2JRZA

Solution structure of the bright/arid domain from the human jarid1c protein.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
SMNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVCNTRPFDNEEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Histone demethylase JARID1C
publication title Backbone and sidechain 1H, 13C and 15N resonance assignments of the Bright/ARID domain from the human JARID1C (SMCX) protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 117
sequence length 117
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jrzA00
1KN5A 2YQEA 2CXYA 2RQ5A 4LJXA 2JRZA 1RYUA 2LI6A 2KK0A 1IG6A 5K4LA 1C20A 2EQYA 5CEHA 2OEHA 2EH9A 1KKXA 2LM1A 1KQQA 2JXJA
chains in the Genus database with same CATH superfamily
5KFMA 1ZQTA 1M6YA 1PVQA 4I2AA 5KFBA 4PZOA 2HHWA 2XICA 3B0YA 2K8BB 1UA0A 7ICKA 3Q8RB 3RBEA 3B9JA 4BJQA 3TFRA 4YFKA 4UAWA 4YN4A 1L8LA 3AU2A 4BXOA 4DSIA 3M8RA 3GIKA 8ICOA 5AKLA 3G6YA 2FMPA 4PL1A 4YVZA 3ISBA 5T14A 4YXJA 4IC9A 2NV3A 3Q8PB 2N1RA 5CEHA 4RQ1A 4YMOA 1HIWA 2DFLA 3RJJA 3T5KA 3M6ZA 8ICXA 9ICFA 3AM9A 5J2DA 3RB6A 2BQUA 5C0YA 4RQNA 3SAGA 1DOQA 4KLEA 3M1YA 3C2KA 5J2EA 1SGGA 2YX8A 4QWCA 1T8EA 3QNMA 4KLSA 4X5VA 4DQRA 2MAXA 5J0PA 3H4DA 2WB1C 1WYGA 4O5EA 4HAIA 2I6XA 1BPYA 4UB1A 4K4IA 5J0UA 2G07A 3D2QA 5IIJA 3I76A 1QSSA 2RQ5A 1L6NA 3H0LB 5AKXA 8ICYA 4PHDA 1S0OA 4US9A 2XI9A 5ALUA 3RBDA 1KTQA 4OO1J 4ED8A 2XO7A 2P35A 3TAQA 2GO7A 3ZD8A 2ESEA 2A1AA 3BQ7A 1V38A 3NVVA 5J2AA 3PX4A 5DBAA 5TZVA 3MFIA 3C28A 3GV7B 1QQ6A 5J0WA 5KFQA 1O03A 4KLTA 1ZQOA 1ZQIA 2NRWA 3ISCA 3MFHA 2RLTA 1X2IA 1GO3F 1QSLA 2FMSA 4QZCA 4C7ZA 1L3VA 3ONNA 9ICSA 5AIBA 2IA6A 3V72A 1BPXA 2AU0A 3JPRA 1TAMA 3WKCA 5DDYA 1L5UA 3E0FA 1D9FA 5J0SA 4UARA 4C8OA 3PMNA 8ICIA 1FFUA 2G5HB 2FPKA 2KFZA 3SMVA 2IBKA 2KHVA 4R66A 5FP0A 3OPXA 3ED5A 2KN7A 2EZXA 1BVSA 2YMLA 3QUQA 5J0TA 3RAQA 8ICGA 4YMMA 4I2HA 2HBLA 2XGQA 5KFLA 5AIAA 5KFXA 7ICMA 2Y1JA 3EPGA 5ALHA 4Y2TA 3VCBA 2IHNA 3BDPA 1SKSA 3PSTA 2M9NA 3BQ0A 4ICAA 3PSPA 3Q8LA 1KLNA 3RF9A 2H3ZA 5L1MA 5ALRA 1ZQRA 4QZDA 1X6JA 4BUGA 3H4BA 4DF4A 7ICRA 5KG7A 2DPIA 1ZQEA 1Q8KA 1ZXIA 2XY7A 2LYHA 4JV1A 5DBBA 9ICCA 1PUZA 7ICQA 4PZNA 4NM1A 3RAXA 1ZRMA 1K1QA 5AICA 3TACB 4DF8A 1A76A 1DGSA 1SV0A 3NASA 1XU4A 2HOIA 4MF2A 2VJ4A 2ISPA 2K4HA 3KHHA 3HJEA 2KJ5A 9ICQA 3QUTA 5CR0A 4F5RA 1COKA 4O9MA 4DL4A 4ECSA 4F5NA 4O3OA 1CI4A 1U9LA 2V9WA 2KFNA 2R18A 2KHQA 4NM2A 2EQYA 3DV9A 3PSIA 3HPOA 2Y0SF 5L1KA 5AI4A 9ICGA 2NRTA 5AK4A 4F5PA 3AN1A 3F2CA 3AQEA 5F9NA 2AJQA 1IIPA 3H8MA 4P0QB 1IM4A 3CYMA 1ZYQA 5ALGA 2EAMA 4F8RA 4M9JA 3ZD9A 1LKYB 2ZIXB 2C2EA 2JXJA 4NJ8A 2HDOA 3QXGA 4QNLA 7ICOA 1WCNA 2IOFA 4DWIA 3NGDA 2ODGA 3M6KA 4RPYA 5J0OA 3GZFA 4PL2A 4JWMA 2DPJA 2QLTA 1NOMA 2ZUBA 3ISDA 2PMZF 2E8PA 1XO0A 3WKAA 5ALJA 5C5JA 4DO9A 1U47A 4YG2A 4UAUA 4C4TA 2OM6A 4JV0A 4JV2A 1B4FA 3MR3A 2IOHA 1JXEA 2JGAA 4RT2A 3KTQA 9ICLA 4P0QA 4J9OA 3OSNA 4B9SA 3QZ8A 3ICXA 4PGQA 4KN4A 3TADA 2G0AA 3TANA 2R8KA 2H3IA 1LKYA 2OH2A 2BPCA 2FI1A 5HR6A 2ZIXA 4R65A 2DWQA 5ALSA 3D2NA 2P6RA 3ZDCA 2W3RA 4UBCA 4A8EA 1RQLA 5KNIA 2KVSA 5DGAA 2HBKA 9ICOA 1QSYA 4GIBA 1S97A 5ALDA 3KBBA 2CXYA 4PHAA 3T5HA 4TUQA 5HHIA 2HBJA 3BJYA 2MA1A 3MR5A 4I2GA 3NS1A 2K8CB 4EEYA 5KFGA 1UPHA 2ZTCA 1SZPA 4RPZA 4M2YA 2WTFA 2Y9UA 5HR7A 3C23A 2WAQC 3V7LA 1NKBA 2ZXIA 1N62A 1S9FA 1HUOA 2KD1A 4RQ3A 2OWOA 3PNCA 1SIJA 3V7JA 2JV3A 5KFSA 4KLUA 3GV8B 4I2IA 1ED1A 2CRXA 5D49A 2EANA 2I5HA 2XC9A 2ZIVB 1L7OA 1X9XA 2BGWA 3KD3A 4QIWF 5KFCA 3PO5A 3RH5A 3UMGA 2W7PA 4M47A 3KHRA 3V7KA 5KFWA 4RU9A 4IQUA 5EE1A 1A6SA 4M0AA 5CP2A 1XO1A 8ICHA 4NXZA 4C7YA 1L7MA 1XS9D 1ZQKA 2JEFA 1XWLA 2ZIWB 1ZETA 2XCPA 2KKVA 1BPBA 4ECTA 4R64A 4PHEA 3M9MB 4E0DA 8ICTA 4P4MA 4AYBC 3D2SA 1IV8A 2E8OA 2D6FC 4G3IA 2KG5A 1T4GA 1JRPA 1ZJNA 2JEJA 1L3SA 4GXIA 5DB7A 3N4MB 3SD7A 4F3OA 1Z19A 4FFDA 4RQ0A 5KFYA 4YR3A 2F3NA 2ZIVA 4IRCA 4G9BA 5KAFU 4RQ4A 4F4KA 5TISU 4KLMA 4IQVA 4RNOA 2W04A 1SB3C 4C8MA 1NZBA 3JPTA 1RYUA 2DQNB 3N7PD 4NLCA 5IIOA 3AEVA 4RPXA 3HP6A 3Q8KA 5ALQA 5DQGA 1TAUA 9ICNA 5KFIA 5L1LA 3D6JA 4UB5A 4U6PA 1FO4A 4QZ9A 2R8IA 1TK0A 3BZCA 5AI5A 1ZQNA 2QARA 3UM9A 2K89A 2NRVA 4K4HA 4F91B 1LVHA 7ICIA 2K4PA 4BGDA 3U26A 3MDCA 3N28A 1ZQMA 4Q8FA 2F76X 4ED7A 2O6KA 5DLFA 4RUCA 4YQWA 3WK7A 5DKWA 2JHDA 4NLGA 5IILA 4K4GA 3M7DA 1NZPA 2ZUDA 4EYIB 5AM4A 1PK1B 5KFHA 1KDHA 4QZFA 1KFDA 4CF5A 4B9TA 3JPPA 2F2AB 2OHFA 3Q8MA 2E8MA 3WKEA 3PX6A 2J6UA 1ZQVA 2KICA 2W3SA 4Q45A 3LYSA 3MABA 5KFJA 5EWFA 1MSWD 2BQ3A 5KFOA 4RQMA 4UW9A 3Q8SB 2HHUA 1SV0C 1SKRA 3RB0A 1ZD5A 1ZQSA 5KL8B 5KAIU 1SXDA 2D3DA 3H0MB 5KT4A 1KRPA 3SYZA 3F5EA 1Z3EB 2IHMA 4ECUA 3H8JA 4UB2A 9ICVA 3QUCA 4ELVA 5ALKA 1T94A 3FDSA 4DL6A 3MC1A 2EZZA 2YMPA 2HOQA 4C4SA 5AK5A 2Q4TA 4LJXA 4J9PA 2ZIUB 1PK1A 5L9XA 2GH1A 5AI6A 2CPRA 4RQ8A 2R8JA 3AQFA 2UVUA 4R8UB 4FO6A 5ALIA 3RJIA 3QX7A 1V97A 1N60A 2KIVA 4F4YA 5HP4A 2IMWP 4EZ9A 1N61A 3GV5B 2KSOB 5GTHU 1J2MA 2RHFA 2YMMA 2LHTA 3GDXA 3OGUA 4QWEA 4QZEA 9ICPA 5AKJA 3M9NB 3SENA 2M0NA 4EX6A 4F71A 4ECVA 7ICUA 2ZTDA 2BDUA 4ED1A 4KLGA 2KJ8A 3SEIA 4F2RA 2XCAA 4QZBA 1Z1BA 5AKEA 3M9OB 3KZXA 4UBBA 1ZQGA 2FJ6A 2BZFA 1URJA 5DG7A 4M04A 5AM3A 4OJPA 5J2FA 5L1JA 5BOLA 4UB8U 5A0LA 1YT3A 1TAQA 1S0MA 4U7CA 3ZDEA 3RB3A 2XY6A 1UCVA 5KG6A 1NK5A 1Q3UA 1N48A 2C2DA 5HMLA 4NL9A 2WF7A 5AI0A 5J0QA 2FE9A 4ECZA 4Z6CA 4R8UA 2ASLA 3TADC 1OXJA 3EWAA 1TVAA 1UQVA 1Z1VA 5J2IA 3BS7A 3BS5B 1ZQBA 4O3SA 1X66A 3FYHA 3RJFA 1WUDA 5J2BA 3FM9A 3KHLA 1JIHA 3A0BU 1D8BA 2G06A 4KLOA 2W7OA 2KSOA 2DL0A 4UB4A 3C1ZA 2B0CA 4O3RA 4F5OA 3UMBA 1ZQYA 4NV0A 1J2NA 4MEXA 4GC6A 5KG5A 2JMGA 2JR5A 5DGBA 4NLZA 2LI6A 2Y0SC 1T3QA 3RRGA 4O3MA 8ICNA 2BHNA 1X9WA 4Y2YA 1BPDA 4IQTA 4YXMA 5IIMA 4DL2A 2W9AA 3SV3A 3NRZA 4B9MA 2JH7A 4ECYA 3LK9A 4ED6A 4XA5A 1SL0A 4UAVA 5D4BA 5ALFA 5DDMA 1L8OA 5EWEA 2LPEA 7ICHA 4BDPA 2WF6A 2A1JB 5CHGA 4UB6U 4IRKA 3L3FX 2DF4B 4Z6FA 4F4ZA 1S5LU 5KT6A 1A0PA 1KFTA 2W8KA 8ICPA 4DL5A 3EPIA 5KFRA 4IRDA 2VKQA 1MQ3A 3PY8A 4HYKA 4J9MA 3HKZF 5KT3A 2F1JA 1X42A 1SL2A 1XSLA 4YD2A 2LYAA 5DQIA 1QQ5A 2W9MA 1X6IA 2L5YA 4WJ3B 1S77D 3C21A 3SZ2A 9ICEA 2W54A 1TK5A 1ZD2P 1HJPA 3ETRA 3OJUA 4Y2RA 4DCCA 4O5CA 1CRXA 3KOOA 4DQIA 4FBUA 3CP8A 2HHQA 4RQ5A 2LBOA 4P0PB 4RZRA 4BX9C 3BQ1A 2ISOA 2F44A 4UQGA 8ICEA 2YTUA 4PJ0U 5HNKA 3NUQA 4NWIA 5EWGA 3MR2A 3HILA 2A1JA 3PVXA 2JZBB 4UAYA 3UXNA 3E58A 3QU4A 4XQ8A 4DOAA 2F1HA 3OSPA 1DGJA 1V85A 5F3XB 2C28A 4QZ8A 5EE9A 1WWUA 1Y88A 3EUB2 1RZTA 4EBCA 2CN1A 1NJZA 3KHGA 1DK3A 4DQQA 2BPGA 4TUPA 2D8CA 2ZJ8A 4KX3A 2KJ9A 5AKHA 4US8A 4OJ6A 3EZ5A 3PMLA 2B6GA 1RM6C 3HRDD 8ICZA 3KKAA 4Y2UA 1S0VA 4O3NA 2ASJA 4KLFA 3UQ0A 3GILA 4NY8A 1NI3A 2I9GA 3F53A 1KBUA 2E3TA 4OJLA 3C2LA 1KEJA 2YQEA 1UHUA 3C29A 4B9VA 2KZMA 8ICWA 4J9NA 4P0PA 5ALOA 3ZI4A 4Q43A 2KK0A 1ZQFA 4DL7A 2BKEA 1EXNA 3V6KA 1JUDA 4DFMA 5ALVA 4NLKA 3K1RB 4DSEA 4Y2JA 5CWRA 2E5SA 2GLEA 4J9QA 4Y2PA 3BZKA 3PX0A 3PR5B 1QQ7A 5CRXA 3HT3A 1JALA 1SWWA 1TE2A 2E1FA 4I2DA 5ALZA 1JROA 5H2FU 2FLPA 4TUSA 1RG6A 3HW8A 2JH1A 1RQNA 3PR4A 4QW9A 2NO4A 2Y1IA 3IM1A 4Y2XA 2HW3A 9ICIA 3ZDBA 1ZJMA 2VANA 3IDWA 4MFCA 2BCVA 2GWSA 2Y9TA 2AXTU 1ZOLA 3THVA 1WG8A 9ICWA 1NKCA 5KG1A 5IINA 3WK8A 5KT7A 2NO5A 1D8LA 3A0HU 3PW4A 4C0ZA 2ZXHA 4I2JA 4YP3A 4F5QA 9ICHA 4KITB 1UT8A 1BPEA 5DQHA 2AGPA 1Q46A 3OHBA 1U48A 2ALZA 3I1YA 4OCZA 4CNQA 2W8LA 5K4LA 4B9LA 3T5LA 4DLGA 3RFAA 2HHVA 2OYYA 2OEHA 3L5KA 1PVRA 5AKYA 4FBTA 5J8YA 2FDRA 2QB1A 2HI0A 2HSZA 3PO4A 1NK4A 7ICEA 4O5KA 5KFVA 4UASA 7ICSA 2G5IB 5J2KA 5G5GA 4I27A 4KN7A 9ICMA 1BNOA 3M8SA 4F4XA 2MUTB 4MFFA 2AGQA 4FS2A 3TARA 1NKEA 5KFTA 8ICUA 5DB8A 3ETLA 4GC7A 4KMOB 1KQQA 1PVPA 4DEZA 5HHHA 2KZ3A 5ALEA 2ES6A 3WU2U 2RP5A 3HX0A 5G5HA 4F92B 4QZIA 3SAHA 5J29A 2I1QA 4Z6DA 2VA2A 3GFKB 2J6TA 2H3FA 3RJHA 1Z00B 4I28A 1ZQ1C 4FS1A 4ECRA 9ICBA 4GXJA 4BWMA 3SR6A 4RT3A 5J0RA 1KN5A 2K8AA 1TV9A 8ICQA 7ICLA 2FLNA 3T5JA 3K1ZA 8ICCA 2BDPA 5EE0A 2BCRA 4ED2A 4NL9C 3ALRA 1FFVA 2V4QA 1F5SA 3SQIA 1ZQDA 3TFSA 5E79U 3PZPA 4XRHA 4TURA 2MUTA 1MQ2A 3PSFA 4C80A 3F2BA 5J2CA 3T79A 1DK2A 2WAQF 4DSLA 2A3VA 4QWBA 4RNMA 1B43A 1T7PA 2FPMA 1SV4A 2FPLA 3MGIA 3RR7A 2RDJA 2DKXA 1X40A 1OUQA 5KTQA 3WK4A 3JPOA 2HVHA 2ZIWA 3UXPA 2W43A 5BOMA 4PH5A 4AP9A 4YMNA 4RNNA 4PGXA 2KTQA 1Z00A 2AQ0A 1L3TA 3GIIA 3QU7A 2DUYA 5KFEA 2A19A 2OCEA 2G09A 4GFJA 5JUMA 3KZIU 2HBMA 1RXWA 1ZQUA 3C5FA 4RQ7A 8ICMA 9ICAA 2YY6A 2F8LA 1SL1A 3HWTA 2FMQA 5ALNA 3ZDDA 1S76D 3MBYA 4CRXA 3SV4A 5GTIU 1IG6A 3PW0A 1NK9A 5BPCA 3AU6A 1COOA 1AROP 3GIMA 1D9DA 3UMCA 3LVWA 4C8NA 5AI9A 5AKKA 3UXOA 2C2RA 3LWLA 1BNPA 2LM4A 5JRTA 5CJ7A 3E2EA 4DFKA 1ZD4A 4TQRA 3QZ7A 1U4BA 4EX7A 2KOBA 2PFPA 4CDGA 1U45A 8ICKA 2VIXA 1T3NA 3I28A 4Q44A 4RQ6A 3TAPA 1N56A 5ALMA 5AM5A 9ICRA 4P2HA 4M6WB 1RYRA 9ICUA 3GU3A 3QEAZ 2YB4A 3UQ2A 4IR9A 4Y2QA 4MFAA 4I29A 4KLQA 1WCLA 4BWJA 2ASDA 2F77X 5KFZA 2P6UA 4DL3A 8ICBA 3GIJA 4QW8A 4LZDA 2LYBA 2ZJAA 2NRZA 1AQ6A 4CCHA 3RTVA 3OJSA 1Z4OA 5DB9A 2HCFA 2NRXA 2HHXA 1S10A 5AKIA 4LZGA 5AM1A 3C1YA 3SAFA 2PI5A 1SKWA 4ELTA 2ZUCA 2NYVA 1PK3A 1ZQXA 3NTUA 5AHXA 5DBCA 3IRUA 4ECXA 3RRHA 3KKAC 4RUAA 7ICGA 1RXVA 4Y2VA 4ELUA 4Y2SA 1SWVA 3ORYA 4ED3A 2WHEA 2W03A 2BQRA 1UA1A 4M6WA 4ECQA 4F2SA 2H3QA 4I2BA 2KIWA 1RDFA 3ZDAA 4C8KA 3QUBA 1NK6A 2Q0ZX 1N5WA 2LMRA 4C8LA 1ECWA 2ZIUA 4KLDA 3L4PA 1V9PA 5AK6A 1P7DA 2EAOA 1N2XA 4IR1A 4EZ6A 3HKZC 4CE6A 3AUOA 4M9NA 2AGOA 2DBYA 3QU5A 4USAA 5AM0A 3RB4A 2HMXA 2KE7A 2KZZA 3NVZA 4EEKA 4PGYA 2BR0A 2PXIA 4QZAA 4B9NA 1F44A 5KG2A 4F4WA 5DG8A 4CF4A 7ICVA 1B0XA 3WK9A 7ICPA 1ZQCA 3N7SC 2RDIA 2R8GA 2WF5A 2ZJ5A 2AHOB 1S0NA 2OXOA 2JRZA 1VLBA 2DKZA 4JB3A 5KG3A 4B9UA 4XUSA 4C4RA 3F2DA 2WFAA 1HUZA 1JMSA 4EBDA 4IL6U 4DFPA 3PV8A 5KT5A 2VJ5A 3FAHA 1YZ6A 1YZ7A 2W11A 1FIQA 2WB1F 3IG8A 4KLHA 4DS4A 2BCQA 4JMUA 1O08A 1ZQWA 1NNLA 4Q8EA 5ALTA 2LKYA 1B22A 3TI0A 1NK0A 5B5EU 3MGHA 1KSPA 3NVWA 2BCUA 3DDHA 4ZH4A 5KT2A 3CRXA 4EELA 3T3FA 2ZG6A 3PW2A 7ICJA 3BS5A 5AKZA 5J8YC 2J6SA 4FE3A 5AI8A 4IS7A 1KFSA 4KLLA 4NLNA 4TQSA 9ICJA 2ATLA 2PMZC 2HHTA 5HMMA 2XGPA 1QH9A 1XNSA 1PZNA 3OHAA 4OD0A 1QCKA 1KL9A 1S8OA 8ICRA 5AKGA 1Q3VA 4ZOHC 3H8WA 1RPLA 5D46A 2W9BB 3LDAA 4EBEA 2F1IA 4F50A 5ALPA 1JI7A 8ICSA 2XVTA 3IP4B 4UB3A 3BQ2A 2JEIA 2PFQA 4GLXA 4I2EA 2AQ4A 1SXEA 2PKEA 1NJYA 2MU2A 3IN5A 3NRWA 4KTQA 1HEKA 2K4IA 2KNJA 1NJXA 3WK6A 3N97B 1MC8A 4F72A 5AK3A 2P66A 3FC4A 4CF3A 3RJEA 4OJOA 5KFNA 1TFRA 1WWVA 3H0RB 1BGXT 3AMZA 1OW5A 1N5XA 5KFPA 3TQ1A 1X9SA 3SI8A 4O3PA 5JU5A 1SZHA 3C2MA 4CGZA 1RYSA 2RRDA 1L7NA 3PW7A 5JTIA 4DFDA 2YMQA 2W9BA 4DOCA 1K5OA 3WKBA 5CA7A 3QE9Y 4EENA 1IXRA 3MR6A 3GQCA 4J9RA 4DLEA 1DXSA 1VJ5A 4DQSA 1XC9A 2B21A 4B6JA 8ICVA 2MSNA 2JZBA 1NJWA 2MRLA 4M9GA 2WF9A 2JEGA 1JN3A 2KMDA 2W55A 4QIWC 5KFAA 2F8KA 3G6XA 5J2JA 3CW2C 5J2HA 3AL0B 3K75D 1MN8A 4YR0A 2AH5A 1FEZA 4FZNA 5ALXA 2PFOA 1LV5A 2YB1A 4UAZA 3JPSA 4QZHA 3MGVA 3LWMA 1NK7A 4LVSA 3J81j 4GXKA 1TKDA 5ALLA 5KFKA 2KVCA 2XY5A 4DS5A 2PI4A 5CB1A 3K4GA 3N7RC 4YD1A 5ALYA 2UVWA 3BQTA 2XIDA 3F5AA 1VDVA 5L1IA 2R8HA 1ZRNA 2ZTEA 5KG0A 5KFUA 1ZQQA 3IV6A 3IHQB 4JK1A 2C22A 4MF8A 1JX4A 4P4OA 1D8YA 8ICAA 4JWNA 1TK8A 2UVVA 1H38A 1X9MA 1JXLA 4KLIA 4KX5A 2V4RA 7ICNA 3JPNA 1ZQHA 4YCXA 2EH9A 2QB0B 7ICTA 1ZQAA 5AM2A 2DGZA 5DLGA 4QWDA 3V6JA 3CNHA 3G6VA 5KFFA 3NVYA 1U49A 1CUKA 3WKDA 4M9LA 4DSKA 3H40A 3LVVA 3C5GA 3EW9A 1UT5A 3QU9A 1C20A 2W9CB 2HOFA 3RH6A 5F9LA 5DG9A 1XSNA 3JPQA 4PPXA 3DEEA 1NK8A 3RJKA 2G08A 5KG4A 5J0YA 1K1SA 1ZQZA 1Z4NA 4NLBA 5J0XA 4ECWA 4FZMA 3H7IA 4J9SA 2HHSA 2KKPA 4DOBA 5KL1B 5KFDA 4QJFB 1DRGA 7ICFA 2EAPA 4OJ5A 1QTMA 2HVIA 4ED0A 4DSFA 4M9HA 9ICTA 2PFNA 5EOZA 4QWAA 1ZQJA 1BPZA 5ALWA 2WF8A 3IG5A 1QLNA 3TKAA 2EDUA 3RH4A 3QU2A 2QB0A 2KV2A 5EE3A 4MEYA 4DQPA 2E1EA 2QARB 3OTQA 1ZQLA 2K4EA 3R9KA 4PHPA 4QZGA 4EYHB 1LB2B 1XSPA 2UVRA 2K60A 3VC8A 4YR2A 1C7YA 4J9KA 4KMUA 4KLJA 2W9CA 3RR8A 4O0IA 4I2CA 2KP7A 3MDAA 1ZQPA 8ICJA 1KW4A 2E8NA 5IIKA 1J97A 4MHVA 8ICFA 4R63A 3EYZA 2H3VA 2YN4A 4J9LA 3O0FA 4ACOA 1L3UA 3QEBZ 5B66U 2LM1A 5J2GA 2BPFA 4UATA 9ICKA 2EZYA 2VA3A 4DFJA 3QYPA 4Z6EA 4P4PA 3H8SA 2GOLA 4J03A 1N63A 3V6HA 2BCSA 2QKQA 5DB6A 3B0XA 4BXOB 1MA7A 3UPQA 1A77A 3PW5A 1L7PA 4I2FA 1ZD3A 4O3QA 2FLLA 8ICLA 2IOFK 2KEYA 3WK5A 5IIIA 3RJGA 3KFUF 2H5XA 4RQ2A 2VA8A 4FZLA 3S6JA 9ICXA 4JUZA 4IQWA 3Q8QB 4DSJA 1KKXA 1CEZA 1F0MA 4AYBF 2Z7JA 4F93B
chains in the Genus database with same CATH topology
1KN5A 2YQEA 2CXYA 2RQ5A 4LJXA 2JRZA 1RYUA 2LI6A 2KK0A 1IG6A 5K4LA 1C20A 2EQYA 5CEHA 2OEHA 2EH9A 1KKXA 2LM1A 1KQQA 2JXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  2YQE A;  2CXY A;  2RQ5 A;  4LJX A;  2JRZ A;  1RYU A;  2LI6 A;  2KK0 A;  1IG6 A;  5K4L A;  1C20 A;  2EQY A;  5CEH A;  2OEH A;  2EH9 A;  1KKX A;  2LM1 A;  1KQQ A;  2JXJ A; 
#chains in the Genus database with same CATH topology
 5KFM A;  1ZQT A;  1M6Y A;  1PVQ A;  4I2A A;  5KFB A;  4PZO A;  2HHW A;  2XIC A;  3B0Y A;  2K8B B;  1UA0 A;  7ICK A;  3Q8R B;  3RBE A;  3B9J A;  4BJQ A;  3TFR A;  4YFK A;  4UAW A;  4YN4 A;  1L8L A;  3AU2 A;  4BXO A;  4DSI A;  3M8R A;  3GIK A;  8ICO A;  5AKL A;  3G6Y A;  2FMP A;  4PL1 A;  4YVZ A;  3ISB A;  5T14 A;  4YXJ A;  4IC9 A;  2NV3 A;  3Q8P B;  2N1R A;  5CEH A;  4RQ1 A;  4YMO A;  1HIW A;  2DFL A;  3RJJ A;  3T5K A;  3M6Z A;  8ICX A;  9ICF A;  3AM9 A;  5J2D A;  3RB6 A;  2BQU A;  5C0Y A;  4RQN A;  3SAG A;  1DOQ A;  4KLE A;  3M1Y A;  3C2K A;  5J2E A;  1SGG A;  2YX8 A;  4QWC A;  1T8E A;  3QNM A;  4KLS A;  4X5V A;  4DQR A;  2MAX A;  5J0P A;  3H4D A;  2WB1 C;  1WYG A;  4O5E A;  4HAI A;  2I6X A;  1BPY A;  4UB1 A;  4K4I A;  5J0U A;  2G07 A;  3D2Q A;  5IIJ A;  3I76 A;  1QSS A;  2RQ5 A;  1L6N A;  3H0L B;  5AKX A;  8ICY A;  4PHD A;  1S0O A;  4US9 A;  2XI9 A;  5ALU A;  3RBD A;  1KTQ A;  4OO1 J;  4ED8 A;  2XO7 A;  2P35 A;  3TAQ A;  2GO7 A;  3ZD8 A;  2ESE A;  2A1A A;  3BQ7 A;  1V38 A;  3NVV A;  5J2A A;  3PX4 A;  5DBA A;  5TZV A;  3MFI A;  3C28 A;  3GV7 B;  1QQ6 A;  5J0W A;  5KFQ A;  1O03 A;  4KLT A;  1ZQO A;  1ZQI A;  2NRW A;  3ISC A;  3MFH A;  2RLT A;  1X2I A;  1GO3 F;  1QSL A;  2FMS A;  4QZC A;  4C7Z A;  1L3V A;  3ONN A;  9ICS A;  5AIB A;  2IA6 A;  3V72 A;  1BPX A;  2AU0 A;  3JPR A;  1TAM A;  3WKC A;  5DDY A;  1L5U A;  3E0F A;  1D9F A;  5J0S A;  4UAR A;  4C8O A;  3PMN A;  8ICI A;  1FFU A;  2G5H B;  2FPK A;  2KFZ A;  3SMV A;  2IBK A;  2KHV A;  4R66 A;  5FP0 A;  3OPX A;  3ED5 A;  2KN7 A;  2EZX A;  1BVS A;  2YML A;  3QUQ A;  5J0T A;  3RAQ A;  8ICG A;  4YMM A;  4I2H A;  2HBL A;  2XGQ A;  5KFL A;  5AIA A;  5KFX A;  7ICM A;  2Y1J A;  3EPG A;  5ALH A;  4Y2T A;  3VCB A;  2IHN A;  3BDP A;  1SKS A;  3PST A;  2M9N A;  3BQ0 A;  4ICA A;  3PSP A;  3Q8L A;  1KLN A;  3RF9 A;  2H3Z A;  5L1M A;  5ALR A;  1ZQR A;  4QZD A;  1X6J A;  4BUG A;  3H4B A;  4DF4 A;  7ICR A;  5KG7 A;  2DPI A;  1ZQE A;  1Q8K A;  1ZXI A;  2XY7 A;  2LYH A;  4JV1 A;  5DBB A;  9ICC A;  1PUZ A;  7ICQ A;  4PZN A;  4NM1 A;  3RAX A;  1ZRM A;  1K1Q A;  5AIC A;  3TAC B;  4DF8 A;  1A76 A;  1DGS A;  1SV0 A;  3NAS A;  1XU4 A;  2HOI A;  4MF2 A;  2VJ4 A;  2ISP A;  2K4H A;  3KHH A;  3HJE A;  2KJ5 A;  9ICQ A;  3QUT A;  5CR0 A;  4F5R A;  1COK A;  4O9M A;  4DL4 A;  4ECS A;  4F5N A;  4O3O A;  1CI4 A;  1U9L A;  2V9W A;  2KFN A;  2R18 A;  2KHQ A;  4NM2 A;  2EQY A;  3DV9 A;  3PSI A;  3HPO A;  2Y0S F;  5L1K A;  5AI4 A;  9ICG A;  2NRT A;  5AK4 A;  4F5P A;  3AN1 A;  3F2C A;  3AQE A;  5F9N A;  2AJQ A;  1IIP A;  3H8M A;  4P0Q B;  1IM4 A;  3CYM A;  1ZYQ A;  5ALG A;  2EAM A;  4F8R A;  4M9J A;  3ZD9 A;  1LKY B;  2ZIX B;  2C2E A;  2JXJ A;  4NJ8 A;  2HDO A;  3QXG A;  4QNL A;  7ICO A;  1WCN A;  2IOF A;  4DWI A;  3NGD A;  2ODG A;  3M6K A;  4RPY A;  5J0O A;  3GZF A;  4PL2 A;  4JWM A;  2DPJ A;  2QLT A;  1NOM A;  2ZUB A;  3ISD A;  2PMZ F;  2E8P A;  1XO0 A;  3WKA A;  5ALJ A;  5C5J A;  4DO9 A;  1U47 A;  4YG2 A;  4UAU A;  4C4T A;  2OM6 A;  4JV0 A;  4JV2 A;  1B4F A;  3MR3 A;  2IOH A;  1JXE A;  2JGA A;  4RT2 A;  3KTQ A;  9ICL A;  4P0Q A;  4J9O A;  3OSN A;  4B9S A;  3QZ8 A;  3ICX A;  4PGQ A;  4KN4 A;  3TAD A;  2G0A A;  3TAN A;  2R8K A;  2H3I A;  1LKY A;  2OH2 A;  2BPC A;  2FI1 A;  5HR6 A;  2ZIX A;  4R65 A;  2DWQ A;  5ALS A;  3D2N A;  2P6R A;  3ZDC A;  2W3R A;  4UBC A;  4A8E A;  1RQL A;  5KNI A;  2KVS A;  5DGA A;  2HBK A;  9ICO A;  1QSY A;  4GIB A;  1S97 A;  5ALD A;  3KBB A;  2CXY A;  4PHA A;  3T5H A;  4TUQ A;  5HHI A;  2HBJ A;  3BJY A;  2MA1 A;  3MR5 A;  4I2G A;  3NS1 A;  2K8C B;  4EEY A;  5KFG A;  1UPH A;  2ZTC A;  1SZP A;  4RPZ A;  4M2Y A;  2WTF A;  2Y9U A;  5HR7 A;  3C23 A;  2WAQ C;  3V7L A;  1NKB A;  2ZXI A;  1N62 A;  1S9F A;  1HUO A;  2KD1 A;  4RQ3 A;  2OWO A;  3PNC A;  1SIJ A;  3V7J A;  2JV3 A;  5KFS A;  4KLU A;  3GV8 B;  4I2I A;  1ED1 A;  2CRX A;  5D49 A;  2EAN A;  2I5H A;  2XC9 A;  2ZIV B;  1L7O A;  1X9X A;  2BGW A;  3KD3 A;  4QIW F;  5KFC A;  3PO5 A;  3RH5 A;  3UMG A;  2W7P A;  4M47 A;  3KHR A;  3V7K A;  5KFW A;  4RU9 A;  4IQU A;  5EE1 A;  1A6S A;  4M0A A;  5CP2 A;  1XO1 A;  8ICH A;  4NXZ A;  4C7Y A;  1L7M A;  1XS9 D;  1ZQK A;  2JEF A;  1XWL A;  2ZIW B;  1ZET A;  2XCP A;  2KKV A;  1BPB A;  4ECT A;  4R64 A;  4PHE A;  3M9M B;  4E0D A;  8ICT A;  4P4M A;  4AYB C;  3D2S A;  1IV8 A;  2E8O A;  2D6F C;  4G3I A;  2KG5 A;  1T4G A;  1JRP A;  1ZJN A;  2JEJ A;  1L3S A;  4GXI A;  5DB7 A;  3N4M B;  3SD7 A;  4F3O A;  1Z19 A;  4FFD A;  4RQ0 A;  5KFY A;  4YR3 A;  2F3N A;  2ZIV A;  4IRC A;  4G9B A;  5KAF U;  4RQ4 A;  4F4K A;  5TIS U;  4KLM A;  4IQV A;  4RNO A;  2W04 A;  1SB3 C;  4C8M A;  1NZB A;  3JPT A;  1RYU A;  2DQN B;  3N7P D;  4NLC A;  5IIO A;  3AEV A;  4RPX A;  3HP6 A;  3Q8K A;  5ALQ A;  5DQG A;  1TAU A;  9ICN A;  5KFI A;  5L1L A;  3D6J A;  4UB5 A;  4U6P A;  1FO4 A;  4QZ9 A;  2R8I A;  1TK0 A;  3BZC A;  5AI5 A;  1ZQN A;  2QAR A;  3UM9 A;  2K89 A;  2NRV A;  4K4H A;  4F91 B;  1LVH A;  7ICI A;  2K4P A;  4BGD A;  3U26 A;  3MDC A;  3N28 A;  1ZQM A;  4Q8F A;  2F76 X;  4ED7 A;  2O6K A;  5DLF A;  4RUC A;  4YQW A;  3WK7 A;  5DKW A;  2JHD A;  4NLG A;  5IIL A;  4K4G A;  3M7D A;  1NZP A;  2ZUD A;  4EYI B;  5AM4 A;  1PK1 B;  5KFH A;  1KDH A;  4QZF A;  1KFD A;  4CF5 A;  4B9T A;  3JPP A;  2F2A B;  2OHF A;  3Q8M A;  2E8M A;  3WKE A;  3PX6 A;  2J6U A;  1ZQV A;  2KIC A;  2W3S A;  4Q45 A;  3LYS A;  3MAB A;  5KFJ A;  5EWF A;  1MSW D;  2BQ3 A;  5KFO A;  4RQM A;  4UW9 A;  3Q8S B;  2HHU A;  1SV0 C;  1SKR A;  3RB0 A;  1ZD5 A;  1ZQS A;  5KL8 B;  5KAI U;  1SXD A;  2D3D A;  3H0M B;  5KT4 A;  1KRP A;  3SYZ A;  3F5E A;  1Z3E B;  2IHM A;  4ECU A;  3H8J A;  4UB2 A;  9ICV A;  3QUC A;  4ELV A;  5ALK A;  1T94 A;  3FDS A;  4DL6 A;  3MC1 A;  2EZZ A;  2YMP A;  2HOQ A;  4C4S A;  5AK5 A;  2Q4T A;  4LJX A;  4J9P A;  2ZIU B;  1PK1 A;  5L9X A;  2GH1 A;  5AI6 A;  2CPR A;  4RQ8 A;  2R8J A;  3AQF A;  2UVU A;  4R8U B;  4FO6 A;  5ALI A;  3RJI A;  3QX7 A;  1V97 A;  1N60 A;  2KIV A;  4F4Y A;  5HP4 A;  2IMW P;  4EZ9 A;  1N61 A;  3GV5 B;  2KSO B;  5GTH U;  1J2M A;  2RHF A;  2YMM A;  2LHT A;  3GDX A;  3OGU A;  4QWE A;  4QZE A;  9ICP A;  5AKJ A;  3M9N B;  3SEN A;  2M0N A;  4EX6 A;  4F71 A;  4ECV A;  7ICU A;  2ZTD A;  2BDU A;  4ED1 A;  4KLG A;  2KJ8 A;  3SEI A;  4F2R A;  2XCA A;  4QZB A;  1Z1B A;  5AKE A;  3M9O B;  3KZX A;  4UBB A;  1ZQG A;  2FJ6 A;  2BZF A;  1URJ A;  5DG7 A;  4M04 A;  5AM3 A;  4OJP A;  5J2F A;  5L1J A;  5BOL A;  4UB8 U;  5A0L A;  1YT3 A;  1TAQ A;  1S0M A;  4U7C A;  3ZDE A;  3RB3 A;  2XY6 A;  1UCV A;  5KG6 A;  1NK5 A;  1Q3U A;  1N48 A;  2C2D A;  5HML A;  4NL9 A;  2WF7 A;  5AI0 A;  5J0Q A;  2FE9 A;  4ECZ A;  4Z6C A;  4R8U A;  2ASL A;  3TAD C;  1OXJ A;  3EWA A;  1TVA A;  1UQV A;  1Z1V A;  5J2I A;  3BS7 A;  3BS5 B;  1ZQB A;  4O3S A;  1X66 A;  3FYH A;  3RJF A;  1WUD A;  5J2B A;  3FM9 A;  3KHL A;  1JIH A;  3A0B U;  1D8B A;  2G06 A;  4KLO A;  2W7O A;  2KSO A;  2DL0 A;  4UB4 A;  3C1Z A;  2B0C A;  4O3R A;  4F5O A;  3UMB A;  1ZQY A;  4NV0 A;  1J2N A;  4MEX A;  4GC6 A;  5KG5 A;  2JMG A;  2JR5 A;  5DGB A;  4NLZ A;  2LI6 A;  2Y0S C;  1T3Q A;  3RRG A;  4O3M A;  8ICN A;  2BHN A;  1X9W A;  4Y2Y A;  1BPD A;  4IQT A;  4YXM A;  5IIM A;  4DL2 A;  2W9A A;  3SV3 A;  3NRZ A;  4B9M A;  2JH7 A;  4ECY A;  3LK9 A;  4ED6 A;  4XA5 A;  1SL0 A;  4UAV A;  5D4B A;  5ALF A;  5DDM A;  1L8O A;  5EWE A;  2LPE A;  7ICH A;  4BDP A;  2WF6 A;  2A1J B;  5CHG A;  4UB6 U;  4IRK A;  3L3F X;  2DF4 B;  4Z6F A;  4F4Z A;  1S5L U;  5KT6 A;  1A0P A;  1KFT A;  2W8K A;  8ICP A;  4DL5 A;  3EPI A;  5KFR A;  4IRD A;  2VKQ A;  1MQ3 A;  3PY8 A;  4HYK A;  4J9M A;  3HKZ F;  5KT3 A;  2F1J A;  1X42 A;  1SL2 A;  1XSL A;  4YD2 A;  2LYA A;  5DQI A;  1QQ5 A;  2W9M A;  1X6I A;  2L5Y A;  4WJ3 B;  1S77 D;  3C21 A;  3SZ2 A;  9ICE A;  2W54 A;  1TK5 A;  1ZD2 P;  1HJP A;  3ETR A;  3OJU A;  4Y2R A;  4DCC A;  4O5C A;  1CRX A;  3KOO A;  4DQI A;  4FBU A;  3CP8 A;  2HHQ A;  4RQ5 A;  2LBO A;  4P0P B;  4RZR A;  4BX9 C;  3BQ1 A;  2ISO A;  2F44 A;  4UQG A;  8ICE A;  2YTU A;  4PJ0 U;  5HNK A;  3NUQ A;  4NWI A;  5EWG A;  3MR2 A;  3HIL A;  2A1J A;  3PVX A;  2JZB B;  4UAY A;  3UXN A;  3E58 A;  3QU4 A;  4XQ8 A;  4DOA A;  2F1H A;  3OSP A;  1DGJ A;  1V85 A;  5F3X B;  2C28 A;  4QZ8 A;  5EE9 A;  1WWU A;  1Y88 A;  3EUB 2;  1RZT A;  4EBC A;  2CN1 A;  1NJZ A;  3KHG A;  1DK3 A;  4DQQ A;  2BPG A;  4TUP A;  2D8C A;  2ZJ8 A;  4KX3 A;  2KJ9 A;  5AKH A;  4US8 A;  4OJ6 A;  3EZ5 A;  3PML A;  2B6G A;  1RM6 C;  3HRD D;  8ICZ A;  3KKA A;  4Y2U A;  1S0V A;  4O3N A;  2ASJ A;  4KLF A;  3UQ0 A;  3GIL A;  4NY8 A;  1NI3 A;  2I9G A;  3F53 A;  1KBU A;  2E3T A;  4OJL A;  3C2L A;  1KEJ A;  2YQE A;  1UHU A;  3C29 A;  4B9V A;  2KZM A;  8ICW A;  4J9N A;  4P0P A;  5ALO A;  3ZI4 A;  4Q43 A;  2KK0 A;  1ZQF A;  4DL7 A;  2BKE A;  1EXN A;  3V6K A;  1JUD A;  4DFM A;  5ALV A;  4NLK A;  3K1R B;  4DSE A;  4Y2J A;  5CWR A;  2E5S A;  2GLE A;  4J9Q A;  4Y2P A;  3BZK A;  3PX0 A;  3PR5 B;  1QQ7 A;  5CRX A;  3HT3 A;  1JAL A;  1SWW A;  1TE2 A;  2E1F A;  4I2D A;  5ALZ A;  1JRO A;  5H2F U;  2FLP A;  4TUS A;  1RG6 A;  3HW8 A;  2JH1 A;  1RQN A;  3PR4 A;  4QW9 A;  2NO4 A;  2Y1I A;  3IM1 A;  4Y2X A;  2HW3 A;  9ICI A;  3ZDB A;  1ZJM A;  2VAN A;  3IDW A;  4MFC A;  2BCV A;  2GWS A;  2Y9T A;  2AXT U;  1ZOL A;  3THV A;  1WG8 A;  9ICW A;  1NKC A;  5KG1 A;  5IIN A;  3WK8 A;  5KT7 A;  2NO5 A;  1D8L A;  3A0H U;  3PW4 A;  4C0Z A;  2ZXH A;  4I2J A;  4YP3 A;  4F5Q A;  9ICH A;  4KIT B;  1UT8 A;  1BPE A;  5DQH A;  2AGP A;  1Q46 A;  3OHB A;  1U48 A;  2ALZ A;  3I1Y A;  4OCZ A;  4CNQ A;  2W8L A;  5K4L A;  4B9L A;  3T5L A;  4DLG A;  3RFA A;  2HHV A;  2OYY A;  2OEH A;  3L5K A;  1PVR A;  5AKY A;  4FBT A;  5J8Y A;  2FDR A;  2QB1 A;  2HI0 A;  2HSZ A;  3PO4 A;  1NK4 A;  7ICE A;  4O5K A;  5KFV A;  4UAS A;  7ICS A;  2G5I B;  5J2K A;  5G5G A;  4I27 A;  4KN7 A;  9ICM A;  1BNO A;  3M8S A;  4F4X A;  2MUT B;  4MFF A;  2AGQ A;  4FS2 A;  3TAR A;  1NKE A;  5KFT A;  8ICU A;  5DB8 A;  3ETL A;  4GC7 A;  4KMO B;  1KQQ A;  1PVP A;  4DEZ A;  5HHH A;  2KZ3 A;  5ALE A;  2ES6 A;  3WU2 U;  2RP5 A;  3HX0 A;  5G5H A;  4F92 B;  4QZI A;  3SAH A;  5J29 A;  2I1Q A;  4Z6D A;  2VA2 A;  3GFK B;  2J6T A;  2H3F A;  3RJH A;  1Z00 B;  4I28 A;  1ZQ1 C;  4FS1 A;  4ECR A;  9ICB A;  4GXJ A;  4BWM A;  3SR6 A;  4RT3 A;  5J0R A;  1KN5 A;  2K8A A;  1TV9 A;  8ICQ A;  7ICL A;  2FLN A;  3T5J A;  3K1Z A;  8ICC A;  2BDP A;  5EE0 A;  2BCR A;  4ED2 A;  4NL9 C;  3ALR A;  1FFV A;  2V4Q A;  1F5S A;  3SQI A;  1ZQD A;  3TFS A;  5E79 U;  3PZP A;  4XRH A;  4TUR A;  2MUT A;  1MQ2 A;  3PSF A;  4C80 A;  3F2B A;  5J2C A;  3T79 A;  1DK2 A;  2WAQ F;  4DSL A;  2A3V A;  4QWB A;  4RNM A;  1B43 A;  1T7P A;  2FPM A;  1SV4 A;  2FPL A;  3MGI A;  3RR7 A;  2RDJ A;  2DKX A;  1X40 A;  1OUQ A;  5KTQ A;  3WK4 A;  3JPO A;  2HVH A;  2ZIW A;  3UXP A;  2W43 A;  5BOM A;  4PH5 A;  4AP9 A;  4YMN A;  4RNN A;  4PGX A;  2KTQ A;  1Z00 A;  2AQ0 A;  1L3T A;  3GII A;  3QU7 A;  2DUY A;  5KFE A;  2A19 A;  2OCE A;  2G09 A;  4GFJ A;  5JUM A;  3KZI U;  2HBM A;  1RXW A;  1ZQU A;  3C5F A;  4RQ7 A;  8ICM A;  9ICA A;  2YY6 A;  2F8L A;  1SL1 A;  3HWT A;  2FMQ A;  5ALN A;  3ZDD A;  1S76 D;  3MBY A;  4CRX A;  3SV4 A;  5GTI U;  1IG6 A;  3PW0 A;  1NK9 A;  5BPC A;  3AU6 A;  1COO A;  1ARO P;  3GIM A;  1D9D A;  3UMC A;  3LVW A;  4C8N A;  5AI9 A;  5AKK A;  3UXO A;  2C2R A;  3LWL A;  1BNP A;  2LM4 A;  5JRT A;  5CJ7 A;  3E2E A;  4DFK A;  1ZD4 A;  4TQR A;  3QZ7 A;  1U4B A;  4EX7 A;  2KOB A;  2PFP A;  4CDG A;  1U45 A;  8ICK A;  2VIX A;  1T3N A;  3I28 A;  4Q44 A;  4RQ6 A;  3TAP A;  1N56 A;  5ALM A;  5AM5 A;  9ICR A;  4P2H A;  4M6W B;  1RYR A;  9ICU A;  3GU3 A;  3QEA Z;  2YB4 A;  3UQ2 A;  4IR9 A;  4Y2Q A;  4MFA A;  4I29 A;  4KLQ A;  1WCL A;  4BWJ A;  2ASD A;  2F77 X;  5KFZ A;  2P6U A;  4DL3 A;  8ICB A;  3GIJ A;  4QW8 A;  4LZD A;  2LYB A;  2ZJA A;  2NRZ A;  1AQ6 A;  4CCH A;  3RTV A;  3OJS A;  1Z4O A;  5DB9 A;  2HCF A;  2NRX A;  2HHX A;  1S10 A;  5AKI A;  4LZG A;  5AM1 A;  3C1Y A;  3SAF A;  2PI5 A;  1SKW A;  4ELT A;  2ZUC A;  2NYV A;  1PK3 A;  1ZQX A;  3NTU A;  5AHX A;  5DBC A;  3IRU A;  4ECX A;  3RRH A;  3KKA C;  4RUA A;  7ICG A;  1RXV A;  4Y2V A;  4ELU A;  4Y2S A;  1SWV A;  3ORY A;  4ED3 A;  2WHE A;  2W03 A;  2BQR A;  1UA1 A;  4M6W A;  4ECQ A;  4F2S A;  2H3Q A;  4I2B A;  2KIW A;  1RDF A;  3ZDA A;  4C8K A;  3QUB A;  1NK6 A;  2Q0Z X;  1N5W A;  2LMR A;  4C8L A;  1ECW A;  2ZIU A;  4KLD A;  3L4P A;  1V9P A;  5AK6 A;  1P7D A;  2EAO A;  1N2X A;  4IR1 A;  4EZ6 A;  3HKZ C;  4CE6 A;  3AUO A;  4M9N A;  2AGO A;  2DBY A;  3QU5 A;  4USA A;  5AM0 A;  3RB4 A;  2HMX A;  2KE7 A;  2KZZ A;  3NVZ A;  4EEK A;  4PGY A;  2BR0 A;  2PXI A;  4QZA A;  4B9N A;  1F44 A;  5KG2 A;  4F4W A;  5DG8 A;  4CF4 A;  7ICV A;  1B0X A;  3WK9 A;  7ICP A;  1ZQC A;  3N7S C;  2RDI A;  2R8G A;  2WF5 A;  2ZJ5 A;  2AHO B;  1S0N A;  2OXO A;  2JRZ A;  1VLB A;  2DKZ A;  4JB3 A;  5KG3 A;  4B9U A;  4XUS A;  4C4R A;  3F2D A;  2WFA A;  1HUZ A;  1JMS A;  4EBD A;  4IL6 U;  4DFP A;  3PV8 A;  5KT5 A;  2VJ5 A;  3FAH A;  1YZ6 A;  1YZ7 A;  2W11 A;  1FIQ A;  2WB1 F;  3IG8 A;  4KLH A;  4DS4 A;  2BCQ A;  4JMU A;  1O08 A;  1ZQW A;  1NNL A;  4Q8E A;  5ALT A;  2LKY A;  1B22 A;  3TI0 A;  1NK0 A;  5B5E U;  3MGH A;  1KSP A;  3NVW A;  2BCU A;  3DDH A;  4ZH4 A;  5KT2 A;  3CRX A;  4EEL A;  3T3F A;  2ZG6 A;  3PW2 A;  7ICJ A;  3BS5 A;  5AKZ A;  5J8Y C;  2J6S A;  4FE3 A;  5AI8 A;  4IS7 A;  1KFS A;  4KLL A;  4NLN A;  4TQS A;  9ICJ A;  2ATL A;  2PMZ C;  2HHT A;  5HMM A;  2XGP A;  1QH9 A;  1XNS A;  1PZN A;  3OHA A;  4OD0 A;  1QCK A;  1KL9 A;  1S8O A;  8ICR A;  5AKG A;  1Q3V A;  4ZOH C;  3H8W A;  1RPL A;  5D46 A;  2W9B B;  3LDA A;  4EBE A;  2F1I A;  4F50 A;  5ALP A;  1JI7 A;  8ICS A;  2XVT A;  3IP4 B;  4UB3 A;  3BQ2 A;  2JEI A;  2PFQ A;  4GLX A;  4I2E A;  2AQ4 A;  1SXE A;  2PKE A;  1NJY A;  2MU2 A;  3IN5 A;  3NRW A;  4KTQ A;  1HEK A;  2K4I A;  2KNJ A;  1NJX A;  3WK6 A;  3N97 B;  1MC8 A;  4F72 A;  5AK3 A;  2P66 A;  3FC4 A;  4CF3 A;  3RJE A;  4OJO A;  5KFN A;  1TFR A;  1WWV A;  3H0R B;  1BGX T;  3AMZ A;  1OW5 A;  1N5X A;  5KFP A;  3TQ1 A;  1X9S A;  3SI8 A;  4O3P A;  5JU5 A;  1SZH A;  3C2M A;  4CGZ A;  1RYS A;  2RRD A;  1L7N A;  3PW7 A;  5JTI A;  4DFD A;  2YMQ A;  2W9B A;  4DOC A;  1K5O A;  3WKB A;  5CA7 A;  3QE9 Y;  4EEN A;  1IXR A;  3MR6 A;  3GQC A;  4J9R A;  4DLE A;  1DXS A;  1VJ5 A;  4DQS A;  1XC9 A;  2B21 A;  4B6J A;  8ICV A;  2MSN A;  2JZB A;  1NJW A;  2MRL A;  4M9G A;  2WF9 A;  2JEG A;  1JN3 A;  2KMD A;  2W55 A;  4QIW C;  5KFA A;  2F8K A;  3G6X A;  5J2J A;  3CW2 C;  5J2H A;  3AL0 B;  3K75 D;  1MN8 A;  4YR0 A;  2AH5 A;  1FEZ A;  4FZN A;  5ALX A;  2PFO A;  1LV5 A;  2YB1 A;  4UAZ A;  3JPS A;  4QZH A;  3MGV A;  3LWM A;  1NK7 A;  4LVS A;  3J81 j;  4GXK A;  1TKD A;  5ALL A;  5KFK A;  2KVC A;  2XY5 A;  4DS5 A;  2PI4 A;  5CB1 A;  3K4G A;  3N7R C;  4YD1 A;  5ALY A;  2UVW A;  3BQT A;  2XID A;  3F5A A;  1VDV A;  5L1I A;  2R8H A;  1ZRN A;  2ZTE A;  5KG0 A;  5KFU A;  1ZQQ A;  3IV6 A;  3IHQ B;  4JK1 A;  2C22 A;  4MF8 A;  1JX4 A;  4P4O A;  1D8Y A;  8ICA A;  4JWN A;  1TK8 A;  2UVV A;  1H38 A;  1X9M A;  1JXL A;  4KLI A;  4KX5 A;  2V4R A;  7ICN A;  3JPN A;  1ZQH A;  4YCX A;  2EH9 A;  2QB0 B;  7ICT A;  1ZQA A;  5AM2 A;  2DGZ A;  5DLG A;  4QWD A;  3V6J A;  3CNH A;  3G6V A;  5KFF A;  3NVY A;  1U49 A;  1CUK A;  3WKD A;  4M9L A;  4DSK A;  3H40 A;  3LVV A;  3C5G A;  3EW9 A;  1UT5 A;  3QU9 A;  1C20 A;  2W9C B;  2HOF A;  3RH6 A;  5F9L A;  5DG9 A;  1XSN A;  3JPQ A;  4PPX A;  3DEE A;  1NK8 A;  3RJK A;  2G08 A;  5KG4 A;  5J0Y A;  1K1S A;  1ZQZ A;  1Z4N A;  4NLB A;  5J0X A;  4ECW A;  4FZM A;  3H7I A;  4J9S A;  2HHS A;  2KKP A;  4DOB A;  5KL1 B;  5KFD A;  4QJF B;  1DRG A;  7ICF A;  2EAP A;  4OJ5 A;  1QTM A;  2HVI A;  4ED0 A;  4DSF A;  4M9H A;  9ICT A;  2PFN A;  5EOZ A;  4QWA A;  1ZQJ A;  1BPZ A;  5ALW A;  2WF8 A;  3IG5 A;  1QLN A;  3TKA A;  2EDU A;  3RH4 A;  3QU2 A;  2QB0 A;  2KV2 A;  5EE3 A;  4MEY A;  4DQP A;  2E1E A;  2QAR B;  3OTQ A;  1ZQL A;  2K4E A;  3R9K A;  4PHP A;  4QZG A;  4EYH B;  1LB2 B;  1XSP A;  2UVR A;  2K60 A;  3VC8 A;  4YR2 A;  1C7Y A;  4J9K A;  4KMU A;  4KLJ A;  2W9C A;  3RR8 A;  4O0I A;  4I2C A;  2KP7 A;  3MDA A;  1ZQP A;  8ICJ A;  1KW4 A;  2E8N A;  5IIK A;  1J97 A;  4MHV A;  8ICF A;  4R63 A;  3EYZ A;  2H3V A;  2YN4 A;  4J9L A;  3O0F A;  4ACO A;  1L3U A;  3QEB Z;  5B66 U;  2LM1 A;  5J2G A;  2BPF A;  4UAT A;  9ICK A;  2EZY A;  2VA3 A;  4DFJ A;  3QYP A;  4Z6E A;  4P4P A;  3H8S A;  2GOL A;  4J03 A;  1N63 A;  3V6H A;  2BCS A;  2QKQ A;  5DB6 A;  3B0X A;  4BXO B;  1MA7 A;  3UPQ A;  1A77 A;  3PW5 A;  1L7P A;  4I2F A;  1ZD3 A;  4O3Q A;  2FLL A;  8ICL A;  2IOF K;  2KEY A;  3WK5 A;  5III A;  3RJG A;  3KFU F;  2H5X A;  4RQ2 A;  2VA8 A;  4FZL A;  3S6J A;  9ICX A;  4JUZ A;  4IQW A;  3Q8Q B;  4DSJ A;  1KKX A;  1CEZ A;  1F0M A;  4AYB F;  2Z7J A;  4F93 B; 
#chains in the Genus database with same CATH homology
 1KN5 A;  2YQE A;  2CXY A;  2RQ5 A;  4LJX A;  2JRZ A;  1RYU A;  2LI6 A;  2KK0 A;  1IG6 A;  5K4L A;  1C20 A;  2EQY A;  5CEH A;  2OEH A;  2EH9 A;  1KKX A;  2LM1 A;  1KQQ A;  2JXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...