2YMQA

Chloropropionic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
225
structure length
224
Chain Sequence
b'SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 91
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymqA01
4Y2RA 2C9MA 3DAOA 5ALPA 2P9JA 2PKEA 5AW2A 2YJ5A 3EPRA 3N1UA 3ZU6A 1SWWA 5ALZA 4XPZA 5ALHA 2ZOSA 2W11A 1L6RA 3RF6A 1S8OA 5AKLA 2YMMA 4UMEA 1U7OA 4RESA 2YMLA 4Y2PA 2WM8A 2X4DA 3NALA 5AK4A 2W43A 2JAOA 2MU1A 4CF5A 1N9KA 3W5DA 1ZD5A 3ZVLA 3MC1A 3M9LA 5ALKA 2YJ3A 2CFSA 1ZRMA 5AI0A 2Q4RA 5AVVA 5AVZA 4EX7A 3U7HB 3OCWA 3AR2A 5AKXA 1RQLA 4BKMA 2I6XA 5ALMA 3WK6A 1Z4PX 2HI0A 3PDWA 2R8EA 4C4SA 2YY6A 3N8GA 2WF5A 4DFDA 4BX2A 3PCTA 3R9KA 3WKAA 3I6BA 1RMYA 4FYPA 1Z4MA 2D2VA 3WK4A 5AW0A 4MUMA 2RBKA 4YGYA 5A3SA 1Z4KA 1RQNA 3UMBA 2EARA 3QUTA 5AW1A 1ZS9A 5ALSA 4CF4A 2WFAA 1L7PA 3L8FA 5AKYA 4ZEXA 2FPWA 2AMYA 3QLEA 4IFTA 4AP9A 3ZWDA 4DCCA 3B9BA 5AM2A 4C4RA 2FPSA 2BDEA 1U7PA 4F71A 1U2SA 5AI4A 3DDHA 2HF7A 2VKQA 4HGPA 3BA6A 1Z5GA 3OCZA 3I76A 3U13A 2FPXA 5ALTA 3N5KA 5A3RA 3MPOA 3ZTWA 3DV9A 2WF6A 1N8NA 5ALUA 4QQFA 1QQ7A 4PNHA 1U2TA 1RKQA 3QNMA 3QU9A 4XOUA 2I33A 2JGAA 4KX3A 3OCYA 2CFRA 3N07A 3FGOA 4MWOA 2Q5EA 4JDPA 4NAVA 1YDFA 1CQZA 3KC2A 4L57A 5T41A 3SD7A 2O9JA 4KNVA 2BY4A 2HHLA 3ONNA 4YIHA 5AI9A 4Y3UA 1NRWA 3A1CA 2I54A 4I9GA 4L6CA 4Y2YA 1YS9A 2RARA 2HEGA 2BDUA 2IOFA 1YNSA 2G09A 3OPXA 5ALVA 3N28A 4FFDA 5AK6A 2ZBFA 1O08A 4HGNA 3QU5A 3L0CA 4BX3A 4FE3A 4C4TA 3BWVA 3U19A 1Z4JA 3NANA 5ALXA 4KYTA 5AVUA 5AW4A 1TA0A 1RDFA 3NASA 3WKDA 1QYIA 2P27A 2R8XA 3IJ5A 5AW6A 3UM9A 4E88A 3FZQA 1RPZA 4UW9A 3MN1A 3HYCA 4EEKA 3L8GA 2YMQA 4BNDB 1T5SA 2OA0A 2CFTA 2NO4A 3OCUA 2Q4TA 4NABA 1MH9A 2GHQA 1NNLA 3SMVA 3ZX4A 3QX7A 5FP0A 4EENA 1LTQA 3PGLA 3ZTYA 2MSNA 3WKBA 2YBDA 4YCMA 4J2TA 5AK5A 3I28A 2G08A 3QU7A 4BYGA 2G1AA 1WVIA 2G07A 1LVHA 1T5TA 2CN1A 2G0AA 4F72A 4IG4A 4QJBA 2P11A 2WF9A 4Y2SA 2PQ0A 3AR6A 2OM6A 2GO7A 3VAYA 3AR9A 1Z4OA 4UASA 1EK1A 1RKVA 2HO4A 3MMZA 3CZ4A 3FVVA 3WK7A 4CF3A 3ESRA 5AW8A 3ZVMA 1L7NA 2EATA 2YJ6A 3E84A 4Y2QA 2FDRA 4Y2TA 3ZWKA 2DQSA 3ZUPA 5AM1A 4HGQA 2B0CA 1RLMA 2I34A 2PR7A 2I55A 5A3QA 1KYTA 2YJ4A 4EX6A 1TJ5A 5JJBA 5AIBA 1S2OA 1RKUA 4UATA 1F5SA 2ZBEA 3ET4A 4YH1A 3QU2A 4HGOA 2C4NA 2IA5A 3OCXA 2B8JA 3ESQA 4YCNA 4CE6A 4YIKA 4UM7A 4GIBA 1SWVA 1Q91A 1ZD2P 1U02A 2WF8A 2ZXEA 4UMVA 1IWOA 3KBBA 1RRCA 4DWOA 5ALFA 3WK5A 4HAIA 2ZBDA 5AI6A 4Y2JA 3A1DA 4O8CA 4KN8A 1TE2A 3WKEA 2IOFK 3A1EA 2IYEA 3L1VA 1O03A 5ALLA 2R8ZA 3OCVA 1Y8AA 2FPRA 4KNWA 3RFUA 1VFPA 3F9RA 1Z88A 5AW7A 1J8DA 5ALIA 4AS3A 2FEAA 5AM3A 2NYVA 1Z4QA 2JAWA 4NWIA 5AVSA 2ODAA 4ZEVA 4AS2A 3L5KA 3B8EA 4BBJA 5AW3A 3WGVA 4G9BA 2C8LA 3L7YA 3WKCA 2RB5A 2OYCA 4XE5A 5ALYA 2AH5A 2FUCA 1XPJA 2C88A 5AI8A 4J03A 4XQ0A 4CNQA 3R09A 1QH9A 4BEVA 2FUEA 4OCZA 1ZD4A 3KDPA 3EWIA 3SHQA 5AKHA 2GHTA 5ALEA 2EAUA 3EF0A 5AVYA 5ALNA 3SF0A 3L0BA 2WF7A 3GYGA 1CR6A 3A3YA 1ZOLA 5E0OA 2B30A 5IS2A 5AW5A 4YCLA 3L8EA 5AK3A 5AKIA 4RETA 4BNDA 3PGVA 2GMWA 4Y2XA 3SKXA 3L1UA 3E58A 5ALQA 2HF2A 4NFLA 3KD3A 5ALJA 4UMFA 2ZBGA 3ZI4A 5AW9A 2R8YA 4UMDA 3WK8A 4UM5A 3FM9A 3SLRA 1RLTA 2HOQA 2IOHA 3ZX5A 3ZW7A 5AVWA 1ZJJA 1XVIA 3UMGA 4BX0A 4DW8A 1NF2A 5ALWA 1Q92A 2P69A 1FEZA 3QGMA 1T9ZA 2G06A 1WR8A 1VJRA 3NAMA 1L8OA 1TJ4A 4ZEWA 5IT0A 4BEWA 5AKGA 3I1YA 1EK2A 3OTQA 1PW5A 4GXTA 1RMQA 4HGRA 3IB6A 3E8MA 2G80A 2B1RA 3E81A 1SU4A 5AICA 2W4MA 2HSZA 5AM0A 5AM4A 4I9FA 5ALGA 4UU1A 3W5AA 3QYPA 1YMQA 3AR4A 2MU2A 1WZCA 3B9RA 2NO5A 5ALOA 1L8LA 4G63A 4EELA 4B6JA 3WK9A 5IT4A 3AR5A 1TJ3A 2B8EA 5AVXA 3AR7A 3QUBA 2C8KA 3NRJA 3U7EB 5AVRA 3W5CA 1L7MA 3QXGA 2HCFA 2I7DA 4HYTA 3KOOA 1RC8A 3FPSA 3ET5A 1YV9A 3J7TA 4JB3A 3QUQA 2O2XA 5AI5A 4UAVA 5ALDA 4Y2VA 1X42A 4UAUA 2ZG6A 3CNHA 1L7OA 3KZXA 2YFYA 1XP5A 1AQ6A 1JUDA 3K1ZA 5AKKA 5ALRA 1Z4LA 4UARA 2AUTA 1RLOA 2HDOA 3QU4A 3EF1A 3D6JA 2JAUA 2YN4A 3ZVNA 3U7GA 3IRUA 3HLTA 3S6JA 2YMPA 3WGUA 4OD0A 1WPGA 2B1QA 2QYHA 4NV0A 2GFHA 5AESA 3M1YA 3SKYA 3TLMA 2HX1A 3ED5A 5AHXA 5AKZA 4OFZA 1J97A 2JARA 2WHEA 2FI1A 1RMTA 3DNPA 5AVTA 4L6AA 3W5BA 1Z4NA 3NIWA 2QLTA 1ZD3A 5AM5A 3U26A 3UMCA 2AGVA 3QUCA 3NUQA 3R4CA 5AKJA 3U7FB 4OHFA 4UU0A 3L0YA 5AKEA 4KX5A 5AVQA 2RAVA 3L8HA 4Y2UA 1YJ5A 5AIAA 1ZRNA 1QQ5A 1VJ5A 1Z5UA 2FPUA 3FPBA 3P96A 2OBBA 2B82A 1Z4IA 1QQ6A 4H1WA 1K1EA 4EZEA 3AR3A 3AR8A
chains in the Genus database with same CATH superfamily
2HHVA 2ZWIA 1XEXB 3UPUA 2XWPA 5CLFA 1RZ3A 5TPWA 4BUGA 4BNFA 1DAPA 5FBQB 1H5NA 1JECA 1ULHA 3HJRA 2DFNA 4O02B 3WMWA 9LDTA 2G36A 4F9EA 1GXSA 2FR8A 4C76A 2OK7A 2CC2A 1KF0A 3KSMA 1N63A 4U7DA 1EGVB 4BXOB 1YI0A 3SDZA 1Z19A 3EIFA 1BVUA 2Z2KA 3CPJB 2NAPA 4ENTA 3I52A 5KC8A 5A03A 5IBQA 5JUMA 9ICTA 4M1MA 2RONA 1ZI6A 2QAIA 4BPRA 5IJXA 4OAPA 1WCWA 4CTKA 3DLIA 4ID3A 3ZGLA 3QVXA 3ZV7A 5G40A 3EGIA 2Y0CA 4JJ6A 5KYYB 2FLPA 3ZDYB 3NZEA 1YZ7A 5MN5A 2A0XA 4U7TB 4QTZA 1JDUA 4DMCA 3FGOA 2NM0A 4MKGA 4QBTA 2RHMA 3IQFA 2Y1KA 1HT0A 1NRWA 4OVKA 3IHTA 5TT1A 2ZBFA 1R50A 3LWBA 4Q1VA 2H1FA 2DJIA 3D8NA 3B1WA 1J6UA 1PZFA 5F52A 1KI2A 5KL1B 3G2JA 4CKBA 2XYVA 2Z0MA 1R4AA 4D80A 3H42B 3W3ZB 3ZDFA 2I2FA 1GLNA 4NZPA 3TE6A 1R6UA 4MCHA 4R66A 4HUQB 2OBLA 1SCKA 3VU3A 1P2UA 3A9SA 4BGEA 3BHNA 4O5OA 2NU9B 1O94D 4B35A 2AB0A 4KR2A 2W6CX 3QEOA 3ROMA 3HSKA 1SZJG 2CLKB 4WK6A 4QODA 5J3JA 3L5OA 1TGVA 4Z3OA 2XB8A 1ZD2P 3IUMA 2CUTA 1Z07A 2VRWA 4H1TA 3FZNA 5ALFA 4AF8A 3GDGA 4CQMD 2HSEA 1E4YA 4ZTBA 1C1DA 5CNIA 3ENKA 3TBHA 1YTLA 2BHRA 4Y1GA 1K3FA 3BN3A 5BO5A 3ZD8A 3FRIA 5F12A 2HLHA 4IM7A 4Q01A 4RU9A 2X15A 1GYQA 4ERXA 1GRNA 2PZBA 2KSQA 3CRVA 1P1HA 4V0QA 4QU9A 4I2EA 3E0FA 4N9WA 1DQZA 1A72A 1FA9A 2XICA 4F4WA 5TISU 1ZM3A 3MMSA 1CWUA 3KJXA 5DXFA 3BWXA 1L8AA 4LZWA 1IAVA 2HBRA 3FCXA 3DAFA 4RWZA 1BU5A 2HREA 4AKIA 4TS1A 4DIBA 1RXWA 3IELA 4KQMA 3Q15C 1YWGO 3ECSA 2V9ZA 2EC5A 2D8CA 4IXWA 4G9EA 3SYZA 3W5UA 5K5EA 2I67A 3BHJA 3ETLA 4ENPA 1BXGA 2OCEA 1AQNA 2B36A 3LCRA 3UJ9A 2GCIA 3HVHA 1KWKA 2PD3A 3UT5B 1DUSA 5IWCA 1A8QA 1GHTA 3ICWA 2V6MA 5DNCA 5A0FA 1TK0A 3HYNA 4RENA 5FD8A 2P2ZA 4UAVA 3P2JA 2W2QA 1DQNA 4LNAA 1GWNA 2OCKA 3DLHA 1T3GA 1GJRA 1DWUA 1EFRD 5L95A 1DBPA 5GZ6A 1Z6XA 4G37A 1GM5A 1DKMA 2AI3A 5IK2D 2RGGA 1K75A 4JWTA 3T5HA 2VA3A 2NU8B 3AFHA 1LDYA 4TRJA 4J43A 3LF1A 4KN9S 4C2UA 3LSTA 5KNDA 4FFBB 1J5PA 2EVWX 2AI2A 4PRYA 3TPZA 3V1NA 2A9QA 4PPGA 3G8CA 3JW8A 4C03A 5CBPB 4OHOA 1ZRNA 2D0DA 3HJBA 2QB1A 3T1TA 4E94A 4F46A 2J6TA 4MDYA 1APBA 1QIKA 3LPAA 1F2UA 3OQPA 1NDUA 3B5JA 3BL6A 4W4TA 4P54A 4DC9A 3C74A 3CSUA 4BLWA 3O73A 3QFSA 4Y2PA 1LLDA 4NNJA 3W1VA 2FSIA 4FW8A 1QSYA 2IP1A 1CYDA 2R9VA 3R3JA 5T6BA 4WGFA 2BI8A 2QXUA 2V7BA 2O1SA 4RS4A 5H9VA 2BHSA 4DXAA 2QZSA 3H3FA 3WWCA 3ADPA 1WXIA 4FFLA 2YNMD 3RF7A 5FDFA 1VL1A 3DEIA 5EL0A 4GZLA 2YX1A 3CX7A 2UXBB 4RK0A 5I9BA 4OY3A 1K5HA 1RPLA 3TINA 1XRNA 2ECKA 5KMGB 1WKVA 3DF7A 2JIDA 3E7PA 1EAMA 1MP0A 4S35A 5C1PA 5TMDA 2OP1A 1WOMA 5BN5A 1AS3A 4CWAA 3ZKAA 4IWXA 1UANA 3CQ9A 1NBMD 4FE4A 5JZSA 1C3JA 3GLFE 3MDAA 3SLKA 3QEMB 3ZK8A 1KGSA 1IZ0A 3RAQA 1ZQAA 1TVMA 3PE4A 4C29A 3KJNA 3OA2A 3TB4A 1ZJMA 4NX2A 3GAAA 1NDQA 3QEJA 3CINA 4Z4HA 3SJBA 4P3YA 3R77A 5E7IA 3V00A 3R8FA 4DEXA 1TK9A 1PO7A 3VZDA 9ICJA 1RPZA 2IXEA 3GRCA 4BNDB 4O3OA 1M73E 2YBDA 1W73A 1V7ZA 3TTSA 1ENYA 4O2AF 3OJFA 1W9MA 4BCCA 2VSYA 1FXUA 1EWVA 1L7NA 3PO5A 4BFXA 1WG8A 5ETJA 3V7YA 4HMOA 2C99A 9ICBA 2YYZA 3WE7A 4RBNA 2BC9A 5LA6B 3P2EA 3H9JA 4HJXA 3OOYA 2FEMA 3FPAA 5CDTA 1KU0A 4YCNA 2O07A 2UV8A 4U7FA 2CDAA 2ATXA 3GJXC 3SHWA 1UFVA 1Y7LA 4CM7A 3A1EA 4CTOA 3AUJB 1EDZA 1N7JA 3X1JA 4CM4A 2PMZF 2WEKA 3K16A 1GTL1 2GN2A 4E12A 2Y6VA 2ONYA 4CGZA 4JEIA 1U2ZA 1YRYE 4LRQA 4Y1FA 2OO3A 1MV5A 3SZ3A 1YI1A 2W42A 3EVEA 3IDFA 4IV0A 4OCZA 4AN4A 1CRPA 4FBMA 1YB2A 3P2MA 4IEIA 1WCYA 2CCGA 3KSRA 2BV3A 3C2MA 4XYBA 5A05A 2ISSD 2A3RA 5D3ZA 2L17A 4P7JA 3GBSA 1JTVA 3KKMA 1HDEA 3U40A 1Z25A 4KLLA 4X91A 4US0R 3AM1A 3F9CA 3TAQA 2WRZA 1M76A 2WAMA 3LBFA 4KTQA 2BE9A 4IWNA 3GRAA 2J46A 1NK9A 3OZIA 1EJ0A 3H17A 2B4YA 4HS4A 4DQKA 4KXUA 3QBJA 1W34A 3VYRB 3FOFC 2HRQA 3J80A 3J81k 5BUCA 2ZI4A 4DM4A 3WLEA 4LY3A 4ED9A 5AM0A 2J4CA 1EXVA 1DB3A 4BFCA 5J2UA 1I7NA 4A0SA 1HFKA 3GRYA 4DR1B 4WSOA 4B6JA 2B8EA 4C5CA 3I6QA 1FJ2A 4EO7A 1UP7A 2CVZA 3IV9A 5FOWA 5JH7B 5TB5A 4Y2VA 1RJEA 5C9ZA 1RYNA 1JPJA 3LLCA 4L50A 2KD1A 5GJVC 2BEKA 2XMPA 2ZJ0A 5E4YA 1YJAA 4CDGA 1FUIA 3G88A 1T0PA 5L4LA 2Q5HA 2TMGA 2Y27A 3DV0A 3R44A 3EZ6A 4TKMA 5C7LO 1QIIA 2TMYA 4INOA 3UXYA 3LFHA 3M3DA 3KE9A 2DWUA 4YDRA 3T3GA 2OD2A 3OTIA 3SQLA 2YNMA 4R0VA 1RQ7A 2RGBA 4WGGA 4JU8A 3BQ7A 4UAGA 2JLXA 1Q0HA 5BSFA 4JC8A 3N2EA 1MT0A 3G2IA 4RV5A 3T34A 3PG5A 3VR3A 1GGKA 3RAJA 3RH5A 2ZVQX 1X9MA 2NUBA 4FFMA 2WMYA 2Y0EA 4KJXA 2SKDA 5JXHA 5E8RA 2WU8A 2BT4A 2EU8A 2D2IA 3UY4A 1XMOB 2VZLA 1P1IA 2JIOA 2HK7A 5B3JA 4I8IA 4O0LA 1T4GA 2QN6A 3SPXA 3NBUA 1PJSA 2PKCA 1E1CB 4HMQA 4CYMA 3C8HA 4YRCA 3DPSA 2Z8YM 3RUDA 3D5QA 2OAP1 1E9RA 2XEXA 4CIBA 3QI7A 2YVLA 1P0FA 3L01A 2O52A 3L0PA 3EG9B 3BA1A 3DC7A 4XWTA 2VQFB 4D74A 3MWDA 1JMKC 4ZVTA 3BMOA 3ZY2A 2JFWA 3FDJA 3ZDXB 2V9WA 3OUUA 1QO0D 2JMGA 6AT1A 2I54A 3IDAA 4INZA 4V39A 1JA1A 1B0ZA 1WQ4A 3JD0A 5KQSA 2W2XA 4PZZA 1QAOA 2NT3A 3GEMA 4ZAVA 3LFTA 3GAFA 2VPPA 4ARCA 2J67A 4UPEA 1J0AA 3LY9A 3RUFA 2Q1SA 1NC1A 4ZRMA 2ZQYA 3L7IA 3OLCX 5BR7A 3QVOA 2WM9B 3NASA 4F93B 3PLAE 2BFEA 1M2VA 1MV8A 2Z58A 3EA5A 2BPFA 3RS9A 2I6QA 3OMXA 5E79U 4IDAA 1WO8A 2YXBA 1KRHA 2G1KA 4ZO7A 1WVIA 4ZTZB 2ZRPA 2CVHA 2RJ3A 3BWCA 2P9BA 2IFTA 3ZU3A 3KXDA 3RIYA 1P3DA 3I2GA 1PKXA 2VSXA 2JIBA 4Q19A 1D8AA 2FMSA 4A23A 4GT1A 2WZCA 4V03A 2OV1A 2I3DA 3NTLA 2FYTA 3VFDA 1QE3A 3KEMA 1R5NA 1IZ9A 3T5AA 3ZOKA 2FAXA 4B9VA 3L4PA 4WOKA 5F98A 1S2GA 1R6BX 5LNK6 3FRHA 4JXXA 3NVVA 3DHVA 4M9QA 1ORIA 2XY6A 4JH0A 2ZUTA 1IN5A 2ARKA 3RVLA 5JJLA 3X43A 2DTXA 3FNRA 5TGZA 2QUIA 4TYNA 3TZ6A 5H2FU 2WABA 5KG6A 4I50A 1KDHA 5CTAA 4WV3A 3LYAA 1MG0A 1Z5WA 4EG6A 1SD5A 3Q5DA 2HA4A 2B30A 2ZBUA 5F3RA 3O8CA 1WIWA 5J59A 3L8EA 1EUQA 3ZGZA 4IEFB 4QYIA 2E89A 2FK8A 1JE1A 1U1GA 3HEBA 3C7KA 4DA7A 2ZUDA 3K1JA 3EGXB 3K35A 1ODCA 3ED1A 2HSGA 1NSYA 2GZ1A 3STUA 4Q15A 4M88A 1T6BY 1F17A 3E8MA 2OV6A 1ADBA 5CVJA 5C0OE 2VP4A 4AZ3B 2C9BA 1SC4A 1QAQA 1H1LA 3PFCA 1HDXA 1SC3A 1NX6A 3ZCSA 2HZBA 1WNTA 1XN1A 5HOQA 4GSKA 1R0ZA 2PMBA 4BJ3A 3ZH9B 5CFPA 5JOQA 1GQ2A 3PS9A 4ZVLA 1S8NA 1R9GA 5HDQA 4X84A 1UH5A 2YBEA 5JHGB 3PW4A 2HUPA 3OZDA 1KOLA 4TLBA 1C3LA 5KT7A 5CIWA 2JARA 4JX8A 1S2LA 3HN2A 2E7ZA 4HPWA 4NONA 2YQ5A 3G1WA 3NUQA 3FIJA 3B6EA 4K2HA 4HLUC 4DMGA 1Q0UA 3R4VA 1QSSA 1H6AA 3O2NA 1LI7A 4K6OA 2VPQA 4FOOA 1E9CA 1NVUQ 5KKNB 4GS5A 2BF4A 3QVTA 1WHSA 4OP1A 4BQFA 3V42A 2Q99A 4H1WA 4LNUA 1YONA 1OWMA 3JVEA 2JLCA 4ZV7A 2I9KA 2Z43A 1MORA 4G9GA 4UBCA 3A3KA 2KJ5A 1VHJA 2Z56A 1SXJD 1K0FA 3PC8A 2P79A 1N57A 3JZIA 4E22A 2C2MA 2XGOA 4X54A 3PXBA 3SFTA 3BEDA 3EQZA 3K5IA 4OYLA 4CTNA 3PX0A 2EGGA 1TU3A 1ISFA 1K8RA 1YRAA 2IYNA 4UDXX 2WTMA 1QO0A 4I81A 2FMFA 2JBWA 3FFAA 3JWGA 2PNFA 2IS2A 1XEWX 4D6PA 4YY3B 5JYCA 4P4LA 2I6FA 2WHPA 4X95A 4F71A 3TTUA 3AU8A 3Q1KA 2PXCA 1E5XA 2W9CA 3GDXA 5IYZB 5IJ9B 1V43A 2QIPA 3PEUA 2GBPA 1YR7A 3IKTA 4YCXA 1J2RA 5SYNA 1P6XA 2JLAA 2PD4A 2J31A 2A9KA 2G28A 2R8OA 4HYEA 5P8WA 3K15A 5KUTA 1XR3A 2CCKA 4WXRA 1FUEA 2R44A 3CLHA 1L3IA 2WMDA 2FW9A 2QPOA 5EHXA 4US2R 2E8OA 4M7PA 2WA1A 4GYJA 1Q19A 5JAUA 3BD9A 2DTDA 3O8NA 2IYAA 4FOPA 4JT8A 2EERA 2VSOA 1ZC3A 4TROA 3IESA 2QLLA 1Y4ZA 1FLNA 4D5EA 2RGUA 1AOXA 4YS6A 1M8FA 1Z75A 2LIPA 2X7XA 2G07A 3SJUA 2D5AA 2NPFA 4TMXA 2QL6A 4PAQA 2SNIE 4FUTA 2WAQC 3CUSA 2GJKA 4F3NA 1Y1RA 1ZQ1A 3QEAZ 1EK1A 2ORWA 4R3WA 4WOBA 3E84A 4OKSA 5DXAA 1QK4A 5ECDA 1Q0ZA 4D0RA 3DBRA 1ONBA 1RM6C 2MSCB 1AKWA 2E8PA 3THXB 4X6UA 2E5LB 1T3QA 4LSWA 1IM5A 2QTFA 2Y8EA 5CLQA 3HXLA 5JTTA 5LQJA 4HVAA 2DEUA 4JSYA 3FPKA 2OESA 3OM8A 4IUBS 1OIVA 3PYLA 1ZISA 4KWEA 1FMJA 2BEUA 1B15A 2IUSA 2FSPA 1ZVMA 4K9KA 3HABA 1XD2A 1Q74A 2D0PB 3GJ8A 4HQ6A 2YCLA 4H59A 4DG8A 1XBTA 3BMNA 2ONCA 1D3AA 3CLKA 2IHMA 4J4TA 4IIJF 3DKVA 1Z0JA 3I0MA 3Q8SB 4IOJA 5E0OA 3LDGA 4CFZA 4DUPA 5K0CA 4RTKA 3NATA 1TXGA 1GQQA 1PJ2A 5CK5A 1BE6A 1V8ZA 1CR1A 3M6UA 2YQZA 3ZBQA 4NCIA 4KQ6A 3FR7A 2NTNA 4NS4A 2PL1A 2WJWA 1BVHA 4EF4A 1RM0A 3ZWVA 4LXGA 4BEWA 4EL5A 2KE7A 4DC1A 4YFKA 4X3PA 2CZGA 3NT4A 4EOGA 3TLKA 2KMLA 3RAXA 3R9XB 4HWTA 1DHTA 3OCCA 5MGNA 4OLAA 1Y4UA 4QRIA 3N86A 4KODA 4QOFA 4YPFA 2NU7B 1LZKA 4R2IA 1F06A 5G2OA 3ZR4B 5G1NA 2O7NA 5J0YA 4M9XA 2AWOA 1H3EA 3KWLA 3TFWA 4XLZA 1SXJA 5AO9A 1E2MA 1T9BA 2IU0A 1LRLA 4NXZA 1TRHA 2IZ6A 4IDHA 1T29A 1N2SA 1UEJA 2OO5A 3A4MA 5B55A 1QYWA 2KKVA 1GQOA 2UU9B 2H2DA 2W2VA 1UPBA 4F2PA 5DGXA 4DL6A 2C1ZA 4LN1A 4Y2UA 1E7WA 4LF7B 2RH4A 2I3GA 2QUZA 3TGPA 4YXFA 1E1RA 4KFUA 5A4MS 3KSDO 1L5KA 2O2IA 3C5HA 5HILA 5FX2A 5D5PA 2Y05A 3FOCA 4JBGA 2NW6A 1WW2A 4QZEA 1YCGA 1L1RA 1LLUA 5DTMA 4A2WA 4C20A 2J9RA 4EX7A 3SIXA 4DNOA 3C8MA 2XGJA 1AQIA 1RQLA 3QIVA 2H00A 1Z4PX 2R2GA 1GCUA 4KVZA 2OV4A 1UQUA 1SG0A 2FCRA 1Y6JA 3KKZA 1HEUA 9ICNA 4IHJF 2J3MA 2YS7A 5KWSA 3ZWAA 1P62B 4A8JB 3SMQA 4N65A 5CPBA 4GHWA 3IO3A 3SYMA 3H1BA 1PK1B 4ZRNA 3AO0B 5J0XA 3OZCA 3WHPA 5L3RA 4EZ9A 4KREA 1ZITA 5HTOA 2BFMA 1SBNE 3GT4A 4DBVO 1PDVA 3FHTA 4WBNB 2OXRA 2NUTB 3LC2O 5D49A 3P19A 4R2LA 4M37A 5KTOA 4RQ2A 1D6JA 4B0PA 4UFPA 4FZVA 1FMTA 3QLVA 4XIJA 4RTJA 4ZZ3A 4DS5A 5HXAA 4XQCA 1QSGA 3L8ZA 1CB0A 3VDNB 1CQPA 3CLTC 1LI4A 4DB2A 1I2BA 3UATA 5CB4B 5U4QA 2F00A 3SX4A 4CMIA 1PDOA 1GNRA 4MW7A 4PLVA 1QGYA 1T4DA 2ZRCA 3GLIA 3KJFA 2P77A 4IP0A 2C4VA 3AKYA 2ZE5A 2H5LA 4R8RA 2ZTMA 3V2IA 2ZDHA 3WYEA 2QZPA 1R00A 2F6RA 4HRXA 1JR3E 4M98A 3NBKA 1QHGA 5KFWA 1IZZA 3BT7A 2P9QA 1R64A 4X44A 5D3MB 2PL3A 3Q0IA 2BP7B 2OCBA 4BNJA 1GA1A 3A4NA 2E48A 2DRIA 3NNDA 4LDNA 4C8KA 1T2EA 3A1DA 4YAEA 5CJPA 1VG0B 2XT0A 3UGQA 4Q00A 3SHFA 2R7LA 3DTNA 1RU3A 3DHEA 1LNSA 4O4JF 1JAHA 4AB1A 4XQ9A 5LIPA 1VFPA 5LQNA 3WICA 1PP4A 3KEGA 1A2QA 5GY7A 1NVTA 4B81A 4B3BA 2NUAA 1MB9A 2XQFA 1ZZGA 1BC5A 3WSVA 3RWOA 1B8UA 4KR3A 3MOIA 4TMWA 1G7TA 1GTJ1 1RJWA 3LQ4A 1KL7A 3V48A 5KQMA 2XMBA 5JSZA 1WWKA 3NVZA 1JXQA 2B0JA 4BQOA 2WUWE 5EA2A 1CJSA 3OQ1A 2E49A 3EXFA 3F4BA 1FU4A 3DZIA 1KU6A 3X1ZA 2GEDA 5KNCD 3KVRA 2IU3A 3IPRA 3R6TA 1ZQXA 2WHXA 1RAAA 2XDQB 1Z34A 4Q4HA 1NXTA 2HK6A 3LFUA 4M53A 5LQKA 1JA9A 4EG8A 2EJTA 2Z3ZA 4CEIA 3ZWMA 1P1BA 2VJ4A 1ZMOA 3I01M 4BO6A 1GNLA 2X8JB 2ASVA 5BYAA 1X70A 1W8DA 2GCPA 1XE3A 5CHYA 5TQVA 1GKKA 1PL0A 1AM4D 2YXNA 3AM9A 2YWBA 2Y1GA 1GRCA 1QDEA 4MULA 2M2IA 5BWBA 1DL5A 1KHHA 4NARA 3LHFA 3QMWA 5JTUA 3A6LA 3IP3A 3ZQUA 3U7JA 4KFTA 5T5QA 1ZXXA 4UBNA 3EY9A 3I12A 4F4CA 5DOZA 4GFJA 4L4SA 5JADA 2OZLA 3H6HA 1H05A 3CUEF 3U7FB 4CVNA 1BCSB 4RZQA 4NEHB 1N3LA 4M0KA 1K5GA 4D42A 4BJ6A 1MC8A 3T7CA 1P5HA 1COKA 1VL2A 3FH0A 3JQAB 2VTVA 4YECA 1W88A 2O0KA 3I8SA 3IAEA 4F3OA 2GOYA 3FYSA 2QR3A 5KFMA 2PGLA 3RBEA 1W6RA 4RESA 2ZRHA 1N2OA 4L8LA 4G0UA 3F4KA 5TJHA 4ZT6A 3HK2A 3FIUA 4ZGWA 4LVOA 3WLMA 4D3ZA 4BLTA 4TTQA 3FETA 5FO0A 4M0FA 4JV5B 2JI7A 4MEAA 1MX1A 2DSTA 2V9PA 2FFAA 4DFDA 2D4HA 2J09A 2WJVA 4QM6A 4CQLB 4WZBA 3ZLVA 2OXTA 3TUIC 4JQZA 1L5WA 1JFVA 3ND6A 1QIEA 4N7MA 3DTVB 3INNA 4YFYA 2Q5OA 2K4HA 4QGHA 2XUQA 1E1YA 1JDBC 4F7DA 4E14A 1PLKA 3U0VA 2Y66A 1ZHHA 4ECQA 1HE5A 3IVXA 3GGCA 1P75A 1U3UA 2J85A 2ZXFA 1QS0B 4IZOA 2QB0A 2WE8A 3BQ0A 4I2VA 4RT3A 2FXVA 2DPJA 1O2DA 2XUIA 3U9TA 4B4KA 1IBLB 2XB4A 4EZIA 3SSOA 1I4TD 3MB5A 1YS9A 1V37A 5REQB 1O57A 3T9FA 2NXJA 3X1DA 2R25B 4KK3A 4N54A 4WKOA 1OXXK 2QD3A 4C4TA 1OD6A 1G4AE 2BJWA 4E03A 4PG5A 1GQFA 2RI0A 2EZ9A 4E88A 3MN1A 1KJWA 3A14A 1I1QB 2I4RA 1UKAA 2V7PA 3OCUA 4EENA 4BDPA 2JFUA 4E5PA 4PW0A 4KC0A 1KZ9A 2TSYB 1SK8A 3ZIAD 1O77A 2WF9A 2O0HA 3A36A 3CP8A 5PGMA 4AL4A 4HXEB 4Y2QA 4PZ0A 4Y9RA 1GPH1 1I24A 1PJAA 4DGQA 3PXUA 1YE3A 2QZ4A 3U44B 4MWZA 3CVUA 2F9FA 2V6JA 2PFNA 3P32A 2QR5A 1ZGGA 4E7OA 5J2CA 5JWOA 4X7MA 1E6KA 2JKZA 3PV0A 1BFKA 1MJ5A 4KN8A 3T99A 2Q5JA 3EGCA 3GFFA 2JRCA 2DQYA 2DQZA 5H7XA 2O3SA 1J8DA 3K30A 3JQ8A 5J4KA 5KFIA 3H5WA 3QXCA 4G9BA 1ETHA 3TSAA 1FXWF 3AY7A 1IIBA 5KFKA 4LRTB 4AWAA 3G0IA 1Z2DA 2C88A 5HUHA 1NJ6A 4AUMA 2C78A 2FWNA 4I4LA 3KQSA 1EVKA 4LRWA 1W5TA 4LK2A 2X0KA 2HK9A 4OOEA 4BO7A 3CJRA 3F73A 2BFDB 3I8OA 2AGOA 2IPXA 2DZDA 1Y33E 4KO8A 1OW5A 4C7OA 2NP7A 4IOLA 1X74A 4M8SA 2Z3WA 1OLUB 4EEYA 2RMKA 3BBPA 3O3CA 4Z6CA 4DHEA 4GMFA 1GRRA 3W6OA 1MB4A 2FSSA 4NE2A 3IP7A 4LY0A 3AK4A 1VECA 2A3NA 1UJBA 2ZJ2A 4QUHA 1QP8A 1TIBA 2JD1A 2IX9A 3K1AB 2BLLA 5E6UB 4R65A 3WFIA 5ALDA 3Q88A 4FINA 5L7WA 3BGWA 4W7HA 3UGKA 4HDAA 4B3IA 3ZWWA 3IMFA 2PJDA 4BLSA 1PSWA 1SHZA 2XXBA 4ER6A 3W2TA 1HE1C 1EHIA 4BY9E 3GFBA 1Z4NA 5C5DA 2WYVA 4IQFA 3W78A 1RWMA 3AI3A 3ML1A 1HGXA 3PX7A 3OIYA 1WV0A 4WK0B 5BNZA 3C6QA 1T3ZA 3QKWA 3UJ7A 1N34B 1F4LA 4NLCA 4PF1A 4MV4A 3RIGA 2JDID 2IX3A 4WACA 3EOBI 3GLRA 1M75A 3WAJA 4QTXA 3LK6A 4MV5A 1I7PA 1IB0A 3GUHA 2MRLA 2WY2D 4Y2RA 2C9MA 3VKHA 1G291 3FUCA 4CBVA 3GFTA 3HFGA 4KO1S 1NXOA 3E15A 1PJQA 4D3FA 4D9FA 2NU9A 4UQGA 4R1QA 1DVRA 1KDTA 1RWNA 2DF4B 8ICJA 1GSHA 2JI4A 4PGMA 1P8AA 5ECWA 1M1YB 2FV8A 3DULA 2CHUA 2NXNA 2WU1A 5HF8A 1L3TA 4DEZA 3DYBA 3ZWDA 3EXEA 4EHHA 3TJRA 5KI6A 3RS7A 1CUBA 3R76A 4J7CA 3TOVA 3OZVA 2Q5QA 2OZEA 1KFJB 2AOUB 2E4VA 1RKQA 4I8DA 3UQ0A 3HPRA 5D2CA 4YI5A 5A2GA 2P4EA 4BLRA 4BQEA 4TM7A 4GX5A 4X24A 1AB5A 2Z5LA 5EI5A 5BNFA 4QUJA 2AF4C 4H77A 4EYQA 1CVRA 4KRYA 1ORTA 5L45A 2YWJA 2F8LA 3H4VA 4Z9YA 1TA0A 3AUFA 4RXUA 3BEOA 3OJCA 5HFJA 5IXJA 1NJWA 4I5DA 4UM9D 4KN4A 1YQXA 3RTAA 1T10A 1Y80A 4X90A 3W8EA 2FG7C 3VC3A 3KAPA 3B38A 3IQGX 1WDWB 1YUBA 1U63A 3MFYA 1KZHA 3SZOA 3QU2A 2YQ4A 1FTWA 3OJOA 5ISMA 2E2WA 3AG6A 4J8PA 1TVEA 2DP4E 3JWHA 3IQHX 2Y1IA 2PT9A 3VPSA 1QQTA 5THXA 1RP1A 1SXQA 3ZHQA 2R8ZA 2P4SA 5CUQA 4KBGA 4PC3A 4MRNA 1KIMA 4HNTA 3O4IA 1YB4A 2NVOA 4OQYA 4DOBA 2P1RA 3JPYA 1VBKA 3QVSA 5CFOA 1TQHA 4FD2A 2BMVA 3U1BA 3DJFA 3G2MA 3RVQA 4G4SP 3SX0A 4L5AA 2Y0SF 2H5JA 4FMCF 1GPKA 3VO1A 2PMFA 3FJYA 1PUXA 2HA2A 3Q3GE 3EOZA 2JEYA 2IYXA 4I2JA 3GEHA 1I6LA 2UZ4A 1VE6A 2JD2A 4L76A 3C7CB 2WPNA 1B0AA 3IUPA 5HOEA 2WNSA 3NAMA 2CJYA 5J8YC 3D7NA 2FSUA 2R6JA 3QMPA 3CVOA 1UXOA 2ZYSA 1L4MA 2QE6A 4K86A 5B6IA 3BFJA 5J0UA 3R5FA 5KAPA 2Q0HA 2JDIA 5JQGF 3VQTA 1U3FA 4TXLA 2VT2A 2QN7A 1SZHA 1EXMA 4EMSA 3KQYA 1P7CA 4IVQA 3AF6A 3C1OA 5KWVA 2AN9A 3N6XA 3FB4A 4J0GA 4YRMA 4AYXA 2OSVA 4YCDA 3SKYA 3PDIB 2XWJI 1GARA 2VR1A 2KG5A 4YT5A 2DLCX 4D6YA 3U26A 1OKKD 3EC1A 4JS0A 5DHFA 2R7MA 1N8SA 4GXIA 1GG9A 2J3LA 1HDZA 2BGWA 3ZQKA 4TMZA 3GN1A 2J0VA 1AQLA 2OYRA 5TVGA 1XFDA 1OI7A 4TVBA 4DCSA 4PBTA 5CNMA 4J0JA 3AB7A 3K0AA 3WLQA 4BEJA 4KPUB 4NG4A 1KH3A 1LTHR 4OUDA 2W43A 4GXQA 3EGVA 3JPTA 2YJ3A 4DE5A 2PH5A 4DIEA 4G81A 5AKXA 2ECFA 1JSRA 1FX0B 4AULA 1T8SA 4G5RA 4R41A 3F2VA 2D1FA 3ZBPA 1KI9A 4BWVA 5HCIA 2DFDA 1LK5A 1D4FA 2AX3A 4OQXA 1TA4A 4RS3A 2G63A 5LDDC 1N2CE 3Q7PA 3T06B 1CX9B 4EKGA 1EVYA 4JYBA 3EPHA 3AYZB 2VJMB 3GJRA 4B45A 2PN1A 4ZEXA 5DP2A 4L7VA 5IDWA 1WB4A 3NBFA 4HAZA 3CF4G 2BFBB 3BRWD 4ZT5A 3T3PB 4D9JA 3LUKA 1T3NA 3LCJA 4YRFA 5G41A 1E2KA 3VUEA 2OORC 2ZE8A 1KJQA 2A19A 3T5JA 1PSDA 1NUSA 2JCSA 2JGRA 3NCHA 2Z2JA 4I7EA 4DLNA 4PRLA 3DEHA 3I5AA 3IDZA 4F1JA 4DYHA 3L8CA 1QF6A 2XH8A 3N7PD 3IO5A 5I51A 4Q7MB 3C7AA 2LDXA 3P7MA 4OHRA 1KQNA 3ROKA 4Q82A 2HFKA 4UU7A 1NOIA 4C0HA 4CFYA 3H19A 1BXZA 2A94A 1MH9A 5AJVB 2HPAA 2QYTA 3T8YA 3F2IA 1WPQA 1VCOA 4DILA 1HC7A 3P0IA 1LVHA 3LWNA 2X9LA 3EX7C 7ICEA 2CUKA 3I9NA 3F47A 4MMXB 4JUBA 1QHSA 1C9MA 3GA5A 4Q7LA 3H97A 4NH4A 3LRXA 1ZHFA 2KW5A 3ESBA 4X66B 2XYQA 4HZGA 2FN7A 3GCZA 1VRVA 1JX6A 3P4YA 4YHBA 2LKCA 3N7SC 3AU6A 4YIKA 3L7BA 3SS9X 3R3WA 1UBRS 2P4UA 3LX5A 4DJAA 1WD5A 2X1VA 4O8CA 4Y2JA 4LSMA 4CFSA 3DR3A 2BTQA 4C3OB 1F20A 4R64A 2FZGA 4ZDKA 2I78A 1ZETA 5J0RA 3RS4A 1UF9A 2GWHA 5CURA 4YAIA 3NP9A 2EKDA 4A7PA 3Q5EA 1K8YB 2WIBA 3C29A 3HJUA 1P17A 2CV1A 3QW2A 3HP7A 3RGWS 2ZIWB 4FYHA 2C4MA 2BONA 4IGAA 2M6LA 5B7PA 5AKHA 1E2BA 2PY6A 4RF3A 4K1LA 3PGKA 1MLDA 4I9HA 2QLNA 2A5JA 3GIKA 5IVKA 3SNHA 5A62A 2Z1NA 4RETA 4C6SA 4L74A 1U7TA 2LKDA 4FLFA 3UTCA 3NETA 2VWHA 2R8YA 1EQ2A 2O2DA 1ACMA 1W4CA 2Q3EA 3K6RA 2FFQA 3SWWA 1PRYA 3H13A 2X2EA 3LQ1A 1XTJA 1ZNWA 5BSHA 3HMQA 1KRPA 1FFHA 2DSNA 4E0BA 4ND7A 2DH6A 3V4PB 5KFHA 5AM4A 4FHDA 4GQIA 2BRUA 1LWOA 1OKKA 1QYDA 1MU0A 2JGKA 3EWNA 4Q34A 4IF4A 3UUWA 4OYHA 2CLIB 2PRIA 4HN4B 3CKYA 2V6BA 3JAWB 2FMXA 5AJTA 3DOJA 3RIMA 3TW0A 4LXTA 4C43A 4N3AA 2VH5R 3JAKA 4JR0A 5DYTA 1FVOA 1ZQRA 3ZVNA 3PXEA 1OYOA 3ZVRA 4RLFA 1V71A 1P45A 4FFOA 2Y4NA 3CLSD 4TQAA 3VPGA 1T0UA 1VE9A 4KR0A 1XROA 2VQ6A 3W5BA 4DY6A 1FC0A 3DZBA 1GDTA 3JPNA 3NKLA 4DY4A 4ZDJA 2R5NA 2HU8A 4E2YA 3P0FA 1UQVA 2NTYC 4XFKA 2QM3A 1E92A 1O94A 4W6QA 3RVSA 1FFDA 1P4AA 1VG9B 4JLPA 1A1VA 2PX4A 4HB4A 4B7AA 1X7ZA 5CG1A 2PO7A 4N7BA 4F5DA 4ZGBA 3E9DA 4RZRA 3JY6A 5FHRA 4O1IA 4D96A 3BRWA 1UC8A 5FJIA 3L1IA 1SA0B 4O63O 4RY0A 3A7EA 1GFZA 4CQMA 1G60A 3LX8A 1Q3KA 5AFSA 4P5EA 2H4WA 2FNAA 4NL9A 2GVZC 4NS1A 3VYTB 4NRDA 3BMCA 4N76A 3RFCA 3BQTA 5JC8A 3RB4A 2WTFA 4E32A 3CG4A 3SYTA 4O2RA 2V4MA 2CLEB 4Q9KA 1PFYA 4BFYA 3AY6A 2O20A 3REQB 3N97B 4GYKA 3QXHA 3UBTA 2RG7A 2QOEA 3BCHA 5A7GA 2EP8A 4C0JA 1XQ9A 4OOFA 2RI6A 4B8ZA 1JNXX 2ZM5A 1FJHA 3H5OA 2WSSD 3PGMA 4B3FX 2JH8A 2YZ7A 1A69A 2QTHA 1ST3A 4GOND 4WNYA 2XODA 4UNSA 3HWTA 2W5UA 1Q12A 2H48A 2EGHA 4NH0A 3PDUA 2C5BA 1KI6A 1NUPA 4G5GA 3PRKE 4ZVUA 1W4AA 5F2OA 2XRYA 2H2WA 3FLEA 1OHHD 2WZDA 4FJ2A 1UFQA 1PBNA 5ANRB 4HDRB 1Y1SA 3A1TA 2WG1A 5ICMA 2RI1A 3BQ1A 3NANA 1EFAA 1KRXA 1P1RA 3IQDB 3ICCA 3QUSA 2NYUA 3WADA 3G2HA 8OHMA 3O8OB 3N6VA 1IHUA 5FI3A 1NF3A 4MRAA 1ZCJA 4N8SA 3S29A 4ZXFA 1PI3A 4LOJA 3RDPA 2ZTEA 3V3TA 4M9HA 3DONA 4YDHB 5E4FA 1NY5A 4ARZA 2V8BA 2VK2A 1FTGA 3VJRA 1EFRA 3D64A 3E3NA 4RPLA 2ZRDA 5EMHA 3FVQA 3T7KA 5IK2A 4IV5A 4WLOA 3PVXA 4MICA 4RSGA 3EAFA 2Q3FA 2Q4DA 1XJWA 3UHOA 5BT8A 1S2OA 5LSAA 4FT2A 1MB3A 1FTQA 2R96A 3AQIA 4HDOB 4EK9A 4QWDA 4RHXA 1YL6A 5DI3A 3NS1A 4DV4B 3DPUA 3GFQA 3H5IA 3U7QB 1U2GC 1JEAA 2I1QA 1QYXA 3WOHA 1JG4A 5GQSA 1GNTA 3M4XA 1KBQA 2JNWA 3FYUA 3I05A 3YASA 1C9YA 3TEFA 3J7AC 5I7EA 4CG2A 3C43A 4BWFB 3L5KA 4MHOA 3DD5A 3NBZC 1Q77A 4MB6A 3L7YA 2EL7A 1BHQ1 5ELLA 1UJ6A 3DFMA 3GLHE 5T4BA 5F9FA 4B3CA 3PR5B 2P66A 8ICEA 4FHGA 3TW4A 3OKFA 3L8MA 9ICMA 2BFFA 3HU2A 4LXHA 5AW5A 5TV2A 2WIKA 1O0CA 1ZH6A 4IR9A 1C3OB 1Q95A 1QVVA 1G5TA 3O3NB 2IOHA 2XZPA 4H7KA 4P84A 1X7XB 1ZCZA 3T5GA 4FMDB 3WYBA 1EFUA 3M6FA 4CKEA 2KZZA 1ZOIA 3Q0EA 3RRMA 2ZJOA 4YR9A 2ANCA 1NBMA 1NVXQ 4AJPA 2A58A 5L6LB 4ZZ1A 3I2KA 4US9A 4QGAA 4BE9A 1SKAA 4JUFA 3RB6A 1T6XA 4ALNA 3HEMA 1RS0A 4IQGA 2Q0QA 3J7TA 1ZUNA 1XLVA 3L05A 2GUWA 5M2QA 3HCOA 5KYXA 2COUA 1DUVG 2GN1A 2H3ZA 3S6JA 5CRXA 5CW2A 1KR5A 2EEPA 2D7CA 3RRFA 4WNCA 2CL6X 3NVMB 3VNVA 1E18A 2A0UA 1TPYA 1J24A 2W37A 4YREA 4PM4A 4KUGA 4KLHA 3SKVA 4L6IA 5MDHA 3BORA 2FJ6A 4DWIA 4B7ZA 1YR2A 1EVLA 1QYVA 5HM8A 5JSYA 5DLGA 3SEAA 3L79A 4ENUA 3PW2A 4BGIA 4F2HA 1IY0A 3QSYA 1ED1A 4JYAB 3ZKWB 3PD0A 2WSSA 4JI0B 3K9FC 3EW7A 3O0FA 2FWMX 4UQLA 1BE8A 3WK6A 3AL0B 3KFLA 5KYTA 1NZFA 3GFKB 5B6JA 4KE6A 3WA7A 1L7VC 2R5WA 4YUYA 3L3FX 4HK4A 4X1KA 2OC9A 4IL6U 5JSQA 5KCMA 4Q48A 2XE4A 5HHTA 1OHHA 1CQIB 1PE0A 1EGQA 5E2AA 2J3IA 1KYYA 1U0RA 1Q22A 3A7DA 4FFVA 2Z04A 1JS1X 1NM5C 1VLJA 1OYVA 4PC2A 1SGGA 1CEXA 3OHBA 3EG5A 1OA1A 1AQJA 1Y5LA 2QRMA 4Y9SA 1P5ZB 4UB6U 3PFFA 2XYGA 4ML3A 1SVOA 4EBFA 2WMOB 4D4IA 1GUYA 1SC1A 3K6SB 2VTBA 1XC7A 2JGAA 4KX3A 5E6RB 5BSKA 5BPFA 2RHJA 3O26A 4JJ7A 3V4RA 2R7KA 5BYJA 1JH9A 3EIWA 1ISJA 2HQOA 1QRRA 3KELA 3A3OA 3LQFA 3RC9A 1KDYA 3AFIA 1QYCA 5KX5F 1FTSA 3U4QA 2DFLA 1Z4JA 5KFXA 5DSXA 3WDMA 3FC4A 3JQ6A 3QEKA 4GWGA 2P27A 3FZQA 3HRDD 4AW9A 4JP2A 1JQ5A 1R66A 4RF2A 1NFQA 3SEQA 1A96A 1ZM9A 2O4UX 2XVYA 4MQBA 3KTAA 4AUEA 3RGGA 2PGAA 1O9GA 2C2KA 4AG5A 1AXRA 1XYYA 4D41A 4FONA 3FGNA 1CK4A 3QQ5A 2D5CA 2IUUA 3JD1A 1H2YA 2GCNA 2HY7A 2KK0A 2R0QC 3PVCA 4RYLA 4LQLA 5JYEA 4YP9A 3NRCA 3D8TA 1W5EA 2MIIA 1Y6FA 4JL5A 4J0HA 3NWPA 2D7JA 4X94A 3CISA 2CV0A 2ZJ8A 3KB6A 4MVJF 1Q0TA 4DCMA 1G2PA 8ICNA 1R6DA 4ETNA 2QJTA 1ZL2A 4EAQA 4HNUA 3VNUA 2KQUA 3H1PA 1C7IA 4PHCA 1JEQB 2V45A 3PFWO 4F6CA 2P30A 3WO0A 5LC1A 4RFSB 4DSUA 3R7NA 4H3KB 1KKLA 4DSEA 5E0KB 3AEQB 2CB9A 3CW2C 5LP6F 5G1PA 4WKNA 3OICA 1S2MA 2O8BA 4FO6A 1XCOA 1IV8A 4LGYA 3ZLUA 4HWOA 2ISPA 3NHRA 3QE0A 5FA6A 1ISRA 5KTKA 3PHHA 1UT6A 3I0NA 3B70A 2IQ5A 3PD1A 2XE8A 2VCYA 1JR4A 3RJFA 1IOVA 1GSOA 5AUPB 4EY5A 1H94A 4C5AA 4KE8A 1JDPA 1XZHA 4G0VA 5K3OA 3PU6A 4CL2A 3VNRA 2P7HA 4BMCA 2WTAA 4UHCA 3H6KA 4F4ZA 3UHAA 3JQAD 4TKVB 1SB9A 4Z9XA 1X7YB 1Z7GA 4AJEA 3IQEA 3T0IA 3N0XA 5DIZA 3WIUA 3LQRA 3V7WA 2CXSA 4CF7A 4KQCA 4UB8U 3M6VA 3W8FA 2MR5A 1B16A 4PZYA 2NUTA 3UNXA 2V74B 3T79A 4RK7A 2EAMA 3GIWA 1K9SA 1TQDA 3HX0A 3OAAD 2QG6A 2YN4A 1EI9A 4HQRA 3FYHA 1NUQA 1X14A 5JWRA 5KU1A 3MTJA 3HG7A 3ANSA 1UDWA 3FTCA 4KOAA 4AUKA 4MR7B 2C9OA 3K6JA 4RSMA 1KN5A 2Y67A 2W2OA 4KBYA 2KV2A 1IBSA 4EFMA 1ADFA 2HKIA 5DKFA 1SOMA 5IINA 4C2TA 3JTMA 3OURA 3UMYA 2B6NA 4BBZA 4MGEA 4TTVA 3KZKA 2BHNA 4LQDA 4QOEA 4CIYA 5CG2A 1Z8FA 1PG5A 1XZDA 2OCYC 1FVHA 2EZUA 2XIDA 2FZVA 1MOQA 2IXFA 1AZLA 5BV2P 3TW8A 3U5ZB 3NRWA 2H06A 2XNDD 2GTHA 2B9EA 4F5YA 1I3CA 1ZD8A 4TUSA 3P52A 2GF2A 2XOEA 3MRTA 3VU8A 4D4MA 5DLYA 1NZJA 2B4RO 4AY4A 1Z06A 2A7QA 4KR6A 1YJBA 3AIOA 3I76A 1N2ZA 3ILHA 1WUIS 5J2BA 3TRIA 5KJ6A 2J9FB 5LLSA 1SQ0A 2YV2A 3WDSA 1RJ9B 4EVQA 4X1OA 5IM4F 1ENOA 1TECE 1YH3A 4IILA 1U8TA 1KE1A 1W93A 3LT1A 3Q0TA 4FW9A 1RLUA 3WNDA 3UEOA 4IW3B 2JAHA 1AD2A 1B8PA 1G3IA 3I53A 4HVLA 3WLSA 1MIOB 1MABB 2Q1YA 4J9NA 1X2EA 4R05A 3OP1A 4C21A 3SZGA 3IR7A 4DOMA 3MEQA 3AFOA 2DKZA 5ALXA 2DQ4A 8ATCA 1QYIA 2GI4A 3HYRA 2Q4TA 3TI0A 4B31A 4FHCA 2OEPA 3R74A 4KYVA 1T5TA 3G0BA 4XGIA 4LEIA 3BRQA 4BZWA 3BXZA 3OG9A 3WL7A 2YJ6A 5B4VA 1E6WA 3QITA 1M34B 1F3OA 2ZIXA 1JHYA 4U3JA 2FLNA 4OF4A 2RRDA 1F5SA 2C59A 4CZ2A 3RRJA 4YLYA 3BQMB 4MW2A 1F38A 3HKBA 2P2DA 2FLKA 3JALB 1KEVA 1DTWB 1Q91A 1O58A 5EIBD 3EF3A 4I4NA 2GXUA 3TBFA 5BRJA 2O05A 4U2DA 2EP5A 1NSTA 5AJXA 1Z0FA 2AFIA 2HO5A 4N40A 2GPWA 4NV1A 1MJGA 1H85A 4M9SA 3U6KA 3PQ8A 9ATCA 4C7XA 1M6YA 1BCSA 1JI0A 2RKWA 1HURA 2OWOA 2QLFA 4P0PB 4QBGB 2CXRA 4H7EA 2XA9A 3JQAA 5JRTA 1C1YA 3CPEA 4W9MC 4G97A 5AKIA 2GB4A 5JFOA 5ED0A 1TZMA 1ODFA 3CH7A 1P7YA 3P9QA 5K9ZA 5GONA 1QDLB 1XZBA 2P40A 1ECLA 3W7VA 3WRVA 5KOHA 1NIPA 3OAAA 5IRCD 3FR8A 5CEHA 2O0MA 2IPOA 5JROA 1L8OA 4FOSA 3AEUA 3AVUA 2PUFA 1AJEA 4CLHA 3N5CA 4MI9A 3ZD6A 4OX9Y 4A6XA 1G4UR 1GNQA 1G0NA 4NR0A 1TO1E 2HSZA 3BWMA 1QGOA 4HXYA 4A6DA 4PCUA 3WIEA 1E77A 1A50B 4FGWA 2PV7A 5FLYA 2B4KA 3OT1B 2CWDA 2ZT5A 3F5DA 2J9GA 4PVCA 1LDMA 4F6RB 2OM2A 3NGXA 3DLTA 2YV1A 1P1JA 3EFOA 3QVMA 3WNZA 2YW9A 4OGGA 3R20A 3C1AA 2LM4A 3FROA 4I2DA 1XWWA 1FF9A 3MBIA 3GVPA 1Y89A 5BUQA 4X8OA 2GBLA 3TLGB 2HBKA 1UBHS 1P9OA 1GO3F 3U7GA 2VOEA 4O59O 2YUTA 5DHQA 2XGPA 1POWA 4E70A 2G4LA 4E13A 3BE6A 3ER6A 1DEXA 1ZU4A 2XNKA 3UFXA 1EK0A 4PCLA 3RC2A 4RQ7A 1JSLA 3TYXA 4L07A 3MTBA 1OAOA 2KIWA 4Q3LA 3LBIA 2HMWA 1GUBA 1LLQA 4E07A 5HE9A 2V7UA 2AHOA 4LVSA 5LR6A 2FGKA 1JEYB 2PVCA 1H2RS 3PQEA 1XNRB 4HFNA 4LY6A 1ZQLA 3QPDA 4QQRA 1NP3A 4WA7A 3HSYA 2C3PA 4QXQA 1PCXA 4Q1DA 5BUSA 4BATA 2HFJA 3NT2A 4NJMA 2NO6A 3WHKA 1U0GA 3A2LA 1HBJA 1ULZA 3NM5A 4Z6EA 2IIBA 1DJPA 5DBCA 3IBGA 1Z35A 5TS2A 4UHDA 1MAVA 3KYJB 5C3MA 5HRCA 1K8XB 3QWBA 1AKRA 1PS8A 2Q3BA 2CYCA 2HHWA 5K03A 4EP1A 3TADA 3JPRA 3TL2A 2HLNA 1X0XA 2E21A 3CX8A 5FPSA 3S5UA 3QVVA 1HQCA 2CF5A 5ESXA 1NZBA 3UQYS 1VXRA 5L1MA 3N07A 2HMVA 5BVHB 3KNZA 1DSSG 4NU5A 5FI1B 1YVRA 2B5WA 4L6CA 3MUFA 3D8BA 1LQ2A 3C3CA 2G09A 4EJ6A 5ITWA 5BSRA 3ZW9A 4RL6A 1UM8A 2YHUA 1U1EA 1WU7A 4AJ9A 3EQ6A 1JVSA 4LRSB 2EBUA 4KHZA 1NURA 5F9HA 1L1EA 4QDZA 1XDWA 2VYCA 1ZD9A 2FEPA 2UXCB 4QNRA 2AFHA 1BXKA 3OX4A 5HIKA 4XYGA 4S0ZA 2GO7A 4RH0A 5BW5A 2AK2A 2I99A 1CT9A 1DQPA 2FMQA 3QTTA 4UBBA 4L22A 3TCXB 1IBMB 4IXMA 4DR3B 2NNLD 4HEHA 1ODLA 2W0SA 1M54A 3AYXB 2CLLB 4A4DA 4PS1A 1XAJA 1AXEA 1BMFD 1Y7PA 4HYYA 1T1GA 1AK9A 3E9RA 3QX8A 1QVAA 4MGHA 2P5SA 2WHYA 2WWHA 2IV3A 5CAEA 4K0RA 4B83A 3EVNA 3FDZA 4Y8VA 2P2YA 2FX3A 1OAKA 1J5EB 3FMVA 5BT9A 4DNXA 5K09A 3ZU5A 1KO4A 2P9TA 3ADKA 3UYKA 3K9QO 7MHTA 5I8PA 3L2OB 1C9NA 4OAQA 1CJMA 2O7VA 3M34A 1MAHA 5ECGC 1E2DA 5HRUA 1PQYA 5CP2A 4PPNA 4YNBA 1ISHA 1A5ZA 1K88A 3SOPA 3KYDB 3FMFA 4UTVA 3JWEA 2ZB7A 2CUNA 2V4RA 1ZH2A 1VLHA 3ZJYA 2R6FA 1SKUA 3P2YA 1W0JD 5FOUA 2HBJA 2D59A 3RQSA 2GZRA 1EGHA 1JMVA 4Z4CA 2QAGA 5K45A 2AOXA 5FOSA 1P1KA 3I5UA 4J6FA 2FXIA 5HR6A 2GPAA 3L92A 3UMFA 4NM1A 3KLNA 2G25A 1QTIA 5TMBA 1T26A 4KQKA 2E37A 1EM6A 3T3OA 1GZ3A 5KTYA 3G0GA 3OTQA 4GXTA 3JRNA 1RMQA 2G80A 2TMKA 3K09C 4L08A 1R6AA 4DCUA 1UM9A 3F9IA 1JEDA 5BMVB 1MVOA 3QBTA 3UK1A 4K3UA 1WZCA 3GCWA 3T41A 4GE0A 3IEXA 3RFFA 4S05A 1NAIA 2VDPB 5FUMA 3C8UA 3Q8XB 3IURA 1L7MA 1A82A 3TXXA 1T36B 2Q3DA 3A8TA 4EIWA 2IZ7A 5A02A 2D0OB 4LVUA 3HUEA 5LBUA 3MCTA 2ASJA 1HUQA 1DIBA 8ICOA 1RHJA 2KPOA 4UHHA 4ETMA 2P6PA 3FI9A 3OM9A 2NQ2C 3HSSA 4PG8A 4CEJB 2ZK7A 4NBRA 3TN7A 1A9OA 2KZ3A 3NBAA 2GR9A 1FDVA 3AQ4A 4NG5A 2PXAA 2Z2XA 1FVFA 5H83A 3GZFA 5H70A 2F7SA 3LKDA 3SC2A 3U3XA 4AURA 1FTNA 1JYSA 4I27A 3O47A 4BO9A 4FDVA 4TRRA 2SICE 3R6DA 3GNLA 4QICA 2ZDQA 3B0YA 4U9IS 3V8PA 4DAOA 2AQIA 4JUZA 1VYTA 1S8OA 4UMEA 3M4YA 1IJFA 2HBMA 4RUAA 4EPYA 3KKPA 4ZKEA 2DG2A 4A0QA 4IX9A 5BV7A 4EBEA 1SN7A 3R5KA 4UUAA 2W70A 3AR2A 3ONEA 3RPEA 5EXSA 3VZSA 2VO1A 1DG1G 3MAJA 3V1LA 3GV7B 3KP1A 4D97A 4IS2A 3ZHUA 2L19A 3HKZF 5GIOE 3BGSA 4PU0A 4DF3A 3C39A 2B92A 4LDJA 3GDWA 4RPXA 4YI3A 5HF9A 2EARA 1L3BA 5FAXA 2EGUA 3RS0A 3E4DA 3PT9A 3JRWA 5KTRA 2VATA 1GLGA 1XSNA 1T3LA 3GXBA 4P4GA 2HW8A 4K4HA 4WOJA 3G7NA 4OGKA 4F5WA 1GVNB 5AXDA 1CZNA 1RTTA 3BF8A 3H1GA 3A27A 1IZYA 3O4HA 1WETA 3D43A 4DPLA 4HXFB 4ZQEA 5KNCA 5J4YA 3OVMA 3N6RA 2F1KA 4ZOHC 2EKZA 5A7FA 2KLBA 4C0BA 2FDCA 3C3MA 3KB8A 3B48A 3OPXA 1Z56C 4LRUA 2PGXA 2GBGA 5KYNA 1XEXA 1LPBB 1N5RA 1TIKA 5JARA 2PQ2A 3EB9A 2R8XA 3E18A 3IJ5A 3KFVA 2QTMA 4MWGA 2CFTA 3UJDA 4JWNA 2CD7A 4PV7A 5I9TA 1S8AA 1XSEA 4IGFA 3RTDA 4I2HA 4FXOA 4IVNA 3Q7IA 3D59A 4YT2A 3FTEA 5B53A 5CD1A 2VJOA 1D2MA 4G2NA 4UVIA 1T0HB 1YJCA 4BXOA 3ZCUA 1L5RA 1C7YA 1ZM7A 1V45E 2PR7A 5IC6A 2VPYA 5IAKA 2I7VA 1ZR4A 4PSAA 1RI5A 3DMDA 4MWDA 1ADJA 3DXZA 4GVXA 2VSNA 3S7TA 3DO8A 4MFAA 3GJZA 1E2JA 3GB9A 3WKEA 3ENQA 3GFPA 1M2HA 5JD4A 5KYYA 4TTSA 3ZDDA 3TD2A 3FOZA 3ZBUA 2JAWA 3AUYA 3V1KA 3NWBA 3AHDA 3KB2A 4KN7A 2GQ0A 4RFLA 5A6SB 3W4JA 1CY2A 5KTNA 1ZCBA 5FPKA 1EM8B 4Q9JA 2IBKA 2GNPA 4Q3KA 4CNQA 3E61A 5CT5A 2L18A 3GLVA 2HJSA 4MVWA 3AVVA 1NV8A 4UHJA 3D6MA 5JISA 4BFSA 4DC0A 5GPBA 2GBFA 1NJ2A 3M2TA 3TMKA 2GZSA 2FUG6 3IDWA 3OJXA 2LIVA 1NNI1 2B35A 1R18A 2W03A 3ZS8A 2MSKA 3HY4A 4TS3A 3CRW1 1QMPA 5KTQA 4YRSA 4L0QA 5FPTA 2VAPA 2WSBA 2AN1A 4HUQA 2H3VA 3GMIA 5T3YA 2G06A 3IPAA 2CLFB 4KLGA 3LLMA 4A5SA 2YZGA 5KYUB 4EATA 4L5CA 2HV8A 5IUJC 3WGNA 4MKIA 4IZIA 4E5MA 4KLSA 3JVDA 4ZYUA 5A0VA 8ADHA 1KVRA 2CGEA 4FZRA 4U7HA 1DI0A 3JRXA 3ZD9A 2P4QA 4G25A 3GJ4A 1OB5A 1IJBA 1NA5A 1E9DA 3U56A 4DREA 2ZUEA 5BNTA 4EW6A 4BFTA 4URHA 1XHEA 3Q2KA 4H7IA 1L1QA 4Y67A 1WPGA 1HYBA 3O8RA 4MV9A 5IN4A 5J2UF 3EA4A 4L6AA 1ZK2A 3DOEA 2IEZA 3EJWA 2W4IA 3KHSA 3ZIAA 2I2CA 3DE0X 3DEFA 3HUTA 4K8RB 4LJ7A 4FKMA 1EK5A 1CP2A 2RHLA 1U0OC 1QGED 2QEQA 3RB0A 2JC3A 4B0OA 1YFLA 4NMLA 2AR7A 4K7JA 5C5IA 4ZYZA 5HJ5A 1JX4A 4G0ZA 3PHCA 4N7RA 3AY0A 1I6KA 3OBBA 5JCOC 3OI7A 2HSWA 3PI6A 3UICA 9ICGA 4U4AA 1UFRA 3DM9B 1JHUA 3OU2A 4II2A 5J4HA 3EMBA 1RRVA 4N8DA 3U4AA 1Y9JA 1RP7A 3X1YA 2PSSA 2INGX 3UT5A 5A3SA 1TAUA 2QJWA 2A6PA 1CPYA 4LJYA 4BNWA 1P77A 4K9LA 1X87A 4G1CA 4DPMA 1VMDA 3BXOA 1QGZA 4NCBA 4NE7A 2Q2NA 2IEDA 2FVXA 3PFHA 1FRZA 4PX9A 1Z5GA 3NDIA 3RK4A 1T2NA 3WIDA 1YJXA 1QM5A 3G13A 2NU8A 4NBNA 5DBOA 5F3WB 3ELWA 5DBBA 1GT6A 4FFBA 3OO1A 3ODGA 3ZZUA 4OLHA 3STYA 4CETA 4JLOA 1ESDA 2RP5A 4PG7A 1GKYA 1LV5A 4C04A 5AQ1A 1ZGCA 1WCXA 1CULC 3ZE7A 4BE4A 5CBPA 2QX4A 3KTQA 2C42A 4PLGA 4B3DA 1UK6A 1AHHA 1AGPA 2YTUA 3GBVA 5EWEA 4OQDA 5CITA 2FMIA 4RO0A 2J5QA 2G0TA 4G65A 4XGKA 5CA0B 1WXXA 3HVJA 2VH1A 1TVCA 1PFKA 3REFA 3NFRA 2F4NA 1TKRA 3QE2A 5NULA 2J6SA 1A0OA 3BDPA 2DPIA 4C8OA 2C2YA 4TYYA 4TV8B 4Q12A 4MFFA 3PJFA 3B82A 3ER8A 1TA9A 2HHAA 1ONOA 3U9SA 3AR6A 3N75A 1OXSC 5COQA 4FQ5A 1Z38A 1VSBA 3LCMA 4TQGA 2FCAA 3E53A 1JIVA 2PK3A 4H0FA 4RA9B 5BXQC 3SFZA 4OSEA 5M34A 3TIXB 1X3LA 4OMFG 5A3QA 1J70A 1U5BB 5EUQB 2JD0A 3PHGA 4QBFA 2XUOA 5B5SA 3ZWPA 3MJSA 4FKZA 1JKIA 3PSPA 3X1WA 2OKCA 5FPQA 1UPAA 1QBGA 5KMGA 4GQBA 1JWBB 1YDMA 4F0JA 3CS3A 4F86A 3O91A 4YJKA 3OCVA 5T3UA 2ZRIA 3EVDA 1U7DA 3RH6A 1FMLA 4Q43A 3P71T 3EZ9A 3TRJA 4EM6A 2P6MA 1S3GA 3L6OO 4G09A 3QEMA 2NYRA 1FFVA 3Q8QB 3HPOA 2PAFA 1QRSA 3VR2D 2W2PA 1TF2A 3USZA 3RJMA 3VX3A 5IKMA 4AYTA 2BZ0A 1Z18A 2CFOA 2XKJE 4BNDA 5K6AC 4CNBA 2Q2VA 3L46A 3QPVA 5GINE 3ZI4A 3MLBA 1W7AA 3A0RB 3T6KA 3VOBA 3OE1A 3UIEA 5B1YA 1PWYE 1T9ZA 3C70A 5GVSA 1G20E 4I50F 1CQXA 3CNOA 2CV2A 4FYMA 5LA6A 1C9JA 2XCIA 5BQ5A 3DD1A 1NGSA 2A14A 1T2FA 4IZHA 3E48A 2I8LA 1GG8A 2GRJA 1ZQNA 5IU6A 3OOJA 2G0NA 3A0UA 1B1AA 4TTRA 3LKBA 2XDWA 1PR0A 1KP9A 1CYEA 2HA7A 1SBYA 1OH5A 4TM8A 2Q6VA 4EYIB 5JRJA 2OBMA 2H0QA 5A1JA 3MCUA 2YXLA 1YVDA 3W2HA 7ICHA 1PGPA 3BIXA 4OHXA 3M1YA 3B9PA 5A9TA 3R7BA 3F5SA 4YD1A 1U98A 4Q66C 3HACA 4XDGA 1BKSB 2AGVA 3QLJA 2UYOA 5AKEA 3W9SA 2WKRA 1J06A 2BUCA 4E1AA 1Q7CA 1GZ6A 1OILA 4WERA 1JVBA 5ABPA 4KWHA 1CY0A 1CSEE 4DF8A 4YRLA 3VR5H 3MS4A 1CUDA 2EZZA 1HDRA 2ZJ1A 2PTGA 4FLEA 3BJMA 1OX5A 5AK4A 3U7RA 3RW9A 3EGOA 2QRKA 3SS8A 2Q5LA 3LCUA 4S12A 2IHZA 2HMXA 3TTWA 2NO0A 1JQAA 2REOA 4RY9A 1DWOA 1DRVA 4NXNB 4NAUA 1R88A 1RADA 4XKJA 3EZ5A 3JD4A 3RV3A 2WP8J 2M98A 1IY1A 2WT9A 3TR5A 1Z0UA 1L0BA 2VKTA 4U8GA 4FJ0A 3GD5A 3QVLA 3MQ4A 2C22A 4RM3A 3QVKA 5JH7A 3WGTA 4BZQA 5FAKA 1SKWA 2VF8A 1D1QA 2W3RA 2Y68A 2CLMB 3JWJA 3QM1A 4V0NA 3EDCA 2X4GA 1U2DA 2LBOA 3DW1X 4FHZA 4P3PA 5DNEA 4AJJA 5KHAA 8ICLA 1RYMA 1GGNA 2PLAA 2GPJA 4GL4A 4LUCA 4Q9AA 4LFAB 4BWJA 3P4XA 2Z9DA 3G49A 1G8MA 4KGXA 4NZYA 1WB9A 5JAPA 2A7XA 3BDIA 1Z0SA 1HEYA 4BVJA 3R41A 3T1NA 1FSSA 1AT1A 1HSZA 3B5IA 3JTEA 5U1PA 4RQ5A 1M2OB 1E5QA 5AJHA 2TRSB 3UOWA 3D2LA 3T5PA 3WZ2A 2DT8A 3AR9A 4G1BA 2QX7A 1UAAA 2IEGA 1NBEA 4HQNA 3OJUA 2QT1A 1ABBA 4I9NA 2YY5A 5JR3A 3D2AA 1E1CA 4DWJA 4QDUA 1CRLA 3GRKA 1W1IA 1XNJA 1WA5A 1C7ZA 5A04A 1PK9A 4MTCA 1GPUA 1E9SA 3EG9A 3K72B 3IUEA 4BPBA 1MOZA 2NRVA 2XECA 4IGKA 3H9UA 4ZQIA 5HE8A 4Q8EA 4BB0A 1T8RA 3H2SA 2PANA 4P2GA 3WLLA 2H31A 2HMUA 3IP8A 1B2LA 5DHSA 2C3UA 4BBJA 5TEVA 4DM3A 3B1JA 3K70C 3QYFA 3OF5A 1YB1A 1Y3CE 3C5VA 2JKYA 2Q1UA 4FYWA 3RKUA 1BGWA 4K9QA 4MYRA 3GMTA 3U3RA 3UKOA 4FB5A 1QB8A 5BPCA 1RHMA 4MVJM 2P6UA 5HZHA 4GX0A 4DMLA 3MDCA 3OESA 1KI4A 2EL9A 2PEZA 3OIWA 4ON9A 1HEIA 1Z22A 3ZJTA 3PXDA 2QL7A 1SUCA 5KB3A 1SJ9A 4BFUA 5FYQA 5B58T 4TLCA 1YZHA 4NY8A 3T12A 3W8NA 3CNQS 4EELA 4LXXA 3OWOA 1GEGA 1XJQA 3KUKA 2JAXA 4POAA 1CF2O 1N7HA 1E9AA 5EJ2A 5K4HA 1MHTA 4JXZA 3EZNA 3U3DA 3PK0A 1DO0A 3K9GA 3PPIA 1NTRA 4Y6RA 1W8IA 1ZCFA 5AR1A 3EQ8A 1DAMA 5KNLA 2YWCA 3UN1A 2QJRA 3AC0A 1HT2E 1L5MA 3H86A 1RBQA 5T8KC 2FZLA 4YAKA 5KTMA 1F9EA 1KXZA 3H16A 5EOVA 3T0GA 4PGAA 2OV3A 4UNNA 4TXJA 4YPOA 1CF4A 3DA8A 4NFHA 2WK1A 1POXA 2W11A 2VK4A 2WKPA 1V9CA 3EGXA 2FZWA 3SOZA 1S3IA 3HJAA 5JMPA 5CGQB 4K88A 3WHLA 4YP1A 5IBRA 4LRYA 3LUDA 4LZAA 1VHTA 1XD8A 1U8EA 3R3HA 4FCCA 2B20A 4GC5A 5HVNA 4AZ3A 2NSLA 1EFPB 1UHUA 2PT7A 4Z99A 2GN6A 1JI7A 1GPJA 3RVJA 3NQ41 3UJ3X 5ALSA 5A0TA 1UPCA 3L6UA 3QBEA 4HY3A 3IP5A 5H9WA 4RFVA 3GMSA 4F4HA 1RCFA 4FZNA 3VO9A 3TDNA 5IDYA 2E18A 2WJAA 5FWYB 4ZO6A 3MAGA 4BVLA 3DP9A 3FPFA 1ZVQA 4YR0A 1TT7A 4JCCA 2EHJA 4F2RA 1FQJA 2GCOB 3B89A 1XDSA 1B0UA 1RZVA 4IL5A 1W87A 4I19A 1RPNA 1CNMA 1XMSA 1EA7A 2J6IA 5ERYA 3OKCA 4UNIA 4OPMA 3QBDA 4RQ8A 2P68A 1ENPA 2IU4A 1SXDA 8ICHA 4HGNA 3VH4A 3O7MA 3N0RA 5DCYA 2D06A 4ZV4A 1AN9A 2XNCA 2PJUA 5JCZA 3G02A 4YAWA 4JT9A 1T6ZA 1P0MA 1S5LU 1LNZA 3LVRE 3JVIA 4MVXA 1RBZA 4FBTA 4PAGA 4KK4A 2OM6A 2PM8A 3SJCA 1G2QA 4TKVA 1H2EA 1UR5A 5DDIP 2I5PO 4M0UA 3B60A 1HA3A 2VH2A 3EEFA 3K92A 1SV4A 1DCTA 4IUCS 4P34A 4K9MA 1IHOA 3B3QA 1KAHA 1DBQA 4JB8A 2C97A 4AKEA 4H18A 4HGOA 5F1YA 2C4NA 1U80A 2OD7A 2R68A 3AJEA 1UBJS 3TLAA 4ND2A 4Q3NA 4PZCA 1G55A 1R9MA 5IYZA 5IJ9A 1E2LA 2Q27A 4NBUA 3U62A 2NNWB 1NV9A 2BFPA 3NBQA 2AQ0A 4C30A 1X40A 3PW5A 3BIFA 3HZHA 5EUBA 1GVHA 4QU5A 3JPPA 1T2AA 4UUBA 3G5TA 9ICXA 2R79A 1R3DA 4BRSA 3O4GA 4JI6B 4MB0A 5C8XA 1JBKA 2OB2A 1SC9A 4NCXA 1QIDA 2K89A 1J4AA 3SKXA 5D87A 5L1LA 3ZNQA 2BE7A 2D13A 4RKQA 4W8HA 2GM4A 1YBHA 3H0MB 5DO9A 2HJ9A 4OU5A 2ADOA 3NORA 2LMRA 4HYKA 3P2OA 4FR5A 4BNNA 3ZHVA 4GXJA 8ICWA 1UXIA 4JBXA 4MR9B 1XZNA 3THXA 2ZYHA 1J25A 3AHFA 1G9SA 4XIGS 1IXYA 3SS7X 3SJ7A 3LF2A 4II3A 4DMFA 1I1OA 1WS6A 3THWB 1AKNA 1CQJB 4KXNA 2X9VA 3X2SA 1GTG1 4WLFA 2I7DA 3FMIA 3UPTA 2DHRA 2BKUA 2YV3A 2ASLA 2HQBA 2JEFA 2XDYA 1NVGA 2EF0A 4C88A 3NDJA 1Z8HA 1I2MA 4EO4A 3TNYA 4JGGA 4IIEA 4E6EA 1QVWA 4WE3A 1MIOA 2R8HA 1SL1A 3PVSA 1PVOA 3HCNA 2VJBA 2WKQA 1Y1PA 1FNMA 4IDBA 2YHAA 1L4FA 4I1RA 1JHVA 5IDQA 3DDWA 5AHKA 3P9RA 3VTKA 5A7HA 5EKSA 4DV2B 1QPZA 4LXUA 3L7AA 4QQNA 5BSVA 3NPMA 8ICQA 3KT0A 1PVQA 4B9AA 1MC5A 3CLUC 1WXDA 5EXEA 4I2GA 5DBFA 4B6QA 5J2EA 1RYSA 2IY9A 3G5UA 5U9CA 2YFHA 1C4KA 5KT4A 3KS9A 1C14A 4PLFA 1DTSA 2A78A 3R9XA 1TTTA 4ILEA 1CIJA 4IMRA 2ZIZA 2Z1DA 5EJGA 4OJPA 4MFCA 2VDVE 3WK4A 3O6VA 1AGRA 4GDMA 4PFQA 4EHJA 3EQ7A 3D4BA 1YMVA 2Q1WA 3V9AA 2C2OA 2NU7A 4PAWA 4C87A 1BJKA 4QUAA 3GJ6A 4AP9A 2EJBA 4NE9A 5AM2A 1BWRA 4OKIA 3HCPA 3S28A 2GAAA 2VANA 2X0DA 2IIVA 3VAZA 2PL5A 2CXHA 3MT7A 2E4WA 4V0LA 2WB1C 3E9QA 2HF9A 1M1XB 3PNYA 1F7VA 3H2KA 5IIOA 1DC3A 1YDFA 4FP9A 2V0GA 3S70A 4EAAA 5F23A 4PFKA 1LV7A 2R87A 1DAOA 3R0QA 9ICFA 1D2CA 2V8OA 4M87A 3BE5A 4QZBA 1P0CA 4C4OA 1DXQA 1Z36A 3E5HA 3L84A 5T4HA 2GAOA 3SM9A 5DDMA 1OI4A 1D2NA 3HU3A 2P41A 2CJPA 2DWPA 3PCRB 4CKZA 2VK1A 3ZX4A 3QX7A 1BA3A 3FVWA 4HKTA 2QX6A 1F8FA 5DYGA 3GRPA 4E5DA 3DE3X 1QBKC 3KPUA 3RE1A 1EUYA 1ES9A 1D09A 3GDHA 3ABRB 2MYTA 2Y6UA 3EW9A 2PXHA 3ZWKA 4Z8XA 5HKKD 5AM1A 3C14C 1WKBA 4ZAFA 2R1TB 4P31A 3V7LA 1UOOA 4XWGA 4BRWA 3PC7A 4A8JA 1NYQA 5C3UA 2IXGA 4KGZA 3OPYI 1X2IA 1PK1A 1SB3C 2ZXEA 2A8YA 3HR4A 3WBFA 3I61A 3MR3A 1OZAA 4QFCA 4WBNA 2IYEA 2CB0A 1OWLA 4EA9A 4UNQA 4MS4B 4C01A 5DDYA 5CVCA 4RUCA 1GOTA 5CFZA 4OXIA 2A0FA 4G23A 2A1JB 5GOZA 4WKPA 4AN1A 1KQPA 3UV6A 1COZA 4C6HA 4FDAA 1JG3A 1Q14A 4P58A 5LLTA 2AG8A 1NHWA 1KBOA 1XKLA 3O4VA 3OKPA 4BEVA 2ZUBA 3DTVD 4QULA 5CB4A 5ES3A 1OH6A 5EIXA 3B1VA 1V38A 2OAGA 4LE1A 4D9MA 2DGZA 3EZFA 2ROQA 3VH2A 4FFNA 2BZ1A 4A73A 2C1XA 4AS1A 4X3CA 1YA6A 1G66A 3UUFA 1BOOA 5F9LA 3HCAA 4F85A 3PIRA 8ICKA 1KQGA 1YD7A 3P0EA 4Q45A 1ZMXA 2HOFA 4O29A 4LHZA 2Q6TA 1I2ZA 2RBEA 1VPVA 4YMIA 1XYGA 4J29A 1QR2A 1E3LA 5D3MA 3FF4A 2BP7A 3BRCA 2IHYA 4J76A 3E81A 5B1IA 4Y6PA 3VYWA 3AUKA 4ARAA 3WGIA 2NG1A 3RF9A 2VDMB 3R6GA 1XWFA 1TU4A 2NO5A 3RD5A 3EJ6A 1KY5A 4NPCA 4I3FA 1Q0SA 1TJ3A 4UEQA 3INTA 4IUYA 5E1MA 3NBXX 1WSAA 1EB9A 1HLFA 1ZGAA 2C9CA 1KDZA 2IL1A 4YWHA 2WD9A 4MCIA 1CUUA 1Z73A 3G79A 1CY6A 5DNYB 1FSFA 2WLSA 9GPBA 2PQ6A 3TLMA 2BL4A 2XGSA 3SF8B 5JNRA 5JATA 1NJSA 4IRMA 4ND4A 3ROZA 1CVIA 3TQCA 2AG5A 2XVZA 2A67A 5CU7A 1BW9B 4X20B 3DTYA 1RR6A 5D1NA 4J9LA 3RYTC 4D3SA 1MNQA 3U61B 1QFJA 1TZBA 1QQ5A 5IP5A 2AA3A 3I4LA 2X8LA 5CHEA 5CLJA 4LX0A 4R1PA 1D9XA 3LMKA 1TPZA 4PC7A 1C20A 1NLFA 5GIPE 2OQRA 2G7MC 1E3TA 3OM1A 2XDQA 3IIIA 1E62A 1L5QA 3SNKA 2EW1A 1CEQA 5DX8A 1OREA 1V3VA 1ZD5A 3MC1A 1Z17A 1IBCA 1OZFA 3MYRA 3EIUA 1MXHA 3OE5A 4TUYB 2LYBA 2BSXA 5SY4A 3A9TA 3PFBA 1XDBA 2N47A 4QZFA 2E6UX 2X8JA 3WA6A 2JFVA 3OHPA 2NVWA 1BX1A 1NI4B 1Z4KA 1VE7A 3PXAA 2X0NA 4NYJQ 5HQTA 2WFAA 3NNSA 5JBNA 4NJEB 5KFQA 5KFSA 1E3IA 1C1XB 1VL5A 3AEKB 4A0HA 2A1UB 2VDRB 3MPOA 1G2OA 2XTZA 3LT4A 1SCBA 4Y2GA 2FPLA 5ESRA 2O23A 5HHHA 2OWDA 1Q1GA 1EGMB 4OLJA 4E15A 3DHNA 3WRWA 2ZWVA 5HKKA 1G2IA 1NRJB 3AM4A 1ZBQA 2QB5A 2GKGA 3H4DA 4K2AA 2QVXX 3DE2X 2LWIA 1R4NB 3CZRA 1YHNA 5LXTB 4OJYA 1A9QA 4QXPA 2G5IB 6Q21A 2I3AA 3THYB 4R2HA 4CDNA 2IYTA 2CN1A 3BZWA 1N8KA 2C2GA 4Y2SA 3QJYA 3C48A 2P8JA 4C7ZA 2R00C 4JGBA 3VYUB 4AG6A 2ONZA 4CQLA 3NG1A 3ESCA 5ILOA 1LLFA 2ZBEA 2O3RA 1M2WA 4KPEC 3WL5A 2X1HA 3DTVA 4D7AA 2FJ0A 4RADA 1EDOA 3C5FA 3F3SA 2HHHB 3I9V1 2OHIA 4DV0B 3GU3A 3OTOB 3CKLA 2W6NA 3ACBA 2PT5A 1QS0A 3B0XA 4CI0B 1E7YA 3G2NA 3WB2A 2CD9A 2FMHA 4YMMA 3RFUA 4CR8A 1DBRA 2BCGY 3KAJA 3O31A 1H2FA 3IEKA 4M0PA 1JR2A 2JGDB 5EE0A 1TMOA 2VF7A 1F2TB 2ID4A 2Q7OE 1E8DA 5C32A 1J8VA 5B7QA 4GXNA 4WDQA 1VG8A 3R6LA 1AO0A 2X3UA 5REQA 2ORVA 3GCGA 1KK1A 3BUSA 4RTLA 1PX2A 3S8YA 5JY6A 2FMUA 1CRQA 2VIXA 2OFXA 1ZOLA 2XNDA 2JLWA 1XQYA 4EGFA 3WL3A 3EGEA 1M2NA 4BVGA 4B9SA 3KU1A 4G36A 3KD3A 4AKGA 4HTFB 3JQ9A 2N42A 3ZZTA 2AU0A 3F53A 3K0EA 2M1XA 2CL0X 1VMAA 2Q6IA 4QPDA 4CIDA 4X6LA 1QUFA 4D9KA 5KPJA 1CU1A 4I6EA 1NF2A 2GXQA 1X1EA 1WR8A 5LMNB 4K9SA 1QHHB 5L3SB 2RHOA 3EDQA 3BZUA 3U44A 1C7RA 2V1XA 1LLCA 1LXCA 4OG2A 1E7QA 5KG5A 4A1FA 1UWCA 4HSGA 1WP4A 4V02A 3K4GA 1T1RA 2ZJ7A 1JHZA 4GNKA 4RHUA 4RD1A 2PGDA 5EIEA 4YMHA 1OZ0A 1XP5A 3CURA 4BUJA 3W04A 5ALRA 2WFLB 4HF7A 1W19A 4IHQA 1X1RA 3ZZ1A 1CQWA