2JRZA

Solution structure of the bright/arid domain from the human jarid1c protein.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
SMNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVCNTRPFDNEEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1C
publication title Backbone and sidechain 1H, 13C and 15N resonance assignments of the Bright/ARID domain from the human JARID1C (SMCX) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 117
sequence length 117
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jrzA00
5CEHA 1KKXA 2EQYA 1KN5A 2LI6A 2RQ5A 2LM1A 4LJXA 1IG6A 1RYUA 1C20A 2OEHA 5K4LA 1KQQA 2YQEA 2JXJA 2EH9A 2JRZA 2KK0A 2CXYA
chains in the Genus database with same CATH superfamily
1SGGA 1ZRMA 2BCSA 5L1KA 2OWOA 1ZJMA 4RQ6A 3ZI4A 4F4ZA 3T79A 4PHEA 4IQVA 4DQIA 2KOBA 5ALFA 3T3FA 2EAMA 1L5UA 9ICOA 4DOBA 4J9KA 3QEBZ 3NRWA 5AK6A 3MFHA 4NL9A 4Y2JA 1SL1A 4UARA 1TE2A 4F4WA 1U4BA 1LV5A 2Y0SC 2V4RA 1H38A 2G09A 1N5WA 1SV4A 1Z4OA 2W9CA 3C23A 4RQNA 3HX0A 1YZ6A 3JPPA 1NI3A 1RQNA 1KFSA 4ECYA 2KJ8A 3FDSA 2JV3A 2NO5A 4USAA 1UT5A 4J9LA 4G9BA 1S9FA 2NYVA 4QZBA 2QARA 3OGUA 8ICPA 4M04A 2DFLA 8ICLA 5KG3A 2ASLA 1JROA 1X40A 4UBCA 4IL6U 4RPZA 7ICRA 2K4EA 5CWRA 2C28A 1ZQHA 2ZTDA 3H0RB 5AIBA 2V4QA 3HPOA 1T7PA 2YMLA 1NJXA 4RUAA 5KTQA 2BQRA 3IP4B 3UMCA 4FS2A 1U49A 3RH5A 3GFKB 2HHVA 2AGPA 1UHUA 3KZIU 1ZQPA 4F91B 5HR7A 4Q43A 1EXNA 4ELUA 1KRPA 1RYUA 3H8MA 1T4GA 4I29A 4IRDA 3NASA 4DS4A 4KLOA 8ICBA 4P0QB 4BGDA 2XICA 9ICNA 2CN1A 2W04A 2AJQA 5EE3A 4C4TA 1QH9A 3FM9A 4Y2RA 7ICTA 4YP3A 3BZKA 2MRLA 3CP8A 1OW5A 4AYBC 3ORYA 4RQ7A 2R8JA 3B0YA 2MU2A 2LBOA 3EPGA 3PX4A 4QW9A 4ELVA 4ECRA 3V7KA 2G08A 4IQTA 5J0SA 5AHXA 1XO1A 1Q46A 4TUPA 2QB0B 3ISDA 3SQIA 3N7PD 3PW7A 2XGQA 4FBTA 2RLTA 1A76A 2K4PA 4GIBA 2J6UA 4NM1A 2H3QA 3DEEA 1KKXA 3N28A 2KNJA 3OJUA 3J81j 1CI4A 3KHHA 3SYZA 2JEJA 2KP7A 1F5SA 3LWLA 3MGIA 1NK8A 4F50A 1NKEA 1WYGA 1ZQIA 4GXJA 3EYZA 3TARA 4DQQA 4F5PA 1M6YA 4JV0A 2ISPA 8ICJA 9ICHA 2BCUA 4IRKA 1PK1A 1ZQWA 4O5CA 4P4OA 3TFSA 4QWCA 1RG6A 1D8LA 4DL3A 2GOLA 4C80A 2BCVA 3TKAA 4ED1A 3K1ZA 5ALVA 2ZXIA 2KZ3A 2RQ5A 2IHMA 4O5EA 4PH5A 2K60A 1O03A 8ICVA 5KFDA 1BPXA 5KFFA 3SZ2A 3IDWA 1ZQRA 4O3NA 4CNQA 3M6ZA 2MAXA 3JPSA 2AQ4A 1K1SA 3QZ7A 4DL7A 2YMPA 4DSEA 4JV1A 2Y9UA 4F5QA 1PUZA 2HBMA 2DPIA 3F2CA 4JWNA 3RJJA 9ICUA 3B0XA 2FI1A 5TZVA 1D9FA 4KLMA 2ES6A 2I1QA 4J9NA 1L7NA 2F44A 1QQ5A 4Y2UA 5AKIA 8ICCA 1BPBA 4I2DA 3MR6A 2XY5A 1RZTA 2HDOA 1JIHA 7ICKA 4TUQA 2ESEA 5J2GA 4O0IA 4HAIA 2NRTA 1FFUA 3BQTA 3MGHA 2XCPA 3SR6A 2K8AA 9ICLA 2AH5A 1JXLA 3C2KA 3QEAZ 5AM1A 5ALSA 4KLQA 5J0XA 2KZZA 3BS5A 3C5FA 4R66A 3BQ0A 4Q8EA 3C21A 3HT3A 4C0ZA 5ALNA 5KG4A 4DFKA 2ZXHA 4XUSA 3OHAA 1KL9A 2JGAA 4I2CA 1Z1BA 2K89A 5AKGA 1SKRA 4IC9A 4YMMA 1ZQEA 1S0VA 4OJLA 2QLTA 2C2DA 3RFAA 2A1AA 1Q8KA 4I2EA 4FZNA 4QZEA 4EENA 1TAQA 4M0AA 5ALUA 3QU7A 3C1YA 4I2HA 2VANA 5DQIA 3KFUF 8ICOA 3KHRA 9ICGA 5HHIA 3JPNA 1TAUA 4ECQA 5EE9A 5ALIA 3BJYA 1J97A 3HKZF 4YMOA 1PVPA 5HMMA 1HEKA 1ZETA 2GH1A 2W3SA 4UAVA 2KJ9A 2HBKA 5KFUA 4F92B 3H0MB 3NVYA 1A0PA 5ALWA 1ZQQA 4R64A 5DG8A 3GIIA 3IV6A 4EZ9A 3IM1A 3DV9A 5AI8A 2EZYA 2HHSA 5D4BA 2R8KA 4P0PB 2WTFA 8ICNA 2FE9A 4DOAA 2JZBB 3K75D 9ICEA 1NZBA 8ICZA 2IOFK 2G0AA 3RAQA 2HHTA 3G6XA 4GXIA 3A0HU 3SI8A 3BS7A 3TI0A 4P0QA 2Y1IA 1WUDA 2Y0SF 2MA1A 4FFDA 7ICSA 2W03A 2VJ5A 5KFNA 2W9BB 2MUTB 4KLHA 4XQ8A 5J0QA 1TK8A 4KN4A 4RUCA 4QIWC 3ED5A 5ALOA 1DRGA 3V6KA 4NLNA 2OXOA 4F4XA 3NVVA 3PY8A 3M7DA 4YR0A 3WU2U 1U48A 2JHDA 2EANA 2A1JB 2HHWA 1V38A 3ZD9A 2HCFA 1DGSA 1NK4A 3D2QA 1UCVA 5ALEA 1WCLA 8ICIA 2QB0A 1NOMA 4NXZA 1L6NA 2KZMA 5J8YA 5JTIA 4G3IA 5DKWA 4C7ZA 2EZZA 2Z7JA 5AKKA 4GLXA 1IV8A 1ZQJA 3KKAC 4K4GA 3AUOA 1N62A 5G5HA 1B22A 2WFAA 3JPQA 3OTQA 3QXGA 2HBLA 5ALPA 2KIVA 5EOZA 1S0NA 2OH2A 5DQGA 3RB6A 4J9MA 3PO5A 1XNSA 4QZDA 3V72A 5JUMA 3NGDA 1X66A 2JEFA 1YT3A 4QW8A 1A77A 2W9MA 4AYBF 2XC9A 3H7IA 3UQ0A 2ZG6A 2LM1A 2ASJA 4Q45A 3H8JA 4NLBA 4LJXA 3LVWA 4PGQA 1ZQOA 4US8A 1ZQZA 4ED2A 4JV2A 5KAIU 5ALKA 8ICMA 2FPMA 7ICUA 3Q8QB 3SV4A 2XO7A 1NKBA 1JN3A 4F4KA 5CHGA 4QZAA 4CRXA 3PMNA 8ICUA 3HP6A 2EQYA 1A6SA 1KSPA 2L5YA 4ICAA 5D46A 1NJZA 2M9NA 1XC9A 2ZIVA 3WK4A 2ZIWB 1SZHA 4BWJA 4RNNA 3RJGA 4P2HA 1J2MA 4M6WB 3OSPA 2DUYA 2W8KA 5G5GA 2Y9TA 5KFSA 1QSSA 2N1RA 1KFTA 1RDFA 1N56A 3D2SA 3RF9A 3CW2C 2KD1A 8ICHA 2WF8A 4CF4A 1SKWA 4UB1A 5AM3A 2ZIXA 3EUB2 8ICRA 1OXJA 4UB4A 1Q3VA 1Q3UA 1JUDA 3BZCA 4YCXA 2I5HA 3TAPA 3RB0A 2E8NA 2NRZA 4K4HA 3F2BA 1ZQ1C 2F1IA 2BPCA 1BPZA 5DQHA 2FLPA 5AIAA 1CUKA 4MF2A 5D49A 3RB3A 4DFMA 4KITB 3TANA 3C5GA 4UASA 4F5NA 4M9JA 1ZJNA 1X9MA 4O9MA 2ZTEA 3NVWA 4Z6DA 3N4MB 1XSPA 4NLGA 3LWMA 2H3IA 4RU9A 2DPJA 3EZ5A 2JEGA 4YXJA 2YMMA 3PMLA 7ICOA 4EZ6A 3QU2A 4PHAA 1UA1A 3H8WA 5DLGA 3PNCA 3VCBA 4DL4A 2W8LA 3K4GA 4OCZA 1IXRA 4O3SA 2WF7A 4OJ6A 5KFGA 3PVXA 4I2FA 1ZQNA 2NO4A 3AU2A 2HI0A 2KE7A 1C7YA 2I6XA 4Y2XA 1VDVA 4DSFA 8ICQA 1D8YA 1SWWA 4UB5A 3GQCA 5ALXA 2BQUA 4I2GA 2O6KA 4P0PA 1B43A 3KOOA 4RT2A 4EYHB 2E1FA 4UB6U 2RP5A 5DDYA 2ZJ8A 1U47A 3IG8A 5AKHA 1ZYQA 5J2BA 3I1YA 2ZUBA 3TADC 4DWIA 4UB3A 5KFYA 1S97A 2G5IB 4ECUA 8ICSA 5AI0A 5ALJA 2R8IA 2W9BA 1XO0A 2MUTA 3QE9Y 3QU5A 2VIXA 5J0TA 4RQ4A 1DXSA 3NVZA 5F9LA 4CGZA 4NLCA 7ICJA 5CP2A 8ICKA 2XCAA 3IRUA 5KT4A 3WKBA 4UATA 3WKEA 4RPYA 3GIJA 4KTQA 5KL8B 1RXVA 4GC6A 5IIKA 1S0OA 1K5OA 1UA0A 5J2FA 4ACOA 4C8LA 2ODGA 2PI5A 5KFAA 4OO1J 4IRCA 5IIJA 4DF4A 4CE6A 2KEYA 1CRXA 4R8UB 1KLNA 2JEIA 2KKPA 4DLGA 1UT8A 5E79U 4FZMA 4JUZA 1PVQA 2HHXA 5AM2A 5GTHU 3T5HA 1WWVA 4J03A 5KFCA 1ZQLA 4BWMA 3R9KA 2XIDA 4KLLA 3RH4A 2BCRA 5CR0A 4RQ1A 2GWSA 4KLDA 1ED1A 1DGJA 4KLGA 3M8RA 4KLSA 1RYRA 1N5XA 4ED7A 3N7SC 2F3NA 1Z19A 3AMZA 4QIWF 4F93B 4KLIA 5JU5A 3SAGA 5DB8A 3SV3A 3M6KA 2MSNA 1XU4A 4QNLA 9ICKA 2DKXA 3ETLA 2ZUCA 4Q44A 2F77X 4RNOA 1RPLA 4PL2A 2JH7A 1MSWD 1XWLA 2ZTCA 3QUTA 3KZXA 4EELA 2W9AA 1T94A 3KHLA 5J0WA 1V85A 2OYYA 5L1JA 2R18A 5KFOA 3FC4A 1QSYA 3MBYA 5AK5A 3PR5B 1L8OA 4OJPA 1KFDA 3TFRA 3HRDD 4YG2A 2RHFA 4QZHA 4QZ8A 4EBEA 2FMSA 4BDPA 5IIMA 4OJ5A 4ECWA 3N7RC 5KT5A 3PV8A 2HW3A 1BVSA 5EE0A 3F5AA 3KHGA 4MEXA 2DGZA 5KT3A 5J0OA 7ICEA 3NS1A 1P7DA 2PFPA 9ICXA 3ONNA 2ZIWA 2C2RA 2KV2A 2WF5A 3AL0B 3RR8A 2WF6A 1V9PA 2EDUA 4J9OA 1B0XA 4M6WA 1L7MA 2Q4TA 4B9UA 4C7YA 4PGXA 4PGYA 3RJEA 3ISBA 4F72A 1QCKA 3PR4A 2M0NA 3Q8SB 3LDAA 1Y88A 1ZQVA 5KFBA 1L3UA 1SZPA 2VA3A 1RM6C 2BDPA 7ICLA 3M1YA 2JR5A 1N61A 5K4LA 4M9LA 3WK9A 3Q8MA 1NK9A 5ALLA 3AEVA 1T3NA 4KN7A 1QQ6A 3SENA 1KN5A 4RNMA 5HR6A 5L1MA 2KKVA 5DLFA 4UW9A 2ALZA 4PL1A 3C2MA 3ZDEA 4GFJA 3GDXA 4I2IA 3AQEA 4XA5A 1MQ2A 5CJ7A 1C20A 1X9WA 4PJ0U 4F5RA 1TKDA 1KEJA 2JXJA 4OJOA 1TK5A 2HOQA 1FO4A 4F2SA 9ICFA 1ZQGA 3ALRA 3ICXA 4Y2VA 1N60A 2VKQA 4ZH4A 2B0CA 3L4PA 4YXMA 1UQVA 1ZQYA 4GC7A 4P4PA 2P35A 8ICEA 1Z1VA 3FAHA 4CF5A 5L1IA 3KKAA 1XS9D 4NLKA 5AK4A 3RTVA 4UAWA 3T5JA 2FJ6A 2UVVA 1U9LA 5AM5A 2FLLA 4B9MA 1HIWA 4BXOB 4E0DA 3SAHA 2F8LA 5J0PA 3AN1A 5AICA 2HMXA 1JXEA 4M47A 2ZJAA 4RQ2A 1FEZA 3V7JA 1BPDA 4RQ3A 2PFOA 2HVHA 3ZDBA 3C1ZA 3LVVA 2YQEA 4LVSA 3UXOA 3JPTA 5KG7A 3M8SA 4BJQA 7ICVA 1COKA 2G06A 1LVHA 2KFZA 1IG6A 2LHTA 4F8RA 3UQ2A 5KAFU 4O5KA 8ICYA 5HHHA 4UBBA 5KFIA 1BPYA 4NJ8A 1UPHA 3PSFA 2VA2A 2VJ4A 3NRZA 4FS1A 4C8MA 4KX5A 4ECVA 1S5LU 2K8BB 3CYMA 2J6TA 3E0FA 1XSLA 4YFKA 9ICCA 3PO4A 3RB4A 2ISOA 4UAUA 4RQMA 4QWAA 3TAQA 9ICAA 4QWDA 1URJA 1F44A 4IR1A 4QWBA 4I2BA 4ECZA 3GZFA 4MHVA 2OHFA 3KD3A 3WKDA 1COOA 4RT3A 2ATLA 4O3PA 1Z00B 4KLUA 2DBYA 9ICTA 2F76X 2NRWA 4PPXA 4HYKA 2KK0A 5IIIA 3MFIA 4ED3A 5DBAA 3M9OB 5DG9A 2R8HA 4TQRA 7ICFA 3MDAA 5H2FU 2HOIA 4JWMA 2AGOA 4ED6A 2F1JA 8ICXA 3V7LA 4PHDA 3RAXA 2GO7A 3E58A 1BGXT 4YR3A 4US9A 2W54A 4O3QA 1SWVA 2F2AB 3PZPA 1ZQDA 4DQSA 1ZQCA 2KG5A 3GIKA 4QWEA 3Q8PB 4IR9A 9ICJA 4EBDA 4YN4A 4K4IA 3ZD8A 5J2IA 1ZD3A 4LZGA 4EEKA 1NK0A 4EEYA 5F9NA 4UB8U 2QB1A 3PW0A 3SAFA 1ZD2P 5CRXA 5DG7A 3PW2A 3ZDDA 1S0MA 4M9HA 3L5KA 4C4SA 4DQPA 3A0BU 3THVA 3C29A 4DL5A 2YY6A 3KTQA 1D9DA 5KG0A 3L3FX 3UM9A 3C2LA 2ZIUB 5EWEA 2NRVA 4U6PA 2LYAA 2WB1C 4I28A 1J2NA 4UB2A 1ZQXA 1AQ6A 1U45A 4TUSA 4NLZA 3V6JA 2W55A 3OSNA 4ECXA 8ICWA 4JB3A 2BZFA 1ZD5A 2LM4A 3GIMA 3O0FA 3AQFA 1RQLA 2UVRA 5CA7A 2FPLA 4DEZA 4IQUA 2ZJ5A 2A3VA 1RYSA 4F4YA 3TADA 2OEHA 1X9XA 3T5KA 1SV0C 3MABA 4Y2YA 5IILA 5KT2A 3ZDCA 1CEZA 4DL6A 5KG1A 2CXYA 5J2CA 2YTUA 2W7OA 2W43A 5ALTA 1MC8A 5AKXA 5A0LA 4C8NA 3OJSA 4OD0A 3NUQA 5T14A 4ED8A 4B6JA 8ICTA 5AI5A 5BOLA 5AI9A 3UMGA 3QU4A 3EPIA 5J0YA 3I28A 9ICSA 2FMPA 2F8KA 4M9NA 4CF3A 4BUGA 9ICWA 4RPXA 3WKCA 4B9SA 8ICFA 2LMRA 3AM9A 2KICA 1Z3EB 4DFJA 5KT6A 3D6JA 5J2KA 4AP9A 5ALYA 3RH6A 4YMNA 3Q8LA 3QUCA 4DFPA 1MQ3A 1BPEA 1FFVA 3WKAA 4P4MA 5KFKA 3TQ1A 1S77D 3WK7A 4EYIB 4U7CA 5F3XB 3SD7A 4BXOA 4A8EA 1X2IA 5AI6A 2H5XA 5ALDA 1TVAA 2HBJA 5AM0A 2BPGA 4EX7A 2XY6A 5TISU 5J29A 1NK5A 4Y2QA 1N2XA 2NV3A 2B6GA 2IHNA 4WJ3B 2RDJA 1KW4A 4BX9C 4R63A 4ELTA 1NK7A 1ECWA 5J2JA 4B9TA 4Y2PA 2JZBA 5KFRA 3G6YA 2R8GA 3RRHA 4X5VA 1K1QA 3QUQA 2FDRA 4NM2A 2LPEA 1ZQBA 2ASDA 2AHOB 5HNKA 5CEHA 2H3ZA 2E8OA 5AKLA 3DDHA 2D3DA 4FO6A 5DGBA 4NWIA 4I27A 1NK6A 2OM6A 2D8CA 3I76A 5CB1A 9ICIA 3F5EA 3Q8RB 4R65A 2PFQA 2J6SA 2E5SA 1IM4A 3KBBA 4MFFA 2YMQA 4YR2A 7ICGA 9ICPA 3WK5A 2A1JA 1TAMA 5J2HA 4KLEA 3N97B 2DKZA 5J0RA 1L7OA 5KFLA 2KSOB 4KLFA 2PMZC 1ZQTA 3GV5B 2LKYA 1NJWA 1T3QA 5JRTA 2KJ5A 1X6IA 2A19A 4Q8FA 2C2EA 1B4FA 1T8EA 3PSIA 4YD2A 1X42A 2NRXA 3HJEA 3HILA 3SEIA 4JMUA 3RJIA 1JX4A 2KVCA 5L9XA 1GO3F 3PX6A 1ZQKA 4NL9C 4QZ9A 1Z00A 2RRDA 2PFNA 1ZQMA 4DCCA 2KN7A 2DQNB 5J0UA 5ALMA 2EH9A 3QZ8A 2K8CB 3UXNA 3QU9A 4DL2A 2G5HB 3F2DA 5DB9A 2WHEA 3C28A 4DOCA 4YQWA 4DFDA 4QJFB 1NJYA 2FLNA 5KG5A 5DB6A 4QZIA 2JMGA 2YN4A 3JPRA 3IN5A 1X9SA 5KFZA 1KDHA 4M2YA 2D6FC 2HVIA 2WAQC 3TACB 2HHUA 2P6UA 3MDCA 1BNOA 4UAYA 7ICNA 2LI6A 1TK0A 5B5EU 4F3OA 1VJ5A 1N48A 7ICMA 2UVWA 4KX3A 4QZFA 1LKYB 1Z4NA 1FIQA 4NV0A 1DOQA 5KFEA 1KBUA 1JMSA 5KNIA 2OCEA 3ISCA 1S8OA 5AKZA 1N63A 4PZNA 2ZIUA 4ECSA 2V9WA 1D8BA 5KFXA 2UVUA 4RQ0A 2BQ3A 1PZNA 4PZOA 3M9NB 3U26A 5ALQA 1F0MA 5DGAA 4DF8A 1VLBA 3B9JA 3GU3A 1RXWA 7ICHA 4MF8A 2DL0A 2EAPA 3H0LB 1S76D 2XY7A 1KTQA 3MR2A 2ZIVB 4KLJA 1MA7A 1ZQUA 4IQWA 3H40A 3MR3A 2KMDA 5DBBA 7ICPA 2RDIA 5AK3A 2PKEA 4KLTA 5C0YA 3BQ7A 3D2NA 5B66U 5KG6A 1ZOLA 4LZDA 3VC8A 4J9SA 3RJHA 3H8SA 5KFTA 4O3RA 5EWGA 4YVZA 2BKEA 2LYHA 4B9NA 1MN8A 1JALA 2ZIXB 4UAZA 4C8KA 4QZGA 1SL2A 4DSJA 9ICMA 2QKQA 2EZXA 2HOFA 3ZDAA 1BNPA 4TQSA 4PHPA 5BPCA 1DK3A 3PW5A 3EW9A 3OPXA 1WWUA 2WB1F 1ZD4A 2E3TA 2FPKA 1HUZA 2JH1A 2JRZA 5AKYA 3CNHA 4C4RA 5DDMA 4O3OA 2Q0ZX 1WCNA 4Z6FA 3MR5A 1JRPA 3SMVA 5ALZA 1HJPA 3T5LA 3H4DA 1ZQAA 4RQ5A 5KG2A 3BQ2A 2F1HA 5KFHA 2AU0A 2YX8A 4NY8A 3PX0A 1JI7A 1OUQA 2E8MA 2W9CB 2IOHA 3IG5A 3RJFA 5KFPA 5KFMA 4J9QA 5IIOA 1HUOA 2GLEA 5C5JA 2IMWP 5EE1A 2C22A 4J9PA 2QARB 4MFAA 5KFVA 9ICBA 4DSKA 7ICIA 2VA8A 3Q8KA 1KQQA 2ZUDA 2YB4A 5AKJA 2AGQA 5EWFA 2DWQA 2IBKA 4ED0A 4FBUA 2XVTA 5ALHA 4O3MA 2HHQA 2I9GA 5DB7A 4B9LA 1SB3C 9ICRA 2H3VA 2B21A 3CRXA 3FYHA 3MC1A 1QTMA 5DBCA 5FP0A 4RZRA 2PXIA 4Z6CA 3GV8B 2KIWA 2YB1A 2PI4A 1NZPA 3PSPA 3ETRA 3H4BA 3PW4A 4UQGA 5HMLA 3G6VA 2BDUA 1SXDA 4CCHA 1QLNA 4XRHA 4DLEA 2W7PA 4DS5A 1SL0A 4DSLA 4YD1A 5GTIU 3GV7B 4I2JA 3EWAA 4GXKA 4DQRA 4I2AA 3RRGA 3RBDA 1L3TA 1XSNA 2KFNA 4RQ8A 2KSOA 1SV0A 4KMUA 4R8UA 1AROP 2AXTU 1DK2A 4FZLA 1TV9A 3NTUA 4MEYA 2G07A 4MFCA 5J2AA 1WG8A 3IHQB 5AI4A 3RBEA 4EX6A 5ALRA 2P6RA 1IIPA 2HSZA 1L3SA 8ICGA 4DSIA 2AQ0A 1ZQSA 4Z6EA 3V6HA 3AU6A 2CRXA 5HP4A 3WK6A 2P66A 2KHVA 4CDGA 1V97A 4C8OA 5KFWA 1PK1B 3F53A 3GILA 4DO9A 1LB2B 2K4HA 2Y1JA 2BGWA 2K4IA 3JPOA 3OHBA 9ICQA 1ZQFA 1QQ7A 3BQ1A 3HW8A 1QSLA 2WF9A 4EBCA 3LYSA 4J9RA 2BCQA 5KFQA 2BR0A 1SXEA 4ECTA 1SIJA 2PMZF 2W3RA 2IOFA 1LKYA 7ICQA 5AM4A 3K1RB 2EAOA 2W11A 3UPQA 3MGVA 1S10A 3BDPA 3LK9A 5KL1B 2DF4B 1ZRNA 3HWTA 5J2DA 2XGPA 5IINA 5KT7A 8ICAA 1ZXIA 1YZ7A 5L1LA 4Y2TA 9ICVA 2E1EA 1O08A 5ALGA 1NNLA 3UMBA 4TURA 2KHQA 3QNMA 3RJKA 3QX7A 4B9VA 4F5OA 5BOMA 2LYBA 3RR7A 1L8LA 2BHNA 2CPRA 3PSTA 3UXPA 2KTQA 3S6JA 3QUBA 5J2EA 1NKCA 2WAQF 4QZCA 3HKZC 4IS7A 2E8PA 3E2EA 2IA6A 3QYPA 1L7PA 4F71A 1TFRA 2BPFA 2KVSA 1PVRA 2H3FA 3BS5B 4Y2SA 5KFJA 1PK3A 2XI9A 1L3VA 4ZOHC 1SKSA 4M9GA 4F2RA 5AKEA 2FMQA 4KMOB 4FE3A 4JK1A 3WK8A 5J8YC 1X6JA 3M9MB
chains in the Genus database with same CATH topology
5CEHA 1KKXA 2EQYA 1KN5A 2LI6A 2RQ5A 2LM1A 4LJXA 1IG6A 1RYUA 1C20A 2OEHA 5K4LA 1KQQA 2YQEA 2JXJA 2EH9A 2JRZA 2KK0A 2CXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEH A;  1KKX A;  2EQY A;  1KN5 A;  2LI6 A;  2RQ5 A;  2LM1 A;  4LJX A;  1IG6 A;  1RYU A;  1C20 A;  2OEH A;  5K4L A;  1KQQ A;  2YQE A;  2JXJ A;  2EH9 A;  2JRZ A;  2KK0 A;  2CXY A; 
#chains in the Genus database with same CATH topology
 1SGG A;  1ZRM A;  2BCS A;  5L1K A;  2OWO A;  1ZJM A;  4RQ6 A;  3ZI4 A;  4F4Z A;  3T79 A;  4PHE A;  4IQV A;  4DQI A;  2KOB A;  5ALF A;  3T3F A;  2EAM A;  1L5U A;  9ICO A;  4DOB A;  4J9K A;  3QEB Z;  3NRW A;  5AK6 A;  3MFH A;  4NL9 A;  4Y2J A;  1SL1 A;  4UAR A;  1TE2 A;  4F4W A;  1U4B A;  1LV5 A;  2Y0S C;  2V4R A;  1H38 A;  2G09 A;  1N5W A;  1SV4 A;  1Z4O A;  2W9C A;  3C23 A;  4RQN A;  3HX0 A;  1YZ6 A;  3JPP A;  1NI3 A;  1RQN A;  1KFS A;  4ECY A;  2KJ8 A;  3FDS A;  2JV3 A;  2NO5 A;  4USA A;  1UT5 A;  4J9L A;  4G9B A;  1S9F A;  2NYV A;  4QZB A;  2QAR A;  3OGU A;  8ICP A;  4M04 A;  2DFL A;  8ICL A;  5KG3 A;  2ASL A;  1JRO A;  1X40 A;  4UBC A;  4IL6 U;  4RPZ A;  7ICR A;  2K4E A;  5CWR A;  2C28 A;  1ZQH A;  2ZTD A;  3H0R B;  5AIB A;  2V4Q A;  3HPO A;  1T7P A;  2YML A;  1NJX A;  4RUA A;  5KTQ A;  2BQR A;  3IP4 B;  3UMC A;  4FS2 A;  1U49 A;  3RH5 A;  3GFK B;  2HHV A;  2AGP A;  1UHU A;  3KZI U;  1ZQP A;  4F91 B;  5HR7 A;  4Q43 A;  1EXN A;  4ELU A;  1KRP A;  1RYU A;  3H8M A;  1T4G A;  4I29 A;  4IRD A;  3NAS A;  4DS4 A;  4KLO A;  8ICB A;  4P0Q B;  4BGD A;  2XIC A;  9ICN A;  2CN1 A;  2W04 A;  2AJQ A;  5EE3 A;  4C4T A;  1QH9 A;  3FM9 A;  4Y2R A;  7ICT A;  4YP3 A;  3BZK A;  2MRL A;  3CP8 A;  1OW5 A;  4AYB C;  3ORY A;  4RQ7 A;  2R8J A;  3B0Y A;  2MU2 A;  2LBO A;  3EPG A;  3PX4 A;  4QW9 A;  4ELV A;  4ECR A;  3V7K A;  2G08 A;  4IQT A;  5J0S A;  5AHX A;  1XO1 A;  1Q46 A;  4TUP A;  2QB0 B;  3ISD A;  3SQI A;  3N7P D;  3PW7 A;  2XGQ A;  4FBT A;  2RLT A;  1A76 A;  2K4P A;  4GIB A;  2J6U A;  4NM1 A;  2H3Q A;  3DEE A;  1KKX A;  3N28 A;  2KNJ A;  3OJU A;  3J81 j;  1CI4 A;  3KHH A;  3SYZ A;  2JEJ A;  2KP7 A;  1F5S A;  3LWL A;  3MGI A;  1NK8 A;  4F50 A;  1NKE A;  1WYG A;  1ZQI A;  4GXJ A;  3EYZ A;  3TAR A;  4DQQ A;  4F5P A;  1M6Y A;  4JV0 A;  2ISP A;  8ICJ A;  9ICH A;  2BCU A;  4IRK A;  1PK1 A;  1ZQW A;  4O5C A;  4P4O A;  3TFS A;  4QWC A;  1RG6 A;  1D8L A;  4DL3 A;  2GOL A;  4C80 A;  2BCV A;  3TKA A;  4ED1 A;  3K1Z A;  5ALV A;  2ZXI A;  2KZ3 A;  2RQ5 A;  2IHM A;  4O5E A;  4PH5 A;  2K60 A;  1O03 A;  8ICV A;  5KFD A;  1BPX A;  5KFF A;  3SZ2 A;  3IDW A;  1ZQR A;  4O3N A;  4CNQ A;  3M6Z A;  2MAX A;  3JPS A;  2AQ4 A;  1K1S A;  3QZ7 A;  4DL7 A;  2YMP A;  4DSE A;  4JV1 A;  2Y9U A;  4F5Q A;  1PUZ A;  2HBM A;  2DPI A;  3F2C A;  4JWN A;  3RJJ A;  9ICU A;  3B0X A;  2FI1 A;  5TZV A;  1D9F A;  4KLM A;  2ES6 A;  2I1Q A;  4J9N A;  1L7N A;  2F44 A;  1QQ5 A;  4Y2U A;  5AKI A;  8ICC A;  1BPB A;  4I2D A;  3MR6 A;  2XY5 A;  1RZT A;  2HDO A;  1JIH A;  7ICK A;  4TUQ A;  2ESE A;  5J2G A;  4O0I A;  4HAI A;  2NRT A;  1FFU A;  3BQT A;  3MGH A;  2XCP A;  3SR6 A;  2K8A A;  9ICL A;  2AH5 A;  1JXL A;  3C2K A;  3QEA Z;  5AM1 A;  5ALS A;  4KLQ A;  5J0X A;  2KZZ A;  3BS5 A;  3C5F A;  4R66 A;  3BQ0 A;  4Q8E A;  3C21 A;  3HT3 A;  4C0Z A;  5ALN A;  5KG4 A;  4DFK A;  2ZXH A;  4XUS A;  3OHA A;  1KL9 A;  2JGA A;  4I2C A;  1Z1B A;  2K89 A;  5AKG A;  1SKR A;  4IC9 A;  4YMM A;  1ZQE A;  1S0V A;  4OJL A;  2QLT A;  2C2D A;  3RFA A;  2A1A A;  1Q8K A;  4I2E A;  4FZN A;  4QZE A;  4EEN A;  1TAQ A;  4M0A A;  5ALU A;  3QU7 A;  3C1Y A;  4I2H A;  2VAN A;  5DQI A;  3KFU F;  8ICO A;  3KHR A;  9ICG A;  5HHI A;  3JPN A;  1TAU A;  4ECQ A;  5EE9 A;  5ALI A;  3BJY A;  1J97 A;  3HKZ F;  4YMO A;  1PVP A;  5HMM A;  1HEK A;  1ZET A;  2GH1 A;  2W3S A;  4UAV A;  2KJ9 A;  2HBK A;  5KFU A;  4F92 B;  3H0M B;  3NVY A;  1A0P A;  5ALW A;  1ZQQ A;  4R64 A;  5DG8 A;  3GII A;  3IV6 A;  4EZ9 A;  3IM1 A;  3DV9 A;  5AI8 A;  2EZY A;  2HHS A;  5D4B A;  2R8K A;  4P0P B;  2WTF A;  8ICN A;  2FE9 A;  4DOA A;  2JZB B;  3K75 D;  9ICE A;  1NZB A;  8ICZ A;  2IOF K;  2G0A A;  3RAQ A;  2HHT A;  3G6X A;  4GXI A;  3A0H U;  3SI8 A;  3BS7 A;  3TI0 A;  4P0Q A;  2Y1I A;  1WUD A;  2Y0S F;  2MA1 A;  4FFD A;  7ICS A;  2W03 A;  2VJ5 A;  5KFN A;  2W9B B;  2MUT B;  4KLH A;  4XQ8 A;  5J0Q A;  1TK8 A;  4KN4 A;  4RUC A;  4QIW C;  3ED5 A;  5ALO A;  1DRG A;  3V6K A;  4NLN A;  2OXO A;  4F4X A;  3NVV A;  3PY8 A;  3M7D A;  4YR0 A;  3WU2 U;  1U48 A;  2JHD A;  2EAN A;  2A1J B;  2HHW A;  1V38 A;  3ZD9 A;  2HCF A;  1DGS A;  1NK4 A;  3D2Q A;  1UCV A;  5ALE A;  1WCL A;  8ICI A;  2QB0 A;  1NOM A;  4NXZ A;  1L6N A;  2KZM A;  5J8Y A;  5JTI A;  4G3I A;  5DKW A;  4C7Z A;  2EZZ A;  2Z7J A;  5AKK A;  4GLX A;  1IV8 A;  1ZQJ A;  3KKA C;  4K4G A;  3AUO A;  1N62 A;  5G5H A;  1B22 A;  2WFA A;  3JPQ A;  3OTQ A;  3QXG A;  2HBL A;  5ALP A;  2KIV A;  5EOZ A;  1S0N A;  2OH2 A;  5DQG A;  3RB6 A;  4J9M A;  3PO5 A;  1XNS A;  4QZD A;  3V72 A;  5JUM A;  3NGD A;  1X66 A;  2JEF A;  1YT3 A;  4QW8 A;  1A77 A;  2W9M A;  4AYB F;  2XC9 A;  3H7I A;  3UQ0 A;  2ZG6 A;  2LM1 A;  2ASJ A;  4Q45 A;  3H8J A;  4NLB A;  4LJX A;  3LVW A;  4PGQ A;  1ZQO A;  4US8 A;  1ZQZ A;  4ED2 A;  4JV2 A;  5KAI U;  5ALK A;  8ICM A;  2FPM A;  7ICU A;  3Q8Q B;  3SV4 A;  2XO7 A;  1NKB A;  1JN3 A;  4F4K A;  5CHG A;  4QZA A;  4CRX A;  3PMN A;  8ICU A;  3HP6 A;  2EQY A;  1A6S A;  1KSP A;  2L5Y A;  4ICA A;  5D46 A;  1NJZ A;  2M9N A;  1XC9 A;  2ZIV A;  3WK4 A;  2ZIW B;  1SZH A;  4BWJ A;  4RNN A;  3RJG A;  4P2H A;  1J2M A;  4M6W B;  3OSP A;  2DUY A;  2W8K A;  5G5G A;  2Y9T A;  5KFS A;  1QSS A;  2N1R A;  1KFT A;  1RDF A;  1N56 A;  3D2S A;  3RF9 A;  3CW2 C;  2KD1 A;  8ICH A;  2WF8 A;  4CF4 A;  1SKW A;  4UB1 A;  5AM3 A;  2ZIX A;  3EUB 2;  8ICR A;  1OXJ A;  4UB4 A;  1Q3V A;  1Q3U A;  1JUD A;  3BZC A;  4YCX A;  2I5H A;  3TAP A;  3RB0 A;  2E8N A;  2NRZ A;  4K4H A;  3F2B A;  1ZQ1 C;  2F1I A;  2BPC A;  1BPZ A;  5DQH A;  2FLP A;  5AIA A;  1CUK A;  4MF2 A;  5D49 A;  3RB3 A;  4DFM A;  4KIT B;  3TAN A;  3C5G A;  4UAS A;  4F5N A;  4M9J A;  1ZJN A;  1X9M A;  4O9M A;  2ZTE A;  3NVW A;  4Z6D A;  3N4M B;  1XSP A;  4NLG A;  3LWM A;  2H3I A;  4RU9 A;  2DPJ A;  3EZ5 A;  2JEG A;  4YXJ A;  2YMM A;  3PML A;  7ICO A;  4EZ6 A;  3QU2 A;  4PHA A;  1UA1 A;  3H8W A;  5DLG A;  3PNC A;  3VCB A;  4DL4 A;  2W8L A;  3K4G A;  4OCZ A;  1IXR A;  4O3S A;  2WF7 A;  4OJ6 A;  5KFG A;  3PVX A;  4I2F A;  1ZQN A;  2NO4 A;  3AU2 A;  2HI0 A;  2KE7 A;  1C7Y A;  2I6X A;  4Y2X A;  1VDV A;  4DSF A;  8ICQ A;  1D8Y A;  1SWW A;  4UB5 A;  3GQC A;  5ALX A;  2BQU A;  4I2G A;  2O6K A;  4P0P A;  1B43 A;  3KOO A;  4RT2 A;  4EYH B;  2E1F A;  4UB6 U;  2RP5 A;  5DDY A;  2ZJ8 A;  1U47 A;  3IG8 A;  5AKH A;  1ZYQ A;  5J2B A;  3I1Y A;  2ZUB A;  3TAD C;  4DWI A;  4UB3 A;  5KFY A;  1S97 A;  2G5I B;  4ECU A;  8ICS A;  5AI0 A;  5ALJ A;  2R8I A;  2W9B A;  1XO0 A;  2MUT A;  3QE9 Y;  3QU5 A;  2VIX A;  5J0T A;  4RQ4 A;  1DXS A;  3NVZ A;  5F9L A;  4CGZ A;  4NLC A;  7ICJ A;  5CP2 A;  8ICK A;  2XCA A;  3IRU A;  5KT4 A;  3WKB A;  4UAT A;  3WKE A;  4RPY A;  3GIJ A;  4KTQ A;  5KL8 B;  1RXV A;  4GC6 A;  5IIK A;  1S0O A;  1K5O A;  1UA0 A;  5J2F A;  4ACO A;  4C8L A;  2ODG A;  2PI5 A;  5KFA A;  4OO1 J;  4IRC A;  5IIJ A;  4DF4 A;  4CE6 A;  2KEY A;  1CRX A;  4R8U B;  1KLN A;  2JEI A;  2KKP A;  4DLG A;  1UT8 A;  5E79 U;  4FZM A;  4JUZ A;  1PVQ A;  2HHX A;  5AM2 A;  5GTH U;  3T5H A;  1WWV A;  4J03 A;  5KFC A;  1ZQL A;  4BWM A;  3R9K A;  2XID A;  4KLL A;  3RH4 A;  2BCR A;  5CR0 A;  4RQ1 A;  2GWS A;  4KLD A;  1ED1 A;  1DGJ A;  4KLG A;  3M8R A;  4KLS A;  1RYR A;  1N5X A;  4ED7 A;  3N7S C;  2F3N A;  1Z19 A;  3AMZ A;  4QIW F;  4F93 B;  4KLI A;  5JU5 A;  3SAG A;  5DB8 A;  3SV3 A;  3M6K A;  2MSN A;  1XU4 A;  4QNL A;  9ICK A;  2DKX A;  3ETL A;  2ZUC A;  4Q44 A;  2F77 X;  4RNO A;  1RPL A;  4PL2 A;  2JH7 A;  1MSW D;  1XWL A;  2ZTC A;  3QUT A;  3KZX A;  4EEL A;  2W9A A;  1T94 A;  3KHL A;  5J0W A;  1V85 A;  2OYY A;  5L1J A;  2R18 A;  5KFO A;  3FC4 A;  1QSY A;  3MBY A;  5AK5 A;  3PR5 B;  1L8O A;  4OJP A;  1KFD A;  3TFR A;  3HRD D;  4YG2 A;  2RHF A;  4QZH A;  4QZ8 A;  4EBE A;  2FMS A;  4BDP A;  5IIM A;  4OJ5 A;  4ECW A;  3N7R C;  5KT5 A;  3PV8 A;  2HW3 A;  1BVS A;  5EE0 A;  3F5A A;  3KHG A;  4MEX A;  2DGZ A;  5KT3 A;  5J0O A;  7ICE A;  3NS1 A;  1P7D A;  2PFP A;  9ICX A;  3ONN A;  2ZIW A;  2C2R A;  2KV2 A;  2WF5 A;  3AL0 B;  3RR8 A;  2WF6 A;  1V9P A;  2EDU A;  4J9O A;  1B0X A;  4M6W A;  1L7M A;  2Q4T A;  4B9U A;  4C7Y A;  4PGX A;  4PGY A;  3RJE A;  3ISB A;  4F72 A;  1QCK A;  3PR4 A;  2M0N A;  3Q8S B;  3LDA A;  1Y88 A;  1ZQV A;  5KFB A;  1L3U A;  1SZP A;  2VA3 A;  1RM6 C;  2BDP A;  7ICL A;  3M1Y A;  2JR5 A;  1N61 A;  5K4L A;  4M9L A;  3WK9 A;  3Q8M A;  1NK9 A;  5ALL A;  3AEV A;  1T3N A;  4KN7 A;  1QQ6 A;  3SEN A;  1KN5 A;  4RNM A;  5HR6 A;  5L1M A;  2KKV A;  5DLF A;  4UW9 A;  2ALZ A;  4PL1 A;  3C2M A;  3ZDE A;  4GFJ A;  3GDX A;  4I2I A;  3AQE A;  4XA5 A;  1MQ2 A;  5CJ7 A;  1C20 A;  1X9W A;  4PJ0 U;  4F5R A;  1TKD A;  1KEJ A;  2JXJ A;  4OJO A;  1TK5 A;  2HOQ A;  1FO4 A;  4F2S A;  9ICF A;  1ZQG A;  3ALR A;  3ICX A;  4Y2V A;  1N60 A;  2VKQ A;  4ZH4 A;  2B0C A;  3L4P A;  4YXM A;  1UQV A;  1ZQY A;  4GC7 A;  4P4P A;  2P35 A;  8ICE A;  1Z1V A;  3FAH A;  4CF5 A;  5L1I A;  3KKA A;  1XS9 D;  4NLK A;  5AK4 A;  3RTV A;  4UAW A;  3T5J A;  2FJ6 A;  2UVV A;  1U9L A;  5AM5 A;  2FLL A;  4B9M A;  1HIW A;  4BXO B;  4E0D A;  3SAH A;  2F8L A;  5J0P A;  3AN1 A;  5AIC A;  2HMX A;  1JXE A;  4M47 A;  2ZJA A;  4RQ2 A;  1FEZ A;  3V7J A;  1BPD A;  4RQ3 A;  2PFO A;  2HVH A;  3ZDB A;  3C1Z A;  3LVV A;  2YQE A;  4LVS A;  3UXO A;  3JPT A;  5KG7 A;  3M8S A;  4BJQ A;  7ICV A;  1COK A;  2G06 A;  1LVH A;  2KFZ A;  1IG6 A;  2LHT A;  4F8R A;  3UQ2 A;  5KAF U;  4O5K A;  8ICY A;  5HHH A;  4UBB A;  5KFI A;  1BPY A;  4NJ8 A;  1UPH A;  3PSF A;  2VA2 A;  2VJ4 A;  3NRZ A;  4FS1 A;  4C8M A;  4KX5 A;  4ECV A;  1S5L U;  2K8B B;  3CYM A;  2J6T A;  3E0F A;  1XSL A;  4YFK A;  9ICC A;  3PO4 A;  3RB4 A;  2ISO A;  4UAU A;  4RQM A;  4QWA A;  3TAQ A;  9ICA A;  4QWD A;  1URJ A;  1F44 A;  4IR1 A;  4QWB A;  4I2B A;  4ECZ A;  3GZF A;  4MHV A;  2OHF A;  3KD3 A;  3WKD A;  1COO A;  4RT3 A;  2ATL A;  4O3P A;  1Z00 B;  4KLU A;  2DBY A;  9ICT A;  2F76 X;  2NRW A;  4PPX A;  4HYK A;  2KK0 A;  5III A;  3MFI A;  4ED3 A;  5DBA A;  3M9O B;  5DG9 A;  2R8H A;  4TQR A;  7ICF A;  3MDA A;  5H2F U;  2HOI A;  4JWM A;  2AGO A;  4ED6 A;  2F1J A;  8ICX A;  3V7L A;  4PHD A;  3RAX A;  2GO7 A;  3E58 A;  1BGX T;  4YR3 A;  4US9 A;  2W54 A;  4O3Q A;  1SWV A;  2F2A B;  3PZP A;  1ZQD A;  4DQS A;  1ZQC A;  2KG5 A;  3GIK A;  4QWE A;  3Q8P B;  4IR9 A;  9ICJ A;  4EBD A;  4YN4 A;  4K4I A;  3ZD8 A;  5J2I A;  1ZD3 A;  4LZG A;  4EEK A;  1NK0 A;  4EEY A;  5F9N A;  4UB8 U;  2QB1 A;  3PW0 A;  3SAF A;  1ZD2 P;  5CRX A;  5DG7 A;  3PW2 A;  3ZDD A;  1S0M A;  4M9H A;  3L5K A;  4C4S A;  4DQP A;  3A0B U;  3THV A;  3C29 A;  4DL5 A;  2YY6 A;  3KTQ A;  1D9D A;  5KG0 A;  3L3F X;  3UM9 A;  3C2L A;  2ZIU B;  5EWE A;  2NRV A;  4U6P A;  2LYA A;  2WB1 C;  4I28 A;  1J2N A;  4UB2 A;  1ZQX A;  1AQ6 A;  1U45 A;  4TUS A;  4NLZ A;  3V6J A;  2W55 A;  3OSN A;  4ECX A;  8ICW A;  4JB3 A;  2BZF A;  1ZD5 A;  2LM4 A;  3GIM A;  3O0F A;  3AQF A;  1RQL A;  2UVR A;  5CA7 A;  2FPL A;  4DEZ A;  4IQU A;  2ZJ5 A;  2A3V A;  1RYS A;  4F4Y A;  3TAD A;  2OEH A;  1X9X A;  3T5K A;  1SV0 C;  3MAB A;  4Y2Y A;  5IIL A;  5KT2 A;  3ZDC A;  1CEZ A;  4DL6 A;  5KG1 A;  2CXY A;  5J2C A;  2YTU A;  2W7O A;  2W43 A;  5ALT A;  1MC8 A;  5AKX A;  5A0L A;  4C8N A;  3OJS A;  4OD0 A;  3NUQ A;  5T14 A;  4ED8 A;  4B6J A;  8ICT A;  5AI5 A;  5BOL A;  5AI9 A;  3UMG A;  3QU4 A;  3EPI A;  5J0Y A;  3I28 A;  9ICS A;  2FMP A;  2F8K A;  4M9N A;  4CF3 A;  4BUG A;  9ICW A;  4RPX A;  3WKC A;  4B9S A;  8ICF A;  2LMR A;  3AM9 A;  2KIC A;  1Z3E B;  4DFJ A;  5KT6 A;  3D6J A;  5J2K A;  4AP9 A;  5ALY A;  3RH6 A;  4YMN A;  3Q8L A;  3QUC A;  4DFP A;  1MQ3 A;  1BPE A;  1FFV A;  3WKA A;  4P4M A;  5KFK A;  3TQ1 A;  1S77 D;  3WK7 A;  4EYI B;  4U7C A;  5F3X B;  3SD7 A;  4BXO A;  4A8E A;  1X2I A;  5AI6 A;  2H5X A;  5ALD A;  1TVA A;  2HBJ A;  5AM0 A;  2BPG A;  4EX7 A;  2XY6 A;  5TIS U;  5J29 A;  1NK5 A;  4Y2Q A;  1N2X A;  2NV3 A;  2B6G A;  2IHN A;  4WJ3 B;  2RDJ A;  1KW4 A;  4BX9 C;  4R63 A;  4ELT A;  1NK7 A;  1ECW A;  5J2J A;  4B9T A;  4Y2P A;  2JZB A;  5KFR A;  3G6Y A;  2R8G A;  3RRH A;  4X5V A;  1K1Q A;  3QUQ A;  2FDR A;  4NM2 A;  2LPE A;  1ZQB A;  2ASD A;  2AHO B;  5HNK A;  5CEH A;  2H3Z A;  2E8O A;  5AKL A;  3DDH A;  2D3D A;  4FO6 A;  5DGB A;  4NWI A;  4I27 A;  1NK6 A;  2OM6 A;  2D8C A;  3I76 A;  5CB1 A;  9ICI A;  3F5E A;  3Q8R B;  4R65 A;  2PFQ A;  2J6S A;  2E5S A;  1IM4 A;  3KBB A;  4MFF A;  2YMQ A;  4YR2 A;  7ICG A;  9ICP A;  3WK5 A;  2A1J A;  1TAM A;  5J2H A;  4KLE A;  3N97 B;  2DKZ A;  5J0R A;  1L7O A;  5KFL A;  2KSO B;  4KLF A;  2PMZ C;  1ZQT A;  3GV5 B;  2LKY A;  1NJW A;  1T3Q A;  5JRT A;  2KJ5 A;  1X6I A;  2A19 A;  4Q8F A;  2C2E A;  1B4F A;  1T8E A;  3PSI A;  4YD2 A;  1X42 A;  2NRX A;  3HJE A;  3HIL A;  3SEI A;  4JMU A;  3RJI A;  1JX4 A;  2KVC A;  5L9X A;  1GO3 F;  3PX6 A;  1ZQK A;  4NL9 C;  4QZ9 A;  1Z00 A;  2RRD A;  2PFN A;  1ZQM A;  4DCC A;  2KN7 A;  2DQN B;  5J0U A;  5ALM A;  2EH9 A;  3QZ8 A;  2K8C B;  3UXN A;  3QU9 A;  4DL2 A;  2G5H B;  3F2D A;  5DB9 A;  2WHE A;  3C28 A;  4DOC A;  4YQW A;  4DFD A;  4QJF B;  1NJY A;  2FLN A;  5KG5 A;  5DB6 A;  4QZI A;  2JMG A;  2YN4 A;  3JPR A;  3IN5 A;  1X9S A;  5KFZ A;  1KDH A;  4M2Y A;  2D6F C;  2HVI A;  2WAQ C;  3TAC B;  2HHU A;  2P6U A;  3MDC A;  1BNO A;  4UAY A;  7ICN A;  2LI6 A;  1TK0 A;  5B5E U;  4F3O A;  1VJ5 A;  1N48 A;  7ICM A;  2UVW A;  4KX3 A;  4QZF A;  1LKY B;  1Z4N A;  1FIQ A;  4NV0 A;  1DOQ A;  5KFE A;  1KBU A;  1JMS A;  5KNI A;  2OCE A;  3ISC A;  1S8O A;  5AKZ A;  1N63 A;  4PZN A;  2ZIU A;  4ECS A;  2V9W A;  1D8B A;  5KFX A;  2UVU A;  4RQ0 A;  2BQ3 A;  1PZN A;  4PZO A;  3M9N B;  3U26 A;  5ALQ A;  1F0M A;  5DGA A;  4DF8 A;  1VLB A;  3B9J A;  3GU3 A;  1RXW A;  7ICH A;  4MF8 A;  2DL0 A;  2EAP A;  3H0L B;  1S76 D;  2XY7 A;  1KTQ A;  3MR2 A;  2ZIV B;  4KLJ A;  1MA7 A;  1ZQU A;  4IQW A;  3H40 A;  3MR3 A;  2KMD A;  5DBB A;  7ICP A;  2RDI A;  5AK3 A;  2PKE A;  4KLT A;  5C0Y A;  3BQ7 A;  3D2N A;  5B66 U;  5KG6 A;  1ZOL A;  4LZD A;  3VC8 A;  4J9S A;  3RJH A;  3H8S A;  5KFT A;  4O3R A;  5EWG A;  4YVZ A;  2BKE A;  2LYH A;  4B9N A;  1MN8 A;  1JAL A;  2ZIX B;  4UAZ A;  4C8K A;  4QZG A;  1SL2 A;  4DSJ A;  9ICM A;  2QKQ A;  2EZX A;  2HOF A;  3ZDA A;  1BNP A;  4TQS A;  4PHP A;  5BPC A;  1DK3 A;  3PW5 A;  3EW9 A;  3OPX A;  1WWU A;  2WB1 F;  1ZD4 A;  2E3T A;  2FPK A;  1HUZ A;  2JH1 A;  2JRZ A;  5AKY A;  3CNH A;  4C4R A;  5DDM A;  4O3O A;  2Q0Z X;  1WCN A;  4Z6F A;  3MR5 A;  1JRP A;  3SMV A;  5ALZ A;  1HJP A;  3T5L A;  3H4D A;  1ZQA A;  4RQ5 A;  5KG2 A;  3BQ2 A;  2F1H A;  5KFH A;  2AU0 A;  2YX8 A;  4NY8 A;  3PX0 A;  1JI7 A;  1OUQ A;  2E8M A;  2W9C B;  2IOH A;  3IG5 A;  3RJF A;  5KFP A;  5KFM A;  4J9Q A;  5IIO A;  1HUO A;  2GLE A;  5C5J A;  2IMW P;  5EE1 A;  2C22 A;  4J9P A;  2QAR B;  4MFA A;  5KFV A;  9ICB A;  4DSK A;  7ICI A;  2VA8 A;  3Q8K A;  1KQQ A;  2ZUD A;  2YB4 A;  5AKJ A;  2AGQ A;  5EWF A;  2DWQ A;  2IBK A;  4ED0 A;  4FBU A;  2XVT A;  5ALH A;  4O3M A;  2HHQ A;  2I9G A;  5DB7 A;  4B9L A;  1SB3 C;  9ICR A;  2H3V A;  2B21 A;  3CRX A;  3FYH A;  3MC1 A;  1QTM A;  5DBC A;  5FP0 A;  4RZR A;  2PXI A;  4Z6C A;  3GV8 B;  2KIW A;  2YB1 A;  2PI4 A;  1NZP A;  3PSP A;  3ETR A;  3H4B A;  3PW4 A;  4UQG A;  5HML A;  3G6V A;  2BDU A;  1SXD A;  4CCH A;  1QLN A;  4XRH A;  4DLE A;  2W7P A;  4DS5 A;  1SL0 A;  4DSL A;  4YD1 A;  5GTI U;  3GV7 B;  4I2J A;  3EWA A;  4GXK A;  4DQR A;  4I2A A;  3RRG A;  3RBD A;  1L3T A;  1XSN A;  2KFN A;  4RQ8 A;  2KSO A;  1SV0 A;  4KMU A;  4R8U A;  1ARO P;  2AXT U;  1DK2 A;  4FZL A;  1TV9 A;  3NTU A;  4MEY A;  2G07 A;  4MFC A;  5J2A A;  1WG8 A;  3IHQ B;  5AI4 A;  3RBE A;  4EX6 A;  5ALR A;  2P6R A;  1IIP A;  2HSZ A;  1L3S A;  8ICG A;  4DSI A;  2AQ0 A;  1ZQS A;  4Z6E A;  3V6H A;  3AU6 A;  2CRX A;  5HP4 A;  3WK6 A;  2P66 A;  2KHV A;  4CDG A;  1V97 A;  4C8O A;  5KFW A;  1PK1 B;  3F53 A;  3GIL A;  4DO9 A;  1LB2 B;  2K4H A;  2Y1J A;  2BGW A;  2K4I A;  3JPO A;  3OHB A;  9ICQ A;  1ZQF A;  1QQ7 A;  3BQ1 A;  3HW8 A;  1QSL A;  2WF9 A;  4EBC A;  3LYS A;  4J9R A;  2BCQ A;  5KFQ A;  2BR0 A;  1SXE A;  4ECT A;  1SIJ A;  2PMZ F;  2W3R A;  2IOF A;  1LKY A;  7ICQ A;  5AM4 A;  3K1R B;  2EAO A;  2W11 A;  3UPQ A;  3MGV A;  1S10 A;  3BDP A;  3LK9 A;  5KL1 B;  2DF4 B;  1ZRN A;  3HWT A;  5J2D A;  2XGP A;  5IIN A;  5KT7 A;  8ICA A;  1ZXI A;  1YZ7 A;  5L1L A;  4Y2T A;  9ICV A;  2E1E A;  1O08 A;  5ALG A;  1NNL A;  3UMB A;  4TUR A;  2KHQ A;  3QNM A;  3RJK A;  3QX7 A;  4B9V A;  4F5O A;  5BOM A;  2LYB A;  3RR7 A;  1L8L A;  2BHN A;  2CPR A;  3PST A;  3UXP A;  2KTQ A;  3S6J A;  3QUB A;  5J2E A;  1NKC A;  2WAQ F;  4QZC A;  3HKZ C;  4IS7 A;  2E8P A;  3E2E A;  2IA6 A;  3QYP A;  1L7P A;  4F71 A;  1TFR A;  2BPF A;  2KVS A;  1PVR A;  2H3F A;  3BS5 B;  4Y2S A;  5KFJ A;  1PK3 A;  2XI9 A;  1L3V A;  4ZOH C;  1SKS A;  4M9G A;  4F2R A;  5AKE A;  2FMQ A;  4KMO B;  4FE3 A;  4JK1 A;  3WK8 A;  5J8Y C;  1X6J A;  3M9M B; 
#chains in the Genus database with same CATH homology
 5CEH A;  1KKX A;  2EQY A;  1KN5 A;  2LI6 A;  2RQ5 A;  2LM1 A;  4LJX A;  1IG6 A;  1RYU A;  1C20 A;  2OEH A;  5K4L A;  1KQQ A;  2YQE A;  2JXJ A;  2EH9 A;  2JRZ A;  2KK0 A;  2CXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...