3VCBA

C425s mutant of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vcbA00
3GZFA 3VCBA 3VC8A
chains in the Genus database with same CATH superfamily
1LKYA 1NK4A 4O3NA 1TK0A 3H8MA 2I5HA 2VA3A 1ZETA 2JXJA 1UA1A 3HILA 5KG5A 3PX0A 3RTVA 9ICXA 3VCBA 3SZ2A 1H38A 2PI5A 4UAYA 4C8LA 4ECZA 5DBBA 1D9FA 3TADA 2EZXA 2FE9A 1V38A 3IV6A 5AICA 1S0VA 4IQVA 2F3NA 3UXPA 2DGZA 5KL8B 3C5FA 1O03A 3LYSA 2UVVA 8ICLA 1L8LA 2GLEA 2YN4A 4J9SA 1ZQZA 3H0LB 3N7RC 4C80A 1N56A 1UPHA 2Y1JA 1S9FA 4QNLA 3RFAA 1T7PA 3PW4A 4QZAA 1WYGA 3PW0A 5DDMA 4F4YA 4KTQA 3NUQA 3ALRA 2RRDA 5EE1A 3FM9A 5TZVA 2I1QA 2KJ5A 4C8MA 3AM9A 4DWIA 5J0PA 1N2XA 5CP2A 2FPKA 3EYZA 3M6KA 4ED3A 2YMQA 2HHQA 3RJIA 4F5PA 1TK5A 4DCCA 4DF8A 5G5GA 4RUCA 5L1KA 4F93B 4YD2A 4RNNA 2JMGA 1QCKA 2XVTA 5BOLA 4UB2A 4UQGA 4FZMA 5HMLA 3UQ2A 3BQ7A 4Y2TA 1L7MA 3AL0B 5J2AA 2MUTA 3LVVA 4RQ1A 1BPYA 4DOCA 1ZD4A 4KITB 2NO5A 4UAUA 4BJQA 4R65A 1S0NA 4I2CA 4F5NA 2DKZA 4Q8EA 2Y9UA 1RYRA 4I2AA 2K4IA 2KJ8A 4GXJA 8ICZA 1ZRMA 4YMNA 7ICGA 4UATA 5J0XA 3H8SA 5JUMA 2YMLA 4QZCA 1JALA 3KHHA 3TFRA 1JX4A 2PMZC 3FC4A 9ICUA 3V7JA 4K4IA 1ZQ1C 1BVSA 2DF4B 1C7YA 3PY8A 1L7OA 4M6WA 5DGBA 5L1LA 1V97A 5AKJA 1A77A 2JV3A 2KFZA 5J0RA 1B43A 4EBDA 5FP0A 4QZFA 4P0QB 5AI6A 2GOLA 2BZFA 3Q8KA 3RH4A 2ZTEA 3MABA 4ECYA 4KLGA 2YB4A 5D49A 2DQNB 2R18A 5KFQA 9ICIA 2HBLA 2W04A 9ICRA 4RT3A 1T8EA 1V85A 3M9OB 5J2IA 1X66A 4J9NA 8ICMA 1BNOA 4PL2A 2LYAA 2M9NA 2G06A 9ICQA 3SAGA 3D6JA 9ICWA 5DQGA 4GFJA 4YXJA 4MEXA 2UVRA 3AUOA 2A3VA 3TARA 3H8WA 2BPGA 3NVVA 1U4BA 3MR3A 4Q43A 4DSJA 2WF7A 1DOQA 4QWDA 1N61A 3RJHA 5BOMA 4C8NA 9ICBA 3I28A 1KKXA 4Y2JA 4Z6DA 1VLBA 8ICXA 5AIAA 1S76D 3RRGA 4RNMA 2DPIA 3LK9A 3M6ZA 4MEYA 3PNCA 1SZHA 1CUKA 4DL7A 4PGQA 3OHBA 2KKPA 2VA8A 5AKKA 1JROA 2WB1C 3UPQA 2DWQA 4UB5A 3B9JA 2M0NA 5AKHA 1XS9D 3V6KA 2P35A 4UARA 1CI4A 1UT5A 4P0PB 4O3PA 4NXZA 3TKAA 5KFIA 3HKZF 5DLGA 5HR7A 4KLTA 1J2MA 3QU5A 8ICNA 1JMSA 4DS5A 3BS5A 3ZDAA 4UBCA 4IRCA 4G9BA 3GIKA 4IRKA 5J2CA 2W9MA 5DB7A 1S77D 4RQ0A 4NLCA 1NI3A 2K4HA 3J81j 1UCVA 2KKVA 4US9A 1K5OA 4DFJA 4J9OA 5ALOA 1BPDA 1Y88A 3SV3A 8ICHA 4RPYA 2W7OA 4DQRA 2W43A 5GTHU 3ZDBA 3N97B 3Q8LA 4B9LA 4I2FA 2BQRA 2KJ9A 1X9XA 4NL9C 3GV7B 4RPXA 3H0RB 2JH7A 3BZKA 3GU3A 1S97A 4M9NA 3ZI4A 4F4XA 4DSFA 3SEIA 1IM4A 2F76X 1IG6A 1BPEA 2NRTA 4KLHA 1YZ7A 4R63A 3OSNA 5H2FU 1ZQKA 4KLSA 2ZIVB 2RDJA 1NJYA 1U49A 4UB4A 1B4FA 3QX7A 3PSFA 2HBJA 3M7DA 1U9LA 4Y2XA 2QARB 1QQ7A 3BS5B 5IIMA 3E2EA 4YFKA 3NGDA 2F1IA 1GO3F 2F8LA 1SKRA 3PR4A 5KG6A 3IRUA 4EBCA 1L7PA 3F5EA 5KFMA 2ZUBA 5DB6A 2CXYA 1ZQAA 2IOFA 4J9LA 5IIOA 1ZQPA 4QZBA 1HJPA 1YZ6A 5AIBA 1KFDA 3C21A 2OWOA 1KN5A 3WK4A 4O5EA 1MSWD 3AEVA 1HEKA 3RAQA 3T5KA 2YTUA 4DO9A 3GFKB 1X9SA 3T79A 1Z00B 3PMNA 4FS1A 4TUQA 5AKLA 3EPIA 2R8KA 5EWFA 4HYKA 5CR0A 4FO6A 4F72A 1NJZA 5IIKA 2P6RA 3SI8A 4LZGA 3ZDEA 4PHAA 2KE7A 4UW9A 3WKDA 4QIWF 4IR9A 4M04A 2W3SA 1MA7A 4EBEA 3IG8A 9ICNA 2E5SA 3HWTA 3QU2A 3FYHA 2XGPA 4PGYA 4O9MA 4UASA 2BDPA 2BHNA 3GDXA 1XSPA 2DKXA 3PW5A 2KZZA 3RRHA 5ALVA 1N5WA 4IQTA 8ICGA 4QW9A 2AQ0A 4DOBA 3AU2A 5F3XB 2R8JA 2GH1A 4J9MA 4G3IA 3ETRA 2Q0ZX 2HW3A 1B22A 1NJWA 5L1JA 5J2FA 4IC9A 2C2RA 3BQ1A 1SL2A 1BGXT 3WKCA 4TUSA 4FFDA 2AJQA 4F8RA 3PSTA 5ALLA 2Y9TA 4DFMA 7ICIA 4RQ2A 3CW2C 3UQ0A 2R8GA 2EANA 4KLEA 2Y0SC 3Q8QB 3Q8PB 1XSLA 1NNLA 1L6NA 2ZUDA 4O5CA 5KFDA 1OXJA 5CB1A 4LJXA 5J8YC 2NYVA 2Y1IA 4F3OA 4QZHA 2KVSA 4C4TA 2XIDA 5J2DA 1BPZA 4LZDA 5J8YA 4EELA 2NRXA 5J29A 4PL1A 1NK0A 2G5HB 2AU0A 2F77X 3QUTA 3JPQA 3WK8A 4B9UA 4EX7A 1XNSA 2A1AA 3C29A 4QZGA 1FEZA 1YT3A 3UMCA 2RDIA 4YD1A 2ZTDA 1F0MA 2W03A 2CN1A 5DBCA 1SL1A 2WTFA 5AI9A 1ZQMA 2BCVA 2WB1F 1QSSA 5KFNA 5DGAA 3AQEA 5HP4A 1S10A 2J6SA 2HSZA 5AM0A 4QWEA 4KLMA 5DG8A 3GILA 2HHUA 1RYUA 2ES6A 3M9MB 3G6YA 4UB6U 2EAPA 3N7PD 3UXNA 5AK3A 5ALQA 8ICOA 2MA1A 2PMZF 4DOAA 1RYSA 1KSPA 5ALRA 2BCSA 2KG5A 1ZYQA 5HNKA 4DQSA 7ICVA 4NLBA 4Y2PA 2E1EA 4F5RA 3THVA 4K4HA 5KFLA 3RH6A 2BKEA 3C2MA 5K4LA 5DQHA 2W54A 2R8HA 2KEYA 3MGHA 2B21A 3Q8SB 4KX3A 4FBTA 4EYHB 2Q4TA 2LMRA 2DUYA 1HUZA 4X5VA 9ICTA 2EDUA 4MF2A 4Z6EA 4J9PA 1NZBA 2H3VA 1SXEA 2ATLA 1RG6A 1FFVA 5B66U 3MFIA 1EXNA 4A8EA 3LWLA 1URJA 1BNPA 4RU9A 2ZJAA 2K4EA 3PO4A 8ICSA 1RXWA 1HIWA 3GV8B 2KMDA 4U6PA 3TANA 2VANA 4NY8A 4DQQA 2A19A 2OM6A 1D8YA 3D2NA 2A1JB 1KRPA 5AKYA 2O6KA 1KEJA 4YP3A 1ED1A 4EX6A 2C2DA 5AI4A 5KFUA 2CPRA 4DF4A 3D2SA 3ORYA 2AH5A 4DL5A 2XY7A 2WF9A 2ZIWA 2LHTA 4DSEA 4Y2SA 1X42A 1K1QA 3EZ5A 1RZTA 2OCEA 4AYBC 1U45A 1UHUA 2OEHA 5EWEA 5AHXA 4F5OA 3K75D 1ZQHA 2LYBA 5AM1A 1T4GA 4FZLA 2XGQA 5DBAA 3KHLA 5AKZA 4I2HA 3QZ7A 4PGXA 5KT5A 4B9SA 3IP4B 3KZIU 2FMQA 8ICKA 1J97A 2V4QA 4YQWA 2QB1A 1NOMA 1F44A 1VJ5A 2A1JA 1FO4A 5CHGA 8ICCA 4QZEA 3C1ZA 4ECTA 2KSOB 2JGAA 3MDCA 3RJJA 3PX4A 3MBYA 2F1JA 5KTQA 1NZPA 1L8OA 4DS4A 1S5LU 4QZDA 4YG2A 4I2DA 1PVQA 5EE3A 3HRDD 7ICNA 2KTQA 2KIVA 3F2BA 4ECUA 4BWJA 2LPEA 1LV5A 4QJFB 3M8RA 4MF8A 5ALMA 3UMGA 4O3RA 4USAA 4M47A 4XQ8A 1QSLA 3H4DA 3JPTA 3N28A 4DEZA 3TAQA 3LWMA 2B0CA 2BR0A 3SYZA 2AGOA 4F4KA 1DK3A 5EE9A 1XWLA 2VIXA 2ASLA 2ZUCA 4KN4A 1JIHA 1QQ5A 1P7DA 1KLNA 2H3QA 3BDPA 2QLTA 3QNMA 4P4MA 2D6FC 4KN7A 4R66A 3T3FA 1ZQBA 5DB9A 2WHEA 1L3UA 3M1YA 2W9AA 9ICEA 1IXRA 1JI7A 1SKWA 4JV0A 2G08A 5J2KA 2KHQA 5J2GA 3HP6A 7ICUA 4QZ8A 3T5HA 4NLZA 3RB4A 1M6YA 4NLGA 1WWUA 1QH9A 1L3VA 5KT2A 3U26A 3WK7A 2CRXA 4Q8FA 5KFRA 4PJ0U 3QZ8A 3ZD8A 4JWMA 1C20A 2H3FA 3SMVA 5DKWA 8ICUA 5J0OA 2I9GA 5D46A 3TAPA 2G0AA 1ZQGA 3A0HU 5KFYA 5HR6A 2VKQA 1J2NA 4QZ9A 4UBBA 4KLOA 1UT8A 3RR8A 3V6HA 5J2BA 4KLUA 4IQUA 4QWBA 4YXMA 4C4SA 1T3NA 2HBKA 2KD1A 2KZMA 1NJXA 4OD0A 5KFHA 5ALNA 3F2DA 3DEEA 1XO1A 3HKZC 3E58A 4IRDA 4JWNA 2BGWA 3UMBA 3KKAA 3T5JA 5DB8A 3N4MB 3FAHA 1NK5A 5KT6A 1ZQOA 1RPLA 3NVYA 7ICPA 4U7CA 2YMMA 2VJ5A 4KMUA 2XY5A 2E8NA 4RQ7A 3AN1A 5JTIA 3GV5B 2H3IA 3RBEA 3JPPA 2JH1A 2YB1A 2HVIA 4ECVA 2OH2A 5KFZA 5KFJA 2K8BB 3BQ0A 5AKGA 4TURA 1QQ6A 3Q8RB 2JZBB 1Q46A 3IDWA 4EENA 3OPXA 2BQUA 1T94A 2HHTA 1JXEA 2LYHA 2W9BA 3OGUA 5AI8A 3F2CA 7ICQA 9ICOA 3RBDA 4O3MA 8ICQA 4M9JA 2W9CB 1ZQIA 3K1RB 3L5KA 2NRVA 7ICKA 1PZNA 4M9HA 4C8OA 2KV2A 4DL4A 2N1RA 4M9LA 4P4OA 1TKDA 5KT3A 2B6GA 3KTQA 1L3SA 2DFLA 5E79U 4I2JA 1RDFA 4DQPA 4DFKA 2XY6A 4I28A 5AI0A 9ICPA 1SL0A 1ZXIA 3ETLA 4JV2A 3VC8A 3Q8MA 4HAIA 3WK6A 2KP7A 4NLNA 8ICFA 1RXVA 2VJ4A 1QTMA 2LBOA 7ICOA 4GXKA 1BPBA 8ICWA 2ZJ8A 4M2YA 3OSPA 2R8IA 4DL6A 4C8KA 4UB1A 4JUZA 2FJ6A 4RPZA 3PMLA 2NRZA 3H0MB 3BQ2A 4FZNA 5KFWA 2C22A 1X40A 2QARA 3JPOA 3EPGA 4ELTA 2WF5A 7ICMA 1ZQCA 2FPMA 1SGGA 5CEHA 3I1YA 5KFSA 1ZJNA 1MN8A 1TFRA 3PZPA 5KFVA 2ASJA 1NKBA 1Q3VA 4OJLA 3KBBA 1A76A 3LVWA 4E0DA 1DGJA 1MQ3A 5KFEA 4JK1A 3S6JA 1X9MA 4YVZA 9ICGA 2P66A 1TK8A 4P4PA 1DGSA 4OCZA 4NWIA 5BPCA 9ICCA 3JPNA 2V9WA 5KAIU 3RF9A 2EZZA 3BS7A 4F91B 3D2QA 3AMZA 2IBKA 5HMMA 4GXIA 3G6XA 1KBUA 2DPJA 4O5KA 3L4PA 1KQQA 8ICAA 3BJYA 3PVXA 4ICAA 3RJKA 4CF3A 4GC7A 3SAFA 2WF8A 1JRPA 4BWMA 3ED5A 2WF6A 5KFXA 1JXLA 4QWAA 4JV1A 5CA7A 3QUBA 3JPSA 4DLEA 3PV8A 1TAQA 4BUGA 4ZH4A 3RH5A 1MC8A 2MU2A 7ICTA 3PW2A 3NVZA 3BZCA 3E0FA 4FE3A 2PKEA 5C5JA 1QSYA 2WAQF 4KLQA 3GIMA 1PVPA 4R64A 9ICFA 3GIJA 1FIQA 4F4ZA 4O0IA 2KNJA 4KLDA 4PZNA 4KMOB 2ZIXB 1TAMA 1NK9A 3WKAA 8ICBA 1JUDA 7ICEA 1ZQNA 2E3TA 2YQEA 2ZIWB 3ZDDA 4PHDA 5ALWA 3H40A 4AP9A 2KZ3A 2ZTCA 1COOA 1KL9A 1ZQXA 5KFCA 2PFNA 5IIIA 1ZQEA 4CF5A 4PH5A 3QXGA 1ZQLA 4YN4A 5KG7A 3HT3A 5KFPA 4BDPA 4YMMA 4QZIA 1VDVA 4OO1J 1Z4OA 7ICSA 5EOZA 5AK6A 3UM9A 3V7KA 4P0PA 3PSIA 1ZQYA 4IR1A 3WU2U 2ALZA 2FLLA 2XCPA 3H7IA 1S0OA 2ZXHA 1WUDA 1N60A 4GC6A 4I2IA 2ISOA 4F2RA 1XSNA 2E8PA 2EZYA 3KFUF 1ECWA 2RQ5A 1ZQWA 1S8OA 5KG2A 5KG4A 5KFGA 2J6TA 4YCXA 2P6UA 2HOQA 5B5EU 1DXSA 3WK5A 3ISBA 3IN5A 4TQRA 3CYMA 1X6JA 3TACB 4ECWA 3OJSA 5KT4A 2JEIA 1N62A 1PK1B 3B0XA 3K1ZA 3FDSA 1DRGA 2H3ZA 5CWRA 3SQIA 1Z1VA 2YX8A 4RQNA 2RP5A 4DL3A 1L3TA 4DSLA 3MGIA 4UB3A 2IA6A 1KDHA 2XCAA 3QUCA 1ZJMA 2HMXA 3GZFA 1WG8A 2PXIA 2F1HA 3HJEA 3KHRA 2HHWA 1ZQJA 1RQNA 3MDAA 5KG1A 4EEYA 3M9NB 4JB3A 4WJ3B 5DG9A 2FMPA 5ALEA 5AK5A 3RAXA 4UAVA 4RUAA 2AGPA 2F2AB 4C7ZA 1SZPA 1KW4A 2NV3A 2ZG6A 1A6SA 5ALKA 4OJ5A 3IG5A 5C0YA 2E8OA 3OJUA 8ICEA 5KG0A 1L5UA 1ZQSA 5DQIA 5KL1B 1COKA 9ICLA 3C5GA 4C7YA 2ZJ5A 2G07A 2IMWP 3LDAA 1ZRNA 4NL9A 3PO5A 5AM3A 2BQ3A 4J9QA 2MUTB 4K4GA 4ED1A 3HPOA 1KTQA 2JRZA 4RQ6A 1RQLA 2ODGA 1IV8A 4PHPA 3ISCA 5AM4A 3EWAA 2XICA 3RJFA 4BGDA 3RB3A 4ED0A 5L1MA 3F53A 4XA5A 1HUOA 5EE0A 3ICXA 5F9NA 4UAWA 2HHXA 4YMOA 4PHEA 2HHSA 1Z19A 3G6VA 1LB2B 4M6WB 3RB0A 4ED8A 5J0TA 1A0PA 4ECQA 3QEAZ 4KLJA 3B0YA 3QEBZ 3H8JA 2C2EA 4F2SA 5ALGA 5ALYA 4O3QA 4Q44A 5G5HA 4CGZA 1LVHA 4TUPA 2W3RA 3QU4A 3KZXA 8ICVA 3F5AA 4DFPA 1D9DA 2KHVA 2OYYA 2PFOA 2XC9A 2PI4A 3QYPA 2PFPA 2KSOA 2DL0A 3EUB2 2F8KA 4ELUA 2V4RA 1OW5A 4C0ZA 2W8KA 2FI1A 2UVUA 5ALIA 4P2HA 4ECSA 4R8UB 5CJ7A 3HX0A 2W9BB 2L5YA 1WWVA 2W55A 4ED2A 2WAQC 3NASA 2XI9A 5J0QA 5L1IA 4RQ4A 2FMSA 3PW7A 2HDOA 1NK8A 5D4BA 3IHQB 4J9RA 3RJGA 1ZQRA 1Q8KA 9ICJA 2W11A 3OTQA 4Z6CA 2C28A 1X6IA 9ICVA 1DK2A 2BDUA 3WK9A 3HW8A 1AQ6A 3PSPA 3K4GA 5ALZA 2BCQA 3CP8A 2I6XA 2WFAA 2LI6A 2MAXA 4IS7A 3KOOA 2AQ4A 1F5SA 1SV0A 3IM1A 2GO7A 4DLGA 4B9TA 2BPFA 1B0XA 4QIWC 3SAHA 4Y2VA 1PUZA 1ZD3A 2J6UA 5KG3A 4BX9C 4R8UA 3C2KA 3JPRA 3MC1A 5KFBA 3DDHA 5AKXA 4B6JA 4O3OA 5KFTA 4RZRA 4EYIB 2JHDA 4CNQA 4YR0A 3C28A 1SV4A 4QWCA 3C2LA 1X2IA 5F9LA 5ALTA 2ESEA 2ZIXA 3BQTA 4YR3A 2ISPA 1ZQTA 1XC9A 4QW8A 5IIJA 4CE6A 2NRWA 2E8MA 3QUQA 5J0YA 4RQ8A 2K8CB 3L3FX 4MFFA 3QE9Y 5KFOA 9ICHA 2OXOA 3T5LA 7ICRA 4DSIA 4Y2QA 3QU7A 4F4WA 1NK6A 1N63A 8ICPA 2FLNA 5AK4A 3SV4A 1S0MA 1CRXA 4I2EA 4CDGA 1CEZA 5KNIA 2D3DA 5KFFA 3MR2A 1BPXA 4IQWA 4NM1A 2E1FA 2ZIVA 5ALJA 3WKBA 5ALXA 5DDYA 2EAOA 1T3QA 5ALSA 4I27A 1ZQQA 2AHOB 5J2JA 2JEFA 2IHNA 2ZIUA 2G5IB 4MFCA 1V9PA 3KHGA 4B9MA 2AGQA 1OUQA 4MHVA 4IL6U 1QLNA 4J9KA 4YR2A 3I76A 3N7SC 7ICJA 5J0WA 1PK1A 2JR5A 5AI5A 2W7PA 5ALHA 4UB8U 4OJPA 2HHVA 2K60A 2W9CA 4KLFA 7ICHA 4CCHA 4BXOA 4DSKA 4KLLA 1ZOLA 1SV0C 5AM2A 9ICSA 4ACOA 3QU9A 1U47A 4NV0A 3UXOA 2VA2A 5L9XA 3V72A 1Z3EB 4JMUA 1JN3A 4NJ8A 1Z00A 5KFKA 4RT2A 9ICKA 1XO0A 1ZQDA 2KVCA 5KFAA 3AQFA 3TI0A 1D8LA 9ICAA 1L7NA 4RQ3A 4F92B 4F5QA 3MFHA 1TV9A 4Q45A 1Q3UA 2MRLA 3M8SA 3H4BA 5ALUA 3NTUA 3ONNA 4ECRA 2K4PA 4OJOA 4C4RA 8ICJA 2ASDA 5IINA 5A0LA 1NKEA 2HOFA 5KAFU 4ED6A 3RJEA 2RHFA 4EZ9A 1RM6C 3CNHA 7ICFA 4I2BA 3NVWA 1PVRA 3SD7A 2Z7JA 1K1SA 1KFSA 3GIIA 3O0FA 3TADC 2HI0A 2HBMA 2FDRA 4KX5A 1NKCA 4GLXA 4Y2RA 1UA0A 4UAZA 4B9NA 5DLFA 2PFQA 4NLKA 5AKEA 3C1YA 3KD3A 1Z4NA 2XO7A 4RQMA 3PR5B 1SB3C 1UQVA 4EZ6A 2IOHA 8ICTA 2OHFA 1LKYB 1SWVA 5J0UA 4P0QA 1O08A 4DL2A 1ZD2P 3KKAC 2JEGA 3WKEA 5DG7A 2JEJA 4EEKA 4O3SA 5J2HA 4LVSA 1KFTA 5IILA 4J03A 4Y2UA 3SENA 2D8CA 2W8LA 4AYBF 4B9VA 5J0SA 2KICA 3NS1A 8ICYA 1ZQFA 4ED7A 5EWGA 5AKIA 2BCRA 3NRWA 2EAMA 3MR5A 2IOFK 4DQIA 2YY6A 2RLTA 4ZOHC 1WCLA 1TVAA 7ICLA 4CF4A 3PX6A 5GTIU 1SIJA 3MR6A 2KFNA 1SKSA 2KIWA 1ZQVA 2H5XA 1D8BA 1SXDA 1MQ2A 2HCFA 4F50A 2ZXIA 2KN7A 2KK0A 1WCNA 3ZD9A 4KLIA 2ZIUB 3EW9A 4I2GA 5ALDA 5ALPA 3A0BU 2FLPA 2DBYA 1TAUA 5TISU 3TQ1A 8ICRA 2GWSA 3DV9A 1SWWA 5ALFA 3CRXA 2LM1A 4XUSA 4RNOA 3MGVA 5T14A 5HHIA 4F71A 4RQ5A 3AU6A 3GQCA 1NK7A 4TQSA 9ICMA 1ZQUA 2QB0B 4Y2YA 4ECXA 3V7LA 4BXOB 3RB6A 4MFAA 1N5XA 5J2EA 8ICIA 1Z1BA 4I29A 4PZOA 5CRXA 2K8AA 3OHAA 1ZD5A 2BCUA 3NRZA 4XRHA 4US8A 4GIBA 2IHMA 5JU5A 2MSNA 1XU4A 3ISDA 5KT7A 2JZBA 2QKQA 1AROP 4M0AA 3ZDCA 2F44A 4OJ6A 4ELVA 1PK3A 2BPCA 4CRXA 3TFSA 2HVHA 3SR6A 2Y0SF 5AM5A 2K89A 2LKYA 1U48A 2LM4A 4FBUA 2QB0A 2NO4A 2KOBA 1FFUA 3RR7A 4M9GA 2YMPA 2G09A 3V6JA 2AXTU 2FPLA 4NM2A 5JRTA 4DFDA 2UVWA 3C23A 4Z6FA 2EH9A 4PPXA 1X9WA 1IIPA 3R9KA 2HOIA 2EQYA 4FS2A 5HHHA 1N48A 1TE2A
chains in the Genus database with same CATH topology
5C0YA 3PSTA 3IP4B 4NV0A 1GO3F 2F8LA 5A0LA 4OO1J 2HOFA 2H3FA 3CRXA 2KV2A 3SMVA 2K4IA 2KJ8A 2RHFA 1CRXA 2KEYA 1F44A 4CDGA 3F5EA 3MGVA 5KL1B 2N1RA 4P0PA 2Y0SC 2G0AA 3PSIA 4KX3A 5T14A 4PL2A 3M6ZA 4NWIA 1PVRA 2Q4TA 2Z7JA 1L6NA 3VCBA 2G07A 2JGAA 3RF9A 5HR6A 1SZHA 3O0FA 2PMZC 4KX5A 2HBMA 3D2QA 2VKQA 2KKPA 2ZXHA 2E1FA 1WUDA 1ZQ1C 4OJLA 2ZIVA 2BDUA 2WB1C 1KBUA 2DF4B 1NZBA 3PSPA 2M0NA 2H3VA 1HEKA 3CP8A 2DGZA 5KL8B 2XIDA 3KFUF 1ECWA 1PVQA 4P0PB 4ICAA 4A8EA 1Z1BA 1URJA 2XICA 3LYSA 3F2BA 2HBKA 2ZIUA 3HKZF 4QIWC 3SAFA 2KD1A 3SAHA 5CRXA 2K4EA 2K8AA 3VC8A 4PL1A 5HR7A 2G5IB 2HOQA 1HIWA 3F53A 3T79A 2G5HB 4P0QA 4QJFB 4P0QB 3IN5A 3F2DA 2F77X 2GOLA 3CYMA 3H0LB 3ICXA 3DEEA 3N7RC 4OJOA 1OUQA 4U6PA 3HKZC 1UPHA 4BX9C 4QNLA 3RFAA 1XNSA 3C29A 1Z19A 2YB4A 3N7SC 1YT3A 4BUGA 2VJ4A 2LBOA 2DQNB 4NLCA 1A0PA 2CN1A 2W03A 3K1ZA 2OM6A 2R18A 3D2NA 2HBLA 2K4HA 2W04A 3ALRA 3NUQA 2RRDA 2H3ZA 2W7PA 1DRGA 3E0FA 2KKVA 4FE3A 4QIWF 4AYBF 4OJPA 2KJ5A 2VIXA 2WAQF 2WB1F 3SQIA 2YX8A 1ED1A 4U7CA 1MA7A 2KICA 2RP5A 3AQEA 1P7DA 2VJ5A 2H3QA 3IG8A 4CGZA 2E5SA 2JHDA 4OJ6A 2D6FC 2CPRA 3NRWA 1PVPA 2H3IA 3M6KA 3C28A 4CRXA 2W7OA 3D2SA 3H0MB 2KNJA 4FZNA 2KJ9A 3KZXA 2Y0SF 4ACOA 2HMXA 2JH1A 2K89A 2LKYA 2LYAA 2YB1A 2KHVA 2OYYA 2ZIXB 1TAMA 2ZIXA 3F5AA 4KMOB 3GZFA 2JH7A 3GU3A 2ZIWA 2G08A 3H0RB 3N7PD 2OH2A 2KHQA 4JMUA 2G06A 2LHTA 3SAGA 2KOBA 2K8BB 4GFJA 2MA1A 2PMZF 1XO0A 2F76X 2A3VA 2G09A 2JMGA 2ZIWB 2KVCA 2KIWA 2K8CB 2XVTA 3OPXA 3L3FX 3AQFA 1T94A 1D8BA 4FZMA 4C0ZA 4AYBC 2ZIVB 4WJ3B 2GH1A 3AL0B 3F2CA 1IIPA 2OXOA 2ZXIA 3PSFA 3PZPA 3LVVA 2HOIA 2HBJA 3M7DA 2F2AB 2LYBA 1Q3UA 4O3MA 2MRLA 4IC9A 4NLBA 2CRXA 2E1EA 2WAQC 2ZIUB 2NV3A 2XI9A 2ZG6A 1Q3VA 1A6SA 3ONNA 4BJQA 4FZLA 4OJ5A 3IG5A 3LVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZF A;  3VCB A;  3VC8 A; 
#chains in the Genus database with same CATH topology
 1LKY A;  1NK4 A;  4O3N A;  1TK0 A;  3H8M A;  2I5H A;  2VA3 A;  1ZET A;  2JXJ A;  1UA1 A;  3HIL A;  5KG5 A;  3PX0 A;  3RTV A;  9ICX A;  3VCB A;  3SZ2 A;  1H38 A;  2PI5 A;  4UAY A;  4C8L A;  4ECZ A;  5DBB A;  1D9F A;  3TAD A;  2EZX A;  2FE9 A;  1V38 A;  3IV6 A;  5AIC A;  1S0V A;  4IQV A;  2F3N A;  3UXP A;  2DGZ A;  5KL8 B;  3C5F A;  1O03 A;  3LYS A;  2UVV A;  8ICL A;  1L8L A;  2GLE A;  2YN4 A;  4J9S A;  1ZQZ A;  3H0L B;  3N7R C;  4C80 A;  1N56 A;  1UPH A;  2Y1J A;  1S9F A;  4QNL A;  3RFA A;  1T7P A;  3PW4 A;  4QZA A;  1WYG A;  3PW0 A;  5DDM A;  4F4Y A;  4KTQ A;  3NUQ A;  3ALR A;  2RRD A;  5EE1 A;  3FM9 A;  5TZV A;  2I1Q A;  2KJ5 A;  4C8M A;  3AM9 A;  4DWI A;  5J0P A;  1N2X A;  5CP2 A;  2FPK A;  3EYZ A;  3M6K A;  4ED3 A;  2YMQ A;  2HHQ A;  3RJI A;  4F5P A;  1TK5 A;  4DCC A;  4DF8 A;  5G5G A;  4RUC A;  5L1K A;  4F93 B;  4YD2 A;  4RNN A;  2JMG A;  1QCK A;  2XVT A;  5BOL A;  4UB2 A;  4UQG A;  4FZM A;  5HML A;  3UQ2 A;  3BQ7 A;  4Y2T A;  1L7M A;  3AL0 B;  5J2A A;  2MUT A;  3LVV A;  4RQ1 A;  1BPY A;  4DOC A;  1ZD4 A;  4KIT B;  2NO5 A;  4UAU A;  4BJQ A;  4R65 A;  1S0N A;  4I2C A;  4F5N A;  2DKZ A;  4Q8E A;  2Y9U A;  1RYR A;  4I2A A;  2K4I A;  2KJ8 A;  4GXJ A;  8ICZ A;  1ZRM A;  4YMN A;  7ICG A;  4UAT A;  5J0X A;  3H8S A;  5JUM A;  2YML A;  4QZC A;  1JAL A;  3KHH A;  3TFR A;  1JX4 A;  2PMZ C;  3FC4 A;  9ICU A;  3V7J A;  4K4I A;  1ZQ1 C;  1BVS A;  2DF4 B;  1C7Y A;  3PY8 A;  1L7O A;  4M6W A;  5DGB A;  5L1L A;  1V97 A;  5AKJ A;  1A77 A;  2JV3 A;  2KFZ A;  5J0R A;  1B43 A;  4EBD A;  5FP0 A;  4QZF A;  4P0Q B;  5AI6 A;  2GOL A;  2BZF A;  3Q8K A;  3RH4 A;  2ZTE A;  3MAB A;  4ECY A;  4KLG A;  2YB4 A;  5D49 A;  2DQN B;  2R18 A;  5KFQ A;  9ICI A;  2HBL A;  2W04 A;  9ICR A;  4RT3 A;  1T8E A;  1V85 A;  3M9O B;  5J2I A;  1X66 A;  4J9N A;  8ICM A;  1BNO A;  4PL2 A;  2LYA A;  2M9N A;  2G06 A;  9ICQ A;  3SAG A;  3D6J A;  9ICW A;  5DQG A;  4GFJ A;  4YXJ A;  4MEX A;  2UVR A;  3AUO A;  2A3V A;  3TAR A;  3H8W A;  2BPG A;  3NVV A;  1U4B A;  3MR3 A;  4Q43 A;  4DSJ A;  2WF7 A;  1DOQ A;  4QWD A;  1N61 A;  3RJH A;  5BOM A;  4C8N A;  9ICB A;  3I28 A;  1KKX A;  4Y2J A;  4Z6D A;  1VLB A;  8ICX A;  5AIA A;  1S76 D;  3RRG A;  4RNM A;  2DPI A;  3LK9 A;  3M6Z A;  4MEY A;  3PNC A;  1SZH A;  1CUK A;  4DL7 A;  4PGQ A;  3OHB A;  2KKP A;  2VA8 A;  5AKK A;  1JRO A;  2WB1 C;  3UPQ A;  2DWQ A;  4UB5 A;  3B9J A;  2M0N A;  5AKH A;  1XS9 D;  3V6K A;  2P35 A;  4UAR A;  1CI4 A;  1UT5 A;  4P0P B;  4O3P A;  4NXZ A;  3TKA A;  5KFI A;  3HKZ F;  5DLG A;  5HR7 A;  4KLT A;  1J2M A;  3QU5 A;  8ICN A;  1JMS A;  4DS5 A;  3BS5 A;  3ZDA A;  4UBC A;  4IRC A;  4G9B A;  3GIK A;  4IRK A;  5J2C A;  2W9M A;  5DB7 A;  1S77 D;  4RQ0 A;  4NLC A;  1NI3 A;  2K4H A;  3J81 j;  1UCV A;  2KKV A;  4US9 A;  1K5O A;  4DFJ A;  4J9O A;  5ALO A;  1BPD A;  1Y88 A;  3SV3 A;  8ICH A;  4RPY A;  2W7O A;  4DQR A;  2W43 A;  5GTH U;  3ZDB A;  3N97 B;  3Q8L A;  4B9L A;  4I2F A;  2BQR A;  2KJ9 A;  1X9X A;  4NL9 C;  3GV7 B;  4RPX A;  3H0R B;  2JH7 A;  3BZK A;  3GU3 A;  1S97 A;  4M9N A;  3ZI4 A;  4F4X A;  4DSF A;  3SEI A;  1IM4 A;  2F76 X;  1IG6 A;  1BPE A;  2NRT A;  4KLH A;  1YZ7 A;  4R63 A;  3OSN A;  5H2F U;  1ZQK A;  4KLS A;  2ZIV B;  2RDJ A;  1NJY A;  1U49 A;  4UB4 A;  1B4F A;  3QX7 A;  3PSF A;  2HBJ A;  3M7D A;  1U9L A;  4Y2X A;  2QAR B;  1QQ7 A;  3BS5 B;  5IIM A;  3E2E A;  4YFK A;  3NGD A;  2F1I A;  1GO3 F;  2F8L A;  1SKR A;  3PR4 A;  5KG6 A;  3IRU A;  4EBC A;  1L7P A;  3F5E A;  5KFM A;  2ZUB A;  5DB6 A;  2CXY A;  1ZQA A;  2IOF A;  4J9L A;  5IIO A;  1ZQP A;  4QZB A;  1HJP A;  1YZ6 A;  5AIB A;  1KFD A;  3C21 A;  2OWO A;  1KN5 A;  3WK4 A;  4O5E A;  1MSW D;  3AEV A;  1HEK A;  3RAQ A;  3T5K A;  2YTU A;  4DO9 A;  3GFK B;  1X9S A;  3T79 A;  1Z00 B;  3PMN A;  4FS1 A;  4TUQ A;  5AKL A;  3EPI A;  2R8K A;  5EWF A;  4HYK A;  5CR0 A;  4FO6 A;  4F72 A;  1NJZ A;  5IIK A;  2P6R A;  3SI8 A;  4LZG A;  3ZDE A;  4PHA A;  2KE7 A;  4UW9 A;  3WKD A;  4QIW F;  4IR9 A;  4M04 A;  2W3S A;  1MA7 A;  4EBE A;  3IG8 A;  9ICN A;  2E5S A;  3HWT A;  3QU2 A;  3FYH A;  2XGP A;  4PGY A;  4O9M A;  4UAS A;  2BDP A;  2BHN A;  3GDX A;  1XSP A;  2DKX A;  3PW5 A;  2KZZ A;  3RRH A;  5ALV A;  1N5W A;  4IQT A;  8ICG A;  4QW9 A;  2AQ0 A;  4DOB A;  3AU2 A;  5F3X B;  2R8J A;  2GH1 A;  4J9M A;  4G3I A;  3ETR A;  2Q0Z X;  2HW3 A;  1B22 A;  1NJW A;  5L1J A;  5J2F A;  4IC9 A;  2C2R A;  3BQ1 A;  1SL2 A;  1BGX T;  3WKC A;  4TUS A;  4FFD A;  2AJQ A;  4F8R A;  3PST A;  5ALL A;  2Y9T A;  4DFM A;  7ICI A;  4RQ2 A;  3CW2 C;  3UQ0 A;  2R8G A;  2EAN A;  4KLE A;  2Y0S C;  3Q8Q B;  3Q8P B;  1XSL A;  1NNL A;  1L6N A;  2ZUD A;  4O5C A;  5KFD A;  1OXJ A;  5CB1 A;  4LJX A;  5J8Y C;  2NYV A;  2Y1I A;  4F3O A;  4QZH A;  2KVS A;  4C4T A;  2XID A;  5J2D A;  1BPZ A;  4LZD A;  5J8Y A;  4EEL A;  2NRX A;  5J29 A;  4PL1 A;  1NK0 A;  2G5H B;  2AU0 A;  2F77 X;  3QUT A;  3JPQ A;  3WK8 A;  4B9U A;  4EX7 A;  1XNS A;  2A1A A;  3C29 A;  4QZG A;  1FEZ A;  1YT3 A;  3UMC A;  2RDI A;  4YD1 A;  2ZTD A;  1F0M A;  2W03 A;  2CN1 A;  5DBC A;  1SL1 A;  2WTF A;  5AI9 A;  1ZQM A;  2BCV A;  2WB1 F;  1QSS A;  5KFN A;  5DGA A;  3AQE A;  5HP4 A;  1S10 A;  2J6S A;  2HSZ A;  5AM0 A;  4QWE A;  4KLM A;  5DG8 A;  3GIL A;  2HHU A;  1RYU A;  2ES6 A;  3M9M B;  3G6Y A;  4UB6 U;  2EAP A;  3N7P D;  3UXN A;  5AK3 A;  5ALQ A;  8ICO A;  2MA1 A;  2PMZ F;  4DOA A;  1RYS A;  1KSP A;  5ALR A;  2BCS A;  2KG5 A;  1ZYQ A;  5HNK A;  4DQS A;  7ICV A;  4NLB A;  4Y2P A;  2E1E A;  4F5R A;  3THV A;  4K4H A;  5KFL A;  3RH6 A;  2BKE A;  3C2M A;  5K4L A;  5DQH A;  2W54 A;  2R8H A;  2KEY A;  3MGH A;  2B21 A;  3Q8S B;  4KX3 A;  4FBT A;  4EYH B;  2Q4T A;  2LMR A;  2DUY A;  1HUZ A;  4X5V A;  9ICT A;  2EDU A;  4MF2 A;  4Z6E A;  4J9P A;  1NZB A;  2H3V A;  1SXE A;  2ATL A;  1RG6 A;  1FFV A;  5B66 U;  3MFI A;  1EXN A;  4A8E A;  3LWL A;  1URJ A;  1BNP A;  4RU9 A;  2ZJA A;  2K4E A;  3PO4 A;  8ICS A;  1RXW A;  1HIW A;  3GV8 B;  2KMD A;  4U6P A;  3TAN A;  2VAN A;  4NY8 A;  4DQQ A;  2A19 A;  2OM6 A;  1D8Y A;  3D2N A;  2A1J B;  1KRP A;  5AKY A;  2O6K A;  1KEJ A;  4YP3 A;  1ED1 A;  4EX6 A;  2C2D A;  5AI4 A;  5KFU A;  2CPR A;  4DF4 A;  3D2S A;  3ORY A;  2AH5 A;  4DL5 A;  2XY7 A;  2WF9 A;  2ZIW A;  2LHT A;  4DSE A;  4Y2S A;  1X42 A;  1K1Q A;  3EZ5 A;  1RZT A;  2OCE A;  4AYB C;  1U45 A;  1UHU A;  2OEH A;  5EWE A;  5AHX A;  4F5O A;  3K75 D;  1ZQH A;  2LYB A;  5AM1 A;  1T4G A;  4FZL A;  2XGQ A;  5DBA A;  3KHL A;  5AKZ A;  4I2H A;  3QZ7 A;  4PGX A;  5KT5 A;  4B9S A;  3IP4 B;  3KZI U;  2FMQ A;  8ICK A;  1J97 A;  2V4Q A;  4YQW A;  2QB1 A;  1NOM A;  1F44 A;  1VJ5 A;  2A1J A;  1FO4 A;  5CHG A;  8ICC A;  4QZE A;  3C1Z A;  4ECT A;  2KSO B;  2JGA A;  3MDC A;  3RJJ A;  3PX4 A;  3MBY A;  2F1J A;  5KTQ A;  1NZP A;  1L8O A;  4DS4 A;  1S5L U;  4QZD A;  4YG2 A;  4I2D A;  1PVQ A;  5EE3 A;  3HRD D;  7ICN A;  2KTQ A;  2KIV A;  3F2B A;  4ECU A;  4BWJ A;  2LPE A;  1LV5 A;  4QJF B;  3M8R A;  4MF8 A;  5ALM A;  3UMG A;  4O3R A;  4USA A;  4M47 A;  4XQ8 A;  1QSL A;  3H4D A;  3JPT A;  3N28 A;  4DEZ A;  3TAQ A;  3LWM A;  2B0C A;  2BR0 A;  3SYZ A;  2AGO A;  4F4K A;  1DK3 A;  5EE9 A;  1XWL A;  2VIX A;  2ASL A;  2ZUC A;  4KN4 A;  1JIH A;  1QQ5 A;  1P7D A;  1KLN A;  2H3Q A;  3BDP A;  2QLT A;  3QNM A;  4P4M A;  2D6F C;  4KN7 A;  4R66 A;  3T3F A;  1ZQB A;  5DB9 A;  2WHE A;  1L3U A;  3M1Y A;  2W9A A;  9ICE A;  1IXR A;  1JI7 A;  1SKW A;  4JV0 A;  2G08 A;  5J2K A;  2KHQ A;  5J2G A;  3HP6 A;  7ICU A;  4QZ8 A;  3T5H A;  4NLZ A;  3RB4 A;  1M6Y A;  4NLG A;  1WWU A;  1QH9 A;  1L3V A;  5KT2 A;  3U26 A;  3WK7 A;  2CRX A;  4Q8F A;  5KFR A;  4PJ0 U;  3QZ8 A;  3ZD8 A;  4JWM A;  1C20 A;  2H3F A;  3SMV A;  5DKW A;  8ICU A;  5J0O A;  2I9G A;  5D46 A;  3TAP A;  2G0A A;  1ZQG A;  3A0H U;  5KFY A;  5HR6 A;  2VKQ A;  1J2N A;  4QZ9 A;  4UBB A;  4KLO A;  1UT8 A;  3RR8 A;  3V6H A;  5J2B A;  4KLU A;  4IQU A;  4QWB A;  4YXM A;  4C4S A;  1T3N A;  2HBK A;  2KD1 A;  2KZM A;  1NJX A;  4OD0 A;  5KFH A;  5ALN A;  3F2D A;  3DEE A;  1XO1 A;  3HKZ C;  3E58 A;  4IRD A;  4JWN A;  2BGW A;  3UMB A;  3KKA A;  3T5J A;  5DB8 A;  3N4M B;  3FAH A;  1NK5 A;  5KT6 A;  1ZQO A;  1RPL A;  3NVY A;  7ICP A;  4U7C A;  2YMM A;  2VJ5 A;  4KMU A;  2XY5 A;  2E8N A;  4RQ7 A;  3AN1 A;  5JTI A;  3GV5 B;  2H3I A;  3RBE A;  3JPP A;  2JH1 A;  2YB1 A;  2HVI A;  4ECV A;  2OH2 A;  5KFZ A;  5KFJ A;  2K8B B;  3BQ0 A;  5AKG A;  4TUR A;  1QQ6 A;  3Q8R B;  2JZB B;  1Q46 A;  3IDW A;  4EEN A;  3OPX A;  2BQU A;  1T94 A;  2HHT A;  1JXE A;  2LYH A;  2W9B A;  3OGU A;  5AI8 A;  3F2C A;  7ICQ A;  9ICO A;  3RBD A;  4O3M A;  8ICQ A;  4M9J A;  2W9C B;  1ZQI A;  3K1R B;  3L5K A;  2NRV A;  7ICK A;  1PZN A;  4M9H A;  4C8O A;  2KV2 A;  4DL4 A;  2N1R A;  4M9L A;  4P4O A;  1TKD A;  5KT3 A;  2B6G A;  3KTQ A;  1L3S A;  2DFL A;  5E79 U;  4I2J A;  1RDF A;  4DQP A;  4DFK A;  2XY6 A;  4I28 A;  5AI0 A;  9ICP A;  1SL0 A;  1ZXI A;  3ETL A;  4JV2 A;  3VC8 A;  3Q8M A;  4HAI A;  3WK6 A;  2KP7 A;  4NLN A;  8ICF A;  1RXV A;  2VJ4 A;  1QTM A;  2LBO A;  7ICO A;  4GXK A;  1BPB A;  8ICW A;  2ZJ8 A;  4M2Y A;  3OSP A;  2R8I A;  4DL6 A;  4C8K A;  4UB1 A;  4JUZ A;  2FJ6 A;  4RPZ A;  3PML A;  2NRZ A;  3H0M B;  3BQ2 A;  4FZN A;  5KFW A;  2C22 A;  1X40 A;  2QAR A;  3JPO A;  3EPG A;  4ELT A;  2WF5 A;  7ICM A;  1ZQC A;  2FPM A;  1SGG A;  5CEH A;  3I1Y A;  5KFS A;  1ZJN A;  1MN8 A;  1TFR A;  3PZP A;  5KFV A;  2ASJ A;  1NKB A;  1Q3V A;  4OJL A;  3KBB A;  1A76 A;  3LVW A;  4E0D A;  1DGJ A;  1MQ3 A;  5KFE A;  4JK1 A;  3S6J A;  1X9M A;  4YVZ A;  9ICG A;  2P66 A;  1TK8 A;  4P4P A;  1DGS A;  4OCZ A;  4NWI A;  5BPC A;  9ICC A;  3JPN A;  2V9W A;  5KAI U;  3RF9 A;  2EZZ A;  3BS7 A;  4F91 B;  3D2Q A;  3AMZ A;  2IBK A;  5HMM A;  4GXI A;  3G6X A;  1KBU A;  2DPJ A;  4O5K A;  3L4P A;  1KQQ A;  8ICA A;  3BJY A;  3PVX A;  4ICA A;  3RJK A;  4CF3 A;  4GC7 A;  3SAF A;  2WF8 A;  1JRP A;  4BWM A;  3ED5 A;  2WF6 A;  5KFX A;  1JXL A;  4QWA A;  4JV1 A;  5CA7 A;  3QUB A;  3JPS A;  4DLE A;  3PV8 A;  1TAQ A;  4BUG A;  4ZH4 A;  3RH5 A;  1MC8 A;  2MU2 A;  7ICT A;  3PW2 A;  3NVZ A;  3BZC A;  3E0F A;  4FE3 A;  2PKE A;  5C5J A;  1QSY A;  2WAQ F;  4KLQ A;  3GIM A;  1PVP A;  4R64 A;  9ICF A;  3GIJ A;  1FIQ A;  4F4Z A;  4O0I A;  2KNJ A;  4KLD A;  4PZN A;  4KMO B;  2ZIX B;  1TAM A;  1NK9 A;  3WKA A;  8ICB A;  1JUD A;  7ICE A;  1ZQN A;  2E3T A;  2YQE A;  2ZIW B;  3ZDD A;  4PHD A;  5ALW A;  3H40 A;  4AP9 A;  2KZ3 A;  2ZTC A;  1COO A;  1KL9 A;  1ZQX A;  5KFC A;  2PFN A;  5III A;  1ZQE A;  4CF5 A;  4PH5 A;  3QXG A;  1ZQL A;  4YN4 A;  5KG7 A;  3HT3 A;  5KFP A;  4BDP A;  4YMM A;  4QZI A;  1VDV A;  4OO1 J;  1Z4O A;  7ICS A;  5EOZ A;  5AK6 A;  3UM9 A;  3V7K A;  4P0P A;  3PSI A;  1ZQY A;  4IR1 A;  3WU2 U;  2ALZ A;  2FLL A;  2XCP A;  3H7I A;  1S0O A;  2ZXH A;  1WUD A;  1N60 A;  4GC6 A;  4I2I A;  2ISO A;  4F2R A;  1XSN A;  2E8P A;  2EZY A;  3KFU F;  1ECW A;  2RQ5 A;  1ZQW A;  1S8O A;  5KG2 A;  5KG4 A;  5KFG A;  2J6T A;  4YCX A;  2P6U A;  2HOQ A;  5B5E U;  1DXS A;  3WK5 A;  3ISB A;  3IN5 A;  4TQR A;  3CYM A;  1X6J A;  3TAC B;  4ECW A;  3OJS A;  5KT4 A;  2JEI A;  1N62 A;  1PK1 B;  3B0X A;  3K1Z A;  3FDS A;  1DRG A;  2H3Z A;  5CWR A;  3SQI A;  1Z1V A;  2YX8 A;  4RQN A;  2RP5 A;  4DL3 A;  1L3T A;  4DSL A;  3MGI A;  4UB3 A;  2IA6 A;  1KDH A;  2XCA A;  3QUC A;  1ZJM A;  2HMX A;  3GZF A;  1WG8 A;  2PXI A;  2F1H A;  3HJE A;  3KHR A;  2HHW A;  1ZQJ A;  1RQN A;  3MDA A;  5KG1 A;  4EEY A;  3M9N B;  4JB3 A;  4WJ3 B;  5DG9 A;  2FMP A;  5ALE A;  5AK5 A;  3RAX A;  4UAV A;  4RUA A;  2AGP A;  2F2A B;  4C7Z A;  1SZP A;  1KW4 A;  2NV3 A;  2ZG6 A;  1A6S A;  5ALK A;  4OJ5 A;  3IG5 A;  5C0Y A;  2E8O A;  3OJU A;  8ICE A;  5KG0 A;  1L5U A;  1ZQS A;  5DQI A;  5KL1 B;  1COK A;  9ICL A;  3C5G A;  4C7Y A;  2ZJ5 A;  2G07 A;  2IMW P;  3LDA A;  1ZRN A;  4NL9 A;  3PO5 A;  5AM3 A;  2BQ3 A;  4J9Q A;  2MUT B;  4K4G A;  4ED1 A;  3HPO A;  1KTQ A;  2JRZ A;  4RQ6 A;  1RQL A;  2ODG A;  1IV8 A;  4PHP A;  3ISC A;  5AM4 A;  3EWA A;  2XIC A;  3RJF A;  4BGD A;  3RB3 A;  4ED0 A;  5L1M A;  3F53 A;  4XA5 A;  1HUO A;  5EE0 A;  3ICX A;  5F9N A;  4UAW A;  2HHX A;  4YMO A;  4PHE A;  2HHS A;  1Z19 A;  3G6V A;  1LB2 B;  4M6W B;  3RB0 A;  4ED8 A;  5J0T A;  1A0P A;  4ECQ A;  3QEA Z;  4KLJ A;  3B0Y A;  3QEB Z;  3H8J A;  2C2E A;  4F2S A;  5ALG A;  5ALY A;  4O3Q A;  4Q44 A;  5G5H A;  4CGZ A;  1LVH A;  4TUP A;  2W3R A;  3QU4 A;  3KZX A;  8ICV A;  3F5A A;  4DFP A;  1D9D A;  2KHV A;  2OYY A;  2PFO A;  2XC9 A;  2PI4 A;  3QYP A;  2PFP A;  2KSO A;  2DL0 A;  3EUB 2;  2F8K A;  4ELU A;  2V4R A;  1OW5 A;  4C0Z A;  2W8K A;  2FI1 A;  2UVU A;  5ALI A;  4P2H A;  4ECS A;  4R8U B;  5CJ7 A;  3HX0 A;  2W9B B;  2L5Y A;  1WWV A;  2W55 A;  4ED2 A;  2WAQ C;  3NAS A;  2XI9 A;  5J0Q A;  5L1I A;  4RQ4 A;  2FMS A;  3PW7 A;  2HDO A;  1NK8 A;  5D4B A;  3IHQ B;  4J9R A;  3RJG A;  1ZQR A;  1Q8K A;  9ICJ A;  2W11 A;  3OTQ A;  4Z6C A;  2C28 A;  1X6I A;  9ICV A;  1DK2 A;  2BDU A;  3WK9 A;  3HW8 A;  1AQ6 A;  3PSP A;  3K4G A;  5ALZ A;  2BCQ A;  3CP8 A;  2I6X A;  2WFA A;  2LI6 A;  2MAX A;  4IS7 A;  3KOO A;  2AQ4 A;  1F5S A;  1SV0 A;  3IM1 A;  2GO7 A;  4DLG A;  4B9T A;  2BPF A;  1B0X A;  4QIW C;  3SAH A;  4Y2V A;  1PUZ A;  1ZD3 A;  2J6U A;  5KG3 A;  4BX9 C;  4R8U A;  3C2K A;  3JPR A;  3MC1 A;  5KFB A;  3DDH A;  5AKX A;  4B6J A;  4O3O A;  5KFT A;  4RZR A;  4EYI B;  2JHD A;  4CNQ A;  4YR0 A;  3C28 A;  1SV4 A;  4QWC A;  3C2L A;  1X2I A;  5F9L A;  5ALT A;  2ESE A;  2ZIX A;  3BQT A;  4YR3 A;  2ISP A;  1ZQT A;  1XC9 A;  4QW8 A;  5IIJ A;  4CE6 A;  2NRW A;  2E8M A;  3QUQ A;  5J0Y A;  4RQ8 A;  2K8C B;  3L3F X;  4MFF A;  3QE9 Y;  5KFO A;  9ICH A;  2OXO A;  3T5L A;  7ICR A;  4DSI A;  4Y2Q A;  3QU7 A;  4F4W A;  1NK6 A;  1N63 A;  8ICP A;  2FLN A;  5AK4 A;  3SV4 A;  1S0M A;  1CRX A;  4I2E A;  4CDG A;  1CEZ A;  5KNI A;  2D3D A;  5KFF A;  3MR2 A;  1BPX A;  4IQW A;  4NM1 A;  2E1F A;  2ZIV A;  5ALJ A;  3WKB A;  5ALX A;  5DDY A;  2EAO A;  1T3Q A;  5ALS A;  4I27 A;  1ZQQ A;  2AHO B;  5J2J A;  2JEF A;  2IHN A;  2ZIU A;  2G5I B;  4MFC A;  1V9P A;  3KHG A;  4B9M A;  2AGQ A;  1OUQ A;  4MHV A;  4IL6 U;  1QLN A;  4J9K A;  4YR2 A;  3I76 A;  3N7S C;  7ICJ A;  5J0W A;  1PK1 A;  2JR5 A;  5AI5 A;  2W7P A;  5ALH A;  4UB8 U;  4OJP A;  2HHV A;  2K60 A;  2W9C A;  4KLF A;  7ICH A;  4CCH A;  4BXO A;  4DSK A;  4KLL A;  1ZOL A;  1SV0 C;  5AM2 A;  9ICS A;  4ACO A;  3QU9 A;  1U47 A;  4NV0 A;  3UXO A;  2VA2 A;  5L9X A;  3V72 A;  1Z3E B;  4JMU A;  1JN3 A;  4NJ8 A;  1Z00 A;  5KFK A;  4RT2 A;  9ICK A;  1XO0 A;  1ZQD A;  2KVC A;  5KFA A;  3AQF A;  3TI0 A;  1D8L A;  9ICA A;  1L7N A;  4RQ3 A;  4F92 B;  4F5Q A;  3MFH A;  1TV9 A;  4Q45 A;  1Q3U A;  2MRL A;  3M8S A;  3H4B A;  5ALU A;  3NTU A;  3ONN A;  4ECR A;  2K4P A;  4OJO A;  4C4R A;  8ICJ A;  2ASD A;  5IIN A;  5A0L A;  1NKE A;  2HOF A;  5KAF U;  4ED6 A;  3RJE A;  2RHF A;  4EZ9 A;  1RM6 C;  3CNH A;  7ICF A;  4I2B A;  3NVW A;  1PVR A;  3SD7 A;  2Z7J A;  1K1S A;  1KFS A;  3GII A;  3O0F A;  3TAD C;  2HI0 A;  2HBM A;  2FDR A;  4KX5 A;  1NKC A;  4GLX A;  4Y2R A;  1UA0 A;  4UAZ A;  4B9N A;  5DLF A;  2PFQ A;  4NLK A;  5AKE A;  3C1Y A;  3KD3 A;  1Z4N A;  2XO7 A;  4RQM A;  3PR5 B;  1SB3 C;  1UQV A;  4EZ6 A;  2IOH A;  8ICT A;  2OHF A;  1LKY B;  1SWV A;  5J0U A;  4P0Q A;  1O08 A;  4DL2 A;  1ZD2 P;  3KKA C;  2JEG A;  3WKE A;  5DG7 A;  2JEJ A;  4EEK A;  4O3S A;  5J2H A;  4LVS A;  1KFT A;  5IIL A;  4J03 A;  4Y2U A;  3SEN A;  2D8C A;  2W8L A;  4AYB F;  4B9V A;  5J0S A;  2KIC A;  3NS1 A;  8ICY A;  1ZQF A;  4ED7 A;  5EWG A;  5AKI A;  2BCR A;  3NRW A;  2EAM A;  3MR5 A;  2IOF K;  4DQI A;  2YY6 A;  2RLT A;  4ZOH C;  1WCL A;  1TVA A;  7ICL A;  4CF4 A;  3PX6 A;  5GTI U;  1SIJ A;  3MR6 A;  2KFN A;  1SKS A;  2KIW A;  1ZQV A;  2H5X A;  1D8B A;  1SXD A;  1MQ2 A;  2HCF A;  4F50 A;  2ZXI A;  2KN7 A;  2KK0 A;  1WCN A;  3ZD9 A;  4KLI A;  2ZIU B;  3EW9 A;  4I2G A;  5ALD A;  5ALP A;  3A0B U;  2FLP A;  2DBY A;  1TAU A;  5TIS U;  3TQ1 A;  8ICR A;  2GWS A;  3DV9 A;  1SWW A;  5ALF A;  3CRX A;  2LM1 A;  4XUS A;  4RNO A;  3MGV A;  5T14 A;  5HHI A;  4F71 A;  4RQ5 A;  3AU6 A;  3GQC A;  1NK7 A;  4TQS A;  9ICM A;  1ZQU A;  2QB0 B;  4Y2Y A;  4ECX A;  3V7L A;  4BXO B;  3RB6 A;  4MFA A;  1N5X A;  5J2E A;  8ICI A;  1Z1B A;  4I29 A;  4PZO A;  5CRX A;  2K8A A;  3OHA A;  1ZD5 A;  2BCU A;  3NRZ A;  4XRH A;  4US8 A;  4GIB A;  2IHM A;  5JU5 A;  2MSN A;  1XU4 A;  3ISD A;  5KT7 A;  2JZB A;  2QKQ A;  1ARO P;  4M0A A;  3ZDC A;  2F44 A;  4OJ6 A;  4ELV A;  1PK3 A;  2BPC A;  4CRX A;  3TFS A;  2HVH A;  3SR6 A;  2Y0S F;  5AM5 A;  2K89 A;  2LKY A;  1U48 A;  2LM4 A;  4FBU A;  2QB0 A;  2NO4 A;  2KOB A;  1FFU A;  3RR7 A;  4M9G A;  2YMP A;  2G09 A;  3V6J A;  2AXT U;  2FPL A;  4NM2 A;  5JRT A;  4DFD A;  2UVW A;  3C23 A;  4Z6F A;  2EH9 A;  4PPX A;  1X9W A;  1IIP A;  3R9K A;  2HOI A;  2EQY A;  4FS2 A;  5HHH A;  1N48 A;  1TE2 A; 
#chains in the Genus database with same CATH homology
 5C0Y A;  3PST A;  3IP4 B;  4NV0 A;  1GO3 F;  2F8L A;  5A0L A;  4OO1 J;  2HOF A;  2H3F A;  3CRX A;  2KV2 A;  3SMV A;  2K4I A;  2KJ8 A;  2RHF A;  1CRX A;  2KEY A;  1F44 A;  4CDG A;  3F5E A;  3MGV A;  5KL1 B;  2N1R A;  4P0P A;  2Y0S C;  2G0A A;  3PSI A;  4KX3 A;  5T14 A;  4PL2 A;  3M6Z A;  4NWI A;  1PVR A;  2Q4T A;  2Z7J A;  1L6N A;  3VCB A;  2G07 A;  2JGA A;  3RF9 A;  5HR6 A;  1SZH A;  3O0F A;  2PMZ C;  4KX5 A;  2HBM A;  3D2Q A;  2VKQ A;  2KKP A;  2ZXH A;  2E1F A;  1WUD A;  1ZQ1 C;  4OJL A;  2ZIV A;  2BDU A;  2WB1 C;  1KBU A;  2DF4 B;  1NZB A;  3PSP A;  2M0N A;  2H3V A;  1HEK A;  3CP8 A;  2DGZ A;  5KL8 B;  2XID A;  3KFU F;  1ECW A;  1PVQ A;  4P0P B;  4ICA A;  4A8E A;  1Z1B A;  1URJ A;  2XIC A;  3LYS A;  3F2B A;  2HBK A;  2ZIU A;  3HKZ F;  4QIW C;  3SAF A;  2KD1 A;  3SAH A;  5CRX A;  2K4E A;  2K8A A;  3VC8 A;  4PL1 A;  5HR7 A;  2G5I B;  2HOQ A;  1HIW A;  3F53 A;  3T79 A;  2G5H B;  4P0Q A;  4QJF B;  4P0Q B;  3IN5 A;  3F2D A;  2F77 X;  2GOL A;  3CYM A;  3H0L B;  3ICX A;  3DEE A;  3N7R C;  4OJO A;  1OUQ A;  4U6P A;  3HKZ C;  1UPH A;  4BX9 C;  4QNL A;  3RFA A;  1XNS A;  3C29 A;  1Z19 A;  2YB4 A;  3N7S C;  1YT3 A;  4BUG A;  2VJ4 A;  2LBO A;  2DQN B;  4NLC A;  1A0P A;  2CN1 A;  2W03 A;  3K1Z A;  2OM6 A;  2R18 A;  3D2N A;  2HBL A;  2K4H A;  2W04 A;  3ALR A;  3NUQ A;  2RRD A;  2H3Z A;  2W7P A;  1DRG A;  3E0F A;  2KKV A;  4FE3 A;  4QIW F;  4AYB F;  4OJP A;  2KJ5 A;  2VIX A;  2WAQ F;  2WB1 F;  3SQI A;  2YX8 A;  1ED1 A;  4U7C A;  1MA7 A;  2KIC A;  2RP5 A;  3AQE A;  1P7D A;  2VJ5 A;  2H3Q A;  3IG8 A;  4CGZ A;  2E5S A;  2JHD A;  4OJ6 A;  2D6F C;  2CPR A;  3NRW A;  1PVP A;  2H3I A;  3M6K A;  3C28 A;  4CRX A;  2W7O A;  3D2S A;  3H0M B;  2KNJ A;  4FZN A;  2KJ9 A;  3KZX A;  2Y0S F;  4ACO A;  2HMX A;  2JH1 A;  2K89 A;  2LKY A;  2LYA A;  2YB1 A;  2KHV A;  2OYY A;  2ZIX B;  1TAM A;  2ZIX A;  3F5A A;  4KMO B;  3GZF A;  2JH7 A;  3GU3 A;  2ZIW A;  2G08 A;  3H0R B;  3N7P D;  2OH2 A;  2KHQ A;  4JMU A;  2G06 A;  2LHT A;  3SAG A;  2KOB A;  2K8B B;  4GFJ A;  2MA1 A;  2PMZ F;  1XO0 A;  2F76 X;  2A3V A;  2G09 A;  2JMG A;  2ZIW B;  2KVC A;  2KIW A;  2K8C B;  2XVT A;  3OPX A;  3L3F X;  3AQF A;  1T94 A;  1D8B A;  4FZM A;  4C0Z A;  4AYB C;  2ZIV B;  4WJ3 B;  2GH1 A;  3AL0 B;  3F2C A;  1IIP A;  2OXO A;  2ZXI A;  3PSF A;  3PZP A;  3LVV A;  2HOI A;  2HBJ A;  3M7D A;  2F2A B;  2LYB A;  1Q3U A;  4O3M A;  2MRL A;  4IC9 A;  4NLB A;  2CRX A;  2E1E A;  2WAQ C;  2ZIU B;  2NV3 A;  2XI9 A;  2ZG6 A;  1Q3V A;  1A6S A;  3ONN A;  4BJQ A;  4FZL A;  4OJ5 A;  3IG5 A;  3LVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...