2YMQA

Chloropropionic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 91
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymqA01
5ALVA 3OCYA 1NF2A 1TA0A 4MWOA 5AKJA 3L7YA 2C8KA 3W5DA 5ALLA 2RAVA 4XOUA 4BX0A 4G63A 4YIHA 2R8ZA 1ZRMA 3WK6A 1LTQA 2NYVA 3NASA 3NANA 2YJ3A 3I6BA 2R8YA 3J7TA 3AR5A 4UM5A 3WKDA 2HHLA 4C4TA 2G80A 2HCFA 2JAWA 1N8NA 1Z4LA 1FEZA 1RQNA 4HGRA 1RLMA 4XPZA 1QYIA 4HGQA 5AKIA 4KNWA 3QUQA 5AIBA 2BDEA 3EPRA 4Y2PA 3L8HA 4ZEWA 2HI0A 3M1YA 1SU4A 3ZU6A 2YY6A 3ESRA 1XPJA 5T41A 5ALUA 4Y2UA 3AR6A 3ZTYA 2CFTA 3EWIA 3SF0A 1YJ5A 3IB6A 2CFRA 2P69A 3RFUA 4HAIA 4Y2SA 4BEVA 2FUEA 3WKBA 5AKHA 1YS9A 5AVXA 2YBDA 2ZBGA 2I55A 2G07A 3I76A 1ZD4A 2PQ0A 4IG4A 4L6CA 1VFPA 4YCLA 1L8OA 2B1RA 1Z4NA 1Z4OA 5AW2A 3R09A 2JARA 2W43A 3OCXA 3PGLA 4BX3A 4EX7A 4OHFA 1RMTA 5A3RA 5ALZA 2AGVA 3ED5A 5FP0A 3MMZA 4E88A 1ZD5A 3FVVA 4BX2A 3EF1A 4OFZA 4FE3A 4NV0A 3ZX5A 4UMDA 3I1YA 3L8FA 1WR8A 1L7OA 2R8EA 4I9GA 4YH1A 3E8MA 3UM9A 2FPRA 4RESA 5AKGA 1T5TA 3QGMA 5IT0A 4IFTA 5E0OA 4YCMA 2IOFA 4J03A 3DDHA 4KNVA 1Z4KA 4F71A 5AICA 2Q4RA 1S8OA 1YDFA 4BBJA 1L7PA 3A1CA 4DWOA 2EAUA 4UMVA 2WF8A 4DFDA 2PR7A 2MU1A 2ZBFA 2CN1A 4YCNA 2ODAA 5AK5A 5ALEA 4NAVA 2GO7A 3EF0A 3QU5A 5ALQA 1J97A 3PGVA 5AW1A 3KD3A 4AS2A 1RMQA 2Q4TA 4AP9A 4UMEA 1TE2A 4C4RA 3SD7A 3UMCA 1WZCA 2JAUA 2RBKA 4H1WA 3NUQA 2D2VA 1QQ6A 3R4CA 3FGOA 2I34A 1YMQA 2OA0A 2FPSA 3QUBA 1ZOLA 3E81A 1O08A 3QNMA 2ZOSA 3WKCA 3ZTWA 5ALPA 2HOQA 2MU2A 1Q92A 5AK6A 3FM9A 1RKQA 3FZQA 3OCWA 5AVSA 2G0AA 2IYEA 5AKYA 5AM5A 1RKVA 3A3YA 3ZWKA 5AVYA 3CZ4A 2WF9A 2FPXA 4KX5A 3SKXA 3N1UA 4FYPA 2EARA 3L0YA 3VAYA 1N9KA 2ZG6A 4UU0A 3R9KA 2B8EA 4EEKA 4Y2JA 1Z4IA 2BDUA 2I54A 3NAMA 2C88A 4UW9A 1RC8A 1L6RA 4Y2TA 2ZBDA 3AR4A 4EZEA 4OCZA 3UMBA 1NNLA 3AR8A 1X42A 1TJ3A 3L5KA 3TLMA 1NRWA 3WKEA 4BNDA 5AVQA 1XP5A 4DCCA 1VJRA 3ZI4A 2I33A 1ZD3A 1CR6A 2P27A 1TJ4A 3KZXA 5AVVA 1O03A 3U13A 3U7GA 2B0CA 2YN4A 3QYPA 4DW8A 2NO5A 3CNHA 5AHXA 1U2SA 2YMMA 1T5SA 5AKZA 2ZBEA 3PCTA 3WK5A 4CF4A 3ZWDA 1Z4MA 5IT4A 1L7NA 2YMQA 1Z4PX 1ZJJA 3D6JA 4XE5A 4KX3A 3SKYA 2O9JA 5AW4A 1Q91A 3KC2A 1YNSA 5ALKA 5ALHA 1U7PA 3U7EB 4HYTA 5AI4A 1RDFA 1F5SA 3DAOA 3WK9A 5AM1A 3W5CA 4QQFA 1QQ5A 1ZRNA 1SWWA 4UAVA 3L0BA 1RQLA 3L0CA 5AM4A 3WKAA 1YV9A 1U2TA 3L1VA 4EX6A 2MSNA 5AW5A 5A3SA 5AI6A 4XQ0A 3ET5A 4AS3A 3WGVA 3ZVNA 3IJ5A 4RETA 1KYTA 1U7OA 4C4SA 4EELA 4FFDA 1EK1A 2FPUA 3HYCA 4Y2RA 4UMFA 4MUMA 2YFYA 2B30A 3B9RA 4JDPA 2G06A 4I9FA 2FDRA 3UMGA 5AW7A 2IOHA 2CFSA 3B9BA 5AI0A 5ALWA 1J8DA 2WM8A 1IWOA 3QU9A 1L7MA 2OM6A 5ALOA 5ALXA 2JGAA 1U02A 3MN1A 2HF7A 5AW3A 4GIBA 3FPBA 1VJ5A 4G9BA 2WF6A 2B82A 3QU2A 4CNQA 1RKUA 4F72A 5AKKA 2VKQA 5ALJA 4CE6A 1Z4JA 2FEAA 2PKEA 2HF2A 3OCVA 5A3QA 2B1QA 2DQSA 2HEGA 2NO4A 3L8GA 5AM0A 3KOOA 3U7HB 2BY4A 2P11A 3E84A 2HO4A 3WK4A 3A1DA 3DNPA 4Y2YA 3QXGA 5AK3A 1RMYA 3N8GA 2YJ4A 2YMPA 4KN8A 5AK4A 4B6JA 1PW5A 4CF5A 3IRUA 3DV9A 3ESQA 1ZS9A 5JJBA 2WHEA 4JB3A 5ALRA 4UASA 4EENA 3B8EA 4L57A 5AVZA 1Z5GA 3QLEA 1RPZA 5AI8A 3W5AA 5AM3A 2EATA 4YGYA 3ZW7A 5ALFA 1L8LA 4HGOA 5ALDA 2RARA 4NABA 4PNHA 1Z88A 2FUCA 2G08A 1Y8AA 5AW0A 3ZVMA 5AW8A 5AW9A 1RRCA 2JAOA 4Y3UA 5AI9A 3N07A 4UARA 2AUTA 5AVUA 3BA6A 4HGPA 3U19A 2OBBA 5IS2A 3W5BA 4KYTA 4UU1A 2C4NA 4UAUA 2HDOA 3SLRA 1QH9A 1WVIA 2Q5EA 3FPSA 1RLTA 2G09A 2ZXEA 4J2TA 3AR2A 3OPXA 3QUTA 3L1UA 4BEWA 5AIAA 2GHTA 2C9MA 2WF7A 4Y2VA 5ALIA 3AR7A 2W4MA 3F9RA 1Z5UA 2WFAA 2FPWA 3N28A 1LVHA 2I7DA 3K1ZA 2I6XA 1TJ5A 2RB5A 3NIWA 2YJ5A 3PDWA 1Z4QA 4BKMA 3ET4A 3L8EA 4UM7A 2YMLA 5ALTA 5AI5A 3GYGA 2R8XA 3QUCA 1RLOA 3MC1A 5ALGA 2O2XA 1K1EA 4Y2XA 5AKXA 3QU4A 4Y2QA 3SMVA 2OYCA 3OCUA 4GXTA 5AKEA 2HX1A 5AVRA 5AM2A 2IOFK 4OD0A 1CQZA 2G1AA 3AR9A 5AESA 5AVTA 3ZUPA 3ZX4A 3E58A 4QJBA 3SHQA 3M9LA 2AH5A 4BNDB 3QX7A 1S2OA 2YJ6A 4NFLA 3P96A 1QQ7A 5ALSA 5ALYA 4ZEVA 1JUDA 5AKLA 3WK7A 3OCZA 1ZD2P 2WF5A 2QLTA 3WK8A 3U26A 4L6AA 3RF6A 2GHQA 2AMYA 2P9JA 3HLTA 1SWVA 3S6JA 3U7FB 5AVWA 1AQ6A 3OTQA 2GMWA 3NRJA 4BYGA 1EK2A 3A1EA 3I28A 4O8CA 1MH9A 2C8LA 3KDPA 3WGUA 4ZEXA 2QYHA 3BWVA 2B8JA 2X4DA 1WPGA 3QU7A 1T9ZA 3KBBA 2GFHA 2W11A 3MPOA 2FI1A 4NWIA 3ZVLA 5AW6A 5ALNA 2HSZA 5ALMA 4HGNA 3NALA 1XVIA 2IA5A 3N5KA 4YIKA 4CF3A 4UATA 3AR3A 3ONNA
chains in the Genus database with same CATH superfamily
1X7DA 5CWRA 3BBPA 1A5AB 2WEKA 4KLJA 2YUIA 3GMDA 2X14A 2GRAA 4DJJA 3FWPA 4G1MB 1WNTA 4RSMA 4CM5A 3N86A 4M1YA 4P3YA 2YXPX 4MCJA 2PXXA 3H75A 4OUDB 4HLNA 3ZDZB 6YASA 2IXDA 4K03A 1OXKB 3WFIA 4NENB 1Z3IX 1ZAKA 2FWNA 3OY7A 1IEVA 4U9HS 3PUKA 1SU7A 3MINA 2IEZA 4AJ2A 2AI3A 1ZK4A 4BUZA 1AKYA 1KEVA 4NICA 1H2FA 3HILA 4CG1A 1YI8A 2FZKA 5IIMA 3NIBA 4HUQA 3T5MA 4INOA 4L0DA 3LL4A 2XMPA 3ZJ5A 3WMRA 1ZD4A 3BN3A 1KAQA 5BQ5A 2W6CX 5EESA 1N57A 1SG9A 4BX8A 3T7CA 3PQCA 3RR7A 1JBEA 1K3FA 4E5YA 1Q6ZA 5EJMA 2YNMD 1NJZA 3C5VA 4QIWC 5CEJA 2R8EA 3WWZA 1DRGA 2JC3A 5DOVA 4DQXA 1URJA 1G5IA 4DNXA 4AKTA 3AJAA 1TVEA 4CG0A 1E3EA 2W9CA 1A9SA 3NPAA 4XA8A 4FFNA 2PT6A 1A1VA 1X1RA 5LLDA 3UK7A 4CR6A 3PNLA 1W94A 4UMEA 1TE2A 4FS2A 1GPDG 4AJLA 4IDDA 4BV2A 4OJ5A 5DNEA 4DA0A 3H1EA 1UPHA 4M7RA 2NTYC 5HQJA 4CM4A 4P2GA 4IGEA 3ZWYA 3QLTA 4JLAA 1FDVA 3TKYA 4W5RA 1N2GA 1PJ4A 4RXUA 2O52A 4ZPXA 5EMJA 3FMOB 3PL5A 4FLEA 3D1JA 2JI6A 1ZD9A 1HKHA 4UBNA 1L5HB 3R8XA 2O0MA 3A0UA 5DBGA 3DTTA 3QWBA 2YMQA 1G0OA 3Q98A 3GGSA 1QCDA 3EZ7A 4KKVA 4KO4S 4MJLA 1PNRA 4TQRA 3MTDA 5G0UA 4QO8A 5JQWA 2PUHA 3KYIB 1DBIA 3V2GA 2JI7A 1UF9A 4KB5A 2INGX 4JBWA 5HHTA 2Y1IA 2B1IA 2X8JB 4OL0A 1PP4A 2WIBA 3C8ZA 4DLKA 4XD2A 2GJAA 4Q47A 2ZCVA 3RH5A 4X8HA 3O03A 5G0VA 1AK1A 1RXWA 4R7TA 3KHUA 1I2MA 2Q0ZX 2VZ9A 5A2GA 2J07A 1XQVA 1A8QA 1I5EA 2FZLA 5KFHA 1IZ8A 3JPWA 2BY4A 2JJ1D 4DVGA 2WK1A 4JJIA 4QE3A 1V7ZA 3AKDA 4YO7A 4MS3A 1Z1VA 4IIHA 2HJGA 3QPAA 3ILYA 1E4VA 3ETCA 5FULA 2B1JA 5A04A 3H40A 4LK2A 4XOIA 1EB8A 2W6MA 2O4CA 2GJ4A 4IIXA 1UFQA 4Y9RA 5L40A 2VWHA 3T7DA 4REQA 3OTIA 4JOQA 1ZOOA 2YZKA 3HP4A 3F3KA 4JLNA 1YU9A 4MUFA 4RVSA 1BZYA 2FSGA 3VHXB 2WP0A 3ET4A 1DFIA 4CI0B 5HCNA 4R1MA 3VO8A 4NK4A 1M75A 1X7ZB 1I6LA 4QLAA 1CQIB 4MK4A 3MJFA 1KXJA 3OPVA 4FINA 3TAQA 1B26A 3L7LA 3LUDA 1UXHA 1AHNA 1GILA 1IJBA 5BP7A 2KHVA 1BEEA 1RE0A 1QG4A 4BYGA 2PL3A 3M6IA 4ZH4A 3AF5A 1GCUA 3QELA 4JBXA 2QB0B 4Z0NA 4ZDIA 1EWYA 2H2IA 1YS7A 4RORA 1I24A 4B3IA 1YR6A 3VOTA 3T5GA 1W9HA 4CKXA 3GZNA 1M6HA 1Y8QB 5LNK6 4P4LA 2QB5A 3LLVA 1NKCA 1JA1A 4BYMA 1BC5A 1XFDA 4F8RA 1G8AA 1LW6E 3OP4A 4CIDA 5KOIA 1IOLA 5SICE 4ITRC 3WYBA 4E6EA 2W2LA 1Y6QA 4RK1A 5FF9A 3DZIA 1S3SA 3G6XA 4GOKA 2QNBA 3N2YA 5BN5A 4B81A 3CO0S 1N5RA 4CL3A 1B8VA 2WMNB 2ONCA 1UBCA 1VKOA 3JPOA 3RNLA 1XJ0A 4TQAA 3RFVA 1FPQA 3TADC 1JYSA 3LDHA 3KQWA 4KAFA 2IVZA 4PYIA 4W4TA 2IWHA 4O1IA 3RRBA 1X7XB 3P9YA 1L8OA 3L92A 1JDSA 1Z5VA 2H3FA 3H5WA 5E1BA 1AF4A 1G16A 4EY8A 4RTSA 1LRLA 4UB3A 3WMXA 4DIDA 4JLMA 2IXBA 1LDEA 3L8DA 1NBHA 2X15A 4DLVA 1E89A 1SHZA 4MITA 1FUYB 4IXNA 3CG4A 2H65A 2PUDA 2H5JA 3JARA 3QX9A 4OJPA 4MQEA 3DWIA 4ME6A 8OHMA 4C01A 3RUDA 3V33A 1UMCA 2HNKA 1KL7A 1F1JA 5CNMA 2HYIC 1SBTA 4EBBA 1BA3A 1WZCA 3D8BA 3LHFA 4JSYA 1N7HA 4DPMA 1HTWA 4BMDA 2E9SA 3EAGA 2EBFX 4H7DA 2GT1A 1TQ2A 4H1VA 3SHWA 5DM70 1NN0A 2EX0A 1LW7A 2PQ6A 3N2GB 1FSZA 1TKCA 5G0SA 2QTTA 1VL6A 3UT5B 2IIVA 3U3MA 4P3KA 2RH5A 2V7VA 3JRWA 4MP8A 3AEQB 1NJWA 2ZANA 1PR2A 2V55B 3TXXA 1ZCFA 5CLLA 4XEHA 2X1VA 5KNDD 4I4LA 3SKYA 4L7QA 3HCBA 1OLUB 4W1QA 5IVHA 1YDHA 3SYRA 1D8TA 3BCHA 4QZAA 4CM3A 2J48A 2QPAA 4TQUS 4HPJB 1UFOA 3C7AA 4V0QA 3W8RA 2K8BB 2VHVA 3PI6A 1DDIA 2CY0A 2EZ9A 2FOXA 3BRQA 1AMNA 4PRKA 1Q50A 3HY3A 3U1VA 4C0LA 2BFDB 2N0SA 4PRLA 3FOAA 1SUWA 1GFSA 1UKVY 2PS3A 3GV8B 2HF7A 5K0BA 1YS6A 4KG7A 4OLHA 2ZIUB 2NQTA 1X70A 3DMPA 3NJRA 4BUCA 2XPCA 3EYAA 4OQNA 4GECA 4OXKA 1M2HA 1JSZA 1RWWA 3W5VA 4CLOB 2OYRA 4LGYA 1YCHA 2ZKLA 3A1DA 2CHQA 1ZR4A 5DG9A 2E7ZA 3DV9A 3AEUA 3GPLA 3IQWA 3IUMA 3A4VA 4F2DA 4PPFA 1V48A 2OAGA 2H1VA 5EN4A 2HQBA 5ER9A 1P4GA 1WW2A 3VZQA 2PT9A 5T6MA 4P5PA 1GWNA 2OGTA 4MYRA 1Z12A 4KLQA 3G49A 8ICTA 1OBCA 4PHTA 4ZJUA 1RVDA 3TLYA 2HA7A 5HR5A 4ELVA 3RDPA 4PY2A 3IPYA 1U0FA 4YO8A 1Q46A 4HDQB 2Y6UA 4WBNB 1IXYA 5EFOA 5IASA 3SF8A 2R00A 3DXYA 1NVFA 2C1ZA 5E1MA 1HRDA 4UB5A 2OYCA 4N8DA 3HXKA 4QU0A 1C1XB 3PQ4A 4AF6A 2QQFA 5EGNA 4EFLA 1SFRA 3E58A 4L4ZA 4WX2B 2F2AB 1VSUA 3CLRD 1SXGA 3FOWA 1F1BA 3V4PB 1TAMA 1N2XA 4D7AA 5ISMA 4KYVA 1PBTA 3O4GA 1YU6A 2GHQA 3I2KA 1R6AA 4RD4A 2H1IA 4MYCA 2Y76A 3PSHA 2FZ5A 3D0KA 5JPCA 4KP7A 3S2YA 4GUAA 3KBBA 3BXOA 3WG9A 4B4VA 3FCXA 3GUUA 2AHRA 3GI1A 1RVV1 2IA5A 5CVTA 4G41A 4MWSA 3W7AA 3F1LA 4EHAA 1DIBA 2QAIA 2ORVA 5KFXA 2OHXA 1KI7A 4U6PA 1E2FA 2TS1A 1T2UA 2IXGA 3NEAA 3SXPA 5F5NA 821PA 1VYHA 4HH3C 4Z5XA 1VBMA 4KYIB 4PSVA 4OHPA 1FP2A 3BSYA 2G4CA 2BW0A 4RMGA 4DLLA 4FNOA 2WTAA 3D5EA 4KPFC 1CVIA 5B3JA 4BEVA 1E63A 4FOOA 4EGFA 1WF6A 2H8KA 3N0VA 1SRRA 5K4GA 4B8WA 1LBIA 5DHTA 9ICPA 4LSWA 3ZHXA 2QL7A 3GCZA 4GSKA 4JXZA 2W6ZA 3EXHC 1XZPA 3HKEA 1QCKA 4X1YB 4J6FA 4WCFA 1J8YF 4LQDA 1DIAA 1VZ3A 4JB8A 5GJBA 1EFHA 1YH3A 4ZWNA 4UFOA 1KETA 3VAZA 8ABPA 2QRKA 2HK9A 3N6VA 1U2GC 1VJTA 4DWOA 4U0JA 2MU1A 3HBNA 3QITA 1IHXA 4K2AA 4NAVA 3GC6A 3VH1A 3AESB 4QOIA 4C80A 3FDIA 5I8ZA 1ZI9A 4KO8A 1C0PA 4KZKA 1JEQA 1U80A 5J0OA 3LRXA 3FGZA 5I3ZA 1CUAA 3ILVA 1KSHA 4YJFA 7ICKA 1YHZA 1DGJA 5EIBD 1MPXA 3FETA 1GZHB 4F0JA 2BL4A 1YBMA 4M9GA 5JFOA 3H3FA 4OL9A 1Z4IA 3ONFA 1AK2A 4OG2A 5MN6A 4RNOA 3HDQA 4NONA 4BOYA 2F7SA 1WUYA 3GVXA 1DWUA 3DUWA 1CHNA 1MQ2A 2XODA 2GGSA 3DO8A 2REBA 4E31A 5DTRA 3K7EA 2ZYDA 4AKIA 3DCYA 3VR6D 5IXYA 3GF4A 5JZSA 8ICWA 5C1IA 1LSUA 1FDOA 1J0AA 1U7PA 3SZUA 1F5SA 3PEYA 1I2BA 2H9IA 2JGJA 4XIFA 2HBQA 2UUAB 4GI7A 1GTVA 4S0ZA 4WTOA 3ZJTA 4RABA 1B3RA 2X8AA 1O6BA 5KSYA 3UTCA 3KQUA 3IUJA 4JL5A 3ZHYA 1DO0A 4X24A 1OI7A 1H1DA 1B0AA 2OZLA 2WUEA 3K92A 3L1HA 3DFFA 4QBHA 1D0SA 4QTUB 3FOFC 1DPGA 5FXMA 3VPGA 3CVVA 1OYYA 2BBTA 3IPCA 5KFKA 2PMZC 2Q45A 3KTAA 3D6UA 3KAJA 5KTPA 2FRDA 2YJ4A 1QIHA 1RRFA 3FJOA 1MEOA 1DC7A 1UZLA 1KK3A 1R0KA 3AHDA 4LI3X 1AKNA 3U4QB 4MKHA 2G08A 2FUG1 5LZ2A 1BRMA 1QGED 4W99A 3BZUA 1VMAA 5KTTA 2OB1A 4G5OA 5FTKA 2NU8B 4BCCA 4W5NA 1M1UA 1WUIS 1X1SA 3NCHA 3B7PA 3JZMA 3W5HA 1V95A 2NMVA 2P75A 1OI2A 2BIFA 2CXUA 3UGQA 5KZMB 4M6WA 3HXLA 1LDMA 3KQPA 3KOUA 1X7YA 3L8EA 1GPWB 1NX9A 3EEYA 8ICZA 3A1VA 3FWNA 2V6GA 5D3MB 1TB4A 1ZCJA 3U1TA 5ICSA 4B7CA 1MJGM 2X4LA 4WKCA 4MVJF 2XDAA 2GPWA 4ODIA 1XI2A 3MT7A 5KFYA 1W5SA 3LQ2A 5GOTA 2G8LA 4DWIA 4DV1B 4GLJA 3LT4A 4FOSA 1WXIA 5JLAA 3GJ5A 4FD2A 5DWDA 3GLGB 3ZCTA 1E96A 5AW6A 2VYQA 4IUCS 4JUBA 3KEMA 1VHJA 4FLFA 3B6IA 3OFSA 3AWIA 1Q1NA 2F9LA 2FMUA 4XOUA 2H1RA 1ODKA 2NV6A 3JQRA 3DHNA 3WK6A 2MIIA 1RPJA 1K06A 3ER6A 4I50B 2ASJA 3FHJA 2J3JA 5T4HA 1VMIA 4LQCA 1IRIA 2IF2A 3SC6A 4OUKX 4RCYA 2C4UA 1JHAA 4HJXA 3W7VA 2XMBA 3EPRA 4QTZA 5BY2A 5EC8A 1F2UB 1DIGA 4FYJA 4EK9A 4Y9SA 1SGGA 3UOGA 4HNUA 4LY9A 3V7KA 4B3HA 3BM5A 3N0RA 4F21A 4HF7A 2I55A 4IIBA 4OX9Y 1QGUA 3QHPA 4XAQA 5DOZA 5MHTA 4RSRA 4CQJA 4KPYA 1KQPA 1MRZA 3R09A 1K6IA 1RWNA 4IQWA 1MVOA 4PZAA 4X45A 2RGEA 5LQAA 2X6QA 2N75A 2VSOA 4WNAA 2ZBUA 1MCZA 5ECWA 4IQGA 2F76X 1JXLA 3QEAZ 4YQWA 2G0TA 1PR0A 3HDJA 1KKXA 2GPJA 2PO7A 4GF5A 1YMUA 2CN1A 5EXTA 3V72A 2NPOA 1U5BB 1NFRA 5KQMA 3WIDA 3MFHA 1CUYA 5KJEA 4I81A 4GQBA 4CV3A 2P6RA 2ZWMA 3S3TA 3E81A 2XOXA 3A4LA 1SZHA 2DL0A 1I2AA 4HLCA 4JYCA 5BPFA 2QV7A 5DIFA 1KJYA 2PUAA 3H0LB 4MH0R 4JYPA 3CUUA 3ECSA 5KT6A 3CVWA 4UOEA 3OOWA 2PGDA 3JPTA 1K5DA 4BP8A 2ZTEA 4BMXA 4TRJA 1RAAA 1E6MA 1EAYA 1E7YA 4BEJA 2BFNA 1X1EA 1QRSA 4ZI7B 1GA1A 5D3QA 3RVKA 1L5UA 2ZE8A 5J4LA 3AOEC 4MUYA 1KK0A 1G8MA 1TEHA 3ZLJA 4FDVA 1FTSA 4BV8A 5J1SB 5HSGA 1YDEA 3MVEA 1ZQGA 2AG6A 1AU9A 3HJTA 3LCRA 4IMRA 5TGZA 1PLKA 2O5CA 2IEGA 1T1JA 2W7TA 3AUJB 3C8HA 5ALXA 4PAOA 3T1OA 2WSBA 3G1TA 5KQSA 4P0QA 4LSGA 4BNIA 1L2TA 1Z82A 1EVZA 5B1SA 1J5XA 3GUZA 2J0QA 4BMYA 2ZVPX 1X9IA 4NP6A 1BYIA 3M1AA 3V2UA 3UJNA 2OV3A 3FTEA 5TPWA 2HUNA 1V11B 3IQHX 4DM4A 2HO4A 4LY6A 3GWZA 2UZ0A 3AVQA 1NV8A 4DVJA 1ZIOA 3S1AA 3C2QA 2WQ6A 3GPIA 1ACMA 1G63A 4DEVA 4R4JA 4PYQA 2QORA 3B1WA 4L5YA 1ZIYA 3SR3A 1LKZA 3O9ZA 4C3OB 3EXFA 1OU0A 4E11A 1NUHA 1OSNA 1RLTA 3HNPA 4HHEA 1E7RA 4TKLA 1GZ6A 4Q8EA 2LI6A 2WF7A 4GVXA 4RHUA 1ZJZA 4KE7A 2YFKA 5JTTA 3TBHA 5ED0A 3ENQA 2OFPA 4HNAA 3BZCA 3F6SA 3KEOA 4NNOA 4XQ8A 4W8GA 1QP8A 4OUDA 1ZGCA 3TQRA 4KLMA 1UKCA 1ZBDA 1VIYA 4WD3A 4LJ8A 1WS6A 3QLVC 2VYND 3V8QA 4FB4A 3KOWA 2ALJA 3DD5A 4FTWA 4EHHA 5K3FB 1HC7A 4HH1A 4BFUA 1WDKA 4L4UA 5LDHA 2JFGA 1L5OA 1Q7RA 1J20A 1TOAA 5LMCA 3TO5A 2GEKA 2ZYSA 3ZWWA 4BNFA 1ZIXA 4D80A 5CM9C 2A14A 4BVAA 3H9GA 4EMTA 2ZGVA 1YZ3A 4GH5A 1TA0A 3HXMA 1WIWA 3GZTB 4OJTA 4NYIR 3FNEA 5CT4A 1ZIDA 2F8SA 4NK5A 4ZMRA 2CYCA 3MUEA 2VTDA 5L95A 3T5LA 4BX9A 1ICIA 3WHLA 1Z2DA 3K53A 3GJ7A 3KU4A 1SBYA 3TIFA 1E99A 3IKVA 4AAYA 5K3EA 1X40A 3KNZA 3OLCX 1PZGA 2EQBA 3SJAA 5ERGB 2EW2A 2J7PD 3RFUA 4BKRA 3LQFA 2FN9A 2YBDA 3EMVA 3RC3A 3MAGA 2YIDA 2XOKD 4PJ0U 1WU8A 4QPDA 5FJJA 1T0JB 1PJSA 4XQCA 1Z25A 3RQIA 3EVTA 4QYIA 4ZVSA 1C41A 2VNAA 1MC1A 4PLPA 5EWJB 1RYMA 3CV3A 9ICWA 1QRAA 1L5HA 5J63A 4NPCA 3F6CA 3EC2A 3R6WA 2Q0QA 5I7VA 3OHBA 2XZPA 5TQ2B 4BFYA 3S8YA 4WJKB 2P77A 3DVAB 2CL5A 2ZR7A 3B1VA 1EUDB 1F12A 4LZAA 5H16A 2OUKA 3HUEA 3R8FA 3BWBA 5E7QA 1W5AA 3UHJA 2GJKA 2DUUA 4CLRB 1E1KA 2EJCA 5EWEA 4IVNA 3K70D 4HQFA 5E4TA 1KFKB 1GU7A 4ZJYA 1H8EA 2A35A 3GLKA 8ICKA 3OT5A 4JBLA 5JYEA 4PQGA 2LXNA 4AJIA 3CZQA 3Q8WA 3E1KA 3ZWDA 1C7EA 3PXUA 1BKDR 1N78A 4LHEA 3LOPA 5JRDS 5F3WB 1PFVA 5LXTB 4LZGA 5DM2A 4NLCA 2QRNA 1KE2A 2XYPA 1EJ2A 4QNRA 2C3UA 2ATCA 1ZM7A 10MHA 1KYWA 5LKRA 5GWXA 2GZMA 1IBMB 5HUHA 3JYOA 3ZCPA 4Z6DA 3VMFA 3RVJA 4Y7CA 2QVXX 2M98A 5GJWC 2B8WA 3QEBZ 3GXBA 4H6XA 4L9SA 2NNWB 1KU6A 1U02A 3HXPA 2EAPA 4O2AB 3KE8A 2QNRA 1DXHA 4B3FX 3DUFB 1VE9A 2HCJB 3GGJA 4IQVA 1GVNB 1IXZA 4AY3A 1H2YA 3ENWA 2DQSA 1FFUA 3COPA 3FAKA 3VHXA 2BONA 1BS1A 4UHCA 2YMPA 3T3GA 5KT5A 4CF5A 4GXIA 3I4CA 2FN8A 1UMBA 1X7ZA 4L57A 3TZCA 3V2IA 1QG2A 4NX2A 1Y1QA 1UBHS 3AHIA 1XGKA 5LYJF 4C5AA 4YALA 1DC4A 3K72B 3PSPA 1BG6A 4CL0A 3TNFA 4MAAA 2C4NA 3D5TA 3EWNA 1BPXA 4KXVA 4LJ6A 5CM8B 2IS1A 3AHFA 2A4MA 3SI7A 3ZWQA 3ZDEA 4OXNA 4LZLA 2C2HA 1US8B 2PKQO 1JKJB 3TINA 1RI3A 4D92A 2AOTB 4UM7A 5DI3B 5C81A 2Q6KA 1P7VA 1JR3E 4R2KA 3DZHA 4N39A 1I32A 3AIOA 4D9GA 4YRLA 3P9IA 2F67A 1PR6A 4UUAA 5JDIA 3PDIA 4EPTA 3GH3A 2GYVA 4FS8A 5C0OE 3IIJA 3T7SA 4HXFB 1BSVA 3KAKA 3OIDA 4KH1A 5DN6A 4RQ3A 4HPXB 3AB3A 1GAXA 4E32A 4TQSA 2HMXA 3BD6A 3PCRB 4MULA 3T1QA 1QSSA 3M4XA 4JV1A 2JHPA 3MJSA 2XA9A 5DFAA 1X7XA 4ISCA 4HTAA 2VPWA 3RROA 1U8UA 2ZJAA 5TQJA 1PFYA 1KY5A 3FYTA 1P0FA 1MC8A 2FUG6 1XRLA 3IJRA 4RA6B 1ZXIA 2A7QA 1ZISA 2Y1CA 3G2HA 3N05A 3P97A 3ZHZA 4DA8A 3LWNA 1BNOA 4X7RA 2WIAA 4LZOA 4ECQA 1E0KA 1ELOA 3WYNA 2P6OA 1GCIA 4MUGA 3LT5A 4B83A 1DTWA 2KMLA 1OW3B 3AY6A 3OJFA 3I9JA 2D1YA 4K1LA 2VDVE 3G8YA 2WBLC 3MGCA 1NVAA 4QODA 2PZGA 3UMFA 7ICGA 3DO6A 4B3DA 2A9RA 1DZIA 3E2EA 4GZLA 1NW9B 3B8HA 4BNNA 2P4HX 2CDCA 2SKCA 2I2FA 4CMJA 1NU6A 4J9OA 1ES9A 5IT5A 1XK6A 2WF8A 2RJOA 2D2EA 2PR7A 3JZDA 3LO5A 4V0LA 1X13A 5KG7A 3ZD6A 5IILA 1HY3A 2NYUA 3U3OA 1OLUA 3CUYA 3UAVA 4HK4A 1XQYA 3EGVA 4BNMA 3GUHA 3ZXIA 4HEJA 1I1QB 1P9OA 5AK6A 3DEHA 3TOVA 4P4TA 4YFYA 3DBIA 5B12A 1TZKA 2I1VB 5DHFA 2RGAA 1L6RA 1R10A 3AVUA 4JT4A 3MGIA 1VMKA 4CMEC 4AUEA 1A9RA 3WP0A 2QDKA 5EWFA 4ZZ3A 4IH1A 1SC3A 3FG9A 3TB4A 5IP5A 5ICCA 5BSHA 5HGXA 4RWEA 4D4IA 4GM1A 2RRDA 1XS9D 3W7BA 5IAGA 2D8MA 2AX4A 2BCSA 4NBLA 5AJVB 1RQ2A 4O9MA 3T0FA 2BHTA 2XQVA 5CVJA 4GC6A 1EK1A 2X3UA 5TEVA 2IYOA 3MRVA 3RYCA 3AJ9A 5BSFA 4FKBA 3E8SA 5L1KA 1JALA 3MSXA 4RJIA 5KFAA 5HMLA 3JWJA 1GTG1 5LYYA 4BMOB 1T3TA 1TKRA 3V7FA 1QHEA 3W4JA 5DP1A 4B31A 3HPOA 4YXJA 3M6AA 2RP5A 3NBAA 3T5HA 1VPEA 2LRHA 3L8YA 3ZNNA 1T3HA 3N2LA 1QOZA 2IXEA 4W1PA 3JV7A 5ITSA 3FCCA 1ZU4A 3WMEA 4PLYA 1XVUA 2P2ZA 1IY9A 2F90A 1N75A 1ODTC 4L3WA 3HUFA 4BB9A 4IS2A 4MV8A 3QOFA 2G88A 4LF9B 2FLLA 1X94A 1I36A 1GSIA 1PG2A 1KEJA 2IU4A 3LLCA 4EJSB 4RQMA 4O4HF 1UIRA 3ZVMA 2C2KA 3E9YA 3N07A 3V8RA 4DLSA 4B9MA 3H4VA 3ZI0A 3BILA 3EPLA 3EHEA 2JCYA 3OZRA 4OAPA 1XMXA 3N58A 1I3CA 4M8NE 2CLDX 3RJKA 1ZVKA 5I8WA 1SUSA 2JHCA 1FO4A 3FLMA 1NU8A 2PRYA 1N33B 4IMIB 3JAKB 5K3OA 1K4KA 4DCGA 4LBVA 1E64A 1WQ1R 1F44A 3HGMA 5F1KA 4GKBA 3K9HA 4LY0A 4PHAA 3N7TA 3IIKA 1E3DA 4BE9A 4UVGA 3SIPA 3M6VA 3AVOA 4G5YA 1FC0A 3JAWA 4Q34A 1Q0RA 2XQJA 1GPLA 1NMSA 2YV2A 4IJWA 5TZVA 5IWCA 3I0MA 1G60A 3FYUC 1Z3EB 4M8KA 1NF2A 1OX5A 2GBFA 2KW5A 3QMMA 1NK9A 4MQ6A 1CF9A 4X1YA 4ABTA 4R16A 5CLHA 3F98A 5DMXA 2OYSA 2H85A 2JI4A 3NTUA 4TVOA 3PHGA 3F6EX 5TMPA 1M54A 4AK9A 1EZZA 5DZSA 2JIZA 3Q6IA 1NN1A 4AY5A 1ZL0A 3K0CA 3L8ZA 5E6UA 1E2DA 4F86A 2LCIA 3SEFA 3B1FA 5EZ5A 4CL2A 1WMFA 2ZB8A 3BYZA 1D7OA 1F9AA 2Q27A 3GL9A 4Q43A 4XWAA 1G6OA 1TV9A 4HB3A 2ZB3A 5B57C 9GPBA 2Z9CA 1X19A 2P9BA 5BW6B 4AMVA 2X2PA 2RGWA 3USZA 4QHYA 2WHXA 1IOZA 2GAJA 3K94A 1NIPA 2BFEA 4B7XA 3EGXA 4OQDA 2IGTA 4LJXA 1J9GA 1KVUA 1H2WA 5P8WA 1KDVA 2JLCA 1B14A 2AJTA 2ZJ6A 1DCTA 1UC8A 2WA1A 2QLFA 2DPGA 3IRVA 4QZDA 2PFGA 2O1WA 1E5QA 4AZ3B 4ETWA 5ALQA 2L0XA 2OG1A 4FT2A 1GM5A 3VKGA 2FY8A 1Z15A 3H9BA 2WWIA 2HHJA 3D2AA 5DGAA 4BLTA 4PQYA 2V9WA 4YUWA 1MG5A 5K3SA 1QHIA 3CO5A 3M8KA 3OCWA 1ESMA 4BQOA 2O05A 3QNUA 1YKGA 1QO0A 4EZEA 4ML3A 2JFNA 5L1MA 5KWSA 4GX2A 3PL1A 3NYIA 4WECA 4YFKA 2ICAA 3V1YA 3V8VA 2GK3A 3U80A 4JLBA 3ZW9A 3RS9A 2OP0A 5KPDA 2GZAA 2X9QA 4OFWA 1ZOIA 4IFIA 3KSAC 5EWLB 5IF3A 1X77A 3K5IA 1W8DA 5FHQA 2J6HA 3E5HA 1WWVA 2FW1A 1RYUA 3ZWOA 3ZCSA 5HM8A 1GPH1 1KI8A 4C04A 3L1VA 1VOTA 1TEVA 1H0HA 4OHZA 3IJ5A 4M21A 4FFDA 4G1EB 4A6PA 2YZMA 3TTYA 3ANYB 1OH5A 3R7BA 3PIRA 1Z0UA 4BWFB 1S2LA 3ADDA 3V1UA 4BL5A 1YB2A 4V3CA 4LECA 2V4MA 1J23A 1T5LA 4DSAA 2Q99A 4C5CA 3BSWA 1L5RA 2VYVA 5LPNA 2LYAA 3H2KA 3ROGA 4HNQA 4XQGA 2Y0EA 2D7CA 1NXVA 5IBRA 1C4WA 3I0NA 2P11A 4JT8A 2AN9A 3GFQA 5J2CA 5LBTA 3E22B 5GINE 2DBZA 4RXTA 1Z6TA 1LDNA 3DZCA 1KVTA 4X61A 4DADA 3O8QB 3DEFA 4XB2A 5D3MA 5F35A 1KYXA 4WKBA 3DTVB 5BN3B 2O06A 4LXUA 2IZOA 2RARA 4YMIA 1X0XA 4Y1FA 1C7QA 5JUWA 2XICA 4Z9FA 2XGJA 3NO4A 3ZU3A 2EC5A 3SLRA 1ISSA 5M34A 1L7EA 2W6IA 3GLGE 4YCAA 4FMCF 4L8WB 4F2HA 4E5MA 3PUXA 3R9XB 4C20A 5K0ZA 1LDBA 4QZHA 4OBXA 7MHTA 3V8EA 3FRHA 3O90A 1K6XA 3JTMA 5TDHA 2M32A 1P29A 1JDBC 4BEBA 3IV9A 4A8PA 4QU5A 3RS2A 1KMHB 3KXIA 4YAWA 2XKJE 1WMAA 1XEXA 4MJXA 4ALIA 1DAOA 2QSJA 3VJRA 3CWQA 4CIXA 3SC2A 2AEJA 1UEIA 3MWDB 2OOSA 5FCDA 4KVGA 1A4RA 3L2OB 1NWHA 4OA5A 2QMYA 4I5DA 2HCTA 4LOAA 3RJZA 1QU2A 2DFPA 1PF7E 2IYUA 4Q1AA 1MA3A 3N8IA 4LZNA 5GAJA 5F64A 3V48A 1WULS 2WJ3A 2RI6A 3AXSA 4R68A 5L4LA 4DLGA 3ISVA 1CP3A 3CH6A 3GV7B 3GIIA 4TL6A 3W3AA 7MDHA 1WHTB 1ZQZA 3MJ4A 2PD4A 2Z8YM 3V5NA 1U11A 3BH6A 3WI7A 5KPJA 3TOZA 4NU5A 3EFOB 4F4UA 1X7WB 4HLDA 2VCEA 1VGVA 4MLPA 5IMSA 1E4EB 6PFKA 5KG5A 4NI5A 4WT7A 2P3OA 4QDUA 5JNVA 3KVVA 1NQOA 1Z0SA 2BISA 1GRNA 2WAQC 4U7JA 4OV6B 5A4FS 3ND8A 1RM6C 1VFPA 5KOYA 1E4OA 2FPIB 4QGBA 3DLHA 2TRSB 4N18A 2FZWA 221PA 1JRLA 1SIUA 3OEHD 3DZDA 2AQ4A 2I7CA 4XYBA 3URKA 3F5QA 1PGJA 3IEMA 2CHUA 3IE0A 4K9KA 3OOEA 5K3CA 4YHHB 3C97A 2ZYIA 4BBJA 2H16A 3QE0A 4U2KA 4NJEA 1DOZA 4DFDA 3KPWA 1P77A 1ECWA 2ZJZA 4MGEA 2WYWA 4UD6A 1BW9B 3SOPA 5HKAA 4HPWA 4OMFG 5J0UA 2IW1A 2EP5A 3EDMA 5A7GA 2O50A 4FONA 1YASA 2XBUA 3MR6A 2VSFA 3Q7QA 3A36A 3VI4B 3PNSA 2JCVA 2JGFA 5CA7A 4JS0A 1ZQVA 5LP6C 5AKYA 1RKVA 2NXCA 5E38A 1BHO1 2ORWA 2IH2A 2JGDA 3I73A 3JPRA 1JG4A 1U7UA 2PXAA 4D3YA 3SR0A 3U6KA 1B43A 2PMBA 3GGPA 4QARA 1EGAA 1KO4A 4EVRA 3SJZA 3UWPA 1T8WA 1AB6A 5C8YF 3BHNA 4ASUA 4ER5A 3W6UA 4A1OA 3NTQA 1ONBA 1D4AA 5EZ6B 3U44A 1DIOB 2RGBA 3KELA 4CMGA 4HWSA 1X6JA 1GNPA 3NBUA 3PHJA 3CMCO 4N4AA 2DY0A 3TQSA 1NMYA 2X86A 4HB4A 1UK9A 3WBFA 3R6TA 3JD2A 3N75A 2JJQA 1TTQB 5FLXA 5KTOA 2JD2A 2K4PA 4WE3A 3PHBE 2Y93A 2YFYA 1EXNA 1H69A 1BCRA 5DB7A 3EXEA 4FHGA 3ORRA 1E2KA 4IRUB 4WCVA 3W9SA 2W98A 2ZIVA 2JLUA 2YS6A 3TOCA 4RIEA 1ST2A 1I5RA 1FL9A 2WG0A 4Z7OB 4OP1A 4HDSB 1YR8A 3PPXA 5EWGA 4KIWA 2XVXA 4AT1A 1IZ0A 3CBQA 5AUPB 3A9RA 3HB7A 4EO9A 3G82C 3GJ8A 1VIDA 4L4XA 1VL1A 3UXMA 1XNQB 3KM0A 3T8YA 2WW8A 5ALRA 4R8UA 1TVKB 1Y1PA 2XTJA 2WT8A 3PP8A 2F8KA 3E61A 2R6FA 2E21A 3IILA 4RO0A 1IUNA 3M6UA 1GHTA 3WBJA 1ZQCA 1BJRE 1RP7A 3D3WA 3LU1A 1ZU5A 4DFMA 4EBCA 5KDLA 1F7VA 1DC5A 3L7DA 2VS1A 4B3JA 1K3UB 1RC1A 4M38A 4RH0A 2QARB 4IDEA 5C7IO 3C98A 2ZYAA 2WVHA 3H8VA 3HVIA 3HWWA 3SN6A 4RZRA 3RFCA 2X5XA 3U37A 2X1HA 3ZU2A 3PEUA 2NZ2A 2K7FA 3ZOKA 1YJAA 1Y6ZA 3EMKA 2SBTA 3A9UA 4BVHA 1EXVA 1OD6A 4LWOA 2J4CA 1SV0A 2ISCA 3WGQA 1Z0ZA 4B46A 4YK7A 3GNLA 4GI3A 1IQ0A 4IICA 3OHPA 3QFRA 2HCRA 4LZJA 1RJ9A 2HQRA 1IBSA 4KACA 2C8LA 1Y5NA 1EAMA 1R0XA 4I4TB 2B8JA 4EHDA 3ZHOA 4MFAA 3FDZB 4NWIA 1HV8A 4G1CA 4JSRA 2FWIA 3LBAA 3WZLA 2FLVA 3EQ2A 2CSXA 3CVJA 1FTGA 3NG1A 5FWDA 3SE0A 3IOYA 3FTNA 3L7YA 2TMYA 5KYVA 4UAJA 4XLTA 1R5JA 2F8TA 2FW8A 2Q4BA 4JUZA 3T1VA 1RYEA 2HUPA 2OHVA 2GHIA 1Q15A 1F0YA 4O3OA 4YN3A 4L08A 5IVKA 3RGWS 4GS5A 2WYIA 2O8BB 2W6JD 1SKSA 5FL7A 2DBVO 4Y6RA 3GP5A 5AJYA 1COKA 3V1LA 4KN4A 4MYHA 2AOWA 5CPFA 5TRTA 1VBFA 2PZFA 3DVAA 4PHEA 4BGIA 3OAAA 2NVUA 1NQAO 3PRJA 4Q7EA 4HNVA 5BWLA 4KR7A 2F4NA 3PZPA 3JXEA 2DY1A 3C3AA 1J39A 2VRCA 1QIGA 4CLRA 1DJLA 4D4JA 3LI2A 3MD9A 4GX5A 3ZLTA 4ARZA 3IEKA 3B6KA 2QD1A 2JL1A 1YDFA 3GA7A 5DU2A 4DBVO 1O95A 2QTNA 2Y9UA 3AW9A 4D3SA 1YRHA 3G8DA 4C4RA 5BSRA 4ROTA 4EL0A 1MTZA 1R0ZA 4PFKA 3F97A 4YMUA 5IAEA 5GZ1A 4KIUA 1YL7A 1PJQA 2VJYA 3FZQA 5JS6A 3CZ4A 2C2MA 3G23A 2JGIA 3U7IA 3ZJUA 3KVRA 4BJHB 3D6MA 3LVRE 1Z6GA 2Q4DA 4AN1A 3VSAA 4KDFA 2EGHA 1XEWY 2H1LA 2J33A 3IPRA 3UO8B 1LH0A 1BCSA 2NO5A 1G2PA 3BHJA 4IL6U 2G25A 4YJKA 2A1JA 1GGFA 2X2FA 3AMVA 1ZNWA 1ID1A 2XGOA 1KO5A 3G13A 5ITWA 3KQHA 1ADFA 3RK4A 4PIVA 2OO7A 3ICWA 2H59A 1VRCA 1QFYA 2IVFA 4EO4A 5I4KA 1Z07A 1ABFA 2O6LA 3LPCA 2Z2ZA 4A0HA 4MUMA 1P4AA 1XKXA 3IAHA 2IUTA 3R41A 4R1UA 5M04A 3EH2A 4HYEA 4KYUA 3ROTA 1YHYA 2ZBVA 1LFDB 5L3SB 3L0IB 1QYWA 1ZL2A 1W29A 4XLLA 2A2ZA 4Q4JA 3WOHA 1US8A 2NZVG 3WRWA 5E4JA 1N25A 4LJSA 1DOHA 1L5FA 1Z28A 1YTLA 4XIYA 2PBLA 4L2IB 2WRZA 5DI3A 3PE6A 1S2IA 4L75A 3IRUA 4P35A 3DOFA 1UP6A 3K15A 4N01A 4QFMA 1YQTA 1C9EA 5DXJA 5H0IA 2WG1A 4R69A 2ES4A 2Q3BA 4OI4A 1AZSC 3OZVA 3T35A 1JI0A 4G23A 4JI4B 4Q18A 1VIVA 4GL2A 2FX2A 2P65A 4R1LA 1T9AA 3N74A 3TM5A 3SC3A 4XUDA 3UOAB 4LS3A 2ZIWB 1XZHA 2V3VA 3O3OB 2QJOA 2H29A 1ID8A 2EFDB 1AZWA 4IHAA 5AOCA 5JU5A 3F53A 2Z2XA 4JP8A 4J7CA 4EUEA 1K66A 5BO5A 3NFYA 1PR9A 4LAFA 4EPWA 4JLWA 3WLQA 3RH6A 2PH1A 4GC5A 5LDGA 2H7XA 1QPBA 4BNDB 5FPPA 3ZLBA 4R8LA 2I5HA 1XF9A 4PW0A 3QVVA 2EKQA 4G0ZA 4UB8U 4XGKA 4DOBA 3OTQA 4EY7A 3IELA 1G3MA 2CV1A 3MOGA 4LHVA 1DUIA 2RKOA 5KNBH 4UXJA 1QIFA 1T9ZA 2OO5A 3BMNB 3EARA 3OLZA 1T7PA 2CVQA 1ZVVA 1FMLA 4M9JA 2O2ZA 2VXOA 4FILA 2Q3EA 5FLKA 3ZZNA 2C22A 2BM9A 3E4CA 4BC0A 1MW8X 4RHFA 2JBAB 3A37A 3BL8A 4AQDA 5B5EU 5BXQC 1DO8A 4ECWA 4XR9A 4KPUB 3EVDA 4LJ7A 4Y7DA 4ZQFA 5HKOA 1E8NA 4YRGA 1ABBA 2J5RA 4EEYA 2V9PA 3DYIA 5FUXA 4NBNA 4QG7A 1L7XA 3DVLA 1M2FA 2XWQA 3WBKA 2XDQA 3PUJA 1OZFA 4JXKA 1OLXB 2MWMA 4GKAA 4XXHA 1U2DA 3AY0A 2QR5A 1XZQA 1VBNA 2YVUA 1MOZA 3VZRA 1GKYA 5G0WA 4UD2A 3VR4H 5A3RA 3AM4A 2C77A 4MB6A 3DL4A 3MTIA 1D2HA 4MRMA 4JH0A 4NV0A 1MO2A 3I1YA 2IYRA 3SQXA 3D0RA 3OWHA 5LIRA 1Z4KA 3NHKA 1ZGBA 2EQ5A 5TS3A 8ICOA 2G3YA 1MC4A 3UHAA 5K3AA 4NZMA 2VDRB 3GA5A 16PKA 4XWTA 3UMCA 4POOA 1FVFA 1O96B 3TTWA 4ECXA 4O2BF 2ZUDA 4YONB 2QZZA 3G2JA 1XMOB 2PKWA 2VZ0A 1ZQIA 3HBJA 3GGOA 4HR7A 4QJIA 1KZ7B 2H3ZA 1J7KA 5K0TA 1QO7A 1P81A 4QWAA 3OC0A 1UQVA 1P5JA 1V8FA 1JMVA 4FR5A 4KQ1A 2PIDA 2XCIA 1VGRA 2BI4A 5FIUA 1O6CA 1MV5A 4WESA 2VKTA 2BRUC 3TLCA 3CX7A 1NULA 1Q17A 3O1IC 2Z5GA 1U2SA 5JH7B 4NH0A 1H3FA 2OESA 1P9NA 2P3LA 4PHCA 3KQMA 1KERA 4ZXPA 4B85A 2BEVB 2ZM5A 1KDRA 4LNAA 4GQIA 3IFSA 1GTL1 5DRTA 3OETA 4OYLA 2H63A 1GV0A 1XXHB 1J6UA 4G85A 2PZBA 2B6HA 2H54A 3PPWA 4PQEA 4D41A 1RI1A 3CYFA 2OZKA 1NZDA 4Z1MD 5DHAA 4I6EA 3BEOA 1YOBA 3NDJA 4D44A 3H42B 1IAQA 2GBPA 4F5NA 3KSBC 1IWOA 4PGHA 4A6EA 3DAGA 3WGGA 1AM4D 2CJWA 2C31A 1B74A 2JFHA 1VP9A 4JHXA 1XAIA 2VKQA 2JFUA 2HA4A 1QZ3A 3R23A 2R79A 3PA8A 2HU2A 5SYNA 3S1LA 4HATA 1A5SB 4PLTA 3TZ6A 5K4AA 3LVFO 5PGMA 3JAKA 2DR2A 2QVBA 2X77A 4NHEA 2CLMB 1IIBA 9ABPA 4DQKA 2WSIA 1NTOA 1YZHA 3SEIA 5IABA 3F1KA 3FY4A 4X20A 1EM8A 1L8LA 2M9NA 3A3KA 3C4VA 4JBIA 1BXRA 2ZPTX 3W2TA 1JQ5A 1YUBA 3AN1A 4BU1A 3U9SA 3TCKA 3PB3A 3B3JA 3CBGA 5HCIA 1BGVA 3D2SA 3C28A 5F76A 1NVGA 2HV8A 3CRW1 1YI1A 2RDIA 3H11A 2EF0A 3HJBA 4PQFA 3NBQA 3L02A 7ABPA 3BKWA 4O3RA 1S0UA 1VB3A 5JJIA 4K2HA 3BE5A 2JCGA 2IDMA 5C37A 2WIKA 4ZIRB 5BV8A 2JGLA 1Y63A 5H2FU 4ESOA 1KJ8A 1T6BY 1ENZA 4QX6A 1TVAA 1S7CA 1KJ9A 4IKOA 3R7SA 4CV1A 2RK4A 4AG3A 2FHPA 1P7YA 2BGWA 2DEUA 5AVTA 3FWKA 5ALSA 2HMWA 4JVLA 2LM1A 3CSSA 1IZYA 1I14A 2CGEA 4URXR 2XW6A 3A1EA 1Z7BA 1NBMD 3NV9A 2ADOA 3IEIA 3DE3X 1LBTA 1LVUA 1GQYA 2XNKA 1ZNYA 3DDWA 1T5BA 1IG3A 3NI2A 3K6JA 5KOJB 2OFFA 5IC5A 4MXDA 1Y1SA 3AI3A 4YQYA 4WH0A 2C8KA 1JG1A 4BNVA 2J0SA 1QRUA 2BM8A 1U98A 4J0QA 3SS7X 1ZH0A 4UTXA 5BQXA 1XHLA 4Z53A 1C4XA 1RZRA 3LCUA 2JR5A 1HZZC 2Y0PA 1ONPA 1MB4A 1OBOA 5G0TA 2W8LA 2QW0X 4U7FA 2AWNA 4EG1A 4JJ8A 4QELA 4WZAB 4LVSA 4LI0A 4B44A 4C4ZA 2VANA 3ZU6A 2FRXA 1IN1A 3A9WA 1YJ5A 1RJFA 4RS3A 2C1XA 2M2IA 3RI3A 4JV5B 1T4CB 4F3RA 3K4PA 5D01A 2ENWA 4WGGA 4ZGGA 2VDMB 4JY7A 3TD2A 4DMMA 5LD2B 2BP7A 2JATA 3VU1A 2WUVA 2PZLA 4KKXB 3BSFA 1S5PA 4R8KA 3ZKWB 1WE2A 1QSGA 4W5QA 5HQ3B 4Q82A 1KU0A 2EIXA 2P9EA 1XZFA 4YCDA 2YXLA 3Q8PB 3CLTD 4QA9A 1GA6A 5H81A 3OKPA 4DOCA 2D6FA 3JQCA 4JT2A 2W7PA 3M83A 1WU7A 4EECA 2PWAA 5E9WA 3EJ6A 2IHMA 2I6TA 3G88A 1OPRA 3EVBA 1DRUA 4P5EA 3H1FA 4EHBA 3IKTA 4RIGA 5DG7A 2E8NA 1KTQA 1TADA 4R1OA 4GOOD 4GXJA 3R7LA 3UW3A 2GM4A 1A1SA 1YC2A 2NZXA 1QWSA 1QRDA 4KFCA 1ANKA 5J8YC 3ANTA 3EZ9A 1CR6A 1Y82A 3TUIC 1XFAA 1HLDA 3KXDA 4UB2A 5DEIA 5HOEA 2OWDA 3D7SA 3UW1A 2PD3A 3RR2A 3ETGA 5B53A 3IERA 2ODGA 1AB5A 4IR7A 3E22A 5GZ6A 3G2LA 4E14A 1GPBA 1E2GA 1NVKA 3K0HA 3TGWA 3PG5A 4E5PA 1S97A 5SV2A 1W30A 5BN3A 1PJ2A 1BE8A 3QIVA 4DCVA 2Z8XA 3KE9A 5CYFA 2NX2A 3VKUA 1ATZA 1MENA 1SXIA 3LT0A 3LECA 4ADSG 3WQBA 4HAOA 4NENA 1QOPB 3FPBA 1BNPA 4BTLA 3ITNA 4P4NA 3KEGA 4F72A 2R11A 4MIKA 3QMPA 4IRCA 3BWMA 2IYFA 3IOBA 1UDXA 1W0JA 1L7RA 1E5TA 1EFDN 2BE9A 3V42A 3R9XA 1HGXA 1HE2A 5ERYA 2W2NA 1Z5NA 3MWGA 4ZOEA 4BFWA 3S8MA 1XTZA 3I2IA 5KUTA 1MEJA 5JXWA 4EENA 3NBZC 1KMHA 3LCJA 5EHIA 2BKLA 4PNHA 4PPXA 1OYOA 1SCIA 2GSDA 4ZKEA 3AZQA 2WHQA 4GYJA 1PK7A 4DHEA 2VQEB 2FQXA 5JNLA 1LQ2A 3MWDA 5J2KA 4ZU1X 1Y98A 5A9TA 5DGDA 3N7AA 1MT0A 4L02A 2BBSA 1EA7A 4P4MA 2A5JA 3JQ6A 2D4AA 4RV5A 4YUVA 4EUHA 1N5OX 3S4YA 1N2CB 1C7ZA 4P4GA 3TF5A 3ASUA 3OOHA 1XWFA 4UHFA 4Z3KA 3CR8A 1AS3A 4GPIB 2ZUCA 1RM3A 3WV5A 1KLNA 1RWBA 4RDCA 4AYTA 5AKXA 2G5GX 4IW3B 2RAUA 3RASA 1WHTA 2W2KB 3NHBA 4IOLA 3DDSA 1VGQA 2HPVA 4Q4LA 3LCVB 4LQLA 1H2AS 5H9WA 1QBKC 1XQ6A 3BIWA 3PKJA 4UQLA 3IDQA 2OBFA 3F46A 5CJPA 1ZP6A 1SB8A 1P1BA 3ZZUA 1DRKA 3B1ZA 3KSUA 1IAVA 2FGKA 4LMPA 1ZQNA 2CK3D 2JIMA 3H8MA 3IUQA 3DSRA 2HDHA 4H7PA 3WRXA 2QP3A 2NYRA 3VH4A 1ZQJA 4GGOA 2FPIA 4AKEA 4GMDA 2PGAA 1CDEA 2X42A 4EB8A 1SU8A 2R8BA 5C46F 2XADA 3SQIA 3RAPR 1Z6ZA 4CW7A 1B8PA 2WMYA 1PO7A 1WCWA 4ZZ1A 2VDQB 5JE8A 5H02A 1ORWA 3O9MA 1ZEJA 1WSAA 3RC1A 2R8GA 3E70C 5HFNA 3ROXA 1SJ9A 3G2IA 2YBEA 1QYIA 3HK2A 2X8JA 4AS1A 2Q49A 2CNDA 3WA7A 1MNQA 2XWSA 5AQEA 1PFUA 5J4KA 3ZK7A 3DM5A 2IZ1A 3D8RA 1DX9A 5AKHA 2E55A 3NRZA 2O8CB 3GLFB 4F5YA 2IBKA 2I3GA 3EIFA 2BMFA 1ZG3A 3AETB 1MHPA 1M6YA 4P7BA 2J41A 1MZPA 5F7OA 5DHUA 2IOYA 3L4PA 1SKYB 4F4IA 3PU6A 1BPEA 3SYNA 5CFQA 2Z2KA 1E9SA 2ATIA 1XDGA 2V8OA 2G6BA 5I8PA 2AQ0A 2ZK7A 4HLUC 3GJZA 3SCZA 5IDQA 1K4MA 2AS0A 4E3WA 4LHWA 3LQ1A 3D3NA 3ZZMA 4E0DA 5FI5A 2HC9A 2R4UA 1H5NA 5AM5A 3MQ2A 2Z57A 1YZTA 4HQKA 2R87A 2NRVA 3NAMA 4WKGA 4QVKA 4FBGA 4HEA1 5D86A 1QP4A 1LK0A 2BH9A 1IMJA 1CQIA 3UXPA 5JCJA 4M0CA 4PC1A 4CV2A 1KIFA 3Q41A 3N8KA 1WSBA 5FFFA 4NE7A 2DUNA 1N3BA 3BSSA 1M2OB 4CIWA 3DR3A 2QT0A 4EJ2A 4HDSA 1NA5A 4MW7A 2AUNA 3P9RA 3AY7A 4RFSB 1Q77A 2QB0A 6LDHA 3SHTA 1NRJB 4M4SA 2Q1SA 1N1MA 4LSZA 1EFVB 4IIFA 1BNCA 3C1UA 1ADBA 2FWBA 1H3NA 3NHYA 3TRKA 5BQOA 2AJCA 1Y8QA 1JR3A 1JDZA 3AHHA 4G9EA 1H2HA 3PO5A 4UCXA 3STHA 3O7WA 4AIIA 4TOIA 5F2KA 3ETDA 5LMZA 4WEQA 3L8CA 3ZHUA 5LVAA 4FBMA 4C8NA 1UJ4A 3R0VA 4F46A 2IIBA 2KMDA 3GCXA 3OJOA 4DV0B 1LPPA 1ITZA 4O3SA 1PQ4A 4R40A 3KYDB 1V3QE 3N0TA 5JEEA 5L9AA 2IQ5A 1PK8A 2FG5A 1E20A 3VOBA 3FCEA 3FFBA 4ZC1A 1TGYA 2OK8A 3TD6A 4O33A 2ZIGA 2R3SA 3NORA 4D99A 4KLTA 4J0IA 3GYBA 1B0UA 3K2BA 1G3QA 3LYHA 3NHFA 1Y0BA 3PHLA 4LXHA 1H4SA 3A25A 4OIFA 3PUWA 5M2QA 3NBMA 4GX1A 1E8MA 3LDGA 3FDZA 1C7JA 4OHBA 2DR0A 5IM4F 3FMFA 4WLOA 4Q9AA 4JC0A 2WY2D 1Q1QA 1RHJA 4QUEA 2ZXHA 4DR6B 4E30A 2IZ5A 4N6NA 3OP1A 4BLVA 3GRPA 5DE3A 4CUKA 3K09A 5CHGA 2VDWB 1Y7TA 1SEPA 5EZQA 4YDHB 2ZR9A 3N2GA 3GZ4A 5DO9A 3RSLA 1BDMA 4B8YA 3R3VA 4RH1A 1YB1A 1ZMXA 5IDXA 3UT5A 4LJ4A 3BZBA 4GPAA 3IR7A 3NUGA 4B9EA 3AEQA 4TSFD 4MP3A 1L8AA 1I3MA 2I4MA 2YWFA 5KNLA 5LOVF 3IVAA 3LQKA 2VDOB 3HACA 1D04A 1C20A 5ES4B 4D8UA 5CT8A 5FI0B 1RWKA 2PGIA 5FR1A 1QE0A 1II9A 2V7BA 5KHAA 1EXWA 4N5DA 2C84A 3WLAA 4UEWA 1TIKA 1MIHA 1BOFA 4ATNA 1YQUA 1SV4A 3GP8A 2JAQA 1N8NA 3CNEA 1V5IA 2PAFA 4JK3A 3Q0IA 1Z34A 3R8CA 2BFDA 2P9QA 5F7ZA 4D81A 5L1LA 4PTLA 2WNIA 3RT7A 4D3FA 5EOZA 5ECDA 2ARKA 1KS9A 2ZIUA 1YZUA 4RJKA 1OB5A 1SXEA 1L7VC 2C9ZA 1JB1A 3I8SA 2FSPA 4H77A 3S40A 2UDPA 4CLOA 1THZA 1A8IA 4TXJA 1J4AA 4JLUA 4X94A 1WA5A 1UINA 1DBWA 2W9XA 2HJSA 2QUBA 1FDTA 1JHMA 5JMTA 1XNJA 5EQDA 3F9IA 4MV3A 5BSEA 2IX3A 5KFGA 2R8KA 3QOXA 3QBEA 5K4HA 3P9CA 1NMXA 3JATB 5K0SA 3CF6R 1QQTA 1A8PA 5JY1A 1JSLA 4UOQA 1GPJA 5JWRA 3T9BA 2G40A 2HGSA 4C14A 5KFUA 5T57A 4WBXC 3ICOA 3C3WA 4WBNA 3JR3A 1XC7A 4YROA 1O9GA 3UXNA 3QI2A 5CT6A 4XJTA 2WJZB 3QFFA 4RPXA 1L4GA 1NKSA 4CN8A 5H3HA 4BBPA 2VOJA 3LK6A 3R9IA 2JD0A 2A33A 3GZJA 2H3HA 1FP4B 1C1XA 3LWZA 4JCCA 3TIGA 2HYDA 1A8HA 1KMMA 2IZ7A 5FPHA 1TJ4A 2VHXA 5KS2A 1BWSA 3IGFA 4N6OA 3TW4A 1QVVA 3OX1A 3ZS8A 3LYAA 5L3SA 3EJWA 2QE7A 2HMTA 3WL7A 5F2OA 3O3NB 4Q44A 3GFSA 1GYQA 3CF4A 2H18A 1UXGA 1LI7A 4K3UA 1GIAA 1V4VA 3EDOA 2CMFA 3SKVA 4GR4A 2NSJA 2XVAA 4RMJA 4PYLA 4LYFA 5I7WA 3FTPA 4ICIA 4HNTA 3PDCA 4BJQA 2EP7A 2Q7DA 2PKQP 4Z8XA 2VPTA 4L28A 4A5SA 1PJ8A 2PZKA 5FFNA 2H17A 1N5LA 1XD9A 4K26A 3BIJA 1VI6A 4TT3D 5BW8A 2ZIWA 2P8JA 4P6VF 3L7JA 3ONWA 3Q6MA 3U9TA 1VBKA 3QKRB 3CLSC 4X7MA 1R16A 1VL5A 4HN2A 4H7EA 4R1PA 5A6SB 2PRIA 2YX1A 4PX3A 1Q1GA 4O0IA 3ESAA 2YZ2A 2OZVA 3HUUA 4KAXA 1N8KA 4AMBA 5EG5A 3ZS9A 3BK7A 4QDZA 4OSEA 1O5IA 4QWWA 4LHSA 4M9SA 4L76A 1J2UA 2JFQA 1B2RA 1CY1A 4QFDA 3RH4A 1DGQA 1P8JA 5CB4F 1J24A 3RH0A 3GNTA 5KT3A 3UBTA 1F8UA 3BMNA 4ZQIA 3AESA 4F2WA 4Q4DA 1FS4A 1YBAA 2BSQA 1TAQA 2E89A 2ZJ7A 3VC7A 3GYGA 1AUOA 4WINA 4PO1A 3W06A 5DGTA 4ITUA 2GM5A 3P0HA 2ACVA 3AUXA 1N5WA 4O2RA 1CRZA 2HLDD 4G25A 1W36C 4QRIA 5KREA 1F9EA 1ZD2P 2WF5A 3RTDA 8ICXA 1RZTA 5JO9A 3KUUA 3LXUX 4TL8A 1OAOA 1SG0A 3WLPA 2QZ9A 3R3WA 5KFEA 4QHSA 3U4HA 5F1YA 1W47A 4YAGA 2PX3A 4B9VA 1OLXA 2Y0SF 4UCQA 3TGPA 1D9XA 4J1SA 1ZNXA 3HCAA 3M4ZA 3LKVA 5JT1A 4C2BA 3B78A 5BYAA 3HCCA 1WP9A 2I4NA 2MYPA 1KO7A 2WM3A 5ALLA 2W00A 3M6KA 4MW5A 4D6YA 5JPDA 2RGDA 2BOVA 4BB5A 3BL5A 4F4JA 4RHYA 5DLEA 4HGRA 3EMBA 1K75A 1EJBA 2GERA 2OKGA 4BZPA 1C50A 4LDJA 4RQUA 1R7RA 3CWCA 2LPEA 4M37A 3BEDA 2QRPA 2F3UA 3E3NA 9ICGA 1JAXA 3KLPX 4G8CA 4EG0A 4BE4A 4TLCA 4AXXA 3CLRC 3S2SA 1M2EA 1EWRA 3KAPA 5DTIA 5EL0A 5KFWA 3M6MD 3DKPA 3LFUA 3HA5A 2H5IA 2XCLA 4RS4A 3I23A 4IBOA 5AVOA 3D43A 1KDZA 2R5NA 1S6YA 3U4QA 3PQ3A 1EDZA 1T36B 2NXJA 4H3SA 4ZO4A 2FPGB 3UGKA 4TV8F 4UEJA 4B4DA 4MUHA 1BS9A 2I8LA 2NU8A 5JH7A 5IIOA 4P86A 2NTNA 4PC3A 4QOHA 5CG1A 4CEJB 5KL8B 3EIHA 3DDZX 1JMKC 2XUJA 2ZSUA 2XWPA 3CXUA 1ZOLA 3CPSA 2I3ZA 1SXJC 1D1QA 1UJ2A 3IAAA 1XXHE 5JD4A 3ZV6A 2FOIA 2P7HA 2J3EA 4MQBA 3OZTA 3THSA 1WCV1 2P6PA 1X9XA 4YR9A 5J1TB 1GGMA 3VU9B 3IMCA 2FZCA 4U7DA 1NM5C 2ZBEA 3L8MA 4FZNA 4Z9XA 5HK9A 1E6LA 1WB4A 4XE5A 3NYQA 1NJYA 1CC1S 3KZKA 1UBMS 1WX1A 4TTIA 2ZCJA 2A9FA 3SI8A 1R88A 4AO8A 3GLGA 1HLFA 4YMOA 3CRRA 1TEZA 2HBYA 1EVEA 3AK4A 4P2HA 4N03A 2H7YA 4QUBA 4P0TA 4ZQHA 4IS3A 1FP1D 4J4BA 1DKLA 3G6WA 1KVSA 2X0JA 3G59A 2X5NA 4I50A 3LUHA 5KX5F 4S04A 2HVHA 1CD5A 1HLPA 3AYXB 4GLOA 4UHEA 4Z3OA 3TDKA 3ELWA 4JV0A 1FS6A 3HS3A 1D9FA 3EH1A 5EIBC 1EVLA 1U04A 4O4IF 4QIHA 3PHCA 3CVXA 1PZNA 3DOOA 4G8DA 1F2UA 3LY5A 4D9JA 1GTSA 4KPEC 3VTAA 3C0KA 1VCMA 2VDNB 3AM9A 2PXHA 1P5ZB 4R9NA 4FZ5A 3RBVA 2C20A 2Q7XA 3I05A 4LXYA 1BKSB 3G7NA 2P30A 4HEA6 3P5BA 3NHAA 2JGNA 2VA9A 4YAFA 1RRCA 3MG9A 4FU0A 2PZAA 1WKCA 2XE7A 5FKJA 3BD7A 3KOZA 3NVZA 4KQMA 4H1TA 1EDOA 3VNAA 3HH8A 1YIOA 3ZK8A 4QZ8A 1IPFA 3ACDA 1G18A 1U5BA 3OU2A 2X9NA 3LQYA 2QW8A 2ZRKA 2FPPB 2JIZD 4C0BA 3PX4A 5DIZA 1N0IA 2K60A 1ECGA 3VQTA 2E6KA 1PV2A 1O1YA 2LM4A 2B92A 3D54D 4I5FA 4TLBA 5LMUB 1C81A 3H8JA 4M76B 3GG2A 5JOQA 1A9QA 1X6VA 2D59A 1UPTA 5F7JA 4RSHA 5EJ4A 3A10A 2J9GA 4L1KA 4WZAE 3D02A 4D9NA 3ECCA 4ZI7A 2E82A 4PLCA 3KKLA 3GDXA 1OCEA 1R4MB 5KYUB 4Z6FA 5ALMA 2ASEA 1FFBA 5SY6A 1SOWA 1KMIY 3KEQA 2LDBA 3R76A 3Q1LA 5DKWA 5CA0F 2Q29A 1NLYA 3DE5X 4V0RA 3COZA 4JV2A 5AJTA 1EP9A 3EHDA 4XLZA 3IJEB 4L0QA 3QUQA 2JLZA 4BQRA 4TYWA 3R5XA 2E4UA 4OPMA 2W6QA 2JGRA 4KDEA 1I4OA 1ZVMA 1EU1A 4JD5A 5DNYB 3FKSA 1SMKA 3R2JA 3VPHA 1MBZA 1YD7A 5AVXA 1PZEA 3IQEA 2X5OA 2A5LA 3L43A 3H13A 1FLAA 5ENVA 3IA2A 1V11A 2WMOB 3NR2A 2QIPA 1CW2B 1XZLA 4MR8B 2E1EA 1F6BA 1DFGA 4LHZA 5EERA 1ZD5A 5KAPA 3AL0C 2FJPA 4FE3A 4N0DA 2RBGA 1I7NA 2Y66A 3CKLA 5IFKA 3LGXA 4J9MA 4KRYA 1HE5A 4DB4A 2JG3A 4Z4QA 3QTBA 4R9SA 5AXBA 4ZTZB 3BIXA 1DT3A 4RHTA 4UHJA 4RVHA 5DASA 4B7AA 4EH1A 2W93A 3C43A 5HVNA 3STYA 4E5KA 4KWEA 3ENZA 3PPVA 3SDBA 4E21A 3WO1A 2MSCB 3DTYA 4YCJA 2FMKA 2ODBA 1YVDA 1ZA1A 2YVKA 1Q19A 3QA3E 4BFLA 2P5TB 1SXDA 4DMCA 4MVXA 1JVNA 5LLSA 4ZJZA 5BR8B 4Z9YA 2VCYA 3GPDG 3B5EA 1SUCA 5HNKA 1R6TA 1SK9A 2QA5A 1FYXA 3HC7A 3U4AA 4P0PB 2WJAA 4RTLA 1L1QA 4BKPA 3QSYA 2RLTA 2B8NA 4K8OA 3DFZA 5K3FA 2G71A 3HYTA 7ICRA 4DCMA 3GFFA 4YT8A 5KINB 3HBAA 1WRBA 4IIEA 5I48A 2IIQA 5K0CA 2ORIA 4JJEA 5B58C 5B4UA 4YP5A 4JOCA 1VHQA 4DOMA 4HY3A 2GF9A 2BCUA 4OI1A 1DBQA 3WYCA 4DDUA 1EFCA 1CY0A 4IVQA 1KO1A 3P2OA 3FXAA 5A3SA 2KVCA 3MQ4A 1GPNA 1EGHA 1F06A 3C21A 5B7PA 2XZLA 1PDVA 2FDRA 1JQEA 3HUDA 3SQWA 2CXSA 3RTEA 1J8DA 2ZIAA 3G9XA 5CXSA 1JT9A 2C4KA 1BX1A 3MN1A 1HQYE 4R98A 1GGEA 1FVOA 4KN5A 3VH2A 4KBFA 3T52A 4HLQB 1E5LA 4BNZA 1HM5A 3OQNA 3CGGA 5J2JA 1DWPA 2WYUA 1N2CE 2HTEA 2V7XA 3C3JA 1NOIA 1DXYA 1WNFA 1NBOA 5GY7A 3C70A 3Q6NA 1I1OA 3WLFA 2XEDA 3A32A 4AROA 3GR6A 2IK8A 2QQ5A 1Y34E 1SULA 5HJ2A 2QM3A 2PNJA 3HV2A 4XDYA 2QUJA 1Y8AA 5JV5A 1J1UA 2J9FB 1CF4A 4HX2A 1RXVA 4DS4A 3BMXA 4KCGA 5EWJA 3QYJA 1EUYA 2AR7A 3P9NA 1SC1A 3Q15C 3RSFA 4V2IA 1T8UA 3K5PA 5EZYB 4JQYA 3AUOA 1OFTA 3BS5B 5TQ2A 4RZXA 3WHKA 3UGJA 3NIWA 4IWXA 3ROQA 4RVCA 1AH2A 5EJ6A 1L5LA 3GFKB 3GY0A 1EUDA 5G53C 4S1OA 3IKMB 4YN4A 4ENQA 2G4LA 4Y2QA 2BR5A 4IMPA 1JG6A 1BRTA 3DF7A 4PCLA 3I6IA 2P9HA 2EWMA 2OCYC 2PEYA 4CN9A 1KVRA 3M9XA 3BX1A 3SFVA 4BJ6A 3PFHA 3ZXXA 3V8BA 3HLTA 4WFQA 2ZVJA 5D5QA 7ICEA 3MS4A 3JR7A 1NG9A 1OOEA 1QBGA 4OH7A 2BGJA 1XEWX 1ZQBA 1ZRSA 4IXTA 4YASA 3ZUGA 5CD1A 5BUSA 4G3IA 3BGDA 3EGIA 1BVYF 2AKAB 4ED1A 3B2QA 5LXTA 1XVIA 3GLFE 1W4CA 2BMWA 3QYAA 1MNAA 3AETA 2GTPA 1T2AA 1AS2A 3BS4A 1UBGA 2FMPA 2FU5C 3ROKA 5I7EA 1EX7A 4FEAA 3VDNB 5KBYA 1JTFA 3AM3A 2CMDA 1FX1A 3ND5A 4BP9A 1PQPA 4C7XA 1CJTC 2IBTA 1SKYE 2MJLA 3VHLB 5TF4A 2QYTA 3A2MA 1LBQA 3CZCA 2V7QA 3VM6A 4J2OA 4D3ZA 1QZUA 2NTJA 3A1NA 4MICA 4B2LA 3B6JA 4O2AA 1R74A 1E3SA 2PUVA 4TRRA 3DUFA 4Y2UA 4N0PA 4F4HA 1V37A 4H3HB 3ZWBA 3G9TA 4Q45A 2RGNA 4XCQA 2XCTB 1E2MA 4OHWA 3MGHA 4FFPA 4U9IS 2OILA 2FPKA 1GG5A 2VP2A 1USUA 3FAZA 3FRJA 5CAEB 1RCTE 4CMKA 2G17A 4ESHA 3BJMA 1L5ZA 1PKEA 3PR4A 3FZEA 4C05A 2ZSHA 1AMUA 4BNKA 1ILEA 3I9FA 3M5WA 4FUTA 2FSUA 3OICA 5FQOA 2VR1A 2PH7A 4Q3LA 4OU5A 2NZUG 2XI4A 3W5IA 5AR1A 3OU6A 1COWA 2CCJA 4LE2A 5AOBA 4HP8A 4YJ2F 2P2CA 4K81B 2C5HA 3AT1A 1J0DA 2YINC 1JKJA 1M1XB 3EBOA 2JVIA 3BE8A 1LGYA 3Q5GA 2AOTA 2WTXA 2ZWAA 1UJCA 5AVYA 4GGPA 3TCNA 4FP9A 2VH1A 4KQWA 3ICVA 3K9WA 3L0ZA 4QZIA 7ICJA 4DAEA 5CITA 4MRVA 3VBEA 4Q02A 1Y1RA 4HH0A 3U13A 5ICFA 1T2CA 4PFSA 1QHSA 3ROEA 1KFTA 3MTEA 3H5AA 3KOMA 2W2LD 4E51A 1TX4B 4KQ6A 2XTMA 1ENOA 1ORIA 1QIMA 3KYDA 4L0MA 1KWKA 1BJKA 4IFEA 2IF0A 1ZRNA 4FGUA 1C9KA 2XY6A 2VSQA 5KFRA 1DXSA 3E3OA 3V97A 5A4DA 4RETA 3EXG1 5A2QA 3JQFC 4QSHA 4P3XA 4UMFA 2W4IA 1T9DA 4PNEA 5HCUA 2CXQA 2JNWA 3NYRA 4RA6A 4IZOA 1GZ3A 1CUUA 4OB6A 1TU0A 4B6QA 3VZSA 1MIOB 3BCRA 4RQNA 4G5GA 3E2MA 2HDWA 1UH5A 4C7YA 3IDOA 2GSWA 4I3HA 1ENPA 4HQ6A 1DCKA 2DVMA 4IDQA 3E84A 4G0PA 1OX6A 4QHTA 1OX4B 2VZEA 2CYBA 3X1WA 1KYYA 1F38A 1JJIA 3NHZA 3ESQA 2PT7A 5K7SA 2XE4A 3PQ8A 3WLLA 5IJWA 2B9VA 1C2TA 3G7SA 4C1BA 1T9GR 1TRHA 1U0BB 3FPCA 2BVNA 4QGHA 5AW0A 2Z4TA 5DX1A 1YZLA 5AMXA 1UT8A 1TKDA 2EH9A 4DQUA 1YCFA 2BUBA 3W5BA 4WK6A 2E3JA 1VA5A 2UYQA 4AQYB 2C3OA 1QONA 1UDRA 3VTZA 2HHCA 4ZV4A 3FHLA 4NNPA 5HA5A 1OV4A 1S7GA 2YXNA 4DEZA 2CNKA 3HWTA 3OY2A 4FZRA 2BJHA 2YFQA 4NESA 1Z4QA 2ZT7A 4MCIA 2BN4A 3E5NA 3L0OA 5CLIA 4HFRA 2O7NA 1NDUA 3D6FA 1GADO 1AY0A 4OO3A 3OAAD 3J80A 4LYAA 3TRDA 3MBOA 1DC8A 4LF4B 4QKQA 1SZPA 4S2UA 5CJJA 1NQXA 4BO4A 3TEFA 3HVUA 2WWXA 3KV1A 2JASA 4BZQA 4HGYA 1E9BA 3MJTA 2QLTA 4TTSA 2GPNA 3EOAI 4X84A 4HB0A 5CTAA 4L9WA 4GM4A 1HK7A 1ZWKA 5FV4A 2EGGA 5HF5A 3AIMA 4W9MC 3DE4X 4J43A 4KGXA 3DVQX 4YP6A 1E9AA 1FNSA 3DNMA 9LDBA 1G5HA 2XECA 5EMHA 1A04A 5CYPA 2IYSA 3MOSA 2RONA 3IH5A 5D2CA 4X6XA 2ZROA 3SVLA 1GRRA 4MWDA 4BMVA 4OJ6A 4HX9A 2FJ0A 4CYMA 3IMFA 2H2AA 3OKAA 4O3QA 1U3GA 4QD3A 5C5DA 4ZD6A 2C58A 2OENG 3GJYA 4S1WA 3P0IA 4W82A 4J8PA 2E3TA 1B1AA 3KJXA 4ON9A 3S2IA 2X5KO 1ZN7A 4NATA 2PNFA 5ALUA 3MGVA 2D5IA 2D2FA 1ZGGA 4CCHA 1EP1B 4U2GA 2ZBGA 4OJYA 1YXMA 2B1RA 1Z4NA 5AW2A 4JFRA 2FA9A 3PGLA 4YREA 1PIWA 5CNIA 3FNRA 3GFGA 3OX2A 4BVJA 1FP4A 1D2AA 1JIUA 1T5TA 1OUQA 4ARAA 1K63A 4EJSA 1OTXA 2PMEA 4YMGA 1I2DA 3LWDA 4YMMA 4WCDA 1V8PA 3H5OA 3WAKA 1SH7A 2CLOB 1V9LA 3DAPA 4ANFA 4O5KA 3LSTA 1X14A 3V6HA 5T8KA 2DRIA 2EERA 1C3JA 2IHZA 4ZYZA 2C2XA 1S3FA 3LT2A 3D1LA 3PSTA 2RDJA 2CVZA 3R4CA 2WSSA 2QIOA 5J0QA 4YC7A 1VG1A 4KR0A 2LD4A 5HZKA 4DQPA 4DXAA 4O59O 4GI2A 5JAHA 3P20A 1DKOA 1CUHA 3N1UA 2J9XB 3A1SA 3R9KA 3QPWA 1ZNQO 2J32A 4P93A 2QN7A 1DCFA 2IEBA 3ETEA 3NIDB 3SM3A 4ZI5A 3W2IA 1EVIA 5JC8A 4DV7B 3HLYA 4C43A 2QPOA 3OA2A 1ZH8A 3TQHA 3KKEA 4OMUA 1JZTA 3WNZA 4BN4A 3EEQA 3LUFA 2NO6A 2W2TA 3L6DA 4V0OA 1KY4A 4R7GA 1NX6A 5I9LA 1P1CA 3QKRA 4MIEA 4DJEC 3L6OO 4ETIA 3ZOZA 3NWPA 4YLGA 3VNSA 2ZSEA 1DV1A 1QP0A 1ZJWA 5A6SA 3VSDA 1SU6A 2FLKA 3QZUA 1X38A 4TM8A 1Q44A 5CR9A 3LYLA 2GOYA 1NVMB 2NG1A 1K6EA 2PMFA 1RHKA 5JBNA 2VI5A 3GUVA 4ZEMA 3C6XA 1J7JA 3QU9A 1VL8A 1NOMA 1ZX1A 4DFJA 2WVAA 4RTPA 1YHNA 1NXWA 2WYVA 3UHOA 3ELUA 5HS4A 5NLLA 3D8SA 3FGPA 5JNRA 1HPLA 4EMUA 2YH2A 4D57A 4KVAA 2IU3A 2OORC 3IUYA 5IULC 1GL7A 2AC2A 2PUCA 1A9XB 1S3IA 1SY7A 4ED9A 1RAEA 3D7NA 3G0GA 1WV1A 4QULA 3KPYA 5FH9A 2Y1FA 1UKZA 5J29A 7ICIA 4I55F 2B61A 3HWX1 1QG0A 3MD0A 5ALDA 1Z88A 4MV1A 2CYAA 4HWOA 1B6GA 4JUCA 3UMMA 2I6QA 3VNUA 3C8MA 1E6UA 2EJVA 1NNI1 4GSLA 1JQKA 3OOJA 2VPPA 4HZGA 3IBTA 4M0MA 5DULA 3VU3A 5HF8A 3L1UA 2O1EA 3V8MA 5F9LA 2WAXA 5SZHB 3RCBA 4AZ3A 2MYTA 4LDZA 1LFAA 1FDRA 2YJ5A 2ZUFA 4HNHA 2P2NA 3QBTA 2RAFA 3EE6A 3GDHA 1CQXA 1KQOA 3SSOA 3QY9A 1WDWB 1G66A 4JC8A 5DNAA 4UHDA 1K1SA 1V7QA 1Q16A 1WZNA 4PYRA 5KQRA 4EI8A 3MUNA 2Y77A 3D7LA 4J0KA 3MXTA 1RWVA 3AONB 2P9ZA 3NDIA 2H2HA 4CM8B 2WHPB 3ESZA 2AYYA 1E2NA 4NCKA 5DB6A 3MDAA 2F8LA 2HA0A 4IXDA 5EWLA 3T4EA 4JJ7A 2H8GA 1QIKA 2QLMA 4HEHA 4RA9B 3RBDA 1KFBB 2Y3IA 3KYBA 4G63A 1J2MA 1UJNA 5JD6A 1CZRA 1JGTA 3SXJA 3I6BA 3IOCA 3LE8A 5L3VA 2V0NA 3UJPA 3OZCA 1NASA 2YCLA 3U31A 3H16A 1YC5A 4G1UC 1GNSA 3DBOB 4I1VA 4DQDA 2MSEB 4CEJA 3FLAA 4QGGA 2AF4C 3N97B 3DV2A 3MCUA 1FW8A 4ZANA 1E9RA 1NN5A 2PYZA 4C6TB 1M67A 2XVMA 3PXEA 4BX3A 4Z6KA 3AZPA 4LOLA 3ND6A 3BAZA 1HT0A 2V9ZA 2HMYB 3PGA1 3PZRA 5JD5A 3O8QA 4MUBA 3DTVA 3A9SA 4MW6A 1Q1AA 1QIJA 4A0FA 2Q1TA 3RTAA 2YRWA 3S55A 4FK8A 4LJAA 1WSDA 4O5AA 1AHIA 3CUTA 3DBVO 2R84A 1XTRA 3ZEAA 3QVSA 5FX2A 3X43A 4BFXA 4MKIA 4JASB 3GJXC 1GNLA 4KO2S 1QZZA 5DISB 2Q9CA 2VA8A 2A9JA 4S05A 5A5VA 1PYDA 4WOJA 4C78A 2FK7A 1TK2A 2CLHB 2VAVA 3LDAA 2FMIA 1Y5MA 2SHKA 4XWOA 3IQGX 4C6SA 1E0AA 4FDTA 5ESRA 3ZH2A 1HR0B 3PI7A 3FD8A 2EF1A 1ZN2A 1KGDA 3P2MA 1XYVA 4F3OA 2ETXA 4B48A 1AG9A 5J2UB 2H11A 4YXWA 3DOIA 3CXRA 4GD3Q 4PU0A 1XJWA 5FA5A 5FORA 4J76A 2QROA 2WJHA 3L7NA 4IZIA 2L18A 2I6UA 2Q1XA 5ALWA 1V8BA 1W87A 4H35A 1HYHA 3EFOA 5IKXA 1X7WA 3I1FA 2RHCA 3MCWA 3R40A 4S2EA 1HNZB 3MJDA 2EL7A 1WZUA 5CXUA 3L7AA 3SIWA 1L6NA 3AFOA 1E4EA 4AWAA 2G67A 1XUOA 2HFJA 4M04A 1NK4A 5E7IA 1UK7A 2BT4A 1E1LA 5AK3A 4MFCA 3FCOA 4B5LA 1Q0SA 4YT5A 1QHXA 3BC1A 3L4SO 3G9ZA 3V46A 1GQRA 4NCHA 1JPUA 1T91A 5AI9A