4QIWF

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 37
structure length 122
sequence length 122
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwF02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qiwF01
3SAFA 2MA1A 2KV2A 4QJFB 2E1EA 2RHFA 3SAHA 4O3MA 4CGZA 1D8BA 2CPRA 1WUDA 4CDGA 4QIWF 4OO1J 4NLBA 2HBJA 3SAGA 1YT3A 3CYMA 2HBMA 2HBLA 2DGZA 2RRDA 5C0YA 4NLCA 2E1FA 2HBKA 1GO3F
chains in the Genus database with same CATH superfamily
1ZAUA 4IQWA 5AI4A 1TAEA 2JIZG 3E58A 1S5LZ 2RMKB 1KKXA 4ASUG 4JI5O 4DFJA 4JI4B 4DLEA 3JD3A 1C7YA 1TA8A 3PW7A 1E1RG 1S0NA 4EFBA 3E8FA 1Q82W 2XT9A 2UU9B 4H13B 3RTVA 1PM9A 2LQTA 5EIBD 3ZRWA 2R9IA 3FX7A 1XOUA 1V55C 1OCZB 1IVSA 2OCHA 4I55A 1K9MW 4MTXA 3C1ZA 2EULA 1N34B 4F6RB 3MHSC 5KMGB 4TQSA 3AMZA 2WFAA 4KX5A 4TV8B 4DW1A 4RQ7A 1SWVA 1VEWA 1RXWA 3L9DA 3VQXA 4LFBB 3ZHRA 4BX9C 4BJQA 5IILA 4LH7A 1N36O 3W7XA 5B66U 3K4GA 3HKEA 5J0WA 1WAZA 5DBBA 1L7OA 2X6BA 5L3GA 3GIIA 2YMMA 1RYSA 4Q8EA 2UXDB 1US6A 5ALIA 1Q6IA 4DR5O 4US9A 2KZMA 1HNXO 3H40A 2N74A 3HKCB 5EK0A 3K04A 1FXKB 4OO1J 2I6XA 4IQTA 3FB7C 3TXSA 1Q8IA 4X66O 1O08A 5KFNA 1X59A 1UA0A 3E8GA 3IGAC 5B1OA 3CPWU 1ZUQA 8ICIA 2KIWA 4DRXB 3STZC 3QZ8A 3T1CA 2KJ5A 8ICUA 1QSSA 3WKEA 5ALLA 4JUZA 2XY7A 4CC6A 4C4SA 1JX9A 8ICGA 1NZPA 3UMCA 4KLMA 5AI0A 4L8JA 1EXNA 4F4KA 4FJCC 3UXPA 2ZJ5A 2D8CA 5L3EA 4O4JB 4DR3B 4FFKA 3RJEA 9ICVA 4YMOA 1KFSA 1SZXA 1HJPA 5KFBA 1NJWA 3ABKB 2GO7A 5BPCA 1L5UA 5CA3A 3ISCA 3KHRA 4GXJA 5KA6A 2Q9LA 4PH5A 3LVVA 4LF5O 4KLFA 4DOBA 2GOLA 2F1HA 1PZNA 3ETGA 2JZBA 5KAFZ 4YHHO 3DDHA 2ZXWB 4UB8U 2E1FA 3ETLA 3C5FA 2G09A 2QR4A 3H01A 5JJJB 4I9QA 5J0QA 5ALKA 3ASOC 5J0UA 1WLEA 4UVBA 1S8OA 2LYHA 3IJ4A 2W0XA 2V4QA 2A19A 2ZKOA 4Y2PA 1JMSA 2H3ZA 5F3XB 4OJLA 3ZDEA 2QM7A 3H1JH 1DTOA 4DR6B 2CN1A 1ZQXA 5LXTA 3CE2A 1NH2B 4UB3A 1H38A 2DWEC 4O0IA 1MMMA 1YJ9V 3HKDB 4KLUA 5DG8A 1ZQHA 1N32O 3N28A 3WK5A 2CGOA 3KOOA 2XOKG 2K60A 3QXGA 2NR5A 5AKKA 3OGCC 3K5OA 3A2FA 2K9PA 1VQ5V 1ZQPA 1NBMG 3GV5B 2Q0AA 1TVKB 3CHXA 4F93B 4JI1B 1D8LA 1VIBA 2QKCA 3RWRD 5DBCA 3N97B 3JCUZ 5GTIU 3LK9A 2CPRA 3C1YA 2BCRA 8ICZA 2HLDG 5JTIA 3E22A 1Q7YW 7ICRA 4ECZA 2HMXA 4X8AA 4K4IA 3M8SA 4IGGA 5FP0A 2K4HA 5BOLA 3JAWB 5G5GA 1HEKA 2OWOA 2DQ3A 2H3OA 3LSQA 3ASNB 4PA6A 5JU5A 1NVPB 5KUMA 2IJHA 2IOFA 5D4BA 1OCOB 5GONB 3K0GA 4RAIA 4QWBA 2ZXHA 3QUBA 2V9WA 1YCIA 4I4TB 3CP8A 3U11A 1THZA 4BGDA 3NXSA 2NRVA 3BQTA 1ZRNA 5HP4A 5AICA 5KFJA 5L9XA 3CSXA 1Z00A 5AHXA 5AM2A 3JASB 4RPYA 4TQRA 4J80A 9ICKA 5EC1C 8ICQA 4FMTA 3THVA 2HHXA 2R8GA 4KX3A 4ED1A 3A8TA 1SWWA 3PNCA 1B4FA 4C0ZA 3Q8MA 4CF4A 3AM9A 3QZ7A 2YIBA 3Q8KA 3ZMSA 3ABTA 3CX5F 3J81j 7ICGA 3C2MA 5KT5A 1V38A 2IM9A 3OGIB 3RJIA 2FTKA 1TUEB 1K1SA 2OH2A 2KSDA 2LYAA 3CS5A 4RQ3A 5KG6A 3MGHA 2P5OA 4F3OA 4DV1B 3DC5A 3FDSA 1UA1A 2VA2A 3QUQA 2QTSA 4YR0A 2EINC 4JV1A 2KKVA 2BDUA 4F5PA 3T5LA 5EOZA 4HZ3A 1A6SA 1JUDA 3M1YA 5IINA 4RUFA 1LB2B 3RB0A 2DQ0A 4GKKO 1UT8A 5KFRA 2BCVA 3TFRA 3ZMVA 2FLLA 1K5QA 3C3TA 3K5MA 7ICNA 5KFIA 3WG7B 4KL1A 1SB3C 1PUZA 2N1RA 2KP7A 4PL2A 4EB6B 1L8LA 3CCUV 1JJOA 1VLBA 2DPIA 1VQPV 4TSFG 4IYHA 2ZINA 1VQ6V 1CXZB 4FLXA 1YI2V 1X9XA 4KLGA 3AG4B 1CEZA 1RDFA 2MAXA 4I2DA 2PTMA 3T4DA 5HFLA 3JPTA 1TK8A 4I0XB 3O65A 5HMMA 4K3AA 3LYSA 3TKAA 4U6PA 1SV4A 1Q6HA 3SAGA 1B06A 2KOBA 2K4PA 4H0LB 4MT8A 5J0RA 2HHVA 1XWLA 2ZIVB 2Q68A 1MZFA 3GZFA 1M9NA 3RR8A 2JVDA 4RUCA 1M56C 3LNMB 1XSPA 2Y0SC 1PVQA 3U10A 2JEIA 5J2IA 3K03A 3WB2A 1JRPA 2UVUA 3KFUF 1AILA 4CC5A 2HI0A 3RF9A 2YX8A 3SI8A 2UVWA 4IIJB 4G28B 1L3SA 1G4YB 5AG2A 3CP1A 4P2ZA 4PL1A 1ZX3A 3ZHVA 9ICBA 3AG2B 1HWYA 4MVRA 4NXMO 4J9SA 4I50B 4F5NA 1M5IA 1HNWB 4WFFA 4Z1VA 4YFKA 5KA5A 2HVJC 4BAYA 4MVOA 5KFVA 5DKWA 2JEGA 2ZDIA 4XUSA 2CE4A 4FLVA 5EE0A 8ICXA 1N0JA 1D5NA 4LF6B 5KFMA 2W3SA 2B1IA 2EAPA 5HNKA 1CI4A 3QF7A 3GWKC 4QWCA 1QSYA 3THOA 2YMPA 5B3SB 2D3OW 2AHZA 3C90A 2FPLA 3K9SA 4HNAA 4DF4A 2AGOA 3LUTB 5DEDA 4JV5B 3MAQA 3CCMV 1YJNV 3RJHA 1PNKA 2L35A 3G67A 4HAMA 2YSUB 4UCTA 5TISZ 1T3QA 4JI6B 1ZQVA 3UT5A 1XU4A 2UXCO 3UM7A 2XC9A 3HRDD 1NOMA 3C5GA 4UFZA 1Q86W 2H3VA 1QNMA 2ZDIC 3DSQA 3FAVA 4ED8A 4F6EA 2Y1JA 1N4CA 3BA9A 4NM1A 4NLKA 3SYPA 4LP8A 2ZD9A 1KMIZ 5ALOA 4NM2A 4UB4A 1TUBA 2XAHA 2YEVB 3E35A 9ICOA 4M0AA 2GBOA 4OJ5A 4ZIBA 1S0OA 4GXKA 1S76D 1N63A 3PO5A 3CYOA 4I55B 4X65O 3HT3A 4QZ9A 5ALSA 4RQ6A 1M57B 2Y4TA 4B9NA 2D6FC 2M7WA 5KFYA 1NK6A 2KTQA 4DR7O 1V54C 5B1BC 2CUGA 1JFFA 1T94A 5B66Z 5DN6G 4KMOB 1I0HA 2HOQA 2KN7A 2VA3A 4UCRA 1EN5A 5IYDO 4MHVA 3SR6A 5C5JA 2DGZA 5DDYA 4DFKA 4CRXA 3B2EE 4PDRA 1SETA 1ZQDA 3K9AA 4F4ZA 3JATA 2A1AA 1YIJV 4BR6A 5FNVB 4O3RA 2ATKC 2HOFA 2XVTA 3KHHA 4YD2A 4DL2A 3FYEB 3B0YA 4TUSA 4M9HA 4FLZA 4BW5A 3PJSK 3C29A 4EEKA 4YG2A 7ICLA 5KAIU 1WJZA 3A0RA 5J2UB 3VBBA 4QZEA 2BPFA 1YXBA 1V97A 1P7DA 4ELTA 3GVMA 4UCVA 1OCCC 2HR3A 4DQSA 4MTFA 1SGGA 2F1IA 4PGYA 1YZBA 4UCSA 4LFCO 4JI5B 4C8MA 4R64A 4CCHA 5J0SA 5L1MA 3HJEA 4I27A 1G8MA 3B4SA 1BPDA 3ZHSA 1KRPA 3TGUH 2QKAA 2KFNA 4QW8A 1WCLA 3I1YA 1ZD2P 2JZBB 2A7WA 4JI3O 1PNMA 4UB8Z 1GM9A 3HILA 2KK0A 3NVZA 3WFVA 4EEYA 2E5LB 3OGUA 5KMGA 1TK5A 3SMVA 4P0PA 2EIKC 1JVMA 4X62B 2Y1IA 4IC9A 4KTQA 5H9CA 4NTWA 1F0MA 3JPNA 4JTDB 3BZCA 1Z3EB 4RQ5A 2F44A 1M90W 4IT5A 4B3TO 2X6CA 4F2RA 3KHLA 2QGNA 4FIPC 4FVMA 3BPZA 3ABLC 1EFRG 5KFXA 1OCZC 1V9PA 1FXKA 4MW3A 2GV9A 3G71V 1ORQC 2UVVA 2QTOA 3K57A 2JGAA 2QDOA 4CDGA 2OTJV 5BOMA 4NLNA 3D36A 1QU7A 5LA6A 1QSLA 4QWDA 3ABUA 4DRXA 3MR6A 2DJVA 1Z4NA 4RPZA 5J2CA 3L72H 5GTIZ 1PP9H 2HVIA 4EFEA 4DK1A 4R8UB 3CJHA 4DFDA 2O57A 4WFGA 4ZHQB 3TQ1A 1HUZA 1N0NA 1VF7A 4PGQA 1XL4A 3AG2C 3HWTA 4Z2WA 4TWKA 2E5SA 1ZYQA 4O4JA 4RQMA 2V7QG 2LMRA 3F5EA 4PZNA 2H3FA 1WWUA 5DG7A 1FXKC 1K4CC 1WA8A 3HB3B 3R66A 2P06A 3PX0A 2QWQB 4OX9O 1YVWA 4B9MA 5AKYA 8ICSA 1KBUA 4YHHB 4ECQA 5FPOA 4R7CA 4X64O 8ICWA 3D36C 1QQ6A 2W6IG 5AK5A 1AJPA 5KT2A 5J0YA 3QTCA 1ZOLA 4QZFA 2P35A 1SS3A 2YIAA 2QJ1A 2BCQA 5B5EU 1K3EA 3WKCA 4AYBC 2W11A 1VQLV 4DO2A 2EINB 9ICAA 1AROP 2YUAA 4E2LA 3PSIA 2A06H 3QEAZ 2HVKC 1URJA 5J0PA 5KFGA 1SV0C 1IIPA 2Z7JA 3H8WA 5IWAO 1N32B 4CBCA 3SAHA 3RVZA 1L3TA 5BXZA 5ALDA 1HP8A 5KFPA 3NS1A 5J8YA 1TFRA 3BAAA 2GLEA 3JPOA 2BTQA 3HKDA 3TJTA 2ZXWC 2BSKB 2QWPB 4DR4O 3SJBC 5ALRA 4FBUA 2I9GA 4YJ2B 2BGWA 1ZQCA 2H5XA 1WB8A 1YZ7A 2EANA 8ICEA 3STLC 2KHQA 1V85A 4PI2A 1TVKA 4GKJO 2Z3YA 5JWPA 1HR0B 4KLDA 1XDCA 2EZZA 3UO3A 7ICSA 1K97A 3I28A 1Q43A 3D3QA 8ICHA 3FKSG 4KLQA 3ZRSA 4ZKIA 5ALNA 4UAVA 4TQDA 2KE7A 3CW2C 3H7IA 3JAWA 5J8YC 4PA9A 2FMSA 4FO6A 4MFFA 1ZXIA 4EBEA 2XASA 2RP5A 1NK4A 2W0FC 3TK1A 3ZMTA 3NUQA 3ZMZA 4KHPB 4O5CA 1X9WA 2ZTDA 3T1HB 2J6TA 4I4TA 4MF8A 2PKEA 2FLPA 3FYHA 3SQIA 2OCEA 3LWMA 1WN7A 4KLIA 1MQ3A 2ZTCA 1P7GA 1RXVA 2GTSA 5KHKA 3JASA 3G6EV 3AU6A 3A0BU 2WLJA 1IG6A 5ALGA 4R50A 4M9JA 1XNSA 1PK3A 2DF4B 1XMOB 1MABG 3CRXA 5KFAA 3ABMB 5KFKA 3M99B 4MVMA 4YY3O 2XGQA 2W7PA 2X6AA 3ASNC 1YTFD 5FPRA 3W7SA 1CP9A 4PHDA 1OCOC 5AK3A 1R3KC 4CS4A 3WB1A 4KP4A 3CRQA 2HG5C 1JIHA 4KLTA 4NJ8A 1WP8A 3BABA 1GK9A 5IJ9B 4O3QA 1NTKH 1NKBA 3SJAC 3TI0A 1Z5VA 3QNEA 9ICIA 8ICYA 4BIZA 1LR1A 4X20A 3KTQA 9ICMA 1U45A 4C8KA 3OAAG 8ICFA 2BPCA 1HIWA 4M04A 2PI5A 4KMUA 4RQ0A 4YR3A 3OW2U 3K79A 4OXSA 4EYHB 2E1EA 5KT7A 3K59A 1G1XB 2YXLA 3F7VC 4U7NA 1IBLO 4PA3A 4WFEA 2G0AA 5J29A 1NK8A 1MZEA 4HNAB 4U7OA 3RJFA 2F4VB 4NTYA 2QARA 5TZVA 4DSKA 2HHHO 7ICOA 5ALTA 4EB6A 1MA7A 2JDIG 1H2NA 2IU3A 4K4GA 1DLBA 4JYYA 4B3RO 3HKBB 2Y48A 3OMNB 4N21A 3OR7C 2HW3A 3OUFA 3K1RB 1H8HG 1PL0A 3FAVB 4H33A 2YDEA 1XREA 2O6KA 3CB2A 1F4MA 4JYAB 2EIMC 4QJFB 2H94A 4LFAO 4CS2A 2A3VA 4ED0A 2ASJA 1Q90D 4BXOB 3UMBA 4F91B 1TUBB 1IBKB 1SKRA 4B9SA 4BWAA 3BS5A 4FFBB 4UBBA 3I76A 4RT2A 2HHUA 2GWSA 4LF7O 4OD0A 2Y9UA 4I2BA 4MVZA 1NJZA 5JQGB 4IRCA 4IRKA 4JI7O 3AG4C 2I5HA 2ITCC 2BZFA 4ED6A 5KG7A 4IIJA 4P0QA 4BW9A 1AJQA 4BIUA 3SR2C 5L3CA 2KFZA 2HHSA 2KQXA 5CR0A 4I50A 2JK5C 4W4KA 2XO7A 3ETQA 4HYOA 3GV7B 1X42A 1Y66A 4UCUA 4O3MA 3GV8B 1J2MA 4I2IA 1KTQA 3IM1A 2W8KA 2P66A 4DV7O 4LF4O 1NQTA 1YITV 4DV4O 2B5UA 3QE9Y 4TOIA 4OJPA 4B3MB 4LR3A 1KUQA 1SKWA 4QGPA 3AL0B 2RQ5A 1HDJA 3NTUA 2W9AA 1Y67A 8ICVA 5KAIZ 4K0KB 4NLZA 3SDLA 4EX7A 4F4YA 1BHAA 1DF4A 1N2XA 3L5KA 4MW8A 4UV8A 5EE9A 2CK3G 3QYPA 3WKAA 4PELA 2M9NA 2WLMA 1RM6C 3RB6A 4B7KA 2AGPA 2FE9A 3K1ZA 5DGBA 1NR7A 3NASA 1RPOA 3QUCA 4F50A 4PGXA 4CE6A 3IV6A 3JAKB 1N60A 2HHQA 3F5TA 2LW7A 3ABLB 2YEVA 4QZHA 5B3SC 3TCUA 5HMLA 1N33O 2K8AA 2KEYA 1R3JC 4CH6A 5EIBC 2UXNA 2PMZC 3PW5A 4WBNA 1CUKA 1HNZB 4NXNO 4P0PB 1FAFA 4FLWA 3G80A 4TQFA 5ALXA 8ICAA 2F23A 1L7NA 4Y2XA 4DSEA 1FIQA 5DQIA 2E75B 1RQLA 3F53A 4GXIA 3OE7G 4DO9A 5E1AC 2XNDG 4DWIA 2WF6A 4ECRA 1L6NA 2PF4E 2Q73A 2UXBO 2A3QA 5J2TB 3K5NA 3ZDDA 5IIIA 2F1JA 4ACOA 1SQVH 1JXEA 5FNVA 2P6UA 3IDWA 2JS3A 3ISBA 4DV5O 1M57C 2EZXA 4JMUA 2JJ1G 5LA6B 3SYAA 4LF8O 1BNPA 2IBZH 3MABA 5JRTA 1D5AA 4RWUA 1BQZA 5J2UA 4YJ3B 3CJHB 5ALFA 1COOA 3J7AU 2FPKA 4LFCB 3D2QA 3W7UA 1GM7A 4J9RA 4JI8O 3TARA 4C4RA 5AI6A 2VRZA 1WA8B 2F2AB 2UUAO 3CRCA 4O2AA 5AKIA 1FFXB 1GN3A 1LNQA 1T7PA 3JSNA 1IURA 2UXXA 2NRWA 1SC5B 4JI3B 2E8NA 1NI8A 2LO1A 2AQ4A 3X2QB 4UAWA 1TGOA 4JWNA 2ETNA 4ABMA 3T1YO 3RYCA 2BCCH 2XGPA 3IFXA 4QNHB 4NKGB 2H3QA 3TETA 1FFVA 2BCSA 3V72A 5B5EZ 2C2RA 2ISPA 2BQ3A 3GWOA 3WU2U 3BQ2A 3K06A 3AK1A 4Y2RA 3T79A 2UUCB 3QO5A 5CP2A 4B3TB 3PY8A 2WA3A 1B43A 4J9NA 2WAQF 1SQFA 4ZOLB 3VOUA 4CZZA 3V7KA 2WLIB 3MHHC 4UCOA 5KG2A 1JXLA 1FO4A 5DECA 4I29A 4NVPA 4J9OA 4LVSA 1IZ3A 2XICA 2W43A 2BTQB 9ICEA 3B8NA 4GYCB 4CS3A 1ROPA 1R1BA 4EENA 3CMAV 2C2AA 3L71H 4F5QA 4O5KA 2HHWA 4ED7A 5KG5A 4QPJA 1SESA 3GB7C 5AKEA 3G6BA 3QG5A 3EXAA 4NTXA 3RBEA 1XMQO 1SL1A 4R8UA 3EYZA 3R65A 1KKCA 4ZHQA 3MR5A 3I56V 3JD1A 1LKYB 1NK7A 3UCSC 2R8JA 9ICFA 3H1IH 2HHTA 4BIOA 1LUWA 1YT3A 4QZAA 1NKDA 1RP3B 8ICPA 2GHYA 2H8PC 1JI7A 3M7MX 3QU2A 5C93A 1BT8A 3NRZA 1JMKC 2FYUH 2Y4UA 4I2JA 3RRGA 2QE7G 5J2FA 3APOA 1U96A 2ZUBA 3WK9A 2JEFA 3U26A 3M8RA 1FS0G 4FZ1A 1W0KG 3K75D 2JRIA 2AHYA 2PFQA 4IL6U 4GC6A 2ZCEA 5CB4A 5AKLA 2R8IA 5J2HA 3RAXA 2LJ2A 4JI2B 1N5WA 3A0BZ 5BMVB 1RZTA 5EWFA 4DUZO 3NVWA 2C2DA 3HPLC 4TV9A 5J2JA 2PYLA 2A1JB 1S10A 4IRDA 3RT3C 3RYFB 5DGAA 1R6TA 3EWAA 5CB1A 1T8EA 4MVQA 3ZHQA 5C0YA 5EWGA 4KN7A 3AEIA 4NYKA 4JV0A 2LFSA 3L70H 5L1IA 4DR4B 2N04A 3NVYA 1NTZH 3ETDA 3SPCA 2FI1A 2L6LA 5HR7A 3RH6A 4H37A 3EUB2 1ZL8A 2BSKA 2Q0OC 4X20B 1J5EO 4DW0A 4D6TH 4GKJB 4YJ2A 2EIJB 2OYYA 3V6JA 1Z19A 3L4PA 3RGBA 5AM3A 4DF8A 4DV6B 1I5XA 2W9BA 1F51A 4LZDA 3H1KH 1ZRMA 2WF5A 4GX1A 4B3SO 2VIXA 2EIMB 4AQYB 1FKAO 4O2BA 1FXHA 3IHQB 5D46A 4LF9O 1K33A 2E8PA 1N5XA 2CGNA 3ONNA 1SA0B 2F43G 4D7SA 2VQEB 3CC2V 5IT9N 1L0LH 2QARB 4RO2A 2AZ0A 4ECWA 4XDLA 1TVAA 3Q8RB 5D5QA 3F2DA 1XNRO 1P84F 4RT3A 4GT1A 2YB1A 1D2DA 4J9QA 4MVUA 1Z1BA 1TAUA 7ICMA 3PX6A 1ZSPA 2Q0ZX 2WTFA 2W9MA 2EH9A 5L1JA 3ED5A 9ICQA 3ZEDA 4NB5A 3WK6A 1I94B 2UVRA 2ZE7A 2XTAA 2F95B 3J81N 5AKHA 2D3DA 1SKSA 3OM3B 3O9OA 3RH4A 3K58A 4ICGA 1SZHA 3N7RC 1ZD4A 3BS5B 1MC8A 4TUQA 1BQ0A 3AN1A 1ZQZA 3LDAA 3M9OB 2KZZA 3I55V 1K7DA 2KD1A 1NKCA 2WB1C 3OJSA 4X89A 4DV0O 1ZQTA 4TUYB 3B0XA 3OTOO 4J9KA 3AG3B 7ICIA 4O3OA 5KFCA 1A0PA 2RHFA 2JEJA 4F5RA 1ZLZA 2Z5UA 5IJ9A 5KUKA 1SF9A 4JAVA 3V6KA 9ICXA 4P0QB 3GIKA 4DYLA 4QW9A 4F4WA 3LVWA 2PMZF 3G6YA 3D2NA 1B6QA 3P32A 1IBMB 3IAYA 3EFFK 3SV4A 2F8KA 4RQNA 4C7ZA 1K34A 4NL9A 3ABMC 3W7TA 1N8RW 4UARA 5LP6B 3DTUB 5KL8B 2DMXA 4JYCA 4JI0O 4ELVA 2KJ8A 1PVRA 4NY8A 2ATLA 2B1GA 5FLXN 3BVOA 9ICCA 3JPRA 3UQ0A 4YQWA 4YXWG 2M0NA 3RVYA 1ZQLA 5BR8B 1OUQA 7ICJA 1X40A 4Y2JA 2ZIOA 1IV8A 3T5HA 4B3RB 2YI9A 3KZXA 4UV9A 3UKMA 2PYJA 1XQ8A 3HKBA 3H4BA 2PGGA 5H6QA 4NL9C 4I7ZB 1KW4A 5LOVB 4ZI7A 2ZTEA 1EBOA 4Z6CA 3UPQA 8ICJA 4LFAB 1Q3EA 3E0FA 1OHHG 2YIDA 4IS7A 4NXZA 4Z6FA 1ZQSA 3VCBA 3QEBZ 4USAA 5L3FA 2YXHA 2LKYA 4OJOA 1AI6A 4DSFA 1NNLA 4BXOA 1K5OA 5AM5A 1N56A 1SQXH 4PZOA 1QQ7A 4FFBA 4WBNB 3B9JA 1BE3H 3CWBH 1ZJNA 4DL3A 1GN4A 2EZOA 4P9PA 4LF7B 1L8OA 5K1PA 4I2HA 4JI7B 3BRCA 1L7PA 5KFEA 4UAYA 2HFEC 4O3SA 4DV3O 5JQGA 4DL4A 4Y2VA 1RYUA 4J42A 2R9AA 4MVSA 9ICPA 1XC9A 1PK1B 4LZGA 5LBQA 1BPEA 3GIMA 3BEHA 2L5YA 2UU9O 1QCEA 4Y2SA 1JCHA 1Y74B 4Q44A 2ZJAA 4DV7B 1ZQUA 1Q81W 3RBDA 2N05A 5LHIA 2MA1A 2ZIWB 5J9PC 4DV4B 1F44A 2V4DA 4C7YA 3TAQA 4C80A 2AGAA 3O0FA 3E2EA 2DN9A 5DLGA 1EM1A 1YDXA 3LDDA 5LHGA 1WPXA 5DB6A 3HW8A 5CHGA 2HCFA 1M4UA 2LP7A 4I5SA 1L1FA 2OCCB 3OD4A 2RCVA 5H5NA 4C8OA 5GW7A 2LM4A 4B08A 4LFBO 1L3VA 1R6KA 1UCVA 5CBHA 4EZ6A 1KSPA 3PW4A 4U3FH 5LYJB 4EYIB 1GN6A 5LGNA 4YXJA 1IDSA 4WF9V 1N62A 3C23A 2PFOA 4O2AB 3ZD9A 2MK3A 2P4KA 1TAMA 3JAKA 1GAXA 4KUMA 3MFIA 2R18A 1OW5A 2XAQA 2HJFC 1N33B 3RR7A 2Q7HA 2PUSA 4QPKA 1S3JA 3UXNA 2EAOA 2ITDC 3H8JA 4RUEA 3K5LA 5CBGA 5DB9A 4NXNB 2EQYA 3RYCB 3OTQA 1UPGA 2P6RA 1EZVH 1ZQWA 5K4LA 5KL1B 4MFCA 4EX6A 3I5DA 5L1LA 4FZ0A 5J0OA 4CF5A 2Y69B 1N36B 4CH3A 4X5VA 5IYBO 2ZIUA 2DWDC 4KLOA 4NLCA 2FMPA 4HBNA 1ZQYA 3UM9A 1HNXB 4DR5B 3CD6V 2UXBB 1GO3F 2KVCA 4K4HA 1WPBA 4DSLA 2JXJA 2QB1A 3QU4A 4PI0A 4RQ8A 1P49A 5J2TA 4MFAA 3BY6A 4X66B 4DV5B 5KFFA 3OTFA 8ICTA 1LV5A 2KIVA 4KN4A 5DB8A 2HOIA 1X4TA 2P22C 1KEJA 2AZ2A 4LF8B 2KNJA 3FC4A 5KLVH 4ZH4A 3IC7A 3AU2A 5KFHA 2XCAA 2P4VA 3CRRA 5LHHA 4I2AA 5DLFA 3AQEA 1FEZA 4JGSA 4NV0A 3FFQA 4YJ3A 2JGDB 3M7DA 2F93B 4DR6O 5IJ0B 1S0VA 1FYJA 2UUAB 1QR9A 1ZQMA 4LF5B 4PJ0U 3OPXA 1AB3A 9ICSA 2E74B 4DK0A 2YY6A 5F9LA 1O9GA 2ADPA 3OT7A 1QCKA 1P4RA 1FFXA 9ICRA 1GRJA 5CJ7A 5HFMA 3T1YB 3FM9A 3IC9A 5DQHA 2KKPA 1D9DA 4IL6Z 5CB4B 3P3NA 4JI1O 3MDSA 5KHHA 1QQCA 2OXOA 4N23A 4XBFA 2KHVA 5DG9A 1YHQV 2DW4A 4TV9B 3WKDA 3DC6A 3H8SA 4F72A 8ICCA 2ZE5A 5CA1A 4J03A 4UUJC 4ZOLA 2EAMA 3PSTA 2WLIA 4JWMA 1NJIW 1U4BA 2G5HB 1ZQJA 5JVDA 4GIBA 4QZ8A 3TAPA 5EYPB 1F4NA 4O4LB 1VQ4V 3L3FX 3QVNA 1NU1H 2JR5A 3ZI4A 1QTMA 2RLTA 3X2QC 2OEHA 3MDCA 1ZL8B 4Q8FA 3LSSA 1BL8A 4US8A 4FLTA 2H3IA 2ZM6O 2LPEA 3HP6A 2OHFA 4DL6A 4LNUB 3CRMA 2FJ6A 4FM0A 1O03A 2WB1F 5KFUA 3PSFA 3ZJZA 5ITZA 3WB0A 1XMQB 3KKAA 2Y0SF 3TADA 2W9BB 1BPXA 4WCEV 3HPOA 1SQGA 3L74H 2ILMA 4FLYA 3T5KA 2ZR2A 2DUYA 7ICTA 1FXVA 4JTCB 1J2NA 4O2BB 5KHIA 3JARB 1LKYA 3N7SC 5HHHA 1ZWIC 3OUSA 2Q7EA 2DWQA 3N2KB 4ECUA 1XHZA 1WB7A 3BQ0A 3NGDA 1BPZA 3Q4HA 2HBJA 4R63A 3A0HU 5JJNB 8ICBA 2MSNA 5ALJA 2CTPA 1KC8W 1K73W 3TADC 4RU9A 3MBYA 4KLHA 1NH2D 1RSOB 3DEEA 2K1EA 2ES6A 2LHTA 1SL2A 8ICRA 2CTWA 4DUYO 1S5HC 5BMVA 3MGIA 5B1NA 1LUVA 4JB3A 1RFYA 3NVVA 4M6WA 5KNIA 1U97A 2AW9A 2A1JA 1JQ0A 1ZQ1C 4O5EA 3GILA 3RYFA 1COKA 4NR1A 3RFAA 4ECVA 1JA8A 4Q45A 5ALMA 3QU5A 3CXHF 3LSUA 4C8NA 4MSWC 4IR1A 4IQUA 4K35A 4RQ1A 2R8KA 1RPRA 2W9CA 2X0LA 2UUBO 2ZE8A 1VARA 1DOQA 5J2EA 3CC4V 4ECSA 2WPDG 3CCVV 3OSNA 1NVPD 3GDXA 2E3CA 4FLUA 4LJXA 5H2FU 4B3SB 4G2KA 4GKKB 4KLEA 2AU0A 2C28A 3WK7A 2RDCA 1A76A 5CBFA 1IX9A 2HJDA 2YB4A 1B3QA 4LF9B 5E79U 4U3JB 1KD1W 1SQQH 3RYIB 1JX4A 4H44B 4DEZA 4EBCA 3W7WA 1NJYA 5DM6V 5T14A 5KG0A 3T3FA 2E76B 2PFNA 1IXMA 4WFHA 1XNRB 3UO2A 3SYCA 2XY6A 3ORYA 3GU3A 1NKEA 4KLJA 1JN3A 1CRXA 1KYOF 3CMEV 2WWWA 2E8OA 1OZ0A 4R66A 2FKXA 5D5PA 5J2BA 3H4DA 2ASLA 3PMNA 1BCCH 1Q46A 1W59A 1ZQIA 4AHCA 1ZJMA 4RQ2A 2EIJC 3RRHA 4ECYA 1HNWO 2WF7A 4ZI7B 1PL4A 1BSMA 4EBDA 2K4EA 4F4XA 3AK2A 4IR9A 4HAIA 1GTOA 5C8YB 2HDOA 1VQNV 2JEXA 3HX0A 3ZS8C 4PA7A 4DQRA 2ZQMA 4LF6O 3MGVA 1OV9A 4C7UA 3TANA 2MRLA 1UJWB 1SKVA 5L3DA 4DV0B 3OTOB 4BDPA 2LM1A 9ICJA 1Y88A 4TUPA 1YEWA 4JV5O 2AHOB 4B9TA 3E83A 2XCPA 4RNMA 4TUYA 2G07A 4JI6O 1NR1A 1A77A 2FLNA 4FBTA 1VQ7V 9ICGA 2EZPA 3PO4A 4DLGA 2ISOA 4NXMB 3N27A 1R73A 1QLEB 4C4TA 2DYSB 4DV2O 1FJGO 4AP9A 2EILB 3JAMN 1P7BA 2QA4V 2LW1A 1K1QA 1TV9A 1ZQKA 1G6UA 2BDPA 3SJCC 4O9MA 3TACB 5ALVA 3V7JA 5LP6A 1Z1VA 4NLGA 3RAQA 4K8XA 4I2CA 3OMIB 4QWAA 4JV2A 5AM0A 1PV0A 2W04A 2QSAA 3ALRA 2Q6AA 5AI5A 3AG3C 4UASA 2BR0A 2AQ0A 1VQ8V 1B0XA 1SERA 4YD1A 4A8EA 3QU9A 3SYOA 2VA8A 2WF9A 2UXCB 2KSOB 4J7JA 3WKBA 3B8MA 4PHAA 2ODGA 3VC8A 2HP8A 2ODMA 4P9OA 4A5UB 1QLNA 1X6IA 3SD7A 4FS2A 4O4IA 1KP2A 1FFUA 1L7MA 5LOVA 5LP6C 3CCRV 1D8BA 2G08A 3OEHG 7ICUA 1H2LA 5J2DA 1H8EG 2FL4A 3FB8C 3RYHB 5LMUO 2BHNA 1NK0A 2D2CB 4NLBA 1XO0A 4GX0A 1ZQQA 1BPBA 1SZPA 2CTRA 1Z5WA 2DPJA 4FE3A 2Q8VA 1Y6XA 4X65B 2OTLV 4QIWC 4JK1A 4PDVA 1XS9D 2IH3C 4UVAA 4GC7A 2YXYA 4PD4F 5J2GA 1VQMV 2PI4A 3GFKB 3KKYA 1ZQRA 4DV3B 2QKSA 4DR7B 1ZQNA 4IYIA 1RQNA 3M8AA 4F2SA 2FMLA 1OXJA 3BCCH 3CC7V 4DR2O 3RBZA 2RDIA 2ZIUB 1XNQO 1ZETA 2QWRB 2YC0A 2V4RA 3UQ2A 2IHMA 1JR9A 1PK1A 2WLLA 2ZR3A 3B09A 4G27B 1L3UA 4O3NA 1K92A 5F2VO 5KT6A 4IHJA 2XIDA 3RN4A 1Y74A 4LWSA 1W2BU 4AYBF 2CH7A 2QWNB 4X1IA 3Q8LA 3JPPA 5DBAA 2ZIWA 1XEQA 3EZ5A 3DXRA 2F3NA 3K3WA 2E5LO 2OT5A 5AM1A 4YR2A 4Y2UA 2ZIMA 2KZ3A 4X62O 5G5HA 1F5SA 1BGXT 5KT4A 1JROA 3GQCA 4LC1A 9ICUA 5B1AB 2Q4PA 3QNMA 4KLSA 2A79B 1NS1A 3M6ZA 4FPPA 3F5WC 2LGWA 5LYJA 2W6JG 2ZUCA 2JRZA 4PJ0Z 1MSWD 1QQ5A 3S3XA 3C2LA 2J6UA 1KB9F 2HBMA 8ICMA 3PV8A 1NT2B 2GH1A 2ARHA 2NO4A 4JAAA 3RFRA 2OCCC 2MUTB 3SAFA 3UXOA 5CA0A 1SQPH 4O3PA 2ZG6A 5CWRA 4Y2YA 3PR4A 4F5OA 2KVSA 1XSLA 4DSJA 4UB1A 3OJUA 4YP3A 1DGJA 2K89A 1PNLA 5CA1B 2NV3A 2JGUA 1BHBA 2IJIA 3ZN0A 1DK1A 1A32A 2JV3A 1KP3A 5JVDB 1S5JA 1XUQA 3HR0A 7ICVA 1K4DC 1SL0A 5KFOA 4UB6U 4LH6A 4J10A 1KBHA 5KX5B 5CN0A 2PFPA 1FD9A 1AP5A 2CRXA 5A9GA 1D9FA 2ADQB 2WF8A 3AUOA 2YICA 3JCZA 5ITZB 2Y69C 1X9SA 1KDHA 3FAHA 4BUGA 2DKXA 4CGZA 5LGUA 1UT5A 3FD9A 4PV1B 3TFSA 2JGDA 2PZSA 3CCSV 3C2KA 3R9KA 2ZT9B 1JPXA 5IJ0A 1KQSU 1SZTA 1X6JA 4UB5A 3CYMA 2IJKA 4OX9B 3M9MB 3PX4A 2R8HA 4UAUA 1BNOA 5AIBA 4X1KA 5JH7B 3J80N 3ZD8A 4LBEC 1S0MA 4X64B 4D7TA 2XI9A 1YTFB 2PY5A 3WK8A 1ZQGA 3PZPA 3Q4HB 3D8CA 3A0HZ 4J7ZA 2ZIXB 4P4PA 3H1LH 5JUMA 4B9VA 4B9UA 4ZOHC 1WCNA 1Y76A 2RQ6A 5DQGA 1HR0O 2DYRC 5JCOA 2EJRA 3JPSA 1T3NA 1VF6A 1XBLA 2GUZB 3AG1C 5KFSA 7ICPA 3SGIA 4M6WB 3RJGA 4MTOA 3C28A 2HVHA 1T5EA 1DGSA 3JALB 3P3PA 3S6JA 1YSCA 2VJ4A 1GKFA 5IWAB 3SEIA 4DL7A 1NK9A 1L8DA 4TT3G 2KG5A 2LYBA 1X2IA 5EYPA 3N2GB 4KHPO 1AR5A 2AH5A 1ENVA 2BKEA 4O4LA 4X1YB 4J9ZB 3H0LB 5AKXA 2W9CB 1ZQEA 3N7PD 2ZM6B 3T1HO 2DQNB 1R3LC 5J0XA 2XHBA 4QZGA 1H2SB 4GX5A 2NYVA 3Q8QB 5JCOC 4LNUA 1VF6C 2DBYA 1KECA 3H1HH 2QKQA 2Q69A 4YMMA 2LBOA 4I2GA 2ZE6A 1WG8A 2ASDA 5H2FZ 5IY5B 1XMOO 4IQVA 1IXBA 1VMGA 1TKDA 1MQ2A 7ICKA 5E79Z 2AXTU 5ALWA 2IBKA 3LDCA 4GX2A 2BOBC 2KG7B 3JARA 3PW0A 4RQEA 4EELA 2DE0X 1AI5A 2XY5A 3E8HA 4DQPA 3L75H 4QNLA 3N2KA 1K5SA 5EZYB 3KZIU 4WFAV 3CRAA 5IE9A 3QU7A 1S77D 4PDLA 2WA4A 2KMDA 2YIBD 4UW9A 2EBOA 1KN5A 4Y2QA 4OCZA 1R6NA 2EDUA 4DUYB 1SQBH 3APQA 4PPXA 1RSOA 1OCRB 3ZIAG 3KBBA 3PSPA 4QE7A 5AI8A 1NK5A 2BQRA 3RJKA 2HEPA 4GUNA 4KXRA 5AM4A 5IYZA 4YY3B 2HBLA 2WLKA 1WP7A 4F92B 3KCYA 1MNGA 2P90A 1COWG 4DR1O 2VJ5A 2NLJC 4R6ZA 2KJ9A 5CMUA 1MSDA 1GH6A 2F4VO 4M9LA 3HKZC 3SYZA 1QH9A 2K8CB 2B9ZA 4UVCA 2UUBB 1AP6A 4AI8A 1R3IC 1H2GA 2MW2B 3PR5B 2QB0B 4M2YA 1TE2A 4M9NA 2ZNIA 4Q20A 4QIWF 4YMNA 3G6XA 1I7FA 3OFNG 1M1KW 4YIPA 4DSIA 3RH5A 5EE1A 4JYAO 3MFHA 4OPAA 1T4GA 2W8LA 2GDSA 4I9WA 2QEXV 1QVFU 3F2BA 4QZDA 1RPLA 3N4MB 2YTUA 4KITB 2RRDA 1Y4MA 5BY1A 1IBKO 2QM4A 1W0JG 1RG6A 4DQIA 4MS2A 1IBLB 1MA1A 2E3TA 3PMLA 4U3JA 4DOAA 4QWEA 3M9NB 2X7RB 3RYIA 4FZLA 2IOFK 4XDJA 1WWVA 3JD2A 2F77X 4RNOA 2HHHB 2C2EA 3CNHA 5DB7A 1ZQBA 4WJ3B 5LMNO 3CXCU 1IXRA 3K08A 4ICAA 2P67A 4JPRA 4DL5A 2F8LA 4Z6EA 2MU2A 2VANA 3QO7A 2BTOA 4O4IB 4Z6DA 4PA4A 2NN4A 8ICOA 3ZCCA 3EPGA 2XAFA 2IU0A 1TAQA 2FDRA 3KCXA 3IG5A 1Q6UA 3LNNA 2JMGA 3ZDCA 2P6JA 4F8RA 3D6JA 5C8YA 3SV3A 2VQFO 5KFQA 4O4HA 5BZBA 9ICNA 3PN1A 4B3MO 1Z2GA 1V55B 1XL6A 3MC1A 2GTAA 3OR6C 3EW9A 3MD0A 4DXWA 4K0KO 2AJQA 3BHPA 1BS3A 1MN8A 2JH7A 5KFLA 3KD3A 5GTHU 3ETEA 3NRWA 4FM2A 2KICA 1U9LA 2QLTA 1NZ6A 1FJGB 4DV2B 5KG1A 2IHNA 3S3WA 4W4LA 4F71A 5ALQA 4J9PA 1Q5OA 5LGTA 3RJJA 2Y9TA 4JI4O 2FPMA 4XQ8A 5KFWA 3ZRWB 2WLLB 3TXQA 2P7TC 4JTAB 1F7YA 2JEUA 4E0DA 4IHJB 4QZBA 3OSPA 4LWSB 3JSLA 3EHBB 4X1IB 2CH7B 2CDYA 5K1XA 4LF4B 1ZQOA 4KLLA 2R9RB 5A2QN 3DXRB 3OMAB 4J11A 1N34O 1RM1C 5JJEB 1HNZO 9ICWA 4DCCA 1UQVA 2ZUDA 3GIJA 4GLXA 4DQQA 1FFTB 1PKXA 4DS5A 2VWJA 1IM4A 2YMQA 1ZQFA 2Q4TA 3HKEB 4Q6GA 3ZRVA 2F66C 4BWJA 3V7LA 1QLEC 2DYSC 2KSOA 4J41A 4L87A 1PD3A 1KKDA 3UMGA 2C22A 2EILC 2WHEA 4BWMA 4JAUA 4E4EA 1ZQAA 4B7EA 4RUAA 2DOSA 5IYCO 4P30A 2UXDO 4UATA 5AK6A 5J2KA 3OHBA 3U0ZA 5LMUB 1NJXA 4J7KA 3T4ZA 4RQFA 1QVGU 2W55A 2RJZA 3ISDA 3H9VA 3RYHA 3D2SA 4FS1A 2J6SA 1EN6A 3LDEA 2OIGA 1C20A 3OHAA 1KQQA 3C3SA 2IH1C 1WUDA 1F23A 1MG1A 2JS5A 4J9MA 2B0CA 4MEYA 5EC2C 2DFLA 3RB3A 5CA0B 1SA0A 3ASOB 3BQ7A 1M6YA 5CEHA 7ICFA 3BS7A 4G3IA 4DR2B 4UBCA 3WU2Z 1X66A 5ALUA 1QBZA 4I28A 3ETRA 3SPIA 1XNQB 1S5LU 2DKZA 4DR3O 7ICQA 1XSNA 5DDMA 1J95A 1SRYA 5HHIA 2EX3A 4GZRB 1VQ9V 4UB6Z 2E8MA 1AVMA 2K8BB 1ZD5A 2IA6A 3L73H 4F6RA 2CXYA 4OPHA 1Z4OA 4ELUA 4TV8A 3FYIB 4XRHA 5KTQA 4DS4A 2V1DA 3B40A 1QR8A 2OM6A 1KLNA 5KFZA 3Q8PB 2YS8A 4JZ2A 3NR7A 2UUCO 3F2CA 1DF5A 5LXTB 4JI8B 2DYRB 4QZCA 1KU9A 4I2EA 1HW7A 4ECXA 4YVZA 2BOCC 3AG1B 1B22A 3F7YC 3FB6C 4CNQA 2GSMB 3HKCA 2ZXIA 1AR4A 2A9HA 2FB5A 3JD0A 1PVPA 2A0LA 4K8ZA 1KL9A 1AI7A 2VWKA 4X1KB 5EWEA 2KKWA 2NRZA 2Y0IA 2YQEA 4Z1MG 4PHPA 1CPYA 3E86A 1N61A 4MEXA 3ZRXA 3KG2A 1S72V 1VQOV 2B6GA 2QM8A 4OJ6A 4EKWA 1Y76B 5IIJA 2MUTA 3F5AA 5B1AC 2BE3A 3BZKA 1N48A 3E22B 3ICXA 4RPXA 4UB2A 5J0TA 4RQ4A 2Q67A 4Y2TA 2CTQA 5IIKA 1VQKV 1BPYA 1BZKA 4CH5A 2R70A 1SV0A 1WNSA 1BMFG 1HUOA 5ALZA 1GMGA 4YXMA 4P2HA 4U7CA 1Q8KA 4FFDA 3JYCA 2Z0AA 5KAFU 3QX7A 1XILA 1FPOA 1M93A 5KFDA 2JJ2G 1Z00B 5AKJA 5F9NA 5IDJA 5KX5A 7ICHA 8ICNA 2RN9A 1YZ6A 1QHTA 2W3RA 4JI2O 1XO1A 3B77A 3HKZF 4CH4A 2B21A 3C21A 2WLNA 3BA8A 3BJYA 3QO8A 5ALPA 3FB5C 5KFTA 1YF2A 2YMLA 2CAZC 4M47A 2KB1A 3ABKC 1DRGA 1ECWA 1I08A 3DGEA 4R8CA 3UQ8A 2IMWP 2AXTZ 1O9HA 2HKOA 3ZBHA 2XAGA 3D3IA 2G5IB 4AILC 1S9FA 3WK4A 3DV9A 5AKGA 1UPHA 4RNNA 1NZBA 1Q3UA 1Q3VA 2BPGA 5JH7A 3KZIZ 9ICTA 4XDKA 3KHGA 2FMQA 1JOYA 3QUTA 2LGQA 4XA5A 3SZ2A 3MDAA 2ZIXA 4DV1O 1EZJA 3AG7A 3RB4A 5ALYA 5EBWC 3KKAC 4MTGA 4ED2A 3ZMUA 2LFRA 4ED3A 4JF3A 4P4MA 4DOCA 2IW5A 4DV6O 5D49A 3E8BA 3SENA 4DUZB 3JPQA 3M6KA 4M9GA 3JD4A 5H6RA 4FZMA 2GUZA 5IYZB 4AQYO 2KV2A 2AGQA 7ICEA 1TK0A 1GM8A 1XHXA 4FZNA 1SIJA 3Q8SB 5ALHA 1BVSA 2ALZA 3CCQV 1AR1B 4PHZA 2WAMA 2XAJA 2VQEO 3JALA 1JALA 5GONA 1S97A 9ICLA 1M56B 9ICHA 3H8MA 4G9BA 5AK4A 2BCUA 1E79G 3ZX6A 1H2MA 2WAQC 3N2GA 3ZDBA 4X9QA 4X1YA 1NTMH 3V6HA 5CRXA 1J5EB 1NI3A 2JHDA 1GN2A 1UFIA 3E89A 4LCUC 2I1QA 3VQVA 3AEVA 5AI9A 5L3BA 1I94O 1K8AW 2NNUA 1BGYH 3SPJA 3G6VA 5KG3A 4UQGA 1VF5B 3BDPA 8ICLA 4F4LA 3G4SV 1L0NH 4FM1A 3CCLV 2PXIA 1VDVA 3ZHTA 5CA7A 4RZRA 2KG7A 5KHGA 2LI6A 5FL7G 2IJJA 1SXEA 8ICKA 3AK3A 3IP4B 4B6JA 2YI8A 3P30A 4PDMA 1D8YA 5LL6Y 5EZYA 3OEEG 5HR6A 2RDJA 2VS0A 1YJWV 5IIOA 4MF2A 1JJ2U 4KFMA 4X88A 2HBKA 4CF3A 1RYRA 5EE3A 1IBMO 5IY5C 1ZTEA 5J2AA 4ECTA 3H0RB 1ZD3A 1X9MA 2ZJ8A 5EBLC 4HYKA 2BQUA 4B9LA 4JZGA 4UXNA 1U47A 5KHJA 3RW0A 4O4HB 5KT3A 4DR1B 3IG8A 1U48A 2G38A 2G06A 4R65A 1B04A 2DL0A 3EPIA 1SXDA 5BR8O 4WFBV 4UAZA 3UT5B 3IN5A 3ZDAA 2WLHA 1PPJH 1RM1B 5GTHZ 5KG4A 1AI4A 2HSZA 1DK3A 3MR3A 2F76X 3ZHUA 1KFDA 1V54B 5B1BB 2M6YA 4JYBA 4DFPA 4J9YB 2QB0A 3PVXA 2K4IA 2W03A 1MOFA 4EZ9A 1OCRC 4I0XA 2ESEA 4P4OA 5AKZA 3K0DA 2OYQA 4PHEA 2JH1A 1AQ6A 4FK5C 4JI0B 3AQFA 2Q7GA 3WG7C 3VQWA 2ZIVA 2WSSG 1KFTA 4ZBMA 1VJ5A 2W54A 1H2KA 3ZN1A 2EZYA 1VP7A 4QE9A 1UHUA 4C8LA 2RNBA 2Y0PA 4OGQB 5IIMA 1URFA 3SYQA 5LMNB 4YN4A 2R72A 4Q43A 1OJHA 1U49A 4YCXA 1JFFB 2ZNJA 4GCZA 1WYGA 3T5JA 1I5YA 3VQYA 1J97A 3H0MB 1DXSA 4TURA 2YN4A 3IRUA 1OCCB 3CCJV 3PW2A 3SJQC 3SPGA 3CEIA 4YIOA 3BQ1A 3MR2A 3CCEV 2F1MA 2NRXA 4DFMA 4GFJA 1AJNA 3JATB 2EJ7A 2Q5ZA 4QZIA 1DK2A 2VQFB 5ALEA 5AIAA 2VKQA 4J9LA 1XI1A 1ED1A 3BFRA 3T2MA 1EN4A 2NRTA 5L1KA 4I2FA 4EEQA 2QWOB 2OIEA 4NWIA 4JASA 3LWLA 2IOHA 1E1QG 2XUMA 5A0LA 3SPHA 5TISU 2W7OA 1LVHA 2EIKB 5EBMC 3ML0A 3EVKA 2NO5A
chains in the Genus database with same CATH topology
1K97A 4J9ZB 3H0LB 3FKSG 3ZRSA 2MA1A 2ZIWB 3N7PD 4ZKIA 1F44A 5J9PC 5LHIA 2DQNB 1R3LC 3O0FA 2JIZG 3E2EA 4ASUG 4GX5A 3LDDA 4PA9A 1WPXA 3JD3A 5LHGA 1KECA 2LP7A 2Q69A 4I5SA 1L1FA 2OCCB 1Q82W 1E1RG 2LBOA 2RP5A 2XASA 2W0FC 3E8FA 5GW7A 3NUQA 3TK1A 3ZMTA 3ZMZA 5IY5B 3ZRWA 2R9IA 1R6KA 1OCZB 1V55C 5CBHA 3SQIA 1K9MW 4MTXA 3LDCA 3MHSC 4GX2A 2BOBC 4RQEA 4KX5A 5LGNA 4WF9V 3G6EV 1AI5A 2WLJA 3E8HA 2MK3A 4QNLA 1TAMA 4KUMA 4R50A 1XNSA 1K5SA 2DF4B 2R18A 2XAQA 4BX9C 2HJFC 4BJQA 4WFAV 1MABG 3CRXA 3ABMB 3M99B 4MVMA 4QPKA 3W7XA 1S3JA 1S77D 2W7PA 4PDLA 2ITDC 2X6AA 3ASNC 1YTFD 2X6BA 4RUEA 2EBOA 5CBGA 5L3GA 3W7SA 1CP9A 1OCOC 1R3KC 1R6NA 4KP4A 5EK0A 2HG5C 5KL1B 3K04A 1FXKB 4OO1J 1OCRB 3ZIAG 1GK9A 3PSPA 4QE7A 2Y69B 3FB7C 2HBLA 3QNEA 2WLKA 5IYBO 4BIZA 2ZIUA 2P90A 2DWDC 3E8GA 1COWG 3IGAC 3OAAG 2KIWA 4NLCA 5B1OA 3STZC 2VJ5A 2KJ5A 2NLJC 4R6ZA 2KJ9A 5CMUA 1HIWA 1GO3F 3T1CA 3CD6V 2KVCA 2PI5A 3HKZC 2K8CB 3OW2U 1JX9A 4UVCA 3K79A 4OXSA 2E1EA 3BY6A 1R3IC 1H2GA 3F7VC 4FJCC 4U7NA 4PA3A 5L3EA 4WFEA 2HOIA 2G0AA 4Q20A 2KNJA 4QIWF 3ABKB 3OFNG 1M1KW 4U7OA 5CA3A 5KA6A 3IC7A 3LVVA 5LHHA 4I9WA 3AQEA 1MA7A 2JDIG 2GOLA 2IU3A 4JGSA 3ETGA 2QEXV 1QVFU 3F2BA 4NV0A 1DLBA 2RRDA 1Y4MA 3M7DA 1W0JG 4MS2A 2Y48A 3OMNB 2ZXWB 4N21A 2E1FA 3OR7C 2G09A 3OUFA 1H8HG 1PL0A 1S0VA 2X7RB 3H01A 4H33A 4FZLA 4XDJA 1QR9A 3JD2A 2F77X 1F4MA 1WLEA 3ASOC 3OPXA 4UVBA 2EIMC 4QJFB 2H94A 2A3VA 1P4RA 4WJ3B 3CXCU 2H3ZA 4ICAA 2P67A 3K08A 4JPRA 4OJLA 2F8LA 2QM7A 1DTOA 5HFMA 2CN1A 2KKPA 3QO7A 1NH2B 4PA4A 2DWEC 1H38A 3ZCCA 2OXOA 4N23A 2XAFA 2IU0A 2KHVA 4XBFA 1YJ9V 1YHQV 2DW4A 4MVZA 3IG5A 2XOKG 3OGCC 2JMGA 2P6JA 3AG4C 2ITCC 5BZBA 1VQ5V 4P0QA 1NBMG 4UUJC 1V55B 1XL6A 1AJQA 4BIUA 3OR6C 4DXWA 3MD0A 5L3CA 3PSTA 2WLIA 1S72V 1NJIW 2JK5C 2G5HB 4HYOA 1Y66A 4O3MA 1F4NA 2HLDG 2CPRA 3L3FX 1VQ4V 2JH7A 1Q7YW 3ETEA 3X2QC 3NRWA 2HMXA 2KICA 4X8AA 1NQTA 1YITV 3LSSA 1BL8A 2H3IA 2B5UA 2K4HA 4OJPA 1HEKA 3LSQA 2DQ3A 3AL0B 4PA6A 3ASNB 5LGTA 1NVPB 5KUMA 2WB1F 2IJHA 1OCOB 3PSFA 3ZJZA 3K0GA 4RAIA 2WLLB 3ZRWB 2ZXHA 2Y0SF 1DF4A 2JEUA 2P7TC 4JTAB 4MW8A 4WCEV 4UV8A 2CK3G 3CP8A 1THZA 3EHBB 3NXSA 4PELA 2WLMA 2ZR2A 1FXVA 2R9RB 4JTCB 3OMAB 3K1ZA 3N7SC 1NR7A 1RPOA 1ZWIC 3OUSA 1RM1C 1PKXA 1FFTB 5EC1C 4FMTA 4KX3A 2Q4TA 4C0ZA 3ABLB 2YEVA 3ZRVA 5B3SC 3TCUA 1QLEC 4L87A 2K8AA 2KEYA 2HBJA 1R3JC 1PD3A 2DYSC 4JAUA 2EILC 1KKDA 3ZMSA 2UXNA 3ABTA 1KC8W 1K73W 2PMZC 5IYCO 4P30A 4P0PB 1NH2D 3DEEA 2FTKA 2K1EA 2LHTA 1TUEB 2OH2A 3T4ZA 1S5HC 5B1NA 4RQFA 1QVGU 2LYAA 3D2SA 3F53A 3OE7G 1JQ0A 1ZQ1C 1SERA 3LDEA 5E1AC 2XNDG 3RFAA 2IH1C 1WUDA 1F23A 2EINC 1L6NA 2KKVA 1MG1A 2BDUA 4HZ3A 5EC2C 1A6SA 4MSWC 4RUFA 4ACOA 3ASOB 2DQ0A 1RPRA 2X0LA 3ZMVA 1QBZA 1K5QA 3SPIA 1M57C 3CC4V 4JMUA 2JJ1G 3WG7B 3SYAA 2WPDG 3CCVV 1NVPD 2N1RA 1J95A 4PL2A 1SRYA 3CCUV 1VQPV 4TSFG 4G2KA 1VQ9V 1VQ6V 3D2QA 5CBFA 3W7UA 1GM7A 2YB4A 2K8BB 1YI2V 1KD1W 3AG4B 3W7WA 1CEZA 5DM6V 5T14A 3T4DA 1IXMA 3FYIB 5HFLA 2F2AB 4WFHA 3SYCA 2V1DA 3GU3A 3LYSA 3CMEV 4U6PA 1CRXA 2OM6A 1LNQA 1QR8A 2WWWA 2UXXA 3SAGA 1OZ0A 2KOBA 4MT8A 3F2CA 1DF5A 2ZIVB 2DYRB 2Q68A 2EIJC 3X2QB 3GZFA 1M9NA 3AG1B 2BOCC 3F7YC 3FB6C 3IFXA 4QNHB 1M56C 3LNMB 2GSMB 2H3QA 3TETA 2Y0SC 1PVQA 2K4EA 2ZXIA 2A9HA 3JD0A 1PVPA 2A0LA 3K03A 1GTOA 3KFUF 1AI7A 3GWOA 3RF9A 3K06A 2YX8A 1VQNV 2JEXA 3T79A 3QO5A 4PA7A 4G28B 2ZQMA 3MGVA 4Z1MG 1G4YB 1CPYA 3E86A 3CP1A 2WAQF 4P2ZA 4PL1A 2MRLA 3KG2A 3AG2B 4MVRA 1HWYA 3VOUA 3ZRXA 2QM8A 2WLIB 4OJ6A 3MHHC 5L3DA 4CZZA 1UJWB 4EKWA 4WFFA 3F5AA 5KA5A 5B1AC 2HVJC 4BAYA 4MVOA 2ZDIA 3E83A 3ICXA 2G07A 2XICA 1NR1A 2Q67A 1VQ7V 2EZPA 3B8NA 2B1IA 1ROPA 1VQKV 1R73A 2C2AA 1QLEB 5B3SB 2DYSB 2AHZA 3CMAV 2D3OW 4QPJA 2EILB 2QA4V 1P7BA 3LUTB 1BMFG 1SESA 3GB7C 1GMGA 3CCMV 1YJNV 1PNKA 4HAMA 2YSUB 4U7CA 3JYCA 3UM7A 3R65A 3OMIB 3I56V 3JD1A 2W04A 2JJ2G 1Q86W 2H3VA 3ALRA 5IDJA 2ZDIC 2Q6AA 3AG3C 1YT3A 1NKDA 1VQ8V 2GHYA 2H8PC 3HKZF 3B77A 3SYPA 5C93A 4LP8A 4A8EA 2WLNA 3QO8A 2ZD9A 2XAHA 3SYOA 2YEVB 3FB5C 3E35A 2QE7G 2KB1A 3ABKC 1DRGA 1ECWA 4OJ5A 3B8MA 3VC8A 3DGEA 4P9OA 4R8CA 1S76D 1FS0G 3CYOA 1QLNA 1W0KG 2HKOA 2XAGA 2AHYA 3D3IA 2G5IB 1KP2A 1VQOV 1M57B 3CCRV 1D8BA 2G08A 1UPHA 2D6FC 2M7WA 3OEHG 1NZBA 1Q3UA 1Q3VA 1H8EG 1V54C 3FB8C 3HPLC 5B1BC 4XDKA 1T94A 1JOYA 5DN6G 4NLBA 1XO0A 4KMOB 4GX0A 2OTLV 4FE3A 2HOQA 5IYDO 4QIWC 2ZIXA 4PDVA 1EZJA 4MVQA 5EBWC 2DGZA 2IH3C 5C0YA 4MTGA 4UVAA 3ZMUA 4CRXA 2LFRA 4JF3A 3AEIA 2IW5A 4PDRA 1SETA 3K9AA 1VQMV 2LFSA 3E8BA 2PI4A 2QKSA 1YIJV 3SPCA 3M6KA 3ETDA 2ATKC 3JD4A 4H37A 5HR7A 2HOFA 2XVTA 4FZMA 3FYEB 5H6RA 2KV2A 1GM8A 3RBZA 3CC7V 2ZIUB 4FZNA 3PJSK 4BW5A 3CCQV 2EIJB 1AR1B 2WAMA 3C29A 2XAJA 2OYYA 1Z19A 3CPWU 3A0RA 1M56B 2WLLA 2ZR3A 1I5XA 4G27B 1E79G 1F51A 1K92A 3VBBA 1P7DA 2XIDA 4GX1A 1W2BU 2WAQC 4AYBF 1OCCC 2HR3A 4MTFA 2VIXA 2EIMB 2ZIWA 5CRXA 3K3WA 1FXHA 2JHDA 1G8MA 1K33A 2OT5A 3ONNA 2F43G 3E89A 4LCUC 3CC2V 4RO2A 4XDLA 5L3BA 3F2DA 1K8AW 4GT1A 2NNUA 2YB1A 4LC1A 3SPJA 5B1AB 2A79B 4MVUA 1Z1BA 4F4LA 1PNMA 3G4SV 3M6ZA 1GM9A 4FPPA 3F5WC 3WFVA 3CCLV 3SMVA 4P0PA 2EIKC 1JVMA 2W6JG 5FL7G 2IJJA 5H9CA 4IC9A 1MSWD 3IP4B 3P30A 4PDMA 4JTDB 3OM3B 2HBMA 3OEEG 5HR6A 1SZHA 1YJWV 3N7RC 2GH1A 1M90W 2X6CA 1JJ2U 4KFMA 4X88A 2HBKA 3I55V 2OCCC 4FIPC 1K7DA 2KD1A 2WB1C 3SAFA 4X89A 3ABLC 5IY5C 3H0RB 1EFRG 5EBLC 3AG3B 1OCZC 2ZG6A 1FXKA 1A0PA 2RHFA 4MW3A 4UXNA 2Z5UA 3G71V 5KUKA 1ORQC 3RW0A 2QTOA 4JAVA 2K89A 2JGAA 1PNLA 4CDGA 2NV3A 3IG8A 4P0QB 2OTJV 1BHBA 2IJIA 2G06A 3D36A 3ZN0A 3LVWA 2PMZF 1B6QA 3D2NA 3ABUA 3P32A 3EFFK 4WFBV 1KP3A 1K34A 3IN5A 3ABMC 2WLHA 3W7TA 1N8RW 1K4DC 1RM1B 4WFGA 1AI4A 3DTUB 5KL8B 4JYCA 2KJ8A 2F76X 1XL4A 1PVRA 1V54B 5B1BB 4JYBA 4J9YB 2E5SA 2B1GA 4TWKA 5CN0A 2CRXA 2V7QG 2K4IA 2W03A 1MOFA 1K4CC 3F5EA 1FXKC 2H3FA 3HB3B 1OCRC 2M0NA 4YXWG 3RVYA 3JCZA 2Y69C 3K0DA 1OUQA 4BUGA 1KBUA 2JH1A 4CGZA 5LGUA 4R7CA 4FK5C 3AQFA 3WG7C 3KZXA 2W6IG 4UV9A 2ZIVA 1AJPA 2WSSG 3UKMA 4ZBMA 5H6QA 3ZN1A 4QE9A 3CCSV 1JPXA 1KQSU 1SZTA 1EBOA 3CYMA 1K3EA 3E0FA 2IJKA 3SYQA 1OHHG 4AYBC 4GCZA 1VQLV 4DO2A 3VCBA 5L3FA 2EINB 4LBEC 2LKYA 4OJOA 1AI6A 1BHAA 2XI9A 1AROP 1I5YA 4E2LA 1YTFB 3PSIA 3H0MB 3PZPA 2HVKC 1URJA 2ZIXB 1OCCB 3CCJV 1IIPA 3SJQC 3SPGA 2Z7JA 3CCEV 4P9PA 2EZOA 4CBCA 3SAHA 3RVZA 1AJNA 4GFJA 2DYRC 2EJRA 2HFEC 2ZXWC 3AG1C 2VKQA 4MTOA 1ED1A 3C28A 3T2MA 3STLC 2KHQA 4NWIA 1YSCA 2VJ4A 1GKFA 1E1QG 4JASA 2Z3YA 5A0LA 4MVSA 4TT3G 5LBQA 3SPHA 3BEHA 2LYBA 2W7OA 1QCEA 1JCHA 2EIKB 1Q81W 5EBMC 3ML0A 1ENVA 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAF A;  2MA1 A;  2KV2 A;  4QJF B;  2E1E A;  2RHF A;  3SAH A;  4O3M A;  4CGZ A;  1D8B A;  2CPR A;  1WUD A;  4CDG A;  4QIW F;  4OO1 J;  4NLB A;  2HBJ A;  3SAG A;  1YT3 A;  3CYM A;  2HBM A;  2HBL A;  2DGZ A;  2RRD A;  5C0Y A;  4NLC A;  2E1F A;  2HBK A;  1GO3 F; 
#chains in the Genus database with same CATH topology
 1ZAU A;  4IQW A;  5AI4 A;  1TAE A;  2JIZ G;  3E58 A;  1S5L Z;  2RMK B;  1KKX A;  4ASU G;  4JI5 O;  4DFJ A;  4JI4 B;  4DLE A;  3JD3 A;  1C7Y A;  1TA8 A;  3PW7 A;  1E1R G;  1S0N A;  4EFB A;  3E8F A;  1Q82 W;  2XT9 A;  2UU9 B;  4H13 B;  3RTV A;  1PM9 A;  2LQT A;  5EIB D;  3ZRW A;  2R9I A;  3FX7 A;  1XOU A;  1V55 C;  1OCZ B;  1IVS A;  2OCH A;  4I55 A;  1K9M W;  4MTX A;  3C1Z A;  2EUL A;  1N34 B;  4F6R B;  3MHS C;  5KMG B;  4TQS A;  3AMZ A;  2WFA A;  4KX5 A;  4TV8 B;  4DW1 A;  4RQ7 A;  1SWV A;  1VEW A;  1RXW A;  3L9D A;  3VQX A;  4LFB B;  3ZHR A;  4BX9 C;  4BJQ A;  5IIL A;  4LH7 A;  1N36 O;  3W7X A;  5B66 U;  3K4G A;  3HKE A;  5J0W A;  1WAZ A;  5DBB A;  1L7O A;  2X6B A;  5L3G A;  3GII A;  2YMM A;  1RYS A;  4Q8E A;  2UXD B;  1US6 A;  5ALI A;  1Q6I A;  4DR5 O;  4US9 A;  2KZM A;  1HNX O;  3H40 A;  2N74 A;  3HKC B;  5EK0 A;  3K04 A;  1FXK B;  4OO1 J;  2I6X A;  4IQT A;  3FB7 C;  3TXS A;  1Q8I A;  4X66 O;  1O08 A;  5KFN A;  1X59 A;  1UA0 A;  3E8G A;  3IGA C;  5B1O A;  3CPW U;  1ZUQ A;  8ICI A;  2KIW A;  4DRX B;  3STZ C;  3QZ8 A;  3T1C A;  2KJ5 A;  8ICU A;  1QSS A;  3WKE A;  5ALL A;  4JUZ A;  2XY7 A;  4CC6 A;  4C4S A;  1JX9 A;  8ICG A;  1NZP A;  3UMC A;  4KLM A;  5AI0 A;  4L8J A;  1EXN A;  4F4K A;  4FJC C;  3UXP A;  2ZJ5 A;  2D8C A;  5L3E A;  4O4J B;  4DR3 B;  4FFK A;  3RJE A;  9ICV A;  4YMO A;  1KFS A;  1SZX A;  1HJP A;  5KFB A;  1NJW A;  3ABK B;  2GO7 A;  5BPC A;  1L5U A;  5CA3 A;  3ISC A;  3KHR A;  4GXJ A;  5KA6 A;  2Q9L A;  4PH5 A;  3LVV A;  4LF5 O;  4KLF A;  4DOB A;  2GOL A;  2F1H A;  1PZN A;  3ETG A;  2JZB A;  5KAF Z;  4YHH O;  3DDH A;  2ZXW B;  4UB8 U;  2E1F A;  3ETL A;  3C5F A;  2G09 A;  2QR4 A;  3H01 A;  5JJJ B;  4I9Q A;  5J0Q A;  5ALK A;  3ASO C;  5J0U A;  1WLE A;  4UVB A;  1S8O A;  2LYH A;  3IJ4 A;  2W0X A;  2V4Q A;  2A19 A;  2ZKO A;  4Y2P A;  1JMS A;  2H3Z A;  5F3X B;  4OJL A;  3ZDE A;  2QM7 A;  3H1J H;  1DTO A;  4DR6 B;  2CN1 A;  1ZQX A;  5LXT A;  3CE2 A;  1NH2 B;  4UB3 A;  1H38 A;  2DWE C;  4O0I A;  1MMM A;  1YJ9 V;  3HKD B;  4KLU A;  5DG8 A;  1ZQH A;  1N32 O;  3N28 A;  3WK5 A;  2CGO A;  3KOO A;  2XOK G;  2K60 A;  3QXG A;  2NR5 A;  5AKK A;  3OGC C;  3K5O A;  3A2F A;  2K9P A;  1VQ5 V;  1ZQP A;  1NBM G;  3GV5 B;  2Q0A A;  1TVK B;  3CHX A;  4F93 B;  4JI1 B;  1D8L A;  1VIB A;  2QKC A;  3RWR D;  5DBC A;  3N97 B;  3JCU Z;  5GTI U;  3LK9 A;  2CPR A;  3C1Y A;  2BCR A;  8ICZ A;  2HLD G;  5JTI A;  3E22 A;  1Q7Y W;  7ICR A;  4ECZ A;  2HMX A;  4X8A A;  4K4I A;  3M8S A;  4IGG A;  5FP0 A;  2K4H A;  5BOL A;  3JAW B;  5G5G A;  1HEK A;  2OWO A;  2DQ3 A;  2H3O A;  3LSQ A;  3ASN B;  4PA6 A;  5JU5 A;  1NVP B;  5KUM A;  2IJH A;  2IOF A;  5D4B A;  1OCO B;  5GON B;  3K0G A;  4RAI A;  4QWB A;  2ZXH A;  3QUB A;  2V9W A;  1YCI A;  4I4T B;  3CP8 A;  3U11 A;  1THZ A;  4BGD A;  3NXS A;  2NRV A;  3BQT A;  1ZRN A;  5HP4 A;  5AIC A;  5KFJ A;  5L9X A;  3CSX A;  1Z00 A;  5AHX A;  5AM2 A;  3JAS B;  4RPY A;  4TQR A;  4J80 A;  9ICK A;  5EC1 C;  8ICQ A;  4FMT A;  3THV A;  2HHX A;  2R8G A;  4KX3 A;  4ED1 A;  3A8T A;  1SWW A;  3PNC A;  1B4F A;  4C0Z A;  3Q8M A;  4CF4 A;  3AM9 A;  3QZ7 A;  2YIB A;  3Q8K A;  3ZMS A;  3ABT A;  3CX5 F;  3J81 j;  7ICG A;  3C2M A;  5KT5 A;  1V38 A;  2IM9 A;  3OGI B;  3RJI A;  2FTK A;  1TUE B;  1K1S A;  2OH2 A;  2KSD A;  2LYA A;  3CS5 A;  4RQ3 A;  5KG6 A;  3MGH A;  2P5O A;  4F3O A;  4DV1 B;  3DC5 A;  3FDS A;  1UA1 A;  2VA2 A;  3QUQ A;  2QTS A;  4YR0 A;  2EIN C;  4JV1 A;  2KKV A;  2BDU A;  4F5P A;  3T5L A;  5EOZ A;  4HZ3 A;  1A6S A;  1JUD A;  3M1Y A;  5IIN A;  4RUF A;  1LB2 B;  3RB0 A;  2DQ0 A;  4GKK O;  1UT8 A;  5KFR A;  2BCV A;  3TFR A;  3ZMV A;  2FLL A;  1K5Q A;  3C3T A;  3K5M A;  7ICN A;  5KFI A;  3WG7 B;  4KL1 A;  1SB3 C;  1PUZ A;  2N1R A;  2KP7 A;  4PL2 A;  4EB6 B;  1L8L A;  3CCU V;  1JJO A;  1VLB A;  2DPI A;  1VQP V;  4TSF G;  4IYH A;  2ZIN A;  1VQ6 V;  1CXZ B;  4FLX A;  1YI2 V;  1X9X A;  4KLG A;  3AG4 B;  1CEZ A;  1RDF A;  2MAX A;  4I2D A;  2PTM A;  3T4D A;  5HFL A;  3JPT A;  1TK8 A;  4I0X B;  3O65 A;  5HMM A;  4K3A A;  3LYS A;  3TKA A;  4U6P A;  1SV4 A;  1Q6H A;  3SAG A;  1B06 A;  2KOB A;  2K4P A;  4H0L B;  4MT8 A;  5J0R A;  2HHV A;  1XWL A;  2ZIV B;  2Q68 A;  1MZF A;  3GZF A;  1M9N A;  3RR8 A;  2JVD A;  4RUC A;  1M56 C;  3LNM B;  1XSP A;  2Y0S C;  1PVQ A;  3U10 A;  2JEI A;  5J2I A;  3K03 A;  3WB2 A;  1JRP A;  2UVU A;  3KFU F;  1AIL A;  4CC5 A;  2HI0 A;  3RF9 A;  2YX8 A;  3SI8 A;  2UVW A;  4IIJ B;  4G28 B;  1L3S A;  1G4Y B;  5AG2 A;  3CP1 A;  4P2Z A;  4PL1 A;  1ZX3 A;  3ZHV A;  9ICB A;  3AG2 B;  1HWY A;  4MVR A;  4NXM O;  4J9S A;  4I50 B;  4F5N A;  1M5I A;  1HNW B;  4WFF A;  4Z1V A;  4YFK A;  5KA5 A;  2HVJ C;  4BAY A;  4MVO A;  5KFV A;  5DKW A;  2JEG A;  2ZDI A;  4XUS A;  2CE4 A;  4FLV A;  5EE0 A;  8ICX A;  1N0J A;  1D5N A;  4LF6 B;  5KFM A;  2W3S A;  2B1I A;  2EAP A;  5HNK A;  1CI4 A;  3QF7 A;  3GWK C;  4QWC A;  1QSY A;  3THO A;  2YMP A;  5B3S B;  2D3O W;  2AHZ A;  3C90 A;  2FPL A;  3K9S A;  4HNA A;  4DF4 A;  2AGO A;  3LUT B;  5DED A;  4JV5 B;  3MAQ A;  3CCM V;  1YJN V;  3RJH A;  1PNK A;  2L35 A;  3G67 A;  4HAM A;  2YSU B;  4UCT A;  5TIS Z;  1T3Q A;  4JI6 B;  1ZQV A;  3UT5 A;  1XU4 A;  2UXC O;  3UM7 A;  2XC9 A;  3HRD D;  1NOM A;  3C5G A;  4UFZ A;  1Q86 W;  2H3V A;  1QNM A;  2ZDI C;  3DSQ A;  3FAV A;  4ED8 A;  4F6E A;  2Y1J A;  1N4C A;  3BA9 A;  4NM1 A;  4NLK A;  3SYP A;  4LP8 A;  2ZD9 A;  1KMI Z;  5ALO A;  4NM2 A;  4UB4 A;  1TUB A;  2XAH A;  2YEV B;  3E35 A;  9ICO A;  4M0A A;  2GBO A;  4OJ5 A;  4ZIB A;  1S0O A;  4GXK A;  1S76 D;  1N63 A;  3PO5 A;  3CYO A;  4I55 B;  4X65 O;  3HT3 A;  4QZ9 A;  5ALS A;  4RQ6 A;  1M57 B;  2Y4T A;  4B9N A;  2D6F C;  2M7W A;  5KFY A;  1NK6 A;  2KTQ A;  4DR7 O;  1V54 C;  5B1B C;  2CUG A;  1JFF A;  1T94 A;  5B66 Z;  5DN6 G;  4KMO B;  1I0H A;  2HOQ A;  2KN7 A;  2VA3 A;  4UCR A;  1EN5 A;  5IYD O;  4MHV A;  3SR6 A;  5C5J A;  2DGZ A;  5DDY A;  4DFK A;  4CRX A;  3B2E E;  4PDR A;  1SET A;  1ZQD A;  3K9A A;  4F4Z A;  3JAT A;  2A1A A;  1YIJ V;  4BR6 A;  5FNV B;  4O3R A;  2ATK C;  2HOF A;  2XVT A;  3KHH A;  4YD2 A;  4DL2 A;  3FYE B;  3B0Y A;  4TUS A;  4M9H A;  4FLZ A;  4BW5 A;  3PJS K;  3C29 A;  4EEK A;  4YG2 A;  7ICL A;  5KAI U;  1WJZ A;  3A0R A;  5J2U B;  3VBB A;  4QZE A;  2BPF A;  1YXB A;  1V97 A;  1P7D A;  4ELT A;  3GVM A;  4UCV A;  1OCC C;  2HR3 A;  4DQS A;  4MTF A;  1SGG A;  2F1I A;  4PGY A;  1YZB A;  4UCS A;  4LFC O;  4JI5 B;  4C8M A;  4R64 A;  4CCH A;  5J0S A;  5L1M A;  3HJE A;  4I27 A;  1G8M A;  3B4S A;  1BPD A;  3ZHS A;  1KRP A;  3TGU H;  2QKA A;  2KFN A;  4QW8 A;  1WCL A;  3I1Y A;  1ZD2 P;  2JZB B;  2A7W A;  4JI3 O;  1PNM A;  4UB8 Z;  1GM9 A;  3HIL A;  2KK0 A;  3NVZ A;  3WFV A;  4EEY A;  2E5L B;  3OGU A;  5KMG A;  1TK5 A;  3SMV A;  4P0P A;  2EIK C;  1JVM A;  4X62 B;  2Y1I A;  4IC9 A;  4KTQ A;  5H9C A;  4NTW A;  1F0M A;  3JPN A;  4JTD B;  3BZC A;  1Z3E B;  4RQ5 A;  2F44 A;  1M90 W;  4IT5 A;  4B3T O;  2X6C A;  4F2R A;  3KHL A;  2QGN A;  4FIP C;  4FVM A;  3BPZ A;  3ABL C;  1EFR G;  5KFX A;  1OCZ C;  1V9P A;  1FXK A;  4MW3 A;  2GV9 A;  3G71 V;  1ORQ C;  2UVV A;  2QTO A;  3K57 A;  2JGA A;  2QDO A;  4CDG A;  2OTJ V;  5BOM A;  4NLN A;  3D36 A;  1QU7 A;  5LA6 A;  1QSL A;  4QWD A;  3ABU A;  4DRX A;  3MR6 A;  2DJV A;  1Z4N A;  4RPZ A;  5J2C A;  3L72 H;  5GTI Z;  1PP9 H;  2HVI A;  4EFE A;  4DK1 A;  4R8U B;  3CJH A;  4DFD A;  2O57 A;  4WFG A;  4ZHQ B;  3TQ1 A;  1HUZ A;  1N0N A;  1VF7 A;  4PGQ A;  1XL4 A;  3AG2 C;  3HWT A;  4Z2W A;  4TWK A;  2E5S A;  1ZYQ A;  4O4J A;  4RQM A;  2V7Q G;  2LMR A;  3F5E A;  4PZN A;  2H3F A;  1WWU A;  5DG7 A;  1FXK C;  1K4C C;  1WA8 A;  3HB3 B;  3R66 A;  2P06 A;  3PX0 A;  2QWQ B;  4OX9 O;  1YVW A;  4B9M A;  5AKY A;  8ICS A;  1KBU A;  4YHH B;  4ECQ A;  5FPO A;  4R7C A;  4X64 O;  8ICW A;  3D36 C;  1QQ6 A;  2W6I G;  5AK5 A;  1AJP A;  5KT2 A;  5J0Y A;  3QTC A;  1ZOL A;  4QZF A;  2P35 A;  1SS3 A;  2YIA A;  2QJ1 A;  2BCQ A;  5B5E U;  1K3E A;  3WKC A;  4AYB C;  2W11 A;  1VQL V;  4DO2 A;  2EIN B;  9ICA A;  1ARO P;  2YUA A;  4E2L A;  3PSI A;  2A06 H;  3QEA Z;  2HVK C;  1URJ A;  5J0P A;  5KFG A;  1SV0 C;  1IIP A;  2Z7J A;  3H8W A;  5IWA O;  1N32 B;  4CBC A;  3SAH A;  3RVZ A;  1L3T A;  5BXZ A;  5ALD A;  1HP8 A;  5KFP A;  3NS1 A;  5J8Y A;  1TFR A;  3BAA A;  2GLE A;  3JPO A;  2BTQ A;  3HKD A;  3TJT A;  2ZXW C;  2BSK B;  2QWP B;  4DR4 O;  3SJB C;  5ALR A;  4FBU A;  2I9G A;  4YJ2 B;  2BGW A;  1ZQC A;  2H5X A;  1WB8 A;  1YZ7 A;  2EAN A;  8ICE A;  3STL C;  2KHQ A;  1V85 A;  4PI2 A;  1TVK A;  4GKJ O;  2Z3Y A;  5JWP A;  1HR0 B;  4KLD A;  1XDC A;  2EZZ A;  3UO3 A;  7ICS A;  1K97 A;  3I28 A;  1Q43 A;  3D3Q A;  8ICH A;  3FKS G;  4KLQ A;  3ZRS A;  4ZKI A;  5ALN A;  4UAV A;  4TQD A;  2KE7 A;  3CW2 C;  3H7I A;  3JAW A;  5J8Y C;  4PA9 A;  2FMS A;  4FO6 A;  4MFF A;  1ZXI A;  4EBE A;  2XAS A;  2RP5 A;  1NK4 A;  2W0F C;  3TK1 A;  3ZMT A;  3NUQ A;  3ZMZ A;  4KHP B;  4O5C A;  1X9W A;  2ZTD A;  3T1H B;  2J6T A;  4I4T A;  4MF8 A;  2PKE A;  2FLP A;  3FYH A;  3SQI A;  2OCE A;  3LWM A;  1WN7 A;  4KLI A;  1MQ3 A;  2ZTC A;  1P7G A;  1RXV A;  2GTS A;  5KHK A;  3JAS A;  3G6E V;  3AU6 A;  3A0B U;  2WLJ A;  1IG6 A;  5ALG A;  4R50 A;  4M9J A;  1XNS A;  1PK3 A;  2DF4 B;  1XMO B;  1MAB G;  3CRX A;  5KFA A;  3ABM B;  5KFK A;  3M99 B;  4MVM A;  4YY3 O;  2XGQ A;  2W7P A;  2X6A A;  3ASN C;  1YTF D;  5FPR A;  3W7S A;  1CP9 A;  4PHD A;  1OCO C;  5AK3 A;  1R3K C;  4CS4 A;  3WB1 A;  4KP4 A;  3CRQ A;  2HG5 C;  1JIH A;  4KLT A;  4NJ8 A;  1WP8 A;  3BAB A;  1GK9 A;  5IJ9 B;  4O3Q A;  1NTK H;  1NKB A;  3SJA C;  3TI0 A;  1Z5V A;  3QNE A;  9ICI A;  8ICY A;  4BIZ A;  1LR1 A;  4X20 A;  3KTQ A;  9ICM A;  1U45 A;  4C8K A;  3OAA G;  8ICF A;  2BPC A;  1HIW A;  4M04 A;  2PI5 A;  4KMU A;  4RQ0 A;  4YR3 A;  3OW2 U;  3K79 A;  4OXS A;  4EYH B;  2E1E A;  5KT7 A;  3K59 A;  1G1X B;  2YXL A;  3F7V C;  4U7N A;  1IBL O;  4PA3 A;  4WFE A;  2G0A A;  5J29 A;  1NK8 A;  1MZE A;  4HNA B;  4U7O A;  3RJF A;  2F4V B;  4NTY A;  2QAR A;  5TZV A;  4DSK A;  2HHH O;  7ICO A;  5ALT A;  4EB6 A;  1MA7 A;  2JDI G;  1H2N A;  2IU3 A;  4K4G A;  1DLB A;  4JYY A;  4B3R O;  3HKB B;  2Y48 A;  3OMN B;  4N21 A;  3OR7 C;  2HW3 A;  3OUF A;  3K1R B;  1H8H G;  1PL0 A;  3FAV B;  4H33 A;  2YDE A;  1XRE A;  2O6K A;  3CB2 A;  1F4M A;  4JYA B;  2EIM C;  4QJF B;  2H94 A;  4LFA O;  4CS2 A;  2A3V A;  4ED0 A;  2ASJ A;  1Q90 D;  4BXO B;  3UMB A;  4F91 B;  1TUB B;  1IBK B;  1SKR A;  4B9S A;  4BWA A;  3BS5 A;  4FFB B;  4UBB A;  3I76 A;  4RT2 A;  2HHU A;  2GWS A;  4LF7 O;  4OD0 A;  2Y9U A;  4I2B A;  4MVZ A;  1NJZ A;  5JQG B;  4IRC A;  4IRK A;  4JI7 O;  3AG4 C;  2I5H A;  2ITC C;  2BZF A;  4ED6 A;  5KG7 A;  4IIJ A;  4P0Q A;  4BW9 A;  1AJQ A;  4BIU A;  3SR2 C;  5L3C A;  2KFZ A;  2HHS A;  2KQX A;  5CR0 A;  4I50 A;  2JK5 C;  4W4K A;  2XO7 A;  3ETQ A;  4HYO A;  3GV7 B;  1X42 A;  1Y66 A;  4UCU A;  4O3M A;  3GV8 B;  1J2M A;  4I2I A;  1KTQ A;  3IM1 A;  2W8K A;  2P66 A;  4DV7 O;  4LF4 O;  1NQT A;  1YIT V;  4DV4 O;  2B5U A;  3QE9 Y;  4TOI A;  4OJP A;  4B3M B;  4LR3 A;  1KUQ A;  1SKW A;  4QGP A;  3AL0 B;  2RQ5 A;  1HDJ A;  3NTU A;  2W9A A;  1Y67 A;  8ICV A;  5KAI Z;  4K0K B;  4NLZ A;  3SDL A;  4EX7 A;  4F4Y A;  1BHA A;  1DF4 A;  1N2X A;  3L5K A;  4MW8 A;  4UV8 A;  5EE9 A;  2CK3 G;  3QYP A;  3WKA A;  4PEL A;  2M9N A;  2WLM A;  1RM6 C;  3RB6 A;  4B7K A;  2AGP A;  2FE9 A;  3K1Z A;  5DGB A;  1NR7 A;  3NAS A;  1RPO A;  3QUC A;  4F50 A;  4PGX A;  4CE6 A;  3IV6 A;  3JAK B;  1N60 A;  2HHQ A;  3F5T A;  2LW7 A;  3ABL B;  2YEV A;  4QZH A;  5B3S C;  3TCU A;  5HML A;  1N33 O;  2K8A A;  2KEY A;  1R3J C;  4CH6 A;  5EIB C;  2UXN A;  2PMZ C;  3PW5 A;  4WBN A;  1CUK A;  1HNZ B;  4NXN O;  4P0P B;  1FAF A;  4FLW A;  3G80 A;  4TQF A;  5ALX A;  8ICA A;  2F23 A;  1L7N A;  4Y2X A;  4DSE A;  1FIQ A;  5DQI A;  2E75 B;  1RQL A;  3F53 A;  4GXI A;  3OE7 G;  4DO9 A;  5E1A C;  2XND G;  4DWI A;  2WF6 A;  4ECR A;  1L6N A;  2PF4 E;  2Q73 A;  2UXB O;  2A3Q A;  5J2T B;  3K5N A;  3ZDD A;  5III A;  2F1J A;  4ACO A;  1SQV H;  1JXE A;  5FNV A;  2P6U A;  3IDW A;  2JS3 A;  3ISB A;  4DV5 O;  1M57 C;  2EZX A;  4JMU A;  2JJ1 G;  5LA6 B;  3SYA A;  4LF8 O;  1BNP A;  2IBZ H;  3MAB A;  5JRT A;  1D5A A;  4RWU A;  1BQZ A;  5J2U A;  4YJ3 B;  3CJH B;  5ALF A;  1COO A;  3J7A U;  2FPK A;  4LFC B;  3D2Q A;  3W7U A;  1GM7 A;  4J9R A;  4JI8 O;  3TAR A;  4C4R A;  5AI6 A;  2VRZ A;  1WA8 B;  2F2A B;  2UUA O;  3CRC A;  4O2A A;  5AKI A;  1FFX B;  1GN3 A;  1LNQ A;  1T7P A;  3JSN A;  1IUR A;  2UXX A;  2NRW A;  1SC5 B;  4JI3 B;  2E8N A;  1NI8 A;  2LO1 A;  2AQ4 A;  3X2Q B;  4UAW A;  1TGO A;  4JWN A;  2ETN A;  4ABM A;  3T1Y O;  3RYC A;  2BCC H;  2XGP A;  3IFX A;  4QNH B;  4NKG B;  2H3Q A;  3TET A;  1FFV A;  2BCS A;  3V72 A;  5B5E Z;  2C2R A;  2ISP A;  2BQ3 A;  3GWO A;  3WU2 U;  3BQ2 A;  3K06 A;  3AK1 A;  4Y2R A;  3T79 A;  2UUC B;  3QO5 A;  5CP2 A;  4B3T B;  3PY8 A;  2WA3 A;  1B43 A;  4J9N A;  2WAQ F;  1SQF A;  4ZOL B;  3VOU A;  4CZZ A;  3V7K A;  2WLI B;  3MHH C;  4UCO A;  5KG2 A;  1JXL A;  1FO4 A;  5DEC A;  4I29 A;  4NVP A;  4J9O A;  4LVS A;  1IZ3 A;  2XIC A;  2W43 A;  2BTQ B;  9ICE A;  3B8N A;  4GYC B;  4CS3 A;  1ROP A;  1R1B A;  4EEN A;  3CMA V;  2C2A A;  3L71 H;  4F5Q A;  4O5K A;  2HHW A;  4ED7 A;  5KG5 A;  4QPJ A;  1SES A;  3GB7 C;  5AKE A;  3G6B A;  3QG5 A;  3EXA A;  4NTX A;  3RBE A;  1XMQ O;  1SL1 A;  4R8U A;  3EYZ A;  3R65 A;  1KKC A;  4ZHQ A;  3MR5 A;  3I56 V;  3JD1 A;  1LKY B;  1NK7 A;  3UCS C;  2R8J A;  9ICF A;  3H1I H;  2HHT A;  4BIO A;  1LUW A;  1YT3 A;  4QZA A;  1NKD A;  1RP3 B;  8ICP A;  2GHY A;  2H8P C;  1JI7 A;  3M7M X;  3QU2 A;  5C93 A;  1BT8 A;  3NRZ A;  1JMK C;  2FYU H;  2Y4U A;  4I2J A;  3RRG A;  2QE7 G;  5J2F A;  3APO A;  1U96 A;  2ZUB A;  3WK9 A;  2JEF A;  3U26 A;  3M8R A;  1FS0 G;  4FZ1 A;  1W0K G;  3K75 D;  2JRI A;  2AHY A;  2PFQ A;  4IL6 U;  4GC6 A;  2ZCE A;  5CB4 A;  5AKL A;  2R8I A;  5J2H A;  3RAX A;  2LJ2 A;  4JI2 B;  1N5W A;  3A0B Z;  5BMV B;  1RZT A;  5EWF A;  4DUZ O;  3NVW A;  2C2D A;  3HPL C;  4TV9 A;  5J2J A;  2PYL A;  2A1J B;  1S10 A;  4IRD A;  3RT3 C;  3RYF B;  5DGA A;  1R6T A;  3EWA A;  5CB1 A;  1T8E A;  4MVQ A;  3ZHQ A;  5C0Y A;  5EWG A;  4KN7 A;  3AEI A;  4NYK A;  4JV0 A;  2LFS A;  3L70 H;  5L1I A;  4DR4 B;  2N04 A;  3NVY A;  1NTZ H;  3ETD A;  3SPC A;  2FI1 A;  2L6L A;  5HR7 A;  3RH6 A;  4H37 A;  3EUB 2;  1ZL8 A;  2BSK A;  2Q0O C;  4X20 B;  1J5E O;  4DW0 A;  4D6T H;  4GKJ B;  4YJ2 A;  2EIJ B;  2OYY A;  3V6J A;  1Z19 A;  3L4P A;  3RGB A;  5AM3 A;  4DF8 A;  4DV6 B;  1I5X A;  2W9B A;  1F51 A;  4LZD A;  3H1K H;  1ZRM A;  2WF5 A;  4GX1 A;  4B3S O;  2VIX A;  2EIM B;  4AQY B;  1FKA O;  4O2B A;  1FXH A;  3IHQ B;  5D46 A;  4LF9 O;  1K33 A;  2E8P A;  1N5X A;  2CGN A;  3ONN A;  1SA0 B;  2F43 G;  4D7S A;  2VQE B;  3CC2 V;  5IT9 N;  1L0L H;  2QAR B;  4RO2 A;  2AZ0 A;  4ECW A;  4XDL A;  1TVA A;  3Q8R B;  5D5Q A;  3F2D A;  1XNR O;  1P84 F;  4RT3 A;  4GT1 A;  2YB1 A;  1D2D A;  4J9Q A;  4MVU A;  1Z1B A;  1TAU A;  7ICM A;  3PX6 A;  1ZSP A;  2Q0Z X;  2WTF A;  2W9M A;  2EH9 A;  5L1J A;  3ED5 A;  9ICQ A;  3ZED A;  4NB5 A;  3WK6 A;  1I94 B;  2UVR A;  2ZE7 A;  2XTA A;  2F95 B;  3J81 N;  5AKH A;  2D3D A;  1SKS A;  3OM3 B;  3O9O A;  3RH4 A;  3K58 A;  4ICG A;  1SZH A;  3N7R C;  1ZD4 A;  3BS5 B;  1MC8 A;  4TUQ A;  1BQ0 A;  3AN1 A;  1ZQZ A;  3LDA A;  3M9O B;  2KZZ A;  3I55 V;  1K7D A;  2KD1 A;  1NKC A;  2WB1 C;  3OJS A;  4X89 A;  4DV0 O;  1ZQT A;  4TUY B;  3B0X A;  3OTO O;  4J9K A;  3AG3 B;  7ICI A;  4O3O A;  5KFC A;  1A0P A;  2RHF A;  2JEJ A;  4F5R A;  1ZLZ A;  2Z5U A;  5IJ9 A;  5KUK A;  1SF9 A;  4JAV A;  3V6K A;  9ICX A;  4P0Q B;  3GIK A;  4DYL A;  4QW9 A;  4F4W A;  3LVW A;  2PMZ F;  3G6Y A;  3D2N A;  1B6Q A;  3P32 A;  1IBM B;  3IAY A;  3EFF K;  3SV4 A;  2F8K A;  4RQN A;  4C7Z A;  1K34 A;  4NL9 A;  3ABM C;  3W7T A;  1N8R W;  4UAR A;  5LP6 B;  3DTU B;  5KL8 B;  2DMX A;  4JYC A;  4JI0 O;  4ELV A;  2KJ8 A;  1PVR A;  4NY8 A;  2ATL A;  2B1G A;  5FLX N;  3BVO A;  9ICC A;  3JPR A;  3UQ0 A;  4YQW A;  4YXW G;  2M0N A;  3RVY A;  1ZQL A;  5BR8 B;  1OUQ A;  7ICJ A;  1X40 A;  4Y2J A;  2ZIO A;  1IV8 A;  3T5H A;  4B3R B;  2YI9 A;  3KZX A;  4UV9 A;  3UKM A;  2PYJ A;  1XQ8 A;  3HKB A;  3H4B A;  2PGG A;  5H6Q A;  4NL9 C;  4I7Z B;  1KW4 A;  5LOV B;  4ZI7 A;  2ZTE A;  1EBO A;  4Z6C A;  3UPQ A;  8ICJ A;  4LFA B;  1Q3E A;  3E0F A;  1OHH G;  2YID A;  4IS7 A;  4NXZ A;  4Z6F A;  1ZQS A;  3VCB A;  3QEB Z;  4USA A;  5L3F A;  2YXH A;  2LKY A;  4OJO A;  1AI6 A;  4DSF A;  1NNL A;  4BXO A;  1K5O A;  5AM5 A;  1N56 A;  1SQX H;  4PZO A;  1QQ7 A;  4FFB A;  4WBN B;  3B9J A;  1BE3 H;  3CWB H;  1ZJN A;  4DL3 A;  1GN4 A;  2EZO A;  4P9P A;  4LF7 B;  1L8O A;  5K1P A;  4I2H A;  4JI7 B;  3BRC A;  1L7P A;  5KFE A;  4UAY A;  2HFE C;  4O3S A;  4DV3 O;  5JQG A;  4DL4 A;  4Y2V A;  1RYU A;  4J42 A;  2R9A A;  4MVS A;  9ICP A;  1XC9 A;  1PK1 B;  4LZG A;  5LBQ A;  1BPE A;  3GIM A;  3BEH A;  2L5Y A;  2UU9 O;  1QCE A;  4Y2S A;  1JCH A;  1Y74 B;  4Q44 A;  2ZJA A;  4DV7 B;  1ZQU A;  1Q81 W;  3RBD A;  2N05 A;  5LHI A;  2MA1 A;  2ZIW B;  5J9P C;  4DV4 B;  1F44 A;  2V4D A;  4C7Y A;  3TAQ A;  4C80 A;  2AGA A;  3O0F A;  3E2E A;  2DN9 A;  5DLG A;  1EM1 A;  1YDX A;  3LDD A;  5LHG A;  1WPX A;  5DB6 A;  3HW8 A;  5CHG A;  2HCF A;  1M4U A;  2LP7 A;  4I5S A;  1L1F A;  2OCC B;  3OD4 A;  2RCV A;  5H5N A;  4C8O A;  5GW7 A;  2LM4 A;  4B08 A;  4LFB O;  1L3V A;  1R6K A;  1UCV A;  5CBH A;  4EZ6 A;  1KSP A;  3PW4 A;  4U3F H;  5LYJ B;  4EYI B;  1GN6 A;  5LGN A;  4YXJ A;  1IDS A;  4WF9 V;  1N62 A;  3C23 A;  2PFO A;  4O2A B;  3ZD9 A;  2MK3 A;  2P4K A;  1TAM A;  3JAK A;  1GAX A;  4KUM A;  3MFI A;  2R18 A;  1OW5 A;  2XAQ A;  2HJF C;  1N33 B;  3RR7 A;  2Q7H A;  2PUS A;  4QPK A;  1S3J A;  3UXN A;  2EAO A;  2ITD C;  3H8J A;  4RUE A;  3K5L A;  5CBG A;  5DB9 A;  4NXN B;  2EQY A;  3RYC B;  3OTQ A;  1UPG A;  2P6R A;  1EZV H;  1ZQW A;  5K4L A;  5KL1 B;  4MFC A;  4EX6 A;  3I5D A;  5L1L A;  4FZ0 A;  5J0O A;  4CF5 A;  2Y69 B;  1N36 B;  4CH3 A;  4X5V A;  5IYB O;  2ZIU A;  2DWD C;  4KLO A;  4NLC A;  2FMP A;  4HBN A;  1ZQY A;  3UM9 A;  1HNX B;  4DR5 B;  3CD6 V;  2UXB B;  1GO3 F;  2KVC A;  4K4H A;  1WPB A;  4DSL A;  2JXJ A;  2QB1 A;  3QU4 A;  4PI0 A;  4RQ8 A;  1P49 A;  5J2T A;  4MFA A;  3BY6 A;  4X66 B;  4DV5 B;  5KFF A;  3OTF A;  8ICT A;  1LV5 A;  2KIV A;  4KN4 A;  5DB8 A;  2HOI A;  1X4T A;  2P22 C;  1KEJ A;  2AZ2 A;  4LF8 B;  2KNJ A;  3FC4 A;  5KLV H;  4ZH4 A;  3IC7 A;  3AU2 A;  5KFH A;  2XCA A;  2P4V A;  3CRR A;  5LHH A;  4I2A A;  5DLF A;  3AQE A;  1FEZ A;  4JGS A;  4NV0 A;  3FFQ A;  4YJ3 A;  2JGD B;  3M7D A;  2F93 B;  4DR6 O;  5IJ0 B;  1S0V A;  1FYJ A;  2UUA B;  1QR9 A;  1ZQM A;  4LF5 B;  4PJ0 U;  3OPX A;  1AB3 A;  9ICS A;  2E74 B;  4DK0 A;  2YY6 A;  5F9L A;  1O9G A;  2ADP A;  3OT7 A;  1QCK A;  1P4R A;  1FFX A;  9ICR A;  1GRJ A;  5CJ7 A;  5HFM A;  3T1Y B;  3FM9 A;  3IC9 A;  5DQH A;  2KKP A;  1D9D A;  4IL6 Z;  5CB4 B;  3P3N A;  4JI1 O;  3MDS A;  5KHH A;  1QQC A;  2OXO A;  4N23 A;  4XBF A;  2KHV A;  5DG9 A;  1YHQ V;  2DW4 A;  4TV9 B;  3WKD A;  3DC6 A;  3H8S A;  4F72 A;  8ICC A;  2ZE5 A;  5CA1 A;  4J03 A;  4UUJ C;  4ZOL A;  2EAM A;  3PST A;  2WLI A;  4JWM A;  1NJI W;  1U4B A;  2G5H B;  1ZQJ A;  5JVD A;  4GIB A;  4QZ8 A;  3TAP A;  5EYP B;  1F4N A;  4O4L B;  1VQ4 V;  3L3F X;  3QVN A;  1NU1 H;  2JR5 A;  3ZI4 A;  1QTM A;  2RLT A;  3X2Q C;  2OEH A;  3MDC A;  1ZL8 B;  4Q8F A;  3LSS A;  1BL8 A;  4US8 A;  4FLT A;  2H3I A;  2ZM6 O;  2LPE A;  3HP6 A;  2OHF A;  4DL6 A;  4LNU B;  3CRM A;  2FJ6 A;  4FM0 A;  1O03 A;  2WB1 F;  5KFU A;  3PSF A;  3ZJZ A;  5ITZ A;  3WB0 A;  1XMQ B;  3KKA A;  2Y0S F;  3TAD A;  2W9B B;  1BPX A;  4WCE V;  3HPO A;  1SQG A;  3L74 H;  2ILM A;  4FLY A;  3T5K A;  2ZR2 A;  2DUY A;  7ICT A;  1FXV A;  4JTC B;  1J2N A;  4O2B B;  5KHI A;  3JAR B;  1LKY A;  3N7S C;  5HHH A;  1ZWI C;  3OUS A;  2Q7E A;  2DWQ A;  3N2K B;  4ECU A;  1XHZ A;  1WB7 A;  3BQ0 A;  3NGD A;  1BPZ A;  3Q4H A;  2HBJ A;  4R63 A;  3A0H U;  5JJN B;  8ICB A;  2MSN A;  5ALJ A;  2CTP A;  1KC8 W;  1K73 W;  3TAD C;  4RU9 A;  3MBY A;  4KLH A;  1NH2 D;  1RSO B;  3DEE A;  2K1E A;  2ES6 A;  2LHT A;  1SL2 A;  8ICR A;  2CTW A;  4DUY O;  1S5H C;  5BMV A;  3MGI A;  5B1N A;  1LUV A;  4JB3 A;  1RFY A;  3NVV A;  4M6W A;  5KNI A;  1U97 A;  2AW9 A;  2A1J A;  1JQ0 A;  1ZQ1 C;  4O5E A;  3GIL A;  3RYF A;  1COK A;  4NR1 A;  3RFA A;  4ECV A;  1JA8 A;  4Q45 A;  5ALM A;  3QU5 A;  3CXH F;  3LSU A;  4C8N A;  4MSW C;  4IR1 A;  4IQU A;  4K35 A;  4RQ1 A;  2R8K A;  1RPR A;  2W9C A;  2X0L A;  2UUB O;  2ZE8 A;  1VAR A;  1DOQ A;  5J2E A;  3CC4 V;  4ECS A;  2WPD G;  3CCV V;  3OSN A;  1NVP D;  3GDX A;  2E3C A;  4FLU A;  4LJX A;  5H2F U;  4B3S B;  4G2K A;  4GKK B;  4KLE A;  2AU0 A;  2C28 A;  3WK7 A;  2RDC A;  1A76 A;  5CBF A;  1IX9 A;  2HJD A;  2YB4 A;  1B3Q A;  4LF9 B;  5E79 U;  4U3J B;  1KD1 W;  1SQQ H;  3RYI B;  1JX4 A;  4H44 B;  4DEZ A;  4EBC A;  3W7W A;  1NJY A;  5DM6 V;  5T14 A;  5KG0 A;  3T3F A;  2E76 B;  2PFN A;  1IXM A;  4WFH A;  1XNR B;  3UO2 A;  3SYC A;  2XY6 A;  3ORY A;  3GU3 A;  1NKE A;  4KLJ A;  1JN3 A;  1CRX A;  1KYO F;  3CME V;  2WWW A;  2E8O A;  1OZ0 A;  4R66 A;  2FKX A;  5D5P A;  5J2B A;  3H4D A;  2ASL A;  3PMN A;  1BCC H;  1Q46 A;  1W59 A;  1ZQI A;  4AHC A;  1ZJM A;  4RQ2 A;  2EIJ C;  3RRH A;  4ECY A;  1HNW O;  2WF7 A;  4ZI7 B;  1PL4 A;  1BSM A;  4EBD A;  2K4E A;  4F4X A;  3AK2 A;  4IR9 A;  4HAI A;  1GTO A;  5C8Y B;  2HDO A;  1VQN V;  2JEX A;  3HX0 A;  3ZS8 C;  4PA7 A;  4DQR A;  2ZQM A;  4LF6 O;  3MGV A;  1OV9 A;  4C7U A;  3TAN A;  2MRL A;  1UJW B;  1SKV A;  5L3D A;  4DV0 B;  3OTO B;  4BDP A;  2LM1 A;  9ICJ A;  1Y88 A;  4TUP A;  1YEW A;  4JV5 O;  2AHO B;  4B9T A;  3E83 A;  2XCP A;  4RNM A;  4TUY A;  2G07 A;  4JI6 O;  1NR1 A;  1A77 A;  2FLN A;  4FBT A;  1VQ7 V;  9ICG A;  2EZP A;  3PO4 A;  4DLG A;  2ISO A;  4NXM B;  3N27 A;  1R73 A;  1QLE B;  4C4T A;  2DYS B;  4DV2 O;  1FJG O;  4AP9 A;  2EIL B;  3JAM N;  1P7B A;  2QA4 V;  2LW1 A;  1K1Q A;  1TV9 A;  1ZQK A;  1G6U A;  2BDP A;  3SJC C;  4O9M A;  3TAC B;  5ALV A;  3V7J A;  5LP6 A;  1Z1V A;  4NLG A;  3RAQ A;  4K8X A;  4I2C A;  3OMI B;  4QWA A;  4JV2 A;  5AM0 A;  1PV0 A;  2W04 A;  2QSA A;  3ALR A;  2Q6A A;  5AI5 A;  3AG3 C;  4UAS A;  2BR0 A;  2AQ0 A;  1VQ8 V;  1B0X A;  1SER A;  4YD1 A;  4A8E A;  3QU9 A;  3SYO A;  2VA8 A;  2WF9 A;  2UXC B;  2KSO B;  4J7J A;  3WKB A;  3B8M A;  4PHA A;  2ODG A;  3VC8 A;  2HP8 A;  2ODM A;  4P9O A;  4A5U B;  1QLN A;  1X6I A;  3SD7 A;  4FS2 A;  4O4I A;  1KP2 A;  1FFU A;  1L7M A;  5LOV A;  5LP6 C;  3CCR V;  1D8B A;  2G08 A;  3OEH G;  7ICU A;  1H2L A;  5J2D A;  1H8E G;  2FL4 A;  3FB8 C;  3RYH B;  5LMU O;  2BHN A;  1NK0 A;  2D2C B;  4NLB A;  1XO0 A;  4GX0 A;  1ZQQ A;  1BPB A;  1SZP A;  2CTR A;  1Z5W A;  2DPJ A;  4FE3 A;  2Q8V A;  1Y6X A;  4X65 B;  2OTL V;  4QIW C;  4JK1 A;  4PDV A;  1XS9 D;  2IH3 C;  4UVA A;  4GC7 A;  2YXY A;  4PD4 F;  5J2G A;  1VQM V;  2PI4 A;  3GFK B;  3KKY A;  1ZQR A;  4DV3 B;  2QKS A;  4DR7 B;  1ZQN A;  4IYI A;  1RQN A;  3M8A A;  4F2S A;  2FML A;  1OXJ A;  3BCC H;  3CC7 V;  4DR2 O;  3RBZ A;  2RDI A;  2ZIU B;  1XNQ O;  1ZET A;  2QWR B;  2YC0 A;  2V4R A;  3UQ2 A;  2IHM A;  1JR9 A;  1PK1 A;  2WLL A;  2ZR3 A;  3B09 A;  4G27 B;  1L3U A;  4O3N A;  1K92 A;  5F2V O;  5KT6 A;  4IHJ A;  2XID A;  3RN4 A;  1Y74 A;  4LWS A;  1W2B U;  4AYB F;  2CH7 A;  2QWN B;  4X1I A;  3Q8L A;  3JPP A;  5DBA A;  2ZIW A;  1XEQ A;  3EZ5 A;  3DXR A;  2F3N A;  3K3W A;  2E5L O;  2OT5 A;  5AM1 A;  4YR2 A;  4Y2U A;  2ZIM A;  2KZ3 A;  4X62 O;  5G5H A;  1F5S A;  1BGX T;  5KT4 A;  1JRO A;  3GQC A;  4LC1 A;  9ICU A;  5B1A B;  2Q4P A;  3QNM A;  4KLS A;  2A79 B;  1NS1 A;  3M6Z A;  4FPP A;  3F5W C;  2LGW A;  5LYJ A;  2W6J G;  2ZUC A;  2JRZ A;  4PJ0 Z;  1MSW D;  1QQ5 A;  3S3X A;  3C2L A;  2J6U A;  1KB9 F;  2HBM A;  8ICM A;  3PV8 A;  1NT2 B;  2GH1 A;  2ARH A;  2NO4 A;  4JAA A;  3RFR A;  2OCC C;  2MUT B;  3SAF A;  3UXO A;  5CA0 A;  1SQP H;  4O3P A;  2ZG6 A;  5CWR A;  4Y2Y A;  3PR4 A;  4F5O A;  2KVS A;  1XSL A;  4DSJ A;  4UB1 A;  3OJU A;  4YP3 A;  1DGJ A;  2K89 A;  1PNL A;  5CA1 B;  2NV3 A;  2JGU A;  1BHB A;  2IJI A;  3ZN0 A;  1DK1 A;  1A32 A;  2JV3 A;  1KP3 A;  5JVD B;  1S5J A;  1XUQ A;  3HR0 A;  7ICV A;  1K4D C;  1SL0 A;  5KFO A;  4UB6 U;  4LH6 A;  4J10 A;  1KBH A;  5KX5 B;  5CN0 A;  2PFP A;  1FD9 A;  1AP5 A;  2CRX A;  5A9G A;  1D9F A;  2ADQ B;  2WF8 A;  3AUO A;  2YIC A;  3JCZ A;  5ITZ B;  2Y69 C;  1X9S A;  1KDH A;  3FAH A;  4BUG A;  2DKX A;  4CGZ A;  5LGU A;  1UT5 A;  3FD9 A;  4PV1 B;  3TFS A;  2JGD A;  2PZS A;  3CCS V;  3C2K A;  3R9K A;  2ZT9 B;  1JPX A;  5IJ0 A;  1KQS U;  1SZT A;  1X6J A;  4UB5 A;  3CYM A;  2IJK A;  4OX9 B;  3M9M B;  3PX4 A;  2R8H A;  4UAU A;  1BNO A;  5AIB A;  4X1K A;  5JH7 B;  3J80 N;  3ZD8 A;  4LBE C;  1S0M A;  4X64 B;  4D7T A;  2XI9 A;  1YTF B;  2PY5 A;  3WK8 A;  1ZQG A;  3PZP A;  3Q4H B;  3D8C A;  3A0H Z;  4J7Z A;  2ZIX B;  4P4P A;  3H1L H;  5JUM A;  4B9V A;  4B9U A;  4ZOH C;  1WCN A;  1Y76 A;  2RQ6 A;  5DQG A;  1HR0 O;  2DYR C;  5JCO A;  2EJR A;  3JPS A;  1T3N A;  1VF6 A;  1XBL A;  2GUZ B;  3AG1 C;  5KFS A;  7ICP A;  3SGI A;  4M6W B;  3RJG A;  4MTO A;  3C28 A;  2HVH A;  1T5E A;  1DGS A;  3JAL B;  3P3P A;  3S6J A;  1YSC A;  2VJ4 A;  1GKF A;  5IWA B;  3SEI A;  4DL7 A;  1NK9 A;  1L8D A;  4TT3 G;  2KG5 A;  2LYB A;  1X2I A;  5EYP A;  3N2G B;  4KHP O;  1AR5 A;  2AH5 A;  1ENV A;  2BKE A;  4O4L A;  4X1Y B;  4J9Z B;  3H0L B;  5AKX A;  2W9C B;  1ZQE A;  3N7P D;  2ZM6 B;  3T1H O;  2DQN B;  1R3L C;  5J0X A;  2XHB A;  4QZG A;  1H2S B;  4GX5 A;  2NYV A;  3Q8Q B;  5JCO C;  4LNU A;  1VF6 C;  2DBY A;  1KEC A;  3H1H H;  2QKQ A;  2Q69 A;  4YMM A;  2LBO A;  4I2G A;  2ZE6 A;  1WG8 A;  2ASD A;  5H2F Z;  5IY5 B;  1XMO O;  4IQV A;  1IXB A;  1VMG A;  1TKD A;  1MQ2 A;  7ICK A;  5E79 Z;  2AXT U;  5ALW A;  2IBK A;  3LDC A;  4GX2 A;  2BOB C;  2KG7 B;  3JAR A;  3PW0 A;  4RQE A;  4EEL A;  2DE0 X;  1AI5 A;  2XY5 A;  3E8H A;  4DQP A;  3L75 H;  4QNL A;  3N2K A;  1K5S A;  5EZY B;  3KZI U;  4WFA V;  3CRA A;  5IE9 A;  3QU7 A;  1S77 D;  4PDL A;  2WA4 A;  2KMD A;  2YIB D;  4UW9 A;  2EBO A;  1KN5 A;  4Y2Q A;  4OCZ A;  1R6N A;  2EDU A;  4DUY B;  1SQB H;  3APQ A;  4PPX A;  1RSO A;  1OCR B;  3ZIA G;  3KBB A;  3PSP A;  4QE7 A;  5AI8 A;  1NK5 A;  2BQR A;  3RJK A;  2HEP A;  4GUN A;  4KXR A;  5AM4 A;  5IYZ A;  4YY3 B;  2HBL A;  2WLK A;  1WP7 A;  4F92 B;  3KCY A;  1MNG A;  2P90 A;  1COW G;  4DR1 O;  2VJ5 A;  2NLJ C;  4R6Z A;  2KJ9 A;  5CMU A;  1MSD A;  1GH6 A;  2F4V O;  4M9L A;  3HKZ C;  3SYZ A;  1QH9 A;  2K8C B;  2B9Z A;  4UVC A;  2UUB B;  1AP6 A;  4AI8 A;  1R3I C;  1H2G A;  2MW2 B;  3PR5 B;  2QB0 B;  4M2Y A;  1TE2 A;  4M9N A;  2ZNI A;  4Q20 A;  4QIW F;  4YMN A;  3G6X A;  1I7F A;  3OFN G;  1M1K W;  4YIP A;  4DSI A;  3RH5 A;  5EE1 A;  4JYA O;  3MFH A;  4OPA A;  1T4G A;  2W8L A;  2GDS A;  4I9W A;  2QEX V;  1QVF U;  3F2B A;  4QZD A;  1RPL A;  3N4M B;  2YTU A;  4KIT B;  2RRD A;  1Y4M A;  5BY1 A;  1IBK O;  2QM4 A;  1W0J G;  1RG6 A;  4DQI A;  4MS2 A;  1IBL B;  1MA1 A;  2E3T A;  3PML A;  4U3J A;  4DOA A;  4QWE A;  3M9N B;  2X7R B;  3RYI A;  4FZL A;  2IOF K;  4XDJ A;  1WWV A;  3JD2 A;  2F77 X;  4RNO A;  2HHH B;  2C2E A;  3CNH A;  5DB7 A;  1ZQB A;  4WJ3 B;  5LMN O;  3CXC U;  1IXR A;  3K08 A;  4ICA A;  2P67 A;  4JPR A;  4DL5 A;  2F8L A;  4Z6E A;  2MU2 A;  2VAN A;  3QO7 A;  2BTO A;  4O4I B;  4Z6D A;  4PA4 A;  2NN4 A;  8ICO A;  3ZCC A;  3EPG A;  2XAF A;  2IU0 A;  1TAQ A;  2FDR A;  3KCX A;  3IG5 A;  1Q6U A;  3LNN A;  2JMG A;  3ZDC A;  2P6J A;  4F8R A;  3D6J A;  5C8Y A;  3SV3 A;  2VQF O;  5KFQ A;  4O4H A;  5BZB A;  9ICN A;  3PN1 A;  4B3M O;  1Z2G A;  1V55 B;  1XL6 A;  3MC1 A;  2GTA A;  3OR6 C;  3EW9 A;  3MD0 A;  4DXW A;  4K0K O;  2AJQ A;  3BHP A;  1BS3 A;  1MN8 A;  2JH7 A;  5KFL A;  3KD3 A;  5GTH U;  3ETE A;  3NRW A;  4FM2 A;  2KIC A;  1U9L A;  2QLT A;  1NZ6 A;  1FJG B;  4DV2 B;  5KG1 A;  2IHN A;  3S3W A;  4W4L A;  4F71 A;  5ALQ A;  4J9P A;  1Q5O A;  5LGT A;  3RJJ A;  2Y9T A;  4JI4 O;  2FPM A;  4XQ8 A;  5KFW A;  3ZRW B;  2WLL B;  3TXQ A;  2P7T C;  4JTA B;  1F7Y A;  2JEU A;  4E0D A;  4IHJ B;  4QZB A;  3OSP A;  4LWS B;  3JSL A;  3EHB B;  4X1I B;  2CH7 B;  2CDY A;  5K1X A;  4LF4 B;  1ZQO A;  4KLL A;  2R9R B;  5A2Q N;  3DXR B;  3OMA B;  4J11 A;  1N34 O;  1RM1 C;  5JJE B;  1HNZ O;  9ICW A;  4DCC A;  1UQV A;  2ZUD A;  3GIJ A;  4GLX A;  4DQQ A;  1FFT B;  1PKX A;  4DS5 A;  2VWJ A;  1IM4 A;  2YMQ A;  1ZQF A;  2Q4T A;  3HKE B;  4Q6G A;  3ZRV A;  2F66 C;  4BWJ A;  3V7L A;  1QLE C;  2DYS C;  2KSO A;  4J41 A;  4L87 A;  1PD3 A;  1KKD A;  3UMG A;  2C22 A;  2EIL C;  2WHE A;  4BWM A;  4JAU A;  4E4E A;  1ZQA A;  4B7E A;  4RUA A;  2DOS A;  5IYC O;  4P30 A;  2UXD O;  4UAT A;  5AK6 A;  5J2K A;  3OHB A;  3U0Z A;  5LMU B;  1NJX A;  4J7K A;  3T4Z A;  4RQF A;  1QVG U;  2W55 A;  2RJZ A;  3ISD A;  3H9V A;  3RYH A;  3D2S A;  4FS1 A;  2J6S A;  1EN6 A;  3LDE A;  2OIG A;  1C20 A;  3OHA A;  1KQQ A;  3C3S A;  2IH1 C;  1WUD A;  1F23 A;  1MG1 A;  2JS5 A;  4J9M A;  2B0C A;  4MEY A;  5EC2 C;  2DFL A;  3RB3 A;  5CA0 B;  1SA0 A;  3ASO B;  3BQ7 A;  1M6Y A;  5CEH A;  7ICF A;  3BS7 A;  4G3I A;  4DR2 B;  4UBC A;  3WU2 Z;  1X66 A;  5ALU A;  1QBZ A;  4I28 A;  3ETR A;  3SPI A;  1XNQ B;  1S5L U;  2DKZ A;  4DR3 O;  7ICQ A;  1XSN A;  5DDM A;  1J95 A;  1SRY A;  5HHI A;  2EX3 A;  4GZR B;  1VQ9 V;  4UB6 Z;  2E8M A;  1AVM A;  2K8B B;  1ZD5 A;  2IA6 A;  3L73 H;  4F6R A;  2CXY A;  4OPH A;  1Z4O A;  4ELU A;  4TV8 A;  3FYI B;  4XRH A;  5KTQ A;  4DS4 A;  2V1D A;  3B40 A;  1QR8 A;  2OM6 A;  1KLN A;  5KFZ A;  3Q8P B;  2YS8 A;  4JZ2 A;  3NR7 A;  2UUC O;  3F2C A;  1DF5 A;  5LXT B;  4JI8 B;  2DYR B;  4QZC A;  1KU9 A;  4I2E A;  1HW7 A;  4ECX A;  4YVZ A;  2BOC C;  3AG1 B;  1B22 A;  3F7Y C;  3FB6 C;  4CNQ A;  2GSM B;  3HKC A;  2ZXI A;  1AR4 A;  2A9H A;  2FB5 A;  3JD0 A;  1PVP A;  2A0L A;  4K8Z A;  1KL9 A;  1AI7 A;  2VWK A;  4X1K B;  5EWE A;  2KKW A;  2NRZ A;  2Y0I A;  2YQE A;  4Z1M G;  4PHP A;  1CPY A;  3E86 A;  1N61 A;  4MEX A;  3ZRX A;  3KG2 A;  1S72 V;  1VQO V;  2B6G A;  2QM8 A;  4OJ6 A;  4EKW A;  1Y76 B;  5IIJ A;  2MUT A;  3F5A A;  5B1A C;  2BE3 A;  3BZK A;  1N48 A;  3E22 B;  3ICX A;  4RPX A;  4UB2 A;  5J0T A;  4RQ4 A;  2Q67 A;  4Y2T A;  2CTQ A;  5IIK A;  1VQK V;  1BPY A;  1BZK A;  4CH5 A;  2R70 A;  1SV0 A;  1WNS A;  1BMF G;  1HUO A;  5ALZ A;  1GMG A;  4YXM A;  4P2H A;  4U7C A;  1Q8K A;  4FFD A;  3JYC A;  2Z0A A;  5KAF U;  3QX7 A;  1XIL A;  1FPO A;  1M93 A;  5KFD A;  2JJ2 G;  1Z00 B;  5AKJ A;  5F9N A;  5IDJ A;  5KX5 A;  7ICH A;  8ICN A;  2RN9 A;  1YZ6 A;  1QHT A;  2W3R A;  4JI2 O;  1XO1 A;  3B77 A;  3HKZ F;  4CH4 A;  2B21 A;  3C21 A;  2WLN A;  3BA8 A;  3BJY A;  3QO8 A;  5ALP A;  3FB5 C;  5KFT A;  1YF2 A;  2YML A;  2CAZ C;  4M47 A;  2KB1 A;  3ABK C;  1DRG A;  1ECW A;  1I08 A;  3DGE A;  4R8C A;  3UQ8 A;  2IMW P;  2AXT Z;  1O9H A;  2HKO A;  3ZBH A;  2XAG A;  3D3I A;  2G5I B;  4AIL C;  1S9F A;  3WK4 A;  3DV9 A;  5AKG A;  1UPH A;  4RNN A;  1NZB A;  1Q3U A;  1Q3V A;  2BPG A;  5JH7 A;  3KZI Z;  9ICT A;  4XDK A;  3KHG A;  2FMQ A;  1JOY A;  3QUT A;  2LGQ A;  4XA5 A;  3SZ2 A;  3MDA A;  2ZIX A;  4DV1 O;  1EZJ A;  3AG7 A;  3RB4 A;  5ALY A;  5EBW C;  3KKA C;  4MTG A;  4ED2 A;  3ZMU A;  2LFR A;  4ED3 A;  4JF3 A;  4P4M A;  4DOC A;  2IW5 A;  4DV6 O;  5D49 A;  3E8B A;  3SEN A;  4DUZ B;  3JPQ A;  3M6K A;  4M9G A;  3JD4 A;  5H6R A;  4FZM A;  2GUZ A;  5IYZ B;  4AQY O;  2KV2 A;  2AGQ A;  7ICE A;  1TK0 A;  1GM8 A;  1XHX A;  4FZN A;  1SIJ A;  3Q8S B;  5ALH A;  1BVS A;  2ALZ A;  3CCQ V;  1AR1 B;  4PHZ A;  2WAM A;  2XAJ A;  2VQE O;  3JAL A;  1JAL A;  5GON A;  1S97 A;  9ICL A;  1M56 B;  9ICH A;  3H8M A;  4G9B A;  5AK4 A;  2BCU A;  1E79 G;  3ZX6 A;  1H2M A;  2WAQ C;  3N2G A;  3ZDB A;  4X9Q A;  4X1Y A;  1NTM H;  3V6H A;  5CRX A;  1J5E B;  1NI3 A;  2JHD A;  1GN2 A;  1UFI A;  3E89 A;  4LCU C;  2I1Q A;  3VQV A;  3AEV A;  5AI9 A;  5L3B A;  1I94 O;  1K8A W;  2NNU A;  1BGY H;  3SPJ A;  3G6V A;  5KG3 A;  4UQG A;  1VF5 B;  3BDP A;  8ICL A;  4F4L A;  3G4S V;  1L0N H;  4FM1 A;  3CCL V;  2PXI A;  1VDV A;  3ZHT A;  5CA7 A;  4RZR A;  2KG7 A;  5KHG A;  2LI6 A;  5FL7 G;  2IJJ A;  1SXE A;  8ICK A;  3AK3 A;  3IP4 B;  4B6J A;  2YI8 A;  3P30 A;  4PDM A;  1D8Y A;  5LL6 Y;  5EZY A;  3OEE G;  5HR6 A;  2RDJ A;  2VS0 A;  1YJW V;  5IIO A;  4MF2 A;  1JJ2 U;  4KFM A;  4X88 A;  2HBK A;  4CF3 A;  1RYR A;  5EE3 A;  1IBM O;  5IY5 C;  1ZTE A;  5J2A A;  4ECT A;  3H0R B;  1ZD3 A;  1X9M A;  2ZJ8 A;  5EBL C;  4HYK A;  2BQU A;  4B9L A;  4JZG A;  4UXN A;  1U47 A;  5KHJ A;  3RW0 A;  4O4H B;  5KT3 A;  4DR1 B;  3IG8 A;  1U48 A;  2G38 A;  2G06 A;  4R65 A;  1B04 A;  2DL0 A;  3EPI A;  1SXD A;  5BR8 O;  4WFB V;  4UAZ A;  3UT5 B;  3IN5 A;  3ZDA A;  2WLH A;  1PPJ H;  1RM1 B;  5GTH Z;  5KG4 A;  1AI4 A;  2HSZ A;  1DK3 A;  3MR3 A;  2F76 X;  3ZHU A;  1KFD A;  1V54 B;  5B1B B;  2M6Y A;  4JYB A;  4DFP A;  4J9Y B;  2QB0 A;  3PVX A;  2K4I A;  2W03 A;  1MOF A;  4EZ9 A;  1OCR C;  4I0X A;  2ESE A;  4P4O A;  5AKZ A;  3K0D A;  2OYQ A;  4PHE A;  2JH1 A;  1AQ6 A;  4FK5 C;  4JI0 B;  3AQF A;  2Q7G A;  3WG7 C;  3VQW A;  2ZIV A;  2WSS G;  1KFT A;  4ZBM A;  1VJ5 A;  2W54 A;  1H2K A;  3ZN1 A;  2EZY A;  1VP7 A;  4QE9 A;  1UHU A;  4C8L A;  2RNB A;  2Y0P A;  4OGQ B;  5IIM A;  1URF A;  3SYQ A;  5LMN B;  4YN4 A;  2R72 A;  4Q43 A;  1OJH A;  1U49 A;  4YCX A;  1JFF B;  2ZNJ A;  4GCZ A;  1WYG A;  3T5J A;  1I5Y A;  3VQY A;  1J97 A;  3H0M B;  1DXS A;  4TUR A;  2YN4 A;  3IRU A;  1OCC B;  3CCJ V;  3PW2 A;  3SJQ C;  3SPG A;  3CEI A;  4YIO A;  3BQ1 A;  3MR2 A;  3CCE V;  2F1M A;  2NRX A;  4DFM A;  4GFJ A;  1AJN A;  3JAT B;  2EJ7 A;  2Q5Z A;  4QZI A;  1DK2 A;  2VQF B;  5ALE A;  5AIA A;  2VKQ A;  4J9L A;  1XI1 A;  1ED1 A;  3BFR A;  3T2M A;  1EN4 A;  2NRT A;  5L1K A;  4I2F A;  4EEQ A;  2QWO B;  2OIE A;  4NWI A;  4JAS A;  3LWL A;  2IOH A;  1E1Q G;  2XUM A;  5A0L A;  3SPH A;  5TIS U;  2W7O A;  1LVH A;  2EIK B;  5EBM C;  3ML0 A;  3EVK A;  2NO5 A; 
#chains in the Genus database with same CATH homology
 1K97 A;  4J9Z B;  3H0L B;  3FKS G;  3ZRS A;  2MA1 A;  2ZIW B;  3N7P D;  4ZKI A;  1F44 A;  5J9P C;  5LHI A;  2DQN B;  1R3L C;  3O0F A;  2JIZ G;  3E2E A;  4ASU G;  4GX5 A;  3LDD A;  4PA9 A;  1WPX A;  3JD3 A;  5LHG A;  1KEC A;  2LP7 A;  2Q69 A;  4I5S A;  1L1F A;  2OCC B;  1Q82 W;  1E1R G;  2LBO A;  2RP5 A;  2XAS A;  2W0F C;  3E8F A;  5GW7 A;  3NUQ A;  3TK1 A;  3ZMT A;  3ZMZ A;  5IY5 B;  3ZRW A;  2R9I A;  1R6K A;  1OCZ B;  1V55 C;  5CBH A;  3SQI A;  1K9M W;  4MTX A;  3LDC A;  3MHS C;  4GX2 A;  2BOB C;  4RQE A;  4KX5 A;  5LGN A;  4WF9 V;  3G6E V;  1AI5 A;  2WLJ A;  3E8H A;  2MK3 A;  4QNL A;  1TAM A;  4KUM A;  4R50 A;  1XNS A;  1K5S A;  2DF4 B;  2R18 A;  2XAQ A;  4BX9 C;  2HJF C;  4BJQ A;  4WFA V;  1MAB G;  3CRX A;  3ABM B;  3M99 B;  4MVM A;  4QPK A;  3W7X A;  1S3J A;  1S77 D;  2W7P A;  4PDL A;  2ITD C;  2X6A A;  3ASN C;  1YTF D;  2X6B A;  4RUE A;  2EBO A;  5CBG A;  5L3G A;  3W7S A;  1CP9 A;  1OCO C;  1R3K C;  1R6N A;  4KP4 A;  5EK0 A;  2HG5 C;  5KL1 B;  3K04 A;  1FXK B;  4OO1 J;  1OCR B;  3ZIA G;  1GK9 A;  3PSP A;  4QE7 A;  2Y69 B;  3FB7 C;  2HBL A;  3QNE A;  2WLK A;  5IYB O;  4BIZ A;  2ZIU A;  2P90 A;  2DWD C;  3E8G A;  1COW G;  3IGA C;  3OAA G;  2KIW A;  4NLC A;  5B1O A;  3STZ C;  2VJ5 A;  2KJ5 A;  2NLJ C;  4R6Z A;  2KJ9 A;  5CMU A;  1HIW A;  1GO3 F;  3T1C A;  3CD6 V;  2KVC A;  2PI5 A;  3HKZ C;  2K8C B;  3OW2 U;  1JX9 A;  4UVC A;  3K79 A;  4OXS A;  2E1E A;  3BY6 A;  1R3I C;  1H2G A;  3F7V C;  4FJC C;  4U7N A;  4PA3 A;  5L3E A;  4WFE A;  2HOI A;  2G0A A;  4Q20 A;  2KNJ A;  4QIW F;  3ABK B;  3OFN G;  1M1K W;  4U7O A;  5CA3 A;  5KA6 A;  3IC7 A;  3LVV A;  5LHH A;  4I9W A;  3AQE A;  1MA7 A;  2JDI G;  2GOL A;  2IU3 A;  4JGS A;  3ETG A;  2QEX V;  1QVF U;  3F2B A;  4NV0 A;  1DLB A;  2RRD A;  1Y4M A;  3M7D A;  1W0J G;  4MS2 A;  2Y48 A;  3OMN B;  2ZXW B;  4N21 A;  2E1F A;  3OR7 C;  2G09 A;  3OUF A;  1H8H G;  1PL0 A;  1S0V A;  2X7R B;  3H01 A;  4H33 A;  4FZL A;  4XDJ A;  1QR9 A;  3JD2 A;  2F77 X;  1F4M A;  1WLE A;  3ASO C;  3OPX A;  4UVB A;  2EIM C;  4QJF B;  2H94 A;  2A3V A;  1P4R A;  4WJ3 B;  3CXC U;  2H3Z A;  4ICA A;  2P67 A;  3K08 A;  4JPR A;  4OJL A;  2F8L A;  2QM7 A;  1DTO A;  5HFM A;  2CN1 A;  2KKP A;  3QO7 A;  1NH2 B;  4PA4 A;  2DWE C;  1H38 A;  3ZCC A;  2OXO A;  4N23 A;  2XAF A;  2IU0 A;  2KHV A;  4XBF A;  1YJ9 V;  1YHQ V;  2DW4 A;  4MVZ A;  3IG5 A;  2XOK G;  3OGC C;  2JMG A;  2P6J A;  3AG4 C;  2ITC C;  5BZB A;  1VQ5 V;  4P0Q A;  1NBM G;  4UUJ C;  1V55 B;  1XL6 A;  1AJQ A;  4BIU A;  3OR6 C;  4DXW A;  3MD0 A;  5L3C A;  3PST A;  2WLI A;  1S72 V;  1NJI W;  2JK5 C;  2G5H B;  4HYO A;  1Y66 A;  4O3M A;  1F4N A;  2HLD G;  2CPR A;  3L3F X;  1VQ4 V;  2JH7 A;  1Q7Y W;  3ETE A;  3X2Q C;  3NRW A;  2HMX A;  2KIC A;  4X8A A;  1NQT A;  1YIT V;  3LSS A;  1BL8 A;  2H3I A;  2B5U A;  2K4H A;  4OJP A;  1HEK A;  3LSQ A;  2DQ3 A;  3AL0 B;  4PA6 A;  3ASN B;  5LGT A;  1NVP B;  5KUM A;  2WB1 F;  2IJH A;  1OCO B;  3PSF A;  3ZJZ A;  3K0G A;  4RAI A;  2WLL B;  3ZRW B;  2ZXH A;  2Y0S F;  1DF4 A;  2JEU A;  2P7T C;  4JTA B;  4MW8 A;  4WCE V;  4UV8 A;  2CK3 G;  3CP8 A;  1THZ A;  3EHB B;  3NXS A;  4PEL A;  2WLM A;  2ZR2 A;  1FXV A;  2R9R B;  4JTC B;  3OMA B;  3K1Z A;  3N7S C;  1NR7 A;  1RPO A;  1ZWI C;  3OUS A;  1RM1 C;  1PKX A;  1FFT B;  5EC1 C;  4FMT A;  4KX3 A;  2Q4T A;  4C0Z A;  3ABL B;  2YEV A;  3ZRV A;  5B3S C;  3TCU A;  1QLE C;  4L87 A;  2K8A A;  2KEY A;  2HBJ A;  1R3J C;  1PD3 A;  2DYS C;  4JAU A;  2EIL C;  1KKD A;  3ZMS A;  2UXN A;  3ABT A;  1KC8 W;  1K73 W;  2PMZ C;  5IYC O;  4P30 A;  4P0P B;  1NH2 D;  3DEE A;  2FTK A;  2K1E A;  2LHT A;  1TUE B;  2OH2 A;  3T4Z A;  1S5H C;  5B1N A;  4RQF A;  1QVG U;  2LYA A;  3D2S A;  3F53 A;  3OE7 G;  1JQ0 A;  1ZQ1 C;  1SER A;  3LDE A;  5E1A C;  2XND G;  3RFA A;  2IH1 C;  1WUD A;  1F23 A;  2EIN C;  1L6N A;  2KKV A;  1MG1 A;  2BDU A;  4HZ3 A;  5EC2 C;  1A6S A;  4MSW C;  4RUF A;  4ACO A;  3ASO B;  2DQ0 A;  1RPR A;  2X0L A;  3ZMV A;  1QBZ A;  1K5Q A;  3SPI A;  1M57 C;  3CC4 V;  4JMU A;  2JJ1 G;  3WG7 B;  3SYA A;  2WPD G;  3CCV V;  1NVP D;  2N1R A;  1J95 A;  4PL2 A;  1SRY A;  3CCU V;  1VQP V;  4TSF G;  4G2K A;  1VQ9 V;  1VQ6 V;  3D2Q A;  5CBF A;  3W7U A;  1GM7 A;  2YB4 A;  2K8B B;  1YI2 V;  1KD1 W;  3AG4 B;  3W7W A;  1CEZ A;  5DM6 V;  5T14 A;  3T4D A;  1IXM A;  3FYI B;  5HFL A;  2F2A B;  4WFH A;  3SYC A;  2V1D A;  3GU3 A;  3LYS A;  3CME V;  4U6P A;  1CRX A;  2OM6 A;  1LNQ A;  1QR8 A;  2WWW A;  2UXX A;  3SAG A;  1OZ0 A;  2KOB A;  4MT8 A;  3F2C A;  1DF5 A;  2ZIV B;  2DYR B;  2Q68 A;  2EIJ C;  3X2Q B;  3GZF A;  1M9N A;  3AG1 B;  2BOC C;  3F7Y C;  3FB6 C;  3IFX A;  4QNH B;  1M56 C;  3LNM B;  2GSM B;  2H3Q A;  3TET A;  2Y0S C;  1PVQ A;  2K4E A;  2ZXI A;  2A9H A;  3JD0 A;  1PVP A;  2A0L A;  3K03 A;  1GTO A;  3KFU F;  1AI7 A;  3GWO A;  3RF9 A;  3K06 A;  2YX8 A;  1VQN V;  2JEX A;  3T79 A;  3QO5 A;  4PA7 A;  4G28 B;  2ZQM A;  3MGV A;  4Z1M G;  1G4Y B;  1CPY A;  3E86 A;  3CP1 A;  2WAQ F;  4P2Z A;  4PL1 A;  2MRL A;  3KG2 A;  3AG2 B;  4MVR A;  1HWY A;  3VOU A;  3ZRX A;  2QM8 A;  2WLI B;  4OJ6 A;  3MHH C;  5L3D A;  4CZZ A;  1UJW B;  4EKW A;  4WFF A;  3F5A A;  5KA5 A;  5B1A C;  2HVJ C;  4BAY A;  4MVO A;  2ZDI A;  3E83 A;  3ICX A;  2G07 A;  2XIC A;  1NR1 A;  2Q67 A;  1VQ7 V;  2EZP A;  3B8N A;  2B1I A;  1ROP A;  1VQK V;  1R73 A;  2C2A A;  1QLE B;  5B3S B;  2DYS B;  2AHZ A;  3CMA V;  2D3O W;  4QPJ A;  2EIL B;  2QA4 V;  1P7B A;  3LUT B;  1BMF G;  1SES A;  3GB7 C;  1GMG A;  3CCM V;  1YJN V;  1PNK A;  4HAM A;  2YSU B;  4U7C A;  3JYC A;  3UM7 A;  3R65 A;  3OMI B;  3I56 V;  3JD1 A;  2W04 A;  2JJ2 G;  1Q86 W;  2H3V A;  3ALR A;  5IDJ A;  2ZDI C;  2Q6A A;  3AG3 C;  1YT3 A;  1NKD A;  1VQ8 V;  2GHY A;  2H8P C;  3HKZ F;  3B77 A;  3SYP A;  5C93 A;  4LP8 A;  4A8E A;  2WLN A;  3QO8 A;  2ZD9 A;  2XAH A;  3SYO A;  2YEV B;  3FB5 C;  3E35 A;  2QE7 G;  2KB1 A;  3ABK C;  1DRG A;  1ECW A;  4OJ5 A;  3B8M A;  3VC8 A;  3DGE A;  4P9O A;  4R8C A;  1S76 D;  1FS0 G;  3CYO A;  1QLN A;  1W0K G;  2HKO A;  2XAG A;  2AHY A;  3D3I A;  2G5I B;  1KP2 A;  1VQO V;  1M57 B;  3CCR V;  1D8B A;  2G08 A;  1UPH A;  2D6F C;  2M7W A;  3OEH G;  1NZB A;  1Q3U A;  1Q3V A;  1H8E G;  1V54 C;  3FB8 C;  3HPL C;  5B1B C;  4XDK A;  1T94 A;  1JOY A;  5DN6 G;  4NLB A;  1XO0 A;  4KMO B;  4GX0 A;  2OTL V;  4FE3 A;  2HOQ A;  5IYD O;  4QIW C;  2ZIX A;  4PDV A;  1EZJ A;  4MVQ A;  5EBW C;  2DGZ A;  2IH3 C;  5C0Y A;  4MTG A;  4UVA A;  3ZMU A;  4CRX A;  2LFR A;  4JF3 A;  3AEI A;  2IW5 A;  4PDR A;  1SET A;  3K9A A;  1VQM V;  2LFS A;  3E8B A;  2PI4 A;  2QKS A;  1YIJ V;  3SPC A;  3M6K A;  3ETD A;  2ATK C;  3JD4 A;  4H37 A;  5HR7 A;  2HOF A;  2XVT A;  4FZM A;  3FYE B;  5H6R A;  2KV2 A;  1GM8 A;  3RBZ A;  3CC7 V;  2ZIU B;  4FZN A;  3PJS K;  4BW5 A;  3CCQ V;  2EIJ B;  1AR1 B;  2WAM A;  3C29 A;  2XAJ A;  2OYY A;  1Z19 A;  3CPW U;  3A0R A;  1M56 B;  2WLL A;  2ZR3 A;  1I5X A;  4G27 B;  1E79 G;  1F51 A;  1K92 A;  3VBB A;  1P7D A;  2XID A;  4GX1 A;  1W2B U;  2WAQ C;  4AYB F;  1OCC C;  2HR3 A;  4MTF A;  2VIX A;  2EIM B;  2ZIW A;  5CRX A;  3K3W A;  1FXH A;  2JHD A;  1G8M A;  1K33 A;  2OT5 A;  3ONN A;  2F43 G;  3E89 A;  4LCU C;  3CC2 V;  4RO2 A;  4XDL A;  5L3B A;  3F2D A;  1K8A W;  4GT1 A;  2NNU A;  2YB1 A;  4LC1 A;  3SPJ A;  5B1A B;  2A79 B;  4MVU A;  1Z1B A;  4F4L A;  1PNM A;  3G4S V;  3M6Z A;  1GM9 A;  4FPP A;  3F5W C;  3WFV A;  3CCL V;  3SMV A;  4P0P A;  2EIK C;  1JVM A;  2W6J G;  5FL7 G;  2IJJ A;  5H9C A;  4IC9 A;  1MSW D;  3IP4 B;  3P30 A;  4PDM A;  4JTD B;  3OM3 B;  2HBM A;  3OEE G;  5HR6 A;  1SZH A;  1YJW V;  3N7R C;  2GH1 A;  1M90 W;  2X6C A;  1JJ2 U;  4KFM A;  4X88 A;  2HBK A;  3I55 V;  2OCC C;  4FIP C;  1K7D A;  2KD1 A;  2WB1 C;  3SAF A;  4X89 A;  3ABL C;  5IY5 C;  3H0R B;  1EFR G;  5EBL C;  3AG3 B;  1OCZ C;  2ZG6 A;  1FXK A;  1A0P A;  2RHF A;  4MW3 A;  4UXN A;  2Z5U A;  3G71 V;  5KUK A;  1ORQ C;  3RW0 A;  2QTO A;  4JAV A;  2K89 A;  2JGA A;  1PNL A;  4CDG A;  2NV3 A;  3IG8 A;  4P0Q B;  2OTJ V;  1BHB A;  2IJI A;  2G06 A;  3D36 A;  3ZN0 A;  3LVW A;  2PMZ F;  1B6Q A;  3D2N A;  3ABU A;  3P32 A;  3EFF K;  4WFB V;  1KP3 A;  1K34 A;  3IN5 A;  3ABM C;  2WLH A;  3W7T A;  1N8R W;  1K4D C;  1RM1 B;  4WFG A;  1AI4 A;  3DTU B;  5KL8 B;  4JYC A;  2KJ8 A;  2F76 X;  1XL4 A;  1PVR A;  1V54 B;  5B1B B;  4JYB A;  4J9Y B;  2E5S A;  2B1G A;  4TWK A;  5CN0 A;  2CRX A;  2V7Q G;  2K4I A;  2W03 A;  1MOF A;  1K4C C;  3F5E A;  1FXK C;  2H3F A;  3HB3 B;  1OCR C;  2M0N A;  4YXW G;  3RVY A;  3JCZ A;  2Y69 C;  3K0D A;  1OUQ A;  4BUG A;  1KBU A;  2JH1 A;  4CGZ A;  5LGU A;  4R7C A;  4FK5 C;  3AQF A;  3WG7 C;  3KZX A;  2W6I G;  4UV9 A;  2ZIV A;  1AJP A;  2WSS G;  3UKM A;  4ZBM A;  5H6Q A;  3ZN1 A;  4QE9 A;  3CCS V;  1JPX A;  1KQS U;  1SZT A;  1EBO A;  3CYM A;  1K3E A;  3E0F A;  2IJK A;  3SYQ A;  1OHH G;  4AYB C;  4GCZ A;  1VQL V;  4DO2 A;  3VCB A;  5L3F A;  2EIN B;  4LBE C;  2LKY A;  4OJO A;  1AI6 A;  1BHA A;  2XI9 A;  1ARO P;  1I5Y A;  4E2L A;  1YTF B;  3PSI A;  3H0M B;  3PZP A;  2HVK C;  1URJ A;  2ZIX B;  1OCC B;  3CCJ V;  1IIP A;  3SJQ C;  3SPG A;  2Z7J A;  3CCE V;  4P9P A;  2EZO A;  4CBC A;  3SAH A;  3RVZ A;  1AJN A;  4GFJ A;  2DYR C;  2EJR A;  2HFE C;  2ZXW C;  3AG1 C;  2VKQ A;  4MTO A;  1ED1 A;  3C28 A;  3T2M A;  3STL C;  2KHQ A;  4NWI A;  1YSC A;  2VJ4 A;  1GKF A;  1E1Q G;  4JAS A;  2Z3Y A;  5A0L A;  4MVS A;  4TT3 G;  5LBQ A;  3SPH A;  3BEH A;  2LYB A;  2W7O A;  1QCE A;  1JCH A;  2EIK B;  1Q81 W;  5EBM C;  3ML0 A;  1ENV A;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...