4QIWF

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 37
structure length 122
sequence length 122
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwF02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qiwF01
4CDGA 2MA1A 2KV2A 5C0YA 4QIWF 2HBKA 3SAFA 1YT3A 4NLBA 4QJFB 2HBLA 2HBJA 4NLCA 3SAGA 4CGZA 1D8BA 2E1EA 2DGZA 2HBMA 2RRDA 4O3MA 3CYMA 1GO3F 2CPRA 2E1FA 3SAHA 4OO1J 1WUDA 2RHFA
chains in the Genus database with same CATH superfamily
3HILA 2N05A 4JUZA 1WYGA 1PM9A 2ZNJA 1BPBA 4PI0A 2B9ZA 5C8YB 2WLNA 3OMNB 2EQYA 3TGUH 3B2EE 1IG6A 3UKMA 4JYAO 5DBAA 1SZXA 3IP4B 3K5LA 3G67A 2YI9A 4EZ6A 3OD4A 4DV7B 3KKAA 4KLUA 1VQOV 4TWKA 2KTQA 1H2LA 2E8NA 8ICFA 2YXHA 1QSYA 4IQVA 4MFCA 4H33A 4MTXA 1KBUA 4JI6O 2H94A 4OJPA 2KZ3A 5KFUA 5J0TA 3J81j 1JUDA 1ZQWA 1S8OA 2Q69A 4J9NA 3EUB2 2F4VB 3KKYA 2RQ5A 4C8KA 2IH1C 3GIJA 2W7PA 7ICQA 4YG2A 2YS8A 4DL2A 9ICXA 1X2IA 2JEUA 4EFBA 2I1QA 5JJEB 2HBJA 2QWPB 2PF4E 1QTMA 3RB6A 4LFCO 3QO7A 3KHLA 3N2GB 5EWEA 2ADPA 3GB7C 5L9XA 4PD4F 3HJEA 5FL7G 5B1AC 2PMZC 4PHDA 1MNGA 2R70A 2K4EA 1WJZA 5B5EZ 4DQQA 4CZZA 2BPFA 4GC6A 2ZE7A 3CJHB 3N27A 5JVDB 3MGIA 4O2AA 4DV4B 2EAOA 5J2JA 4RUEA 4O3PA 2XI9A 1CXZB 3CPWU 3JPPA 1Y88A 3PW7A 3SMVA 2LMRA 3UQ0A 2ZDIC 4LFBB 4XBFA 3HB3B 5AM5A 4NXZA 3K5OA 1VQ6V 2MUTB 1NZPA 4USAA 3UQ2A 5KMGA 1BNPA 1O03A 4ZKIA 4X66B 3RJKA 1GN2A 1NJZA 4DW1A 1I94O 1SA0A 4ECTA 3VOUA 2Y4TA 2E3TA 1VMGA 1KEJA 2MSNA 5BR8O 3NRZA 1XL6A 3J80N 5DB6A 5DG7A 2F3NA 4Y2PA 2BPCA 2Z5UA 3BJYA 9ICVA 1N0JA 4ECQA 3JCUZ 1ZL8B 1AP6A 3FD9A 4KLLA 4Z1VA 2A0LA 1SC5B 4QZAA 1NTZH 4GXJA 4MVUA 1EM1A 4UBBA 1ZAUA 4UATA 2GBOA 2QB1A 2DF4B 3T4DA 4DV6O 2HOFA 1BS3A 1MC8A 1A76A 2K9PA 3OTOB 4AQYO 3ABLC 1KRPA 2W3RA 4CF5A 3AEVA 3L4PA 1JI7A 5DDYA 1MSDA 4ZBMA 3SAHA 1Q81W 5DECA 4P0PA 2K4PA 5L3CA 5HMMA 3APQA 3E8BA 1WUDA 3E0FA 4I2JA 4JK1A 1X9MA 2HHHB 2OM6A 5J2UA 4GX2A 4JTAB 5C5JA 4Y2VA 3IDWA 1HEKA 3K1RB 1ORQC 3ABLB 2BSKA 2CE4A 4O4JB 2UU9O 3J7AU 8ICZA 5LHGA 2X6AA 1KMIZ 1HDJA 5EC2C 1ZJMA 5JH7B 4LCUC 5JTIA 2V4QA 2VJ4A 2GWSA 2LGQA 1N8RW 2KKVA 2JK5C 4NR1A 3U26A 4I27A 2VJ5A 3TKAA 1NK4A 2JRZA 2IBZH 3BQ7A 4I0XB 4NLKA 4YR0A 3UXOA 4F4LA 2DFLA 3PMLA 4GLXA 2ZIUA 1FXVA 3KG2A 1W0JG 3JATB 2OIEA 4IQWA 3NXSA 4XDLA 2JGDA 4BAYA 5J2IA 4PHAA 3H1IH 4LVSA 1XNQO 2PFNA 1Z4NA 2NRTA 5KX5A 1H38A 3WKDA 2FI1A 8ICNA 2YIAA 3SZ2A 5IYDO 2W9AA 2W43A 4IS7A 5GTHU 4RAIA 5KL8B 1K33A 2CN1A 4LF9B 1KW4A 2AW9A 4B3RB 4MTGA 4ELUA 4YXJA 1NR7A 1YXBA 3SJCC 5IWAB 2Y4UA 3IFXA 4O0IA 1N63A 3STZC 1UPHA 2A1AA 5HR6A 1MZEA 2Y0SF 1OV9A 3CC2V 3JD4A 1Z00A 3V7JA 2KG5A 2F93B 2E8OA 4FLTA 1ZQZA 5TISU 2D6FC 1SA0B 3CC7V 4IRKA 3LSQA 9ICKA 2KJ9A 3ASOC 3RYCA 7ICKA 3PSPA 1NKCA 4CC6A 2UXDB 5LGTA 4LBEC 3QEBZ 1AR1B 1SZHA 4RO2A 4DL7A 2Y9TA 1SQGA 1S72V 3Q8SB 5CBGA 3RRGA 1FPOA 3F7VC 4QZ8A 2B1IA 2DL0A 3MC1A 8ICTA 3ASOB 2P6JA 3JAKA 4DV7O 4KP4A 3KTQA 2WAQF 4QIWC 1VF6A 4MVMA 2YXLA 2KEYA 3THOA 4B9MA 3CWBH 3E35A 4PDVA 1XHZA 3ZHSA 4BIOA 4JI0O 3LNNA 2XTAA 1WWVA 1SETA 2OYQA 3GDXA 3SYCA 4I2BA 4EYHB 2ZIOA 2JEIA 2HG5C 4DLEA 3KCXA 2ATLA 2Q73A 3UMBA 2IBKA 4UB3A 2AZ0A 4EZ9A 4P0PB 3K08A 5B66U 9ICQA 1XUQA 4DR1B 3H8JA 1VQKV 1K5OA 1V97A 5J2UB 3VQVA 1SQQH 5KA5A 4YJ3A 3AG7A 1Q3UA 4PZNA 2YEVA 4E0DA 1DF4A 5CMUA 2ITCC 3BZKA 1N33O 4NV0A 2P4KA 2YICA 1TUBA 4WF9V 3OGCC 3DTUB 4DS4A 2C2EA 2FPLA 1WCNA 3CP1A 5AIAA 1ZQSA 1JALA 5EZYA 5L3FA 2ZIUB 4DV4O 2FB5A 2ZM6B 3SJBC 4DSEA 3M9NB 4F50A 1PVQA 1S5LU 2ZT9B 4LFBO 9ICOA 4M9JA 1ZQDA 1SXEA 2FJ6A 5KX5B 1U9LA 4IL6U 4I2GA 1Q82W 4RNMA 4JV5O 5DQHA 1L7PA 5EOZA 4X66O 1V9PA 1QU7A 4O3QA 5J0PA 3WK9A 3KBBA 5GTIZ 2A3QA 5JQGA 4GX5A 1WN7A 5KFVA 4QZHA 4LF8O 1PK1A 3GV8B 2LQTA 4FZMA 5KFBA 7ICGA 4TSFG 3A2FA 2VQEB 1X66A 5IIJA 1Z00B 3ZX6A 4JMUA 5LHIA 2O57A 3QZ8A 5HP4A 1QR9A 4MEXA 4B9LA 1SB3C 1WNSA 4X64O 4DUYB 1ZQEA 1XEQA 4UUJC 3C1ZA 3N7PD 4OJ6A 5JJNB 4XUSA 2NO4A 4GYCB 2ZIVA 3APOA 3BEHA 1Q43A 4DV0O 2H3VA 2A7WA 1N5WA 4PZOA 5ALPA 2XAHA 1FFTB 4O4LA 1WLEA 3PSFA 2GSMB 4P4MA 4JYCA 3OTOO 1S97A 2VIXA 3EXAA 2AHYA 3JPOA 3PW4A 2JV3A 1IVSA 3RAXA 2BTQA 2NR5A 2BCRA 8ICHA 2KHQA 1S5HC 3CRMA 2E8MA 2Y9UA 1C20A 1NI3A 3CRXA 2HHQA 3QO5A 2BE3A 4DV2B 2EDUA 1LR1A 4TUYA 3TJTA 4MF8A 1SQXH 2CK3G 9ICSA 5EE1A 4FLVA 5T14A 4YVZA 5J8YC 4CRXA 2EZPA 4K4HA 2ATKC 2GUZA 1NK8A 4Q8EA 5E79Z 1UA1A 2UVUA 2JZBA 2X6CA 1K3EA 4YD1A 4UCSA 1AI6A 4OJLA 4N23A 2ZKOA 5BY1A 2UVWA 4TQRA 2KP7A 3LDDA 2HCFA 3I28A 4P9PA 4YJ3B 2GO7A 2ZXHA 3ML0A 4QGPA 1SL1A 4R8CA 5KAIZ 2YEVB 4M47A 2EX3A 2JEXA 2BKEA 2BCSA 3I56V 2WWWA 1HR0B 2XY5A 7ICJA 5LHHA 2A06H 2E74B 2K8AA 1PD3A 5KT7A 4UAVA 5J2HA 1TUBB 2F95B 3K9AA 4LF7O 5GONB 1COKA 5KT4A 2MW2B 5EZYB 3JALA 3EHBB 3A0BZ 3PX0A 2LM1A 4LF9O 8ICOA 4DRXB 1ROPA 1LVHA 2EIJC 4B3RO 5IWAO 3R66A 3CCSV 2E75B 5J9PC 2GH1A 1N48A 4JI3B 2XT9A 5KAFZ 2HBMA 5CA0A 1TVKA 3EPIA 1UA0A 3CYMA 4QZFA 3H1JH 5J0SA 1F44A 2RQ6A 1SERA 2YB4A 1IV8A 4J9SA 5JQGB 3H8SA 2JIZG 4K4GA 3CD6V 2PFOA 1ZYQA 3C3SA 1PK1B 1ZQJA 1XHXA 4MHVA 4UAUA 4R6ZA 2ILMA 5KFDA 3GIMA 1XI1A 1NK7A 3RBDA 5DN6G 2DOSA 2C2RA 1YT3A 2UXCB 1XO1A 4WFAV 1GM7A 3ZDCA 4PPXA 2KB1A 3LYSA 2CGOA 1LNQA 3ZHRA 2DWDC 1D9FA 5IYZA 2QDOA 4JTDB 2VS0A 4PDMA 3ZBHA 3ONNA 2BR0A 4RQEA 4DV5B 2VA2A 3N7SC 2ZE8A 4UB4A 3C28A 2XGPA 4X65O 2Y0PA 3CCVV 2YUAA 3WKCA 4IYHA 4G9BA 4YY3B 1YTFD 1ZETA 1R3JC 4P4OA 1JMKC 2EAMA 5ALVA 4QW8A 4DXWA 1ZD3A 1W0KG 4TUYB 4B9VA 3WK8A 4F4KA 1ZRMA 3LUTB 4DO2A 3KOOA 1WP7A 2IU3A 3ETRA 5AM0A 4PGXA 3U11A 1GAXA 4JZGA 2JZBB 9ICEA 2L35A 2F66C 2D8CA 3V6HA 2W54A 4RPZA 1PPJH 3SPCA 1GMGA 1P7GA 4O3MA 4F5OA 1KKXA 7ICLA 3CCLV 2OCCC 3E58A 1D5AA 5KG7A 3RH4A 2NRWA 5CHGA 3RB4A 1A6SA 1N36O 2AHOB 4F92B 1AR5A 3EZ5A 1EN5A 2H3ZA 2YN4A 2RN9A 2KV2A 3SYAA 5KFIA 5JRTA 1MSWD 4RQ3A 1V55C 1ZQIA 3JALB 1VQPV 4JI7B 2YXYA 3B40A 1Y67A 1N32B 3V6JA 1FJGO 4JB3A 1J5EB 5HNKA 2IJJA 5AKJA 1UHUA 5FPRA 1YTFB 8ICSA 5IT9N 5AI6A 3FB7C 4M2YA 1U4BA 7ICIA 5K1PA 1V55B 4EEKA 1N4CA 4RQ2A 1NTMH 2L5YA 4KX5A 5CA7A 1TVKB 4GT1A 4NL9C 5CA0B 2A3VA 3SV4A 1RZTA 3PN1A 2V1DA 2XVTA 2BDPA 8ICVA 5KL1B 4X20A 3RT3C 4DUYO 1OJHA 4I2IA 3V7KA 2KSOA 1DF5A 3GIKA 2Q4PA 3QE9Y 2RDJA 2H8PC 1Q7YW 1RYRA 2W8LA 2ZR3A 4F6RB 1F5SA 2YB1A 2GTSA 3F5TA 2VKQA 4UARA 1CRXA 1J2NA 4ZI7A 5IJ9A 5DDMA 2AU0A 4MTFA 1WWUA 4BXOA 5KFGA 1NU1H 4DR2O 5HHHA 5IYZB 3KZIU 1ZLZA 2WLJA 4C4RA 5KFSA 4PDRA 2LYAA 3CRAA 4QWAA 4F72A 4RQ1A 5B1NA 1Y6XA 2WLIA 2QM8A 3WB2A 4NXNB 3I5DA 4LR3A 4X8AA 4NVPA 4O3NA 3H0LB 5J0WA 2F1HA 4Z1MG 5BOMA 4KLEA 3NS1A 4FS2A 5DB8A 1Q3VA 1X4TA 3MHSC 4YXMA 1FXKC 2NRXA 2Q0OC 9ICPA 5EBLC 4AP9A 3DGEA 1E1QG 2DN9A 1JRPA 5LBQA 4J9LA 2DE0X 5HFMA 4FFBA 2BCQA 5DGBA 1AI4A 4KLOA 5AKHA 2CTRA 3Q4HA 4Y2UA 4FS1A 1GK9A 2UUAB 2OCEA 1K34A 1DOQA 1LV5A 3SPJA 3B9JA 4CF4A 4AILC 1PNKA 1L3UA 4IRCA 9ICBA 3CCJV 3QXGA 4DR5B 4KLHA 4FPPA 4LFAB 3WB0A 1H8HG 4RZRA 5KG0A 4IYIA 2EAPA 2VWJA 3CXCU 3KHRA 3RH6A 1RM6C 2GLEA 4DL4A 2F1IA 3HRDD 2YY6A 3OPXA 2ODMA 4JI3O 1RP3B 1VDVA 2IJIA 1B06A 4MS2A 3QU9A 4WFGA 4YMOA 4WCEV 3CP8A 4EYIB 4IRDA 3K58A 1ZQCA 3ZCCA 2MK3A 4NB5A 1TAMA 1Z5VA 2QTSA 2HHTA 2WPDG 4C80A 3JD3A 1NJIW 4BWJA 4R65A 4F4XA 4KHPO 2ZNIA 1ZD5A 3Q8QB 2UXCO 4X20B 2W04A 1VLBA 3IN5A 1RSOA 9ICHA 3RYFB 2EIKB 2KSOB 3H01A 3RBEA 7ICVA 4DWIA 4UVCA 2R18A 3QG5A 3F2BA 4FM2A 2ZIXB 1MG1A 5G5GA 2ZQMA 1K9MW 4DV5O 3PR4A 2JEGA 4OJ5A 2XIDA 2B6GA 1X9XA 2CAZC 1L7MA 3QUTA 4DR6B 4ZI7B 4PL1A 2LW7A 2W9BA 1GM9A 4PA6A 1QLNA 3RH5A 3KZXA 2HHXA 1SKSA 3TANA 2QKSA 3E8GA 3K9SA 4I50A 4YY3O 4FZNA 1TE2A 2W6IG 4MVQA 4H44B 1RQNA 1UT8A 2WF8A 4FE3A 4QPJA 3M1YA 4IQTA 4Z6EA 2UVVA 3CB2A 4JAAA 4LP8A 4I55A 3PSIA 1OCCC 2JJ2G 4EB6A 1GKFA 4LC1A 1Y76A 1BQZA 1P4RA 1FEZA 1NJWA 5ALDA 1NI8A 1SQFA 2WLIB 2EZYA 3BS7A 2Y69C 4GUNA 5C93A 2LYBA 1K8AW 1JVMA 5B5EU 1ZD2P 5IIOA 9ICCA 2QKAA 2BQUA 5LL6Y 4DQIA 3LWLA 1CPYA 5CB4B 1P84F 5AI9A 5HR7A 1BHAA 3D6JA 2V4RA 4RQ7A 1PUZA 1OCCB 3ZRWA 2DJVA 7ICOA 4GKKB 5KFXA 3HKZF 3OAAG 2ARHA 9ICFA 2W9CA 4QZDA 3EYZA 2DPJA 3CE2A 4FFBB 1BQ0A 3T2MA 1RFYA 3Q4HB 3ISBA 1ZX3A 3RYIA 4R8UA 3QF7A 1BZKA 4XA5A 3JAWA 1OHHG 3AK1A 1MQ3A 5CEHA 2LI6A 1ENVA 4IHJA 1QCKA 2PI5A 3FB6C 4NXMB 3OR7C 1OCOC 4JTCB 4TV9A 2K60A 5BMVB 1N61A 9ICRA 2R72A 4JV2A 3B0YA 4RQ4A 3V6KA 4IT5A 2I5HA 4QNHB 1NOMA 4NLZA 2HKOA 4M9LA 3A0RA 4B7KA 3D2QA 3ZRXA 3VQYA 2HDOA 1VQ5V 3WG7C 4CNQA 4G27B 1OCOB 5JUMA 1G1XB 3GFKB 2LHTA 1IBKB 2M0NA 8ICXA 2M6YA 4L8JA 3MD0A 4H37A 4CCHA 3PO4A 2YDEA 1SV0C 4YJ2A 4U6PA 5KFCA 2NN4A 4JWNA 3N97B 3L73H 3KCYA 1A77A 3G6XA 4M9NA 3WG7B 1U45A 4K3AA 5FPOA 2WSSG 2Y1JA 2PGGA 3CCRV 4P4PA 5JJJB 4K4IA 3OUFA 3ZMTA 2E5LB 2IMWP 2QGNA 3QX7A 3AG4C 3OEHG 5B1OA 3W7UA 4LF4B 1XMQO 5KFHA 2KN7A 3BFRA 2DQNB 3SPGA 4AYBF 2E3CA 2W9BB 1B6QA 3Q8PB 2Y0SC 2PXIA 4O3SA 1N34O 4I50B 4NXNO 2A1JA 3CX5F 2V7QG 2YIBD 3AG4B 1Y66A 5KG4A 4I55B 4EB6B 2WFAA 1N56A 2B5UA 1Y76B 1NBMG 1TAUA 5D5PA 2ZJAA 2YTUA 3ISCA 3N4MB 3SYOA 4K35A 4YIOA 2R8HA 2KD1A 1PVRA 1XDCA 4ECYA 1I08A 2B1GA 1D9DA 4MVRA 3ZIAG 4PL2A 1FO4A 3LDAA 4DFKA 2OEHA 4J41A 1Q6IA 2CH7A 3ZRWB 4NYKA 3JD2A 3HWTA 2HHSA 4LFAO 4JV1A 1GM8A 1W59A 1SWVA 4O5CA 3HW8A 2W9CB 4RUCA 5L1LA 4O9MA 1AI5A 4OX9B 3K04A 4UAWA 3RYIB 3ZHVA 1M56C 5EWGA 1WA8A 5DB9A 4GXIA 3JAWB 2QWOB 4YXWG 1FKAO 5AKIA 5LGUA 3JD1A 2XAFA 4IHJB 4PJ0Z 5KT6A 4B9TA 4F3OA 4CGZA 2W6JG 3ZI4A 4DFMA 5H9CA 4LF6B 4TV9B 4ECZA 3AG3B 3ABMB 3RW0A 3BS5A 4EFEA 4ED7A 3GILA 8ICKA 4KMUA 2ASJA 3WK7A 2KJ8A 3ZD9A 1M56B 1WPXA 3DC6A 3ZDAA 1QR8A 3LVVA 3S3XA 4R63A 1LUWA 3PMNA 4IIJA 5L3BA 2H5XA 1U97A 3FYEB 4HNAA 2P5OA 1C7YA 3OW2U 1SL2A 5DM6V 1H2GA 4KLDA 5ALSA 4BW5A 4W4KA 3PJSK 1KL9A 2YMQA 3KKAC 1IDSA 4RPYA 4YJ2B 4FBUA 1TV9A 3T5KA 5DLGA 5KFRA 1QVGU 5LA6A 2OIGA 3B77A 4FM0A 2WB1F 1JA8A 4ZOLA 4ASUG 1ZJNA 3H4DA 3AU6A 4CH6A 1PKXA 2LYHA 4D7TA 1EN6A 3HKDA 2AGQA 3ALRA 4JI1B 1K7DA 4I9QA 3AM9A 2WF7A 1YVWA 3WKEA 4JV0A 2BPGA 4MW8A 4U7OA 5EE9A 3IC7A 4C4TA 4NLNA 8ICGA 1X40A 4FZ0A 5AKGA 4LJXA 2FKXA 4UB8Z 3CCUV 8ICUA 3DC5A 4P30A 4CF3A 2QE7G 5IYCO 4DFDA 2IW5A 8ICPA 5ALTA 1JROA 1VQ8V 2HHVA 2IOFA 3VQWA 4UB6Z 2KVSA 5LP6A 1M6YA 4MT8A 5L1JA 1AJQA 5IJ0A 4GKKO 3WKBA 2OCHA 4XDKA 2QJ1A 1PZNA 5KG1A 5EBWC 4ECWA 2J6TA 4WBNA 1BPEA 2ESEA 3AQFA 2RNBA 1AVMA 2R9AA 4B7EA 5J2FA 2CH7B 4BR6A 4GXKA 3JSLA 3M8AA 4O2AB 4I5SA 4NXMO 1ED1A 1ZQMA 5AK5A 3NVYA 2JEFA 2N74A 1XSNA 4KFMA 2Z7JA 4Y2SA 1RXWA 4ECVA 1WA8B 4DL3A 2E76B 4J80A 4PA3A 2HEPA 3WFVA 2BQ3A 5CR0A 5KMGB 4GC7A 2N1RA 3T1CA 1NK9A 5FP0A 3T1YB 4B9SA 3G6EV 3BS5B 1IBKO 4J9RA 4DYLA 3FYIB 2UXBB 3GV7B 3QO8A 4EBCA 4BWAA 4YD2A 2DBYA 2IOFK 2BZFA 5KNIA 3F7YC 2G07A 2P4VA 3C23A 3C5GA 4HNAB 2AXTZ 2EZZA 3RN4A 5L1MA 2AGPA 1IXBA 5H2FZ 4TURA 2LO1A 1UJWB 3ZMVA 2E5LO 4JI4B 9ICGA 2F1JA 4KLGA 3QUQA 1G6UA 4LF4O 4US9A 5KHIA 3AK3A 5EWFA 1V54C 4ZOLB 3UXNA 3OHAA 2YC0A 8ICLA 5CA3A 3JARA 2YMLA 4Y2JA 4Q44A 2F4VO 3HKDB 1GN6A 1ZTEA 2PMZF 5ITZA 5J2TA 1DTOA 2LPEA 2IJKA 3K0DA 4RT2A 2XHBA 5CWRA 1V54B 2PY5A 5KAIU 3TFSA 5IINA 5BXZA 2L6LA 4Y2RA 1F4MA 2IHMA 2R9IA 1XNSA 3K5MA 2BSKB 3RYHA 1D8BA 5AI8A 1RPOA 5JCOA 4E4EA 2NV3A 2XCPA 3ICXA 4GFJA 9ICWA 3QNMA 3NVWA 1L3VA 4QWBA 3N7RC 2F23A 2YI8A 5IJ0B 4DR7B 4ED0A 1NZ6A 4O5KA 5CBHA 1ZQUA 4RQ5A 1EN4A 2JGDB 2OYYA 5H6QA 4DUZB 4OX9O 1KSPA 5KAFU 5AKZA 4TUPA 2CTQA 2K4HA 5KFWA 9ICAA 2EJRA 2DWEC 4H0LB 1HNWB 2BOCC 1XS9D 2WF6A 1WP8A 4DF8A 4LF6O 4FK5C 1Q8IA 2O6KA 1K4CC 2ZJ5A 4UCRA 3ZEDA 3IAYA 1X6IA 4F2SA 2JR5A 4IR1A 4I2CA 3QVNA 3RJFA 1ZQRA 3C3TA 1YZ7A 3F5AA 4PI2A 1S5JA 5IE9A 5IYBO 3PZPA 2PTMA 4KLIA 3DEEA 3THVA 4NJ8A 8ICAA 2WLHA 2NYVA 2CDYA 4DO9A 3TCUA 4ICAA 2QR4A 5B1BB 3MAQA 1KBHA 1QVFU 2KZZA 3RYCB 3SPIA 1KECA 4MVOA 5KT5A 1ZQOA 1VF6C 2XUMA 1TFRA 4O2BA 2WA3A 4DFJA 1Z2GA 1T3NA 2EJ7A 4MFFA 3OGUA 1EZVH 1XMOB 1QHTA 3D36A 1XSLA 2DQ3A 5GTHZ 2FYUH 3G6VA 5KFLA 2W3SA 1V38A 4QZ9A 4D7SA 3EPGA 4KLJA 2OHFA 3JAKB 1XREA 1OCZC 1NT2B 2MAXA 1EZJA 3E8HA 3TK1A 5ALYA 1BE3H 2UXNA 3DXRA 5IIIA 3OEEG 4DV1B 2HHHO 1XC9A 3SDLA 1K5QA 1M1KW 3RB0A 3JARB 2YX8A 1PV0A 5TISZ 1M90W 3D2SA 2Q7HA 5AG2A 5JCOC 2G06A 4TOIA 4QNLA 4XDJA 4TQSA 4DQSA 4OGQB 5ITZB 3CS5A 1OCZB 2IM9A 1U96A 3D2NA 3ZD8A 5KG5A 3PW0A 1U49A 2OWOA 2Y48A 4UCUA 3AL0B 1BPDA 4EBDA 2K4IA 1NQTA 5D5QA 3OTFA 1UFIA 1UQVA 3SPHA 1ZQQA 4LNUA 5KA6A 1ZQHA 3RYHB 4WFHA 2F8KA 1FS0G 2KG7A 4F8RA 4DR3B 1LKYA 1VQ7V 3K57A 4FFKA 2Z0AA 4OD0A 2VANA 4I7ZB 4HBNA 2Q0ZX 5TZVA 4MW3A 2EANA 1NK6A 1SZTA 3H0MB 4RT3A 4EX6A 3JSNA 3JPRA 2KE7A 8ICWA 3VCBA 2KIWA 3R9KA 5KFZA 2AH5A 2HJFC 1NH2D 3V72A 2WLLA 5DBCA 5LXTA 2JH7A 2B0CA 2WTFA 4J10A 2E1EA 1NJYA 3IV6A 1HUZA 2HHUA 2QM7A 4QPKA 1MQ2A 1PNMA 2GDSA 2CPRA 3P32A 4BIUA 2DYRC 1BSMA 3T5LA 1T5EA 1ZQXA 1Z3EB 2UXDO 2UXBO 2QSAA 1RQLA 4IR9A 5KLVH 1IBMB 3L74H 4CDGA 4RNOA 3CRQA 3QNEA 4QIWF 3ZS8C 2M7WA 1ZRNA 2Q0AA 3GIIA 5J2AA 3CMAV 2W03A 2DYRB 1URJA 1S9FA 2ZUBA 3K4GA 4M6WA 3PVXA 1KYOF 1O9HA 1QLEB 4EX7A 4DV3B 4JI4O 1AQ6A 2ZJ8A 4FJCC 2ZIVB 1SS3A 3WU2Z 4O2BB 2VQFB 3L3FX 4O4LB 4NM2A 2F77X 4TQDA 2X6BA 1T94A 3RR8A 3PV8A 1Q90D 1QSLA 1FFVA 3HR0A 3L9DA 2BTQB 4TV8A 4W4LA 3AU2A 5LMNB 3NVZA 2I6XA 3BQ1A 4OPAA 5CA1A 3W7SA 4FLUA 1NH2B 2EZOA 5AM4A 5EYPA 4DR1O 3SENA 5H5NA 2GOLA 5DQGA 3F53A 4J7ZA 5L3DA 2KKWA 4UB1A 2LKYA 2GUZB 4BW9A 2PZSA 3N28A 4ED1A 2K8BB 8ICCA 3SEIA 5J0RA 1RG6A 3HT3A 2JS5A 5ALXA 4DS5A 1GO3F 2ISOA 1H2SB 4JAUA 3SV3A 4I4TA 4YP3A 3BQTA 4LNUB 2ZM6O 5DEDA 2FE9A 3ZRSA 2W8KA 3SD7A 1QCEA 3ZDBA 1RM1C 2X0LA 1LKYB 4CS3A 5BPCA 4C8OA 1HNWO 4B08A 4FO6A 1GTOA 4UCTA 1BL8A 3SJAC 3I76A 3C2KA 1G8MA 3MFHA 4KLMA 3TQ1A 4U3FH 3TADA 1IURA 2QWNB 3C5FA 3JYCA 4KL1A 3K59A 5J2KA 3RR7A 1RM1B 1PVPA 2WLLB 5LXTB 3QTCA 4ZHQA 4F4ZA 1FD9A 5KFEA 1JOYA 2Q9LA 2ZR2A 2VQEO 4ED6A 1COOA 4UCOA 5LOVA 3RBZA 2BGWA 5CN0A 4UV9A 4JF3A 1NJXA 1Z1BA 1L5UA 1JQ0A 1LB2B 3BRCA 1OCRB 2MRLA 5DBBA 4DR4B 3D3IA 1BHBA 3HKZC 3WKAA 1B4FA 4US8A 4DFPA 4Q20A 2I9GA 3ZN0A 1MOFA 4B3TB 4PH5A 2ZTEA 4UB5A 2KSDA 1PP9H 4KN4A 4X1KA 3B0XA 1Q46A 1URFA 2JXJA 5CB1A 4M6WB 1UT5A 4MFAA 3T1HB 4P2HA 7ICUA 2BDUA 3FFQA 3FC4A 1YJWV 1YCIA 4DV2O 2Q8VA 4DV1O 4DSFA 1FYJA 1YF2A 4AHCA 5BZBA 1FXHA 1SESA 5J2BA 2QM4A 1P7DA 3Q8KA 4EEQA 1QNMA 3A0HZ 7ICPA 1TUEB 5EYPB 4X5VA 3PR5B 3ZJZA 2ETNA 4JYAB 1JJ2U 2EILC 3CHXA 5FLXN 3RAQA 2W11A 1BCCH 5KFAA 3QU2A 4RUFA 1YEWA 5KFYA 2DYSB 1HR0O 3UT5A 1GRJA 4CH4A 2XAGA 5F9LA 3GVMA 1KTQA 5IILA 1YSCA 2BOBC 3AK2A 4ACOA 1VIBA 2EILB 5LMUB 2OXOA 4A5UB 2XICA 4I4TB 1L8LA 3ZHTA 2XY7A 1J95A 7ICFA 3TAQA 3RRHA 4PHZA 5HMLA 1BPXA 2W9MA 4P2ZA 4AYBC 1ZQ1C 1KDHA 4MVSA 4Q45A 2KFNA 1AI7A 2KICA 4R64A 1H2MA 2W0XA 1HNXB 2DUYA 1E1RG 2WF5A 1GH6A 3OE7G 4LFCB 2P6UA 1JJOA 2UUCB 3J81N 4C8NA 3ZRVA 4ELTA 3UQ8A 4XRHA 3HKBA 3OMIB 3BAAA 4ED2A 2JGAA 1HUOA 5G5HA 1R6KA 1S10A 4Y2QA 2EIKC 8ICRA 2BQRA 1RYSA 4NY8A 4JASA 4ZHQB 4J7KA 1TVAA 2KQXA 1NKEA 5ALKA 3SR6A 3RJGA 2XC9A 1IBMO 4Z6DA 1MZFA 1KD1W 1N5XA 4DLGA 3QYPA 1P49A 2HVHA 4UXNA 4TQFA 2FMPA 2NO5A 3I1YA 4DV3O 5E1AC 2F44A 1S77D 3ABKB 5IDJA 4NTWA 5KG2A 3DSQA 1KLNA 2FLLA 3K79A 2WA4A 2VQFO 4QE9A 4R7CA 1YIJV 3DDHA 1M9NA 3GQCA 1I94B 2RRDA 5ALWA 3HPLC 2F43G 4X1KB 3DV9A 2JJ1G 4UV8A 4TUQA 1I7FA 4DSKA 1T8EA 5IJ9B 4BXOB 5BR8B 2FLPA 3TACB 3OT7A 5AKXA 2KHVA 1TK8A 4ECUA 3H9VA 2DW4A 3VBBA 1S3JA 2EULA 1XILA 5ALFA 3RB3A 5A9GA 3HKCA 1F51A 3NVVA 2XNDG 1IIPA 1COWG 5LYJA 1ZQYA 5AKEA 2AZ2A 3KHHA 3Q8MA 5F3XB 3T5HA 2Q67A 1OUQA 3ETEA 1SZPA 2IU0A 2EZXA 3CXHF 4UVAA 4DV6B 3RFRA 4DK0A 4GIBA 3W7WA 2YIDA 4AQYB 1XWLA 1PNLA 1RPLA 1OW5A 5HHIA 1R6TA 3K1ZA 4JI2B 5ALJA 1S0VA 4Q43A 3RWRD 3NTUA 2XOKG 2XASA 3KFUF 2ZE6A 2WB1C 3BHPA 2DKZA 4KN7A 3GWOA 1S76D 4UASA 3N2GA 2ZD9A 4JI7O 3TXQA 5KHKA 1N32O 2GV9A 4BIZA 2UU9B 2QWQB 1J5EO 1JX9A 4DSIA 1ZXIA 3CRRA 3OSNA 3AMZA 1R1BA 3UM9A 3K06A 4Q6GA 3A8TA 2CTWA 1XL4A 4LWSA 2K8CB 4YFKA 1KKDA 4KLQA 3K5NA 1U47A 3O0FA 3QEAZ 7ICHA 1U48A 4QZEA 3HKBB 9ICUA 3SJQC 2XAQA 4NTYA 3PX4A 1M93A 4YHHB 4ZH4A 3H1LH 4DR4O 2OT5A 2JH1A 2P7TC 2ZXWB 1I0HA 3IJ4A 3CSXA 2C22A 2Q4TA 3ZMSA 1K92A 4F2RA 3M9OB 1UPGA 4O4IA 1DXSA 4B3TO 4YMMA 2HI0A 3LDEA 4LH6A 3ZHQA 1HP8A 2G08A 1GN3A 1YJNV 4UFZA 1D2DA 3I55V 1RSOB 2ZDIA 4FBTA 3OUSA 4P9OA 3U10A 3T5JA 3OM3B 1K1QA 2HW3A 1XU4A 3E2EA 2H3QA 4I28A 3UO2A 3HP6A 3LVWA 7ICRA 2FMLA 2OTLV 5AICA 5J2CA 5A2QN 2HVJC 3BA8A 3T79A 3MR5A 3QUCA 1ZL8A 4UB8U 4I29A 2RDCA 4J9MA 4N21A 1AR4A 2YSUB 5J0QA 4X62B 5HFLA 1NK5A 3SI8A 4UB6U 4C8MA 2J6SA 1T3QA 3FB8C 4C7UA 1SRYA 1EFRG 3HKCB 4RQNA 4R66A 4F4WA 4NKGB 1KUQA 1QQ5A 2HJDA 3E83A 5LYJB 5ALOA 3FAVA 5L3EA 1AILA 1NKDA 3D8CA 3F5WC 5EC1C 4WJ3B 4QWEA 2CRXA 1TK0A 1KP3A 2UUBB 3B09A 1CUKA 2JS3A 1IM4A 2FDRA 4RQ0A 4M0AA 1YI2V 5AK6A 5DQIA 3MGHA 1Q3EA 2JVDA 2E1FA 4PV1B 4QE7A 4JI0B 3NRWA 2PI4A 2UUAO 5LMUO 1Q86W 3F2CA 3P30A 1ZQPA 4U7NA 2WAQC 4O4JA 5KFTA 4DR5O 2V9WA 2QKCA 1XNRB 3L5KA 5JH7A 4KITB 3AG3C 4RQ6A 1FFXA 3ABMC 2Q7EA 1HNXO 4R8UB 2HOIA 2AGAA 2AHZA 1Z1VA 2KVCA 2ZIWA 4YQWA 4YCXA 2IHNA 5L1IA 4NLCA 1P7BA 4I0XA 5ALMA 4KXRA 2UUCO 1QH9A 3FKSG 1QQ7A 4J9KA 2Y0IA 3JATA 2Q68A 2OTJV 2F76X 1SGGA 4M9GA 1N33B 3OMAB 4C0ZA 1A32A 5JWPA 1ZOLA 1I5XA 3EW9A 4RQFA 2KIVA 3D3QA 4LWSB 1AJPA 3SQIA 1DRGA 4X88A 9ICLA 5B1AB 2AXTU 2ASDA 3UMGA 3JPSA 4Y2YA 3L71H 4F93B 5H2FU 9ICMA 2YMPA 3UM7A 3GWKC 1DK1A 2VA3A 1TAQA 3TI0A 4R50A 1FFUA 2X7RB 3E86A 2G5HB 4O4IB 3P3NA 4JV5B 2NNUA 2KKPA 3UPQA 4J9OA 4G2KA 4F91B 4DR6O 4EENA 1TKDA 1B04A 2J6UA 4QZBA 3UXPA 5J29A 1B43A 1ZD4A 5AI0A 1Y74A 1F23A 8ICIA 4EKWA 4LF8B 2YMMA 3TARA 4C7ZA 2P66A 1IX9A 2AQ0A 3RVYA 5D49A 2W7OA 2NRVA 4B9UA 2HVKC 1JN3A 4X64B 3RJIA 3N2KA 3S3WA 5KHHA 1SWWA 3BVOA 2ZTCA 3C90A 2VRZA 4KTQA 5AKKA 4NLBA 2LGWA 1XBLA 4TT3G 2A1JB 3AG1C 4DV0B 3QU5A 5KFPA 2MU2A 4RWUA 3WK6A 3RF9A 4BJQA 4B3MB 1BGYH 4GKJB 3M7MX 4FLZA 8ICBA 9ICTA 4JAVA 2IOHA 3M99B 3FAVB 5IIKA 4JI2O 4I2HA 4GCZA 2JMGA 5CRXA 3AG1B 2CUGA 3OFNG 4RNNA 1AP5A 2BCUA 3IM1A 2ASLA 2AGOA 2E5SA 8ICMA 1CI4A 1R73A 2RHFA 4RQMA 3EFFK 1Q6UA 2IA6A 3AN1A 1SL0A 5H6RA 1KB9F 1NTKH 5GTIU 3UO3A 3C21A 2F1MA 5KFJA 3H0RB 1FFXB 5KG3A 2ZIWB 4GX1A 2Q6AA 1US6A 2EIMC 1O08A 4ICGA 1IXMA 4BWMA 2ZE5A 3LWMA 2C2DA 1NZBA 3RJHA 3MR6A 1L3SA 1ZQGA 4J11A 4NLGA 3SYQA 4YHHO 2KJ5A 4K8XA 2PFQA 4LF7B 3OJUA 2C28A 2HP8A 3QU4A 1WCLA 3SYPA 2EIMB 3SR2C 3PO5A 4QZCA 4H13B 4ABMA 4BX9C 4EBEA 4IIJB 4DK1A 3R65A 2H3OA 2PFPA 1R3KC 2ZIMA 4QWDA 4PGQA 2CTPA 3QU7A 4KLTA 2HOQA 1M57C 4ELVA 2KK0A 4PDLA 5LA6B 1ZWIC 1Z4OA 4CS4A 4O3RA 4F4YA 4MF2A 5E79U 1Y74B 4HZ3A 4HYOA 4Z6CA 4X62O 1QBZA 4C8LA 3ZHUA 4DOAA 4J9QA 1KFSA 1Z5WA 3JASA 4PHPA 3L70H 5ALGA 4UBCA 5EK0A 3SAFA 1X6JA 2QLTA 3IRUA 4DEZA 4BUGA 1M57B 2Z3YA 4YN4A 5LP6C 2HMXA 4IC9A 1QQCA 3N2KB 4DOBA 1WB8A 1TK5A 2G38A 1DGSA 1XSPA 5BOLA 3MGVA 1VQNV 2LW1A 5KUMA 1JCHA 1KC8W 2UUBO 1ZQVA 2QTOA 3M6KA 2KMDA 2P67A 1L8OA 4LZGA 1S0MA 1YHQV 1VF7A 4F5PA 2BCVA 4HAMA 5LP6B 1K5SA 3GZFA 3A0BU 4B6JA 1MA7A 4X65B 3KHGA 3RJEA 1XNRO 4UVBA 4WBNB 3VQXA 3RTVA 8ICQA 1ZQAA 1I5YA 2EBOA 4ECSA 4NM1A 1ZQFA 1H2KA 2A9HA 3AUOA 1ZUQA 2H3IA 1L7NA 3M7DA 3PW5A 2HSZA 2AJQA 3LSSA 2H3FA 5J8YA 4J9PA 3TXSA 4KLFA 1TAEA 1HWYA 4HAIA 1THZA 1NNLA 1DGJA 3FAHA 5B1BC 3CNHA 1N2XA 4X1YA 2FPKA 2D3DA 2DMXA 5J2EA 3H1HH 1Q8KA 5GONA 3AEIA 3TFRA 4JWMA 2G09A 2RMKB 2QB0A 1V85A 1JIHA 4MTOA 1N36B 2P22C 2G0AA 3S6JA 2FMSA 4NTXA 3F5EA 5AKYA 5ALZA 3K03A 4DRXA 2IH3C 2MA1A 1SIJA 5J0OA 2FMQA 4J9ZB 2G5IB 1F0MA 2VA8A 1XO0A 1B0XA 3WU2U 3FX7A 4QJFB 2R8IA 5ALNA 3ZDDA 5DB7A 1FJGB 3Q8RB 1RPRA 1ZQLA 2B21A 1F7YA 2R8JA 1GN4A 1BNOA 1ECWA 5KFMA 4QWCA 3G6YA 4MEYA 5ALUA 3AQEA 1H2NA 4I2EA 3PX6A 3BABA 1H8EG 2JRIA 3NR7A 4YR3A 1EBOA 4JYBA 4JI1O 2PYJA 4U7CA 4KMOB 2HR3A 7ICSA 3FM9A 3CW2C 5KHGA 3HPOA 4Q8FA 4UAYA 3M8RA 3MBYA 2DWQA 5JU5A 5LGNA 3JASB 3G71V 1M4UA 1VARA 1EXNA 5J2TB 1JR9A 4B3MO 3H8WA 4GKJO 1L8DA 3MABA 4IQUA 3SAGA 1XOUA 3E22A 4X9QA 4FIPC 4EELA 2WLMA 4FLWA 3T3FA 4DR2B 3H40A 4LH7A 2PYLA 2GTAA 2P90A 3FDSA 2EH9A 1ZQKA 5DG8A 3LNMB 7ICMA 2Q7GA 4JI8B 1L0LH 1JXEA 1T7PA 2VWKA 3X2QC 5L1KA 5C0YA 1WPBA 3V7LA 8ICYA 2E8PA 2HBKA 3BQ2A 1PL0A 4PELA 1AJNA 4CH3A 5KTQA 4G3IA 1HNZB 2ZUDA 1VEWA 5EBMC 1X59A 5AM1A 4BGDA 4Y2XA 3HKEA 2W55A 2CXYA 3ASNC 5B66Z 4B3SB 3AG2C 1FIQA 4RUAA 3MR2A 3CYOA 2P35A 3BCCH 3X2QB 4DF4A 2Q5ZA 5KFOA 1VQMV 3LSUA 3M8SA 5A0LA 1KFTA 5D46A 2R8KA 4J9YB 4X1YB 3JPTA 1ZQNA 3T1YO 8ICJA 1IBLB 4DQPA 5AK4A 1QLEC 3GU3A 5AM3A 3ASNB 4GX0A 2QB0B 2FPMA 4OO1J 3AG2B 2QA4V 3W7XA 5D4BA 5KFNA 3WK4A 5J0YA 1IXRA 5ALRA 1D5NA 3D36C 3NASA 5CP2A 1XQ8A 1ZQTA 5F9NA 3K75D 3MDCA 1PL4A 1S5LZ 3B8NA 3G80A 2ADQB 2FTKA 1B22A 3CMEV 1JX4A 2XCAA 5ALHA 3PSTA 2DGZA 2AQ4A 1UCVA 9ICJA 3ETLA 3ORYA 3M6ZA 4IL6Z 1YITV 4K0KB 9ICNA 2EIJB 2ALZA 2LFSA 1NK0A 3A0HU 1LUVA 4UAZA 1D8YA 2EINC 4LF5B 1BGXT 1K73W 3H7IA 2BCCH 2YQEA 4KHPB 4F6RA 4NL9A 1O9GA 1ZSPA 1Q6HA 3DXRB 1G4YB 2ZXIA 1OZ0A 5J0XA 2F2AB 2EINB 2LFRA 5EIBD 4QZIA 4EEYA 4NWIA 2PUSA 5ALIA 1A0PA 3ISDA 3JPQA 1NR1A 1JMSA 3ZMZA 2WAMA 2GHYA 2A19A 3E22B 4IGGA 2WF9A 3BQ0A 1X9SA 3SYZA 1X9WA 4DR7O 1S0NA 5DGAA 1DK2A 1MA1A 3ZMUA 4TUSA 3IGAC 3G6BA 2ES6A 1YDXA 1VQLV 3RGBA 5IIMA 2CGNA 2QWRB 4DUZO 4FLXA 2NLJC 3JAMN 2KG7B 3C29A 3H1KH 1TA8A 4O4HA 1J2MA 2XY6A 1K97A 3WB1A 2KNJA 5CJ7A 2R8GA 4OXSA 5KG6A 4B9NA 3K0GA 4G28B 1L0NH 5KFQA 2HFEC 1T4GA 4MSWC 4UQGA 3EVKA 1OCRC 5EIBC 5AHXA 4O5EA 3HKEB 4U3JA 2N04A 1RDFA 5ALEA 4M9HA 2UXXA 3ETGA 2OH2A 4QW9A 3ZN1A 4DOCA 2ZG6A 1FXKA 3CRCA 5ALLA 4YMNA 1MABG 1ZQBA 3MDSA 2KFZA 2JDIG 3STLC 5GW7A 4RQ8A 1R3LC 4KLSA 4JI5B 2RLTA 2PKEA 4DSJA 5ALQA 1E79G 5KT3A 4F5RA 1K4DC 4WFEA 4DSLA 2OCCB 3ETQA 2FLNA 3JPNA 3MDAA 1KU9A 1D8LA 3WK5A 1BT8A 1MN8A 3K3WA 1XMOO 2LBOA 2K89A 1HJPA 9ICIA 4X1IA 1KQSU 1RYUA 2RP5A 4FZLA 4FMTA 1N0NA 4ECXA 2FL4A 2XGQA 3ETDA 3QUBA 3PNCA 3IC9A 1L1FA 4KX3A 1FAFA 3RFAA 5EE3A 3PY8A 4I2DA 1WB7A 3RYFA 4UCVA 1R6NA 4I2AA 2LP7A 3E89A 4X89A 2KZMA 4FM1A 4XQ8A 2QKQA 3CEIA 2ZIXA 4TV8B 3C2LA 2DYSC 3CCMV 3ABTA 5CA1B 4CBCA 5K1XA 4P0QA 1SQPH 3CCEV 1KQQA 3O65A 3P3PA 1N60A 4ECRA 2NRZA 2WHEA 3GV5B 4DL5A 1YZBA 4PA7A 4JI8O 5EE0A 4YR2A 2D2CB 1XMQB 1BPYA 3FB5C 3L72H 4JI6B 3RVZA 4DR3O 2D3OW 2A79B 4JZ2A 2DPIA 5J2DA 3G4SV 1L6NA 1JPXA 2ZTDA 4CH5A 1Y4MA 3O9OA 3EWAA 1SQBH 4E2LA 2QARA 1N34B 1SQVH 2WLKA 4J7JA 1TGOA 3TADC 4CS2A 4ZIBA 5CBFA 1HNZO 1VF5B 5FNVA 5CB4A 1NVPD 4K8ZA 2HBLA 1BVSA 1QQ6A 4O4HB 4B3SO 2UVRA 1HW7A 2C2AA 2F8LA 3T4ZA 3VC8A 1WG8A 5AKLA 2HLDG 5AI4A 2DKXA 2RJZA 3RJJA 5KFFA 1SKWA 1IBLO 4KUMA 8ICEA 4U3JB 3W7TA 1CP9A 3TETA 3M9MB 1SF9A 3ABKC 3OJSA 3C1YA 3JCZA 1K1SA 1SKVA 5KHJA 4Y2TA 1FXKB 4F6EA 5J2GA 5LOVB 5AIBA 1VJ5A 2RCVA 4Z6FA 1JFFA 5BMVA 2ZINA 2JHDA 1J97A 3F2DA 1S0OA 4F71A 2ISPA 1DLBA 3UMCA 5KUKA 5L3GA 1SXDA 4J42A 2Y1IA 4CE6A 1BMFG 1MMMA 4K0KO 3LDCA 2K1EA 4X1IB 1JXLA 4UW9A 3BA9A 2M9NA 4FZ1A 4LF5O 3IHQB 1VQ4V 1NVPB 3CCQV 3L75H 4F5NA 5LMNO 2RDIA 2ZCEA 2QEXV 5C8YA 2ZUCA 4C4SA 3ED5A 7ICEA 1SKRA 1KFDA 4FFDA 1Q5OA 4C7YA 4OPHA 4WFBV 1DK3A 1VQ9V 1Z19A 1CEZA 4FVMA 4J03A 4M04A 1SV0A 4P0QB 5DLFA 4YIPA 4JGSA 1M5IA 3MHHC 1KKCA 2HHWA 4I9WA 5KT2A 4QZGA 2DQ0A 3NUQA 1F4NA 2LM4A 4ZOHC 1NKBA 1AB3A 5AK3A 4UB2A 2V4DA 2P6RA 3B4SA 3ZDEA 5IY5C 3UT5B 4PA9A 1YJ9V 3KZIZ 1PK3A 3OTQA 4DW0A 1R3IC 4BDPA 3OR6C 3C2MA 1L3TA 2HVIA 4LZDA 3E8FA 4PA4A 3U0ZA 1X42A 4PJ0U 5KFKA 2QARB 4DQRA 2R9RB 2W0FC 3Q8LA 5B3SC 4PGYA 4ED8A 1BPZA 1SV4A 3QZ7A 5DKWA 4MVZA 1HIWA 5FNVB 1B3QA 2KOBA 1YZ6A 3PW2A 5IY5B 4DL6A 2ZXWC 2P06A 3UCSC 3H4BA 5K4LA 4RPXA 1NS1A 3CJHA 4AI8A 4FLYA 3FYHA 5DG9A 1KN5A 4JPRA 4CC5A 5JVDA 4O3OA 1N62A 4I2FA 4DCCA 3MR3A 2IJHA 2JGUA 2Y69B 4D6TH 1RXVA 4OJOA 1L7OA 4L87A 4WFFA 3B8MA 5B3SB 1W2BU 4JI5O 4OCZA 3OGIB 2JEJA 5AM2A 3BZCA 1XNQB 3IG5A 2XO7A 2MUTA 1OXJA 1QSSA 3TAPA 4ED3A 1AROP 5J0UA 3SGIA 3OSPA 3KD3A 4JYYA 2ODGA 1VP7A 1WAZA 4PHEA 1JFFB 7ICTA 7ICNA 3BY6A 3LK9A 1KP2A 3H8MA 3BDPA 4A8EA 1IZ3A 4F5QA 2YIBA 2BTOA 2ITDC 2BHNA 3ABUA 2LJ2A 4Z2WA 4RU9A 3T1HO 3CC4V 3BPZA 3JD0A 4GZRB 4HYKA 3NGDA 3MFIA 5F2VO 3IG8A 5AI5A 3HX0A 2XAJA 3OHBA
chains in the Genus database with same CATH topology
2QM8A 2EIMB 4MW3A 1SZTA 4X8AA 3H0MB 2WLNA 3OMNB 4WF9V 4BX9C 3H0LB 3UKMA 3VCBA 3R65A 4Z1MG 2KIWA 2HJFC 3IP4B 1Q3VA 1NH2D 3MHSC 2WLLA 1FXKC 1R3KC 2JH7A 5EBLC 2E1EA 3DGEA 1VQOV 1E1QG 4TWKA 2QM7A 2HOQA 1M57C 4QPKA 5LBQA 1PNMA 5HFMA 2CPRA 4H33A 1KBUA 4MTXA 2H94A 4PDLA 1AI4A 4OJPA 3P32A 4BIUA 2DYRC 1GK9A 1ZWIC 1K34A 3SPJA 4HYOA 2Q69A 4HZ3A 1PNKA 1QBZA 3CCJV 4CDGA 2IH1C 3QNEA 4FPPA 4QIWF 2W7PA 5EK0A 3SAFA 1H8HG 2M7WA 1M57B 2JEUA 4BUGA 3CXCU 3CMAV 2Z3YA 2W03A 2HMXA 4IC9A 2HBJA 3OPXA 1URJA 2DYRB 3QO7A 1QLEB 2IJIA 3GB7C 4FJCC 2ZIVB 4MS2A 3MGVA 5FL7G 4WFGA 2PMZC 5B1AC 1JCHA 5KUMA 1KC8W 2QTOA 1VQNV 3L3FX 4WCEV 3M6KA 2K4EA 3CP8A 2P67A 2F77X 4CZZA 3ZCCA 2X6BA 2MK3A 1YHQV 4HAMA 1T94A 1K5SA 1TAMA 3GZFA 1MA7A 2WPDG 4RUEA 3JD3A 4UVBA 1NJIW 3CPWU 2XI9A 3W7SA 1NH2B 2EZOA 3SMVA 2ZDIC 2W04A 1I5YA 3IN5A 2EBOA 2GOLA 4XBFA 2EIKB 2A9HA 3H01A 3F53A 3HB3B 2H3IA 1VQ6V 4UVCA 2R18A 5L3DA 3M7DA 3LSSA 3F2BA 2H3FA 2LKYA 2ZIXB 1MG1A 2ZQMA 1K9MW 1HWYA 1THZA 4ZKIA 2K8BB 4OJ5A 2XIDA 5B1BC 3VOUA 4PL1A 3AEIA 4JAUA 1GO3F 1GM9A 2G09A 4PA6A 1QLNA 3KZXA 2QKSA 3E8GA 4MTOA 1XL6A 4FZNA 2W6IG 4MVQA 2G0AA 3ZRSA 4FE3A 4QPJA 2Z5UA 3F5EA 1QCEA 3K03A 2IH3C 1RM1C 2X0LA 2MA1A 4LP8A 4J9ZB 2G5IB 3PSIA 1OCCC 2JJ2G 1GKFA 1XO0A 4LC1A 2A0LA 1P4RA 2Y69C 2WLIB 5C93A 1K8AW 4QJFB 1GTOA 1BL8A 4MVUA 2LYBA 1JVMA 1G8MA 1RPRA 1CPYA 3JYCA 1BHAA 5HR7A 2DF4B 3T4DA 2HOFA 1RM1B 1ECWA 1PVPA 2WLLB 1OCCB 3AQEA 3ZRWA 3ABLC 1JOYA 3HKZF 2ZR2A 3OAAG 1H8EG 3RBZA 4ZBMA 1Q81W 3SAHA 1EBOA 4JYBA 4UV9A 4JF3A 4P0PA 1Z1BA 5CN0A 1JQ0A 4U7CA 3T2MA 5L3CA 4KMOB 3E0FA 1WUDA 2MRLA 1OCRB 2HR3A 3E8BA 2OM6A 3D3IA 4GX2A 4JTAB 1BHBA 3HKZC 4Q20A 1HEKA 1OHHG 1ORQC 3ZN0A 3ABLB 1MOFA 5LGNA 1ENVA 5LHGA 3FB6C 2X6AA 3G71V 2PI5A 3OR7C 5EC2C 1OCOC 4LCUC 4JTCB 2VJ4A 1N8RW 2KKVA 2JK5C 3SAGA 2VJ5A 4FIPC 2WLMA 4F4LA 3KG2A 2ZIUA 1FXVA 1W0JG 4QNHB 3NXSA 2P90A 2BDUA 2HKOA 4XDLA 1YJWV 3A0RA 4BAYA 3D2QA 3LNMB 3ZRXA 1VQ5V 3WG7C 4G27B 1OCOB 5BZBA 1FXHA 1SESA 2LHTA 2M0NA 3X2QC 5C0YA 1P7DA 1H38A 3MD0A 4H37A 2HBKA 1PL0A 4PELA 1AJNA 4U6PA 5IYDO 1TUEB 4RAIA 5EBMC 5KL8B 1K33A 2CN1A 3ZJZA 3WG7B 4MTGA 1NR7A 2EILC 1JJ2U 2WSSG 3ASNC 3IFXA 3AG2C 3CCRV 3STZC 3CYOA 1UPHA 5HR6A 2Y0SF 3OUFA 4RUFA 3X2QB 3ZMTA 2DYSB 3AG4C 3OEHG 3JD4A 5B1OA 3W7UA 1VQMV 3CC2V 5A0LA 2XAGA 2D6FC 4J9YB 3CC7V 1YSCA 2DQNB 3SPGA 4AYBF 3LSQA 2KJ9A 2BOBC 4ACOA 3ASOC 3PSPA 1B6QA 3GU3A 2OXOA 1QLEC 2XICA 2Y0SC 4OO1J 2EILB 3AG2B 3ASNB 4GX0A 4LBEC 1J95A 1AR1B 1SZHA 4RO2A 3W7XA 2V7QG 1S72V 3AG4B 4P2ZA 5CBGA 1Y66A 4AYBC 3F7VC 1ZQ1C 4MVSA 1AI7A 2KICA 2B5UA 2B1IA 3OE7G 1E1RG 1NBMG 3ASOB 3B8NA 2P6JA 3SYOA 2FTKA 4KP4A 2WAQF 3CMEV 4QIWC 2KD1A 1PVRA 3ZRVA 3PSTA 2DGZA 3OMIB 4MVMA 3M6ZA 2JGAA 2KEYA 2B1GA 4MVRA 1R6KA 3E35A 4PDVA 3ZIAG 1YITV 4PL2A 2EIJB 2EIKC 2LFSA 1SETA 4JASA 3ZRWB 2EINC 3SYCA 3JD2A 2HG5C 1GM8A 1K73W 1KD1W 4P0PB 3K08A 4UXNA 1AI5A 3K04A 1G4YB 1VQKV 1M56C 2ZXIA 1OZ0A 5KA5A 2F2AB 5E1AC 4YXWG 3ABKB 1S77D 1Q3UA 5IDJA 5LGUA 2EINB 3JD1A 2LFRA 2XAFA 2YEVA 3K79A 4NWIA 1DF4A 4QE9A 4R7CA 5CMUA 2W6JG 4CGZA 2ITCC 5H9CA 1A0PA 1YIJV 1M9NA 1NR1A 3ZMZA 4NV0A 2RRDA 2WAMA 2GHYA 3AG3B 3HPLC 3OGCC 3DTUB 2F43G 3ABMB 3RW0A 2JJ1G 4UV8A 2KJ8A 1WPXA 1M56B 3CP1A 3ZMUA 5L3FA 1QR8A 2ZIUB 3IGAC 3LVVA 1VQLV 2KHVA 2DW4A 2NLJC 1PVQA 3VBBA 5L3BA 3C29A 1S3JA 3FYEB 3OW2U 1K97A 1H2GA 5DM6V 1F51A 4BW5A 2XNDG 2KNJA 3PJSK 4OXSA 1IIPA 1COWG 3K0GA 1Q82W 4G28B 2HFEC 4MSWC 2Q67A 1OCRC 1OUQA 1QVGU 3B77A 3ETEA 2IU0A 2WB1F 4UVAA 4GX5A 2UXXA 3ETGA 4ASUG 2OH2A 3W7WA 3ZN1A 2ZG6A 1FXKA 1PKXA 4FZMA 1PNLA 4TSFG 3K1ZA 1MABG 5LHIA 4JMUA 1S0VA 3ALRA 2JDIG 3STLC 1K7DA 5GW7A 1R3LC 2XOKG 1QR9A 2XASA 3KFUF 2WB1C 4MW8A 1E79G 4WFEA 3GWOA 1K4DC 3IC7A 4U7OA 1S76D 4UUJC 3N7PD 4OJ6A 2OCCB 2ZD9A 2QA4V 3CCUV 2ZIVA 3BEHA 4P30A 2H3VA 4BIZA 2QE7G 3K3WA 2XAHA 1FFTB 1JX9A 2IW5A 5IYCO 2LBOA 2K89A 1WLEA 3PSFA 1VQ8V 2GSMB 1KQSU 4JYCA 3K06A 2RP5A 2VIXA 4FZLA 2AHYA 4MT8A 4FMTA 1AJQA 1XL4A 2K8CB 1KKDA 4XDKA 3ETDA 3O0FA 2KHQA 1S5HC 5EBWC 1L1FA 4KX3A 3CRXA 3SJQC 3RFAA 2XAQA 3QO5A 3AQFA 1R6NA 2CK3G 2LP7A 3E89A 4X89A 2OT5A 2JH1A 2P7TC 2ZXWB 5T14A 2Q4TA 4CRXA 2EZPA 1K92A 2ATKC 4I5SA 2ZIXA 3ZMSA 2DYSC 1ED1A 3CCMV 3ABTA 3LDEA 4CBCA 4P0QA 2X6CA 1K3EA 2G08A 1AI6A 4OJLA 4N23A 1YJNV 4KFMA 3I55V 3CCEV 2Z7JA 2ZDIA 3OUSA 3LDDA 4P9OA 4P9PA 3OM3B 4PA3A 2ZXHA 3ML0A 3WFVA 2H3QA 3E2EA 4R8CA 2YEVB 3LVWA 2JEXA 2OTLV 3I56V 2N1RA 3T1CA 2WWWA 4PA7A 5LHHA 2HVJC 3FB5C 3RVZA 2K8AA 3T79A 1PD3A 2D3OW 3K9AA 2A79B 3G6EV 3G4SV 1L6NA 1JPXA 4N21A 1Y4MA 2YSUB 4E2LA 3EHBB 3FYIB 3QO8A 2WLKA 5HFLA 5CBFA 3F7YC 2G07A 3FB8C 1NVPD 1ROPA 2EIJC 2HBLA 1SRYA 1EFRG 2C2AA 2F8LA 3T4ZA 5J9PC 3VC8A 3CCSV 2GH1A 1UJWB 3E83A 3ZMVA 5L3EA 1NKDA 2HLDG 3F5WC 5EC1C 4WJ3B 2HBMA 2CRXA 1KP3A 3CYMA 1YI2V 1V54C 1F44A 4KUMA 5LGTA 2E1FA 2YB4A 4QE7A 3W7TA 1SERA 3NRWA 1CP9A 3TETA 2PI4A 2JIZG 3ABKC 5CA3A 1Q86W 3F2CA 3JCZA 3P30A 3CD6V 1FXKB 4U7NA 2WAQC 4R6ZA 2PMZF 1DTOA 3AG3C 5DN6G 1YT3A 2IJKA 3ABMC 3K0DA 2JHDA 3F2DA 1V54B 2HOIA 1GM7A 2AHZA 4WFAV 2ZIWA 2KVCA 3LYSA 2KB1A 1P7BA 4NLCA 1DLBA 1LNQA 2DWDC 1F4MA 2R9IA 3FKSG 1XNSA 5KUKA 5L3GA 4JTDB 1D8BA 2Q68A 1BMFG 2F76X 3ONNA 1RPOA 3LDCA 4PDMA 2K1EA 4RQEA 2OTJV 2NV3A 3N7SC 3OMAB 3C28A 3ICXA 4C0ZA 4GFJA 1I5XA 4RQFA 3N7RC 1VQ4V 3CCVV 1NVPB 1AJPA 3CCQV 3SQIA 5CBHA 1DRGA 1YTFD 4X88A 2QEXV 5B1AB 1R3JC 2OYYA 5H6QA 4DXWA 1W0KG 3UM7A 2K4HA 3LUTB 2EJRA 4DO2A 4R50A 2DWEC 2IU3A 2X7RB 4WFBV 1VQ9V 2BOCC 2G5HB 1Z19A 3E86A 1CEZA 2NNUA 4FK5C 2KKPA 4P0QB 1K4CC 4JGSA 4G2KA 3MHHC 3SPCA 4I9WA 1GMGA 4O3MA 2DQ0A 3NUQA 1F4NA 3CCLV 2OCCC 4EKWA 1F23A 3F5AA 1A6SA 5IYBO 3PZPA 3DEEA 3RVYA 5IY5C 1YJ9V 4PA9A 2WLHA 2W7OA 3TCUA 4ICAA 2H3ZA 2HVKC 5B1BB 2KV2A 3SYAA 1R3IC 1QVFU 1MSWD 3OR6C 3SPIA 1KECA 4MVOA 3E8FA 1V55C 4PA4A 4NLBA 1VQPV 4TT3G 2R9RB 2W0FC 3AG1C 5B3SC 4MVZA 1HIWA 3RF9A 2IJJA 2KOBA 5IY5B 4BJQA 2ZXWC 3D36A 1YTFB 2DQ3A 4JAVA 4JPRA 3M99B 3FB7C 2IJHA 1V55B 2Y69B 1OCZC 4GCZA 1EZJA 4KX5A 3E8HA 4GT1A 2JMGA 5CRXA 3TK1A 4OJOA 2A3VA 3AG1B 3OFNG 3B8MA 4L87A 4WFFA 5B3SB 2V1DA 1W2BU 2UXNA 2XVTA 3OEEG 1R73A 5KL1B 2E5SA 1K5QA 1M1KW 2RHFA 1DF5A 2YX8A 1M90W 3IG5A 3D2SA 3EFFK 5H6RA 2G06A 1AROP 4QNLA 4XDJA 2H8PC 1Q7YW 1OCZB 2ZR3A 3D2NA 3H0RB 3BY6A 2YB1A 1KP2A 2VKQA 1CRXA 2Y48A 3AL0B 4A8EA 2ZIWB 4MTFA 4GX1A 2Q6AA 2K4IA 1NQTA 2ITDC 2EIMC 3ABUA 1IXMA 3SPHA 3CC4V 5KA6A 3JD0A 1NZBA 2WLJA 4WFHA 1FS0G 4PDRA 2LYAA 3SYQA 2KJ5A 3IG8A 1VQ7V 2XAJA 3SYPA 5B1NA 2WLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDG A;  2MA1 A;  2KV2 A;  5C0Y A;  4QIW F;  2HBK A;  3SAF A;  1YT3 A;  4NLB A;  4QJF B;  2HBL A;  2HBJ A;  4NLC A;  3SAG A;  4CGZ A;  1D8B A;  2E1E A;  2DGZ A;  2HBM A;  2RRD A;  4O3M A;  3CYM A;  1GO3 F;  2CPR A;  2E1F A;  3SAH A;  4OO1 J;  1WUD A;  2RHF A; 
#chains in the Genus database with same CATH topology
 3HIL A;  2N05 A;  4JUZ A;  1WYG A;  1PM9 A;  2ZNJ A;  1BPB A;  4PI0 A;  2B9Z A;  5C8Y B;  2WLN A;  3OMN B;  2EQY A;  3TGU H;  3B2E E;  1IG6 A;  3UKM A;  4JYA O;  5DBA A;  1SZX A;  3IP4 B;  3K5L A;  3G67 A;  2YI9 A;  4EZ6 A;  3OD4 A;  4DV7 B;  3KKA A;  4KLU A;  1VQO V;  4TWK A;  2KTQ A;  1H2L A;  2E8N A;  8ICF A;  2YXH A;  1QSY A;  4IQV A;  4MFC A;  4H33 A;  4MTX A;  1KBU A;  4JI6 O;  2H94 A;  4OJP A;  2KZ3 A;  5KFU A;  5J0T A;  3J81 j;  1JUD A;  1ZQW A;  1S8O A;  2Q69 A;  4J9N A;  3EUB 2;  2F4V B;  3KKY A;  2RQ5 A;  4C8K A;  2IH1 C;  3GIJ A;  2W7P A;  7ICQ A;  4YG2 A;  2YS8 A;  4DL2 A;  9ICX A;  1X2I A;  2JEU A;  4EFB A;  2I1Q A;  5JJE B;  2HBJ A;  2QWP B;  2PF4 E;  1QTM A;  3RB6 A;  4LFC O;  3QO7 A;  3KHL A;  3N2G B;  5EWE A;  2ADP A;  3GB7 C;  5L9X A;  4PD4 F;  3HJE A;  5FL7 G;  5B1A C;  2PMZ C;  4PHD A;  1MNG A;  2R70 A;  2K4E A;  1WJZ A;  5B5E Z;  4DQQ A;  4CZZ A;  2BPF A;  4GC6 A;  2ZE7 A;  3CJH B;  3N27 A;  5JVD B;  3MGI A;  4O2A A;  4DV4 B;  2EAO A;  5J2J A;  4RUE A;  4O3P A;  2XI9 A;  1CXZ B;  3CPW U;  3JPP A;  1Y88 A;  3PW7 A;  3SMV A;  2LMR A;  3UQ0 A;  2ZDI C;  4LFB B;  4XBF A;  3HB3 B;  5AM5 A;  4NXZ A;  3K5O A;  1VQ6 V;  2MUT B;  1NZP A;  4USA A;  3UQ2 A;  5KMG A;  1BNP A;  1O03 A;  4ZKI A;  4X66 B;  3RJK A;  1GN2 A;  1NJZ A;  4DW1 A;  1I94 O;  1SA0 A;  4ECT A;  3VOU A;  2Y4T A;  2E3T A;  1VMG A;  1KEJ A;  2MSN A;  5BR8 O;  3NRZ A;  1XL6 A;  3J80 N;  5DB6 A;  5DG7 A;  2F3N A;  4Y2P A;  2BPC A;  2Z5U A;  3BJY A;  9ICV A;  1N0J A;  4ECQ A;  3JCU Z;  1ZL8 B;  1AP6 A;  3FD9 A;  4KLL A;  4Z1V A;  2A0L A;  1SC5 B;  4QZA A;  1NTZ H;  4GXJ A;  4MVU A;  1EM1 A;  4UBB A;  1ZAU A;  4UAT A;  2GBO A;  2QB1 A;  2DF4 B;  3T4D A;  4DV6 O;  2HOF A;  1BS3 A;  1MC8 A;  1A76 A;  2K9P A;  3OTO B;  4AQY O;  3ABL C;  1KRP A;  2W3R A;  4CF5 A;  3AEV A;  3L4P A;  1JI7 A;  5DDY A;  1MSD A;  4ZBM A;  3SAH A;  1Q81 W;  5DEC A;  4P0P A;  2K4P A;  5L3C A;  5HMM A;  3APQ A;  3E8B A;  1WUD A;  3E0F A;  4I2J A;  4JK1 A;  1X9M A;  2HHH B;  2OM6 A;  5J2U A;  4GX2 A;  4JTA B;  5C5J A;  4Y2V A;  3IDW A;  1HEK A;  3K1R B;  1ORQ C;  3ABL B;  2BSK A;  2CE4 A;  4O4J B;  2UU9 O;  3J7A U;  8ICZ A;  5LHG A;  2X6A A;  1KMI Z;  1HDJ A;  5EC2 C;  1ZJM A;  5JH7 B;  4LCU C;  5JTI A;  2V4Q A;  2VJ4 A;  2GWS A;  2LGQ A;  1N8R W;  2KKV A;  2JK5 C;  4NR1 A;  3U26 A;  4I27 A;  2VJ5 A;  3TKA A;  1NK4 A;  2JRZ A;  2IBZ H;  3BQ7 A;  4I0X B;  4NLK A;  4YR0 A;  3UXO A;  4F4L A;  2DFL A;  3PML A;  4GLX A;  2ZIU A;  1FXV A;  3KG2 A;  1W0J G;  3JAT B;  2OIE A;  4IQW A;  3NXS A;  4XDL A;  2JGD A;  4BAY A;  5J2I A;  4PHA A;  3H1I H;  4LVS A;  1XNQ O;  2PFN A;  1Z4N A;  2NRT A;  5KX5 A;  1H38 A;  3WKD A;  2FI1 A;  8ICN A;  2YIA A;  3SZ2 A;  5IYD O;  2W9A A;  2W43 A;  4IS7 A;  5GTH U;  4RAI A;  5KL8 B;  1K33 A;  2CN1 A;  4LF9 B;  1KW4 A;  2AW9 A;  4B3R B;  4MTG A;  4ELU A;  4YXJ A;  1NR7 A;  1YXB A;  3SJC C;  5IWA B;  2Y4U A;  3IFX A;  4O0I A;  1N63 A;  3STZ C;  1UPH A;  2A1A A;  5HR6 A;  1MZE A;  2Y0S F;  1OV9 A;  3CC2 V;  3JD4 A;  1Z00 A;  3V7J A;  2KG5 A;  2F93 B;  2E8O A;  4FLT A;  1ZQZ A;  5TIS U;  2D6F C;  1SA0 B;  3CC7 V;  4IRK A;  3LSQ A;  9ICK A;  2KJ9 A;  3ASO C;  3RYC A;  7ICK A;  3PSP A;  1NKC A;  4CC6 A;  2UXD B;  5LGT A;  4LBE C;  3QEB Z;  1AR1 B;  1SZH A;  4RO2 A;  4DL7 A;  2Y9T A;  1SQG A;  1S72 V;  3Q8S B;  5CBG A;  3RRG A;  1FPO A;  3F7V C;  4QZ8 A;  2B1I A;  2DL0 A;  3MC1 A;  8ICT A;  3ASO B;  2P6J A;  3JAK A;  4DV7 O;  4KP4 A;  3KTQ A;  2WAQ F;  4QIW C;  1VF6 A;  4MVM A;  2YXL A;  2KEY A;  3THO A;  4B9M A;  3CWB H;  3E35 A;  4PDV A;  1XHZ A;  3ZHS A;  4BIO A;  4JI0 O;  3LNN A;  2XTA A;  1WWV A;  1SET A;  2OYQ A;  3GDX A;  3SYC A;  4I2B A;  4EYH B;  2ZIO A;  2JEI A;  2HG5 C;  4DLE A;  3KCX A;  2ATL A;  2Q73 A;  3UMB A;  2IBK A;  4UB3 A;  2AZ0 A;  4EZ9 A;  4P0P B;  3K08 A;  5B66 U;  9ICQ A;  1XUQ A;  4DR1 B;  3H8J A;  1VQK V;  1K5O A;  1V97 A;  5J2U B;  3VQV A;  1SQQ H;  5KA5 A;  4YJ3 A;  3AG7 A;  1Q3U A;  4PZN A;  2YEV A;  4E0D A;  1DF4 A;  5CMU A;  2ITC C;  3BZK A;  1N33 O;  4NV0 A;  2P4K A;  2YIC A;  1TUB A;  4WF9 V;  3OGC C;  3DTU B;  4DS4 A;  2C2E A;  2FPL A;  1WCN A;  3CP1 A;  5AIA A;  1ZQS A;  1JAL A;  5EZY A;  5L3F A;  2ZIU B;  4DV4 O;  2FB5 A;  2ZM6 B;  3SJB C;  4DSE A;  3M9N B;  4F50 A;  1PVQ A;  1S5L U;  2ZT9 B;  4LFB O;  9ICO A;  4M9J A;  1ZQD A;  1SXE A;  2FJ6 A;  5KX5 B;  1U9L A;  4IL6 U;  4I2G A;  1Q82 W;  4RNM A;  4JV5 O;  5DQH A;  1L7P A;  5EOZ A;  4X66 O;  1V9P A;  1QU7 A;  4O3Q A;  5J0P A;  3WK9 A;  3KBB A;  5GTI Z;  2A3Q A;  5JQG A;  4GX5 A;  1WN7 A;  5KFV A;  4QZH A;  4LF8 O;  1PK1 A;  3GV8 B;  2LQT A;  4FZM A;  5KFB A;  7ICG A;  4TSF G;  3A2F A;  2VQE B;  1X66 A;  5IIJ A;  1Z00 B;  3ZX6 A;  4JMU A;  5LHI A;  2O57 A;  3QZ8 A;  5HP4 A;  1QR9 A;  4MEX A;  4B9L A;  1SB3 C;  1WNS A;  4X64 O;  4DUY B;  1ZQE A;  1XEQ A;  4UUJ C;  3C1Z A;  3N7P D;  4OJ6 A;  5JJN B;  4XUS A;  2NO4 A;  4GYC B;  2ZIV A;  3APO A;  3BEH A;  1Q43 A;  4DV0 O;  2H3V A;  2A7W A;  1N5W A;  4PZO A;  5ALP A;  2XAH A;  1FFT B;  4O4L A;  1WLE A;  3PSF A;  2GSM B;  4P4M A;  4JYC A;  3OTO O;  1S97 A;  2VIX A;  3EXA A;  2AHY A;  3JPO A;  3PW4 A;  2JV3 A;  1IVS A;  3RAX A;  2BTQ A;  2NR5 A;  2BCR A;  8ICH A;  2KHQ A;  1S5H C;  3CRM A;  2E8M A;  2Y9U A;  1C20 A;  1NI3 A;  3CRX A;  2HHQ A;  3QO5 A;  2BE3 A;  4DV2 B;  2EDU A;  1LR1 A;  4TUY A;  3TJT A;  4MF8 A;  1SQX H;  2CK3 G;  9ICS A;  5EE1 A;  4FLV A;  5T14 A;  4YVZ A;  5J8Y C;  4CRX A;  2EZP A;  4K4H A;  2ATK C;  2GUZ A;  1NK8 A;  4Q8E A;  5E79 Z;  1UA1 A;  2UVU A;  2JZB A;  2X6C A;  1K3E A;  4YD1 A;  4UCS A;  1AI6 A;  4OJL A;  4N23 A;  2ZKO A;  5BY1 A;  2UVW A;  4TQR A;  2KP7 A;  3LDD A;  2HCF A;  3I28 A;  4P9P A;  4YJ3 B;  2GO7 A;  2ZXH A;  3ML0 A;  4QGP A;  1SL1 A;  4R8C A;  5KAI Z;  2YEV B;  4M47 A;  2EX3 A;  2JEX A;  2BKE A;  2BCS A;  3I56 V;  2WWW A;  1HR0 B;  2XY5 A;  7ICJ A;  5LHH A;  2A06 H;  2E74 B;  2K8A A;  1PD3 A;  5KT7 A;  4UAV A;  5J2H A;  1TUB B;  2F95 B;  3K9A A;  4LF7 O;  5GON B;  1COK A;  5KT4 A;  2MW2 B;  5EZY B;  3JAL A;  3EHB B;  3A0B Z;  3PX0 A;  2LM1 A;  4LF9 O;  8ICO A;  4DRX B;  1ROP A;  1LVH A;  2EIJ C;  4B3R O;  5IWA O;  3R66 A;  3CCS V;  2E75 B;  5J9P C;  2GH1 A;  1N48 A;  4JI3 B;  2XT9 A;  5KAF Z;  2HBM A;  5CA0 A;  1TVK A;  3EPI A;  1UA0 A;  3CYM A;  4QZF A;  3H1J H;  5J0S A;  1F44 A;  2RQ6 A;  1SER A;  2YB4 A;  1IV8 A;  4J9S A;  5JQG B;  3H8S A;  2JIZ G;  4K4G A;  3CD6 V;  2PFO A;  1ZYQ A;  3C3S A;  1PK1 B;  1ZQJ A;  1XHX A;  4MHV A;  4UAU A;  4R6Z A;  2ILM A;  5KFD A;  3GIM A;  1XI1 A;  1NK7 A;  3RBD A;  5DN6 G;  2DOS A;  2C2R A;  1YT3 A;  2UXC B;  1XO1 A;  4WFA V;  1GM7 A;  3ZDC A;  4PPX A;  2KB1 A;  3LYS A;  2CGO A;  1LNQ A;  3ZHR A;  2DWD C;  1D9F A;  5IYZ A;  2QDO A;  4JTD B;  2VS0 A;  4PDM A;  3ZBH A;  3ONN A;  2BR0 A;  4RQE A;  4DV5 B;  2VA2 A;  3N7S C;  2ZE8 A;  4UB4 A;  3C28 A;  2XGP A;  4X65 O;  2Y0P A;  3CCV V;  2YUA A;  3WKC A;  4IYH A;  4G9B A;  4YY3 B;  1YTF D;  1ZET A;  1R3J C;  4P4O A;  1JMK C;  2EAM A;  5ALV A;  4QW8 A;  4DXW A;  1ZD3 A;  1W0K G;  4TUY B;  4B9V A;  3WK8 A;  4F4K A;  1ZRM A;  3LUT B;  4DO2 A;  3KOO A;  1WP7 A;  2IU3 A;  3ETR A;  5AM0 A;  4PGX A;  3U11 A;  1GAX A;  4JZG A;  2JZB B;  9ICE A;  2L35 A;  2F66 C;  2D8C A;  3V6H A;  2W54 A;  4RPZ A;  1PPJ H;  3SPC A;  1GMG A;  1P7G A;  4O3M A;  4F5O A;  1KKX A;  7ICL A;  3CCL V;  2OCC C;  3E58 A;  1D5A A;  5KG7 A;  3RH4 A;  2NRW A;  5CHG A;  3RB4 A;  1A6S A;  1N36 O;  2AHO B;  4F92 B;  1AR5 A;  3EZ5 A;  1EN5 A;  2H3Z A;  2YN4 A;  2RN9 A;  2KV2 A;  3SYA A;  5KFI A;  5JRT A;  1MSW D;  4RQ3 A;  1V55 C;  1ZQI A;  3JAL B;  1VQP V;  4JI7 B;  2YXY A;  3B40 A;  1Y67 A;  1N32 B;  3V6J A;  1FJG O;  4JB3 A;  1J5E B;  5HNK A;  2IJJ A;  5AKJ A;  1UHU A;  5FPR A;  1YTF B;  8ICS A;  5IT9 N;  5AI6 A;  3FB7 C;  4M2Y A;  1U4B A;  7ICI A;  5K1P A;  1V55 B;  4EEK A;  1N4C A;  4RQ2 A;  1NTM H;  2L5Y A;  4KX5 A;  5CA7 A;  1TVK B;  4GT1 A;  4NL9 C;  5CA0 B;  2A3V A;  3SV4 A;  1RZT A;  3PN1 A;  2V1D A;  2XVT A;  2BDP A;  8ICV A;  5KL1 B;  4X20 A;  3RT3 C;  4DUY O;  1OJH A;  4I2I A;  3V7K A;  2KSO A;  1DF5 A;  3GIK A;  2Q4P A;  3QE9 Y;  2RDJ A;  2H8P C;  1Q7Y W;  1RYR A;  2W8L A;  2ZR3 A;  4F6R B;  1F5S A;  2YB1 A;  2GTS A;  3F5T A;  2VKQ A;  4UAR A;  1CRX A;  1J2N A;  4ZI7 A;  5IJ9 A;  5DDM A;  2AU0 A;  4MTF A;  1WWU A;  4BXO A;  5KFG A;  1NU1 H;  4DR2 O;  5HHH A;  5IYZ B;  3KZI U;  1ZLZ A;  2WLJ A;  4C4R A;  5KFS A;  4PDR A;  2LYA A;  3CRA A;  4QWA A;  4F72 A;  4RQ1 A;  5B1N A;  1Y6X A;  2WLI A;  2QM8 A;  3WB2 A;  4NXN B;  3I5D A;  4LR3 A;  4X8A A;  4NVP A;  4O3N A;  3H0L B;  5J0W A;  2F1H A;  4Z1M G;  5BOM A;  4KLE A;  3NS1 A;  4FS2 A;  5DB8 A;  1Q3V A;  1X4T A;  3MHS C;  4YXM A;  1FXK C;  2NRX A;  2Q0O C;  9ICP A;  5EBL C;  4AP9 A;  3DGE A;  1E1Q G;  2DN9 A;  1JRP A;  5LBQ A;  4J9L A;  2DE0 X;  5HFM A;  4FFB A;  2BCQ A;  5DGB A;  1AI4 A;  4KLO A;  5AKH A;  2CTR A;  3Q4H A;  4Y2U A;  4FS1 A;  1GK9 A;  2UUA B;  2OCE A;  1K34 A;  1DOQ A;  1LV5 A;  3SPJ A;  3B9J A;  4CF4 A;  4AIL C;  1PNK A;  1L3U A;  4IRC A;  9ICB A;  3CCJ V;  3QXG A;  4DR5 B;  4KLH A;  4FPP A;  4LFA B;  3WB0 A;  1H8H G;  4RZR A;  5KG0 A;  4IYI A;  2EAP A;  2VWJ A;  3CXC U;  3KHR A;  3RH6 A;  1RM6 C;  2GLE A;  4DL4 A;  2F1I A;  3HRD D;  2YY6 A;  3OPX A;  2ODM A;  4JI3 O;  1RP3 B;  1VDV A;  2IJI A;  1B06 A;  4MS2 A;  3QU9 A;  4WFG A;  4YMO A;  4WCE V;  3CP8 A;  4EYI B;  4IRD A;  3K58 A;  1ZQC A;  3ZCC A;  2MK3 A;  4NB5 A;  1TAM A;  1Z5V A;  2QTS A;  2HHT A;  2WPD G;  4C80 A;  3JD3 A;  1NJI W;  4BWJ A;  4R65 A;  4F4X A;  4KHP O;  2ZNI A;  1ZD5 A;  3Q8Q B;  2UXC O;  4X20 B;  2W04 A;  1VLB A;  3IN5 A;  1RSO A;  9ICH A;  3RYF B;  2EIK B;  2KSO B;  3H01 A;  3RBE A;  7ICV A;  4DWI A;  4UVC A;  2R18 A;  3QG5 A;  3F2B A;  4FM2 A;  2ZIX B;  1MG1 A;  5G5G A;  2ZQM A;  1K9M W;  4DV5 O;  3PR4 A;  2JEG A;  4OJ5 A;  2XID A;  2B6G A;  1X9X A;  2CAZ C;  1L7M A;  3QUT A;  4DR6 B;  4ZI7 B;  4PL1 A;  2LW7 A;  2W9B A;  1GM9 A;  4PA6 A;  1QLN A;  3RH5 A;  3KZX A;  2HHX A;  1SKS A;  3TAN A;  2QKS A;  3E8G A;  3K9S A;  4I50 A;  4YY3 O;  4FZN A;  1TE2 A;  2W6I G;  4MVQ A;  4H44 B;  1RQN A;  1UT8 A;  2WF8 A;  4FE3 A;  4QPJ A;  3M1Y A;  4IQT A;  4Z6E A;  2UVV A;  3CB2 A;  4JAA A;  4LP8 A;  4I55 A;  3PSI A;  1OCC C;  2JJ2 G;  4EB6 A;  1GKF A;  4LC1 A;  1Y76 A;  1BQZ A;  1P4R A;  1FEZ A;  1NJW A;  5ALD A;  1NI8 A;  1SQF A;  2WLI B;  2EZY A;  3BS7 A;  2Y69 C;  4GUN A;  5C93 A;  2LYB A;  1K8A W;  1JVM A;  5B5E U;  1ZD2 P;  5IIO A;  9ICC A;  2QKA A;  2BQU A;  5LL6 Y;  4DQI A;  3LWL A;  1CPY A;  5CB4 B;  1P84 F;  5AI9 A;  5HR7 A;  1BHA A;  3D6J A;  2V4R A;  4RQ7 A;  1PUZ A;  1OCC B;  3ZRW A;  2DJV A;  7ICO A;  4GKK B;  5KFX A;  3HKZ F;  3OAA G;  2ARH A;  9ICF A;  2W9C A;  4QZD A;  3EYZ A;  2DPJ A;  3CE2 A;  4FFB B;  1BQ0 A;  3T2M A;  1RFY A;  3Q4H B;  3ISB A;  1ZX3 A;  3RYI A;  4R8U A;  3QF7 A;  1BZK A;  4XA5 A;  3JAW A;  1OHH G;  3AK1 A;  1MQ3 A;  5CEH A;  2LI6 A;  1ENV A;  4IHJ A;  1QCK A;  2PI5 A;  3FB6 C;  4NXM B;  3OR7 C;  1OCO C;  4JTC B;  4TV9 A;  2K60 A;  5BMV B;  1N61 A;  9ICR A;  2R72 A;  4JV2 A;  3B0Y A;  4RQ4 A;  3V6K A;  4IT5 A;  2I5H A;  4QNH B;  1NOM A;  4NLZ A;  2HKO A;  4M9L A;  3A0R A;  4B7K A;  3D2Q A;  3ZRX A;  3VQY A;  2HDO A;  1VQ5 V;  3WG7 C;  4CNQ A;  4G27 B;  1OCO B;  5JUM A;  1G1X B;  3GFK B;  2LHT A;  1IBK B;  2M0N A;  8ICX A;  2M6Y A;  4L8J A;  3MD0 A;  4H37 A;  4CCH A;  3PO4 A;  2YDE A;  1SV0 C;  4YJ2 A;  4U6P A;  5KFC A;  2NN4 A;  4JWN A;  3N97 B;  3L73 H;  3KCY A;  1A77 A;  3G6X A;  4M9N A;  3WG7 B;  1U45 A;  4K3A A;  5FPO A;  2WSS G;  2Y1J A;  2PGG A;  3CCR V;  4P4P A;  5JJJ B;  4K4I A;  3OUF A;  3ZMT A;  2E5L B;  2IMW P;  2QGN A;  3QX7 A;  3AG4 C;  3OEH G;  5B1O A;  3W7U A;  4LF4 B;  1XMQ O;  5KFH A;  2KN7 A;  3BFR A;  2DQN B;  3SPG A;  4AYB F;  2E3C A;  2W9B B;  1B6Q A;  3Q8P B;  2Y0S C;  2PXI A;  4O3S A;  1N34 O;  4I50 B;  4NXN O;  2A1J A;  3CX5 F;  2V7Q G;  2YIB D;  3AG4 B;  1Y66 A;  5KG4 A;  4I55 B;  4EB6 B;  2WFA A;  1N56 A;  2B5U A;  1Y76 B;  1NBM G;  1TAU A;  5D5P A;  2ZJA A;  2YTU A;  3ISC A;  3N4M B;  3SYO A;  4K35 A;  4YIO A;  2R8H A;  2KD1 A;  1PVR A;  1XDC A;  4ECY A;  1I08 A;  2B1G A;  1D9D A;  4MVR A;  3ZIA G;  4PL2 A;  1FO4 A;  3LDA A;  4DFK A;  2OEH A;  4J41 A;  1Q6I A;  2CH7 A;  3ZRW B;  4NYK A;  3JD2 A;  3HWT A;  2HHS A;  4LFA O;  4JV1 A;  1GM8 A;  1W59 A;  1SWV A;  4O5C A;  3HW8 A;  2W9C B;  4RUC A;  5L1L A;  4O9M A;  1AI5 A;  4OX9 B;  3K04 A;  4UAW A;  3RYI B;  3ZHV A;  1M56 C;  5EWG A;  1WA8 A;  5DB9 A;  4GXI A;  3JAW B;  2QWO B;  4YXW G;  1FKA O;  5AKI A;  5LGU A;  3JD1 A;  2XAF A;  4IHJ B;  4PJ0 Z;  5KT6 A;  4B9T A;  4F3O A;  4CGZ A;  2W6J G;  3ZI4 A;  4DFM A;  5H9C A;  4LF6 B;  4TV9 B;  4ECZ A;  3AG3 B;  3ABM B;  3RW0 A;  3BS5 A;  4EFE A;  4ED7 A;  3GIL A;  8ICK A;  4KMU A;  2ASJ A;  3WK7 A;  2KJ8 A;  3ZD9 A;  1M56 B;  1WPX A;  3DC6 A;  3ZDA A;  1QR8 A;  3LVV A;  3S3X A;  4R63 A;  1LUW A;  3PMN A;  4IIJ A;  5L3B A;  2H5X A;  1U97 A;  3FYE B;  4HNA A;  2P5O A;  1C7Y A;  3OW2 U;  1SL2 A;  5DM6 V;  1H2G A;  4KLD A;  5ALS A;  4BW5 A;  4W4K A;  3PJS K;  1KL9 A;  2YMQ A;  3KKA C;  1IDS A;  4RPY A;  4YJ2 B;  4FBU A;  1TV9 A;  3T5K A;  5DLG A;  5KFR A;  1QVG U;  5LA6 A;  2OIG A;  3B77 A;  4FM0 A;  2WB1 F;  1JA8 A;  4ZOL A;  4ASU G;  1ZJN A;  3H4D A;  3AU6 A;  4CH6 A;  1PKX A;  2LYH A;  4D7T A;  1EN6 A;  3HKD A;  2AGQ A;  3ALR A;  4JI1 B;  1K7D A;  4I9Q A;  3AM9 A;  2WF7 A;  1YVW A;  3WKE A;  4JV0 A;  2BPG A;  4MW8 A;  4U7O A;  5EE9 A;  3IC7 A;  4C4T A;  4NLN A;  8ICG A;  1X40 A;  4FZ0 A;  5AKG A;  4LJX A;  2FKX A;  4UB8 Z;  3CCU V;  8ICU A;  3DC5 A;  4P30 A;  4CF3 A;  2QE7 G;  5IYC O;  4DFD A;  2IW5 A;  8ICP A;  5ALT A;  1JRO A;  1VQ8 V;  2HHV A;  2IOF A;  3VQW A;  4UB6 Z;  2KVS A;  5LP6 A;  1M6Y A;  4MT8 A;  5L1J A;  1AJQ A;  5IJ0 A;  4GKK O;  3WKB A;  2OCH A;  4XDK A;  2QJ1 A;  1PZN A;  5KG1 A;  5EBW C;  4ECW A;  2J6T A;  4WBN A;  1BPE A;  2ESE A;  3AQF A;  2RNB A;  1AVM A;  2R9A A;  4B7E A;  5J2F A;  2CH7 B;  4BR6 A;  4GXK A;  3JSL A;  3M8A A;  4O2A B;  4I5S A;  4NXM O;  1ED1 A;  1ZQM A;  5AK5 A;  3NVY A;  2JEF A;  2N74 A;  1XSN A;  4KFM A;  2Z7J A;  4Y2S A;  1RXW A;  4ECV A;  1WA8 B;  4DL3 A;  2E76 B;  4J80 A;  4PA3 A;  2HEP A;  3WFV A;  2BQ3 A;  5CR0 A;  5KMG B;  4GC7 A;  2N1R A;  3T1C A;  1NK9 A;  5FP0 A;  3T1Y B;  4B9S A;  3G6E V;  3BS5 B;  1IBK O;  4J9R A;  4DYL A;  3FYI B;  2UXB B;  3GV7 B;  3QO8 A;  4EBC A;  4BWA A;  4YD2 A;  2DBY A;  2IOF K;  2BZF A;  5KNI A;  3F7Y C;  2G07 A;  2P4V A;  3C23 A;  3C5G A;  4HNA B;  2AXT Z;  2EZZ A;  3RN4 A;  5L1M A;  2AGP A;  1IXB A;  5H2F Z;  4TUR A;  2LO1 A;  1UJW B;  3ZMV A;  2E5L O;  4JI4 B;  9ICG A;  2F1J A;  4KLG A;  3QUQ A;  1G6U A;  4LF4 O;  4US9 A;  5KHI A;  3AK3 A;  5EWF A;  1V54 C;  4ZOL B;  3UXN A;  3OHA A;  2YC0 A;  8ICL A;  5CA3 A;  3JAR A;  2YML A;  4Y2J A;  4Q44 A;  2F4V O;  3HKD B;  1GN6 A;  1ZTE A;  2PMZ F;  5ITZ A;  5J2T A;  1DTO A;  2LPE A;  2IJK A;  3K0D A;  4RT2 A;  2XHB A;  5CWR A;  1V54 B;  2PY5 A;  5KAI U;  3TFS A;  5IIN A;  5BXZ A;  2L6L A;  4Y2R A;  1F4M A;  2IHM A;  2R9I A;  1XNS A;  3K5M A;  2BSK B;  3RYH A;  1D8B A;  5AI8 A;  1RPO A;  5JCO A;  4E4E A;  2NV3 A;  2XCP A;  3ICX A;  4GFJ A;  9ICW A;  3QNM A;  3NVW A;  1L3V A;  4QWB A;  3N7R C;  2F23 A;  2YI8 A;  5IJ0 B;  4DR7 B;  4ED0 A;  1NZ6 A;  4O5K A;  5CBH A;  1ZQU A;  4RQ5 A;  1EN4 A;  2JGD B;  2OYY A;  5H6Q A;  4DUZ B;  4OX9 O;  1KSP A;  5KAF U;  5AKZ A;  4TUP A;  2CTQ A;  2K4H A;  5KFW A;  9ICA A;  2EJR A;  2DWE C;  4H0L B;  1HNW B;  2BOC C;  1XS9 D;  2WF6 A;  1WP8 A;  4DF8 A;  4LF6 O;  4FK5 C;  1Q8I A;  2O6K A;  1K4C C;  2ZJ5 A;  4UCR A;  3ZED A;  3IAY A;  1X6I A;  4F2S A;  2JR5 A;  4IR1 A;  4I2C A;  3QVN A;  3RJF A;  1ZQR A;  3C3T A;  1YZ7 A;  3F5A A;  4PI2 A;  1S5J A;  5IE9 A;  5IYB O;  3PZP A;  2PTM A;  4KLI A;  3DEE A;  3THV A;  4NJ8 A;  8ICA A;  2WLH A;  2NYV A;  2CDY A;  4DO9 A;  3TCU A;  4ICA A;  2QR4 A;  5B1B B;  3MAQ A;  1KBH A;  1QVF U;  2KZZ A;  3RYC B;  3SPI A;  1KEC A;  4MVO A;  5KT5 A;  1ZQO A;  1VF6 C;  2XUM A;  1TFR A;  4O2B A;  2WA3 A;  4DFJ A;  1Z2G A;  1T3N A;  2EJ7 A;  4MFF A;  3OGU A;  1EZV H;  1XMO B;  1QHT A;  3D36 A;  1XSL A;  2DQ3 A;  5GTH Z;  2FYU H;  3G6V A;  5KFL A;  2W3S A;  1V38 A;  4QZ9 A;  4D7S A;  3EPG A;  4KLJ A;  2OHF A;  3JAK B;  1XRE A;  1OCZ C;  1NT2 B;  2MAX A;  1EZJ A;  3E8H A;  3TK1 A;  5ALY A;  1BE3 H;  2UXN A;  3DXR A;  5III A;  3OEE G;  4DV1 B;  2HHH O;  1XC9 A;  3SDL A;  1K5Q A;  1M1K W;  3RB0 A;  3JAR B;  2YX8 A;  1PV0 A;  5TIS Z;  1M90 W;  3D2S A;  2Q7H A;  5AG2 A;  5JCO C;  2G06 A;  4TOI A;  4QNL A;  4XDJ A;  4TQS A;  4DQS A;  4OGQ B;  5ITZ B;  3CS5 A;  1OCZ B;  2IM9 A;  1U96 A;  3D2N A;  3ZD8 A;  5KG5 A;  3PW0 A;  1U49 A;  2OWO A;  2Y48 A;  4UCU A;  3AL0 B;  1BPD A;  4EBD A;  2K4I A;  1NQT A;  5D5Q A;  3OTF A;  1UFI A;  1UQV A;  3SPH A;  1ZQQ A;  4LNU A;  5KA6 A;  1ZQH A;  3RYH B;  4WFH A;  2F8K A;  1FS0 G;  2KG7 A;  4F8R A;  4DR3 B;  1LKY A;  1VQ7 V;  3K57 A;  4FFK A;  2Z0A A;  4OD0 A;  2VAN A;  4I7Z B;  4HBN A;  2Q0Z X;  5TZV A;  4MW3 A;  2EAN A;  1NK6 A;  1SZT A;  3H0M B;  4RT3 A;  4EX6 A;  3JSN A;  3JPR A;  2KE7 A;  8ICW A;  3VCB A;  2KIW A;  3R9K A;  5KFZ A;  2AH5 A;  2HJF C;  1NH2 D;  3V72 A;  2WLL A;  5DBC A;  5LXT A;  2JH7 A;  2B0C A;  2WTF A;  4J10 A;  2E1E A;  1NJY A;  3IV6 A;  1HUZ A;  2HHU A;  2QM7 A;  4QPK A;  1MQ2 A;  1PNM A;  2GDS A;  2CPR A;  3P32 A;  4BIU A;  2DYR C;  1BSM A;  3T5L A;  1T5E A;  1ZQX A;  1Z3E B;  2UXD O;  2UXB O;  2QSA A;  1RQL A;  4IR9 A;  5KLV H;  1IBM B;  3L74 H;  4CDG A;  4RNO A;  3CRQ A;  3QNE A;  4QIW F;  3ZS8 C;  2M7W A;  1ZRN A;  2Q0A A;  3GII A;  5J2A A;  3CMA V;  2W03 A;  2DYR B;  1URJ A;  1S9F A;  2ZUB A;  3K4G A;  4M6W A;  3PVX A;  1KYO F;  1O9H A;  1QLE B;  4EX7 A;  4DV3 B;  4JI4 O;  1AQ6 A;  2ZJ8 A;  4FJC C;  2ZIV B;  1SS3 A;  3WU2 Z;  4O2B B;  2VQF B;  3L3F X;  4O4L B;  4NM2 A;  2F77 X;  4TQD A;  2X6B A;  1T94 A;  3RR8 A;  3PV8 A;  1Q90 D;  1QSL A;  1FFV A;  3HR0 A;  3L9D A;  2BTQ B;  4TV8 A;  4W4L A;  3AU2 A;  5LMN B;  3NVZ A;  2I6X A;  3BQ1 A;  4OPA A;  5CA1 A;  3W7S A;  4FLU A;  1NH2 B;  2EZO A;  5AM4 A;  5EYP A;  4DR1 O;  3SEN A;  5H5N A;  2GOL A;  5DQG A;  3F53 A;  4J7Z A;  5L3D A;  2KKW A;  4UB1 A;  2LKY A;  2GUZ B;  4BW9 A;  2PZS A;  3N28 A;  4ED1 A;  2K8B B;  8ICC A;  3SEI A;  5J0R A;  1RG6 A;  3HT3 A;  2JS5 A;  5ALX A;  4DS5 A;  1GO3 F;  2ISO A;  1H2S B;  4JAU A;  3SV3 A;  4I4T A;  4YP3 A;  3BQT A;  4LNU B;  2ZM6 O;  5DED A;  2FE9 A;  3ZRS A;  2W8K A;  3SD7 A;  1QCE A;  3ZDB A;  1RM1 C;  2X0L A;  1LKY B;  4CS3 A;  5BPC A;  4C8O A;  1HNW O;  4B08 A;  4FO6 A;  1GTO A;  4UCT A;  1BL8 A;  3SJA C;  3I76 A;  3C2K A;  1G8M A;  3MFH A;  4KLM A;  3TQ1 A;  4U3F H;  3TAD A;  1IUR A;  2QWN B;  3C5F A;  3JYC A;  4KL1 A;  3K59 A;  5J2K A;  3RR7 A;  1RM1 B;  1PVP A;  2WLL B;  5LXT B;  3QTC A;  4ZHQ A;  4F4Z A;  1FD9 A;  5KFE A;  1JOY A;  2Q9L A;  2ZR2 A;  2VQE O;  4ED6 A;  1COO A;  4UCO A;  5LOV A;  3RBZ A;  2BGW A;  5CN0 A;  4UV9 A;  4JF3 A;  1NJX A;  1Z1B A;  1L5U A;  1JQ0 A;  1LB2 B;  3BRC A;  1OCR B;  2MRL A;  5DBB A;  4DR4 B;  3D3I A;  1BHB A;  3HKZ C;  3WKA A;  1B4F A;  4US8 A;  4DFP A;  4Q20 A;  2I9G A;  3ZN0 A;  1MOF A;  4B3T B;  4PH5 A;  2ZTE A;  4UB5 A;  2KSD A;  1PP9 H;  4KN4 A;  4X1K A;  3B0X A;  1Q46 A;  1URF A;  2JXJ A;  5CB1 A;  4M6W B;  1UT5 A;  4MFA A;  3T1H B;  4P2H A;  7ICU A;  2BDU A;  3FFQ A;  3FC4 A;  1YJW V;  1YCI A;  4DV2 O;  2Q8V A;  4DV1 O;  4DSF A;  1FYJ A;  1YF2 A;  4AHC A;  5BZB A;  1FXH A;  1SES A;  5J2B A;  2QM4 A;  1P7D A;  3Q8K A;  4EEQ A;  1QNM A;  3A0H Z;  7ICP A;  1TUE B;  5EYP B;  4X5V A;  3PR5 B;  3ZJZ A;  2ETN A;  4JYA B;  1JJ2 U;  2EIL C;  3CHX A;  5FLX N;  3RAQ A;  2W11 A;  1BCC H;  5KFA A;  3QU2 A;  4RUF A;  1YEW A;  5KFY A;  2DYS B;  1HR0 O;  3UT5 A;  1GRJ A;  4CH4 A;  2XAG A;  5F9L A;  3GVM A;  1KTQ A;  5IIL A;  1YSC A;  2BOB C;  3AK2 A;  4ACO A;  1VIB A;  2EIL B;  5LMU B;  2OXO A;  4A5U B;  2XIC A;  4I4T B;  1L8L A;  3ZHT A;  2XY7 A;  1J95 A;  7ICF A;  3TAQ A;  3RRH A;  4PHZ A;  5HML A;  1BPX A;  2W9M A;  4P2Z A;  4AYB C;  1ZQ1 C;  1KDH A;  4MVS A;  4Q45 A;  2KFN A;  1AI7 A;  2KIC A;  4R64 A;  1H2M A;  2W0X A;  1HNX B;  2DUY A;  1E1R G;  2WF5 A;  1GH6 A;  3OE7 G;  4LFC B;  2P6U A;  1JJO A;  2UUC B;  3J81 N;  4C8N A;  3ZRV A;  4ELT A;  3UQ8 A;  4XRH A;  3HKB A;  3OMI B;  3BAA A;  4ED2 A;  2JGA A;  1HUO A;  5G5H A;  1R6K A;  1S10 A;  4Y2Q A;  2EIK C;  8ICR A;  2BQR A;  1RYS A;  4NY8 A;  4JAS A;  4ZHQ B;  4J7K A;  1TVA A;  2KQX A;  1NKE A;  5ALK A;  3SR6 A;  3RJG A;  2XC9 A;  1IBM O;  4Z6D A;  1MZF A;  1KD1 W;  1N5X A;  4DLG A;  3QYP A;  1P49 A;  2HVH A;  4UXN A;  4TQF A;  2FMP A;  2NO5 A;  3I1Y A;  4DV3 O;  5E1A C;  2F44 A;  1S77 D;  3ABK B;  5IDJ A;  4NTW A;  5KG2 A;  3DSQ A;  1KLN A;  2FLL A;  3K79 A;  2WA4 A;  2VQF O;  4QE9 A;  4R7C A;  1YIJ V;  3DDH A;  1M9N A;  3GQC A;  1I94 B;  2RRD A;  5ALW A;  3HPL C;  2F43 G;  4X1K B;  3DV9 A;  2JJ1 G;  4UV8 A;  4TUQ A;  1I7F A;  4DSK A;  1T8E A;  5IJ9 B;  4BXO B;  5BR8 B;  2FLP A;  3TAC B;  3OT7 A;  5AKX A;  2KHV A;  1TK8 A;  4ECU A;  3H9V A;  2DW4 A;  3VBB A;  1S3J A;  2EUL A;  1XIL A;  5ALF A;  3RB3 A;  5A9G A;  3HKC A;  1F51 A;  3NVV A;  2XND G;  1IIP A;  1COW G;  5LYJ A;  1ZQY A;  5AKE A;  2AZ2 A;  3KHH A;  3Q8M A;  5F3X B;  3T5H A;  2Q67 A;  1OUQ A;  3ETE A;  1SZP A;  2IU0 A;  2EZX A;  3CXH F;  4UVA A;  4DV6 B;  3RFR A;  4DK0 A;  4GIB A;  3W7W A;  2YID A;  4AQY B;  1XWL A;  1PNL A;  1RPL A;  1OW5 A;  5HHI A;  1R6T A;  3K1Z A;  4JI2 B;  5ALJ A;  1S0V A;  4Q43 A;  3RWR D;  3NTU A;  2XOK G;  2XAS A;  3KFU F;  2ZE6 A;  2WB1 C;  3BHP A;  2DKZ A;  4KN7 A;  3GWO A;  1S76 D;  4UAS A;  3N2G A;  2ZD9 A;  4JI7 O;  3TXQ A;  5KHK A;  1N32 O;  2GV9 A;  4BIZ A;  2UU9 B;  2QWQ B;  1J5E O;  1JX9 A;  4DSI A;  1ZXI A;  3CRR A;  3OSN A;  3AMZ A;  1R1B A;  3UM9 A;  3K06 A;  4Q6G A;  3A8T A;  2CTW A;  1XL4 A;  4LWS A;  2K8C B;  4YFK A;  1KKD A;  4KLQ A;  3K5N A;  1U47 A;  3O0F A;  3QEA Z;  7ICH A;  1U48 A;  4QZE A;  3HKB B;  9ICU A;  3SJQ C;  2XAQ A;  4NTY A;  3PX4 A;  1M93 A;  4YHH B;  4ZH4 A;  3H1L H;  4DR4 O;  2OT5 A;  2JH1 A;  2P7T C;  2ZXW B;  1I0H A;  3IJ4 A;  3CSX A;  2C22 A;  2Q4T A;  3ZMS A;  1K92 A;  4F2R A;  3M9O B;  1UPG A;  4O4I A;  1DXS A;  4B3T O;  4YMM A;  2HI0 A;  3LDE A;  4LH6 A;  3ZHQ A;  1HP8 A;  2G08 A;  1GN3 A;  1YJN V;  4UFZ A;  1D2D A;  3I55 V;  1RSO B;  2ZDI A;  4FBT A;  3OUS A;  4P9O A;  3U10 A;  3T5J A;  3OM3 B;  1K1Q A;  2HW3 A;  1XU4 A;  3E2E A;  2H3Q A;  4I28 A;  3UO2 A;  3HP6 A;  3LVW A;  7ICR A;  2FML A;  2OTL V;  5AIC A;  5J2C A;  5A2Q N;  2HVJ C;  3BA8 A;  3T79 A;  3MR5 A;  3QUC A;  1ZL8 A;  4UB8 U;  4I29 A;  2RDC A;  4J9M A;  4N21 A;  1AR4 A;  2YSU B;  5J0Q A;  4X62 B;  5HFL A;  1NK5 A;  3SI8 A;  4UB6 U;  4C8M A;  2J6S A;  1T3Q A;  3FB8 C;  4C7U A;  1SRY A;  1EFR G;  3HKC B;  4RQN A;  4R66 A;  4F4W A;  4NKG B;  1KUQ A;  1QQ5 A;  2HJD A;  3E83 A;  5LYJ B;  5ALO A;  3FAV A;  5L3E A;  1AIL A;  1NKD A;  3D8C A;  3F5W C;  5EC1 C;  4WJ3 B;  4QWE A;  2CRX A;  1TK0 A;  1KP3 A;  2UUB B;  3B09 A;  1CUK A;  2JS3 A;  1IM4 A;  2FDR A;  4RQ0 A;  4M0A A;  1YI2 V;  5AK6 A;  5DQI A;  3MGH A;  1Q3E A;  2JVD A;  2E1F A;  4PV1 B;  4QE7 A;  4JI0 B;  3NRW A;  2PI4 A;  2UUA O;  5LMU O;  1Q86 W;  3F2C A;  3P30 A;  1ZQP A;  4U7N A;  2WAQ C;  4O4J A;  5KFT A;  4DR5 O;  2V9W A;  2QKC A;  1XNR B;  3L5K A;  5JH7 A;  4KIT B;  3AG3 C;  4RQ6 A;  1FFX A;  3ABM C;  2Q7E A;  1HNX O;  4R8U B;  2HOI A;  2AGA A;  2AHZ A;  1Z1V A;  2KVC A;  2ZIW A;  4YQW A;  4YCX A;  2IHN A;  5L1I A;  4NLC A;  1P7B A;  4I0X A;  5ALM A;  4KXR A;  2UUC O;  1QH9 A;  3FKS G;  1QQ7 A;  4J9K A;  2Y0I A;  3JAT A;  2Q68 A;  2OTJ V;  2F76 X;  1SGG A;  4M9G A;  1N33 B;  3OMA B;  4C0Z A;  1A32 A;  5JWP A;  1ZOL A;  1I5X A;  3EW9 A;  4RQF A;  2KIV A;  3D3Q A;  4LWS B;  1AJP A;  3SQI A;  1DRG A;  4X88 A;  9ICL A;  5B1A B;  2AXT U;  2ASD A;  3UMG A;  3JPS A;  4Y2Y A;  3L71 H;  4F93 B;  5H2F U;  9ICM A;  2YMP A;  3UM7 A;  3GWK C;  1DK1 A;  2VA3 A;  1TAQ A;  3TI0 A;  4R50 A;  1FFU A;  2X7R B;  3E86 A;  2G5H B;  4O4I B;  3P3N A;  4JV5 B;  2NNU A;  2KKP A;  3UPQ A;  4J9O A;  4G2K A;  4F91 B;  4DR6 O;  4EEN A;  1TKD A;  1B04 A;  2J6U A;  4QZB A;  3UXP A;  5J29 A;  1B43 A;  1ZD4 A;  5AI0 A;  1Y74 A;  1F23 A;  8ICI A;  4EKW A;  4LF8 B;  2YMM A;  3TAR A;  4C7Z A;  2P66 A;  1IX9 A;  2AQ0 A;  3RVY A;  5D49 A;  2W7O A;  2NRV A;  4B9U A;  2HVK C;  1JN3 A;  4X64 B;  3RJI A;  3N2K A;  3S3W A;  5KHH A;  1SWW A;  3BVO A;  2ZTC A;  3C90 A;  2VRZ A;  4KTQ A;  5AKK A;  4NLB A;  2LGW A;  1XBL A;  4TT3 G;  2A1J B;  3AG1 C;  4DV0 B;  3QU5 A;  5KFP A;  2MU2 A;  4RWU A;  3WK6 A;  3RF9 A;  4BJQ A;  4B3M B;  1BGY H;  4GKJ B;  3M7M X;  4FLZ A;  8ICB A;  9ICT A;  4JAV A;  2IOH A;  3M99 B;  3FAV B;  5IIK A;  4JI2 O;  4I2H A;  4GCZ A;  2JMG A;  5CRX A;  3AG1 B;  2CUG A;  3OFN G;  4RNN A;  1AP5 A;  2BCU A;  3IM1 A;  2ASL A;  2AGO A;  2E5S A;  8ICM A;  1CI4 A;  1R73 A;  2RHF A;  4RQM A;  3EFF K;  1Q6U A;  2IA6 A;  3AN1 A;  1SL0 A;  5H6R A;  1KB9 F;  1NTK H;  5GTI U;  3UO3 A;  3C21 A;  2F1M A;  5KFJ A;  3H0R B;  1FFX B;  5KG3 A;  2ZIW B;  4GX1 A;  2Q6A A;  1US6 A;  2EIM C;  1O08 A;  4ICG A;  1IXM A;  4BWM A;  2ZE5 A;  3LWM A;  2C2D A;  1NZB A;  3RJH A;  3MR6 A;  1L3S A;  1ZQG A;  4J11 A;  4NLG A;  3SYQ A;  4YHH O;  2KJ5 A;  4K8X A;  2PFQ A;  4LF7 B;  3OJU A;  2C28 A;  2HP8 A;  3QU4 A;  1WCL A;  3SYP A;  2EIM B;  3SR2 C;  3PO5 A;  4QZC A;  4H13 B;  4ABM A;  4BX9 C;  4EBE A;  4IIJ B;  4DK1 A;  3R65 A;  2H3O A;  2PFP A;  1R3K C;  2ZIM A;  4QWD A;  4PGQ A;  2CTP A;  3QU7 A;  4KLT A;  2HOQ A;  1M57 C;  4ELV A;  2KK0 A;  4PDL A;  5LA6 B;  1ZWI C;  1Z4O A;  4CS4 A;  4O3R A;  4F4Y A;  4MF2 A;  5E79 U;  1Y74 B;  4HZ3 A;  4HYO A;  4Z6C A;  4X62 O;  1QBZ A;  4C8L A;  3ZHU A;  4DOA A;  4J9Q A;  1KFS A;  1Z5W A;  3JAS A;  4PHP A;  3L70 H;  5ALG A;  4UBC A;  5EK0 A;  3SAF A;  1X6J A;  2QLT A;  3IRU A;  4DEZ A;  4BUG A;  1M57 B;  2Z3Y A;  4YN4 A;  5LP6 C;  2HMX A;  4IC9 A;  1QQC A;  3N2K B;  4DOB A;  1WB8 A;  1TK5 A;  2G38 A;  1DGS A;  1XSP A;  5BOL A;  3MGV A;  1VQN V;  2LW1 A;  5KUM A;  1JCH A;  1KC8 W;  2UUB O;  1ZQV A;  2QTO A;  3M6K A;  2KMD A;  2P67 A;  1L8O A;  4LZG A;  1S0M A;  1YHQ V;  1VF7 A;  4F5P A;  2BCV A;  4HAM A;  5LP6 B;  1K5S A;  3GZF A;  3A0B U;  4B6J A;  1MA7 A;  4X65 B;  3KHG A;  3RJE A;  1XNR O;  4UVB A;  4WBN B;  3VQX A;  3RTV A;  8ICQ A;  1ZQA A;  1I5Y A;  2EBO A;  4ECS A;  4NM1 A;  1ZQF A;  1H2K A;  2A9H A;  3AUO A;  1ZUQ A;  2H3I A;  1L7N A;  3M7D A;  3PW5 A;  2HSZ A;  2AJQ A;  3LSS A;  2H3F A;  5J8Y A;  4J9P A;  3TXS A;  4KLF A;  1TAE A;  1HWY A;  4HAI A;  1THZ A;  1NNL A;  1DGJ A;  3FAH A;  5B1B C;  3CNH A;  1N2X A;  4X1Y A;  2FPK A;  2D3D A;  2DMX A;  5J2E A;  3H1H H;  1Q8K A;  5GON A;  3AEI A;  3TFR A;  4JWM A;  2G09 A;  2RMK B;  2QB0 A;  1V85 A;  1JIH A;  4MTO A;  1N36 B;  2P22 C;  2G0A A;  3S6J A;  2FMS A;  4NTX A;  3F5E A;  5AKY A;  5ALZ A;  3K03 A;  4DRX A;  2IH3 C;  2MA1 A;  1SIJ A;  5J0O A;  2FMQ A;  4J9Z B;  2G5I B;  1F0M A;  2VA8 A;  1XO0 A;  1B0X A;  3WU2 U;  3FX7 A;  4QJF B;  2R8I A;  5ALN A;  3ZDD A;  5DB7 A;  1FJG B;  3Q8R B;  1RPR A;  1ZQL A;  2B21 A;  1F7Y A;  2R8J A;  1GN4 A;  1BNO A;  1ECW A;  5KFM A;  4QWC A;  3G6Y A;  4MEY A;  5ALU A;  3AQE A;  1H2N A;  4I2E A;  3PX6 A;  3BAB A;  1H8E G;  2JRI A;  3NR7 A;  4YR3 A;  1EBO A;  4JYB A;  4JI1 O;  2PYJ A;  4U7C A;  4KMO B;  2HR3 A;  7ICS A;  3FM9 A;  3CW2 C;  5KHG A;  3HPO A;  4Q8F A;  4UAY A;  3M8R A;  3MBY A;  2DWQ A;  5JU5 A;  5LGN A;  3JAS B;  3G71 V;  1M4U A;  1VAR A;  1EXN A;  5J2T B;  1JR9 A;  4B3M O;  3H8W A;  4GKJ O;  1L8D A;  3MAB A;  4IQU A;  3SAG A;  1XOU A;  3E22 A;  4X9Q A;  4FIP C;  4EEL A;  2WLM A;  4FLW A;  3T3F A;  4DR2 B;  3H40 A;  4LH7 A;  2PYL A;  2GTA A;  2P90 A;  3FDS A;  2EH9 A;  1ZQK A;  5DG8 A;  3LNM B;  7ICM A;  2Q7G A;  4JI8 B;  1L0L H;  1JXE A;  1T7P A;  2VWK A;  3X2Q C;  5L1K A;  5C0Y A;  1WPB A;  3V7L A;  8ICY A;  2E8P A;  2HBK A;  3BQ2 A;  1PL0 A;  4PEL A;  1AJN A;  4CH3 A;  5KTQ A;  4G3I A;  1HNZ B;  2ZUD A;  1VEW A;  5EBM C;  1X59 A;  5AM1 A;  4BGD A;  4Y2X A;  3HKE A;  2W55 A;  2CXY A;  3ASN C;  5B66 Z;  4B3S B;  3AG2 C;  1FIQ A;  4RUA A;  3MR2 A;  3CYO A;  2P35 A;  3BCC H;  3X2Q B;  4DF4 A;  2Q5Z A;  5KFO A;  1VQM V;  3LSU A;  3M8S A;  5A0L A;  1KFT A;  5D46 A;  2R8K A;  4J9Y B;  4X1Y B;  3JPT A;  1ZQN A;  3T1Y O;  8ICJ A;  1IBL B;  4DQP A;  5AK4 A;  1QLE C;  3GU3 A;  5AM3 A;  3ASN B;  4GX0 A;  2QB0 B;  2FPM A;  4OO1 J;  3AG2 B;  2QA4 V;  3W7X A;  5D4B A;  5KFN A;  3WK4 A;  5J0Y A;  1IXR A;  5ALR A;  1D5N A;  3D36 C;  3NAS A;  5CP2 A;  1XQ8 A;  1ZQT A;  5F9N A;  3K75 D;  3MDC A;  1PL4 A;  1S5L Z;  3B8N A;  3G80 A;  2ADQ B;  2FTK A;  1B22 A;  3CME V;  1JX4 A;  2XCA A;  5ALH A;  3PST A;  2DGZ A;  2AQ4 A;  1UCV A;  9ICJ A;  3ETL A;  3ORY A;  3M6Z A;  4IL6 Z;  1YIT V;  4K0K B;  9ICN A;  2EIJ B;  2ALZ A;  2LFS A;  1NK0 A;  3A0H U;  1LUV A;  4UAZ A;  1D8Y A;  2EIN C;  4LF5 B;  1BGX T;  1K73 W;  3H7I A;  2BCC H;  2YQE A;  4KHP B;  4F6R A;  4NL9 A;  1O9G A;  1ZSP A;  1Q6H A;  3DXR B;  1G4Y B;  2ZXI A;  1OZ0 A;  5J0X A;  2F2A B;  2EIN B;  2LFR A;  5EIB D;  4QZI A;  4EEY A;  4NWI A;  2PUS A;  5ALI A;  1A0P A;  3ISD A;  3JPQ A;  1NR1 A;  1JMS A;  3ZMZ A;  2WAM A;  2GHY A;  2A19 A;  3E22 B;  4IGG A;  2WF9 A;  3BQ0 A;  1X9S A;  3SYZ A;  1X9W A;  4DR7 O;  1S0N A;  5DGA A;  1DK2 A;  1MA1 A;  3ZMU A;  4TUS A;  3IGA C;  3G6B A;  2ES6 A;  1YDX A;  1VQL V;  3RGB A;  5IIM A;  2CGN A;  2QWR B;  4DUZ O;  4FLX A;  2NLJ C;  3JAM N;  2KG7 B;  3C29 A;  3H1K H;  1TA8 A;  4O4H A;  1J2M A;  2XY6 A;  1K97 A;  3WB1 A;  2KNJ A;  5CJ7 A;  2R8G A;  4OXS A;  5KG6 A;  4B9N A;  3K0G A;  4G28 B;  1L0N H;  5KFQ A;  2HFE C;  1T4G A;  4MSW C;  4UQG A;  3EVK A;  1OCR C;  5EIB C;  5AHX A;  4O5E A;  3HKE B;  4U3J A;  2N04 A;  1RDF A;  5ALE A;  4M9H A;  2UXX A;  3ETG A;  2OH2 A;  4QW9 A;  3ZN1 A;  4DOC A;  2ZG6 A;  1FXK A;  3CRC A;  5ALL A;  4YMN A;  1MAB G;  1ZQB A;  3MDS A;  2KFZ A;  2JDI G;  3STL C;  5GW7 A;  4RQ8 A;  1R3L C;  4KLS A;  4JI5 B;  2RLT A;  2PKE A;  4DSJ A;  5ALQ A;  1E79 G;  5KT3 A;  4F5R A;  1K4D C;  4WFE A;  4DSL A;  2OCC B;  3ETQ A;  2FLN A;  3JPN A;  3MDA A;  1KU9 A;  1D8L A;  3WK5 A;  1BT8 A;  1MN8 A;  3K3W A;  1XMO O;  2LBO A;  2K89 A;  1HJP A;  9ICI A;  4X1I A;  1KQS U;  1RYU A;  2RP5 A;  4FZL A;  4FMT A;  1N0N A;  4ECX A;  2FL4 A;  2XGQ A;  3ETD A;  3QUB A;  3PNC A;  3IC9 A;  1L1F A;  4KX3 A;  1FAF A;  3RFA A;  5EE3 A;  3PY8 A;  4I2D A;  1WB7 A;  3RYF A;  4UCV A;  1R6N A;  4I2A A;  2LP7 A;  3E89 A;  4X89 A;  2KZM A;  4FM1 A;  4XQ8 A;  2QKQ A;  3CEI A;  2ZIX A;  4TV8 B;  3C2L A;  2DYS C;  3CCM V;  3ABT A;  5CA1 B;  4CBC A;  5K1X A;  4P0Q A;  1SQP H;  3CCE V;  1KQQ A;  3O65 A;  3P3P A;  1N60 A;  4ECR A;  2NRZ A;  2WHE A;  3GV5 B;  4DL5 A;  1YZB A;  4PA7 A;  4JI8 O;  5EE0 A;  4YR2 A;  2D2C B;  1XMQ B;  1BPY A;  3FB5 C;  3L72 H;  4JI6 B;  3RVZ A;  4DR3 O;  2D3O W;  2A79 B;  4JZ2 A;  2DPI A;  5J2D A;  3G4S V;  1L6N A;  1JPX A;  2ZTD A;  4CH5 A;  1Y4M A;  3O9O A;  3EWA A;  1SQB H;  4E2L A;  2QAR A;  1N34 B;  1SQV H;  2WLK A;  4J7J A;  1TGO A;  3TAD C;  4CS2 A;  4ZIB A;  5CBF A;  1HNZ O;  1VF5 B;  5FNV A;  5CB4 A;  1NVP D;  4K8Z A;  2HBL A;  1BVS A;  1QQ6 A;  4O4H B;  4B3S O;  2UVR A;  1HW7 A;  2C2A A;  2F8L A;  3T4Z A;  3VC8 A;  1WG8 A;  5AKL A;  2HLD G;  5AI4 A;  2DKX A;  2RJZ A;  3RJJ A;  5KFF A;  1SKW A;  1IBL O;  4KUM A;  8ICE A;  4U3J B;  3W7T A;  1CP9 A;  3TET A;  3M9M B;  1SF9 A;  3ABK C;  3OJS A;  3C1Y A;  3JCZ A;  1K1S A;  1SKV A;  5KHJ A;  4Y2T A;  1FXK B;  4F6E A;  5J2G A;  5LOV B;  5AIB A;  1VJ5 A;  2RCV A;  4Z6F A;  1JFF A;  5BMV A;  2ZIN A;  2JHD A;  1J97 A;  3F2D A;  1S0O A;  4F71 A;  2ISP A;  1DLB A;  3UMC A;  5KUK A;  5L3G A;  1SXD A;  4J42 A;  2Y1I A;  4CE6 A;  1BMF G;  1MMM A;  4K0K O;  3LDC A;  2K1E A;  4X1I B;  1JXL A;  4UW9 A;  3BA9 A;  2M9N A;  4FZ1 A;  4LF5 O;  3IHQ B;  1VQ4 V;  1NVP B;  3CCQ V;  3L75 H;  4F5N A;  5LMN O;  2RDI A;  2ZCE A;  2QEX V;  5C8Y A;  2ZUC A;  4C4S A;  3ED5 A;  7ICE A;  1SKR A;  1KFD A;  4FFD A;  1Q5O A;  4C7Y A;  4OPH A;  4WFB V;  1DK3 A;  1VQ9 V;  1Z19 A;  1CEZ A;  4FVM A;  4J03 A;  4M04 A;  1SV0 A;  4P0Q B;  5DLF A;  4YIP A;  4JGS A;  1M5I A;  3MHH C;  1KKC A;  2HHW A;  4I9W A;  5KT2 A;  4QZG A;  2DQ0 A;  3NUQ A;  1F4N A;  2LM4 A;  4ZOH C;  1NKB A;  1AB3 A;  5AK3 A;  4UB2 A;  2V4D A;  2P6R A;  3B4S A;  3ZDE A;  5IY5 C;  3UT5 B;  4PA9 A;  1YJ9 V;  3KZI Z;  1PK3 A;  3OTQ A;  4DW0 A;  1R3I C;  4BDP A;  3OR6 C;  3C2M A;  1L3T A;  2HVI A;  4LZD A;  3E8F A;  4PA4 A;  3U0Z A;  1X42 A;  4PJ0 U;  5KFK A;  2QAR B;  4DQR A;  2R9R B;  2W0F C;  3Q8L A;  5B3S C;  4PGY A;  4ED8 A;  1BPZ A;  1SV4 A;  3QZ7 A;  5DKW A;  4MVZ A;  1HIW A;  5FNV B;  1B3Q A;  2KOB A;  1YZ6 A;  3PW2 A;  5IY5 B;  4DL6 A;  2ZXW C;  2P06 A;  3UCS C;  3H4B A;  5K4L A;  4RPX A;  1NS1 A;  3CJH A;  4AI8 A;  4FLY A;  3FYH A;  5DG9 A;  1KN5 A;  4JPR A;  4CC5 A;  5JVD A;  4O3O A;  1N62 A;  4I2F A;  4DCC A;  3MR3 A;  2IJH A;  2JGU A;  2Y69 B;  4D6T H;  1RXV A;  4OJO A;  1L7O A;  4L87 A;  4WFF A;  3B8M A;  5B3S B;  1W2B U;  4JI5 O;  4OCZ A;  3OGI B;  2JEJ A;  5AM2 A;  3BZC A;  1XNQ B;  3IG5 A;  2XO7 A;  2MUT A;  1OXJ A;  1QSS A;  3TAP A;  4ED3 A;  1ARO P;  5J0U A;  3SGI A;  3OSP A;  3KD3 A;  4JYY A;  2ODG A;  1VP7 A;  1WAZ A;  4PHE A;  1JFF B;  7ICT A;  7ICN A;  3BY6 A;  3LK9 A;  1KP2 A;  3H8M A;  3BDP A;  4A8E A;  1IZ3 A;  4F5Q A;  2YIB A;  2BTO A;  2ITD C;  2BHN A;  3ABU A;  2LJ2 A;  4Z2W A;  4RU9 A;  3T1H O;  3CC4 V;  3BPZ A;  3JD0 A;  4GZR B;  4HYK A;  3NGD A;  3MFI A;  5F2V O;  3IG8 A;  5AI5 A;  3HX0 A;  2XAJ A;  3OHB A; 
#chains in the Genus database with same CATH homology
 2QM8 A;  2EIM B;  4MW3 A;  1SZT A;  4X8A A;  3H0M B;  2WLN A;  3OMN B;  4WF9 V;  4BX9 C;  3H0L B;  3UKM A;  3VCB A;  3R65 A;  4Z1M G;  2KIW A;  2HJF C;  3IP4 B;  1Q3V A;  1NH2 D;  3MHS C;  2WLL A;  1FXK C;  1R3K C;  2JH7 A;  5EBL C;  2E1E A;  3DGE A;  1VQO V;  1E1Q G;  4TWK A;  2QM7 A;  2HOQ A;  1M57 C;  4QPK A;  5LBQ A;  1PNM A;  5HFM A;  2CPR A;  4H33 A;  1KBU A;  4MTX A;  2H94 A;  4PDL A;  1AI4 A;  4OJP A;  3P32 A;  4BIU A;  2DYR C;  1GK9 A;  1ZWI C;  1K34 A;  3SPJ A;  4HYO A;  2Q69 A;  4HZ3 A;  1PNK A;  1QBZ A;  3CCJ V;  4CDG A;  2IH1 C;  3QNE A;  4FPP A;  4QIW F;  2W7P A;  5EK0 A;  3SAF A;  1H8H G;  2M7W A;  1M57 B;  2JEU A;  4BUG A;  3CXC U;  3CMA V;  2Z3Y A;  2W03 A;  2HMX A;  4IC9 A;  2HBJ A;  3OPX A;  1URJ A;  2DYR B;  3QO7 A;  1QLE B;  2IJI A;  3GB7 C;  4FJC C;  2ZIV B;  4MS2 A;  3MGV A;  5FL7 G;  4WFG A;  2PMZ C;  5B1A C;  1JCH A;  5KUM A;  1KC8 W;  2QTO A;  1VQN V;  3L3F X;  4WCE V;  3M6K A;  2K4E A;  3CP8 A;  2P67 A;  2F77 X;  4CZZ A;  3ZCC A;  2X6B A;  2MK3 A;  1YHQ V;  4HAM A;  1T94 A;  1K5S A;  1TAM A;  3GZF A;  1MA7 A;  2WPD G;  4RUE A;  3JD3 A;  4UVB A;  1NJI W;  3CPW U;  2XI9 A;  3W7S A;  1NH2 B;  2EZO A;  3SMV A;  2ZDI C;  2W04 A;  1I5Y A;  3IN5 A;  2EBO A;  2GOL A;  4XBF A;  2EIK B;  2A9H A;  3H01 A;  3F53 A;  3HB3 B;  2H3I A;  1VQ6 V;  4UVC A;  2R18 A;  5L3D A;  3M7D A;  3LSS A;  3F2B A;  2H3F A;  2LKY A;  2ZIX B;  1MG1 A;  2ZQM A;  1K9M W;  1HWY A;  1THZ A;  4ZKI A;  2K8B B;  4OJ5 A;  2XID A;  5B1B C;  3VOU A;  4PL1 A;  3AEI A;  4JAU A;  1GO3 F;  1GM9 A;  2G09 A;  4PA6 A;  1QLN A;  3KZX A;  2QKS A;  3E8G A;  4MTO A;  1XL6 A;  4FZN A;  2W6I G;  4MVQ A;  2G0A A;  3ZRS A;  4FE3 A;  4QPJ A;  2Z5U A;  3F5E A;  1QCE A;  3K03 A;  2IH3 C;  1RM1 C;  2X0L A;  2MA1 A;  4LP8 A;  4J9Z B;  2G5I B;  3PSI A;  1OCC C;  2JJ2 G;  1GKF A;  1XO0 A;  4LC1 A;  2A0L A;  1P4R A;  2Y69 C;  2WLI B;  5C93 A;  1K8A W;  4QJF B;  1GTO A;  1BL8 A;  4MVU A;  2LYB A;  1JVM A;  1G8M A;  1RPR A;  1CPY A;  3JYC A;  1BHA A;  5HR7 A;  2DF4 B;  3T4D A;  2HOF A;  1RM1 B;  1ECW A;  1PVP A;  2WLL B;  1OCC B;  3AQE A;  3ZRW A;  3ABL C;  1JOY A;  3HKZ F;  2ZR2 A;  3OAA G;  1H8E G;  3RBZ A;  4ZBM A;  1Q81 W;  3SAH A;  1EBO A;  4JYB A;  4UV9 A;  4JF3 A;  4P0P A;  1Z1B A;  5CN0 A;  1JQ0 A;  4U7C A;  3T2M A;  5L3C A;  4KMO B;  3E0F A;  1WUD A;  2MRL A;  1OCR B;  2HR3 A;  3E8B A;  2OM6 A;  3D3I A;  4GX2 A;  4JTA B;  1BHB A;  3HKZ C;  4Q20 A;  1HEK A;  1OHH G;  1ORQ C;  3ZN0 A;  3ABL B;  1MOF A;  5LGN A;  1ENV A;  5LHG A;  3FB6 C;  2X6A A;  3G71 V;  2PI5 A;  3OR7 C;  5EC2 C;  1OCO C;  4LCU C;  4JTC B;  2VJ4 A;  1N8R W;  2KKV A;  2JK5 C;  3SAG A;  2VJ5 A;  4FIP C;  2WLM A;  4F4L A;  3KG2 A;  2ZIU A;  1FXV A;  1W0J G;  4QNH B;  3NXS A;  2P90 A;  2BDU A;  2HKO A;  4XDL A;  1YJW V;  3A0R A;  4BAY A;  3D2Q A;  3LNM B;  3ZRX A;  1VQ5 V;  3WG7 C;  4G27 B;  1OCO B;  5BZB A;  1FXH A;  1SES A;  2LHT A;  2M0N A;  3X2Q C;  5C0Y A;  1P7D A;  1H38 A;  3MD0 A;  4H37 A;  2HBK A;  1PL0 A;  4PEL A;  1AJN A;  4U6P A;  5IYD O;  1TUE B;  4RAI A;  5EBM C;  5KL8 B;  1K33 A;  2CN1 A;  3ZJZ A;  3WG7 B;  4MTG A;  1NR7 A;  2EIL C;  1JJ2 U;  2WSS G;  3ASN C;  3IFX A;  3AG2 C;  3CCR V;  3STZ C;  3CYO A;  1UPH A;  5HR6 A;  2Y0S F;  3OUF A;  4RUF A;  3X2Q B;  3ZMT A;  2DYS B;  3AG4 C;  3OEH G;  3JD4 A;  5B1O A;  3W7U A;  1VQM V;  3CC2 V;  5A0L A;  2XAG A;  2D6F C;  4J9Y B;  3CC7 V;  1YSC A;  2DQN B;  3SPG A;  4AYB F;  3LSQ A;  2KJ9 A;  2BOB C;  4ACO A;  3ASO C;  3PSP A;  1B6Q A;  3GU3 A;  2OXO A;  1QLE C;  2XIC A;  2Y0S C;  4OO1 J;  2EIL B;  3AG2 B;  3ASN B;  4GX0 A;  4LBE C;  1J95 A;  1AR1 B;  1SZH A;  4RO2 A;  3W7X A;  2V7Q G;  1S72 V;  3AG4 B;  4P2Z A;  5CBG A;  1Y66 A;  4AYB C;  3F7V C;  1ZQ1 C;  4MVS A;  1AI7 A;  2KIC A;  2B5U A;  2B1I A;  3OE7 G;  1E1R G;  1NBM G;  3ASO B;  3B8N A;  2P6J A;  3SYO A;  2FTK A;  4KP4 A;  2WAQ F;  3CME V;  4QIW C;  2KD1 A;  1PVR A;  3ZRV A;  3PST A;  2DGZ A;  3OMI B;  4MVM A;  3M6Z A;  2JGA A;  2KEY A;  2B1G A;  4MVR A;  1R6K A;  3E35 A;  4PDV A;  3ZIA G;  1YIT V;  4PL2 A;  2EIJ B;  2EIK C;  2LFS A;  1SET A;  4JAS A;  3ZRW B;  2EIN C;  3SYC A;  3JD2 A;  2HG5 C;  1GM8 A;  1K73 W;  1KD1 W;  4P0P B;  3K08 A;  4UXN A;  1AI5 A;  3K04 A;  1G4Y B;  1VQK V;  1M56 C;  2ZXI A;  1OZ0 A;  5KA5 A;  2F2A B;  5E1A C;  4YXW G;  3ABK B;  1S77 D;  1Q3U A;  5IDJ A;  5LGU A;  2EIN B;  3JD1 A;  2LFR A;  2XAF A;  2YEV A;  3K79 A;  4NWI A;  1DF4 A;  4QE9 A;  4R7C A;  5CMU A;  2W6J G;  4CGZ A;  2ITC C;  5H9C A;  1A0P A;  1YIJ V;  1M9N A;  1NR1 A;  3ZMZ A;  4NV0 A;  2RRD A;  2WAM A;  2GHY A;  3AG3 B;  3HPL C;  3OGC C;  3DTU B;  2F43 G;  3ABM B;  3RW0 A;  2JJ1 G;  4UV8 A;  2KJ8 A;  1WPX A;  1M56 B;  3CP1 A;  3ZMU A;  5L3F A;  1QR8 A;  2ZIU B;  3IGA C;  3LVV A;  1VQL V;  2KHV A;  2DW4 A;  2NLJ C;  1PVQ A;  3VBB A;  5L3B A;  3C29 A;  1S3J A;  3FYE B;  3OW2 U;  1K97 A;  1H2G A;  5DM6 V;  1F51 A;  4BW5 A;  2XND G;  2KNJ A;  3PJS K;  4OXS A;  1IIP A;  1COW G;  3K0G A;  1Q82 W;  4G28 B;  2HFE C;  4MSW C;  2Q67 A;  1OCR C;  1OUQ A;  1QVG U;  3B77 A;  3ETE A;  2IU0 A;  2WB1 F;  4UVA A;  4GX5 A;  2UXX A;  3ETG A;  4ASU G;  2OH2 A;  3W7W A;  3ZN1 A;  2ZG6 A;  1FXK A;  1PKX A;  4FZM A;  1PNL A;  4TSF G;  3K1Z A;  1MAB G;  5LHI A;  4JMU A;  1S0V A;  3ALR A;  2JDI G;  3STL C;  1K7D A;  5GW7 A;  1R3L C;  2XOK G;  1QR9 A;  2XAS A;  3KFU F;  2WB1 C;  4MW8 A;  1E79 G;  4WFE A;  3GWO A;  1K4D C;  3IC7 A;  4U7O A;  1S76 D;  4UUJ C;  3N7P D;  4OJ6 A;  2OCC B;  2ZD9 A;  2QA4 V;  3CCU V;  2ZIV A;  3BEH A;  4P30 A;  2H3V A;  4BIZ A;  2QE7 G;  3K3W A;  2XAH A;  1FFT B;  1JX9 A;  2IW5 A;  5IYC O;  2LBO A;  2K89 A;  1WLE A;  3PSF A;  1VQ8 V;  2GSM B;  1KQS U;  4JYC A;  3K06 A;  2RP5 A;  2VIX A;  4FZL A;  2AHY A;  4MT8 A;  4FMT A;  1AJQ A;  1XL4 A;  2K8C B;  1KKD A;  4XDK A;  3ETD A;  3O0F A;  2KHQ A;  1S5H C;  5EBW C;  1L1F A;  4KX3 A;  3CRX A;  3SJQ C;  3RFA A;  2XAQ A;  3QO5 A;  3AQF A;  1R6N A;  2CK3 G;  2LP7 A;  3E89 A;  4X89 A;  2OT5 A;  2JH1 A;  2P7T C;  2ZXW B;  5T14 A;  2Q4T A;  4CRX A;  2EZP A;  1K92 A;  2ATK C;  4I5S A;  2ZIX A;  3ZMS A;  2DYS C;  1ED1 A;  3CCM V;  3ABT A;  3LDE A;  4CBC A;  4P0Q A;  2X6C A;  1K3E A;  2G08 A;  1AI6 A;  4OJL A;  4N23 A;  1YJN V;  4KFM A;  3I55 V;  3CCE V;  2Z7J A;  2ZDI A;  3OUS A;  3LDD A;  4P9O A;  4P9P A;  3OM3 B;  4PA3 A;  2ZXH A;  3ML0 A;  3WFV A;  2H3Q A;  3E2E A;  4R8C A;  2YEV B;  3LVW A;  2JEX A;  2OTL V;  3I56 V;  2N1R A;  3T1C A;  2WWW A;  4PA7 A;  5LHH A;  2HVJ C;  3FB5 C;  3RVZ A;  2K8A A;  3T79 A;  1PD3 A;  2D3O W;  3K9A A;  2A79 B;  3G6E V;  3G4S V;  1L6N A;  1JPX A;  4N21 A;  1Y4M A;  2YSU B;  4E2L A;  3EHB B;  3FYI B;  3QO8 A;  2WLK A;  5HFL A;  5CBF A;  3F7Y C;  2G07 A;  3FB8 C;  1NVP D;  1ROP A;  2EIJ C;  2HBL A;  1SRY A;  1EFR G;  2C2A A;  2F8L A;  3T4Z A;  5J9P C;  3VC8 A;  3CCS V;  2GH1 A;  1UJW B;  3E83 A;  3ZMV A;  5L3E A;  1NKD A;  2HLD G;  3F5W C;  5EC1 C;  4WJ3 B;  2HBM A;  2CRX A;  1KP3 A;  3CYM A;  1YI2 V;  1V54 C;  1F44 A;  4KUM A;  5LGT A;  2E1F A;  2YB4 A;  4QE7 A;  3W7T A;  1SER A;  3NRW A;  1CP9 A;  3TET A;  2PI4 A;  2JIZ G;  3ABK C;  5CA3 A;  1Q86 W;  3F2C A;  3JCZ A;  3P30 A;  3CD6 V;  1FXK B;  4U7N A;  2WAQ C;  4R6Z A;  2PMZ F;  1DTO A;  3AG3 C;  5DN6 G;  1YT3 A;  2IJK A;  3ABM C;  3K0D A;  2JHD A;  3F2D A;  1V54 B;  2HOI A;  1GM7 A;  2AHZ A;  4WFA V;  2ZIW A;  2KVC A;  3LYS A;  2KB1 A;  1P7B A;  4NLC A;  1DLB A;  1LNQ A;  2DWD C;  1F4M A;  2R9I A;  3FKS G;  1XNS A;  5KUK A;  5L3G A;  4JTD B;  1D8B A;  2Q68 A;  1BMF G;  2F76 X;  3ONN A;  1RPO A;  3LDC A;  4PDM A;  2K1E A;  4RQE A;  2OTJ V;  2NV3 A;  3N7S C;  3OMA B;  3C28 A;  3ICX A;  4C0Z A;  4GFJ A;  1I5X A;  4RQF A;  3N7R C;  1VQ4 V;  3CCV V;  1NVP B;  1AJP A;  3CCQ V;  3SQI A;  5CBH A;  1DRG A;  1YTF D;  4X88 A;  2QEX V;  5B1A B;  1R3J C;  2OYY A;  5H6Q A;  4DXW A;  1W0K G;  3UM7 A;  2K4H A;  3LUT B;  2EJR A;  4DO2 A;  4R50 A;  2DWE C;  2IU3 A;  2X7R B;  4WFB V;  1VQ9 V;  2BOC C;  2G5H B;  1Z19 A;  3E86 A;  1CEZ A;  2NNU A;  4FK5 C;  2KKP A;  4P0Q B;  1K4C C;  4JGS A;  4G2K A;  3MHH C;  3SPC A;  4I9W A;  1GMG A;  4O3M A;  2DQ0 A;  3NUQ A;  1F4N A;  3CCL V;  2OCC C;  4EKW A;  1F23 A;  3F5A A;  1A6S A;  5IYB O;  3PZP A;  3DEE A;  3RVY A;  5IY5 C;  1YJ9 V;  4PA9 A;  2WLH A;  2W7O A;  3TCU A;  4ICA A;  2H3Z A;  2HVK C;  5B1B B;  2KV2 A;  3SYA A;  1R3I C;  1QVF U;  1MSW D;  3OR6 C;  3SPI A;  1KEC A;  4MVO A;  3E8F A;  1V55 C;  4PA4 A;  4NLB A;  1VQP V;  4TT3 G;  2R9R B;  2W0F C;  3AG1 C;  5B3S C;  4MVZ A;  1HIW A;  3RF9 A;  2IJJ A;  2KOB A;  5IY5 B;  4BJQ A;  2ZXW C;  3D36 A;  1YTF B;  2DQ3 A;  4JAV A;  4JPR A;  3M99 B;  3FB7 C;  2IJH A;  1V55 B;  2Y69 B;  1OCZ C;  4GCZ A;  1EZJ A;  4KX5 A;  3E8H A;  4GT1 A;  2JMG A;  5CRX A;  3TK1 A;  4OJO A;  2A3V A;  3AG1 B;  3OFN G;  3B8M A;  4L87 A;  4WFF A;  5B3S B;  2V1D A;  1W2B U;  2UXN A;  2XVT A;  3OEE G;  1R73 A;  5KL1 B;  2E5S A;  1K5Q A;  1M1K W;  2RHF A;  1DF5 A;  2YX8 A;  1M90 W;  3IG5 A;  3D2S A;  3EFF K;  5H6R A;  2G06 A;  1ARO P;  4QNL A;  4XDJ A;  2H8P C;  1Q7Y W;  1OCZ B;  2ZR3 A;  3D2N A;  3H0R B;  3BY6 A;  2YB1 A;  1KP2 A;  2VKQ A;  1CRX A;  2Y48 A;  3AL0 B;  4A8E A;  2ZIW B;  4MTF A;  4GX1 A;  2Q6A A;  2K4I A;  1NQT A;  2ITD C;  2EIM C;  3ABU A;  1IXM A;  3SPH A;  3CC4 V;  5KA6 A;  3JD0 A;  1NZB A;  2WLJ A;  4WFH A;  1FS0 G;  4PDR A;  2LYA A;  3SYQ A;  2KJ5 A;  3IG8 A;  1VQ7 V;  2XAJ A;  3SYP A;  5B1N A;  2WLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...