4QIWF

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 37
structure length 122
sequence length 122
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qiwF02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qiwF01
2HBJA 2HBMA 4OO1J 3SAHA 4CGZA 4O3MA 2RRDA 3SAGA 2CPRA 2RHFA 1YT3A 2E1EA 4QJFB 2HBKA 1D8BA 4NLCA 4CDGA 4NLBA 3SAFA 2E1FA 1WUDA 4QIWF 3CYMA 1GO3F 2DGZA 2MA1A 2KV2A 5C0YA 2HBLA
chains in the Genus database with same CATH superfamily
4Q8EA 2QSAA 2EIJC 1ZQ1C 4CCHA 9ICGA 5F2VO 3J81N 1J5EO 7ICRA 2IBZH 2L35A 3UCSC 2EZXA 5KMGA 4PL1A 4F5RA 5DQGA 4PZNA 4RPZA 3L75H 2KHQA 4BXOB 3K9SA 4PA7A 5KFEA 5CWRA 4QWEA 1QQ7A 1NNLA 3WKCA 1V9PA 3T1YO 1KW4A 3Q8SB 2QM4A 5L3GA 9ICIA 2BPFA 2FTKA 2JR5A 4F6RB 1DXSA 4WFHA 3FAVB 2AGOA 1QCEA 3SPIA 2YDEA 4QIWF 2AHYA 4RNOA 3IDWA 1L5UA 1HNWO 2YICA 4CE6A 1MSDA 4FZ1A 4O3OA 5D5QA 2J6UA 3CWBH 2ZJAA 3ETEA 4MFAA 1M6YA 8ICKA 2Z0AA 5KFSA 5CB4B 2KD1A 4X8AA 1JRPA 2QKCA 1BQ0A 5IIKA 4F5NA 2ZIWB 4F5OA 1T3NA 3ZN0A 5G5GA 3LSSA 2C28A 9ICNA 1UHUA 1R3KC 3M9OB 4KLDA 3NRZA 4F4XA 3T5JA 4MF8A 3N28A 1HW7A 4NXNO 3WK7A 9ICEA 3A0RA 4JZGA 5L1MA 3ISDA 2IHMA 4H44B 1QLNA 3GIJA 8ICLA 2IHNA 3NVVA 2HBLA 1A0PA 1VEWA 5ALRA 1D2DA 5HHHA 4HBNA 3HP6A 1FFUA 2GBOA 2C2RA 4J9SA 3QZ7A 3JD2A 4IQTA 1NZ6A 3QZ8A 3WG7C 4LF7B 3ABMC 1Q81W 1PPJH 8ICHA 1K1SA 4M9GA 5EWGA 2Y9TA 4JV1A 2R9RB 1Z2GA 2V1DA 5FLXN 5ALFA 3BQ2A 1ZQWA 3QUCA 4DSJA 2YUAA 1JIHA 3JSNA 1BPBA 1LV5A 3O0FA 1A6SA 4IL6U 3RR8A 1HNZO 2P7TC 1SQQH 2FB5A 4YJ3B 1S5LZ 1UQVA 5J2UB 4PZOA 5JTIA 2AXTZ 2RMKB 8ICWA 5AM1A 3K5NA 1NK7A 4FLXA 4F2RA 3DEEA 4WFAV 3V6JA 2OEHA 3SAHA 1KP2A 1Z4OA 3AK2A 1Z1VA 2M6YA 3BVOA 1AILA 4IR9A 3QEAZ 2DOSA 4G9BA 2G38A 4GCZA 1R3LC 4P0PB 1ZL8B 4NXNB 8ICCA 2ZUBA 4Z6DA 3WKDA 5KHJA 3QU4A 1AB3A 2EINB 1IURA 1Q43A 4NYKA 2K89A 5J2GA 2YQEA 4Q44A 4O3RA 2FL4A 4LF4B 4YIOA 4YY3B 3HKDA 1H8HG 1RYRA 3I5DA 5KLVH 2PGGA 3CC2V 4Y2YA 3HKCA 2UUCB 2YN4A 2K4EA 4Q45A 1YJWV 2KG7A 2FMPA 3G6XA 4RQ7A 5K1PA 2ETNA 2ISOA 1XILA 2BPCA 5DBCA 3QO5A 4KLUA 5KAFZ 2X7RB 1NK4A 4DR5B 4JYAO 3CNHA 2OTLV 3AG4C 4XA5A 3IM1A 4MSWC 1O9HA 1Q86W 4JAVA 4DRXB 2XVTA 2QKQA 4GKJO 3CD6V 3BS7A 1AVMA 3QU9A 1X9MA 3UT5A 4Y2PA 2W9MA 1ZQOA 2LQTA 5IY5C 1O03A 1N34O 1WYGA 4DV0B 1W2BU 1U9LA 4OPHA 4FPPA 5AICA 4C4TA 1QQ5A 5GTIU 3GIKA 2G06A 2EDUA 2UXBO 3FB6C 7ICIA 4UBCA 5DQHA 5CBHA 4I2FA 1NH2B 4DF4A 2NV3A 4ELUA 2K8AA 3NXSA 2YTUA 3PW2A 5IT9N 1SGGA 2ALZA 5HR6A 4DLEA 3IG8A 3ZDBA 1JJOA 2EIMB 3KZIZ 1L6NA 3MR5A 3RTVA 4QPKA 2YX8A 4LFCB 2KG5A 4YD1A 4JYAB 1QH9A 1XWLA 4DLGA 4DR1O 3TANA 4HAMA 7ICPA 1KKCA 4QZDA 5CRXA 1XI1A 4AHCA 3DTUB 3GV7B 1BPZA 5JVDA 3TARA 1Y74A 2BE3A 4KHPB 4O2BB 2HCFA 2OCHA 2R9AA 3G4SV 2DE0X 3MFHA 5A9GA 3TAPA 4KFMA 4Q20A 3AG3B 3MR3A 3N7SC 1IXBA 4KMUA 2XCPA 1GN3A 1QBZA 3OEHG 3F53A 4DSFA 5KFFA 1BVSA 3QXGA 1XHXA 4DR7O 2W8LA 4KLGA 2LW7A 1ZQSA 2QB1A 9ICMA 1Z00B 2GLEA 4KUMA 3ZRXA 4YHHB 4I50B 4UAVA 1Z5VA 4MHVA 2F95B 4QNHB 4YJ2A 4NXMB 2Q4PA 5LYJA 1BZKA 1AI7A 4GKKB 4I2HA 4HYOA 3SDLA 1M9NA 1X9SA 3I1YA 3QVNA 1X6JA 4UCOA 4CH4A 2F4VO 4UB3A 2WLIA 5L3DA 4OJ5A 4CDGA 5ALVA 1JUDA 3J7AU 4TURA 1V55C 1AR5A 3VCBA 1GM7A 3LWMA 3IFXA 1YCIA 1J5EB 1PVPA 1VQ6V 1BHAA 5L3EA 3QEBZ 1QVGU 3Q8LA 1P7GA 3CRCA 2F44A 4EBCA 4QZBA 4M6WB 9ICTA 4P4PA 8ICJA 4JI5O 3CPWU 4KN4A 4NXZA 3OPXA 3T5KA 3CCMV 4LF8B 2KZMA 2L5YA 3L74H 3UMGA 3AG7A 1DTOA 1YT3A 1N63A 3U26A 5J2EA 1ZLZA 3C3TA 3HWTA 5B3SB 1MA1A 1K7DA 4GKKO 3B09A 4LCUC 5IYCO 3BY6A 4MVMA 4TUSA 1MMMA 2UUBO 2OT5A 2ZE7A 4P30A 3LK9A 2ODMA 5FL7G 2OWOA 5AI8A 2UUCO 4K0KB 3RYIB 1O08A 1BNPA 4B3MO 1QR8A 4FVMA 5J2TB 3RB3A 3AK3A 5HNKA 3CMAV 3MHSC 2XAQA 4FK5C 3M7DA 4O3NA 1VQ9V 4LF5B 5IJ9B 2PXIA 4UB6U 4K8ZA 4RAIA 4CBCA 1QVFU 2PFNA 2VS0A 3JASB 3JAWA 5H6RA 1VDVA 8ICXA 1F51A 2RDIA 2PI4A 3SJBC 3FAHA 2BOBC 3RJKA 2FLLA 2BSKB 1MC8A 1S0OA 1OCZC 3MFIA 3D3IA 1S97A 1H2SB 3RRHA 1ROPA 2KG7B 4P2ZA 2VQEB 5KFQA 3ORYA 3B0XA 4DR3B 1QTMA 1BHBA 5DBAA 4NLGA 2H3FA 4RQNA 1E1RG 2RNBA 5KFIA 3GV5B 4UB5A 2Y48A 3VC8A 2WF9A 3HKZC 4JPRA 2EZZA 3OEEG 4NVPA 5KFTA 2WF7A 1M57B 1VP7A 3I76A 5DB6A 2VA3A 5ALTA 3OT7A 4AP9A 3PJSK 1OCCC 1VLBA 2Y4UA 5AI4A 4EB6B 3TXQA 1KN5A 1MQ2A 4DSEA 4YMOA 4LFBO 5AIAA 3WKBA 3OUSA 3T1HB 1N32O 3K1RB 4UB1A 1NK0A 1GN6A 4LBEC 1X9XA 2MU2A 3QNEA 3J80N 4AYBC 5ALQA 3GILA 1WCNA 5KHIA 1Q7YW 4EX6A 4TQDA 4RUEA 5LOVA 4IRCA 1BE3H 4W4KA 1M90W 1OCZB 1H2MA 2L6LA 2P66A 4O4JA 2HHVA 4UB8Z 1XMOB 2YI9A 2FI1A 1RP3B 2N74A 1HDJA 3CS5A 4JV0A 4YHHO 3MGHA 3APOA 3HKDB 5KFOA 1SKSA 4RQ4A 3FB7C 1LKYA 1W0JG 2JH7A 1X40A 1F0MA 4UW9A 1FD9A 1K4DC 3SAFA 5KFRA 1XOUA 3WK5A 2EAMA 4JWMA 3JATA 5IIOA 3E35A 2XAFA 2BQRA 4ELVA 4ZOLB 3V6HA 1IX9A 1B4FA 8ICOA 2IOFK 3CX5F 5KT7A 1JXLA 4EENA 4IRDA 2CK3G 5C93A 2P5OA 4I2GA 2GSMB 3LDCA 2KIWA 1NBMG 2KKVA 3MAQA 1FXHA 3JD1A 4DFKA 4DFMA 3RH4A 3L73H 2QWRB 4RQ5A 3SYOA 3Q8KA 1XBLA 4NWIA 3BZCA 2HHWA 5JH7B 5IWAO 3C1ZA 1KD1W 1HNZB 5J2TA 2Q67A 2QWPB 3CCLV 5KT3A 1Q3UA 3OTOB 5J2BA 2JV3A 2W9BA 4PH5A 3UPQA 2DYRC 2F2AB 1ZRNA 5EE3A 2VWKA 3R9KA 1ZQBA 2FLNA 2ILMA 1TAUA 3PSTA 3BA9A 5C8YB 2JS5A 2KFNA 3BAAA 3FC4A 4JI3B 3RBDA 4YVZA 2ATLA 2JRZA 9ICSA 4GX1A 2Q7EA 5KT5A 2XNDG 3ABMB 2CXYA 1KRPA 4Z2WA 3FDSA 1KKXA 1AI6A 1WCLA 4MS2A 5C8YA 2W8KA 4F6RA 3WB1A 2IOFA 1V97A 4B9LA 2LYAA 4DV1B 5KFWA 3X2QC 2OH2A 1K97A 4Y2QA 3HPOA 4R50A 1PD3A 1K4CC 2Y4TA 4FBUA 5AKHA 1NVPB 1H38A 3RF9A 2DL0A 2WLNA 2WLMA 2YS8A 1K1QA 2A1JA 2KIVA 2W9CB 4ZKIA 1OXJA 3GQCA 3P3NA 1OCOB 2ASJA 7ICHA 3APQA 4NL9C 1ZD2P 1AJPA 3MR6A 4UCRA 4J41A 2FJ6A 1NK5A 4F6EA 2WAMA 3C90A 5KUMA 4P2HA 5J2IA 4M9HA 4R8UB 1JR9A 4HAIA 4CF5A 4RT3A 1VF6A 1CUKA 5CA1B 3SR2C 4CF3A 2HMXA 1LVHA 4ECUA 5IIIA 1NI8A 3B2EE 1TA8A 2E1EA 5KFNA 1ZQGA 3LDEA 3LWLA 1QQCA 1UA1A 5KAIZ 2J6TA 2A19A 7ICJA 9ICBA 3FB8C 4IS7A 5AHXA 4N21A 3HPLC 1UT8A 3V7LA 4X65B 4ED7A 9ICQA 2KJ5A 5AKLA 1COWG 1FYJA 3ABKC 1SV4A 5GONA 2ZKOA 4WFEA 1RYSA 4YR0A 1S77D 4DR2O 3A2FA 4O4JB 1FIQA 7ICSA 3S3XA 1Q46A 2WLLA 3K04A 3OHBA 1EFRG 2YIBD 2DF4B 3CE2A 1C20A 1NVPD 3KHHA 1XO1A 1NK8A 1D9DA 2D2CB 2DKXA 5IILA 5KFVA 3GVMA 3RYFB 2ITCC 3K4GA 1SKVA 3ZHTA 1VQ8V 1BGXT 1XNSA 2KK0A 3ZD8A 5KX5B 1FS0G 3B8MA 3UT5B 2NRZA 3E89A 4DQQA 2LBOA 4ED6A 3PW0A 4J9YB 3HKEB 5ALZA 1IM4A 8ICNA 1SIJA 1GM8A 3OJSA 1XEQA 2C2EA 2CH7A 3N2GB 4A5UB 1NKCA 3AEIA 4NV0A 4US9A 2E5LO 4HNAA 2K8CB 4DW0A 4KXRA 1FFVA 1ZQQA 3HB3B 1NTMH 2JZBA 3AQFA 5L3FA 4QWCA 5BY1A 1LUWA 1ZYQA 2VQFO 3ZRVA 5DDMA 4M04A 2Q7HA 5JJEB 4LF9B 4EELA 5L3BA 2CH7B 4YXJA 1TK5A 1YITV 1N48A 4YN4A 4YXWG 2XASA 4LZDA 3QYPA 4HZ3A 1X59A 1TKDA 4KLSA 1SZHA 1JX4A 5JH7A 3EXAA 4O9MA 2AHZA 2PFOA 5JVDB 3IGAC 2A9HA 1QHTA 2EILB 2ZD9A 4DV6B 2DYSC 3MDAA 4K4GA 8ICYA 5B66U 4RWUA 5EZYB 5KA6A 1HNXO 4I0XA 3NGDA 5EK0A 2HKOA 4AI8A 3W7TA 2GUZA 4XBFA 5HHIA 2HHSA 7ICOA 1N0JA 1TVKB 3C21A 4F4ZA 4DO9A 4DOAA 3Q4HB 2QEXV 2GH1A 5J2CA 4GC7A 3CRQA 2EJRA 4J9PA 2A1JB 2W9CA 4NL9A 1FKAO 1L8LA 1BPXA 8ICBA 1V55B 2XO7A 4EBEA 1P4RA 3JATB 5KHGA 3E8BA 4D6TH 2G09A 3OUFA 1CEZA 2LJ2A 4YJ2B 3D2SA 3ZMSA 1L7OA 3JAMN 5DLFA 4F50A 2WTFA 3OGIB 4PDRA 3BFRA 3W7UA 1ZQRA 3LUTB 4CGZA 3QUTA 4KTQA 2P22C 4M0AA 4DR7B 4RUAA 4FZ0A 3Q8MA 1IBLB 2E8OA 3BZKA 3H8SA 2VJ5A 9ICRA 1SWWA 2I5HA 2WF8A 3Q8QB 3I55V 1ZQLA 5CB1A 4DV3O 2XUMA 1L7NA 4QZ9A 1IV8A 2XY6A 1AP5A 2B1GA 5L3CA 5JU5A 2O57A 3NS1A 3DC6A 3H1KH 3AG1B 4CH3A 3KD3A 3K5LA 5EIBC 4AILC 4DK0A 1DGJA 3CC7V 3N4MB 3G6VA 5AKJA 4DR2B 2DQNB 5JRTA 3N2KA 3UO3A 4BJQA 1JVMA 4X66O 1RSOA 4IQWA 3ONNA 4TV8B 1HIWA 4YQWA 1H2GA 1SXEA 2QM7A 1SKWA 4OX9O 4DR4O 4IL6Z 1B6QA 2UVUA 1ZTEA 4J42A 5ALIA 2ARHA 2F76X 4I55B 3TKAA 3FD9A 4O2AB 5CN0A 3AL0B 4JI6B 2HOFA 4JWNA 3R66A 1BS3A 4ECTA 1XSLA 2B5UA 3B8NA 4J03A 1MA7A 4MF2A 2A0LA 4Z6EA 3CJHB 2MSNA 2UXNA 1KYOF 3ABTA 5EBWC 4DK1A 2DQ3A 1GO3F 2QA4V 2QARA 4OJOA 2HG5C 1J97A 5E79U 3ZS8C 2HOIA 1XMQO 3AN1A 1YZ7A 2H3OA 5L9XA 1MG1A 1OJHA 3JASA 5GTHU 4MVUA 4R7CA 3N2GA 4I5SA 2AZ0A 3CCQV 2VQEO 1ZOLA 3J81j 4LF6B 4B3TO 3G71V 1FXKA 1NR7A 3N7PD 5LA6B 3ZHQA 5LXTB 2LFRA 3T5LA 4MVQA 3AEVA 2KJ8A 2OCCB 3U10A 3QUQA 3QG5A 4B3RO 4FFBA 2ATKC 3K5MA 2YMMA 4JV2A 1KU9A 5ITZB 1XHZA 2HLDG 1X42A 2Q6AA 5J9PC 1FAFA 2M9NA 4DL3A 2CGNA 4ZBMA 5H9CA 1R6TA 3ZEDA 1I94B 1M93A 4DFDA 3SYCA 4LF6O 3PO4A 3CHXA 2Y1IA 4IIJA 4J10A 3EWAA 4O5EA 9ICWA 1XMQB 2AU0A 2ESEA 2NR5A 4PJ0U 1B3QA 3ETQA 1GKFA 3VQYA 2GUZB 2JEIA 5EWFA 1PK3A 3RW0A 2W3SA 3VOUA 4QPJA 2R8KA 2UXCB 3JPTA 2KN7A 2ZIOA 1PK1B 2D3DA 3SPJA 3ZHSA 1M5IA 2NNUA 4ICGA 4FZMA 3TFRA 7ICLA 3BQ1A 1OCRC 3RR7A 2GTSA 2FPLA 2JGDA 4LFBB 5IJ9A 4RUFA 4X64B 2UXDB 1N0NA 2AJQA 2DYSB 2EILC 4NLNA 3QNMA 5K1XA 3PX4A 1PP9H 2Y0PA 3C2KA 4OXSA 4FM2A 4PD4F 3M8AA 3TXSA 2UU9B 4NB5A 1KUQA 1XNRB 4C4RA 4CS2A 4K4HA 3EHBB 2XY5A 4J9LA 2P4KA 3L4PA 2IOHA 2EIMC 5ALUA 1QSSA 2VJ4A 5F9LA 3WB2A 4JASA 4MEYA 4I28A 2UXCO 4NLBA 5GW7A 1XSNA 3E83A 4JI0B 1QU7A 2P35A 1Q3EA 3FB5C 2G5IB 5JJJB 2Q69A 2DUYA 5T14A 1H8EG 2ZE8A 1XNQB 5KG5A 5IJ0B 1NTKH 1ZQAA 3SQIA 3JAWB 4DRXA 1B0XA 2BQ3A 2PY5A 5DKWA 5EYPB 3AG1C 3MBYA 2RQ5A 3DXRA 5J2FA 4UVCA 5AKXA 1RPLA 2ZIXA 4DW1A 4DV4O 2P67A 5B1OA 4QGPA 3RB0A 4KITB 2XOKG 4O5CA 3RJEA 2BOCC 4DUZB 2F3NA 4YMNA 4TQFA 3VQWA 4XQ8A 4ZHQB 1WPXA 3ISCA 5L1IA 2ZM6B 3T1CA 4MT8A 2JXJA 1GRJA 1S0MA 2K60A 2YMPA 4XDLA 2ASLA 3WK6A 2XCAA 2E5SA 1SL2A 1NKDA 1PKXA 1M56B 5LA6A 3HKZF 3BQ0A 2EINC 3KFUF 3HKEA 1ZD5A 3ZCCA 4IYHA 2VRZA 5DB7A 4KLHA 2ZQMA 3IAYA 5EWEA 1XUQA 2BCCH 3BQTA 2EIJB 4PDMA 1SB3C 5AK4A 3A8TA 1D8BA 2Q5ZA 3K57A 1LNQA 4ED3A 3RB6A 1YHQV 2F8LA 5B5EZ 1U96A 4B3SO 5BR8O 2C2DA 4JTAB 3F2BA 5AIBA 4PHPA 1O9GA 1I0HA 2R8JA 3D3QA 2IU0A 3L3FX 4BIZA 1YJ9V 4R65A 4R63A 4DUYO 1N5WA 3SENA 3E58A 4ED0A 4OO1J 3KKAA 2EIKC 1LKYB 2BTQA 4DV4B 1VQKV 4ED2A 7ICKA 3SI8A 3UO2A 2IA6A 4DV3B 3ZMUA 1MZEA 2HFEC 3F5AA 3OW2U 9ICUA 2JGDB 3PN1A 8ICQA 4IGGA 1FXKC 1NQTA 4KHPO 2Q73A 4BX9C 1FJGO 5J2HA 2KV2A 4RQ0A 3L70H 4DR6O 2MUTB 5AI5A 2IU3A 1RM1C 3F7VC 1BPDA 4DEZA 2OHFA 2P06A 3G6EV 4C7UA 4AQYO 2EULA 4U7CA 2R8GA 3V6KA 1S0NA 5J2UA 4U7OA 4ECWA 5DBBA 1UJWB 1T7PA 2E74B 3FKSG 3WFVA 1N8RW 1PUZA 1R3IC 3IJ4A 1ZQFA 3E8GA 4JGSA 1ZWIC 5CP2A 2NO4A 4DV0O 3MD0A 2W7OA 1PNLA 4P0PA 4YP3A 1ZL8A 1N34B 3ETDA 4QE9A 2VA8A 2BGWA 3KOOA 1F4MA 1VQ5V 4RNNA 4LF7O 3UXNA 4DV6O 3IC7A 4J9OA 2G08A 1N2XA 2KNJA 5KAIU 1TAEA 2PUSA 1AI5A 5KT4A 1GH6A 1SQPH 2CUGA 5DB8A 5KFLA 1W0KG 4R6ZA 2NRVA 4RZRA 2ZIXB 3JPNA 2FMSA 3AG2C 3V7KA 3H01A 4LP8A 2UUAB 1ZRMA 4I2CA 2WLKA 2ZXIA 4TQSA 4C8OA 4EFBA 1XL6A 5KT6A 2UVVA 2ZXWB 1KTQA 4QZ8A 4L8JA 2W6IG 3UKMA 1PL4A 4JI7B 4U6PA 2QTSA 1WB7A 2P4VA 3PSPA 2LP7A 2KJ9A 2PI5A 1P49A 3CJHA 8ICTA 4MEXA 4JTCB 5J0TA 3KBBA 5B1AB 2ZR3A 4O0IA 2YXHA 4FMTA 1JQ0A 4EKWA 2EJ7A 2GV9A 1U47A 1H2NA 5AI6A 5KFPA 3RBZA 1RPOA 2VKQA 3WK8A 1T94A 2A3VA 4UVAA 4CNQA 3GDXA 4EBDA 4B7KA 2EANA 2WB1F 3KKAC 4RPYA 1JFFB 5LXTA 1D5AA 4RU9A 2QWQB 2W11A 2ZUDA 4Y2VA 1K5OA 4FFBB 3E22A 4LNUB 3M1YA 5IDJA 2FMLA 3Q8RB 1AJNA 2BZFA 2ISPA 4C8KA 1XQ8A 5ALJA 2ADQB 5JUMA 2RDCA 4RQ6A 4CH6A 4O3QA 5TISU 4ED8A 5HFLA 1US6A 2UXDO 3RYFA 5CA7A 4RQ8A 1UCVA 9ICHA 1RM6C 5J8YA 4JF3A 5B1BB 3KG2A 4GLXA 2G0AA 2W0FC 2HHHB 4JI6O 2XI9A 5KFDA 3ML0A 1SQXH 2HOQA 3EFFK 3H7IA 4MVZA 2QE7G 4W4LA 2LM1A 4GC6A 4PHEA 3CCEV 4B9VA 2G5HB 3BDPA 4Y2TA 1R6NA 5B66Z 2B9ZA 4YFKA 1HP8A 4Z6FA 3KZXA 4OPAA 2CN1A 1JMSA 4Y2XA 2V7QG 3R65A 2H3QA 3MABA 1Q8IA 4I4TB 4O3SA 4AQYB 3WKEA 2C2AA 1TVKA 1TE2A 2E8PA 4GXKA 1Q6HA 3T2MA 1S72V 4PV1B 5DGAA 2KSDA 4ACOA 9ICAA 1I94O 1QSYA 3CYOA 2AQ4A 1YF2A 2CTRA 1Z4NA 1PVQA 5EYPA 4UVBA 4FIPC 3ZIAG 1L7MA 3ZHVA 2HVHA 2ZNIA 3KTQA 3KCXA 4K35A 1YTFD 1AQ6A 4ECQA 2UVWA 4IC9A 2RJZA 3M7MX 3JPOA 1KBHA 4LF4O 2F1JA 1WA8B 2E1FA 3IG5A 4ECZA 4BGDA 2AH5A 3G6BA 4CZZA 1OHHG 5LMUO 4B9TA 4I55A 4YMMA 4KLJA 2AW9A 3P30A 4ECYA 4JK1A 9ICCA 2IW5A 3NVYA 3OD4A 4E0DA 4P9PA 3CW2C 4X5VA 1TK0A 4EEKA 1ZQNA 1DF5A 3D2NA 1XL4A 2H8PC 2UUAO 1IDSA 4Y2JA 2OCCC 3CCVV 3B0YA 4FLYA 2YXLA 2Q0AA 4UXNA 5D5PA 3SJAC 3WG7B 4JI7O 2DPIA 2X6AA 4GXIA 3STZC 2RHFA 4I2JA 2HJFC 4WCEV 2PFQA 1J2MA 5AK5A 4MFFA 3THOA 4DV2B 2YEVA 3UXPA 1DK3A 1SESA 1FXKB 4I7ZB 1NZPA 4F72A 3TACB 1ZQJA 7ICFA 2QR4A 1FO4A 3G80A 5HMLA 3H8JA 2LPEA 3Q8PB 4M9LA 5B1NA 2X0LA 2V4QA 5H2FZ 4J9ZB 4GKJB 2EQYA 2AQ0A 3OR6C 3LDDA 4X62B 1NOMA 4PHDA 2WA4A 5TISZ 2W9BB 4JZ2A 3C3SA 3GB7C 1ZQYA 3V72A 4F91B 3MGVA 1G1XB 5DM6V 4RQEA 1Q90D 1K8AW 4BW9A 2QTOA 1R73A 5J2AA 3H0LB 4J9QA 1S5JA 4NLCA 5L1LA 3HR0A 4DR6B 2FDRA 2PFPA 4UV9A 3D2QA 1IZ3A 1N33B 2AGQA 5AI0A 2Y0SF 4DSIA 4JI1O 1V85A 1SC5B 1JI7A 3RYHA 4OJPA 4JI2B 5EOZA 4K0KO 2DWQA 3H1LH 4J7ZA 2OTJV 4CRXA 3SZ2A 2B6GA 5LGNA 5J0PA 3ISBA 2WA3A 2Z5UA 2XHBA 5LL6Y 4NTYA 2KP7A 1VF5B 2AZ2A 2JJ2G 2KZ3A 3H0MB 4LFCO 2Q0OC 3K03A 3RYHB 5HMMA 3E22B 8ICIA 3T1YB 1TUBB 4I4TA 2RQ6A 4DV7O 3P3PA 2ZIVB 4NLKA 4BDPA 2JIZG 4F4YA 4AYBF 2ZNJA 1X6IA 3O65A 3HKBA 5BR8B 1GTOA 4KLLA 3ASOB 1Z3EB 1YJNV 1HR0B 4GYCB 4X1YB 1WAZA 3WU2Z 1M4UA 3H0RB 5J2KA 3ETGA 1R3JC 3RT3C 1SL1A 4LF9O 4LJXA 2X6CA 2VQFB 4CH5A 1T3QA 1EZJA 2KZZA 1FXVA 1RFYA 2R72A 1RZTA 8ICUA 3C5FA 3JYCA 4PA4A 4I2IA 1RXWA 1YVWA 5CEHA 1DRGA 3ZDAA 2N05A 4EYIB 4WFGA 2Y0IA 1GK9A 1JX9A 1SA0B 5ALEA 1BL8A 2Q8VA 2W0XA 2ZE6A 3TGUH 4D7TA 4KX3A 4DR5O 4K8XA 5CMUA 3F5EA 4JAAA 2IMWP 2D6FC 2IJHA 1L0LH 1JOYA 1E1QG 1UPGA 3TJTA 3M6ZA 2OIGA 4DO2A 2B0CA 8ICZA 4ECRA 1ZAUA 8ICEA 1CP9A 1F5SA 4F3OA 2KTQA 2F1MA 1JROA 2G07A 5B1BC 3W7WA 1TK8A 2NO5A 2RN9A 3SYPA 1XSPA 2DBYA 1R1BA 4ZOHC 4Z1MG 1UFIA 1TAQA 1XU4A 5KFHA 4HYKA 2KFZA 7ICEA 1SQVH 3ETRA 1JMKC 3VQXA 2KICA 4BIOA 5J0RA 1SV0A 1X66A 4UB4A 1ZQIA 1E79G 5KFUA 5DDYA 5FP0A 3ASOC 4MTGA 4MVSA 5ALKA 3HILA 2BDPA 5LHHA 2W6JG 3EPIA 4O5KA 8ICVA 3OMNB 4UUJC 4YR2A 2ES6A 5LHIA 2UXXA 2WF5A 4DR1B 1XNRO 4U3FH 2UU9O 3B9JA 3FYHA 5J8YC 4CS4A 1BMFG 1JXEA 2HHHO 3RJFA 2Q9LA 1S10A 1JFFA 2JJ1G 4I2EA 4JI8B 1T5EA 3IHQB 4QZEA 3OSPA 5HFMA 1ZQUA 3SGIA 1TFRA 4JYCA 3FYIB 4RQMA 1V54B 1VQ7V 4R64A 3B40A 5KUKA 1NZBA 1VF6C 3K79A 2Q4TA 1N36O 1HUOA 2XY7A 1BQZA 5KT2A 1SQBH 4UB6Z 1WP7A 1J2NA 2HBMA 1RQNA 1Z19A 2W43A 2LO1A 5KL8B 4MW3A 3F5TA 3RRGA 4X1IB 3U0ZA 2W03A 3T4ZA 3LNNA 4ZHQA 1OUQA 2ZE5A 5IYZB 3ZDEA 4DL5A 2PZSA 4RO2A 5F9NA 2F4VB 1EN6A 4J9MA 2P6JA 2BCVA 2CTPA 1TUBA 3KZIU 1PZNA 2AGAA 4JMUA 2E3TA 9ICLA 3H1IH 4BWJA 2R18A 3SYZA 1CRXA 5KFAA 1YEWA 2K9PA 4U3JB 2LI6A 1OCOC 3CXHF 3QX7A 4JI1B 2R9IA 4UASA 3AG4B 1AR4A 2OM6A 2NN4A 4J9KA 4R66A 2QGNA 2YXYA 2YB4A 2XC9A 5ALHA 5AM0A 4UARA 1NT2B 2NRXA 9ICKA 2B1IA 4I9QA 3ZHUA 7ICTA 1IG6A 5ALDA 1XS9D 1AP6A 5LHGA 5EBMC 3K1ZA 1SKRA 2P6UA 3T4DA 1VQMV 2ZXWC 3ETLA 3DGEA 5AKEA 2OYYA 4E4EA 1N36B 5EE1A 2WLHA 1Q3VA 2GDSA 1DK2A 1N61A 1XC9A 8ICRA 4DQPA 4Z6CA 4J9NA 1X4TA 2EZOA 3CP1A 2LYBA 2W7PA 3PMNA 2HBJA 3MDCA 1URFA 3SYQA 5IWAB 2BR0A 4KLOA 1K5SA 4TQRA 3M99B 5DN6G 5LGUA 1SXDA 1XO0A 5ALOA 1ZETA 3PW7A 4GIBA 4IHJB 3SMVA 3GIIA 1EN5A 2EIKB 2HHQA 3JD3A 3LVWA 1L3VA 4IRKA 3MDSA 3RVZA 4X9QA 3E2EA 2E8MA 2Y9UA 3D6JA 3RJHA 1Q5OA 1GN2A 3HW8A 4KN7A 4PGYA 4XUSA 1S3JA 2CDYA 2K4IA 1JPXA 4FLTA 4DL2A 2JEUA 3F2CA 4DR3O 2OCEA 2MA1A 5J29A 1NJWA 2ZIMA 1MSWD 1JN3A 3QU5A 4M2YA 1WWUA 2ZUCA 3AM9A 1OZ0A 2PYLA 2JGAA 3E0FA 1G4YB 2Z3YA 3O9OA 2F93B 8ICPA 4PDLA 3VQVA 3ZMTA 1RG6A 3AG3C 4B3RB 4PI2A 3RFAA 2PMZF 4TSFG 5E1AC 1A77A 1I08A 2JK5C 2CPRA 5J2DA 4YCXA 2MUTA 1N60A 5BXZA 5ALYA 4UBBA 3JPQA 2V4RA 3JPPA 1F7YA 1IBLO 1CI4A 1ZQCA 5JQGA 4ABMA 5J0QA 5DB9A 5KA5A 4R8UA 1F23A 4PDVA 4ZI7B 3UQ8A 5CA1A 3KHGA 2JMGA 1A32A 2K4PA 1SZPA 2HI0A 4H0LB 3OFNG 1FEZA 4PA9A 5KFZA 5KG1A 1C7YA 2LGQA 3FX7A 3QU7A 1DGSA 1NI3A 2HW3A 2HHXA 1RPRA 3EW9A 3BEHA 1EXNA 3RH5A 5DQIA 2PYJA 4QW8A 2XAHA 3QU2A 1S5LU 3L5KA 2FE9A 1BPYA 4QZFA 1H2KA 5IYBO 3IN5A 5G5HA 4D7SA 3ZHRA 1PL0A 4JV5O 2A1AA 2ITDC 2JEFA 3MR2A 3PY8A 4TWKA 3TADA 1NJZA 1SQGA 5BOLA 4HNAB 4J80A 1Y66A 2OYQA 4MFCA 4KLEA 1X2IA 1QLEC 1DF4A 2KE7A 3JPRA 4ECSA 2Q7GA 2XGQA 3ABLC 4UB8U 1KC8W 1KECA 4UCSA 2CE4A 1BPEA 1P7DA 4DF8A 3FM9A 4O4HA 4F92B 2OIEA 1U97A 4F4WA 2W3RA 1DLBA 1OCCB 4FZNA 2LW1A 3RN4A 1L1FA 3BCCH 3SAGA 5ALSA 1QR9A 1ZQZA 5KFMA 4TUPA 2F8KA 3ABKB 4UATA 1SETA 3RGBA 3TETA 3UMBA 1WN7A 3OR7C 3UM9A 4FBTA 1NKEA 2NLJC 3V7JA 4UAZA 5FNVB 5D46A 2R8HA 5EC2C 4RNMA 2RDJA 1NJYA 1WLEA 3WK4A 3LSQA 1NK6A 5J0OA 1B04A 5AKYA 8ICGA 1ZSPA 2IJJA 4KX5A 2FPKA 4MVRA 2F43G 2K4HA 5IJ0A 3JSLA 1Q6IA 1MZFA 1AI4A 1GM9A 2QDOA 4H37A 3AU6A 4RPXA 4B9NA 3K5OA 3BA8A 7ICMA 2GTAA 3UM7A 3RYCA 1YIJV 1SS3A 3RAQA 2ZTCA 1XDCA 2ZG6A 4I0XB 1GN4A 4CC5A 5LYJB 4B7EA 1KSPA 1HR0O 1WWVA 5LMNB 4C8LA 4ZOLA 3PX6A 3NTUA 5IINA 2BCUA 3QTCA 3AQEA 3I56V 5AI9A 5F3XB 3TCUA 3BQ7A 2DN9A 2AXTU 4BAYA 4G28B 1SF9A 1NJIW 1RYUA 5EE9A 4OJLA 3KHLA 1F4NA 3JALA 3RB4A 1ZJNA 3C2MA 7ICGA 1YI2V 2QB0B 2HBKA 2WAQF 4TV9A 4ZI7A 2F1HA 4M6WA 1IIPA 2IJKA 2BCRA 4DCCA 4DSKA 4Q43A 1ZQPA 4ECXA 3CYMA 1SQFA 4MTFA 2HSZA 2JRIA 2K8BB 2GHYA 3K0DA 2W54A 2NRWA 3GWKC 3T5HA 4G27B 5KG7A 1AJQA 4JI2O 4KLQA 1L7PA 1V38A 1S9FA 2ZDIA 2ADPA 3UMCA 4EZ9A 5KTQA 3K9AA 2IBKA 1LR1A 5H6QA 3SPGA 4YXMA 2DYRB 2QARB 1Q8KA 3UXOA 3WKAA 5CBFA 2LGWA 4JAUA 3P32A 4P0QB 5KFYA 3L9DA 1KFDA 2F66C 2XT9A 3U11A 1N5XA 4UAWA 2DWDC 4X89A 1TAMA 2GWSA 2DMXA 2YC0A 4P9OA 4JI4O 2BCSA 1XNQO 3ASNB 2B21A 4UFZA 3H8MA 4DUYB 4JI3O 3M8RA 5CA0A 4FZLA 1BGYH 1RQLA 5ALLA 2UXBB 5HP4A 4C7YA 1SZTA 1SA0A 4F93B 3OE7G 3OAAG 2A79B 1Y6XA 5KG6A 2MW2B 3TK1A 5LBQA 4WJ3B 4X62O 4JUZA 1UPHA 5BPCA 1F44A 1MOFA 4NR1A 3ZRWB 5KG4A 1OV9A 4RQ2A 4X64O 4NKGB 1YZBA 2QWNB 4DV7B 5KG2A 2P90A 3ABLB 1VJ5A 3IP4B 1SL0A 4JB3A 4PHAA 2HEPA 4PJ0Z 5KNIA 2BQUA 5DECA 3M6KA 4QWBA 9ICJA 2KKPA 2BPGA 3E86A 1YDXA 2KQXA 4FM0A 4BUGA 3PSFA 4FO6A 1MABG 2PMZC 5DGBA 5KHKA 1BSMA 3BHPA 5IY5B 1S5HC 5A2QN 3PZPA 4UCVA 2VANA 2EX3A 2CAZC 3EUB2 3ED5A 4E2LA 1NU1H 5JWPA 1U48A 4DQIA 4KP4A 2UVRA 2WHEA 3SD7A 5KFXA 1L3UA 4JI0O 1EZVH 2E76B 3OTFA 1WG8A 5KFBA 4DOBA 5KX5A 5ALWA 1VQ4V 5IYDO 4FLZA 3CCSV 5C0YA 3OTQA 2LYHA 1Y67A 2XAGA 3F7YC 2YIBA 3QUBA 2KSOB 4DQRA 2RLTA 1N33O 2JS3A 4KLFA 3AK1A 4O4LA 2KMDA 4C4SA 3TI0A 5EZYA 2JDIG 1FPOA 4O3MA 8ICAA 2JEXA 5CJ7A 3ZX6A 3FYEB 5K4LA 1BCCH 3N27A 2GOLA 4FFKA 2X6BA 3ZDDA 4KMOB 2ZJ8A 4UQGA 2VIXA 1OCRB 3PNCA 4LFAO 2HR3A 2RP5A 4B3TB 3BS5A 2K1EA 3PW4A 5HR7A 3KCYA 4J7KA 1XMOO 5GTHZ 4JYYA 5AM4A 3HKBB 3AMZA 4X1KA 1SZXA 4OCZA 4XRHA 2DJVA 4DV2O 1NKBA 1TGOA 3M9MB 1N32B 1M1KW 4GXJA 4NTWA 1ORQC 1NTZH 4Q8FA 1ZQXA 4CF4A 4O4IA 3D36C 5IE9A 4EZ6A 3QF7A 1N56A 3DV9A 4H33A 5DG8A 2BSKA 1QSLA 2EBOA 4X66B 2YY6A 3Q4HA 3NR7A 2KVSA 1IBMB 1Y74B 3OHAA 4PPXA 1Q82W 2HJDA 4TUYB 4C8NA 5AM2A 1KBUA 4NM1A 3C23A 5KFJA 9ICPA 3F2DA 3JALB 4JI4B 1BT8A 2CTQA 3ABUA 5DG9A 1COOA 2J6SA 4X1IA 4MW8A 1Y76A 3OGUA 3RWRD 3JARB 4LFAB 4LVSA 2DGZA 4B9UA 1QLEB 3CXCU 3SV3A 4UV8A 2H3ZA 4MVOA 3B4SA 3D8CA 3EZ5A 9ICVA 2E8NA 3JPSA 4DS4A 1ED1A 3TAQA 2ZIUB 4X20A 2PKEA 4IQUA 4DL7A 3QO7A 2WB1C 4XDJA 4YY3O 2HHTA 4F8RA 3RJGA 3ZRWA 1B43A 2ZTDA 4FS2A 3MGIA 4QZCA 2ZDIC 4J7JA 4MTXA 3PR5B 1T4GA 3PR4A 3AUOA 4RQ3A 2F23A 3SJQC 3RYCB 3LYSA 2W04A 3HT3A 3K06A 4TT3G 5EC1C 3RFRA 3RBEA 1SRYA 1ZQDA 3W7SA 4NTXA 4PA3A 2R8IA 2I6XA 5BMVB 3C2LA 1KL9A 2FMQA 1D5NA 3SPHA 3MC1A 3DDHA 3C29A 4YIPA 4LF8O 3QE9Y 4IQVA 9ICXA 9ICOA 1U49A 2XIDA 1MQ3A 1URJA 1YZ6A 2LMRA 5LMNO 1VQLV 3FAVA 2WAQC 2AHOB 4DL4A 4MTOA 3STLC 1M57C 3THVA 3CCUV 1KB9F 4GX0A 5KG0A 3NUQA 4NY8A 3A0BU 3CP8A 5A0LA 1Z1BA 7ICQA 1KDHA 1S0VA 4I2BA 5KMGB 1JCHA 3QO8A 1VF7A 3CMEV 2EAOA 3G6YA 2W55A 2BTQB 1K9MW 4QNLA 4J9RA 1QNMA 4BXOA 2GO7A 3CEIA 4O4LB 1IXMA 1AR1B 5L1KA 3S3WA 1L8DA 3OMIB 3NASA 3WK9A 2V9WA 4RT2A 2KKWA 4KLTA 3HJEA 4BWAA 5JQGB 4TV8A 2O6KA 2ZT9B 5CR0A 3N97B 1LUVA 2JVDA 4BWMA 3LNMB 1U4BA 1PNMA 1VARA 1THZA 4EYHB 3IV6A 3ZMZA 2E5LB 3ALRA 3RJIA 4NXMO 4KLIA 3ZJZA 5J0XA 4RQFA 1BNOA 4US8A 2QB0A 3AU2A 3NVWA 1T8EA 4G3IA 3PVXA 3X2QB 2ZINA 3GWOA 4PL2A 2Q0ZX 1ZD4A 2NRTA 2ODGA 4X88A 3SJCC 1G6UA 1TUEB 1H2LA 3RJJA 1ZQVA 4P4OA 1FFXB 2DW4A 4GUNA 1KKDA 4TUQA 3DSQA 1N62A 3CRRA 5EE0A 1PM9A 1OW5A 5JCOA 5IIJA 4USAA 5GTIZ 3FFQA 1ZJMA 3E8FA 4JTDB 4UB2A 5JJNB 4JI8O 4JI5B 3K75D 2XTAA 2M0NA 1ZQTA 2IM9A 3G67A 3H4DA 1PK1A 4OD0A 3GU3A 3CC4V 5CHGA 8ICMA 2HVKC 4PHZA 1KFTA 1S76D 4DYLA 4KL1A 1FFTB 3B77A 5L1JA 4Q6GA 2WLLB 2Q68A 2EH9A 3C5GA 1IBKB 1D8YA 5H5NA 4IIJB 1EN4A 4TOIA 4X20B 4FE3A 8ICSA 3EVKA 1B22A 2DQ0A 4BR6A 2F1IA 4GZRB 1NR1A 4X1YA 4ZIBA 4QZAA 4QW9A 4EB6A 3BPZA 5AM5A 4ECVA 3E8HA 3JD4A 4F2SA 4U7NA 4Z1VA 4DUZO 1S8OA 2N04A 4NLZA 5AM3A 4ED1A 2BCQA 4I2DA 3A0HZ 2A7WA 2ZM6O 5TZVA 1HUZA 4B9SA 2Z7JA 1VIBA 3KKYA 1LB2B 2HVJC 3JARA 1WB8A 1M56C 3N7RC 2A06H 5IIMA 4G2KA 5FPOA 2VWJA 7ICNA 1ZD3A 3K0GA 3A0HU 1XREA 3JAKA 5B1AC 4WF9V 3BRCA 3W7XA 1JALA 3CCRV 2BDUA 1YSCA 1K34A 1PVRA 1HNWB 2QLTA 4C7ZA 4LNUA 1K3EA 1AROP 4R8CA 3K08A 3PMLA 3NRWA 5LP6A 5FNVA 2PTMA 1VQPV 5ALNA 3JAKB 1JJ2U 4B3SB 1IVSA 1ZQEA 1QQ6A 3EPGA 4FS1A 4DXWA 4DV5O 1JA8A 4X1KB 3H8WA 4GT1A 4C0ZA 5LGTA 1QCKA 5AKKA 3CRAA 2BTOA 4IT5A 2FYUH 1PV0A 4EFEA 3SPCA 1NK9A 2HHUA 5FPRA 2EZYA 5CA3A 4X65O 2KEYA 3GIMA 2KSOA 1Y4MA 3K58A 4PELA 3PX0A 1W59A 3CSXA 2N1RA 3C28A 2BHNA 5KFCA 2QJ1A 3TADC 3DXRB 2IJIA 2M7WA 1RSOB 4CS3A 4TUYA 4Y2UA 5ALMA 4DFJA 3S6JA 4LC1A 3ZN1A 4PA6A 2WPDG 4DSLA 5EBLC 5DG7A 5KG3A 2D3OW 9ICFA 4M9NA 1KFSA 1Z5WA 4I2AA 3NVZA 2QKSA 4U3JA 5AKGA 4JV5B 3ZD9A 4LH6A 1EM1A 5AKIA 2XAJA 2ASDA 1SWVA 4N23A 1ZQMA 4WBNA 2JEJA 5B3SC 1FFXA 1RM1B 8ICFA 3UQ2A 4K4IA 1KLNA 4C8MA 3HX0A 5ALGA 1UA0A 4DV1O 4F71A 5B5EU 2Y69C 2ZCEA 2CGOA 3UQ0A 2ZIVA 4B6JA 3RYIA 1U45A 4KLMA 4ICAA 2HVIA 4I9WA 1MNGA 1COKA 4FJCC 4LF5O 2OXOA 4O3PA 3M8SA 4GX5A 4LWSA 4UAYA 5DLGA 3ZI4A 4RUCA 3ZDCA 2KOBA 1Y88A 2NYVA 5KFGA 1DK1A 3BABA 4LZGA 1K73W 3HRDD 1Y76B 3JD0A 3PO5A 1B06A 2DFLA 4F4LA 5ITZA 3A0BZ 3BJYA 4TV9B 4GFJA 2ZR2A 5KFKA 2LHTA 1KMIZ 2YI8A 2H94A 4PI0A 2WLIB 4NM2A 1R6KA 1TVAA 5J0WA 2VA2A 1KQSU 4K3AA 4QZHA 2V4DA 2C22A 1HJPA 1GMGA 1WP8A 2ZIUA 3OTOO 4M9JA 2Y69B 4ELTA 2FKXA 5CA0B 2YMLA 1HNXB 1VQOV 2HDOA 5ALXA 4JYBA 2IH3C 1IBMO 2W9AA 3I28A 2DWEC 1WNSA 4QWAA 2Y1JA 2QWOB 1D8LA 3L71H 2RCVA 1VQNV 4P0QA 2QM8A 4I50A 2H5XA 3F5WC 5GONB 2MRLA 3ZMVA 4BW5A 5C5JA 1IXRA 1ENVA 1L0NH 2YIDA 3EYZA 3PW5A 3JCZA 1RXVA 4DFPA 3ZRSA 2JH1A 4QZGA 5BMVA 1I5XA 1L8OA 2FPMA 3SV4A 2KHVA 2WLJA 4J11A 2RRDA 2ZTEA 4DV5B 4I29A 1EBOA 2KB1A 3PV8A 2YIAA 3T3FA 4IHJA 3OJUA 1CXZB 1J95A 4QIWC 4F5QA 3N2KB 2E3CA 3SYAA 1NJXA 1K5QA 4UCTA 4UCUA 1YTFB 3HKCB 3L72H 4WFFA 4DL6A 5J0YA 1YXBA 5KHHA 5LMUB 4CC6A 2LFSA 1UT5A 5J0UA 1ZX3A 4YJ3A 2D8CA 4ZH4A 3H40A 3GFKB 2LM4A 4OGQB 1VMGA 1ZUQA 4M47A 3MHHC 4Y2SA 4B9MA 4FLWA 1SERA 4FFDA 4PGXA 1P7BA 3BS5B 1ZXIA 1KQQA 4QE7A 4OJ6A 2WSSG 2CRXA 3LSUA 4B3MB 2JZBB 4LR3A 3ASNC 3ZBHA 2MAXA 3H4BA 1ZQKA 7ICUA 1MN8A 3IRUA 1ZQHA 2H3IA 2UUBB 3VBBA 1V54C 5H2FU 2R70A 3CRMA 2I9GA 4IR1A 2YSUB 5EIBD 5LOVB 2AGPA 1CPYA 1G8MA 3D36A 1WJZA 2E75B 5D4BA 3DC5A 4L87A 3WB0A 3K59A 3PSIA 1D9FA 5ALPA 5J2JA 2XICA 5AKZA 1N4CA 4OX9B 4DR4B 3OMAB 4DQSA 2I1QA 5CBGA 3AG2B 5CB4A 4YG2A 4F4KA 4P4MA 3CB2A 5E79Z 2CTWA 5DEDA 2ZIWA 4UAUA 1ECWA 4EEQA 3GZFA 3OM3B 4LWSB 4QJFB 5J0SA 1WPBA 5BZBA 1GAXA 5KAFU 4YD2A 2IH1C 7ICVA 1L3SA 4H13B 4Y2RA 4ASUG 3RAXA 4EX7A 3RVYA 4FLVA 1K92A 5JCOC 3RH6A 4DWIA 3KHRA 3H9VA 4BIUA 4WBNB 1A76A 3LDAA 3LVVA 1KP3A 2XGPA 3SR6A 3H1HH 3TFSA 2JGUA 2ZXHA 5D49A 3GV8B 5LP6C 4O4HB 1SV0C 4DOCA 2H3VA 4PGQA 2EAPA 1K33A 2ZJ5A 5LP6B 3H1JH 3CCJV 2MK3A 2JEGA 1I5YA 1PNKA 2DPJA 2YMQA 1TV9A 4XDKA 1FJGB 2YEVB 4O2BA 4A8EA 2A3QA 1P84F 4NJ8A 5IYZA 2LKYA 3TQ1A 2PF4E 1RDFA 2WFAA 4EEYA 4FLUA 3JCUZ 5AK6A 2F77X 5KL1B 1NH2D 1I7FA 4FM1A 4IYIA 2DKZA 3ICXA 4QZIA 3CRXA 3T79A 1Q6UA 1X9WA 4DS5A 4F5PA 2Y0SC 3IC9A 5AG2A 1NS1A 2EZPA 1Z00A 2BKEA 1HWYA 2WWWA 4O2AA 2P6RA 4WFBV 4YR3A 3SEIA 2JHDA 4I27A 4LH7A 4GX2A 4B08A 5AK3A 4RQ1A 3OSNA 1DOQA 5BOMA 2FLPA 3WU2U 4C80A 2WF6A 3C1YA 3M9NB 3K3WA 1HEKA 1L3TA 4O4IB 2YB1A 1WUDA 1WA8A 1KEJA 2HP8A 1IBKO 4QWDA 2QKAA 3T1HO 3OGCC 2KVCA
chains in the Genus database with same CATH topology
3F7YC 2EIJC 3E89A 1ZQ1C 5B1NA 2X0LA 2LBOA 4J9ZB 4J9YB 2JDIG 1GM8A 3LDDA 3OR6C 4O3MA 2JEXA 4PL1A 3AEIA 4NV0A 3FYEB 2K8CB 2GOLA 2X6BA 2KHQA 4KMOB 3GB7C 2VIXA 3HB3B 1OCRB 3MGVA 4PA7A 3AQFA 5L3FA 5DM6V 2HR3A 2RP5A 4RQEA 1K8AW 2QTOA 2K1EA 5HR7A 3ZRVA 5L3GA 1R73A 3H0LB 5L3BA 2FTKA 4NLCA 1YITV 4WFHA 4UV9A 1QCEA 3D2QA 2XASA 4YXWG 3SPIA 4QIWF 4HZ3A 2AHYA 1SZHA 1M1KW 2AHZA 1ORQC 3ETEA 2Y0SF 3IGAC 2A9HA 2EILB 2ZD9A 2KD1A 2DYSC 4X8AA 5KA6A 4OJPA 2ZIWB 2OTJV 4H33A 4CRXA 5LGNA 5EK0A 3ZN0A 2EBOA 2HKOA 2Z5UA 3W7TA 3LSSA 4XBFA 2QEXV 1R3KC 1Q82W 2GH1A 2JJ2G 3H0MB 1KBUA 2EJRA 3F2DA 3A0RA 3K03A 3ABUA 4MW8A 1V55B 1P4RA 1QLNA 2ZIVB 2DGZA 3E8BA 1QLEB 3CXCU 2HBLA 1A0PA 2G09A 3OUFA 1CEZA 3D2SA 3ZMSA 2JIZG 4UV8A 2H3ZA 4AYBF 4MVOA 1GTOA 3JD2A 4PDRA 3ASOB 1YJNV 3WG7C 1ED1A 3W7UA 3LUTB 4CGZA 3ABMC 2ZIUB 3H0RB 3ETGA 1Q81W 1R3JC 3QO7A 2WB1C 4XDJA 2X6CA 2R9RB 3ZRWA 1EZJA 1FXVA 2V1DA 3JYCA 4PA4A 2ZDIC 4MTXA 2VJ5A 1DRGA 3I55V 4WFGA 3SJQC 1GK9A 3LYSA 1JX9A 2W04A 3O0FA 1A6SA 1BL8A 2B1GA 3K06A 1SRYA 2P7TC 4TT3G 5EC1C 5L3CA 3AG1B 3W7SA 4KX3A 5CMUA 3F5EA 4PA3A 3CC7V 2D6FC 2IJHA 1JOYA 1E1QG 2DQNB 3DEEA 3M6ZA 4BJQA 1JVMA 4DO2A 3SPHA 4WFAV 3ONNA 3C29A 1HIWA 3SAHA 1H2GA 1KP2A 1CP9A 2QM7A 4GCZA 1VQLV 2XIDA 1URJA 2G07A 5B1BC 1R3LC 4P0PB 3W7WA 2WAQC 1B6QA 4MTOA 3SYPA 3STLC 1M57C 2EINB 3CCUV 2F76X 4GX0A 5CN0A 2K89A 3AL0B 2HOFA 4Z1MG 3NUQA 5A0LA 3CP8A 1Z1BA 1H8HG 2B5UA 3B8NA 1S0VA 2KICA 2A0LA 1MA7A 1JCHA 3CC2V 3QO8A 2UXNA 3CMEV 2K4EA 3ABTA 5EBWC 2DQ3A 1K9MW 1GO3F 4QNLA 2QA4V 2HG5C 4OJOA 1YJWV 1E79G 2HOIA 3ASOC 4MTGA 1AR1B 1IXMA 3QO5A 4MVSA 3OMIB 1MG1A 2X7RB 4R7CA 4MVUA 4I5SA 2OTLV 3CCQV 5LHHA 3AG4C 2W6JG 4MSWC 3OMNB 1Q86W 4JAVA 4UUJC 3G71V 1FXKA 2XVTA 5LHIA 2UXXA 1NR7A 3N7PD 3LNMB 3CD6V 2LFRA 1PNMA 4MVQA 2OCCB 2KJ8A 1THZA 5IY5C 1BMFG 3ZMZA 2ATKC 3ALRA 1W2BU 4FPPA 3ZJZA 2HLDG 2JJ1G 4RQFA 2Q6AA 5J9PC 2G06A 4ZBMA 3X2QB 5HFMA 3GWOA 5H9CA 4JYCA 4PL2A 3FB6C 3FYIB 1V54B 4X88A 1VQ7V 5CBHA 3SYCA 5KUKA 1NZBA 3K79A 1NH2B 2Q4TA 1TUEB 2NV3A 3NXSA 2K8AA 2HBMA 1Z19A 5KL8B 2DW4A 4MW3A 5HR6A 1KKDA 3IG8A 2W03A 2EIMB 1GKFA 3T4ZA 1OUQA 1L6NA 4QPKA 3RW0A 2YX8A 3VOUA 4QPJA 3E8FA 4JTDB 4RO2A 2P6JA 4HAMA 2M0NA 5CRXA 3SPJA 3DTUB 2NNUA 4FZMA 4JMUA 1OCRC 3G4SV 2R18A 3GU3A 3CC4V 1CRXA 2HVKC 4RUFA 1S76D 4KFMA 4Q20A 1FFTB 1OCOC 3AG3B 3B77A 3N7SC 2DYSB 2R9IA 1QBZA 2EILC 2WLLB 2Q68A 3OEHG 3AG4B 3F53A 2OM6A 4OXSA 4FE3A 2YB4A 2DQ0A 4KUMA 3ZRXA 2B1IA 3EHBB 1NR1A 4QNHB 2EIMC 5LHGA 3E8HA 3JD4A 4U7NA 1AI7A 3K1ZA 2VJ4A 4HYOA 5EBMC 1M9NA 4JASA 3T4DA 1VQMV 2ZXWC 3DGEA 2OYYA 2WLIA 5L3DA 4OJ5A 4CDGA 2WLHA 2Z7JA 4NLBA 1Q3VA 5GW7A 2HVJC 1V55C 3VCBA 1GM7A 1M56C 2EZOA 3N7RC 3CP1A 3IFXA 4G2KA 1BHAA 1PVPA 3E83A 2LYBA 1VQ6V 5L3EA 1QVGU 3K0GA 2W7PA 2HBJA 2G5IB 3FB5C 2Q69A 5T14A 5B1AC 1H8EG 3SYQA 1K5SA 2BDUA 1YSCA 3W7XA 3CCRV 1K34A 3M99B 1PVRA 5DN6G 5LGUA 3SQIA 1XO0A 1K3EA 1AROP 4R8CA 3CPWU 3K08A 3OPXA 3SMVA 2EIKB 3AG1C 3JD3A 4FK5C 3NRWA 3LVWA 3RVZA 3CCMV 4UVCA 2ZIXA 3E2EA 1DTOA 1YT3A 1VQPV 2P67A 1JJ2U 5B1OA 5B3SB 4DXWA 1S3JA 2XOKG 2BOCC 2K4IA 1JPXA 1K7DA 4LCUC 5IYCO 2JEUA 3BY6A 3F2CA 4MVMA 4GT1A 2OT5A 4C0ZA 4P30A 2MA1A 5FL7G 5LGTA 1WPXA 1MSWD 3T1CA 4MT8A 1OZ0A 4XDLA 1QR8A 3SPCA 5CA3A 2JGAA 2KEYA 3E0FA 1G4YB 1Y4MA 2E5SA 2Z3YA 4PELA 4PDLA 1NKDA 3CMAV 3ZMTA 1PKXA 3MHSC 1M56B 2XAQA 3HKZF 2N1RA 3C28A 3M7DA 3KFUF 2EINC 3AG3C 4TSFG 3RFAA 2PMZF 1VQ9V 5E1AC 2JK5C 2CPRA 2ZQMA 2IJIA 2M7WA 4RAIA 4CBCA 4LC1A 1QVFU 3ZN1A 2EIJB 4PA6A 4PDMA 2WPDG 5H6RA 5EBLC 1D8BA 1F51A 2D3OW 1LNQA 2PI4A 1YHQV 5KA5A 1F23A 2BOBC 4PDVA 2QKSA 2F8LA 1OCZC 2JMGA 3D3IA 2XAJA 1ROPA 4JTAB 3F2BA 4N23A 3OFNG 4P2ZA 4PA9A 5B3SC 2IU0A 3L3FX 4BIZA 1RM1B 1YJ9V 1BHBA 2H3FA 1RPRA 1E1RG 3BEHA 2Y48A 4JPRA 3VC8A 4OO1J 3HKZC 2XAHA 3OEEG 2EIKC 1M57B 2Y69C 1VQKV 2ZIVA 3PJSK 5IYBO 1OCCC 3IN5A 4ICAA 3ZMUA 1PL0A 4I9WA 2HFEC 4FJCC 2OXOA 4GX5A 3F5AA 2ITDC 3OW2U 3OUSA 4TWKA 2KOBA 1FXKC 1NQTA 4LBEC 1Y66A 4BX9C 1K73W 1QLEC 3QNEA 2KV2A 4AYBC 1DF4A 3JD0A 3ABLC 1KC8W 1KECA 4F4LA 2IU3A 1RM1C 3F7VC 1Q7YW 4GFJA 2ZR2A 1P7DA 4RUEA 3G6EV 2LHTA 2H94A 2WLIB 1M90W 1R6KA 1OCZB 1KQSU 4U7CA 4U7OA 1DLBA 1OCCB 1UJWB 4FZNA 1GMGA 1L1FA 2ZIUA 2Y69B 3SAGA 1QR9A 3FKSG 3WFVA 3ABKB 1N8RW 1VQOV 1R3IC 1SETA 3TETA 3OR7C 4JYBA 2IH3C 3FB7C 1W0JG 2JH7A 3E8GA 4JGSA 2DWEC 1K4DC 1ZWIC 3SAFA 3MD0A 2W7OA 1PNLA 4P0PA 2NLJC 3ETDA 4QE9A 1F4MA 1VQ5V 1VQNV 4P0QA 2QM8A 3E35A 3F5WC 3IC7A 3ZMVA 2MRLA 2XAFA 5EC2C 1ENVA 2G08A 2KNJA 1WLEA 4BW5A 1AI5A 3LSQA 3JCZA 3ZRSA 2JH1A 1I5XA 2IJJA 4WFBV 4KX5A 1W0KG 2F43G 4MVRA 2K4HA 4R6ZA 2KHVA 2WLJA 2RRDA 1AI4A 2ZIXB 1GM9A 1EBOA 3AG2C 2CK3G 2KB1A 3H01A 4H37A 4LP8A 5C93A 2GSMB 2WLKA 2ZXIA 2KIWA 1NBMG 1J95A 4QIWC 3LDCA 2KKVA 1XL6A 3SYAA 1FXHA 1K5QA 2ZXWB 3JD1A 3UKMA 1YTFB 2W6IG 4WFFA 3UM7A 4U6PA 1YIJV 3PSPA 2LFSA 2LP7A 2KJ9A 2ZG6A 2PI5A 3SYOA 4NWIA 1KD1W 3MHHC 4JTCB 1SERA 5B1AB 2Q67A 2ZR3A 1P7BA 3CCLV 4FMTA 1JQ0A 4EKWA 1Q3UA 3B8MA 3AQEA 3I56V 4QE7A 4OJ6A 2WSSG 2CRXA 3TCUA 2DYRC 2F2AB 3RBZA 1RPOA 2VKQA 2A3VA 1T94A 3ASNC 4UVAA 4BAYA 4G28B 2WB1F 1NJIW 4OJLA 1F4NA 3PSTA 1YI2V 2HBKA 2H3IA 2WAQF 3VBBA 1V54C 1IIPA 2IJKA 5IDJA 1AJNA 2YSUB 4GX1A 4MTFA 3CYMA 3ABMB 1G8MA 1CPYA 2XNDG 3D36A 2K8BB 2GHYA 3K0DA 4L87A 4G27B 1AI6A 3PSIA 1AJQA 5HFLA 2ZDIA 2XICA 4MS2A 4WF9V 3OMAB 3K9AA 5CBGA 5H6QA 3AG2B 3SPGA 2DYRB 4JF3A 5B1BB 3KG2A 2G0AA 2W0FC 2LYAA 2ZIWA 2XI9A 3ML0A 3X2QC 2HOQA 3EFFK 5CBFA 4MVZA 2QE7G 2OH2A 1ECWA 1K97A 4JAUA 3GZFA 3OM3B 1PD3A 4P0QB 1K4CC 3P32A 4R50A 3CCEV 2G5HB 4QJFB 1R6NA 5BZBA 2DWDC 1NVPB 4X89A 1TAMA 1H38A 2IH1C 3RF9A 2WLNA 2WLMA 3KZXA 4P9OA 4ASUG 2CN1A 4ZKIA 3RVYA 3ASNB 1K92A 1OCOB 2V7QG 2H3QA 3R65A 2C2AA 1AJPA 4BIUA 4FZLA 3T2MA 3LVVA 1KP3A 1S72V 2WAMA 5KUMA 4ACOA 2ZXHA 1SZTA 3CYOA 3ZCCA 3OE7G 1PVQA 3OAAG 2A79B 4UVBA 4FIPC 2H3VA 2HMXA 3TK1A 3ZIAG 5LBQA 1K33A 4WJ3B 1UPHA 1F44A 3CCJV 1MOFA 2MK3A 2E1EA 1I5YA 3ZRWB 1PNKA 3LDEA 1YTFD 4XDKA 2YEVB 2P90A 4IC9A 3ABLB 4A8EA 3IP4B 3FB8C 2LKYA 2E1FA 4N21A 3IG5A 3M6KA 3HPLC 2KKPA 3E86A 4CZZA 1OHHG 1COWG 4BUGA 2KJ5A 2F77X 3PSFA 5KL1B 1MABG 3P30A 1NH2D 2IW5A 4P9PA 2PMZC 3ABKC 1DF5A 1XL4A 3ICXA 2H8PC 3D2NA 3CRXA 3T79A 2Y0SC 2OCCC 1S5HC 4WFEA 2EZPA 5IY5B 3CCVV 1S77D 3PZPA 2WWWA 1HWYA 4UXNA 3WG7B 2WLLA 3K04A 1EFRG 2X6AA 3STZC 4E2LA 2JHDA 2DF4B 2RHFA 2HJFC 4GX2A 4WCEV 1NVPD 4KP4A 2YEVA 3K3WA 1HEKA 2YB1A 1SESA 1FXKB 2ITCC 1WUDA 1XNSA 5IYDO 1VQ4V 1VQ8V 3CCSV 5C0YA 1FS0G 3OGCC 2XAGA 2KVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBJ A;  2HBM A;  4OO1 J;  3SAH A;  4CGZ A;  4O3M A;  2RRD A;  3SAG A;  2CPR A;  2RHF A;  1YT3 A;  2E1E A;  4QJF B;  2HBK A;  1D8B A;  4NLC A;  4CDG A;  4NLB A;  3SAF A;  2E1F A;  1WUD A;  4QIW F;  3CYM A;  1GO3 F;  2DGZ A;  2MA1 A;  2KV2 A;  5C0Y A;  2HBL A; 
#chains in the Genus database with same CATH topology
 4Q8E A;  2QSA A;  2EIJ C;  1ZQ1 C;  4CCH A;  9ICG A;  5F2V O;  3J81 N;  1J5E O;  7ICR A;  2IBZ H;  2L35 A;  3UCS C;  2EZX A;  5KMG A;  4PL1 A;  4F5R A;  5DQG A;  4PZN A;  4RPZ A;  3L75 H;  2KHQ A;  4BXO B;  3K9S A;  4PA7 A;  5KFE A;  5CWR A;  4QWE A;  1QQ7 A;  1NNL A;  3WKC A;  1V9P A;  3T1Y O;  1KW4 A;  3Q8S B;  2QM4 A;  5L3G A;  9ICI A;  2BPF A;  2FTK A;  2JR5 A;  4F6R B;  1DXS A;  4WFH A;  3FAV B;  2AGO A;  1QCE A;  3SPI A;  2YDE A;  4QIW F;  2AHY A;  4RNO A;  3IDW A;  1L5U A;  1HNW O;  2YIC A;  4CE6 A;  1MSD A;  4FZ1 A;  4O3O A;  5D5Q A;  2J6U A;  3CWB H;  2ZJA A;  3ETE A;  4MFA A;  1M6Y A;  8ICK A;  2Z0A A;  5KFS A;  5CB4 B;  2KD1 A;  4X8A A;  1JRP A;  2QKC A;  1BQ0 A;  5IIK A;  4F5N A;  2ZIW B;  4F5O A;  1T3N A;  3ZN0 A;  5G5G A;  3LSS A;  2C28 A;  9ICN A;  1UHU A;  1R3K C;  3M9O B;  4KLD A;  3NRZ A;  4F4X A;  3T5J A;  4MF8 A;  3N28 A;  1HW7 A;  4NXN O;  3WK7 A;  9ICE A;  3A0R A;  4JZG A;  5L1M A;  3ISD A;  2IHM A;  4H44 B;  1QLN A;  3GIJ A;  8ICL A;  2IHN A;  3NVV A;  2HBL A;  1A0P A;  1VEW A;  5ALR A;  1D2D A;  5HHH A;  4HBN A;  3HP6 A;  1FFU A;  2GBO A;  2C2R A;  4J9S A;  3QZ7 A;  3JD2 A;  4IQT A;  1NZ6 A;  3QZ8 A;  3WG7 C;  4LF7 B;  3ABM C;  1Q81 W;  1PPJ H;  8ICH A;  1K1S A;  4M9G A;  5EWG A;  2Y9T A;  4JV1 A;  2R9R B;  1Z2G A;  2V1D A;  5FLX N;  5ALF A;  3BQ2 A;  1ZQW A;  3QUC A;  4DSJ A;  2YUA A;  1JIH A;  3JSN A;  1BPB A;  1LV5 A;  3O0F A;  1A6S A;  4IL6 U;  3RR8 A;  1HNZ O;  2P7T C;  1SQQ H;  2FB5 A;  4YJ3 B;  1S5L Z;  1UQV A;  5J2U B;  4PZO A;  5JTI A;  2AXT Z;  2RMK B;  8ICW A;  5AM1 A;  3K5N A;  1NK7 A;  4FLX A;  4F2R A;  3DEE A;  4WFA V;  3V6J A;  2OEH A;  3SAH A;  1KP2 A;  1Z4O A;  3AK2 A;  1Z1V A;  2M6Y A;  3BVO A;  1AIL A;  4IR9 A;  3QEA Z;  2DOS A;  4G9B A;  2G38 A;  4GCZ A;  1R3L C;  4P0P B;  1ZL8 B;  4NXN B;  8ICC A;  2ZUB A;  4Z6D A;  3WKD A;  5KHJ A;  3QU4 A;  1AB3 A;  2EIN B;  1IUR A;  1Q43 A;  4NYK A;  2K89 A;  5J2G A;  2YQE A;  4Q44 A;  4O3R A;  2FL4 A;  4LF4 B;  4YIO A;  4YY3 B;  3HKD A;  1H8H G;  1RYR A;  3I5D A;  5KLV H;  2PGG A;  3CC2 V;  4Y2Y A;  3HKC A;  2UUC B;  2YN4 A;  2K4E A;  4Q45 A;  1YJW V;  2KG7 A;  2FMP A;  3G6X A;  4RQ7 A;  5K1P A;  2ETN A;  2ISO A;  1XIL A;  2BPC A;  5DBC A;  3QO5 A;  4KLU A;  5KAF Z;  2X7R B;  1NK4 A;  4DR5 B;  4JYA O;  3CNH A;  2OTL V;  3AG4 C;  4XA5 A;  3IM1 A;  4MSW C;  1O9H A;  1Q86 W;  4JAV A;  4DRX B;  2XVT A;  2QKQ A;  4GKJ O;  3CD6 V;  3BS7 A;  1AVM A;  3QU9 A;  1X9M A;  3UT5 A;  4Y2P A;  2W9M A;  1ZQO A;  2LQT A;  5IY5 C;  1O03 A;  1N34 O;  1WYG A;  4DV0 B;  1W2B U;  1U9L A;  4OPH A;  4FPP A;  5AIC A;  4C4T A;  1QQ5 A;  5GTI U;  3GIK A;  2G06 A;  2EDU A;  2UXB O;  3FB6 C;  7ICI A;  4UBC A;  5DQH A;  5CBH A;  4I2F A;  1NH2 B;  4DF4 A;  2NV3 A;  4ELU A;  2K8A A;  3NXS A;  2YTU A;  3PW2 A;  5IT9 N;  1SGG A;  2ALZ A;  5HR6 A;  4DLE A;  3IG8 A;  3ZDB A;  1JJO A;  2EIM B;  3KZI Z;  1L6N A;  3MR5 A;  3RTV A;  4QPK A;  2YX8 A;  4LFC B;  2KG5 A;  4YD1 A;  4JYA B;  1QH9 A;  1XWL A;  4DLG A;  4DR1 O;  3TAN A;  4HAM A;  7ICP A;  1KKC A;  4QZD A;  5CRX A;  1XI1 A;  4AHC A;  3DTU B;  3GV7 B;  1BPZ A;  5JVD A;  3TAR A;  1Y74 A;  2BE3 A;  4KHP B;  4O2B B;  2HCF A;  2OCH A;  2R9A A;  3G4S V;  2DE0 X;  3MFH A;  5A9G A;  3TAP A;  4KFM A;  4Q20 A;  3AG3 B;  3MR3 A;  3N7S C;  1IXB A;  4KMU A;  2XCP A;  1GN3 A;  1QBZ A;  3OEH G;  3F53 A;  4DSF A;  5KFF A;  1BVS A;  3QXG A;  1XHX A;  4DR7 O;  2W8L A;  4KLG A;  2LW7 A;  1ZQS A;  2QB1 A;  9ICM A;  1Z00 B;  2GLE A;  4KUM A;  3ZRX A;  4YHH B;  4I50 B;  4UAV A;  1Z5V A;  4MHV A;  2F95 B;  4QNH B;  4YJ2 A;  4NXM B;  2Q4P A;  5LYJ A;  1BZK A;  1AI7 A;  4GKK B;  4I2H A;  4HYO A;  3SDL A;  1M9N A;  1X9S A;  3I1Y A;  3QVN A;  1X6J A;  4UCO A;  4CH4 A;  2F4V O;  4UB3 A;  2WLI A;  5L3D A;  4OJ5 A;  4CDG A;  5ALV A;  1JUD A;  3J7A U;  4TUR A;  1V55 C;  1AR5 A;  3VCB A;  1GM7 A;  3LWM A;  3IFX A;  1YCI A;  1J5E B;  1PVP A;  1VQ6 V;  1BHA A;  5L3E A;  3QEB Z;  1QVG U;  3Q8L A;  1P7G A;  3CRC A;  2F44 A;  4EBC A;  4QZB A;  4M6W B;  9ICT A;  4P4P A;  8ICJ A;  4JI5 O;  3CPW U;  4KN4 A;  4NXZ A;  3OPX A;  3T5K A;  3CCM V;  4LF8 B;  2KZM A;  2L5Y A;  3L74 H;  3UMG A;  3AG7 A;  1DTO A;  1YT3 A;  1N63 A;  3U26 A;  5J2E A;  1ZLZ A;  3C3T A;  3HWT A;  5B3S B;  1MA1 A;  1K7D A;  4GKK O;  3B09 A;  4LCU C;  5IYC O;  3BY6 A;  4MVM A;  4TUS A;  1MMM A;  2UUB O;  2OT5 A;  2ZE7 A;  4P30 A;  3LK9 A;  2ODM A;  5FL7 G;  2OWO A;  5AI8 A;  2UUC O;  4K0K B;  3RYI B;  1O08 A;  1BNP A;  4B3M O;  1QR8 A;  4FVM A;  5J2T B;  3RB3 A;  3AK3 A;  5HNK A;  3CMA V;  3MHS C;  2XAQ A;  4FK5 C;  3M7D A;  4O3N A;  1VQ9 V;  4LF5 B;  5IJ9 B;  2PXI A;  4UB6 U;  4K8Z A;  4RAI A;  4CBC A;  1QVF U;  2PFN A;  2VS0 A;  3JAS B;  3JAW A;  5H6R A;  1VDV A;  8ICX A;  1F51 A;  2RDI A;  2PI4 A;  3SJB C;  3FAH A;  2BOB C;  3RJK A;  2FLL A;  2BSK B;  1MC8 A;  1S0O A;  1OCZ C;  3MFI A;  3D3I A;  1S97 A;  1H2S B;  3RRH A;  1ROP A;  2KG7 B;  4P2Z A;  2VQE B;  5KFQ A;  3ORY A;  3B0X A;  4DR3 B;  1QTM A;  1BHB A;  5DBA A;  4NLG A;  2H3F A;  4RQN A;  1E1R G;  2RNB A;  5KFI A;  3GV5 B;  4UB5 A;  2Y48 A;  3VC8 A;  2WF9 A;  3HKZ C;  4JPR A;  2EZZ A;  3OEE G;  4NVP A;  5KFT A;  2WF7 A;  1M57 B;  1VP7 A;  3I76 A;  5DB6 A;  2VA3 A;  5ALT A;  3OT7 A;  4AP9 A;  3PJS K;  1OCC C;  1VLB A;  2Y4U A;  5AI4 A;  4EB6 B;  3TXQ A;  1KN5 A;  1MQ2 A;  4DSE A;  4YMO A;  4LFB O;  5AIA A;  3WKB A;  3OUS A;  3T1H B;  1N32 O;  3K1R B;  4UB1 A;  1NK0 A;  1GN6 A;  4LBE C;  1X9X A;  2MU2 A;  3QNE A;  3J80 N;  4AYB C;  5ALQ A;  3GIL A;  1WCN A;  5KHI A;  1Q7Y W;  4EX6 A;  4TQD A;  4RUE A;  5LOV A;  4IRC A;  1BE3 H;  4W4K A;  1M90 W;  1OCZ B;  1H2M A;  2L6L A;  2P66 A;  4O4J A;  2HHV A;  4UB8 Z;  1XMO B;  2YI9 A;  2FI1 A;  1RP3 B;  2N74 A;  1HDJ A;  3CS5 A;  4JV0 A;  4YHH O;  3MGH A;  3APO A;  3HKD B;  5KFO A;  1SKS A;  4RQ4 A;  3FB7 C;  1LKY A;  1W0J G;  2JH7 A;  1X40 A;  1F0M A;  4UW9 A;  1FD9 A;  1K4D C;  3SAF A;  5KFR A;  1XOU A;  3WK5 A;  2EAM A;  4JWM A;  3JAT A;  5IIO A;  3E35 A;  2XAF A;  2BQR A;  4ELV A;  4ZOL B;  3V6H A;  1IX9 A;  1B4F A;  8ICO A;  2IOF K;  3CX5 F;  5KT7 A;  1JXL A;  4EEN A;  4IRD A;  2CK3 G;  5C93 A;  2P5O A;  4I2G A;  2GSM B;  3LDC A;  2KIW A;  1NBM G;  2KKV A;  3MAQ A;  1FXH A;  3JD1 A;  4DFK A;  4DFM A;  3RH4 A;  3L73 H;  2QWR B;  4RQ5 A;  3SYO A;  3Q8K A;  1XBL A;  4NWI A;  3BZC A;  2HHW A;  5JH7 B;  5IWA O;  3C1Z A;  1KD1 W;  1HNZ B;  5J2T A;  2Q67 A;  2QWP B;  3CCL V;  5KT3 A;  1Q3U A;  3OTO B;  5J2B A;  2JV3 A;  2W9B A;  4PH5 A;  3UPQ A;  2DYR C;  2F2A B;  1ZRN A;  5EE3 A;  2VWK A;  3R9K A;  1ZQB A;  2FLN A;  2ILM A;  1TAU A;  3PST A;  3BA9 A;  5C8Y B;  2JS5 A;  2KFN A;  3BAA A;  3FC4 A;  4JI3 B;  3RBD A;  4YVZ A;  2ATL A;  2JRZ A;  9ICS A;  4GX1 A;  2Q7E A;  5KT5 A;  2XND G;  3ABM B;  2CXY A;  1KRP A;  4Z2W A;  3FDS A;  1KKX A;  1AI6 A;  1WCL A;  4MS2 A;  5C8Y A;  2W8K A;  4F6R A;  3WB1 A;  2IOF A;  1V97 A;  4B9L A;  2LYA A;  4DV1 B;  5KFW A;  3X2Q C;  2OH2 A;  1K97 A;  4Y2Q A;  3HPO A;  4R50 A;  1PD3 A;  1K4C C;  2Y4T A;  4FBU A;  5AKH A;  1NVP B;  1H38 A;  3RF9 A;  2DL0 A;  2WLN A;  2WLM A;  2YS8 A;  1K1Q A;  2A1J A;  2KIV A;  2W9C B;  4ZKI A;  1OXJ A;  3GQC A;  3P3N A;  1OCO B;  2ASJ A;  7ICH A;  3APQ A;  4NL9 C;  1ZD2 P;  1AJP A;  3MR6 A;  4UCR A;  4J41 A;  2FJ6 A;  1NK5 A;  4F6E A;  2WAM A;  3C90 A;  5KUM A;  4P2H A;  5J2I A;  4M9H A;  4R8U B;  1JR9 A;  4HAI A;  4CF5 A;  4RT3 A;  1VF6 A;  1CUK A;  5CA1 B;  3SR2 C;  4CF3 A;  2HMX A;  1LVH A;  4ECU A;  5III A;  1NI8 A;  3B2E E;  1TA8 A;  2E1E A;  5KFN A;  1ZQG A;  3LDE A;  3LWL A;  1QQC A;  1UA1 A;  5KAI Z;  2J6T A;  2A19 A;  7ICJ A;  9ICB A;  3FB8 C;  4IS7 A;  5AHX A;  4N21 A;  3HPL C;  1UT8 A;  3V7L A;  4X65 B;  4ED7 A;  9ICQ A;  2KJ5 A;  5AKL A;  1COW G;  1FYJ A;  3ABK C;  1SV4 A;  5GON A;  2ZKO A;  4WFE A;  1RYS A;  4YR0 A;  1S77 D;  4DR2 O;  3A2F A;  4O4J B;  1FIQ A;  7ICS A;  3S3X A;  1Q46 A;  2WLL A;  3K04 A;  3OHB A;  1EFR G;  2YIB D;  2DF4 B;  3CE2 A;  1C20 A;  1NVP D;  3KHH A;  1XO1 A;  1NK8 A;  1D9D A;  2D2C B;  2DKX A;  5IIL A;  5KFV A;  3GVM A;  3RYF B;  2ITC C;  3K4G A;  1SKV A;  3ZHT A;  1VQ8 V;  1BGX T;  1XNS A;  2KK0 A;  3ZD8 A;  5KX5 B;  1FS0 G;  3B8M A;  3UT5 B;  2NRZ A;  3E89 A;  4DQQ A;  2LBO A;  4ED6 A;  3PW0 A;  4J9Y B;  3HKE B;  5ALZ A;  1IM4 A;  8ICN A;  1SIJ A;  1GM8 A;  3OJS A;  1XEQ A;  2C2E A;  2CH7 A;  3N2G B;  4A5U B;  1NKC A;  3AEI A;  4NV0 A;  4US9 A;  2E5L O;  4HNA A;  2K8C B;  4DW0 A;  4KXR A;  1FFV A;  1ZQQ A;  3HB3 B;  1NTM H;  2JZB A;  3AQF A;  5L3F A;  4QWC A;  5BY1 A;  1LUW A;  1ZYQ A;  2VQF O;  3ZRV A;  5DDM A;  4M04 A;  2Q7H A;  5JJE B;  4LF9 B;  4EEL A;  5L3B A;  2CH7 B;  4YXJ A;  1TK5 A;  1YIT V;  1N48 A;  4YN4 A;  4YXW G;  2XAS A;  4LZD A;  3QYP A;  4HZ3 A;  1X59 A;  1TKD A;  4KLS A;  1SZH A;  1JX4 A;  5JH7 A;  3EXA A;  4O9M A;  2AHZ A;  2PFO A;  5JVD B;  3IGA C;  2A9H A;  1QHT A;  2EIL B;  2ZD9 A;  4DV6 B;  2DYS C;  3MDA A;  4K4G A;  8ICY A;  5B66 U;  4RWU A;  5EZY B;  5KA6 A;  1HNX O;  4I0X A;  3NGD A;  5EK0 A;  2HKO A;  4AI8 A;  3W7T A;  2GUZ A;  4XBF A;  5HHI A;  2HHS A;  7ICO A;  1N0J A;  1TVK B;  3C21 A;  4F4Z A;  4DO9 A;  4DOA A;  3Q4H B;  2QEX V;  2GH1 A;  5J2C A;  4GC7 A;  3CRQ A;  2EJR A;  4J9P A;  2A1J B;  2W9C A;  4NL9 A;  1FKA O;  1L8L A;  1BPX A;  8ICB A;  1V55 B;  2XO7 A;  4EBE A;  1P4R A;  3JAT B;  5KHG A;  3E8B A;  4D6T H;  2G09 A;  3OUF A;  1CEZ A;  2LJ2 A;  4YJ2 B;  3D2S A;  3ZMS A;  1L7O A;  3JAM N;  5DLF A;  4F50 A;  2WTF A;  3OGI B;  4PDR A;  3BFR A;  3W7U A;  1ZQR A;  3LUT B;  4CGZ A;  3QUT A;  4KTQ A;  2P22 C;  4M0A A;  4DR7 B;  4RUA A;  4FZ0 A;  3Q8M A;  1IBL B;  2E8O A;  3BZK A;  3H8S A;  2VJ5 A;  9ICR A;  1SWW A;  2I5H A;  2WF8 A;  3Q8Q B;  3I55 V;  1ZQL A;  5CB1 A;  4DV3 O;  2XUM A;  1L7N A;  4QZ9 A;  1IV8 A;  2XY6 A;  1AP5 A;  2B1G A;  5L3C A;  5JU5 A;  2O57 A;  3NS1 A;  3DC6 A;  3H1K H;  3AG1 B;  4CH3 A;  3KD3 A;  3K5L A;  5EIB C;  4AIL C;  4DK0 A;  1DGJ A;  3CC7 V;  3N4M B;  3G6V A;  5AKJ A;  4DR2 B;  2DQN B;  5JRT A;  3N2K A;  3UO3 A;  4BJQ A;  1JVM A;  4X66 O;  1RSO A;  4IQW A;  3ONN A;  4TV8 B;  1HIW A;  4YQW A;  1H2G A;  1SXE A;  2QM7 A;  1SKW A;  4OX9 O;  4DR4 O;  4IL6 Z;  1B6Q A;  2UVU A;  1ZTE A;  4J42 A;  5ALI A;  2ARH A;  2F76 X;  4I55 B;  3TKA A;  3FD9 A;  4O2A B;  5CN0 A;  3AL0 B;  4JI6 B;  2HOF A;  4JWN A;  3R66 A;  1BS3 A;  4ECT A;  1XSL A;  2B5U A;  3B8N A;  4J03 A;  1MA7 A;  4MF2 A;  2A0L A;  4Z6E A;  3CJH B;  2MSN A;  2UXN A;  1KYO F;  3ABT A;  5EBW C;  4DK1 A;  2DQ3 A;  1GO3 F;  2QA4 V;  2QAR A;  4OJO A;  2HG5 C;  1J97 A;  5E79 U;  3ZS8 C;  2HOI A;  1XMQ O;  3AN1 A;  1YZ7 A;  2H3O A;  5L9X A;  1MG1 A;  1OJH A;  3JAS A;  5GTH U;  4MVU A;  4R7C A;  3N2G A;  4I5S A;  2AZ0 A;  3CCQ V;  2VQE O;  1ZOL A;  3J81 j;  4LF6 B;  4B3T O;  3G71 V;  1FXK A;  1NR7 A;  3N7P D;  5LA6 B;  3ZHQ A;  5LXT B;  2LFR A;  3T5L A;  4MVQ A;  3AEV A;  2KJ8 A;  2OCC B;  3U10 A;  3QUQ A;  3QG5 A;  4B3R O;  4FFB A;  2ATK C;  3K5M A;  2YMM A;  4JV2 A;  1KU9 A;  5ITZ B;  1XHZ A;  2HLD G;  1X42 A;  2Q6A A;  5J9P C;  1FAF A;  2M9N A;  4DL3 A;  2CGN A;  4ZBM A;  5H9C A;  1R6T A;  3ZED A;  1I94 B;  1M93 A;  4DFD A;  3SYC A;  4LF6 O;  3PO4 A;  3CHX A;  2Y1I A;  4IIJ A;  4J10 A;  3EWA A;  4O5E A;  9ICW A;  1XMQ B;  2AU0 A;  2ESE A;  2NR5 A;  4PJ0 U;  1B3Q A;  3ETQ A;  1GKF A;  3VQY A;  2GUZ B;  2JEI A;  5EWF A;  1PK3 A;  3RW0 A;  2W3S A;  3VOU A;  4QPJ A;  2R8K A;  2UXC B;  3JPT A;  2KN7 A;  2ZIO A;  1PK1 B;  2D3D A;  3SPJ A;  3ZHS A;  1M5I A;  2NNU A;  4ICG A;  4FZM A;  3TFR A;  7ICL A;  3BQ1 A;  1OCR C;  3RR7 A;  2GTS A;  2FPL A;  2JGD A;  4LFB B;  5IJ9 A;  4RUF A;  4X64 B;  2UXD B;  1N0N A;  2AJQ A;  2DYS B;  2EIL C;  4NLN A;  3QNM A;  5K1X A;  3PX4 A;  1PP9 H;  2Y0P A;  3C2K A;  4OXS A;  4FM2 A;  4PD4 F;  3M8A A;  3TXS A;  2UU9 B;  4NB5 A;  1KUQ A;  1XNR B;  4C4R A;  4CS2 A;  4K4H A;  3EHB B;  2XY5 A;  4J9L A;  2P4K A;  3L4P A;  2IOH A;  2EIM C;  5ALU A;  1QSS A;  2VJ4 A;  5F9L A;  3WB2 A;  4JAS A;  4MEY A;  4I28 A;  2UXC O;  4NLB A;  5GW7 A;  1XSN A;  3E83 A;  4JI0 B;  1QU7 A;  2P35 A;  1Q3E A;  3FB5 C;  2G5I B;  5JJJ B;  2Q69 A;  2DUY A;  5T14 A;  1H8E G;  2ZE8 A;  1XNQ B;  5KG5 A;  5IJ0 B;  1NTK H;  1ZQA A;  3SQI A;  3JAW B;  4DRX A;  1B0X A;  2BQ3 A;  2PY5 A;  5DKW A;  5EYP B;  3AG1 C;  3MBY A;  2RQ5 A;  3DXR A;  5J2F A;  4UVC A;  5AKX A;  1RPL A;  2ZIX A;  4DW1 A;  4DV4 O;  2P67 A;  5B1O A;  4QGP A;  3RB0 A;  4KIT B;  2XOK G;  4O5C A;  3RJE A;  2BOC C;  4DUZ B;  2F3N A;  4YMN A;  4TQF A;  3VQW A;  4XQ8 A;  4ZHQ B;  1WPX A;  3ISC A;  5L1I A;  2ZM6 B;  3T1C A;  4MT8 A;  2JXJ A;  1GRJ A;  1S0M A;  2K60 A;  2YMP A;  4XDL A;  2ASL A;  3WK6 A;  2XCA A;  2E5S A;  1SL2 A;  1NKD A;  1PKX A;  1M56 B;  5LA6 A;  3HKZ F;  3BQ0 A;  2EIN C;  3KFU F;  3HKE A;  1ZD5 A;  3ZCC A;  4IYH A;  2VRZ A;  5DB7 A;  4KLH A;  2ZQM A;  3IAY A;  5EWE A;  1XUQ A;  2BCC H;  3BQT A;  2EIJ B;  4PDM A;  1SB3 C;  5AK4 A;  3A8T A;  1D8B A;  2Q5Z A;  3K57 A;  1LNQ A;  4ED3 A;  3RB6 A;  1YHQ V;  2F8L A;  5B5E Z;  1U96 A;  4B3S O;  5BR8 O;  2C2D A;  4JTA B;  3F2B A;  5AIB A;  4PHP A;  1O9G A;  1I0H A;  2R8J A;  3D3Q A;  2IU0 A;  3L3F X;  4BIZ A;  1YJ9 V;  4R65 A;  4R63 A;  4DUY O;  1N5W A;  3SEN A;  3E58 A;  4ED0 A;  4OO1 J;  3KKA A;  2EIK C;  1LKY B;  2BTQ A;  4DV4 B;  1VQK V;  4ED2 A;  7ICK A;  3SI8 A;  3UO2 A;  2IA6 A;  4DV3 B;  3ZMU A;  1MZE A;  2HFE C;  3F5A A;  3OW2 U;  9ICU A;  2JGD B;  3PN1 A;  8ICQ A;  4IGG A;  1FXK C;  1NQT A;  4KHP O;  2Q73 A;  4BX9 C;  1FJG O;  5J2H A;  2KV2 A;  4RQ0 A;  3L70 H;  4DR6 O;  2MUT B;  5AI5 A;  2IU3 A;  1RM1 C;  3F7V C;  1BPD A;  4DEZ A;  2OHF A;  2P06 A;  3G6E V;  4C7U A;  4AQY O;  2EUL A;  4U7C A;  2R8G A;  3V6K A;  1S0N A;  5J2U A;  4U7O A;  4ECW A;  5DBB A;  1UJW B;  1T7P A;  2E74 B;  3FKS G;  3WFV A;  1N8R W;  1PUZ A;  1R3I C;  3IJ4 A;  1ZQF A;  3E8G A;  4JGS A;  1ZWI C;  5CP2 A;  2NO4 A;  4DV0 O;  3MD0 A;  2W7O A;  1PNL A;  4P0P A;  4YP3 A;  1ZL8 A;  1N34 B;  3ETD A;  4QE9 A;  2VA8 A;  2BGW A;  3KOO A;  1F4M A;  1VQ5 V;  4RNN A;  4LF7 O;  3UXN A;  4DV6 O;  3IC7 A;  4J9O A;  2G08 A;  1N2X A;  2KNJ A;  5KAI U;  1TAE A;  2PUS A;  1AI5 A;  5KT4 A;  1GH6 A;  1SQP H;  2CUG A;  5DB8 A;  5KFL A;  1W0K G;  4R6Z A;  2NRV A;  4RZR A;  2ZIX B;  3JPN A;  2FMS A;  3AG2 C;  3V7K A;  3H01 A;  4LP8 A;  2UUA B;  1ZRM A;  4I2C A;  2WLK A;  2ZXI A;  4TQS A;  4C8O A;  4EFB A;  1XL6 A;  5KT6 A;  2UVV A;  2ZXW B;  1KTQ A;  4QZ8 A;  4L8J A;  2W6I G;  3UKM A;  1PL4 A;  4JI7 B;  4U6P A;  2QTS A;  1WB7 A;  2P4V A;  3PSP A;  2LP7 A;  2KJ9 A;  2PI5 A;  1P49 A;  3CJH A;  8ICT A;  4MEX A;  4JTC B;  5J0T A;  3KBB A;  5B1A B;  2ZR3 A;  4O0I A;  2YXH A;  4FMT A;  1JQ0 A;  4EKW A;  2EJ7 A;  2GV9 A;  1U47 A;  1H2N A;  5AI6 A;  5KFP A;  3RBZ A;  1RPO A;  2VKQ A;  3WK8 A;  1T94 A;  2A3V A;  4UVA A;  4CNQ A;  3GDX A;  4EBD A;  4B7K A;  2EAN A;  2WB1 F;  3KKA C;  4RPY A;  1JFF B;  5LXT A;  1D5A A;  4RU9 A;  2QWQ B;  2W11 A;  2ZUD A;  4Y2V A;  1K5O A;  4FFB B;  3E22 A;  4LNU B;  3M1Y A;  5IDJ A;  2FML A;  3Q8R B;  1AJN A;  2BZF A;  2ISP A;  4C8K A;  1XQ8 A;  5ALJ A;  2ADQ B;  5JUM A;  2RDC A;  4RQ6 A;  4CH6 A;  4O3Q A;  5TIS U;  4ED8 A;  5HFL A;  1US6 A;  2UXD O;  3RYF A;  5CA7 A;  4RQ8 A;  1UCV A;  9ICH A;  1RM6 C;  5J8Y A;  4JF3 A;  5B1B B;  3KG2 A;  4GLX A;  2G0A A;  2W0F C;  2HHH B;  4JI6 O;  2XI9 A;  5KFD A;  3ML0 A;  1SQX H;  2HOQ A;  3EFF K;  3H7I A;  4MVZ A;  2QE7 G;  4W4L A;  2LM1 A;  4GC6 A;  4PHE A;  3CCE V;  4B9V A;  2G5H B;  3BDP A;  4Y2T A;  1R6N A;  5B66 Z;  2B9Z A;  4YFK A;  1HP8 A;  4Z6F A;  3KZX A;  4OPA A;  2CN1 A;  1JMS A;  4Y2X A;  2V7Q G;  3R65 A;  2H3Q A;  3MAB A;  1Q8I A;  4I4T B;  4O3S A;  4AQY B;  3WKE A;  2C2A A;  1TVK A;  1TE2 A;  2E8P A;  4GXK A;  1Q6H A;  3T2M A;  1S72 V;  4PV1 B;  5DGA A;  2KSD A;  4ACO A;  9ICA A;  1I94 O;  1QSY A;  3CYO A;  2AQ4 A;  1YF2 A;  2CTR A;  1Z4N A;  1PVQ A;  5EYP A;  4UVB A;  4FIP C;  3ZIA G;  1L7M A;  3ZHV A;  2HVH A;  2ZNI A;  3KTQ A;  3KCX A;  4K35 A;  1YTF D;  1AQ6 A;  4ECQ A;  2UVW A;  4IC9 A;  2RJZ A;  3M7M X;  3JPO A;  1KBH A;  4LF4 O;  2F1J A;  1WA8 B;  2E1F A;  3IG5 A;  4ECZ A;  4BGD A;  2AH5 A;  3G6B A;  4CZZ A;  1OHH G;  5LMU O;  4B9T A;  4I55 A;  4YMM A;  4KLJ A;  2AW9 A;  3P30 A;  4ECY A;  4JK1 A;  9ICC A;  2IW5 A;  3NVY A;  3OD4 A;  4E0D A;  4P9P A;  3CW2 C;  4X5V A;  1TK0 A;  4EEK A;  1ZQN A;  1DF5 A;  3D2N A;  1XL4 A;  2H8P C;  2UUA O;  1IDS A;  4Y2J A;  2OCC C;  3CCV V;  3B0Y A;  4FLY A;  2YXL A;  2Q0A A;  4UXN A;  5D5P A;  3SJA C;  3WG7 B;  4JI7 O;  2DPI A;  2X6A A;  4GXI A;  3STZ C;  2RHF A;  4I2J A;  2HJF C;  4WCE V;  2PFQ A;  1J2M A;  5AK5 A;  4MFF A;  3THO A;  4DV2 B;  2YEV A;  3UXP A;  1DK3 A;  1SES A;  1FXK B;  4I7Z B;  1NZP A;  4F72 A;  3TAC B;  1ZQJ A;  7ICF A;  2QR4 A;  1FO4 A;  3G80 A;  5HML A;  3H8J A;  2LPE A;  3Q8P B;  4M9L A;  5B1N A;  2X0L A;  2V4Q A;  5H2F Z;  4J9Z B;  4GKJ B;  2EQY A;  2AQ0 A;  3OR6 C;  3LDD A;  4X62 B;  1NOM A;  4PHD A;  2WA4 A;  5TIS Z;  2W9B B;  4JZ2 A;  3C3S A;  3GB7 C;  1ZQY A;  3V72 A;  4F91 B;  3MGV A;  1G1X B;  5DM6 V;  4RQE A;  1Q90 D;  1K8A W;  4BW9 A;  2QTO A;  1R73 A;  5J2A A;  3H0L B;  4J9Q A;  1S5J A;  4NLC A;  5L1L A;  3HR0 A;  4DR6 B;  2FDR A;  2PFP A;  4UV9 A;  3D2Q A;  1IZ3 A;  1N33 B;  2AGQ A;  5AI0 A;  2Y0S F;  4DSI A;  4JI1 O;  1V85 A;  1SC5 B;  1JI7 A;  3RYH A;  4OJP A;  4JI2 B;  5EOZ A;  4K0K O;  2DWQ A;  3H1L H;  4J7Z A;  2OTJ V;  4CRX A;  3SZ2 A;  2B6G A;  5LGN A;  5J0P A;  3ISB A;  2WA3 A;  2Z5U A;  2XHB A;  5LL6 Y;  4NTY A;  2KP7 A;  1VF5 B;  2AZ2 A;  2JJ2 G;  2KZ3 A;  3H0M B;  4LFC O;  2Q0O C;  3K03 A;  3RYH B;  5HMM A;  3E22 B;  8ICI A;  3T1Y B;  1TUB B;  4I4T A;  2RQ6 A;  4DV7 O;  3P3P A;  2ZIV B;  4NLK A;  4BDP A;  2JIZ G;  4F4Y A;  4AYB F;  2ZNJ A;  1X6I A;  3O65 A;  3HKB A;  5BR8 B;  1GTO A;  4KLL A;  3ASO B;  1Z3E B;  1YJN V;  1HR0 B;  4GYC B;  4X1Y B;  1WAZ A;  3WU2 Z;  1M4U A;  3H0R B;  5J2K A;  3ETG A;  1R3J C;  3RT3 C;  1SL1 A;  4LF9 O;  4LJX A;  2X6C A;  2VQF B;  4CH5 A;  1T3Q A;  1EZJ A;  2KZZ A;  1FXV A;  1RFY A;  2R72 A;  1RZT A;  8ICU A;  3C5F A;  3JYC A;  4PA4 A;  4I2I A;  1RXW A;  1YVW A;  5CEH A;  1DRG A;  3ZDA A;  2N05 A;  4EYI B;  4WFG A;  2Y0I A;  1GK9 A;  1JX9 A;  1SA0 B;  5ALE A;  1BL8 A;  2Q8V A;  2W0X A;  2ZE6 A;  3TGU H;  4D7T A;  4KX3 A;  4DR5 O;  4K8X A;  5CMU A;  3F5E A;  4JAA A;  2IMW P;  2D6F C;  2IJH A;  1L0L H;  1JOY A;  1E1Q G;  1UPG A;  3TJT A;  3M6Z A;  2OIG A;  4DO2 A;  2B0C A;  8ICZ A;  4ECR A;  1ZAU A;  8ICE A;  1CP9 A;  1F5S A;  4F3O A;  2KTQ A;  2F1M A;  1JRO A;  2G07 A;  5B1B C;  3W7W A;  1TK8 A;  2NO5 A;  2RN9 A;  3SYP A;  1XSP A;  2DBY A;  1R1B A;  4ZOH C;  4Z1M G;  1UFI A;  1TAQ A;  1XU4 A;  5KFH A;  4HYK A;  2KFZ A;  7ICE A;  1SQV H;  3ETR A;  1JMK C;  3VQX A;  2KIC A;  4BIO A;  5J0R A;  1SV0 A;  1X66 A;  4UB4 A;  1ZQI A;  1E79 G;  5KFU A;  5DDY A;  5FP0 A;  3ASO C;  4MTG A;  4MVS A;  5ALK A;  3HIL A;  2BDP A;  5LHH A;  2W6J G;  3EPI A;  4O5K A;  8ICV A;  3OMN B;  4UUJ C;  4YR2 A;  2ES6 A;  5LHI A;  2UXX A;  2WF5 A;  4DR1 B;  1XNR O;  4U3F H;  2UU9 O;  3B9J A;  3FYH A;  5J8Y C;  4CS4 A;  1BMF G;  1JXE A;  2HHH O;  3RJF A;  2Q9L A;  1S10 A;  1JFF A;  2JJ1 G;  4I2E A;  4JI8 B;  1T5E A;  3IHQ B;  4QZE A;  3OSP A;  5HFM A;  1ZQU A;  3SGI A;  1TFR A;  4JYC A;  3FYI B;  4RQM A;  1V54 B;  1VQ7 V;  4R64 A;  3B40 A;  5KUK A;  1NZB A;  1VF6 C;  3K79 A;  2Q4T A;  1N36 O;  1HUO A;  2XY7 A;  1BQZ A;  5KT2 A;  1SQB H;  4UB6 Z;  1WP7 A;  1J2N A;  2HBM A;  1RQN A;  1Z19 A;  2W43 A;  2LO1 A;  5KL8 B;  4MW3 A;  3F5T A;  3RRG A;  4X1I B;  3U0Z A;  2W03 A;  3T4Z A;  3LNN A;  4ZHQ A;  1OUQ A;  2ZE5 A;  5IYZ B;  3ZDE A;  4DL5 A;  2PZS A;  4RO2 A;  5F9N A;  2F4V B;  1EN6 A;  4J9M A;  2P6J A;  2BCV A;  2CTP A;  1TUB A;  3KZI U;  1PZN A;  2AGA A;  4JMU A;  2E3T A;  9ICL A;  3H1I H;  4BWJ A;  2R18 A;  3SYZ A;  1CRX A;  5KFA A;  1YEW A;  2K9P A;  4U3J B;  2LI6 A;  1OCO C;  3CXH F;  3QX7 A;  4JI1 B;  2R9I A;  4UAS A;  3AG4 B;  1AR4 A;  2OM6 A;  2NN4 A;  4J9K A;  4R66 A;  2QGN A;  2YXY A;  2YB4 A;  2XC9 A;  5ALH A;  5AM0 A;  4UAR A;  1NT2 B;  2NRX A;  9ICK A;  2B1I A;  4I9Q A;  3ZHU A;  7ICT A;  1IG6 A;  5ALD A;  1XS9 D;  1AP6 A;  5LHG A;  5EBM C;  3K1Z A;  1SKR A;  2P6U A;  3T4D A;  1VQM V;  2ZXW C;  3ETL A;  3DGE A;  5AKE A;  2OYY A;  4E4E A;  1N36 B;  5EE1 A;  2WLH A;  1Q3V A;  2GDS A;  1DK2 A;  1N61 A;  1XC9 A;  8ICR A;  4DQP A;  4Z6C A;  4J9N A;  1X4T A;  2EZO A;  3CP1 A;  2LYB A;  2W7P A;  3PMN A;  2HBJ A;  3MDC A;  1URF A;  3SYQ A;  5IWA B;  2BR0 A;  4KLO A;  1K5S A;  4TQR A;  3M99 B;  5DN6 G;  5LGU A;  1SXD A;  1XO0 A;  5ALO A;  1ZET A;  3PW7 A;  4GIB A;  4IHJ B;  3SMV A;  3GII A;  1EN5 A;  2EIK B;  2HHQ A;  3JD3 A;  3LVW A;  1L3V A;  4IRK A;  3MDS A;  3RVZ A;  4X9Q A;  3E2E A;  2E8M A;  2Y9U A;  3D6J A;  3RJH A;  1Q5O A;  1GN2 A;  3HW8 A;  4KN7 A;  4PGY A;  4XUS A;  1S3J A;  2CDY A;  2K4I A;  1JPX A;  4FLT A;  4DL2 A;  2JEU A;  3F2C A;  4DR3 O;  2OCE A;  2MA1 A;  5J29 A;  1NJW A;  2ZIM A;  1MSW D;  1JN3 A;  3QU5 A;  4M2Y A;  1WWU A;  2ZUC A;  3AM9 A;  1OZ0 A;  2PYL A;  2JGA A;  3E0F A;  1G4Y B;  2Z3Y A;  3O9O A;  2F93 B;  8ICP A;  4PDL A;  3VQV A;  3ZMT A;  1RG6 A;  3AG3 C;  4B3R B;  4PI2 A;  3RFA A;  2PMZ F;  4TSF G;  5E1A C;  1A77 A;  1I08 A;  2JK5 C;  2CPR A;  5J2D A;  4YCX A;  2MUT A;  1N60 A;  5BXZ A;  5ALY A;  4UBB A;  3JPQ A;  2V4R A;  3JPP A;  1F7Y A;  1IBL O;  1CI4 A;  1ZQC A;  5JQG A;  4ABM A;  5J0Q A;  5DB9 A;  5KA5 A;  4R8U A;  1F23 A;  4PDV A;  4ZI7 B;  3UQ8 A;  5CA1 A;  3KHG A;  2JMG A;  1A32 A;  2K4P A;  1SZP A;  2HI0 A;  4H0L B;  3OFN G;  1FEZ A;  4PA9 A;  5KFZ A;  5KG1 A;  1C7Y A;  2LGQ A;  3FX7 A;  3QU7 A;  1DGS A;  1NI3 A;  2HW3 A;  2HHX A;  1RPR A;  3EW9 A;  3BEH A;  1EXN A;  3RH5 A;  5DQI A;  2PYJ A;  4QW8 A;  2XAH A;  3QU2 A;  1S5L U;  3L5K A;  2FE9 A;  1BPY A;  4QZF A;  1H2K A;  5IYB O;  3IN5 A;  5G5H A;  4D7S A;  3ZHR A;  1PL0 A;  4JV5 O;  2A1A A;  2ITD C;  2JEF A;  3MR2 A;  3PY8 A;  4TWK A;  3TAD A;  1NJZ A;  1SQG A;  5BOL A;  4HNA B;  4J80 A;  1Y66 A;  2OYQ A;  4MFC A;  4KLE A;  1X2I A;  1QLE C;  1DF4 A;  2KE7 A;  3JPR A;  4ECS A;  2Q7G A;  2XGQ A;  3ABL C;  4UB8 U;  1KC8 W;  1KEC A;  4UCS A;  2CE4 A;  1BPE A;  1P7D A;  4DF8 A;  3FM9 A;  4O4H A;  4F92 B;  2OIE A;  1U97 A;  4F4W A;  2W3R A;  1DLB A;  1OCC B;  4FZN A;  2LW1 A;  3RN4 A;  1L1F A;  3BCC H;  3SAG A;  5ALS A;  1QR9 A;  1ZQZ A;  5KFM A;  4TUP A;  2F8K A;  3ABK B;  4UAT A;  1SET A;  3RGB A;  3TET A;  3UMB A;  1WN7 A;  3OR7 C;  3UM9 A;  4FBT A;  1NKE A;  2NLJ C;  3V7J A;  4UAZ A;  5FNV B;  5D46 A;  2R8H A;  5EC2 C;  4RNM A;  2RDJ A;  1NJY A;  1WLE A;  3WK4 A;  3LSQ A;  1NK6 A;  5J0O A;  1B04 A;  5AKY A;  8ICG A;  1ZSP A;  2IJJ A;  4KX5 A;  2FPK A;  4MVR A;  2F43 G;  2K4H A;  5IJ0 A;  3JSL A;  1Q6I A;  1MZF A;  1AI4 A;  1GM9 A;  2QDO A;  4H37 A;  3AU6 A;  4RPX A;  4B9N A;  3K5O A;  3BA8 A;  7ICM A;  2GTA A;  3UM7 A;  3RYC A;  1YIJ V;  1SS3 A;  3RAQ A;  2ZTC A;  1XDC A;  2ZG6 A;  4I0X B;  1GN4 A;  4CC5 A;  5LYJ B;  4B7E A;  1KSP A;  1HR0 O;  1WWV A;  5LMN B;  4C8L A;  4ZOL A;  3PX6 A;  3NTU A;  5IIN A;  2BCU A;  3QTC A;  3AQE A;  3I56 V;  5AI9 A;  5F3X B;  3TCU A;  3BQ7 A;  2DN9 A;  2AXT U;  4BAY A;  4G28 B;  1SF9 A;  1NJI W;  1RYU A;  5EE9 A;  4OJL A;  3KHL A;  1F4N A;  3JAL A;  3RB4 A;  1ZJN A;  3C2M A;  7ICG A;  1YI2 V;  2QB0 B;  2HBK A;  2WAQ F;  4TV9 A;  4ZI7 A;  2F1H A;  4M6W A;  1IIP A;  2IJK A;  2BCR A;  4DCC A;  4DSK A;  4Q43 A;  1ZQP A;  4ECX A;  3CYM A;  1SQF A;  4MTF A;  2HSZ A;  2JRI A;  2K8B B;  2GHY A;  3K0D A;  2W54 A;  2NRW A;  3GWK C;  3T5H A;  4G27 B;  5KG7 A;  1AJQ A;  4JI2 O;  4KLQ A;  1L7P A;  1V38 A;  1S9F A;  2ZDI A;  2ADP A;  3UMC A;  4EZ9 A;  5KTQ A;  3K9A A;  2IBK A;  1LR1 A;  5H6Q A;  3SPG A;  4YXM A;  2DYR B;  2QAR B;  1Q8K A;  3UXO A;  3WKA A;  5CBF A;  2LGW A;  4JAU A;  3P32 A;  4P0Q B;  5KFY A;  3L9D A;  1KFD A;  2F66 C;  2XT9 A;  3U11 A;  1N5X A;  4UAW A;  2DWD C;  4X89 A;  1TAM A;  2GWS A;  2DMX A;  2YC0 A;  4P9O A;  4JI4 O;  2BCS A;  1XNQ O;  3ASN B;  2B21 A;  4UFZ A;  3H8M A;  4DUY B;  4JI3 O;  3M8R A;  5CA0 A;  4FZL A;  1BGY H;  1RQL A;  5ALL A;  2UXB B;  5HP4 A;  4C7Y A;  1SZT A;  1SA0 A;  4F93 B;  3OE7 G;  3OAA G;  2A79 B;  1Y6X A;  5KG6 A;  2MW2 B;  3TK1 A;  5LBQ A;  4WJ3 B;  4X62 O;  4JUZ A;  1UPH A;  5BPC A;  1F44 A;  1MOF A;  4NR1 A;  3ZRW B;  5KG4 A;  1OV9 A;  4RQ2 A;  4X64 O;  4NKG B;  1YZB A;  2QWN B;  4DV7 B;  5KG2 A;  2P90 A;  3ABL B;  1VJ5 A;  3IP4 B;  1SL0 A;  4JB3 A;  4PHA A;  2HEP A;  4PJ0 Z;  5KNI A;  2BQU A;  5DEC A;  3M6K A;  4QWB A;  9ICJ A;  2KKP A;  2BPG A;  3E86 A;  1YDX A;  2KQX A;  4FM0 A;  4BUG A;  3PSF A;  4FO6 A;  1MAB G;  2PMZ C;  5DGB A;  5KHK A;  1BSM A;  3BHP A;  5IY5 B;  1S5H C;  5A2Q N;  3PZP A;  4UCV A;  2VAN A;  2EX3 A;  2CAZ C;  3EUB 2;  3ED5 A;  4E2L A;  1NU1 H;  5JWP A;  1U48 A;  4DQI A;  4KP4 A;  2UVR A;  2WHE A;  3SD7 A;  5KFX A;  1L3U A;  4JI0 O;  1EZV H;  2E76 B;  3OTF A;  1WG8 A;  5KFB A;  4DOB A;  5KX5 A;  5ALW A;  1VQ4 V;  5IYD O;  4FLZ A;  3CCS V;  5C0Y A;  3OTQ A;  2LYH A;  1Y67 A;  2XAG A;  3F7Y C;  2YIB A;  3QUB A;  2KSO B;  4DQR A;  2RLT A;  1N33 O;  2JS3 A;  4KLF A;  3AK1 A;  4O4L A;  2KMD A;  4C4S A;  3TI0 A;  5EZY A;  2JDI G;  1FPO A;  4O3M A;  8ICA A;  2JEX A;  5CJ7 A;  3ZX6 A;  3FYE B;  5K4L A;  1BCC H;  3N27 A;  2GOL A;  4FFK A;  2X6B A;  3ZDD A;  4KMO B;  2ZJ8 A;  4UQG A;  2VIX A;  1OCR B;  3PNC A;  4LFA O;  2HR3 A;  2RP5 A;  4B3T B;  3BS5 A;  2K1E A;  3PW4 A;  5HR7 A;  3KCY A;  4J7K A;  1XMO O;  5GTH Z;  4JYY A;  5AM4 A;  3HKB B;  3AMZ A;  4X1K A;  1SZX A;  4OCZ A;  4XRH A;  2DJV A;  4DV2 O;  1NKB A;  1TGO A;  3M9M B;  1N32 B;  1M1K W;  4GXJ A;  4NTW A;  1ORQ C;  1NTZ H;  4Q8F A;  1ZQX A;  4CF4 A;  4O4I A;  3D36 C;  5IE9 A;  4EZ6 A;  3QF7 A;  1N56 A;  3DV9 A;  4H33 A;  5DG8 A;  2BSK A;  1QSL A;  2EBO A;  4X66 B;  2YY6 A;  3Q4H A;  3NR7 A;  2KVS A;  1IBM B;  1Y74 B;  3OHA A;  4PPX A;  1Q82 W;  2HJD A;  4TUY B;  4C8N A;  5AM2 A;  1KBU A;  4NM1 A;  3C23 A;  5KFJ A;  9ICP A;  3F2D A;  3JAL B;  4JI4 B;  1BT8 A;  2CTQ A;  3ABU A;  5DG9 A;  1COO A;  2J6S A;  4X1I A;  4MW8 A;  1Y76 A;  3OGU A;  3RWR D;  3JAR B;  4LFA B;  4LVS A;  2DGZ A;  4B9U A;  1QLE B;  3CXC U;  3SV3 A;  4UV8 A;  2H3Z A;  4MVO A;  3B4S A;  3D8C A;  3EZ5 A;  9ICV A;  2E8N A;  3JPS A;  4DS4 A;  1ED1 A;  3TAQ A;  2ZIU B;  4X20 A;  2PKE A;  4IQU A;  4DL7 A;  3QO7 A;  2WB1 C;  4XDJ A;  4YY3 O;  2HHT A;  4F8R A;  3RJG A;  3ZRW A;  1B43 A;  2ZTD A;  4FS2 A;  3MGI A;  4QZC A;  2ZDI C;  4J7J A;  4MTX A;  3PR5 B;  1T4G A;  3PR4 A;  3AUO A;  4RQ3 A;  2F23 A;  3SJQ C;  3RYC B;  3LYS A;  2W04 A;  3HT3 A;  3K06 A;  4TT3 G;  5EC1 C;  3RFR A;  3RBE A;  1SRY A;  1ZQD A;  3W7S A;  4NTX A;  4PA3 A;  2R8I A;  2I6X A;  5BMV B;  3C2L A;  1KL9 A;  2FMQ A;  1D5N A;  3SPH A;  3MC1 A;  3DDH A;  3C29 A;  4YIP A;  4LF8 O;  3QE9 Y;  4IQV A;  9ICX A;  9ICO A;  1U49 A;  2XID A;  1MQ3 A;  1URJ A;  1YZ6 A;  2LMR A;  5LMN O;  1VQL V;  3FAV A;  2WAQ C;  2AHO B;  4DL4 A;  4MTO A;  3STL C;  1M57 C;  3THV A;  3CCU V;  1KB9 F;  4GX0 A;  5KG0 A;  3NUQ A;  4NY8 A;  3A0B U;  3CP8 A;  5A0L A;  1Z1B A;  7ICQ A;  1KDH A;  1S0V A;  4I2B A;  5KMG B;  1JCH A;  3QO8 A;  1VF7 A;  3CME V;  2EAO A;  3G6Y A;  2W55 A;  2BTQ B;  1K9M W;  4QNL A;  4J9R A;  1QNM A;  4BXO A;  2GO7 A;  3CEI A;  4O4L B;  1IXM A;  1AR1 B;  5L1K A;  3S3W A;  1L8D A;  3OMI B;  3NAS A;  3WK9 A;  2V9W A;  4RT2 A;  2KKW A;  4KLT A;  3HJE A;  4BWA A;  5JQG B;  4TV8 A;  2O6K A;  2ZT9 B;  5CR0 A;  3N97 B;  1LUV A;  2JVD A;  4BWM A;  3LNM B;  1U4B A;  1PNM A;  1VAR A;  1THZ A;  4EYH B;  3IV6 A;  3ZMZ A;  2E5L B;  3ALR A;  3RJI A;  4NXM O;  4KLI A;  3ZJZ A;  5J0X A;  4RQF A;  1BNO A;  4US8 A;  2QB0 A;  3AU2 A;  3NVW A;  1T8E A;  4G3I A;  3PVX A;  3X2Q B;  2ZIN A;  3GWO A;  4PL2 A;  2Q0Z X;  1ZD4 A;  2NRT A;  2ODG A;  4X88 A;  3SJC C;  1G6U A;  1TUE B;  1H2L A;  3RJJ A;  1ZQV A;  4P4O A;  1FFX B;  2DW4 A;  4GUN A;  1KKD A;  4TUQ A;  3DSQ A;  1N62 A;  3CRR A;  5EE0 A;  1PM9 A;  1OW5 A;  5JCO A;  5IIJ A;  4USA A;  5GTI Z;  3FFQ A;  1ZJM A;  3E8F A;  4JTD B;  4UB2 A;  5JJN B;  4JI8 O;  4JI5 B;  3K75 D;  2XTA A;  2M0N A;  1ZQT A;  2IM9 A;  3G67 A;  3H4D A;  1PK1 A;  4OD0 A;  3GU3 A;  3CC4 V;  5CHG A;  8ICM A;  2HVK C;  4PHZ A;  1KFT A;  1S76 D;  4DYL A;  4KL1 A;  1FFT B;  3B77 A;  5L1J A;  4Q6G A;  2WLL B;  2Q68 A;  2EH9 A;  3C5G A;  1IBK B;  1D8Y A;  5H5N A;  4IIJ B;  1EN4 A;  4TOI A;  4X20 B;  4FE3 A;  8ICS A;  3EVK A;  1B22 A;  2DQ0 A;  4BR6 A;  2F1I A;  4GZR B;  1NR1 A;  4X1Y A;  4ZIB A;  4QZA A;  4QW9 A;  4EB6 A;  3BPZ A;  5AM5 A;  4ECV A;  3E8H A;  3JD4 A;  4F2S A;  4U7N A;  4Z1V A;  4DUZ O;  1S8O A;  2N04 A;  4NLZ A;  5AM3 A;  4ED1 A;  2BCQ A;  4I2D A;  3A0H Z;  2A7W A;  2ZM6 O;  5TZV A;  1HUZ A;  4B9S A;  2Z7J A;  1VIB A;  3KKY A;  1LB2 B;  2HVJ C;  3JAR A;  1WB8 A;  1M56 C;  3N7R C;  2A06 H;  5IIM A;  4G2K A;  5FPO A;  2VWJ A;  7ICN A;  1ZD3 A;  3K0G A;  3A0H U;  1XRE A;  3JAK A;  5B1A C;  4WF9 V;  3BRC A;  3W7X A;  1JAL A;  3CCR V;  2BDU A;  1YSC A;  1K34 A;  1PVR A;  1HNW B;  2QLT A;  4C7Z A;  4LNU A;  1K3E A;  1ARO P;  4R8C A;  3K08 A;  3PML A;  3NRW A;  5LP6 A;  5FNV A;  2PTM A;  1VQP V;  5ALN A;  3JAK B;  1JJ2 U;  4B3S B;  1IVS A;  1ZQE A;  1QQ6 A;  3EPG A;  4FS1 A;  4DXW A;  4DV5 O;  1JA8 A;  4X1K B;  3H8W A;  4GT1 A;  4C0Z A;  5LGT A;  1QCK A;  5AKK A;  3CRA A;  2BTO A;  4IT5 A;  2FYU H;  1PV0 A;  4EFE A;  3SPC A;  1NK9 A;  2HHU A;  5FPR A;  2EZY A;  5CA3 A;  4X65 O;  2KEY A;  3GIM A;  2KSO A;  1Y4M A;  3K58 A;  4PEL A;  3PX0 A;  1W59 A;  3CSX A;  2N1R A;  3C28 A;  2BHN A;  5KFC A;  2QJ1 A;  3TAD C;  3DXR B;  2IJI A;  2M7W A;  1RSO B;  4CS3 A;  4TUY A;  4Y2U A;  5ALM A;  4DFJ A;  3S6J A;  4LC1 A;  3ZN1 A;  4PA6 A;  2WPD G;  4DSL A;  5EBL C;  5DG7 A;  5KG3 A;  2D3O W;  9ICF A;  4M9N A;  1KFS A;  1Z5W A;  4I2A A;  3NVZ A;  2QKS A;  4U3J A;  5AKG A;  4JV5 B;  3ZD9 A;  4LH6 A;  1EM1 A;  5AKI A;  2XAJ A;  2ASD A;  1SWV A;  4N23 A;  1ZQM A;  4WBN A;  2JEJ A;  5B3S C;  1FFX A;  1RM1 B;  8ICF A;  3UQ2 A;  4K4I A;  1KLN A;  4C8M A;  3HX0 A;  5ALG A;  1UA0 A;  4DV1 O;  4F71 A;  5B5E U;  2Y69 C;  2ZCE A;  2CGO A;  3UQ0 A;  2ZIV A;  4B6J A;  3RYI A;  1U45 A;  4KLM A;  4ICA A;  2HVI A;  4I9W A;  1MNG A;  1COK A;  4FJC C;  4LF5 O;  2OXO A;  4O3P A;  3M8S A;  4GX5 A;  4LWS A;  4UAY A;  5DLG A;  3ZI4 A;  4RUC A;  3ZDC A;  2KOB A;  1Y88 A;  2NYV A;  5KFG A;  1DK1 A;  3BAB A;  4LZG A;  1K73 W;  3HRD D;  1Y76 B;  3JD0 A;  3PO5 A;  1B06 A;  2DFL A;  4F4L A;  5ITZ A;  3A0B Z;  3BJY A;  4TV9 B;  4GFJ A;  2ZR2 A;  5KFK A;  2LHT A;  1KMI Z;  2YI8 A;  2H94 A;  4PI0 A;  2WLI B;  4NM2 A;  1R6K A;  1TVA A;  5J0W A;  2VA2 A;  1KQS U;  4K3A A;  4QZH A;  2V4D A;  2C22 A;  1HJP A;  1GMG A;  1WP8 A;  2ZIU A;  3OTO O;  4M9J A;  2Y69 B;  4ELT A;  2FKX A;  5CA0 B;  2YML A;  1HNX B;  1VQO V;  2HDO A;  5ALX A;  4JYB A;  2IH3 C;  1IBM O;  2W9A A;  3I28 A;  2DWE C;  1WNS A;  4QWA A;  2Y1J A;  2QWO B;  1D8L A;  3L71 H;  2RCV A;  1VQN V;  4P0Q A;  2QM8 A;  4I50 A;  2H5X A;  3F5W C;  5GON B;  2MRL A;  3ZMV A;  4BW5 A;  5C5J A;  1IXR A;  1ENV A;  1L0N H;  2YID A;  3EYZ A;  3PW5 A;  3JCZ A;  1RXV A;  4DFP A;  3ZRS A;  2JH1 A;  4QZG A;  5BMV A;  1I5X A;  1L8O A;  2FPM A;  3SV4 A;  2KHV A;  2WLJ A;  4J11 A;  2RRD A;  2ZTE A;  4DV5 B;  4I29 A;  1EBO A;  2KB1 A;  3PV8 A;  2YIA A;  3T3F A;  4IHJ A;  3OJU A;  1CXZ B;  1J95 A;  4QIW C;  4F5Q A;  3N2K B;  2E3C A;  3SYA A;  1NJX A;  1K5Q A;  4UCT A;  4UCU A;  1YTF B;  3HKC B;  3L72 H;  4WFF A;  4DL6 A;  5J0Y A;  1YXB A;  5KHH A;  5LMU B;  4CC6 A;  2LFS A;  1UT5 A;  5J0U A;  1ZX3 A;  4YJ3 A;  2D8C A;  4ZH4 A;  3H40 A;  3GFK B;  2LM4 A;  4OGQ B;  1VMG A;  1ZUQ A;  4M47 A;  3MHH C;  4Y2S A;  4B9M A;  4FLW A;  1SER A;  4FFD A;  4PGX A;  1P7B A;  3BS5 B;  1ZXI A;  1KQQ A;  4QE7 A;  4OJ6 A;  2WSS G;  2CRX A;  3LSU A;  4B3M B;  2JZB B;  4LR3 A;  3ASN C;  3ZBH A;  2MAX A;  3H4B A;  1ZQK A;  7ICU A;  1MN8 A;  3IRU A;  1ZQH A;  2H3I A;  2UUB B;  3VBB A;  1V54 C;  5H2F U;  2R70 A;  3CRM A;  2I9G A;  4IR1 A;  2YSU B;  5EIB D;  5LOV B;  2AGP A;  1CPY A;  1G8M A;  3D36 A;  1WJZ A;  2E75 B;  5D4B A;  3DC5 A;  4L87 A;  3WB0 A;  3K59 A;  3PSI A;  1D9F A;  5ALP A;  5J2J A;  2XIC A;  5AKZ A;  1N4C A;  4OX9 B;  4DR4 B;  3OMA B;  4DQS A;  2I1Q A;  5CBG A;  3AG2 B;  5CB4 A;  4YG2 A;  4F4K A;  4P4M A;  3CB2 A;  5E79 Z;  2CTW A;  5DED A;  2ZIW A;  4UAU A;  1ECW A;  4EEQ A;  3GZF A;  3OM3 B;  4LWS B;  4QJF B;  5J0S A;  1WPB A;  5BZB A;  1GAX A;  5KAF U;  4YD2 A;  2IH1 C;  7ICV A;  1L3S A;  4H13 B;  4Y2R A;  4ASU G;  3RAX A;  4EX7 A;  3RVY A;  4FLV A;  1K92 A;  5JCO C;  3RH6 A;  4DWI A;  3KHR A;  3H9V A;  4BIU A;  4WBN B;  1A76 A;  3LDA A;  3LVV A;  1KP3 A;  2XGP A;  3SR6 A;  3H1H H;  3TFS A;  2JGU A;  2ZXH A;  5D49 A;  3GV8 B;  5LP6 C;  4O4H B;  1SV0 C;  4DOC A;  2H3V A;  4PGQ A;  2EAP A;  1K33 A;  2ZJ5 A;  5LP6 B;  3H1J H;  3CCJ V;  2MK3 A;  2JEG A;  1I5Y A;  1PNK A;  2DPJ A;  2YMQ A;  1TV9 A;  4XDK A;  1FJG B;  2YEV B;  4O2B A;  4A8E A;  2A3Q A;  1P84 F;  4NJ8 A;  5IYZ A;  2LKY A;  3TQ1 A;  2PF4 E;  1RDF A;  2WFA A;  4EEY A;  4FLU A;  3JCU Z;  5AK6 A;  2F77 X;  5KL1 B;  1NH2 D;  1I7F A;  4FM1 A;  4IYI A;  2DKZ A;  3ICX A;  4QZI A;  3CRX A;  3T79 A;  1Q6U A;  1X9W A;  4DS5 A;  4F5P A;  2Y0S C;  3IC9 A;  5AG2 A;  1NS1 A;  2EZP A;  1Z00 A;  2BKE A;  1HWY A;  2WWW A;  4O2A A;  2P6R A;  4WFB V;  4YR3 A;  3SEI A;  2JHD A;  4I27 A;  4LH7 A;  4GX2 A;  4B08 A;  5AK3 A;  4RQ1 A;  3OSN A;  1DOQ A;  5BOM A;  2FLP A;  3WU2 U;  4C80 A;  2WF6 A;  3C1Y A;  3M9N B;  3K3W A;  1HEK A;  1L3T A;  4O4I B;  2YB1 A;  1WUD A;  1WA8 A;  1KEJ A;  2HP8 A;  1IBK O;  4QWD A;  2QKA A;  3T1H O;  3OGC C;  2KVC A; 
#chains in the Genus database with same CATH homology
 3F7Y C;  2EIJ C;  3E89 A;  1ZQ1 C;  5B1N A;  2X0L A;  2LBO A;  4J9Z B;  4J9Y B;  2JDI G;  1GM8 A;  3LDD A;  3OR6 C;  4O3M A;  2JEX A;  4PL1 A;  3AEI A;  4NV0 A;  3FYE B;  2K8C B;  2GOL A;  2X6B A;  2KHQ A;  4KMO B;  3GB7 C;  2VIX A;  3HB3 B;  1OCR B;  3MGV A;  4PA7 A;  3AQF A;  5L3F A;  5DM6 V;  2HR3 A;  2RP5 A;  4RQE A;  1K8A W;  2QTO A;  2K1E A;  5HR7 A;  3ZRV A;  5L3G A;  1R73 A;  3H0L B;  5L3B A;  2FTK A;  4NLC A;  1YIT V;  4WFH A;  4UV9 A;  1QCE A;  3D2Q A;  2XAS A;  4YXW G;  3SPI A;  4QIW F;  4HZ3 A;  2AHY A;  1SZH A;  1M1K W;  2AHZ A;  1ORQ C;  3ETE A;  2Y0S F;  3IGA C;  2A9H A;  2EIL B;  2ZD9 A;  2KD1 A;  2DYS C;  4X8A A;  5KA6 A;  4OJP A;  2ZIW B;  2OTJ V;  4H33 A;  4CRX A;  5LGN A;  5EK0 A;  3ZN0 A;  2EBO A;  2HKO A;  2Z5U A;  3W7T A;  3LSS A;  4XBF A;  2QEX V;  1R3K C;  1Q82 W;  2GH1 A;  2JJ2 G;  3H0M B;  1KBU A;  2EJR A;  3F2D A;  3A0R A;  3K03 A;  3ABU A;  4MW8 A;  1V55 B;  1P4R A;  1QLN A;  2ZIV B;  2DGZ A;  3E8B A;  1QLE B;  3CXC U;  2HBL A;  1A0P A;  2G09 A;  3OUF A;  1CEZ A;  3D2S A;  3ZMS A;  2JIZ G;  4UV8 A;  2H3Z A;  4AYB F;  4MVO A;  1GTO A;  3JD2 A;  4PDR A;  3ASO B;  1YJN V;  3WG7 C;  1ED1 A;  3W7U A;  3LUT B;  4CGZ A;  3ABM C;  2ZIU B;  3H0R B;  3ETG A;  1Q81 W;  1R3J C;  3QO7 A;  2WB1 C;  4XDJ A;  2X6C A;  2R9R B;  3ZRW A;  1EZJ A;  1FXV A;  2V1D A;  3JYC A;  4PA4 A;  2ZDI C;  4MTX A;  2VJ5 A;  1DRG A;  3I55 V;  4WFG A;  3SJQ C;  1GK9 A;  3LYS A;  1JX9 A;  2W04 A;  3O0F A;  1A6S A;  1BL8 A;  2B1G A;  3K06 A;  1SRY A;  2P7T C;  4TT3 G;  5EC1 C;  5L3C A;  3AG1 B;  3W7S A;  4KX3 A;  5CMU A;  3F5E A;  4PA3 A;  3CC7 V;  2D6F C;  2IJH A;  1JOY A;  1E1Q G;  2DQN B;  3DEE A;  3M6Z A;  4BJQ A;  1JVM A;  4DO2 A;  3SPH A;  4WFA V;  3ONN A;  3C29 A;  1HIW A;  3SAH A;  1H2G A;  1KP2 A;  1CP9 A;  2QM7 A;  4GCZ A;  1VQL V;  2XID A;  1URJ A;  2G07 A;  5B1B C;  1R3L C;  4P0P B;  3W7W A;  2WAQ C;  1B6Q A;  4MTO A;  3SYP A;  3STL C;  1M57 C;  2EIN B;  3CCU V;  2F76 X;  4GX0 A;  5CN0 A;  2K89 A;  3AL0 B;  2HOF A;  4Z1M G;  3NUQ A;  5A0L A;  3CP8 A;  1Z1B A;  1H8H G;  2B5U A;  3B8N A;  1S0V A;  2KIC A;  2A0L A;  1MA7 A;  1JCH A;  3CC2 V;  3QO8 A;  2UXN A;  3CME V;  2K4E A;  3ABT A;  5EBW C;  2DQ3 A;  1K9M W;  1GO3 F;  4QNL A;  2QA4 V;  2HG5 C;  4OJO A;  1YJW V;  1E79 G;  2HOI A;  3ASO C;  4MTG A;  1AR1 B;  1IXM A;  3QO5 A;  4MVS A;  3OMI B;  1MG1 A;  2X7R B;  4R7C A;  4MVU A;  4I5S A;  2OTL V;  3CCQ V;  5LHH A;  3AG4 C;  2W6J G;  4MSW C;  3OMN B;  1Q86 W;  4JAV A;  4UUJ C;  3G71 V;  1FXK A;  2XVT A;  5LHI A;  2UXX A;  1NR7 A;  3N7P D;  3LNM B;  3CD6 V;  2LFR A;  1PNM A;  4MVQ A;  2OCC B;  2KJ8 A;  1THZ A;  5IY5 C;  1BMF G;  3ZMZ A;  2ATK C;  3ALR A;  1W2B U;  4FPP A;  3ZJZ A;  2HLD G;  2JJ1 G;  4RQF A;  2Q6A A;  5J9P C;  2G06 A;  4ZBM A;  3X2Q B;  5HFM A;  3GWO A;  5H9C A;  4JYC A;  4PL2 A;  3FB6 C;  3FYI B;  1V54 B;  4X88 A;  1VQ7 V;  5CBH A;  3SYC A;  5KUK A;  1NZB A;  3K79 A;  1NH2 B;  2Q4T A;  1TUE B;  2NV3 A;  3NXS A;  2K8A A;  2HBM A;  1Z19 A;  5KL8 B;  2DW4 A;  4MW3 A;  5HR6 A;  1KKD A;  3IG8 A;  2W03 A;  2EIM B;  1GKF A;  3T4Z A;  1OUQ A;  1L6N A;  4QPK A;  3RW0 A;  2YX8 A;  3VOU A;  4QPJ A;  3E8F A;  4JTD B;  4RO2 A;  2P6J A;  4HAM A;  2M0N A;  5CRX A;  3SPJ A;  3DTU B;  2NNU A;  4FZM A;  4JMU A;  1OCR C;  3G4S V;  2R18 A;  3GU3 A;  3CC4 V;  1CRX A;  2HVK C;  4RUF A;  1S76 D;  4KFM A;  4Q20 A;  1FFT B;  1OCO C;  3AG3 B;  3B77 A;  3N7S C;  2DYS B;  2R9I A;  1QBZ A;  2EIL C;  2WLL B;  2Q68 A;  3OEH G;  3AG4 B;  3F53 A;  2OM6 A;  4OXS A;  4FE3 A;  2YB4 A;  2DQ0 A;  4KUM A;  3ZRX A;  2B1I A;  3EHB B;  1NR1 A;  4QNH B;  2EIM C;  5LHG A;  3E8H A;  3JD4 A;  4U7N A;  1AI7 A;  3K1Z A;  2VJ4 A;  4HYO A;  5EBM C;  1M9N A;  4JAS A;  3T4D A;  1VQM V;  2ZXW C;  3DGE A;  2OYY A;  2WLI A;  5L3D A;  4OJ5 A;  4CDG A;  2WLH A;  2Z7J A;  4NLB A;  1Q3V A;  5GW7 A;  2HVJ C;  1V55 C;  3VCB A;  1GM7 A;  1M56 C;  2EZO A;  3N7R C;  3CP1 A;  3IFX A;  4G2K A;  1BHA A;  1PVP A;  3E83 A;  2LYB A;  1VQ6 V;  5L3E A;  1QVG U;  3K0G A;  2W7P A;  2HBJ A;  2G5I B;  3FB5 C;  2Q69 A;  5T14 A;  5B1A C;  1H8E G;  3SYQ A;  1K5S A;  2BDU A;  1YSC A;  3W7X A;  3CCR V;  1K34 A;  3M99 B;  1PVR A;  5DN6 G;  5LGU A;  3SQI A;  1XO0 A;  1K3E A;  1ARO P;  4R8C A;  3CPW U;  3K08 A;  3OPX A;  3SMV A;  2EIK B;  3AG1 C;  3JD3 A;  4FK5 C;  3NRW A;  3LVW A;  3RVZ A;  3CCM V;  4UVC A;  2ZIX A;  3E2E A;  1DTO A;  1YT3 A;  1VQP V;  2P67 A;  1JJ2 U;  5B1O A;  5B3S B;  4DXW A;  1S3J A;  2XOK G;  2BOC C;  2K4I A;  1JPX A;  1K7D A;  4LCU C;  5IYC O;  2JEU A;  3BY6 A;  3F2C A;  4MVM A;  4GT1 A;  2OT5 A;  4C0Z A;  4P30 A;  2MA1 A;  5FL7 G;  5LGT A;  1WPX A;  1MSW D;  3T1C A;  4MT8 A;  1OZ0 A;  4XDL A;  1QR8 A;  3SPC A;  5CA3 A;  2JGA A;  2KEY A;  3E0F A;  1G4Y B;  1Y4M A;  2E5S A;  2Z3Y A;  4PEL A;  4PDL A;  1NKD A;  3CMA V;  3ZMT A;  1PKX A;  3MHS C;  1M56 B;  2XAQ A;  3HKZ F;  2N1R A;  3C28 A;  3M7D A;  3KFU F;  2EIN C;  3AG3 C;  4TSF G;  3RFA A;  2PMZ F;  1VQ9 V;  5E1A C;  2JK5 C;  2CPR A;  2ZQM A;  2IJI A;  2M7W A;  4RAI A;  4CBC A;  4LC1 A;  1QVF U;  3ZN1 A;  2EIJ B;  4PA6 A;  4PDM A;  2WPD G;  5H6R A;  5EBL C;  1D8B A;  1F51 A;  2D3O W;  1LNQ A;  2PI4 A;  1YHQ V;  5KA5 A;  1F23 A;  2BOB C;  4PDV A;  2QKS A;  2F8L A;  1OCZ C;  2JMG A;  3D3I A;  2XAJ A;  1ROP A;  4JTA B;  3F2B A;  4N23 A;  3OFN G;  4P2Z A;  4PA9 A;  5B3S C;  2IU0 A;  3L3F X;  4BIZ A;  1RM1 B;  1YJ9 V;  1BHB A;  2H3F A;  1RPR A;  1E1R G;  3BEH A;  2Y48 A;  4JPR A;  3VC8 A;  4OO1 J;  3HKZ C;  2XAH A;  3OEE G;  2EIK C;  1M57 B;  2Y69 C;  1VQK V;  2ZIV A;  3PJS K;  5IYB O;  1OCC C;  3IN5 A;  4ICA A;  3ZMU A;  1PL0 A;  4I9W A;  2HFE C;  4FJC C;  2OXO A;  4GX5 A;  3F5A A;  2ITD C;  3OW2 U;  3OUS A;  4TWK A;  2KOB A;  1FXK C;  1NQT A;  4LBE C;  1Y66 A;  4BX9 C;  1K73 W;  1QLE C;  3QNE A;  2KV2 A;  4AYB C;  1DF4 A;  3JD0 A;  3ABL C;  1KC8 W;  1KEC A;  4F4L A;  2IU3 A;  1RM1 C;  3F7V C;  1Q7Y W;  4GFJ A;  2ZR2 A;  1P7D A;  4RUE A;  3G6E V;  2LHT A;  2H94 A;  2WLI B;  1M90 W;  1R6K A;  1OCZ B;  1KQS U;  4U7C A;  4U7O A;  1DLB A;  1OCC B;  1UJW B;  4FZN A;  1GMG A;  1L1F A;  2ZIU A;  2Y69 B;  3SAG A;  1QR9 A;  3FKS G;  3WFV A;  3ABK B;  1N8R W;  1VQO V;  1R3I C;  1SET A;  3TET A;  3OR7 C;  4JYB A;  2IH3 C;  3FB7 C;  1W0J G;  2JH7 A;  3E8G A;  4JGS A;  2DWE C;  1K4D C;  1ZWI C;  3SAF A;  3MD0 A;  2W7O A;  1PNL A;  4P0P A;  2NLJ C;  3ETD A;  4QE9 A;  1F4M A;  1VQ5 V;  1VQN V;  4P0Q A;  2QM8 A;  3E35 A;  3F5W C;  3IC7 A;  3ZMV A;  2MRL A;  2XAF A;  5EC2 C;  1ENV A;  2G08 A;  2KNJ A;  1WLE A;  4BW5 A;  1AI5 A;  3LSQ A;  3JCZ A;  3ZRS A;  2JH1 A;  1I5X A;  2IJJ A;  4WFB V;  4KX5 A;  1W0K G;  2F43 G;  4MVR A;  2K4H A;  4R6Z A;  2KHV A;  2WLJ A;  2RRD A;  1AI4 A;  2ZIX B;  1GM9 A;  1EBO A;  3AG2 C;  2CK3 G;  2KB1 A;  3H01 A;  4H37 A;  4LP8 A;  5C93 A;  2GSM B;  2WLK A;  2ZXI A;  2KIW A;  1NBM G;  1J95 A;  4QIW C;  3LDC A;  2KKV A;  1XL6 A;  3SYA A;  1FXH A;  1K5Q A;  2ZXW B;  3JD1 A;  3UKM A;  1YTF B;  2W6I G;  4WFF A;  3UM7 A;  4U6P A;  1YIJ V;  3PSP A;  2LFS A;  2LP7 A;  2KJ9 A;  2ZG6 A;  2PI5 A;  3SYO A;  4NWI A;  1KD1 W;  3MHH C;  4JTC B;  1SER A;  5B1A B;  2Q67 A;  2ZR3 A;  1P7B A;  3CCL V;  4FMT A;  1JQ0 A;  4EKW A;  1Q3U A;  3B8M A;  3AQE A;  3I56 V;  4QE7 A;  4OJ6 A;  2WSS G;  2CRX A;  3TCU A;  2DYR C;  2F2A B;  3RBZ A;  1RPO A;  2VKQ A;  2A3V A;  1T94 A;  3ASN C;  4UVA A;  4BAY A;  4G28 B;  2WB1 F;  1NJI W;  4OJL A;  1F4N A;  3PST A;  1YI2 V;  2HBK A;  2H3I A;  2WAQ F;  3VBB A;  1V54 C;  1IIP A;  2IJK A;  5IDJ A;  1AJN A;  2YSU B;  4GX1 A;  4MTF A;  3CYM A;  3ABM B;  1G8M A;  1CPY A;  2XND G;  3D36 A;  2K8B B;  2GHY A;  3K0D A;  4L87 A;  4G27 B;  1AI6 A;  3PSI A;  1AJQ A;  5HFL A;  2ZDI A;  2XIC A;  4MS2 A;  4WF9 V;  3OMA B;  3K9A A;  5CBG A;  5H6Q A;  3AG2 B;  3SPG A;  2DYR B;  4JF3 A;  5B1B B;  3KG2 A;  2G0A A;  2W0F C;  2LYA A;  2ZIW A;  2XI9 A;  3ML0 A;  3X2Q C;  2HOQ A;  3EFF K;  5CBF A;  4MVZ A;  2QE7 G;  2OH2 A;  1ECW A;  1K97 A;  4JAU A;  3GZF A;  3OM3 B;  1PD3 A;  4P0Q B;  1K4C C;  3P32 A;  4R50 A;  3CCE V;  2G5H B;  4QJF B;  1R6N A;  5BZB A;  2DWD C;  1NVP B;  4X89 A;  1TAM A;  1H38 A;  2IH1 C;  3RF9 A;  2WLN A;  2WLM A;  3KZX A;  4P9O A;  4ASU G;  2CN1 A;  4ZKI A;  3RVY A;  3ASN B;  1K92 A;  1OCO B;  2V7Q G;  2H3Q A;  3R65 A;  2C2A A;  1AJP A;  4BIU A;  4FZL A;  3T2M A;  3LVV A;  1KP3 A;  1S72 V;  2WAM A;  5KUM A;  4ACO A;  2ZXH A;  1SZT A;  3CYO A;  3ZCC A;  3OE7 G;  1PVQ A;  3OAA G;  2A79 B;  4UVB A;  4FIP C;  2H3V A;  2HMX A;  3TK1 A;  3ZIA G;  5LBQ A;  1K33 A;  4WJ3 B;  1UPH A;  1F44 A;  3CCJ V;  1MOF A;  2MK3 A;  2E1E A;  1I5Y A;  3ZRW B;  1PNK A;  3LDE A;  1YTF D;  4XDK A;  2YEV B;  2P90 A;  4IC9 A;  3ABL B;  4A8E A;  3IP4 B;  3FB8 C;  2LKY A;  2E1F A;  4N21 A;  3IG5 A;  3M6K A;  3HPL C;  2KKP A;  3E86 A;  4CZZ A;  1OHH G;  1COW G;  4BUG A;  2KJ5 A;  2F77 X;  3PSF A;  5KL1 B;  1MAB G;  3P30 A;  1NH2 D;  2IW5 A;  4P9P A;  2PMZ C;  3ABK C;  1DF5 A;  1XL4 A;  3ICX A;  2H8P C;  3D2N A;  3CRX A;  3T79 A;  2Y0S C;  2OCC C;  1S5H C;  4WFE A;  2EZP A;  5IY5 B;  3CCV V;  1S77 D;  3PZP A;  2WWW A;  1HWY A;  4UXN A;  3WG7 B;  2WLL A;  3K04 A;  1EFR G;  2X6A A;  3STZ C;  4E2L A;  2JHD A;  2DF4 B;  2RHF A;  2HJF C;  4GX2 A;  4WCE V;  1NVP D;  4KP4 A;  2YEV A;  3K3W A;  1HEK A;  2YB1 A;  1SES A;  1FXK B;  2ITC C;  1WUD A;  1XNS A;  5IYD O;  1VQ4 V;  1VQ8 V;  3CCS V;  5C0Y A;  1FS0 G;  3OGC C;  2XAG A;  2KVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...