4QIWF

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
total genus 37
structure length 122
sequence length 122
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwF02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qiwF01
1WUDA 3SAHA 3SAGA 1D8BA 2RHFA 2HBJA 3CYMA 2KV2A 4NLBA 5C0YA 1YT3A 1GO3F 4O3MA 4OO1J 4NLCA 4CGZA 3SAFA 2MA1A 2E1EA 4CDGA 2HBMA 2RRDA 4QIWF 2HBKA 2HBLA 2CPRA 4QJFB 2E1FA 2DGZA
chains in the Genus database with same CATH superfamily
2GOLA 1HNWB 4KN4A 2QWPB 2W55A 3IM1A 5LHIA 2I5HA 3RB0A 2LW7A 3E89A 3E86A 2ISOA 1PP9H 4NLNA 1FFUA 4QZBA 2B6GA 4FJCC 5KG6A 3G67A 1B3QA 1THZA 2H3QA 2G09A 1YSCA 1F51A 4DV1B 4DR1B 2PFNA 1DK1A 2A0LA 1Y6XA 2XICA 2VJ5A 3LVWA 4GXIA 3SJQC 5JJNB 1ZQRA 2GDSA 1DXSA 1SQPH 3T4ZA 4DR3B 4LFAO 4D6TH 1RSOB 2Y69B 2PMZC 4TUSA 1KFSA 2PFPA 3JSLA 3N7SC 2E8OA 1FKAO 2P6JA 1KQSU 1RSOA 3HKDA 1N32O 3NVVA 2DYSB 1MSWD 4KXRA 1SL0A 2F8KA 2JH1A 2LGQA 3BABA 2KG7B 2WSSG 1AVMA 1Q6IA 1P7GA 4ECXA 4YHHB 2KVCA 1ZQVA 1TK8A 3T5KA 1JROA 2OYYA 4QZGA 1RP3B 1ZD4A 4DL3A 1PK1B 3TACB 5KFPA 4M9JA 3CP8A 5L1LA 3FYEB 3ZRWB 3GB7C 1KYOF 3CC2V 3THVA 3H0RB 1PK1A 2UXNA 3IG8A 1Z1BA 3ZRWA 4F91B 2KVSA 3F7YC 4DQRA 4KLJA 2E5LO 4J9LA 2F43G 3F5WC 3K5NA 2OYQA 2C2DA 2ZM6O 3WB0A 3V7JA 5KFGA 4XA5A 4PA4A 1PKXA 3KD3A 5IWAO 3LDEA 4X66B 3THOA 1LV5A 4YJ3A 3K5MA 1HR0B 1Z3EB 1S5JA 4F5QA 3FB7C 7ICHA 2WF9A 3STZC 4DV5O 1BL8A 1QU7A 3OGCC 4I2AA 3TANA 2JVDA 1N2XA 4DS4A 2BQRA 1VMGA 4QZFA 2HDOA 1GK9A 4UXNA 2E5SA 2H3VA 1OZ0A 4ZKIA 2QKQA 1HJPA 2VQEB 2KJ8A 4F3OA 2UUBB 4QZHA 2Y69C 4X64B 1KP2A 2JGUA 3Q8PB 2NV3A 3SQIA 1BGXT 4QW9A 1B4FA 3ETEA 4PDLA 5IDJA 1S0VA 2DYSC 1MQ2A 2HKOA 7ICFA 4CNQA 1UFIA 1ZQSA 2F2AB 2ATKC 1XNQB 2JEGA 1ZAUA 4DUZB 3L4PA 5TISZ 1KBUA 1GN3A 9ICBA 4LP8A 1ZXIA 4PHZA 4UCUA 2FMQA 1SF9A 1KP3A 1FJGO 3UT5B 4P4OA 4YQWA 1XMQB 2UXBB 5IYCO 3ZHRA 2WTFA 4FVMA 3QF7A 1F5SA 4F72A 2PI4A 1Y67A 3UT5A 2W43A 4EB6A 2F66C 1EM1A 1HNXO 5JVDA 4WFHA 3B0YA 4JI8O 3UM7A 1SQGA 4D7TA 1SL1A 4Z6FA 5EC2C 2BTOA 5LMNB 5DEDA 4H37A 1EN4A 1O08A 1F4NA 3K1ZA 3IC9A 5LP6A 2ZE7A 2FPMA 4RQ5A 3K0GA 3OUSA 2Y0PA 2KV2A 4UVCA 3CCJV 4DR5O 1KD1W 1NK6A 4RQ8A 2YMQA 3KZXA 4L8JA 4EFEA 2A1AA 2QARB 3GILA 1V97A 1SC5B 4JPRA 3UXPA 4DF8A 3T5HA 3CJHA 1HUOA 1L5UA 4F5OA 4DOCA 3FAVA 1UA1A 5CN0A 4DS5A 2ZXWB 2QLTA 4MW3A 3EWAA 4TQDA 2WLLB 1FO4A 5JCOA 3NVZA 4DYLA 5ALPA 4IL6U 2XC9A 4JV0A 1LB2B 1WLEA 3MD0A 1MOFA 4R7CA 3CD6V 2YIDA 2E74B 5J2DA 2ASJA 8ICKA 5CEHA 4LF9O 1Q43A 5AKKA 1NK0A 2Y48A 2ZNJA 1IBMB 5DDMA 3SJBC 5H9CA 3PSPA 2LQTA 2WLIB 5B3SB 3K08A 4PH5A 2E8NA 4NM1A 2W7OA 2HW3A 1DLBA 3LVVA 2HBKA 2QWRB 2YEVA 2Y4UA 1IBLO 5J2HA 1N0NA 3QVNA 5DG9A 3H1IH 4J80A 3OTOB 2G5IB 2Q9LA 2WAMA 3WU2U 3RYHA 3PW0A 4FK5C 3K58A 1VQ4V 1ZQJA 1SKWA 3MFHA 4PJ0Z 4DL4A 3CRQA 3SAHA 1PVRA 4DV3O 1KN5A 4F5NA 2LHTA 3BQ2A 2BQUA 4IQWA 8ICXA 1NK9A 2VWKA 4PELA 5AI5A 1JQ0A 5KFJA 4I2DA 1ZQIA 4USAA 5IT9N 1OV9A 5JCOC 1TE2A 4KX3A 1RPLA 2KSDA 2ZXWC 4CS2A 3C23A 1ZETA 1QR8A 1MQ3A 4Y2SA 3RH5A 2Z0AA 4X9QA 1J5EO 3AU6A 4LFBB 1URFA 1US6A 3K57A 4FLXA 5AM2A 1FPOA 3TJTA 4KMUA 4PL1A 1SXEA 5BMVA 5T14A 3SV4A 1E1QG 4NLBA 3Q8LA 4LF4B 4X20A 2ZCEA 1F44A 3WKAA 3NRZA 1Z5WA 3JYCA 5B3SC 2ZTEA 4LF7O 3SR2C 4B3RB 4KHPB 2XIDA 1ZQNA 2GSMB 5L3BA 5KFOA 1RQLA 3OSPA 1ZTEA 1KKCA 4CC6A 2H3FA 2ZUBA 4MF2A 2ESEA 3SPCA 1TV9A 1R6NA 4IHJB 5HHIA 5J0YA 5ALKA 4YCXA 2C2AA 2WF6A 4K35A 3RB3A 3EHBB 1V9PA 5DG7A 8ICVA 1L8OA 1EZVH 2KSOB 3M1YA 2IW5A 1L1FA 3AQEA 1IX9A 2KOBA 4UQGA 2AJQA 3BQTA 2OCHA 4JYBA 3M9OB 2YB4A 8ICBA 2MA1A 2BPGA 3L75H 2JIZG 1YDXA 4ZOLA 3PZPA 1QQ5A 4FFBA 4EELA 4BDPA 2NYVA 3TFRA 1JALA 1NI3A 3E8HA 5KHGA 5C5JA 3KFUF 1K9MW 2ZIUB 4I2JA 5KT6A 3KG2A 4J03A 3PSIA 3WKEA 4BUGA 4JGSA 4DO2A 1WCNA 4RQFA 3SPJA 1O9HA 4QWEA 5BXZA 2F4VO 2IH3C 1SRYA 5LXTA 2XNDG 1SESA 4HAMA 5AK5A 3D36A 4EYIB 2OHFA 1MC8A 1SV0C 2W04A 3AG4B 5A0LA 1FYJA 4UFZA 4EFBA 1V54B 2WPDG 1H2GA 2FKXA 3KKYA 2HBLA 2O6KA 5IIKA 3FX7A 3H40A 4GKKB 3OTFA 4TQRA 1Q5OA 1RYRA 5H6QA 3KHGA 3KBBA 4UB4A 3G6BA 4Y2XA 3VQYA 1YTFB 2ALZA 2ZIWB 3MR3A 4TQSA 2EJ7A 4FS1A 3LSSA 5KHIA 4X5VA 4PDMA 2EJRA 2P6RA 4QZ8A 1D9FA 4C4SA 2UVRA 5DQGA 3G80A 4DUYO 2BQ3A 8ICYA 5IIOA 4CH3A 4F50A 3N2KA 1VQ5V 4MT8A 4QIWF 4JB3A 2HOIA 3RFAA 2ZKOA 2P4KA 2E8PA 3NASA 2BCVA 3FKSG 5AKJA 5DGAA 2UUAO 1PL0A 4Q8EA 5EIBC 2HHHB 2HG5C 2EINB 3DTUB 5ALRA 1ZQHA 3LWMA 2DWQA 2FMSA 2QWOB 4MSWC 5IYZA 3PJSK 1BS3A 2F76X 4J41A 4R8UA 1NU1H 2XVTA 3OD4A 3PW7A 4TV9B 5AKGA 1MN8A 5CB4B 3JAWB 2PYLA 3AG4C 2AH5A 3ASNB 4Z1MG 2PXIA 2W6JG 4NXNB 4DSLA 4TV9A 3JAKB 3G6EV 1V54C 4DSIA 5CB4A 3JAWA 2ZIVA 1S76D 5CA3A 3SD7A 3RJEA 4B9NA 3JAKA 1R6TA 1HW7A 2BKEA 1GH6A 2R9AA 2ODGA 4TV8B 1NI8A 2FDRA 3WFVA 3GIKA 5KA6A 4JI7B 1R3LC 2AGAA 3HB3B 5IYDO 1S3JA 1K8AW 5AM4A 1MABG 4IL6Z 5KFQA 1AROP 4DLGA 4E2LA 3PN1A 1WP8A 4DK1A 3MGHA 4DXWA 4PHDA 5L3CA 1ZUQA 4MVUA 2LBOA 4EZ6A 3RVYA 5IIMA 1N34O 1M4UA 5AG2A 3ZDEA 3FB6C 5KFEA 1YF2A 4ECRA 1FAFA 2GV9A 1Q3EA 3U0ZA 2G38A 3CCEV 3VCBA 5KFNA 4LF6B 3F2DA 2NN4A 4UUJC 5AKIA 4U7NA 3RBDA 3PX4A 3MR6A 4WBNA 4ABMA 4X62O 2LPEA 4PI0A 2EINC 5F3XB 4GKJO 5KL8B 4B3MB 2Q67A 4FBUA 1XSNA 1PV0A 2KTQA 3ZD9A 5J0PA 3ZMSA 4I50A 1U49A 4J9OA 3U11A 4CS4A 1L0LH 2IJIA 4JV5B 1K92A 4TSFG 1XREA 2GO7A 1DOQA 2RRDA 4MEYA 5AKZA 2KICA 1K33A 3RW0A 3I76A 3WKBA 4DOBA 2LP7A 4ACOA 2ZJAA 3JARA 4OX9O 3S3XA 2D3OW 3AUOA 4FLVA 3FD9A 4I28A 2BSKB 5EZYA 4PL2A 4MS2A 5AI6A 4NLKA 1ZQUA 4P2HA 2RNBA 3ABKB 3HKCA 4O0IA 5DG8A 4LF8B 4F4KA 5JQGB 4M9LA 4JI4O 5BY1A 5EE9A 4BWAA 2DUYA 2DN9A 3W7SA 4I0XB 4RWUA 5JQGA 2M9NA 1DGSA 4FE3A 3BDPA 5CBFA 4JI1O 3AG2B 3C21A 3AK3A 1XWLA 2QWNB 4ED6A 2P6UA 4RO2A 3DC5A 4KP4A 3V6JA 3O9OA 2W03A 5HFLA 2P7TC 1ZD5A 1AR5A 3T1HO 4CF4A 5J0TA 3K5OA 3C90A 1A0PA 3EPGA 3FB5C 4BJQA 3SYAA 3KHRA 3BPZA 4NXZA 4DK0A 1A76A 2YY6A 4PA3A 4JI5B 4YD2A 1ENVA 4FMTA 5EOZA 4Y2PA 2Z3YA 3ZI4A 4GX0A 1WPBA 5EBMC 5LMUB 4YJ2A 3CC4V 5G5GA 3F2BA 1E1RG 4FZ1A 3Q8SB 4BR6A 2NO5A 5J2BA 4ELVA 4FFDA 1GM7A 2VQFB 5ALYA 4B6JA 2FLLA 2OIEA 4JI6B 2ZINA 2VIXA 5KUKA 1CPYA 2AXTZ 3ABUA 1NH2B 4K3AA 4GXJA 4F2RA 3CS5A 3IJ4A 2LO1A 3ABKC 4B9TA 2GTSA 5F9LA 1ZQEA 2ILMA 8ICOA 1Y88A 4N21A 3CYMA 4YFKA 3CB2A 3MDSA 4EEKA 2IJHA 3J7AU 3WK6A 5KFDA 4J9QA 3TI0A 2GHYA 3W7UA 1KB9F 4NTWA 4YY3O 1BMFG 4MTXA 5HMLA 3AG2C 1VQOV 1VDVA 5KFUA 4DF4A 3JASB 2JV3A 2KKWA 4HYKA 4DR2B 1WNSA 1S0MA 3IFXA 4K0KB 1FFXB 4LJXA 1CI4A 4IR1A 1Z5VA 3G71V 1A77A 2FMLA 4X65O 4B9MA 2DF4B 3J81j 1MZFA 1ZSPA 3E35A 2LFRA 1Z00B 4F71A 1WB7A 2F1JA 1WA8B 1X2IA 5TISU 4YXWG 4IRCA 2RHFA 3H0LB 3Q8QB 5B1AB 1HWYA 2YTUA 1QCEA 2NR5A 1RYUA 2ZIXA 1Z00A 1WA8A 2WLHA 2VA8A 2IHNA 4ZHQA 3AK2A 3H01A 1JN3A 3LNNA 1QSYA 4DV2O 4B3SB 1ZRMA 4TUYB 3CCVV 3APOA 2KZZA 1JX4A 4IR9A 4PA6A 4J9YB 1T8EA 4TUYA 4EEYA 3ETQA 4PGYA 1NS1A 2W9CB 4UARA 2YIBA 1S0NA 1N0JA 3OJSA 3KZIZ 2UUCO 4B3TO 4DV4B 2IOFK 4N23A 3HJEA 2XASA 4P30A 3ASOB 3I5DA 3HPLC 4LNUA 3H0MB 3WB1A 4O3RA 2QM7A 2EIKB 3SR6A 4QWCA 3M9NB 4ED1A 9ICIA 3MR5A 1D5NA 4MVQA 4F4ZA 4MW8A 5BOLA 1NR7A 5CA1A 2V9WA 5EIBD 1SIJA 3LDDA 1I94B 1BHBA 2LGWA 3JPOA 3BCCH 4AQYB 2ATLA 4RUEA 2LYBA 9ICVA 4JYAB 5KFSA 4YR0A 1XQ8A 4IQUA 1VQMV 1ZQCA 1Y4MA 3UCSC 4MVZA 2BCUA 4UV8A 5FPRA 3ZMZA 1RYSA 5KA5A 5E79Z 5AIAA 3CE2A 5CWRA 1N5WA 3RJFA 4K4HA 1TUBA 5B1AC 2N04A 1YCIA 2P5OA 5KUMA 4Q20A 3JPQA 1MA7A 2CTQA 1YTFD 5IJ9B 1WWUA 4IS7A 4DR7B 5F9NA 3V6HA 4NKGB 2EAMA 3ONNA 2EZXA 2RQ5A 5IJ9A 1T5EA 2KK0A 3I56V 5K4LA 5CR0A 3SI8A 1MZEA 5DM6V 5GTIZ 1L7PA 3ASOC 2AGQA 9ICEA 3NVYA 2JR5A 4RQ4A 1MSDA 4I29A 3C2MA 4ELTA 1RPRA 2EIKC 3UM9A 2KIVA 1ZD3A 4UATA 1LUVA 3QU9A 3ABMB 1VQPV 2ZQMA 1LNQA 3RB6A 1ROPA 1YZ6A 5D5PA 5B1BB 2F95B 8ICJA 3QNMA 1JR9A 3OMNB 4O3MA 3WKDA 3RYIA 1G8MA 1L0NH 1P7BA 4BIZA 4WFAV 3NVWA 1KU9A 3HKBA 3EUB2 4ICAA 7ICKA 4DRXB 3GV7B 3P32A 3AM9A 4EX7A 5ALHA 5ALEA 4P0PB 4RAIA 5BR8O 1T7PA 4NM2A 3TAPA 1BPEA 4PDVA 2W3RA 3DEEA 4P0PA 4B7KA 2IM9A 4DFMA 3Q8KA 2XAFA 3NR7A 4GCZA 3SZ2A 1YHQV 1MMMA 2DGZA 2JH7A 8ICAA 4I2CA 1NBMG 3B2EE 2W9BA 1XC9A 1SXDA 3N28A 4QZ9A 3MHHC 2H3IA 2AHYA 5EK0A 5KFXA 4W4LA 1U47A 3L3FX 3FFQA 4DV1O 4DR1O 3E22A 5IIIA 4TQFA 1IXRA 4UV9A 3MDCA 2GH1A 1JRPA 7ICIA 4UBCA 2CTWA 4R8CA 2ZG6A 3C1ZA 5G5HA 4JV2A 4JI5O 3BQ0A 4LBEC 4I5SA 4NLZA 5AKLA 7ICPA 4IC9A 8ICEA 9ICAA 4YIPA 3HKDB 2JEFA 4DR4B 3BJYA 4YHHO 3ABMC 1XMOO 1S5HC 3M99B 4FLZA 2E3CA 5J0UA 2UXDO 3OHAA 1BPDA 2HBJA 5B1BC 3AEIA 3GWKC 2QB1A 3HP6A 3CMAV 1B04A 3CCQV 2VANA 5JRTA 3HPOA 4O3PA 9ICTA 1KC8W 4O4JA 2OTJV 2KMDA 1QSLA 2OWOA 4ECWA 2BCRA 2XI9A 4JK1A 2XGQA 1BT8A 1SQFA 5C93A 5CP2A 4JUZA 1ECWA 1UT8A 4C7YA 4J10A 4J7KA 5J2KA 4EZ9A 1H2MA 4Y2RA 2K1EA 3RT3C 4X66O 1JA8A 5LYJA 4NR1A 1TAQA 2BOCC 5J0RA 2ZXIA 1COWG 1KTQA 4MFFA 1X6JA 2W6IG 2ZT9B 4LFAB 4YJ3B 5KNIA 3T1YB 4FIPC 3OSNA 4WFBV 1UHUA 2PTMA 2E3TA 4WFGA 1ZD2P 1YT3A 4JI0O 4JTCB 4ZBMA 2JRZA 5J2UB 1N32B 5J2FA 4AP9A 3F5AA 5J2UA 2BHNA 1XO0A 1Q3VA 2IMWP 4C7ZA 1DK3A 4P0QA 2A79B 3OR6C 3ISDA 3DGEA 3SPGA 4MTFA 1NJIW 4NXMO 4UB5A 4DUZO 4RNNA 3JPSA 3QZ8A 3UQ0A 4UB3A 1K5QA 2B9ZA 4OXSA 4OJ5A 4DV6O 3W7WA 1T3QA 3H4BA 2EILB 2B21A 2E5LB 2ARHA 2KJ5A 5EBLC 8ICRA 2X0LA 4NVPA 3ICXA 2ZM6B 8ICZA 4F4WA 4M9NA 2I1QA 3CRRA 2LFSA 1U48A 4M2YA 4EB6B 5IWAB 1S97A 2V7QG 2IA6A 5JVDB 1BHAA 3UO3A 3OHBA 3BVOA 4HNAB 1N48A 4DV5B 2KEYA 4QJFB 2XY5A 4O4IA 1JI7A 3T4DA 3B40A 2WF5A 4HNAA 1M56B 1OCZB 5LP6B 2ZE6A 3OE7G 2RQ6A 1RZTA 1SA0A 3ZMUA 1N36O 2JK5C 3ISCA 9ICRA 4B9VA 1I08A 1NH2D 3IP4B 1Q81W 1XS9D 5KFLA 2A7WA 4Y2QA 4F6RB 4JYYA 1COOA 2XAJA 4RUFA 5KFIA 4NTXA 3ISBA 4MVRA 3NRWA 1VEWA 3CJHB 4F6RA 1L3VA 5D5QA 3M6ZA 3FAVB 3M7DA 1XO1A 4M47A 2HOQA 4CF5A 2H5XA 2W8LA 4O3NA 1KEJA 2A19A 2ZR3A 3D3IA 4DR6O 3SYCA 1FJGB 4US9A 2HHUA 3TFSA 7ICLA 3CHXA 2BCSA 2F93B 1NOMA 3TCUA 2J6TA 3CRAA 5AICA 8ICPA 1COKA 1HNXB 4CBCA 1SWVA 3BS5B 1AB3A 3R9KA 4JI8B 4B9LA 4J9SA 4UASA 2EILC 5AI4A 2HJDA 4PA7A 3BZKA 1U4BA 3BS5A 1BCCH 4Z6DA 1WJZA 3M7MX 1K3EA 4C0ZA 3BQ7A 3RRGA 4G3IA 1Q8IA 2P66A 1JJ2U 2YEVB 4J7ZA 5DECA 1GN4A 1ZQXA 5ALDA 3EPIA 4LWSB 4ED3A 3RYHB 3PMLA 2RJZA 4ECTA 1M56C 1OCZC 4LWSA 2QWQB 5LP6C 2XHBA 3WG7B 1SQQH 1I7FA 2IJJA 4KLTA 1D5AA 1JMKC 3AK1A 4K4GA 1NK4A 2QB0B 4B08A 3SJAC 2ZR2A 2HHTA 4ED0A 2QB0A 3PY8A 4LF9B 3L74H 2DQ0A 3RAXA 5FL7G 1PNMA 4QE7A 5IIJA 3UKMA 1A6SA 4U3JA 1PZNA 4LFBO 4Z2WA 5CB1A 3CPWU 5LGNA 2CK3G 3QO7A 4KL1A 3RN4A 4QGPA 2EULA 2W11A 3RF9A 5JJJB 4DL2A 4IGGA 4EX6A 5LL6Y 1H2KA 1X9MA 3UMBA 3ZHUA 3UXOA 4Q6GA 1IBLB 2HP8A 5BMVB 4WFEA 3K79A 4ZI7A 1SZHA 2YQEA 5ALSA 2R8HA 3J81N 4PHEA 4X20B 5L1MA 1KKXA 2G0AA 2Q4TA 4UCSA 4KLEA 4GIBA 2UVVA 1GO3F 5KFBA 3FAHA 3QTCA 2ZUCA 2QTOA 4DV3B 2CH7A 1N4CA 2DQ3A 1W0JG 5CRXA 5J2CA 2F1MA 1YIJV 2UU9B 4WCEV 2ETNA 4MTGA 2PFQA 4UAVA 3C2KA 3L70H 7ICOA 3C5GA 4I2EA 2KB1A 3WG7C 4JI2O 7ICSA 5D46A 4RQ0A 2XUMA 3QO5A 4TUQA 5C8YB 2AQ0A 5L3FA 3NTUA 4DV0O 5JH7A 4OPAA 9ICMA 1ZQDA 9ICSA 1K4DC 5C8YA 3CSXA 5DLFA 1ZQAA 2W0FC 4ELUA 3B9JA 4IQTA 4LZDA 2ITCC 1QLNA 4NLCA 1X9XA 2J6UA 4JAUA 4JI3O 1F7YA 3IHQB 2FL4A 1K4CC 2P22C 2YICA 1L6NA 4QZIA 4ZOLB 4FFBB 1ZJNA 3HW8A 1XNSA 9ICOA 1EZJA 2AXTU 2IOFA 3RR8A 3BRCA 5DBCA 4LF7B 3FYIB 1ZX3A 2FI1A 4OD0A 1AI5A 4IIJA 1PK3A 3W7TA 3K3WA 5KG3A 3FB8C 1N61A 1RG6A 4RT3A 1JPXA 2FE9A 3LDAA 5JU5A 1U45A 1MG1A 2B1IA 2N74A 8ICHA 3CRXA 1NJYA 1FXVA 3E8FA 5LXTB 4U7OA 4WF9V 3GFKB 4RNMA 2DPJA 2KFZA 2DBYA 4O4HB 3PMNA 2VRZA 4UB1A 1AJQA 4NLGA 1YITV 1SGGA 4J9RA 4KLLA 4E4EA 4O4HA 5J2IA 1W0KG 1J97A 4BW5A 4O2BA 4I2GA 4I4TB 4KLUA 3RH4A 5KFWA 4F5PA 4DCCA 4XBFA 4GYCB 5ALOA 1FXKB 2QR4A 9ICUA 1P4RA 4I4TA 4OPHA 4Z1VA 3BAAA 1YJNV 4MHVA 4PPXA 1EN6A 1U9LA 3MGIA 1FXKA 2P90A 2BTQA 2Q8VA 3K1RB 4X8AA 3ZMTA 2R18A 3HWTA 1Y74A 4Y2TA 2R8KA 4OGQB 1J95A 3SENA 1XNRB 5EWEA 5KHHA 3E8GA 4FM0A 4EKWA 2JGAA 3G4SV 1H38A 5AM5A 3KZIU 3N2KB 4Y2JA 4X1IB 5GTHU 4K4IA 1GTOA 3PW5A 7ICJA 5ITZB 5DKWA 4DO9A 1NKCA 4YMNA 4FLUA 4J7JA 5A9GA 4X1IA 1NJZA 3K75D 5ITZA 4YMMA 1NZ6A 2YXHA 2QGNA 1PPJH 5J29A 5IYZB 3GV8B 5FPOA 4R8UB 4I55B 2EQYA 3ZDBA 5KX5A 2HVJC 3QXGA 3D36C 4BIUA 1KRPA 3CMEV 4I55A 4G28B 5C0YA 2A3QA 3PW2A 2HFEC 1X6IA 4F92B 2OCEA 2XCAA 2PFOA 2UVWA 1BVSA 2HR3A 3H8WA 2MW2B 2HCFA 2ZIVB 4US8A 4QE9A 4GXKA 5K1PA 8ICUA 1L8LA 4FO6A 5BZBA 2CTRA 1JXLA 2GWSA 4Y2UA 1FXKC 1P49A 5E79U 4UCRA 4DUYB 2A3VA 7ICGA 1XL6A 1S0OA 1S72V 3QE9Y 3JD2A 3ZCCA 1IBKO 1PD3A 4P9OA 5CBHA 1JXEA 3MGVA 2DYRB 3CXHF 2HHXA 3DDHA 4MVOA 3T3FA 1B06A 4QWBA 4R63A 1ZQ1C 2EZOA 2UUAB 4LFCO 2FLNA 3ZHQA 4YIOA 4KLOA 1IIPA 3CWBH 2EIMB 1IXBA 3UQ8A 1QBZA 5DQIA 1XSPA 2JJ1G 2G07A 3NXSA 1QQ7A 2C2RA 3RR7A 4ECVA 2Y0SC 2OEHA 5GTIU 1NKBA 2W54A 4TT3G 2HHQA 1K1SA 2XAHA 3B8MA 4HZ3A 5J8YA 2JEUA 4AHCA 4KITB 1ZQYA 3QU7A 1T3NA 4TOIA 4U3FH 1NZBA 4WBNB 5JWPA 5ALJA 5CHGA 3P30A 1K34A 1PNLA 2R8JA 1N63A 2HSZA 9ICWA 2UXCO 2Z7JA 1H2NA 1H8HG 2UXXA 4JV5O 1TVKB 1L3UA 5KG4A 1SZXA 4FPPA 2I6XA 4I50B 2OXOA 4GX2A 2DW4A 3TXSA 1RM1B 2X6CA 5IJ0B 1TVKA 5AM1A 5DBBA 3A0HZ 4YN4A 3RAQA 4H13B 3U10A 1VP7A 5IJ0A 4ECQA 3K4GA 4EBEA 3F2CA 5LA6A 3VOUA 1QTMA 2WF8A 3QEBZ 1N34B 5L3EA 8ICGA 3JARB 2WAQC 2BE3A 2NRWA 1FD9A 4DV7O 2JEXA 1HP8A 5EZYB 5L3DA 2O57A 2DYRC 3HKCB 5AIBA 2VA3A 5IINA 4H0LB 4YG2A 1SB3C 4Q8FA 3A0RA 3STLC 3UMGA 4C8OA 1KFTA 4I9WA 2LM4A 3RJGA 5B66U 3TXQA 2EIMC 4M0AA 5B5EZ 4GKJB 2I9GA 1AR1B 3MHSC 5J8YC 1ZOLA 3ZS8C 4F4XA 2YUAA 5KLVH 4DLEA 1JVMA 2IBZH 2CXYA 4DOAA 1NTZH 2BCCH 5IE9A 4XDKA 1AI7A 2K8BB 1ZYQA 4RZRA 3ZN1A 2A1JB 4KUMA 2R8GA 4ZIBA 1ZQLA 4F4LA 3CEIA 2A1JA 4ED8A 4DWIA 3WK8A 2AHZA 9ICGA 3RFRA 1FFVA 2JEIA 1TK5A 3RTVA 4CH5A 1R3JC 1BPBA 2Q69A 2M7WA 2CN1A 3D2SA 3FYHA 4I2FA 3CYOA 1C7YA 2G06A 5EE1A 2KZMA 2QKCA 4JASA 1RM1C 5KFTA 3B8NA 1TFRA 4QZEA 5KAIU 4RUCA 1PVPA 4RPXA 3ZRSA 5BOMA 5D49A 5L9XA 3OGIB 4YJ2B 1Q90D 3S6JA 1QQCA 4JI6O 1ZQZA 1FIQA 4JI4B 2RDIA 3G6XA 3RVZA 2P35A 8ICMA 2HVKC 3TK1A 1WYGA 4MF8A 2JS3A 4JI1B 4UB6U 2D3DA 3ZBHA 2VJ4A 5LHGA 4I2HA 1NKEA 1D8LA 4Y2YA 2P67A 3T79A 2G08A 2DWDC 1QH9A 1NT2B 3DXRB 3T1HB 1CRXA 9ICLA 1JCHA 3LDCA 1H2LA 2B0CA 4B9SA 3C3TA 3DXRA 5ALFA 3B09A 2KKVA 2ZNIA 1N62A 3M8AA 3PSFA 5KT3A 3ZIAG 5LGUA 2PMZF 2E1EA 2LYHA 9ICCA 3N7RC 4GLXA 3D3QA 3VQWA 4KMOB 4PZNA 3AEVA 1TK0A 5LHHA 8ICQA 4HAIA 3W7XA 2Q68A 1K5OA 1NJXA 1GN6A 2GLEA 3HKEA 3EZ5A 1BZKA 1SQBH 2AU0A 3IV6A 5KG2A 2ZDIA 4NY8A 4QIWC 1HNZO 3ABTA 1ZL8A 2VKQA 4KLIA 3ZHSA 1VQ9V 3PO5A 2ZIXB 2CTPA 2Q7GA 2FPKA 3H1JH 5GONA 4ZHQB 4RQ3A 3H7IA 1Q7YW 3GIJA 5JUMA 4UVBA 2W8KA 3QUTA 2C22A 2K89A 1W59A 2JRIA 4AILC 4YMOA 1ZWIC 3DV9A 4NJ8A 4MTOA 4C7UA 4RQEA 1YJWV 1Z4NA 2Q7EA 1N33O 3HILA 4ECUA 4YY3B 2PZSA 3E2EA 1NK5A 4FZMA 1S9FA 1P84F 4JV1A 4LNUB 5GTHZ 5F2VO 2RDJA 5ALLA 1H2SB 1KSPA 4R6ZA 3RRHA 4YR3A 3JALB 4I2BA 3ML0A 4CC5A 1I94O 4O9MA 1CP9A 3K06A 5CA1B 2HEPA 3QG5A 3ZD8A 3O0FA 4M9HA 8ICNA 1LR1A 1Q82W 4LF5O 1NK7A 2NRTA 3JALA 2H3ZA 2K4HA 1NZPA 2F3NA 4X65B 3L5KA 4JYAO 3F5EA 2OCCB 2Z5UA 4LC1A 3Q8MA 3OM3B 3H1KH 4J9PA 3R65A 4YXMA 4QWAA 2KQXA 4BWMA 4RQNA 2EIJB 1KLNA 4ED7A 3ZDAA 4RUAA 2ZDIC 1BPZA 2KHVA 4DQSA 2XAQA 2KD1A 3WK5A 3F5TA 4J11A 4L87A 4XUSA 5A2QN 1KKDA 2MRLA 1OCRB 3ETLA 5KFKA 3SYPA 2UUCB 2WF7A 1TUBB 5ALIA 3ZRXA 1HIWA 4B3TB 1Q6UA 4UB8Z 3F53A 5AI9A 5KG0A 2AGPA 2QEXV 2C28A 1R3IC 3K5LA 1OW5A 2MUTA 1NJWA 2JMGA 2EAPA 1XBLA 4M6WB 3EXAA 4UCTA 2DFLA 4DQIA 3M8SA 4M6WA 3ETDA 7ICQA 5KHJA 2CAZC 2FTKA 1QSSA 4FM2A 5J2TA 2QTSA 4FFKA 1VQ8V 2PUSA 1GAXA 2CGNA 2XTAA 7ICNA 5H6RA 1K7DA 5DB6A 2IH1C 2OCCC 3TARA 1UPGA 5KFHA 3RYIB 5J2JA 4R66A 2WB1C 3QYPA 4FS2A 1VF7A 1P7DA 4ICGA 3C28A 3HKBB 3OEHG 1ED1A 4FLWA 2ZE8A 2EZYA 1NVPB 9ICXA 5J9PC 4C8MA 3UQ2A 1PVQA 2EIJC 4DFJA 1JFFB 1M93A 1U96A 3E0FA 4NB5A 4BW9A 3SDLA 3BY6A 1IG6A 2JZBB 1OCRC 3HT3A 1HNWO 1JFFA 2JDIG 4FM1A 2W9BB 1WAZA 1S5LU 2JZBA 8ICIA 4JTDB 3ZHTA 1WWVA 4GX1A 3ZJZA 2KZ3A 2K4PA 3E22B 4RU9A 4A8EA 3D8CA 3QU5A 7ICMA 4ZOHC 2D6FC 1L3TA 4LZGA 2X6BA 1R73A 3A0BU 4XQ8A 1IM4A 4C4TA 2ZUDA 5B66Z 3NUQA 1K5SA 2R8IA 4DR3O 4LCUC 3HRDD 1VQ6V 1BQ0A 1M6YA 1XU4A 5ALNA 1Z19A 1XHXA 5KAFZ 3KOOA 3N2GA 3IG5A 2Q7HA 3EW9A 2ASLA 4DFPA 4LVSA 3RYFB 3BFRA 2Q0OC 3K9AA 4EENA 4R50A 5BR8B 3RYFA 1X40A 1FXHA 3LK9A 2YC0A 1L7MA 3RB4A 5EE3A 4ZH4A 5KFVA 2RDCA 3I28A 4O4JB 4KLSA 3QUQA 3SYOA 1FS0G 5J0XA 1YVWA 4F93B 2B5UA 1XL4A 9ICQA 5ALXA 4QPJA 2W9AA 5CBGA 3OFNG 5KAIZ 2IOHA 1ZRNA 3SAFA 3ZDCA 1URJA 3DC6A 4J9KA 3BA9A 5BPCA 5AK4A 4EEQA 1AP5A 3ZX6A 5LYJB 1LKYB 1N5XA 2DPIA 1OHHG 5EYPB 3T1YO 4AYBC 2ES6A 4PHPA 3AMZA 1LKYA 4I2IA 4U7CA 1X4TA 2ADQB 4GUNA 3QNEA 4W4KA 5EYPA 1HR0O 4UB6Z 1VJ5A 3QU4A 1GMGA 4C8LA 1FFTB 5EWGA 2RCVA 3OTQA 3A2FA 4QWDA 1XMOB 5HMMA 1FEZA 4JWNA 3QU2A 2GTAA 2KG7A 4IYIA 1WCLA 2UXDB 4IT5A 5DGBA 1X9SA 1GM9A 1M5IA 3X2QB 2DJVA 5JTIA 2VQEO 1ZQBA 2ISPA 2V4QA 2C2EA 2DWEC 4X64O 2UUBO 1VF6A 4RNOA 4P0QB 1IURA 1NKDA 2R70A 1B6QA 2AW9A 3V7LA 1D8YA 1XNQO 1F4MA 4Q43A 3ZMVA 4AI8A 1DRGA 1M1KW 2H8PC 2WA4A 3IDWA 3PR5B 4PV1B 1XMQO 2UXBO 1DGJA 4I9QA 4F4YA 2Y1JA 1AR4A 1R1BA 2B1GA 4ASUG 1ZJMA 4IRKA 2D2CB 1VQKV 1TAUA 4XRHA 9ICNA 5AKHA 3ZDDA 5HFMA 4UW9A 3LNMB 1SQXH 4JI0B 2Q5ZA 5KT2A 1KUQA 5LMNO 1PNKA 3SEIA 4O4IB 3KTQA 3EFFK 2L5YA 1BGYH 2EH9A 1XEQA 2BPFA 5J0OA 2YI9A 4C8KA 3ABLB 1SA0B 3V6KA 1X66A 4PHAA 5L1KA 5EWFA 3HR0A 3FM9A 3K0DA 3PNCA 2BCQA 4B9UA 4NXMB 5IILA 2YB1A 2LM1A 5KFYA 2G5HB 4DQPA 4QPKA 3IRUA 4JZGA 4NTYA 3I55V 3GIMA 5ALMA 3VBBA 4DV6B 1VF6C 3MABA 2XY6A 5AKYA 4MVSA 3X2QC 1V85A 1B43A 3F7VC 1OJHA 2LJ2A 1ZQPA 4NWIA 2H3OA 1TKDA 1LUWA 1I0HA 2PYJA 1AILA 3EVKA 3HKZC 5H5NA 5DLGA 2OIGA 3JD1A 1LVHA 4J9NA 1TVAA 4KLFA 5AM3A 2BDUA 3QEAZ 1QR9A 1QVFU 3BS7A 3CCUV 2ZXHA 3AG7A 1ZQGA 2LI6A 4J9MA 3WKCA 5CMUA 4CH4A 3QO8A 1IBMO 3LSQA 1YEWA 4JAAA 2HOFA 3VC8A 4M04A 1A32A 3LWLA 5KL1B 5B1NA 1N36B 2F1HA 4OCZA 3BQ1A 1QNMA 2BR0A 2JJ2G 8ICWA 2QARA 4UAYA 4DR5B 3CCMV 3OTOO 3AL0B 1PUZA 4EBCA 4D7SA 2YIBD 1JOYA 3APQA 2DL0A 3PX6A 3ABLC 2EX3A 4NYKA 4QNHB 2WLLA 1U97A 4DR6B 1GN2A 2FYUH 1DF4A 2DMXA 2MAXA 3JPNA 9ICPA 2WHEA 3U26A 5IY5B 5J0SA 3CRMA 1WUDA 4FLTA 2F77X 2BZFA 1EN5A 1D8BA 1TGOA 2RMKB 3A0HU 3E83A 3TADA 2A9HA 8ICLA 4PZOA 3CCLV 5AM0A 1YI2V 2F1IA 2ZIOA 2WFAA 4O5KA 4U3JB 2W7PA 2Y9UA 3CW2C 3JPRA 2KE7A 2EBOA 1OUQA 5D4BA 2WLIA 2Q0ZX 5E1AC 4CE6A 2Y9TA 3OPXA 3WK9A 4J9ZB 3JAMN 4O3QA 4O4LB 2IBKA 3T5LA 5KFAA 2CRXA 1WB8A 4ZI7B 5AI8A 5B5EU 2GBOA 4O4LA 2Y0SF 4LF4O 4UAWA 4ECYA 4G27B 1EXNA 2R9IA 3WK7A 5IYBO 2F44A 5KFCA 3VQXA 4DQQA 1RFYA 3GWOA 1UCVA 3RJHA 4C8NA 1BPXA 1S5LZ 1AQ6A 3KHLA 2UU9O 4B3RO 2CH7B 4KHPO 2E76B 3H4DA 2KFNA 2WLKA 3KHHA 1XOUA 4R64A 3MFIA 5ALTA 1AP6A 4OJLA 4PD4F 1KMIZ 2N05A 3A0BZ 3ED5A 2LKYA 3IC7A 3J80N 2EAOA 3V72A 3OW2U 2JGDB 3SYQA 1ORQC 4UCOA 1T94A 2DKXA 3TADC 3TGUH 1BNOA 4J42A 5IY5C 5JH7B 2YSUB 1D2DA 1KQQA 1J5EB 3RJKA 1G4YB 2JGDA 4BIOA 2E75B 4PDRA 5J0WA 3B0XA 4O3OA 4B7EA 5K1XA 1C20A 4G9BA 2VA2A 3GVMA 2W9MA 2JS5A 3MBYA 4QNLA 4RT2A 2HJFC 3E8BA 4JYCA 2WA3A 5FNVB 3MAQA 2WAQF 3D2NA 2Q6AA 4NL9A 5LBQA 4UB2A 3QUCA 1Z2GA 5FNVA 4DSJA 1SETA 5J2GA 4GC7A 2PI5A 4BWJA 3O65A 1JMSA 4H33A 4CDGA 2WWWA 3S3WA 2Q73A 2W3SA 5DN6G 2KIWA 1SV0A 4CF3A 4IIJB 1Q86W 1SL2A 3C3SA 1WP7A 3OJUA 1NVPD 4X88A 1IZ3A 4C4RA 1G6UA 1K73W 4OJOA 2XO7A 5FP0A 1M9NA 7ICEA 5AK3A 2VS0A 3ZN0A 1BQZA 3T1CA 1SKSA 4HYOA 4UCVA 3SV3A 2KNJA 2A06H 2NRVA 2H94A 4IHJA 1TAEA 4IYHA 3SAGA 2NRZA 1E79G 4JI2B 4YVZA 3H8SA 1S77D 2YMMA 4ECSA 3N4MB 2KSOA 3CX5F 1I5YA 1HEKA 2K4EA 4DV0B 4MEXA 1QQ6A 4O2BB 1ZQWA 1M90W 2JEJA 4O5EA 4GKKO 2NO4A 3OGUA 3NGDA 4JAVA 5AK6A 1Q3UA 3D6JA 1RDFA 3SMVA 7ICUA 2DQNB 3OR7C 4JI3B 4F5RA 2M6YA 3GDXA 1BE3H 3P3PA 1NQTA 3OAAG 2L35A 2WLMA 5L3GA 2BTQB 2F8LA 4EBDA 3IAYA 1XNRO 1RM6C 3B77A 3I1YA 1VARA 1Y74B 4MFAA 2AGOA 2Q4PA 2FJ6A 1X9WA 1QCKA 2ZIUA 1QHTA 1RPOA 3L9DA 5CA0B 3RYCB 2KJ9A 4NL9C 2D8CA 4CCHA 9ICJA 5CA0A 3LUTB 2QE7G 3IGAC 3L71H 3RYCA 3CRCA 1WN7A 2N1RA 3PV8A 2QDOA 4A5UB 4WFFA 5HR7A 4GC6A 2XCPA 2F4VB 2PKEA 4R65A 3N27A 1VF5B 3Q4HB 4E0DA 2ZD9A 4PGQA 2HHHO 2DE0X 5KFRA 1SZTA 4Y2VA 1L7NA 3Q4HA 1TA8A 5KTQA 5J0QA 2EANA 4CZZA 4P2ZA 2ZTDA 4Z6CA 2K8CB 1IXMA 1UPHA 5KX5B 1Z4OA 1H8EG 1SZPA 1XUQA 1SS3A 1NNLA 1O9GA 4NXNO 1NTKH 1X59A 2ZIWA 2ASDA 3KCXA 4LH7A 2ADPA 1L8DA 1ZQKA 2NNUA 1SWWA 1F0MA 1NK8A 5TZVA 1XSLA 5DQHA 1DF5A 3ORYA 3M9MB 1W2BU 3H8MA 4WJ3B 4GFJA 4MFCA 4KLMA 4Z6EA 8ICSA 2K9PA 4JI7O 2V1DA 3K03A 3AG1B 3JCUZ 8ICTA 3AU2A 1VIBA 2E1FA 3WB2A 1UA0A 1ZQTA 1K1QA 4TUPA 4UB8U 3L73H 9ICFA 2AZ2A 2HLDG 3JD3A 4K8XA 2JHDA 4I27A 1UQVA 3RWRD 5KG5A 1ZQOA 3BEHA 4DFDA 5HHHA 4LH6A 5ALZA 4DEZA 2YIAA 2RN9A 4G2KA 1GM8A 5KT7A 8ICCA 3K04A 2KN7A 4LF6O 5KT5A 4XDLA 4RQ6A 3G6VA 5GW7A 4UAZA 4X1KB 2ZIMA 1T4GA 2X6AA 1B0XA 4B3MO 4X1KA 3LYSA 3BZCA 3FC4A 3NS1A 5H2FU 3FDSA 5J2AA 4TV8A 3AG3B 3RJJA 4JZ2A 2X7RB 1Q46A 4GX5A 2LW1A 3CXCU 1ZQQA 3N7PD 3GIIA 4DW0A 1IBKB 1F23A 3OMIB 2M0NA 2HVHA 4JMUA 1KL9A 5L1JA 1NTMH 5JJEB 2KG5A 1L3SA 4OO1J 4MVMA 2BPCA 4LFCB 2ITDC 2ZJ5A 4F8RA 7ICVA 2QA4V 5LA6B 5DBAA 3T5JA 4GT1A 5AHXA 4ECZA 2HHVA 1JIHA 3BHPA 3JD4A 2E8MA 1KECA 3AG1C 2CPRA 4GZRB 4H44B 4CS3A 2CE4A 2YS8A 4OJPA 4UAUA 5DB9A 4LF8O 4DSKA 3ALRA 1OCCB 4U6PA 1XILA 3H1LH 2L6LA 2CDYA 4O3SA 3SYZA 5J2EA 3WU2Z 3MC1A 3PSTA 2AQ4A 5EBWC 4CH6A 4X62B 1J2MA 2RP5A 2UXCB 1N56A 2IU3A 3ASNC 4ED2A 1JUDA 3WK4A 2UVUA 2PF4E 3QUBA 1RXVA 3DSQA 5KAFU 1Q6HA 5KFMA 3CCSV 3V7KA 5HR6A 1BNPA 3ZHVA 1AI4A 3SJCC 3SGIA 4K8ZA 3M6KA 5DB8A 2FLPA 2AHOB 2WB1F 4JF3A 1XI1A 1QVGU 3AG3C 1HDJA 4BAYA 2YDEA 3BA8A 1KBHA 3CP1A 4BXOB 4RQ7A 3H8JA 3QX7A 4FZNA 2YMPA 1ZLZA 3H1HH 2V4DA 1N60A 2HMXA 4YXJA 2BSKA 3H9VA 4BXOA 4PA9A 5LMUO 4DV7B 4OX9B 4QZCA 1KDHA 2RLTA 1KW4A 4DL7A 2K4IA 3JPTA 2QKSA 2GUZB 2VQFO 4Q45A 3JD0A 4I0XA 4M9GA 1SKVA 4PI2A 2HBMA 1RQNA 1HUZA 3EYZA 4FZLA 2FB5A 2GUZA 2MU2A 1GRJA 1IDSA 2YI8A 2ZJ8A 4IRDA 3ZRVA 1OCCC 2J6SA 5ALVA 1QLEB 3Q8RB 2Y4TA 2V4RA 5KFFA 4DFKA 3GZFA 2YX8A 4KLDA 2OTLV 1UJWB 4DSFA 1X42A 3PX0A 3SPIA 2LYAA 4DL6A 2KHQA 2Y1IA 3ETGA 1N8RW 3UXNA 2HHSA 3TETA 3AN1A 2PY5A 2HVIA 4DSEA 3TKAA 3SPHA 5DDYA 3M8RA 4DR2O 5ALGA 1Z1VA 4Q44A 5KT4A 4K0KO 2YXLA 4UBBA 3TAQA 2QKAA 2XOKG 7ICRA 1S10A 1V55B 1PM9A 1IVSA 3N97B 9ICKA 1O03A 4BGDA 3HKEB 3RH6A 4KX5A 4TURA 4DL5A 1OCOB 4KFMA 1MNGA 5HNKA 5AKXA 1ZL8B 3JATB 3OEEG 5GONB 1SERA 2BDPA 3AQFA 4B3SO 2MSNA 5EE0A 1EBOA 1JJOA 4F6EA 2QM4A 3JATA 2F23A 3PO4A 1KFDA 4KN7A 4RPZA 4HBNA 2KP7A 1BPYA 2FPLA 1M57B 3C29A 1J2NA 3TQ1A 4DV4O 4AYBF 1PL4A 3JCZA 3LSUA 1SKRA 5FLXN 1YXBA 2QM8A 3JASA 1XHZA 3CC7V 1SQVH 2Y0IA 3OMAB 3R66A 1WG8A 4RQ1A 3B4SA 1QLEC 2HI0A 3PW4A 2XAGA 5L1IA 1FFXA 2EZZA 1ZQFA 1AI6A 1YZBA 5ALUA 5KHKA 3RBZA 2AZ0A 4AQYO 2PGGA 1DTOA 2K8AA 2P4VA 2Q0AA 3JSNA 3OT7A 5EC1C 2LMRA 3GQCA 1HNZB 2XT9A 2DKZA 4QZDA 3UO2A 4LR3A 4X89A 1G1XB 2IJKA 2NLJC 4JWMA 1SV4A 4BX9C 4FBTA 2NRXA 2KKPA 2ODMA 3E58A 1IV8A 5AI0A 1V55C 2JXJA 3T2MA 3ETRA 4DV2B 4C80A 1OCOC 3KCYA 2XY7A 2W9CA 4YR2A 3A8TA 3PR4A 3UPQA 3VQVA 3GV5B 5HP4A 1ZQMA 2EZPA 5LGTA 1N33B 1CUKA 1NR1A 3KKAA 5AKEA 4FZ0A 1TAMA 1L7OA 2WLNA 1YJ9V 2QJ1A 4DR7O 2YMLA 5CJ7A 2MUTB 4KLGA 2DOSA 2OT5A 2QSAA 1M57C 4JTAB 2CGOA 4FLYA 4OJ6A 4YP3A 5DB7A 4RQ2A 4KLQA 3UMCA 4LF5B 2ZTCA 4QZAA 2ZE5A 3C1YA 4QW8A 2FMPA 1MA1A 4RPYA 3P3NA 2K60A 5J2TB 2WLJA 2BOBC 4RQMA 2XGPA 3C2LA 3RBEA 2YXYA 3QZ7A 1CEZA 4KTQA 4TWKA 3MDAA 1B22A 1Y66A 1VQ7V 1R3KC 3C5FA 2IHMA 1I5XA 2R9RB 1Y76B 4X1YB 3D2QA 1XDCA 3MR2A 5H2FZ 1JX9A 4O5CA 5KFZA 1UT5A 1VLBA 3HKZF 3CNHA 4EYHB 4XDJA 4CRXA 1Y76A 2MK3A 4O2AB 4X1YA 3K9SA 1VQNV 2YN4A 4O2AA 4P4PA 3ZEDA 1TUEB 5ALQA 3G6YA 2W0XA 2R72A 3IN5A 1S8OA 5KMGB 4YD1A 5CA7A 3KKAC 1GKFA 4PJ0U 2BGWA 3OUFA 5KMGA 1CXZB 1K97A 1V38A 4DW1A 3CCRV 3JPPA 5LOVB 1Q8KA 1DK2A 4UVAA 5B1OA 4IQVA 1D9DA 1AJPA 3L72H 5LOVA 4NV0A 5KG7A 4KLHA 4PGXA 3RGBA 2CUGA 2EDUA 1RXWA 5KG1A 4CGZA 1AJNA 3K59A 1EFRG 4P9PA 8ICFA 3GU3A 3PVXA 4F2SA 3N2GB 3HX0A 5ALWA 2OM6A 2P06A 4DRXA 7ICTA 4DR4O 4I7ZB 1YZ7A 2HHWA 1BSMA 1WPXA 1VQLV 1OXJA 4P4MA 2OH2A 2IU0A 2VWJA 3RJIA 9ICHA 1R6KA
chains in the Genus database with same CATH topology
5IY5B 1WUDA 2GOLA 3ABKC 2F77X 1D8BA 3E83A 4N21A 3CYMA 2A9HA 2HVJC 5LHIA 4BIUA 3CMEV 4G28B 5C0YA 2IJHA 2HFEC 3E89A 3CCLV 3E86A 1YI2V 2GHYA 4FJCC 3W7UA 2HR3A 2W7PA 1BMFG 2ZIVB 3AG2C 4MTXA 1THZA 2H3QA 4QE9A 2G09A 1YSCA 2EBOA 1VQOV 1OUQA 1F51A 2WLIA 5BZBA 5E1AC 1FXKC 3OPXA 2A0LA 3IFXA 2XICA 2VJ5A 3LVWA 3SJQC 2A3VA 4J9ZB 3T4ZA 3G71V 1XL6A 1S72V 2Y69B 3JD2A 2PMZC 2CRXA 3ZCCA 3N7SC 1PD3A 4P9OA 2DF4B 3MGVA 3E35A 5CBHA 2P6JA 2DYRB 2Y0SF 2LFRA 4MVOA 1KQSU 4G27B 2R9IA 1ZQ1C 2EZOA 4YXWG 2DYSB 5IYBO 1MSWD 2RHFA 3H0LB 5B1AB 2JH1A 1HWYA 1QCEA 3GWOA 2WLHA 2ZIXA 2WSSG 1IIPA 2EIMB 3H01A 1QBZA 2KVCA 2G07A 2JJ1G 2WLKA 3NXSA 3CCVV 2OYYA 2Y0SC 4TT3G 2XAHA 4PA6A 4J9YB 3B8MA 4HZ3A 2JEUA 3CP8A 4OJLA 3FYEB 3ZRWB 3GB7C 3CC2V 2LKYA 3H0RB 1NZBA 3IC7A 4N23A 2UXNA 3IG8A 2XASA 4P30A 1Z1BA 3ASOB 3ZRWA 3P30A 1K34A 1PNLA 3F7YC 3OW2U 3HPLC 3SYQA 1ORQC 1T94A 3H0MB 2F43G 3F5WC 5IY5C 2QM7A 2Z7JA 2YSUB 1H8HG 2EIKB 2UXXA 1G4YB 4MVQA 4MW8A 4PDRA 4FPPA 1NR7A 2OXOA 4GX2A 2DW4A 1PKXA 4PA4A 2X6CA 3LDEA 3LDDA 2HJFC 4QNLA 3E8BA 4JYCA 1RM1B 1BHBA 2WAQF 3D2NA 2Q6AA 5LBQA 4RUEA 3FB7C 2LYBA 3STZC 1BL8A 1SETA 4H33A 2PI5A 3F2CA 3VOUA 4CDGA 2WWWA 3OGCC 5DN6G 2KIWA 1VQMV 1Q86W 5L3EA 1Y4MA 1GK9A 4UXNA 1NVPD 2E5SA 2H3VA 2WAQC 1OZ0A 4MVZA 4X88A 4ZKIA 2KJ8A 4UV8A 1K73W 2Y69C 4OJOA 1KP2A 3ZMZA 2JEXA 1M9NA 5L3DA 5KA5A 2NV3A 3SQIA 3ZN0A 2DYRC 3T1CA 3ETEA 4HYOA 4PDLA 5IDJA 1S0VA 2KNJA 2DYSC 2H94A 2HKOA 5B1AC 3SAGA 1E79G 3A0RA 3STLC 2F2AB 2ATKC 4I9WA 5KUMA 1S77D 2EIMC 4Q20A 1MA7A 1AR1B 3MHSC 1YTFD 1KBUA 4LP8A 1I5YA 1HEKA 2K4EA 1KP3A 1JVMA 1M90W 5IYCO 3ONNA 4XDKA 1AI7A 2K8BB 4JAVA 3ZN1A 2PI4A 1Q3UA 4KUMA 3I56V 5DM6V 3SMVA 3OR7C 2DQNB 4F4LA 3ASOC 4WFHA 2AHZA 1NQTA 3OAAG 2WLMA 3UM7A 5L3GA 2F8LA 5EC2C 3B77A 4H37A 1R3JC 1F4NA 1RPRA 2M7WA 2CN1A 3K1ZA 3D2SA 2EIKC 2Q69A 2ZIUA 1RPOA 3ABMB 2KJ9A 3CYOA 1VQPV 2G06A 1LNQA 2ZQMA 3K0GA 1ROPA 3OUSA 4JASA 1RM1C 2KV2A 4UVCA 3CCJV 3B8NA 5B1BB 1KD1W 1PVPA 3LUTB 2QE7G 3IGAC 3ZRSA 3KZXA 3OMNB 2N1RA 4O3MA 4WFFA 5HR7A 1G8MA 1P7BA 4BIZA 4JPRA 4WFAV 4ICAA 3RVZA 2HVKC 3TK1A 3P32A 5CN0A 2ZD9A 4P0PB 4RAIA 2ZXWB 1SZTA 4MW3A 2WLLB 4PDVA 3DEEA 4P0PA 2XAFA 2VJ4A 4GCZA 4CZZA 5LHGA 1YHQV 4P2ZA 1WLEA 3MD0A 2DGZA 1MOFA 2JH7A 1NBMG 4R7CA 2K8CB 1IXMA 2P67A 1UPHA 3T79A 3CD6V 2G08A 2DWDC 1H8EG 3MHHC 2H3IA 1CRXA 2AHYA 5EK0A 1JCHA 2ZIWA 3L3FX 2Y48A 3LDCA 2NNUA 2KKVA 1DF5A 5H9CA 3PSPA 4UV9A 2WLIB 1W2BU 3PSFA 5B3SB 2GH1A 4WJ3B 3K08A 4GFJA 3ZIAG 5LGUA 2PMZF 2E1EA 2V1DA 3N7RC 2W7OA 1DLBA 3LVVA 2ZG6A 4KMOB 2HBKA 3K03A 2YEVA 3AG1B 4R8CA 5LHHA 3W7XA 2Q68A 2E1FA 4LBEC 4I5SA 2G5IB 2WAMA 4IC9A 4FK5C 1VQ4V 2HLDG 3JD3A 2JHDA 2ZDIA 4QIWC 3ABMC 3ABTA 2VKQA 1S5HC 3M99B 3BEHA 1VQ9V 2ZIXB 3SAHA 1PVRA 2HBJA 5B1BC 2LHTA 3AEIA 1Q7YW 4G2KA 4UVBA 3CMAV 1GM8A 2K89A 4PELA 3CCQV 1KC8W 1JQ0A 3K04A 2OTJV 1ZWIC 4MTOA 4XDLA 4RQEA 1YJWV 5GW7A 2XI9A 4KX3A 5C93A 2ZXWC 2X6AA 1ECWA 1QR8A 3LYSA 3E2EA 4FZMA 2K1EA 4R6ZA 3ML0A 2BOCC 3AG3B 2ZXIA 1CP9A 1COWG 2X7RB 3K06A 4PL1A 4GX5A 3CXCU 3O0FA 2W6IG 3N7PD 1Q82W 4FIPC 2H3ZA 4WFBV 2K4HA 5T14A 1E1QG 1F23A 4NLBA 3OMIB 3F5EA 2OCCB 2Z5UA 4LC1A 2M0NA 3OM3B 4JMUA 4WFGA 1YT3A 3R65A 4OO1J 1F44A 4MVMA 4JTCB 4ZBMA 2ITDC 2QA4V 3JYCA 5B3SC 4GT1A 2XIDA 3F5AA 3JD4A 1XO0A 1KECA 1Q3VA 2GSMB 3AG1C 5L3BA 2CPRA 2EIJB 2ZDIC 4P0QA 4OJPA 2A79B 2KHVA 2XAQA 3OR6C 2KD1A 4L87A 2H3FA 3SPCA 3DGEA 3ALRA 4MTFA 1OCCB 4U6PA 2MRLA 1R6NA 1OCRB 3SPGA 3SYPA 1NJIW 3ZRXA 1HIWA 2C2AA 1K5QA 4OXSA 3EHBB 4OJ5A 3PSTA 3F53A 3W7WA 5EBWC 2EILB 2IW5A 1L1FA 2RP5A 2KJ5A 3AQEA 1R3IC 2QEXV 2KOBA 5EBLC 2IU3A 3ASNC 2X0LA 3ICXA 2JMGA 2LFSA 4JYBA 2YB4A 2V7QG 2MA1A 3CCSV 1BHAA 3ETDA 5HR6A 2JIZG 2FTKA 1AI4A 3PZPA 2KEYA 4QJFB 3M6KA 3T4DA 3E8HA 3KFUF 1K9MW 2WB1F 1M56B 4JF3A 1QVGU 1VQ8V 2ZIUB 1OCZB 3AG3C 4BAYA 3KG2A 4JGSA 3PSIA 4BUGA 3OE7G 3CP1A 3ZMUA 4DO2A 4RQFA 2JK5C 4FZNA 3SPJA 5H6RA 1K7DA 3IP4B 1NH2D 1Q81W 2HMXA 2IH1C 4PA9A 2OCCC 2IH3C 1SRYA 2WB1C 2XAJA 2XNDG 1SESA 1P7DA 4HAMA 3C28A 2K4IA 2QKSA 3NRWA 1ED1A 3OEHG 4MVRA 3D36A 3JD0A 3M6ZA 2W04A 3AG4B 5A0LA 3M7DA 1NVPB 2HOQA 5J9PC 1V54B 2HBMA 1H2GA 1PVQA 2WPDG 4FZLA 2EIJC 2ZR3A 3D3IA 3SYCA 2HBLA 3E0FA 3BY6A 3ZRVA 1OCCC 1QLEB 1OCRC 5H6QA 3TCUA 2JDIG 4CBCA 3GZFA 2YX8A 4JTDB 2OTLV 1UJWB 4GX1A 1YTFB 3SPIA 3ZJZA 2LYAA 2ZIWB 2KHQA 2EILC 3ETGA 4PA7A 1N8RW 3TETA 3LSSA 4A8EA 4PDMA 2D6FC 2EJRA 2X6BA 1R73A 1K3EA 3SPHA 4C0ZA 3NUQA 1K5SA 1JJ2U 2YEVB 4LCUC 1VQ6V 1VQ5V 2XOKG 1V55B 4MT8A 4QIWF 1Z19A 2HOIA 3RFAA 3IG5A 4KX5A 1OCOB 3FKSG 1M56C 4KFMA 1OCZC 1PL0A 3K9AA 3WG7B 4R50A 2HG5C 2IJJA 2EINB 3OEEG 1SERA 3AQFA 3DTUB 1FXHA 1EBOA 4MSWC 3PJSK 2F76X 2XVTA 4RUFA 1FS0G 3SYOA 1M57B 2B5UA 2ZR2A 3C29A 1XL4A 3AG4C 3ASNB 4Z1MG 2W6JG 4QPJA 2DQ0A 5FL7G 3OFNG 1PNMA 4QE7A 3UKMA 5CBGA 3SAFA 1A6SA 3G6EV 4AYBF 1V54C 1URJA 3JCZA 2ZIVA 1S76D 2QM8A 5CA3A 3CPWU 5LGNA 3OMAB 3CC7V 2CK3G 3QO7A 1QLEC 1OHHG 3WFVA 2XAGA 3RF9A 5KA6A 1AI6A 1R3LC 3HB3B 3RBZA 4AYBC 4U7CA 5IYDO 1S3JA 1K8AW 3QNEA 1MABG 4WFEA 3K79A 1DTOA 2K8AA 1SZHA 1AROP 1GMGA 4E2LA 1FFTB 5EC1C 2G0AA 2Q4TA 4DXWA 5L3CA 4MVUA 1GO3F 2LBOA 3RVYA 4X89A 2QTOA 2IJKA 2NLJC 3FB6C 2DQ3A 4BX9C 1W0JG 5CRXA 1GM9A 3X2QB 2KKPA 2DWEC 1V55C 3T2MA 1YIJV 3CCEV 3VCBA 4P0QB 4WCEV 1NKDA 3F2DA 1OCOC 4MTGA 4U7NA 4UUJC 1B6QA 2KB1A 3WG7C 2EZPA 5LGTA 1F4MA 2EINC 1NR1A 3ZMVA 5KL8B 3QO5A 1DRGA 1TAMA 1M1KW 2Q67A 5L3FA 2H8PC 2WLNA 1YJ9V 1K4DC 2OT5A 2W0FC 1M57C 2ITCC 3ZMSA 4JTAB 2B1GA 4OJ6A 4ASUG 4NLCA 1QLNA 2IJIA 1VQKV 4JAUA 1K92A 4TSFG 1K4CC 1L6NA 5HFMA 3LNMB 1PNKA 2RRDA 1K33A 1XNSA 2KICA 3EFFK 3RW0A 2WLJA 2BOBC 2LP7A 3FYIB 4ACOA 1AI5A 3ABLB 1CEZA 3W7TA 3K3WA 4TWKA 2D3OW 1Y66A 3FB8C 1VQ7V 1R3KC 1JPXA 4PL2A 3K0DA 2B1IA 4MS2A 1MG1A 1I5XA 2R9RB 3ABKB 3D2QA 3CRXA 1FXVA 2YB1A 1JX9A 3E8FA 2G5HB 4QPKA 4U7OA 4WF9V 3HKZF 1KKDA 4XDJA 4CRXA 2MK3A 3I55V 3W7SA 1AJQA 3VBBA 1YITV 4MVSA 4FE3A 3X2QC 3F7VC 1W0KG 5CBFA 1VQNV 4BW5A 3AG2B 1TUEB 4NWIA 3IN5A 3HKZC 4RO2A 3JD1A 1GKFA 4KP4A 4XBFA 2W03A 1FXKB 5HFLA 1P4RA 2P7TC 1QVFU 3OUFA 2BDUA 1QR9A 1YJNV 3CCUV 2ZXHA 1FXKA 2P90A 5CMUA 1K97A 1A0PA 3QO8A 3CCRV 3LSQA 4X8AA 4UVAA 3FB5C 2R18A 4BJQA 5B1OA 3ZMTA 2HOFA 3VC8A 1J95A 1AJPA 3SYAA 4PA3A 4NV0A 5KL1B 3E8GA 5B1NA 1ENVA 4FMTA 4EKWA 2JGAA 4CGZA 1AJNA 1EFRG 2Z3YA 4GX0A 4P9PA 5EBMC 3G4SV 2JJ2G 1H38A 3GU3A 3CCMV 3AL0B 3CC4V 1GTOA 3F2BA 1E1RG 2OM6A 1GM7A 1JOYA 3ABLC 1WPXA 4QNHB 2VIXA 2WLLA 1VQLV 2IU0A 2OH2A 1CPYA 3ABUA 5KUKA 1NH2B 1DF4A 1EZJA 1R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUD A;  3SAH A;  3SAG A;  1D8B A;  2RHF A;  2HBJ A;  3CYM A;  2KV2 A;  4NLB A;  5C0Y A;  1YT3 A;  1GO3 F;  4O3M A;  4OO1 J;  4NLC A;  4CGZ A;  3SAF A;  2MA1 A;  2E1E A;  4CDG A;  2HBM A;  2RRD A;  4QIW F;  2HBK A;  2HBL A;  2CPR A;  4QJF B;  2E1F A;  2DGZ A; 
#chains in the Genus database with same CATH topology
 2GOL A;  1HNW B;  4KN4 A;  2QWP B;  2W55 A;  3IM1 A;  5LHI A;  2I5H A;  3RB0 A;  2LW7 A;  3E89 A;  3E86 A;  2ISO A;  1PP9 H;  4NLN A;  1FFU A;  4QZB A;  2B6G A;  4FJC C;  5KG6 A;  3G67 A;  1B3Q A;  1THZ A;  2H3Q A;  2G09 A;  1YSC A;  1F51 A;  4DV1 B;  4DR1 B;  2PFN A;  1DK1 A;  2A0L A;  1Y6X A;  2XIC A;  2VJ5 A;  3LVW A;  4GXI A;  3SJQ C;  5JJN B;  1ZQR A;  2GDS A;  1DXS A;  1SQP H;  3T4Z A;  4DR3 B;  4LFA O;  4D6T H;  1RSO B;  2Y69 B;  2PMZ C;  4TUS A;  1KFS A;  2PFP A;  3JSL A;  3N7S C;  2E8O A;  1FKA O;  2P6J A;  1KQS U;  1RSO A;  3HKD A;  1N32 O;  3NVV A;  2DYS B;  1MSW D;  4KXR A;  1SL0 A;  2F8K A;  2JH1 A;  2LGQ A;  3BAB A;  2KG7 B;  2WSS G;  1AVM A;  1Q6I A;  1P7G A;  4ECX A;  4YHH B;  2KVC A;  1ZQV A;  1TK8 A;  3T5K A;  1JRO A;  2OYY A;  4QZG A;  1RP3 B;  1ZD4 A;  4DL3 A;  1PK1 B;  3TAC B;  5KFP A;  4M9J A;  3CP8 A;  5L1L A;  3FYE B;  3ZRW B;  3GB7 C;  1KYO F;  3CC2 V;  3THV A;  3H0R B;  1PK1 A;  2UXN A;  3IG8 A;  1Z1B A;  3ZRW A;  4F91 B;  2KVS A;  3F7Y C;  4DQR A;  4KLJ A;  2E5L O;  4J9L A;  2F43 G;  3F5W C;  3K5N A;  2OYQ A;  2C2D A;  2ZM6 O;  3WB0 A;  3V7J A;  5KFG A;  4XA5 A;  4PA4 A;  1PKX A;  3KD3 A;  5IWA O;  3LDE A;  4X66 B;  3THO A;  1LV5 A;  4YJ3 A;  3K5M A;  1HR0 B;  1Z3E B;  1S5J A;  4F5Q A;  3FB7 C;  7ICH A;  2WF9 A;  3STZ C;  4DV5 O;  1BL8 A;  1QU7 A;  3OGC C;  4I2A A;  3TAN A;  2JVD A;  1N2X A;  4DS4 A;  2BQR A;  1VMG A;  4QZF A;  2HDO A;  1GK9 A;  4UXN A;  2E5S A;  2H3V A;  1OZ0 A;  4ZKI A;  2QKQ A;  1HJP A;  2VQE B;  2KJ8 A;  4F3O A;  2UUB B;  4QZH A;  2Y69 C;  4X64 B;  1KP2 A;  2JGU A;  3Q8P B;  2NV3 A;  3SQI A;  1BGX T;  4QW9 A;  1B4F A;  3ETE A;  4PDL A;  5IDJ A;  1S0V A;  2DYS C;  1MQ2 A;  2HKO A;  7ICF A;  4CNQ A;  1UFI A;  1ZQS A;  2F2A B;  2ATK C;  1XNQ B;  2JEG A;  1ZAU A;  4DUZ B;  3L4P A;  5TIS Z;  1KBU A;  1GN3 A;  9ICB A;  4LP8 A;  1ZXI A;  4PHZ A;  4UCU A;  2FMQ A;  1SF9 A;  1KP3 A;  1FJG O;  3UT5 B;  4P4O A;  4YQW A;  1XMQ B;  2UXB B;  5IYC O;  3ZHR A;  2WTF A;  4FVM A;  3QF7 A;  1F5S A;  4F72 A;  2PI4 A;  1Y67 A;  3UT5 A;  2W43 A;  4EB6 A;  2F66 C;  1EM1 A;  1HNX O;  5JVD A;  4WFH A;  3B0Y A;  4JI8 O;  3UM7 A;  1SQG A;  4D7T A;  1SL1 A;  4Z6F A;  5EC2 C;  2BTO A;  5LMN B;  5DED A;  4H37 A;  1EN4 A;  1O08 A;  1F4N A;  3K1Z A;  3IC9 A;  5LP6 A;  2ZE7 A;  2FPM A;  4RQ5 A;  3K0G A;  3OUS A;  2Y0P A;  2KV2 A;  4UVC A;  3CCJ V;  4DR5 O;  1KD1 W;  1NK6 A;  4RQ8 A;  2YMQ A;  3KZX A;  4L8J A;  4EFE A;  2A1A A;  2QAR B;  3GIL A;  1V97 A;  1SC5 B;  4JPR A;  3UXP A;  4DF8 A;  3T5H A;  3CJH A;  1HUO A;  1L5U A;  4F5O A;  4DOC A;  3FAV A;  1UA1 A;  5CN0 A;  4DS5 A;  2ZXW B;  2QLT A;  4MW3 A;  3EWA A;  4TQD A;  2WLL B;  1FO4 A;  5JCO A;  3NVZ A;  4DYL A;  5ALP A;  4IL6 U;  2XC9 A;  4JV0 A;  1LB2 B;  1WLE A;  3MD0 A;  1MOF A;  4R7C A;  3CD6 V;  2YID A;  2E74 B;  5J2D A;  2ASJ A;  8ICK A;  5CEH A;  4LF9 O;  1Q43 A;  5AKK A;  1NK0 A;  2Y48 A;  2ZNJ A;  1IBM B;  5DDM A;  3SJB C;  5H9C A;  3PSP A;  2LQT A;  2WLI B;  5B3S B;  3K08 A;  4PH5 A;  2E8N A;  4NM1 A;  2W7O A;  2HW3 A;  1DLB A;  3LVV A;  2HBK A;  2QWR B;  2YEV A;  2Y4U A;  1IBL O;  5J2H A;  1N0N A;  3QVN A;  5DG9 A;  3H1I H;  4J80 A;  3OTO B;  2G5I B;  2Q9L A;  2WAM A;  3WU2 U;  3RYH A;  3PW0 A;  4FK5 C;  3K58 A;  1VQ4 V;  1ZQJ A;  1SKW A;  3MFH A;  4PJ0 Z;  4DL4 A;  3CRQ A;  3SAH A;  1PVR A;  4DV3 O;  1KN5 A;  4F5N A;  2LHT A;  3BQ2 A;  2BQU A;  4IQW A;  8ICX A;  1NK9 A;  2VWK A;  4PEL A;  5AI5 A;  1JQ0 A;  5KFJ A;  4I2D A;  1ZQI A;  4USA A;  5IT9 N;  1OV9 A;  5JCO C;  1TE2 A;  4KX3 A;  1RPL A;  2KSD A;  2ZXW C;  4CS2 A;  3C23 A;  1ZET A;  1QR8 A;  1MQ3 A;  4Y2S A;  3RH5 A;  2Z0A A;  4X9Q A;  1J5E O;  3AU6 A;  4LFB B;  1URF A;  1US6 A;  3K57 A;  4FLX A;  5AM2 A;  1FPO A;  3TJT A;  4KMU A;  4PL1 A;  1SXE A;  5BMV A;  5T14 A;  3SV4 A;  1E1Q G;  4NLB A;  3Q8L A;  4LF4 B;  4X20 A;  2ZCE A;  1F44 A;  3WKA A;  3NRZ A;  1Z5W A;  3JYC A;  5B3S C;  2ZTE A;  4LF7 O;  3SR2 C;  4B3R B;  4KHP B;  2XID A;  1ZQN A;  2GSM B;  5L3B A;  5KFO A;  1RQL A;  3OSP A;  1ZTE A;  1KKC A;  4CC6 A;  2H3F A;  2ZUB A;  4MF2 A;  2ESE A;  3SPC A;  1TV9 A;  1R6N A;  4IHJ B;  5HHI A;  5J0Y A;  5ALK A;  4YCX A;  2C2A A;  2WF6 A;  4K35 A;  3RB3 A;  3EHB B;  1V9P A;  5DG7 A;  8ICV A;  1L8O A;  1EZV H;  2KSO B;  3M1Y A;  2IW5 A;  1L1F A;  3AQE A;  1IX9 A;  2KOB A;  4UQG A;  2AJQ A;  3BQT A;  2OCH A;  4JYB A;  3M9O B;  2YB4 A;  8ICB A;  2MA1 A;  2BPG A;  3L75 H;  2JIZ G;  1YDX A;  4ZOL A;  3PZP A;  1QQ5 A;  4FFB A;  4EEL A;  4BDP A;  2NYV A;  3TFR A;  1JAL A;  1NI3 A;  3E8H A;  5KHG A;  5C5J A;  3KFU F;  1K9M W;  2ZIU B;  4I2J A;  5KT6 A;  3KG2 A;  4J03 A;  3PSI A;  3WKE A;  4BUG A;  4JGS A;  4DO2 A;  1WCN A;  4RQF A;  3SPJ A;  1O9H A;  4QWE A;  5BXZ A;  2F4V O;  2IH3 C;  1SRY A;  5LXT A;  2XND G;  1SES A;  4HAM A;  5AK5 A;  3D36 A;  4EYI B;  2OHF A;  1MC8 A;  1SV0 C;  2W04 A;  3AG4 B;  5A0L A;  1FYJ A;  4UFZ A;  4EFB A;  1V54 B;  2WPD G;  1H2G A;  2FKX A;  3KKY A;  2HBL A;  2O6K A;  5IIK A;  3FX7 A;  3H40 A;  4GKK B;  3OTF A;  4TQR A;  1Q5O A;  1RYR A;  5H6Q A;  3KHG A;  3KBB A;  4UB4 A;  3G6B A;  4Y2X A;  3VQY A;  1YTF B;  2ALZ A;  2ZIW B;  3MR3 A;  4TQS A;  2EJ7 A;  4FS1 A;  3LSS A;  5KHI A;  4X5V A;  4PDM A;  2EJR A;  2P6R A;  4QZ8 A;  1D9F A;  4C4S A;  2UVR A;  5DQG A;  3G80 A;  4DUY O;  2BQ3 A;  8ICY A;  5IIO A;  4CH3 A;  4F50 A;  3N2K A;  1VQ5 V;  4MT8 A;  4QIW F;  4JB3 A;  2HOI A;  3RFA A;  2ZKO A;  2P4K A;  2E8P A;  3NAS A;  2BCV A;  3FKS G;  5AKJ A;  5DGA A;  2UUA O;  1PL0 A;  4Q8E A;  5EIB C;  2HHH B;  2HG5 C;  2EIN B;  3DTU B;  5ALR A;  1ZQH A;  3LWM A;  2DWQ A;  2FMS A;  2QWO B;  4MSW C;  5IYZ A;  3PJS K;  1BS3 A;  2F76 X;  4J41 A;  4R8U A;  1NU1 H;  2XVT A;  3OD4 A;  3PW7 A;  4TV9 B;  5AKG A;  1MN8 A;  5CB4 B;  3JAW B;  2PYL A;  3AG4 C;  2AH5 A;  3ASN B;  4Z1M G;  2PXI A;  2W6J G;  4NXN B;  4DSL A;  4TV9 A;  3JAK B;  3G6E V;  1V54 C;  4DSI A;  5CB4 A;  3JAW A;  2ZIV A;  1S76 D;  5CA3 A;  3SD7 A;  3RJE A;  4B9N A;  3JAK A;  1R6T A;  1HW7 A;  2BKE A;  1GH6 A;  2R9A A;  2ODG A;  4TV8 B;  1NI8 A;  2FDR A;  3WFV A;  3GIK A;  5KA6 A;  4JI7 B;  1R3L C;  2AGA A;  3HB3 B;  5IYD O;  1S3J A;  1K8A W;  5AM4 A;  1MAB G;  4IL6 Z;  5KFQ A;  1ARO P;  4DLG A;  4E2L A;  3PN1 A;  1WP8 A;  4DK1 A;  3MGH A;  4DXW A;  4PHD A;  5L3C A;  1ZUQ A;  4MVU A;  2LBO A;  4EZ6 A;  3RVY A;  5IIM A;  1N34 O;  1M4U A;  5AG2 A;  3ZDE A;  3FB6 C;  5KFE A;  1YF2 A;  4ECR A;  1FAF A;  2GV9 A;  1Q3E A;  3U0Z A;  2G38 A;  3CCE V;  3VCB A;  5KFN A;  4LF6 B;  3F2D A;  2NN4 A;  4UUJ C;  5AKI A;  4U7N A;  3RBD A;  3PX4 A;  3MR6 A;  4WBN A;  4ABM A;  4X62 O;  2LPE A;  4PI0 A;  2EIN C;  5F3X B;  4GKJ O;  5KL8 B;  4B3M B;  2Q67 A;  4FBU A;  1XSN A;  1PV0 A;  2KTQ A;  3ZD9 A;  5J0P A;  3ZMS A;  4I50 A;  1U49 A;  4J9O A;  3U11 A;  4CS4 A;  1L0L H;  2IJI A;  4JV5 B;  1K92 A;  4TSF G;  1XRE A;  2GO7 A;  1DOQ A;  2RRD A;  4MEY A;  5AKZ A;  2KIC A;  1K33 A;  3RW0 A;  3I76 A;  3WKB A;  4DOB A;  2LP7 A;  4ACO A;  2ZJA A;  3JAR A;  4OX9 O;  3S3X A;  2D3O W;  3AUO A;  4FLV A;  3FD9 A;  4I28 A;  2BSK B;  5EZY A;  4PL2 A;  4MS2 A;  5AI6 A;  4NLK A;  1ZQU A;  4P2H A;  2RNB A;  3ABK B;  3HKC A;  4O0I A;  5DG8 A;  4LF8 B;  4F4K A;  5JQG B;  4M9L A;  4JI4 O;  5BY1 A;  5EE9 A;  4BWA A;  2DUY A;  2DN9 A;  3W7S A;  4I0X B;  4RWU A;  5JQG A;  2M9N A;  1DGS A;  4FE3 A;  3BDP A;  5CBF A;  4JI1 O;  3AG2 B;  3C21 A;  3AK3 A;  1XWL A;  2QWN B;  4ED6 A;  2P6U A;  4RO2 A;  3DC5 A;  4KP4 A;  3V6J A;  3O9O A;  2W03 A;  5HFL A;  2P7T C;  1ZD5 A;  1AR5 A;  3T1H O;  4CF4 A;  5J0T A;  3K5O A;  3C90 A;  1A0P A;  3EPG A;  3FB5 C;  4BJQ A;  3SYA A;  3KHR A;  3BPZ A;  4NXZ A;  4DK0 A;  1A76 A;  2YY6 A;  4PA3 A;  4JI5 B;  4YD2 A;  1ENV A;  4FMT A;  5EOZ A;  4Y2P A;  2Z3Y A;  3ZI4 A;  4GX0 A;  1WPB A;  5EBM C;  5LMU B;  4YJ2 A;  3CC4 V;  5G5G A;  3F2B A;  1E1R G;  4FZ1 A;  3Q8S B;  4BR6 A;  2NO5 A;  5J2B A;  4ELV A;  4FFD A;  1GM7 A;  2VQF B;  5ALY A;  4B6J A;  2FLL A;  2OIE A;  4JI6 B;  2ZIN A;  2VIX A;  5KUK A;  1CPY A;  2AXT Z;  3ABU A;  1NH2 B;  4K3A A;  4GXJ A;  4F2R A;  3CS5 A;  3IJ4 A;  2LO1 A;  3ABK C;  4B9T A;  2GTS A;  5F9L A;  1ZQE A;  2ILM A;  8ICO A;  1Y88 A;  4N21 A;  3CYM A;  4YFK A;  3CB2 A;  3MDS A;  4EEK A;  2IJH A;  3J7A U;  3WK6 A;  5KFD A;  4J9Q A;  3TI0 A;  2GHY A;  3W7U A;  1KB9 F;  4NTW A;  4YY3 O;  1BMF G;  4MTX A;  5HML A;  3AG2 C;  1VQO V;  1VDV A;  5KFU A;  4DF4 A;  3JAS B;  2JV3 A;  2KKW A;  4HYK A;  4DR2 B;  1WNS A;  1S0M A;  3IFX A;  4K0K B;  1FFX B;  4LJX A;  1CI4 A;  4IR1 A;  1Z5V A;  3G71 V;  1A77 A;  2FML A;  4X65 O;  4B9M A;  2DF4 B;  3J81 j;  1MZF A;  1ZSP A;  3E35 A;  2LFR A;  1Z00 B;  4F71 A;  1WB7 A;  2F1J A;  1WA8 B;  1X2I A;  5TIS U;  4YXW G;  4IRC A;  2RHF A;  3H0L B;  3Q8Q B;  5B1A B;  1HWY A;  2YTU A;  1QCE A;  2NR5 A;  1RYU A;  2ZIX A;  1Z00 A;  1WA8 A;  2WLH A;  2VA8 A;  2IHN A;  4ZHQ A;  3AK2 A;  3H01 A;  1JN3 A;  3LNN A;  1QSY A;  4DV2 O;  4B3S B;  1ZRM A;  4TUY B;  3CCV V;  3APO A;  2KZZ A;  1JX4 A;  4IR9 A;  4PA6 A;  4J9Y B;  1T8E A;  4TUY A;  4EEY A;  3ETQ A;  4PGY A;  1NS1 A;  2W9C B;  4UAR A;  2YIB A;  1S0N A;  1N0J A;  3OJS A;  3KZI Z;  2UUC O;  4B3T O;  4DV4 B;  2IOF K;  4N23 A;  3HJE A;  2XAS A;  4P30 A;  3ASO B;  3I5D A;  3HPL C;  4LNU A;  3H0M B;  3WB1 A;  4O3R A;  2QM7 A;  2EIK B;  3SR6 A;  4QWC A;  3M9N B;  4ED1 A;  9ICI A;  3MR5 A;  1D5N A;  4MVQ A;  4F4Z A;  4MW8 A;  5BOL A;  1NR7 A;  5CA1 A;  2V9W A;  5EIB D;  1SIJ A;  3LDD A;  1I94 B;  1BHB A;  2LGW A;  3JPO A;  3BCC H;  4AQY B;  2ATL A;  4RUE A;  2LYB A;  9ICV A;  4JYA B;  5KFS A;  4YR0 A;  1XQ8 A;  4IQU A;  1VQM V;  1ZQC A;  1Y4M A;  3UCS C;  4MVZ A;  2BCU A;  4UV8 A;  5FPR A;  3ZMZ A;  1RYS A;  5KA5 A;  5E79 Z;  5AIA A;  3CE2 A;  5CWR A;  1N5W A;  3RJF A;  4K4H A;  1TUB A;  5B1A C;  2N04 A;  1YCI A;  2P5O A;  5KUM A;  4Q20 A;  3JPQ A;  1MA7 A;  2CTQ A;  1YTF D;  5IJ9 B;  1WWU A;  4IS7 A;  4DR7 B;  5F9N A;  3V6H A;  4NKG B;  2EAM A;  3ONN A;  2EZX A;  2RQ5 A;  5IJ9 A;  1T5E A;  2KK0 A;  3I56 V;  5K4L A;  5CR0 A;  3SI8 A;  1MZE A;  5DM6 V;  5GTI Z;  1L7P A;  3ASO C;  2AGQ A;  9ICE A;  3NVY A;  2JR5 A;  4RQ4 A;  1MSD A;  4I29 A;  3C2M A;  4ELT A;  1RPR A;  2EIK C;  3UM9 A;  2KIV A;  1ZD3 A;  4UAT A;  1LUV A;  3QU9 A;  3ABM B;  1VQP V;  2ZQM A;  1LNQ A;  3RB6 A;  1ROP A;  1YZ6 A;  5D5P A;  5B1B B;  2F95 B;  8ICJ A;  3QNM A;  1JR9 A;  3OMN B;  4O3M A;  3WKD A;  3RYI A;  1G8M A;  1L0N H;  1P7B A;  4BIZ A;  4WFA V;  3NVW A;  1KU9 A;  3HKB A;  3EUB 2;  4ICA A;  7ICK A;  4DRX B;  3GV7 B;  3P32 A;  3AM9 A;  4EX7 A;  5ALH A;  5ALE A;  4P0P B;  4RAI A;  5BR8 O;  1T7P A;  4NM2 A;  3TAP A;  1BPE A;  4PDV A;  2W3R A;  3DEE A;  4P0P A;  4B7K A;  2IM9 A;  4DFM A;  3Q8K A;  2XAF A;  3NR7 A;  4GCZ A;  3SZ2 A;  1YHQ V;  1MMM A;  2DGZ A;  2JH7 A;  8ICA A;  4I2C A;  1NBM G;  3B2E E;  2W9B A;  1XC9 A;  1SXD A;  3N28 A;  4QZ9 A;  3MHH C;  2H3I A;  2AHY A;  5EK0 A;  5KFX A;  4W4L A;  1U47 A;  3L3F X;  3FFQ A;  4DV1 O;  4DR1 O;  3E22 A;  5III A;  4TQF A;  1IXR A;  4UV9 A;  3MDC A;  2GH1 A;  1JRP A;  7ICI A;  4UBC A;  2CTW A;  4R8C A;  2ZG6 A;  3C1Z A;  5G5H A;  4JV2 A;  4JI5 O;  3BQ0 A;  4LBE C;  4I5S A;  4NLZ A;  5AKL A;  7ICP A;  4IC9 A;  8ICE A;  9ICA A;  4YIP A;  3HKD B;  2JEF A;  4DR4 B;  3BJY A;  4YHH O;  3ABM C;  1XMO O;  1S5H C;  3M99 B;  4FLZ A;  2E3C A;  5J0U A;  2UXD O;  3OHA A;  1BPD A;  2HBJ A;  5B1B C;  3AEI A;  3GWK C;  2QB1 A;  3HP6 A;  3CMA V;  1B04 A;  3CCQ V;  2VAN A;  5JRT A;  3HPO A;  4O3P A;  9ICT A;  1KC8 W;  4O4J A;  2OTJ V;  2KMD A;  1QSL A;  2OWO A;  4ECW A;  2BCR A;  2XI9 A;  4JK1 A;  2XGQ A;  1BT8 A;  1SQF A;  5C93 A;  5CP2 A;  4JUZ A;  1ECW A;  1UT8 A;  4C7Y A;  4J10 A;  4J7K A;  5J2K A;  4EZ9 A;  1H2M A;  4Y2R A;  2K1E A;  3RT3 C;  4X66 O;  1JA8 A;  5LYJ A;  4NR1 A;  1TAQ A;  2BOC C;  5J0R A;  2ZXI A;  1COW G;  1KTQ A;  4MFF A;  1X6J A;  2W6I G;  2ZT9 B;  4LFA B;  4YJ3 B;  5KNI A;  3T1Y B;  4FIP C;  3OSN A;  4WFB V;  1UHU A;  2PTM A;  2E3T A;  4WFG A;  1ZD2 P;  1YT3 A;  4JI0 O;  4JTC B;  4ZBM A;  2JRZ A;  5J2U B;  1N32 B;  5J2F A;  4AP9 A;  3F5A A;  5J2U A;  2BHN A;  1XO0 A;  1Q3V A;  2IMW P;  4C7Z A;  1DK3 A;  4P0Q A;  2A79 B;  3OR6 C;  3ISD A;  3DGE A;  3SPG A;  4MTF A;  1NJI W;  4NXM O;  4UB5 A;  4DUZ O;  4RNN A;  3JPS A;  3QZ8 A;  3UQ0 A;  4UB3 A;  1K5Q A;  2B9Z A;  4OXS A;  4OJ5 A;  4DV6 O;  3W7W A;  1T3Q A;  3H4B A;  2EIL B;  2B21 A;  2E5L B;  2ARH A;  2KJ5 A;  5EBL C;  8ICR A;  2X0L A;  4NVP A;  3ICX A;  2ZM6 B;  8ICZ A;  4F4W A;  4M9N A;  2I1Q A;  3CRR A;  2LFS A;  1U48 A;  4M2Y A;  4EB6 B;  5IWA B;  1S97 A;  2V7Q G;  2IA6 A;  5JVD B;  1BHA A;  3UO3 A;  3OHB A;  3BVO A;  4HNA B;  1N48 A;  4DV5 B;  2KEY A;  4QJF B;  2XY5 A;  4O4I A;  1JI7 A;  3T4D A;  3B40 A;  2WF5 A;  4HNA A;  1M56 B;  1OCZ B;  5LP6 B;  2ZE6 A;  3OE7 G;  2RQ6 A;  1RZT A;  1SA0 A;  3ZMU A;  1N36 O;  2JK5 C;  3ISC A;  9ICR A;  4B9V A;  1I08 A;  1NH2 D;  3IP4 B;  1Q81 W;  1XS9 D;  5KFL A;  2A7W A;  4Y2Q A;  4F6R B;  4JYY A;  1COO A;  2XAJ A;  4RUF A;  5KFI A;  4NTX A;  3ISB A;  4MVR A;  3NRW A;  1VEW A;  3CJH B;  4F6R A;  1L3V A;  5D5Q A;  3M6Z A;  3FAV B;  3M7D A;  1XO1 A;  4M47 A;  2HOQ A;  4CF5 A;  2H5X A;  2W8L A;  4O3N A;  1KEJ A;  2A19 A;  2ZR3 A;  3D3I A;  4DR6 O;  3SYC A;  1FJG B;  4US9 A;  2HHU A;  3TFS A;  7ICL A;  3CHX A;  2BCS A;  2F93 B;  1NOM A;  3TCU A;  2J6T A;  3CRA A;  5AIC A;  8ICP A;  1COK A;  1HNX B;  4CBC A;  1SWV A;  3BS5 B;  1AB3 A;  3R9K A;  4JI8 B;  4B9L A;  4J9S A;  4UAS A;  2EIL C;  5AI4 A;  2HJD A;  4PA7 A;  3BZK A;  1U4B A;  3BS5 A;  1BCC H;  4Z6D A;  1WJZ A;  3M7M X;  1K3E A;  4C0Z A;  3BQ7 A;  3RRG A;  4G3I A;  1Q8I A;  2P66 A;  1JJ2 U;  2YEV B;  4J7Z A;  5DEC A;  1GN4 A;  1ZQX A;  5ALD A;  3EPI A;  4LWS B;  4ED3 A;  3RYH B;  3PML A;  2RJZ A;  4ECT A;  1M56 C;  1OCZ C;  4LWS A;  2QWQ B;  5LP6 C;  2XHB A;  3WG7 B;  1SQQ H;  1I7F A;  2IJJ A;  4KLT A;  1D5A A;  1JMK C;  3AK1 A;  4K4G A;  1NK4 A;  2QB0 B;  4B08 A;  3SJA C;  2ZR2 A;  2HHT A;  4ED0 A;  2QB0 A;  3PY8 A;  4LF9 B;  3L74 H;  2DQ0 A;  3RAX A;  5FL7 G;  1PNM A;  4QE7 A;  5IIJ A;  3UKM A;  1A6S A;  4U3J A;  1PZN A;  4LFB O;  4Z2W A;  5CB1 A;  3CPW U;  5LGN A;  2CK3 G;  3QO7 A;  4KL1 A;  3RN4 A;  4QGP A;  2EUL A;  2W11 A;  3RF9 A;  5JJJ B;  4DL2 A;  4IGG A;  4EX6 A;  5LL6 Y;  1H2K A;  1X9M A;  3UMB A;  3ZHU A;  3UXO A;  4Q6G A;  1IBL B;  2HP8 A;  5BMV B;  4WFE A;  3K79 A;  4ZI7 A;  1SZH A;  2YQE A;  5ALS A;  2R8H A;  3J81 N;  4PHE A;  4X20 B;  5L1M A;  1KKX A;  2G0A A;  2Q4T A;  4UCS A;  4KLE A;  4GIB A;  2UVV A;  1GO3 F;  5KFB A;  3FAH A;  3QTC A;  2ZUC A;  2QTO A;  4DV3 B;  2CH7 A;  1N4C A;  2DQ3 A;  1W0J G;  5CRX A;  5J2C A;  2F1M A;  1YIJ V;  2UU9 B;  4WCE V;  2ETN A;  4MTG A;  2PFQ A;  4UAV A;  3C2K A;  3L70 H;  7ICO A;  3C5G A;  4I2E A;  2KB1 A;  3WG7 C;  4JI2 O;  7ICS A;  5D46 A;  4RQ0 A;  2XUM A;  3QO5 A;  4TUQ A;  5C8Y B;  2AQ0 A;  5L3F A;  3NTU A;  4DV0 O;  5JH7 A;  4OPA A;  9ICM A;  1ZQD A;  9ICS A;  1K4D C;  5C8Y A;  3CSX A;  5DLF A;  1ZQA A;  2W0F C;  4ELU A;  3B9J A;  4IQT A;  4LZD A;  2ITC C;  1QLN A;  4NLC A;  1X9X A;  2J6U A;  4JAU A;  4JI3 O;  1F7Y A;  3IHQ B;  2FL4 A;  1K4C C;  2P22 C;  2YIC A;  1L6N A;  4QZI A;  4ZOL B;  4FFB B;  1ZJN A;  3HW8 A;  1XNS A;  9ICO A;  1EZJ A;  2AXT U;  2IOF A;  3RR8 A;  3BRC A;  5DBC A;  4LF7 B;  3FYI B;  1ZX3 A;  2FI1 A;  4OD0 A;  1AI5 A;  4IIJ A;  1PK3 A;  3W7T A;  3K3W A;  5KG3 A;  3FB8 C;  1N61 A;  1RG6 A;  4RT3 A;  1JPX A;  2FE9 A;  3LDA A;  5JU5 A;  1U45 A;  1MG1 A;  2B1I A;  2N74 A;  8ICH A;  3CRX A;  1NJY A;  1FXV A;  3E8F A;  5LXT B;  4U7O A;  4WF9 V;  3GFK B;  4RNM A;  2DPJ A;  2KFZ A;  2DBY A;  4O4H B;  3PMN A;  2VRZ A;  4UB1 A;  1AJQ A;  4NLG A;  1YIT V;  1SGG A;  4J9R A;  4KLL A;  4E4E A;  4O4H A;  5J2I A;  1W0K G;  1J97 A;  4BW5 A;  4O2B A;  4I2G A;  4I4T B;  4KLU A;  3RH4 A;  5KFW A;  4F5P A;  4DCC A;  4XBF A;  4GYC B;  5ALO A;  1FXK B;  2QR4 A;  9ICU A;  1P4R A;  4I4T A;  4OPH A;  4Z1V A;  3BAA A;  1YJN V;  4MHV A;  4PPX A;  1EN6 A;  1U9L A;  3MGI A;  1FXK A;  2P90 A;  2BTQ A;  2Q8V A;  3K1R B;  4X8A A;  3ZMT A;  2R18 A;  3HWT A;  1Y74 A;  4Y2T A;  2R8K A;  4OGQ B;  1J95 A;  3SEN A;  1XNR B;  5EWE A;  5KHH A;  3E8G A;  4FM0 A;  4EKW A;  2JGA A;  3G4S V;  1H38 A;  5AM5 A;  3KZI U;  3N2K B;  4Y2J A;  4X1I B;  5GTH U;  4K4I A;  1GTO A;  3PW5 A;  7ICJ A;  5ITZ B;  5DKW A;  4DO9 A;  1NKC A;  4YMN A;  4FLU A;  4J7J A;  5A9G A;  4X1I A;  1NJZ A;  3K75 D;  5ITZ A;  4YMM A;  1NZ6 A;  2YXH A;  2QGN A;  1PPJ H;  5J29 A;  5IYZ B;  3GV8 B;  5FPO A;  4R8U B;  4I55 B;  2EQY A;  3ZDB A;  5KX5 A;  2HVJ C;  3QXG A;  3D36 C;  4BIU A;  1KRP A;  3CME V;  4I55 A;  4G28 B;  5C0Y A;  2A3Q A;  3PW2 A;  2HFE C;  1X6I A;  4F92 B;  2OCE A;  2XCA A;  2PFO A;  2UVW A;  1BVS A;  2HR3 A;  3H8W A;  2MW2 B;  2HCF A;  2ZIV B;  4US8 A;  4QE9 A;  4GXK A;  5K1P A;  8ICU A;  1L8L A;  4FO6 A;  5BZB A;  2CTR A;  1JXL A;  2GWS A;  4Y2U A;  1FXK C;  1P49 A;  5E79 U;  4UCR A;  4DUY B;  2A3V A;  7ICG A;  1XL6 A;  1S0O A;  1S72 V;  3QE9 Y;  3JD2 A;  3ZCC A;  1IBK O;  1PD3 A;  4P9O A;  5CBH A;  1JXE A;  3MGV A;  2DYR B;  3CXH F;  2HHX A;  3DDH A;  4MVO A;  3T3F A;  1B06 A;  4QWB A;  4R63 A;  1ZQ1 C;  2EZO A;  2UUA B;  4LFC O;  2FLN A;  3ZHQ A;  4YIO A;  4KLO A;  1IIP A;  3CWB H;  2EIM B;  1IXB A;  3UQ8 A;  1QBZ A;  5DQI A;  1XSP A;  2JJ1 G;  2G07 A;  3NXS A;  1QQ7 A;  2C2R A;  3RR7 A;  4ECV A;  2Y0S C;  2OEH A;  5GTI U;  1NKB A;  2W54 A;  4TT3 G;  2HHQ A;  1K1S A;  2XAH A;  3B8M A;  4HZ3 A;  5J8Y A;  2JEU A;  4AHC A;  4KIT B;  1ZQY A;  3QU7 A;  1T3N A;  4TOI A;  4U3F H;  1NZB A;  4WBN B;  5JWP A;  5ALJ A;  5CHG A;  3P30 A;  1K34 A;  1PNL A;  2R8J A;  1N63 A;  2HSZ A;  9ICW A;  2UXC O;  2Z7J A;  1H2N A;  1H8H G;  2UXX A;  4JV5 O;  1TVK B;  1L3U A;  5KG4 A;  1SZX A;  4FPP A;  2I6X A;  4I50 B;  2OXO A;  4GX2 A;  2DW4 A;  3TXS A;  1RM1 B;  2X6C A;  5IJ0 B;  1TVK A;  5AM1 A;  5DBB A;  3A0H Z;  4YN4 A;  3RAQ A;  4H13 B;  3U10 A;  1VP7 A;  5IJ0 A;  4ECQ A;  3K4G A;  4EBE A;  3F2C A;  5LA6 A;  3VOU A;  1QTM A;  2WF8 A;  3QEB Z;  1N34 B;  5L3E A;  8ICG A;  3JAR B;  2WAQ C;  2BE3 A;  2NRW A;  1FD9 A;  4DV7 O;  2JEX A;  1HP8 A;  5EZY B;  5L3D A;  2O57 A;  2DYR C;  3HKC B;  5AIB A;  2VA3 A;  5IIN A;  4H0L B;  4YG2 A;  1SB3 C;  4Q8F A;  3A0R A;  3STL C;  3UMG A;  4C8O A;  1KFT A;  4I9W A;  2LM4 A;  3RJG A;  5B66 U;  3TXQ A;  2EIM C;  4M0A A;  5B5E Z;  4GKJ B;  2I9G A;  1AR1 B;  3MHS C;  5J8Y C;  1ZOL A;  3ZS8 C;  4F4X A;  2YUA A;  5KLV H;  4DLE A;  1JVM A;  2IBZ H;  2CXY A;  4DOA A;  1NTZ H;  2BCC H;  5IE9 A;  4XDK A;  1AI7 A;  2K8B B;  1ZYQ A;  4RZR A;  3ZN1 A;  2A1J B;  4KUM A;  2R8G A;  4ZIB A;  1ZQL A;  4F4L A;  3CEI A;  2A1J A;  4ED8 A;  4DWI A;  3WK8 A;  2AHZ A;  9ICG A;  3RFR A;  1FFV A;  2JEI A;  1TK5 A;  3RTV A;  4CH5 A;  1R3J C;  1BPB A;  2Q69 A;  2M7W A;  2CN1 A;  3D2S A;  3FYH A;  4I2F A;  3CYO A;  1C7Y A;  2G06 A;  5EE1 A;  2KZM A;  2QKC A;  4JAS A;  1RM1 C;  5KFT A;  3B8N A;  1TFR A;  4QZE A;  5KAI U;  4RUC A;  1PVP A;  4RPX A;  3ZRS A;  5BOM A;  5D49 A;  5L9X A;  3OGI B;  4YJ2 B;  1Q90 D;  3S6J A;  1QQC A;  4JI6 O;  1ZQZ A;  1FIQ A;  4JI4 B;  2RDI A;  3G6X A;  3RVZ A;  2P35 A;  8ICM A;  2HVK C;  3TK1 A;  1WYG A;  4MF8 A;  2JS3 A;  4JI1 B;  4UB6 U;  2D3D A;  3ZBH A;  2VJ4 A;  5LHG A;  4I2H A;  1NKE A;  1D8L A;  4Y2Y A;  2P67 A;  3T79 A;  2G08 A;  2DWD C;  1QH9 A;  1NT2 B;  3DXR B;  3T1H B;  1CRX A;  9ICL A;  1JCH A;  3LDC A;  1H2L A;  2B0C A;  4B9S A;  3C3T A;  3DXR A;  5ALF A;  3B09 A;  2KKV A;  2ZNI A;  1N62 A;  3M8A A;  3PSF A;  5KT3 A;  3ZIA G;  5LGU A;  2PMZ F;  2E1E A;  2LYH A;  9ICC A;  3N7R C;  4GLX A;  3D3Q A;  3VQW A;  4KMO B;  4PZN A;  3AEV A;  1TK0 A;  5LHH A;  8ICQ A;  4HAI A;  3W7X A;  2Q68 A;  1K5O A;  1NJX A;  1GN6 A;  2GLE A;  3HKE A;  3EZ5 A;  1BZK A;  1SQB H;  2AU0 A;  3IV6 A;  5KG2 A;  2ZDI A;  4NY8 A;  4QIW C;  1HNZ O;  3ABT A;  1ZL8 A;  2VKQ A;  4KLI A;  3ZHS A;  1VQ9 V;  3PO5 A;  2ZIX B;  2CTP A;  2Q7G A;  2FPK A;  3H1J H;  5GON A;  4ZHQ B;  4RQ3 A;  3H7I A;  1Q7Y W;  3GIJ A;  5JUM A;  4UVB A;  2W8K A;  3QUT A;  2C22 A;  2K89 A;  1W59 A;  2JRI A;  4AIL C;  4YMO A;  1ZWI C;  3DV9 A;  4NJ8 A;  4MTO A;  4C7U A;  4RQE A;  1YJW V;  1Z4N A;  2Q7E A;  1N33 O;  3HIL A;  4ECU A;  4YY3 B;  2PZS A;  3E2E A;  1NK5 A;  4FZM A;  1S9F A;  1P84 F;  4JV1 A;  4LNU B;  5GTH Z;  5F2V O;  2RDJ A;  5ALL A;  1H2S B;  1KSP A;  4R6Z A;  3RRH A;  4YR3 A;  3JAL B;  4I2B A;  3ML0 A;  4CC5 A;  1I94 O;  4O9M A;  1CP9 A;  3K06 A;  5CA1 B;  2HEP A;  3QG5 A;  3ZD8 A;  3O0F A;  4M9H A;  8ICN A;  1LR1 A;  1Q82 W;  4LF5 O;  1NK7 A;  2NRT A;  3JAL A;  2H3Z A;  2K4H A;  1NZP A;  2F3N A;  4X65 B;  3L5K A;  4JYA O;  3F5E A;  2OCC B;  2Z5U A;  4LC1 A;  3Q8M A;  3OM3 B;  3H1K H;  4J9P A;  3R65 A;  4YXM A;  4QWA A;  2KQX A;  4BWM A;  4RQN A;  2EIJ B;  1KLN A;  4ED7 A;  3ZDA A;  4RUA A;  2ZDI C;  1BPZ A;  2KHV A;  4DQS A;  2XAQ A;  2KD1 A;  3WK5 A;  3F5T A;  4J11 A;  4L87 A;  4XUS A;  5A2Q N;  1KKD A;  2MRL A;  1OCR B;  3ETL A;  5KFK A;  3SYP A;  2UUC B;  2WF7 A;  1TUB B;  5ALI A;  3ZRX A;  1HIW A;  4B3T B;  1Q6U A;  4UB8 Z;  3F53 A;  5AI9 A;  5KG0 A;  2AGP A;  2QEX V;  2C28 A;  1R3I C;  3K5L A;  1OW5 A;  2MUT A;  1NJW A;  2JMG A;  2EAP A;  1XBL A;  4M6W B;  3EXA A;  4UCT A;  2DFL A;  4DQI A;  3M8S A;  4M6W A;  3ETD A;  7ICQ A;  5KHJ A;  2CAZ C;  2FTK A;  1QSS A;  4FM2 A;  5J2T A;  2QTS A;  4FFK A;  1VQ8 V;  2PUS A;  1GAX A;  2CGN A;  2XTA A;  7ICN A;  5H6R A;  1K7D A;  5DB6 A;  2IH1 C;  2OCC C;  3TAR A;  1UPG A;  5KFH A;  3RYI B;  5J2J A;  4R66 A;  2WB1 C;  3QYP A;  4FS2 A;  1VF7 A;  1P7D A;  4ICG A;  3C28 A;  3HKB B;  3OEH G;  1ED1 A;  4FLW A;  2ZE8 A;  2EZY A;  1NVP B;  9ICX A;  5J9P C;  4C8M A;  3UQ2 A;  1PVQ A;  2EIJ C;  4DFJ A;  1JFF B;  1M93 A;  1U96 A;  3E0F A;  4NB5 A;  4BW9 A;  3SDL A;  3BY6 A;  1IG6 A;  2JZB B;  1OCR C;  3HT3 A;  1HNW O;  1JFF A;  2JDI G;  4FM1 A;  2W9B B;  1WAZ A;  1S5L U;  2JZB A;  8ICI A;  4JTD B;  3ZHT A;  1WWV A;  4GX1 A;  3ZJZ A;  2KZ3 A;  2K4P A;  3E22 B;  4RU9 A;  4A8E A;  3D8C A;  3QU5 A;  7ICM A;  4ZOH C;  2D6F C;  1L3T A;  4LZG A;  2X6B A;  1R73 A;  3A0B U;  4XQ8 A;  1IM4 A;  4C4T A;  2ZUD A;  5B66 Z;  3NUQ A;  1K5S A;  2R8I A;  4DR3 O;  4LCU C;  3HRD D;  1VQ6 V;  1BQ0 A;  1M6Y A;  1XU4 A;  5ALN A;  1Z19 A;  1XHX A;  5KAF Z;  3KOO A;  3N2G A;  3IG5 A;  2Q7H A;  3EW9 A;  2ASL A;  4DFP A;  4LVS A;  3RYF B;  3BFR A;  2Q0O C;  3K9A A;  4EEN A;  4R50 A;  5BR8 B;  3RYF A;  1X40 A;  1FXH A;  3LK9 A;  2YC0 A;  1L7M A;  3RB4 A;  5EE3 A;  4ZH4 A;  5KFV A;  2RDC A;  3I28 A;  4O4J B;  4KLS A;  3QUQ A;  3SYO A;  1FS0 G;  5J0X A;  1YVW A;  4F93 B;  2B5U A;  1XL4 A;  9ICQ A;  5ALX A;  4QPJ A;  2W9A A;  5CBG A;  3OFN G;  5KAI Z;  2IOH A;  1ZRN A;  3SAF A;  3ZDC A;  1URJ A;  3DC6 A;  4J9K A;  3BA9 A;  5BPC A;  5AK4 A;  4EEQ A;  1AP5 A;  3ZX6 A;  5LYJ B;  1LKY B;  1N5X A;  2DPI A;  1OHH G;  5EYP B;  3T1Y O;  4AYB C;  2ES6 A;  4PHP A;  3AMZ A;  1LKY A;  4I2I A;  4U7C A;  1X4T A;  2ADQ B;  4GUN A;  3QNE A;  4W4K A;  5EYP A;  1HR0 O;  4UB6 Z;  1VJ5 A;  3QU4 A;  1GMG A;  4C8L A;  1FFT B;  5EWG A;  2RCV A;  3OTQ A;  3A2F A;  4QWD A;  1XMO B;  5HMM A;  1FEZ A;  4JWN A;  3QU2 A;  2GTA A;  2KG7 A;  4IYI A;  1WCL A;  2UXD B;  4IT5 A;  5DGB A;  1X9S A;  1GM9 A;  1M5I A;  3X2Q B;  2DJV A;  5JTI A;  2VQE O;  1ZQB A;  2ISP A;  2V4Q A;  2C2E A;  2DWE C;  4X64 O;  2UUB O;  1VF6 A;  4RNO A;  4P0Q B;  1IUR A;  1NKD A;  2R70 A;  1B6Q A;  2AW9 A;  3V7L A;  1D8Y A;  1XNQ O;  1F4M A;  4Q43 A;  3ZMV A;  4AI8 A;  1DRG A;  1M1K W;  2H8P C;  2WA4 A;  3IDW A;  3PR5 B;  4PV1 B;  1XMQ O;  2UXB O;  1DGJ A;  4I9Q A;  4F4Y A;  2Y1J A;  1AR4 A;  1R1B A;  2B1G A;  4ASU G;  1ZJM A;  4IRK A;  2D2C B;  1VQK V;  1TAU A;  4XRH A;  9ICN A;  5AKH A;  3ZDD A;  5HFM A;  4UW9 A;  3LNM B;  1SQX H;  4JI0 B;  2Q5Z A;  5KT2 A;  1KUQ A;  5LMN O;  1PNK A;  3SEI A;  4O4I B;  3KTQ A;  3EFF K;  2L5Y A;  1BGY H;  2EH9 A;  1XEQ A;  2BPF A;  5J0O A;  2YI9 A;  4C8K A;  3ABL B;  1SA0 B;  3V6K A;  1X66 A;  4PHA A;  5L1K A;  5EWF A;  3HR0 A;  3FM9 A;  3K0D A;  3PNC A;  2BCQ A;  4B9U A;  4NXM B;  5IIL A;  2YB1 A;  2LM1 A;  5KFY A;  2G5H B;  4DQP A;  4QPK A;  3IRU A;  4JZG A;  4NTY A;  3I55 V;  3GIM A;  5ALM A;  3VBB A;  4DV6 B;  1VF6 C;  3MAB A;  2XY6 A;  5AKY A;  4MVS A;  3X2Q C;  1V85 A;  1B43 A;  3F7V C;  1OJH A;  2LJ2 A;  1ZQP A;  4NWI A;  2H3O A;  1TKD A;  1LUW A;  1I0H A;  2PYJ A;  1AIL A;  3EVK A;  3HKZ C;  5H5N A;  5DLG A;  2OIG A;  3JD1 A;  1LVH A;  4J9N A;  1TVA A;  4KLF A;  5AM3 A;  2BDU A;  3QEA Z;  1QR9 A;  1QVF U;  3BS7 A;  3CCU V;  2ZXH A;  3AG7 A;  1ZQG A;  2LI6 A;  4J9M A;  3WKC A;  5CMU A;  4CH4 A;  3QO8 A;  1IBM O;  3LSQ A;  1YEW A;  4JAA A;  2HOF A;  3VC8 A;  4M04 A;  1A32 A;  3LWL A;  5KL1 B;  5B1N A;  1N36 B;  2F1H A;  4OCZ A;  3BQ1 A;  1QNM A;  2BR0 A;  2JJ2 G;  8ICW A;  2QAR A;  4UAY A;  4DR5 B;  3CCM V;  3OTO O;  3AL0 B;  1PUZ A;  4EBC A;  4D7S A;  2YIB D;  1JOY A;  3APQ A;  2DL0 A;  3PX6 A;  3ABL C;  2EX3 A;  4NYK A;  4QNH B;  2WLL A;  1U97 A;  4DR6 B;  1GN2 A;  2FYU H;  1DF4 A;  2DMX A;  2MAX A;  3JPN A;  9ICP A;  2WHE A;  3U26 A;  5IY5 B;  5J0S A;  3CRM A;  1WUD A;  4FLT A;  2F77 X;  2BZF A;  1EN5 A;  1D8B A;  1TGO A;  2RMK B;  3A0H U;  3E83 A;  3TAD A;  2A9H A;  8ICL A;  4PZO A;  3CCL V;  5AM0 A;  1YI2 V;  2F1I A;  2ZIO A;  2WFA A;  4O5K A;  4U3J B;  2W7P A;  2Y9U A;  3CW2 C;  3JPR A;  2KE7 A;  2EBO A;  1OUQ A;  5D4B A;  2WLI A;  2Q0Z X;  5E1A C;  4CE6 A;  2Y9T A;  3OPX A;  3WK9 A;  4J9Z B;  3JAM N;  4O3Q A;  4O4L B;  2IBK A;  3T5L A;  5KFA A;  2CRX A;  1WB8 A;  4ZI7 B;  5AI8 A;  5B5E U;  2GBO A;  4O4L A;  2Y0S F;  4LF4 O;  4UAW A;  4ECY A;  4G27 B;  1EXN A;  2R9I A;  3WK7 A;  5IYB O;  2F44 A;  5KFC A;  3VQX A;  4DQQ A;  1RFY A;  3GWO A;  1UCV A;  3RJH A;  4C8N A;  1BPX A;  1S5L Z;  1AQ6 A;  3KHL A;  2UU9 O;  4B3R O;  2CH7 B;  4KHP O;  2E76 B;  3H4D A;  2KFN A;  2WLK A;  3KHH A;  1XOU A;  4R64 A;  3MFI A;  5ALT A;  1AP6 A;  4OJL A;  4PD4 F;  1KMI Z;  2N05 A;  3A0B Z;  3ED5 A;  2LKY A;  3IC7 A;  3J80 N;  2EAO A;  3V72 A;  3OW2 U;  2JGD B;  3SYQ A;  1ORQ C;  4UCO A;  1T94 A;  2DKX A;  3TAD C;  3TGU H;  1BNO A;  4J42 A;  5IY5 C;  5JH7 B;  2YSU B;  1D2D A;  1KQQ A;  1J5E B;  3RJK A;  1G4Y B;  2JGD A;  4BIO A;  2E75 B;  4PDR A;  5J0W A;  3B0X A;  4O3O A;  4B7E A;  5K1X A;  1C20 A;  4G9B A;  2VA2 A;  3GVM A;  2W9M A;  2JS5 A;  3MBY A;  4QNL A;  4RT2 A;  2HJF C;  3E8B A;  4JYC A;  2WA3 A;  5FNV B;  3MAQ A;  2WAQ F;  3D2N A;  2Q6A A;  4NL9 A;  5LBQ A;  4UB2 A;  3QUC A;  1Z2G A;  5FNV A;  4DSJ A;  1SET A;  5J2G A;  4GC7 A;  2PI5 A;  4BWJ A;  3O65 A;  1JMS A;  4H33 A;  4CDG A;  2WWW A;  3S3W A;  2Q73 A;  2W3S A;  5DN6 G;  2KIW A;  1SV0 A;  4CF3 A;  4IIJ B;  1Q86 W;  1SL2 A;  3C3S A;  1WP7 A;  3OJU A;  1NVP D;  4X88 A;  1IZ3 A;  4C4R A;  1G6U A;  1K73 W;  4OJO A;  2XO7 A;  5FP0 A;  1M9N A;  7ICE A;  5AK3 A;  2VS0 A;  3ZN0 A;  1BQZ A;  3T1C A;  1SKS A;  4HYO A;  4UCV A;  3SV3 A;  2KNJ A;  2A06 H;  2NRV A;  2H94 A;  4IHJ A;  1TAE A;  4IYH A;  3SAG A;  2NRZ A;  1E79 G;  4JI2 B;  4YVZ A;  3H8S A;  1S77 D;  2YMM A;  4ECS A;  3N4M B;  2KSO A;  3CX5 F;  1I5Y A;  1HEK A;  2K4E A;  4DV0 B;  4MEX A;  1QQ6 A;  4O2B B;  1ZQW A;  1M90 W;  2JEJ A;  4O5E A;  4GKK O;  2NO4 A;  3OGU A;  3NGD A;  4JAV A;  5AK6 A;  1Q3U A;  3D6J A;  1RDF A;  3SMV A;  7ICU A;  2DQN B;  3OR7 C;  4JI3 B;  4F5R A;  2M6Y A;  3GDX A;  1BE3 H;  3P3P A;  1NQT A;  3OAA G;  2L35 A;  2WLM A;  5L3G A;  2BTQ B;  2F8L A;  4EBD A;  3IAY A;  1XNR O;  1RM6 C;  3B77 A;  3I1Y A;  1VAR A;  1Y74 B;  4MFA A;  2AGO A;  2Q4P A;  2FJ6 A;  1X9W A;  1QCK A;  2ZIU A;  1QHT A;  1RPO A;  3L9D A;  5CA0 B;  3RYC B;  2KJ9 A;  4NL9 C;  2D8C A;  4CCH A;  9ICJ A;  5CA0 A;  3LUT B;  2QE7 G;  3IGA C;  3L71 H;  3RYC A;  3CRC A;  1WN7 A;  2N1R A;  3PV8 A;  2QDO A;  4A5U B;  4WFF A;  5HR7 A;  4GC6 A;  2XCP A;  2F4V B;  2PKE A;  4R65 A;  3N27 A;  1VF5 B;  3Q4H B;  4E0D A;  2ZD9 A;  4PGQ A;  2HHH O;  2DE0 X;  5KFR A;  1SZT A;  4Y2V A;  1L7N A;  3Q4H A;  1TA8 A;  5KTQ A;  5J0Q A;  2EAN A;  4CZZ A;  4P2Z A;  2ZTD A;  4Z6C A;  2K8C B;  1IXM A;  1UPH A;  5KX5 B;  1Z4O A;  1H8E G;  1SZP A;  1XUQ A;  1SS3 A;  1NNL A;  1O9G A;  4NXN O;  1NTK H;  1X59 A;  2ZIW A;  2ASD A;  3KCX A;  4LH7 A;  2ADP A;  1L8D A;  1ZQK A;  2NNU A;  1SWW A;  1F0M A;  1NK8 A;  5TZV A;  1XSL A;  5DQH A;  1DF5 A;  3ORY A;  3M9M B;  1W2B U;  3H8M A;  4WJ3 B;  4GFJ A;  4MFC A;  4KLM A;  4Z6E A;  8ICS A;  2K9P A;  4JI7 O;  2V1D A;  3K03 A;  3AG1 B;  3JCU Z;  8ICT A;  3AU2 A;  1VIB A;  2E1F A;  3WB2 A;  1UA0 A;  1ZQT A;  1K1Q A;  4TUP A;  4UB8 U;  3L73 H;  9ICF A;  2AZ2 A;  2HLD G;  3JD3 A;  4K8X A;  2JHD A;  4I27 A;  1UQV A;  3RWR D;  5KG5 A;  1ZQO A;  3BEH A;  4DFD A;  5HHH A;  4LH6 A;  5ALZ A;  4DEZ A;  2YIA A;  2RN9 A;  4G2K A;  1GM8 A;  5KT7 A;  8ICC A;  3K04 A;  2KN7 A;  4LF6 O;  5KT5 A;  4XDL A;  4RQ6 A;  3G6V A;  5GW7 A;  4UAZ A;  4X1K B;  2ZIM A;  1T4G A;  2X6A A;  1B0X A;  4B3M O;  4X1K A;  3LYS A;  3BZC A;  3FC4 A;  3NS1 A;  5H2F U;  3FDS A;  5J2A A;  4TV8 A;  3AG3 B;  3RJJ A;  4JZ2 A;  2X7R B;  1Q46 A;  4GX5 A;  2LW1 A;  3CXC U;  1ZQQ A;  3N7P D;  3GII A;  4DW0 A;  1IBK B;  1F23 A;  3OMI B;  2M0N A;  2HVH A;  4JMU A;  1KL9 A;  5L1J A;  1NTM H;  5JJE B;  2KG5 A;  1L3S A;  4OO1 J;  4MVM A;  2BPC A;  4LFC B;  2ITD C;  2ZJ5 A;  4F8R A;  7ICV A;  2QA4 V;  5LA6 B;  5DBA A;  3T5J A;  4GT1 A;  5AHX A;  4ECZ A;  2HHV A;  1JIH A;  3BHP A;  3JD4 A;  2E8M A;  1KEC A;  3AG1 C;  2CPR A;  4GZR B;  4H44 B;  4CS3 A;  2CE4 A;  2YS8 A;  4OJP A;  4UAU A;  5DB9 A;  4LF8 O;  4DSK A;  3ALR A;  1OCC B;  4U6P A;  1XIL A;  3H1L H;  2L6L A;  2CDY A;  4O3S A;  3SYZ A;  5J2E A;  3WU2 Z;  3MC1 A;  3PST A;  2AQ4 A;  5EBW C;  4CH6 A;  4X62 B;  1J2M A;  2RP5 A;  2UXC B;  1N56 A;  2IU3 A;  3ASN C;  4ED2 A;  1JUD A;  3WK4 A;  2UVU A;  2PF4 E;  3QUB A;  1RXV A;  3DSQ A;  5KAF U;  1Q6H A;  5KFM A;  3CCS V;  3V7K A;  5HR6 A;  1BNP A;  3ZHV A;  1AI4 A;  3SJC C;  3SGI A;  4K8Z A;  3M6K A;  5DB8 A;  2FLP A;  2AHO B;  2WB1 F;  4JF3 A;  1XI1 A;  1QVG U;  3AG3 C;  1HDJ A;  4BAY A;  2YDE A;  3BA8 A;  1KBH A;  3CP1 A;  4BXO B;  4RQ7 A;  3H8J A;  3QX7 A;  4FZN A;  2YMP A;  1ZLZ A;  3H1H H;  2V4D A;  1N60 A;  2HMX A;  4YXJ A;  2BSK A;  3H9V A;  4BXO A;  4PA9 A;  5LMU O;  4DV7 B;  4OX9 B;  4QZC A;  1KDH A;  2RLT A;  1KW4 A;  4DL7 A;  2K4I A;  3JPT A;  2QKS A;  2GUZ B;  2VQF O;  4Q45 A;  3JD0 A;  4I0X A;  4M9G A;  1SKV A;  4PI2 A;  2HBM A;  1RQN A;  1HUZ A;  3EYZ A;  4FZL A;  2FB5 A;  2GUZ A;  2MU2 A;  1GRJ A;  1IDS A;  2YI8 A;  2ZJ8 A;  4IRD A;  3ZRV A;  1OCC C;  2J6S A;  5ALV A;  1QLE B;  3Q8R B;  2Y4T A;  2V4R A;  5KFF A;  4DFK A;  3GZF A;  2YX8 A;  4KLD A;  2OTL V;  1UJW B;  4DSF A;  1X42 A;  3PX0 A;  3SPI A;  2LYA A;  4DL6 A;  2KHQ A;  2Y1I A;  3ETG A;  1N8R W;  3UXN A;  2HHS A;  3TET A;  3AN1 A;  2PY5 A;  2HVI A;  4DSE A;  3TKA A;  3SPH A;  5DDY A;  3M8R A;  4DR2 O;  5ALG A;  1Z1V A;  4Q44 A;  5KT4 A;  4K0K O;  2YXL A;  4UBB A;  3TAQ A;  2QKA A;  2XOK G;  7ICR A;  1S10 A;  1V55 B;  1PM9 A;  1IVS A;  3N97 B;  9ICK A;  1O03 A;  4BGD A;  3HKE B;  3RH6 A;  4KX5 A;  4TUR A;  4DL5 A;  1OCO B;  4KFM A;  1MNG A;  5HNK A;  5AKX A;  1ZL8 B;  3JAT B;  3OEE G;  5GON B;  1SER A;  2BDP A;  3AQF A;  4B3S O;  2MSN A;  5EE0 A;  1EBO A;  1JJO A;  4F6E A;  2QM4 A;  3JAT A;  2F23 A;  3PO4 A;  1KFD A;  4KN7 A;  4RPZ A;  4HBN A;  2KP7 A;  1BPY A;  2FPL A;  1M57 B;  3C29 A;  1J2N A;  3TQ1 A;  4DV4 O;  4AYB F;  1PL4 A;  3JCZ A;  3LSU A;  1SKR A;  5FLX N;  1YXB A;  2QM8 A;  3JAS A;  1XHZ A;  3CC7 V;  1SQV H;  2Y0I A;  3OMA B;  3R66 A;  1WG8 A;  4RQ1 A;  3B4S A;  1QLE C;  2HI0 A;  3PW4 A;  2XAG A;  5L1I A;  1FFX A;  2EZZ A;  1ZQF A;  1AI6 A;  1YZB A;  5ALU A;  5KHK A;  3RBZ A;  2AZ0 A;  4AQY O;  2PGG A;  1DTO A;  2K8A A;  2P4V A;  2Q0A A;  3JSN A;  3OT7 A;  5EC1 C;  2LMR A;  3GQC A;  1HNZ B;  2XT9 A;  2DKZ A;  4QZD A;  3UO2 A;  4LR3 A;  4X89 A;  1G1X B;  2IJK A;  2NLJ C;  4JWM A;  1SV4 A;  4BX9 C;  4FBT A;  2NRX A;  2KKP A;  2ODM A;  3E58 A;  1IV8 A;  5AI0 A;  1V55 C;  2JXJ A;  3T2M A;  3ETR A;  4DV2 B;  4C80 A;  1OCO C;  3KCY A;  2XY7 A;  2W9C A;  4YR2 A;  3A8T A;  3PR4 A;  3UPQ A;  3VQV A;  3GV5 B;  5HP4 A;  1ZQM A;  2EZP A;  5LGT A;  1N33 B;  1CUK A;  1NR1 A;  3KKA A;  5AKE A;  4FZ0 A;  1TAM A;  1L7O A;  2WLN A;  1YJ9 V;  2QJ1 A;  4DR7 O;  2YML A;  5CJ7 A;  2MUT B;  4KLG A;  2DOS A;  2OT5 A;  2QSA A;  1M57 C;  4JTA B;  2CGO A;  4FLY A;  4OJ6 A;  4YP3 A;  5DB7 A;  4RQ2 A;  4KLQ A;  3UMC A;  4LF5 B;  2ZTC A;  4QZA A;  2ZE5 A;  3C1Y A;  4QW8 A;  2FMP A;  1MA1 A;  4RPY A;  3P3N A;  2K60 A;  5J2T B;  2WLJ A;  2BOB C;  4RQM A;  2XGP A;  3C2L A;  3RBE A;  2YXY A;  3QZ7 A;  1CEZ A;  4KTQ A;  4TWK A;  3MDA A;  1B22 A;  1Y66 A;  1VQ7 V;  1R3K C;  3C5F A;  2IHM A;  1I5X A;  2R9R B;  1Y76 B;  4X1Y B;  3D2Q A;  1XDC A;  3MR2 A;  5H2F Z;  1JX9 A;  4O5C A;  5KFZ A;  1UT5 A;  1VLB A;  3HKZ F;  3CNH A;  4EYH B;  4XDJ A;  4CRX A;  1Y76 A;  2MK3 A;  4O2A B;  4X1Y A;  3K9S A;  1VQN V;  2YN4 A;  4O2A A;  4P4P A;  3ZED A;  1TUE B;  5ALQ A;  3G6Y A;  2W0X A;  2R72 A;  3IN5 A;  1S8O A;  5KMG B;  4YD1 A;  5CA7 A;  3KKA C;  1GKF A;  4PJ0 U;  2BGW A;  3OUF A;  5KMG A;  1CXZ B;  1K97 A;  1V38 A;  4DW1 A;  3CCR V;  3JPP A;  5LOV B;  1Q8K A;  1DK2 A;  4UVA A;  5B1O A;  4IQV A;  1D9D A;  1AJP A;  3L72 H;  5LOV A;  4NV0 A;  5KG7 A;  4KLH A;  4PGX A;  3RGB A;  2CUG A;  2EDU A;  1RXW A;  5KG1 A;  4CGZ A;  1AJN A;  3K59 A;  1EFR G;  4P9P A;  8ICF A;  3GU3 A;  3PVX A;  4F2S A;  3N2G B;  3HX0 A;  5ALW A;  2OM6 A;  2P06 A;  4DRX A;  7ICT A;  4DR4 O;  4I7Z B;  1YZ7 A;  2HHW A;  1BSM A;  1WPX A;  1VQL V;  1OXJ A;  4P4M A;  2OH2 A;  2IU0 A;  2VWJ A;  3RJI A;  9ICH A;  1R6K A; 
#chains in the Genus database with same CATH homology
 5IY5 B;  1WUD A;  2GOL A;  3ABK C;  2F77 X;  1D8B A;  3E83 A;  4N21 A;  3CYM A;  2A9H A;  2HVJ C;  5LHI A;  4BIU A;  3CME V;  4G28 B;  5C0Y A;  2IJH A;  2HFE C;  3E89 A;  3CCL V;  3E86 A;  1YI2 V;  2GHY A;  4FJC C;  3W7U A;  2HR3 A;  2W7P A;  1BMF G;  2ZIV B;  3AG2 C;  4MTX A;  1THZ A;  2H3Q A;  4QE9 A;  2G09 A;  1YSC A;  2EBO A;  1VQO V;  1OUQ A;  1F51 A;  2WLI A;  5BZB A;  5E1A C;  1FXK C;  3OPX A;  2A0L A;  3IFX A;  2XIC A;  2VJ5 A;  3LVW A;  3SJQ C;  2A3V A;  4J9Z B;  3T4Z A;  3G71 V;  1XL6 A;  1S72 V;  2Y69 B;  3JD2 A;  2PMZ C;  2CRX A;  3ZCC A;  3N7S C;  1PD3 A;  4P9O A;  2DF4 B;  3MGV A;  3E35 A;  5CBH A;  2P6J A;  2DYR B;  2Y0S F;  2LFR A;  4MVO A;  1KQS U;  4G27 B;  2R9I A;  1ZQ1 C;  2EZO A;  4YXW G;  2DYS B;  5IYB O;  1MSW D;  2RHF A;  3H0L B;  5B1A B;  2JH1 A;  1HWY A;  1QCE A;  3GWO A;  2WLH A;  2ZIX A;  2WSS G;  1IIP A;  2EIM B;  3H01 A;  1QBZ A;  2KVC A;  2G07 A;  2JJ1 G;  2WLK A;  3NXS A;  3CCV V;  2OYY A;  2Y0S C;  4TT3 G;  2XAH A;  4PA6 A;  4J9Y B;  3B8M A;  4HZ3 A;  2JEU A;  3CP8 A;  4OJL A;  3FYE B;  3ZRW B;  3GB7 C;  3CC2 V;  2LKY A;  3H0R B;  1NZB A;  3IC7 A;  4N23 A;  2UXN A;  3IG8 A;  2XAS A;  4P30 A;  1Z1B A;  3ASO B;  3ZRW A;  3P30 A;  1K34 A;  1PNL A;  3F7Y C;  3OW2 U;  3HPL C;  3SYQ A;  1ORQ C;  1T94 A;  3H0M B;  2F43 G;  3F5W C;  5IY5 C;  2QM7 A;  2Z7J A;  2YSU B;  1H8H G;  2EIK B;  2UXX A;  1G4Y B;  4MVQ A;  4MW8 A;  4PDR A;  4FPP A;  1NR7 A;  2OXO A;  4GX2 A;  2DW4 A;  1PKX A;  4PA4 A;  2X6C A;  3LDE A;  3LDD A;  2HJF C;  4QNL A;  3E8B A;  4JYC A;  1RM1 B;  1BHB A;  2WAQ F;  3D2N A;  2Q6A A;  5LBQ A;  4RUE A;  3FB7 C;  2LYB A;  3STZ C;  1BL8 A;  1SET A;  4H33 A;  2PI5 A;  3F2C A;  3VOU A;  4CDG A;  2WWW A;  3OGC C;  5DN6 G;  2KIW A;  1VQM V;  1Q86 W;  5L3E A;  1Y4M A;  1GK9 A;  4UXN A;  1NVP D;  2E5S A;  2H3V A;  2WAQ C;  1OZ0 A;  4MVZ A;  4X88 A;  4ZKI A;  2KJ8 A;  4UV8 A;  1K73 W;  2Y69 C;  4OJO A;  1KP2 A;  3ZMZ A;  2JEX A;  1M9N A;  5L3D A;  5KA5 A;  2NV3 A;  3SQI A;  3ZN0 A;  2DYR C;  3T1C A;  3ETE A;  4HYO A;  4PDL A;  5IDJ A;  1S0V A;  2KNJ A;  2DYS C;  2H94 A;  2HKO A;  5B1A C;  3SAG A;  1E79 G;  3A0R A;  3STL C;  2F2A B;  2ATK C;  4I9W A;  5KUM A;  1S77 D;  2EIM C;  4Q20 A;  1MA7 A;  1AR1 B;  3MHS C;  1YTF D;  1KBU A;  4LP8 A;  1I5Y A;  1HEK A;  2K4E A;  1KP3 A;  1JVM A;  1M90 W;  5IYC O;  3ONN A;  4XDK A;  1AI7 A;  2K8B B;  4JAV A;  3ZN1 A;  2PI4 A;  1Q3U A;  4KUM A;  3I56 V;  5DM6 V;  3SMV A;  3OR7 C;  2DQN B;  4F4L A;  3ASO C;  4WFH A;  2AHZ A;  1NQT A;  3OAA G;  2WLM A;  3UM7 A;  5L3G A;  2F8L A;  5EC2 C;  3B77 A;  4H37 A;  1R3J C;  1F4N A;  1RPR A;  2M7W A;  2CN1 A;  3K1Z A;  3D2S A;  2EIK C;  2Q69 A;  2ZIU A;  1RPO A;  3ABM B;  2KJ9 A;  3CYO A;  1VQP V;  2G06 A;  1LNQ A;  2ZQM A;  3K0G A;  1ROP A;  3OUS A;  4JAS A;  1RM1 C;  2KV2 A;  4UVC A;  3CCJ V;  3B8N A;  5B1B B;  1KD1 W;  1PVP A;  3LUT B;  2QE7 G;  3IGA C;  3ZRS A;  3KZX A;  3OMN B;  2N1R A;  4O3M A;  4WFF A;  5HR7 A;  1G8M A;  1P7B A;  4BIZ A;  4JPR A;  4WFA V;  4ICA A;  3RVZ A;  2HVK C;  3TK1 A;  3P32 A;  5CN0 A;  2ZD9 A;  4P0P B;  4RAI A;  2ZXW B;  1SZT A;  4MW3 A;  2WLL B;  4PDV A;  3DEE A;  4P0P A;  2XAF A;  2VJ4 A;  4GCZ A;  4CZZ A;  5LHG A;  1YHQ V;  4P2Z A;  1WLE A;  3MD0 A;  2DGZ A;  1MOF A;  2JH7 A;  1NBM G;  4R7C A;  2K8C B;  1IXM A;  2P67 A;  1UPH A;  3T79 A;  3CD6 V;  2G08 A;  2DWD C;  1H8E G;  3MHH C;  2H3I A;  1CRX A;  2AHY A;  5EK0 A;  1JCH A;  2ZIW A;  3L3F X;  2Y48 A;  3LDC A;  2NNU A;  2KKV A;  1DF5 A;  5H9C A;  3PSP A;  4UV9 A;  2WLI B;  1W2B U;  3PSF A;  5B3S B;  2GH1 A;  4WJ3 B;  3K08 A;  4GFJ A;  3ZIA G;  5LGU A;  2PMZ F;  2E1E A;  2V1D A;  3N7R C;  2W7O A;  1DLB A;  3LVV A;  2ZG6 A;  4KMO B;  2HBK A;  3K03 A;  2YEV A;  3AG1 B;  4R8C A;  5LHH A;  3W7X A;  2Q68 A;  2E1F A;  4LBE C;  4I5S A;  2G5I B;  2WAM A;  4IC9 A;  4FK5 C;  1VQ4 V;  2HLD G;  3JD3 A;  2JHD A;  2ZDI A;  4QIW C;  3ABM C;  3ABT A;  2VKQ A;  1S5H C;  3M99 B;  3BEH A;  1VQ9 V;  2ZIX B;  3SAH A;  1PVR A;  2HBJ A;  5B1B C;  2LHT A;  3AEI A;  1Q7Y W;  4G2K A;  4UVB A;  3CMA V;  1GM8 A;  2K89 A;  4PEL A;  3CCQ V;  1KC8 W;  1JQ0 A;  3K04 A;  2OTJ V;  1ZWI C;  4MTO A;  4XDL A;  4RQE A;  1YJW V;  5GW7 A;  2XI9 A;  4KX3 A;  5C93 A;  2ZXW C;  2X6A A;  1ECW A;  1QR8 A;  3LYS A;  3E2E A;  4FZM A;  2K1E A;  4R6Z A;  3ML0 A;  2BOC C;  3AG3 B;  2ZXI A;  1CP9 A;  1COW G;  2X7R B;  3K06 A;  4PL1 A;  4GX5 A;  3CXC U;  3O0F A;  2W6I G;  3N7P D;  1Q82 W;  4FIP C;  2H3Z A;  4WFB V;  2K4H A;  5T14 A;  1E1Q G;  1F23 A;  4NLB A;  3OMI B;  3F5E A;  2OCC B;  2Z5U A;  4LC1 A;  2M0N A;  3OM3 B;  4JMU A;  4WFG A;  1YT3 A;  3R65 A;  4OO1 J;  1F44 A;  4MVM A;  4JTC B;  4ZBM A;  2ITD C;  2QA4 V;  3JYC A;  5B3S C;  4GT1 A;  2XID A;  3F5A A;  3JD4 A;  1XO0 A;  1KEC A;  1Q3V A;  2GSM B;  3AG1 C;  5L3B A;  2CPR A;  2EIJ B;  2ZDI C;  4P0Q A;  4OJP A;  2A79 B;  2KHV A;  2XAQ A;  3OR6 C;  2KD1 A;  4L87 A;  2H3F A;  3SPC A;  3DGE A;  3ALR A;  4MTF A;  1OCC B;  4U6P A;  2MRL A;  1R6N A;  1OCR B;  3SPG A;  3SYP A;  1NJI W;  3ZRX A;  1HIW A;  2C2A A;  1K5Q A;  4OXS A;  3EHB B;  4OJ5 A;  3PST A;  3F53 A;  3W7W A;  5EBW C;  2EIL B;  2IW5 A;  1L1F A;  2RP5 A;  2KJ5 A;  3AQE A;  1R3I C;  2QEX V;  2KOB A;  5EBL C;  2IU3 A;  3ASN C;  2X0L A;  3ICX A;  2JMG A;  2LFS A;  4JYB A;  2YB4 A;  2V7Q G;  2MA1 A;  3CCS V;  1BHA A;  3ETD A;  5HR6 A;  2JIZ G;  2FTK A;  1AI4 A;  3PZP A;  2KEY A;  4QJF B;  3M6K A;  3T4D A;  3E8H A;  3KFU F;  1K9M W;  2WB1 F;  1M56 B;  4JF3 A;  1QVG U;  1VQ8 V;  2ZIU B;  1OCZ B;  3AG3 C;  4BAY A;  3KG2 A;  4JGS A;  3PSI A;  4BUG A;  3OE7 G;  3CP1 A;  3ZMU A;  4DO2 A;  4RQF A;  2JK5 C;  4FZN A;  3SPJ A;  5H6R A;  1K7D A;  3IP4 B;  1NH2 D;  1Q81 W;  2HMX A;  2IH1 C;  4PA9 A;  2OCC C;  2IH3 C;  1SRY A;  2WB1 C;  2XAJ A;  2XND G;  1SES A;  1P7D A;  4HAM A;  3C28 A;  2K4I A;  2QKS A;  3NRW A;  1ED1 A;  3OEH G;  4MVR A;  3D36 A;  3JD0 A;  3M6Z A;  2W04 A;  3AG4 B;  5A0L A;  3M7D A;  1NVP B;  2HOQ A;  5J9P C;  1V54 B;  2HBM A;  1H2G A;  1PVQ A;  2WPD G;  4FZL A;  2EIJ C;  2ZR3 A;  3D3I A;  3SYC A;  2HBL A;  3E0F A;  3BY6 A;  3ZRV A;  1OCC C;  1QLE B;  1OCR C;  5H6Q A;  3TCU A;  2JDI G;  4CBC A;  3GZF A;  2YX8 A;  4JTD B;  2OTL V;  1UJW B;  4GX1 A;  1YTF B;  3SPI A;  3ZJZ A;  2LYA A;  2ZIW B;  2KHQ A;  2EIL C;  3ETG A;  4PA7 A;  1N8R W;  3TET A;  3LSS A;  4A8E A;  4PDM A;  2D6F C;  2EJR A;  2X6B A;  1R73 A;  1K3E A;  3SPH A;  4C0Z A;  3NUQ A;  1K5S A;  1JJ2 U;  2YEV B;  4LCU C;  1VQ6 V;  1VQ5 V;  2XOK G;  1V55 B;  4MT8 A;  4QIW F;  1Z19 A;  2HOI A;  3RFA A;  3IG5 A;  4KX5 A;  1OCO B;  3FKS G;  1M56 C;  4KFM A;  1OCZ C;  1PL0 A;  3K9A A;  3WG7 B;  4R50 A;  2HG5 C;  2IJJ A;  2EIN B;  3OEE G;  1SER A;  3AQF A;  3DTU B;  1FXH A;  1EBO A;  4MSW C;  3PJS K;  2F76 X;  2XVT A;  4RUF A;  1FS0 G;  3SYO A;  1M57 B;  2B5U A;  2ZR2 A;  3C29 A;  1XL4 A;  3AG4 C;  3ASN B;  4Z1M G;  2W6J G;  4QPJ A;  2DQ0 A;  5FL7 G;  3OFN G;  1PNM A;  4QE7 A;  3UKM A;  5CBG A;  3SAF A;  1A6S A;  3G6E V;  4AYB F;  1V54 C;  1URJ A;  3JCZ A;  2ZIV A;  1S76 D;  2QM8 A;  5CA3 A;  3CPW U;  5LGN A;  3OMA B;  3CC7 V;  2CK3 G;  3QO7 A;  1QLE C;  1OHH G;  3WFV A;  2XAG A;  3RF9 A;  5KA6 A;  1AI6 A;  1R3L C;  3HB3 B;  3RBZ A;  4AYB C;  4U7C A;  5IYD O;  1S3J A;  1K8A W;  3QNE A;  1MAB G;  4WFE A;  3K79 A;  1DTO A;  2K8A A;  1SZH A;  1ARO P;  1GMG A;  4E2L A;  1FFT B;  5EC1 C;  2G0A A;  2Q4T A;  4DXW A;  5L3C A;  4MVU A;  1GO3 F;  2LBO A;  3RVY A;  4X89 A;  2QTO A;  2IJK A;  2NLJ C;  3FB6 C;  2DQ3 A;  4BX9 C;  1W0J G;  5CRX A;  1GM9 A;  3X2Q B;  2KKP A;  2DWE C;  1V55 C;  3T2M A;  1YIJ V;  3CCE V;  3VCB A;  4P0Q B;  4WCE V;  1NKD A;  3F2D A;  1OCO C;  4MTG A;  4U7N A;  4UUJ C;  1B6Q A;  2KB1 A;  3WG7 C;  2EZP A;  5LGT A;  1F4M A;  2EIN C;  1NR1 A;  3ZMV A;  5KL8 B;  3QO5 A;  1DRG A;  1TAM A;  1M1K W;  2Q67 A;  5L3F A;  2H8P C;  2WLN A;  1YJ9 V;  1K4D C;  2OT5 A;  2W0F C;  1M57 C;  2ITC C;  3ZMS A;  4JTA B;  2B1G A;  4OJ6 A;  4ASU G;  4NLC A;  1QLN A;  2IJI A;  1VQK V;  4JAU A;  1K92 A;  4TSF G;  1K4C C;  1L6N A;  5HFM A;  3LNM B;  1PNK A;  2RRD A;  1K33 A;  1XNS A;  2KIC A;  3EFF K;  3RW0 A;  2WLJ A;  2BOB C;  2LP7 A;  3FYI B;  4ACO A;  1AI5 A;  3ABL B;  1CEZ A;  3W7T A;  3K3W A;  4TWK A;  2D3O W;  1Y66 A;  3FB8 C;  1VQ7 V;  1R3K C;  1JPX A;  4PL2 A;  3K0D A;  2B1I A;  4MS2 A;  1MG1 A;  1I5X A;  2R9R B;  3ABK B;  3D2Q A;  3CRX A;  1FXV A;  2YB1 A;  1JX9 A;  3E8F A;  2G5H B;  4QPK A;  4U7O A;  4WF9 V;  3HKZ F;  1KKD A;  4XDJ A;  4CRX A;  2MK3 A;  3I55 V;  3W7S A;  1AJQ A;  3VBB A;  1YIT V;  4MVS A;  4FE3 A;  3X2Q C;  3F7V C;  1W0K G;  5CBF A;  1VQN V;  4BW5 A;  3AG2 B;  1TUE B;  4NWI A;  3IN5 A;  3HKZ C;  4RO2 A;  3JD1 A;  1GKF A;  4KP4 A;  4XBF A;  2W03 A;  1FXK B;  5HFL A;  1P4R A;  2P7T C;  1QVF U;  3OUF A;  2BDU A;  1QR9 A;  1YJN V;  3CCU V;  2ZXH A;  1FXK A;  2P90 A;  5CMU A;  1K97 A;  1A0P A;  3QO8 A;  3CCR V;  3LSQ A;  4X8A A;  4UVA A;  3FB5 C;  2R18 A;  4BJQ A;  5B1O A;  3ZMT A;  2HOF A;  3VC8 A;  1J95 A;  1AJP A;  3SYA A;  4PA3 A;  4NV0 A;  5KL1 B;  3E8G A;  5B1N A;  1ENV A;  4FMT A;  4EKW A;  2JGA A;  4CGZ A;  1AJN A;  1EFR G;  2Z3Y A;  4GX0 A;  4P9P A;  5EBM C;  3G4S V;  2JJ2 G;  1H38 A;  3GU3 A;  3CCM V;  3AL0 B;  3CC4 V;  1GTO A;  3F2B A;  1E1R G;  2OM6 A;  1GM7 A;  1JOY A;  3ABL C;  1WPX A;  4QNH B;  2VIX A;  2WLL A;  1VQL V;  2IU0 A;  2OH2 A;  1CPY A;  3ABU A;  5KUK A;  1NH2 B;  1DF4 A;  1EZJ A;  1R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...