4QIWF

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
b'MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 37
structure length 122
sequence length 122
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwF02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qiwF01
4QJFB 4CGZA 2RRDA 2HBJA 1WUDA 3SAHA 1YT3A 2HBMA 2HBLA 2E1EA 4NLBA 3SAGA 3CYMA 2MA1A 2CPRA 1GO3F 4OO1J 4NLCA 4CDGA 2E1FA 2KV2A 2HBKA 5C0YA 1D8BA 4O3MA 2DGZA 2RHFA 3SAFA 4QIWF
chains in the Genus database with same CATH superfamily
2F44A 1J2NA 4JI2O 2I1QA 2KKVA 5J8YA 2HOIA 1NK8A 2KJ8A 1SKSA 5LXTB 4BJQA 4ED6A 4DV2B 3PX4A 1OCRB 3SJAC 5FNVB 3G6VA 4F4LA 4JI2B 2H3FA 1FXHA 4PGYA 4DOAA 3SYPA 5EC1C 1V54B 1QSYA 3ZIAG 1S0MA 3LSSA 3WU2U 5TISU 1JX9A 2F77X 4GC7A 2YSUB 5ALVA 1ZQVA 3K9AA 3MGVA 1NZBA 5J0WA 4DS4A 4RQMA 1IDSA 5LMNO 1KECA 2F1MA 3SDLA 1VQ7V 2B6GA 5KL8B 5DM6V 2AGAA 4DW0A 1S76D 4O3RA 3OHAA 1Q86W 2K89A 4EZ6A 4C8NA 4UCVA 4P4PA 8ICGA 4EEKA 1XSLA 1W59A 4E4EA 4ECZA 5LMNB 2ASDA 2UXCO 2V7QG 2UXNA 4PA7A 4UQGA 3T3FA 2Q4TA 4UB1A 3L73H 5AKLA 2WF5A 2YI9A 3GIMA 2Q0ZX 3H8JA 5IIKA 3J7AU 2M9NA 1SERA 3H0RB 4J9OA 4IQTA 2NNUA 1HUZA 4F4KA 5HMLA 4FZNA 3F5AA 2P6RA 3B0XA 4Y2VA 2HOFA 2YXLA 2XAFA 2OCCC 2Y69C 2ZIOA 2DKZA 1NTKH 5GONB 4FLWA 4WFHA 2LYAA 1RM1C 5KFCA 3HR0A 1ZQKA 1X9XA 1ZSPA 2Q7EA 3AG4C 3QU7A 2PUSA 3QE9Y 1MQ3A 4DSKA 2KSOA 2OEHA 1FXKA 2JVDA 2DKXA 4P2ZA 3N4MB 4I7ZB 3L75H 5KA5A 3WKBA 4I29A 4NB5A 2JJ1G 1NZ6A 3KKYA 4QW9A 3BCCH 2F2AB 3E83A 3H0LB 4XRHA 4O4HB 3QNEA 1BE3H 2P5OA 1L7MA 2P7TC 2QWPB 4H13B 1ZQSA 1P7DA 1WB7A 1EN6A 3CRMA 4KLJA 1NT2B 2ZE5A 4KXRA 4C8OA 3FKSG 1VQMV 2ADQB 2E1FA 2ZXHA 5F9NA 1Z1VA 3CRCA 4F6EA 2KP7A 5LHHA 3AG2C 4CH4A 1L3TA 4F3OA 1WAZA 1KLNA 4CF5A 2PFQA 1KMIZ 1L1FA 5FL7G 1C7YA 3PNCA 3PX6A 1TK0A 4KLEA 1ZRMA 4GXJA 1R6KA 4YFKA 3HPLC 3FAVB 2XCPA 1SL1A 1QH9A 3CRXA 4F8RA 1TUBA 2CH7A 2Q6AA 1AI7A 1SV0C 2WSSG 4LF6O 2BOCC 1AB3A 2HHTA 4J9PA 1VQNV 5AM1A 1B3QA 3Q8KA 4J9MA 1GRJA 3CCJV 2UVUA 4HAMA 1XC9A 2FE9A 2B1GA 3HKBB 4RUEA 4D7TA 1A32A 3T5KA 5DLFA 2WLMA 1MN8A 5FLXN 1VF7A 3CRQA 1D8BA 4LF6B 1QVFU 3RH4A 4L8JA 1N63A 1H2LA 3CPWU 4TQRA 2X0LA 5KX5B 2NRZA 4PD4F 1QQ7A 4LFBO 4I55B 1KP3A 5J0SA 4U7OA 1Z4OA 1JR9A 2AXTU 4F72A 1MG1A 3OSNA 3V7LA 4UAVA 3V6HA 2F23A 4WFAV 1XU4A 2QA4V 5K4LA 4RNMA 3Q8SB 1K34A 1WWVA 2K4IA 2BCVA 2XC9A 3SZ2A 4E2LA 2EILB 1U4BA 3OTOB 1J5EB 2Y0SF 2EZYA 3K5OA 4GCZA 5ALGA 1KC8W 3ASNC 1YI2V 4KP4A 5AKKA 2KQXA 2VJ4A 3PW5A 4JF3A 1ZQBA 4MSWC 2FLNA 5C0YA 4BWMA 5AM2A 1ZQGA 4OPAA 3PW4A 2E75B 5IJ0A 2EBOA 3SD7A 4PHDA 1ZWIC 2Z5UA 5KG0A 4M9JA 5BZBA 4ICAA 2F43G 2HHQA 3SPHA 1VLBA 3TQ1A 3JPPA 4RQFA 4QGPA 2F1HA 2ZIWA 4NYKA 1IBMB 3DTUB 5CRXA 3A0BU 4RQ7A 1BT8A 4DFDA 2BCQA 1O03A 3GDXA 5D4BA 4QIWC 4LNUB 1HW7A 1R6NA 2JXJA 4P9OA 2PXIA 4DLEA 3ZDAA 2XASA 2D8CA 5L3CA 2KN7A 4JV1A 1XSPA 4O5EA 2WLNA 2Y1JA 4IS7A 4DCCA 3M99B 4DQPA 2XNDG 4MVRA 3EVKA 4PA3A 1D2DA 9ICOA 4KLDA 2YS8A 3K08A 2KMDA 1Y74B 3WK7A 2H94A 3SAFA 5DGAA 3TK1A 1YF2A 3M9NB 3RB3A 2UXDO 2HVKC 3CJHA 1ZL8B 3H9VA 4UVCA 3WK5A 3S3XA 1K4DC 3WKDA 4C0ZA 7ICGA 3AM9A 3C1YA 2E1EA 1YTFD 2BQRA 1R73A 1RFYA 5J2TA 5KHJA 1WN7A 4IRDA 4K8XA 1YVWA 3JATB 3ZHQA 1AJQA 1JPXA 3PV8A 1SKRA 4BIZA 4D6TH 5CBGA 2AZ0A 1BQ0A 4QZEA 2AH5A 3PSTA 2DYSC 2YIAA 1HNZB 5JH7B 1LKYA 3H8MA 3BPZA 4EYHB 3BHPA 1WB8A 3E22B 2D3DA 2WLJA 1IM4A 1SL0A 2BPGA 3VOUA 2XT9A 3RT3C 5KFMA 3UO2A 7ICPA 5J0OA 3ZHSA 1E1RG 1XI1A 5BOLA 4I2HA 4ELTA 3QUQA 5CHGA 1SQFA 3GB7C 3ETEA 4NL9A 3NVYA 2PI4A 4O2AB 8ICVA 4NLBA 1LUVA 1ZTEA 3HKDA 1UT5A 5IDJA 1GM8A 3OUSA 4GX2A 4LF7O 2ZJ8A 8ICPA 4LZGA 1N0NA 1TFRA 5KT4A 5L3BA 1V55C 5KFXA 3K75D 5KFLA 3STLC 5G5HA 1NK9A 4GUNA 5ALLA 3RH5A 5KT3A 2IMWP 4B3TO 2MU2A 3IC9A 2DGZA 2OM6A 1URJA 4QW8A 8ICOA 4LF7B 4O9MA 5JU5A 1XNQB 1XHXA 3VQYA 3G71V 2A1AA 2YY6A 4B3TB 3RB0A 1FXVA 1Z3EB 1M1KW 1MSDA 3CCQV 2YMPA 2R8KA 4IT5A 2PYLA 5EWEA 4CF3A 3WG7C 4KLUA 1Q90D 1YZ6A 4UAUA 8ICQA 5J0RA 2ZXWB 3CX5F 3RYFA 3H01A 4DS5A 1KBUA 4RQ3A 2JR5A 4KN7A 2G0AA 3F7VC 4JYCA 1P49A 3CW2C 2F8LA 4X89A 1UCVA 3N7PD 1SETA 5J2DA 2Y9UA 1QCKA 4I28A 4FS1A 3H1IH 3RYCB 1X66A 4B6JA 4FLYA 1ZJNA 4KMUA 1K73W 1ZXIA 1KU9A 2CN1A 8ICNA 5EYPA 4KLOA 2BTQB 3OGIB 5B5EZ 1X59A 4I2FA 3CHXA 3BZKA 1JUDA 4Y2XA 1GKFA 4O3SA 2BSKB 3N28A 5T14A 4NLGA 2IJHA 2WLKA 3LK9A 3IGAC 4L87A 3T5JA 3ZJZA 4EEQA 1RG6A 3LDCA 2XO7A 1A6SA 2Y48A 4YR3A 4P2HA 5G5GA 2F3NA 3JSNA 1YJ9V 1M57B 1TUEB 4OO1J 1ZQZA 3Q4HB 3PVXA 5J0PA 4G3IA 1P7GA 1CRXA 4UB6U 2JMGA 3ZDDA 2OTLV 2FYUH 1L5UA 4I2GA 3CD6V 4OX9B 4FLUA 4P0QB 2PZSA 1WYGA 1WWUA 1R3LC 5AK5A 2W7PA 5KFGA 4Z2WA 5KMGA 1Z19A 3OEEG 3RW0A 4J9LA 3ZN1A 2W6IG 4FJCC 2P67A 2CE4A 3ABKC 2WF8A 5H2FZ 2J6SA 4PDMA 2HLDG 4CH5A 1SESA 3B9JA 4YG2A 4I2AA 1SB3C 4XUSA 2PKEA 1HWYA 2KK0A 1QSSA 1SZTA 3MHSC 3TCUA 1T4GA 3K1ZA 3I28A 2EIMC 2QWNB 3OW2U 2XIDA 4ZBMA 4BWAA 4DW1A 1B4FA 1BL8A 1RSOA 3AK3A 3R9KA 2HBJA 2BPFA 3L4PA 1C20A 1QBZA 4IC9A 1PNMA 9ICBA 5EOZA 3ZMZA 2UXBO 2ZIXA 4UAZA 3AUOA 2HVHA 1WNSA 4JAUA 4NVPA 5ALFA 1Q7YW 3ZD8A 3IHQB 1U48A 3IP4B 1JXLA 2R9IA 3CYMA 4FM1A 3T5HA 1ZYQA 2ITCC 5KFTA 3K59A 2UXBB 3GILA 4J9NA 3K4GA 4NXZA 5KT6A 2XAGA 1AJNA 1KDHA 1L8DA 1RXVA 3ZHTA 4CS4A 3MFIA 5DB7A 5KAFZ 2RJZA 1D8LA 2AGPA 3G6BA 4EZ9A 3KD3A 4WJ3B 4UB3A 5CB1A 1EZJA 1XDCA 1D9FA 2LFRA 2P4VA 4JAAA 4UCUA 2WHEA 5B66U 4ZOLB 1RPLA 1NK5A 2WLIB 4Y2TA 4Z6DA 2Z0AA 1NU1H 4MHVA 1FFUA 1M4UA 1JMSA 3KKAA 1BGXT 5IYBO 1EBOA 4F6RA 3ZMSA 5HMMA 1ZD2P 1IXBA 4OJ5A 4JTAB 4FPPA 3M8AA 3E8HA 2BCRA 2XICA 5FP0A 5L1KA 4CS3A 4O4JB 9ICFA 4MTOA 4H44B 3EPIA 3NRZA 1N4CA 5KG2A 2UUBO 3WB1A 1VARA 1HEKA 4JWMA 3ABLC 3EXAA 4DV1O 2AHOB 4HYKA 4J11A 5ITZA 4GKJO 2QB1A 2GUZA 3LWLA 4WFEA 2AHZA 1DXSA 2UVVA 2DYRC 1XNSA 4J80A 3N2KA 4QPJA 2G38A 3OGUA 1D8YA 4DV1B 3ICXA 1WP7A 4YMOA 1SA0B 1FKAO 3ASOC 3MC1A 5KFKA 1AILA 2HDOA 2VWJA 1SWWA 1M56C 2L35A 2KZ3A 4GKJB 1X2IA 4PHEA 2EULA 1RPRA 2A1JA 1ZQEA 1K7DA 2DQ0A 1YITV 4GX1A 2H3ZA 1PZNA 4MTXA 1IX9A 4AHCA 1IIPA 3C1ZA 1NK7A 4U3JA 2G09A 3ZRWA 5EWFA 5LYJB 4FZ1A 1ZQLA 3ISCA 4EBEA 4PI0A 1S8OA 1NH2D 3CCMV 3SQIA 3JARB 5E79U 4FS2A 3OTFA 5CR0A 2HOQA 4M0AA 1R1BA 1DK3A 4TT3G 2UU9O 2HHVA 5KNIA 4G28B 4ED2A 2Q0OC 5ALZA 5C8YB 2KVSA 3G67A 3PO4A 3MGHA 2GH1A 3RYHA 4NY8A 4R8UA 1UA0A 1QU7A 1VJ5A 1XUQA 5KHKA 2GWSA 1JFFA 2XAHA 2WAMA 2FPKA 4M47A 3DSQA 3FFQA 1U9LA 2UU9B 2HCFA 5J2EA 2AXTZ 2P06A 2NRWA 1P84F 2HSZA 2C28A 3O9OA 2FPLA 2F66C 1SQVH 3A0RA 4Z6FA 5DBBA 4FK5C 4Q6GA 4EBCA 4H33A 2V9WA 4C8MA 1NJXA 9ICEA 2ZD9A 3K5LA 4DR3O 2DFLA 2ZR3A 2V4DA 2QM4A 3FYIB 5J2UB 4IHJB 4YXMA 1Z5VA 1UQVA 4DO9A 1VQKV 2R8HA 1TVKA 2R72A 1HJPA 1X9WA 2ZIVB 4HAIA 2F95B 1LUWA 3VQXA 5ALSA 3UMBA 5KFVA 4MVUA 4DR3B 3RJEA 3H1HH 2ZTCA 4K0KO 5EBWC 4QWDA 2G5IB 4I4TA 1J95A 1F7YA 4RQ0A 2EIKC 4DOBA 5KHHA 4QZIA 2BGWA 4ED8A 5ALIA 2PFNA 1YCIA 1F51A 1N34O 3WK9A 7ICTA 1ED1A 3G6XA 1E79G 3A0BZ 4K0KB 2VIXA 3H40A 2QGNA 3KBBA 3MR6A 5LOVA 2QB0B 1H2SB 1J97A 3LDAA 4NM2A 3IAYA 1SC5B 5J9PC 4DRXA 1N34B 3B4SA 4RPZA 1N62A 2C2AA 3MR2A 1JI7A 2QKSA 2ZDIA 3FC4A 2JEUA 3F5EA 5HHIA 3CRRA 1B43A 4CC5A 4ZHQB 8ICEA 1XO1A 3EUB2 3BDPA 2E74B 2N05A 1N36O 3WKCA 2CPRA 5KG3A 1GO3F 4UBBA 2HHHO 4DSJA 1FEZA 4MFFA 2JGAA 5AK3A 2ZUCA 4QZDA 1B22A 4LH6A 2M0NA 3PO5A 1PKXA 2PI5A 3H0MB 2AU0A 3TAQA 1TK8A 1OCRC 1N36B 3NASA 5ALWA 3OEHG 1PV0A 1NI3A 4Z1VA 2HHHB 4YJ3B 4C7UA 4EB6A 2K1EA 3HJEA 2RN9A 2F8KA 4JYYA 2A0LA 1SQBH 3ETRA 3ZMTA 2ES6A 1XSNA 9ICKA 1XILA 4DR6O 3F5WC 1NZPA 2EQYA 4XDLA 4TUSA 3K9SA 1Q43A 9ICRA 1YEWA 4KLGA 3UXNA 4PZNA 4F5QA 4LWSA 1HR0O 4DR6B 1K5OA 5ALXA 4DLGA 1KP2A 2KG5A 4UCSA 2PMZC 2DPIA 2C2RA 2BKEA 1G6UA 1XL4A 2RDJA 2PFPA 5H9CA 1XQ8A 5DEDA 8ICXA 1J2MA 1HR0B 4F5OA 3BS7A 4AI8A 2E5SA 1G8MA 2HJDA 2W6JG 4Q8FA 1K5QA 4BAYA 3RAXA 3C29A 1RYSA 3PJSK 4FLVA 2RQ5A 4M6WA 1T8EA 3RJKA 5EIBC 4DV3O 4RNNA 1NR7A 3SR2C 1GN6A 4JI1O 1JJOA 4F2RA 4ZH4A 4X20B 4K8ZA 5GTIZ 4O4LB 2WB1C 1GM9A 2F93B 2AGOA 1DOQA 4OJPA 3KZXA 3TXSA 4IRCA 1F0MA 5KFPA 3EFFK 3ETDA 4F91B 4O3PA 1KKCA 4J9YB 2MSNA 4JI1B 4RQEA 3MAQA 3SYQA 2DPJA 1FD9A 3NUQA 3TADA 3V6JA 1XHZA 2LI6A 2JV3A 3C5GA 3DC5A 1L7OA 2MA1A 4YR2A 2X6AA 1E1QG 5J2HA 1ORQC 2PF4E 1UHUA 4RPXA 9ICAA 1SRYA 1AR4A 2JS3A 1IV8A 5IWAO 5FPOA 4Z6EA 1X40A 2KSOB 4ED0A 1Z00A 4DSIA 2Q73A 3QX7A 1F5SA 3E58A 4YIPA 5KFEA 1LB2B 2AW9A 1AI5A 2W8LA 3AU6A 5AKGA 4RQ6A 1TAEA 4IL6Z 1MC8A 2ISOA 5IJ9B 4JZGA 1EN5A 5IWAB 3UMCA 4X1YA 3M8RA 1T3QA 3KG2A 4UB6Z 2CTWA 1BNOA 3RB4A 5KFUA 2AZ2A 3QU9A 4DSEA 3CC2V 4R65A 4OGQB 1RM6C 4K4HA 1K97A 1HIWA 5KT2A 1FO4A 4X1IB 3SJBC 4P9PA 2PY5A 3E35A 4X1KA 3GV5B 4DR5O 3P3PA 4PDRA 4Y2PA 4YXWG 4BW9A 3PW7A 4GXIA 4QWCA 2R8IA 2WPDG 1H38A 1GMGA 4I2BA 1P7BA 5DN6G 4X5VA 3W7SA 1N33O 4YCXA 5KG6A 3L9DA 2IU3A 4QWAA 3ORYA 5ALPA 4DR5B 5F3XB 4EFEA 4QZ8A 3OMAB 4ECTA 8ICYA 1K92A 3HP6A 3HPOA 4TSFG 2K8AA 3CCUV 2XVTA 4F71A 1SV4A 3V6KA 1TUBB 4B7EA 2CH7B 5KG1A 4Y2JA 3PR4A 4DF8A 1ZQ1C 5AIAA 3OPXA 2DWQA 1ZX3A 2ILMA 2ZR2A 2W8KA 1XMQO 1K8AW 2IU0A 2HBKA 2LYHA 4RT2A 2E76B 2KJ5A 3RVYA 3LYSA 4ECRA 1GN4A 3H8SA 3P32A 3D2SA 1SF9A 2EILC 3RVZA 1Q81W 5AI0A 2LJ2A 4LBEC 4YMMA 3ZMUA 1XMQB 3L71H 4KITB 1F44A 5D5QA 1FFXA 1PD3A 2UXCB 3DDHA 1LNQA 1WPBA 2OTJV 2IOFA 5JJJB 1Z2GA 2WAQC 4EEYA 2ZE6A 1COOA 4KL1A 1PNKA 4UVAA 2WTFA 4AYBC 3THVA 2CGOA 3RYIA 4GFJA 3E8GA 4IIJA 5CJ7A 4R7CA 1VQ5V 4MVZA 2XCAA 4J03A 3IG8A 2Y0IA 3BA8A 3KHHA 1NQTA 2ZIUA 5B66Z 4WBNA 2KKWA 1H2NA 3KFUF 1QR8A 2XAQA 3JPSA 3G6YA 1K5SA 3ZDBA 4KN4A 4P4OA 4AYBF 4GC6A 5KG7A 2DE0X 1QR9A 4BXOA 5JVDA 2RP5A 1XMOO 1IBMO 5HFMA 5IJ0B 2DMXA 5CA7A 2B0CA 1N5XA 5IYCO 3GV8B 4UW9A 5AI9A 4KHPO 2EZPA 3CMEV 2ARHA 5KUMA 7ICFA 1XBLA 4DV4O 4JI0O 3M6KA 7ICLA 1RP3B 2UUBB 5C5JA 2ZIWB 1TAMA 2YC0A 3DXRA 3OD4A 3GV7B 4DSLA 1XMOB 3OGCC 2DJVA 4JAVA 1K33A 1BHAA 4K4IA 4DR2O 3ZMVA 4KHPB 3E89A 4U3FH 3CS5A 4DV4B 4JI0B 5LA6A 1KQSU 3CCSV 1ZQWA 4ASUG 3Q8RB 4UB8U 1QLNA 2BCSA 5DECA 2IBZH 4DR2B 4PELA 2YB4A 1KFDA 5LXTA 2Z7JA 2R18A 1TKDA 3AQFA 5JQGA 2NV3A 2IHMA 4ELVA 5DDYA 3HT3A 1UA1A 1SKWA 4QZ9A 4RQ2A 4B9NA 1K1QA 1I5XA 3QTCA 3CJHB 5DQIA 4IR1A 2KG7A 4I2JA 2KD1A 4OCZA 3ZRVA 3TAPA 4NKGB 4PGQA 3O0FA 2IJJA 1NK6A 2BCCH 4J42A 4DYLA 3H1JH 4YHHO 5J2TB 2ATKC 3Q8MA 2F4VO 2KHQA 5DDMA 3ETLA 2YICA 3JAMN 2HG5C 4F5PA 4F5RA 1KFSA 1LKYB 5J0UA 2YIDA 4YHHB 5IIOA 7ICIA 1KKDA 2KB1A 4JTDB 1KD1W 3JD1A 2GSMB 1EFRG 2F4VB 2YN4A 3ML0A 5LP6A 4AQYO 1FYJA 3QO8A 8ICIA 5IT9N 3N97B 4LFBB 4QNLA 2P22C 2YMLA 4R6ZA 1QQ5A 4UCTA 2Q7GA 5JTIA 3HKDB 3JAKA 1COWG 4OD0A 3C28A 5EIBD 1Y88A 3HB3B 3K3WA 4DL6A 1PK1A 4O3MA 4G27B 4H0LB 1WG8A 3F53A 3HX0A 2NN4A 2DBYA 3AG1B 3D3QA 3PMNA 4TOIA 4UCOA 2DN9A 3TJTA 5JWPA 1MABG 4X62O 4O3NA 4US9A 4KX5A 4DQRA 2LGWA 4PHZA 4RWUA 5KUKA 4IQUA 2JH1A 1W0KG 5GONA 3JD4A 5HFLA 1Y76A 3QUTA 8ICZA 4J41A 1K9MW 4JYBA 4YP3A 4X62B 1NTMH 3FAHA 1VF6C 3GIIA 1T5EA 4PDLA 1Z5WA 4KX3A 4CC6A 1ZUQA 2DWDC 4CDGA 2FKXA 1XWLA 2LPEA 3LVWA 3DEEA 3ISBA 4NXMO 3AN1A 1R6TA 3HKZC 3LWMA 7ICJA 1HP8A 2B9ZA 2LMRA 2I9GA 4QIWF 2OIEA 4JTCB 4YIOA 1L3VA 1WCLA 1M57C 4FMTA 5D49A 2LW1A 2Q7HA 5B1AB 4ED1A 2MUTB 3QZ7A 3GU3A 4M04A 3F2DA 5EBMC 3CCRV 1A76A 5EYPB 1Q6HA 2RDCA 1JCHA 4ABMA 3PSPA 5AM5A 2MRLA 2IHNA 2K8CB 5CEHA 4NLCA 4OJ6A 2GTSA 2UXDB 3UKMA 3B8NA 3DC6A 2IOHA 1O9GA 3O65A 3IN5A 2L5YA 1NKEA 1L0NH 3BY6A 5AKIA 4EBDA 4P30A 2Q69A 3H8WA 3A0HZ 5CWRA 3ZBHA 3M9MB 3BQ2A 5EZYA 4LR3A 4MEYA 3CP8A 3L5KA 3S6JA 3OAAG 1BPDA 4MVOA 4I2IA 2EINB 4PZOA 1NBMG 1DF5A 5GTHZ 5LHGA 5IYDO 1IBKO 5L3GA 2KOBA 1AR1B 1SL2A 3RRGA 2VQEO 3V7KA 3LNNA 4ECXA 4PH5A 2Q67A 1N5WA 4YXJA 4I55A 5AM3A 3TGUH 2JGDA 1HUOA 3X2QB 2VKQA 2ISPA 1S0VA 1MZFA 1IBKB 4ELUA 3AL0B 3BEHA 2K8BB 4I2CA 5AKJA 2VQEB 2IOFK 2VWKA 4OJOA 1L8LA 4HNAA 3Q8QB 3FD9A 3MBYA 4Q44A 4UBCA 1O9HA 4CBCA 5AKYA 5KFDA 2YXYA 4ZI7A 4ZOHC 3CXHF 5KT7A 5B1NA 4Y2YA 3QVNA 1SQPH 9ICVA 4EYIB 2WLLA 4QZFA 2E8MA 2ZIXB 2XY7A 1UPHA 3B0YA 1VQOV 3K5NA 1S5LU 2HMXA 2M6YA 3ZHUA 3CXCU 2OIGA 5B3SB 2ITDC 4JI6O 4DQSA 4FBTA 3RF9A 1TGOA 4YJ2A 1D9DA 4TV9A 4MS2A 2WFAA 1AJPA 2IA6A 8ICBA 5HNKA 1JQ0A 3IDWA 4EX6A 5J2FA 1K3EA 3FB7C 1PNLA 2CXYA 3C2LA 5BMVA 3U0ZA 4JI6B 4LJXA 5F9LA 3BS5A 4UAYA 5J2KA 2DUYA 5D5PA 4LNUA 4J9KA 3AEVA 1SZPA 4UARA 2IH1C 4QE7A 2MAXA 1AROP 3OE7G 4BWJA 4MEXA 1EN4A 2Q8VA 3B8MA 5TZVA 2EZOA 3ZS8C 1HDJA 2Y9TA 4F4WA 3EYZA 4UASA 4ED3A 3VQVA 3HILA 4F6RB 1VQLV 2HI0A 4X66O 4AILC 7ICVA 4ECVA 2G5HB 2YXHA 1Y74A 3A2FA 4TUYA 4TV8A 3LUTB 3D36C 2EAPA 5J2JA 4MVSA 3MD0A 3W7UA 1ZQIA 3QYPA 4EENA 2QARA 1R3JC 1ZL8A 3BRCA 3N2GA 3LDDA 1O08A 2QKCA 3IC7A 4X66B 2W7OA 1IVSA 5L9XA 5LGUA 1S97A 4DFKA 4KLHA 2NR5A 4CH3A 5KFQA 4UAWA 5LMUO 3T1HO 4GKKO 5ITZB 1WCNA 2NO5A 3WU2Z 4XA5A 4FZMA 1BPEA 2GUZB 2V4QA 5TISZ 3OJUA 1Q46A 2XAJA 3N2KB 1OCZB 3OR6C 4RZRA 2FMQA 5LMUB 1YJWV 1SV0A 4GKKB 2QKQA 3RR7A 2W9MA 2HHSA 5ALHA 4MF8A 2HW3A 8ICRA 1VEWA 1WJZA 4BIUA 2A1JB 9ICNA 1OJHA 5JJNB 3JALA 3N7SC 4DK0A 3RBEA 4NR1A 2JK5C 1LV5A 3ZDCA 4P0PA 3ZRWB 4LF9O 4CGZA 1KTQA 3JPRA 2LQTA 2K4EA 3JCZA 3SV3A 3CNHA 5IY5B 2DOSA 2HEPA 4I5SA 2KIVA 1TK5A 2JEJA 3WK4A 3TETA 4I9WA 3VC8A 1F4NA 2LKYA 3UQ0A 2ZE7A 3ZI4A 4JI8O 3RYHB 4R8UB 1JFFB 2HHUA 1K1SA 3UMGA 1CEZA 4GX5A 3SYCA 3CSXA 3OMIB 2XGQA 2W03A 4F93B 3HRDD 1BS3A 2P6JA 1BMFG 3L3FX 1VQ8V 4JI8B 3PSFA 4NM1A 3TARA 3BQ1A 2XY6A 4RO2A 4F50A 1N32O 2ATLA 2I6XA 1TVKB 2NRXA 5GW7A 4LFCO 1VQ4V 1PM9A 3MDAA 5KFWA 1K4CC 2WA4A 2DW4A 5AHXA 4I4TB 4PI2A 1N32B 2HKOA 1XNRO 4YN4A 3UT5B 5KFJA 2VANA 3QO5A 4DUZO 4UB4A 1D5AA 4KLTA 2LGQA 5JJEB 4WF9V 2RDIA 3C21A 4FZLA 3OM3B 4FLTA 5J2GA 4CZZA 1NJIW 2BCUA 3L72H 2YTUA 2B21A 5CB4A 1ZJMA 2BQUA 2QWRB 5LOVB 4NLNA 4C4TA 4DUZB 1BNPA 4Y2QA 3J81j 1R3KC 4U6PA 4DRXB 4O5KA 2YUAA 4ACOA 1GAXA 2UVWA 2A3QA 3Q4HA 3RFRA 3PX0A 1NK4A 5B1OA 5K1XA 2FDRA 4M9NA 3M9OB 4IGGA 2EIJB 3ZRXA 1X42A 1ZQDA 1L3UA 1NJWA 3AK2A 3MDSA 3ISDA 5J8YC 2W3SA 3HKEB 2CAZC 5ALMA 2NLJC 3BA9A 2BZFA 4QZHA 3R66A 5DLGA 3C90A 2KZMA 5K1PA 5IINA 1ZQFA 5HP4A 2EH9A 4C7ZA 3M1YA 4EB6B 1ZQRA 1KQQA 2AQ4A 3IRUA 3HW8A 2EDUA 2ESEA 8ICWA 3K0DA 4DL2A 2W55A 3OJSA 3K57A 3RGBA 2QM8A 4LZDA 5IYZA 3JSLA 3E8BA 2JJ2G 4MVMA 1ZQAA 8ICMA 3JD2A 2KV2A 3H4DA 2JZBB 2LBOA 4DF4A 1WA8A 3CP1A 1IG6A 2ZKOA 7ICSA 5D46A 4OXSA 5HHHA 1CXZB 4PGXA 4X88A 2ODMA 4U7CA 4LWSB 1B06A 4O2BA 4DR4O 1VF5B 4LP8A 1JX4A 2ZNJA 2ZTDA 1NNLA 2PGGA 1UFIA 4RAIA 5CN0A 1ZQYA 2DQNB 2E8PA 9ICLA 2CUGA 4X65O 3T1YO 2CTRA 2W9CA 2Z3YA 5DBCA 5KAIU 3JPNA 5AK6A 4DSFA 2C2DA 8ICCA 2DL0A 2OHFA 1THZA 3B09A 4MT8A 5KA6A 5L3FA 4DR4B 3SPGA 5KFAA 4JMUA 3RBDA 4JV2A 2XTAA 4J9SA 1PVQA 3FB8C 1T94A 2EZZA 4FZ0A 3SPJA 2OYYA 2KFNA 3T1YB 5EE9A 3T79A 4GT1A 3QO7A 5J0QA 4M6WB 1MZEA 3BVOA 2OCEA 4F4XA 9ICJA 1Q6UA 4UB2A 3GWOA 2Q9LA 3AMZA 4I50A 2AHYA 3NGDA 1JXEA 5KFOA 5KFIA 3J81N 3UPQA 1ZQQA 4C7YA 5ALJA 3P30A 4FFKA 5EE0A 3ABMB 2OT5A 5EE3A 1IXRA 1NVPB 1B6QA 2K60A 4KMOB 2DF4B 5KTQA 4RQNA 2E8NA 4MFCA 7ICOA 3C2MA 4UV9A 3GWKC 3RWRD 4FFDA 4F2SA 2KICA 5J2BA 4E0DA 3SEIA 4GX0A 5DQGA 1GK9A 5BOMA 1Z00B 2I5HA 3QU2A 2LM1A 5DB9A 2JEFA 2AJQA 2A3VA 1ZQCA 2RNBA 3PZPA 1V54C 1YT3A 3CCLV 2EJRA 4LFAO 1L0LH 4X1YB 1BHBA 8ICJA 2EJ7A 5KL1B 2YIBD 2B1IA 3SPCA 5AM4A 3BFRA 1Q8IA 1V38A 1XL6A 4ZKIA 5HR7A 1BPYA 2YIBA 3JAWA 2K9PA 1JVMA 5ALRA 2H8PC 4JASA 1OUQA 3WK8A 2HVIA 3TFSA 2YEVA 1NKCA 1H2KA 1Y6XA 1VQ6V 2ASJA 4X1KB 3GIKA 4DO2A 3BQ0A 4BR6A 9ICCA 5B1BB 2N04A 4YD2A 3IM1A 1VMGA 2BDUA 2ZJ5A 4WCEV 2DWEC 5KFNA 1US6A 1IBLO 4JYAO 5AI8A 5ALUA 2Y4UA 4KLQA 3TXQA 2IJIA 2JGUA 1S0NA 4I2DA 3NVZA 2FLLA 4J9QA 7ICKA 3JCUZ 4DL7A 4FIPC 3WB0A 3H1LH 3IG5A 5EWGA 2PMZF 5IILA 1Q3VA 4N21A 3DV9A 3CC7V 5CA3A 1IBLB 2P35A 4JYAB 1GH6A 4MVQA 4UVBA 1VQ9V 4BW5A 1OV9A 3JASA 1DK1A 3RBZA 2VQFO 4ZIBA 4FM2A 5DBAA 1S5LZ 1V9PA 5DG8A 4DV3B 2A19A 1HNXO 1FFXB 3ALRA 4JB3A 3STZC 1BZKA 1ROPA 2OWOA 4RQ4A 1BPBA 3H4BA 2VQFB 4MW8A 3F2BA 1F23A 5CA0A 4DV6O 1B04A 1M93A 3RYIB 4PL2A 2ZXIA 4IIJB 1HNXB 5C93A 4Z6CA 1VP7A 5ALEA 2WB1F 9ICGA 4FBUA 2G08A 1KFTA 4NLKA 2ZIUB 2GHYA 4DV6B 4NJ8A 4WBNB 4FE3A 1FXKB 3UM9A 2KE7A 4Q45A 1I94O 4IRKA 4BDPA 4I0XA 3M6ZA 1ZQUA 1MOFA 4NLZA 1FJGO 4JI4O 1OCCB 1CUKA 1KSPA 3PW0A 4W4KA 2PFOA 2NO4A 1XO0A 1Z4NA 1AVMA 3E8FA 3GQCA 5ALNA 3B77A 1I94B 4B08A 3E86A 5A0LA 3DXRB 5JCOC 4JI4B 1FJGB 3K58A 2AGQA 4UV8A 3QNMA 4U7NA 3BQ7A 1L8OA 2P90A 4DV2O 2PTMA 4QZBA 1DLBA 2CGNA 5LA6B 7ICRA 3LVVA 3ZHVA 1BSMA 3ZN0A 3W7WA 3PN1A 1ZQPA 2BE3A 2HR3A 1GN2A 4ECSA 2Q0AA 4O4IA 1ZOLA 1L7NA 4GIBA 3AG3B 2YQEA 3PY8A 1JJ2U 2HBMA 3SJCC 2VS0A 2V4RA 1X9SA 1KW4A 2IBKA 2IH3C 5JQGB 2YX8A 3I56V 5CBFA 3J80N 1SWVA 5H5NA 4DUYO 1N33B 2KG7B 1NJZA 3QUBA 3KTQA 4B3RO 1XEQA 4KLFA 3LDEA 5H2FU 2W04A 3M7DA 4XDJA 3KHGA 3I76A 1XREA 4DUYB 4NL9C 5FPRA 3EHBB 4JV5O 3IV6A 5CA1A 4B3RB 1LVHA 2HJFC 3CMAV 1ZQTA 1SKVA 4B3MO 2MW2B 4PHPA 2N74A 1H2MA 1VDVA 2R8JA 3AG1C 4GYCB 3TACB 4UATA 4IR9A 5LP6B 4JV5B 1AR5A 4PPXA 2W9BA 2NYVA 5ALYA 1EZVH 2ZT9B 4KTQA 1NJYA 1ZQJA 1FIQA 4B3MB 4USAA 5ALDA 1BPXA 5KFFA 8ICSA 2LW7A 3JAKB 1LR1A 4IQWA 5ALKA 2QE7G 3HKCA 4X20A 5ALQA 1SXDA 4O4LA 2WAQF 2ZM6O 4I9QA 1PK1B 3GVMA 2H3IA 4KLMA 3OSPA 4C4RA 2P66A 1QLEB 1RXWA 2J6UA 4NWIA 1BPZA 4DR1O 3BAAA 1SXEA 5AI6A 4R50A 2ZM6B 4RQ1A 1Y76B 5KAFU 1FFTB 2KTQA 1Q82W 3N7RC 5AI4A 3SPIA 4KLIA 2JEGA 5CBHA 4DEZA 2Y0PA 5B1AC 2WF9A 4LVSA 4DR1B 4FFBA 1U97A 1Q3UA 4KLLA 4J7KA 5AICA 2D2CB 1OCOB 1JOYA 4OJLA 5IJ9A 3WKAA 4DFPA 5AKEA 3E0FA 3I5DA 3RJFA 4OX9O 3AU2A 1NR1A 4HZ3A 5EE1A 1MA1A 2H5XA 3U10A 2EX3A 2E3CA 5FNVA 3ZDEA 1A77A 5J0YA 2JRZA 3D6JA 3TI0A 4X1IA 9ICHA 5L3DA 3D8CA 4W4LA 3ZCCA 2OXOA 3PMLA 3F7YC 5L1JA 2VA3A 1JIHA 5IIJA 4JGSA 1X6IA 2EANA 4DR7O 1KUQA 2KZZA 5E79Z 3DGEA 3QZ8A 3JD3A 2OCHA 2Y1IA 2RCVA 3G4SV 3APOA 2FPMA 2EINC 1S5HC 4P4MA 4RU9A 3F2CA 1FS0G 3I55V 1VQPV 3EZ5A 3VCBA 1CP9A 1YTFB 3AQEA 4Y2UA 2XY5A 1QCEA 1OHHG 3I1YA 4US8A 3FB5C 4DR7B 4M9LA 1H8HG 1FAFA 5KFZA 1WUDA 4O3QA 5EZYB 4ICGA 4JPRA 4Y2RA 2G06A 3CRAA 3X2QC 1SZXA 4WFBV 1TV9A 1CI4A 3LNMB 1JROA 2ZTEA 4TQSA 3THOA 3QU4A 3T2MA 4CCHA 3CCVV 3OTQA 4LH7A 2Y4TA 1A0PA 2GLEA 2KKPA 2KVCA 3A8TA 2Y0SC 4AQYB 1H2GA 1D5NA 3OTOO 5E1AC 5HR6A 1QVGU 1J5EO 5KAIZ 1Q8KA 2JGDB 3NR7A 3MABA 2R9AA 4Q43A 4ECYA 2FMSA 2VA8A 1M5IA 3ABTA 5B3SC 7ICUA 2RRDA 2ZXWC 3T5LA 4IYHA 4HNAB 8ICTA 2A79B 2IJKA 1COKA 4BX9C 3RTVA 4ZI7B 3TFRA 4LF8O 2LFSA 2UXXA 3CYOA 3Q8PB 2WLLB 2KNJA 2Q4PA 4MFAA 2BTOA 2BR0A 4GXKA 4YVZA 3ETGA 3QUCA 1EM1A 3OUFA 4QPKA 4TUQA 3PW2A 1RQNA 2Y69B 2OCCB 5KFBA 3RYFB 4LF8B 1ZQXA 2IM9A 4YJ2B 1KL9A 1MNGA 4TV9B 4ECQA 2GBOA 3JPOA 3KOOA 1RM1B 4IQVA 4O4HA 1H8EG 3RFAA 2QTOA 4R8CA 4F92B 3UQ8A 2BHNA 2D6FC 3AG4B 4PV1B 1BVSA 3KKAC 4RNOA 3KHRA 2X7RB 2OH2A 3AK1A 5BMVB 4R66A 3BS5B 5IIIA 2A9HA 4G9BA 2WF7A 4F4ZA 4NXMB 4JUZA 4A8EA 3OR7C 1QQCA 4EELA 5L1MA 2BQ3A 3JPQA 2Q68A 2XI9A 3HKZF 2UUAO 3ZD9A 4LC1A 3CC4V 1X9MA 3KZIU 5DKWA 5JCOA 3WB2A 1BQZA 4TUYB 4TV8B 2F1JA 2VJ5A 2UUAB 1V97A 3FAVA 1OCZC 4EKWA 2QARB 3SAHA 3N2GB 5KMGB 1YIJV 2YDEA 3GFKB 3MDCA 5AM0A 3IFXA 1N2XA 3AG2B 1HNZO 3RAQA 3HKBA 1S77D 4M9GA 4DQIA 5DQHA 3CEIA 3M7MX 1F4MA 1YHQV 2QM7A 3ZRSA 3SYOA 3TKAA 3NVWA 4EFBA 1QSLA 2FL4A 3FYHA 5KX5A 1TVAA 1KEJA 5IY5C 4N23A 3K0GA 2EZXA 3EWAA 3T4ZA 2W3RA 2XUMA 5KT5A 3SYZA 4DL5A 1JA8A 4UB5A 1DRGA 1N0JA 3JALB 5EBLC 2R8GA 4QZAA 4JI3O 3QXGA 4NTXA 3G80A 3ZEDA 3FM9A 4P0PB 7ICNA 1RSOB 1ZD5A 1JALA 1NK0A 1AI6A 5L1IA 3CB2A 3MFHA 3L70H 3NVVA 9ICQA 1N61A 2XOKG 3N27A 4RQ5A 5J2AA 4DL4A 9ICSA 4JI3B 1ZRNA 1XNQO 3R65A 5LGTA 3JD0A 4B3SO 4B9LA 2ZE8A 2Q5ZA 4JI5O 2K4HA 4PA9A 1Q5OA 9ICMA 1GN3A 1ENVA 4OPHA 2ZIMA 2J6TA 1KBHA 9ICXA 4B3SB 4DV5O 2HHWA 3ASNB 4QJFB 3K06A 3K1RB 3FB6C 3IJ4A 3SGIA 2W0XA 1JMKC 4QWEA 4JI5B 1G1XB 1HNWO 3D3IA 3C23A 3FX7A 4RUFA 5AKHA 5A9GA 4JI7O 3FYEB 1TAQA 1V85A 3GZFA 4PJ0U 3SAGA 3RJHA 5GTIU 2NRVA 1Q6IA 2KSDA 3ZX6A 4G2KA 4DV5B 4NTWA 4DFMA 3ED5A 1ZD3A 1AQ6A 2ZINA 3MR5A 1QTMA 1AP6A 1HNWB 1XS9D 4D7SA 4JI7B 4LF5O 5AK4A 2K4PA 2W54A 4J10A 2PYJA 2ZUBA 3MGIA 2ZDIC 3NTUA 4YD1A 2MUTA 4KFMA 2HP8A 1N56A 1YXBA 5KFRA 2AQ0A 4F5NA 9ICUA 4IYIA 4C4SA 4LF5B 2EIJC 3RJIA 1SZHA 3LSQA 1S0OA 1RYRA 4TQDA 5CB4B 5LGNA 2ZNIA 4JK1A 1MQ2A 3JYCA 4UCRA 5CP2A 8ICHA 3JATA 1Q3EA 2KJ9A 4CNQA 4IL6U 1MSWD 3OT7A 4B9VA 8ICFA 4X64O 2QR4A 1SQQH 2JRIA 1ECWA 4I2EA 4FLXA 2CK3G 2QLTA 2ETNA 5JH7A 3T1HB 4O5CA 2HFEC 1M90W 2QEXV 3UM7A 3E22A 4O3OA 2C2EA 4DWIA 2ZUDA 4QZCA 1N48A 1SQXH 4H37A 4A5UB 1ZQHA 4X64B 1I08A 2QWQB 4C80A 2F1IA 1S10A 4U3JB 1U45A 1MA7A 1N8RW 4O2AA 4PA6A 2DYSB 2ZQMA 1QHTA 4DV7O 1PK3A 1W0JG 1WLEA 5L3EA 4J7ZA 2JHDA 3MR3A 3G6EV 1NH2B 4LF9B 1I7FA 5J2IA 1P4RA 3F5TA 1CPYA 4ECUA 5BY1A 3C5FA 2ODGA 3ETQA 4UXNA 5IYZB 1KKXA 4QE9A 4DV7B 2E5LO 1UT8A 4FO6A 1TA8A 4UUJC 1WA8B 2YI8A 2FMPA 2JEXA 1DF4A 1I0HA 7ICEA 4TUPA 1V55B 3U26A 1NTZH 3OHBA 5BR8O 4B7KA 1FFVA 4O2BB 1ZQOA 2E5LB 2XGPA 3ZHRA 5AKXA 3RN4A 4RT3A 3BQTA 1RYUA 4DV0O 2LHTA 1YSCA 5J29A 2W9CB 3UO3A 1W2BU 4KUMA 5BR8B 3C3TA 2P6UA 2ZJAA 1VF6A 1SGGA 4B9UA 3W7XA 1ZQNA 1URFA 4BGDA 4LFCB 4J9ZB 4CS2A 4UFZA 5DGBA 2WWWA 3ABMC 3CCEV 3K03A 3RYCA 4DV0B 2RLTA 3SV4A 4MW3A 3S3WA 1L7PA 1TE2A 2W9AA 5KG4A 1U49A 3WG7B 1XOUA 2BTQA 1BGYH 5LL6Y 3TADC 2FB5A 3EW9A 1VIBA 2LYBA 2L6LA 2BSKA 4PDVA 9ICWA 1XNRB 2LP7A 3C2KA 5KFHA 4DOCA 8ICKA 2R9RB 1QQ6A 4I50B 2R70A 1ZLZA 2QJ1A 4PA4A 2EAOA 1KYOF 4YMNA 3SYAA 1GM7A 3H7IA 2KIWA 4UB8Z 4YY3O 2W0FC 5KHGA 1UPGA 5AI5A 3RR8A 1JRPA 2H3QA 3B2EE 4Z1MG 4P0QA 5IIMA 2ZG6A 1R3IC 2CRXA 1X6JA 4YY3B 2N1RA 4DFJA 4TWKA 3K04A 2MK3A 2RMKB 3VQWA 4DXWA 2CTPA 4X8AA 3PR5B 8ICUA 3RJJA 2HVJC 4R63A 1KRPA 1RQLA 1M6YA 1NKBA 4B9MA 2QSAA 3L74H 4NV0A 3RB6A 1DGJA 1PP9H 3WKEA 1YZ7A 1BCCH 5B1BC 2O57A 4RUAA 1RPOA 3P3NA 2V1DA 5AKZA 2ASLA 4WFGA 3QF7A 5ALTA 4Y2SA 1L6NA 4ED7A 3SENA 3AG7A 5JUMA 4RUCA 4CE6A 3ABKB 3JAWB 1RDFA 2RHFA 3V7JA 1DGSA 1S9FA 3V72A 3BABA 2YEVB 4R64A 2UUCO 1GTOA 2EAMA 3M8SA 1ZETA 3K5MA 1L3SA 2CDYA 3KCXA 7ICHA 1PL0A 4QNHB 5J0TA 2EIMB 2D3OW 5LHIA 4LF4O 1DTOA 4MTFA 5DG9A 1NKDA 1WPXA 5IE9A 4DQQA 2UUCB 4DL3A 3CE2A 4QWBA 3QEBZ 2BPCA 2GOLA 5H6QA 3WK6A 4X65B 4LF4B 4C8KA 4NTYA 2JS5A 3UXPA 2KFZA 5AIBA 2IW5A 2ZCEA 1SIJA 2FTKA 1JN3A 4ZOLA 4CRXA 1PUZA 2WLIA 3H1KH 5AG2A 3JASB 4WFFA 4Q8EA 4FM0A 4TQFA 2B5UA 2HHXA 5BXZA 3RH6A 4JV0A 4LCUC 5EK0A 3OMNB 1U96A 5EC2C 1MMMA 1YJNV 1FXKC 1ZAUA 2RQ6A 4BIOA 1Y67A 1AP5A 4M2YA 3UT5A 3U11A 2WLHA 2VA2A 4O4JA 1G4YB 2QWOB 3T4DA 3MHHC 5CA0B 1YZBA 1OCCC 1KB9F 1WP8A 2W43A 3VBBA 2C22A 2GTAA 4CH6A 1X4TA 2CTQA 3KHLA 3EPGA 3B40A 4HBNA 3APQA 5DB8A 2JH7A 4XQ8A 5J0XA 2DQ3A 4K3AA 1UJWB 3D36A 2KEYA 4I0XB 4MTGA 1OXJA 4I27A 2OYQA 4K4GA 3BZCA 8ICAA 1SA0A 3AEIA 7ICMA 4RQ8A 3BJYA 3KZIZ 1T3NA 4RPYA 1FPOA 2GDSA 5KLVH 5KFSA 2G07A 3ABLB 5ALOA 1DK2A 3JPTA 5A2QN 1OZ0A 1S72V 4QZGA 3SR6A 4GZRB 2QDOA 4YR0A 3C3SA 2JEIA 3AG3C 1I5YA 3HKEA 2DYRB 2FLPA 5J2CA 3NS1A 4HYOA 5KG5A 5LYJA 4LFAB 4C8LA 1SQGA 1U47A 1Y4MA 3W7TA 3SI8A 2VRZA 3JARA 3ASOB 3D2NA 5CMUA 1M56B 3TANA 2UVRA 4B9TA 2GO7A 1RZTA 1S3JA 3LSUA 3T1CA 1YDXA 9ICIA 4XDKA 5C8YA 7ICQA 3UQ2A 2FI1A 1IURA 2P4KA 3OFNG 4BUGA 3RJGA 3QG5A 2KHVA 3A0HU 2YMMA 2X6CA 3NXSA 4O4IB 9ICTA 3PSIA 4NXNO 3HWTA 3E2EA 3WFVA 4DK1A 2JZBA 4J7JA 2FMLA 3SMVA 3Q8LA 5F2VO 4CF4A 1Z1BA 2E3TA 4PHAA 4NXNB 5GTHU 5J2UA 4IHJA 4KLSA 1T7PA 4JZ2A 1EXNA 5LP6C 3RRHA 3QEAZ 2ZIVA 1TAUA 4AP9A 5JRTA 4GLXA 3ONNA 1N60A 1PVPA 2XHBA 1IZ3A 4YQWA 1PL4A 5H6RA 5CA1B 2A06H 2ALZA 5DB6A 5DG7A 4EX7A 2HBLA 1S5JA 4B9SA 2E8OA 2YMQA 1IXMA 3KCYA 2H3OA 4X9QA 2F76X 3UCSC 1QLEC 2W9BB 5L1LA 4K35A 1SS3A 2NRTA 2QB0A 2O6KA 1PVRA 4FVMA 1NVPD 3HKCB 2A7WA 4PJ0Z 2LO1A 4TURA 4MF2A 2EIKB 4M9HA 3UXOA 4Q20A 2GV9A 2QKAA 3D2QA 3ABUA 4ECWA 5KHIA 5JVDB 2ADPA 4BXOB 1NI8A 5KFYA 2WA3A 2WF6A 2YB1A 1B0XA 2BDPA 4ZHQA 2H3VA 2W11A 5BPCA 4FLZA 1OW5A 2X6BA 1OCOC 3GIJA 2JIZG 3NRWA 1M9NA 8ICLA 4F4YA 1PPJH 2BOBC 1AI4A 2QTSA 3SJQC 4PL1A 3CWBH 5B5EU 9ICPA 2JDIG 3K79A 1ZD4A 2M7WA 5LBQA 3FDSA 1KN5A 1NOMA 2FJ6A 1QNMA 1NS1A 4FFBB 4XBFA 4YJ3A 4JWNA 2LM4A 1Y66A 1ZQMA 4O0IA 3QU5A 4J9RA
chains in the Genus database with same CATH topology
3IC7A 2RRDA 2W7OA 2ZXWC 5LGUA 2A79B 2IJKA 2KKVA 2ZIVB 2HOIA 2KJ8A 4BX9C 4BJQA 4FZMA 4MVUA 1OCRB 2LFSA 2UXXA 3CYOA 5EBWC 2G5IB 1J95A 2XAJA 2WLLB 2KNJA 4F4LA 1OCZB 3OR6C 2EIKC 2H3FA 1FXHA 1YJWV 3SYPA 3ETGA 5EC1C 1V54B 3ZIAG 3OUFA 1F51A 3LSSA 4QPKA 1ED1A 2Y69B 2OCCB 4BIUA 1E79G 1JX9A 2F77X 2VIXA 3N7SC 2YSUB 1RM1B 2JK5C 1H8EG 3RFAA 2QTOA 4R8CA 4P0PA 2D6FC 3K9AA 3AG4B 3ZRWB 3MGVA 1NZBA 4CGZA 5J9PC 2X7RB 2OH2A 1KECA 2C2AA 2K4EA 1VQ7V 2A9HA 2QKSA 2ZDIA 5KL8B 2JEUA 3F5EA 3JCZA 5DM6V 5IY5B 4I5SA 1S76D 4A8EA 3OR7C 3TETA 1Q86W 4I9WA 2K89A 3VC8A 2Q68A 1F4NA 2LKYA 2XI9A 2CPRA 3HKZF 1GO3F 2V7QG 2UXNA 4PA7A 2JGAA 4LC1A 3CC4V 4GX5A 1CEZA 2Q4TA 3SYCA 2M0NA 3OMIB 1PKXA 2PI5A 3H0MB 2W03A 1OCRC 2VJ5A 3OEHG 2P6JA 1BMFG 3L3FX 1VQ8V 3PSFA 1OCZC 1SERA 3H0RB 4EKWA 2NNUA 4FZNA 3F5AA 3SAHA 2K1EA 1YIJV 4RO2A 2HOFA 2A0LA 3ZMTA 2XAFA 2OCCC 2Y69C 5GW7A 3IFXA 3AG2B 1VQ4V 4WFHA 2LYAA 1RM1C 1S77D 1K4CC 3F5WC 3AG4C 1F4MA 4XDLA 1YHQV 2QM7A 2DW4A 3SYOA 3ZRSA 1FXKA 2HKOA 3QO5A 4P2ZA 5KA5A 5IY5C 4WF9V 4N23A 3K0GA 4FZLA 3OM3B 3T4ZA 2JJ1G 1NJIW 1KP2A 4CZZA 1DRGA 2PMZC 1XL4A 2F2AB 3E83A 3H0LB 5EBLC 3QNEA 5H9CA 4P0PB 1AI6A 2P7TC 1R3KC 4U6PA 1P7DA 4ACOA 2E5SA 1G8MA 2W6JG 1K5QA 4BAYA 2XOKG 3C29A 5B1OA 3PJSK 3R65A 3FKSG 5LGTA 3JD0A 1VQMV 2E1FA 2ZXHA 2EIJB 1NR7A 2K4HA 4PA9A 5LHHA 3ZRXA 3AG2C 1ENVA 2NLJC 1L1FA 2WB1C 1GM9A 3ASNB 5FL7G 4QJFB 3K06A 4OJPA 1R6KA 3FB6C 3KZXA 3ETDA 3EFFK 3HPLC 4J9YB 3D3IA 3CRXA 2Q6AA 2WSSG 4RUFA 1AI7A 4RQEA 2BOCC 3SYQA 3FYEB 3NUQA 3GZFA 3SAGA 1VQNV 3K0DA 4G2KA 2MA1A 2X6AA 1E1QG 2QM8A 1ORQC 4HAMA 3CCJV 2B1GA 4RUEA 3E8BA 2JJ2G 4MVMA 1SRYA 3JD2A 2KV2A 2WLMA 2LBOA 1QVFU 1D8BA 3CP1A 3CPWU 2X0LA 4OXSA 2ZDIC 1AI5A 1KP3A 4KFMA 4X88A 4U7CA 4U7OA 4LP8A 1MG1A 4WFAV 2QA4V 5CN0A 2EIJC 4RAIA 1SZHA 3LSQA 2DQNB 5LGNA 1K34A 3KG2A 2K4IA 2Z3YA 4E2LA 2EILB 3JYCA 3CC2V 1THZA 5L3FA 2KJ9A 2Y0SF 4MT8A 5KA6A 1MSWD 4GCZA 1K97A 1HIWA 3SPGA 4JMUA 1KC8W 3ASNC 1YI2V 4P9PA 1ECWA 4KP4A 1PVQA 3FB8C 2CK3G 1T94A 2VJ4A 4JF3A 4MSWC 2HFEC 2OYYA 3E35A 3SPJA 3T79A 4GT1A 3UM7A 5C0YA 3QO7A 4PDRA 4YXWG 2EBOA 2Z5UA 1ZWIC 4H37A 2WPDG 5BZBA 4ICAA 1GMGA 1P7BA 2F43G 3GWOA 1H38A 3SPHA 5DN6G 3W7SA 4RQFA 2AHYA 2IU3A 1MA7A 1N8RW 2ZIWA 4PA6A 3OMAB 3P30A 1Q82W 3DTUB 5CRXA 2DYSB 2ZQMA 1K92A 3ABMB 2OT5A 4TSFG 2K8AA 3CCUV 2XVTA 4QIWC 1W0JG 1NVPB 1R6NA 1WLEA 1B6QA 5L3EA 1ZQ1C 1VQKV 4P9OA 3OPXA 2JHDA 2DF4B 4KMOB 2ZR2A 3G6EV 1NH2B 2XASA 1P4RA 1K8AW 1CPYA 4UV9A 2IU0A 2HBKA 5L3CA 4UXNA 2KJ5A 2WLNA 3M99B 3LYSA 3RVYA 4QE9A 3P32A 2KICA 3D2SA 4GX0A 2XNDG 2EILC 4MVRA 4PA3A 3RVZA 4UUJC 1GK9A 3K08A 1Q81W 4LBEC 2JEXA 1DF4A 3ZMUA 3TK1A 2H94A 3SAFA 1F44A 1V55B 1PD3A 2OTJV 1LNQA 2A3VA 2HVKC 2WAQC 3PZPA 1V54C 1YT3A 4UVCA 3CCLV 1PNKA 1K4DC 4UVAA 2EJRA 4AYBC 4C0ZA 1BHBA 4GFJA 3SPCA 5KL1B 2E1EA 2B1IA 3E8GA 4R7CA 1YTFD 2LHTA 1YSCA 1VQ5V 1XL6A 1R73A 4MVZA 4ZKIA 1W2BU 5HR7A 4KUMA 3IG8A 1AJQA 1JPXA 1NQTA 4BIZA 2ZIUA 5CBGA 3ZJZA 1JVMA 2H8PC 4JASA 1OUQA 3KFUF 1QR8A 2XAQA 3W7XA 3PSTA 2DYSC 2YEVA 1K5SA 2WWWA 4J9ZB 3ABMC 3CCEV 3K03A 1VQ6V 4AYBF 4MW3A 2WLJA 1QR9A 4DO2A 2RP5A 5B1BB 3WG7B 5HFMA 3VOUA 5IYCO 2BDUA 2LYBA 4PDVA 1E1RG 2EZPA 4WCEV 3CMEV 2LP7A 2R9RB 2DWEC 5KUMA 3GB7C 3ETEA 3M6KA 4PA4A 2PI4A 2ZIWB 1TAMA 4NLBA 3SYAA 1BHAA 1GM7A 2IJIA 3OGCC 4JAVA 1K33A 5IDJA 2KIWA 1GM8A 3OUSA 4GX2A 2W0FC 3ZMVA 5L3BA 1V55C 3E89A 4FIPC 3IG5A 3STLC 2H3QA 2PMZF 1Q3VA 4N21A 3CC7V 4Z1MG 4P0QA 5CA3A 1KQSU 2ZG6A 1R3IC 2DGZA 2CRXA 2OM6A 1URJA 4MVQA 4UVBA 4ASUG 4BW5A 3CCSV 1VQ9V 1QLNA 2N1RA 3RBZA 4TWKA 3K04A 2MK3A 4PELA 2YB4A 4DXWA 3G71V 4X8AA 2Z7JA 2R18A 3AQFA 2NV3A 3ALRA 1FXVA 2HVJC 1I5XA 3STZC 1ROPA 4NV0A 3I55V 4MW8A 3F2BA 1F23A 3CCQV 1M1KW 3ZRVA 2KD1A 5B1BC 3WG7C 1RPOA 3O0FA 2IJJA 4PL2A 2ZXIA 2V1DA 2ZXWB 3H01A 4WFGA 5C93A 1M90W 1L6NA 1KBUA 2WB1F 2G08A 3F7VC 2G0AA 4JYCA 4X89A 2F8LA 2ZIUB 2ATKC 2GHYA 3ABKB 4FE3A 2KHQA 2RHFA 3N7PD 1FXKB 1SETA 2HG5C 2YEVB 1GTOA 3M6ZA 1MOFA 1K73W 1OCCB 1KKDA 2CN1A 2KB1A 4JTDB 1KD1W 3JD1A 4QNHB 1PL0A 2GSMB 1EFRG 2EIMB 1GKFA 2D3OW 5LHIA 3ML0A 5T14A 1XO0A 3IGAC 1DTOA 2IJHA 2WLKA 1NKDA 3E8FA 1WPXA 3B77A 3QO8A 3LDCA 4MTFA 4QNLA 1A6SA 2Y48A 3E86A 4R6ZA 5A0LA 1YJ9V 1COWG 1M57B 4OO1J 1TUEB 3C28A 2GOLA 4UV8A 3HB3B 1CRXA 3K3WA 4U7NA 5H6QA 2JMGA 4O3MA 4G27B 2OTLV 3F53A 3CD6V 3AG1B 2IW5A 2FTKA 4P0QB 2P90A 1MABG 1DLBA 1R3LC 4CRXA 2W7PA 3LVVA 4KX5A 2WLIA 3ZN0A 5KUKA 4WFFA 2JH1A 1Z19A 1W0KG 3W7WA 3OEEG 3JD4A 5HFLA 2B5UA 2HR3A 3RW0A 3ZN1A 1K9MW 4LCUC 2W6IG 3AG3B 4FJCC 4JYBA 5EK0A 2HBMA 1JJ2U 2P67A 3OMNB 3ABKC 2IH3C 5EC2C 1YJNV 1FXKC 4PDMA 2HLDG 2YX8A 1SESA 3I56V 4PDLA 5CBFA 4KX3A 2WLHA 1G4YB 3T4DA 2DWDC 3MHHC 2QEXV 4CDGA 1OCCC 4L87A 3LVWA 1HWYA 3LDEA 3VBBA 1SZTA 3TCUA 3DEEA 3MHSC 3K1ZA 2W04A 2EIMC 3OW2U 3M7DA 5IYDO 2XIDA 4XDJA 4ZBMA 3HKZC 1BL8A 4QIWF 2JH7A 3EHBB 2DQ3A 4JTCB 1M57C 1UJWB 2HBJA 4FMTA 2HJFC 2KEYA 1QBZA 3D36A 4IC9A 1PNMA 4MTGA 5B1AB 3CMAV 3ZMZA 2ZIXA 3GU3A 3F2DA 3AEIA 4JAUA 5EBMC 3CCRV 3AG1C 1Q7YW 3IP4B 1JCHA 2R9IA 2G07A 3CYMA 3PSPA 3ABLB 2MRLA 2ITCC 2K8CB 1OZ0A 1S72V 4NLCA 4OJ6A 3UKMA 3B8NA 3AG3C 2QE7G 1I5YA 4HYOA 2DYRB 2XAGA 3IN5A 1AJNA 2WAQF 3BY6A 3W7TA 1Y4MA 4P30A 2Q69A 3ASOB 3D2NA 5CMUA 1M56B 2H3IA 1S3JA 4WJ3B 2LFRA 1EZJA 3CP8A 3T1CA 1QLEB 4XDKA 2WLIB 4NWIA 3OFNG 4R50A 4BUGA 3OAAG 4MVOA 2KHVA 2X6CA 3NXSA 2EINB 3PSIA 1FFTB 1NBMG 1DF5A 5IYBO 3E2EA 1EBOA 3N7RC 3WFVA 5L3GA 5LHGA 2KOBA 3ZMSA 3SPIA 1AR1B 4JTAB 4OJ5A 4FPPA 3E8HA 5CBHA 3SMVA 2XICA 5B1AC 2Q67A 1Z1BA 4MTOA 1Q3UA 3X2QB 2VKQA 1OCOB 1JOYA 1S0VA 4OJLA 3BEHA 3AL0B 2K8BB 1HEKA 3E0FA 3ABLC 1NR1A 4OJOA 2ZIVA 4HZ3A 3ONNA 1PVPA 4CBCA 4WFEA 5H6RA 5B1NA 2AHZA 2DYRC 1XNSA 2WLLA 4QPJA 5L3DA 2HBLA 2ZIXB 3ICXA 1UPHA 1VQOV 1IXMA 3ASOC 2HMXA 3ZCCA 3CXCU 2OXOA 1M56C 2ITDC 3F7YC 5B3SB 2F76X 3RF9A 1QLEC 4JGSA 1RPRA 2DQ0A 1K7DA 1YITV 4GX1A 2H3ZA 3DGEA 4MS2A 4MTXA 3JD3A 1AJPA 3G4SV 1IIPA 1JQ0A 1PVRA 1S5HC 1FS0G 1K3EA 2G09A 3F2CA 1PNLA 2EINC 3FB7C 3ZRWA 1VQPV 3VCBA 1CP9A 1NVPD 1YTFB 3AQEA 1QCEA 1OHHG 3FB5C 2EIKB 1NH2D 1H8HG 3CCMV 3SQIA 4Q20A 3ABUA 3D2QA 1WUDA 2YB1A 2HOQA 4JPRA 4TT3G 2IH1C 4QE7A 2G06A 2H3VA 4G28B 1AROP 3OE7G 3X2QC 2X6BA 1OCOC 4WFBV 3B8MA 2JIZG 3NRWA 2EZOA 3LNMB 2GH1A 1M9NA 2BOBC 2XAHA 2WAMA 3T2MA 1AI4A 3SJQC 4PL1A 3CCVV 1VQLV 2JDIG 3K79A 1A0PA 2G5HB 2M7WA 2KKPA 5LBQA 2KVCA 3LUTB 3A0RA 2Y0SC 4FK5C 1H2GA 4H33A 4MVSA 3MD0A 5E1AC 5HR6A 4XBFA 3W7UA 2ZD9A 1QVGU 1Y66A 2ZR3A 1R3JC 3FYIB 5B3SC 3ABTA 3LDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJF B;  4CGZ A;  2RRD A;  2HBJ A;  1WUD A;  3SAH A;  1YT3 A;  2HBM A;  2HBL A;  2E1E A;  4NLB A;  3SAG A;  3CYM A;  2MA1 A;  2CPR A;  1GO3 F;  4OO1 J;  4NLC A;  4CDG A;  2E1F A;  2KV2 A;  2HBK A;  5C0Y A;  1D8B A;  4O3M A;  2DGZ A;  2RHF A;  3SAF A;  4QIW F; 
#chains in the Genus database with same CATH topology
 2F44 A;  1J2N A;  4JI2 O;  2I1Q A;  2KKV A;  5J8Y A;  2HOI A;  1NK8 A;  2KJ8 A;  1SKS A;  5LXT B;  4BJQ A;  4ED6 A;  4DV2 B;  3PX4 A;  1OCR B;  3SJA C;  5FNV B;  3G6V A;  4F4L A;  4JI2 B;  2H3F A;  1FXH A;  4PGY A;  4DOA A;  3SYP A;  5EC1 C;  1V54 B;  1QSY A;  3ZIA G;  1S0M A;  3LSS A;  3WU2 U;  5TIS U;  1JX9 A;  2F77 X;  4GC7 A;  2YSU B;  5ALV A;  1ZQV A;  3K9A A;  3MGV A;  1NZB A;  5J0W A;  4DS4 A;  4RQM A;  1IDS A;  5LMN O;  1KEC A;  2F1M A;  3SDL A;  1VQ7 V;  2B6G A;  5KL8 B;  5DM6 V;  2AGA A;  4DW0 A;  1S76 D;  4O3R A;  3OHA A;  1Q86 W;  2K89 A;  4EZ6 A;  4C8N A;  4UCV A;  4P4P A;  8ICG A;  4EEK A;  1XSL A;  1W59 A;  4E4E A;  4ECZ A;  5LMN B;  2ASD A;  2UXC O;  2V7Q G;  2UXN A;  4PA7 A;  4UQG A;  3T3F A;  2Q4T A;  4UB1 A;  3L73 H;  5AKL A;  2WF5 A;  2YI9 A;  3GIM A;  2Q0Z X;  3H8J A;  5IIK A;  3J7A U;  2M9N A;  1SER A;  3H0R B;  4J9O A;  4IQT A;  2NNU A;  1HUZ A;  4F4K A;  5HML A;  4FZN A;  3F5A A;  2P6R A;  3B0X A;  4Y2V A;  2HOF A;  2YXL A;  2XAF A;  2OCC C;  2Y69 C;  2ZIO A;  2DKZ A;  1NTK H;  5GON B;  4FLW A;  4WFH A;  2LYA A;  1RM1 C;  5KFC A;  3HR0 A;  1ZQK A;  1X9X A;  1ZSP A;  2Q7E A;  3AG4 C;  3QU7 A;  2PUS A;  3QE9 Y;  1MQ3 A;  4DSK A;  2KSO A;  2OEH A;  1FXK A;  2JVD A;  2DKX A;  4P2Z A;  3N4M B;  4I7Z B;  3L75 H;  5KA5 A;  3WKB A;  4I29 A;  4NB5 A;  2JJ1 G;  1NZ6 A;  3KKY A;  4QW9 A;  3BCC H;  2F2A B;  3E83 A;  3H0L B;  4XRH A;  4O4H B;  3QNE A;  1BE3 H;  2P5O A;  1L7M A;  2P7T C;  2QWP B;  4H13 B;  1ZQS A;  1P7D A;  1WB7 A;  1EN6 A;  3CRM A;  4KLJ A;  1NT2 B;  2ZE5 A;  4KXR A;  4C8O A;  3FKS G;  1VQM V;  2ADQ B;  2E1F A;  2ZXH A;  5F9N A;  1Z1V A;  3CRC A;  4F6E A;  2KP7 A;  5LHH A;  3AG2 C;  4CH4 A;  1L3T A;  4F3O A;  1WAZ A;  1KLN A;  4CF5 A;  2PFQ A;  1KMI Z;  1L1F A;  5FL7 G;  1C7Y A;  3PNC A;  3PX6 A;  1TK0 A;  4KLE A;  1ZRM A;  4GXJ A;  1R6K A;  4YFK A;  3HPL C;  3FAV B;  2XCP A;  1SL1 A;  1QH9 A;  3CRX A;  4F8R A;  1TUB A;  2CH7 A;  2Q6A A;  1AI7 A;  1SV0 C;  2WSS G;  4LF6 O;  2BOC C;  1AB3 A;  2HHT A;  4J9P A;  1VQN V;  5AM1 A;  1B3Q A;  3Q8K A;  4J9M A;  1GRJ A;  3CCJ V;  2UVU A;  4HAM A;  1XC9 A;  2FE9 A;  2B1G A;  3HKB B;  4RUE A;  4D7T A;  1A32 A;  3T5K A;  5DLF A;  2WLM A;  1MN8 A;  5FLX N;  1VF7 A;  3CRQ A;  1D8B A;  4LF6 B;  1QVF U;  3RH4 A;  4L8J A;  1N63 A;  1H2L A;  3CPW U;  4TQR A;  2X0L A;  5KX5 B;  2NRZ A;  4PD4 F;  1QQ7 A;  4LFB O;  4I55 B;  1KP3 A;  5J0S A;  4U7O A;  1Z4O A;  1JR9 A;  2AXT U;  4F72 A;  1MG1 A;  3OSN A;  3V7L A;  4UAV A;  3V6H A;  2F23 A;  4WFA V;  1XU4 A;  2QA4 V;  5K4L A;  4RNM A;  3Q8S B;  1K34 A;  1WWV A;  2K4I A;  2BCV A;  2XC9 A;  3SZ2 A;  4E2L A;  2EIL B;  1U4B A;  3OTO B;  1J5E B;  2Y0S F;  2EZY A;  3K5O A;  4GCZ A;  5ALG A;  1KC8 W;  3ASN C;  1YI2 V;  4KP4 A;  5AKK A;  2KQX A;  2VJ4 A;  3PW5 A;  4JF3 A;  1ZQB A;  4MSW C;  2FLN A;  5C0Y A;  4BWM A;  5AM2 A;  1ZQG A;  4OPA A;  3PW4 A;  2E75 B;  5IJ0 A;  2EBO A;  3SD7 A;  4PHD A;  1ZWI C;  2Z5U A;  5KG0 A;  4M9J A;  5BZB A;  4ICA A;  2F43 G;  2HHQ A;  3SPH A;  1VLB A;  3TQ1 A;  3JPP A;  4RQF A;  4QGP A;  2F1H A;  2ZIW A;  4NYK A;  1IBM B;  3DTU B;  5CRX A;  3A0B U;  4RQ7 A;  1BT8 A;  4DFD A;  2BCQ A;  1O03 A;  3GDX A;  5D4B A;  4QIW C;  4LNU B;  1HW7 A;  1R6N A;  2JXJ A;  4P9O A;  2PXI A;  4DLE A;  3ZDA A;  2XAS A;  2D8C A;  5L3C A;  2KN7 A;  4JV1 A;  1XSP A;  4O5E A;  2WLN A;  2Y1J A;  4IS7 A;  4DCC A;  3M99 B;  4DQP A;  2XND G;  4MVR A;  3EVK A;  4PA3 A;  1D2D A;  9ICO A;  4KLD A;  2YS8 A;  3K08 A;  2KMD A;  1Y74 B;  3WK7 A;  2H94 A;  3SAF A;  5DGA A;  3TK1 A;  1YF2 A;  3M9N B;  3RB3 A;  2UXD O;  2HVK C;  3CJH A;  1ZL8 B;  3H9V A;  4UVC A;  3WK5 A;  3S3X A;  1K4D C;  3WKD A;  4C0Z A;  7ICG A;  3AM9 A;  3C1Y A;  2E1E A;  1YTF D;  2BQR A;  1R73 A;  1RFY A;  5J2T A;  5KHJ A;  1WN7 A;  4IRD A;  4K8X A;  1YVW A;  3JAT B;  3ZHQ A;  1AJQ A;  1JPX A;  3PV8 A;  1SKR A;  4BIZ A;  4D6T H;  5CBG A;  2AZ0 A;  1BQ0 A;  4QZE A;  2AH5 A;  3PST A;  2DYS C;  2YIA A;  1HNZ B;  5JH7 B;  1LKY A;  3H8M A;  3BPZ A;  4EYH B;  3BHP A;  1WB8 A;  3E22 B;  2D3D A;  2WLJ A;  1IM4 A;  1SL0 A;  2BPG A;  3VOU A;  2XT9 A;  3RT3 C;  5KFM A;  3UO2 A;  7ICP A;  5J0O A;  3ZHS A;  1E1R G;  1XI1 A;  5BOL A;  4I2H A;  4ELT A;  3QUQ A;  5CHG A;  1SQF A;  3GB7 C;  3ETE A;  4NL9 A;  3NVY A;  2PI4 A;  4O2A B;  8ICV A;  4NLB A;  1LUV A;  1ZTE A;  3HKD A;  1UT5 A;  5IDJ A;  1GM8 A;  3OUS A;  4GX2 A;  4LF7 O;  2ZJ8 A;  8ICP A;  4LZG A;  1N0N A;  1TFR A;  5KT4 A;  5L3B A;  1V55 C;  5KFX A;  3K75 D;  5KFL A;  3STL C;  5G5H A;  1NK9 A;  4GUN A;  5ALL A;  3RH5 A;  5KT3 A;  2IMW P;  4B3T O;  2MU2 A;  3IC9 A;  2DGZ A;  2OM6 A;  1URJ A;  4QW8 A;  8ICO A;  4LF7 B;  4O9M A;  5JU5 A;  1XNQ B;  1XHX A;  3VQY A;  3G71 V;  2A1A A;  2YY6 A;  4B3T B;  3RB0 A;  1FXV A;  1Z3E B;  1M1K W;  1MSD A;  3CCQ V;  2YMP A;  2R8K A;  4IT5 A;  2PYL A;  5EWE A;  4CF3 A;  3WG7 C;  4KLU A;  1Q90 D;  1YZ6 A;  4UAU A;  8ICQ A;  5J0R A;  2ZXW B;  3CX5 F;  3RYF A;  3H01 A;  4DS5 A;  1KBU A;  4RQ3 A;  2JR5 A;  4KN7 A;  2G0A A;  3F7V C;  4JYC A;  1P49 A;  3CW2 C;  2F8L A;  4X89 A;  1UCV A;  3N7P D;  1SET A;  5J2D A;  2Y9U A;  1QCK A;  4I28 A;  4FS1 A;  3H1I H;  3RYC B;  1X66 A;  4B6J A;  4FLY A;  1ZJN A;  4KMU A;  1K73 W;  1ZXI A;  1KU9 A;  2CN1 A;  8ICN A;  5EYP A;  4KLO A;  2BTQ B;  3OGI B;  5B5E Z;  1X59 A;  4I2F A;  3CHX A;  3BZK A;  1JUD A;  4Y2X A;  1GKF A;  4O3S A;  2BSK B;  3N28 A;  5T14 A;  4NLG A;  2IJH A;  2WLK A;  3LK9 A;  3IGA C;  4L87 A;  3T5J A;  3ZJZ A;  4EEQ A;  1RG6 A;  3LDC A;  2XO7 A;  1A6S A;  2Y48 A;  4YR3 A;  4P2H A;  5G5G A;  2F3N A;  3JSN A;  1YJ9 V;  1M57 B;  1TUE B;  4OO1 J;  1ZQZ A;  3Q4H B;  3PVX A;  5J0P A;  4G3I A;  1P7G A;  1CRX A;  4UB6 U;  2JMG A;  3ZDD A;  2OTL V;  2FYU H;  1L5U A;  4I2G A;  3CD6 V;  4OX9 B;  4FLU A;  4P0Q B;  2PZS A;  1WYG A;  1WWU A;  1R3L C;  5AK5 A;  2W7P A;  5KFG A;  4Z2W A;  5KMG A;  1Z19 A;  3OEE G;  3RW0 A;  4J9L A;  3ZN1 A;  2W6I G;  4FJC C;  2P67 A;  2CE4 A;  3ABK C;  2WF8 A;  5H2F Z;  2J6S A;  4PDM A;  2HLD G;  4CH5 A;  1SES A;  3B9J A;  4YG2 A;  4I2A A;  1SB3 C;  4XUS A;  2PKE A;  1HWY A;  2KK0 A;  1QSS A;  1SZT A;  3MHS C;  3TCU A;  1T4G A;  3K1Z A;  3I28 A;  2EIM C;  2QWN B;  3OW2 U;  2XID A;  4ZBM A;  4BWA A;  4DW1 A;  1B4F A;  1BL8 A;  1RSO A;  3AK3 A;  3R9K A;  2HBJ A;  2BPF A;  3L4P A;  1C20 A;  1QBZ A;  4IC9 A;  1PNM A;  9ICB A;  5EOZ A;  3ZMZ A;  2UXB O;  2ZIX A;  4UAZ A;  3AUO A;  2HVH A;  1WNS A;  4JAU A;  4NVP A;  5ALF A;  1Q7Y W;  3ZD8 A;  3IHQ B;  1U48 A;  3IP4 B;  1JXL A;  2R9I A;  3CYM A;  4FM1 A;  3T5H A;  1ZYQ A;  2ITC C;  5KFT A;  3K59 A;  2UXB B;  3GIL A;  4J9N A;  3K4G A;  4NXZ A;  5KT6 A;  2XAG A;  1AJN A;  1KDH A;  1L8D A;  1RXV A;  3ZHT A;  4CS4 A;  3MFI A;  5DB7 A;  5KAF Z;  2RJZ A;  1D8L A;  2AGP A;  3G6B A;  4EZ9 A;  3KD3 A;  4WJ3 B;  4UB3 A;  5CB1 A;  1EZJ A;  1XDC A;  1D9F A;  2LFR A;  2P4V A;  4JAA A;  4UCU A;  2WHE A;  5B66 U;  4ZOL B;  1RPL A;  1NK5 A;  2WLI B;  4Y2T A;  4Z6D A;  2Z0A A;  1NU1 H;  4MHV A;  1FFU A;  1M4U A;  1JMS A;  3KKA A;  1BGX T;  5IYB O;  1EBO A;  4F6R A;  3ZMS A;  5HMM A;  1ZD2 P;  1IXB A;  4OJ5 A;  4JTA B;  4FPP A;  3M8A A;  3E8H A;  2BCR A;  2XIC A;  5FP0 A;  5L1K A;  4CS3 A;  4O4J B;  9ICF A;  4MTO A;  4H44 B;  3EPI A;  3NRZ A;  1N4C A;  5KG2 A;  2UUB O;  3WB1 A;  1VAR A;  1HEK A;  4JWM A;  3ABL C;  3EXA A;  4DV1 O;  2AHO B;  4HYK A;  4J11 A;  5ITZ A;  4GKJ O;  2QB1 A;  2GUZ A;  3LWL A;  4WFE A;  2AHZ A;  1DXS A;  2UVV A;  2DYR C;  1XNS A;  4J80 A;  3N2K A;  4QPJ A;  2G38 A;  3OGU A;  1D8Y A;  4DV1 B;  3ICX A;  1WP7 A;  4YMO A;  1SA0 B;  1FKA O;  3ASO C;  3MC1 A;  5KFK A;  1AIL A;  2HDO A;  2VWJ A;  1SWW A;  1M56 C;  2L35 A;  2KZ3 A;  4GKJ B;  1X2I A;  4PHE A;  2EUL A;  1RPR A;  2A1J A;  1ZQE A;  1K7D A;  2DQ0 A;  1YIT V;  4GX1 A;  2H3Z A;  1PZN A;  4MTX A;  1IX9 A;  4AHC A;  1IIP A;  3C1Z A;  1NK7 A;  4U3J A;  2G09 A;  3ZRW A;  5EWF A;  5LYJ B;  4FZ1 A;  1ZQL A;  3ISC A;  4EBE A;  4PI0 A;  1S8O A;  1NH2 D;  3CCM V;  3SQI A;  3JAR B;  5E79 U;  4FS2 A;  3OTF A;  5CR0 A;  2HOQ A;  4M0A A;  1R1B A;  1DK3 A;  4TT3 G;  2UU9 O;  2HHV A;  5KNI A;  4G28 B;  4ED2 A;  2Q0O C;  5ALZ A;  5C8Y B;  2KVS A;  3G67 A;  3PO4 A;  3MGH A;  2GH1 A;  3RYH A;  4NY8 A;  4R8U A;  1UA0 A;  1QU7 A;  1VJ5 A;  1XUQ A;  5KHK A;  2GWS A;  1JFF A;  2XAH A;  2WAM A;  2FPK A;  4M47 A;  3DSQ A;  3FFQ A;  1U9L A;  2UU9 B;  2HCF A;  5J2E A;  2AXT Z;  2P06 A;  2NRW A;  1P84 F;  2HSZ A;  2C28 A;  3O9O A;  2FPL A;  2F66 C;  1SQV H;  3A0R A;  4Z6F A;  5DBB A;  4FK5 C;  4Q6G A;  4EBC A;  4H33 A;  2V9W A;  4C8M A;  1NJX A;  9ICE A;  2ZD9 A;  3K5L A;  4DR3 O;  2DFL A;  2ZR3 A;  2V4D A;  2QM4 A;  3FYI B;  5J2U B;  4IHJ B;  4YXM A;  1Z5V A;  1UQV A;  4DO9 A;  1VQK V;  2R8H A;  1TVK A;  2R72 A;  1HJP A;  1X9W A;  2ZIV B;  4HAI A;  2F95 B;  1LUW A;  3VQX A;  5ALS A;  3UMB A;  5KFV A;  4MVU A;  4DR3 B;  3RJE A;  3H1H H;  2ZTC A;  4K0K O;  5EBW C;  4QWD A;  2G5I B;  4I4T A;  1J95 A;  1F7Y A;  4RQ0 A;  2EIK C;  4DOB A;  5KHH A;  4QZI A;  2BGW A;  4ED8 A;  5ALI A;  2PFN A;  1YCI A;  1F51 A;  1N34 O;  3WK9 A;  7ICT A;  1ED1 A;  3G6X A;  1E79 G;  3A0B Z;  4K0K B;  2VIX A;  3H40 A;  2QGN A;  3KBB A;  3MR6 A;  5LOV A;  2QB0 B;  1H2S B;  1J97 A;  3LDA A;  4NM2 A;  3IAY A;  1SC5 B;  5J9P C;  4DRX A;  1N34 B;  3B4S A;  4RPZ A;  1N62 A;  2C2A A;  3MR2 A;  1JI7 A;  2QKS A;  2ZDI A;  3FC4 A;  2JEU A;  3F5E A;  5HHI A;  3CRR A;  1B43 A;  4CC5 A;  4ZHQ B;  8ICE A;  1XO1 A;  3EUB 2;  3BDP A;  2E74 B;  2N05 A;  1N36 O;  3WKC A;  2CPR A;  5KG3 A;  1GO3 F;  4UBB A;  2HHH O;  4DSJ A;  1FEZ A;  4MFF A;  2JGA A;  5AK3 A;  2ZUC A;  4QZD A;  1B22 A;  4LH6 A;  2M0N A;  3PO5 A;  1PKX A;  2PI5 A;  3H0M B;  2AU0 A;  3TAQ A;  1TK8 A;  1OCR C;  1N36 B;  3NAS A;  5ALW A;  3OEH G;  1PV0 A;  1NI3 A;  4Z1V A;  2HHH B;  4YJ3 B;  4C7U A;  4EB6 A;  2K1E A;  3HJE A;  2RN9 A;  2F8K A;  4JYY A;  2A0L A;  1SQB H;  3ETR A;  3ZMT A;  2ES6 A;  1XSN A;  9ICK A;  1XIL A;  4DR6 O;  3F5W C;  1NZP A;  2EQY A;  4XDL A;  4TUS A;  3K9S A;  1Q43 A;  9ICR A;  1YEW A;  4KLG A;  3UXN A;  4PZN A;  4F5Q A;  4LWS A;  1HR0 O;  4DR6 B;  1K5O A;  5ALX A;  4DLG A;  1KP2 A;  2KG5 A;  4UCS A;  2PMZ C;  2DPI A;  2C2R A;  2BKE A;  1G6U A;  1XL4 A;  2RDJ A;  2PFP A;  5H9C A;  1XQ8 A;  5DED A;  8ICX A;  1J2M A;  1HR0 B;  4F5O A;  3BS7 A;  4AI8 A;  2E5S A;  1G8M A;  2HJD A;  2W6J G;  4Q8F A;  1K5Q A;  4BAY A;  3RAX A;  3C29 A;  1RYS A;  3PJS K;  4FLV A;  2RQ5 A;  4M6W A;  1T8E A;  3RJK A;  5EIB C;  4DV3 O;  4RNN A;  1NR7 A;  3SR2 C;  1GN6 A;  4JI1 O;  1JJO A;  4F2R A;  4ZH4 A;  4X20 B;  4K8Z A;  5GTI Z;  4O4L B;  2WB1 C;  1GM9 A;  2F93 B;  2AGO A;  1DOQ A;  4OJP A;  3KZX A;  3TXS A;  4IRC A;  1F0M A;  5KFP A;  3EFF K;  3ETD A;  4F91 B;  4O3P A;  1KKC A;  4J9Y B;  2MSN A;  4JI1 B;  4RQE A;  3MAQ A;  3SYQ A;  2DPJ A;  1FD9 A;  3NUQ A;  3TAD A;  3V6J A;  1XHZ A;  2LI6 A;  2JV3 A;  3C5G A;  3DC5 A;  1L7O A;  2MA1 A;  4YR2 A;  2X6A A;  1E1Q G;  5J2H A;  1ORQ C;  2PF4 E;  1UHU A;  4RPX A;  9ICA A;  1SRY A;  1AR4 A;  2JS3 A;  1IV8 A;  5IWA O;  5FPO A;  4Z6E A;  1X40 A;  2KSO B;  4ED0 A;  1Z00 A;  4DSI A;  2Q73 A;  3QX7 A;  1F5S A;  3E58 A;  4YIP A;  5KFE A;  1LB2 B;  2AW9 A;  1AI5 A;  2W8L A;  3AU6 A;  5AKG A;  4RQ6 A;  1TAE A;  4IL6 Z;  1MC8 A;  2ISO A;  5IJ9 B;  4JZG A;  1EN5 A;  5IWA B;  3UMC A;  4X1Y A;  3M8R A;  1T3Q A;  3KG2 A;  4UB6 Z;  2CTW A;  1BNO A;  3RB4 A;  5KFU A;  2AZ2 A;  3QU9 A;  4DSE A;  3CC2 V;  4R65 A;  4OGQ B;  1RM6 C;  4K4H A;  1K97 A;  1HIW A;  5KT2 A;  1FO4 A;  4X1I B;  3SJB C;  4P9P A;  2PY5 A;  3E35 A;  4X1K A;  3GV5 B;  4DR5 O;  3P3P A;  4PDR A;  4Y2P A;  4YXW G;  4BW9 A;  3PW7 A;  4GXI A;  4QWC A;  2R8I A;  2WPD G;  1H38 A;  1GMG A;  4I2B A;  1P7B A;  5DN6 G;  4X5V A;  3W7S A;  1N33 O;  4YCX A;  5KG6 A;  3L9D A;  2IU3 A;  4QWA A;  3ORY A;  5ALP A;  4DR5 B;  5F3X B;  4EFE A;  4QZ8 A;  3OMA B;  4ECT A;  8ICY A;  1K92 A;  3HP6 A;  3HPO A;  4TSF G;  2K8A A;  3CCU V;  2XVT A;  4F71 A;  1SV4 A;  3V6K A;  1TUB B;  4B7E A;  2CH7 B;  5KG1 A;  4Y2J A;  3PR4 A;  4DF8 A;  1ZQ1 C;  5AIA A;  3OPX A;  2DWQ A;  1ZX3 A;  2ILM A;  2ZR2 A;  2W8K A;  1XMQ O;  1K8A W;  2IU0 A;  2HBK A;  2LYH A;  4RT2 A;  2E76 B;  2KJ5 A;  3RVY A;  3LYS A;  4ECR A;  1GN4 A;  3H8S A;  3P32 A;  3D2S A;  1SF9 A;  2EIL C;  3RVZ A;  1Q81 W;  5AI0 A;  2LJ2 A;  4LBE C;  4YMM A;  3ZMU A;  1XMQ B;  3L71 H;  4KIT B;  1F44 A;  5D5Q A;  1FFX A;  1PD3 A;  2UXC B;  3DDH A;  1LNQ A;  1WPB A;  2OTJ V;  2IOF A;  5JJJ B;  1Z2G A;  2WAQ C;  4EEY A;  2ZE6 A;  1COO A;  4KL1 A;  1PNK A;  4UVA A;  2WTF A;  4AYB C;  3THV A;  2CGO A;  3RYI A;  4GFJ A;  3E8G A;  4IIJ A;  5CJ7 A;  4R7C A;  1VQ5 V;  4MVZ A;  2XCA A;  4J03 A;  3IG8 A;  2Y0I A;  3BA8 A;  3KHH A;  1NQT A;  2ZIU A;  5B66 Z;  4WBN A;  2KKW A;  1H2N A;  3KFU F;  1QR8 A;  2XAQ A;  3JPS A;  3G6Y A;  1K5S A;  3ZDB A;  4KN4 A;  4P4O A;  4AYB F;  4GC6 A;  5KG7 A;  2DE0 X;  1QR9 A;  4BXO A;  5JVD A;  2RP5 A;  1XMO O;  1IBM O;  5HFM A;  5IJ0 B;  2DMX A;  5CA7 A;  2B0C A;  1N5X A;  5IYC O;  3GV8 B;  4UW9 A;  5AI9 A;  4KHP O;  2EZP A;  3CME V;  2ARH A;  5KUM A;  7ICF A;  1XBL A;  4DV4 O;  4JI0 O;  3M6K A;  7ICL A;  1RP3 B;  2UUB B;  5C5J A;  2ZIW B;  1TAM A;  2YC0 A;  3DXR A;  3OD4 A;  3GV7 B;  4DSL A;  1XMO B;  3OGC C;  2DJV A;  4JAV A;  1K33 A;  1BHA A;  4K4I A;  4DR2 O;  3ZMV A;  4KHP B;  3E89 A;  4U3F H;  3CS5 A;  4DV4 B;  4JI0 B;  5LA6 A;  1KQS U;  3CCS V;  1ZQW A;  4ASU G;  3Q8R B;  4UB8 U;  1QLN A;  2BCS A;  5DEC A;  2IBZ H;  4DR2 B;  4PEL A;  2YB4 A;  1KFD A;  5LXT A;  2Z7J A;  2R18 A;  1TKD A;  3AQF A;  5JQG A;  2NV3 A;  2IHM A;  4ELV A;  5DDY A;  3HT3 A;  1UA1 A;  1SKW A;  4QZ9 A;  4RQ2 A;  4B9N A;  1K1Q A;  1I5X A;  3QTC A;  3CJH B;  5DQI A;  4IR1 A;  2KG7 A;  4I2J A;  2KD1 A;  4OCZ A;  3ZRV A;  3TAP A;  4NKG B;  4PGQ A;  3O0F A;  2IJJ A;  1NK6 A;  2BCC H;  4J42 A;  4DYL A;  3H1J H;  4YHH O;  5J2T B;  2ATK C;  3Q8M A;  2F4V O;  2KHQ A;  5DDM A;  3ETL A;  2YIC A;  3JAM N;  2HG5 C;  4F5P A;  4F5R A;  1KFS A;  1LKY B;  5J0U A;  2YID A;  4YHH B;  5IIO A;  7ICI A;  1KKD A;  2KB1 A;  4JTD B;  1KD1 W;  3JD1 A;  2GSM B;  1EFR G;  2F4V B;  2YN4 A;  3ML0 A;  5LP6 A;  4AQY O;  1FYJ A;  3QO8 A;  8ICI A;  5IT9 N;  3N97 B;  4LFB B;  4QNL A;  2P22 C;  2YML A;  4R6Z A;  1QQ5 A;  4UCT A;  2Q7G A;  5JTI A;  3HKD B;  3JAK A;  1COW G;  4OD0 A;  3C28 A;  5EIB D;  1Y88 A;  3HB3 B;  3K3W A;  4DL6 A;  1PK1 A;  4O3M A;  4G27 B;  4H0L B;  1WG8 A;  3F53 A;  3HX0 A;  2NN4 A;  2DBY A;  3AG1 B;  3D3Q A;  3PMN A;  4TOI A;  4UCO A;  2DN9 A;  3TJT A;  5JWP A;  1MAB G;  4X62 O;  4O3N A;  4US9 A;  4KX5 A;  4DQR A;  2LGW A;  4PHZ A;  4RWU A;  5KUK A;  4IQU A;  2JH1 A;  1W0K G;  5GON A;  3JD4 A;  5HFL A;  1Y76 A;  3QUT A;  8ICZ A;  4J41 A;  1K9M W;  4JYB A;  4YP3 A;  4X62 B;  1NTM H;  3FAH A;  1VF6 C;  3GII A;  1T5E A;  4PDL A;  1Z5W A;  4KX3 A;  4CC6 A;  1ZUQ A;  2DWD C;  4CDG A;  2FKX A;  1XWL A;  2LPE A;  3LVW A;  3DEE A;  3ISB A;  4NXM O;  3AN1 A;  1R6T A;  3HKZ C;  3LWM A;  7ICJ A;  1HP8 A;  2B9Z A;  2LMR A;  2I9G A;  4QIW F;  2OIE A;  4JTC B;  4YIO A;  1L3V A;  1WCL A;  1M57 C;  4FMT A;  5D49 A;  2LW1 A;  2Q7H A;  5B1A B;  4ED1 A;  2MUT B;  3QZ7 A;  3GU3 A;  4M04 A;  3F2D A;  5EBM C;  3CCR V;  1A76 A;  5EYP B;  1Q6H A;  2RDC A;  1JCH A;  4ABM A;  3PSP A;  5AM5 A;  2MRL A;  2IHN A;  2K8C B;  5CEH A;  4NLC A;  4OJ6 A;  2GTS A;  2UXD B;  3UKM A;  3B8N A;  3DC6 A;  2IOH A;  1O9G A;  3O65 A;  3IN5 A;  2L5Y A;  1NKE A;  1L0N H;  3BY6 A;  5AKI A;  4EBD A;  4P30 A;  2Q69 A;  3H8W A;  3A0H Z;  5CWR A;  3ZBH A;  3M9M B;  3BQ2 A;  5EZY A;  4LR3 A;  4MEY A;  3CP8 A;  3L5K A;  3S6J A;  3OAA G;  1BPD A;  4MVO A;  4I2I A;  2EIN B;  4PZO A;  1NBM G;  1DF5 A;  5GTH Z;  5LHG A;  5IYD O;  1IBK O;  5L3G A;  2KOB A;  1AR1 B;  1SL2 A;  3RRG A;  2VQE O;  3V7K A;  3LNN A;  4ECX A;  4PH5 A;  2Q67 A;  1N5W A;  4YXJ A;  4I55 A;  5AM3 A;  3TGU H;  2JGD A;  1HUO A;  3X2Q B;  2VKQ A;  2ISP A;  1S0V A;  1MZF A;  1IBK B;  4ELU A;  3AL0 B;  3BEH A;  2K8B B;  4I2C A;  5AKJ A;  2VQE B;  2IOF K;  2VWK A;  4OJO A;  1L8L A;  4HNA A;  3Q8Q B;  3FD9 A;  3MBY A;  4Q44 A;  4UBC A;  1O9H A;  4CBC A;  5AKY A;  5KFD A;  2YXY A;  4ZI7 A;  4ZOH C;  3CXH F;  5KT7 A;  5B1N A;  4Y2Y A;  3QVN A;  1SQP H;  9ICV A;  4EYI B;  2WLL A;  4QZF A;  2E8M A;  2ZIX B;  2XY7 A;  1UPH A;  3B0Y A;  1VQO V;  3K5N A;  1S5L U;  2HMX A;  2M6Y A;  3ZHU A;  3CXC U;  2OIG A;  5B3S B;  2ITD C;  4JI6 O;  4DQS A;  4FBT A;  3RF9 A;  1TGO A;  4YJ2 A;  1D9D A;  4TV9 A;  4MS2 A;  2WFA A;  1AJP A;  2IA6 A;  8ICB A;  5HNK A;  1JQ0 A;  3IDW A;  4EX6 A;  5J2F A;  1K3E A;  3FB7 C;  1PNL A;  2CXY A;  3C2L A;  5BMV A;  3U0Z A;  4JI6 B;  4LJX A;  5F9L A;  3BS5 A;  4UAY A;  5J2K A;  2DUY A;  5D5P A;  4LNU A;  4J9K A;  3AEV A;  1SZP A;  4UAR A;  2IH1 C;  4QE7 A;  2MAX A;  1ARO P;  3OE7 G;  4BWJ A;  4MEX A;  1EN4 A;  2Q8V A;  3B8M A;  5TZV A;  2EZO A;  3ZS8 C;  1HDJ A;  2Y9T A;  4F4W A;  3EYZ A;  4UAS A;  4ED3 A;  3VQV A;  3HIL A;  4F6R B;  1VQL V;  2HI0 A;  4X66 O;  4AIL C;  7ICV A;  4ECV A;  2G5H B;  2YXH A;  1Y74 A;  3A2F A;  4TUY A;  4TV8 A;  3LUT B;  3D36 C;  2EAP A;  5J2J A;  4MVS A;  3MD0 A;  3W7U A;  1ZQI A;  3QYP A;  4EEN A;  2QAR A;  1R3J C;  1ZL8 A;  3BRC A;  3N2G A;  3LDD A;  1O08 A;  2QKC A;  3IC7 A;  4X66 B;  2W7O A;  1IVS A;  5L9X A;  5LGU A;  1S97 A;  4DFK A;  4KLH A;  2NR5 A;  4CH3 A;  5KFQ A;  4UAW A;  5LMU O;  3T1H O;  4GKK O;  5ITZ B;  1WCN A;  2NO5 A;  3WU2 Z;  4XA5 A;  4FZM A;  1BPE A;  2GUZ B;  2V4Q A;  5TIS Z;  3OJU A;  1Q46 A;  2XAJ A;  3N2K B;  1OCZ B;  3OR6 C;  4RZR A;  2FMQ A;  5LMU B;  1YJW V;  1SV0 A;  4GKK B;  2QKQ A;  3RR7 A;  2W9M A;  2HHS A;  5ALH A;  4MF8 A;  2HW3 A;  8ICR A;  1VEW A;  1WJZ A;  4BIU A;  2A1J B;  9ICN A;  1OJH A;  5JJN B;  3JAL A;  3N7S C;  4DK0 A;  3RBE A;  4NR1 A;  2JK5 C;  1LV5 A;  3ZDC A;  4P0P A;  3ZRW B;  4LF9 O;  4CGZ A;  1KTQ A;  3JPR A;  2LQT A;  2K4E A;  3JCZ A;  3SV3 A;  3CNH A;  5IY5 B;  2DOS A;  2HEP A;  4I5S A;  2KIV A;  1TK5 A;  2JEJ A;  3WK4 A;  3TET A;  4I9W A;  3VC8 A;  1F4N A;  2LKY A;  3UQ0 A;  2ZE7 A;  3ZI4 A;  4JI8 O;  3RYH B;  4R8U B;  1JFF B;  2HHU A;  1K1S A;  3UMG A;  1CEZ A;  4GX5 A;  3SYC A;  3CSX A;  3OMI B;  2XGQ A;  2W03 A;  4F93 B;  3HRD D;  1BS3 A;  2P6J A;  1BMF G;  3L3F X;  1VQ8 V;  4JI8 B;  3PSF A;  4NM1 A;  3TAR A;  3BQ1 A;  2XY6 A;  4RO2 A;  4F50 A;  1N32 O;  2ATL A;  2I6X A;  1TVK B;  2NRX A;  5GW7 A;  4LFC O;  1VQ4 V;  1PM9 A;  3MDA A;  5KFW A;  1K4C C;  2WA4 A;  2DW4 A;  5AHX A;  4I4T B;  4PI2 A;  1N32 B;  2HKO A;  1XNR O;  4YN4 A;  3UT5 B;  5KFJ A;  2VAN A;  3QO5 A;  4DUZ O;  4UB4 A;  1D5A A;  4KLT A;  2LGQ A;  5JJE B;  4WF9 V;  2RDI A;  3C21 A;  4FZL A;  3OM3 B;  4FLT A;  5J2G A;  4CZZ A;  1NJI W;  2BCU A;  3L72 H;  2YTU A;  2B21 A;  5CB4 A;  1ZJM A;  2BQU A;  2QWR B;  5LOV B;  4NLN A;  4C4T A;  4DUZ B;  1BNP A;  4Y2Q A;  3J81 j;  1R3K C;  4U6P A;  4DRX B;  4O5K A;  2YUA A;  4ACO A;  1GAX A;  2UVW A;  2A3Q A;  3Q4H A;  3RFR A;  3PX0 A;  1NK4 A;  5B1O A;  5K1X A;  2FDR A;  4M9N A;  3M9O B;  4IGG A;  2EIJ B;  3ZRX A;  1X42 A;  1ZQD A;  1L3U A;  1NJW A;  3AK2 A;  3MDS A;  3ISD A;  5J8Y C;  2W3S A;  3HKE B;  2CAZ C;  5ALM A;  2NLJ C;  3BA9 A;  2BZF A;  4QZH A;  3R66 A;  5DLG A;  3C90 A;  2KZM A;  5K1P A;  5IIN A;  1ZQF A;  5HP4 A;  2EH9 A;  4C7Z A;  3M1Y A;  4EB6 B;  1ZQR A;  1KQQ A;  2AQ4 A;  3IRU A;  3HW8 A;  2EDU A;  2ESE A;  8ICW A;  3K0D A;  4DL2 A;  2W55 A;  3OJS A;  3K57 A;  3RGB A;  2QM8 A;  4LZD A;  5IYZ A;  3JSL A;  3E8B A;  2JJ2 G;  4MVM A;  1ZQA A;  8ICM A;  3JD2 A;  2KV2 A;  3H4D A;  2JZB B;  2LBO A;  4DF4 A;  1WA8 A;  3CP1 A;  1IG6 A;  2ZKO A;  7ICS A;  5D46 A;  4OXS A;  5HHH A;  1CXZ B;  4PGX A;  4X88 A;  2ODM A;  4U7C A;  4LWS B;  1B06 A;  4O2B A;  4DR4 O;  1VF5 B;  4LP8 A;  1JX4 A;  2ZNJ A;  2ZTD A;  1NNL A;  2PGG A;  1UFI A;  4RAI A;  5CN0 A;  1ZQY A;  2DQN B;  2E8P A;  9ICL A;  2CUG A;  4X65 O;  3T1Y O;  2CTR A;  2W9C A;  2Z3Y A;  5DBC A;  5KAI U;  3JPN A;  5AK6 A;  4DSF A;  2C2D A;  8ICC A;  2DL0 A;  2OHF A;  1THZ A;  3B09 A;  4MT8 A;  5KA6 A;  5L3F A;  4DR4 B;  3SPG A;  5KFA A;  4JMU A;  3RBD A;  4JV2 A;  2XTA A;  4J9S A;  1PVQ A;  3FB8 C;  1T94 A;  2EZZ A;  4FZ0 A;  3SPJ A;  2OYY A;  2KFN A;  3T1Y B;  5EE9 A;  3T79 A;  4GT1 A;  3QO7 A;  5J0Q A;  4M6W B;  1MZE A;  3BVO A;  2OCE A;  4F4X A;  9ICJ A;  1Q6U A;  4UB2 A;  3GWO A;  2Q9L A;  3AMZ A;  4I50 A;  2AHY A;  3NGD A;  1JXE A;  5KFO A;  5KFI A;  3J81 N;  3UPQ A;  1ZQQ A;  4C7Y A;  5ALJ A;  3P30 A;  4FFK A;  5EE0 A;  3ABM B;  2OT5 A;  5EE3 A;  1IXR A;  1NVP B;  1B6Q A;  2K60 A;  4KMO B;  2DF4 B;  5KTQ A;  4RQN A;  2E8N A;  4MFC A;  7ICO A;  3C2M A;  4UV9 A;  3GWK C;  3RWR D;  4FFD A;  4F2S A;  2KIC A;  5J2B A;  4E0D A;  3SEI A;  4GX0 A;  5DQG A;  1GK9 A;  5BOM A;  1Z00 B;  2I5H A;  3QU2 A;  2LM1 A;  5DB9 A;  2JEF A;  2AJQ A;  2A3V A;  1ZQC A;  2RNB A;  3PZP A;  1V54 C;  1YT3 A;  3CCL V;  2EJR A;  4LFA O;  1L0L H;  4X1Y B;  1BHB A;  8ICJ A;  2EJ7 A;  5KL1 B;  2YIB D;  2B1I A;  3SPC A;  5AM4 A;  3BFR A;  1Q8I A;  1V38 A;  1XL6 A;  4ZKI A;  5HR7 A;  1BPY A;  2YIB A;  3JAW A;  2K9P A;  1JVM A;  5ALR A;  2H8P C;  4JAS A;  1OUQ A;  3WK8 A;  2HVI A;  3TFS A;  2YEV A;  1NKC A;  1H2K A;  1Y6X A;  1VQ6 V;  2ASJ A;  4X1K B;  3GIK A;  4DO2 A;  3BQ0 A;  4BR6 A;  9ICC A;  5B1B B;  2N04 A;  4YD2 A;  3IM1 A;  1VMG A;  2BDU A;  2ZJ5 A;  4WCE V;  2DWE C;  5KFN A;  1US6 A;  1IBL O;  4JYA O;  5AI8 A;  5ALU A;  2Y4U A;  4KLQ A;  3TXQ A;  2IJI A;  2JGU A;  1S0N A;  4I2D A;  3NVZ A;  2FLL A;  4J9Q A;  7ICK A;  3JCU Z;  4DL7 A;  4FIP C;  3WB0 A;  3H1L H;  3IG5 A;  5EWG A;  2PMZ F;  5IIL A;  1Q3V A;  4N21 A;  3DV9 A;  3CC7 V;  5CA3 A;  1IBL B;  2P35 A;  4JYA B;  1GH6 A;  4MVQ A;  4UVB A;  1VQ9 V;  4BW5 A;  1OV9 A;  3JAS A;  1DK1 A;  3RBZ A;  2VQF O;  4ZIB A;  4FM2 A;  5DBA A;  1S5L Z;  1V9P A;  5DG8 A;  4DV3 B;  2A19 A;  1HNX O;  1FFX B;  3ALR A;  4JB3 A;  3STZ C;  1BZK A;  1ROP A;  2OWO A;  4RQ4 A;  1BPB A;  3H4B A;  2VQF B;  4MW8 A;  3F2B A;  1F23 A;  5CA0 A;  4DV6 O;  1B04 A;  1M93 A;  3RYI B;  4PL2 A;  2ZXI A;  4IIJ B;  1HNX B;  5C93 A;  4Z6C A;  1VP7 A;  5ALE A;  2WB1 F;  9ICG A;  4FBU A;  2G08 A;  1KFT A;  4NLK A;  2ZIU B;  2GHY A;  4DV6 B;  4NJ8 A;  4WBN B;  4FE3 A;  1FXK B;  3UM9 A;  2KE7 A;  4Q45 A;  1I94 O;  4IRK A;  4BDP A;  4I0X A;  3M6Z A;  1ZQU A;  1MOF A;  4NLZ A;  1FJG O;  4JI4 O;  1OCC B;  1CUK A;  1KSP A;  3PW0 A;  4W4K A;  2PFO A;  2NO4 A;  1XO0 A;  1Z4N A;  1AVM A;  3E8F A;  3GQC A;  5ALN A;  3B77 A;  1I94 B;  4B08 A;  3E86 A;  5A0L A;  3DXR B;  5JCO C;  4JI4 B;  1FJG B;  3K58 A;  2AGQ A;  4UV8 A;  3QNM A;  4U7N A;  3BQ7 A;  1L8O A;  2P90 A;  4DV2 O;  2PTM A;  4QZB A;  1DLB A;  2CGN A;  5LA6 B;  7ICR A;  3LVV A;  3ZHV A;  1BSM A;  3ZN0 A;  3W7W A;  3PN1 A;  1ZQP A;  2BE3 A;  2HR3 A;  1GN2 A;  4ECS A;  2Q0A A;  4O4I A;  1ZOL A;  1L7N A;  4GIB A;  3AG3 B;  2YQE A;  3PY8 A;  1JJ2 U;  2HBM A;  3SJC C;  2VS0 A;  2V4R A;  1X9S A;  1KW4 A;  2IBK A;  2IH3 C;  5JQG B;  2YX8 A;  3I56 V;  5CBF A;  3J80 N;  1SWV A;  5H5N A;  4DUY O;  1N33 B;  2KG7 B;  1NJZ A;  3QUB A;  3KTQ A;  4B3R O;  1XEQ A;  4KLF A;  3LDE A;  5H2F U;  2W04 A;  3M7D A;  4XDJ A;  3KHG A;  3I76 A;  1XRE A;  4DUY B;  4NL9 C;  5FPR A;  3EHB B;  4JV5 O;  3IV6 A;  5CA1 A;  4B3R B;  1LVH A;  2HJF C;  3CMA V;  1ZQT A;  1SKV A;  4B3M O;  2MW2 B;  4PHP A;  2N74 A;  1H2M A;  1VDV A;  2R8J A;  3AG1 C;  4GYC B;  3TAC B;  4UAT A;  4IR9 A;  5LP6 B;  4JV5 B;  1AR5 A;  4PPX A;  2W9B A;  2NYV A;  5ALY A;  1EZV H;  2ZT9 B;  4KTQ A;  1NJY A;  1ZQJ A;  1FIQ A;  4B3M B;  4USA A;  5ALD A;  1BPX A;  5KFF A;  8ICS A;  2LW7 A;  3JAK B;  1LR1 A;  4IQW A;  5ALK A;  2QE7 G;  3HKC A;  4X20 A;  5ALQ A;  1SXD A;  4O4L A;  2WAQ F;  2ZM6 O;  4I9Q A;  1PK1 B;  3GVM A;  2H3I A;  4KLM A;  3OSP A;  4C4R A;  2P66 A;  1QLE B;  1RXW A;  2J6U A;  4NWI A;  1BPZ A;  4DR1 O;  3BAA A;  1SXE A;  5AI6 A;  4R50 A;  2ZM6 B;  4RQ1 A;  1Y76 B;  5KAF U;  1FFT B;  2KTQ A;  1Q82 W;  3N7R C;  5AI4 A;  3SPI A;  4KLI A;  2JEG A;  5CBH A;  4DEZ A;  2Y0P A;  5B1A C;  2WF9 A;  4LVS A;  4DR1 B;  4FFB A;  1U97 A;  1Q3U A;  4KLL A;  4J7K A;  5AIC A;  2D2C B;  1OCO B;  1JOY A;  4OJL A;  5IJ9 A;  3WKA A;  4DFP A;  5AKE A;  3E0F A;  3I5D A;  3RJF A;  4OX9 O;  3AU2 A;  1NR1 A;  4HZ3 A;  5EE1 A;  1MA1 A;  2H5X A;  3U10 A;  2EX3 A;  2E3C A;  5FNV A;  3ZDE A;  1A77 A;  5J0Y A;  2JRZ A;  3D6J A;  3TI0 A;  4X1I A;  9ICH A;  5L3D A;  3D8C A;  4W4L A;  3ZCC A;  2OXO A;  3PML A;  3F7Y C;  5L1J A;  2VA3 A;  1JIH A;  5IIJ A;  4JGS A;  1X6I A;  2EAN A;  4DR7 O;  1KUQ A;  2KZZ A;  5E79 Z;  3DGE A;  3QZ8 A;  3JD3 A;  2OCH A;  2Y1I A;  2RCV A;  3G4S V;  3APO A;  2FPM A;  2EIN C;  1S5H C;  4P4M A;  4RU9 A;  3F2C A;  1FS0 G;  3I55 V;  1VQP V;  3EZ5 A;  3VCB A;  1CP9 A;  1YTF B;  3AQE A;  4Y2U A;  2XY5 A;  1QCE A;  1OHH G;  3I1Y A;  4US8 A;  3FB5 C;  4DR7 B;  4M9L A;  1H8H G;  1FAF A;  5KFZ A;  1WUD A;  4O3Q A;  5EZY B;  4ICG A;  4JPR A;  4Y2R A;  2G06 A;  3CRA A;  3X2Q C;  1SZX A;  4WFB V;  1TV9 A;  1CI4 A;  3LNM B;  1JRO A;  2ZTE A;  4TQS A;  3THO A;  3QU4 A;  3T2M A;  4CCH A;  3CCV V;  3OTQ A;  4LH7 A;  2Y4T A;  1A0P A;  2GLE A;  2KKP A;  2KVC A;  3A8T A;  2Y0S C;  4AQY B;  1H2G A;  1D5N A;  3OTO O;  5E1A C;  5HR6 A;  1QVG U;  1J5E O;  5KAI Z;  1Q8K A;  2JGD B;  3NR7 A;  3MAB A;  2R9A A;  4Q43 A;  4ECY A;  2FMS A;  2VA8 A;  1M5I A;  3ABT A;  5B3S C;  7ICU A;  2RRD A;  2ZXW C;  3T5L A;  4IYH A;  4HNA B;  8ICT A;  2A79 B;  2IJK A;  1COK A;  4BX9 C;  3RTV A;  4ZI7 B;  3TFR A;  4LF8 O;  2LFS A;  2UXX A;  3CYO A;  3Q8P B;  2WLL B;  2KNJ A;  2Q4P A;  4MFA A;  2BTO A;  2BR0 A;  4GXK A;  4YVZ A;  3ETG A;  3QUC A;  1EM1 A;  3OUF A;  4QPK A;  4TUQ A;  3PW2 A;  1RQN A;  2Y69 B;  2OCC B;  5KFB A;  3RYF B;  4LF8 B;  1ZQX A;  2IM9 A;  4YJ2 B;  1KL9 A;  1MNG A;  4TV9 B;  4ECQ A;  2GBO A;  3JPO A;  3KOO A;  1RM1 B;  4IQV A;  4O4H A;  1H8E G;  3RFA A;  2QTO A;  4R8C A;  4F92 B;  3UQ8 A;  2BHN A;  2D6F C;  3AG4 B;  4PV1 B;  1BVS A;  3KKA C;  4RNO A;  3KHR A;  2X7R B;  2OH2 A;  3AK1 A;  5BMV B;  4R66 A;  3BS5 B;  5III A;  2A9H A;  4G9B A;  2WF7 A;  4F4Z A;  4NXM B;  4JUZ A;  4A8E A;  3OR7 C;  1QQC A;  4EEL A;  5L1M A;  2BQ3 A;  3JPQ A;  2Q68 A;  2XI9 A;  3HKZ F;  2UUA O;  3ZD9 A;  4LC1 A;  3CC4 V;  1X9M A;  3KZI U;  5DKW A;  5JCO A;  3WB2 A;  1BQZ A;  4TUY B;  4TV8 B;  2F1J A;  2VJ5 A;  2UUA B;  1V97 A;  3FAV A;  1OCZ C;  4EKW A;  2QAR B;  3SAH A;  3N2G B;  5KMG B;  1YIJ V;  2YDE A;  3GFK B;  3MDC A;  5AM0 A;  3IFX A;  1N2X A;  3AG2 B;  1HNZ O;  3RAQ A;  3HKB A;  1S77 D;  4M9G A;  4DQI A;  5DQH A;  3CEI A;  3M7M X;  1F4M A;  1YHQ V;  2QM7 A;  3ZRS A;  3SYO A;  3TKA A;  3NVW A;  4EFB A;  1QSL A;  2FL4 A;  3FYH A;  5KX5 A;  1TVA A;  1KEJ A;  5IY5 C;  4N23 A;  3K0G A;  2EZX A;  3EWA A;  3T4Z A;  2W3R A;  2XUM A;  5KT5 A;  3SYZ A;  4DL5 A;  1JA8 A;  4UB5 A;  1DRG A;  1N0J A;  3JAL B;  5EBL C;  2R8G A;  4QZA A;  4JI3 O;  3QXG A;  4NTX A;  3G80 A;  3ZED A;  3FM9 A;  4P0P B;  7ICN A;  1RSO B;  1ZD5 A;  1JAL A;  1NK0 A;  1AI6 A;  5L1I A;  3CB2 A;  3MFH A;  3L70 H;  3NVV A;  9ICQ A;  1N61 A;  2XOK G;  3N27 A;  4RQ5 A;  5J2A A;  4DL4 A;  9ICS A;  4JI3 B;  1ZRN A;  1XNQ O;  3R65 A;  5LGT A;  3JD0 A;  4B3S O;  4B9L A;  2ZE8 A;  2Q5Z A;  4JI5 O;  2K4H A;  4PA9 A;  1Q5O A;  9ICM A;  1GN3 A;  1ENV A;  4OPH A;  2ZIM A;  2J6T A;  1KBH A;  9ICX A;  4B3S B;  4DV5 O;  2HHW A;  3ASN B;  4QJF B;  3K06 A;  3K1R B;  3FB6 C;  3IJ4 A;  3SGI A;  2W0X A;  1JMK C;  4QWE A;  4JI5 B;  1G1X B;  1HNW O;  3D3I A;  3C23 A;  3FX7 A;  4RUF A;  5AKH A;  5A9G A;  4JI7 O;  3FYE B;  1TAQ A;  1V85 A;  3GZF A;  4PJ0 U;  3SAG A;  3RJH A;  5GTI U;  2NRV A;  1Q6I A;  2KSD A;  3ZX6 A;  4G2K A;  4DV5 B;  4NTW A;  4DFM A;  3ED5 A;  1ZD3 A;  1AQ6 A;  2ZIN A;  3MR5 A;  1QTM A;  1AP6 A;  1HNW B;  1XS9 D;  4D7S A;  4JI7 B;  4LF5 O;  5AK4 A;  2K4P A;  2W54 A;  4J10 A;  2PYJ A;  2ZUB A;  3MGI A;  2ZDI C;  3NTU A;  4YD1 A;  2MUT A;  4KFM A;  2HP8 A;  1N56 A;  1YXB A;  5KFR A;  2AQ0 A;  4F5N A;  9ICU A;  4IYI A;  4C4S A;  4LF5 B;  2EIJ C;  3RJI A;  1SZH A;  3LSQ A;  1S0O A;  1RYR A;  4TQD A;  5CB4 B;  5LGN A;  2ZNI A;  4JK1 A;  1MQ2 A;  3JYC A;  4UCR A;  5CP2 A;  8ICH A;  3JAT A;  1Q3E A;  2KJ9 A;  4CNQ A;  4IL6 U;  1MSW D;  3OT7 A;  4B9V A;  8ICF A;  4X64 O;  2QR4 A;  1SQQ H;  2JRI A;  1ECW A;  4I2E A;  4FLX A;  2CK3 G;  2QLT A;  2ETN A;  5JH7 A;  3T1H B;  4O5C A;  2HFE C;  1M90 W;  2QEX V;  3UM7 A;  3E22 A;  4O3O A;  2C2E A;  4DWI A;  2ZUD A;  4QZC A;  1N48 A;  1SQX H;  4H37 A;  4A5U B;  1ZQH A;  4X64 B;  1I08 A;  2QWQ B;  4C80 A;  2F1I A;  1S10 A;  4U3J B;  1U45 A;  1MA7 A;  1N8R W;  4O2A A;  4PA6 A;  2DYS B;  2ZQM A;  1QHT A;  4DV7 O;  1PK3 A;  1W0J G;  1WLE A;  5L3E A;  4J7Z A;  2JHD A;  3MR3 A;  3G6E V;  1NH2 B;  4LF9 B;  1I7F A;  5J2I A;  1P4R A;  3F5T A;  1CPY A;  4ECU A;  5BY1 A;  3C5F A;  2ODG A;  3ETQ A;  4UXN A;  5IYZ B;  1KKX A;  4QE9 A;  4DV7 B;  2E5L O;  1UT8 A;  4FO6 A;  1TA8 A;  4UUJ C;  1WA8 B;  2YI8 A;  2FMP A;  2JEX A;  1DF4 A;  1I0H A;  7ICE A;  4TUP A;  1V55 B;  3U26 A;  1NTZ H;  3OHB A;  5BR8 O;  4B7K A;  1FFV A;  4O2B B;  1ZQO A;  2E5L B;  2XGP A;  3ZHR A;  5AKX A;  3RN4 A;  4RT3 A;  3BQT A;  1RYU A;  4DV0 O;  2LHT A;  1YSC A;  5J29 A;  2W9C B;  3UO3 A;  1W2B U;  4KUM A;  5BR8 B;  3C3T A;  2P6U A;  2ZJA A;  1VF6 A;  1SGG A;  4B9U A;  3W7X A;  1ZQN A;  1URF A;  4BGD A;  4LFC B;  4J9Z B;  4CS2 A;  4UFZ A;  5DGB A;  2WWW A;  3ABM C;  3CCE V;  3K03 A;  3RYC A;  4DV0 B;  2RLT A;  3SV4 A;  4MW3 A;  3S3W A;  1L7P A;  1TE2 A;  2W9A A;  5KG4 A;  1U49 A;  3WG7 B;  1XOU A;  2BTQ A;  1BGY H;  5LL6 Y;  3TAD C;  2FB5 A;  3EW9 A;  1VIB A;  2LYB A;  2L6L A;  2BSK A;  4PDV A;  9ICW A;  1XNR B;  2LP7 A;  3C2K A;  5KFH A;  4DOC A;  8ICK A;  2R9R B;  1QQ6 A;  4I50 B;  2R70 A;  1ZLZ A;  2QJ1 A;  4PA4 A;  2EAO A;  1KYO F;  4YMN A;  3SYA A;  1GM7 A;  3H7I A;  2KIW A;  4UB8 Z;  4YY3 O;  2W0F C;  5KHG A;  1UPG A;  5AI5 A;  3RR8 A;  1JRP A;  2H3Q A;  3B2E E;  4Z1M G;  4P0Q A;  5IIM A;  2ZG6 A;  1R3I C;  2CRX A;  1X6J A;  4YY3 B;  2N1R A;  4DFJ A;  4TWK A;  3K04 A;  2MK3 A;  2RMK B;  3VQW A;  4DXW A;  2CTP A;  4X8A A;  3PR5 B;  8ICU A;  3RJJ A;  2HVJ C;  4R63 A;  1KRP A;  1RQL A;  1M6Y A;  1NKB A;  4B9M A;  2QSA A;  3L74 H;  4NV0 A;  3RB6 A;  1DGJ A;  1PP9 H;  3WKE A;  1YZ7 A;  1BCC H;  5B1B C;  2O57 A;  4RUA A;  1RPO A;  3P3N A;  2V1D A;  5AKZ A;  2ASL A;  4WFG A;  3QF7 A;  5ALT A;  4Y2S A;  1L6N A;  4ED7 A;  3SEN A;  3AG7 A;  5JUM A;  4RUC A;  4CE6 A;  3ABK B;  3JAW B;  1RDF A;  2RHF A;  3V7J A;  1DGS A;  1S9F A;  3V72 A;  3BAB A;  2YEV B;  4R64 A;  2UUC O;  1GTO A;  2EAM A;  3M8S A;  1ZET A;  3K5M A;  1L3S A;  2CDY A;  3KCX A;  7ICH A;  1PL0 A;  4QNH B;  5J0T A;  2EIM B;  2D3O W;  5LHI A;  4LF4 O;  1DTO A;  4MTF A;  5DG9 A;  1NKD A;  1WPX A;  5IE9 A;  4DQQ A;  2UUC B;  4DL3 A;  3CE2 A;  4QWB A;  3QEB Z;  2BPC A;  2GOL A;  5H6Q A;  3WK6 A;  4X65 B;  4LF4 B;  4C8K A;  4NTY A;  2JS5 A;  3UXP A;  2KFZ A;  5AIB A;  2IW5 A;  2ZCE A;  1SIJ A;  2FTK A;  1JN3 A;  4ZOL A;  4CRX A;  1PUZ A;  2WLI A;  3H1K H;  5AG2 A;  3JAS B;  4WFF A;  4Q8E A;  4FM0 A;  4TQF A;  2B5U A;  2HHX A;  5BXZ A;  3RH6 A;  4JV0 A;  4LCU C;  5EK0 A;  3OMN B;  1U96 A;  5EC2 C;  1MMM A;  1YJN V;  1FXK C;  1ZAU A;  2RQ6 A;  4BIO A;  1Y67 A;  1AP5 A;  4M2Y A;  3UT5 A;  3U11 A;  2WLH A;  2VA2 A;  4O4J A;  1G4Y B;  2QWO B;  3T4D A;  3MHH C;  5CA0 B;  1YZB A;  1OCC C;  1KB9 F;  1WP8 A;  2W43 A;  3VBB A;  2C22 A;  2GTA A;  4CH6 A;  1X4T A;  2CTQ A;  3KHL A;  3EPG A;  3B40 A;  4HBN A;  3APQ A;  5DB8 A;  2JH7 A;  4XQ8 A;  5J0X A;  2DQ3 A;  4K3A A;  1UJW B;  3D36 A;  2KEY A;  4I0X B;  4MTG A;  1OXJ A;  4I27 A;  2OYQ A;  4K4G A;  3BZC A;  8ICA A;  1SA0 A;  3AEI A;  7ICM A;  4RQ8 A;  3BJY A;  3KZI Z;  1T3N A;  4RPY A;  1FPO A;  2GDS A;  5KLV H;  5KFS A;  2G07 A;  3ABL B;  5ALO A;  1DK2 A;  3JPT A;  5A2Q N;  1OZ0 A;  1S72 V;  4QZG A;  3SR6 A;  4GZR B;  2QDO A;  4YR0 A;  3C3S A;  2JEI A;  3AG3 C;  1I5Y A;  3HKE A;  2DYR B;  2FLP A;  5J2C A;  3NS1 A;  4HYO A;  5KG5 A;  5LYJ A;  4LFA B;  4C8L A;  1SQG A;  1U47 A;  1Y4M A;  3W7T A;  3SI8 A;  2VRZ A;  3JAR A;  3ASO B;  3D2N A;  5CMU A;  1M56 B;  3TAN A;  2UVR A;  4B9T A;  2GO7 A;  1RZT A;  1S3J A;  3LSU A;  3T1C A;  1YDX A;  9ICI A;  4XDK A;  5C8Y A;  7ICQ A;  3UQ2 A;  2FI1 A;  1IUR A;  2P4K A;  3OFN G;  4BUG A;  3RJG A;  3QG5 A;  2KHV A;  3A0H U;  2YMM A;  2X6C A;  3NXS A;  4O4I B;  9ICT A;  3PSI A;  4NXN O;  3HWT A;  3E2E A;  3WFV A;  4DK1 A;  2JZB A;  4J7J A;  2FML A;  3SMV A;  3Q8L A;  5F2V O;  4CF4 A;  1Z1B A;  2E3T A;  4PHA A;  4NXN B;  5GTH U;  5J2U A;  4IHJ A;  4KLS A;  1T7P A;  4JZ2 A;  1EXN A;  5LP6 C;  3RRH A;  3QEA Z;  2ZIV A;  1TAU A;  4AP9 A;  5JRT A;  4GLX A;  3ONN A;  1N60 A;  1PVP A;  2XHB A;  1IZ3 A;  4YQW A;  1PL4 A;  5H6R A;  5CA1 B;  2A06 H;  2ALZ A;  5DB6 A;  5DG7 A;  4EX7 A;  2HBL A;  1S5J A;  4B9S A;  2E8O A;  2YMQ A;  1IXM A;  3KCY A;  2H3O A;  4X9Q A;  2F76 X;  3UCS C;  1QLE C;  2W9B B;  5L1L A;  4K35 A;  1SS3 A;  2NRT A;  2QB0 A;  2O6K A;  1PVR A;  4FVM A;  1NVP D;  3HKC B;  2A7W A;  4PJ0 Z;  2LO1 A;  4TUR A;  4MF2 A;  2EIK B;  4M9H A;  3UXO A;  4Q20 A;  2GV9 A;  2QKA A;  3D2Q A;  3ABU A;  4ECW A;  5KHI A;  5JVD B;  2ADP A;  4BXO B;  1NI8 A;  5KFY A;  2WA3 A;  2WF6 A;  2YB1 A;  1B0X A;  2BDP A;  4ZHQ A;  2H3V A;  2W11 A;  5BPC A;  4FLZ A;  1OW5 A;  2X6B A;  1OCO C;  3GIJ A;  2JIZ G;  3NRW A;  1M9N A;  8ICL A;  4F4Y A;  1PPJ H;  2BOB C;  1AI4 A;  2QTS A;  3SJQ C;  4PL1 A;  3CWB H;  5B5E U;  9ICP A;  2JDI G;  3K79 A;  1ZD4 A;  2M7W A;  5LBQ A;  3FDS A;  1KN5 A;  1NOM A;  2FJ6 A;  1QNM A;  1NS1 A;  4FFB B;  4XBF A;  4YJ3 A;  4JWN A;  2LM4 A;  1Y66 A;  1ZQM A;  4O0I A;  3QU5 A;  4J9R A; 
#chains in the Genus database with same CATH homology
 3IC7 A;  2RRD A;  2W7O A;  2ZXW C;  5LGU A;  2A79 B;  2IJK A;  2KKV A;  2ZIV B;  2HOI A;  2KJ8 A;  4BX9 C;  4BJQ A;  4FZM A;  4MVU A;  1OCR B;  2LFS A;  2UXX A;  3CYO A;  5EBW C;  2G5I B;  1J95 A;  2XAJ A;  2WLL B;  2KNJ A;  4F4L A;  1OCZ B;  3OR6 C;  2EIK C;  2H3F A;  1FXH A;  1YJW V;  3SYP A;  3ETG A;  5EC1 C;  1V54 B;  3ZIA G;  3OUF A;  1F51 A;  3LSS A;  4QPK A;  1ED1 A;  2Y69 B;  2OCC B;  4BIU A;  1E79 G;  1JX9 A;  2F77 X;  2VIX A;  3N7S C;  2YSU B;  1RM1 B;  2JK5 C;  1H8E G;  3RFA A;  2QTO A;  4R8C A;  4P0P A;  2D6F C;  3K9A A;  3AG4 B;  3ZRW B;  3MGV A;  1NZB A;  4CGZ A;  5J9P C;  2X7R B;  2OH2 A;  1KEC A;  2C2A A;  2K4E A;  1VQ7 V;  2A9H A;  2QKS A;  2ZDI A;  5KL8 B;  2JEU A;  3F5E A;  3JCZ A;  5DM6 V;  5IY5 B;  4I5S A;  1S76 D;  4A8E A;  3OR7 C;  3TET A;  1Q86 W;  4I9W A;  2K89 A;  3VC8 A;  2Q68 A;  1F4N A;  2LKY A;  2XI9 A;  2CPR A;  3HKZ F;  1GO3 F;  2V7Q G;  2UXN A;  4PA7 A;  2JGA A;  4LC1 A;  3CC4 V;  4GX5 A;  1CEZ A;  2Q4T A;  3SYC A;  2M0N A;  3OMI B;  1PKX A;  2PI5 A;  3H0M B;  2W03 A;  1OCR C;  2VJ5 A;  3OEH G;  2P6J A;  1BMF G;  3L3F X;  1VQ8 V;  3PSF A;  1OCZ C;  1SER A;  3H0R B;  4EKW A;  2NNU A;  4FZN A;  3F5A A;  3SAH A;  2K1E A;  1YIJ V;  4RO2 A;  2HOF A;  2A0L A;  3ZMT A;  2XAF A;  2OCC C;  2Y69 C;  5GW7 A;  3IFX A;  3AG2 B;  1VQ4 V;  4WFH A;  2LYA A;  1RM1 C;  1S77 D;  1K4C C;  3F5W C;  3AG4 C;  1F4M A;  4XDL A;  1YHQ V;  2QM7 A;  2DW4 A;  3SYO A;  3ZRS A;  1FXK A;  2HKO A;  3QO5 A;  4P2Z A;  5KA5 A;  5IY5 C;  4WF9 V;  4N23 A;  3K0G A;  4FZL A;  3OM3 B;  3T4Z A;  2JJ1 G;  1NJI W;  1KP2 A;  4CZZ A;  1DRG A;  2PMZ C;  1XL4 A;  2F2A B;  3E83 A;  3H0L B;  5EBL C;  3QNE A;  5H9C A;  4P0P B;  1AI6 A;  2P7T C;  1R3K C;  4U6P A;  1P7D A;  4ACO A;  2E5S A;  1G8M A;  2W6J G;  1K5Q A;  4BAY A;  2XOK G;  3C29 A;  5B1O A;  3PJS K;  3R65 A;  3FKS G;  5LGT A;  3JD0 A;  1VQM V;  2E1F A;  2ZXH A;  2EIJ B;  1NR7 A;  2K4H A;  4PA9 A;  5LHH A;  3ZRX A;  3AG2 C;  1ENV A;  2NLJ C;  1L1F A;  2WB1 C;  1GM9 A;  3ASN B;  5FL7 G;  4QJF B;  3K06 A;  4OJP A;  1R6K A;  3FB6 C;  3KZX A;  3ETD A;  3EFF K;  3HPL C;  4J9Y B;  3D3I A;  3CRX A;  2Q6A A;  2WSS G;  4RUF A;  1AI7 A;  4RQE A;  2BOC C;  3SYQ A;  3FYE B;  3NUQ A;  3GZF A;  3SAG A;  1VQN V;  3K0D A;  4G2K A;  2MA1 A;  2X6A A;  1E1Q G;  2QM8 A;  1ORQ C;  4HAM A;  3CCJ V;  2B1G A;  4RUE A;  3E8B A;  2JJ2 G;  4MVM A;  1SRY A;  3JD2 A;  2KV2 A;  2WLM A;  2LBO A;  1QVF U;  1D8B A;  3CP1 A;  3CPW U;  2X0L A;  4OXS A;  2ZDI C;  1AI5 A;  1KP3 A;  4KFM A;  4X88 A;  4U7C A;  4U7O A;  4LP8 A;  1MG1 A;  4WFA V;  2QA4 V;  5CN0 A;  2EIJ C;  4RAI A;  1SZH A;  3LSQ A;  2DQN B;  5LGN A;  1K34 A;  3KG2 A;  2K4I A;  2Z3Y A;  4E2L A;  2EIL B;  3JYC A;  3CC2 V;  1THZ A;  5L3F A;  2KJ9 A;  2Y0S F;  4MT8 A;  5KA6 A;  1MSW D;  4GCZ A;  1K97 A;  1HIW A;  3SPG A;  4JMU A;  1KC8 W;  3ASN C;  1YI2 V;  4P9P A;  1ECW A;  4KP4 A;  1PVQ A;  3FB8 C;  2CK3 G;  1T94 A;  2VJ4 A;  4JF3 A;  4MSW C;  2HFE C;  2OYY A;  3E35 A;  3SPJ A;  3T79 A;  4GT1 A;  3UM7 A;  5C0Y A;  3QO7 A;  4PDR A;  4YXW G;  2EBO A;  2Z5U A;  1ZWI C;  4H37 A;  2WPD G;  5BZB A;  4ICA A;  1GMG A;  1P7B A;  2F43 G;  3GWO A;  1H38 A;  3SPH A;  5DN6 G;  3W7S A;  4RQF A;  2AHY A;  2IU3 A;  1MA7 A;  1N8R W;  2ZIW A;  4PA6 A;  3OMA B;  3P30 A;  1Q82 W;  3DTU B;  5CRX A;  2DYS B;  2ZQM A;  1K92 A;  3ABM B;  2OT5 A;  4TSF G;  2K8A A;  3CCU V;  2XVT A;  4QIW C;  1W0J G;  1NVP B;  1R6N A;  1WLE A;  1B6Q A;  5L3E A;  1ZQ1 C;  1VQK V;  4P9O A;  3OPX A;  2JHD A;  2DF4 B;  4KMO B;  2ZR2 A;  3G6E V;  1NH2 B;  2XAS A;  1P4R A;  1K8A W;  1CPY A;  4UV9 A;  2IU0 A;  2HBK A;  5L3C A;  4UXN A;  2KJ5 A;  2WLN A;  3M99 B;  3LYS A;  3RVY A;  4QE9 A;  3P32 A;  2KIC A;  3D2S A;  4GX0 A;  2XND G;  2EIL C;  4MVR A;  4PA3 A;  3RVZ A;  4UUJ C;  1GK9 A;  3K08 A;  1Q81 W;  4LBE C;  2JEX A;  1DF4 A;  3ZMU A;  3TK1 A;  2H94 A;  3SAF A;  1F44 A;  1V55 B;  1PD3 A;  2OTJ V;  1LNQ A;  2A3V A;  2HVK C;  2WAQ C;  3PZP A;  1V54 C;  1YT3 A;  4UVC A;  3CCL V;  1PNK A;  1K4D C;  4UVA A;  2EJR A;  4AYB C;  4C0Z A;  1BHB A;  4GFJ A;  3SPC A;  5KL1 B;  2E1E A;  2B1I A;  3E8G A;  4R7C A;  1YTF D;  2LHT A;  1YSC A;  1VQ5 V;  1XL6 A;  1R73 A;  4MVZ A;  4ZKI A;  1W2B U;  5HR7 A;  4KUM A;  3IG8 A;  1AJQ A;  1JPX A;  1NQT A;  4BIZ A;  2ZIU A;  5CBG A;  3ZJZ A;  1JVM A;  2H8P C;  4JAS A;  1OUQ A;  3KFU F;  1QR8 A;  2XAQ A;  3W7X A;  3PST A;  2DYS C;  2YEV A;  1K5S A;  2WWW A;  4J9Z B;  3ABM C;  3CCE V;  3K03 A;  1VQ6 V;  4AYB F;  4MW3 A;  2WLJ A;  1QR9 A;  4DO2 A;  2RP5 A;  5B1B B;  3WG7 B;  5HFM A;  3VOU A;  5IYC O;  2BDU A;  2LYB A;  4PDV A;  1E1R G;  2EZP A;  4WCE V;  3CME V;  2LP7 A;  2R9R B;  2DWE C;  5KUM A;  3GB7 C;  3ETE A;  3M6K A;  4PA4 A;  2PI4 A;  2ZIW B;  1TAM A;  4NLB A;  3SYA A;  1BHA A;  1GM7 A;  2IJI A;  3OGC C;  4JAV A;  1K33 A;  5IDJ A;  2KIW A;  1GM8 A;  3OUS A;  4GX2 A;  2W0F C;  3ZMV A;  5L3B A;  1V55 C;  3E89 A;  4FIP C;  3IG5 A;  3STL C;  2H3Q A;  2PMZ F;  1Q3V A;  4N21 A;  3CC7 V;  4Z1M G;  4P0Q A;  5CA3 A;  1KQS U;  2ZG6 A;  1R3I C;  2DGZ A;  2CRX A;  2OM6 A;  1URJ A;  4MVQ A;  4UVB A;  4ASU G;  4BW5 A;  3CCS V;  1VQ9 V;  1QLN A;  2N1R A;  3RBZ A;  4TWK A;  3K04 A;  2MK3 A;  4PEL A;  2YB4 A;  4DXW A;  3G71 V;  4X8A A;  2Z7J A;  2R18 A;  3AQF A;  2NV3 A;  3ALR A;  1FXV A;  2HVJ C;  1I5X A;  3STZ C;  1ROP A;  4NV0 A;  3I55 V;  4MW8 A;  3F2B A;  1F23 A;  3CCQ V;  1M1K W;  3ZRV A;  2KD1 A;  5B1B C;  3WG7 C;  1RPO A;  3O0F A;  2IJJ A;  4PL2 A;  2ZXI A;  2V1D A;  2ZXW B;  3H01 A;  4WFG A;  5C93 A;  1M90 W;  1L6N A;  1KBU A;  2WB1 F;  2G08 A;  3F7V C;  2G0A A;  4JYC A;  4X89 A;  2F8L A;  2ZIU B;  2ATK C;  2GHY A;  3ABK B;  4FE3 A;  2KHQ A;  2RHF A;  3N7P D;  1FXK B;  1SET A;  2HG5 C;  2YEV B;  1GTO A;  3M6Z A;  1MOF A;  1K73 W;  1OCC B;  1KKD A;  2CN1 A;  2KB1 A;  4JTD B;  1KD1 W;  3JD1 A;  4QNH B;  1PL0 A;  2GSM B;  1EFR G;  2EIM B;  1GKF A;  2D3O W;  5LHI A;  3ML0 A;  5T14 A;  1XO0 A;  3IGA C;  1DTO A;  2IJH A;  2WLK A;  1NKD A;  3E8F A;  1WPX A;  3B77 A;  3QO8 A;  3LDC A;  4MTF A;  4QNL A;  1A6S A;  2Y48 A;  3E86 A;  4R6Z A;  5A0L A;  1YJ9 V;  1COW G;  1M57 B;  4OO1 J;  1TUE B;  3C28 A;  2GOL A;  4UV8 A;  3HB3 B;  1CRX A;  3K3W A;  4U7N A;  5H6Q A;  2JMG A;  4O3M A;  4G27 B;  2OTL V;  3F53 A;  3CD6 V;  3AG1 B;  2IW5 A;  2FTK A;  4P0Q B;  2P90 A;  1MAB G;  1DLB A;  1R3L C;  4CRX A;  2W7P A;  3LVV A;  4KX5 A;  2WLI A;  3ZN0 A;  5KUK A;  4WFF A;  2JH1 A;  1Z19 A;  1W0K G;  3W7W A;  3OEE G;  3JD4 A;  5HFL A;  2B5U A;  2HR3 A;  3RW0 A;  3ZN1 A;  1K9M W;  4LCU C;  2W6I G;  3AG3 B;  4FJC C;  4JYB A;  5EK0 A;  2HBM A;  1JJ2 U;  2P67 A;  3OMN B;  3ABK C;  2IH3 C;  5EC2 C;  1YJN V;  1FXK C;  4PDM A;  2HLD G;  2YX8 A;  1SES A;  3I56 V;  4PDL A;  5CBF A;  4KX3 A;  2WLH A;  1G4Y B;  3T4D A;  2DWD C;  3MHH C;  2QEX V;  4CDG A;  1OCC C;  4L87 A;  3LVW A;  1HWY A;  3LDE A;  3VBB A;  1SZT A;  3TCU A;  3DEE A;  3MHS C;  3K1Z A;  2W04 A;  2EIM C;  3OW2 U;  3M7D A;  5IYD O;  2XID A;  4XDJ A;  4ZBM A;  3HKZ C;  1BL8 A;  4QIW F;  2JH7 A;  3EHB B;  2DQ3 A;  4JTC B;  1M57 C;  1UJW B;  2HBJ A;  4FMT A;  2HJF C;  2KEY A;  1QBZ A;  3D36 A;  4IC9 A;  1PNM A;  4MTG A;  5B1A B;  3CMA V;  3ZMZ A;  2ZIX A;  3GU3 A;  3F2D A;  3AEI A;  4JAU A;  5EBM C;  3CCR V;  3AG1 C;  1Q7Y W;  3IP4 B;  1JCH A;  2R9I A;  2G07 A;  3CYM A;  3PSP A;  3ABL B;  2MRL A;  2ITC C;  2K8C B;  1OZ0 A;  1S72 V;  4NLC A;  4OJ6 A;  3UKM A;  3B8N A;  3AG3 C;  2QE7 G;  1I5Y A;  4HYO A;  2DYR B;  2XAG A;  3IN5 A;  1AJN A;  2WAQ F;  3BY6 A;  3W7T A;  1Y4M A;  4P30 A;  2Q69 A;  3ASO B;  3D2N A;  5CMU A;  1M56 B;  2H3I A;  1S3J A;  4WJ3 B;  2LFR A;  1EZJ A;  3CP8 A;  3T1C A;  1QLE B;  4XDK A;  2WLI B;  4NWI A;  3OFN G;  4R50 A;  4BUG A;  3OAA G;  4MVO A;  2KHV A;  2X6C A;  3NXS A;  2EIN B;  3PSI A;  1FFT B;  1NBM G;  1DF5 A;  5IYB O;  3E2E A;  1EBO A;  3N7R C;  3WFV A;  5L3G A;  5LHG A;  2KOB A;  3ZMS A;  3SPI A;  1AR1 B;  4JTA B;  4OJ5 A;  4FPP A;  3E8H A;  5CBH A;  3SMV A;  2XIC A;  5B1A C;  2Q67 A;  1Z1B A;  4MTO A;  1Q3U A;  3X2Q B;  2VKQ A;  1OCO B;  1JOY A;  1S0V A;  4OJL A;  3BEH A;  3AL0 B;  2K8B B;  1HEK A;  3E0F A;  3ABL C;  1NR1 A;  4OJO A;  2ZIV A;  4HZ3 A;  3ONN A;  1PVP A;  4CBC A;  4WFE A;  5H6R A;  5B1N A;  2AHZ A;  2DYR C;  1XNS A;  2WLL A;  4QPJ A;  5L3D A;  2HBL A;  2ZIX B;  3ICX A;  1UPH A;  1VQO V;  1IXM A;  3ASO C;  2HMX A;  3ZCC A;  3CXC U;  2OXO A;  1M56 C;  2ITD C;  3F7Y C;  5B3S B;  2F76 X;  3RF9 A;  1QLE C;  4JGS A;  1RPR A;  2DQ0 A;  1K7D A;  1YIT V;  4GX1 A;  2H3Z A;  3DGE A;  4MS2 A;  4MTX A;  3JD3 A;  1AJP A;  3G4S V;  1IIP A;  1JQ0 A;  1PVR A;  1S5H C;  1FS0 G;  1K3E A;  2G09 A;  3F2C A;  1PNL A;  2EIN C;  3FB7 C;  3ZRW A;  1VQP V;  3VCB A;  1CP9 A;  1NVP D;  1YTF B;  3AQE A;  1QCE A;  1OHH G;  3FB5 C;  2EIK B;  1NH2 D;  1H8H G;  3CCM V;  3SQI A;  4Q20 A;  3ABU A;  3D2Q A;  1WUD A;  2YB1 A;  2HOQ A;  4JPR A;  4TT3 G;  2IH1 C;  4QE7 A;  2G06 A;  2H3V A;  4G28 B;  1ARO P;  3OE7 G;  3X2Q C;  2X6B A;  1OCO C;  4WFB V;  3B8M A;  2JIZ G;  3NRW A;  2EZO A;  3LNM B;  2GH1 A;  1M9N A;  2BOB C;  2XAH A;  2WAM A;  3T2M A;  1AI4 A;  3SJQ C;  4PL1 A;  3CCV V;  1VQL V;  2JDI G;  3K79 A;  1A0P A;  2G5H B;  2M7W A;  2KKP A;  5LBQ A;  2KVC A;  3LUT B;  3A0R A;  2Y0S C;  4FK5 C;  1H2G A;  4H33 A;  4MVS A;  3MD0 A;  5E1A C;  5HR6 A;  4XBF A;  3W7U A;  2ZD9 A;  1QVG U;  1Y66 A;  2ZR3 A;  1R3J C;  3FYI B;  5B3S C;  3ABT A;  3LDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...