3VCBA

C425s mutant of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vcbA00
3VC8A 3VCBA 3GZFA
chains in the Genus database with same CATH superfamily
5CHGA 4NM2A 3BQTA 4RUCA 3TARA 3PR4A 2R8JA 5KG5A 5KFFA 4RQ8A 4IQTA 3H0LB 3RH6A 4CF4A 4G9BA 3PX4A 4M9NA 1QLNA 3E58A 3RF9A 3QUCA 1QQ5A 3KOOA 2WB1C 2FPKA 1ZETA 2BPGA 5CWRA 3MGVA 4U7CA 2KD1A 3LVVA 1URJA 2MRLA 1L7OA 3B0XA 2KHVA 1NK0A 5CB1A 1TVAA 3RJJA 1SL2A 1QQ6A 4KLEA 4I2DA 4FS2A 1PK1B 4K4GA 4PJ0U 3HX0A 4UBBA 2NRZA 4KITB 2VANA 1TK8A 1U4BA 3QU7A 1ZJNA 1TKDA 1SZPA 8ICJA 3LWMA 4JUZA 5ALZA 4F4KA 1BNOA 1RQLA 4RPZA 2XC9A 2C2EA 5ALXA 3CNHA 2W8LA 9ICMA 4B9LA 3VCBA 3C2KA 2ZXIA 4OJOA 3UXNA 2HHVA 1L7NA 7ICGA 4QZBA 3TQ1A 1WYGA 2HBJA 3TAQA 5AI9A 3RJIA 1WWVA 4JWMA 2IOFA 3DEEA 4RNOA 1JX4A 3PO5A 4DL6A 4IRDA 4JWNA 4QZ9A 2W54A 4KLJA 2JHDA 5ALLA 3NUQA 5AKEA 4RPYA 3KTQA 4O3OA 4BX9C 1BPEA 1OUQA 2EAMA 5KFUA 4DEZA 3A0HU 1SZHA 2K60A 4RQ2A 5KTQA 2XY6A 8ICPA 1L7PA 3QUQA 2NYVA 5J2JA 3MC1A 5J0QA 2KEYA 2KIVA 9ICSA 3JPQA 4DQIA 3HPOA 5J0UA 1S0OA 2J6SA 3V7KA 4ED0A 1DOQA 4NL9A 4R8UB 2F1HA 2A3VA 7ICEA 4QZ8A 3QE9Y 9ICHA 3LYSA 5GTIU 1PVRA 3G6YA 4KLGA 4C8NA 5ALEA 5AKIA 3SD7A 5JUMA 2Y9TA 4P0PA 5KFXA 2JEIA 3HKZF 5AI4A 3Q8RB 2H5XA 4M6WB 4PZNA 4LVSA 1LKYA 4DL2A 2J6TA 4JV1A 2WTFA 2K8CB 4MEXA 5CJ7A 4NY8A 1ZQUA 1T8EA 5BPCA 1T4GA 2CXYA 5KL8B 1EXNA 1WG8A 2Y0SF 5J2FA 2XCPA 5KFJA 8ICCA 1YZ6A 2AU0A 3V6KA 4C4RA 4Y2QA 2DGZA 4OJPA 5HR6A 4ZH4A 4KLOA 5EE9A 2JV3A 2VJ4A 3NRWA 1X42A 2PKEA 5ALRA 4KN7A 5G5HA 1N60A 4YP3A 5AKLA 5IIOA 7ICTA 3AL0B 3HILA 9ICVA 4AP9A 4J9RA 5KFVA 3PW2A 4CE6A 4YCXA 5EWEA 3SEIA 2B0CA 9ICIA 3WK9A 2W8KA 4IS7A 1XNSA 2F77X 3IRUA 2FJ6A 1RYRA 4CF5A 1CI4A 1N62A 3T5LA 2RDIA 3SZ2A 2KSOB 2A1JB 1AROP 4CCHA 4F4WA 1JI7A 3H8WA 5EE1A 5AKZA 1ZQLA 4FFDA 3KKAA 1TAUA 2PMZC 4Q8EA 5ALUA 3OHAA 9ICWA 7ICIA 4F93B 2ZJ8A 3TKAA 4EX7A 1IXRA 1L3VA 1KSPA 2JMGA 5KG4A 2G09A 4OO1J 4UASA 2AXTU 3PX6A 5DB8A 3AU2A 4MHVA 5AHXA 3RB6A 2L5YA 2BKEA 2KJ8A 4JMUA 4ED1A 1T94A 4B9NA 4DSFA 5L1JA 1NK7A 4PL2A 1RM6C 3QZ8A 2JRZA 3UMBA 3WKAA 5KFKA 3SV4A 2QLTA 3AMZA 2NV3A 4ECWA 3PMLA 4O3QA 1JUDA 2KNJA 8ICWA 1ZQNA 1ZYQA 2KOBA 1Z1BA 1UCVA 1CUKA 2D6FC 3GIIA 4NM1A 3KZIU 5AI8A 3AUOA 1ZQKA 4IQWA 1ZOLA 4DSJA 5AKYA 4YMMA 4TUPA 3C2LA 4MF8A 1X9WA 3N7RC 2G08A 3WU2U 1COKA 1ZD4A 2VJ5A 2GOLA 1SB3C 5BOMA 3H8SA 2ZIXA 2K89A 2E5SA 3V6JA 5KFPA 2DFLA 5KNIA 4LJXA 3WKCA 2ASDA 3NVWA 5KFTA 1L6NA 4KLUA 2UVUA 2RHFA 5AKGA 3TI0A 3QU4A 3HT3A 4M47A 1S10A 5DDMA 4IR9A 3PMNA 1QSYA 4I2JA 3IG8A 4DFJA 4DOAA 1ZQOA 3T3FA 2ZIWA 3PR5B 5J0XA 2MA1A 3RFAA 2FMQA 2PI5A 1ECWA 1NK8A 3WK8A 3QU2A 4JK1A 4RUAA 3PSPA 1ZD5A 2ZJ5A 3UMGA 4EZ9A 4KMOB 5KFYA 1QQ7A 3H4BA 7ICSA 1OW5A 1WCNA 3PY8A 4PZOA 3RAQA 1A76A 4PL1A 4J9SA 4NL9C 5TISU 3QNMA 5AI5A 2WF7A 2IOFK 3ALRA 5KFWA 1TV9A 4XA5A 1DGSA 4IRCA 9ICLA 2ZIVA 1Z1VA 5EE3A 2W9MA 3JPNA 2QARA 3QX7A 1Z19A 4PPXA 2KG5A 4KLIA 5HP4A 1X40A 4B9SA 4PHAA 1B43A 4NLGA 4O5KA 1KTQA 2W7OA 3M8SA 1P7DA 2PFPA 2Q0ZX 4DFDA 2O6KA 4QNLA 2KFNA 1IG6A 3NS1A 4M2YA 9ICJA 4WJ3B 4EZ6A 5AM4A 3HJEA 5ALJA 3RJFA 4Y2SA 4C0ZA 5AKKA 3FYHA 3TFSA 2XICA 3QEBZ 4QZDA 1L7MA 2NO4A 5IIIA 2XIDA 1SIJA 3B9JA 3M6KA 3T5KA 4M0AA 2OYYA 4PGYA 2H3FA 4Y2VA 2XY7A 4UB1A 5DBBA 2HW3A 4F4YA 4F5QA 4C7YA 4Y2JA 1K1SA 7ICKA 1HUOA 3M7DA 3KHRA 1RQNA 4QZIA 4UB2A 2JEFA 1NI3A 4QWBA 4Y2XA 5J2BA 5K4LA 3GZFA 1ZQXA 4UB8U 1B0XA 5J0RA 4A8EA 1UQVA 4DS5A 4B9MA 2EANA 2HHXA 2N1RA 2JZBA 1T3QA 4RNNA 4O3RA 9ICNA 2ZUDA 5L1MA 4Y2TA 1S76D 4KMUA 2I9GA 2B6GA 4QW8A 4C8MA 2CPRA 4ECVA 4NV0A 1SKSA 4LZDA 4RQ0A 3M8RA 2E8OA 4EENA 7ICVA 4UQGA 5KFOA 1RYUA 2W9BA 4OJ6A 3F5AA 4RQNA 2GO7A 5L1LA 3HKZC 3EWAA 3ZD9A 3IHQB 1QSLA 8ICEA 2KN7A 1UPHA 2FI1A 4DQRA 2K8BB 3PW5A 1U45A 2YX8A 3OGUA 2W03A 5DB6A 3UQ2A 4B9VA 3KHHA 2F76X 1NJWA 4X5VA 1ZQSA 4YMOA 2ALZA 4US9A 2KMDA 4Y2UA 1XSPA 2FE9A 1HJPA 1DRGA 2Y0SC 8ICMA 3GIJA 3FAHA 3PW0A 4JV2A 4OCZA 2FLPA 1X6JA 4J9LA 4FZLA 2OHFA 4FZNA 4I2GA 1X66A 4OD0A 3VC8A 3M1YA 5KFEA 3ONNA 2OXOA 5HR7A 1TE2A 3MDAA 1RG6A 1JXEA 3H8MA 1SL0A 3EZ5A 2KVCA 5J0WA 1O08A 5HHHA 5C0YA 1X6IA 4CNQA 5J0OA 4DSEA 1NJZA 3WK7A 1SWVA 2B21A 1YT3A 3H0MB 3N7PD 5ALQA 1MSWD 2J6UA 1A77A 4TUSA 3PX0A 1ZJMA 2BQ3A 2DQNB 5AI0A 5KFBA 2PFOA 8ICLA 7ICPA 3BS7A 2VA8A 2W9CA 1XC9A 1WUDA 4I2FA 4NLZA 4R64A 3TAPA 7ICFA 3QUTA 1SKRA 2HHSA 2QB1A 5CEHA 4YVZA 9ICUA 4DO9A 4FO6A 2XGQA 4ECYA 1JROA 4UB4A 4B9TA 2LKYA 2C2RA 3ICXA 1ZQGA 1LB2B 1RDFA 4MFAA 1BPBA 4DF8A 3UM9A 4CF3A 4GXIA 5KAFU 4US8A 3WKDA 3D2SA 2W3SA 3MFHA 3OSPA 2UVRA 2I1QA 4TQSA 1ZQZA 3BS5B 5DBCA 8ICAA 4IQVA 5KFRA 4Z6FA 4BGDA 4DS4A 3O0FA 3MBYA 4BWJA 1N2XA 1V38A 5EWFA 2DL0A 3RB3A 2JH1A 2WAQF 2ZIUB 2A19A 5KAIU 3CP8A 8ICFA 1S8OA 2IMWP 9ICGA 1SXDA 3BQ2A 2IBKA 4I2EA 2C22A 2GWSA 3KHGA 1FFUA 2JR5A 2KE7A 5ALOA 4RQMA 2JGAA 3PNCA 4YFKA 3KBBA 4TURA 4XQ8A 8ICNA 4UB5A 2F3NA 3PSFA 4F5OA 1ZQTA 5J2IA 2QB0A 2WF5A 3UXOA 2KIWA 2LI6A 4RQ7A 4QZHA 2WF8A 1VLBA 5D49A 1ZQVA 3PVXA 3EUB2 2P35A 4ACOA 5DB9A 2HBLA 2AGQA 4R66A 2YTUA 2HVIA 3UXPA 4NJ8A 2Z7JA 4QZEA 9ICXA 5KT6A 2VA3A 1QH9A 4OJLA 5AIAA 5ALNA 2F2AB 3RRGA 1ZD3A 7ICMA 4KLFA 2WF6A 5HNKA 1XSNA 4IL6U 9ICCA 3L3FX 4KLMA 3LWLA 4QZCA 4P4OA 5J0YA 2YY6A 4XRHA 4EYIB 2AHOB 3D2NA 1X9XA 4USAA 3ISCA 4QZAA 1LV5A 3G6VA 2HHTA 2KFZA 5AKJA 3H8JA 4BUGA 4DQSA 3QUBA 4I2IA 3V7JA 3GV5B 4RQ1A 2HOQA 5J2DA 7ICQA 5F9LA 4QIWF 5AK4A 4F91B 1TK5A 3BQ7A 1V97A 2AJQA 4YN4A 5ALWA 1YZ7A 2R18A 4K4HA 4RT2A 1MQ2A 1ZQFA 4TUQA 3OJSA 2MUTA 2M0NA 4FE3A 1HIWA 1SL1A 9ICOA 1Q8KA 3I76A 4KTQA 3WK5A 4P0PB 5KT7A 4PHDA 1NOMA 2WB1F 2YMMA 3SAFA 3GIKA 4NXZA 2LM4A 4EEKA 3ETRA 1LKYB 4J9PA 2CN1A 4NLCA 4UB6U 3IV6A 1ZRNA 4RZRA 2I6XA 3C23A 2C2DA 1MQ3A 1RPLA 1L3UA 4BWMA 4EBDA 4UBCA 1KRPA 2AQ4A 2D3DA 1T3NA 1SV0A 4PGXA 1K5OA 1ED1A 2E8MA 4EBEA 2LYBA 3TFRA 3FDSA 2K8AA 4BJQA 2E8PA 5J0PA 4DSLA 1HUZA 5J2HA 1Q3UA 2XVTA 8ICYA 4F4ZA 1NKCA 4F4XA 3GV8B 3WKEA 4MEYA 1X9SA 1B4FA 4UW9A 2PI4A 5ALDA 5ALHA 5ALPA 2FLNA 4ECQA 3Q8MA 5IIKA 2HHWA 3UPQA 5ALKA 3GDXA 2HCFA 4C80A 4M9LA 1SGGA 4GXKA 1S77D 3RB0A 2KK0A 2EZYA 4ZOHC 3PO4A 3LVWA 4E0DA 1KDHA 4F2RA 4TQRA 7ICJA 1NKBA 7ICUA 2JXJA 4FBTA 4I2CA 2OWOA 5CP2A 1N63A 1L8LA 4KN4A 5AICA 3V6HA 2RQ5A 2FDRA 1L5UA 4ECTA 3C1YA 7ICNA 2IHMA 3AQFA 4QW9A 3L4PA 1C20A 2K4HA 4UB3A 3ZDCA 9ICQA 3F53A 1LVHA 4UAUA 1NJYA 3QYPA 2MU2A 4RQ4A 1XS9D 1QTMA 1KFDA 3DDHA 3MR3A 1IV8A 2W3RA 1RXWA 3PW4A 4YR2A 4IR1A 5KFNA 1S0MA 2D8CA 4PGQA 4DL3A 3T5HA 2BR0A 5L9XA 3WKBA 5AM1A 2RDJA 7ICHA 1S97A 3SQIA 3D2QA 5J2CA 5KT5A 1PVPA 5J2GA 1F44A 3Q8KA 2FPMA 4EBCA 4DL5A 2YB1A 1V9PA 2EZZA 2W43A 3FC4A 3HRDD 5L1KA 4YR3A 1ZQDA 5J8YA 2HBMA 4C8OA 1FFVA 1QSSA 4BXOA 4FS1A 5CR0A 2DKZA 5AK6A 4MF2A 2XO7A 2RLTA 3SENA 5KFHA 2BDUA 3JPSA 9ICBA 1V85A 4FBUA 1Z4NA 4MFCA 1NK4A 1D8BA 1MA7A 2MAXA 2ATLA 2XCAA 5J2EA 2ODGA 2G07A 2Q4TA 5DG9A 2ZIXB 2V9WA 5KG0A 2WAQC 3N7SC 2F8LA 3M9NB 1MN8A 4KX5A 2BQUA 5KFGA 2KP7A 4P0QA 4EX6A 4HAIA 8ICUA 5AM5A 3PV8A 1NKEA 4FZMA 2V4QA 4ED2A 4MFFA 2HI0A 3BQ0A 3BDPA 1PVQA 3Q8PB 4Y2YA 4P2HA 5DG7A 3RBEA 3AU6A 9ICEA 2ZIWB 1UT8A 2KKPA 5AM3A 1NK6A 2P66A 5KFAA 4C4TA 3CRXA 4J9QA 4M9JA 2JH7A 2UVWA 1XWLA 1J97A 5JU5A 1NZPA 2DBYA 3ISBA 1FO4A 3THVA 4ED7A 4I2HA 2IA6A 3QEAZ 5B5EU 5ALGA 2ZIVB 3C2MA 2KZMA 5EOZA 1SV4A 2ASJA 3RJEA 9ICRA 5IINA 2NRVA 1J2NA 2QARB 8ICRA 1TAQA 4DL7A 1ZQPA 4Q44A 3KKAC 2KTQA 2BCQA 4DFMA 3S6JA 1WCLA 1D9DA 4O3MA 2HHUA 4QWDA 1S0VA 5ALYA 1F0MA 4KLHA 3GV7B 1SV0C 5ALMA 3MFIA 3SI8A 2HBKA 1L8OA 2ZTEA 1VDVA 1NZBA 3K1RB 2ISPA 4J03A 3KD3A 3UMCA 5ALSA 4DQPA 1TK0A 1KEJA 1PK1A 2BDPA 4QZGA 4O0IA 3LDAA 1SWWA 3KFUF 3Q8LA 2KKVA 1ZQAA 1NK5A 1F5SA 3UQ0A 1FIQA 1B22A 8ICBA 3H7IA 3MABA 4QWCA 2LBOA 4GFJA 2FPLA 5KG7A 4DLGA 8ICVA 2LHTA 5D4BA 4Q8FA 2HOIA 4QIWC 1OXJA 2PXIA 4YD1A 2P6UA 2E8NA 4RT3A 2JZBB 2HDOA 4F2SA 3ED5A 1JMSA 1U9LA 2AH5A 4GIBA 5IIMA 5ALVA 1UA0A 4PHEA 8ICTA 4KX3A 9ICAA 2LYAA 1ZQ1C 4UATA 3ZDAA 1L3SA 4ECRA 1A6SA 1JN3A 1RXVA 2AGOA 4F71A 5G5GA 3ZDDA 1BGXT 2W9BB 1U49A 3C1ZA 5H2FU 1BPZA 1XU4A 4AYBF 7ICLA 3GU3A 2H3IA 2K4EA 3ETLA 3C29A 4J9MA 3NTUA 5KFLA 8ICHA 2BHNA 3U26A 1CEZA 5AKHA 5DKWA 9ICTA 4PHPA 3K75D 3F5EA 2G06A 4DF4A 2EAPA 5AK5A 4YMNA 3E2EA 2YN4A 3BQ1A 4R8UA 1ZQYA 3T79A 1VJ5A 3TACB 9ICPA 1COOA 1Q3VA 5B66U 1S5LU 5DQHA 2G5HB 2NRXA 3JPRA 3LK9A 4M9HA 1UHUA 4R65A 3KHLA 4U6PA 2M9NA 4C8KA 4O3SA 5J8YC 4M6WA 3OTQA 4QWEA 2ASLA 2H3ZA 4J9NA 1A0PA 1XO1A 4XUSA 2OCEA 5AK3A 3H40A 1ZXIA 2MSNA 2H3VA 4NLBA 2DPJA 3HW8A 5KFIA 5KFQA 1ZQQA 3RR8A 3IP4B 1BPXA 4KLTA 3F2BA 1PK3A 3BJYA 2FMPA 2W9CB 2JEJA 2KZZA 4I2BA 4I27A 5ALTA 2A1AA 2VIXA 2KZ3A 4QZFA 8ICGA 2ZTCA 3AEVA 2PFNA 2HMXA 2YB4A 4J9OA 1PUZA 2EDUA 4GC7A 2ESEA 3RB4A 8ICQA 2Y9UA 1ZD2P 1GO3F 4DOBA 3IM1A 2R8HA 5DLFA 2Y1JA 2BPCA 4I28A 3MR2A 1Z4OA 2BCSA 4K4IA 4IQUA 3PW7A 3E0FA 4DSIA 5EE0A 3TADA 4JB3A 1XO0A 4UAVA 4HYKA 4PH5A 8ICIA 2QKQA 5HHIA 4ECZA 1KN5A 3C21A 2KJ9A 2FLLA 2XI9A 1N56A 2XGPA 4Z6DA 3DV9A 4ECSA 4C4SA 4QWAA 3KZXA 2AGPA 2BGWA 2KSOA 4P4MA 2A1JA 4IRKA 1ZQHA 2F1IA 5IILA 5DB7A 5F9NA 1TAMA 4ECUA 4B9UA 1QCKA 2EQYA 3A0BU 1KL9A 2DUYA 2NRWA 4O5EA 4ELUA 8ICZA 5T14A 1KQQA 3NGDA 3M9MB 3WK6A 3HP6A 5KG2A 1Q46A 3RTVA 2VKQA 2G0AA 1L3TA 2BZFA 2KV2A 5DQIA 5DG8A 2DKXA 3IDWA 5J2KA 1XSLA 4DWIA 2OEHA 5KT3A 2R8KA 3AN1A 5D46A 1KFSA 5AM2A 4F92B 3C28A 1JXLA 2F8KA 4F5NA 4KLQA 2EZXA 1DK3A 3F2CA 1HEKA 5CA7A 1BNPA 1JIHA 2QB0B 5AIBA 1ZQWA 2LPEA 1UA1A 4KLSA 3JPPA 5KG1A 2VA2A 3D6JA 7ICOA 2FMSA 5DQGA 4Z6EA 2GLEA 4F8RA 3ORYA 2NO5A 3RJGA 1NK9A 5BOLA 4OJ5A 4CDGA 1U47A 3GIMA 2E1FA 5J29A 3GILA 4I2AA 1TFRA 4O3NA 1ZQMA 1ZQBA 4F72A 3M6ZA 2XY5A 1O03A 1MC8A 3QU5A 2ZTDA 1KBUA 3V7LA 2RP5A 4P4PA 2IOHA 4RQ5A 3T5JA 2E3TA 3IN5A 5KT4A 3SAGA 9ICFA 4C7ZA 2R8IA 4NLKA 3ZD8A 2HHQA 5E79U 4LZGA 5J0SA 4DL4A 3SV3A 2E1EA 8ICSA 2OM6A 5KFZA 5J0TA 4UAZA 2BCVA 4JV0A 3Q8QB 1RYSA 1N61A 2Y1IA 2DPIA 4YD2A 2GH1A 4O9MA 3IG5A 1UT5A 3B0YA 2W04A 5JRTA 5JTIA 4F50A 3R9KA 3EPIA 3RH5A 1D8LA 2BPFA 2W55A 4IC9A 1X9MA 1S0NA 3OHBA 3AM9A 3WK4A 3EW9A 5KFMA 2MUTB 4O3PA 1KKXA 5ALFA 5DLGA 1T7PA 3CYMA 1Y88A 2KICA 4DFPA 5KFCA 3OSNA 5KFDA 3FM9A 2YMQA 4CGZA 5KFSA 1IM4A 2W11A 1D9FA 3MGHA 2ZUCA 1M6YA 5DGAA 2F44A 4EYHB 2YQEA 3OPXA 1S9FA 4KLLA 1IIPA 2UVVA 2V4RA 5AKXA 4DQQA 2KVSA 4YG2A 5KG3A 2BCUA 4R63A 4EEYA 2I5HA 1SKWA 3N97B 2EAOA 2K4PA 5DBAA 3PSIA 3RJHA 4I29A 1BVSA 2NRTA 3NVVA 3RBDA 2R8GA 4UAYA 1KLNA 2H3QA 8ICXA 4Z6CA 4AYBC 8ICOA 3I1YA 4M9GA 2WFAA 1K1QA 4YXMA 4RQ3A 5KG6A 1BPYA 2ZJAA 2BCRA 3BZKA 2ISOA 2JEGA 2F1JA 3TADC 2RRDA 3OJUA 3G6XA 1SXEA 3EYZA 1ZQRA 4GXJA 4F5RA 3QXGA 8ICKA 4YXJA 1J2MA 3K1ZA 3I28A 1ZQJA 4ELVA 4ECXA 2LYHA 1ZQIA 3HWTA 3NVYA 4DSKA 1N48A 4YQWA 5ALIA 4NWIA 1ZQCA 2P6RA 1N5WA 5A0LA 4NLNA 3RJKA 4G3IA 5HMLA 3SR6A 3QZ7A 3JPOA 2HSZA 1H38A 3N4MB 4QJFB 2K4IA 4RPXA 2C28A 4M04A 2WHEA 5DGBA 5AM0A 1JRPA 4Q43A 2LM1A 3PSTA 3SYZA 3L5KA 4ICAA 4RQ6A 3F2DA 4UAWA 2DWQA 3SAHA 3ZDEA 1KFTA 5KT2A 1AQ6A 5C5JA 3MR5A 2KJ5A 1DGJA 4O5CA 2G5IB 1PZNA 5L1IA 2CRXA 3GQCA 4J9KA 2YMPA 3TANA 2AQ0A 2HVHA 3PZPA 2EH9A 2ZXHA 4Q45A 1NNLA 2W7PA 3C5FA 4ED3A 5F3XB 1C7YA 4ED6A 4EELA 4Y2PA 5HMMA 3N28A 3ZDBA 1Z00A 5KL1B 1D8YA 3RR7A 2PFQA 4F5PA 4KLDA 4ELTA 2ES6A 1DXSA 3NRZA 3SMVA 3RAXA 2W9AA 1DK2A 3JPTA 2YMLA 4GLXA 2PMZF 3M9OB 4BXOB 4GC6A 1NJXA 2KHQA 1N5XA 3Q8SB 1ZQEA 1JALA 4F3OA 4RU9A 4DOCA 4ED8A 2ZUBA 5TZVA 5J2AA 3MGIA 4UARA 4C8LA 5GTHU 3V72A 3K4GA 5AI6A 3NASA 5IIJA 1BPDA 3GFKB 3AQEA 1X2IA 3H4DA 5DDYA 2BQRA 4P0QB 2HOFA 1FEZA 2LMRA 3H0RB 5FP0A 3CW2C 4DFKA 4RNMA 1U48A 4BDPA 3QU9A 2WF9A 2OH2A 3NVZA 3RRHA 1CRXA 4CRXA 3C5GA 3ISDA 1RZTA 4DLEA 2ZG6A 4B6JA 3BS5A 3ZI4A 2IHNA 1WWUA 3EPGA 3RH4A 3MR6A 3J81j 1Z3EB 5CRXA 3BZCA 1KW4A 7ICRA 5EWGA 1ZRMA 1Z00B 9ICKA 2DF4B 3MDCA 4Y2RA 4YR0A 2ZIUA 4DCCA
chains in the Genus database with same CATH topology
2E1FA 2XVTA 3AL0B 2KJ9A 2XI9A 3H0LB 5KL1B 3M6ZA 4FZLA 4C0ZA 1P7DA 4O3MA 2XICA 2HBMA 3O0FA 4FZNA 3PSIA 3F5EA 4BX9C 3D2NA 3N7RC 3VC8A 2G08A 1KBUA 2G06A 1OUQA 3ONNA 2OXOA 5HR7A 3RF9A 2H3QA 2RP5A 2XIDA 4AYBC 1SZHA 2JH1A 2WAQF 2ZIUB 3IN5A 2VJ5A 3M6KA 2GOLA 2KVCA 2OYYA 2WB1C 2HBKA 3KZXA 2H3FA 3CP8A 3SMVA 2ZIXA 3T79A 1NZBA 2BDUA 2KEYA 3SAGA 4BUGA 5C0YA 2K89A 2E5SA 1XNSA 3MGVA 2PMZF 2F77X 4U7CA 1Q3VA 2KD1A 3LVVA 1URJA 2MRLA 2RRDA 1D8BA 3M7DA 1TAMA 1MA7A 2G5HB 2KHVA 2HOQA 1L6NA 2E1EA 1YT3A 2KHQA 3H0MB 3N7PD 3KFUF 2RHFA 4QIWF 2KKVA 4CDGA 4U6PA 2OM6A 2G07A 2Q4TA 3LVWA 2ZIXB 3K1ZA 3GZFA 2A3VA 2WAQC 3N7SC 2F8LA 2H3ZA 2JGAA 2DQNB 3LYSA 5T14A 4KX5A 1PVRA 4A8EA 4P0QA 1A0PA 3IG8A 2GH1A 2N1RA 3IG5A 4FZMA 2ZIWA 2LBOA 2R18A 2VKQA 2W04A 4GFJA 2MA1A 2G0AA 4NWIA 3RFAA 4P0PA 3AQEA 2PMZC 1ECWA 1PVQA 3HKZF 3PSFA 5A0LA 2H3VA 2LHTA 1WUDA 3PSPA 3F2DA 4NLBA 2M0NA 4FE3A 2KV2A 1HIWA 4KMOB 2HOIA 4P0QB 2HOFA 4QIWC 3IP4B 2JMGA 2CPRA 3AQFA 4NV0A 4IC9A 2K4HA 2G09A 2K8CB 4OO1J 2ZIWB 3H0RB 4QJFB 2K4IA 3F2BA 2KIWA 2KKPA 3C28A 4PL1A 4P0PB 3F53A 3ALRA 2VIXA 2WB1F 4ACOA 3PSTA 2HBLA 3SAFA 3CRXA 3CYMA 3VCBA 2ZXIA 2ZIVA 4ICAA 4OJ6A 2JH7A 4KX3A 3F5AA 4OJOA 3F2CA 2YB1A 1HEKA 2CN1A 2HMXA 2KICA 2LYAA 3HKZC 5KL8B 3SAHA 3SQIA 1ZQ1C 2Y0SF 2KJ8A 2YB4A 2Z7JA 2LKYA 1T94A 4JMUA 4NLCA 2OH2A 1A6SA 4CGZA 2HBJA 3ICXA 1Z19A 1UPHA 2KJ5A 1CRXA 2K8BB 4PL2A 4OJLA 4CRXA 2G5IB 2DGZA 1GO3F 2YX8A 4OJPA 2W03A 5HR6A 2F2AB 2CRXA 2ZG6A 2ZIVB 2NV3A 3DEEA 2W7OA 2VJ4A 3OPXA 4AYBF 1IIPA 3NRWA 2F76X 1ED1A 2H3IA 3GU3A 2KNJA 2K4EA 3D2QA 3PZPA 5CRXA 3C29A 3E0FA 2LYBA 2ZXHA 1PVPA 2KOBA 1Z1BA 4QNLA 2K8AA 2W7PA 4BJQA 1F44A 3D2SA 3L3FX 2DF4B 2JHDA 4OJ5A 2D6FC 1XO0A 1DRGA 2ZIUA 2Y0SC 4WJ3B 3NUQA 1Q3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VC8 A;  3VCB A;  3GZF A; 
#chains in the Genus database with same CATH topology
 5CHG A;  4NM2 A;  3BQT A;  4RUC A;  3TAR A;  3PR4 A;  2R8J A;  5KG5 A;  5KFF A;  4RQ8 A;  4IQT A;  3H0L B;  3RH6 A;  4CF4 A;  4G9B A;  3PX4 A;  4M9N A;  1QLN A;  3E58 A;  3RF9 A;  3QUC A;  1QQ5 A;  3KOO A;  2WB1 C;  2FPK A;  1ZET A;  2BPG A;  5CWR A;  3MGV A;  4U7C A;  2KD1 A;  3LVV A;  1URJ A;  2MRL A;  1L7O A;  3B0X A;  2KHV A;  1NK0 A;  5CB1 A;  1TVA A;  3RJJ A;  1SL2 A;  1QQ6 A;  4KLE A;  4I2D A;  4FS2 A;  1PK1 B;  4K4G A;  4PJ0 U;  3HX0 A;  4UBB A;  2NRZ A;  4KIT B;  2VAN A;  1TK8 A;  1U4B A;  3QU7 A;  1ZJN A;  1TKD A;  1SZP A;  8ICJ A;  3LWM A;  4JUZ A;  5ALZ A;  4F4K A;  1BNO A;  1RQL A;  4RPZ A;  2XC9 A;  2C2E A;  5ALX A;  3CNH A;  2W8L A;  9ICM A;  4B9L A;  3VCB A;  3C2K A;  2ZXI A;  4OJO A;  3UXN A;  2HHV A;  1L7N A;  7ICG A;  4QZB A;  3TQ1 A;  1WYG A;  2HBJ A;  3TAQ A;  5AI9 A;  3RJI A;  1WWV A;  4JWM A;  2IOF A;  3DEE A;  4RNO A;  1JX4 A;  3PO5 A;  4DL6 A;  4IRD A;  4JWN A;  4QZ9 A;  2W54 A;  4KLJ A;  2JHD A;  5ALL A;  3NUQ A;  5AKE A;  4RPY A;  3KTQ A;  4O3O A;  4BX9 C;  1BPE A;  1OUQ A;  2EAM A;  5KFU A;  4DEZ A;  3A0H U;  1SZH A;  2K60 A;  4RQ2 A;  5KTQ A;  2XY6 A;  8ICP A;  1L7P A;  3QUQ A;  2NYV A;  5J2J A;  3MC1 A;  5J0Q A;  2KEY A;  2KIV A;  9ICS A;  3JPQ A;  4DQI A;  3HPO A;  5J0U A;  1S0O A;  2J6S A;  3V7K A;  4ED0 A;  1DOQ A;  4NL9 A;  4R8U B;  2F1H A;  2A3V A;  7ICE A;  4QZ8 A;  3QE9 Y;  9ICH A;  3LYS A;  5GTI U;  1PVR A;  3G6Y A;  4KLG A;  4C8N A;  5ALE A;  5AKI A;  3SD7 A;  5JUM A;  2Y9T A;  4P0P A;  5KFX A;  2JEI A;  3HKZ F;  5AI4 A;  3Q8R B;  2H5X A;  4M6W B;  4PZN A;  4LVS A;  1LKY A;  4DL2 A;  2J6T A;  4JV1 A;  2WTF A;  2K8C B;  4MEX A;  5CJ7 A;  4NY8 A;  1ZQU A;  1T8E A;  5BPC A;  1T4G A;  2CXY A;  5KL8 B;  1EXN A;  1WG8 A;  2Y0S F;  5J2F A;  2XCP A;  5KFJ A;  8ICC A;  1YZ6 A;  2AU0 A;  3V6K A;  4C4R A;  4Y2Q A;  2DGZ A;  4OJP A;  5HR6 A;  4ZH4 A;  4KLO A;  5EE9 A;  2JV3 A;  2VJ4 A;  3NRW A;  1X42 A;  2PKE A;  5ALR A;  4KN7 A;  5G5H A;  1N60 A;  4YP3 A;  5AKL A;  5IIO A;  7ICT A;  3AL0 B;  3HIL A;  9ICV A;  4AP9 A;  4J9R A;  5KFV A;  3PW2 A;  4CE6 A;  4YCX A;  5EWE A;  3SEI A;  2B0C A;  9ICI A;  3WK9 A;  2W8K A;  4IS7 A;  1XNS A;  2F77 X;  3IRU A;  2FJ6 A;  1RYR A;  4CF5 A;  1CI4 A;  1N62 A;  3T5L A;  2RDI A;  3SZ2 A;  2KSO B;  2A1J B;  1ARO P;  4CCH A;  4F4W A;  1JI7 A;  3H8W A;  5EE1 A;  5AKZ A;  1ZQL A;  4FFD A;  3KKA A;  1TAU A;  2PMZ C;  4Q8E A;  5ALU A;  3OHA A;  9ICW A;  7ICI A;  4F93 B;  2ZJ8 A;  3TKA A;  4EX7 A;  1IXR A;  1L3V A;  1KSP A;  2JMG A;  5KG4 A;  2G09 A;  4OO1 J;  4UAS A;  2AXT U;  3PX6 A;  5DB8 A;  3AU2 A;  4MHV A;  5AHX A;  3RB6 A;  2L5Y A;  2BKE A;  2KJ8 A;  4JMU A;  4ED1 A;  1T94 A;  4B9N A;  4DSF A;  5L1J A;  1NK7 A;  4PL2 A;  1RM6 C;  3QZ8 A;  2JRZ A;  3UMB A;  3WKA A;  5KFK A;  3SV4 A;  2QLT A;  3AMZ A;  2NV3 A;  4ECW A;  3PML A;  4O3Q A;  1JUD A;  2KNJ A;  8ICW A;  1ZQN A;  1ZYQ A;  2KOB A;  1Z1B A;  1UCV A;  1CUK A;  2D6F C;  3GII A;  4NM1 A;  3KZI U;  5AI8 A;  3AUO A;  1ZQK A;  4IQW A;  1ZOL A;  4DSJ A;  5AKY A;  4YMM A;  4TUP A;  3C2L A;  4MF8 A;  1X9W A;  3N7R C;  2G08 A;  3WU2 U;  1COK A;  1ZD4 A;  2VJ5 A;  2GOL A;  1SB3 C;  5BOM A;  3H8S A;  2ZIX A;  2K89 A;  2E5S A;  3V6J A;  5KFP A;  2DFL A;  5KNI A;  4LJX A;  3WKC A;  2ASD A;  3NVW A;  5KFT A;  1L6N A;  4KLU A;  2UVU A;  2RHF A;  5AKG A;  3TI0 A;  3QU4 A;  3HT3 A;  4M47 A;  1S10 A;  5DDM A;  4IR9 A;  3PMN A;  1QSY A;  4I2J A;  3IG8 A;  4DFJ A;  4DOA A;  1ZQO A;  3T3F A;  2ZIW A;  3PR5 B;  5J0X A;  2MA1 A;  3RFA A;  2FMQ A;  2PI5 A;  1ECW A;  1NK8 A;  3WK8 A;  3QU2 A;  4JK1 A;  4RUA A;  3PSP A;  1ZD5 A;  2ZJ5 A;  3UMG A;  4EZ9 A;  4KMO B;  5KFY A;  1QQ7 A;  3H4B A;  7ICS A;  1OW5 A;  1WCN A;  3PY8 A;  4PZO A;  3RAQ A;  1A76 A;  4PL1 A;  4J9S A;  4NL9 C;  5TIS U;  3QNM A;  5AI5 A;  2WF7 A;  2IOF K;  3ALR A;  5KFW A;  1TV9 A;  4XA5 A;  1DGS A;  4IRC A;  9ICL A;  2ZIV A;  1Z1V A;  5EE3 A;  2W9M A;  3JPN A;  2QAR A;  3QX7 A;  1Z19 A;  4PPX A;  2KG5 A;  4KLI A;  5HP4 A;  1X40 A;  4B9S A;  4PHA A;  1B43 A;  4NLG A;  4O5K A;  1KTQ A;  2W7O A;  3M8S A;  1P7D A;  2PFP A;  2Q0Z X;  4DFD A;  2O6K A;  4QNL A;  2KFN A;  1IG6 A;  3NS1 A;  4M2Y A;  9ICJ A;  4WJ3 B;  4EZ6 A;  5AM4 A;  3HJE A;  5ALJ A;  3RJF A;  4Y2S A;  4C0Z A;  5AKK A;  3FYH A;  3TFS A;  2XIC A;  3QEB Z;  4QZD A;  1L7M A;  2NO4 A;  5III A;  2XID A;  1SIJ A;  3B9J A;  3M6K A;  3T5K A;  4M0A A;  2OYY A;  4PGY A;  2H3F A;  4Y2V A;  2XY7 A;  4UB1 A;  5DBB A;  2HW3 A;  4F4Y A;  4F5Q A;  4C7Y A;  4Y2J A;  1K1S A;  7ICK A;  1HUO A;  3M7D A;  3KHR A;  1RQN A;  4QZI A;  4UB2 A;  2JEF A;  1NI3 A;  4QWB A;  4Y2X A;  5J2B A;  5K4L A;  3GZF A;  1ZQX A;  4UB8 U;  1B0X A;  5J0R A;  4A8E A;  1UQV A;  4DS5 A;  4B9M A;  2EAN A;  2HHX A;  2N1R A;  2JZB A;  1T3Q A;  4RNN A;  4O3R A;  9ICN A;  2ZUD A;  5L1M A;  4Y2T A;  1S76 D;  4KMU A;  2I9G A;  2B6G A;  4QW8 A;  4C8M A;  2CPR A;  4ECV A;  4NV0 A;  1SKS A;  4LZD A;  4RQ0 A;  3M8R A;  2E8O A;  4EEN A;  7ICV A;  4UQG A;  5KFO A;  1RYU A;  2W9B A;  4OJ6 A;  3F5A A;  4RQN A;  2GO7 A;  5L1L A;  3HKZ C;  3EWA A;  3ZD9 A;  3IHQ B;  1QSL A;  8ICE A;  2KN7 A;  1UPH A;  2FI1 A;  4DQR A;  2K8B B;  3PW5 A;  1U45 A;  2YX8 A;  3OGU A;  2W03 A;  5DB6 A;  3UQ2 A;  4B9V A;  3KHH A;  2F76 X;  1NJW A;  4X5V A;  1ZQS A;  4YMO A;  2ALZ A;  4US9 A;  2KMD A;  4Y2U A;  1XSP A;  2FE9 A;  1HJP A;  1DRG A;  2Y0S C;  8ICM A;  3GIJ A;  3FAH A;  3PW0 A;  4JV2 A;  4OCZ A;  2FLP A;  1X6J A;  4J9L A;  4FZL A;  2OHF A;  4FZN A;  4I2G A;  1X66 A;  4OD0 A;  3VC8 A;  3M1Y A;  5KFE A;  3ONN A;  2OXO A;  5HR7 A;  1TE2 A;  3MDA A;  1RG6 A;  1JXE A;  3H8M A;  1SL0 A;  3EZ5 A;  2KVC A;  5J0W A;  1O08 A;  5HHH A;  5C0Y A;  1X6I A;  4CNQ A;  5J0O A;  4DSE A;  1NJZ A;  3WK7 A;  1SWV A;  2B21 A;  1YT3 A;  3H0M B;  3N7P D;  5ALQ A;  1MSW D;  2J6U A;  1A77 A;  4TUS A;  3PX0 A;  1ZJM A;  2BQ3 A;  2DQN B;  5AI0 A;  5KFB A;  2PFO A;  8ICL A;  7ICP A;  3BS7 A;  2VA8 A;  2W9C A;  1XC9 A;  1WUD A;  4I2F A;  4NLZ A;  4R64 A;  3TAP A;  7ICF A;  3QUT A;  1SKR A;  2HHS A;  2QB1 A;  5CEH A;  4YVZ A;  9ICU A;  4DO9 A;  4FO6 A;  2XGQ A;  4ECY A;  1JRO A;  4UB4 A;  4B9T A;  2LKY A;  2C2R A;  3ICX A;  1ZQG A;  1LB2 B;  1RDF A;  4MFA A;  1BPB A;  4DF8 A;  3UM9 A;  4CF3 A;  4GXI A;  5KAF U;  4US8 A;  3WKD A;  3D2S A;  2W3S A;  3MFH A;  3OSP A;  2UVR A;  2I1Q A;  4TQS A;  1ZQZ A;  3BS5 B;  5DBC A;  8ICA A;  4IQV A;  5KFR A;  4Z6F A;  4BGD A;  4DS4 A;  3O0F A;  3MBY A;  4BWJ A;  1N2X A;  1V38 A;  5EWF A;  2DL0 A;  3RB3 A;  2JH1 A;  2WAQ F;  2ZIU B;  2A19 A;  5KAI U;  3CP8 A;  8ICF A;  1S8O A;  2IMW P;  9ICG A;  1SXD A;  3BQ2 A;  2IBK A;  4I2E A;  2C22 A;  2GWS A;  3KHG A;  1FFU A;  2JR5 A;  2KE7 A;  5ALO A;  4RQM A;  2JGA A;  3PNC A;  4YFK A;  3KBB A;  4TUR A;  4XQ8 A;  8ICN A;  4UB5 A;  2F3N A;  3PSF A;  4F5O A;  1ZQT A;  5J2I A;  2QB0 A;  2WF5 A;  3UXO A;  2KIW A;  2LI6 A;  4RQ7 A;  4QZH A;  2WF8 A;  1VLB A;  5D49 A;  1ZQV A;  3PVX A;  3EUB 2;  2P35 A;  4ACO A;  5DB9 A;  2HBL A;  2AGQ A;  4R66 A;  2YTU A;  2HVI A;  3UXP A;  4NJ8 A;  2Z7J A;  4QZE A;  9ICX A;  5KT6 A;  2VA3 A;  1QH9 A;  4OJL A;  5AIA A;  5ALN A;  2F2A B;  3RRG A;  1ZD3 A;  7ICM A;  4KLF A;  2WF6 A;  5HNK A;  1XSN A;  4IL6 U;  9ICC A;  3L3F X;  4KLM A;  3LWL A;  4QZC A;  4P4O A;  5J0Y A;  2YY6 A;  4XRH A;  4EYI B;  2AHO B;  3D2N A;  1X9X A;  4USA A;  3ISC A;  4QZA A;  1LV5 A;  3G6V A;  2HHT A;  2KFZ A;  5AKJ A;  3H8J A;  4BUG A;  4DQS A;  3QUB A;  4I2I A;  3V7J A;  3GV5 B;  4RQ1 A;  2HOQ A;  5J2D A;  7ICQ A;  5F9L A;  4QIW F;  5AK4 A;  4F91 B;  1TK5 A;  3BQ7 A;  1V97 A;  2AJQ A;  4YN4 A;  5ALW A;  1YZ7 A;  2R18 A;  4K4H A;  4RT2 A;  1MQ2 A;  1ZQF A;  4TUQ A;  3OJS A;  2MUT A;  2M0N A;  4FE3 A;  1HIW A;  1SL1 A;  9ICO A;  1Q8K A;  3I76 A;  4KTQ A;  3WK5 A;  4P0P B;  5KT7 A;  4PHD A;  1NOM A;  2WB1 F;  2YMM A;  3SAF A;  3GIK A;  4NXZ A;  2LM4 A;  4EEK A;  3ETR A;  1LKY B;  4J9P A;  2CN1 A;  4NLC A;  4UB6 U;  3IV6 A;  1ZRN A;  4RZR A;  2I6X A;  3C23 A;  2C2D A;  1MQ3 A;  1RPL A;  1L3U A;  4BWM A;  4EBD A;  4UBC A;  1KRP A;  2AQ4 A;  2D3D A;  1T3N A;  1SV0 A;  4PGX A;  1K5O A;  1ED1 A;  2E8M A;  4EBE A;  2LYB A;  3TFR A;  3FDS A;  2K8A A;  4BJQ A;  2E8P A;  5J0P A;  4DSL A;  1HUZ A;  5J2H A;  1Q3U A;  2XVT A;  8ICY A;  4F4Z A;  1NKC A;  4F4X A;  3GV8 B;  3WKE A;  4MEY A;  1X9S A;  1B4F A;  4UW9 A;  2PI4 A;  5ALD A;  5ALH A;  5ALP A;  2FLN A;  4ECQ A;  3Q8M A;  5IIK A;  2HHW A;  3UPQ A;  5ALK A;  3GDX A;  2HCF A;  4C80 A;  4M9L A;  1SGG A;  4GXK A;  1S77 D;  3RB0 A;  2KK0 A;  2EZY A;  4ZOH C;  3PO4 A;  3LVW A;  4E0D A;  1KDH A;  4F2R A;  4TQR A;  7ICJ A;  1NKB A;  7ICU A;  2JXJ A;  4FBT A;  4I2C A;  2OWO A;  5CP2 A;  1N63 A;  1L8L A;  4KN4 A;  5AIC A;  3V6H A;  2RQ5 A;  2FDR A;  1L5U A;  4ECT A;  3C1Y A;  7ICN A;  2IHM A;  3AQF A;  4QW9 A;  3L4P A;  1C20 A;  2K4H A;  4UB3 A;  3ZDC A;  9ICQ A;  3F53 A;  1LVH A;  4UAU A;  1NJY A;  3QYP A;  2MU2 A;  4RQ4 A;  1XS9 D;  1QTM A;  1KFD A;  3DDH A;  3MR3 A;  1IV8 A;  2W3R A;  1RXW A;  3PW4 A;  4YR2 A;  4IR1 A;  5KFN A;  1S0M A;  2D8C A;  4PGQ A;  4DL3 A;  3T5H A;  2BR0 A;  5L9X A;  3WKB A;  5AM1 A;  2RDJ A;  7ICH A;  1S97 A;  3SQI A;  3D2Q A;  5J2C A;  5KT5 A;  1PVP A;  5J2G A;  1F44 A;  3Q8K A;  2FPM A;  4EBC A;  4DL5 A;  2YB1 A;  1V9P A;  2EZZ A;  2W43 A;  3FC4 A;  3HRD D;  5L1K A;  4YR3 A;  1ZQD A;  5J8Y A;  2HBM A;  4C8O A;  1FFV A;  1QSS A;  4BXO A;  4FS1 A;  5CR0 A;  2DKZ A;  5AK6 A;  4MF2 A;  2XO7 A;  2RLT A;  3SEN A;  5KFH A;  2BDU A;  3JPS A;  9ICB A;  1V85 A;  4FBU A;  1Z4N A;  4MFC A;  1NK4 A;  1D8B A;  1MA7 A;  2MAX A;  2ATL A;  2XCA A;  5J2E A;  2ODG A;  2G07 A;  2Q4T A;  5DG9 A;  2ZIX B;  2V9W A;  5KG0 A;  2WAQ C;  3N7S C;  2F8L A;  3M9N B;  1MN8 A;  4KX5 A;  2BQU A;  5KFG A;  2KP7 A;  4P0Q A;  4EX6 A;  4HAI A;  8ICU A;  5AM5 A;  3PV8 A;  1NKE A;  4FZM A;  2V4Q A;  4ED2 A;  4MFF A;  2HI0 A;  3BQ0 A;  3BDP A;  1PVQ A;  3Q8P B;  4Y2Y A;  4P2H A;  5DG7 A;  3RBE A;  3AU6 A;  9ICE A;  2ZIW B;  1UT8 A;  2KKP A;  5AM3 A;  1NK6 A;  2P66 A;  5KFA A;  4C4T A;  3CRX A;  4J9Q A;  4M9J A;  2JH7 A;  2UVW A;  1XWL A;  1J97 A;  5JU5 A;  1NZP A;  2DBY A;  3ISB A;  1FO4 A;  3THV A;  4ED7 A;  4I2H A;  2IA6 A;  3QEA Z;  5B5E U;  5ALG A;  2ZIV B;  3C2M A;  2KZM A;  5EOZ A;  1SV4 A;  2ASJ A;  3RJE A;  9ICR A;  5IIN A;  2NRV A;  1J2N A;  2QAR B;  8ICR A;  1TAQ A;  4DL7 A;  1ZQP A;  4Q44 A;  3KKA C;  2KTQ A;  2BCQ A;  4DFM A;  3S6J A;  1WCL A;  1D9D A;  4O3M A;  2HHU A;  4QWD A;  1S0V A;  5ALY A;  1F0M A;  4KLH A;  3GV7 B;  1SV0 C;  5ALM A;  3MFI A;  3SI8 A;  2HBK A;  1L8O A;  2ZTE A;  1VDV A;  1NZB A;  3K1R B;  2ISP A;  4J03 A;  3KD3 A;  3UMC A;  5ALS A;  4DQP A;  1TK0 A;  1KEJ A;  1PK1 A;  2BDP A;  4QZG A;  4O0I A;  3LDA A;  1SWW A;  3KFU F;  3Q8L A;  2KKV A;  1ZQA A;  1NK5 A;  1F5S A;  3UQ0 A;  1FIQ A;  1B22 A;  8ICB A;  3H7I A;  3MAB A;  4QWC A;  2LBO A;  4GFJ A;  2FPL A;  5KG7 A;  4DLG A;  8ICV A;  2LHT A;  5D4B A;  4Q8F A;  2HOI A;  4QIW C;  1OXJ A;  2PXI A;  4YD1 A;  2P6U A;  2E8N A;  4RT3 A;  2JZB B;  2HDO A;  4F2S A;  3ED5 A;  1JMS A;  1U9L A;  2AH5 A;  4GIB A;  5IIM A;  5ALV A;  1UA0 A;  4PHE A;  8ICT A;  4KX3 A;  9ICA A;  2LYA A;  1ZQ1 C;  4UAT A;  3ZDA A;  1L3S A;  4ECR A;  1A6S A;  1JN3 A;  1RXV A;  2AGO A;  4F71 A;  5G5G A;  3ZDD A;  1BGX T;  2W9B B;  1U49 A;  3C1Z A;  5H2F U;  1BPZ A;  1XU4 A;  4AYB F;  7ICL A;  3GU3 A;  2H3I A;  2K4E A;  3ETL A;  3C29 A;  4J9M A;  3NTU A;  5KFL A;  8ICH A;  2BHN A;  3U26 A;  1CEZ A;  5AKH A;  5DKW A;  9ICT A;  4PHP A;  3K75 D;  3F5E A;  2G06 A;  4DF4 A;  2EAP A;  5AK5 A;  4YMN A;  3E2E A;  2YN4 A;  3BQ1 A;  4R8U A;  1ZQY A;  3T79 A;  1VJ5 A;  3TAC B;  9ICP A;  1COO A;  1Q3V A;  5B66 U;  1S5L U;  5DQH A;  2G5H B;  2NRX A;  3JPR A;  3LK9 A;  4M9H A;  1UHU A;  4R65 A;  3KHL A;  4U6P A;  2M9N A;  4C8K A;  4O3S A;  5J8Y C;  4M6W A;  3OTQ A;  4QWE A;  2ASL A;  2H3Z A;  4J9N A;  1A0P A;  1XO1 A;  4XUS A;  2OCE A;  5AK3 A;  3H40 A;  1ZXI A;  2MSN A;  2H3V A;  4NLB A;  2DPJ A;  3HW8 A;  5KFI A;  5KFQ A;  1ZQQ A;  3RR8 A;  3IP4 B;  1BPX A;  4KLT A;  3F2B A;  1PK3 A;  3BJY A;  2FMP A;  2W9C B;  2JEJ A;  2KZZ A;  4I2B A;  4I27 A;  5ALT A;  2A1A A;  2VIX A;  2KZ3 A;  4QZF A;  8ICG A;  2ZTC A;  3AEV A;  2PFN A;  2HMX A;  2YB4 A;  4J9O A;  1PUZ A;  2EDU A;  4GC7 A;  2ESE A;  3RB4 A;  8ICQ A;  2Y9U A;  1ZD2 P;  1GO3 F;  4DOB A;  3IM1 A;  2R8H A;  5DLF A;  2Y1J A;  2BPC A;  4I28 A;  3MR2 A;  1Z4O A;  2BCS A;  4K4I A;  4IQU A;  3PW7 A;  3E0F A;  4DSI A;  5EE0 A;  3TAD A;  4JB3 A;  1XO0 A;  4UAV A;  4HYK A;  4PH5 A;  8ICI A;  2QKQ A;  5HHI A;  4ECZ A;  1KN5 A;  3C21 A;  2KJ9 A;  2FLL A;  2XI9 A;  1N56 A;  2XGP A;  4Z6D A;  3DV9 A;  4ECS A;  4C4S A;  4QWA A;  3KZX A;  2AGP A;  2BGW A;  2KSO A;  4P4M A;  2A1J A;  4IRK A;  1ZQH A;  2F1I A;  5IIL A;  5DB7 A;  5F9N A;  1TAM A;  4ECU A;  4B9U A;  1QCK A;  2EQY A;  3A0B U;  1KL9 A;  2DUY A;  2NRW A;  4O5E A;  4ELU A;  8ICZ A;  5T14 A;  1KQQ A;  3NGD A;  3M9M B;  3WK6 A;  3HP6 A;  5KG2 A;  1Q46 A;  3RTV A;  2VKQ A;  2G0A A;  1L3T A;  2BZF A;  2KV2 A;  5DQI A;  5DG8 A;  2DKX A;  3IDW A;  5J2K A;  1XSL A;  4DWI A;  2OEH A;  5KT3 A;  2R8K A;  3AN1 A;  5D46 A;  1KFS A;  5AM2 A;  4F92 B;  3C28 A;  1JXL A;  2F8K A;  4F5N A;  4KLQ A;  2EZX A;  1DK3 A;  3F2C A;  1HEK A;  5CA7 A;  1BNP A;  1JIH A;  2QB0 B;  5AIB A;  1ZQW A;  2LPE A;  1UA1 A;  4KLS A;  3JPP A;  5KG1 A;  2VA2 A;  3D6J A;  7ICO A;  2FMS A;  5DQG A;  4Z6E A;  2GLE A;  4F8R A;  3ORY A;  2NO5 A;  3RJG A;  1NK9 A;  5BOL A;  4OJ5 A;  4CDG A;  1U47 A;  3GIM A;  2E1F A;  5J29 A;  3GIL A;  4I2A A;  1TFR A;  4O3N A;  1ZQM A;  1ZQB A;  4F72 A;  3M6Z A;  2XY5 A;  1O03 A;  1MC8 A;  3QU5 A;  2ZTD A;  1KBU A;  3V7L A;  2RP5 A;  4P4P A;  2IOH A;  4RQ5 A;  3T5J A;  2E3T A;  3IN5 A;  5KT4 A;  3SAG A;  9ICF A;  4C7Z A;  2R8I A;  4NLK A;  3ZD8 A;  2HHQ A;  5E79 U;  4LZG A;  5J0S A;  4DL4 A;  3SV3 A;  2E1E A;  8ICS A;  2OM6 A;  5KFZ A;  5J0T A;  4UAZ A;  2BCV A;  4JV0 A;  3Q8Q B;  1RYS A;  1N61 A;  2Y1I A;  2DPI A;  4YD2 A;  2GH1 A;  4O9M A;  3IG5 A;  1UT5 A;  3B0Y A;  2W04 A;  5JRT A;  5JTI A;  4F50 A;  3R9K A;  3EPI A;  3RH5 A;  1D8L A;  2BPF A;  2W55 A;  4IC9 A;  1X9M A;  1S0N A;  3OHB A;  3AM9 A;  3WK4 A;  3EW9 A;  5KFM A;  2MUT B;  4O3P A;  1KKX A;  5ALF A;  5DLG A;  1T7P A;  3CYM A;  1Y88 A;  2KIC A;  4DFP A;  5KFC A;  3OSN A;  5KFD A;  3FM9 A;  2YMQ A;  4CGZ A;  5KFS A;  1IM4 A;  2W11 A;  1D9F A;  3MGH A;  2ZUC A;  1M6Y A;  5DGA A;  2F44 A;  4EYH B;  2YQE A;  3OPX A;  1S9F A;  4KLL A;  1IIP A;  2UVV A;  2V4R A;  5AKX A;  4DQQ A;  2KVS A;  4YG2 A;  5KG3 A;  2BCU A;  4R63 A;  4EEY A;  2I5H A;  1SKW A;  3N97 B;  2EAO A;  2K4P A;  5DBA A;  3PSI A;  3RJH A;  4I29 A;  1BVS A;  2NRT A;  3NVV A;  3RBD A;  2R8G A;  4UAY A;  1KLN A;  2H3Q A;  8ICX A;  4Z6C A;  4AYB C;  8ICO A;  3I1Y A;  4M9G A;  2WFA A;  1K1Q A;  4YXM A;  4RQ3 A;  5KG6 A;  1BPY A;  2ZJA A;  2BCR A;  3BZK A;  2ISO A;  2JEG A;  2F1J A;  3TAD C;  2RRD A;  3OJU A;  3G6X A;  1SXE A;  3EYZ A;  1ZQR A;  4GXJ A;  4F5R A;  3QXG A;  8ICK A;  4YXJ A;  1J2M A;  3K1Z A;  3I28 A;  1ZQJ A;  4ELV A;  4ECX A;  2LYH A;  1ZQI A;  3HWT A;  3NVY A;  4DSK A;  1N48 A;  4YQW A;  5ALI A;  4NWI A;  1ZQC A;  2P6R A;  1N5W A;  5A0L A;  4NLN A;  3RJK A;  4G3I A;  5HML A;  3SR6 A;  3QZ7 A;  3JPO A;  2HSZ A;  1H38 A;  3N4M B;  4QJF B;  2K4I A;  4RPX A;  2C28 A;  4M04 A;  2WHE A;  5DGB A;  5AM0 A;  1JRP A;  4Q43 A;  2LM1 A;  3PST A;  3SYZ A;  3L5K A;  4ICA A;  4RQ6 A;  3F2D A;  4UAW A;  2DWQ A;  3SAH A;  3ZDE A;  1KFT A;  5KT2 A;  1AQ6 A;  5C5J A;  3MR5 A;  2KJ5 A;  1DGJ A;  4O5C A;  2G5I B;  1PZN A;  5L1I A;  2CRX A;  3GQC A;  4J9K A;  2YMP A;  3TAN A;  2AQ0 A;  2HVH A;  3PZP A;  2EH9 A;  2ZXH A;  4Q45 A;  1NNL A;  2W7P A;  3C5F A;  4ED3 A;  5F3X B;  1C7Y A;  4ED6 A;  4EEL A;  4Y2P A;  5HMM A;  3N28 A;  3ZDB A;  1Z00 A;  5KL1 B;  1D8Y A;  3RR7 A;  2PFQ A;  4F5P A;  4KLD A;  4ELT A;  2ES6 A;  1DXS A;  3NRZ A;  3SMV A;  3RAX A;  2W9A A;  1DK2 A;  3JPT A;  2YML A;  4GLX A;  2PMZ F;  3M9O B;  4BXO B;  4GC6 A;  1NJX A;  2KHQ A;  1N5X A;  3Q8S B;  1ZQE A;  1JAL A;  4F3O A;  4RU9 A;  4DOC A;  4ED8 A;  2ZUB A;  5TZV A;  5J2A A;  3MGI A;  4UAR A;  4C8L A;  5GTH U;  3V72 A;  3K4G A;  5AI6 A;  3NAS A;  5IIJ A;  1BPD A;  3GFK B;  3AQE A;  1X2I A;  3H4D A;  5DDY A;  2BQR A;  4P0Q B;  2HOF A;  1FEZ A;  2LMR A;  3H0R B;  5FP0 A;  3CW2 C;  4DFK A;  4RNM A;  1U48 A;  4BDP A;  3QU9 A;  2WF9 A;  2OH2 A;  3NVZ A;  3RRH A;  1CRX A;  4CRX A;  3C5G A;  3ISD A;  1RZT A;  4DLE A;  2ZG6 A;  4B6J A;  3BS5 A;  3ZI4 A;  2IHN A;  1WWU A;  3EPG A;  3RH4 A;  3MR6 A;  3J81 j;  1Z3E B;  5CRX A;  3BZC A;  1KW4 A;  7ICR A;  5EWG A;  1ZRM A;  1Z00 B;  9ICK A;  2DF4 B;  3MDC A;  4Y2R A;  4YR0 A;  2ZIU A;  4DCC A; 
#chains in the Genus database with same CATH homology
 2E1F A;  2XVT A;  3AL0 B;  2KJ9 A;  2XI9 A;  3H0L B;  5KL1 B;  3M6Z A;  4FZL A;  4C0Z A;  1P7D A;  4O3M A;  2XIC A;  2HBM A;  3O0F A;  4FZN A;  3PSI A;  3F5E A;  4BX9 C;  3D2N A;  3N7R C;  3VC8 A;  2G08 A;  1KBU A;  2G06 A;  1OUQ A;  3ONN A;  2OXO A;  5HR7 A;  3RF9 A;  2H3Q A;  2RP5 A;  2XID A;  4AYB C;  1SZH A;  2JH1 A;  2WAQ F;  2ZIU B;  3IN5 A;  2VJ5 A;  3M6K A;  2GOL A;  2KVC A;  2OYY A;  2WB1 C;  2HBK A;  3KZX A;  2H3F A;  3CP8 A;  3SMV A;  2ZIX A;  3T79 A;  1NZB A;  2BDU A;  2KEY A;  3SAG A;  4BUG A;  5C0Y A;  2K89 A;  2E5S A;  1XNS A;  3MGV A;  2PMZ F;  2F77 X;  4U7C A;  1Q3V A;  2KD1 A;  3LVV A;  1URJ A;  2MRL A;  2RRD A;  1D8B A;  3M7D A;  1TAM A;  1MA7 A;  2G5H B;  2KHV A;  2HOQ A;  1L6N A;  2E1E A;  1YT3 A;  2KHQ A;  3H0M B;  3N7P D;  3KFU F;  2RHF A;  4QIW F;  2KKV A;  4CDG A;  4U6P A;  2OM6 A;  2G07 A;  2Q4T A;  3LVW A;  2ZIX B;  3K1Z A;  3GZF A;  2A3V A;  2WAQ C;  3N7S C;  2F8L A;  2H3Z A;  2JGA A;  2DQN B;  3LYS A;  5T14 A;  4KX5 A;  1PVR A;  4A8E A;  4P0Q A;  1A0P A;  3IG8 A;  2GH1 A;  2N1R A;  3IG5 A;  4FZM A;  2ZIW A;  2LBO A;  2R18 A;  2VKQ A;  2W04 A;  4GFJ A;  2MA1 A;  2G0A A;  4NWI A;  3RFA A;  4P0P A;  3AQE A;  2PMZ C;  1ECW A;  1PVQ A;  3HKZ F;  3PSF A;  5A0L A;  2H3V A;  2LHT A;  1WUD A;  3PSP A;  3F2D A;  4NLB A;  2M0N A;  4FE3 A;  2KV2 A;  1HIW A;  4KMO B;  2HOI A;  4P0Q B;  2HOF A;  4QIW C;  3IP4 B;  2JMG A;  2CPR A;  3AQF A;  4NV0 A;  4IC9 A;  2K4H A;  2G09 A;  2K8C B;  4OO1 J;  2ZIW B;  3H0R B;  4QJF B;  2K4I A;  3F2B A;  2KIW A;  2KKP A;  3C28 A;  4PL1 A;  4P0P B;  3F53 A;  3ALR A;  2VIX A;  2WB1 F;  4ACO A;  3PST A;  2HBL A;  3SAF A;  3CRX A;  3CYM A;  3VCB A;  2ZXI A;  2ZIV A;  4ICA A;  4OJ6 A;  2JH7 A;  4KX3 A;  3F5A A;  4OJO A;  3F2C A;  2YB1 A;  1HEK A;  2CN1 A;  2HMX A;  2KIC A;  2LYA A;  3HKZ C;  5KL8 B;  3SAH A;  3SQI A;  1ZQ1 C;  2Y0S F;  2KJ8 A;  2YB4 A;  2Z7J A;  2LKY A;  1T94 A;  4JMU A;  4NLC A;  2OH2 A;  1A6S A;  4CGZ A;  2HBJ A;  3ICX A;  1Z19 A;  1UPH A;  2KJ5 A;  1CRX A;  2K8B B;  4PL2 A;  4OJL A;  4CRX A;  2G5I B;  2DGZ A;  1GO3 F;  2YX8 A;  4OJP A;  2W03 A;  5HR6 A;  2F2A B;  2CRX A;  2ZG6 A;  2ZIV B;  2NV3 A;  3DEE A;  2W7O A;  2VJ4 A;  3OPX A;  4AYB F;  1IIP A;  3NRW A;  2F76 X;  1ED1 A;  2H3I A;  3GU3 A;  2KNJ A;  2K4E A;  3D2Q A;  3PZP A;  5CRX A;  3C29 A;  3E0F A;  2LYB A;  2ZXH A;  1PVP A;  2KOB A;  1Z1B A;  4QNL A;  2K8A A;  2W7P A;  4BJQ A;  1F44 A;  3D2S A;  3L3F X;  2DF4 B;  2JHD A;  4OJ5 A;  2D6F C;  1XO0 A;  1DRG A;  2ZIU A;  2Y0S C;  4WJ3 B;  3NUQ A;  1Q3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...