2YMQA

Chloropropionic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 91
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymqA01
2X4DA 5AHXA 5AKGA 2RARA 3ET4A 2R8XA 1AQ6A 3OCUA 3ZVMA 5AM3A 2PR7A 2P9JA 2YJ6A 2JAOA 5AKXA 5AK4A 2RB5A 3AR2A 2CFRA 1L7PA 1YDFA 1QQ5A 1YNSA 3QX7A 2JARA 4UARA 1TE2A 3IB6A 4UAVA 4KX3A 1SU4A 3P96A 4YCLA 1YV9A 2FI1A 5AVWA 4Y2JA 5FP0A 2OYCA 1WVIA 2HCFA 2FUCA 4NFLA 5AKYA 2CFSA 3NASA 3FVVA 3U7FB 5ALVA 2B8EA 5AI5A 1IWOA 2AMYA 3QGMA 2B1RA 3W5DA 2QLTA 4UM7A 1YJ5A 4UATA 2NO4A 3E58A 2FPRA 3RFUA 5ALIA 3SHQA 4OHFA 1Z4LA 3SLRA 3L0YA 4EEKA 2EARA 2Q4RA 3EPRA 1S2OA 4JB3A 4XE5A 5ALSA 3KOOA 5A3SA 5AM5A 2G06A 4L57A 4O8CA 4Y2RA 2HI0A 2GFHA 3NIWA 3EF1A 1KYTA 5ALYA 5AW0A 3QU2A 3QU9A 2G80A 4UMDA 3DV9A 1ZS9A 5AI0A 5AW1A 3N5KA 3D6JA 5AW9A 4CF5A 3ESQA 4J03A 3WK7A 3QLEA 5ALQA 2C8LA 5AW7A 3WGVA 1F5SA 1XPJA 3NANA 3M9LA 3ZW7A 5E0OA 2WFAA 5ALKA 4F71A 5ALXA 1N8NA 3PCTA 5AI9A 2WF8A 1VJ5A 3QUCA 2BDEA 2C4NA 2B30A 2IOFA 3U7EB 4DW8A 2FEAA 3EWIA 3MPOA 4Y2SA 5AVRA 4DCCA 4Y3UA 3EF0A 1U7PA 5AIAA 1WR8A 3ZVLA 4HYTA 4IG4A 4YIHA 3OPXA 4UASA 2VKQA 2IOFK 3I6BA 4Y2UA 3A1DA 3MMZA 2GMWA 3UMGA 2RAVA 2ZXEA 1NF2A 3ZTWA 3B8EA 4QJBA 5IT0A 5ALPA 1TA0A 3IJ5A 4ZEVA 2O9JA 1Q92A 1Z4JA 1RMTA 2WHEA 3L0CA 1RDFA 3AR4A 2ZOSA 3KZXA 1Z5GA 5A3QA 2HSZA 1O03A 3QXGA 5AW2A 5AI4A 4UU0A 3KC2A 3KD3A 3L8HA 4Y2XA 5AVQA 2G08A 3SKXA 5AVVA 3U7GA 1RPZA 1Z4PX 2DQSA 1L7NA 1Z5UA 2OA0A 3W5BA 3WKDA 2BDUA 2OBBA 1Z4QA 3W5AA 2I6XA 3QUTA 1LVHA 2WF7A 4UMEA 3BWVA 2I7DA 3F9RA 1U02A 3SMVA 1U2TA 5ALOA 4YIKA 2HHLA 3B9BA 1J97A 5ALLA 1CQZA 2IA5A 4BKMA 1U7OA 5AKJA 1RQLA 2G0AA 1Z4OA 1RKQA 3L0BA 1RMYA 2W4MA 2W43A 4BX2A 1EK1A 3QUQA 2AGVA 3QU4A 2R8YA 3FPBA 2ZBDA 1ZD3A 4GIBA 1ZRNA 2MU2A 3DNPA 2YBDA 1ZD2P 2HEGA 5AVYA 4RESA 3QU5A 3KDPA 4L6CA 2HX1A 2FPUA 3E81A 3L7YA 2I33A 3ZTYA 3MC1A 4BEWA 4NWIA 5ALFA 4EELA 1RQNA 5IT4A 3S6JA 4ZEXA 5AW3A 3PDWA 3R4CA 4FE3A 5AVUA 3M1YA 3L8EA 3K1ZA 4GXTA 3AR5A 3ZWKA 4B6JA 3WK6A 4KX5A 5AM2A 5ALNA 5ALTA 4IFTA 2YFYA 4BNDA 3UMCA 2JAUA 1QYIA 2HDOA 3QUBA 3ZU6A 3W5CA 4DWOA 5ALEA 1CR6A 3L1UA 2B1QA 2FPXA 3NRJA 3WK4A 1Y8AA 1X42A 2AH5A 3E8MA 4UMFA 2C88A 5AW8A 2ZBGA 5ALZA 1Z4KA 4KN8A 3A3YA 1Z4MA 5AW6A 4YCMA 4NV0A 2CFTA 3PGLA 3N8GA 1SWWA 2ODAA 2G1AA 2YJ5A 1U2SA 4EENA 2IYEA 2WM8A 2R8ZA 1Q91A 2WF9A 3I76A 3A1CA 4QQFA 3R09A 2PKEA 3ZWDA 4DFDA 4HAIA 2HF2A 3OCZA 5AK6A 3N1UA 3UM9A 1YS9A 1RKUA 1ZJJA 2AUTA 4JDPA 1JUDA 1T5TA 3WK8A 3IRUA 4NAVA 4YGYA 1Z4IA 3OCYA 3A1EA 4AS3A 4I9GA 1ZRMA 2D2VA 3FGOA 1MH9A 2YMQA 3ZUPA 3QYPA 3KBBA 3HLTA 3ESRA 4XPZA 3DDHA 4F72A 2MSNA 3ONNA 1XP5A 3U7HB 3ZI4A 4AS2A 2GO7A 2YY6A 4BBJA 5AESA 5AVTA 2R8EA 2PQ0A 3NUQA 1TJ3A 4Y2PA 5AKIA 3U26A 5AIBA 4UM5A 4FFDA 3AR6A 1SWVA 2P69A 3AR8A 2IOHA 1Z88A 4BX3A 5T41A 2B0CA 3WKEA 2RBKA 4MWOA 4EX7A 4G9BA 3SD7A 5ALWA 5ALJA 2ZBFA 4HGNA 5ALHA 3CNHA 3OCVA 5AKEA 5AM4A 3DAOA 5AICA 3WKAA 1FEZA 2YJ3A 3I28A 3MN1A 4UW9A 1RRCA 5AW4A 1T9ZA 2ZBEA 3ZX5A 2B8JA 3B9RA 2CN1A 5AVZA 2NYVA 4BEVA 3GYGA 4ZEWA 3AR9A 4I9FA 1VJRA 2C9MA 4CF3A 5AKZA 2EATA 5ALUA 1N9KA 2P27A 2FUEA 2W11A 2Q5EA 3VAYA 4Y2VA 3TLMA 5IS2A 2YJ4A 3E84A 3WK9A 3NAMA 4CF4A 3QU7A 2HOQA 3N07A 2MU1A 1RLOA 2YMPA 1L6RA 4RETA 2Q4TA 4OFZA 3CZ4A 4Y2QA 5AK5A 3WK5A 1NNLA 1RKVA 4YCNA 4OCZA 1RLTA 5AI6A 1ZOLA 5AI8A 2WF6A 5AM0A 2FDRA 1XVIA 3L5KA 2B82A 1ZD5A 4OD0A 4EX6A 5AVSA 3UMBA 5AM1A 3ET5A 1TJ4A 5ALRA 2FPSA 2I55A 3PGVA 2G07A 1L7MA 1S8OA 1L8LA 4BX0A 4XQ0A 3L8GA 5AKHA 4PNHA 2BY4A 2FPWA 1NRWA 2O2XA 1QQ6A 3AR7A 2P11A 1RC8A 5ALDA 4UMVA 1YMQA 1QH9A 2ZG6A 4Y2YA 5JJBA 4UU1A 2HF7A 1L7OA 5A3RA 3ZX4A 3U13A 3FPSA 3ZVNA 3NALA 4XOUA 4Y2TA 3L8FA 1T5SA 3L1VA 2EAUA 4BYGA 1WZCA 1K1EA 4KNWA 4J2TA 3OTQA 5AKLA 1O08A 1L8OA 4HGOA 4YH1A 5AVXA 4UAUA 1PW5A 2YMMA 4KYTA 4H1WA 1LTQA 3OCXA 3SKYA 3QNMA 4C4TA 4C4RA 1J8DA 4E88A 4KNVA 5AK3A 3BA6A 1WPGA 3AR3A 4AP9A 1ZD4A 2GHQA 3OCWA 4EZEA 4CNQA 4BNDB 2OM6A 4MUMA 3FZQA 3N28A 1TJ5A 2C8KA 3U19A 3I1YA 4HGPA 2QYHA 2HO4A 2NO5A 3HYCA 2YMLA 2G09A 3WGUA 3WKBA 3SF0A 4HGRA 3RF6A 1RLMA 4CE6A 1RMQA 4FYPA 4L6AA 5AKKA 4G63A 5AW5A 2GHTA 1QQ7A 2YN4A 1Z4NA 5ALGA 3WKCA 4HGQA 2I34A 3FM9A 1VFPA 2JAWA 4C4SA 3R9KA 4NABA 2I54A 2WF5A 2JGAA 1EK2A 5ALMA 3ED5A 3J7TA
chains in the Genus database with same CATH superfamily
4ZHSA 1LSJA 1Q0TA 5IAEA 5JNWA 1UWVA 3OQ6A 1AQ6A 3D8SA 2VA8A 1R0KA 2POCA 3BRSA 1Q7TA 5KHOC 3A1NA 2OYRA 4YDHB 4QXMA 1DTWA 4IX1A 3JYLA 3NHLA 2RH8A 1U94A 4WRRA 2OVBA 1LB2B 3ANNA 4RPIA 3UH0A 5SZHB 4LJAA 5DULA 1MQ3A 1GG5A 1SA0A 2C5EA 4NG5A 3E5HA 4KQ2A 2PH1A 3FPCA 1QRRA 4UU8A 4D44A 1C8BA 1AS3A 1TJYA 1KTIA 4WV3A 3JVVA 3NBXX 3OEHD 4QELA 2AKAB 3A4YA 3H11B 4GKJB 1PZMA 1AQYA 1GPNA 2JRLA 1DKLA 1Z3IX 2Y76A 3BB4A 3KJFA 3F2VA 3AOEC 3PHLA 3I8SA 8ICKA 5F3DA 2OYCA 1ZRHA 4M3NA 1K75A 3ZKWB 2JIPA 1OB2A 4HO1X 4HXGA 1GA4A 1INLA 4QO7A 4X1YA 1JF8A 1M1NA 2BL4A 1SKSA 3B60A 3LKBA 5AKYA 2EAPA 3ETGA 1NBMA 3ESYA 4Q3KA 4AICA 1N6KA 3N75A 3OJCA 4KQKA 2ZQ5A 4IQ8A 4GZ5A 5AI5A 1UIRA 4Q7KA 3OOWA 3LQYA 3K6SA 1ISMA 3BIXA 3DWEX 5DB9A 1XBTA 2JCXA 2QRUA 2MYPA 3E22B 3OO0A 2QUIA 2QLTA 4NMLA 1DE0A 4RA6A 4ZANA 3AOGA 3CE6A 3R6LA 2WJGA 3VNRA 4MFCA 5KQRA 2FZCA 5J2IA 2OAP1 3KSMA 4UATA 1QH8B 2ZRPA 3MUOA 4G8DA 5CX4A 3WWPA 4D4HA 2Y0PA 4GMKA 4DA6A 4DV2B 1NRIA 3HKEA 4S0ZA 5EE5B 1Q3VA 1TM4E 2FQYA 4C4AA 5J23A 4F2SA 4E5NA 3OT4A 1L5KA 2X6QA 3FUVA 2KICA 2GEJA 2W9BA 4KLGA 4O9MA 2H59A 3C3JA 2RHFA 1TW3A 4Y1FA 1W88A 3F6CA 3LWNA 1ZESA 4LVUA 3E8XA 2C57A 4PPGA 2G06A 2X5OA 1Z26A 1QH8A 3FN4A 3NAZA 4GYWA 4KDEA 3JWJA 4OH7A 2FEMA 2X1HA 2P2YA 1AGYA 1JG2A 2X40A 4MYCA 4OIFA 3ZU5A 2EGHA 2JGIA 4NYJQ 4Q9AA 3T1TA 1EUDA 4MA0A 4FGWA 4CIYA 4NC9A 4TS9A 1ZS9A 3CZ9A 3GK3A 4L5BA 4QRHA 2FR8C 5K4AA 4NMXB 4LF6B 2NPOA 3PC3A 1GGEA 4JHXA 4LECA 3HKDB 4IVNA 4NLKA 1K7FB 4MO2A 1FW6A 2OT3B 2Y67A 3AEUA 3QV1A 4GMHA 3K9HA 2FWIA 3NBAA 3ZY2A 4BASA 3THXA 4F7WA 5AW7A 1JZQA 2RGYA 3F7TA 1FQKA 5SYAA 3M3DA 1HLPA 1JVBA 1W8IA 4C4OA 1KI1A 5LQDA 2UU9B 1JU9A 3WXBA 1AA9A 1KJZA 1IRIA 5CYPA 2OGTA 3VZCA 5KG4A 3EPIA 2NSLA 4CN8A 4B6OA 2Q6OA 3E0QA 1WLYA 4X8HA 4BX9A 3GQCA 4K87A 1N2CE 4XPIB 1S0UA 1XRPA 1DUSA 2WJ6A 3I6IA 4EKEA 1LPBB 2D7JA 5KFIA 3EWIA 1WVMA 3MPOA 4G25A 3WFZA 4P1ZA 1Q8KA 4CEHA 4ZHQB 1RP1A 1AZTA 1IB0A 2A5JA 2FV8A 1TTHA 3UWPA 1R9MA 3T94A 3GFSA 2FZVA 5FOUA 1IEVA 2E4ZA 4ER3A 5HHIA 1HJPA 4K1LA 2DB3A 1PJLA 1B43A 3G8CA 5IBCA 3ZLVA 5HG0A 3QIAA 4US1R 3A31A 5B1DA 2TECE 1JEOA 4PZ0A 1MBZA 3BMCA 4IWXA 1YR7A 2PX6A 1ZC3A 2MYTA 2V5UA 5DN6D 3BIJA 1ZHOA 5ES4B 5EYPA 1I0ZA 2I6SA 3C3XA 2WTFA 3M5WA 4XYMA 3RJTA 1KC3A 5FUXA 4DV3B 4DRZA 2AK2A 4JEHA 4Y8VA 4U2KA 1F06A 2X3FA 2RG1A 2AG1A 4ENSA 1LD3A 3EMDA 1G6Q1 1SPXA 3NH6A 3PPWA 4Q9LA 3DEEA 2XGOA 7ICNA 2X0RA 4YYZA 2GLXA 1QO0A 1PZEA 4MARA 4XXHA 1H6CA 4QXPA 4E5KA 3JAWA 3NR2A 1NFFA 2B6GA 3PFKA 3TE6A 4NJ8A 2F7SA 2YIDA 3OFJA 3OLYA 3B48A 2HHQA 3AQEA 5CJ7A 2I2XB 3EJWA 1I4EB 3OIWA 5CW2A 5A3VA 4DC9A 4YQEA 1ZQNA 2B6NA 2LCIA 2QW1A 3EA0A 3G82C 1JB1A 1BCSB 4QRDA 1SU6A 3V6KA 2W70A 4FZ5A 2JEZA 3UF0A 3QEBZ 3N2KA 2Y4NA 5P21A 2GH1A 1C3JA 1ZGZA 4TLCA 5KYYB 4B7ZA 1QAQA 5DB8A 4B40A 3SI7A 1YVPA 5K05A 2AKEA 3GMTA 4G3IA 1CEZA 1RQPA 5GJVC 2GDJA 2BDUA 4H31A 3P52A 3C48A 4IS2A 4K8RB 1Y8ZA 5KFBA 1AZWA 3ICQB 4CG1A 3T6KA 2WMOB 5KT5A 2HMYB 3UGKA 4BNIA 1QZUA 3ZHYA 4CMAA 3GIMA 4O2BA 1Q84A 5ICMA 5F5XA 3V00A 1DAPA 4OJQA 4R63A 1U2TA 3EPPA 4PFQA 2RP5A 3VC1A 1LK0A 5IF3A 2PXHA 4WCVA 4HZGA 3A6FA 3IE2A 2C2MA 1QFSA 1ZH4A 2DOKA 3CQ9A 1L0BA 1UT6A 4ND4A 4U2BA 5GAJA 4KYUA 4F50A 2J6SA 4O2BB 4ZVPA 1BJRE 5G1PA 3L7MA 5FI1B 2H08A 4EL0A 3HS3A 5KG0A 1FVFA 4LSGA 1C7IA 4L0MA 4OXNA 4PZYA 4FFNA 2WKQA 3C74A 3EUAA 2CZGA 5JG7A 4WFQA 5CVCA 5K2MA 3HPOA 1MUUA 1FZTA 4YCJA 5EJ2A 3DOUA 1K8QA 1P1BA 2GD2A 5KFVA 4PPYA 3K0EA 1CDDA 1UWKA 4Z2YA 4Q8FA 4CT4B 4EGAA 3COYA 1OHHD 3RRBA 1VKZA 4E7PA 2VYVD 2ZBRA 1E9FA 3JALB 1CQJB 4HRXA 4ND1A 2C3PA 4WLNA 3UANA 5K03A 2JGJA 4QOJA 1X0VA 3ZIAD 3F6RA 4BNFA 3BE8A 4AX8A 3JS5A 1VYUA 3VNQA 1KJJA 2FR8A 3N0RA 3GL9A 3R6GA 2W0SA 4RPXA 5EP1A 1LPAB 3TOZA 4J7AA 2HHUA 1OB5A 2QRVA 4X66B 3QKRA 1CUHA 4P38A 5ED4A 3L4SO 5ALFA 1CUCA 3GGOA 4O5AA 4QJ5A 4MIEA 5CB4F 3FOZA 3Q8KA 3KT0A 1LCIA 3ROEA 3ERCA 3BE4A 1E2LA 4MYSA 1DV2A 2RSLA 1U0EA 2AMVA 1G2PA 1YZVA 4PAWA 5K6RA 2FPPB 3BUSA 1YL5A 1L3IA 1UXKA 4DHWA 2EGUA 1DV1A 1J9ZA 2OV3A 3F4LA 3PL5A 3F1LA 5TPWB 4KKXB 3TOXA 2D1FA 3AJRA 1ICEA 3W5VA 1QH0A 1YR6A 3ZWNA 2OUKA 3RRFA 3EQ2A 2VIXA 1K7XB 1A82A 2X5KO 3NVMB 1H2XA 3SI8A 4WCFB 3AB3A 3EQZA 1GT6A 4LF4B 1P5RA 2JGMA 4LW8A 1TVKB 1DIHA 4RT3A 2JAUA 1GRQA 2DBVO 3ENKA 4ZRMA 2HDOA 4Z9XA 3RYFA 3KQLA 3W5CA 4RKWA 4OI4A 3DAYA 4Z0HO 4HH4A 3DLBA 4AF6A 3CJTA 4RVOA 5ENZA 3I53A 3NRJA 1ZK0A 1IEWA 1IHPA 3DMTA 3WGTA 2H85A 3PJEA 1JA9A 1VRVA 4IMIB 1UOPA 4Y98A 5I6DA 5HNKA 4IO1A 3HSSA 1G20E 4OVKA 1MENA 1Z4MA 1XRMA 2BM9A 3FIJA 4YCMA 1G2OA 5L1LA 5AW6A 3V8RA 2O07A 1LDMA 1QNFA 2ZJ1A 1IC6A 3CTMA 3EUWA 3Q3VA 1Y6JA 4N49A 1ZY2A 9ICPA 3ICOA 4OXYA 2XEDA 2XH8A 3IIEA 3ZGLA 3IUPA 4GGPA 3QPAA 3ZHZA 5CDSA 3ANMA 3HBFA 3W06A 3VJRA 3PUZA 4KSYA 3D7MA 5DLQC 4WVFA 2Q5HA 4MRMA 3F5DA 2O7RA 5JJ5A 2OHOA 1UA1A 3JCZA 1GKUB 3K35A 3PNOA 3SNHA 3O2NA 3OZAA 2V7EA 1T3NA 3O7MA 1P73A 4X8LA 4KR0A 3RU2A 5KFSA 1RXSA 4N5IX 4YAWA 2WJ3A 1R9JA 3RE1A 2W54A 1Q57A 1UXJA 5B64A 1XMSA 2VDQB 2CMFA 5KFYA 2D8AA 3CURA 3EDMA 5DCLA 4JT9A 1Q21A 4OGFA 4P7KA 1GZUA 4B3SB 5JTIA 2DL0A 2HHSA 2BI8A 2UVPB 1U5CA 3ORFA 4U3JB 2IT1A 5JSKA 3A10A 4A2PA 2O2IA 3HDTA 4W5RA 5LA6B 5TB5A 3WK8A 4OYRA 4M1SA 1P2UA 4P5DA 2FUG6 4YGYA 2R7AA 4RU9A 3TSWA 3ZY6A 3SY8A 4DMGA 5I9BA 4PTLA 2D2VA 5SY4A 4DDWA 2PFNA 5JCZA 4OUKX 5G40A 4DEXA 2NU9A 3KBBA 1G3MA 3D64A 4FHGA 1Q83A 1L4EA 3HL0A 1Z9BA 2FXIA 1FRQA 4GI1A 1KQNA 5LYJF 3U7HB 1D8AA 1T91A 4UHEA 3HZZA 2BI7A 4WXEA 3MQ4A 3ILXA 4DPMA 3R24A 1R16A 1XNSA 1NASA 3C3AA 5FUWA 2GF0A 1XZ8A 3UKJA 2F48A 1K6EA 5EIWA 3ROZA 4BN4A 2BGUA 2NU9B 1EFRA 1NVXQ 1FIQA 1U2PA 4FYIA 4G09A 4B7CA 2IKQA 3ME5A 5A5FA 3DDZX 2WSMA 2GEUA 4FPXA 1ZJ5A 1M10A 4M9CA 4MMYB 2YWRA 3T7RA 3OPYA 3VPXA 3ZDQA 1SR8A 1ZMOA 3L7LA 4N0QA 5C5EA 1KJWA 4IJUA 3R7SA 1SZPA 1QGUA 2KFZA 1WZIA 2RBKA 1R4MA 1ZH2A 2CY0A 3CIFA 4ZDJA 2YJGA 1M73E 4MVJF 3RTEA 2PK3A 5MHTA 4C7OA 1DJMA 4YMLA 4AKSA 2P4QA 3TMYA 3WSWA 1JWBB 5IDWA 5CVDA 5EP3A 4MHTA 2ROQA 5GOZA 4N3AA 4P0PB 1VG8A 2R8PA 3LMKA 5AICA 5KNIA 4MW0A 4TRNA 5FTMA 2O8EB 5KAMA 4MINA 3FSRA 1YHNA 4HWOA 3A9CA 5DG7A 3G6YA 1WMDA 2V0CA 3AT1A 1XRLA 5EXTA 4D79A 4FOSA 1FJGB 1E2MA 2HBYA 3ZW8A 3D2BA 3GFTA 4F4UA 2VHYA 1DT3A 1KQOA 1M74A 2C9CA 3WYFA 2C7OA 2OZEA 3N8HA 4I2FA 4UHBA 1DKRA 3F74A 1B8NA 1JHOA 1FXWA 1FS4A 1P7PA 3NC1C 5CLHA 2O05A 3FSGD 4PXAA 2J41A 5CRIA 1VHTA 3RIEA 3N70A 5D3QA 3F2BA 1X0XA 3ER6A 3WLMA 3MHTA 4ZVKA 4C4ZA 4FWTA 1ARZA 1CFZA 1N1GA 3PFCA 4LYAA 3IUQA 2HMXA 2A30A 4R2HA 1ISSA 5H81A 1BU8A 1TT7A 4FKBA 3OTHA 9ICLA 1JLLA 2ADFA 3ND9A 4ARAA 2D06A 5EJ5A 1UC9A 4JR2A 5FBZA 1KQPA 2VF8A 3B5IA 2V8BA 5HA5A 2VJAA 2WVGA 1BG6A 4JX9A 4NLGA 5BW8A 2D6FA 1WDWB 2MINB 2WB4A 2CVOA 5G4KA 1SPBS 2EJUA 3JPQA 1F8GA 3EEBA 2NVBA 3UHOA 1IBKB 2NXEA 1NR1A 3FCCA 4O2BF 3FHJA 3GJQA 3UOAB 621PA 3AL0C 1KOJA 2FJ0A 3IHWA 3B9QA 4WHMA 2RB4A 3IKVA 1ONSA 5HK8A 2JHDA 1ADFA 2BFPA 2G9RA 2XVXA 1BE8A 4HDRB 1XDUA 4OK6A 2WZDA 2C9DA 4JKOA 1U4OA 3V6JA 2DBZA 2H2IA 3G88A 3LPMA 1PK1B 1E7SA 3MS7A 3SQIA 1OX4B 4MQEA 4V0MA 4B82A 2GTPA 2WT4A 4NE2A 4WZBE 2HGZA 3SCZA 4UNQA 1EGAA 2AL7A 3G59A 5EP4A 5HJ2A 1NULA 1SURA 2ERXA 3RB6A 1JQ5A 5L95A 3JQGB 3T3FA 1FVXA 3UJ8A 1DQSA 2YKGA 3UVEA 3Q7IA 1TKRA 4F60A 1Q0HA 1TIBA 2IQ5A 4F8RA 2N47A 1PGQA 1NBEA 4CCAA 1U3UA 4TKLA 3Q11A 2JLVA 1FFBA 1L7OA 5TDHA 4P3XA 2JD1A 4B9TA 3PR5B 1W5EA 4Q9KA 1MFPA 1S3FA 2OV1A 1IZZA 3BRCA 5J9FA 4PF1A 1E2QA 3M4ZA 4OP1A 4AO6A 5AUPB 5J8YA 2P9BA 4Y2TA 1QAMA 2J3JA 2BFAA 2PU5A 2CF5A 1RM0A 3EXHC 3P9PA 5U4QA 3QKIA 1OZFA 4ZQEA 3TR6A 3ZV5A 1EYZA 1QGDA 4US9A 1S0MA 2FXVA 2RHOA 4FYMA 4JYMA 5CVEA 3S8MA 2E48A 1N2XA 1KR2A 4WKCA 3CR8A 3U3ZA 4P7GA 4CDRA 1ZAYA 4X94A 3IKLA 5IARA 1J1UA 1BS1A 4TMVA 3QMWA 3HPQA 3KKAA 1F8FA 4KMSA 4E88A 1XTJA 1HA3A 4II3A 2VYFA 2Q3CA 1DXYA 2BZ1A 2VSOA 3AINA 4TV9B 2KLHA 1KS2A 1LH0A 2ZJ4A 3IP7A 2IXGA 1YCFA 3K4PA 4RWEA 1NXQA 4EF6A 3FZYA 5KJ6A 1HDOA 4LJ6A 4BV8A 3GLSA 2WTNA 2BEWA 3U40A 3GJYA 1OXJA 2H5XA 3HNRA 3HKDA 3PD0A 1W76A 4BJHB 4DCUA 5HF6A 3VC3A 3DUFA 3CVOA 3HO1A 3HO6A 3U09A 4MUXA 2AQKA 2JLQA 4OB7A 4RFSB 4WA8A 2G82A 5IJAA 3P4XA 4HGPA 4NFYA 5HTOA 2XTMA 3PR4A 3TLYA 4DG5A 2PG3A 4H1TA 3QVUA 3UHAA 1N5JA 2HGSA 3DZCA 3WKBA 1FF9A 3ADBA 5IMSA 4L74A 2IZOA 5TY0A 2BCVA 2UVRA 2BSQA 3CINA 2GKSA 1FFYA 2GRUA 2FSSA 3CLRC 1H23A 4XM2A 2NX2A 4C2BA 4A73A 2AMLA 2Q3HA 1R8YA 4ERXA 4IRCA 2HA7A 2NXNA 3CZCA 4HYEA 4W6QA 5A5GA 5ARDA 1FU4A 3A3KA 4FS2A 4YJHA 1BNPA 1WXGA 4B9AA 3R9KA 4ALJA 4EHAA 5H80A 2ATLA 1QVRA 4MLCA 1GAWA 1TYAE 4X3CA 1OKKA 3C0KA 1FDTA 5F3WB 1K0FA 1NIJA 1PK9A 5EUMA 4AQDA 5D5HA 5J2JA 1ISFA 1YR1A 5I7WA 3TW0A 1DAIA 2Z8YM 5L8VA 4G41A 3FUUA 2NO7A 3OOSA 1ST3A 1G8JA 8ICEA 1WCLA 4EJ6A 5B4VA 2NU8A 5E9AA 2JAOA 4GYKA 4MQMA 4P58A 3MBOA 4JFAA 4X92A 5IEBA 5JADA 1N5WA 2NSHA 1H9AA 4HH0A 3FRJA 4WXHA 8ICWA 1IHXA 1O77A 1ZMXA 5HUHA 4DA0A 1HO3A 1EDEA 1QQ5A 3JQDA 1PU2A 3HY4A 4GXJA 4FC6A 1NW3A 2HPVA 4H17A 4ZT3A 3FLEA 4HR7A 4P4SB 3CR3C 3OP1A 3GV7B 1E8DA 4TXMA 1PWHA 1ZG3A 4Y2JA 2R8HA 3CH5A 2RHLA 1S0OA 1F2TB 1VRWA 3LK7A 5AJTA 5EWLB 1MJ5A 5SYMA 3DLHA 3PXCX 4FMPA 1D8YA 2A3RA 3NW9A 1KAMA 4M38A 1ZA1A 2P9FA 4M0PA 4PCLA 1PHPA 2VPTA 2Y66A 2OXTA 4PPXA 1IQPA 4ROSA 4AY5A 2H2GA 4CMCA 2ZRNA 2WU8A 3N2KB 2RH4A 3I9JA 4F4FA 1YRBA 4TKUB 3NYRA 1PT6A 1G7CA 2X86A 4IMRA 2V1UA 3DF9A 1ZHFA 4GOND 2WAQC 1G3QA 3O38A 1TK9A 1P62B 4MVJH 4JSYA 1VM6A 1RYRA 1V1RB 2H52A 3EJ6A 4WOCA 1YOVA 3UQ2A 1XAGA 2FPRA 3MTDA 3IVGA 1U48A 1U6IA 2QL5A 3GLIE 2AXNA 3RLIA 3ENWA 5CT8A 3RFUA 3T52A 4PNPA 3S2ZA 3V4ZA 3NDBB 3T41A 4QDZA 4WACA 3DMDA 1ODKA 4D9IA 1C0EA 2RHHA 2AR9A 2ZRDA 3MTBA 2BELA 4N6NA 4IHJA 5EXPA 1F6DA 3VSEA 3BFVA 1C1DB 4M1TA 1KMHA 4FW8A 3OKCA 5IABA 1QC5B 4P86A 2Q3EA 3FNRA 4DNXA 1W36D 4TUQA 2V4RA 1W4RA 2H29A 4LYFA 1D6JA 2DQYA 3OKPA 3X43A 3VYSB 3DV9A 4NF2A 5BXQC 1XTRA 5E6RA 3PGKA 3KALA 1N0WA 3H86A 1CNEA 1CUZA 4YRJA 4C05A 5BVHA 3JRNA 3ESQA 3NM6B 5KC9A 3VZQA 4OO3A 2VWHA 3D0QA 3QLEA 1NI3A 3RB3A 2ECPA 2G5GX 4RO0A 3AC0A 5CLGA 4CTJA 3MELA 1GPYA 2C5GA 2XZPA 2YCLA 2L18A 1F5SA 3D7SA 3MWGA 5DHPA 3T5KA 2DUNA 2JD2A 4QZHA 2CDRA 1NJXA 4B4DA 4DLYA 4FEGA 2MSCB 2VT6A 3EFEA 4DJAA 5E6RB 2JFXA 2QARB 3BREA 1OUQA 1XI2A 3LVRE 4WK0B 3E23A 4W5QA 2K2WA 2W3RA 3O9MA 5DQGA 3ANLA 3T35A 3U4HA 2ZZNA 1I7PA 3TGPA 2C7RA 1C14A 2YZMA 2IV3A 5KYXA 2YZKA 4N5DA 3KAKA 1OH6A 2WD8A 4ENVA 2QQEA 5UKDA 2P5SA 4HP8A 2EZZA 2WHQA 4TTPA 5MFPA 2C54A 2XMRA 5DGCA 4KWEA 1FUYB 3W78A 3BE5A 1PT7A 2CGEA 3RTAA 2E5WA 1S0NA 4BJ3A 3CBQA 4ARZB 4F46A 4EAAA 2Z7JA 2A1JA 1NVEA 1FBTA 1OPXA 2WJHA 2K4MA 2F9FA 4HKTA 4MIYA 5CXSA 3WDKA 4CL2A 2JEGA 2X14A 3EQ9A 4OJMX 3UMGA 3LBAA 3EAQA 1U1EA 1TC2A 4L4RA 5BMVA 1TVAA 3JPTA 1G63A 3B3FA 3CSSA 4HYYA 4GG1A 3FNIA 4I1YA 2E8NA 2NYUA 2VNIA 2GK6A 1GUYA 8ICAA 1D8BA 3A06A 3OQOA 3EQ6A 3F4KA 4MDFA 1IG0A 4XA5A 3SBXA 3O1JC 2PLFA 3BQ2A 3SJUA 4BQOA 2EQ5A 4X7MA 2E8MA 1C7ZA 3FOAA 1E60A 2FW0A 4JEUA 3L4EA 4D4LA 3EGXA 4GEKA 3MCTA 3DLAA 3IOYA 4M83A 5ANRB 1LDNA 1Q15A 1EWKA 4CHTA 4YV1A 1HT0A 4WBXC 1V6SA 1IH8A 4NMWA 1SBQA 3OIFA 1KZ1A 3Q15C 4M53A 3TAHA 4ATNA 4Q3NA 4K2AA 5BY2A 2IFTA 1J2UA 2G7ZA 1GNLA 4WERA 5HFAA 1YHZA 3BFXA 1L7NA 2OA0A 2W6MA 2Q27A 1XV5A 3WKDA 1Y5MA 1T8RA 1TT5A 4LY9A 1Y82A 4C0SA 2XVYA 5DWVA 3QUTA 3HMQA 4HAUA 5KSPA 3HA5A 3OAAD 7ICOA 1GTRA 2HV9A 3P2KA 5AOVA 3GRRA 3SV3A 3E9RA 5DXJA 4INAA 9LDBA 4D6XA 5I3CA 1NX9A 2GEKA 3F9RA 3PC8A 3WLNA 2CRXA 1L5HA 1GPH1 4IOKA 1EG7A 1V3VA 3Q8LA 4LDQA 1KAOA 3GRCA 1G41A 2VEDA 2IA5A 2XMQA 1VHLA 3ZIDA 5HKKD 5DOVA 1B8VA 3I04M 2PGJA 4O4JB 4WSOA 1U7OA 2FQQA 3NORA 1D4FA 5LIPA 1M2GA 1G17A 2R8RA 2R8IA 4X84A 1Q0PA 3LGXA 4BV3A 5DI3A 1Q1EA 2GXAA 5HQ3A 5GZ1A 1UQUA 1TPYA 1GXSB 3ADPA 3BKXA 1JU3A 4TZKA 5DSZA 4NYIQ 2ZYWX 1QHHB 4UPVA 3R7DA 4NCJA 4TQUS 5KOIA 1JS1X 2YBDA 2AOTA 3OU6A 1EB8A 4DCNA 3SZMA 1R0LA 2FE9A 1E20A 4OP3A 3MABA 2ZP1A 4IOJA 4TTQA 1ZGHA 2LV8A 3B3GA 3S55A 3PZBA 2VCHA 1TF7A 13PKA 4RYLA 3TSCA 1VJ0A 1L1RA 4Y6GB 1DAGA 3QBJA 4EGCB 1GPMA 4CUKA 4F3YA 1G5FA 1U28A 1D8TA 4NWIA 2V7UA 3A4LA 3W8NA 4BEWA 4P4OA 3GUCA 3V48A 4YX9A 5DISB 5EIBC 4C03A 4LZGA 1HDYA 2Y1KA 2JLZA 3K09C 2OVFA 1KSJA 4LCBA 1KZGB 2ZUWA 4IL5A 5ULLA 3IA7A 4EF5A 2VDPB 1ED1A 3A7EA 5LZ9A 2UYQA 2P9YA 4YECA 3QJYA 2P77A 5HS4A 4JH0A 3UXPA 1QYWA 5H16A 1KQQA 2XICA 5DE3A 3DHNA 2BGMA 5JARA 1D2GA 4A0RA 3ZOKA 1D0SA 1OIXA 3KOYA 4F2RA 4C3VA 4EEYA 4D80A 1WB6A 4AJ1A 2VSYA 3NHWA 1YJAA 2H7XA 2ZRIA 1A71A 4L8GA 2GWHA 5TC4A 1U7XA 5D51S 5ERGB 4CUZA 4DWVA 4IJQA 4LJKA 1RXIA 1T2EA 2Q9BA 1PSDA 2Z4TA 2QX9A 4RH0A 5FQOA 5BSKA 1NSFA 2W6NA 2G5HB 4DQSA 2L69A 1MC1A 1SOVA 4XUCA 4ZT2A 1YZ7A 4AJ4A 3W0LB 1GOTA 1X1CA 4RHCA 3CYMA 2XWSA 3IJRA 4HTFB 1D2RA 3B20A 4LRQA 5BT8A 8MHTA 2XY7A 1BYUA 1NL3A 1XN1A 4KDFA 4KWHA 4NU8X 1QE5A 4AMYA 4OJPA 3JQAA 1JR3E 4B80A 4DBLC 3ZVKA 2YJ5A 4WQMA 3JD1A 5JJCA 4OJKA 3JQAD 4J7UA 4PTZA 4QTYA 4JBNA 4HQNA 1W5FA 4C1NA 3OT1A 4LJSA 4DR4B 1QK4A 3T5LA 3H40A 4HX9A 4KBYA 4PANA 1O54A 4N1AA 2J5QA 4I2DA 5CVJA 5J4HA 1Q17A 5IC4A 3GDHA 5E7MA 3WBJA 4Y9RA 4UAZA 4L7VA 1DRGA 9ICHA 2HF2A 4A5OA 5LL6P 3RAEC 3OZEA 1T8WA 1YQUA 1IN5A 3M7IA 3P9KA 4FUTA 1FRZA 4KYVA 3B51X 3VDNB 1WBDA 3BICA 1XZDA 4OLFA 1DPGA 1OFTA 1RKUA 3HJRA 3LH5A 1HPLA 2R7LA 4OHWA 4C04A 3GLHE 2UUOA 3E3AA 2OAEA 1VYHA 4CBVA 2BP7A 1QX4A 5C8YB 1JUDA 8ICOA 1M8JA 1U2EA 4ML3A 2W6JD 3Q7SA 2QKYA 4KR7A 5TXGA 1EXNA 2C3UA 3GGDA 5A9SB 3VGJA 1KEEA 2FMSA 2H4HA 1W35A 2N1MA 2ETXA 4KEAA 3O9ZA 2P1ZA 1NJYA 3T7DA 1BH6A 1ECJA 1TFUA 1LY1A 3AW9A 2FMUA 4G5YA 1D2NA 4TMYA 3DDHA 2P5YA 5KFFA 3IEUA 5DYNA 3V4OA 4HLUA 2JJQA 1XL1A 3VDQA 1XEWX 1XNJA 3KKAC 1M34B 3OH8A 2XCIA 3ODPA 4BNVA 1LK5A 4MW9A 1PO7A 3EZGA 3FTCA 3JYNA 1EVLA 3U26A 2JGLA 2WJ4A 3EGVA 2X0EA 4BWJA 2I4IA 2XUDA 1RYDA 5KFHA 2QYTA 3WO1A 4DO9A 2BCUA 3AR8A 4Q1EA 1JEQA 2O2CA 5LBIA 1KERA 3WMRA 5JAQA 3WADA 1U9YA 2VUIB 1IM5A 3GC6A 2GEBA 3LY9A 4OQPA 5LB2A 1DRVA 3OOEA 3V1TC 2LKCA 8ICIA 2ZSJA 2CVPA 3JZMA 1OH7A 4ZVLA 3E3OA 1CS4C 2G1JA 4NMHA 2R4UA 4ZI7F 3KT6A 2J3KA 4JLOA 5J2TB 3NWEA 4CIVA 4NBLA 2ZBFA 1WXDA 3QWIA 1I7SB 2ZAYA 3X1DA 4EFMA 2O0LA 5CA7A 3TJZA 1RVV1 2GCGA 2PYIA 3TUIC 1CZLA 3UBMA 2WYOA 5TQ0A 4CM8B 2QN9A 3HA2A 2WFZA 2FEWB 1TCVA 3OFKA 2X9NA 2VJCA 2IYOA 5ESWA 3H5AA 3AEUB 4HY3A 2ZBEA 4D2IA 4YT4A 2AOUA 2B8JA 3A32A 3IHLA 1HKHA 3PV8A 2ZB2A 2I2AA 3PGJA 4R1QA 3V8PA 1WPQA 2OCDA 3QPDA 3ZJVA 1RG6A 3K1YA 4WZAE 1Q2XA 2VZLA 1PT9A 4KO2S 1FTYA 1W94A 4BEVA 2QUAA 3AR9A 1KVRA 3EGWA 4Y9DA 3TM5A 4OQZA 2A88A 1YZKA 1GQSA 1P39A 1X15A 2B1GA 2BFEA 2YUTA 3I1FA 2KKPA 2ZUCA 2H63A 3QSYA 2JHFA 4FT4A 2I22A 3R6DA 4BFXA 4C0QC 2GOLA 1X19A 2ZE6A 3UO8B 4F4CA 4HZUB 1QSGA 3BQNB 4KQIA 4QIHA 1C7RA 3P9XA 1W47A 5D6OA 3PXBA 3R6TA 4UULA 5T4HA 3ROFA 1E77A 2KLBA 3PEYA 2B4AA 3EVZA 2KWIA 3PR3A 4GOOD 2JLUA 1GQFA 2BEUA 4BRZA 1QV6A 2YMPA 4BEJA 1L6RA 3MFQA 4IR7A 5K3SA 4AROA 4M0DA 1CV2A 1JEAA 3COPA 3SEFA 5E1DA 1NNLA 2PZGA 3BGOS 4FZJA 1Z63A 4BZPA 1XRJA 2J30A 1K92A 5AM0A 1W75A 3DEHA 4EKYA 1L7RA 2B82A 2VAPA 3D54D 4DSUA 3D6HA 3LRTA 5FI5A 4RD1A 1AO0A 2RGXA 3MWDA 1BTOA 2PAFA 4O2AF 3KJEA 4N5LA 3RJZA 4ZMBA 3OCJA 5ALRA 721PA 2QZJA 4A0GA 4AS1A 1G2QA 1IXRA 2BWJA 4IDEA 1II9A 2FWBA 4RKYA 1C8KA 1KQFA 1ISJA 3HVKA 3R5SA 5DIZA 1P0CA 3SJCA 3DZDA 4ELVA 4AMBA 3JAWB 2R18A 1NJZA 3TD9A 2ZM5A 2FN4A 3Q8SB 4P4SA 1FFXB 3MJTA 4GP9A 4X64B 3PGA1 4IF6A 3EW7A 3QF4A 4JL8A 1HOXA 1DP4A 3HLYA 5GM2A 1AQIA 3LI2A 5T6BA 1VJGA 1J07A 1NP3A 2WG2A 1C0KA 1E4OA 1QR2A 3NGLA 1WTAA 2X2FA 3MS4A 3RW9A 2WQ6A 3CLTD 3GZ4A 5KAFU 4NHOA 2RK6A 1KO5A 4QZAA 3B2QA 5D5PA 4DWWA 4IQ0A 1KH3A 3NTXA 5DHAA 3CVXA 2A33A 3WMWA 5ILGA 1E6LA 2CCGA 2KJQA 5FUQA 3A2KA 4FDLA 1JE1A 3H2YA 4HRVA 1KI9A 3I5YA 4PLHA 2VF7A 2FPOA 2C2DA 3PW0A 3L8FA 2CYAA 3L1VA 1CG6A 1I9CA 3TFQA 3HWRA 2I1WA 3G0IA 3OZTA 5GTDA 2REQB 2D5IA 3FAZA 2IPOA 4P93A 1P7VA 1ZL0A 1IM8A 3UUGA 1KTQA 4MO9A 4WBNA 4DQKA 4E4RA 1NMQA 5LSAA 2NZ2A 3JQEA 1SUCA 1E6WA 2R8BA 3CPSA 3COSA 4V0OA 2DEUA 3SZ2A 1GO2A 2XXAB 2AJDA 3T3IA 2ZUTA 4RZSA 1QBGA 3U6KA 1YA8A 5CEEA 2JDID 4C8MA 2Z8XA 4M7RA 2R65A 2ADOA 5LZ8A 3WNQA 1C0IA 1J42A 2Q8NA 1RWXA 5K8IA 1Z2OX 2OMKA 1XMQB 1WY7A 2WKWA 4JBWA 1S7CA 1DX9A 1L2TA 1P3DA 3I9V1 3LBIA 3TLEA 3O4HA 4AP9A 5CITA 4G4IA 3OI7A 1NMSA 4FBMA 4AUNA 4EBBA 5C7IO 4IFEA 1K88A 5E7IA 5KT6A 4CNQA 5A1JA 3MLEA 3HP1A 4R51A 3I62A 3C16C 2E49A 3ZQKA 2ZXIA 3LPNA 3FZQA 3AVXA 1KSHA 1BROA 4HPJB 3AEQB 4ZQIA 4FNMA 3M6LA 2IKSA 1HNNA 4CM4B 3O8CA 5LLSA 1U3CA 1QGAA 4PYMA 1LEHA 3W3ZB 1QYCA 4GQIA 5B58C 5HR5A 4Y18A 4A27A 1YKFA 2AOVA 4M0LA 4OQYA 4AWXA 3G8DA 1KWGA 1G20B 3H4MA 3BN3A 1R4ZA 1XD2B 2YN4A 2VVTA 4NBVA 3Q3GE 5JOQA 4ETMA 1RQ7A 4FGZA 3R40A 1L3UA 3UV7A 1QYRA 2IUFA 4P5EA 2Q1XA 4RTKA 3AH8A 4NECA 3GJ8A 5IDVA 3ADKA 1XA3A 4INPA 1LW6E 1AKVA 4J07A 3ISBA 4X85A 5HUQA 4DDHA 1YR9A 2FEKA 2H1OA 2AUNA 1FYVA 2X4DA 5FPSA 5A03A 1XVAA 1J5XA 4PM4A 4GYJA 1YK0A 4F2DA 1OUMA 3KWFA 4LX8A 3ZI7A 3RTGA 3ZVMA 2XD4A 4DYHA 2HR1A 5AJXA 3ORRA 3CB4A 2PUHA 3GV5B 4BZXA 4JY7A 3PLNA 5AKXA 2DX7A 3HLKA 4R3NA 3FZEA 2BQUA 3CR7A 2RB5A 4MHOA 3FXAA 1UBJS 5CFLA 1W52X 1YU9A 2A0YA 2CFRA 2PTHA 3AL2A 3KBOA 5NULA 3AEVA 4R64A 1R15A 3NRCA 1E3LA 2IYXA 2TRSB 3CWCA 4AJJA 1ADCA 1LKZA 2PFSA 2PV0A 3W3AA 1P2TA 2Q5LA 2Z8ZA 4O08A 5FTJA 2O2EA 3DO5A 5DEOA 5ECYA 3T7TA 3ZDZB 3BH7A 1Y0BA 3KV3O 3QTBA 1JEYA 2C42A 3OY2A 4ITUA 1BX3A 1IG3A 1WVIA 3A8TA 1VLVA 2OCKA 3ICVA 4LNAA 2F8LA 1DKMA 1JPUA 2QTBA 2R84A 3OLQA 4PR0A 1IXRC 5HEKA 3WRYC 3IDAA 5C5CA 5EJ9A 4XH9B 3G7UA 3PC8C 4MRAA 3RUHA 5BQ3A 5DGAA 4QUJA 3BWEA 5MN5A 2OG1A 3ELWA 2XUQA 3ENNA 3S29A 1OKKD 3GY0A 2QIOA 3ZK9A 1SVUA 2FR0A 3U56A 2VI5A 1O0CA 2KSOB 5DMHA 5THQA 3QGMA 4TURA 1MC4A 3W5DA 4ZOHC 5F9LA 4YD1A 5BSGA 5ILQA 5F2KA 1UPFA 1G8KA 3GN2A 4K6KA 3NYQA 3ZXUB 1BYIA 1DBPA 4PZNA 3PEUA 1GUAA 5ENVA 3SBDA 3ELDA 3DPUA 3MAJA 1X9GA 1ZSYA 4IXTA 5F9FA 4O63O 3CLRD 1OLXA 1XS9D 3WGLA 2HYDA 2PCLA 2GF2A 4FBLA 2C77A 6NULA 2EARA 2D5AA 3EIQA 4RMJA 1S2OA 4XE5A 2PL1A 2EF0A 2HIAA 2JEJA 4QX6A 1KVSA 1T0JB 4JP1A 4LVCA 1V3QE 1XXHB 5A3SA 4KVAA 5LP6A 3ZBUA 2W7PA 4LY0A 4R9SA 3M2PA 1PG0A 4BMVA 2BQ3A 1XRRA 1YK1A 3RJ5A 1M7GA 2FMIA 2WHXA 1P5FA 5D1HA 3VBCA 2HQOA 3U9TA 4MV4A 1O94D 3QU9A 4JV0A 3TOCA 2COKA 3NWBA 4J9VA 4JA0A 3KLOA 1ZD9A 2CJXA 4R81A 5DGIA 4BFCA 1J2RA 2BTEA 3PW4A 3LT4A 3BB3A 2CJYA 1BQ3A 2WKRA 3U4GA 4AIRA 2LIPA 3E8SA 2AXPA 3BMOA 4YP3A 4ZO6A 4XVRA 2QRKA 2QGFA 2P2SA 1F20A 3ETRA 2DPMA 3BZUA 3F96A 4DR3B 4PH5A 1Y1KE 2Z1MA 1SIWA 4EHIA 2AJLI 3EDCA 4CXMA 4E03A 1NPTO 1DGQA 4B81A 1IOLA 1PZFA 4IILA 4LBZA 3RGWS 4QG3A 1D1PA 4F6RA 2ZYGA 1SUDA 1O94C 1DWQA 1XYGA 2AJCA 2WUFA 3BM5A 2X42A 4J1QA 3UGJA 5NLLA 1HYEA 1P8JA 3AY7A 1G0OA 1EUCA 1P1IA 3QHQA 3OSPA 2MSEB 4PWYA 2DERA 1E1QA 2JKZA 1TEZA 1ES9A 1VJTA 1SVWA 1SCJA 4JV5B 1BGXT 4S24A 3UAWA 4EUHA 4LXGA 4ZREA 1JSLA 4UASA 4UZEA 1F0MA 3COVA 1TOAA 4Y2UA 1E64A 16PKA 1FC0A 4XVCA 2NYAA 2YRFA 1PJ8A 2GMWA 5LXTF 4UAWA 5KWIA 2PUAA 1VG9B 2R7MA 2XZTA 2XW6A 1U7UA 3LC0A 3N74A 2L5YA 5FT9A 5K0EA 1BGVA 2IZ6A 4H0CA 3ZXXA 5KFOA 4P0QB 3E82A 4GVPA 4Q02A 5BP7A 1C1XB 1MX9A 3T4XA 2CVHA 2VAMA 5WRFA 3M49A 2QM3A 2YNMD 4A0QA 5IT0A 1PJAA 1SVNA 2ZROA 4ZEVA 2C2GA 2ZJ7A 1VIVA 4HFRA 1BQEA 2GXSA 4NV3A 4QUHA 3A9RA 3ZGZA 3ZD6A 3P26A 1AN0A 1MA3A 4M9UA 3U60B 2GZAA 3A4TA 4ICIA 2BFBA 4X1IA 2XRMA 4F8JA 2OO5C 4GC7A 4TVOA 2X4LA 2KOBA 1FXWF 1HQKA 1R8QA 2GI4A 2KBFA 3AY0A 3M3HA 4Z86A 3T5GA 3VTFA 4E15A 2EEPA 4R65A 1O57A 5AOCA 1Q50A 4WZAA 3HKBB 4Y2XA 5L7TA 4IGKA 3JWHA 1E9DA 1XFAA 3IPRA 3ZLUA 4LTDA 2QB0A 1Z4PX 4Q93A 4OGKA 1H0RA 1LKYB 5J0PA 1Z5UA 2BGJA 4GE0A 4Q44A 1H2BA 3LLCA 3WNVA 4CEJB 2HHVA 2PD6A 5FXMA 4NOLA 4R8UB 1NWHA 2D54A 3AETA 2GB4A 2I6FA 4U4AA 2ORED 4OBXA 4Q7MB 4MS3A 1TGYA 4JLNA 2WF7A 1W2WB 4OHYA 1B42A 1P4HA 4XYBA 3KCQA 1JH8A 4HEJA 1OD6A 4H7KA 3RRXA 4F5DA 3PZPA 2DPHA 3E9YA 3ZD8A 2V7QD 3KDSE 4IDFA 4FYJA 2PT6A 1BXZA 1R0YA 2LGJA 3PJRA 4F97A 1SH7A 1CJVC 3ZV3A 4DS4A 2B94A 2HPAA 3ONDA 1SIJA 2FJUA 4X93A 3SF8A 1DEKA 4FX2A 4XQ9A 4B3IA 3LA8A 4QPJC 1UBSB 1RCTE 4W9NC 1KK3A 1TYEB 4DL9A 1FYWA 2I03A 2QQGA 5FBRB 5I9LA 2ZXUA 2EW8A 2AB0A 4D5GA 2R8YA 1EJBA 1VSTA 2WD7B 4DT1A 1ZD3A 1RLIA 4GLOA 5CX1B 3CONA 2UUAB 4JXZA 1U0OC 2HJ9A 2I66A 3IBGA 3LO8A 3GLQA 1FXUA 4KLSA 3MGKA 2BKAA 3IR6A 2O1WA 3OZRA 4QEDA 2NU7A 4M9QA 4M1KA 2XGPA 8ICTA 1UMBA 2A5FA 1MRNA 3KSBC 2XCLA 1XNRB 4BC0A 4LTNA 3DVQX 1QF7A 3FETA 3AVYA 2EOAA 3RBZA 1XK6A 2QTGA 1JEDA 3QE3A 4YA6A 4MVJG 3TWOA 3FTNA 3CCFA 2OKCA 3L6RA 1YJXA 2YTZA 1FP1D 2W22A 4RDIA 5JVDF 4BMYA 3D2AA 4YRLA 4KH1A 3K31A 4RANA 4UNPA 1Y6FA 1DUVG 2HCRA 2K7ZA 1GM5A 2F8SA 5JSUA 4P3OA 3ZKAA 1HMPA 4DVGA 2J5XA 3TDKA 4FIDA 1DFGA 5JZ9A 2QTAA 2EFYA 2RDMA 3ESBA 3I6YA 3S3TA 2XWQA 5A4JA 3Q0TA 4HVAA 1A77A 4D3YA 4M7WA 2BGTA 1L5QA 3C7TA 4IRKA 5J2GA 4KMOB 5FO0A 2Y1WA 2HOFA 1U31A 2IVZA 4E7OA 3UMCA 3O8BA 2EBHX 5F21A 1ECLA 2IF2A 2ZB7A 4DLSA 2KB0A 3PMNA 3QYFA 4DRYA 2HFJA 1PN3A 3EIXA 4KTQA 1ZFNA 2ZREA 4G24A 3SFZA 4G1MB 3WRYA 3M1IA 3FJYA 4FZNA 4B6GA 4QZGA 2PUCA 1MEJA 1M1YE 3E8MA 1SHJA 3LG2A 2B7BA 4YR7A 3NFYA 3ASVA 3PQCA 4PLFA 5I7SA 5A02A 3AHCA 3JXEA 4LYHA 2GCPA 2CXXA 2FPGB 3F5QA 3LUPA 2O2ZA 1XKXA 4J9QA 4OK5A 4RL6A 1UPUA 4URVR 4MV1A 2EQYA 2GTHA 2JI4A 1V8PA 5I47A 1HX7A 2VTBB 3QHAA 4MVWA 1UKBA 3T9DA 2HADA 2ZI5A 1QVVA 4QQ8A 1SUWA 2C2BA 4ZT5A 5CDUA 5K9ZA 1V4VA 4E70A 3AVOA 4Z51A 4ZYYA 1UPTA 3T9BA 2JLXA 4YXFA 4JK1A 4ZO4A 1XVLA 2Z43A 4WKBA 3BYZA 2K87A 1PV2A 1XALA 3I2HA 1NI5A 3RSSA 2PKEA 4AYTA 2EGGA 1N6LA 2OXEA 2EFCB 2WPDA 2ZTLA 3KP1A 1NQ5A 2G88A 3HB4X 5EPEA 5FRDA 5A71A 4E5SA 1L9XA 2W03A 2DG2A 1M8GA 4ZDKA 1YS9A 1YF3A 3J7AC 4ECVA 1NG1A 1ZJJA 1ZN8A 2IXAA 2AUTA 2R751 1LWOA 1NN0A 4RS4A 5FJIA 3WWYA 2ZB3A 1T1EA 4LHEA 3EVAA 4G0UA 2DHEA 5CMLA 5JLAA 4D25A 3THVA 3KEQA 4NAVA 4N3CA 1Z4IA 5DHTA 4JB0A 4P4PA 4EYHB 2AHRA 2NZXA 1B0PA 1JIJA 1ZQKA 1O2DA 2VAXA 2Z3WA 2O0JA 4D4GA 2PO5A 1ZQFA 1KGDA 3NYWA 3ZUPA 2LM1A 9ICRA 3JQ9C 4JEMA 1S8NA 2B1IA 2PFQA 2XNSA 2Q1WA 4HV4A 4AI6A 4X62B 1XHLA 2GPJA 3B7GA 4UE3S 4EG1A 2OBXA 2AWNA 3DZBA 4EFKA 5AUQA 1GCIA 2ZIFA 2FETA 3OZUA 2CWWA 2Z2IA 1V48A 5JWRA 4NCKA 5HKBA 3JWGA 4UBBA 4AG5A 4FCTA 5J2EA 4HB3A 4MIOA 3DMPA 4YK7A 3H2IA 4BZZA 2PT7A 4RVFA 2HCJB 1XZHA 3O8DA 4IOLA 5CNMA 2WV9A 4FHEA 2ZUFA 3I64A 1FDSA 4PBRA 1E5LA 4QD3A 4JELA 2VYVA 4BX3A 3QG5A 1NJGA 3R0ZA 3RRZA 1ZVQA 4U1RA 4V0RA 1JP7A 4I2VA 3T9EA 3KUDA 4FR0A 1B8UA 3GVCA 2GKOA 1KP9A 3LCUA 2IJGX 4M36A 2VWGA 2R86A 4EA8A 5LMNB 1PYGA 2H1HA 4OL9A 3RIXA 4YPOA 1NNI1 3KQOA 1FFAA 5HKKA 3WKAA 2AJTA 4CKXA 4CKYA 4P4NA 3DAHA 3CUTA 1AKYA 4RQUA 1BXGB 3EFHA 4ELTA 2AF4C 1F0NA 3FWHA 4UUBA 4EFLA 1FCJA 4RK1A 3RR8A 3JAMA 3KK0A 1MX5A 1Y9EA 4IRMA 4LDJA 2UZ0A 1WW8A 1K6XA 3OWOA 3SNKA 5C1BA 2HMAA 4XM0A 4EVIA 5JFOA 5LJLA 2FJ6A 4NQZA 4PS1A 3PR2B 4PICA 4D42A 8ATCA 1FL9A 2ZYTX 4Z6EA 3A1TA 3GEGA 4ZEWA 1KK0A 2DKNA 5FWDA 2QR3A 2QRLA 4BTVA 4C3ZA 4NENB 3DNMA 4XAQA 2P27A 3VSCA 1P91A 1P80A 5J0SA 3F5FA 1ZEMA 2H2DA 2Q1UA 4PIPA 4QU5A 4YI3A 2A6PA 1PS9A 4XIIA 2YTUA 1R0ZA 2MT9A 5TJHA 2JKYA 2LRHA 4V03A 4WZ6A 2IEZA 5IKOA 4BNTA 3LBFA 2BJWA 1HNWB 5EFZA 1I80A 1TKDA 4YDQA 4EO4A 4ZAVA 3SSOA 1NW5A 1QCCA 4FFSA 3JR7A 3FMIA 4XTRA 3ROMA 2X7JA 3RS0A 3UC5A 2R8GA 1MSWD 1X7WB 1M0EA 3R0IA 2N75A 4DMRA 4IV0A 1YC5A 2GILA 4OCZA 5E9QA 5C7OO 3AFMA 1PV4A 1KHTA 1ZOLA 4G1VA 1VI2A 5C8DA 1XDZA 3RHTA 1ZD5A 1DJNA 1T8SA 1W49A 2MMGA 2XA1A 5DTRA 4EX6A 3MGHA 4D9FA 4NM2A 3HU2A 2C29D 4WASA 1CRWG 5LP6C 3IT2A 3GQBA 3RUCA 4DLXA 5FBWB 5JROA 1RWOA 1MKYA 2WSLA 1XXHE 1H4QA 4DL3A 4PYOA 1US8B 4JXJA 2QROA 1GCOA 4GXRA 1ZOSA 2XCPA 4LOAA 3AG6A 4NDZA 4P3KA 2JVJA 2Q4OA 2V6JA 2AYYA 1E58A 3A0UA 3P2MA 4FNOA 4KH0A 1E5QA 1KMMA 4MQFA 4ZO7A 5D6NA 5AKHA 1QCDA 1NR5A 5DTMA 4JJ7A 3JPRA 2PUJA 4RVHA 2H1FA 3UXNA 3EOBI 4O3NA 4K9LA 1K9SA 4EW2A 5ALDA 4B43A 3BWDD 4FHZA 2HSJA 2D5CA 3CMMA 2M1XA 3CTPA 3DE1X 4LZOA 4PC2A 5DW0A 1RYEA 1YASA 3I2KA 3PQDA 4G86A 4GLBA 4AULA 4D9MA 5E3JA 3SVZA 1QHYA 1N8KA 2X0JA 3MJVA 1ADJA 1NUPA 1AZSC 4G4GA 4ZU6X 1S3IA 5ICFA 2H1LA 3K5WA 5H1YA 4QPPA 3EA4A 3FKQA 4PYJA 3ZVNA 4I14A 1C3OB 2IYPA 3B1JA 3TQHA 3ZH2A 3D3NA 4BP9A 4H08A 5A06A 2C78A 3K5IA 1YDHA 4O33A 4QDXA 2VDRB 3P9IA 4F6LA 2FZGA 3R8XA 3H0EA 4F3TA 2QD1A 3V6LA 2I7XA 1PS8A 3OE4A 2OK7A 3C6BA 3OTQA 4DYDA 3Q3IA 5K0TA 5L3SA 4DV1B 1Q0QA 1UK7A 1ECPA 1ZQ9A 4J3FA 3EGDB 2EG9A 1PW5A 1YE8A 1PR0A 1HBJA 4PO8A 4Z7JA 1LTQA 4KO8A 4HFMA 3EX7C 2B2CA 2RIPA 4Q9DA 4WK6A 4C4RA 5AYVA 2WTEA 2ZTDA 3PTAA 4XUEA 3HKZF 1U3DA 4TWZA 4I1PA 1UXHA 3EXHA 1SXGA 4PLZA 4TUPA 3GX1A 1N4AA 4QT0A 3FTEA 3P9ZA 3IO3A 5H7XA 1YCGA 4LFBB 1G19A 2JF0A 3B5JA 1ZD4A 3PV0A 3M89A 3L6EA 1JLKA 2B78A 5TV2A 3MM4A 1C4XA 3MOSA 2IIBA 4W7SA 3C2MA 4EZEA 3QFCA 2G28A 2IMWP 3EEOA 3DEAA 3F97A 1GZDA 2OV4A 1UQTA 2EFJA 1QKJA 5EEHA 3TB6A 1NOIA 4BRWA 4IVRA 4ZCRA 3EF3A 3I1YA 3H9UA 1D0IA 3NOVA 4GXKA 3IRVA 4KFCA 2AZMA 3DV0B 4KSCA 2V6GA 3C8HA 4JV1A 3SF0A 5DHFA 1FMCA 3HX0A 2P5TB 4UTPA 2UUPA 4HGRA 4ZU3A 3MTJA 3HYLA 1NC3A 4CE6A 4OH1A 4F8EA 1A2QA 4U6PA 3UXMA 4YB8A 1I6LA 1YZQA 1Z18A 2FHSA 2VPYA 5FCDA 2GHTA 4RQ8A 2D0OB 1YB6A 2QYOA 3KLPX 2I34A 3P20A 3UMFA 3FM9A 1VFPA 1DTWB 1V8ZA 4I4LA 4PZPA 3A0BU 1F2UA 2EV9A 1N5MA 3DV0A 5E1MA 5IN4A 3MMSA 4G9GA 1MHPA 1ZJZA 1S9FA 1UOQA 4JDUA 3QLVA 3NZEA 3MGBA 3TTUA 2W90A 2P3LA 3MCVA 8LDHA 1XD8A 3MOGA 2R6FA 4Y9TA 5TPZA 3RC1A 4CF6A 1PGNA 3RRYA 1SAYA 4W99A 1JTEA 2OORC 1DZ3A 2J7PA 2FFRA 1Z7GA 1J8FA 3MWEB 4CLRA 5HILA 2VJNA 4MGKR 1OGIA 1M0WA 1VP3A 1SIBE 1MAAA 4NNJA 4ZQGA 3D5QA 4QQKA 4MMZB 4GT1A 4I19A 2WWHA 3IB6A 1W36C 4LV8B 1KAHA 1E89A 2W6IA 2WINI 2RGCA 3AI3A 3BXOA 5KL1B 3EG9B 3N59A 4R4JA 5K8JB 3EBOA 2O7NA 4LS3A 4I9HA 4LYJA 4NU6A 5KI6A 5LQMA 2OBFA 5TF0A 2YOHA 1WUKS 4MB2A 4J0FA 1THTA 2O1XA 3JARB 5H0IA 4PHDA 1S5PA 1G6KA 2PUFA 2O7VA 1IUNA 2XZLA 3F8SA 4F3OA 4JUIA 4REQA 2B8EA 1WCYA 2AMYA 2O6HA 4Z99A 1ZR4A 4OSEA 2FF7A 3FTFA 3T4PA 5AR1A 1IJEA 2FK8A 2IVFA 3C3WA 2PIAA 2WWTA 3H2ZA 5D87A 2EVWX 3WNDA 3WZMA 2CEAA 4XYLA 2J48A 3QBEA 3KLNA 2X8LA 3G6XA 1MVNA 5A0TA 2G83A 3TO5A 1C9EA 1GYQA 2DC1A 3OT5A 3D2SA 4S1NA 1RWBA 1UK9A 4RX1A 2YNMA 4L5IA 4I4TA 2ZYDA 5BMVF 1I1NA 3GMDA 4NNOA 4RVSA 1X66A 4XDGA 3ZQ4A 3ROGA 3CISA 1CULC 3KOOA 1IQUA 5E95A 3S2FA 3V9PA 5JU6A 1OXKB 1JDSA 4YRZA 1RI1A 1EUCB 5CHEA 5IM4F 3CX4A 5E9JA 2DR2A 4ESEA 4NLCA 2QENA 1LWNA 2COUA 1KYTA 3KAJA 1K3FA 5HJ7A 1IAQA 3QU2A 2GDZA 2GZMA 2G7MC 2GFIA 1Z82A 2FMXA 3GUYA 3PQFA 1GLNA 4UMDA 4JN6B 1XZBA 4Q34A 5TT1A 4CM8A 4PGYA 1UZLA 3IIIA 4CN9A 1IXSB 4M1ZA 3N5KA 4QJIA 1HTBA 3B1FA 3DM9B 1E18A 2KYRA 3L0DA 4BUZA 4EY6A 3OUZA 2M9MA 4B3MB 4BO0A 1AKNA 2PMKA 3IT3A 4QYXA 2PLRA 5JXHA 1RXEA 2DTEA 2FE4A 2OO5A 4QNRA 4LWOA 3NMUF 5CBKA 4TV9A 4FMDB 3ONVA 4Q18A 4QYIB 3JQBA 4BJ5A 1II8A 4L22A 4Y1EA 1Z8NA 3RH4A 3ANXA 1AF7A 1RD4A 2ZSHA 3KQTA 1JNXX 2B69A 2GJSA 5IIOA 4LJ7A 4Y30A 3DMFA 2CXTA 4NR0A 5IXJA 4URUR 5FOTA 5L3RA 1ANKA 2HCBA 1N6RA 1YQXA 2QTFA 3NC4A 3NHPA 4N6GA 4GXIA 4RFSA 4LCJA 3ZZMA 1KRPA 2VWQA 4I9NA 3RR2A 2GN9A 1VMDA 1L5UA 1JL3A 1PLKA 1T1RA 2O2GA 2PPLA 2VJLA 4QLAA 4D98A 1SXJE 1KDOA 4LHXA 4BWYA 3UFXA 3HFSA 1OXTA 3NDJA 3N05A 3CZPA 1UPCA 3OM9A 1E5TA 5KG1A 4BDSA 3Q9NA 5C7LO 2VJYA 4WY5A 1U98A 4RY8A 5IVIA 1Y3IA 3LFTA 1BMFD 5CHYA 1CNMA 2VDUE 2BPOA 1FRFS 2PGAA 4HS4A 4WMLA 2AA3A 1D07A 1I5RA 2C3OA 3ROKA 1ZO8A 5ITZA 3BXZA 3J81k 1ZQHA 5DCWA 1A0OA 2WHRA 3L0CA 1RDFA 1F14A 1VB3A 1XRSB 2ZCUA 3EEFA 3NI2A 3VYWA 1G1MA 2R9VA 1TFRA 2X3UA 3I01A 4H6VA 4UHKA 4YP7A 1BFKA 4A3SA 6Q21A 3GCXA 4O02B 2I4LA 4RADA 1OI2A 2PSJA 2ONCA 4RNCA 3RBVA 3TAQA 2F1KA 4YP5A 2KTQA 4Q43A 2DT8A 4FJ1A 1LV7A 2CKDA 2A57A 1MO5A 5DTIA 4EW6A 2WD9A 2XTJA 5GADl 5A6SA 1Z39A 1ZK1A 3B1KA 5LNK1 3CVVA 2P65A 5HFJA 3FMFA 3I01M 4EYEA 3DEZA 3WBFA 2F43A 2QBYA 3JPWA 1Z0JA 1A04A 2NU7B 3WLEA 1V71A 1N4DA 1CVIA 1MNAA 1WY5A 3VZRA 3LCCA 1C7JA 2QJTA 4FI3C 4C7MA 2Q7XA 1VPWA 1CUKA 3RT1A 3RVJA 3COZA 4NS4A 3E61A 5DLYA 4NM1A 2LYHA 3NLLA 2UXBB 4L72A 1JKFA 3RHZA 1LF5A 1K5HA 2XCUA 2R2AA 4CUJA 1WHSA 5C1OA 5TVKA 4EIWA 5E4YA 1PW7A 1VGVA 4O4IF 4R1SA 4J16A 4ECWA 1JRLA 2I67A 2NTEA 1K7EB 4UEQA 3ZUGA 1USIA 1W87A 2ONYA 3EXFB 4D0SA 4JLUA 1Y4ZA 2QPAA 1YZLA 1TF2A 4NYMR 4YRDA 5KFEA 2DP4E 4U0KA 4G07A 2DRIA 1JA1A 2FEOA 3VISA 4D26A 5LMCA 3QUQA 1GTJ1 1AJEA 1PD0A 1WPRA 1SL1A 3GV0A 2PANA 3GLRA 2VCYA 1KDVA 3ICEA 1RYUA 1T4DA 4YBZA 4BFUA 4BX9C 5ADUS 4YPFA 3U0VA 2YQ5A 4BXOB 2K4HA 4HGYA 1DG1G 1UDRA 4L5JA 4UOZA 4JLVA 1UAGA 1GN8A 4G2NA 1TZCA 3KDPA 4R3UC 3U3KA 4K4IA 1NLMA 2Q1YA 1XWLA 2YOFA 2YX1A 9ABPA 5JC1A 3ZK8A 2H5JA 3N6VA 2DKXA 3R3VA 4JD5A 3B1WA 2H3HA 1IEXA 3DTVD 1XQXA 3QI2A 1S9HA 1EP9A 3CY6A 4AZSA 1Z2EA 5BSUA 1Z5WA 2GERA 2DWCA 1RZTA 4XB6B 1PJTA 2YWFA 1QIGA 4ZDIA 1YR2A 4XQ8A 3I9LA 4M7PA 1OW5A 3SAGA 3H0RB 1E6EA 2AVDA 2HTEA 1DOZA 7ICTA 2FJPA 4U2GA 4FFLA 1MQ2A 3IH5A 4W63A 5CTAA 3SYLA 1AQLA 4EW3A 1FTWA 3HABA 5HZHA 3KETA 4BO4A 3Q5EA 3GJ7A 5E1OA 4IRUB 1JHMA 3W9BA 5HCIA 2FWAA 4K03A 2YN2A 4HXEB 4FKMA 5ITVA 2XVZA 1LDGA 1TX4B 2GR9A 2H00A 4O4IB 5CR9A 1E3WA 3WK6A 2WU1A 4EA7A 2QD2A 1QG2A 1UDCA 3KOMA 4RLFA 2C8VA 1P2SA 3AGQA 4BNDA 4KAJA 1ENYA 4M1WA 3NIFB 3V3KA 1ULSA 2DUUA 2YR0A 1QFZA 4PEVA 3ESZA 3DE6X 4OLBA 3FYDA 3KJNA 2QHXA 3KLMX 1MTZA 2FSVC 3S1AA 1XC7A 2GJ8A 4JEIA 3T7IA 2Q1TA 1D6MA 4YVZA 2FFBA 3RAQA 4I4CA 4M98A 4S2UA 4D8VA 3NBYC 3FUTA 1J9EA 3HDQA 5ALZA 1Z4KA 3K4GA 2E1RA 3IALA 2YFKA 3WLTA 1U49A 2G9NA 1G20A 1EFTA 3A7DA 3GAAA 4MF8A 1OWMA 5KYWA 3PNVA 2H4FA 4IDBA 5CM8B 4CQMB 4NV0A 1PUIA 2CFTA 2HT6A 3KR9A 3GGGA 1TU0A 3LNTA 3MDCA 1SXJD 1UQRA 4IO0A 1SWWA 2DR0A 3MD9A 3OZVA 4P7FA 5GIOE 1JIXA 1WZEA 4G4JA 3V1UA 1FQJA 4FN5A 2C28A 1EFKA 4RAOA 1Z00A 2C7GA 1KZ7B 4EB8A 5E1BA 5L1MA 3IS3A 4L4UA 5K3FA 3VXKA 1MJGM 3E7WA 2I9PA 2H3IA 4N7RA 4BB9A 3BS5B 2PZJA 1U6JA 2UZIR 5JRTA 1I3NA 1CSEE 1ZH6A 2R68A 4FO6A 1KYIA 3CUEF 3STVA 3GA0A 3R3ZA 1O6ZA 1XEAA 3AVTA 1M0TA 4R01A 1YZ3A 1RXUA 3SS7X 1EA5A 1BXRB 3LVBA 3PEEA 4HX2A 2OXCA 4MYRA 3JU3A 4UBMA 5D1NA 5LNK6 1W0KD 3NWJA 5JFTA 1EIZA 2GLEA 4TLAA 5BT9A 5LQUA 3VSAA 4AZ3B 3KOWA 3C5WP 3MWJA 4PR3A 3PU6A 2ZTVA 2E8PA 1IZ8A 1NUHA 3JQFC 1STOA 3VSBA 5JT1A 5A6VA 4GQAA 5KOHB 3IOCA 2P2CA 2VUTA 3IEXA 2D1SA 4W1QA 1PR3A 4CLOA 3KQHA 3ZZTA 1UMDB 1AE1A 3B36A 3BRWD 1NW6A 3PNYA 1M2FA 4HSGA 1S2DA 3W2EA 3CVYA 2C9OA 4FHFA 4C6HA 1NXPA 5DF1A 3SEQA 4ZXPA 1KFCB 3ZI4A 5CT6A 2D8CA 4BQQA 2EFHB 4G01B 4X5OA 3NHJA 1NXTA 4UQLA 5IF9A 4USAA 1CS0B 2JLRA 1BPDA 3HCRA 1WM1A 2WJJA 2WRZA 4AD8A 1T2DA 1ZQYA 1NLYA 4HJRA 1P9RA 4URWR 4N39A 4PN3A 3A4VA 1B8OA 3EYZA 1BIFA 3DOIA 3ZNNA 3SQNA 1YL7A 4EWLA 2MUTB 1EFUA 1MEOA 1XMJA 2P9EA 4MV0A 2IUTA 2X7XA 3IFSA 3BJYA 3ANTA 2ZEJA 2FCRA 4LA4A 5EZSA 3CM0A 3HUTA 1NN5A 3RVKA 3K4HA 4CVNA 4YMWA 4F91B 1U2GC 1V11A 2HNAA 5H68A 2HBQA 1EKXA 2V45A 3V4PB 4B45A 4AO8A 2JI9A 3VZBA 2B83A 3MBYA 2FU5C 5C8YA 1CBUA 4ZXFA 4J9RA 1B41A 4PHCA 3R8CA 1KY2A 5C2JB 1COKA 3SWWA 3FGZA 4O4HA 5JO0A 4GE3A 4G2TA 2LIVA 4Z9AA 3ZHRA 2MUTA 4KWTA 1RLJA 1CD5A 5HP4A 3BILA 1JE0A 3PWKA 1H3NA 5ECWA 3TSAA 4E4YA 5BQXA 1TZKA 1QB7A 2CNNA 5BV1A 4UBCA 1FEZA 4MVJA 5KQPA 5IAGA 1VPDA 2B8TA 4B3DA 2ID8A 2J6HA 1RQGA 2DBYA 1W4AA 4DIOA 1KBUA 4XJXA 3VV3A 3AP1A 5JAMA 2ENUA 4UUNA 3AFOA 2A9KA 5A5EA 5JC8A 4IUCS 4MW1A 3L7AA 4Q15A 5E38A 3IDQA 2PZ8A 3IL2A 4O25A 1KN5A 5BW5A 1LLUA 5FTKA 1VCIA 2W11A 3BK7A 3FHOA 1NKVA 5L7WA 4YLEA 2WICA 5H9VA 4IHKA 3C98A 4KLNA 1C7EA 2NG1A 4EFDA 3M83A 1K7YA 9ICTA 2NP7A 3TLCA 2UAGA 1Z5ZA 5CNKA 3PCXA 5KWEA 1MA0A 1DJQA 1IN6A 1JSZA 4D7AA 4NXNB 2PZAA 2BISA 4ND8B 5SY9A 3BWCA 4BYMA 4FB4A 1E1NA 4XTCS 3KSRA 5AK5A 4IM7A 4ZZ0A 1L5HB 2LP4Y 3UTDA 3E9EA 3J81A 2NUPB 3DE2X 5BYJA 4ZYUA 7ICMA 4RQMA 2P30A 4JJZA 3QYAA 4J7CA 4JQZA 4HAXA 3NBUA 3UA3A 4K2HA 2Q4EA 3GEHA 5KHLB 3ICWA 5FOSA 4UB5A 2K8CB 4B6FA 3N2NA 5J63A 1LPOA 1IPEA 2BDTA 3M6IA 2TMYA 4C43A 3H2HA 3ESDA 2R8KA 1GKIA 4HN9A 5TJ9A 4BL5A 1XO0A 2OXRA 3G2NA 4N40A 4BX0A 3CW2A 4FN4A 5BNFA 2Z08A 1U63A 4B47A 2XPCA 2BFBB 3K9WA 1MDFA 1RWNA 4PX5A 1CDEA 4AECA 4LCEA 1L4FA 3L46A 3TE7A 1AC5A 1HEKA 3TAPA 1H4VB 3WBBA 4EQ6B 3RR7A 1J39A 1XB2A 3LK6A 3PUWA 4ZCQA 2PMZC 4QWCA 1YMQA 4QSHA 4TTRA 1GPUA 4OQMA 5JSYA 1C9JA 4Y6OA 3UAZA 3ZEAA 4BNWA 2D7DA 1EEHA 4P4TA 4Y2YA 2CZCA 4IICA 4CMEA 2W9CA 1CEXA 3NETA 2I5PO 4EJFA 3U16A 2C58A 1GLGA 3C4QA 3LTEA 1H93A 5KS2A 1YQQA 1ZIXA 2B9EA 2CXPA 3KQYA 4U2CA 4NLZA 1CHDA 1B6SA 4UVGA 2ZIWA 1AHHA 1X9MA 3TMAA 5I48A 1W5SA 2AXQA 2ISCA 2I4RA 3HYTA 3H4DA 1T94A 2CLCX 4I2BA 1WZCA 3PFWO 1K1EA 2B3DA 2IZ7A 3LKZA 3WIDA 3TN7A 4C0AC 2V6BA 4AURA 4D56A 4EUEA 5CA0F 1TEXA 1LBIA 4HGOA 3UPUA 2W9CB 1PQPA 4B7XA 3T5HA 2E85A 2ZR9A 3B6JA 4QWMA 4ENTA 3QLJA 2IHZA 1YVUA 3BJIC 1GSHA 3OZXA 4BMCA 3T3OA 1PK8A 2VKTA 4NESA 1VYVA 3BCUA 1B4DA 6REQB 3S81A 3TTWA 1AK2A 5IT5A 4K3VA 4N01A 5AO9A 1FDRA 3V33A 3GFOA 4C0WA 4F4ZA 2WWRA 3FVTA 1AZLA 3QOXA 1WPGA 4POAA 2OCPA 5FOVA 4BNZA 4UOEA 1HWYA 1CEYA 3MBIA 3VA7A 4JB2A 1MT3A 5C31A 4MP6A 1JXLA 3CB2A 4IZHA 3BCHA 4UUPA 4RD2A 2F4VB 4RHUA 4MWEA 3QVKA 3OP4A 4MUMA 5KINB 4JI8B 4C8OA 3AOEA 4LYEA 4FNAA 3NT4A 1OLSB 3ZE9A 2H3EA 4JP5A 4EI9A 4ZIRA 5J2TA 1SU8A 3ZJYA 3VYTB 1KEZA 3T7JA 4HNAB 5HR6A 3JVUA 2AC2A 2FE1A 4F85A 2PHZA 2QR2A 4RZQA 2E5FA 3UKDA 2MRLA 3D2NA 3VC7A 3NP9A 2R6ZA 5LQRA 3NBKA 3NYIA 2WHPB 1NN3A 4V1CI 3SEAA 2VPPA 1J2NA 3WXMA 3HP6A 2VS1A 4AKIA 3L7JA 5AW5A 3BGDA 4JLJA 1F60A 3VR6H 1XDBA 2X58A 1QPZA 2ATVA 2P2NA 3SHVA 3V1KA 1Z15A 4ZOAA 3MF4A 4EY8A 4EGSA 1ADGA 4ND6A 4HNAA 1EK2A 3L0ZA 2A94A 3KEOA 3T7CA 4UB6U 2XDQB 3DAPA 4OJNA 4U7FA 3V3TA 2HC9A 4AMUA 3ETLA 2OLEA 5DSTA 2OG2A 4C5AA 1T6NA 1AUXA 4G5SA 2Z4SA 4IIVA 4OPMA 3BG5A 4KREA 3NJ8A 2J6UA 4FEYA 3RIMA 2WV7A 2BF4A 5KT2A 2ODEA 1IY9A 2I6UA 3OBBA 1DAFA 4RQTA 5AM3A 3FUCA 5IDYA 1M1YA 3TVYA 3P5SA 4Q3AA 2GT1A 2OD2A 4YYEA 4EDFA 3OTIA 4B3RB 4IUBS 2FAXA 3MMXA 2HA5A 1HDZA 1DC3A 2HBRA 3JQFA 4O2LA 4TQ9A 4WKOA 5HJEA 4NLLA 4DCJA 4PO9A 4ZK6A 5M04A 2DPIA 2R6CA 4I55A 5CJ2A 4PYLA 1NYLA 2DCMA 4GVLA 4CW7A 2QUBA 2W3SA 1MAUA 2P90A 3DHYA 1AB5A 5CP8A 5LQSA 4QW8A 2KJ8A 3CSUA 3HZRA 2IV7A 3CJQA 1G8SA 3OIUA 3B85A 2ZUUA 3EZ7A 3OF5A 4K7JA 4LF7B 4OIMA 3QKUA 4EJ2A 2Q50A 4U7JA 1ECBA 1MB0A 1XVUA 4PCAA 3B7PA 2PX4A 3BZBA 4YQYA 1A5SB 3EVEA 3MT7A 2ALZA 3L1JA 3N0TA 1JTVA 9ICEA 3PWSA 2O3SA 2RAPA 4WGGA 3UJ7A 4U7DA 1QGZA 2VOEA 4BECA 1S2GA 2GN6A 4OHRA 1U0SY 1I10A 4F4HA 4PXYA 4EBDA 2HOIA 4ARBA 1GIAA 2XUHA 4H6PA 4KIUA 1FVOA 1JIQA 5FO1A 2LCFA 4RPGA 1B8PA 1PYOA 3AL3A 2GO1A 1VJ1A 4E11A 2O2YA 4O4LA 2VXBA 1IUOA 4WT7A 4ZJPA 4LZLA 1T9KA 1UJMA 1O96B 3EZ5A 3BQMB 4M0EA 1B74A 5CDYA 2NUAA 3B13B 3WIBA 3E2IA 4NI5A 1EDZA 1VOTA 2EZ8A 3E1GA 3OOHA 4RHYA 4ZGBA 5AJYA 5SY6A 1FJHA 2E6UX 1X1SA 2C5HA 4C87A 4BRSA 5CRXA 1J0XO 2GCOB 4L76A 1WEHA 2BLLA 3EAGA 8ICSA 2HO5A 2JK1A 1LK7A 3MBKA 4NEHB 5JZBA 2ZIAA 5B36A 2DKZA 2VUSA 3LHKA 4ED9A 2DE0X 3IGFA 4HJXA 2H4ZA 1RZRA 2GK7A 2EZYA 1SL2A 4UB1A 1T29A 3WHKA 4B09A 4MR7B 5AW0A 2LKYA 2P9GA 1GGHA 3QA3E 2RMKA 3EQ7A 3GG2A 5LPNA 3CYFA 4N65A 1CJBA 3RIGA 5FOWA 1YH3A 2OHHA 5C52B 1XFDA 1XTKA 1DTEA 1J06A 2YXEA 1VLMA 4J0JA 4DLLA 1WRBA 1A72A 3LCMA 1CY4A 4P22A 4P92A 4PYRA 2GVDC 2HLDA 1G7SA 1SN7A 4KXNA 3ISVA 4UE2A 4A23A 2BMEA 3K0FA 3PSAA 4K6MA 2IHNA 2MDTA 1VKHA 4FBTA 1H2AS 2I78A 5IEJA 4S1WA 3BIOA 2FRVA 3E5NA 4D43A 3E35A 4MW4A 1XF1A 3LYAA 2HW8A 1VL6A 3HB7A 4QC2A 3RYIA 4RA9B 3FAKA 3AUJB 1N2CB 4GS5A 5EHQA 3L7IA 1OXXK 2QXYA 1E0SA 1COZA 4KXLA 2IUUA 2DSTA 5FBKA 3BH0A 2AR0A 3A9WA 1V16B 2YVKA 3AJDA 3MNFA 4YIHA 1LTKA 5JZVA 9ICKA 4UUOA 2J0SA 1U0TA 1YVDA 2ZRBA 3PHCA 1FX1A 2R8OA 2ZAIA 3W5AA 3PX7A 3VKHA 2H9YA 3ADOA 5CVVA 2FPMA 4LXHA 2C1ZA 3SIRA 2HRZA 3UIEA 1RJEA 4HLQB 4JNKA 3GT3A 4CTNA 4AIIA 4M1MA 5EZYF 3UCEA 2Q3BA 2CNLA 4B8YA 2VH2A 4E1VA 1DBWA 4EGQA 2IYLD 1E5VA 2V5VA 4C14A 5IJ9A 1M6VA 1RYFA 1X70A 3M6ZA 2R6JA 2KD1A 3IUEA 1W7AA 1Z5GA 5JD4A 1T8YA 1JHPA 1ZOOA 2F2TA 4QNNA 3CKKA 4Q9HA 1Q11A 5AI4A 3VCBA 2ON6A 3TQFA 2Y1DA 3VFDA 5FEUA 3WVNA 1BRMA 1A69A 2IIQA 1V26A 3GIWA 1NVVR 4GM1A 3V6HA 1QGOA 2OFPA 3FPHA 3Q2KA 1IFXA 4E21A 2EBFX 4TKUA 3QZ8A 4URFA 1IE3A 3AFIA 3TYXA 5J0UA 4MRMB 3GLIB 2DQSA 3K9CA 1A76A 1Q7BA 4IXMA 4LGMA 1U1DA 1TLTA 2ZCVA 3G2MA 4JYCA 4LPKA 4AF7A 4OJ5A 2OBBA 4BQIA 5GIPE 4OGLA 4P83A 1JFVA 2DPYA 4PWZA 3R3SA 5I5EA 1TYCA 4JBXA 3I2FA 1BHO1 4JV2A 1LVHA 4MRPA 5KEIA 3F6YA 4UM8B 4PQFA 2O2HA 1P2DA 4YCCA 4MYTA 1N34B 4UMEA 2BM8A 2D4AA 4R40A 4ASUA 4RUAA 2ODWA 5L40A 3JD4A 4OFWA 4AXBA 3OQIA 4Q7EA 5KTMA 3WHPA 4H15A 4QOIA 3OJSA 1SD2A 4ACBA 5GONF 4BDPA 5IVPA 121PA 1CQZA 4B74A 1DADA 4XWOA 4DV6B 2JZNA 3F8TA 4X95A 5CM9C 5IJZA 4KR3A 4Z6DA 1V38A 5AKJA 1W2HA 3HADA 1RMYA 1H2HA 2W4MA 1C9KA 4GVXA 3UT0A 3TZCA 3KELA 2YXBA 4INOA 4ZAGA 5KPDA 2ZBDA 4P0TA 1I3OA 2UV8A 1BOOA 1GSAA 1FYXA 3P2EA 4IF4A 2X3YA 2VTDA 4NCHA 5C4GB 4PC3A 3DBVO 3LWZA 2FMQA 1WZUA 3P8ZA 3ZLBA 3AJAA 2QT1A 4HQRA 3V6MA 5LDHA 1A9SA 1HK7A 3MT8A 5TT0A 5AVYA 1NQAO 1XZCA 4TV9F 2QORA