2YMQA

Chloropropionic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
total genus 91
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymqA01
2Q5EA 4HGPA 4AP9A 1WR8A 3J7TA 5ALZA 1WZCA 3SHQA 4XQ0A 4GIBA 1ZRNA 3CNHA 3W5AA 3R4CA 5AVTA 4YIHA 1TA0A 3WK8A 5ALEA 3U7EB 3A1EA 3KC2A 2B8JA 2BDEA 3W5BA 2YMLA 3ET4A 4YGYA 2ZBFA 2G06A 3MN1A 4MUMA 3FVVA 3ZVNA 4RESA 1FEZA 2RAVA 1LTQA 3ZUPA 3W5CA 1Q91A 4CF4A 2AMYA 4YCMA 4JB3A 4J2TA 1YNSA 3QU7A 4Y2PA 5ALIA 2YJ6A 3ZVLA 5AVWA 5AM2A 2O2XA 3NUQA 3R9KA 3FPBA 5AK4A 3AR7A 5AW2A 4BBJA 1EK2A 4J03A 1SWVA 4AS3A 5AM4A 2HO4A 1QQ6A 4KNWA 4UMEA 1EK1A 2G07A 1S8OA 3ZWDA 3QUTA 2HHLA 3QU4A 2YY6A 2JAOA 3AR8A 2R8YA 1RQLA 2FPRA 2NO4A 2W11A 1QYIA 3L1VA 5ALDA 5AM1A 1QQ7A 3K1ZA 4UM7A 3A1CA 5A3QA 2NYVA 2NO5A 5AW5A 3PCTA 4UM5A 1ZD4A 4Y2TA 2PQ0A 4Y2UA 3E81A 2EAUA 3U7GA 3U26A 1AQ6A 2YJ5A 5ALRA 1Q92A 3DV9A 3ZTYA 1YDFA 4HYTA 1IWOA 4YH1A 3BA6A 4UATA 2ZG6A 1Z4IA 5AICA 3W5DA 2YBDA 4UAVA 2Q4RA 1L7NA 3AR4A 3DNPA 5FP0A 1L6RA 3U7FB 2EATA 5A3RA 2BY4A 1JUDA 1RPZA 2HF7A 4DFDA 2MU2A 5AI0A 4NV0A 3QXGA 2B8EA 3NRJA 2FEAA 3ET5A 4OCZA 4BEWA 1ZRMA 4PNHA 2IOFA 3MC1A 5JJBA 1NNLA 2YMMA 5AW3A 2W4MA 4NABA 3P96A 3OPXA 2FI1A 1U7OA 3WGVA 3QYPA 3U19A 4DCCA 2FPXA 3WGUA 3N8GA 1Z4LA 3NALA 5AW4A 2HI0A 2I6XA 2PKEA 4NWIA 4KX5A 3QUCA 1ZD2P 4UARA 1ZJJA 5AK6A 1YJ5A 2G0AA 1RLOA 4FYPA 3U13A 4RETA 2CFRA 3FM9A 5AKIA 1U7PA 4AS2A 1ZOLA 5ALYA 5ALVA 3ZX5A 1O08A 1CQZA 4NFLA 2RB5A 5AW1A 1ZS9A 2OBBA 3CZ4A 4XOUA 4HGOA 5AM5A 2FUCA 3L1UA 2MU1A 1U2TA 3B9BA 4G9BA 5ALFA 5AK3A 5ALJA 5ALXA 5AKXA 2C88A 2ODAA 3SKYA 2ZBGA 3HYCA 3EWIA 3QU9A 5ALTA 3NIWA 3SLRA 1VJRA 2PR7A 5AHXA 1RMYA 3NASA 1N8NA 5ALLA 2X4DA 4EX6A 3HLTA 1VJ5A 5ALUA 3QLEA 2YJ4A 3MPOA 5AM0A 1T5SA 1F5SA 3M9LA 3SF0A 3QUBA 2YMPA 2ZBEA 1L7PA 2B1QA 3L7YA 3L0CA 2WF5A 2WF8A 3IB6A 1RLMA 4CNQA 3M1YA 4BX2A 1Z4JA 5AVYA 2FDRA 2HOQA 5AVRA 4L6CA 3KOOA 2ZOSA 2O9JA 4HGQA 1S2OA 3VAYA 1T9ZA 4I9GA 3ZVMA 3OCXA 3OCUA 2IOHA 1SU4A 3N07A 1J97A 4E88A 3WKAA 3AR6A 4EEKA 4L6AA 3OTQA 3L8HA 4IG4A 3FZQA 3OCVA 4BX3A 4C4RA 4UMVA 4OFZA 1X42A 1WPGA 1U2SA 3MMZA 3WK9A 4Y2JA 3WKDA 4Y2VA 3QNMA 2HF2A 2G09A 5AKLA 2QYHA 2CN1A 2FPWA 3L8EA 2FPSA 1YMQA 5AVZA 2RBKA 4JDPA 3AR5A 4B6JA 4UW9A 3UM9A 1L7OA 1Z5UA 4UAUA 1L8LA 5ALOA 5ALGA 4QJBA 4OD0A 4OHFA 2HEGA 3EF1A 4XPZA 3RFUA 2R8EA 2FUEA 3UMGA 2R8ZA 3KBBA 2G1AA 3FPSA 3PGVA 3QGMA 3U7HB 4Y2YA 4KN8A 2G08A 3OCWA 1NF2A 3QU2A 4UMDA 4KX3A 4BYGA 2IOFK 2ZXEA 2CFTA 2HX1A 5AI6A 3ZWKA 1Z88A 1RKQA 1XPJA 3KD3A 2Q4TA 2W43A 3L0YA 2WHEA 2P27A 3IRUA 3F9RA 4YIKA 5ALKA 3OCZA 4C4TA 2JAUA 1VFPA 3BWVA 5AKEA 2DQSA 5AKKA 5AIBA 1Z4OA 5AKHA 3GYGA 4I9FA 4GXTA 4O8CA 5AM3A 5AVVA 1XVIA 3WK4A 5AI4A 3A1DA 2FPUA 5ALMA 2HCFA 3N28A 1Y8AA 4FFDA 2D2VA 2B1RA 4UMFA 5AW6A 3ZI4A 5ALHA 3WK6A 1RDFA 3L8GA 3WKBA 3TLMA 1Z4KA 5AI9A 1RKUA 4BNDA 2YFYA 1KYTA 3EF0A 1TJ4A 5T41A 2R8XA 5AKZA 2VKQA 4QQFA 3SD7A 2QLTA 4CF5A 2HDOA 2JGAA 5AVSA 4EX7A 2IA5A 1L7MA 1QH9A 1XP5A 2EARA 4KNVA 2I7DA 3AR3A 1RLTA 1Z5GA 2BDUA 1RRCA 1TE2A 1ZD5A 5AW9A 3OCYA 5IT4A 3WK5A 3E58A 3EPRA 1TJ3A 1U02A 2C8LA 3N1UA 4IFTA 5A3SA 1WVIA 3WK7A 1CR6A 5AIAA 2G80A 3ZTWA 1SWWA 1LVHA 3WKCA 4EZEA 2OA0A 1TJ5A 5IS2A 1ZD3A 1Z4MA 1L8OA 2B30A 1Z4NA 3I76A 3RF6A 3L5KA 4XE5A 4HAIA 2JAWA 3ED5A 5AVUA 2IYEA 1MH9A 3I6BA 1RMTA 4L57A 2GMWA 5IT0A 2I55A 3KDPA 1J8DA 2I54A 4UASA 4BKMA 3IJ5A 4DWOA 5AKYA 4H1WA 2P11A 2AGVA 1QQ5A 1RMQA 1YV9A 2OYCA 3D6JA 4ZEXA 4EELA 3NAMA 4BEVA 5AESA 3QUQA 4Y2SA 5ALNA 1Z4PX 2MSNA 5ALWA 3B8EA 2YN4A 5AK5A 2WM8A 4Y2RA 3I28A 4ZEWA 3AR9A 4BNDB 4Y3UA 3QU5A 2YMQA 4HGNA 5AVXA 3UMBA 4BX0A 3ZX4A 1N9KA 5AI8A 1RKVA 3ESQA 1NRWA 3A3YA 2AH5A 4EENA 1T5TA 3E8MA 1YS9A 2GFHA 3NANA 2C8KA 3AR2A 4G63A 3SMVA 2AUTA 5AW8A 2WF7A 3N5KA 3ESRA 5ALSA 5AI5A 3S6JA 3DAOA 3PDWA 4Y2XA 4F71A 5ALQA 4MWOA 2GHTA 5AW7A 3ZW7A 2CFSA 1Z4QA 2WFAA 3SKXA 4FE3A 4HGRA 3QX7A 4Y2QA 2HSZA 3L8FA 5AW0A 2C9MA 3WKEA 1K1EA 2GHQA 1RQNA 4F72A 3FGOA 4UU1A 1RC8A 2OM6A 3DDHA 2ZBDA 3L0BA 5AKGA 2JARA 2B82A 3B9RA 4YCNA 4KYTA 3R09A 2I33A 2P9JA 3PGLA 4CF3A 4DW8A 3KZXA 2B0CA 1O03A 5AVQA 2C4NA 4NAVA 4ZEVA 3ZU6A 2I34A 3E84A 2GO7A 3I1YA 2RARA 2YJ3A 1PW5A 4YCLA 3ONNA 3UMCA 4CE6A 2WF9A 2WF6A 5AKJA 2P69A 4C4SA 4UU0A 5ALPA 5E0OA
chains in the Genus database with same CATH superfamily
2YV4A 2PEYA 1SHUX 1FMJA 4PZOA 2G4CA 4FYVA 2V59A 2BQRA 3RRNA 3C3XA 2XITA 2KM1A 3VPFA 3AXTA 2XCQA 2HU7A 3Q8KA 1CP2A 4CU5A 4DB4A 4JBLA 4IVQA 4DXDA 4QO8A 5INTA 2BUCA 4FLMA 1YNSA 1P4GA 4R8MA 5EJFA 2BFPA 4H60A 1SELA 2XKAA 4F4IA 1QQ6A 4PBSA 2HKIA 4TTQA 3U49A 5ITZA 3HI6A 2OSVA 4OP3A 5BQXA 2ZI9A 1SUSA 2VYVA 2X8LA 1K92A 3AHHA 1Y4AE 4JJZA 3FF1A 3TW0A 2H0QA 2FEOA 5KFUA 3B0XA 1QH1B 2HHVA 4KLSA 3ZZTA 2LV8A 3LYHA 3RC1A 5A6SB 1HO3A 1CDDA 4ETNA 1QDEA 5EHZA 2GAFA 3BT7A 2H0RA 2NYAA 3BCRA 1QFMA 4HWKA 4WNAA 2VF4X 4C0SA 3OHPA 5DM60 4UBNA 2WIAA 5DBEX 3I73A 3HEMA 2WIFA 1T8WA 4CCWA 4ODIA 1UBGA 3NS1A 5DM4A 1YO6A 4GKJB 4RETA 4I4NA 3NP7A 3I1FA 5ALVA 3ONEA 3D0QA 3OOSA 3FNHA 1SXHA 3HS3A 4Q7MB 1KETA 1UBLS 4IXDA 3EIOA 4ZYVA 4N9WA 5ALJA 3U7QA 5TQVA 2H2GA 3MERA 3AF0A 4CQMB 3F98A 3VVMA 4IQ4A 1SQFA 6LDHA 4LCBA 3KUCA 5EUQB 3HCWA 3HLTA 4RVDA 5F9FA 3W9UA 4MV8A 1VMIA 1WHTB 3F7MA 3T1QA 1QGDA 3RC3A 3TLGB 1EP1B 2W42A 3I45A 4V2IA 3V7NA 2AZXA 3B13B 3ENWA 5JO9A 1N9GB 4PSUA 3DWEX 3HY3A 1JDBB 1Z8HA 5KG5A 2P8JA 4KIFA 1G42A 3MWJA 1I51A 2BHNA 1SVOA 4H59A 1CR2A 4YJHA 3INRA 2YJTD 3MRTA 3UGTA 2A30A 5FF9A 4L3WA 2W43A 5A62A 4N5DA 3M9XA 5ALKA 3D4LA 3MDAA 2C94A 5I7AA 4YMHA 3EIEA 5K0GA 1KC1A 2ZM5A 2WI8A 3K35A 4UUOA 2ORIA 1MHPA 5NULA 3EZ2A 1EX1A 4F1JA 4P31A 3FCEA 1ZGZA 3RJJA 4JOSA 1FNNA 4NAUA 4AICA 1ML4A 1DIHA 5IDWA 5KT7A 1P1HA 4QTTB 5FI5A 1T2EA 3KUKA 2OYSA 3EDMA 4WK6A 4BJ1A 1DL5A 1CHNA 1PVOA 3UH0A 2X7HA 2FR8C 3EPIA 5B3JA 3K0KA 5CIQA 4RPYA 2AJCA 4KDFA 1NQTA 3JVVA 3K72B 5J0RA 5KNIA 1P2GA 1NMEA 3GLHE 5EQFA 4OB7A 1M2WA 2WUWE 5C8YA 4L57A 2NUAA 5GINE 4H4CA 3CN7A 4HDRA 4I2DA 2CNKA 1F3LA 3MGHA 2GN8A 1T7PA 3ABIA 1D7AA 3KSBC 3V4SA 2WB1F 2PVSA 3VDMA 3CSSA 4JLNA 3WL4A 3D3KA 4DUYB 3HFRA 3HGQA 1FUIA 2QPAA 1LKYA 1C4KA 1GPDG 3Q11A 2ZI4A 4HB2A 3DE7X 3PTZA 1JECA 1MJ5A 1WCYA 4YRBA 3V8BA 1JG2A 3GJTA 1BDJA 1XEXB 3BFXA 3SQLA 1I7NA 2HB6A 2V7UA 2I3AA 3O0FA 1LS1A 4BLTA 3WI7A 2K4HA 5JI2E 5J2FA 3WIOA 3KAPA 1LS6A 4CF3A 1RJGA 3F5SA 3K92A 5CJ7A 2YJ3A 2Q6IA 1DQPA 2F1OA 3BH6A 4UDYX 4X97A 4B46A 3NRBA 2KJ5A 3H0MB 1NN1A 4F5NA 3JQGA 4PQGA 3RVBA 6NULA 3PTLA 5EMNA 1WS6A 3S44A 3C5EA 4R51A 2ZIUB 4A2WA 1MB3A 3PEUA 1ISMA 4EGAA 1IK4A 4X24A 3WWZA 3OZBA 1M5RA 4XW2A 2OBNA 3OTIA 1PR0A 3Q0EA 2QVYX 2XGMA 3ULKA 5LA6A 3D3WA 5GTDA 3M6LA 2EFDB 2P9YA 1XEWX 4Y2TA 4INZA 1E9DA 3B6IA 4YUYA 2JGDB 5J0UA 5D6OA 1IYZA 4XH9B 1UPTA 4NECA 1JTVA 5F7JA 1IM8A 3VOTA 2RP5A 3H1PA 4BX9C 8ATCA 3KQVA 1UDRA 1CB0A 1GL9B 1NYQA 2A1TS 4LVOA 1D1SA 3WGVA 5KG3A 1ZC4A 3DOHA 4XVQA 5CDSA 3N8GA 5FJJA 5EYPB 1Z8NA 3GMSA 3F6SA 5I5GA 4PL1A 4M38A 3M2TA 1LK7A 4D4MA 4DR3B 1Y6JA 3LOUA 1UA1A 2I4IA 2RHJA 1LF0A 4MCJA 1G9SA 3VYRB 3NP9A 2IYTA 1PZMA 4WWHA 1DAIA 3I61A 5L40A 5A04A 5ERXA 4QOGA 2H00A 3UFXA 2B4YA 1X66A 2VQ6A 3KYBA 1AY0A 3BK1A 3FJYA 4D4GA 4F4JA 5E9QA 1KERA 3RYIA 5CRXA 5KCZA 2E8PA 2C2XA 1DINA 4HDKB 3F7TA 1C9MA 1Y34E 4G8BA 4PO8A 2FPSA 2A67A 1JHOA 4WH0A 5EL0A 3SEZA 1J56A 3IMGA 4WLEA 4B4WA 4FR5A 4KRXA 3PGVA 4EGSA 2OV3A 1SXJB 1FSPA 3KHRA 4Y2YA 3IIKA 4YMNA 4K4GA 3DO8A 3PJGA 1SGWA 1AB5A 1BSVA 2JLAA 3UYKA 4KQ1A 4XEHA 3OMLA 3E48A 3MGCA 1M1YB 1SCQA 4MARA 3D6MA 1QO0A 5EMLA 3RB0A 1T13A 3PHBE 1B7GO 5FUVA 4X62B 1BQEA 1TAMA 5E6RA 3TSAA 4C0BA 4UE6A 3N8IA 3HM9A 5AOVA 5CM2Z 4PAOA 4JOBA 4USAA 2MHCA 1ZBQA 3OP4A 1CR4A 4P6VF 1ZIPA 3B1JA 3VDRA 2PPLA 3HO1A 3SYLA 3HJBA 2PFSA 1WXEA 2CPRA 2ODTX 3SDZA 2P5TB 4RIFA 1KVUA 5DP2A 4M49A 2UUOA 1FLDA 1BS9A 2CYBA 4GOLD 4AO6A 4NRDA 4HDNB 4Q0MA 4IJVA 5JC8A 1E3MA 4FFSA 1JRPA 1G18A 4DBLC 1ENOA 4I1IA 3DVLA 4V0OA 5AQEA 1EP9A 5DBCA 1V16A 3TIXB 5FFMA 5LMZA 1OI4A 1V6SA 1HPLA 4X65B 1DEHA 4I19A 2BVNA 3AJRA 4AKSA 2FNAA 2YJZA 1KYVA 2JD1A 3AHEA 3NR2A 4RKFA 1FTYA 3OZWA 5C80A 1C1XA 3PFNA 2BELA 1HOTA 5DLEA 5K01A 4MJXA 1HQDA 5FI3A 3DVAA 4H31A 1XJ0A 3FI9A 4CYMA 1G21A 4GE0A 3QHPA 4QYXA 2ZSHA 3AF1A 4YR7A 4P4SA 3F7OA 4II7A 3OOEA 1KXJA 2CFSA 3RODA 4HY3A 1KI1A 5TQ0A 1T9HA 4M9GA 2OZLB 1X6JA 3DDHA 5LLTA 2H51A 2JARA 3QUAA 3F6EX 4B9TA 5J4KA 5FUQA 4Z0PA 1RSZA 1CRQA 2WAXA 4PLZA 3FCOA 2WQ6A 3QIAA 1THTA 4PG8A 4Z4FA 1ESNA 4TUQA 3WADA 4WDRA 4HGPA 1VI6A 2RCNA 3V8NA 1Z5PA 3PKZA 3P97A 1L5HA 1ZD9A 2ZIEA 4GOJA 4QYWA 4WTOA 2DEUA 5FPPA 2J0UB 1TM1E 2DAPA 3NBFA 4WGGA 4CIAA 1ICIA 1Y82A 4YCMA 4Z86A 3NGXA 1PGJA 1PL7A 9ICLA 4DQUA 4OM7A 1RXSA 1N2JA 3A0BU 1WF3A 4A8JA 3UWPA 4BRUA 3TINA 4HYEA 2CNWA 1L5FA 2R8YA 1RQLA 1QV6A 4O4JB 4W7HA 2KYRA 3H19A 1MR3F 1DFGA 4ITVA 4XWKA 3ZTTA 1GZUA 2C22A 1ZC3A 3DZ8A 1XA4A 2W6CX 2Q1XA 2IEZA 4P7BA 3GEIA 1V85A 3ZZUA 2Q5HA 1ZQKA 3M70A 4YLEA 3JRWA 2Q8NA 1H66A 2KZZA 1W88B 2OVBA 4J9KA 2XNDA 1UR5A 3CN9A 5CDUA 2BEVA 4PTLA 2KFNA 3ABOB 1RAHA 1LBIA 2XAAA 4AJLA 7ICFA 1PTJC 3ND6A 3K9WA 2PKEA 2E5FA 3QUCA 1WVGA 3H2ZA 1T9CA 1I3CA 1WCIA 3U7JA 2HBZA 4EKIA 3CJQA 3UTDA 3REGA 1II9A 4JSYA 1KRPA 1YKFA 2C61A 3JVUA 1YR1A 3KWMA 2JLXA 1HLFA 4PSKA 1NK8A 1JHRA 4KFTA 1AS2A 2NVWA 5EZ6B 3OCJA 3NM6B 1BC5A 3RH5A 4DL2A 5DYIA 4BZPA 2Q3MA 3AETA 2YXLA 6ABPA 3EUB2 4LZDA 4G36A 4V0SA 1EBUA 2F3TA 4PZCA 3TFQA 4AIIA 3P9NA 3B2QA 3H17A 3P9CA 5EXSA 2X5NA 1PGPA 1NY6A 3ETDA 1ZMOA 1JDPA 1ZXLA 3I4LA 2JLCA 1R3DA 4EHNA 2GAIA 1LRJA 3ENZA 4ND8A 2FLWA 1H6BA 1X7GA 2Y0PA 5IIMA 2KZMA 2V7QA 5ITWA 5CA1A 3RJ5A 4W9RA 4EK9A 3DTVA 2A57A 3G0HA 5ALOA 3N7SC 3QX3A 2BDTA 1PTKA 4P34A 4ZGWA 5AHRA 2FSVA 2ZSDA 5T7BA 2PNFA 3QU2A 1QKJA 2GJ4A 3LHSA 2GLEA 1KQGA 4WLVA 4II3A 3S2IA 2VHQA 5KWEA 4FUTA 4IDEA 3GMIA 2W8BB 1PVDA 5KYXA 3MUNA 2QKQA 1DXYA 3KLMX 3ZVRA 2RG1A 1Y33E 1ODJA 3PQ7A 2QRGA 2ZRJA 3JPRA 3ZY4A 2XIQA 5FWNA 4G84A 4CM3A 2HWUA 1YJQA 2DTDA 1XJCA 3C1UA 3AP3A 5LM3A 3ZQKA 3T3NA 4XYBA 1MEEA 3IIMA 4Y67A 3ER9A 4XRGA 1Y9DA 4OI4A 3DE4X 4KN6A 3RHZA 4JVMA 2BDPA 3FPFA 4L1KA 1CUWA 4ZCPA 3WAGA 2JJ1D 1UJ2A 1EFRD 3RJ9A 2FY8A 2CW5A 5CEEA 2QE7D 4JR0A 2IEGA 3UMMA 4RLSA 3O8LA 1BCRB 3TQTA 2NTEA 2HIAA 1R15A 3VZSA 3HBLA 4C7KA 4R0MA 1QC5A 5AJVB 1JA1A 3AR9A 1DEKA 4IMRA 1NQVA 2QX6A 2IXFA 1TVCA 1N9KA 2OWEA 3ESQA 5HCNA 1DC5A 2VVTA 4ZA2A 4YJ3F 4TXHA 5JBNA 5JY1A 2WAAA 1K5HA 2J3EA 3A4YA 4PJ0U 1JWLA 2X19A 2XE4A 3X44A 5JSUA 2J0VA 2IMWP 3IPAA 1ZQFA 5E9JA 2ZSUA 1VMAA 3H7IA 1P1FA 4HCJA 3EIXA 3T0GA 3ZHYA 1KZ7B 5DRTA 2WDZA 3RS0A 4MDYA 3P9KA 1PWYE 5A2GA 3KZXA 2PFOA 4C08A 3SXJA 2GYWA 1EMDA 2VYQA 1GRCA 4IR1A 2Q2QA 3ID6C 3UMCA 4CKWA 1QLWA 4BMSA 1CPYA 2NOAA 4HDQB 4O2AF 1SU8A 4ZTZB 2QRPA 4YX9A 1SQGA 3RF9A 1RYHA 1U7TA 1ZH8A 2QJOA 3I3OA 1FNCA 2W37A 2VJDA 4DL5A 2YYAA 1C20A 3KC2A 4Y8VA 2QRVA 4I4TA 4WCFC 5C32A 2BM9A 1U63A 3EXEA 1M2JA 5CVEA 1DC7A 2YJ6A 3FR8A 4OU5A 2QLBA 2JG3A 1CRZA 4JUAA 1CIJA 4FFLA 5EWEA 3TRJA 4N82A 2Q3CA 2Q3DA 3EJWA 2DOKA 4ARCA 4R1PA 3GUYA 5LC1A 4QXOA 1NJ5A 2ZS7A 2I8AA 3B1KA 3KEFA 4UAVA 4GFDA 2HJ9A 4N5LA 1E8DA 5DVZA 1W47A 4KUGA 1HNNA 4IIHA 4R1UA 5KI6A 4IYRA 5H3HA 4E6EA 4C04A 4LFBB 3BD9A 4YRPA 2QAJA 5IPFA 5BSVA 1Q20A 1MQAA 3CISA 4IP0A 3OY7A 2WJWA 1B93A 1W6RA 3K5HA 4RSHA 3WTBA 1CY4A 4LC9A 3Q3JB 4C7OA 4WI1A 3CPJB 4GPIB 2BSQA 3VISA 5FBLB 1S0VA 1WWVA 2MDTA 5BSTA 3STTA 4RPCA 4KLCA 5EWFA 3J81k 4RENA 2G8NA 1OSNA 1XV5A 4FDMA 5EJ8A 3PO5A 1CF2O 2DB3A 4G1MB 8ICXA 1CRWG 3KJFA 2GM4A 3U3DA 1NXQA 2K87A 5BPCA 1F48A 3RHFA 4J1TC 2VXYA 2KMDA 1Z6TA 2P0YA 3EFHA 1QB8A 2FQQA 2A92A 4LRYA 4CEIA 1Z5UA 3CVWA 5ALGA 2OAEA 4TSRA 3NIBA 4MRNA 4A03A 4QZCA 1A4UA 1RFGE 1DT3A 5A9RA 3R5FA 4BYGA 3ENVA 4MJ3A 1TZJA 3LF1A 4EVQA 2I1QA 3FROA 5CXXA 2RLTA 2C5SA 4UVGA 5EOVA 4BVLA 3HDQA 4GPEA 4GEGA 3UMJA 2R7LA 1KIAA 5FHQA 1KRHA 1V4BA 2WJPA 4B6RA 2EXXA 5F9NA 2ONCA 2JCVA 3AT1A 4LSZA 3X1DA 3VAAA 4DLAA 1UKYA 3C74A 2W04A 2ZAIA 4K9NA 1MRNA 1QH9A 5K0LA 3ND5A 4E2ZA 1R5NA 1D9FA 1IQRA 4UNIA 3THXB 1MXHA 1L1RA 1A9OA 4GZMA 1FU4A 1WSWA 3PFBA 1W5SA 2ZB3A 2B30A 2VOEA 4U0KA 1E9SA 1FDSA 2IYEA 2W54A 1Z0FA 5TGTA 4ND2A 4AJPA 5MF6A 2A9FA 4ZVKA 1KP9A 1H2YA 2IUTA 3IE0A 2Z4RA 5B58T 3GYBA 1DIAA 4GU5A 5KAIU 5F3DA 3A70A 2Z5GA 4HGNA 3DL2A 4IL6U 4RKRA 5MHTA 3EVGA 3DL7A 2JEIA 3IHKA 1JHQA 5JD3A 4S12A 1ADGA 5LQRA 3BMOB 2ZB8A 1A9PA 4J43A 2Y67A 4IQWA 3GQVA 1J1UA 4E31A 5ELXA 5FLEX 2BCRA 2Y4OA 3W5HA 4FE3A 1J5PA 1TX4B 1P7ZA 4ZCSA 2GRJA 1AF4A 5FT9A 9ICPA 1Q7CA 1M1ZA 2P35A 3OWXA 4PRKA 3SR6A 1VSBA 1ZGAA 2AD5A 1Z6QA 1KL7A 2SBTA 1IVSA 4ZYWA 5TJHA 5CLFA 1H6CA 1OZGA 2J9YB 2XNCA 4BASA 2R8RA 1ZUIA 1D8BA 2FWMX 1G1AA 3CUVA 1JFSA 1UBFA 3PL5A 5TJ9A 1MV8A 2I7TA 2DPXA 2R96A 1DRGA 2HPVA 2X8JA 3TI0A 3NBYC 4FB4A 5DASA 1N4DA 2OGWA 3MT7A 3UJ9A 2AUMA 1MABB 1QP4A 1G63A 1XXHB 4DQIA 3KB6A 1PFYA 4BRZA 3FFXA 4U2CA 3FNEA 4BP1A 4D41A 5H3LA 5JNSA 1IBMB 3EGXB 2E48A 4OSOA 4WHMA 3BRWD 2VT2A 3O7WA 4WN3A 5CA0A 2HHSA 5EPOA 4RIEA 4JLAA 4EA6A 1W35A 2ZG6A 5A4FS 2PGNA 1OX5A 1EK6A 1NUUA 2P6MA 3ECCA 3F3SA 1DBSA 1L5ZA 2NXWA 3A26A 4YMLA 2FEAA 3DFUA 3A05A 1HDRA 3ZK7A 4AZVA 2NUPB 3JWHA 2IOFA 2BFCA 2NU9B 2YMMA 4ECRA 4C2BA 3ND9A 1BA3A 4DCCA 1Z9BA 1WDKA 3ASUA 3JQEA 4HAZA 1BPZA 5AK6A 3A0HU 4KQ6A 2BW0A 4EW2A 2QN3A 4NFLA 1GKYA 4H0NA 1HDYA 2WSYB 2NZUG 2MU1A 1QTMA 3MRVA 4W8OA 2ZIXA 4UB6U 3D31A 3W0LB 1Z16A 3FTCA 3O75A 1V9PA 5ADWA 1VTKA 3F9CA 1JYSA 3O8QB 3WWEA 3QLEA 4IOKA 4RF4A 4PZ9A 3U3KA 4LY3A 1B1AA 2H4XA 5KNBA 2WF5A 2BEUA 1R0LA 1D9DA 1MU0A 1THGA 7ICLA 3ZKWB 3PA8A 4F84A 4L74A 4OL9A 4EEYA 3SYRA 3C7DB 3KALA 4P5DA 2GPAA 3T99A 3K4QA 3WLHA 1U0EA 4WFJA 1IBSA 3SV4A 3OD5A 4MR7B 3ROFA 1OH5A 2H9YA 4WKGA 5KTMA 4QZAA 2EAMA 4GWGA 3MTDA 1UOQA 4C03A 5IAOA 2JH7A 4NU0A 2ACEA 1DTSA 1QCCA 4RC9A 1KSGA 2BH2A 2X2FA 1CZHA 2C5AA 4C8MA 1FSZA 3L9WA 4V0LA 1E6CA 4X20A 2C5FA 3QEMB 2W2LA 4MLPA 3BWVA 2GM3A 2NUTA 3SOPA 3GYGA 1NWCA 3A7DA 5DN6D 2IYQA 4QOFA 4GKKB 3OAAD 2P9ZA 4PG7A 1EUCA 1JEDA 3G5AA 4BNIA 2C82A 4F9FA 5HILA 2PV7A 2VZ9A 4BUCA 1QCYA 3HMKA 4P7FA 1Y1QA 4IIJA 4K2HA 3QV2A 2EQ5A 4HG2A 4QOJA 4XZ3A 3VPBA 5DLPA 3UFBA 3BGWA 3TVYA 1LEHA 2DFVA 4OMCA 3BN3A 4M0MA 4R1QA 1FP4B 2AJQA 1FFSA 2P62A 1VL6A 3IKTA 2DPYA 1NJSA 1IATA 4BCBA 5DG7A 2QTAA 5DFAA 7ICGA 4K9MA 3BQ1A 5CYPA 5HX7A 3FZGA 1AGYA 4EPXA 6Q21A 2PBRA 2WICA 5KSPA 1I2DA 1B14A 2P3SA 5KYUA 5KSZA 4UM8B 3QLJA 1OD6A 1NUSA 2ATVA 3C2QA 5J2HA 4KN7A 3ND7A 3ANXA 5DOZA 2H92A 3G2JA 3L4SO 1YL7A 3SNHA 2RHHA 4KK4A 3ELWA 4RNMA 1EUDA 1YJAA 1X9XA 5HKOA 2HQOA 1CUYA 3BXOA 3OSPA 3V1TC 3WRVA 1X3LA 2P6UA 2ZBDA 3M6FA 1K1SA 2DL0A 1KFDA 2CLKB 2I62A 2HU2A 2RE8A 1IC6A 1B2LA 3ANNA 5CB1A 5DXFA 5JSHA 2DJ5A 2W6ID 2B8WA 1YBVA 4OLBA 1ZU4A 2G63A 4CEHA 3URKA 3TARA 3DXFA 2DWCA 2BEWB 1RZRD 3IEKA 2W3SA 2QTLA 4R98A 2UVRA 2IX3A 4P3PA 2IY9A 3OPQA 4ZDKA 3ZVLA 3QLVC 5LP1A 4UPEA 4F4CA 3JVDA 3FPBA 4NC9A 3BS5A 4S35A 3I6QA 3LCMA 3RVDA 1V3VA 1U8AA 3S2YA 2FPRA 3G0IA 3L1VA 4HWTA 5WRFA 2H3IA 3U48A 2FE9A 3EA5A 4MK4A 4UHEA 1H2EA 1PX2A 3V9PA 4DJJA 5EWJB 5CAEA 3D3EA 2H7YA 1EQ2A 1CUFA 4C7JA 4BB0A 1KJ9A 4DQXA 13PKA 3GEBA 1FCJA 1Z2OX 4FO6A 3UZUA 5K05A 1ZVVA 1YB5A 4YRAA 2HT1A 3MRXA 1Y88A 4KH0A 2XUOA 5CPFA 4HDSB 3W3ZB 4KX5A 2Q4EA 5KFLA 1XF9A 2VTBB 3FUCA 4IOLA 1BE8A 4XA5A 4MFFA 5IBPA 3NHFA 3T4EA 3M9WA 4PFJA 1IB0A 1NC1A 4QWMA 1CUZA 5DIFA 4IMIB 2EKLA 4L15A 1LW6E 4RULA 2WIJA 1DIOB 3NHKA 5HW0A 4E5KA 1T8UA 3WAKA 2O3UA 3KT3A 1U8UA 1O77A 5AQ1A 1O94A 2Q21A 4KN5A 3BXXA 3DQZA 4FU0A 2RAPA 5J4LA 1DUSA 3PHIA 2Z6AA 4KAXA 2YTUA 1HMYA 1JQKA 1EVQA 4BECA 4EYGA 2KSOA 4EWLA 2DC1A 1NDUA 4TS1A 4FEGA 1QE3A 5EKUA 1DDIA 3HB9A 2QD3A 4M0CA 3C85A 4JYCA 2VNHA 1AQUA 3E5MA 1KJQA 4RQ6A 4B6JA 4UW9A 3ZYCA 4YQZA 4XVHA 1EH5A 4D6PA 3OHBA 2DTXA 3KQUA 4OD0A 3DAFA 4H7DA 3CH7A 4CRWB 4YQFA 4XUDA 4EHHA 1ZICA 5B3KA 3KOZA 4GOKA 3OCZA 3DNMA 2OO7A 2QTVA 1GCUA 1XKTA 4KB5A 2XMRA 2PMWB 3AEUB 1F20A 4QYTA 2FW7A 3D6TB 1E79D 4K6KA 4Z2YA 3H1AA 2SNIE 3A9UA 3OQ6A 2UYQA 3EXHA 4XASA 2IEDA 1E1NA 5KL8B 1Q0ZA 4FNAA 2HDOA 1WW8A 1V9CA 4WXPA 2DT5A 3HDVA 5GPBA 2JA1A 4B9NA 1KR5A 2O0HA 2QMYA 4X45A 4N6OA 2EOAA 3HB0A 1N2XA 3EPRA 1Z2DA 4F4ZA 4R01A 3FYDA 3VO2A 4BQRA 1UADA 1KOGA 3T4PA 1HLDA 4PYMA 3HUEA 1XP8A 4JI8B 2VHJA 1QZTA 2PO5A 4M83A 4BBAA 3FNRA 3U7IA 3D1LA 1N6LA 4QGAA 4Z9FA 2RHMA 1XNSA 1JJBA 4F4YA 4B7CA 4QVIA 2ZXIA 3I6MA 4I5EA 5KL1B 4KBFA 3KVRA 1IL0A 3F1LA 4H7HA 4B7UA 4P3OA 2PA0A 1A72A 4ZK6A 2ZUCA 4B3DA 1RYEA 2B78A 4M8KA 1F8UA 4B74A 2HA3A 1B26A 1SRQA 2G83A 4RTJA 1HEKA 3JQ7A 4X8LA 1G291 4PYJA 1PS0A 3S6JA 5JZMA 2B3DA 4Q3NA 2CBGA 8ICYA 4B9LA 1LVUA 3I12A 4PHCA 4UU1A 4KGXA 1K5PA 1HURA 4F5ZA 1DJQA 4FE7A 5T3YA 3BD7A 3L6DA 1P3DA 5F1OA 2RGRA 2XYPA 1OZHA 5E3IA 3USES 3ROEA 2XZOA 4F3OA 4MHOA 2IPMA 4COOA 2NP6A 5H02A 2IOYA 5LLSA 1HWYA 1WQ4A 3VO1A 5K6RA 4YGYA 3UMFA 3BZWA 1VM6A 2P4EA 2H65A 1NC3A 1V97A 4NOLA 1M3SA 2AOWA 3GPLA 1L4GA 4OUDA 3RVLA 2VANA 1HYQA 2ZYHA 3ED1A 3ZGOA 2QMHA 5EGNA 1DJOA 4LZNA 4JWKA 3ETGA 1NIPA 4J2HA 2BFMA 3V42A 3BBLA 2ZRGA 3EYZA 4G2TA 4ER5A 4F5PA 5ITVA 2AMJA 3PS9A 4BUGA 2HQRA 2WZBA 3FPGA 4I6JA 4EYHB 1HBJA 2REOA 1YFZA 2P9BA 1TIKA 2F1HA 2ODBA 3FPJA 2FW1A 2C31A 1Y4UA 1E2EA 4HDAA 1V2GA 1AUPA 5M04A 3AB3A 2VP9A 4I4CA 2XNHA 1U1IA 2M9MA 5L3QA 3GLKA 1IHDA 3C8ZA 3I92A 1Z3EB 1KQNA 3Q10A 4FOLA 1SUCA 3A32A 2ZAOA 2AL7A 1C3EA 1ZS9A 1MJGM 1WY5A 3OTOB 3RGGA 4MF8A 4YAEA 2IGTA 2AYYA 2ZVQX 3TB6A 3MAGA 3WGNA 5K0SA 4JGBA 3PQ2A 4YBRA 2GFQA 4BP8A 4O1IA 3AEYA 4AUMA 4R8UB 5BNWA 1N8NA 2COUA 4QNLA 1ODLA 2CE2X 5L4NA 4IJMA 1X1DA 5B64A 1P0MA 3BD6A 3VHXA 2Q5LA 2ZI5A 4MXDA 4IXTA 4HVLA 3PXCX 4GVXA 5B37A 3OZTA 3ZNNA 1ZAKA 5JSYA 1XQ9A 3FTDA 1LTKA 1SU4A 4TX1A 4FCTA 2CDAA 1M10A 1GQQA 1NVEA 2M9NA 3ZIAD 3NHWA 1L2TA 4PGAA 1Z18A 2H5JA 4N0DA 2F67A 1N5OX 1YS4A 2R6HA 2XYHA 3NVDA 2C5EA 1L8LA 1W7AA 1I2CA 1OGYA 3RB3A 3F49S 3S1AB 1ATIA 3PPWA 4C0QC 1MO2A 3G6XA 1XZCA 4A1OA 3OCWA 2C2WA 2XUFA 2ZTHA 3F9RA 3AUKA 1YA8A 4ZOEA 4JYPA 3LX8A 3DZFA 3HJAA 2G7MC 3D4PA 2JJQA 1R8SA 4ZQCB 4REQA 1I01A 2VJCA 3TLMA 3EFOA 3G5MA 1TJ4A 4YT2A 2NZVG 4NHEA 2BOVA 3O8OA 4U2GA 4K7JA 3KU1A 4GL2A 4DSOA 3I09A 4OJPA 1B00A 3GCXA 4D3XA 1RQPA 1S8AA 4RV5A 3EHEA 3VR6D 5EIOA 3G7UA 4FHCA 2LUOA 1T4GA 1FNBA 1PDOA 5FUBA 3UKDA 4C80A 3C5WP 3JASB 3IO3A 3FJOA 2OGTA 3ITDA 4YNBA 3QF7A 5IHPA 3HCRA 3TDMA 3ZE1B 1CS4C 3CEAA 1KDZA 4KBYA 1UC4B 1JEQB 3D0RA 4EELA 5ER9A 3I6YA 1II8B 5JH7A 5G4LA 1OXXK 1EQAA 3TNDA 4JT4A 1SHJA 3OO1A 1XN1A 5H4HA 2WTBA 4Z0TA 4BX0A 3M6XA 2GRUA 1GSHA 1F7VA 4GDMA 1NAHA 3VZBA 1EDDA 1EJBA 3SJUA 2BRUA 5JLJA 3WMEA 3SDSA 1OV6A 2MSDB 2AXPA 3CLRD 4R6WA 1AS3A 4OXYA 3QI7A 2QP9X 3M81A 2GVZC 1BE1A 3DDUA 1G3QA 9ICWA 5TF0A 3AP2A 5I47A 4GF5A 2JLQA 4GWLA 1G7RA 4KYTA 3R09A 3T9DA 1LBSA 4ZD6A 4L5AA 3N2IA 4UUQA 1ZFNA 5G1PA 4CQJA 2A33A 2BAGA 4PPXA 2Y0SC 5FI1B 1FFUA 5J2DA 3HWRA 4DMKA 3DUFB 1LSSA 3UPQA 1G38A 4ZCIA 1GRRA 1O97D 2ZUEA 2PXCA 3W5BA 1NXPA 2SECE 4Q45A 1UZUA 3C7CB 3LQKA 4C0JA 3G02A 2IXGA 5KO2A 1IFXA 5BNTA 1QF7A 3S8MA 3V7YA 1KFSA 3NYIA 4K4IA 4MRVA 4XFKA 2P1ZA 2JIZD 2FW8A 2W2KA 3E2IA 5J0PA 4PTZA 3G2PA 2FQ1A 2HJWA 3PCTA 1M54A 3EXIA 1UC5B 1MX1A 2DPIA 3PX3A 5E8JA 1VP9A 4D0RA 3FVQA 5CG2A 2O8EB 3HH8A 5DDMA 2ON6A 2HEIA 3FHJA 4HRVA 2YH2A 1YI0A 4WZAA 4OHPA 1LV5A 1XMQB 1RWKA 4BP9A 1CS0B 3RWOA 4WAUA 4Q03A 1ZRMA 3ACCA 2W4MA 1LDEA 3EEBA 3PNLA 2GF2A 3U80A 2H5XA 4FN4A 2FA9A 3M6KA 3FM9A 1IXYA 1Q3UA 3NEJA 3ETHA 1R0YA 2A5GA 4FINA 4RELA 2BI8A 4UULA 4C2UA 1G5HA 2I1WA 3IPYA 2AU0A 2YC2C 1IHUA 1GNRA 5EIXA 3K2IA 4QPNA 5F51A 1E2IA 4G0VA 1LBTA 1KI6B 1QX4A 1UCFA 1ZLXA 1U3CA 3UH1A 1NKCA 4LXXA 3C45A 5LIPA 1IHXA 9LDTA 3RF7A 1WD7A 1ZWKA 1RWVA 4HKTA 5KREA 2HBLA 3VKGA 4B3HA 3KOOA 4L78A 4MW2A 2MJLA 4C7XA 4GQAA 4I2IA 2P79A 4HDMA 2WSSD 1AH2A 4OQXA 4L6AA 1CDEA 4KW7A 3GB9A 1N2HA 5A7HA 2H4YA 2GXAA 3D8NA 1IPFA 1JI7A 3OZUA 4GM4A 5TY0A 1ZZEA 2WEKA 3B7PA 1YDHA 4RQ8A 3EXFB 3LP5A 4NH4A 2H9AA 1NJ2A 4OHRA 2ZR7A 2JJ8A 4NXMB 2ZRHA 2ORED 3QFHA 3MM4A 4TS9A 1ZDMA 2OFPA 2ZSAA 5JT1A 3OT1B 3B20A 4N49A 4Q3KA 1L4LA 1JDUA 4F2RA 3UXOA 1ZQGA 6ADHA 4ECYA 1FSGA 3LO5A 3U09A 4UEKA 3IO5A 3DHYA 4DG8A 3G17A 1G5IA 4AJKA 3H2IA 1IXRA 4LHYA 4ZHQB 1EEXB 4CKEB 2Y1FA 3INTA 1DIRA 5KG6A 4PZAA 1UPCA 3BE4A 5LYJA 1J90A 3C3EA 5BYJA 1TJ3A 1CUBA 3CINA 5B6PA 5E1BA 3CZRA 3RREA 1J70A 1T25A 3Q85A 2EP7A 1B0UA 2YB4A 2HA0A 3U1VA 1TFUA 3MF4A 1SEVA 4ARZB 3QVUA 2UZ1B 5H83A 1IY2A 1G2OA 1JEJA 1POWA 5BPFA 3LNCA 3I9MA 5E7MA 3B9PA 3D4BA 2EP5A 4UBLA 2YN4A 3GNTA 3CLUC 4KDEA 3SC6A 2QL9A 3N59A 4QGSA 4P98A 1EIWA 4LISA 4S2EA 1Y80A 3ETRA 1TW2A 3D3JA 3GBSA 2ERCA 2V7BA 4JBGA 4LXQA 3D6VA 3PY8A 3WLRA 1T1IA 3D3QA 4ZU6X 2DPJA 3SMVA 1EVEA 3BE5A 1CY7A 5PGMA 2JZBB 5JS7A 1D1PA 3FVRA 2ECKA 1TI7A 4UCWA 2H2IA 4Z3KA 3LAWA 5BN3B 1J2MA 2LPMA 1BVRA 3R9XA 2AT1A 4JZKA 1DAKA 2A35A 2VPWA 4IXWA 2QNBA 2W2MA 3ERCA 3JQDA 5TT0A 3QVTA 4KN4A 4AUEA 3O9MA 2V3WA 4DL3A 3C0KA 2G72A 1URJA 2PKQP 1KFKB 4AZ0B 3W8DA 4DCMA 4EO7A 1I8TA 2WVAA 4O3FA 2GAJA 4UVHA 2QX7A 1GG2A 3QKSA 4YRDA 5BNZA 4MVJF 4YMIA 2O1EA 4PWYA 2YWJA 2X0EA 4X1IB 2HO4A 5JFTA 2FWRA 1EP3B 2PUBA 2PT7A 4EM6A 2FZ5A 1MCZA 5KG4A 821PA 1N32B 1E92A 4G4GA 3WQQA 4MVWA 1ZI9A 2DHDA 2GI4A 4IVPA 4L5YA 1P6UA 3C3WA 4G65A 1UDCA 3PWKA 3DHEA 3BC1A 1Q6YA 1AUOA 1P9LA 2XRFA 2DUMA 3BM5A 1SKWA 3ZNQA 4BQPA 3DVSX 3DKIA 1L5QA 5FH9A 3OF3A 2R4TA 1Z4LA 2PZBA 4ZYYA 5KTYA 4IX9A 3IG5A 4DL9A 4KQCA 5BV1A 1H1LB 4EO4A 4JBXA 1RWMA 1EDEA 1LPPA 2PKWA 1JEOA 2ATEA 2P6PA 2D4AA 1U7WA 3KLOA 4EOGA 3ZE0B 4Q02A 1L8XA 1PFUA 3PENA 1P0CA 1BEEA 3FKSA 1GO3F 1TM4E 5E6SA 3EUEA 2A78A 5FHRA 4DOMA 4BWVA 4HGZA 2PMKA 5AM0A 3OOYA 1QZUA 3OQVA 5CMLA 3FFWA 2PD4A 5LN1A 3UJ6A 1K27A 5JPDA 3ETJA 1LPBB 4WOBA 2H7CA 5IKXA 3TM4A 4FD2A 1I80A 3BH7A 4EEKA 4KMUA 5JWRA 4R9NA 4C4RA 2D7DA 1UMBB 4M86A 3M6AA 3PSTA 4Y2JA 2G88A 1EWYA 2LYHA 3LYSA 4NZOA 5H5JA 2QRZA 5BYKA 2PUFA 2W3RA 8ICSA 3RC2A 1JG3A 3UJPA 2FZEA 1N2OA 1Q7GA 4LI0A 3MFIA 2OYRA 2V1UA 4P08A 1OQAA 5KINB 1LA2A 2O14A 4LXHA 3UT6A 2C7RA 1RQXA 2EX1A 3R0VA 4EGCB 4RQ0A 4IKPA 2H06A 1J1IA 1QRTA 1KY4A 2HOFA 3GFFA 3UKJA 5FLKA 4I2VA 3IM1A 5CDFA 3ICEA 3VYTB 3HR4A 4G97A 3AEXA 3G9XA 1BS2A 3FLMA 1UK7A 2R25B 2GD0A 2MSCB 2QUZA 1U0FA 3VOBA 4PYKA 2Q3FA 3ADKA 1ONOA 3IT1A 1TVKB 2WLTA 4F1WA 3FVWA 5KC9A 1WHSA 3AR3A 1PL6A 4DEYA 1CNMA 5J47A 1MEOA 1WSDA 5IP5A 5J5AA 5KUTA 1JPVA 2VCEA 2O1SA 3I0ZA 2R6CA 4XARA 5CGQB 3RJHA 1SUEA 3W90A 1GFWA 4G5RA 2Y2VA 3KQTA 4ANFA 2HTFA 3J81j 2CL0X 2YW9A 3DKPA 5H82A 1CVLA 3N6XA 1DDOA 3AJ8A 3VH1A 1UOPA 2FWAA 1GU1A 4KSCA 3TLYA 1NHWA 1CV2A 3S1LA 5BSMA 2JANA 3BQTA 4TZ0A 4L5BA 1P91A 1OJ7A 3SU8A 5KYNA 1YVPA 4MRMA 4CEJA 2BCGY 3FOBA 3L6UA 3ZDYB 1Q7EA 4Z4GA 3D2CA 1JQ5A 4MWGA 4W8HA 4YCDA 2ZTVA 4BNZA 2C8KA 1U5BB 1DRJA 3AL0B 3IAM6 4MDFA 4LGCA 4OQZA 2N9UA 3EEFA 3SLGA 3IG8A 4L4XA 4A8TA 4KVFA 4DQSA 2MR6A 1YQQA 2CXRA 2WY2D 4JJAA 3NBQA 4CODB 4J16A 5AP9A 5HE8A 3NAQA 1PSDA 3MAJA 4MVJD 1JR3E 4HGYA 3PQCA 3ELUA 1N1EA 2RGNC 4KLRA 1K8ZB 1XPUA 4AP9A 4XA8A 4C0WA 2N3ZA 5DB9A 3LWNA 1U80A 4YMWA 1JR6A 1NXVA 4RJTA 4ZAVA 4XX1A 5ALEA 4JYMA 2AHOA 2HMVA 4C29A 2ZE5A 3EZ9A 3R9WA 3RIMA 3FBWA 1GILA 3SHTA 4AKHA 2Q4BA 3COSA 5LCXA 2DYKA 1JEYA 3IOCA 3KWLA 2VHTA 2PTGA 4LYEA 5LOVA 4XJVA 1MO4A 1T4MA 2WV7A 5B6JA 5ALDA 2CXOA 2AR0A 4YRNA 2AWOA 1H2XA 3ONDA 6YASA 3LWDA 5AUPB 4CIBA 2PSEA 4CR8A 1J49A 1U0GA 4G41A 3ZDCA 1ZJ6A 4C5BA 1QOPB 4JEMA 1QGZA 4BRSA 5AI0A 4NLGA 1Y3HA 2Z3WA 4IJQA 1D8YA 4DIFA 4IGKA 1LKZA 2WMDA 3RJTA 1FRNA 3ZHTA 1AGRA 4XM2A 2VRNA 3Q15C 1QVAA 4RY8A 2ADFA 2JH3A 1Z07A 5LDGA 5IM4A 2BFEB 4NPAA 2CHUA 5JXWA 3KPYA 2GB4A 2OBBA 5H81A 5DB4A 4KACA 2G17A 1UKBA 5HJEA 5HE9A 4DLBA 3WLOA 2MOKA 3REQB 3X3HA 4XR9A 2VSQA 3PRJA 5T8KA 1AHPA 3IEPA 3EGVA 3SYNA 2R7MA 4S0XA 4FT2A 1LDNA 5JISA 1D7OA 3MFQA 5DCLA 2FFAA 1E89A 3GFGA 4HYKA 3E53A 1FYWA 1OUQA 2WKPA 2P2GA 1VE9A 4LJ5A 5HZHA 1E0AA 2QMZA 5B66U 1T4CA 1N7IA 3Q9NA 4PHEA 4FW8A 3RT1A 2VYCA 2PWBA 4JDPA 5EQDA 3MTAA 3FDSA 3OJSA 4UZSA 2DPMA 4R64A 1CZNA 5GM2A 1Z7WA 1X13A 3KFXA 3PP8A 4DZTA 4X3OA 3TANA 5HKAA 3KD3A 3SDBA 2B4AA 4E15A 2QMUA 3QEBZ 3RANA 2DR0A 4J1NA 5L3ZA 4H7PA 4OYHA 3LL4A 1C7FA 2PD3A 4B4DA 1V3TA 4OPMA 4YC7A 1FOEB 3NUGA 1WJGA 5AXAA 2KKVA 5AKZA 1JPNA 1E7RA 5H2FU 2FCRA 5KX5F 2PMDA 5L6LB 1ZJ5A 4I9UA 3B12A 5C51B 3A9WA 3FDIA 3MSXA 1FRQA 1NE7A 3ORRA 4ENSA 3DHVA 4P5EA 4LQ4A 1GT91 2BKXA 1XVTA 1EUZA 3UV3A 5KTTA 1E5DA 5A4DA 4CIYA 4H0FA 3HUTA 2IYSA 1UT5A 2O5RA 2W83A 5IS2A 4G56A 1OBFO 3GRFA 2QPTA 3L5KA 4JWNA 4M2LA 5KG0A 4N12A 4R63A 3ZBTA 5EC8A 3Q3VA 2HOIA 4PXYA 3MS2A 1XTQA 5JRDS 1ESZA 3BF7A 3HRDD 1T34A 4Y9SA 2C3YA 5ALNA 4Q3EA 2FMKA 1Z06A 3UATA 1CY1A 4DIUA 4B82A 5ISMA 3H0RB 3ZV5A 3BWEA 1RKXA 2JVIA 4W1SA 3FMVA 2I3GA 1U4NA 1KU6A 2FWIA 3PQFA 3H11B 4HLNA 1W1IA 5JBQA 2I3ZA 1ORTA 4DCJA 2M2IA 1Z5WA 4CM4A 3FOWA 3HBAA 3V1NA 1JS1X 2WYIA 9ICUA 3OZGA 5BR7A 1HSZA 2C9MA 3JYNA 4MUYA 4FUQA 3M4ZA 1I4DD 2YV2A 8GPBA 2BFDB 3D2AA 3KEOA 4BMVA 3K30A 1M66A 4HSGA 4GRIA 2V96A 1EG2A 2NNLD 1XYYA 2DP4E 3V3KA 2J6CA 3QH4A 4OHOA 5EVJA 4Y6QA 1PGOA 2FRDA 3TKYA 5FLXA 3O2NA 1QSYA 1J24A 4XKJA 3KQLA 3C29A 2VHCA 1TEHA 4D9FA 4G1CA 1DWOA 2HW3A 4JEIA 2FJ0A 2AQKA 2H18A 3PJEA 3C3PA 1S0NA 4OHUA 3BMQB 4DUGD 3PT9A 1XRPA 1N8KA 1UJBA 3R0ZA 2JS7A 2FHSA 3VAZA 3O83A 2D8CA 3P9YA 3BS4A 2NT3A 1SHZA 3GPDG 3KZIU 5H7XA 3SQWA 1YJXA 3EQ7A 1O95A 3NPMA 3THYB 4GPZA 3E27A 1XMVA 4A7PA 5F4ZA 3P94A 3R7LA 3OF5A 1T3ZA 3F3KA 5ICFA 4KC0A 1TAHA 4E7OA 4L27A 1XC9A 1M34B 1TKAA 5IEBA 1TQ8A 4A0RA 1JXLA 1E2PA 3AWDA 3ES9A 1LX7A 5ARDA 2O57A 4NWIA 5DNWA 4P38A 1QXSA 4FTWA 4XSVA 4ZOLA 4RT3A 1DJNA 3K09A 3VKVA 1O08A 3KK0A 3TLZA 1FDUA 2K4MA 1YQUA 3W7AA 5E4TA 3C1YA 2C4VA 3NYRA 1T8SA 5ALTA 1KYYA 4TZTA 3BAFA 5ITSA 5J0XA 2ZP1A 4QOEA 3O0TA 1QNFA 1RP1A 5L8VA 1D2EA 5J2EA 4OXKA 2ROQA 1T0IA 2ZTDA 1KJNA 3HCEA 1ATZA 2FN4A 4Y6GB 4DGQA 3LUKA 5D3KA 2QLNA 4IF6A 1NG1A 1R9JA 3MINA 1DLJA 3CLKA 2CJPA 3NM5A 3F7NA 3IQZA 4B3GA 4YAJA 4WECA 4XVCA 4ACAA 1SKYB 4C3VA 5I4IA 2W0MA 4CM8B 4TYPA 1KBUA 3TFRA 4B75A 1UDXA 1M2OB 3V4PB 4QWCA 5IABA 2J7KA 3FPSA 4UXIA 5J9FA 1YQDA 5BN5B 1Y7LA 4FJ1A 4C0AC 2OBLA 5JCXA 2CWDA 3TIGA 2C3UA 1ZQQA 3T7CA 3BCUA 4GSKA 1S10A 1K6EA 1I24A 1GZ3A 2UVPA 3MJDA 2ZZMA 5FA8A 1KL9A 2QYTA 1ZK0A 3G7SA 3V8QA 2O1XA 4TT3D 2ZTMA 3SBOA 5HF9A 2X0DA 2JLVA 3QFCA 1MW8X 4E7PA 3EH2A 2BFAA 1ODFA 1GFSA 3SSAA 1KHTA 4C8LA 1YD7A 2WJYA 3VUEA 2EJBA 4RMHA 4HLCA 4QLBA 1OI3A 3R75A 2OYYA 2IWRA 4MKIA 4RH0A 3PQ3A 1ZD3A 2PGXA 4BQOA 4HAIA 1QZXA 2CDBA 4CIVA 3TFWA 2AFHA 3I6BA 2OENG 1QV7A 4M76B 4OI1A 4UEWA 2W6NA 4DV0B 4XPIB 3I83A 3S2GA 1H65A 2AGVA 2R66A 3WNDA 4WXMA 4LZLA 5CGZA 3HKDB 2CLLB 3N2YA 4XJSA 1Y5IA 4LPKA 3GLQA 5AJWA 2HVIA 4KRFA 1QYCA 4TZ6A 7ICQA 1EQUA 2JHAA 4PLWA 5K6AA 1DCMA 3N2NA 3AVQA 1Y98A 4G63A 4M89A 2O0MA 4B0OA 5IF9A 5K0EA 5JRZA 2OK8A 2D3WA 2WT8A 1H9BA 1CY2A 1NZPA 3FSGA 4URZR 4OLJA 1MAHA 1BPDA 4CKCA 3AJDA 2G6BA 3L7AA 1JHXA 2AF3C 4E0BA 1BXRB 4JUCA 3ZJYA 1D2HA 2ANCA 3VSEA 2GS9A 3OIYA 4FCVA 1ZQEA 1B6GA 1UM8A 1YGYA 2NVUB 2O0JA 3ABQB 5T6BA 1HXHA 1Q7TA 3CHYA 3MN1A 4P86A 5JVDF 2QZSA 1AK9A 4NFHA 4JB3A 5HIIA 4RLQA 2CYAA 1JKMA 1XCPA 2ATLA 1G55A 2FFHA 3SQMA 2BPOA 2WTUA 2XUJA 3FUUA 1AMNA 3TR6A 5FBWB 1DQZA 2FMTA 4MKRA 3LZ6A 4F5OA 4JR1A 1TV9A 2XKJE 4FFWA 1JGTA 1W19A 3TJRA 4D57A 2JLUA 2OWDA 3ABZA 2Y0CA 5DM0A 1M1NA 4NIMA 1K0UA 1S76D 4BN5A 3BRSA 2HIHA 2PSDA 4CKBA 1K63A 1IZ9A 4BFYA 4QULA 1R4MB 5JNWA 1Q1QA 1KP3A 4NYMQ 2IV3A 1N0HA 3BB1A 2Z95A 4F8RA 5AR1A 4XFDA 2AFRA 2ACWA 1AOXA 2H48A 4DWJA 3CVXA 2KMLA 1KMCA 3I3SR 4Q21A 2Y9TA 2R5WA 1X7XA 5I9IA 2DVMA 5B36A 4RVOA 2DY0A 4JQZA 1YU9A 2MSEB 2WJZB 3QOYA 5JO0A 1F5NA 3MJVA 1R0SA 1DC6A 3NIWA 3COPA 2F3RA 4IH1A 1FDOA 4A9AA 8ICAA 3R0JA 2GUGA 2FZKA 4MR9A 1I30A 3MELA 6PFKA 1VE6A 3PLAE 2PH3A 1E94E 1SY7A 3CLTD 5J2TA 1TAUA 1RAIA 2LNDA 1PFKA 3SC3A 1HDIA 4HGQA 4AURA 4TMFA 1WUDA 1J09A 4NESA 1SBYA 2HJVA 1F8XA 2KHVA 3KT6A 3GGGA 5GONA 1RWBA 5F3XB 2C0PA 2E85A 5L7TA 5LBIA 5EJ4A 1SL0A 4G6ZA 3ZXYA 1V71A 1FW8A 5K3SA 1B8OA 1ETUA 3VJRA 3O2SB 5LXTF 4Q3DA 4JNKA 2R1ZA 1CWUA 4WUVA 1DTWA 5EHIA 5K6TA 2XRMA 1X3SA 2Z3ZA 3HJTA 3A31A 3K5PA 5C1DA 2PX5A 4KR7A 3BFJA 1MHTA 2OHFA 4BUZA 1TUEA 2HK6A 4TV9F 1F4LA 3H5OA 1XTJA 1TA9A 3SFZA 2KQUA 1Z28A 2X4IA 4JA2A 2DZDA 3AQIA 4K8RB 2O52A 2VAPA 2FLNA 3MUFA 3QKUA 4PL2A 4JA0A 4N76A 3T3OA 5HGJA 3MPUA 3WMXA 4IV5A 3SZOA 5JSQA 3EZ6A 4AFNA 1GZ6A 3PW5A 4MUIA 3H13A 4JEHA 3JQ8B 4I5IA 5DX8A 4BUJA 2MRLA 2A5JA 2BC9A 3LLCA 1XJQA 2V4QA 4Q24A 5IAGA 3QX9A 4LJLA 4YP5A 4DV6B 3T3DA 1VCNA 4GLFA 4RTNA 1DEOA 1Z45A 1T24A 1PKXA 2JAHA 3A9RA 3WB0A 1PJ2A 3W06A 4QGBA 2XOEA 4JP3A 3AM4A 1TTTA 1YZTA 4KXFB 1EE1A 2CMGA 1QSGA 2K8BB 3ZW8A 2ETXA 1FS4A 4Y1RB 2ORVA 3DZBA 2XVXA 5F12A 1B8UA 4IUCS 2WG1A 1EWTA 4QXAA 4BTVA 1EFKA 4A23A 3HCCA 4XIFA 3V4FA 1E3IA 1GFZA 4X5VA 1GYPA 1IEXA 3D5TA 2B9EA 5I3CA 4RL4A 1OYOA 2DG2A 2GK7A 5KFNA 1JHVA 3VOSA 1DHRA 5EWMA 3NRZA 5FXMA 3UJAA 3AUOA 3SIWA 3G5LA 3RS2A 3I2GA 4HT3B 4D81A 4ZPJA 1Y4DE 2C2MA 3CO0S 1CF4A 2HMYB 3BMXA 3GRVA 3RB8A 1ZGBA 2XXBA 2EWWA 3EAFA 4RU1A 1PEYA 3FUXA 4QZHA 1Q91A 3TZ6A 1SUWA 3PHGA 1YRYE 4LF7B 2Z83A 3TW4A 1LB2B 3M82A 3SC2B 5AW2A 2P2SA 1QYRA 2CNBA 1DI0A 2R1UA 1YACA 4C2AA 4F4XA 3PXDA 1EWRA 2XZTA 3LTNC 2ZPTX 1L4MA 1KFEB 3D64A 2FB9A 4RFVA 2W98A 5F1KA 2FXVA 4DF8A 1BIFA 1MV5A 4BKRA 4RQ4A 4RHCA 4WZBA 1IHPA 3CNLA 4DNFA 2WTMA 4CTOA 3ZC3A 4BNHA 4MQFB 1WQ3A 1U5CA 5EE5B 3S2ZA 5C5DA 1BMFD 5JHHB 2WWYA 2IYPA 4XUGB 4I29A 1JLLA 3TE6A 2I6XA 1CHDA 4TN5A 1UQUA 2JIBA 5CDTA 1Z7BA 3RAGA 1GDHA 1O0CA 3LK6A 5HHTA 1OLXA 2YWGA 5BW5A 1KBQA 4WNCA 2CL6X 4FFBB 5T4HA 4Q3LA 3QVWA 5HIJA 3IQFA 2YVQA 3C1AA 2HBQA 2XF2A 1X19A 4DCVA 3LY9A 3UJBA 2VWHA 1E3QA 2I65A 5KG1A 2BIFA 2ZJOA 1JXQA 1CKEA 4DAEA 4AZWA 3V6JA 4BO2A 5J2UA 4QATA 1ZQ1C 1VCIA 3ESBA 2NW6A 3TM5A 4GOXA 2VJMB 2HBYA 3LUCA 1E8MA 2PSFA 1LWNA 5FEMA 3OJCA 1R9GA 3LPAA 1JFFA 3Q3GE 3IYLW 2KJQA 2QU7A 4TXLA 2V65A 5A0FA 4ETWA 3JQAD 1WRBA 4TKUB 3DBHA 3QXXA 1CDOA 3E9RA 1UBHS 1FIQA 5HR5A 3IVXA 1EFTA 1KKMA 3S4YA 3EF1A 2IW1A 1JPUA 2AOTB 2F1IA 1E7YA 3P2EA 3KR2A 1NQWA 4ICAA 1FTGA 2WKRA 2P66A 2PUHA 4FNOA 3QWIA 1Z0DA 1NOIA 5FIUA 1JFLA 3RQIA 2XB2A 4ZVUA 3Q8RB 4WIAA 1W29A 3LQ2A 4JLKA 5DWDA 4INAA 1OYVA 2F2TA 3PWZA 2VF7A 2HREA 1ADBA 1YB6A 2C99A 3JR3A 2ZJ7A 3KBOA 3Q3IA 4OREX 3U6KA 3UCEA 4WOKA 2MCFA 2DU8A 4DRXB 3GAAA 4AYWA 1YZYA 3KB1A 1TKDA 3EFEA 4ZYLA 3LGSA 1RYNA 2YZKA 5SV2A 5B3AA 4E70A 4NYIQ 2NP7A 1PK1B 1S4MA 4ARSA 2CD7A 2VRCA 4RHUA 3JQBC 3ZWPA 4XUCA 1DOHA 2VDQB 2QZZA 4YJ2A 1E1RA 2HLDD 1LTHR 3O2JA 1G21E 4DCUA 3B78A 3T3IA 1PWHA 3WQBA 3HYLA 1RWNA 2FV8A 1P1KA 4LC0A 4DJFC 4A15A 3WNVA 3HVUA 1LPOA 1O6GA 5HWSA 3EEIA 3VR2D 1P7DA 4LPSA 4UTZA 4CF7A 3GWZA 4AF8A 1QHGA 3OFJA 1WUHS 3FLEA 4PFKA 4E13A 1M8GA 4PC1A 3V97A 1U7DA 3WLQA 4O59O 2JZNA 1YE8A 2PZJA 4QHYA 3RFCA 2C54A 1F2TA 1I3OA 4LECA 2YRXA 3UC5A 2A1IA 4XEUA 5IRCD 2H3ZA 4O5AA 3L8FA 4GS5A 3FB4A 4F72A 1K98A 4ECVA 2MSKA 4OXXA 3LOQA 2D4HA 1CUVA 3FMPB 2B82A 5KOHB 2BM1A 3ZYZA 1HQKA 1QJCA 1NLZA 3FSEA 5AVQA 3AP1A 2XNJA 3DT8A 1WD5A 3HXTA 5BOLA 3C8MA 3L0DA 1Z47A 4EECA 3IE2A 1SD1A 4U9HS 4IIUA 2NXCA 1AQNA 1FPMA 1AMUA 2RGBA 1XD2A 4X6LA 2LI6A 5K8LA 2UXCB 2DBQA 3UTCA 4YJ3B 1UMDA 1NJ6A 1N2EA 1A1SA 3K96A 4OHZA 4R69A 1KFCB 3LDHA 2Z5FA 1OR8A 2VSOA 4O4HA 2IPXA 3BTVA 1ABEA 4C07A 1AKUA 4HX2A 3K9LA 3E82A 1SVUA 3H0EA 4PG6A 1AQ6A 2QIOA 2DKFA 2A0XA 1CJKC 4BP3A 2C07A 3A0RB 2OXOA 2J6BA 5KX5B 2J32A 4O2AB 4PGGA 1N9ZA 1PCXA 4NMLA 4N9QA 4IRXA 4X63A 3TLBA 1OFIA 1E1QA 2WC1A 3H4BA 3WLFA 1MC4A 1CE8A 1R5JA 4UZFA 1J0XO 2JD2A 1EUQA 1U3TA 1WXGA 2GN9A 5AW4A 4LGMA 1HYGA 3TNYA 2J5XA 3UWMA 4NBWA 1L5GB 4G8DA 2O8DB 3FFBA 1PKEA 4MIKA 1FO4A 1U9CA 1Q0UA 3L1UA 4DLNA 2EYUA 2I1LA 4I81A 5H1YA 2PM8A 1WWKA 5AK3A 3ZY5A 1MC1A 5E38A 2AOUB 3GHYA 3DOEA 1VKRA 1OVMA 4FXOA 2PL3A 4C1NA 4G1VA 2BZFA 3AVWA 1F3OA 5FTLA 4D5EA 3HEAA 4ATNA 3WWPA 2D6FA 1CFJA 3UOGA 1E6WA 2BR0A 4V0QA 3ENQA 1HE2A 1GIAA 1P33A 1Z4JA 2NRWA 2W9MA 5BR1A 1YZQA 3TSCA 2X6QA 1TK9A 1XZEA 1IXKA 3N07A 3WGQA 1X7YB 1V8OA 1KDVA 2I29A 5HSGA 1O0SA 1U2SA 2RI0A 1RNLA 4IJ6A 4KLFA 1K9VF 4Y18A 2BZ0A 4U7FA 4LFAB 5B6IA 3BORA 1EVLA 4WBNF 1H1DA 2KWIA 3QXHA 3MHTA 1X1SA 2FP3A 1XFDA 2FUG6 1SV4A 1ULAA 4HUQA 3L79A 1FX1A 3JY6A 1L5SA 4B2YA 1ORRA 2Q4OA 5G53C 3CRZA 1VDVA 2YQ4A 3VTKA 4WA8A 2FK7A 4MA5A 5AKHA 4IXNA 4YI3A 2RDJA 3LUDA 2P9EA 4LCJA 4YAOA 4D8YA 2YRWA 2GYUA 1Z3IX 3PC3A 2X1LA 4UPDA 3H1FA 1X87A 4TXMA 1X7ZA 3M33A 2K6GA 1FFXB 1O3YA 1O4VA 2AG0A 3M4JA 2P6OA 1GARA 3EZNA 2RKBA 2LDXA 3LP8A 3KQSA 3G0OA 1IUNA 4OATA 1SB8A 4YGXB 1B8NA 1DZ3A 2IXDA 2QTZA 4QGGA 1PN3A 2BSAA 4XTCS 1TJ5A 1ZUNB 4JGIA 4IYJA 4M9QA 3M9OB 2H1FA 5IZCA 2HIGA 4TTTS 3QF4B 4E2XA 4YPOA 4EBFA 3DEKA 2I87A 4FYIA 3TJMA 5BVHA 3ME5A 1ZIOA 1GKUB 1I7SB 1GLVA 2HU5A 1W0JD 4IIBA 1HKHA 1AKWA 2P91A 3IP5A 2WSIA 1CVIA 2WPDA 3SXUB 4KQIA 2RK6A 2FU5C 1T5TA 3G8AA 1HE8B 1N56A 1MOPA 1L5KA 5LQMA 3OX1A 4NBUA 3ZBQA 4MWZA 1U9JA 4PYIA 2ES4A 1IY1A 2F1RA 4JP5A 1JG6A 2P9JA 2SKEA 2LPEA 2RJNA 2VI5A 4ZOAA 4NNJA 4R1LA 5EHXA 2W4QA 2VAXA 1ECJA 5L1LA 1P2VA 1C30A 5JD4A 3KR9A 1LRKA 3RFTA 5FQNA 3SE7A 3IP6A 3ZWYA 4FDUA 3P2YA 4XCXA 4XWYA 1VJDA 1FDIA 1DCFA 1LLCA 2E4ZA 4JQCA 4BX8A 4KIGA 1BHSA 2J3KA 2DGZA 2HA2A 4ZEOA 1VPEA 1O7JA 4ME6A 3GIIA 2IYLD 1H38A 5B3JC 1LV8A 3DAGA 2FOXA 3K0BA 4P3NA 2ZROA 3FMOB 4I5FA 4AZ3B 2PI4A 4W9MC 4LY9A 1FXWF 3MRSA 1X8LA 1LFAA 3GBPA 2ECOA 4DYHA 2FFRA 2FJPA 4EUHA 3EHDA 1NPYA 2AQ4A 1CD5A 4G5GA 3G2QA 1W30A 2CVPA 4QEDA 4NHOA 4RD0A 1JIIA 1KBZA 5JCJD 1F8YA 3FWHA 3NT5A 2ZW9A 4LF6B 2DFLA 1R5BA 5HKKA 1BVHA 2OPHA 5CBPB 1ORDA 2MSLA 3K31A 4BEWA 2ZBRA 5DYWA 1TMYA 4RU9A 5HDBB 1T2NA 2B99A 1EI9A 1J2YA 3RRYA 2HDWA 2VDUE 5C7IO 1PQUA 3C8DA 2KOBA 3V2IA 5H3CA 4GKBA 3AI7A 1MG5A 5HZMA 4HJXA 2NPIA 5ALXA 3F0TA 4GZ5A 4M55A 3LKVA 4MMYB 2JFNA 2L18A 1SVKA 4BOYA 1E4VA 1JBKA 2H2AA 3NUZA 1ZI8A 3QLTA 5ALLA 1C5KA 3TQCA 2O5CA 1MB4A 4U63A 1ZSYA 1JNXX 2Y3IA 4FBLA 3SF0A 2AR9A 4Q1DA 4DKJA 3QSYA 3ZZMA 4OV6B 1FYDA 3HYTA 2HHTA 1QRAA 2BKVA 1E62A 3O3NB 3DYBA 5LU9A 2QARB 4B8WA 1M6VA 1LLFA 1H2ZA 2QDKA 3RTBA 4U8HA 2AD1A 3HEBA 4MKHA 5DM2A 1BRTA 3B1WA 1XHFA 3C70A 4ZN6A 1WZIA 4FBTA 5CJ2A 3Q4GA 5JQGF 2Q5OA 3VO9A 4NZ9A 1QCZA 2GN4A 2HNAA 4J9QA 3VVLA 3CIOA 1RZUA 4LQLA 3RU9A 5IMSA 1XK6A 1Z8DA 1KI4A 5DT2A 4QRHA 1UQRA 1DHTA 2HV9A 1R88A 3OBBA 3U3ZA 4DV5B 2DWOA 3EH1A 1N57A 3VTFA 3GXOA 4BPRA 5JVDB 2XA2A 3L18A 3GAZA 5H8WA 2JFBA 4HLDA 3QBJA 4KXQA 3IHQB 1IOLA 3SG0A 4PGQA 1PHPA 4FOPA 3E23A 4MB2A 3P9SA 4DM4A 3VBCA 1DUIA 2UVVA 2F4VB 2F62A 4JI6B 2ZVJA 2Y92A 4RYLA 3U4HA 1QHNA 1C7JA 1MTOA 2FP4B 1YQWA 3TTVA 3WXMA 3RKRA 2C29D 3ROGA 4DXAA 4QQRA 4R7GA 3FSJX 2MYNA 1T9AA 4ZO7A 3DP7A 2GEVA 2PK3A 3ZU3A 3AJEA 4LX0A 1M5UA 3L93A 1QH0A 2BFBB 2G77B 2GEJA 3QRWA 4AY6A 1PF7E 2VLIA 5D5HA 4CKZA 1MAWA 1C9JA 3KELA 4HBZA 5K2OA 4Q8EA 3V6HA 2G70A 1WX1A 4BXOA 3GJXC 2EZ4A 1J9ZA 1H23A 3W3AD 2UZ4A 2IZ1A 4A2PA 1Z5ZA 3H3XA 1OB2A 1N6RA 2MSNA 1G60A 4Q05A 1GTL1 1QIKA 2ZTLA 3BKWA 5CK5A 1IZYA 4PQEA 4I4LA 1OXTA 1Z63A 3EW7A 2EFEB 2VH5R 2OD7A 8LDHA 3JAKA 1QHSA 1YBAA 4BO9A 1A98A 2GHIA 2EKDA 4B3RB 3GMTA 2ZQZA 1E0DA 1EFPB 2CUZA 5A2QA 3HBNA 5D85A 5KFGA 4FYKA 2HA7A 3RU3A 5C1BA 3GCGA 2NQTA 3I01M 4D1YA 3ACBA 3P20A 5D00A 3TL6A 2W9BB 1O03A 4NR0A 1AK2A 3P9ZA 4YCSA 1XIVA 3CKKA 4ZV4A 2XUPA 3UAGA 3D7KA 1PL0A 1NJXA 4CW7A 5DB7A 3BPSA 5G02A 3AM1A 3BX1A 4TRRA 3RBXA 1U3DA 2X3FA 4ZAWA 2D06A 4ENPA 4XWTA 4X5OA 1SIOA 2K2WA 4GM0A 1Y9JA 4QTXA 3JQAB 1A97A 3R9KA 1DPFA 4GRDA 1WYGA 3M6MD 3PKIA 2GZAA 1ZQZA 2XVAA 3IMEA 4OUKX 4TV9B 2NO5A 2M1ZA 5J4HA 4P9NA 1AKEA 3FPLA 2X5JO 7ICJA 3LUGA 3IEXA 2Z08A 4GO1A 2HBKA 4AJEA 4IDOA 4IBOA 1F12A 4F8JA 2C7PA 3NONA 1ZJNA 4G89A 1O57A 3A1TA 4LF4B 2ZRDA 5BYBA 1I10A 2XQKA 4X92A 3KZOA 1HQCA 4GQBA 1EFVB 1MGPA 3QW2A 1H3NA 2O6LA 5COBA 2GCPA 4NMXB 2CFRA 3WMRA 5GGYA 3DGEC 2IH5A 4DARA 4XM1A 2XXAB 3GT0A 4HZUA 2WWVD 3HDGA 4AC9A 4Q3BA 4XRRA 4BO3A 4F5YA 2W90A 2QJFA 4RVGA 1SKAA 4OOEA 3OT4A 1QRDA 1XA3A 2X4DA 4LWOA 3UMVA 4Q47A 2EX0A 4LJRA 5JAZA 3DV0A 2HMTA 5LKRA 2Z2XA 4LOKA 5F98A 1NLMA 3QBDA 1YRAA 4BX2A 4O2BF 4BO7A 3OFND 2FVYA 4AT1A 4I66A 4KGDA 2I9KA 2VK1A 3IJRA 5IIJA 4TMXA 4EEZA 4QPCA 1BKSB 1UDWA 1ZM4A 3ROZA 1BH2A 3LFHA 4EKYA 4UJ3A 2BM0A 2D1QA 1XL0A 2VSYA 3V7WA 4OK6A 5F76A 2FJ6A 3JQQA 3EVBA 3GGOA 4H08A 3K6SA 3KBBA 4WN9B 5C37A 3AH8A 5L95A 4GP6A 1Z2AA 3U4QB 1PR5A 4DDUA 2XZLA 1VKJA 4IOMA 1NYTA 3K0EA 5BMOA 3D6AA 3MXTA 3HGMA 2A3VA 1VHLA 2ID8A 4CRXA 4RVCA 4EI2A 3NTUA 5C4IA 2PUGA 4LJ4A 5EIBC 3EAGA 2WYWA 3JPTA 4X41A 3TD6A 4DT1B 2VUTA 2NU6A 3EGCA 1P4JA 2OO3A 1KYXA 1T5IA 2QQEA 1SIBE 2PPVA 1FZQA 4XIIA 4EBBA 3BXGA 3W5JA 1NGSA 5F7XA 4TYNA 2Z8ZA 5KNLA 4CCAA 4MS3B 5HFJA 3RS8A 1KOFA 4M21A 3WNCA 1I5EA 4AWAA 2Q27A 3B51X 4UDXX 2WD7B 4Z6FA 5IT0A 5C5EA 3RR8A 1QKIA 4Z54A 2CNNA 3STUA 2BCEA 4BAUA 1E9EA 3B8EA 4BE7B 2WM8A 3GIMA 2O07A 4MEXA 4HTFA 4NJEA 2YJGA 1S4QA 3DQQA 1M5TA 3OJXA 5FJIA 5F21A 3BIWA 2GARA 3W6NA 1ILWA 4IDPA 4QUIA 2GHTA 3WWYA 3MYRA 3TKLA 1KMHB 4DSNA 4UOEA 4G37A 3GDXA 1XJWA 1RC8A 5BMVF 3HCBA 4BFUA 1IE3A 1UMCB 3DO5A 3OQMA 3ZBUA 1CLUA 2CNOA 2KFZA 2J9XB 5DXJA 1UXKA 3OE4A 2V7GA 2WMOB 5ECYA 5JEDA 1K0FA 3ABSB 1OI7A 1YI1A 1S9HA 5SY4A 5F2EA 3K0AB 5CT5A 2ZBFA 4RK5A 1JROA 4MULA 1AHIA 2Z2YA 4CKYA 2QTGA 4QDOA 3BRQA 1IWPB 1J99A 2WDPA 5CLJA 1R6VA 1DX6A 1ZQVA 1HDGO 4N48A 2W6JD 4NI5A 4J90A 2PRIA 3N87A 1N33B 3A1CA 4A6DA 4WL0A 4HBGA 3PX2A 2Y1GA 3WYNA 1RG6A 4AL4A 1HETA 2QW8A 2P3LA 1N2CB 2IRWA 3ZR4B 2OHHA 3DBRB 1OKKD 4CTNA 1KZ6A 2GJSA 2K5UA 9ICNA 3KHKA 4GAEA 3OIWA 1KY3A 3L07A 4WOCA 1ZSVA 1KZGB 2HF7A 3FIJA 1GUYA 2H63A 2CUKA 3TCKA 4DMGA 4RNCA 3CR7A 4EFLA 5AW3A 1GY8A 3BILA 1SOAA 5E4JA 2RHTA 4JGGA 2GKOA 4MP6A 1UFVA 1KO8A 3ITKA 3GA0A 3KSUA 1GXSB 1X2EA 3WGKA 1YR6A 4MJ7A 1SXQA 5JCOA 4NZPA 5KNCH 3N6VA 3GZNB 4CIWA 1R27A 4YRGA 3UUGA 2Z2IA 1UXHA 3KPVA 4CMIA 1JRLA 2V55B 3OF2A 3L6BA 4HRXA 2QQFA 2ZUWA 1BFUA 5SY9A 4FS8A 3UQZA 5EUBA 2VCYA 2X0FA 3HV0A 4DV2B 1H94A 1WXXA 3DC2A 2CZGA 1G2PA 1WNTA 2GZRA 1ZVQA 3LRTA 5CM8B 1CERA 3RUHA 5T4EA 4F3KA 1Z5OA 3G8CA 3CX7A 1XX6A 4JC8A 1UBNA 2UAGA 2ZIVB 1C4OA 1NBMA 2ZI6A 4J49A 2C0CA 4NE2A 3JZFA 3O8RA 3W05A 4O0LA 4GW3A 2IV7A 3K9FC 4K1LA 4DMCA 2CXNA 2JJ2A 3M9MB 3QVXA 5G0WA 1D6SA 1L3BA 5LJIA 3B89A 4M0KA 1PL8A 3OHSX 3JVIA 5K3BA 2ZS8A 4LOIA 2JIDA 3GDFA 4HMPA 1YGPA 3K94A 4Z8XA 3UMGA 3BMCB 5U9CA 2QUKA 1DKRA 3QA3E 2FEKA 4EUNA 2MUTB 3G59A 3IRUA 3T1OA 1UODA 3T8YA 4TZKA 4PZDA 4NZYA 2W9CB 3GLGA 2NZYA 2C2DA 2B1RA 1W49A 1OIVA 3OEEA 3EF0A 4B45A 4FP9A 1P81A 4UZEA 2QD2A 3ZGVA 2A5YB 3REFA 1XZNA 2RIPA 1XKLA 1HE3A 2BE9A 3PUIA 5IUKC 2TMYA 3P71T 4BZQA 1ZQAA 4GWKA 5LJLA 1TW3A 2KD1A 1PVPA 4EJSB 5AIAA 4Y30A 1G1MA 4M22A 1J39A 1DK3A 3C3CA 5LU8A 3G2LA 4QBTA 5AFSA 1V1JA 5C52B 4BWFB 4LE0A 1AO3A 2J3QA 4TS4A 2IHVA 3NVVA 4LK2A 2X0JA 5JS6A 1QCKA 1XE3A 3V7UA 4DIDA 4FWBA 2P11A 3QVVA 5DF1A 3D6JA 4CT4B 2Q5IA 5SYMA 1LSJA 5C5IA 4V0KA 1UK9A 4S0ZA 4K5QA 1TECE 1BD4A 3Q40A 3R77A 2J09A 3QLUA 2BJHA 1H8HD 4ZIRA 7ICEA 4QQNA 4JEUA 3TECE 2W2TA 1VLLA 1YT3A 3OEHD 3N8KA 1RLIA 3RI3A 3QW4B 5FWDA 5D49A 2C3PA 2L19A 1HYBA 5K2MA 1UIRA 5J1SB 5AW0A 4R9SA 3VC2A 1XF1A 2BGGA 3CW8X 4HWOA 3AIMA 3B6ZA 1V48A 3LV8A 1U9LA 1S3IA 1GAEO 2QAGC 4S04A 1XDDA 2F3SA 4PYLA 2DFNA 1V1RA 2XCPA 2Y68A 2ZB2A 2OGZA 3CLSC 3MCAA 3G3EA 2WK1A 3S2SA 5TS2A 4HQFA 4QQKA 4HAUA 1WR8A 4RWEA 2OE2A 5J43A 5K3AA 4H17A 2K8AA 3SCZA 4WBNB 4O2LA 4CCYA 2Q99A 4MITA 2XQJA 5FOVA 1TYBE 1V7CA 2P40A 5CP2A 5E8RA 4B0PA 2AK2A 2VRBA 4LE1A 1F51E 3A8TA 3TD9A 1J9EA 3PFWO 4DR5B 2OQIA 2OCKA 2J7PD 3WSVA 2A5DA 3PD7A 1DBRA 5KT3A 4BJ5A 4G3IA 2D2IA 1E4EA 1QFJA 3P8ZA 3QU4A 1O5IA 3HVHA 4L2IA 4J0DA 3UENA 2O7VA 4EG1A 2WOJA 5F23A 1YB1A 1Q92A 4AUNA 1M6HA 1UWCA 4HYTA 2GM5A 3IAS6 1GITA 1Z5VA 3DEAA 1EK0A 2AC2A 5CNMA 3OECA 2J59A 3QZUA 4P82A 1F2UB 2ZRBA 4DFDA 3NC0C 4ID3A 3KOWA 4A0QA 3BQ7A 1RRMA 1WY7A 3LHKA 3ZX5A 5IM5A 3ZWAA 2AN4A 5DP1A 1T0JB 1PW7A 1WKVA 1XNGA 3KQOA 1CEYA 1MRSA 2CC2A 1HDOA 3UUFA 4CL2A 1Y5MA 2E4VA 4XDYA 5AKXA 4F12A 1ANKA 3WLJA 2VLBA 3RABA 4WASA 4OK3A 2CYCA 3E9ZA 5I8PA 3TIFA 1PEAA 1R74A 1M8JA 4FFVA 2H54A 2WBLC 2ZBEA 2MYUA 3MUOA 1TEZA 1RJFA 4WEQA 2QW0X 4XQ8A 3BAZA 2PIAA 1FVOA 2IFTA 3H5IA 3FAHA 1QS0A 1ZU5A 3WKAA 4J94A 2BUBA 2B34A 3C3YA 4EVSA 4JLUA 5FULA 2IODA 3QELB 3ZD6A 4HXFB 1L1QA 2XCRB 4FMDF 3Q7IA 1BJKA 1M33A 1QV9A 3EG9B 2XV1A 1XRLA 1R66A 5FOXA 3GEGA 4NU8X 2ZXHA 3QKRA 3TF5A 4K9SA 1IXSB 2WR8A 4GG1A 3M8SA 5K03A 2GCNA 2AKEA 3NOQA 4B9EA 1LSOA 1R0XA 3FPKA 3BJMA 4A27A 3T5LA 2KK0A 4ECTA 3PX7A 5DQHA 4Z9XA 3VGPA 3AEQA 3CRRA 4X94A 4A6PA 4BIMA 5G1NA 2L0XA 3ECAA 2F7SA 3QITA 2PTHA 3VZQA 1VFNA 2J5QA 4AJHA 5BW4A 4NLZA 4QLOA 1Y6GA 5ABPA 3W34A 1SXEA 4EPRA 3HBJA 4QASA 3RARA 2H3FA 2E18A 4RK4A 3I37X 4RTKA 4S24A 3WA6A 5FPSA 3E58A 2KJ9A 1NR5A 3VR3D 2VCHA 1JB1A 4YXJA 4MVYA 2BZ1A 1SOUA 2XAUA 3SSOA 2PH7A 3BHJA 4L76A 1V5WA 1G8FA 4LNAA 3V7LA 2I54A 3Q72A 2YXEA 5DHTA 4U6NA 2QPOA 1F4VA 5A5DA 1TC1A 2NV2B 3BWCA 1NURA 2ZJ1A 3Q2KA 1XTKA 5HJ2A 3PSPA 2O6HA 1AA9A 5B1IA 3N53A 4FGUA 3M34A 4KQ2A 5CT6A 3Q6MA 4R7TA 3PEYA 4OI2A 1L5YA 4N7MA 1ZXXA 4UAZA 2KX7A 4JIGA 2P9GA <