3VCBA

C425s mutant of the c-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus a59
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
STFEEMALTTFMITKESYSKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAACSQLAKAMETFNHNNGNDVLYQPPTASVTTSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal cytoplasmic domain of non-structural protein 4 from mouse hepatitis virus A59.
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords RNA-directed RNA polymerase
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3vcbA00
3VCBA 3GZFA 3VC8A
chains in the Genus database with same CATH superfamily
1BNPA 4DSKA 1PK1A 4B9UA 3SYZA 5L9XA 4R64A 3TI0A 5KG2A 1D9FA 4QJFB 3EUB2 3KBBA 1L7MA 4I2DA 2KZMA 5AICA 1ZQUA 3MGHA 2G5HB 8ICXA 3BDPA 2WF8A 5J29A 4C80A 3L3FX 1T3QA 4MFCA 1JUDA 2E8MA 1ZQMA 3FAHA 3EW9A 2HVIA 1COOA 4YCXA 3PZPA 2MUTA 1N48A 4LJXA 4X5VA 4Y2RA 5KFIA 3KFUF 3N28A 1X9SA 1KW4A 1Q3VA 5BOLA 4EX7A 1PK3A 3NRWA 4GXIA 4QZCA 2KP7A 1X2IA 4ELVA 1UA1A 2HBJA 3M8RA 1PK1B 4NLCA 3CP8A 3KHRA 2ASLA 5IIMA 3H8JA 4QZ9A 4DL3A 2E8PA 5KFOA 1TAQA 4F93B 5AI0A 2H3FA 4PZNA 3KHHA 1URJA 3QE9Y 4Q43A 3AU2A 8ICJA 1VJ5A 4MFFA 3OJSA 2UVRA 3T5JA 4JWNA 5DBAA 4C0ZA 1N63A 3G6YA 3H4BA 2R8HA 2E8OA 5AKEA 4YMMA 2JHDA 1T4GA 4KLIA 4QIWF 4FO6A 4EYIB 4DWIA 1J97A 4O3NA 4US8A 2A1JB 3Q8QB 4B9VA 3I1YA 1S76D 1YZ6A 3NS1A 1A0PA 1NK9A 1ZD5A 3Q8RB 5KAFU 2LMRA 9ICRA 5KFCA 1VDVA 5ALXA 3V6KA 2KKVA 3BZKA 2WAQC 3OJUA 4NLZA 1JXEA 1K1SA 3RJGA 4ED6A 1XU4A 2BQ3A 5ALGA 1IM4A 3KHLA 2YMLA 4KITB 5IIKA 4P0PB 4DL7A 3EPIA 4K4HA 5J2GA 1JMSA 1HUOA 2F8LA 2G08A 4P0QB 2CRXA 3HKZC 9ICLA 9ICUA 4NWIA 1ZD2P 2XY7A 3D2SA 8ICNA 4ED8A 1Q8KA 2NRVA 8ICQA 3PVXA 2HBLA 4G9BA 5J2BA 2W9BB 2RDIA 5AM1A 4KLGA 4RUCA 1KFDA 1L3UA 2I9GA 4IRCA 7ICLA 4NLBA 1Z4OA 2IOFK 1QCKA 4CF5A 1ZQQA 4DOBA 2QB0B 4M9NA 1DGSA 4UB6U 4NY8A 5J8YA 5GTIU 5J0WA 4F92B 2VJ5A 4IC9A 1KRPA 1X6JA 2JEFA 2JXJA 5IIOA 4DSFA 4XA5A 4YD1A 3KHGA 2DBYA 1S0NA 8ICFA 3QU9A 3FM9A 4I27A 9ICBA 3HPOA 3LWLA 5KL8B 5J0UA 5J2DA 2F77X 4YD2A 1RM6C 1IXRA 3GQCA 5D4BA 3PMLA 2XGPA 3HILA 5DQHA 3ONNA 2KSOB 3GIIA 2K4HA 1ZQKA 3WKCA 2F2AB 4PL1A 3M9MB 3H8MA 2J6TA 3JPPA 3L4PA 5IILA 2BZFA 2ISOA 4RQ0A 5CEHA 5H2FU 5HHIA 4U7CA 4RPZA 5JRTA 2WB1C 4M9GA 1TK5A 4M47A 7ICUA 3AEVA 1T94A 2BHNA 1RYUA 4BWJA 2YMPA 4R66A 1UQVA 7ICOA 1SV0C 3BS7A 4ED3A 4OJOA 4DCCA 5DQIA 3TAQA 3RB4A 3VCBA 4FBUA 4QZBA 2Y0SC 2KZZA 2EAOA 2KVCA 2W9CA 2BGWA 1SV0A 3A0HU 1ZQZA 4KTQA 3BS5B 5KFXA 4DSIA 4YFKA 2YB4A 1RZTA 2P6UA 1TFRA 1ZQNA 5J2FA 2GWSA 2ZIVA 1SZHA 2BQUA 4BJQA 2FJ6A 2FLLA 3RAQA 5DB6A 3PV8A 2R8IA 3WK7A 4QWAA 4RQ5A 2WHEA 4KLMA 1Z1VA 1ZQIA 2HHXA 4ZOHC 2JEIA 4EZ6A 3PMNA 5ALJA 9ICMA 2V4QA 5J2IA 2HW3A 1DK2A 2W7OA 2BCRA 3NTUA 2ODGA 1S8OA 1XO0A 2QB0A 1BPEA 4QZFA 3RRHA 5G5GA 3NRZA 1XNSA 3RH6A 4O3RA 1TV9A 4FFDA 1LVHA 2KEYA 3SD7A 4PPXA 2KJ8A 5AM5A 3C23A 8ICAA 3SR6A 2BPFA 4P0PA 4C8NA 1A77A 1P7DA 2OYYA 2PKEA 3B0YA 5HP4A 1X9XA 2MSNA 5DLFA 1LKYA 2WF5A 3V7JA 3ISCA 3PX6A 4KLQA 4EZ9A 2CPRA 1ZQWA 2W43A 1H38A 5KT6A 1EXNA 5J2AA 5DLGA 2ESEA 1JROA 4HAIA 1CUKA 2LKYA 1S5LU 4MEYA 3UM9A 2RDJA 2F1IA 3TQ1A 3OGUA 3AU6A 5ALVA 4PGQA 4PHDA 4RT3A 1ZQHA 1ZQBA 3RR7A 4EENA 4BDPA 1S77D 1Z3EB 4AP9A 4I2CA 8ICOA 2B6GA 2QKQA 3MGIA 1V85A 2AGOA 4ECZA 2ZXHA 4J9NA 1X9WA 4ZH4A 4G3IA 2F44A 4KMUA 8ICZA 4RQMA 4CDGA 9ICQA 3F2CA 1ZQGA 3AN1A 4DFDA 2CXYA 4JK1A 4IRKA 4C8MA 4DSEA 4US9A 2JZBB 5T14A 3QUCA 2F8KA 4QW8A 3PO4A 1ZQ1C 4JMUA 2EQYA 1CRXA 2NRZA 5AM4A 1QSYA 1L7PA 4UARA 4P4PA 7ICEA 1S10A 5B5EU 5AKLA 3AL0B 3EWAA 3ZD9A 4QWCA 4M9LA 4CCHA 4KLTA 3T5HA 2PFOA 4UQGA 3M1YA 4USAA 2ZIVB 5FP0A 4JV2A 5ALQA 4PL2A 5KT5A 1KFSA 2EZZA 4PGXA 2KZ3A 2HMXA 2AQ0A 2K4IA 3KKAC 2WF7A 1L3VA 2XGQA 4QWEA 1IV8A 3IDWA 1KSPA 2VKQA 4EYHB 1WYGA 7ICKA 2EH9A 2JZBA 2B21A 2Y9UA 2XICA 3V7LA 4ECWA 4QZIA 1BPDA 4JV0A 3QEAZ 2KVSA 2LHTA 3PW0A 3F53A 4YMNA 3ZDDA 4DLEA 3DEEA 4TUQA 2K89A 2ZTDA 3RJIA 2O6KA 4KN7A 4EELA 2W54A 3MFIA 1ZQPA 4OCZA 2LPEA 2K8CB 3FC4A 2ZUCA 3NVWA 4Z6FA 2GH1A 3ZD8A 9ICKA 2QLTA 3PW4A 3CRXA 2W7PA 4ED7A 3ED5A 3MGVA 3EZ5A 1ZQRA 1QLNA 5KFBA 3C2KA 4BX9C 5KFZA 1ZQLA 5TZVA 4DQRA 4LZDA 5KG0A 3H40A 2LM1A 2KMDA 5KG1A 2AGQA 4CNQA 2XCPA 8ICMA 2BCQA 2L5YA 4KLJA 1X66A 5C5JA 4J9OA 2HSZA 2AHOB 2R8GA 4RQ3A 2XI9A 5E79U 4QNLA 1QTMA 1SL2A 5IIJA 1SKRA 2IOHA 4C4SA 9ICIA 5ALWA 2NO5A 2FMQA 2IOFA 2DKZA 1C7YA 4CE6A 2G0AA 4TUSA 3ICXA 1TE2A 2H5XA 5IIIA 1RXWA 1GO3F 4RT2A 5J0XA 4IQUA 4ECYA 4GXKA 4NL9A 1TKDA 1SL0A 1ZQEA 2PI5A 4FE3A 2G5IB 3T5KA 9ICSA 5KFFA 4QZAA 2EDUA 3KKAA 2W9BA 4F4YA 4ECSA 3KOOA 1KDHA 2HHUA 3AQEA 4MF2A 5CP2A 3T5LA 1KQQA 4B6JA 1NNLA 4DLGA 4F2RA 3JPOA 1S0MA 5AKGA 4BUGA 2W9AA 1ZQCA 5KFJA 1VLBA 2DFLA 5KFSA 1NOMA 4R65A 1QSLA 2N1RA 5AHXA 1NKBA 3SQIA 3GV8B 3SI8A 5CWRA 8ICWA 2Y1JA 2G07A 2WF6A 4R8UB 9ICAA 4RPYA 5L1LA 2K4EA 9ICTA 4QIWC 2WTFA 4OO1J 5AI5A 1KTQA 4IQVA 5KFYA 1N5WA 5F9NA 4F5NA 1FEZA 2W3RA 2AQ4A 3T3FA 5CB1A 4IS7A 2W55A 5ALYA 1SKWA 1MQ3A 7ICFA 2VIXA 1PUZA 3I28A 2OH2A 5KFKA 3IHQB 5KFDA 4ECVA 1DOQA 1KEJA 1SV4A 4YXMA 4YMOA 3QEBZ 3G6VA 7ICSA 3SV3A 1N62A 2AXTU 3ZDEA 2KJ9A 1ED1A 5KG7A 2F1HA 2I6XA 1L3TA 3PX0A 4IQWA 4LZGA 3M6ZA 3SEIA 2ES6A 3ALRA 3LDAA 3QUQA 4BWMA 3C1YA 5KT2A 2KIVA 5KAIU 4FZMA 1D8YA 5EOZA 3PR4A 3GIMA 2W04A 4YR0A 4Z6EA 2NRXA 4Y2XA 4UB1A 2YQEA 1V38A 5DGAA 4IR1A 3H4DA 1S0OA 2C22A 5AI4A 5ALHA 5DQGA 9ICFA 1KBUA 2NRWA 3OTQA 1TAMA 4XRHA 1AROP 4P4MA 3ZDCA 2VANA 2EAPA 1C20A 5AI8A 1A76A 4O3QA 4DS5A 1TAUA 2Y0SF 5J0YA 4CGZA 2V9WA 4FS1A 2ZJ5A 1U48A 5CR0A 1HIWA 4J9LA 5AKZA 4P4OA 4R8UA 4FBTA 1IG6A 2ASDA 2XIDA 5AM3A 2QARA 1SXDA 4GC6A 3NGDA 5EE0A 3MR3A 4Y2TA 1L3SA 9ICWA 5J0OA 3H7IA 4DF8A 1HEKA 2DWQA 2KFNA 2DQNB 5DDYA 2RLTA 3PW5A 2AGPA 3JPQA 3IG8A 3TADC 2JH7A 1T8EA 1AQ6A 3M9NB 8ICGA 3PSIA 5ALOA 3QNMA 4I2AA 4Y2UA 8ICKA 3K75D 2JH1A 2GO7A 5D49A 3NVVA 4U6PA 3WU2U 4OD0A 3IRUA 2PMZF 5F9LA 2E8NA 1N2XA 1U45A 1MC8A 1RYSA 2FPKA 1OXJA 4QZHA 2AH5A 2CN1A 2P6RA 2OXOA 1F44A 1JALA 4A8EA 3RAXA 2BKEA 3AM9A 4EEKA 3QU2A 5ALMA 4F91B 5CHGA 3PY8A 2KNJA 3V7KA 1NK8A 1B0XA 1QQ7A 5CJ7A 2A19A 4RQ7A 4RQ1A 4HYKA 3GV7B 9ICPA 3PX4A 5KFHA 3ORYA 3B0XA 2IMWP 4WJ3B 3AMZA 2M0NA 5JTIA 3TFSA 3QUBA 3RRGA 1RG6A 1LKYB 3RF9A 3SMVA 3SAGA 2DGZA 4C4RA 1ZJMA 4JWMA 5AK4A 4YXJA 1JX4A 2Y1IA 3K1RB 4F71A 3LWMA 4DO9A 3RJEA 5J0SA 3B9JA 2HCFA 2DUYA 3O0FA 1S97A 2D8CA 1XC9A 1NK6A 3IM1A 5J8YC 5ALDA 4KMOB 3MBYA 1SGGA 5A0LA 1FFVA 4I2GA 4MF8A 8ICYA 9ICNA 5J2HA 7ICRA 1BPYA 2ZUBA 5AI6A 1XO1A 5ALUA 4YR3A 3TFRA 3A0BU 5KFMA 1PVPA 3EYZA 4RNOA 3ETLA 3V6JA 2KFZA 1NZPA 5IINA 3LVWA 4PGYA 2LYBA 4ELUA 5L1JA 5AKKA 5AIBA 4RNNA 2QARB 5KL1B 4KLEA 2RP5A 4P0QA 4Y2QA 3JPTA 3PSTA 4UASA 1WCNA 3WK8A 1TVAA 4KLSA 1HUZA 3GFKB 3U26A 3TANA 4M9HA 4DQIA 2DF4B 5DKWA 3RB6A 2GOLA 3QU4A 4YN4A 4DSLA 3BQ2A 4B9TA 5C0YA 2M9NA 4IR9A 3R9KA 1SZPA 2E1EA 2DPIA 5KT7A 2FMSA 3S6JA 3IG5A 4DEZA 1N5XA 5EE3A 4OJPA 4F72A 5HHHA 3F5AA 4LVSA 2FPMA 3UXPA 2UVWA 1L7NA 2HI0A 3T79A 4KX5A 5J0TA 3CYMA 4GC7A 3GV5B 1WWVA 2PFPA 1LB2B 4NM2A 1XSNA 1PVQA 2OM6A 4ECRA 8ICVA 4J9RA 2W11A 3KTQA 4JB3A 1RQNA 2J6SA 1J2MA 4UB5A 2AJQA 4JUZA 1XSPA 5TISU 4O3MA 1DGJA 2EANA 2HOQA 3SENA 2YX8A 2PFNA 3K4GA 7ICPA 3UQ2A 2KICA 2W8KA 1BVSA 1ZOLA 3WK9A 3HT3A 4RQ4A 1FO4A 2F1JA 2BPGA 2UVVA 2W9MA 2NYVA 4YP3A 2IHNA 4M0AA 2FMPA 5DB9A 3HW8A 4ACOA 3LVVA 4F5RA 1ZQJA 1OUQA 3M9OB 3Q8KA 4F5OA 1X6IA 4EBEA 4NLNA 1XSLA 3C21A 4GIBA 7ICGA 3WK4A 5AIAA 1ZQAA 2A3VA 2OHFA 5DBCA 4I2HA 4DL5A 3GZFA 4KLLA 5KFNA 2BPCA 4UAZA 1YT3A 3L5KA 4K4IA 2HOIA 2FDRA 4JV1A 4CRXA 3M7DA 3RTVA 1WCLA 4TQRA 4QWBA 1LV5A 1N61A 4AYBF 5AKHA 4QZ8A 5ALPA 1ZETA 4DOCA 1FFUA 5EWFA 2LM4A 1KKXA 5J2KA 4NV0A 4ECTA 8ICRA 4QZDA 1JI7A 5DG7A 2IBKA 2ZIWA 1K1QA 2RRDA 1NK0A 2ALZA 1A6SA 1L8OA 1NKCA 5DG8A 2JRZA 2D3DA 2IHMA 4ED0A 2WFAA 2KN7A 4KLOA 1Q46A 2RHFA 4TURA 2NRTA 4XQ8A 2RQ5A 4F4XA 2Z7JA 5KFEA 4I2JA 3WK5A 4C8LA 1BPBA 2WB1F 5GTHU 5HR6A 2DL0A 2LI6A 2HHQA 1K5OA 9ICXA 1L6NA 2VJ4A 2JEGA 2PFQA 5J2EA 2GLEA 1S9FA 3BQ1A 2MUTB 1JN3A 4CF3A 3ETRA 3WKBA 1QSSA 3HP6A 3CW2C 2YY6A 1OW5A 2ZIUB 5ALEA 1Q3UA 2G09A 2FLPA 4B9SA 4FZLA 5KFTA 2XY5A 3QZ8A 2EZXA 2MA1A 4Q44A 3QU7A 2HOFA 2KG5A 1ZXIA 3ZDAA 1CEZA 4R63A 3NASA 2WF9A 4EX6A 3MDCA 3UXNA 3PW7A 2AU0A 5ALSA 2C28A 3SAFA 2KJ5A 3QU5A 1Z4NA 4ECXA 3H0LB 2ASJA 1ZRNA 4ECUA 2C2DA 1N60A 2XY6A 4RQ6A 1Z00B 3C28A 5KG4A 1COKA 4YG2A 3DV9A 2A1AA 2HBMA 2ZJAA 1ZD3A 4MHVA 3M6KA 4DSJA 1KFTA 3C5GA 1B4FA 1T3NA 2D6FC 2OCEA 5HR7A 4B9MA 1WUDA 3FYHA 4M04A 1D8BA 1FIQA 4F4KA 2H3IA 4C8KA 3PW2A 1UCVA 9ICEA 1MN8A 1BPXA 2ZXIA 2MU2A 1PVRA 2I5HA 5ALZA 3ZI4A 5HNKA 3NUQA 1X9MA 4YR2A 1SWVA 3OPXA 9ICVA 2LBOA 4O3OA 2UVUA 1SWWA 3NVZA 2OEHA 3GIJA 2K8AA 3PSPA 2BCSA 1MSWD 5EWEA 5J0QA 5ALLA 3KZXA 1ZQFA 4M6WB 5AK5A 4UAUA 1BGXT 4M9JA 2WAQF 5ALNA 2F3NA 2E1FA 3MFHA 1IIPA 3KD3A 3MR5A 7ICMA 2E5SA 2K60A 5KFQA 4UAWA 3UQ0A 4QZGA 5JU5A 3Q8PB 3H0RB 3N7RC 3UMCA 4DFMA 3CNHA 2EZYA 4PHAA 8ICUA 2VA2A 1QQ6A 1ECWA 4KLHA 4I2IA 2R8KA 1MA7A 2HHTA 2NV3A 1NK7A 3GIKA 4F5PA 1RXVA 2W03A 4NM1A 4F8RA 5DGBA 1ZQVA 4J9KA 3QZ7A 2ZIUA 2BQRA 4UATA 3C1ZA 4TUPA 3I76A 1PZNA 4NJ8A 3ISBA 3OHAA 3PSFA 3VC8A 3EPGA 1XS9D 5KTQA 2ZTCA 1RDFA 3SAHA 3GILA 3BQTA 3D2NA 2EAMA 3LYSA 2J6UA 2KKPA 1ZQYA 4O3PA 3M8SA 8ICTA 7ICHA 3LK9A 4DQQA 4Y2JA 2BCUA 5AKYA 4EBCA 8ICEA 3UMBA 1ZRMA 4UAVA 5D46A 1M6YA 4UB4A 4DFKA 2HHVA 1QH9A 2P66A 3QX7A 5KFUA 2PXIA 4QW9A 1V9PA 4RPXA 2C2EA 4Q8EA 2Q4TA 3JPRA 2HDOA 3GDXA 3C2MA 4O5CA 4I2BA 4OJ6A 4BXOB 2YMMA 4DFPA 3TKAA 1B22A 4Z6DA 5B66U 1RYRA 5KG3A 3G6XA 4F5QA 2W3SA 5ALTA 2G06A 3F2BA 2YTUA 4GFJA 4RNMA 4ED1A 5AK6A 1NJYA 5KFWA 4C7ZA 4I29A 4ELTA 2LYAA 3WK6A 3OHBA 2YN4A 3FDSA 5HMMA 5EE1A 1ZD4A 5KFLA 3BJYA 1DXSA 2BCVA 1Z19A 3F5EA 4NLGA 2VA3A 1NJXA 3TADA 1RQLA 1SB3C 2XVTA 4ECQA 5L1IA 2R8JA 1DK3A 1JRPA 1UA0A 3MR2A 4F4WA 5AKJA 5J2JA 2HVHA 1D9DA 4RQNA 1MQ2A 3RBDA 1KL9A 2HBKA 9ICHA 9ICGA 5DB8A 2H3VA 4DL4A 2OWOA 1U4BA 1KN5A 5BOMA 1NZBA 3RH4A 5AM2A 4QZEA 3MABA 3HWTA 3BQ0A 1NK4A 4EBDA 3JPSA 3UPQA 2C2RA 1NJWA 4I28A 3RFAA 2V4RA 4MEXA 1T7PA 5KFGA 4DFJA 3Q8LA 1V97A 5EE9A 3IV6A 3E58A 4RU9A 2K4PA 9ICJA 2YMQA 1L5UA 5CA7A 4I2FA 2JR5A 4RZRA 2H3QA 7ICNA 3THVA 4O3SA 8ICPA 3HX0A 3J81j 4M6WA 1QQ5A 3N7PD 3WKAA 5F3XB 5EWGA 2ATLA 1X40A 1UT8A 3PR5B 1BNOA 3MR6A 3C29A 5DB7A 4MFAA 1ZQDA 1KLNA 4UB8U 2ZJ8A 3PO5A 2ZIWB 4NXZA 4O5EA 5ALFA 5ALIA 3HJEA 4C7YA 3RJJA 3E0FA 2W8LA 4I2EA 3RJFA 2YB1A 1J2NA 3UXOA 4UBBA 4UBCA 4C4TA 2KSOA 4IRDA 1WG8A 4TQSA 2HHWA 3N4MB 2BR0A 1ZQTA 1U9LA 3RB3A 5L1MA 3AQFA 3BQ7A 3QUTA 5KG6A 2JV3A 3NVYA 5KNIA 5DG9A 3K1ZA 1UT5A 5L1KA 3AUOA 3D2QA 2FPLA 3V6HA 5DBBA 4BGDA 5JUMA 2XO7A 4KLUA 1U47A 1O08A 2KIWA 3PNCA 1NKEA 2PMZC 1F0MA 4DQPA 1UPHA 1RPLA 4F4ZA 4KLDA 2Y9TA 4UAYA 2LYHA 3WKDA 4KX3A 3ISDA 2BDPA 2W9CB 1B43A 1S0VA 1HJPA 5K4LA 2FI1A 5AKXA 4RUAA 4J9SA 3UMGA 4UB2A 4P2HA 3HRDD 4KLFA 3WKEA 2KD1A 5DDMA 4KN4A 4YVZA 5HMLA 3TACB 5KFVA 3Q8MA 5BPCA 2XCAA 5KG5A 1L7OA 3KZIU 1YZ7A 3N97B 7ICTA 2K8BB 4O5KA 1TK0A 2DPJA 3MC1A 1TK8A 1ZJNA 2I1QA 1NI3A 5KT4A 4QWDA 1SKSA 4DF4A 5KT3A 9ICCA 4Z6CA 3RH5A 8ICLA 7ICIA 1O03A 2E3TA 2KOBA 1XWLA 4Q45A 1F5SA 1WWUA 4OJLA 5KFAA 2KHQA 4J9PA 3C2LA 4F3OA 8ICSA 4AYBC 2ZUDA 2JGAA 5AK3A 8ICCA 3RBEA 4B9NA 7ICQA 1D8LA 2R18A 4PJ0U 5J0RA 4DS4A 4DL6A 5AM0A 4UB3A 1L8LA 5G5HA 3JPNA 2VA8A 1ZQSA 4B9LA 1DRGA 2FE9A 4DQSA 4FS2A 1SXEA 1NJZA 2KV2A 4Y2VA 1Z00A 7ICJA 1BPZA 3GU3A 4IQTA 2ISPA 4M2YA 2ZIXA 4O0IA 4Y2YA 2FLNA 4Y2SA 3RB0A 4E0DA 2MRLA 3RJHA 3Q8SB 7ICVA 1ZQXA 3BS5A 4F2SA 3H8WA 1U49A 2NO4A 1SL1A 2KE7A 4XUSA 3HKZF 4O9MA 5AI9A 3IN5A 3TAPA 1NK5A 4F50A 2JMGA 2F76X 4OJ5A 3C5FA 1SIJA 2DKXA 1UHUA 4UW9A 4DL2A 4K4GA 3D6JA 5AKIA 4YQWA 3F2DA 4ED2A 3SV4A 8ICBA 5J2CA 5CRXA 4NLKA 3TARA 1N56A 3IP4B 2KHVA 2ZIXB 4PH5A 2HHSA 4EEYA 4CF4A 8ICHA 4RQ8A 3DDHA 4FZNA 4GLXA 1JXLA 3OSPA 4IL6U 4DOAA 3H8SA 2QB1A 3MDAA 2P35A 2JEJA 2ZG6A 4J03A 4ICAA 2KK0A 2A1JA 3E2EA 3BZCA 3H0MB 4RQ2A 3SZ2A 2IA6A 4Q8FA 4PHEA 2H3ZA 4PZOA 2BDUA 1CI4A 3OSNA 8ICIA 5ALRA 4PHPA 1X42A 1Y88A 4GXJA 4C8OA 4NL9C 4BXOA 5J0PA 3ZDBA 3QXGA 2Q0ZX 3V72A 2MAXA 3QYPA 2XC9A 3RJKA 1JIHA 1ZYQA 2KTQA 2PI4A 4J9MA 4J9QA 1ZQOA 2B0CA 3N7SC 5ALKA 5KFPA 2ZTEA 5KFRA 1Z1BA 9ICOA 4Y2PA 3RR8A
chains in the Genus database with same CATH topology
2KICA 2JH7A 2KJ9A 3NUQA 1XO0A 3AL0B 3ONNA 1ED1A 2KKVA 1XNSA 2WAQC 2WB1F 2G0AA 3HKZF 3OPXA 3PSIA 2K4HA 5HR6A 4QJFB 2LBOA 3IN5A 3LVWA 2F2AB 3ICXA 4PL1A 2H3QA 2KEYA 2KD1A 2JH1A 3M6ZA 1GO3F 2G5HB 2KJ8A 2JMGA 2LYBA 3ALRA 2F76X 2ZIVB 3L3FX 2K8AA 4OJ5A 3PSPA 4P0QB 4U6PA 2VJ4A 4P0PA 1L6NA 4PL2A 1P7DA 2Q4TA 3KZXA 2OYYA 5KL1B 4P0PB 2RP5A 4P0QA 2PMZF 4FZMA 2K8BB 4FE3A 3N7PD 3PSTA 4U7CA 2HMXA 2F8LA 2G08A 2G5IB 4OJ6A 2K4IA 3LVVA 4ACOA 3F2DA 3PZPA 1OUQA 2WAQF 2WB1C 3HKZC 2CRXA 2E1FA 2W04A 5CRXA 4NWIA 1T94A 2ZIUB 3KFUF 1IIPA 2VKQA 3C29A 2G09A 2DF4B 1Q3UA 3IP4B 2CN1A 3D2SA 2KHVA 2OXOA 2ZIXB 2ZIWB 4FZLA 1F44A 4A8EA 2E5SA 2G06A 3F2BA 4GFJA 2GOLA 2CPRA 1Q3VA 2A3VA 3AQEA 2XICA 3H0RB 3N7RC 3NRWA 3GZFA 2HBLA 2KNJA 2LYAA 4OJOA 2KOBA 4FZNA 4OJLA 5C0YA 2MA1A 3E0FA 1ECWA 2KHQA 1KBUA 2HOFA 4BUGA 2HBJA 2E1EA 2LHTA 3VCBA 1TAMA 1YT3A 4AYBC 1Z19A 3F53A 2LKYA 2YB1A 2Y0SC 2NV3A 3F5EA 2ZG6A 2JGAA 1MA7A 2XVTA 4NLCA 4ICAA 2HOIA 3IG5A 2KVCA 3DEEA 3SAFA 3CP8A 3H0MB 2KJ5A 2K89A 2N1RA 4NLBA 4OJPA 4CRXA 2R18A 3H0LB 4WJ3B 2Y0SF 3SQIA 2M0NA 3M7DA 3F5AA 4CGZA 2K8CB 2H3ZA 2W03A 2BDUA 2YB4A 2H3FA 4AYBF 1URJA 1HIWA 2GH1A 3AQFA 2G07A 3RF9A 2HBKA 3C28A 3SMVA 3SAGA 2DGZA 4KX5A 3T79A 3CRXA 2HBMA 2W7PA 2K4EA 2ZXHA 3CYMA 4NV0A 2H3VA 4QIWC 3MGVA 1DRGA 3M6KA 2ZIUA 4OO1J 2VJ5A 2ZIVA 4BX9C 4IC9A 3O0FA 3K1ZA 2KV2A 2XIDA 2ZIWA 1SZHA 4C0ZA 1NZBA 4BJQA 1PVQA 2OM6A 3PSFA 3D2QA 3VC8A 4CDGA 2RRDA 2D6FC 3GU3A 3F2CA 5HR7A 1A6SA 1WUDA 2JHDA 3SAHA 2ZIXA 3D2NA 2VIXA 4QIWF 3RFAA 5T14A 2OH2A 4KMOB 2KIWA 1D8BA 3LYSA 5A0LA 2PMZC 3N7SC 1HEKA 2MRLA 1ZQ1C 5KL8B 2H3IA 4O3MA 2XI9A 4JMUA 1UPHA 1CRXA 2KKPA 4QNLA 2DQNB 2HOQA 2RHFA 2YX8A 2F77X 4KX3A 2ZXIA 1PVRA 1A0PA 2W7OA 1Z1BA 1PVPA 3IG8A 2Z7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCB A;  3GZF A;  3VC8 A; 
#chains in the Genus database with same CATH topology
 1BNP A;  4DSK A;  1PK1 A;  4B9U A;  3SYZ A;  5L9X A;  4R64 A;  3TI0 A;  5KG2 A;  1D9F A;  4QJF B;  3EUB 2;  3KBB A;  1L7M A;  4I2D A;  2KZM A;  5AIC A;  1ZQU A;  3MGH A;  2G5H B;  8ICX A;  3BDP A;  2WF8 A;  5J29 A;  4C80 A;  3L3F X;  1T3Q A;  4MFC A;  1JUD A;  2E8M A;  1ZQM A;  3FAH A;  3EW9 A;  2HVI A;  1COO A;  4YCX A;  3PZP A;  2MUT A;  1N48 A;  4LJX A;  4X5V A;  4Y2R A;  5KFI A;  3KFU F;  3N28 A;  1X9S A;  1KW4 A;  1Q3V A;  5BOL A;  4EX7 A;  1PK3 A;  3NRW A;  4GXI A;  4QZC A;  2KP7 A;  1X2I A;  4ELV A;  1UA1 A;  2HBJ A;  3M8R A;  1PK1 B;  4NLC A;  3CP8 A;  3KHR A;  2ASL A;  5IIM A;  3H8J A;  4QZ9 A;  4DL3 A;  2E8P A;  5KFO A;  1TAQ A;  4F93 B;  5AI0 A;  2H3F A;  4PZN A;  3KHH A;  1URJ A;  3QE9 Y;  4Q43 A;  3AU2 A;  8ICJ A;  1VJ5 A;  4MFF A;  3OJS A;  2UVR A;  3T5J A;  4JWN A;  5DBA A;  4C0Z A;  1N63 A;  3G6Y A;  3H4B A;  2R8H A;  2E8O A;  5AKE A;  4YMM A;  2JHD A;  1T4G A;  4KLI A;  4QIW F;  4FO6 A;  4EYI B;  4DWI A;  1J97 A;  4O3N A;  4US8 A;  2A1J B;  3Q8Q B;  4B9V A;  3I1Y A;  1S76 D;  1YZ6 A;  3NS1 A;  1A0P A;  1NK9 A;  1ZD5 A;  3Q8R B;  5KAF U;  2LMR A;  9ICR A;  5KFC A;  1VDV A;  5ALX A;  3V6K A;  2KKV A;  3BZK A;  2WAQ C;  3OJU A;  4NLZ A;  1JXE A;  1K1S A;  3RJG A;  4ED6 A;  1XU4 A;  2BQ3 A;  5ALG A;  1IM4 A;  3KHL A;  2YML A;  4KIT B;  5IIK A;  4P0P B;  4DL7 A;  3EPI A;  4K4H A;  5J2G A;  1JMS A;  1HUO A;  2F8L A;  2G08 A;  4P0Q B;  2CRX A;  3HKZ C;  9ICL A;  9ICU A;  4NWI A;  1ZD2 P;  2XY7 A;  3D2S A;  8ICN A;  4ED8 A;  1Q8K A;  2NRV A;  8ICQ A;  3PVX A;  2HBL A;  4G9B A;  5J2B A;  2W9B B;  2RDI A;  5AM1 A;  4KLG A;  4RUC A;  1KFD A;  1L3U A;  2I9G A;  4IRC A;  7ICL A;  4NLB A;  1Z4O A;  2IOF K;  1QCK A;  4CF5 A;  1ZQQ A;  4DOB A;  2QB0 B;  4M9N A;  1DGS A;  4UB6 U;  4NY8 A;  5J8Y A;  5GTI U;  5J0W A;  4F92 B;  2VJ5 A;  4IC9 A;  1KRP A;  1X6J A;  2JEF A;  2JXJ A;  5IIO A;  4DSF A;  4XA5 A;  4YD1 A;  3KHG A;  2DBY A;  1S0N A;  8ICF A;  3QU9 A;  3FM9 A;  4I27 A;  9ICB A;  3HPO A;  3LWL A;  5KL8 B;  5J0U A;  5J2D A;  2F77 X;  4YD2 A;  1RM6 C;  1IXR A;  3GQC A;  5D4B A;  3PML A;  2XGP A;  3HIL A;  5DQH A;  3ONN A;  2KSO B;  3GII A;  2K4H A;  1ZQK A;  3WKC A;  2F2A B;  4PL1 A;  3M9M B;  3H8M A;  2J6T A;  3JPP A;  3L4P A;  5IIL A;  2BZF A;  2ISO A;  4RQ0 A;  5CEH A;  5H2F U;  5HHI A;  4U7C A;  4RPZ A;  5JRT A;  2WB1 C;  4M9G A;  1TK5 A;  4M47 A;  7ICU A;  3AEV A;  1T94 A;  2BHN A;  1RYU A;  4BWJ A;  2YMP A;  4R66 A;  1UQV A;  7ICO A;  1SV0 C;  3BS7 A;  4ED3 A;  4OJO A;  4DCC A;  5DQI A;  3TAQ A;  3RB4 A;  3VCB A;  4FBU A;  4QZB A;  2Y0S C;  2KZZ A;  2EAO A;  2KVC A;  2W9C A;  2BGW A;  1SV0 A;  3A0H U;  1ZQZ A;  4KTQ A;  3BS5 B;  5KFX A;  4DSI A;  4YFK A;  2YB4 A;  1RZT A;  2P6U A;  1TFR A;  1ZQN A;  5J2F A;  2GWS A;  2ZIV A;  1SZH A;  2BQU A;  4BJQ A;  2FJ6 A;  2FLL A;  3RAQ A;  5DB6 A;  3PV8 A;  2R8I A;  3WK7 A;  4QWA A;  4RQ5 A;  2WHE A;  4KLM A;  1Z1V A;  1ZQI A;  2HHX A;  4ZOH C;  2JEI A;  4EZ6 A;  3PMN A;  5ALJ A;  9ICM A;  2V4Q A;  5J2I A;  2HW3 A;  1DK2 A;  2W7O A;  2BCR A;  3NTU A;  2ODG A;  1S8O A;  1XO0 A;  2QB0 A;  1BPE A;  4QZF A;  3RRH A;  5G5G A;  3NRZ A;  1XNS A;  3RH6 A;  4O3R A;  1TV9 A;  4FFD A;  1LVH A;  2KEY A;  3SD7 A;  4PPX A;  2KJ8 A;  5AM5 A;  3C23 A;  8ICA A;  3SR6 A;  2BPF A;  4P0P A;  4C8N A;  1A77 A;  1P7D A;  2OYY A;  2PKE A;  3B0Y A;  5HP4 A;  1X9X A;  2MSN A;  5DLF A;  1LKY A;  2WF5 A;  3V7J A;  3ISC A;  3PX6 A;  4KLQ A;  4EZ9 A;  2CPR A;  1ZQW A;  2W43 A;  1H38 A;  5KT6 A;  1EXN A;  5J2A A;  5DLG A;  2ESE A;  1JRO A;  4HAI A;  1CUK A;  2LKY A;  1S5L U;  4MEY A;  3UM9 A;  2RDJ A;  2F1I A;  3TQ1 A;  3OGU A;  3AU6 A;  5ALV A;  4PGQ A;  4PHD A;  4RT3 A;  1ZQH A;  1ZQB A;  3RR7 A;  4EEN A;  4BDP A;  1S77 D;  1Z3E B;  4AP9 A;  4I2C A;  8ICO A;  2B6G A;  2QKQ A;  3MGI A;  1V85 A;  2AGO A;  4ECZ A;  2ZXH A;  4J9N A;  1X9W A;  4ZH4 A;  4G3I A;  2F44 A;  4KMU A;  8ICZ A;  4RQM A;  4CDG A;  9ICQ A;  3F2C A;  1ZQG A;  3AN1 A;  4DFD A;  2CXY A;  4JK1 A;  4IRK A;  4C8M A;  4DSE A;  4US9 A;  2JZB B;  5T14 A;  3QUC A;  2F8K A;  4QW8 A;  3PO4 A;  1ZQ1 C;  4JMU A;  2EQY A;  1CRX A;  2NRZ A;  5AM4 A;  1QSY A;  1L7P A;  4UAR A;  4P4P A;  7ICE A;  1S10 A;  5B5E U;  5AKL A;  3AL0 B;  3EWA A;  3ZD9 A;  4QWC A;  4M9L A;  4CCH A;  4KLT A;  3T5H A;  2PFO A;  4UQG A;  3M1Y A;  4USA A;  2ZIV B;  5FP0 A;  4JV2 A;  5ALQ A;  4PL2 A;  5KT5 A;  1KFS A;  2EZZ A;  4PGX A;  2KZ3 A;  2HMX A;  2AQ0 A;  2K4I A;  3KKA C;  2WF7 A;  1L3V A;  2XGQ A;  4QWE A;  1IV8 A;  3IDW A;  1KSP A;  2VKQ A;  4EYH B;  1WYG A;  7ICK A;  2EH9 A;  2JZB A;  2B21 A;  2Y9U A;  2XIC A;  3V7L A;  4ECW A;  4QZI A;  1BPD A;  4JV0 A;  3QEA Z;  2KVS A;  2LHT A;  3PW0 A;  3F53 A;  4YMN A;  3ZDD A;  4DLE A;  3DEE A;  4TUQ A;  2K89 A;  2ZTD A;  3RJI A;  2O6K A;  4KN7 A;  4EEL A;  2W54 A;  3MFI A;  1ZQP A;  4OCZ A;  2LPE A;  2K8C B;  3FC4 A;  2ZUC A;  3NVW A;  4Z6F A;  2GH1 A;  3ZD8 A;  9ICK A;  2QLT A;  3PW4 A;  3CRX A;  2W7P A;  4ED7 A;  3ED5 A;  3MGV A;  3EZ5 A;  1ZQR A;  1QLN A;  5KFB A;  3C2K A;  4BX9 C;  5KFZ A;  1ZQL A;  5TZV A;  4DQR A;  4LZD A;  5KG0 A;  3H40 A;  2LM1 A;  2KMD A;  5KG1 A;  2AGQ A;  4CNQ A;  2XCP A;  8ICM A;  2BCQ A;  2L5Y A;  4KLJ A;  1X66 A;  5C5J A;  4J9O A;  2HSZ A;  2AHO B;  2R8G A;  4RQ3 A;  2XI9 A;  5E79 U;  4QNL A;  1QTM A;  1SL2 A;  5IIJ A;  1SKR A;  2IOH A;  4C4S A;  9ICI A;  5ALW A;  2NO5 A;  2FMQ A;  2IOF A;  2DKZ A;  1C7Y A;  4CE6 A;  2G0A A;  4TUS A;  3ICX A;  1TE2 A;  2H5X A;  5III A;  1RXW A;  1GO3 F;  4RT2 A;  5J0X A;  4IQU A;  4ECY A;  4GXK A;  4NL9 A;  1TKD A;  1SL0 A;  1ZQE A;  2PI5 A;  4FE3 A;  2G5I B;  3T5K A;  9ICS A;  5KFF A;  4QZA A;  2EDU A;  3KKA A;  2W9B A;  4F4Y A;  4ECS A;  3KOO A;  1KDH A;  2HHU A;  3AQE A;  4MF2 A;  5CP2 A;  3T5L A;  1KQQ A;  4B6J A;  1NNL A;  4DLG A;  4F2R A;  3JPO A;  1S0M A;  5AKG A;  4BUG A;  2W9A A;  1ZQC A;  5KFJ A;  1VLB A;  2DFL A;  5KFS A;  1NOM A;  4R65 A;  1QSL A;  2N1R A;  5AHX A;  1NKB A;  3SQI A;  3GV8 B;  3SI8 A;  5CWR A;  8ICW A;  2Y1J A;  2G07 A;  2WF6 A;  4R8U B;  9ICA A;  4RPY A;  5L1L A;  2K4E A;  9ICT A;  4QIW C;  2WTF A;  4OO1 J;  5AI5 A;  1KTQ A;  4IQV A;  5KFY A;  1N5W A;  5F9N A;  4F5N A;  1FEZ A;  2W3R A;  2AQ4 A;  3T3F A;  5CB1 A;  4IS7 A;  2W55 A;  5ALY A;  1SKW A;  1MQ3 A;  7ICF A;  2VIX A;  1PUZ A;  3I28 A;  2OH2 A;  5KFK A;  3IHQ B;  5KFD A;  4ECV A;  1DOQ A;  1KEJ A;  1SV4 A;  4YXM A;  4YMO A;  3QEB Z;  3G6V A;  7ICS A;  3SV3 A;  1N62 A;  2AXT U;  3ZDE A;  2KJ9 A;  1ED1 A;  5KG7 A;  2F1H A;  2I6X A;  1L3T A;  3PX0 A;  4IQW A;  4LZG A;  3M6Z A;  3SEI A;  2ES6 A;  3ALR A;  3LDA A;  3QUQ A;  4BWM A;  3C1Y A;  5KT2 A;  2KIV A;  5KAI U;  4FZM A;  1D8Y A;  5EOZ A;  3PR4 A;  3GIM A;  2W04 A;  4YR0 A;  4Z6E A;  2NRX A;  4Y2X A;  4UB1 A;  2YQE A;  1V38 A;  5DGA A;  4IR1 A;  3H4D A;  1S0O A;  2C22 A;  5AI4 A;  5ALH A;  5DQG A;  9ICF A;  1KBU A;  2NRW A;  3OTQ A;  1TAM A;  4XRH A;  1ARO P;  4P4M A;  3ZDC A;  2VAN A;  2EAP A;  1C20 A;  5AI8 A;  1A76 A;  4O3Q A;  4DS5 A;  1TAU A;  2Y0S F;  5J0Y A;  4CGZ A;  2V9W A;  4FS1 A;  2ZJ5 A;  1U48 A;  5CR0 A;  1HIW A;  4J9L A;  5AKZ A;  4P4O A;  4R8U A;  4FBT A;  1IG6 A;  2ASD A;  2XID A;  5AM3 A;  2QAR A;  1SXD A;  4GC6 A;  3NGD A;  5EE0 A;  3MR3 A;  4Y2T A;  1L3S A;  9ICW A;  5J0O A;  3H7I A;  4DF8 A;  1HEK A;  2DWQ A;  2KFN A;  2DQN B;  5DDY A;  2RLT A;  3PW5 A;  2AGP A;  3JPQ A;  3IG8 A;  3TAD C;  2JH7 A;  1T8E A;  1AQ6 A;  3M9N B;  8ICG A;  3PSI A;  5ALO A;  3QNM A;  4I2A A;  4Y2U A;  8ICK A;  3K75 D;  2JH1 A;  2GO7 A;  5D49 A;  3NVV A;  4U6P A;  3WU2 U;  4OD0 A;  3IRU A;  2PMZ F;  5F9L A;  2E8N A;  1N2X A;  1U45 A;  1MC8 A;  1RYS A;  2FPK A;  1OXJ A;  4QZH A;  2AH5 A;  2CN1 A;  2P6R A;  2OXO A;  1F44 A;  1JAL A;  4A8E A;  3RAX A;  2BKE A;  3AM9 A;  4EEK A;  3QU2 A;  5ALM A;  4F91 B;  5CHG A;  3PY8 A;  2KNJ A;  3V7K A;  1NK8 A;  1B0X A;  1QQ7 A;  5CJ7 A;  2A19 A;  4RQ7 A;  4RQ1 A;  4HYK A;  3GV7 B;  9ICP A;  3PX4 A;  5KFH A;  3ORY A;  3B0X A;  2IMW P;  4WJ3 B;  3AMZ A;  2M0N A;  5JTI A;  3TFS A;  3QUB A;  3RRG A;  1RG6 A;  1LKY B;  3RF9 A;  3SMV A;  3SAG A;  2DGZ A;  4C4R A;  1ZJM A;  4JWM A;  5AK4 A;  4YXJ A;  1JX4 A;  2Y1I A;  3K1R B;  4F71 A;  3LWM A;  4DO9 A;  3RJE A;  5J0S A;  3B9J A;  2HCF A;  2DUY A;  3O0F A;  1S97 A;  2D8C A;  1XC9 A;  1NK6 A;  3IM1 A;  5J8Y C;  5ALD A;  4KMO B;  3MBY A;  1SGG A;  5A0L A;  1FFV A;  4I2G A;  4MF8 A;  8ICY A;  9ICN A;  5J2H A;  7ICR A;  1BPY A;  2ZUB A;  5AI6 A;  1XO1 A;  5ALU A;  4YR3 A;  3TFR A;  3A0B U;  5KFM A;  1PVP A;  3EYZ A;  4RNO A;  3ETL A;  3V6J A;  2KFZ A;  1NZP A;  5IIN A;  3LVW A;  4PGY A;  2LYB A;  4ELU A;  5L1J A;  5AKK A;  5AIB A;  4RNN A;  2QAR B;  5KL1 B;  4KLE A;  2RP5 A;  4P0Q A;  4Y2Q A;  3JPT A;  3PST A;  4UAS A;  1WCN A;  3WK8 A;  1TVA A;  4KLS A;  1HUZ A;  3GFK B;  3U26 A;  3TAN A;  4M9H A;  4DQI A;  2DF4 B;  5DKW A;  3RB6 A;  2GOL A;  3QU4 A;  4YN4 A;  4DSL A;  3BQ2 A;  4B9T A;  5C0Y A;  2M9N A;  4IR9 A;  3R9K A;  1SZP A;  2E1E A;  2DPI A;  5KT7 A;  2FMS A;  3S6J A;  3IG5 A;  4DEZ A;  1N5X A;  5EE3 A;  4OJP A;  4F72 A;  5HHH A;  3F5A A;  4LVS A;  2FPM A;  3UXP A;  2UVW A;  1L7N A;  2HI0 A;  3T79 A;  4KX5 A;  5J0T A;  3CYM A;  4GC7 A;  3GV5 B;  1WWV A;  2PFP A;  1LB2 B;  4NM2 A;  1XSN A;  1PVQ A;  2OM6 A;  4ECR A;  8ICV A;  4J9R A;  2W11 A;  3KTQ A;  4JB3 A;  1RQN A;  2J6S A;  1J2M A;  4UB5 A;  2AJQ A;  4JUZ A;  1XSP A;  5TIS U;  4O3M A;  1DGJ A;  2EAN A;  2HOQ A;  3SEN A;  2YX8 A;  2PFN A;  3K4G A;  7ICP A;  3UQ2 A;  2KIC A;  2W8K A;  1BVS A;  1ZOL A;  3WK9 A;  3HT3 A;  4RQ4 A;  1FO4 A;  2F1J A;  2BPG A;  2UVV A;  2W9M A;  2NYV A;  4YP3 A;  2IHN A;  4M0A A;  2FMP A;  5DB9 A;  3HW8 A;  4ACO A;  3LVV A;  4F5R A;  1ZQJ A;  1OUQ A;  3M9O B;  3Q8K A;  4F5O A;  1X6I A;  4EBE A;  4NLN A;  1XSL A;  3C21 A;  4GIB A;  7ICG A;  3WK4 A;  5AIA A;  1ZQA A;  2A3V A;  2OHF A;  5DBC A;  4I2H A;  4DL5 A;  3GZF A;  4KLL A;  5KFN A;  2BPC A;  4UAZ A;  1YT3 A;  3L5K A;  4K4I A;  2HOI A;  2FDR A;  4JV1 A;  4CRX A;  3M7D A;  3RTV A;  1WCL A;  4TQR A;  4QWB A;  1LV5 A;  1N61 A;  4AYB F;  5AKH A;  4QZ8 A;  5ALP A;  1ZET A;  4DOC A;  1FFU A;  5EWF A;  2LM4 A;  1KKX A;  5J2K A;  4NV0 A;  4ECT A;  8ICR A;  4QZD A;  1JI7 A;  5DG7 A;  2IBK A;  2ZIW A;  1K1Q A;  2RRD A;  1NK0 A;  2ALZ A;  1A6S A;  1L8O A;  1NKC A;  5DG8 A;  2JRZ A;  2D3D A;  2IHM A;  4ED0 A;  2WFA A;  2KN7 A;  4KLO A;  1Q46 A;  2RHF A;  4TUR A;  2NRT A;  4XQ8 A;  2RQ5 A;  4F4X A;  2Z7J A;  5KFE A;  4I2J A;  3WK5 A;  4C8L A;  1BPB A;  2WB1 F;  5GTH U;  5HR6 A;  2DL0 A;  2LI6 A;  2HHQ A;  1K5O A;  9ICX A;  1L6N A;  2VJ4 A;  2JEG A;  2PFQ A;  5J2E A;  2GLE A;  1S9F A;  3BQ1 A;  2MUT B;  1JN3 A;  4CF3 A;  3ETR A;  3WKB A;  1QSS A;  3HP6 A;  3CW2 C;  2YY6 A;  1OW5 A;  2ZIU B;  5ALE A;  1Q3U A;  2G09 A;  2FLP A;  4B9S A;  4FZL A;  5KFT A;  2XY5 A;  3QZ8 A;  2EZX A;  2MA1 A;  4Q44 A;  3QU7 A;  2HOF A;  2KG5 A;  1ZXI A;  3ZDA A;  1CEZ A;  4R63 A;  3NAS A;  2WF9 A;  4EX6 A;  3MDC A;  3UXN A;  3PW7 A;  2AU0 A;  5ALS A;  2C28 A;  3SAF A;  2KJ5 A;  3QU5 A;  1Z4N A;  4ECX A;  3H0L B;  2ASJ A;  1ZRN A;  4ECU A;  2C2D A;  1N60 A;  2XY6 A;  4RQ6 A;  1Z00 B;  3C28 A;  5KG4 A;  1COK A;  4YG2 A;  3DV9 A;  2A1A A;  2HBM A;  2ZJA A;  1ZD3 A;  4MHV A;  3M6K A;  4DSJ A;  1KFT A;  3C5G A;  1B4F A;  1T3N A;  2D6F C;  2OCE A;  5HR7 A;  4B9M A;  1WUD A;  3FYH A;  4M04 A;  1D8B A;  1FIQ A;  4F4K A;  2H3I A;  4C8K A;  3PW2 A;  1UCV A;  9ICE A;  1MN8 A;  1BPX A;  2ZXI A;  2MU2 A;  1PVR A;  2I5H A;  5ALZ A;  3ZI4 A;  5HNK A;  3NUQ A;  1X9M A;  4YR2 A;  1SWV A;  3OPX A;  9ICV A;  2LBO A;  4O3O A;  2UVU A;  1SWW A;  3NVZ A;  2OEH A;  3GIJ A;  2K8A A;  3PSP A;  2BCS A;  1MSW D;  5EWE A;  5J0Q A;  5ALL A;  3KZX A;  1ZQF A;  4M6W B;  5AK5 A;  4UAU A;  1BGX T;  4M9J A;  2WAQ F;  5ALN A;  2F3N A;  2E1F A;  3MFH A;  1IIP A;  3KD3 A;  3MR5 A;  7ICM A;  2E5S A;  2K60 A;  5KFQ A;  4UAW A;  3UQ0 A;  4QZG A;  5JU5 A;  3Q8P B;  3H0R B;  3N7R C;  3UMC A;  4DFM A;  3CNH A;  2EZY A;  4PHA A;  8ICU A;  2VA2 A;  1QQ6 A;  1ECW A;  4KLH A;  4I2I A;  2R8K A;  1MA7 A;  2HHT A;  2NV3 A;  1NK7 A;  3GIK A;  4F5P A;  1RXV A;  2W03 A;  4NM1 A;  4F8R A;  5DGB A;  1ZQV A;  4J9K A;  3QZ7 A;  2ZIU A;  2BQR A;  4UAT A;  3C1Z A;  4TUP A;  3I76 A;  1PZN A;  4NJ8 A;  3ISB A;  3OHA A;  3PSF A;  3VC8 A;  3EPG A;  1XS9 D;  5KTQ A;  2ZTC A;  1RDF A;  3SAH A;  3GIL A;  3BQT A;  3D2N A;  2EAM A;  3LYS A;  2J6U A;  2KKP A;  1ZQY A;  4O3P A;  3M8S A;  8ICT A;  7ICH A;  3LK9 A;  4DQQ A;  4Y2J A;  2BCU A;  5AKY A;  4EBC A;  8ICE A;  3UMB A;  1ZRM A;  4UAV A;  5D46 A;  1M6Y A;  4UB4 A;  4DFK A;  2HHV A;  1QH9 A;  2P66 A;  3QX7 A;  5KFU A;  2PXI A;  4QW9 A;  1V9P A;  4RPX A;  2C2E A;  4Q8E A;  2Q4T A;  3JPR A;  2HDO A;  3GDX A;  3C2M A;  4O5C A;  4I2B A;  4OJ6 A;  4BXO B;  2YMM A;  4DFP A;  3TKA A;  1B22 A;  4Z6D A;  5B66 U;  1RYR A;  5KG3 A;  3G6X A;  4F5Q A;  2W3S A;  5ALT A;  2G06 A;  3F2B A;  2YTU A;  4GFJ A;  4RNM A;  4ED1 A;  5AK6 A;  1NJY A;  5KFW A;  4C7Z A;  4I29 A;  4ELT A;  2LYA A;  3WK6 A;  3OHB A;  2YN4 A;  3FDS A;  5HMM A;  5EE1 A;  1ZD4 A;  5KFL A;  3BJY A;  1DXS A;  2BCV A;  1Z19 A;  3F5E A;  4NLG A;  2VA3 A;  1NJX A;  3TAD A;  1RQL A;  1SB3 C;  2XVT A;  4ECQ A;  5L1I A;  2R8J A;  1DK3 A;  1JRP A;  1UA0 A;  3MR2 A;  4F4W A;  5AKJ A;  5J2J A;  2HVH A;  1D9D A;  4RQN A;  1MQ2 A;  3RBD A;  1KL9 A;  2HBK A;  9ICH A;  9ICG A;  5DB8 A;  2H3V A;  4DL4 A;  2OWO A;  1U4B A;  1KN5 A;  5BOM A;  1NZB A;  3RH4 A;  5AM2 A;  4QZE A;  3MAB A;  3HWT A;  3BQ0 A;  1NK4 A;  4EBD A;  3JPS A;  3UPQ A;  2C2R A;  1NJW A;  4I28 A;  3RFA A;  2V4R A;  4MEX A;  1T7P A;  5KFG A;  4DFJ A;  3Q8L A;  1V97 A;  5EE9 A;  3IV6 A;  3E58 A;  4RU9 A;  2K4P A;  9ICJ A;  2YMQ A;  1L5U A;  5CA7 A;  4I2F A;  2JR5 A;  4RZR A;  2H3Q A;  7ICN A;  3THV A;  4O3S A;  8ICP A;  3HX0 A;  3J81 j;  4M6W A;  1QQ5 A;  3N7P D;  3WKA A;  5F3X B;  5EWG A;  2ATL A;  1X40 A;  1UT8 A;  3PR5 B;  1BNO A;  3MR6 A;  3C29 A;  5DB7 A;  4MFA A;  1ZQD A;  1KLN A;  4UB8 U;  2ZJ8 A;  3PO5 A;  2ZIW B;  4NXZ A;  4O5E A;  5ALF A;  5ALI A;  3HJE A;  4C7Y A;  3RJJ A;  3E0F A;  2W8L A;  4I2E A;  3RJF A;  2YB1 A;  1J2N A;  3UXO A;  4UBB A;  4UBC A;  4C4T A;  2KSO A;  4IRD A;  1WG8 A;  4TQS A;  2HHW A;  3N4M B;  2BR0 A;  1ZQT A;  1U9L A;  3RB3 A;  5L1M A;  3AQF A;  3BQ7 A;  3QUT A;  5KG6 A;  2JV3 A;  3NVY A;  5KNI A;  5DG9 A;  3K1Z A;  1UT5 A;  5L1K A;  3AUO A;  3D2Q A;  2FPL A;  3V6H A;  5DBB A;  4BGD A;  5JUM A;  2XO7 A;  4KLU A;  1U47 A;  1O08 A;  2KIW A;  3PNC A;  1NKE A;  2PMZ C;  1F0M A;  4DQP A;  1UPH A;  1RPL A;  4F4Z A;  4KLD A;  2Y9T A;  4UAY A;  2LYH A;  3WKD A;  4KX3 A;  3ISD A;  2BDP A;  2W9C B;  1B43 A;  1S0V A;  1HJP A;  5K4L A;  2FI1 A;  5AKX A;  4RUA A;  4J9S A;  3UMG A;  4UB2 A;  4P2H A;  3HRD D;  4KLF A;  3WKE A;  2KD1 A;  5DDM A;  4KN4 A;  4YVZ A;  5HML A;  3TAC B;  5KFV A;  3Q8M A;  5BPC A;  2XCA A;  5KG5 A;  1L7O A;  3KZI U;  1YZ7 A;  3N97 B;  7ICT A;  2K8B B;  4O5K A;  1TK0 A;  2DPJ A;  3MC1 A;  1TK8 A;  1ZJN A;  2I1Q A;  1NI3 A;  5KT4 A;  4QWD A;  1SKS A;  4DF4 A;  5KT3 A;  9ICC A;  4Z6C A;  3RH5 A;  8ICL A;  7ICI A;  1O03 A;  2E3T A;  2KOB A;  1XWL A;  4Q45 A;  1F5S A;  1WWU A;  4OJL A;  5KFA A;  2KHQ A;  4J9P A;  3C2L A;  4F3O A;  8ICS A;  4AYB C;  2ZUD A;  2JGA A;  5AK3 A;  8ICC A;  3RBE A;  4B9N A;  7ICQ A;  1D8L A;  2R18 A;  4PJ0 U;  5J0R A;  4DS4 A;  4DL6 A;  5AM0 A;  4UB3 A;  1L8L A;  5G5H A;  3JPN A;  2VA8 A;  1ZQS A;  4B9L A;  1DRG A;  2FE9 A;  4DQS A;  4FS2 A;  1SXE A;  1NJZ A;  2KV2 A;  4Y2V A;  1Z00 A;  7ICJ A;  1BPZ A;  3GU3 A;  4IQT A;  2ISP A;  4M2Y A;  2ZIX A;  4O0I A;  4Y2Y A;  2FLN A;  4Y2S A;  3RB0 A;  4E0D A;  2MRL A;  3RJH A;  3Q8S B;  7ICV A;  1ZQX A;  3BS5 A;  4F2S A;  3H8W A;  1U49 A;  2NO4 A;  1SL1 A;  2KE7 A;  4XUS A;  3HKZ F;  4O9M A;  5AI9 A;  3IN5 A;  3TAP A;  1NK5 A;  4F50 A;  2JMG A;  2F76 X;  4OJ5 A;  3C5F A;  1SIJ A;  2DKX A;  1UHU A;  4UW9 A;  4DL2 A;  4K4G A;  3D6J A;  5AKI A;  4YQW A;  3F2D A;  4ED2 A;  3SV4 A;  8ICB A;  5J2C A;  5CRX A;  4NLK A;  3TAR A;  1N56 A;  3IP4 B;  2KHV A;  2ZIX B;  4PH5 A;  2HHS A;  4EEY A;  4CF4 A;  8ICH A;  4RQ8 A;  3DDH A;  4FZN A;  4GLX A;  1JXL A;  3OSP A;  4IL6 U;  4DOA A;  3H8S A;  2QB1 A;  3MDA A;  2P35 A;  2JEJ A;  2ZG6 A;  4J03 A;  4ICA A;  2KK0 A;  2A1J A;  3E2E A;  3BZC A;  3H0M B;  4RQ2 A;  3SZ2 A;  2IA6 A;  4Q8F A;  4PHE A;  2H3Z A;  4PZO A;  2BDU A;  1CI4 A;  3OSN A;  8ICI A;  5ALR A;  4PHP A;  1X42 A;  1Y88 A;  4GXJ A;  4C8O A;  4NL9 C;  4BXO A;  5J0P A;  3ZDB A;  3QXG A;  2Q0Z X;  3V72 A;  2MAX A;  3QYP A;  2XC9 A;  3RJK A;  1JIH A;  1ZYQ A;  2KTQ A;  2PI4 A;  4J9M A;  4J9Q A;  1ZQO A;  2B0C A;  3N7S C;  5ALK A;  5KFP A;  2ZTE A;  5KFR A;  1Z1B A;  9ICO A;  4Y2P A;  3RR8 A; 
#chains in the Genus database with same CATH homology
 2KIC A;  2JH7 A;  2KJ9 A;  3NUQ A;  1XO0 A;  3AL0 B;  3ONN A;  1ED1 A;  2KKV A;  1XNS A;  2WAQ C;  2WB1 F;  2G0A A;  3HKZ F;  3OPX A;  3PSI A;  2K4H A;  5HR6 A;  4QJF B;  2LBO A;  3IN5 A;  3LVW A;  2F2A B;  3ICX A;  4PL1 A;  2H3Q A;  2KEY A;  2KD1 A;  2JH1 A;  3M6Z A;  1GO3 F;  2G5H B;  2KJ8 A;  2JMG A;  2LYB A;  3ALR A;  2F76 X;  2ZIV B;  3L3F X;  2K8A A;  4OJ5 A;  3PSP A;  4P0Q B;  4U6P A;  2VJ4 A;  4P0P A;  1L6N A;  4PL2 A;  1P7D A;  2Q4T A;  3KZX A;  2OYY A;  5KL1 B;  4P0P B;  2RP5 A;  4P0Q A;  2PMZ F;  4FZM A;  2K8B B;  4FE3 A;  3N7P D;  3PST A;  4U7C A;  2HMX A;  2F8L A;  2G08 A;  2G5I B;  4OJ6 A;  2K4I A;  3LVV A;  4ACO A;  3F2D A;  3PZP A;  1OUQ A;  2WAQ F;  2WB1 C;  3HKZ C;  2CRX A;  2E1F A;  2W04 A;  5CRX A;  4NWI A;  1T94 A;  2ZIU B;  3KFU F;  1IIP A;  2VKQ A;  3C29 A;  2G09 A;  2DF4 B;  1Q3U A;  3IP4 B;  2CN1 A;  3D2S A;  2KHV A;  2OXO A;  2ZIX B;  2ZIW B;  4FZL A;  1F44 A;  4A8E A;  2E5S A;  2G06 A;  3F2B A;  4GFJ A;  2GOL A;  2CPR A;  1Q3V A;  2A3V A;  3AQE A;  2XIC A;  3H0R B;  3N7R C;  3NRW A;  3GZF A;  2HBL A;  2KNJ A;  2LYA A;  4OJO A;  2KOB A;  4FZN A;  4OJL A;  5C0Y A;  2MA1 A;  3E0F A;  1ECW A;  2KHQ A;  1KBU A;  2HOF A;  4BUG A;  2HBJ A;  2E1E A;  2LHT A;  3VCB A;  1TAM A;  1YT3 A;  4AYB C;  1Z19 A;  3F53 A;  2LKY A;  2YB1 A;  2Y0S C;  2NV3 A;  3F5E A;  2ZG6 A;  2JGA A;  1MA7 A;  2XVT A;  4NLC A;  4ICA A;  2HOI A;  3IG5 A;  2KVC A;  3DEE A;  3SAF A;  3CP8 A;  3H0M B;  2KJ5 A;  2K89 A;  2N1R A;  4NLB A;  4OJP A;  4CRX A;  2R18 A;  3H0L B;  4WJ3 B;  2Y0S F;  3SQI A;  2M0N A;  3M7D A;  3F5A A;  4CGZ A;  2K8C B;  2H3Z A;  2W03 A;  2BDU A;  2YB4 A;  2H3F A;  4AYB F;  1URJ A;  1HIW A;  2GH1 A;  3AQF A;  2G07 A;  3RF9 A;  2HBK A;  3C28 A;  3SMV A;  3SAG A;  2DGZ A;  4KX5 A;  3T79 A;  3CRX A;  2HBM A;  2W7P A;  2K4E A;  2ZXH A;  3CYM A;  4NV0 A;  2H3V A;  4QIW C;  3MGV A;  1DRG A;  3M6K A;  2ZIU A;  4OO1 J;  2VJ5 A;  2ZIV A;  4BX9 C;  4IC9 A;  3O0F A;  3K1Z A;  2KV2 A;  2XID A;  2ZIW A;  1SZH A;  4C0Z A;  1NZB A;  4BJQ A;  1PVQ A;  2OM6 A;  3PSF A;  3D2Q A;  3VC8 A;  4CDG A;  2RRD A;  2D6F C;  3GU3 A;  3F2C A;  5HR7 A;  1A6S A;  1WUD A;  2JHD A;  3SAH A;  2ZIX A;  3D2N A;  2VIX A;  4QIW F;  3RFA A;  5T14 A;  2OH2 A;  4KMO B;  2KIW A;  1D8B A;  3LYS A;  5A0L A;  2PMZ C;  3N7S C;  1HEK A;  2MRL A;  1ZQ1 C;  5KL8 B;  2H3I A;  4O3M A;  2XI9 A;  4JMU A;  1UPH A;  1CRX A;  2KKP A;  4QNL A;  2DQN B;  2HOQ A;  2RHF A;  2YX8 A;  2F77 X;  4KX3 A;  2ZXI A;  1PVR A;  1A0P A;  2W7O A;  1Z1B A;  1PVP A;  3IG8 A;  2Z7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...