3VCBA

C425s mutant of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
b'STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vcbA00
3VC8A 3GZFA 3VCBA
chains in the Genus database with same CATH superfamily
4C8NA 1X2IA 2K60A 4IQUA 1WWUA 2KJ8A 2YX8A 5ALFA 1LKYA 3GV7B 3IHQB 3MGIA 3M9NB 1U47A 4FZMA 5J29A 4PL1A 4YG2A 5J2AA 3PX0A 5AIBA 5D49A 2ZG6A 2BZFA 1TKDA 1JMSA 5IIOA 4O5CA 5J2EA 5B66U 1J2MA 3GILA 3GZFA 2OWOA 4UB3A 1HIWA 2WF6A 4DQPA 3H8JA 8ICOA 4QIWF 2JZBB 3KZIU 2KFZA 4ACOA 3PR5B 5CWRA 2E3TA 2AGPA 5KT5A 1WUDA 4I27A 2PXIA 3MABA 4MFCA 4M9HA 2IA6A 5ALIA 3V7KA 2HHSA 1X66A 4JWMA 9ICMA 1TV9A 7ICPA 1ZJMA 5CHGA 3PW5A 1ZD5A 2Q4TA 2IMWP 2FPKA 3RH6A 2EZZA 1N62A 4PGQA 3TARA 5KFMA 2E8NA 1SKRA 4US9A 1U49A 4J9QA 3AEVA 4RT2A 4M9JA 7ICUA 1Q8KA 1ZQAA 1V9PA 4ED8A 4RQ8A 4F5QA 8ICQA 3T79A 2WTFA 5CA7A 1HUZA 9ICQA 5L1LA 2RRDA 2YB4A 1B22A 1L7OA 1Z1VA 2KK0A 1SKSA 5KFBA 3L3FX 3Q8LA 1T94A 3N7RC 4MF8A 3A0BU 4QWAA 2JZBA 5ALYA 4DL4A 4B9VA 2G08A 4BDPA 4CGZA 5J0YA 3WK4A 4ICAA 4KLDA 1KRPA 3V7LA 3T5HA 4HYKA 4JV1A 4Y2SA 1QCKA 4M47A 4F4ZA 2LBOA 1ZQDA 5KFVA 3F5EA 2OM6A 4UB4A 4GC6A 3HILA 1ZQTA 1SWVA 1TK8A 2K4EA 8ICIA 2W03A 1UQVA 2HVHA 4DQQA 3C2LA 1ZQUA 2BQUA 3GQCA 4KITB 4MF2A 4EELA 7ICVA 2LYBA 2JH7A 1L3VA 1D8LA 7ICTA 4YMOA 1UHUA 2EH9A 5KAIU 5BPCA 4UASA 3MDCA 4DO9A 5KFXA 4I2GA 2ODGA 4ZH4A 1NOMA 2KE7A 3AMZA 3DV9A 2V9WA 9ICWA 1KL9A 1T7PA 8ICEA 1WCNA 4Y2XA 5HR7A 3PNCA 3PSTA 2KICA 4R64A 9ICVA 4QZAA 5E79U 4QWEA 3Q8MA 1Z4OA 1LV5A 3HT3A 4Z6DA 5KFNA 3WKCA 1NI3A 1QLNA 4O9MA 5D46A 2KNJA 2XO7A 5IINA 5ALVA 5BOLA 4B9NA 5EE1A 1QQ5A 1BNOA 4F71A 4NL9A 4KMOB 2YMPA 4OO1J 4XRHA 4O3SA 4QZ9A 3I1YA 7ICNA 2C22A 4DSFA 3AUOA 4QZHA 2H5XA 3F5AA 4J9RA 1X6IA 3FYHA 3J81j 1BPXA 1HEKA 4KMUA 3HP6A 1H38A 5HMLA 7ICHA 5DLFA 4OJ5A 2KVCA 7ICSA 2HSZA 2KZMA 4YP3A 4YMNA 1X9WA 1NNLA 5ALPA 4I28A 8ICBA 1V97A 1TK5A 1L7NA 2CRXA 2UVRA 4DSLA 5AKXA 5DQHA 2Y9TA 2W9CB 3AQEA 4TQRA 2VJ5A 4QJFB 5J0PA 3UQ0A 2BPFA 1RYRA 3C2MA 4RQ1A 3F2BA 3RRGA 1NK6A 2BCSA 4FFDA 2MU2A 8ICUA 4KX3A 5ALLA 3QU4A 4RNMA 2KD1A 1X42A 2KV2A 4O3QA 1NK5A 4IQVA 1V38A 9ICRA 3NASA 1U45A 4O3NA 4I29A 5DB7A 5KFAA 2EANA 4BX9C 2M0NA 4BGDA 4PJ0U 2HHQA 4B9LA 1A77A 4UARA 2D6FC 3V72A 9ICSA 5ALOA 2FMPA 1L8LA 1CUKA 8ICRA 5AHXA 2V4QA 2F1HA 4C0ZA 3ALRA 5K4LA 9ICKA 3IG5A 2W9CA 4DLEA 4J9KA 1S77D 1U48A 1KKXA 4AP9A 3D2NA 5AM0A 3NRWA 1SV4A 2W55A 5KFQA 5KT2A 1KFSA 1RDFA 2FLNA 5DDMA 5JUMA 1C20A 4QZFA 2PI4A 2GLEA 3CRXA 4O5EA 8ICYA 4NXZA 5L1IA 4KLHA 3RJIA 3FAHA 2Y1IA 1BVSA 3SV3A 2R8JA 4M9LA 4RQ0A 3IDWA 4IRCA 4PHPA 4EX6A 9ICOA 5EE3A 1MC8A 4F8RA 2DPJA 1JRPA 3VC8A 1RXVA 4Q8EA 1ZQHA 2RP5A 1N5XA 3N7PD 4CCHA 3BZCA 4RZRA 2DKXA 1F0MA 2W9MA 2BCUA 4CF3A 5AM3A 2ZUDA 4X5VA 3AQFA 3M6ZA 4R65A 5CRXA 5G5GA 1L3SA 1TAUA 4O3MA 1WCLA 7ICEA 2PI5A 2G09A 5DQIA 1Z4NA 2DF4B 1ZQWA 5HHHA 4UAYA 9ICXA 5AM2A 3Q8KA 3ZD8A 1ZJNA 2UVVA 3KHHA 4ECYA 5AK3A 2W43A 5JTIA 5ALGA 3SD7A 1S0NA 1FFUA 1DGJA 3BS5B 4YR2A 3GIJA 4Y2RA 5EE0A 4CDGA 1JXEA 4NLBA 1PK1B 2XVTA 3QZ8A 5KG2A 1KEJA 4C4RA 2NO4A 4UB2A 2NRWA 5DBBA 3H0LB 4EZ9A 1GO3F 3KKAA 1S97A 1MN8A 2H3QA 5KFFA 4Y2YA 9ICIA 1JN3A 5DKWA 4I2BA 1NK0A 2KHVA 4IC9A 1QTMA 3OSNA 1BGXT 3A0HU 1JXLA 2YQEA 3BJYA 2MAXA 2F76X 1O08A 3BS5A 5DQGA 2WF9A 1UCVA 2XGPA 8ICFA 2D8CA 4M9GA 3TAPA 3PZPA 4NL9C 1PK1A 3ZDEA 1FEZA 9ICCA 4ELTA 1M6YA 1ZQZA 4F5NA 2F8KA 2VIXA 1XO1A 2BCVA 3QUBA 2OEHA 1NJYA 1LKYB 3OJUA 4F50A 4RU9A 3PV8A 1RXWA 1NKBA 3EZ5A 5AKZA 4CRXA 2ASJA 3IM1A 2NV3A 4ED7A 4IRDA 3PMLA 5DB9A 3G6XA 3DDHA 4KLMA 1B0XA 1OW5A 3TFRA 1PVRA 2KZ3A 3H8WA 3KD3A 8ICSA 4OD0A 1N56A 1UT5A 4C4TA 4USAA 1DK2A 2XCPA 4G3IA 2H3IA 3E2EA 5B5EU 2FLLA 8ICVA 3RF9A 1ZETA 4RPXA 1RG6A 5KFSA 2FMSA 3ORYA 2ISPA 2EAMA 2HHTA 2YB1A 3RAQA 4CE6A 7ICJA 3E0FA 2MUTB 5J0TA 1URJA 2HBKA 4ED0A 3ZDDA 4IR9A 4UAVA 4M6WB 2XICA 1QSYA 1P7DA 3QUQA 4ED1A 4RT3A 2EAOA 3BDPA 4YQWA 2Y9UA 4LZGA 4ECRA 2YMQA 1NZPA 4KLGA 4UB8U 1ZQFA 4EEKA 1NK7A 5G5HA 2PMZC 3H8SA 2E1EA 3AN1A 2W54A 3PSFA 1ZYQA 1N61A 2ZTCA 8ICMA 4RNOA 5AK5A 4DSIA 4DQRA 2LPEA 1QQ6A 2KMDA 3IRUA 5AKYA 4KLLA 1COKA 3NGDA 5KFEA 4J9PA 5KT4A 1OUQA 5ALNA 3GV8B 2VA8A 3F2CA 5J2JA 2NYVA 4JV0A 5KFOA 5DB6A 2GO7A 3C29A 3G6YA 4DL2A 2PFOA 2HOQA 1A76A 2LM1A 4TUQA 2RDJA 2ZIVB 1VDVA 2MUTA 3PW0A 1X40A 2DUYA 3D6JA 3AM9A 5IIIA 2ZJAA 4M6WA 4C8MA 4DOCA 3QE9Y 3LDAA 3C1YA 4EZ6A 3N4MB 4PL2A 3MFIA 2B0CA 9ICBA 4RQ6A 4I2IA 2AJQA 2PFPA 5KT6A 2KVSA 2ALZA 5DG7A 1ZQYA 2LMRA 2YN4A 1KTQA 5A0LA 1N2XA 2I6XA 3ETRA 1PUZA 4KLIA 4UBCA 3KHGA 1ZRMA 2WAQC 2W7PA 3IN5A 3AU2A 3F53A 5AICA 3RB0A 3QU2A 2KN7A 3WKAA 2JHDA 1T3NA 9ICJA 3RFAA 1XWLA 5DBAA 1SIJA 5J2DA 2XIDA 2XY6A 2ZIWB 4QZGA 2ZIVA 1S0VA 2R18A 5CB1A 2W3RA 1S8OA 3TKAA 3M9OB 1VJ5A 2A3VA 3UM9A 3PMNA 3PO4A 5HNKA 2IBKA 5AKIA 5IIMA 2JXJA 2VA2A 2ZTDA 2HBJA 1SXEA 1SL0A 2AQ4A 4I2FA 3UXNA 3UPQA 2R8GA 3S6JA 1DK3A 2NRTA 3HPOA 2PMZF 2ZUBA 4DF4A 3KKAC 3H4DA 4WJ3B 5IILA 4UBBA 4OJPA 4IS7A 9ICPA 3QEAZ 3D2QA 5AI8A 2HVIA 1RYUA 1RM6C 3NVZA 4YD2A 3KHLA 3PW7A 3SI8A 2DWQA 3UMCA 2BQRA 1BPBA 1YT3A 2AH5A 1U9LA 5CR0A 4ECSA 3UXPA 3SQIA 2VKQA 2ZIWA 3T5LA 3PX6A 4FBTA 3I28A 4P0PB 4ED3A 1SGGA 5AKGA 4J9NA 4R8UB 1SL1A 3QU9A 4Y2PA 8ICLA 5KT7A 2MSNA 4RPYA 1BPZA 3GIIA 1PVQA 4PGXA 4NLNA 5KG6A 3HWTA 4I2JA 4XA5A 5J2FA 3RB4A 2E8MA 4KN7A 1UA1A 4RQMA 3TACB 5AI9A 2JH1A 4DL3A 2DBYA 3TANA 1KDHA 9ICTA 3H4BA 4PHDA 4PZNA 1PZNA 4UQGA 4RQNA 2WFAA 2V4RA 1CRXA 5DDYA 2WAQF 5ALEA 5HMMA 7ICMA 2AHOB 2ZXHA 3WKEA 3C2KA 1MQ2A 4PHAA 1WG8A 3M8SA 3WK5A 4P4PA 2PKEA 2H3ZA 5KFWA 1NK8A 3KFUF 2Q0ZX 3JPTA 5KFGA 4C8OA 4F3OA 4P0PA 3HW8A 3GU3A 4R8UA 3M1YA 4QWBA 4TUSA 2YMMA 3ZDCA 4YVZA 4R63A 2AQ0A 3RH5A 2FMQA 3I76A 2ATLA 4ECXA 2IOHA 5ALHA 2W8LA 5J2BA 2NRZA 3TFSA 4O0IA 1Y88A 2EDUA 2DGZA 3WU2U 3JPOA 3BQ2A 3K1ZA 1L6NA 2Y0SC 2FPLA 3H8MA 4DQSA 4GLXA 2EQYA 1L3TA 2F44A 2C2RA 3KTQA 3ZDAA 1TAQA 3V6HA 1K1SA 3LVWA 3RJHA 3SAGA 5J0QA 1B4FA 5J0UA 5L1KA 1Z3EB 3BQ1A 3CNHA 4DFJA 2KJ9A 2OHFA 4C8LA 5L9XA 3SENA 2XY7A 3UMBA 4F93B 1JALA 1T8EA 1T4GA 3SAFA 1ECWA 1D9FA 2R8KA 2A1JA 1J97A 2RLTA 2C2DA 3G6VA 5KFYA 4Y2JA 5J8YA 5GTIU 3SEIA 4F5RA 3RBDA 4DWIA 5AI0A 4KN4A 2ZXIA 1Q3UA 5HP4A 4AYBC 4C8KA 2IOFA 4GFJA 4M2YA 1BPEA 4GXIA 1RQLA 3CYMA 4F92B 1PK3A 2A1AA 1JROA 3JPQA 5D4BA 1N48A 2W7OA 5EWGA 3RBEA 2OH2A 1F5SA 2W11A 3K75D 4Z6CA 3NTUA 3JPRA 4J9LA 1RYSA 2HHUA 2LYHA 4DFDA 4PGYA 3K1RB 4DSKA 5ALUA 3RJFA 4GXJA 1EXNA 3K4GA 3SR6A 4Z6FA 5KFDA 1NK9A 4O3PA 4RPZA 1BPYA 2OYYA 3B0XA 5KFRA 1ZQNA 2KJ5A 1NJZA 5ALMA 2RQ5A 3WK6A 3M9MB 3N28A 3V6JA 1S0OA 4TUPA 1KW4A 5AM5A 3OJSA 1TVAA 2JEGA 5H2FU 5AKHA 4RQ2A 1WWVA 1ZQIA 1DRGA 2Y0SF 7ICKA 3SYZA 2KEYA 9ICAA 4PHEA 2EZXA 4QWCA 2JV3A 3RH4A 4QW8A 2WF7A 1SL2A 3H7IA 3ISCA 3EYZA 5AK6A 5KFPA 5AI6A 9ICFA 2BDPA 3WKBA 1XS9D 5AM1A 3GV5B 1SKWA 2LKYA 2ASDA 3KHRA 1S9FA 3C21A 2G07A 4EYIB 2JEIA 2HBMA 1BNPA 1DXSA 1CEZA 1N63A 1YZ6A 4XQ8A 2JEJA 5DG8A 2W3SA 3BQTA 1L7PA 4J9MA 4RQ7A 5KG1A 3KZXA 1ZQKA 4F2RA 4MFFA 4Q45A 4NWIA 2E8PA 3GIMA 3OGUA 2UVWA 4M9NA 3L5KA 4B9SA 4BWMA 4IQWA 4MEYA 4PPXA 8ICKA 1ZD2P 4AYBF 4QNLA 2F77X 1ZXIA 4FZNA 5J2HA 3OHAA 2FJ6A 4MEXA 4QZBA 2BR0A 2F2AB 4BJQA 1FFVA 4C7ZA 5KG4A 3PW4A 1ZQRA 2KG5A 4K4GA 5KAFU 3PX4A 1FIQA 1NKCA 3U26A 4YMMA 4RQ3A 2DPIA 4XUSA 3EPGA 3E58A 1X6JA 4CNQA 2F3NA 1KBUA 2KIWA 3ED5A 2UVUA 4OJOA 2DQNB 4NLGA 3ONNA 3JPNA 2WF8A 2HHVA 1CI4A 2PFQA 3V7JA 1ZQ1C 4YXMA 4Y2VA 3NVYA 3GIKA 9ICHA 4M0AA 3MGHA 4F4YA 2WB1C 3WK8A 1LVHA 1NK4A 4JK1A 4LVSA 4Y2UA 1X9MA 1RQNA 2ES6A 3QYPA 5DGAA 1A6SA 1LB2B 4FS1A 4YXJA 2G5IB 2C2EA 5DB8A 1D8BA 1ZQOA 3RJJA 3DEEA 5DGBA 2JRZA 3ETLA 4DS5A 3HRDD 3Q8QB 1Z1BA 5ALQA 1F44A 3O0FA 4DL5A 3QU5A 8ICJA 4OJ6A 1SZPA 1DOQA 2FPMA 3PSPA 4BWJA 5KFZA 4TQSA 1SB3C 4ECTA 4QZDA 5TISU 5BOMA 4B9MA 1HUOA 4I2CA 4GC7A 3ZI4A 1L7MA 1TE2A 2C28A 2MA1A 2P35A 3C23A 7ICIA 1XNSA 8ICXA 4DOAA 2VA3A 8ICWA 1ZQCA 4HAIA 5FP0A 1S10A 4UATA 5KFTA 1ZD3A 2JGAA 2QB1A 2ZUCA 1ZQGA 2GOLA 8ICPA 3JPSA 4F5PA 4YFKA 1XC9A 4J9OA 1NZBA 2OCEA 2XI9A 1L8OA 2VANA 3NUQA 4MHVA 2KOBA 1AROP 3VCBA 3RAXA 4DFKA 5AKEA 3MR2A 4EBDA 1MSWD 4KLQA 4DL6A 1A0PA 2RDIA 1X9SA 3MC1A 4P2HA 5JU5A 4DSEA 2BCQA 1IG6A 5J8YC 1O03A 3FM9A 5KL1B 1K1QA 2W9BA 5AKLA 1QSSA 2O6KA 5JRTA 3M8RA 3T3FA 1YZ7A 2EAPA 5KFLA 1V85A 2BKEA 2AGOA 3QEBZ 3ZD9A 5KFIA 7ICOA 2J6UA 2Y1JA 4QZIA 3L4PA 2XGQA 8ICHA 2HI0A 2AXTU 1XSPA 2KIVA 9ICGA 3RTVA 4US8A 9ICLA 3MR5A 1T3QA 4EYHB 2YY6A 3CW2C 2HHWA 1ED1A 2E5SA 4KX5A 4KLUA 4DFMA 2WB1F 4YD1A 2HHXA 3PO5A 7ICRA 4IR1A 4FO6A 2IHMA 4PH5A 2J6SA 4I2EA 3LVVA 4BXOB 4EENA 3THVA 1IXRA 4LZDA 2BHNA 2K4IA 3PVXA 4F2SA 5IIKA 4K4IA 4NV0A 8ICNA 2R8HA 3UMGA 3LK9A 1S0MA 2JR5A 4EX7A 4KLFA 2LYAA 1QQ7A 3TQ1A 1XSNA 2F1IA 4CF5A 5KL8B 4DLGA 1QH9A 4NJ8A 4Z6EA 3RJGA 5DBCA 4O3RA 2JEFA 2K8BB 2XC9A 1KSPA 4NM1A 5IIJA 1TFRA 4OCZA 3H0MB 3QUTA 5ALZA 4F4KA 2KP7A 8ICCA 1N5WA 1NJWA 4KLTA 4IQTA 9ICNA 2XCAA 4YN4A 1L3UA 4BXOA 1NKEA 1SXDA 2GH1A 4KLOA 4Q8FA 5CP2A 4DL7A 4CF4A 5GTHU 3ZDBA 5J0OA 3PR4A 8ICTA 1SWWA 2LI6A 3C1ZA 5KT3A 3Q8RB 4DCCA 5KTQA 4F4WA 4K4HA 2L5YA 4UB6U 5EOZA 3EWAA 4FZLA 4F91B 2R8IA 2P66A 2ZIXB 4RQ5A 3QUCA 5J0RA 3IP4B 9ICEA 4ZOHC 5AKKA 5F3XB 5ALJA 1HJPA 4F72A 1XU4A 4F5OA 2FLPA 5J0XA 4PZOA 4RNNA 3NS1A 3T5KA 3EW9A 1NJXA 1Q46A 5J0WA 1JI7A 2MRLA 4DEZA 4E0DA 3KBBA 2I9GA 4I2AA 3AL0B 7ICGA 1DGSA 2G0AA 2K4HA 2OXOA 1K5OA 4B9TA 3OHBA 4LJXA 2VJ4A 5AKJA 3MDAA 1QSLA 5F9NA 4B6JA 1RZTA 4RUAA 3SV4A 4I2HA 4P4OA 4P0QB 4QW9A 4R66A 1BPDA 1SV0A 2AGQA 4IL6U 3BZKA 2RHFA 4ECWA 5DLGA 5L1JA 2ZIXA 2ZTEA 5KG5A 2DL0A 1C7YA 1XSLA 3RR8A 4ED6A 2B6GA 3QX7A 2BPGA 5J2GA 3RB6A 2J6TA 4KLEA 2CXYA 2A1JB 2DKZA 3TADA 3SMVA 2ZJ8A 2K8CB 2NRVA 4KTQA 4DQIA 4GXKA 1KFDA 2LHTA 2E8OA 3HX0A 2F8LA 1WYGA 3IG8A 2P6UA 3C5GA 4ECZA 2ESEA 2AU0A 2F1JA 1VLBA 2DFLA 4NY8A 4P4MA 3SZ2A 3HJEA 3N97B 5ALTA 1ZQVA 5KG3A 1FO4A 1S76D 2EZYA 3D2SA 1PVPA 2K4PA 4P0QA 1N60A 3NVVA 3MR3A 3OSPA 4DOBA 2I5HA 5AIAA 3V6KA 2A19A 5KFKA 4G9BA 5J2CA 4O3OA 1Z00B 4Q44A 5ALWA 1AQ6A 4IRKA 1MQ3A 5KG7A 2FI1A 3FDSA 3MGVA 2HOFA 3QXGA 3QNMA 2H3FA 3Q8PB 4EEYA 1ZQEA 3MBYA 2QB0B 1UPHA 2FE9A 2NO5A 4UB1A 1KN5A 7ICQA 2QLTA 2KKVA 4GIBA 1ZQLA 2M9NA 3R9KA 3C28A 3RRHA 4UW9A 2G5HB 3C5FA 4C7YA 5F9LA 3HKZC 3RJKA 2LM4A 5KFJA 4J03A 1SZHA 2KZZA 2HW3A 5C5JA 5CJ7A 1OXJA 5ALRA 4C80A 4YCXA 2XY5A 3BQ7A 1ZOLA 4Y2TA 4Q43A 8ICAA 4YR0A 3PW2A 3ISDA 3WKDA 4UAWA 3BQ0A 4EBEA 2ISOA 1X9XA 2N1RA 4O5KA 1JUDA 3EPIA 1UT8A 3TAQA 1Z00A 4JMUA 1J2NA 3F2DA 1JX4A 2QARB 3NVWA 4QWDA 2P6RA 2HCFA 2G06A 3PSIA 1IM4A 4ELUA 4M04A 3WK7A 3B0YA 1D8YA 3H40A 3RB3A 4ELVA 4TURA 2BGWA 4JB3A 4FE3A 2W04A 3MR6A 3PY8A 2IOFK 2QB0A 3CP8A 1KQQA 3H0RB 5DG9A 4DFPA 2KSOB 5ALXA 4UB5A 4ED2A 4QZEA 2YMLA 4I2DA 1JIHA 2D3DA 3UXOA 1KLNA 4JWNA 4ECQA 5L1MA 1Q3VA 1S5LU 3OTQA 2QKQA 4FS2A 5EWFA 2W8KA 5AI5A 4DSJA 3UQ2A 2GWSA 5EE9A 5TZVA 5J2IA 4DF8A 3OPXA 3LYSA 4OJLA 3KOOA 3GFKB 4NLKA 4JUZA 4BUGA 1COOA 4KLSA 4UAZA 4ECVA 2FDRA 2W9AA 2BDUA 2QARA 4U7CA 1B43A 4NLZA 5AM4A 3ISBA 1IIPA 1U4BA 3FC4A 2BPCA 1L5UA 2H3VA 5KG0A 1ZQBA 2K8AA 1ZQSA 4U6PA 5KNIA 3Q8SB 2E1FA 5T14A 2KFNA 4KLJA 1IV8A 1RPLA 2I1QA 2KSOA 4ECUA 8ICGA 4QIWC 1ZQXA 2KKPA 3QU7A 2BQ3A 4FBUA 3ICXA 9ICUA 2JMGA 3GDXA 4QZ8A 4A8EA 4YR3A 5AI4A 3MFHA 5ALSA 4C4SA 3HKZF 2CPRA 1ZQQA 1ZQJA 2ZIUB 5AK4A 2PFNA 3SAHA 3IV6A 3EUB2 4EBCA 1KFTA 5HR6A 1ZRNA 2HMXA 3NRZA 4B9UA 1ZQPA 2HOIA 2ZJ5A 4NLCA 3M7DA 4J9SA 5J0SA 2WF5A 4RUCA 1D9DA 2IHNA 1SV0C 2YTUA 2K89A 5C0YA 2B21A 2HDOA 5KFUA 4DS4A 5CEHA 3BS7A 1ZQMA 3WK9A 2BCRA 7ICLA 4MFAA 3QZ7A 3B9JA 1Z19A 5ALDA 5HHIA 4QZCA 2NRXA 4F4XA 2CN1A 3JPPA 4JV2A 5EWEA 2ASLA 3TADC 4RQ4A 1MA7A 3T5JA 2Z7JA 2WHEA 1UA0A 8ICZA 1ZD4A 3TI0A 7ICFA 2W9BB 2HBLA 3AU6A 3RR7A 3LWLA 1TK0A 1TAMA 5KFCA 3M6KA 2ZIUA 3N7SC 2KTQA 4UAUA 2KHQA 5J2KA 4Y2QA 5KFHA 3RJEA 1XO0A 4NM2A 3LWMA 5ALKA
chains in the Genus database with same CATH topology
2DGZA 2K8AA 2G08A 4C0ZA 2KOBA 3ALRA 3C28A 4CGZA 3VCBA 4NLBA 4U6PA 2ZIXA 1PVRA 2E1FA 5T14A 2G5HB 3K1ZA 1L6NA 2Y0SC 3HKZC 4ICAA 1YT3A 4KMOB 4OO1J 4PL2A 2XVTA 2KJ8A 2YX8A 3IG5A 3SQIA 1SZHA 1A0PA 2OYYA 2VKQA 2ZIWA 4P0PB 2KJ5A 4QIWC 5KL1B 2KKPA 3D2NA 4FZMA 3H0LB 2LBOA 3LVWA 3NRWA 4PL1A 3F5AA 3ICXA 3SMVA 2JMGA 3F5EA 1KBUA 2KIWA 2GH1A 2H3IA 2K8CB 2OM6A 2ZG6A 1GO3F 2N1RA 4OJOA 4A8EA 2DQNB 3RF9A 3SAGA 3ONNA 5A0LA 1HEKA 4JMUA 3F2DA 1ZQ1C 2H3QA 2K4EA 2W03A 1DRGA 2Y0SF 3HKZF 2CPRA 4OJ5A 2LHTA 1PVQA 3CRXA 2F8LA 2WB1C 2WAQC 3GZFA 2W7PA 2KVCA 1HIWA 2KEYA 3IG8A 2ZIUB 3F53A 2G06A 3PSIA 3IN5A 2YB1A 2KJ9A 3SAHA 3E0FA 4QIWF 1URJA 2KHVA 2JHDA 5HR6A 1A6SA 2HBKA 4IC9A 2LYBA 2JH7A 2HMXA 4ACOA 2JH1A 2G5IB 4FZLA 2HOIA 4FE3A 3RFAA 2XICA 2W04A 3SAFA 1D8BA 1P7DA 2ZIXB 1WUDA 3DEEA 3CP8A 1ECWA 3M7DA 4NLCA 2CRXA 3D2SA 1ED1A 2XIDA 1PVPA 3IP4B 3H0RB 2LKYA 1Z1BA 2E5SA 4KX5A 4P0QA 2ZIWB 1F44A 3VC8A 3O0FA 2F76X 2WB1F 2ZIVA 2WAQF 1CRXA 3AQEA 2K89A 5C0YA 2VJ5A 2R18A 2RP5A 4QJFB 2ZXHA 2PMZC 3N7PD 3F2BA 4OJ6A 2G07A 3LVVA 2E1EA 3PSPA 2A3VA 2K4IA 1Q3VA 3PSFA 2ZXIA 1Q3UA 2HBMA 2Q4TA 4NV0A 3PZPA 3AQFA 3M6ZA 4KX3A 2MRLA 4AYBC 2H3ZA 1Z19A 3KFUF 2HBJA 2KD1A 5CRXA 4GFJA 2KV2A 5HR7A 3CYMA 4P0PA 2CN1A 4O3MA 3OPXA 2MA1A 3PSTA 2KICA 3AL0B 2G09A 2LYAA 3GU3A 3LYSA 4OJLA 2VIXA 3MGVA 1XNSA 2HOFA 3KZXA 4BUGA 1MA7A 4NWIA 2H3FA 2DF4B 2G0AA 2K4HA 2PMZF 2Z7JA 2W7OA 2OXOA 5KL8B 4BX9C 4WJ3B 4OJPA 1OUQA 2OH2A 2M0NA 2HBLA 3T79A 2BDUA 4U7CA 2VJ4A 3D2QA 4AYBF 4QNLA 1TAMA 1UPHA 3F2CA 2F77X 2JGAA 3M6KA 2RRDA 2GOLA 2YB4A 4FZNA 1IIPA 2ZIUA 4CRXA 3C29A 3N7SC 2K8BB 2HOQA 4P0QB 2D6FC 2KHQA 1XO0A 2ZIVB 1NZBA 3H0MB 3L3FX 1T94A 3N7RC 2KKVA 2F2AB 2H3VA 2NV3A 2XI9A 2RHFA 3NUQA 4BJQA 4CDGA 2KNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VC8 A;  3GZF A;  3VCB A; 
#chains in the Genus database with same CATH topology
 4C8N A;  1X2I A;  2K60 A;  4IQU A;  1WWU A;  2KJ8 A;  2YX8 A;  5ALF A;  1LKY A;  3GV7 B;  3IHQ B;  3MGI A;  3M9N B;  1U47 A;  4FZM A;  5J29 A;  4PL1 A;  4YG2 A;  5J2A A;  3PX0 A;  5AIB A;  5D49 A;  2ZG6 A;  2BZF A;  1TKD A;  1JMS A;  5IIO A;  4O5C A;  5J2E A;  5B66 U;  1J2M A;  3GIL A;  3GZF A;  2OWO A;  4UB3 A;  1HIW A;  2WF6 A;  4DQP A;  3H8J A;  8ICO A;  4QIW F;  2JZB B;  3KZI U;  2KFZ A;  4ACO A;  3PR5 B;  5CWR A;  2E3T A;  2AGP A;  5KT5 A;  1WUD A;  4I27 A;  2PXI A;  3MAB A;  4MFC A;  4M9H A;  2IA6 A;  5ALI A;  3V7K A;  2HHS A;  1X66 A;  4JWM A;  9ICM A;  1TV9 A;  7ICP A;  1ZJM A;  5CHG A;  3PW5 A;  1ZD5 A;  2Q4T A;  2IMW P;  2FPK A;  3RH6 A;  2EZZ A;  1N62 A;  4PGQ A;  3TAR A;  5KFM A;  2E8N A;  1SKR A;  4US9 A;  1U49 A;  4J9Q A;  3AEV A;  4RT2 A;  4M9J A;  7ICU A;  1Q8K A;  1ZQA A;  1V9P A;  4ED8 A;  4RQ8 A;  4F5Q A;  8ICQ A;  3T79 A;  2WTF A;  5CA7 A;  1HUZ A;  9ICQ A;  5L1L A;  2RRD A;  2YB4 A;  1B22 A;  1L7O A;  1Z1V A;  2KK0 A;  1SKS A;  5KFB A;  3L3F X;  3Q8L A;  1T94 A;  3N7R C;  4MF8 A;  3A0B U;  4QWA A;  2JZB A;  5ALY A;  4DL4 A;  4B9V A;  2G08 A;  4BDP A;  4CGZ A;  5J0Y A;  3WK4 A;  4ICA A;  4KLD A;  1KRP A;  3V7L A;  3T5H A;  4HYK A;  4JV1 A;  4Y2S A;  1QCK A;  4M47 A;  4F4Z A;  2LBO A;  1ZQD A;  5KFV A;  3F5E A;  2OM6 A;  4UB4 A;  4GC6 A;  3HIL A;  1ZQT A;  1SWV A;  1TK8 A;  2K4E A;  8ICI A;  2W03 A;  1UQV A;  2HVH A;  4DQQ A;  3C2L A;  1ZQU A;  2BQU A;  3GQC A;  4KIT B;  4MF2 A;  4EEL A;  7ICV A;  2LYB A;  2JH7 A;  1L3V A;  1D8L A;  7ICT A;  4YMO A;  1UHU A;  2EH9 A;  5KAI U;  5BPC A;  4UAS A;  3MDC A;  4DO9 A;  5KFX A;  4I2G A;  2ODG A;  4ZH4 A;  1NOM A;  2KE7 A;  3AMZ A;  3DV9 A;  2V9W A;  9ICW A;  1KL9 A;  1T7P A;  8ICE A;  1WCN A;  4Y2X A;  5HR7 A;  3PNC A;  3PST A;  2KIC A;  4R64 A;  9ICV A;  4QZA A;  5E79 U;  4QWE A;  3Q8M A;  1Z4O A;  1LV5 A;  3HT3 A;  4Z6D A;  5KFN A;  3WKC A;  1NI3 A;  1QLN A;  4O9M A;  5D46 A;  2KNJ A;  2XO7 A;  5IIN A;  5ALV A;  5BOL A;  4B9N A;  5EE1 A;  1QQ5 A;  1BNO A;  4F71 A;  4NL9 A;  4KMO B;  2YMP A;  4OO1 J;  4XRH A;  4O3S A;  4QZ9 A;  3I1Y A;  7ICN A;  2C22 A;  4DSF A;  3AUO A;  4QZH A;  2H5X A;  3F5A A;  4J9R A;  1X6I A;  3FYH A;  3J81 j;  1BPX A;  1HEK A;  4KMU A;  3HP6 A;  1H38 A;  5HML A;  7ICH A;  5DLF A;  4OJ5 A;  2KVC A;  7ICS A;  2HSZ A;  2KZM A;  4YP3 A;  4YMN A;  1X9W A;  1NNL A;  5ALP A;  4I28 A;  8ICB A;  1V97 A;  1TK5 A;  1L7N A;  2CRX A;  2UVR A;  4DSL A;  5AKX A;  5DQH A;  2Y9T A;  2W9C B;  3AQE A;  4TQR A;  2VJ5 A;  4QJF B;  5J0P A;  3UQ0 A;  2BPF A;  1RYR A;  3C2M A;  4RQ1 A;  3F2B A;  3RRG A;  1NK6 A;  2BCS A;  4FFD A;  2MU2 A;  8ICU A;  4KX3 A;  5ALL A;  3QU4 A;  4RNM A;  2KD1 A;  1X42 A;  2KV2 A;  4O3Q A;  1NK5 A;  4IQV A;  1V38 A;  9ICR A;  3NAS A;  1U45 A;  4O3N A;  4I29 A;  5DB7 A;  5KFA A;  2EAN A;  4BX9 C;  2M0N A;  4BGD A;  4PJ0 U;  2HHQ A;  4B9L A;  1A77 A;  4UAR A;  2D6F C;  3V72 A;  9ICS A;  5ALO A;  2FMP A;  1L8L A;  1CUK A;  8ICR A;  5AHX A;  2V4Q A;  2F1H A;  4C0Z A;  3ALR A;  5K4L A;  9ICK A;  3IG5 A;  2W9C A;  4DLE A;  4J9K A;  1S77 D;  1U48 A;  1KKX A;  4AP9 A;  3D2N A;  5AM0 A;  3NRW A;  1SV4 A;  2W55 A;  5KFQ A;  5KT2 A;  1KFS A;  1RDF A;  2FLN A;  5DDM A;  5JUM A;  1C20 A;  4QZF A;  2PI4 A;  2GLE A;  3CRX A;  4O5E A;  8ICY A;  4NXZ A;  5L1I A;  4KLH A;  3RJI A;  3FAH A;  2Y1I A;  1BVS A;  3SV3 A;  2R8J A;  4M9L A;  4RQ0 A;  3IDW A;  4IRC A;  4PHP A;  4EX6 A;  9ICO A;  5EE3 A;  1MC8 A;  4F8R A;  2DPJ A;  1JRP A;  3VC8 A;  1RXV A;  4Q8E A;  1ZQH A;  2RP5 A;  1N5X A;  3N7P D;  4CCH A;  3BZC A;  4RZR A;  2DKX A;  1F0M A;  2W9M A;  2BCU A;  4CF3 A;  5AM3 A;  2ZUD A;  4X5V A;  3AQF A;  3M6Z A;  4R65 A;  5CRX A;  5G5G A;  1L3S A;  1TAU A;  4O3M A;  1WCL A;  7ICE A;  2PI5 A;  2G09 A;  5DQI A;  1Z4N A;  2DF4 B;  1ZQW A;  5HHH A;  4UAY A;  9ICX A;  5AM2 A;  3Q8K A;  3ZD8 A;  1ZJN A;  2UVV A;  3KHH A;  4ECY A;  5AK3 A;  2W43 A;  5JTI A;  5ALG A;  3SD7 A;  1S0N A;  1FFU A;  1DGJ A;  3BS5 B;  4YR2 A;  3GIJ A;  4Y2R A;  5EE0 A;  4CDG A;  1JXE A;  4NLB A;  1PK1 B;  2XVT A;  3QZ8 A;  5KG2 A;  1KEJ A;  4C4R A;  2NO4 A;  4UB2 A;  2NRW A;  5DBB A;  3H0L B;  4EZ9 A;  1GO3 F;  3KKA A;  1S97 A;  1MN8 A;  2H3Q A;  5KFF A;  4Y2Y A;  9ICI A;  1JN3 A;  5DKW A;  4I2B A;  1NK0 A;  2KHV A;  4IC9 A;  1QTM A;  3OSN A;  1BGX T;  3A0H U;  1JXL A;  2YQE A;  3BJY A;  2MAX A;  2F76 X;  1O08 A;  3BS5 A;  5DQG A;  2WF9 A;  1UCV A;  2XGP A;  8ICF A;  2D8C A;  4M9G A;  3TAP A;  3PZP A;  4NL9 C;  1PK1 A;  3ZDE A;  1FEZ A;  9ICC A;  4ELT A;  1M6Y A;  1ZQZ A;  4F5N A;  2F8K A;  2VIX A;  1XO1 A;  2BCV A;  3QUB A;  2OEH A;  1NJY A;  1LKY B;  3OJU A;  4F50 A;  4RU9 A;  3PV8 A;  1RXW A;  1NKB A;  3EZ5 A;  5AKZ A;  4CRX A;  2ASJ A;  3IM1 A;  2NV3 A;  4ED7 A;  4IRD A;  3PML A;  5DB9 A;  3G6X A;  3DDH A;  4KLM A;  1B0X A;  1OW5 A;  3TFR A;  1PVR A;  2KZ3 A;  3H8W A;  3KD3 A;  8ICS A;  4OD0 A;  1N56 A;  1UT5 A;  4C4T A;  4USA A;  1DK2 A;  2XCP A;  4G3I A;  2H3I A;  3E2E A;  5B5E U;  2FLL A;  8ICV A;  3RF9 A;  1ZET A;  4RPX A;  1RG6 A;  5KFS A;  2FMS A;  3ORY A;  2ISP A;  2EAM A;  2HHT A;  2YB1 A;  3RAQ A;  4CE6 A;  7ICJ A;  3E0F A;  2MUT B;  5J0T A;  1URJ A;  2HBK A;  4ED0 A;  3ZDD A;  4IR9 A;  4UAV A;  4M6W B;  2XIC A;  1QSY A;  1P7D A;  3QUQ A;  4ED1 A;  4RT3 A;  2EAO A;  3BDP A;  4YQW A;  2Y9U A;  4LZG A;  4ECR A;  2YMQ A;  1NZP A;  4KLG A;  4UB8 U;  1ZQF A;  4EEK A;  1NK7 A;  5G5H A;  2PMZ C;  3H8S A;  2E1E A;  3AN1 A;  2W54 A;  3PSF A;  1ZYQ A;  1N61 A;  2ZTC A;  8ICM A;  4RNO A;  5AK5 A;  4DSI A;  4DQR A;  2LPE A;  1QQ6 A;  2KMD A;  3IRU A;  5AKY A;  4KLL A;  1COK A;  3NGD A;  5KFE A;  4J9P A;  5KT4 A;  1OUQ A;  5ALN A;  3GV8 B;  2VA8 A;  3F2C A;  5J2J A;  2NYV A;  4JV0 A;  5KFO A;  5DB6 A;  2GO7 A;  3C29 A;  3G6Y A;  4DL2 A;  2PFO A;  2HOQ A;  1A76 A;  2LM1 A;  4TUQ A;  2RDJ A;  2ZIV B;  1VDV A;  2MUT A;  3PW0 A;  1X40 A;  2DUY A;  3D6J A;  3AM9 A;  5III A;  2ZJA A;  4M6W A;  4C8M A;  4DOC A;  3QE9 Y;  3LDA A;  3C1Y A;  4EZ6 A;  3N4M B;  4PL2 A;  3MFI A;  2B0C A;  9ICB A;  4RQ6 A;  4I2I A;  2AJQ A;  2PFP A;  5KT6 A;  2KVS A;  2ALZ A;  5DG7 A;  1ZQY A;  2LMR A;  2YN4 A;  1KTQ A;  5A0L A;  1N2X A;  2I6X A;  3ETR A;  1PUZ A;  4KLI A;  4UBC A;  3KHG A;  1ZRM A;  2WAQ C;  2W7P A;  3IN5 A;  3AU2 A;  3F53 A;  5AIC A;  3RB0 A;  3QU2 A;  2KN7 A;  3WKA A;  2JHD A;  1T3N A;  9ICJ A;  3RFA A;  1XWL A;  5DBA A;  1SIJ A;  5J2D A;  2XID A;  2XY6 A;  2ZIW B;  4QZG A;  2ZIV A;  1S0V A;  2R18 A;  5CB1 A;  2W3R A;  1S8O A;  3TKA A;  3M9O B;  1VJ5 A;  2A3V A;  3UM9 A;  3PMN A;  3PO4 A;  5HNK A;  2IBK A;  5AKI A;  5IIM A;  2JXJ A;  2VA2 A;  2ZTD A;  2HBJ A;  1SXE A;  1SL0 A;  2AQ4 A;  4I2F A;  3UXN A;  3UPQ A;  2R8G A;  3S6J A;  1DK3 A;  2NRT A;  3HPO A;  2PMZ F;  2ZUB A;  4DF4 A;  3KKA C;  3H4D A;  4WJ3 B;  5IIL A;  4UBB A;  4OJP A;  4IS7 A;  9ICP A;  3QEA Z;  3D2Q A;  5AI8 A;  2HVI A;  1RYU A;  1RM6 C;  3NVZ A;  4YD2 A;  3KHL A;  3PW7 A;  3SI8 A;  2DWQ A;  3UMC A;  2BQR A;  1BPB A;  1YT3 A;  2AH5 A;  1U9L A;  5CR0 A;  4ECS A;  3UXP A;  3SQI A;  2VKQ A;  2ZIW A;  3T5L A;  3PX6 A;  4FBT A;  3I28 A;  4P0P B;  4ED3 A;  1SGG A;  5AKG A;  4J9N A;  4R8U B;  1SL1 A;  3QU9 A;  4Y2P A;  8ICL A;  5KT7 A;  2MSN A;  4RPY A;  1BPZ A;  3GII A;  1PVQ A;  4PGX A;  4NLN A;  5KG6 A;  3HWT A;  4I2J A;  4XA5 A;  5J2F A;  3RB4 A;  2E8M A;  4KN7 A;  1UA1 A;  4RQM A;  3TAC B;  5AI9 A;  2JH1 A;  4DL3 A;  2DBY A;  3TAN A;  1KDH A;  9ICT A;  3H4B A;  4PHD A;  4PZN A;  1PZN A;  4UQG A;  4RQN A;  2WFA A;  2V4R A;  1CRX A;  5DDY A;  2WAQ F;  5ALE A;  5HMM A;  7ICM A;  2AHO B;  2ZXH A;  3WKE A;  3C2K A;  1MQ2 A;  4PHA A;  1WG8 A;  3M8S A;  3WK5 A;  4P4P A;  2PKE A;  2H3Z A;  5KFW A;  1NK8 A;  3KFU F;  2Q0Z X;  3JPT A;  5KFG A;  4C8O A;  4F3O A;  4P0P A;  3HW8 A;  3GU3 A;  4R8U A;  3M1Y A;  4QWB A;  4TUS A;  2YMM A;  3ZDC A;  4YVZ A;  4R63 A;  2AQ0 A;  3RH5 A;  2FMQ A;  3I76 A;  2ATL A;  4ECX A;  2IOH A;  5ALH A;  2W8L A;  5J2B A;  2NRZ A;  3TFS A;  4O0I A;  1Y88 A;  2EDU A;  2DGZ A;  3WU2 U;  3JPO A;  3BQ2 A;  3K1Z A;  1L6N A;  2Y0S C;  2FPL A;  3H8M A;  4DQS A;  4GLX A;  2EQY A;  1L3T A;  2F44 A;  2C2R A;  3KTQ A;  3ZDA A;  1TAQ A;  3V6H A;  1K1S A;  3LVW A;  3RJH A;  3SAG A;  5J0Q A;  1B4F A;  5J0U A;  5L1K A;  1Z3E B;  3BQ1 A;  3CNH A;  4DFJ A;  2KJ9 A;  2OHF A;  4C8L A;  5L9X A;  3SEN A;  2XY7 A;  3UMB A;  4F93 B;  1JAL A;  1T8E A;  1T4G A;  3SAF A;  1ECW A;  1D9F A;  2R8K A;  2A1J A;  1J97 A;  2RLT A;  2C2D A;  3G6V A;  5KFY A;  4Y2J A;  5J8Y A;  5GTI U;  3SEI A;  4F5R A;  3RBD A;  4DWI A;  5AI0 A;  4KN4 A;  2ZXI A;  1Q3U A;  5HP4 A;  4AYB C;  4C8K A;  2IOF A;  4GFJ A;  4M2Y A;  1BPE A;  4GXI A;  1RQL A;  3CYM A;  4F92 B;  1PK3 A;  2A1A A;  1JRO A;  3JPQ A;  5D4B A;  1N48 A;  2W7O A;  5EWG A;  3RBE A;  2OH2 A;  1F5S A;  2W11 A;  3K75 D;  4Z6C A;  3NTU A;  3JPR A;  4J9L A;  1RYS A;  2HHU A;  2LYH A;  4DFD A;  4PGY A;  3K1R B;  4DSK A;  5ALU A;  3RJF A;  4GXJ A;  1EXN A;  3K4G A;  3SR6 A;  4Z6F A;  5KFD A;  1NK9 A;  4O3P A;  4RPZ A;  1BPY A;  2OYY A;  3B0X A;  5KFR A;  1ZQN A;  2KJ5 A;  1NJZ A;  5ALM A;  2RQ5 A;  3WK6 A;  3M9M B;  3N28 A;  3V6J A;  1S0O A;  4TUP A;  1KW4 A;  5AM5 A;  3OJS A;  1TVA A;  2JEG A;  5H2F U;  5AKH A;  4RQ2 A;  1WWV A;  1ZQI A;  1DRG A;  2Y0S F;  7ICK A;  3SYZ A;  2KEY A;  9ICA A;  4PHE A;  2EZX A;  4QWC A;  2JV3 A;  3RH4 A;  4QW8 A;  2WF7 A;  1SL2 A;  3H7I A;  3ISC A;  3EYZ A;  5AK6 A;  5KFP A;  5AI6 A;  9ICF A;  2BDP A;  3WKB A;  1XS9 D;  5AM1 A;  3GV5 B;  1SKW A;  2LKY A;  2ASD A;  3KHR A;  1S9F A;  3C21 A;  2G07 A;  4EYI B;  2JEI A;  2HBM A;  1BNP A;  1DXS A;  1CEZ A;  1N63 A;  1YZ6 A;  4XQ8 A;  2JEJ A;  5DG8 A;  2W3S A;  3BQT A;  1L7P A;  4J9M A;  4RQ7 A;  5KG1 A;  3KZX A;  1ZQK A;  4F2R A;  4MFF A;  4Q45 A;  4NWI A;  2E8P A;  3GIM A;  3OGU A;  2UVW A;  4M9N A;  3L5K A;  4B9S A;  4BWM A;  4IQW A;  4MEY A;  4PPX A;  8ICK A;  1ZD2 P;  4AYB F;  4QNL A;  2F77 X;  1ZXI A;  4FZN A;  5J2H A;  3OHA A;  2FJ6 A;  4MEX A;  4QZB A;  2BR0 A;  2F2A B;  4BJQ A;  1FFV A;  4C7Z A;  5KG4 A;  3PW4 A;  1ZQR A;  2KG5 A;  4K4G A;  5KAF U;  3PX4 A;  1FIQ A;  1NKC A;  3U26 A;  4YMM A;  4RQ3 A;  2DPI A;  4XUS A;  3EPG A;  3E58 A;  1X6J A;  4CNQ A;  2F3N A;  1KBU A;  2KIW A;  3ED5 A;  2UVU A;  4OJO A;  2DQN B;  4NLG A;  3ONN A;  3JPN A;  2WF8 A;  2HHV A;  1CI4 A;  2PFQ A;  3V7J A;  1ZQ1 C;  4YXM A;  4Y2V A;  3NVY A;  3GIK A;  9ICH A;  4M0A A;  3MGH A;  4F4Y A;  2WB1 C;  3WK8 A;  1LVH A;  1NK4 A;  4JK1 A;  4LVS A;  4Y2U A;  1X9M A;  1RQN A;  2ES6 A;  3QYP A;  5DGA A;  1A6S A;  1LB2 B;  4FS1 A;  4YXJ A;  2G5I B;  2C2E A;  5DB8 A;  1D8B A;  1ZQO A;  3RJJ A;  3DEE A;  5DGB A;  2JRZ A;  3ETL A;  4DS5 A;  3HRD D;  3Q8Q B;  1Z1B A;  5ALQ A;  1F44 A;  3O0F A;  4DL5 A;  3QU5 A;  8ICJ A;  4OJ6 A;  1SZP A;  1DOQ A;  2FPM A;  3PSP A;  4BWJ A;  5KFZ A;  4TQS A;  1SB3 C;  4ECT A;  4QZD A;  5TIS U;  5BOM A;  4B9M A;  1HUO A;  4I2C A;  4GC7 A;  3ZI4 A;  1L7M A;  1TE2 A;  2C28 A;  2MA1 A;  2P35 A;  3C23 A;  7ICI A;  1XNS A;  8ICX A;  4DOA A;  2VA3 A;  8ICW A;  1ZQC A;  4HAI A;  5FP0 A;  1S10 A;  4UAT A;  5KFT A;  1ZD3 A;  2JGA A;  2QB1 A;  2ZUC A;  1ZQG A;  2GOL A;  8ICP A;  3JPS A;  4F5P A;  4YFK A;  1XC9 A;  4J9O A;  1NZB A;  2OCE A;  2XI9 A;  1L8O A;  2VAN A;  3NUQ A;  4MHV A;  2KOB A;  1ARO P;  3VCB A;  3RAX A;  4DFK A;  5AKE A;  3MR2 A;  4EBD A;  1MSW D;  4KLQ A;  4DL6 A;  1A0P A;  2RDI A;  1X9S A;  3MC1 A;  4P2H A;  5JU5 A;  4DSE A;  2BCQ A;  1IG6 A;  5J8Y C;  1O03 A;  3FM9 A;  5KL1 B;  1K1Q A;  2W9B A;  5AKL A;  1QSS A;  2O6K A;  5JRT A;  3M8R A;  3T3F A;  1YZ7 A;  2EAP A;  5KFL A;  1V85 A;  2BKE A;  2AGO A;  3QEB Z;  3ZD9 A;  5KFI A;  7ICO A;  2J6U A;  2Y1J A;  4QZI A;  3L4P A;  2XGQ A;  8ICH A;  2HI0 A;  2AXT U;  1XSP A;  2KIV A;  9ICG A;  3RTV A;  4US8 A;  9ICL A;  3MR5 A;  1T3Q A;  4EYH B;  2YY6 A;  3CW2 C;  2HHW A;  1ED1 A;  2E5S A;  4KX5 A;  4KLU A;  4DFM A;  2WB1 F;  4YD1 A;  2HHX A;  3PO5 A;  7ICR A;  4IR1 A;  4FO6 A;  2IHM A;  4PH5 A;  2J6S A;  4I2E A;  3LVV A;  4BXO B;  4EEN A;  3THV A;  1IXR A;  4LZD A;  2BHN A;  2K4I A;  3PVX A;  4F2S A;  5IIK A;  4K4I A;  4NV0 A;  8ICN A;  2R8H A;  3UMG A;  3LK9 A;  1S0M A;  2JR5 A;  4EX7 A;  4KLF A;  2LYA A;  1QQ7 A;  3TQ1 A;  1XSN A;  2F1I A;  4CF5 A;  5KL8 B;  4DLG A;  1QH9 A;  4NJ8 A;  4Z6E A;  3RJG A;  5DBC A;  4O3R A;  2JEF A;  2K8B B;  2XC9 A;  1KSP A;  4NM1 A;  5IIJ A;  1TFR A;  4OCZ A;  3H0M B;  3QUT A;  5ALZ A;  4F4K A;  2KP7 A;  8ICC A;  1N5W A;  1NJW A;  4KLT A;  4IQT A;  9ICN A;  2XCA A;  4YN4 A;  1L3U A;  4BXO A;  1NKE A;  1SXD A;  2GH1 A;  4KLO A;  4Q8F A;  5CP2 A;  4DL7 A;  4CF4 A;  5GTH U;  3ZDB A;  5J0O A;  3PR4 A;  8ICT A;  1SWW A;  2LI6 A;  3C1Z A;  5KT3 A;  3Q8R B;  4DCC A;  5KTQ A;  4F4W A;  4K4H A;  2L5Y A;  4UB6 U;  5EOZ A;  3EWA A;  4FZL A;  4F91 B;  2R8I A;  2P66 A;  2ZIX B;  4RQ5 A;  3QUC A;  5J0R A;  3IP4 B;  9ICE A;  4ZOH C;  5AKK A;  5F3X B;  5ALJ A;  1HJP A;  4F72 A;  1XU4 A;  4F5O A;  2FLP A;  5J0X A;  4PZO A;  4RNN A;  3NS1 A;  3T5K A;  3EW9 A;  1NJX A;  1Q46 A;  5J0W A;  1JI7 A;  2MRL A;  4DEZ A;  4E0D A;  3KBB A;  2I9G A;  4I2A A;  3AL0 B;  7ICG A;  1DGS A;  2G0A A;  2K4H A;  2OXO A;  1K5O A;  4B9T A;  3OHB A;  4LJX A;  2VJ4 A;  5AKJ A;  3MDA A;  1QSL A;  5F9N A;  4B6J A;  1RZT A;  4RUA A;  3SV4 A;  4I2H A;  4P4O A;  4P0Q B;  4QW9 A;  4R66 A;  1BPD A;  1SV0 A;  2AGQ A;  4IL6 U;  3BZK A;  2RHF A;  4ECW A;  5DLG A;  5L1J A;  2ZIX A;  2ZTE A;  5KG5 A;  2DL0 A;  1C7Y A;  1XSL A;  3RR8 A;  4ED6 A;  2B6G A;  3QX7 A;  2BPG A;  5J2G A;  3RB6 A;  2J6T A;  4KLE A;  2CXY A;  2A1J B;  2DKZ A;  3TAD A;  3SMV A;  2ZJ8 A;  2K8C B;  2NRV A;  4KTQ A;  4DQI A;  4GXK A;  1KFD A;  2LHT A;  2E8O A;  3HX0 A;  2F8L A;  1WYG A;  3IG8 A;  2P6U A;  3C5G A;  4ECZ A;  2ESE A;  2AU0 A;  2F1J A;  1VLB A;  2DFL A;  4NY8 A;  4P4M A;  3SZ2 A;  3HJE A;  3N97 B;  5ALT A;  1ZQV A;  5KG3 A;  1FO4 A;  1S76 D;  2EZY A;  3D2S A;  1PVP A;  2K4P A;  4P0Q A;  1N60 A;  3NVV A;  3MR3 A;  3OSP A;  4DOB A;  2I5H A;  5AIA A;  3V6K A;  2A19 A;  5KFK A;  4G9B A;  5J2C A;  4O3O A;  1Z00 B;  4Q44 A;  5ALW A;  1AQ6 A;  4IRK A;  1MQ3 A;  5KG7 A;  2FI1 A;  3FDS A;  3MGV A;  2HOF A;  3QXG A;  3QNM A;  2H3F A;  3Q8P B;  4EEY A;  1ZQE A;  3MBY A;  2QB0 B;  1UPH A;  2FE9 A;  2NO5 A;  4UB1 A;  1KN5 A;  7ICQ A;  2QLT A;  2KKV A;  4GIB A;  1ZQL A;  2M9N A;  3R9K A;  3C28 A;  3RRH A;  4UW9 A;  2G5H B;  3C5F A;  4C7Y A;  5F9L A;  3HKZ C;  3RJK A;  2LM4 A;  5KFJ A;  4J03 A;  1SZH A;  2KZZ A;  2HW3 A;  5C5J A;  5CJ7 A;  1OXJ A;  5ALR A;  4C80 A;  4YCX A;  2XY5 A;  3BQ7 A;  1ZOL A;  4Y2T A;  4Q43 A;  8ICA A;  4YR0 A;  3PW2 A;  3ISD A;  3WKD A;  4UAW A;  3BQ0 A;  4EBE A;  2ISO A;  1X9X A;  2N1R A;  4O5K A;  1JUD A;  3EPI A;  1UT8 A;  3TAQ A;  1Z00 A;  4JMU A;  1J2N A;  3F2D A;  1JX4 A;  2QAR B;  3NVW A;  4QWD A;  2P6R A;  2HCF A;  2G06 A;  3PSI A;  1IM4 A;  4ELU A;  4M04 A;  3WK7 A;  3B0Y A;  1D8Y A;  3H40 A;  3RB3 A;  4ELV A;  4TUR A;  2BGW A;  4JB3 A;  4FE3 A;  2W04 A;  3MR6 A;  3PY8 A;  2IOF K;  2QB0 A;  3CP8 A;  1KQQ A;  3H0R B;  5DG9 A;  4DFP A;  2KSO B;  5ALX A;  4UB5 A;  4ED2 A;  4QZE A;  2YML A;  4I2D A;  1JIH A;  2D3D A;  3UXO A;  1KLN A;  4JWN A;  4ECQ A;  5L1M A;  1Q3V A;  1S5L U;  3OTQ A;  2QKQ A;  4FS2 A;  5EWF A;  2W8K A;  5AI5 A;  4DSJ A;  3UQ2 A;  2GWS A;  5EE9 A;  5TZV A;  5J2I A;  4DF8 A;  3OPX A;  3LYS A;  4OJL A;  3KOO A;  3GFK B;  4NLK A;  4JUZ A;  4BUG A;  1COO A;  4KLS A;  4UAZ A;  4ECV A;  2FDR A;  2W9A A;  2BDU A;  2QAR A;  4U7C A;  1B43 A;  4NLZ A;  5AM4 A;  3ISB A;  1IIP A;  1U4B A;  3FC4 A;  2BPC A;  1L5U A;  2H3V A;  5KG0 A;  1ZQB A;  2K8A A;  1ZQS A;  4U6P A;  5KNI A;  3Q8S B;  2E1F A;  5T14 A;  2KFN A;  4KLJ A;  1IV8 A;  1RPL A;  2I1Q A;  2KSO A;  4ECU A;  8ICG A;  4QIW C;  1ZQX A;  2KKP A;  3QU7 A;  2BQ3 A;  4FBU A;  3ICX A;  9ICU A;  2JMG A;  3GDX A;  4QZ8 A;  4A8E A;  4YR3 A;  5AI4 A;  3MFH A;  5ALS A;  4C4S A;  3HKZ F;  2CPR A;  1ZQQ A;  1ZQJ A;  2ZIU B;  5AK4 A;  2PFN A;  3SAH A;  3IV6 A;  3EUB 2;  4EBC A;  1KFT A;  5HR6 A;  1ZRN A;  2HMX A;  3NRZ A;  4B9U A;  1ZQP A;  2HOI A;  2ZJ5 A;  4NLC A;  3M7D A;  4J9S A;  5J0S A;  2WF5 A;  4RUC A;  1D9D A;  2IHN A;  1SV0 C;  2YTU A;  2K89 A;  5C0Y A;  2B21 A;  2HDO A;  5KFU A;  4DS4 A;  5CEH A;  3BS7 A;  1ZQM A;  3WK9 A;  2BCR A;  7ICL A;  4MFA A;  3QZ7 A;  3B9J A;  1Z19 A;  5ALD A;  5HHI A;  4QZC A;  2NRX A;  4F4X A;  2CN1 A;  3JPP A;  4JV2 A;  5EWE A;  2ASL A;  3TAD C;  4RQ4 A;  1MA7 A;  3T5J A;  2Z7J A;  2WHE A;  1UA0 A;  8ICZ A;  1ZD4 A;  3TI0 A;  7ICF A;  2W9B B;  2HBL A;  3AU6 A;  3RR7 A;  3LWL A;  1TK0 A;  1TAM A;  5KFC A;  3M6K A;  2ZIU A;  3N7S C;  2KTQ A;  4UAU A;  2KHQ A;  5J2K A;  4Y2Q A;  5KFH A;  3RJE A;  1XO0 A;  4NM2 A;  3LWM A;  5ALK A; 
#chains in the Genus database with same CATH homology
 2DGZ A;  2K8A A;  2G08 A;  4C0Z A;  2KOB A;  3ALR A;  3C28 A;  4CGZ A;  3VCB A;  4NLB A;  4U6P A;  2ZIX A;  1PVR A;  2E1F A;  5T14 A;  2G5H B;  3K1Z A;  1L6N A;  2Y0S C;  3HKZ C;  4ICA A;  1YT3 A;  4KMO B;  4OO1 J;  4PL2 A;  2XVT A;  2KJ8 A;  2YX8 A;  3IG5 A;  3SQI A;  1SZH A;  1A0P A;  2OYY A;  2VKQ A;  2ZIW A;  4P0P B;  2KJ5 A;  4QIW C;  5KL1 B;  2KKP A;  3D2N A;  4FZM A;  3H0L B;  2LBO A;  3LVW A;  3NRW A;  4PL1 A;  3F5A A;  3ICX A;  3SMV A;  2JMG A;  3F5E A;  1KBU A;  2KIW A;  2GH1 A;  2H3I A;  2K8C B;  2OM6 A;  2ZG6 A;  1GO3 F;  2N1R A;  4OJO A;  4A8E A;  2DQN B;  3RF9 A;  3SAG A;  3ONN A;  5A0L A;  1HEK A;  4JMU A;  3F2D A;  1ZQ1 C;  2H3Q A;  2K4E A;  2W03 A;  1DRG A;  2Y0S F;  3HKZ F;  2CPR A;  4OJ5 A;  2LHT A;  1PVQ A;  3CRX A;  2F8L A;  2WB1 C;  2WAQ C;  3GZF A;  2W7P A;  2KVC A;  1HIW A;  2KEY A;  3IG8 A;  2ZIU B;  3F53 A;  2G06 A;  3PSI A;  3IN5 A;  2YB1 A;  2KJ9 A;  3SAH A;  3E0F A;  4QIW F;  1URJ A;  2KHV A;  2JHD A;  5HR6 A;  1A6S A;  2HBK A;  4IC9 A;  2LYB A;  2JH7 A;  2HMX A;  4ACO A;  2JH1 A;  2G5I B;  4FZL A;  2HOI A;  4FE3 A;  3RFA A;  2XIC A;  2W04 A;  3SAF A;  1D8B A;  1P7D A;  2ZIX B;  1WUD A;  3DEE A;  3CP8 A;  1ECW A;  3M7D A;  4NLC A;  2CRX A;  3D2S A;  1ED1 A;  2XID A;  1PVP A;  3IP4 B;  3H0R B;  2LKY A;  1Z1B A;  2E5S A;  4KX5 A;  4P0Q A;  2ZIW B;  1F44 A;  3VC8 A;  3O0F A;  2F76 X;  2WB1 F;  2ZIV A;  2WAQ F;  1CRX A;  3AQE A;  2K89 A;  5C0Y A;  2VJ5 A;  2R18 A;  2RP5 A;  4QJF B;  2ZXH A;  2PMZ C;  3N7P D;  3F2B A;  4OJ6 A;  2G07 A;  3LVV A;  2E1E A;  3PSP A;  2A3V A;  2K4I A;  1Q3V A;  3PSF A;  2ZXI A;  1Q3U A;  2HBM A;  2Q4T A;  4NV0 A;  3PZP A;  3AQF A;  3M6Z A;  4KX3 A;  2MRL A;  4AYB C;  2H3Z A;  1Z19 A;  3KFU F;  2HBJ A;  2KD1 A;  5CRX A;  4GFJ A;  2KV2 A;  5HR7 A;  3CYM A;  4P0P A;  2CN1 A;  4O3M A;  3OPX A;  2MA1 A;  3PST A;  2KIC A;  3AL0 B;  2G09 A;  2LYA A;  3GU3 A;  3LYS A;  4OJL A;  2VIX A;  3MGV A;  1XNS A;  2HOF A;  3KZX A;  4BUG A;  1MA7 A;  4NWI A;  2H3F A;  2DF4 B;  2G0A A;  2K4H A;  2PMZ F;  2Z7J A;  2W7O A;  2OXO A;  5KL8 B;  4BX9 C;  4WJ3 B;  4OJP A;  1OUQ A;  2OH2 A;  2M0N A;  2HBL A;  3T79 A;  2BDU A;  4U7C A;  2VJ4 A;  3D2Q A;  4AYB F;  4QNL A;  1TAM A;  1UPH A;  3F2C A;  2F77 X;  2JGA A;  3M6K A;  2RRD A;  2GOL A;  2YB4 A;  4FZN A;  1IIP A;  2ZIU A;  4CRX A;  3C29 A;  3N7S C;  2K8B B;  2HOQ A;  4P0Q B;  2D6F C;  2KHQ A;  1XO0 A;  2ZIV B;  1NZB A;  3H0M B;  3L3F X;  1T94 A;  3N7R C;  2KKV A;  2F2A B;  2H3V A;  2NV3 A;  2XI9 A;  2RHF A;  3NUQ A;  4BJQ A;  4CDG A;  2KNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...