA 1X42A 7ICKA 1Q46A 1ZQLA 1V9PA 3K1RB 1HEKA 1OW5A 3ZDCA 5KFNA 4Y2VA 1LKYB 2KHQA 1S0NA 4KN7A 3PX4A 3T3FA 2ZIVA 3BS5B 1JROA 2AHOB 5HMMA 3MDCA 4YR3A 1N56A 8ICWA 4Q45A 5L1JA 4PGXA 2PFOA 4O3SA 1PZNA 3VCBA 4UAVA 1QQ6A 3GQCA 1BPDA 5KAFU 4KLSA 1URJA 3RAQA 2G08A 4CRXA 3M1YA 4I2AA 5KFUA 2H3ZA 3SD7A 4TURA 4FZNA 3LDAA 3HX0A 4KLJA 1BGXT 3RJHA 2GLEA 1N48A 3BS7A 2V4QA 3UM9A 3THVA 2DF4B 1NOMA 2NRWA 4DL7A 1Z1VA 2KSOB 4DFDA 3IRUA 4C4RA 7ICRA 3EWAA 2E8PA 3OTQA 4G3IA 1MN8A 4BXOB 4K4HA 1X6JA 4O3OA 5JRTA 2XC9A 2QKQA 2K60A 5G5HA 2JEJA 2XGPA 4DL4A 3F5EA 4F4YA 2BPCA 3FM9A 5J0UA 2G5IB 4KLFA 2ODGA 4LVSA 4C8MA 3PO5A 1SWWA 5L1MA 1JUDA 2G0AA 2R18A 2KN7A 3HT3A 3K4GA 5TZVA 1NKCA 1D8YA 2PMZF 3AEVA 4KX5A 1A77A 4UBBA 4DSJA 1JIHA 2VIXA 4Y2QA 4ED8A 5ALSA 4EX6A 1KSPA 1KRPA 5ALKA 2RRDA 2K4PA 2G5HB 1X2IA 1N2XA 2EANA 3NVVA 4RUCA 2PI4A 3UMBA 5DLFA 1HIWA 2BDUA 4FS1A 8ICCA 1SKWA 1ZQYA 3UMCA 4ECZA 3ISCA 4I2FA 2XVTA 5IIMA 5J2DA 1FIQA 1XWLA 2VJ4A 4B9SA 2NRVA 4NL9A 4Y2SA 1L3UA 2A19A 5ALOA 2BHNA 4JV0A 1CEZA 3ETRA 2KFNA 1SV0A 1NKBA 1BPXA 2PFPA 2EZXA 3WKDA 3KHGA 2HBJA 1H38A 2XCPA 4C8KA 3RR8A 4UB4A 4CF5A 2KJ8A 4O0IA 2PMZC 1D9DA 1ZQEA 4PZNA 4GXIA 1UQVA 2AU0A 3RBEA 5DBCA 3J81j 1Z4NA 2QB0B 5IIOA 2WFAA 5GTHU 4QJFB 4QWEA 2Q4TA 2H3IA 2ZUDA 2C22A 4I2JA 4CF3A 2LI6A 5KAIU 1PVRA 5AI6A 2ZIWA 1ZQ1C 2HOQA 5CA7A 9ICXA 2EAOA 1X9WA 4RQ5A 4Q44A 2K8CB 2NO4A 3E0FA 8ICGA 4R66A 4J03A 4LZDA 1KFSA 9ICOA 4TUPA 5AKZA 2W55A 4QZDA 2HI0A 3SMVA 4J9PA 5DG9A 3M9MB 5C0YA 1KDHA 4Q8FA 1S8OA 2ZIWB 3JPSA 2F2AB 5L1LA 4KLIA 1V97A 1Z19A 1TV9A 4F5QA 2MAXA 4F72A 2W8LA 1NK4A 2NV3A 4ED3A 4IRDA 2MRLA 1AROP 4PJ0U 1SV4A 3MGHA 1NK9A 4KLUA 2ZIUB 4DEZA 2OEHA 3Q8SB 1PK1A 5AM5A 2ATLA 1YT3A 4NL9C 8ICLA 3WK5A 4PHDA 4GXJA 4UAZA 5KFLA 1Y88A 9ICMA 1NNLA 2IOFA 2BDPA 2BCRA 4PGYA 3CW2C 1MQ3A 4BDPA 3PX0A 2WB1F 4AP9A 1ZETA 2IMWP 4I2BA 2Y9UA 3GDXA 2A3VA 1U9LA 1V85A 3V6JA 4ECTA 2YB4A 4F4XA 3OSNA 4QNLA 2OHFA 5J2IA 7ICSA 3MR2A 3ONNA 5B66U 1CRXA 4FBUA 3BJYA 1SWVA 1B22A 4M6WA 1ZD4A 5AKIA 4M47A 2C2DA 4DQRA 4OJ5A 9ICUA 4OCZA 1X9XA 3WK7A 4M9JA 3QUQA 3D2QA 5TISU 4U6PA 4YR0A 4J9LA 2IBKA 1BPBA 2HW3A 2C2RA 1HUZA 5KFRA 1NK6A 3M8SA 4FS2A 4DSFA 1NI3A 2NRTA 4I28A 4TUQA 1ZQQA 4ECSA 2W3SA 4ECUA 3LWLA 3BZKA 5D4BA 2GWSA 1GO3F 3KD3A 1L7MA 3PSTA 5AK4A 2Y1JA 3Q8MA 2BQRA 5EE0A 3MR3A 4QZBA 3MFHA 4IRKA 2BCSA 3UQ0A 3GIJA 2JH7A 2P35A 2AGOA 5ALVA 1SL2A 4E0DA 4P4MA 2ZTDA 3GV7B 4B9NA 4QW9A 1XSPA 4NJ8A 3BQ0A 1ZQUA 1WWUA 4P2HA 2IOFK 3GU3A 5J2FA 1KTQA 4ECWA 3H8MA 7ICMA 2A1AA 5IILA 1S0MA 5KG0A 4NLCA 2Q0ZX 4UB6U 4DL2A 3IN5A 3MBYA 2XIDA 4J9NA 2FMPA 4YR2A 9ICSA 3NGDA 3M6ZA 1F44A 4KLQA 3QUBA 5AKHA 4RQ7A 5C5JA 3GILA 2GH1A 1EXNA 3OPXA 1FFUA 4JV2A 2HHTA 2JMGA 1S0VA 2KSOA 3C1ZA 4JUZA 4C7YA 4ED7A 2XGQA 4MF2A 4G9BA 3V7LA 1Q8KA 2PI5A 3Q8QB 9ICNA 3PSFA 2K4IA 3D2SA 2YMQA 4MEYA 1Z3EB 4O3PA 2C2EA 4EZ6A 2PFNA 3SENA 1Z00B 4RU9A 3PW4A 2F3NA 4DOCA 1S0OA 3EZ5A 2IOHA 1QH9A 2R8JA 1QLNA 2HOIA 4OJ6A 4J9MA 4NLGA 4EYHB 2PKEA 4JK1A 4Y2PA 1KFTA 5KL1B 4ELUA 3N7SC 2ASJA 4LZGA 4DL6A 2UVUA 1J2MA 4Y2XA 4GFJA 5HHHA 2VA2A 1KLNA 2D3DA 8ICYA 2E8NA 3LVVA 2Z7JA 1L6NA 1X9SA 3OHAA 7ICIA 3PSPA 4EENA 2RP5A 4B6JA 1PUZA 2ZIXA 3TAQA 1ZQKA 3QU2A 3PV8A 3T5JA 3KKAC 5ALGA 2XICA 3F2BA 4YD2A 4I2HA 1ZQOA 2D6FC 2DPJA 3MC1A 1QCKA 4DL3A 4NM2A 3H8JA 5KT3A 5J0PA 1RXWA 3BDPA 4KLMA 4XA5A 3KHHA 3NVZA 5J8YA 1ZXIA 1HJPA 5KFKA 3I28A 2HCFA 2FE9A 2LKYA 4IQVA 5KFDA 2G07A 1A6SA 3PW7A 4NLZA 2KFZA 2G09A 3KZXA 4RQ2A 3EW9A 1ZQXA 4Z6CA 4F4WA 1BNPA 3RRGA 3JPQA 1KBUA 2V9WA 3KBBA 5IINA 5ALDA 8ICXA 4F71A 4TQSA 5KFVA 4DLEA 3QZ8A 4ED1A 4CE6A 2FLPA 2KIWA 1FFVA 5AKEA 3GIKA 1ZD5A 2UVRA 4CGZA 3B9JA 2HMXA 4PZOA 4P4OA 1S77D 5DB9A 4WJ3B 2MA1A 5EOZA 4C0ZA 1FO4A 2WF6A 5CHGA 2H3VA 3H0RB 3WKEA 1ZOLA 3ZDAA 5AI5A 1XC9A 4DSEA 4DF4A 3H7IA 3PX6A 2XY5A 3MABA 3I1YA 3D2NA 4YXMA 4DOBA 3NTUA 4IC9A 3UXOA 5AM2A 4J9KA 1KN5A 4MHVA 4DS4A 3TAPA 1S97A 5F9LA 4C4TA 1ZQIA 2IHNA 4KMUA 3TKAA 5EE1A 2PXIA 4QW8A 4YMMA 2KMDA 2KEYA 4UB8U 3AMZA 2K8AA 3PR5B 4ECYA 2BCUA 2R8GA 3FAHA 1TK0A 5EWGA 2GOLA 1HUOA 5ALTA 4MFFA 1X9MA 4Y2JA 1XSNA 1DXSA 2ES6A 4F3OA 2KZZA 7ICEA 5DBAA 1L3VA 1L8OA 2BR0A 5GTIU 4DQPA 3M6KA 4JV1A 2KVCA 2O6KA 3RF9A 1NJWA 1WUDA 2F8KA 1L8LA 1L7OA 3SV3A 1JRPA 1SGGA 3QE9Y 7ICGA 5AKGA 5DDMA 4FO6A 4DO9A 2WF7A 2ZJ5A 5AM4A 3Q8PB 3GIIA 5DGAA 4I27A 4RT3A 4PHPA 2KJ5A 4TUSA 2H3QA 5ALHA 4DWIA 8ICZA 3H8WA 4R65A 3N97B 4UAYA 5KG6A 2KJ9A 2K8BB 3MFIA 3N4MB 2J6UA 2H3FA 3QEBZ 7ICQA 2I6XA 8ICHA 4LJXA 4ECRA 2F8LA 5ALPA 3TADC 1RYRA 3C1YA 3SAGA 1ZQSA 4F4ZA 1IM4A 4ZH4A 4YVZA 2XY7A 5J2JA 3BQ2A 4M9LA 8ICQA 1WCNA 2DL0A 3T5LA 4KLTA 9ICTA 2J6SA 5KFBA 2DFLA 4DQQA 2ZUCA 4HAIA 2QB1A 5KG4A 4EEYA 1N5XA 5CP2A 3TFSA 2KZMA 5KFZA 1S76D 2KTQA 1QQ7A 5KFMA 3H4BA 3AUOA 4RPYA 3SV4A 4Y2YA 3UQ2A 5DQHA 1WG8A 1WYGA 3ZDDA 3SYZA 5KFQA 4YQWA 3IDWA 2DPIA 5HNKA 4J9QA 2ASDA 4I2DA 2KG5A 2LM1A 4RUAA 1JXEA 5DGBA 5K4LA 4KITB 4I2GA 3SR6A 5KFCA 3K75D 2EQYA 1T7PA 5AK6A 5KFXA 4ZOHC 4Z6DA 3GZFA 5J29A 2CPRA 4QZIA 4KLGA 3UXNA 3AN1A 4P0PB 4EELA 4EZ9A 4UW9A 4JMUA 4QIWF 1IV8A 2E8OA 3B0YA 2ZUBA 4BXOA 3OJUA 5L1KA 4UASA 2KKPA 4PH5A 2W8KA 4F50A 1BPZA 1B43A 2JH1A 3KKAA 9ICGA 2KD1A 2LPEA 3RJEA 1DOQA 3Q8KA 2HHXA 5DLGA 4UB2A 1IG6A 2EH9A 1K5OA 1D8BA 4PL2A 3A0HU 1ZQHA 2ASLA 1RZTA 3C21A 1UT8A 1N5WA 3AM9A 2F76X 1UCVA 5AK3A 5L1IA 2RDJA 2KZ3A 3OJSA 1TAQA 2HBMA 1BPYA 3PZPA 4USAA 1UA0A 2BPFA 7ICOA 3NS1A 9ICBA 2AJQA 5J2AA 1MA7A 1UPHA 3WK4A 5KL8B 5AKKA 4YMNA 1KKXA 2W03A 4O9MA 2B21A 3QEAZ 2AQ0A 3RB0A 3OSPA 1VDVA 1VJ5A 1Z1BA 3NVWA 3HPOA 1XU4A 3KOOA 1XS9D 5CR0A 4C7ZA 4P0QA 4IRCA 2YMPA 4EEKA 3F53A 3L3FX 4FE3A 3DV9A 1ZQGA 4CCHA 3JPNA 1BNOA 2HHSA 9ICQA 4O3NA 3T79A 3V6HA 3H0MB 3AU2A 1K1SA 3Q8RB 5ALUA 5KT4A 2F77X 1JMSA 4RQNA 2XO7A 8ICFA 1SZHA 3PNCA 1CI4A 7ICJA 2I5HA 4F93B 4R63A 2OM6A 1TKDA 1XO0A 4KLEA 2XCAA 2ZIXB 3L5KA
chains in the Genus database with same CATH topology
2LM1A 2EQYA 1KKXA 1KN5A 2JXJA 2OEHA 2KK0A 2CXYA 4LJXA 2JRZA 5K4LA 1C20A 5CEHA 1KQQA 1RYUA 2RQ5A 2LI6A 2YQEA 1IG6A 2EH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM1 A;  2EQY A;  1KKX A;  1KN5 A;  2JXJ A;  2OEH A;  2KK0 A;  2CXY A;  4LJX A;  2JRZ A;  5K4L A;  1C20 A;  5CEH A;  1KQQ A;  1RYU A;  2RQ5 A;  2LI6 A;  2YQE A;  1IG6 A;  2EH9 A; 
#chains in the Genus database with same CATH topology
 3QXG A;  2PFQ A;  4UAU A;  9ICK A;  2E1E A;  5III A;  1ZQM A;  4ACO A;  2GO7 A;  2QAR A;  1RYS A;  4ED2 A;  4F5R A;  1YZ7 A;  5KTQ A;  3Q8L A;  2RQ5 A;  3PMN A;  1DK2 A;  3UPQ A;  2AH5 A;  5CEH A;  4BUG A;  8ICT A;  5DG8 A;  8ICA A;  4UB5 A;  1VLB A;  5ALJ A;  3F2D A;  1NKE A;  3RJI A;  4PHE A;  4O5C A;  3RAX A;  4JWM A;  2DWQ A;  4C8O A;  1T3Q A;  4US8 A;  1SXE A;  2ZIV B;  5ALY A;  2HDO A;  2RLT A;  4AYB C;  4O5E A;  1NK0 A;  2WF8 A;  3JPO A;  1Z00 A;  1A0P A;  2JZB B;  5KFF A;  3V7J A;  4JWN A;  3QX7 A;  2LYH A;  1MC8 A;  2E3T A;  4RPZ A;  4IR1 A;  2J6T A;  4DFP A;  4ELV A;  4ECQ A;  2HSZ A;  2R8I A;  2N1R A;  4UAW A;  3WKA A;  1M6Y A;  3ISB A;  2M0N A;  4O3R A;  2ZTE A;  3G6X A;  4QZF A;  5HR7 A;  2QLT A;  3M9N B;  4RZR A;  4B9M A;  4DSK A;  2YN4 A;  1Z4O A;  3C28 A;  2HHU A;  3OGU A;  2OXO A;  3CP8 A;  3C2L A;  1KW4 A;  2W43 A;  9ICA A;  1ZQA A;  3LWM A;  2W7P A;  2LM4 A;  2ZXH A;  7ICF A;  8ICE A;  2DKX A;  5ALL A;  3V72 A;  1V38 A;  4RNM A;  4UBC A;  1TE2 A;  3RJK A;  8ICI A;  1ZQW A;  3SEI A;  2YY6 A;  1L7P A;  3IV6 A;  2DQN B;  1L5U A;  3WK8 A;  3UXP A;  4CDG A;  3PO4 A;  5ALM A;  1TK5 A;  3SI8 A;  2ZTC A;  1SKR A;  2WAQ F;  5JUM A;  1RPL A;  1XNS A;  2OWO A;  4NV0 A;  2QB0 A;  5DKW A;  5J0T A;  4R8U A;  2B0C A;  5J2B A;  4OJP A;  3TQ1 A;  3TAR A;  1S10 A;  2K4H A;  1S9F A;  2VAN A;  2UVV A;  3IHQ B;  1KQQ A;  5KFO A;  3S6J A;  5DG7 A;  7ICT A;  2RHF A;  4Q8E A;  3C5F A;  3LYS A;  2HBK A;  5KG1 A;  1N62 A;  3WK6 A;  3JPP A;  3MR6 A;  1ZD2 P;  3FDS A;  4J9R A;  2W7O A;  1U47 A;  4QZC A;  1ZQC A;  1FEZ A;  2LMR A;  2KOB A;  1ZQZ A;  9ICJ A;  3ED5 A;  2EZY A;  7ICL A;  3C23 A;  2Y9T A;  3JPT A;  4YCX A;  3QZ7 A;  2I1Q A;  3RR7 A;  4O3Q A;  2F1J A;  2JEG A;  2WB1 C;  3ZDE A;  1RYU A;  2FMS A;  2F44 A;  3KZI U;  4O3M A;  7ICV A;  9ICP A;  2JZB A;  2OYY A;  3DDH A;  4GC6 A;  5G5G A;  4C8L A;  1MSW D;  5KFI A;  3I76 A;  4FFD A;  1NJZ A;  1OXJ A;  1ED1 A;  4I2E A;  2LYA A;  2D8C A;  3EPI A;  5KT6 A;  1U49 A;  3F5A A;  2WAQ C;  4FZM A;  5AKY A;  3N7R C;  1QSL A;  2JEI A;  3PR4 A;  5J0Q A;  8ICB A;  1LKY A;  2G06 A;  2BGW A;  2A1J B;  4TQR A;  4YXJ A;  5J2C A;  2FJ6 A;  5J0Y A;  1PVP A;  5DBB A;  4QZ9 A;  2KV2 A;  4B9T A;  4F4K A;  5BOL A;  5CRX A;  5AKJ A;  4QIW C;  3WK9 A;  5ALE A;  3VC8 A;  2FLN A;  2E1F A;  1UT5 A;  2MUT B;  4IL6 U;  1TK8 A;  3V7K A;  1TFR A;  5IIK A;  2QAR B;  1IXR A;  3PML A;  3RH4 A;  3ALR A;  4QZ8 A;  4CNQ A;  2KIC A;  3E58 A;  4P4P A;  4RNN A;  4YFK A;  2FPL A;  3G6Y A;  3PW5 A;  4M2Y A;  2AGQ A;  3SQI A;  4Z6E A;  1B0X A;  4M04 A;  4GLX A;  4I29 A;  1YZ6 A;  1ZYQ A;  4US9 A;  2W9C A;  3CNH A;  2B6G A;  2P6U A;  4YG2 A;  4K4I A;  4OD0 A;  5ALN A;  2HHV A;  2VA3 A;  9ICI A;  4RNO A;  9ICW A;  4XQ8 A;  4F5N A;  1QQ5 A;  1LV5 A;  5J2K A;  3RJJ A;  3FC4 A;  4DFJ A;  3U26 A;  2E8M A;  5KFG A;  3OHB A;  2L5Y A;  4DQI A;  1PK1 B;  5KFW A;  4EBC A;  5ALZ A;  8ICR A;  2KNJ A;  1RM6 C;  1JI7 A;  7ICP A;  2KP7 A;  4JB3 A;  3MR5 A;  1J2N A;  3H8S A;  3RH5 A;  1DGJ A;  3L4P A;  3HRD D;  3JPR A;  8ICN A;  3ETL A;  3V6K A;  3BS5 A;  2BQ3 A;  2LHT A;  4OJO A;  4BJQ A;  8ICV A;  2JGA A;  9ICH A;  4XRH A;  2RDI A;  2EAM A;  5KFH A;  3TAC B;  5KT2 A;  5D46 A;  3PSI A;  3N28 A;  3M9O B;  5ALR A;  1QTM A;  1RQN A;  9ICL A;  3IG5 A;  3IM1 A;  1ECW A;  4ICA A;  2EAP A;  5KFE A;  2BCV A;  8ICU A;  4ED0 A;  1LVH A;  2Y0S C;  1B4F A;  5KG3 A;  3BQ1 A;  4DCC A;  2CN1 A;  1S5L U;  2KHV A;  4XUS A;  4IQW A;  3A0B U;  2ZXI A;  5DQG A;  4GXK A;  1DK3 A;  5ALX A;  3SAF A;  4F5P A;  1D8L A;  2JRZ A;  4BWJ A;  3AU6 A;  2FLL A;  1N61 A;  4RQ6 A;  4RT2 A;  2R8H A;  3RTV A;  1WWV A;  9ICV A;  2YQE A;  4OJL A;  3TFR A;  2KVS A;  3M8R A;  2XI9 A;  1J97 A;  2H5X A;  2W54 A;  4M6W B;  5AKL A;  1SL0 A;  3TAN A;  3RRH A;  2LBO A;  2CRX A;  2MSN A;  5AK5 A;  2HOF A;  3ZD9 A;  2FMQ A;  5JU5 A;  4PL1 A;  5AIB A;  2W9M A;  1ZQN A;  5AIC A;  3CYM A;  3IG8 A;  1NZP A;  2EDU A;  4IR9 A;  3G6V A;  3C2M A;  3LVW A;  1DGS A;  5E79 U;  4DSI A;  3TI0 A;  1COO A;  1CUK A;  3IP4 B;  3QUC A;  8ICS A;  4RQ0 A;  4MFA A;  5DQI A;  1TAU A;  4Y2T A;  5HML A;  1QSY A;  4J9O A;  1P7D A;  4F91 B;  4GC7 A;  8ICP A;  4F8R A;  1RXV A;  3EYZ A;  2AQ4 A;  4QZG A;  2NRX A;  3FYH A;  4ELT A;  2ESE A;  1BPE A;  1N60 A;  4RPX A;  2P66 A;  2W9B A;  2C28 A;  4K4G A;  2W9A A;  4RQ8 A;  1UA1 A;  2FPK A;  1L3T A;  1PVQ A;  3N7P D;  3NAS A;  5J2G A;  2YMM A;  1Q3V A;  3WKB A;  5J2E A;  4A8E A;  2HHQ A;  3TAD A;  8ICM A;  2HVH A;  1N63 A;  5KG5 A;  4MEX A;  3RB4 A;  5EE3 A;  4U7C A;  1NK5 A;  1XSL A;  4QWA A;  4KLD A;  1ZQF A;  5DB7 A;  2ZJA A;  2HBL A;  1ZQB A;  4KLH A;  3HKZ C;  2DUY A;  1F5S A;  3AQE A;  1X40 A;  2DKZ A;  4DF8 A;  3NVY A;  5AM3 A;  4BWM A;  5D49 A;  1COK A;  2DGZ A;  2UVW A;  2Y1I A;  2VA8 A;  1RG6 A;  4NLK A;  3C29 A;  4UB3 A;  2BQU A;  4QZE A;  1T4G A;  2YTU A;  4EYI B;  1LB2 B;  5F9N A;  2F1H A;  3MGI A;  3GIM A;  2OCE A;  2ISP A;  9ICC A;  2W3R A;  3UMG A;  2I9G A;  4RQ3 A;  4MFC A;  3H4D A;  3M7D A;  3C5G A;  3C2K A;  1JXL A;  3GFK B;  1L3S A;  5JTI A;  3T5K A;  4QZA A;  5DDY A;  5F3X B;  1U45 A;  1IIP A;  4IQT A;  4O5K A;  1TAM A;  3EUB 2;  4YN4 A;  2FPM A;  4Y2R A;  4DQS A;  4NWI A;  5T14 A;  4UQG A;  2W9C B;  2ALZ A;  3ISD A;  3MGV A;  4HYK A;  3HW8 A;  5B5E U;  4M9H A;  1ZJN A;  2KE7 A;  2WF9 A;  4I2I A;  4QWB A;  2YB1 A;  4UB1 A;  3HP6 A;  1NJX A;  3DEE A;  2IHM A;  3RH6 A;  5KFS A;  4I2C A;  4EX7 A;  7ICU A;  3RJG A;  5CWR A;  4F92 B;  4DLG A;  8ICO A;  7ICN A;  2E5S A;  1ZQR A;  3CRX A;  2CXY A;  2W04 A;  1ZQJ A;  2ZJ8 A;  1D9F A;  1O08 A;  1T94 A;  1ZQD A;  3GV5 B;  2BZF A;  1T3N A;  4NLN A;  4Y2U A;  1NJY A;  4B9U A;  2NO5 A;  5KT7 A;  4DL5 A;  5A0L A;  5EE9 A;  5J0O A;  3R9K A;  2FI1 A;  3EPG A;  3SZ2 A;  1ZJM A;  5J0S A;  4KN4 A;  2MU2 A;  1Q3U A;  4QWC A;  5AHX A;  3ICX A;  4UAR A;  4R64 A;  1JN3 A;  5AI4 A;  1TVA A;  3ZD8 A;  4F2S A;  1NZB A;  2OH2 A;  4KMO B;  5BOM A;  3LK9 A;  4PPX A;  1A76 A;  3ORY A;  5AIA A;  4PHA A;  4DFK A;  5AM0 A;  3QU7 A;  4NM1 A;  2JV3 A;  4FBT A;  2Y0S F;  4DOA A;  5ALW A;  2AXT U;  2KIV A;  3RB3 A;  4M9G A;  4EBE A;  1U48 A;  1C7Y A;  3B0X A;  5ALQ A;  1UHU A;  5AI0 A;  4OO1 J;  1ZD3 A;  3O0F A;  3QNM A;  4KX3 A;  4NLB A;  1X66 A;  1SIJ A;  2BPG A;  4F2R A;  4M0A A;  4QWD A;  4ED6 A;  2NYV A;  1SB3 C;  8ICK A;  1NK8 A;  3E2E A;  5L9X A;  2M9N A;  3MDA A;  3NRW A;  1ZRM A;  2YML A;  9ICE A;  5J0R A;  4IQU A;  4NXZ A;  2AGP A;  3QU9 A;  3QYP A;  5DB6 A;  5HP4 A;  5IIJ A;  1X6I A;  4P0Q B;  2MUT A;  4M9N A;  4C8N A;  5KFY A;  1PK3 A;  2WHE A;  2JHD A;  5FP0 A;  2ZG6 A;  3PW2 A;  2K4E A;  5KFP A;  3ZDB A;  5KT5 A;  3KTQ A;  3HIL A;  4YMO A;  3RJF A;  5EWF A;  3KHR A;  3AQF A;  2KKV A;  4NY8 A;  1ZRN A;  1KL9 A;  5CJ7 A;  1XO1 A;  3HKZ F;  3QU5 A;  1OUQ A;  5J0X A;  1SZP A;  4DS5 A;  1ZQT A;  1K1Q A;  1DRG A;  5H2F U;  2W9B B;  1SV0 C;  5KFT A;  3H40 A;  2R8K A;  5BPC A;  1U4B A;  2FDR A;  2VJ5 A;  8ICJ A;  1KEJ A;  2JR5 A;  1O03 A;  2K89 A;  1QSS A;  1C20 A;  3KFU F;  2NRZ A;  4GIB A;  4F5O A;  3PVX A;  4RQM A;  1T8E A;  4QZH A;  9ICR A;  2BCQ A;  5KG7 A;  2LYB A;  3D6J A;  2WTF A;  2XY6 A;  4ECX A;  3WKC A;  3WU2 U;  2F1I A;  1L7N A;  1RQL A;  5ALF A;  1WCL A;  1SKS A;  9ICF A;  3GV8 B;  4CF4 A;  2JEF A;  3ZI4 A;  4KLL A;  2VKQ A;  4YP3 A;  3T5H A;  1MQ2 A;  5KG2 A;  2YX8 A;  4DSL A;  2EZZ A;  2KK0 A;  4IS7 A;  5J0W A;  4C80 A;  3PW0 A;  3SAH A;  5AKX A;  4BX9 C;  1AQ6 A;  2A1J A;  4RQ1 A;  4PGQ A;  4MF8 A;  1RDF A;  1SL1 A;  3BZC A;  4RQ4 A;  3RBD A;  4Z6F A;  1SXD A;  3NUQ A;  3BQT A;  5ALI A;  5KNI A;  5EWE A;  1ZQV A;  5CB1 A;  4C4S A;  4YD1 A;  4BGD A;  3PY8 A;  1BVS A;  3QU4 A;  4AYB F;  4EBD A;  3NRZ A;  4J9S A;  4P0P A;  3HJE A;  7ICH A;  4Q43 A;  2WF5 A;  1JX4 A;  2DBY A;  1KFD A;  3HWT A;  3AL0 B;  2V4R A;  5HR6 A;  3RB6 A;  5KFA A;  5KFJ A;  4KLO A;  3BQ7 A;  1F0M A;  4B9V A;  4FZL A;  2HVI A;  4KTQ A;  2ZIU A;  3RFA A;  4ECV A;  3QUT A;  2W11 A;  3KHL A;  5AI8 A;  4DFM A;  5J8Y C;  2ISO A;  5AM1 A;  3K1Z A;  1ZQP A;  5J2H A;  4X5V A;  5DB8 A;  3F2C A;  2IA6 A;  2HHW A;  4B9L A;  1JAL A;  5AI9 A;  2JXJ A;  3H0L B;  1NK7 A;  4UAT A;  4R8U B;  2BKE A;  5HHI A;  2P6R A;  1X42 A;  7ICK A;  1Q46 A;  1ZQL A;  1V9P A;  3K1R B;  1HEK A;  1OW5 A;  3ZDC A;  5KFN A;  4Y2V A;  1LKY B;  2KHQ A;  1S0N A;  4KN7 A;  3PX4 A;  3T3F A;  2ZIV A;  3BS5 B;  1JRO A;  2AHO B;  5HMM A;  3MDC A;  4YR3 A;  1N56 A;  8ICW A;  4Q45 A;  5L1J A;  4PGX A;  2PFO A;  4O3S A;  1PZN A;  3VCB A;  4UAV A;  1QQ6 A;  3GQC A;  1BPD A;  5KAF U;  4KLS A;  1URJ A;  3RAQ A;  2G08 A;  4CRX A;  3M1Y A;  4I2A A;  5KFU A;  2H3Z A;  3SD7 A;  4TUR A;  4FZN A;  3LDA A;  3HX0 A;  4KLJ A;  1BGX T;  3RJH A;  2GLE A;  1N48 A;  3BS7 A;  2V4Q A;  3UM9 A;  3THV A;  2DF4 B;  1NOM A;  2NRW A;  4DL7 A;  1Z1V A;  2KSO B;  4DFD A;  3IRU A;  4C4R A;  7ICR A;  3EWA A;  2E8P A;  3OTQ A;  4G3I A;  1MN8 A;  4BXO B;  4K4H A;  1X6J A;  4O3O A;  5JRT A;  2XC9 A;  2QKQ A;  2K60 A;  5G5H A;  2JEJ A;  2XGP A;  4DL4 A;  3F5E A;  4F4Y A;  2BPC A;  3FM9 A;  5J0U A;  2G5I B;  4KLF A;  2ODG A;  4LVS A;  4C8M A;  3PO5 A;  1SWW A;  5L1M A;  1JUD A;  2G0A A;  2R18 A;  2KN7 A;  3HT3 A;  3K4G A;  5TZV A;  1NKC A;  1D8Y A;  2PMZ F;  3AEV A;  4KX5 A;  1A77 A;  4UBB A;  4DSJ A;  1JIH A;  2VIX A;  4Y2Q A;  4ED8 A;  5ALS A;  4EX6 A;  1KSP A;  1KRP A;  5ALK A;  2RRD A;  2K4P A;  2G5H B;  1X2I A;  1N2X A;  2EAN A;  3NVV A;  4RUC A;  2PI4 A;  3UMB A;  5DLF A;  1HIW A;  2BDU A;  4FS1 A;  8ICC A;  1SKW A;  1ZQY A;  3UMC A;  4ECZ A;  3ISC A;  4I2F A;  2XVT A;  5IIM A;  5J2D A;  1FIQ A;  1XWL A;  2VJ4 A;  4B9S A;  2NRV A;  4NL9 A;  4Y2S A;  1L3U A;  2A19 A;  5ALO A;  2BHN A;  4JV0 A;  1CEZ A;  3ETR A;  2KFN A;  1SV0 A;  1NKB A;  1BPX A;  2PFP A;  2EZX A;  3WKD A;  3KHG A;  2HBJ A;  1H38 A;  2XCP A;  4C8K A;  3RR8 A;  4UB4 A;  4CF5 A;  2KJ8 A;  4O0I A;  2PMZ C;  1D9D A;  1ZQE A;  4PZN A;  4GXI A;  1UQV A;  2AU0 A;  3RBE A;  5DBC A;  3J81 j;  1Z4N A;  2QB0 B;  5IIO A;  2WFA A;  5GTH U;  4QJF B;  4QWE A;  2Q4T A;  2H3I A;  2ZUD A;  2C22 A;  4I2J A;  4CF3 A;  2LI6 A;  5KAI U;  1PVR A;  5AI6 A;  2ZIW A;  1ZQ1 C;  2HOQ A;  5CA7 A;  9ICX A;  2EAO A;  1X9W A;  4RQ5 A;  4Q44 A;  2K8C B;  2NO4 A;  3E0F A;  8ICG A;  4R66 A;  4J03 A;  4LZD A;  1KFS A;  9ICO A;  4TUP A;  5AKZ A;  2W55 A;  4QZD A;  2HI0 A;  3SMV A;  4J9P A;  5DG9 A;  3M9M B;  5C0Y A;  1KDH A;  4Q8F A;  1S8O A;  2ZIW B;  3JPS A;  2F2A B;  5L1L A;  4KLI A;  1V97 A;  1Z19 A;  1TV9 A;  4F5Q A;  2MAX A;  4F72 A;  2W8L A;  1NK4 A;  2NV3 A;  4ED3 A;  4IRD A;  2MRL A;  1ARO P;  4PJ0 U;  1SV4 A;  3MGH A;  1NK9 A;  4KLU A;  2ZIU B;  4DEZ A;  2OEH A;  3Q8S B;  1PK1 A;  5AM5 A;  2ATL A;  1YT3 A;  4NL9 C;  8ICL A;  3WK5 A;  4PHD A;  4GXJ A;  4UAZ A;  5KFL A;  1Y88 A;  9ICM A;  1NNL A;  2IOF A;  2BDP A;  2BCR A;  4PGY A;  3CW2 C;  1MQ3 A;  4BDP A;  3PX0 A;  2WB1 F;  4AP9 A;  1ZET A;  2IMW P;  4I2B A;  2Y9U A;  3GDX A;  2A3V A;  1U9L A;  1V85 A;  3V6J A;  4ECT A;  2YB4 A;  4F4X A;  3OSN A;  4QNL A;  2OHF A;  5J2I A;  7ICS A;  3MR2 A;  3ONN A;  5B66 U;  1CRX A;  4FBU A;  3BJY A;  1SWV A;  1B22 A;  4M6W A;  1ZD4 A;  5AKI A;  4M47 A;  2C2D A;  4DQR A;  4OJ5 A;  9ICU A;  4OCZ A;  1X9X A;  3WK7 A;  4M9J A;  3QUQ A;  3D2Q A;  5TIS U;  4U6P A;  4YR0 A;  4J9L A;  2IBK A;  1BPB A;  2HW3 A;  2C2R A;  1HUZ A;  5KFR A;  1NK6 A;  3M8S A;  4FS2 A;  4DSF A;  1NI3 A;  2NRT A;  4I28 A;  4TUQ A;  1ZQQ A;  4ECS A;  2W3S A;  4ECU A;  3LWL A;  3BZK A;  5D4B A;  2GWS A;  1GO3 F;  3KD3 A;  1L7M A;  3PST A;  5AK4 A;  2Y1J A;  3Q8M A;  2BQR A;  5EE0 A;  3MR3 A;  4QZB A;  3MFH A;  4IRK A;  2BCS A;  3UQ0 A;  3GIJ A;  2JH7 A;  2P35 A;  2AGO A;  5ALV A;  1SL2 A;  4E0D A;  4P4M A;  2ZTD A;  3GV7 B;  4B9N A;  4QW9 A;  1XSP A;  4NJ8 A;  3BQ0 A;  1ZQU A;  1WWU A;  4P2H A;  2IOF K;  3GU3 A;  5J2F A;  1KTQ A;  4ECW A;  3H8M A;  7ICM A;  2A1A A;  5IIL A;  1S0M A;  5KG0 A;  4NLC A;  2Q0Z X;  4UB6 U;  4DL2 A;  3IN5 A;  3MBY A;  2XID A;  4J9N A;  2FMP A;  4YR2 A;  9ICS A;  3NGD A;  3M6Z A;  1F44 A;  4KLQ A;  3QUB A;  5AKH A;  4RQ7 A;  5C5J A;  3GIL A;  2GH1 A;  1EXN A;  3OPX A;  1FFU A;  4JV2 A;  2HHT A;  2JMG A;  1S0V A;  2KSO A;  3C1Z A;  4JUZ A;  4C7Y A;  4ED7 A;  2XGQ A;  4MF2 A;  4G9B A;  3V7L A;  1Q8K A;  2PI5 A;  3Q8Q B;  9ICN A;  3PSF A;  2K4I A;  3D2S A;  2YMQ A;  4MEY A;  1Z3E B;  4O3P A;  2C2E A;  4EZ6 A;  2PFN A;  3SEN A;  1Z00 B;  4RU9 A;  3PW4 A;  2F3N A;  4DOC A;  1S0O A;  3EZ5 A;  2IOH A;  1QH9 A;  2R8J A;  1QLN A;  2HOI A;  4OJ6 A;  4J9M A;  4NLG A;  4EYH B;  2PKE A;  4JK1 A;  4Y2P A;  1KFT A;  5KL1 B;  4ELU A;  3N7S C;  2ASJ A;  4LZG A;  4DL6 A;  2UVU A;  1J2M A;  4Y2X A;  4GFJ A;  5HHH A;  2VA2 A;  1KLN A;  2D3D A;  8ICY A;  2E8N A;  3LVV A;  2Z7J A;  1L6N A;  1X9S A;  3OHA A;  7ICI A;  3PSP A;  4EEN A;  2RP5 A;  4B6J A;  1PUZ A;  2ZIX A;  3TAQ A;  1ZQK A;  3QU2 A;  3PV8 A;  3T5J A;  3KKA C;  5ALG A;  2XIC A;  3F2B A;  4YD2 A;  4I2H A;  1ZQO A;  2D6F C;  2DPJ A;  3MC1 A;  1QCK A;  4DL3 A;  4NM2 A;  3H8J A;  5KT3 A;  5J0P A;  1RXW A;  3BDP A;  4KLM A;  4XA5 A;  3KHH A;  3NVZ A;  5J8Y A;  1ZXI A;  1HJP A;  5KFK A;  3I28 A;  2HCF A;  2FE9 A;  2LKY A;  4IQV A;  5KFD A;  2G07 A;  1A6S A;  3PW7 A;  4NLZ A;  2KFZ A;  2G09 A;  3KZX A;  4RQ2 A;  3EW9 A;  1ZQX A;  4Z6C A;  4F4W A;  1BNP A;  3RRG A;  3JPQ A;  1KBU A;  2V9W A;  3KBB A;  5IIN A;  5ALD A;  8ICX A;  4F71 A;  4TQS A;  5KFV A;  4DLE A;  3QZ8 A;  4ED1 A;  4CE6 A;  2FLP A;  2KIW A;  1FFV A;  5AKE A;  3GIK A;  1ZD5 A;  2UVR A;  4CGZ A;  3B9J A;  2HMX A;  4PZO A;  4P4O A;  1S77 D;  5DB9 A;  4WJ3 B;  2MA1 A;  5EOZ A;  4C0Z A;  1FO4 A;  2WF6 A;  5CHG A;  2H3V A;  3H0R B;  3WKE A;  1ZOL A;  3ZDA A;  5AI5 A;  1XC9 A;  4DSE A;  4DF4 A;  3H7I A;  3PX6 A;  2XY5 A;  3MAB A;  3I1Y A;  3D2N A;  4YXM A;  4DOB A;  3NTU A;  4IC9 A;  3UXO A;  5AM2 A;  4J9K A;  1KN5 A;  4MHV A;  4DS4 A;  3TAP A;  1S97 A;  5F9L A;  4C4T A;  1ZQI A;  2IHN A;  4KMU A;  3TKA A;  5EE1 A;  2PXI A;  4QW8 A;  4YMM A;  2KMD A;  2KEY A;  4UB8 U;  3AMZ A;  2K8A A;  3PR5 B;  4ECY A;  2BCU A;  2R8G A;  3FAH A;  1TK0 A;  5EWG A;  2GOL A;  1HUO A;  5ALT A;  4MFF A;  1X9M A;  4Y2J A;  1XSN A;  1DXS A;  2ES6 A;  4F3O A;  2KZZ A;  7ICE A;  5DBA A;  1L3V A;  1L8O A;  2BR0 A;  5GTI U;  4DQP A;  3M6K A;  4JV1 A;  2KVC A;  2O6K A;  3RF9 A;  1NJW A;  1WUD A;  2F8K A;  1L8L A;  1L7O A;  3SV3 A;  1JRP A;  1SGG A;  3QE9 Y;  7ICG A;  5AKG A;  5DDM A;  4FO6 A;  4DO9 A;  2WF7 A;  2ZJ5 A;  5AM4 A;  3Q8P B;  3GII A;  5DGA A;  4I27 A;  4RT3 A;  4PHP A;  2KJ5 A;  4TUS A;  2H3Q A;  5ALH A;  4DWI A;  8ICZ A;  3H8W A;  4R65 A;  3N97 B;  4UAY A;  5KG6 A;  2KJ9 A;  2K8B B;  3MFI A;  3N4M B;  2J6U A;  2H3F A;  3QEB Z;  7ICQ A;  2I6X A;  8ICH A;  4LJX A;  4ECR A;  2F8L A;  5ALP A;  3TAD C;  1RYR A;  3C1Y A;  3SAG A;  1ZQS A;  4F4Z A;  1IM4 A;  4ZH4 A;  4YVZ A;  2XY7 A;  5J2J A;  3BQ2 A;  4M9L A;  8ICQ A;  1WCN A;  2DL0 A;  3T5L A;  4KLT A;  9ICT A;  2J6S A;  5KFB A;  2DFL A;  4DQQ A;  2ZUC A;  4HAI A;  2QB1 A;  5KG4 A;  4EEY A;  1N5X A;  5CP2 A;  3TFS A;  2KZM A;  5KFZ A;  1S76 D;  2KTQ A;  1QQ7 A;  5KFM A;  3H4B A;  3AUO A;  4RPY A;  3SV4 A;  4Y2Y A;  3UQ2 A;  5DQH A;  1WG8 A;  1WYG A;  3ZDD A;  3SYZ A;  5KFQ A;  4YQW A;  3IDW A;  2DPI A;  5HNK A;  4J9Q A;  2ASD A;  4I2D A;  2KG5 A;  2LM1 A;  4RUA A;  1JXE A;  5DGB A;  5K4L A;  4KIT B;  4I2G A;  3SR6 A;  5KFC A;  3K75 D;  2EQY A;  1T7P A;  5AK6 A;  5KFX A;  4ZOH C;  4Z6D A;  3GZF A;  5J29 A;  2CPR A;  4QZI A;  4KLG A;  3UXN A;  3AN1 A;  4P0P B;  4EEL A;  4EZ9 A;  4UW9 A;  4JMU A;  4QIW F;  1IV8 A;  2E8O A;  3B0Y A;  2ZUB A;  4BXO A;  3OJU A;  5L1K A;  4UAS A;  2KKP A;  4PH5 A;  2W8K A;  4F50 A;  1BPZ A;  1B43 A;  2JH1 A;  3KKA A;  9ICG A;  2KD1 A;  2LPE A;  3RJE A;  1DOQ A;  3Q8K A;  2HHX A;  5DLG A;  4UB2 A;  1IG6 A;  2EH9 A;  1K5O A;  1D8B A;  4PL2 A;  3A0H U;  1ZQH A;  2ASL A;  1RZT A;  3C21 A;  1UT8 A;  1N5W A;  3AM9 A;  2F76 X;  1UCV A;  5AK3 A;  5L1I A;  2RDJ A;  2KZ3 A;  3OJS A;  1TAQ A;  2HBM A;  1BPY A;  3PZP A;  4USA A;  1UA0 A;  2BPF A;  7ICO A;  3NS1 A;  9ICB A;  2AJQ A;  5J2A A;  1MA7 A;  1UPH A;  3WK4 A;  5KL8 B;  5AKK A;  4YMN A;  1KKX A;  2W03 A;  4O9M A;  2B21 A;  3QEA Z;  2AQ0 A;  3RB0 A;  3OSP A;  1VDV A;  1VJ5 A;  1Z1B A;  3NVW A;  3HPO A;  1XU4 A;  3KOO A;  1XS9 D;  5CR0 A;  4C7Z A;  4P0Q A;  4IRC A;  2YMP A;  4EEK A;  3F53 A;  3L3F X;  4FE3 A;  3DV9 A;  1ZQG A;  4CCH A;  3JPN A;  1BNO A;  2HHS A;  9ICQ A;  4O3N A;  3T79 A;  3V6H A;  3H0M B;  3AU2 A;  1K1S A;  3Q8R B;  5ALU A;  5KT4 A;  2F77 X;  1JMS A;  4RQN A;  2XO7 A;  8ICF A;  1SZH A;  3PNC A;  1CI4 A;  7ICJ A;  2I5H A;  4F93 B;  4R63 A;  2OM6 A;  1TKD A;  1XO0 A;  4KLE A;  2XCA A;  2ZIX B;  3L5K A; 
#chains in the Genus database with same CATH homology
 2LM1 A;  2EQY A;  1KKX A;  1KN5 A;  2JXJ A;  2OEH A;  2KK0 A;  2CXY A;  4LJX A;  2JRZ A;  5K4L A;  1C20 A;  5CEH A;  1KQQ A;  1RYU A;  2RQ5 A;  2LI6 A;  2YQE A;  1IG6 A;  2EH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...