3VCBA

C425s mutant of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vcbA00
3VCBA 3VC8A 3GZFA
chains in the Genus database with same CATH superfamily
2BCRA 5F9LA 3KFUF 2KEYA 4KLTA 1XS9D 2KFZA 2G0AA 4LJXA 2WF5A 3V7KA 3KBBA 3DDHA 3UXNA 5ALWA 4F5RA 4TURA 1Z1VA 5ALTA 2W55A 1PVQA 3M1YA 4DL7A 2HVIA 4YMOA 2LYBA 4IQVA 1QQ5A 1SV0C 4O3NA 3KKAC 2LM1A 5EWGA 2W9CB 2DFLA 4JV1A 2MRLA 2JH1A 5KFZA 4DL6A 3NRWA 1TVAA 4BXOA 1SWVA 3MGVA 4DQQA 5DGBA 1ZQWA 2E3TA 5KFRA 4FS2A 3OHAA 2M9NA 4NL9A 2YMLA 2AGPA 3T5JA 2ZJ8A 2NV3A 7ICEA 4RT3A 2GLEA 1XNSA 1QSYA 3KZIU 3VCBA 2YMPA 2HCFA 3RJFA 4RPYA 1ZQGA 2HOFA 3D2SA 1KRPA 2ZIXB 3L4PA 2VA8A 3PSTA 2WHEA 2FPKA 4Z6CA 4C80A 3UXPA 5KFOA 5G5HA 5J0RA 4OO1J 2OCEA 3KHHA 5AM3A 1X6JA 4Y2RA 1DRGA 5DB8A 1N62A 7ICSA 2ESEA 3GQCA 3WK8A 4F4WA 1JIHA 7ICIA 4DFDA 4ECZA 3IM1A 1FIQA 5CR0A 4NLZA 5B5EU 3JPSA 2BHNA 4UB2A 3SV3A 4NY8A 4YQWA 9ICSA 3QYPA 5DDYA 5ALNA 2IBKA 8ICNA 4RQ7A 2KFNA 3PNCA 4DSIA 4R8UA 4UB8U 4RT2A 3N28A 3ZDAA 4UBBA 2EDUA 3BS5B 4ZH4A 2K4PA 4DLEA 1L7OA 4CE6A 2KKPA 4LZDA 2H3QA 3NASA 5KFEA 1RXVA 1S0NA 1HUOA 2KJ5A 3M6ZA 2GOLA 4JV0A 4EBCA 2BPCA 2YTUA 1ZQVA 5AI5A 8ICPA 4DFKA 4MFCA 3KHLA 1KFSA 2P6UA 2DKZA 1NJYA 2KICA 1PVPA 3QEAZ 4O3SA 1QSSA 2EZYA 3TAQA 3UXOA 5KFHA 2F3NA 5ALJA 1KTQA 2JZBB 5L1MA 3M9MB 3ISBA 1S77D 2AGQA 1BVSA 3M9NB 1LV5A 5J0PA 1PZNA 5DB9A 2V9WA 4J9LA 1BPDA 3DEEA 4NLBA 4B9VA 3RR7A 5L1JA 1X42A 4XA5A 4C7ZA 1QSLA 4J9QA 1T3QA 9ICRA 3RBEA 5J0YA 1Q3VA 1SL2A 3PW0A 4IRDA 3KZXA 1LKYB 4EELA 1DK3A 4RQ8A 9ICTA 2QLTA 4KLEA 3U26A 4P0PA 5KFWA 5DQIA 1X6IA 2P66A 2W43A 4DQPA 4Y2VA 2OXOA 1D8YA 2W9AA 2UVWA 3MR6A 2ZUCA 2JH7A 4ACOA 4ELUA 4PGXA 5DG7A 1NK4A 3AMZA 4KX5A 1NJXA 2EAOA 5KFSA 3PY8A 4E0DA 3PZPA 5EOZA 3NGDA 9ICOA 2LKYA 3F5AA 3MC1A 3QZ7A 4Q44A 5CEHA 4QNLA 1LB2B 3PW2A 5AM2A 4J9PA 2JEIA 5J2CA 5ALQA 2EAPA 4F4XA 1XWLA 3ETRA 5B66U 1COOA 1CRXA 4M9NA 2BKEA 5AICA 5HHIA 3C29A 2IHMA 3GIIA 4Y2UA 2D3DA 5DB7A 1ZXIA 4ECSA 9ICHA 3T79A 3UQ0A 1HJPA 3IHQB 4UB3A 4O3QA 1RPLA 3I1YA 2KE7A 5AIBA 2KIVA 4RQ6A 1BNPA 2F1JA 4UB6U 9ICNA 3WK5A 3RRHA 3MBYA 5J2FA 2HBKA 1WUDA 4QZDA 1RQLA 5H2FU 5KFBA 1BPYA 4QWBA 3D2NA 3PSFA 4ECUA 1COKA 2BPGA 1ZQDA 2QB0A 4TUQA 1Q8KA 1U45A 4Q43A 2JHDA 4IC9A 8ICWA 1ZQHA 4JV2A 2F8KA 2CRXA 5L1LA 4LVSA 4QZCA 4CF5A 3EZ5A 7ICFA 4EYHB 5KFYA 4JUZA 4ZOHC 4GXKA 3KTQA 1L7NA 3GILA 3I76A 1YT3A 4B9MA 3EPGA 3T3FA 4PHDA 4QZHA 3H8WA 3M8RA 5KT7A 5KAFU 3F2BA 3F53A 4FBUA 4K4HA 2W7PA 1SL1A 1SXDA 1FO4A 1L7PA 4O3PA 4FZLA 4YXMA 3O0FA 3UMBA 2JEJA 2PFOA 4J9RA 2A1JB 3N7PD 4EENA 1K1SA 2HBMA 2ALZA 3PR4A 3QU7A 1PK1A 4UARA 1VDVA 4M9GA 8ICXA 9ICIA 1TAQA 4C4SA 3M9OB 4GXIA 3AUOA 1EXNA 2W3RA 3N97B 4NL9C 4BJQA 2K60A 4QZ9A 1TFRA 2K8BB 2ZJ5A 8ICTA 7ICQA 3QU9A 3NRZA 5D49A 4F72A 4ECRA 4J03A 4F92B 2D8CA 4PZOA 4UB5A 5AIAA 4M9JA 4K4IA 2IHNA 3QUCA 4ED3A 3PW5A 1ZQNA 2RHFA 5HMLA 1BPBA 3RJJA 7ICUA 1IXRA 3F5EA 3QU2A 4B9SA 4QWCA 2ODGA 5J0UA 3S6JA 4A8EA 5AM0A 3RB0A 3MFHA 4O3MA 5KFQA 2NRZA 2YMQA 2FI1A 4UB4A 3D6JA 3RFAA 3GDXA 4RNNA 2HHSA 1IG6A 3RBDA 4JWMA 3BQ2A 8ICAA 1TKDA 1N56A 2B0CA 5HP4A 3HKZC 1SWWA 1X66A 2XVTA 4O5KA 4I28A 5AI0A 2LYAA 2ZIVB 1X40A 3H8MA 1MQ3A 2UVVA 1URJA 2P6RA 5IIKA 1N61A 2HVHA 4C8LA 4ECQA 2KZZA 1L5UA 2XCAA 3FAHA 5KFLA 2VA2A 3RJHA 2G07A 2R8KA 4F5PA 2XCPA 4OJOA 3K1ZA 4MFAA 9ICUA 4I2EA 5AKXA 1BPXA 1RM6C 4O3RA 4O3OA 5D4BA 1JRPA 4QZBA 3RAQA 2E1EA 3H8JA 2MA1A 5DDMA 1OW5A 5ALXA 3MR3A 1MA7A 4B9TA 4J9NA 3ISDA 2G06A 1UPHA 4I2CA 1DGSA 3CNHA 3V6HA 4F2RA 4KLIA 2GH1A 1JXLA 4QWEA 3QUTA 4P2HA 1XSLA 5ALLA 2RDIA 3ZDCA 5EWFA 2NRXA 3JPOA 5KFNA 1KN5A 8ICLA 4DL5A 2YX8A 2KIWA 1PUZA 4G9BA 1KFTA 4I29A 3FYHA 2NRWA 2XICA 4YR0A 3TACB 1ZJNA 4I2JA 3J81j 3SQIA 1C7YA 4DSKA 2NYVA 9ICMA 5CB1A 1SB3C 4X5VA 2J6SA 3AL0B 4F4YA 4DOBA 2ASJA 3RR8A 4DSFA 3UMGA 2IA6A 5J0TA 4JB3A 5ALUA 2H3VA 4R63A 2YB4A 4RQMA 3WKEA 3CW2C 4GXJA 5C0YA 3TKAA 3V72A 9ICKA 3RAXA 5KL8B 2ASDA 1D8BA 5KFDA 1F0MA 3RH5A 1T94A 3JPPA 2AHOB 4I2BA 5ALHA 3G6YA 1N63A 3H0LB 2QKQA 3HT3A 2VANA 2DUYA 4PL1A 2KHVA 5J8YA 5EWEA 2Y0SC 5CRXA 9ICQA 2NRTA 3AN1A 5JU5A 3ZDBA 3PSIA 1SKSA 4QZIA 2CXYA 2AJQA 1ZQJA 4ECXA 3PO5A 1KLNA 1M6YA 2PI4A 3OGUA 5AK3A 5J2AA 5F9NA 4QIWC 2FPMA 2ZIXA 3EYZA 5DG8A 2VJ4A 4M0AA 5L9XA 5GTIU 1X9XA 3V7JA 1QQ6A 4RQ5A 3SAGA 1X9MA 2FLLA 4J9MA 3BJYA 1P7DA 1ZQQA 9ICAA 1L3TA 7ICJA 5AKHA 3RJKA 1U47A 5AKJA 2DKXA 2CN1A 1ZETA 4DEZA 2C2DA 4RQ0A 1U4BA 1ECWA 1L6NA 4ECWA 3OPXA 1Z00B 1KFDA 5J0SA 1IV8A 5ALEA 8ICCA 1KQQA 3JPNA 7ICHA 1SZHA 3JPRA 4O5CA 4UW9A 2DQNB 3OHBA 1UA0A 5KG2A 1O08A 1JN3A 4RU9A 4KX3A 5HHHA 2HOIA 4YMNA 3F2DA 2FE9A 4WJ3B 3TADA 2BCSA 4PL2A 2MSNA 5L1KA 4F5QA 1RZTA 3BS5A 3TFSA 1X2IA 4M9LA 2E5SA 4R65A 3SR6A 2WAQC 4RPXA 1S9FA 1FFUA 3K4GA 5HNKA 3ETLA 4ED6A 2W3SA 2BDPA 4UAZA 2V4QA 1ZQCA 4YN4A 2KHQA 1WG8A 2KK0A 4BXOB 4M47A 5AK6A 5AKYA 1O03A 3RB3A 3WKAA 4UAWA 4XQ8A 2ATLA 7ICMA 5KFPA 5AKLA 2ZTCA 2MAXA 3IG5A 4DSLA 4FZMA 4PHAA 9ICWA 3GU3A 5KFJA 3F2CA 2IMWP 5CJ7A 4EZ6A 9ICLA 4ELVA 2N1RA 3QUBA 1RXWA 4C8KA 4KN4A 3UM9A 1OUQA 5AI6A 2KZMA 3HRDD 2K89A 2Z7JA 5AK4A 2YB1A 4RNOA 5CP2A 7ICTA 4C8MA 2PFNA 1T7PA 5KG5A 1DK2A 5KFVA 1RYUA 2XY5A 4DO9A 7ICLA 3V6KA 4DFJA 3GV8B 2W7OA 2HBLA 4IL6U 1D8LA 1XO1A 4YD2A 2BQUA 1YZ7A 1ZQZA 2LM4A 2VKQA 3B0XA 1ZQOA 3E0FA 5J2BA 1T3NA 1UT8A 4B9LA 4KN7A 4PPXA 4MF2A 2WFAA 4UAYA 2ISPA 3TANA 2K4EA 4DL4A 4KLUA 2FMPA 1JROA 4I2IA 2DBYA 3PX4A 4Q8FA 4DWIA 2R8IA 2E8OA 4J9OA 5JTIA 4RQ4A 4R8UB 4F3OA 1U9LA 3TQ1A 4U7CA 4CCHA 3ZDEA 4JMUA 1CUKA 3HILA 3AM9A 3H8SA 5BOMA 5JUMA 3E2EA 2W9MA 3R9KA 5ALKA 2ZUDA 3KOOA 3KHRA 4DFPA 4Q8EA 5KG4A 1V38A 1SKWA 1SL0A 2LMRA 4J9KA 7ICOA 3SAHA 7ICNA 5CWRA 1TAUA 2H5XA 2WF6A 2RLTA 1B22A 4DL2A 5KFXA 3HW8A 4Y2YA 2HBJA 4Y2SA 1QQ7A 5AKEA 5ALRA 4EZ9A 2ES6A 3PW4A 2KSOB 4YP3A 2IOHA 1IIPA 4F8RA 1WCLA 2XY7A 1CEZA 4RQ2A 8ICIA 4C4RA 3QE9Y 1DXSA 3G6XA 4DQRA 1JALA 2C2RA 1H38A 2OYYA 2ZIWB 3H40A 5EE3A 2ZG6A 3OJUA 3FM9A 3WKBA 4DF8A 2G5IB 2KOBA 3L5KA 5J0QA 1ZQYA 1N5WA 2H3IA 4P0QB 3M8SA 3GFKB 5DLFA 1ZQIA 5ALIA 4AYBF 5DBCA 3B0YA 1A77A 3NVWA 4UAVA 4KLFA 4KITB 2DWQA 3OSPA 2JGAA 1A76A 2FPLA 3EPIA 2E8NA 1ZQXA 5HMMA 3LYSA 4F91B 1Z4OA 2Y9UA 3WKCA 5AK5A 3CRXA 5J8YC 3PO4A 2UVRA 2F77X 1V9PA 3HWTA 1VLBA 3LDAA 1YZ6A 4DFMA 1BGXT 1JX4A 4AYBC 4O9MA 3KD3A 9ICVA 3PV8A 1S97A 2MUTB 4QZEA 2WB1C 1ZQTA 4F93B 5AM5A 1WWUA 3SV4A 4UBCA 1KBUA 2AH5A 8ICGA 4BDPA 4NLCA 2ZUBA 2HOQA 3QUQA 5DBBA 2HHTA 3Q8MA 5KG3A 3Q8RB 2YY6A 2QB0B 8ICHA 1SIJA 2K4IA 2W03A 4R64A 1UA1A 9ICBA 4KLMA 1SZPA 4F50A 2E8PA 2BCQA 4BUGA 4EBEA 2FLPA 5AHXA 1XO0A 5AM1A 4ECTA 3IV6A 4F5OA 3BZCA 1PK3A 4P4MA 4O5EA 5KAIU 3BS7A 1NK0A 4IR1A 8ICJA 5KFGA 3V7LA 4PZNA 5KFFA 2W9BA 2KVSA 2LBOA 3AQFA 4Y2PA 1XSNA 2BQ3A 1S5LU 1NOMA 4Y2XA 1ZQUA 2RP5A 4NXZA 4XRHA 3TADC 5CHGA 4F2SA 2EZZA 2KN7A 2BCVA 4R66A 4OCZA 1VJ5A 4C8NA 1L8LA 4QWAA 3HKZF 4EX6A 3IN5A 3ORYA 4QWDA 4RUCA 4EBDA 4FO6A 4DSJA 3Q8KA 4PGQA 1GO3F 4QW8A 1KEJA 1BPEA 3PMNA 3ISCA 1J2NA 2LHTA 4YG2A 4F4KA 1NK9A 3PX6A 1ZJMA 2XY6A 5DQGA 2LI6A 3QU4A 3HPOA 3AEVA 7ICPA 2MU2A 3ZD9A 4CDGA 3MABA 1UT5A 4KLDA 5KFCA 2R18A 5DBAA 2M0NA 1FEZA 1ZQBA 3MDCA 5HR7A 1K5OA 2JEGA 3A0HU 4ED1A 3ALRA 4ED2A 2FMQA 1ZQMA 1ZD3A 1V97A 5EE9A 5HR6A 2O6KA 5DKWA 3RB6A 2XC9A 4Y2TA 3GIKA 2QARA 3VC8A 4C0ZA 3RJIA 2B6GA 3Q8PB 4M6WA 1LVHA 2W54A 2JR5A 4NWIA 1NZPA 3TARA 2ZIUB 8ICEA 4QZFA 2RQ5A 1TE2A 2BQRA 4QZGA 2Y1IA 4GFJA 1JI7A 1BPZA 2NO5A 4QJFB 1U48A 2VIXA 1KDHA 2F2AB 2FMSA 4MHVA 5KG6A 1QH9A 4C7YA 4IQWA 1NNLA 5IIJA 3SI8A 2R8HA 1S10A 2PKEA 2HHQA 2W8LA 2BDUA 2WF8A 1ED1A 4I2HA 2R8JA 1NK8A 4AP9A 4F5NA 7ICVA 3EW9A 3Q8LA 5EE0A 4NLKA 3GIMA 2Y0SF 5J2IA 1D9FA 4PHEA 2W9CA 2F44A 2KP7A 4NLGA 2DPIA 1MSWD 3SZ2A 1KL9A 5J2GA 2K8CB 2I9GA 3NS1A 1WWVA 4IRKA 3GV7B 4I2DA 2FDRA 2L5YA 4QIWF 5ALDA 3RJGA 3C28A 1ZQPA 3AU6A 4Z6FA 4Z6EA 3OJSA 3BQTA 1D9DA 2Y9TA 1S0MA 4DL3A 8ICBA 4OD0A 1Z00A 3L3FX 2NO4A 3SEIA 2ZTDA 3NVYA 4G3IA 2F76X 1TK8A 2JEFA 1PVRA 8ICMA 5TZVA 5J2DA 4KMOB 4BGDA 5DLGA 5J2JA 1HUZA 4XUSA 8ICVA 3WK7A 4IQUA 4KLGA 4MEYA 2AXTU 4OJ5A 1NK6A 3BQ7A 8ICUA 2F1HA 4YMMA 3FC4A 1N5XA 3SD7A 4P4PA 1U49A 1AROP 2XO7A 5E79U 3TAPA 1B4FA 2C22A 3C21A 4Y2JA 4M2YA 1S0OA 3WK4A 4KLQA 5KFKA 4I2AA 3G6VA 2DGZA 2DF4B 4KLLA 2VJ5A 1ZQLA 4IQTA 1XSPA 4IR9A 5JRTA 5J2EA 5AM4A 2OM6A 3C2MA 1JXEA 4US8A 2V4RA 1J97A 2BCUA 3NVVA 1ZQSA 2WAQF 3BQ1A 3RH6A 3K75D 1WCNA 3TI0A 3MFIA 4EYIB 2KD1A 1ZQ1C 4KMUA 9ICJA 3WK9A 4YFKA 1B0XA 5DGAA 5KG0A 5AI9A 5KFMA 1L8OA 2BZFA 2I5HA 1S8OA 4B9NA 3MGIA 1JUDA 5AI4A 4RQ1A 2I1QA 9ICGA 1A0PA 4MF8A 2HSZA 2EAMA 1ZQRA 4QZAA 3LVVA 2W11A 3QNMA 5BOLA 2BGWA 5F3XB 2ZXHA 3UQ2A 4CGZA 1DGJA 4UATA 4GC6A 3N7SC 3K1RB 2JZBA 4EEYA 2F8LA 1SV4A 2LPEA 1KSPA 4B6JA 1ZQFA 1UQVA 4F71A 5J0WA 4RNMA 1ZQEA 1S0VA 3IRUA 4ED8A 3JPTA 5KT4A 4FS1A 1TK5A 2JXJA 2HHUA 1Z19A 5BPCA 9ICPA 2RRDA 2KTQA 1LKYA 7ICKA 5T14A 2K4HA 3KHGA 3DV9A 4OJPA 2YN4A 5L1IA 4DOAA 4I2FA 4YCXA 3RJEA 8ICYA 3EUB2 4YVZA 2DPJA 1A6SA 3QXGA 3UMCA 3MR5A 4M9HA 4EEKA 4UAUA 1N2XA 7ICGA 3H4BA 1K1QA 3N4MB 1QLNA 2XGQA 4FBTA 4KLHA 2AQ4A 1T4GA 5DQHA 2H3ZA 2PMZF 3C5GA 5A0LA 4B9UA 5J2KA 1NK5A 2KMDA 5J0OA 5J2HA 3RB4A 5KT5A 5KFIA 4DCCA 3MR2A 1UCVA 1Z4NA 2ZJAA 4O0IA 2HDOA 1IM4A 3M6KA 5KT6A 4DF4A 1RDFA 4RQNA 2HHWA 2UVUA 3PSPA 4KTQA 4DOCA 2YMMA 2KSOA 1NKCA 2PMZC 5ALMA 3AU2A 2G08A 5J29A 1JMSA 4CRXA 2A1AA 2G5HB 1SGGA 1AQ6A 5CA7A 5KG1A 3PVXA 2XIDA 5ALYA 3H4DA 8ICZA 2AGOA 1J2MA 5IILA 2KG5A 3SMVA 3I28A 9ICFA 4RUAA 2ZIWA 8ICRA 1CI4A 4CF4A 4I27A 5DG9A 4LZGA 8ICOA 3CP8A 2LYHA 2FJ6A 1FFVA 8ICQA 3NTUA 4P0QA 5J0XA 2P35A 2JRZA 1NKEA 1DOQA 2W04A 2AQ0A 3GV5B 4UQGA 4YR3A 4JWNA 2XGPA 1B43A 2JV3A 2H3FA 3RF9A 5GTHU 5IIOA 2HHVA 3LWMA 2KJ9A 4P0PB 2I6XA 1L7MA 3WU2U 4US9A 2EANA 1ZYQA 3H7IA 4FFDA 3PX0A 3T5KA 2B21A 4HAIA 2MUTA 1Z1BA 7ICRA 3GZFA 1NZBA 3BZKA 4MEXA 5FP0A 3C1ZA 3ZD8A 2CPRA 5KFTA 1SV0A 2A1JA 3KKAA 4I2GA 8ICSA 4TQSA 2NRVA 5ALSA 3OTQA 3PMLA 3E58A 4NLNA 4DQIA 3SAFA 4JK1A 4GLXA 3RH4A 2XI9A 2WB1F 4KLSA 3LWLA 3H0MB 3PR5B 2K8AA 1NI3A 1RG6A 1SXEA 1MN8A 3IDWA 2WTFA 1ZQAA 1XC9A 2EH9A 5IIIA 4PH5A 2A3VA 4U6PA 4EX7A 4Q45A 4C8OA 4ICAA 2E1FA 3BDPA 5ALPA 4OJLA 1MC8A 4DLGA 3EWAA 1L3VA 4BX9C 3QU5A 3TFRA 1NJWA 1V85A 5AKKA 3ICXA 4YXJA 4KLJA 3THVA 2FLNA 1OXJA 2RDJA 1KKXA 1QCKA 1X9SA 5KG7A 4NV0A 3C23A 4M04A 3NUQA 2A19A 3Q8SB 4FZNA 1HIWA 5ALVA 3H0RB 5ALGA 2JMGA 2C2EA 2PFPA 1KW4A 3C1YA 2ASLA 4UASA 4HYKA 3GIJA 2DL0A 3M7DA 4OJ6A 2AU0A 4YR2A 5KTQA 2BPFA 1RYSA 1ZRNA 1L3UA 3ZI4A 1Y88A 1ZQKA 5AKGA 3FDSA 1ZRMA 2R8GA 4K4GA 4NM2A 3B9JA 2ZIVA 1Q3UA 1QTMA 9ICCA 3IP4B 4IS7A 3OSNA 3WK6A 1RQNA 2KZ3A 3D2QA 1X9WA 4J9SA 3ZDDA 3SENA 3UPQA 4RZRA 1ZD2P 5KT2A 3Q8QB 8ICKA 3HP6A 2KJ8A 1BNOA 2D6FC 2J6TA 1NK7A 1UHUA 5AI8A 4PHPA 2YQEA 5KT3A 4USAA 2EZXA 1Z3EB 1PK1B 5KFUA 1T8EA 3MGHA 3BQ0A 4ELTA 2PFQA 4NM1A 2F1IA 1C20A 4UB1A 2ZIUA 4TUPA 4DQSA 3CYMA 5ALZA 2J6UA 5G5GA 5KFAA 4IRCA 1NKBA 3LK9A 1TK0A 2KV2A 2QB1A 5ALOA 4ECYA 4TUSA 3LVWA 3IG8A 2KNJA 2W9BB 4ECVA 5ALFA 4CNQA 3SYZA 3A0BU 2WF9A 4PJ0U 2PXIA 2EQYA 3HJEA 1RYRA 4F4ZA 1F5SA 4Z6DA 4BWMA 4TQRA 1ZD4A 5IINA 2ISOA 4CF3A 4DS5A 4RQ3A 1ZOLA 1NJZA 4NJ8A 3T5HA 1S76D 2HI0A 3C5FA 1Q46A 4RPZA 9ICEA 2KVCA 2HMXA 5KNIA 1N48A 4FE3A 3C2LA 1MQ2A 3N7RC 2HW3A 1SKRA 5EE1A 1HEKA 8ICFA 2GO7A 2C28A 3QZ8A 5KL1B 4Y2QA 3HX0A 3NVZA 2BR0A 9ICXA 3ONNA 3V6JA 3QEBZ 3RRGA 3C2KA 4QZ8A 1N60A 1L3SA 4GIBA 4P4OA 1WYGA 4BWJA 5AKZA 5AKIA 2OH2A 2ZXIA 3QX7A 2PI5A 2VA3A 2ZTEA 4ED7A 5DB6A 2Q0ZX 4GC7A 2Q4TA 2IOFK 2KKVA 3WKDA 2W8KA 3T5LA 2IOFA 2QARB 4YD1A 4M6WB 3RTVA 4DS4A 4PGYA 4KLOA 1ZD5A 4QW9A 2Y1JA 4ED0A 5IIMA 5K4LA 3MDAA 2OHFA 1TAMA 1F44A 4DSEA 2G09A 2E8MA 3ED5A 2GWSA 3JPQA 1TV9A 4MFFA 2WF7A 3AQEA 5TISU 2HHXA 1XU4A 5C5JA 5D46A 4C4TA 2OEHA 2OWOA 3PW7A
chains in the Genus database with same CATH topology
4PL2A 3AL0B 2F2AB 2H3FA 3M7DA 3F53A 4OJ6A 3RF9A 2JH7A 2KEYA 2H3IA 3KFUF 4P0QB 4ACOA 2W7PA 1A6SA 2H3VA 4KX5A 2KJ9A 4AYBF 3HKZC 2E5SA 2XVTA 2G0AA 4FZLA 2YB4A 3HKZF 4P0PB 2KVCA 2OM6A 2HMXA 3PZPA 2LKYA 4U7CA 5C0YA 3F5AA 4FE3A 3IN5A 2WAQC 3O0FA 5KL8B 5T14A 1D8BA 2LYAA 2WAQF 2ZIVB 2JGAA 3N7RC 1T94A 4JMUA 1HEKA 4QNLA 1PVQA 2BDUA 3H0LB 1Z1BA 2H3ZA 3GZFA 2PMZF 3N7PD 5KL1B 1ED1A 1URJA 5A0LA 3LYSA 1NZBA 2LYBA 2ZIVA 1GO3F 2HBMA 1Q3UA 2KD1A 1ZQ1C 3CRXA 4PL1A 2KHVA 2CPRA 2KHQA 2LHTA 2KKPA 3IP4B 2H3QA 1CRXA 2F77X 2Y0SC 3ONNA 2MRLA 2JH1A 3D2QA 2Y0SF 5CRXA 3C29A 4AYBC 3NRWA 3PSIA 2KJ5A 3M6ZA 2GOLA 3M6KA 4CDGA 3SAFA 2KJ8A 2D6FC 3IG5A 2G07A 3SAHA 3MGVA 4FZMA 3PSPA 2K8CB 2R18A 2WB1C 3T79A 2XI9A 2WB1F 3GU3A 2M0NA 4BJQA 3H0MB 3F2DA 3F2CA 2PMZC 5HR7A 4OJOA 2K8BB 2K8AA 2KICA 1A0PA 3K1ZA 4QIWC 1PVPA 1KBUA 2G08A 4QIWF 2ZIXA 3C28A 4NLCA 2OH2A 3LVVA 2N1RA 4CRXA 2HOQA 3ALRA 2A3VA 2VJ4A 4U6PA 2G5HB 2ZXIA 2NV3A 1OUQA 1XNSA 2K89A 2Z7JA 2E1FA 3L3FX 2ZXHA 2HBJA 4ICAA 3VCBA 3SAGA 4OJLA 4CGZA 2E1EA 2YB1A 1P7DA 2HBKA 2MA1A 2Q4TA 2XIDA 1WUDA 2F76X 2RHFA 4BX9C 1MA7A 2K4IA 2KKVA 2W03A 2G06A 1UPHA 2ZIUA 3N7SC 1PVRA 3F5EA 2HOFA 2F8LA 2CN1A 3D2SA 5HR6A 3D2NA 3PSFA 3SMVA 2ZIXB 4KMOB 3CYMA 4BUGA 3DEEA 4NLBA 2ZIWA 1IIPA 3ICXA 3PSTA 4A8EA 1ECWA 2GH1A 1L6NA 2JHDA 4IC9A 3VC8A 3OPXA 4C0ZA 2HBLA 2KV2A 2W7OA 4O3MA 4OO1J 1XO0A 4OJ5A 3LVWA 3IG8A 2KNJA 3CP8A 1Q3VA 4NWIA 4NV0A 1DRGA 3KZXA 2CRXA 1SZHA 1TAMA 2VKQA 2OYYA 2ZIUB 2YX8A 3NUQA 2G09A 2KIWA 4P0QA 1F44A 2DQNB 3E0FA 2LBOA 1Z19A 3RFAA 2XICA 3AQFA 2ZIWB 4FZNA 2ZG6A 1HIWA 2W04A 2RRDA 4P0PA 4GFJA 3SQIA 3H0RB 4KX3A 1YT3A 2JMGA 2HOIA 2K4HA 3AQEA 2DGZA 2DF4B 2G5IB 2KOBA 2OXOA 2VJ5A 2K4EA 2RP5A 4OJPA 4QJFB 4WJ3B 2VIXA 3F2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCB A;  3VC8 A;  3GZF A; 
#chains in the Genus database with same CATH topology
 2BCR A;  5F9L A;  3KFU F;  2KEY A;  4KLT A;  1XS9 D;  2KFZ A;  2G0A A;  4LJX A;  2WF5 A;  3V7K A;  3KBB A;  3DDH A;  3UXN A;  5ALW A;  4F5R A;  4TUR A;  1Z1V A;  5ALT A;  2W55 A;  1PVQ A;  3M1Y A;  4DL7 A;  2HVI A;  4YMO A;  2LYB A;  4IQV A;  1QQ5 A;  1SV0 C;  4O3N A;  3KKA C;  2LM1 A;  5EWG A;  2W9C B;  2DFL A;  4JV1 A;  2MRL A;  2JH1 A;  5KFZ A;  4DL6 A;  3NRW A;  1TVA A;  4BXO A;  1SWV A;  3MGV A;  4DQQ A;  5DGB A;  1ZQW A;  2E3T A;  5KFR A;  4FS2 A;  3OHA A;  2M9N A;  4NL9 A;  2YML A;  2AGP A;  3T5J A;  2ZJ8 A;  2NV3 A;  7ICE A;  4RT3 A;  2GLE A;  1XNS A;  1QSY A;  3KZI U;  3VCB A;  2YMP A;  2HCF A;  3RJF A;  4RPY A;  1ZQG A;  2HOF A;  3D2S A;  1KRP A;  2ZIX B;  3L4P A;  2VA8 A;  3PST A;  2WHE A;  2FPK A;  4Z6C A;  4C80 A;  3UXP A;  5KFO A;  5G5H A;  5J0R A;  4OO1 J;  2OCE A;  3KHH A;  5AM3 A;  1X6J A;  4Y2R A;  1DRG A;  5DB8 A;  1N62 A;  7ICS A;  2ESE A;  3GQC A;  3WK8 A;  4F4W A;  1JIH A;  7ICI A;  4DFD A;  4ECZ A;  3IM1 A;  1FIQ A;  5CR0 A;  4NLZ A;  5B5E U;  3JPS A;  2BHN A;  4UB2 A;  3SV3 A;  4NY8 A;  4YQW A;  9ICS A;  3QYP A;  5DDY A;  5ALN A;  2IBK A;  8ICN A;  4RQ7 A;  2KFN A;  3PNC A;  4DSI A;  4R8U A;  4UB8 U;  4RT2 A;  3N28 A;  3ZDA A;  4UBB A;  2EDU A;  3BS5 B;  4ZH4 A;  2K4P A;  4DLE A;  1L7O A;  4CE6 A;  2KKP A;  4LZD A;  2H3Q A;  3NAS A;  5KFE A;  1RXV A;  1S0N A;  1HUO A;  2KJ5 A;  3M6Z A;  2GOL A;  4JV0 A;  4EBC A;  2BPC A;  2YTU A;  1ZQV A;  5AI5 A;  8ICP A;  4DFK A;  4MFC A;  3KHL A;  1KFS A;  2P6U A;  2DKZ A;  1NJY A;  2KIC A;  1PVP A;  3QEA Z;  4O3S A;  1QSS A;  2EZY A;  3TAQ A;  3UXO A;  5KFH A;  2F3N A;  5ALJ A;  1KTQ A;  2JZB B;  5L1M A;  3M9M B;  3ISB A;  1S77 D;  2AGQ A;  1BVS A;  3M9N B;  1LV5 A;  5J0P A;  1PZN A;  5DB9 A;  2V9W A;  4J9L A;  1BPD A;  3DEE A;  4NLB A;  4B9V A;  3RR7 A;  5L1J A;  1X42 A;  4XA5 A;  4C7Z A;  1QSL A;  4J9Q A;  1T3Q A;  9ICR A;  3RBE A;  5J0Y A;  1Q3V A;  1SL2 A;  3PW0 A;  4IRD A;  3KZX A;  1LKY B;  4EEL A;  1DK3 A;  4RQ8 A;  9ICT A;  2QLT A;  4KLE A;  3U26 A;  4P0P A;  5KFW A;  5DQI A;  1X6I A;  2P66 A;  2W43 A;  4DQP A;  4Y2V A;  2OXO A;  1D8Y A;  2W9A A;  2UVW A;  3MR6 A;  2ZUC A;  2JH7 A;  4ACO A;  4ELU A;  4PGX A;  5DG7 A;  1NK4 A;  3AMZ A;  4KX5 A;  1NJX A;  2EAO A;  5KFS A;  3PY8 A;  4E0D A;  3PZP A;  5EOZ A;  3NGD A;  9ICO A;  2LKY A;  3F5A A;  3MC1 A;  3QZ7 A;  4Q44 A;  5CEH A;  4QNL A;  1LB2 B;  3PW2 A;  5AM2 A;  4J9P A;  2JEI A;  5J2C A;  5ALQ A;  2EAP A;  4F4X A;  1XWL A;  3ETR A;  5B66 U;  1COO A;  1CRX A;  4M9N A;  2BKE A;  5AIC A;  5HHI A;  3C29 A;  2IHM A;  3GII A;  4Y2U A;  2D3D A;  5DB7 A;  1ZXI A;  4ECS A;  9ICH A;  3T79 A;  3UQ0 A;  1HJP A;  3IHQ B;  4UB3 A;  4O3Q A;  1RPL A;  3I1Y A;  2KE7 A;  5AIB A;  2KIV A;  4RQ6 A;  1BNP A;  2F1J A;  4UB6 U;  9ICN A;  3WK5 A;  3RRH A;  3MBY A;  5J2F A;  2HBK A;  1WUD A;  4QZD A;  1RQL A;  5H2F U;  5KFB A;  1BPY A;  4QWB A;  3D2N A;  3PSF A;  4ECU A;  1COK A;  2BPG A;  1ZQD A;  2QB0 A;  4TUQ A;  1Q8K A;  1U45 A;  4Q43 A;  2JHD A;  4IC9 A;  8ICW A;  1ZQH A;  4JV2 A;  2F8K A;  2CRX A;  5L1L A;  4LVS A;  4QZC A;  4CF5 A;  3EZ5 A;  7ICF A;  4EYH B;  5KFY A;  4JUZ A;  4ZOH C;  4GXK A;  3KTQ A;  1L7N A;  3GIL A;  3I76 A;  1YT3 A;  4B9M A;  3EPG A;  3T3F A;  4PHD A;  4QZH A;  3H8W A;  3M8R A;  5KT7 A;  5KAF U;  3F2B A;  3F53 A;  4FBU A;  4K4H A;  2W7P A;  1SL1 A;  1SXD A;  1FO4 A;  1L7P A;  4O3P A;  4FZL A;  4YXM A;  3O0F A;  3UMB A;  2JEJ A;  2PFO A;  4J9R A;  2A1J B;  3N7P D;  4EEN A;  1K1S A;  2HBM A;  2ALZ A;  3PR4 A;  3QU7 A;  1PK1 A;  4UAR A;  1VDV A;  4M9G A;  8ICX A;  9ICI A;  1TAQ A;  4C4S A;  3M9O B;  4GXI A;  3AUO A;  1EXN A;  2W3R A;  3N97 B;  4NL9 C;  4BJQ A;  2K60 A;  4QZ9 A;  1TFR A;  2K8B B;  2ZJ5 A;  8ICT A;  7ICQ A;  3QU9 A;  3NRZ A;  5D49 A;  4F72 A;  4ECR A;  4J03 A;  4F92 B;  2D8C A;  4PZO A;  4UB5 A;  5AIA A;  4M9J A;  4K4I A;  2IHN A;  3QUC A;  4ED3 A;  3PW5 A;  1ZQN A;  2RHF A;  5HML A;  1BPB A;  3RJJ A;  7ICU A;  1IXR A;  3F5E A;  3QU2 A;  4B9S A;  4QWC A;  2ODG A;  5J0U A;  3S6J A;  4A8E A;  5AM0 A;  3RB0 A;  3MFH A;  4O3M A;  5KFQ A;  2NRZ A;  2YMQ A;  2FI1 A;  4UB4 A;  3D6J A;  3RFA A;  3GDX A;  4RNN A;  2HHS A;  1IG6 A;  3RBD A;  4JWM A;  3BQ2 A;  8ICA A;  1TKD A;  1N56 A;  2B0C A;  5HP4 A;  3HKZ C;  1SWW A;  1X66 A;  2XVT A;  4O5K A;  4I28 A;  5AI0 A;  2LYA A;  2ZIV B;  1X40 A;  3H8M A;  1MQ3 A;  2UVV A;  1URJ A;  2P6R A;  5IIK A;  1N61 A;  2HVH A;  4C8L A;  4ECQ A;  2KZZ A;  1L5U A;  2XCA A;  3FAH A;  5KFL A;  2VA2 A;  3RJH A;  2G07 A;  2R8K A;  4F5P A;  2XCP A;  4OJO A;  3K1Z A;  4MFA A;  9ICU A;  4I2E A;  5AKX A;  1BPX A;  1RM6 C;  4O3R A;  4O3O A;  5D4B A;  1JRP A;  4QZB A;  3RAQ A;  2E1E A;  3H8J A;  2MA1 A;  5DDM A;  1OW5 A;  5ALX A;  3MR3 A;  1MA7 A;  4B9T A;  4J9N A;  3ISD A;  2G06 A;  1UPH A;  4I2C A;  1DGS A;  3CNH A;  3V6H A;  4F2R A;  4KLI A;  2GH1 A;  1JXL A;  4QWE A;  3QUT A;  4P2H A;  1XSL A;  5ALL A;  2RDI A;  3ZDC A;  5EWF A;  2NRX A;  3JPO A;  5KFN A;  1KN5 A;  8ICL A;  4DL5 A;  2YX8 A;  2KIW A;  1PUZ A;  4G9B A;  1KFT A;  4I29 A;  3FYH A;  2NRW A;  2XIC A;  4YR0 A;  3TAC B;  1ZJN A;  4I2J A;  3J81 j;  3SQI A;  1C7Y A;  4DSK A;  2NYV A;  9ICM A;  5CB1 A;  1SB3 C;  4X5V A;  2J6S A;  3AL0 B;  4F4Y A;  4DOB A;  2ASJ A;  3RR8 A;  4DSF A;  3UMG A;  2IA6 A;  5J0T A;  4JB3 A;  5ALU A;  2H3V A;  4R63 A;  2YB4 A;  4RQM A;  3WKE A;  3CW2 C;  4GXJ A;  5C0Y A;  3TKA A;  3V72 A;  9ICK A;  3RAX A;  5KL8 B;  2ASD A;  1D8B A;  5KFD A;  1F0M A;  3RH5 A;  1T94 A;  3JPP A;  2AHO B;  4I2B A;  5ALH A;  3G6Y A;  1N63 A;  3H0L B;  2QKQ A;  3HT3 A;  2VAN A;  2DUY A;  4PL1 A;  2KHV A;  5J8Y A;  5EWE A;  2Y0S C;  5CRX A;  9ICQ A;  2NRT A;  3AN1 A;  5JU5 A;  3ZDB A;  3PSI A;  1SKS A;  4QZI A;  2CXY A;  2AJQ A;  1ZQJ A;  4ECX A;  3PO5 A;  1KLN A;  1M6Y A;  2PI4 A;  3OGU A;  5AK3 A;  5J2A A;  5F9N A;  4QIW C;  2FPM A;  2ZIX A;  3EYZ A;  5DG8 A;  2VJ4 A;  4M0A A;  5L9X A;  5GTI U;  1X9X A;  3V7J A;  1QQ6 A;  4RQ5 A;  3SAG A;  1X9M A;  2FLL A;  4J9M A;  3BJY A;  1P7D A;  1ZQQ A;  9ICA A;  1L3T A;  7ICJ A;  5AKH A;  3RJK A;  1U47 A;  5AKJ A;  2DKX A;  2CN1 A;  1ZET A;  4DEZ A;  2C2D A;  4RQ0 A;  1U4B A;  1ECW A;  1L6N A;  4ECW A;  3OPX A;  1Z00 B;  1KFD A;  5J0S A;  1IV8 A;  5ALE A;  8ICC A;  1KQQ A;  3JPN A;  7ICH A;  1SZH A;  3JPR A;  4O5C A;  4UW9 A;  2DQN B;  3OHB A;  1UA0 A;  5KG2 A;  1O08 A;  1JN3 A;  4RU9 A;  4KX3 A;  5HHH A;  2HOI A;  4YMN A;  3F2D A;  2FE9 A;  4WJ3 B;  3TAD A;  2BCS A;  4PL2 A;  2MSN A;  5L1K A;  4F5Q A;  1RZT A;  3BS5 A;  3TFS A;  1X2I A;  4M9L A;  2E5S A;  4R65 A;  3SR6 A;  2WAQ C;  4RPX A;  1S9F A;  1FFU A;  3K4G A;  5HNK A;  3ETL A;  4ED6 A;  2W3S A;  2BDP A;  4UAZ A;  2V4Q A;  1ZQC A;  4YN4 A;  2KHQ A;  1WG8 A;  2KK0 A;  4BXO B;  4M47 A;  5AK6 A;  5AKY A;  1O03 A;  3RB3 A;  3WKA A;  4UAW A;  4XQ8 A;  2ATL A;  7ICM A;  5KFP A;  5AKL A;  2ZTC A;  2MAX A;  3IG5 A;  4DSL A;  4FZM A;  4PHA A;  9ICW A;  3GU3 A;  5KFJ A;  3F2C A;  2IMW P;  5CJ7 A;  4EZ6 A;  9ICL A;  4ELV A;  2N1R A;  3QUB A;  1RXW A;  4C8K A;  4KN4 A;  3UM9 A;  1OUQ A;  5AI6 A;  2KZM A;  3HRD D;  2K89 A;  2Z7J A;  5AK4 A;  2YB1 A;  4RNO A;  5CP2 A;  7ICT A;  4C8M A;  2PFN A;  1T7P A;  5KG5 A;  1DK2 A;  5KFV A;  1RYU A;  2XY5 A;  4DO9 A;  7ICL A;  3V6K A;  4DFJ A;  3GV8 B;  2W7O A;  2HBL A;  4IL6 U;  1D8L A;  1XO1 A;  4YD2 A;  2BQU A;  1YZ7 A;  1ZQZ A;  2LM4 A;  2VKQ A;  3B0X A;  1ZQO A;  3E0F A;  5J2B A;  1T3N A;  1UT8 A;  4B9L A;  4KN7 A;  4PPX A;  4MF2 A;  2WFA A;  4UAY A;  2ISP A;  3TAN A;  2K4E A;  4DL4 A;  4KLU A;  2FMP A;  1JRO A;  4I2I A;  2DBY A;  3PX4 A;  4Q8F A;  4DWI A;  2R8I A;  2E8O A;  4J9O A;  5JTI A;  4RQ4 A;  4R8U B;  4F3O A;  1U9L A;  3TQ1 A;  4U7C A;  4CCH A;  3ZDE A;  4JMU A;  1CUK A;  3HIL A;  3AM9 A;  3H8S A;  5BOM A;  5JUM A;  3E2E A;  2W9M A;  3R9K A;  5ALK A;  2ZUD A;  3KOO A;  3KHR A;  4DFP A;  4Q8E A;  5KG4 A;  1V38 A;  1SKW A;  1SL0 A;  2LMR A;  4J9K A;  7ICO A;  3SAH A;  7ICN A;  5CWR A;  1TAU A;  2H5X A;  2WF6 A;  2RLT A;  1B22 A;  4DL2 A;  5KFX A;  3HW8 A;  4Y2Y A;  2HBJ A;  4Y2S A;  1QQ7 A;  5AKE A;  5ALR A;  4EZ9 A;  2ES6 A;  3PW4 A;  2KSO B;  4YP3 A;  2IOH A;  1IIP A;  4F8R A;  1WCL A;  2XY7 A;  1CEZ A;  4RQ2 A;  8ICI A;  4C4R A;  3QE9 Y;  1DXS A;  3G6X A;  4DQR A;  1JAL A;  2C2R A;  1H38 A;  2OYY A;  2ZIW B;  3H40 A;  5EE3 A;  2ZG6 A;  3OJU A;  3FM9 A;  3WKB A;  4DF8 A;  2G5I B;  2KOB A;  3L5K A;  5J0Q A;  1ZQY A;  1N5W A;  2H3I A;  4P0Q B;  3M8S A;  3GFK B;  5DLF A;  1ZQI A;  5ALI A;  4AYB F;  5DBC A;  3B0Y A;  1A77 A;  3NVW A;  4UAV A;  4KLF A;  4KIT B;  2DWQ A;  3OSP A;  2JGA A;  1A76 A;  2FPL A;  3EPI A;  2E8N A;  1ZQX A;  5HMM A;  3LYS A;  4F91 B;  1Z4O A;  2Y9U A;  3WKC A;  5AK5 A;  3CRX A;  5J8Y C;  3PO4 A;  2UVR A;  2F77 X;  1V9P A;  3HWT A;  1VLB A;  3LDA A;  1YZ6 A;  4DFM A;  1BGX T;  1JX4 A;  4AYB C;  4O9M A;  3KD3 A;  9ICV A;  3PV8 A;  1S97 A;  2MUT B;  4QZE A;  2WB1 C;  1ZQT A;  4F93 B;  5AM5 A;  1WWU A;  3SV4 A;  4UBC A;  1KBU A;  2AH5 A;  8ICG A;  4BDP A;  4NLC A;  2ZUB A;  2HOQ A;  3QUQ A;  5DBB A;  2HHT A;  3Q8M A;  5KG3 A;  3Q8R B;  2YY6 A;  2QB0 B;  8ICH A;  1SIJ A;  2K4I A;  2W03 A;  4R64 A;  1UA1 A;  9ICB A;  4KLM A;  1SZP A;  4F50 A;  2E8P A;  2BCQ A;  4BUG A;  4EBE A;  2FLP A;  5AHX A;  1XO0 A;  5AM1 A;  4ECT A;  3IV6 A;  4F5O A;  3BZC A;  1PK3 A;  4P4M A;  4O5E A;  5KAI U;  3BS7 A;  1NK0 A;  4IR1 A;  8ICJ A;  5KFG A;  3V7L A;  4PZN A;  5KFF A;  2W9B A;  2KVS A;  2LBO A;  3AQF A;  4Y2P A;  1XSN A;  2BQ3 A;  1S5L U;  1NOM A;  4Y2X A;  1ZQU A;  2RP5 A;  4NXZ A;  4XRH A;  3TAD C;  5CHG A;  4F2S A;  2EZZ A;  2KN7 A;  2BCV A;  4R66 A;  4OCZ A;  1VJ5 A;  4C8N A;  1L8L A;  4QWA A;  3HKZ F;  4EX6 A;  3IN5 A;  3ORY A;  4QWD A;  4RUC A;  4EBD A;  4FO6 A;  4DSJ A;  3Q8K A;  4PGQ A;  1GO3 F;  4QW8 A;  1KEJ A;  1BPE A;  3PMN A;  3ISC A;  1J2N A;  2LHT A;  4YG2 A;  4F4K A;  1NK9 A;  3PX6 A;  1ZJM A;  2XY6 A;  5DQG A;  2LI6 A;  3QU4 A;  3HPO A;  3AEV A;  7ICP A;  2MU2 A;  3ZD9 A;  4CDG A;  3MAB A;  1UT5 A;  4KLD A;  5KFC A;  2R18 A;  5DBA A;  2M0N A;  1FEZ A;  1ZQB A;  3MDC A;  5HR7 A;  1K5O A;  2JEG A;  3A0H U;  4ED1 A;  3ALR A;  4ED2 A;  2FMQ A;  1ZQM A;  1ZD3 A;  1V97 A;  5EE9 A;  5HR6 A;  2O6K A;  5DKW A;  3RB6 A;  2XC9 A;  4Y2T A;  3GIK A;  2QAR A;  3VC8 A;  4C0Z A;  3RJI A;  2B6G A;  3Q8P B;  4M6W A;  1LVH A;  2W54 A;  2JR5 A;  4NWI A;  1NZP A;  3TAR A;  2ZIU B;  8ICE A;  4QZF A;  2RQ5 A;  1TE2 A;  2BQR A;  4QZG A;  2Y1I A;  4GFJ A;  1JI7 A;  1BPZ A;  2NO5 A;  4QJF B;  1U48 A;  2VIX A;  1KDH A;  2F2A B;  2FMS A;  4MHV A;  5KG6 A;  1QH9 A;  4C7Y A;  4IQW A;  1NNL A;  5IIJ A;  3SI8 A;  2R8H A;  1S10 A;  2PKE A;  2HHQ A;  2W8L A;  2BDU A;  2WF8 A;  1ED1 A;  4I2H A;  2R8J A;  1NK8 A;  4AP9 A;  4F5N A;  7ICV A;  3EW9 A;  3Q8L A;  5EE0 A;  4NLK A;  3GIM A;  2Y0S F;  5J2I A;  1D9F A;  4PHE A;  2W9C A;  2F44 A;  2KP7 A;  4NLG A;  2DPI A;  1MSW D;  3SZ2 A;  1KL9 A;  5J2G A;  2K8C B;  2I9G A;  3NS1 A;  1WWV A;  4IRK A;  3GV7 B;  4I2D A;  2FDR A;  2L5Y A;  4QIW F;  5ALD A;  3RJG A;  3C28 A;  1ZQP A;  3AU6 A;  4Z6F A;  4Z6E A;  3OJS A;  3BQT A;  1D9D A;  2Y9T A;  1S0M A;  4DL3 A;  8ICB A;  4OD0 A;  1Z00 A;  3L3F X;  2NO4 A;  3SEI A;  2ZTD A;  3NVY A;  4G3I A;  2F76 X;  1TK8 A;  2JEF A;  1PVR A;  8ICM A;  5TZV A;  5J2D A;  4KMO B;  4BGD A;  5DLG A;  5J2J A;  1HUZ A;  4XUS A;  8ICV A;  3WK7 A;  4IQU A;  4KLG A;  4MEY A;  2AXT U;  4OJ5 A;  1NK6 A;  3BQ7 A;  8ICU A;  2F1H A;  4YMM A;  3FC4 A;  1N5X A;  3SD7 A;  4P4P A;  1U49 A;  1ARO P;  2XO7 A;  5E79 U;  3TAP A;  1B4F A;  2C22 A;  3C21 A;  4Y2J A;  4M2Y A;  1S0O A;  3WK4 A;  4KLQ A;  5KFK A;  4I2A A;  3G6V A;  2DGZ A;  2DF4 B;  4KLL A;  2VJ5 A;  1ZQL A;  4IQT A;  1XSP A;  4IR9 A;  5JRT A;  5J2E A;  5AM4 A;  2OM6 A;  3C2M A;  1JXE A;  4US8 A;  2V4R A;  1J97 A;  2BCU A;  3NVV A;  1ZQS A;  2WAQ F;  3BQ1 A;  3RH6 A;  3K75 D;  1WCN A;  3TI0 A;  3MFI A;  4EYI B;  2KD1 A;  1ZQ1 C;  4KMU A;  9ICJ A;  3WK9 A;  4YFK A;  1B0X A;  5DGA A;  5KG0 A;  5AI9 A;  5KFM A;  1L8O A;  2BZF A;  2I5H A;  1S8O A;  4B9N A;  3MGI A;  1JUD A;  5AI4 A;  4RQ1 A;  2I1Q A;  9ICG A;  1A0P A;  4MF8 A;  2HSZ A;  2EAM A;  1ZQR A;  4QZA A;  3LVV A;  2W11 A;  3QNM A;  5BOL A;  2BGW A;  5F3X B;  2ZXH A;  3UQ2 A;  4CGZ A;  1DGJ A;  4UAT A;  4GC6 A;  3N7S C;  3K1R B;  2JZB A;  4EEY A;  2F8L A;  1SV4 A;  2LPE A;  1KSP A;  4B6J A;  1ZQF A;  1UQV A;  4F71 A;  5J0W A;  4RNM A;  1ZQE A;  1S0V A;  3IRU A;  4ED8 A;  3JPT A;  5KT4 A;  4FS1 A;  1TK5 A;  2JXJ A;  2HHU A;  1Z19 A;  5BPC A;  9ICP A;  2RRD A;  2KTQ A;  1LKY A;  7ICK A;  5T14 A;  2K4H A;  3KHG A;  3DV9 A;  4OJP A;  2YN4 A;  5L1I A;  4DOA A;  4I2F A;  4YCX A;  3RJE A;  8ICY A;  3EUB 2;  4YVZ A;  2DPJ A;  1A6S A;  3QXG A;  3UMC A;  3MR5 A;  4M9H A;  4EEK A;  4UAU A;  1N2X A;  7ICG A;  3H4B A;  1K1Q A;  3N4M B;  1QLN A;  2XGQ A;  4FBT A;  4KLH A;  2AQ4 A;  1T4G A;  5DQH A;  2H3Z A;  2PMZ F;  3C5G A;  5A0L A;  4B9U A;  5J2K A;  1NK5 A;  2KMD A;  5J0O A;  5J2H A;  3RB4 A;  5KT5 A;  5KFI A;  4DCC A;  3MR2 A;  1UCV A;  1Z4N A;  2ZJA A;  4O0I A;  2HDO A;  1IM4 A;  3M6K A;  5KT6 A;  4DF4 A;  1RDF A;  4RQN A;  2HHW A;  2UVU A;  3PSP A;  4KTQ A;  4DOC A;  2YMM A;  2KSO A;  1NKC A;  2PMZ C;  5ALM A;  3AU2 A;  2G08 A;  5J29 A;  1JMS A;  4CRX A;  2A1A A;  2G5H B;  1SGG A;  1AQ6 A;  5CA7 A;  5KG1 A;  3PVX A;  2XID A;  5ALY A;  3H4D A;  8ICZ A;  2AGO A;  1J2M A;  5IIL A;  2KG5 A;  3SMV A;  3I28 A;  9ICF A;  4RUA A;  2ZIW A;  8ICR A;  1CI4 A;  4CF4 A;  4I27 A;  5DG9 A;  4LZG A;  8ICO A;  3CP8 A;  2LYH A;  2FJ6 A;  1FFV A;  8ICQ A;  3NTU A;  4P0Q A;  5J0X A;  2P35 A;  2JRZ A;  1NKE A;  1DOQ A;  2W04 A;  2AQ0 A;  3GV5 B;  4UQG A;  4YR3 A;  4JWN A;  2XGP A;  1B43 A;  2JV3 A;  2H3F A;  3RF9 A;  5GTH U;  5IIO A;  2HHV A;  3LWM A;  2KJ9 A;  4P0P B;  2I6X A;  1L7M A;  3WU2 U;  4US9 A;  2EAN A;  1ZYQ A;  3H7I A;  4FFD A;  3PX0 A;  3T5K A;  2B21 A;  4HAI A;  2MUT A;  1Z1B A;  7ICR A;  3GZF A;  1NZB A;  3BZK A;  4MEX A;  5FP0 A;  3C1Z A;  3ZD8 A;  2CPR A;  5KFT A;  1SV0 A;  2A1J A;  3KKA A;  4I2G A;  8ICS A;  4TQS A;  2NRV A;  5ALS A;  3OTQ A;  3PML A;  3E58 A;  4NLN A;  4DQI A;  3SAF A;  4JK1 A;  4GLX A;  3RH4 A;  2XI9 A;  2WB1 F;  4KLS A;  3LWL A;  3H0M B;  3PR5 B;  2K8A A;  1NI3 A;  1RG6 A;  1SXE A;  1MN8 A;  3IDW A;  2WTF A;  1ZQA A;  1XC9 A;  2EH9 A;  5III A;  4PH5 A;  2A3V A;  4U6P A;  4EX7 A;  4Q45 A;  4C8O A;  4ICA A;  2E1F A;  3BDP A;  5ALP A;  4OJL A;  1MC8 A;  4DLG A;  3EWA A;  1L3V A;  4BX9 C;  3QU5 A;  3TFR A;  1NJW A;  1V85 A;  5AKK A;  3ICX A;  4YXJ A;  4KLJ A;  3THV A;  2FLN A;  1OXJ A;  2RDJ A;  1KKX A;  1QCK A;  1X9S A;  5KG7 A;  4NV0 A;  3C23 A;  4M04 A;  3NUQ A;  2A19 A;  3Q8S B;  4FZN A;  1HIW A;  5ALV A;  3H0R B;  5ALG A;  2JMG A;  2C2E A;  2PFP A;  1KW4 A;  3C1Y A;  2ASL A;  4UAS A;  4HYK A;  3GIJ A;  2DL0 A;  3M7D A;  4OJ6 A;  2AU0 A;  4YR2 A;  5KTQ A;  2BPF A;  1RYS A;  1ZRN A;  1L3U A;  3ZI4 A;  1Y88 A;  1ZQK A;  5AKG A;  3FDS A;  1ZRM A;  2R8G A;  4K4G A;  4NM2 A;  3B9J A;  2ZIV A;  1Q3U A;  1QTM A;  9ICC A;  3IP4 B;  4IS7 A;  3OSN A;  3WK6 A;  1RQN A;  2KZ3 A;  3D2Q A;  1X9W A;  4J9S A;  3ZDD A;  3SEN A;  3UPQ A;  4RZR A;  1ZD2 P;  5KT2 A;  3Q8Q B;  8ICK A;  3HP6 A;  2KJ8 A;  1BNO A;  2D6F C;  2J6T A;  1NK7 A;  1UHU A;  5AI8 A;  4PHP A;  2YQE A;  5KT3 A;  4USA A;  2EZX A;  1Z3E B;  1PK1 B;  5KFU A;  1T8E A;  3MGH A;  3BQ0 A;  4ELT A;  2PFQ A;  4NM1 A;  2F1I A;  1C20 A;  4UB1 A;  2ZIU A;  4TUP A;  4DQS A;  3CYM A;  5ALZ A;  2J6U A;  5G5G A;  5KFA A;  4IRC A;  1NKB A;  3LK9 A;  1TK0 A;  2KV2 A;  2QB1 A;  5ALO A;  4ECY A;  4TUS A;  3LVW A;  3IG8 A;  2KNJ A;  2W9B B;  4ECV A;  5ALF A;  4CNQ A;  3SYZ A;  3A0B U;  2WF9 A;  4PJ0 U;  2PXI A;  2EQY A;  3HJE A;  1RYR A;  4F4Z A;  1F5S A;  4Z6D A;  4BWM A;  4TQR A;  1ZD4 A;  5IIN A;  2ISO A;  4CF3 A;  4DS5 A;  4RQ3 A;  1ZOL A;  1NJZ A;  4NJ8 A;  3T5H A;  1S76 D;  2HI0 A;  3C5F A;  1Q46 A;  4RPZ A;  9ICE A;  2KVC A;  2HMX A;  5KNI A;  1N48 A;  4FE3 A;  3C2L A;  1MQ2 A;  3N7R C;  2HW3 A;  1SKR A;  5EE1 A;  1HEK A;  8ICF A;  2GO7 A;  2C28 A;  3QZ8 A;  5KL1 B;  4Y2Q A;  3HX0 A;  3NVZ A;  2BR0 A;  9ICX A;  3ONN A;  3V6J A;  3QEB Z;  3RRG A;  3C2K A;  4QZ8 A;  1N60 A;  1L3S A;  4GIB A;  4P4O A;  1WYG A;  4BWJ A;  5AKZ A;  5AKI A;  2OH2 A;  2ZXI A;  3QX7 A;  2PI5 A;  2VA3 A;  2ZTE A;  4ED7 A;  5DB6 A;  2Q0Z X;  4GC7 A;  2Q4T A;  2IOF K;  2KKV A;  3WKD A;  2W8K A;  3T5L A;  2IOF A;  2QAR B;  4YD1 A;  4M6W B;  3RTV A;  4DS4 A;  4PGY A;  4KLO A;  1ZD5 A;  4QW9 A;  2Y1J A;  4ED0 A;  5IIM A;  5K4L A;  3MDA A;  2OHF A;  1TAM A;  1F44 A;  4DSE A;  2G09 A;  2E8M A;  3ED5 A;  2GWS A;  3JPQ A;  1TV9 A;  4MFF A;  2WF7 A;  3AQE A;  5TIS U;  2HHX A;  1XU4 A;  5C5J A;  5D46 A;  4C4T A;  2OEH A;  2OWO A;  3PW7 A; 
#chains in the Genus database with same CATH homology
 4PL2 A;  3AL0 B;  2F2A B;  2H3F A;  3M7D A;  3F53 A;  4OJ6 A;  3RF9 A;  2JH7 A;  2KEY A;  2H3I A;  3KFU F;  4P0Q B;  4ACO A;  2W7P A;  1A6S A;  2H3V A;  4KX5 A;  2KJ9 A;  4AYB F;  3HKZ C;  2E5S A;  2XVT A;  2G0A A;  4FZL A;  2YB4 A;  3HKZ F;  4P0P B;  2KVC A;  2OM6 A;  2HMX A;  3PZP A;  2LKY A;  4U7C A;  5C0Y A;  3F5A A;  4FE3 A;  3IN5 A;  2WAQ C;  3O0F A;  5KL8 B;  5T14 A;  1D8B A;  2LYA A;  2WAQ F;  2ZIV B;  2JGA A;  3N7R C;  1T94 A;  4JMU A;  1HEK A;  4QNL A;  1PVQ A;  2BDU A;  3H0L B;  1Z1B A;  2H3Z A;  3GZF A;  2PMZ F;  3N7P D;  5KL1 B;  1ED1 A;  1URJ A;  5A0L A;  3LYS A;  1NZB A;  2LYB A;  2ZIV A;  1GO3 F;  2HBM A;  1Q3U A;  2KD1 A;  1ZQ1 C;  3CRX A;  4PL1 A;  2KHV A;  2CPR A;  2KHQ A;  2LHT A;  2KKP A;  3IP4 B;  2H3Q A;  1CRX A;  2F77 X;  2Y0S C;  3ONN A;  2MRL A;  2JH1 A;  3D2Q A;  2Y0S F;  5CRX A;  3C29 A;  4AYB C;  3NRW A;  3PSI A;  2KJ5 A;  3M6Z A;  2GOL A;  3M6K A;  4CDG A;  3SAF A;  2KJ8 A;  2D6F C;  3IG5 A;  2G07 A;  3SAH A;  3MGV A;  4FZM A;  3PSP A;  2K8C B;  2R18 A;  2WB1 C;  3T79 A;  2XI9 A;  2WB1 F;  3GU3 A;  2M0N A;  4BJQ A;  3H0M B;  3F2D A;  3F2C A;  2PMZ C;  5HR7 A;  4OJO A;  2K8B B;  2K8A A;  2KIC A;  1A0P A;  3K1Z A;  4QIW C;  1PVP A;  1KBU A;  2G08 A;  4QIW F;  2ZIX A;  3C28 A;  4NLC A;  2OH2 A;  3LVV A;  2N1R A;  4CRX A;  2HOQ A;  3ALR A;  2A3V A;  2VJ4 A;  4U6P A;  2G5H B;  2ZXI A;  2NV3 A;  1OUQ A;  1XNS A;  2K89 A;  2Z7J A;  2E1F A;  3L3F X;  2ZXH A;  2HBJ A;  4ICA A;  3VCB A;  3SAG A;  4OJL A;  4CGZ A;  2E1E A;  2YB1 A;  1P7D A;  2HBK A;  2MA1 A;  2Q4T A;  2XID A;  1WUD A;  2F76 X;  2RHF A;  4BX9 C;  1MA7 A;  2K4I A;  2KKV A;  2W03 A;  2G06 A;  1UPH A;  2ZIU A;  3N7S C;  1PVR A;  3F5E A;  2HOF A;  2F8L A;  2CN1 A;  3D2S A;  5HR6 A;  3D2N A;  3PSF A;  3SMV A;  2ZIX B;  4KMO B;  3CYM A;  4BUG A;  3DEE A;  4NLB A;  2ZIW A;  1IIP A;  3ICX A;  3PST A;  4A8E A;  1ECW A;  2GH1 A;  1L6N A;  2JHD A;  4IC9 A;  3VC8 A;  3OPX A;  4C0Z A;  2HBL A;  2KV2 A;  2W7O A;  4O3M A;  4OO1 J;  1XO0 A;  4OJ5 A;  3LVW A;  3IG8 A;  2KNJ A;  3CP8 A;  1Q3V A;  4NWI A;  4NV0 A;  1DRG A;  3KZX A;  2CRX A;  1SZH A;  1TAM A;  2VKQ A;  2OYY A;  2ZIU B;  2YX8 A;  3NUQ A;  2G09 A;  2KIW A;  4P0Q A;  1F44 A;  2DQN B;  3E0F A;  2LBO A;  1Z19 A;  3RFA A;  2XIC A;  3AQF A;  2ZIW B;  4FZN A;  2ZG6 A;  1HIW A;  2W04 A;  2RRD A;  4P0P A;  4GFJ A;  3SQI A;  3H0R B;  4KX3 A;  1YT3 A;  2JMG A;  2HOI A;  2K4H A;  3AQE A;  2DGZ A;  2DF4 B;  2G5I B;  2KOB A;  2OXO A;  2VJ5 A;  2K4E A;  2RP5 A;  4OJP A;  4QJF B;  4WJ3 B;  2VIX A;  3F2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...