4QIWF

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 37
structure length 122
sequence length 122
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwF02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qiwF01
4NLCA 4OO1J 2HBJA 2CPRA 2RHFA 3SAGA 2RRDA 1GO3F 2HBLA 4QIWF 2HBMA 4CGZA 2KV2A 2DGZA 4QJFB 3SAFA 1WUDA 1YT3A 1D8BA 2E1EA 2MA1A 3SAHA 4O3MA 2E1FA 3CYMA 4CDGA 2HBKA 4NLBA 5C0YA
chains in the Genus database with same CATH superfamily
1H2GA 1M57C 5L1KA 5EIBC 5J2TB 5CA0B 1M9NA 3ZBHA 2RJZA 1PVPA 2BQRA 4FZMA 1QR8A 2G0AA 2Y0IA 3QG5A 2AXTZ 1S72V 2E3CA 1SGGA 3ABMB 2VQEB 1V9PA 3H8JA 4M9JA 4DV5B 4P0PA 2C22A 5KHJA 2A7WA 2CGNA 4FZ1A 4DR2B 1ZQCA 1KFSA 2LHTA 4DEZA 5JTIA 3OJUA 9ICMA 3FFQA 1J5EO 4F4YA 4NL9C 1A6SA 4LF5O 1QLNA 4WFGA 5CBFA 1ZRMA 2RMKB 7ICSA 2EIMC 5J0WA 2EIMB 1HNWB 1YF2A 2R8GA 1M6YA 4F6RB 3SPIA 5KFWA 9ICIA 4YXWG 3K5LA 1GKFA 2M0NA 4JV5B 4IC9A 2LYHA 1A77A 2B1GA 4UAZA 2DYSB 4J11A 1GO3F 2EJRA 2LM1A 2F43G 4J9ZB 3CJHA 2EJ7A 1AI7A 2QM8A 5CB1A 3BQ0A 4QWDA 2WLNA 5KX5B 2ODMA 5G5GA 4DR1O 4C80A 4KN7A 2WWWA 4O4JA 4LFBO 4OJ5A 2VQFO 2EZPA 3OR7C 4GC7A 4DS5A 2A79B 3TARA 1OCCC 5ALJA 4IQTA 2AGOA 1Z5WA 3CCUV 2PI4A 4F5RA 2Y4UA 3T2MA 4ED6A 3B77A 3WK7A 3C2KA 2JGDB 2AW9A 4KITB 3CJHB 4O4LA 2KJ5A 3CCEV 1NBMG 2BPGA 4ED3A 5EK0A 2KOBA 5BXZA 5TISU 3ZMZA 3QX7A 5HNKA 1L6NA 4WFHA 2G08A 1TFRA 5E79U 4PI0A 2QB1A 2A1JB 2DKXA 1TK0A 5LA6A 5KFEA 7ICIA 1FJGO 1F51A 1XL4A 5J0SA 2F1MA 5CHGA 1KSPA 1TVKA 3PNCA 1J95A 1Z1VA 1NR1A 2Y48A 2JIZG 1RG6A 4JYBA 4DR5O 4F91B 4LF9O 2JXJA 2AGAA 1WA8B 2IH1C 3OTOO 1VQ9V 4PL1A 4CCHA 3B0XA 2A9HA 1J5EB 4GLXA 4NXNO 2HVHA 2UUCB 1XSLA 1BT8A 2VRZA 5E79Z 2WLJA 1IXRA 1ZQYA 2DF4B 3B8NA 1N0NA 4BIUA 2L5YA 2D6FC 2Q7GA 2XVTA 3GB7C 1NK8A 2YEVA 2FI1A 4UAUA 1WA8A 2CN1A 1JI7A 5HFLA 2CH7A 4WFEA 4JUZA 4B3RO 4JTAB 2KV2A 5JJJB 2FB5A 4DL3A 8ICYA 4I0XB 4DR1B 1ZUQA 2JDIG 1X4TA 3N7RC 5ALEA 1XHXA 4NXNB 4LZGA 2FPLA 3OJSA 9ICOA 1F44A 5ALGA 2JK5C 3QUQA 2JJ1G 1KUQA 3ETEA 3CRQA 4EBEA 1QLEC 5TZVA 2LGWA 1CI4A 4MW3A 3N2GB 2E8MA 2F95B 2JHDA 2HBJA 3ABKB 4ZHQA 1K5OA 2IW5A 4NB5A 2BTQA 2CUGA 7ICKA 5KT6A 5J0UA 2CTRA 4CF4A 2A06H 4C7UA 2AU0A 2JV3A 4F50A 1Q3UA 2GUZA 1YZBA 3EWAA 4J03A 4B9VA 4I2JA 2ATLA 2Q4PA 3Q8SB 2QKCA 2BSKA 1K7DA 3ML0A 5AKLA 2PKEA 1T4GA 4YD1A 4MVUA 1IIPA 2BCUA 2IA6A 2XAGA 3MD0A 5EC2C 3OPXA 2P06A 1KC8W 1ORQC 4OPAA 4LFBB 4CBCA 1NNLA 2BCVA 1FXKC 2UXNA 4MTFA 3S3WA 4IRKA 1T3QA 3SJBC 3RYIA 4BUGA 3RB0A 1B04A 2EBOA 4H37A 4J7ZA 5KHKA 2QM4A 4B3TO 2P22C 2A0LA 2Y69C 3M1YA 4Y2PA 2QTSA 4PH5A 4QZGA 4X88A 5F3XB 4ZBMA 2IOFK 3THVA 2F93B 2MW2B 4NR1A 4OXSA 4DV1O 3DEEA 3G6XA 4ELTA 5KG4A 2VIXA 3CYOA 4YHHB 2M6YA 1XC9A 1OCRC 1PD3A 4JI4B 3P3PA 3DV9A 1YJ9V 3QUCA 2CDYA 3OSNA 9ICJA 1Y74B 4ZOLA 1Q6IA 1RSOB 2QWQB 4WFFA 2BCRA 1L8OA 1ZWIC 3LDAA 5D46A 5DQHA 1MABG 4JYYA 3FC4A 1LUVA 3M8SA 1R73A 1JOYA 4UB8Z 3I5DA 3OMIB 5J2JA 5KFIA 3ZRSA 1Q3VA 4ZHQB 2OTLV 9ICVA 4NJ8A 1K1QA 2WF5A 4X1KB 3THOA 3K06A 2JEFA 1D9FA 1LV5A 2F1JA 5JH7B 1XEQA 4JI0O 1HDJA 2RHFA 1QQCA 3RYCA 3K1RB 4OJ6A 2JS5A 3QF7A 5FPRA 3KD3A 3SYOA 4FFBA 2E3TA 1NJWA 1NKEA 1URFA 4GIBA 2VJ5A 4FS1A 3GWKC 3BA9A 4JK1A 4DR6B 3JD3A 2BHNA 4LFAO 2KTQA 1U9LA 3HRDD 1K8AW 2W9CA 2BDPA 1BZKA 1PV0A 1S5LZ 4MW8A 3AG3C 4BGDA 4Y2JA 2Q7HA 2DYSC 3QE9Y 1IBKB 2LW1A 1NH2D 1LKYB 5EZYA 4QWAA 5AM5A 4PJ0Z 4JV5O 2E75B 1Q81W 3P3NA 3TAPA 1HNZO 4I9WA 4PGYA 3G6BA 3H8WA 1YXBA 3C3SA 4D6TH 3V6KA 4I50A 5KG5A 1JVMA 1LR1A 5BOMA 2FL4A 4RPYA 4FPPA 3ZRVA 4LNUB 5J9PC 1N5XA 4UB6Z 4BW9A 3T79A 4NV0A 3QZ7A 2P67A 5EE1A 2DWEC 4K0KO 3Q4HA 4JI1B 4ED2A 1I0HA 3OTOB 3HJEA 5LYJB 2V7QG 4U7OA 5KA6A 3RYFA 1NZBA 3HKCA 5TISZ 3N97B 2GHYA 2P6JA 2G5HB 3APOA 3CSXA 4OO1J 3QU9A 2ETNA 1RYSA 2AHOB 2AQ0A 5J0XA 1UA0A 3C21A 4I28A 2N74A 1RDFA 4LVSA 4DFDA 3DXRB 4WFBV 1N33O 1TGOA 3ZD9A 3CMEV 5JUMA 1K5QA 3H0LB 4HBNA 3UMBA 2EIKC 2KD1A 2KIVA 2R72A 4LF8B 5ALRA 1VP7A 2CK3G 8ICBA 2HVIA 2RNBA 4EYIB 4PZNA 4TV8A 2WTFA 4NTYA 5AHXA 9ICNA 2H5XA 1YEWA 1N60A 4BDPA 1TUEB 2JH7A 1OV9A 2AGPA 2EDUA 5KFXA 3RFAA 3PY8A 3OTFA 3TXQA 5KT5A 5J2KA 4MTOA 1ZQJA 1YIJV 3D2QA 5FL7G 2EZYA 2HHHO 3BEHA 1NK5A 2ZUBA 4I2IA 2ASJA 2F3NA 1XMQO 4AP9A 3WK4A 2KZZA 4A5UB 2CTQA 2AZ2A 3TKAA 3HKEA 2Z0AA 5LP6B 2IH3C 3GIMA 3JPTA 1WWVA 3SYCA 9ICUA 3F2DA 1GAXA 4BWAA 3QEAZ 5AKEA 1MQ3A 4R8UA 2JS3A 3FAVB 1R3JC 4ECVA 2HKOA 2PYLA 1RPLA 2ISOA 5DLGA 3HX0A 4RUFA 2DUYA 4K8ZA 1IDSA 2JEUA 4ZI7A 1IBKO 2V1DA 4Z6DA 2FE9A 1PM9A 8ICLA 5IIJA 1QU7A 2M9NA 5KFYA 2Y1IA 8ICIA 4DV6B 2VANA 2ASLA 3UM7A 4EB6B 4W4LA 3AEIA 4EEYA 4DR7B 1NK7A 2OEHA 3FYEB 4WF9V 4DR6O 2QB0B 4LCUC 2WF7A 3TQ1A 2CXYA 4RQNA 1HNXO 1MZFA 3RTVA 1UJWB 4DSFA 1D8LA 1QLEB 2JGUA 1T7PA 4JV1A 5JCOA 1ZSPA 2ZE5A 4KX3A 2NYVA 2ZIUB 2YXYA 4UCUA 4QZBA 5LMNO 2IJKA 1QVFU 2ZR2A 4TUSA 2P4KA 5DBCA 4XA5A 5KT2A 4O4IB 5IIMA 7ICRA 4YIPA 3GQCA 1PK1B 4HNAB 1MMMA 4A8EA 9ICFA 1L1FA 2AGQA 5L1MA 4R65A 2PMZC 4F6RA 4NL9A 2OCCC 1YHQV 9ICTA 3E86A 4C4TA 1KMIZ 2QKAA 4PHZA 4TV8B 3MFIA 5LOVA 2OYQA 2ADPA 2OHFA 1NKCA 2UVUA 3PX4A 4P2HA 1SETA 4UB5A 2NRXA 4Y2TA 3UO2A 4HAIA 1AP5A 3HKDA 1U97A 3U10A 2G07A 1AR4A 2EILB 3ABLB 3MHHC 2UXCO 3HKEB 5KT7A 4XQ8A 5LOVB 1YJNV 2YQEA 2BQUA 3GFKB 4KTQA 2ZXIA 2W11A 4JAAA 4NLNA 1AJPA 2EIKB 3WKBA 4J9QA 3MGVA 1CPYA 4RU9A 3T5KA 5B66Z 5GTIU 5HMMA 4YQWA 4DV6O 1E1RG 3TGUH 5DDMA 2KICA 5ALDA 2QGNA 1Q3EA 1OW5A 1BS3A 5AG2A 4P0QA 1H2NA 3A0HZ 4JI5O 4DQIA 1OJHA 2HHHB 9ICPA 1RYUA 4Y2SA 2R8HA 4MS2A 3RJGA 3RYHB 3K4GA 4LF7O 4MVRA 3HPLC 2E1EA 4UAYA 5DGAA 2WLLB 2N1RA 4QIWC 2UUBO 3FYIB 2WSSG 4UCRA 4JI8B 2GDSA 2AHZA 1XMQB 3RJHA 4GKKO 4TV9B 5AI0A 2A3VA 5CJ7A 3C29A 1SF9A 3QUTA 8ICXA 4RZRA 1V54C 4NXMO 5AKYA 4I2BA 4F72A 1P4RA 3A2FA 4O3RA 1T8EA 4C8MA 4RUEA 2IBKA 4PPXA 4LF4B 2GUZB 2FYUH 4QZDA 4X62O 3UXOA 4TUYB 2VWKA 1IBLO 4N21A 5HP4A 1K5SA 5J0RA 3HWTA 3NXSA 3WU2U 4Z6CA 1DK2A 1JIHA 1L7MA 3QU7A 1J2MA 4Y2RA 2BSKB 5ALVA 2N05A 3TFSA 1DTOA 2JGDA 4L8JA 5GONB 5ALIA 4O4LB 2UXCB 1TVAA 3UT5A 3T1HO 5H2FU 1TK5A 1KL9A 3RB3A 2OIEA 2Z5UA 3L73H 1FD9A 1PPJH 4DRXB 3I1YA 3G6VA 9ICCA 3QYPA 4NLGA 3NS1A 4DV3O 2C2AA 2KSOB 3ZN0A 4M9GA 1GK9A 4PDRA 3B09A 3ASOC 4DCCA 4J41A 5B1BC 1VQ6V 1ZD4A 2YDEA 2NO5A 3C3TA 2UU9O 5DECA 4BIOA 3W7UA 2NV3A 2R9RB 2W9BA 2R8IA 3AK3A 2K4PA 3CHXA 5AM2A 5CA1A 4X1YB 8ICCA 5B5EZ 3T1HB 1ZYQA 4JPRA 4RQ7A 5J8YA 4JMUA 4O2BB 3D3IA 3BQ1A 1NJYA 3VQWA 1WP7A 2K9PA 4FLVA 9ICBA 1FKAO 4UVBA 5H2FZ 4CH6A 1SL1A 1WPBA 1XREA 2P7TC 5D4BA 1IV8A 2LYAA 3N7PD 2LJ2A 4DF8A 2C2EA 1SQPH 3D36C 1ENVA 3DSQA 5LGNA 1FO4A 4B9TA 2KKWA 2Q8VA 2YIBD 4LF6O 4NXMB 1VQKV 2ZT9B 2DGZA 4F5PA 3QUBA 1I5XA 4X1KA 3S3XA 4G9BA 3BS5B 4H33A 3JCZA 4JGSA 4YCXA 5ALKA 5IYDO 1L8LA 2YX8A 5AI5A 4MVOA 4RQ5A 5KFDA 4TUYA 1HNZB 2HHXA 1SB3C 3PO4A 1Z00B 5KHIA 3SPHA 2VKQA 3CEIA 1BSMA 2FTKA 3JARB 4JI5B 1UFIA 2WHEA 2KP7A 3I28A 2KG5A 8ICHA 1V38A 2D8CA 4BR6A 3H0MB 4O4IA 3I76A 5J0OA 1M1KW 1NVPB 4HNAA 2KKPA 4BWJA 1Y88A 2CTPA 1N36B 2EAPA 3F5EA 3KHRA 4FMTA 3G67A 2PGGA 2P5OA 1QQ7A 1S5HC 3N27A 1U47A 2K8CB 1WCNA 5KFKA 4OX9B 3H7IA 2F4VB 3ZHSA 2UXDB 1QTMA 3ZHQA 8ICKA 4E4EA 4DW1A 4DV4O 1ZQOA 2EILC 3ABLC 3ZRXA 3JPQA 4CE6A 1GM7A 8ICQA 1NTMH 3RYIB 4B3TB 4RQ0A 4MT8A 5IJ0A 4LNUA 3JD1A 3IDWA 2EIJB 4ELUA 3UQ2A 1VQLV 5IWAB 2W03A 1RP3B 8ICNA 3CW2C 3JPOA 2FLNA 2PFPA 1R6TA 4LF8O 3MR2A 4QW9A 2Q0OC 2ZIOA 3AG4B 1X59A 1PZNA 4UASA 5ALTA 1Z2GA 2EX3A 2NLJC 3LDDA 1XNQB 5DGBA 5H6QA 2UUCO 7ICLA 2KIWA 3UMCA 3N28A 3NVWA 3MDAA 3UQ0A 2ALZA 1TUBB 4MVQA 2J6UA 2BGWA 2GO7A 2ASDA 1DLBA 3GILA 3LK9A 5KFJA 4PGQA 5B1NA 3IFXA 4O3SA 4J10A 1VJ5A 2Q0ZX 1JALA 1KP2A 3ABMC 4UB2A 4IGGA 4BJQA 3RRGA 5ALZA 4LH7A 4LP8A 3OMAB 1BPEA 5LMUB 3BHPA 1XSNA 1S10A 2AHYA 5ALSA 5KMGA 5AI6A 2HG5C 4FLUA 3FAHA 4JV0A 1YCIA 2XI9A 1XOUA 4UQGA 1VLBA 2OYYA 3RF9A 1EN5A 2ZXWC 4MVZA 1IG6A 3ZJZA 5KFTA 5J0QA 1ZQWA 5ALWA 3NVZA 1N2XA 5C0YA 4RQFA 4U7CA 4UB1A 3Q8RB 4KLSA 1WB7A 8ICSA 5HFMA 3M8RA 2E76B 3RAQA 4UB6U 1RZTA 2X6CA 1BMFG 4EZ9A 2LPEA 3H4DA 1L8DA 2R18A 1VEWA 1N61A 2LMRA 2G38A 1NOMA 1KYOF 3WK5A 2BPFA 4I27A 5CWRA 2QDOA 4I2GA 4DUZO 3P30A 3D8CA 4ECZA 2IM9A 2IU3A 3IM1A 2W7OA 2HOIA 2UXBB 5LGUA 1AR5A 1V55B 1P7DA 1COOA 1AILA 2FLPA 2XOKG 4K35A 1RFYA 1S5JA 5BZBA 1VQOV 3ED5A 2MRLA 2ZD9A 3IRUA 4UBBA 2BOCC 3LWMA 1TKDA 2KFZA 3J81N 4U6PA 3KCXA 4YFKA 1SV0C 4KHPB 4WBNB 5AKXA 4PA3A 4DR5B 4PDVA 5DG7A 3FD9A 4RT2A 3JYCA 4I0XA 4M9NA 1AVMA 5KAFU 1ZQKA 1N4CA 4J9NA 3AK2A 3NUQA 2C28A 2F4VO 1KRPA 4CH4A 4JZ2A 2ZUDA 4ZI7B 3ALRA 2XNDG 3KZIZ 4I9QA 5AKIA 2R8JA 1WN7A 1JUDA 3DC5A 4JAUA 2KJ9A 2HW3A 4EEKA 3ABUA 4F5NA 4FBTA 2GBOA 2NRVA 4EB6A 3G4SV 5JJEB 1Y6XA 4GKJO 1Z5VA 2E8NA 4I4TA 3ZD8A 4DO2A 1IBMO 1FFVA 2ZJ8A 4ECQA 3T1YO 5ALNA 3OGUA 5IDJA 4NTXA 5FPOA 5DB8A 2ZIVA 5G5HA 3J81j 4X8AA 3DDHA 3RBZA 2KZMA 5B3SB 3GV7B 4TQFA 2WB1F 2ZTCA 3UCSC 2ZIWA 4C0ZA 3OGIB 3MGIA 4GFJA 4TQRA 1DF5A 1T94A 5LYJA 1CXZB 1DF4A 4M9HA 1H2SB 3NTUA 5J2AA 3BVOA 2YIDA 1FXKA 4GKKB 5LXTB 4O0IA 3K5NA 2WPDG 3OEEG 1XWLA 1Q7YW 1HWYA 2A1JA 1YSCA 1FXVA 3F7VC 4EX6A 1F0MA 4UVAA 1YJWV 1RQNA 4DYLA 4FLXA 3C2LA 5C5JA 3T5LA 5IINA 2V9WA 4JTCB 3T4DA 2F77X 5CRXA 2KZ3A 5KX5A 3GIJA 4Q44A 2H3VA 3IG8A 3GU3A 1ROPA 1THZA 4ECUA 3IG5A 4DRXA 1S77D 5DBAA 2W04A 5B66U 2JZBA 1PVRA 1R6KA 8ICZA 4LC1A 4YY3B 1X40A 3WKAA 4P4PA 2ZM6B 3SJAC 1P7GA 3KBBA 1SRYA 5EYPB 4DL2A 4J9LA 3CC4V 3E8HA 4XUSA 1WJZA 4QE9A 2PUSA 2WF9A 4TOIA 3MBYA 2D2CB 2IJIA 2X6AA 5KG3A 4Q45A 3ZI4A 4KLEA 4RUAA 2F23A 2KE7A 1GH6A 1SXDA 4O4HB 3K9SA 1SA0B 1N34B 3KKYA 3AN1A 4EFEA 4LWSB 4P0QB 1LVHA 3CCSV 7ICEA 1RQLA 4KP4A 1SWWA 1SKWA 2CGOA 2QKQA 2Y4TA 1X9WA 2YUAA 3PW0A 1B4FA 4YHHO 3Q8LA 1S0NA 4OX9O 3U11A 4B7KA 2HFEC 2FJ6A 2B5UA 4UBCA 1RXVA 2ARHA 4DW0A 2A3QA 1VQ8V 1I5YA 3PN1A 2QWOB 3O65A 4D7SA 1XO0A 3KOOA 4YJ2A 3TETA 4JWMA 4DSIA 3IGAC 3MR6A 3EUB2 4ECTA 4UUJC 1T5EA 4M6WA 4GUNA 1HP8A 1H2LA 3LNMB 3HKDB 3O0FA 1L3TA 2W9BB 2YMPA 1R3LC 1BQ0A 5GTHU 3F53A 2H3OA 5JU5A 2RN9A 4KFMA 4YN4A 4DSKA 4FM2A 2JVDA 3A0RA 5IYBO 1BNPA 3ASNB 4B9SA 3L75H 2UUBB 2UVWA 3RR7A 2ZQMA 3RB4A 4M6WB 1GM8A 2HBKA 4MEYA 1YDXA 2Y0SF 3L4PA 2X0LA 3MABA 2LW7A 4MTXA 3M9MB 2WLIA 2PZSA 3SDLA 2ESEA 5IT9N 2Q69A 5AK5A 2VA2A 2ITDC 3ETDA 3PSPA 4QIWF 1SZPA 1L3SA 1KQQA 1J97A 2H3FA 1ZQTA 4KMUA 4IRCA 4KLHA 4J9YB 5EE0A 4PHDA 2KVCA 1MN8A 5ALPA 5HR6A 4JI3B 7ICGA 3CCQV 2YI8A 5B1AC 2I6XA 5AK4A 1ZL8B 5EIBD 4LF5B 1X2IA 4GXJA 2F44A 4F2SA 3W7TA 1NK6A 3WKEA 1NJZA 2KQXA 3WK6A 2ZE7A 4GYCB 4UB8U 8ICUA 2ZNJA 3CRAA 3JAWA 1JFFB 2RDIA 2XY7A 2ZINA 1EFRG 5F9NA 3RVZA 1JR9A 3MC1A 3E89A 3RWRD 3T3FA 3CCLV 4IYIA 1N8RW 5KFZA 1VF5B 3RJFA 4MEXA 9ICAA 2ZIXB 4UARA 7ICNA 8ICGA 1MNGA 1TUBA 2JMGA 1B22A 1BPXA 4Z2WA 4JI2O 1SQQH 1S3JA 2R9IA 5B5EU 3BRCA 3MR5A 3BS7A 2DMXA 1G1XB 3UPQA 4DFPA 2K8AA 1W2BU 2E74B 1BPYA 3BA8A 5ITZA 3QU4A 1BGXT 2ZTEA 1KECA 1ZQSA 1PKXA 3RYHA 3ZDCA 4K4HA 5KFNA 3VC8A 4ZOHC 2O6KA 4ZKIA 5IYZB 3CYMA 2QE7G 1ECWA 5KAFZ 1EZVH 3B2EE 2YC0A 4LF9B 2K4EA 1G8MA 4X20B 3A8TA 4LFCB 2QTOA 4Z6FA 2GV9A 1ZQ1C 1F23A 4DK0A 4FE3A 4J9RA 2ZIMA 3M8AA 1XS9D 1KEJA 5AICA 3MFHA 1M4UA 1S8OA 1KFDA 3SYZA 2Q6AA 5ITZB 1RM1C 3LYSA 2V4RA 1RPRA 4UCSA 2H8PC 4DL7A 3QO5A 5DM6V 2WAQC 2E8OA 2FMSA 4X20A 3KZXA 2V4DA 5DG9A 2EZOA 1JMSA 4DV0O 1UQVA 3IP4B 3A0BZ 2HVKC 3TXSA 5K1PA 3HP6A 5KUKA 3SENA 3JPNA 2H3IA 3SJCC 4QPJA 8ICJA 1DGSA 2EIJC 3UT5B 9ICHA 1TVKB 1BNOA 2XAQA 5JVDA 4DV0B 2OT5A 3VQYA 5FNVA 1N63A 3N2KB 2VS0A 1Q86W 1A76A 5KFFA 1N5WA 2D3DA 3CCMV 2KHQA 5L1LA 2WF6A 3SQIA 3JAKA 3LDEA 3STLC 2XCPA 2OWOA 4F3OA 4ABMA 4GX2A 5J2BA 3PMLA 3IAYA 5FP0A 5CA7A 1ZQZA 2XY6A 1FYJA 4KLUA 4X1IA 1KKCA 1XHZA 2XC9A 4FBUA 4RQ8A 4DQSA 3FB6C 1B0XA 2YMMA 1AI6A 4AQYB 1V54B 5AIAA 4F92B 4U3FH 3IC9A 5CB4A 3SYPA 1MSWD 2MUTB 4X64B 3JARA 4H0LB 3CX5F 4D7TA 3BAAA 1VQPV 4DV5O 2WB1C 2DE0X 3RFRA 3PR4A 4YG2A 2K89A 2QB0A 5EWFA 4B9MA 4K4GA 2OM6A 1M93A 1XQ8A 5J2UA 3CCVV 3OM3B 3L5KA 2FPMA 2C2RA 3CP8A 3CC7V 1ZQGA 4LBEC 2YB1A 4QZFA 1UPGA 1NKBA 1QQ5A 1SV0A 2PTMA 2XHBA 4DV7O 3KCYA 5EBMC 3W7SA 1ZLZA 3HB3B 3HKZC 3BS5A 5ALQA 4EENA 2XIDA 1XILA 4R50A 1UCVA 4K4IA 1K3EA 4R66A 5L3CA 1SL2A 2BZFA 3HKCB 4X64O 3BABA 1PK3A 5LHGA 2UXDO 1Q8IA 4TSFG 8ICTA 2DOSA 5T14A 1L3VA 2DQ3A 1HNXB 3PJSK 5IY5B 2DQ0A 5IY5C 1XBLA 1PNMA 5IYCO 4B3SB 2E5SA 4DO9A 3H40A 1YZ6A 8ICAA 5GTIZ 5CA0A 4DFJA 4DSLA 4TWKA 4WCEV 4DL5A 4Q43A 3H4BA 3H1HH 1Q6HA 4F4WA 5CN0A 4ECXA 3PSFA 4DFMA 1VIBA 5J2IA 2DBYA 4XRHA 2QA4V 2YY6A 1LUWA 4IIJA 4TV9A 2UXXA 1JXLA 4KN4A 5DLFA 4KLGA 1RM6C 4W4KA 5KUMA 5BMVA 1I94O 4IRDA 3HILA 1X66A 5DN6G 3HKBA 1BGYH 1ZD5A 2RP5A 1FIQA 3QEBZ 2NR5A 4QE7A 4QZCA 3W7WA 4DV2O 1I7FA 2CE4A 1WLEA 4PA6A 1PL4A 3AL0B 1NTZH 2Y69B 8ICRA 3ISDA 1HJPA 3E22A 1O08A 4OJPA 5J2TA 2IHNA 1SESA 3LVWA 2Q0AA 1G4YB 4X65O 4F71A 4DUYO 1TE2A 4FIPC 4JI8O 1VQNV 1EN4A 4MF2A 1SQGA 3IC7A 4NVPA 4G2KA 5KG1A 4UB4A 2BOBC 2HR3A 3KFUF 3TACB 1R1BA 5AKKA 1SA0A 3BCCH 3MHSC 4PA9A 2VJ4A 4XDLA 1KKXA 1UPHA 2BPCA 2V4QA 1F4NA 1Y67A 5F2VO 2KNJA 3PW7A 2RCVA 4JTDB 4PDLA 1FAFA 1NS1A 3PW2A 3QO8A 4Z1VA 3ETLA 4QWBA 4I2AA 4CH3A 5LGTA 3BZKA 3CCRV 4DS4A 1QBZA 1DGJA 2ES6A 3KKAA 3L3FX 3C5FA 4UCTA 1KQSU 4AI8A 5JWPA 1HNWO 4EYHB 1IURA 2W0FC 4ZH4A 1MQ2A 3SYQA 3H8SA 1D8YA 2KK0A 5IIIA 2EINC 3GVMA 3ZMVA 1GMGA 4O2BA 3ETRA 4CF3A 4DV3B 3JD4A 1FS0G 3T5JA 2ZR3A 3EPIA 4F2RA 4AHCA 3H1LH 2IBZH 3AQEA 3H1KH 2J6TA 3VQXA 4C8NA 2HBLA 2KEYA 4O4HA 4CS2A 2ZNIA 2DN9A 5KFHA 2DL0A 5DEDA 1KD1W 4DV1B 4ACOA 1F7YA 2MAXA 3KHGA 4C7ZA 3CRXA 3NASA 1CEZA 1KB9F 4MVSA 4EEQA 5BR8O 4CS3A 3TADC 2XGPA 5C8YB 2ZG6A 4RQMA 2XICA 4B08A 1ZQQA 1WUDA 1Q5OA 2Y0SC 2LQTA 4USAA 3SD7A 4YIOA 2ZKOA 2ITCC 3UKMA 3B4SA 3EHBB 1Y4MA 8ICOA 5AM1A 5EOZA 1H8HG 3ZHRA 3RJEA 5L3DA 4OJOA 2JEGA 4IS7A 1OZ0A 5DDYA 3BQ7A 1PP9H 3D2NA 3AU2A 2IU0A 4TQDA 2YB4A 1XNRO 2ZDIC 4C8OA 4IL6Z 2OCCB 2Z7JA 5AM4A 1CP9A 5CEHA 2OH2A 4B3SO 1ZL8A 1S5LU 4K3AA 2G09A 3PO5A 1M5IA 2OCHA 1QCKA 5JQGB 4Y2XA 4YP3A 2XGQA 4O5CA 2WF8A 1SC5B 4NTWA 3WB1A 3ZDBA 3IN5A 4GKJB 3CRCA 2D3OW 4JB3A 4PELA 2Z3YA 1BE3H 4JI0B 4ECWA 2EULA 3SAFA 2BTQB 1D8BA 4QNHB 2MA1A 2C2DA 4EKWA 5BPCA 4B9NA 4O3MA 4KLFA 3G6EV 4GX0A 1B43A 1DRGA 3WB0A 3DC6A 2H3ZA 1L7PA 5JRTA 2JJ2G 4I5SA 4PA4A 5KFQA 4MF8A 3AG2C 3FB5C 5L3GA 3C90A 2KG7A 3SAGA 3OT7A 5J0YA 4LR3A 1DOQA 1ZTEA 4Q8FA 2L35A 3ZS8C 2DPIA 1K4CC 4RQ4A 2R70A 4X66O 3D36A 2AXTU 3EXAA 5DKWA 1COWG 2DWQA 3WG7C 3E8BA 1Q6UA 3UQ8A 2NRTA 4YR3A 1OXJA 3CS5A 5EBLC 2LI6A 4B3MB 2WLKA 9ICLA 4Y2YA 4J80A 1ZQDA 1ZRNA 3K04A 3FYHA 2VA3A 3AG2B 5J8YC 2HP8A 3K5OA 3NR7A 4KL1A 4O2AA 3NRZA 3F2CA 1ZX3A 4DFKA 4ASUG 2PYJA 4HYOA 2EZXA 1K97A 5L1IA 2RQ5A 4M2YA 1NQTA 4X66B 2ODGA 4QWEA 4RNMA 5DBBA 3SZ2A 5LMNB 4X89A 4FLZA 4G3IA 1NZ6A 2UUAO 4KLLA 2LFSA 4YXMA 3VCBA 1XO1A 3D2SA 1JN3A 1IBLB 1ZJNA 3OD4A 2W55A 2OXOA 4MHVA 3K08A 2QWNB 2DW4A 1PNKA 1HUOA 2YTUA 3AK1A 3WKCA 5DQIA 1C7YA 2W9MA 1UT8A 9ICQA 2QEXV 4PHEA 3Q8KA 2DFLA 4CRXA 3RAXA 1NI3A 4C7YA 3ZDEA 4DV2B 1AP6A 4TURA 3CE2A 2BCCH 1SS3A 1PK1A 1V97A 1GTOA 3NGDA 5IJ9A 5CB4B 5JJNB 1QSYA 1FEZA 4PI2A 3T1YB 4MFFA 1L3UA 4FLYA 3JD0A 1WNSA 4M9LA 2CAZC 2ZCEA 4NYKA 3WFVA 4RNOA 3RGBA 4QNLA 3FX7A 1YTFD 2B0CA 4B9LA 2DPJA 1SIJA 5IJ0B 3SMVA 1PNLA 1SQXH 4R6ZA 4ECSA 3JSNA 5B1BB 3ASOB 1OCCB 3K0DA 5CMUA 5J2HA 4JI2B 4IYHA 5D49A 1U4BA 2OIGA 5H9CA 1F5SA 2W3RA 5KL8B 3SJQC 1NK9A 1WYGA 1K33A 2QLTA 1P7BA 5KHHA 3J80N 4BW5A 5KFUA 1ZD3A 3C28A 1JXEA 4ECYA 3BPZA 3M7MX 4QWCA 5KHGA 3RB6A 4DR3B 1N32O 4X62B 5KL1B 4RPZA 3RR8A 2UXBO 1N36O 5KG2A 3O9OA 5D5PA 8ICEA 2P6UA 4KHPO 1D5AA 3OE7G 4UXNA 1N48A 2JEJA 2F1IA 2GTSA 5KMGB 4YJ3B 1M90W 2QWRB 2B21A 4CGZA 4JI7B 4YVZA 3PX6A 5J2DA 1WCLA 4IIJB 1K9MW 2HJDA 1P84F 1ZQXA 4YMMA 4J9SA 4PJ0U 4F8RA 1NH2B 4R64A 5BY1A 1N34O 4L87A 5C93A 4JI6O 1GN2A 1TK8A 2W6IG 2E1FA 2EANA 4CDGA 4RQ3A 2CH7B 4ICAA 1ZQMA 4P0PB 3J7AU 4E2LA 3OTQA 2BTOA 4KLDA 3WU2Z 1IBMB 4NWIA 4F4ZA 4JASA 3ZHUA 1BHAA 5LP6C 1Q8KA 1ZQRA 3K79A 1DXSA 1U96A 4JI7O 1OCRB 2BKEA 2ZIXA 4IL6U 1KTQA 3E35A 3ZEDA 3MDCA 2GH1A 4B9UA 4MFAA 2R9AA 3ZHTA 2VA8A 3RRHA 1N0JA 4QGPA 2JGAA 5J2EA 4HAMA 4MTGA 4RNNA 4LFAB 1VQ5V 3E8GA 3TK1A 1SV4A 4JZGA 5CBGA 1ZQVA 4CF5A 2WLHA 2ZIWB 4DSJA 4C8LA 2MSNA 5KFGA 4DLEA 1XNRB 3ISCA 3UMGA 3TFRA 5KFMA 4O4JB 3SPJA 3W7XA 1KU9A 3HT3A 1YVWA 3AG7A 3ZRWA 1M56C 3JATB 3K59A 1L5UA 4FS2A 2LP7A 4U7NA 3B0YA 5LHHA 2VWJA 4J7JA 4PL2A 1QR9A 2F66C 4KLIA 4O5EA 1NK0A 2Q9LA 3QU5A 1QSLA 4BXOA 3UM9A 4UVCA 1BPBA 1JQ0A 2WA3A 4O3PA 4O5KA 2GSMB 4X1IB 1SKRA 2FMPA 2CTWA 3CNHA 4RUCA 4R8CA 3JD2A 4XDKA 4JI1O 1SQBH 2J6SA 4XBFA 1AB3A 3BFRA 1VF6C 3PW5A 7ICFA 4FK5C 1U45A 4JWNA 4OPHA 4RQ1A 3F5WC 2MUTA 3PZPA 4R8UB 1VMGA 2QM7A 2NO4A 1SWVA 3GDXA 3E83A 3ABKC 3N2KA 3LDCA 3KKAC 4G28B 2FMQA 3MDSA 4UW9A 4TUPA 1BPDA 2DYRC 2I1QA 4F5QA 4KLTA 3CPWU 3ZIAG 3SGIA 3VQVA 5J29A 5BOLA 3AQFA 4G27B 3ZX6A 2YICA 1DK3A 1MSDA 1T3NA 2W0XA 5L3EA 1YT3A 4O9MA 7ICMA 3WK9A 2KHVA 2P4VA 3C1YA 1L7OA 1S76D 3C1ZA 3JALB 1EN6A 4QW8A 5L3FA 3Q8QB 3TANA 2BCSA 4CC6A 3PX0A 1I94B 3Q8PB 3AG4C 2YI9A 3CMAV 3UXPA 3G71V 4LFCO 3JPPA 3ASNC 4N23A 5CR0A 1WAZA 2WLMA 4K0KB 5KNIA 5AI4A 5K4LA 5C8YA 4R7CA 3K57A 3MR3A 1XMOO 3H9VA 4PZOA 3V72A 1U48A 3SR2C 2UVVA 1L0NH 4MSWC 2ZE8A 2KSOA 4DQQA 1SL0A 4QZ8A 5J2CA 2KN7A 4GZRB 2RQ6A 3DTUB 2G06A 1YITV 2HEPA 4MVMA 1QNMA 2BR0A 3L71H 1GN4A 3OAAG 2W9CB 3KZIU 1ZD2P 3B40A 8ICPA 5F9LA 2ILMA 2PFNA 2GLEA 4IHJA 3K58A 1UT5A 4DL4A 4O3QA 1C20A 1N33B 2WFAA 5L3BA 1ED1A 5AKHA 3OHBA 2HHSA 1CUKA 4J9OA 4UFZA 1FPOA 3K3WA 3A0BU 5K1XA 1AI5A 4GX5A 5EE9A 4AILC 1GN3A 2DWDC 1AROP 3V7KA 5ALMA 3D3QA 1Z4OA 3C23A 5A2QN 3AG1C 1HR0B 4DL6A 3M6ZA 4B7EA 4UB3A 3N2GA 1H38A 4DUYB 1MA7A 4EELA 4Y2VA 4IT5A 1JFFA 3LUTB 2F2AB 1ZAUA 1GRJA 7ICPA 3RN4A 2ZJ5A 4M47A 3WB2A 5GONA 1FFXB 2WLLA 2F76X 3L70H 3L74H 4CS4A 1WPXA 4BAYA 5EC1C 4DV7B 7ICUA 3JAMN 1WB8A 2QWPB 2HLDG 4LF7B 1JX4A 4CC5A 5IWAO 3E22B 2W7PA 3R9KA 2CRXA 4US8A 3IJ4A 4KLMA 9ICKA 1F4MA 2IMWP 3SYAA 1XI1A 1K73W 4C4RA 5AK3A 2UUAB 4YY3O 2Q5ZA 2A1AA 4DSEA 5EE3A 4FO6A 2JRZA 4J9KA 5IE9A 4P2ZA 1NU1H 3RH4A 5FNVB 4LZDA 2WLIB 4C4SA 4CNQA 4ED0A 4DV4B 2JZBB 4KUMA 2GWSA 5GTHZ 3SI8A 4RAIA 1EXNA 1H2MA 1ZQPA 2P6RA 2KG7B 1BVSA 3OSPA 3F5AA 4YJ2B 4QZHA 4LF4O 7ICOA 2AZ0A 1AJNA 2W43A 3LNNA 4GX1A 3FKSG 2QSAA 1S0MA 4KLOA 2KSDA 5KFOA 3I56V 3WKDA 3HW8A 4UV8A 1Q46A 3B9JA 1QSSA 2PMZF 2RDCA 3PV8A 1MA1A 1ZOLA 4OCZA 3T4ZA 4FZ0A 3RBDA 2EZZA 5AI9A 4NLCA 1W0JG 4Q20A 8ICVA 2LM4A 4QZEA 2RDJA 4PDMA 3G80A 4EBCA 3M9OB 2YN4A 3E2EA 3OEHG 4DLGA 1MOFA 1D5NA 1N62A 1WG8A 1HW7A 4HYKA 1LKYA 2Q4TA 2LKYA 3T5HA 4FLWA 3JCUZ 3M9NB 4CZZA 3STZC 1Z00A 4NLZA 1HEKA 2HHWA 5KAIZ 3C2MA 2EAOA 9ICGA 3QNEA 4PV1B 2BCQA 8ICFA 5DB6A 1OCOC 1HUZA 1SZTA 2KB1A 1P49A 5L1JA 3F7YC 3EW9A 2HHUA 4ELVA 3H1IH 5JH7A 3AG1B 3ZHVA 1K34A 1KDHA 1KW4A 2YMLA 2HSZA 4RT3A 1ZQIA 5AKGA 5A0LA 1NI8A 3PVXA 4ZIBA 1Z4NA 3IV6A 4P4OA 2QR4A 4I55A 1NJXA 4F6EA 3JASB 1X6JA 2XUMA 3HKZF 4E0DA 2IJJA 3M6KA 1Z1BA 2YEVB 4B6JA 2HBMA 1FXKB 3FM9A 5KG0A 3JALA 4FFKA 1Q90D 4DOBA 4HZ3A 4R63A 3KG2A 1IXBA 2HJFC 5IJ9B 4JI3O 3A0HU 5KFSA 1KFTA 2XAJA 3ZCCA 1S0OA 1B3QA 4JF3A 1YTFB 1Q43A 3GIKA 3ZN1A 2XAFA 3ICXA 5KLVH 4GCZA 4DR7O 4F4KA 3PW4A 3WG7B 1BQZA 4I2HA 2UVRA 2XT9A 2HI0A 5EWGA 1TA8A 4X1YA 4J9MA 2W6JG 3H01A 1D9DA 5A9GA 3EPGA 5KFVA 1R3IC 4DR2O 2Q68A 4WJ3B 3FB8C 4TUQA 3RJIA 2GTAA 2B9ZA 1E79G 2W9AA 2W54A 4QPKA 2LO1A 2DQNB 1X9MA 4IQWA 5HHIA 4QJFB 1FJGB 3JSLA 3TAQA 1PL0A 2Y9UA 4X9QA 2LFRA 3RYFB 5LP6A 2EAMA 3CP1A 2HOFA 3ZMSA 1NTKH 3RT3C 1XNSA 4GC6A 4BXOB 2XCAA 5L9XA 5AM0A 1JPXA 2F1HA 3H8MA 4ZOLB 5KTQA 3KTQA 1K92A 4TT3G 5KAIU 4DOCA 4B3RB 2QJ1A 3HKBB 5KFPA 3GV5B 2IOHA 5IYZA 1BHBA 1GM9A 1NVPD 3H1JH 5KT4A 2IHMA 3QZ8A 4YJ3A 5AIBA 1TAUA 4X65B 4EZ6A 3GWOA 2NN4A 4GXKA 4NKGB 1ZQEA 4Z1MG 2F8KA 1QHTA 3M99B 2KVSA 4AQYO 4UATA 3AM9A 1BL8A 2K4IA 5KFAA 5CA3A 3MAQA 5DB9A 3QTCA 5KT3A 5CBHA 9ICXA 2CPRA 2ZIVB 2W8KA 4I2CA 2KJ8A 3PSTA 5B1OA 4TQSA 2AH5A 1JX9A 4BIZA 4P30A 4FM1A 2E5LB 1O03A 2HOQA 2XAHA 5IIOA 1KLNA 3DXRA 1ZJMA 4XDJA 5B1AB 1JJ2U 1FFUA 5ALLA 2L6LA 2JR5A 1ZQUA 3QU2A 2EINB 3OGCC 3JAKB 1MC8A 3N7SC 1TV9A 3TJTA 3LWLA 4NM1A 4EX7A 5DG8A 4DF4A 4QZ9A 2YXLA 2ZXHA 2FKXA 2ZXWB 1HIWA 4RQ6A 1W59A 1EM1A 2NRWA 2H94A 1ZQNA 3ETGA 3OW2U 4UV9A 5AK6A 1YI2V 5EYPA 3P32A 1AI4A 2FDRA 5ALFA 2FLLA 5B3SC 3N4MB 4RQ2A 4Z6EA 4AYBF 4IR1A 5BR8B 3MGHA 1XDCA 3NVVA 3UXNA 3FDSA 5FLXN 2KMDA 4I4TB 3OFNG 1FFTB 3X2QC 2PI5A 4I2DA 3JPSA 3B8MA 4DQPA 2ZUCA 1AQ6A 2WAMA 2JEXA 5EZYB 3CD6V 1XMOB 2OTJV 4FZNA 3GZFA 2QKSA 2YIBA 2ADQB 3EFFK 2K8BB 2YMQA 1VF6A 2P90A 4EFBA 1X42A 1E1QG 5LMUO 3BJYA 2PY5A 2E5LO 4JV2A 2DYRB 1BPZA 4FFDA 4O3NA 4DWIA 1M57B 5AKZA 1ZQBA 1FXHA 3VBBA 9ICSA 3GV8B 2ZIUA 3FB7C 7ICVA 2FMLA 1TAQA 3JASA 4JYAO 5J0TA 3V7JA 4I2FA 3CB2A 3ORYA 3NVYA 4FM0A 5AM3A 4DXWA 4RO2A 9ICRA 1IXMA 5AKJA 3F2BA 4KXRA 2FPKA 4P9PA 2ISPA 3JPRA 3K75D 3TCUA 3ZRWB 3AU6A 3LSQA 1SQVH 5KA5A 4J42A 4M0AA 1HR0O 4RWUA 4PD4F 3ABTA 3E58A 1RM1B 3V7LA 2HDOA 4YR0A 3SPGA 3QVNA 2ZJAA 5CP2A 5DQGA 4B3MO 2EH9A 1G6UA 5EWEA 1L0LH 3KHLA 2PXIA 4IQUA 5IIKA 2IOFA 1R6NA 3LVVA 3E8FA 4K8XA 4BX9C 1UHUA 4M04A 2XTAA 1X9SA 1KKDA 1X9XA 3BZCA 5EBWC 2JRIA 1K1SA 4BWMA 5J0PA 2Q73A 4WBNA 2EQYA 1XU4A 2JH1A 3CXCU 2NRZA 1SZHA 3RJJA 9ICWA 4O2AB 2KKVA 1NJIW 1Y76A 1D2DA 4I29A 1Y74A 3TI0A 4WFAV 5E1AC 2HVJC 2Q7EA 1KBHA 1J2NA 7ICTA 1RSOA 4DR3O 1N32B 4US9A 3CXHF 1PVQA 3U0ZA 3QNMA 2XO7A 2WA4A 3EVKA 7ICQA 4DOAA 3L72H 4ICGA 3RBEA 4DUZB 3QO7A 2W3SA 2YSUB 3JAWB 1XL6A 2QARA 3D6JA 1N56A 3U26A 2ZTDA 4KLQA 2WAQF 5LL6Y 4OD0A 5J2UB 3DGEA 1RXWA 1JROA 2LGQA 4NLBA 4PA7A 2ZDIA 1ZQFA 3VOUA 1VF7A 1X6IA 4LH6A 2HHVA 4MFCA 2QARB 1DK1A 2G5IB 2LYBA 1UA1A 4UAVA 3PR5B 1JJOA 1A0PA 4C8KA 1ZQLA 2Y0PA 2X6BA 4LF6B 5ALUA 2K4HA 1OCZB 3PSIA 1IZ3A 3CRMA 3UO3A 5JQGA 1ZQHA 2YS8A 3BY6A 1XNQO 2N04A 5LXTA 3V6HA 4Y2QA 3Q8MA 1SZXA 2BQ3A 1W0KG 2RLTA 5KFLA 2HMXA 1NR7A 3HR0A 5LA6B 2LBOA 3BQTA 3RW0A 2E8PA 4IHJB 4JI4O 5ALYA 2K60A 3SEIA 4I50B 5ALHA 2RRDA 3M7DA 3GIIA 2AQ4A 1H8EG 3T1CA 5J2FA 2M7WA 3ZMUA 1SQFA 1S97A 1A32A 3IHQB 1VARA 2B1IA 4P9OA 5D5QA 5BMVB 3APQA 3KHHA 1JMKC 3RJKA 3K0GA 1SERA 4JAVA 1YZ7A 1R3KC 5CA1B 2ZM6O 3ISBA 2P66A 2Y9TA 9ICEA 1TAEA 2MK3A 3H0RB 1S9FA 4CH5A 4U3JB 4F5OA 4LWSA 4P4MA 2W8LA 3E0FA 4QZIA 3OUFA 4Y2UA 4UAWA 4H13B 2DJVA 1Z3EB 2AJQA 3SV3A 1FFXA 5KFCA 3ZMTA 4NY8A 3PMNA 4UCOA 3AMZA 4JI6B 1IVSA 2X7RB 4F4LA 1MZEA 3SV4A 1K4DC 5LHIA 2XASA 4YR2A 3BQ2A 8ICWA 2PFOA 3SAHA 4DQRA 7ICJA 3OHAA 4YMNA 1IM4A 4KX5A 2BDUA 1WWUA 4F4XA 2K1EA 2P35A 4FLTA 5HR7A 5H5NA 3L9DA 3RYCB 4YMOA 5HMLA 2I9GA 3WK8A 2JEIA 1NK4A 5KG6A 3AEVA 1JRPA 4IQVA 1GN6A 1VQ4V 1ZQAA 4PHPA 2H3QA 5KFRA 3SPCA 3ZDDA 5AI8A 2MU2A 3FAVA 5H6RA 2ATKC 2HHQA 4FJCC 1JCHA 1Q82W 1H2KA 1Y66A 3K9AA 1OHHG 2YIAA 1B06A 1COKA 4RPXA 7ICHA 2UU9B 5ALXA 2DKZA 3ONNA 3HPOA 1L7NA 4JYCA 2Y1JA 4JYAB 2I5HA 1QQ6A 5KG7A 4NLKA 1LB2B 4Q8EA 3EZ5A 4FVMA 2BE3A 4Q6GA 1LNQA 1PUZA 1US6A 5JCOC 1QH9A 2A19A 3CWBH 1OCZC 1XUQA 3I55V 1NT2B 2B6GA 3K1ZA 1IX9A 1BCCH 1JA8A 3LSSA 4YXJA 1QVGU 1OUQA 3RVYA 2VQEO 4U3JA 2KFNA 1SXEA 4GT1A 3EYZA 4I2EA 4ECRA 3F5TA 5JVDB 1Y76B 5HHHA 3X2QB 2Q67A 4NM2A 4J9PA 4LJXA 1Z19A 1O9HA 2ZE6A 1ZXIA 3AUOA 4X5VA 1SKVA 4ED8A 3BDPA 2XY5A 4J7KA 4OGQB 3ETQA 1VQMV 3RH5A 1RYRA 4I55B 1V85A 1AR1B 1QCEA 4ED1A 3AG3B 1KN5A 1KBUA 4F93B 2HHTA 1KP3A 4DR4B 1O9GA 3NRWA 2PFQA 1XSPA 4YD2A 2OCEA 2HCFA 1U49A 1OCOB 1RPOA 1V55C 5ALOA 1MG1A 4KLJA 3RH6A 3TADA 2YXHA 8ICMA 1S0VA 3R66A 1EBOA 4DR4O 3Q4HB 1M56B 4H44B 1NKDA 4FFBB 3CC2V 2O57A 1NZPA 4GXIA 3K5MA 1SKSA 3OMNB 4FZLA 4UCVA 4RQEA 3OUSA 2NNUA 5LBQA 4KMOB 1VQ7V 4I7ZB 1EZJA 5DB7A 3JATA 2IJHA 3G6YA 3QXGA 2PF4E 3ZDAA 3CRRA 1VDVA 2GOLA 4AYBC 3K03A 3LSUA 2F8LA 4NXZA 4IR9A 1URJA 4PHAA 2VQFB 3CCJV 4QZAA 4DK1A 1I08A 1TAMA 3SR6A 1AJQA 5KFBA 4OJLA 5J2GA 1ZETA 3C5GA 2R8KA 3OR6C 3S6JA 1CRXA 1B6QA 4EBDA 3R65A 4O3OA 4PGXA 3V6JA 1WP8A 5GW7A 5IILA 4ED7A
chains in the Genus database with same CATH topology
1H2GA 2UXXA 3D3IA 4NLCA 1M57C 1W0JG 4Q20A 1M9NA 5KUMA 4UVBA 5DN6G 4PDMA 1PVPA 1QR8A 4FZMA 2P7TC 2G0AA 2RP5A 2LYAA 3N7PD 3OEHG 1S72V 3E2EA 4QE7A 1MOFA 3ABMB 3W7WA 5LGNA 1ENVA 1WLEA 4PA6A 2Q4TA 4P0PA 3AL0B 2Y69B 2LKYA 1VQKV 4CZZA 2LHTA 2DGZA 4OJPA 1SESA 1HEKA 1I5XA 3STZC 3LVWA 3QNEA 1G4YB 1VQNV 1SZTA 4H33A 1OCOC 3JCZA 1A6SA 4FIPC 4JGSA 2KB1A 1QLNA 5IYDO 4WFGA 5CBFA 3F7YC 3IC7A 2EIMC 4G2KA 2EIMB 5LHHA 2BOBC 2YX8A 2HR3A 3KFUF 3AG1B 3MHSC 4MVOA 1K34A 4PA9A 3SPIA 2VJ4A 4XDLA 4YXWG 5A0LA 1GKFA 1UPHA 1F4NA 2M0NA 3SPHA 4IC9A 2VKQA 2KNJA 2B1GA 2DYSB 1GO3F 2EJRA 2FTKA 4JTDB 2F43G 4J9ZB 4PDLA 3HKZF 2IJJA 1AI7A 3M6KA 3QO8A 1Z1BA 2YEVB 3H0MB 2QM8A 2WLNA 5LGTA 1M1KW 2HBMA 1NVPB 1FXKB 3CCRV 2KKPA 1QBZA 4HZ3A 2WWWA 3KG2A 3F5EA 3L3FX 4OJ5A 2HJFC 2EZPA 3OR7C 4FMTA 1KQSU 3CCUV 2A79B 1OCCC 2XAJA 3ZCCA 1S5HC 2W0FC 2PI4A 3SYQA 3T2MA 2EINC 4JF3A 3B77A 1YTFB 2K8CB 3ZMVA 1GMGA 2XAFA 3ICXA 3ZN1A 3JD4A 4GCZA 2KJ5A 3CCEV 1NBMG 1FS0G 3WG7B 2ZR3A 5EK0A 2EILC 3ABLC 3ZRXA 2KOBA 1GM7A 3ZMZA 3AQEA 1L6NA 2W6JG 3H01A 2G08A 4MT8A 4WFHA 1R3IC 2HBLA 2KEYA 3JD1A 2EIJB 1KD1W 2Q68A 4WJ3B 3FB8C 1VQLV 4ACOA 1F51A 2W03A 3CRXA 1CEZA 1E79G 1XL4A 4MVSA 4QPKA 1J95A 2DQNB 2ZG6A 3AG4B 4QJFB 2XICA 1NR1A 2JIZG 1WUDA 2Y48A 2Y0SC 1PL0A 2NLJC 3LDDA 4JYBA 5H6QA 2ITCC 3UKMA 2KIWA 2LFRA 2IH1C 3EHBB 1Y4MA 4PL1A 4MVQA 1VQ9V 2A9HA 1H8HG 3CP1A 2HOFA 5L3DA 3ZMSA 1XNSA 4OJOA 1DLBA 1OZ0A 3D2NA 1JPXA 2WLJA 5B1NA 2IU0A 3IFXA 2DF4B 2YB4A 3B8NA 2ZDIC 4BIUA 1K92A 4TT3G 2D6FC 1KP2A 2XVTA 2Z7JA 2OCCB 4BJQA 1CP9A 2OH2A 3ABMC 3GB7C 2YEVA 4LP8A 1BHBA 2G09A 2CN1A 3OMAB 1GM9A 5HFLA 1NVPD 4WFEA 2AHYA 4JTAB 2KV2A 3IN5A 2D3OW 2HG5C 3GWOA 4PELA 2Z3YA 4Z1MG 2XI9A 2JDIG 3SAFA 3M99B 3N7RC 1D8BA 4QNHB 2MA1A 4EKWA 2OYYA 3RF9A 2ZXWC 4MVZA 3ZJZA 4O3MA 1F44A 3G6EV 2JK5C 4GX0A 1BL8A 1DRGA 2JJ1G 3ETEA 2K4IA 1QLEC 5CA3A 2H3ZA 5C0YA 4MW3A 4RQFA 2JJ2G 4U7CA 4I5SA 5CBHA 2JHDA 4PA4A 2HBJA 2CPRA 3AG2C 3FB5C 2ZIVB 3ABKB 5HFMA 5L3GA 2KJ8A 3SAGA 3PSTA 2IW5A 1BMFG 2X6CA 1JX9A 5B1OA 4P30A 4BIZA 2R18A 2HOQA 2XAHA 1K4CC 3D36A 1Q3UA 1COWG 3WG7C 4XDJA 3E8BA 5B1AB 1JJ2U 5EBLC 3P30A 2WLKA 2EINB 2IU3A 3OGCC 2W7OA 3N7SC 1K7DA 3ML0A 2HOIA 3K04A 3AG2B 4MVUA 5LGUA 1IIPA 1V55B 1P7DA 2XAGA 2XOKG 3MD0A 3OPXA 3F2CA 5EC2C 1ORQC 5BZBA 1VQOV 1KC8W 4ASUG 1FXKC 4MTFA 2UXNA 4HYOA 4CBCA 1K97A 2ZXHA 2MRLA 2ZD9A 2ZXWB 1NQTA 1HIWA 2BOCC 4BUGA 2EBOA 4H37A 4X89A 2H94A 4U6PA 3ETGA 3OW2U 2LFSA 4UV9A 1YI2V 3VCBA 3P32A 4PA3A 4PDVA 1AI4A 2A0LA 2Y69C 3JYCA 3D2SA 5B3SC 4X88A 2OXOA 4AYBF 4ZBMA 3K08A 3NUQA 2DW4A 1PNKA 4OXSA 3DEEA 3OFNG 1FFTB 3ALRA 2XNDG 3X2QC 2VIXA 3B8MA 2PI5A 3CYOA 2WAMA 3CD6V 2JEXA 1OCRC 2OTJV 4FZNA 3GZFA 2KJ9A 1PD3A 2QKSA 4JAUA 2QEXV 3ABUA 1YJ9V 4CRXA 3EFFK 3G4SV 2K8BB 2P90A 4WFFA 1E1QG 1ZWIC 4DO2A 1MABG 2DYRB 1GTOA 1R73A 5IDJA 1JOYA 1M57B 2ZIVA 3OMIB 4X8AA 1FXHA 3RBZA 3ZRSA 1Q3VA 3VBBA 2OTLV 5B3SB 2ZIUA 3FB7C 3JD0A 2WB1F 3K06A 2ZIWA 4C0ZA 3WFVA 4GFJA 1DF5A 1T94A 4QNLA 1DF4A 4DXWA 4RO2A 1IXMA 3F2BA 1YTFD 1FXKA 4P9PA 2RHFA 3ZRWB 3TCUA 3LSQA 2WPDG 3OEEG 1Q7YW 4OJ6A 1HWYA 3SMVA 1PNLA 4R6ZA 5KA5A 1YSCA 5B1BB 1FXVA 3ASOB 3ABTA 3F7VC 1OCCB 3K0DA 4UVAA 5CMUA 3SYOA 1RM1B 1YJWV 4JTCB 2VJ5A 3SPGA 3T4DA 5H9CA 3JD3A 2F77X 5CRXA 5KL8B 3SJQC 1K8AW 1THZA 2H3VA 3IG8A 3GU3A 1ROPA 3IG5A 1S77D 2W04A 1R6NA 3E8FA 3LVVA 4BX9C 1PVRA 1R6KA 4MW8A 3AG3C 1KKDA 1K33A 4LC1A 2DYSC 5EBWC 1P7BA 1NH2D 1SRYA 4BW5A 3CC4V 2JH1A 3CXCU 3E8HA 3C28A 1SZHA 4QE9A 1Q81W 2KKVA 4I9WA 1NJIW 2IJIA 5KL1B 2X6AA 4WFAV 5E1AC 2HVJC 1JVMA 3OE7G 4FPPA 1PVQA 4UXNA 3ZRVA 5J9PC 1M90W 4CGZA 3QO7A 3T79A 4NV0A 4P0QB 2P67A 2YSUB 3CCSV 1K9MW 1XL6A 4KP4A 1NH2B 2DWEC 4L87A 5C93A 2WAQF 2W6IG 2E1FA 2V7QG 2HFEC 3DGEA 4U7OA 4CDGA 2B5UA 5KA6A 1NZBA 2GHYA 4NLBA 4ICAA 2P6JA 2ZDIA 4P0PB 4PA7A 3VOUA 2G5HB 4E2LA 1VQ8V 1I5YA 4OO1J 1XO0A 2G5IB 2LYBA 4NWIA 4JASA 3TETA 1BHAA 1A0PA 3IGAC 3K79A 1OCRB 4UUJC 2X6BA 2ZIXA 2K4HA 1OCZB 3PSIA 3LNMB 3E35A 4WFBV 3O0FA 3CMEV 1R3LC 2GH1A 3H0LB 1K5QA 3BY6A 2EIKC 2KD1A 2JGAA 3F53A 4HAMA 4KFMA 4MTGA 2CK3G 1VQ5V 3E8GA 3A0RA 5IYBO 3ASNB 3TK1A 1W0KG 5CBGA 2ZQMA 1TUEB 2JH7A 2HMXA 1NR7A 2ZIWB 2WLHA 2LBOA 1GM8A 2HBKA 2X0LA 2Y0SF 3RFAA 1YIJV 4MTOA 3RW0A 3D2QA 5FL7G 4MTXA 3BEHA 2WLIA 3SPJA 3W7XA 3ZRWA 2RRDA 3M7DA 1M56C 2Q69A 1H8EG 2ITDC 2LP7A 2M7WA 3PSPA 4QIWF 2IH3C 3ETDA 4U7NA 3ZMUA 4PL2A 1QR9A 2H3FA 4J9YB 3SYCA 3F2DA 2B1IA 4P9OA 4UVCA 1JQ0A 2KVCA 1R3JC 2HKOA 2GSMB 5HR6A 3K0GA 3CCQV 4RUFA 1SERA 4JAVA 5B1AC 2JEUA 1R3KC 4R8CA 3JD2A 3W7TA 2V1DA 4XDKA 4XBFA 2MK3A 3H0RB 3E0FA 4FK5C 3F5WC 3OUFA 3PZPA 3RVZA 2QM7A 1EFRG 3UM7A 3E89A 3AEIA 3CCLV 1N8RW 3E83A 3ABKC 3FYEB 3LDCA 4G28B 4WF9V 4LCUC 2ZIXB 2DYRC 2JMGA 3ZMTA 1UJWB 1QLEB 3CPWU 1S3JA 2R9IA 3ZIAG 4G27B 3AQFA 2X7RB 4F4LA 1K4DC 4KX3A 5LHIA 2XASA 2K8AA 2ZIUB 1W2BU 5L3EA 1KECA 1PKXA 1YT3A 3SAHA 2IJKA 1QVFU 2KHVA 2ZR2A 3VC8A 4ZKIA 1S76D 3CYMA 2QE7G 1ECWA 4KX5A 2BDUA 1G8MA 2K4EA 2K1EA 4A8EA 5L3FA 1L1FA 2PMZC 5HR7A 2QTOA 1ZQ1C 1F23A 2OCCC 1YHQV 3AG4C 4FE3A 3E86A 3CMAV 3G71V 1RM1C 2Q6AA 1VQ4V 3ASNC 2H3QA 4N23A 3SPCA 3LYSA 1SETA 1RPRA 2WLMA 2H8PC 3QO5A 5DM6V 2WAQC 5H6RA 2ATKC 4FJCC 1JCHA 3KZXA 4R7CA 1Q82W 2G07A 1Y66A 2EZOA 3K9AA 1OHHG 2EILB 3ABLB 3IP4B 2QA4V 3MHHC 4MSWC 3ONNA 2HVKC 4JYCA 1YJNV 5KUKA 2H3IA 4QPJA 3DTUB 2G06A 2ZXIA 1LNQA 2EIJC 4MVMA 1YITV 1AJPA 2EIKB 2XAQA 1CPYA 3MGVA 3OAAG 2OT5A 1Q86W 1OCZC 3CCMV 3I55V 1E1RG 2KHQA 2KICA 3K1ZA 3LSSA 5L3BA 1ED1A 3SQIA 1OUQA 3LDEA 3STLC 3RVYA 1QVGU 4P0QA 4GX2A 3K3WA 4GT1A 1AI5A 4GX5A 4MS2A 2DWDC 3X2QB 2Q67A 1AROP 4MVRA 3HPLC 2E1EA 3FB6C 2WLLB 1Z19A 2N1RA 4QIWC 3AG1C 3M6ZA 3FYIB 2WSSG 1H38A 1MA7A 1AI6A 2AHZA 1V54B 1VQMV 3SYPA 2A3VA 1MSWD 3LUTB 2F2AB 3C29A 1AR1B 1QCEA 1VQPV 1V54C 3AG3B 1KBUA 2WB1C 2K89A 1KP3A 2F76X 1P4RA 2WLLA 2OM6A 1WPXA 3CCVV 3NRWA 4RUEA 4BAYA 3OM3B 5EC1C 3CP8A 2HLDG 3CC7V 1OCOB 1RPOA 4LBEC 2YB1A 1V55C 1MG1A 4N21A 2W7PA 2CRXA 1K5SA 1S0VA 3NXSA 1EBOA 5EBMC 3W7SA 1K73W 1F4MA 1M56B 3SYAA 1NKDA 3HB3B 1DTOA 3CC2V 3HKZC 4RQEA 3OMNB 4FZLA 2XIDA 3OUSA 4R50A 1K3EA 2NNUA 5LBQA 2Z5UA 5L3CA 4P2ZA 4KMOB 1VQ7V 2WLIB 1EZJA 5LHGA 4KUMA 4TSFG 2C2AA 4RAIA 3ZN0A 2IJHA 5T14A 1GK9A 4PDRA 3ASOC 3F5AA 5B1BC 3T1CA 1VQ6V 2DQ3A 1AJNA 2GOLA 3K03A 4AYBC 3PJSK 2DQ0A 5IY5B 5IY5C 1PNMA 2F8LA 5IYCO 1URJA 2E5SA 4GX1A 3CCJV 3FKSG 3W7UA 2NV3A 2R9RB 4TWKA 1TAMA 4WCEV 1AJQA 3I56V 4OJLA 4UV8A 2PMZF 5CN0A 3PSFA 3OR6C 1B6QA 1CRXA 4JPRA 3R65A 5GW7A 3T4ZA 4JMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLC A;  4OO1 J;  2HBJ A;  2CPR A;  2RHF A;  3SAG A;  2RRD A;  1GO3 F;  2HBL A;  4QIW F;  2HBM A;  4CGZ A;  2KV2 A;  2DGZ A;  4QJF B;  3SAF A;  1WUD A;  1YT3 A;  1D8B A;  2E1E A;  2MA1 A;  3SAH A;  4O3M A;  2E1F A;  3CYM A;  4CDG A;  2HBK A;  4NLB A;  5C0Y A; 
#chains in the Genus database with same CATH topology
 1H2G A;  1M57 C;  5L1K A;  5EIB C;  5J2T B;  5CA0 B;  1M9N A;  3ZBH A;  2RJZ A;  1PVP A;  2BQR A;  4FZM A;  1QR8 A;  2G0A A;  2Y0I A;  3QG5 A;  2AXT Z;  1S72 V;  2E3C A;  1SGG A;  3ABM B;  2VQE B;  1V9P A;  3H8J A;  4M9J A;  4DV5 B;  4P0P A;  2C22 A;  5KHJ A;  2A7W A;  2CGN A;  4FZ1 A;  4DR2 B;  1ZQC A;  1KFS A;  2LHT A;  4DEZ A;  5JTI A;  3OJU A;  9ICM A;  3FFQ A;  1J5E O;  4F4Y A;  4NL9 C;  1A6S A;  4LF5 O;  1QLN A;  4WFG A;  5CBF A;  1ZRM A;  2RMK B;  7ICS A;  2EIM C;  5J0W A;  2EIM B;  1HNW B;  1YF2 A;  2R8G A;  1M6Y A;  4F6R B;  3SPI A;  5KFW A;  9ICI A;  4YXW G;  3K5L A;  1GKF A;  2M0N A;  4JV5 B;  4IC9 A;  2LYH A;  1A77 A;  2B1G A;  4UAZ A;  2DYS B;  4J11 A;  1GO3 F;  2EJR A;  2LM1 A;  2F43 G;  4J9Z B;  3CJH A;  2EJ7 A;  1AI7 A;  2QM8 A;  5CB1 A;  3BQ0 A;  4QWD A;  2WLN A;  5KX5 B;  2ODM A;  5G5G A;  4DR1 O;  4C80 A;  4KN7 A;  2WWW A;  4O4J A;  4LFB O;  4OJ5 A;  2VQF O;  2EZP A;  3OR7 C;  4GC7 A;  4DS5 A;  2A79 B;  3TAR A;  1OCC C;  5ALJ A;  4IQT A;  2AGO A;  1Z5W A;  3CCU V;  2PI4 A;  4F5R A;  2Y4U A;  3T2M A;  4ED6 A;  3B77 A;  3WK7 A;  3C2K A;  2JGD B;  2AW9 A;  4KIT B;  3CJH B;  4O4L A;  2KJ5 A;  3CCE V;  1NBM G;  2BPG A;  4ED3 A;  5EK0 A;  2KOB A;  5BXZ A;  5TIS U;  3ZMZ A;  3QX7 A;  5HNK A;  1L6N A;  4WFH A;  2G08 A;  1TFR A;  5E79 U;  4PI0 A;  2QB1 A;  2A1J B;  2DKX A;  1TK0 A;  5LA6 A;  5KFE A;  7ICI A;  1FJG O;  1F51 A;  1XL4 A;  5J0S A;  2F1M A;  5CHG A;  1KSP A;  1TVK A;  3PNC A;  1J95 A;  1Z1V A;  1NR1 A;  2Y48 A;  2JIZ G;  1RG6 A;  4JYB A;  4DR5 O;  4F91 B;  4LF9 O;  2JXJ A;  2AGA A;  1WA8 B;  2IH1 C;  3OTO O;  1VQ9 V;  4PL1 A;  4CCH A;  3B0X A;  2A9H A;  1J5E B;  4GLX A;  4NXN O;  2HVH A;  2UUC B;  1XSL A;  1BT8 A;  2VRZ A;  5E79 Z;  2WLJ A;  1IXR A;  1ZQY A;  2DF4 B;  3B8N A;  1N0N A;  4BIU A;  2L5Y A;  2D6F C;  2Q7G A;  2XVT A;  3GB7 C;  1NK8 A;  2YEV A;  2FI1 A;  4UAU A;  1WA8 A;  2CN1 A;  1JI7 A;  5HFL A;  2CH7 A;  4WFE A;  4JUZ A;  4B3R O;  4JTA B;  2KV2 A;  5JJJ B;  2FB5 A;  4DL3 A;  8ICY A;  4I0X B;  4DR1 B;  1ZUQ A;  2JDI G;  1X4T A;  3N7R C;  5ALE A;  1XHX A;  4NXN B;  4LZG A;  2FPL A;  3OJS A;  9ICO A;  1F44 A;  5ALG A;  2JK5 C;  3QUQ A;  2JJ1 G;  1KUQ A;  3ETE A;  3CRQ A;  4EBE A;  1QLE C;  5TZV A;  2LGW A;  1CI4 A;  4MW3 A;  3N2G B;  2E8M A;  2F95 B;  2JHD A;  2HBJ A;  3ABK B;  4ZHQ A;  1K5O A;  2IW5 A;  4NB5 A;  2BTQ A;  2CUG A;  7ICK A;  5KT6 A;  5J0U A;  2CTR A;  4CF4 A;  2A06 H;  4C7U A;  2AU0 A;  2JV3 A;  4F50 A;  1Q3U A;  2GUZ A;  1YZB A;  3EWA A;  4J03 A;  4B9V A;  4I2J A;  2ATL A;  2Q4P A;  3Q8S B;  2QKC A;  2BSK A;  1K7D A;  3ML0 A;  5AKL A;  2PKE A;  1T4G A;  4YD1 A;  4MVU A;  1IIP A;  2BCU A;  2IA6 A;  2XAG A;  3MD0 A;  5EC2 C;  3OPX A;  2P06 A;  1KC8 W;  1ORQ C;  4OPA A;  4LFB B;  4CBC A;  1NNL A;  2BCV A;  1FXK C;  2UXN A;  4MTF A;  3S3W A;  4IRK A;  1T3Q A;  3SJB C;  3RYI A;  4BUG A;  3RB0 A;  1B04 A;  2EBO A;  4H37 A;  4J7Z A;  5KHK A;  2QM4 A;  4B3T O;  2P22 C;  2A0L A;  2Y69 C;  3M1Y A;  4Y2P A;  2QTS A;  4PH5 A;  4QZG A;  4X88 A;  5F3X B;  4ZBM A;  2IOF K;  3THV A;  2F93 B;  2MW2 B;  4NR1 A;  4OXS A;  4DV1 O;  3DEE A;  3G6X A;  4ELT A;  5KG4 A;  2VIX A;  3CYO A;  4YHH B;  2M6Y A;  1XC9 A;  1OCR C;  1PD3 A;  4JI4 B;  3P3P A;  3DV9 A;  1YJ9 V;  3QUC A;  2CDY A;  3OSN A;  9ICJ A;  1Y74 B;  4ZOL A;  1Q6I A;  1RSO B;  2QWQ B;  4WFF A;  2BCR A;  1L8O A;  1ZWI C;  3LDA A;  5D46 A;  5DQH A;  1MAB G;  4JYY A;  3FC4 A;  1LUV A;  3M8S A;  1R73 A;  1JOY A;  4UB8 Z;  3I5D A;  3OMI B;  5J2J A;  5KFI A;  3ZRS A;  1Q3V A;  4ZHQ B;  2OTL V;  9ICV A;  4NJ8 A;  1K1Q A;  2WF5 A;  4X1K B;  3THO A;  3K06 A;  2JEF A;  1D9F A;  1LV5 A;  2F1J A;  5JH7 B;  1XEQ A;  4JI0 O;  1HDJ A;  2RHF A;  1QQC A;  3RYC A;  3K1R B;  4OJ6 A;  2JS5 A;  3QF7 A;  5FPR A;  3KD3 A;  3SYO A;  4FFB A;  2E3T A;  1NJW A;  1NKE A;  1URF A;  4GIB A;  2VJ5 A;  4FS1 A;  3GWK C;  3BA9 A;  4JK1 A;  4DR6 B;  3JD3 A;  2BHN A;  4LFA O;  2KTQ A;  1U9L A;  3HRD D;  1K8A W;  2W9C A;  2BDP A;  1BZK A;  1PV0 A;  1S5L Z;  4MW8 A;  3AG3 C;  4BGD A;  4Y2J A;  2Q7H A;  2DYS C;  3QE9 Y;  1IBK B;  2LW1 A;  1NH2 D;  1LKY B;  5EZY A;  4QWA A;  5AM5 A;  4PJ0 Z;  4JV5 O;  2E75 B;  1Q81 W;  3P3N A;  3TAP A;  1HNZ O;  4I9W A;  4PGY A;  3G6B A;  3H8W A;  1YXB A;  3C3S A;  4D6T H;  3V6K A;  4I50 A;  5KG5 A;  1JVM A;  1LR1 A;  5BOM A;  2FL4 A;  4RPY A;  4FPP A;  3ZRV A;  4LNU B;  5J9P C;  1N5X A;  4UB6 Z;  4BW9 A;  3T79 A;  4NV0 A;  3QZ7 A;  2P67 A;  5EE1 A;  2DWE C;  4K0K O;  3Q4H A;  4JI1 B;  4ED2 A;  1I0H A;  3OTO B;  3HJE A;  5LYJ B;  2V7Q G;  4U7O A;  5KA6 A;  3RYF A;  1NZB A;  3HKC A;  5TIS Z;  3N97 B;  2GHY A;  2P6J A;  2G5H B;  3APO A;  3CSX A;  4OO1 J;  3QU9 A;  2ETN A;  1RYS A;  2AHO B;  2AQ0 A;  5J0X A;  1UA0 A;  3C21 A;  4I28 A;  2N74 A;  1RDF A;  4LVS A;  4DFD A;  3DXR B;  4WFB V;  1N33 O;  1TGO A;  3ZD9 A;  3CME V;  5JUM A;  1K5Q A;  3H0L B;  4HBN A;  3UMB A;  2EIK C;  2KD1 A;  2KIV A;  2R72 A;  4LF8 B;  5ALR A;  1VP7 A;  2CK3 G;  8ICB A;  2HVI A;  2RNB A;  4EYI B;  4PZN A;  4TV8 A;  2WTF A;  4NTY A;  5AHX A;  9ICN A;  2H5X A;  1YEW A;  1N60 A;  4BDP A;  1TUE B;  2JH7 A;  1OV9 A;  2AGP A;  2EDU A;  5KFX A;  3RFA A;  3PY8 A;  3OTF A;  3TXQ A;  5KT5 A;  5J2K A;  4MTO A;  1ZQJ A;  1YIJ V;  3D2Q A;  5FL7 G;  2EZY A;  2HHH O;  3BEH A;  1NK5 A;  2ZUB A;  4I2I A;  2ASJ A;  2F3N A;  1XMQ O;  4AP9 A;  3WK4 A;  2KZZ A;  4A5U B;  2CTQ A;  2AZ2 A;  3TKA A;  3HKE A;  2Z0A A;  5LP6 B;  2IH3 C;  3GIM A;  3JPT A;  1WWV A;  3SYC A;  9ICU A;  3F2D A;  1GAX A;  4BWA A;  3QEA Z;  5AKE A;  1MQ3 A;  4R8U A;  2JS3 A;  3FAV B;  1R3J C;  4ECV A;  2HKO A;  2PYL A;  1RPL A;  2ISO A;  5DLG A;  3HX0 A;  4RUF A;  2DUY A;  4K8Z A;  1IDS A;  2JEU A;  4ZI7 A;  1IBK O;  2V1D A;  4Z6D A;  2FE9 A;  1PM9 A;  8ICL A;  5IIJ A;  1QU7 A;  2M9N A;  5KFY A;  2Y1I A;  8ICI A;  4DV6 B;  2VAN A;  2ASL A;  3UM7 A;  4EB6 B;  4W4L A;  3AEI A;  4EEY A;  4DR7 B;  1NK7 A;  2OEH A;  3FYE B;  4WF9 V;  4DR6 O;  2QB0 B;  4LCU C;  2WF7 A;  3TQ1 A;  2CXY A;  4RQN A;  1HNX O;  1MZF A;  3RTV A;  1UJW B;  4DSF A;  1D8L A;  1QLE B;  2JGU A;  1T7P A;  4JV1 A;  5JCO A;  1ZSP A;  2ZE5 A;  4KX3 A;  2NYV A;  2ZIU B;  2YXY A;  4UCU A;  4QZB A;  5LMN O;  2IJK A;  1QVF U;  2ZR2 A;  4TUS A;  2P4K A;  5DBC A;  4XA5 A;  5KT2 A;  4O4I B;  5IIM A;  7ICR A;  4YIP A;  3GQC A;  1PK1 B;  4HNA B;  1MMM A;  4A8E A;  9ICF A;  1L1F A;  2AGQ A;  5L1M A;  4R65 A;  2PMZ C;  4F6R A;  4NL9 A;  2OCC C;  1YHQ V;  9ICT A;  3E86 A;  4C4T A;  1KMI Z;  2QKA A;  4PHZ A;  4TV8 B;  3MFI A;  5LOV A;  2OYQ A;  2ADP A;  2OHF A;  1NKC A;  2UVU A;  3PX4 A;  4P2H A;  1SET A;  4UB5 A;  2NRX A;  4Y2T A;  3UO2 A;  4HAI A;  1AP5 A;  3HKD A;  1U97 A;  3U10 A;  2G07 A;  1AR4 A;  2EIL B;  3ABL B;  3MHH C;  2UXC O;  3HKE B;  5KT7 A;  4XQ8 A;  5LOV B;  1YJN V;  2YQE A;  2BQU A;  3GFK B;  4KTQ A;  2ZXI A;  2W11 A;  4JAA A;  4NLN A;  1AJP A;  2EIK B;  3WKB A;  4J9Q A;  3MGV A;  1CPY A;  4RU9 A;  3T5K A;  5B66 Z;  5GTI U;  5HMM A;  4YQW A;  4DV6 O;  1E1R G;  3TGU H;  5DDM A;  2KIC A;  5ALD A;  2QGN A;  1Q3E A;  1OW5 A;  1BS3 A;  5AG2 A;  4P0Q A;  1H2N A;  3A0H Z;  4JI5 O;  4DQI A;  1OJH A;  2HHH B;  9ICP A;  1RYU A;  4Y2S A;  2R8H A;  4MS2 A;  3RJG A;  3RYH B;  3K4G A;  4LF7 O;  4MVR A;  3HPL C;  2E1E A;  4UAY A;  5DGA A;  2WLL B;  2N1R A;  4QIW C;  2UUB O;  3FYI B;  2WSS G;  4UCR A;  4JI8 B;  2GDS A;  2AHZ A;  1XMQ B;  3RJH A;  4GKK O;  4TV9 B;  5AI0 A;  2A3V A;  5CJ7 A;  3C29 A;  1SF9 A;  3QUT A;  8ICX A;  4RZR A;  1V54 C;  4NXM O;  5AKY A;  4I2B A;  4F72 A;  1P4R A;  3A2F A;  4O3R A;  1T8E A;  4C8M A;  4RUE A;  2IBK A;  4PPX A;  4LF4 B;  2GUZ B;  2FYU H;  4QZD A;  4X62 O;  3UXO A;  4TUY B;  2VWK A;  1IBL O;  4N21 A;  5HP4 A;  1K5S A;  5J0R A;  3HWT A;  3NXS A;  3WU2 U;  4Z6C A;  1DK2 A;  1JIH A;  1L7M A;  3QU7 A;  1J2M A;  4Y2R A;  2BSK B;  5ALV A;  2N05 A;  3TFS A;  1DTO A;  2JGD A;  4L8J A;  5GON B;  5ALI A;  4O4L B;  2UXC B;  1TVA A;  3UT5 A;  3T1H O;  5H2F U;  1TK5 A;  1KL9 A;  3RB3 A;  2OIE A;  2Z5U A;  3L73 H;  1FD9 A;  1PPJ H;  4DRX B;  3I1Y A;  3G6V A;  9ICC A;  3QYP A;  4NLG A;  3NS1 A;  4DV3 O;  2C2A A;  2KSO B;  3ZN0 A;  4M9G A;  1GK9 A;  4PDR A;  3B09 A;  3ASO C;  4DCC A;  4J41 A;  5B1B C;  1VQ6 V;  1ZD4 A;  2YDE A;  2NO5 A;  3C3T A;  2UU9 O;  5DEC A;  4BIO A;  3W7U A;  2NV3 A;  2R9R B;  2W9B A;  2R8I A;  3AK3 A;  2K4P A;  3CHX A;  5AM2 A;  5CA1 A;  4X1Y B;  8ICC A;  5B5E Z;  3T1H B;  1ZYQ A;  4JPR A;  4RQ7 A;  5J8Y A;  4JMU A;  4O2B B;  3D3I A;  3BQ1 A;  1NJY A;  3VQW A;  1WP7 A;  2K9P A;  4FLV A;  9ICB A;  1FKA O;  4UVB A;  5H2F Z;  4CH6 A;  1SL1 A;  1WPB A;  1XRE A;  2P7T C;  5D4B A;  1IV8 A;  2LYA A;  3N7P D;  2LJ2 A;  4DF8 A;  2C2E A;  1SQP H;  3D36 C;  1ENV A;  3DSQ A;  5LGN A;  1FO4 A;  4B9T A;  2KKW A;  2Q8V A;  2YIB D;  4LF6 O;  4NXM B;  1VQK V;  2ZT9 B;  2DGZ A;  4F5P A;  3QUB A;  1I5X A;  4X1K A;  3S3X A;  4G9B A;  3BS5 B;  4H33 A;  3JCZ A;  4JGS A;  4YCX A;  5ALK A;  5IYD O;  1L8L A;  2YX8 A;  5AI5 A;  4MVO A;  4RQ5 A;  5KFD A;  4TUY A;  1HNZ B;  2HHX A;  1SB3 C;  3PO4 A;  1Z00 B;  5KHI A;  3SPH A;  2VKQ A;  3CEI A;  1BSM A;  2FTK A;  3JAR B;  4JI5 B;  1UFI A;  2WHE A;  2KP7 A;  3I28 A;  2KG5 A;  8ICH A;  1V38 A;  2D8C A;  4BR6 A;  3H0M B;  4O4I A;  3I76 A;  5J0O A;  1M1K W;  1NVP B;  4HNA A;  2KKP A;  4BWJ A;  1Y88 A;  2CTP A;  1N36 B;  2EAP A;  3F5E A;  3KHR A;  4FMT A;  3G67 A;  2PGG A;  2P5O A;  1QQ7 A;  1S5H C;  3N27 A;  1U47 A;  2K8C B;  1WCN A;  5KFK A;  4OX9 B;  3H7I A;  2F4V B;  3ZHS A;  2UXD B;  1QTM A;  3ZHQ A;  8ICK A;  4E4E A;  4DW1 A;  4DV4 O;  1ZQO A;  2EIL C;  3ABL C;  3ZRX A;  3JPQ A;  4CE6 A;  1GM7 A;  8ICQ A;  1NTM H;  3RYI B;  4B3T B;  4RQ0 A;  4MT8 A;  5IJ0 A;  4LNU A;  3JD1 A;  3IDW A;  2EIJ B;  4ELU A;  3UQ2 A;  1VQL V;  5IWA B;  2W03 A;  1RP3 B;  8ICN A;  3CW2 C;  3JPO A;  2FLN A;  2PFP A;  1R6T A;  4LF8 O;  3MR2 A;  4QW9 A;  2Q0O C;  2ZIO A;  3AG4 B;  1X59 A;  1PZN A;  4UAS A;  5ALT A;  1Z2G A;  2EX3 A;  2NLJ C;  3LDD A;  1XNQ B;  5DGB A;  5H6Q A;  2UUC O;  7ICL A;  2KIW A;  3UMC A;  3N28 A;  3NVW A;  3MDA A;  3UQ0 A;  2ALZ A;  1TUB B;  4MVQ A;  2J6U A;  2BGW A;  2GO7 A;  2ASD A;  1DLB A;  3GIL A;  3LK9 A;  5KFJ A;  4PGQ A;  5B1N A;  3IFX A;  4O3S A;  4J10 A;  1VJ5 A;  2Q0Z X;  1JAL A;  1KP2 A;  3ABM C;  4UB2 A;  4IGG A;  4BJQ A;  3RRG A;  5ALZ A;  4LH7 A;  4LP8 A;  3OMA B;  1BPE A;  5LMU B;  3BHP A;  1XSN A;  1S10 A;  2AHY A;  5ALS A;  5KMG A;  5AI6 A;  2HG5 C;  4FLU A;  3FAH A;  4JV0 A;  1YCI A;  2XI9 A;  1XOU A;  4UQG A;  1VLB A;  2OYY A;  3RF9 A;  1EN5 A;  2ZXW C;  4MVZ A;  1IG6 A;  3ZJZ A;  5KFT A;  5J0Q A;  1ZQW A;  5ALW A;  3NVZ A;  1N2X A;  5C0Y A;  4RQF A;  4U7C A;  4UB1 A;  3Q8R B;  4KLS A;  1WB7 A;  8ICS A;  5HFM A;  3M8R A;  2E76 B;  3RAQ A;  4UB6 U;  1RZT A;  2X6C A;  1BMF G;  4EZ9 A;  2LPE A;  3H4D A;  1L8D A;  2R18 A;  1VEW A;  1N61 A;  2LMR A;  2G38 A;  1NOM A;  1KYO F;  3WK5 A;  2BPF A;  4I27 A;  5CWR A;  2QDO A;  4I2G A;  4DUZ O;  3P30 A;  3D8C A;  4ECZ A;  2IM9 A;  2IU3 A;  3IM1 A;  2W7O A;  2HOI A;  2UXB B;  5LGU A;  1AR5 A;  1V55 B;  1P7D A;  1COO A;  1AIL A;  2FLP A;  2XOK G;  4K35 A;  1RFY A;  1S5J A;  5BZB A;  1VQO V;  3ED5 A;  2MRL A;  2ZD9 A;  3IRU A;  4UBB A;  2BOC C;  3LWM A;  1TKD A;  2KFZ A;  3J81 N;  4U6P A;  3KCX A;  4YFK A;  1SV0 C;  4KHP B;  4WBN B;  5AKX A;  4PA3 A;  4DR5 B;  4PDV A;  5DG7 A;  3FD9 A;  4RT2 A;  3JYC A;  4I0X A;  4M9N A;  1AVM A;  5KAF U;  1ZQK A;  1N4C A;  4J9N A;  3AK2 A;  3NUQ A;  2C28 A;  2F4V O;  1KRP A;  4CH4 A;  4JZ2 A;  2ZUD A;  4ZI7 B;  3ALR A;  2XND G;  3KZI Z;  4I9Q A;  5AKI A;  2R8J A;  1WN7 A;  1JUD A;  3DC5 A;  4JAU A;  2KJ9 A;  2HW3 A;  4EEK A;  3ABU A;  4F5N A;  4FBT A;  2GBO A;  2NRV A;  4EB6 A;  3G4S V;  5JJE B;  1Y6X A;  4GKJ O;  1Z5V A;  2E8N A;  4I4T A;  3ZD8 A;  4DO2 A;  1IBM O;  1FFV A;  2ZJ8 A;  4ECQ A;  3T1Y O;  5ALN A;  3OGU A;  5IDJ A;  4NTX A;  5FPO A;  5DB8 A;  2ZIV A;  5G5H A;  3J81 j;  4X8A A;  3DDH A;  3RBZ A;  2KZM A;  5B3S B;  3GV7 B;  4TQF A;  2WB1 F;  2ZTC A;  3UCS C;  2ZIW A;  4C0Z A;  3OGI B;  3MGI A;  4GFJ A;  4TQR A;  1DF5 A;  1T94 A;  5LYJ A;  1CXZ B;  1DF4 A;  4M9H A;  1H2S B;  3NTU A;  5J2A A;  3BVO A;  2YID A;  1FXK A;  4GKK B;  5LXT B;  4O0I A;  3K5N A;  2WPD G;  3OEE G;  1XWL A;  1Q7Y W;  1HWY A;  2A1J A;  1YSC A;  1FXV A;  3F7V C;  4EX6 A;  1F0M A;  4UVA A;  1YJW V;  1RQN A;  4DYL A;  4FLX A;  3C2L A;  5C5J A;  3T5L A;  5IIN A;  2V9W A;  4JTC B;  3T4D A;  2F77 X;  5CRX A;  2KZ3 A;  5KX5 A;  3GIJ A;  4Q44 A;  2H3V A;  3IG8 A;  3GU3 A;  1ROP A;  1THZ A;  4ECU A;  3IG5 A;  4DRX A;  1S77 D;  5DBA A;  2W04 A;  5B66 U;  2JZB A;  1PVR A;  1R6K A;  8ICZ A;  4LC1 A;  4YY3 B;  1X40 A;  3WKA A;  4P4P A;  2ZM6 B;  3SJA C;  1P7G A;  3KBB A;  1SRY A;  5EYP B;  4DL2 A;  4J9L A;  3CC4 V;  3E8H A;  4XUS A;  1WJZ A;  4QE9 A;  2PUS A;  2WF9 A;  4TOI A;  3MBY A;  2D2C B;  2IJI A;  2X6A A;  5KG3 A;  4Q45 A;  3ZI4 A;  4KLE A;  4RUA A;  2F23 A;  2KE7 A;  1GH6 A;  1SXD A;  4O4H B;  3K9S A;  1SA0 B;  1N34 B;  3KKY A;  3AN1 A;  4EFE A;  4LWS B;  4P0Q B;  1LVH A;  3CCS V;  7ICE A;  1RQL A;  4KP4 A;  1SWW A;  1SKW A;  2CGO A;  2QKQ A;  2Y4T A;  1X9W A;  2YUA A;  3PW0 A;  1B4F A;  4YHH O;  3Q8L A;  1S0N A;  4OX9 O;  3U11 A;  4B7K A;  2HFE C;  2FJ6 A;  2B5U A;  4UBC A;  1RXV A;  2ARH A;  4DW0 A;  2A3Q A;  1VQ8 V;  1I5Y A;  3PN1 A;  2QWO B;  3O65 A;  4D7S A;  1XO0 A;  3KOO A;  4YJ2 A;  3TET A;  4JWM A;  4DSI A;  3IGA C;  3MR6 A;  3EUB 2;  4ECT A;  4UUJ C;  1T5E A;  4M6W A;  4GUN A;  1HP8 A;  1H2L A;  3LNM B;  3HKD B;  3O0F A;  1L3T A;  2W9B B;  2YMP A;  1R3L C;  1BQ0 A;  5GTH U;  3F53 A;  2H3O A;  5JU5 A;  2RN9 A;  4KFM A;  4YN4 A;  4DSK A;  4FM2 A;  2JVD A;  3A0R A;  5IYB O;  1BNP A;  3ASN B;  4B9S A;  3L75 H;  2UUB B;  2UVW A;  3RR7 A;  2ZQM A;  3RB4 A;  4M6W B;  1GM8 A;  2HBK A;  4MEY A;  1YDX A;  2Y0S F;  3L4P A;  2X0L A;  3MAB A;  2LW7 A;  4MTX A;  3M9M B;  2WLI A;  2PZS A;  3SDL A;  2ESE A;  5IT9 N;  2Q69 A;  5AK5 A;  2VA2 A;  2ITD C;  3ETD A;  3PSP A;  4QIW F;  1SZP A;  1L3S A;  1KQQ A;  1J97 A;  2H3F A;  1ZQT A;  4KMU A;  4IRC A;  4KLH A;  4J9Y B;  5EE0 A;  4PHD A;  2KVC A;  1MN8 A;  5ALP A;  5HR6 A;  4JI3 B;  7ICG A;  3CCQ V;  2YI8 A;  5B1A C;  2I6X A;  5AK4 A;  1ZL8 B;  5EIB D;  4LF5 B;  1X2I A;  4GXJ A;  2F44 A;  4F2S A;  3W7T A;  1NK6 A;  3WKE A;  1NJZ A;  2KQX A;  3WK6 A;  2ZE7 A;  4GYC B;  4UB8 U;  8ICU A;  2ZNJ A;  3CRA A;  3JAW A;  1JFF B;  2RDI A;  2XY7 A;  2ZIN A;  1EFR G;  5F9N A;  3RVZ A;  1JR9 A;  3MC1 A;  3E89 A;  3RWR D;  3T3F A;  3CCL V;  4IYI A;  1N8R W;  5KFZ A;  1VF5 B;  3RJF A;  4MEX A;  9ICA A;  2ZIX B;  4UAR A;  7ICN A;  8ICG A;  1MNG A;  1TUB A;  2JMG A;  1B22 A;  1BPX A;  4Z2W A;  4JI2 O;  1SQQ H;  1S3J A;  2R9I A;  5B5E U;  3BRC A;  3MR5 A;  3BS7 A;  2DMX A;  1G1X B;  3UPQ A;  4DFP A;  2K8A A;  1W2B U;  2E74 B;  1BPY A;  3BA8 A;  5ITZ A;  3QU4 A;  1BGX T;  2ZTE A;  1KEC A;  1ZQS A;  1PKX A;  3RYH A;  3ZDC A;  4K4H A;  5KFN A;  3VC8 A;  4ZOH C;  2O6K A;  4ZKI A;  5IYZ B;  3CYM A;  2QE7 G;  1ECW A;  5KAF Z;  1EZV H;  3B2E E;  2YC0 A;  4LF9 B;  2K4E A;  1G8M A;  4X20 B;  3A8T A;  4LFC B;  2QTO A;  4Z6F A;  2GV9 A;  1ZQ1 C;  1F23 A;  4DK0 A;  4FE3 A;  4J9R A;  2ZIM A;  3M8A A;  1XS9 D;  1KEJ A;  5AIC A;  3MFH A;  1M4U A;  1S8O A;  1KFD A;  3SYZ A;  2Q6A A;  5ITZ B;  1RM1 C;  3LYS A;  2V4R A;  1RPR A;  4UCS A;  2H8P C;  4DL7 A;  3QO5 A;  5DM6 V;  2WAQ C;  2E8O A;  2FMS A;  4X20 A;  3KZX A;  2V4D A;  5DG9 A;  2EZO A;  1JMS A;  4DV0 O;  1UQV A;  3IP4 B;  3A0B Z;  2HVK C;  3TXS A;  5K1P A;  3HP6 A;  5KUK A;  3SEN A;  3JPN A;  2H3I A;  3SJC C;  4QPJ A;  8ICJ A;  1DGS A;  2EIJ C;  3UT5 B;  9ICH A;  1TVK B;  1BNO A;  2XAQ A;  5JVD A;  4DV0 B;  2OT5 A;  3VQY A;  5FNV A;  1N63 A;  3N2K B;  2VS0 A;  1Q86 W;  1A76 A;  5KFF A;  1N5W A;  2D3D A;  3CCM V;  2KHQ A;  5L1L A;  2WF6 A;  3SQI A;  3JAK A;  3LDE A;  3STL C;  2XCP A;  2OWO A;  4F3O A;  4ABM A;  4GX2 A;  5J2B A;  3PML A;  3IAY A;  5FP0 A;  5CA7 A;  1ZQZ A;  2XY6 A;  1FYJ A;  4KLU A;  4X1I A;  1KKC A;  1XHZ A;  2XC9 A;  4FBU A;  4RQ8 A;  4DQS A;  3FB6 C;  1B0X A;  2YMM A;  1AI6 A;  4AQY B;  1V54 B;  5AIA A;  4F92 B;  4U3F H;  3IC9 A;  5CB4 A;  3SYP A;  1MSW D;  2MUT B;  4X64 B;  3JAR A;  4H0L B;  3CX5 F;  4D7T A;  3BAA A;  1VQP V;  4DV5 O;  2WB1 C;  2DE0 X;  3RFR A;  3PR4 A;  4YG2 A;  2K89 A;  2QB0 A;  5EWF A;  4B9M A;  4K4G A;  2OM6 A;  1M93 A;  1XQ8 A;  5J2U A;  3CCV V;  3OM3 B;  3L5K A;  2FPM A;  2C2R A;  3CP8 A;  3CC7 V;  1ZQG A;  4LBE C;  2YB1 A;  4QZF A;  1UPG A;  1NKB A;  1QQ5 A;  1SV0 A;  2PTM A;  2XHB A;  4DV7 O;  3KCY A;  5EBM C;  3W7S A;  1ZLZ A;  3HB3 B;  3HKZ C;  3BS5 A;  5ALQ A;  4EEN A;  2XID A;  1XIL A;  4R50 A;  1UCV A;  4K4I A;  1K3E A;  4R66 A;  5L3C A;  1SL2 A;  2BZF A;  3HKC B;  4X64 O;  3BAB A;  1PK3 A;  5LHG A;  2UXD O;  1Q8I A;  4TSF G;  8ICT A;  2DOS A;  5T14 A;  1L3V A;  2DQ3 A;  1HNX B;  3PJS K;  5IY5 B;  2DQ0 A;  5IY5 C;  1XBL A;  1PNM A;  5IYC O;  4B3S B;  2E5S A;  4DO9 A;  3H40 A;  1YZ6 A;  8ICA A;  5GTI Z;  5CA0 A;  4DFJ A;  4DSL A;  4TWK A;  4WCE V;  4DL5 A;  4Q43 A;  3H4B A;  3H1H H;  1Q6H A;  4F4W A;  5CN0 A;  4ECX A;  3PSF A;  4DFM A;  1VIB A;  5J2I A;  2DBY A;  4XRH A;  2QA4 V;  2YY6 A;  1LUW A;  4IIJ A;  4TV9 A;  2UXX A;  1JXL A;  4KN4 A;  5DLF A;  4KLG A;  1RM6 C;  4W4K A;  5KUM A;  5BMV A;  1I94 O;  4IRD A;  3HIL A;  1X66 A;  5DN6 G;  3HKB A;  1BGY H;  1ZD5 A;  2RP5 A;  1FIQ A;  3QEB Z;  2NR5 A;  4QE7 A;  4QZC A;  3W7W A;  4DV2 O;  1I7F A;  2CE4 A;  1WLE A;  4PA6 A;  1PL4 A;  3AL0 B;  1NTZ H;  2Y69 B;  8ICR A;  3ISD A;  1HJP A;  3E22 A;  1O08 A;  4OJP A;  5J2T A;  2IHN A;  1SES A;  3LVW A;  2Q0A A;  1G4Y B;  4X65 O;  4F71 A;  4DUY O;  1TE2 A;  4FIP C;  4JI8 O;  1VQN V;  1EN4 A;  4MF2 A;  1SQG A;  3IC7 A;  4NVP A;  4G2K A;  5KG1 A;  4UB4 A;  2BOB C;  2HR3 A;  3KFU F;  3TAC B;  1R1B A;  5AKK A;  1SA0 A;  3BCC H;  3MHS C;  4PA9 A;  2VJ4 A;  4XDL A;  1KKX A;  1UPH A;  2BPC A;  2V4Q A;  1F4N A;  1Y67 A;  5F2V O;  2KNJ A;  3PW7 A;  2RCV A;  4JTD B;  4PDL A;  1FAF A;  1NS1 A;  3PW2 A;  3QO8 A;  4Z1V A;  3ETL A;  4QWB A;  4I2A A;  4CH3 A;  5LGT A;  3BZK A;  3CCR V;  4DS4 A;  1QBZ A;  1DGJ A;  2ES6 A;  3KKA A;  3L3F X;  3C5F A;  4UCT A;  1KQS U;  4AI8 A;  5JWP A;  1HNW O;  4EYH B;  1IUR A;  2W0F C;  4ZH4 A;  1MQ2 A;  3SYQ A;  3H8S A;  1D8Y A;  2KK0 A;  5III A;  2EIN C;  3GVM A;  3ZMV A;  1GMG A;  4O2B A;  3ETR A;  4CF3 A;  4DV3 B;  3JD4 A;  1FS0 G;  3T5J A;  2ZR3 A;  3EPI A;  4F2R A;  4AHC A;  3H1L H;  2IBZ H;  3AQE A;  3H1K H;  2J6T A;  3VQX A;  4C8N A;  2HBL A;  2KEY A;  4O4H A;  4CS2 A;  2ZNI A;  2DN9 A;  5KFH A;  2DL0 A;  5DED A;  1KD1 W;  4DV1 B;  4ACO A;  1F7Y A;  2MAX A;  3KHG A;  4C7Z A;  3CRX A;  3NAS A;  1CEZ A;  1KB9 F;  4MVS A;  4EEQ A;  5BR8 O;  4CS3 A;  3TAD C;  2XGP A;  5C8Y B;  2ZG6 A;  4RQM A;  2XIC A;  4B08 A;  1ZQQ A;  1WUD A;  1Q5O A;  2Y0S C;  2LQT A;  4USA A;  3SD7 A;  4YIO A;  2ZKO A;  2ITC C;  3UKM A;  3B4S A;  3EHB B;  1Y4M A;  8ICO A;  5AM1 A;  5EOZ A;  1H8H G;  3ZHR A;  3RJE A;  5L3D A;  4OJO A;  2JEG A;  4IS7 A;  1OZ0 A;  5DDY A;  3BQ7 A;  1PP9 H;  3D2N A;  3AU2 A;  2IU0 A;  4TQD A;  2YB4 A;  1XNR O;  2ZDI C;  4C8O A;  4IL6 Z;  2OCC B;  2Z7J A;  5AM4 A;  1CP9 A;  5CEH A;  2OH2 A;  4B3S O;  1ZL8 A;  1S5L U;  4K3A A;  2G09 A;  3PO5 A;  1M5I A;  2OCH A;  1QCK A;  5JQG B;  4Y2X A;  4YP3 A;  2XGQ A;  4O5C A;  2WF8 A;  1SC5 B;  4NTW A;  3WB1 A;  3ZDB A;  3IN5 A;  4GKJ B;  3CRC A;  2D3O W;  4JB3 A;  4PEL A;  2Z3Y A;  1BE3 H;  4JI0 B;  4ECW A;  2EUL A;  3SAF A;  2BTQ B;  1D8B A;  4QNH B;  2MA1 A;  2C2D A;  4EKW A;  5BPC A;  4B9N A;  4O3M A;  4KLF A;  3G6E V;  4GX0 A;  1B43 A;  1DRG A;  3WB0 A;  3DC6 A;  2H3Z A;  1L7P A;  5JRT A;  2JJ2 G;  4I5S A;  4PA4 A;  5KFQ A;  4MF8 A;  3AG2 C;  3FB5 C;  5L3G A;  3C90 A;  2KG7 A;  3SAG A;  3OT7 A;  5J0Y A;  4LR3 A;  1DOQ A;  1ZTE A;  4Q8F A;  2L35 A;  3ZS8 C;  2DPI A;  1K4C C;  4RQ4 A;  2R70 A;  4X66 O;  3D36 A;  2AXT U;  3EXA A;  5DKW A;  1COW G;  2DWQ A;  3WG7 C;  3E8B A;  1Q6U A;  3UQ8 A;  2NRT A;  4YR3 A;  1OXJ A;  3CS5 A;  5EBL C;  2LI6 A;  4B3M B;  2WLK A;  9ICL A;  4Y2Y A;  4J80 A;  1ZQD A;  1ZRN A;  3K04 A;  3FYH A;  2VA3 A;  3AG2 B;  5J8Y C;  2HP8 A;  3K5O A;  3NR7 A;  4KL1 A;  4O2A A;  3NRZ A;  3F2C A;  1ZX3 A;  4DFK A;  4ASU G;  2PYJ A;  4HYO A;  2EZX A;  1K97 A;  5L1I A;  2RQ5 A;  4M2Y A;  1NQT A;  4X66 B;  2ODG A;  4QWE A;  4RNM A;  5DBB A;  3SZ2 A;  5LMN B;  4X89 A;  4FLZ A;  4G3I A;  1NZ6 A;  2UUA O;  4KLL A;  2LFS A;  4YXM A;  3VCB A;  1XO1 A;  3D2S A;  1JN3 A;  1IBL B;  1ZJN A;  3OD4 A;  2W55 A;  2OXO A;  4MHV A;  3K08 A;  2QWN B;  2DW4 A;  1PNK A;  1HUO A;  2YTU A;  3AK1 A;  3WKC A;  5DQI A;  1C7Y A;  2W9M A;  1UT8 A;  9ICQ A;  2QEX V;  4PHE A;  3Q8K A;  2DFL A;  4CRX A;  3RAX A;  1NI3 A;  4C7Y A;  3ZDE A;  4DV2 B;  1AP6 A;  4TUR A;  3CE2 A;  2BCC H;  1SS3 A;  1PK1 A;  1V97 A;  1GTO A;  3NGD A;  5IJ9 A;  5CB4 B;  5JJN B;  1QSY A;  1FEZ A;  4PI2 A;  3T1Y B;  4MFF A;  1L3U A;  4FLY A;  3JD0 A;  1WNS A;  4M9L A;  2CAZ C;  2ZCE A;  4NYK A;  3WFV A;  4RNO A;  3RGB A;  4QNL A;  3FX7 A;  1YTF D;  2B0C A;  4B9L A;  2DPJ A;  1SIJ A;  5IJ0 B;  3SMV A;  1PNL A;  1SQX H;  4R6Z A;  4ECS A;  3JSN A;  5B1B B;  3ASO B;  1OCC B;  3K0D A;  5CMU A;  5J2H A;  4JI2 B;  4IYH A;  5D49 A;  1U4B A;  2OIG A;  5H9C A;  1F5S A;  2W3R A;  5KL8 B;  3SJQ C;  1NK9 A;  1WYG A;  1K33 A;  2QLT A;  1P7B A;  5KHH A;  3J80 N;  4BW5 A;  5KFU A;  1ZD3 A;  3C28 A;  1JXE A;  4ECY A;  3BPZ A;  3M7M X;  4QWC A;  5KHG A;  3RB6 A;  4DR3 B;  1N32 O;  4X62 B;  5KL1 B;  4RPZ A;  3RR8 A;  2UXB O;  1N36 O;  5KG2 A;  3O9O A;  5D5P A;  8ICE A;  2P6U A;  4KHP O;  1D5A A;  3OE7 G;  4UXN A;  1N48 A;  2JEJ A;  2F1I A;  2GTS A;  5KMG B;  4YJ3 B;  1M90 W;  2QWR B;  2B21 A;  4CGZ A;  4JI7 B;  4YVZ A;  3PX6 A;  5J2D A;  1WCL A;  4IIJ B;  1K9M W;  2HJD A;  1P84 F;  1ZQX A;  4YMM A;  4J9S A;  4PJ0 U;  4F8R A;  1NH2 B;  4R64 A;  5BY1 A;  1N34 O;  4L87 A;  5C93 A;  4JI6 O;  1GN2 A;  1TK8 A;  2W6I G;  2E1F A;  2EAN A;  4CDG A;  4RQ3 A;  2CH7 B;  4ICA A;  1ZQM A;  4P0P B;  3J7A U;  4E2L A;  3OTQ A;  2BTO A;  4KLD A;  3WU2 Z;  1IBM B;  4NWI A;  4F4Z A;  4JAS A;  3ZHU A;  1BHA A;  5LP6 C;  1Q8K A;  1ZQR A;  3K79 A;  1DXS A;  1U96 A;  4JI7 O;  1OCR B;  2BKE A;  2ZIX A;  4IL6 U;  1KTQ A;  3E35 A;  3ZED A;  3MDC A;  2GH1 A;  4B9U A;  4MFA A;  2R9A A;  3ZHT A;  2VA8 A;  3RRH A;  1N0J A;  4QGP A;  2JGA A;  5J2E A;  4HAM A;  4MTG A;  4RNN A;  4LFA B;  1VQ5 V;  3E8G A;  3TK1 A;  1SV4 A;  4JZG A;  5CBG A;  1ZQV A;  4CF5 A;  2WLH A;  2ZIW B;  4DSJ A;  4C8L A;  2MSN A;  5KFG A;  4DLE A;  1XNR B;  3ISC A;  3UMG A;  3TFR A;  5KFM A;  4O4J B;  3SPJ A;  3W7X A;  1KU9 A;  3HT3 A;  1YVW A;  3AG7 A;  3ZRW A;  1M56 C;  3JAT B;  3K59 A;  1L5U A;  4FS2 A;  2LP7 A;  4U7N A;  3B0Y A;  5LHH A;  2VWJ A;  4J7J A;  4PL2 A;  1QR9 A;  2F66 C;  4KLI A;  4O5E A;  1NK0 A;  2Q9L A;  3QU5 A;  1QSL A;  4BXO A;  3UM9 A;  4UVC A;  1BPB A;  1JQ0 A;  2WA3 A;  4O3P A;  4O5K A;  2GSM B;  4X1I B;  1SKR A;  2FMP A;  2CTW A;  3CNH A;  4RUC A;  4R8C A;  3JD2 A;  4XDK A;  4JI1 O;  1SQB H;  2J6S A;  4XBF A;  1AB3 A;  3BFR A;  1VF6 C;  3PW5 A;  7ICF A;  4FK5 C;  1U45 A;  4JWN A;  4OPH A;  4RQ1 A;  3F5W C;  2MUT A;  3PZP A;  4R8U B;  1VMG A;  2QM7 A;  2NO4 A;  1SWV A;  3GDX A;  3E83 A;  3ABK C;  3N2K A;  3LDC A;  3KKA C;  4G28 B;  2FMQ A;  3MDS A;  4UW9 A;  4TUP A;  1BPD A;  2DYR C;  2I1Q A;  4F5Q A;  4KLT A;  3CPW U;  3ZIA G;  3SGI A;  3VQV A;  5J29 A;  5BOL A;  3AQF A;  4G27 B;  3ZX6 A;  2YIC A;  1DK3 A;  1MSD A;  1T3N A;  2W0X A;  5L3E A;  1YT3 A;  4O9M A;  7ICM A;  3WK9 A;  2KHV A;  2P4V A;  3C1Y A;  1L7O A;  1S76 D;  3C1Z A;  3JAL B;  1EN6 A;  4QW8 A;  5L3F A;  3Q8Q B;  3TAN A;  2BCS A;  4CC6 A;  3PX0 A;  1I94 B;  3Q8P B;  3AG4 C;  2YI9 A;  3CMA V;  3UXP A;  3G71 V;  4LFC O;  3JPP A;  3ASN C;  4N23 A;  5CR0 A;  1WAZ A;  2WLM A;  4K0K B;  5KNI A;  5AI4 A;  5K4L A;  5C8Y A;  4R7C A;  3K57 A;  3MR3 A;  1XMO O;  3H9V A;  4PZO A;  3V72 A;  1U48 A;  3SR2 C;  2UVV A;  1L0N H;  4MSW C;  2ZE8 A;  2KSO A;  4DQQ A;  1SL0 A;  4QZ8 A;  5J2C A;  2KN7 A;  4GZR B;  2RQ6 A;  3DTU B;  2G06 A;  1YIT V;  2HEP A;  4MVM A;  1QNM A;  2BR0 A;  3L71 H;  1GN4 A;  3OAA G;  2W9C B;  3KZI U;  1ZD2 P;  3B40 A;  8ICP A;  5F9L A;  2ILM A;  2PFN A;  2GLE A;  4IHJ A;  3K58 A;  1UT5 A;  4DL4 A;  4O3Q A;  1C20 A;  1N33 B;  2WFA A;  5L3B A;  1ED1 A;  5AKH A;  3OHB A;  2HHS A;  1CUK A;  4J9O A;  4UFZ A;  1FPO A;  3K3W A;  3A0B U;  5K1X A;  1AI5 A;  4GX5 A;  5EE9 A;  4AIL C;  1GN3 A;  2DWD C;  1ARO P;  3V7K A;  5ALM A;  3D3Q A;  1Z4O A;  3C23 A;  5A2Q N;  3AG1 C;  1HR0 B;  4DL6 A;  3M6Z A;  4B7E A;  4UB3 A;  3N2G A;  1H38 A;  4DUY B;  1MA7 A;  4EEL A;  4Y2V A;  4IT5 A;  1JFF A;  3LUT B;  2F2A B;  1ZAU A;  1GRJ A;  7ICP A;  3RN4 A;  2ZJ5 A;  4M47 A;  3WB2 A;  5GON A;  1FFX B;  2WLL A;  2F76 X;  3L70 H;  3L74 H;  4CS4 A;  1WPX A;  4BAY A;  5EC1 C;  4DV7 B;  7ICU A;  3JAM N;  1WB8 A;  2QWP B;  2HLD G;  4LF7 B;  1JX4 A;  4CC5 A;  5IWA O;  3E22 B;  2W7P A;  3R9K A;  2CRX A;  4US8 A;  3IJ4 A;  4KLM A;  9ICK A;  1F4M A;  2IMW P;  3SYA A;  1XI1 A;  1K73 W;  4C4R A;  5AK3 A;  2UUA B;  4YY3 O;  2Q5Z A;  2A1A A;  4DSE A;  5EE3 A;  4FO6 A;  2JRZ A;  4J9K A;  5IE9 A;  4P2Z A;  1NU1 H;  3RH4 A;  5FNV B;  4LZD A;  2WLI B;  4C4S A;  4CNQ A;  4ED0 A;  4DV4 B;  2JZB B;  4KUM A;  2GWS A;  5GTH Z;  3SI8 A;  4RAI A;  1EXN A;  1H2M A;  1ZQP A;  2P6R A;  2KG7 B;  1BVS A;  3OSP A;  3F5A A;  4YJ2 B;  4QZH A;  4LF4 O;  7ICO A;  2AZ0 A;  1AJN A;  2W43 A;  3LNN A;  4GX1 A;  3FKS G;  2QSA A;  1S0M A;  4KLO A;  2KSD A;  5KFO A;  3I56 V;  3WKD A;  3HW8 A;  4UV8 A;  1Q46 A;  3B9J A;  1QSS A;  2PMZ F;  2RDC A;  3PV8 A;  1MA1 A;  1ZOL A;  4OCZ A;  3T4Z A;  4FZ0 A;  3RBD A;  2EZZ A;  5AI9 A;  4NLC A;  1W0J G;  4Q20 A;  8ICV A;  2LM4 A;  4QZE A;  2RDJ A;  4PDM A;  3G80 A;  4EBC A;  3M9O B;  2YN4 A;  3E2E A;  3OEH G;  4DLG A;  1MOF A;  1D5N A;  1N62 A;  1WG8 A;  1HW7 A;  4HYK A;  1LKY A;  2Q4T A;  2LKY A;  3T5H A;  4FLW A;  3JCU Z;  3M9N B;  4CZZ A;  3STZ C;  1Z00 A;  4NLZ A;  1HEK A;  2HHW A;  5KAI Z;  3C2M A;  2EAO A;  9ICG A;  3QNE A;  4PV1 B;  2BCQ A;  8ICF A;  5DB6 A;  1OCO C;  1HUZ A;  1SZT A;  2KB1 A;  1P49 A;  5L1J A;  3F7Y C;  3EW9 A;  2HHU A;  4ELV A;  3H1I H;  5JH7 A;  3AG1 B;  3ZHV A;  1K34 A;  1KDH A;  1KW4 A;  2YML A;  2HSZ A;  4RT3 A;  1ZQI A;  5AKG A;  5A0L A;  1NI8 A;  3PVX A;  4ZIB A;  1Z4N A;  3IV6 A;  4P4O A;  2QR4 A;  4I55 A;  1NJX A;  4F6E A;  3JAS B;  1X6J A;  2XUM A;  3HKZ F;  4E0D A;  2IJJ A;  3M6K A;  1Z1B A;  2YEV B;  4B6J A;  2HBM A;  1FXK B;  3FM9 A;  5KG0 A;  3JAL A;  4FFK A;  1Q90 D;  4DOB A;  4HZ3 A;  4R63 A;  3KG2 A;  1IXB A;  2HJF C;  5IJ9 B;  4JI3 O;  3A0H U;  5KFS A;  1KFT A;  2XAJ A;  3ZCC A;  1S0O A;  1B3Q A;  4JF3 A;  1YTF B;  1Q43 A;  3GIK A;  3ZN1 A;  2XAF A;  3ICX A;  5KLV H;  4GCZ A;  4DR7 O;  4F4K A;  3PW4 A;  3WG7 B;  1BQZ A;  4I2H A;  2UVR A;  2XT9 A;  2HI0 A;  5EWG A;  1TA8 A;  4X1Y A;  4J9M A;  2W6J G;  3H01 A;  1D9D A;  5A9G A;  3EPG A;  5KFV A;  1R3I C;  4DR2 O;  2Q68 A;  4WJ3 B;  3FB8 C;  4TUQ A;  3RJI A;  2GTA A;  2B9Z A;  1E79 G;  2W9A A;  2W54 A;  4QPK A;  2LO1 A;  2DQN B;  1X9M A;  4IQW A;  5HHI A;  4QJF B;  1FJG B;  3JSL A;  3TAQ A;  1PL0 A;  2Y9U A;  4X9Q A;  2LFR A;  3RYF B;  5LP6 A;  2EAM A;  3CP1 A;  2HOF A;  3ZMS A;  1NTK H;  3RT3 C;  1XNS A;  4GC6 A;  4BXO B;  2XCA A;  5L9X A;  5AM0 A;  1JPX A;  2F1H A;  3H8M A;  4ZOL B;  5KTQ A;  3KTQ A;  1K92 A;  4TT3 G;  5KAI U;  4DOC A;  4B3R B;  2QJ1 A;  3HKB B;  5KFP A;  3GV5 B;  2IOH A;  5IYZ A;  1BHB A;  1GM9 A;  1NVP D;  3H1J H;  5KT4 A;  2IHM A;  3QZ8 A;  4YJ3 A;  5AIB A;  1TAU A;  4X65 B;  4EZ6 A;  3GWO A;  2NN4 A;  4GXK A;  4NKG B;  1ZQE A;  4Z1M G;  2F8K A;  1QHT A;  3M99 B;  2KVS A;  4AQY O;  4UAT A;  3AM9 A;  1BL8 A;  2K4I A;  5KFA A;  5CA3 A;  3MAQ A;  5DB9 A;  3QTC A;  5KT3 A;  5CBH A;  9ICX A;  2CPR A;  2ZIV B;  2W8K A;  4I2C A;  2KJ8 A;  3PST A;  5B1O A;  4TQS A;  2AH5 A;  1JX9 A;  4BIZ A;  4P30 A;  4FM1 A;  2E5L B;  1O03 A;  2HOQ A;  2XAH A;  5IIO A;  1KLN A;  3DXR A;  1ZJM A;  4XDJ A;  5B1A B;  1JJ2 U;  1FFU A;  5ALL A;  2L6L A;  2JR5 A;  1ZQU A;  3QU2 A;  2EIN B;  3OGC C;  3JAK B;  1MC8 A;  3N7S C;  1TV9 A;  3TJT A;  3LWL A;  4NM1 A;  4EX7 A;  5DG8 A;  4DF4 A;  4QZ9 A;  2YXL A;  2ZXH A;  2FKX A;  2ZXW B;  1HIW A;  4RQ6 A;  1W59 A;  1EM1 A;  2NRW A;  2H94 A;  1ZQN A;  3ETG A;  3OW2 U;  4UV9 A;  5AK6 A;  1YI2 V;  5EYP A;  3P32 A;  1AI4 A;  2FDR A;  5ALF A;  2FLL A;  5B3S C;  3N4M B;  4RQ2 A;  4Z6E A;  4AYB F;  4IR1 A;  5BR8 B;  3MGH A;  1XDC A;  3NVV A;  3UXN A;  3FDS A;  5FLX N;  2KMD A;  4I4T B;  3OFN G;  1FFT B;  3X2Q C;  2PI5 A;  4I2D A;  3JPS A;  3B8M A;  4DQP A;  2ZUC A;  1AQ6 A;  2WAM A;  2JEX A;  5EZY B;  3CD6 V;  1XMO B;  2OTJ V;  4FZN A;  3GZF A;  2QKS A;  2YIB A;  2ADQ B;  3EFF K;  2K8B B;  2YMQ A;  1VF6 A;  2P90 A;  4EFB A;  1X42 A;  1E1Q G;  5LMU O;  3BJY A;  2PY5 A;  2E5L O;  4JV2 A;  2DYR B;  1BPZ A;  4FFD A;  4O3N A;  4DWI A;  1M57 B;  5AKZ A;  1ZQB A;  1FXH A;  3VBB A;  9ICS A;  3GV8 B;  2ZIU A;  3FB7 C;  7ICV A;  2FML A;  1TAQ A;  3JAS A;  4JYA O;  5J0T A;  3V7J A;  4I2F A;  3CB2 A;  3ORY A;  3NVY A;  4FM0 A;  5AM3 A;  4DXW A;  4RO2 A;  9ICR A;  1IXM A;  5AKJ A;  3F2B A;  4KXR A;  2FPK A;  4P9P A;  2ISP A;  3JPR A;  3K75 D;  3TCU A;  3ZRW B;  3AU6 A;  3LSQ A;  1SQV H;  5KA5 A;  4J42 A;  4M0A A;  1HR0 O;  4RWU A;  4PD4 F;  3ABT A;  3E58 A;  1RM1 B;  3V7L A;  2HDO A;  4YR0 A;  3SPG A;  3QVN A;  2ZJA A;  5CP2 A;  5DQG A;  4B3M O;  2EH9 A;  1G6U A;  5EWE A;  1L0L H;  3KHL A;  2PXI A;  4IQU A;  5IIK A;  2IOF A;  1R6N A;  3LVV A;  3E8F A;  4K8X A;  4BX9 C;  1UHU A;  4M04 A;  2XTA A;  1X9S A;  1KKD A;  1X9X A;  3BZC A;  5EBW C;  2JRI A;  1K1S A;  4BWM A;  5J0P A;  2Q73 A;  4WBN A;  2EQY A;  1XU4 A;  2JH1 A;  3CXC U;  2NRZ A;  1SZH A;  3RJJ A;  9ICW A;  4O2A B;  2KKV A;  1NJI W;  1Y76 A;  1D2D A;  4I29 A;  1Y74 A;  3TI0 A;  4WFA V;  5E1A C;  2HVJ C;  2Q7E A;  1KBH A;  1J2N A;  7ICT A;  1RSO A;  4DR3 O;  1N32 B;  4US9 A;  3CXH F;  1PVQ A;  3U0Z A;  3QNM A;  2XO7 A;  2WA4 A;  3EVK A;  7ICQ A;  4DOA A;  3L72 H;  4ICG A;  3RBE A;  4DUZ B;  3QO7 A;  2W3S A;  2YSU B;  3JAW B;  1XL6 A;  2QAR A;  3D6J A;  1N56 A;  3U26 A;  2ZTD A;  4KLQ A;  2WAQ F;  5LL6 Y;  4OD0 A;  5J2U B;  3DGE A;  1RXW A;  1JRO A;  2LGQ A;  4NLB A;  4PA7 A;  2ZDI A;  1ZQF A;  3VOU A;  1VF7 A;  1X6I A;  4LH6 A;  2HHV A;  4MFC A;  2QAR B;  1DK1 A;  2G5I B;  2LYB A;  1UA1 A;  4UAV A;  3PR5 B;  1JJO A;  1A0P A;  4C8K A;  1ZQL A;  2Y0P A;  2X6B A;  4LF6 B;  5ALU A;  2K4H A;  1OCZ B;  3PSI A;  1IZ3 A;  3CRM A;  3UO3 A;  5JQG A;  1ZQH A;  2YS8 A;  3BY6 A;  1XNQ O;  2N04 A;  5LXT A;  3V6H A;  4Y2Q A;  3Q8M A;  1SZX A;  2BQ3 A;  1W0K G;  2RLT A;  5KFL A;  2HMX A;  1NR7 A;  3HR0 A;  5LA6 B;  2LBO A;  3BQT A;  3RW0 A;  2E8P A;  4IHJ B;  4JI4 O;  5ALY A;  2K60 A;  3SEI A;  4I50 B;  5ALH A;  2RRD A;  3M7D A;  3GII A;  2AQ4 A;  1H8E G;  3T1C A;  5J2F A;  2M7W A;  3ZMU A;  1SQF A;  1S97 A;  1A32 A;  3IHQ B;  1VAR A;  2B1I A;  4P9O A;  5D5Q A;  5BMV B;  3APQ A;  3KHH A;  1JMK C;  3RJK A;  3K0G A;  1SER A;  4JAV A;  1YZ7 A;  1R3K C;  5CA1 B;  2ZM6 O;  3ISB A;  2P66 A;  2Y9T A;  9ICE A;  1TAE A;  2MK3 A;  3H0R B;  1S9F A;  4CH5 A;  4U3J B;  4F5O A;  4LWS A;  4P4M A;  2W8L A;  3E0F A;  4QZI A;  3OUF A;  4Y2U A;  4UAW A;  4H13 B;  2DJV A;  1Z3E B;  2AJQ A;  3SV3 A;  1FFX A;  5KFC A;  3ZMT A;  4NY8 A;  3PMN A;  4UCO A;  3AMZ A;  4JI6 B;  1IVS A;  2X7R B;  4F4L A;  1MZE A;  3SV4 A;  1K4D C;  5LHI A;  2XAS A;  4YR2 A;  3BQ2 A;  8ICW A;  2PFO A;  3SAH A;  4DQR A;  7ICJ A;  3OHA A;  4YMN A;  1IM4 A;  4KX5 A;  2BDU A;  1WWU A;  4F4X A;  2K1E A;  2P35 A;  4FLT A;  5HR7 A;  5H5N A;  3L9D A;  3RYC B;  4YMO A;  5HML A;  2I9G A;  3WK8 A;  2JEI A;  1NK4 A;  5KG6 A;  3AEV A;  1JRP A;  4IQV A;  1GN6 A;  1VQ4 V;  1ZQA A;  4PHP A;  2H3Q A;  5KFR A;  3SPC A;  3ZDD A;  5AI8 A;  2MU2 A;  3FAV A;  5H6R A;  2ATK C;  2HHQ A;  4FJC C;  1JCH A;  1Q82 W;  1H2K A;  1Y66 A;  3K9A A;  1OHH G;  2YIA A;  1B06 A;  1COK A;  4RPX A;  7ICH A;  2UU9 B;  5ALX A;  2DKZ A;  3ONN A;  3HPO A;  1L7N A;  4JYC A;  2Y1J A;  4JYA B;  2I5H A;  1QQ6 A;  5KG7 A;  4NLK A;  1LB2 B;  4Q8E A;  3EZ5 A;  4FVM A;  2BE3 A;  4Q6G A;  1LNQ A;  1PUZ A;  1US6 A;  5JCO C;  1QH9 A;  2A19 A;  3CWB H;  1OCZ C;  1XUQ A;  3I55 V;  1NT2 B;  2B6G A;  3K1Z A;  1IX9 A;  1BCC H;  1JA8 A;  3LSS A;  4YXJ A;  1QVG U;  1OUQ A;  3RVY A;  2VQE O;  4U3J A;  2KFN A;  1SXE A;  4GT1 A;  3EYZ A;  4I2E A;  4ECR A;  3F5T A;  5JVD B;  1Y76 B;  5HHH A;  3X2Q B;  2Q67 A;  4NM2 A;  4J9P A;  4LJX A;  1Z19 A;  1O9H A;  2ZE6 A;  1ZXI A;  3AUO A;  4X5V A;  1SKV A;  4ED8 A;  3BDP A;  2XY5 A;  4J7K A;  4OGQ B;  3ETQ A;  1VQM V;  3RH5 A;  1RYR A;  4I55 B;  1V85 A;  1AR1 B;  1QCE A;  4ED1 A;  3AG3 B;  1KN5 A;  1KBU A;  4F93 B;  2HHT A;  1KP3 A;  4DR4 B;  1O9G A;  3NRW A;  2PFQ A;  1XSP A;  4YD2 A;  2OCE A;  2HCF A;  1U49 A;  1OCO B;  1RPO A;  1V55 C;  5ALO A;  1MG1 A;  4KLJ A;  3RH6 A;  3TAD A;  2YXH A;  8ICM A;  1S0V A;  3R66 A;  1EBO A;  4DR4 O;  3Q4H B;  1M56 B;  4H44 B;  1NKD A;  4FFB B;  3CC2 V;  2O57 A;  1NZP A;  4GXI A;  3K5M A;  1SKS A;  3OMN B;  4FZL A;  4UCV A;  4RQE A;  3OUS A;  2NNU A;  5LBQ A;  4KMO B;  1VQ7 V;  4I7Z B;  1EZJ A;  5DB7 A;  3JAT A;  2IJH A;  3G6Y A;  3QXG A;  2PF4 E;  3ZDA A;  3CRR A;  1VDV A;  2GOL A;  4AYB C;  3K03 A;  3LSU A;  2F8L A;  4NXZ A;  4IR9 A;  1URJ A;  4PHA A;  2VQF B;  3CCJ V;  4QZA A;  4DK1 A;  1I08 A;  1TAM A;  3SR6 A;  1AJQ A;  5KFB A;  4OJL A;  5J2G A;  1ZET A;  3C5G A;  2R8K A;  3OR6 C;  3S6J A;  1CRX A;  1B6Q A;  4EBD A;  3R65 A;  4O3O A;  4PGX A;  3V6J A;  1WP8 A;  5GW7 A;  5IIL A;  4ED7 A; 
#chains in the Genus database with same CATH homology
 1H2G A;  2UXX A;  3D3I A;  4NLC A;  1M57 C;  1W0J G;  4Q20 A;  1M9N A;  5KUM A;  4UVB A;  5DN6 G;  4PDM A;  1PVP A;  1QR8 A;  4FZM A;  2P7T C;  2G0A A;  2RP5 A;  2LYA A;  3N7P D;  3OEH G;  1S72 V;  3E2E A;  4QE7 A;  1MOF A;  3ABM B;  3W7W A;  5LGN A;  1ENV A;  1WLE A;  4PA6 A;  2Q4T A;  4P0P A;  3AL0 B;  2Y69 B;  2LKY A;  1VQK V;  4CZZ A;  2LHT A;  2DGZ A;  4OJP A;  1SES A;  1HEK A;  1I5X A;  3STZ C;  3LVW A;  3QNE A;  1G4Y B;  1VQN V;  1SZT A;  4H33 A;  1OCO C;  3JCZ A;  1A6S A;  4FIP C;  4JGS A;  2KB1 A;  1QLN A;  5IYD O;  4WFG A;  5CBF A;  3F7Y C;  3IC7 A;  2EIM C;  4G2K A;  2EIM B;  5LHH A;  2BOB C;  2YX8 A;  2HR3 A;  3KFU F;  3AG1 B;  3MHS C;  4MVO A;  1K34 A;  4PA9 A;  3SPI A;  2VJ4 A;  4XDL A;  4YXW G;  5A0L A;  1GKF A;  1UPH A;  1F4N A;  2M0N A;  3SPH A;  4IC9 A;  2VKQ A;  2KNJ A;  2B1G A;  2DYS B;  1GO3 F;  2EJR A;  2FTK A;  4JTD B;  2F43 G;  4J9Z B;  4PDL A;  3HKZ F;  2IJJ A;  1AI7 A;  3M6K A;  3QO8 A;  1Z1B A;  2YEV B;  3H0M B;  2QM8 A;  2WLN A;  5LGT A;  1M1K W;  2HBM A;  1NVP B;  1FXK B;  3CCR V;  2KKP A;  1QBZ A;  4HZ3 A;  2WWW A;  3KG2 A;  3F5E A;  3L3F X;  4OJ5 A;  2HJF C;  2EZP A;  3OR7 C;  4FMT A;  1KQS U;  3CCU V;  2A79 B;  1OCC C;  2XAJ A;  3ZCC A;  1S5H C;  2W0F C;  2PI4 A;  3SYQ A;  3T2M A;  2EIN C;  4JF3 A;  3B77 A;  1YTF B;  2K8C B;  3ZMV A;  1GMG A;  2XAF A;  3ICX A;  3ZN1 A;  3JD4 A;  4GCZ A;  2KJ5 A;  3CCE V;  1NBM G;  1FS0 G;  3WG7 B;  2ZR3 A;  5EK0 A;  2EIL C;  3ABL C;  3ZRX A;  2KOB A;  1GM7 A;  3ZMZ A;  3AQE A;  1L6N A;  2W6J G;  3H01 A;  2G08 A;  4MT8 A;  4WFH A;  1R3I C;  2HBL A;  2KEY A;  3JD1 A;  2EIJ B;  1KD1 W;  2Q68 A;  4WJ3 B;  3FB8 C;  1VQL V;  4ACO A;  1F51 A;  2W03 A;  3CRX A;  1CEZ A;  1E79 G;  1XL4 A;  4MVS A;  4QPK A;  1J95 A;  2DQN B;  2ZG6 A;  3AG4 B;  4QJF B;  2XIC A;  1NR1 A;  2JIZ G;  1WUD A;  2Y48 A;  2Y0S C;  1PL0 A;  2NLJ C;  3LDD A;  4JYB A;  5H6Q A;  2ITC C;  3UKM A;  2KIW A;  2LFR A;  2IH1 C;  3EHB B;  1Y4M A;  4PL1 A;  4MVQ A;  1VQ9 V;  2A9H A;  1H8H G;  3CP1 A;  2HOF A;  5L3D A;  3ZMS A;  1XNS A;  4OJO A;  1DLB A;  1OZ0 A;  3D2N A;  1JPX A;  2WLJ A;  5B1N A;  2IU0 A;  3IFX A;  2DF4 B;  2YB4 A;  3B8N A;  2ZDI C;  4BIU A;  1K92 A;  4TT3 G;  2D6F C;  1KP2 A;  2XVT A;  2Z7J A;  2OCC B;  4BJQ A;  1CP9 A;  2OH2 A;  3ABM C;  3GB7 C;  2YEV A;  4LP8 A;  1BHB A;  2G09 A;  2CN1 A;  3OMA B;  1GM9 A;  5HFL A;  1NVP D;  4WFE A;  2AHY A;  4JTA B;  2KV2 A;  3IN5 A;  2D3O W;  2HG5 C;  3GWO A;  4PEL A;  2Z3Y A;  4Z1M G;  2XI9 A;  2JDI G;  3SAF A;  3M99 B;  3N7R C;  1D8B A;  4QNH B;  2MA1 A;  4EKW A;  2OYY A;  3RF9 A;  2ZXW C;  4MVZ A;  3ZJZ A;  4O3M A;  1F44 A;  3G6E V;  2JK5 C;  4GX0 A;  1BL8 A;  1DRG A;  2JJ1 G;  3ETE A;  2K4I A;  1QLE C;  5CA3 A;  2H3Z A;  5C0Y A;  4MW3 A;  4RQF A;  2JJ2 G;  4U7C A;  4I5S A;  5CBH A;  2JHD A;  4PA4 A;  2HBJ A;  2CPR A;  3AG2 C;  3FB5 C;  2ZIV B;  3ABK B;  5HFM A;  5L3G A;  2KJ8 A;  3SAG A;  3PST A;  2IW5 A;  1BMF G;  2X6C A;  1JX9 A;  5B1O A;  4P30 A;  4BIZ A;  2R18 A;  2HOQ A;  2XAH A;  1K4C C;  3D36 A;  1Q3U A;  1COW G;  3WG7 C;  4XDJ A;  3E8B A;  5B1A B;  1JJ2 U;  5EBL C;  3P30 A;  2WLK A;  2EIN B;  2IU3 A;  3OGC C;  2W7O A;  3N7S C;  1K7D A;  3ML0 A;  2HOI A;  3K04 A;  3AG2 B;  4MVU A;  5LGU A;  1IIP A;  1V55 B;  1P7D A;  2XAG A;  2XOK G;  3MD0 A;  3OPX A;  3F2C A;  5EC2 C;  1ORQ C;  5BZB A;  1VQO V;  1KC8 W;  4ASU G;  1FXK C;  4MTF A;  2UXN A;  4HYO A;  4CBC A;  1K97 A;  2ZXH A;  2MRL A;  2ZD9 A;  2ZXW B;  1NQT A;  1HIW A;  2BOC C;  4BUG A;  2EBO A;  4H37 A;  4X89 A;  2H94 A;  4U6P A;  3ETG A;  3OW2 U;  2LFS A;  4UV9 A;  1YI2 V;  3VCB A;  3P32 A;  4PA3 A;  4PDV A;  1AI4 A;  2A0L A;  2Y69 C;  3JYC A;  3D2S A;  5B3S C;  4X88 A;  2OXO A;  4AYB F;  4ZBM A;  3K08 A;  3NUQ A;  2DW4 A;  1PNK A;  4OXS A;  3DEE A;  3OFN G;  1FFT B;  3ALR A;  2XND G;  3X2Q C;  2VIX A;  3B8M A;  2PI5 A;  3CYO A;  2WAM A;  3CD6 V;  2JEX A;  1OCR C;  2OTJ V;  4FZN A;  3GZF A;  2KJ9 A;  1PD3 A;  2QKS A;  4JAU A;  2QEX V;  3ABU A;  1YJ9 V;  4CRX A;  3EFF K;  3G4S V;  2K8B B;  2P90 A;  4WFF A;  1E1Q G;  1ZWI C;  4DO2 A;  1MAB G;  2DYR B;  1GTO A;  1R73 A;  5IDJ A;  1JOY A;  1M57 B;  2ZIV A;  3OMI B;  4X8A A;  1FXH A;  3RBZ A;  3ZRS A;  1Q3V A;  3VBB A;  2OTL V;  5B3S B;  2ZIU A;  3FB7 C;  3JD0 A;  2WB1 F;  3K06 A;  2ZIW A;  4C0Z A;  3WFV A;  4GFJ A;  1DF5 A;  1T94 A;  4QNL A;  1DF4 A;  4DXW A;  4RO2 A;  1IXM A;  3F2B A;  1YTF D;  1FXK A;  4P9P A;  2RHF A;  3ZRW B;  3TCU A;  3LSQ A;  2WPD G;  3OEE G;  1Q7Y W;  4OJ6 A;  1HWY A;  3SMV A;  1PNL A;  4R6Z A;  5KA5 A;  1YSC A;  5B1B B;  1FXV A;  3ASO B;  3ABT A;  3F7V C;  1OCC B;  3K0D A;  4UVA A;  5CMU A;  3SYO A;  1RM1 B;  1YJW V;  4JTC B;  2VJ5 A;  3SPG A;  3T4D A;  5H9C A;  3JD3 A;  2F77 X;  5CRX A;  5KL8 B;  3SJQ C;  1K8A W;  1THZ A;  2H3V A;  3IG8 A;  3GU3 A;  1ROP A;  3IG5 A;  1S77 D;  2W04 A;  1R6N A;  3E8F A;  3LVV A;  4BX9 C;  1PVR A;  1R6K A;  4MW8 A;  3AG3 C;  1KKD A;  1K33 A;  4LC1 A;  2DYS C;  5EBW C;  1P7B A;  1NH2 D;  1SRY A;  4BW5 A;  3CC4 V;  2JH1 A;  3CXC U;  3E8H A;  3C28 A;  1SZH A;  4QE9 A;  1Q81 W;  2KKV A;  4I9W A;  1NJI W;  2IJI A;  5KL1 B;  2X6A A;  4WFA V;  5E1A C;  2HVJ C;  1JVM A;  3OE7 G;  4FPP A;  1PVQ A;  4UXN A;  3ZRV A;  5J9P C;  1M90 W;  4CGZ A;  3QO7 A;  3T79 A;  4NV0 A;  4P0Q B;  2P67 A;  2YSU B;  3CCS V;  1K9M W;  1XL6 A;  4KP4 A;  1NH2 B;  2DWE C;  4L87 A;  5C93 A;  2WAQ F;  2W6I G;  2E1F A;  2V7Q G;  2HFE C;  3DGE A;  4U7O A;  4CDG A;  2B5U A;  5KA6 A;  1NZB A;  2GHY A;  4NLB A;  4ICA A;  2P6J A;  2ZDI A;  4P0P B;  4PA7 A;  3VOU A;  2G5H B;  4E2L A;  1VQ8 V;  1I5Y A;  4OO1 J;  1XO0 A;  2G5I B;  2LYB A;  4NWI A;  4JAS A;  3TET A;  1BHA A;  1A0P A;  3IGA C;  3K79 A;  1OCR B;  4UUJ C;  2X6B A;  2ZIX A;  2K4H A;  1OCZ B;  3PSI A;  3LNM B;  3E35 A;  4WFB V;  3O0F A;  3CME V;  1R3L C;  2GH1 A;  3H0L B;  1K5Q A;  3BY6 A;  2EIK C;  2KD1 A;  2JGA A;  3F53 A;  4HAM A;  4KFM A;  4MTG A;  2CK3 G;  1VQ5 V;  3E8G A;  3A0R A;  5IYB O;  3ASN B;  3TK1 A;  1W0K G;  5CBG A;  2ZQM A;  1TUE B;  2JH7 A;  2HMX A;  1NR7 A;  2ZIW B;  2WLH A;  2LBO A;  1GM8 A;  2HBK A;  2X0L A;  2Y0S F;  3RFA A;  1YIJ V;  4MTO A;  3RW0 A;  3D2Q A;  5FL7 G;  4MTX A;  3BEH A;  2WLI A;  3SPJ A;  3W7X A;  3ZRW A;  2RRD A;  3M7D A;  1M56 C;  2Q69 A;  1H8E G;  2ITD C;  2LP7 A;  2M7W A;  3PSP A;  4QIW F;  2IH3 C;  3ETD A;  4U7N A;  3ZMU A;  4PL2 A;  1QR9 A;  2H3F A;  4J9Y B;  3SYC A;  3F2D A;  2B1I A;  4P9O A;  4UVC A;  1JQ0 A;  2KVC A;  1R3J C;  2HKO A;  2GSM B;  5HR6 A;  3K0G A;  3CCQ V;  4RUF A;  1SER A;  4JAV A;  5B1A C;  2JEU A;  1R3K C;  4R8C A;  3JD2 A;  3W7T A;  2V1D A;  4XDK A;  4XBF A;  2MK3 A;  3H0R B;  3E0F A;  4FK5 C;  3F5W C;  3OUF A;  3PZP A;  3RVZ A;  2QM7 A;  1EFR G;  3UM7 A;  3E89 A;  3AEI A;  3CCL V;  1N8R W;  3E83 A;  3ABK C;  3FYE B;  3LDC A;  4G28 B;  4WF9 V;  4LCU C;  2ZIX B;  2DYR C;  2JMG A;  3ZMT A;  1UJW B;  1QLE B;  3CPW U;  1S3J A;  2R9I A;  3ZIA G;  4G27 B;  3AQF A;  2X7R B;  4F4L A;  1K4D C;  4KX3 A;  5LHI A;  2XAS A;  2K8A A;  2ZIU B;  1W2B U;  5L3E A;  1KEC A;  1PKX A;  1YT3 A;  3SAH A;  2IJK A;  1QVF U;  2KHV A;  2ZR2 A;  3VC8 A;  4ZKI A;  1S76 D;  3CYM A;  2QE7 G;  1ECW A;  4KX5 A;  2BDU A;  1G8M A;  2K4E A;  2K1E A;  4A8E A;  5L3F A;  1L1F A;  2PMZ C;  5HR7 A;  2QTO A;  1ZQ1 C;  1F23 A;  2OCC C;  1YHQ V;  3AG4 C;  4FE3 A;  3E86 A;  3CMA V;  3G71 V;  1RM1 C;  2Q6A A;  1VQ4 V;  3ASN C;  2H3Q A;  4N23 A;  3SPC A;  3LYS A;  1SET A;  1RPR A;  2WLM A;  2H8P C;  3QO5 A;  5DM6 V;  2WAQ C;  5H6R A;  2ATK C;  4FJC C;  1JCH A;  3KZX A;  4R7C A;  1Q82 W;  2G07 A;  1Y66 A;  2EZO A;  3K9A A;  1OHH G;  2EIL B;  3ABL B;  3IP4 B;  2QA4 V;  3MHH C;  4MSW C;  3ONN A;  2HVK C;  4JYC A;  1YJN V;  5KUK A;  2H3I A;  4QPJ A;  3DTU B;  2G06 A;  2ZXI A;  1LNQ A;  2EIJ C;  4MVM A;  1YIT V;  1AJP A;  2EIK B;  2XAQ A;  1CPY A;  3MGV A;  3OAA G;  2OT5 A;  1Q86 W;  1OCZ C;  3CCM V;  3I55 V;  1E1R G;  2KHQ A;  2KIC A;  3K1Z A;  3LSS A;  5L3B A;  1ED1 A;  3SQI A;  1OUQ A;  3LDE A;  3STL C;  3RVY A;  1QVG U;  4P0Q A;  4GX2 A;  3K3W A;  4GT1 A;  1AI5 A;  4GX5 A;  4MS2 A;  2DWD C;  3X2Q B;  2Q67 A;  1ARO P;  4MVR A;  3HPL C;  2E1E A;  3FB6 C;  2WLL B;  1Z19 A;  2N1R A;  4QIW C;  3AG1 C;  3M6Z A;  3FYI B;  2WSS G;  1H38 A;  1MA7 A;  1AI6 A;  2AHZ A;  1V54 B;  1VQM V;  3SYP A;  2A3V A;  1MSW D;  3LUT B;  2F2A B;  3C29 A;  1AR1 B;  1QCE A;  1VQP V;  1V54 C;  3AG3 B;  1KBU A;  2WB1 C;  2K89 A;  1KP3 A;  2F76 X;  1P4R A;  2WLL A;  2OM6 A;  1WPX A;  3CCV V;  3NRW A;  4RUE A;  4BAY A;  3OM3 B;  5EC1 C;  3CP8 A;  2HLD G;  3CC7 V;  1OCO B;  1RPO A;  4LBE C;  2YB1 A;  1V55 C;  1MG1 A;  4N21 A;  2W7P A;  2CRX A;  1K5S A;  1S0V A;  3NXS A;  1EBO A;  5EBM C;  3W7S A;  1K73 W;  1F4M A;  1M56 B;  3SYA A;  1NKD A;  3HB3 B;  1DTO A;  3CC2 V;  3HKZ C;  4RQE A;  3OMN B;  4FZL A;  2XID A;  3OUS A;  4R50 A;  1K3E A;  2NNU A;  5LBQ A;  2Z5U A;  5L3C A;  4P2Z A;  4KMO B;  1VQ7 V;  2WLI B;  1EZJ A;  5LHG A;  4KUM A;  4TSF G;  2C2A A;  4RAI A;  3ZN0 A;  2IJH A;  5T14 A;  1GK9 A;  4PDR A;  3ASO C;  3F5A A;  5B1B C;  3T1C A;  1VQ6 V;  2DQ3 A;  1AJN A;  2GOL A;  3K03 A;  4AYB C;  3PJS K;  2DQ0 A;  5IY5 B;  5IY5 C;  1PNM A;  2F8L A;  5IYC O;  1URJ A;  2E5S A;  4GX1 A;  3CCJ V;  3FKS G;  3W7U A;  2NV3 A;  2R9R B;  4TWK A;  1TAM A;  4WCE V;  1AJQ A;  3I56 V;  4OJL A;  4UV8 A;  2PMZ F;  5CN0 A;  3PSF A;  3OR6 C;  1B6Q A;  1CRX A;  4JPR A;  3R65 A;  5GW7 A;  3T4Z A;  4JMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...