2JRZA

Solution structure of the bright/arid domain from the human jarid1c protein.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
b'SMNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVCNTRPFDNEEKDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1C
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Backbone and sidechain 1H, 13C and 15N resonance assignments of the Bright/ARID domain from the human JARID1C (SMCX) protein.
pubmed doi rcsb
total genus 35
structure length 117
sequence length 117
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jrzA00
2YQEA 5K4LA 1KKXA 2EQYA 4LJXA 1RYUA 2JRZA 2KK0A 2JXJA 1KQQA 2RQ5A 2OEHA 1KN5A 1C20A 2CXYA 1IG6A 2LM1A 2LI6A 5CEHA 2EH9A
chains in the Genus database with same CATH superfamily
1ZQNA 5KFTA 4EZ6A 1DK2A 1D9FA 2BQUA 2YQEA 1J2NA 4UAWA 2JEFA 1QSSA 7ICMA 2KSOB 4U6PA 2AU0A 2BQRA 1S76D 5KFYA 2IMWP 2EAOA 5BOLA 1BPYA 2ZIUA 9ICGA 1H38A 2KK0A 1JROA 4Q8FA 1SZHA 2F44A 5J2CA 3M6ZA 1ZQTA 4CCHA 4NL9C 3TACB 1Z1VA 1DOQA 3PY8A 4LZDA 5KAFU 3WK6A 4KN7A 4RQ8A 4M04A 3HPOA 2HHQA 1ZJMA 4P0QB 1ZQBA 4RT2A 1IG6A 4B6JA 4QW9A 2VA3A 4Z6DA 4C8MA 4CNQA 5D49A 5ALTA 3TADC 5T14A 1WWVA 1COKA 3UMGA 4KITB 4EZ9A 2PFOA 5F9NA 5GTHU 1RXVA 3MR3A 3V6KA 1MA7A 2E8MA 1VDVA 4Y2QA 2RLTA 2CPRA 3QU4A 4GFJA 3HWTA 4NM1A 5AKGA 4P4PA 1XSNA 7ICSA 4F91B 3C23A 4RNMA 3G6YA 1L8LA 9ICBA 1D8BA 2JH7A 4K4GA 4ELTA 3ORYA 4UBBA 4TUPA 1TKDA 4I2CA 4BWMA 1IM4A 3O0FA 2YN4A 2BCVA 1J97A 1S77D 5KG4A 2F2AB 2KVCA 4EBEA 2EAMA 2HHTA 3ZDCA 4GLXA 2KTQA 2HVHA 3RH4A 3MFHA 1NJZA 4Z6FA 1Z4OA 4NLCA 3A0BU 3C2MA 4F2RA 2ZJ5A 4QZFA 3NUQA 4O0IA 4KTQA 2I9GA 5AM2A 1KDHA 4O3QA 5KFZA 1EXNA 4UB3A 5CR0A 4NXZA 4R64A 1ZOLA 3OTQA 2E8OA 1NK8A 1ZQLA 1U48A 3BQ0A 2BCRA 4ED7A 1N63A 2ZUDA 4UW9A 3SQIA 5ALEA 1NJYA 4E0DA 5AKKA 2W43A 4DFJA 1X9XA 2BKEA 3NS1A 2VA8A 1PVQA 2LKYA 2K8BB 1BGXT 5KFSA 3PSPA 2BHNA 3N7PD 1N62A 2W55A 2C22A 5AK5A 1ZQSA 4NWIA 4KLOA 3PW2A 1HIWA 2MU2A 2KFZA 1QH9A 3L5KA 9ICWA 2CRXA 2HBKA 2OM6A 5ALVA 4C4TA 4DLEA 3AU6A 8ICFA 3PV8A 4DLGA 4DOCA 3TFRA 5AKHA 3C2LA 4QZ8A 3IG8A 3WKDA 4ELVA 1M6YA 3IV6A 2LM4A 3FAHA 4PPXA 3G6XA 5J2IA 3ZDDA 3Q8KA 4P0PA 1S0OA 3KZIU 1U4BA 4U7CA 3V7JA 1ZQCA 2J6UA 1L7OA 1Z3EB 2PFNA 3H0LB 3I28A 3Q8PB 3PW4A 1ZQVA 3IHQB 4QIWC 1HUZA 3KOOA 2HW3A 4NL9A 2ZIXB 4MF2A 2QB0A 4KLLA 4J9QA 5AICA 2AQ0A 2FI1A 4YP3A 1WCLA 2H3ZA 2DL0A 4RQ1A 2Y1IA 1IV8A 2BR0A 4K4IA 3THVA 2YMQA 4ICAA 3SD7A 5JRTA 2W9BB 8ICQA 4M6WB 5ALJA 4IL6U 2UVRA 3F53A 2ESEA 5KFFA 1CEZA 2KIVA 1JRPA 1XWLA 2Y0SC 4EYIB 4JV2A 2G08A 4EENA 3KTQA 3AN1A 3KFUF 8ICRA 2XI9A 3ED5A 4I2GA 1ZQMA 5AM1A 1ZQHA 3HJEA 2KJ5A 3ISDA 4DOAA 4NLZA 3AL0B 3T5LA 2EH9A 4B9NA 1RPLA 4NY8A 1VJ5A 3RBEA 1KKXA 3V7LA 2BGWA 2KJ9A 4R8UB 2JZBA 1MSWD 1L8OA 2K4HA 4CE6A 5DG8A 4ECZA 1T4GA 2QARA 1ZQYA 5DGAA 1SL1A 3TFSA 2G5IB 4PHPA 2OXOA 3ISBA 3JPTA 8ICWA 5AI9A 2E8PA 3QXGA 1TK0A 3PMNA 4RNOA 5BOMA 3BS5A 1S97A 2F1HA 1NKBA 4R66A 2ZTDA 4ED6A 1ZQRA 3M6KA 2HMXA 3RH5A 2FMPA 4K4HA 5HMMA 4RZRA 4PL2A 4UARA 5ALOA 3QX7A 1N60A 4X5VA 1SKRA 3MGVA 4DF8A 2FMQA 5DQHA 2V4QA 5J0RA 5DLGA 2JEGA 1Z4NA 4C8KA 3D6JA 1SZPA 3IG5A 2E8NA 2ZIUB 2R8KA 2UVVA 5L9XA 4ZOHC 4DQPA 5ALLA 1DGJA 3DDHA 5ALNA 5IIKA 1ZD2P 1AQ6A 2IOFA 2XY6A 4O5KA 2ASDA 2NRVA 1JALA 1BVSA 2CN1A 2W3SA 1QSYA 3GU3A 3GIIA 8ICKA 1PZNA 9ICSA 4RQ6A 4QWCA 4IC9A 5AHXA 4RQ3A 4ZH4A 3FYHA 1V9PA 4IRDA 4Q43A 2ZIWA 4P4OA 3PMLA 2B6GA 4DSEA 1S9FA 1ZQEA 2UVUA 4KLTA 3ICXA 5J0YA 1N5WA 1WCNA 3PR5B 4I27A 2W03A 4DQSA 1U49A 2OHFA 2W9AA 1X6IA 3JPQA 5DKWA 4PHDA 3WK8A 2HOFA 2D3DA 3VC8A 4UB2A 2VKQA 3NGDA 1C20A 5HR6A 3HT3A 5AKXA 8ICOA 3OPXA 3UMCA 3ONNA 1UHUA 2F8LA 5ALYA 3HKZF 2ZJAA 1JMSA 4KLIA 3QUQA 3LK9A 2HVIA 4OJ6A 5KT3A 1DGSA 2IOFK 4PHAA 3GZFA 2E1FA 4KLQA 5B66U 2ZJ8A 2KIWA 8ICCA 1SGGA 2GWSA 2XCAA 1KW4A 4YN4A 4YVZA 4LJXA 1KFTA 4ECTA 4XA5A 3H0MB 4G3IA 2HBJA 5G5HA 5DQGA 3TAQA 4I2IA 3H4BA 4HAIA 1XC9A 2N1RA 3MBYA 3RJEA 5TISU 4US9A 4PGXA 3FC4A 4QIWF 3TKAA 4DL2A 2W54A 3J81j 2HHSA 3ZD9A 1L3SA 2WAQC 2HI0A 5J2GA 3GILA 5H2FU 4M9NA 3MR6A 2HOIA 4UB5A 4GIBA 5KFGA 3RH6A 1UA1A 4QW8A 4YFKA 1KSPA 2DFLA 5L1KA 4OJ5A 3RB0A 2A1JA 4BJQA 5KFWA 2ISPA 4IQWA 3JPRA 1BPZA 1V38A 8ICAA 4IR9A 3SAGA 5IIJA 4BWJA 1WWUA 3WKCA 4GC7A 2WF9A 1TE2A 4KN4A 4AYBF 3M9NB 2W3RA 1NK9A 4JK1A 5ALFA 5AKZA 1ZQAA 5J0UA 3M9MB 2W7OA 4DS4A 5KFHA 3RR8A 4RNNA 2XGQA 3OSNA 3SZ2A 1JIHA 4F2SA 4F4KA 1NI3A 4EBDA 2NRTA 3H4DA 5KFQA 4O5EA 2G09A 2A19A 4F5QA 1D8YA 4O3RA 1LV5A 1GO3F 3NASA 7ICEA 7ICNA 1XO0A 4QZEA 4F72A 3LWLA 4EYHB 4KLHA 4JWMA 2AGOA 2O6KA 4QWAA 2JEJA 2XO7A 3I76A 1S10A 4DOBA 1NKCA 8ICUA 4FBTA 4DSJA 4DFDA 4FE3A 5DLFA 4KLDA 5DB9A 2A3VA 5AI6A 5GTIU 5DBAA 3AM9A 1ZQGA 1A0PA 4BDPA 1N48A 4QZIA 4Q44A 2HBMA 3UQ2A 5ALZA 4GXJA 8ICBA 3WK5A 3UXPA 2KKVA 3PSFA 2FPMA 2F3NA 4CRXA 2PKEA 1XNSA 1ZQIA 1NK4A 3B0YA 1LKYB 4TUSA 7ICJA 2A1AA 4KLEA 4J9LA 3K1RB 1SWWA 4DQRA 4GXIA 3Q8SB 2R8GA 1AROP 5HMLA 1JXEA 4DCCA 2BPFA 4Y2XA 1ZYQA 3EYZA 1T94A 3V72A 5ALXA 3L4PA 3E0FA 4M47A 5A0LA 5IIIA 1S8OA 4RU9A 3NVVA 1COOA 3BQ2A 2KZZA 3MDCA 1RQNA 2KE7A 3UXOA 1TAUA 1V97A 4I2JA 5KT5A 4RQ0A 3MGIA 5DG9A 2BCUA 5G5GA 4QZAA 3EZ5A 4MFAA 4DEZA 2BCQA 1TFRA 4Z6EA 5DQIA 7ICHA 5C0YA 7ICKA 2XIDA 5J0PA 4DSLA 4QZDA 4UAVA 4ECYA 5IILA 1N56A 4CF4A 3RJGA 3IP4B 5KFBA 2MA1A 2ZXHA 4FO6A 8ICVA 3RB3A 2IA6A 2ZIWB 2GH1A 1KFDA 1RZTA 7ICUA 1D9DA 8ICPA 3PNCA 2DPIA 4C80A 4F93B 5DBCA 5ALGA 1B22A 3PO4A 5KFPA 4DO9A 4DL3A 3T5KA 5KT7A 2PMZF 4FFDA 4OCZA 2ES6A 4F8RA 5JU5A 1BNOA 2DGZA 2OCEA 5KG3A 3Q8RB 1UCVA 5CA7A 2H3IA 4JMUA 5ALIA 5KL1B 2ZUCA 5KG1A 4FS1A 4UBCA 2K4IA 3PX6A 1XU4A 3M8RA 4J9RA 3ETRA 3H40A 2BCSA 4YR2A 7ICIA 9ICQA 3MR5A 8ICIA 1KRPA 2LI6A 2BDPA 1IXRA 1LB2B 2KSOA 4C4SA 1QQ7A 2AH5A 2QLTA 7ICGA 1Q8KA 4UATA 1NK0A 3EPIA 4C4RA 1BPEA 1NK7A 4LVSA 5J2AA 1U47A 3UMBA 4P4MA 4I2EA 4YMMA 4M9GA 2DPJA 1Y88A 2YTUA 1B43A 3WKEA 3BQ7A 1TAMA 2LYAA 4IQTA 1X42A 2W9CB 5KG0A 2Y1JA 3GIMA 3AU2A 1OW5A 3E58A 1DK3A 4O3OA 4IRKA 3H8JA 2F8KA 1NNLA 2HOQA 2YMLA 7ICRA 1NK6A 2EAPA 4NJ8A 1K1QA 4DL7A 1OXJA 1Q46A 1UT5A 9ICKA 4RQ5A 3UPQA 2WAQF 3IM1A 4IS7A 5ALRA 4DL4A 1QTMA 4C0ZA 4B9MA 9ICLA 4EX6A 4EX7A 5EE0A 2XGPA 2G5HB 2W8KA 1C7YA 2JRZA 3MC1A 3OJSA 1T8EA 4M9JA 3HX0A 4USAA 3RF9A 3QEAZ 2W04A 1Q3VA 3KHHA 3PX4A 3WKAA 2WF5A 9ICJA 1SB3C 2YMMA 3C21A 9ICAA 5EWFA 8ICNA 4IR1A 5IIOA 8ICXA 1PK3A 3AUOA 3E2EA 4R63A 2C28A 1ED1A 5CB1A 4RQ2A 2FE9A 5KL8B 5CJ7A 3PX0A 2HHWA 3KHLA 2EZYA 4RPZA 3PO5A 3SENA 3T5HA 3B9JA 3HILA 1SXEA 2P66A 3H8SA 2QB0B 2EANA 5AI4A 2BPGA 3OHAA 4CDGA 2QKQA 4RQ7A 2IBKA 4PL1A 4QZBA 2ZIVB 9ICRA 1X9WA 1A6SA 1BNPA 9ICEA 3C28A 2DF4B 4AYBC 4OO1J 3V6HA 5AK3A 2AXTU 2HBLA 1ZQOA 2OYYA 4Y2VA 4UB6U 1V85A 3SAHA 4QZCA 2I1QA 5AI8A 1N61A 1HEKA 5IIMA 1NK5A 1A76A 4Y2PA 9ICHA 3IRUA 4RPXA 4BXOA 5ALHA 1JI7A 3T3FA 9ICMA 3CW2C 4UAZA 2WF6A 4B9SA 2ZIXA 2XY5A 2HDOA 3IN5A 1RM6C 3M9OB 2LMRA 3GV7B 5J0OA 4ECWA 2B0CA 2XC9A 1KEJA 2R8IA 4QJFB 1KN5A 2F1IA 1KBUA 5FP0A 5DDYA 3QZ7A 5D4BA 1XSLA 2B21A 4KLFA 3N97B 3AQFA 1ZQPA 2KKPA 5ALDA 5KFAA 4EELA 3GQCA 5L1JA 1RYUA 4DL6A 3CNHA 4YCXA 4US8A 5KFNA 4I28A 4Y2UA 1XS9D 4BUGA 1TV9A 1XSPA 4MF8A 3GV5B 2FPLA 1KLNA 4RUAA 4RQMA 2FMSA 2W7PA 2MUTB 3LVWA 3C5GA 3RJHA 3PSIA 3RRHA 7ICTA 1LKYA 3C2KA 5KFMA 1SIJA 4MEYA 4ED3A 4P0PB 3QU5A 4ED0A 2EQYA 3BZCA 4ECUA 2RP5A 2YMPA 2CXYA 1X9SA 3C1ZA 2KD1A 3PVXA 5JTIA 4RQ4A 1LVHA 2JV3A 2JMGA 1PUZA 1Z19A 9ICFA 2LHTA 5CHGA 1YZ6A 1ZQKA 1SKSA 5EWEA 2BZFA 2YB4A 2C2EA 4F4YA 2D6FC 3HKZC 2IOHA 3HP6A 4KLJA 4YR3A 1IIPA 2DBYA 4I2HA 5KNIA 1ZD3A 4NM2A 2NRWA 5KFLA 5DB8A 2KN7A 3RTVA 1O03A 5DGBA 2H3QA 1KFSA 2K89A 1ZQZA 1U9LA 4NLBA 3NRZA 8ICGA 2FJ6A 2EZXA 4XRHA 2VA2A 8ICTA 4RQNA 2FLLA 2K8CB 1JXLA 4M9LA 2HHUA 1PVRA 4J9KA 3KBBA 1MN8A 5L1MA 1TAQA 3CP8A 4GXKA 2ATLA 1JX4A 4ED2A 2YX8A 3RAXA 3TI0A 2YY6A 3N4MB 2JZBB 4FZMA 2ASJA 2IHMA 1T7PA 1SWVA 4B9UA 3TANA 5HP4A 2PFQA 4PZNA 5F9LA 1UT8A 4QNLA 4QZ9A 4Q45A 5AK6A 1ZJNA 4JUZA 4JWNA 3ALRA 2DKZA 1K5OA 3JPSA 4ECXA 1RG6A 3G6VA 1NJWA 2PI4A 2KOBA 3WKBA 2WF7A 1N5XA 4F71A 4OD0A 3KHGA 9ICVA 4O9MA 4I2BA 5J2DA 2RDJA 5AIBA 2A1JB 3RJIA 1CRXA 4DQIA 4KLUA 1ZQQA 2EZZA 1Z1BA 2PFPA 4UB4A 2ZUBA 1XO1A 1WG8A 5L1IA 2DUYA 4FZNA 3TARA 4C8LA 1QLNA 4ELUA 2E5SA 3BQ1A 2PXIA 4C8NA 1ECWA 4O3PA 2K4PA 1DXSA 1SL2A 4C8OA 4M9HA 3N7RC 2QB1A 9ICOA 4PZOA 4J9NA 3ETLA 1O08A 3KKAA 3CRXA 2HHVA 4Z6CA 3UQ0A 2Y9TA 4F5OA 2WTFA 3WU2U 3NRWA 5AM0A 4ED1A 3RJFA 3QE9Y 5JUMA 1P7DA 4YR0A 4F50A 7ICVA 3FM9A 2C2DA 1FFUA 2JH1A 4DFMA 3SMVA 5J0TA 2JEIA 4F5PA 3N28A 3DV9A 3AMZA 9ICNA 4DSIA 2MAXA 5KFVA 5ALMA 1QQ5A 2JXJA 4OJOA 2KJ8A 3SAFA 3QU7A 4IQUA 5F3XB 4DS5A 2ZTCA 2HCFA 4DF4A 3QUTA 3ZI4A 4F5NA 2WFAA 2FLNA 2G0AA 2Q4TA 5KT6A 2H5XA 4KMOB 1RQLA 3C1YA 3ZD8A 2KICA 3QEBZ 1CUKA 4Y2JA 1L3UA 1SV4A 4ECQA 4O5CA 1WYGA 3I1YA 1TK8A 4J03A 2GOLA 3H7IA 5CRXA 3MR2A 5B5EU 1L7PA 8ICLA 4KLGA 3M8SA 2DKXA 4ECVA 4UB8U 2KNJA 4DL5A 4R8UA 1S0MA 4Y2SA 5ALSA 2J6SA 3N7SC 1T3NA 5J2HA 2KMDA 7ICFA 5IINA 1A77A 3B0XA 1UPHA 4G9BA 5AKLA 2DWQA 3RJJA 3F2BA 4JV1A 4YXMA 5EE1A 1F44A 1NOMA 2EDUA 1U45A 2JR5A 2LPEA 3BJYA 1UA0A 5J29A 3PR4A 5AI0A 3KHRA 1X9MA 5DB7A 1RDFA 3V6JA 7ICPA 3F5AA 3PZPA 2NYVA 4F4XA 5KFXA 4F92B 5J2FA 2QARB 1X6JA 5DDMA 5DB6A 3GV8B 3PW5A 5AK4A 9ICTA 2RRDA 3ZDAA 4BX9C 3Q8LA 4FBUA 3SI8A 5EOZA 1X2IA 1J2MA 3K75D 1X66A 5J0XA 2VJ5A 3C29A 1BPBA 5J8YC 2KG5A 4KX3A 8ICHA 1D8LA 1FFVA 3HRDD 2KP7A 5AM3A 4J9PA 5EWGA 2HHXA 4R65A 4PHEA 3WK9A 4UASA 2KZMA 3C5FA 4DFKA 5DBBA 4OJPA 2R8HA 2OWOA 3LYSA 7ICLA 5ALKA 3D2NA 5EE3A 2ZG6A 4NLGA 2ODGA 1SL0A 1F0MA 5EE9A 5TZVA 1S0NA 5AKYA 4LZGA 2R18A 2AJQA 1TK5A 9ICUA 2P6RA 2MUTA 2J6TA 4Y2RA 1L3VA 2K60A 4UAUA 5KFOA 3RB6A 8ICSA 4JB3A 2W9BA 2ZIVA 4M0AA 2VIXA 2L5YA 2H3VA 4Q8EA 4ED8A 3MFIA 5ALUA 2NO4A 5KFCA 1S0VA 1ZD5A 5AKEA 3OJUA 2V9WA 3WK4A 4MFCA 4TQSA 2RQ5A 3S6JA 3KD3A 2WF8A 5KFRA 1F5SA 5HR7A 5J2KA 4RT3A 7ICOA 2LYBA 3RJKA 5KFEA 1L7NA 2KEYA 3RBDA 1ZQWA 4WJ3B 1L5UA 2RHFA 3A0HU 1NZBA 2K8AA 3KZXA 1JN3A 3MGHA 3OSPA 3ZDEA 4DQQA 3MABA 4HYKA 3RAQA 5CP2A 4UQGA 2ZTEA 3QUCA 1URJA 2XICA 5KG2A 3T5JA 1MC8A 4IQVA 4KMUA 9ICXA 8ICYA 3SEIA 3D2SA 4PH5A 2LM1A 1TVAA 3RFAA 4KX5A 2NRZA 4I2DA 1K1SA 2NO5A 2D8CA 3M7DA 3F2DA 9ICPA 4PGYA 3JPOA 1KQQA 3F5EA 2JHDA 4CF5A 4QWBA 3ZDBA 2W11A 5KG6A 4TQRA 4MEXA 5J0SA 5KT2A 3SYZA 3GIJA 1S5LU 1ZQ1C 1L7MA 4F4ZA 5AKIA 5CEHA 4EBCA 5KFKA 4J9SA 1B0XA 4JV0A 1RXWA 4B9VA 4I29A 4PJ0U 1Q3UA 3RRGA 3BS5B 3EUB2 1CI4A 5AI5A 3UM9A 4J9OA 2KHVA 3GDXA 4P0QA 3T79A 1YZ7A 2XVTA 4CF3A 1MQ3A 7ICQA 3VCBA 2ZXIA 5E79U 2P6UA 1HJPA 3SV4A 5AIAA 2VANA 5KFDA 1OUQA 4NLNA 2BDUA 2PMZC 3NVZA 3LDAA 3K1ZA 2NV3A 3TQ1A 1ZQJA 4CGZA 5J2EA 4BGDA 1FO4A 5J0WA 3U26A 1ZQXA 2UVWA 1ZETA 2MRLA 1FEZA 2I6XA 4NV0A 2Y9UA 2XY7A 1ZD4A 2Q0ZX 5KG7A 4O3NA 1SV0C 3BZKA 5KFJA 2ASLA 3D2QA 4YXJA 2G07A 1PK1B 1RYRA 4I2FA 2F77X 2F1JA 3QZ8A 2KHQA 3DEEA 2WHEA 4QZGA 4J9MA 1ZRNA 4FZLA 3JPNA 3PW7A 4ECSA 1KTQA 2W9CA 2RDIA 3RB4A 4DFPA 1BPXA 5C5JA 3K4GA 5J0QA 1L6NA 3NVWA 4ACOA 5KG5A 3NTUA 1HUOA 2K4EA 3PW0A 4YQWA 1N2XA 2FLPA 1MQ2A 4GC6A 2M9NA 2E1EA 1ZXIA 5ALQA 2H3FA 2IHNA 2P35A 4QWEA 2I5HA 3MDAA 4YD1A 4C7ZA 2Y0SF 1BPDA 3EW9A 2OH2A 4IRCA 2C2RA 3EWAA 4YMOA 3GFKB 4YG2A 3R9KA 4YMNA 3F2CA 2AQ4A 5KFUA 5HHHA 2AGPA 2F76X 2JGAA 2VJ4A 5J8YA 2LYHA 3OGUA 1B4FA 3Q8QB 1QSLA 4TURA 4F3OA 2M0NA 4QZHA 1SXDA 3L3FX 8ICMA 2GO7A 3QYPA 2KV2A 4DSFA 4Y2TA 4DSKA 2KFNA 3LVVA 3PSTA 3RR7A 4UAYA 1Z00A 2OEHA 3OHBA 1VLBA 2WB1F 2R8JA 4XUSA 1PVPA 2GLEA 5BPCA 2G06A 4PGQA 5DG7A 5KFIA 9ICCA 4KLMA 4B9LA 2ALZA 2WB1C 3QUBA 1T3QA 4UB1A 3QU9A 5K4LA 3QU2A 1SKWA 2HSZA 2MSNA 5J2JA 1RYSA 4EEYA 1WUDA 3ISCA 3BDPA 4NLKA 3H0RB 5L1LA 1FIQA 2NRXA 4Y2YA 2KVSA 2PI5A 1ZRMA 2W9MA 4C7YA 8ICJA 4M2YA 2V4RA 3EPGA 4MFFA 5KT4A 5AKJA 1Z00B 2XCPA 3LWMA 2BQ3A 1UQVA 3JPPA 4MHVA 1ZQDA 4AP9A 5AM4A 2YB1A 5KAIU 3BQTA 3H8WA 3H8MA 3GIKA 3CYMA 1X40A 2AHOB 4RPYA 8ICEA 3Q8MA 4B9TA 5HHIA 1ZQUA 8ICZA 3TADA 4BXOB 3V7KA 2FDRA 3NVYA 4QWDA 3AQEA 1L3TA 1NJXA 1DRGA 4FS2A 1KL9A 4O3SA 3HW8A 4O3MA 1QQ6A 3QNMA 5AM5A 4F4WA 4F5RA 2E3TA 3FDSA 4I2AA 5ALWA 1ZQFA 3AEVA 3BS7A 2FPKA 4XQ8A 3UXNA 2BPCA 3IDWA 2DQNB 5ALPA 1NKEA 2KZ3A 2ISOA 2Z7JA 2LBOA 3SR6A 1NZPA 5HNKA 1PK1A 4M6WA 5KTQA 5D46A 3M1YA 4P2HA 5CWRA 4ECRA 3TAPA 9ICIA 5J2BA 3SV3A 4TUQA 2W8LA 1QCKA 1SV0A 3WK7A 4EEKA 4KLSA 3KKAC 2AGQA 1JUDA 1YT3A 4YD2A 4DWIA 4OJLA 4RUCA 4A8EA
chains in the Genus database with same CATH topology
2YQEA 5K4LA 1KKXA 2EQYA 4LJXA 1RYUA 2JRZA 2KK0A 2JXJA 1KQQA 2RQ5A 2OEHA 1KN5A 1C20A 2CXYA 1IG6A 2LM1A 2LI6A 5CEHA 2EH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQE A;  5K4L A;  1KKX A;  2EQY A;  4LJX A;  1RYU A;  2JRZ A;  2KK0 A;  2JXJ A;  1KQQ A;  2RQ5 A;  2OEH A;  1KN5 A;  1C20 A;  2CXY A;  1IG6 A;  2LM1 A;  2LI6 A;  5CEH A;  2EH9 A; 
#chains in the Genus database with same CATH topology
 1ZQN A;  5KFT A;  4EZ6 A;  1DK2 A;  1D9F A;  2BQU A;  2YQE A;  1J2N A;  4UAW A;  2JEF A;  1QSS A;  7ICM A;  2KSO B;  4U6P A;  2AU0 A;  2BQR A;  1S76 D;  5KFY A;  2IMW P;  2EAO A;  5BOL A;  1BPY A;  2ZIU A;  9ICG A;  1H38 A;  2KK0 A;  1JRO A;  4Q8F A;  1SZH A;  2F44 A;  5J2C A;  3M6Z A;  1ZQT A;  4CCH A;  4NL9 C;  3TAC B;  1Z1V A;  1DOQ A;  3PY8 A;  4LZD A;  5KAF U;  3WK6 A;  4KN7 A;  4RQ8 A;  4M04 A;  3HPO A;  2HHQ A;  1ZJM A;  4P0Q B;  1ZQB A;  4RT2 A;  1IG6 A;  4B6J A;  4QW9 A;  2VA3 A;  4Z6D A;  4C8M A;  4CNQ A;  5D49 A;  5ALT A;  3TAD C;  5T14 A;  1WWV A;  1COK A;  3UMG A;  4KIT B;  4EZ9 A;  2PFO A;  5F9N A;  5GTH U;  1RXV A;  3MR3 A;  3V6K A;  1MA7 A;  2E8M A;  1VDV A;  4Y2Q A;  2RLT A;  2CPR A;  3QU4 A;  4GFJ A;  3HWT A;  4NM1 A;  5AKG A;  4P4P A;  1XSN A;  7ICS A;  4F91 B;  3C23 A;  4RNM A;  3G6Y A;  1L8L A;  9ICB A;  1D8B A;  2JH7 A;  4K4G A;  4ELT A;  3ORY A;  4UBB A;  4TUP A;  1TKD A;  4I2C A;  4BWM A;  1IM4 A;  3O0F A;  2YN4 A;  2BCV A;  1J97 A;  1S77 D;  5KG4 A;  2F2A B;  2KVC A;  4EBE A;  2EAM A;  2HHT A;  3ZDC A;  4GLX A;  2KTQ A;  2HVH A;  3RH4 A;  3MFH A;  1NJZ A;  4Z6F A;  1Z4O A;  4NLC A;  3A0B U;  3C2M A;  4F2R A;  2ZJ5 A;  4QZF A;  3NUQ A;  4O0I A;  4KTQ A;  2I9G A;  5AM2 A;  1KDH A;  4O3Q A;  5KFZ A;  1EXN A;  4UB3 A;  5CR0 A;  4NXZ A;  4R64 A;  1ZOL A;  3OTQ A;  2E8O A;  1NK8 A;  1ZQL A;  1U48 A;  3BQ0 A;  2BCR A;  4ED7 A;  1N63 A;  2ZUD A;  4UW9 A;  3SQI A;  5ALE A;  1NJY A;  4E0D A;  5AKK A;  2W43 A;  4DFJ A;  1X9X A;  2BKE A;  3NS1 A;  2VA8 A;  1PVQ A;  2LKY A;  2K8B B;  1BGX T;  5KFS A;  3PSP A;  2BHN A;  3N7P D;  1N62 A;  2W55 A;  2C22 A;  5AK5 A;  1ZQS A;  4NWI A;  4KLO A;  3PW2 A;  1HIW A;  2MU2 A;  2KFZ A;  1QH9 A;  3L5K A;  9ICW A;  2CRX A;  2HBK A;  2OM6 A;  5ALV A;  4C4T A;  4DLE A;  3AU6 A;  8ICF A;  3PV8 A;  4DLG A;  4DOC A;  3TFR A;  5AKH A;  3C2L A;  4QZ8 A;  3IG8 A;  3WKD A;  4ELV A;  1M6Y A;  3IV6 A;  2LM4 A;  3FAH A;  4PPX A;  3G6X A;  5J2I A;  3ZDD A;  3Q8K A;  4P0P A;  1S0O A;  3KZI U;  1U4B A;  4U7C A;  3V7J A;  1ZQC A;  2J6U A;  1L7O A;  1Z3E B;  2PFN A;  3H0L B;  3I28 A;  3Q8P B;  3PW4 A;  1ZQV A;  3IHQ B;  4QIW C;  1HUZ A;  3KOO A;  2HW3 A;  4NL9 A;  2ZIX B;  4MF2 A;  2QB0 A;  4KLL A;  4J9Q A;  5AIC A;  2AQ0 A;  2FI1 A;  4YP3 A;  1WCL A;  2H3Z A;  2DL0 A;  4RQ1 A;  2Y1I A;  1IV8 A;  2BR0 A;  4K4I A;  3THV A;  2YMQ A;  4ICA A;  3SD7 A;  5JRT A;  2W9B B;  8ICQ A;  4M6W B;  5ALJ A;  4IL6 U;  2UVR A;  3F53 A;  2ESE A;  5KFF A;  1CEZ A;  2KIV A;  1JRP A;  1XWL A;  2Y0S C;  4EYI B;  4JV2 A;  2G08 A;  4EEN A;  3KTQ A;  3AN1 A;  3KFU F;  8ICR A;  2XI9 A;  3ED5 A;  4I2G A;  1ZQM A;  5AM1 A;  1ZQH A;  3HJE A;  2KJ5 A;  3ISD A;  4DOA A;  4NLZ A;  3AL0 B;  3T5L A;  2EH9 A;  4B9N A;  1RPL A;  4NY8 A;  1VJ5 A;  3RBE A;  1KKX A;  3V7L A;  2BGW A;  2KJ9 A;  4R8U B;  2JZB A;  1MSW D;  1L8O A;  2K4H A;  4CE6 A;  5DG8 A;  4ECZ A;  1T4G A;  2QAR A;  1ZQY A;  5DGA A;  1SL1 A;  3TFS A;  2G5I B;  4PHP A;  2OXO A;  3ISB A;  3JPT A;  8ICW A;  5AI9 A;  2E8P A;  3QXG A;  1TK0 A;  3PMN A;  4RNO A;  5BOM A;  3BS5 A;  1S97 A;  2F1H A;  1NKB A;  4R66 A;  2ZTD A;  4ED6 A;  1ZQR A;  3M6K A;  2HMX A;  3RH5 A;  2FMP A;  4K4H A;  5HMM A;  4RZR A;  4PL2 A;  4UAR A;  5ALO A;  3QX7 A;  1N60 A;  4X5V A;  1SKR A;  3MGV A;  4DF8 A;  2FMQ A;  5DQH A;  2V4Q A;  5J0R A;  5DLG A;  2JEG A;  1Z4N A;  4C8K A;  3D6J A;  1SZP A;  3IG5 A;  2E8N A;  2ZIU B;  2R8K A;  2UVV A;  5L9X A;  4ZOH C;  4DQP A;  5ALL A;  1DGJ A;  3DDH A;  5ALN A;  5IIK A;  1ZD2 P;  1AQ6 A;  2IOF A;  2XY6 A;  4O5K A;  2ASD A;  2NRV A;  1JAL A;  1BVS A;  2CN1 A;  2W3S A;  1QSY A;  3GU3 A;  3GII A;  8ICK A;  1PZN A;  9ICS A;  4RQ6 A;  4QWC A;  4IC9 A;  5AHX A;  4RQ3 A;  4ZH4 A;  3FYH A;  1V9P A;  4IRD A;  4Q43 A;  2ZIW A;  4P4O A;  3PML A;  2B6G A;  4DSE A;  1S9F A;  1ZQE A;  2UVU A;  4KLT A;  3ICX A;  5J0Y A;  1N5W A;  1WCN A;  3PR5 B;  4I27 A;  2W03 A;  4DQS A;  1U49 A;  2OHF A;  2W9A A;  1X6I A;  3JPQ A;  5DKW A;  4PHD A;  3WK8 A;  2HOF A;  2D3D A;  3VC8 A;  4UB2 A;  2VKQ A;  3NGD A;  1C20 A;  5HR6 A;  3HT3 A;  5AKX A;  8ICO A;  3OPX A;  3UMC A;  3ONN A;  1UHU A;  2F8L A;  5ALY A;  3HKZ F;  2ZJA A;  1JMS A;  4KLI A;  3QUQ A;  3LK9 A;  2HVI A;  4OJ6 A;  5KT3 A;  1DGS A;  2IOF K;  4PHA A;  3GZF A;  2E1F A;  4KLQ A;  5B66 U;  2ZJ8 A;  2KIW A;  8ICC A;  1SGG A;  2GWS A;  2XCA A;  1KW4 A;  4YN4 A;  4YVZ A;  4LJX A;  1KFT A;  4ECT A;  4XA5 A;  3H0M B;  4G3I A;  2HBJ A;  5G5H A;  5DQG A;  3TAQ A;  4I2I A;  3H4B A;  4HAI A;  1XC9 A;  2N1R A;  3MBY A;  3RJE A;  5TIS U;  4US9 A;  4PGX A;  3FC4 A;  4QIW F;  3TKA A;  4DL2 A;  2W54 A;  3J81 j;  2HHS A;  3ZD9 A;  1L3S A;  2WAQ C;  2HI0 A;  5J2G A;  3GIL A;  5H2F U;  4M9N A;  3MR6 A;  2HOI A;  4UB5 A;  4GIB A;  5KFG A;  3RH6 A;  1UA1 A;  4QW8 A;  4YFK A;  1KSP A;  2DFL A;  5L1K A;  4OJ5 A;  3RB0 A;  2A1J A;  4BJQ A;  5KFW A;  2ISP A;  4IQW A;  3JPR A;  1BPZ A;  1V38 A;  8ICA A;  4IR9 A;  3SAG A;  5IIJ A;  4BWJ A;  1WWU A;  3WKC A;  4GC7 A;  2WF9 A;  1TE2 A;  4KN4 A;  4AYB F;  3M9N B;  2W3R A;  1NK9 A;  4JK1 A;  5ALF A;  5AKZ A;  1ZQA A;  5J0U A;  3M9M B;  2W7O A;  4DS4 A;  5KFH A;  3RR8 A;  4RNN A;  2XGQ A;  3OSN A;  3SZ2 A;  1JIH A;  4F2S A;  4F4K A;  1NI3 A;  4EBD A;  2NRT A;  3H4D A;  5KFQ A;  4O5E A;  2G09 A;  2A19 A;  4F5Q A;  1D8Y A;  4O3R A;  1LV5 A;  1GO3 F;  3NAS A;  7ICE A;  7ICN A;  1XO0 A;  4QZE A;  4F72 A;  3LWL A;  4EYH B;  4KLH A;  4JWM A;  2AGO A;  2O6K A;  4QWA A;  2JEJ A;  2XO7 A;  3I76 A;  1S10 A;  4DOB A;  1NKC A;  8ICU A;  4FBT A;  4DSJ A;  4DFD A;  4FE3 A;  5DLF A;  4KLD A;  5DB9 A;  2A3V A;  5AI6 A;  5GTI U;  5DBA A;  3AM9 A;  1ZQG A;  1A0P A;  4BDP A;  1N48 A;  4QZI A;  4Q44 A;  2HBM A;  3UQ2 A;  5ALZ A;  4GXJ A;  8ICB A;  3WK5 A;  3UXP A;  2KKV A;  3PSF A;  2FPM A;  2F3N A;  4CRX A;  2PKE A;  1XNS A;  1ZQI A;  1NK4 A;  3B0Y A;  1LKY B;  4TUS A;  7ICJ A;  2A1A A;  4KLE A;  4J9L A;  3K1R B;  1SWW A;  4DQR A;  4GXI A;  3Q8S B;  2R8G A;  1ARO P;  5HML A;  1JXE A;  4DCC A;  2BPF A;  4Y2X A;  1ZYQ A;  3EYZ A;  1T94 A;  3V72 A;  5ALX A;  3L4P A;  3E0F A;  4M47 A;  5A0L A;  5III A;  1S8O A;  4RU9 A;  3NVV A;  1COO A;  3BQ2 A;  2KZZ A;  3MDC A;  1RQN A;  2KE7 A;  3UXO A;  1TAU A;  1V97 A;  4I2J A;  5KT5 A;  4RQ0 A;  3MGI A;  5DG9 A;  2BCU A;  5G5G A;  4QZA A;  3EZ5 A;  4MFA A;  4DEZ A;  2BCQ A;  1TFR A;  4Z6E A;  5DQI A;  7ICH A;  5C0Y A;  7ICK A;  2XID A;  5J0P A;  4DSL A;  4QZD A;  4UAV A;  4ECY A;  5IIL A;  1N56 A;  4CF4 A;  3RJG A;  3IP4 B;  5KFB A;  2MA1 A;  2ZXH A;  4FO6 A;  8ICV A;  3RB3 A;  2IA6 A;  2ZIW B;  2GH1 A;  1KFD A;  1RZT A;  7ICU A;  1D9D A;  8ICP A;  3PNC A;  2DPI A;  4C80 A;  4F93 B;  5DBC A;  5ALG A;  1B22 A;  3PO4 A;  5KFP A;  4DO9 A;  4DL3 A;  3T5K A;  5KT7 A;  2PMZ F;  4FFD A;  4OCZ A;  2ES6 A;  4F8R A;  5JU5 A;  1BNO A;  2DGZ A;  2OCE A;  5KG3 A;  3Q8R B;  1UCV A;  5CA7 A;  2H3I A;  4JMU A;  5ALI A;  5KL1 B;  2ZUC A;  5KG1 A;  4FS1 A;  4UBC A;  2K4I A;  3PX6 A;  1XU4 A;  3M8R A;  4J9R A;  3ETR A;  3H40 A;  2BCS A;  4YR2 A;  7ICI A;  9ICQ A;  3MR5 A;  8ICI A;  1KRP A;  2LI6 A;  2BDP A;  1IXR A;  1LB2 B;  2KSO A;  4C4S A;  1QQ7 A;  2AH5 A;  2QLT A;  7ICG A;  1Q8K A;  4UAT A;  1NK0 A;  3EPI A;  4C4R A;  1BPE A;  1NK7 A;  4LVS A;  5J2A A;  1U47 A;  3UMB A;  4P4M A;  4I2E A;  4YMM A;  4M9G A;  2DPJ A;  1Y88 A;  2YTU A;  1B43 A;  3WKE A;  3BQ7 A;  1TAM A;  2LYA A;  4IQT A;  1X42 A;  2W9C B;  5KG0 A;  2Y1J A;  3GIM A;  3AU2 A;  1OW5 A;  3E58 A;  1DK3 A;  4O3O A;  4IRK A;  3H8J A;  2F8K A;  1NNL A;  2HOQ A;  2YML A;  7ICR A;  1NK6 A;  2EAP A;  4NJ8 A;  1K1Q A;  4DL7 A;  1OXJ A;  1Q46 A;  1UT5 A;  9ICK A;  4RQ5 A;  3UPQ A;  2WAQ F;  3IM1 A;  4IS7 A;  5ALR A;  4DL4 A;  1QTM A;  4C0Z A;  4B9M A;  9ICL A;  4EX6 A;  4EX7 A;  5EE0 A;  2XGP A;  2G5H B;  2W8K A;  1C7Y A;  2JRZ A;  3MC1 A;  3OJS A;  1T8E A;  4M9J A;  3HX0 A;  4USA A;  3RF9 A;  3QEA Z;  2W04 A;  1Q3V A;  3KHH A;  3PX4 A;  3WKA A;  2WF5 A;  9ICJ A;  1SB3 C;  2YMM A;  3C21 A;  9ICA A;  5EWF A;  8ICN A;  4IR1 A;  5IIO A;  8ICX A;  1PK3 A;  3AUO A;  3E2E A;  4R63 A;  2C28 A;  1ED1 A;  5CB1 A;  4RQ2 A;  2FE9 A;  5KL8 B;  5CJ7 A;  3PX0 A;  2HHW A;  3KHL A;  2EZY A;  4RPZ A;  3PO5 A;  3SEN A;  3T5H A;  3B9J A;  3HIL A;  1SXE A;  2P66 A;  3H8S A;  2QB0 B;  2EAN A;  5AI4 A;  2BPG A;  3OHA A;  4CDG A;  2QKQ A;  4RQ7 A;  2IBK A;  4PL1 A;  4QZB A;  2ZIV B;  9ICR A;  1X9W A;  1A6S A;  1BNP A;  9ICE A;  3C28 A;  2DF4 B;  4AYB C;  4OO1 J;  3V6H A;  5AK3 A;  2AXT U;  2HBL A;  1ZQO A;  2OYY A;  4Y2V A;  4UB6 U;  1V85 A;  3SAH A;  4QZC A;  2I1Q A;  5AI8 A;  1N61 A;  1HEK A;  5IIM A;  1NK5 A;  1A76 A;  4Y2P A;  9ICH A;  3IRU A;  4RPX A;  4BXO A;  5ALH A;  1JI7 A;  3T3F A;  9ICM A;  3CW2 C;  4UAZ A;  2WF6 A;  4B9S A;  2ZIX A;  2XY5 A;  2HDO A;  3IN5 A;  1RM6 C;  3M9O B;  2LMR A;  3GV7 B;  5J0O A;  4ECW A;  2B0C A;  2XC9 A;  1KEJ A;  2R8I A;  4QJF B;  1KN5 A;  2F1I A;  1KBU A;  5FP0 A;  5DDY A;  3QZ7 A;  5D4B A;  1XSL A;  2B21 A;  4KLF A;  3N97 B;  3AQF A;  1ZQP A;  2KKP A;  5ALD A;  5KFA A;  4EEL A;  3GQC A;  5L1J A;  1RYU A;  4DL6 A;  3CNH A;  4YCX A;  4US8 A;  5KFN A;  4I28 A;  4Y2U A;  1XS9 D;  4BUG A;  1TV9 A;  1XSP A;  4MF8 A;  3GV5 B;  2FPL A;  1KLN A;  4RUA A;  4RQM A;  2FMS A;  2W7P A;  2MUT B;  3LVW A;  3C5G A;  3RJH A;  3PSI A;  3RRH A;  7ICT A;  1LKY A;  3C2K A;  5KFM A;  1SIJ A;  4MEY A;  4ED3 A;  4P0P B;  3QU5 A;  4ED0 A;  2EQY A;  3BZC A;  4ECU A;  2RP5 A;  2YMP A;  2CXY A;  1X9S A;  3C1Z A;  2KD1 A;  3PVX A;  5JTI A;  4RQ4 A;  1LVH A;  2JV3 A;  2JMG A;  1PUZ A;  1Z19 A;  9ICF A;  2LHT A;  5CHG A;  1YZ6 A;  1ZQK A;  1SKS A;  5EWE A;  2BZF A;  2YB4 A;  2C2E A;  4F4Y A;  2D6F C;  3HKZ C;  2IOH A;  3HP6 A;  4KLJ A;  4YR3 A;  1IIP A;  2DBY A;  4I2H A;  5KNI A;  1ZD3 A;  4NM2 A;  2NRW A;  5KFL A;  5DB8 A;  2KN7 A;  3RTV A;  1O03 A;  5DGB A;  2H3Q A;  1KFS A;  2K89 A;  1ZQZ A;  1U9L A;  4NLB A;  3NRZ A;  8ICG A;  2FJ6 A;  2EZX A;  4XRH A;  2VA2 A;  8ICT A;  4RQN A;  2FLL A;  2K8C B;  1JXL A;  4M9L A;  2HHU A;  1PVR A;  4J9K A;  3KBB A;  1MN8 A;  5L1M A;  1TAQ A;  3CP8 A;  4GXK A;  2ATL A;  1JX4 A;  4ED2 A;  2YX8 A;  3RAX A;  3TI0 A;  2YY6 A;  3N4M B;  2JZB B;  4FZM A;  2ASJ A;  2IHM A;  1T7P A;  1SWV A;  4B9U A;  3TAN A;  5HP4 A;  2PFQ A;  4PZN A;  5F9L A;  1UT8 A;  4QNL A;  4QZ9 A;  4Q45 A;  5AK6 A;  1ZJN A;  4JUZ A;  4JWN A;  3ALR A;  2DKZ A;  1K5O A;  3JPS A;  4ECX A;  1RG6 A;  3G6V A;  1NJW A;  2PI4 A;  2KOB A;  3WKB A;  2WF7 A;  1N5X A;  4F71 A;  4OD0 A;  3KHG A;  9ICV A;  4O9M A;  4I2B A;  5J2D A;  2RDJ A;  5AIB A;  2A1J B;  3RJI A;  1CRX A;  4DQI A;  4KLU A;  1ZQQ A;  2EZZ A;  1Z1B A;  2PFP A;  4UB4 A;  2ZUB A;  1XO1 A;  1WG8 A;  5L1I A;  2DUY A;  4FZN A;  3TAR A;  4C8L A;  1QLN A;  4ELU A;  2E5S A;  3BQ1 A;  2PXI A;  4C8N A;  1ECW A;  4O3P A;  2K4P A;  1DXS A;  1SL2 A;  4C8O A;  4M9H A;  3N7R C;  2QB1 A;  9ICO A;  4PZO A;  4J9N A;  3ETL A;  1O08 A;  3KKA A;  3CRX A;  2HHV A;  4Z6C A;  3UQ0 A;  2Y9T A;  4F5O A;  2WTF A;  3WU2 U;  3NRW A;  5AM0 A;  4ED1 A;  3RJF A;  3QE9 Y;  5JUM A;  1P7D A;  4YR0 A;  4F50 A;  7ICV A;  3FM9 A;  2C2D A;  1FFU A;  2JH1 A;  4DFM A;  3SMV A;  5J0T A;  2JEI A;  4F5P A;  3N28 A;  3DV9 A;  3AMZ A;  9ICN A;  4DSI A;  2MAX A;  5KFV A;  5ALM A;  1QQ5 A;  2JXJ A;  4OJO A;  2KJ8 A;  3SAF A;  3QU7 A;  4IQU A;  5F3X B;  4DS5 A;  2ZTC A;  2HCF A;  4DF4 A;  3QUT A;  3ZI4 A;  4F5N A;  2WFA A;  2FLN A;  2G0A A;  2Q4T A;  5KT6 A;  2H5X A;  4KMO B;  1RQL A;  3C1Y A;  3ZD8 A;  2KIC A;  3QEB Z;  1CUK A;  4Y2J A;  1L3U A;  1SV4 A;  4ECQ A;  4O5C A;  1WYG A;  3I1Y A;  1TK8 A;  4J03 A;  2GOL A;  3H7I A;  5CRX A;  3MR2 A;  5B5E U;  1L7P A;  8ICL A;  4KLG A;  3M8S A;  2DKX A;  4ECV A;  4UB8 U;  2KNJ A;  4DL5 A;  4R8U A;  1S0M A;  4Y2S A;  5ALS A;  2J6S A;  3N7S C;  1T3N A;  5J2H A;  2KMD A;  7ICF A;  5IIN A;  1A77 A;  3B0X A;  1UPH A;  4G9B A;  5AKL A;  2DWQ A;  3RJJ A;  3F2B A;  4JV1 A;  4YXM A;  5EE1 A;  1F44 A;  1NOM A;  2EDU A;  1U45 A;  2JR5 A;  2LPE A;  3BJY A;  1UA0 A;  5J29 A;  3PR4 A;  5AI0 A;  3KHR A;  1X9M A;  5DB7 A;  1RDF A;  3V6J A;  7ICP A;  3F5A A;  3PZP A;  2NYV A;  4F4X A;  5KFX A;  4F92 B;  5J2F A;  2QAR B;  1X6J A;  5DDM A;  5DB6 A;  3GV8 B;  3PW5 A;  5AK4 A;  9ICT A;  2RRD A;  3ZDA A;  4BX9 C;  3Q8L A;  4FBU A;  3SI8 A;  5EOZ A;  1X2I A;  1J2M A;  3K75 D;  1X66 A;  5J0X A;  2VJ5 A;  3C29 A;  1BPB A;  5J8Y C;  2KG5 A;  4KX3 A;  8ICH A;  1D8L A;  1FFV A;  3HRD D;  2KP7 A;  5AM3 A;  4J9P A;  5EWG A;  2HHX A;  4R65 A;  4PHE A;  3WK9 A;  4UAS A;  2KZM A;  3C5F A;  4DFK A;  5DBB A;  4OJP A;  2R8H A;  2OWO A;  3LYS A;  7ICL A;  5ALK A;  3D2N A;  5EE3 A;  2ZG6 A;  4NLG A;  2ODG A;  1SL0 A;  1F0M A;  5EE9 A;  5TZV A;  1S0N A;  5AKY A;  4LZG A;  2R18 A;  2AJQ A;  1TK5 A;  9ICU A;  2P6R A;  2MUT A;  2J6T A;  4Y2R A;  1L3V A;  2K60 A;  4UAU A;  5KFO A;  3RB6 A;  8ICS A;  4JB3 A;  2W9B A;  2ZIV A;  4M0A A;  2VIX A;  2L5Y A;  2H3V A;  4Q8E A;  4ED8 A;  3MFI A;  5ALU A;  2NO4 A;  5KFC A;  1S0V A;  1ZD5 A;  5AKE A;  3OJU A;  2V9W A;  3WK4 A;  4MFC A;  4TQS A;  2RQ5 A;  3S6J A;  3KD3 A;  2WF8 A;  5KFR A;  1F5S A;  5HR7 A;  5J2K A;  4RT3 A;  7ICO A;  2LYB A;  3RJK A;  5KFE A;  1L7N A;  2KEY A;  3RBD A;  1ZQW A;  4WJ3 B;  1L5U A;  2RHF A;  3A0H U;  1NZB A;  2K8A A;  3KZX A;  1JN3 A;  3MGH A;  3OSP A;  3ZDE A;  4DQQ A;  3MAB A;  4HYK A;  3RAQ A;  5CP2 A;  4UQG A;  2ZTE A;  3QUC A;  1URJ A;  2XIC A;  5KG2 A;  3T5J A;  1MC8 A;  4IQV A;  4KMU A;  9ICX A;  8ICY A;  3SEI A;  3D2S A;  4PH5 A;  2LM1 A;  1TVA A;  3RFA A;  4KX5 A;  2NRZ A;  4I2D A;  1K1S A;  2NO5 A;  2D8C A;  3M7D A;  3F2D A;  9ICP A;  4PGY A;  3JPO A;  1KQQ A;  3F5E A;  2JHD A;  4CF5 A;  4QWB A;  3ZDB A;  2W11 A;  5KG6 A;  4TQR A;  4MEX A;  5J0S A;  5KT2 A;  3SYZ A;  3GIJ A;  1S5L U;  1ZQ1 C;  1L7M A;  4F4Z A;  5AKI A;  5CEH A;  4EBC A;  5KFK A;  4J9S A;  1B0X A;  4JV0 A;  1RXW A;  4B9V A;  4I29 A;  4PJ0 U;  1Q3U A;  3RRG A;  3BS5 B;  3EUB 2;  1CI4 A;  5AI5 A;  3UM9 A;  4J9O A;  2KHV A;  3GDX A;  4P0Q A;  3T79 A;  1YZ7 A;  2XVT A;  4CF3 A;  1MQ3 A;  7ICQ A;  3VCB A;  2ZXI A;  5E79 U;  2P6U A;  1HJP A;  3SV4 A;  5AIA A;  2VAN A;  5KFD A;  1OUQ A;  4NLN A;  2BDU A;  2PMZ C;  3NVZ A;  3LDA A;  3K1Z A;  2NV3 A;  3TQ1 A;  1ZQJ A;  4CGZ A;  5J2E A;  4BGD A;  1FO4 A;  5J0W A;  3U26 A;  1ZQX A;  2UVW A;  1ZET A;  2MRL A;  1FEZ A;  2I6X A;  4NV0 A;  2Y9U A;  2XY7 A;  1ZD4 A;  2Q0Z X;  5KG7 A;  4O3N A;  1SV0 C;  3BZK A;  5KFJ A;  2ASL A;  3D2Q A;  4YXJ A;  2G07 A;  1PK1 B;  1RYR A;  4I2F A;  2F77 X;  2F1J A;  3QZ8 A;  2KHQ A;  3DEE A;  2WHE A;  4QZG A;  4J9M A;  1ZRN A;  4FZL A;  3JPN A;  3PW7 A;  4ECS A;  1KTQ A;  2W9C A;  2RDI A;  3RB4 A;  4DFP A;  1BPX A;  5C5J A;  3K4G A;  5J0Q A;  1L6N A;  3NVW A;  4ACO A;  5KG5 A;  3NTU A;  1HUO A;  2K4E A;  3PW0 A;  4YQW A;  1N2X A;  2FLP A;  1MQ2 A;  4GC6 A;  2M9N A;  2E1E A;  1ZXI A;  5ALQ A;  2H3F A;  2IHN A;  2P35 A;  4QWE A;  2I5H A;  3MDA A;  4YD1 A;  4C7Z A;  2Y0S F;  1BPD A;  3EW9 A;  2OH2 A;  4IRC A;  2C2R A;  3EWA A;  4YMO A;  3GFK B;  4YG2 A;  3R9K A;  4YMN A;  3F2C A;  2AQ4 A;  5KFU A;  5HHH A;  2AGP A;  2F76 X;  2JGA A;  2VJ4 A;  5J8Y A;  2LYH A;  3OGU A;  1B4F A;  3Q8Q B;  1QSL A;  4TUR A;  4F3O A;  2M0N A;  4QZH A;  1SXD A;  3L3F X;  8ICM A;  2GO7 A;  3QYP A;  2KV2 A;  4DSF A;  4Y2T A;  4DSK A;  2KFN A;  3LVV A;  3PST A;  3RR7 A;  4UAY A;  1Z00 A;  2OEH A;  3OHB A;  1VLB A;  2WB1 F;  2R8J A;  4XUS A;  1PVP A;  2GLE A;  5BPC A;  2G06 A;  4PGQ A;  5DG7 A;  5KFI A;  9ICC A;  4KLM A;  4B9L A;  2ALZ A;  2WB1 C;  3QUB A;  1T3Q A;  4UB1 A;  3QU9 A;  5K4L A;  3QU2 A;  1SKW A;  2HSZ A;  2MSN A;  5J2J A;  1RYS A;  4EEY A;  1WUD A;  3ISC A;  3BDP A;  4NLK A;  3H0R B;  5L1L A;  1FIQ A;  2NRX A;  4Y2Y A;  2KVS A;  2PI5 A;  1ZRM A;  2W9M A;  4C7Y A;  8ICJ A;  4M2Y A;  2V4R A;  3EPG A;  4MFF A;  5KT4 A;  5AKJ A;  1Z00 B;  2XCP A;  3LWM A;  2BQ3 A;  1UQV A;  3JPP A;  4MHV A;  1ZQD A;  4AP9 A;  5AM4 A;  2YB1 A;  5KAI U;  3BQT A;  3H8W A;  3H8M A;  3GIK A;  3CYM A;  1X40 A;  2AHO B;  4RPY A;  8ICE A;  3Q8M A;  4B9T A;  5HHI A;  1ZQU A;  8ICZ A;  3TAD A;  4BXO B;  3V7K A;  2FDR A;  3NVY A;  4QWD A;  3AQE A;  1L3T A;  1NJX A;  1DRG A;  4FS2 A;  1KL9 A;  4O3S A;  3HW8 A;  4O3M A;  1QQ6 A;  3QNM A;  5AM5 A;  4F4W A;  4F5R A;  2E3T A;  3FDS A;  4I2A A;  5ALW A;  1ZQF A;  3AEV A;  3BS7 A;  2FPK A;  4XQ8 A;  3UXN A;  2BPC A;  3IDW A;  2DQN B;  5ALP A;  1NKE A;  2KZ3 A;  2ISO A;  2Z7J A;  2LBO A;  3SR6 A;  1NZP A;  5HNK A;  1PK1 A;  4M6W A;  5KTQ A;  5D46 A;  3M1Y A;  4P2H A;  5CWR A;  4ECR A;  3TAP A;  9ICI A;  5J2B A;  3SV3 A;  4TUQ A;  2W8L A;  1QCK A;  1SV0 A;  3WK7 A;  4EEK A;  4KLS A;  3KKA C;  2AGQ A;  1JUD A;  1YT3 A;  4YD2 A;  4DWI A;  4OJL A;  4RUC A;  4A8E A; 
#chains in the Genus database with same CATH homology
 2YQE A;  5K4L A;  1KKX A;  2EQY A;  4LJX A;  1RYU A;  2JRZ A;  2KK0 A;  2JXJ A;  1KQQ A;  2RQ5 A;  2OEH A;  1KN5 A;  1C20 A;  2CXY A;  1IG6 A;  2LM1 A;  2LI6 A;  5CEH A;  2EH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...