2YMQA

Chloropropionic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 91
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymqA01
3AR8A 4PNHA 2Q4RA 2EARA 4XQ0A 3FM9A 2ZBGA 2OA0A 4Y2XA 3IRUA 2B8JA 1Z5UA 5AKIA 3MC1A 3M9LA 4DW8A 4BEVA 1N9KA 1Q91A 1XPJA 4YCMA 3I6BA 5AI9A 1U7PA 4L57A 2HF2A 3IJ5A 4KN8A 5ALOA 5AVRA 5AVQA 3OCYA 1Z4KA 2D2VA 4C4SA 3WKDA 4CF3A 2FI1A 5AICA 3FZQA 1K1EA 3M1YA 4FE3A 4UMFA 5AW2A 2G09A 3QU4A 2QLTA 3E84A 4OFZA 4EENA 3U19A 2B8EA 3BWVA 2QYHA 3ZTYA 1ZD2P 1T9ZA 3DAOA 3SHQA 3SD7A 5ALWA 2WHEA 3I28A 4KYTA 2ZG6A 4UU0A 5ALKA 1O03A 2MSNA 4XOUA 4HGPA 3QUBA 2DQSA 4CF4A 3U7EB 4IFTA 2HI0A 5FP0A 2YJ4A 3ZU6A 5AKHA 5AW6A 2AMYA 2AH5A 1ZOLA 3EWIA 2CFTA 2O2XA 4JDPA 3ET4A 2YMLA 4JB3A 4UAVA 2I33A 3D6JA 2WF7A 4KNVA 2HEGA 2HCFA 3QUTA 3ED5A 3QUCA 3PDWA 4NABA 1Z4QA 1RKVA 1NF2A 3QXGA 2YN4A 3ZUPA 4HGOA 5AKJA 3U26A 2X4DA 4CNQA 1Z4IA 5ALDA 2I55A 3AR9A 3WGUA 3WK9A 4AS2A 5AW8A 1JUDA 2JAUA 2CFSA 4BX0A 1RC8A 3A3YA 2G08A 2IOFA 5AVWA 1U2TA 3AR6A 2IOFK 2PQ0A 4ZEVA 2C9MA 4QQFA 4XPZA 3QLEA 3WK7A 2VKQA 3BA6A 2C4NA 5ALFA 1N8NA 3ESRA 4FFDA 2C88A 4DCCA 3E58A 3ZX4A 2BDEA 2YJ3A 1ZRNA 1S8OA 3WK4A 4HGQA 4C4RA 1TA0A 3E81A 4FYPA 2JGAA 4BNDA 4EX7A 3N28A 3QU2A 4GXTA 2BY4A 3W5CA 2WF5A 5AKYA 2HX1A 1EK2A 3QUQA 3UMGA 5ALMA 2FPUA 1AQ6A 1XVIA 3EF0A 1RRCA 1ZJJA 3SMVA 5AKZA 4DWOA 2MU2A 3U13A 2WFAA 1L7NA 5AVTA 3QU7A 1RPZA 5AVVA 2GHTA 2HHLA 3ZTWA 3W5BA 4YIKA 5AW3A 5ALTA 2I34A 1L7OA 2YMQA 3FPSA 3KOOA 4CF5A 3OCWA 4G63A 3UMCA 3WKEA 2EAUA 2GFHA 3U7GA 5IT0A 5AM2A 1Z4PX 1RMYA 4EX6A 2HF7A 4EEKA 1RKUA 3KD3A 1ZD3A 2ODAA 2P9JA 4BEWA 5AIBA 4MUMA 4YH1A 5AKXA 2OBBA 2FDRA 4Y2TA 3W5DA 1LTQA 1QQ7A 1CR6A 5A3RA 4MWOA 2ZBFA 5AVSA 2G0AA 3ZI4A 2G06A 1U7OA 5T41A 3NRJA 2OYCA 4YCLA 4HGRA 2YMMA 2FPSA 3EF1A 1NRWA 3K1ZA 2WF8A 3WK6A 5AKGA 3L0BA 4XE5A 3AR3A 3MN1A 2JAWA 5AI4A 3HYCA 2RARA 4CE6A 2YJ5A 5ALLA 3WK8A 2GHQA 2FPXA 4KNWA 3WKBA 1RLTA 3EPRA 5AM3A 3I1YA 4Y2PA 1WPGA 3ESQA 3NAMA 2ZBDA 4UMDA 1QQ5A 1Y8AA 1XP5A 5ALXA 3NASA 3AR5A 3L8GA 4NAVA 3DNPA 2PKEA 3DDHA 4UW9A 1Z4OA 4Y2VA 2RAVA 4BKMA 2P27A 4F72A 5AI5A 3GYGA 4J03A 1VJ5A 4NV0A 4EZEA 5AESA 2FPWA 4Y2UA 1SWVA 3TLMA 4HYTA 2IOHA 3OCUA 3N5KA 2YY6A 4KX5A 4NWIA 3KDPA 2YBDA 2CN1A 4BX3A 3DV9A 2JARA 4UM5A 3PGLA 3L0CA 1TE2A 1ZD5A 3ZWDA 2WM8A 2GMWA 2NO4A 3L0YA 4UM7A 3QGMA 3ZW7A 1TJ4A 3QU5A 1WZCA 2Q4TA 3B8EA 2ZXEA 4Y2YA 4I9GA 3SLRA 1PW5A 3KBBA 5ALYA 1T5SA 5JJBA 3OTQA 5AM1A 2HO4A 1J8DA 1WVIA 1RQLA 2P69A 1F5SA 1RLMA 1RMQA 2G1AA 5ALQA 3N07A 1RKQA 4IG4A 3MPOA 5AW9A 2OM6A 3L7YA 3KC2A 3SKYA 2ZBEA 5ALIA 1LVHA 3I76A 1EK1A 4UARA 4RETA 5AK5A 5AVUA 3MMZA 1ZRMA 2I6XA 4Y2JA 3AR7A 5AHXA 4BYGA 3OCXA 1L7MA 5AIAA 2IYEA 4Y3UA 5AW7A 4UATA 3NALA 1L6RA 4ZEWA 5ALJA 3R9KA 4UMEA 5ALVA 5AW1A 1L7PA 1Q92A 5AK3A 1KYTA 3A1CA 5AM4A 3L8EA 4Y2RA 5AVZA 2C8KA 1YDFA 1TJ3A 4H1WA 3ZX5A 1NNLA 1RMTA 4J2TA 3S6JA 2B1RA 2JAOA 2R8XA 3FPBA 4EELA 4F71A 4OD0A 1YNSA 4QJBA 4YGYA 1VFPA 3FGOA 5ALUA 3N1UA 3ONNA 2BDUA 4UASA 1O08A 1Z88A 2YJ6A 2GO7A 4BBJA 5AM5A 2FUEA 2G80A 2C8LA 2RBKA 2WF6A 3B9RA 4HGNA 4Y2QA 5AI6A 4YCNA 5AVYA 3E8MA 1RDFA 2CFRA 2WF9A 4OCZA 5ALHA 2B0CA 4L6CA 3QX7A 3ZVNA 2NYVA 5IS2A 2IA5A 2MU1A 5ALNA 2R8EA 3WGVA 2I54A 5ALEA 1YJ5A 5IT4A 2HDOA 5A3QA 3A1EA 4UAUA 1ZS9A 3WKAA 3J7TA 1ZD4A 4E88A 3W5AA 4Y2SA 1YV9A 5E0OA 3WK5A 1FEZA 1MH9A 4BX2A 3CZ4A 4C4TA 2PR7A 3KZXA 4KX3A 3PCTA 3ZVLA 5AM0A 1RQNA 1S2OA 1Z5GA 2FUCA 1QQ6A 3ZVMA 3RF6A 3U7HB 3ZWKA 5AI8A 3WKCA 1U2SA 3F9RA 3OCVA 3OCZA 3PGVA 4GIBA 3VAYA 2B1QA 1QYIA 1CQZA 5ALGA 1IWOA 3SF0A 3NUQA 1WR8A 3R09A 3U7FB 3CNHA 4BNDB 1QH9A 1L8LA 4OHFA 1X42A 2AGVA 4YIHA 5ALRA 2RB5A 3P96A 5AK6A 3L1VA 5AW0A 2HSZA 2R8ZA 2ZOSA 2HOQA 5AKLA 5AW4A 2NO5A 2O9JA 3A1DA 3AR4A 3L1UA 4NFLA 4G9BA 2YMPA 1L8OA 4B6JA 1RLOA 5ALSA 3ET5A 1Z4MA 3QYPA 2AUTA 3OPXA 4HAIA 2B30A 2EATA 4UMVA 1Z4NA 1SWWA 3NANA 2YFYA 2B82A 3QU9A 4RESA 1Z4LA 2FPRA 4AS3A 1U02A 4L6AA 1T5TA 3N8GA 3B9BA 3FVVA 3RFUA 2W11A 1YS9A 3SKXA 5AW5A 2Q5EA 5A3SA 2I7DA 1TJ5A 2G07A 5AK4A 2FEAA 1YMQA 5AVXA 2R8YA 4ZEXA 3UM9A 4UU1A 2W4MA 3L8FA 4AP9A 1SU4A 2P11A 3AR2A 3L8HA 3L5KA 1Z4JA 3NIWA 3QNMA 1J97A 5ALPA 5AKKA 3HLTA 3UMBA 5AI0A 2W43A 4O8CA 5AKEA 4DFDA 1VJRA 4I9FA 5ALZA 3R4CA 3IB6A
chains in the Genus database with same CATH superfamily
4WLOA 4CL0A 1IN1A 4MV0A 3L4JA 1C3XA 4MR7B 3HVHA 2VA9A 2AKYA 1DC5A 1WPQA 2FLVA 3RQIA 5B2FA 1XMOB 4JI7B 2I6UA 1Z5UA 5T6BA 5EWLB 3V4FA 3M6AA 2HWKA 3B51X 4YNBA 5E6UB 4HWTA 4UTRA 3NORA 3QE0A 4HB0A 2Y71A 5JCJA 2VHVA 3EVBA 3PNQA 4TLBA 5J4HA 1Q11A 3KE8A 1KMNA 3KZNA 2PZLA 4I4IA 3IJ5A 4NY8A 4J9QA 3G6YA 3OP1A 4KMOA 9ICKA 3FW1A 1D9DA 2Y27A 3QBDA 1CZNA 1DG1G 4LQ4A 5KTNA 1R88A 2OO5A 4QFDA 3E2PA 4XZ3A 1GPBA 3SYKA 2FI1A 4FE3A 1L5WA 1K1EA 4DV7B 3VJKA 1RWWA 5T7BA 3Q6MA 1V38A 5C5CA 3LBHA 1G66A 4F6RB 3OEWA 5U1PA 3O84A 8ICZA 2J6CA 2ORYA 5KTMA 4EENA 1VG9B 2FWIA 1XVUA 3MXOA 1S7GA 2I4TA 1ZJ5A 2P9CA 4FFBB 4JWTA 4ZGGA 4EAAA 1GNTA 3ZTYA 5LJIA 2XCRB 2NV6A 3ZDEA 5JC8A 1VCHA 1XF9A 3DAOA 4JLAA 5G4KA 2IKQA 2P62A 1NYRA 4OO3A 1JG4A 5LDGA 2G6BA 4TMKA 1NJSA 5A7GA 2WSMA 1XCPA 5H7XA 3R8FA 1E63A 1YE3A 2GN2A 5HK9A 4HGPA 3WHIA 2GXUA 4XUDA 2ZSUA 1N5MA 2JS7A 2HWWA 2ZWAA 3FLBA 4RM3A 5C4IA 5CDTA 3D8HA 3LDUA 1XCGB 2XW6A 4G81A 2YJ4A 4MUHA 4UNNA 3TR0A 3CZ9A 3KKZA 3BSFA 3MUOA 4RNMA 2V54A 4WCFA 3TINA 5LZ2A 2UYQA 1CB7A 4DUYB 3N7PD 1B0PA 3PYMA 2VEDA 3H83A 1ZOLA 1K9VF 2AD5A 4MAMA 4PBSA 3IDOA 2DKOA 1S2LA 5EWGA 1JG2A 3V8QA 4C0XA 2C99A 3ELDA 1QIMA 4JBGA 5AHRA 2WF7A 1E1QA 4DPLA 2HOFA 2GHIA 3G2IA 3O8QB 1X13A 1P9LA 2APJA 4MR8A 3OBIA 1SR8A 1XKTA 3ND9A 1ID8A 2GPWA 3ROKA 3L2OB 3DOCA 4K6OA 3KTAA 4WZ6A 3CQ9A 3CLTC 1WMBA 3CNEA 3L0SA 3N5CA 1VYUA 3U26A 3SQXA 1G8AA 4Y1EA 4CNQA 2BONA 2I71A 4MQMA 3RKRA 3FSRA 1BPYA 2XTZA 3CIFA 3OIUA 3SYMA 1D4AA 3GIIA 1IJFA 2ZJZA 4UC0A 3CYMA 4V0ME 2H2DA 3JPTA 3NYIA 5JVDB 4P2GA 13PKA 3FBTA 3H75A 3VNUA 1TK9A 5TISU 4M9LA 3AN1A 1TGVA 1EFAA 4P2HA 4YV1A 3H8SA 3N53A 4K1XA 4O5CA 3EASA 3RK4A 2Y1IA 1PEKE 2QY6A 2TMKA 4QPNA 4XPZA 5DRTA 3QLEA 3G6WA 5HIJA 4TL7A 1M6EX 4DSJA 1PZMA 3JATB 1GRQA 1A2OA 1TEXA 2HNAA 4L0QA 2QM0A 2FP4B 3GJ7A 3E4CA 3MAAC 2B5VA 4HL6A 2C88A 5LDHA 3CE6A 4DCCA 5FTWA 1FUEA 2K2QB 3C39A 5EGSA 1SV4A 1VLVA 3ZGYA 4FFBA 1XTRA 2FP3A 2ZIGA 4XWAA 5LLSA 3QZUA 1UBLS 1NFRA 3HU2A 4P3XA 3PSAA 3PV8A 3EDQA 5CYOA 1Y9EA 2GN8A 3A3KA 4LYYA 1VJDA 1L9KA 2JIMA 5AKYA 2AOWA 2NSLA 3OLXA 3IEMA 2XY6A 5EI5A 2WOOA 4L78A 3F6SA 5KFUA 1L5OA 3DCJA 3RS2A 4BJQA 2IP4A 4B5KA 1GKYA 2P75A 1MAVA 1U0JA 4LV6A 5K3CA 3L0DA 2H59A 3U3XA 3WL6A 5JXWA 3D4BA 1RYNA 1TM3E 2LYHA 1DJPA 5HZHA 5LD2C 1W5SA 2ZYSA 4JZKA 4MQ6A 2WC1A 3WGLA 1RP7A 2O54A 2RBGA 3ZJ4A 3PW0A 1KPGA 2DQ4A 1REQB 2J9XB 3GLSA 3SIWA 3GIWA 1WWVA 2X8WA 3T0FA 2X8JB 8ICNA 1AQUA 1NV8A 3T3IA 1NWHA 5KYTA 1W59A 1PBNA 4O9MA 2OB1A 3RVRA 4YMIA 4D4JA 2ECKA 2ZWMA 3INTA 5J0OA 5JO0A 1BJRE 3E22A 3EPKA 5DXAA 1C4WA 1RRMA 2Y4OA 3AY3A 1V35A 3LDAA 2JH9A 3IIJA 3NAZA 1VDZA 2FV8A 3UV6A 5D84A 2OCDA 3V7FA 3EVZA 5E8RA 2AFRA 3ODPA 3UTCA 2PA0A 4MO9A 1OZ0A 4URVR 1U45A 3IV7A 2QL5A 3LLVA 4JQSA 2GVDC 1ZUD1 1J22A 3ZU5A 2R6R1 1N8SA 2Y1GA 5AIBA 4KQJA 4MUMA 1NLYA 3ZNPA 2RGUA 2B99A 2WUDA 1M1YA 1LTQA 3P9XA 3OWHA 3ME5A 3QLUA 2MR6A 1UDBA 2JFGA 3QVGB 3IPLA 9ICCA 3TM4A 1BXRB 2ESRA 4YRAA 5JVDA 3IEVA 2FY8A 3CMCO 4TWJA 3RIGA 3CF4G 3B3FA 4JFRA 4BRSA 5IG2A 5EWMB 2XD4A 3Q87B 4L9WA 1U7OA 4J94A 3RE1A 1P2SA 1JAHA 4YCJA 4C0KA 1NONA 2Z4SA 3AMZA 2X8LA 3Q3EA 1Z7EA 3SY8A 3ZCVA 4EUHA 3KPVA 2A5LA 4YHBA 1GITA 5BW4A 4QXOA 4EGCB 2H9AA 4MS3A 4GQIA 3HA5A 4Q9JA 3L7DA 4MP3A 3ZY4A 4DOCA 1IHUA 3W6UA 3EVDA 2HBMA 1NDHA 4EYSA 2EX1A 1DOQA 2NVUA 2R751 3F67A 4ZCLA 2WM9B 3QRWA 2KKVA 3D8RA 3L1JA 1SKUA 2H08A 4EGJA 3O38A 2ET6A 4FWBA 1R8XA 5K8UA 3K6RA 1C4XA 5ARCA 3ISDA 4HX5A 1DX4A 1DNPA 4GSYA 5DSZA 2EFDB 4MUIA 5FADA 1C1YA 3VYTB 1K2WA 4C7VA 1ML3A 3PX6A 5H1YA 3CP8A 3A6FA 3CRMA 3S68A 1WSWA 2PH3A 3N6XA 4QUKA 5SZHB 1AGXA 1YRYE 5KVAA 1P1FA 1BGWA 2PXHA 5F1KA 4QDOA 4TQUS 3OJLA 2AMVA 3KZVA 4FFMA 4NENA 2XCIA 4NFYA 4ED6A 4QKQA 3WAJA 3M4NA 1TK0A 3W4JA 4DHWA 1RXUA 1KNXA 2BM0A 1H42A 4NHOA 4PW0A 1YGYA 2IP1A 2RAVA 3QXSA 4CV0A 3MVEA 1PJLA 3DZKA 1T5IA 1CKEA 2XY7A 1A9YA 4J03A 1GO2A 2FXVA 2ENUA 3VHQA 4LJ7A 3WLHA 2R4QA 4KDRA 1OXMA 3CC8A 4PSUA 3RBVA 2X1VA 5DDMA 1NKEA 2ZTCA 4D3ZA 1RXIA 3R7DA 5GPBA 2EEPA 2QLLA 1L3VA 2GPYA 4QQNA 1RWXA 4R40A 1WP4A 4RBNA 5FOUA 3UPTA 4HAXA 1N2HA 3G1UA 3JVDA 5I47A 2VBIA 3CEPB 2H2AA 3QA9A 5IJ9B 1KOLA 2DPGA 3IDQA 1LBTA 2UZ4A 4N9QA 1BDIA 4EJMA 1DUVG 1R1DA 2CGEA 2JIDA 4JV1A 1OLXA 1TUGA 5BRNA 2Q0SA 1R18A 2OXRA 1U7UA 4RA9A 3LYUA 4YRJA 3QNUA 1UQUA 1LNSA 3Q3IA 3IG5A 5BMVB 4FINA 1RZRA 4CCSA 3RCBA 5KEIA 4NL9A 3MHTA 2CHQA 1SXJB 2COEA 4YD2A 1UOPA 3EARA 3EZ2A 1QHEA 1Q57A 1T5SA 1YQWA 3DBLA 4R54A 3VZBA 2PJZA 3U7IA 2IE0A 2QN3A 3VI3B 3I01M 1ZSNA 4BVLA 2C22A 1P3Y1 4C4PA 2R4UA 4MULA 4QAJA 4XFJA 1BMFA 5ESWA 4D3SA 3GLIB 4D9GA 3EQ8A 1SXPA 4N5NA 1CBUA 2LXNA 3MSCA 3UJBA 4C7ZA 1Q1ZA 4IG4A 2RHRA 1PUJA 2VLBA 3C3MA 1KL9A 2WE8A 2J30A 3NGDA 4U4AA 4D8WA 3IAS6 1XDZA 4XB2A 4W1RA 3V32A 1VPEA 4QULA 3I76A 2Z5VA 2AR7A 4FBGA 5FBLB 4F9TA 1SBQA 1TZBA 1RM6C 5AK5A 2C4UA 2XSZD 3UMRA 3FBGA 3KPYA 3DLIA 4BP9A 3P5BA 1L7MA 4IZOA 1T8UA 1OZFA 3MCWA 4NHEA 1XLTC 2CWDA 1NX9A 3V2UA 1FFEA 1TQDA 3NPAA 4FBMA 3Q8QB 3G85A 3GUYA 1AA9A 4P7GA 3PF8A 1I14A 4M76B 3U2QA 2V7GA 2X4IA 3PX0A 4RJIA 4V02A 5FV4A 3M5WA 3K92A 4HH1A 2V6IA 3ZLTA 5CAEA 3KSAC 1K89A 5HSGA 2FZKA 1IZ8A 9ICUA 1O9HA 2BL4A 5AVJA 2RBEA 3TEFA 2Q6IA 4DQVA 1FCJA 2I7TA 3B6MA 3QW4B 3HA3A 2D4AA 3VNVA 4U3JA 3V97A 5IN4A 4FOTA 5FOSA 4RF2A 3LGAA 3X1WA 4K6FA 1TJPB 3IQWA 4ND8B 4JGIA 3S2ZA 2FGJA 1L0BA 2CL7X 3DV0A 4NPHA 4YRFA 1PEYA 4KN4A 1O97D 1SGWA 2JF0A 3UWOA 2I6SA 1Y8QA 2SICE 2P2SA 4D9MA 3C74A 4YGYA 2IS1A 5K8CA 3FGOA 1O9GA 5EZYF 1P6UA 1UFVA 3PFWO 2WYIA 3LCJA 1MXHA 1U3CA 1XF1A 1W6UA 1DDGA 2WF6A 3QH4A 4R7GA 5DNUA 4OO1J 5TLSA 1NK5A 1SL0A 1HT0A 4ECAA 3O4IA 4S2UA 1B0UA 4MRNA 1CG6A 4EECA 5FF9A 2EW1A 2ZSBA 3WLQA 1GPNA 2GAIA 4EJSC 2ZIAA 1K4MA 3VOTA 1X7ZA 2LKYA 2NYVA 2I1LA 1JEEA 1E0JA 4KBGA 4NZOA 3S1LA 3TQIA 4EITA 1O4VA 2Q8NA 1IJKA 4W9MC 2PRJA 2VXOA 1XO0A 3FMPB 3QBEA 5K6RA 2UVQA 4KHPB 4R1QA 5EERA 2BHTA 1HDYA 1ORVA 3KX2A 3MSXA 3BMOB 8ICXA 4RCYA 3SJBA 3QIAA 4B48A 1ZVVA 3J7TA 2WLSA 2FU5C 4EHLA 4DSKA 1YV9A 5G41A 1U7ZA 1I3LA 3KSBC 2OYYA 1PNTA 3PE4A 5CT6A 3LBIA 3CZ4A 1XTBA 4OQXA 1SXJD 5FBVB 4M0EA 2QX4A 4KLCA 4U2GA 5KDLA 3KZXA 3G88A 4A91A 1KS2A 1PYDA 3PEYA 3WWCA 5IVKA 1NLFA 2D6FC 4EWLA 1YAJA 4ZV4A 4EEZA 4KLDA 4TMYA 5LVAA 2RMKA 1SAYA 5HM6A 2IPOA 2VCYA 3TVYA 1X7ZB 1YB6A 1Y5NA 3L9XA 1WB6A 1XPRA 1X7WB 2KNJA 4D45A 4J3JA 5FNVA 1JEYA 1C80A 1BDMA 2COKA 4YRDA 4Q9LA 2FMIA 9ICLA 1WUIS 1IWOA 3OMLA 4GECA 2IXTA 4ERNA 4ENUA 2WUGA 4AP6A 5J43A 2CL0X 2YNMA 3NHZA 2XBMA 3UWPA 1L7QA 3F5AA 1M3SA 4ERXA 3TR5A 3MNFA 4UD6A 3ZWPA 5KU1A 3EFHA 4NYMR 3AU9A 1JLKA 3ZDDA 3P96A 4ZQHA 3T8YA 2NO9A 3UHAA 1E3SA 1I2AA 2BE7A 2ZOSA 4LXXA 4ZDIA 3NGMA 1KIAA 2QRHA 4WACA 2QR2A 3H1TA 5EXDA 5JROA 4ODIA 4G9BA 4JV0A 4MMZB 1SKAA 1QRAA 3F71A 4IIYA 3TW4A 2AMJA 3MUNA 4FT2A 1ULUA 2VOJA 1FNBA 3HCOA 3OAAD 5DLYA 4K4GA 3SQNA 3QJ5A 1ZUNB 1EP3B 4FFNA 2HPVA 1V48A 2LNDA 4QPDA 1BS2A 1SBTA 1THZA 3FHJA 1V1JA 1UJMA 2XXJA 3VYUB 2HIAA 3E0FA 4LF9B 4IZIA 3EH2A 3IPXA 1Z22A 2X9QA 4UBCA 1DOZA 1J25A 2CF5A 4AURA 4HNHA 1YRAA 1CDZA 5KI6A 4NYJR 4AS3A 4IO0A 1PNVA 3TXAA 4EFDA 4ZCTA 4YT5A 4AKSA 2BWJA 1HTWA 1VE5A 2B94A 3LO5A 5KTKA 4FFVA 4K9SA 1KDVA 1BC5A 2LE0A 1JA9A 4X1KA 2E4AA 2Y1OA 2UVDA 4RQ7A 3O9VA 2FYTA 2O8BA 1BH2A 4H17A 9ICTA 4JQZA 1ESMA 4M49A 4UEWA 1JMSA 4Y6SA 2ZRNA 2ZVDA 4E22A 4Z0TA 5IPFA 2XGSA 2YWBA 5GOZA 2EQBA 3CINA 4BGDA 1NATA 3IUBA 1QG6A 2VHUA 1XZGA 1QZ3A 1FP4B 3R20A 2I7XA 5TPZD 1KS9A 4B6EA 3ODGA 2C7OA 5ALPA 1EB9A 2KBEA 4TXHA 5SZKB 4X65B 3G8YA 5AI0A 4B5LA 4NJMA 2JJ1A 1KSPA 3ZDQA 5BV2P 3AETA 5ELLA 2HJHA 2I80A 4KR9A 1YWGO 3NAQA 2FKAA 1FP1D 4ZQBA 3WWYA 1UA0A 1KMCA 3FSGA 4PU0A 5LYJB 4PN7A 4X8HA 1SIBE 1ZETA 2HCJB 3AR8A 3KNZA 4C0LA 1RW4A 3SXPA 4KLSA 2FEOA 3RSLA 4DC0A 1DFGA 2IH2A 1X38A 2ORED 1I1OA 5FKJA 1JE1A 1X7WA 3IJEB 2FFRA 5KFRA 3GZNB 1VLZA 4TKVB 3ZZNA 2J41A 3C1UA 3IAFA 1LDEA 4ZT2A 4B83A 4BNLA 3N39C 2A1UB 4B4VA 2ZIUA 4K05A 4TT8A 4DW8A 1HYEA 3MQ2A 5AJXA 5BSFA 3KQWA 4BEVA 1HA3A 1YF3A 3T94A 3R76A 1BG6A 2VYVA 4E11A 3C15C 9LDTA 3D31A 4ZYTA 1CRQA 1EWYA 1MA0A 4I5DA 1WU7A 4C0ZA 1JXOA 1U7PA 1ZD8A 2OAGA 4L57A 3T5PA 5K3OA 1D6JA 2A9JA 7ICHA 2W2LD 2WDPA 4K9LA 3WC4A 3TLKA 2VSFA 3AG6A 1DPFA 4X1YA 4D97A 2PR2A 4J0HA 3RSSA 1P9RA 3DWIA 1IG6A 4KP7A 1AUPA 3HUEA 5J0TA 4M9UA 4AUMA 5ABPA 2C54A 1B8PA 2J5RA 4R71A 4WBNF 5A5VA 3LX8A 4XYGA 1T1EA 4OFZA 3FZEA 3PCXA 4RQBA 3BC1A 2WVHA 1OQAA 4ACOA 3OOYA 5C3MA 3CF0A 1IAQA 4OH7A 1G42A 3T1NA 1E7YA 2IHNA 2IXEA 4BQQA 1J6UA 2ZZKA 1GO3F 2E8NA 4AQYB 2NZVG 1EK0A 2D2IA 5C0YA 3ISJA 7ICPA 1RYEA 3K9QO 1Z18A 3INYA 4DJTA 1V1MB 3WRXC 3WL3A 3C2LA 3LQQA 1NPYA 2OV4A 3KTOA 4J91A 3HDGA 3K8QA 5KNBD 4G26A 2I4LA 1BH6A 4ILKA 4MZXA 4CF4A 1JMKC 1FVXA 1C7ZA 3VPCA 3GUVA 4B84A 4ZT4A 2GEBA 4L6IA 4JI5B 1TIKA 1D2GA 2Q0QA 1S7CA 3Q3JB 4HX2A 3FXAA 1JSRA 4G5XA 2J9ZB 1GNLA 2LRHA 4URUR 3NYWA 1XU9A 3AW8A 3K4PA 4ZD6A 4KNYA 4R5MA 1M5RA 2JPDA 1KSJA 2ZETA 2HLNA 5ENVA 4IDOA 2ZYDA 1NA5A 3SAGA 1TJYA 4R9RA 3FDFA 4YAJA 4JMPA 2VK2A 1MVLA 2C7GA 1IG0A 2REQA 4PWYA 3ZQKA 1NG1A 2O8FB 2F43B 1V8PA 2K5UA 4PPYA 1MDFA 4WCFC 4CYMA 2AKAB 4IIDA 1P9WA 3OQOA 1ZYQA 5H16A 4BJ5A 3PIIA 1X1DA 3PDWA 1IHDA 1L5FA 2BD0A 3FTNA 5DOZA 5MGBA 3U17A 3LHDA 4B8WA 4RKWA 1K3FA 1NF2A 4KTQA 2IV2X 4B35A 3EVNA 4QDJA 3B6ZA 3RFFA 4B6FA 3N9IA 1FP2A 3PE6A 1TMYA 2AG1A 4OBWA 4OI2A 5D7BA 5EWEA 3LYHA 2I55A 3WGQA 4BLPA 4F0JA 1J00A 2WMOB 3WK9A 2YY7A 4AS2A 1UOQA 2R48A 4JLOA 3UJ3X 5KMGB 4IQ8A 3EGDB 3RJ5A 4DV1B 3Q2IA 2VFAA 1XK6A 2X4GA 1X6IA 1ICIA 1MJGA 4JELA 4B2LA 3M70A 1OHHD 4IXWA 3UFXB 3VHLB 3O8OA 2Z1MA 3DP9A 4MTCA 3DE5X 1KEPA 1MRNA 4CHGA 1CQXA 1QBKC 2D06A 4I2VA 6REQA 5T4HA 4B3IA 4KBFA 3HJFA 2WQZA 4BC0A 4JV2A 2QQFA 3KVNA 3TXXA 3IURA 2DWPA 1B73A 1Z3IX 4M47A 2HLPA 2ZUSA 5BN4B 8ICMA 4GM4A 3QELA 4M54A 1ZOOA 4V0LA 5IFLA 4MS1B 4YDSA 3HWRA 4FB4A 4MDEA 4ZC8A 4DAEA 4PZCA 1JJIA 3D6MA 1JIUA 1U3VA 2VZ9A 5CK5A 1BMDA 2HW8A 1VPDA 2POQX 3BYZA 3C3YA 4I9UA 3WK4A 4CIAA 3GUHA 2ZYUX 1VIAA 1PQPA 3H1EA 4KQEA 4YMTA 4JS0A 5JE8A 2MCFA 3A0HU 1BEEA 1TF5A 4QTZA 3BQ9A 4US0R 3V4VB 4L95C 3ITEA 1KW4A 3DEKA 1U4SA 3OZCA 3V80A 4E09A 3RTBA 1YKGA 2V3CC 4BLUA 5BVHB 8ICBA 2XKKA 1T4CB 3ZW9A 2HX1A 2Z2YA 2Q0ZX 2FPUA 4CEJA 4A2PA 4ZYYA 4EW2A 1Y1PA 3M9WA 4BQRA 1E1YA 4G1MB 2RC5A 3JQGA 1W6RA 4XX0A 4DCOA 1M34A 4EQ6B 1MAHA 4IDPA 4YN3A 4DR2B 1O0BA 2VHQA 1X70A 3Q6IA 2YUTA 4JLVA 5A5EA 2WFMA 1C8KA 2XB2A 4ITUA 1FMLA 4PYOA 3QSYA 3ZTWA 2H1RA 1PR9A 3LGXA 2OHOA 1KQQA 3K6JA 4A6EA 5G4LA 2D13A 1M73E 3UMJA 4N49A 2R6ZA 4L5IA 5B1SA 3ZW8A 3DZDA 4TTAA 4BCCA 2SECE 1AQJA 3KOOA 3OIGA 5BR8B 5C7OO 5TB5A 1YCGA 2HV8A 3E9YA 3FGNA 4KJXA 4OGGA 1G5IA 3GPDG 2AU0A 1ZJ4A 3UTDA 2C5FA 4RELA 5EPUA 4ZYWA 4TM8A 5L40A 3FYUC 2V4ZA 2GFHA 4PZDA 3RVBA 4J0QA 1KAGA 4QATA 2P6UA 1QJ4A 5CP2A 4M37A 4ARZA 3FOZA 4XWTA 2J5QA 4EX6A 1LV5A 2NVWA 2JLCA 3ETCA 1R4NA 4FLEA 5DEIA 4I2EA 2AEMA 5F9FA 4CPDA 1GL7A 1PFWA 4G65A 1T4GA 2IZ6A 3C3AA 3IQDB 3K53A 2ONKA 5CJ2A 3GJ6A 4D5EA 3IP7A 4LHEA 1U3FA 1LKYA 2GCIA 1H6DA 1GR0A 4DLRA 1BAPA 1GLVA 2A9PA 5C34B 3W8EA 3O83A 4AT1A 5TQJA 3DR3A 2JBAB 4DLXA 3MT9A 4RPLA 1ZGCA 4S24A 2A9KA 3VOSA 4D9HA 3JRNA 1YIDA 4GXQA 1ISRA 2HMAA 3JPOA 2VTEA 3GIDA 4J4BA 4NRDA 5J0QA 4NPAA 2BHRA 4IIJA 2PEYA 4YRLA 4QJFB 2A7QA 4LJLA 4KXQA 2LVBA 4CQNA 2OLKA 1CIJA 4LDNA 4D9CA 2W6ID 4CCWA 3NHAA 2VBFA 2P67A 4UJ5A 4IHAA 1EXMA 2O3QA 5KC9A 2OZEA 3OT5A 4YCLA 3FYDA 4ZCQA 3T3OA 1GRNA 2JCGA 2Y8EA 1DJOA 1ZCZA 4R65A 5FPSA 2NYUA 1QJCA 2BP7B 3OZEA 5LP6F 3D3NA 2OGUA 4LZJA 2NV3A 2WVGA 9ICXA 5AKGA 2AUNA 2FZ5A 2XWQA 1R0XA 1IBCA 2YWXA 3MN1A 3ZHZA 5J58A 2IHUA 5A03A 4LMBA 2DBYA 4AJNA 1KYZA 2PXAA 3WMRA 5GTIU 4NLCA 4PHEA 1DXYA 4MTLA 1YMUA 5E79U 4MDFA 3J81j 1JYFA 2BFBB 2K87A 2IRWA 5TVKA 1GTRA 2OORA 4IFBA 4EUKA 1EFLA 4DWWA 4Y18A 1QCYA 4BB9A 2WZCA 1VE1A 2CDCA 3KVOA 4DCSA 4LDAA 3PHBE 2C57A 2ZAYA 1PEAA 2PMWB 1CF4A 3RFVA 2ZRAA 1U0OC 2VEOA 9ICNA 1N5JA 3ESQA 3RC9A 3VOAA 1DC8A 2ES4A 2EF0A 5JQGF 5CITA 2J6SA 2VP0A 3MS2A 4RZSA 3K8OE 3C5EA 1M72A 4JR2A 3V8MA 2J48A 3AR5A 4B1FA 4XRRA 3RYFA 4F60A 6AT1A 1KBZA 4RVDA 3ETRA 1OXJA 3ND6A 4JK3A 4LF7B 2R8BA 1XAGA 2HA2A 3R9XB 2E1EA 1G17A 3UATA 4AY4A 3BIWA 1SCIA 4WXMA 1Q7RA 4UPVA 3MJTA 1RR6A 5CJ7A 2C2RA 2XVZA 3LPCA 2XKBA 3VV2A 4F21A 3OMWA 5AESA 5EWJA 3WS7A 2FMPA 3VHXB 1HKHA 4QZVA 5DNYB 1SWVA 3IUQA 1I7DA 1EVLA 2F4NA 3QVVA 1OIVA 2BFBA 4BASA 3NBYC 4EGSA 1K7YA 5A06A 4JJEA 3ZXUB 2Z1NA 5MN4A 1B15A 3KHGA 1XDGA 1AT1A 2FQYA 4GRIA 1PGQA 2YBDA 1J56A 4GX1A 2XVMA 3ETJA 2CJWA 4KEAA 4UQPA 3C6MA 3QX9A 1ZSVA 3QKSB 1L1FA 1RXCA 1KVSA 4A23A 2E82A 3PUYA 1WXHA 4S35A 2Q1UA 2AQ8A 3KJGA 2ZRCA 2A6PA 1RE0A 2JGRA 1QK5A 2QRJA 3WVNA 1G8MA 2IPLA 3VVCA 2MUTA 1E6MA 2H7CA 4KQXA 2KICA 3ZW7A 4YUZA 5DNDA 1TQ6A 5DLFA 1TJ4A 1U31A 1U3UA 2AG8A 2D2XA 3DV0B 3R3JA 3TDMA 3VDNB 1Z63A 3B38A 3HR4A 5DCUA 3VVLA 4V0MA 4O8ZA 4M1TA 4R8MA 3RGWS 3UG6A 4ZOAA 3ZOZA 1JE0A 1FIQA 1AQYA 1FFXA 1IB0A 2ILTA 1H0HA 2XUQA 3SBOA 3OIDA 4RIGA 3LY8A 1Y48E 2WM2A 3A6JA 2HO4A 4XWYA 4J3NA 2J6HA 3JPYA 4EYGA 1F5SA 8ICIA 3MDCA 2VR1A 3HI6A 1YU6A 1DKRA 3ER9A 2QX7A 3UANA 4MROA 5E8JA 2LIPA 2PGJA 2PU5A 3BH0A 2ORVA 3DCYA 1WXXA 4O5KA 2JD1A 4DBLE 1W36B 3ORSA 4MP6A 1KEJA 2WWXA 4R81A 5JAPA 3S29A 1RZ3A 5LZ8A 4CMKA 2WR8A 3EJ6A 1DO8A 4TKLA 1AMOA 3K9GA 1MF7A 1CZUA 1WUTA 4M04A 4J0GA 4XOIA 1DQPA 1LK7A 3CLHA 3TCXB 2G9NA 3TQQA 1PVVA 3NNNA 4PAOA 3SSMA 2ZIXA 5ILQA 1KJIA 1XAJA 3BRQA 1G0NA 1IVYA 1WQ4A 1XZNA 3ZOKA 4BFTA 3H5NA 4X6LA 3RC2A 1XV5A 2YZKA 2GWHA 1EEHA 2C3PA 2JLBA 4ETIA 3K9BA 1VE6A 3L8YA 4RU9A 1M2JA 3RBEA 1NVKA 3NT4A 2XO7A 1CJMA 1PDVA 3O4FA 4FFOA 2W3RA 1I5EA 1D09A 1ZQ9A 2HYDA 1ZHFA 3I5UA 4G2NA 4IPTA 4EKNB 4YT4A 5AUPB 1L2TA 3ZY5A 1XFDA 3DTVD 4NZYA 3UJAA 4F3YA 3KLNA 3PQCA 1UAGA 2ORWA 3A25A 3E3MA 3L01A 4QUGA 4ZQGA 5JU5A 2B37A 2XKJE 4PRZA 4R84A 5F77A 5EJ6A 3H5LA 3TZHA 3CIOA 3X1KA 2QW0X 4NVRA 2ASDA 1P2UA 1NJFA 3GFRA 1QDEA 3ZN2A 4BWMA 3HM2A 4U9UA 3SDSA 3ICXA 4Q5IA 2Q27A 2Q1WA 2ZDHA 4FYYA 1NT4A 1TIPA 1Y3HA 1ZAKA 4HLNA 1FJHA 5LA6F 1ZQQA 3BBPA 1ABBA 3FCSB 3TFOA 1KPIA 2A94A 5C51B 2D0OB 4C1BA 4KCGA 2C8LA 1Y6RA 3VJRA 4L76A 1C50A 5TJ9A 3PQ4A 4YJFA 4CTKA 1V45E 4JIMA 4L28A 8ICCA 2QNIA 3TLZA 1QHIA 1Y33E 1XTUA 2VAMA 2VT6A 4MWEA 1LDBA 4FPXA 4OYYA 3TW6A 5LZ5A 3ZWMA 2QLJA 4ED2A 2YNMC 3HZHA 1TVEA 3VMMA 5IT9A 3GPIA 1JSCA 5ALHA 1T9GS 3N2EA 4GKVA 4MXDA 1N1EA 1QP7A 1MA3A 2C3OA 2D7JA 3IE2A 4NQZA 1C5KA 1RT9A 1CS0A 3VDMA 1KH1A 1W19A 5HTOA 2O4UX 3KSDO 4C87A 2ZSJA 1R8JA 3OOWA 4I81A 5A3QA 5BSGA 5A4KA 5JDIC 4JEHA 3S2FA 5B7QA 1NKBA 3AF2A 2Y9UA 3H1AA 4GI3A 2G4CA 1XS9D 1WX1A 4FMBB 5FNZA 3CGWA 4OJQA 4QTYA 4IJMA 1GLGA 1NC3A 2J7KA 3GWGA 3OZRA 5DYIA 2NMVA 3KRTA 4G0WA 1JKFA 2MSEB 2OKCA 4P5EA 3VPAA 4D43A 2M9NA 1GSHA 3BWMA 1VI6A 4C8KA 3S2YA 5CVCA 1J4AA 1RQ7A 3OM1A 2UZ0A 4AG6A 4ZDJA 2RH4A 1V1RB 1KSFX 2XZPA 1VRVA 3FFTA 4CM7A 4JL8A 2CLSA 1XD2B 1DAHA 1M1XB 3L4PA 3F2BA 2PJDA 2QM8A 3IA2A 5IILA 5KAIU 4RMNA 3RF6A 4BMVA 1NW9B 5GV7A 2BCGY 3SV3A 1E6LA 4H4EA 4PFJA 4Y6PA 1CY0A 8ICQA 3STWA 4XDHA 2GEKA 3VU9A 1GNPA 1DMRA 2W4IA 2PLNA 1OC2A 1SHTX 2OVBA 3OQMA 5G1OA 2AYXA 1SA0A 2EIXA 4U5QA 4BKUA 3ACCA 2H48A 2J7PD 3EQ6A 6REQB 4K2HA 5CA0F 5DF1A 2GK7A 1R4MB 3HXPA 1KBUA 1YA6A 2WWIA 1CY6A 2QZSA 3W2HA 3PUZA 1S01A 3JSXA 5JZBA 2ISQA 2F2AB 2HOQA 2EZ4A 1N2CE 2PX2A 3Q0IA 2OAQ1 3H65A 4MUJA 4O08A 3QMWA 5J4LA 1KBOA 3AF6A 5EJAA 2QN1A 2YMPA 3FFWA 5CDYA 1JFRA 1UZMA 1CV2A 3D6HA 1OAOC 3MTQA 1NKSA 4RVNA 4DIUA 1CF9A 4F4UA 5KZMB 1DTWA 4TKUA 1H1TA 5KT3A 1Z4MA 4IS7A 4MRVA 1LX6A 3H05A 4XJVA 1BPBA 4ZAZA 4Z7OB 4RPZA 3TAHA 3U4HA 7REQB 1JROA 3ZQJA 5LWQA 3LF2A 3KLBA 4OP1A 1F8UA 2WIDA 3GJ8A 3CKYA 3G7NA 2B34A 2BCEA 3MCZA 3JWPA 3IGFA 4OV6B 3O7WA 4G85A 1PQUA 3S81A 2Z8ZA 5E6SB 4DE5A 4KE6A 2ZRQA 4MQ5A 3GLFA 1TYAE 4TV8B 2AXEA 4JHXA 4M7PA 2P30A 5MN6A 2WSLA 3G17A 1M9NA 3CEHA 1EGVB 1VCOA 4RTQA 4ED3A 1ZQRA 1MQ9A 4X1YB 3RLFA 1JKIA 3F53A 1B7GO 2F6RA 4BNWA 1Z0IA 4XUGB 2A84A 1D6SA 1MBZA 4UE6A 5DI3A 1G21E 2PL1A 5EUBA 2C61A 4UU1A 2H5XA 2P9YA 4RY9A 5IF9A 1LSJA 3BGVA 3FRIA 4Z6EA 1OBFO 1TM7E 1UBGA 2MMGA 4GPEA 3H11B 4IQ4A 4Q66C 1GUBA 2QVCA 1B8VA 3ECCA 4F9GA 3M6VA 1QFYA 3O3MB 4GHWA 5DW3A 4DM4A 1Z2AA 4GUAA 3MRSA 4EG6A 1IY8A 5CT4A 1YBVA 4K8RB 4M2YA 1FDIA 3Q8MA 1RPTA 4PGQA 3WYDA 3T3NA 3VSDA 4YXMA 4I55F 4FGWA 3ST7A 3T38A 1FXSA 3M1AA 4FD2A 5B6JA 3TTSA 4PO3X 4GBGA 4U9IS 1AROP 2HDWA 3EISA 1GFWA 3C6KA 3AVTA 2P91A 3I1IA 3GLUA 2QXUA 3IQIX 4MUXA 4QPCA 3WXMA 5AO9A 3VH2A 1J07A 2QYOA 1EGAA 2VCHA 5CR0A 2XT6A 1L4NA 3C3BA 1FTYA 4MVCA 4MI3A 4A4DA 1K5HA 1Q91A 1OAKA 4X5VA 1Q1BA 1X9XA 1QKJA 2GWRA 2K4IA 4B2PA 5BSEA 4WX2B 1GPAA 4DLPA 2FRVA 1X1SA 4MQFB 1MVNA 3FUUA 5FFFA 4CLOB 5FX2A 5AVRA 3TZ6A 5HE9A 1MQ3A 1V96A 1MOSA 2IYZA 2XWJI 2W48A 4NI5A 4WGFA 4JLDA 4FU0A 3SC2A 3ZJYA 1H2XA 2ZANA 4DQKA 1ZBDA 2EGUA 3B1WA 4KPEC 2Z2KA 1I36A 4C1NA 3ZHSA 2X5NA 2FWJA 2RH5A 4QWDA 2W04A 4RX1A 3WADA 3ZE0B 2BLLA 4MWZA 5KU7A 1YZYA 2FSPA 1NSTA 3V1TC 4UDNA 2SKEA 3L6OO 3ZYCA 2J0UA 5K2OA 1XPUA 2OXTA 2HHUA 1V9CA 1M0SA 4Q3KA 3HU5A 3VR1A 3G5LA 4GX0A 5BV8A 2ZKIA 1T9ZA 3SHQA 1LSSA 1GQYA 3TNLA 2CJXA 4U7HA 3W2GA 2QTVB 3KSUA 3X2EA 1U99A 3F5QA 4L4XA 4NCKA 3G8DA 5TPWB 3UUFA 1BCRB 2B5OA 3HB7A 2VJKA 1AN0A 2E87A 1VJCA 3R5FA 4BP1A 3L06A 3U7EB 4IFTA 5JRJA 4KRGA 4N3CA 2GPTA 4C7KA 4FE4A 4G8BA 3MFYA 5GY7A 3KOUA 2PWPA 3L3BA 1ZFNA 2IYPA 2WPDD 4P34A 3RVJA 2R6FA 3CXUA 2HSJA 5KFDA 1FDRA 3EXIB 5D3MA 3X1ZA 5LA6A 1UBFA 2FRXA 3QXXA 4MZDA 1ZQAA 1OW3B 2F48A 5F3RA 4L5BA 3DBRA 2ASJA 2EJUA 4N7BA 1C8VB 1Z0UA 5U4QA 3ZD9A 1L7VC 2V4RA 2CEAA 2XTJA 1KIMA 3KFUF 2YDXA 3E1GA 3ZE6A 3P9NA 3NVWA 1ICEA 2IXGA 4EZ6A 4HRAA 5KTTA 1GL9B 1S3IA 3U61B 2V0GA 1ZYUA 2VDLB 1MJFA 1T0JB 2PM8A 5BSKA 1RZTA 1KYXA 1RLUA 4QDXA 3PD1A 2HWXA 1RXEA 1H3NA 1JLSA 3BQNB 4MUEA 1C9DB 1JR3A 4NS4A 1NQXA 1T4MA 1JVNA 1YVDA 2ZBPA 3LU1A 3PZBA 4Q7KA 1PEDA 2LCFA 2ODBA 2AXTU 2X4DA 1UQTA 4R69A 3OF2A 4F3CA 1E6KA 3LCRA 1YZ7A 5A4IS 1T9AA 4GKJB 5JNVA 4OYHA 1JZQA 2X2FA 2PIAA 3TOZA 1AZWA 2BH9A 4R1TA 1W0KD 3L1HA 1XMQB 5C4GB 3K4GA 4F2DA 1IDOA 2B25A 2YVQA 4NOLA 1PK1A 1K97A 2C03A 1KP9A 4ZVNA 3HP4A 3IQEA 2ONJA 1WMAA 1EFHA 1I9GA 1R64A 3QEMA 4BWGA 5T57A 1VJ0A 3RVLA 4EVIA 4DDTA 5FOTA 4JI2B 2BF4A 8ICTA 2PUWA 4LNAA 5CXUA 3BD7A 4N39A 4OIFA 2DPXA 4N0MA 4QYMA 5C46F 4KN7A 2Y1WA 3AFGA 4L7VA 4JWNA 1E7SA 2P6MA 4OU4A 1NVGA 5F4ZA 4EHAA 2W37A 3CZ5A 4YAOA 3ZI7A 1KR2A 1HK7A 1UADA 4CM9A 1JGTA 1EBFA 2QR3A 5KJEA 1P1IA 2GUWA 3QTLA 4ALMA 4P08A 4HDQB 3F7NA 5G5HA 4G23A 4Q9NA 3RU7A 1YRLA 4X5OA 5FB3A 4JMUA 5CLFA 3J81k 3FNHA 3EF0A 1T9HA 1GGKA 5KNDH 4UNRA 4F9FA 1TO1E 3GXOA 4KQ6A 4FSHA 1ZX1A 1AXRA 5B36A 2PS0A 3DFIA 1M7GA 3Q98A 3SDBA 5SZJA 1UMCA 1BD4A 4HTFB 4B45A 5JAZA 4QPZA 5JO9A 4NOMA 3PR4A 4YROA 3MAGA 2WHXA 5IDVA 3E23A 4N0PA 4CM8B 1MPXA 2D0DA 5DM2A 3C3CA 1IHOA 8ICYA 1IK6A 1RXYA 2Z09A 3P26A 3O91A 5J0UA 1AVTA 2I0FA 2BI8A 4J0IA 2OTCA 3AHJA 4XSVA 4WKNA 4G84A 3T3PB 2W00A 5EFOA 4R9VA 3ML1A 4PG5A 5IBQA 5JNLA 3T5JA 1W88A 3KOMA 1IN4A 4YPFA 4CKWB 8OHMA 1L5QA 1I01A 1OKKA 2GD2A 2I29A 1OXBB 3B82A 4YXWD 3D8UA 3ZDRA 1KTIA 3K9WA 2AJDA 3ZQUA 3ZWXA 3NRWA 1UKEA 4HNSA 4B9TA 4AY3A 5JQGA 5K4HA 1RG6A 5HA5A 4KVGA 2Z4TA 4C6SA 2I78A 3ANLA 3RD5A 4YH1A 3AFHA 3FWPA 2O8CA 4DQ0A 1DTSA 4H1VA 2VYND 2I5HA 2N1RA 4MFFA 3R9XA 4EI2A 4MP8A 2FSGA 2PAFA 2BGUA 1U0NA 5CHEA 3C48A 1JT9A 5NLLA 4I1IA 4LHVA 1TW2A 5AJTA 2W6JD 4AK9A 2JZOA 3L7NA 1U4OA 3FA2A 5FIUA 4EATA 5I7RA 2VSNA 3PMNA 4PHDA 1S77D 4TYYA 4F6LA 5H8WA 1PAUA 4J6FA 3OKAA 1IEWA 6LDHA 1BYIA 1HM5A 3KB1A 4QZ9A 2KS6A 4YJGB 3MTBA 4Y0AA 3MJVA 3C8UA 2XMBA 1CUEA 2QMOA 5HCUA 1JALA 4PNZA 4QU8A 2AIRA 5F51A 5KFSA 1ZNWA 3EQ9A 4LK3A 4WLVA 4OH1A 1PR2A 1NMEA 3D3WA 1JLLA 4J0KA 2ZUTA 2WF8A 2C96A 2W5UA 5HHHA 4QO7A 3VV3A 2H8KA 1N36B 1O0SA 2QL6A 3C3XA 1DGSA 2OC4A 1R15A 3IEKA 4U3JB 2HMVA 3UMFA 4PSDA 3ZCXA 1JWAB 3ZD6A 5J59A 4ALIA 4IIJF 2MMCA 4GPIB 4ZAYA 2ZIVA 1ZBQA 1TK3A 2CEKA 3ZBTA 2G40A 2F3PA 1RCFA 1P7DA 2P1RA 2R2AA 1QHHA 3QENA 3X1MA 3QZ8A 1Q17A 2GBPA 1F0PA 5CCBA 4Z49A 1JG6A 5KG3A 2HMWA 1W5EA 1XRSB 3EVFA 5A5FA 3MWKA 4MLCA 2E1PA 4BLWA 1Z13A 3L7BA 4PCLA 3AKZA 4X64B 2IBMA 2ZXHA 2JC3A 3FVRA 1R37A 3VBEA 3VPBA 4XUSA 3WLOA 4AMBA 5C81A 4ECTA 3LF1A 2OORC 3KL2A 4O1IA 1FRFS 1J8YF 3AB8A 3MGIA 1CZRA 3CXRA 2R47A 5DE3A 2QIOA 4RZHA 2YWHA 3PFNA 7YASA 4DF4A 2WU8A 3K71B 3EA5A 2W98A 3SICE 4JC5A 3OIWA 5CLQA 3TCNA 2CLLB 2FEKA 3BL8A 1X40A 1M6VB 1N2OA 1S2GA 1YQEA 2ECQA 2OHIA 2XGOA 3W5SA 3KDSE 2AZXA 5IN5A 4NV0A 3MTAA 5EZYB 3JPNA 3FCCA 3IMKA 4WFJA 2X4LA 5A1JA 3P0JA 3N7AA 2PMFA 3GPCA 4CT0A 5F21A 2HMXA 5JYDA 2CK3D 4L75A 1Y4ZA 3DKVA 3R7AA 1G9TA 1Z0SA 3PFHA 4ID3A 4JMLA 1LPNA 5DLGA 1PFGA 5BP7A 2YY6A 1BWRA 5K1ZA 2YS6A 1YDHA 2EG5A 4EVSA 2Z43A 2QLMA 3CKMA 3SCZA 1HLPA 2FDCA 4U5XA 2PE5A 1YR3A 4LKOA 3N97B 2DUMA 3DSRA 5CGZA 4ZVPA 1F6BA 2RI6A 2NU8A 3N7RC 3T34A 4COKA 2A9FA 3D4PA 3EZGA 3O8NA 1HZZA 1ZVKA 2FH5B 2Q3LA 4HQ6A 1DRVA 4OHXA 1G6KA 1NBIA 4IL5A 1OH6A 4IDNA 4TSFA 4BFYA 1VPVA 2R62A 4FHEA 1P6QA 3QGMA 1SHJA 2A1AA 3NEPX 5KJFA 5DGAA 4TLMB 2ZRPA 3EHDA 1W85B 2YRFA 4I9GA 3AUFA 5F12A 2Q8PA 3UW3A 1MZPA 1C41A 3G59A 1N0WA 1CEXA 1I51A 4GWKA 1WUDA 4LOJA 2HJ9A 4TYPA 4WV3A 4MW4A 2R7NA 1IBSA 3R5XA 3HY6A 4R9SA 4A8JB 2D2EA 1EWQA 2JFFA 4F93B 2V97A 3NLLA 5C8YB 5L7TA 1B74A 2JGLA 4M0FA 4UVHA 5CK4A 1U94A 1NJ2A 1SXHA 2A5DA 2DFVA 4G56A 4PC2A 3FCAA 4YASA 3UT0A 1NAHA 1T8EA 4UAWA 1ID1A 5ALIA 2AYZA 3DEFA 1JI0A 4TXLA 4WMLA 3TZLA 4F8EA 4ITRC 1UBKS 4U7TB 3VR0A 1RHRA 5FPHA 1NU6A 5AJUA 2INGX 4ECXA 2GI4A 2V55B 4GI1A 1Q77A 4CR7A 4FHFA 2YOGA 3SG0A 3H5OA 1B76A 3TEMA 5BWCA 2AOTB 2V45A 3BE8A 3M7IA 4J76A 4UULA 4DY4A 5LM3A 1EB8A 2CVHA 4PX9A 3NGXA 3OY7A 3CTPA 1L7PA 4RF5A 4W5QA 3LPAA 4LDJA 1FC0A 3SHOA 2V5AA 1SZJG 3SNKA 3E1KA 1YBHA 1JIKA 3GLKA 2XH8A 4HQFA 3ANNA 4N5DA 3ZY6A 3H3JA 3A9UA 1OWOA 1K5GA 2BKEA 4FLMA 2R00A 5LB2A 4HDCA 1Z2PX 3LY9A 1UJ4A 4H1WA 3BDVA 4HHEA 1ACMA 2Y4NA 3RM3A 1HYHA 3WBJA 4GP7A 3R3ZA 2WJWA 4ECZA 3W5JA 3V34A 3DEHA 2VNKA 4EELA 1DLJA 3GRPA 3K8ZA 3P4UA 3UFBA 4OD0A 1HYQA 3PENA 4Z0NA 4YX9A 2A3NA 3ONNA 4INPA 2BDUA 1SNYA 5JS7A 3DPIA 1O08A 1DL5A 1MB9A 1VHTA 1DE0A 2NPOA 2FF5A 3KALA 1E1NA 3NKVA 4LNUA 5CVUA 1J9ZA 2RJ3A 1D1QA 4IBOA 2PFOA 1N0IA 1K6JA 1PJTA 2FZGA 4WJZA 4ZQEA 2OSBA 4ECQA 1YCHA 2EYUA 1M8FA 3R0IA 2ASVA 4LVCA 4LFCB 4CNBA 5I8PA 3TF5A 3JPSA 2QYTA 1RQPA 1QZUA 9ICHA 1K7XB 1PJBA 4ROTA 4WL0A 1J5EB 5J0PA 2QD2A 2B0CA 2JHPA 5HKOA 3H0LB 4QEDA 2VRCA 2BFEA 1HH4A 2PUVA 2EFGA 3FY4A 3PXXA 1L6NA 4RWZA 3VI4B 3UB3A 3BM5A 2MU1A 5ERGB 4DUGA 3LW8A 4E03A 5BV1A 2PH7A 5EE9A 1RJ9A 2LTAA 4XB1A 1A7JA 4R6XA 1G1MA 4ARIA 4UZSA 7REQA 5JZMA 4KLJA 1XMJA 4G01B 2JMGA 4ZI7F 3HCPA 1V7PC 4RC9A 2GK3A 3GARA 2CC2A 3ROPA 3U56A 2J3QA 3RUDA 3UAVA 3AL0C 1FEZA 1ZVQA 3ZR4B 5EJ7A 4DIMA 3IKVA 4YR0A 4B0PA 2GRUA 5CRXA 1E69A 4M1YA 3AOGA 5K3SA 4FB5A 1EFKA 2ZYHA 4JBHA 3A1UA 4HJXA 2FUCA 4KLRA 4Y9SA 5CPFA 4KMUA 4S1VA 2IMWP 1E1LA 4D9KA 3BQ7A 1Q2UA 1TYZA 4N82A 2PBFA 3R3VA 1NK8A 4S1PA 3B0XA 1IN7A 1T25A 3GY0A 3OCJA 3D4NA 3LXXA 1HOXA 3OPYB 1U2SA 4ZYZA 2JGMA 1U5BA 3OCVA 4CEHB 4CEIB 1UL1X 2B1QA 2ERYA 3NWEA 2AQIA 3O1IC 4JBNA 3C3EA 4RQMA 3QI7A 4YWJA 4KRFA 2PMZF 1EVEA 2I66A 4TYMA 1PK1B 3I2IA 1E66A 3O74A 5E7IA 1U0TA 4KQ2A 4Z51A 4H6VA 5K6AC 1WMDA 3IULA 3ETLA 4ZVSA 3HKEA 1G3UA 3NS7A 5KAFU 1FX0B 1N1GA 2D3WA 1XYVA 3KSZO 5AW0A 4OHRA 3ZWCA 1N2CB 4UKDA 4RQUA 1CUYA 5AKLA 1E1DA 1JLRA 3FFXA 3CSSA 3OZIA 2I8AA 5H9VA 2CMGA 3CBGA 4B9LA 3RVNA 1H6AA 4BX9A 4B6JA 1XALA 2GBLA 1GPDG 3DQPA 4RPCA 1TCVA 3W2FA 1QIJA 1ODLA 4PSAA 4S05A 2HBYA 4QWAA 4QSHA 3FWKA 3HGMA 1FIUA 3AUTA 1P2GA 1US8B 1YULA 4LY6A 5JR3A 2H54A 2JD0A 3QPDA 2B0JA 2R8GA 2VDNB 3PT5A 4RS3A 2IUEA 1VHWA 1JDVA 3KU4A 1FP7A 3I9MA 1OAOA 3USES 4UMVA 4GI5A 2AE2A 4R8LA 1Z62A 1FDOA 1ESNA 1Q7CA 2FWBA 2R2GA 4REMA 2VDRB 4RESA 3T4EA 2PXIA 3C8HA 1WS6A 3PHGA 4L7QA 5ERYA 2QGNA 4BJHB 1V95A 3CLUD 4AUEA 2CLOB 2ID4A 1T8RA 4KIWA 3RB0A 1MPTA 4P7BA 4P4MA 5L6LB 3BQTA 2NVUB 3N8GA 4ALJA 2YX1A 3AF5A 2CF6A 1ZC4A 3LP6A 4P92A 3RS7A 2Z0MA 1TJ5A 2CNBA 3P2IA 2WKPA 1K92A 1TM1E 2HRZA 1RAEA 3F8TA 4ENVA 2A9RA 3G0CA 1VLMA 2W4MA 4NBSA 4FD3A 2GXQA 3MILA 2AGPA 1C0PA 1PHPA 4Z6FA 3L5KA 1ZLYA 2DCUA 4OEHA 3IMGA 4RSMA 1UBHS 4XUEA 3PR3A 3UEOA 1M2HA 3RB8A 1KKMA 4CR8A 2ZM6B 1G3QA 4P3YA 1BPXA 3L07A 4KQCA 2H4JA 1NY6A 2C0CA 3CUUA 4ZARA 2W9MA 4KMRA 3UAWA 4PGGA 4TUYF 5KFCA 1T15A 3AIMA 3I2KA 4FYJA 1PBTA 4OSPA 4NK5A 3HK2A 3WL7A 4BWVA 3K96A 1N3LA 5THKA 3P1JA 4W5JA 5AKEA 2R18A 2GNOA 2WYOA 3ZS9A 3E3AA 4KFTA 1ABFA 4OB7A 5FXMA 4Q47A 2OFFA 3HJAA 3UXYA 4A8HA 2PTHA 4LC1A 5BUSA 5HIKA 4X60A 4XLZA 3CVOA 3CX4A 3PXGA 4DLEA 2Q4RA 2R9VA 3UUWA 1HYGA 2EZXA 2PWBA 5BWNA 3UWMA 1JHOA 2P2NA 4PHFA 3WNVA 4EMTA 2Y05A 5E3IA 4PYNA 1KA9H 3DLTA 2OA0A 4K9KA 3REQB 3RG2A 3RRZA 1J90A 3RVKA 2DFPA 2W6OA 2BCSA 3A26A 3W5VA 1F9AA 1UM9A 1BHQ1 4RQ5A 2ZPTX 1LD3A 4UZFA 1GPLA 2AHOB 3VR5H 3EGOA 5FWYA 1Z34A 2JKYA 1V41E 1K66A 3NWBA 4JLUA 5DYTA 4RJKA 2MINB 3PXBA 2ORIA 3UA3A 1LLUA 1NOMA 1I6LA 1I3NA 3A6EA 4IYJA 3NOXA 4BRUA 1Z4KA 4OA8A 2ENWA 3AU2A 2RI0A 4RD6A 4UNQA 2O1EA 3VPDA 5IVIA 5AICA 3L92A 1FMCA 1XRJA 4WXPA 1K06A 2P4UA 2XRMA 2PUBA 2G09A 1PV2A 1R12A 2FDXA 2FPPB 2B2CA 3DMRA 4Y7CA 4C2BA 4I1SA 1JWLA 2F1IA 4EI7A 1VE7A 2AGOA 2XUPA 5BRAA 4Z6KA 3NV7A 3F5SA 2OKGA 1HQKA 1KI8A 1U1GA 1BE0A 2NAPA 5DOVA 3BICA 3TQTA 4GDFA 1VHQA 3CURA 2RDJA 4URHA 3RLIA 3PNVA 5F98A 1LPSA 5CX1B 2WAQC 2K4HA 1NBAA 3WRYC 1XQ6A 2QMHA 5ALKA 2VYCA 1ZK1A 3T1QA 2B4AA 1VSQA 5HBGA 4HFMA 5DB4A 1FW8A 1AXEA 2C7VA 3EIXA 2ZUVA 4I29A 3GFPA 5IAGA 4OB6A 1YS4A 1PFQA 3V4PB 3I2JA 3HCRA 4S1OA 2FEWB 2MRLA 4QECA 3M6KA 5I4CA 3ICEA 3EB9A 2RJNA 3MW8A 1YOBA 1DKPA 2EJBA 5C18A 1XDDA 2DTXA 2OCPA 4RSHA 3RYHA 1QP0A 1IG3A 5LZ7A 1SELA 4CKBB 4MV8A 3OTOB 1OH7A 1KXZA 2D3TA 3TACB 2OHVA 3JV7A 4AKEA 1DKLA 5GMOA 2RSLA 1QVVA 2W54A 1UWKA 3WIBA 3LBFA 5JS8A 4OQ4A 3UCXA 5C5DA 3BFJA 4EHKA 3GZFA 4EA8A 4E07A 1ZIYA 4NZ9A 5H0IA 3QUTA 1C0EA 1LK0A 5H59A 3LIIA 1Y9DA 3FDJA 4O4JF 5DV9A 1KO5A 5KTPA 1Z6GA 2WQ6A 8ICLA 4KAFA 3QKUA 4JJZA 4HEJA 1QRDA 2VLIA 3VR2A 4PFQA 2C28A 9ICSA 1I1HA 4WH0A 1D9XA 5K3DA 4GW3A 1PW7A 1TUIA 2OZPA 2AFHB 3I34X 3VBCA 1O95D 2QTCA 3NYRA 4QDZA 4TTRA 3SQMA 4AZ3B 4B3XA 2CFIA 3ZJVA 4DLYA 1SCAA 3F5DA 1DBSA 1SVOA 2B4YA 2CT8A 1X92A 2PUEA 3HCAA 1P1BA 4FWTA 3TFWA 4U6QA 3T1OA 5HOEA 4GYYA 4KVAA 4P98A 3TSAA 1RC8A 2H5IA 3FNEA 4I5EA 1Q3TA 2TSYB 4GWLA 4EFNA 4EDFA 3PNYA 5CHYA 1C1DA 2QW1A 3NG1A 3O0DA 3OI7A 4P4LA 3GELA 2Q7DA 2W2MA 3WOHA 1TO2E 1WW3A 2X15A 4PYKA 3O8LA 1KC3A 1PTJC 3QLUC 3UK2A 5SV2A 5ARDA 4A5SA 1QYWA 3K35A 3IYLW 1XBTA 3Q72A 2HU5A 4U6PA 3AX6A 2YICA 2HREA 4JT9A 3BRCA 4MV7A 1Z00B 3R0VA 5ALFA 4KXMA 3DCIA 4XARA 5A7HA 3JQQA 3ZWVA 4YQFA 5KYWA 2QBYA 4BFSA 1K8RA 1X3SA 3TCKA 3JS5A 3DE7X 1G21B 3N2NA 4V38A 1GKKA 2Y0PA 4YRZA 1ZRNA 3DTTA 4GE0A 3T7KA 3O90A 3L7MA 4JODA 3CSUA 1J2JA 3TQCA 2BCQA 1T2FA 5TQ0A 4BZPA 3CVUA 1AF4A 1WM1A 4Y67A 2RD2A 4RD3A 1UBSB 5ICCA 3ZDCA 1OLOA 5EP4A 1UZUA 3G7SA 3VZQA 2PPLA 1ORIA 1G8FA 1XEWX 4N7MA 4JU8A 1AS0A 1KR5A 1EK2A 2BSXA 2P41A 3IHTA 1NW6A 3PGMA 4BP8A 5MFPA 1E2DA 1NIJA 1X86B 4NOJA 3WLEA 3LKVA 2WT8A 1A76A 2NO7A 4DBVO 3PR2B 1OWNA 1YFZA 2OG1A 4PQYA 3TARA 1NNUA 2Q4BA 3ADKA 3BQ0A 4YDQA 3IDAA 4MQLA 5EC8A 2DHDA 4Q1CA 3ZJTA 2ZYGA 4XJTA 1R9GA 2J85A 3IPRA 3I4FA 3DW1X 2V0NA 3N6RA 1IYZA 4PN3A 2IYNA 5KTOA 4A73A 5FLEX 4QUBA 1XZCA 4BKOA 1ZJMA 2YMQA 1M75A 1DBPA 4CF5A 3H4DA 5BYAA 4PG6A 1BIFA 4PFKA 2RKBA 3DOIA 4FZRA 5CUQA 2VNJA 4JBWA 1QR2A 3IDWA 2R8OA 4DMGA 5U4XA 3HBFA 4H3HB 3CEMA 5AM2A 1W1WA 1UMBB 2I22A 3AJRA 3BIOA 3PC8C 4PINA 5IDQA 3CW8X 4A7PA 3BGIA 1R0WA 1OWMA 3KKEA 4I46A 5DNAA 4BUZA 2HYIC 3AWIA 1A8IA 1PR6A 1IJBA 1BJTA 3PVXA 1M6HA 5K8JB 1SOAA 1GNSA 5FYQA 4D4HA 1WUHS 2WJVA 4CN8A 3KFLA 1IL0A 5B3AA 3LRPA 5EQTA 3FWNA 5DDYA 1DB3A 5BUCA 1HTBA 1IQ0A 1WXGA 4QTUB 2JASA 1N5DA 7ICMA 1I6MA 2QB5A 4HX9A 2D1QA 3H5VA 3KR1A 3LDHA 2ZUWA 3N2LA 3FCEA 1WUKS 1WRBA 2P2GA 2ZRFA 1PK8A 2Y92A 2LP4Y 3IQFA 4XDGA 3GFSA 4NCIA 4ZT3A 1HDIA 4DA7A 3JQGB 2HR1A 1LBIA 1G98A 1NOKA 2LDBA 5A0VA 4PGMA 3NIBA 1SBNE 3X1YA 1HE5A 1XZHA 2PV0A 2R6DA 5CDFE 1NHWA 1YAHA 4GMXA 4CHTA 1PL8A 4G07A 2CXPA 4ZVOA 4ZI5A 4YMOA 5KNIA 1EAMA 3W0LB 3WSVA 1UP7A 2W8KA 1V8OA 2QI9C 1IZYA 3MUFA 3MWLA 4YO8A 3WNZA 2RIPA 9ICQA 2YTUA 2GLTA 5B12A 1GZ6A 4MGYR 2XQKA 3IQZA 5DT9A 4BX8A 4XSHA 1DDIA 2BGTA 3RT1A 1UEXC 1ZOIA 3EPRA 1Q1GA 4RH0A 3JQ8A 2H0AA 1N77A 3H8MA 1NPDA 1L5HA 1DRKA 2ZSHA 1RLIA 4S1TA 1HV8A 1N2CA 1RYYA 4MOWA 1D2EA 3DVRX 1N6NA 5ALXA 2O50A 2WG1A 4P4TA 2LPEA 1UHUA 4GC9A 1G20E 5E1MA 4LZDA 5JXGA 4PRYA 5CDUA 4YQEA 2O5EA 2YB1A 4LJYA 1A5TA 3HBLA 1IEVA 3TOSA 3I39X 1RAHA 3SNHA 5AI5A 4A8EA 2QRVB 3KKAC 4Q19A 4GVLA 5AYVA 4F38A 3J81A 1R6AA 1X1AA 3A31A 4B2IA 2P3LA 1CU1A 2X22A 3ETHA 1RKBA 3KOXA 4GEGA 2I03A 3TLMA 4UUPA 4B43A 4H31A 2KE7A 1MEEA 2Y66A 2H3EA 2P2DA 4G8JA 4IRUB 1ZKMA 3JU3A 1X7XA 3AP2A 4GR9A 4MUFA 5FYDA 3SS7X 4DRZA 1NM5A 3KT6A 4JQOA 5TARA 5C80A 5C0OE 5GV8A 1JKJB 3BHIA 1VB3A 1F4VA 3A2LA 2C2ZA 2JARA 4IF4A 4L8LA 1KI6A 4QTXA 1B8UA 3N4MB 4GVPA 4MVJH 3OM9A 4J7AA 3RSFA 3O92A 3QTBA 4IXTA 4A8TA 1A4IA 1T4BA 2Q5LA 1KOFA 4E1VA 1XTZA 4YMSA 3W6OA 4HFRA 1SKYB 3AIKA 1I5OA 4YRGA 5JZSA 4CCAA 1M2FA 3RAFC 3LOUA 4A15A 2BFDB 3Q8SB 1RHMA 1V8BA 3PX2A 4LWQA 4PLYA 2QQ5A 1PNOA 3G9TA 5CYPA 1TT7A 3VHRA 4KR6A 4OSOA 4KPUA 1B43A 3BN3A 2JLQA 4JYCA 5DLEA 4M4SA 3HKCB 1SA0B 4QT4A 3EWAA 1NDUA 3G3EA 1A9XB 4BCBA 1DWUA 1VIVA 2CK3A 2HA5A 4RPGA 1A04A 2XMGA 3MPOA 1AK9A 4L02A 4PZ0A 4FDMA 4F4CA 3E15A 1GR1A 4HY3A 1K5DA 4P53A 1P7ZA 1QG0A 2GLUA 2XDQA 3AJ9A 1ENOA 4NMWA 1T6YA 4PXAA 4TMXA 5DI3B 1V9LA 2D54A 1R7RA 1WSAA 2P90A 2XNDA 1EWVA 3IUYA 3HB9A 3QZ7A 3LC0A 4FGZA 1BN6A 2QMUA 4M7OA 4OXQA 1I2MA 4EYEA 5ECWA 1XMIA 1X87A 3L0ZA 1IIRA 3R77A 3WMFA 5FAXA 3QMPA 3R9KA 2CXTA 1POXA 2IZ5A 1NUUA 3M34A 2V4QA 2Q0XA 2R66A 3OQJA 5K3FB 4LF4B 1UT8A 2XR1A 4CZ2A 3A1CA 4Q3EA 4QU9A 4DOAA 1E2LA 1PL7A 2OBMA 2VT3A 2Q29A 4BNXA 4MJLA 4XVUA 3HYSA 1JJFA 2RH8A 3QQPA 5C7IO 1VJTA 4LAFA 3P9KA 5MF6A 4CMIB 5JXHA 3NVYA 2HHSA 1ZM7A 3M9XA 5DFAA 3GW8A 1PSZA 521PA 4YMMA 1W4AA 2I3GA 3AIIA 4NXMB 4EUNA 1YQ9A 4MR9B 1EXVA 2C2EA 1RYMA 1WXFA 1RADA 2IPXA 3I09A 4MI9A 3G23A 3KT3A 1SZDA 4P9NA 5DJ5A 3W1VA 2IL1A 1KZ6A 1MQ2A 1SPXA 1DAIA 4HMPA 4QOHA 3M4XA 1U11A 2A4MA 3KL4A 2Y76A 1VFPA 1IIPA 5K51A 3MIZA 2WJIA 4IAOA 5LR6A 5C31A 2OL4A 2XQFA 4B4KA 3CJQA 4BGIA 2E48A 2B98A 2WB1F 3H18A 4TXMA 5EN4A 4DCNA 3MEQA 5HR5A 4UU8A 3EXHA 3SX2A 1MJHA 5AI6A 1R6XA 3K72B 4J8PA 4MLPA 5B4VA 1K7FB 2UVUA 3RFAA 1SMKA 4GKBA 4MV6A 1POWA 4FJ1A 2QMYA 2JGEA 3HFRA 2OCYC 1U2PA 4C6RA 2UAGA 2NSDA 4ND4A 4HYQA 5FV7A 2NYRA 4FM9A 4DZTA 1G3RA 2CHUA 4LECA 1R16A 1WY7A 2PRSA 1T3HA 3DFMA 3DMTA 3I52A 1WCNA 2K8AA 3OE5A 3DMDA 3NUZA 5EHZA 8ICGA 3QKRB 4JI0B 3H7IA 3ANMA 4YQYA 4E6PA 1JI7A 2E1FA 1KAMA 3KLPX 2GPBA 4P7KA 1SG9A 3SC6A 3A1EA 4FFWA 4EG1A 1ZS9A 1XQWA 4L5CA 1U0EA 2C9YA 4HYKA 4H18A 4DSTA 2BUAA 3A4YA 2D5BA 2QV7A 3F3YA 3V55A 3VISA 4KUGA 4D42A 3HLYA 3VPFA 3PUXA 1Z38A 2IZ7A 4WGGA 2QJFA 3MJDA 3TM5A 4R64A 4HDNA 4TTIA 4OYLA 4AX8A 4TMFA 3RJIA 4HPWA 2HQ1A 4IGFA 4CMBA 5A4FS 2L19A 3FN4A 3FZYA 2AL7A 2G36A 3KTFA 3VZCA 5LLTA 2JEIA 5SYMA 5BOVA 2ID8A 4JVSB 1OX4B 2EBWA 5KFOA 3DMFA 4F46A 5YASA 4LCJA 5AI8A 4PSVA 4F4HA 1O96B 3D7LA 1YI0A 1GL3A 4DV3B 3GLGE 1PK3A 1UBRS 2HOIA 1MIOA 4ACBA 4XX1A 4NICA 4OA5A 2WWRA 1E1RD 1UKVY 2TMGA 3GOQA 4PZZA 2DSNA 3FYUB 3GGOA 1DAEA 3U48A 1JB1A 2KE5A 2PRYA 3E9QA 1Y82A 2GJAA 2VPPA 3MHPA 4GQAA 4HYEA 4IMRA 3V3KA 4OHFA 3TTVA 1SEVA 2Q4DA 2Z2ZA 3E1SA 2QN9A 3TSCA 1HIWA 2EDUA 2YQEA 1SBZA 1VL1A 3BXPA 4KVZA 5J2HA 4WXHA 2R8ZA 5CM2Z 3UAOA 1SKQA 3H2IA 2CL6X 3D8TA 4KE8A 4FO6A 1MOZA 1XWIA 2YWEA 2Z9DA 3M1IA 4ONEA 3MJCA 2AOXA 1SQGA 1L8AA 4X6XA 5GJBA 2HVHA 3ZHYA 3WMEA 3AHIA 3CUTA 1PT8A 5HW0A 1P75A 3ZPXA 1MGPA 3ABOB 1X74A 5JAOA 3BTOA 5FI0B 3P20A 5ALSA 3A9RA 3LBNA 3ZHXA 1HL3A 1VL2A 5CB1A 2CB9A 4FILA 1UDXA 4FZLA 3M5CA 2HF8A 1F2TB 2UKDA 2DFLA 2CLDX 1CULC 1EX9A 3GRCA 4U2EA 1DRJA 4L5YA 4LJSA 1YSCA 2PGOA 2DEUA 1VA4A 1VBKA 4A5OA 2QKQA 1K88A 2Q2VA 1GNRA 4Q48A 5EKSA 3U4CA 2P9TA 4YUXA 3VKGA 2WABA 3HBAA 4QREA 6ABPA 3I53A 4HWRA 5KTQA 4UB2A 2JIRA 2X5JO 3L0IB 2HADA 1ZM2A 1B6TA 1Q6YA 1IY1A 1QIDA 1SEPA 1PUXA 2PD3A 4QIWF 4Q9HA 3D4LA 5L95A 1ZICA 4GL4A 4D57A 1JKMA 1YONA 5FI5A 1EHIA 2I7DA 3HA7A 4RA6A 5IC4A 1GZUA 4I4NA 4O4JB 5AVXA 5LIPA 2TECE 2IEZA 3KXPA 2OHGA 2SCUA 3BJIC 3VR3A 3ZCTA 4Z86A 3SM9A 3AERB 3O8BA 4MO2A 4QELA 4XH9B 3EOBI 3PJGA 3GBPA 4I2JA 2IHKA 3FJOA 4MX8A 4RPYA 3EEQA 3QBVA 2KZZA 4PZLA 3URMA 1NVEA 4WDRA 3T7CA 2G8LA 4RGBA 3CGGA 3LMKA 2ACVA 4IZ6A 1J20A 2PWZA 3WIDA 5IANA 1I1QB 3JYLA 2IBTA 2HA7A 3FLAA 2JEJA 2A1TS 3BH6A 4PLCA 1XZ8A 4ASUD 3P2JA 4OJYA 5DH9A 5GTDA 3WHLA 4RZ2A 5HCNA 1XLTA 3SEQA 2VF8A 4L72A 4F1JA 3SJ7A 3V1NA 5IH3A 4CTNA 5GADl 1ISGA 3TKAA 2FB9A 2OYSA 4D26A 4O4HA 3FWHA 1U3TA 4CKEA 1FFHA 2LWIA 5CGQB 1YS7A 5DU2A 1O95A 3FKJA 3MD9A 1GUAA 2UYYA 2L5YA 3DMTC 1X14A 2OENG 1JDTA 2OFWA 2Q4OA 2SCUB 2G5IB 3G8CA 4D4GA 4DSAA 5B1YA 5LQNA 3ZV7A 1V1MA 4CKZA 5LKRA 3D3JA 4JZYA 1NMSA 1QIKA 2QP3A 2XQJA 4X3OA 1QVAA 1EEXB 2IW3A 5DN6A 5JS1A 3QE2A 4W5WA 1NW7A 1NWCA 4I19A 4KN6A 1ONNA 3CCBA 4QHYA 5FUYA 5AI9A 2A1JB 3D3EA 5FWDA 1QSSA 2H1CA 2ZSDA 3AUUA 3LI2A 3H8WA 3EQ2A 2XQGA 3AESB 1KI2A 4LRWA 1I80A 1Y8RB 3PDUA 4HDRA 3M1YA 1IWPB 4RD0A 5KG0A 4ECYA 1MTZA 2HO5A 5EIOA 3BMNA 3NWJA 1ADYA 4IVPA 1L5RA 5D3QA 1XMVA 3WMWA 1A3CA 3C1AA 4D8UA 1OZAA 2V8OA 2R6AA 2E4WA 3BWYA 3D02A 4H3SA 2O2GA 4WRRA 6NULA 2PPVA 4RV9A 4EMUA 2EW8A 2ZZMA 3COJA 1BGVA 1Z37A 1V0JA 1AC5A 3NM6B 5CT8A 3WYGA 1DS6A 2VWHA 2YRXA 5CEFA 2P35A 3IP8A 3EOAI 3H2SA 4G0XA 4MVJE 4E7OA 4UJ3A 5HIIA 2EHDA 4JAVC 4YT2A 3RRJA 1IN6A 1B41A 4X8LA 5KNCD 2ZG6A 4QGBA 1QK3A 4UD2A 3HQ4O 4UU0A 2Y2VA 2RG1A 3OFKA 4TL6A 4YP9A 3ZXIA 4BQEA 3S2UA 2MSNA 2JIZD 2XCOA 1X19A 5FJIA 5EQFA 4NBVA 4AUNA 4E3WA 2OBXA 1Z6XA 4OFXA 4FNAA 3UKJA 1YHNA 1ZWLA 2Y0CA 3GCDA 4DC9A 1AGRA 5H70A 2PMCA 3GDOA 3GFVA 4KYVA 1XDUA 1D9ZA 3V3TA 2A9QA 2EZZA 1JJBA 2PCLA 4LEIA 1UMDA 2YBEA 3H5WA 3F5MA 1Z07A 3K5PA 3KKOA 5AJWA 3OFSA 3CPSA 2OY0A 3EFEA 4HH0A 4MCAA 3ET4A 3PUWA 4I14A 2W2QA 1JHUA 3SQLA 1GSAA 5GVRA 1TZ2A 1RI4A 4FXPA 4LRTB 3D3QA 1H4QA 3HRIA 3D6JA 3ENKA 4MRMA 4Q12A 3HB5X 2AEFA 1L4EA 1TPYA 1PZHA 2IDZA 3F4LA 3GGGA 5D3KA 3SZUA 4GC7A 4UBLA 5T8KC 4C7YA 4G1UC 3AZOA 4N18A 1KMQA 3DBIA 3VQTA 1EWRA 4NECA 4B81A 5B66U 4J9PA 1FBNA 1QGAA 2YYAA 1W29A 4MV3A 5KDOA 3HPRA 5AKJA 4IMPA 1GDTA 2FX3A 2OT3B 5KYYB 1NJ5A 4FYMA 4NY1A 5JFOA 3ABRB 3NTQA 3OC6A 3MOIA 3IELA 1LKYB 1G5PA 1ZN8A 2JHCA 2P6OA 3A37A 1BVHA 3VPXA 4BU0A 5BPCA 1C3OA 1F2UB 2JAUA 4WQMA 2CFSA 1TTTA 4MV1A 4TL9A 1DIHA 4F5EA 2B4RO 3ZWYA 4CQMD 2IBKA 1DAGA 1ECPA 2EQAA 2GLXA 3G0GA 3NHPA 5G0UA 3RBZA 5ESDA 3AK4A 1TKCA 3ZK7A 5BORA 1T0IA 1JAYA 3K0AB 2NTJA 1I2CA 5K3AA 3PFIA 3EGIA 4I50A 4OHVA 2VPZA 4LHZA 3ZWQA 3CH5A 4IX9A 3LHKA 1XI2A 2B6NA 2W2KB 3K1RB 2D3DA 1A2QA 1UP6A 1C81A 4OLFA 1ND5A 2C4NA 3EBLA 4LZPA 5CB0A 4EIWA 2DWCA 3DC7A 4QHSA 5CIWA 1C7FA 5DCYA 5FPKA 3M1LA 4C7MA 1AURA 1C9NA 3ESRA 4IOJA 1JXAA 1NT2A 2Z1DA 3BX1A 3TNJA 1ZU5A 1NMXA 1M1UA 1NW4A 2YIDA 1AZTA 2HBKA 2ZS7A 1CUWA 4K6MA 1E8NA 1XU7A 2EP5A 1E60A 4YJ2B 4YP3A 2BDTA 4CIDA 4U7PB 2ADFA 3A58B 3DL2A 4R16A 5LQMA 1ZR4A 2B3DA 1IXRA 2KD1A 2H1OA 4BIMA 5KFVA 2OD2A 3RIXA 4TTJA 4F9EA 2GSWA 3F46A 4CN9A 1CX9B 2NACA 4PH5A 2O2JA 1FSPA 1T3ZA 2FJUA 1LK5A 1QHYA 4OHMA 4JUIA 5F33A 3TTWA 3GLFB 1V8ZA 2GA9A 2Q7XA 3QYJA 3A4NA 5HHIA 3RASA 5F7XA 3HVRA 1ZUHA 4LOIA 5TVGA 4A03A 1FZQA 3QU7A 2Q5IA 1H94A 4TV8F 3IEIA 1DFHA 1HLGA 1RI5A 3FMVA 1Z5NA 1G6OA 2WYVA 2ASLA 4I7EA 3SJZA 3W4IA 4PQEA 2WZDA 3RYFB 2ISPA 2B1IA 3LUCA 2IYYA 1Z6AA 4LOKA 4NAUA 4OKNA 5D86A 2CD7A 1YI1A 3R0XA 3T06B 4QUDA 2X13A 4ER0A 1L7OA 3D9QX 3LD9A 2HJVA 3OCWA 4KLHA 2HHWA 5EQJB 3KFXA 3RKUA 3U3OA 1SVKA 2VPWA 2BBSA 4ZAVA 3BJRA 2XYHA 3FSJX 1KY5A 2V65A 2EVWX 4IMIB 4P4GA 4W6ZA 4ZYXA 3AKEA 4Y9DA 1XDWA 4AP5A 4JASB 5JS6A 4HEQA 2IHZA 2W6QA 4ND7A 5LNK1 2QM3A 3UV3A 4CI9A 1TKBA 3EGEA 3VU8A 4DRXB 2CNLA 4ENQA 2CUKA 3GJ3A 1Q2XA 4X7RA 2WMYA 3C6QA 4O2AB 1DCFA 4KXFB 3HN2A 4OMDA 4QVKA 4DMLA 5BSUA 4EJ0A 4I2NA 1SCNE 1YB1A 3DKKA 5B64A 5AKXA 1P0MA 1TVCA 2P65A 3H4MA 2B2NA 3W5DA 2WKRA 2F64A 4C0AC 3QEBZ 3GN1A 1PVQA 4G0YA 4DIBA 1OWPA 4LA4A 2FFAA 5E0KB 3OG9A 4HEA1 4FYHA 3N3AC 4HN2A 2Y2UA 3LYSA 5B2ZA 3V8RA 4BO0A 4O29A 3ZI4A 3ZV3A 1P4SA 4HS4A 4OL9A 5JT1A 4RORA 1QIHA 2GSDA 2HM7A 3WNDA 2E4VA 4D0SA 3W79A 3HXOA 1OFIA 1YK0A 2KZMA 1QTIA 1MCZA 2QENA 4ZRMA 3A9TA 3FPAA 1RHQA 4HGRA 4QASA 4TN5A 3WGYA 1NAIA 5FR1A 3T7AA 2QK4A 3A7DA 2FMQA 4EPRA 4PAQA 1V11A 1TYCA 3VH4A 3DNFA 1C30A 2NZ2A 3LWDA 4LOAA 5BO5A 3OPVA 4DQPA 4LX8A 3UAGA 3H17A 3A9SA 1KVQA 2J07A 3L77A 5HUQA 1DOHA 3V1YA 4PLGA